5D3GA

Structure of hiv-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer dna aptamer
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer DNA aptamer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
total genus 153
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5d3gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5d3gA05
5DQIA 2OPSA 4XPCA 1NK9A 2F96A 1S0OA 3PX4A 1XR7A 1HQEB 4LSNA 4BACA 3DLEB 1NOYA 2WONA 5C24B 1KFSA 3LAMA 1CZ9A 1VK0A 3D28A 5KG2A 3BQ1A 2QKBA 2IM0A 4RW4A 4YR0A 1NK7A 5C25B 1ASUA 5CYMB 2XWYA 3OSPA 4C8MA 2VA3A 3LPUA 4CK2A 1VRTB 4H4MA 3HVRA 2BQ3A 2ZQBA 4B9SA 3MEDB 1L3UA 3V9WA 3HVWA 1TL1A 4HHTA 2B5JB 2OPQA 2IM2A 4DSKA 1NOZA 3DRSB 4B3OB 1WSEA 2WOMB 3KKRA 3JSMB 4H54A 3OYJA 3WNFA 5HP1A 1BIUA 3H59A 4YP3A 1XR6A 3CFOA 1BGXT 1GOBA 4RNOA 4ECXA 4CHPA 4LD0A 3RRHA 3BSNA 3NHGA 3V9UA 1ASVA 1REVB 1FKPA 1W9HA 4AH9A 4CEAA 3G6YA 1TP7A 3OSNA 2HNZA 2B6AA 4TLRA 4J2BA 5DG9A 3KNAA 4K4TA 1R0AB 2I1RA 3M8PB 1RTJA 2UVWA 1UWBB 3P83D 3TQ1A 5HBMA 3EPGA 1TV6B 1RT5B 1S6PB 4EBCA 3KD5E 1LV5A 4B9LA 4KKOB 2AGOA 2XI2A 2R2TA 5KFSA 3IAYA 4FXDA 4Y2AA 3ITHB 3S9HA 2JEIA 1RTHB 2BRLA 4FJ9A 4TY8B 1ZBIA 3H40A 3CG7A 4HVJA 1ZTTA 2ILYA 3GIKA 2O4GA 4W5TA 1VSMA 2FVQA 2WK4A 5K14A 2BRKA 4FJHA 2OA8A 4DL7A 4YFUA 3HVTB 3AVHA 2HHSA 2WCXA 3EPIA 3FDSA 3ZSRA 3MEGB 2O5DA 2QKKA 3NF9A 5KT2A 4ECZA 4TN2A 5KG1A 4H4MB 4MK9A 3VQBA 1LAVA 1DTQA 2F8EX 4KREA 2E6LA 5DG7A 5KFPA 2X6NA 3E01A 4IQXA 4J2EA 4DFPA 3DDKA 3OHAA 1S6QB 1OS5A 4ED0A 3CM6A 1JLAB 3ICLA 1S1UA 2XI3A 2ZD1B 4RNHA 1RBUA 3QIPB 4HKQA 3OL6A 4KFBB 3AVMA 3RAXA 3GIMA 4Y1CA 1R0AA 3EYZA 4L8RB 3V6HA 3LP2B 2YNIA 1S1TB 1FK9A 2HNDA 1S1WA 2GUIA 3VQPA 2OPRA 3OHBA 2CJQA 3OL9A 4E7LA 1C6VA 3PX6A 1NK0A 1LWFA 3G10A 4M3TA 4DL6A 4CIFA 3SZ2A 1WSGA 3I8DA 1ITGA 2J6TA 2ATLA 4KHRA 4AHSA 1RILA 1KVCA 1RT1A 2DPIA 3OYGA 3ZT1A 2BR0A 1B9FA 3K2PA 4K4SA 2GV9A 1JL2A 3S3OA 4N5SA 4I2QA 1JLAA 3I0SB 1U09A 3KHGA 3ZSQA 3KOAA 4NCAA 4E0DA 3E01B 4DU1A 2FBXA 5C25A 1T03B 3IG1B 4K4VA 4FJKA 4NLQA 4CFCA 3NGIA 1MU2A 4ECVA 4K8ZA 3FSIA 2JEGA 3GV5B 1ZBUA 1BL3A 3VQAA 4KB0A 4IFYA 2DPJA 4NCGA 2JC0A 2IC3B 1RDRA 1C0UA 2E6MA 3TR8A 3JYTA 5HRPA 3PO4A 4GC7A 4ZP8A 4B08A 4LSNB 5KT5A 4DG1B 2RN2A 1RBVA 4M3XA 1X9MA 4FM1A 3IRXB 5KFZA 2FBYA 4C8NA 1SUQA 4RW4B 1RTIB 2F8TA 2IM1A 2WOMA 2HAIA 4RW7B 2FVCA 1NKEA 4ZVEA 1F21A 4TQRA 4ED6A 1U04A 5KFQA 1S0MA 2V9WA 3G86A 4WFZA 4W5NA 3HK2A 3AVFA 3RR7A 3MXIA 2YNFB 1X9WA 3ZSOA 1HYSB 4ZPDA 1JLGB 3QZ7A 4O3PA 3ZT3A 4DF8A 1VSFA 1GX6A 5J2NA 1FKOA 3SYZA 4DTSA 5HROA 1S9GA 4CESA 3VQDA 4CF9A 4GC6A 3VQCA 3T19A 5JS2A 4ZPAA 5DG8A 2IC3A 3TANA 4ZVFA 4DLGA 3TABA 1S0NA 4R8UA 3KMSA 4E7IA 3H08A 4F4KA 1TKZB 1MMLA 1RBRA 3DI6B 5C5JA 3BQ0A 1I39A 1I3AA 2X78A 4OPKA 3V1RA 3OYCA 3Q8RB 3SJJA 4JV0A 3QESA 5KRSA 5CZ2A 4CJTA 4FLUA 2PYJA 3G6VA 4CE9A 3RBDA 3I0RB 3EZUA 4O3SA 2HHUA 3MR5A 4CIGA 5L1LA 3V1QA 1EP4B 2OPSB 1IKWA 4NLYA 2BQUA 4OPJA 3V6DA 2C28A 3KLIA 2X6SA 4CGDA 4DSJA 3ZSZA 1L3SA 3M8QB 1SUQB 4J9LA 2FJXA 3CWJA 4Z4GA 3PR5B 1Q9XA 1HYVA 1JLCB 2XC9A 4O55A 2G8KA 1RTDA 1C1CB 2YNIB 1SH0A 3RMCA 3LP0A 2R8KA 4RW9B 1N6QB 4EP5A 4CCHA 1VRUA 3WNGA 4KRFA 3HL8A 1RBSA 3KMQA 5CY4A 3HSTB 3GV7B 4HTUA 4CJSA 2ETJA 2ASLA 3ZSVA 4MK7A 3PR4A 4QOZB 5L1IA 3KLHB 3IGVA 1T8EA 2W7PA 3KLFB 4ICLA 1S10A 3SQ0A 3TAMA 3U6FA 4CJWA 3LP2A 4FW2A 1XI1A 4Z4EA 4DQQA 1J5OA 1Z25A 4DQSA 4CGFA 4NCGB 4ID1A 3HPGA 1VSJA 1LW2B 4CGJA 3FQKA 1JLFA 4O4RA 4CJUA 1WLJA 3BREA 1HYZA 3V9XA 5EWEA 3V6DB 2FVSA 4W5OA 1NK6A 4FJJA 1KHWA 4TXSA 5KFCA 3C95A 2AX0A 5KFAA 5DGAA 1N6QA 4IR9A 3LALA 3TAGA 4W5RA 3K59A 2B5JA 2OPQB 4ZHRB 3KJVA 4YR3A 4PY5A 2HHTA 3M8QA 1JL1A 1Z26A 4FVMA 3AV9A 3UPFA 2JEFA 3HYFA 4RW9A 4IFVB 2IDOA 4E7HA 3VA0A 1O1WA 1U47A 4FBTA 3L2QA 2FC0A 4FJMA 4F4YA 4FM0A 3DLKB 1C0TA 2BDPA 3NKYA 4F4ZA 4ECQA 4CEOA 3N6LA 1RYRA 3DLGB 3K5MA 4NZ0A 4TY8A 4IG0B 4DTXA 4PUOB 2WB4A 4JUZA 1VSEA 5F9LA 4ZP9A 1UA1A 4IH7A 3PO5A 5KFGA 4DEZA 4FCYA 5HP1B 1VSLA 3BQ2A 1SKSA 3NMAA 5D3GB 3CJ2A 2R8HA 5DMRA 3PZPA 4CEEA 4CERA 2Z1JA 2RF2B 2J6SA 2HHWA 5KFBA 2R8GA 3OYAA 3OS1A 3LP3A 4DU4A 4Q8FA 3DOKA 5FRNA 2VG7A 3AVAA 3NF7A 1C1CA 5J1EA 3CFPA 5FDLB 4HUFA 2GIQA 2ATQA 1BHLA 1QTMA 4DTJA 1GOAA 4ID5A 5I3UB 3AA2A 3K5OA 1NJZA 4UQGA 1ZBLA 1XC9A 3CDUA 1TKTA 4J9RA 4RNMA 3OYBA 2VWJA 4M94A 4DQIA 4BDYA 1RT3A 4IG3A 3OVNA 3NGYA 4J9OA 2GC8A 4FLTA 4ED7A 1RTIA 4KTZA 5DQGA 1IH7A 1TQLA 3NBPA 4TQSA 1T3NA 2XCAA 4H8KA 2R2RA 5KFWA 5KT3A 2C22A 2EHGA 4QW9A 3NH0A 1J5OB 4K50A 5HRRA 4WFXA 1RA7A 3GYNA 3HJFA 2UVVA 4ECTA 4TY9A 4K8XA 2RDJA 5I42B 1BCOA 3DLHA 3LWLA 3L2VA 2KW4A 4EBDA 3KK1A 4O3RA 3SCXA 4WXOA 4FJGA 2HNYA 4PWDB 5F9NA 1VRUB 1SL1A 4M3UA 4AHUA 4I2QB 1QE1A 3H5XA 1YTUA 4Y34A 3V9ZA 2B4JA 4C8OA 5CYQB 2VG7B 3CDEA 4NLDA 2GIRA 5KFYA 1T7PA 2FLNA 4EO8A 2XY7A 1MU2B 3SV4A 3AO3A 1RBTA 2HW3A 5JXSA 4O44B 2IOCA 4KBIA 2IMWP 3GIIA 1X1PA 5KFRA 4I9QA 1KVAA 1WSFA 5SZTA 4F2SA 2OPRB 4XIUA 3VQQA 1JLFB 2E9ZA 1JXBA 4NYFA 4LH5A 4CK3A 1JIHA 5L9XA 1VRTA 2HVIA 3QZ8A 1W25A 4KHWA 4CF8A 2HHXA 4M3ZA 2YKNB 5FRMA 3A2FA 3KK2B 4KV8B 3NBPB 1EKEA 1XHZA 3ASMA 3ITHA 2DFFA 4NRTA 4HYKA 1HJRA 5F8JA 1WSIA 2C2EA 2P5GA 1RT4A 5FROA 2FBTA 3L2WA 2YKMB 3KTQA 3V4IB 3DOLA 2P1JA 1D5AA 4AHCA 5I3UA 2IAJB 2FJVA 1C0MA 4OLBA 3OYEA 2E9TA 1SH2A 3P1GA 4DS5A 1ASWA 4URGA 5L1KA 3LZJA 4FW1A 1IKXA 5SWMA 3MTKA 3OYIA 1IG9A 2P5OA 4DSLA 3RWUA 1NK4A 1LW2A 3BR9A 1HMVA 2QXFA 3BJYA 4OL8A 2UUTA 4ED2A 5F8LA 3S3MA 1TV6A 5F8HA 1S1VA 2KTQA 3M8PA 2LSNA 5CZ1A 4Q44A 3UDLA 3M9MB 3RB0A 1JKHB 1I6JA 4ELVA 4OLAA 4OKJA 4EYIB 1U49A 3FFIB 1SKWA 2GBZA 4KO0B 2XCPA 1KVBA 5DLGA 3BSAA 4CJQA 5I42A 1QUVA 3ZT0A 4E1MA 2C2DA 1JLEA 4RW7A 3QO9B 4CHQA 4OKEA 1CZBA 1SV5A 4IOBA 1J54A 1HPZB 2G8WA 1NHUA 4FLWA 4DSIA 3AVBA 1QSSA 1TKTB 1J53A 4DLEA 3CJ0A 1CXUA 3AVJA 3KLVA 3D45A 2Z1GA 1RA6A 4G1QB 1NHVA 3QEVA 3BGRB 1KSPA 3PHEA 2E9RX 2D3UA 4GVMA 3TAFA 2ASDA 1S9FA 4O3NA 4M45A 4Q0BB 3RMBA 4O0IA 4Z4FA 3MAQA 3T5LA 4ED1A 1RT6A 1JXEA 2ILZA 4KHMA 5J1EB 3ZT4A 1IM4A 3MECB 5J2QA 3HVAA 1CLQA 1LW0B 4CEDA 3OYFA 4CHOA 4FJNA 4R5PB 5KFOA 3C6UA 2HNYB 3GILA 3THVA 2BANA 2V4RA 4RUAA 4B8AB 4Z4IA 2WONB 4KSEB 4OGCA 3RB6A 1LAWA 1KLNA 3NAIA 4FJIA 1RT6B 4RW6B 1LWFB 3KLHA 4C8KA 5T14A 4O44A 4IH5A 3AVKA 3CFRA 1JLQB 4BE2A 1DLOB 2P51A 1TL1B 3NH2A 3ZSXA 3ZT2A 3MEEA 2HVHA 3QLHA 2D41A 3QNOA 4F4WA 1S6PA 1TAUA 3OYHA 4Q8EA 3LANA 5F8GA 2D0AA 3LDSA 1NKBA 4MH8A 1N56A 1BQMB 1VSHA 3SFUA 4X2BA 3PW7A 3QERA 4KO0A 5EWGA 5C42A 4E19A 3CO9A 4NLGA 4CJ5A 4ELUA 4HUGA 4PQUB 1UWBA 5KGWA 4F4XA 1JLGA 3NGDA 2FVRA 5KGXA 3T5HA 3DLRA 3O3GA 1D1UA 4NRUA 3H5UA 1D9FA 4F8RA 2W9CA 3AVIA 3CQ8A 3NGZA 3D0PA 1VSDA 1RT7B 1LWEA 4DTPA 1WNEA 3OYNA 1NK5A 2HHQA 2BE2A 1D0EA 3CDWA 4NLVA 4IG0A 3SNNA 1LWCB 1GOCA 2QE5A 3V81A 5C42B 4MK8A 2XGQA 3AVGA 4ZHRA 4CFAA 1EETA 3VQ8A 3QGGA 4QWCA 1VSKA 4WE1A 3DOLB 3FRZA 4CEBA 1BIZA 3TI0A 3C6TA 2OZSA 2HHVA 5J2MA 5J2PA 4CF0A 4DSEA 1ZETA 2IJNA 3OL7A 4JS4A 1BISA 2NUBA 1TK5A 3DLBA 1S1XB 3VQ5A 4AILC 4O4GB 2HB5A 4IR1A 4KV8A 3MR3A 4M42A 1QS4A 2WTFA 1KRPA 4KHYA 3OYMA 3M8RA 3F9KA 5KI6A 4E1NA 1L5UA 3RRGA 4KAIA 1S1UB 3N6NA 4FM2A 1S9GB 3IGNA 2XY6A 3VQ9A 3PW4A 3K5NA 2G8UA 4M3YA 4YR2A 4KKOA 4CFDA 1T94A 2W8LA 3MR2A 1S9EB 4MQ3A 4KTQA 4N56A 3QNNA 4Z4CA 5KFLA 1YVUA 4IH6A 4EZ6A 1RT2B 3SUPA 4CIEA 3P5JA 4Y2CA 3U3YA 2Z1IA 4ED3A 1HNVB 1KLMA 3RB4A 4M3RA 1WNSA 1NJYA 5K14B 4ZPCA 1UAXA 3T1AA 1JLBA 5KT7A 1TK8A 3Q8PB 3KHHA 4FJXA 1WSHA 3DM2A 4K4ZA 2OPPA 3V6JA 2FJWA 3IS9A 3LAKA 5KG6A 3AVNA 5DGBA 2BE2B 1S4FA 4DU3A 3DOKB 4DSFA 4CF1A 2FBVA 2V4QA 3L3VA 2Y1JA 3KK1B 3Q8QB 5KFHA 4G1QA 4ZVHA 3C6TB 4DS4A 4DFKA 2QK9A 3KK3B 4U6PA 5JS1A 4EYHB 4RU9A 4IRKA 3K57A 3DMJA 4PQUA 4MKBA 5F8MA 1HQUA 3KKSA 5KG0A 4K4YA 1HARA 4IDKA 1C1BB 4RW8B 1KTQA 4MFBB 3PVXA 3NCIA 1S1TA 3OS2A 4QWEA 4DL4A 1K1QA 4KI4A 3HP6A 1A5XA 5HBMB 2PYLA 3GV8B 4JV1A 4IBNA 1N4LA 4IFYB 4O5BA 3G0ZA 3MECA 5J2QB 1EXQA 2OZMA 3KLFA 4DG1A 4N76A 2IA6A 3PW2A 3QIOA 3M8SA 1IKVA 2W8KA 3EY1A 3B6PA 1J9AA 4NLXA 2EC0A 3QEWA 5KFVA 2DTUA 5KG4A 3RMAA 3TAEA 3RTVA 3FQLA 3DYAB 3MEGA 1RDDA 4XPEA 4BE0A 4LQ3A 4FK2A 3H4DA 4ELTA 4M95A 4O3OA 4Y1DA 2YHAA 4K4WA 3T3FA 2RDIA 1S9EA 4NLUA 3ZSYA 1HMVB 3MXJA 3LZIA 5JUMA 2XO7A 3CVKA 3OLBA 4FJ8A 3DYAA 1C1BA 4RW8A 3PV8A 4N41A 3TAQA 3GIJA 3VQ6A 4DF4A 3DLGA 2JLEA 3BGRA 4JS5A 4AHRA 3PY8A 4KFBA 4DFMA 4RW6A 2RKIB 3Q8SB 3HO1A 4RNNA 4CF2A 3MXMA 1LWCA 4CK1A 5FDLA 2VG5A 3KHRA 4CEQA 3GQCA 1S1WB 2IAJA 5EUHA 1RT7A 5KTQA 1SV5B 4NYZA 4O0JA 1TK0A 4KTWA 2RF2A 3O4NA 4NLWA 2RPIA 4ECRA 1Z4UA 4RZRA 3C6UB 1GX5A 1QQCA 3SI6A 1HYSA 1B9DA 3RAQA 4KHQA 3LP0B 1ZYQA 3V1OA 3VA3A 3E51A 4M3WA 1IKWB 4ZVGA 4FS2A 5J2NB 3OS0A 2KFZA 4I9LA 4MFBA 4MKAA 4I7FA 1ZBFA 3PX0A 4WE1B 4Z0UA 1ZBHA 4Q45A 1JLCA 1S1VB 4ZTFA 3V6KA 4QWAA 1DTTB 4FZYA 1RT3B 4IG3B 3PW5A 4FLYA 5E41A 3FFIA 1Q9YA 1REVA 1U45A 4OGEA 5HLFA 1LWEB 4EZ9A 2R8JA 3QINA 1KLMB 4CJVA 4RUCA 1K6YA 1L3TA 1C0UB 2G8IA 4OVLA 4CJ3A 3HHKA 2BANB 3ALYA 5DQHA 1TVRB 1IKVB 3I0RA 3NH1A 2ALZA 4CJFA 1FKOB 4E7KA 4KB7A 3QIDA 1U48A 3H5SA 1CSJA 3IG1A 4I2PA 2J6UA 3SPYA 3VQSA 1TGOA 2RKIA 3CM5A 3VQ4A 1TKZA 4CJKA 1HNVA 4HCBA 3BDPA 2HMIA 3PUFA 3JSMA 4DQRA 3SPZA 2EX3A 4FYDA 2CKWA 4MIBA 4WZMA 1T05A 3ULDA 3AO4A 2D7SA 1RT4B 2R7YA 3L8BA 3QEXA 3KK3A 3NAHA 1YT3A 4E7JA 4WYWA 4J9PA 3D5MA 4CJPA 1RDCA 2Y1IA 1DTQB 3L2RA 3OLAA 2I5JB 2IS3A 2D0CA 3M9NB 3OJSA 1IKYA 2O4IA 1S49A 1UOCA 4BWJA 4IFVA 5F8IA 4J9KA 2W7OA 2YKMA 5HRSA 1CXQA 3QLHB 4MIAA 3L3UA 3KJVB 1QSYA 2B43A 3CJ4A 2JEJA 5F8NA 4FLZA 3MFHA 4R0EA 4BE1A 5KG7A 2YKNA 1DLOA 3QIPA 4J9QA 3SUNA 3DM2B 3IRXA 2YNHB 4B9TA 4FZZA 3OY9A 5HLFB 3MEEB 2G8FA 1HNIA 4K4XA 3CIZA 3AO2A 2G8VA 1EX4A 2R2SA 3TVKA 3NDKA 1FK9B 3SFGA 5C24A 1RYSA 4KHSA 4CGIA 3HXMA 3MR6A 2HWHA 3QGIA 4LSLB 3VQEA 3DRRA 2YHBA 2ZE2B 3SQ1A 4ECYA 2AU0A 2I5JA 1RT1B 1TKDA 4WXWA 5KFUA 1JXLA 2PY5A 1XWLA 3DRSA 4F50A 4O4GA 1HNIB 1IO2A 4G3IA 5KG3A 3TAPA 3SUOA 3HKWA 2R2UA 4TSXA 1QE1B 4ID5B 4B3OA 3KLEA 4DTOA 5KFFA 3IS9B 1HRHA 1BCMA 5KFIA 3TARA 2AWZA 1NKCA 4IKAA 3OYDA 4C8LA 1WN7A 2BQRA 4EBEA 4DMNA 2KQ2A 1QSLA 5T7BA 4CGHA 3T5JA 2DFHA 1SKRA 4RG8A 1EETB 3ISNC 3HP9A 1A5VA 2G8HA 4HUEA 4EO6A 1BI4B 2A1SA 1N5YB 3DMJB 4FBUA 3UQSA 1RTJB 2OPPB 1YTAA 3NFAA 3B6OA 3KLGB 1B92A 3RBEA 1W0HA 1JLBB 5HRNA 1WSJA 2FLPA 3DRRB 4I7FB 4CJLA 1BI4A 4RNFA 3QYYA 2W9BA 2DFEA 2XRIA 3AA5X 3HT3A 3QGHA 3ZSWA 3AA4A 4GMJB 4W5QA 3PJWA 4IDKB 4FLVA 4OKKA 3SV3A 4IRCA 4OJRA 2UUWA 1WAFA 2F8SA 3H4BA 1HQUB 4H4OA 4QWDA 3NE6A 3SQ2A 4AHVA 2JC1A 2VWKA 4EP4A 5KFMA 5KT4A 2KFNA 3LP1B 2YNFA 2FLLA 2VG6A 3U3GA 5KFTA 4FK4A 4F3TA 4NCBA 4CJRA 4DQPA 4QW8A 3HPHA 4CEFA 4CFBA 4ZTJA 5KFNA 2OH2A 3NF6A 5HROB 3L2UA 4TYBA 1TAQA 4LSLA 1QAIA 1BQNB 1RDBA 4E3SA 2OYQA 2UVUA 4B9NA 3TAMB 2X74A 4CECA 1KFDA 3LPTA 4N47A 3BSCA 4PWDA 5KFXA 3O3HA 2A1RA 1C0TB 3SI8A 3HPOA 3NL0A 1KCFA 1A5WA 3RMDA 1TKXB 1NNDA 3MFIA 3KLGA 1S48A 1T05B 1HQEA 1X9SA 4ECWA 4TYAA 5EDWA 4YNQA 3PJXA 2YNGB 3F73A 5D3GA 5CYMA 3V4IA 2R8IA 5DLFA 4I2PB 5J2MB 4BWMA 4WFYA 3V81B 1C1AA 3NAEA 4PA1A 1TL3A 1TKXA 3G6XA 4Z4HA 1S6QA 3VQ7A 4JRPA 4QWBA 1IKXB 1N48A 3OYLA 1XHXA 3LP1A 4HCCA 1N5YA 1Q8IA 4KAZA 4Q43A 3I0SA 1JX4A 1IKYB 3KIOA 4J9MA 5DK5A 4J9SA 2E4LA 5KT6A 2HNZB 5KRTA 2WHOA 4NLPA 4J2AA 4URQU 4KE5A 1RTDB 1RDAA 4QAGA 1S5JA 1JKHA 3KLIB 4NLTA 2VG6B 2D0BA 2Z1HA 2W42A 2V0NA 2AJQA 2QV6A 4LH4A 1NK8A 1VSIA 2AGQA 4DTNA 4M41A 4GW6A 4JLHA 3BSOA 2BGGA 1RNHA 5L1JA 3UR0A 4WYLA 3H5YA 2ZD1A 4FJ7A 1RAJA 5EU7A 4R5PA 4CHYA 1NJWA 4Y3CA 4KHNA 2D3ZA 4WZQA 4B9MA 3SUQA 4DTUA 1SL2A 1YVFA 4CJ4A 3ZCMA 4E89A 4ZMMA 2IBKA 1RCHA 5KFKA 5KFJA 4ZPBA 4JRQA 5EWFA 4CEZA 3V9SA 1TVRA 4B9UA 4LQ9A 4NLRA 4QCLA 4CGGA 3DRPB 3OYKA 3I5AA 2FVPA 3SQ4A 4KPYA 3HVTA 3UIQA 3JYTB 1FKPB 3AO5A 2UVRA 3QETA 4KB1A 4YMEA 1TL3B 1WAJA 3QEPA 4FLXA 3KLEB 4KI6A 4F2RA 4U7CA 4CJEA 1BQNA 2AQ4A 3QO9A 2HWIA 4BDZA 2C2RA 1C2PA 3M9OB 4FK0A 3RR8A 2YV0X 2KZZA 4Q5VA 2D5RA 4ZP6A 2PZSA 1ZTWA 4O3QA 2ZE2A 4CHNA 3LWMA 4IKFA 4F3OA 4H4OB 1QHTA 2XY8A 2WRMA 4R8UB 3H2LA 4CHZA 1UA0A 4NYNA 4AHTA 4XO0A 4Q0BA 2Q3SA 3DI6A 3KD1E 4NLSA 4K4UA 4ECSA 3TWHA 3DRPA 3WNEA 2W9CB 4DWIA 2W9AA 3CJ3A 3N6MA 3C94A 3O3FA 1U4BA 1FXXA 1D8YA 2KZMA 4DL5A 1XR5A 3O4QA 2IJFA 4FS1A 3H98A 1D9DA 2W9BB 3KK2A 2XY5A 3PW0A 3I5BA 2ASJA 2AX1A 2XGPA 3DLEA 2AGPA 3RB3A 4ECUA 3I5CA 1NJXA 2DY4A 5KG5A 3S3NA 2ZKUA 2VA2A 3DLKA 5KFEA 3IN5A 3K5LA 4BDPA 3AVCA 4IRDA 3EZ5A 1S1XA 1QAJA 4EEYA 5KFDA 3VN5A 2XHBA 4FJ5A 1G15A 3ISND 4PUOA 4KHUA 3KHLA 3CYMA 4B8CA 3MEDA 2IGIA 4B9VA 4NLOA 2JGUA 3CJ5A 1Y97A 4URSA 2HMIB 2ITGA 3OJUA 3AVLA 1SH3A 1L3VA 2HNDB 2IM3A 4J2DA 2VG5B 4ICLB 5J2PB 3HM9A 4ZP7A 3NF8A 1KHVA 1RTHA 1BQMA 3WNHA 4DL3A 4J9NA 4FJLA 2YNGA 1K1SA 1EP4A 4DFJA 4DL2A 4LY7A 4YQWA 4ED8A 1T03A 1JLQA 3MF5A 4JV2A 1JLEB 3OL8A 1LW0A 1S97A 4FZXC 3T5KA 3K58A 4DTRA 2B6AB 3AO1A 1SL0A 1RT5A 5CYQA 1HPZA 3QEIA 4QPXA 4DTMA 1RT2A 2YNHA 1DTTA 3AA3A
chains in the Genus database with same CATH superfamily
2QFIA 4AYBD 3MPVA 4JI4F 2OTJS 3RBXA 3FVYA 2C3OA 3PX4A 5BN9A 4B02A 3DLEB 2PEBA 3LAMA 2JLGA 1Q82O 1K9MT 3MPWA 2QKBA 1NGIA 1NK7A 1ASUA 2DJWA 5HL7Q 3LPUA 1VRTB 2BQ3A 4ETXA 3A5LC 3C2PA 3HVWA 2ZOFA 2B0GA 1RHQB 5IC6B 4DSKA 1NOZA 2K8GA 3UN5A 2WOMB 1VQ4N 2FB0A 5AR0A 2LMIA 3MN6A 2LA4A 3H59A 3PTWA 1HR0K 1GNKA 4ECXA 3RRHA 3A0IX 3V9UA 1ASVA 3TSPA 1D3WA 4JB8B 4AH9A 1FCAA 3OUYA 3OSNA 5AQSA 1E4FT 4X4NA 2M8HA 4ZLPA 1SJFA 4X65K 4DV4J 5DG9A 1R0AB 2I1RA 1FESA 3M8PB 2CZ4A 3PM9A 5IV4A 4WFBQ 1UWBB 2QFJA 1RCOB 3TQ1A 1TV6B 1RT5B 2CPXA 3ID6A 1LV5A 1PIEA 2J5AA 2AGOA 3CC2S 5KFSA 2R2TA 2MKCA 3IAYA 2Q3PA 4JEPA 1AA1B 2P9UA 3HLUA 3ZTQA 4HHHA 4GNIA 1LFPA 4GKKJ 3CG7A 4HVJA 2QLXA 3GIKA 2O4GA 1M5KC 1VSMA 2AJFE 2A18A 3UB5A 3EPIA 3J7Z5 1KD1T 2QKKA 5KT2A 7AT1B 4TN2A 2OANA 3NGKA 2CPDA 4BRFA 1J2VA 4K7QA 4JKAA 4KREA 4J2EA 3FKBA 2QO3A 1YGYA 3CM6A 3GLJA 2CZVC 5LSLA 4CT9A 2PA8D 1HBUB 1AW0A 2RQCA 1S12A 1UEUA 1F2GA 2CPFA 3QIPB 4FWQA 1BUXA 2ROGA 4KFBB 2XS7A 4L76A 1B7YB 1VI7A 2YNIA 4YN3B 1S1TB 2R7SA 1WELA 3I33A 2B7BB 1S1WA 3MDFA 3OHBA 3N4WA 1YLXA 2DNLA 2CJQA 4OZ5A 4B1VA 1C6VA 3CC2N 2GO8A 1XMQF 4DL6A 2DO0A 3R7SB 4CIFA 2V52B 1WSGA 2H3GX 2W41A 2J6TA 4AHSA 1KVCA 2BZ2A 2DPIA 3AQOA 3ZT1A 1B9FA 1N34J 1JL2A 3S3OA 3FZHA 1FJCA 4M7YA 1U09A 2FJDB 4NCAA 1N33K 3CHWA 4LRCA 4FJKA 4NLQA 1Z2LA 4M63A 2ZJQQ 5J1PA 3PRVA 1IR2A 4K8ZA 4V1Ak 2JEGA 2R4FA 3GV5B 4NB4A 4USMA 1ZBUA 4RWWA 3VQAA 3VTIA 2OTLS 2F5GA 2JC0A 2IC3B 1FNMA 1RDRA 2E6MA 4WQ4A 1DQ8A 3SAHA 3JYTA 4IO9Q 5E0OA 2BM1A 2O8CB 3CJKA 4QJVA 4CZEA 2DPNA 3I55S 2RN2A 3AGKA 2P9SA 1N88A 1YJ9S 3IRXB 1T9XA 1RWMB 1RTIB 2F8MA 3KKFA 3RW6A 2M5YA 4XTTA 3W62A 1ZAWA 2FVCA 1NKEA 2BJ9A 3J7AN 2CDQA 1F21A 3M2UB 4DV4F 2Q0UA 2V9WA 4OI4A 1GAOA 5IXUA 3RR7A 3ZSOA 1HYSB 4WF9Q 1Y00A 5B0FA 3WQPA 3ZT3A 2L9WA 1IQTA 3OUYB 5J2NA 2YKAA 2KM8B 1SKUB 3DJCA 1S9GA 4CF9A 3VQCA 3T19A 4CO0A 2VC1A 3QB0A 2BBEA 3TANA 4BGAA 1G7CB 2ZBQA 4R8UA 3D0GE 3KMSA 4E7IA 4DR5J 3IR5B 4F4KA 5ELZA 1RBRA 4NX9A 5HJYA 3U1LA 4A8MP 2NREA 4H0PA 1I39A 1J5EJ 4YOYA 3G82B 4OPKA 2GHWA 3CNQP 1YBTA 1U6FA 2HGNA 4JV0A 3QESA 5CZ2A 1XN9A 4FLUA 2PYJA 2RT3A 3RBDA 1NSKL 3EKUA 2HHUA 1P1LA 4DPUA 1NGJA 2HIYA 1IKWA 2BQUA 1R8HA 3V6DA 3H1QA 2X6SA 1FRMA 1EX8A 3Q0AA 2K3KA 2WBMA 2FHOB 1SUQB 3BGLA 3OV7A 5J1NA 1N52B 3E9LA 3QT5A 4Z4GA 1Q9XA 2MQOA 3TZYA 5BYSA 2G8KA 3VETA 1H6KX 2FPHX 1RWUA 3LGMA 2PT0A 3OFHA 4KY3A 2W6LA 1HHSA 4RW9B 4UTGA 4EP5A 1VRUA 3DDNA 4ILLA 2LA6A 3GTYX 3S7RA 2P9LB 3C16B 4HTUA 4CJSA 3A3OB 2YCHA 2OAUA 1VAZA 5L1IA 3KLHB 3IGVA 3UD4P 2W7PA 4JP8A 1OPIA 3U6FA 1FNOA 4DQQA 2YHWA 5IM0A 3Q89A 1J5OA 4CJ7A 5T7LA 2O8FA 4YOVA 3EE9A 4ID1A 3MUMP 2GWKA 3TA1A 2YJFA 4RR5A 4OHXA 2UV8G 5GAHI 2P9IB 4O4RA 1CJKB 3CD6S 3CDAA 4LVOP 3BREA 1HYZA 1WLJA 1K8KB 1Z6RA 3F56A 2F9TA 2MZ1A 2HS0A 5LJ3Y 2E66A 2AX0A 1N6QA 4DR7K 4DPOA 4W5RA 4PY5A 3GE1A 4PPZA 2F8HA 3OT9A 2ZBCA 2XMWA 2IDOA 4YB1P 3GR1A 3VA0A 4F3MA 1NM1A 2QT7A 3L2QA 1GEHA 2NRHA 1WBBA 4FJMA 2Z4PA 2CH6A 1C0TA 2QIFA 3NKYA 4F4ZA 2ZVIA 4ECQA 4C8YA 1TL5A 4WYBA 2HQ3A 4OZJA 2MY7A 4IG0B 4WBFA 4LBIA 4PUOB 4ZVUB 4ILGB 4JUZA 4IH7A 4JOUA 3SCJE 2FSNA 1K0TA 3PO5A 3K9JA 3HHLD 5HP1B 4M5MA 1VSLA 4X62K 2FGCA 4P9SA 1FFWB 4E8UA 3CJ2A 4DV5J 2E88A 2O8EA 2R8HA 2R8GA 1B3TA 2D4WA 3LP3A 1VDHA 2CQ2A 1CULB 2B7CB 4WFNL 2VQEK 4BRKA 4K0KJ 2W4PA 3CFPA 3DXMB 1FKAF 2BE9B 5K8OA 3O80A 4RLEA 2IDEA 2GIQA 5LJWA 4OYAA 2B51A 2QLFB 3KUGA 3CC4N 3HOTA 2X3DA 1ZBLA 2NUHA 3OR2A 2FJBB 5GVQA 2DHXA 3KUHA 2R7UA 1TUYA 2DHGA 1F9HA 5ETRA 3VAJA 2GC8A 4ED7A 1RTIA 3R1LA 1TQLA 3NBPA 5F3ZA 5KFWA 4H8KA 2XMKA 4G6VB 1UJ4A 2G2YA 2QL7B 2UVVA 4ECTA 4F67A 5HVGA 5I42B 2IA0A 3LWLA 4LC9B 3NNCA 2NUUG 5CR4A 2G4BA 2DH8A 4MLEA 4NMXA 2V68A 1NMNA 1SL1A 3W1YC 4TNOA 2XBPA 2E5IA 4HLBA 2B4JA 5A8WA 2EWSA 2VG7B 3FNNA 3U7JA 2GIRA 2DIUA 3EZWA 2FLNA 1W2BM 4CNZA 4EO8A 3R5AA 2RU9A 2BYCA 1NDPA 1NLKL 3VEZA 4KBIA 4CWBA 2HFUA 3GIIA 4Y65A 5FPDA 4KGZB 1X1PA 5KFRA 5SZTA 4HI2A 1RU1A 5K5MA 5AZIA 2EG1A 4CO3A 1N8RT 4PXCA 4EFAC 4JKHA 3DN9A 1JIHA 4CBUA 1TELA 1OSDA 4I64A 3LM2A 3C16A 2AA4A 1QDUB 4FVCA 2BACA 2HHXA 1VQMN 2YKNB 1WHXA 4DV5F 2L48A 2LQ5A 2KDOA 3ENQA 3ASMA 3O6WA 1FF2A 2DNMA 3IDHA 5GAGP 1FJGJ 3KTQA 3C8YA 3DOLA 5EVZA 1VQ8N 1Y3KA 4QQBA 2IAJB 3I8BA 2NYHA 5ETSA 4PYDA 3W0LA 3OYEA 2E9TA 1SH2A 3GFYA 3AJDA 3VF0B 4YB5A 4KH0B 3MOZA 3LZJA 3TA2A 5L46A 4OX9F 2XSFA 3SJHA 1SJ3P 2WVBA 2YTCA 3IR7B 5CD4H 4ED2A 3I4HX 1TV6A 3M6XA 3B54A 1S1VA 1XMOF 3LA0A 3CCQS 1BG3A 4EAHD 4C1NI 1ZXOA 1SIWB 4OLAA 1U49A 3FFIB 4QYZK 4KO0B 1KVBA 3GSIA 4K43A 2GQQA 4PEOA 3ZX2A 4E1MA 3QNWB 3L7UA 4RW7A 3J7YI 1G1XA 4UY85 4CLZA 4MTPA 4WTYA 3AA8A 4LF5K 2G8WA 4DSIA 4F26A 1QSSA 1QAYA 4GKJJ 3TUZC 1CXUA 3AVJA 3KLVA 1XC3A 4JK9A 3BGRB 3W65A 5LL6Z 1KSPA 1LCUA 2D3UA 3P4UB 3T9NA 1HNXK 3TAFA 1NRKA 1NXIA 1T02A 4V19X 4LF8F 4O3NA 4ATNA 4Z4FA 4A62A 2DNGA 2VFRA 4ED1A 3PJ9A 1S77D 2MJNA 3ZT4A 2DT9A 4GV6A 4CEDA 4CHOA 4R5PB 4P7TA 3MDQA 2VDIA 1SS6A 4LF9K 1HBMA 3CCWA 3GILA 3THVA 4Z4IA 3CJSA 3NGTA 4KSEB 1N0UA 2CPEA 3RB6A 1M5OC 1IJFB 3KK7A 4RUHA 1YITS 1RT6B 1VQOS 1Q86T 1YVNA 1UEKA 2OGUA 4D3GA 3AD9C 2C3PA 3NS7B 4PXBA 4F36A 5HMXA 1OQ6A 4DV0J 5HK4A 4BE2A 1DLOB 2P51A 1CQMA 1OY8A 5AQHA 3GWCA 1WJ9A 3VGVA 1IWGA 4QBUA 3GYGA 2FUG9 1NDLA 3ZX3A 3TWZA 3EVWA 3SCLE 1R31A 1S6PA 5D0EA 2ZUGA 1XNQF 1NNEA 3LDSA 2D0AA 1NO8A 4U8YA 1SAZA 3I56S 3SFUA 3BGFA 3PW7A 3QERA 5C42A 4NLGA 4CJ5A 4ELUA 1HNZF 2CPHA 4HUGA 1F5CA 4ZJOA 1TU0B 3SCIE 8RUCA 1JLGA 2FVRA 3NGDA 2MSSA 1HWJA 1MN9A 3O3GA 1VJQA 2W9CA 3AVIA 1V5IB 1VSDA 4AQYK 2HQIA 4M8LA 3AD7C 4DTPA 4AM7A 5E84A 2HBZB 2KG1A 4JN4A 3MCMA 1YI2N 4NLVA 4CO4A 4IG0A 1JNZB 1LWCB 1ZS6A 5C42B 4CT8A 4IO1A 2X1AA 1HW8A 2CXEA 3AVGA 3H6EA 2QA4S 1YITN 4DHYA 4Y0WA 1VQNN 4A8WA 3C6TA 1UW4A 2HHVA 4JI1K 3QBCA 2IJNA 1KDNA 2UXDK 4IR1A 5GMEA 4ZPVR 4M42A 2WTFA 1KRPA 4KHYA 3HFZB 3TX8A 1RDUA 3IGNA 3VQ9A 2E7VA 4M3YA 2B56A 1EWQA 4LF6K 4KKOA 4CFDA 1IQZA 2JWKA 4B1ZA 2W8LA 1YVUA 4EZ6A 1RT2B 1AUSL 3SUPA 4B1XB 1RAEB 3P5JA 4Y2CA 1HNVB 1KLMA 1KEKA 4M3RA 1PAUB 5K14B 1HFEL 4UQTA 2DGSA 4DV0F 4Y2KA 2L9DA 5AQKA 1UMJA 3HDSA 5KT7A 3VMFB 2HBJA 3Q8PB 2J8SA 4B3SJ 1U8WA 2QSWA 2RS2A 1BDGA 3WEEB 2IPOB 1CG2A 5KG6A 5GIOA 2BE2B 2RRBA 1S4FA 3DOKB 2V4QA 3KG1A 5KFHA 4BCAA 3MOJB 3CB4A 3KK3B 3VAKA 4EYHB 4IRKA 3K57A 3DMJA 4PQUA 4PABA 4MKBA 2RSQA 3EN9A 5F0XA 3I4PA 1IG8A 2DYAA 1UETA 3M1FA 4NZ6A 1K1QA 4IJNA 1FVQA 4M5KA 5HBMB 2C2KB 2V7YA 2PYLA 5F2RA 1N4LA 1AFJA 4DPYA 3W8GA 3MECA 1EXQA 1Q18A 2MB0B 2RHQB 4N7TA 3PW2A 2EEYA 2F40A 4JI6F 2Q97A 4BRQA 3EY1A 4NLXA 3MK6A 2Q66A 2ZOMA 5GAEP 2DTUA 2NRTA 2XTJP 3RMAA 2P9PA 1S6OA 2DNQA 4FWOA 4FK2A 2C42A 1ELOA 2YHAA 1GH8A 2FSKA 3T3FA 2RDIA 5HMYA 1X3MA 1FXRA 3H90A 2NRZA 3DOMA 5E26A 2VQFK 4BR5A 4N41A 4ES2A 3NWGA 2F9WA 3VQ6A 1ITPA 2JLEA 1GLJO 3DAWA 2NRRA 5AQJA 4AHRA 3VALA 4DFMA 3C0BA 1RTZA 1X31C 4NXNK 3QMLA 2HFSA 3W2WB 4Y00A 4CEQA 4K5SA 5EUHA 3B4MA 2CG8A 4LSZB 1IXKA 5B0EA 4EUVA 2E1RA 3SQOP 5KTQA 1SV5B 1TK0A 4RZRA 4MKVA 4KHQA 1CULA 2BJ1A 5D4LA 4GKKK 3SSQA 3FE1A 2KN4A 4ZVGA 3OS0A 5L38A 3CF5L 1NGFA 2HF3A 3IRWP 1ZBFA 4CTAB 3SXLA 1RBLA 3UCZP 5HN0A 3DDIA 8AT1B 1RADB 1N32K 5C7PA 2CGJA 3CXCR 1CS4B 4FLYA 2QRRA 3IAM9 1MG7A 3HM8A 4LIWA 4B3SF 2KKHA 2HWTA 1U45A 2R8JA 4CJVA 1KC8O 3OW2R 2G8IA 3LDNA 4CJ3A 4RCHA 2IMOA 3W64A 3HHKA 2BANB 4PWWA 2N4CA 4FSVA 1IKVB 2ALZA 4U67L 3TTCA 3RAMA 2DRDA 1FKOB 2KVQE 2XNQA 3EO3A 2BH1A 4P74A 2RVJA 2Y0BB 4I2PA 5AQVA 3S01A 3VQSA 1TGOA 3VQ4A 4IZ9A 1TKZA 5SUHA 2IRXA 1HNVA 2VQFJ 4CM2A 3BDPA 1HD1A 3VGMA 1GMVA 4EU0A 4DQRA 4P2MA 7FD1A 3I55N 2CKWA 5AQGA 1T05A 3AO4A 2O8FB 1K8KA 5GAGI 3CI5A 3L8BA 2V5HG 4JKGB 1EQ0A 1RXOB 2LP4A 4A5BA 3TSUA 2Y1IA 3L2RA 3M30A 4FWSA 5K8PA 1MWKA 3A8IA 4UZCA 1NB7A 2O4IA 1CJTA 3G71N 3MURP 1TMMA 2IYGA 5HRSA 1VQKS 3HZGA 2O8BA 3CJ4A 4YHHF 1FXDA 1VK3A 4JI7F 1DLOA 3W2VB 3QIPA 1ZC6A 3DM2B 5DDQC 2KLAA 4CO2A 1R43A 3BEGB 4BLGA 2LKZA 4ZIWA 3IKMA 2OCEA 4FZZA 1UJ6A 1VFJA 3VPZA 1HNIA 2CJXB 2G8VA 1EX4A 2R9LA 1TMJA 1FK9B 3SFGA 5DDPC 3AHPA 1RYSA 1S57A 3PACA 1T6DA 3HXMA 2ASOA 1KOOA 2CVEA 3EXCX 2KT2A 2YVSA 3WXKA 2POKA 1RBOB 5DZ6A 1HNZJ 2AU0A 3MMBB 1TKDA 4DR1J 1SJRA 4ERDA 4K2JA 1HNIB 2DY1A 5DRKA 4G3IA 3TAPA 1M1GA 2M8DB 5IT9O 1QE1B 3UE5A 3FR0A 3HHNB 5CYJA 4DTOA 3IS9B 1BCMA 3CJ9A 1BU6O 1DZ5A 3CJCA 4IKAA 4GRSA 3FGUA 2DRAA 2CNOB 4C9DA 1SQFA 1DEJA 5B0CA 3CC7N 4FOIA 4MYUA 1EETB 1SIZA 3MM8A 3J80Y 4HUEA 4EO6A 2CNNB 3R1XA 2G8HA 3K0JA 4FYXB 3DMJB 4FBUA 1YZ7A 4ILJA 1EWRA 5B7WA 3MWBA 2CADA 1VC0A 2PGCA 4DKWA 1ROFA 3QSYB 3T69A 1UKUA 1GMWD 1WSJA 1HI8A 5AQYA 2FLPA 3DRRB 4ZPWR 3M32B 4LRDA 2GMLA 2RU3A 4BRGA 5T41A 4H0XB 2KM8C 4OLOA 4WWSA 4Y6IA 4C7QA 3AA5X 3HT3A 2CQ4A 2QZ8A 4WFAL 3PJWA 3NGRA 3G6EN 1RCXB 2OJ3A 2X1FA 1WAFA 3H4BA 2UXCF 4KH6A 2JC1A 4EP4A 2FLLA 2VG6A 4W4MA 5D77A 5KFTA 1GLEG 4FK4A 2NCKL 2EKNA 2WW8A 3OVBA 3T1YK 3K7RA 2B9EA 3FRYA 4QW8A 3HPHA 2MZRA 1HPMA 4CFBA 3T6BA 5H9FJ 3TPQA 4TYBA 1TAQA 1BQNB 1RDBA 4E3SA 2HOEA 3LPTA 4H03B 3BSCA 2J9CA 3O3HA 2A1RA 4AFFA 1Y10A 5M1NA 1A5WA 3MFIA 3J80U 4QZVB 1S48A 1MNEA 1HQEA 4EHUA 1GMUA 2PDAA 1HW9A 2Z57B 4YNQA 3AJ1A 3PJXA 2YNGB 3CCRS 2BE7D 3PDNA 2DBBA 4I2PB 1KQGB 2DY9A 3ILOA 2AEJA 5EOYA 3M2RA 1UW9A 4RBUA 2FD2A 3PSIA 1TKXA 4Z4HA 1S6QA 2BVZA 4QWBA 3J81Y 2AEFA 1YJVA 2J0SD 4HCCA 1N5YA 3ULEA 3O1BA 4YORA 4KAZA 3I0SA 2XMVA 1RZMA 2UUCK 1YJWS 4ZLNA 2DNKA 5KRTA 4IOAL 3UO0A 2I0XA 1RDAA 1S5JA 2FJAB 1IVZA 1JKHA 3KLIB 1RHJB 2V0NA 1VQPN 1VSIA 1HKGA 4M41A 3S6EA 2BV3A 3BSOA 1HR0J 2ZBPA 5L1JA 4FJ7A 2NZ4A 1Q53A 1Q81T 4KHNA 1TFYA 4O8UA 2A6MA 1SL2A 4ZOSA 3CJKB 4E89A 2Y9HA 2IBKA 1ZBTA 4TLQA 5KFJA 1J5EF 4DR1K 2HBMA 4DR6K 4L3NA 1VQ6N 2UUAJ 3L4IA 4B9UA 2UXCJ 2ZZNA 4LQ9A 3ULEB 1VJWA 3IA0A 3OYKA 1EAYC 3HVTA 3ETMA 4LFBK 1XNRF 3KWIA 2VODA 4F4AA 3AQPA 3IAS9 4F2RA 1YRTA 4NYPA 2IDLA 2O67A 2LU2A 3R6GB 4DZDA 2LEBA 2CIMA 3J7YU 3M9OB 4RTFD 4CH7A 1J27A 3HHLA 3M4XA 2HGMA 4I1TA 2D5RA 2AZ3A 2PZSA 4C48A 1U26A 1ZTWA 3DFEA 4ZCMA 4O3QA 2FXUA 3GONA 4NO7A 1KR4A 5AQQA 4F3OA 2FY8A 2WRMA 1QD1A 1OYEA 2HKEA 3TQEA 2YI1A 1UVMA 1ZM3A 4XO0A 4A8YA 3DI6A 3ZZTA 2M0GB 3ZXWA 5AE3A 4CZHA 4KGKA 3FLCO 2B9YA 2YH1A 5AQLA 1Z1ZA 1SBRA 3HSGA 2W9AA 3N6MA 2G1DA 2WW4A 4P10A 3D66A 1WTFA 2DTJA 3B6BA 2PIIA 3LDLA 4F0HA 2IJFA 3H98A 2R7WA 2XY5A 1JCFA 3G82A 4UY8T 4KQZA 3DLEA 1RGIA 2GVDA 3RB3A 4GV9A 1VQ9S 5KG5A 3S3NA 1NM2A 3SLCA 4EIAA 1VLYA 1IBLK 3VN5A 2XHBA 2WUSA 4MMOA 1CEZA 3BKTA 3OBWA 3MCPA 4B9VA 3UVJA 2ZH5A 4URSA 1EQMA 2VPYB 2GVDB 1MDUB 3VGLA 2HNDB 2MYFA 1MLAA 2CUYA 4ICLB 3DKDA 5J2PB 1TZ0A 2ZZMA 3HM9A 2CQIA 1KHVA 1BQMA 4X4SA 3WNHA 4DV3J 4DL3A 4J9NA 1WSVA 2CJ9A 1K1SA 3POTB 5BR8J 3AB2B 5A2QU 4X65J 4JV2A 3ENHA 4K25A 5CHIA 3VAGA 1S97A 1E4GT 4FZXC 2B6AB 3GJTB 4X4OA 1V3ZA 5HQMA 1XQIA 1LNQA 4DL0C 2YNHA 5DQIA 3GFZA 3UVJB 4XPCA 2LDIA 4P2SA 1IUJA 3CCSN 1XR7A 3ZZ0A 3PFOA 4LSNA 2GQCA 3Q24A 4UW2A 5C24B 1T44A 4BR4A 1CZ9A 3SBGA 1N32J 3WEEA 3D28A 5KG2A 3BQ1A 4YR0A 4F0KA 5CYMB 2XWYA 2NXNA 4DV1F 4XH4A 3OSPA 4DUZF 2AJ0A 2DRBA 2ZQBA 3MEDB 4AQYJ 1L3UA 2FIUA 2J7KA 3VAIA 4WJBA 4C6AA 2IVOA 4X4VA 4HHTA 3WIVA 2ASYA 3MMCB 1HQ2A 4TU8A 1WSEA 3KKRA 3QBXA 3JSMB 4H54A 3MN9A 2VFTA 3OYJA 5HP1A 2CJBA 2H51B 2E2QA 4BC7A 3CFOA 2Z0GA 5E3RA 1HNWK 2P6SA 4RNOA 4LD0A 3NHGA 1K8AO 1S59A 4CEAA 3HI0A 3G6YA 1TP7A 2E5JA 5LT5A 2OTJN 4JI5K 2HNZA 4TLRA 2ZGYA 1E6VB 5GAGU 3KNAA 2KXNB 1RTJA 2BMBA 1S6PB 3PEHA 2CVIA 1PYOB 1U25A 2VGMA 4FXDA 2PEHA 4Y2AA 1FE0A 2FHMA 3ITHB 2IIRA 3H45C 1RTHB 2BRLA 1ZBIA 3H40A 2B3TB 3VF2A 1FTCA 1D9AA 1SCJB 2QN6B 3O6QA 1X4HA 3A3PB 2WK4A 3FGVA 4OI2A 5K20B 1KVIA 3H2VE 2BRKA 3A5OC 4FJHA 3EXYA 3EKSA 4DL7A 2F63A 3HVTB 3J81j 1H7WA 1VCTA 4AL6A 4DCOB 1I1GA 3MEGB 5CH7B 2O5DA 4ECZA 5KG1A 2QM1A 4H4MB 1NGBA 4MK9A 4R0JA 2HPUA 5DG7A 2E6LA 5KFPA 3MAAB 2X6NA 5AQPA 4C3MA 3P6YC 3DDKA 2BW7A 3RZAA 4ISFA 5LJ5Y 4DI6A 3GIRA 4ZVQB 3E9PA 2YWFA 4HKQA 2DR6A 4MIWA 3OL6A 4ZK7M 3W5YA 1X4BA 3GIMA 2HMPA 4L8RB 4KGXB 3ZETB 2BKNA 3M6UA 3CCVN 1P9QC 3MEKA 3VQPA 5LMNK 2IRYA 3D54A 3CEDA 4OZ3A 2ATCB 4JK8A 3PX6A 5GMDA 3AOBA 3FBBA 2GEMA 4KPCA 2JWNA 1ESVA 2MY8A 3SZ2A 1ITGA 4X64K 3FBCA 2QMWA 6FD1A 2W2PP 1Q4RA 2NRWA 4K4SA 2GV9A 5LXYA 1JLAA 3U27A 4FPRA 2WVEA 2P9LA 3VWSA 4E0DA 2FBXA 2ZJRQ 4XEIA 4LUBA 4L75A 5G0RA 5AQOA 4W90B 2E1PA 4CFCA 4P75A 2DH9A 2N3OA 1XMQK 2QC3A 2UUBF 4NASA 2KJWA 1H0HB 3D6TB 3R7NB 4K41A 3FSIA 3CPEA 3OTCA 1B0PA 5AQTA 4LF4J 1KTVA 4IFYA 4DV7K 2DPJA 3N4QA 4C0HA 2XNRA 1C0UA 1T9VA 4OX7A 2YJEA 2CAJA 2UZAA 5A0YA 5HATA 4LF6J 2OIHA 2QEXS 2BJEA 5GAHP 1S7HA 3PO4A 5HRPA 1VIXA 4YB6A 3VVTA 5MAOA 5A2QO 3WHIA 3MAHA 2RE2A 2DNRA 1WOOA 1RBVA 1YJ7A 2QLWA 3M05A 1X9MA 2V67A 1S79A 1HI1A 3ZYYX 1U7LA 1SUQA 2F4VF 2IY5B 2WOMA 2HAIA 3VERA 3ET6B 3DWLA 2AT1B 1JK9B 1S0MA 2XS2A 1ILYA 2XMUA 3IWXA 3WX8A 4WFZA 3QQCD 3M8WA 3JS9A 1FRXA 1S0VA 3GSDA 3MXIA 4JKEA 4MDAA 3QZ7A 2VKRA 1N34F 4O3PA 2UU9K 4XDCA 5HVHA 2L3MA 4DF8A 3U1NA 1GX6A 2CWKA 3SYZA 5BRFA 4DTSA 2GA7A 5JS2A 2IC3A 4DLGA 1S0NA 3H08A 3FJ2A 3G2XA 2JFKA 3DI6B 3BZQA 4C0OC 3BBFA 2E20A 1I3AA 4JI8F 3O8WA 3BO4A 1CC8A 3SJJA 5KRSA 1GLDG 3FK4A 2VJUA 3G6VA 4CE9A 1N36F 3H3NO 5L9NA 3S41A 2OELA 5IWAJ 4OHWA 3V1QA 2OPSB 4NLYA 2MEWA 2RHKA 4LR9A 3ILIA 2YX7A 4DSJA 2ZVSA 3RJMB 3G8QA 5LMUF 3QJPA 3CCEN 1L3SA 5AFUH 3M8QB 2ZH6A 5DO2A 1OMSA 2QSFA 1U0SA 1ICEB 4USWA 3LPYA 3FCWA 3PR5B 3BEXA 3BGOP 4DR6J 1HYVA 3MM9B 3ENAA 2XC9A 1WC5A 3K8WA 3IWLA 1RTDA 4NA1A 2EFOA 3LM9A 2YNIB 4X66J 2FC9A 1KQFB 4KRFA 2MSTA 4CLLA 4BC5A 1WC1A 4CBWA 2NPIA 3HSTB 2BEFA 2R3VA 2VFSA 2ZJQL 3BH7B 2ASLA 1T8EA 1RWWB 3TZZA 1WOSA 3KLFB 2JOQA 5FIIA 5AQZA 3TAMA 2GGPB 1FTRA 4CJWA 3LP2A 1XI1A 3UD5A 4NPOA 2DD8S 3U02A 3VGSA 1VSJA 4EMDA 1LW2B 1FDNA 1K44A 1JLFA 2J4RA 4IWVA 2DGOA 3V9XA 4MJKA 2OSQA 2MXYA 3A8KA 1X4CA 2W4DA 1NK6A 3AAPA 4TXSA 5KFCA 4E98A 5DGAA 5K9FA 4LFCF 3TAGA 2B5JA 2OPQB 4YR3A 4FVMA 3AV9A 3AODA 1VHFA 2JEFA 1HKBA 3HYFA 3KWGA 4E7HA 3OPKA 5DM6Q 4BROA 3WBZA 5LXRA 4F4YA 4FM0A 3DLKB 2BDPA 4BREA 3QSIA 1X0PA 4CEOA 3N6LA 1RYRA 1Q7YT 1UFKA 1UCNA 1L3KA 4NZ0A 3K0SA 1U2RA 3G4SN 4JV5F 3ADAC 2ZJRL 1Q81O 2KI2A 3H7HB 1GXTA 3QWUA 3LPEA 4YOTA 2MLXA 1IBMF 1SXLA 3S1TA 4DEZA 3UNGC 4OI3A 3W61A 2A6AA 1SKSA 5M1QA 2XHWA 4PZVA 5C12A 3OXLA 2RE1A 3PZPA 2VZ9A 3UDEA 4CEEA 4CERA 2HHWA 4J8FA 2UXDJ 3D7SB 5FRNA 3BYRA 4M5IA 1G3OA 4B3MF 3B8HA 4USJC 2HK2A 3JSRA 1BHLA 4DTJA 1Q1KA 4ID5A 5I3UB 3AA2A 2FQQB 1NHKL 1XC9A 4RNMA 1S7IA 4DQIA 1RT3A 3R1HA 1KXPA 5DM7Q 2P5VA 4RBTA 3NGYA 3R97A 4FLTA 1BY9A 4JNEA 1HUXA 2J76E 1T3NA 5KT3A 2K7KA 1KS2A 3GYNA 1RABB 2EFGA 3DLHA 4K0KK 2Q43A 3L2VA 3OA9A 2AIRB 4EBDA 3KK1A 3GG1A 3G4SS 3HRGA 4O3RA 5F9NA 3TUPA 1VRUB 3B78A 4M3UA 3VHQA 4AHUA 2MGZB 1EB0A 1QE1A 2C2NA 4NXNJ 2KO1A 2OMLA 4IEEA 5CYQB 2BA9A 1S72N 3BUZB 1RK8A 1BWFO 1NH7A 4G65A 3SV4A 2QYCA 1RBTA 1SI9A 2IOCA 5C10A 4BR7A 2IMWP 2LQ9A 1RDWX 3C7NA 1KVKA 3MM8B 5T7LB 2RIJA 1KVAA 1WSFA 3BM7A 1NCLA 1X0FA 1GXUA 3T1HF 4F2SA 3OVSA 1AZSA 3BO3A 2E9ZA 1OPZA 4NYFA 3MM7A 1QVGM 1SC4B 4NEZA 2G9OA 1BC6A 3HT0A 1UTAA 1VRTA 5B0DA 3N5BA 4CF8A 4M3ZA 4LF5J 2Z2YB 3GFXA 4KV8B 4PRFA 2VU5A 2UXBK 2YX4A 1TYQB 3UKUA 4NRTA 4KHPF 4JKFA 1HJRA 5F8JA 1WSIA 4A4JA 1RT4A 3M8YA 5FROA 2XSJB 3I9ZA 4ZLLA 1FNXH 2QX0A 3V4IB 2P1JA 2A3ZA 2AV5A 4ZN3A 3D9BA 3H42A 4J5OA 1G4CA 5AXKA 4OLBA 3P1GA 4BRMA 5L1KA 3RSEB 2W40A 3C19A 2N7YA 1RAOA 2P5OA 1YJWN 4DV2F 2UYTA 2QXFA 2JSXA 4YDDB 3BJYA 4OL8A 3CPWM 2MKJA 3W7BA 1NU4A 2LSNA 3UDLA 3M9MB 3RB0A 4EYIB 3WDOA 3C14B 3C6HA 3VF6A 5ETNA 5DLGA 4CJQA 1JLEA 2HBKA 4UT4A 4ZCKA 1PKUA 5AE1A 4CW7B 5LL6d 1HPZB 1NHUA 3AVBA 3OR2B 1J53A 3FZKA 5HO4A 4OO1J 3DGPB 3PHEA 2PO4A 3NMUA 2NSCA 1H1VA 3MMJA 3LDPA 4P2FA 2LQJA 4A61A 3RMBA 4O0IA 4Z2XA 3T5LA 1OIAA 1UZHA 1FJGK 2ILZA 4TU9A 3HVAA 2B4PA 3RSEA 1LW0B 3OFGA 3ZX0A 3AFGA 3I87A 1KQKA 1U1QA 5HI7A 3MWPA 3C6UA 2D1CA 2Q6BA 4KBOA 2BANA 3G25A 2OD4A 3N79A 2WONB 4DR3K 2HFZA 5BPMA 1LAWA 5B8HA 2KHCA 4W98A 4FWRA 5C2CA 3E3XA 4C8KA 4O44A 4IH5A 4WFAQ 4WU3A 4FP9A 1H73A 3M30B 4GKJF 4L72B 3F5TA 4OZ1A 3ZSXA 3ZT2A 5B0AA 3MEEA 2H48B 1DGKN 1R27B 3QLHA 3QNOA 2ZH4A 1TAUA 2HIQA 3Q22A 2M70A 4H0OA 3P31A 1A6LA 4W92B 3LANA 5C2FA 2F7VA 1N56A 1UVIA 1BQMB 4X64J 2W2QP 4X2BA 2GVZA 1E6VA 4E19A 1R8PA 1BLUA 5ETMA 3MCOA 2EXUA 2OFHX 1F60B 2JRSA 4A46A 4BRDA 2HYIB 3H5UA 1N0VC 2LCWA 2DCUB 2CPIA 3MI7X 1X5OA 1FRHA 2A40A 2BE2A 1D0EA 4RO0A 2G0IA 1VR6A 2OEMA 4DDFA 1GOCA 3V81A 2XGQA 4DN0A 3EGNA 5C15A 3KNGA 4PG6A 1EETA 1Q0NA 3QGGA 2G1HA 1VSKA 3CJRA 1FHTA 3M6GA 4WE1A 3ENWA 3FRZA 2ZH9A 3BP8A 1X3NA 2E5LK 1BIZA 3TI0A 3ZZUA 2XSJA 5J2PA 4C11A 4DSEA 3L6QA 3J7YP 2DGTA 2NUBA 2VQEJ 3DLBA 4TVAB 1NWKA 3VQ5A 4AILC 2HB5A 3TJ8A 1YUWA 1YIJS 4KV8A 3F9KA 5KI6A 3RRGA 1S9GB 4U7UD 1WI8A 2XY6A 5F0UA 2GFFA 3K5NA 2G8UA 3I9V9 5GADP 4JD2A 1UAWA 2V34A 2ZM6K 4X84A 1LK5A 4MQ3A 4N56A 1NGAA 2MHEA 2PMZD 1FW6A 1HBNA 1VQPS 2D1KA 2G13A 1YJRA 3U3YA 3D0IE 1GLFO 3RB4A 1WNSA 3A5NC 2KB2A 3CD0A 1MWQA 4UOHA 3UI3A 4FJXA 4DZ6A 3DM2A 4K4ZA 2OPPA 3CMAN 3V6JA 1UWAA 3NVKA 2JVRA 2FSJA 5DGBA 1VQ6S 1N5VA 4BS2A 3N0VA 3R2CJ 4CF1A 2FBVA 3Q8QB 4O0NA 1S76D 2IYIA 4G1QA 4ZVHA 3EGZA 4U6PA 3CCLN 3IXQA 4RU9A 3EE3A 3PRDA 2QWOA 5F8MA 1T9WA 2FZKB 3RG6A 4IDKA 1C1BB 4RW8B 1KTQA 3BZCA 4MFBB 1S72S 4ZIVA 1R8AA 5AXLA 3PVXA 5IC4B 2KVIA 2F4VJ 4JI1J 3CCUS 4B9QA 1VYAA 5H9FK 4LF4F 3BY5A 4WIIA 4IFYB 4O5BA 1GLAG 3J7ZT 4ZVOB 4H5RA 2KH9A 4KH4A 3KLFA 2O1PA 2XYPB 5CZVA 1UVNA 1VQ7S 4FVUA 3E66A 4N76A 4YOXA 3US5A 3QIOA 3CTRA 1NPPA 4NA3A 2W8KA 2QLBB 4F02A 1N36K 1X60A 4BHQA 5KG4A 3CJTA 3TAEA 3RTVA 3FQLA 3P49B 5AJ3K 4XPEA 2CQGA 4DUYK 4BE0A 4ZJQA 4LQ3A 1UZDA 3NP5A 2VGNA 3H4DA 3IFRA 5IFMA 4JI4J 2LVWA 3AAWB 4A48A 1NZ8A 4Y1DA 4CTAA 1CVJA 2PFUA 1Q5VA 3K89A 4NLUA 2DHHA 3U8XA 3MXJA 3A8JA 5JUMA 1HBUA 1WC4A 4BRAA 1A9NB 3PV8A 4J91A 3TAQA 1ZBSA 2D0OA 1F1BB 2C2OB 4CDIA 4CVNE 3O9UA 1XEZA 4IJAA 1RAAB 5ETKA 4KGMA 2OEJA 1M1KT 4RW6A 1JNRB 2DNZA 4B17A 4KJIA 4Q2MA 1RKIA 5FDLA 2VG5A 2P9CA 2WSCC 2QL9B 2DR5A 4AXJA 3KHRA 3EWGA 1PCAA 3QT8A 1JCEA 1WOPA 4CD1A 3R27A 3TTDA 4B3RK 4NYZA 2RF2A 5B09A 3O4NA 2RPIA 4ECRA 1Z4UA 3C6UB 1QQCA 3HHDA 1HYSA 2Y1RI 3CCMN 3RAQA 2ZITA 2CJAA 3ATUA 3E51A 2CPZA 4BY9C 3KUEA 4NXNF 2KFZA 4I9LA 4Z0UA 3NNHA 1ZBHA 4K59A 2DGXA 1R6YA 3CCRN 3NMRA 3O4WA 5D78A 2VKZG 4DR6F 3P5BP 4IG3B 3PW5A 2BTFA 4OZNA 3FFIA 4HEA9 2QWNA 1A7GE 2VUGA 3FZMA 4EZ9A 3MPYA 1V4TA 4OGEA 1WC6A 4DJBA 1L3TA 1RFQA 4OVLA 1Q7YO 3ALYA 1B4SA 1BWVA 3G96A 1TVRB 1FDBA 4AXIA 2JL9A 4LF2A 3A5MC 4CJFA 1KOHA 4NOHA 3VEXA 4QR2A 2LDYA 1JJ2R 4KB7A 4QIEA 3QIDA 4FWLA 5KOXA 3IG1A 3KHYA 3SPYA 4DBQA 2QEXN 5EY4A 2RKIA 4CM0A 3CM5A 5AFUA 4CJKA 3D0HE 1W2BR 3HKZD 5IT9U 3TOQA 4FYDA 1PBAA 4MIBA 4QS8A 1C0GA 4BRIA 4FN5A 1RT4B 3QEXA 1YT3A 4WYWA 3D5MA 4DXLA 3WXLA 4LRFA 2I5JB 3OLAA 2GUPA 2Z2ZA 3M9NB 1WC3A 1RAGB 1WUUA 2O3DA 1FJEB 3QPIA 4CZJA 3CERA 3KG4A 1DQ9A 2J9DE 1S49A 1UOCA 5AJ3J 4IFVA 5F8IA 1HBOB 1G2EA 1WKLA 1FI4A 1LFWA 1KP6A 2FHJD 4MIAA 4H0YB 1T9TA 3L3UA 4K2XA 2HVEA 3NNAA 3KJVB 5HVFA 1QSYA 4Z7CA 2N7CA 2WVDA 5F8NA 5AZJA 3R6LB 4BE1A 3GCWP 4J9QA 2BKOA 1XBWA 1H7XA 3MCAB 1TL4A 5HLFB 1LXNA 3P45B 1YBAA 5D15A 3CIZA 3CMES 4PCQA 4C2MA 1AB8A 3QWPA 1ATNA 2R42A 3DHWC 5C24A 1YJNN 4CGIA 1DBDA 3QGIA 4O8KA 4LSLB 1RP5A 3VQEA 3DRRA 3CJQA 4PXDA 2YHBA 3JXUA 4ECYA 2I5JA 2ZH8A 2PY5A 1JXLA 4O4GA 2W2NP 2LYVA 4DCHA 4OYIA 1WOQA 2R2UA 4TSXA 4B1YB 1NLVA 1LXJA 4OYOA 2BUPA 4N8OA 3UKRA 2GW8A 2PSZA 2FHJA 5GAEI 3VOVA 1NKCA 5GIPA 2Y1LB 1WN7A 1SC1B 2BQRA 2V2ZA 4LIRA 2SXLA 4EBEA 4DMNA 2KQ2A 1QSLA 5T7BA 4M5HA 3T5JA 1Y5IB 2DFHA 4OZLA 1SKRA 5LOQA 4C0BA 3Q8VA 3ZZRA 3ISNC 2FGOA 3HP9A 1A5VA 4FXWA 4ID8A 1NG9A 2FC8A 2A1SA 3O9SA 2KYXA 4M5DB 1YTAA 4USIA 3AOAA 1U0HA 3KLGB 2FZCB 1JLBB 1B70B 1OY6A 1GLLO 1Q8BA 2H3EB 1BA0A 3H46O 1ACMB 2W25A 4CP5A 1E6YA 2EW9A 2AYMA 3DRXA 5A8RA 2VFVA 4JI3F 4BGBA 3RW7A 2XRIA 3TX0A 3ZSWA 2O8BB 4W5QA 2OP5A 4OKKA 4IRCA 2UUWA 3CCLS 3IP0A 3W2VA 5ADZA 1HQUB 3NE6A 4AHVA 2VWKA 2KFNA 3G9CA 2COLA 3U3GA 4MT1A 4F3TA 5C2DA 4CJRA 4DQPA 4CEFA 2VD3A 2OH2A 2GV1A 4ES1A 4PQAA 2KXHA 4MYTA 4B9NA 3TAMB 2GGPA 3VGKA 2RQMA 4N47A 4PWDA 5KFXA 1C0TB 3SI8A 5CCMA 1NNDA 3KLGA 3SDEB 3TUJC 3MX2A 3A12A 1T05B 3W3SA 3MZIA 4CI0B 4U7BA 2RUGA 5IV3A 5M2PA 4H4KA 5D3GA 3Q8UA 2A2CA 5J2MB 1VQNS 4LBHA 3NAEA 4PA1A 1OWXA 4EI2A 3DXKB 3G6XA 3VQ7A 3HX9A 2P8IA 4JRPA 1Y11A 5FPMA 2YH0A 1XHXA 5MLCV 4P73A 2CFXA 2M3DA 4Q43A 2F9JA 1SPBP 3GDQA 1CQNA 4DPTA 5A6PA 2HNZB 4O23A 2WHOA 3B82A 4URQU 1RTDB 4QAGA 3SK3A 4DR4K 3HFKA 4NLTA 2VG6B 2DK2A 1NMDA 2D0BA 5ITHA 3P39A 2FHKA 4LH4A 4GW6A 4JLHA 1ULRA 4B3TJ 4R5PA 4CHYA 1NJWA 3M2VA 2D3ZA 2HAFA 3ZCMA 4CLKA 3R7BB 4ZMMA 3QFWA 4HWIA 5KFKA 2JNJA 1C4AA 4UOCA 4CEZA 5IM0B 3MD3A 2I7PA 1FWPA 4PG7A 3M1VA 4ZVRB 3I96A 3DRPB 3I5AA 3SQ4A 3UIQA 3AO5A 4YMEA 4L74A 3MAAA 3JSBA 4KI6A 4U7CA 2EBGA 1XNRJ 2UV8A 4C8ZA 2AQ4A 2HWIA 1VC6A 2PBDA 4BDZA 2HEKA 2G2OA 3RR8A 4C98A 4B1WB 4U9RA 3P4IA 1K9MO 1S5ZA 4ZP6A 2F4FA 2BOAA 2EI5A 4CHNA 1F0XA 3PKYA 4IKFA 4WPAA 1U0HB 1JJHA 2XY8A 4R8UB 3H2LA 3ENOA 1U6ZA 1HJOA 1D8ZA 1O5JA 4NLSA 2YPYA 2HBRB 3TEGA 4LF7F 1BD6A 1SVDA 3WNEA 2O8DB 2CNKB 2MZTA 2A42A 2MTLA 1EZZB 2CA9A 4CZLA 3O3FA 1FXXA 2NLXA 1RWOB 4WQ5A 1OVQA 3JAMO 2KZMA 3BN7A 4FS1A 1S4EA 4LR7A 3V2UC 1D9DA 1EHWA 2W9BB 3KK2A 4DV4K 3I5BA 2P9KB 5BRHA 2AX1A 3UKUB 2WSFC 3FZBA 5FD1A 1V3SA 5G0RB 3I5CA 4DR7F 1G6BA 2ZKUA 3IN5A 3K5LA 4BDPA 4NI2A 1Q7LB 3AVCA 1S1XA 3KDOA 4EEYA 2HRUA 5LJVA 1G15A 3CETA 3OTOF 4KHUA 3KHLA 3CYMA 1DARA 2KHOA 3MEDA 3CMQA 5KOWA 2ACMA 2QGFB 3NEKA 3N01A 4V19S 2CPJA 1YJUA 3IMQJ 3I6PA 4KRWA 2ITGA 4UOFA 1PG5B 1SH3A 1YJTA 3IMXA 2VG5B 3U1MA 1DFDA 1V9OA 3I31A 3VGTA 1KD1O 1NBWA 4FJLA 3QRQA 2ZJPQ 3JTOA 4LY7A 2ZM6J 2OD6A 4ER8A 2KG0A 3CIMA 4HL9A 2BX6A 2KU7A 3W9IA 3T5KA 2BJDA 4ZPTR 1F6TA 1HPZA 3LTOA 1RT2A 3AA3A 3O5BA 3C15B 1U1LA 3GJQB 2AYBA 2VQEF 3AH6A 1NK9A 2F96A 5A2QY 3DC2A 1VIOA 4BC9A 4B3MJ 4BACA 5AZIB 3L7PA 5AE2A 3QFPA 2WONA 3EICA 4I68A 1KFSA 2WSEC 2A6OA 1VK0A 3M5RA 5A8WB 2MQPA 2ZBIA 3PIPL 4YY3J 5C25B 4C8MA 4CK2A 4H4MA 5GMKa 2DITA 3V9WA 1YQHA 4D3HA 2QTDA 4JI4K 2W24A 1TL1A 3E8OA 2B5JB 2OPQA 2IM2A 5D4PA 3WX4A 3DRSB 2E2NA 2E8AA 1CJVB 2HQCA 4HACA 3WNFA 4LR8A 4YP3A 5DS7A 1XR6A 4JI0K 2CGLA 4GMKA 2XEXA 4CHPA 4HTJA 2WBNA 3BSNA 5EX3A 2XMJA 2VH7A 4WCEL 4GVBA 3VR1A 4J2BA 4HT7A 3UDVA 4K4TA 2V63A 4C4WA 5BR8K 1T9YA 2GZOA 3P83D 4RUBA 5ETLA 3KD5E 4NE9C 1NDCA 2CNLB 2Z30B 3MMAB 5IQ6A 3AB4B 1RHRB 2EFNA 3S9HA 2EFQA 2JEIA 2KRRA 2AYEA 4FJ9A 4TY8B 1HI0P 3UN3A 4QU7A 2EFPA 4W5TA 4DR3J 2FVQA 3MTJA 4YFUA 1ZAVA 2WFBA 2HHSA 1YHQN 3FDSA 3ZSRA 2GNKA 1HL6A 1FD2A 3D6FB 4DV6J 5IT4A 4X62F 1LAVA 1R0BG 1DTQA 2F8EX 2VBYA 2E7WA 4FDFA 3RRKA 3TO8A 2G2ZA 3E01A 4IQXA 4DFPA 3OHAA 1B0TA 1S6QB 3BF3A 4ED0A 5EHHA 2CQ0A 1H74A 1WC0A 3ET6A 3ICLA 1S1UA 2XI3A 3OBYA 3UD3P 2MKYA 4LFAK 3HSDA 1RBUA 4DUZK 1XNQK 4CO1A 1QQNA 5TKYA 5HQ8A 2OKQA 4DQ8A 3UKRB 2HSEB 3T1YJ 1R0AA 3L7OA 3EYZA 4EGLA 1S22A 1Q8LA 4HH1A 5CXTA 2DGWA 3M1VB 2VCPA 2HNDA 3GMGA 2K3IA 2LXIA 3EMTA 5BN8A 1D09B 1M5HA 1Q82T 1X4DA 1CJUA 1T0TV 1NK0A 2EPIA 1IBKF 1LWFA 1GTHA 1FRLA 3G10A 3DLLQ 2PD1A 2WC9A 3FEXB 3I8DA 3PHTA 1LK7A 2ATLA 4KHRA 5M2RA 1ATRA 3GJSB 2QW9A 3OYGA 2YPZA 2BR0A 3K2PA 1GQEA 4N5SA 3I0SB 3KHGA 3ZSQA 3KOAA 4DU1A 4RBVA 4K4VA 2JLFA 4WF9L 1MU2A 5CE3A 3NGIA 3LGNA 4ECVA 2YKPA 4GO5X 3MPUB 1HNXF 4LF8K 5ADXA 1FD8A 1NJIT 4WTOB 1FJGF 4NXMF 3IR6B 4PR6A 3TR8A 1VQYA 3EJMA 4PHTX 3K2YA 2R7RA 1RWNB 5DDOC 4ZP8A 3TP2A 4B08A 4LSNB 3VESA 5BPNA 3F41A 4DG1B 2A41A 4CI6A 1DURA 2B9XA 5KFZA 5JJBA 1W97L 4RW4B 2E1ZA 3R2DJ 3DXMA 2IM1A 3NGSA 2F8TA 2H5EA 4RW7B 1DRZA 4ZVEA 4OV6A 2VICA 5KPZA 4WP8A 4TQRA 2E5LJ 4ED6A 5KFQA 1VQLN 3H8YA 5D6GA 3D3BJ 3P8BB 2GIFA 4W5NA 3G71S 2E44A 5D4OA 3SSRA 2YNFB 1X9WA 4FWNA 1FRJA 3KZBA 4ZPDA 1JLGB 1H2TZ 1B7FA 4OYZA 2IIHA 4JI5J 2RQKA 1YSJA 3GU0A 1MN7A 1FKOA 2KKZA 2XMTA 3WC2A 4CESA 3VQDA 4GC6A 4ZVFA 5HMZA 2E1CA 1HNWJ 3QBWA 5A0YB 5AQIA 1FX4A 1TKZB 1MMLA 1PC5A 3BQ0A 1IBKJ 2X78A 1YF5L 3OYCA 3GOIA 2E5HA 2HQGA 2P2CB 3D67A 3CCMS 4Y0FA 3T41A 4AQYF 1MA9B 5EX5A 2UUBJ 3CD6N 4O3SA 3MR5A 3DXSX 1NB2A 4OI0A 4OPJA 2HHHF 3TA0A 2QA2A 3SSSA 1RQ0A 1AROP 4FWKA 2YXLA 4BVPA 3M6VA 3T1YF 2E1AA 1IWAA 4J9LA 1EKSA 2FJXA 3GE9A 3CWJA 1P1TA 4K5RA 4O55A 2M7SA 2CRLA 1W7AA 2DH7A 2XYGB 1HWKA 3CJ8A 3LP0A 3MM6A 5C2GA 2R8KA 1N6QB 3WQUA 4CCHA 4ZDNA 2RH3A 3WNGA 2Q1LA 3HL8A 1RBSA 5IT9Y 5CY4A 1X5PA 2H4YB 4WP9A 1YBUA 2ETJA 2ZM6F 4YOWA 4MK7A 3PR4A 2R7TA 4QOZB 2JHEA 3NWRA 5U47A 5BPLA 3GP9A 3DU6A 3M2UA 4FW2A 1UP1A 4DQSA 4NCGB 2W4CA 4AE5A 4CGJA 3FQKA 3QGPA 2ZWPA 5EWEA 4CZIA 3V6DB 3MGJA 2CDRB 4X65F 4KC5A 2BUNA 4JKCA 2GS8A 5JICA 4FJJA 1CJTB 1KHWA 3PFEA 1TUUA 3BPSP 1NGDA 3LALA 2PI4A 3K59A 2A5XA 2HHTA 4ZHRB 1M5VC 3M8QA 1Z26A 1RE1B 2MZQA 3OTDA 3UDCA 4PYAA 3EE8A 4JYAF 2QA1A 1O1WA 1U47A 1H2UX 1HNZK 3FBFA 1MWMA 4OJ1A 2I9SA 3DLGB 4DU7A 3K5MA 4DN9A 1RWXB 4EFHA 4YY3K 4TY8A 3R5CA 3Q23A 1REGX 4M5GA 3TJ9A 2P9KA 2WB4A 1MROA 5A76A 1HIYA 4N77A 1B64A 4OPAA 1HWIA 2HSTA 2ZGZA 3BQ2A 3NMAA 5DMRA 3ILJA 3FUYA 2Z1JA 2J6SA 2C2MB 3TUIC 4M5JA 5KFBA 5BRDA 4GVBB 3OS1A 5THWA 4Q8FA 3KG0A 5GAHU 1TYQA 3AVAA 2W2OP 4DV5K 3A1YG 3NF7A 3D4JA 2UXDF 4NYOA 1QTMA 5AZJB 1WHVA 4CLYA 2MPUA 4XAKA 2Z58B 1WHWA 3CDUA 1TKTA 2LXFA 5M1FA 4J9RA 3OYBA 2VWJA 3PRBA 3W5ZA 3ZNUA 4IG3A 1AZSB 1I5OB 2JH3A 4J9OA 3BYPA 4OZ0A 4FF4A 4XH1A 5DQGA 5CQGA 1IH7A 4LFAJ 4TQSA 2XCAA 2C22A 2EHGA 3D1OA 2XMMA 1J5OB 4K50A 3OXFA 5HRRA 1WHYA 3TVYA 3HJFA 4BQZA 1P90A 4CIOA 4K8XA 4J37A 3S8SA 1BCOA 2R7QA 1OKJA 5D4NA 3R9LA 3THYB 4ED5A 2QJ3A 5JVGL 4PWDB 4LF7K 1U24A 1N33F 1RWPB 3HD1A 1YTUA 4C11B 5KFYA 1T7PA 3J7A1 1MU2B 1NBEB 4L73A 3AO3A 1IBLF 2HW3A 4O44B 1PILA 2ZWHA 3FEYB 4DV7J 4QIWD 1BO5O 3HHLC 4I9QA 5AQXA 3BGUA 4KYZA 3VQQA 1JLFB 2ZOGA 4YEAA 4OX6A 5JVHQ 3IUCA 4WP3A 3O44A 3IBWA 5AQRA 2HVIA 3QZ8A 1CPZA 3A8EA 4KHWA 1BQXA 3A2FA 3NBPB 2HG4A 3AOCA 1EKEA 2QXLA 1N36J 3UCGA 4YS2A 4HYKA 2C2EA 4OJHA 3L2WA 3NS6A 2J7UA 4HH0A 2RUSA 5HSPA 5I3UA 2FJVA 1WG4A 4GV3A 2X1BA 1Y4ZB 1RISA 2DGQA 4DS5A 4URGA 4L6V3 1UL3A 4YHHJ 2XM3A 1YAGA 1IKXA 5SWMA 2R7OA 3NCPA 2MDAA 1IG9A 4DSLA 3A4TA 2CYYA 5I4MA 4FWPA 1SQEA 2B8PA 1HMVA 4IEIA 3DGVA 5F8LA 4V19J 2MKHA 3O9TA 2HFNA 4ED4A 1JKHB 3CMEN 1I6JA 4OZ2A 1VQ9N 5HJXA 1O0PA 2PE8A 1SKWA 2GBZA 2XCPA 1QY7A 1HD0A 2XLJA 2F3JA 4DR5K 1Y3JA 3BSAA 5I42A 2MLYA 4OHYA 3ZT0A 1R7IA 3NCQA 2UP1A 4JI8J 3PSFA 4HDHA 4JI7K 4CHQA 2KT3A 3ZZZA 5CCLA 2NPFA 4IOBA 1ZZFA 3W60A 4QS9A 1VBZA 1WEYA 4A8FA 3CJ0A 3WT0A 2Z1GA 3D45A 3DXKA 2P9NA 5H9EK 2X7IA 3ZTOA 1IN0A 3QEVA 1NH8A 1VBXA 2AF6A 1N5SA 4FOEA 3THPA 4GVMA 1NUEA 3AJ2A 3MAQA 1VQ5N 2L9NA 1RT6A 1JXEA 2MMYA 4KHMA 2C3YA 3MECB 1CLQA 3OR1A 5KFOA 1RWVB 3L3CA 2HNYB 4B3RJ 2QWLA 2OO4A 2V4RA 1Z05A 3HSJA 4B8AB 4KGVB 2QA4N 1KLNA 3NAIA 4FNIA 1N8RO 5D8HB 3CCSS 2CQDA 2UUCF 3KLHA 5T14A 4RX6A 1ZM2A 1VQSA 3CFRA 2L08A 1I3OB 2HRTA 3GG0A 3NH2A 2C1EB 2HVZA 2HVHA 3VENA 2D41A 4F4WA 3T7ZA 2LEAA 3ZEUA 1N34K 3OYHA 2MQLA 3H2UB 3KXDA 5F8GA 2WBRA 1NKBA 4JI7J 3PG9A 1F9FA 3SAFA 4YDXA 3L09A 2WB1D 3CO9A 4WQ5C 2JVOA 4PQUB 1FRIA 1UWBA 1CC7A 3MUVP 5KGWA 4WKRA 2Q1NA 1VQ5S 4F4XA 1N5QA 2V9KA 3JSYA 3T5HA 3DLRA 1D1UA 4NRUA 4FYWB 2ZH3A 1D9FA 3EL2A 1TUGB 2O8DA 3R5DA 3JAMU 3D0PA 2VPWB 2DHAA 4ILRA 3D7EO 2HHQA 2CG4A 3ZZYA 4A47A 1HLUA 1CLFA 2CQHA 4MK8A 4CFAA 2X51A 1Y9OA 1VS3A 5AQNA 2YHYA 4ZVTB 3C46A 1PAEX 3U9ZA 2Q6CA 2OZSA 2HBLA 1ZETA 1YWXA 3OL7A 2CJKA 1I94F 1TK5A 1S1XB 4O4GB 1TR0A 3AY0A 1I51B 2H9ZA 2VONA 3IC1A 1F3VA 2APOA 1QS4A 3WIUA 1R89A 1W2IA 3ENVA 3HSZA 1L5UA 1S1UB 3N6NA 4JHDB 4Z94A 3OD2A 2VASA 3TJAA 2Z56B 4J7CA 4YR2A 4LFCJ 4QIGA 1EARA 4RPFA 1XTZA 1JB0C 1NDKA 2VWBA 1NJIO 5EX0A 3VCDA 2N3LA 3MM5B 3MR2A 1S9EB 3QNNA 3NGUA 4Z4CA 4IQMA 5DM6L 4DV3K 4CIEA 3J80O 3UR3C 5K8MA 4CQ1A 4U7UK 4NEYA 8ATCB 2YWHA 1RGVA 3MM6B 4ZPCA 1M5PC 3TEHB 1UAXA 2V50A 2HBQB 1JLBA 4KR0B 1RHUB 1WSHA 2D0PA 3HJVA 4BBYA 1Q86O 5DJBA 2FJWA 1GXLA 3MX5A 3IS9A 3P5TL 5AQFA 1WB9A 1QUPA 3DHXA 3RGIA 5I3QA 4DU3A 3HF5A 1YRUA 2JWLA 4DSFA 3L3VA 3KK1B 4JKDA 4J90A 3C6TB 4DS4A 4ZVSB 5JS1A 3KWMA 4PKGA 5L39A 3KKSA 4AF1A 1HQUA 2YBVA 5KG0A 2V69A 4K4YA 5HOOA 5A8KA 2IJRA 4DV2J 4CZGA 1OVYA 3H25A 2BJ3A 4OYXA 1KC8T 4I6WA 1PGZA 2ZF5O 3PEJA 2I8EA 2I38A 3HP6A 2ZC3A