5D3GA

Structure of hiv-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer dna aptamer
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
publication title Structure of HIV-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer DNA aptamer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 153
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5d3gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5d3gA05
3RBDA 4K4XA 4FJJA 4CJPA 3OL7A 1BI4A 4Y34A 4CEOA 1RDAA 1NK8A 5HRRA 5HBMB 2W9CB 2E6LA 4GVMA 3H5UA 4EP4A 2YNIB 2XGPA 4I2PA 3IN5A 2BQRA 3ZSWA 1JLQB 4R5PB 4KKOB 3HVTB 4IDKB 5L1JA 3S9HA 4ZHRB 5J2MB 4TXSA 3M9MB 5DGAA 3MEEA 3DLBA 2IAJB 4IRCA 2W7OA 5HLFB 4DSLA 5EWEA 4URSA 4TY8A 4ELUA 3QGGA 2F96A 2FBYA 4CF0A 1TV6B 3QESA 1RTDB 3MR2A 2R2RA 4M3TA 4W5OA 4O3PA 3FSIA 4E1NA 1BISA 4RUAA 2VWKA 4O3SA 2Z1IA 1Z4UA 1RBVA 3MXIA 3E01B 3L2QA 4CEEA 3ULDA 1W9HA 4J9KA 3T1AA 2J6UA 4RW7B 4ZMMA 3OYAA 1BQNB 4CGGA 3SZ2A 2HAIA 1TL3B 1CXUA 1HQEA 2UVVA 3VQPA 4JV1A 3QEWA 4JV0A 4ID5B 4ED2A 2F8TA 4FLWA 3QNOA 1JLGA 3FDSA 1JLBB 5C24B 4EEYA 2AU0A 4Q0BB 1JLEA 2E4LA 1NK7A 3HK2A 5KFXA 3BREA 2IM2A 1FKPB 3GV5B 3C6TB 3VQSA 4FK4A 3TAGA 2WB4A 3AVKA 2WCXA 2WONA 1LW0A 1ZTTA 5KFEA 5HRSA 1UA1A 4E89A 3P83D 4G1QB 3F73A 4IQXA 2IM0A 5J2QA 1QUVA 1BIZA 1S0MA 3KLFB 3JSMA 1XHXA 3L3UA 1XR6A 4ECVA 3V9XA 4J2AA 1IO2A 2XCAA 3OYJA 4J2DA 4IFVB 4Q8FA 1RBSA 4FYDA 1DLOB 4CK3A 4XPEA 4I2QB 4E7LA 4OKEA 4Q8EA 2OPSB 2FLNA 3OYNA 3SPYA 2HMIA 3HKWA 4IG3B 4BWJA 2XY7A 5J1EB 3O4QA 4TYAA 2XI3A 3U6FA 2ZE2B 2DPIA 3KLEA 3CG7A 1A5XA 1XR5A 3ISNC 3DOKA 3CFOA 1T94A 2HNYB 2WHOA 2IM3A 1U48A 4DFJA 2NUBA 2W42A 4M3ZA 4CJ3A 4O0IA 5KFOA 4RW9B 2D0BA 3L2WA 1FXXA 2G8IA 3MEDB 2E9RX 3T5JA 1QS4A 2XO7A 2HNDA 3AV9A 3LP0A 4MQ3A 1ZBIA 2YNHA 4NLPA 3HL8A 2AGOA 2UVUA 4N5SA 1NK9A 4H8KA 4EZ9A 1K1SA 5KFNA 3KLGB 1JLCA 3ZSQA 1QE1A 1W25A 4H4MA 2VG6A 2RDJA 4FK2A 3UDLA 4CJTA 1JLAA 3DYAB 4J9QA 2Z1GA 5KFZA 4B9SA 1RBRA 1C1BB 3V81B 5KFTA 4HTUA 3LP2B 1WN7A 2X6NA 3P1GA 4ZP7A 5FRMA 2UVWA 4E1MA 4LQ9A 2XRIA 4CJVA 3BSOA 1FK9B 3KOAA 5JXSA 3T5HA 2KFZA 1C6VA 4QWCA 3RMDA 2Q3SA 2YV0X 2I1RA 5DQIA 1JLQA 3ZCMA 1KCFA 3T3FA 1REVB 4KKOA 2VG5A 4DTOA 4IDKA 4ZHRA 1I6JA 4FZZA 1S6QA 4DTNA 1L3VA 4AH9A 4JRPA 1U45A 4OVLA 2UUWA 3BQ0A 5J2NB 1IKXB 1WSGA 2OPQB 4CFCA 4B3OA 3TQ1A 3TAMB 1GOBA 4KTWA 1S9GA 1TAUA 3OYIA 2YKMB 1RTDA 4CF2A 1VSDA 3VQ7A 4DSIA 3OL9A 4HYKA 4ZP6A 3OSNA 4I9LA 3MXJA 3PO5A 4DF4A 2ILYA 1BCOA 4ZTFA 2HHSA 1HRHA 1HQUB 4EP5A 4URQU 1RA7A 4DL2A 2P51A 5DQGA 4WFYA 4KO0A 3RB4A 2OPRA 3PJXA 1TL3A 5F8LA 4NYNA 3V6DB 3H98A 4BWMA 4MKAA 2PYLA 4Z0UA 3VQ5A 4DQSA 3OYGA 3Q8QB 1JLBA 3NGDA 2R8IA 4KHYA 2R8GA 1CSJA 2O4IA 1RDCA 5CYMA 1KFSA 4EZ6A 3I0SB 1ASVA 4KB1A 4DL4A 3QINA 3H40A 3C6TA 5KFPA 3SUQA 3PUFA 4FJGA 1CLQA 4YMEA 4MK8A 3EPGA 4B08A 2XWYA 1ZTWA 1D9FA 4IH7A 3UPFA 4NLXA 5HRNA 2C2DA 1VSMA 4DLEA 3KJVA 4N41A 3NE6A 4ZPBA 2EHGA 3AVAA 5F8IA 3HJFA 5KFHA 4WE1A 2JLEA 4ZVGA 4ELTA 3OYEA 4DTSA 1NKCA 3ZT3A 1LWEA 1UA0A 5EU7A 1BI4B 4DEZA 1JXLA 2YKNA 2RDIA 1NOZA 4OKJA 3BGRA 3C95A 4CGDA 2HB5A 1HMVA 3AVJA 4KHNA 3CM6A 3QZ8A 2F8SA 4OJRA 3RBEA 1BQMA 4ECRA 2C22A 2IMWP 2G8VA 4I2PB 3D28A 4FCYA 3H4DA 4Y1CA 3V1OA 5KG1A 4F4XA 3MEEB 1K1QA 3MR3A 1MU2B 2W9BB 5T7BA 2B5JA 2JC0A 4IBNA 3OHAA 1RTIA 4DL5A 5D3GA 3LAKA 3DDKA 5F9LA 1VSHA 4KTZA 1X9WA 3BQ2A 5L9XA 2PYJA 3TANA 4JV2A 1TKXB 3SJJA 2ZD1B 4FM1A 5DLFA 4PWDA 4F50A 3RR8A 3MECA 2JGUA 2XY8A 1K6YA 2FJWA 2O5DA 4GC6A 5KRSA 1MMLA 4WXWA 4DSEA 3PR5B 1KHWA 3T19A 3ZSOA 1J9AA 4Y2AA 2ITGA 3QETA 3SV4A 4OGCA 4U6PA 4KHQA 2GV9A 5KFMA 2W9AA 3TAPA 2IBKA 4J9LA 4FW1A 4QWDA 5T14A 1HQEB 4AHVA 3K5MA 2RN2A 3NAIA 4K4YA 4FLXA 2G8KA 3PX0A 4CF1A 4Z4FA 4CGIA 3QEVA 4H54A 4CHQA 3FQLA 3ZSRA 5C42B 5DLGA 5HP1B 1JLEB 2G8UA 4KB0A 5E41A 4FBTA 3A2FA 4FZXC 1RT6A 3N6NA 5KGWA 4F2RA 1VSEA 2A1RA 2Z1HA 3DRSA 1JLFB 3BR9A 2V4RA 1LW0B 4FS2A 4ED6A 4N76A 4FXDA 3LPTA 1JXEA 3M9OB 1RT5A 5J2QB 4FW2A 4BDPA 1IKXA 1N5YA 4FJMA 2X78A 4QPXA 2OH2A 4CJLA 3QGHA 1S0OA 4NLOA 2QKKA 4KHMA 2GC8A 2UVRA 2G8WA 3MR6A 4E0DA 4O5BA 2AGQA 4F3OA 3TWHA 1UWBB 4RZRA 3U3YA 4CESA 2HMIB 4FLTA 1S1UA 5KFIA 3RRHA 2RF2A 3HP9A 3SUNA 3I5AA 4MK7A 3CO9A 3AA5X 3DOKB 5J2PB 1HYVA 1KFDA 1QQCA 3SQ2A 3NMAA 4HVJA 4K4TA 4O3QA 4TQSA 3EZ5A 3QLHA 4B9UA 3WNHA 4DSFA 1WAFA 2HNDB 3KD5E 2R2SA 3LP0B 2D41A 3RTVA 2YNHB 4KV8A 3KHGA 2IS3A 4NLQA 3BQ1A 1JLCB 4DL3A 1S1TB 1QE1B 4J2BA 4H4MB 1S97A 2VG6B 2E9ZA 1QSSA 4EO8A 1WSHA 3HSTB 4CJSA 4TN2A 5EWGA 4FJ7A 1I3AA 1L5UA 3NGYA 3M9NB 2XC9A 1KLMA 2VG7A 1JX4A 2GIQA 5KT7A 1RT7A 3Q8PB 4M41A 3UQSA 1C2PA 3H59A 5KFCA 3CFPA 4DU4A 4M42A 4CEFA 2QE5A 2IOCA 4ECQA 4CEZA 3QYYA 1XHZA 4DSKA 1JL1A 4YQWA 2BQ3A 5KFAA 3CFRA 1IKYA 2VG5B 1RTJA 4PUOA 4ID1A 3MXMA 4FJKA 4XPCA 1S6QB 3HVAA 3ZSXA 1SKWA 2IJFA 1MU2A 2CJQA 2W9BA 4HHTA 1HYSB 1S1WA 4OLAA 4B3OB 1LAVA 1VK0A 5FDLA 1S9GB 4KAIA 3KNAA 4E7IA 3EYZA 3E51A 1CXQA 3LP3A 1TKXA 3V4IA 4NCGA 1LV5A 2ZD1A 1QTMA 4CFDA 4PY5A 1N6QA 2ASJA 4Z4CA 4ECSA 3LZIA 3AA2A 3VQ8A 2E9TA 4DS4A 4NLTA 3LPUA 4IH5A 2XI2A 4CEBA 1EETA 2VWJA 3IS9A 4KFBB 1RYRA 1NKEA 4KO0B 2OPRB 3KK2A 3AO3A 4CF8A 3H5YA 5KG4A 3NGZA 3PY8A 1DTTB 1IKVA 3IRXA 3CYMA 3NH1A 3FRZA 1TQLA 2W8KA 5C42A 3PW0A 3V6HA 5HP1A 3I5BA 3I8DA 5CYMB 2I5JA 3PW4A 3CJ0A 1CZ9A 1ASWA 1JLFA 1WNSA 2P5GA 3TABA 4KREA 3KKRA 4F4YA 5JS2A 1XC9A 1A5VA 3HM9A 1ZETA 4RUCA 1S6PB 3ZSVA 2C2RA 1HNIA 3O3GA 4K50A 4QWEA 3AVCA 3KJVB 3QNNA 5KG2A 3OYLA 4EBEA 4WE1B 5EWFA 3KLIA 3RR7A 2FJVA 3DI6A 4BDYA 3KK3A 4CHOA 4CIGA 5KFSA 1LWEB 1SV5A 1RT2A 3GIIA 1D0EA 3QGIA 4ED0A 1UWBA 2YKNB 3BGRB 4CHPA 1J53A 4FJIA 1HMVB 4ZVEA 1VRTA 3LP1A 1BQMB 4W5QA 2E6MA 4NLVA 4MIBA 3MFIA 1QHTA 1TKTA 3DLKA 1U4BA 2WTFA 2XY6A 3KMQA 5J2PA 3AVLA 4M95A 5KG6A 4GMJB 2Z1JA 3CJ5A 3MF5A 2KW4A 1XR7A 2B5JB 4LH4A 3OL6A 3M8PA 1RTIB 4R8UA 1QSLA 5D3GB 1BIUA 3G6VA 4M45A 3QIDA 4ECTA 1RBTA 4MK9A 1FKOA 4ZPAA 5DQHA 3D0PA 4UQGA 4PWDB 1NHVA 3PR4A 3MECB 4MFBB 4ZVFA 1J54A 1S1TA 3NHGA 5L1LA 4FJ5A 4TSXA 5EDWA 1BHLA 3V9WA 4HUFA 1S9EA 3OY9A 4O4GA 4FBUA 3DMJA 1SH3A 3PZPA 3GIKA 2FBXA 4YR0A 4TLRA 1S1XA 1ASUA 5KFLA 4FLZA 4FM2A 3HHKA 3NF6A 2G8FA 4LQ3A 3CDEA 2FVCA 1J5OA 3AA4A 4DS5A 1WNEA 3OSPA 3RB3A 4IRKA 3QEPA 5KFKA 4CGHA 1CZBA 4OGEA 5DMRA 3CWJA 4DQPA 1RT6B 4DL6A 1C0MA 5I3UA 4PA1A 3DRSB 1NJWA 1VSKA 3WNGA 3PW5A 2HNZB 4NLWA 3K5LA 1R0AA 3ZT0A 3OYKA 4X2BA 1RT5B 4Q45A 2BE2A 1HYSA 5KFGA 1N5YB 4J9NA 2FBTA 4QCLA 4K8XA 4C8LA 4WFZA 5CZ1A 2QV6A 2Y1JA 4OPKA 3HT3A 1GOAA 4C8MA 3BDPA 1RDRA 4RNOA 4ZPCA 3V9ZA 1S1UB 5C25A 5I42A 5KT3A 4C8KA 2RF2B 2D3UA 2AWZA 1LW2A 1T05A 4KFBA 5C5JA 2AX0A 1D5AA 3N6MA 1NOYA 3HPGA 5KI6A 2KTQA 3NL0A 3MAQA 1DTTA 3SI8A 3O3FA 1EX4A 3WNEA 5KFFA 1RILA 3H2LA 3HPHA 4J9PA 1GX6A 1WSEA 3K5NA 1ZBFA 3ALYA 1UOCA 3OS0A 3QLHB 4AHSA 2FLLA 4RNHA 4Q43A 4F4WA 3LZJA 3SI6A 4CGJA 4Y2CA 1S49A 2IA6A 2X74A 4KV8B 5CYQA 2OPPA 4ECWA 3QIOA 1S6PA 4DWIA 4MKBA 1L3UA 2FVSA 4AHRA 1UAXA 3MEGA 4FM0A 3TR8A 4I9QA 1KSPA 3VN5A 3RAXA 2FVRA 3H5XA 1KLMB 2VG7B 1YTUA 4HUEA 1NK5A 1RT7B 3OYCA 5F9NA 3NBPA 4FJHA 4E19A 3T5LA 3OJUA 2DFHA 1YTAA 4B8CA 2C28A 4RW4B 4DTPA 3RMBA 3AVBA 2DPJA 3GILA 5CY4A 5KFYA 3NCIA 3OLAA 3BSCA 1IKYB 1SKSA 4B9LA 1RTJB 4PUOB 3HO1A 1LWFB 3CJ4A 4CK2A 3ISND 3I0RA 3PVXA 3AVHA 4K4UA 4M3YA 4J9RA 1S1WB 1B9DA 3CDWA 1WSFA 4FJNA 1S1VB 2OYQA 3SYZA 1HARA 3DLEA 5FDLB 4WFXA 4MIAA 4LSLB 3V4IB 4NCGB 3CIZA 4NLDA 3KIOA 1N6QB 1C1CA 4MFBA 4F4KA 4PQUA 1NJXA 3SUOA 2A1SA 1RDDA 3SV3A 1EETB 1WSIA 4ZP8A 4ICLA 4RNMA 1IG9A 3IS9B 2IGIA 3EY1A 2VA2A 1TAQA 3V9SA 4AILC 3KK2B 4F4ZA 2HW3A 1ZBHA 3D45A 1A5WA 1IKVB 4RG8A 3IRXB 1C1AA 3RMAA 2WOMA 1T8EA 2J6TA 2B4JA 1LWCA 1WAJA 1Q9YA 1KVAA 3ZT1A 2P1JA 4ZPDA 2I5JB 4RW6A 2YHAA 3UIQA 4QW9A 3VQ4A 4DQIA 3GIJA 4N56A 4FJ9A 3G86A 3NGIA 4E7KA 2HNZA 4CJRA 3RAQA 2ZQBA 3NKYA 5FRNA 3RMCA 1HNIB 1U04A 4KHSA 4FLVA 3Q8SB 4DTXA 4FJLA 1NJZA 2C2EA 4K8ZA 3V6KA 1XWLA 3KLIB 3SFUA 1HNVA 4CJUA 3DI6B 3KK3B 1SV5B 1RT2B 2R8KA 1EP4A 3C6UA 5F8JA 3PW2A 2PY5A 1TVRA 2AX1A 1T3NA 2BRKA 3NDKA 3NH0A 1X9MA 1T03A 4ECXA 3JYTA 3QEXA 1VRTB 5HRPA 4CEDA 4AHTA 3LP1B 4IKFA 4JUZA 1TKTB 4DFMA 3DLKB 1O1WA 4NLYA 4CK1A 1S4FA 3ICLA 4YR3A 1S5JA 2BRLA 1LAWA 4Z4HA 2WRMA 3OS2A 3GV8B 4DTUA 4CCHA 2YHBA 4LSNA 4AHCA 3VQQA 3TAQA 1U47A 3S3MA 3HVWA 3M8PB 4R8UB 1RCHA 3QEIA 3THVA 4M3WA 3QIPA 3V1QA 2XGQA 1FKOB 4IOBA 3DRPB 1U49A 4NYFA 5DGBA 2BANA 4ED1A 1N4LA 5F8MA 4CGFA 1RT1A 4NRUA 4CECA 5DG8A 4IFYB 1TKZA 3DOLB 3AVGA 4F3TA 2RKIA 5L1IA 1SUQA 5KTQA 2GUIA 3KK1A 1S9EB 4HUGA 4DG1A 4O4GB 3DMJB 2IC3A 4E7JA 5L1KA 4KPYA 4DU3A 1S48A 3DLRA 1S1XB 1RTHA 3FQKA 4W5TA 5JS1A 3KHHA 5F8HA 2AQ4A 3O3HA 4NLUA 1J5OB 3CM5A 4H4OA 1HYZA 1BCMA 4YFUA 3OYBA 3CDUA 4TY9A 3SFGA 5KFRA 1SH0A 4RW4A 5KG0A 3AVMA 5I3UB 1NHUA 1KVCA 4CFBA 3K59A 1DTQA 1BGXT 3K58A 4EYIB 3C94A 1LWFA 1R0AB 2B6AA 4CIFA 2V4QA 2KQ2A 4O3NA 4ED8A 4NLGA 2YNFA 1OS5A 4K4ZA 4LY7A 2DTUA 3L8BA 2BE2B 1Z25A 3AA3A 2HVHA 1YT3A 3DRRA 1S1VA 3PV8A 1RDBA 4O3RA 1IKWA 5KFWA 3LALA 3HPOA 3KLHA 3AO2A 4LSLA 2ASDA 3FFIA 2UUTA 2FLPA 4KI6A 2OZMA 2IM1A 4KHUA 1KLNA 1T7PA 4O55A 4U7CA 3P5JA 2HHTA 1X9SA 4DL7A 4URGA 3UR0A 4QWAA 1HJRA 4DFPA 2DY4A 2HHUA 2HWIA 5C25B 5I42B 4K4VA 4B9MA 4IR1A 5KT2A 1LW2B 1T05B 1NKBA 3DLGB 2VA3A 1U09A 4KE5A 3ZSZA 4CE9A 4KB7A 4GC7A 3SQ1A 3VQBA 1VRUA 1RBUA 4DTMA 3KD1E 2FC0A 1JKHA 2R8HA 4O3OA 3ITHA 3EPIA 3TI0A 4NCAA 3I5CA 3PX4A 4Q5VA 5JUMA 3IAYA 4CJ4A 3DM2B 1BL3A 4O44B 2JEGA 2XCPA 5CYQB 2ALZA 2ETJA 2OPPB 4YNQA 2FBVA 1GX5A 3NFAA 4CJEA 3OJSA 4B9VA 3MEGB 4RW8A 2HHQA 1D1UA 4G3IA 4J9MA 4DF8A 4OKKA 5KG3A 3IGVA 4WXOA 3QZ7A 3OYDA 2OA8A 4DSJA 3NBPB 3G0ZA 5CZ2A 2FVQA 4F8RA 4CERA 3OL8A 2R2TA 2ATQA 1TL1A 3AO4A 4TQRA 4IH6A 2JEJA 1D8YA 5F8NA 3V6JA 1RT3A 4CFAA 3MFHA 3M8QB 1EXQA 2X6SA 4CJ5A 4OLBA 3K5OA 3I0RB 2W8LA 4AHUA 2KFNA 4ECYA 4NLRA 2JC1A 1B9FA 1I39A 3LWLA 2ILZA 3DLEB 4Y3CA 1JL2A 4FLUA 3VQDA 4FK0A 3V1RA 1C0TA 3PJWA 3BJYA 3AVFA 4DTRA 3DRPA 4KSEB 3WNFA 3QO9A 3SQ4A 1C0UB 1N56A 4LH5A 1C1CB 5KFJA 3VA3A 4B9TA 4BACA 1IM4A 4PQUB 4QOZB 2LSNA 4W5RA 3KMSA 1YVFA 3IG1A 4IFYA 4FJXA 4QAGA 3DOLA 2PZSA 4Z4GA 4ICLB 2JEIA 1W0HA 5F8GA 2EC0A 4KRFA 4BE1A 1HPZA 2QXFA 2WOMB 3DLHA 1RT4A 2BQUA 1IH7A 2B43A 3AVNA 1LWCB 3RB0A 4I7FA 4EBCA 3NH2A 2CKWA 3GIMA 4QWBA 2YNGA 4RW6B 4IR9A 4ZVHA 3SNNA 4Y1DA 5FROA 3TVKA 3PHEA 4O0JA 1KVBA 4ED7A 1WSJA 1QSYA 5HBMA 2V9WA 2W9CA 5HROB 1B92A 1KRPA 4JRQA 1VSIA 4NLSA 2YNIA 4HCCA 4KAZA 4GW6A 3OYHA 3M8RA 1SL1A 4E7HA 4L8RB 1TK0A 4R5PA 1HNVB 4WZQA 3HVTA 2FVPA 5J2MA 2RPIA 2IJNA 1TGOA 1NK4A 4DTJA 4RNFA 1EP4B 5K14B 2IAJA 3C6UB 4FZYA 3G6YA 4FLYA 4ELVA 2FJXA 3ZT4A 1TVRB 5KT6A 5HLFA 4FS1A 4IG0B 1ITGA 1T03B 2ATLA 3JYTB 3H4BA 3CJ3A 1SH2A 1TV6A 5EUHA 3DLGA 4J9OA 5DG9A 4K4SA 1JXBA 4YR2A 2HHVA 2XHBA 2AGPA 2DFFA 1VSLA 3GYNA 4ECZA 5KT5A 1QAIA 4C8OA 4LSNB 3D5MA 2AJQA 3E01A 3T5KA 3RB6A 3L3VA 2O4GA 2BDPA 4J9SA 4W5NA 1XI1A 4RW7A 2Y1IA 1BQNA 3OHBA 3QIPB 4CJFA 3DM2A 4ID5A 3HP6A 4O44A 2R2UA 1RA6A 1SKRA 2BANB 3N6LA 1S10A 4DU1A 3LDSA 4Q44A 4EBDA 1L3SA 2HWHA 1RT1B 5C24A 4FJ8A 4Q0BA 1JIHA 4JS4A 1TKZB 1RNHA 1FKPA 2RKIB 4E3SA 3B6PA 1SUQB 3KK1B 1NNDA 2G8HA 3PO4A 4DG1B 1KHVA 4EO6A 3SQ0A 2IC3B 2IDOA 3F9KA 4DFKA 2D5RA 4G1QA 3BSNA 1RTHB 4IKAA 1NK0A 3QERA 3HYFA 4XIUA 4H4OB 1QAJA 2W7PA 3KLFA 2QKBA 5KFBA 1VSJA 4XO0A 5DG7A 4KI4A 2F8EX 4FVMA 4ZTJA 5KRTA 3TAFA 4IFVA 1TP7A 3KKSA 3SCXA 1DTQB 4JLHA 4B9NA 1DLOA 4QW8A 4WYLA 1TK5A 4I2QA 5KG7A 2B6AB 2OPSA 3M8QA 2YNFB 4IG3A 3TAEA 3EZUA 3VQEA 3DRRB 5J1EA 1X1PA 5KG5A 3CJ2A 3B6OA 3O4NA 4KHRA 2ZE2A 1IKWB 4CJQA 3NF9A 3S3OA 3KLHB 1D9DA 4BE2A 3RRGA 3FFIB 2ZKUA 3VA0A 1L3TA 2HNYA 1TKDA 1C0UA 3VQCA 3OYMA 4N47A 3ASMA 4TY8B 4CHYA 4JS5A 3NAEA 4RW9A 3MEDA 3AVIA 3L2UA 3K2PA 3OS1A 1Z26A 1SL2A 4ZP9A 4CIEA 1G15A 3HVRA 4IRDA 3PW7A 1N48A 3CQ8A 1VSFA 1VRUB 3L2VA 3LWMA 4NRTA 3KLGA 3K57A 3BSAA 3LANA 2BR0A 1JKHB 5KFQA 3ZSYA 3VQ6A 3G6XA 4OPJA 3AO5A 3ITHB 3U3GA 3DYAA 2WK4A 1C1BA 3V81A 3KLVA 2P5OA 4J2EA 3LP2A 2XY5A 3CVKA 3SUPA 4O4RA 2HVIA 2D7SA 5KT4A 4KHWA 1FK9A 1JLGB 2QK9A 4CJWA 3OYFA 4K4WA 4ED3A 1Y97A 4KTQA 5HROA 2GIRA 1NK6A 3G10A 4DMNA 4RW8B 3H5SA 4DQQA 4Z4EA 1Q8IA 1RAJA 4RU9A 2WONB 3NAHA 1RYSA 1REVA 2KZMA 4HKQA 1Q9XA 1EKEA 1SL0A 4YP3A 5K14A 2DFEA 5J2NA 4F2SA 2OPQA 4CJKA 3JSMB 4M3UA 3OVNA 4IG0A 3TAMA 4DLGA 3L2RA 2EX3A 1TL1B 2YKMA 1ZBLA 1S0NA 4CEAA 4ECUA 4CHNA 4NYZA 3LAMA 1RT3B 3NF7A 3V9UA 4LD0A 2BGGA 4CEQA 5KFUA 1YVUA 1HQUA 3TARA 3GQCA 4OL8A 2J6SA 5KFDA 2R7YA 3PX6A 3MTKA 3KLEB 3MR5A 5SZTA 1C0TB 3RWUA 3SPZA 4NZ0A 1GOCA 3NF8A 2KZZA 3V6DA 2D0CA 4TYBA 5KFVA 1TK8A 2OZSA 5SWMA 4WYWA 2HHXA 3S3NA 3H08A 2R8JA 3QO9B 2D3ZA 3M8SA 3AO1A 2HHWA 3VQAA 3KHRA 4KBIA 2JEFA 1S9FA 1NJYA 3KTQA 4B8AB 4CHZA 5KGXA 3IG1B 4Z4IA 4R0EA 4DQRA 1ZBUA 3HXMA 3I0SA 4M3XA 3ZT2A 1F21A 4HCBA 4C8NA 4EYHB 3VQ9A 1ZYQA 2V0NA 3OLBA 1HPZB 2D0AA 3Q8RB 2ASLA 1RT4B 3KHLA 4RNNA 4NCBA 3GV7B 1KTQA 4I7FB 4BDZA 1JLAB 1WLJA 3IGNA 4M94A 4WZMA 4CF9A 4MH8A 4BE0A 2GBZA 5DK5A 2YNGB 4M3RA
chains in the Genus database with same CATH superfamily
5DO2A 4OLPA 2I0XA 2A42A 1BWEA 4CJPA 3OL7A 3OXFA 4Y34A 4AD6A 3J7AN 1TL7A 4JI0F 3MK6A 1XMOK 1YBTA 2MDAA 2WTUA 3NLCA 5HMYA 3PIPL 1WOSA 3H5UA 1IBLF 4RCHA 2F8HA 4LRDA 2QX0A 1EWRA 3WX8A 3AA8A 1WF1A 4M5GA 1DAXA 2ZWOA 1FJGF 2R3VA 5L1JA 3M1VA 3I96A 5IT0A 1VQ4S 4IRCA 2DR8A 3DU5A 2GA7A 4GVEA 1RXOB 4DSLA 2XULA 4TY8A 3D1OA 1CQMA 4ELUA 1DQAA 1H1VA 3K9KA 5AQZA 2MMYA 3OTCA 4NA2A 1H7WA 2M2BA 3FSIA 2V8DA 2FQQB 4TLQA 4H5NA 4RUAA 2VWKA 3KWMA 4O3SA 2Z1IA 4OYIA 4CEEA 4LBHA 3D4JA 1NGBA 1YIJN 1W9HA 3T1AA 4ZMMA 4CGGA 3SAFA 2OTJN 2F5GA 5B8HA 2HAIA 2J0XA 3GLJA 1SIZA 1BG3A 1U6BA 4PYAA 3OQ2A 4ED2A 3DDIA 1O51A 3I82A 4O8UA 2GMJA 4FLWA 2CG4A 1JLGA 1VDHA 4EEYA 3SLCA 3HK2A 3DCAA 2IM2A 3DJCA 3C7NA 1SQFA 2PA8D 4LF9J 5A8KB 3E2EA 3VEWA 4DV6J 1M90T 1YIJS 2XS7A 3D3BJ 1FRIA 4IQXA 1N0UA 5J2QA 3FSYA 2OTJS 1Z6RA 2O8DA 4DR6K 3KLFB 3JSMA 1CQNA 3GCWP 2ZH5A 5DDOC 4A8WA 1U6ZA 2R7QA 2R7XA 2XMJA 3UB5A 1R89A 2ZH9A 4JHDA 2NXNA 3C46A 1RBSA 5ADXA 3VGVA 1B64A 3KNGA 1HW9A 2KRRA 3ZNJ1 1NSQA 4CK3A 3Q23A 4QYZK 2OPSB 2CG8A 2I38A 3HKWA 1XN9A 2YBVA 4YHHK 1YBUA 4TYAA 3U6FA 3F9MA 4OI6A 2DPIA 3FZMA 1YRUA 4C8YA 2ZM6K 3ULEA 3ISNC 1YSJA 4GKJK 1UP1A 3M6UA 4LSZB 2HNYB 2IM3A 2A41A 4CO1A 3GOIA 2R42A 2ZH2A 4I68A 3M5RA 2D0BA 1D4XA 1IBKF 4X4RA 3WBZA 1VIOA 3JB9k 3R1LA 2HNDA 2NLXA 1NLKL 3SDEB 1F2GA 1XMBA 2YNHA 2QGFB 3KLGB 2XSJA 1QE1A 1BMQB 4JK8A 2VG6A 1U1PA 2V52B 2L9WA 1Q86T 2NZCA 5A2QO 2BOAA 4J9QA 2Z1GA 3PKMA 1G1XA 5KFZA 4LT6A 5KFTA 5E0OA 4PRFA 4GO5X 4JI2K 5FRMA 2QM1A 4ANEA 1C6VA 3WXMB 2CQ0A 1JJHA 4CDIA 1V3ZA 5DQIA 1JLQA 5EX0A 3ZCMA 1KCFA 5B08A 4KKOA 4IDKA 2A3JA 4FZZA 2IYIA 1L3VA 4DTNA 1SB6A 3CJCA 4BC7A 4AH9A 5HQLA 4OVLA 1WSGA 3TQ1A 3EGVA 4DPUA 1S9GA 3MI7X 2QG9B 4MKYA 3UKUA 2YKMB 2DNKA 3NCRA 3OL9A 1U1RA 4HYKA 4FPBA 3B4MA 2HHSA 1YF5L 2YX6A 4F4AA 2F9TA 2M70A 4DL2A 4K2XA 1FWKA 4PEOA 3A8EA 4Y00A 1A0OB 5CHIA 1K8KB 2GWJA 4KO0A 1TL3A 4NYNA 4F25A 4A5BA 3BKFA 3N9UC 2A5XA 3VV2B 3FEZA 3BEXA 5H9EK 4K0KF 5BR8J 2V4JB 3ZZOA 1YX2A 4Q2LA 2M88A 1GTHA 2H9ZA 3H40A 2GEMA 3C6TA 3K2YA 3SUQA 4LFCK 3PUFA 1RZMA 2J9EA 5M1PA 4MK8A 2DGUA 3UE2A 2DNOA 5H9FK 3MM5A 4U96A 4IH7A 1N0VC 4O5FA 1I1GA 4ILHA 4U95A 4BVOA 1HIYA 2RQKA 2LP4A 1VSMA 3A3NB 2D74B 2UXDF 1YTYA 3NE6A 4ZPBA 3C14A 3AVAA 3VWSA 4WE1A 2JLEA 3CMAN 3OYEA 2V34A 4PPZA 3ZT3A 3J7YI 4PKIA 1SBRA 4DR7J 5H1SQ 1PILA 4DEZA 2HLUA 2NRRA 2VDIA 5F0WA 1GLEG 1FRMA 2DHGA 1WHXA 1UEVA 4KHNA 4B3MK 2HFNA 4ECRA 2C22A 2IMWP 1FT8A 2G8VA 4I2PB 5LL6Z 4FCYA 3CGIA 4JI4J 2GJIA 2ASOA 1DGKN 1K1QA 3IFEA 2MGZA 3L4BC 2HVEA 4KIAA 2ZITA 2PFUA 4WPAA 4F26A 3IAS9 4LIWA 5AE3A 5IFMA 3J7AP 3W65A 4DCOB 4DR3F 2ZZTA 3DXBA 2JNJA 4O0NA 4A8OA 3TTCA 4PWDA 3ENVA 1FNXH 3RR8A 2XY8A 1K6YA 2GGPB 1MMLA 2CQHA 3IWNC 2NZ4A 3U9ZA 3MCOA 3QETA 3SV4A 5E26A 4U6PA 1VC5A 3M2UB 4J9LA 3IKMA 3VGMA 5HJXA 1ILYA 4QWDA 2PEHA 4HTLA 3K5MA 2RN2A 1K73O 4FLXA 2X7IA 4K25A 2ZBPA 4CGIA 3QEVA 2Q2RA 4DJBA 3DGPB 4CLUA 1FVQA 2ZZMA 2NUHA 1RT6A 5KGWA 4F2RA 1VSEA 2A1RA 3K89A 1EJ7L 4DR7K 3FK4A 2RMLA 5JLHA 1DARA 3NGUA 2V4RA 4ZVQB 4ED6A 1SC4B 4DV1J 3CXCM 1RT5A 4FP9A 3P49B 4CZCA 3FCHA 4FJMA 3HFKA 4QPXA 3THYB 2OH2A 1Q4RA 3F2KA 4H0VB 4ZKAA 2E2QA 4NLOA 4KHMA 5A6WA 1N88A 4WP8A 2Q0UA 4FSVA 3G6ES 2AGQA 3QFUA 4A8FA 4JI3F 3BGOP 1P27B 3TQEA 1S1UA 4C1NI 3RRHA 3HP9A 3SUNA 1N36F 4BHQA 3QMQA 2HVDA 3CO9A 1O0PA 4X62K 2J0SD 3GJSB 1PC5A 2JFDA 4B9UA 1GXLA 1WAFA 3LP0B 4X66J 1P6TA 2IS3A 3C16B 4J2BA 4PCQA 4EO8A 3OHRA 4ZIWA 2HIYA 1L5UA 3R5AA 2YQ0A 1VQ5N 3THXB 2P9CA 2NQPA 3M4XA 1KLMA 2VG7A 2AA4A 4DV1K 2GIQA 2YCHA 2NXEA 3S1TA 1RT7A 1I94F 3Q8PB 1KP6A 4M41A 3UQSA 5IT9U 3ID6A 4MDAA 2EVZA 4FF4A 3ZC4A 1RJJA 3GB0A 3M30B 5TKYA 4ECQA 1ZAVA 4BC9A 3PIOQ 1JL1A 4YQWA 2BQ3A 5E7OB 5KFAA 1IKYA 2ZUAA 1S6QB 2HPUA 1NGCA 2IJFA 1UWAA 3M05A 4HHTA 1VQ5S 3VF2A 3VOVA 4OLAA 1LAVA 1VK0A 1PJ5A 4E7IA 3OT9A 2ZF5O 3EYZA 2NYHA 5G4DA 2CIMA 3V4IA 2ZD1A 4F9OA 5T41A 4PY5A 3OFEA 4RBTA 4Z4CA 2B4VA 4ISGA 3AA2A 3VQ8A 3LOUA 2OELA 1SIWB 2E9TA 4AFFA 2IIHA 2KB2A 4KJIA 1TFYA 1OPZA 1Q53A 3IC1A 1HNZK 1MNEA 1VQLN 3VAHA 3KK2A 4TVAB 5D0HA 3AO3A 2QYCA 1DTTB 5ETOA 1ZM2A 1SJ3P 3CYMA 3OPKA 1JCEA 4GVBA 2NRTA 2W8KA 5C12A 2WAQD 4RJVA 1JJCB 3H2VE 1F60B 3QICA 5CYMB 3ILOA 4JKEA 3PW4A 2CPIA 4CLYA 2JJ4D 2IVFB 3UDEA 5F0XA 1A5VA 2VDHA 1M5SA 3T1HJ 1W7WA 1HNIA 4WQ5C 1T9XA 3CJKA 4QWEA 1VQLS 4IWVA 2GQQA 4OX9K 1HR0F 3K0JA 4EBEA 1CULA 2FJVA 5D4PA 4BDYA 5KFSA 4A8SA 2DH8A 1CEZA 4JKDA 1V9OA 3BGRB 3US5A 3MCNA 3UVJA 4PXBA 3LP1A 1NM1A 1MWMA 3MFIA 4LREA 1MROB 1TKTA 4C3KA 1KC8T 2JLGA 3LM2A 2WTFA 5J2PA 4AM7A 1VQ7N 4USHA 3AVLA 4M95A 3OTOJ 1G3OA 2KW4A 2B5JB 4EHTA 1RTIB 2MZTA 4R8UA 1NPKA 1BIUA 3K0SA 4M45A 4S0MA 3QIDA 3WEEB 5LXYA 3OA9A 1HNXF 2LQJA 5AQWA 1FDAA 4USVA 5DQHA 3D0PA 3TO8A 4PPDA 2OUGA 3PR4A 3SBGA 1XERA 3MPVA 4OHVA 1S1TA 4K5RA 2W40A 5KPRA 2QC3A 2Q43A 5CA5A 1VQ7S 3HSJA 3OY9A 4O4GA 3MCMA 3PZPA 2FBXA 2BW7A 3DDNA 5I3PA 3UR3C 2DITA 4YR0A 1VQPN 3UCZP 5CZXA 5KFLA 4ITSA 3AODA 4R79A 4NOHA 1J5OA 3AQPA 5M2UA 1WNEA 3RB3A 4IRKA 1CZBA 4OGEA 1T9YA 5I3UA 1NJWA 3DRSB 3K5PA 3PW5A 2RHKA 3K5LA 5JVHQ 3ZT0A 3DXKB 3BGUA 1JMTA 1BDGA 4NMLA 2OEKA 3C6HA 5KFGA 1KQGB 5AXLA 1VQPS 2RJZA 3TEHB 3MM7A 4U7BA 5CZ1A 1WOQA 2QV6A 2Y1JA 3PIOL 4OPKA 3MCAB 2ZHBA 4RNOA 1TUVA 3HSGA 4CZHA 1A6LA 2O67A 1VAZA 2AWZA 1W2BR 2MZ1A 5LJVA 3FVYA 2E29A 4LF6K 4BR4A 1RP5A 3N6MA 3H1VX 4P72A 3NL0A 1VQ8S 2NRWA 3WNEA 3CB4A 5JMVA 5KFFA 4WKRA 5AJ3J 1Z2ZA 1N34F 5KOXA 1NGEA 1ZBFA 1NUEA 3QLHB 1CS4B 2DT9A 4CZIA 3CD0A 3GMGA 2YJEA 4Q43A 2PE8A 3VF4A 4FPIA 1S49A 2X74A 2KT2A 5CYQA 3IR7B 4NI2A 1U1NA 1B7FA 4I9QA 3IR5B 1LXNA 4OI0A 3SQGB 1WHYA 3TUZC 3RAXA 1X4FA 5HOOA 3QRPA 4USKA 2UUAF 5IC4B 3H1QA 2J0WA 1U25A 2E7WA 1XMQJ 4ISFA 4IEEA 4OV1A 3P39A 2XMTA 4OYXA 4DR5K 2HFSA 3T5LA 2HBJA 3J81Y 1ATSA 2E1AA 5B0DA 4RW4B 3KG1A 3C15B 3BSCA 4PUOB 2L3MA 3T1YF 2RDDA 2NXCA 1IBMJ 5K20B 3PVXA 3A5MC 2QZ8A 3U4LA 1S1WB 2E1YA 2KRBA 1S1VB 4YY3K 4CLZA 3RW6A 3SYZA 1HARA 5IC6B 5CAAA 3DLEA 2IYGA 2WW8A 5E2QA 1JXVA 1M90O 1Y00A 2OHDA 3RAMA 4NCGB 4NLDA 3QJJA 2CJ9A 5RUBA 3KIOA 3FEXB 1KQFB 4Z94A 4BRQA 1N6QB 1HNWJ 3AHPA 2A1SA 3TVZA 1EETB 3SSSA 4OYPA 3L6QA 1IG9A 3IS9B 1TAQA 3ATVA 3V9SA 4F4ZA 3NG8A 2OEJA 3D45A 1A5WA 1MWQA 4JV5F 1C1AA 2WOMA 4LF4K 3G71N 3J81O 1WAJA 1Q9YA 1W26A 1KVAA 4DX8H 3ZZTA 1KNZA 4ZPDA 2YKAA 2UXCK 4P7TA 4YDDB 2XZTB 3GIJA 3SCJE 3NGIA 2HNZA 1OQ6A 4CJRA 1FO1A 1WELA 1VOMA 1U04A 2HG4A 1F9HA 4DV2F 3OR2A 5IT4A 1NJZA 4NXMJ 1X5PA 3O9UA 2C2EA 3FE1A 3V6KA 5LT5A 3G71S 4CJUA 3DI6B 3KK3B 1HBUA 4NYPA 5ETKA 3K7RA 1RT2B 2CJYB 2OFHX 1M5PC 5IOLA 4PKHA 3GE9A 4ZPWR 5BN8A 2PY5A 1T3NA 3NDKA 1QUPA 5JVHL 4ECXA 5D4NA 4USIA 1VRTB 5AQVA 4CEDA 4JYAK 4EFHA 2NSBA 4YB1P 4JUZA 2ZVIA 4DFMA 2IVPA 4R25A 3ICLA 4YB6A 5DZ6A 3O08A 2K2PA 4OHZA 2VGMA 3TEGA 2YHBA 5CR4A 4C0HA 1U47A 2CGLA 4H03B 3ZETB 3LDLA 3M8PB 5FLXY 2W4DA 1H74A 4M3WA 3QIPA 3V1QA 4FWMA 1WI8A 3AFGA 3DRPB 5M1KA 3TJAA 1U2RA 1U49A 2BJ3A 4CGFA 2HRTA 3FNNA 4CECA 3QBCA 1HKBA 1J5EF 4P7VA 2LXUA 1TKZA 2KG0A 2D0PA 2DXFA 2Y9HA 5L1IA 1SUQA 1ATNA 1V3SA 1QAYA 2G0IA 4NPOA 4KPYA 3F56A 5DS7A 1VK8A 5EOYA 3DLRA 5B0GA 1RTHA 5CE3A 1CJKA 3KHHA 5F8HA 3FBCA 4NLUA 4A46A 4UZCA 2P9PB 4NXMK 4TY9A 2IMOA 3VVUA 2UXBK 4PG5A 2QO3A 4NE9C 3R2DJ 4CFBA 1BGXT 2L41A 4M1KA 2OD6A 1LWFA 3TUJC 3C6AA 2DPNA 2B6AA 2JFKA 4NLGA 4LY7A 4FYVB 5FLXO 2AYMA 2CPEA 3AD9C 3DRRA 2MQMA 4DV7F 4JN4A 1E3MA 4O3RA 5BYQA 5KFWA 3U02A 4CO2A 3T41A 2BJ7A 2UUTA 3OR1A 5IV3A 2FLPA 4KI6A 2HHHK 3NCPA 3P5JA 4DV4K 4DUYF 1BWFO 3ADAC 1TUGB 1S3XA 5K8NA 4DFPA 5C25B 2W24A 3QRRA 1LW2B 2QFJA 4C2MA 3DLGB 4JI7F 4KE5A 4BR7A 3ZSZA 4OJ3A 1S0VA 2ZBIA 2L9NA 1NJIT 4CZJA 3KD1E 2FC0A 2R8HA 3CCEN 3PTWA 5AZJA 2BXJA 1NB7A 1TU0B 2QI2A 2DR5A 3IAYA 2ZFHA 5AQSA 1Q7YT 1W97L 1BL3A 2VBXA 4O44B 3ZEUB 2VL1A 4WJBA 2HF4A 4B9VA 3MEGB 1D1UA 4DR1K 4JI5K 4UOGA 3CCES 4OYBA 4QR1A 5KG3A 2ZH3A 1X5OA 3IGVA 4WXOA 5DZ7A 4LC9B 3QZ7A 4DV0K 5ETLA 4AYBD 4ZITA 1XK8A 3CT9A 5A0YB 4WFBQ 1FA0A 2COLA 3I32A 2ATQA 1HBMA 3CJQA 3AO4A 4IH6A 2M5YA 3JSYA 3HSZA 2JEJA 1D8YA 3I4PA 2AHOB 5F8NA 3TUPA 1RT3A 4AT1B 5LMNK 3R7NB 3MFHA 3NNHA 4FF1A 4I6MA 1EXQA 4CJ5A 3ELHA 2W8LA 2KFNA 4ECYA 3LWLA 2ILZA 9RUBA 2BUNA 4DV5F 3MWBA 1C0TA 3PJWA 4FWNA 3BN4A 4CH7A 3A8KA 4DTRA 2PI4A 5E3RA 2YWEA 3VEZA 3CJ8A 4KSEB 3MMBB 4LBIA 3WC2A 4UQTA 1X4DA 1N56A 2FHOB 4LH5A 1C1CB 1E6YA 2UUBJ 1EO1A 1OMSA 3HHEA 1U7LA 2MJNA 2LSNA 4W5RA 2UUCF 3DOLA 5L8RC 2E5LK 1SPBP 1YJVA 1VIXA 2LXIA 3NGKA 4P2XA 2RRAA 4G9ZA 2IDEA 3JS9A 2BYCA 4BE1A 3M8YA 1EWQA 2CRLA 2GHVC 5T7LB 3NY0A 5K8PA 3RB0A 7AT1B 5M2RA 4HI1A 3CJSA 3FLCO 3VHQA 3WQPA 1KWMA 2FJDB 4JD2A 2B7CB 2RT3A 4Y1DA 2YH1A 1U8SA 1WSJA 2NYIA 3QSYB 3GFXA 3GSDA 3UNYA 5HBMA 4A57A 2W9CA 2CPJA 5HROB 3G9CA 4GKKF 1WI6A 2YNIA 1EHWA 2RIJA 2DNMA 2DNRA 1HNVB 3R2CJ 4ES3A 1WC0A 5J2MA 2RPIA 1NK4A 3FCWA 1FJGJ 1GLCG 3GJQB 4BRKA 4CT9A 1EP4B 2IAJA 4FZYA 1VBZA 4FLYA 2FJXA 1TVRB 5HLFA 5DM7Q 1M1HA 4FS1A 1HD0A 3CJ3A 2V6AA 1TV6A 2LEAA 5EUHA 2VV5A 1RB0A 2EG2A 4J9OA 4EUVA 1X0PA 4YR2A 4XDDA 4QR0A 2UUBK 2J7WA 3LDPA 3GYNA 2HQ3A 1RAOA 4C8OA 1NU4A 4J9SA 2HF3A 4RW7A 2Y1IA 1YZ7A 1NPRA 2ZVSA 2FSJA 4CJFA 2F8MA 1SZ2A 1S10A 4V19X 2Q0RA 1BQXA 1BU6O 3W61A 4HDGA 1JIHA 4JS4A 1AA1B 1NU0A 3PO4A 1QD1A 2ZZNA 2IDOA 3E66A 3F9KA 2N3OA 3G96A 4G1QA 5GADU 3IR6B 1K9MT 4X65F 4JI0K 4IKAA 1NK0A 4IO9Q 3HYFA 3TYTA 2CWXA 5DG7A 3IO1A 1LOUA 2F8EX 1IBLK 3H0PA 4FVMA 3MOJB 3MM6A 3IP0A 3M3ZA 3NS5A 2IVOA 4FYWB 1DLOA 3M8ZA 3JAMY 2XM3A 3D7SB 3H8YA 3CD5A 3M8QA 1IQTA 2YNFB 4UOCA 3TAEA 3BZQA 3EZUA 4CO5A 3BV8A 1SXLA 1FI4A 3J7Z5 5M1FA 2WVCA 3B6OA 1URNA 3MUVP 1IKWB 2KXFA 2CZVC 4WFBL 3FZ2A 1SKUB 3S3OA 1D9DA 2G0CA 1ZZNA 4UY8O 4K41A 2RS2A 3VA0A 2WSCC 2KXHA 2QWRA 4NXNF 1TKDA 1C0UA 4AF1A 1BA1A 2LU2A 3A5OC 5C2DA 3EN9A 3HJVA 2UYTA 2PSZA 3ASMA 4USWA 4JS5A 2F9DA 3L2UA 1DBDA 4KR0B 4M5LA 1G15A 2CGJA 1N48A 4GKJF 2ABYA 1QY7A 3ENAA 2QLWA 2H54B 3MMAB 4OX6A 2FHKA 3RZAA 3L2VA 3THWB 3NWGA 2BR0A 1YJ9N 1JKHB 3G6XA 1GMUA 4LVNP 1ZZFA 3AO5A 3ITHB 4OPJA 3U3GA 1KC8O 3DYAA 2NXUA 1U1OA 3EMTA 3F41A 2VFSA 3LP2A 5CCLA 2XLIA 3A0IX 3SUPA 3Q86A 2CZ9A 2QLJB 1NMEB 2VOPA 2P9IB 1WKKA 4CJWA 4FDFA 1H0HB 2GVDB 1NK6A 4RW8B 1VQSA 1VLYA 3Q2TC 3AT1B 1YJ9S 1RYSA 1REVA 3MAAB 3CPEA 1U1MA 3W60A 1EKEA 3HI0A 1SL0A 5E3QA 2E7VA 2V69A 1M5KC 1NG9A 2W6LA 4CJKA 4M3UA 1RLDA 3L2RA 5C2CA 1QQOA 1TL1B 4EFAC 1AT1B 4ECUA 3HHLC 3ZZPA 4NYZA 1GLJO 5LM7E 4UTGA 2HKEA 2MKKA 3NF7A 4WK1A 2M4MA 3V9UA 2BGGA 4CEQA 4P2MA 1ZC6A 1HQUA 4OL8A 2P5VA 5KFDA 3H3OB 1IBKK 5DM7L 5HVGA 2O8CA 2NSCA 3E9PA 2D69A 4X64K 5KFVA 2OZSA 2VBZA 5SWMA 1Z1ZA 2D1KA 3S3NA 4H4KA 4IUFA 3QO9B 3PXGa 2D3ZA 4IJAA 3RSEA 3BPSP 2NNWA 3AO1A 3WX4A 1EQ0A 3KHRA 1S9FA 4B8AB 5AZIB 5ETMA 3NOCA 1S99A 1N32F 3IMXA 1O6XA 3HXMA 3FZKA 3I0SA 3R1XA 4PYDA 3ZT2A 1OH7A 1F21A 2CWKA 4LIRA 3VQ9A 4OYZA 2Z4PA 1FDDA 4LF7J 2X1BA 5B7WA 5GIPA 2RUGA 3J7A1 1KTQA 3C19A 4I7FB 4I4BA 4M94A 4WZMA 3EL2A 2NCKL 2FHJD 4ILGB 4LFBF 2P9NA 4ETXA 1NGHA 3JQMA 1XNRF 4CEOA 4CZFA 2FB0A 1RDAA 3RUBL 3NXZA 2E6LA 2H4YB 4EP4A 2VPXB 4IO9L 1P8ZA 1OH8A 3IN5A 4R5PB 3PFOA 3S9HA 3BF1A 2RD5C 4DPOA 1X4GA 5DGAA 2VGNA 3DLBA 2IPOB 2VZ9A 3N01A 1HWIA 1KKHA 5EWEA 3CO0P 1FKAF 4P2FA 5GIOA 2C3YA 3VVTA 1XNQF 3VMFB 3QESA 4EK2A 2E5GA 1T6DA 3CJ9A 3MR2A 4O3PA 3MM9A 4E1NA 1TMJA 2Q6BA 4CT8A 5AQFA 2AYGA 3BZKA 1EKSA 4K0KK 3M6VA 4L3NA 2ERRA 5K9FA 2GX8A 3H7HB 5HAOA 2HS0A 4YUDA 4QYRA 3VR1A 4CD3A 4JI1F 2FSKA 3BKTA 3ZZRA 3LL3A 2UVVA 4JV1A 1TYQA 1AUDA 5E84A 4O8KA 2JWKA 2F8TA 3SMZA 1RWMB 3QNOA 1SC6A 1YBAA 1KDNA 5CCMA 3FDSA 1JLBB 5C24B 2AU0A 3PCOB 4NZ6A 1UVNA 4OPHA 2UXDK 1JLEA 2E4LA 4LFAJ 3SSRA 3BREA 3VEOA 2ZGZA 3B54A 5LMUF 4FK4A 2WB4A 3QT8A 3AVKA 2YPZA 4ZCLA 1APSA 1GNKA 1ZTTA 4NB4A 2P9SB 3ENQA 3VALA 1UA1A 1FE0A 2DNZA 1WACA 5HVFA 2F40A 1BIZA 1HHSA 1PC4A 4WCEQ 4LR9A 3V9XA 2XCAA 1TUUA 1NMNA 4IFVB 4Q8FA 4FYDA 5CH7B 4XPEA 3CCUN 4I2QB 4E7LA 4OKEA 1ELOA 3CJRA 4JI3J 1XJWB 2HMIA 3NNCA 4KC5A 2V68A 1WUAA 4OZNA 1NEEA 2XI3A 1NCLA 4DR3K 3KLEA 2JSXA 2CNLB 1XR5A 2Q66A 2Q36A 1FW6A 1NMDA 4BRPA 2WHOA 5AFUA 2M52A 2I2YA 2GAGC 4BCAA 2CXEA 4CJ3A 3TSQA 2FDNA 1KVKA 3PACA 4RW9B 3L2WA 1FXXA 3MEDB 3CCUS 5LJ3Y 4AXJA 4FN5A 3D2EB 1X0FA 3OFHA 3HL8A 2AGOA 1UVMA 4N5SA 1NK9A 1EKRA 1JLCA 3ZSQA 5B0AA 4E2FB 3AOCA 1RBLA 2DRAA 1E4GT 2RDJA 1HKCA 1JLAA 4LF5K 2FLOA 1RBRA 1C1BB 3LGNA 3V81B 2BBEA 4HTUA 1VHXA 1WN7A 3P1GA 4ZP7A 2QTDA 3N4PA 1S4EA 1KS2A 2CFXA 3CCJN 2KFZA 2KU7A 2M8DB 2B4OA 1QVFR 3A5LC 3DXMA 2Q3SA 2YV0X 3S7RA 2I1RA 2WW4A 3LDQA 4USJC 1FFSB 3CJ7A 2VG5A 4DTOA 1NBWA 3QFHA 3Q22A 1DURA 2LVWA 5L39A 4DV3J 4JI3K 4G6VB 4Q7AA 4DHVA 1IKXB 2OPQB 3NOGA 4FYYB 5ADZA 4B3OA 3TAMB 1T02A 1N36K 2BE9B 3F5TA 3OYIA 2RVJA 3CCJS 3O9SA 5GAGP 3D1QA 2MJUA 1LNQA 4DF4A 2HFZA 1UFLA 3CCRN 3D2FB 1JQGA 2P51A 4ZVOB 1FJ7A 1KAXA 3L7PA 2QWPA 1N8RT 3RB4A 1JK9B 3H98A 2LFVA 2UU9J 4C4WA 3VQ5A 4DQSA 4JKBA 4MJKA 2E88A 3CDAA 3Q8QB 1Q95G 5IM0B 2O4IA 4EZ6A 2VKZG 5KPZA 3VESA 1WHVA 4BG8A 4DUZF 3EPGA 3CCRS 2WVBA 2UV8A 2XWYA 4JBCA 1D9FA 1I94K 3UPFA 2J9DA 2HSEB 2GVZA 5HRNA 3R8EA 3JSRA 3MMJA 4DLEA 2Z2YB 4N41A 4DR4K 1HR0J 5F8IA 1NDKA 1XQSC 4LMZA 4KH5A 1ACMB 1NKCA 2MQQA 1RGIA 4QZVB 3SBMA 4FO0A 1TL7B 5IWAF 2MLYA 4OKJA 1NOZA 3L4QA 4CGDA 2HB5A 2DNNA 3R5JB 3CM6A 2ZH6A 3QZ8A 2F8SA 3KVGA 3RBEA 4HL9A 4P73A 2EI5A 1LFPA 3D28A 4WCEL 3TPQA 3H4DA 4Y1CA 2XMWA 5B09A 3M1VB 3MR3A 2I7PA 2W9BB 3R7BB 3MR7A 5T7BA 2WBNA 5D3GA 2HZAA 5F9LA 1X9WA 4QS9A 2B3TB 1RADB 2MHNA 1VS3A 2A10A 1TKXB 1VQMN 4CBXA 5DLFA 4F50A 1REGX 3UFCX 1NGAA 4GC6A 5M1QA 2LCWA 4DSEA 3KK7A 1KHWA 4DPYA 4CBUA 4ERDA 3ZSOA 1J9AA 2GV9A 1FD8A 5KFMA 2IBKA 4W92B 3TZWA 3LGHA 5T14A 4B1YB 3CJTA 4PHTX 2G8KA 4ATNA 1ZBTA 1NH7A 1X4EA 2DNLA 4H54A 4C3MA 3FQLA 3R6MA 3ZSRA 3W5YA 5HP1B 4L72B 1HR0K 1VQMS 4KB0A 1H73A 3RG6A 2ZBQA 4P6QA 4FBTA 3A2FA 4FZXC 3AB2B 3JTOA 3HBTA 1JLFB 3BR9A 4FS2A 2IVYA 3FKBA 3CCQN 1JXEA 5J2QB 3GL1A 1OQ3A 3KJFB 1N5YA 2YQ3A 5DRKA 4CJLA 3D6HB 1PBAA 4JHDB 2GC8A 2UVRA 3O44A 1PJ6A 2F4VK 4FNIA 4O5BA 3I31A 3ZTSA 1HFEL 2E2PA 4F3OA 5THWA 1AYEA 4QOTA 1KQSM 4FLTA 1OY9A 3W8GA 3CCQS 2RUSA 1K8KA 1HNXK 4B3SF 2DCLA 3MDFA 4MK7A 3ULEB 2KXNB 1FF2A 2EFPA 1HYVA 2GZOA 1M1KO 2ATCB 4K4TA 4IFEA 3BF4A 1UCNA 4X4SA 2P9UB 3I8BA 3Q8VA 2V4JA 5F3ZA 2GWKA 2GQCA 1TUYA 4JI6J 1WORA 3N5FA 3WNHA 2OEMA 4HLBA 2HNDB 5HK4A 4V1Ak 4CLLA 4NEYA 2YNHB 3PEHA 4KV8A 1RHQB 2BKNA 4NLQA 3BQ1A 2E1MC 3EICA 2XSJB 1QE1B 4M5JA 2RRBA 2F63A 4Z7CA 2VG6B 2E9ZA 1QSSA 3AOAA 2VC0A 2J7UA 3HSTB 3BBCA 3IBWA 3GG4A 1WDTA 4FJ7A 1OSDA 4MDBA 3NGYA 3H6EA 4BRHA 2JHEA 5KT7A 3CQXA 3CNQP 2UUAJ 1C2PA 5KFCA 3CFPA 4DU4A 3GCXP 2H51B 2QE5A 2IOCA 2V8GA 4ZVPB 2E8AA 1XHZA 2A18A 4DSKA 2EWSA 2HHPA 4MLHA 3CFRA 2KJVA 4BGBA 4ZLNA 1RTJA 1OWXA 4FJKA 4XPCA 3HVAA 1Y9OA 1SKWA 1U6FA 3BY5A 2ITMA 2HK2A 1GFWB 1S9GB 4KAIA 3UKUB 2CJAA 2N4DA 1CXQA 2RHQB 1LKZA 4CI0B 1QTMA 5SUHA 4CFDA 1R8AA 4B3RF 1Q78A 3L09A 5D4OA 4ECSA 2BVZA 1FTRA 4DX6A 1N34K 4CEBA 2PN6A 1JNZB 4B1VA 3QQCD 2PC6A 2V7YA 1VQ9N 4KO0B 4NL5A 4PKDB 3P4UB 4CF8A 3H5YA 5KG4A 2XG8A 3NGZA 3PY8A 1IKVA 2BJ9A 3NH1A 2FZCB 1BO5O 3FRZA 3VENA 2CVIA 5EGYA 4KH0B 1HWUA 4PXDA 3ZX0A 2I5JA 1T0TV 1CJTA 1U2CA 4A62A 7FDRA 3CJ0A 3VGTA 1RCXB 3W64A 1M5HA 5JS2A 2UUAK 1NM2A 5BPMA 4RUCA 1S6PB 2EKNA 2C2RA 1KEKA 3O3GA 2M7SA 3QWUA 1VQ9S 1BXNA 4BC5A 4L74A 5KG2A 3C14B 3OYLA 2W41A 4WE1B 4ZJLA 5EWFA 3RR7A 3EE3A 4B3TF 4CIGA 2MTLA 3N0VA 3GIIA 1GLFO 3I33A 4TU9A 3CPWM 3T1YK 2Y3YA 4JI8J 2XQCA 4U9RA 4FJIA 1WOPA 1SC3B 2YHXA 1VQKS 4AXIA 2R7OA 4DR2J 5A2QU 5D77A 3PYGA 2AJ2A 4MIBA 2LLZA 2C2OB 5HO4A 3GBTA 2FJBB 3KMQA 2B9YA 1X4CA 1BUPA 3PDNA 2MGZB 2Z1JA 4YB5A 3N4QA 3QMLA 3MF5A 4OHWA 2GTDA 3G6VA 3TTFA 4MK9A 3BBBA 1FKOA 2WSFC 2EBEA 4NZ7A 4PWDB 4J90A 1QVGR 4JV5K 3UW1A 4MFBB 2JLFA 4OI1A 4FJ5A 3HOTA 1GMWD 1VR6A 2DHXA 1S9EA 3GSIA 3DMJA 1SH3A 3UCUP 4KH6A 1T9TA 3MN9A 1TR0A 3SCKE 1ASUA 2L08A 4ILMA 4FM2A 3HHKA 1VCTA 4OX7A 5B0FA 1V5VA 3KDNA 4DS5A 3QEPA 4DV2K 3CWJA 5AT1B 2R7VA 3VGKA 4DQPA 5BREA 2AV5A 1RT6B 1LEOA 2OJ3A 2QW9A 3G8SA 4ZVRB 3GFZA 4NLWA 1WKJA 4GO7X 3ZX2A 2F7TA 2DRDA 1CJUA 1RT5B 4LJMA 1N52B 3AH6A 3BKUA 5JMNA 3TZXA 2FBTA 1XIQA 3H2UB 2BV3A 1Q0NA 3OFGA 4I0WA 5HMXA 4WFZA 4M8LA 3JQJA 2GJFA 3NS6A 2DHHA 1ZA1B 4C8MA 1NSPA 3VEVA 4FKXA 3W8PA 1S1UB 2OTLS 5I42A 3OUYA 1HX1A 4F04B 5KT3A 4DCPB 1H6KX 5D15A 4BLGA 4BQLA 3HZEA 4LF8J 2AX0A 4JI7J 1NGGA 5KI6A 3MAQA 1DTTA 3O3FA 2GW8A 2Q1LA 5GADI 4DV4F 2VWBA 1RILA 3H2LA 3ZZ0A 3HPHA 4J9PA 3J80O 1J5EK 3K5NA 5IQQA 2KKHA 4CYUB 1VQON 1UVKA 3LZJA 4CGJA 4IO1A 3WIUA 1X4HA 1JNRB 4AQYK 3PG9A 2IA6A 2FPHX 1T44A 5BYRA 4DWIA 1PYTA 1EZZB 4MKBA 2W25A 2DH9A 1L3UA 4OZ1A 5DDQC 4U7UK 1UVIA 3W9HA 2I8EA 2MZSA 3QFWA 2CNKB 1KLMB 2VG7B 1YTUA 1NK5A 1RT7B 3TZYA 3MD1A 2RQCA 2AEMA 3R3LA 3NBPA 2CUYA 1VQOS 4CO0A 2R4FA 1GLDG 2MXYA 1YTAA 4B8CA 3IA0A 1AFJA 4DV7K 5CD4H 3RMBA 3AVBA 1RCOB 3JXUA 5CY4A 4DU8A 4K43A 1MROA 1Q8KA 1DFDA 2HMPA 3NEKA 2QWMA 3OLAA 1IKYB 4F0HA 1B0PA 4DV0F 4OZLA 3UWTA 2R7SA 3CJ4A 3VAGA 4C9DA 4DUYK 3ISND 3I0RA 3AVHA 4M3YA 4J9RA 1ULRA 2PMWA 2EC2A 2GJ2A 2Y8YA 1ZAXA 3CDBA 1FX4A 4IOCQ 4JI7K 3V4IB 3CIZA 1EQMA 3D2WA 3TNVA 2PMZD 2P9LB 1YJRA 1YDLA 3P5TL 2MQ8A 1IM6A 3AAWB 2AZ3A 1G7CB 3SV3A 2IBOA 2UUCJ 4ZP8A 4C0OC 4ICLA 4RNMA 2WVEA 3EY1A 4YEAA 2G9OA 5FIIA 4AILC 1D8ZA 1YVNA 3KK2B 2NRZA 4U8YA 3J7YP 1NH8A 2HWTA 4MAKA 3GPAA 3PRDA 3W2VA 2C1EB 2DO4A 4FPRA 4QIVA 4GVBB 5LL6d 3ZT1A 4Y6IA 2B8QA 4H5WA 2P1JA 1ZOTA 9ATCB 3FZLA 4RW6A 3UIQA 3PKYA 4HVZA 3Q2SC 1RWNB 3LF0A 4LRCA 4DQIA 4N56A 1O5JA 4E7KA 2K3IA 2DXDA 4DV6F 4UY85 1VISA 1VC6A 3NKYA 5FRNA 4OMFG 1HNIB 3RMCA 4FWQA 3ZTQA 3CJKB 3Q8SB 4FJLA 4ZK7M 2DGWA 2MKJA 1WG4A 1CULB 3SK3A 3HRGA 4KGXB 3CF5Q 2R8KA 1KVJA 1I3OB 2POKA 3EO3A 3CXCR 3PW2A 2O8FA 1E6VB 1XMOJ 1RDUA 4LBPA 3ZO7A 3NH0A 4F3QA 3SEOA 2VQFF 4AUKA 1T03A 2B51A 4DV5K 3UVJB 4OYWA 4AHTA 3LP1B 2YKOA 4IKFA 1FWLA 1TKTB 3MN5A 4ISEA 2B8PA 3I6PA 4GV6A 2DEJA 3D1HA 2BTFA 2N7CA 4Z4HA 1PBUA 3OS2A 3GV8B 5AQJA 4B1ZA 3O1BA 4LSNA 2UUCK 1DHMA 4JKAA 3UDCA 2QL9B 3S3MA 3HVWA 4R8UB 1RCHA 2XGQA 2KH9A 4IOBA 2M3DA 1G99A 2BANA 1N4LA 3BH6B 1N54B 8AT1B 4PG6A 3O8MA 2MY8A 2JOQA 4IFYB 3AVGA 1X5TA 2RKIA 2CQ2A 2EFOA 4A2BA 3GFHA 3KK1A 3SQGA 1U0HA 4DG1A 4O4GB 2IC3A 4E7JA 2FJEB 5L1KA 2OSRA 2IY5B 1S48A 4P9SA 3NS7B 5LJ5Y 4W5TA 2ZH1A 3W2WA 1U1LA 1J5OB 4W90B 4GKKK 5A8WA 5D4LA 1VQ4N 4RW4A 2FHJA 2O01C 5KG0A 1QLNA 3WXLA 3J8AA 5I3UB 2A2DA 3AY9A 1BUXA 3C94A 2DGTA 2V4QA 4OFZA 2Z2ZA 2W2PP 4DXLA 4ID8A 3VGUA 2OMLA 4DR6J 3AA3A 2HVHA 3JXOA 3DU6A 2HSTA 1S1VA 3PV8A 2EXUA 2W2OP 1ROFA 1RDBA 4NA1A 3AO2A 2D3O1 3L95X 3MM7B 3FFIA 4CNZA 3D0GE 1LOTB 3L4IA 2IM1A 2MKHA 3IM8A 3L7UA 4KHUA 4UOFA 4QYZJ 2HHTA 4DL7A 1M0SA 1PSDA 2VH7A 4YHHJ 3BP8A 1NKBA 4FF3A 3AJDA 2VA3A 5FD1A 2ZM6J 2MKYA 2CQCA 3FR0A 3CE8A 3VQBA 1RBUA 4YDXA 1R0CB 4IOCL 4GKJJ 1Q16B 2CYYA 3B82A 4AL5A 1IQZA 3AAQA 3TI0A 4NCAA 4UW2A 3I5CA 5CQGA 3PX4A 4UT4A 1CLFA 1FRHA 4Q5VA 2VPYB 4OIXA 5EXWA 3KG0A 3HKZD 4DPTA 3DM2B 1TFWA 1B70B 2XCPA 1HHTP 4GV3A 5CYQB 4X65K 2ETJA 1FEHA 1NZAA 2FBVA 4NI2B 3A12A 4Y2KA 3OJSA 2XMKA 2J9CA 4C7QA 4G3IA 4AM6A 4FVUA 4UUWA 1UKUA 1DJ0A 1Z2LA 4MO5A 4OKKA 2GFFA 4JI2J 3BPDA 3AAPA 5CZ2A 1VQNN 3CCTA 4F8RA 3WQUA 3OL8A 4EIAA 4TQRA 3RGIA 4JI4F 3NCQA 4KY3A 3CQYA 4CFAA 1F9FA 3NGTA 3TUIC 4NXNK 5K8OA 1M5VC 3VCDA 4WQ4C 2VB6A 3CF5L 2JC1A 2CJBA 3S01A 3DLEB 3TW0A 1OVQA 4FLUA 3VQDA 3V1RA 3NVKA 3K8VA 2HRUA 3AJ1A 3DRPA 1VQNS 1ITPA 3JS6A 2PGCA 1QVGM 2XNQA 3FCVA 5KFJA 3VA3A 4RTFD 1Y64A 3IG1A 1ESVA 4BRNA 1NHKL 2YWWA 4QAGA 2E66A 1T3OA 2PZSA 2JEIA 3GYGA 3AB4B 1VQYA 2XNRA 3F0NA 4X64F 3TSPA 3AD7C 1VHIA 1HPZA 4BROA 2HGLA 2WOMB 3GFYA 2BQUA 1IH7A 3HF5A 1ZPVA 2Y0BB 5H9EJ 3AVNA 2P9PA 4EBCA 2BACA 2B9WA 4ZOSA 5DJBA 1BHNA 4EHUA 4BRDA 3QBWA 4LFCJ 1B0TA 1F0XA 5FROA 5EVZA 2ZH7A 2EFGA 2XHCA 1X7VA 3B78A 5D0GA 5H9FJ 5F3TA 3TX0A 1MN9A 3ZTPA 4JRQA 3JSBA 1U8WA 4NLSA 5ETVA 4HCCA 4GW6A 5E5NA 1SL1A 1RSCA 4WZQA 3HVTA 1HBUB 2PT0A 2OCEA 2CQIA 1P8GA 1Q1KA 3N4WA 5K14B 4KHPF 4CZKA 3G6YA 1CZAN 4ELVA 5KT6A 3MPYA 4IG0B 1ITGA 3ZFVA 2E7XA 4B3MJ 3H4BA 4QIEA 2YTCA 5AQUA 3DLGA 5DG9A 1K0TA 3A1YG 2YHYA 5C2GA 4BR5A 2AGPA 1HPMA 1H3DA 2DFFA 4XK8C 3CIMA 2CPYA 2AJQA 3E01A 1M5OC 3RB6A 1N32K 2O4GA 4W5NA 5LOQA 1BQNA 3O9QA 4PG4A 3OHBA 2NRHA 3WHIA 3QIPB 2YXLA 4X66F 3KUEA 1TELA 1VGYA 2G1DA 4ID5A 1H7XA 3BDEA 4O44A 1ZM4A 2DNQA 2R2UA 1SKRA 3O2IA 5AQLA 1VJQA 3N6LA 4C8ZA 1WC6A 4DU1A 4M5IA 2HWHA 2KHOA 4FWRA 4Q0BA 1TKZB 3J7ZO 1RNHA 1FKPA 4JEPA 1SUQB 1NNDA 1RKIA 2CPFA 3LUYA 3BO4A 2XYHB 4EO6A 4LFBK 5AQIA 3SQ0A 3ZNUA 2MQNA 1XNRK 2DD8S 1RTHB 5CHCB 4L76A 3VPZA 3QERA 1JJ4A 5HL7Q 1QAJA 2A6MA 1RTZA 2QLFB 2QKBA 2MKSA 1VSJA 4XO0A 4ZTJA 4A4JA 3TAFA 3T7ZA 2O8BA 3KKSA 3SCXA 3KDOA 4JOUA 4J5OA 4QW8A 1TK5A 2V9KA 2DEIA 2B6AB 4OI2A 4IG3A 3J81U 2K8GA 5ETQA 3DRRB 5J1EA 4A59A 1XNQK 2ZE2A 4CJQA 2ASPA 3J7YU 1J6ZA 2KVIA 1L3TA 2RNEA 2K3KA 1QQMA 2BA9A 1S5ZA 2V8HA 2AJFE 2K7KA 3M1FA 4BR0A 2W1BA 4JI1K 3K2PA 4DPWA 1VYAA 2O8EA 1K47A 4CIEA 1S72N 3PHTA 3PW7A 3CQ8A 3MX2A 3BO3A 1VSFA 3U1NA 4X62J 4NRTA 3K57A 3BSAA 4YDUA 4BS2A 3ZSYA 1LFWA 2GUPA 3C65A 5AZJB 4CJ7A 5JICA 3MCPA 4C0BA 3ET6A 2WK4A 2DGVA 1R0BG 5LMUK 1IWAA 4J2EA 4C97A 3EDQB 3EGNA 5AXKA 3UDVA 3T1HF 4KHWA 5KT4A 1FK9A 3R3TA 4K4WA 4KTQA 5HROA 2GIRA 3HI9A 3G6EN 4Z37A 2A0FB 1S72S 4LF5F 4DQQA 3DHWC 5FJ4A 5ADXH 5AQOA 2WONB 3NAHA 3Q8YA 4BRAA 2GMHA 5J2NA 1WD6A 2MY7A 4F2SA 2W01A 2KJWA 4CZGA 1FDBA 2HBQB 1RBOB 1HBMB 4ZDNA 2HRYA 2K7JA 2RAQA 1ZBLA 3AA9A 1RT3B 3EXCX 3HHLB 3LO3A 3OTOF 2JL9A 4I6MB 3SQOP 1JB0C 3X1LB 2VHGA 4E8UA 1ZAWA 5KFUA 5MLCV 2RILA 1R8PA 3PX6A 3OBIA 2CQ4A 1C0TB 3RWUA 1X8DA 3SPZA 1GOCA 3OFFA 3V6DA 4LVOP 2D0CA 3MWTA 2MQOA 4LRFA 1E6YB 1HWLA 4KBIA 5ITHA 3BZCA 4CHZA 5FLXU 1O13A 4R0EA 4DQRA 1ZBUA 4ETZA 4M3XA 2R7UA 3HHDA 1HNZJ 4C8NA 1HKGA 2H3GX 1MN7A 2BE7D 3SAHA 1ZYQA 3OLBA 4IO8A 2ASLA 1DEJA 4RNNA 4NCBA 1KONA 3D54A 3EZWA 2GBZA 1NAQA 1VLOA 4M3RA 5AXMA 3T6JA 3RBXA 1WEYA 2DXEA 1HA1A 4FJJA 5JVGQ 1BI4A 3NGSA 4ZLPA 4IYQA 4MO4A 1YJ7A 1UW9A 5HBMB 2W9CB 4GVMA 1FXLA 4DR4F 4OX9J 3NP5A 2YNIB 2FGOA 5HL7L 1CG2A 4ANDA 2KM8B 4ZHRB 5J2MB 5ETRA 2PEBA 2VU5A 4BGAA 3M9MB 1N33K 3MEEA 2IAJB 2B4PA 3HCXA 2B0GA 2N4CA 2AEJA 3PSFA 4JKGA 5HLFB 4CVNE 2AF6A 1TZ0A 3QGGA 3DOMA 1TV6B 1RTDB 4P52A 3W7BA 4M3TA 4W5OA 3GP9A 4CM2A 1FRJA 4MMOA 5E3AA 1BISA 4D3GA 4CLWA 3THWA 2YX1A 1UFWA 3B4DA 5AJ3F 2VC1A 5A8RA 3HD1A 1Z4UA 1RBVA 1WWHA 3L2QA 1UFKA 3ULDA 3P45B 3CERA 4J9KA 4DN9A 2J6UA 3SJHA 1HUXA 4RW7B 3M8WA 3TRGA 3OYAA 1Q82O 1FFWB 1WF0A 2FZGB 1HQEA 3VQPA 4DUZK 3CMEN 1RWVB 5M1OA 2N3LA 1C4CA 2V2KA 1KOHA 4ENOA 4RO0A 4CH1A 1NK7A 5KFXA 3ULHA 1VQ6N 3GV5B 3DLLQ 3TAGA 1KAZA 2V50A 1LW0A 4DMZA 5KFEA 1MWZA 4E89A 4G1QB 2W6KA 5IWAK 1XMQF 3F73A 4RX6A 3R5DA 3IBCB 2IM0A 4UY8T 5HMWA 1AZSA 2J76E 3VEXA 1XHXA 3CMES 3L3UA 1XR6A 2FYXA 4B02A 1NGIA 4J2AA 1IO2A 2QWQA 3MM6B 3OYJA 4J2DA 2X1FA 4XTTA 3ILJA 1YRXA 4ILLA 1DLOB 3BS9A 8ATCB 2XBPA 1IBMF 1VQ6S 4Q8EA 4M5DB 4L6V3 2XY7A 2DNYA 3O4QA 2AJ1A 1IWGA 4KPCA 5U47A 1A5XA 3CG7A 4BRCA 2F4VF 3DXSX 3DOKA 2NXJA 3CFOA 1T94A 2MPUA 1HNWF 5AQRA 3UD5A 3VEYA 1U48A 4DFJA 4DL0C 4A8XA 2ZJRQ 4USUA 5IV4A 2W42A 2XHWA 2HQIA 4O0IA 2XLJA 2AZ1A 2K1RB 1YJTA 2CJKA 2G8IA 2E9RX 2AJ0A 3M2RA 1QAXA 4KBOA 1Q81O 1V5IB 1YQHA 4LF6J 4NLPA 1RWKB 4KH4A 4H8KA 1K1SA 2MSTA 2HQGA 5KFNA 2D3OR 3CW2C 1G4CA 1GMWA 1W25A 4H4MA 1S7IA 3ZTOA 4FK2A 4CJTA 2CPDA 4UUXA 3DYAB 4XH5A 3VAKA 4B9SA 1EIYB 3M2VA 2HYIB 3LP2B 3G87A 4OJ1A 4YN3B 2X6NA 2GHWA 1IUJA 2UVWA 2MZJA 4MYUA 5GMKa 2XRIA 4JK9A 3BSOA 3KOAA 1WUUA 5JXSA 3T5HA 4QWCA 3RMDA 4A8MP 2H5IB 4NEZA 2LKZA 3IM9A 2VJVA 1PJ7A 3KKFA 2F3JA 1REVB 2CQGA 3Q8UA 1I6JA 1R8CA 5AE1A 3MN7A 3IMQJ 3E1YA 2VQEK 1U45A 4JRPA 5JVGL 1VQ8N 2LECA 4DR5J 2MHEA 1GOBA 2G4BA 1TAUA 1KOOA 4CF2A 4B3SK 3LM9A 3NRBA 4P10A 4ZP6A 4I9LA 3P3DA 1NXIA 3FJ2A 2AKWB 3PO5A 3LDNA 3D68A 3CCWA 3KJQB 1HQUB 3CI5A 4WIIA 1RA7A 4YY3J 3M32B 2CDQA 2O8CB 2OPRA 3PJXA 4Z0UA 2AP6A 3OYGA 1ZA2B 1D09B 3TSUA 3RSEB 5L46A 1JLBA 3NGDA 4KGMA 4KT0C 4PAAA 1CSJA 1RDCA 3VTHA 3I0SB 3RU0A 4KB1A 4DL4A 3QINA 2X3DA 1CLQA 5GAEP 4YMEA 2AW0A 3QJLA 3O6WA 1ZTWA 3FZBA 2BKPA 4OYOA 2R7TA 2JH3A 4NLXA 4LF4J 3I55N 1GMVA 2C2DA 3KJVA 2OO4A 2ZHOA 1SS6A 5L9NA 2EHGA 2GS8A 3HJFA 5KFHA 3D0HE 2UXCJ 1FERA 1ZBSA 2RE1A 4ELTA 2P9NB 4B3TJ 2PIIA 1LWEA 1ZPWX 5MLCQ 3DLLL 3TA2A 2MLZA 2YKNA 3C95A 1HMVA 2NRXA 2IDLA 1RDWX 2CPXA 4OJRA 3Q83A 1BQMA 2IIRA 3PSIA 4CI6A 3I55S 3V1OA 3JAMU 4GNIA 5KG1A 1LQ9A 3FFKB 1RI7A 1S6OA 4F4XA 4E1JA 4B3RK 5LXRA 1KBRA 3MMVA 1X3MA 1MU2B 3W63A 4ZVUB 4X4NA 1WC5A 4DL5A 4ZA1A 3LAKA 3DDKA 1VSHA 4KTZA 5IQ6A 2F9JA 3P8BB 3OW2M 4JYAJ 5L9XA 2PYJA 3TANA 4M5KA 1OH6A 2DR9A 5ELZA 3SJJA 4FM1A 3MM9B 4I64A 1T11A 1U24A 3S41A 3MECA 2Z2MA 5KRSA 1S76D 3C3LA 1D9AA 1SCJB 1X5SA 3PR5B 3GR1A 1X60A 1R31A 4Y2AA 4CZMA 2ITGA 2ZJRL 4KHQA 3K17A 3X3UA 3VQTA 3TAPA 2XS2A 4FW1A 3Q0AA 1CJVA 3NAIA 4K4YA 4MKVA 4N8OA 3E8OA 5IXUA 4OQJA 4CHQA 3TU5A 5C42B 1CPZA 1JLEB 1ZM9A 1FNOA 2G8UA 5E41A 4L3KA 2IFXA 1F5BA 2ZH4A 2Z1HA 3WXJA 4AL6A 4B3TK 3CCMN 3TZZA 2LYVA 4YOXA 2K06A 4N76A 3ZTRA 1AROP 1NDCA 3M9OB 2CQBA 2HQCA 4OPAA 5JJBA 4BDPA 4B9QA 1IKXA 1FCAA 4YOTA 4YB7A 4ZS6A 3ILLA 3QGHA 2UXBJ 1GXUA 4NA3A 1S0OA 2YQ1A 2G8WA 2YHWA 1L3KA 4IOAQ 2XO6A 4DCHA 3DC2A 3TWHA 1UWBB 4MLEA 2HMIB 1IJJA 4BG9A 3KWGA 2Q31A 5KFIA 3CCMS 4CBWA 2RF2A 4J7CA 3QT5A 3OVSA 4BRLA 2GV1A 4CLPA 3H45C 3D9BA 2Z58B 2GIFA 5HN0A 2HHHJ 1QQCA 1AW0A 3SXLA 3CJAA 3SQ2A 3NMAA 4DV4J 4TQSA 3OXLA 3EZ5A 2VIHA 2LMIA 1P1LA 4JK7A 1WSRA 4U67Q 1WC3A 2V2VA 4DSFA 3MM8A 4CTAA 4PR6A 3KD5E 4GVLA 1ICEB 2R2SA 4OJGA 1HLUA 3RTVA 1HBNA 3L0QA 1T9WA 3GONA 1JLCB 4DL3A 1H38A 1S97A 2W4PA 4DB3A 2X51A 2J7KA 5ETPA 3P96A 3A3PB 1RK8A 2FSNA 4AQYF 3AY0A 2YX7A 3QAEA 2A40A 2QSWA 1WC1A 4CEFA 2DNGA 5CABA 3DXMB 3MAHA 3QYYA 4DR1J 4P2SA 4JI5J 1EQYA 5EX5A 4ZVSB 3D3CJ 4I6WA 2VG5B 4ID1A 3MXMA 3EVWA 1RABB 4DV0J 2CJQA 3OBWA 2W9BA 1FEEA 1HYSB 5ETNA 1DRZA 2KFYA 2BMBA 4B3OB 4PWWA 3D66A 4JKCA 5FDLA 2LQ8A 5F41A 4I67A 4HEA9 4JAXA 3E51A 2D9PA 3LP3A 1TKXA 1LV5A 1UMJA 2MQPA 2Q79A 1BLUA 5LMNJ 5B0EA 4GRSA 2ASJA 2GAHC 4DS4A 4NLTA 4IH5A 5LJWA 2XI2A 3EJMA 2CJXB 4KFBB 4OZJA 3P38A 2FXUA 2C3PA 4J91A 1U1KA 3IRXA 3PLAA 2BJDA 1TQLA 2DGOA 3PW0A 3V6HA 5HP1A 3I5BA 2FC8A 1K8AO 2VCPA 4J9UE 1KD1O 3M6XA 3KFWX 2E5LJ 2HBRB 1R3NA 3THPA 1C0FA 1JLFA 4FWLA 1WNSA 4KREA 2Y8WA 3K8WA 4F4YA 4WP3A 4A47A 1ZETA 3ZSVA 5BRDA 2GVZB 3UKRA 4EI2A 2KL8A 1MW7A 3AVCA 4B1XB 3QNNA 4NASA 3KLIA 1PKUA 1X9JA 4Y65A 4L73A 5A2QY 3D7EO 1SV5A 4HI2A 4QIFA 1D0EA 4ED0A 2AP1A 3HHLD 2DIVA 2E20A 2EEYA 1FE4A 2QTWA 2QT7A 3L7OA 2VQFJ 2P9KA 2E6MA 4C23A 4NLVA 1QHTA 3DLKA 1WTFA 1U4BA 2BM0A 1FJEB 5KG6A 3M7VA 3CJ5A 2G2YA 2QFIA 4IOAL 2P9UA 2EBGA 5C10A 3OL6A 2C2MB 4JNEA 1QSLA 5D3GB 3ONQA 3V4MA 4ECTA 5GAHP 2PBDA 1B4SA 1NHVA 1YGYA 4ZCKA 3FSXA 3J81j 2ADCA 1J54A 5L1LA 3FEYB 5KPTA 3WC0A 4B1UB 5EDWA 4WIQA 1BHLA 4DOZA 3V9WA 4HUFA 4LF9K 4FPAA 4WWSA 2IHR1 3GIKA 4U67L 4DV6K 1IG8A 2H48B 1S1XA 4M5NA 2G8FA 3NF6A 4LQ3A 1OYEA 4WBFA 3AA4A 5KFKA 4Y0WA 3LH2S 4DL6A 4X4UA 4HACA 1C0MA 4PA1A 1VSKA 2RRNA 5A76A 1IR1A 3WNGA 1R0AA 3OYKA 4JI0J 4X2BA 2ZDPA 4Q45A 2BE2A 2VQFK 3CC4N 1M1KT 1N5YB 1S7HA 4J9NA 4TU8A 1IBLJ 4D3HA 1OH5A 2XMUA 4C8LA 2FZKB 1IJEB 1SJRA 2VD3A 3JTPA 1HBOA 3HT3A 4PZVA 4N77A 2KVQE 2XWXA 3V2UC 1RDRA 3EUNA 1MMDA 2D3UA 2GO9A 4YOYA 1T05A 2XB2D 1X4AA 4BRFA 5GAEU 1BA0A 5C5JA 1D5AA 3HSDA 1NOYA 1U1QA 3CC4S 4YOUA 3SI8A 3KUGA 1EX4A 4Y28C 1N5TA 2BJEA 3VAFA 3O1WA 3ZZZA 3ALYA 1UOCA 3CETA 1Z05A 4AHSA 2FLLA 1YK9A 4ALZA 3SI6A 4LF7F 4Y2CA 1WHWA 5D0EA 4KV8B 2OPPA 4ECWA 4QU6A 1S6PA 1UVLA 2ADBA 2NPFA 2JX2A 4WQ5A 5C0YA 2FF6A 4CZLA 3PYFA 3U7JA 1KSPA 3BGFA 3H90A 2VJUA 2Q1NA 1NSAA 1H2TZ 2VFTA 2EPIA 3QWPA 1PYSB 3U1LA 3NWRA 2XS5A 2HS4A 3OYCA 5F9NA 1RU2A 2DBBA 4E19A 2J8SA 4DTPA 3G82A 2DPJA 2CDRB 3GILA 1SKSA 4B9LA 4H0OA 1RTJB 3HO1A 4CK2A 2VF3A 4ZCMA 3CMAS 3BUZB 2FJAB 1WSFA 1OPIA 4WFXA 4MIAA 4LSLB 3NGRA 4FWPA 2HQDA 2ZUGA 5FPEA 3DN9A 5FPDA 4MFBA 4PQUA 5BR8K 1RKJA 1NJXA 1RFQA 2C3OA 3WXIA 1NGDA 3VF0B 1IBKJ 4K59A 2IGIA 2P8IA 3AGRA 4EAHD 2MLXA 2DHSA 3GE1A 2HW3A 4X64J 1ZBHA 4OYMA 5AR0A 1IKVB 4CQ1A 4RG8A 3RMAA 3S6EA 3OXGA 3PRVA