5D3GA

Structure of hiv-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer dna aptamer
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
553
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
molecule tags Transferase
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
publication title Structure of HIV-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer DNA aptamer.
pubmed doi rcsb
total genus 153
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5d3gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5d3gA05
1YVUA 2VWJA 2KQ2A 3CYMA 4YQWA 4EP4A 1X9WA 3BSOA 1C0MA 4Z0UA 5HROB 4N41A 1WLJA 1SUQA 1JLFB 3KLEA 1IKXB 3BQ0A 4QAGA 1IKVB 1GOCA 3V6DA 4RNNA 3M8RA 4ELVA 1QUVA 1U48A 4DS5A 1VSLA 1RCHA 4F2SA 3THVA 3MECA 4ZMMA 2Z1GA 3SNNA 2RPIA 3H5SA 3OVNA 2J6UA 3PV8A 4LSLA 5KFFA 4CGFA 3OS1A 3NKYA 4JRQA 1J9AA 4HHTA 1UA0A 1KVCA 3KIOA 3OL9A 5KGWA 2WONA 2BANA 4Y2CA 1TAQA 5KT5A 2UVUA 3QERA 2GIRA 4J9SA 4DG1B 5JXSA 3ALYA 2IAJA 1JLBB 3LP0A 2EHGA 4NYNA 3V1QA 1JL1A 3DRPA 4WFZA 1T94A 3DOKB 3CJ0A 2AGOA 4NCGB 4B9NA 2D0BA 5KFMA 1B92A 4DFPA 1RTJB 3CFPA 3EY1A 4DSKA 2FVRA 4O4RA 3L2RA 2VG5B 2DFEA 3UQSA 2Y1JA 4C8NA 4E1MA 3N6LA 1R0AA 3OYCA 5HLFA 2D3UA 3KHRA 2BRKA 3S3MA 1ASWA 4ECXA 5DG9A 3NH1A 3ZT0A 2AX1A 4CJUA 5F9NA 4QWDA 4YFUA 4FK4A 1NJZA 3AVMA 4CJ3A 5K14A 4R5PB 1RT7B 4E7KA 3O4QA 3LDSA 4JUZA 4ED1A 1HNIB 2HNZA 2R2UA 2R2SA 4CEAA 1RT3B 3OYJA 3RMAA 4CEFA 1BQNA 1J5OA 5KT7A 5EDWA 3OYEA 1RT1B 2PY5A 1N48A 1S6PB 3NAIA 2XI3A 4K4TA 5HRSA 3OYKA 2YNGB 1Z4UA 2F8EX 3SI8A 4O4GB 1C6VA 3O3GA 4DLGA 4TY8A 1D8YA 4OL8A 1JLQB 3PY8A 2KZMA 2AGPA 1C1AA 4HVJA 1ASVA 1XI1A 3NF6A 4AILC 3DI6B 1MU2A 3PX6A 2J6SA 3MECB 3FFIA 5KG6A 2W7OA 3OSNA 4CHQA 1IH7A 1BI4A 2FJVA 4FJ5A 3K58A 4J9KA 4EZ6A 2BANB 1L3TA 2FLNA 2OPQB 3DLEA 4TYAA 1EP4A 3QIOA 4FLVA 1RNHA 2A1RA 3NAHA 1C0TA 3DOKA 4KTZA 4CEEA 4CIFA 3I5BA 1RBTA 2XY7A 4PA1A 3O3FA 1NHVA 3KLGB 4DWIA 5HROA 3N6NA 1FKPA 1MMLA 4DTOA 5KRTA 4EBDA 4FLXA 3DLHA 3SQ4A 1T03B 2E6MA 3QLHA 4EBCA 1S1WA 4W5OA 3MF5A 1A5WA 4C8MA 4ID5B 4CFCA 3K5NA 1JLGB 1HQEB 2XY8A 4DS4A 5FROA 2WHOA 4QWCA 1KVAA 3V9UA 2BGGA 1SH0A 4ZP9A 4AHVA 3OS2A 4OKJA 4CGIA 4XO0A 2JLEA 3EPGA 3DDKA 3H5UA 3PO4A 2HNZB 2B43A 1BQMB 2YNFB 4KHMA 2XCPA 4PUOA 1VSIA 3PUFA 3K5LA 2UUTA 1Y97A 4Q44A 2XI2A 4CJTA 3DLKA 1RDDA 4M45A 1NKBA 4PWDA 3ZT4A 5F8JA 3CVKA 2IC3B 4ECZA 1IKYA 4F3OA 1RT4A 1LAWA 3CQ8A 3QEVA 2HW3A 3BSNA 1F21A 5F8GA 2HVIA 1HYVA 1DTTB 2HVHA 5KFUA 2WRMA 4NLOA 2WTFA 1ZYQA 1XC9A 3H5XA 4BE1A 3L3VA 4W5RA 5F8NA 2F8TA 4CEDA 4F4WA 1K1SA 2OH2A 2RF2B 3H4DA 4ZHRB 4OPJA 2C28A 1DTQB 3KK3B 2ALZA 1QHTA 3HP6A 5DQHA 3T1AA 1TKXA 2C22A 3TVKA 2RDJA 2KZZA 4EBEA 3SFGA 3EPIA 4B9LA 4X2BA 3HPGA 1KFDA 3KTQA 3WNGA 4CJVA 1TGOA 3NH2A 1RILA 5C42A 4CFDA 3OJSA 3TARA 4MK8A 4RW7B 2BQRA 4FW1A 4HUGA 5CYQA 1Z25A 4M42A 3GV5B 1C0TB 3HPOA 4EEYA 5JUMA 4NCAA 1CXQA 3I5CA 5KFOA 2QXFA 4F8RA 3ZCMA 1RDBA 1C2PA 1RTIA 4CJFA 2QK9A 2RKIA 4NLYA 4ZPCA 5KGXA 4KHNA 3HJFA 4NYFA 3UDLA 4J9QA 4NLPA 1BISA 3TWHA 5KFVA 3FDSA 4IDKA 4B3OB 3ITHB 5L9XA 2JEGA 4Q43A 1QQCA 1RYSA 2YHBA 3JSMB 1VSKA 2VG6A 3HVTB 4EZ9A 3TANA 2OZSA 3HL8A 5KTQA 3MXMA 3CM5A 1TKDA 3QNOA 1FXXA 3CFOA 3PVXA 3UR0A 4M3ZA 2D5RA 4ZVFA 4NLSA 4Y1DA 3GV7B 2O4IA 2XY6A 4Z4IA 3U3GA 1OS5A 1D9FA 3DLRA 3AVJA 3P1GA 2G8IA 3AA2A 3M9NB 4RW9B 3ZSWA 1U04A 4FJ9A 4DU1A 2ZD1A 4DU4A 4TYBA 5EWFA 4M3XA 4NRTA 1O1WA 4IFVA 3HXMA 4JLHA 1A5XA 4MH8A 1JKHA 5C25A 2G8HA 4B9MA 1S9GA 2ILZA 5FDLA 4DU3A 5L1JA 1XHXA 4JV2A 3L2WA 3V9SA 3QZ8A 4ID1A 4BDYA 4OGEA 1TV6A 3D5MA 3RB3A 3KOAA 1HNVB 1SL2A 2YHAA 4FYDA 4ECQA 1RTDB 4RUCA 5KG4A 3OYGA 1C1CB 1SKWA 2HB5A 2VWKA 4CJ4A 1VK0A 1S1TA 5HP1A 3LWMA 3C6TB 5FRMA 1EETB 3PW5A 3TABA 3AVNA 3L2VA 2B5JA 3O4NA 3NGIA 3KLFB 4KI6A 4CE9A 2IC3A 4KHSA 1L3VA 1S1UA 3JYTA 2GV9A 1LWCA 4Z4HA 4BWMA 1U47A 3BREA 4J9RA 2VG7B 4FJ7A 2R8HA 2Z1JA 1RT5B 1HYSA 3E51A 5HRPA 1S6QA 4DL2A 3I0SA 4U7CA 5J2PA 4NCBA 4RNMA 3IS9B 3KK3A 4ZP7A 2E9TA 2FJWA 3TAPA 1L3SA 1ZBFA 1KLMA 3MR2A 4EO8A 3L3UA 2HHUA 2P1JA 3PR4A 1TAUA 2YV0X 4RUAA 3KLVA 5KFEA 4CF2A 1RDAA 2HHTA 3LPUA 3PJWA 1HMVB 1VSJA 4DEZA 2PYJA 3BGRA 3MR3A 4AH9A 2R8KA 4IH5A 4RW8A 4KB7A 1WNEA 2LSNA 3DOLA 2IGIA 1GX6A 4Q5VA 3QESA 2B6AB 2D3ZA 4FLYA 2OZMA 1VSHA 3C94A 5KFNA 4KV8B 3MFHA 3K5OA 3VQ8A 2G8FA 3FQLA 3OYHA 1RT6B 3RAQA 3DLGB 4OLAA 3MEDA 3OYAA 4CCHA 3ZSYA 2HNYA 2IJNA 4B8CA 4JS5A 4WFXA 4HYKA 4ZPDA 2G8WA 4CHNA 3L2UA 1WSGA 4K4VA 5KFXA 1QE1B 3BQ2A 1NK0A 3MR5A 2YNIB 1VSMA 3KLGA 3V81A 1LWEB 3ZSXA 3VQPA 1GOAA 3C6TA 3KLIB 3RWUA 3T3FA 2O5DA 4GC7A 3AVBA 4IG0A 4TXSA 3HP9A 2B5JB 1FKPB 4DTMA 1LWFB 1BCMA 1WAFA 2W42A 5HRRA 3V1OA 3KK2B 2FC0A 1U45A 1S1WB 3MAQA 3BDPA 3SV3A 2ASJA 4JS4A 1TK5A 3DYAB 1U09A 4Q0BA 1S0NA 3GIKA 4J2AA 4IOBA 4IFVB 2VG7A 1JLCA 3P5JA 1QAJA 1IO2A 4J9OA 2VA2A 5J2NA 1HRHA 2JGUA 3DMJA 4GW6A 2YNHB 4RNFA 4RG8A 2ZE2B 4GVMA 1NK7A 1EX4A 4FZYA 4M3UA 3HVRA 4HUFA 1IKYB 4QCLA 2HMIA 4M3YA 4MKBA 3QEXA 4HCBA 3HKWA 3QO9B 3RMBA 1ZTWA 4ICLB 1BGXT 2EC0A 4O55A 5KG7A 4JV0A 1TVRB 5D3GA 4RZRA 1S0OA 1S9EA 4CECA 4FLTA 4O5BA 5KG3A 1YVFA 4Q8FA 1UOCA 4NLRA 4KV8A 3CWJA 3KLFA 4CJPA 2IMWP 4ED2A 4F4KA 1LAVA 4TY8B 3M9OB 2WOMA 1RA6A 4I7FB 3HVWA 3K5MA 4CGDA 4CEQA 4C8LA 4B9TA 3NAEA 2C2RA 4DTJA 1IG9A 1RT5A 5HRNA 1JLAB 4FJMA 2HAIA 1CXUA 4XIUA 1CSJA 3N6MA 3V81B 1BL3A 3VQBA 4LH4A 3HSTB 2JEIA 2CKWA 1SUQB 4ZVEA 4FVMA 3OJUA 4FZZA 3V9XA 2OPQA 4DFMA 3DLEB 1NKEA 4CEBA 4NYZA 3CIZA 1VSEA 4OJRA 4I2PA 3KK1A 1QSLA 3JSMA 3AVAA 2BRLA 5KFAA 3AVCA 3DRSA 3LP1A 4E7LA 3I0RA 2HWIA 4IFYA 4DTNA 3MXJA 2W9BB 2JC1A 4FZXC 4J2BA 3KMSA 4Z4CA 4KB1A 4KTQA 1ZBLA 3F9KA 4FJLA 3IG1A 2CJQA 3VQ6A 1T03A 3QLHB 2EX3A 1SL1A 5I3UA 1TKTA 3CO9A 1SKSA 1LW2B 2ATQA 1T05A 3WNFA 5T14A 1NKCA 4HCCA 1HPZB 1WN7A 1LWEA 1RBSA 2KFZA 1VRTA 5KFDA 1JXEA 1NK6A 3T5HA 4DF8A 3TAMA 4DSFA 1S9GB 1C0UB 3ZT1A 1YTUA 1JLEB 1HYZA 1LWFA 3D28A 1VRUB 4BE2A 5KFQA 5J1EA 3NDKA 2FBVA 4KKOA 3VQSA 2ATLA 1FK9B 4MFBB 3QEWA 3C6UB 2QKKA 2DPJA 4WXWA 1C1CA 1YT3A 3OS0A 3LAKA 4QPXA 1RTHA 3VQCA 1LW0A 4RW4A 4TQRA 1NJYA 4CF1A 4UQGA 1KFSA 4CGGA 5KFKA 4Q45A 3QGHA 3NMAA 3HO1A 3HHKA 4CHPA 2ZKUA 2O4GA 3VQAA 2FVSA 3OYBA 2E9ZA 3RTVA 1S1UB 3JYTB 4QWAA 3KK1B 4H54A 3IS9A 4ICLA 2ITGA 3AA5X 3OHAA 4BE0A 1HQUA 5F8LA 1N5YB 4FBUA 1S6QB 3MEEB 2FBTA 4RNHA 4CJQA 2JC0A 1RTIB 3DRRA 3AVLA 3WNHA 3G6XA 4K8XA 3BGRB 5FRNA 3VQEA 4IR9A 4CF0A 4I2QA 4LQ3A 3VA3A 3T5JA 2KW4A 3BSCA 1RBUA 3SUNA 3V6DB 3TQ1A 4C8OA 4Y3CA 1KHWA 4K50A 3LANA 4DSEA 4N56A 5KT6A 3OYFA 4KHYA 4CHYA 4DF4A 1Z26A 2WB4A 2BQUA 2JEFA 3G10A 3SFUA 3MEGB 1KCFA 1ITGA 3SI6A 4CJLA 1CZBA 4E0DA 4R8UA 4DG1A 3GIMA 1RT6A 3RB6A 3V6JA 1JLBA 3LP0B 4DQRA 4BWJA 3DRPB 4I2PB 1JIHA 5J2QA 2HWHA 2OPRB 5SZTA 3LPTA 4ZVHA 4DTPA 1QE1A 1JKHB 3IGNA 4RNOA 2YNIA 4DL6A 2D0CA 3LP2B 1I6JA 3TAGA 1W9HA 3SQ1A 5DLGA 2C2EA 2BQ3A 4PWDB 4RW4B 1QS4A 3ISND 1IKXA 3RBEA 1EXQA 1TV6B 2IDOA 4I9QA 4RU9A 5KFLA 2D0AA 3PX0A 3OY9A 2D41A 3PW2A 4Q0BB 1UA1A 3PW0A 4CEZA 4ECYA 1REVB 2XWYA 2XY5A 1C1BB 3DM2A 2IM0A 3G6VA 4KREA 4CIEA 1JX4A 1RT7A 2RDIA 5F8MA 5EU7A 3AO1A 2IS3A 1DTQA 2YNHA 1VRTB 2HNDB 4LD0A 2Z1HA 5KG2A 4IKAA 1TKXB 3QINA 4H8KA 4U6PA 4TY9A 1CLQA 4ELUA 3IN5A 2ZE2A 1VRUA 4IRCA 3QO9A 2XGQA 4BDZA 4I2QB 3CJ3A 5DLFA 3QIDA 3VQQA 3NGDA 1IKWB 1RTJA 1HYSB 4ECWA 2V0NA 4M3RA 2ZQBA 4OPKA 1ZBUA 4K4SA 4L8RB 1JL2A 2IM3A 1UWBA 2P51A 2DTUA 3RRGA 3QEIA 4FM0A 3OYMA 3G86A 4DTUA 4IQXA 3H5YA 3IGVA 1U49A 2UUWA 1EKEA 4FM1A 4K4XA 4FJ8A 4ZTFA 3E01B 3VQ7A 5L1KA 4FS2A 1Q9XA 3AVHA 4IR1A 1HNIA 3RB4A 3IRXA 2Z1IA 4FJHA 2RN2A 2VG6B 3HVTA 3RAXA 1S1VA 1Q9YA 4CK1A 2FBYA 3U6FA 5KRSA 3UIQA 3OYNA 1HQUB 2XC9A 5KT3A 3MEDB 2QV6A 4DL4A 3BJYA 4O3OA 5F9LA 4GC6A 2HHSA 3NBPA 3EZUA 4DMNA 3CDWA 3M8SA 3CJ4A 3V6KA 1JLQA 5KFYA 3TAQA 2FVPA 4CFBA 4FJKA 2NUBA 2D7SA 1REVA 1XR5A 4QOZB 3KJVA 3AA4A 1GX5A 4E1NA 3GYNA 3KLIA 3KHLA 3QGIA 1S4FA 2HHQA 1IKVA 3RRHA 4DTXA 4QWBA 3MEGA 5KI6A 2XO7A 3KKSA 1LW2A 4E19A 3CDUA 1TL1A 4TSXA 4URSA 2AJQA 4MK9A 4ECUA 4FBTA 5J2QB 2HHVA 1ZBIA 2OPRA 3VQ5A 1S9FA 2ASLA 5JS1A 3VQDA 1JLCB 4B9VA 3PJXA 4IBNA 1HPZA 2YNGA 1S0MA 2IM1A 3M9MB 4WXOA 1D9DA 2PZSA 4W5TA 4ZP6A 5SWMA 3O3HA 1JLGA 3TI0A 1LWCB 4MQ3A 3M8QB 4DFJA 3AVIA 3SQ0A 3E01A 2YKNA 5KFWA 1QAIA 1R0AB 1NK8A 1Q8IA 1UAXA 4AHTA 3LAMA 3S3NA 5KFSA 2FBXA 2YNFA 3IRXB 4EYHB 4KHRA 4CGJA 4NLDA 2HNDA 2FVCA 3T5KA 5J2MB 4MIAA 3SZ2A 4AHSA 4C8KA 5K14B 2F96A 4J9PA 2W9CB 1WSEA 4NZ0A 2BR0A 3G0ZA 4F50A 4DTRA 1KSPA 2IBKA 1I39A 3VA0A 3ITHA 4CJRA 3B6OA 1NHUA 1L5UA 3KJVB 4Y2AA 1X9MA 1S10A 1D0EA 3OLAA 4AHCA 3V9WA 4DQQA 5L1IA 2XCAA 4ID5A 1NOZA 4CERA 3PW7A 2DFFA 4J9LA 3ZT2A 4W5QA 4H4OA 3ZT3A 4CFAA 2KFNA 4F4XA 3PX4A 1TKZB 3RMCA 4CESA 1BI4B 5C24B 1S1VB 3PHEA 4ED0A 1X9SA 4FJJA 4R0EA 3NF8A 1KRPA 4BDPA 3CFRA 2IOCA 1L3UA 3IG1B 5C25B 2YKMB 1NK5A 4QW9A 3SCXA 3AVFA 5KFRA 2BE2A 3C95A 2DPIA 2W8KA 3MTKA 3EZ5A 4J9NA 1BHLA 3AO4A 2Q3SA 1WAJA 3KMQA 4KBIA 5CY4A 5KFIA 2QE5A 4FW2A 4WZMA 2FVQA 3HT3A 3Q8RB 2ILYA 2YKNB 2ASDA 3PO5A 3NF7A 4W5NA 1TK8A 1N6QA 4WE1B 2P5OA 4FM2A 4KFBA 1NNDA 1RBRA 4Z4GA 5DK5A 4O0JA 4CJ5A 4KAIA 4TLRA 5EWEA 4LSNB 3QZ7A 2I5JA 2XGPA 3OHBA 4URGA 2GC8A 4RW6B 3EYZA 4MFBA 1J53A 4ZPAA 3IAYA 2AQ4A 2VG5A 3KNAA 3PR5B 3CG7A 3AO5A 1RTHB 4M94A 4HTUA 4EO6A 3SYZA 5DQIA 5I42A 2V9WA 4JRPA 1D1UA 3TR8A 4CGHA 4O3PA 1RT2A 3QNNA 4NLTA 3NFAA 2X6SA 4M41A 4IDKB 3ULDA 1RTDA 2HHXA 3M8QA 4FJXA 1UWBB 4F4ZA 3MR6A 2OPSB 3SQ2A 4Z4FA 3CJ2A 1IKWA 4CJWA 4LH5A 2B6AA 4KO0A 1NK4A 3NE6A 1T7PA 5CYMA 2ETJA 3M8PA 1J54A 3QIPB 4ED6A 1WNSA 5KFPA 4J9MA 4O4GA 3VN5A 2P5GA 3OL8A 3LP3A 5KG0A 5HBMB 4LQ9A 5DGAA 4YP3A 3G6YA 4K4ZA 4WZQA 3P83D 2W9CA 1SKRA 4Y34A 4IKFA 2I1RA 5CYQB 1ZTTA 5DGBA 5KG1A 2BE2B 4ED7A 4KHUA 3KLHA 3TAEA 4MIBA 1BIZA 3HM9A 2V4QA 2R8JA 3I0SB 2Y1IA 2E9RX 3Q8QB 2W9BA 4IRKA 4YR2A 4CIGA 4B08A 1FKOB 5L1LA 4Y1CA 4AHRA 4E7JA 4ZVGA 1XHZA 3NBPB 3FSIA 1QSYA 4K4WA 5KG5A 3OSPA 3SUOA 5KFJA 4LY7A 2X78A 4IG3B 4Z4EA 1HNVA 1HMVA 4ZP8A 3ZSZA 3GQCA 1WSIA 2OYQA 4E89A 4F3TA 4H4MB 2I5JB 1T05B 3NH0A 1EETA 1N4LA 4CK3A 2GUIA 3D45A 4LSLB 4FK2A 2G8KA 1QTMA 3QETA 5C24A 4MKAA 4K8ZA 1KVBA 3KKRA 3NGYA 2AWZA 3HPHA 4QWEA 3ZSQA 3RMDA 3S3OA 4N76A 3GIJA 4G1QA 1W0HA 3SJJA 4TQSA 4OVLA 3NCIA 3RB0A 1JLEA 5J1EB 1TL1B 1SL0A 1LV5A 1NK9A 2FLPA 1WSFA 3CM6A 3OYDA 1SH2A 3GV8B 2IJFA 1KHVA 4YMEA 5KT2A 2AU0A 4K4YA 4I9LA 5HLFB 4QW8A 4OKEA 4ZPBA 5D3GB 4J2EA 1S97A 1S9EB 1G15A 3Q8SB 3I8DA 3M8PB 3S9HA 1ASUA 2E6LA 5JS2A 4NLGA 4G3IA 4CJEA 3B6PA 1RDCA 4YR3A 3KLHB 1RA7A 2IM2A 4DQSA 5CZ2A 1RT1A 3V9ZA 3OYIA 3V4IB 1A5VA 3H40A 4FS1A 5KFZA 3TAFA 1RT2B 4NLQA 4EYIB 3AVKA 5DG7A 2GIQA 4XPCA 3H59A 1WSHA 2HMIB 1RAJA 3KHGA 1NJXA 1NJWA 2R2TA 3QYYA 3RR8A 3FRZA 5J2PB 4EP5A 4DSLA 5DQGA 4M3TA 4FJGA 4DLEA 1SV5A 3DRSB 3LP1B 1TP7A 2IA6A 4IFYB 3LZIA 1S5JA 5T7BA 1KTQA 1HARA 5DMRA 5CYMB 4FK0A 4CK2A 3QIPA 3KLEB 1NOYA 4O44A 4HKQA 4B9UA 1BCOA 1K1QA 4R8UB 4GMJB 3KK2A 4I7FA 4OGCA 1JXBA 1T3NA 2XHBA 3DYAA 5DG8A 2W8LA 3MXIA 2XRIA 3SUQA 1RDRA 2FLLA 3ZSOA 4KPYA 1XR6A 1KLNA 4M95A 4ECSA 4KE5A 4KHWA 3DLGA 5J2NB 1XR7A 2IAJB 3KD5E 4KHQA 1N56A 2WK4A 2DY4A 3LALA 1QSSA 3GILA 3L2QA 2HHWA 3RR7A 3SPYA 2YKMA 4NLUA 4ZTJA 1HQEA 2A1SA 3F73A 3SV4A 1C1BA 4CHZA 2VA3A 3DM2B 2G8VA 4NCGA 4PY5A 4KKOB 3LWLA 3GIIA 3ISNC 1FK9A 1S49A 4DSJA 2E4LA 3K57A 4DQPA 1BQMA 4DL7A 4NLXA 1N6QB 4LSNA 3FQKA 4PQUA 4ECVA 5KT4A 2R8GA 3ASMA 3CJ5A 2F8SA 1RT4B 4KFBB 1B9DA 4E3SA 1RBVA 4KSEB 2PYLA 5I3UB 4IH6A 4R5PA 4AHUA 1DTTA 3HYFA 5KFTA 2UVWA 4Q8EA 3V6HA 4FXDA 3RBDA 5HP1B 4CJSA 4E7HA 5I42B 2R2RA 3CDEA 1S6PA 4ZHRA 4ED3A 3K2PA 1S1XB 2DFHA 1BQNB 2R7YA 4HUEA 3H08A 4M3WA 4WFYA 3NHGA 1N5YA 1W25A 1BIUA 3H2LA 3K59A 3DRRB 1TL3A 2WCXA 3VQ4A 5KFBA 1DLOA 5CZ1A 3H4BA 1GOBA 4N47A 2OPSA 1SH3A 4O3RA 3U3YA 3MFIA 3AO2A 4RW7A 4O3NA 3I0RB 1TVRA 4O0IA 3C6UA 3OYLA 4NRUA 1RYRA 1JXLA 4K4UA 3DI6A 2OPPA 1X1PA 1JLFA 3H98A 4FLZA 5C5JA 1KLMB 4FCYA 4YR0A 4KO0B 5F8HA 2AGQA 1EP4B 1B9FA 3HVAA 1I3AA 1TKTB 4BACA 2C2DA 2UVVA 4JV1A 4KI4A 3NF9A 4MK7A 2W9AA 2B4JA 5HBMA 1JLAA 1VSDA 3OL6A 4DQIA 3KHHA 4B3OA 4ELTA 4DSIA 1TKZA 3SPZA 3Q8PB 5EWGA 1CZ9A 4XPEA 4DL3A 3ZSRA 1IM4A 4DFKA 3AO3A 1FKOA 5F8IA 1SV5B 3ZSVA 4NLVA 3LZJA 4KB0A 4FLUA 3TAMB 1TQLA 4J2DA 3KD1E 3LP2A 4OKKA 1C0UA 4F2RA 4YNQA 4O3SA 3V1RA 2HNYB 4O44B 3NGZA 1WSJA 4H4MA 4KAZA 2UVRA 3SUPA 2V4RA 4IG3A 4RW9A 3OL7A 3BR9A 2ZD1B 3AVGA 4FJNA 3T5LA 4F4YA 4B8AB 5E41A 4WE1A 4NLWA 4IRDA 1HJRA 4N5SA 1YTAA 5FDLB 4WYWA 4PUOB 2AX0A 4IG0B 3VQ9A 3QGGA 2FJXA 1S1XA 4IH7A 3DLKB 4ECRA 2GBZA 3AV9A 1VSFA 3AA3A 4E7IA 4G1QB 5KFCA 4ED8A 4KRFA 4FJIA 1ZBHA 4RW6A 3A2FA 2W7PA 5KFHA 4WYLA 2QKBA 3HK2A 3BSAA 3ICLA 2WONB 1S1TB 4URQU 3D0PA 3OLBA 4CEOA 1J5OB 3UPFA 3PZPA 1XWLA 4CHOA 5EUHA 4O3QA 3MEEA 2RF2A 1S48A 3NL0A 2X6NA 3DMJB 2OPPB 5J2MA 2KTQA 3L8BA 4PQUB 4FLWA 2OA8A 4CF9A 2X74A 2BDPA 4DTSA 1U4BA 3PW4A 1MU2B 1K6YA 5C42B 3DLBA 1LW0B 4OLBA 3FFIB 2JEJA 3T19A 3BQ1A 3I5AA 1TK0A 4KTWA 1ZETA 2G8UA 5KFGA 3WNEA 2R8IA 4TN2A 1D5AA 4CJKA 1T8EA 4B9SA 3V4IA 2J6TA 2WOMB 1TL3B 4DL5A 1DLOB 4CF8A 1RT3A 2RKIB 4H4OB 4RW8B 3QEPA 4ECTA 3DOLB
chains in the Genus database with same CATH superfamily
1KOOA 1YVUA 2HPUA 2W2PP 3ZZYA 2RS2A 4IO9L 1HPMA 5A8KA 4EP4A 2VBWA 2UYTA 3RVCA 4N41A 5BJRA 3GE1A 2RH3A 2QL7B 1FHTA 1IKVB 5A2QU 4RNNA 1GXTA 4K2JA 4ELVA 1XNQJ 1CC7A 2VPZB 4ZVOB 1Q4RA 3MMAA 4F2SA 1Q1KA 1NM2A 2QJ3A 3MECA 1AROP 3ID8A 3CCUN 5GVQA 4DR6K 1UA0A 5KFFA 3OS1A 2XMVA 2ZH7A 3L09A 3KIOA 4UOFA 1RWOB 3MCPA 4PYDA 1T0TV 1UETA 4DG1B 5IT0A 2DH7A 2IPOB 2LQBA 5JXSA 4DR1J 4NYNA 4AXJA 1HR0J 4WFZA 3JSRA 4M5GA 3S7RA 3DOKB 4NCGB 4B9NA 3BZCA 4X84A 4ES2A 5KFMA 2HSEB 2O1PA 1RTJB 1VQKN 4LF7J 1V5VA 2RHKA 2DGOA 5IT4A 1VQ6S 3UQSA 3FMWA 4RWXA 2FLOA 2Y1JA 2ZH3A 2ZM6K 4NXMF 1Y9OA 4Z37A 2D3UA 3ZNUA 2BRKA 3QBWA 4CJ7A 2OMLA 4A8XA 3R3LA 1ASWA 3SMPA 3T1HK 1FCAA 4CJUA 2YXLA 4ATNA 4YFUA 3P3DA 3AVMA 4R5PB 1RT7B 1TTHB 3O4QA 3LDSA 1HNIB 2HNZA 2R2UA 3MDFA 2L41A 2QLJB 1YF5L 4M5DA 2GUPA 1M1KO 3SIPB 1TUGB 1MW7A 2FF6A 1J5OA 5H9FJ 3FE1A 1S72N 2PY5A 3HM8A 4P52A 3ZZPA 3NAIA 2XI3A 3OYKA 1YKWA 3MN6A 3IMQJ 4PXDA 4DLGA 5H9EK 3PHTA 1IBMJ 1E6YA 2KG0A 4WQ5A 3NF6A 1XQIA 2X1BA 3PX6A 1CC8A 5MLCQ 1LEOA 4JI5K 2AJ2A 3OSNA 4CHQA 2NXUA 3K58A 5D0GA 1FVQA 1L3TA 4JI3K 4NYPA 2OPQB 3DLEA 4FLVA 4O5FA 3FZFA 5E3CA 4KTZA 3HHEA 4BC2A 1KXPA 2NXCA 1RBTA 5IS2A 4PA1A 1FNMA 1S72S 2OFGX 3AOAA 2GX8A 4DWIA 1SS6A 3U1LA 1FKPA 1NPPA 3MWBA 5KRTA 2YY3A 3JS9A 3JTNA 1S1WA 1A5WA 4CFCA 4F3QA 2R7XA 2HBLA 2EFNA 3EUNA 3ZLJA 3ZX0A 2PD1A 1AFJA 3EPGA 3TNVA 2RD5C 3PO4A 2GMLA 2PFDA 1VRQC 2B43A 1RTZA 2XCPA 3HZGA 3K5LA 1VSIA 3DAWA 1NKBA 5DZ6A 2WW4A 4HR2A 3CVKA 3PKYA 3K5PA 4DX7A 2X1GA 4PG7A 2M5YA 2ZH4A 6FD1A 1ELOA 1ZYQA 1HI0P 3H5XA 4MLEA 3L3VA 1B4SA 4BE1A 1CJUA 5F8NA 4KBOA 3WQPA 4F4WA 1KTVA 3SMSA 4JI3F 4FPRA 2OH2A 4CBWA 3B6BA 3H42A 2RF2B 3CF5Q 4ZHRB 1QHTA 1DQ8A 3CPWM 5DQHA 3T1AA 2NS1B 1C0FA 3UD4P 2OSRA 4E8UA 3SEOA 4EBEA 3SFGA 3EPIA 4JKCA 3HPGA 4L75A 4L3NA 2DGTA 1TGOA 3Q2SC 2DPNA 1I94J 3CCJS 2JX2A 2UUBJ 4FW1A 5CYQA 4M42A 5FLXO 3QBCA 3G4SN 2MTLA 4EEYA 3HPOA 1NWKA 3NG8A 4PAAA 4WKYA 2EC2A 5KFOA 4F4AA 2QXFA 5ETQA 2NREA 1Z2LA 3CC2N 2EG2A 2DGXA 4DV6K 3TZZA 2CH5A 4JHDA 2YJFA 1K8KB 1URRA 3HJFA 3J7Z5 3I9ZA 4WTOB 3ZTRA 4YB7A 4FPAA 4G6VB 3TWHA 3FDSA 3QSYB 3ITHB 4FN5A 2RB7A 3FZLA 5AQRA 1HLUA 5L9XA 4LR8A 4TU8A 2YHBA 3TR5A 2VG6A 2CH6A 3SMZA 2OZSA 5KTQA 4QZVB 3MXMA 3CM5A 1VR6A 5E7OB 4W98A 3VENA 2BJ7A 2KVQE 2O4IA 3Q83A 3LW5C 2XYHB 3EICA 4TVAB 4OX9K 4GV3A 4M5JA 3M9NB 2X1AA 3BDEA 2DR6A 2Q79A 2R7TA 4DU4A 3OR2B 3UNYA 4TYBA 1R3NA 2E5LJ 1X4GA 3FGUA 3VGTA 3QRPA 4B9MA 2G8HA 1S9GA 2ILZA 5BPNA 1HWLA 3AD9C 1XHXA 3L2WA 5CZVA 6FDRA 4ID1A 4OGEA 3R7NB 1RK8A 1EO1A 2GNKA 4CLZA 3ZTOA 1SL2A 3OYGA 1XMOJ 2BE7D 1VQPS 1KAYA 4CJ4A 2EVZA 1I51B 5HP1A 4DV5K 4MTPA 2MQLA 3AVNA 1YK9A 2M9KA 2ZOGA 3G25A 3RG6A 4DR4K 1W97L 4EFHA 4MDAA 4KHSA 4OLOA 3EL2A 1L3VA 4LUBA 3TA0A 1S1UA 3JYTA 2GV9A 4Z4HA 3Q22A 3KYLA 2VG7B 4FJ7A 5GINA 4NPOA 1RT5B 2ZWHA 3AJ1A 2C2NA 2DNYA 2OCEA 4RNMA 4OX9F 2E9TA 2FJWA 5IQ6A 3V4MA 4DV4F 3MR7A 2J9DA 2HHUA 2VC0A 2YV0X 2ZH8A 3KLVA 1FDNA 4ISFA 2K1RA 2E2NA 2V5HG 4CZEA 1EZZB 2CNLB 4AH9A 2F7VA 2R8KA 3GR1A 4K5SA 5E84A 2BVZA 2LSNA 3DOLA 3UO0A 2IGIA 1C4AA 1GX6A 2KXNB 3QESA 2B6AB 1OVYA 5GIPA 1RZMA 2OZMA 2CFXA 5KFNA 1UVMA 4KV8B 3UWTA 1OPZA 2GJ2A 3F5TA 5AFUA 2C3MA 1RT6B 3DLGB 3I31A 4Y2KA 4X62F 3EE9A 3MEDA 4OLAA 5DRKA 2XHCA 4DV0F 2XHWA 5HMXA 2HURA 3ZSYA 4H0VB 2IJNA 5I3QA 4HYKA 1UWAA 1WSGA 2QFIA 3AXMA 3BQ2A 3KLGA 2GTDA 1FNXH 1NGEA 1LWEB 3OBIA 2BA9A 3VQPA 3DNCA 1HR0K 3C6TA 1NGIA 5AQMA 2HIYA 2O5DA 4LFAK 4GC7A 2XM3A 1S77D 3NGTA 3CCUS 3J7A1 3VZIA 5B0CA 4J91A 5B0EA 5HO4A 2I7PA 1S4EA 3V1OA 5AQZA 1U45A 1S1WB 3JXOA 4JS4A 1TK5A 1WC0A 1S99A 1U2RA 2P9SA 1IR1A 3ATUA 1KC8T 1IO2A 3THPA 2ZH1A 4C11B 4TLQA 3DOMA 2ZE2B 4GVMA 1EX4A 4FZYA 5LSRA 3NP5A 2Q36A 2V68A 1B0VA 3VHQA 3WZ0A 1D3WA 3ZZZA 2H4YB 3K8WA 3MK6A 4ICLB 2NNWA 1BGXT 2NRTA 5KG7A 4LF6J 2CGLA 4O0NA 5D3GA 2JRSA 4MKYA 4CECA 3UD5A 4CLWA 5IOLA 4NLRA 3CWJA 2P9UA 4PEOA 2ZGZA 2EWHA 4I7FB 3RRKA 3R5JB 5K8NA 4DQ8A 4UY85 3M1VB 1IG9A 4U8VA 4XIUA 1E4GT 3N6MA 1R8AA 1BL3A 1T3VA 1SUQB 4FVMA 2DD8S 3T1HJ 3DLEB 3OXGA 1QLNA 4E1JA 1X0PA 2DIUA 4KGZB 1FRMA 3E9PA 2A6OA 3KK1A 4YOYA 2GQCA 2XEXA 1Q5YA 3AVAA 2BRLA 4B3SF 4QIWD 4E7LA 3GPAA 2HWIA 3TZYA 4PQAA 2CUYA 1NU0A 2VICA 2ZJPL 3G6EN 1U6ZA 1HD0A 4GMKA 1G7CB 3KJNB 3F9KA 3PFOA 4FJLA 5LJ5Y 5BREA 3VQ6A 5ETRA 4USKA 5AQUA 4MT1A 1TKTA 4H4KA 2RNEA 2ATQA 2GO8A 1UP1A 1T05A 3T1YJ 3D6FB 3WNFA 1RGVA 1LWEA 1RBSA 2J9CA 3HI9A 2A3ZA 2QLBB 3TWZA 3E9OA 1JLEB 1RWUA 1VQ9N 1LWFA 3CETA 1VRUB 4JI4K 4BE2A 2JVRA 4H0OA 1PYOB 2W2MP 2VQEJ 3FZHA 9RUBA 3NDKA 2FBVA 2HLUA 2I2YA 3QFWA 2R4FA 4NXNJ 2MKJA 4BLGA 1HNWJ 3OS0A 3SQOP 1RTHA 4M5MA 4RW4A 4TQRA 1NJYA 3BEXA 4HWIA 4UQGA 2EFVA 2V8VA 5KFKA 1O0PA 4CHPA 1HBNB 4YHHF 2O4GA 3OYBA 1UL3A 1UVJA 2VPYB 3RTVA 3CPEA 1S1UB 3JYTB 2BE9B 5ETMA 3W60A 5M2PA 4OZ3A 3IS9A 4ICLA 3CCVN 1QVGR 3GDQA 3AA5X 1HQUA 3VGVA 3DKDA 3I9V9 4RNHA 1R8HA 3DRRA 2DNPA 3C3LA 4KHPF 4CLTA 5JMVA 3AARA 5AJ3F 3CD0A 3T5JA 2KW4A 3BSCA 1RBUA 4P6QA 4R79A 4N56A 3QATA 3OYFA 1YJNN 4JYAF 3J7YU 2FJEB 2BQUA 2VDHA 3TSUA 5KAKA 3D4JA 3SI6A 1LCUA 1CZBA 1FVSA 2JWLA 4OYOA 3GIMA 2DH8A 1S59A 3LP0B 4DQRA 1Y4ZB 4BWJA 1VJWA 3J7YI 2HWHA 4NEYA 1HIYA 4ZCKA 2QZ8A 4QPTA 1QE1A 3C16A 1JKHB 3IGNA 4YHHK 3LP2B 1W9HA 1VAZA 2LEBA 4ZA1A 4YOWA 1GEHA 2QRRA 4JI8K 4OI6A 3A8YA 3CB4A 2VQFJ 5KFLA 4BR9A 3PX0A 3OY9A 2D41A 3PW2A 4CEZA 2BW7A 2G1DA 4ECYA 2XY5A 2N7CA 2P9SB 2YWFA 3CCWA 2B56A 2GFFA 1V3RA 3CSKA 3QNWB 1DTQA 3BR8A 3AFGA 3QINA 4FYVB 2HS4A 4B3RJ 1R89A 4ELUA 4JYAK 5KOXA 2ZE2A 2YHYA 4BDZA 4I2QB 4A2AA 2V7YA 2HBKA 4U7UK 3NGDA 4DJBA 4RKUC 2MGZA 3EGNA 4JI0J 1NDKA 4K4SA 4DI6A 1JJ2R 1M5SA 3MCAB 3CCSN 3QEIA 4FM0A 3OYMA 3MM8B 1WOSA 3GP9A 1FRHA 1YIJN 1U49A 4OMFG 4K59A 2IYGA 4DX5A 2GVZA 1LFPA 5L1KA 1Q9XA 2OO4A 4IR1A 1N32J 1HNIA 2WC9A 3RB4A 3IRXA 3O9SA 5KPZA 2LA6A 3EN9A 2Z1IA 2RN2A 2E5IA 4CK1A 2FBYA 1H6KX 1KVKA 5KRSA 5AQOA 3NVMA 1TZ0A 5IV3A 3BJYA 3CTRA 5A8RB 3LL3A 2BOPA 1OQ3A 4GC6A 2HHSA 3MCNA 1F5BA 2FVPA 4RBVA 4TU7A 2O66A 2X7IA 4QOZB 1HBMB 1PYSB 1VC5A 3KJVA 1KOHA 2NYIA 1GX5A 2HFSA 2XTJP 4WFAQ 3KHLA 3M6GA 1SQFA 3I6PA 3ULEA 2HHQA 1IKVA 1RAOA 5CHCB 1U2CA 3M6UA 3Q0AA 4E19A 1TL1A 3VWSA 1JXVA 3J80O 4WQ5C 4KJIA 2QWPA 1S9FA 3H0PA 4MO5A 3VQDA 2MZTA 3ZTPA 2HBMA 2UUCK 4B9VA 4AQYK 3TO8A 2P9KB 3CNQP 2YNGA 1Q7YT 3M9MB 2YX4A 1W2BM 2PZSA 4W5TA 4U95A 5AZJA 3WQUA 2V51B 3O3HA 3D1QA 2P9CA 3UCZP 4DV4K 1KQKA 3TUIC 2QFJA 2F9DA 1FO1A 1IJJA 2EBEA 3E01A 2YX1A 1QAIA 1Q8LA 3Q7CA 1FEHA 2ZJQQ 3MOZA 3S3NA 5F1XA 4LRCA 5C12A 2FBXA 2FC8A 1VQ7S 1WORA 3CJ9A 4NO7A 4CGJA 1E6VA 1K73T 2RRAA 1WOQA 1SJ4P 4H03B 2NZCA 4C8KA 3MN7A 4ALZA 1YSJA 1F2HA 5KPTA 2LYVA 2LXUA 2DTJA 1H98A 3SXLA 5AXKA 4I4BA 4FYXB 4N77A 2VONA 3VA0A 1WEYA 1HLWA 2NLXA 5AT1B 3B6OA 4X4RA 5BR8K 2ASMA 2UZAA 2QA4N 4Y2AA 4GO7X 4BGBA 1OY8A 4AYBD 4LF8F 2XCAA 3M32B 2W40A 1E6YB 2PE8A 3JQMA 3ZT2A 4W5QA 2GVZB 2H51B 3J7YP 2O3DA 1HWKA 5DM6Q 1TKZB 1NXIA 2XMWA 4JI4F 4H4KC 1N34J 3VAKA 1JJ2M 2YWGA 2EG1A 1G2EA 1M0SA 1JJ4A 4IOXA 4NYOA 4ED0A 2CPHA 3CFRA 1R43A 2FHKA 1YHQS 2DNMA 1BE4A 5GAHP 4JHDB 4ZIWA 1JNZB 3CJCA 2KT3A 3ZETA 1FWLA 1IWGA 1XNRF 2XMTA 4J9NA 3O2IA 4HH1A 1BHLA 3AO4A 3JQKA 1WAJA 3KMQA 4LF2A 3T6JA 2OHDA 2PMWA 3HT3A 3Q8RB 4UY8O 2YKNB 3PO5A 1XEZA 4CNYA 4WE1B 2P5OA 3O5BA 1FJGK 2HRUA 3LA0A 4ETZA 4B3TK 4H0PA 2UXCF 5CE3A 5DK5A 2VQFF 1JQGA 1VHXA 1DJ0A 1ITPA 5AJ3J 2I5JA 4URGA 2O01C 5ADXA 4ZPAA 5LSLA 4CTAB 3MWPA 1Q81T 3VMFB 2MHEA 3PR5B 3CG7A 1RTHB 4M94A 3CI5A 4EO6A 3EVOA 5DQIA 3SYZA 4DR6F 1NMEB 3AJ2A 2FXUA 3VAIA 4JRPA 1YJVA 4IJAA 1N8RT 3ULHA 3GJQB 2V4JB 2HGNA 4L3KA 2QYGA 3BO4A 3A3NB 5A6WA 2IRUA 3ZFVA 3NFAA 1Q82T 2FQQB 3MI7X 4BRMA 1GLJO 3GCWP 2F5GA 5AQKA 1F6TA 3ZZUA 2HHXA 2ZJPQ 3M8QA 1IJFB 1P1LA 3MR6A 2OPSB 2RUGA 5HOOA 4JI6F 3SQ2A 2VODA 1CG2A 3SK3A 3G82A 1B0PA 1T7PA 4OZNA 5GIOA 5CYMA 5LXYA 4JI5F 1J54A 3QIPB 3TRGA 4FWLA 3VN5A 1ZC6A 2HMPA 3OL8A 3G71S 5DGAA 3P83D 1SC6A 5CYQB 4PABA 5KG1A 4X64K 2FF3B 3KLHA 4L73A 1OSDA 4MIBA 3O9UA 2GCFA 1NGHA 2B8PA 4AXIA 2R8JA 2Z57B 3K7RA 1RADB 5EVZA 3VESA 1FKOB 2W41A 1WHYA 5FIIA 3SUOA 4IG3B 3LDQA 1HNVA 3ZSZA 3TVZA 1WSIA 2E1ZA 2OYQA 4E89A 4DV3F 4H4MB 1AW0A 1HBUB 3VGLA 2GUIA 4BQLA 4OX8A 3D45A 4FK2A 2G8KA 2M70A 1IWAA 1QTMA 1I94K 2XBPA 1FF2A 3G4SS 1KVBA 3KKRA 5DDOC 2AWZA 3CD5A 1TELA 3TZWA 2YHWA 1W0HA 3SJJA 4KY3A 3C19A 2KRBA 3CCEN 2QYCA 2VGNA 1UFLA 2ROPA 2KYXA 3ZETB 1TL1B 4NZ7A 5I3PA 4MYUA 2X1FA 1FD2A 4K4YA 4UF4A 1M90T 1VFJA 4I9LA 4QW8A 3C2PA 2I7NA 1RACB 3TA2A 5AXLA 2F3JA 3VGUA 1BOTO 1GH8A 3C15A 2V2VA 1YXQA 1W7WA 1UW9A 4NLGA 1PC5A 4XH4A 2IA0A 4ANDA 3B6PA 1APSA 1RDCA 3M3ZA 3G6ES 1E6VB 2IM2A 2D69A 1CEZA 5CZ2A 3GWCA 2WBRA 3V4IB 4B3MJ 3TAFA 3PSIA 4EYIB 4NLQA 3K0JA 1GTHA 4GKKK 2KT5A 5DG7A 2GIQA 2EWSA 1J5EK 3GFHA 2QWMA 1R27B 1WSHA 2HMIB 2RHQB 1RAJA 1RAGB 5LL6d 2R2TA 2HHHJ 3QYYA 3PIPL 4Z94A 4EP5A 5CR4A 1Z05A 1TP7A 3D0IE 2IA6A 4IFYB 1T9WA 3LZIA 1S5JA 3BB5A 3M32A 2QEXN 2FZCB 3QIPA 2KH9A 3M2VA 3D2WA 1DFDA 4O44A 1BCOA 2LEAA 5HVFA 4GMJB 3C7NB 5M1OA 3KK2A 4I7FA 4OGCA 2QGFB 1JXBA 3MXIA 2XRIA 4JKGA 3C6HA 2F4VJ 3HSJA 2FLLA 4B1YB 4GVLA 1XR6A 4M95A 3FBCA 4KHWA 1BA0A 4DX6A 1GQEA 2IAJB 3KD5E 4DR3K 4FWOA 1KAXA 1TL7B 2LQ9A 1V5IB 1QSSA 3HHLA 5CD4A 1VQ9S 2F8HA 2HBYB 3PYEA 4ZTJA 1GMVA 4JI0F 2FHMA 2VU5A 4AL7A 2P9EA 2VA3A 4PG8A 2D0PA 2MB0B 3KK7A 2DHHA 4KKOB 3LWLA 5M1QA 2P9LB 4A8FA 4JD2A 1UTAA 4DSJA 4OPHA 5FPDA 4CM2A 5E26A 1U26A 1L3KA 3U02A 1TFYA 4J9VA 2R8GA 5I9EB 5KT4A 3ASMA 4USJC 1SQKA 2LMIA 1DTTA 3HYFA 2UVWA 2HQDA 4M7XA 4NEZA 2DGUA 1FERA 4FXDA 5HP1B 4CJSA 4E7HA 2POKA 4JI6J 3MURP 1BQNB 2LXIA 3PM9A 1BO5O 3H08A 2ZUGA 1DBDA 2PC6A 2UXDJ 1W25A 3BKTA 3CCQN 3HRGA 2V9KA 2BJ1A 3FZMA 4CRJA 2DT9A 2E20A 2VH7A 3AO2A 4RW7A 4O3NA 3I0RB 4DX8H 4UOGA 1WC6A 1HW9A 2NXNA 1X60A 3DI6A 2NCKL 2BTFA 2O8DA 5C5JA 1ZXOA 3TUPA 3OD2A 4KYZA 4FF3A 3HVAA 1I3AA 1SJRA 3EX7B 4BACA 2MQPA 1CJTB 4MK7A 3R8YA 2W9AA 2B4JA 3KHHA 1H0HB 1TKZA 1Y3KA 3Q8PB 2MKCA 5EWGA 4XPEA 2KVIA 4DOZA 2JJ4D 1ZBTA 4DFKA 3M8ZA 4KHPJ 2L48A 1WTFA 3GIRA 4QU7A 2L9DA 4KB0A 3LGHA 1T44A 1Q78A 1TQLA 4K2XA 5CZXA 4YOXA 4OKKA 1C0UA 4YNQA 1BA1A 1WEZA 3E8OA 2KLAA 1OSCA 1SJ1A 4O44B 3CXCM 3M2UA 4H4MA 3ZC4A 1HNWK 3SUPA 1N33K 4G1IA 4ZJOA 1M5HA 4IG3A 4RW9A 2KM8C 2ZD1B 1WKJA 3M30A 1Y7PA 3T5LA 1NRKA 1FI4A 4A59A 3AGKA 4WE1A 2KHOA 1YTAA 1VLOA 5FDLB 1TL7A 3QGGA 3UN3A 5LMNF 3CCQS 2KRRA 5D4NA 4K41A 2GZOA 4X62K 4G1QB 1S76D 4ED8A 4BBYA 1H3DA 1R8PA 4FJIA 1ZBHA 5KFHA 4DCPB 4CTAA 1HKAA 3N9UC 1T9TA 4URQU 4GKKJ 3QFHA 3UPFA 3PZPA 4WTYA 1PSDA 5EUHA 3MEEA 1S48A 3NL0A 4ZOSA 1YIJS 4OIXA 3I56S 3VAGA 4QYZJ 5AXMA 4I0WA 3EGVA 1H74A 3VF2A 3M6WA 1U4BA 4DTSA 1T9UA 2B9YA 3MM5B 5MAOA 1CJKB 1OIAA 4TU9A 1LW0B 2CQ1A 4Z7YA 2W4PA 3CMQA 4EU0A 4CZGA 2R7SA 3ZTQA 5EX5A 3OUYB 2G8UA 3GR0A 3CCLS 3NEKA 4TN2A 2VOOA 1VGYA 1D5AA 4W4MA 3VAFA 4B9SA 3V4IA 2ZOMA 5GADP 2CNOB 4USIA 1DLOB 3MHYA 5JJBA 2FZGB 3WHIA 4RW8B 1J5EJ 1B70B 4ECTA 1S12A 2P9NB 1Q7LB 2VUGA 5K8PA 1ZPWX 4DBQA 3HSCA 2VWJA 1XNRK 4OZ1A 2VFSA 1X9WA 4CT8A 3BSOA 2VFTA 2ZM6F 3Q86A 3CCZA 1K9MT 1WLJA 1SUQA 5D77A 3KLEA 1U25A 3QQCD 3SLCA 3C7NA 2G9OA 3B54A 3NNAA 5LMNJ 3M8RA 1QUVA 1CJTA 4OHXA 2AA4A 1REGX 1PIEA 4ZMMA 1V6HA 3TSPA 4BR7A 2U2FA 2FHJA 3OVNA 2OEJA 2J6UA 2EK1A 4CGFA 1JJCB 4X4UA 2BANA 5KT5A 4DV1J 3HHLB 1R31A 3UD3P 3Q7BA 2DNHA 2IAJA 3LP0A 4CLLA 5IWAK 4RBUA 3DLLQ 5TKYA 1B92A 4P73A 3J81U 1J5EF 1ESVA 3CFPA 3HOSA 2FSJA 1MMDA 3CCMN 2DFEA 4JI2F 3CC4S 1RBAA 1XBWA 3EMTA 3S3MA 3O44A 2CQDA 4ECXA 5DG9A 2DGWA 3NH1A 2AJ1A 4ISGA 4BRLA 4QWDA 5H1SQ 4CO2A 1NJZA 4ZVPB 1FFSB 2V34A 4E7KA 1AB8A 2VD3A 1RT3B 4XDDA 3DJCA 4BC5A 4CEFA 1BQNA 3LTOA 3MX5A 5KT7A 3UDCA 2FJAB 2PFFB 2YNGB 2KB2A 3TSQA 4DXLA 1QDUB 4JN4A 2MQ8A 3SI8A 2AKWB 4O4GB 2DIVA 1C6VA 3TU5A 4BR2A 4TY8A 2H5IB 2GVDB 1C1AA 4HVJA 3HTVA 3QB0A 2ROGA 3DI6B 4LRBA 3MMAB 3I87A 3MECB 1FDAA 2W7OA 2OP5A 2MKIA 5CABA 2AIRB 2E1RA 4FJ5A 4J9KA 4EZ6A 4DU7A 2BKPA 2DH9A 1HNZK 2FLNA 4DV6F 3GYGA 4UT4A 1I94F 2C42A 1GMWD 2MYFA 2IJRA 1YITS 1XMBA 3OXFA 3I5BA 1SCJB 2XY7A 2HF3A 1PC4A 4QS9A 5ETLA 4B1UB 4BRPA 4B1WB 3EGWB 1NBWA 3TTDA 3HOTA 1X5TA 5GAGU 5HROA 4YB1P 2EPIA 2B9XA 2CPZA 1IBCB 4EBDA 3EJMA 3DLHA 3SQ4A 2B4PA 1T03B 4EBCA 4W5OA 4C8MA 3KUGA 3UNGC 1JLGB 3DHWC 4FL9A 5FROA 2WHOA 4QWCA 4PXCA 4ZP9A 4AHVA 1WWHA 4CGIA 4XO0A 3NCQA 3DDKA 4UZBA 3H5UA 4NZ6A 4JV5K 2YNFB 5CQGA 3PUFA 4BS2A 2UUTA 4U67L 4M5DB 4PWDA 3NOGA 3ZT4A 5F8JA 2Z30B 1U0HB 4CO4A 4F3OA 1LAWA 3NOCA 2HVIA 1DTTB 4X66J 2BJDA 2WTFA 1XC9A 2LEPA 1YVNA 2IVOA 2AEFA 1K1SA 3KWGA 2P9KA 4IO8A 4CBXA 2F4VK 4K5RA 5HK4A 1DTQB 5A76A 2ALZA 4FKXA 3VAMA 2RDJA 2KZZA 1YJ7A 1WHVA 4B9LA 4X2BA 4ANEA 2VOPA 3KTQA 3WNGA 3NH2A 1HKGA 3DN9A 4I6YA 3SAGA 2LKZA 1FW6A 5CHIA 4HUGA 2MGZB 2HBRB 3GV5B 2XMUA 4FNIA 3OUYA 1VK8A 4NCAA 4DV2K 2DB1A 4C0HA 3OVAA 4PYAA 2XS7A 2QC3A 1TYQA 2RUSA 3MAHA 1H72C 2UUAK 2R7VA 2W7AA 5AR0A 2Y1RI 2EW9A 2EI5A 4KHNA 1S57A 2UXBK 1BISA 1H2TZ 5KFVA 4IDKA 5A0YA 5U47A 4X4OA 1BDGA 4DV2J 1RYSA 2IRYA 2HF4A 3C46A 4EZ9A 3TANA 8ATCB 1XK8A 1TKDA 1LK7A 1RU2A 1FXXA 3CJ8A 3IR5B 4F02A 2D5RA 1F5CA 2ACMA 4ZVFA 4DN0A 4DR4F 4ILMA 4AT1B 3U3GA 1D9FA 1EKRA 1MROB 2G8IA 2P6TA 3FCWA 3BZKA 4FJ9A 4FWQA 5EWFA 4NRTA 1O1WA 4IFVA 1IJEB 3DXMA 4MH8A 5A2QO 1NGFA 3VEXA 2CDRB 4DU3A 3QZ8A 1GMWA 1P9YA 1XQSC 1TV6A 4PKHA 3D5MA 3RB3A 4A8SA 3K17A 3IWNC 2CPXA 2YHAA 1RTDB 2B7BB 4XK8C 1SKWA 3CJQA 1Y11A 3LWMA 2RHSB 5IV4A 4PKIA 5FRMA 3PW5A 2OLWA 2RE1A 3W66A 3L2VA 4F0HA 3KUHA 3HZ6A 2WTUA 3NGIA 3NMRA 3CQYA 4Y28C 1NGBA 3WUHA 2WVCA 4A8QA 1U8WA 4C48A 2GELA 2FJDB 3BBCA 5B0FA 4KH1B 3UVJB 2DRBA 1GNKA 3NCPA 1K8KA 2JSXA 1U47A 2O8EA 1HYSA 2ZHBA 3E51A 3FR0A 5HRPA 2UXDK 1WG5A 3OTCA 2KJWA 3BP8A 4U7CA 4NCBA 4JI1J 2FYXA 3CC7N 3DOMB 3TAPA 2F7TA 3OPKA 2P1JA 2ALYB 3PR4A 1TAUA 5KFEA 4CF2A 5EY4A 5C2GA 2HHTA 3IBWA 1HMVB 5LL6Z 1HHTP 4EGLA 3V2UC 3BGRA 2PYJA 4LF8K 2BM1A 4HHUA 1PKUA 5KOWA 4RW8A 3EWGA 5IT9Y 3QAUA 2G4BA 2FDNA 1GLLO 4GVBA 1VQSA 2D3ZA 1UPPA 4G1PA 3W3SA 3D66A 5FLXU 3C94A 3EE8A 3VQ8A 3FQLA 4UUWA 1LOUA 1KQFB 2CADA 1S3XA 1VDHA 3OBYA 2HNYA 1CJVA 4B8CA 4FWPA 2WFBA 4JS5A 3CE8A 2GAGC 2OJ3A 2V94A 4Z2XA 4W92B 3L2UA 4BRAA 5KFXA 1RWMB 4ZCIA 1KD1O 4RBTA 3ZNJ1 3MR5A 1VSMA 2MZSA 4DUZJ 1ZA1B 1RAAB 1HD1A 2GWJA 1TUUA 2Y8YA 2K7KA 1GOAA 4FXVA 3T1HF 3VV2B 2B5JB 3LDPA 2RIJA 3U7JA 4DV7F 4DTMA 1WAFA 2W42A 2J7UA 5HRRA 5AQJA 2VPXB 1U09A 1KEKA 4Q0BA 1S0NA 1VK3A 2HFUA 4ILGB 3BO2A 2ADCA 4J2AA 4IOBA 2XB2D 2V8HA 4YN3B 4J9OA 3WIVA 2VGMA 3ENQA 1HRHA 3A0IX 3IKMA 5BPMA 1WC5A 5B0BA 3DMJA 4GW6A 2YNHB 4RG8A 7FD1A 2VIHA 3MXHP 2KL8A 3CCRS 4HUFA 4QCLA 1PJ5A 1HNXJ 2FHJD 2GHWA 4B3SK 2E7WA 2H5EA 1G4CA 2P9LA 1WD6A 1TVRB 1KN6A 4B3MK 4USHA 4FLTA 1UOCA 3KLFA 4CJPA 1ILYA 2L9NA 4TY8B 3M9OB 2I0XA 3AQOA 1RA6A 3P8BB 1IBKF 3KNGA 1SC3B 4C8LA 2MZJA 2HVZA 1Z6RA 1YX2A 1RWVB 2I8EA 1CXUA 2JEIA 2E1PA 5D0EA 3V9XA 3CMEN 3IBCB 1NKEA 4CEBA 1TYQB 3UKRB 3NS6A 4B3SJ 1AFIA 1YI2N 3VVTA 3JSMA 4OO1J 1BLUA 5IWAF 4DUYJ 3AVCA 3JAMY 2WVBA 4C3KA 4IFYA 3TTCA 1HKCA 3H1VX 4CZJA 1IQTA 4FZXC 3ZEUA 4J2BA 2C3PA 1VQ5N 1X4CA 4KB1A 2V6AA 1VS3A 1T9XA 3IG1A 1VQNN 3N01A 4CH1A 5I3UA 3GFZA 1YJWN 3MZIA 3CO9A 4CW7B 2ASPA 3IM8A 3CCRN 1NKCA 2X3GA 1HQ2A 1S79A 1YTYA 2P9IB 4CZMA 2J0WA 5EXWA 1BG3A 4LFBK 1TFWA 5B7WA 1YTUA 3D28A 2CPJA 1EWQA 3VF4A 2MLZA 5J1EA 5KFQA 4H0XB 5MLCV 3VQSA 4FZVA 2BV3A 4EHUA 4Q7AA 3BBBA 4JKAA 3DGPA 2Z8QA 4WXWA 2BX6A 3LAKA 4OLPA 2ZHOA 4DDFA 1U1KA 4JNEA 4JEPA 1NMDA 1FKAF 2CYYA 2AT1B 1GAOA 3HHKA 3ATVA 4DR1F 3FC9A 4DB3A 1UEKA 4O23A 3CF5L 4QWAA 3KK1B 1T3OA 1FRKA 4H54A 4ETXA 4H5VA 4HH0A 1TMMA 4DV4J 5F8LA 4FBUA 2CRLA 5D6GA 4CJQA 1B0TA 3AVLA 3NLCA 4LFCJ 1UPMB 3BGRB 3IR6B 2ZVIA 4IR9A 1OH8A 1H1VA 3VA3A 4X66K 4U96A 3W8PA 2CZ9A 4KR0B 4C2MA 3OA9A 3LANA 1ZM3A 4WU3A 1MMNA 4DSEA 4KHYA 4FXWA 3P31A 1Z26A 1TU0B 5IM0B 2JEFA 2A5XA 4X62J 2CQ2A 1VQ7N 4P2MA 3QAEA 4PHTX 4MIWA 5IQQA 4BRIA 4E0DA 1S6UA 4R8UA 4V19X 2OKQA 2E5JA 3RB6A 1YRTA 2VYPA 1GLAG 4I2PB 5J2QA 2FD2A 4JK7A 4X4TA 2G2ZA 3GE9A 1A6LA 3IMXA 2Y1LB 3Q23A 4RNOA 2YNIA 1I6JA 1FXLA 4BG8A 1NSPA 5L8RC 1B64A 2LCWA 5DLGA 2C2EA 2HFVA 4ENOA 3ZZOA 5EOYA 4RW4B 2BOAA 2Q0RA 3ISND 3A13A 1IKXA 1N0UA 3PRBA 2BKNA 3M2UB 3R5AA 1HA1A 4I9QA 4RU9A 2D0AA 3SBMA 1OH6A 4WFNL 3MM9B 4Q0BB 1UA1A 4YDUA 4A62A 3Q8YA 3HMJG 4WFBQ 3DM2A 2IM0A 3LGMA 1MSWD 4KREA 2UUBF 3MD1A 1JX4A 1RT7A 2RDIA 3AO1A 2IS3A 1VQKS 1QVGM 2YI1A 4V19S 2FJBB 5J1NA 4ISEA 1VBYA 4C9DA 3LM2A 4TY9A 3TVYA 3BGOP 1XNQK 3QO9A 2XGQA 4YY3K 4F26A 1FESA 3CJ3A 4JKFA 5DM7L 3VQQA 1HYSB 4M3RA 1PGZA 1UJ4A 2IM3A 2J0QD 2P51A 1FDBA 5D0RA 1O13A 1UVLA 5ELZA 5B8HA 3SDEB 3H5YA 5DETA 2HK2A 3B4DA 4K0KF 1H7XA 1NJIT 3RAMA 2LU1A 2QXLA 1FXDA 4ZTFA 2CJ9A 2IRXA 5F0XA 3EO3A 4JI7F 3MCMA 3THYB 2VG6B 3RAXA 2XMKA 2KO1A 4DV1F 3UIQA 2XC9A 4ZJLA 4CLUA 5KT3A 4AQYJ 2ABYA 4W90B 4WJBA 3M8WA 5HL7Q 5HMZA 3CDWA 3M8SA 5ADXH 5LY3A 3BGFA 1JLQA 4FJKA 2ZWPA 4WU2A 1REVA 2EFOA 3OR2A 4QIVA 2MZ1A 5AQQA 1X7VA 2A1BA 4NE9C 2CVEA 4ZLLA 3AH6A 4IEIA 5KQDA 3ZEUB 2ZOFA 1ZA2B 3D3CJ 2XO7A 5LJVA 1VBZA 5FLXY 1LW2A 4TSXA 4URSA 4JYAJ 3CJTA 4QBUA 2Q0UA 1FJEB 5GAGP 3UE5A 1HBOB 1NZAA 3S01A 3RW7A 2J5AA 3CCMS 3ZZRA 4FF4A 3TUJC 5JS1A 3T6BA 5DS7A 4K0KK 1JLCB 2GW8A 2GMJA 3P45B 3X3UA 3ETMA 4IBNA 1RISA 3ZZTA 4F25A 2KM8B 2IM1A 2C2OB 3MM8A 2ASOA 4MLHA 2PSZA 5SWMA 2VWBA 4BRKA 3TI0A 3KG1A 4F67A 4DFJA 3OBWA 2QM1A 1M5KC 1M90O 2YKNA 1KQGB 1GLBG 1X3NA 1X8DA 2ERRA 1U1NA 2AEMA 3E2EA 4KHRA 2MPUA 2FVCA 3DU5A 3UDEA 4MIAA 3O9QA 1YQHA 2K1RB 5CH7B 3U1MA 4CLFA 2DNKA 3FMBA 1N5QA 3HSZA 2CQPA 4OYWA 3G0ZA 3R2DJ 2OTLS 1KSPA 2ZVSA 1T6CA 3PIOQ 1NMNA 4CJRA 4BVPA 5M1KA 1NHUA 3GONA 3THXB 5CD4H 1S10A 1D0EA 1RBOB 4FF2A 4AHCA 3V9WA 4DQQA 4CO1A 4JI2J 1JCEA 4P10A 1WOOA 3UKRA 3PW7A 4B1VA 1SJQA 4H4OA 1ACMB 4YUDA 1CPZA 2LXFA 4CFAA 3FBFA 1WC3A 3RMCA 1E4FT 4QIEA 4HI2A 1OYDA 5C24B 1S1VB 2R7OA 1ZM4A 1KRPA 4A46A 2ITMA 1CULA 1DY3A 2IOCA 1RLCL 3UI3A 2HBQB 3ENWA 5C25B 2YKMB 1NK5A 2XNQA 2WVFA 3RSEA 4CO0A 3VEZA 2CNKB 3UFCX 2DKOB 2DNQA 1Y0HA 3C95A 2DPIA 3KG4A 4WIIA 1YUWA 4F04B 1FWPA 4XTTA 3H20A 4KBIA 2AJFE 5KFIA 2QE5A 4OYAA 3MMBB 2FVQA 4WZMA 4H0TB 2ILYA 2Y8WA 3NF7A 4W5NA 4ES3A 2W25A 2CWXA 1WKKA 4KFBA 3RZAA 2JWNA 1VJQA 5AE3A 1RBRA 1RBLA 4CJ5A 3U1NA 5FJ4A 2WB1D 4LSNB 1IN0A 3W2VA 3OHBA 1RXOB 2GWKA 2HS0A 1PO6A 6AT1B 4RW6B 4NMXA 3EYZA 4MFBA 3IAYA 3MUVP 3KNAA 2D1KA 2OEMA 3I82A 5D4LA 5IC6B 1WI8A 2WW8A 3QDKA 2YKAA 5I42A 4USWA 1U8SA 2V9WA 4OQJA 4JI8F 3A8JA 3DDNA 1RT2A 2E2OA 3PKMA 3QNNA 3NNHA 3CXCR 4U7BA 2B6AA 2D4WA 3NE6A 2BMBA 5EX0A 1RWNB 4J9MA 2WSEC 2P5GA 5ETSA 5KG0A 4YP3A 4KRWA 1SKRA 5L39A 5LMUF 4FYWB 2I1RA 4IKFA 2HLTA 1NO8A 3TAEA 1N36F 2NR0A 3SBTA 2V4QA 5A8KB 3HDSA 3H25A 2LP4A 1XMOF 1NH7A 4ZVGA 2ZC3A 2MKHA 3VEVA 1YI2S 3OSPA 4DHVA 1O5JA 4DUYK 2J7KA 2EKYA 3VALA 5K8MA 2X78A 2ZBPA 1HMVA 3C65A 2HFNA 1JCFA 3FNNA 4L72B 1N52B 3LGNA 3TJ9A 2I5JB 4CK3A 4CZKA 4LSLB 1K8AT 3DXBA 1EB0A 4MKAA 3SCKE 4K8ZA 4FOEA 3L4BC 3NGYA 2NLWA 3HPHA 4QWEA 3S3OA 3GMGA 3GIJA 3CEDA 3F56A 3R1LA 4OVLA 2C2KB 1UCNA 3RB0A 2N7YA 4L6V3 2CQ3A 4P72A 3G8SA 3L0QA 3BH7B 4C0BA 1MG7A 5GAEI 2H3EB 2ACYA 1TUYA 3QFPA 1LV5A 4IXCA 2VBYA 1NK9A 3VGMA 2VDIA 3H90A 3CM6A 1OH5A 3OYDA 1GT8A 1SH2A 3OTDA 2IJFA 4YDXA 3Q89A 4CM0A 1WKLA 4ZPBA 1RE1B 1SI9A 5D3GB 3DRYA 3G82B 1S97A 4PRFA 1E3MA 3M8PB 5AZIA 2E8AA 4G3IA 4EAHD 3SSSA 4CJEA 1X0FA 3GJTB 3VCDA 3HJVA 3KLHB 3C8YA 3VAJA 1RA7A 2JH3A 3E66A 3V9ZA 1A5VA 4ZITA 4HTIA 3H40A 4FS1A 1UAWA 1NDLA 1ZAXA 1OH7A 1XMQJ 1XIQA 1Q18A 1VYAA 1RAFB 1K0TA 3FEYB 4ZJQA 5J2PB 4LFCK 1RB0A 4NOHA 2FGOA 5M1PA 1N34K 4LF1A 3CCLN 3A3OB 2OI2A 1NOYA 5BYSA 1K1QA 1UW4A 3SCJE 4NXMK 4C3LA 1R8CA 4LF7F 2UUCJ 3DYAA 4M5HA 2W24A 2RSQA 5J1PA 4Y0WA 3HLUA 5AQWA 2QG9B 3Q24A 3TEHB 4DPUA 2ZBQA 1HNXF 4KHQA 3GL1A 1N56A 2VBXA 2DHGA 2WK4A 4FDFA 4ZVSB 1Q79A 3D67A 4S0MA 2QWQA 3KFWX 5HL7L 3L2QA 4PR6A 1BWEA 5B0AA 2YKMA 2BACA 3D9BA 4NLUA 2AHOB 3RSEB 1HBOA 1HQEA 2QWNA 4CHZA 1ZS6A 4NCGA 2R7QA 3DCAA 1FK9A 1S49A 3BF4A 3QJLA 1NGGA 2E4LA 1BQMA 3MMBA 1VQMN 3K89A 2WBMA 3CIPA 4ZPTR 1HWJA 2ZJRQ 2A6AA 3E9LA 4E3SA 1RBVA 2PYLA 3DC2A 5I3UB 2Z2ZA 4R5PA 2SXLA 4I67A 4AHUA 5KFTA 4MDBA 5GAEP 3THWB 3V6HA 3BZQA 4HI1A 3RBDA 2DNLA 5I42B 4PPDA 2QEXS 1RCOB 3LM9A 4ER8A 1KQSR 1UJ5A 4ZHRA 1RWXB 2GX9A 3K2PA 2QA2A 4NLCA 1SB6A 1LXNA 5IWAJ 1VHIA 1NUEA 1VQ4N 4KH4A 1BIUA 1V9OA 1TL3A 3ONQA 2DVIA 3M2VB 1Y64A 2JWKA 5CZ1A 3H4BA 2A6MA 3QMLA 2ZJQL 3U3YA 2EBGA 3MFIA 1PJ6A 1TVRA 4NRUA 4FWNA 3THXA 1JXLA 3OTOF 2FUG9 5CYJA 2PEBA 3H98A 4FLZA 4I56A 4FCYA 2MKYA 4LIWA 4LF4J 2KG1A 1Q86O 2C2DA 1X5SA 4KI4A 1TL5A 2DISA 1JLAA 4B3OA 2UP1A 1DQ9A 3NY0A 2V63A 3IP0A 4BRHA 2K06A 4DL3A 3KDOA 1FJGJ 2ZZMA 4BR0A 3AO3A 1R59O 5C2CA 1VIOA 5F8IA 1PILA 3C16B 1VOMA 4J2DA 1RABB 3LP2A 3B4MA 1IQZA 1GFWB 2COLA 3BPSP 1Q8KA 4ZPWR 3NGZA 2G2YA 4KAZA 4DV7K 4MJKA 2QWLA 1N5VA 2VC1A 3OL7A 1EQYA 3AVGA 1NM1A 4HTLA 3EXYA 1G6BA 4M63A 4B8AB 3S8SA 4BRFA 5FD1A 1HJRA 5IM0A 4HDGA 4PPZA 1YBUA 1KNZA 4IG0B 2VPWB 1S1XA 3DLKB 2VZ9A 4AM6A 3LO3A 2H65B 1VSFA 2AYBA 2PDAA 4NA2A 2BJ8A 1JNRB 4RW6A 3A2FA 1YRXA 3OR1A 1GLCG 4BC7A 3HK2A 4WYLA 3ICLA 1EX8A 5E2QA 1CJUB 1S1TB 3D0PA 4CEOA 3FJ2A 1J5OB 1XWLA 2CJYB 2VHGA 3OW2R 2A40A 4CHOA 2DHSA 5GAEU 4DV0J 2RF2A 4M7YA 4FPBA 5LM7E 5AFUH 2O8CA 3SSQA 2YTCA 5J2MA 2YWWA 3L8BA 4FLWA 1Y10A 2M7SA 2OA8A 2LU2A 1PAUB 1AXQA 4KQZA 5SUHA 4RUBA 2EKNA 4AE5A 2X74A 2CWKA 2BDPA 2D3O1 3THWA 1MU2B 3PDNA 5C42B 3LQVA 3DLBA 3HI0A 4OLBA 3AB2B 4F9OA 3W8GA 3FFIB 4EHTA 3I5AA 1TK0A 2CPFA 4KTWA 2KDOA 1ZETA 4WWSA 5KFGA 3WNEA 2R8IA 2YWHA 2PIIA 3KUEA 3ZZ0A 5GMKa 2P5VA 2J6TA 4K25A 1S7IA 5D78A 1RI7A 2QA4S 2W2OP 3O80A 4USTA 3QEPA 3AGRA 3DXKB 2KQ2A 1OMSA 4V19J 3HBTA 3O6WA 1ZAWA 2R3VA 3P39A 2KI2A 4KH0B 3AOBA 3A4TA 3O9TA 3ULEB 2CXEA 4QAGA 2AYEA 1GOCA 2FGCA 3V6DA 2XLKA 3NMUA 3KJQB 4J5OA 3DXSX 1U48A 4DS5A 1VSLA 2VB6A 1RCHA 3FLCO 1NZ8A 3MUTP 3THVA 5CA5A 2D3OR 2Z1GA 3GFYA 1BUXA 3QT7A 3KD1E 4LSLA 3NKYA 1J9AA 3OL9A 3VTIA 1ZBSA 1FX2A 2WONA 4Y2CA 1TAQA 3EGZA 4GKJK 4QYRA 3TX8A 4ED4A 2UVUA 2GIRA 3R5GA 2QTWA 1JL1A 3DRPA 4LFBF 4Q2LA 1ZH5A 2L3MA 3CJ0A 2AGOA 1PBAA 2D0BA 5AQXA 3BO3A 3QPIA 1N32K 1IR0A 2AMCB 2BBEA 3EY1A 4O4RA 3R6LB 3L2RA 1KR4A 3FZKA 2Z4PA 4E1MA 3OYCA 3KHRA 1O8BA 1EIYB 2QWRA 2ZGYA 3UKUA 5F9NA 4L76A 2JNJA 1K73O 1CZAN 4OYBA 4FK4A 1RKJA 2IVYA 4CJ3A 1OKJA 4JUZA 2DXFA 2R2SA 4GKJJ 2JVOA 2OIHA 5IFMA 5L38A 2N3OA 4C3MA 4XEIA 3MWTA 3OYEA 1RT1B 2E1YA 2NRXA 4OX6A 1M5VC 3T1YK 4M5IA 1N48A 5HRSA 1Z4UA 2F8EX 1GLFO 4KPCA 1NH8A 3O3GA 1XMOK 5ETPA 1D8YA 1VC0A 3PY8A 2KZMA 2AGPA 2J8AA 5E3PA 3ZTSA 4AILC 4BQZA 1MU2A 4DR7J 3J80U 2GGPB 4C98A 2CQ0A 2JFKA 5B09A 3FFIA 4CZIA 4NXNK 2GA7A 3CPWR 1IH7A 8RUCA 1BI4A 1T95A 3M05A 1W7AA 3FBEA 2BANB 1NB2A 2V8DA 4WF9L 1SAZA 3W63A 3WDOA 4HTJA 4TYAA 1EP4A 3QIOA 4YOTA 3WEEB 4EK2A 2DHXA 2UXBF 2A1RA 3BBFA 3VVUA 4CEEA 2HG4A 2M3DA 4M63C 3O3FA 3HX9A 1NHVA 3CW2C 3KLGB 3EEQA 3N6NA 2NRHA 4DTOA 2IVMA 2ZF5O 2YQ3A 1OYEA 2ZDPA 3AY9A 2HQ3A 3MF5A 1HQEB 2XY8A 4DV5F 3BYRA 4DS4A 3GB0A 3OFHA 1SH0A 1Q53A 3OS2A 2ZJRL 4OKJA 2JLEA 4ERDA 2VQEF 5F0WA 2RRBA 1SJ3P 1BQMB 4PUOA 1FD8A 1EQ0A 1Y97A 3IAS9 2XI2A 4Q44A 3DLKA 1RDDA 3JTPA 3TOQA 3FGVA 3MPDA 4JV5J 2PGCA 1IKYA 4ECZA 1RT4A 1VISA 3CQ8A 3QEVA 3MMCB 2G2OA 4P7TA 2HW3A 3BSNA 5F8GA 3BGUA 3BUZB 5KFUA 2WRMA 4NLOA 1HWUA 4ZDNA 2F8TA 4CEDA 2W6LA 2DNNA 2XSFA 2GS8A 3ZO7A 3AAPA 2Z56B 4PL8A 3H4DA 4BRCA 4OPJA 2C28A 3KK3B 2RDDA 5M1FA 4EI2A 4PWUA 2E2PA 1UKUA 1RAEB 2V2KA 2RILA 2ZWOA 1MWMA 1KFDA 2MQOA 1RKIA 5C42A 2HRTA 3OJSA 3GJSB 3TARA 4MK8A 4U9RA 1QVFR 1NU4A 2O8FB 1C0TB 3D1HA 5JLFA 4B3TF 4BROA 2IMOA 3I5CA 4JI7K 1H2UX 3VZHA 2ZBCA 4ZLNA 2LECA 3ZCMA 1J6ZA 2DGSA 1C2PA 1RAIB 3MM7A 2RKIA 4ZPCA 5KGXA 2VQEK 1N33F 4NYFA 3UDLA 4J9QA 1KS2A 3CJSA 4B3OB 2JEGA 1QQCA 4J90A 4HHHA 1R8BA 1VSKA 3HVTB 4NX9A 2IVPA 2XSJA 1FTCA 1RHQB 2UUAJ 3R8EA 4DR7F 3QNOA 2P6SA 3PVXA 3UR0A 3CFOA 4NLSA 4C4WA 4Y1DA 2KYZA 1F3VA 2XY6A 4Z4IA 3CCJN 1OS5A 1OO0B 4WKRA 4HVZA 3P4UB 4JI6K 4EWTA 3P1GA 3AA2A 1DKGD 1U04A 2VKZG 2KU7A 4LF9F 4M3XA 3HXMA 3HHNB 1A5XA 3ZYYX 1JKHA 2E7XA 1WDTA 5C25A 3R6GB 1RWPB 4ILJA 2QA4G 2BUNA 4JKHA 2QI2A 5JVHL 5L1JA 4J7CA 4JV2A 5M2RA 2D0OA 4BDYA 4M1KA 1QTNB 3MGJA 3CD6S 3KOAA 3QRRA 3HHLD 1ZAVA 3AODA 1DQAA 4FYDA 4FWMA 1C1CB 2CQCA 1XTZA 1MN7A 4KT0C 2VWKA 4YY3J 1VK0A 1S1TA 4JB8B 5G4DA 1EETB 3TABA 1WEXA 2DY9A 4JOUA 1F9EB 1N36J 1HX1A 3LPEA 2B5JA 3CGIA 4X4NA 3O4NA 5H9FK 1R0BG 5HATA 4BRGA 4CE9A 5L46A 3MDQA 4IFEA 4DMZA 1LWCA 4A8OA 3N4PA 3N4WA 3BREA 4OHVA 4J9RA 2R8HA 1PYTA 3DDIA 4DCOB 2Z1JA 1QD1A 3PACA 1S5ZA 2IVNA 4DL2A 2YPYA 3I0SA 3WBZA 4BC3A 3IS9B 3W9JA 3KK3A 4B3MF 1YITN 1G1XA 3R7SB 3H3NO 2HQCA 1L3SA 1ZBFA 2V8PA 1PBUA 3L7UA 3I4PA 2GAHC 2DR7A 4RUAA 1VSJA 1VMBA 4HLBA 2HVDA 4IH5A 1FNOA 1WF0A 3MN9A 3IR7B 4KB7A 4ITSA 3L4IA 1WNEA 2HZCA 1YJWS 3DXKA 3QT6A 1RDWX 4FLYA 1VSHA 3JAMU 5AJ3K 5AQGA 2G0IA 3MFHA 5BRDA 3K5OA 2G8FA 3M6VA 3KWIA 3ENVA 1Q7YO 3DRXA 3MPWA 5HSPA 4ZPDA 1H38A 2G8WA 4CHNA 5HVGA 4K4VA 1QE1B 3WEEA 1YG0A 1NK0A 1VQLS 1FFGB 3V81A 2VFRA 3ZSXA 4OZ5A 5ADZA 1KVIA 4DUZF 1FDDA 4B1ZA 1RU1A 3FSYA 3KLIB 4GKKF 4JD2B 2BW2A 3RWUA 3CCTA 3T3FA 3N0VA 1FKPB 3ILJA 2FTRA 1LWFB 1BCMA 1V4TA 3MAQA 1RSCA 3BDPA 4P2FA 1WHXA 3DYAB 1OJ4A 5GMEA 1MLAA 3CD7A 1QAJA 3D0GE 3P5JA 3J7ZO 1I1GA 2HGLA 4ANCA 2ATCB 4X4VA 1MWZA 1XMQK 2DCUB 2PFUA 2NSCA 3PIPQ 4M3UA 1DRZA 2GV1A 1F9HA 2H5JB 5C0YA 1IKYB 2HMIA 3O1WA 5FPMA 4MKBA 4HHJA 1NGCA 3QEXA 3HKWA 4V1Ak 3VEWA 2JFDA 2RQKA 2AF6A 1ZTWA 4FKYA 3P4IA 2EC0A 4O55A 4RZRA 4ZVTB 4F0MA 3CO0P 2PO4A 3HFZB 5KG3A 1YVFA 1FRXA 5EX3A 2GHVC 2XS5A 3R9LA 2IMWP 3AQPA 1NEEA 1RLDA 2XYGB 1O6XA 3HVWA 1D9AA 1Z1ZA 3K5MA 3CULA 3VGKA 1TMJA 2RT3A 3EDQB 2C3OA 2DRAA 5AQVA 2DRDA 4C97A 4ZN3A 2FIUA 4WF9Q 2J9EA 4DTJA 1RT5A 4FJMA 1F2GA 2HAIA 4OYXA 2X51A 2XO6A 3VEYA 3VQBA 4LH4A 2NXEA 5K20B 5A8RA 1BY9A 4ZVEA 2OPQA 4PZVA 4DFMA 3CDBA 1RCXB 2CG4A 3MM7B 4OJRA 2RAQA 2AZ3A 3ENOA 3DGVA 2MKSA 4DUYF 1VQNS 1BUPA 1HL6A 1QSLA 1NGDA 4PWWA 5KFAA 1Y5IB 3U9ZA 4DTNA 3MXJA 1T11A 3L3CA 4LR7A 2NZTA 4KTQA 2ZBIA 1ZBLA 3NS5A 2CJQA 4UUXA 2EX3A 2IFXA 3O9RA 3H45C 1FTRA 3M4XA 4DR4J 1SKSA 3DLJA 5T7LB 5DM7Q 3OFGA 1WDDA 3DWLA 4DV0K 4YS2A 2FHOB 2CPEA 4PKGA 4HCCA 3DU6A 3OFFA 5KFDA 3T5HA 4DF8A 1U02A 1F9FA 5RUBA 3W0LA 3TAMA 2DHAA 3PRDA 4DSFA 1S9GB 4CT9A 1FEEA 1V3SA 1HYZA 2UXCJ 2PA3A 4ZN1A 2Q6CA 1ZM2A 5LSOA 1NBEB 4AQYF 7AT1B 1X4BA 3A5LC 1FK9B 4JI5J 3QEWA 3C6UB 2QKKA 4U67Q 2DPJA 1C1CA 1YT3A 3CC7S 2G1HA 3DFEA 3U9DA 3KG0A 3VQCA 1LW0A 4PXEA 2VFVA 1IBMK 2XWXA 4CF1A 1YAGA 2E7VA 5ETNA 1KFSA 2QA1A 2LVWA 3NMAA 3HO1A 3VQAA 1F3FA 4A47A 2W4CA 2DEJA 4RU2A 2E9ZA 4KGXB 4RL1A 1IM6A 1X5OA 2YKOA 3OQ2A 3OHAA 3LF0A 2NZ4A 2FBTA 2JC0A 2V67A 2FC9A 2MHNA 3IWLA 3VQEA 3I96A 4CF0A 4LQ3A 4MYTA 1J2VA 3O08A 2HRYA 3SUNA 1JJHA 3TQ1A 2UXBJ 1U1MA 4IOAQ 4ZVUB 5DDQC 2G0JA 4NI2B 2F4VF 3S6EA 1GLEG 5HQ8A 2M52A 3Q8VA 3SDEA 4CHYA 2B4UA 4DF4A 4DHYA 4I69A 3SQGA 1A7GE 1Q95G 3SFUA 1DT9A 3GJRB 1URNA 4CVNE 3MEGB 3PEJA 1KCFA 2P9IA 4WFAL 2IHR1 1ITGA 3MM6A 2DITA 1RT6A 2HQIA 1N33J 1VQ4S 1T02A 1JLBA 5JVHQ 1JIHA 3ILIA 2HAFA 4CQ1A 5SZTA 3LPTA 2HZVA 2H3GX 1JWWA 4DV2F 3EKUA 1YJRA 3W5YA 3ID6A 3TAGA 2VF3A 4CLPA 2UUAF 2BQ3A 4PWDB 1HJOA 2NSBA 4C0OC 2IDOA 2AYGA 2O67A 2W4DA 3PW0A 1VQPN 1REVB 3L95X 3MCOA 3G6VA 4I6MA 4CP5A 1NB7A 5EU7A 4USUA 3A5MC 2Y0SD 3SJHA 1P6TA 4LD0A 2Z1HA 4IKAA 1TKXB 1MDUB 4OI4A 4U6PA 2Q3PA 4OJ3A 2NRVA 2H54B 1CLQA 4CO3A 1V3ZA 5LJWA 1M5PC 1FWKA 1GMUA 1VRUA 4HACB 4IRCA 3R6MA 3QIDA 3EVMA 2HWTA 3KWMA 3FUYA 1IKWB 4FWRA 1RTJA 5B0DA 4DR5F 1YJTA 2ZQBA 1YGYA 3OVSA 1ZBUA 4L8RB 1JL2A 4YB6A 1UWBA 2ROEA 4CO5A 3JS6A 4DR2J 2NQPA 2P9UB 2EFPA 4DTUA 4IQXA 4DV3K 5AQYA 3FRYA 2DXEA 2IDEA 2DK2A 3H2VE 4QIFA 3QMQA 1BQXA 1FRLA 1QY7A 4C1NK 2MSSA 4FS2A 3AVHA 2VASA 4LJMA 1A0OB 2HFZA 2FZKB 4FJHA 2E1CA 4A57A 2CDQA 3U6FA 1RHUB 1N88A 1RFQA 3OYNA 1HQUB 1YJUA 3CCES 1IBLK 3MEDB 2QV6A 4D3GA 4O3OA 5F9LA 4J8FA 3NBPA 3EZUA 3JQJA 2HBJA 1HBUA 1NLKL 3PTWA 5KFYA 3TAQA 4CFBA 1WACA 2DGQA 4BRNA 3BN4A 3CJKA 2VFUA 2D7SA 5LXRA 1XR5A 1OY9A 4NI2A 3AA4A 2UXCK 4E1NA 3GYNA 3KLIA 5JVGQ 1P8ZA 1S4FA 3RRHA 1W2IA 4DTXA 3G9CA 4QWBA 3MEGA 3KKSA 5T7LA 3W2WB 3I55N 2HSTA 4B3RF 4BR4A 1P27