5D3GA

Structure of hiv-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer dna aptamer
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
publication title Structure of HIV-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer DNA aptamer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
total genus 153
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5d3gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5d3gA05
4DSJA 1JXEA 2P5GA 2ZE2A 3KKSA 4EZ9A 3KTQA 2V4QA 3NAIA 1MU2A 4K4WA 1S97A 5KT4A 4UQGA 3AO1A 2WONA 1S6QB 2DFHA 4WZMA 4KBIA 5DQHA 4J9MA 3PW7A 4O44B 4TYBA 4Z4EA 3QNNA 4NLOA 5C24A 2JEJA 2OZMA 4DQSA 4F4KA 1TKZA 1TK5A 3SUPA 1LAWA 2KFZA 3CIZA 1HYVA 3H5SA 5C25B 1KHWA 1IKWA 1JLGB 4DL5A 3HPGA 4NCBA 3QLHB 3G10A 1C1AA 4J2AA 3T3FA 1WNSA 5L1KA 4M3WA 2BRKA 3A2FA 4M95A 4G1QA 3ZT3A 2IJNA 3BSAA 3QZ8A 4I2PB 5KT3A 1NKBA 4QW8A 2ALZA 3NKYA 3IS9A 4B3OB 4F3OA 3S3OA 1CZ9A 4OKEA 4DL3A 2RF2B 4CESA 3Q8PB 3OS0A 4KKOB 4CHNA 2UVRA 4W5OA 1XR7A 5KFLA 3KMSA 3TR8A 3EZ5A 4LQ9A 3CFOA 4URGA 4AILC 1RT2A 1RT6A 4FJ9A 2XWYA 3QERA 2ZKUA 2HNDA 4KHRA 4CFBA 4FBTA 1CXQA 2AQ4A 4FJLA 3KJVB 2JEFA 3OYNA 4ECTA 4CJ5A 2YKNB 4E1NA 4BWJA 1RA6A 4ZVFA 4FJ7A 5KFXA 3DYAB 1IKVB 3I0RA 2HHUA 3V6JA 5CYMB 3KLFB 1N56A 3HPHA 3KK1A 1U47A 3SI8A 4JV2A 3MFIA 4N47A 3DLGA 1VRUA 4NLDA 2FBXA 3MEEA 3VQEA 4B9VA 1LW2B 3OLBA 1S1UB 4FZYA 4MH8A 4J2DA 1IH7A 3VQ8A 1A5VA 1VSEA 4XPEA 4CEEA 5HRSA 4O3RA 4CJRA 4DQIA 3RB3A 1ITGA 4YQWA 3ZSVA 2OH2A 1C1CB 2AGQA 1RT1B 3NAHA 4RNOA 3SFUA 4ELVA 4QPXA 3NH0A 1IG9A 4TYAA 4FLVA 2R8IA 4IG3A 4B8CA 3NF9A 2KZMA 1HNIA 1MMLA 5HROA 3CQ8A 4F2SA 5KT5A 3OYDA 1ZYQA 1S0OA 3TAQA 4DS5A 1REVB 4ED2A 3KMQA 3AVMA 2BQRA 1JKHB 4E19A 1NJWA 4ECXA 4OKJA 2A1RA 3E01A 1SUQB 4URQU 2B4JA 5CZ1A 2FBVA 3RMCA 5J1EA 1S1WB 3KLGB 2XI3A 3T5JA 3VQPA 2GIRA 5KFAA 1KRPA 2HNZB 2FLPA 3V1OA 4K4XA 4DSKA 4EO8A 4DTJA 5KFMA 3TAMA 2DTUA 4X2BA 2G8HA 5D3GB 3VQDA 4ELUA 1W0HA 2W7OA 4J9LA 2IM2A 4NLQA 1LWFA 3C95A 5J2PB 4IH7A 4M3RA 1SL2A 1JLEA 2RPIA 1S4FA 1KFSA 5L9XA 1NJZA 3IRXA 3FRZA 2VA3A 3RB0A 3ZT0A 2BANA 3L2WA 3GQCA 3DLEA 5KFHA 2E4LA 2XHBA 1YTUA 1T05A 3N6NA 2OA8A 1RTDA 3MAQA 2PYJA 4Z4FA 1C1BA 1JLFB 5DG8A 3KHGA 1JLQA 1D5AA 1HJRA 4CF9A 4C8KA 3ISNC 4BWMA 4NYZA 4CIGA 3SCXA 4FJ5A 1A5XA 4M3YA 3QEXA 4KHYA 1SH0A 2HHTA 1I3AA 3LWMA 4CEFA 4XPCA 3RMBA 4HCCA 3M9OB 1FKOB 4DL2A 4R8UB 4O0JA 2HHVA 1RDCA 3LP0A 4IKAA 1JIHA 5HRRA 1RT3B 4HUFA 1JLAB 3D28A 3G0ZA 4LH4A 3V9ZA 3NBPA 5HP1B 1TAQA 3DMJA 2VWJA 4KAIA 2VG6A 1S5JA 2B5JB 4CGDA 2E6LA 3IGVA 4ID5A 2W9AA 4HYKA 1UWBB 5F8JA 2KW4A 5J2MB 2PZSA 4IH5A 2GC8A 1I39A 2YNIB 4MKBA 4FM0A 4QWBA 3MFHA 4IRKA 2ZD1B 4JS4A 2B43A 4ED8A 1CSJA 3HPOA 3DRSB 1UAXA 4CEAA 1J5OB 2Y1JA 1KVCA 4CJPA 4RW6B 3HL8A 4FLXA 4KB7A 3ZT2A 4DTMA 5FDLA 3QIPB 3OYHA 1XR6A 4DF4A 4KO0B 5F8MA 4URSA 4EP5A 5I42B 5L1LA 1TP7A 3SJJA 3H4BA 1HQEA 1WAFA 4IRDA 1VSJA 5F8HA 4IFYA 1TVRB 3I5AA 2XCAA 2XY5A 4LSLB 5KFKA 4KSEB 3HJFA 1VSIA 3SZ2A 4ECZA 1C0UA 3OLAA 3OL9A 1K6YA 3C6UA 3QGGA 2I5JB 4DLGA 3QIOA 1S9GB 3D0PA 3I0SB 3TQ1A 2XI2A 3OS2A 4PUOA 2R8JA 3T5HA 3U3GA 4O3SA 1TKXB 4RW8A 2HVIA 5KT6A 1QSLA 4FXDA 3KK3A 4M45A 3JYTA 1EKEA 1VRTB 3T5KA 3VQ6A 4GVMA 1TL3B 3MR5A 3BQ1A 2IMWP 2OYQA 4MIAA 3V6DA 2IM0A 3BJYA 3SI6A 4RUAA 4KI6A 4F50A 3AVBA 1RTIB 4DG1A 2R2SA 2XY8A 3NE6A 4Z4GA 4QWAA 5F9LA 3LWLA 3NMAA 1RT7A 1HMVA 3V1RA 4K4YA 1Z25A 2VG7B 4AHCA 3OHBA 4K4TA 4M3TA 4LQ3A 2P5OA 4FJ8A 2KQ2A 1ZBFA 3NCIA 4NYNA 3QYYA 2JEIA 3OYMA 3FQKA 4CK1A 1NOYA 4B9UA 5KG4A 4CERA 4Q8FA 1D1UA 4Y2AA 1NK8A 2WOMB 5JS2A 3RB6A 5EUHA 4DMNA 4CGHA 3H08A 1TGOA 3QEWA 4FLYA 4CJ3A 3ASMA 3DI6A 4HKQA 5EWGA 4KI4A 1CLQA 2ASJA 2J6TA 4CF1A 2W9BB 5DGAA 5KFZA 4CJQA 3SPZA 1FK9A 3SQ1A 3NGZA 4CJVA 5HRNA 3P5JA 4K8XA 3EPGA 5I3UA 1IKYB 4F3TA 1T3NA 3BDPA 4GC6A 2C28A 4OGCA 4KHNA 1DTTB 3MF5A 4CJFA 1RBSA 3I5BA 1Z26A 3M8SA 3KK2B 3RRGA 3VQSA 5KG2A 3HYFA 1NK5A 4DU1A 4GMJB 4IQXA 4QOZB 1HQUB 4C8LA 1SH2A 3L2RA 2IS3A 3BSOA 2OPSB 4OPJA 3V9UA 3TAPA 1S6PB 4PY5A 2OPRB 1W25A 1WNEA 3AA5X 1BISA 5J2QA 2FJVA 4W5RA 3MXMA 1LWEA 3QEVA 2VG5B 3Q8SB 2EC0A 2ZE2B 3UPFA 3DLHA 4FLZA 4LH5A 3LP2A 3LDSA 4CCHA 2OPQB 3SYZA 1DTQB 3PW2A 4KFBA 1BI4A 2HWIA 2WK4A 2RKIA 1WSFA 4FJKA 3QGHA 1TL1A 4NLGA 4J2EA 2IAJA 3B6OA 4QWEA 3FFIB 3O3HA 5T14A 1HPZA 2Y1IA 1XC9A 1TKZB 2C22A 2G8IA 5HRPA 3L2UA 3TABA 4O3QA 4JUZA 1QHTA 2B6AA 1HYSA 3K2PA 1S49A 2QKBA 4TY8B 3VQ4A 1UA1A 5K14A 1ZTWA 3AO2A 2AX1A 2XO7A 4WE1A 4N5SA 3BGRA 2DPIA 4BDPA 4AHUA 3U6FA 5HLFA 2YNHB 4ECVA 3DM2B 5KG1A 3V4IB 3PJWA 3SQ0A 1WLJA 2YNGB 3GIIA 1N6QA 2V0NA 5HBMA 3DLKA 4CGGA 5KFNA 3K5MA 4FJIA 1KFDA 5J2NA 1RDAA 1XHXA 3D45A 4IDKB 3HVAA 1S0NA 4KV8A 2IM1A 1JX4A 1QSSA 5CYQB 4OPKA 1G15A 2UVUA 5JUMA 5C42B 3PV8A 3OYGA 3MEDA 3HO1A 2HAIA 3H5XA 4CJTA 5DK5A 1L3UA 3AVKA 4RNNA 4K4UA 4AHTA 3VN5A 4BE1A 5SZTA 4IR1A 4O4GB 1WN7A 4YR2A 2HNDB 1L3VA 3OYLA 3FDSA 4EO6A 4I7FB 1Y97A 1S6QA 4Q45A 2DFEA 3GV5B 3HXMA 4JS5A 1Z4UA 4KE5A 1LW0B 3AVAA 4O44A 3RAQA 5FRNA 4K4SA 3GYNA 4NLSA 1FKPB 4MK7A 4CHOA 3TANA 1D8YA 5C25A 1NKCA 4DL7A 1JLGA 2WB4A 3QLHA 3PX6A 4MKAA 3KD5E 4CFDA 2PYLA 2IBKA 2JEGA 3DOLB 1VSHA 1TK0A 4CJKA 1LWCA 4I2PA 3FQLA 1RDBA 4B3OA 4FM1A 3PX4A 2HHWA 3I8DA 3BR9A 2KTQA 4Y1CA 3O3FA 2RF2A 3HP6A 3RR8A 4KKOA 1BQMA 1Q8IA 3BQ2A 3TVKA 3AA2A 1SKWA 4CJSA 4FVMA 3OL7A 1B9FA 3OVNA 1GOAA 1VSFA 1QQCA 2HW3A 1EETB 2A1SA 1YVFA 3SV3A 1RTHB 3QIDA 2AU0A 4J9KA 3EPIA 3H5UA 4O3OA 1T7PA 2IC3B 4Y1DA 3KJVA 1FXXA 5CZ2A 1U45A 2HWHA 1U04A 1X9MA 1ASUA 2GUIA 2YKNA 1BIZA 1ZBUA 1NJXA 3KOAA 3G6YA 3OSPA 1UA0A 1TQLA 3DYAA 3NH1A 1IKVA 3OL8A 5E41A 4WFYA 4ZPAA 5EWEA 1SKSA 5KT2A 5F8NA 3OYAA 5CYMA 3KLFA 2HMIB 1VSKA 3V81B 4I2QB 2RDIA 4K4ZA 3OJUA 1X9SA 4NLVA 4EBDA 4BDZA 3JSMB 2D41A 1LW2A 1S1UA 3TAEA 1T03A 4FJHA 2Z1GA 1ZBHA 1EX4A 4OJRA 5KFJA 4HUEA 3IRXB 1KHVA 4PQUB 1LAVA 4DS4A 1BQNB 4AHSA 1RT4B 1R0AB 2FVRA 3HVTA 2FLLA 3GV8B 3DRPB 4E0DA 3NF6A 1X1PA 2DPJA 3ZSXA 4ELTA 3H2LA 1C1BB 4M94A 4KTQA 3DOKB 1KTQA 4O5BA 5KFOA 3KKRA 4ZP7A 1X9WA 1EXQA 4E7JA 1JKHA 4PWDA 1SH3A 3K58A 3EY1A 3RMDA 4F4ZA 5T7BA 1SUQA 1EP4A 4H4MB 2NUBA 2ILYA 4MFBB 1RAJA 4CFAA 3BSNA 1L3SA 1HARA 3KLGA 3KLIB 3MECB 5KFIA 4RW7B 3KLHB 2QKKA 2HNZA 4NCGB 3I5CA 3PO5A 4ECQA 3LP0B 1QE1B 4EYHB 2XY7A 4CF8A 5D3GA 4CJ4A 3DMJB 3K5NA 3MXIA 2BE2B 3EZUA 3LP3A 4DQQA 2YKMB 5KFPA 2Z1JA 5J2PA 2PY5A 4TQSA 5KG0A 2WHOA 3Q8RB 2X6NA 3LP1B 4CHYA 2BR0A 4DQPA 1N48A 4XO0A 2HB5A 1DLOB 1RBUA 3VQCA 4FS2A 3NGIA 2D5RA 4DSFA 1RYSA 2V9WA 3M8QB 5DG9A 3SUOA 1HNVB 3EYZA 3LPTA 3K59A 2G8UA 3QEPA 1D9FA 3HHKA 1JLFA 2ITGA 1WSIA 2QE5A 4L8RB 3P1GA 3IG1B 3CM6A 2HHSA 1C6VA 3HVRA 1C0MA 2R2UA 4ECUA 2ATLA 3ZT1A 4FJXA 2YNFB 1FKOA 3BSCA 5EWFA 4Z0UA 1RA7A 4K4VA 4R8UA 4FK4A 4M41A 4ED6A 2C2DA 2XRIA 4IG0B 1S48A 4NRUA 3M8RA 2JC0A 2W8KA 2HHXA 3CJ2A 2B5JA 3ITHB 4NZ0A 1BCMA 2Z1HA 2HNYB 4C8MA 1UWBA 4OVLA 5J2MA 4AHVA 5KFGA 4JV1A 1TV6B 4LSNB 3T19A 1IO2A 1JLCA 3OYFA 3V1QA 4RW8B 2YNIA 3NF7A 3RBEA 4R5PB 2ZD1A 5KFCA 1JXBA 1BCOA 3DRSA 4CHQA 1J5OA 4KHQA 3BQ0A 4FLWA 1RCHA 4RW6A 1T94A 4O4RA 4M42A 5DQIA 5KFQA 4MK8A 4CECA 1WSGA 3IN5A 3M8PB 3GIMA 4NYFA 3QIPA 2R2TA 4KREA 2KZZA 4CFCA 4KTZA 4B9LA 3M9MB 4H4OB 4KO0A 1U09A 3NGDA 3K5LA 2RDJA 4RG8A 4O55A 4FJNA 5I42A 2G8VA 4K50A 4DU3A 3OYEA 4IBNA 4EYIB 3DRRB 2W9CB 4JLHA 4LSLA 2D0AA 4Y34A 2QV6A 3ZSZA 4OLBA 3CJ3A 2AGOA 2UVVA 2O5DA 3L8BA 4XIUA 1RTJB 2FVPA 4I9QA 1S9GA 4IFVB 3I0SA 4CIEA 3LALA 4ZHRB 3ICLA 1W9HA 4NRTA 3RMAA 1S9FA 2DFFA 2JLEA 4H8KA 1TKXA 4EEYA 4HTUA 4NLXA 3G6XA 1TAUA 2P51A 4DTPA 3NHGA 4DFMA 1SV5B 3T5LA 3F9KA 1VRTA 3ZSOA 1N5YB 4WXWA 4FJGA 3MEGB 4LY7A 2QXFA 2D7SA 1TL3A 3CDUA 4NLUA 4RUCA 1JXLA 3H5YA 1GOBA 3NF8A 1K1SA 1NK9A 2WRMA 1TK8A 1FK9B 3QO9B 2FVCA 1ZBIA 3AVNA 4ECWA 1WSEA 1RTIA 4TQRA 3KLEB 1S1VB 2XY6A 5L1JA 1IKXB 3PW5A 3T1AA 3OYCA 1BL3A 3C6TB 1RILA 2OPPB 1HYZA 4GW6A 5FROA 4Q0BB 2X74A 4CEBA 2VG7A 4ICLA 1VSDA 3VQ9A 4FJMA 3CJ0A 3PW0A 4CJLA 2G8WA 2KFNA 1S1XB 1S1TB 2YV0X 2C2EA 1TKTB 3HVWA 4RNHA 4ED7A 3NFAA 4TN2A 4ZPBA 4RW4B 4B9MA 4J9SA 4ZP8A 3PR4A 4CF2A 3MR3A 1KSPA 1S9EA 2E6MA 4KHUA 3RRHA 4ZPDA 4AHRA 5KRSA 1RT5B 2W42A 2W9BA 4OGEA 1MU2B 3RTVA 2HVHA 1J53A 3KHLA 1IKYA 4FM2A 2WONB 4ECRA 1J54A 4O0IA 4WFXA 2D0BA 2JC1A 3QETA 2R2RA 1DTTA 3L2VA 4CHZA 4K8ZA 1SKRA 2BDPA 4CK3A 3KK2A 1RDRA 1I6JA 3CFRA 5C24B 5DMRA 4YP3A 1JL2A 5HBMB 2UUWA 1C0TA 4M3UA 4B9TA 1KLMA 3ZSRA 3OYJA 1HQUA 4B8AB 1NKEA 1IKWB 3AVCA 2OPSA 2IOCA 1S6PA 1GX5A 3ZSQA 4JRPA 4KV8B 2OPRA 3SNNA 3AA3A 3QEIA 4MQ3A 3B6PA 2C2RA 2VG5A 4G1QB 1OS5A 2VWKA 3IAYA 5FRMA 5JXSA 3ISND 2OPQA 3CJ5A 1DTQA 4FLUA 3IS9B 1VSLA 4DL6A 2DY4A 1Q9XA 3FSIA 4RW9A 3VQQA 3TAFA 4U6PA 3CM5A 4CEQA 5KGXA 2AJQA 1KCFA 3FFIA 4O3PA 4EBEA 1L3TA 1JLBA 2OZSA 4ZTJA 3KLVA 3QZ7A 2G8KA 4C8OA 1RT2B 1RT6B 2BGGA 4TY8A 3AO4A 1O1WA 4WZQA 2G8FA 4CJWA 3F73A 5DLFA 1RYRA 2YNHA 4KTWA 3DM2A 3V4IA 3NL0A 1NHVA 3CYMA 2YNGA 1LWCB 1NK7A 3WNEA 3QGIA 2ATQA 4KHSA 5KFSA 3UDLA 2FLNA 4BACA 4YR0A 1B9DA 4MIBA 2IDOA 1RBVA 4DTOA 3MR2A 5KFUA 2ETJA 4CGJA 3I0RB 4IDKA 3WNHA 5L1IA 1QSYA 1BQMB 5CYQA 3KK1B 2UUTA 2ZQBA 5C42A 4ZPCA 2Z1IA 3DLGB 1VRUB 2D3ZA 3OYBA 4Y3CA 2XC9A 1KVAA 1KLNA 3SQ4A 3MEEB 3VQ5A 1BIUA 4ZP9A 3IGNA 4F2RA 4KPYA 4OLAA 3TWHA 4ECSA 3G6VA 4DSIA 4O4GA 4CEZA 1F21A 4FZXC 3O3GA 4I7FA 3VQAA 5KFTA 4N76A 3QESA 1LW0A 4KHMA 3OYIA 2CJQA 1L5UA 4ED3A 4CJUA 4E7KA 3CG7A 5DGBA 4B08A 1FKPA 5KFWA 1WSJA 3LANA 2BRLA 4IG3B 3OHAA 1HNIB 5HROB 4N56A 2Q3SA 4TSXA 4DU4A 1S0MA 4CGFA 4OL8A 2FJWA 4DFPA 4DSLA 4ED1A 1D0EA 3NAEA 3N6LA 4OKKA 4Q43A 4FK2A 2ASLA 3DOLA 3PVXA 5KFVA 4Z4IA 3DLBA 4LD0A 3SQ2A 4FCYA 5SWMA 4WFZA 4ZVEA 3RB4A 3CWJA 3E01B 5C5JA 4BDYA 5J1EB 4WXOA 1T03B 3SFGA 1CXUA 3THVA 5KFRA 3L2QA 4E3SA 1VK0A 3TAMB 3H59A 4NLRA 4Z4CA 1GOCA 2V4RA 3NDKA 4KB1A 3UR0A 3HVTB 5KRTA 1EETA 5DLGA 5DG7A 1LWFB 2X78A 4Q5VA 1RTHA 1QAJA 3OSNA 4B9NA 4RZRA 3HKWA 2F8SA 1JLEB 2IC3A 2GV9A 5KGWA 2FJXA 4PWDB 3PUFA 3DLRA 2BANB 2O4IA 4DLEA 2R8KA 4HCBA 2FVQA 4IOBA 3DLEB 1C1CA 1RT1A 4NLWA 3VA0A 1T05B 3SPYA 2F8TA 1EP4B 1VSMA 3TI0A 1UOCA 4JV0A 1RTDB 4IH6A 2FBTA 3DDKA 3MR6A 3AVGA 4EZ6A 3QINA 3KNAA 3U3YA 2HMIA 1JLQB 2AWZA 3V81A 4I2QA 1ZETA 3TARA 1REVA 4F4XA 1CZBA 1U4BA 4Q8EA 3SV4A 1NOZA 2FBYA 4CE9A 3KHRA 4WYLA 4J9PA 4ID1A 3GV7B 4CJEA 3JSMA 3RR7A 1S1WA 3AVLA 3L3UA 3LAMA 3HP9A 4J9QA 2R7YA 5DQGA 2F8EX 2E9RX 4QCLA 4PQUA 3AVJA 2D3UA 4F8RA 3HM9A 1BQNA 4J9NA 3NBPB 5KG3A 1RT4A 3AVIA 1R0AA 4RNFA 2VG6B 3PHEA 4TY9A 3DRPA 4ID5B 3OS1A 3L3VA 3KHHA 2R8HA 4E7HA 3CDWA 4E7LA 4EP4A 4FJJA 3SUQA 4F4YA 4FBUA 1RDDA 3DOKA 3KIOA 3PJXA 4ZTFA 4EBCA 4BE0A 2F96A 4J2BA 2BQ3A 1YTAA 2R8GA 4H4MA 4MFBA 3PZPA 4DQRA 3KLIA 3MECA 4RW7A 3KLHA 4DF8A 3O4NA 2XGQA 3SUNA 2IGIA 4KB0A 4NCGA 5FDLB 3WNFA 1C2PA 1QE1A 3KD1E 3RAXA 3H4DA 2X6SA 1NHUA 1BGXT 4QW9A 1ASVA 4M3ZA 4RU9A 4DWIA 5KTQA 1QUVA 2ASDA 2BE2A 5KG7A 2YKMA 4W5NA 1HQEB 5F8GA 4IFYB 4E89A 4U7CA 3M9NB 1WSHA 3LP1A 1JLCB 1Q9YA 4Z4HA 4AH9A 3LAKA 3GIKA 2EHGA 1DLOA 3HT3A 1C0UB 1RT3A 4DEZA 5KFDA 5KFFA 3C6UB 3VA3A 4IKFA 1JLAA 2YHBA 5KT7A 2GIQA 4HUGA 5HP1A 4DTXA 4N41A 3OY9A 4IRCA 4BE2A 4E7IA 4KHWA 4QAGA 3V9XA 2GBZA 3S3NA 3M8QA 3QNOA 1KVBA 1HNVA 4PUOB 4B9SA 3G86A 4HHTA 3ZSYA 2ILZA 3CFPA 3PY8A 3N6MA 2JGUA 3KK3B 3H98A 4CEDA 3IG1A 4J9OA 3WNGA 1NK0A 3JYTB 5KI6A 1NK6A 2IM3A 3P83D 1RNHA 3V6HA 1NJYA 1N4LA 3K57A 2WCXA 4WYWA 2RN2A 2UVWA 5EU7A 3S3MA 3PO4A 2YNFA 3AO3A 4ZVHA 3NGYA 2W7PA 3V6DB 3NH2A 5KFBA 2BQUA 3E51A 4IG0A 1NK4A 4DG1B 4ZMMA 3VQ7A 1SL1A 5F8LA 3OYKA 4DTUA 2E9ZA 3AO5A 3ITHA 3VQBA 4YFUA 1RT7B 2HNYA 1HMVB 4E1MA 3ZSWA 4ZP6A 1TVRA 2J6UA 1JL1A 4CEOA 3ALYA 2E9TA 1TV6A 4LSNA 4ZVGA 2I1RA 3S9HA 4C8NA 4FYDA 3H40A 2WTFA 4CK2A 4R5PA 1IM4A 2EX3A 4ECYA 4FW1A 4M3XA 4IR9A 4CHPA 2I5JA 2W8LA 1J9AA 5F9NA 1XI1A 1GX6A 4R0EA 4DTSA 4DL4A 5EDWA 1XHZA 4HVJA 4DTRA 4KRFA 4W5QA 4YR3A 1HRHA 2LSNA 3RWUA 3M8PA 4YMEA 3PW4A 3ULDA 5KFYA 2AGPA 4H4OA 4G3IA 5CY4A 4CGIA 3LPUA 1RBRA 3AV9A 3DI6B 1TKDA 4TXSA 3ZT4A 3DRRA 2W9CA 3K5OA 4ICLB 5JS1A 3V6KA 1K1QA 4PA1A 4ED0A 3PR5B 1U49A 5I3UB 2FVSA 4I9LA 3AVFA 2J6SA 2O4GA 3AVHA 1D9DA 4FZZA 4Q44A 1RTJA 1U48A 1ZTTA 2QK9A 3CVKA 4NLTA 3V9SA 3CJ4A 2P1JA 3V9WA 4IFVA 4ZHRA 4FLTA 1YVUA 1ASWA 3CDEA 3C94A 4RNMA 4YNQA 3LZIA 4J9RA 3GILA 1QAIA 1S9EB 5KFEA 2HHQA 1SV5A 4NCAA 1N5YA 3AA4A 3MEGA 5J2QB 2AX0A 1LWEB 3CO9A 4DSEA 1QTMA 1XWLA 4W5TA 3O4QA 1QS4A 2VA2A 3LP2B 3QO9A 2IA6A 2WOMA 4KFBB 4DFKA 4CF0A 1BI4B 4DFJA 2RKIB 4FW2A 5F8IA 1A5WA 1TL1B 3KLEA 1S1VA 2IAJB 1B92A 1IKXA 3GIJA 2IJFA 4Y2CA 1HPZB 4QWDA 5KG5A 3RBDA 4NLPA 3C6TA 1SL0A 2OPPA 3BREA 1C0TB 2YHAA 4NLYA 1KLMB 3UQSA 4TLRA 4H54A 4Q0BA 1BHLA 4GC7A 3LZJA 2B6AB 1HYSB 4FS1A 3UIQA 4JRQA 1WAJA 5K14B 3HK2A 2FC0A 4WE1B 3BGRB 1S10A 5HLFB 1S1XA 1S1TA 4CIFA 1TKTA 3PX0A 2D0CA 3Q8QB 3D5MA 4QWCA 1RBTA 1ZBLA 2XGPA 2CKWA 3HSTB 1N6QB 3TAGA 4RW4A 3DLKB 3OJSA 3MXJA 3ZCMA 3MTKA 5J2NB 2XCPA 1XR5A 1LV5A 4RW9B 4KAZA 4MK9A 1NNDA 4O3NA 4DTNA 1T8EA 4F4WA 5KG6A 4FK0A 3OL6A 3MEDB 1YT3A 1JLBB 1RT5A
chains in the Genus database with same CATH superfamily
5I3PA 2W2OP 1RP5A 3AO1A 2WONA 4OX9F 3GJTB 5IOLA 2HBQB 1QUPA 4J9MA 3DGVA 3M1VB 4XTTA 2CZVC 3QNNA 4DQSA 4KGXB 3SUPA 4OI3A 2CADA 2D9OA 4USHA 4GV9A 1LXNA 2Z57B 4WPAA 3R5JB 4J2AA 3T3FA 4CM0A 1WNSA 3L6QA 4PZVA 3E9PA 3C16B 1VHFA 5EHHA 2B9YA 1NMEB 3C65A 4JKBA 2VHGA 2IJNA 1T6CA 1HNXJ 3WQUA 3QDKA 5KT3A 1NKBA 4JD2A 3EZWA 3JTOA 4Z7CA 2QLXA 3M32A 5AE1A 5DDOC 4CESA 1RAIB 4CHNA 5LL6d 1XTZA 4HR2A 4W5OA 1XR7A 2CAJA 2XTJP 3VGVA 3EZ5A 2LEBA 4CH1A 4DX7A 1F6TA 5B0DA 2L9DA 4NLBA 2XWYA 1WF1A 3QERA 4UF4A 2HNDA 1NSKL 4KHRA 4CFBA 2PMHA 2OIHA 4FBTA 3UVJB 3HRGA 4KH4A 2AQ4A 3KJVB 4NOHA 1FFWB 2K06A 4E1NA 2W6LA 5KOWA 3NGSA 1R43A 4BWJA 3HX9A 4ZVFA 2LXUA 3DYAB 1IKVB 4ENOA 5ADXH 2YH0A 2YX1A 3V6JA 3KLFB 3IBFB 2ROPA 2NLWA 4WF9L 2V8VA 5AQWA 1KDNA 4Y6IA 2DTJA 4P7TA 4YUDA 1NJIT 3MEEA 2CQDA 1F5AA 4ZJOA 3VQEA 4DV0F 4B9VA 3CMAN 3UCGA 3OTBA 3VHQA 2HF4A 4IEEA 2FJDB 3VZIA 2V69A 5ETLA 2ZZTA 1ZPVA 2W7AA 4XPEA 1WG1A 4NA3A 4CEEA 5HRSA 4CJRA 1SVDA 1C1CB 3NAHA 2BM0A 2GAHC 4TYAA 3AY9A 4FLVA 2DCLA 3NMRA 1I1GA 3UFCX 4B8CA 1CG2A 1T11A 4F2SA 1JCFA 2YHYA 4DV7K 1S0OA 3OFEA 1T9YA 4DS5A 3N4PA 2KYXA 1Q53A 3QSIA 3MX5A 2DHSA 3KMQA 1FWLA 3DNCA 2WC9A 2MLZA 1M5VC 4ECXA 4OKJA 2B4JA 2QMUB 4URQU 4IJNA 5BPLA 5BR8K 1R7IA 1LWXA 5KFAA 3FK4A 1KRPA 3RJMB 2HNZB 2P9LA 3V1OA 3FBFA 3Q22A 3ILIA 4DSKA 4DTJA 4LFCJ 1G99A 4PEOA 2G8HA 4H5RA 3OTOK 4ELUA 1OQ6A 4J91A 1GLDG 2W7OA 4J9LA 1ATSA 3M1FA 3C95A 5J2PB 3CC2S 1JLEA 4ZVQB 2LQJA 5L9XA 4UW2A 3FRZA 2FPHX 1VHXA 3ZT0A 1R6YA 1M5OC 1VDHA 4YEAA 4QYZK 1BC6A 2D9PA 3DLEA 1M5PC 1T05A 4J37A 2J7KA 4ED5A 3THWB 1DJ0A 2GA7A 4LF2A 4DR7F 2EKYA 3MUTP 4FKYA 4BG9A 5DG8A 3KHGA 3HSGA 1D5AA 1BHNA 4DV3F 4L3KA 2HHTA 1T9XA 4ZVTB 1I3AA 3FGUA 3ZX3A 2HOEA 4CEFA 1EHWA 3OBWA 5D0GA 4BVOA 4BR2A 4DL2A 4WQ5A 4O0JA 3DXBA 2NSBA 3M6XA 2B8QA 1XMQF 2XS5A 3LP0A 2CVEA 4CD1A 4LFBK 1ZBTA 2B5JB 2W9AA 5F8JA 3QT8A 1HKCA 2HWTA 3HOSA 4Q7AA 2GC8A 2PA3A 1NAQA 1I39A 2YNIB 3KUEA 2QWMA 4IRKA 1MA9B 4CM2A 4IOAL 3PFEA 4HTIA 4OYXA 3D7SB 5M1NA 2GJ2A 2Y1JA 2W2PP 5LXYA 2BA9A 4RW6B 4USJC 4KB7A 2R7SA 3QIPB 1XR6A 1PCAA 4KO0B 1H2TZ 3SBTA 2UXDJ 4LBHA 3CTRA 5EGYA 1FTRA 3SJJA 1GT8A 5D4PA 2BABA 3N4QA 5KFKA 1YK9A 5LL6Z 3HJFA 4GO5X 1VSIA 3BV8A 4WU3A 4F25A 3OL9A 1K6YA 4DLGA 3QIOA 2UUAF 4P71A 4DB3A 4PWUA 3I0SB 3TQ1A 4O8UA 3T5HA 5C2FA 4O3SA 1TKXB 4ANEA 5KT6A 1BE4A 3D6HB 4M45A 3GMGA 1SJQA 1EKEA 4DV5F 1CC7A 1MN7A 4JNEA 1WWHA 4ZVPB 1TL3B 3MR5A 4DDFA 3BQ1A 2OYQA 5SUHA 2MLXA 3PEJA 5LMNF 1X4DA 4JI4K 3J81Y 3VGSA 3SI6A 4RUAA 2HQFA 1LK5A 3THYA 4LFAK 1YJWS 2R2SA 3E9OA 4WFNL 2VPYB 2MEWA 2EWSA 2GMJA 5F9LA 1UFWA 2VQEF 4W98A 2F9TA 3NGKA 2RQMA 1RK8A 2UUCF 2AJ1A 3DHWC 2VG7B 1VQON 4AHCA 3MMAA 4M3TA 4EFHA 2P5VA 2P5OA 2OTLN 4IO9Q 5GAGI 4FJ8A 1RWOB 3EGNA 1ZBFA 2DNYA 2VONA 4NYNA 4NO7A 2JEIA 3OYMA 1WJ9A 4CK1A 4OI4A 4B9UA 3J80O 4P9SA 2EG2A 1X4HA 4DV7J 1FJGF 1WC3A 4DR3K 5AQLA 5EVZA 3ENAA 5GAHU 2L9NA 2ZOMA 4FLYA 3DI6A 4HKQA 5EWGA 1H73A 3UKUB 4KI4A 3R27A 2J6TA 4NXNJ 3BKFA 4YHHK 2W9BB 3VGTA 4CJQA 4EMDA 2A1BA 2XSJB 3BH7B 1U6FA 3P5JA 2XLJA 4LRFA 4GC6A 4OGCA 3CD6S 1NGBA 3DCAA 3CXCM 2QLWA 3M8SA 4OX8A 3A1YG 1H3DA 1DQAA 3VAFA 1N36F 3HYFA 1YVNA 2Z4PA 1NK5A 4FL9A 1K0TA 4GMJB 1EAYC 1YZ6A 2BJ1A 3A5MC 4OPJA 1Y11A 3V9UA 2KL8A 3HCXA 4DXLA 3P3DA 1X60A 3QWUA 4RR5A 4X4UA 3Q83A 4W5RA 1VQMN 2ZE2B 1S7IA 2O3DA 2RB7A 3UPFA 5DM6Q 1WKKA 3R5DA 1DTQB 4KFBA 3MPWA 3IUCA 1TU0B 1WSFA 2RKIA 1KQGB 3A8JA 2VQFF 2M52A 3IO1A 3R5AA 1X0FA 5T14A 3DC2A 1HPZA 2Y1IA 1IV0A 1WB9A 2AJ4A 2G8IA 2YH1A 3TABA 4K25A 4O3QA 2B6AA 1HYSA 3BZKA 3EVWA 1S49A 1NUEA 4TY8B 5K14A 1E6VA 3AO2A 2XO7A 4N5SA 4ECVA 4DV6J 1GFWB 1I51B 1SC3B 4M63C 3O1WA 4LF7F 2YNGB 3CJBA 2V0NA 4DV1J 3E66A 4TNOA 1PJ7A 3K5MA 4FJIA 3FEYB 3CB4A 2XS2A 1KFDA 4DUZK 1Q4RA 3GFHA 4UY85 3HVAA 5AQIA 2IM1A 1QSSA 5CYQB 3MN7A 3PV8A 3QT7A 2E1CA 2N3OA 3CQXA 1O51A 2K1RB 2O67A 2MSTA 5DK5A 4RNNA 1NDCA 4AHTA 3VEVA 3VN5A 5SZTA 5BXIA 3AOCA 1UW4A 4DR6K 1OVYA 4I7FB 1Y97A 4PPDA 1OY8A 3HXMA 1Z4UA 3AD8C 3M1VA 3RAQA 4GVBB 1OMSA 2U1AA 3JSYA 1FRLA 3GYNA 4NLSA 1HWIA 1XIQA 4OHVA 4X65K 4Z37A 4AXJA 3HZGA 3S1TA 2ZJPQ 4CFDA 4QPTA 3QJPA 2IBKA 2JEGA 3DOLB 1SB6A 3MN6A 3Q7BA 4K0KF 2HKEA 5KPZA 4U8YA 2QA1A 4PR6A 4FM1A 1WDDA 3I8DA 3BR9A 4Y1CA 3O3FA 3RR8A 1CZAN 1JCGA 2QSWA 2CXEA 3AA2A 4FVMA 4H0YB 3AOAA 3MMJA 1VSFA 2Y9HA 1R8BA 2W41A 4WK3A 4H0PA 1D4XA 5M1QA 3D66A 3UVJA 3JQMA 2KB2A 1T7PA 2XMVA 3KJVA 4N8NA 5CZ2A 3I82A 3Q8UA 4H0XB 1DT9A 4Q2LA 1I94J 2BMBA 2DGOA 2AF6A 3I55N 3G6YA 3ZX2A 1OJ4A 3DYAA 1IKVA 2DR9A 3OL8A 2QTDA 4ZPAA 5EWEA 3W5ZA 2NCKL 2FXUA 4B3MK 3OYAA 3KLFA 3RUBL 4I2QB 4FF1A 4USIA 3F41A 2NS1B 1E4FT 3F44A 2Y1RI 5E84A 3JAMY 4DR3J 1NM2A 1YDLA 1SZ2A 1X9SA 2ZNZA 3CJSA 2D41A 4HTLA 1V9OA 2IRYA 1HNXF 4ZITA 2COLA 2YWHA 1EQYA 1EX4A 4OJRA 4HUEA 2VJUA 3ULHA 1Z2LA 3QGPA 1PYTA 1NGDA 3H1QA 1BQNB 2WSEC 4GVLA 3WBZA 1RT4B 3BGFA 3QMLA 2WVCA 2AJFE 1YZ7A 4BHQA 2DPJA 3ZSXA 4ELTA 1NSQA 3H2LA 3EVOA 4WQ5C 4L3QA 4O5BA 2DNRA 2MKYA 5CCMA 4Z94A 4ISEA 4AE5A 3CJKB 1XBWA 3QBCA 3EEQA 2G0IA 5T7BA 2ILYA 4MFBB 3UNYA 3BSNA 5KFIA 4ZKAA 2QKKA 2HNZA 4NCGB 5C10A 1YRUA 5DDRC 2V94A 2VPXB 4IO1A 2C42A 1IBLJ 5AQMA 5AQXA 3DMJB 1WTFA 4DV4J 1K0VA 1NPPA 3CCMS 4DQQA 5KFPA 5J2PA 4CLYA 4TQSA 3Q8RB 3BBCA 3BYPA 1LEOA 4EK2A 2BR0A 4DQPA 3KUHA 2QMXA 2W2NP 1S77D 2ADCA 4LBIA 1WSVA 2CIMA 1V5VA 4FS2A 2D5RA 3MOZA 1IWAA 5A2QY 3THWA 1SJ1A 3M8QB 4M7YA 3LPTA 2C3OA 4CO4A 1EWRA 8ATCB 1JJCB 2QE5A 1FXRA 2RJZA 4M1KA 3GCWP 3IG1B 3U1NA 4CH0S 2NRRA 3AB2B 2CPJA 3HVRA 1C6VA 1C0MA 4PAAA 4M5DB 1WORA 4AL5A 3C19A 3OA9A 3O6QA 3JS9A 5JMNA 4Z0UA 5C0YA 1RA7A 5IT9Y 2E2OA 1D09B 2ASPA 4LF6J 1S48A 3H3NO 1BG3A 2EEYA 4LFCF 2X1GA 3PTWA 3DGPA 2HHXA 3CJ2A 4NLCA 2B5JA 3ITHB 2VFTA 1N33K 4PG6A 1CJKB 4UZBA 3JQKA 3O08A 1JLCA 4BC5A 3V1QA 2YNIA 2HQDA 3I96A 2V63A 1JXBA 4CHQA 5JVGQ 3A12A 4KHQA 4X4TA 3W2WB 4RW6A 3WQPA 2JSXA 3H6EA 1VQ6S 4RLEA 4PPZA 5JICA 4MK8A 3D2EB 2A2CA 1WSGA 3QIPA 2R2TA 4LF9K 1XC3A 4KO0A 3NGDA 1EWQA 3S7RA 3GR0A 1IWGA 5MLCV 3J7YI 4CI6A 4DU3A 1GEHA 3JXUA 3OYEA 3FR0A 2HFSA 4JLHA 3MAHA 1U0HB 2K3KA 2GFFA 2QV6A 1XMOJ 3ZSZA 2AW0A 5AFUH 3TUIC 1KP6A 1V4SA 2PE8A 1WI8A 2WBRA 4EFAC 1KQFB 1HD0A 4DR1J 1S72N 3I0SA 2OELA 4ZHRB 3ICLA 3B4DA 1S9FA 2BACA 1HR0J 4CBWA 1TKXA 2E2NA 1QZ6A 1C4AA 4OZ2A 3TJ8A 3C14B 3NHGA 1SV5B 4FJGA 2QXFA 4PL7A 1TL3A 3FZMA 2DD8S 4AF1A 1JXLA 4H0VB 1NK9A 3MN5A 2WRMA 1UP1A 1NU4A 4U67L 2KXFA 2OAUA 1J2VA 2IYGA 2ZNYA 3KLEB 1KEKA 4TQRA 1S1VB 1GLJO 5L1JA 4FWPA 1IKXB 2NYIA 2HZVA 5CR4A 1RDWX 3C6TB 3AQOA 1RILA 2UXDF 4ITSA 4YOUA 4IEIA 3AHPA 4CEBA 2VG7A 1X5TA 2DNOA 3EDRB 4DN0A 2XBPA 1XNQJ 4C1NI 1K44A 3PW0A 4CJLA 2G8WA 2YV0X 1TKTB 1CJVB 3HVWA 2UU9K 3M6UA 1FRJA 1HHQA 4RU2A 1N5QA 2XYGB 3VVUA 4F0HA 5JLFA 3IBWA 4QIWD 3UKUA 4MAKA 2HF3A 2ZF5O 3GBTA 3D0IE 2ABYA 4YN3B 2W9BA 4OGEA 2H9ZA 3ET6A 3RTVA 2HVHA 1H2UX 1W2BM 4ECRA 1J54A 4WFXA 2JC1A 1YI2N 4K8ZA 4CT9A 1SKRA 3VF4A 2GHVC 4L74A 1GQEA 3CCWA 4YP3A 2VOOA 1JL2A 1ZS6A 2C3YA 4ILMA 4X64K 4M3UA 2ZKTA 1KLMA 2BE9B 4B8AB 1RHQB 1CEZA 3ZX0A 3AVCA 2Q97A 2IOCA 4P52A 1GX5A 2LU2A 2VGNA 4JRPA 3SNNA 3HULA 1NXIA 3R8YA 3B6PA 2YXLA 2BX6A 5JMVA 2A10A 2RH3A 1OS5A 2JRSA 2RUGA 4AQYJ 1XQIA 3CMAS 1DTQA 4FLUA 4W92B 3IS9B 3D1QA 4DL6A 4DV7F 1XEZA 2HBJA 4RW9A 3KJNB 3VQQA 3CM5A 2OEKA 2DRAA 1KCFA 4FYVB 2X3DA 3QFHA 3CF5Q 1JLBA 3IWLA 2OZSA 4ZTJA 3NVKA 4GKJK 2XNQA 1RT2B 1RT6B 4NXNF 5ETVA 3R1LA 1XMBA 4TY8A 1O1WA 4CW7B 5IM0B 2F8MA 2G8FA 4BRQA 1RYRA 5IT0A 4G65A 1N33J 2YNGA 1LWCB 1NK7A 3QGIA 1K8AO 4KHSA 1UWAA 4ILJA 2VIHA 5EX5A 4MIBA 3KHYA 1S3XA 3MR2A 1NGHA 2Z0GA 5L1IA 1BQMB 5CYQA 3KK1B 4QR2A 3WHIA 3KG4A 3DLGB 1UPMB 2PD1A 3OYBA 4Y3CA 2XC9A 3EGZA 3ZTRA 1N5TA 3VQ5A 4C8YA 4KPYA 4OLAA 3TWHA 1PYOB 5GAHP 1JK9B 3AOBA 3AA8A 4ZCLA 4I7FA 4HHHA 4CP5A 2M70A 1L5UA 4BBYA 4CJUA 4GVBA 3LGMA 4E7KA 5K8PA 4PRFA 5H9EJ 5KFWA 2J76E 4YORA 3W9JA 2BRLA 1BU6O 3OHAA 1HNIB 4OI0A 4TSXA 4D3HA 4J90A 4ES3A 4OL8A 3DOLA 3PVXA 5GMDA 4C3LA 3DLBA 4DV6F 3FCHA 5IC6B 3TOQA 4ZDNA 2FF3B 4WXOA 1VHIA 4DV1F 1T03B 4UOHA 4B3RK 3THVA 4OYZA 2CJAA 2RU3A 3VEZA 5KFRA 3PKMA 4B1UB 5HQ8A 2EI5A 1WD6A 3TAMB 3R1XA 2D0OA 4NLRA 3PYEA 4Z4CA 4DZDA 3NDKA 4JI2K 4BR0A 3BM7A 3QRRA 2E1YA 3OSNA 4D3GA 1Q1KA 4JK8A 3FMBA 2FB0A 4CZLA 2GQCA 4FF3A 1PO6A 4IOBA 4OZJA 2ZH7A 4NLWA 4CLWA 3SPYA 1RAOA 4DOZA 3VESA 4JV0A 4BRPA 3B78A 2FJAB 3NLCA 3OTCA 1IBMK 4EZ6A 3C15B 2HVDA 3FCWA 2AWZA 2ZBQA 4I2QA 3HZEA 3CCRN 3FNNA 3TJAA 2OANA 2IVNA 4Q8EA 3DFEA 3W65A 2CPHA 4OMFG 1SJ4P 2FBYA 2MJUA 4WYLA 4ID1A 4ER8A 3QATA 3RR7A 4Y65A 1S1WA 3T6JA 4C9DA 3O6WA 3HI0A 1N0VC 4OV1A 2DB1A 1NCLA 3EDQB 1YJRA 1BQNA 1W2IA 5KG3A 1RT4A 3AVIA 1N8RT 3PHEA 3OS1A 2R8HA 4Y0FA 5CYJA 2KT5A 4E7LA 4U9RA 4FJJA 3SUQA 3N79A 4FBUA 1RDDA 3PJXA 4YS2A 2HSEB 4EBCA 2YWFA 2E1AA 2BQ3A 3PRDA 3CJKA 1KXPA 4JI8K 4DU8A 1RAEB 2BW2A 4H5TA 2CQ1A 3HFZB 4MFBA 3PZPA 3SAHA 1I94F 3WC0A 2XGQA 3SUNA 4NCGA 1UEUA 1RKIA 3U1MA 2FSNA 1C2PA 3KD1E 4ANCA 1HI8A 1BGXT 1NHUA 4E1JA 2P8IA 5KG7A 2OP5A 3G87A 5EN1A 4OI6A 4FYXB 4E89A 3M9NB 1FX4A 4USVA 4DR3F 4YB6A 2X1FA 4LRCA 3LGNA 1VQOS 3HMJG 4AH9A 2JOQA 4I6YA 2HQ3A 5AQPA 4DCOB 1R3NA 3GIKA 3PACA 1C0UB 3C6UB 3VA3A 1JLAA 2MZTA 2YHBA 5HP1A 5C2DA 4E7IA 4KHWA 2WBMA 2PA8D 3M8QA 3QNOA 1RI7A 4PUOB 2L48A 3AXMA 1MWMA 4L73A 2JGUA 3HHDA 5F2RA 2DK2A 3IG1A 1QQNA 3WNGA 5GMEA 5KI6A 2IM3A 3P83D 3V6HA 3K57A 2K7JA 2WCXA 4M5DA 3PO4A 3S3MA 3AO3A 3KG1A 3NH2A 3WC2A 3IKMA 1WEZA 4JK9A 4DG1B 3TEHB 2V68A 3PIPL 2O8BB 2RT3A 2FC9A 3ITHA 4ID8A 4YFUA 1FKAF 2QLBB 1IBLF 1HMVB 3ZSWA 4P7VA 1PILA 4DV4F 1QVFR 2E9TA 1CJKA 4ZVGA 4CBXA 2VH7A 3S9HA 4C8NA 1TYQB 3VGKA 2Q6CA 3G9CA 1OVQA 2GS8A 1GLFO 4CZCA 4IR9A 3W2WA 5F9NA 1YGYA 1V3ZA 1XHZA 3D2EA 1VCTA 4YR3A 3SCKE 3W8PA 1ZAVA 2BTFA 2ZUAA 4F3MA 4BRCA 1MMDA 1X5SA 1SC6A 1K73O 3FRYA 2KRBA 4NA1A 4NZ6A 4OX6A 2J8SA 2AYGA 1JB0C 2DNQA 4BC7A 4ICLB 1U0HA 1K1QA 1KVJA 5I3UB 2FVSA 4I9LA 2J6SA 7FD1A 4YDDB 3AVHA 1S76D 4UQTA 4FZZA 1YRTA 5G4DA 1U48A 4Y2KA 5HL7L 4LF6F 3CVKA 4NLTA 3QBWA 2P1JA 3P31A 5M1FA 3O9SA 2D0PA 4ZHRA 4C11B 1ASWA 2O66A 3CJRA 3CUNA 3CDEA 3C94A 2DGXA 4RNMA 1UETA 2EWHA 2YWGA 3C14A 4IDHA 5FPEA 5KFEA 1NGEA 1SV5A 1GMWA 5J2QB 2EC2A 2AX0A 3O1BA 1LWEB 1SJFA 1QS4A 3J81U 1ATNA 2IA6A 2WOMA 2ZWOA 5J1NA 3EVMA 1TUWA 2MQNA 5F8IA 3KLEA 1S1VA 2QLFB 1IKXA 3PLAA 2F9WA 1IG8A 4Y2MA 3GIJA 1X4CA 2IJFA 4QWDA 2X1BA 3K0SA 4NLPA 3C6TA 4AFFA 2H65B 2APOA 4OFZA 3UQSA 3O4WA 4GC7A 3O9TA 3LZJA 4FF2A 5LSLA 4DR2K 4QIVA 4FS1A 5E3CA 4WE1B 1VGYA 1S10A 2ZH6A 3VF2A 4YY3K 2FHOB 4OLOA 1TKTA 4PG8A 1CJVA 3Q8QB 3F9MA 3HT0A 1RBTA 3VQTA 1BA0A 3HSTB 3AAPA 1IBCB 5E0OA 4M7XA 1XNRJ 3N0VA 4NXMK 2Y8YA 1OYDA 3ZCMA 5B08A 1SQEA 2QWNA 3QAEA 4DR1F 1XR5A 1UFLA 4DPTA 4KAZA 3RAMA 4MK9A 1NNDA 4O8KA 4X4VA 4DTNA 2BUNA 1H72C 1AFIA 3OL6A 3QETA 2DH7A 2QSFA 3VGMA 2P5GA 2E5GA 3JSBA 3KKSA 1RFQA 2V4QA 3R6GB 1N32K 4EI2A 2QXLA 4M5JA 1KD1T 3KUGA 1S6QB 2DFHA 3VPZA 3GFZA 3OXGA 5DQHA 5FPNA 3BDEA 1PG5B 2WTUA 4KQZA 1MWQA 4WTYA 4FP9A 4Z4EA 4NLOA 2JEJA 2OTJS 2CQ3A 1WC4A 1TKZA 1TK5A 1JNRB 3BGLA 1VQKS 2DGQA 3I55S 1KHWA 5H1SV 2XZWA 5BRHA 3HPGA 2AEMA 2FLOA 3NOGA 3G10A 4DR5K 3HSZA 1Y4ZB 2NUUG 1XNQF 1CC8A 3A2FA 2AHOB 1HNZJ 5IQQA 2RAQA 5KPRA 3QZ8A 4FOIA 1BLUA 2V51B 3IS9A 5HK4A 3TSPA 2OHDA 2ROGA 5BREA 4ZLPA 2F9DA 4OKEA 3TTDA 2QLJB 1G6BA 4DL3A 3M05A 4JKDA 3J80Y 2LQ5A 1BDGA 1TL4A 3ATVA 5F0UA 1R0BG 3M8YA 4NMXA 1O13A 2QYGA 3CFOA 2RE1A 4AILC 2CPYA 1RT2A 1RT6A 2UXBJ 4FJ9A 4DUYK 5AQJA 5IM0A 1KQSR 1C0GA 1S57A 2YQ0A 2JEFA 4C7QA 3IM9A 5A8KB 2DPNA 3FMWA 2NXJA 2DH9A 3ENOA 2QZ8A 2F7VA 3BO2A 3DU6A 2E5IA 3L7UA 2XMTA 1HKAA 3NGRA 2PGCA 4X4QA 3VEWA 3ID8A 1U1OA 1N56A 3KK1A 4RWWA 4CIOA 3SI8A 2VICA 3MFIA 3M6WA 3DLGA 1RWUA 3BS9A 2I8EA 2H5JB 1HA1A 3IWNC 3I4HX 2W6KA 1S1UB 4J2DA 3VQ8A 2MKKA 1A5VA 4AQYF 1SJRA 4C0OC 1SQGA 3T41A 4O3RA 1UW9A 1ZM9A 3RB3A 3IR5B 1RGVA 4EWTA 2OH2A 4A2BA 1VJWA 2AGQA 1PC5A 1QVGR 1T9WA 3SFUA 1QM9A 4GVEA 4QPXA 3NH0A 2GO9A 3VAIA 1C4CA 1X0PA 2VV5A 3NF9A 1HNIA 1MMLA 3CQ8A 4FVUA 4U7UK 1M90O 1RZMA 4CDIA 5KT5A 3OYDA 1ZYQA 2NZCA 3LO3A 5T41A 4DV2J 5AQGA 1X4BA 2ZITA 3H7HB 4OZ5A 3ETMA 4HACA 1SUQB 1N33F 2FBVA 1FE0A 4PABA 3CJTA 2FLPA 3EX7B 3CERA 3V2UC 1IR1A 4EO8A 5D0RA 5KFMA 2E5JA 3KJQB 3I4PA 3TAMA 4X2BA 3VQDA 4E2FB 3H46O 2W01A 1HJOA 1S12A 2IM2A 1RKJA 1J5EJ 4BGAA 3B8AX 3J81O 1SL2A 1IQZA 1S4FA 2CJKA 5FD1A 3IRXA 2EFVA 3KYLA 3L2WA 4RUBA 3GQCA 5KFHA 1V5IB 2LXFA 1U1NA 3BEXA 1OY6A 3TP2A 3ZZPA 4LC9B 3FZBA 2H1YA 3FZKA 4Z4FA 5DDPC 1C1BA 1JLFB 3C15A 1FDDA 4GKKK 5E3AA 2FDNA 5T7LB 4NYZA 4BLGA 3SCXA 4FJ5A 1K8KB 3TW0A 1A5XA 4M3YA 1SH0A 1S22A 2KM8C 2LEPA 3D3CJ 3JAMU 7AT1B 4DR4J 3PYFA 2BOAA 4S0MA 2A5XA 4USKA 2ACYA 2DT9A 4TU7A 4IOCL 2BJ3A 4IKAA 1JIHA 1RT3B 4HUFA 4LR8A 4C8ZA 4QIEA 4LF8J 3V9ZA 4M5IA 4E8UA 4OI2A 2VWJA 4YOEA 2HGLA 4OYBA 4BRMA 3IGVA 2KT2A 3IAM9 4HYKA 2C3UA 4X66K 1S72S 2PZSA 5KQDA 5H9FJ 2BJ8A 4MKBA 4U8VA 4QWBA 4OV6A 3CNQP 3MFHA 2IY5B 4FWNA 3HD1A 3A5LC 5HQMA 2OFGX 1GMUA 1UAXA 1J5OB 1J6ZA 4CJPA 4FLXA 3M8WA 3ZT2A 2ZUGA 4DMZA 4FN5A 3POTA 4XH5A 1IN0A 1KR4A 4BC4A 3NOCA 4EP5A 4AL6A 5I42B 2CWKA 1U1MA 3KNGA 3D0HE 1TP7A 5CE3A 3H4BA 2XZTB 3TX8A 2MQQA 3CC2N 2UUBK 5F8HA 4JI7J 3QRPA 3I5AA 1JXVA 2XCAA 4LSLB 4KSEB 2EFNA 2VPWB 4JI3J 2V8GA 3OTDA 3SZ2A 3D3BJ 5KQ8A 3ZNUA 4ECZA 1C0UA 3OLAA 1M5KC 3CCVN 5B0CA 1DEJA 3C6UA 3PCOB 1NLKL 3ID6A 2LA4A 1UJ6A 2UYTA 1P9YA 1ZA2B 2KJWA 1CQNA 3D0PA 3OS2A 3A4TA 4PUOA 1ROFA 4KHPK 1XJWB 4RWXA 2W1BA 1Z2ZA 1Q79A 4FXDA 2BZ2A 4BR4A 4DN9A 1K9MO 1S5ZA 3VQ6A 4GVMA 4DPYA 1PAEX 2WUSA 2F7TA 3SMSA 3UKRB 5IT9U 3NNCA 2V8PA 3AVBA 5ETTA 5JVHQ 3A3NB 1FERA 4DG1A 3U8XA 3TSUA 2DY1A 4Z4GA 2E5LK 2O8BA 1YI2S 4I69A 4CRJA 4JKGA 3NP5A 2A3JA 1HMVA 3SAGA 4H0OA 4UY8T 3A13A 4WFAL 4R25A 1O5JA 3LM2A 1TYQA 3MN9A 1KWMA 4LQ3A 2H5IB 3NNHA 5IWAJ 1FTCA 1VK3A 1MDUB 3QYYA 1WKLA 2C3PA 2NREA 1GLAG 2HGNA 2I0XA 4Q8FA 4ES1A 3Q8VA 1NK8A 3DLJA 3JTNA 4A8QA 3RB6A 2KXHA 3L09A 3TJ9A 3WZ0A 4CGHA 4DMNA 1LQ9A 4B3SJ 1KC8T 1ZOTA 4BREA 4CJ3A 3ASMA 4OIXA 1XUPO 4I4BA 4B3TK 3ZTPA 3EZOA 4CF1A 3AT1B 1U2CA 5F41A 2NZTA 1FK9A 1U7LA 3M6VA 4WQ4C 3SQ1A 4RO0A 2Z30B 5I3UA 2I38A 1T3NA 3BDPA 4B1YB 5F3TA 3MF5A 1NGFA 2HSTA 4WJBA 1AA1B 3VQSA 5KG2A 5JLHA 4K42A 2GAGC 4EUVA 2N3LA 4IQXA 3MURP 1HPMA 4QOZB 3NS5A 1SH2A 3L2RA 5DZ6A 2ZJRQ 2OPSB 5C2GA 3L95X 5BPMA 2QMWA 1C0FA 1X9JA 3C0BA 1TMMA 1R31A 3AA5X 4ZN3A 5B7WA 2NRHA 5J2QA 1LWEA 2VG5B 2EC0A 3DLHA 4FLZA 3QSYB 4CCHA 2OPQB 3SYZA 4QS8A 2QWOA 2VKRA 3PW2A 2XMUA 3MM7B 2YWEA 3EM1A 4J2EA 3GL1A 2CNNB 2QFJA 5AQRA 5K8NA 3FFIB 2VF3A 1CLFA 2NUHA 3F2KA 3VAJA 2VPZB 2C22A 4NEZA 3PIPQ 1WC0A 5EX3A 2NRXA 3NS6A 4B17A 3J7A1 3BYRA 4J9VA 4AXIA 4WE1A 4YDXA 1YJ9N 3Q86A 2CGLA 3U6FA 3IR7B 1VQ5N 2YNHB 4CZGA 3DM2B 1U1QA 3J7ZO 2XLKA 1A9NB 1VS3A 1HX1A 2YBVA 2C2OB 5D77A 3LOUA 5KFNA 2RE2A 3NEKA 1RU1A 3D45A 2LEAA 2K3IA 4OZLA 1S0NA 4KV8A 1B7YB 5JUMA 1NDKA 3CC4N 3KFWX 5A0YB 3DN9A 1RISA 3E1YA 3ENWA 3AVKA 4L6V3 4BE1A 4IR1A 1B3TA 2HNDB 4LIRA 1L3VA 3FDSA 4EO6A 1S6QA 4Q45A 5LSRA 4KE5A 3HBTA 4ZVSB 2KG1A 2RSQA 1H6KX 1HLUA 3A5NC 4IWVA 1PC4A 1FKPB 5CCLA 1HNWJ 4CHOA 5HL7Q 1D8YA 1WSRA 4H4KA 5HJYA 5GADU 1P1TA 3B4MA 3AB4B 3WX4A 1FNOA 2OMOA 1HHTP 4WKYA 1VSHA 1Z05A 3FQLA 4BQLA 5A2QO 3PX4A 1XNRF 2HHWA 4F67A 2CDRB 5L39A 2HPUA 3HP6A 4CI0B 2NNWA 2Q66A 4CJSA 1TZ0A 5E7OB 3OVNA 5M1PA 3A3PB 2ZOFA 1TL7B 3SIPB 1QQCA 2HW3A 4USMA 1RTHB 3QIDA 3G96A 2AU0A 3H5UA 3BKTA 2E5LJ 3ZTOA 1FXXA 1U45A 2HWHA 1HBNB 4A8KA 1X9MA 1U04A 4JB8B 2P9KB 5ETMA 4ED4A 3K8VA 3O3LA 4MTPA 2LQBA 3OSPA 1GLBG 3O5TB 1UA0A 1TQLA 4HVZA 5E41A 4WFYA 4AL7A 5KT2A 5F8NA 4UUWA 2HMIB 2R7TA 4FPRA 3IDHA 2R7WA 3K0JA 1QVFM 4USUA 3D6TB 4HL9A 4F04B 2HS3A 1HNZF 4FPBA 3JSMB 2CZ4A 1S1UA 2RRAA 2E44A 2F9JA 2JL9A 2Z1GA 1ZBHA 2YQ1A 5KFJA 2G4BA 4PQUB 2GGPB 4FXWA 1VQNN 1G7CB 3MMVA 2AP1A 2FUG9 5M1OA 2A0FB 1R0AB 3HVTA 3DRPB 3FUYA 1X1PA 2UXBF 4KTQA 3DDIA 5KFOA 1EXQA 2QL7B 2KKHA 4E7JA 3M3ZA 4PWDA 1SH3A 2MGZB 2B9WA 8RUCA 3EY1A 1U26A 4BRLA 1SUQA 1EP4A 2Q36A 1NEEA 1L3SA 3I56N 3KLIB 1VYAA 3KLHB 4LF5K 3I5CA 3CIPA 2DIUA 3LP0B 4EYHB 4ZLJA 4CF8A 4K43A 4KH1B 2WVFA 2YKMB 2BJ7A 5KG0A 2XM3A 5BYQA 4CYUB 3NCRA 1FEHA 5ETOA 4XO0A 2EXUA 3HOTA 4BRGA 3LM9A 1IM6A 1G4CA 5D0HA 4R0JA 1RBUA 2HS0A 4C3MA 1FE4A 3P38A 1DRZA 5ADZA 5DG9A 1HNVB 3EYZA 3BZCA 3QEPA 2M9KA 1YJVA 2DJWA 1JLFA 2E2QA 3AJ2A 5DDQC 2ITGA 2O8FB 5T7LA 3ZXWA 4L8RB 1K8KA 1V3SA 4JYAJ 3P1GA 4CT8A 3CM6A 4ZIVA 3V5RA 1V3RA 4DV2F 4ECUA 2ATLA 3ZT1A 3ISZA 2YNFB 2X1AA 1VBZA 5HVHA 3BSCA 2NRTA 3CJCA 5AJ3J 2Q43A 4JI5J 3SAFA 2C2DA 4IO8A 2XRIA 4IG0B 5E2QA 4FWLA 4PG7A 2JC0A 3HFVA 3C7NB 3MM6B 4ES2A 1S0VA 5HMYA 4C8MA 3L4IA 3Q2SC 3DXKB 3IFRA 1VISA 2W2MP 5THWA 3UD5A 1J5EF 1FD8A 1F2GA 4DCJB 1J5OA 4FOEA 3BQ0A 4LVNP 3AAQA 4XH1A 4K2XA 3S6EA 2QFIA 4F26A 3HM8A 1MLAA 1YKWA 3OVAA 3M8PB 3GIMA 3G6EN 2KZZA 2BXJA 4GV6A 3M9MB 3SSSA 4JKAA 3UDVA 1U09A 3CI5A 3K5LA 5ETQA 5I42A 3A8YA 2G8VA 1UJ4A 4K50A 2RNEA 4IBNA 1GTEA 1SKUB 4DR4F 4DL0C 2I7PA 4LSLA 2D0AA 2FZCB 3CCUN 1T44A 4ILRA 4A59A 2HHHK 2AGOA 2UVVA 2O5DA 1SIWB 5RUBA 4XIUA 3VEOA 2ATCB 3RW6A 1HWUA 2FVPA 4I9QA 4LF8F 3NCQA 1NRKA 2Y3YA 4NRTA 2FGOA 2JLEA 4EEYA 4NLXA 3G6XA 2HRYA 3V4MA 2VWBA 4KGZB 4HEA9 2F4VK 3WQTA 3HHNB 5AE3A 2UXCJ 4DFMA 2D74B 1CS4B 4RPFA 3MEGB 5GVQA 1KBRA 4LY7A 1FWKA 1DARA 1GOBA 3VR1A 4H5WA 3CJQA 3QO9B 3R6MA 4XK8C 3UKRA 2GUPA 1ZBIA 1M1HA 4V1Ak 5KOXA 3PW5A 2H3GX 4IOCQ 2F5GA 4CVNE 3T1YK 3B54A 3NGTA 3CDAA 2JJ4D 1WC5A 3GDQA 3EL2A 4FJMA 1VIOA 3CJ0A 2FQQB 4MKVA 1ZAXA 2D3O1 4ZVUB 2KFNA 2C2EA 4JI3F 3ZYYX 2CPEA 4RNHA 1RGIA 3NFAA 3TNVA 5DJBA 2G0JA 3PIOL 1RB0A 1Q8KA 5D4LA 3EKUA 4ZP8A 2GMLA 4FF4A 2VCPA 2HBMA 2BOPA 1H7XA 5EY4A 1S9EA 2HRUA 2VUGA 1VQ4N 3L4BC 4KHUA 4CZHA 3RRHA 2BKOA 2RIJA 3MTJA 3CE8A 3GE1A 2Y8WA 3M2UB 4A5BA 1MU2B 1J53A 4FM2A 3H3OB 1P8GA 3O9UA 1SJ3P 3WDOA 2XSFA 4A47A 2BDPA 2A18A 1U1LA 4CK3A 1I5OB 2N4DA 5C24B 3UR3C 2PMWA 3VEXA 3DDNA 4FSVA 2UUWA 3PNIA 1C0TA 4B9TA 2Z56B 3P49B 2OPSA 4NYOA 4FPAA 3D2WA 1FHTA 4CH7A 2QWRA 4EHUA 1YBAA 3BGOP 1KAXA 1EQMA 4MQ3A 1FNMA 3K89A 1WI6A 2CNLB 1VQ7N 2MLYA 2VG5A 5IWAF 4JV5K 1FESA 5ADXA 3ISND 2GX9A 4B9QA 4OYPA 2OPQA 3CJ5A 4CLKA 1AW0A 1WACA 2C2NA 6FDRA 3LDPA 1Q9XA 3MCOA 3MM7A 5E3QA 2JVOA 4A8MP 1WHVA 3MOJB 3FFIA 4B3SF 4EBEA 1L3TA 5GAEU 2XULA 3P96A 3KLVA 2G8KA 4C8OA 2JFDA 1IVZA 1T9UA 1NZAA 2PEBA 3L4QA 5LMUK 3T9NA 3F73A 4ISFA 2J9EA 5DLFA 3TRGA 2YNHA 3DM2A 3NL0A 3W9IA 3DAWA 1VQ9S 2ATQA 3BH6B 5AQNA 3VENA 4ZS6A 1T02A 2IDOA 4DTOA 5KFUA 1NDLA 3W62A 4FYYB 2DR8A 1G3OA 4OZ0A 4LRDA 3OV7A 2ZVSA 2ZQBA 3HJVA 5A0YA 4ZPCA 2Z1IA 5K5MA 4FWSA 2D3ZA 1KLNA 1ITPA 2HGMA 4JI1K 1R89A 2RVJA 4F2RA 2D1CA 1N34K 2FZKB 4WCEL 4ECSA 3EN9A 2M2BA 4CEZA 2ZWPA 2LMIA 4JI0J 1CJTB 4N76A 3OVBA 2LA6A 1SC1B 1OKJA 5HMZA 4PXCA 2KDOA 4LRBA 1FI4A 3AD9C 3I33A 1FKPA 1P9QC 1NGCA 4I1TA 3LANA 2HIQA 2YX4A 5IV3A 1Q0NA 2HFVA 5HROB 1DAXA 3ENQA 4N56A 2Q3SA 2DGWA 4DU4A 4L75A 1JMTA 4CGFA 5CHIA 2GO8A 3EGWB 3QMQA 1DFDA 1Q95G 4OKKA 3MPUB 3G4SN 2MQPA 2ASLA 4XEIA 3IXQA 1BA1A 4FCYA 3CWJA 1PGZA 4LMZA 1VQLN 5J1EB 2GZOA 2GWKA 1YJNN 1WBDA 5FLXO 1UVIA 3MM8B 4DHYA 1ZC6A 2VBWA 2HFNA 4OX9K 1F60B 2HAFA 4OI1A 3J80U 5TKWA 2AYMA 2V4RA 1TL7A 1PIEA 3MMBB 4KB1A 5KRTA 1L3KA 1RTHA 1TTHB 4PYDA 2HQCA 1QAJA 3EGVA 4RZRA 3HKWA 3CJ9A 1N5SA 1EZZB 2ZC3A 4E98A 2P9NA 2BEFA 2F8SA 1RWMB 2NXCA 4IQMA 1HBNA 5KGWA 2P9IB 2XYHB 2BANB 4DLEA 4F3QA 2P9KA 2M8DB 2FVQA 2W4PA 3UWTA 5E5NA 1RT1A 3N01A 2OMLA 2OCEA 4C97A 2I6WA 1VSMA 4CZEA 1UEKA 5A6PA 1RTDB 3ZNJ1 3MR6A 2DNGA 3AVGA 3QINA 2XEXA 3KWGA 1HNWF 2HMIA 2RHQB 3GYXB 2IRUA 2POKA 2X7IA 1REVA 3GU0A 2E1ZA 2CQ2A 1CZBA 1U4BA 1GH8A 3UNGC 3SV4A 3T1HJ 4CE9A 1T0TV 3GV7B 2HEKA 4CJEA 3JSMA 1KVIA 3GFXA 3LAMA 2V8DA 2R7YA 5AZIB 2ZJQL 3MX2A 5LSOA 4PQUA 2GGPA 3AVJA 4HDHA 2D3UA 3GE9A 4F8RA 3HM9A 2H54B 2SXLA 3CCVS 5HANA 2PC6A 1R0AA 4RNFA 2E2PA 1RWXB 3DRPA 2MQLA 5AXLA 3L3VA 4E7HA 2QWQA 3CDWA 4KGMA 3Q23A 3AQPA 3H0PA 4LREA 3U02A 4QBUA 3FZLA 1FXLA 4ZTFA 3TSQA 4GRSA 2QWLA 1NGJA 4WU2A 2B0GA 3GYGA 2E5LF 1WHXA 1Y0HA 3KWMA 5EX0A 2MGZA 2R8GA 5BJRA 4DV0K 4DQRA 3KLIA 4LF4J 3KLHA 4DF8A 1VMBA 5GADP 3VEYA 2IGIA 4JI6J 4KB0A 3WNFA 2MZSA 3SCLE 2CG8A 4K8RA 4CO2A 3SLCA 2X6SA 2M88A 2XG8A 2Q79A 2WSCC 4JV5J 4CBUA 3DOMB 1ASVA 2V34A 5KTQA 1QUVA 5B0AA 3DGPB 1H7WA 2YKMA 4W5NA 1HQEB 2YKPA 1WG4A 1ZBSA 2BV3A 1MROB 1JLCB 3MM5B 1Q9YA 4Z4HA 4CYUA 1O8BA 1FJEB 4Z2XA 3LAKA 4RCHA 5M2PA 2JHEA 2DO0A 5KFDA 5KFFA 3M7VA 2ZH5A 4IRCA 4BE2A 5CXTA 2BJ9A 3UO0A 3UDCA 1KVBA 1HNVA 1ICEB 3DRYA 1WEXA 3G86A 3ZSYA 3CFPA 2O8FA 2VGMA 1UAWA 1NK0A 5CD4H 3JYTB 2XMMA 4JOUA 1NJYA 4YDUA 2CQBA 2N7YA 2AD9A 2YNFA 2E88A 3TZZA 4FVCA 4ZVHA 2ZDOA 4I67A 4PYAA 4DPXA 2MHNA 3IWXA 2WVDA 1Y7PA 2ZH2A 3E51A 3D54A 5B0GA 4IG0A 1H0HB 3VQ7A 2IMOA 1SI9A 1SL1A 5F8LA 4V19J 3C7NA 3MM6A 2E9ZA 3VAHA 3AO5A 5IQ6A 5B0FA 4XAKA 4JEPA 3DXKA 1TVRA 4CEOA 4DR7K 4FYDA 4CK2A 5M2RA 5HVGA 1IM4A 2EX3A 4ECYA 2ZHOA 4DV3K 4OPHA 2I5JA 1REGX 4QR1A 2KYZA 4WKRA 4DL4A 3J7Z5 5EDWA 3GONA 1RSCA 4FWMA 4NZ7A 4WWSA 4HVJA 3VALA 4W5QA 4ZVOB 1HRHA 3R5GA 3H2UB 3MMCB 3RWUA 3M8PA 4YMEA 3S01A 2MJNA 1QZ5A 2E20A 1YBUA 1XMQK 3LPUA 2CZ9A 1U1RA 1YX2A 1RWVB 3M2RB 1FDBA 4JYAF 5DM7Q 4TXSA 1H38A 3EJMA 3UD3P 5JS1A 3W8GA 4EHTA 4ED0A 3R7BB 3J7AN 3HSJA 3AVFA 1GXLA 4LJMA 3LQVA 5GIOA 5AJ3F 1YJ9S 5I9EB 1M1KO 4JI5F 1URRA 4Q44A 1VQ5S 1ZTTA 5A8RB 3V9SA 2P6SA 1VR6A 3MCMA 3UN3A 3AAWB 4ANDA 1TR0A 3LZIA 4J9RA 5HAOA 4M5KA 2FSJA 2NXUA 3N5FA 2XB2D 2BJEA 4F0KA 1CS4A 3MEGA 3CC4S 5BR8J 3CO9A 2EFOA 3O4QA 2KHOA 3DWLA 3PKYA 2F65A 3ET6B 3A8IA 3QO9A 1JCEA 3ZETB 3JB9k 2OD4A 4KJIA 1BI4B 3OTOJ 4XDDA 1TL1B 5ETPA 3EKSA 1R8HA 1MWZA 2DITA 1Y3JA 3GG0A 1SL0A 2UUAK 4FWQA 2YHAA 1KLMB 1ZZFA 2F8HA 2XHCA 4TLRA 4H5VA 3QWPA 1BHLA 1Y3KA 2E5HA 4DPWA 3UIQA 1B0PA 4JRQA 3BGRB 2J0WA 4QYZJ 3ZZ0A 5HLFB 1NSPA 3PX0A 4DV5K 4DZ6A 4GY2B 3EXCX 3DRXA 3R6LB 1N6QB 2YVSA 3DLKB 1SXLA 4JAXA 5KPTA 5LMNK 3BPSP 4JN4A 4K59A 3MXJA 2DGTA 5J2NB 4FXVA 3QRQA 1LV5A 4X62K 3H45C 4RW9B 4PKIA 4NI2B 1Z6RA 2CPDA 1YT3A 1JLBB 3SCIE 2Q1NA 2UXCF 2VQEK 3M2UA 4CQ1A 1QAXA 3NAIA 1MU2A 4CWBA 4C48A 2UUCK 4UQGA 4LFBJ 1SBRA 1QY7A 4BR5A 2EKNA 5K8OA 2V7ZA 4O44B 1EJ7L 5C24A 4KGKA 2LQ9A 1LAWA 2KFZA 3G71N 3CIZA 1TL5A 1HYVA 3H5SA 2VFVA 1FJGK 4CLUA 1RHMB 4C2MA 4NCBA 3QLHB 1RHRB 2QWPA 4JKHA 2OSRA 2BRKA 3L7PA 4M95A 2J0XA 3PM9A 3UB5A 4OHZA 4NASA 3AD7C 3BSAA 4OLPA 2C2KB 2KHDA 2PMZD 2A40A 2ALZA 3HI9A 3NKYA 4F3OA 2WFBA 2PFUA 4MO5A 3NCPA 3NWGA 2RF2B 2F4FA 3Q8PB 2VC0A 4KKOB 3IA0A 3HHEA 3CCJN 4FPIA 2BH1A 3GG4A 1VQNS 5KFLA 1N36K 5BRFA 1ULRA 1RXOB 4URGA 3W61A 2ZKUA 4K7QA 4PHTX 1CXQA 4FJLA 1KONA 5D4NA 2UV8G 3OFGA 3VTHA 3QBXA 3OUYA 2YKNB 3LDOA 1PYSB 5A8WB 1AYEA 4PKDB 2NPFA 1PSDA 3PIOQ 3I56S 5LT5A 2HHUA 5CYMB 5FPMA 3MDFA 3ATUA 1U47A 4F9OA 2VQFK 1VRQC 4JI4J 4TKTA 5K9FA 4WTOB 2EK6A 1LW2B 4LFAJ 3OLBA 3CXCR 3MCPA 1RWWB 1IH7A 2O01C 4BROA 2P9CA 1CJTA 1F0XA 4KY3A 2M0GB 1UL3A 2DGVA 1VSEA 2AZ3A 1RHJB 4DQIA 1Q7YO 1HWJA 2C2ZB 3P4UB 2OTJN 3M2VB 2HHPA 1VQKN 4ELVA 1OQ3A 2KZMA 5HROA 2CQCA 1ACMB 2DH8A 3TAQA 4U7BA 2DBBA 5IZHA 1HWLA 3P39A 3RBZA 1JKHB 2DNHA 5DZ7A 2BJDA 3RMCA 5CZ1A 5J1EA 1S1WB 3KLGB 2XI3A 3T5JA 4I0WA 3TVZA 3MM8A 3IP0A 3U9DA 2CPZA 4L76A 1BMQB 3PRVA 4YHHJ 2DTUA 1P8ZA 3MMBA 2EVZA 3TEGA 1DQ9A 2Z2ZA 4A57A 1JJ2M 3GP9A 2GHWA 2VASA 3FZFA 1OYEA 3C8YA 4M3RA 2LP4A 1VQYA 2RPIA 2RMLA 3VCDA 4JI0F 1YQHA 3DXMB 4NL5A 5GAEP 1U6BA 2P9IA 2BANA 2AV5A 3M8ZA 2CJBA 1YTUA 4QJVA 4K0KK 3N6NA 2HBYB 3M6GA 2OA8A 1RTDA 2PYJA 4IO9L 3EE9A 2LYVA 3ILLA 2CH5A 5GAGU 1X5OA 3G6ES 1HJRA 4CF9A 3ISNC 1ZPWX 4BWMA 4I56A 4CIGA 5F0WA 1RADB 4KHYA 3QEXA 4CZIA 6AT1B 3LWMA 4UOFA 3RMBA 4I64A 4F7VA 4YOWA 1D3WA 1YLXA 5AQYA 2MZJA 4R8UB 1NGAA 4ERDA 5AZIA 2EBGA 1RDCA 2W25A 3CCUS 2CH6A 1XN9A 3PG9A 2EFPA 2OD6A 1Y10A 1JLAB 3D28A 2GTDA 3G0ZA 4LH4A 3CDBA 5HP1B 1DBDA 1TAQA 3AA9A 1K8AT 3OPKA 2V2ZA 3GIRA 4CGDA 2NRWA 1UWBB 5MLCQ 5J2MB 5AFUA 2NLXA 2Q0RA 3ADAC 5AQFA 5D0EA 4FM0A 2EG1A 2A6OA 2HG4A 2ZD1B 2B43A 4ED8A 3HPOA 2FC8A 3DRSB 1WF2A 4N77A 4CEAA 3AXKA 1NM1A 1F2HA 4DUZJ 4WF9Q 3HL8A 2B3TB 4C1NK 5C12A 4IUFA 1HNXK 3OYHA 2RILA 2AYBA 5DM6L 4URSA 3DOMA 3SQOP 4ZA1A 5L1LA 4GO7X 4DR6J 3PYGA 2MSSA 1HQEA 4IRDA 1VSJA 3T1HF 3D6MB 1MROA 3B82A 4HH1A 2XY5A 3MM5A 4BRDA 1WBBA 2L08A 1H2VZ 1RLDA 4FZVA 2MY7A 2DRBA 4X65J 1S9GB 3RG6A 2WW8A 5HJXA 2LFVA 2XI2A 2GQ2A 1F5BA 5IC4B 3FZ2A 3U3GA 5BN8A 3RU0A 4RW8A 2HVIA 3VVTA 4JKCA 3JYTA 1VRTB 1VQ4S 5D8HB 4WFBL 3CCQN 1ZM2A 4MIAA 4CLLA 3BJYA 2ZH8A 2P9UB 3TZXA 1HFEL 6FD1A 4LF4F 4OYOA 3VF0B 1ZH5A 4JI6F 2XY8A 3JTPA 2KVIA 3LWLA 1VLYA 3NMAA 4JV5F 3O1LA 1WDTA 3MCSA 1IR0A 2FZGB 1Z25A 3CT9A 2XMKA 5CHCB 4HHJA 3SXLA 2RHKA 2KQ2A 4NPOA 2IVMA 2QYCA 3NY0A 2CYYA 4MDAA 3FQKA 1VQ7S 1VIXA 1FRKA 4B3MJ 1D1UA 4NE9C 2YKOA 4Y2AA 2XHWA 3CGIA 3MMCA 2WOMB 5EUHA 4Z7YA 4PWWA 1QDUB 3QEWA 1B0TA 1ZA1B 2BKPA 3M2RA 3CSKA 3G82B 1RWKB 5DGAA 5CA5A 5KFZA 3NGZA 3W0LA 2B51A 5HRNA 4F3TA 2C28A 4KHNA 2IHR1 4CJFA 1RBSA 1Z26A 5A8RA 5M2UA 1T9TA 2HZCA 4O23A 4IOAQ 2C3MA 2J9DA 4DU1A 4J9UE 4WP9A 1UCNA 4OYAA 2IS3A 1WEYA 3BSOA 1Q86O 1S6PB 4PY5A 2OPRB 1W25A 1WNEA 1H74A 3K7RA 1U8WA 2FJVA 4NA2A 3Q8SB 3WX8A 1D8ZA 3CIMA 3A0IX 1Q8BA 3LDSA 2HLTA 3ZETA 5JJBA 1KQKA 4JKEA 3TUZC 5A76A 1BI4A 2HWIA 2WK4A 3MM9B 1TL1A 2V2KA 1HBUB 2IIHA 4OX7A 4QWEA 2JWLA 2GEMA 3B6OA 4A62A 3C66A 1HUXA 5E3RA 2CJYB 1TKZB 3OR1A 1K47A 3L2UA 1QHTA 2ZH3A 2WAQD 1X4GA 1HW9A 2G1HA 2QKBA 2HBLA 1UA1A 1ZTWA 3SJHA 3BGRA 2DPIA 4AHUA 1UTAA 4QU6A 1BQXA 2FTRA 5HLFA 2ZC4A 5KG1A 3V4IB 3PJWA 3SQ0A 1WLJA 3NNAA 3G4SS 2AEFA 4P75A 3GIIA 2BBEA 1N6QA 4R79A 4C0BA 5HBMA 3DLKA 4USWA 2Y0SD 4B02A 2ASOA 5J2NA 1VQLS 2HMPA 1XHXA 3BF3A 3O2IA 3GPAA 1YJNS 5GINA 4IDKB 3FZHA 1AB8A 4NI2A 1JX4A 4OPKA 2UVUA 4LRAA 3OYGA 1MWYA 3QAUA 2DNLA 2HAIA 3VV2B 4CJTA 2PT0A 1L3UA 4WFNQ 4K4UA 2UXDK 5BR8F 4O4GB 2QTWA 4YR2A 2IPOB 2R7UA 3BPDA 5HVFA 5I3QA 2DFEA 4JS5A 1LW0B 2MYFA 3OTOF 4O44A 4M63A 1HD1A 4RUHA 4BRAA 3RGIA 4MK7A 3TANA 3E9LA 4OYMA 2NXNA 9ATCB 3F0NA 5DS7A 4DL7A 1VQ8S 5AQHA 2WB4A 3QLHA 2LLZA 5GAHI 1K73T 3PX6A 4Y00A 1JNZB 1RTZA 2LU1A 4I6MB 4CJKA 1OH7A 4LF9J 3T6BA 3EWGA 1RDBA 1HI0P 3VTIA 3U4LA 2KTQA 2RF2A 4KKOA 2ZHBA 1H1VA 4P6QA 1Q8IA 3TVKA 1SKWA 3FE1A 3OL7A 3T9ZA 1B9FA 3W9HA 1GOAA 2VFRA 5E33A 1EETB 4Y2IA 3I9ZA 1YVFA 3VOVA 5ETRA 3UN2A 5HO4A 4BC3A 3MWBA 1SS6A 4ZIWA 4Y1DA 1Q81O 4FDFA 4LFBF 3I9V9 3SDEB 3TVYA 1ASUA 4Y0WA 4PXDA 2GUIA 2YKNA 4UOGA 2AMCB 1ZBUA 2G13A 5K20B 4HACB 3PSIA 5A8WA 3HFKA 4QU7A 1CPZA 1SKSA 1RBAA 3KDNA 5CYMA 5JVGL 1VSKA 3V81B 2JLFA 4TU8A 3EE8A 5L8RC 1XK8A 3I8BA 1W2BR 2CGJA 5AQSA 3MR7A 3CPEA 3NS7B 2CVIA 4NLVA 4BDZA 3KG0A 1LW2A 1GMWD 4HT7A 4ZPWR 4NXNK 2Q31A 5LJ5Y 2ZGZA 3IRXB 4B1VA 1KHVA 1N88A 1KAZA 3CCSN 1VOMA 3ZTSA 3J7YU 1LAVA 3M2VA 3QT5A 1CQMA 3TX0A 4B1WB 4AHSA 2FLLA 1QAYA 4PL8A 3US5A 4E0DA 2ZBRA 2P9SB 2DNZA 1C1BB 3HZ6A 4TVAB 4OQJA 3WIUA 3DOKB 2UU9J 3KKRA 4ZP7A 2Z2YB 1X9WA 4C4WA 1JKHA 4TLQA 2JDJA 3RMDA 4JK7A 4LIWA 3WXKA 4H4MB 1RAJA 3KLGA 3MECB 4KC5A 2QEXS 2CA9A 1YIJS 3BB5A 4ECQA 1U02A 4C6AA 1IR2A 3E2EA 3L0QA 4KRWA 4MLEA 3K5NA 3AJ1A 3MXIA 2BE2B 2B9XA 1FJ7A 1WG5A 2ZH1A 2DYAA 1YITN 2CQIA 3D1OA 2AT1B 4JI4F 4EIAA 1UMJA 3FKBA 3LP1B 3HSCA 2G2YA 4RBVA 1VAZA 2V52B 4LFAF 3QT6A 3R3TA 3DXMA 2HB5A 1DLOB 2R4FA 3CEDA 4X64J 4F02A 2MQOA 1JWWA 3VQCA 4DV6K 1X4AA 4DSFA 2XMJA 2V9WA 2CUYA 1IXKA 2CRLA 3SUOA 1B0VA 3K59A 4DV1K 1D9FA 5LJWA 1TMJA 3POTB 1WSIA 1Q82O 1PBUA 5AXKA 1R59O 2R2UA 2Q6BA 3OXFA 1VJQA 1FRIA 3ZZUA 4OHWA 2QC3A 3PJ9A 4K4VA 4R8UA 4CZMA 2D4WA 4K5SA 4FK4A 2QA4G 4OHYA 3VETA 4NRUA 4FNHA 5AQTA 3M8RA 4GKJJ 1U2RA 2E7VA 2ZBIA 1HKBA 2UP1A 4YHHF 5BN9A 4NZ0A 1BCMA 5FLXY 2HNYB 1UWBA 5J2MA 4JV1A 1WF0A 4LSNB 3T19A 3NXZA 3W3SA 3EXYA 2AJ2A 3RBEA 3GFYA 2ZD1A 2Q0UA 3DRSA 4A46A 2AJ0A 1T94A 2UV8A 2VKZG 3ZO7A 5DQIA 3MXHP 5KFQA 2H48B 2B8PA 1DURA 3WXLA 3H25A 4NYFA 1AROP 4KREA 4BQZA 4KTZA 4PKHA 2ZH4A 2RDJA 4RG8A 3B6BA 4P2XA 4JKGB 2A3ZA 3KJFB 4YB5A 3DRRB 1VC6A 2ZOGA 1GLCG 2JZ5A 1TUYA 1OH8A 1M90T 2IRXA 2B9EA 2YPZA 4X62F 4MO4A 4USTA 3CF5L 1MN9A 3L8BA 2JX2A 1HWKA 1RTJB 1WOQA 1S9GA 3JSRA 1YJTA 2CPXA 4CIEA 1EB0A 1T6DA 1I94K 1UVKA 1AUDA 3RMAA 4UUXA 2DFFA 2KT3A 2QRRA 1RAAB 4ATNA 4P2SA 4HTUA 1HBMB