1XMQK

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xmqK00
2UUAK 1J5EK 4DUZK 4JI6K 4JI7K 2UXDK 4X65K 3OTOK 3JAMO 4LFAK 4DUYK 2HHHK 1N34K 2UUCK 1HR0K 4JI3K 4K0KK 2F4VK 4DV3K 4JI0K 4LF7K 4DV4K 1XNQK 2VQFK 4JYAK 3J7YP 5LMNK 4GKJK 2VQEK 5AJ3K 4LFBK 2UXCK 4DV0K 4DV1K 4CVNE 1HNZK 4KHPK 4CW7B 4DV5K 5A2QO 4JI4K 4JI5K 2E5LK 4LF6K 4DR3K 1XNRK 4JV5K 4DR4K 4DR5K 4DR1K 3T1YK 4LFCK 5IWAK 4DR6K 1N36K 4YY3K 4V19S 4X62K 3J80O 4JI8K 5LMUK 3J81O 4LF5K 4B3MK 4LF8K 1HNXK 1IBKK 4B3TK 4DV7K 4LF4K 4DR7K 4JI2K 4NXNK 1N33K 4X64K 3T1HK 1FJGK 4LF9K 1XMQK 1I94K 4DV6K 4AQYK 1IBMK 4GKKK 4JI1K 5BR8K 4B3SK 1N32K 4OX9K 4X66K 4YHHK 2UUBK 3J7AP 5IT9O 2UU9K 4NXMK 4DR2K 5LL6Z 4DV2K 5FLXO 1HNWK 1IBLK 2ZM6K 1XMOK 2UXBK 4B3RK
chains in the Genus database with same CATH superfamily
1I39A 1VSJA 2D0PA 4CBWA 3FLCO 3VN5A 3IUCA 3OTOK 4HTLA 3I8BA 4R5PA 1WB9A 4H4OA 2UUCK 4BRNA 3OS1A 4BC2A 3IG1A 4O0JA 3O9SA 4DQSA 4B9UA 3KLEA 1X1PA 3AVBA 3WXLA 1U45A 3QETA 3ENHA 3LP2A 5JVGL 1REVA 4JS4A 2HHQA 1GOBA 4I7FA 1BI4B 1NKCA 4DCHA 3CM6A 2HHTA 4N47A 2QXFA 4AHCA 1C1CA 4KH6A 3NBPA 1RDCA 4CHPA 3SAHA 5TKYA 2HVHA 4DR4K 5M1FA 3UB5A 1ZBIA 4K43A 3TTFA 5KPRA 3VQ6A 1ASWA 3CCEN 1YT3A 2AA4A 3D45A 4CK1A 3G0ZA 1SL0A 3CQ8A 4OO1J 1KC8O 4WQ4A 1EX4A 5J2MA 4FM0A 2FC0A 1TAUA 2I7NA 3EEQA 2E1ZA 1HUXA 1OVQA 4LF4K 3P39A 1NGDA 4MFBA 3OY9A 2OPRA 4A2AA 1WNSA 2OCEA 1XWLA 1FJGK 1Z05A 5D3GA 4HHTA 1HNVA 3HPGA 4CK3A 1NNEA 4K8XA 3L3UA 1GLLO 3QMLA 1IBMK 4CEAA 3MK6A 4IFVA 2O8CA 1RCHA 5BPMA 5LJVA 3CPWM 4JEPA 5IT9O 3MCAB 4YOTA 1SL1A 2QWNA 3WXMB 3BF3A 1Y64A 1U47A 4CCHA 3THWA 1GLEG 3CQYA 4I6MA 3CF5L 1VK0A 4M3YA 2WOMA 4PHTX 3CC2N 4ID1A 2VWBA 1NGJA 1JLBA 3THXA 2OPSA 4DU3A 3JAMO 3OBWA 1TUUA 3KLHA 3B8AX 4H5TA 1HR0K 3HL8A 4IEEA 3NE6A 4WCEL 4FJ8A 4CZMA 5FROA 5F2RA 1VHXA 1DTTA 4CERA 4CJ4A 5HRNA 4B1YB 4DV4K 3SUOA 4ZTFA 3QIOA 4BQZA 1OH8A 3O1WA 3C6TA 3VEWA 1VQKN 3D2EB 4DTOA 4JYAK 4QOZB 4QCLA 4B9TA 3JXUA 3LWMA 2RN2A 5AQSA 4XIUA 1RTHA 3H08A 3K5NA 4DTUA 1L3TA 3C6UA 1CZAN 3CJAA 1CZ9A 1HNZK 1VSLA 1HJOA 4XEIA 4CW7B 4Z94A 4CHOA 5I42A 2FBVA 3KWGA 4BG9A 5AQJA 4A2BA 5CHIA 1TYQA 2A1SA 4JKDA 1N36K 4E7IA 2QKBA 1EQYA 3LDOA 2WC9A 3ULEA 3T19A 4C1NK 1RT2A 4GV9A 2VG7A 3THYB 1UWBA 2ZF5O 4GV6A 4O0IA 4OPAA 2I7PA 4BC4A 2CH5A 2ATQA 2P9LA 4IOCL 5DK5A 4JAXA 4LF5K 3E9OA 3CCSN 2CGJA 3K58A 1DKGD 4YOVA 2HBJA 4O8UA 2YCHA 1LWFA 3K59A 3VQ9A 5AFUA 4IO8A 1C0UA 1LWCA 3VQQA 3OYFA 2O8DA 3SYZA 3A0IX 2A1RA 3RTVA 3CXCM 3QEWA 1I3AA 3MN9A 4H0XB 1KTQA 1J54A 1R59O 2R7YA 3E66A 3PX0A 3OYKA 2ZD1A 1BIUA 1WOQA 3WXIA 2HF3A 1HKGA 1C6VA 2E2PA 4Z0UA 2UUBK 4H0YB 4CFDA 2ASOA 4IEIA 1KCFA 5LY3A 4XH1A 1WUAA 3C6AA 4HUFA 1RTDA 4BE1A 3FZKA 1IBLK 4F9OA 1C0TA 1C1BA 3BF1A 5HLFA 5C15A 4IWVA 3G10A 4HUGA 4B9VA 5AQWA 4AHRA 2RE2A 3NF7A 4IOAL 1WLJA 2HHHK 1MA9B 3M8RA 3AY9A 1L3UA 1GLFO 4JKGB 3H1QA 3OHRA 4AM6A 1KVBA 2QWPA 2XRIA 3PIPL 3EO3A 4DFPA 3CCLN 4K42A 1NMNA 1VQ5N 3DMJA 4DV0K 5GAHP 2P9UA 4FWNA 3S3NA 3RR8A 2VWKA 1E3MA 3SMPA 1ZXOA 3P4IA 5BREA 4H03B 4ILGB 3FZMA 3LP1A 1JL1A 4H0VB 3LDSA 4KFBA 4O8KA 3AVKA 3V1RA 3VF2A 4XH5A 1ASVA 1ILYA 1S3XA 3EY1A 4W5NA 3SMSA 3MXJA 4CEFA 1ATSA 3C7NA 3CJ1A 3CJ9A 4YDUA 4GW6A 3OS2A 1WAJA 2IVPA 4EZ6A 4BRAA 1T03A 4KHUA 4ILJA 1L3SA 5KQDA 3ZEUA 3O9UA 3VQPA 4CZLA 2Y1JA 3HO1A 3AA5X 3AO3A 3EKUA 3HOTA 3GOIA 4CEZA 4A59A 2AP1A 4DB3A 4EHUA 1YHQN 4B9MA 4W5OA 1DTQA 1TV6A 5AQUA 4DQPA 1VQMN 4OKKA 4CD3A 4PL8A 3NMUA 3NH2A 1RDDA 4M7YA 4OKEA 3ZT1A 4BGBA 4CEBA 1WN7A 3V4IA 1BQNA 3MXIA 3OBYA 1W7AA 2KHOA 3MDQA 5BN8A 1KXPA 3NHGA 4M42A 3KK7A 1YTAA 2IDOA 4QS9A 3VA0A 4CJTA 3MN6A 2F96A 4J2EA 1IG9A 3AV9A 1RILA 4BREA 4M7XA 4GMJB 4FM2A 1BOTO 2B5JA 2YHXA 3HOSA 3QEPA 2E8AA 4JI3K 3KLGA 1V4TA 4CGFA 1J9AA 1XC9A 2FF6A 3S3OA 3R6MA 5KPTA 1TVRA 1VSEA 3LAMA 4MLHA 5AQHA 1YIJN 2O8EB 4F8RA 2BH1A 3RWUA 3RMBA 3ZSRA 4WQ4C 4QAGA 3TAQA 4PKHA 4KHWA 1NGBA 4C8NA 1YTUA 3CFPA 2G8FA 3ZSWA 5CE3A 5BRDA 1QSLA 1IKXA 1L3VA 3QINA 1SAZA 3ZSZA 1ZC6A 4LFCK 4BE0A 1RTJA 4DSEA 1EWRA 2IAJA 4BR0A 4Z4FA 5HRPA 2ZGYA 2IVNA 5JVHL 4X62K 1Q82O 4E7JA 1JLGA 1R0AA 5GINA 1P8ZA 3QEXA 4JKHA 4CZIA 1IV0A 3RVCA 4ISEA 1U04A 4RCHA 3LDNA 2Z1IA 3V6DA 2WONA 2O8FB 3FR0A 4AHTA 4N76A 3K5OA 1EWQA 1KLMA 5I9EB 3AVFA 3AVAA 1HNXK 3PO4A 2WTUA 3FFKB 2UYTA 4ISGA 3WT0A 2QM1A 4DLGA 2EWSA 2NUBA 3PSFA 1M1KO 4YORA 1BCMA 1W97L 4JHDA 3MMVA 4DU1A 3WQTA 4B1XB 1BA1A 1RT3A 3V1OA 2HHSA 1LCUA 5CYMA 1S9EA 3AO2A 1T8EA 4FWMA 4JI1K 3AVCA 2HMPA 3CYMA 3NVMA 1HPMA 3HBTA 3KK2A 5C2DA 4DS4A 1S5JA 4NXMK 2D1KA 4CGHA 1KAYA 3AAPA 1XI1A 3L8BA 2FXUA 2KQ2A 2ZM6K 3V9UA 4O5BA 1FXXA 4R79A 3KHYA 4CIGA 3TR8A 5HP1A 5AQYA 2UUAK 2UXDK 4CJWA 3LALA 5EY4A 3NGZA 2YNGA 4E19A 4FWQA 4WF9L 4FK0A 4DTMA 1X9SA 2P9SA 2YNFA 4JD2A 4DKWA 3P1GA 2QI2A 2DY4A 1L5UA 1N5YA 3L2VA 3VF4A 4H5WA 3ZSOA 2YHAA 2FF3B 4OKJA 5DM6L 1ESVA 3ZSYA 4BRFA 4FLWA 5AQXA 4FVUA 3AARA 5C42A 4O44A 5FPNA 1TKDA 2QWRA 1VSDA 1K8KB 1RDAA 3C7NB 5A2QO 3CFRA 3E01A 4DQ8A 2E5LK 3ZSXA 1T05A 1QHTA 1WSHA 1F21A 4KREA 3T1YK 1BA0A 2RF2A 2PZSA 3AVIA 2XY7A 4FPBA 4V19S 3PX6A 5BPNA 4JK8A 1Q86O 4IZ9A 4ZTJA 3R1XA 3AA4A 2VWJA 4JKBA 1WBDA 2W6LA 2D4WA 4I2QA 3U3GA 4HVJA 4E7HA 3WUHA 2HNZA 3NDKA 1NK7A 1WAFA 1GLDG 4NYNA 3HXMA 1RDUA 1QS4A 4CZGA 1YJ9N 3ATUA 4ILHA 3OJSA 3L4QA 2HHVA 3HPOA 1QE1A 1X3MA 2PYLA 3RMDA 4K41A 3VQBA 2HBLA 3OYMA 4BDPA 3KKSA 4DV6K 4AHSA 3HTVA 2XY5A 3NH1A 5FDLA 5BRFA 4KPYA 3KIOA 5HRRA 2QWOA 2QW9A 3TAMA 3FFIA 2FBTA 5KI6A 1NJWA 4FCYA 2O8BA 2JWKA 1UA0A 4ID5A 4MQ3A 3RSEB 4CF1A 3TAFA 2G8WA 4HUEA 1JXEA 3AVGA 1RBUA 4FM1A 5FPMA 1J5EK 3B6OA 4JI6K 1BIZA 1JCFA 1M90O 3A2FA 3SUQA 3DXMA 1HKCA 4BRLA 1A5XA 4B9QA 2QA4N 3T7ZA 3WXJA 3QERA 4AM7A 4CJQA 3DLHA 1SKRA 5AQFA 4PKGA 5JS2A 3WXKA 4DV3K 4JI0K 1ITGA 3DXKA 4LF7K 2BUPA 4YDUC 3PUFA 3MN7A 5DM7L 3GBTA 3L2WA 1C0MA 5GIPA 3LANA 3L3VA 5AJ3K 4ELTA 1C0FA 3FZFA 2UXCK 3A5MC 3ALYA 1SL2A 4B9NA 3J8AA 3P83D 4FXDA 3V9WA 4F4KA 4CZKA 3N4QA 3I0RA 4RTFD 1XC3A 5JMVA 3TI0A 4FJIA 1NWKA 2ITGA 1QQCA 3TSQA 1G15A 1HKBA 5HBMA 2QK9A 4EP4A 1JLEA 5EU7A 4CF2A 3QFPA 2G8KA 3TARA 3ZETB 4I9QA 4E1JA 4KAZA 1NM1A 1TAQA 4B3MK 3F73A 4NO7A 4BRPA 1NBWA 3AVMA 1RBSA 4NLBA 4EP5A 4MDAA 3LDLA 3Q7CA 5JLHA 4BC5A 3KTQA 4OLBA 4GNIA 5BN9A 1GOCA 4PY5A 3DLRA 3A5LC 1KLNA 2P9PA 4CJKA 3F5TA 4B1UB 3LP3A 3DYAA 5AFUH 2F7TA 3SQ1A 4GY2B 4CI6A 3HZ6A 1DEJA 2IOCA 1JXBA 3SNNA 3H3NO 4FL9A 5BR8K 2RHKA 2X74A 4FPAA 4NCBA 4KHQA 1U2VB 1NU0A 3SQ2A 4J2AA 4FK2A 2YKNA 3O4WA 5JLFA 1CXQA 1BCOA 5LL6Z 4DV2K 1RDWX 1HNWK 4OPHA 1NJXA 2GELA 1T7PA 1NJYA 4KKOA 2F8TA 1ZYQA 3ZX3A 3CIPA 4CK2A 4NCGA 2P51A 4DUZK 3OYEA 3O9TA 4EZ9A 3VGMA 4FJNA 4FLUA 3NF6A 4DUYK 3DLGA 3RMAA 3E9PA 5HL7L 1VQ6N 3JSMA 1NGGA 4A57A 2A41A 2GX9A 2HF4A 4A5AA 4B1VA 4TSXA 3NGIA 4Q5VA 1NGAA 5ADXH 3A5OC 1U48A 1V4SA 1UAXA 3WEEA 1QZ5A 4WFNL 2VQEK 1DT9A 2BE2A 5ELZA 3TAGA 4CEEA 3JS6A 2PFUA 3VTHA 4CEDA 2KW4A 4G9ZA 4BC3A 3VGLA 4DTJA 4B1ZA 4WFAL 1BGXT 4DR5K 1VSIA 4DR1K 4CFAA 4EAHD 5EOYA 4YY3K 1YVNA 3K9JA 5AZJB 3MECA 2IIRA 4FO0A 2WUSA 1YAGA 4BG8A 3R9PA 1MWKA 1KAXA 3BP8A 3KZBA 1VSHA 5C12A 1XHZA 5AZIA 4DFJA 4NXNK 4B3OA 4J2DA 2KZZA 1Q7YO 3CC7N 2Z1HA 2P9KB 3WQUA 1KVCA 3O8MA 3LDPA 4Q0BA 4DSFA 4Z4CA 2HMIA 4KHSA 2X78A 3ID8A 3HM9A 3H46O 2YNIA 4PQUA 3U8XA 4DLEA 2QWLA 2YHYA 5AQRA 3J7AP 2UU9K 3UKRB 4CHYA 2ZQBA 1BHLA 3DRPA 3M8PA 5AQKA 1H1VA 4M3TA 4FSVA 3DXKB 4H4MA 4CBUA 4KTQA 1RNHA 2DTUA 3V9SA 1O1WA 3VQDA 1LOTB 1QVGM 2E88A 3D2FA 3VQAA 3M6GA 4B8AB 2H3GX 3D6RA 2D0OA 2GTDA 1RDBA 5M1NA 2Q2RA 4IFEA 4FWKA 4LH5A 3DLEA 2W41A 4NB4A 4LY7A 2CH6A 2VQFK 4H0OA 1Q18A 2VCPA 3PY8A 4PUOA 3R3LA 3DAWA 2KLAA 2V52B 3GE1A 1TK0A 4M3ZA 3VTIA 4FLYA 1HQEA 3LL3A 1OVYA 3SBGA 4HCCA 4W5RA 2ASMA 2GEMA 4BVOA 4IFYA 5ADXA 4O5FA 1XUPO 3SAGA 3PIOL 4FWSA 4DTXA 1C1AA 3SPYA 1WSIA 4JRPA 1YITN 3UKUA 3IS9A 3KJVA 2DFHA 3J81O 2V7ZA 3OYAA 2E20A 1S22A 1WBBA 2YKMA 3ASMA 2F9TA 3ENOA 3LAKA 4E3SA 2JLEA 5BPLA 1T44A 5H1SQ 3G6EN 3TTCA 4X64K 4OPKA 3H6EA 5I3UA 4LF9K 3AA3A 1A5VA 3CCQN 1XMQK 3WNGA 3QESA 1B92A 4EHTA 2OA8A 2Q1NA 1O13A 4B8CA 4BE2A 4FJLA 2X6NA 4QS8A 3MEEA 5EX5A 5KPZA 2IC3A 5FPDA 1Q9XA 4H0TB 4CJRA 3DLLL 4H5NA 1YVUA 3MWTA 3ZX0A 2O8CB 2QKKA 1HRHA 1FW6A 4LD0A 4FZYA 2F9WA 1SS6A 1SV5A 3MN5A 5SZTA 3THWB 2PYJA 3VQEA 2D0CA 1ZBHA 4DSIA 4I6MB 4F2SA 4CBXA 3WNEA 3THXB 2ETJA 2YJFA 4C23A 2F4VK 5MLCQ 3G71N 5M1QA 2YNHA 3UE5A 4CJFA 1KFSA 1TKXA 3F9KA 4WYBA 5HROA 3AVHA 1Z25A 4BDYA 1VSKA 2IS3A 4DF4A 4HCBA 4CHZA 3QO9A 4Z4HA 4LFBK 3LP0A 4CJ5A 4BR7A 1NK0A 3IDHA 3IRXA 3NF8A 4K8ZA 1BU6O 3EZWA 1NOZA 3CM5A 4KH5A 4JK9A 1X9WA 3W0LA 3HI0A 3M5RA 4LSLA 3WNHA 4CE9A 3QNOA 1VQPN 2BGGA 4DU4A 3L2QA 4JN4A 2KTQA 4NYFA 3O3GA 1GLJO 3GDQA 2XY6A 4N5SA 3C6HA 3HSCA 3TAEA 4DMNA 1RT5A 1TYQB 2DFFA 4AILC 3VESA 3O3FA 3QLHA 1KVAA 2YV0X 3ULEB 1ZBSA 1Z26A 1B9FA 2Q3SA 1OH5A 3C65A 3THVA 2ZJRL 2P9LB 4Y1CA 2OPPA 4LF8K 5KRSA 4GVEA 4O55A 3CMEN 3CD6N 1VRTA 1IH7A 5AQMA 3D0PA 2NRXA 4DR7K 1JL2A 4DSJA 1ASUA 4YOYA 3SQ4A 2VG6A 3HRGA 3CQXA 4Y0WA 4XH4A 3SQ0A 3ID6A 4L3QA 4BWJA 2O8DB 4PL7A 2FSNA 3MX2A 4KRFA 4BRQA 4DSLA 1HYVA 2JWLA 4BDZA 2HBKA 2P9IA 3I33A 4ISFA 5GAEP 4OGEA 2G8UA 4FJMA 4W5QA 4I9LA 4KV8A 3UIQA 3FZHA 1TKZA 2ITMA 3VEXA 3OYHA 1BL3A 1J5OA 2P9NA 2P5OA 2QWMA 3JYTA 2GBZA 1N6QA 4CGJA 3ZT4A 4CJVA 2VYPA 4JKFA 2NNWA 3AO4A 3LM2A 3KVGA 3R8EA 4IDHA 4JI7K 2X6SA 1S1UA 3N4PA 3AO1A 3HJFA 1TKTA 3CCJN 4U67L 1RGIA 3AO5A 3TSPA 3VQ4A 4BQLA 4OPJA 1NKEA 1BI4A 1XNQK 5GADP 4FW1A 5HOOA 3VEZA 4IG0A 3SZ2A 3QDKA 3DOLA 3LDQA 4DTRA 3SPZA 2QEXN 2D0BA 4JI4K 4CIFA 1WSEA 1JLAA 1QHAA 4JI5K 3CJ7A 3U3YA 3T3FA 1NJZA 1K8AO 4ELVA 1W0HA 2P9UB 5KGXA 4JV5K 4FJXA 2O4GA 3A8YA 1EKEA 4E7KA 3EKSA 3TU5A 4WQ5A 3HT3A 3TTDA 3G25A 4FZXC 3O9RA 3TAPA 4Z4GA 3OW2M 1QQMA 5T7BA 3B6PA 1VSMA 3L6QA 2Q97A 3W3DA 4RW4A 2J4RA 1BISA 4CESA 3K57A 5C2FA 4J2BA 1IJJA 1S6PA 1CXUA 1W9HA 4CEQA 3LPTA 4FWRA 3ZEUB 2HVIA 5CZ1A 2W6KA 2D5RA 1K6YA 1W2BM 5EXWA 4E7LA 5AQTA 2E1YA 2QXLA 4IXCA 1VQON 3BUZB 3ZLJA 1NG9A 1I94K 4EFHA 3M8SA 3ITHA 3VERA 4IO9L 2VG5A 3ZT2A 4F3OA 1YUWA 3O6WA 2ZJQL 2NRVA 4DF8A 1NK4A 2G8HA 3VQ5A 1DGKN 3CERA 1J53A 3O5BA 4BVPA 1S1TA 2XO7A 3KKRA 1NKBA 3FZLA 4B9LA 3S3MA 3SLCA 2DFEA 1OH6A 3AVLA 3VEYA 4F3TA 3NCIA 4OVLA 4BRHA 1C0GA 2AJQA 1EETA 3AVJA 4H0PA 3MXMA 4RWTA 3I55N 2E2OA 1JLCA 4DFKA 2HW3A 4WFBL 1G99A 4M3WA 1KRPA 3OYLA 3D2EA 1QSSA 4FJ5A 3HVTA 3F2KA 1LAWA 3NGYA 3OYGA 1TUYA 5AQQA 4G1QA 5TKWA 3H3OB 3IMXA 3KWIA 2B4JA 1RT1A 1S9GA 4DR3K 3ZT0A 3H1VX 1XNRK 3MWPA 3QBWA 5FRNA 3Q7BA 3THYA 2NLXA 4AHUA 2HBMA 2E6LA 3WNFA 1Q8IA 4RW9A 4DTNA 3QEVA 5FRMA 1GLCG 4JS5A 3ENBA 1MU2A 1BUPA 3HSTB 3O1BA 3C0BA 3HM8A 4WE1A 5LMUK 2A40A 4FK4A 3ZX2A 2FSKA 3PLAA 1BO5O 1JLQA 1S72N 5AQZA 3DOKA 4H8KA 1NLVA 2V51B 2Q31A 1IBKK 5C25A 4JI2K 1ZBUA 3J7ZO 4F2RA 1VAZA 4E1NA 2GUPA 4JKAA 2F8SA 1UA1A 3GL1A 1K9MO 2YHWA 1D5AA 4AQYK 4JHDB 4JRQA 1QVFM 2HHUA 4CGDA 4M3RA 4ELUA 3DM2A 1BQMA 5AQIA 4OX9K 2PAVA 4OLAA 3LZJA 1LW0A 3DWLA 5BRHA 1ZBFA 3O3HA 4DTPA 1Y97A 3IFRA 4BR9A 3SBTA 3EE8A 3V1QA 4YOXA 4Z4IA 5GAGP 3SAFA 1SKWA 3K9KA 3VMFB 2FLOA 4BGAA 1SZ2A 1LW2A 1JLFA 1RBRA 4LFAK 4JKGA 1IO2A 2ZWHA 3NAEA 1RT7A 3CPEA 1X9MA 3L4IA 3HK2A 3MX5A 2QWQA 1GLBG 2NRTA 2KFNA 2P9SB 4JD2B 4GV3A 1S6QA 3NF9A 4DWIA 1U4BA 3P38A 4KHPK 1HQUA 4KO0A 5E84A 4DV5K 1SKSA 5C24A 2VGMA 1K73O 4N56A 3KLFA 3HP9A 5CR4A 3TSUA 3ISNC 1N8RO 4PKIA 4C8KA 5J1EA 1NK8A 2GWKA 2HHWA 2GUIA 3QFUA 3VETA 4C1NI 1Q9YA 1D8YA 2JGUA 1NOYA 1MWMA 3TANA 1E4GT 1VSFA 2Q0UA 5KRTA 1RTIA 3J80O 3ZSVA 1VQ4N 4FOEA 2FBXA 4CHQA 3OJUA 4M63C 2V7YA 3OYNA 1YJNN 4BROA 4FYDA 5KGWA 5SWMA 4JNEA 3VQ8A 3OS0A 4UQGA 4BRCA 3MEDA 2P1JA 3AGKA 4B3TK 4AH9A 3P31A 3V9ZA 5CY4A 1ATRA 3LWLA 3SV4A 1CZBA 1U6ZA 4KI4A 3H45C 3BY5A 3T1HK 4O4GA 3SK3A 4BRMA 4BACA 4GVMA 2P5GA 1TK8A 1VQNN 5F1XA 1HNIA 4H5RA 1JCEA 3U9DA 4W5TA 2HNYA 4B3SK 2HHXA 3EE9A 1J6ZA 5AQOA 4FWPA 3ULDA 4FLXA 4CHNA 2KZMA 1VRUA 1KFDA 4CJEA 3QIPA 2OANA 4DTSA 1TK5A 1LV5A 3KD1E 4DG1A 4PWDA 2HNDA 4J8FA 3AVNA 2NRWA 4YNQA 2NRHA 2GV9A 2O8BB 3VA3A 1X3NA 5E41A 1YJWN 4L8RB 2BDPA 4BRDA 4IOXA 4A5BA 3DXMB 2CGLA 2O8EA 4FLVA 2YI1A 4FJ9A 3T69A 3L0QA 2OTLN 5JICA 3DLKA 2G8VA 4WQ5C 4CF9A 4DQIA 1S1WA 1KSPA 1YXQA 2FSJA 3MCPA 5DMRA 4B1WB 1KD1O 4CF8A 1RT4A 5BR9A 4LF6K 4HTUA 3BZCA 4BRIA 3DRSA 4KHYA 3EZ5A 3HYFA 4CZEA 3QEIA 3QICA 2OTJN 1QZ6A 5FPEA 3E9LA 1VQ9N 3PO5A 2G8IA 1BDGA 1ATNA 3OYCA 3C95A 2Q0RA 2O8FA 4JI8K 4IJAA 4JK7A 2ZE2A 1ZBLA 5AQGA 4C8LA 1EP4A 3C94A 1S1XA 2OPQA 3VEOA 4NLCA 4A62A 4OGCA 1BG3A 3LPUA 3PV8A 3HPHA 4DV7K 2A6AA 1NGEA 4KI6A 2VGNA 1NJIO 4FLTA 3HVRA 1Z6RA 3BGRA 1NMDA 4E0DA 1EXQA 3SJHA 4CIEA 1E4FT 2P9PB 5CZ2A 4LSNA 4BRKA 1DLOA 1HJRA 3CCMN 3OA9A 2NRZA 2KFZA 1IG8A 1T3VA 4X66K 4YHHK 1NGCA 3SUNA 1XHXA 1LAVA 5FLXO 5KTQA 3GG4A 1GLAG 4CFBA 3ATVA 1T6DA 4X65K 4QS7A 3VPZA 4CGGA 1QSYA 3U6FA 5LJWA 1X9JA 4KB0A 1YI2N 1RFQA 3CETA 4IBNA 1A5WA 3DRRA 1Q81O 4FZZA 3SJJA 3VGKA 4N41A 3O08A 1K8KA 1VQ7N 3J7YP 3CJCA 5LMNK 3U9ZA 4EIAA 4CJ3A 4GKJK 4HWIA 3CHWA 3DI6A 4CFCA 4B08A 3K5MA 4DV1K 2XY8A 4CVNE 1HYSA 3WEEB 2NRRA 3QB0A 4FJGA 4IDKA 3AGRA 1NK9A 3VOVA 1OKJA 1NGHA 3M1FA 2NZTA 4KTWA 3EYZA 4MLEA 1GOAA 1XQSC 2PBDA 4DR6K 3AA2A 2EX3A 3PX4A 3LM9A 4LH4A 4MO4A 3DJCA 3OYDA 4CJPA 3HP6A 4NCAA 1JJ2M 3VENA 4JKEA 2PY5A 3KK1A 1P90A 3RR7A 4C8MA 4YOWA 5J2PA 3VEVA 3S9HA 3SI6A 5EVZA 4IKFA 1UOCA 2YHBA 2EHGA 2I5JA 4FLZA 3U4LA 2IVOA 1U49A 2FBYA 3O4NA 4PA1A 2YJEA 4LC9B 1WSJA 3M8QA 5AZIB 2RPIA 5J2QA 4FWOA 3IKMA 2E4LA 1SQKA 3NVKA 3V9XA 4Z4EA 1HLUA 1N32K 2OYQA 4FW2A 3RSEA 1HX1A 3BEXA 2W40A 3PSIA 4DSKA 3MEGA 4ICLA 1JKHA 2E6MA 4Y1DA 4CJSA 1QQOA 3VF6A 1WSFA 1HYZA 3NFAA 2UXBK 3AAQA 4B3RK 4BY9C 4IG3A 2B6AA 1NGFA 4FJ7A 4BR2A 4YFUA 1T6CA 1RBTA 2WFBA 4CZHA 1HMVA 1N34K 3D2FB 2ZGZA 3A5NC 4CF0A 4K0KK 4RW7A 1BWFO 3TABA 4RW8A 4C8OA 4YOUA 2KKZA 4M3UA 4CZJA 4CZFA 1VQLN 3ZSQA 4FWLA 4KBOA 4M45A 1TL1A 4H5VA 4KB1A 1QTMA 3V81A 3CFOA 1FKOA 4KH4A 3OYBA 4M3XA 3O80A 3ZETA 3E1YA 1KQSM 3EN9A 4DQQA 2CGKA 2BTFA 4ZHRA 4DFMA 3QBXA 3L2UA 5K14A 4RW6A 2WBNA 3UKUB 3ZT3A 4A61A 5AQPA 4DHYA 2QTDA 1JCGA 4FVMA 1D9FA 3LZIA 5AQNA 1LWEA 3CC4N 3D7EO 3CJBA 4KHNA 2Y1IA 5C10A 1EO1A 4JLHA 3O4QA 4E1MA 4CJ7A 4AHVA 2E2NA 1U2VA 4DS5A 5B8HA 5M1OA 4CGIA 4FJKA 1NK5A 3CCUN 5AQVA 4FJHA 3TPQA 1QQNA 3M3ZA 5JS1A 3OVNA 4MO5A 5AR0A 1B9DA 3BZKA 5E26A 2ASPA 3P5JA 2YX6A 4BWMA 2E2QA 1XMOK 4CEOA 2IGIA 5M1PA 2RKIA 3I56N 1OH7A 3EL2A 3S41A 1S1VA 1WSGA 2A5XA 1RT6A 3SUPA 4K25A 4DQRA 1FKPA 3RRHA 3OYJA 3CCRN 5CYQA 3T1AA 3K0SA 3RMCA 4U7BA 4FOIA 3KLIA 1CLQA 4JKCA 3F9MA 4IJNA 1TL3A 3I8DA 3ZCMA 4BR5A 4CJLA 3K5LA 4B9SA 5C0YA 3O9QA 3IAYA 5AQLA 1KAZA 4BRGA 2D0AA 4RG8A 2HSTA 2W42A 5AZJA 1D9DA 3I0SA 2Q36A 3K2PA 1TGOA 5IWAK 4FJJA 3KK3A 3L2RA 2LSNA 2OZSA 3FGUA 1YF5L 3DLBA 2A3ZA 4CD1A 1D4XA 4MDBA 5F0XA 3RRGA 5M1KA 3NH0A 2HB5A 5GIOA 3CG7A 1NK6A 2XHBA 3CMAN 1IKVA 1IKWA 2ZJPL 5KQ8A 4CECA 4AF1A 2P9KA 3VQCA 3CCVN 4UY8O 2GWJA 2Z1JA 3MAQA 1MDUB 3FE1A 5HRSA 1N33K 1RBVA 3VQ7A 3QNNA 4OJRA 3SV3A 2HOEA 3KD5E 4I2PA 4E89A 2BANA 1VQ8N 4GKKK 3UKRA 4KTZA 2Z1GA 5J2NA 2A42A 3G4SN 2P9IB 1IKYA 4M41A 1SUQA 2DPNA 3ZYYX 3SCXA 3BDPA 1NGIA 1HPZA 3TWHA 3OYIA 4DR2K 2O4IA 4CJUA 3CI5A 2OZMA 4BR4A 2P9NB 1FK9A
chains in the Genus database with same CATH topology
2UUAK 1J5EK 4DUZK 4JI6K 4JI7K 2UXDK 4X65K 3OTOK 3JAMO 4LFAK 4DUYK 2HHHK 1N34K 2UUCK 1HR0K 4JI3K 4K0KK 2F4VK 4DV3K 4JI0K 4LF7K 4DV4K 1XNQK 2VQFK 4JYAK 3J7YP 5LMNK 4GKJK 2VQEK 5AJ3K 4LFBK 2UXCK 4DV0K 4DV1K 4CVNE 1HNZK 4KHPK 4CW7B 4DV5K 5A2QO 4JI4K 4JI5K 2E5LK 4LF6K 4DR3K 1XNRK 4JV5K 4DR4K 4DR5K 4DR1K 3T1YK 4LFCK 5IWAK 4DR6K 1N36K 4YY3K 4V19S 4X62K 3J80O 4JI8K 5LMUK 3J81O 4LF5K 4B3MK 4LF8K 1HNXK 1IBKK 4B3TK 4DV7K 4LF4K 4DR7K 4JI2K 4NXNK 1N33K 4X64K 3T1HK 1FJGK 4LF9K 1XMQK 1I94K 4DV6K 4AQYK 1IBMK 4GKKK 4JI1K 5BR8K 4B3SK 1N32K 4OX9K 4X66K 4YHHK 2UUBK 3J7AP 5IT9O 2UU9K 4NXMK 4DR2K 5LL6Z 4DV2K 5FLXO 1HNWK 1IBLK 2ZM6K 1XMOK 2UXBK 4B3RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA K;  1J5E K;  4DUZ K;  4JI6 K;  4JI7 K;  2UXD K;  4X65 K;  3OTO K;  3JAM O;  4LFA K;  4DUY K;  2HHH K;  1N34 K;  2UUC K;  1HR0 K;  4JI3 K;  4K0K K;  2F4V K;  4DV3 K;  4JI0 K;  4LF7 K;  4DV4 K;  1XNQ K;  2VQF K;  4JYA K;  3J7Y P;  5LMN K;  4GKJ K;  2VQE K;  5AJ3 K;  4LFB K;  2UXC K;  4DV0 K;  4DV1 K;  4CVN E;  1HNZ K;  4KHP K;  4CW7 B;  4DV5 K;  5A2Q O;  4JI4 K;  4JI5 K;  2E5L K;  4LF6 K;  4DR3 K;  1XNR K;  4JV5 K;  4DR4 K;  4DR5 K;  4DR1 K;  3T1Y K;  4LFC K;  5IWA K;  4DR6 K;  1N36 K;  4YY3 K;  4V19 S;  4X62 K;  3J80 O;  4JI8 K;  5LMU K;  3J81 O;  4LF5 K;  4B3M K;  4LF8 K;  1HNX K;  1IBK K;  4B3T K;  4DV7 K;  4LF4 K;  4DR7 K;  4JI2 K;  4NXN K;  1N33 K;  4X64 K;  3T1H K;  1FJG K;  4LF9 K;  1XMQ K;  1I94 K;  4DV6 K;  4AQY K;  1IBM K;  4GKK K;  4JI1 K;  5BR8 K;  4B3S K;  1N32 K;  4OX9 K;  4X66 K;  4YHH K;  2UUB K;  3J7A P;  5IT9 O;  2UU9 K;  4NXM K;  4DR2 K;  5LL6 Z;  4DV2 K;  5FLX O;  1HNW K;  1IBL K;  2ZM6 K;  1XMO K;  2UXB K;  4B3R K; 
#chains in the Genus database with same CATH topology
 1I39 A;  1VSJ A;  2D0P A;  4CBW A;  3FLC O;  3VN5 A;  3IUC A;  3OTO K;  4HTL A;  3I8B A;  4R5P A;  1WB9 A;  4H4O A;  2UUC K;  4BRN A;  3OS1 A;  4BC2 A;  3IG1 A;  4O0J A;  3O9S A;  4DQS A;  4B9U A;  3KLE A;  1X1P A;  3AVB A;  3WXL A;  1U45 A;  3QET A;  3ENH A;  3LP2 A;  5JVG L;  1REV A;  4JS4 A;  2HHQ A;  1GOB A;  4I7F A;  1BI4 B;  1NKC A;  4DCH A;  3CM6 A;  2HHT A;  4N47 A;  2QXF A;  4AHC A;  1C1C A;  4KH6 A;  3NBP A;  1RDC A;  4CHP A;  3SAH A;  5TKY A;  2HVH A;  4DR4 K;  5M1F A;  3UB5 A;  1ZBI A;  4K43 A;  3TTF A;  5KPR A;  3VQ6 A;  1ASW A;  3CCE N;  1YT3 A;  2AA4 A;  3D45 A;  4CK1 A;  3G0Z A;  1SL0 A;  3CQ8 A;  4OO1 J;  1KC8 O;  4WQ4 A;  1EX4 A;  5J2M A;  4FM0 A;  2FC0 A;  1TAU A;  2I7N A;  3EEQ A;  2E1Z A;  1HUX A;  1OVQ A;  4LF4 K;  3P39 A;  1NGD A;  4MFB A;  3OY9 A;  2OPR A;  4A2A A;  1WNS A;  2OCE A;  1XWL A;  1FJG K;  1Z05 A;  5D3G A;  4HHT A;  1HNV A;  3HPG A;  4CK3 A;  1NNE A;  4K8X A;  3L3U A;  1GLL O;  3QML A;  1IBM K;  4CEA A;  3MK6 A;  4IFV A;  2O8C A;  1RCH A;  5BPM A;  5LJV A;  3CPW M;  4JEP A;  5IT9 O;  3MCA B;  4YOT A;  1SL1 A;  2QWN A;  3WXM B;  3BF3 A;  1Y64 A;  1U47 A;  4CCH A;  3THW A;  1GLE G;  3CQY A;  4I6M A;  3CF5 L;  1VK0 A;  4M3Y A;  2WOM A;  4PHT X;  3CC2 N;  4ID1 A;  2VWB A;  1NGJ A;  1JLB A;  3THX A;  2OPS A;  4DU3 A;  3JAM O;  3OBW A;  1TUU A;  3KLH A;  3B8A X;  4H5T A;  1HR0 K;  3HL8 A;  4IEE A;  3NE6 A;  4WCE L;  4FJ8 A;  4CZM A;  5FRO A;  5F2R A;  1VHX A;  1DTT A;  4CER A;  4CJ4 A;  5HRN A;  4B1Y B;  4DV4 K;  3SUO A;  4ZTF A;  3QIO A;  4BQZ A;  1OH8 A;  3O1W A;  3C6T A;  3VEW A;  1VQK N;  3D2E B;  4DTO A;  4JYA K;  4QOZ B;  4QCL A;  4B9T A;  3JXU A;  3LWM A;  2RN2 A;  5AQS A;  4XIU A;  1RTH A;  3H08 A;  3K5N A;  4DTU A;  1L3T A;  3C6U A;  1CZA N;  3CJA A;  1CZ9 A;  1HNZ K;  1VSL A;  1HJO A;  4XEI A;  4CW7 B;  4Z94 A;  4CHO A;  5I42 A;  2FBV A;  3KWG A;  4BG9 A;  5AQJ A;  4A2B A;  5CHI A;  1TYQ A;  2A1S A;  4JKD A;  1N36 K;  4E7I A;  2QKB A;  1EQY A;  3LDO A;  2WC9 A;  3ULE A;  3T19 A;  4C1N K;  1RT2 A;  4GV9 A;  2VG7 A;  3THY B;  1UWB A;  2ZF5 O;  4GV6 A;  4O0I A;  4OPA A;  2I7P A;  4BC4 A;  2CH5 A;  2ATQ A;  2P9L A;  4IOC L;  5DK5 A;  4JAX A;  4LF5 K;  3E9O A;  3CCS N;  2CGJ A;  3K58 A;  1DKG D;  4YOV A;  2HBJ A;  4O8U A;  2YCH A;  1LWF A;  3K59 A;  3VQ9 A;  5AFU A;  4IO8 A;  1C0U A;  1LWC A;  3VQQ A;  3OYF A;  2O8D A;  3SYZ A;  3A0I X;  2A1R A;  3RTV A;  3CXC M;  3QEW A;  1I3A A;  3MN9 A;  4H0X B;  1KTQ A;  1J54 A;  1R59 O;  2R7Y A;  3E66 A;  3PX0 A;  3OYK A;  2ZD1 A;  1BIU A;  1WOQ A;  3WXI A;  2HF3 A;  1HKG A;  1C6V A;  2E2P A;  4Z0U A;  2UUB K;  4H0Y B;  4CFD A;  2ASO A;  4IEI A;  1KCF A;  5LY3 A;  4XH1 A;  1WUA A;  3C6A A;  4HUF A;  1RTD A;  4BE1 A;  3FZK A;  1IBL K;  4F9O A;  1C0T A;  1C1B A;  3BF1 A;  5HLF A;  5C15 A;  4IWV A;  3G10 A;  4HUG A;  4B9V A;  5AQW A;  4AHR A;  2RE2 A;  3NF7 A;  4IOA L;  1WLJ A;  2HHH K;  1MA9 B;  3M8R A;  3AY9 A;  1L3U A;  1GLF O;  4JKG B;  3H1Q A;  3OHR A;  4AM6 A;  1KVB A;  2QWP A;  2XRI A;  3PIP L;  3EO3 A;  4DFP A;  3CCL N;  4K42 A;  1NMN A;  1VQ5 N;  3DMJ A;  4DV0 K;  5GAH P;  2P9U A;  4FWN A;  3S3N A;  3RR8 A;  2VWK A;  1E3M A;  3SMP A;  1ZXO A;  3P4I A;  5BRE A;  4H03 B;  4ILG B;  3FZM A;  3LP1 A;  1JL1 A;  4H0V B;  3LDS A;  4KFB A;  4O8K A;  3AVK A;  3V1R A;  3VF2 A;  4XH5 A;  1ASV A;  1ILY A;  1S3X A;  3EY1 A;  4W5N A;  3SMS A;  3MXJ A;  4CEF A;  1ATS A;  3C7N A;  3CJ1 A;  3CJ9 A;  4YDU A;  4GW6 A;  3OS2 A;  1WAJ A;  2IVP A;  4EZ6 A;  4BRA A;  1T03 A;  4KHU A;  4ILJ A;  1L3S A;  5KQD A;  3ZEU A;  3O9U A;  3VQP A;  4CZL A;  2Y1J A;  3HO1 A;  3AA5 X;  3AO3 A;  3EKU A;  3HOT A;  3GOI A;  4CEZ A;  4A59 A;  2AP1 A;  4DB3 A;  4EHU A;  1YHQ N;  4B9M A;  4W5O A;  1DTQ A;  1TV6 A;  5AQU A;  4DQP A;  1VQM N;  4OKK A;  4CD3 A;  4PL8 A;  3NMU A;  3NH2 A;  1RDD A;  4M7Y A;  4OKE A;  3ZT1 A;  4BGB A;  4CEB A;  1WN7 A;  3V4I A;  1BQN A;  3MXI A;  3OBY A;  1W7A A;  2KHO A;  3MDQ A;  5BN8 A;  1KXP A;  3NHG A;  4M42 A;  3KK7 A;  1YTA A;  2IDO A;  4QS9 A;  3VA0 A;  4CJT A;  3MN6 A;  2F96 A;  4J2E A;  1IG9 A;  3AV9 A;  1RIL A;  4BRE A;  4M7X A;  4GMJ B;  4FM2 A;  1BOT O;  2B5J A;  2YHX A;  3HOS A;  3QEP A;  2E8A A;  4JI3 K;  3KLG A;  1V4T A;  4CGF A;  1J9A A;  1XC9 A;  2FF6 A;  3S3O A;  3R6M A;  5KPT A;  1TVR A;  1VSE A;  3LAM A;  4MLH A;  5AQH A;  1YIJ N;  2O8E B;  4F8R A;  2BH1 A;  3RWU A;  3RMB A;  3ZSR A;  4WQ4 C;  4QAG A;  3TAQ A;  4PKH A;  4KHW A;  1NGB A;  4C8N A;  1YTU A;  3CFP A;  2G8F A;  3ZSW A;  5CE3 A;  5BRD A;  1QSL A;  1IKX A;  1L3V A;  3QIN A;  1SAZ A;  3ZSZ A;  1ZC6 A;  4LFC K;  4BE0 A;  1RTJ A;  4DSE A;  1EWR A;  2IAJ A;  4BR0 A;  4Z4F A;  5HRP A;  2ZGY A;  2IVN A;  5JVH L;  4X62 K;  1Q82 O;  4E7J A;  1JLG A;  1R0A A;  5GIN A;  1P8Z A;  3QEX A;  4JKH A;  4CZI A;  1IV0 A;  3RVC A;  4ISE A;  1U04 A;  4RCH A;  3LDN A;  2Z1I A;  3V6D A;  2WON A;  2O8F B;  3FR0 A;  4AHT A;  4N76 A;  3K5O A;  1EWQ A;  1KLM A;  5I9E B;  3AVF A;  3AVA A;  1HNX K;  3PO4 A;  2WTU A;  3FFK B;  2UYT A;  4ISG A;  3WT0 A;  2QM1 A;  4DLG A;  2EWS A;  2NUB A;  3PSF A;  1M1K O;  4YOR A;  1BCM A;  1W97 L;  4JHD A;  3MMV A;  4DU1 A;  3WQT A;  4B1X B;  1BA1 A;  1RT3 A;  3V1O A;  2HHS A;  1LCU A;  5CYM A;  1S9E A;  3AO2 A;  1T8E A;  4FWM A;  4JI1 K;  3AVC A;  2HMP A;  3CYM A;  3NVM A;  1HPM A;  3HBT A;  3KK2 A;  5C2D A;  4DS4 A;  1S5J A;  4NXM K;  2D1K A;  4CGH A;  1KAY A;  3AAP A;  1XI1 A;  3L8B A;  2FXU A;  2KQ2 A;  2ZM6 K;  3V9U A;  4O5B A;  1FXX A;  4R79 A;  3KHY A;  4CIG A;  3TR8 A;  5HP1 A;  5AQY A;  2UUA K;  2UXD K;  4CJW A;  3LAL A;  5EY4 A;  3NGZ A;  2YNG A;  4E19 A;  4FWQ A;  4WF9 L;  4FK0 A;  4DTM A;  1X9S A;  2P9S A;  2YNF A;  4JD2 A;  4DKW A;  3P1G A;  2QI2 A;  2DY4 A;  1L5U A;  1N5Y A;  3L2V A;  3VF4 A;  4H5W A;  3ZSO A;  2YHA A;  2FF3 B;  4OKJ A;  5DM6 L;  1ESV A;  3ZSY A;  4BRF A;  4FLW A;  5AQX A;  4FVU A;  3AAR A;  5C42 A;  4O44 A;  5FPN A;  1TKD A;  2QWR A;  1VSD A;  1K8K B;  1RDA A;  3C7N B;  5A2Q O;  3CFR A;  3E01 A;  4DQ8 A;  2E5L K;  3ZSX A;  1T05 A;  1QHT A;  1WSH A;  1F21 A;  4KRE A;  3T1Y K;  1BA0 A;  2RF2 A;  2PZS A;  3AVI A;  2XY7 A;  4FPB A;  4V19 S;  3PX6 A;  5BPN A;  4JK8 A;  1Q86 O;  4IZ9 A;  4ZTJ A;  3R1X A;  3AA4 A;  2VWJ A;  4JKB A;  1WBD A;  2W6L A;  2D4W A;  4I2Q A;  3U3G A;  4HVJ A;  4E7H A;  3WUH A;  2HNZ A;  3NDK A;  1NK7 A;  1WAF A;  1GLD G;  4NYN A;  3HXM A;  1RDU A;  1QS4 A;  4CZG A;  1YJ9 N;  3ATU A;  4ILH A;  3OJS A;  3L4Q A;  2HHV A;  3HPO A;  1QE1 A;  1X3M A;  2PYL A;  3RMD A;  4K41 A;  3VQB A;  2HBL A;  3OYM A;  4BDP A;  3KKS A;  4DV6 K;  4AHS A;  3HTV A;  2XY5 A;  3NH1 A;  5FDL A;  5BRF A;  4KPY A;  3KIO A;  5HRR A;  2QWO A;  2QW9 A;  3TAM A;  3FFI A;  2FBT A;  5KI6 A;  1NJW A;  4FCY A;  2O8B A;  2JWK A;  1UA0 A;  4ID5 A;  4MQ3 A;  3RSE B;  4CF1 A;  3TAF A;  2G8W A;  4HUE A;  1JXE A;  3AVG A;  1RBU A;  4FM1 A;  5FPM A;  1J5E K;  3B6O A;  4JI6 K;  1BIZ A;  1JCF A;  1M90 O;  3A2F A;  3SUQ A;  3DXM A;  1HKC A;  4BRL A;  1A5X A;  4B9Q A;  2QA4 N;  3T7Z A;  3WXJ A;  3QER A;  4AM7 A;  4CJQ A;  3DLH A;  1SKR A;  5AQF A;  4PKG A;  5JS2 A;  3WXK A;  4DV3 K;  4JI0 K;  1ITG A;  3DXK A;  4LF7 K;  2BUP A;  4YDU C;  3PUF A;  3MN7 A;  5DM7 L;  3GBT A;  3L2W A;  1C0M A;  5GIP A;  3LAN A;  3L3V A;  5AJ3 K;  4ELT A;  1C0F A;  3FZF A;  2UXC K;  3A5M C;  3ALY A;  1SL2 A;  4B9N A;  3J8A A;  3P83 D;  4FXD A;  3V9W A;  4F4K A;  4CZK A;  3N4Q A;  3I0R A;  4RTF D;  1XC3 A;  5JMV A;  3TI0 A;  4FJI A;  1NWK A;  2ITG A;  1QQC A;  3TSQ A;  1G15 A;  1HKB A;  5HBM A;  2QK9 A;  4EP4 A;  1JLE A;  5EU7 A;  4CF2 A;  3QFP A;  2G8K A;  3TAR A;  3ZET B;  4I9Q A;  4E1J A;  4KAZ A;  1NM1 A;  1TAQ A;  4B3M K;  3F73 A;  4NO7 A;  4BRP A;  1NBW A;  3AVM A;  1RBS A;  4NLB A;  4EP5 A;  4MDA A;  3LDL A;  3Q7C A;  5JLH A;  4BC5 A;  3KTQ A;  4OLB A;  4GNI A;  5BN9 A;  1GOC A;  4PY5 A;  3DLR A;  3A5L C;  1KLN A;  2P9P A;  4CJK A;  3F5T A;  4B1U B;  3LP3 A;  3DYA A;  5AFU H;  2F7T A;  3SQ1 A;  4GY2 B;  4CI6 A;  3HZ6 A;  1DEJ A;  2IOC A;  1JXB A;  3SNN A;  3H3N O;  4FL9 A;  5BR8 K;  2RHK A;  2X74 A;  4FPA A;  4NCB A;  4KHQ A;  1U2V B;  1NU0 A;  3SQ2 A;  4J2A A;  4FK2 A;  2YKN A;  3O4W A;  5JLF A;  1CXQ A;  1BCO A;  5LL6 Z;  4DV2 K;  1RDW X;  1HNW K;  4OPH A;  1NJX A;  2GEL A;  1T7P A;  1NJY A;  4KKO A;  2F8T A;  1ZYQ A;  3ZX3 A;  3CIP A;  4CK2 A;  4NCG A;  2P51 A;  4DUZ K;  3OYE A;  3O9T A;  4EZ9 A;  3VGM A;  4FJN A;  4FLU A;  3NF6 A;  4DUY K;  3DLG A;  3RMA A;  3E9P A;  5HL7 L;  1VQ6 N;  3JSM A;  1NGG A;  4A57 A;  2A41 A;  2GX9 A;  2HF4 A;  4A5A A;  4B1V A;  4TSX A;  3NGI A;  4Q5V A;  1NGA A;  5ADX H;  3A5O C;  1U48 A;  1V4S A;  1UAX A;  3WEE A;  1QZ5 A;  4WFN L;  2VQE K;  1DT9 A;  2BE2 A;  5ELZ A;  3TAG A;  4CEE A;  3JS6 A;  2PFU A;  3VTH A;  4CED A;  2KW4 A;  4G9Z A;  4BC3 A;  3VGL A;  4DTJ A;  4B1Z A;  4WFA L;  1BGX T;  4DR5 K;  1VSI A;  4DR1 K;  4CFA A;  4EAH D;  5EOY A;  4YY3 K;  1YVN A;  3K9J A;  5AZJ B;  3MEC A;  2IIR A;  4FO0 A;  2WUS A;  1YAG A;  4BG8 A;  3R9P A;  1MWK A;  1KAX A;  3BP8 A;  3KZB A;  1VSH A;  5C12 A;  1XHZ A;  5AZI A;  4DFJ A;  4NXN K;  4B3O A;  4J2D A;  2KZZ A;  1Q7Y O;  3CC7 N;  2Z1H A;  2P9K B;  3WQU A;  1KVC A;  3O8M A;  3LDP A;  4Q0B A;  4DSF A;  4Z4C A;  2HMI A;  4KHS A;  2X78 A;  3ID8 A;  3HM9 A;  3H46 O;  2YNI A;  4PQU A;  3U8X A;  4DLE A;  2QWL A;  2YHY A;  5AQR A;  3J7A P;  2UU9 K;  3UKR B;  4CHY A;  2ZQB A;  1BHL A;  3DRP A;  3M8P A;  5AQK A;  1H1V A;  4M3T A;  4FSV A;  3DXK B;  4H4M A;  4CBU A;  4KTQ A;  1RNH A;  2DTU A;  3V9S A;  1O1W A;  3VQD A;  1LOT B;  1QVG M;  2E88 A;  3D2F A;  3VQA A;  3M6G A;  4B8A B;  2H3G X;  3D6R A;  2D0O A;  2GTD A;  1RDB A;  5M1N A;  2Q2R A;  4IFE A;  4FWK A;  4LH5 A;  3DLE A;  2W41 A;  4NB4 A;  4LY7 A;  2CH6 A;  2VQF K;  4H0O A;  1Q18 A;  2VCP A;  3PY8 A;  4PUO A;  3R3L A;  3DAW A;  2KLA A;  2V52 B;  3GE1 A;  1TK0 A;  4M3Z A;  3VTI A;  4FLY A;  1HQE A;  3LL3 A;  1OVY A;  3SBG A;  4HCC A;  4W5R A;  2ASM A;  2GEM A;  4BVO A;  4IFY A;  5ADX A;  4O5F A;  1XUP O;  3SAG A;  3PIO L;  4FWS A;  4DTX A;  1C1A A;  3SPY A;  1WSI A;  4JRP A;  1YIT N;  3UKU A;  3IS9 A;  3KJV A;  2DFH A;  3J81 O;  2V7Z A;  3OYA A;  2E20 A;  1S22 A;  1WBB A;  2YKM A;  3ASM A;  2F9T A;  3ENO A;  3LAK A;  4E3S A;  2JLE A;  5BPL A;  1T44 A;  5H1S Q;  3G6E N;  3TTC A;  4X64 K;  4OPK A;  3H6E A;  5I3U A;  4LF9 K;  3AA3 A;  1A5V A;  3CCQ N;  1XMQ K;  3WNG A;  3QES A;  1B92 A;  4EHT A;  2OA8 A;  2Q1N A;  1O13 A;  4B8C A;  4BE2 A;  4FJL A;  2X6N A;  4QS8 A;  3MEE A;  5EX5 A;  5KPZ A;  2IC3 A;  5FPD A;  1Q9X A;  4H0T B;  4CJR A;  3DLL L;  4H5N A;  1YVU A;  3MWT A;  3ZX0 A;  2O8C B;  2QKK A;  1HRH A;  1FW6 A;  4LD0 A;  4FZY A;  2F9W A;  1SS6 A;  1SV5 A;  3MN5 A;  5SZT A;  3THW B;  2PYJ A;  3VQE A;  2D0C A;  1ZBH A;  4DSI A;  4I6M B;  4F2S A;  4CBX A;  3WNE A;  3THX B;  2ETJ A;  2YJF A;  4C23 A;  2F4V K;  5MLC Q;  3G71 N;  5M1Q A;  2YNH A;  3UE5 A;  4CJF A;  1KFS A;  1TKX A;  3F9K A;  4WYB A;  5HRO A;  3AVH A;  1Z25 A;  4BDY A;  1VSK A;  2IS3 A;  4DF4 A;  4HCB A;  4CHZ A;  3QO9 A;  4Z4H A;  4LFB K;  3LP0 A;  4CJ5 A;  4BR7 A;  1NK0 A;  3IDH A;  3IRX A;  3NF8 A;  4K8Z A;  1BU6 O;  3EZW A;  1NOZ A;  3CM5 A;  4KH5 A;  4JK9 A;  1X9W A;  3W0L A;  3HI0 A;  3M5R A;  4LSL A;  3WNH A;  4CE9 A;  3QNO A;  1VQP N;  2BGG A;  4DU4 A;  3L2Q A;  4JN4 A;  2KTQ A;  4NYF A;  3O3G A;  1GLJ O;  3GDQ A;  2XY6 A;  4N5S A;  3C6H A;  3HSC A;  3TAE A;  4DMN A;  1RT5 A;  1TYQ B;  2DFF A;  4AIL C;  3VES A;  3O3F A;  3QLH A;  1KVA A;  2YV0 X;  3ULE B;  1ZBS A;  1Z26 A;  1B9F A;  2Q3S A;  1OH5 A;  3C65 A;  3THV A;  2ZJR L;  2P9L B;  4Y1C A;  2OPP A;  4LF8 K;  5KRS A;  4GVE A;  4O55 A;  3CME N;  3CD6 N;  1VRT A;  1IH7 A;  5AQM A;  3D0P A;  2NRX A;  4DR7 K;  1JL2 A;  4DSJ A;  1ASU A;  4YOY A;  3SQ4 A;  2VG6 A;  3HRG A;  3CQX A;  4Y0W A;  4XH4 A;  3SQ0 A;  3ID6 A;  4L3Q A;  4BWJ A;  2O8D B;  4PL7 A;  2FSN A;  3MX2 A;  4KRF A;  4BRQ A;  4DSL A;  1HYV A;  2JWL A;  4BDZ A;  2HBK A;  2P9I A;  3I33 A;  4ISF A;  5GAE P;  4OGE A;  2G8U A;  4FJM A;  4W5Q A;  4I9L A;  4KV8 A;  3UIQ A;  3FZH A;  1TKZ A;  2ITM A;  3VEX A;  3OYH A;  1BL3 A;  1J5O A;  2P9N A;  2P5O A;  2QWM A;  3JYT A;  2GBZ A;  1N6Q A;  4CGJ A;  3ZT4 A;  4CJV A;  2VYP A;  4JKF A;  2NNW A;  3AO4 A;  3LM2 A;  3KVG A;  3R8E A;  4IDH A;  4JI7 K;  2X6S A;  1S1U A;  3N4P A;  3AO1 A;  3HJF A;  1TKT A;  3CCJ N;  4U67 L;  1RGI A;  3AO5 A;  3TSP A;  3VQ4 A;  4BQL A;  4OPJ A;  1NKE A;  1BI4 A;  1XNQ K;  5GAD P;  4FW1 A;  5HOO A;  3VEZ A;  4IG0 A;  3SZ2 A;  3QDK A;  3DOL A;  3LDQ A;  4DTR A;  3SPZ A;  2QEX N;  2D0B A;  4JI4 K;  4CIF A;  1WSE A;  1JLA A;  1QHA A;  4JI5 K;  3CJ7 A;  3U3Y A;  3T3F A;  1NJZ A;  1K8A O;  4ELV A;  1W0H A;  2P9U B;  5KGX A;  4JV5 K;  4FJX A;  2O4G A;  3A8Y A;  1EKE A;  4E7K A;  3EKS A;  3TU5 A;  4WQ5 A;  3HT3 A;  3TTD A;  3G25 A;  4FZX C;  3O9R A;  3TAP A;  4Z4G A;  3OW2 M;  1QQM A;  5T7B A;  3B6P A;  1VSM A;  3L6Q A;  2Q97 A;  3W3D A;  4RW4 A;  2J4R A;  1BIS A;  4CES A;  3K57 A;  5C2F A;  4J2B A;  1IJJ A;  1S6P A;  1CXU A;  1W9H A;  4CEQ A;  3LPT A;  4FWR A;  3ZEU B;  2HVI A;  5CZ1 A;  2W6K A;  2D5R A;  1K6Y A;  1W2B M;  5EXW A;  4E7L A;  5AQT A;  2E1Y A;  2QXL A;  4IXC A;  1VQO N;  3BUZ B;  3ZLJ A;  1NG9 A;  1I94 K;  4EFH A;  3M8S A;  3ITH A;  3VER A;  4IO9 L;  2VG5 A;  3ZT2 A;  4F3O A;  1YUW A;  3O6W A;  2ZJQ L;  2NRV A;  4DF8 A;  1NK4 A;  2G8H A;  3VQ5 A;  1DGK N;  3CER A;  1J53 A;  3O5B A;  4BVP A;  1S1T A;  2XO7 A;  3KKR A;  1NKB A;  3FZL A;  4B9L A;  3S3M A;  3SLC A;  2DFE A;  1OH6 A;  3AVL A;  3VEY A;  4F3T A;  3NCI A;  4OVL A;  4BRH A;  1C0G A;  2AJQ A;  1EET A;  3AVJ A;  4H0P A;  3MXM A;  4RWT A;  3I55 N;  2E2O A;  1JLC A;  4DFK A;  2HW3 A;  4WFB L;  1G99 A;  4M3W A;  1KRP A;  3OYL A;  3D2E A;  1QSS A;  4FJ5 A;  3HVT A;  3F2K A;  1LAW A;  3NGY A;  3OYG A;  1TUY A;  5AQQ A;  4G1Q A;  5TKW A;  3H3O B;  3IMX A;  3KWI A;  2B4J A;  1RT1 A;  1S9G A;  4DR3 K;  3ZT0 A;  3H1V X;  1XNR K;  3MWP A;  3QBW A;  5FRN A;  3Q7B A;  3THY A;  2NLX A;  4AHU A;  2HBM A;  2E6L A;  3WNF A;  1Q8I A;  4RW9 A;  4DTN A;  3QEV A;  5FRM A;  1GLC G;  4JS5 A;  3ENB A;  1MU2 A;  1BUP A;  3HST B;  3O1B A;  3C0B A;  3HM8 A;  4WE1 A;  5LMU K;  2A40 A;  4FK4 A;  3ZX2 A;  2FSK A;  3PLA A;  1BO5 O;  1JLQ A;  1S72 N;  5AQZ A;  3DOK A;  4H8K A;  1NLV A;  2V51 B;  2Q31 A;  1IBK K;  5C25 A;  4JI2 K;  1ZBU A;  3J7Z O;  4F2R A;  1VAZ A;  4E1N A;  2GUP A;  4JKA A;  2F8S A;  1UA1 A;  3GL1 A;  1K9M O;  2YHW A;  1D5A A;  4AQY K;  4JHD B;  4JRQ A;  1QVF M;  2HHU A;  4CGD A;  4M3R A;  4ELU A;  3DM2 A;  1BQM A;  5AQI A;  4OX9 K;  2PAV A;  4OLA A;  3LZJ A;  1LW0 A;  3DWL A;  5BRH A;  1ZBF A;  3O3H A;  4DTP A;  1Y97 A;  3IFR A;  4BR9 A;  3SBT A;  3EE8 A;  3V1Q A;  4YOX A;  4Z4I A;  5GAG P;  3SAF A;  1SKW A;  3K9K A;  3VMF B;  2FLO A;  4BGA A;  1SZ2 A;  1LW2 A;  1JLF A;  1RBR A;  4LFA K;  4JKG A;  1IO2 A;  2ZWH A;  3NAE A;  1RT7 A;  3CPE A;  1X9M A;  3L4I A;  3HK2 A;  3MX5 A;  2QWQ A;  1GLB G;  2NRT A;  2KFN A;  2P9S B;  4JD2 B;  4GV3 A;  1S6Q A;  3NF9 A;  4DWI A;  1U4B A;  3P38 A;  4KHP K;  1HQU A;  4KO0 A;  5E84 A;  4DV5 K;  1SKS A;  5C24 A;  2VGM A;  1K73 O;  4N56 A;  3KLF A;  3HP9 A;  5CR4 A;  3TSU A;  3ISN C;  1N8R O;  4PKI A;  4C8K A;  5J1E A;  1NK8 A;  2GWK A;  2HHW A;  2GUI A;  3QFU A;  3VET A;  4C1N I;  1Q9Y A;  1D8Y A;  2JGU A;  1NOY A;  1MWM A;  3TAN A;  1E4G T;  1VSF A;  2Q0U A;  5KRT A;  1RTI A;  3J80 O;  3ZSV A;  1VQ4 N;  4FOE A;  2FBX A;  4CHQ A;  3OJU A;  4M63 C;  2V7Y A;  3OYN A;  1YJN N;  4BRO A;  4FYD A;  5KGW A;  5SWM A;  4JNE A;  3VQ8 A;  3OS0 A;  4UQG A;  4BRC A;  3MED A;  2P1J A;  3AGK A;  4B3T K;  4AH9 A;  3P31 A;  3V9Z A;  5CY4 A;  1ATR A;  3LWL A;  3SV4 A;  1CZB A;  1U6Z A;  4KI4 A;  3H45 C;  3BY5 A;  3T1H K;  4O4G A;  3SK3 A;  4BRM A;  4BAC A;  4GVM A;  2P5G A;  1TK8 A;  1VQN N;  5F1X A;  1HNI A;  4H5R A;  1JCE A;  3U9D A;  4W5T A;  2HNY A;  4B3S K;  2HHX A;  3EE9 A;  1J6Z A;  5AQO A;  4FWP A;  3ULD A;  4FLX A;  4CHN A;  2KZM A;  1VRU A;  1KFD A;  4CJE A;  3QIP A;  2OAN A;  4DTS A;  1TK5 A;  1LV5 A;  3KD1 E;  4DG1 A;  4PWD A;  2HND A;  4J8F A;  3AVN A;  2NRW A;  4YNQ A;  2NRH A;  2GV9 A;  2O8B B;  3VA3 A;  1X3N A;  5E41 A;  1YJW N;  4L8R B;  2BDP A;  4BRD A;  4IOX A;  4A5B A;  3DXM B;  2CGL A;  2O8E A;  4FLV A;  2YI1 A;  4FJ9 A;  3T69 A;  3L0Q A;  2OTL N;  5JIC A;  3DLK A;  2G8V A;  4WQ5 C;  4CF9 A;  4DQI A;  1S1W A;  1KSP A;  1YXQ A;  2FSJ A;  3MCP A;  5DMR A;  4B1W B;  1KD1 O;  4CF8 A;  1RT4 A;  5BR9 A;  4LF6 K;  4HTU A;  3BZC A;  4BRI A;  3DRS A;  4KHY A;  3EZ5 A;  3HYF A;  4CZE A;  3QEI A;  3QIC A;  2OTJ N;  1QZ6 A;  5FPE A;  3E9L A;  1VQ9 N;  3PO5 A;  2G8I A;  1BDG A;  1ATN A;  3OYC A;  3C95 A;  2Q0R A;  2O8F A;  4JI8 K;  4IJA A;  4JK7 A;  2ZE2 A;  1ZBL A;  5AQG A;  4C8L A;  1EP4 A;  3C94 A;  1S1X A;  2OPQ A;  3VEO A;  4NLC A;  4A62 A;  4OGC A;  1BG3 A;  3LPU A;  3PV8 A;  3HPH A;  4DV7 K;  2A6A A;  1NGE A;  4KI6 A;  2VGN A;  1NJI O;  4FLT A;  3HVR A;  1Z6R A;  3BGR A;  1NMD A;  4E0D A;  1EXQ A;  3SJH A;  4CIE A;  1E4F T;  2P9P B;  5CZ2 A;  4LSN A;  4BRK A;  1DLO A;  1HJR A;  3CCM N;  3OA9 A;  2NRZ A;  2KFZ A;  1IG8 A;  1T3V A;  4X66 K;  4YHH K;  1NGC A;  3SUN A;  1XHX A;  1LAV A;  5FLX O;  5KTQ A;  3GG4 A;  1GLA G;  4CFB A;  3ATV A;  1T6D A;  4X65 K;  4QS7 A;  3VPZ A;  4CGG A;  1QSY A;  3U6F A;  5LJW A;  1X9J A;  4KB0 A;  1YI2 N;  1RFQ A;  3CET A;  4IBN A;  1A5W A;  3DRR A;  1Q81 O;  4FZZ A;  3SJJ A;  3VGK A;  4N41 A;  3O08 A;  1K8K A;  1VQ7 N;  3J7Y P;  3CJC A;  5LMN K;  3U9Z A;  4EIA A;  4CJ3 A;  4GKJ K;  4HWI A;  3CHW A;  3DI6 A;  4CFC A;  4B08 A;  3K5M A;  4DV1 K;  2XY8 A;  4CVN E;  1HYS A;  3WEE B;  2NRR A;  3QB0 A;  4FJG A;  4IDK A;  3AGR A;  1NK9 A;  3VOV A;  1OKJ A;  1NGH A;  3M1F A;  2NZT A;  4KTW A;  3EYZ A;  4MLE A;  1GOA A;  1XQS C;  2PBD A;  4DR6 K;  3AA2 A;  2EX3 A;  3PX4 A;  3LM9 A;  4LH4 A;  4MO4 A;  3DJC A;  3OYD A;  4CJP A;  3HP6 A;  4NCA A;  1JJ2 M;  3VEN A;  4JKE A;  2PY5 A;  3KK1 A;  1P90 A;  3RR7 A;  4C8M A;  4YOW A;  5J2P A;  3VEV A;  3S9H A;  3SI6 A;  5EVZ A;  4IKF A;  1UOC A;  2YHB A;  2EHG A;  2I5J A;  4FLZ A;  3U4L A;  2IVO A;  1U49 A;  2FBY A;  3O4N A;  4PA1 A;  2YJE A;  4LC9 B;  1WSJ A;  3M8Q A;  5AZI B;  2RPI A;  5J2Q A;  4FWO A;  3IKM A;  2E4L A;  1SQK A;  3NVK A;  3V9X A;  4Z4E A;  1HLU A;  1N32 K;  2OYQ A;  4FW2 A;  3RSE A;  1HX1 A;  3BEX A;  2W40 A;  3PSI A;  4DSK A;  3MEG A;  4ICL A;  1JKH A;  2E6M A;  4Y1D A;  4CJS A;  1QQO A;  3VF6 A;  1WSF A;  1HYZ A;  3NFA A;  2UXB K;  3AAQ A;  4B3R K;  4BY9 C;  4IG3 A;  2B6A A;  1NGF A;  4FJ7 A;  4BR2 A;  4YFU A;  1T6C A;  1RBT A;  2WFB A;  4CZH A;  1HMV A;  1N34 K;  3D2F B;  2ZGZ A;  3A5N C;  4CF0 A;  4K0K K;  4RW7 A;  1BWF O;  3TAB A;  4RW8 A;  4C8O A;  4YOU A;  2KKZ A;  4M3U A;  4CZJ A;  4CZF A;  1VQL N;  3ZSQ A;  4FWL A;  4KBO A;  4M45 A;  1TL1 A;  4H5V A;  4KB1 A;  1QTM A;  3V81 A;  3CFO A;  1FKO A;  4KH4 A;  3OYB A;  4M3X A;  3O80 A;  3ZET A;  3E1Y A;  1KQS M;  3EN9 A;  4DQQ A;  2CGK A;  2BTF A;  4ZHR A;  4DFM A;  3QBX A;  3L2U A;  5K14 A;  4RW6 A;  2WBN A;  3UKU B;  3ZT3 A;  4A61 A;  5AQP A;  4DHY A;  2QTD A;  1JCG A;  4FVM A;  1D9F A;  3LZI A;  5AQN A;  1LWE A;  3CC4 N;  3D7E O;  3CJB A;  4KHN A;  2Y1I A;  5C10 A;  1EO1 A;  4JLH A;  3O4Q A;  4E1M A;  4CJ7 A;  4AHV A;  2E2N A;  1U2V A;  4DS5 A;  5B8H A;  5M1O A;  4CGI A;  4FJK A;  1NK5 A;  3CCU N;  5AQV A;  4FJH A;  3TPQ A;  1QQN A;  3M3Z A;  5JS1 A;  3OVN A;  4MO5 A;  5AR0 A;  1B9D A;  3BZK A;  5E26 A;  2ASP A;  3P5J A;  2YX6 A;  4BWM A;  2E2Q A;  1XMO K;  4CEO A;  2IGI A;  5M1P A;  2RKI A;  3I56 N;  1OH7 A;  3EL2 A;  3S41 A;  1S1V A;  1WSG A;  2A5X A;  1RT6 A;  3SUP A;  4K25 A;  4DQR A;  1FKP A;  3RRH A;  3OYJ A;  3CCR N;  5CYQ A;  3T1A A;  3K0S A;  3RMC A;  4U7B A;  4FOI A;  3KLI A;  1CLQ A;  4JKC A;  3F9M A;  4IJN A;  1TL3 A;  3I8D A;  3ZCM A;  4BR5 A;  4CJL A;  3K5L A;  4B9S A;  5C0Y A;  3O9Q A;  3IAY A;  5AQL A;  1KAZ A;  4BRG A;  2D0A A;  4RG8 A;  2HST A;  2W42 A;  5AZJ A;  1D9D A;  3I0S A;  2Q36 A;  3K2P A;  1TGO A;  5IWA K;  4FJJ A;  3KK3 A;  3L2R A;  2LSN A;  2OZS A;  3FGU A;  1YF5 L;  3DLB A;  2A3Z A;  4CD1 A;  1D4X A;  4MDB A;  5F0X A;  3RRG A;  5M1K A;  3NH0 A;  2HB5 A;  5GIO A;  3CG7 A;  1NK6 A;  2XHB A;  3CMA N;  1IKV A;  1IKW A;  2ZJP L;  5KQ8 A;  4CEC A;  4AF1 A;  2P9K A;  3VQC A;  3CCV N;  4UY8 O;  2GWJ A;  2Z1J A;  3MAQ A;  1MDU B;  3FE1 A;  5HRS A;  1N33 K;  1RBV A;  3VQ7 A;  3QNN A;  4OJR A;  3SV3 A;  2HOE A;  3KD5 E;  4I2P A;  4E89 A;  2BAN A;  1VQ8 N;  4GKK K;  3UKR A;  4KTZ A;  2Z1G A;  5J2N A;  2A42 A;  3G4S N;  2P9I B;  1IKY A;  4M41 A;  1SUQ A;  2DPN A;  3ZYY X;  3SCX A;  3BDP A;  1NGI A;  1HPZ A;  3TWH A;  3OYI A;  4DR2 K;  2O4I A;  4CJU A;  3CI5 A;  2OZM A;  4BR4 A;  2P9N B;  1FK9 A; 
#chains in the Genus database with same CATH homology
 2UUA K;  1J5E K;  4DUZ K;  4JI6 K;  4JI7 K;  2UXD K;  4X65 K;  3OTO K;  3JAM O;  4LFA K;  4DUY K;  2HHH K;  1N34 K;  2UUC K;  1HR0 K;  4JI3 K;  4K0K K;  2F4V K;  4DV3 K;  4JI0 K;  4LF7 K;  4DV4 K;  1XNQ K;  2VQF K;  4JYA K;  3J7Y P;  5LMN K;  4GKJ K;  2VQE K;  5AJ3 K;  4LFB K;  2UXC K;  4DV0 K;  4DV1 K;  4CVN E;  1HNZ K;  4KHP K;  4CW7 B;  4DV5 K;  5A2Q O;  4JI4 K;  4JI5 K;  2E5L K;  4LF6 K;  4DR3 K;  1XNR K;  4JV5 K;  4DR4 K;  4DR5 K;  4DR1 K;  3T1Y K;  4LFC K;  5IWA K;  4DR6 K;  1N36 K;  4YY3 K;  4V19 S;  4X62 K;  3J80 O;  4JI8 K;  5LMU K;  3J81 O;  4LF5 K;  4B3M K;  4LF8 K;  1HNX K;  1IBK K;  4B3T K;  4DV7 K;  4LF4 K;  4DR7 K;  4JI2 K;  4NXN K;  1N33 K;  4X64 K;  3T1H K;  1FJG K;  4LF9 K;  1XMQ K;  1I94 K;  4DV6 K;  4AQY K;  1IBM K;  4GKK K;  4JI1 K;  5BR8 K;  4B3S K;  1N32 K;  4OX9 K;  4X66 K;  4YHH K;  2UUB K;  3J7A P;  5IT9 O;  2UU9 K;  4NXM K;  4DR2 K;  5LL6 Z;  4DV2 K;  5FLX O;  1HNW K;  1IBL K;  2ZM6 K;  1XMO K;  2UXB K;  4B3R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...