1XMQK

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xmqK00
5FLXO 4LFBK 1XNRK 4DV2K 4JI3K 4B3MK 1XMQK 4DV1K 1N36K 4LF7K 1HNWK 4DUYK 5LL6Z 1FJGK 4NXNK 1I94K 4DR1K 4LFCK 4JI6K 3OTOK 4LF4K 4LF9K 1IBLK 2HHHK 4DR7K 3J81O 4B3TK 4OX9K 4KHPK 5BR8K 4DR6K 4JI5K 4YHHK 4JI4K 4DV7K 5IWAK 4DV5K 4X62K 4YY3K 4DV3K 3J7YP 2ZM6K 4K0KK 5A2QO 4DR2K 4AQYK 4B3SK 5LMUK 4JI7K 4DV4K 4X65K 2UUAK 4GKJK 4GKKK 2UUBK 4B3RK 4JV5K 2F4VK 4DUZK 4CVNE 1N33K 1HR0K 2UXBK 4V19S 3T1HK 1IBMK 1N32K 2UUCK 2VQFK 3J7AP 1XNQK 4JYAK 4LF6K 3J80O 4X66K 4DV6K 4JI0K 4LF8K 4DR4K 2E5LK 2VQEK 4DV0K 1IBKK 2UU9K 1HNXK 4LFAK 4JI8K 1XMOK 5LMNK 4DR5K 5IT9O 4CW7B 4DR3K 3T1YK 4NXMK 4JI1K 4LF5K 1HNZK 4JI2K 1N34K 1J5EK 2UXCK 5AJ3K 4X64K 3JAMO 2UXDK
chains in the Genus database with same CATH superfamily
4E7IA 4AF1A 3DLGA 3DI6A 3LALA 5DM7L 3LDSA 2NRVA 4HCCA 4CBUA 3SK3A 3RWUA 3E9LA 3SAHA 1TK0A 1K9MO 2YNGA 1NK8A 4IDKA 3L3UA 4JHDA 4FJLA 1RBRA 4OO1J 4FJ5A 4FZXC 1CXQA 3MX5A 4OPHA 3DLKA 5AQWA 4B08A 4I6MA 5J2NA 5BR8K 1U2VB 4FWKA 3WEEB 4I9QA 3SV4A 3SZ2A 3FE1A 4JK9A 2HBLA 2O8DA 3KIOA 4K42A 3O4NA 2A6AA 1OH6A 3NDKA 3AO4A 3OYEA 5ELZA 3QNOA 3DLRA 1E3MA 5CZ2A 3UKUA 3VENA 4YNQA 4CHZA 3HP9A 3MX2A 3AVJA 3ITHA 3ZSYA 4JK8A 4Q5VA 5HROA 4JRPA 1NLVA 1UWBA 2FBXA 4IJAA 1WBBA 5LJVA 3OYDA 2JWLA 1BQNA 3TAQA 4NLCA 1WSEA 4CJ3A 2NUBA 4A2AA 5AZJA 1WSIA 4LH4A 1EX4A 2Q0RA 3ATUA 3H1VX 4CJ5A 4KBOA 2YI1A 1KQSM 4JI8K 4CF2A 1U47A 4BC3A 1C0GA 4H4OA 5J2QA 2YX6A 1MWMA 3TSUA 1X9SA 4N56A 2E1ZA 4PQUA 4E7LA 1O13A 4M7YA 4FO0A 4BACA 3C65A 1BQMA 4XH4A 1BCOA 4R5PA 4B9MA 3SYZA 3OYLA 1ZBHA 4M3TA 2A3ZA 4CHQA 4GVEA 4JI3K 3HT3A 4CGFA 3IMXA 3QESA 3AAQA 3TU5A 4KTZA 1N36K 4LF7K 4FLWA 5KPTA 3QMLA 4CJLA 2E2OA 2PFUA 4TSXA 3PLAA 1VSMA 4C1NK 3VEVA 2YKNA 4BRLA 2A5XA 3KJVA 3AARA 5B8HA 1BI4B 3CMAN 3ZSQA 3SPYA 4CZJA 4OX9K 5J1EA 2DTUA 3VQQA 4DV7K 2KFNA 4BWMA 3I56N 1N6QA 2O8BA 4QAGA 3K0SA 4H0VB 3H08A 2FXUA 3MN9A 2WOMA 5BPMA 2O8CB 4J2DA 3UKRA 4BRAA 4CFAA 1TUUA 2X74A 3S41A 4DKWA 1RTJA 3ZSXA 4C8LA 4J2BA 3HBTA 5KPRA 4FJJA 2BUPA 1SL2A 2OZSA 3O8MA 1KRPA 1KVBA 2UUBK 1S1TA 3OYBA 5AQTA 4CGDA 3ZCMA 4H4MA 2OTJN 1C0TA 3VQ7A 2UXBK 3SCXA 4J8FA 4BR7A 3LP0A 2Q1NA 1KLMA 3TAGA 4KFBA 4CJWA 3SAFA 5ADXH 3CJ7A 1I39A 4O8KA 3LDNA 3WUHA 2W40A 3RR8A 1HUXA 2FF3B 4H8KA 4E1NA 3HK2A 3PX0A 3RRHA 1HQEA 1LOTB 3C6AA 3HZ6A 2QWPA 4FWQA 2D1KA 4O5BA 2HW3A 1SKWA 3ALYA 2HHUA 3P5JA 1C0FA 3P4IA 4Y1DA 1X3NA 4CF0A 3HXMA 3VTHA 3GE1A 1FK9A 2VYPA 4BVOA 4CF9A 4DSEA 3AO5A 3ENHA 1BL3A 4ID1A 3VGMA 4NO7A 2E4LA 4DWIA 2VG6A 4M3UA 2FLOA 4DF8A 3ZLJA 2HF3A 4I7FA 4IKFA 3LWMA 4DUYK 5LY3A 1JLFA 3OS2A 3NH2A 2AJQA 3QLHA 4FSVA 3SUQA 4HUEA 2G8IA 2RKIA 5FRMA 3OHRA 4DSJA 5GADP 1WLJA 1OVYA 4OGCA 3PIOL 2G8WA 2HHHK 4DR7K 2D0PA 3LDPA 3OBWA 3E9PA 1EXQA 2ITMA 2WFBA 4W5OA 3H45C 4DQQA 1NGBA 1QQCA 3PSIA 1KAXA 2XY5A 3OYGA 3MN6A 4OKEA 3UIQA 1D5AA 3O9TA 1NOYA 4MDBA 4E7HA 3THWA 3TAFA 4CJKA 4EZ9A 4OLAA 2WUSA 4HUFA 1HNIA 2UYTA 1EKEA 4FLVA 4FM0A 2OTLN 1BIZA 2OA8A 4JV5K 4FZYA 2HHSA 3K2PA 4EAHD 3RRGA 2CGKA 3DOKA 2F9WA 4KH5A 4E1JA 2W41A 3A5LC 1SKSA 4CFDA 3MCPA 3SMPA 3HOTA 5HL7L 4AHTA 3NBPA 1CLQA 2B4JA 3WNGA 2Q31A 2Z1JA 4KRFA 1REVA 4CJQA 2E5LK 5HOOA 3RTVA 4FWOA 2ZJRL 2BANA 2VG5A 4UY8O 1WSGA 1ILYA 4DQPA 4GY2B 1KTQA 3HJFA 2E6MA 3HOSA 2NRWA 2QXFA 4L8RB 3AVFA 1G15A 1JJ2M 1TV6A 5EXWA 3CCSN 3CCEN 3DXKB 3G4SN 1FKOA 4CIEA 3LP3A 4X64K 3HI0A 3VQ9A 2RHKA 1IO2A 2UXDK 4A5BA 4FJKA 3VF2A 3VEYA 3KD1E 1ASVA 5C42A 3EE8A 2F96A 4CZHA 4IZ9A 4YDUA 3WXKA 3QEXA 3SQ1A 4MDAA 3AVCA 2A1RA 4DTRA 4E19A 4KHYA 3VF4A 5TKYA 4LD0A 1ZBIA 3Q7BA 4FJ8A 1L3SA 4JI6K 4W5RA 3OTOK 3P38A 3D6RA 4E1MA 3EZWA 1SQKA 2QA4N 3K9KA 1BUPA 5EX5A 4B3TK 1CZ9A 2P9SA 4BR5A 5KRSA 1ATNA 3LANA 3THXB 2HVIA 2HSTA 2I7NA 4JKEA 4PHTX 3VEXA 1TKDA 5KQDA 1CXUA 4HCBA 5E84A 3ZEUA 4R79A 5JLHA 4DQSA 4DQIA 3L8BA 2GV9A 4JKHA 4BRCA 3AA3A 1BHLA 2XY7A 3CJ1A 3QIPA 3PX6A 4CK3A 1RT7A 1C1AA 3MEDA 3VESA 3OW2M 1W97L 3QDKA 3VMFB 4DUZK 1VSFA 2IGIA 3KVGA 1QSLA 2HF4A 3L2WA 3QFPA 4YOYA 1WSHA 3J8AA 5BN8A 3FFIA 2QW9A 3KWGA 1JLBA 1TKXA 4CIFA 3LZJA 4FJ7A 2XHBA 4BRQA 1UA1A 3TPQA 2GELA 1VRTA 1JLCA 3K5NA 3NE6A 3C6HA 3CM6A 4BRIA 3EL2A 1HNXK 1S22A 4RW8A 2CGJA 3VERA 5HP1A 3VQ6A 3LAKA 1NOZA 1LW0A 3DWLA 1JCGA 3VQEA 4EP4A 3L2QA 3DJCA 5C2FA 3CCUN 4JI1K 1YF5L 3HTVA 3VQCA 4B3OA 4AHSA 3QEVA 1RDCA 3FZKA 4B8CA 4J2AA 3VQ5A 1NGHA 2HBKA 1L3VA 3V4IA 3O4QA 1F21A 1IKVA 5M1PA 4C8NA 3WXLA 4DSFA 3AO3A 1M90O 3T3FA 3CFPA 3RMDA 1VSKA 3G0ZA 5ADXA 3ZSOA 2D0AA 4JN4A 4AILC 4DTOA 3E1YA 2P9KA 2P1JA 4M3XA 3ZYYX 4FOIA 4JLHA 1VQKN 3VGLA 3OYAA 5KI6A 4DTJA 4KTWA 5J2PA 3VPZA 4BC4A 4O0IA 4OGEA 1K8AO 4XH1A 3TAMA 3CCVN 4DTXA 1NK0A 2PZSA 4X62K 2P9NA 4DV3K 1LAVA 2PYJA 4JKCA 3O3FA 3V9XA 3JS6A 5D3GA 2KKZA 3IDHA 3RSEB 1TK8A 2Y1IA 3OJSA 4F9OA 3LWLA 2LSNA 3EE9A 1P8ZA 1JXBA 4CJRA 3NHGA 1HX1A 1S9EA 4C1NI 1RT5A 2IC3A 4L3QA 4CGHA 3H6EA 4DG1A 5C0YA 1NG9A 1HRHA 4B1ZA 1BU6O 3AV9A 2GBZA 1MDUB 2EX3A 3O1WA 1VQPN 4PKHA 4ELVA 3ZX0A 3UB5A 1JCEA 3C94A 3DXMA 2A41A 3LP1A 1K6YA 2FSNA 4ILHA 4BQLA 1NGCA 2Z1HA 3PUFA 2P51A 4CECA 4CJPA 4Z4IA 3P1GA 5C10A 3NH1A 4JKAA 4JK7A 4RTFD 4LF8K 3OYIA 5MLCQ 3CIPA 2G8UA 2J4RA 3AGKA 2W6KA 3M6GA 5LJWA 3KHYA 3LAMA 2G8VA 3SV3A 4FZZA 4W5QA 3NGZA 2HNYA 2Q0UA 4FJMA 4CJUA 1SZ2A 4IOXA 3CC2N 4BC2A 3O4WA 3FZMA 3I8BA 5KPZA 3PX4A 3FFKB 4DTPA 1ASUA 1T6CA 1VSJA 2IOCA 4QCLA 4DFPA 4F2SA 3ISNC 2QWMA 3CPWM 4Z4CA 5EY4A 4U67L 1QVGM 3OVNA 3I8DA 1RILA 4CHNA 4ELTA 4BRPA 1HKBA 4G1QA 3CJ9A 2ZD1A 3MDQA 4DSIA 4GV9A 1KD1O 3O6WA 4F8RA 3TTDA 1Q9XA 4FJIA 3THYB 2HMPA 1SKRA 4YHHK 3WT0A 3C7NA 5IWAK 2QKKA 4KB1A 3OYCA 2P9LA 2H3GX 3J7YP 3MAQA 1X1PA 4O0JA 2B6AA 1R0AA 2F8SA 3VTIA 2QWRA 2ZM6K 4OKJA 4BDZA 5M1KA 4CF8A 3J7ZO 2XRIA 4CI6A 2PBDA 3GG4A 3QEWA 2KFZA 2I5JA 3IRXA 3KKRA 4I9LA 2W6LA 4AHUA 1YHQN 1L5UA 4JKDA 3HM8A 3L0QA 4PKIA 4WYBA 5AZIB 3KZBA 1RDWX 2GWJA 1X9WA 3VA0A 1E4GT 1RBUA 3OS1A 3IUCA 3KWIA 3J7AP 3SQ0A 1ATRA 1RFQA 4AH9A 1U2VA 4A2BA 2BDPA 3N4PA 3WEEA 1XQSC 4ZHRA 4E3SA 3QNNA 1BG3A 1DTQA 2ZJQL 4CFCA 4KHNA 5CHIA 5CY4A 1RNHA 2HBMA 3F9KA 2ZWHA 1TUYA 2YJEA 4AM7A 4YDUC 4EIAA 3R6MA 4CW7B 4IFVA 4BRKA 3ZT1A 1VRUA 1QHAA 2IDOA 4RWTA 4KH6A 3V9SA 3BY5A 5CR4A 1NJZA 3RMCA 2HHTA 4CHYA 4KTQA 3ZSZA 1C1BA 1JL1A 1FW6A 2EWSA 1YXQA 1DGKN 4ISEA 3NF6A 2I7PA 4JD2B 1RDUA 2P9UB 3S3OA 4FWLA 2E2PA 3V9ZA 4AM6A 4FYDA 1BA0A 2HHXA 3BDPA 4KI6A 4CE9A 3TTFA 3A5OC 2D0OA 4J2EA 4K41A 2O8FB 1YJWN 5AQHA 3V6DA 2P9UA 2FC0A 4KV8A 3TAPA 1Q18A 3BF3A 4CHOA 3SMSA 4KHPK 1BCMA 4JI5K 1NGEA 2VGNA 4JI4K 1Y97A 2OZMA 2CH5A 3HPHA 1RBVA 2QEXN 3KLGA 2ITGA 4ILGB 4E7KA 3K58A 3IFRA 2EHGA 4H0PA 5AQSA 4KHUA 3NFAA 2KTQA 3CCJN 1XC3A 3LPTA 4DQ8A 4GKKK 4FM1A 2Q3SA 4B3RK 2F4VK 4KHWA 4M45A 4E89A 5HRSA 2ASMA 4OVLA 4CCHA 1WN7A 3HL8A 3MXJA 1YITN 3WQTA 1N32K 1BI4A 4KHQA 3QBWA 4WF9L 3ULEB 4LY7A 3KK7A 3GOIA 1QSSA 2YCHA 3ZT0A 3S9HA 3H46O 1NJWA 4FWMA 2R7YA 4I2QA 4BRDA 4MLHA 4M3RA 1B92A 2P9IB 3ZSVA 4LFAK 2O8CA 3EEQA 4H0XB 4DR5K 3TSQA 3T69A 3HSTB 4MLEA 3KLFA 3D2EB 4LF5K 4PA1A 3MXIA 1NGIA 3AY9A 3K5LA 4JS4A 2P9IA 2QWLA 2V7YA 1GOAA 3A5MC 3VQAA 4OPAA 3KLHA 5KQ8A 1S6PA 4IWVA 2DFEA 4C8MA 3BGRA 3LL3A 4DTMA 5JLFA 4IDHA 3NGIA 1XMQK 4CESA 5J2MA 1Q7YO 2Y1JA 5LL6Z 4CEFA 3VEOA 2G8HA 4FPAA 3AGRA 4LFCK 4HVJA 1KVCA 4H5RA 3CQ8A 3ZSRA 3MCAB 3CHWA 3JYTA 3F9MA 4QOZB 3V1OA 1MU2A 2QWOA 1C6VA 1KVAA 3G6EN 2E2QA 5C24A 1QQNA 3L6QA 4O55A 4WFBL 4BG8A 1C1CA 1OH5A 2NRHA 2KQ2A 4OJRA 3HO1A 5I42A 1RTDA 1NGDA 4DTNA 4ILJA 1NGJA 4ELUA 3O3HA 1WSJA 2KZMA 3U6FA 3SUPA 3ZT4A 4CGIA 4JKGB 2Q2RA 1A5WA 3NAEA 3CF5L 1QHTA 2GUPA 2ZGZA 3EO3A 3FGUA 4KH4A 4M63C 5EVZA 3GL1A 4JNEA 1LW2A 1HR0K 4CJFA 4C23A 5SZTA 1U4BA 1GLAG 4BDYA 4FJGA 3SJHA 2P9PB 3BZCA 4JKGA 3L2RA 3KTQA 1V4TA 4IO9L 4H0YB 1ZC6A 3LDQA 4PL8A 5KGXA 4IEIA 1B9DA 3SI6A 1VSIA 4JEPA 1JLAA 3SQ2A 3DOLA 3O9SA 1VSLA 2W42A 4YOVA 3LM2A 3MEEA 4N47A 1H1VA 4WFNL 2HNDA 4YORA 5FPNA 4CBXA 4F2RA 1GLLO 3ID6A 2OPSA 4B1VA 4NXMK 3D0PA 3G25A 1HNZK 1QVFM 1Z05A 1NU0A 4N41A 4FK4A 3CJBA 4BR9A 1VAZA 1IKWA 4DB3A 3ULDA 2YJFA 4B1WB 4IEEA 1U45A 4YOXA 4DTUA 4B9SA 3WXIA 3OY9A 3EY1A 2ZGYA 4DV1K 3D2FB 4IFEA 4EFHA 5AQNA 1HLUA 4RCHA 1BGXT 3RMAA 4O4GA 1KC8O 1Z26A 4FK0A 2O8EB 3MXMA 1O1WA 3HP6A 4B9QA 3LM9A 4H0TB 4F4KA 4BGAA 3CC7N 2G8KA 1W7AA 1I3AA 1YAGA 3DLBA 1RGIA 3CYMA 3V1RA 4FWSA 3ID8A 3DXKA 4A57A 1JXEA 1WUAA 5AQFA 4BR2A 4MFBA 2DFFA 4Y0WA 1CZAN 2YHAA 5AQYA 3QEPA 3G71N 4B1UB 3OBYA 4MO5A 4FLUA 4GMJB 3VQDA 5F1XA 4A5AA 4JAXA 3NCIA 4JS5A 2AA4A 3MN5A 2IVNA 4ISFA 4QS8A 1RT2A 4N76A 4CHPA 4W5NA 1EWQA 1ASWA 4H03B 1V4SA 3AAPA 4NB4A 5AQXA 3OYFA 1XWLA 1VK0A 4V19S 5H1SQ 2E2NA 3KKSA 1NMDA 4JKFA 2UUCK 3H1QA 2A42A 1MWKA 4OPJA 2PAVA 2WC9A 4Z4EA 2ZQBA 1YVNA 4B1XB 3Q7CA 4BQZA 1QTMA 2OYQA 3THXA 1OH8A 3PIPL 3C0BA 2IVOA 4NLBA 1VQ9N 1JLEA 4DFKA 3MN7A 3EKUA 3U4LA 4CZIA 4HTLA 1S1UA 4CD3A 4Z4HA 2YHWA 3I33A 3K59A 1U49A 5SWMA 4FLYA 4ICLA 5JMVA 3H3NO 5FPDA 2YKMA 4GW6A 4O8UA 1N34K 1IV0A 1FKPA 5AJ3K 2YV0X 1KFDA 4DU3A 1HNVA 4FOEA 1X3MA 4CGJA 3EN9A 1NWKA 1Q9YA 3L2UA 3QFUA 1D9FA 3S3MA 1XHZA 3AVIA 5JICA 1Z6RA 3A0IX 3OYMA 3KK1A 4CZMA 3T19A 3AVBA 1NK4A 4CEZA 4BE0A 3M8PA 4FK2A 3VGKA 4H5NA 1RDAA 4CGGA 2HBJA 1VQ7N 4LF4K 1DTTA 3DLHA 1TGOA 3OYHA 1NJIO 2X6SA 5TKWA 5AQLA 3GDQA 3J81O 5C2DA 5C12A 1YUWA 2WBNA 3CFOA 4Y1CA 2OPPA 2DY4A 5C15A 3NF8A 4W5TA 5GAEP 4GV6A 2RN2A 3WXMB 5GIOA 1KCFA 4CJ4A 4FJNA 1ESVA 5HBMA 3P31A 3EKSA 4GV3A 3VEZA 4DV4K 4BRFA 1SAZA 1KAYA 5BREA 1RBTA 4DS5A 2VG7A 4NCBA 1RT6A 2FBYA 2IVPA 2OPQA 5JS2A 4BGBA 1YJNN 1T8EA 1NMNA 3K9JA 1S6QA 3OYKA 1K8KB 4LF6K 3QBXA 1TL1A 1Y64A 1T3VA 4DV6K 3TAEA 4FJXA 3E01A 3FR0A 1S1XA 4KB0A 1LCUA 4DV0K 4DSLA 3RSEA 1LAWA 3V9WA 2A1SA 3WNEA 1S9GA 4CF1A 3ENOA 1J6ZA 1B9FA 4IBNA 4YFUA 3TSPA 3HRGA 1RT3A 3OS0A 5M1NA 1VQNN 2VWKA 1SS6A 4FJ9A 2D0CA 2NLXA 4A59A 4PUOA 4DFJA 3TI0A 3V81A 4NCGA 3O9UA 3TABA 1XNRK 4DV2K 1HPMA 3BZKA 3VA3A 4BVPA 3CC4N 1WSFA 2HHVA 1XHXA 3C6UA 1YJ9N 4E0DA 4K8ZA 3QICA 5BPNA 1FJGK 1QE1A 2HVHA 3R1XA 2FSJA 1YT3A 5M1FA 4K43A 5DK5A 3DM2A 1NM1A 1Q8IA 1EWRA 4BE1A 5AFUA 1R59O 3LP2A 4FLZA 4C8KA 3T7ZA 2KHOA 2V51B 1VQON 1VQMN 2ASOA 5KRTA 1VQ6N 4NCAA 5GIPA 1HYZA 5HRRA 4WCEL 4IOAL 2DFHA 5FRNA 3SBTA 3B6PA 1NGGA 1XI1A 4CJEA 5LMUK 3IKMA 1NNEA 5AQQA 1LWFA 1TYQB 3WNFA 4CERA 2NRRA 4CVNE 1N33K 4M3YA 3O08A 1S72N 4H5WA 4CJVA 1QQOA 3CCMN 2JWKA 1XNQK 3AVHA 3THYA 2OCEA 2AP1A 2VGMA 4M7XA 3VETA 1T6DA 1T44A 3ZSWA 4JI0K 4MQ3A 2XY6A 2RE2A 4JHDB 4DFMA 1GLFO 4FWNA 1S5JA 1A5XA 2YNFA 2ZJPL 1VSDA 4FL9A 5F2RA 1RT4A 1L3TA 2VWJA 2GX9A 3TWHA 4JRQA 5AQMA 5AQUA 4I6MB 4DLEA 2V7ZA 5AQJA 3CJAA 2OANA 4FXDA 3T1YK 2O8DB 4KPYA 3M8RA 2YHBA 2O4GA 4KREA 4PWDA 4KO0A 2OPRA 1SV5A 3CERA 3ZX3A 1J5EK 1ITGA 3AVAA 4CIGA 3K5MA 3D7EO 5FLXO 3NH0A 3LZIA 4LFBK 2RPIA 1UA0A 5AZIA 3UKUB 3MMVA 1ATSA 3A8YA 4K25A 1QZ6A 1YVUA 3I55N 3PO4A 4CZFA 2BGGA 4F3OA 1KLNA 4HWIA 4EHUA 1D4XA 1L3UA 3W0LA 3HPOA 4UQGA 2IS3A 2FF6A 3DLLL 4Z0UA 3LDLA 4DR1K 5HLFA 3U9DA 3AVKA 4WQ5A 4IXCA 3W3DA 3CM5A 3EYZA 4FLTA 5BRHA 5AZJB 4DHYA 1SL0A 2F8TA 2VWBA 2F9TA 4IG3A 1BO5O 4YY3K 3JXUA 3H3OB 1GLJO 1P90A 2D0BA 3TR8A 3OJUA 1Q81O 4DS4A 4B9TA 1IG9A 3O9RA 4YOUA 1NGAA 3CCQN 4Z4GA 2QWNA 1UOCA 4A61A 1D8YA 3HPGA 4CZGA 4JD2A 3WQUA 5BPLA 1DKGD 3VEWA 2HHWA 1IJJA 4DU4A 1ZBFA 3FLCO 5EU7A 4AHVA 2E1YA 2HOEA 5JVGL 3CPEA 2E8AA 2ETJA 4M41A 2Z1GA 3CFRA 5FROA 2O8FA 4O5FA 3O1BA 3T1HK 3P83D 1S1WA 5AQGA 2QI2A 1TAQA 1VQ5N 3OYJA 4CFBA 3SPZA 5FPEA 1QSYA 1HMVA 1LWCA 5KTQA 5AQZA 3AO1A 3LPUA 3O9QA 5CZ1A 3G10A 2X6NA 1TVRA 1VQLN 2XO7A 5F0XA 4LH5A 2ZE2A 2E88A 4LSLA 4NYFA 1TL3A 1XMOK 1IKXA 5IT9O 2FSKA 4EHTA 2X78A 4CK2A 3M8SA 2GUIA 1LWEA 4ISGA 2O8BB 5T7BA 3CETA 4JI2K 2JGUA 3UKRB 4ID5A 4PKGA 1J9AA 4CJSA 3KK3A 3C95A 3O3GA 1IG8A 3ULEA 3B8AX 4IFYA 5GAHP 4EZ6A 1JKHA 1VQ4N 2RF2A 3BUZB 1C0MA 2DPNA 2CH6A 1BA1A 4DQRA 3AVGA 3QIOA 4GNIA 1IBLK 2Q36A 1DT9A 2G8FA 3CCRN 2YNHA 4C8OA 4H5TA 4CD1A 5GINA 3D2EA 3A2FA 3OA9A 4IG0A 4DMNA 4I2PA 1N5YA 3PV8A 2Q97A 4ZTFA 1QZ5A 3IG1A 4LSNA 4B8AB 3QINA 4Q0BA 3D45A 2QXLA 4IOCL 4KAZA 4XH5A 4JI7K 2P5GA 4DSKA 5KGWA 4F3TA 1GLEG 2GTDA 5BRFA 3QB0A 5AR0A 4XIUA 5CYMA 1YTUA 3M5RA 4IJNA 2ZF5O 4JKBA 1RDBA 3TANA 4BWJA 1RTHA 1ZBUA 1G99A 4DCHA 4CEDA 1QQMA 3N4QA 3C6TA 3SLCA 3RR7A 1HKCA 1NKBA 1GLBG 1MA9B 3HVRA 1GLDG 1ZBSA 4RW6A 4WFAL 3KD5E 3K5OA 2NRZA 3L2VA 2VQEK 1RDDA 3R3LA 2V52B 3PO5A 3L4QA 3WNHA 4BY9C 3A5NC 4YOWA 2ASPA 1TKTA 3ASMA 1DLOA 4E7JA 5LMNK 3DLEA 3VQPA 3CG7A 1E4FT 3SNNA 5CYQA 1XC9A 1NK5A 4EP5A 3SBGA 3VN5A 2BTFA 4IO8A 2UXCK 3THWB 1T03A 3QETA 4YOTA 1W9HA 1NKEA 1WBDA 3GBTA 4G9ZA 2P9PA 2YHXA 1K73O 4WQ4A 1TAUA 4B3MK 1KXPA 3RMBA 1JCFA 4RG8A 3DYAA 3QEIA 3SUNA 1GOCA 3KLIA 3RVCA 1GLCG 4NXNK 3OYNA 1IKYA 1X9JA 2GWKA 4FJHA 5AFUH 5AQKA 2IIRA 5AQVA 2BH1A 2WONA 3QO9A 3CJCA 3M1FA 4BR4A 4CBWA 4MO4A 3FZFA 4HHTA 1VSEA 4RW4A 3E66A 4KHSA 2KW4A 4HUGA 4DF4A 4DU1A 3CD6N 4K0KK 4QS9A 2A40A 4M3WA 1DEJA 4FVUA 2NRTA 1ZBLA 3SUOA 2F7TA 5BR9A 3MWTA 2FBTA 4X65K 4GKJK 4CEEA 1WOQA 3CI5A 3D2FA 3JSMA 3L4IA 2QKBA 1WAJA 2NNWA 4BREA 3HSCA 1IBMK 2O8EA 4BG9A 2VQFK 3QERA 4JYAK 2JLEA 1UAXA 4HTUA 1NK9A 3CMEN 2PY5A 4QS7A 1M1KO 5GAGP 5AQIA 3WXJA 1T05A 2QTDA 3SAGA 4O44A 5BN9A 1NK6A 2P5OA 3TTCA 4CEQA 1VQ8N 1S3XA 2Z1IA 1GOBA 3M3ZA 4ZTJA 2P9SB 1X9MA 1YI2N 2HB5A 5JS1A 4DR3K 3BF1A 4BRMA 5E41A 4OLBA 3L3VA 3LDOA 4WQ5C 4RW9A 1BWFO 1IH7A 3ZEUB 4NYNA 3EZ5A 3BP8A 4FWPA 1N8RO 2E20A 4BE2A 1JL2A 4XEIA 5DMRA 3SQ4A 1OKJA 4CZLA 4BROA 4DTSA 3R8EA 1RT1A 3MEGA 1D9DA 4M42A 1EP4A 5AQRA 4LF9K 5FDLA 4BDPA 3AA2A 3CXCM 1BIUA 1HQUA 4BC5A 2YHYA 5AQOA 3NF9A 3VQ8A 3M8QA 4FCYA 4FVMA 3HVTA 1BISA 3U3YA 2O4IA 3NGYA 4B3SK 4FW2A 1RTIA 4A62A 4B9LA 3O5BA 4KKOA 2B5JA 4H0OA 1SUQA 4CEOA 5EOYA 4B9VA 5CE3A 3MECA 2D4WA 5BRDA 2E6LA 1RBSA 3VF6A 5E26A 3F2KA 2QM1A 1S1VA 3I0RA 1NJYA 3PSFA 4Z94A 3MK6A 3V9UA 2ATQA 3PY8A 1HJOA 5C25A 3U8XA 3BEXA 1T7PA 5I9EB 2GEMA 4KI4A 4BRNA 3FZLA 3U3GA 4FPBA 3ZETB 2D5RA 3DRPA 3J80O 5I3UA 1J5OA 1RCHA 3U9ZA 2P9KB 3CQXA 4FWRA 1EO1A 3KLEA 4Z4FA 1QS4A 1NKCA 3NVKA 4B1YB 2KLAA 2FBVA 2XY8A 1IBKK 1WB9A 3ZETA 1HYVA 3T1AA 4B9NA 3THVA 4CEBA 4PL7A 3KK2A 4WE1A 3ENBA 3E9OA 4CK1A 1J54A 5JVHL 2P9NB 2QWQA 1VHXA 2CGLA 1HKGA 1KFSA 4H5VA 3UE5A 3B6OA 4FW1A 3DRSA 1JLQA 1Q82O 3R9PA 3NF7A 4RW7A 3F5TA 4M3ZA 1KAZA 1VSHA 1W2BM 1HJRA 5FPMA 4DLGA 1U6ZA 4OKKA 3AVNA 3CQYA 1U48A 1K8KA 4CJ7A 4OPKA 1XUPO 4B9UA 1HNWK 3V1QA 2WTUA 1W0HA 4PY5A 3FZHA 2KZZA 4BRHA 1LV5A 1HYSA 3DXMB 2HMIA 1I94K 1BOTO 3S3NA 1SL1A 2BE2A 1JLGA 3AO2A 4K8XA 3ZX2A 1BDGA 4DR6K 1EETA 3I0SA 3O80A 1NJXA 4DV5K 1CZBA 5M1OA 3ATVA 1ZXOA 3VOVA 1Q86O 2IAJA 5M1QA 3VQ4A 3AA5X 3DRRA 3F73A 1A5VA 5K14A 1WAFA 1YTAA 5A2QO 4DR2K 4AQYK 3AA4A 5DM6L 4CZKA 1NGFA 3P39A 2UUAK 3IS9A 1FXXA 4GVMA 2PYLA 3IAYA 3MWPA 3VQBA 1OH7A 4U7BA 3DAWA 1TKZA 4LC9B 1KSPA 3AVLA 3TARA 3HM9A 2QK9A 5HRPA 1OVQA 4CZEA 1EQYA 4X66K 3HYFA 1WNSA 5HRNA 5AQPA 4DR4K 4BRGA 3DMJA 4BR0A 4CEAA 4FM2A 2UU9K 2NZTA 2NRXA 1ZYQA 1C0UA 4WQ4C 4AHCA 1NK7A 3SJJA 4AHRA 1J53A 3C7NB 1TK5A 2HHQA 3NMUA 3ZT3A 2YNIA 2HNZA 2P9LB 3AVMA 3ZT2A 1YIJN 4N5SA 1NBWA 1HPZA 3CCLN 1U04A 4FLXA 3NVMA 1TYQA 1Z25A 2VCPA 3K57A 3JAMO 4CJTA
chains in the Genus database with same CATH topology
5FLXO 4LFBK 1XNRK 4DV2K 4JI3K 4B3MK 1XMQK 4DV1K 1N36K 4LF7K 1HNWK 4DUYK 5LL6Z 1FJGK 4NXNK 1I94K 4DR1K 4LFCK 4JI6K 3OTOK 4LF4K 4LF9K 1IBLK 2HHHK 4DR7K 3J81O 4B3TK 4OX9K 4KHPK 5BR8K 4DR6K 4JI5K 4YHHK 4JI4K 4DV7K 5IWAK 4DV5K 4X62K 4YY3K 4DV3K 3J7YP 2ZM6K 4K0KK 5A2QO 4DR2K 4AQYK 4B3SK 5LMUK 4JI7K 4DV4K 4X65K 2UUAK 4GKJK 4GKKK 2UUBK 4B3RK 4JV5K 2F4VK 4DUZK 4CVNE 1N33K 1HR0K 2UXBK 4V19S 3T1HK 1IBMK 1N32K 2UUCK 2VQFK 3J7AP 1XNQK 4JYAK 4LF6K 3J80O 4X66K 4DV6K 4JI0K 4LF8K 4DR4K 2E5LK 2VQEK 4DV0K 1IBKK 2UU9K 1HNXK 4LFAK 4JI8K 1XMOK 5LMNK 4DR5K 5IT9O 4CW7B 4DR3K 3T1YK 4NXMK 4JI1K 4LF5K 1HNZK 4JI2K 1N34K 1J5EK 2UXCK 5AJ3K 4X64K 3JAMO 2UXDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX O;  4LFB K;  1XNR K;  4DV2 K;  4JI3 K;  4B3M K;  1XMQ K;  4DV1 K;  1N36 K;  4LF7 K;  1HNW K;  4DUY K;  5LL6 Z;  1FJG K;  4NXN K;  1I94 K;  4DR1 K;  4LFC K;  4JI6 K;  3OTO K;  4LF4 K;  4LF9 K;  1IBL K;  2HHH K;  4DR7 K;  3J81 O;  4B3T K;  4OX9 K;  4KHP K;  5BR8 K;  4DR6 K;  4JI5 K;  4YHH K;  4JI4 K;  4DV7 K;  5IWA K;  4DV5 K;  4X62 K;  4YY3 K;  4DV3 K;  3J7Y P;  2ZM6 K;  4K0K K;  5A2Q O;  4DR2 K;  4AQY K;  4B3S K;  5LMU K;  4JI7 K;  4DV4 K;  4X65 K;  2UUA K;  4GKJ K;  4GKK K;  2UUB K;  4B3R K;  4JV5 K;  2F4V K;  4DUZ K;  4CVN E;  1N33 K;  1HR0 K;  2UXB K;  4V19 S;  3T1H K;  1IBM K;  1N32 K;  2UUC K;  2VQF K;  3J7A P;  1XNQ K;  4JYA K;  4LF6 K;  3J80 O;  4X66 K;  4DV6 K;  4JI0 K;  4LF8 K;  4DR4 K;  2E5L K;  2VQE K;  4DV0 K;  1IBK K;  2UU9 K;  1HNX K;  4LFA K;  4JI8 K;  1XMO K;  5LMN K;  4DR5 K;  5IT9 O;  4CW7 B;  4DR3 K;  3T1Y K;  4NXM K;  4JI1 K;  4LF5 K;  1HNZ K;  4JI2 K;  1N34 K;  1J5E K;  2UXC K;  5AJ3 K;  4X64 K;  3JAM O;  2UXD K; 
#chains in the Genus database with same CATH topology
 4E7I A;  4AF1 A;  3DLG A;  3DI6 A;  3LAL A;  5DM7 L;  3LDS A;  2NRV A;  4HCC A;  4CBU A;  3SK3 A;  3RWU A;  3E9L A;  3SAH A;  1TK0 A;  1K9M O;  2YNG A;  1NK8 A;  4IDK A;  3L3U A;  4JHD A;  4FJL A;  1RBR A;  4OO1 J;  4FJ5 A;  4FZX C;  1CXQ A;  3MX5 A;  4OPH A;  3DLK A;  5AQW A;  4B08 A;  4I6M A;  5J2N A;  5BR8 K;  1U2V B;  4FWK A;  3WEE B;  4I9Q A;  3SV4 A;  3SZ2 A;  3FE1 A;  4JK9 A;  2HBL A;  2O8D A;  3KIO A;  4K42 A;  3O4N A;  2A6A A;  1OH6 A;  3NDK A;  3AO4 A;  3OYE A;  5ELZ A;  3QNO A;  3DLR A;  1E3M A;  5CZ2 A;  3UKU A;  3VEN A;  4YNQ A;  4CHZ A;  3HP9 A;  3MX2 A;  3AVJ A;  3ITH A;  3ZSY A;  4JK8 A;  4Q5V A;  5HRO A;  4JRP A;  1NLV A;  1UWB A;  2FBX A;  4IJA A;  1WBB A;  5LJV A;  3OYD A;  2JWL A;  1BQN A;  3TAQ A;  4NLC A;  1WSE A;  4CJ3 A;  2NUB A;  4A2A A;  5AZJ A;  1WSI A;  4LH4 A;  1EX4 A;  2Q0R A;  3ATU A;  3H1V X;  4CJ5 A;  4KBO A;  2YI1 A;  1KQS M;  4JI8 K;  4CF2 A;  1U47 A;  4BC3 A;  1C0G A;  4H4O A;  5J2Q A;  2YX6 A;  1MWM A;  3TSU A;  1X9S A;  4N56 A;  2E1Z A;  4PQU A;  4E7L A;  1O13 A;  4M7Y A;  4FO0 A;  4BAC A;  3C65 A;  1BQM A;  4XH4 A;  1BCO A;  4R5P A;  4B9M A;  3SYZ A;  3OYL A;  1ZBH A;  4M3T A;  2A3Z A;  4CHQ A;  4GVE A;  4JI3 K;  3HT3 A;  4CGF A;  3IMX A;  3QES A;  3AAQ A;  3TU5 A;  4KTZ A;  1N36 K;  4LF7 K;  4FLW A;  5KPT A;  3QML A;  4CJL A;  2E2O A;  2PFU A;  4TSX A;  3PLA A;  1VSM A;  4C1N K;  3VEV A;  2YKN A;  4BRL A;  2A5X A;  3KJV A;  3AAR A;  5B8H A;  1BI4 B;  3CMA N;  3ZSQ A;  3SPY A;  4CZJ A;  4OX9 K;  5J1E A;  2DTU A;  3VQQ A;  4DV7 K;  2KFN A;  4BWM A;  3I56 N;  1N6Q A;  2O8B A;  4QAG A;  3K0S A;  4H0V B;  3H08 A;  2FXU A;  3MN9 A;  2WOM A;  5BPM A;  2O8C B;  4J2D A;  3UKR A;  4BRA A;  4CFA A;  1TUU A;  2X74 A;  3S41 A;  4DKW A;  1RTJ A;  3ZSX A;  4C8L A;  4J2B A;  3HBT A;  5KPR A;  4FJJ A;  2BUP A;  1SL2 A;  2OZS A;  3O8M A;  1KRP A;  1KVB A;  2UUB K;  1S1T A;  3OYB A;  5AQT A;  4CGD A;  3ZCM A;  4H4M A;  2OTJ N;  1C0T A;  3VQ7 A;  2UXB K;  3SCX A;  4J8F A;  4BR7 A;  3LP0 A;  2Q1N A;  1KLM A;  3TAG A;  4KFB A;  4CJW A;  3SAF A;  5ADX H;  3CJ7 A;  1I39 A;  4O8K A;  3LDN A;  3WUH A;  2W40 A;  3RR8 A;  1HUX A;  2FF3 B;  4H8K A;  4E1N A;  3HK2 A;  3PX0 A;  3RRH A;  1HQE A;  1LOT B;  3C6A A;  3HZ6 A;  2QWP A;  4FWQ A;  2D1K A;  4O5B A;  2HW3 A;  1SKW A;  3ALY A;  2HHU A;  3P5J A;  1C0F A;  3P4I A;  4Y1D A;  1X3N A;  4CF0 A;  3HXM A;  3VTH A;  3GE1 A;  1FK9 A;  2VYP A;  4BVO A;  4CF9 A;  4DSE A;  3AO5 A;  3ENH A;  1BL3 A;  4ID1 A;  3VGM A;  4NO7 A;  2E4L A;  4DWI A;  2VG6 A;  4M3U A;  2FLO A;  4DF8 A;  3ZLJ A;  2HF3 A;  4I7F A;  4IKF A;  3LWM A;  4DUY K;  5LY3 A;  1JLF A;  3OS2 A;  3NH2 A;  2AJQ A;  3QLH A;  4FSV A;  3SUQ A;  4HUE A;  2G8I A;  2RKI A;  5FRM A;  3OHR A;  4DSJ A;  5GAD P;  1WLJ A;  1OVY A;  4OGC A;  3PIO L;  2G8W A;  2HHH K;  4DR7 K;  2D0P A;  3LDP A;  3OBW A;  3E9P A;  1EXQ A;  2ITM A;  2WFB A;  4W5O A;  3H45 C;  4DQQ A;  1NGB A;  1QQC A;  3PSI A;  1KAX A;  2XY5 A;  3OYG A;  3MN6 A;  4OKE A;  3UIQ A;  1D5A A;  3O9T A;  1NOY A;  4MDB A;  4E7H A;  3THW A;  3TAF A;  4CJK A;  4EZ9 A;  4OLA A;  2WUS A;  4HUF A;  1HNI A;  2UYT A;  1EKE A;  4FLV A;  4FM0 A;  2OTL N;  1BIZ A;  2OA8 A;  4JV5 K;  4FZY A;  2HHS A;  3K2P A;  4EAH D;  3RRG A;  2CGK A;  3DOK A;  2F9W A;  4KH5 A;  4E1J A;  2W41 A;  3A5L C;  1SKS A;  4CFD A;  3MCP A;  3SMP A;  3HOT A;  5HL7 L;  4AHT A;  3NBP A;  1CLQ A;  2B4J A;  3WNG A;  2Q31 A;  2Z1J A;  4KRF A;  1REV A;  4CJQ A;  2E5L K;  5HOO A;  3RTV A;  4FWO A;  2ZJR L;  2BAN A;  2VG5 A;  4UY8 O;  1WSG A;  1ILY A;  4DQP A;  4GY2 B;  1KTQ A;  3HJF A;  2E6M A;  3HOS A;  2NRW A;  2QXF A;  4L8R B;  3AVF A;  1G15 A;  1JJ2 M;  1TV6 A;  5EXW A;  3CCS N;  3CCE N;  3DXK B;  3G4S N;  1FKO A;  4CIE A;  3LP3 A;  4X64 K;  3HI0 A;  3VQ9 A;  2RHK A;  1IO2 A;  2UXD K;  4A5B A;  4FJK A;  3VF2 A;  3VEY A;  3KD1 E;  1ASV A;  5C42 A;  3EE8 A;  2F96 A;  4CZH A;  4IZ9 A;  4YDU A;  3WXK A;  3QEX A;  3SQ1 A;  4MDA A;  3AVC A;  2A1R A;  4DTR A;  4E19 A;  4KHY A;  3VF4 A;  5TKY A;  4LD0 A;  1ZBI A;  3Q7B A;  4FJ8 A;  1L3S A;  4JI6 K;  4W5R A;  3OTO K;  3P38 A;  3D6R A;  4E1M A;  3EZW A;  1SQK A;  2QA4 N;  3K9K A;  1BUP A;  5EX5 A;  4B3T K;  1CZ9 A;  2P9S A;  4BR5 A;  5KRS A;  1ATN A;  3LAN A;  3THX B;  2HVI A;  2HST A;  2I7N A;  4JKE A;  4PHT X;  3VEX A;  1TKD A;  5KQD A;  1CXU A;  4HCB A;  5E84 A;  3ZEU A;  4R79 A;  5JLH A;  4DQS A;  4DQI A;  3L8B A;  2GV9 A;  4JKH A;  4BRC A;  3AA3 A;  1BHL A;  2XY7 A;  3CJ1 A;  3QIP A;  3PX6 A;  4CK3 A;  1RT7 A;  1C1A A;  3MED A;  3VES A;  3OW2 M;  1W97 L;  3QDK A;  3VMF B;  4DUZ K;  1VSF A;  2IGI A;  3KVG A;  1QSL A;  2HF4 A;  3L2W A;  3QFP A;  4YOY A;  1WSH A;  3J8A A;  5BN8 A;  3FFI A;  2QW9 A;  3KWG A;  1JLB A;  1TKX A;  4CIF A;  3LZJ A;  4FJ7 A;  2XHB A;  4BRQ A;  1UA1 A;  3TPQ A;  2GEL A;  1VRT A;  1JLC A;  3K5N A;  3NE6 A;  3C6H A;  3CM6 A;  4BRI A;  3EL2 A;  1HNX K;  1S22 A;  4RW8 A;  2CGJ A;  3VER A;  5HP1 A;  3VQ6 A;  3LAK A;  1NOZ A;  1LW0 A;  3DWL A;  1JCG A;  3VQE A;  4EP4 A;  3L2Q A;  3DJC A;  5C2F A;  3CCU N;  4JI1 K;  1YF5 L;  3HTV A;  3VQC A;  4B3O A;  4AHS A;  3QEV A;  1RDC A;  3FZK A;  4B8C A;  4J2A A;  3VQ5 A;  1NGH A;  2HBK A;  1L3V A;  3V4I A;  3O4Q A;  1F21 A;  1IKV A;  5M1P A;  4C8N A;  3WXL A;  4DSF A;  3AO3 A;  1M90 O;  3T3F A;  3CFP A;  3RMD A;  1VSK A;  3G0Z A;  5ADX A;  3ZSO A;  2D0A A;  4JN4 A;  4AIL C;  4DTO A;  3E1Y A;  2P9K A;  2P1J A;  4M3X A;  3ZYY X;  4FOI A;  4JLH A;  1VQK N;  3VGL A;  3OYA A;  5KI6 A;  4DTJ A;  4KTW A;  5J2P A;  3VPZ A;  4BC4 A;  4O0I A;  4OGE A;  1K8A O;  4XH1 A;  3TAM A;  3CCV N;  4DTX A;  1NK0 A;  2PZS A;  4X62 K;  2P9N A;  4DV3 K;  1LAV A;  2PYJ A;  4JKC A;  3O3F A;  3V9X A;  3JS6 A;  5D3G A;  2KKZ A;  3IDH A;  3RSE B;  1TK8 A;  2Y1I A;  3OJS A;  4F9O A;  3LWL A;  2LSN A;  3EE9 A;  1P8Z A;  1JXB A;  4CJR A;  3NHG A;  1HX1 A;  1S9E A;  4C1N I;  1RT5 A;  2IC3 A;  4L3Q A;  4CGH A;  3H6E A;  4DG1 A;  5C0Y A;  1NG9 A;  1HRH A;  4B1Z A;  1BU6 O;  3AV9 A;  2GBZ A;  1MDU B;  2EX3 A;  3O1W A;  1VQP N;  4PKH A;  4ELV A;  3ZX0 A;  3UB5 A;  1JCE A;  3C94 A;  3DXM A;  2A41 A;  3LP1 A;  1K6Y A;  2FSN A;  4ILH A;  4BQL A;  1NGC A;  2Z1H A;  3PUF A;  2P51 A;  4CEC A;  4CJP A;  4Z4I A;  3P1G A;  5C10 A;  3NH1 A;  4JKA A;  4JK7 A;  4RTF D;  4LF8 K;  3OYI A;  5MLC Q;  3CIP A;  2G8U A;  2J4R A;  3AGK A;  2W6K A;  3M6G A;  5LJW A;  3KHY A;  3LAM A;  2G8V A;  3SV3 A;  4FZZ A;  4W5Q A;  3NGZ A;  2HNY A;  2Q0U A;  4FJM A;  4CJU A;  1SZ2 A;  4IOX A;  3CC2 N;  4BC2 A;  3O4W A;  3FZM A;  3I8B A;  5KPZ A;  3PX4 A;  3FFK B;  4DTP A;  1ASU A;  1T6C A;  1VSJ A;  2IOC A;  4QCL A;  4DFP A;  4F2S A;  3ISN C;  2QWM A;  3CPW M;  4Z4C A;  5EY4 A;  4U67 L;  1QVG M;  3OVN A;  3I8D A;  1RIL A;  4CHN A;  4ELT A;  4BRP A;  1HKB A;  4G1Q A;  3CJ9 A;  2ZD1 A;  3MDQ A;  4DSI A;  4GV9 A;  1KD1 O;  3O6W A;  4F8R A;  3TTD A;  1Q9X A;  4FJI A;  3THY B;  2HMP A;  1SKR A;  4YHH K;  3WT0 A;  3C7N A;  5IWA K;  2QKK A;  4KB1 A;  3OYC A;  2P9L A;  2H3G X;  3J7Y P;  3MAQ A;  1X1P A;  4O0J A;  2B6A A;  1R0A A;  2F8S A;  3VTI A;  2QWR A;  2ZM6 K;  4OKJ A;  4BDZ A;  5M1K A;  4CF8 A;  3J7Z O;  2XRI A;  4CI6 A;  2PBD A;  3GG4 A;  3QEW A;  2KFZ A;  2I5J A;  3IRX A;  3KKR A;  4I9L A;  2W6L A;  4AHU A;  1YHQ N;  1L5U A;  4JKD A;  3HM8 A;  3L0Q A;  4PKI A;  4WYB A;  5AZI B;  3KZB A;  1RDW X;  2GWJ A;  1X9W A;  3VA0 A;  1E4G T;  1RBU A;  3OS1 A;  3IUC A;  3KWI A;  3J7A P;  3SQ0 A;  1ATR A;  1RFQ A;  4AH9 A;  1U2V A;  4A2B A;  2BDP A;  3N4P A;  3WEE A;  1XQS C;  4ZHR A;  4E3S A;  3QNN A;  1BG3 A;  1DTQ A;  2ZJQ L;  4CFC A;  4KHN A;  5CHI A;  5CY4 A;  1RNH A;  2HBM A;  3F9K A;  2ZWH A;  1TUY A;  2YJE A;  4AM7 A;  4YDU C;  4EIA A;  3R6M A;  4CW7 B;  4IFV A;  4BRK A;  3ZT1 A;  1VRU A;  1QHA A;  2IDO A;  4RWT A;  4KH6 A;  3V9S A;  3BY5 A;  5CR4 A;  1NJZ A;  3RMC A;  2HHT A;  4CHY A;  4KTQ A;  3ZSZ A;  1C1B A;  1JL1 A;  1FW6 A;  2EWS A;  1YXQ A;  1DGK N;  4ISE A;  3NF6 A;  2I7P A;  4JD2 B;  1RDU A;  2P9U B;  3S3O A;  4FWL A;  2E2P A;  3V9Z A;  4AM6 A;  4FYD A;  1BA0 A;  2HHX A;  3BDP A;  4KI6 A;  4CE9 A;  3TTF A;  3A5O C;  2D0O A;  4J2E A;  4K41 A;  2O8F B;  1YJW N;  5AQH A;  3V6D A;  2P9U A;  2FC0 A;  4KV8 A;  3TAP A;  1Q18 A;  3BF3 A;  4CHO A;  3SMS A;  4KHP K;  1BCM A;  4JI5 K;  1NGE A;  2VGN A;  4JI4 K;  1Y97 A;  2OZM A;  2CH5 A;  3HPH A;  1RBV A;  2QEX N;  3KLG A;  2ITG A;  4ILG B;  4E7K A;  3K58 A;  3IFR A;  2EHG A;  4H0P A;  5AQS A;  4KHU A;  3NFA A;  2KTQ A;  3CCJ N;  1XC3 A;  3LPT A;  4DQ8 A;  4GKK K;  4FM1 A;  2Q3S A;  4B3R K;  2F4V K;  4KHW A;  4M45 A;  4E89 A;  5HRS A;  2ASM A;  4OVL A;  4CCH A;  1WN7 A;  3HL8 A;  3MXJ A;  1YIT N;  3WQT A;  1N32 K;  1BI4 A;  4KHQ A;  3QBW A;  4WF9 L;  3ULE B;  4LY7 A;  3KK7 A;  3GOI A;  1QSS A;  2YCH A;  3ZT0 A;  3S9H A;  3H46 O;  1NJW A;  4FWM A;  2R7Y A;  4I2Q A;  4BRD A;  4MLH A;  4M3R A;  1B92 A;  2P9I B;  3ZSV A;  4LFA K;  2O8C A;  3EEQ A;  4H0X B;  4DR5 K;  3TSQ A;  3T69 A;  3HST B;  4MLE A;  3KLF A;  3D2E B;  4LF5 K;  4PA1 A;  3MXI A;  1NGI A;  3AY9 A;  3K5L A;  4JS4 A;  2P9I A;  2QWL A;  2V7Y A;  1GOA A;  3A5M C;  3VQA A;  4OPA A;  3KLH A;  5KQ8 A;  1S6P A;  4IWV A;  2DFE A;  4C8M A;  3BGR A;  3LL3 A;  4DTM A;  5JLF A;  4IDH A;  3NGI A;  1XMQ K;  4CES A;  5J2M A;  1Q7Y O;  2Y1J A;  5LL6 Z;  4CEF A;  3VEO A;  2G8H A;  4FPA A;  3AGR A;  4LFC K;  4HVJ A;  1KVC A;  4H5R A;  3CQ8 A;  3ZSR A;  3MCA B;  3CHW A;  3JYT A;  3F9M A;  4QOZ B;  3V1O A;  1MU2 A;  2QWO A;  1C6V A;  1KVA A;  3G6E N;  2E2Q A;  5C24 A;  1QQN A;  3L6Q A;  4O55 A;  4WFB L;  4BG8 A;  1C1C A;  1OH5 A;  2NRH A;  2KQ2 A;  4OJR A;  3HO1 A;  5I42 A;  1RTD A;  1NGD A;  4DTN A;  4ILJ A;  1NGJ A;  4ELU A;  3O3H A;  1WSJ A;  2KZM A;  3U6F A;  3SUP A;  3ZT4 A;  4CGI A;  4JKG B;  2Q2R A;  1A5W A;  3NAE A;  3CF5 L;  1QHT A;  2GUP A;  2ZGZ A;  3EO3 A;  3FGU A;  4KH4 A;  4M63 C;  5EVZ A;  3GL1 A;  4JNE A;  1LW2 A;  1HR0 K;  4CJF A;  4C23 A;  5SZT A;  1U4B A;  1GLA G;  4BDY A;  4FJG A;  3SJH A;  2P9P B;  3BZC A;  4JKG A;  3L2R A;  3KTQ A;  1V4T A;  4IO9 L;  4H0Y B;  1ZC6 A;  3LDQ A;  4PL8 A;  5KGX A;  4IEI A;  1B9D A;  3SI6 A;  1VSI A;  4JEP A;  1JLA A;  3SQ2 A;  3DOL A;  3O9S A;  1VSL A;  2W42 A;  4YOV A;  3LM2 A;  3MEE A;  4N47 A;  1H1V A;  4WFN L;  2HND A;  4YOR A;  5FPN A;  4CBX A;  4F2R A;  1GLL O;  3ID6 A;  2OPS A;  4B1V A;  4NXM K;  3D0P A;  3G25 A;  1HNZ K;  1QVF M;  1Z05 A;  1NU0 A;  4N41 A;  4FK4 A;  3CJB A;  4BR9 A;  1VAZ A;  1IKW A;  4DB3 A;  3ULD A;  2YJF A;  4B1W B;  4IEE A;  1U45 A;  4YOX A;  4DTU A;  4B9S A;  3WXI A;  3OY9 A;  3EY1 A;  2ZGY A;  4DV1 K;  3D2F B;  4IFE A;  4EFH A;  5AQN A;  1HLU A;  4RCH A;  1BGX T;  3RMA A;  4O4G A;  1KC8 O;  1Z26 A;  4FK0 A;  2O8E B;  3MXM A;  1O1W A;  3HP6 A;  4B9Q A;  3LM9 A;  4H0T B;  4F4K A;  4BGA A;  3CC7 N;  2G8K A;  1W7A A;  1I3A A;  1YAG A;  3DLB A;  1RGI A;  3CYM A;  3V1R A;  4FWS A;  3ID8 A;  3DXK A;  4A57 A;  1JXE A;  1WUA A;  5AQF A;  4BR2 A;  4MFB A;  2DFF A;  4Y0W A;  1CZA N;  2YHA A;  5AQY A;  3QEP A;  3G71 N;  4B1U B;  3OBY A;  4MO5 A;  4FLU A;  4GMJ B;  3VQD A;  5F1X A;  4A5A A;  4JAX A;  3NCI A;  4JS5 A;  2AA4 A;  3MN5 A;  2IVN A;  4ISF A;  4QS8 A;  1RT2 A;  4N76 A;  4CHP A;  4W5N A;  1EWQ A;  1ASW A;  4H03 B;  1V4S A;  3AAP A;  4NB4 A;  5AQX A;  3OYF A;  1XWL A;  1VK0 A;  4V19 S;  5H1S Q;  2E2N A;  3KKS A;  1NMD A;  4JKF A;  2UUC K;  3H1Q A;  2A42 A;  1MWK A;  4OPJ A;  2PAV A;  2WC9 A;  4Z4E A;  2ZQB A;  1YVN A;  4B1X B;  3Q7C A;  4BQZ A;  1QTM A;  2OYQ A;  3THX A;  1OH8 A;  3PIP L;  3C0B A;  2IVO A;  4NLB A;  1VQ9 N;  1JLE A;  4DFK A;  3MN7 A;  3EKU A;  3U4L A;  4CZI A;  4HTL A;  1S1U A;  4CD3 A;  4Z4H A;  2YHW A;  3I33 A;  3K59 A;  1U49 A;  5SWM A;  4FLY A;  4ICL A;  5JMV A;  3H3N O;  5FPD A;  2YKM A;  4GW6 A;  4O8U A;  1N34 K;  1IV0 A;  1FKP A;  5AJ3 K;  2YV0 X;  1KFD A;  4DU3 A;  1HNV A;  4FOE A;  1X3M A;  4CGJ A;  3EN9 A;  1NWK A;  1Q9Y A;  3L2U A;  3QFU A;  1D9F A;  3S3M A;  1XHZ A;  3AVI A;  5JIC A;  1Z6R A;  3A0I X;  3OYM A;  3KK1 A;  4CZM A;  3T19 A;  3AVB A;  1NK4 A;  4CEZ A;  4BE0 A;  3M8P A;  4FK2 A;  3VGK A;  4H5N A;  1RDA A;  4CGG A;  2HBJ A;  1VQ7 N;  4LF4 K;  1DTT A;  3DLH A;  1TGO A;  3OYH A;  1NJI O;  2X6S A;  5TKW A;  5AQL A;  3GDQ A;  3J81 O;  5C2D A;  5C12 A;  1YUW A;  2WBN A;  3CFO A;  4Y1C A;  2OPP A;  2DY4 A;  5C15 A;  3NF8 A;  4W5T A;  5GAE P;  4GV6 A;  2RN2 A;  3WXM B;  5GIO A;  1KCF A;  4CJ4 A;  4FJN A;  1ESV A;  5HBM A;  3P31 A;  3EKS A;  4GV3 A;  3VEZ A;  4DV4 K;  4BRF A;  1SAZ A;  1KAY A;  5BRE A;  1RBT A;  4DS5 A;  2VG7 A;  4NCB A;  1RT6 A;  2FBY A;  2IVP A;  2OPQ A;  5JS2 A;  4BGB A;  1YJN N;  1T8E A;  1NMN A;  3K9J A;  1S6Q A;  3OYK A;  1K8K B;  4LF6 K;  3QBX A;  1TL1 A;  1Y64 A;  1T3V A;  4DV6 K;  3TAE A;  4FJX A;  3E01 A;  3FR0 A;  1S1X A;  4KB0 A;  1LCU A;  4DV0 K;  4DSL A;  3RSE A;  1LAW A;  3V9W A;  2A1S A;  3WNE A;  1S9G A;  4CF1 A;  3ENO A;  1J6Z A;  1B9F A;  4IBN A;  4YFU A;  3TSP A;  3HRG A;  1RT3 A;  3OS0 A;  5M1N A;  1VQN N;  2VWK A;  1SS6 A;  4FJ9 A;  2D0C A;  2NLX A;  4A59 A;  4PUO A;  4DFJ A;  3TI0 A;  3V81 A;  4NCG A;  3O9U A;  3TAB A;  1XNR K;  4DV2 K;  1HPM A;  3BZK A;  3VA3 A;  4BVP A;  3CC4 N;  1WSF A;  2HHV A;  1XHX A;  3C6U A;  1YJ9 N;  4E0D A;  4K8Z A;  3QIC A;  5BPN A;  1FJG K;  1QE1 A;  2HVH A;  3R1X A;  2FSJ A;  1YT3 A;  5M1F A;  4K43 A;  5DK5 A;  3DM2 A;  1NM1 A;  1Q8I A;  1EWR A;  4BE1 A;  5AFU A;  1R59 O;  3LP2 A;  4FLZ A;  4C8K A;  3T7Z A;  2KHO A;  2V51 B;  1VQO N;  1VQM N;  2ASO A;  5KRT A;  1VQ6 N;  4NCA A;  5GIP A;  1HYZ A;  5HRR A;  4WCE L;  4IOA L;  2DFH A;  5FRN A;  3SBT A;  3B6P A;  1NGG A;  1XI1 A;  4CJE A;  5LMU K;  3IKM A;  1NNE A;  5AQQ A;  1LWF A;  1TYQ B;  3WNF A;  4CER A;  2NRR A;  4CVN E;  1N33 K;  4M3Y A;  3O08 A;  1S72 N;  4H5W A;  4CJV A;  1QQO A;  3CCM N;  2JWK A;  1XNQ K;  3AVH A;  3THY A;  2OCE A;  2AP1 A;  2VGM A;  4M7X A;  3VET A;  1T6D A;  1T44 A;  3ZSW A;  4JI0 K;  4MQ3 A;  2XY6 A;  2RE2 A;  4JHD B;  4DFM A;  1GLF O;  4FWN A;  1S5J A;  1A5X A;  2YNF A;  2ZJP L;  1VSD A;  4FL9 A;  5F2R A;  1RT4 A;  1L3T A;  2VWJ A;  2GX9 A;  3TWH A;  4JRQ A;  5AQM A;  5AQU A;  4I6M B;  4DLE A;  2V7Z A;  5AQJ A;  3CJA A;  2OAN A;  4FXD A;  3T1Y K;  2O8D B;  4KPY A;  3M8R A;  2YHB A;  2O4G A;  4KRE A;  4PWD A;  4KO0 A;  2OPR A;  1SV5 A;  3CER A;  3ZX3 A;  1J5E K;  1ITG A;  3AVA A;  4CIG A;  3K5M A;  3D7E O;  5FLX O;  3NH0 A;  3LZI A;  4LFB K;  2RPI A;  1UA0 A;  5AZI A;  3UKU B;  3MMV A;  1ATS A;  3A8Y A;  4K25 A;  1QZ6 A;  1YVU A;  3I55 N;  3PO4 A;  4CZF A;  2BGG A;  4F3O A;  1KLN A;  4HWI A;  4EHU A;  1D4X A;  1L3U A;  3W0L A;  3HPO A;  4UQG A;  2IS3 A;  2FF6 A;  3DLL L;  4Z0U A;  3LDL A;  4DR1 K;  5HLF A;  3U9D A;  3AVK A;  4WQ5 A;  4IXC A;  3W3D A;  3CM5 A;  3EYZ A;  4FLT A;  5BRH A;  5AZJ B;  4DHY A;  1SL0 A;  2F8T A;  2VWB A;  2F9T A;  4IG3 A;  1BO5 O;  4YY3 K;  3JXU A;  3H3O B;  1GLJ O;  1P90 A;  2D0B A;  3TR8 A;  3OJU A;  1Q81 O;  4DS4 A;  4B9T A;  1IG9 A;  3O9R A;  4YOU A;  1NGA A;  3CCQ N;  4Z4G A;  2QWN A;  1UOC A;  4A61 A;  1D8Y A;  3HPG A;  4CZG A;  4JD2 A;  3WQU A;  5BPL A;  1DKG D;  3VEW A;  2HHW A;  1IJJ A;  4DU4 A;  1ZBF A;  3FLC O;  5EU7 A;  4AHV A;  2E1Y A;  2HOE A;  5JVG L;  3CPE A;  2E8A A;  2ETJ A;  4M41 A;  2Z1G A;  3CFR A;  5FRO A;  2O8F A;  4O5F A;  3O1B A;  3T1H K;  3P83 D;  1S1W A;  5AQG A;  2QI2 A;  1TAQ A;  1VQ5 N;  3OYJ A;  4CFB A;  3SPZ A;  5FPE A;  1QSY A;  1HMV A;  1LWC A;  5KTQ A;  5AQZ A;  3AO1 A;  3LPU A;  3O9Q A;  5CZ1 A;  3G10 A;  2X6N A;  1TVR A;  1VQL N;  2XO7 A;  5F0X A;  4LH5 A;  2ZE2 A;  2E88 A;  4LSL A;  4NYF A;  1TL3 A;  1XMO K;  1IKX A;  5IT9 O;  2FSK A;  4EHT A;  2X78 A;  4CK2 A;  3M8S A;  2GUI A;  1LWE A;  4ISG A;  2O8B B;  5T7B A;  3CET A;  4JI2 K;  2JGU A;  3UKR B;  4ID5 A;  4PKG A;  1J9A A;  4CJS A;  3KK3 A;  3C95 A;  3O3G A;  1IG8 A;  3ULE A;  3B8A X;  4IFY A;  5GAH P;  4EZ6 A;  1JKH A;  1VQ4 N;  2RF2 A;  3BUZ B;  1C0M A;  2DPN A;  2CH6 A;  1BA1 A;  4DQR A;  3AVG A;  3QIO A;  4GNI A;  1IBL K;  2Q36 A;  1DT9 A;  2G8F A;  3CCR N;  2YNH A;  4C8O A;  4H5T A;  4CD1 A;  5GIN A;  3D2E A;  3A2F A;  3OA9 A;  4IG0 A;  4DMN A;  4I2P A;  1N5Y A;  3PV8 A;  2Q97 A;  4ZTF A;  1QZ5 A;  3IG1 A;  4LSN A;  4B8A B;  3QIN A;  4Q0B A;  3D45 A;  2QXL A;  4IOC L;  4KAZ A;  4XH5 A;  4JI7 K;  2P5G A;  4DSK A;  5KGW A;  4F3T A;  1GLE G;  2GTD A;  5BRF A;  3QB0 A;  5AR0 A;  4XIU A;  5CYM A;  1YTU A;  3M5R A;  4IJN A;  2ZF5 O;  4JKB A;  1RDB A;  3TAN A;  4BWJ A;  1RTH A;  1ZBU A;  1G99 A;  4DCH A;  4CED A;  1QQM A;  3N4Q A;  3C6T A;  3SLC A;  3RR7 A;  1HKC A;  1NKB A;  1GLB G;  1MA9 B;  3HVR A;  1GLD G;  1ZBS A;  4RW6 A;  4WFA L;  3KD5 E;  3K5O A;  2NRZ A;  3L2V A;  2VQE K;  1RDD A;  3R3L A;  2V52 B;  3PO5 A;  3L4Q A;  3WNH A;  4BY9 C;  3A5N C;  4YOW A;  2ASP A;  1TKT A;  3ASM A;  1DLO A;  4E7J A;  5LMN K;  3DLE A;  3VQP A;  3CG7 A;  1E4F T;  3SNN A;  5CYQ A;  1XC9 A;  1NK5 A;  4EP5 A;  3SBG A;  3VN5 A;  2BTF A;  4IO8 A;  2UXC K;  3THW B;  1T03 A;  3QET A;  4YOT A;  1W9H A;  1NKE A;  1WBD A;  3GBT A;  4G9Z A;  2P9P A;  2YHX A;  1K73 O;  4WQ4 A;  1TAU A;  4B3M K;  1KXP A;  3RMB A;  1JCF A;  4RG8 A;  3DYA A;  3QEI A;  3SUN A;  1GOC A;  3KLI A;  3RVC A;  1GLC G;  4NXN K;  3OYN A;  1IKY A;  1X9J A;  2GWK A;  4FJH A;  5AFU H;  5AQK A;  2IIR A;  5AQV A;  2BH1 A;  2WON A;  3QO9 A;  3CJC A;  3M1F A;  4BR4 A;  4CBW A;  4MO4 A;  3FZF A;  4HHT A;  1VSE A;  4RW4 A;  3E66 A;  4KHS A;  2KW4 A;  4HUG A;  4DF4 A;  4DU1 A;  3CD6 N;  4K0K K;  4QS9 A;  2A40 A;  4M3W A;  1DEJ A;  4FVU A;  2NRT A;  1ZBL A;  3SUO A;  2F7T A;  5BR9 A;  3MWT A;  2FBT A;  4X65 K;  4GKJ K;  4CEE A;  1WOQ A;  3CI5 A;  3D2F A;  3JSM A;  3L4I A;  2QKB A;  1WAJ A;  2NNW A;  4BRE A;  3HSC A;  1IBM K;  2O8E A;  4BG9 A;  2VQF K;  3QER A;  4JYA K;  2JLE A;  1UAX A;  4HTU A;  1NK9 A;  3CME N;  2PY5 A;  4QS7 A;  1M1K O;  5GAG P;  5AQI A;  3WXJ A;  1T05 A;  2QTD A;  3SAG A;  4O44 A;  5BN9 A;  1NK6 A;  2P5O A;  3TTC A;  4CEQ A;  1VQ8 N;  1S3X A;  2Z1I A;  1GOB A;  3M3Z A;  4ZTJ A;  2P9S B;  1X9M A;  1YI2 N;  2HB5 A;  5JS1 A;  4DR3 K;  3BF1 A;  4BRM A;  5E41 A;  4OLB A;  3L3V A;  3LDO A;  4WQ5 C;  4RW9 A;  1BWF O;  1IH7 A;  3ZEU B;  4NYN A;  3EZ5 A;  3BP8 A;  4FWP A;  1N8R O;  2E20 A;  4BE2 A;  1JL2 A;  4XEI A;  5DMR A;  3SQ4 A;  1OKJ A;  4CZL A;  4BRO A;  4DTS A;  3R8E A;  1RT1 A;  3MEG A;  1D9D A;  4M42 A;  1EP4 A;  5AQR A;  4LF9 K;  5FDL A;  4BDP A;  3AA2 A;  3CXC M;  1BIU A;  1HQU A;  4BC5 A;  2YHY A;  5AQO A;  3NF9 A;  3VQ8 A;  3M8Q A;  4FCY A;  4FVM A;  3HVT A;  1BIS A;  3U3Y A;  2O4I A;  3NGY A;  4B3S K;  4FW2 A;  1RTI A;  4A62 A;  4B9L A;  3O5B A;  4KKO A;  2B5J A;  4H0O A;  1SUQ A;  4CEO A;  5EOY A;  4B9V A;  5CE3 A;  3MEC A;  2D4W A;  5BRD A;  2E6L A;  1RBS A;  3VF6 A;  5E26 A;  3F2K A;  2QM1 A;  1S1V A;  3I0R A;  1NJY A;  3PSF A;  4Z94 A;  3MK6 A;  3V9U A;  2ATQ A;  3PY8 A;  1HJO A;  5C25 A;  3U8X A;  3BEX A;  1T7P A;  5I9E B;  2GEM A;  4KI4 A;  4BRN A;  3FZL A;  3U3G A;  4FPB A;  3ZET B;  2D5R A;  3DRP A;  3J80 O;  5I3U A;  1J5O A;  1RCH A;  3U9Z A;  2P9K B;  3CQX A;  4FWR A;  1EO1 A;  3KLE A;  4Z4F A;  1QS4 A;  1NKC A;  3NVK A;  4B1Y B;  2KLA A;  2FBV A;  2XY8 A;  1IBK K;  1WB9 A;  3ZET A;  1HYV A;  3T1A A;  4B9N A;  3THV A;  4CEB A;  4PL7 A;  3KK2 A;  4WE1 A;  3ENB A;  3E9O A;  4CK1 A;  1J54 A;  5JVH L;  2P9N B;  2QWQ A;  1VHX A;  2CGL A;  1HKG A;  1KFS A;  4H5V A;  3UE5 A;  3B6O A;  4FW1 A;  3DRS A;  1JLQ A;  1Q82 O;  3R9P A;  3NF7 A;  4RW7 A;  3F5T A;  4M3Z A;  1KAZ A;  1VSH A;  1W2B M;  1HJR A;  5FPM A;  4DLG A;  1U6Z A;  4OKK A;  3AVN A;  3CQY A;  1U48 A;  1K8K A;  4CJ7 A;  4OPK A;  1XUP O;  4B9U A;  1HNW K;  3V1Q A;  2WTU A;  1W0H A;  4PY5 A;  3FZH A;  2KZZ A;  4BRH A;  1LV5 A;  1HYS A;  3DXM B;  2HMI A;  1I94 K;  1BOT O;  3S3N A;  1SL1 A;  2BE2 A;  1JLG A;  3AO2 A;  4K8X A;  3ZX2 A;  1BDG A;  4DR6 K;  1EET A;  3I0S A;  3O80 A;  1NJX A;  4DV5 K;  1CZB A;  5M1O A;  3ATV A;  1ZXO A;  3VOV A;  1Q86 O;  2IAJ A;  5M1Q A;  3VQ4 A;  3AA5 X;  3DRR A;  3F73 A;  1A5V A;  5K14 A;  1WAF A;  1YTA A;  5A2Q O;  4DR2 K;  4AQY K;  3AA4 A;  5DM6 L;  4CZK A;  1NGF A;  3P39 A;  2UUA K;  3IS9 A;  1FXX A;  4GVM A;  2PYL A;  3IAY A;  3MWP A;  3VQB A;  1OH7 A;  4U7B A;  3DAW A;  1TKZ A;  4LC9 B;  1KSP A;  3AVL A;  3TAR A;  3HM9 A;  2QK9 A;  5HRP A;  1OVQ A;  4CZE A;  1EQY A;  4X66 K;  3HYF A;  1WNS A;  5HRN A;  5AQP A;  4DR4 K;  4BRG A;  3DMJ A;  4BR0 A;  4CEA A;  4FM2 A;  2UU9 K;  2NZT A;  2NRX A;  1ZYQ A;  1C0U A;  4WQ4 C;  4AHC A;  1NK7 A;  3SJJ A;  4AHR A;  1J53 A;  3C7N B;  1TK5 A;  2HHQ A;  3NMU A;  3ZT3 A;  2YNI A;  2HNZ A;  2P9L B;  3AVM A;  3ZT2 A;  1YIJ N;  4N5S A;  1NBW A;  1HPZ A;  3CCL N;  1U04 A;  4FLX A;  3NVM A;  1TYQ A;  1Z25 A;  2VCP A;  3K57 A;  3JAM O;  4CJT A; 
#chains in the Genus database with same CATH homology
 5FLX O;  4LFB K;  1XNR K;  4DV2 K;  4JI3 K;  4B3M K;  1XMQ K;  4DV1 K;  1N36 K;  4LF7 K;  1HNW K;  4DUY K;  5LL6 Z;  1FJG K;  4NXN K;  1I94 K;  4DR1 K;  4LFC K;  4JI6 K;  3OTO K;  4LF4 K;  4LF9 K;  1IBL K;  2HHH K;  4DR7 K;  3J81 O;  4B3T K;  4OX9 K;  4KHP K;  5BR8 K;  4DR6 K;  4JI5 K;  4YHH K;  4JI4 K;  4DV7 K;  5IWA K;  4DV5 K;  4X62 K;  4YY3 K;  4DV3 K;  3J7Y P;  2ZM6 K;  4K0K K;  5A2Q O;  4DR2 K;  4AQY K;  4B3S K;  5LMU K;  4JI7 K;  4DV4 K;  4X65 K;  2UUA K;  4GKJ K;  4GKK K;  2UUB K;  4B3R K;  4JV5 K;  2F4V K;  4DUZ K;  4CVN E;  1N33 K;  1HR0 K;  2UXB K;  4V19 S;  3T1H K;  1IBM K;  1N32 K;  2UUC K;  2VQF K;  3J7A P;  1XNQ K;  4JYA K;  4LF6 K;  3J80 O;  4X66 K;  4DV6 K;  4JI0 K;  4LF8 K;  4DR4 K;  2E5L K;  2VQE K;  4DV0 K;  1IBK K;  2UU9 K;  1HNX K;  4LFA K;  4JI8 K;  1XMO K;  5LMN K;  4DR5 K;  5IT9 O;  4CW7 B;  4DR3 K;  3T1Y K;  4NXM K;  4JI1 K;  4LF5 K;  1HNZ K;  4JI2 K;  1N34 K;  1J5E K;  2UXC K;  5AJ3 K;  4X64 K;  3JAM O;  2UXD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...