1RDAA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTNGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdaA00
5FDLA 2P51A 3SQ0A 4C8LA 3AO5A 1XI1A 4DQPA 1RBRA 4IBNA 4Q5VA 3KLEA 3NAEA 3AO1A 1HYVA 1T05A 4CK2A 3MEDA 3KKSA 4CESA 3ZSYA 4CGFA 1REVA 2YKNA 1IG9A 1BQNA 3QEVA 1Q9XA 5HP1A 1RT3A 3LANA 4DTUA 3AVFA 4KHNA 1QE1A 2D0BA 4CK1A 4CK3A 2KZMA 3QEIA 4IDKA 3NH1A 1U4BA 3NDKA 2XRIA 4F2RA 4F8RA 4FLZA 1BI4B 1QS4A 3QINA 1SKWA 4M45A 4FM2A 2IS3A 4KHQA 2ITGA 1B9DA 4WE1A 4Z4IA 3AO2A 1O1WA 2X6NA 4CF1A 2DFEA 4CFAA 1WNSA 5CY4A 4HUGA 3TI0A 5K14A 4K8ZA 4N47A 2KW4A 3S3NA 3VQ4A 4FLVA 2G8FA 3AVJA 1R0AA 3RWUA 4JS5A 1NKCA 2O4IA 3KLFA 3SUNA 3AVMA 4ID1A 3U3GA 2VG7A 4CCHA 3I0SA 2IOCA 3ZSQA 4F3OA 3U6FA 1VSEA 3TAFA 1ZBHA 1EETA 3AO4A 3TAPA 2A1RA 2FBXA 4E89A 4CGDA 2OPPA 1HNVA 3D45A 3WNHA 1D9FA 4E0DA 3V9WA 1N5YA 3AVGA 1BCMA 1EX4A 3NF8A 4GVMA 4JLHA 3SPZA 1S9GA 3TR8A 3OS0A 4OPJA 3NBPA 3VQPA 4CERA 4Z0UA 1J9AA 3AA4A 1T03A 5J2MA 2W42A 4Y1DA 3PX6A 4CGIA 4BDYA 1QSSA 3DOLA 3MECA 2YHAA 4I2QA 1NJZA 4KI6A 3CM6A 4HCCA 2VWJA 3OYIA 1CZ9A 2QK9A 4FM0A 4DLEA 1C0MA 4B9UA 1SKSA 2LSNA 3WNFA 3TAMA 4E1MA 1RDBA 1UAXA 2RPIA 3T1AA 3VA0A 1VRUA 2Z1JA 4CJLA 4DFJA 3WNEA 4CJ4A 3CYMA 4CHNA 2F8TA 4UQGA 5I3UA 3VQAA 4FM1A 3VQ6A 3NF7A 3NH0A 1RTDA 1QHTA 1X1PA 4BACA 4EZ9A 3SCXA 1FKPA 1SV5A 2D0AA 2OPSA 4DS4A 3OY9A 4I9QA 4BE2A 2F8SA 3OYEA 4RW4A 3DM2A 3OS2A 4FJ8A 4CF2A 1UOCA 4JS4A 3IRXA 4B9LA 1L5UA 4KB1A 1JL2A 2EHGA 5E41A 3CG7A 2E6LA 2ZD1A 3NGYA 5SWMA 1RT7A 3L2WA 2PY5A 2OZSA 3PX0A 2KFZA 1BIZA 2QXFA 3B6PA 3F9KA 3ZSZA 4YNQA 2HW3A 4NCGA 1JLAA 3OYDA 4FJHA 3KK3A 4M3TA 3QERA 3ZSWA 1S1UA 3JYTA 4CEEA 2FC0A 4AHRA 4AHVA 5J2NA 4OGCA 1S9EA 3NH2A 1FK9A 2ZQBA 3V1OA 4I2PA 3IS9A 2BE2A 1UWBA 1C0TA 4GW6A 4KTQA 3VQCA 3SJJA 5KRSA 1EP4A 1WLJA 3DRRA 1BGXT 1TL3A 3L3VA 4F4KA 1VRTA 4IG0A 1KLNA 3EZ5A 4FLUA 4MFBA 1GOCA 4OPKA 3EYZA 4DTPA 4DTNA 3DOKA 1X9MA 4IFVA 3QEXA 1B9FA 3DLKA 4DQRA 4DU4A 5CZ1A 2X6SA 3OYJA 3OYGA 3OYHA 3MXIA 1NOZA 3HXMA 1IO2A 3HL8A 1WSGA 4J2DA 1CXUA 2XY7A 2PYJA 2FBYA 2G8WA 1RBVA 4C8NA 3P83D 1C0UA 4ELTA 4FW2A 4DSJA 4EZ6A 1RBSA 3G0ZA 1ZBUA 4AILC 1WAFA 4RW7A 1A5WA 3AVNA 1TKXA 4CJ5A 4HUEA 1NK7A 1NKEA 1QQCA 2HHWA 3SYZA 3SUPA 1RILA 4DQSA 1VSDA 2Z1HA 3DMJA 1BL3A 3HVTA 2G8VA 2HHSA 3V1RA 3MXMA 4DU3A 3MXJA 2DFFA 2HHVA 3OYLA 3ZCMA 3SQ2A 1BQMA 3LP2A 2GUIA 3TANA 3PO4A 4FZXC 3AA2A 4O4GA 4RG8A 4AHCA 4CJEA 3OYAA 3LAMA 3QIPA 4H8KA 3LZJA 1IKYA 5C25A 3V1QA 1KFDA 1S6PA 4BWMA 4EP5A 1C1BA 1BCOA 4FK0A 4KHWA 4QOZB 3VQEA 1HQUA 4NYNA 4Z4FA 1I3AA 2PZSA 2EX3A 4Y1CA 1RDDA 3T19A 3HM9A 4FLTA 4DSLA 3AVBA 2HB5A 3LWMA 1T7PA 3AA3A 4M3UA 3V9XA 4W5QA 3D0PA 4CE9A 3PO5A 4EP4A 3HVRA 2Y1IA 4B9NA 4CJ3A 2HHTA 3RMAA 1K6YA 4LSNA 1WN7A 3ULDA 1KCFA 4FJGA 4OVLA 1RT4A 3MEGA 1KVAA 4CEBA 4HCBA 1JXEA 1EXQA 1NK8A 4L8RB 3HO1A 3ASMA 3DLEA 4M3YA 1HMVA 4CEZA 4CFBA 4OKKA 1ZBLA 2B6AA 1T8EA 4LSLA 4KAZA 4O0IA 4OJRA 1S5JA 4Z4HA 1RCHA 1UA0A 4B9SA 3B6OA 3L2UA 4OGEA 3NGZA 4KHSA 4DLGA 1JKHA 1KLMA 3V6DA 3WNGA 3I8DA 4FZYA 3KK2A 4NCAA 2YNGA 4B9MA 1YT3A 3HJFA 3ZT4A 1F21A 4C8OA 3RRHA 3DLBA 2YKMA 3AO3A 4DF8A 4R5PA 2O4GA 3K5LA 3K58A 4FJJA 4KI4A 2B4JA 3VQBA 3NCIA 1U47A 4PWDA 3C6TA 4LY7A 4E7IA 4FJ5A 4IKFA 4DMNA 3QIOA 3ZT0A 3ZSXA 4FJIA 1I39A 2X74A 1DTTA 1A5VA 3LDSA 1VSJA 2XY8A 4KTWA 3HP6A 3S9HA 4LH4A 4QAGA 4AHSA 2P5GA 4CFCA 4DTOA 3QNNA 2XY6A 4DTRA 5J2PA 4OLAA 5FROA 4W5NA 4PUOA 1WAJA 3C94A 4FZZA 1HYZA 4W5TA 3KKRA 2HMIA 3ALYA 1C1AA 4LH5A 5KTQA 2KZZA 4FW1A 3VQ8A 1J54A 1TKZA 4JRQA 4DTMA 1SUQA 4ELUA 2HVHA 3OJUA 1SKRA 1NK4A 4M3ZA 4CHPA 2E4LA 4ICLA 4IFYA 1ZYQA 1JLCA 5HRRA 1ASVA 3AVIA 3QNOA 2QKKA 1NK9A 2P5OA 4CIFA 2HNYA 1JL1A 2R7YA 4DTXA 3SQ4A 1DLOA 3O4NA 2YHBA 4FJLA 4NCBA 1TL1A 3OYCA 4LD0A 4E7LA 3KD1E 4FK2A 1JLEA 4IG3A 3NGIA 1SL2A 2D5RA 4W5OA 3BGRA 1XC9A 2DY4A 3VQ5A 1JLBA 2XO7A 1S1WA 3QETA 3SNNA 4PA1A 3AVKA 1QTMA 2FBVA 3DLRA 4FLWA 2HVIA 4CJWA 1RTHA 3FFIA 1ASWA 1XHXA 5KGWA 1LAVA 4M41A 1TAUA 4E1NA 3OVNA 4CGGA 3SV3A 3K2PA 4C8MA 4I9LA 3CQ8A 1L3UA 4B9TA 3CFPA 3AVHA 4C8KA 1HJRA 3KTQA 3V9UA 4FYDA 1Q8IA 1LW2A 1WSIA 4Z4CA 3P5JA 5CZ2A 4ZTFA 4N5SA 2G8HA 4CF9A 2G8KA 3CFRA 4J2BA 3HPHA 1NOYA 2YNIA 1RBUA 1TVRA 3G10A 3OYNA 4B8AB 1NK5A 5KRTA 1UA1A 3KLHA 1KVBA 3QLHA 4ELVA 4CJSA 4E7JA 4I7FA 3KIOA 4M3RA 4FJKA 2I5JA 3RRGA 1EKEA 4M3WA 3RR8A 1VSLA 2IGIA 4KKOA 1JLFA 2YNFA 3MEEA 2Q3SA 3VA3A 4CJRA 4ZHRA 5HRSA 1NK0A 3LP1A 4CGJA 4BE0A 1NKBA 3IAYA 2HHQA 4E19A 4PY5A 1RTIA 2VG6A 3K5NA 3DLGA 4HUFA 2XHBA 1HQEA 4QCLA 2GBZA 3K59A 3M8SA 1NJXA 3SUOA 4CJKA 1J53A 5J2QA 4CHOA 1L3VA 4B3OA 2FBTA 2JGUA 4Z4GA 1A5XA 5HROA 2YV0X 3QESA 5D3GA 1WSEA 3CM5A 4OKJA 4E3SA 4KPYA 4E7KA 1N6QA 1RT6A 4CJQA 1U49A 2QKBA 1RT5A 2HNDA 4CHZA 3LPTA 4CJVA 4DTSA 4Z4EA 4N56A 3RR7A 1TV6A 1KTQA 3NF6A 4FVMA 1L3SA 3QEPA 3S3MA 2E6MA 1TKDA 4N76A 3KLIA 1LWEA 3NHGA 1SL1A 1D8YA 3RTVA 2WONA 1GOAA 3E01A 4KFBA 4HHTA 3TAEA 2KFNA 1U48A 4F3TA 4DG1A 3L3UA 4KV8A 2IDOA 3BDPA 1NJYA 3DLHA 4DTJA 4DFMA 1KSPA 1J5OA 1VSHA 1RNHA 1CXQA 1L3TA 1JLQA 4O44A 1Q9YA 3K5OA 1LV5A 4DSIA 4B9VA 1JLGA 2GV9A 3SV4A 2YNHA 2HHXA 1JXBA 2OPQA 2X78A 1B92A 3JSMA 1HYSA 3SQ1A 1VK0A 4H4MA 3ZT3A 3U3YA 4HVJA 5J1EA 4KHUA 4FK4A 3L2RA 1SL0A 1HNIA 4FJ7A 3DYAA 1XHZA 3TAQA 1QSYA 4BDPA 4DQIA 3L2QA 2Z1IA 3IG1A 3THVA 1HRHA 4CEAA 4RW8A 3TARA 2Y1JA 1KRPA 4DS5A 3LP0A 5EU7A 2KTQA 1IKVA 3VQQA 4KRFA 1HPZA 4XIUA 3VQ7A 1W0HA 1LAWA 3O3HA 2F96A 4CEOA 4CF8A 2OPRA 2ETJA 3F73A 4M3XA 3HPGA 3KLGA 2DTUA 3L2VA 2NUBA 5C24A 4W5RA 4FLYA 3RMBA 1MU2A 1FKOA 4CIEA 4TSXA 3TWHA 3OJSA 3I0RA 1YTUA 2PYLA 1ITGA 5SZTA 1D9DA 5CYMA 1S1VA 3KK1A 1RT1A 3AVCA 1TGOA 3HSTB 3ISNC 4CJPA 3SUQA 3S3OA 1G15A 2OZMA 3C95A 5I42A 4KTZA 3V9ZA 2G8UA 4B08A 1S1TA 2HHUA 3QEWA 5JS1A 1IKWA 3DRPA 4DQQA 4ID5A 4FJ9A 1RBTA 4O55A 3VQDA 4PQUA 2DFHA 4FXDA 1BI4A 4FJNA 3V81A 4KREA 3M8PA 3PY8A 3T3FA 3TABA 1TK8A 4CECA 4CEQA 2BDPA 3EY1A 1X9SA 4J2EA 4GMJB 3ZT1A 4CEDA 3V4IA 1LWCA 4RW6A 5JS2A 4CFDA 4B8CA 1RTJA 2VG5A 1U04A 4CGHA 2Z1GA 5DMRA 4E7HA 1ASUA 4M42A 3DRSA 1CZBA 3AA5X 4CJUA 1NJWA 2A1SA 1Y97A 5HBMA 5HLFA 3OYFA 4CF0A 1WSJA 4BDZA 3UIQA 4DFPA 1BISA 2RN2A 1FXXA 1S1XA 3ZT2A 5HRPA 4OLBA 3LWLA 2D0CA 5KGXA 1D5AA 3HYFA 1VSMA 4OKEA 3KJVA 4RW9A 3NE6A 1ZBIA 3NFAA 4KO0A 4KB0A 3PX4A 4O5BA 3OYMA 3O3FA 3HP9A 2IC3A 4BWJA 5C42A 4DSEA 3VN5A 1C6VA 1RT2A 3CFOA 4F2SA 1WSHA 1RDCA 3TAGA 4YFUA 1X9WA 1VSIA 3H08A 5DK5A 1Z25A 1YTAA 3ZSOA 3OS1A 3KD5E 1NK6A 4CJFA 2ATQA 2JLEA 2ZE2A 3AVLA 4BE1A 3ZSRA 3AVAA 3NF9A 4HTUA 1IKXA 1XWLA 3QO9A 4CHQA 3PV8A 3L8BA 3HT3A 4DSKA 5CYQA 5FRMA 2AJQA 3RMCA 1LW0A 4J2AA 2OA8A 5KI6A 4FCYA 3RMDA 3HK2A 1Z26A 3ITHA 1YVUA 4AHTA 1BIUA 1VSKA 3P1GA 5T7BA 4K8XA 1DTQA 1TK5A 2OYQA 3SZ2A 1QSLA 2WOMA 1S6QA 3DI6A 1W9HA 1KVCA 1ZBFA 4NYFA 4ZTJA 1IH7A 4DF4A 4DFKA 2RKIA 3SPYA 4MQ3A 3K5MA 2BANA 2HNZA 2P1JA 3M8QA 4DU1A 1LWFA 1KFSA 4Q0BA 3LALA 4N41A 3HPOA 3M8RA 3V9SA 1RDAA 3O4QA 4CJTA 4CHYA 5HRNA 3MAQA 3SI6A 3ZSVA 4DWIA 3OYKA 3LPUA 2VWKA 3PUFA 2RF2A 3O3GA 4FLXA 4CIGA 1CLQA 4FJXA 3LZIA 4JRPA 2G8IA 3C6UA 2KQ2A 3A2FA 3LAKA 4AHUA 3OYBA 1BHLA 1C1CA 2IAJA 1U45A 2BGGA 4KHYA 2XY5A 1TK0A 2B5JA 4G1QA 1TAQA 3K57A 4DSFA 3AV9A 1VSFA 1TKTA 5FRNA 3LP3A 1WSFA 4H4OA 4O0JA 4AH9A 3VQ9A 4CEFA 4FJMA 1GOBA
chains in the Genus database with same CATH superfamily
2P51A 3SQ0A 3FE1A 3AO5A 1GLDG 4MO5A 3M5RA 2WUSA 3ZSYA 1VHXA 3WT0A 3QEVA 1Y64A 3THXA 4KHNA 1QE1A 2D0BA 3R8EA 2D4WA 3UKRB 3QEIA 1U4BA 3NDKA 2XRIA 3D2EA 4F8RA 1BI4B 3QINA 4FM2A 1DT9A 2DFEA 3TI0A 2NZTA 4N47A 2KW4A 2G8FA 4C23A 3AVJA 3ENHA 4JS5A 2O4IA 3KLFA 3SUNA 1FJGK 3CCMN 4CCHA 4A59A 2IOCA 4F3OA 4JYAK 3HTVA 2YHWA 1OH6A 3TAFA 1VQKN 3TAPA 1ZBHA 2A1RA 4E0DA 3PIOL 1D9FA 4JN4A 1BCMA 3TR8A 1K73O 5FPNA 3VF6A 3VQPA 4FWOA 1T03A 3EL2A 3PX6A 4BDYA 4JKGB 2YHYA 4I6MA 2QK9A 1NJIO 4CZIA 1C0MA 1SKSA 5BN9A 3CCQN 2RPIA 3A5LC 3LDQA 1VRUA 2HHHK 4JKEA 2F8TA 2UUCK 4U7BA 1QHTA 3BP8A 3QFPA 1VQLN 4EZ9A 1FKPA 4DS4A 1NGFA 3IDHA 3WEEA 4JS4A 4LF4K 4KB1A 4BC4A 3CG7A 2E6LA 3NGYA 3VTHA 3DJCA 3F9KA 3ZSZA 2P9IA 2HW3A 3ZSWA 5J2NA 1S9EA 1FK9A 2ZQBA 4IEEA 2BE2A 4KTQA 3J7AP 1WLJA 1BGXT 3LL3A 3I33A 1VRTA 1MDUB 4OPKA 3EYZA 1TYQA 3A0IX 3DOKA 4IFVA 1B9FA 4IOAL 2F9TA 2X6SA 5TKWA 3OYHA 5GAHP 1IO2A 3HL8A 4K25A 4J2DA 2XY7A 2PYJA 2FBYA 3CIPA 1VQ5N 4DSJA 1RBSA 1WAFA 4RW7A 5AZIB 1U6ZA 1BDGA 3SUPA 2Z1HA 3MXMA 1M90O 2HHVA 3OYLA 1RGIA 2GUIA 3TANA 4W5NA 3AA2A 3LAMA 1IKYA 4DR7K 3D6RA 3CCJN 2PZSA 2EX3A 5FPMA 3HM9A 4FLTA 3AVBA 3H46O 4B3RK 4W5QA 4B9NA 3RMAA 1KVAA 4M3YA 4DHYA 1T8EA 1OVQA 4IZ9A 3B6OA 4H0YB 3G71N 3E9OA 4KHSA 1JKHA 3V6DA 1HX1A 3H1QA 1YJWN 2V7YA 3KK2A 2YNGA 1W2BM 3SAGA 3HJFA 2P9KB 2OANA 4R5PA 5LY3A 1OVYA 5AQZA 1U47A 4E7IA 3ZSXA 1I39A 2X74A 1DTTA 4XH5A 3CXCM 3LDSA 4L3QA 3HP6A 4DTOA 2XY6A 4B1VA 4FZZA 3KKRA 3ALYA 1IG8A 2KZZA 5LJVA 3HBTA 4MO4A 1J54A 4DTMA 4WFBL 3UKRA 3OJUA 1NK4A 2AA4A 4IFYA 4BG8A 3A5NC 3O4NA 1TL1A 4FK2A 1JLEA 5AQFA 2YI1A 1XC9A 2DY4A 4DV3K 3SNNA 4BR4A 2NRWA 4FLWA 2HVIA 1RTHA 3FFIA 3F9MA 4M41A 2ZF5O 3OW2M 5M1PA 3ZX2A 5AQLA 4CZLA 4BREA 3CQ8A 4K41A 3AVHA 4LF9K 3LDNA 4Z4CA 4N5SA 2G8HA 3FZKA 4CF9A 2O8DB 3HPHA 1NOYA 2YNIA 1RBUA 3G10A 3KLHA 2P9NA 5LJWA 4CD3A 4I7FA 5EVZA 4FJKA 3MK6A 1EKEA 3QBWA 4KKOA 3MEEA 2Q3SA 2E8AA 3VA3A 2HHQA 1EWQA 1WBBA 3ATUA 1RTIA 3VOVA 2O8BA 3DLGA 1N33K 5AR0A 3M8SA 2E1YA 4B3OA 3O9QA 2FLOA 3VF2A 1YITN 1O13A 4CJQA 4CHZA 1ATSA 4CJVA 3P31A 2YJEA 1E4FT 4FVMA 3QEPA 4B3SK 3N4QA 3CQYA 3KLIA 3SLCA 1D8YA 4R79A 2KFNA 3O1WA 1U2VB 1U48A 2OCEA 4DG1A 4KV8A 4IJAA 3DLHA 4DTJA 3FZMA 4WQ4C 1S22A 1L3TA 1RNHA 4DSIA 1Q9YA 3K5OA 1LV5A 2NRTA 2W6KA 1GLFO 3SV4A 4YOVA 2HHXA 1XC3A 4H4MA 3JXUA 4YOWA 3SBTA 5J1EA 4KHUA 2QXLA 5KQDA 3J81O 1XMOK 1HNIA 4FJ7A 4FWPA 3DYAA 1JCGA 4DQIA 3L2QA 2Z1IA 3THVA 3KWGA 4RW8A 5AQNA 1KRPA 3CMEN 3LP0A 1IKVA 5AJ3K 4KRFA 1HPZA 3VQ7A 4JHDB 1LAWA 2F96A 4CF8A 4FSVA 3VTIA 4A5BA 2DTUA 3RMBA 3TWHA 2P9SA 1ITGA 5KPTA 3ZYYX 3MWPA 3AVCA 1Q86O 3ZX0A 3C95A 3FZFA 3QEWA 2ZGZA 4FJ9A 1RBTA 3M8PA 3O8MA 3TABA 1W7AA 1NGCA 4ILJA 4J2EA 4CEDA 3ZT1A 3CETA 4JK7A 3MX2A 1U04A 4CGHA 5DMRA 4O5FA 4JNEA 3AA5X 4CJUA 1VQ8N 2A1SA 5HLFA 4PL7A 3OYFA 4CF0A 4BDZA 2CH6A 2RN2A 1BUPA 4OKEA 1K8KA 3NE6A 1GLBG 3NFAA 4BQLA 4XEIA 2IIRA 3KK7A 3P38A 4H0TB 2IC3A 5C42A 1X9JA 4CZHA 1RT2A 5AQKA 5DK5A 3OS1A 3WUHA 1IBKK 3KD5E 4U67L 5CR4A 2ZE2A 3PV8A 4LFBK 4HTUA 4DSKA 3QO9A 3HT3A 3OBWA 3RMCA 1LW0A 1RDUA 1QZ5A 2OA8A 3TTFA 3RMDA 3HK2A 1Z26A 4H0XB 4YDUC 1DTQA 3DI6A 4DF4A 4DFKA 2Q97A 4GV6A 5AQQA 4IOCL 4MQ3A 3K5MA 2BANA 3SPYA 1LWFA 3ZEUB 4Q0BA 4N41A 3V9SA 3M1FA 3ZSVA 3OYKA 3LPUA 4FWKA 3L4IA 2E2PA 4CIGA 1N8RO 2D0OA 2G8IA 2KQ2A 4BG9A 4JKBA 1U45A 2E2QA 3E9LA 1TK0A 4G1QA 3DWLA 1VSFA 5FRNA 3VQ9A 2ITMA 3BY5A 2H3GX 2PAVA 4XH1A 4IBNA 4A2BA 3KLEA 3KKSA 4CESA 4LFAK 4CGFA 1REVA 1R59O 4DR1K 1G99A 5KQ8A 1Q9XA 3LANA 4DTUA 4CK1A 4B3TK 2VGNA 2YX6A 3EZWA 4FWSA 3U4LA 3QBXA 4A2AA 5GAGP 3EE8A 2ITGA 4WE1A 1D4XA 3AO2A 3TU5A 1BOTO 5K14A 2HSTA 3EN9A 3S3NA 3R1XA 3RWUA 1R0AA 2GX9A 5EX5A 3AVMA 4ID1A 3THYA 1QVGM 2VG7A 3QDKA 1EETA 2UXBK 4E89A 3D45A 1EX4A 1X3NA 2GUPA 3NF8A 1S9GA 3OS0A 4OPJA 4EHUA 1U2VA 1VQ7N 4MLEA 1J9AA 3AA4A 4A57A 2ZGYA 2YCHA 5KPRA 2YHAA 4I2QA 1NJZA 4KI6A 3CM6A 2VWJA 1HKGA 4FM0A 4DLEA 2LSNA 3MCAB 4C1NI 3VA0A 3T1AA 4CJ7A 2Z1JA 2HMPA 2P9UB 4UQGA 3VQAA 1NMNA 1RTDA 1X1PA 1T6DA 4GKKK 1ATNA 1XUPO 5ADXH 4B1XB 3ENOA 3IUCA 3OY9A 4BE2A 2AP1A 4GV3A 3LM9A 1UOCA 3IRXA 1L5UA 2IVPA 5BN8A 1OH5A 2ZD1A 5SWMA 2PY5A 3NMUA 1BIZA 4BRPA 4NCGA 5AQMA 5AQXA 2O8CA 1X3MA 4CEEA 4AHRA 4AHVA 4OGCA 3FZHA 4BRNA 2E2OA 3GE1A 4I2PA 4ISGA 1GLEG 3VQCA 3SJJA 1VQ6N 3UB5A 4H0OA 3DRRA 1TL3A 4IG0A 4AM6A 1YJNN 5AQJA 3EZ5A 4FLUA 1GOCA 1YXQA 4DTPA 5M1KA 4DTNA 2NRXA 5GAEP 3RSEB 3QEXA 4DU4A 5CZ1A 3OYJA 4MDAA 3OYGA 1WSGA 1CXUA 3E1YA 4BRAA 3PSFA 4DV0K 1RBVA 4HWIA 2QM1A 4C8NA 1C0UA 4FW2A 3CJ1A 4AILC 1NK7A 1A5WA 3AVNA 1TKXA 4HUEA 1S72N 4H5RA 4JD2B 2A42A 1RILA 2HHSA 3DMJA 3HVTA 1BL3A 3MXJA 1BQMA 3PO4A 4FZXC 1QVFM 4FOEA 1KFDA 4IJNA 4KHWA 4QOZB 4NYNA 4Z4FA 1IBMK 1RDDA 2GELA 3VERA 2HB5A 4M3UA 3AA3A 1ZXOA 5FPEA 5C10A 4CE9A 3PO5A 2Y1IA 4CJ3A 2HHTA 1K6YA 4LSNA 1WN7A 3CERA 3ULDA 1EWRA 1JXEA 4L8RB 1HMVA 4CFBA 2B6AA 4LSLA 3I8BA 4KAZA 3ID8A 4BQZA 3ZEUA 1UA0A 3QICA 4OGEA 4NLBA 3I55N 1KLMA 4FO0A 3WNGA 3I8DA 2RHKA 1YT3A 3ZT4A 3SAHA 3AO3A 4DF8A 2O4GA 3K5LA 1SS6A 3O9TA 2B4JA 3VQBA 2O8FB 4IKFA 3EEQA 4IXCA 1QQOA 1YHQN 4KTWA 4LH4A 3QNNA 3SBGA 3C94A 4CW7B 1HYZA 4W5TA 3LDLA 3LDOA 4ELUA 3GG4A 5TKYA 2P9PA 4XH4A 5HRRA 3AVIA 3QNOA 3O08A 4DV5K 2R7YA 4FJLA 3OYCA 5A2QO 3KD1E 3UKUA 4JI8K 3VESA 3NGIA 1K8AO 3R6MA 4FWMA 5GADP 4V19S 1S1WA 3QETA 1QTMA 2FBVA 4BY9C 2VYPA 5KGWA 2HBKA 4BRGA 3OVNA 3T69A 3O6WA 5AFUH 3O9RA 2CGLA 4B9TA 2KLAA 3GBTA 4NO7A 4FYDA 1LW2A 1EQYA 4QS9A 4JKCA 5CZ2A 1BO5O 4J2BA 3LM2A 3T1HK 1IBLK 3OYNA 4B8AB 1UA1A 4K42A 2UUBK 3HI0A 3KIOA 4GKJK 4M3RA 3RR8A 4CJRA 1NK0A 3CC4N 3WXIA 3O9SA 4AF1A 4E19A 4WCEL 4FVUA 4HUFA 3J7ZO 3SUOA 5JICA 3CCLN 1KAYA 2Q0UA 3EKSA 4Z4GA 1A5XA 5HROA 3QESA 1LOTB 3CM5A 1VQ4N 4OKJA 4JI0K 4JI3K 4KPYA 5JMVA 3WQUA 1RT6A 1RT5A 2HNDA 5BREA 3AAQA 3LPTA 4Z4EA 1DEJA 4N56A 3CHWA 1TV6A 3NF6A 5C2FA 1QZ6A 4N76A 3KHYA 4KFBA 4CI6A 2QWQA 3O4WA 3L3UA 4RCHA 2NNWA 1NGGA 1J5OA 1JLQA 2QEXN 4B9VA 2GV9A 3GDQA 3JSMA 5FLXO 2OTLN 3FLCO 3SQ1A 4KHPK 5F0XA 3KZBA 3TTCA 3CI5A 2V7ZA 4BGBA 4FK4A 1SL0A 2QWRA 2I7PA 3TAQA 4BDPA 3O5BA 3HZ6A 3IG1A 1HRHA 4JKDA 3TARA 1E4GT 2NRRA 2Y1JA 2KTQA 3VQQA 4XIUA 4GVEA 3WXLA 1RDWX 2OPRA 3CF5L 1TUYA 4YOTA 1YIJN 1MU2A 3TTDA 1Z05A 4Z94A 3C65A 3I0RA 4YORA 3CJAA 4QS8A 3UE5A 1D9DA 5CYMA 3Q7CA 2OZMA 1TGOA 3ISNC 3SUQA 1G15A 3G6EN 5AZJB 2HHUA 4B08A 2VQFK 1IKWA 3AY9A 4ID5A 4O55A 2VWBA 3VQDA 2DFHA 1BI4A 1GLJO 4KREA 3K9KA 3PY8A 3J8AA 2KKZA 3EY1A 1X9SA 2OTJN 4FPBA 5JS2A 3BF1A 4E7HA 3GOIA 3CD6N 1ASUA 1ESVA 4H5VA 3SMSA 4M42A 3DRSA 1CZBA 4MDBA 1NJWA 5HBMA 5JVGL 5BRHA 5BPLA 1WSJA 3UIQA 1HKCA 4DFPA 1BISA 4WF9L 3FFKB 5HRPA 2QWNA 4DR3K 4BROA 5KGXA 3L4QA 1KD1O 3HYFA 3ZLJA 1HPMA 1ZBIA 4KO0A 4KB0A 3PX4A 3BEXA 3OYMA 2FSNA 4JKGA 4BWJA 4DSEA 2D0PA 3VN5A 1WSHA 1RDCA 3TAGA 4YFUA 3ZSOA 3H08A 1Z25A 3SMPA 1DKGD 1NGEA 1NK6A 4DV2K 3ZSRA 1XWLA 3L8BA 2AJQA 4BVOA 4J2AA 5KI6A 2BTFA 1BIUA 3ULEB 1VSKA 3P1GA 5T7BA 1S6QA 1ZBFA 4NYFA 1N36K 2A40A 3M8QA 4BC2A 2F4VK 3M8RA 2ZJPL 1RDAA 4CJTA 5HRNA 3SI6A 4JI4K 5M1NA 2FSKA 3C6HA 2WC9A 4FJXA 3W3DA 4JI1K 4JRPA 5DM7L 3C6UA 3CQXA 3VF4A 2IAJA 4B9QA 2UYTA 2O8EB 4H03B 3MN9A 4DSFA 1TKTA 3LP3A 1WSFA 4NXMK 4C8KA 1HUXA 3CJBA 2HF4A 4JI7K 5FDLA 4C8LA 1TUUA 3WXJA 1RBRA 4ISFA 4Q5VA 3NAEA 3AO1A 1T05A 4CK2A 3MEDA 2WTUA 4PHTX 1BQNA 4K0KK 3AVFA 1NBWA 5E84A 2KZMA 3KWIA 4FLZA 4M45A 4KHQA 1B9DA 3ATVA 4Z4IA 4DR4K 5AZIA 1HNZK 2X6NA 1NGBA 5CY4A 4HUGA 3A8YA 3IFRA 3AARA 4BGAA 3G4SN 4FLVA 3VEXA 3I0SA 2E1ZA 3TPQA 3U6FA 4PKIA 1Z6RA 3F5TA 3AO4A 2E2NA 2FBXA 4CGDA 2OPPA 3R3LA 3WNHA 2ZJRL 3V9WA 3AVGA 3HSCA 1YVNA 2P9LB 4JLHA 4EAHD 4LC9B 4WQ4A 3NBPA 3FZLA 4Z0UA 4EFHA 4KH6A 5J2MA 2W42A 4Y1DA 2GTDA 1QSSA 1C0FA 1NGDA 3MECA 4HCCA 4QS7A 4B9UA 4KH4A 3CCSN 1I94K 3KVGA 3VEOA 3TAMA 1RDBA 1UAXA 5B8HA 3C6AA 3IKMA 1HNXK 1HJOA 3C0BA 4CJ4A 3VGMA 3CYMA 4CHNA 5HL7L 5CE3A 4FM1A 3NF7A 3NH0A 4WFNL 3W0LA 2P9KA 2IVNA 3EE9A 4LF5K 3SCXA 2HF3A 1IV0A 1SV5A 1YAGA 2D0AA 4I9QA 5AQTA 3DM2A 3DAWA 3SAFA 4B9LA 1JL2A 2OZSA 4CZGA 2KFZA 2QXFA 4YNQA 3AGKA 3OYDA 3KK3A 3QERA 5AZJA 1S1UA 3JYTA 2UU9K 3PLAA 3NH2A 3DXKB 3CC2N 1J5EK 2F7TA 4BRKA 1UWBA 4GW6A 5KRSA 4MFBA 4M63C 2GWKA 2QWLA 3CJ7A 3K9JA 1NGAA 2YHXA 3R9PA 3MXIA 3THXB 3HXMA 1BA0A 2G8WA 3D2EB 2PFUA 2CGKA 4Y0WA 4ELTA 4EZ6A 3G0ZA 1M1KO 4CJ5A 1T6CA 1NKEA 2G8VA 1OH8A 1VSDA 3P4IA 3V1RA 4WFAL 4DU3A 2DFFA 3SQ2A 3LP2A 3OYAA 4AHCA 4BE1A 2O8DA 4GY2B 5IWAK 5M1FA 3LZJA 4FPAA 3V1QA 1GLLO 1S6PA 1NU0A 4BWMA 1C1BA 4AM7A 1HQUA 1NWKA 5BRFA 1I3AA 4Y1CA 5AQGA 1Q18A 5GIOA 4DSLA 2A5XA 4WQ5A 3QMLA 1QQNA 3D0PA 4YDUA 4EP4A 3HVRA 4FJGA 4OVLA 1RT4A 4I6MB 3HO1A 3ASMA 3DLEA 1ZBLA 2Q31A 4O0IA 4OJRA 5LL6Z 4J8FA 4E1JA 3DXMB 4Z4HA 1N32K 2EWSA 4B9SA 3NGZA 4OPHA 1WB9A 5AQYA 2QTDA 1VAZA 4FZYA 3EO3A 1V4SA 1NGIA 3MN7A 3RRHA 3DLBA 4B1WB 4BRCA 5E26A 5EOYA 3K58A 4KI4A 3NCIA 4BR9A 4FJ5A 4DV7K 4DMNA 3QIOA 3OHRA 3WEEB 4FJIA 2ASOA 3S9HA 4QAGA 4AHSA 2P5GA 4JAXA 4JV5K 4OLAA 5FROA 2P9IB 1YJ9N 1C1AA 3VPZA 3VQ8A 4JRQA 1OH7A 3BZCA 1SUQA 4ICLA 1ZYQA 1JLCA 2F9WA 1ASVA 3FGUA 2QKKA 2P5OA 3SQ4A 1DLOA 3VEZA 1TYQB 4JHDA 3U9ZA 1BU6O 3BGRA 2XO7A 1JLBA 4JK8A 1J6ZA 4PA1A 3AVKA 1N34K 5H1SQ 3B8AX 4GNIA 1ASWA 1SAZA 2D1KA 1XHXA 4KBOA 2NRHA 3SV3A 4FWQA 2FSJA 4I9LA 1L3UA 3CFPA 3K0SA 1HJRA 3V9UA 1ILYA 3P5JA 2Q0RA 3CFRA 1TVRA 2QWPA 3D2FB 4M7XA 4ELVA 4E7JA 4BVPA 2I5JA 4WYBA 3RRGA 2E20A 4M3WA 2IGIA 4H0VB 2GWJA 2YNFA 1XQSC 5HRSA 3IAYA 1NKBA 4CGJA 4BE0A 3FR0A 5C0YA 2VG6A 3K5NA 3K59A 3CCUN 3Q7BA 4CJKA 5AQOA 5J2QA 1L3VA 2JGUA 2YV0X 5D3GA 1WSEA 2NRVA 2Q36A 5M1QA 4E7KA 1N6QA 2QKBA 1NGHA 1KC8O 1P8ZA 1LCUA 1Q7YO 3S3MA 2E6MA 5AQWA 1LWEA 2A3ZA 4IFEA 2WONA 1GOAA 3E01A 4HHTA 3I56N 4F3TA 2IDOA 3BDPA 1NJYA 3DXKA 1OKJA 4BRLA 4DFMA 1NG9A 1CXQA 4ISEA 2ASPA 2YNHA 1JXBA 2OPQA 1HYSA 1ATRA 3A5OC 1VK0A 1WBDA 3ZX3A 3SJHA 3L2RA 1XHZA 1QSYA 5CHIA 4X62K 4IEIA 1QQMA 3E66A 1KQSM 4DS5A 3OBYA 5F2RA 2QW9A 4BRDA 4B1YB 4CEOA 4OO1J 2ETJA 4M3XA 4X66K 3CJCA 3HPGA 3AGRA 3KLGA 3C7NB 3VEWA 4MLHA 3HOSA 3CCEN 4G9ZA 4CIEA 4TSXA 1YTUA 3VENA 1ZC6A 3HM8A 3J80O 1BWFO 4KTZA 5JS1A 2I7NA 4B1ZA 4DQQA 4FXDA 4FJNA 4JK9A 4CBXA 3N4PA 5BR8K 4CEQA 4H5WA 4LF8K 4GMJB 5LMNK 4NXNK 2P9NB 3THWB 4B8CA 3HOTA 3DXMA 3BUZB 2HOEA 4JI5K 1Y97A 3L0QA 2O8BB 1FXXA 1S1XA 3LDPA 3ZT2A 3NVMA 3MMVA 2W41A 4OLBA 3LWLA 2D0CA 1D5AA 4DUZK 1VSMA 3KJVA 4O5BA 3L6QA 3HP9A 2A6AA 2UUAK 4DV4K 4H5TA 1VQNN 3O9UA 4YY3K 1C6VA 1H1VA 4F2SA 4DR5K 1VSIA 1KAZA 1YTAA 1W97L 2ATQA 2JLEA 3AVLA 4QCLA 4DUYK 1IKXA 4CHQA 4NB4A 4C1NK 2P9UA 3E9PA 1KAXA 4BR2A 2KHOA 5IT9O 5I9EB 4FCYA 3ITHA 4IOXA 3VMFB 2OYQA 3SZ2A 1NNEA 1QSLA 1IH7A 3TSQA 2HNZA 2P1JA 3LALA 2A41A 3HPOA 3O4QA 3MAQA 3DLLL 3BF3A 1NMDA 1S3XA 2VWKA 2RF2A 3O3GA 4FLXA 3MN5A 3LZIA 4BC5A 3QFUA 3A2FA 3LAKA 3OYBA 1BHLA 1C1CA 2IVOA 2BGGA 2B5JA 3K57A 3GL1A 3U8XA 2F8SA 4H4OA 4O0JA 4AQYK 4HVJA 1T44A 4DQPA 1XI1A 2P9SB 3D2FA 1HYVA 3RSEA 1GLCG 2YKNA 4A62A 1IG9A 5HP1A 1RT3A 2QI2A 4CK3A 4IDKA 3NH1A 4B3MK 4F2RA 4JI6K 1QS4A 1SKWA 2IS3A 4NLCA 3TSPA 1O1WA 4HTLA 3O1BA 4CF1A 4JD2A 1WNSA 4CFAA 4K8ZA 2V51B 4BR7A 1DGKN 3VQ4A 5JLHA 3ENBA 3MCPA 1NKCA 3U3GA 2VQEK 3ZSQA 1VSEA 2CGJA 1NLVA 1HNVA 3U9DA 3MN6A 1N5YA 4GVMA 3T7ZA 3SPZA 3ID6A 3D7EO 1K8KB 4CERA 4UY8O 3A5MC 1WOQA 4CGIA 5HOOA 3DOLA 1HLUA 3OYIA 1CZ9A 3OTOK 3WNFA 4E1MA 4IWVA 5F1XA 4CJLA 4DFJA 3WNEA 5I3UA 3VQ6A 5BRDA 4BACA 1HNWK 2GEMA 1VQON 4YOYA 2OPSA 2O8FA 3CMAN 3OYEA 4RW4A 3OS2A 4FJ8A 1EO1A 4JKHA 4CF2A 1E3MA 3C7NA 5BPMA 3VGLA 2EHGA 4X65K 5E41A 3L2WA 2W6LA 5BPNA 1JCEA 1RT7A 4FWNA 3PX0A 1GLAG 3B6PA 1JLAA 4FJHA 4PL8A 4M3TA 1VQ9N 2ASMA 2FC0A 4CBUA 3CC7N 3V1OA 3IS9A 1C0TA 3PSIA 1EP4A 3L3VA 2BUPA 4F4KA 4JKAA 1KLNA 3H3OB 5KPZA 4CVNE 1X9MA 2FF6A 3HRGA 3THWA 3DLKA 4DQRA 2HBJA 3AAPA 5AQIA 1NOZA 5EY4A 4GV9A 2RE2A 1VQMN 2JWLA 4IO8A 3P83D 2ZJQL 1ZBUA 4BR0A 1QQCA 3RVCA 2HHWA 3SYZA 2NRZA 5AQUA 4DQSA 4DQ8A 1YI2N 5GINA 3CPWM 2QWMA 3ZCMA 2QWOA 2HBMA 3THYB 4O4GA 4RG8A 4CJEA 4LF6K 3QIPA 4H8KA 2JWKA 5C25A 1BA1A 4EP5A 4OPAA 1BCOA 4FK0A 2E5LK 3VQEA 4JI2K 2BH1A 4BRFA 2W40A 3T19A 3PIPL 2J4RA 1T7PA 3LWMA 1CZAN 3V9XA 3VEYA 5GIPA 1KCFA 3MEGA 4RTFD 4CEBA 1JJ2M 4HCBA 1MWKA 1EXQA 1NK8A 4CEZA 4OKKA 2ZM6K 1YUWA 1S5JA 1RCHA 5ADXA 4YOUA 3L2UA 3BZKA 4IO9L 4BC3A 3MX5A 4DLGA 4NCAA 4B9MA 1F21A 1RFQA 2V52B 4CZFA 4C8OA 4CZMA 2YKMA 4DR2K 4CZKA 4FJJA 4PWDA 3C6TA 4LY7A 4BRMA 3ZT0A 1A5VA 1VSJA 2XY8A 4YHHK 4BR5A 4CFCA 3CCVN 4DTRA 5J2PA 4PUOA 1WAJA 2HMIA 3ZETB 4LH5A 5KTQA 3WXMB 4FW1A 2O8CB 1TKZA 2HVHA 1WUAA 1SKRA 4M3ZA 1XNRK 1T3VA 2HBLA 2E4LA 4CHPA 1NK9A 4CIFA 4OX9K 2HNYA 1JL1A 4NCBA 4DTXA 2YHBA 4LD0A 4E7LA 4H0PA 2WBNA 5EXWA 4IG3A 3TSUA 4RWTA 1SL2A 3O80A 1K9MO 2D5RA 1ZBSA 4W5OA 2E88A 3VQ5A 5AQPA 2Q2RA 1Q81O 1MA9B 3OA9A 3DLRA 1VQPN 4CJWA 1TAUA 1LAVA 4H5NA 4E1NA 3S41A 4CGGA 3K2PA 4C8MA 4YOXA 1NM1A 5MLCQ 3KTQA 1Q8IA 1WSIA 4ZTFA 2CH5A 3MDQA 2G8KA 3IMXA 4K43A 3P39A 2UXDK 1NK5A 5KRTA 1KVBA 3QLHA 4CJSA 1YF5L 4KH5A 1VSLA 4PKHA 1JLFA 4ZHRA 5BR9A 3LP1A 1JCFA 1IJJA 4PY5A 4WQ5C 4BRQA 2XHBA 1HQEA 2GBZA 5C15A 5LMUK 1NJXA 4CZEA 1J53A 4CHOA 2FBTA 2NLXA 4E3SA 5ELZA 1NGJA 4CBWA 4DR6K 1U49A 4DTSA 4A61A 3RR7A 1KTQA 1L3SA 4F9OA 1TKDA 3NHGA 1SL1A 3QB0A 3RTVA 5FPDA 5M1OA 3TAEA 2Q1NA 4DV6K 1HR0K 2WFBA 1KSPA 2VGMA 1VSHA 3CJ9A 3ULEA 4O44A 1JLGA 2X78A 1B92A 4FL9A 4LF7K 4LFCK 2QA4N 3F2KA 3ZT3A 3U3YA 4M7YA 1P90A 3VEVA 2P9PB 5JVHL 4CEAA 5AQSA 5EU7A 3CCRN 2O8EA 5DM6L 1W0HA 3UKUB 3O3HA 3F73A 1FW6A 4PKGA 5AFUA 3L2VA 2NUBA 5C24A 5C2DA 4W5RA 4FLYA 1FKOA 3OJSA 4ILHA 2PYLA 5SZTA 1S1VA 4FWLA 3KK1A 3JS6A 1RT1A 3HSTB 4FOIA 4CJPA 3S3OA 5I42A 3V9ZA 2G8UA 1S1TA 3VGKA 3DRPA 4PQUA 3V81A 4CD1A 3T3FA 1TK8A 1MWMA 4CECA 2BDPA 3J7YP 1XMQK 5JLFA 3M6GA 3V4IA 1LWCA 4RW6A 3H6EA 4IDHA 4CFDA 4JEPA 1RTJA 2VG5A 2Z1GA 5AQRA 3JAMO 4CZJA 3CPEA 1BG3A 4O8UA 2FXUA 3H45C 2P9LA 3G25A 4RW9A 3M3ZA 3T1YK 1XNQK 4ILGB 3O3FA 3NVKA 1SZ2A 1C0GA 4X64K 3CFOA 2VCPA 1X9WA 3WQTA 4B1UB 3ZETA 4CJFA 4EHTA 3VETA 1HKBA 4DV1K 3AVAA 3NF9A 4O8KA 1V4TA 4EIAA 5FRMA 5CYQA 4DCHA 1YVUA 4AHTA 4FWRA 4K8XA 1TK5A 2WOMA 3SK3A 4A5AA 5C12A 1W9HA 1KVCA 4ZTJA 2PBDA 2RKIA 3WXKA 1SQKA 2DPNA 4DU1A 1KFSA 1Q82O 1KXPA 4CHYA 5AQHA 2ZWHA 5AQVA 4DWIA 3PUFA 1CLQA 2UXCK 2YJFA 3MWTA 4JKFA 3H3NO 4DKWA 4AHUA 2FF3B 1QHAA 4KHYA 2XY5A 1TAQA 3EKUA 3H1VX 3AV9A 4DB3A 4AH9A 4CEFA 4FJMA 4BRIA 4BRHA 1GOBA
chains in the Genus database with same CATH topology
5FDLA 2P51A 3SQ0A 4C8LA 3AO5A 1XI1A 4DQPA 1RBRA 4IBNA 4Q5VA 3KLEA 3NAEA 3AO1A 1HYVA 1T05A 4CK2A 3MEDA 3KKSA 4CESA 3ZSYA 4CGFA 1REVA 2YKNA 1IG9A 1BQNA 3QEVA 1Q9XA 5HP1A 1RT3A 3LANA 4DTUA 3AVFA 4KHNA 1QE1A 2D0BA 4CK1A 4CK3A 2KZMA 3QEIA 4IDKA 3NH1A 1U4BA 3NDKA 2XRIA 4F2RA 4F8RA 4FLZA 1BI4B 1QS4A 3QINA 1SKWA 4M45A 4FM2A 2IS3A 4KHQA 2ITGA 1B9DA 4WE1A 4Z4IA 3AO2A 1O1WA 2X6NA 4CF1A 2DFEA 4CFAA 1WNSA 5CY4A 4HUGA 3TI0A 5K14A 4K8ZA 4N47A 2KW4A 3S3NA 3VQ4A 4FLVA 2G8FA 3AVJA 1R0AA 3RWUA 4JS5A 1NKCA 2O4IA 3KLFA 3SUNA 3AVMA 4ID1A 3U3GA 2VG7A 4CCHA 3I0SA 2IOCA 3ZSQA 4F3OA 3U6FA 1VSEA 3TAFA 1ZBHA 1EETA 3AO4A 3TAPA 2A1RA 2FBXA 4E89A 4CGDA 2OPPA 1HNVA 3D45A 3WNHA 1D9FA 4E0DA 3V9WA 1N5YA 3AVGA 1BCMA 1EX4A 3NF8A 4GVMA 4JLHA 3SPZA 1S9GA 3TR8A 3OS0A 4OPJA 3NBPA 3VQPA 4CERA 4Z0UA 1J9AA 3AA4A 1T03A 5J2MA 2W42A 4Y1DA 3PX6A 4CGIA 4BDYA 1QSSA 3DOLA 3MECA 2YHAA 4I2QA 1NJZA 4KI6A 3CM6A 4HCCA 2VWJA 3OYIA 1CZ9A 2QK9A 4FM0A 4DLEA 1C0MA 4B9UA 1SKSA 2LSNA 3WNFA 3TAMA 4E1MA 1RDBA 1UAXA 2RPIA 3T1AA 3VA0A 1VRUA 2Z1JA 4CJLA 4DFJA 3WNEA 4CJ4A 3CYMA 4CHNA 2F8TA 4UQGA 5I3UA 3VQAA 4FM1A 3VQ6A 3NF7A 3NH0A 1RTDA 1QHTA 1X1PA 4BACA 4EZ9A 3SCXA 1FKPA 1SV5A 2D0AA 2OPSA 4DS4A 3OY9A 4I9QA 4BE2A 2F8SA 3OYEA 4RW4A 3DM2A 3OS2A 4FJ8A 4CF2A 1UOCA 4JS4A 3IRXA 4B9LA 1L5UA 4KB1A 1JL2A 2EHGA 5E41A 3CG7A 2E6LA 2ZD1A 3NGYA 5SWMA 1RT7A 3L2WA 2PY5A 2OZSA 3PX0A 2KFZA 1BIZA 2QXFA 3B6PA 3F9KA 3ZSZA 4YNQA 2HW3A 4NCGA 1JLAA 3OYDA 4FJHA 3KK3A 4M3TA 3QERA 3ZSWA 1S1UA 3JYTA 4CEEA 2FC0A 4AHRA 4AHVA 5J2NA 4OGCA 1S9EA 3NH2A 1FK9A 2ZQBA 3V1OA 4I2PA 3IS9A 2BE2A 1UWBA 1C0TA 4GW6A 4KTQA 3VQCA 3SJJA 5KRSA 1EP4A 1WLJA 3DRRA 1BGXT 1TL3A 3L3VA 4F4KA 1VRTA 4IG0A 1KLNA 3EZ5A 4FLUA 4MFBA 1GOCA 4OPKA 3EYZA 4DTPA 4DTNA 3DOKA 1X9MA 4IFVA 3QEXA 1B9FA 3DLKA 4DQRA 4DU4A 5CZ1A 2X6SA 3OYJA 3OYGA 3OYHA 3MXIA 1NOZA 3HXMA 1IO2A 3HL8A 1WSGA 4J2DA 1CXUA 2XY7A 2PYJA 2FBYA 2G8WA 1RBVA 4C8NA 3P83D 1C0UA 4ELTA 4FW2A 4DSJA 4EZ6A 1RBSA 3G0ZA 1ZBUA 4AILC 1WAFA 4RW7A 1A5WA 3AVNA 1TKXA 4CJ5A 4HUEA 1NK7A 1NKEA 1QQCA 2HHWA 3SYZA 3SUPA 1RILA 4DQSA 1VSDA 2Z1HA 3DMJA 1BL3A 3HVTA 2G8VA 2HHSA 3V1RA 3MXMA 4DU3A 3MXJA 2DFFA 2HHVA 3OYLA 3ZCMA 3SQ2A 1BQMA 3LP2A 2GUIA 3TANA 3PO4A 4FZXC 3AA2A 4O4GA 4RG8A 4AHCA 4CJEA 3OYAA 3LAMA 3QIPA 4H8KA 3LZJA 1IKYA 5C25A 3V1QA 1KFDA 1S6PA 4BWMA 4EP5A 1C1BA 1BCOA 4FK0A 4KHWA 4QOZB 3VQEA 1HQUA 4NYNA 4Z4FA 1I3AA 2PZSA 2EX3A 4Y1CA 1RDDA 3T19A 3HM9A 4FLTA 4DSLA 3AVBA 2HB5A 3LWMA 1T7PA 3AA3A 4M3UA 3V9XA 4W5QA 3D0PA 4CE9A 3PO5A 4EP4A 3HVRA 2Y1IA 4B9NA 4CJ3A 2HHTA 3RMAA 1K6YA 4LSNA 1WN7A 3ULDA 1KCFA 4FJGA 4OVLA 1RT4A 3MEGA 1KVAA 4CEBA 4HCBA 1JXEA 1EXQA 1NK8A 4L8RB 3HO1A 3ASMA 3DLEA 4M3YA 1HMVA 4CEZA 4CFBA 4OKKA 1ZBLA 2B6AA 1T8EA 4LSLA 4KAZA 4O0IA 4OJRA 1S5JA 4Z4HA 1RCHA 1UA0A 4B9SA 3B6OA 3L2UA 4OGEA 3NGZA 4KHSA 4DLGA 1JKHA 1KLMA 3V6DA 3WNGA 3I8DA 4FZYA 3KK2A 4NCAA 2YNGA 4B9MA 1YT3A 3HJFA 3ZT4A 1F21A 4C8OA 3RRHA 3DLBA 2YKMA 3AO3A 4DF8A 4R5PA 2O4GA 3K5LA 3K58A 4FJJA 4KI4A 2B4JA 3VQBA 3NCIA 1U47A 4PWDA 3C6TA 4LY7A 4E7IA 4FJ5A 4IKFA 4DMNA 3QIOA 3ZT0A 3ZSXA 4FJIA 1I39A 2X74A 1DTTA 1A5VA 3LDSA 1VSJA 2XY8A 4KTWA 3HP6A 3S9HA 4LH4A 4QAGA 4AHSA 2P5GA 4CFCA 4DTOA 3QNNA 2XY6A 4DTRA 5J2PA 4OLAA 5FROA 4W5NA 4PUOA 1WAJA 3C94A 4FZZA 1HYZA 4W5TA 3KKRA 2HMIA 3ALYA 1C1AA 4LH5A 5KTQA 2KZZA 4FW1A 3VQ8A 1J54A 1TKZA 4JRQA 4DTMA 1SUQA 4ELUA 2HVHA 3OJUA 1SKRA 1NK4A 4M3ZA 4CHPA 2E4LA 4ICLA 4IFYA 1ZYQA 1JLCA 5HRRA 1ASVA 3AVIA 3QNOA 2QKKA 1NK9A 2P5OA 4CIFA 2HNYA 1JL1A 2R7YA 4DTXA 3SQ4A 1DLOA 3O4NA 2YHBA 4FJLA 4NCBA 1TL1A 3OYCA 4LD0A 4E7LA 3KD1E 4FK2A 1JLEA 4IG3A 3NGIA 1SL2A 2D5RA 4W5OA 3BGRA 1XC9A 2DY4A 3VQ5A 1JLBA 2XO7A 1S1WA 3QETA 3SNNA 4PA1A 3AVKA 1QTMA 2FBVA 3DLRA 4FLWA 2HVIA 4CJWA 1RTHA 3FFIA 1ASWA 1XHXA 5KGWA 1LAVA 4M41A 1TAUA 4E1NA 3OVNA 4CGGA 3SV3A 3K2PA 4C8MA 4I9LA 3CQ8A 1L3UA 4B9TA 3CFPA 3AVHA 4C8KA 1HJRA 3KTQA 3V9UA 4FYDA 1Q8IA 1LW2A 1WSIA 4Z4CA 3P5JA 5CZ2A 4ZTFA 4N5SA 2G8HA 4CF9A 2G8KA 3CFRA 4J2BA 3HPHA 1NOYA 2YNIA 1RBUA 1TVRA 3G10A 3OYNA 4B8AB 1NK5A 5KRTA 1UA1A 3KLHA 1KVBA 3QLHA 4ELVA 4CJSA 4E7JA 4I7FA 3KIOA 4M3RA 4FJKA 2I5JA 3RRGA 1EKEA 4M3WA 3RR8A 1VSLA 2IGIA 4KKOA 1JLFA 2YNFA 3MEEA 2Q3SA 3VA3A 4CJRA 4ZHRA 5HRSA 1NK0A 3LP1A 4CGJA 4BE0A 1NKBA 3IAYA 2HHQA 4E19A 4PY5A 1RTIA 2VG6A 3K5NA 3DLGA 4HUFA 2XHBA 1HQEA 4QCLA 2GBZA 3K59A 3M8SA 1NJXA 3SUOA 4CJKA 1J53A 5J2QA 4CHOA 1L3VA 4B3OA 2FBTA 2JGUA 4Z4GA 1A5XA 5HROA 2YV0X 3QESA 5D3GA 1WSEA 3CM5A 4OKJA 4E3SA 4KPYA 4E7KA 1N6QA 1RT6A 4CJQA 1U49A 2QKBA 1RT5A 2HNDA 4CHZA 3LPTA 4CJVA 4DTSA 4Z4EA 4N56A 3RR7A 1TV6A 1KTQA 3NF6A 4FVMA 1L3SA 3QEPA 3S3MA 2E6MA 1TKDA 4N76A 3KLIA 1LWEA 3NHGA 1SL1A 1D8YA 3RTVA 2WONA 1GOAA 3E01A 4KFBA 4HHTA 3TAEA 2KFNA 1U48A 4F3TA 4DG1A 3L3UA 4KV8A 2IDOA 3BDPA 1NJYA 3DLHA 4DTJA 4DFMA 1KSPA 1J5OA 1VSHA 1RNHA 1CXQA 1L3TA 1JLQA 4O44A 1Q9YA 3K5OA 1LV5A 4DSIA 4B9VA 1JLGA 2GV9A 3SV4A 2YNHA 2HHXA 1JXBA 2OPQA 2X78A 1B92A 3JSMA 1HYSA 3SQ1A 1VK0A 4H4MA 3ZT3A 3U3YA 4HVJA 5J1EA 4KHUA 4FK4A 3L2RA 1SL0A 1HNIA 4FJ7A 3DYAA 1XHZA 3TAQA 1QSYA 4BDPA 4DQIA 3L2QA 2Z1IA 3IG1A 3THVA 1HRHA 4CEAA 4RW8A 3TARA 2Y1JA 1KRPA 4DS5A 3LP0A 5EU7A 2KTQA 1IKVA 3VQQA 4KRFA 1HPZA 4XIUA 3VQ7A 1W0HA 1LAWA 3O3HA 2F96A 4CEOA 4CF8A 2OPRA 2ETJA 3F73A 4M3XA 3HPGA 3KLGA 2DTUA 3L2VA 2NUBA 5C24A 4W5RA 4FLYA 3RMBA 1MU2A 1FKOA 4CIEA 4TSXA 3TWHA 3OJSA 3I0RA 1YTUA 2PYLA 1ITGA 5SZTA 1D9DA 5CYMA 1S1VA 3KK1A 1RT1A 3AVCA 1TGOA 3HSTB 3ISNC 4CJPA 3SUQA 3S3OA 1G15A 2OZMA 3C95A 5I42A 4KTZA 3V9ZA 2G8UA 4B08A 1S1TA 2HHUA 3QEWA 5JS1A 1IKWA 3DRPA 4DQQA 4ID5A 4FJ9A 1RBTA 4O55A 3VQDA 4PQUA 2DFHA 4FXDA 1BI4A 4FJNA 3V81A 4KREA 3M8PA 3PY8A 3T3FA 3TABA 1TK8A 4CECA 4CEQA 2BDPA 3EY1A 1X9SA 4J2EA 4GMJB 3ZT1A 4CEDA 3V4IA 1LWCA 4RW6A 5JS2A 4CFDA 4B8CA 1RTJA 2VG5A 1U04A 4CGHA 2Z1GA 5DMRA 4E7HA 1ASUA 4M42A 3DRSA 1CZBA 3AA5X 4CJUA 1NJWA 2A1SA 1Y97A 5HBMA 5HLFA 3OYFA 4CF0A 1WSJA 4BDZA 3UIQA 4DFPA 1BISA 2RN2A 1FXXA 1S1XA 3ZT2A 5HRPA 4OLBA 3LWLA 2D0CA 5KGXA 1D5AA 3HYFA 1VSMA 4OKEA 3KJVA 4RW9A 3NE6A 1ZBIA 3NFAA 4KO0A 4KB0A 3PX4A 4O5BA 3OYMA 3O3FA 3HP9A 2IC3A 4BWJA 5C42A 4DSEA 3VN5A 1C6VA 1RT2A 3CFOA 4F2SA 1WSHA 1RDCA 3TAGA 4YFUA 1X9WA 1VSIA 3H08A 5DK5A 1Z25A 1YTAA 3ZSOA 3OS1A 3KD5E 1NK6A 4CJFA 2ATQA 2JLEA 2ZE2A 3AVLA 4BE1A 3ZSRA 3AVAA 3NF9A 4HTUA 1IKXA 1XWLA 3QO9A 4CHQA 3PV8A 3L8BA 3HT3A 4DSKA 5CYQA 5FRMA 2AJQA 3RMCA 1LW0A 4J2AA 2OA8A 5KI6A 4FCYA 3RMDA 3HK2A 1Z26A 3ITHA 1YVUA 4AHTA 1BIUA 1VSKA 3P1GA 5T7BA 4K8XA 1DTQA 1TK5A 2OYQA 3SZ2A 1QSLA 2WOMA 1S6QA 3DI6A 1W9HA 1KVCA 1ZBFA 4NYFA 4ZTJA 1IH7A 4DF4A 4DFKA 2RKIA 3SPYA 4MQ3A 3K5MA 2BANA 2HNZA 2P1JA 3M8QA 4DU1A 1LWFA 1KFSA 4Q0BA 3LALA 4N41A 3HPOA 3M8RA 3V9SA 1RDAA 3O4QA 4CJTA 4CHYA 5HRNA 3MAQA 3SI6A 3ZSVA 4DWIA 3OYKA 3LPUA 2VWKA 3PUFA 2RF2A 3O3GA 4FLXA 4CIGA 1CLQA 4FJXA 3LZIA 4JRPA 2G8IA 3C6UA 2KQ2A 3A2FA 3LAKA 4AHUA 3OYBA 1BHLA 1C1CA 2IAJA 1U45A 2BGGA 4KHYA 2XY5A 1TK0A 2B5JA 4G1QA 1TAQA 3K57A 4DSFA 3AV9A 1VSFA 1TKTA 5FRNA 3LP3A 1WSFA 4H4OA 4O0JA 4AH9A 3VQ9A 4CEFA 4FJMA 1GOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDL A;  2P51 A;  3SQ0 A;  4C8L A;  3AO5 A;  1XI1 A;  4DQP A;  1RBR A;  4IBN A;  4Q5V A;  3KLE A;  3NAE A;  3AO1 A;  1HYV A;  1T05 A;  4CK2 A;  3MED A;  3KKS A;  4CES A;  3ZSY A;  4CGF A;  1REV A;  2YKN A;  1IG9 A;  1BQN A;  3QEV A;  1Q9X A;  5HP1 A;  1RT3 A;  3LAN A;  4DTU A;  3AVF A;  4KHN A;  1QE1 A;  2D0B A;  4CK1 A;  4CK3 A;  2KZM A;  3QEI A;  4IDK A;  3NH1 A;  1U4B A;  3NDK A;  2XRI A;  4F2R A;  4F8R A;  4FLZ A;  1BI4 B;  1QS4 A;  3QIN A;  1SKW A;  4M45 A;  4FM2 A;  2IS3 A;  4KHQ A;  2ITG A;  1B9D A;  4WE1 A;  4Z4I A;  3AO2 A;  1O1W A;  2X6N A;  4CF1 A;  2DFE A;  4CFA A;  1WNS A;  5CY4 A;  4HUG A;  3TI0 A;  5K14 A;  4K8Z A;  4N47 A;  2KW4 A;  3S3N A;  3VQ4 A;  4FLV A;  2G8F A;  3AVJ A;  1R0A A;  3RWU A;  4JS5 A;  1NKC A;  2O4I A;  3KLF A;  3SUN A;  3AVM A;  4ID1 A;  3U3G A;  2VG7 A;  4CCH A;  3I0S A;  2IOC A;  3ZSQ A;  4F3O A;  3U6F A;  1VSE A;  3TAF A;  1ZBH A;  1EET A;  3AO4 A;  3TAP A;  2A1R A;  2FBX A;  4E89 A;  4CGD A;  2OPP A;  1HNV A;  3D45 A;  3WNH A;  1D9F A;  4E0D A;  3V9W A;  1N5Y A;  3AVG A;  1BCM A;  1EX4 A;  3NF8 A;  4GVM A;  4JLH A;  3SPZ A;  1S9G A;  3TR8 A;  3OS0 A;  4OPJ A;  3NBP A;  3VQP A;  4CER A;  4Z0U A;  1J9A A;  3AA4 A;  1T03 A;  5J2M A;  2W42 A;  4Y1D A;  3PX6 A;  4CGI A;  4BDY A;  1QSS A;  3DOL A;  3MEC A;  2YHA A;  4I2Q A;  1NJZ A;  4KI6 A;  3CM6 A;  4HCC A;  2VWJ A;  3OYI A;  1CZ9 A;  2QK9 A;  4FM0 A;  4DLE A;  1C0M A;  4B9U A;  1SKS A;  2LSN A;  3WNF A;  3TAM A;  4E1M A;  1RDB A;  1UAX A;  2RPI A;  3T1A A;  3VA0 A;  1VRU A;  2Z1J A;  4CJL A;  4DFJ A;  3WNE A;  4CJ4 A;  3CYM A;  4CHN A;  2F8T A;  4UQG A;  5I3U A;  3VQA A;  4FM1 A;  3VQ6 A;  3NF7 A;  3NH0 A;  1RTD A;  1QHT A;  1X1P A;  4BAC A;  4EZ9 A;  3SCX A;  1FKP A;  1SV5 A;  2D0A A;  2OPS A;  4DS4 A;  3OY9 A;  4I9Q A;  4BE2 A;  2F8S A;  3OYE A;  4RW4 A;  3DM2 A;  3OS2 A;  4FJ8 A;  4CF2 A;  1UOC A;  4JS4 A;  3IRX A;  4B9L A;  1L5U A;  4KB1 A;  1JL2 A;  2EHG A;  5E41 A;  3CG7 A;  2E6L A;  2ZD1 A;  3NGY A;  5SWM A;  1RT7 A;  3L2W A;  2PY5 A;  2OZS A;  3PX0 A;  2KFZ A;  1BIZ A;  2QXF A;  3B6P A;  3F9K A;  3ZSZ A;  4YNQ A;  2HW3 A;  4NCG A;  1JLA A;  3OYD A;  4FJH A;  3KK3 A;  4M3T A;  3QER A;  3ZSW A;  1S1U A;  3JYT A;  4CEE A;  2FC0 A;  4AHR A;  4AHV A;  5J2N A;  4OGC A;  1S9E A;  3NH2 A;  1FK9 A;  2ZQB A;  3V1O A;  4I2P A;  3IS9 A;  2BE2 A;  1UWB A;  1C0T A;  4GW6 A;  4KTQ A;  3VQC A;  3SJJ A;  5KRS A;  1EP4 A;  1WLJ A;  3DRR A;  1BGX T;  1TL3 A;  3L3V A;  4F4K A;  1VRT A;  4IG0 A;  1KLN A;  3EZ5 A;  4FLU A;  4MFB A;  1GOC A;  4OPK A;  3EYZ A;  4DTP A;  4DTN A;  3DOK A;  1X9M A;  4IFV A;  3QEX A;  1B9F A;  3DLK A;  4DQR A;  4DU4 A;  5CZ1 A;  2X6S A;  3OYJ A;  3OYG A;  3OYH A;  3MXI A;  1NOZ A;  3HXM A;  1IO2 A;  3HL8 A;  1WSG A;  4J2D A;  1CXU A;  2XY7 A;  2PYJ A;  2FBY A;  2G8W A;  1RBV A;  4C8N A;  3P83 D;  1C0U A;  4ELT A;  4FW2 A;  4DSJ A;  4EZ6 A;  1RBS A;  3G0Z A;  1ZBU A;  4AIL C;  1WAF A;  4RW7 A;  1A5W A;  3AVN A;  1TKX A;  4CJ5 A;  4HUE A;  1NK7 A;  1NKE A;  1QQC A;  2HHW A;  3SYZ A;  3SUP A;  1RIL A;  4DQS A;  1VSD A;  2Z1H A;  3DMJ A;  1BL3 A;  3HVT A;  2G8V A;  2HHS A;  3V1R A;  3MXM A;  4DU3 A;  3MXJ A;  2DFF A;  2HHV A;  3OYL A;  3ZCM A;  3SQ2 A;  1BQM A;  3LP2 A;  2GUI A;  3TAN A;  3PO4 A;  4FZX C;  3AA2 A;  4O4G A;  4RG8 A;  4AHC A;  4CJE A;  3OYA A;  3LAM A;  3QIP A;  4H8K A;  3LZJ A;  1IKY A;  5C25 A;  3V1Q A;  1KFD A;  1S6P A;  4BWM A;  4EP5 A;  1C1B A;  1BCO A;  4FK0 A;  4KHW A;  4QOZ B;  3VQE A;  1HQU A;  4NYN A;  4Z4F A;  1I3A A;  2PZS A;  2EX3 A;  4Y1C A;  1RDD A;  3T19 A;  3HM9 A;  4FLT A;  4DSL A;  3AVB A;  2HB5 A;  3LWM A;  1T7P A;  3AA3 A;  4M3U A;  3V9X A;  4W5Q A;  3D0P A;  4CE9 A;  3PO5 A;  4EP4 A;  3HVR A;  2Y1I A;  4B9N A;  4CJ3 A;  2HHT A;  3RMA A;  1K6Y A;  4LSN A;  1WN7 A;  3ULD A;  1KCF A;  4FJG A;  4OVL A;  1RT4 A;  3MEG A;  1KVA A;  4CEB A;  4HCB A;  1JXE A;  1EXQ A;  1NK8 A;  4L8R B;  3HO1 A;  3ASM A;  3DLE A;  4M3Y A;  1HMV A;  4CEZ A;  4CFB A;  4OKK A;  1ZBL A;  2B6A A;  1T8E A;  4LSL A;  4KAZ A;  4O0I A;  4OJR A;  1S5J A;  4Z4H A;  1RCH A;  1UA0 A;  4B9S A;  3B6O A;  3L2U A;  4OGE A;  3NGZ A;  4KHS A;  4DLG A;  1JKH A;  1KLM A;  3V6D A;  3WNG A;  3I8D A;  4FZY A;  3KK2 A;  4NCA A;  2YNG A;  4B9M A;  1YT3 A;  3HJF A;  3ZT4 A;  1F21 A;  4C8O A;  3RRH A;  3DLB A;  2YKM A;  3AO3 A;  4DF8 A;  4R5P A;  2O4G A;  3K5L A;  3K58 A;  4FJJ A;  4KI4 A;  2B4J A;  3VQB A;  3NCI A;  1U47 A;  4PWD A;  3C6T A;  4LY7 A;  4E7I A;  4FJ5 A;  4IKF A;  4DMN A;  3QIO A;  3ZT0 A;  3ZSX A;  4FJI A;  1I39 A;  2X74 A;  1DTT A;  1A5V A;  3LDS A;  1VSJ A;  2XY8 A;  4KTW A;  3HP6 A;  3S9H A;  4LH4 A;  4QAG A;  4AHS A;  2P5G A;  4CFC A;  4DTO A;  3QNN A;  2XY6 A;  4DTR A;  5J2P A;  4OLA A;  5FRO A;  4W5N A;  4PUO A;  1WAJ A;  3C94 A;  4FZZ A;  1HYZ A;  4W5T A;  3KKR A;  2HMI A;  3ALY A;  1C1A A;  4LH5 A;  5KTQ A;  2KZZ A;  4FW1 A;  3VQ8 A;  1J54 A;  1TKZ A;  4JRQ A;  4DTM A;  1SUQ A;  4ELU A;  2HVH A;  3OJU A;  1SKR A;  1NK4 A;  4M3Z A;  4CHP A;  2E4L A;  4ICL A;  4IFY A;  1ZYQ A;  1JLC A;  5HRR A;  1ASV A;  3AVI A;  3QNO A;  2QKK A;  1NK9 A;  2P5O A;  4CIF A;  2HNY A;  1JL1 A;  2R7Y A;  4DTX A;  3SQ4 A;  1DLO A;  3O4N A;  2YHB A;  4FJL A;  4NCB A;  1TL1 A;  3OYC A;  4LD0 A;  4E7L A;  3KD1 E;  4FK2 A;  1JLE A;  4IG3 A;  3NGI A;  1SL2 A;  2D5R A;  4W5O A;  3BGR A;  1XC9 A;  2DY4 A;  3VQ5 A;  1JLB A;  2XO7 A;  1S1W A;  3QET A;  3SNN A;  4PA1 A;  3AVK A;  1QTM A;  2FBV A;  3DLR A;  4FLW A;  2HVI A;  4CJW A;  1RTH A;  3FFI A;  1ASW A;  1XHX A;  5KGW A;  1LAV A;  4M41 A;  1TAU A;  4E1N A;  3OVN A;  4CGG A;  3SV3 A;  3K2P A;  4C8M A;  4I9L A;  3CQ8 A;  1L3U A;  4B9T A;  3CFP A;  3AVH A;  4C8K A;  1HJR A;  3KTQ A;  3V9U A;  4FYD A;  1Q8I A;  1LW2 A;  1WSI A;  4Z4C A;  3P5J A;  5CZ2 A;  4ZTF A;  4N5S A;  2G8H A;  4CF9 A;  2G8K A;  3CFR A;  4J2B A;  3HPH A;  1NOY A;  2YNI A;  1RBU A;  1TVR A;  3G10 A;  3OYN A;  4B8A B;  1NK5 A;  5KRT A;  1UA1 A;  3KLH A;  1KVB A;  3QLH A;  4ELV A;  4CJS A;  4E7J A;  4I7F A;  3KIO A;  4M3R A;  4FJK A;  2I5J A;  3RRG A;  1EKE A;  4M3W A;  3RR8 A;  1VSL A;  2IGI A;  4KKO A;  1JLF A;  2YNF A;  3MEE A;  2Q3S A;  3VA3 A;  4CJR A;  4ZHR A;  5HRS A;  1NK0 A;  3LP1 A;  4CGJ A;  4BE0 A;  1NKB A;  3IAY A;  2HHQ A;  4E19 A;  4PY5 A;  1RTI A;  2VG6 A;  3K5N A;  3DLG A;  4HUF A;  2XHB A;  1HQE A;  4QCL A;  2GBZ A;  3K59 A;  3M8S A;  1NJX A;  3SUO A;  4CJK A;  1J53 A;  5J2Q A;  4CHO A;  1L3V A;  4B3O A;  2FBT A;  2JGU A;  4Z4G A;  1A5X A;  5HRO A;  2YV0 X;  3QES A;  5D3G A;  1WSE A;  3CM5 A;  4OKJ A;  4E3S A;  4KPY A;  4E7K A;  1N6Q A;  1RT6 A;  4CJQ A;  1U49 A;  2QKB A;  1RT5 A;  2HND A;  4CHZ A;  3LPT A;  4CJV A;  4DTS A;  4Z4E A;  4N56 A;  3RR7 A;  1TV6 A;  1KTQ A;  3NF6 A;  4FVM A;  1L3S A;  3QEP A;  3S3M A;  2E6M A;  1TKD A;  4N76 A;  3KLI A;  1LWE A;  3NHG A;  1SL1 A;  1D8Y A;  3RTV A;  2WON A;  1GOA A;  3E01 A;  4KFB A;  4HHT A;  3TAE A;  2KFN A;  1U48 A;  4F3T A;  4DG1 A;  3L3U A;  4KV8 A;  2IDO A;  3BDP A;  1NJY A;  3DLH A;  4DTJ A;  4DFM A;  1KSP A;  1J5O A;  1VSH A;  1RNH A;  1CXQ A;  1L3T A;  1JLQ A;  4O44 A;  1Q9Y A;  3K5O A;  1LV5 A;  4DSI A;  4B9V A;  1JLG A;  2GV9 A;  3SV4 A;  2YNH A;  2HHX A;  1JXB A;  2OPQ A;  2X78 A;  1B92 A;  3JSM A;  1HYS A;  3SQ1 A;  1VK0 A;  4H4M A;  3ZT3 A;  3U3Y A;  4HVJ A;  5J1E A;  4KHU A;  4FK4 A;  3L2R A;  1SL0 A;  1HNI A;  4FJ7 A;  3DYA A;  1XHZ A;  3TAQ A;  1QSY A;  4BDP A;  4DQI A;  3L2Q A;  2Z1I A;  3IG1 A;  3THV A;  1HRH A;  4CEA A;  4RW8 A;  3TAR A;  2Y1J A;  1KRP A;  4DS5 A;  3LP0 A;  5EU7 A;  2KTQ A;  1IKV A;  3VQQ A;  4KRF A;  1HPZ A;  4XIU A;  3VQ7 A;  1W0H A;  1LAW A;  3O3H A;  2F96 A;  4CEO A;  4CF8 A;  2OPR A;  2ETJ A;  3F73 A;  4M3X A;  3HPG A;  3KLG A;  2DTU A;  3L2V A;  2NUB A;  5C24 A;  4W5R A;  4FLY A;  3RMB A;  1MU2 A;  1FKO A;  4CIE A;  4TSX A;  3TWH A;  3OJS A;  3I0R A;  1YTU A;  2PYL A;  1ITG A;  5SZT A;  1D9D A;  5CYM A;  1S1V A;  3KK1 A;  1RT1 A;  3AVC A;  1TGO A;  3HST B;  3ISN C;  4CJP A;  3SUQ A;  3S3O A;  1G15 A;  2OZM A;  3C95 A;  5I42 A;  4KTZ A;  3V9Z A;  2G8U A;  4B08 A;  1S1T A;  2HHU A;  3QEW A;  5JS1 A;  1IKW A;  3DRP A;  4DQQ A;  4ID5 A;  4FJ9 A;  1RBT A;  4O55 A;  3VQD A;  4PQU A;  2DFH A;  4FXD A;  1BI4 A;  4FJN A;  3V81 A;  4KRE A;  3M8P A;  3PY8 A;  3T3F A;  3TAB A;  1TK8 A;  4CEC A;  4CEQ A;  2BDP A;  3EY1 A;  1X9S A;  4J2E A;  4GMJ B;  3ZT1 A;  4CED A;  3V4I A;  1LWC A;  4RW6 A;  5JS2 A;  4CFD A;  4B8C A;  1RTJ A;  2VG5 A;  1U04 A;  4CGH A;  2Z1G A;  5DMR A;  4E7H A;  1ASU A;  4M42 A;  3DRS A;  1CZB A;  3AA5 X;  4CJU A;  1NJW A;  2A1S A;  1Y97 A;  5HBM A;  5HLF A;  3OYF A;  4CF0 A;  1WSJ A;  4BDZ A;  3UIQ A;  4DFP A;  1BIS A;  2RN2 A;  1FXX A;  1S1X A;  3ZT2 A;  5HRP A;  4OLB A;  3LWL A;  2D0C A;  5KGX A;  1D5A A;  3HYF A;  1VSM A;  4OKE A;  3KJV A;  4RW9 A;  3NE6 A;  1ZBI A;  3NFA A;  4KO0 A;  4KB0 A;  3PX4 A;  4O5B A;  3OYM A;  3O3F A;  3HP9 A;  2IC3 A;  4BWJ A;  5C42 A;  4DSE A;  3VN5 A;  1C6V A;  1RT2 A;  3CFO A;  4F2S A;  1WSH A;  1RDC A;  3TAG A;  4YFU A;  1X9W A;  1VSI A;  3H08 A;  5DK5 A;  1Z25 A;  1YTA A;  3ZSO A;  3OS1 A;  3KD5 E;  1NK6 A;  4CJF A;  2ATQ A;  2JLE A;  2ZE2 A;  3AVL A;  4BE1 A;  3ZSR A;  3AVA A;  3NF9 A;  4HTU A;  1IKX A;  1XWL A;  3QO9 A;  4CHQ A;  3PV8 A;  3L8B A;  3HT3 A;  4DSK A;  5CYQ A;  5FRM A;  2AJQ A;  3RMC A;  1LW0 A;  4J2A A;  2OA8 A;  5KI6 A;  4FCY A;  3RMD A;  3HK2 A;  1Z26 A;  3ITH A;  1YVU A;  4AHT A;  1BIU A;  1VSK A;  3P1G A;  5T7B A;  4K8X A;  1DTQ A;  1TK5 A;  2OYQ A;  3SZ2 A;  1QSL A;  2WOM A;  1S6Q A;  3DI6 A;  1W9H A;  1KVC A;  1ZBF A;  4NYF A;  4ZTJ A;  1IH7 A;  4DF4 A;  4DFK A;  2RKI A;  3SPY A;  4MQ3 A;  3K5M A;  2BAN A;  2HNZ A;  2P1J A;  3M8Q A;  4DU1 A;  1LWF A;  1KFS A;  4Q0B A;  3LAL A;  4N41 A;  3HPO A;  3M8R A;  3V9S A;  1RDA A;  3O4Q A;  4CJT A;  4CHY A;  5HRN A;  3MAQ A;  3SI6 A;  3ZSV A;  4DWI A;  3OYK A;  3LPU A;  2VWK A;  3PUF A;  2RF2 A;  3O3G A;  4FLX A;  4CIG A;  1CLQ A;  4FJX A;  3LZI A;  4JRP A;  2G8I A;  3C6U A;  2KQ2 A;  3A2F A;  3LAK A;  4AHU A;  3OYB A;  1BHL A;  1C1C A;  2IAJ A;  1U45 A;  2BGG A;  4KHY A;  2XY5 A;  1TK0 A;  2B5J A;  4G1Q A;  1TAQ A;  3K57 A;  4DSF A;  3AV9 A;  1VSF A;  1TKT A;  5FRN A;  3LP3 A;  1WSF A;  4H4O A;  4O0J A;  4AH9 A;  3VQ9 A;  4CEF A;  4FJM A;  1GOB A; 
#chains in the Genus database with same CATH topology
 2P51 A;  3SQ0 A;  3FE1 A;  3AO5 A;  1GLD G;  4MO5 A;  3M5R A;  2WUS A;  3ZSY A;  1VHX A;  3WT0 A;  3QEV A;  1Y64 A;  3THX A;  4KHN A;  1QE1 A;  2D0B A;  3R8E A;  2D4W A;  3UKR B;  3QEI A;  1U4B A;  3NDK A;  2XRI A;  3D2E A;  4F8R A;  1BI4 B;  3QIN A;  4FM2 A;  1DT9 A;  2DFE A;  3TI0 A;  2NZT A;  4N47 A;  2KW4 A;  2G8F A;  4C23 A;  3AVJ A;  3ENH A;  4JS5 A;  2O4I A;  3KLF A;  3SUN A;  1FJG K;  3CCM N;  4CCH A;  4A59 A;  2IOC A;  4F3O A;  4JYA K;  3HTV A;  2YHW A;  1OH6 A;  3TAF A;  1VQK N;  3TAP A;  1ZBH A;  2A1R A;  4E0D A;  3PIO L;  1D9F A;  4JN4 A;  1BCM A;  3TR8 A;  1K73 O;  5FPN A;  3VF6 A;  3VQP A;  4FWO A;  1T03 A;  3EL2 A;  3PX6 A;  4BDY A;  4JKG B;  2YHY A;  4I6M A;  2QK9 A;  1NJI O;  4CZI A;  1C0M A;  1SKS A;  5BN9 A;  3CCQ N;  2RPI A;  3A5L C;  3LDQ A;  1VRU A;  2HHH K;  4JKE A;  2F8T A;  2UUC K;  4U7B A;  1QHT A;  3BP8 A;  3QFP A;  1VQL N;  4EZ9 A;  1FKP A;  4DS4 A;  1NGF A;  3IDH A;  3WEE A;  4JS4 A;  4LF4 K;  4KB1 A;  4BC4 A;  3CG7 A;  2E6L A;  3NGY A;  3VTH A;  3DJC A;  3F9K A;  3ZSZ A;  2P9I A;  2HW3 A;  3ZSW A;  5J2N A;  1S9E A;  1FK9 A;  2ZQB A;  4IEE A;  2BE2 A;  4KTQ A;  3J7A P;  1WLJ A;  1BGX T;  3LL3 A;  3I33 A;  1VRT A;  1MDU B;  4OPK A;  3EYZ A;  1TYQ A;  3A0I X;  3DOK A;  4IFV A;  1B9F A;  4IOA L;  2F9T A;  2X6S A;  5TKW A;  3OYH A;  5GAH P;  1IO2 A;  3HL8 A;  4K25 A;  4J2D A;  2XY7 A;  2PYJ A;  2FBY A;  3CIP A;  1VQ5 N;  4DSJ A;  1RBS A;  1WAF A;  4RW7 A;  5AZI B;  1U6Z A;  1BDG A;  3SUP A;  2Z1H A;  3MXM A;  1M90 O;  2HHV A;  3OYL A;  1RGI A;  2GUI A;  3TAN A;  4W5N A;  3AA2 A;  3LAM A;  1IKY A;  4DR7 K;  3D6R A;  3CCJ N;  2PZS A;  2EX3 A;  5FPM A;  3HM9 A;  4FLT A;  3AVB A;  3H46 O;  4B3R K;  4W5Q A;  4B9N A;  3RMA A;  1KVA A;  4M3Y A;  4DHY A;  1T8E A;  1OVQ A;  4IZ9 A;  3B6O A;  4H0Y B;  3G71 N;  3E9O A;  4KHS A;  1JKH A;  3V6D A;  1HX1 A;  3H1Q A;  1YJW N;  2V7Y A;  3KK2 A;  2YNG A;  1W2B M;  3SAG A;  3HJF A;  2P9K B;  2OAN A;  4R5P A;  5LY3 A;  1OVY A;  5AQZ A;  1U47 A;  4E7I A;  3ZSX A;  1I39 A;  2X74 A;  1DTT A;  4XH5 A;  3CXC M;  3LDS A;  4L3Q A;  3HP6 A;  4DTO A;  2XY6 A;  4B1V A;  4FZZ A;  3KKR A;  3ALY A;  1IG8 A;  2KZZ A;  5LJV A;  3HBT A;  4MO4 A;  1J54 A;  4DTM A;  4WFB L;  3UKR A;  3OJU A;  1NK4 A;  2AA4 A;  4IFY A;  4BG8 A;  3A5N C;  3O4N A;  1TL1 A;  4FK2 A;  1JLE A;  5AQF A;  2YI1 A;  1XC9 A;  2DY4 A;  4DV3 K;  3SNN A;  4BR4 A;  2NRW A;  4FLW A;  2HVI A;  1RTH A;  3FFI A;  3F9M A;  4M41 A;  2ZF5 O;  3OW2 M;  5M1P A;  3ZX2 A;  5AQL A;  4CZL A;  4BRE A;  3CQ8 A;  4K41 A;  3AVH A;  4LF9 K;  3LDN A;  4Z4C A;  4N5S A;  2G8H A;  3FZK A;  4CF9 A;  2O8D B;  3HPH A;  1NOY A;  2YNI A;  1RBU A;  3G10 A;  3KLH A;  2P9N A;  5LJW A;  4CD3 A;  4I7F A;  5EVZ A;  4FJK A;  3MK6 A;  1EKE A;  3QBW A;  4KKO A;  3MEE A;  2Q3S A;  2E8A A;  3VA3 A;  2HHQ A;  1EWQ A;  1WBB A;  3ATU A;  1RTI A;  3VOV A;  2O8B A;  3DLG A;  1N33 K;  5AR0 A;  3M8S A;  2E1Y A;  4B3O A;  3O9Q A;  2FLO A;  3VF2 A;  1YIT N;  1O13 A;  4CJQ A;  4CHZ A;  1ATS A;  4CJV A;  3P31 A;  2YJE A;  1E4F T;  4FVM A;  3QEP A;  4B3S K;  3N4Q A;  3CQY A;  3KLI A;  3SLC A;  1D8Y A;  4R79 A;  2KFN A;  3O1W A;  1U2V B;  1U48 A;  2OCE A;  4DG1 A;  4KV8 A;  4IJA A;  3DLH A;  4DTJ A;  3FZM A;  4WQ4 C;  1S22 A;  1L3T A;  1RNH A;  4DSI A;  1Q9Y A;  3K5O A;  1LV5 A;  2NRT A;  2W6K A;  1GLF O;  3SV4 A;  4YOV A;  2HHX A;  1XC3 A;  4H4M A;  3JXU A;  4YOW A;  3SBT A;  5J1E A;  4KHU A;  2QXL A;  5KQD A;  3J81 O;  1XMO K;  1HNI A;  4FJ7 A;  4FWP A;  3DYA A;  1JCG A;  4DQI A;  3L2Q A;  2Z1I A;  3THV A;  3KWG A;  4RW8 A;  5AQN A;  1KRP A;  3CME N;  3LP0 A;  1IKV A;  5AJ3 K;  4KRF A;  1HPZ A;  3VQ7 A;  4JHD B;  1LAW A;  2F96 A;  4CF8 A;  4FSV A;  3VTI A;  4A5B A;  2DTU A;  3RMB A;  3TWH A;  2P9S A;  1ITG A;  5KPT A;  3ZYY X;  3MWP A;  3AVC A;  1Q86 O;  3ZX0 A;  3C95 A;  3FZF A;  3QEW A;  2ZGZ A;  4FJ9 A;  1RBT A;  3M8P A;  3O8M A;  3TAB A;  1W7A A;  1NGC A;  4ILJ A;  4J2E A;  4CED A;  3ZT1 A;  3CET A;  4JK7 A;  3MX2 A;  1U04 A;  4CGH A;  5DMR A;  4O5F A;  4JNE A;  3AA5 X;  4CJU A;  1VQ8 N;  2A1S A;  5HLF A;  4PL7 A;  3OYF A;  4CF0 A;  4BDZ A;  2CH6 A;  2RN2 A;  1BUP A;  4OKE A;  1K8K A;  3NE6 A;  1GLB G;  3NFA A;  4BQL A;  4XEI A;  2IIR A;  3KK7 A;  3P38 A;  4H0T B;  2IC3 A;  5C42 A;  1X9J A;  4CZH A;  1RT2 A;  5AQK A;  5DK5 A;  3OS1 A;  3WUH A;  1IBK K;  3KD5 E;  4U67 L;  5CR4 A;  2ZE2 A;  3PV8 A;  4LFB K;  4HTU A;  4DSK A;  3QO9 A;  3HT3 A;  3OBW A;  3RMC A;  1LW0 A;  1RDU A;  1QZ5 A;  2OA8 A;  3TTF A;  3RMD A;  3HK2 A;  1Z26 A;  4H0X B;  4YDU C;  1DTQ A;  3DI6 A;  4DF4 A;  4DFK A;  2Q97 A;  4GV6 A;  5AQQ A;  4IOC L;  4MQ3 A;  3K5M A;  2BAN A;  3SPY A;  1LWF A;  3ZEU B;  4Q0B A;  4N41 A;  3V9S A;  3M1F A;  3ZSV A;  3OYK A;  3LPU A;  4FWK A;  3L4I A;  2E2P A;  4CIG A;  1N8R O;  2D0O A;  2G8I A;  2KQ2 A;  4BG9 A;  4JKB A;  1U45 A;  2E2Q A;  3E9L A;  1TK0 A;  4G1Q A;  3DWL A;  1VSF A;  5FRN A;  3VQ9 A;  2ITM A;  3BY5 A;  2H3G X;  2PAV A;  4XH1 A;  4IBN A;  4A2B A;  3KLE A;  3KKS A;  4CES A;  4LFA K;  4CGF A;  1REV A;  1R59 O;  4DR1 K;  1G99 A;  5KQ8 A;  1Q9X A;  3LAN A;  4DTU A;  4CK1 A;  4B3T K;  2VGN A;  2YX6 A;  3EZW A;  4FWS A;  3U4L A;  3QBX A;  4A2A A;  5GAG P;  3EE8 A;  2ITG A;  4WE1 A;  1D4X A;  3AO2 A;  3TU5 A;  1BOT O;  5K14 A;  2HST A;  3EN9 A;  3S3N A;  3R1X A;  3RWU A;  1R0A A;  2GX9 A;  5EX5 A;  3AVM A;  4ID1 A;  3THY A;  1QVG M;  2VG7 A;  3QDK A;  1EET A;  2UXB K;  4E89 A;  3D45 A;  1EX4 A;  1X3N A;  2GUP A;  3NF8 A;  1S9G A;  3OS0 A;  4OPJ A;  4EHU A;  1U2V A;  1VQ7 N;  4MLE A;  1J9A A;  3AA4 A;  4A57 A;  2ZGY A;  2YCH A;  5KPR A;  2YHA A;  4I2Q A;  1NJZ A;  4KI6 A;  3CM6 A;  2VWJ A;  1HKG A;  4FM0 A;  4DLE A;  2LSN A;  3MCA B;  4C1N I;  3VA0 A;  3T1A A;  4CJ7 A;  2Z1J A;  2HMP A;  2P9U B;  4UQG A;  3VQA A;  1NMN A;  1RTD A;  1X1P A;  1T6D A;  4GKK K;  1ATN A;  1XUP O;  5ADX H;  4B1X B;  3ENO A;  3IUC A;  3OY9 A;  4BE2 A;  2AP1 A;  4GV3 A;  3LM9 A;  1UOC A;  3IRX A;  1L5U A;  2IVP A;  5BN8 A;  1OH5 A;  2ZD1 A;  5SWM A;  2PY5 A;  3NMU A;  1BIZ A;  4BRP A;  4NCG A;  5AQM A;  5AQX A;  2O8C A;  1X3M A;  4CEE A;  4AHR A;  4AHV A;  4OGC A;  3FZH A;  4BRN A;  2E2O A;  3GE1 A;  4I2P A;  4ISG A;  1GLE G;  3VQC A;  3SJJ A;  1VQ6 N;  3UB5 A;  4H0O A;  3DRR A;  1TL3 A;  4IG0 A;  4AM6 A;  1YJN N;  5AQJ A;  3EZ5 A;  4FLU A;  1GOC A;  1YXQ A;  4DTP A;  5M1K A;  4DTN A;  2NRX A;  5GAE P;  3RSE B;  3QEX A;  4DU4 A;  5CZ1 A;  3OYJ A;  4MDA A;  3OYG A;  1WSG A;  1CXU A;  3E1Y A;  4BRA A;  3PSF A;  4DV0 K;  1RBV A;  4HWI A;  2QM1 A;  4C8N A;  1C0U A;  4FW2 A;  3CJ1 A;  4AIL C;  1NK7 A;  1A5W A;  3AVN A;  1TKX A;  4HUE A;  1S72 N;  4H5R A;  4JD2 B;  2A42 A;  1RIL A;  2HHS A;  3DMJ A;  3HVT A;  1BL3 A;  3MXJ A;  1BQM A;  3PO4 A;  4FZX C;  1QVF M;  4FOE A;  1KFD A;  4IJN A;  4KHW A;  4QOZ B;  4NYN A;  4Z4F A;  1IBM K;  1RDD A;  2GEL A;  3VER A;  2HB5 A;  4M3U A;  3AA3 A;  1ZXO A;  5FPE A;  5C10 A;  4CE9 A;  3PO5 A;  2Y1I A;  4CJ3 A;  2HHT A;  1K6Y A;  4LSN A;  1WN7 A;  3CER A;  3ULD A;  1EWR A;  1JXE A;  4L8R B;  1HMV A;  4CFB A;  2B6A A;  4LSL A;  3I8B A;  4KAZ A;  3ID8 A;  4BQZ A;  3ZEU A;  1UA0 A;  3QIC A;  4OGE A;  4NLB A;  3I55 N;  1KLM A;  4FO0 A;  3WNG A;  3I8D A;  2RHK A;  1YT3 A;  3ZT4 A;  3SAH A;  3AO3 A;  4DF8 A;  2O4G A;  3K5L A;  1SS6 A;  3O9T A;  2B4J A;  3VQB A;  2O8F B;  4IKF A;  3EEQ A;  4IXC A;  1QQO A;  1YHQ N;  4KTW A;  4LH4 A;  3QNN A;  3SBG A;  3C94 A;  4CW7 B;  1HYZ A;  4W5T A;  3LDL A;  3LDO A;  4ELU A;  3GG4 A;  5TKY A;  2P9P A;  4XH4 A;  5HRR A;  3AVI A;  3QNO A;  3O08 A;  4DV5 K;  2R7Y A;  4FJL A;  3OYC A;  5A2Q O;  3KD1 E;  3UKU A;  4JI8 K;  3VES A;  3NGI A;  1K8A O;  3R6M A;  4FWM A;  5GAD P;  4V19 S;  1S1W A;  3QET A;  1QTM A;  2FBV A;  4BY9 C;  2VYP A;  5KGW A;  2HBK A;  4BRG A;  3OVN A;  3T69 A;  3O6W A;  5AFU H;  3O9R A;  2CGL A;  4B9T A;  2KLA A;  3GBT A;  4NO7 A;  4FYD A;  1LW2 A;  1EQY A;  4QS9 A;  4JKC A;  5CZ2 A;  1BO5 O;  4J2B A;  3LM2 A;  3T1H K;  1IBL K;  3OYN A;  4B8A B;  1UA1 A;  4K42 A;  2UUB K;  3HI0 A;  3KIO A;  4GKJ K;  4M3R A;  3RR8 A;  4CJR A;  1NK0 A;  3CC4 N;  3WXI A;  3O9S A;  4AF1 A;  4E19 A;  4WCE L;  4FVU A;  4HUF A;  3J7Z O;  3SUO A;  5JIC A;  3CCL N;  1KAY A;  2Q0U A;  3EKS A;  4Z4G A;  1A5X A;  5HRO A;  3QES A;  1LOT B;  3CM5 A;  1VQ4 N;  4OKJ A;  4JI0 K;  4JI3 K;  4KPY A;  5JMV A;  3WQU A;  1RT6 A;  1RT5 A;  2HND A;  5BRE A;  3AAQ A;  3LPT A;  4Z4E A;  1DEJ A;  4N56 A;  3CHW A;  1TV6 A;  3NF6 A;  5C2F A;  1QZ6 A;  4N76 A;  3KHY A;  4KFB A;  4CI6 A;  2QWQ A;  3O4W A;  3L3U A;  4RCH A;  2NNW A;  1NGG A;  1J5O A;  1JLQ A;  2QEX N;  4B9V A;  2GV9 A;  3GDQ A;  3JSM A;  5FLX O;  2OTL N;  3FLC O;  3SQ1 A;  4KHP K;  5F0X A;  3KZB A;  3TTC A;  3CI5 A;  2V7Z A;  4BGB A;  4FK4 A;  1SL0 A;  2QWR A;  2I7P A;  3TAQ A;  4BDP A;  3O5B A;  3HZ6 A;  3IG1 A;  1HRH A;  4JKD A;  3TAR A;  1E4G T;  2NRR A;  2Y1J A;  2KTQ A;  3VQQ A;  4XIU A;  4GVE A;  3WXL A;  1RDW X;  2OPR A;  3CF5 L;  1TUY A;  4YOT A;  1YIJ N;  1MU2 A;  3TTD A;  1Z05 A;  4Z94 A;  3C65 A;  3I0R A;  4YOR A;  3CJA A;  4QS8 A;  3UE5 A;  1D9D A;  5CYM A;  3Q7C A;  2OZM A;  1TGO A;  3ISN C;  3SUQ A;  1G15 A;  3G6E N;  5AZJ B;  2HHU A;  4B08 A;  2VQF K;  1IKW A;  3AY9 A;  4ID5 A;  4O55 A;  2VWB A;  3VQD A;  2DFH A;  1BI4 A;  1GLJ O;  4KRE A;  3K9K A;  3PY8 A;  3J8A A;  2KKZ A;  3EY1 A;  1X9S A;  2OTJ N;  4FPB A;  5JS2 A;  3BF1 A;  4E7H A;  3GOI A;  3CD6 N;  1ASU A;  1ESV A;  4H5V A;  3SMS A;  4M42 A;  3DRS A;  1CZB A;  4MDB A;  1NJW A;  5HBM A;  5JVG L;  5BRH A;  5BPL A;  1WSJ A;  3UIQ A;  1HKC A;  4DFP A;  1BIS A;  4WF9 L;  3FFK B;  5HRP A;  2QWN A;  4DR3 K;  4BRO A;  5KGX A;  3L4Q A;  1KD1 O;  3HYF A;  3ZLJ A;  1HPM A;  1ZBI A;  4KO0 A;  4KB0 A;  3PX4 A;  3BEX A;  3OYM A;  2FSN A;  4JKG A;  4BWJ A;  4DSE A;  2D0P A;  3VN5 A;  1WSH A;  1RDC A;  3TAG A;  4YFU A;  3ZSO A;  3H08 A;  1Z25 A;  3SMP A;  1DKG D;  1NGE A;  1NK6 A;  4DV2 K;  3ZSR A;  1XWL A;  3L8B A;  2AJQ A;  4BVO A;  4J2A A;  5KI6 A;  2BTF A;  1BIU A;  3ULE B;  1VSK A;  3P1G A;  5T7B A;  1S6Q A;  1ZBF A;  4NYF A;  1N36 K;  2A40 A;  3M8Q A;  4BC2 A;  2F4V K;  3M8R A;  2ZJP L;  1RDA A;  4CJT A;  5HRN A;  3SI6 A;  4JI4 K;  5M1N A;  2FSK A;  3C6H A;  2WC9 A;  4FJX A;  3W3D A;  4JI1 K;  4JRP A;  5DM7 L;  3C6U A;  3CQX A;  3VF4 A;  2IAJ A;  4B9Q A;  2UYT A;  2O8E B;  4H03 B;  3MN9 A;  4DSF A;  1TKT A;  3LP3 A;  1WSF A;  4NXM K;  4C8K A;  1HUX A;  3CJB A;  2HF4 A;  4JI7 K;  5FDL A;  4C8L A;  1TUU A;  3WXJ A;  1RBR A;  4ISF A;  4Q5V A;  3NAE A;  3AO1 A;  1T05 A;  4CK2 A;  3MED A;  2WTU A;  4PHT X;  1BQN A;  4K0K K;  3AVF A;  1NBW A;  5E84 A;  2KZM A;  3KWI A;  4FLZ A;  4M45 A;  4KHQ A;  1B9D A;  3ATV A;  4Z4I A;  4DR4 K;  5AZI A;  1HNZ K;  2X6N A;  1NGB A;  5CY4 A;  4HUG A;  3A8Y A;  3IFR A;  3AAR A;  4BGA A;  3G4S N;  4FLV A;  3VEX A;  3I0S A;  2E1Z A;  3TPQ A;  3U6F A;  4PKI A;  1Z6R A;  3F5T A;  3AO4 A;  2E2N A;  2FBX A;  4CGD A;  2OPP A;  3R3L A;  3WNH A;  2ZJR L;  3V9W A;  3AVG A;  3HSC A;  1YVN A;  2P9L B;  4JLH A;  4EAH D;  4LC9 B;  4WQ4 A;  3NBP A;  3FZL A;  4Z0U A;  4EFH A;  4KH6 A;  5J2M A;  2W42 A;  4Y1D A;  2GTD A;  1QSS A;  1C0F A;  1NGD A;  3MEC A;  4HCC A;  4QS7 A;  4B9U A;  4KH4 A;  3CCS N;  1I94 K;  3KVG A;  3VEO A;  3TAM A;  1RDB A;  1UAX A;  5B8H A;  3C6A A;  3IKM A;  1HNX K;  1HJO A;  3C0B A;  4CJ4 A;  3VGM A;  3CYM A;  4CHN A;  5HL7 L;  5CE3 A;  4FM1 A;  3NF7 A;  3NH0 A;  4WFN L;  3W0L A;  2P9K A;  2IVN A;  3EE9 A;  4LF5 K;  3SCX A;  2HF3 A;  1IV0 A;  1SV5 A;  1YAG A;  2D0A A;  4I9Q A;  5AQT A;  3DM2 A;  3DAW A;  3SAF A;  4B9L A;  1JL2 A;  2OZS A;  4CZG A;  2KFZ A;  2QXF A;  4YNQ A;  3AGK A;  3OYD A;  3KK3 A;  3QER A;  5AZJ A;  1S1U A;  3JYT A;  2UU9 K;  3PLA A;  3NH2 A;  3DXK B;  3CC2 N;  1J5E K;  2F7T A;  4BRK A;  1UWB A;  4GW6 A;  5KRS A;  4MFB A;  4M63 C;  2GWK A;  2QWL A;  3CJ7 A;  3K9J A;  1NGA A;  2YHX A;  3R9P A;  3MXI A;  3THX B;  3HXM A;  1BA0 A;  2G8W A;  3D2E B;  2PFU A;  2CGK A;  4Y0W A;  4ELT A;  4EZ6 A;  3G0Z A;  1M1K O;  4CJ5 A;  1T6C A;  1NKE A;  2G8V A;  1OH8 A;  1VSD A;  3P4I A;  3V1R A;  4WFA L;  4DU3 A;  2DFF A;  3SQ2 A;  3LP2 A;  3OYA A;  4AHC A;  4BE1 A;  2O8D A;  4GY2 B;  5IWA K;  5M1F A;  3LZJ A;  4FPA A;  3V1Q A;  1GLL O;  1S6P A;  1NU0 A;  4BWM A;  1C1B A;  4AM7 A;  1HQU A;  1NWK A;  5BRF A;  1I3A A;  4Y1C A;  5AQG A;  1Q18 A;  5GIO A;  4DSL A;  2A5X A;  4WQ5 A;  3QML A;  1QQN A;  3D0P A;  4YDU A;  4EP4 A;  3HVR A;  4FJG A;  4OVL A;  1RT4 A;  4I6M B;  3HO1 A;  3ASM A;  3DLE A;  1ZBL A;  2Q31 A;  4O0I A;  4OJR A;  5LL6 Z;  4J8F A;  4E1J A;  3DXM B;  4Z4H A;  1N32 K;  2EWS A;  4B9S A;  3NGZ A;  4OPH A;  1WB9 A;  5AQY A;  2QTD A;  1VAZ A;  4FZY A;  3EO3 A;  1V4S A;  1NGI A;  3MN7 A;  3RRH A;  3DLB A;  4B1W B;  4BRC A;  5E26 A;  5EOY A;  3K58 A;  4KI4 A;  3NCI A;  4BR9 A;  4FJ5 A;  4DV7 K;  4DMN A;  3QIO A;  3OHR A;  3WEE B;  4FJI A;  2ASO A;  3S9H A;  4QAG A;  4AHS A;  2P5G A;  4JAX A;  4JV5 K;  4OLA A;  5FRO A;  2P9I B;  1YJ9 N;  1C1A A;  3VPZ A;  3VQ8 A;  4JRQ A;  1OH7 A;  3BZC A;  1SUQ A;  4ICL A;  1ZYQ A;  1JLC A;  2F9W A;  1ASV A;  3FGU A;  2QKK A;  2P5O A;  3SQ4 A;  1DLO A;  3VEZ A;  1TYQ B;  4JHD A;  3U9Z A;  1BU6 O;  3BGR A;  2XO7 A;  1JLB A;  4JK8 A;  1J6Z A;  4PA1 A;  3AVK A;  1N34 K;  5H1S Q;  3B8A X;  4GNI A;  1ASW A;  1SAZ A;  2D1K A;  1XHX A;  4KBO A;  2NRH A;  3SV3 A;  4FWQ A;  2FSJ A;  4I9L A;  1L3U A;  3CFP A;  3K0S A;  1HJR A;  3V9U A;  1ILY A;  3P5J A;  2Q0R A;  3CFR A;  1TVR A;  2QWP A;  3D2F B;  4M7X A;  4ELV A;  4E7J A;  4BVP A;  2I5J A;  4WYB A;  3RRG A;  2E20 A;  4M3W A;  2IGI A;  4H0V B;  2GWJ A;  2YNF A;  1XQS C;  5HRS A;  3IAY A;  1NKB A;  4CGJ A;  4BE0 A;  3FR0 A;  5C0Y A;  2VG6 A;  3K5N A;  3K59 A;  3CCU N;  3Q7B A;  4CJK A;  5AQO A;  5J2Q A;  1L3V A;  2JGU A;  2YV0 X;  5D3G A;  1WSE A;  2NRV A;  2Q36 A;  5M1Q A;  4E7K A;  1N6Q A;  2QKB A;  1NGH A;  1KC8 O;  1P8Z A;  1LCU A;  1Q7Y O;  3S3M A;  2E6M A;  5AQW A;  1LWE A;  2A3Z A;  4IFE A;  2WON A;  1GOA A;  3E01 A;  4HHT A;  3I56 N;  4F3T A;  2IDO A;  3BDP A;  1NJY A;  3DXK A;  1OKJ A;  4BRL A;  4DFM A;  1NG9 A;  1CXQ A;  4ISE A;  2ASP A;  2YNH A;  1JXB A;  2OPQ A;  1HYS A;  1ATR A;  3A5O C;  1VK0 A;  1WBD A;  3ZX3 A;  3SJH A;  3L2R A;  1XHZ A;  1QSY A;  5CHI A;  4X62 K;  4IEI A;  1QQM A;  3E66 A;  1KQS M;  4DS5 A;  3OBY A;  5F2R A;  2QW9 A;  4BRD A;  4B1Y B;  4CEO A;  4OO1 J;  2ETJ A;  4M3X A;  4X66 K;  3CJC A;  3HPG A;  3AGR A;  3KLG A;  3C7N B;  3VEW A;  4MLH A;  3HOS A;  3CCE N;  4G9Z A;  4CIE A;  4TSX A;  1YTU A;  3VEN A;  1ZC6 A;  3HM8 A;  3J80 O;  1BWF O;  4KTZ A;  5JS1 A;  2I7N A;  4B1Z A;  4DQQ A;  4FXD A;  4FJN A;  4JK9 A;  4CBX A;  3N4P A;  5BR8 K;  4CEQ A;  4H5W A;  4LF8 K;  4GMJ B;  5LMN K;  4NXN K;  2P9N B;  3THW B;  4B8C A;  3HOT A;  3DXM A;  3BUZ B;  2HOE A;  4JI5 K;  1Y97 A;  3L0Q A;  2O8B B;  1FXX A;  1S1X A;  3LDP A;  3ZT2 A;  3NVM A;  3MMV A;  2W41 A;  4OLB A;  3LWL A;  2D0C A;  1D5A A;  4DUZ K;  1VSM A;  3KJV A;  4O5B A;  3L6Q A;  3HP9 A;  2A6A A;  2UUA K;  4DV4 K;  4H5T A;  1VQN N;  3O9U A;  4YY3 K;  1C6V A;  1H1V A;  4F2S A;  4DR5 K;  1VSI A;  1KAZ A;  1YTA A;  1W97 L;  2ATQ A;  2JLE A;  3AVL A;  4QCL A;  4DUY K;  1IKX A;  4CHQ A;  4NB4 A;  4C1N K;  2P9U A;  3E9P A;  1KAX A;  4BR2 A;  2KHO A;  5IT9 O;  5I9E B;  4FCY A;  3ITH A;  4IOX A;  3VMF B;  2OYQ A;  3SZ2 A;  1NNE A;  1QSL A;  1IH7 A;  3TSQ A;  2HNZ A;  2P1J A;  3LAL A;  2A41 A;  3HPO A;  3O4Q A;  3MAQ A;  3DLL L;  3BF3 A;  1NMD A;  1S3X A;  2VWK A;  2RF2 A;  3O3G A;  4FLX A;  3MN5 A;  3LZI A;  4BC5 A;  3QFU A;  3A2F A;  3LAK A;  3OYB A;  1BHL A;  1C1C A;  2IVO A;  2BGG A;  2B5J A;  3K57 A;  3GL1 A;  3U8X A;  2F8S A;  4H4O A;  4O0J A;  4AQY K;  4HVJ A;  1T44 A;  4DQP A;  1XI1 A;  2P9S B;  3D2F A;  1HYV A;  3RSE A;  1GLC G;  2YKN A;  4A62 A;  1IG9 A;  5HP1 A;  1RT3 A;  2QI2 A;  4CK3 A;  4IDK A;  3NH1 A;  4B3M K;  4F2R A;  4JI6 K;  1QS4 A;  1SKW A;  2IS3 A;  4NLC A;  3TSP A;  1O1W A;  4HTL A;  3O1B A;  4CF1 A;  4JD2 A;  1WNS A;  4CFA A;  4K8Z A;  2V51 B;  4BR7 A;  1DGK N;  3VQ4 A;  5JLH A;  3ENB A;  3MCP A;  1NKC A;  3U3G A;  2VQE K;  3ZSQ A;  1VSE A;  2CGJ A;  1NLV A;  1HNV A;  3U9D A;  3MN6 A;  1N5Y A;  4GVM A;  3T7Z A;  3SPZ A;  3ID6 A;  3D7E O;  1K8K B;  4CER A;  4UY8 O;  3A5M C;  1WOQ A;  4CGI A;  5HOO A;  3DOL A;  1HLU A;  3OYI A;  1CZ9 A;  3OTO K;  3WNF A;  4E1M A;  4IWV A;  5F1X A;  4CJL A;  4DFJ A;  3WNE A;  5I3U A;  3VQ6 A;  5BRD A;  4BAC A;  1HNW K;  2GEM A;  1VQO N;  4YOY A;  2OPS A;  2O8F A;  3CMA N;  3OYE A;  4RW4 A;  3OS2 A;  4FJ8 A;  1EO1 A;  4JKH A;  4CF2 A;  1E3M A;  3C7N A;  5BPM A;  3VGL A;  2EHG A;  4X65 K;  5E41 A;  3L2W A;  2W6L A;  5BPN A;  1JCE A;  1RT7 A;  4FWN A;  3PX0 A;  1GLA G;  3B6P A;  1JLA A;  4FJH A;  4PL8 A;  4M3T A;  1VQ9 N;  2ASM A;  2FC0 A;  4CBU A;  3CC7 N;  3V1O A;  3IS9 A;  1C0T A;  3PSI A;  1EP4 A;  3L3V A;  2BUP A;  4F4K A;  4JKA A;  1KLN A;  3H3O B;  5KPZ A;  4CVN E;  1X9M A;  2FF6 A;  3HRG A;  3THW A;  3DLK A;  4DQR A;  2HBJ A;  3AAP A;  5AQI A;  1NOZ A;  5EY4 A;  4GV9 A;  2RE2 A;  1VQM N;  2JWL A;  4IO8 A;  3P83 D;  2ZJQ L;  1ZBU A;  4BR0 A;  1QQC A;  3RVC A;  2HHW A;  3SYZ A;  2NRZ A;  5AQU A;  4DQS A;  4DQ8 A;  1YI2 N;  5GIN A;  3CPW M;  2QWM A;  3ZCM A;  2QWO A;  2HBM A;  3THY B;  4O4G A;  4RG8 A;  4CJE A;  4LF6 K;  3QIP A;  4H8K A;  2JWK A;  5C25 A;  1BA1 A;  4EP5 A;  4OPA A;  1BCO A;  4FK0 A;  2E5L K;  3VQE A;  4JI2 K;  2BH1 A;  4BRF A;  2W40 A;  3T19 A;  3PIP L;  2J4R A;  1T7P A;  3LWM A;  1CZA N;  3V9X A;  3VEY A;  5GIP A;  1KCF A;  3MEG A;  4RTF D;  4CEB A;  1JJ2 M;  4HCB A;  1MWK A;  1EXQ A;  1NK8 A;  4CEZ A;  4OKK A;  2ZM6 K;  1YUW A;  1S5J A;  1RCH A;  5ADX A;  4YOU A;  3L2U A;  3BZK A;  4IO9 L;  4BC3 A;  3MX5 A;  4DLG A;  4NCA A;  4B9M A;  1F21 A;  1RFQ A;  2V52 B;  4CZF A;  4C8O A;  4CZM A;  2YKM A;  4DR2 K;  4CZK A;  4FJJ A;  4PWD A;  3C6T A;  4LY7 A;  4BRM A;  3ZT0 A;  1A5V A;  1VSJ A;  2XY8 A;  4YHH K;  4BR5 A;  4CFC A;  3CCV N;  4DTR A;  5J2P A;  4PUO A;  1WAJ A;  2HMI A;  3ZET B;  4LH5 A;  5KTQ A;  3WXM B;  4FW1 A;  2O8C B;  1TKZ A;  2HVH A;  1WUA A;  1SKR A;  4M3Z A;  1XNR K;  1T3V A;  2HBL A;  2E4L A;  4CHP A;  1NK9 A;  4CIF A;  4OX9 K;  2HNY A;  1JL1 A;  4NCB A;  4DTX A;  2YHB A;  4LD0 A;  4E7L A;  4H0P A;  2WBN A;  5EXW A;  4IG3 A;  3TSU A;  4RWT A;  1SL2 A;  3O80 A;  1K9M O;  2D5R A;  1ZBS A;  4W5O A;  2E88 A;  3VQ5 A;  5AQP A;  2Q2R A;  1Q81 O;  1MA9 B;  3OA9 A;  3DLR A;  1VQP N;  4CJW A;  1TAU A;  1LAV A;  4H5N A;  4E1N A;  3S41 A;  4CGG A;  3K2P A;  4C8M A;  4YOX A;  1NM1 A;  5MLC Q;  3KTQ A;  1Q8I A;  1WSI A;  4ZTF A;  2CH5 A;  3MDQ A;  2G8K A;  3IMX A;  4K43 A;  3P39 A;  2UXD K;  1NK5 A;  5KRT A;  1KVB A;  3QLH A;  4CJS A;  1YF5 L;  4KH5 A;  1VSL A;  4PKH A;  1JLF A;  4ZHR A;  5BR9 A;  3LP1 A;  1JCF A;  1IJJ A;  4PY5 A;  4WQ5 C;  4BRQ A;  2XHB A;  1HQE A;  2GBZ A;  5C15 A;  5LMU K;  1NJX A;  4CZE A;  1J53 A;  4CHO A;  2FBT A;  2NLX A;  4E3S A;  5ELZ A;  1NGJ A;  4CBW A;  4DR6 K;  1U49 A;  4DTS A;  4A61 A;  3RR7 A;  1KTQ A;  1L3S A;  4F9O A;  1TKD A;  3NHG A;  1SL1 A;  3QB0 A;  3RTV A;  5FPD A;  5M1O A;  3TAE A;  2Q1N A;  4DV6 K;  1HR0 K;  2WFB A;  1KSP A;  2VGM A;  1VSH A;  3CJ9 A;  3ULE A;  4O44 A;  1JLG A;  2X78 A;  1B92 A;  4FL9 A;  4LF7 K;  4LFC K;  2QA4 N;  3F2K A;  3ZT3 A;  3U3Y A;  4M7Y A;  1P90 A;  3VEV A;  2P9P B;  5JVH L;  4CEA A;  5AQS A;  5EU7 A;  3CCR N;  2O8E A;  5DM6 L;  1W0H A;  3UKU B;  3O3H A;  3F73 A;  1FW6 A;  4PKG A;  5AFU A;  3L2V A;  2NUB A;  5C24 A;  5C2D A;  4W5R A;  4FLY A;  1FKO A;  3OJS A;  4ILH A;  2PYL A;  5SZT A;  1S1V A;  4FWL A;  3KK1 A;  3JS6 A;  1RT1 A;  3HST B;  4FOI A;  4CJP A;  3S3O A;  5I42 A;  3V9Z A;  2G8U A;  1S1T A;  3VGK A;  3DRP A;  4PQU A;  3V81 A;  4CD1 A;  3T3F A;  1TK8 A;  1MWM A;  4CEC A;  2BDP A;  3J7Y P;  1XMQ K;  5JLF A;  3M6G A;  3V4I A;  1LWC A;  4RW6 A;  3H6E A;  4IDH A;  4CFD A;  4JEP A;  1RTJ A;  2VG5 A;  2Z1G A;  5AQR A;  3JAM O;  4CZJ A;  3CPE A;  1BG3 A;  4O8U A;  2FXU A;  3H45 C;  2P9L A;  3G25 A;  4RW9 A;  3M3Z A;  3T1Y K;  1XNQ K;  4ILG B;  3O3F A;  3NVK A;  1SZ2 A;  1C0G A;  4X64 K;  3CFO A;  2VCP A;  1X9W A;  3WQT A;  4B1U B;  3ZET A;  4CJF A;  4EHT A;  3VET A;  1HKB A;  4DV1 K;  3AVA A;  3NF9 A;  4O8K A;  1V4T A;  4EIA A;  5FRM A;  5CYQ A;  4DCH A;  1YVU A;  4AHT A;  4FWR A;  4K8X A;  1TK5 A;  2WOM A;  3SK3 A;  4A5A A;  5C12 A;  1W9H A;  1KVC A;  4ZTJ A;  2PBD A;  2RKI A;  3WXK A;  1SQK A;  2DPN A;  4DU1 A;  1KFS A;  1Q82 O;  1KXP A;  4CHY A;  5AQH A;  2ZWH A;  5AQV A;  4DWI A;  3PUF A;  1CLQ A;  2UXC K;  2YJF A;  3MWT A;  4JKF A;  3H3N O;  4DKW A;  4AHU A;  2FF3 B;  1QHA A;  4KHY A;  2XY5 A;  1TAQ A;  3EKU A;  3H1V X;  3AV9 A;  4DB3 A;  4AH9 A;  4CEF A;  4FJM A;  4BRI A;  4BRH A;  1GOB A; 
#chains in the Genus database with same CATH homology
 5FDL A;  2P51 A;  3SQ0 A;  4C8L A;  3AO5 A;  1XI1 A;  4DQP A;  1RBR A;  4IBN A;  4Q5V A;  3KLE A;  3NAE A;  3AO1 A;  1HYV A;  1T05 A;  4CK2 A;  3MED A;  3KKS A;  4CES A;  3ZSY A;  4CGF A;  1REV A;  2YKN A;  1IG9 A;  1BQN A;  3QEV A;  1Q9X A;  5HP1 A;  1RT3 A;  3LAN A;  4DTU A;  3AVF A;  4KHN A;  1QE1 A;  2D0B A;  4CK1 A;  4CK3 A;  2KZM A;  3QEI A;  4IDK A;  3NH1 A;  1U4B A;  3NDK A;  2XRI A;  4F2R A;  4F8R A;  4FLZ A;  1BI4 B;  1QS4 A;  3QIN A;  1SKW A;  4M45 A;  4FM2 A;  2IS3 A;  4KHQ A;  2ITG A;  1B9D A;  4WE1 A;  4Z4I A;  3AO2 A;  1O1W A;  2X6N A;  4CF1 A;  2DFE A;  4CFA A;  1WNS A;  5CY4 A;  4HUG A;  3TI0 A;  5K14 A;  4K8Z A;  4N47 A;  2KW4 A;  3S3N A;  3VQ4 A;  4FLV A;  2G8F A;  3AVJ A;  1R0A A;  3RWU A;  4JS5 A;  1NKC A;  2O4I A;  3KLF A;  3SUN A;  3AVM A;  4ID1 A;  3U3G A;  2VG7 A;  4CCH A;  3I0S A;  2IOC A;  3ZSQ A;  4F3O A;  3U6F A;  1VSE A;  3TAF A;  1ZBH A;  1EET A;  3AO4 A;  3TAP A;  2A1R A;  2FBX A;  4E89 A;  4CGD A;  2OPP A;  1HNV A;  3D45 A;  3WNH A;  1D9F A;  4E0D A;  3V9W A;  1N5Y A;  3AVG A;  1BCM A;  1EX4 A;  3NF8 A;  4GVM A;  4JLH A;  3SPZ A;  1S9G A;  3TR8 A;  3OS0 A;  4OPJ A;  3NBP A;  3VQP A;  4CER A;  4Z0U A;  1J9A A;  3AA4 A;  1T03 A;  5J2M A;  2W42 A;  4Y1D A;  3PX6 A;  4CGI A;  4BDY A;  1QSS A;  3DOL A;  3MEC A;  2YHA A;  4I2Q A;  1NJZ A;  4KI6 A;  3CM6 A;  4HCC A;  2VWJ A;  3OYI A;  1CZ9 A;  2QK9 A;  4FM0 A;  4DLE A;  1C0M A;  4B9U A;  1SKS A;  2LSN A;  3WNF A;  3TAM A;  4E1M A;  1RDB A;  1UAX A;  2RPI A;  3T1A A;  3VA0 A;  1VRU A;  2Z1J A;  4CJL A;  4DFJ A;  3WNE A;  4CJ4 A;  3CYM A;  4CHN A;  2F8T A;  4UQG A;  5I3U A;  3VQA A;  4FM1 A;  3VQ6 A;  3NF7 A;  3NH0 A;  1RTD A;  1QHT A;  1X1P A;  4BAC A;  4EZ9 A;  3SCX A;  1FKP A;  1SV5 A;  2D0A A;  2OPS A;  4DS4 A;  3OY9 A;  4I9Q A;  4BE2 A;  2F8S A;  3OYE A;  4RW4 A;  3DM2 A;  3OS2 A;  4FJ8 A;  4CF2 A;  1UOC A;  4JS4 A;  3IRX A;  4B9L A;  1L5U A;  4KB1 A;  1JL2 A;  2EHG A;  5E41 A;  3CG7 A;  2E6L A;  2ZD1 A;  3NGY A;  5SWM A;  1RT7 A;  3L2W A;  2PY5 A;  2OZS A;  3PX0 A;  2KFZ A;  1BIZ A;  2QXF A;  3B6P A;  3F9K A;  3ZSZ A;  4YNQ A;  2HW3 A;  4NCG A;  1JLA A;  3OYD A;  4FJH A;  3KK3 A;  4M3T A;  3QER A;  3ZSW A;  1S1U A;  3JYT A;  4CEE A;  2FC0 A;  4AHR A;  4AHV A;  5J2N A;  4OGC A;  1S9E A;  3NH2 A;  1FK9 A;  2ZQB A;  3V1O A;  4I2P A;  3IS9 A;  2BE2 A;  1UWB A;  1C0T A;  4GW6 A;  4KTQ A;  3VQC A;  3SJJ A;  5KRS A;  1EP4 A;  1WLJ A;  3DRR A;  1BGX T;  1TL3 A;  3L3V A;  4F4K A;  1VRT A;  4IG0 A;  1KLN A;  3EZ5 A;  4FLU A;  4MFB A;  1GOC A;  4OPK A;  3EYZ A;  4DTP A;  4DTN A;  3DOK A;  1X9M A;  4IFV A;  3QEX A;  1B9F A;  3DLK A;  4DQR A;  4DU4 A;  5CZ1 A;  2X6S A;  3OYJ A;  3OYG A;  3OYH A;  3MXI A;  1NOZ A;  3HXM A;  1IO2 A;  3HL8 A;  1WSG A;  4J2D A;  1CXU A;  2XY7 A;  2PYJ A;  2FBY A;  2G8W A;  1RBV A;  4C8N A;  3P83 D;  1C0U A;  4ELT A;  4FW2 A;  4DSJ A;  4EZ6 A;  1RBS A;  3G0Z A;  1ZBU A;  4AIL C;  1WAF A;  4RW7 A;  1A5W A;  3AVN A;  1TKX A;  4CJ5 A;  4HUE A;  1NK7 A;  1NKE A;  1QQC A;  2HHW A;  3SYZ A;  3SUP A;  1RIL A;  4DQS A;  1VSD A;  2Z1H A;  3DMJ A;  1BL3 A;  3HVT A;  2G8V A;  2HHS A;  3V1R A;  3MXM A;  4DU3 A;  3MXJ A;  2DFF A;  2HHV A;  3OYL A;  3ZCM A;  3SQ2 A;  1BQM A;  3LP2 A;  2GUI A;  3TAN A;  3PO4 A;  4FZX C;  3AA2 A;  4O4G A;  4RG8 A;  4AHC A;  4CJE A;  3OYA A;  3LAM A;  3QIP A;  4H8K A;  3LZJ A;  1IKY A;  5C25 A;  3V1Q A;  1KFD A;  1S6P A;  4BWM A;  4EP5 A;  1C1B A;  1BCO A;  4FK0 A;  4KHW A;  4QOZ B;  3VQE A;  1HQU A;  4NYN A;  4Z4F A;  1I3A A;  2PZS A;  2EX3 A;  4Y1C A;  1RDD A;  3T19 A;  3HM9 A;  4FLT A;  4DSL A;  3AVB A;  2HB5 A;  3LWM A;  1T7P A;  3AA3 A;  4M3U A;  3V9X A;  4W5Q A;  3D0P A;  4CE9 A;  3PO5 A;  4EP4 A;  3HVR A;  2Y1I A;  4B9N A;  4CJ3 A;  2HHT A;  3RMA A;  1K6Y A;  4LSN A;  1WN7 A;  3ULD A;  1KCF A;  4FJG A;  4OVL A;  1RT4 A;  3MEG A;  1KVA A;  4CEB A;  4HCB A;  1JXE A;  1EXQ A;  1NK8 A;  4L8R B;  3HO1 A;  3ASM A;  3DLE A;  4M3Y A;  1HMV A;  4CEZ A;  4CFB A;  4OKK A;  1ZBL A;  2B6A A;  1T8E A;  4LSL A;  4KAZ A;  4O0I A;  4OJR A;  1S5J A;  4Z4H A;  1RCH A;  1UA0 A;  4B9S A;  3B6O A;  3L2U A;  4OGE A;  3NGZ A;  4KHS A;  4DLG A;  1JKH A;  1KLM A;  3V6D A;  3WNG A;  3I8D A;  4FZY A;  3KK2 A;  4NCA A;  2YNG A;  4B9M A;  1YT3 A;  3HJF A;  3ZT4 A;  1F21 A;  4C8O A;  3RRH A;  3DLB A;  2YKM A;  3AO3 A;  4DF8 A;  4R5P A;  2O4G A;  3K5L A;  3K58 A;  4FJJ A;  4KI4 A;  2B4J A;  3VQB A;  3NCI A;  1U47 A;  4PWD A;  3C6T A;  4LY7 A;  4E7I A;  4FJ5 A;  4IKF A;  4DMN A;  3QIO A;  3ZT0 A;  3ZSX A;  4FJI A;  1I39 A;  2X74 A;  1DTT A;  1A5V A;  3LDS A;  1VSJ A;  2XY8 A;  4KTW A;  3HP6 A;  3S9H A;  4LH4 A;  4QAG A;  4AHS A;  2P5G A;  4CFC A;  4DTO A;  3QNN A;  2XY6 A;  4DTR A;  5J2P A;  4OLA A;  5FRO A;  4W5N A;  4PUO A;  1WAJ A;  3C94 A;  4FZZ A;  1HYZ A;  4W5T A;  3KKR A;  2HMI A;  3ALY A;  1C1A A;  4LH5 A;  5KTQ A;  2KZZ A;  4FW1 A;  3VQ8 A;  1J54 A;  1TKZ A;  4JRQ A;  4DTM A;  1SUQ A;  4ELU A;  2HVH A;  3OJU A;  1SKR A;  1NK4 A;  4M3Z A;  4CHP A;  2E4L A;  4ICL A;  4IFY A;  1ZYQ A;  1JLC A;  5HRR A;  1ASV A;  3AVI A;  3QNO A;  2QKK A;  1NK9 A;  2P5O A;  4CIF A;  2HNY A;  1JL1 A;  2R7Y A;  4DTX A;  3SQ4 A;  1DLO A;  3O4N A;  2YHB A;  4FJL A;  4NCB A;  1TL1 A;  3OYC A;  4LD0 A;  4E7L A;  3KD1 E;  4FK2 A;  1JLE A;  4IG3 A;  3NGI A;  1SL2 A;  2D5R A;  4W5O A;  3BGR A;  1XC9 A;  2DY4 A;  3VQ5 A;  1JLB A;  2XO7 A;  1S1W A;  3QET A;  3SNN A;  4PA1 A;  3AVK A;  1QTM A;  2FBV A;  3DLR A;  4FLW A;  2HVI A;  4CJW A;  1RTH A;  3FFI A;  1ASW A;  1XHX A;  5KGW A;  1LAV A;  4M41 A;  1TAU A;  4E1N A;  3OVN A;  4CGG A;  3SV3 A;  3K2P A;  4C8M A;  4I9L A;  3CQ8 A;  1L3U A;  4B9T A;  3CFP A;  3AVH A;  4C8K A;  1HJR A;  3KTQ A;  3V9U A;  4FYD A;  1Q8I A;  1LW2 A;  1WSI A;  4Z4C A;  3P5J A;  5CZ2 A;  4ZTF A;  4N5S A;  2G8H A;  4CF9 A;  2G8K A;  3CFR A;  4J2B A;  3HPH A;  1NOY A;  2YNI A;  1RBU A;  1TVR A;  3G10 A;  3OYN A;  4B8A B;  1NK5 A;  5KRT A;  1UA1 A;  3KLH A;  1KVB A;  3QLH A;  4ELV A;  4CJS A;  4E7J A;  4I7F A;  3KIO A;  4M3R A;  4FJK A;  2I5J A;  3RRG A;  1EKE A;  4M3W A;  3RR8 A;  1VSL A;  2IGI A;  4KKO A;  1JLF A;  2YNF A;  3MEE A;  2Q3S A;  3VA3 A;  4CJR A;  4ZHR A;  5HRS A;  1NK0 A;  3LP1 A;  4CGJ A;  4BE0 A;  1NKB A;  3IAY A;  2HHQ A;  4E19 A;  4PY5 A;  1RTI A;  2VG6 A;  3K5N A;  3DLG A;  4HUF A;  2XHB A;  1HQE A;  4QCL A;  2GBZ A;  3K59 A;  3M8S A;  1NJX A;  3SUO A;  4CJK A;  1J53 A;  5J2Q A;  4CHO A;  1L3V A;  4B3O A;  2FBT A;  2JGU A;  4Z4G A;  1A5X A;  5HRO A;  2YV0 X;  3QES A;  5D3G A;  1WSE A;  3CM5 A;  4OKJ A;  4E3S A;  4KPY A;  4E7K A;  1N6Q A;  1RT6 A;  4CJQ A;  1U49 A;  2QKB A;  1RT5 A;  2HND A;  4CHZ A;  3LPT A;  4CJV A;  4DTS A;  4Z4E A;  4N56 A;  3RR7 A;  1TV6 A;  1KTQ A;  3NF6 A;  4FVM A;  1L3S A;  3QEP A;  3S3M A;  2E6M A;  1TKD A;  4N76 A;  3KLI A;  1LWE A;  3NHG A;  1SL1 A;  1D8Y A;  3RTV A;  2WON A;  1GOA A;  3E01 A;  4KFB A;  4HHT A;  3TAE A;  2KFN A;  1U48 A;  4F3T A;  4DG1 A;  3L3U A;  4KV8 A;  2IDO A;  3BDP A;  1NJY A;  3DLH A;  4DTJ A;  4DFM A;  1KSP A;  1J5O A;  1VSH A;  1RNH A;  1CXQ A;  1L3T A;  1JLQ A;  4O44 A;  1Q9Y A;  3K5O A;  1LV5 A;  4DSI A;  4B9V A;  1JLG A;  2GV9 A;  3SV4 A;  2YNH A;  2HHX A;  1JXB A;  2OPQ A;  2X78 A;  1B92 A;  3JSM A;  1HYS A;  3SQ1 A;  1VK0 A;  4H4M A;  3ZT3 A;  3U3Y A;  4HVJ A;  5J1E A;  4KHU A;  4FK4 A;  3L2R A;  1SL0 A;  1HNI A;  4FJ7 A;  3DYA A;  1XHZ A;  3TAQ A;  1QSY A;  4BDP A;  4DQI A;  3L2Q A;  2Z1I A;  3IG1 A;  3THV A;  1HRH A;  4CEA A;  4RW8 A;  3TAR A;  2Y1J A;  1KRP A;  4DS5 A;  3LP0 A;  5EU7 A;  2KTQ A;  1IKV A;  3VQQ A;  4KRF A;  1HPZ A;  4XIU A;  3VQ7 A;  1W0H A;  1LAW A;  3O3H A;  2F96 A;  4CEO A;  4CF8 A;  2OPR A;  2ETJ A;  3F73 A;  4M3X A;  3HPG A;  3KLG A;  2DTU A;  3L2V A;  2NUB A;  5C24 A;  4W5R A;  4FLY A;  3RMB A;  1MU2 A;  1FKO A;  4CIE A;  4TSX A;  3TWH A;  3OJS A;  3I0R A;  1YTU A;  2PYL A;  1ITG A;  5SZT A;  1D9D A;  5CYM A;  1S1V A;  3KK1 A;  1RT1 A;  3AVC A;  1TGO A;  3HST B;  3ISN C;  4CJP A;  3SUQ A;  3S3O A;  1G15 A;  2OZM A;  3C95 A;  5I42 A;  4KTZ A;  3V9Z A;  2G8U A;  4B08 A;  1S1T A;  2HHU A;  3QEW A;  5JS1 A;  1IKW A;  3DRP A;  4DQQ A;  4ID5 A;  4FJ9 A;  1RBT A;  4O55 A;  3VQD A;  4PQU A;  2DFH A;  4FXD A;  1BI4 A;  4FJN A;  3V81 A;  4KRE A;  3M8P A;  3PY8 A;  3T3F A;  3TAB A;  1TK8 A;  4CEC A;  4CEQ A;  2BDP A;  3EY1 A;  1X9S A;  4J2E A;  4GMJ B;  3ZT1 A;  4CED A;  3V4I A;  1LWC A;  4RW6 A;  5JS2 A;  4CFD A;  4B8C A;  1RTJ A;  2VG5 A;  1U04 A;  4CGH A;  2Z1G A;  5DMR A;  4E7H A;  1ASU A;  4M42 A;  3DRS A;  1CZB A;  3AA5 X;  4CJU A;  1NJW A;  2A1S A;  1Y97 A;  5HBM A;  5HLF A;  3OYF A;  4CF0 A;  1WSJ A;  4BDZ A;  3UIQ A;  4DFP A;  1BIS A;  2RN2 A;  1FXX A;  1S1X A;  3ZT2 A;  5HRP A;  4OLB A;  3LWL A;  2D0C A;  5KGX A;  1D5A A;  3HYF A;  1VSM A;  4OKE A;  3KJV A;  4RW9 A;  3NE6 A;  1ZBI A;  3NFA A;  4KO0 A;  4KB0 A;  3PX4 A;  4O5B A;  3OYM A;  3O3F A;  3HP9 A;  2IC3 A;  4BWJ A;  5C42 A;  4DSE A;  3VN5 A;  1C6V A;  1RT2 A;  3CFO A;  4F2S A;  1WSH A;  1RDC A;  3TAG A;  4YFU A;  1X9W A;  1VSI A;  3H08 A;  5DK5 A;  1Z25 A;  1YTA A;  3ZSO A;  3OS1 A;  3KD5 E;  1NK6 A;  4CJF A;  2ATQ A;  2JLE A;  2ZE2 A;  3AVL A;  4BE1 A;  3ZSR A;  3AVA A;  3NF9 A;  4HTU A;  1IKX A;  1XWL A;  3QO9 A;  4CHQ A;  3PV8 A;  3L8B A;  3HT3 A;  4DSK A;  5CYQ A;  5FRM A;  2AJQ A;  3RMC A;  1LW0 A;  4J2A A;  2OA8 A;  5KI6 A;  4FCY A;  3RMD A;  3HK2 A;  1Z26 A;  3ITH A;  1YVU A;  4AHT A;  1BIU A;  1VSK A;  3P1G A;  5T7B A;  4K8X A;  1DTQ A;  1TK5 A;  2OYQ A;  3SZ2 A;  1QSL A;  2WOM A;  1S6Q A;  3DI6 A;  1W9H A;  1KVC A;  1ZBF A;  4NYF A;  4ZTJ A;  1IH7 A;  4DF4 A;  4DFK A;  2RKI A;  3SPY A;  4MQ3 A;  3K5M A;  2BAN A;  2HNZ A;  2P1J A;  3M8Q A;  4DU1 A;  1LWF A;  1KFS A;  4Q0B A;  3LAL A;  4N41 A;  3HPO A;  3M8R A;  3V9S A;  1RDA A;  3O4Q A;  4CJT A;  4CHY A;  5HRN A;  3MAQ A;  3SI6 A;  3ZSV A;  4DWI A;  3OYK A;  3LPU A;  2VWK A;  3PUF A;  2RF2 A;  3O3G A;  4FLX A;  4CIG A;  1CLQ A;  4FJX A;  3LZI A;  4JRP A;  2G8I A;  3C6U A;  2KQ2 A;  3A2F A;  3LAK A;  4AHU A;  3OYB A;  1BHL A;  1C1C A;  2IAJ A;  1U45 A;  2BGG A;  4KHY A;  2XY5 A;  1TK0 A;  2B5J A;  4G1Q A;  1TAQ A;  3K57 A;  4DSF A;  3AV9 A;  1VSF A;  1TKT A;  5FRN A;  3LP3 A;  1WSF A;  4H4O A;  4O0J A;  4AH9 A;  3VQ9 A;  4CEF A;  4FJM A;  1GOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...