1RDAA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTNGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdaA00
3H08A 3L2QA 1L3TA 3SZ2A 4CECA 2R7YA 1NK7A 4KHNA 4O4GA 4CJRA 3QEVA 3TWHA 1JXEA 3DOLA 1QQCA 5KI6A 4KRFA 4C8OA 4KB1A 3QLHA 2G8FA 4DQPA 1BIZA 5JS1A 3CM6A 4O55A 3KTQA 3L8BA 4AHVA 3I0SA 2QK9A 4HTUA 1YTUA 4DTNA 4BE2A 1BCOA 2E6MA 2XY6A 1C1CA 2OPRA 4J2BA 1JLBA 2YV0X 5KGXA 2B6AA 3KLEA 1U04A 1IG9A 4DSJA 4E1NA 1VSKA 3QIPA 1RILA 3AVHA 3HVRA 3RTVA 3WNGA 2HNZA 4L8RB 4NCBA 5D3GA 3NF8A 2VWKA 1SV5A 2D0BA 2RF2A 1GOAA 3HYFA 4AILC 2OZSA 4BDZA 4DQQA 3PY8A 5HRRA 1QTMA 1WSGA 4JRPA 3LP2A 4OPKA 2W42A 4FM1A 3TARA 1KCFA 3BDPA 3HPOA 1ZBFA 4PWDA 2X78A 1IKWA 3DMJA 4DFPA 4CIEA 5C42A 3C94A 4CGHA 1CZBA 4UQGA 4B3OA 3VQ9A 4AHSA 1LWFA 3HP6A 3F73A 4DLEA 4E7JA 3RRGA 1U47A 2YNGA 4CESA 2Z1IA 4CK3A 4KKOA 4HUFA 1ZBLA 1Q9YA 2OZMA 4W5NA 2DFHA 4OLAA 1KFDA 3AVMA 1HYZA 3G10A 4E3SA 5HLFA 3L2RA 4JS4A 3OYKA 4FJ5A 1NK4A 1TKZA 3SUQA 1NKCA 2FC0A 3VQ7A 1RBUA 1TGOA 2XO7A 3MXIA 5CYMA 5SZTA 3LPTA 3SV4A 4B9NA 4KB0A 3V81A 2HHXA 3DLRA 1NOZA 3AO3A 4O44A 4CK1A 1CXUA 3C6UA 4CJUA 3QEPA 1S9EA 3NCIA 5J2QA 4M3ZA 1SKWA 1TK0A 2YHAA 3V1QA 3KD1E 4F8RA 4C8KA 3VQCA 3TR8A 4M3WA 1A5XA 1JLGA 1ZYQA 4OGEA 2IAJA 3IG1A 3ITHA 1RTIA 4CGDA 3JSMA 2PY5A 1CLQA 4FW1A 1ZBIA 3KLHA 3K5LA 1RT5A 4I2QA 2RN2A 2XY8A 4DTRA 3DOKA 2B5JA 2KQ2A 3VA0A 1EP4A 4DQIA 3S3NA 3SPZA 3LALA 3E01A 4CJVA 3NH2A 1NK9A 2AJQA 3VQEA 4FYDA 4FW2A 4CF8A 5HRNA 3AA4A 3OY9A 4WE1A 4OKKA 4B08A 2F8SA 2VG6A 4FVMA 3WNHA 1KRPA 1REVA 1QSLA 2EHGA 1ASWA 3OYMA 3L2WA 2Y1JA 2OYQA 4CIFA 3V9WA 3HL8A 1X1PA 1Z25A 2Z1JA 3HT3A 2KFNA 4LSLA 3RMDA 4LY7A 1DLOA 3AVKA 3A2FA 4K8ZA 1J9AA 3KLFA 1IKVA 3LP0A 3AV9A 4FCYA 4B9UA 1HMVA 4M3YA 2KTQA 3VQPA 4ZHRA 4CJTA 4E19A 5HROA 4ELVA 3NDKA 4DS5A 4DFJA 1T8EA 1RT6A 4Y1CA 1J5OA 4FJJA 1LWCA 4RW8A 4M3RA 4NYNA 1SUQA 3DRRA 3VQ5A 3VQQA 4F2RA 1IO2A 4JS5A 4DQSA 1UAXA 3T3FA 1D9DA 3NF6A 3O3HA 2G8UA 3MECA 2A1RA 1ZBHA 2BGGA 1UA1A 1NK5A 1JKHA 1VSJA 5J1EA 4FJ7A 3AVBA 3THVA 4AHTA 3CM5A 1JLCA 1XI1A 4IKFA 2ITGA 4RW6A 1S5JA 1VSEA 4N56A 1VK0A 3S3OA 5SWMA 4FJMA 3ZSVA 1U48A 1WSHA 3IS9A 3F9KA 1DTTA 3SNNA 3O4QA 2ATQA 2IOCA 3MEGA 4Q5VA 3QEWA 3RMAA 4M42A 1S1WA 2IGIA 5KGWA 1BIUA 1C6VA 1VSDA 3K58A 4QOZB 2HW3A 1KLMA 1KVAA 4CGFA 3OYHA 4CHQA 1RDCA 3RMBA 1YTAA 4W5TA 2P5OA 3PV8A 1HYSA 4LD0A 2EX3A 1JXBA 3OYDA 3OYCA 3QETA 1LWEA 1FK9A 1RTJA 1FXXA 3QERA 3TI0A 1C1BA 1N5YA 5FRNA 4ID5A 4Z4FA 1SL0A 5EU7A 3V1OA 4FM2A 2GUIA 4CHZA 3SQ4A 1A5WA 4NYFA 1B9DA 4FJLA 3AO5A 3OS1A 3MXJA 4CFDA 3SUNA 1D8YA 2Q3SA 3ALYA 3TAFA 4ELUA 4CEFA 3VQDA 4CF2A 4OJRA 4FJ9A 1BGXT 3VN5A 1KFSA 3ZSOA 4KTZA 4CGJA 4CJ3A 1WSIA 1S1VA 1SKSA 1T03A 1KSPA 4J2EA 2YKNA 4CJQA 3AO1A 3OYBA 3V9XA 2BANA 3EY1A 4DG1A 4LH4A 2WOMA 4DS4A 4YNQA 1C1AA 1SKRA 3FFIA 4PA1A 3DLGA 3LP3A 3KK2A 3HPGA 4FM0A 3RRHA 3TAGA 3ZSRA 1RT7A 3NFAA 3EYZA 3NHGA 5HP1A 1KTQA 1W0HA 1GOBA 2IDOA 4J2DA 4DSIA 1ZBUA 4Z4CA 4IDKA 3P83D 5I42A 4FZYA 3K5MA 1S6PA 4KTWA 4BDYA 1Z26A 3ZT2A 3OJSA 4E7HA 3HO1A 4I9LA 4JLHA 1UOCA 2HVIA 4CFAA 4CEDA 2RKIA 2BDPA 5HRPA 3MEEA 4QAGA 5J2MA 3AVGA 3LAMA 4N41A 4H4MA 4FXDA 2X6NA 3OYIA 3QEXA 3AVLA 4E89A 1L3VA 4CGGA 4FK4A 4FK0A 3NH0A 2HHWA 1G15A 1Q9XA 3OYFA 4CFBA 3VA3A 1RBTA 1L3UA 4G1QA 3KK1A 3ZSXA 4FLXA 3HXMA 4W5OA 4RW9A 4BACA 1EXQA 3CYMA 5C25A 3C6TA 4EZ6A 1RT4A 2A1SA 4I2PA 4CF1A 1ITGA 3SCXA 1HQEA 1BHLA 4IG0A 1L3SA 3NF9A 4OKEA 4AHCA 4CEBA 4DWIA 2O4IA 3SPYA 5FDLA 4C8LA 4M3TA 1R0AA 1VRTA 5CZ1A 3BGRA 5T7BA 3V9SA 4KHSA 4OKJA 4R5PA 1XC9A 3B6PA 1TKTA 3AVJA 1DTQA 3QO9A 4IFVA 3OJUA 4DTXA 4F3OA 4FJIA 5CYQA 4KHYA 4FLZA 4DU4A 1C0MA 3TAQA 1ASUA 2WONA 3LP1A 3CQ8A 4DU3A 2HNYA 1Y97A 3DLKA 4LH5A 4EP4A 3I8DA 1C0UA 4CHNA 4JRQA 4IG3A 3SI6A 4KV8A 1XHXA 4E7LA 3K2PA 3ULDA 4ICLA 3HSTB 4ID1A 2QXFA 4EZ9A 4CEOA 4KI6A 1XHZA 4CJLA 3ZT3A 1A5VA 1QS4A 1U45A 4CEZA 4CJSA 3PX6A 1T7PA 1NOYA 4FJGA 5HRSA 4Q0BA 2HHTA 3D0PA 1JLFA 4DQRA 3ISNC 3LPUA 2PYJA 4KPYA 4H8KA 3CFRA 4DSEA 4CK2A 1CXQA 4DSFA 1X9SA 1KVCA 3VQ8A 2DY4A 1O1WA 4AH9A 4E0DA 4Z4HA 3SUPA 3K5NA 2HHQA 2FBTA 1X9MA 3QEIA 4CF0A 1RDAA 1BL3A 3NE6A 4CCHA 3HPHA 3QNOA 4BDPA 2HHVA 3OS0A 4HCBA 4CHOA 4E7IA 1QHTA 2Z1HA 4DF4A 4B8CA 4CEAA 1XWLA 1VSIA 5DMRA 4XIUA 3HVTA 1ASVA 3I0RA 1N6QA 3S9HA 4B9VA 2G8HA 2OA8A 1RDDA 1TAUA 2OPSA 5J2NA 1RBSA 3AVFA 3KIOA 3OYJA 3KLGA 1RBVA 4PUOA 4PY5A 4E7KA 4QCLA 1HQUA 2B4JA 2BE2A 1YVUA 1JLQA 4AHUA 3RMCA 4CE9A 4KFBA 4HUGA 1JLEA 3O3FA 4KHWA 1QSSA 1WSEA 1RTHA 2ZD1A 3QIOA 4HHTA 3EZ5A 1LV5A 3AA5X 4CJEA 2OPPA 4DF8A 3ZSYA 3AVIA 2LSNA 3UIQA 2XHBA 2O4GA 3M8SA 2E6LA 2ZQBA 3ZT4A 3M8PA 4OVLA 4KREA 3M8RA 3P1GA 2FBVA 5CZ2A 5E41A 1WAJA 3L2VA 2G8KA 3DLEA 3DLBA 3OYNA 1RNHA 1TL3A 1S6QA 3RR8A 3K59A 1TKDA 2X74A 5FRMA 4DTJA 2XRIA 2F8TA 1RBRA 1TAQA 2JGUA 1T05A 3DRPA 1UA0A 4Z4EA 3M8QA 4K8XA 1NJYA 2YNFA 4DU1A 1YT3A 4KHQA 3JYTA 4HCCA 3MXMA 4FJ8A 1JLAA 2NUBA 4C8NA 4CJWA 3C95A 4B9TA 4CIGA 2VG5A 3S3MA 3NGZA 3U6FA 3KKRA 2P5GA 4KHUA 3LZIA 2YNHA 4FLWA 4KO0A 4HVJA 1HYVA 1S1UA 3O3GA 4Z4GA 3LDSA 3LANA 3VQ4A 2ETJA 2GV9A 4CEEA 4CJPA 1GOCA 3PUFA 4DLGA 5KTQA 3CFPA 3OYLA 2P1JA 5J2PA 4F2SA 1HPZA 2YNIA 1UWBA 1IKXA 1BQNA 4CFCA 4M3XA 1WSFA 3D45A 3AA2A 1RT1A 4CJFA 4CJ5A 3VQ6A 1SL2A 1MU2A 1WSJA 4RW7A 4DTOA 1QE1A 1NJXA 4BE1A 1BI4B 3KJVA 5I3UA 4NCAA 4AHRA 4TSXA 4RG8A 2I5JA 3AO2A 5K14A 4FLVA 3V9UA 1WNSA 2KZZA 2HB5A 1VSMA 1C0TA 1IH7A 3OYGA 4FJHA 3ZCMA 2P51A 4W5QA 4CEQA 4Y1DA 4DTPA 1NK8A 3LZJA 2VWJA 1F21A 1RDBA 1I39A 4H4OA 4N76A 4W5RA 1TV6A 4GVMA 1QSYA 1U4BA 3LWLA 2IS3A 3ZSWA 3V6DA 2PZSA 2HVHA 1B9FA 4M45A 2OPQA 2X6SA 3AO4A 4CGIA 3OS2A 1CZ9A 3P5JA 1NJZA 1X9WA 1D9FA 2HHUA 2G8IA 4ELTA 4B9MA 4F3TA 2PYLA 1LAVA 3CG7A 3MEDA 3SQ0A 1HNVA 3KKSA 3ZT1A 2D0CA 3V4IA 4J2AA 2XY5A 1VSLA 3G0ZA 4Z4IA 1HRHA 4BWJA 4M41A 1RTDA 4FLTA 3PX0A 3DM2A 4ZTJA 4O0IA 4DSLA 4OLBA 1TK5A 3KLIA 4Z0UA 4OGCA 3TAMA 3AVCA 3B6OA 1B92A 4I7FA 4DTMA 3ZT0A 1KLNA 1L5UA 4HUEA 3K5OA 1S1XA 2Y1IA 3MAQA 3K57A 1BISA 3VQAA 3QESA 3U3YA 1JL2A 2XY7A 2HMIA 4GMJB 5JS2A 4YFUA 1KVBA 3ASMA 3HJFA 5HBMA 4MFBA 4F4KA 4KI4A 2DFEA 2IC3A 2Z1GA 4B8AB 3SV3A 3SQ2A 1U49A 3DLHA 4E1MA 3OVNA 3WNFA 3ZSZA 4I9QA 2E4LA 3PO4A 4CHPA 4IBNA 1VSFA 2JLEA 4OPJA 4KAZA 1EX4A 2F96A 1SL1A 3PO5A 3RWUA 1NK6A 5FROA 1LAWA 3NAEA 4PQUA 3HM9A 1RCHA 3RR7A 3IAYA 3T1AA 3OYEA 1S1TA 3NH1A 4KTQA 3NGIA 3L2UA 3SQ1A 1BCMA 4DTUA 1FKPA 1W9HA 3SJJA 5KRTA 2G8WA 1EKEA 1FKOA 4CERA 4B9LA 3HP9A 3HK2A 4IFYA 3V9ZA 4CJ4A 2VG7A 3DRSA 3TANA 1S9GA 4CJKA 4NCGA 3NGYA 3NF7A 4FLYA 3SUOA 3L3VA 1K6YA 1WN7A 3AA3A 4FZXC 1J54A 4N47A 4GW6A 2QKKA 3OYAA 3AVAA 1J53A 2G8VA 1TK8A 1NJWA 4CHYA 1VRUA 3QINA 4DFMA 4C8MA 3KD5E 1D5AA 4M3UA 3O4NA 2D5RA 5CY4A 2GBZA 3QNNA 3WNEA 4DSKA 3DI6A 3PX4A 4FK2A 2HNDA 4O5BA 1LW2A 4DMNA 3T19A 3TAEA 1NK0A 4MQ3A 2D0AA 2FBYA 1BQMA 3NBPA 1EETA 3SYZA 1I3AA 3VQBA 5C24A 2HHSA 4O0JA 3L3UA 4EP5A 4FJNA 2YKMA 1RT3A 3CFOA 1TL1A 4DTSA 3LAKA 1NKEA 3U3GA 5KRSA 1TVRA 1IKYA 1BI4A 4RW4A 4DFKA 2DTUA 2QKBA 4N5SA 1NKBA 1JL1A 1VSHA 4BE0A 1HJRA 3LWMA 4FJKA 2KZMA 1Q8IA 5DK5A 1WAFA 1WLJA 3V1RA 1RT2A 3ZSQA 1LW0A 3AVNA 3DYAA 2KW4A 2YHBA 3IRXA 2RPIA 2DFFA 3TAPA 4FLUA 2KFZA 3KK3A 1TKXA 4LSNA 4B9SA 1HNIA 2FBXA 4CF9A 4FJXA 4ZTFA 2ZE2A 4FZZA 4BWMA 3TABA
chains in the Genus database with same CATH superfamily
3SZ2A 4CECA 4KHNA 2A42A 2UXBK 4KRFA 3J7AP 2G8FA 3CD6N 3CM6A 3KTQA 4JKFA 2A3ZA 4CW7B 4AQYK 4DCHA 3O1WA 4DTNA 1ATRA 1X9JA 1C1CA 2YV0X 3DJCA 2B6AA 5JICA 4DSJA 4E1NA 3AVHA 2HNZA 4NCBA 4DR4K 2VWKA 1Q86O 5JVGL 1WOQA 4H5VA 1M90O 3LP2A 4LF5K 3TARA 1KCFA 1QQNA 3CERA 1ZBFA 3EEQA 4DFPA 4CGHA 1QQMA 3SK3A 4O8UA 5AQJA 4IWVA 2P9UA 2ZWHA 2YNGA 4YOVA 3MMVA 1VQ5N 3SAHA 1KFDA 3G10A 3ZEUA 3NVMA 5HLFA 1NJIO 3SUQA 4JKAA 5BRFA 4B9NA 3E1YA 5SZTA 1V4TA 3CIPA 4KB0A 4BR5A 2YHXA 3DLRA 1V4SA 4CK1A 3C6UA 4M63C 1BU6O 1YJ9N 4WF9L 4PKGA 4JI6K 4M3ZA 1TK0A 2UUCK 2P9IB 4JKDA 3EKSA 3D2EB 3ITHA 1RTIA 4CGDA 1CLQA 2E2QA 3K5LA 4I2QA 5AQRA 2RN2A 2XY8A 3DOKA 3VA0A 4AF1A 1EP4A 4CJVA 3O9UA 3NH2A 3UE5A 3MCAB 3J7YP 1NBWA 4LF4K 3UKUB 3OY9A 4PL7A 4OKKA 2EHGA 3L2WA 2Y1JA 3HL8A 1YF5L 3ZLJA 4BC3A 4LY7A 4FWQA 3WXJA 1HMVA 2KTQA 3VQPA 4E19A 3W0LA 1T8EA 1RT6A 4Y1CA 3LM2A 4FJJA 4H0OA 2IIRA 5C2DA 4OO1J 1SUQA 4F2RA 3ZX0A 3AARA 4CZJA 1YITN 4JI3K 4IJAA 1C0FA 4MLEA 3MECA 1ZBHA 1UA1A 2VGNA 4A61A 3JS6A 1NGBA 3THVA 4DKWA 1JLCA 4GY2B 1VSEA 4N56A 2E8AA 4EAHD 5SWMA 3F9KA 3O9RA 3THXA 3O4QA 5KPRA 3NMUA 3MEGA 3RMAA 1Q18A 3VEWA 1BIUA 4FOIA 4NLCA 4QOZB 3H45C 1WBDA 3O9TA 1KLMA 2UXDK 3HRGA 2Q0RA 4H0VB 3OHRA 3QETA 1FK9A 1W2BM 5FLXO 3CCUN 5AQZA 1SL0A 5EU7A 4FM2A 5BRDA 3AO5A 1HUXA 4CFDA 2FF6A 4QS8A 2Q1NA 5AQLA 4B3MK 2BUPA 4BREA 4OJRA 1BGXT 2QWMA 4CGJA 1WSIA 1T03A 3U9DA 3AO1A 3EY1A 2P9KB 5AQIA 3A5NC 1C1AA 5AQXA 3AGRA 3DLGA 3RRHA 4GNIA 2WTUA 3CJCA 3WXLA 3I8BA 4Z4CA 3MN5A 4IDKA 3P83D 4AM6A 5I42A 1S6PA 1IBMK 1Z26A 3ZT2A 3ZYYX 1Y64A 1N34K 4JLHA 3FFKB 5AQQA 4H0TB 2HVIA 5J2MA 2W6KA 1P90A 3QEXA 3C6HA 3NH0A 1G15A 3BY5A 2D4WA 1L3UA 4G1QA 3D2FA 1EXQA 5C25A 4JKGA 5AQYA 4EZ6A 4ILJA 3R3LA 1OKJA 2AA4A 4WFBL 3SCXA 1HQEA 4AHCA 4DWIA 4GV6A 2YX6A 4C8LA 1R0AA 3O8MA 2FSNA 1VRTA 5CZ1A 3BGRA 4CZLA 3V9SA 1XC9A 3B6PA 3AVJA 2GELA 4DTXA 4B1XB 2WONA 1BG3A 3FZMA 4AM7A 2O8BA 4LH5A 1C0UA 4CHNA 4JRQA 2ZGZA 5BPMA 1QHAA 4ID1A 4JKHA 4CEOA 4CJLA 3G71N 1DEJA 1U45A 4B1UB 4CJSA 2A5XA 1N36K 1T44A 5HRSA 3ISNC 3LPUA 4H8KA 3L0QA 4DSFA 1P8ZA 1KVCA 3LM9A 3H3OB 3CXCM 1HJOA 3QEIA 4LFAK 4CF0A 4J8FA 1BL3A 3HPHA 2O8CB 3E9PA 5ELZA 1TYQB 4B8CA 2P9NA 4CEAA 3CHWA 4XIUA 1KXPA 3DXKA 1N6QA 2NLXA 3AVFA 3KIOA 3HOSA 2BE2A 2NRVA 1YVUA 3RMCA 4HUGA 1K8KA 3O6WA 4NO7A 1W7AA 1KAYA 4B1YB 3M1FA 4IXCA 1E4GT 4JN4A 3EZ5A 4B3RK 1ZC6A 3AA5X 2D0PA 1BA0A 1XUPO 3CJBA 3WXIA 2CGLA 3OYNA 1TL3A 4CZGA 3HZ6A 4BR4A 5FRMA 4DTJA 2I7PA 3M8QA 1NJYA 1HX1A 2KHOA 3E66A 3MXMA 4FJ8A 4JD2B 2NUBA 2P9PB 2VG5A 4WFAL 3PIPL 1S3XA 4JI2K 3LZIA 3DXMB 4JI4K 3MX2A 5MLCQ 2ZJPL 4A57A 1XNQK 4CEEA 4DLGA 3TSQA 5KTQA 3P38A 2P1JA 5J2PA 4M7XA 3TTCA 4M3XA 5EY4A 1GLAG 4B1WB 1RT1A 3VPZA 4BQZA 3KJVA 4NCAA 2QM1A 4JI7K 4DV2K 4BY9C 3VESA 3V9UA 2KZZA 1VSMA 1ZXOA 2GWKA 4NLBA 5A2QO 4FJHA 3ZCMA 4FPBA 4CEQA 4WYBA 3A8YA 4GVMA 4DQ8A 1VQ4N 1GLEG 1YIJN 2OPQA 3WT0A 2G8IA 5LL6Z 4CBUA 2PYLA 2QWRA 3MEDA 3K9KA 1HNVA 2NRXA 3KKSA 5AQFA 2D0CA 3V4IA 4Z4IA 1RTDA 5M1PA 3DM2A 4ZTJA 2GWJA 4O0IA 2GEMA 3KLIA 1KLNA 4BRGA 1JCFA 3K5OA 1E3MA 3LDOA 3OBWA 2F7TA 2Y1IA 3K57A 3QESA 1IBLK 1JL2A 2HMIA 4GMJB 4A5AA 1U49A 5AZIA 2VWBA 4E1MA 3RVCA 3WNFA 2P9UB 4I9QA 5GAHP 1KAZA 3ZEUB 5EOYA 1S22A 2VGMA 3VEYA 3OYEA 1GLFO 4KTQA 3NGIA 5KQ8A 3SQ1A 1W9HA 5KRTA 5AZJA 3HK2A 2VYPA 3EKUA 3V9ZA 4CJ4A 2VG7A 3DRSA 1S9GA 1EWRA 4FLYA 4H0XB 4I6MA 2WUSA 2VQEK 2ZJQL 2QKKA 3OYAA 1NJWA 3KD5E 3O4NA 5CY4A 3K9JA 2QI2A 3CMEN 1OH7A 4DUYK 2NRTA 3TAEA 3T19A 1DT9A 2D0AA 1EETA 1I3AA 2Q2RA 3M6GA 5C24A 5FPDA 4O0JA 3CFOA 3G4SN 5KRSA 4BRDA 4IEIA 3WXMB 1SS6A 1Q8IA 1G99A 3L6QA 3IRXA 3KWGA 2RPIA 4WCEL 4K43A 1TKXA 4LSNA 2HHUA 1L3TA 4BRIA 1JXEA 1T6CA 4C8OA 3QLHA 4B3TK 5JS1A 3THXB 4FSVA 4M7YA 1NGFA 4J2BA 4FPAA 1JLBA 5KGXA 5JMVA 1VSKA 1RILA 3RTVA 4Y0WA 3FR0A 1SV5A 4CZFA 1GOAA 4FWMA 5HRRA 1QTMA 2W42A 4DV4K 2V52B 3HPOA 2E88A 5LMNK 1HPMA 4KBOA 3KK7A 4CIEA 4BR0A 5DM6L 3HP6A 1LWFA 4E7JA 3C0BA 3CC7N 4PL8A 1ZBLA 2Z1IA 4HUFA 4KKOA 2UYTA 2DFHA 4BRKA 4IEEA 3L2RA 4B9QA 1WUAA 1NGAA 1RFQA 5CYMA 5BN9A 2XO7A 3F2KA 3SV4A 3V81A 4BRPA 5F2RA 1GLDG 1YAGA 3QEPA 2BH1A 3JAMO 4BRQA 3KD1E 4F8RA 1VHXA 3TR8A 3LDNA 1JLGA 1ZYQA 4LC9B 4OGEA 2PY5A 1DGKN 4FW1A 1ZBIA 3KLHA 4CI6A 5AQWA 2KQ2A 3SPZA 4BROA 3VMFB 1NK9A 3VQEA 4LF7K 4CF8A 4LF6K 5AQMA 4B1ZA 5HRNA 3ATVA 1KRPA 3D2FB 3OYMA 2CGKA 4RWTA 3DLLL 1YUWA 2OYQA 2Q0UA 3V9WA 1X1PA 2KFNA 4CBWA 3HT3A 4YY3K 4LSLA 3RMDA 3AVKA 2IVPA 3AV9A 4B9UA 4BRFA 1KQSM 5F0XA 4EHUA 2IVNA 4B1VA 3VF2A 2EWSA 4M3RA 4NYNA 3O3HA 4C23A 2A1RA 1SZ2A 3MCPA 1JKHA 1VSJA 5AQSA 3AVBA 4X66K 2ASPA 3CM5A 4H03B 2O8BB 3VEVA 2ITGA 3S3OA 1S5JA 3SBGA 4FJMA 3ZSVA 1U48A 3LDQA 3SNNA 1HR0K 3ZX2A 3QEWA 1HKBA 1ATNA 1OH6A 2ZF5O 4CZHA 2WFBA 1C6VA 1KVAA 1YTAA 4W5TA 1LCUA 2EX3A 1JXBA 5AQPA 3VF6A 2OCEA 1C1BA 1NM1A 3E9LA 4Z4FA 2E2PA 3EL2A 3SQ4A 4BC2A 5B8HA 2ASOA 2HSTA 4NYFA 2P9NB 4FJLA 3OS1A 3MXJA 3O4WA 3SUNA 3DXKB 3PSFA 4CEFA 4CD3A 4CF2A 3IMXA 4L3QA 3ZSOA 4CJ3A 1K8KB 3I55N 4J2EA 4NXMK 3V9XA 1NGCA 4LH4A 3OBYA 2FXUA 3LP3A 4LF8K 2NRHA 3ZSRA 1RT7A 1KTQA 1W0HA 1ZBUA 4FZYA 3K5MA 4BDYA 3HO1A 1HNWK 3SLCA 2IVOA 1UOCA 3R6MA 4CFAA 4FWNA 4CZEA 3LAMA 5JLHA 2O8FA 4FK0A 2QA4N 4C1NI 1Q9XA 4BVPA 3VA3A 3THWA 4YDUC 3RSEA 3ZSXA 4RW9A 1QQOA 3PSIA 1GLCG 1RT4A 2VQFK 4JK9A 4IG0A 4JI5K 4OKEA 5LY3A 4QS9A 4OX9K 5T7BA 1ILYA 4R5PA 4JK7A 3OJUA 2GX9A 4FWPA 5CYQA 4CVNE 3TAQA 4DU3A 3A5LC 1Y97A 4BRAA 4KV8A 1VQ6N 4E7LA 4LFCK 4ICLA 2P9LA 3N4PA 3AGKA 1A5VA 4PKIA 3S41A 4CEZA 3PX6A 1T7PA 1NOYA 2QWNA 1JLFA 2PYJA 4B3SK 1CXQA 2YHWA 3SUPA 4DV5K 4WFNL 3NE6A 4CCHA 4HCBA 4PKHA 1QHTA 1VSIA 1ASVA 2OA8A 1RDDA 2OPSA 4PUOA 3OYJA 2B4JA 4AHUA 4CE9A 3QIOA 5AZIB 4CJEA 3CCLN 3OA9A 4DF8A 3ZSYA 3GDQA 2O4GA 1YHQN 3QB0A 4OVLA 5BR9A 1SAZA 5CZ2A 2FSJA 3L2VA 1TKDA 5AZJB 2XRIA 3UB5A 2F8TA 1XNRK 1N32K 4MO5A 5I9EB 4MO4A 3A5MC 1YT3A 3JYTA 4HCCA 5AQTA 4C8NA 4CJWA 4B9TA 4I6MB 4FLWA 1HYVA 1S1UA 2ETJA 4BG8A 1GOCA 3PUFA 3OYLA 4RCHA 2Q97A 4F2SA 4CFCA 1WSFA 3D45A 3CC2N 4CJ5A 3VQ6A 1WSJA 1BWFO 2OTJN 1BUPA 3KVGA 2I5JA 3AO2A 4JKEA 5K14A 4FLVA 1WNSA 4IZ9A 5AQGA 4EHTA 4BVOA 5CE3A 3OYGA 4W5QA 4Y1DA 3L4QA 4DTPA 1NK8A 1F21A 1I39A 3QDKA 4W5RA 3V6DA 2QWQA 4M45A 1NGJA 1D9FA 5GAEP 3I56N 3CMAN 3CG7A 3FZHA 3SQ0A 3ZT1A 3G0ZA 4A2BA 3PX0A 1VQNN 4DSLA 4OLBA 1Z05A 4DTMA 3CCMN 5C2FA 1L5UA 3CCJN 4A2AA 3CQYA 5F1XA 1J5EK 2W6LA 4YFUA 1KVBA 1BDGA 1H1VA 3KWIA 4XH5A 2IC3A 3SQ2A 2Z1GA 3C6AA 3ENOA 4B8AB 1I94K 1GLBG 3PO4A 4CHPA 4IBNA 5KPZA 4OPJA 2F96A 3PO5A 3RWUA 5FROA 4PQUA 3RR7A 3IAYA 1ESVA 3T1AA 3MK6A 3NH1A 4GKKK 4DTUA 1EKEA 1FKOA 4CERA 4BRMA 3MN9A 4YORA 1WN7A 1VQLN 1J54A 4GW6A 1J53A 4CHYA 4BC5A 1IV0A 1ZBSA 4JI8K 3WNEA 4WQ4C 3O80A 4FK2A 2HNDA 2QTDA 2CH6A 3CCQN 4DMNA 4KH5A 4DB3A 2HHSA 4EP5A 5M1KA 1RT3A 3AY9A 4XEIA 4DTSA 1K9MO 3U3GA 3WQTA 1TVRA 1IKYA 1BI4A 5BPLA 1X3MA 4DFKA 2QKBA 2KLAA 3MN6A 1VSHA 4BE0A 1HJRA 2KZMA 1RT2A 3ZSQA 3IUCA 4DR2K 3J7ZO 2KW4A 2O8DA 2H3GX 2QEXN 4B9SA 4CF9A 3L2QA 1NK7A 4CJRA 3QEVA 3TWHA 2PBDA 1OH5A 4BGAA 4O55A 2E2OA 3I0SA 2QK9A 1YTUA 4CZMA 4BE2A 1IG8A 3KLEA 1U04A 4L8RB 5D3GA 1XQSC 1XMOK 3NF8A 3TSPA 2D0BA 4AILC 4DQQA 2DPNA 4JRPA 4FM1A 3TPQA 3BDPA 3D2EA 4JKBA 3TU5A 4XH1A 1LOTB 3MN7A 3DMJA 4BR9A 4U67L 4MLHA 5C42A 3C94A 3VEZA 4UQGA 1KD1O 3VQ9A 4AHSA 3F73A 3RRGA 4BRHA 1Q9YA 4CK3A 2OZMA 5GAGP 4W5NA 4OLAA 2FSKA 3AVMA 1HYZA 4FJ5A 3OYKA 1NK4A 1TKZA 1NKCA 5IWAK 4HTLA 1RBUA 3LPTA 3QBXA 1NLVA 1NG9A 2GTDA 5LJWA 1NOZA 3AO3A 1JCGA 4CJUA 2OANA 3NCIA 5J2QA 4IDHA 4C8KA 3VQCA 4M3WA 1A5XA 2IAJA 4BQLA 3OTOK 1RT5A 2HBLA 3J81O 3BZCA 4HWIA 4DQIA 3VENA 3LALA 5FPMA 2AJQA 2O8FB 2JWLA 4JHDA 3VOVA 4FYDA 3AA4A 3THWB 3ID6A 4WE1A 3IKMA 3RSEB 2F8SA 4GVEA 3WNHA 1REVA 1Z25A 2Z1JA 3MWTA 1DLOA 1J9AA 1IKVA 3C7NA 4BRCA 2F4VK 4M3YA 5JVHL 3NDKA 5GINA 4DS5A 4ELVA 4YHHK 3C65A 1LWCA 4YOXA 3HI0A 3VQQA 3DRRA 3LDLA 4JS5A 1UAXA 3T3FA 5M1QA 3QMLA 4FWRA 2BGGA 3QFPA 1NK5A 2QWOA 1HKCA 4AHTA 1VQ8N 5IT9O 1XI1A 5JLFA 2OTLN 4IKFA 4RW6A 1Q82O 3B8AX 5AQKA 1VQKN 1WSHA 3IS9A 4KH6A 1MDUB 1NU0A 4OPAA 2ATQA 4M42A 2NRWA 2P9LB 2IGIA 5KGWA 4LFBK 1RDUA 3EE9A 5E26A 1VSDA 4JI0K 4CGFA 1C0GA 4CHQA 1OVYA 3PV8A 4LD0A 3EZWA 4KH4A 3K0SA 1LWEA 3CETA 1RTJA 4H5RA 3QERA 5FRNA 4ID5A 1BOTO 3NVKA 4CHZA 1A5WA 1VQMN 4IOAL 4IO9L 3CC4N 4ELUA 3L4IA 3VN5A 1S1VA 4K41A 1SKSA 3BUZB 2YKNA 4CJQA 3OYBA 4LF9K 1SKRA 4DS4A 4IO8A 3WUHA 4YNQA 4PA1A 2O8EA 4FM0A 2D1KA 3NFAA 3EYZA 2IDOA 1GOBA 3F9MA 1M1KO 4E7HA 1T3VA 4I9LA 2BDPA 2FF3B 3MEEA 4ISEA 5HRPA 3AVGA 3HOTA 4H4MA 2ITMA 2X6NA 3OYIA 4FXDA 2P9SA 4CGGA 1GLJO 3GG4A 4X65K 3OYFA 1RBTA 4MDBA 4YOUA 3LDPA 3KK1A 3HXMA 4BRNA 2RHKA 3BP8A 4JAXA 1KAXA 3C6TA 2A1SA 4KHPK 4I2PA 4CF1A 1ITGA 3P4IA 1BHLA 1L3SA 3NF9A 5H1SQ 2O4IA 4M3TA 3FE1A 2ZJRL 1TKTA 1DTQA 4FJIA 4F3OA 3ULEA 4FLZA 4WQ5C 2O8CA 1NNEA 1ASUA 3LP1A 3EE8A 5TKYA 2YI1A 3P39A 4EP4A 4IG3A 3SI6A 2A41A 3HBTA 1XHXA 1S72N 3K2PA 3HSTB 4JKGB 3SBTA 4EZ9A 4A5BA 3ZT3A 4K42A 3F5TA 4FJGA 4Q0BA 2HBMA 3CFRA 3VQ8A 1MWKA 4AH9A 4E0DA 4Z4HA 3SJHA 4JV5K 2FBTA 1X9MA 2AP1A 2F9TA 3VEXA 3QNOA 4C1NK 4BDPA 2HHVA 1QZ6A 3O1BA 3OS0A 2F9WA 3GOIA 2Q36A 3WEEA 4MDAA 3W3DA 5DMRA 3HVTA 3S9HA 4GV3A 2G8HA 5ADXH 5J2NA 1RBSA 4PY5A 2KFZA 4QCLA 4E7KA 3UKRA 1HQUA 1JLQA 1YJWN 4JD2A 1JLEA 2WBNA 3O3FA 1U6ZA 4KHWA 1RTHA 3IDHA 2LSNA 3M8SA 2ZQBA 3ZT4A 4KREA 3WQUA 4IOXA 3CCVN 4H0YB 3P1GA 5E41A 1WAJA 3DLBA 2G8KA 1O13A 3DLEA 3RR8A 1QVGM 2UU9K 5AQUA 2X74A 4FWKA 3Q7CA 1TAQA 1T05A 4F9OA 2YNFA 4DUZK 1YVNA 3SMSA 3C95A 3DAWA 4CIGA 3S3MA 3G25A 3U6FA 3KKRA 4GV9A 2HF4A 2YNHA 4HVJA 4Z4GA 4RTFD 3LDSA 3VQ4A 2GV9A 3SAGA 3CFPA 1BO5O 1RDWX 1BA1A 3GE1A 2YNIA 3BEXA 3BF1A 4CJFA 1SL2A 1MU2A 1NJXA 3CCRN 1BI4B 2YHYA 4BG9A 4AHRA 4TSXA 2Q31A 4RG8A 2VCPA 4BGBA 2HF3A 2A6AA 2HB5A 3D6RA 1C0TA 5BRHA 1JJ2M 2O8DB 4IFEA 2P51A 3J8AA 3LZJA 4H4OA 1QSYA 4YOWA 2IS3A 2PZSA 2HVHA 2X6SA 3AO4A 3TTFA 3P5JA 2E2NA 1NGHA 5HL7L 4ELTA 4B9MA 4F3TA 1EQYA 1LAVA 4J2AA 1VSLA 4BWJA 5EXWA 1VQON 4DHYA 3MX5A 1TK5A 4Z0UA 4OGCA 3AVCA 3B6OA 1B92A 4I7FA 3ZT0A 4GKJK 3MAQA 3D7EO 3VQAA 3AAPA 3HJFA 1NGEA 4MFBA 4KI4A 2DFEA 3DLHA 1MA9B 2HHHK 4FOEA 4WQ4A 1VSFA 2JLEA 2NZTA 3I33A 2A40A 1SL1A 1NK6A 1LAWA 5CR4A 3NAEA 3HM9A 1RCHA 4IJNA 1S1TA 1R59O 3M5RA 3SJJA 2W41A 3HP9A 4IFYA 1NGGA 5HOOA 3TANA 3ATUA 1JCEA 3VTHA 2ZM6K 3NF7A 3SUOA 5ADXA 3AA3A 1ATSA 2JWKA 3CJ1A 3AVAA 2G8VA 1TK8A 1VRUA 3J80O 4DFMA 4C8MA 1D5AA 2WC9A 2D5RA 4JHDB 2GBZA 4DSKA 4G9ZA 4FWOA 4O5BA 3H1VX 4CJ7A 1LW2A 2FBYA 1BQMA 3NBPA 3SYZA 3VQBA 3MDQA 4FJNA 3L3UA 2W40A 1TL1A 3C7NB 4RW4A 4N5SA 1JL1A 5C0YA 3CI5A 5DK5A 3V1RA 1WLJA 5DM7L 3VGMA 3DYAA 3VGLA 4E1JA 4O8KA 2YHBA 1X3NA 3KK3A 1YXQA 2FBXA 4FJXA 2V51B 4ZTFA 2ZE2A 3TABA 3H08A 4FL9A 2R7YA 4BRLA 4O4GA 3DOLA 1QQCA 2D0OA 1NGIA 5KI6A 2HBKA 4BR2A 4DQPA 1BIZA 3IFRA 1D4XA 4AHVA 3L8BA 1QZ5A 4HTUA 1VQPN 1BCOA 2E6MA 2XY6A 2OPRA 2HOEA 1IG9A 1TUUA 3HVRA 3QIPA 3FZFA 4UY8O 4YOYA 3WNGA 4H5TA 5M1OA 2RF2A 3HYFA 2OZSA 4BDZA 1HLUA 3PY8A 1TUYA 1WSGA 4OPKA 4DV7K 4PWDA 2X78A 1IKWA 3U9ZA 5KQDA 3CJ7A 4O5FA 1CZBA 4B3OA 4DLEA 4DR5K 1U47A 2E20A 4CESA 4E3SA 4JS4A 2FC0A 3VQ7A 4CD1A 3MXIA 1TGOA 1Q7YO 3CCEN 2HHXA 3FZLA 4O44A 1CXUA 2O8EB 3O9QA 3ZETA 3TTDA 1K73O 4IOCL 1S9EA 1SKWA 2YHAA 3V1QA 3DWLA 2QXLA 4X62K 4U7BA 3ENHA 3IG1A 3JSMA 2ASMA 5BN8A 1XMQK 4DTRA 3HSCA 2B5JA 5C12A 1W97L 3H6EA 4JI1K 3CJAA 3S3NA 3E01A 3R9PA 1EO1A 2P9SB 4JNEA 4FW2A 3THYA 2BTFA 4B08A 2NRRA 2VG6A 4FVMA 1QSLA 1ASWA 2QWPA 4CIFA 1N33K 3QFUA 3A2FA 1Q81O 4A62A 4K8ZA 3H46O 1DKGD 3LP0A 3KLFA 2ZGYA 4FCYA 5HROA 4ZHRA 4CJTA 4KB1A 4DFJA 1J5OA 4ILGB 4Z94A 4RW8A 4QS7A 5AQNA 1QVFM 1FJGK 3VQ5A 1U2VA 3N4QA 1IO2A 4DQSA 1D9DA 3NF6A 3FZKA 2G8UA 3ID8A 3EO3A 4H0PA 4FWSA 3ULEB 1YI2N 5J1EA 4FJ7A 1SQKA 2YJFA 1VK0A 5GIPA 5AJ3K 1DTTA 1YJNN 4Q5VA 2IOCA 2UUBK 3CJ9A 2QW9A 1Z6RA 1S1WA 4DR1K 3KZBA 2KKZA 3K58A 3GL1A 2HW3A 3ZX3A 3OYHA 1RDCA 3RMBA 5LMUK 2P5OA 1HYSA 3OYDA 3OYCA 4H5NA 1FXXA 3TI0A 1N8RO 3Q7BA 1N5YA 3G6EN 4DV1K 3V1OA 2GUIA 3WEEB 4XH4A 1B9DA 3VEOA 4FWLA 1D8YA 2Q3SA 3ALYA 3TAFA 1CZAN 3R8EA 3VQDA 3UKRB 3AAQA 4FJ9A 1KFSA 4KTZA 1OH8A 1KSPA 1NMNA 1OVQA 1HNXK 2BANA 4DR6K 4DG1A 2WOMA 3FLCO 3FFIA 3KK2A 3HPGA 4ILHA 3TAGA 1WBBA 5BPNA 4NXNK 3NHGA 5HP1A 4J2DA 4DSIA 2P9IA 4JYAK 4KTWA 5M1FA 4DV0K 1K8AO 3OJSA 2FLOA 3P31A 4CEDA 2RKIA 2GUPA 4QAGA 4N41A 5AFUH 4WQ5A 1L3VA 3AVLA 4E89A 4FK4A 2HHWA 1J6ZA 3BF3A 3GBTA 4ISFA 3UKUA 4CFBA 4CZKA 1IJJA 5C15A 4FLXA 4W5OA 3CPWM 4BACA 2HBJA 3ENBA 3CYMA 4V19S 1NMDA 2YJEA 5M1NA 4CEBA 3SPYA 5FDLA 3A0IX 4FVUA 4EIAA 4KHSA 4OKJA 3QO9A 4IFVA 4X64K 5AQVA 4KHYA 3CCSN 4DU4A 1C0MA 3CQ8A 2HNYA 3QICA 3DLKA 2CH5A 3I8DA 5AQHA 3OW2M 3SMPA 2PAVA 4JKCA 3U8XA 3TSUA 3ULDA 2HMPA 2QXFA 5GADP 3VERA 1XHZA 4KI6A 3T1YK 2J4RA 1QS4A 3U4LA 3VGKA 5E84A 4CZIA 2HHTA 3D0PA 4DQRA 4KPYA 4DSEA 1XC3A 4CK2A 1HNZK 1X9SA 2DY4A 1O1WA 3O5BA 3K5NA 2HHQA 1E4FT 5AQOA 1RDAA 5TKWA 2CGJA 4CHOA 4E7IA 3MWPA 2Z1HA 4DF4A 1XWLA 4DV3K 1VAZA 3I0RA 4B9VA 1TAUA 3KLGA 1RBVA 3QBWA 3CPEA 4KFBA 5BR8K 1QSSA 1WSEA 2ZD1A 2P9KA 4HHTA 2E1YA 1LV5A 2OPPA 3UIQA 3AVIA 5FPEA 2XHBA 2E6LA 3M8PA 4A59A 2E1ZA 3HM8A 3M8RA 2FBVA 1RNHA 1S6QA 3K59A 4DR3K 3M3ZA 2PFUA 1RBRA 2JGUA 1KC8O 3DRPA 3CF5L 1UA0A 4Z4EA 4K8XA 4DU1A 4KHQA 3WXKA 4YDUA 4DV6K 1JLAA 2V7ZA 4K25A 2I7NA 3NGZA 2P5GA 4KHUA 4KO0A 3O3GA 2NRZA 3LANA 5KPTA 4PHTX 4CJPA 1EWQA 5LJVA 3R1XA 4DR7K 4R79A 1HPZA 1UWBA 2E5LK 1IKXA 1BQNA 3AA2A 4RW7A 4DTOA 1QE1A 4BE1A 5I3UA 3JXUA 5AFUA 1IH7A 2UUAK 3T7ZA 3BZKA 3HTVA 1VQ9N 5C10A 1GLLO 1RDBA 4ISGA 2VWJA 4N76A 1TV6A 1FW6A 1U4BA 1HKGA 3LWLA 4JK8A 3ZSWA 1B9FA 4CGIA 3OS2A 1X9WA 1CZ9A 1NJZA 2RE2A 4EFHA 3H3NO 3VETA 2V7YA 4JEPA 3VTIA 2XY5A 1HRHA 4M41A 5BREA 1WB9A 4FLTA 1TYQA 3SAFA 3TAMA 3FGUA 4BR7A 4FO0A 3T69A 4CBXA 4HUEA 3CQXA 1S1XA 4NB4A 3VF4A 1BISA 3U3YA 2XY7A 1VQ7N 5JS2A 3ASMA 5HBMA 4F4KA 3PIOL 3SV3A 3OVNA 3ZSZA 2E4LA 4H5WA 5EVZA 4KAZA 1EX4A 4K0KK 3L2UA 1BCMA 1FKPA 1RGIA 2UXCK 2G8WA 4OPHA 3ZETB 4B9LA 1T6DA 2YCHA 5GIOA 4CJKA 4NCGA 3NGYA 3L3VA 1K6YA 4FZXC 3PLAA 4N47A 2P9PA 3T1HK 5CHIA 3DXMA 3QINA 4M3UA 3QNNA 2QWLA 3O9SA 3KHYA 3THYB 3O08A 3DI6A 3PX4A 1NGDA 3H1QA 4MQ3A 1NK0A 1NWKA 3LL3A 1MWMA 3E9OA 5EX5A 2YKMA 2NNWA 3LAKA 1NKEA 5FPNA 2DTUA 1NKBA 5AR0A 3LWMA 4FJKA 4BC4A 1WAFA 4YOTA 1LW0A 1U2VB 3AVNA 3EN9A 2DFFA 3TAPA 4FLUA 1IBKK 1HNIA 3A5OC 4FZZA 4BWMA
chains in the Genus database with same CATH topology
3H08A 3L2QA 1L3TA 3SZ2A 4CECA 2R7YA 1NK7A 4KHNA 4O4GA 4CJRA 3QEVA 3TWHA 1JXEA 3DOLA 1QQCA 5KI6A 4KRFA 4C8OA 4KB1A 3QLHA 2G8FA 4DQPA 1BIZA 5JS1A 3CM6A 4O55A 3KTQA 3L8BA 4AHVA 3I0SA 2QK9A 4HTUA 1YTUA 4DTNA 4BE2A 1BCOA 2E6MA 2XY6A 1C1CA 2OPRA 4J2BA 1JLBA 2YV0X 5KGXA 2B6AA 3KLEA 1U04A 1IG9A 4DSJA 4E1NA 1VSKA 3QIPA 1RILA 3AVHA 3HVRA 3RTVA 3WNGA 2HNZA 4L8RB 4NCBA 5D3GA 3NF8A 2VWKA 1SV5A 2D0BA 2RF2A 1GOAA 3HYFA 4AILC 2OZSA 4BDZA 4DQQA 3PY8A 5HRRA 1QTMA 1WSGA 4JRPA 3LP2A 4OPKA 2W42A 4FM1A 3TARA 1KCFA 3BDPA 3HPOA 1ZBFA 4PWDA 2X78A 1IKWA 3DMJA 4DFPA 4CIEA 5C42A 3C94A 4CGHA 1CZBA 4UQGA 4B3OA 3VQ9A 4AHSA 1LWFA 3HP6A 3F73A 4DLEA 4E7JA 3RRGA 1U47A 2YNGA 4CESA 2Z1IA 4CK3A 4KKOA 4HUFA 1ZBLA 1Q9YA 2OZMA 4W5NA 2DFHA 4OLAA 1KFDA 3AVMA 1HYZA 3G10A 4E3SA 5HLFA 3L2RA 4JS4A 3OYKA 4FJ5A 1NK4A 1TKZA 3SUQA 1NKCA 2FC0A 3VQ7A 1RBUA 1TGOA 2XO7A 3MXIA 5CYMA 5SZTA 3LPTA 3SV4A 4B9NA 4KB0A 3V81A 2HHXA 3DLRA 1NOZA 3AO3A 4O44A 4CK1A 1CXUA 3C6UA 4CJUA 3QEPA 1S9EA 3NCIA 5J2QA 4M3ZA 1SKWA 1TK0A 2YHAA 3V1QA 3KD1E 4F8RA 4C8KA 3VQCA 3TR8A 4M3WA 1A5XA 1JLGA 1ZYQA 4OGEA 2IAJA 3IG1A 3ITHA 1RTIA 4CGDA 3JSMA 2PY5A 1CLQA 4FW1A 1ZBIA 3KLHA 3K5LA 1RT5A 4I2QA 2RN2A 2XY8A 4DTRA 3DOKA 2B5JA 2KQ2A 3VA0A 1EP4A 4DQIA 3S3NA 3SPZA 3LALA 3E01A 4CJVA 3NH2A 1NK9A 2AJQA 3VQEA 4FYDA 4FW2A 4CF8A 5HRNA 3AA4A 3OY9A 4WE1A 4OKKA 4B08A 2F8SA 2VG6A 4FVMA 3WNHA 1KRPA 1REVA 1QSLA 2EHGA 1ASWA 3OYMA 3L2WA 2Y1JA 2OYQA 4CIFA 3V9WA 3HL8A 1X1PA 1Z25A 2Z1JA 3HT3A 2KFNA 4LSLA 3RMDA 4LY7A 1DLOA 3AVKA 3A2FA 4K8ZA 1J9AA 3KLFA 1IKVA 3LP0A 3AV9A 4FCYA 4B9UA 1HMVA 4M3YA 2KTQA 3VQPA 4ZHRA 4CJTA 4E19A 5HROA 4ELVA 3NDKA 4DS5A 4DFJA 1T8EA 1RT6A 4Y1CA 1J5OA 4FJJA 1LWCA 4RW8A 4M3RA 4NYNA 1SUQA 3DRRA 3VQ5A 3VQQA 4F2RA 1IO2A 4JS5A 4DQSA 1UAXA 3T3FA 1D9DA 3NF6A 3O3HA 2G8UA 3MECA 2A1RA 1ZBHA 2BGGA 1UA1A 1NK5A 1JKHA 1VSJA 5J1EA 4FJ7A 3AVBA 3THVA 4AHTA 3CM5A 1JLCA 1XI1A 4IKFA 2ITGA 4RW6A 1S5JA 1VSEA 4N56A 1VK0A 3S3OA 5SWMA 4FJMA 3ZSVA 1U48A 1WSHA 3IS9A 3F9KA 1DTTA 3SNNA 3O4QA 2ATQA 2IOCA 3MEGA 4Q5VA 3QEWA 3RMAA 4M42A 1S1WA 2IGIA 5KGWA 1BIUA 1C6VA 1VSDA 3K58A 4QOZB 2HW3A 1KLMA 1KVAA 4CGFA 3OYHA 4CHQA 1RDCA 3RMBA 1YTAA 4W5TA 2P5OA 3PV8A 1HYSA 4LD0A 2EX3A 1JXBA 3OYDA 3OYCA 3QETA 1LWEA 1FK9A 1RTJA 1FXXA 3QERA 3TI0A 1C1BA 1N5YA 5FRNA 4ID5A 4Z4FA 1SL0A 5EU7A 3V1OA 4FM2A 2GUIA 4CHZA 3SQ4A 1A5WA 4NYFA 1B9DA 4FJLA 3AO5A 3OS1A 3MXJA 4CFDA 3SUNA 1D8YA 2Q3SA 3ALYA 3TAFA 4ELUA 4CEFA 3VQDA 4CF2A 4OJRA 4FJ9A 1BGXT 3VN5A 1KFSA 3ZSOA 4KTZA 4CGJA 4CJ3A 1WSIA 1S1VA 1SKSA 1T03A 1KSPA 4J2EA 2YKNA 4CJQA 3AO1A 3OYBA 3V9XA 2BANA 3EY1A 4DG1A 4LH4A 2WOMA 4DS4A 4YNQA 1C1AA 1SKRA 3FFIA 4PA1A 3DLGA 3LP3A 3KK2A 3HPGA 4FM0A 3RRHA 3TAGA 3ZSRA 1RT7A 3NFAA 3EYZA 3NHGA 5HP1A 1KTQA 1W0HA 1GOBA 2IDOA 4J2DA 4DSIA 1ZBUA 4Z4CA 4IDKA 3P83D 5I42A 4FZYA 3K5MA 1S6PA 4KTWA 4BDYA 1Z26A 3ZT2A 3OJSA 4E7HA 3HO1A 4I9LA 4JLHA 1UOCA 2HVIA 4CFAA 4CEDA 2RKIA 2BDPA 5HRPA 3MEEA 4QAGA 5J2MA 3AVGA 3LAMA 4N41A 4H4MA 4FXDA 2X6NA 3OYIA 3QEXA 3AVLA 4E89A 1L3VA 4CGGA 4FK4A 4FK0A 3NH0A 2HHWA 1G15A 1Q9XA 3OYFA 4CFBA 3VA3A 1RBTA 1L3UA 4G1QA 3KK1A 3ZSXA 4FLXA 3HXMA 4W5OA 4RW9A 4BACA 1EXQA 3CYMA 5C25A 3C6TA 4EZ6A 1RT4A 2A1SA 4I2PA 4CF1A 1ITGA 3SCXA 1HQEA 1BHLA 4IG0A 1L3SA 3NF9A 4OKEA 4AHCA 4CEBA 4DWIA 2O4IA 3SPYA 5FDLA 4C8LA 4M3TA 1R0AA 1VRTA 5CZ1A 3BGRA 5T7BA 3V9SA 4KHSA 4OKJA 4R5PA 1XC9A 3B6PA 1TKTA 3AVJA 1DTQA 3QO9A 4IFVA 3OJUA 4DTXA 4F3OA 4FJIA 5CYQA 4KHYA 4FLZA 4DU4A 1C0MA 3TAQA 1ASUA 2WONA 3LP1A 3CQ8A 4DU3A 2HNYA 1Y97A 3DLKA 4LH5A 4EP4A 3I8DA 1C0UA 4CHNA 4JRQA 4IG3A 3SI6A 4KV8A 1XHXA 4E7LA 3K2PA 3ULDA 4ICLA 3HSTB 4ID1A 2QXFA 4EZ9A 4CEOA 4KI6A 1XHZA 4CJLA 3ZT3A 1A5VA 1QS4A 1U45A 4CEZA 4CJSA 3PX6A 1T7PA 1NOYA 4FJGA 5HRSA 4Q0BA 2HHTA 3D0PA 1JLFA 4DQRA 3ISNC 3LPUA 2PYJA 4KPYA 4H8KA 3CFRA 4DSEA 4CK2A 1CXQA 4DSFA 1X9SA 1KVCA 3VQ8A 2DY4A 1O1WA 4AH9A 4E0DA 4Z4HA 3SUPA 3K5NA 2HHQA 2FBTA 1X9MA 3QEIA 4CF0A 1RDAA 1BL3A 3NE6A 4CCHA 3HPHA 3QNOA 4BDPA 2HHVA 3OS0A 4HCBA 4CHOA 4E7IA 1QHTA 2Z1HA 4DF4A 4B8CA 4CEAA 1XWLA 1VSIA 5DMRA 4XIUA 3HVTA 1ASVA 3I0RA 1N6QA 3S9HA 4B9VA 2G8HA 2OA8A 1RDDA 1TAUA 2OPSA 5J2NA 1RBSA 3AVFA 3KIOA 3OYJA 3KLGA 1RBVA 4PUOA 4PY5A 4E7KA 4QCLA 1HQUA 2B4JA 2BE2A 1YVUA 1JLQA 4AHUA 3RMCA 4CE9A 4KFBA 4HUGA 1JLEA 3O3FA 4KHWA 1QSSA 1WSEA 1RTHA 2ZD1A 3QIOA 4HHTA 3EZ5A 1LV5A 3AA5X 4CJEA 2OPPA 4DF8A 3ZSYA 3AVIA 2LSNA 3UIQA 2XHBA 2O4GA 3M8SA 2E6LA 2ZQBA 3ZT4A 3M8PA 4OVLA 4KREA 3M8RA 3P1GA 2FBVA 5CZ2A 5E41A 1WAJA 3L2VA 2G8KA 3DLEA 3DLBA 3OYNA 1RNHA 1TL3A 1S6QA 3RR8A 3K59A 1TKDA 2X74A 5FRMA 4DTJA 2XRIA 2F8TA 1RBRA 1TAQA 2JGUA 1T05A 3DRPA 1UA0A 4Z4EA 3M8QA 4K8XA 1NJYA 2YNFA 4DU1A 1YT3A 4KHQA 3JYTA 4HCCA 3MXMA 4FJ8A 1JLAA 2NUBA 4C8NA 4CJWA 3C95A 4B9TA 4CIGA 2VG5A 3S3MA 3NGZA 3U6FA 3KKRA 2P5GA 4KHUA 3LZIA 2YNHA 4FLWA 4KO0A 4HVJA 1HYVA 1S1UA 3O3GA 4Z4GA 3LDSA 3LANA 3VQ4A 2ETJA 2GV9A 4CEEA 4CJPA 1GOCA 3PUFA 4DLGA 5KTQA 3CFPA 3OYLA 2P1JA 5J2PA 4F2SA 1HPZA 2YNIA 1UWBA 1IKXA 1BQNA 4CFCA 4M3XA 1WSFA 3D45A 3AA2A 1RT1A 4CJFA 4CJ5A 3VQ6A 1SL2A 1MU2A 1WSJA 4RW7A 4DTOA 1QE1A 1NJXA 4BE1A 1BI4B 3KJVA 5I3UA 4NCAA 4AHRA 4TSXA 4RG8A 2I5JA 3AO2A 5K14A 4FLVA 3V9UA 1WNSA 2KZZA 2HB5A 1VSMA 1C0TA 1IH7A 3OYGA 4FJHA 3ZCMA 2P51A 4W5QA 4CEQA 4Y1DA 4DTPA 1NK8A 3LZJA 2VWJA 1F21A 1RDBA 1I39A 4H4OA 4N76A 4W5RA 1TV6A 4GVMA 1QSYA 1U4BA 3LWLA 2IS3A 3ZSWA 3V6DA 2PZSA 2HVHA 1B9FA 4M45A 2OPQA 2X6SA 3AO4A 4CGIA 3OS2A 1CZ9A 3P5JA 1NJZA 1X9WA 1D9FA 2HHUA 2G8IA 4ELTA 4B9MA 4F3TA 2PYLA 1LAVA 3CG7A 3MEDA 3SQ0A 1HNVA 3KKSA 3ZT1A 2D0CA 3V4IA 4J2AA 2XY5A 1VSLA 3G0ZA 4Z4IA 1HRHA 4BWJA 4M41A 1RTDA 4FLTA 3PX0A 3DM2A 4ZTJA 4O0IA 4DSLA 4OLBA 1TK5A 3KLIA 4Z0UA 4OGCA 3TAMA 3AVCA 3B6OA 1B92A 4I7FA 4DTMA 3ZT0A 1KLNA 1L5UA 4HUEA 3K5OA 1S1XA 2Y1IA 3MAQA 3K57A 1BISA 3VQAA 3QESA 3U3YA 1JL2A 2XY7A 2HMIA 4GMJB 5JS2A 4YFUA 1KVBA 3ASMA 3HJFA 5HBMA 4MFBA 4F4KA 4KI4A 2DFEA 2IC3A 2Z1GA 4B8AB 3SV3A 3SQ2A 1U49A 3DLHA 4E1MA 3OVNA 3WNFA 3ZSZA 4I9QA 2E4LA 3PO4A 4CHPA 4IBNA 1VSFA 2JLEA 4OPJA 4KAZA 1EX4A 2F96A 1SL1A 3PO5A 3RWUA 1NK6A 5FROA 1LAWA 3NAEA 4PQUA 3HM9A 1RCHA 3RR7A 3IAYA 3T1AA 3OYEA 1S1TA 3NH1A 4KTQA 3NGIA 3L2UA 3SQ1A 1BCMA 4DTUA 1FKPA 1W9HA 3SJJA 5KRTA 2G8WA 1EKEA 1FKOA 4CERA 4B9LA 3HP9A 3HK2A 4IFYA 3V9ZA 4CJ4A 2VG7A 3DRSA 3TANA 1S9GA 4CJKA 4NCGA 3NGYA 3NF7A 4FLYA 3SUOA 3L3VA 1K6YA 1WN7A 3AA3A 4FZXC 1J54A 4N47A 4GW6A 2QKKA 3OYAA 3AVAA 1J53A 2G8VA 1TK8A 1NJWA 4CHYA 1VRUA 3QINA 4DFMA 4C8MA 3KD5E 1D5AA 4M3UA 3O4NA 2D5RA 5CY4A 2GBZA 3QNNA 3WNEA 4DSKA 3DI6A 3PX4A 4FK2A 2HNDA 4O5BA 1LW2A 4DMNA 3T19A 3TAEA 1NK0A 4MQ3A 2D0AA 2FBYA 1BQMA 3NBPA 1EETA 3SYZA 1I3AA 3VQBA 5C24A 2HHSA 4O0JA 3L3UA 4EP5A 4FJNA 2YKMA 1RT3A 3CFOA 1TL1A 4DTSA 3LAKA 1NKEA 3U3GA 5KRSA 1TVRA 1IKYA 1BI4A 4RW4A 4DFKA 2DTUA 2QKBA 4N5SA 1NKBA 1JL1A 1VSHA 4BE0A 1HJRA 3LWMA 4FJKA 2KZMA 1Q8IA 5DK5A 1WAFA 1WLJA 3V1RA 1RT2A 3ZSQA 1LW0A 3AVNA 3DYAA 2KW4A 2YHBA 3IRXA 2RPIA 2DFFA 3TAPA 4FLUA 2KFZA 3KK3A 1TKXA 4LSNA 4B9SA 1HNIA 2FBXA 4CF9A 4FJXA 4ZTFA 2ZE2A 4FZZA 4BWMA 3TABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H08 A;  3L2Q A;  1L3T A;  3SZ2 A;  4CEC A;  2R7Y A;  1NK7 A;  4KHN A;  4O4G A;  4CJR A;  3QEV A;  3TWH A;  1JXE A;  3DOL A;  1QQC A;  5KI6 A;  4KRF A;  4C8O A;  4KB1 A;  3QLH A;  2G8F A;  4DQP A;  1BIZ A;  5JS1 A;  3CM6 A;  4O55 A;  3KTQ A;  3L8B A;  4AHV A;  3I0S A;  2QK9 A;  4HTU A;  1YTU A;  4DTN A;  4BE2 A;  1BCO A;  2E6M A;  2XY6 A;  1C1C A;  2OPR A;  4J2B A;  1JLB A;  2YV0 X;  5KGX A;  2B6A A;  3KLE A;  1U04 A;  1IG9 A;  4DSJ A;  4E1N A;  1VSK A;  3QIP A;  1RIL A;  3AVH A;  3HVR A;  3RTV A;  3WNG A;  2HNZ A;  4L8R B;  4NCB A;  5D3G A;  3NF8 A;  2VWK A;  1SV5 A;  2D0B A;  2RF2 A;  1GOA A;  3HYF A;  4AIL C;  2OZS A;  4BDZ A;  4DQQ A;  3PY8 A;  5HRR A;  1QTM A;  1WSG A;  4JRP A;  3LP2 A;  4OPK A;  2W42 A;  4FM1 A;  3TAR A;  1KCF A;  3BDP A;  3HPO A;  1ZBF A;  4PWD A;  2X78 A;  1IKW A;  3DMJ A;  4DFP A;  4CIE A;  5C42 A;  3C94 A;  4CGH A;  1CZB A;  4UQG A;  4B3O A;  3VQ9 A;  4AHS A;  1LWF A;  3HP6 A;  3F73 A;  4DLE A;  4E7J A;  3RRG A;  1U47 A;  2YNG A;  4CES A;  2Z1I A;  4CK3 A;  4KKO A;  4HUF A;  1ZBL A;  1Q9Y A;  2OZM A;  4W5N A;  2DFH A;  4OLA A;  1KFD A;  3AVM A;  1HYZ A;  3G10 A;  4E3S A;  5HLF A;  3L2R A;  4JS4 A;  3OYK A;  4FJ5 A;  1NK4 A;  1TKZ A;  3SUQ A;  1NKC A;  2FC0 A;  3VQ7 A;  1RBU A;  1TGO A;  2XO7 A;  3MXI A;  5CYM A;  5SZT A;  3LPT A;  3SV4 A;  4B9N A;  4KB0 A;  3V81 A;  2HHX A;  3DLR A;  1NOZ A;  3AO3 A;  4O44 A;  4CK1 A;  1CXU A;  3C6U A;  4CJU A;  3QEP A;  1S9E A;  3NCI A;  5J2Q A;  4M3Z A;  1SKW A;  1TK0 A;  2YHA A;  3V1Q A;  3KD1 E;  4F8R A;  4C8K A;  3VQC A;  3TR8 A;  4M3W A;  1A5X A;  1JLG A;  1ZYQ A;  4OGE A;  2IAJ A;  3IG1 A;  3ITH A;  1RTI A;  4CGD A;  3JSM A;  2PY5 A;  1CLQ A;  4FW1 A;  1ZBI A;  3KLH A;  3K5L A;  1RT5 A;  4I2Q A;  2RN2 A;  2XY8 A;  4DTR A;  3DOK A;  2B5J A;  2KQ2 A;  3VA0 A;  1EP4 A;  4DQI A;  3S3N A;  3SPZ A;  3LAL A;  3E01 A;  4CJV A;  3NH2 A;  1NK9 A;  2AJQ A;  3VQE A;  4FYD A;  4FW2 A;  4CF8 A;  5HRN A;  3AA4 A;  3OY9 A;  4WE1 A;  4OKK A;  4B08 A;  2F8S A;  2VG6 A;  4FVM A;  3WNH A;  1KRP A;  1REV A;  1QSL A;  2EHG A;  1ASW A;  3OYM A;  3L2W A;  2Y1J A;  2OYQ A;  4CIF A;  3V9W A;  3HL8 A;  1X1P A;  1Z25 A;  2Z1J A;  3HT3 A;  2KFN A;  4LSL A;  3RMD A;  4LY7 A;  1DLO A;  3AVK A;  3A2F A;  4K8Z A;  1J9A A;  3KLF A;  1IKV A;  3LP0 A;  3AV9 A;  4FCY A;  4B9U A;  1HMV A;  4M3Y A;  2KTQ A;  3VQP A;  4ZHR A;  4CJT A;  4E19 A;  5HRO A;  4ELV A;  3NDK A;  4DS5 A;  4DFJ A;  1T8E A;  1RT6 A;  4Y1C A;  1J5O A;  4FJJ A;  1LWC A;  4RW8 A;  4M3R A;  4NYN A;  1SUQ A;  3DRR A;  3VQ5 A;  3VQQ A;  4F2R A;  1IO2 A;  4JS5 A;  4DQS A;  1UAX A;  3T3F A;  1D9D A;  3NF6 A;  3O3H A;  2G8U A;  3MEC A;  2A1R A;  1ZBH A;  2BGG A;  1UA1 A;  1NK5 A;  1JKH A;  1VSJ A;  5J1E A;  4FJ7 A;  3AVB A;  3THV A;  4AHT A;  3CM5 A;  1JLC A;  1XI1 A;  4IKF A;  2ITG A;  4RW6 A;  1S5J A;  1VSE A;  4N56 A;  1VK0 A;  3S3O A;  5SWM A;  4FJM A;  3ZSV A;  1U48 A;  1WSH A;  3IS9 A;  3F9K A;  1DTT A;  3SNN A;  3O4Q A;  2ATQ A;  2IOC A;  3MEG A;  4Q5V A;  3QEW A;  3RMA A;  4M42 A;  1S1W A;  2IGI A;  5KGW A;  1BIU A;  1C6V A;  1VSD A;  3K58 A;  4QOZ B;  2HW3 A;  1KLM A;  1KVA A;  4CGF A;  3OYH A;  4CHQ A;  1RDC A;  3RMB A;  1YTA A;  4W5T A;  2P5O A;  3PV8 A;  1HYS A;  4LD0 A;  2EX3 A;  1JXB A;  3OYD A;  3OYC A;  3QET A;  1LWE A;  1FK9 A;  1RTJ A;  1FXX A;  3QER A;  3TI0 A;  1C1B A;  1N5Y A;  5FRN A;  4ID5 A;  4Z4F A;  1SL0 A;  5EU7 A;  3V1O A;  4FM2 A;  2GUI A;  4CHZ A;  3SQ4 A;  1A5W A;  4NYF A;  1B9D A;  4FJL A;  3AO5 A;  3OS1 A;  3MXJ A;  4CFD A;  3SUN A;  1D8Y A;  2Q3S A;  3ALY A;  3TAF A;  4ELU A;  4CEF A;  3VQD A;  4CF2 A;  4OJR A;  4FJ9 A;  1BGX T;  3VN5 A;  1KFS A;  3ZSO A;  4KTZ A;  4CGJ A;  4CJ3 A;  1WSI A;  1S1V A;  1SKS A;  1T03 A;  1KSP A;  4J2E A;  2YKN A;  4CJQ A;  3AO1 A;  3OYB A;  3V9X A;  2BAN A;  3EY1 A;  4DG1 A;  4LH4 A;  2WOM A;  4DS4 A;  4YNQ A;  1C1A A;  1SKR A;  3FFI A;  4PA1 A;  3DLG A;  3LP3 A;  3KK2 A;  3HPG A;  4FM0 A;  3RRH A;  3TAG A;  3ZSR A;  1RT7 A;  3NFA A;  3EYZ A;  3NHG A;  5HP1 A;  1KTQ A;  1W0H A;  1GOB A;  2IDO A;  4J2D A;  4DSI A;  1ZBU A;  4Z4C A;  4IDK A;  3P83 D;  5I42 A;  4FZY A;  3K5M A;  1S6P A;  4KTW A;  4BDY A;  1Z26 A;  3ZT2 A;  3OJS A;  4E7H A;  3HO1 A;  4I9L A;  4JLH A;  1UOC A;  2HVI A;  4CFA A;  4CED A;  2RKI A;  2BDP A;  5HRP A;  3MEE A;  4QAG A;  5J2M A;  3AVG A;  3LAM A;  4N41 A;  4H4M A;  4FXD A;  2X6N A;  3OYI A;  3QEX A;  3AVL A;  4E89 A;  1L3V A;  4CGG A;  4FK4 A;  4FK0 A;  3NH0 A;  2HHW A;  1G15 A;  1Q9X A;  3OYF A;  4CFB A;  3VA3 A;  1RBT A;  1L3U A;  4G1Q A;  3KK1 A;  3ZSX A;  4FLX A;  3HXM A;  4W5O A;  4RW9 A;  4BAC A;  1EXQ A;  3CYM A;  5C25 A;  3C6T A;  4EZ6 A;  1RT4 A;  2A1S A;  4I2P A;  4CF1 A;  1ITG A;  3SCX A;  1HQE A;  1BHL A;  4IG0 A;  1L3S A;  3NF9 A;  4OKE A;  4AHC A;  4CEB A;  4DWI A;  2O4I A;  3SPY A;  5FDL A;  4C8L A;  4M3T A;  1R0A A;  1VRT A;  5CZ1 A;  3BGR A;  5T7B A;  3V9S A;  4KHS A;  4OKJ A;  4R5P A;  1XC9 A;  3B6P A;  1TKT A;  3AVJ A;  1DTQ A;  3QO9 A;  4IFV A;  3OJU A;  4DTX A;  4F3O A;  4FJI A;  5CYQ A;  4KHY A;  4FLZ A;  4DU4 A;  1C0M A;  3TAQ A;  1ASU A;  2WON A;  3LP1 A;  3CQ8 A;  4DU3 A;  2HNY A;  1Y97 A;  3DLK A;  4LH5 A;  4EP4 A;  3I8D A;  1C0U A;  4CHN A;  4JRQ A;  4IG3 A;  3SI6 A;  4KV8 A;  1XHX A;  4E7L A;  3K2P A;  3ULD A;  4ICL A;  3HST B;  4ID1 A;  2QXF A;  4EZ9 A;  4CEO A;  4KI6 A;  1XHZ A;  4CJL A;  3ZT3 A;  1A5V A;  1QS4 A;  1U45 A;  4CEZ A;  4CJS A;  3PX6 A;  1T7P A;  1NOY A;  4FJG A;  5HRS A;  4Q0B A;  2HHT A;  3D0P A;  1JLF A;  4DQR A;  3ISN C;  3LPU A;  2PYJ A;  4KPY A;  4H8K A;  3CFR A;  4DSE A;  4CK2 A;  1CXQ A;  4DSF A;  1X9S A;  1KVC A;  3VQ8 A;  2DY4 A;  1O1W A;  4AH9 A;  4E0D A;  4Z4H A;  3SUP A;  3K5N A;  2HHQ A;  2FBT A;  1X9M A;  3QEI A;  4CF0 A;  1RDA A;  1BL3 A;  3NE6 A;  4CCH A;  3HPH A;  3QNO A;  4BDP A;  2HHV A;  3OS0 A;  4HCB A;  4CHO A;  4E7I A;  1QHT A;  2Z1H A;  4DF4 A;  4B8C A;  4CEA A;  1XWL A;  1VSI A;  5DMR A;  4XIU A;  3HVT A;  1ASV A;  3I0R A;  1N6Q A;  3S9H A;  4B9V A;  2G8H A;  2OA8 A;  1RDD A;  1TAU A;  2OPS A;  5J2N A;  1RBS A;  3AVF A;  3KIO A;  3OYJ A;  3KLG A;  1RBV A;  4PUO A;  4PY5 A;  4E7K A;  4QCL A;  1HQU A;  2B4J A;  2BE2 A;  1YVU A;  1JLQ A;  4AHU A;  3RMC A;  4CE9 A;  4KFB A;  4HUG A;  1JLE A;  3O3F A;  4KHW A;  1QSS A;  1WSE A;  1RTH A;  2ZD1 A;  3QIO A;  4HHT A;  3EZ5 A;  1LV5 A;  3AA5 X;  4CJE A;  2OPP A;  4DF8 A;  3ZSY A;  3AVI A;  2LSN A;  3UIQ A;  2XHB A;  2O4G A;  3M8S A;  2E6L A;  2ZQB A;  3ZT4 A;  3M8P A;  4OVL A;  4KRE A;  3M8R A;  3P1G A;  2FBV A;  5CZ2 A;  5E41 A;  1WAJ A;  3L2V A;  2G8K A;  3DLE A;  3DLB A;  3OYN A;  1RNH A;  1TL3 A;  1S6Q A;  3RR8 A;  3K59 A;  1TKD A;  2X74 A;  5FRM A;  4DTJ A;  2XRI A;  2F8T A;  1RBR A;  1TAQ A;  2JGU A;  1T05 A;  3DRP A;  1UA0 A;  4Z4E A;  3M8Q A;  4K8X A;  1NJY A;  2YNF A;  4DU1 A;  1YT3 A;  4KHQ A;  3JYT A;  4HCC A;  3MXM A;  4FJ8 A;  1JLA A;  2NUB A;  4C8N A;  4CJW A;  3C95 A;  4B9T A;  4CIG A;  2VG5 A;  3S3M A;  3NGZ A;  3U6F A;  3KKR A;  2P5G A;  4KHU A;  3LZI A;  2YNH A;  4FLW A;  4KO0 A;  4HVJ A;  1HYV A;  1S1U A;  3O3G A;  4Z4G A;  3LDS A;  3LAN A;  3VQ4 A;  2ETJ A;  2GV9 A;  4CEE A;  4CJP A;  1GOC A;  3PUF A;  4DLG A;  5KTQ A;  3CFP A;  3OYL A;  2P1J A;  5J2P A;  4F2S A;  1HPZ A;  2YNI A;  1UWB A;  1IKX A;  1BQN A;  4CFC A;  4M3X A;  1WSF A;  3D45 A;  3AA2 A;  1RT1 A;  4CJF A;  4CJ5 A;  3VQ6 A;  1SL2 A;  1MU2 A;  1WSJ A;  4RW7 A;  4DTO A;  1QE1 A;  1NJX A;  4BE1 A;  1BI4 B;  3KJV A;  5I3U A;  4NCA A;  4AHR A;  4TSX A;  4RG8 A;  2I5J A;  3AO2 A;  5K14 A;  4FLV A;  3V9U A;  1WNS A;  2KZZ A;  2HB5 A;  1VSM A;  1C0T A;  1IH7 A;  3OYG A;  4FJH A;  3ZCM A;  2P51 A;  4W5Q A;  4CEQ A;  4Y1D A;  4DTP A;  1NK8 A;  3LZJ A;  2VWJ A;  1F21 A;  1RDB A;  1I39 A;  4H4O A;  4N76 A;  4W5R A;  1TV6 A;  4GVM A;  1QSY A;  1U4B A;  3LWL A;  2IS3 A;  3ZSW A;  3V6D A;  2PZS A;  2HVH A;  1B9F A;  4M45 A;  2OPQ A;  2X6S A;  3AO4 A;  4CGI A;  3OS2 A;  1CZ9 A;  3P5J A;  1NJZ A;  1X9W A;  1D9F A;  2HHU A;  2G8I A;  4ELT A;  4B9M A;  4F3T A;  2PYL A;  1LAV A;  3CG7 A;  3MED A;  3SQ0 A;  1HNV A;  3KKS A;  3ZT1 A;  2D0C A;  3V4I A;  4J2A A;  2XY5 A;  1VSL A;  3G0Z A;  4Z4I A;  1HRH A;  4BWJ A;  4M41 A;  1RTD A;  4FLT A;  3PX0 A;  3DM2 A;  4ZTJ A;  4O0I A;  4DSL A;  4OLB A;  1TK5 A;  3KLI A;  4Z0U A;  4OGC A;  3TAM A;  3AVC A;  3B6O A;  1B92 A;  4I7F A;  4DTM A;  3ZT0 A;  1KLN A;  1L5U A;  4HUE A;  3K5O A;  1S1X A;  2Y1I A;  3MAQ A;  3K57 A;  1BIS A;  3VQA A;  3QES A;  3U3Y A;  1JL2 A;  2XY7 A;  2HMI A;  4GMJ B;  5JS2 A;  4YFU A;  1KVB A;  3ASM A;  3HJF A;  5HBM A;  4MFB A;  4F4K A;  4KI4 A;  2DFE A;  2IC3 A;  2Z1G A;  4B8A B;  3SV3 A;  3SQ2 A;  1U49 A;  3DLH A;  4E1M A;  3OVN A;  3WNF A;  3ZSZ A;  4I9Q A;  2E4L A;  3PO4 A;  4CHP A;  4IBN A;  1VSF A;  2JLE A;  4OPJ A;  4KAZ A;  1EX4 A;  2F96 A;  1SL1 A;  3PO5 A;  3RWU A;  1NK6 A;  5FRO A;  1LAW A;  3NAE A;  4PQU A;  3HM9 A;  1RCH A;  3RR7 A;  3IAY A;  3T1A A;  3OYE A;  1S1T A;  3NH1 A;  4KTQ A;  3NGI A;  3L2U A;  3SQ1 A;  1BCM A;  4DTU A;  1FKP A;  1W9H A;  3SJJ A;  5KRT A;  2G8W A;  1EKE A;  1FKO A;  4CER A;  4B9L A;  3HP9 A;  3HK2 A;  4IFY A;  3V9Z A;  4CJ4 A;  2VG7 A;  3DRS A;  3TAN A;  1S9G A;  4CJK A;  4NCG A;  3NGY A;  3NF7 A;  4FLY A;  3SUO A;  3L3V A;  1K6Y A;  1WN7 A;  3AA3 A;  4FZX C;  1J54 A;  4N47 A;  4GW6 A;  2QKK A;  3OYA A;  3AVA A;  1J53 A;  2G8V A;  1TK8 A;  1NJW A;  4CHY A;  1VRU A;  3QIN A;  4DFM A;  4C8M A;  3KD5 E;  1D5A A;  4M3U A;  3O4N A;  2D5R A;  5CY4 A;  2GBZ A;  3QNN A;  3WNE A;  4DSK A;  3DI6 A;  3PX4 A;  4FK2 A;  2HND A;  4O5B A;  1LW2 A;  4DMN A;  3T19 A;  3TAE A;  1NK0 A;  4MQ3 A;  2D0A A;  2FBY A;  1BQM A;  3NBP A;  1EET A;  3SYZ A;  1I3A A;  3VQB A;  5C24 A;  2HHS A;  4O0J A;  3L3U A;  4EP5 A;  4FJN A;  2YKM A;  1RT3 A;  3CFO A;  1TL1 A;  4DTS A;  3LAK A;  1NKE A;  3U3G A;  5KRS A;  1TVR A;  1IKY A;  1BI4 A;  4RW4 A;  4DFK A;  2DTU A;  2QKB A;  4N5S A;  1NKB A;  1JL1 A;  1VSH A;  4BE0 A;  1HJR A;  3LWM A;  4FJK A;  2KZM A;  1Q8I A;  5DK5 A;  1WAF A;  1WLJ A;  3V1R A;  1RT2 A;  3ZSQ A;  1LW0 A;  3AVN A;  3DYA A;  2KW4 A;  2YHB A;  3IRX A;  2RPI A;  2DFF A;  3TAP A;  4FLU A;  2KFZ A;  3KK3 A;  1TKX A;  4LSN A;  4B9S A;  1HNI A;  2FBX A;  4CF9 A;  4FJX A;  4ZTF A;  2ZE2 A;  4FZZ A;  4BWM A;  3TAB A; 
#chains in the Genus database with same CATH topology
 3SZ2 A;  4CEC A;  4KHN A;  2A42 A;  2UXB K;  4KRF A;  3J7A P;  2G8F A;  3CD6 N;  3CM6 A;  3KTQ A;  4JKF A;  2A3Z A;  4CW7 B;  4AQY K;  4DCH A;  3O1W A;  4DTN A;  1ATR A;  1X9J A;  1C1C A;  2YV0 X;  3DJC A;  2B6A A;  5JIC A;  4DSJ A;  4E1N A;  3AVH A;  2HNZ A;  4NCB A;  4DR4 K;  2VWK A;  1Q86 O;  5JVG L;  1WOQ A;  4H5V A;  1M90 O;  3LP2 A;  4LF5 K;  3TAR A;  1KCF A;  1QQN A;  3CER A;  1ZBF A;  3EEQ A;  4DFP A;  4CGH A;  1QQM A;  3SK3 A;  4O8U A;  5AQJ A;  4IWV A;  2P9U A;  2ZWH A;  2YNG A;  4YOV A;  3MMV A;  1VQ5 N;  3SAH A;  1KFD A;  3G10 A;  3ZEU A;  3NVM A;  5HLF A;  1NJI O;  3SUQ A;  4JKA A;  5BRF A;  4B9N A;  3E1Y A;  5SZT A;  1V4T A;  3CIP A;  4KB0 A;  4BR5 A;  2YHX A;  3DLR A;  1V4S A;  4CK1 A;  3C6U A;  4M63 C;  1BU6 O;  1YJ9 N;  4WF9 L;  4PKG A;  4JI6 K;  4M3Z A;  1TK0 A;  2UUC K;  2P9I B;  4JKD A;  3EKS A;  3D2E B;  3ITH A;  1RTI A;  4CGD A;  1CLQ A;  2E2Q A;  3K5L A;  4I2Q A;  5AQR A;  2RN2 A;  2XY8 A;  3DOK A;  3VA0 A;  4AF1 A;  1EP4 A;  4CJV A;  3O9U A;  3NH2 A;  3UE5 A;  3MCA B;  3J7Y P;  1NBW A;  4LF4 K;  3UKU B;  3OY9 A;  4PL7 A;  4OKK A;  2EHG A;  3L2W A;  2Y1J A;  3HL8 A;  1YF5 L;  3ZLJ A;  4BC3 A;  4LY7 A;  4FWQ A;  3WXJ A;  1HMV A;  2KTQ A;  3VQP A;  4E19 A;  3W0L A;  1T8E A;  1RT6 A;  4Y1C A;  3LM2 A;  4FJJ A;  4H0O A;  2IIR A;  5C2D A;  4OO1 J;  1SUQ A;  4F2R A;  3ZX0 A;  3AAR A;  4CZJ A;  1YIT N;  4JI3 K;  4IJA A;  1C0F A;  4MLE A;  3MEC A;  1ZBH A;  1UA1 A;  2VGN A;  4A61 A;  3JS6 A;  1NGB A;  3THV A;  4DKW A;  1JLC A;  4GY2 B;  1VSE A;  4N56 A;  2E8A A;  4EAH D;  5SWM A;  3F9K A;  3O9R A;  3THX A;  3O4Q A;  5KPR A;  3NMU A;  3MEG A;  3RMA A;  1Q18 A;  3VEW A;  1BIU A;  4FOI A;  4NLC A;  4QOZ B;  3H45 C;  1WBD A;  3O9T A;  1KLM A;  2UXD K;  3HRG A;  2Q0R A;  4H0V B;  3OHR A;  3QET A;  1FK9 A;  1W2B M;  5FLX O;  3CCU N;  5AQZ A;  1SL0 A;  5EU7 A;  4FM2 A;  5BRD A;  3AO5 A;  1HUX A;  4CFD A;  2FF6 A;  4QS8 A;  2Q1N A;  5AQL A;  4B3M K;  2BUP A;  4BRE A;  4OJR A;  1BGX T;  2QWM A;  4CGJ A;  1WSI A;  1T03 A;  3U9D A;  3AO1 A;  3EY1 A;  2P9K B;  5AQI A;  3A5N C;  1C1A A;  5AQX A;  3AGR A;  3DLG A;  3RRH A;  4GNI A;  2WTU A;  3CJC A;  3WXL A;  3I8B A;  4Z4C A;  3MN5 A;  4IDK A;  3P83 D;  4AM6 A;  5I42 A;  1S6P A;  1IBM K;  1Z26 A;  3ZT2 A;  3ZYY X;  1Y64 A;  1N34 K;  4JLH A;  3FFK B;  5AQQ A;  4H0T B;  2HVI A;  5J2M A;  2W6K A;  1P90 A;  3QEX A;  3C6H A;  3NH0 A;  1G15 A;  3BY5 A;  2D4W A;  1L3U A;  4G1Q A;  3D2F A;  1EXQ A;  5C25 A;  4JKG A;  5AQY A;  4EZ6 A;  4ILJ A;  3R3L A;  1OKJ A;  2AA4 A;  4WFB L;  3SCX A;  1HQE A;  4AHC A;  4DWI A;  4GV6 A;  2YX6 A;  4C8L A;  1R0A A;  3O8M A;  2FSN A;  1VRT A;  5CZ1 A;  3BGR A;  4CZL A;  3V9S A;  1XC9 A;  3B6P A;  3AVJ A;  2GEL A;  4DTX A;  4B1X B;  2WON A;  1BG3 A;  3FZM A;  4AM7 A;  2O8B A;  4LH5 A;  1C0U A;  4CHN A;  4JRQ A;  2ZGZ A;  5BPM A;  1QHA A;  4ID1 A;  4JKH A;  4CEO A;  4CJL A;  3G71 N;  1DEJ A;  1U45 A;  4B1U B;  4CJS A;  2A5X A;  1N36 K;  1T44 A;  5HRS A;  3ISN C;  3LPU A;  4H8K A;  3L0Q A;  4DSF A;  1P8Z A;  1KVC A;  3LM9 A;  3H3O B;  3CXC M;  1HJO A;  3QEI A;  4LFA K;  4CF0 A;  4J8F A;  1BL3 A;  3HPH A;  2O8C B;  3E9P A;  5ELZ A;  1TYQ B;  4B8C A;  2P9N A;  4CEA A;  3CHW A;  4XIU A;  1KXP A;  3DXK A;  1N6Q A;  2NLX A;  3AVF A;  3KIO A;  3HOS A;  2BE2 A;  2NRV A;  1YVU A;  3RMC A;  4HUG A;  1K8K A;  3O6W A;  4NO7 A;  1W7A A;  1KAY A;  4B1Y B;  3M1F A;  4IXC A;  1E4G T;  4JN4 A;  3EZ5 A;  4B3R K;  1ZC6 A;  3AA5 X;  2D0P A;  1BA0 A;  1XUP O;  3CJB A;  3WXI A;  2CGL A;  3OYN A;  1TL3 A;  4CZG A;  3HZ6 A;  4BR4 A;  5FRM A;  4DTJ A;  2I7P A;  3M8Q A;  1NJY A;  1HX1 A;  2KHO A;  3E66 A;  3MXM A;  4FJ8 A;  4JD2 B;  2NUB A;  2P9P B;  2VG5 A;  4WFA L;  3PIP L;  1S3X A;  4JI2 K;  3LZI A;  3DXM B;  4JI4 K;  3MX2 A;  5MLC Q;  2ZJP L;  4A57 A;  1XNQ K;  4CEE A;  4DLG A;  3TSQ A;  5KTQ A;  3P38 A;  2P1J A;  5J2P A;  4M7X A;  3TTC A;  4M3X A;  5EY4 A;  1GLA G;  4B1W B;  1RT1 A;  3VPZ A;  4BQZ A;  3KJV A;  4NCA A;  2QM1 A;  4JI7 K;  4DV2 K;  4BY9 C;  3VES A;  3V9U A;  2KZZ A;  1VSM A;  1ZXO A;  2GWK A;  4NLB A;  5A2Q O;  4FJH A;  3ZCM A;  4FPB A;  4CEQ A;  4WYB A;  3A8Y A;  4GVM A;  4DQ8 A;  1VQ4 N;  1GLE G;  1YIJ N;  2OPQ A;  3WT0 A;  2G8I A;  5LL6 Z;  4CBU A;  2PYL A;  2QWR A;  3MED A;  3K9K A;  1HNV A;  2NRX A;  3KKS A;  5AQF A;  2D0C A;  3V4I A;  4Z4I A;  1RTD A;  5M1P A;  3DM2 A;  4ZTJ A;  2GWJ A;  4O0I A;  2GEM A;  3KLI A;  1KLN A;  4BRG A;  1JCF A;  3K5O A;  1E3M A;  3LDO A;  3OBW A;  2F7T A;  2Y1I A;  3K57 A;  3QES A;  1IBL K;  1JL2 A;  2HMI A;  4GMJ B;  4A5A A;  1U49 A;  5AZI A;  2VWB A;  4E1M A;  3RVC A;  3WNF A;  2P9U B;  4I9Q A;  5GAH P;  1KAZ A;  3ZEU B;  5EOY A;  1S22 A;  2VGM A;  3VEY A;  3OYE A;  1GLF O;  4KTQ A;  3NGI A;  5KQ8 A;  3SQ1 A;  1W9H A;  5KRT A;  5AZJ A;  3HK2 A;  2VYP A;  3EKU A;  3V9Z A;  4CJ4 A;  2VG7 A;  3DRS A;  1S9G A;  1EWR A;  4FLY A;  4H0X B;  4I6M A;  2WUS A;  2VQE K;  2ZJQ L;  2QKK A;  3OYA A;  1NJW A;  3KD5 E;  3O4N A;  5CY4 A;  3K9J A;  2QI2 A;  3CME N;  1OH7 A;  4DUY K;  2NRT A;  3TAE A;  3T19 A;  1DT9 A;  2D0A A;  1EET A;  1I3A A;  2Q2R A;  3M6G A;  5C24 A;  5FPD A;  4O0J A;  3CFO A;  3G4S N;  5KRS A;  4BRD A;  4IEI A;  3WXM B;  1SS6 A;  1Q8I A;  1G99 A;  3L6Q A;  3IRX A;  3KWG A;  2RPI A;  4WCE L;  4K43 A;  1TKX A;  4LSN A;  2HHU A;  1L3T A;  4BRI A;  1JXE A;  1T6C A;  4C8O A;  3QLH A;  4B3T K;  5JS1 A;  3THX B;  4FSV A;  4M7Y A;  1NGF A;  4J2B A;  4FPA A;  1JLB A;  5KGX A;  5JMV A;  1VSK A;  1RIL A;  3RTV A;  4Y0W A;  3FR0 A;  1SV5 A;  4CZF A;  1GOA A;  4FWM A;  5HRR A;  1QTM A;  2W42 A;  4DV4 K;  2V52 B;  3HPO A;  2E88 A;  5LMN K;  1HPM A;  4KBO A;  3KK7 A;  4CIE A;  4BR0 A;  5DM6 L;  3HP6 A;  1LWF A;  4E7J A;  3C0B A;  3CC7 N;  4PL8 A;  1ZBL A;  2Z1I A;  4HUF A;  4KKO A;  2UYT A;  2DFH A;  4BRK A;  4IEE A;  3L2R A;  4B9Q A;  1WUA A;  1NGA A;  1RFQ A;  5CYM A;  5BN9 A;  2XO7 A;  3F2K A;  3SV4 A;  3V81 A;  4BRP A;  5F2R A;  1GLD G;  1YAG A;  3QEP A;  2BH1 A;  3JAM O;  4BRQ A;  3KD1 E;  4F8R A;  1VHX A;  3TR8 A;  3LDN A;  1JLG A;  1ZYQ A;  4LC9 B;  4OGE A;  2PY5 A;  1DGK N;  4FW1 A;  1ZBI A;  3KLH A;  4CI6 A;  5AQW A;  2KQ2 A;  3SPZ A;  4BRO A;  3VMF B;  1NK9 A;  3VQE A;  4LF7 K;  4CF8 A;  4LF6 K;  5AQM A;  4B1Z A;  5HRN A;  3ATV A;  1KRP A;  3D2F B;  3OYM A;  2CGK A;  4RWT A;  3DLL L;  1YUW A;  2OYQ A;  2Q0U A;  3V9W A;  1X1P A;  2KFN A;  4CBW A;  3HT3 A;  4YY3 K;  4LSL A;  3RMD A;  3AVK A;  2IVP A;  3AV9 A;  4B9U A;  4BRF A;  1KQS M;  5F0X A;  4EHU A;  2IVN A;  4B1V A;  3VF2 A;  2EWS A;  4M3R A;  4NYN A;  3O3H A;  4C23 A;  2A1R A;  1SZ2 A;  3MCP A;  1JKH A;  1VSJ A;  5AQS A;  3AVB A;  4X66 K;  2ASP A;  3CM5 A;  4H03 B;  2O8B B;  3VEV A;  2ITG A;  3S3O A;  1S5J A;  3SBG A;  4FJM A;  3ZSV A;  1U48 A;  3LDQ A;  3SNN A;  1HR0 K;  3ZX2 A;  3QEW A;  1HKB A;  1ATN A;  1OH6 A;  2ZF5 O;  4CZH A;  2WFB A;  1C6V A;  1KVA A;  1YTA A;  4W5T A;  1LCU A;  2EX3 A;  1JXB A;  5AQP A;  3VF6 A;  2OCE A;  1C1B A;  1NM1 A;  3E9L A;  4Z4F A;  2E2P A;  3EL2 A;  3SQ4 A;  4BC2 A;  5B8H A;  2ASO A;  2HST A;  4NYF A;  2P9N B;  4FJL A;  3OS1 A;  3MXJ A;  3O4W A;  3SUN A;  3DXK B;  3PSF A;  4CEF A;  4CD3 A;  4CF2 A;  3IMX A;  4L3Q A;  3ZSO A;  4CJ3 A;  1K8K B;  3I55 N;  4J2E A;  4NXM K;  3V9X A;  1NGC A;  4LH4 A;  3OBY A;  2FXU A;  3LP3 A;  4LF8 K;  2NRH A;  3ZSR A;  1RT7 A;  1KTQ A;  1W0H A;  1ZBU A;  4FZY A;  3K5M A;  4BDY A;  3HO1 A;  1HNW K;  3SLC A;  2IVO A;  1UOC A;  3R6M A;  4CFA A;  4FWN A;  4CZE A;  3LAM A;  5JLH A;  2O8F A;  4FK0 A;  2QA4 N;  4C1N I;  1Q9X A;  4BVP A;  3VA3 A;  3THW A;  4YDU C;  3RSE A;  3ZSX A;  4RW9 A;  1QQO A;  3PSI A;  1GLC G;  1RT4 A;  2VQF K;  4JK9 A;  4IG0 A;  4JI5 K;  4OKE A;  5LY3 A;  4QS9 A;  4OX9 K;  5T7B A;  1ILY A;  4R5P A;  4JK7 A;  3OJU A;  2GX9 A;  4FWP A;  5CYQ A;  4CVN E;  3TAQ A;  4DU3 A;  3A5L C;  1Y97 A;  4BRA A;  4KV8 A;  1VQ6 N;  4E7L A;  4LFC K;  4ICL A;  2P9L A;  3N4P A;  3AGK A;  1A5V A;  4PKI A;  3S41 A;  4CEZ A;  3PX6 A;  1T7P A;  1NOY A;  2QWN A;  1JLF A;  2PYJ A;  4B3S K;  1CXQ A;  2YHW A;  3SUP A;  4DV5 K;  4WFN L;  3NE6 A;  4CCH A;  4HCB A;  4PKH A;  1QHT A;  1VSI A;  1ASV A;  2OA8 A;  1RDD A;  2OPS A;  4PUO A;  3OYJ A;  2B4J A;  4AHU A;  4CE9 A;  3QIO A;  5AZI B;  4CJE A;  3CCL N;  3OA9 A;  4DF8 A;  3ZSY A;  3GDQ A;  2O4G A;  1YHQ N;  3QB0 A;  4OVL A;  5BR9 A;  1SAZ A;  5CZ2 A;  2FSJ A;  3L2V A;  1TKD A;  5AZJ B;  2XRI A;  3UB5 A;  2F8T A;  1XNR K;  1N32 K;  4MO5 A;  5I9E B;  4MO4 A;  3A5M C;  1YT3 A;  3JYT A;  4HCC A;  5AQT A;  4C8N A;  4CJW A;  4B9T A;  4I6M B;  4FLW A;  1HYV A;  1S1U A;  2ETJ A;  4BG8 A;  1GOC A;  3PUF A;  3OYL A;  4RCH A;  2Q97 A;  4F2S A;  4CFC A;  1WSF A;  3D45 A;  3CC2 N;  4CJ5 A;  3VQ6 A;  1WSJ A;  1BWF O;  2OTJ N;  1BUP A;  3KVG A;  2I5J A;  3AO2 A;  4JKE A;  5K14 A;  4FLV A;  1WNS A;  4IZ9 A;  5AQG A;  4EHT A;  4BVO A;  5CE3 A;  3OYG A;  4W5Q A;  4Y1D A;  3L4Q A;  4DTP A;  1NK8 A;  1F21 A;  1I39 A;  3QDK A;  4W5R A;  3V6D A;  2QWQ A;  4M45 A;  1NGJ A;  1D9F A;  5GAE P;  3I56 N;  3CMA N;  3CG7 A;  3FZH A;  3SQ0 A;  3ZT1 A;  3G0Z A;  4A2B A;  3PX0 A;  1VQN N;  4DSL A;  4OLB A;  1Z05 A;  4DTM A;  3CCM N;  5C2F A;  1L5U A;  3CCJ N;  4A2A A;  3CQY A;  5F1X A;  1J5E K;  2W6L A;  4YFU A;  1KVB A;  1BDG A;  1H1V A;  3KWI A;  4XH5 A;  2IC3 A;  3SQ2 A;  2Z1G A;  3C6A A;  3ENO A;  4B8A B;  1I94 K;  1GLB G;  3PO4 A;  4CHP A;  4IBN A;  5KPZ A;  4OPJ A;  2F96 A;  3PO5 A;  3RWU A;  5FRO A;  4PQU A;  3RR7 A;  3IAY A;  1ESV A;  3T1A A;  3MK6 A;  3NH1 A;  4GKK K;  4DTU A;  1EKE A;  1FKO A;  4CER A;  4BRM A;  3MN9 A;  4YOR A;  1WN7 A;  1VQL N;  1J54 A;  4GW6 A;  1J53 A;  4CHY A;  4BC5 A;  1IV0 A;  1ZBS A;  4JI8 K;  3WNE A;  4WQ4 C;  3O80 A;  4FK2 A;  2HND A;  2QTD A;  2CH6 A;  3CCQ N;  4DMN A;  4KH5 A;  4DB3 A;  2HHS A;  4EP5 A;  5M1K A;  1RT3 A;  3AY9 A;  4XEI A;  4DTS A;  1K9M O;  3U3G A;  3WQT A;  1TVR A;  1IKY A;  1BI4 A;  5BPL A;  1X3M A;  4DFK A;  2QKB A;  2KLA A;  3MN6 A;  1VSH A;  4BE0 A;  1HJR A;  2KZM A;  1RT2 A;  3ZSQ A;  3IUC A;  4DR2 K;  3J7Z O;  2KW4 A;  2O8D A;  2H3G X;  2QEX N;  4B9S A;  4CF9 A;  3L2Q A;  1NK7 A;  4CJR A;  3QEV A;  3TWH A;  2PBD A;  1OH5 A;  4BGA A;  4O55 A;  2E2O A;  3I0S A;  2QK9 A;  1YTU A;  4CZM A;  4BE2 A;  1IG8 A;  3KLE A;  1U04 A;  4L8R B;  5D3G A;  1XQS C;  1XMO K;  3NF8 A;  3TSP A;  2D0B A;  4AIL C;  4DQQ A;  2DPN A;  4JRP A;  4FM1 A;  3TPQ A;  3BDP A;  3D2E A;  4JKB A;  3TU5 A;  4XH1 A;  1LOT B;  3MN7 A;  3DMJ A;  4BR9 A;  4U67 L;  4MLH A;  5C42 A;  3C94 A;  3VEZ A;  4UQG A;  1KD1 O;  3VQ9 A;  4AHS A;  3F73 A;  3RRG A;  4BRH A;  1Q9Y A;  4CK3 A;  2OZM A;  5GAG P;  4W5N A;  4OLA A;  2FSK A;  3AVM A;  1HYZ A;  4FJ5 A;  3OYK A;  1NK4 A;  1TKZ A;  1NKC A;  5IWA K;  4HTL A;  1RBU A;  3LPT A;  3QBX A;  1NLV A;  1NG9 A;  2GTD A;  5LJW A;  1NOZ A;  3AO3 A;  1JCG A;  4CJU A;  2OAN A;  3NCI A;  5J2Q A;  4IDH A;  4C8K A;  3VQC A;  4M3W A;  1A5X A;  2IAJ A;  4BQL A;  3OTO K;  1RT5 A;  2HBL A;  3J81 O;  3BZC A;  4HWI A;  4DQI A;  3VEN A;  3LAL A;  5FPM A;  2AJQ A;  2O8F B;  2JWL A;  4JHD A;  3VOV A;  4FYD A;  3AA4 A;  3THW B;  3ID6 A;  4WE1 A;  3IKM A;  3RSE B;  2F8S A;  4GVE A;  3WNH A;  1REV A;  1Z25 A;  2Z1J A;  3MWT A;  1DLO A;  1J9A A;  1IKV A;  3C7N A;  4BRC A;  2F4V K;  4M3Y A;  5JVH L;  3NDK A;  5GIN A;  4DS5 A;  4ELV A;  4YHH K;  3C65 A;  1LWC A;  4YOX A;  3HI0 A;  3VQQ A;  3DRR A;  3LDL A;  4JS5 A;  1UAX A;  3T3F A;  5M1Q A;  3QML A;  4FWR A;  2BGG A;  3QFP A;  1NK5 A;  2QWO A;  1HKC A;  4AHT A;  1VQ8 N;  5IT9 O;  1XI1 A;  5JLF A;  2OTL N;  4IKF A;  4RW6 A;  1Q82 O;  3B8A X;  5AQK A;  1VQK N;  1WSH A;  3IS9 A;  4KH6 A;  1MDU B;  1NU0 A;  4OPA A;  2ATQ A;  4M42 A;  2NRW A;  2P9L B;  2IGI A;  5KGW A;  4LFB K;  1RDU A;  3EE9 A;  5E26 A;  1VSD A;  4JI0 K;  4CGF A;  1C0G A;  4CHQ A;  1OVY A;  3PV8 A;  4LD0 A;  3EZW A;  4KH4 A;  3K0S A;  1LWE A;  3CET A;  1RTJ A;  4H5R A;  3QER A;  5FRN A;  4ID5 A;  1BOT O;  3NVK A;  4CHZ A;  1A5W A;  1VQM N;  4IOA L;  4IO9 L;  3CC4 N;  4ELU A;  3L4I A;  3VN5 A;  1S1V A;  4K41 A;  1SKS A;  3BUZ B;  2YKN A;  4CJQ A;  3OYB A;  4LF9 K;  1SKR A;  4DS4 A;  4IO8 A;  3WUH A;  4YNQ A;  4PA1 A;  2O8E A;  4FM0 A;  2D1K A;  3NFA A;  3EYZ A;  2IDO A;  1GOB A;  3F9M A;  1M1K O;  4E7H A;  1T3V A;  4I9L A;  2BDP A;  2FF3 B;  3MEE A;  4ISE A;  5HRP A;  3AVG A;  3HOT A;  4H4M A;  2ITM A;  2X6N A;  3OYI A;  4FXD A;  2P9S A;  4CGG A;  1GLJ O;  3GG4 A;  4X65 K;  3OYF A;  1RBT A;  4MDB A;  4YOU A;  3LDP A;  3KK1 A;  3HXM A;  4BRN A;  2RHK A;  3BP8 A;  4JAX A;  1KAX A;  3C6T A;  2A1S A;  4KHP K;  4I2P A;  4CF1 A;  1ITG A;  3P4I A;  1BHL A;  1L3S A;  3NF9 A;  5H1S Q;  2O4I A;  4M3T A;  3FE1 A;  2ZJR L;  1TKT A;  1DTQ A;  4FJI A;  4F3O A;  3ULE A;  4FLZ A;  4WQ5 C;  2O8C A;  1NNE A;  1ASU A;  3LP1 A;  3EE8 A;  5TKY A;  2YI1 A;  3P39 A;  4EP4 A;  4IG3 A;  3SI6 A;  2A41 A;  3HBT A;  1XHX A;  1S72 N;  3K2P A;  3HST B;  4JKG B;  3SBT A;  4EZ9 A;  4A5B A;  3ZT3 A;  4K42 A;  3F5T A;  4FJG A;  4Q0B A;  2HBM A;  3CFR A;  3VQ8 A;  1MWK A;  4AH9 A;  4E0D A;  4Z4H A;  3SJH A;  4JV5 K;  2FBT A;  1X9M A;  2AP1 A;  2F9T A;  3VEX A;  3QNO A;  4C1N K;  4BDP A;  2HHV A;  1QZ6 A;  3O1B A;  3OS0 A;  2F9W A;  3GOI A;  2Q36 A;  3WEE A;  4MDA A;  3W3D A;  5DMR A;  3HVT A;  3S9H A;  4GV3 A;  2G8H A;  5ADX H;  5J2N A;  1RBS A;  4PY5 A;  2KFZ A;  4QCL A;  4E7K A;  3UKR A;  1HQU A;  1JLQ A;  1YJW N;  4JD2 A;  1JLE A;  2WBN A;  3O3F A;  1U6Z A;  4KHW A;  1RTH A;  3IDH A;  2LSN A;  3M8S A;  2ZQB A;  3ZT4 A;  4KRE A;  3WQU A;  4IOX A;  3CCV N;  4H0Y B;  3P1G A;  5E41 A;  1WAJ A;  3DLB A;  2G8K A;  1O13 A;  3DLE A;  3RR8 A;  1QVG M;  2UU9 K;  5AQU A;  2X74 A;  4FWK A;  3Q7C A;  1TAQ A;  1T05 A;  4F9O A;  2YNF A;  4DUZ K;  1YVN A;  3SMS A;  3C95 A;  3DAW A;  4CIG A;  3S3M A;  3G25 A;  3U6F A;  3KKR A;  4GV9 A;  2HF4 A;  2YNH A;  4HVJ A;  4Z4G A;  4RTF D;  3LDS A;  3VQ4 A;  2GV9 A;  3SAG A;  3CFP A;  1BO5 O;  1RDW X;  1BA1 A;  3GE1 A;  2YNI A;  3BEX A;  3BF1 A;  4CJF A;  1SL2 A;  1MU2 A;  1NJX A;  3CCR N;  1BI4 B;  2YHY A;  4BG9 A;  4AHR A;  4TSX A;  2Q31 A;  4RG8 A;  2VCP A;  4BGB A;  2HF3 A;  2A6A A;  2HB5 A;  3D6R A;  1C0T A;  5BRH A;  1JJ2 M;  2O8D B;  4IFE A;  2P51 A;  3J8A A;  3LZJ A;  4H4O A;  1QSY A;  4YOW A;  2IS3 A;  2PZS A;  2HVH A;  2X6S A;  3AO4 A;  3TTF A;  3P5J A;  2E2N A;  1NGH A;  5HL7 L;  4ELT A;  4B9M A;  4F3T A;  1EQY A;  1LAV A;  4J2A A;  1VSL A;  4BWJ A;  5EXW A;  1VQO N;  4DHY A;  3MX5 A;  1TK5 A;  4Z0U A;  4OGC A;  3AVC A;  3B6O A;  1B92 A;  4I7F A;  3ZT0 A;  4GKJ K;  3MAQ A;  3D7E O;  3VQA A;  3AAP A;  3HJF A;  1NGE A;  4MFB A;  4KI4 A;  2DFE A;  3DLH A;  1MA9 B;  2HHH K;  4FOE A;  4WQ4 A;  1VSF A;  2JLE A;  2NZT A;  3I33 A;  2A40 A;  1SL1 A;  1NK6 A;  1LAW A;  5CR4 A;  3NAE A;  3HM9 A;  1RCH A;  4IJN A;  1S1T A;  1R59 O;  3M5R A;  3SJJ A;  2W41 A;  3HP9 A;  4IFY A;  1NGG A;  5HOO A;  3TAN A;  3ATU A;  1JCE A;  3VTH A;  2ZM6 K;  3NF7 A;  3SUO A;  5ADX A;  3AA3 A;  1ATS A;  2JWK A;  3CJ1 A;  3AVA A;  2G8V A;  1TK8 A;  1VRU A;  3J80 O;  4DFM A;  4C8M A;  1D5A A;  2WC9 A;  2D5R A;  4JHD B;  2GBZ A;  4DSK A;  4G9Z A;  4FWO A;  4O5B A;  3H1V X;  4CJ7 A;  1LW2 A;  2FBY A;  1BQM A;  3NBP A;  3SYZ A;  3VQB A;  3MDQ A;  4FJN A;  3L3U A;  2W40 A;  1TL1 A;  3C7N B;  4RW4 A;  4N5S A;  1JL1 A;  5C0Y A;  3CI5 A;  5DK5 A;  3V1R A;  1WLJ A;  5DM7 L;  3VGM A;  3DYA A;  3VGL A;  4E1J A;  4O8K A;  2YHB A;  1X3N A;  3KK3 A;  1YXQ A;  2FBX A;  4FJX A;  2V51 B;  4ZTF A;  2ZE2 A;  3TAB A;  3H08 A;  4FL9 A;  2R7Y A;  4BRL A;  4O4G A;  3DOL A;  1QQC A;  2D0O A;  1NGI A;  5KI6 A;  2HBK A;  4BR2 A;  4DQP A;  1BIZ A;  3IFR A;  1D4X A;  4AHV A;  3L8B A;  1QZ5 A;  4HTU A;  1VQP N;  1BCO A;  2E6M A;  2XY6 A;  2OPR A;  2HOE A;  1IG9 A;  1TUU A;  3HVR A;  3QIP A;  3FZF A;  4UY8 O;  4YOY A;  3WNG A;  4H5T A;  5M1O A;  2RF2 A;  3HYF A;  2OZS A;  4BDZ A;  1HLU A;  3PY8 A;  1TUY A;  1WSG A;  4OPK A;  4DV7 K;  4PWD A;  2X78 A;  1IKW A;  3U9Z A;  5KQD A;  3CJ7 A;  4O5F A;  1CZB A;  4B3O A;  4DLE A;  4DR5 K;  1U47 A;  2E20 A;  4CES A;  4E3S A;  4JS4 A;  2FC0 A;  3VQ7 A;  4CD1 A;  3MXI A;  1TGO A;  1Q7Y O;  3CCE N;  2HHX A;  3FZL A;  4O44 A;  1CXU A;  2O8E B;  3O9Q A;  3ZET A;  3TTD A;  1K73 O;  4IOC L;  1S9E A;  1SKW A;  2YHA A;  3V1Q A;  3DWL A;  2QXL A;  4X62 K;  4U7B A;  3ENH A;  3IG1 A;  3JSM A;  2ASM A;  5BN8 A;  1XMQ K;  4DTR A;  3HSC A;  2B5J A;  5C12 A;  1W97 L;  3H6E A;  4JI1 K;  3CJA A;  3S3N A;  3E01 A;  3R9P A;  1EO1 A;  2P9S B;  4JNE A;  4FW2 A;  3THY A;  2BTF A;  4B08 A;  2NRR A;  2VG6 A;  4FVM A;  1QSL A;  1ASW A;  2QWP A;  4CIF A;  1N33 K;  3QFU A;  3A2F A;  1Q81 O;  4A62 A;  4K8Z A;  3H46 O;  1DKG D;  3LP0 A;  3KLF A;  2ZGY A;  4FCY A;  5HRO A;  4ZHR A;  4CJT A;  4KB1 A;  4DFJ A;  1J5O A;  4ILG B;  4Z94 A;  4RW8 A;  4QS7 A;  5AQN A;  1QVF M;  1FJG K;  3VQ5 A;  1U2V A;  3N4Q A;  1IO2 A;  4DQS A;  1D9D A;  3NF6 A;  3FZK A;  2G8U A;  3ID8 A;  3EO3 A;  4H0P A;  4FWS A;  3ULE B;  1YI2 N;  5J1E A;  4FJ7 A;  1SQK A;  2YJF A;  1VK0 A;  5GIP A;  5AJ3 K;  1DTT A;  1YJN N;  4Q5V A;  2IOC A;  2UUB K;  3CJ9 A;  2QW9 A;  1Z6R A;  1S1W A;  4DR1 K;  3KZB A;  2KKZ A;  3K58 A;  3GL1 A;  2HW3 A;  3ZX3 A;  3OYH A;  1RDC A;  3RMB A;  5LMU K;  2P5O A;  1HYS A;  3OYD A;  3OYC A;  4H5N A;  1FXX A;  3TI0 A;  1N8R O;  3Q7B A;  1N5Y A;  3G6E N;  4DV1 K;  3V1O A;  2GUI A;  3WEE B;  4XH4 A;  1B9D A;  3VEO A;  4FWL A;  1D8Y A;  2Q3S A;  3ALY A;  3TAF A;  1CZA N;  3R8E A;  3VQD A;  3UKR B;  3AAQ A;  4FJ9 A;  1KFS A;  4KTZ A;  1OH8 A;  1KSP A;  1NMN A;  1OVQ A;  1HNX K;  2BAN A;  4DR6 K;  4DG1 A;  2WOM A;  3FLC O;  3FFI A;  3KK2 A;  3HPG A;  4ILH A;  3TAG A;  1WBB A;  5BPN A;  4NXN K;  3NHG A;  5HP1 A;  4J2D A;  4DSI A;  2P9I A;  4JYA K;  4KTW A;  5M1F A;  4DV0 K;  1K8A O;  3OJS A;  2FLO A;  3P31 A;  4CED A;  2RKI A;  2GUP A;  4QAG A;  4N41 A;  5AFU H;  4WQ5 A;  1L3V A;  3AVL A;  4E89 A;  4FK4 A;  2HHW A;  1J6Z A;  3BF3 A;  3GBT A;  4ISF A;  3UKU A;  4CFB A;  4CZK A;  1IJJ A;  5C15 A;  4FLX A;  4W5O A;  3CPW M;  4BAC A;  2HBJ A;  3ENB A;  3CYM A;  4V19 S;  1NMD A;  2YJE A;  5M1N A;  4CEB A;  3SPY A;  5FDL A;  3A0I X;  4FVU A;  4EIA A;  4KHS A;  4OKJ A;  3QO9 A;  4IFV A;  4X64 K;  5AQV A;  4KHY A;  3CCS N;  4DU4 A;  1C0M A;  3CQ8 A;  2HNY A;  3QIC A;  3DLK A;  2CH5 A;  3I8D A;  5AQH A;  3OW2 M;  3SMP A;  2PAV A;  4JKC A;  3U8X A;  3TSU A;  3ULD A;  2HMP A;  2QXF A;  5GAD P;  3VER A;  1XHZ A;  4KI6 A;  3T1Y K;  2J4R A;  1QS4 A;  3U4L A;  3VGK A;  5E84 A;  4CZI A;  2HHT A;  3D0P A;  4DQR A;  4KPY A;  4DSE A;  1XC3 A;  4CK2 A;  1HNZ K;  1X9S A;  2DY4 A;  1O1W A;  3O5B A;  3K5N A;  2HHQ A;  1E4F T;  5AQO A;  1RDA A;  5TKW A;  2CGJ A;  4CHO A;  4E7I A;  3MWP A;  2Z1H A;  4DF4 A;  1XWL A;  4DV3 K;  1VAZ A;  3I0R A;  4B9V A;  1TAU A;  3KLG A;  1RBV A;  3QBW A;  3CPE A;  4KFB A;  5BR8 K;  1QSS A;  1WSE A;  2ZD1 A;  2P9K A;  4HHT A;  2E1Y A;  1LV5 A;  2OPP A;  3UIQ A;  3AVI A;  5FPE A;  2XHB A;  2E6L A;  3M8P A;  4A59 A;  2E1Z A;  3HM8 A;  3M8R A;  2FBV A;  1RNH A;  1S6Q A;  3K59 A;  4DR3 K;  3M3Z A;  2PFU A;  1RBR A;  2JGU A;  1KC8 O;  3DRP A;  3CF5 L;  1UA0 A;  4Z4E A;  4K8X A;  4DU1 A;  4KHQ A;  3WXK A;  4YDU A;  4DV6 K;  1JLA A;  2V7Z A;  4K25 A;  2I7N A;  3NGZ A;  2P5G A;  4KHU A;  4KO0 A;  3O3G A;  2NRZ A;  3LAN A;  5KPT A;  4PHT X;  4CJP A;  1EWQ A;  5LJV A;  3R1X A;  4DR7 K;  4R79 A;  1HPZ A;  1UWB A;  2E5L K;  1IKX A;  1BQN A;  3AA2 A;  4RW7 A;  4DTO A;  1QE1 A;  4BE1 A;  5I3U A;  3JXU A;  5AFU A;  1IH7 A;  2UUA K;  3T7Z A;  3BZK A;  3HTV A;  1VQ9 N;  5C10 A;  1GLL O;  1RDB A;  4ISG A;  2VWJ A;  4N76 A;  1TV6 A;  1FW6 A;  1U4B A;  1HKG A;  3LWL A;  4JK8 A;  3ZSW A;  1B9F A;  4CGI A;  3OS2 A;  1X9W A;  1CZ9 A;  1NJZ A;  2RE2 A;  4EFH A;  3H3N O;  3VET A;  2V7Y A;  4JEP A;  3VTI A;  2XY5 A;  1HRH A;  4M41 A;  5BRE A;  1WB9 A;  4FLT A;  1TYQ A;  3SAF A;  3TAM A;  3FGU A;  4BR7 A;  4FO0 A;  3T69 A;  4CBX A;  4HUE A;  3CQX A;  1S1X A;  4NB4 A;  3VF4 A;  1BIS A;  3U3Y A;  2XY7 A;  1VQ7 N;  5JS2 A;  3ASM A;  5HBM A;  4F4K A;  3PIO L;  3SV3 A;  3OVN A;  3ZSZ A;  2E4L A;  4H5W A;  5EVZ A;  4KAZ A;  1EX4 A;  4K0K K;  3L2U A;  1BCM A;  1FKP A;  1RGI A;  2UXC K;  2G8W A;  4OPH A;  3ZET B;  4B9L A;  1T6D A;  2YCH A;  5GIO A;  4CJK A;  4NCG A;  3NGY A;  3L3V A;  1K6Y A;  4FZX C;  3PLA A;  4N47 A;  2P9P A;  3T1H K;  5CHI A;  3DXM A;  3QIN A;  4M3U A;  3QNN A;  2QWL A;  3O9S A;  3KHY A;  3THY B;  3O08 A;  3DI6 A;  3PX4 A;  1NGD A;  3H1Q A;  4MQ3 A;  1NK0 A;  1NWK A;  3LL3 A;  1MWM A;  3E9O A;  5EX5 A;  2YKM A;  2NNW A;  3LAK A;  1NKE A;  5FPN A;  2DTU A;  1NKB A;  5AR0 A;  3LWM A;  4FJK A;  4BC4 A;  1WAF A;  4YOT A;  1LW0 A;  1U2V B;  3AVN A;  3EN9 A;  2DFF A;  3TAP A;  4FLU A;  1IBK K;  1HNI A;  3A5O C;  4FZZ A;  4BWM A; 
#chains in the Genus database with same CATH homology
 3H08 A;  3L2Q A;  1L3T A;  3SZ2 A;  4CEC A;  2R7Y A;  1NK7 A;  4KHN A;  4O4G A;  4CJR A;  3QEV A;  3TWH A;  1JXE A;  3DOL A;  1QQC A;  5KI6 A;  4KRF A;  4C8O A;  4KB1 A;  3QLH A;  2G8F A;  4DQP A;  1BIZ A;  5JS1 A;  3CM6 A;  4O55 A;  3KTQ A;  3L8B A;  4AHV A;  3I0S A;  2QK9 A;  4HTU A;  1YTU A;  4DTN A;  4BE2 A;  1BCO A;  2E6M A;  2XY6 A;  1C1C A;  2OPR A;  4J2B A;  1JLB A;  2YV0 X;  5KGX A;  2B6A A;  3KLE A;  1U04 A;  1IG9 A;  4DSJ A;  4E1N A;  1VSK A;  3QIP A;  1RIL A;  3AVH A;  3HVR A;  3RTV A;  3WNG A;  2HNZ A;  4L8R B;  4NCB A;  5D3G A;  3NF8 A;  2VWK A;  1SV5 A;  2D0B A;  2RF2 A;  1GOA A;  3HYF A;  4AIL C;  2OZS A;  4BDZ A;  4DQQ A;  3PY8 A;  5HRR A;  1QTM A;  1WSG A;  4JRP A;  3LP2 A;  4OPK A;  2W42 A;  4FM1 A;  3TAR A;  1KCF A;  3BDP A;  3HPO A;  1ZBF A;  4PWD A;  2X78 A;  1IKW A;  3DMJ A;  4DFP A;  4CIE A;  5C42 A;  3C94 A;  4CGH A;  1CZB A;  4UQG A;  4B3O A;  3VQ9 A;  4AHS A;  1LWF A;  3HP6 A;  3F73 A;  4DLE A;  4E7J A;  3RRG A;  1U47 A;  2YNG A;  4CES A;  2Z1I A;  4CK3 A;  4KKO A;  4HUF A;  1ZBL A;  1Q9Y A;  2OZM A;  4W5N A;  2DFH A;  4OLA A;  1KFD A;  3AVM A;  1HYZ A;  3G10 A;  4E3S A;  5HLF A;  3L2R A;  4JS4 A;  3OYK A;  4FJ5 A;  1NK4 A;  1TKZ A;  3SUQ A;  1NKC A;  2FC0 A;  3VQ7 A;  1RBU A;  1TGO A;  2XO7 A;  3MXI A;  5CYM A;  5SZT A;  3LPT A;  3SV4 A;  4B9N A;  4KB0 A;  3V81 A;  2HHX A;  3DLR A;  1NOZ A;  3AO3 A;  4O44 A;  4CK1 A;  1CXU A;  3C6U A;  4CJU A;  3QEP A;  1S9E A;  3NCI A;  5J2Q A;  4M3Z A;  1SKW A;  1TK0 A;  2YHA A;  3V1Q A;  3KD1 E;  4F8R A;  4C8K A;  3VQC A;  3TR8 A;  4M3W A;  1A5X A;  1JLG A;  1ZYQ A;  4OGE A;  2IAJ A;  3IG1 A;  3ITH A;  1RTI A;  4CGD A;  3JSM A;  2PY5 A;  1CLQ A;  4FW1 A;  1ZBI A;  3KLH A;  3K5L A;  1RT5 A;  4I2Q A;  2RN2 A;  2XY8 A;  4DTR A;  3DOK A;  2B5J A;  2KQ2 A;  3VA0 A;  1EP4 A;  4DQI A;  3S3N A;  3SPZ A;  3LAL A;  3E01 A;  4CJV A;  3NH2 A;  1NK9 A;  2AJQ A;  3VQE A;  4FYD A;  4FW2 A;  4CF8 A;  5HRN A;  3AA4 A;  3OY9 A;  4WE1 A;  4OKK A;  4B08 A;  2F8S A;  2VG6 A;  4FVM A;  3WNH A;  1KRP A;  1REV A;  1QSL A;  2EHG A;  1ASW A;  3OYM A;  3L2W A;  2Y1J A;  2OYQ A;  4CIF A;  3V9W A;  3HL8 A;  1X1P A;  1Z25 A;  2Z1J A;  3HT3 A;  2KFN A;  4LSL A;  3RMD A;  4LY7 A;  1DLO A;  3AVK A;  3A2F A;  4K8Z A;  1J9A A;  3KLF A;  1IKV A;  3LP0 A;  3AV9 A;  4FCY A;  4B9U A;  1HMV A;  4M3Y A;  2KTQ A;  3VQP A;  4ZHR A;  4CJT A;  4E19 A;  5HRO A;  4ELV A;  3NDK A;  4DS5 A;  4DFJ A;  1T8E A;  1RT6 A;  4Y1C A;  1J5O A;  4FJJ A;  1LWC A;  4RW8 A;  4M3R A;  4NYN A;  1SUQ A;  3DRR A;  3VQ5 A;  3VQQ A;  4F2R A;  1IO2 A;  4JS5 A;  4DQS A;  1UAX A;  3T3F A;  1D9D A;  3NF6 A;  3O3H A;  2G8U A;  3MEC A;  2A1R A;  1ZBH A;  2BGG A;  1UA1 A;  1NK5 A;  1JKH A;  1VSJ A;  5J1E A;  4FJ7 A;  3AVB A;  3THV A;  4AHT A;  3CM5 A;  1JLC A;  1XI1 A;  4IKF A;  2ITG A;  4RW6 A;  1S5J A;  1VSE A;  4N56 A;  1VK0 A;  3S3O A;  5SWM A;  4FJM A;  3ZSV A;  1U48 A;  1WSH A;  3IS9 A;  3F9K A;  1DTT A;  3SNN A;  3O4Q A;  2ATQ A;  2IOC A;  3MEG A;  4Q5V A;  3QEW A;  3RMA A;  4M42 A;  1S1W A;  2IGI A;  5KGW A;  1BIU A;  1C6V A;  1VSD A;  3K58 A;  4QOZ B;  2HW3 A;  1KLM A;  1KVA A;  4CGF A;  3OYH A;  4CHQ A;  1RDC A;  3RMB A;  1YTA A;  4W5T A;  2P5O A;  3PV8 A;  1HYS A;  4LD0 A;  2EX3 A;  1JXB A;  3OYD A;  3OYC A;  3QET A;  1LWE A;  1FK9 A;  1RTJ A;  1FXX A;  3QER A;  3TI0 A;  1C1B A;  1N5Y A;  5FRN A;  4ID5 A;  4Z4F A;  1SL0 A;  5EU7 A;  3V1O A;  4FM2 A;  2GUI A;  4CHZ A;  3SQ4 A;  1A5W A;  4NYF A;  1B9D A;  4FJL A;  3AO5 A;  3OS1 A;  3MXJ A;  4CFD A;  3SUN A;  1D8Y A;  2Q3S A;  3ALY A;  3TAF A;  4ELU A;  4CEF A;  3VQD A;  4CF2 A;  4OJR A;  4FJ9 A;  1BGX T;  3VN5 A;  1KFS A;  3ZSO A;  4KTZ A;  4CGJ A;  4CJ3 A;  1WSI A;  1S1V A;  1SKS A;  1T03 A;  1KSP A;  4J2E A;  2YKN A;  4CJQ A;  3AO1 A;  3OYB A;  3V9X A;  2BAN A;  3EY1 A;  4DG1 A;  4LH4 A;  2WOM A;  4DS4 A;  4YNQ A;  1C1A A;  1SKR A;  3FFI A;  4PA1 A;  3DLG A;  3LP3 A;  3KK2 A;  3HPG A;  4FM0 A;  3RRH A;  3TAG A;  3ZSR A;  1RT7 A;  3NFA A;  3EYZ A;  3NHG A;  5HP1 A;  1KTQ A;  1W0H A;  1GOB A;  2IDO A;  4J2D A;  4DSI A;  1ZBU A;  4Z4C A;  4IDK A;  3P83 D;  5I42 A;  4FZY A;  3K5M A;  1S6P A;  4KTW A;  4BDY A;  1Z26 A;  3ZT2 A;  3OJS A;  4E7H A;  3HO1 A;  4I9L A;  4JLH A;  1UOC A;  2HVI A;  4CFA A;  4CED A;  2RKI A;  2BDP A;  5HRP A;  3MEE A;  4QAG A;  5J2M A;  3AVG A;  3LAM A;  4N41 A;  4H4M A;  4FXD A;  2X6N A;  3OYI A;  3QEX A;  3AVL A;  4E89 A;  1L3V A;  4CGG A;  4FK4 A;  4FK0 A;  3NH0 A;  2HHW A;  1G15 A;  1Q9X A;  3OYF A;  4CFB A;  3VA3 A;  1RBT A;  1L3U A;  4G1Q A;  3KK1 A;  3ZSX A;  4FLX A;  3HXM A;  4W5O A;  4RW9 A;  4BAC A;  1EXQ A;  3CYM A;  5C25 A;  3C6T A;  4EZ6 A;  1RT4 A;  2A1S A;  4I2P A;  4CF1 A;  1ITG A;  3SCX A;  1HQE A;  1BHL A;  4IG0 A;  1L3S A;  3NF9 A;  4OKE A;  4AHC A;  4CEB A;  4DWI A;  2O4I A;  3SPY A;  5FDL A;  4C8L A;  4M3T A;  1R0A A;  1VRT A;  5CZ1 A;  3BGR A;  5T7B A;  3V9S A;  4KHS A;  4OKJ A;  4R5P A;  1XC9 A;  3B6P A;  1TKT A;  3AVJ A;  1DTQ A;  3QO9 A;  4IFV A;  3OJU A;  4DTX A;  4F3O A;  4FJI A;  5CYQ A;  4KHY A;  4FLZ A;  4DU4 A;  1C0M A;  3TAQ A;  1ASU A;  2WON A;  3LP1 A;  3CQ8 A;  4DU3 A;  2HNY A;  1Y97 A;  3DLK A;  4LH5 A;  4EP4 A;  3I8D A;  1C0U A;  4CHN A;  4JRQ A;  4IG3 A;  3SI6 A;  4KV8 A;  1XHX A;  4E7L A;  3K2P A;  3ULD A;  4ICL A;  3HST B;  4ID1 A;  2QXF A;  4EZ9 A;  4CEO A;  4KI6 A;  1XHZ A;  4CJL A;  3ZT3 A;  1A5V A;  1QS4 A;  1U45 A;  4CEZ A;  4CJS A;  3PX6 A;  1T7P A;  1NOY A;  4FJG A;  5HRS A;  4Q0B A;  2HHT A;  3D0P A;  1JLF A;  4DQR A;  3ISN C;  3LPU A;  2PYJ A;  4KPY A;  4H8K A;  3CFR A;  4DSE A;  4CK2 A;  1CXQ A;  4DSF A;  1X9S A;  1KVC A;  3VQ8 A;  2DY4 A;  1O1W A;  4AH9 A;  4E0D A;  4Z4H A;  3SUP A;  3K5N A;  2HHQ A;  2FBT A;  1X9M A;  3QEI A;  4CF0 A;  1RDA A;  1BL3 A;  3NE6 A;  4CCH A;  3HPH A;  3QNO A;  4BDP A;  2HHV A;  3OS0 A;  4HCB A;  4CHO A;  4E7I A;  1QHT A;  2Z1H A;  4DF4 A;  4B8C A;  4CEA A;  1XWL A;  1VSI A;  5DMR A;  4XIU A;  3HVT A;  1ASV A;  3I0R A;  1N6Q A;  3S9H A;  4B9V A;  2G8H A;  2OA8 A;  1RDD A;  1TAU A;  2OPS A;  5J2N A;  1RBS A;  3AVF A;  3KIO A;  3OYJ A;  3KLG A;  1RBV A;  4PUO A;  4PY5 A;  4E7K A;  4QCL A;  1HQU A;  2B4J A;  2BE2 A;  1YVU A;  1JLQ A;  4AHU A;  3RMC A;  4CE9 A;  4KFB A;  4HUG A;  1JLE A;  3O3F A;  4KHW A;  1QSS A;  1WSE A;  1RTH A;  2ZD1 A;  3QIO A;  4HHT A;  3EZ5 A;  1LV5 A;  3AA5 X;  4CJE A;  2OPP A;  4DF8 A;  3ZSY A;  3AVI A;  2LSN A;  3UIQ A;  2XHB A;  2O4G A;  3M8S A;  2E6L A;  2ZQB A;  3ZT4 A;  3M8P A;  4OVL A;  4KRE A;  3M8R A;  3P1G A;  2FBV A;  5CZ2 A;  5E41 A;  1WAJ A;  3L2V A;  2G8K A;  3DLE A;  3DLB A;  3OYN A;  1RNH A;  1TL3 A;  1S6Q A;  3RR8 A;  3K59 A;  1TKD A;  2X74 A;  5FRM A;  4DTJ A;  2XRI A;  2F8T A;  1RBR A;  1TAQ A;  2JGU A;  1T05 A;  3DRP A;  1UA0 A;  4Z4E A;  3M8Q A;  4K8X A;  1NJY A;  2YNF A;  4DU1 A;  1YT3 A;  4KHQ A;  3JYT A;  4HCC A;  3MXM A;  4FJ8 A;  1JLA A;  2NUB A;  4C8N A;  4CJW A;  3C95 A;  4B9T A;  4CIG A;  2VG5 A;  3S3M A;  3NGZ A;  3U6F A;  3KKR A;  2P5G A;  4KHU A;  3LZI A;  2YNH A;  4FLW A;  4KO0 A;  4HVJ A;  1HYV A;  1S1U A;  3O3G A;  4Z4G A;  3LDS A;  3LAN A;  3VQ4 A;  2ETJ A;  2GV9 A;  4CEE A;  4CJP A;  1GOC A;  3PUF A;  4DLG A;  5KTQ A;  3CFP A;  3OYL A;  2P1J A;  5J2P A;  4F2S A;  1HPZ A;  2YNI A;  1UWB A;  1IKX A;  1BQN A;  4CFC A;  4M3X A;  1WSF A;  3D45 A;  3AA2 A;  1RT1 A;  4CJF A;  4CJ5 A;  3VQ6 A;  1SL2 A;  1MU2 A;  1WSJ A;  4RW7 A;  4DTO A;  1QE1 A;  1NJX A;  4BE1 A;  1BI4 B;  3KJV A;  5I3U A;  4NCA A;  4AHR A;  4TSX A;  4RG8 A;  2I5J A;  3AO2 A;  5K14 A;  4FLV A;  3V9U A;  1WNS A;  2KZZ A;  2HB5 A;  1VSM A;  1C0T A;  1IH7 A;  3OYG A;  4FJH A;  3ZCM A;  2P51 A;  4W5Q A;  4CEQ A;  4Y1D A;  4DTP A;  1NK8 A;  3LZJ A;  2VWJ A;  1F21 A;  1RDB A;  1I39 A;  4H4O A;  4N76 A;  4W5R A;  1TV6 A;  4GVM A;  1QSY A;  1U4B A;  3LWL A;  2IS3 A;  3ZSW A;  3V6D A;  2PZS A;  2HVH A;  1B9F A;  4M45 A;  2OPQ A;  2X6S A;  3AO4 A;  4CGI A;  3OS2 A;  1CZ9 A;  3P5J A;  1NJZ A;  1X9W A;  1D9F A;  2HHU A;  2G8I A;  4ELT A;  4B9M A;  4F3T A;  2PYL A;  1LAV A;  3CG7 A;  3MED A;  3SQ0 A;  1HNV A;  3KKS A;  3ZT1 A;  2D0C A;  3V4I A;  4J2A A;  2XY5 A;  1VSL A;  3G0Z A;  4Z4I A;  1HRH A;  4BWJ A;  4M41 A;  1RTD A;  4FLT A;  3PX0 A;  3DM2 A;  4ZTJ A;  4O0I A;  4DSL A;  4OLB A;  1TK5 A;  3KLI A;  4Z0U A;  4OGC A;  3TAM A;  3AVC A;  3B6O A;  1B92 A;  4I7F A;  4DTM A;  3ZT0 A;  1KLN A;  1L5U A;  4HUE A;  3K5O A;  1S1X A;  2Y1I A;  3MAQ A;  3K57 A;  1BIS A;  3VQA A;  3QES A;  3U3Y A;  1JL2 A;  2XY7 A;  2HMI A;  4GMJ B;  5JS2 A;  4YFU A;  1KVB A;  3ASM A;  3HJF A;  5HBM A;  4MFB A;  4F4K A;  4KI4 A;  2DFE A;  2IC3 A;  2Z1G A;  4B8A B;  3SV3 A;  3SQ2 A;  1U49 A;  3DLH A;  4E1M A;  3OVN A;  3WNF A;  3ZSZ A;  4I9Q A;  2E4L A;  3PO4 A;  4CHP A;  4IBN A;  1VSF A;  2JLE A;  4OPJ A;  4KAZ A;  1EX4 A;  2F96 A;  1SL1 A;  3PO5 A;  3RWU A;  1NK6 A;  5FRO A;  1LAW A;  3NAE A;  4PQU A;  3HM9 A;  1RCH A;  3RR7 A;  3IAY A;  3T1A A;  3OYE A;  1S1T A;  3NH1 A;  4KTQ A;  3NGI A;  3L2U A;  3SQ1 A;  1BCM A;  4DTU A;  1FKP A;  1W9H A;  3SJJ A;  5KRT A;  2G8W A;  1EKE A;  1FKO A;  4CER A;  4B9L A;  3HP9 A;  3HK2 A;  4IFY A;  3V9Z A;  4CJ4 A;  2VG7 A;  3DRS A;  3TAN A;  1S9G A;  4CJK A;  4NCG A;  3NGY A;  3NF7 A;  4FLY A;  3SUO A;  3L3V A;  1K6Y A;  1WN7 A;  3AA3 A;  4FZX C;  1J54 A;  4N47 A;  4GW6 A;  2QKK A;  3OYA A;  3AVA A;  1J53 A;  2G8V A;  1TK8 A;  1NJW A;  4CHY A;  1VRU A;  3QIN A;  4DFM A;  4C8M A;  3KD5 E;  1D5A A;  4M3U A;  3O4N A;  2D5R A;  5CY4 A;  2GBZ A;  3QNN A;  3WNE A;  4DSK A;  3DI6 A;  3PX4 A;  4FK2 A;  2HND A;  4O5B A;  1LW2 A;  4DMN A;  3T19 A;  3TAE A;  1NK0 A;  4MQ3 A;  2D0A A;  2FBY A;  1BQM A;  3NBP A;  1EET A;  3SYZ A;  1I3A A;  3VQB A;  5C24 A;  2HHS A;  4O0J A;  3L3U A;  4EP5 A;  4FJN A;  2YKM A;  1RT3 A;  3CFO A;  1TL1 A;  4DTS A;  3LAK A;  1NKE A;  3U3G A;  5KRS A;  1TVR A;  1IKY A;  1BI4 A;  4RW4 A;  4DFK A;  2DTU A;  2QKB A;  4N5S A;  1NKB A;  1JL1 A;  1VSH A;  4BE0 A;  1HJR A;  3LWM A;  4FJK A;  2KZM A;  1Q8I A;  5DK5 A;  1WAF A;  1WLJ A;  3V1R A;  1RT2 A;  3ZSQ A;  1LW0 A;  3AVN A;  3DYA A;  2KW4 A;  2YHB A;  3IRX A;  2RPI A;  2DFF A;  3TAP A;  4FLU A;  2KFZ A;  3KK3 A;  1TKX A;  4LSN A;  4B9S A;  1HNI A;  2FBX A;  4CF9 A;  4FJX A;  4ZTF A;  2ZE2 A;  4FZZ A;  4BWM A;  3TAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...