1RDAA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTNGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdaA00
3C95A 3S3OA 1JXBA 4KREA 2O4GA 2Z1JA 4KTWA 1DTTA 2BE2A 2AJQA 2DTUA 4ICLA 3DOKA 4CHNA 4E7LA 3DOLA 4GVMA 4I9LA 5FDLA 4CFCA 2P51A 4BDZA 2QKBA 3B6OA 3MEEA 4RG8A 4W5QA 3OYAA 3K59A 3SV4A 3PO5A 4C8LA 3TI0A 4HCCA 4M42A 4BE1A 2A1RA 3LAMA 3C6UA 4C8MA 3M8SA 5CY4A 4DTNA 1REVA 4FJGA 2NUBA 4GW6A 4B8AB 4B9MA 4KTZA 4E19A 4CEAA 1BQNA 5HRSA 3ZSYA 4HTUA 1U47A 3VQPA 1NK4A 4ZTFA 4MQ3A 3ZT2A 4CERA 3NDKA 1RDCA 1TK5A 2P1JA 1NK0A 5KRSA 4HVJA 2IGIA 1LAVA 1JLFA 4AILC 4DSFA 1Q8IA 4BE2A 4DTRA 3CQ8A 3ZSVA 1VSLA 2RF2A 2P5GA 3VQ5A 4LY7A 5KI6A 4CGHA 3M8QA 5J2NA 4DFJA 1U48A 1FK9A 1WSHA 3MXJA 3LALA 4EP5A 4OJRA 3OJUA 1HPZA 1TK8A 3WNGA 4B9VA 1ASWA 4KI6A 3CM5A 4B08A 1RT6A 4DSIA 1XWLA 3CG7A 3DM2A 3P5JA 1SL1A 4DTMA 1FKPA 3AVNA 1QS4A 1NJWA 4CJRA 4BE0A 5SZTA 5EU7A 4CJPA 3WNEA 4I2PA 4FJIA 3ZT0A 1C1CA 1WN7A 1RTJA 3ZSRA 3U3YA 4O55A 1GOBA 1VSMA 4CJWA 2VG5A 4N56A 3QERA 3QEXA 5D3GA 4CGIA 4RW9A 3NH2A 3SQ0A 3V9SA 4J2AA 2HVHA 4YFUA 1RDBA 2FBVA 4HUGA 2F8TA 4CF1A 2LSNA 3QEVA 4M3RA 1Z25A 1TV6A 3HP6A 3HPHA 4QAGA 4E7HA 3SNNA 1EETA 4CK1A 1XI1A 1NJYA 2KFNA 4FZZA 5J2MA 3OYJA 3OY9A 1QSSA 4NCAA 2HHVA 2O4IA 3TAFA 4CJ4A 2OA8A 1VRUA 3ZT4A 3M8PA 1WAJA 4JRPA 3QINA 3SQ1A 3LAKA 2HHTA 1HYSA 3O3GA 3KLEA 1RNHA 4CJKA 3NF6A 1WNSA 3TABA 1TAQA 5CZ1A 4CE9A 4BDYA 3VA3A 1X9WA 1BQMA 1DTQA 3AVKA 5FRMA 3SUQA 1C1AA 1LAWA 3HVRA 4MFBA 4B3OA 3WNHA 5KTQA 4AHSA 4CEEA 3T1AA 4FLTA 1RBUA 5KGXA 1U4BA 3K5OA 4KHUA 1RDDA 3JYTA 3NE6A 3VQ8A 4OKJA 2HB5A 2IC3A 3T19A 5J2QA 1Q9XA 4AH9A 5T7BA 4H4MA 2X6NA 4OGEA 5HBMA 4E3SA 1IKVA 1C1BA 4DFPA 3DLKA 4RW4A 4CHYA 2PYJA 4B9SA 4KPYA 4E1MA 3TAQA 1BI4A 4DTUA 1BCMA 4RW8A 5C24A 2Y1JA 2DFFA 3PX0A 4FW2A 1HQEA 3ITHA 4KKOA 3DLBA 1ZBFA 4YNQA 1DLOA 5HRRA 4CHPA 1LV5A 1BI4B 4CJQA 1VSFA 5HP1A 3P1GA 1T8EA 2G8UA 4CJTA 4DSLA 3BGRA 4GMJB 3L2VA 4C8NA 3ULDA 1SKSA 1TK0A 4FJ7A 3C94A 1SUQA 1UA1A 4K8XA 4HUEA 1B9FA 3QIOA 2FBYA 3NH1A 3OYEA 4FXDA 2HW3A 1UOCA 3OS1A 3HVTA 3EY1A 5KRTA 4FLVA 1SL0A 4DSKA 3L2QA 3K5MA 2G8HA 2XRIA 3RTVA 5CZ2A 4OPKA 1S1TA 3V81A 4M3UA 3SQ4A 5DK5A 3HT3A 3AVAA 3VQEA 1KVAA 4FJ5A 4QOZB 2HHWA 1TKTA 1X9MA 3SI6A 2JLEA 4E7IA 4IG3A 4KRFA 2VWKA 3AO2A 2HHUA 1TGOA 3CFOA 4FW1A 3TAMA 4CFDA 3AVFA 1CZBA 2QK9A 2IS3A 2RKIA 4CGJA 4DU1A 1S5JA 3OYKA 3S3NA 3OYMA 2F96A 3NBPA 3KLGA 1NKCA 1HJRA 3NHGA 4ELTA 4NYFA 3G0ZA 3L2WA 2RPIA 4IG0A 3CFPA 5E41A 4RW6A 4LSLA 4DTOA 4CEBA 4HUFA 1KCFA 4FJMA 4B9LA 3SYZA 2OZMA 1HNVA 2HNDA 4KO0A 3H08A 4CJ5A 4N47A 4HCBA 4DMNA 4CHZA 3SUOA 1YTAA 2I5JA 4E7KA 1WSIA 4TSXA 4NYNA 4ELVA 4N41A 3SUPA 4Z4IA 1JKHA 4C8OA 4E89A 2HVIA 4CGGA 5JS2A 1RBSA 3LDSA 2BGGA 1T7PA 4M45A 4ID1A 4DF8A 3MXIA 3KLIA 4CGFA 4OGCA 3U6FA 5C25A 1N6QA 2JGUA 2KZMA 2Y1IA 4CEZA 1CXQA 4FM0A 1NK9A 3QEIA 1J53A 1JL1A 3E01A 4KTQA 4O5BA 5J2PA 1CXUA 1L3SA 4OKEA 4FJ8A 2B6AA 3V9WA 1NK8A 5CYMA 4IFVA 1A5WA 2OPPA 3ZCMA 4AHVA 3NCIA 3T3FA 1EXQA 4AHRA 3LPUA 3TR8A 2XY5A 2E6MA 1YT3A 1JLQA 2YNGA 4OKKA 3PV8A 3D45A 1QTMA 2HMIA 2IOCA 3LP0A 4CEFA 4HHTA 1Q9YA 1ZBLA 3ALYA 1QQCA 1TAUA 3WNFA 4DTXA 3RMCA 4E1NA 2GV9A 4EZ9A 4DSJA 3DRRA 3KLFA 2XHBA 4FLYA 3VQCA 1CLQA 1RCHA 1KVBA 1L3UA 3KK1A 3HXMA 3G10A 4KHWA 3VN5A 2YNFA 4H4OA 4IKFA 3DRSA 3VQQA 2G8KA 3O4QA 1RTHA 3F73A 4J2BA 4FLUA 4BWJA 1Z26A 3VQAA 2G8FA 1N5YA 3AVLA 4B9UA 3VQDA 3KIOA 1S1WA 4Q5VA 5CYQA 4DU4A 1RT3A 2YHBA 1IO2A 5HRNA 3HO1A 4LH5A 1FXXA 1ITGA 1D5AA 2Z1HA 3V1OA 1NKBA 1VSHA 1O1WA 2YKNA 4Z4GA 2D0AA 4JS4A 1HMVA 4JRQA 4I9QA 5JS1A 4FJ9A 1TL3A 3THVA 4DF4A 2WONA 3QNOA 1JLEA 1TKZA 1VK0A 2VWJA 2YKMA 1HNIA 3LP1A 1Y97A 4BWMA 3O3HA 3I0RA 3EYZA 5HROA 3RR8A 4KHNA 3ISNC 2OPSA 4Z0UA 2XY7A 3L2UA 4J2EA 2HHQA 1LW0A 4CJSA 1RT1A 4CEOA 1RT5A 1WSEA 3QIPA 1TL1A 4O44A 4ELUA 2X74A 1LWEA 4JS5A 3MXMA 3FFIA 4CF2A 3HJFA 2G8VA 2WOMA 1LW2A 4AHCA 1VSJA 4N5SA 3TAEA 1XHZA 4FCYA 2PYLA 2DY4A 3VQ9A 3D0PA 2ZE2A 2ETJA 4OVLA 1KFSA 4W5OA 1S6QA 1WAFA 3VQ6A 5HLFA 1HRHA 4M41A 1B92A 1WSFA 4DTPA 4F4KA 4CK3A 4I7FA 3DMJA 3HL8A 3O4NA 1FKOA 3LP3A 3OVNA 1JXEA 1KSPA 3KK2A 2Q3SA 3A2FA 4RW7A 4M3ZA 3M8RA 1BCOA 1QHTA 2G8IA 1S9EA 4AHTA 1K6YA 4DTSA 3LPTA 3LWMA 3HP9A 4KFBA 1JL2A 1X9SA 1NOYA 1QSLA 4B9NA 3LWLA 3RR7A 2OYQA 4E7JA 1NK7A 3PX6A 1GOAA 3NF8A 3NGYA 1BIZA 2KQ2A 1EP4A 4DFMA 3KD5E 2BANA 2D0BA 3OYFA 4Z4FA 1G15A 1ZBHA 4ZHRA 1EKEA 3AVJA 4FLWA 4PWDA 1J54A 4ID5A 2HNYA 3DLEA 2F8SA 1YVUA 3QEPA 1BISA 4CJUA 4PY5A 1ZYQA 3DLGA 3AVHA 4CJEA 4CF0A 4IFYA 4CGDA 2D0CA 3K5LA 2QXFA 1A5XA 3DRPA 4DQIA 3O3FA 1KFDA 4J2DA 3VA0A 1I39A 1SKWA 4DWIA 4CEQA 3HPGA 4DFKA 1KVCA 1BGXT 4F3OA 1R0AA 3ZT3A 1XC9A 1RBTA 3CM6A 2QKKA 4FK0A 4FLZA 3NH0A 1QSYA 4DLGA 1L5UA 4W5NA 1W9HA 1J9AA 4XIUA 3AVGA 5I3UA 3KTQA 3RWUA 3P83D 4Z4EA 1VSKA 3JSMA 2KTQA 4FJNA 1IH7A 4F3TA 3NGIA 2OPQA 3K58A 4BACA 3OS0A 2X6SA 4E0DA 2E6LA 3PX4A 3OYBA 2YHAA 3OS2A 1WSJA 2P5OA 1ASUA 4BDPA 3ZSXA 3S3MA 1IKYA 1HQUA 1KTQA 4FVMA 4CCHA 3CYMA 3QO9A 1WLJA 5K14A 2D5RA 3L8BA 4W5RA 3V9UA 1D8YA 2B5JA 1TKDA 5FRNA 1VSIA 3MEGA 1KLNA 2DFHA 2FBTA 3SJJA 3ZSZA 3ZT1A 4CECA 4L8RB 1IKWA 3AVMA 1JLGA 4CHOA 3KD1E 4CIFA 4CEDA 1GOCA 3K5NA 3I0SA 3AVBA 3AA3A 4IBNA 4FJHA 4CF9A 3OYDA 4FM2A 3TWHA 4CK2A 1D9FA 3DI6A 4B8CA 4AHUA 2BDPA 3IS9A 4JLHA 5DMRA 2VG7A 3OYHA 3QNNA 2PY5A 3QESA 1L3TA 3IG1A 4Y1DA 4LH4A 4DS5A 1SKRA 4FM1A 4F8RA 1W0HA 2RN2A 2YNIA 3ASMA 3ZSOA 3EZ5A 4LD0A 1LWCA 3QETA 4NCGA 4M3TA 3RMBA 4FYDA 1S6PA 1TKXA 3CFRA 3RMAA 1J5OA 3L2RA 3AO4A 4N76A 3OYLA 3U3GA 3SV3A 3TANA 2R7YA 3NF9A 1CZ9A 3AA2A 3L3UA 3MECA 4Y1CA 1NK6A 2PZSA 4KHSA 1ZBIA 1C0MA 1IKXA 3HK2A 3PO4A 4IDKA 4CHQA 4W5TA 4C8KA 1RBVA 4LSNA 3IAYA 4KI4A 4H8KA 2OZSA 2Z1GA 1B9DA 4EZ6A 3C6TA 4DSEA 1I3AA 3B6PA 4Z4HA 3TARA 1NJXA 3NAEA 1S1XA 4FJKA 4F2SA 4DQSA 1RBRA 3S9HA 3VQ7A 4CJLA 1C0TA 2IDOA 2Z1IA 4DQRA 1TVRA 3AA4A 4WE1A 1VSEA 3ZSQA 1VSDA 3AV9A 3DYAA 4CFAA 1RT4A 1RTIA 2ZQBA 2FC0A 3LP2A 1S9GA 5I42A 3DLHA 4PUOA 3NF7A 4PA1A 1XHXA 2XY6A 3KKSA 2HHSA 1UWBA 5KGWA 4CESA 3VQBA 1BIUA 1SV5A 1X1PA 1KRPA 2KFZA 1NKEA 2W42A 3IRXA 4FK4A 2ZD1A 4CIEA 3AA5X 4OPJA 1S1UA 4DU3A 4FJLA 3AVCA 2VG6A 1U45A 1RT2A 3ZSWA 4NCBA 1UAXA 3HPOA 1BHLA 5FROA 1BL3A 3V1RA 4DLEA 2A1SA 4CJ3A 3SPZA 3TAPA 4ZTJA 3TAGA 3L3VA 2YNHA 1T05A 2IAJA 3DLRA 3OJSA 4M3XA 4Z4CA 4CJFA 2FBXA 2E4LA 4KHQA 1RILA 3F9KA 1EX4A 3LZIA 1QE1A 2B4JA 1T03A 1RTDA 1C0UA 4FJXA 3K2PA 1JLAA 4R5PA 2GBZA 1SL2A 3MAQA 3RRGA 4F2RA 3SPYA 2HNZA 1VRTA 4O0IA 1A5VA 3MEDA 2G8WA 4EP4A 2XY8A 3KKRA 3NGZA 4DQPA 1ASVA 1D9DA 4DS4A 1S1VA 1LWFA 1NK5A 1MU2A 4CIGA 3SZ2A 1NJZA 3BDPA 5C42A 3PY8A 4M3WA 4KHYA 4OLBA 2DFEA 1WSGA 4QCLA 1F21A 1NOZA 2ITGA 3OYNA 4DQQA 1YTUA 5J1EA 4FK2A 3OYCA 3HYFA 1HYZA 3KJVA 4Q0BA 2EHGA 3V1QA 3RRHA 1JLCA 3V4IA 4B9TA 4FZYA 3VQ4A 4FJJA 3PUFA 4O4GA 3QEWA 3OYIA 3V6DA 1C6VA 3HSTB 3QLHA 4CFBA 3KLHA 4KAZA 3V9ZA 3NFAA 2HHXA 3HM9A 1IG9A 5SWMA 4CJVA 2EX3A 3SUNA 4FLXA 1UA0A 1HYVA 3K57A 3SQ2A 3AO1A 4G1QA 3LZJA 5HRPA 4KB0A 1L3VA 1KLMA 2OPRA 1U49A 3LANA 1RDAA 1ZBUA 3AVIA 4UQGA 2X78A 1U04A 2ATQA 2YV0X 2GUIA 2XO7A 4M3YA 3AO5A 4DG1A 3OYGA 3V9XA 1JLBA 4O0JA 4FZXC 1RT7A 3RMDA 2KZZA 4OLAA 4CF8A 3UIQA 4K8ZA 4PQUA 3AO3A 3I8DA 3KK3A 4DTJA 3SCXA 4KB1A 4I2QA 2KW4A 4KV8A
chains in the Genus database with same CATH superfamily
3LDNA 1VQ7N 1IG8A 3IUCA 2DTUA 4J8FA 3R8EA 1N36K 5EY4A 2VWBA 1QQNA 3B6OA 4RG8A 4W5QA 4M42A 3TI0A 4BE1A 1W2BM 1KAYA 2NUBA 2V7YA 1U47A 3VQPA 1NK4A 1NGBA 1TK5A 1QVGM 4CZMA 1NK0A 5KRSA 5M1OA 4HVJA 4AILC 2QWMA 3CQ8A 4F9OA 2FXUA 4CGHA 5KI6A 3O8MA 3N4PA 3MXJA 3DJCA 3GBTA 3OJUA 3M6GA 3WNGA 3CM5A 1VQLN 4DSIA 3U8XA 3G71N 3DM2A 3QBXA 3VTIA 4DTMA 2P9IA 4IO8A 1NGJA 5SZTA 4DV3K 4GNIA 1RTJA 4RWTA 2P9IB 3ZSRA 2VGMA 2ZWHA 4UY8O 3WXMB 4CJWA 2E20A 2VG5A 5D3GA 4CGIA 4H0XB 4RW9A 3WT0A 3SQ0A 4J2AA 2HVHA 1RDBA 2F8TA 4M3RA 1TV6A 3SNNA 1WB9A 2KFNA 3ID6A 4WQ4A 3WUHA 4IOAL 5CR4A 1QSSA 4NCAA 2OTLN 1BWFO 2O4IA 1VQNN 2HHTA 3Q7CA 1HYSA 3CCRN 3KK7A 3LDLA 1Q7YO 4JI7K 4BDYA 3WXJA 4BRAA 2HBMA 2VYPA 4BY9C 3SUQA 3WQTA 4CZHA 3WNHA 3SJHA 4CEEA 3KHYA 4HWIA 1U4BA 3JYTA 3NE6A 3SAHA 3VQ8A 3HOSA 2X6NA 4OO1J 2PYJA 4RW4A 3EE8A 5DM7L 1S72N 1BCMA 5C24A 3PX0A 3DLBA 1HQEA 3ITHA 4FPAA 1ZBFA 3ZEUA 1T8EA 2G8UA 3P1GA 5FPEA 3BGRA 1NJIO 3FGUA 3FR0A 4DR1K 3K9JA 3ZEUB 4CZKA 4DUYK 4HUEA 3N4QA 3OYEA 4JAXA 5AQUA 3EY1A 2V7ZA 4NLBA 4FLVA 1VAZA 3ATUA 4DSKA 2YHXA 1QQOA 1YJNN 2XRIA 4DR4K 5DK5A 4FJ5A 3AVAA 3VQEA 1KVAA 1TKTA 4IG3A 2VWKA 1CZBA 2IS3A 2RKIA 3S3NA 3OYMA 3NHGA 4KBOA 4CEBA 4FJMA 2OZMA 4BRQA 2QWPA 1VQ6N 4HCBA 4DMNA 4DQ8A 2BH1A 1K9MO 1JKHA 1T7PA 2VQFK 2Y1IA 3ZX0A 3GG4A 4KTQA 1NGCA 5J2PA 1CXUA 4H5TA 4YOVA 4L3QA 1A5WA 2EWSA 3ZCMA 1GLEG 3T3FA 4AHRA 3LPUA 4KH5A 2HMIA 3LM2A 1Q9YA 5AQZA 1N33K 3ALYA 1TAUA 2P9SA 3RMCA 3DRRA 5AFUH 3KLFA 1CLQA 3LDOA 1RCHA 1L3UA 3E9LA 2OANA 3L6QA 3G10A 1RGIA 2P9SB 4H0VB 2ITMA 3HM8A 4NO7A 2QM1A 3O4QA 1RTHA 4O5FA 1XNRK 3DXMA 3KIOA 4Q5VA 1T6DA 1YIJN 2IVOA 5AQWA 3K9KA 5CYQA 3IDHA 1YXQA 4C23A 4LH5A 5TKWA 2Z1HA 3V1OA 4GKKK 1NKBA 1VSHA 2D0AA 4IWVA 3ATVA 3ZLJA 2VGNA 2ZF5O 5JS1A 3QNOA 1JLEA 1VQ9N 1VK0A 5BR9A 3LP1A 4KH6A 3LL3A 4WFAL 4KHNA 5HROA 2OPSA 1HNXK 1LWEA 2G8VA 3ZX3A 3F5TA 4CBUA 3D0PA 2ZE2A 2CGLA 4IXCA 5TKYA 4BRPA 1B92A 4F4KA 3THYB 3R3LA 3O4NA 3HL8A 1FKOA 4B1ZA 4BC4A 4RW7A 3A2FA 4M3ZA 2YHWA 3DWLA 3O1BA 2O8EB 4AHTA 1NOYA 3AGRA 3LWLA 3H3OB 4IFEA 3KD5E 2BANA 3O9QA 4Z4FA 1EKEA 1J54A 4WQ5A 1BISA 4CJUA 1OH6A 4PKHA 1ZYQA 1GLBG 3AVHA 4IFYA 2D0CA 4DV1K 3EE9A 3DRPA 1A5XA 4H5NA 5AJ3K 4YDUC 4J2DA 3SK3A 4DR3K 4IJAA 4FWMA 2QKKA 4GV6A 3ENOA 1QSYA 4DLGA 4W5NA 4XIUA 3AVGA 3KTQA 2KTQA 3NGIA 2OPQA 3OYBA 5M1KA 3OS2A 4JKEA 5AZIB 3OBYA 4YY3K 4FVMA 4QS7A 4CCHA 2GELA 5K14A 2D5RA 2UUCK 3V9UA 4CZIA 2ASPA 1KAXA 3MEGA 1KLNA 4B3MK 3VGMA 2PFUA 4L8RB 4MDBA 4CHOA 3K5NA 3AA3A 3NVMA 5AQNA 4JI4K 3VOVA 4B8CA 4AHUA 4JKHA 5E26A 3IS9A 2P9KA 1TUYA 3QESA 1L3TA 3IG1A 4F8RA 5AZJA 4PL7A 2RN2A 3CCVN 3EZ5A 3QETA 1LWCA 4NCGA 1TKXA 3CFRA 5AQRA 3NF9A 1CZ9A 4Y1CA 3SAFA 4FOIA 2ZM6K 4BG9A 5AQMA 2E1YA 4C8KA 3C6HA 1WUAA 3CPEA 4LF7K 4H8KA 2V51B 5BN8A 3DLLL 1S1XA 1QZ6A 5BR8K 2P9LA 1C0TA 2IDOA 2Z1IA 3O9SA 1TYQB 4OPHA 3LP2A 2IVPA 3DLHA 1Z6RA 4PA1A 1UWBA 3MCAB 4JKCA 1MDUB 3VQBA 1X1PA 3D2EB 2W42A 4FK4A 3I56N 4CIEA 2WC9A 2ZJQL 4FJLA 1OKJA 1G99A 1BHLA 2I7PA 5FROA 4WFBL 1BL3A 4NXNK 4CJ3A 3SPZA 2IAJA 4WYBA 2D0OA 1VQPN 1RILA 3F9KA 3CETA 3LZIA 1RTDA 4AM7A 4JI5K 2O8CA 3K2PA 3MAQA 1VRTA 4O0IA 3O9TA 4JD2A 4EP4A 3QB0A 3CCSN 1D9DA 4DS4A 1S1VA 3VGKA 4CIGA 4CZLA 4M3WA 4OLBA 2FSNA 2NRZA 2HHHK 3QMLA 4A59A 4QCLA 1HYZA 2EHGA 3V1QA 1JLCA 4FJJA 1BG3A 3OYIA 1T3VA 3NVKA 4KAZA 3NFAA 2O8BA 5SWMA 3SUNA 2EX3A 3MN9A 4G1QA 1NWKA 4KB0A 2OPRA 3M1FA 5C10A 4UQGA 1Z05A 3OBWA 1JLBA 4O0JA 4FZXC 1RT7A 5BRDA 5DM6L 1BO5O 4B1YB 4K8ZA 5BPLA 3I8DA 3PSFA 3OTOK 3P39A 3SMSA 4KV8A 1JXBA 2E2PA 4JI1K 4DV7K 4DR6K 4BR5A 2J4RA 4E7LA 4GVMA 5FDLA 4CFCA 2P51A 3OYAA 3PO5A 1YJWN 4C8LA 3LAMA 3VENA 5CY4A 4FJGA 4B9MA 4CEAA 1BQNA 1WBDA 5AQGA 4ZTFA 4MQ3A 1RDCA 1W7AA 1LAVA 3SAGA 5CHIA 1YHQN 4BE2A 4DTRA 1KAZA 1VSLA 2RF2A 4PL8A 4LY7A 3ULEA 3M8QA 2QA4N 5LJVA 1U48A 1WSHA 1K8KB 1HPZA 4KI6A 3ULEB 3CC2N 5M1PA 3CMEN 4LC9B 1QS4A 4JKAA 1NJWA 4BE0A 3MWTA 4FJIA 3WNEA 3NMUA 2KHOA 4JI8K 4N56A 3QEXA 4AF1A 1T6CA 3CCLN 3V9SA 2NRWA 5C15A 4YFUA 3A5MC 3HPHA 4FWOA 1XI1A 3CMAN 5J2MA 2Q36A 3HOTA 2HHVA 3TAFA 5KQDA 3VMFB 5ADXA 4JRPA 3SQ1A 3O3GA 5AQLA 4CJKA 2BUPA 1TAQA 4JK7A 4PKGA 4CE9A 1X9WA 1BQMA 4GY2B 1LAWA 3K0SA 4B3OA 5KTQA 1K8AO 2IIRA 3MWPA 3T1AA 4H0OA 2O8FA 2P9UA 2E8AA 4ILHA 2IC3A 3CERA 3T19A 5T7BA 4H4MA 4OGEA 5EXWA 2E2QA 4E1MA 1XUPO 3TAQA 4DTUA 3C0BA 5M1NA 2PBDA 3L4IA 5AQSA 3KZBA 5HRRA 4CJQA 1NU0A 4CJTA 3L2VA 3UB5A 1SKSA 3PIPL 1UA1A 1B9FA 3THWA 2W40A 4JKBA 1HKGA 3VF2A 3H1QA 3HVTA 4BRNA 5FPNA 3ZYYX 1OVQA 4CZEA 4ILGB 4H5VA 4M3UA 2W6KA 4YOTA 2JLEA 1X3MA 2HOEA 4KRFA 3AO2A 1TGOA 2D4WA 1OH8A 1ZXOA 4CFDA 2QK9A 2P9PA 3UE5A 1S5JA 3OYKA 2FF6A 3KLGA 1HKBA 3CJ1A 2UUAK 4NYFA 4LF6K 3L2WA 2RPIA 5HL7L 1M1KO 5KPZA 2FLOA 4RW6A 4LSLA 2E5LK 4HUFA 4B3SK 4KO0A 3H08A 4N47A 5H1SQ 3SUOA 2I5JA 3EKUA 3C65A 1WSIA 4TSXA 4N41A 3SUPA 3DXKA 3VEVA 4CGGA 3PLAA 1NMNA 5JS2A 4OGCA 3PSIA 3DXKB 4CEZA 4FM0A 3OA9A 3QEIA 1J53A 1YITN 3E01A 1SS6A 3VF4A 5ADXH 3V9WA 4HTLA 1YVNA 3NCIA 1EXQA 1TUUA 2NRVA 2YNGA 3BEXA 4OKKA 2QI2A 3D45A 3PV8A 1QTMA 2IOCA 4HHTA 3AAPA 4DTXA 2GV9A 2XHBA 3VQCA 4JI3K 1DKGD 3HXMA 4KHWA 4H4OA 5JLFA 4IKFA 2G8KA 4GV9A 4BR9A 3F73A 4BWJA 1N5YA 3VQDA 1S1WA 4BR0A 4FWRA 1EO1A 2AA4A 4YORA 3CQYA 5HRNA 3HO1A 1ITGA 1D5AA 1O1WA 2YKNA 2O8DA 3FZLA 4K42A 3THVA 4DF4A 1OH5A 4BVOA 3GDQA 2O8DB 2YKMA 1HNIA 5FPDA 4ILJA 3O3HA 5JLHA 1FW6A 4Z0UA 3L2UA 5AFUA 2Q0RA 4BRFA 3T1HK 1VQMN 4CEOA 1TL1A 4O44A 4DCHA 2WBNA 2YJEA 4O8UA 2WOMA 4N5SA 1IBKK 4FCYA 3VQ9A 1HPMA 3QDKA 4OVLA 1XC3A 3P4IA 2E2NA 1Y64A 3ZETA 5GIPA 3IKMA 5AQXA 3CJBA 1KSPA 3O9RA 3ZETB 2Q3SA 5CE3A 2G8IA 2HSTA 3HJFA 1QSLA 3LPTA 5FLXO 3HP9A 4IOXA 4CZJA 3LWMA 1X9SA 4B9NA 5F2RA 4K41A 1NK7A 3NF8A 3NGYA 4DFMA 2NNWA 3OYFA 1Q86O 1RDUA 4FLWA 1NNEA 4ID5A 1E4GT 3CCJN 4IEEA 4IDHA 1BA0A 2UXBK 4CF0A 1JCFA 3K5LA 1HNWK 1KFDA 1SKWA 3RVCA 4DWIA 4CEQA 1KVCA 1R59O 3ZT3A 1R0AA 1XC9A 4FLZA 1W9HA 4CVNE 3A5OC 3P83D 4Z4EA 3R9PA 4FJNA 1IH7A 4F3TA 3THXA 1XNQK 2HMPA 3PX4A 2I7NA 2YHAA 1WSJA 1ASUA 3S3MA 3J8AA 1KTQA 1KXPA 2YI1A 3THXB 5IWAK 3EEQA 1WLJA 2JWKA 2B5JA 1TKDA 5FRNA 1VSIA 2FBTA 2QEXN 2VQEK 3KWIA 3ZT1A 4CECA 4BREA 3KD1E 3I33A 3T7ZA 4G9ZA 3GL1A 4FJHA 3OYDA 4CK2A 2BDPA 3VEXA 4Y1DA 4LH4A 1SKRA 5HOOA 5C0YA 2ZJRL 4DV2K 3ASMA 3ZSOA 1U2VA 3TSQA 3PIOL 4M3TA 4FYDA 1S6PA 5BPMA 4N76A 3U3GA 3SV3A 2CGJA 3TANA 4KHSA 4H0YB 3L3UA 5LJWA 3MECA 2KKZA 1C0MA 3HK2A 3J7ZO 4LSNA 1VQON 2OZSA 3VESA 4DSEA 3W0LA 4Z4HA 1NJXA 3DXMB 3NAEA 4JI0K 4LF5K 4MDAA 4DQSA 3S9HA 4A2BA 5GINA 3AA4A 4WE1A 4U67L 1VSDA 1XQSC 3AV9A 4CFAA 3VEYA 2ZQBA 2F7TA 3NF7A 2XY6A 3KKSA 2QWRA 3M5RA 4JI6K 4XH4A 5KGWA 2W41A 3H6EA 2GEMA 1GLLO 4DV4K 1KRPA 2KFZA 3IRXA 3AY9A 1KD1O 1MWKA 4DU3A 5KPTA 2VG6A 1VQ8N 3F9MA 2HBKA 3Q7BA 4OX9K 4DV5K 3V1RA 3DLRA 3OJSA 3VEWA 3EL2A 4CZGA 1QE1A 1T03A 1WOQA 1JLAA 4F2RA 3RRGA 1EQYA 3SPYA 3MEDA 4JEPA 1LWFA 3BDPA 1MU2A 1GLDG 1LOTB 3SZ2A 1NJZA 3I8BA 4BGAA 1RFQA 1F21A 1NOZA 2WTUA 4KH4A 4NLCA 1YTUA 2E2OA 1C0GA 3CXCM 5J1EA 3OYCA 3HZ6A 4A2AA 4B9TA 5AQOA 3PUFA 3O6WA 2QWOA 3V6DA 3KLHA 3C6AA 3T1YK 3HI0A 4CJVA 4FLXA 4BG8A 4XH5A 2UYTA 3AO1A 1KLMA 1U49A 1U04A 3U4LA 3E66A 4FWPA 2UXDK 5B8HA 4CF8A 4FWSA 3AO3A 4DTJA 4K43A 3C95A 1MWMA 4H5WA 2O4GA 2Z1JA 4FWKA 4KTWA 2BE2A 2AJQA 1VHXA 3VERA 2Q97A 3DOKA 3P31A 3TTFA 4I9LA 3RSEA 3K59A 3SV4A 3H1VX 2A1RA 4C8MA 3M8SA 3CCMN 4GW6A 3RSEB 3GE1A 4KTZA 4E19A 5F1XA 3ZSYA 4HTUA 4CERA 3NDKA 2P1JA 3AAQA 2P9KB 2IGIA 1JLFA 4DSFA 1Q8IA 5AZJB 1H1VA 3ZSVA 2P5GA 3VQ5A 5J2NA 4EP5A 2QTDA 1TK8A 2W6LA 1RT6A 1XWLA 3P5JA 1VQ4N 1SL1A 3AVNA 1BA1A 1N32K 3W3DA 3M3ZA 4CJRA 3J80O 4FPBA 4CJPA 3FZHA 4I2PA 3MX5A 4M7YA 3ZT0A 1C1CA 2AP1A 3BF1A 4X66K 1GOBA 1VSMA 2P9LB 3O4WA 2FBVA 3EN9A 2LSNA 3QEVA 4DKWA 3HP6A 3A8YA 4QAGA 1NJYA 1EETA 3OY9A 5LMUK 4BQZA 1S22A 2OA8A 3MDQA 2ZJPL 1VRUA 1WAJA 3QINA 3O9UA 1RNHA 3TABA 3NF6A 1WNSA 5CZ1A 2KLAA 1VQ5N 5BRHA 1DTQA 5FRMA 1C1AA 5GAHP 3P38A 4ISGA 4C1NI 4AHSA 2QWQA 1RBUA 5KGXA 5MLCQ 3K5OA 1HX1A 1RDDA 5I9EB 5AQVA 5KPRA 2CH5A 2HB5A 4OKJA 5J2QA 1Q9XA 4BQLA 4LFBK 3MN5A 1IKVA 1C1BA 3DLKA 3VPZA 2O8CB 4LF8K 4RW8A 2Y1JA 4I6MA 4FW2A 4BR7A 2ASOA 4IEIA 4JD2B 1ATSA 1EWQA 4CHPA 2NRRA 5HP1A 1VSFA 4DSLA 5GIOA 4WQ4C 3ULDA 1N8RO 1TK0A 3C94A 4K8XA 2FBYA 3NH1A 2HW3A 4FOEA 3OS1A 4FWNA 5KRTA 1SL0A 2G8HA 3VEOA 3U9DA 4JI2K 1S1TA 1P90A 3SLCA 3V81A 3SQ4A 4QOZB 2HHWA 5KQ8A 2YJFA 2O8BB 4MLEA 2HHUA 2BTFA 3CCQN 4FW1A 1ILYA 2A40A 3AVFA 4WF9L 3NBPA 1NKCA 1HJRA 4A61A 4ELTA 5M1FA 3G0ZA 3O1WA 4IG0A 5LY3A 3AGKA 3CFPA 5JVGL 4DTOA 4BRMA 4B9LA 1HNVA 2HNDA 5AQKA 4Z4IA 4C8OA 3D7EO 5BPNA 4WFNL 3KLIA 4CGFA 3U6FA 1N6QA 2KZMA 1NM1A 4BRDA 1NGAA 1CXQA 2D1KA 3QFPA 1NK9A 2PAVA 4FO0A 3LDPA 1L3SA 4OKEA 4FJ8A 2HF3A 3TPQA 4XEIA 4IFVA 2OPPA 1K73O 3L0QA 1NMDA 3O80A 3EO3A 1ZBLA 1IBMK 3WNFA 1ZC6A 4E1NA 4DSJA 4FLYA 1KVBA 1RDWX 2YNFA 4MLHA 1XMQK 3R6MA 3VQQA 4B3RK 4J2BA 4IJNA 1Z26A 3AVLA 1XMOK 4DU4A 1IO2A 4BROA 1FXXA 4E1JA 4JS4A 5IT9O 1N34K 1HMVA 1Q18A 3BP8A 4I9QA 1KC8O 4FJ9A 1TL3A 2VWJA 1NBWA 3VEZA 1Y97A 4EFHA 3G25A 4BRLA 4AQYK 3F2KA 3LM9A 4C1NK 2UU9K 3OW2M 1LW0A 4CJSA 1RT1A 4DHYA 1RT5A 1GLAG 2NLXA 4ELUA 2O8FB 3D2FA 4JS5A 4YDUA 2P9UB 3MXMA 4B3TK 2A42A 1LW2A 4AHCA 1VSJA 2OCEA 4MO5A 1X9JA 3VTHA 2ETJA 3D2FB 1S6QA 3VQ6A 3CC7N 5HLFA 1HRHA 4M41A 4DTPA 4EIAA 3BZKA 3QFUA 3DMJA 1QZ5A 1HR0K 3LP3A 3OVNA 1YI2N 1JXEA 3KK2A 1JJ2M 3M8RA 1QHTA 1I94K 1S9EA 4FWLA 4KFBA 2YX6A 3THWB 3PX6A 3EZWA 1GOAA 4YOXA 1BIZA 1D4XA 2D0BA 3SMPA 4ZHRA 5LL6Z 2HNYA 3DLEA 3QEPA 3DLGA 3ZX2A 4CJEA 4X65K 3G4SN 3O3FA 1I39A 3J81O 1YAGA 3HPGA 4F3OA 1RBTA 2P9PB 4FK0A 3NH0A 3CF5L 1L5UA 3DAWA 1J9AA 1QHAA 5I3UA 3RWUA 1E3MA 1VSKA 5JVHL 4M7XA 4BACA 3OS0A 1WBBA 2P5OA 3ZSXA 2YHYA 1IBLK 1IKYA 3FE1A 2WFBA 4LF9K 3CYMA 1X3NA 3L8BA 3ENHA 1S3XA 2DFHA 3SJJA 2NZTA 3ZSZA 1IKWA 4X64K 1JLGA 4WQ5C 4CIFA 3QBWA 1GOCA 4R79A 3AVBA 4IBNA 4LF4K 4FM2A 5GADP 5BREA 1HJOA 5DMRA 3QNNA 4DS5A 2A5XA 4FM1A 5BRFA 3CJ9A 1SAZA 2YNIA 2RE2A 3RMAA 1J5OA 2F9TA 4BGBA 3AO4A 2R7YA 2GX9A 3AA2A 1NK6A 1ZBIA 1IKXA 3MX2A 1ZBSA 4IDKA 1RBVA 3IAYA 4U7BA 1B9DA 4EZ6A 3C6TA 5AQJA 3HTVA 3TSUA 1HNZK 4FJKA 4F2SA 2OTJN 1RBRA 1IV0A 4CJLA 4GVEA 1TVRA 4DV0K 1VSEA 3DYAA 3A5LC 1RT4A 1QVFM 2FC0A 5I42A 1S9GA 1JCGA 2HHSA 3MMVA 4CESA 5AQYA 1SV5A 2GWKA 1NKEA 3IFRA 2ZD1A 1NGEA 3AA5X 3FLCO 3AVCA 4YOWA 1U45A 1RT2A 1UAXA 3HPOA 3CCEN 2DPNA 2A1SA 4BRGA 3BUZB 3TAGA 3L3VA 5C2DA 3HRGA 4BRCA 4Z4CA 2FBXA 2Q31A 3CJCA 5C2FA 3BZCA 4FL9A 4NXMK 3VF6A 4LFCK 5A2QO 2GBZA 2HNZA 2G8WA 2XY8A 3KKRA 2D0PA 4DQPA 2NRHA 5C42A 1W97L 3PY8A 5M1QA 2DFEA 4BC2A 2UXCK 2QW9A 2CH6A 5AQPA 4EHTA 4FK2A 3O08A 4H03B 3CJ7A 5EVZA 3VQ4A 3SBTA 5AQFA 3HSTB 4BRKA 4CFBA 4GKJK 2HHXA 1LCUA 4IOCL 1GLCG 1J6ZA 3VETA 4JV5K 5AQHA 1FJGK 4RTFD 1L3VA 2HBLA 2XO7A 3AO5A 3OYGA 3V9XA 2KZZA 2ZGZA 4B9QA 4PQUA 4KB1A 2UUBK 1GLJO 3KK3A 1NGHA 3S3OA 4GV3A 4KREA 4OPAA 1DTTA 4K25A 4ICLA 4JHDA 4CHNA 3DOLA 4BDZA 2QKBA 1E4FT 3MEEA 4HCCA 3TU5A 4DUZK 4CJ7A 4JHDB 3C6UA 3A5NC 1NGFA 4XH1A 1REVA 2NRTA 4B8AB 4PHTX 1GLFO 4Y0WA 4DTNA 5HRSA 3ZT2A 1C0FA 4MO4A 1Q82O 1U2VB 2E88A 2VCPA 3GOIA 4DFJA 1FK9A 3LALA 4OJRA 3FZMA 4B9VA 1ASWA 5GAGP 3WEEA 4B08A 3CG7A 3FFKB 1FKPA 2ASMA 4BR2A 2F9WA 3WEEB 5EU7A 1WN7A 3U3YA 4O55A 4A5BA 3QERA 3NH2A 4HUGA 3JXUA 4CF1A 2A3ZA 1Z25A 3VGLA 5EX5A 4E7HA 4CK1A 2QWNA 4V19S 4FZZA 3TTCA 3OYJA 3CD6N 4FSVA 1Q81O 4CJ4A 3ZT4A 3M8PA 4JN4A 3LAKA 3KLEA 3QICA 5JICA 3VA3A 3AVKA 3HVRA 4MFBA 1JCEA 3SBGA 2GTDA 1HUXA 1O13A 4FLTA 4JKDA 4KHUA 1ATRA 3CI5A 4FWQA 4AH9A 5HBMA 4DFPA 1YF5L 4E3SA 4CHYA 1NGGA 4B9SA 4KPYA 1BI4A 4H0PA 2DFFA 4KKOA 4QS8A 4CBXA 3THYA 3EKSA 4YNQA 1DLOA 3MCPA 1BI4B 1LV5A 2FSKA 4GMJB 4C8NA 2O8EA 3CQXA 4FJ7A 1SUQA 3QIOA 4FXDA 1UOCA 5LMNK 3L2QA 4CZFA 4LFAK 3K5MA 3KWGA 4CD1A 5ELZA 3J7YP 3RTVA 3BF3A 5CZ2A 4OPKA 3HT3A 2FSJA 1X9MA 3SI6A 4E7IA 3CFOA 3TAMA 3MN6A 4CGJA 4DU1A 3JAMO 2F96A 3J7AP 5E41A 4CBWA 1KCFA 3SYZA 5AZIA 3UKUA 4CJ5A 4CHZA 1YTAA 1KQSM 4E7KA 4NYNA 4ELVA 2HVIA 4E89A 3UKUB 1RBSA 2HBJA 3LDSA 2YCHA 3CJAA 2BGGA 4M45A 4ID1A 4DF8A 3MXIA 5C25A 2JGUA 4DR7K 1DGKN 4BR4A 1JL1A 4O5BA 3T69A 1NGIA 2B6AA 3FZFA 5E84A 1NK8A 4DB3A 5CYMA 3ENBA 4AHVA 3TR8A 2XY5A 2E6MA 1YT3A 1JLQA 4WCEL 3LP0A 4CEFA 1QQCA 4EZ9A 2FF3B 3AARA 3KK1A 5C12A 4CI6A 3VN5A 5FPMA 3DRSA 2E1ZA 4IZ9A 1T44A 4FLUA 1IJJA 3WXIA 3VQAA 2G8FA 3FZKA 4B9UA 2Q0UA 3ID8A 3WQUA 2QWLA 2A6AA 1TYQA 1RT3A 2YHBA 4DR5K 1YUWA 1J5EK 1V4SA 4Z4GA 4JRQA 3CIPA 1V4TA 2WONA 3D2EA 1TKZA 3MK6A 4BWMA 3I0RA 3EYZA 3RR8A 3ISNC 2XY7A 5BN9A 4J2EA 2HHQA 5EOYA 1WSEA 3QIPA 2X74A 1DEJA 1HLUA 4H5RA 4YOYA 3FFIA 4CF2A 4DR2K 1SZ2A 3TAEA 1BDGA 1XHZA 2PYLA 3I55N 5AQQA 2DY4A 1OH7A 1KFSA 4W5OA 1WAFA 3WXKA 5GAEP 1SQKA 3OHRA 4I6MB 1WSFA 4CK3A 3E9PA 4I7FA 4B1VA 4EHUA 4X62K 1BCOA 4DTSA 1K6YA 1BUPA 1JL2A 3BY5A 3C7NA 4PKIA 3RR7A 2OYQA 4E7JA 4JK9A 2KQ2A 1EP4A 3C7NB 1G15A 1ZBHA 4PWDA 3E1YA 3AVJA 2F8SA 1YVUA 4PY5A 2V52B 1U6ZA 4CGDA 4Z94A 1ATNA 2QXFA 4DQIA 3R1XA 3WXLA 3VA0A 1OVYA 4DFKA 1BGXT 1ESVA 3CM6A 4CD3A 4BRIA 4IO9L 3JSMA 3B8AX 4O8KA 3K58A 1M90O 3JS6A 2X6SA 4CW7B 2E6LA 4E0DA 3CPWM 4BDPA 4RCHA 3CHWA 1HQUA 2NRXA 3H3NO 1MA9B 1QQMA 3CCUN 3G6EN 3QO9A 4W5RA 4B1XB 1D8YA 3L4QA 4K0KK 2JWLA 3AVMA 4CEDA 5F0XA 3I0SA 4FVUA 3A0IX 4BVPA 4B1UB 1CZAN 4CF9A 3U9ZA 3TWHA 5AQTA 1D9FA 3DI6A 4JKFA 1BOTO 4JLHA 1NG9A 2VG7A 3OYHA 2PY5A 2Q1NA 1W0HA 2CGKA 3E9OA 4LD0A 3RMBA 4A57A 1K8KA 3L2RA 4JYAK 3S41A 3OYLA 3O5BA 2PZSA 3H46O 4JNEA 3PO4A 2HF4A 4CHQA 5AQIA 4W5TA 4KI4A 2Z1GA 3D6RA 1I3AA 3B6PA 4A62A 3TARA 2ZGYA 4NB4A 3VQ7A 4YHHK 4DQRA 4M63C 4JK8A 3ZSQA 1RTIA 4A5AA 5AR0A 3LDQA 4DV6K 4PUOA 1HKCA 1XHXA 4BC3A 3TSPA 1BIUA 4JKGA 4QS9A 2WUSA 4OPJA 1S1UA 4BRHA 4JKGB 1EWRA 3ZSWA 3UKRA 4NCBA 3TAPA 4DLEA 4ZTJA 2YNHA 1T05A 4M3XA 4H0TB 3UKRB 4CJFA 2E4LA 4KHQA 1EX4A 2B4JA 2QXLA 4B1WB 1C0UA 4FJXA 2GUPA 4R5PA 3IMXA 1SL2A 1A5VA 4ISEA 3NGZA 1DT9A 1ASVA 1NK5A 4KHYA 4YOUA 1WSGA 2ITGA 3OYNA 4DQQA 4KHPK 4AM6A 2Q2RA 3HYFA 3KJVA 3TTDA 4Q0BA 3V4IA 3RRHA 3HBTA 1VQKN 4FZYA 4O4GA 3QEWA 1C6VA 3QLHA 3MN7A 1P8ZA 3V9ZA 3HM9A 1IG9A 3KVGA 4EAHD 1UA0A 1HYVA 3K57A 3SQ2A 3LZJA 5HRPA 2H3GX 4BC5A 3LANA 1RDAA 4ISFA 5JMVA 1BU6O 1ZBUA 3AVIA 2P9NA 3HSCA 2X78A 2ATQA 2YV0X 4M3YA 2GUIA 4DG1A 3CC4N 3RMDA 1NGDA 2F4VK 2GWJA 4OLAA 2A41A 3UIQA 2P9NB 1NLVA 2RHKA 3SCXA 1YJ9N 3H45C 4I2QA 2KW4A 2IVNA
chains in the Genus database with same CATH topology
3C95A 3S3OA 1JXBA 4KREA 2O4GA 2Z1JA 4KTWA 1DTTA 2BE2A 2AJQA 2DTUA 4ICLA 3DOKA 4CHNA 4E7LA 3DOLA 4GVMA 4I9LA 5FDLA 4CFCA 2P51A 4BDZA 2QKBA 3B6OA 3MEEA 4RG8A 4W5QA 3OYAA 3K59A 3SV4A 3PO5A 4C8LA 3TI0A 4HCCA 4M42A 4BE1A 2A1RA 3LAMA 3C6UA 4C8MA 3M8SA 5CY4A 4DTNA 1REVA 4FJGA 2NUBA 4GW6A 4B8AB 4B9MA 4KTZA 4E19A 4CEAA 1BQNA 5HRSA 3ZSYA 4HTUA 1U47A 3VQPA 1NK4A 4ZTFA 4MQ3A 3ZT2A 4CERA 3NDKA 1RDCA 1TK5A 2P1JA 1NK0A 5KRSA 4HVJA 2IGIA 1LAVA 1JLFA 4AILC 4DSFA 1Q8IA 4BE2A 4DTRA 3CQ8A 3ZSVA 1VSLA 2RF2A 2P5GA 3VQ5A 4LY7A 5KI6A 4CGHA 3M8QA 5J2NA 4DFJA 1U48A 1FK9A 1WSHA 3MXJA 3LALA 4EP5A 4OJRA 3OJUA 1HPZA 1TK8A 3WNGA 4B9VA 1ASWA 4KI6A 3CM5A 4B08A 1RT6A 4DSIA 1XWLA 3CG7A 3DM2A 3P5JA 1SL1A 4DTMA 1FKPA 3AVNA 1QS4A 1NJWA 4CJRA 4BE0A 5SZTA 5EU7A 4CJPA 3WNEA 4I2PA 4FJIA 3ZT0A 1C1CA 1WN7A 1RTJA 3ZSRA 3U3YA 4O55A 1GOBA 1VSMA 4CJWA 2VG5A 4N56A 3QERA 3QEXA 5D3GA 4CGIA 4RW9A 3NH2A 3SQ0A 3V9SA 4J2AA 2HVHA 4YFUA 1RDBA 2FBVA 4HUGA 2F8TA 4CF1A 2LSNA 3QEVA 4M3RA 1Z25A 1TV6A 3HP6A 3HPHA 4QAGA 4E7HA 3SNNA 1EETA 4CK1A 1XI1A 1NJYA 2KFNA 4FZZA 5J2MA 3OYJA 3OY9A 1QSSA 4NCAA 2HHVA 2O4IA 3TAFA 4CJ4A 2OA8A 1VRUA 3ZT4A 3M8PA 1WAJA 4JRPA 3QINA 3SQ1A 3LAKA 2HHTA 1HYSA 3O3GA 3KLEA 1RNHA 4CJKA 3NF6A 1WNSA 3TABA 1TAQA 5CZ1A 4CE9A 4BDYA 3VA3A 1X9WA 1BQMA 1DTQA 3AVKA 5FRMA 3SUQA 1C1AA 1LAWA 3HVRA 4MFBA 4B3OA 3WNHA 5KTQA 4AHSA 4CEEA 3T1AA 4FLTA 1RBUA 5KGXA 1U4BA 3K5OA 4KHUA 1RDDA 3JYTA 3NE6A 3VQ8A 4OKJA 2HB5A 2IC3A 3T19A 5J2QA 1Q9XA 4AH9A 5T7BA 4H4MA 2X6NA 4OGEA 5HBMA 4E3SA 1IKVA 1C1BA 4DFPA 3DLKA 4RW4A 4CHYA 2PYJA 4B9SA 4KPYA 4E1MA 3TAQA 1BI4A 4DTUA 1BCMA 4RW8A 5C24A 2Y1JA 2DFFA 3PX0A 4FW2A 1HQEA 3ITHA 4KKOA 3DLBA 1ZBFA 4YNQA 1DLOA 5HRRA 4CHPA 1LV5A 1BI4B 4CJQA 1VSFA 5HP1A 3P1GA 1T8EA 2G8UA 4CJTA 4DSLA 3BGRA 4GMJB 3L2VA 4C8NA 3ULDA 1SKSA 1TK0A 4FJ7A 3C94A 1SUQA 1UA1A 4K8XA 4HUEA 1B9FA 3QIOA 2FBYA 3NH1A 3OYEA 4FXDA 2HW3A 1UOCA 3OS1A 3HVTA 3EY1A 5KRTA 4FLVA 1SL0A 4DSKA 3L2QA 3K5MA 2G8HA 2XRIA 3RTVA 5CZ2A 4OPKA 1S1TA 3V81A 4M3UA 3SQ4A 5DK5A 3HT3A 3AVAA 3VQEA 1KVAA 4FJ5A 4QOZB 2HHWA 1TKTA 1X9MA 3SI6A 2JLEA 4E7IA 4IG3A 4KRFA 2VWKA 3AO2A 2HHUA 1TGOA 3CFOA 4FW1A 3TAMA 4CFDA 3AVFA 1CZBA 2QK9A 2IS3A 2RKIA 4CGJA 4DU1A 1S5JA 3OYKA 3S3NA 3OYMA 2F96A 3NBPA 3KLGA 1NKCA 1HJRA 3NHGA 4ELTA 4NYFA 3G0ZA 3L2WA 2RPIA 4IG0A 3CFPA 5E41A 4RW6A 4LSLA 4DTOA 4CEBA 4HUFA 1KCFA 4FJMA 4B9LA 3SYZA 2OZMA 1HNVA 2HNDA 4KO0A 3H08A 4CJ5A 4N47A 4HCBA 4DMNA 4CHZA 3SUOA 1YTAA 2I5JA 4E7KA 1WSIA 4TSXA 4NYNA 4ELVA 4N41A 3SUPA 4Z4IA 1JKHA 4C8OA 4E89A 2HVIA 4CGGA 5JS2A 1RBSA 3LDSA 2BGGA 1T7PA 4M45A 4ID1A 4DF8A 3MXIA 3KLIA 4CGFA 4OGCA 3U6FA 5C25A 1N6QA 2JGUA 2KZMA 2Y1IA 4CEZA 1CXQA 4FM0A 1NK9A 3QEIA 1J53A 1JL1A 3E01A 4KTQA 4O5BA 5J2PA 1CXUA 1L3SA 4OKEA 4FJ8A 2B6AA 3V9WA 1NK8A 5CYMA 4IFVA 1A5WA 2OPPA 3ZCMA 4AHVA 3NCIA 3T3FA 1EXQA 4AHRA 3LPUA 3TR8A 2XY5A 2E6MA 1YT3A 1JLQA 2YNGA 4OKKA 3PV8A 3D45A 1QTMA 2HMIA 2IOCA 3LP0A 4CEFA 4HHTA 1Q9YA 1ZBLA 3ALYA 1QQCA 1TAUA 3WNFA 4DTXA 3RMCA 4E1NA 2GV9A 4EZ9A 4DSJA 3DRRA 3KLFA 2XHBA 4FLYA 3VQCA 1CLQA 1RCHA 1KVBA 1L3UA 3KK1A 3HXMA 3G10A 4KHWA 3VN5A 2YNFA 4H4OA 4IKFA 3DRSA 3VQQA 2G8KA 3O4QA 1RTHA 3F73A 4J2BA 4FLUA 4BWJA 1Z26A 3VQAA 2G8FA 1N5YA 3AVLA 4B9UA 3VQDA 3KIOA 1S1WA 4Q5VA 5CYQA 4DU4A 1RT3A 2YHBA 1IO2A 5HRNA 3HO1A 4LH5A 1FXXA 1ITGA 1D5AA 2Z1HA 3V1OA 1NKBA 1VSHA 1O1WA 2YKNA 4Z4GA 2D0AA 4JS4A 1HMVA 4JRQA 4I9QA 5JS1A 4FJ9A 1TL3A 3THVA 4DF4A 2WONA 3QNOA 1JLEA 1TKZA 1VK0A 2VWJA 2YKMA 1HNIA 3LP1A 1Y97A 4BWMA 3O3HA 3I0RA 3EYZA 5HROA 3RR8A 4KHNA 3ISNC 2OPSA 4Z0UA 2XY7A 3L2UA 4J2EA 2HHQA 1LW0A 4CJSA 1RT1A 4CEOA 1RT5A 1WSEA 3QIPA 1TL1A 4O44A 4ELUA 2X74A 1LWEA 4JS5A 3MXMA 3FFIA 4CF2A 3HJFA 2G8VA 2WOMA 1LW2A 4AHCA 1VSJA 4N5SA 3TAEA 1XHZA 4FCYA 2PYLA 2DY4A 3VQ9A 3D0PA 2ZE2A 2ETJA 4OVLA 1KFSA 4W5OA 1S6QA 1WAFA 3VQ6A 5HLFA 1HRHA 4M41A 1B92A 1WSFA 4DTPA 4F4KA 4CK3A 4I7FA 3DMJA 3HL8A 3O4NA 1FKOA 3LP3A 3OVNA 1JXEA 1KSPA 3KK2A 2Q3SA 3A2FA 4RW7A 4M3ZA 3M8RA 1BCOA 1QHTA 2G8IA 1S9EA 4AHTA 1K6YA 4DTSA 3LPTA 3LWMA 3HP9A 4KFBA 1JL2A 1X9SA 1NOYA 1QSLA 4B9NA 3LWLA 3RR7A 2OYQA 4E7JA 1NK7A 3PX6A 1GOAA 3NF8A 3NGYA 1BIZA 2KQ2A 1EP4A 4DFMA 3KD5E 2BANA 2D0BA 3OYFA 4Z4FA 1G15A 1ZBHA 4ZHRA 1EKEA 3AVJA 4FLWA 4PWDA 1J54A 4ID5A 2HNYA 3DLEA 2F8SA 1YVUA 3QEPA 1BISA 4CJUA 4PY5A 1ZYQA 3DLGA 3AVHA 4CJEA 4CF0A 4IFYA 4CGDA 2D0CA 3K5LA 2QXFA 1A5XA 3DRPA 4DQIA 3O3FA 1KFDA 4J2DA 3VA0A 1I39A 1SKWA 4DWIA 4CEQA 3HPGA 4DFKA 1KVCA 1BGXT 4F3OA 1R0AA 3ZT3A 1XC9A 1RBTA 3CM6A 2QKKA 4FK0A 4FLZA 3NH0A 1QSYA 4DLGA 1L5UA 4W5NA 1W9HA 1J9AA 4XIUA 3AVGA 5I3UA 3KTQA 3RWUA 3P83D 4Z4EA 1VSKA 3JSMA 2KTQA 4FJNA 1IH7A 4F3TA 3NGIA 2OPQA 3K58A 4BACA 3OS0A 2X6SA 4E0DA 2E6LA 3PX4A 3OYBA 2YHAA 3OS2A 1WSJA 2P5OA 1ASUA 4BDPA 3ZSXA 3S3MA 1IKYA 1HQUA 1KTQA 4FVMA 4CCHA 3CYMA 3QO9A 1WLJA 5K14A 2D5RA 3L8BA 4W5RA 3V9UA 1D8YA 2B5JA 1TKDA 5FRNA 1VSIA 3MEGA 1KLNA 2DFHA 2FBTA 3SJJA 3ZSZA 3ZT1A 4CECA 4L8RB 1IKWA 3AVMA 1JLGA 4CHOA 3KD1E 4CIFA 4CEDA 1GOCA 3K5NA 3I0SA 3AVBA 3AA3A 4IBNA 4FJHA 4CF9A 3OYDA 4FM2A 3TWHA 4CK2A 1D9FA 3DI6A 4B8CA 4AHUA 2BDPA 3IS9A 4JLHA 5DMRA 2VG7A 3OYHA 3QNNA 2PY5A 3QESA 1L3TA 3IG1A 4Y1DA 4LH4A 4DS5A 1SKRA 4FM1A 4F8RA 1W0HA 2RN2A 2YNIA 3ASMA 3ZSOA 3EZ5A 4LD0A 1LWCA 3QETA 4NCGA 4M3TA 3RMBA 4FYDA 1S6PA 1TKXA 3CFRA 3RMAA 1J5OA 3L2RA 3AO4A 4N76A 3OYLA 3U3GA 3SV3A 3TANA 2R7YA 3NF9A 1CZ9A 3AA2A 3L3UA 3MECA 4Y1CA 1NK6A 2PZSA 4KHSA 1ZBIA 1C0MA 1IKXA 3HK2A 3PO4A 4IDKA 4CHQA 4W5TA 4C8KA 1RBVA 4LSNA 3IAYA 4KI4A 4H8KA 2OZSA 2Z1GA 1B9DA 4EZ6A 3C6TA 4DSEA 1I3AA 3B6PA 4Z4HA 3TARA 1NJXA 3NAEA 1S1XA 4FJKA 4F2SA 4DQSA 1RBRA 3S9HA 3VQ7A 4CJLA 1C0TA 2IDOA 2Z1IA 4DQRA 1TVRA 3AA4A 4WE1A 1VSEA 3ZSQA 1VSDA 3AV9A 3DYAA 4CFAA 1RT4A 1RTIA 2ZQBA 2FC0A 3LP2A 1S9GA 5I42A 3DLHA 4PUOA 3NF7A 4PA1A 1XHXA 2XY6A 3KKSA 2HHSA 1UWBA 5KGWA 4CESA 3VQBA 1BIUA 1SV5A 1X1PA 1KRPA 2KFZA 1NKEA 2W42A 3IRXA 4FK4A 2ZD1A 4CIEA 3AA5X 4OPJA 1S1UA 4DU3A 4FJLA 3AVCA 2VG6A 1U45A 1RT2A 3ZSWA 4NCBA 1UAXA 3HPOA 1BHLA 5FROA 1BL3A 3V1RA 4DLEA 2A1SA 4CJ3A 3SPZA 3TAPA 4ZTJA 3TAGA 3L3VA 2YNHA 1T05A 2IAJA 3DLRA 3OJSA 4M3XA 4Z4CA 4CJFA 2FBXA 2E4LA 4KHQA 1RILA 3F9KA 1EX4A 3LZIA 1QE1A 2B4JA 1T03A 1RTDA 1C0UA 4FJXA 3K2PA 1JLAA 4R5PA 2GBZA 1SL2A 3MAQA 3RRGA 4F2RA 3SPYA 2HNZA 1VRTA 4O0IA 1A5VA 3MEDA 2G8WA 4EP4A 2XY8A 3KKRA 3NGZA 4DQPA 1ASVA 1D9DA 4DS4A 1S1VA 1LWFA 1NK5A 1MU2A 4CIGA 3SZ2A 1NJZA 3BDPA 5C42A 3PY8A 4M3WA 4KHYA 4OLBA 2DFEA 1WSGA 4QCLA 1F21A 1NOZA 2ITGA 3OYNA 4DQQA 1YTUA 5J1EA 4FK2A 3OYCA 3HYFA 1HYZA 3KJVA 4Q0BA 2EHGA 3V1QA 3RRHA 1JLCA 3V4IA 4B9TA 4FZYA 3VQ4A 4FJJA 3PUFA 4O4GA 3QEWA 3OYIA 3V6DA 1C6VA 3HSTB 3QLHA 4CFBA 3KLHA 4KAZA 3V9ZA 3NFAA 2HHXA 3HM9A 1IG9A 5SWMA 4CJVA 2EX3A 3SUNA 4FLXA 1UA0A 1HYVA 3K57A 3SQ2A 3AO1A 4G1QA 3LZJA 5HRPA 4KB0A 1L3VA 1KLMA 2OPRA 1U49A 3LANA 1RDAA 1ZBUA 3AVIA 4UQGA 2X78A 1U04A 2ATQA 2YV0X 2GUIA 2XO7A 4M3YA 3AO5A 4DG1A 3OYGA 3V9XA 1JLBA 4O0JA 4FZXC 1RT7A 3RMDA 2KZZA 4OLAA 4CF8A 3UIQA 4K8ZA 4PQUA 3AO3A 3I8DA 3KK3A 4DTJA 3SCXA 4KB1A 4I2QA 2KW4A 4KV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C95 A;  3S3O A;  1JXB A;  4KRE A;  2O4G A;  2Z1J A;  4KTW A;  1DTT A;  2BE2 A;  2AJQ A;  2DTU A;  4ICL A;  3DOK A;  4CHN A;  4E7L A;  3DOL A;  4GVM A;  4I9L A;  5FDL A;  4CFC A;  2P51 A;  4BDZ A;  2QKB A;  3B6O A;  3MEE A;  4RG8 A;  4W5Q A;  3OYA A;  3K59 A;  3SV4 A;  3PO5 A;  4C8L A;  3TI0 A;  4HCC A;  4M42 A;  4BE1 A;  2A1R A;  3LAM A;  3C6U A;  4C8M A;  3M8S A;  5CY4 A;  4DTN A;  1REV A;  4FJG A;  2NUB A;  4GW6 A;  4B8A B;  4B9M A;  4KTZ A;  4E19 A;  4CEA A;  1BQN A;  5HRS A;  3ZSY A;  4HTU A;  1U47 A;  3VQP A;  1NK4 A;  4ZTF A;  4MQ3 A;  3ZT2 A;  4CER A;  3NDK A;  1RDC A;  1TK5 A;  2P1J A;  1NK0 A;  5KRS A;  4HVJ A;  2IGI A;  1LAV A;  1JLF A;  4AIL C;  4DSF A;  1Q8I A;  4BE2 A;  4DTR A;  3CQ8 A;  3ZSV A;  1VSL A;  2RF2 A;  2P5G A;  3VQ5 A;  4LY7 A;  5KI6 A;  4CGH A;  3M8Q A;  5J2N A;  4DFJ A;  1U48 A;  1FK9 A;  1WSH A;  3MXJ A;  3LAL A;  4EP5 A;  4OJR A;  3OJU A;  1HPZ A;  1TK8 A;  3WNG A;  4B9V A;  1ASW A;  4KI6 A;  3CM5 A;  4B08 A;  1RT6 A;  4DSI A;  1XWL A;  3CG7 A;  3DM2 A;  3P5J A;  1SL1 A;  4DTM A;  1FKP A;  3AVN A;  1QS4 A;  1NJW A;  4CJR A;  4BE0 A;  5SZT A;  5EU7 A;  4CJP A;  3WNE A;  4I2P A;  4FJI A;  3ZT0 A;  1C1C A;  1WN7 A;  1RTJ A;  3ZSR A;  3U3Y A;  4O55 A;  1GOB A;  1VSM A;  4CJW A;  2VG5 A;  4N56 A;  3QER A;  3QEX A;  5D3G A;  4CGI A;  4RW9 A;  3NH2 A;  3SQ0 A;  3V9S A;  4J2A A;  2HVH A;  4YFU A;  1RDB A;  2FBV A;  4HUG A;  2F8T A;  4CF1 A;  2LSN A;  3QEV A;  4M3R A;  1Z25 A;  1TV6 A;  3HP6 A;  3HPH A;  4QAG A;  4E7H A;  3SNN A;  1EET A;  4CK1 A;  1XI1 A;  1NJY A;  2KFN A;  4FZZ A;  5J2M A;  3OYJ A;  3OY9 A;  1QSS A;  4NCA A;  2HHV A;  2O4I A;  3TAF A;  4CJ4 A;  2OA8 A;  1VRU A;  3ZT4 A;  3M8P A;  1WAJ A;  4JRP A;  3QIN A;  3SQ1 A;  3LAK A;  2HHT A;  1HYS A;  3O3G A;  3KLE A;  1RNH A;  4CJK A;  3NF6 A;  1WNS A;  3TAB A;  1TAQ A;  5CZ1 A;  4CE9 A;  4BDY A;  3VA3 A;  1X9W A;  1BQM A;  1DTQ A;  3AVK A;  5FRM A;  3SUQ A;  1C1A A;  1LAW A;  3HVR A;  4MFB A;  4B3O A;  3WNH A;  5KTQ A;  4AHS A;  4CEE A;  3T1A A;  4FLT A;  1RBU A;  5KGX A;  1U4B A;  3K5O A;  4KHU A;  1RDD A;  3JYT A;  3NE6 A;  3VQ8 A;  4OKJ A;  2HB5 A;  2IC3 A;  3T19 A;  5J2Q A;  1Q9X A;  4AH9 A;  5T7B A;  4H4M A;  2X6N A;  4OGE A;  5HBM A;  4E3S A;  1IKV A;  1C1B A;  4DFP A;  3DLK A;  4RW4 A;  4CHY A;  2PYJ A;  4B9S A;  4KPY A;  4E1M A;  3TAQ A;  1BI4 A;  4DTU A;  1BCM A;  4RW8 A;  5C24 A;  2Y1J A;  2DFF A;  3PX0 A;  4FW2 A;  1HQE A;  3ITH A;  4KKO A;  3DLB A;  1ZBF A;  4YNQ A;  1DLO A;  5HRR A;  4CHP A;  1LV5 A;  1BI4 B;  4CJQ A;  1VSF A;  5HP1 A;  3P1G A;  1T8E A;  2G8U A;  4CJT A;  4DSL A;  3BGR A;  4GMJ B;  3L2V A;  4C8N A;  3ULD A;  1SKS A;  1TK0 A;  4FJ7 A;  3C94 A;  1SUQ A;  1UA1 A;  4K8X A;  4HUE A;  1B9F A;  3QIO A;  2FBY A;  3NH1 A;  3OYE A;  4FXD A;  2HW3 A;  1UOC A;  3OS1 A;  3HVT A;  3EY1 A;  5KRT A;  4FLV A;  1SL0 A;  4DSK A;  3L2Q A;  3K5M A;  2G8H A;  2XRI A;  3RTV A;  5CZ2 A;  4OPK A;  1S1T A;  3V81 A;  4M3U A;  3SQ4 A;  5DK5 A;  3HT3 A;  3AVA A;  3VQE A;  1KVA A;  4FJ5 A;  4QOZ B;  2HHW A;  1TKT A;  1X9M A;  3SI6 A;  2JLE A;  4E7I A;  4IG3 A;  4KRF A;  2VWK A;  3AO2 A;  2HHU A;  1TGO A;  3CFO A;  4FW1 A;  3TAM A;  4CFD A;  3AVF A;  1CZB A;  2QK9 A;  2IS3 A;  2RKI A;  4CGJ A;  4DU1 A;  1S5J A;  3OYK A;  3S3N A;  3OYM A;  2F96 A;  3NBP A;  3KLG A;  1NKC A;  1HJR A;  3NHG A;  4ELT A;  4NYF A;  3G0Z A;  3L2W A;  2RPI A;  4IG0 A;  3CFP A;  5E41 A;  4RW6 A;  4LSL A;  4DTO A;  4CEB A;  4HUF A;  1KCF A;  4FJM A;  4B9L A;  3SYZ A;  2OZM A;  1HNV A;  2HND A;  4KO0 A;  3H08 A;  4CJ5 A;  4N47 A;  4HCB A;  4DMN A;  4CHZ A;  3SUO A;  1YTA A;  2I5J A;  4E7K A;  1WSI A;  4TSX A;  4NYN A;  4ELV A;  4N41 A;  3SUP A;  4Z4I A;  1JKH A;  4C8O A;  4E89 A;  2HVI A;  4CGG A;  5JS2 A;  1RBS A;  3LDS A;  2BGG A;  1T7P A;  4M45 A;  4ID1 A;  4DF8 A;  3MXI A;  3KLI A;  4CGF A;  4OGC A;  3U6F A;  5C25 A;  1N6Q A;  2JGU A;  2KZM A;  2Y1I A;  4CEZ A;  1CXQ A;  4FM0 A;  1NK9 A;  3QEI A;  1J53 A;  1JL1 A;  3E01 A;  4KTQ A;  4O5B A;  5J2P A;  1CXU A;  1L3S A;  4OKE A;  4FJ8 A;  2B6A A;  3V9W A;  1NK8 A;  5CYM A;  4IFV A;  1A5W A;  2OPP A;  3ZCM A;  4AHV A;  3NCI A;  3T3F A;  1EXQ A;  4AHR A;  3LPU A;  3TR8 A;  2XY5 A;  2E6M A;  1YT3 A;  1JLQ A;  2YNG A;  4OKK A;  3PV8 A;  3D45 A;  1QTM A;  2HMI A;  2IOC A;  3LP0 A;  4CEF A;  4HHT A;  1Q9Y A;  1ZBL A;  3ALY A;  1QQC A;  1TAU A;  3WNF A;  4DTX A;  3RMC A;  4E1N A;  2GV9 A;  4EZ9 A;  4DSJ A;  3DRR A;  3KLF A;  2XHB A;  4FLY A;  3VQC A;  1CLQ A;  1RCH A;  1KVB A;  1L3U A;  3KK1 A;  3HXM A;  3G10 A;  4KHW A;  3VN5 A;  2YNF A;  4H4O A;  4IKF A;  3DRS A;  3VQQ A;  2G8K A;  3O4Q A;  1RTH A;  3F73 A;  4J2B A;  4FLU A;  4BWJ A;  1Z26 A;  3VQA A;  2G8F A;  1N5Y A;  3AVL A;  4B9U A;  3VQD A;  3KIO A;  1S1W A;  4Q5V A;  5CYQ A;  4DU4 A;  1RT3 A;  2YHB A;  1IO2 A;  5HRN A;  3HO1 A;  4LH5 A;  1FXX A;  1ITG A;  1D5A A;  2Z1H A;  3V1O A;  1NKB A;  1VSH A;  1O1W A;  2YKN A;  4Z4G A;  2D0A A;  4JS4 A;  1HMV A;  4JRQ A;  4I9Q A;  5JS1 A;  4FJ9 A;  1TL3 A;  3THV A;  4DF4 A;  2WON A;  3QNO A;  1JLE A;  1TKZ A;  1VK0 A;  2VWJ A;  2YKM A;  1HNI A;  3LP1 A;  1Y97 A;  4BWM A;  3O3H A;  3I0R A;  3EYZ A;  5HRO A;  3RR8 A;  4KHN A;  3ISN C;  2OPS A;  4Z0U A;  2XY7 A;  3L2U A;  4J2E A;  2HHQ A;  1LW0 A;  4CJS A;  1RT1 A;  4CEO A;  1RT5 A;  1WSE A;  3QIP A;  1TL1 A;  4O44 A;  4ELU A;  2X74 A;  1LWE A;  4JS5 A;  3MXM A;  3FFI A;  4CF2 A;  3HJF A;  2G8V A;  2WOM A;  1LW2 A;  4AHC A;  1VSJ A;  4N5S A;  3TAE A;  1XHZ A;  4FCY A;  2PYL A;  2DY4 A;  3VQ9 A;  3D0P A;  2ZE2 A;  2ETJ A;  4OVL A;  1KFS A;  4W5O A;  1S6Q A;  1WAF A;  3VQ6 A;  5HLF A;  1HRH A;  4M41 A;  1B92 A;  1WSF A;  4DTP A;  4F4K A;  4CK3 A;  4I7F A;  3DMJ A;  3HL8 A;  3O4N A;  1FKO A;  3LP3 A;  3OVN A;  1JXE A;  1KSP A;  3KK2 A;  2Q3S A;  3A2F A;  4RW7 A;  4M3Z A;  3M8R A;  1BCO A;  1QHT A;  2G8I A;  1S9E A;  4AHT A;  1K6Y A;  4DTS A;  3LPT A;  3LWM A;  3HP9 A;  4KFB A;  1JL2 A;  1X9S A;  1NOY A;  1QSL A;  4B9N A;  3LWL A;  3RR7 A;  2OYQ A;  4E7J A;  1NK7 A;  3PX6 A;  1GOA A;  3NF8 A;  3NGY A;  1BIZ A;  2KQ2 A;  1EP4 A;  4DFM A;  3KD5 E;  2BAN A;  2D0B A;  3OYF A;  4Z4F A;  1G15 A;  1ZBH A;  4ZHR A;  1EKE A;  3AVJ A;  4FLW A;  4PWD A;  1J54 A;  4ID5 A;  2HNY A;  3DLE A;  2F8S A;  1YVU A;  3QEP A;  1BIS A;  4CJU A;  4PY5 A;  1ZYQ A;  3DLG A;  3AVH A;  4CJE A;  4CF0 A;  4IFY A;  4CGD A;  2D0C A;  3K5L A;  2QXF A;  1A5X A;  3DRP A;  4DQI A;  3O3F A;  1KFD A;  4J2D A;  3VA0 A;  1I39 A;  1SKW A;  4DWI A;  4CEQ A;  3HPG A;  4DFK A;  1KVC A;  1BGX T;  4F3O A;  1R0A A;  3ZT3 A;  1XC9 A;  1RBT A;  3CM6 A;  2QKK A;  4FK0 A;  4FLZ A;  3NH0 A;  1QSY A;  4DLG A;  1L5U A;  4W5N A;  1W9H A;  1J9A A;  4XIU A;  3AVG A;  5I3U A;  3KTQ A;  3RWU A;  3P83 D;  4Z4E A;  1VSK A;  3JSM A;  2KTQ A;  4FJN A;  1IH7 A;  4F3T A;  3NGI A;  2OPQ A;  3K58 A;  4BAC A;  3OS0 A;  2X6S A;  4E0D A;  2E6L A;  3PX4 A;  3OYB A;  2YHA A;  3OS2 A;  1WSJ A;  2P5O A;  1ASU A;  4BDP A;  3ZSX A;  3S3M A;  1IKY A;  1HQU A;  1KTQ A;  4FVM A;  4CCH A;  3CYM A;  3QO9 A;  1WLJ A;  5K14 A;  2D5R A;  3L8B A;  4W5R A;  3V9U A;  1D8Y A;  2B5J A;  1TKD A;  5FRN A;  1VSI A;  3MEG A;  1KLN A;  2DFH A;  2FBT A;  3SJJ A;  3ZSZ A;  3ZT1 A;  4CEC A;  4L8R B;  1IKW A;  3AVM A;  1JLG A;  4CHO A;  3KD1 E;  4CIF A;  4CED A;  1GOC A;  3K5N A;  3I0S A;  3AVB A;  3AA3 A;  4IBN A;  4FJH A;  4CF9 A;  3OYD A;  4FM2 A;  3TWH A;  4CK2 A;  1D9F A;  3DI6 A;  4B8C A;  4AHU A;  2BDP A;  3IS9 A;  4JLH A;  5DMR A;  2VG7 A;  3OYH A;  3QNN A;  2PY5 A;  3QES A;  1L3T A;  3IG1 A;  4Y1D A;  4LH4 A;  4DS5 A;  1SKR A;  4FM1 A;  4F8R A;  1W0H A;  2RN2 A;  2YNI A;  3ASM A;  3ZSO A;  3EZ5 A;  4LD0 A;  1LWC A;  3QET A;  4NCG A;  4M3T A;  3RMB A;  4FYD A;  1S6P A;  1TKX A;  3CFR A;  3RMA A;  1J5O A;  3L2R A;  3AO4 A;  4N76 A;  3OYL A;  3U3G A;  3SV3 A;  3TAN A;  2R7Y A;  3NF9 A;  1CZ9 A;  3AA2 A;  3L3U A;  3MEC A;  4Y1C A;  1NK6 A;  2PZS A;  4KHS A;  1ZBI A;  1C0M A;  1IKX A;  3HK2 A;  3PO4 A;  4IDK A;  4CHQ A;  4W5T A;  4C8K A;  1RBV A;  4LSN A;  3IAY A;  4KI4 A;  4H8K A;  2OZS A;  2Z1G A;  1B9D A;  4EZ6 A;  3C6T A;  4DSE A;  1I3A A;  3B6P A;  4Z4H A;  3TAR A;  1NJX A;  3NAE A;  1S1X A;  4FJK A;  4F2S A;  4DQS A;  1RBR A;  3S9H A;  3VQ7 A;  4CJL A;  1C0T A;  2IDO A;  2Z1I A;  4DQR A;  1TVR A;  3AA4 A;  4WE1 A;  1VSE A;  3ZSQ A;  1VSD A;  3AV9 A;  3DYA A;  4CFA A;  1RT4 A;  1RTI A;  2ZQB A;  2FC0 A;  3LP2 A;  1S9G A;  5I42 A;  3DLH A;  4PUO A;  3NF7 A;  4PA1 A;  1XHX A;  2XY6 A;  3KKS A;  2HHS A;  1UWB A;  5KGW A;  4CES A;  3VQB A;  1BIU A;  1SV5 A;  1X1P A;  1KRP A;  2KFZ A;  1NKE A;  2W42 A;  3IRX A;  4FK4 A;  2ZD1 A;  4CIE A;  3AA5 X;  4OPJ A;  1S1U A;  4DU3 A;  4FJL A;  3AVC A;  2VG6 A;  1U45 A;  1RT2 A;  3ZSW A;  4NCB A;  1UAX A;  3HPO A;  1BHL A;  5FRO A;  1BL3 A;  3V1R A;  4DLE A;  2A1S A;  4CJ3 A;  3SPZ A;  3TAP A;  4ZTJ A;  3TAG A;  3L3V A;  2YNH A;  1T05 A;  2IAJ A;  3DLR A;  3OJS A;  4M3X A;  4Z4C A;  4CJF A;  2FBX A;  2E4L A;  4KHQ A;  1RIL A;  3F9K A;  1EX4 A;  3LZI A;  1QE1 A;  2B4J A;  1T03 A;  1RTD A;  1C0U A;  4FJX A;  3K2P A;  1JLA A;  4R5P A;  2GBZ A;  1SL2 A;  3MAQ A;  3RRG A;  4F2R A;  3SPY A;  2HNZ A;  1VRT A;  4O0I A;  1A5V A;  3MED A;  2G8W A;  4EP4 A;  2XY8 A;  3KKR A;  3NGZ A;  4DQP A;  1ASV A;  1D9D A;  4DS4 A;  1S1V A;  1LWF A;  1NK5 A;  1MU2 A;  4CIG A;  3SZ2 A;  1NJZ A;  3BDP A;  5C42 A;  3PY8 A;  4M3W A;  4KHY A;  4OLB A;  2DFE A;  1WSG A;  4QCL A;  1F21 A;  1NOZ A;  2ITG A;  3OYN A;  4DQQ A;  1YTU A;  5J1E A;  4FK2 A;  3OYC A;  3HYF A;  1HYZ A;  3KJV A;  4Q0B A;  2EHG A;  3V1Q A;  3RRH A;  1JLC A;  3V4I A;  4B9T A;  4FZY A;  3VQ4 A;  4FJJ A;  3PUF A;  4O4G A;  3QEW A;  3OYI A;  3V6D A;  1C6V A;  3HST B;  3QLH A;  4CFB A;  3KLH A;  4KAZ A;  3V9Z A;  3NFA A;  2HHX A;  3HM9 A;  1IG9 A;  5SWM A;  4CJV A;  2EX3 A;  3SUN A;  4FLX A;  1UA0 A;  1HYV A;  3K57 A;  3SQ2 A;  3AO1 A;  4G1Q A;  3LZJ A;  5HRP A;  4KB0 A;  1L3V A;  1KLM A;  2OPR A;  1U49 A;  3LAN A;  1RDA A;  1ZBU A;  3AVI A;  4UQG A;  2X78 A;  1U04 A;  2ATQ A;  2YV0 X;  2GUI A;  2XO7 A;  4M3Y A;  3AO5 A;  4DG1 A;  3OYG A;  3V9X A;  1JLB A;  4O0J A;  4FZX C;  1RT7 A;  3RMD A;  2KZZ A;  4OLA A;  4CF8 A;  3UIQ A;  4K8Z A;  4PQU A;  3AO3 A;  3I8D A;  3KK3 A;  4DTJ A;  3SCX A;  4KB1 A;  4I2Q A;  2KW4 A;  4KV8 A; 
#chains in the Genus database with same CATH topology
 3LDN A;  1VQ7 N;  1IG8 A;  3IUC A;  2DTU A;  4J8F A;  3R8E A;  1N36 K;  5EY4 A;  2VWB A;  1QQN A;  3B6O A;  4RG8 A;  4W5Q A;  4M42 A;  3TI0 A;  4BE1 A;  1W2B M;  1KAY A;  2NUB A;  2V7Y A;  1U47 A;  3VQP A;  1NK4 A;  1NGB A;  1TK5 A;  1QVG M;  4CZM A;  1NK0 A;  5KRS A;  5M1O A;  4HVJ A;  4AIL C;  2QWM A;  3CQ8 A;  4F9O A;  2FXU A;  4CGH A;  5KI6 A;  3O8M A;  3N4P A;  3MXJ A;  3DJC A;  3GBT A;  3OJU A;  3M6G A;  3WNG A;  3CM5 A;  1VQL N;  4DSI A;  3U8X A;  3G71 N;  3DM2 A;  3QBX A;  3VTI A;  4DTM A;  2P9I A;  4IO8 A;  1NGJ A;  5SZT A;  4DV3 K;  4GNI A;  1RTJ A;  4RWT A;  2P9I B;  3ZSR A;  2VGM A;  2ZWH A;  4UY8 O;  3WXM B;  4CJW A;  2E20 A;  2VG5 A;  5D3G A;  4CGI A;  4H0X B;  4RW9 A;  3WT0 A;  3SQ0 A;  4J2A A;  2HVH A;  1RDB A;  2F8T A;  4M3R A;  1TV6 A;  3SNN A;  1WB9 A;  2KFN A;  3ID6 A;  4WQ4 A;  3WUH A;  4IOA L;  5CR4 A;  1QSS A;  4NCA A;  2OTL N;  1BWF O;  2O4I A;  1VQN N;  2HHT A;  3Q7C A;  1HYS A;  3CCR N;  3KK7 A;  3LDL A;  1Q7Y O;  4JI7 K;  4BDY A;  3WXJ A;  4BRA A;  2HBM A;  2VYP A;  4BY9 C;  3SUQ A;  3WQT A;  4CZH A;  3WNH A;  3SJH A;  4CEE A;  3KHY A;  4HWI A;  1U4B A;  3JYT A;  3NE6 A;  3SAH A;  3VQ8 A;  3HOS A;  2X6N A;  4OO1 J;  2PYJ A;  4RW4 A;  3EE8 A;  5DM7 L;  1S72 N;  1BCM A;  5C24 A;  3PX0 A;  3DLB A;  1HQE A;  3ITH A;  4FPA A;  1ZBF A;  3ZEU A;  1T8E A;  2G8U A;  3P1G A;  5FPE A;  3BGR A;  1NJI O;  3FGU A;  3FR0 A;  4DR1 K;  3K9J A;  3ZEU B;  4CZK A;  4DUY K;  4HUE A;  3N4Q A;  3OYE A;  4JAX A;  5AQU A;  3EY1 A;  2V7Z A;  4NLB A;  4FLV A;  1VAZ A;  3ATU A;  4DSK A;  2YHX A;  1QQO A;  1YJN N;  2XRI A;  4DR4 K;  5DK5 A;  4FJ5 A;  3AVA A;  3VQE A;  1KVA A;  1TKT A;  4IG3 A;  2VWK A;  1CZB A;  2IS3 A;  2RKI A;  3S3N A;  3OYM A;  3NHG A;  4KBO A;  4CEB A;  4FJM A;  2OZM A;  4BRQ A;  2QWP A;  1VQ6 N;  4HCB A;  4DMN A;  4DQ8 A;  2BH1 A;  1K9M O;  1JKH A;  1T7P A;  2VQF K;  2Y1I A;  3ZX0 A;  3GG4 A;  4KTQ A;  1NGC A;  5J2P A;  1CXU A;  4H5T A;  4YOV A;  4L3Q A;  1A5W A;  2EWS A;  3ZCM A;  1GLE G;  3T3F A;  4AHR A;  3LPU A;  4KH5 A;  2HMI A;  3LM2 A;  1Q9Y A;  5AQZ A;  1N33 K;  3ALY A;  1TAU A;  2P9S A;  3RMC A;  3DRR A;  5AFU H;  3KLF A;  1CLQ A;  3LDO A;  1RCH A;  1L3U A;  3E9L A;  2OAN A;  3L6Q A;  3G10 A;  1RGI A;  2P9S B;  4H0V B;  2ITM A;  3HM8 A;  4NO7 A;  2QM1 A;  3O4Q A;  1RTH A;  4O5F A;  1XNR K;  3DXM A;  3KIO A;  4Q5V A;  1T6D A;  1YIJ N;  2IVO A;  5AQW A;  3K9K A;  5CYQ A;  3IDH A;  1YXQ A;  4C23 A;  4LH5 A;  5TKW A;  2Z1H A;  3V1O A;  4GKK K;  1NKB A;  1VSH A;  2D0A A;  4IWV A;  3ATV A;  3ZLJ A;  2VGN A;  2ZF5 O;  5JS1 A;  3QNO A;  1JLE A;  1VQ9 N;  1VK0 A;  5BR9 A;  3LP1 A;  4KH6 A;  3LL3 A;  4WFA L;  4KHN A;  5HRO A;  2OPS A;  1HNX K;  1LWE A;  2G8V A;  3ZX3 A;  3F5T A;  4CBU A;  3D0P A;  2ZE2 A;  2CGL A;  4IXC A;  5TKY A;  4BRP A;  1B92 A;  4F4K A;  3THY B;  3R3L A;  3O4N A;  3HL8 A;  1FKO A;  4B1Z A;  4BC4 A;  4RW7 A;  3A2F A;  4M3Z A;  2YHW A;  3DWL A;  3O1B A;  2O8E B;  4AHT A;  1NOY A;  3AGR A;  3LWL A;  3H3O B;  4IFE A;  3KD5 E;  2BAN A;  3O9Q A;  4Z4F A;  1EKE A;  1J54 A;  4WQ5 A;  1BIS A;  4CJU A;  1OH6 A;  4PKH A;  1ZYQ A;  1GLB G;  3AVH A;  4IFY A;  2D0C A;  4DV1 K;  3EE9 A;  3DRP A;  1A5X A;  4H5N A;  5AJ3 K;  4YDU C;  4J2D A;  3SK3 A;  4DR3 K;  4IJA A;  4FWM A;  2QKK A;  4GV6 A;  3ENO A;  1QSY A;  4DLG A;  4W5N A;  4XIU A;  3AVG A;  3KTQ A;  2KTQ A;  3NGI A;  2OPQ A;  3OYB A;  5M1K A;  3OS2 A;  4JKE A;  5AZI B;  3OBY A;  4YY3 K;  4FVM A;  4QS7 A;  4CCH A;  2GEL A;  5K14 A;  2D5R A;  2UUC K;  3V9U A;  4CZI A;  2ASP A;  1KAX A;  3MEG A;  1KLN A;  4B3M K;  3VGM A;  2PFU A;  4L8R B;  4MDB A;  4CHO A;  3K5N A;  3AA3 A;  3NVM A;  5AQN A;  4JI4 K;  3VOV A;  4B8C A;  4AHU A;  4JKH A;  5E26 A;  3IS9 A;  2P9K A;  1TUY A;  3QES A;  1L3T A;  3IG1 A;  4F8R A;  5AZJ A;  4PL7 A;  2RN2 A;  3CCV N;  3EZ5 A;  3QET A;  1LWC A;  4NCG A;  1TKX A;  3CFR A;  5AQR A;  3NF9 A;  1CZ9 A;  4Y1C A;  3SAF A;  4FOI A;  2ZM6 K;  4BG9 A;  5AQM A;  2E1Y A;  4C8K A;  3C6H A;  1WUA A;  3CPE A;  4LF7 K;  4H8K A;  2V51 B;  5BN8 A;  3DLL L;  1S1X A;  1QZ6 A;  5BR8 K;  2P9L A;  1C0T A;  2IDO A;  2Z1I A;  3O9S A;  1TYQ B;  4OPH A;  3LP2 A;  2IVP A;  3DLH A;  1Z6R A;  4PA1 A;  1UWB A;  3MCA B;  4JKC A;  1MDU B;  3VQB A;  1X1P A;  3D2E B;  2W42 A;  4FK4 A;  3I56 N;  4CIE A;  2WC9 A;  2ZJQ L;  4FJL A;  1OKJ A;  1G99 A;  1BHL A;  2I7P A;  5FRO A;  4WFB L;  1BL3 A;  4NXN K;  4CJ3 A;  3SPZ A;  2IAJ A;  4WYB A;  2D0O A;  1VQP N;  1RIL A;  3F9K A;  3CET A;  3LZI A;  1RTD A;  4AM7 A;  4JI5 K;  2O8C A;  3K2P A;  3MAQ A;  1VRT A;  4O0I A;  3O9T A;  4JD2 A;  4EP4 A;  3QB0 A;  3CCS N;  1D9D A;  4DS4 A;  1S1V A;  3VGK A;  4CIG A;  4CZL A;  4M3W A;  4OLB A;  2FSN A;  2NRZ A;  2HHH K;  3QML A;  4A59 A;  4QCL A;  1HYZ A;  2EHG A;  3V1Q A;  1JLC A;  4FJJ A;  1BG3 A;  3OYI A;  1T3V A;  3NVK A;  4KAZ A;  3NFA A;  2O8B A;  5SWM A;  3SUN A;  2EX3 A;  3MN9 A;  4G1Q A;  1NWK A;  4KB0 A;  2OPR A;  3M1F A;  5C10 A;  4UQG A;  1Z05 A;  3OBW A;  1JLB A;  4O0J A;  4FZX C;  1RT7 A;  5BRD A;  5DM6 L;  1BO5 O;  4B1Y B;  4K8Z A;  5BPL A;  3I8D A;  3PSF A;  3OTO K;  3P39 A;  3SMS A;  4KV8 A;  1JXB A;  2E2P A;  4JI1 K;  4DV7 K;  4DR6 K;  4BR5 A;  2J4R A;  4E7L A;  4GVM A;  5FDL A;  4CFC A;  2P51 A;  3OYA A;  3PO5 A;  1YJW N;  4C8L A;  3LAM A;  3VEN A;  5CY4 A;  4FJG A;  4B9M A;  4CEA A;  1BQN A;  1WBD A;  5AQG A;  4ZTF A;  4MQ3 A;  1RDC A;  1W7A A;  1LAV A;  3SAG A;  5CHI A;  1YHQ N;  4BE2 A;  4DTR A;  1KAZ A;  1VSL A;  2RF2 A;  4PL8 A;  4LY7 A;  3ULE A;  3M8Q A;  2QA4 N;  5LJV A;  1U48 A;  1WSH A;  1K8K B;  1HPZ A;  4KI6 A;  3ULE B;  3CC2 N;  5M1P A;  3CME N;  4LC9 B;  1QS4 A;  4JKA A;  1NJW A;  4BE0 A;  3MWT A;  4FJI A;  3WNE A;  3NMU A;  2KHO A;  4JI8 K;  4N56 A;  3QEX A;  4AF1 A;  1T6C A;  3CCL N;  3V9S A;  2NRW A;  5C15 A;  4YFU A;  3A5M C;  3HPH A;  4FWO A;  1XI1 A;  3CMA N;  5J2M A;  2Q36 A;  3HOT A;  2HHV A;  3TAF A;  5KQD A;  3VMF B;  5ADX A;  4JRP A;  3SQ1 A;  3O3G A;  5AQL A;  4CJK A;  2BUP A;  1TAQ A;  4JK7 A;  4PKG A;  4CE9 A;  1X9W A;  1BQM A;  4GY2 B;  1LAW A;  3K0S A;  4B3O A;  5KTQ A;  1K8A O;  2IIR A;  3MWP A;  3T1A A;  4H0O A;  2O8F A;  2P9U A;  2E8A A;  4ILH A;  2IC3 A;  3CER A;  3T19 A;  5T7B A;  4H4M A;  4OGE A;  5EXW A;  2E2Q A;  4E1M A;  1XUP O;  3TAQ A;  4DTU A;  3C0B A;  5M1N A;  2PBD A;  3L4I A;  5AQS A;  3KZB A;  5HRR A;  4CJQ A;  1NU0 A;  4CJT A;  3L2V A;  3UB5 A;  1SKS A;  3PIP L;  1UA1 A;  1B9F A;  3THW A;  2W40 A;  4JKB A;  1HKG A;  3VF2 A;  3H1Q A;  3HVT A;  4BRN A;  5FPN A;  3ZYY X;  1OVQ A;  4CZE A;  4ILG B;  4H5V A;  4M3U A;  2W6K A;  4YOT A;  2JLE A;  1X3M A;  2HOE A;  4KRF A;  3AO2 A;  1TGO A;  2D4W A;  1OH8 A;  1ZXO A;  4CFD A;  2QK9 A;  2P9P A;  3UE5 A;  1S5J A;  3OYK A;  2FF6 A;  3KLG A;  1HKB A;  3CJ1 A;  2UUA K;  4NYF A;  4LF6 K;  3L2W A;  2RPI A;  5HL7 L;  1M1K O;  5KPZ A;  2FLO A;  4RW6 A;  4LSL A;  2E5L K;  4HUF A;  4B3S K;  4KO0 A;  3H08 A;  4N47 A;  5H1S Q;  3SUO A;  2I5J A;  3EKU A;  3C65 A;  1WSI A;  4TSX A;  4N41 A;  3SUP A;  3DXK A;  3VEV A;  4CGG A;  3PLA A;  1NMN A;  5JS2 A;  4OGC A;  3PSI A;  3DXK B;  4CEZ A;  4FM0 A;  3OA9 A;  3QEI A;  1J53 A;  1YIT N;  3E01 A;  1SS6 A;  3VF4 A;  5ADX H;  3V9W A;  4HTL A;  1YVN A;  3NCI A;  1EXQ A;  1TUU A;  2NRV A;  2YNG A;  3BEX A;  4OKK A;  2QI2 A;  3D45 A;  3PV8 A;  1QTM A;  2IOC A;  4HHT A;  3AAP A;  4DTX A;  2GV9 A;  2XHB A;  3VQC A;  4JI3 K;  1DKG D;  3HXM A;  4KHW A;  4H4O A;  5JLF A;  4IKF A;  2G8K A;  4GV9 A;  4BR9 A;  3F73 A;  4BWJ A;  1N5Y A;  3VQD A;  1S1W A;  4BR0 A;  4FWR A;  1EO1 A;  2AA4 A;  4YOR A;  3CQY A;  5HRN A;  3HO1 A;  1ITG A;  1D5A A;  1O1W A;  2YKN A;  2O8D A;  3FZL A;  4K42 A;  3THV A;  4DF4 A;  1OH5 A;  4BVO A;  3GDQ A;  2O8D B;  2YKM A;  1HNI A;  5FPD A;  4ILJ A;  3O3H A;  5JLH A;  1FW6 A;  4Z0U A;  3L2U A;  5AFU A;  2Q0R A;  4BRF A;  3T1H K;  1VQM N;  4CEO A;  1TL1 A;  4O44 A;  4DCH A;  2WBN A;  2YJE A;  4O8U A;  2WOM A;  4N5S A;  1IBK K;  4FCY A;  3VQ9 A;  1HPM A;  3QDK A;  4OVL A;  1XC3 A;  3P4I A;  2E2N A;  1Y64 A;  3ZET A;  5GIP A;  3IKM A;  5AQX A;  3CJB A;  1KSP A;  3O9R A;  3ZET B;  2Q3S A;  5CE3 A;  2G8I A;  2HST A;  3HJF A;  1QSL A;  3LPT A;  5FLX O;  3HP9 A;  4IOX A;  4CZJ A;  3LWM A;  1X9S A;  4B9N A;  5F2R A;  4K41 A;  1NK7 A;  3NF8 A;  3NGY A;  4DFM A;  2NNW A;  3OYF A;  1Q86 O;  1RDU A;  4FLW A;  1NNE A;  4ID5 A;  1E4G T;  3CCJ N;  4IEE A;  4IDH A;  1BA0 A;  2UXB K;  4CF0 A;  1JCF A;  3K5L A;  1HNW K;  1KFD A;  1SKW A;  3RVC A;  4DWI A;  4CEQ A;  1KVC A;  1R59 O;  3ZT3 A;  1R0A A;  1XC9 A;  4FLZ A;  1W9H A;  4CVN E;  3A5O C;  3P83 D;  4Z4E A;  3R9P A;  4FJN A;  1IH7 A;  4F3T A;  3THX A;  1XNQ K;  2HMP A;  3PX4 A;  2I7N A;  2YHA A;  1WSJ A;  1ASU A;  3S3M A;  3J8A A;  1KTQ A;  1KXP A;  2YI1 A;  3THX B;  5IWA K;  3EEQ A;  1WLJ A;  2JWK A;  2B5J A;  1TKD A;  5FRN A;  1VSI A;  2FBT A;  2QEX N;  2VQE K;  3KWI A;  3ZT1 A;  4CEC A;  4BRE A;  3KD1 E;  3I33 A;  3T7Z A;  4G9Z A;  3GL1 A;  4FJH A;  3OYD A;  4CK2 A;  2BDP A;  3VEX A;  4Y1D A;  4LH4 A;  1SKR A;  5HOO A;  5C0Y A;  2ZJR L;  4DV2 K;  3ASM A;  3ZSO A;  1U2V A;  3TSQ A;  3PIO L;  4M3T A;  4FYD A;  1S6P A;  5BPM A;  4N76 A;  3U3G A;  3SV3 A;  2CGJ A;  3TAN A;  4KHS A;  4H0Y B;  3L3U A;  5LJW A;  3MEC A;  2KKZ A;  1C0M A;  3HK2 A;  3J7Z O;  4LSN A;  1VQO N;  2OZS A;  3VES A;  4DSE A;  3W0L A;  4Z4H A;  1NJX A;  3DXM B;  3NAE A;  4JI0 K;  4LF5 K;  4MDA A;  4DQS A;  3S9H A;  4A2B A;  5GIN A;  3AA4 A;  4WE1 A;  4U67 L;  1VSD A;  1XQS C;  3AV9 A;  4CFA A;  3VEY A;  2ZQB A;  2F7T A;  3NF7 A;  2XY6 A;  3KKS A;  2QWR A;  3M5R A;  4JI6 K;  4XH4 A;  5KGW A;  2W41 A;  3H6E A;  2GEM A;  1GLL O;  4DV4 K;  1KRP A;  2KFZ A;  3IRX A;  3AY9 A;  1KD1 O;  1MWK A;  4DU3 A;  5KPT A;  2VG6 A;  1VQ8 N;  3F9M A;  2HBK A;  3Q7B A;  4OX9 K;  4DV5 K;  3V1R A;  3DLR A;  3OJS A;  3VEW A;  3EL2 A;  4CZG A;  1QE1 A;  1T03 A;  1WOQ A;  1JLA A;  4F2R A;  3RRG A;  1EQY A;  3SPY A;  3MED A;  4JEP A;  1LWF A;  3BDP A;  1MU2 A;  1GLD G;  1LOT B;  3SZ2 A;  1NJZ A;  3I8B A;  4BGA A;  1RFQ A;  1F21 A;  1NOZ A;  2WTU A;  4KH4 A;  4NLC A;  1YTU A;  2E2O A;  1C0G A;  3CXC M;  5J1E A;  3OYC A;  3HZ6 A;  4A2A A;  4B9T A;  5AQO A;  3PUF A;  3O6W A;  2QWO A;  3V6D A;  3KLH A;  3C6A A;  3T1Y K;  3HI0 A;  4CJV A;  4FLX A;  4BG8 A;  4XH5 A;  2UYT A;  3AO1 A;  1KLM A;  1U49 A;  1U04 A;  3U4L A;  3E66 A;  4FWP A;  2UXD K;  5B8H A;  4CF8 A;  4FWS A;  3AO3 A;  4DTJ A;  4K43 A;  3C95 A;  1MWM A;  4H5W A;  2O4G A;  2Z1J A;  4FWK A;  4KTW A;  2BE2 A;  2AJQ A;  1VHX A;  3VER A;  2Q97 A;  3DOK A;  3P31 A;  3TTF A;  4I9L A;  3RSE A;  3K59 A;  3SV4 A;  3H1V X;  2A1R A;  4C8M A;  3M8S A;  3CCM N;  4GW6 A;  3RSE B;  3GE1 A;  4KTZ A;  4E19 A;  5F1X A;  3ZSY A;  4HTU A;  4CER A;  3NDK A;  2P1J A;  3AAQ A;  2P9K B;  2IGI A;  1JLF A;  4DSF A;  1Q8I A;  5AZJ B;  1H1V A;  3ZSV A;  2P5G A;  3VQ5 A;  5J2N A;  4EP5 A;  2QTD A;  1TK8 A;  2W6L A;  1RT6 A;  1XWL A;  3P5J A;  1VQ4 N;  1SL1 A;  3AVN A;  1BA1 A;  1N32 K;  3W3D A;  3M3Z A;  4CJR A;  3J80 O;  4FPB A;  4CJP A;  3FZH A;  4I2P A;  3MX5 A;  4M7Y A;  3ZT0 A;  1C1C A;  2AP1 A;  3BF1 A;  4X66 K;  1GOB A;  1VSM A;  2P9L B;  3O4W A;  2FBV A;  3EN9 A;  2LSN A;  3QEV A;  4DKW A;  3HP6 A;  3A8Y A;  4QAG A;  1NJY A;  1EET A;  3OY9 A;  5LMU K;  4BQZ A;  1S22 A;  2OA8 A;  3MDQ A;  2ZJP L;  1VRU A;  1WAJ A;  3QIN A;  3O9U A;  1RNH A;  3TAB A;  3NF6 A;  1WNS A;  5CZ1 A;  2KLA A;  1VQ5 N;  5BRH A;  1DTQ A;  5FRM A;  1C1A A;  5GAH P;  3P38 A;  4ISG A;  4C1N I;  4AHS A;  2QWQ A;  1RBU A;  5KGX A;  5MLC Q;  3K5O A;  1HX1 A;  1RDD A;  5I9E B;  5AQV A;  5KPR A;  2CH5 A;  2HB5 A;  4OKJ A;  5J2Q A;  1Q9X A;  4BQL A;  4LFB K;  3MN5 A;  1IKV A;  1C1B A;  3DLK A;  3VPZ A;  2O8C B;  4LF8 K;  4RW8 A;  2Y1J A;  4I6M A;  4FW2 A;  4BR7 A;  2ASO A;  4IEI A;  4JD2 B;  1ATS A;  1EWQ A;  4CHP A;  2NRR A;  5HP1 A;  1VSF A;  4DSL A;  5GIO A;  4WQ4 C;  3ULD A;  1N8R O;  1TK0 A;  3C94 A;  4K8X A;  2FBY A;  3NH1 A;  2HW3 A;  4FOE A;  3OS1 A;  4FWN A;  5KRT A;  1SL0 A;  2G8H A;  3VEO A;  3U9D A;  4JI2 K;  1S1T A;  1P90 A;  3SLC A;  3V81 A;  3SQ4 A;  4QOZ B;  2HHW A;  5KQ8 A;  2YJF A;  2O8B B;  4MLE A;  2HHU A;  2BTF A;  3CCQ N;  4FW1 A;  1ILY A;  2A40 A;  3AVF A;  4WF9 L;  3NBP A;  1NKC A;  1HJR A;  4A61 A;  4ELT A;  5M1F A;  3G0Z A;  3O1W A;  4IG0 A;  5LY3 A;  3AGK A;  3CFP A;  5JVG L;  4DTO A;  4BRM A;  4B9L A;  1HNV A;  2HND A;  5AQK A;  4Z4I A;  4C8O A;  3D7E O;  5BPN A;  4WFN L;  3KLI A;  4CGF A;  3U6F A;  1N6Q A;  2KZM A;  1NM1 A;  4BRD A;  1NGA A;  1CXQ A;  2D1K A;  3QFP A;  1NK9 A;  2PAV A;  4FO0 A;  3LDP A;  1L3S A;  4OKE A;  4FJ8 A;  2HF3 A;  3TPQ A;  4XEI A;  4IFV A;  2OPP A;  1K73 O;  3L0Q A;  1NMD A;  3O80 A;  3EO3 A;  1ZBL A;  1IBM K;  3WNF A;  1ZC6 A;  4E1N A;  4DSJ A;  4FLY A;  1KVB A;  1RDW X;  2YNF A;  4MLH A;  1XMQ K;  3R6M A;  3VQQ A;  4B3R K;  4J2B A;  4IJN A;  1Z26 A;  3AVL A;  1XMO K;  4DU4 A;  1IO2 A;  4BRO A;  1FXX A;  4E1J A;  4JS4 A;  5IT9 O;  1N34 K;  1HMV A;  1Q18 A;  3BP8 A;  4I9Q A;  1KC8 O;  4FJ9 A;  1TL3 A;  2VWJ A;  1NBW A;  3VEZ A;  1Y97 A;  4EFH A;  3G25 A;  4BRL A;  4AQY K;  3F2K A;  3LM9 A;  4C1N K;  2UU9 K;  3OW2 M;  1LW0 A;  4CJS A;  1RT1 A;  4DHY A;  1RT5 A;  1GLA G;  2NLX A;  4ELU A;  2O8F B;  3D2F A;  4JS5 A;  4YDU A;  2P9U B;  3MXM A;  4B3T K;  2A42 A;  1LW2 A;  4AHC A;  1VSJ A;  2OCE A;  4MO5 A;  1X9J A;  3VTH A;  2ETJ A;  3D2F B;  1S6Q A;  3VQ6 A;  3CC7 N;  5HLF A;  1HRH A;  4M41 A;  4DTP A;  4EIA A;  3BZK A;  3QFU A;  3DMJ A;  1QZ5 A;  1HR0 K;  3LP3 A;  3OVN A;  1YI2 N;  1JXE A;  3KK2 A;  1JJ2 M;  3M8R A;  1QHT A;  1I94 K;  1S9E A;  4FWL A;  4KFB A;  2YX6 A;  3THW B;  3PX6 A;  3EZW A;  1GOA A;  4YOX A;  1BIZ A;  1D4X A;  2D0B A;  3SMP A;  4ZHR A;  5LL6 Z;  2HNY A;  3DLE A;  3QEP A;  3DLG A;  3ZX2 A;  4CJE A;  4X65 K;  3G4S N;  3O3F A;  1I39 A;  3J81 O;  1YAG A;  3HPG A;  4F3O A;  1RBT A;  2P9P B;  4FK0 A;  3NH0 A;  3CF5 L;  1L5U A;  3DAW A;  1J9A A;  1QHA A;  5I3U A;  3RWU A;  1E3M A;  1VSK A;  5JVH L;  4M7X A;  4BAC A;  3OS0 A;  1WBB A;  2P5O A;  3ZSX A;  2YHY A;  1IBL K;  1IKY A;  3FE1 A;  2WFB A;  4LF9 K;  3CYM A;  1X3N A;  3L8B A;  3ENH A;  1S3X A;  2DFH A;  3SJJ A;  2NZT A;  3ZSZ A;  1IKW A;  4X64 K;  1JLG A;  4WQ5 C;  4CIF A;  3QBW A;  1GOC A;  4R79 A;  3AVB A;  4IBN A;  4LF4 K;  4FM2 A;  5GAD P;  5BRE A;  1HJO A;  5DMR A;  3QNN A;  4DS5 A;  2A5X A;  4FM1 A;  5BRF A;  3CJ9 A;  1SAZ A;  2YNI A;  2RE2 A;  3RMA A;  1J5O A;  2F9T A;  4BGB A;  3AO4 A;  2R7Y A;  2GX9 A;  3AA2 A;  1NK6 A;  1ZBI A;  1IKX A;  3MX2 A;  1ZBS A;  4IDK A;  1RBV A;  3IAY A;  4U7B A;  1B9D A;  4EZ6 A;  3C6T A;  5AQJ A;  3HTV A;  3TSU A;  1HNZ K;  4FJK A;  4F2S A;  2OTJ N;  1RBR A;  1IV0 A;  4CJL A;  4GVE A;  1TVR A;  4DV0 K;  1VSE A;  3DYA A;  3A5L C;  1RT4 A;  1QVF M;  2FC0 A;  5I42 A;  1S9G A;  1JCG A;  2HHS A;  3MMV A;  4CES A;  5AQY A;  1SV5 A;  2GWK A;  1NKE A;  3IFR A;  2ZD1 A;  1NGE A;  3AA5 X;  3FLC O;  3AVC A;  4YOW A;  1U45 A;  1RT2 A;  1UAX A;  3HPO A;  3CCE N;  2DPN A;  2A1S A;  4BRG A;  3BUZ B;  3TAG A;  3L3V A;  5C2D A;  3HRG A;  4BRC A;  4Z4C A;  2FBX A;  2Q31 A;  3CJC A;  5C2F A;  3BZC A;  4FL9 A;  4NXM K;  3VF6 A;  4LFC K;  5A2Q O;  2GBZ A;  2HNZ A;  2G8W A;  2XY8 A;  3KKR A;  2D0P A;  4DQP A;  2NRH A;  5C42 A;  1W97 L;  3PY8 A;  5M1Q A;  2DFE A;  4BC2 A;  2UXC K;  2QW9 A;  2CH6 A;  5AQP A;  4EHT A;  4FK2 A;  3O08 A;  4H03 B;  3CJ7 A;  5EVZ A;  3VQ4 A;  3SBT A;  5AQF A;  3HST B;  4BRK A;  4CFB A;  4GKJ K;  2HHX A;  1LCU A;  4IOC L;  1GLC G;  1J6Z A;  3VET A;  4JV5 K;  5AQH A;  1FJG K;  4RTF D;  1L3V A;  2HBL A;  2XO7 A;  3AO5 A;  3OYG A;  3V9X A;  2KZZ A;  2ZGZ A;  4B9Q A;  4PQU A;  4KB1 A;  2UUB K;  1GLJ O;  3KK3 A;  1NGH A;  3S3O A;  4GV3 A;  4KRE A;  4OPA A;  1DTT A;  4K25 A;  4ICL A;  4JHD A;  4CHN A;  3DOL A;  4BDZ A;  2QKB A;  1E4F T;  3MEE A;  4HCC A;  3TU5 A;  4DUZ K;  4CJ7 A;  4JHD B;  3C6U A;  3A5N C;  1NGF A;  4XH1 A;  1REV A;  2NRT A;  4B8A B;  4PHT X;  1GLF O;  4Y0W A;  4DTN A;  5HRS A;  3ZT2 A;  1C0F A;  4MO4 A;  1Q82 O;  1U2V B;  2E88 A;  2VCP A;  3GOI A;  4DFJ A;  1FK9 A;  3LAL A;  4OJR A;  3FZM A;  4B9V A;  1ASW A;  5GAG P;  3WEE A;  4B08 A;  3CG7 A;  3FFK B;  1FKP A;  2ASM A;  4BR2 A;  2F9W A;  3WEE B;  5EU7 A;  1WN7 A;  3U3Y A;  4O55 A;  4A5B A;  3QER A;  3NH2 A;  4HUG A;  3JXU A;  4CF1 A;  2A3Z A;  1Z25 A;  3VGL A;  5EX5 A;  4E7H A;  4CK1 A;  2QWN A;  4V19 S;  4FZZ A;  3TTC A;  3OYJ A;  3CD6 N;  4FSV A;  1Q81 O;  4CJ4 A;  3ZT4 A;  3M8P A;  4JN4 A;  3LAK A;  3KLE A;  3QIC A;  5JIC A;  3VA3 A;  3AVK A;  3HVR A;  4MFB A;  1JCE A;  3SBG A;  2GTD A;  1HUX A;  1O13 A;  4FLT A;  4JKD A;  4KHU A;  1ATR A;  3CI5 A;  4FWQ A;  4AH9 A;  5HBM A;  4DFP A;  1YF5 L;  4E3S A;  4CHY A;  1NGG A;  4B9S A;  4KPY A;  1BI4 A;  4H0P A;  2DFF A;  4KKO A;  4QS8 A;  4CBX A;  3THY A;  3EKS A;  4YNQ A;  1DLO A;  3MCP A;  1BI4 B;  1LV5 A;  2FSK A;  4GMJ B;  4C8N A;  2O8E A;  3CQX A;  4FJ7 A;  1SUQ A;  3QIO A;  4FXD A;  1UOC A;  5LMN K;  3L2Q A;  4CZF A;  4LFA K;  3K5M A;  3KWG A;  4CD1 A;  5ELZ A;  3J7Y P;  3RTV A;  3BF3 A;  5CZ2 A;  4OPK A;  3HT3 A;  2FSJ A;  1X9M A;  3SI6 A;  4E7I A;  3CFO A;  3TAM A;  3MN6 A;  4CGJ A;  4DU1 A;  3JAM O;  2F96 A;  3J7A P;  5E41 A;  4CBW A;  1KCF A;  3SYZ A;  5AZI A;  3UKU A;  4CJ5 A;  4CHZ A;  1YTA A;  1KQS M;  4E7K A;  4NYN A;  4ELV A;  2HVI A;  4E89 A;  3UKU B;  1RBS A;  2HBJ A;  3LDS A;  2YCH A;  3CJA A;  2BGG A;  4M45 A;  4ID1 A;  4DF8 A;  3MXI A;  5C25 A;  2JGU A;  4DR7 K;  1DGK N;  4BR4 A;  1JL1 A;  4O5B A;  3T69 A;  1NGI A;  2B6A A;  3FZF A;  5E84 A;  1NK8 A;  4DB3 A;  5CYM A;  3ENB A;  4AHV A;  3TR8 A;  2XY5 A;  2E6M A;  1YT3 A;  1JLQ A;  4WCE L;  3LP0 A;  4CEF A;  1QQC A;  4EZ9 A;  2FF3 B;  3AAR A;  3KK1 A;  5C12 A;  4CI6 A;  3VN5 A;  5FPM A;  3DRS A;  2E1Z A;  4IZ9 A;  1T44 A;  4FLU A;  1IJJ A;  3WXI A;  3VQA A;  2G8F A;  3FZK A;  4B9U A;  2Q0U A;  3ID8 A;  3WQU A;  2QWL A;  2A6A A;  1TYQ A;  1RT3 A;  2YHB A;  4DR5 K;  1YUW A;  1J5E K;  1V4S A;  4Z4G A;  4JRQ A;  3CIP A;  1V4T A;  2WON A;  3D2E A;  1TKZ A;  3MK6 A;  4BWM A;  3I0R A;  3EYZ A;  3RR8 A;  3ISN C;  2XY7 A;  5BN9 A;  4J2E A;  2HHQ A;  5EOY A;  1WSE A;  3QIP A;  2X74 A;  1DEJ A;  1HLU A;  4H5R A;  4YOY A;  3FFI A;  4CF2 A;  4DR2 K;  1SZ2 A;  3TAE A;  1BDG A;  1XHZ A;  2PYL A;  3I55 N;  5AQQ A;  2DY4 A;  1OH7 A;  1KFS A;  4W5O A;  1WAF A;  3WXK A;  5GAE P;  1SQK A;  3OHR A;  4I6M B;  1WSF A;  4CK3 A;  3E9P A;  4I7F A;  4B1V A;  4EHU A;  4X62 K;  1BCO A;  4DTS A;  1K6Y A;  1BUP A;  1JL2 A;  3BY5 A;  3C7N A;  4PKI A;  3RR7 A;  2OYQ A;  4E7J A;  4JK9 A;  2KQ2 A;  1EP4 A;  3C7N B;  1G15 A;  1ZBH A;  4PWD A;  3E1Y A;  3AVJ A;  2F8S A;  1YVU A;  4PY5 A;  2V52 B;  1U6Z A;  4CGD A;  4Z94 A;  1ATN A;  2QXF A;  4DQI A;  3R1X A;  3WXL A;  3VA0 A;  1OVY A;  4DFK A;  1BGX T;  1ESV A;  3CM6 A;  4CD3 A;  4BRI A;  4IO9 L;  3JSM A;  3B8A X;  4O8K A;  3K58 A;  1M90 O;  3JS6 A;  2X6S A;  4CW7 B;  2E6L A;  4E0D A;  3CPW M;  4BDP A;  4RCH A;  3CHW A;  1HQU A;  2NRX A;  3H3N O;  1MA9 B;  1QQM A;  3CCU N;  3G6E N;  3QO9 A;  4W5R A;  4B1X B;  1D8Y A;  3L4Q A;  4K0K K;  2JWL A;  3AVM A;  4CED A;  5F0X A;  3I0S A;  4FVU A;  3A0I X;  4BVP A;  4B1U B;  1CZA N;  4CF9 A;  3U9Z A;  3TWH A;  5AQT A;  1D9F A;  3DI6 A;  4JKF A;  1BOT O;  4JLH A;  1NG9 A;  2VG7 A;  3OYH A;  2PY5 A;  2Q1N A;  1W0H A;  2CGK A;  3E9O A;  4LD0 A;  3RMB A;  4A57 A;  1K8K A;  3L2R A;  4JYA K;  3S41 A;  3OYL A;  3O5B A;  2PZS A;  3H46 O;  4JNE A;  3PO4 A;  2HF4 A;  4CHQ A;  5AQI A;  4W5T A;  4KI4 A;  2Z1G A;  3D6R A;  1I3A A;  3B6P A;  4A62 A;  3TAR A;  2ZGY A;  4NB4 A;  3VQ7 A;  4YHH K;  4DQR A;  4M63 C;  4JK8 A;  3ZSQ A;  1RTI A;  4A5A A;  5AR0 A;  3LDQ A;  4DV6 K;  4PUO A;  1HKC A;  1XHX A;  4BC3 A;  3TSP A;  1BIU A;  4JKG A;  4QS9 A;  2WUS A;  4OPJ A;  1S1U A;  4BRH A;  4JKG B;  1EWR A;  3ZSW A;  3UKR A;  4NCB A;  3TAP A;  4DLE A;  4ZTJ A;  2YNH A;  1T05 A;  4M3X A;  4H0T B;  3UKR B;  4CJF A;  2E4L A;  4KHQ A;  1EX4 A;  2B4J A;  2QXL A;  4B1W B;  1C0U A;  4FJX A;  2GUP A;  4R5P A;  3IMX A;  1SL2 A;  1A5V A;  4ISE A;  3NGZ A;  1DT9 A;  1ASV A;  1NK5 A;  4KHY A;  4YOU A;  1WSG A;  2ITG A;  3OYN A;  4DQQ A;  4KHP K;  4AM6 A;  2Q2R A;  3HYF A;  3KJV A;  3TTD A;  4Q0B A;  3V4I A;  3RRH A;  3HBT A;  1VQK N;  4FZY A;  4O4G A;  3QEW A;  1C6V A;  3QLH A;  3MN7 A;  1P8Z A;  3V9Z A;  3HM9 A;  1IG9 A;  3KVG A;  4EAH D;  1UA0 A;  1HYV A;  3K57 A;  3SQ2 A;  3LZJ A;  5HRP A;  2H3G X;  4BC5 A;  3LAN A;  1RDA A;  4ISF A;  5JMV A;  1BU6 O;  1ZBU A;  3AVI A;  2P9N A;  3HSC A;  2X78 A;  2ATQ A;  2YV0 X;  4M3Y A;  2GUI A;  4DG1 A;  3CC4 N;  3RMD A;  1NGD A;  2F4V K;  2GWJ A;  4OLA A;  2A41 A;  3UIQ A;  2P9N B;  1NLV A;  2RHK A;  3SCX A;  1YJ9 N;  3H45 C;  4I2Q A;  2KW4 A;  2IVN A; 
#chains in the Genus database with same CATH homology
 3C95 A;  3S3O A;  1JXB A;  4KRE A;  2O4G A;  2Z1J A;  4KTW A;  1DTT A;  2BE2 A;  2AJQ A;  2DTU A;  4ICL A;  3DOK A;  4CHN A;  4E7L A;  3DOL A;  4GVM A;  4I9L A;  5FDL A;  4CFC A;  2P51 A;  4BDZ A;  2QKB A;  3B6O A;  3MEE A;  4RG8 A;  4W5Q A;  3OYA A;  3K59 A;  3SV4 A;  3PO5 A;  4C8L A;  3TI0 A;  4HCC A;  4M42 A;  4BE1 A;  2A1R A;  3LAM A;  3C6U A;  4C8M A;  3M8S A;  5CY4 A;  4DTN A;  1REV A;  4FJG A;  2NUB A;  4GW6 A;  4B8A B;  4B9M A;  4KTZ A;  4E19 A;  4CEA A;  1BQN A;  5HRS A;  3ZSY A;  4HTU A;  1U47 A;  3VQP A;  1NK4 A;  4ZTF A;  4MQ3 A;  3ZT2 A;  4CER A;  3NDK A;  1RDC A;  1TK5 A;  2P1J A;  1NK0 A;  5KRS A;  4HVJ A;  2IGI A;  1LAV A;  1JLF A;  4AIL C;  4DSF A;  1Q8I A;  4BE2 A;  4DTR A;  3CQ8 A;  3ZSV A;  1VSL A;  2RF2 A;  2P5G A;  3VQ5 A;  4LY7 A;  5KI6 A;  4CGH A;  3M8Q A;  5J2N A;  4DFJ A;  1U48 A;  1FK9 A;  1WSH A;  3MXJ A;  3LAL A;  4EP5 A;  4OJR A;  3OJU A;  1HPZ A;  1TK8 A;  3WNG A;  4B9V A;  1ASW A;  4KI6 A;  3CM5 A;  4B08 A;  1RT6 A;  4DSI A;  1XWL A;  3CG7 A;  3DM2 A;  3P5J A;  1SL1 A;  4DTM A;  1FKP A;  3AVN A;  1QS4 A;  1NJW A;  4CJR A;  4BE0 A;  5SZT A;  5EU7 A;  4CJP A;  3WNE A;  4I2P A;  4FJI A;  3ZT0 A;  1C1C A;  1WN7 A;  1RTJ A;  3ZSR A;  3U3Y A;  4O55 A;  1GOB A;  1VSM A;  4CJW A;  2VG5 A;  4N56 A;  3QER A;  3QEX A;  5D3G A;  4CGI A;  4RW9 A;  3NH2 A;  3SQ0 A;  3V9S A;  4J2A A;  2HVH A;  4YFU A;  1RDB A;  2FBV A;  4HUG A;  2F8T A;  4CF1 A;  2LSN A;  3QEV A;  4M3R A;  1Z25 A;  1TV6 A;  3HP6 A;  3HPH A;  4QAG A;  4E7H A;  3SNN A;  1EET A;  4CK1 A;  1XI1 A;  1NJY A;  2KFN A;  4FZZ A;  5J2M A;  3OYJ A;  3OY9 A;  1QSS A;  4NCA A;  2HHV A;  2O4I A;  3TAF A;  4CJ4 A;  2OA8 A;  1VRU A;  3ZT4 A;  3M8P A;  1WAJ A;  4JRP A;  3QIN A;  3SQ1 A;  3LAK A;  2HHT A;  1HYS A;  3O3G A;  3KLE A;  1RNH A;  4CJK A;  3NF6 A;  1WNS A;  3TAB A;  1TAQ A;  5CZ1 A;  4CE9 A;  4BDY A;  3VA3 A;  1X9W A;  1BQM A;  1DTQ A;  3AVK A;  5FRM A;  3SUQ A;  1C1A A;  1LAW A;  3HVR A;  4MFB A;  4B3O A;  3WNH A;  5KTQ A;  4AHS A;  4CEE A;  3T1A A;  4FLT A;  1RBU A;  5KGX A;  1U4B A;  3K5O A;  4KHU A;  1RDD A;  3JYT A;  3NE6 A;  3VQ8 A;  4OKJ A;  2HB5 A;  2IC3 A;  3T19 A;  5J2Q A;  1Q9X A;  4AH9 A;  5T7B A;  4H4M A;  2X6N A;  4OGE A;  5HBM A;  4E3S A;  1IKV A;  1C1B A;  4DFP A;  3DLK A;  4RW4 A;  4CHY A;  2PYJ A;  4B9S A;  4KPY A;  4E1M A;  3TAQ A;  1BI4 A;  4DTU A;  1BCM A;  4RW8 A;  5C24 A;  2Y1J A;  2DFF A;  3PX0 A;  4FW2 A;  1HQE A;  3ITH A;  4KKO A;  3DLB A;  1ZBF A;  4YNQ A;  1DLO A;  5HRR A;  4CHP A;  1LV5 A;  1BI4 B;  4CJQ A;  1VSF A;  5HP1 A;  3P1G A;  1T8E A;  2G8U A;  4CJT A;  4DSL A;  3BGR A;  4GMJ B;  3L2V A;  4C8N A;  3ULD A;  1SKS A;  1TK0 A;  4FJ7 A;  3C94 A;  1SUQ A;  1UA1 A;  4K8X A;  4HUE A;  1B9F A;  3QIO A;  2FBY A;  3NH1 A;  3OYE A;  4FXD A;  2HW3 A;  1UOC A;  3OS1 A;  3HVT A;  3EY1 A;  5KRT A;  4FLV A;  1SL0 A;  4DSK A;  3L2Q A;  3K5M A;  2G8H A;  2XRI A;  3RTV A;  5CZ2 A;  4OPK A;  1S1T A;  3V81 A;  4M3U A;  3SQ4 A;  5DK5 A;  3HT3 A;  3AVA A;  3VQE A;  1KVA A;  4FJ5 A;  4QOZ B;  2HHW A;  1TKT A;  1X9M A;  3SI6 A;  2JLE A;  4E7I A;  4IG3 A;  4KRF A;  2VWK A;  3AO2 A;  2HHU A;  1TGO A;  3CFO A;  4FW1 A;  3TAM A;  4CFD A;  3AVF A;  1CZB A;  2QK9 A;  2IS3 A;  2RKI A;  4CGJ A;  4DU1 A;  1S5J A;  3OYK A;  3S3N A;  3OYM A;  2F96 A;  3NBP A;  3KLG A;  1NKC A;  1HJR A;  3NHG A;  4ELT A;  4NYF A;  3G0Z A;  3L2W A;  2RPI A;  4IG0 A;  3CFP A;  5E41 A;  4RW6 A;  4LSL A;  4DTO A;  4CEB A;  4HUF A;  1KCF A;  4FJM A;  4B9L A;  3SYZ A;  2OZM A;  1HNV A;  2HND A;  4KO0 A;  3H08 A;  4CJ5 A;  4N47 A;  4HCB A;  4DMN A;  4CHZ A;  3SUO A;  1YTA A;  2I5J A;  4E7K A;  1WSI A;  4TSX A;  4NYN A;  4ELV A;  4N41 A;  3SUP A;  4Z4I A;  1JKH A;  4C8O A;  4E89 A;  2HVI A;  4CGG A;  5JS2 A;  1RBS A;  3LDS A;  2BGG A;  1T7P A;  4M45 A;  4ID1 A;  4DF8 A;  3MXI A;  3KLI A;  4CGF A;  4OGC A;  3U6F A;  5C25 A;  1N6Q A;  2JGU A;  2KZM A;  2Y1I A;  4CEZ A;  1CXQ A;  4FM0 A;  1NK9 A;  3QEI A;  1J53 A;  1JL1 A;  3E01 A;  4KTQ A;  4O5B A;  5J2P A;  1CXU A;  1L3S A;  4OKE A;  4FJ8 A;  2B6A A;  3V9W A;  1NK8 A;  5CYM A;  4IFV A;  1A5W A;  2OPP A;  3ZCM A;  4AHV A;  3NCI A;  3T3F A;  1EXQ A;  4AHR A;  3LPU A;  3TR8 A;  2XY5 A;  2E6M A;  1YT3 A;  1JLQ A;  2YNG A;  4OKK A;  3PV8 A;  3D45 A;  1QTM A;  2HMI A;  2IOC A;  3LP0 A;  4CEF A;  4HHT A;  1Q9Y A;  1ZBL A;  3ALY A;  1QQC A;  1TAU A;  3WNF A;  4DTX A;  3RMC A;  4E1N A;  2GV9 A;  4EZ9 A;  4DSJ A;  3DRR A;  3KLF A;  2XHB A;  4FLY A;  3VQC A;  1CLQ A;  1RCH A;  1KVB A;  1L3U A;  3KK1 A;  3HXM A;  3G10 A;  4KHW A;  3VN5 A;  2YNF A;  4H4O A;  4IKF A;  3DRS A;  3VQQ A;  2G8K A;  3O4Q A;  1RTH A;  3F73 A;  4J2B A;  4FLU A;  4BWJ A;  1Z26 A;  3VQA A;  2G8F A;  1N5Y A;  3AVL A;  4B9U A;  3VQD A;  3KIO A;  1S1W A;  4Q5V A;  5CYQ A;  4DU4 A;  1RT3 A;  2YHB A;  1IO2 A;  5HRN A;  3HO1 A;  4LH5 A;  1FXX A;  1ITG A;  1D5A A;  2Z1H A;  3V1O A;  1NKB A;  1VSH A;  1O1W A;  2YKN A;  4Z4G A;  2D0A A;  4JS4 A;  1HMV A;  4JRQ A;  4I9Q A;  5JS1 A;  4FJ9 A;  1TL3 A;  3THV A;  4DF4 A;  2WON A;  3QNO A;  1JLE A;  1TKZ A;  1VK0 A;  2VWJ A;  2YKM A;  1HNI A;  3LP1 A;  1Y97 A;  4BWM A;  3O3H A;  3I0R A;  3EYZ A;  5HRO A;  3RR8 A;  4KHN A;  3ISN C;  2OPS A;  4Z0U A;  2XY7 A;  3L2U A;  4J2E A;  2HHQ A;  1LW0 A;  4CJS A;  1RT1 A;  4CEO A;  1RT5 A;  1WSE A;  3QIP A;  1TL1 A;  4O44 A;  4ELU A;  2X74 A;  1LWE A;  4JS5 A;  3MXM A;  3FFI A;  4CF2 A;  3HJF A;  2G8V A;  2WOM A;  1LW2 A;  4AHC A;  1VSJ A;  4N5S A;  3TAE A;  1XHZ A;  4FCY A;  2PYL A;  2DY4 A;  3VQ9 A;  3D0P A;  2ZE2 A;  2ETJ A;  4OVL A;  1KFS A;  4W5O A;  1S6Q A;  1WAF A;  3VQ6 A;  5HLF A;  1HRH A;  4M41 A;  1B92 A;  1WSF A;  4DTP A;  4F4K A;  4CK3 A;  4I7F A;  3DMJ A;  3HL8 A;  3O4N A;  1FKO A;  3LP3 A;  3OVN A;  1JXE A;  1KSP A;  3KK2 A;  2Q3S A;  3A2F A;  4RW7 A;  4M3Z A;  3M8R A;  1BCO A;  1QHT A;  2G8I A;  1S9E A;  4AHT A;  1K6Y A;  4DTS A;  3LPT A;  3LWM A;  3HP9 A;  4KFB A;  1JL2 A;  1X9S A;  1NOY A;  1QSL A;  4B9N A;  3LWL A;  3RR7 A;  2OYQ A;  4E7J A;  1NK7 A;  3PX6 A;  1GOA A;  3NF8 A;  3NGY A;  1BIZ A;  2KQ2 A;  1EP4 A;  4DFM A;  3KD5 E;  2BAN A;  2D0B A;  3OYF A;  4Z4F A;  1G15 A;  1ZBH A;  4ZHR A;  1EKE A;  3AVJ A;  4FLW A;  4PWD A;  1J54 A;  4ID5 A;  2HNY A;  3DLE A;  2F8S A;  1YVU A;  3QEP A;  1BIS A;  4CJU A;  4PY5 A;  1ZYQ A;  3DLG A;  3AVH A;  4CJE A;  4CF0 A;  4IFY A;  4CGD A;  2D0C A;  3K5L A;  2QXF A;  1A5X A;  3DRP A;  4DQI A;  3O3F A;  1KFD A;  4J2D A;  3VA0 A;  1I39 A;  1SKW A;  4DWI A;  4CEQ A;  3HPG A;  4DFK A;  1KVC A;  1BGX T;  4F3O A;  1R0A A;  3ZT3 A;  1XC9 A;  1RBT A;  3CM6 A;  2QKK A;  4FK0 A;  4FLZ A;  3NH0 A;  1QSY A;  4DLG A;  1L5U A;  4W5N A;  1W9H A;  1J9A A;  4XIU A;  3AVG A;  5I3U A;  3KTQ A;  3RWU A;  3P83 D;  4Z4E A;  1VSK A;  3JSM A;  2KTQ A;  4FJN A;  1IH7 A;  4F3T A;  3NGI A;  2OPQ A;  3K58 A;  4BAC A;  3OS0 A;  2X6S A;  4E0D A;  2E6L A;  3PX4 A;  3OYB A;  2YHA A;  3OS2 A;  1WSJ A;  2P5O A;  1ASU A;  4BDP A;  3ZSX A;  3S3M A;  1IKY A;  1HQU A;  1KTQ A;  4FVM A;  4CCH A;  3CYM A;  3QO9 A;  1WLJ A;  5K14 A;  2D5R A;  3L8B A;  4W5R A;  3V9U A;  1D8Y A;  2B5J A;  1TKD A;  5FRN A;  1VSI A;  3MEG A;  1KLN A;  2DFH A;  2FBT A;  3SJJ A;  3ZSZ A;  3ZT1 A;  4CEC A;  4L8R B;  1IKW A;  3AVM A;  1JLG A;  4CHO A;  3KD1 E;  4CIF A;  4CED A;  1GOC A;  3K5N A;  3I0S A;  3AVB A;  3AA3 A;  4IBN A;  4FJH A;  4CF9 A;  3OYD A;  4FM2 A;  3TWH A;  4CK2 A;  1D9F A;  3DI6 A;  4B8C A;  4AHU A;  2BDP A;  3IS9 A;  4JLH A;  5DMR A;  2VG7 A;  3OYH A;  3QNN A;  2PY5 A;  3QES A;  1L3T A;  3IG1 A;  4Y1D A;  4LH4 A;  4DS5 A;  1SKR A;  4FM1 A;  4F8R A;  1W0H A;  2RN2 A;  2YNI A;  3ASM A;  3ZSO A;  3EZ5 A;  4LD0 A;  1LWC A;  3QET A;  4NCG A;  4M3T A;  3RMB A;  4FYD A;  1S6P A;  1TKX A;  3CFR A;  3RMA A;  1J5O A;  3L2R A;  3AO4 A;  4N76 A;  3OYL A;  3U3G A;  3SV3 A;  3TAN A;  2R7Y A;  3NF9 A;  1CZ9 A;  3AA2 A;  3L3U A;  3MEC A;  4Y1C A;  1NK6 A;  2PZS A;  4KHS A;  1ZBI A;  1C0M A;  1IKX A;  3HK2 A;  3PO4 A;  4IDK A;  4CHQ A;  4W5T A;  4C8K A;  1RBV A;  4LSN A;  3IAY A;  4KI4 A;  4H8K A;  2OZS A;  2Z1G A;  1B9D A;  4EZ6 A;  3C6T A;  4DSE A;  1I3A A;  3B6P A;  4Z4H A;  3TAR A;  1NJX A;  3NAE A;  1S1X A;  4FJK A;  4F2S A;  4DQS A;  1RBR A;  3S9H A;  3VQ7 A;  4CJL A;  1C0T A;  2IDO A;  2Z1I A;  4DQR A;  1TVR A;  3AA4 A;  4WE1 A;  1VSE A;  3ZSQ A;  1VSD A;  3AV9 A;  3DYA A;  4CFA A;  1RT4 A;  1RTI A;  2ZQB A;  2FC0 A;  3LP2 A;  1S9G A;  5I42 A;  3DLH A;  4PUO A;  3NF7 A;  4PA1 A;  1XHX A;  2XY6 A;  3KKS A;  2HHS A;  1UWB A;  5KGW A;  4CES A;  3VQB A;  1BIU A;  1SV5 A;  1X1P A;  1KRP A;  2KFZ A;  1NKE A;  2W42 A;  3IRX A;  4FK4 A;  2ZD1 A;  4CIE A;  3AA5 X;  4OPJ A;  1S1U A;  4DU3 A;  4FJL A;  3AVC A;  2VG6 A;  1U45 A;  1RT2 A;  3ZSW A;  4NCB A;  1UAX A;  3HPO A;  1BHL A;  5FRO A;  1BL3 A;  3V1R A;  4DLE A;  2A1S A;  4CJ3 A;  3SPZ A;  3TAP A;  4ZTJ A;  3TAG A;  3L3V A;  2YNH A;  1T05 A;  2IAJ A;  3DLR A;  3OJS A;  4M3X A;  4Z4C A;  4CJF A;  2FBX A;  2E4L A;  4KHQ A;  1RIL A;  3F9K A;  1EX4 A;  3LZI A;  1QE1 A;  2B4J A;  1T03 A;  1RTD A;  1C0U A;  4FJX A;  3K2P A;  1JLA A;  4R5P A;  2GBZ A;  1SL2 A;  3MAQ A;  3RRG A;  4F2R A;  3SPY A;  2HNZ A;  1VRT A;  4O0I A;  1A5V A;  3MED A;  2G8W A;  4EP4 A;  2XY8 A;  3KKR A;  3NGZ A;  4DQP A;  1ASV A;  1D9D A;  4DS4 A;  1S1V A;  1LWF A;  1NK5 A;  1MU2 A;  4CIG A;  3SZ2 A;  1NJZ A;  3BDP A;  5C42 A;  3PY8 A;  4M3W A;  4KHY A;  4OLB A;  2DFE A;  1WSG A;  4QCL A;  1F21 A;  1NOZ A;  2ITG A;  3OYN A;  4DQQ A;  1YTU A;  5J1E A;  4FK2 A;  3OYC A;  3HYF A;  1HYZ A;  3KJV A;  4Q0B A;  2EHG A;  3V1Q A;  3RRH A;  1JLC A;  3V4I A;  4B9T A;  4FZY A;  3VQ4 A;  4FJJ A;  3PUF A;  4O4G A;  3QEW A;  3OYI A;  3V6D A;  1C6V A;  3HST B;  3QLH A;  4CFB A;  3KLH A;  4KAZ A;  3V9Z A;  3NFA A;  2HHX A;  3HM9 A;  1IG9 A;  5SWM A;  4CJV A;  2EX3 A;  3SUN A;  4FLX A;  1UA0 A;  1HYV A;  3K57 A;  3SQ2 A;  3AO1 A;  4G1Q A;  3LZJ A;  5HRP A;  4KB0 A;  1L3V A;  1KLM A;  2OPR A;  1U49 A;  3LAN A;  1RDA A;  1ZBU A;  3AVI A;  4UQG A;  2X78 A;  1U04 A;  2ATQ A;  2YV0 X;  2GUI A;  2XO7 A;  4M3Y A;  3AO5 A;  4DG1 A;  3OYG A;  3V9X A;  1JLB A;  4O0J A;  4FZX C;  1RT7 A;  3RMD A;  2KZZ A;  4OLA A;  4CF8 A;  3UIQ A;  4K8Z A;  4PQU A;  3AO3 A;  3I8D A;  3KK3 A;  4DTJ A;  3SCX A;  4KB1 A;  4I2Q A;  2KW4 A;  4KV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...