1RDAA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTNGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdaA00
4H4MA 3QESA 3OYEA 2KZMA 1FXXA 3M8QA 1VSFA 4FJGA 3P1GA 2HHUA 4CJQA 2HNDA 4I2QA 1JLBA 1O1WA 3NF8A 4DTRA 3NF7A 1HJRA 3K5LA 1ASWA 4JRPA 4C8LA 2BE2A 4RW8A 4FJNA 1Z25A 2B6AA 3G0ZA 4ICLA 1RBUA 1S1WA 1ZBUA 3AVIA 3FFIA 3LP3A 1W0HA 4XIUA 4DU4A 3AVNA 3VQ6A 4PUOA 1QE1A 4K8ZA 2KZZA 2FC0A 3V4IA 3D0PA 3BDPA 4M3TA 2YNIA 5JS1A 5JS2A 1SV5A 3OS2A 3EYZA 3QINA 1CZ9A 2OZMA 4FLWA 4OKEA 4KB1A 4O4GA 3OYLA 4HUFA 1SL0A 4DQRA 4KI4A 3LZIA 3OYIA 1KCFA 3OYKA 3S9HA 4CEOA 3DLBA 3HVRA 1JLEA 3KLGA 2DFEA 3SCXA 4CESA 3V9SA 3L8BA 3SUPA 2D5RA 2GUIA 3AO2A 4DTJA 4CF0A 4DFKA 4KB0A 2VG7A 3PO4A 3U3GA 3THVA 1VSJA 2Z1GA 1U49A 3I0SA 4RW9A 4CHPA 3SUOA 4W5QA 1WAJA 1HYVA 4FLZA 1U04A 3SQ0A 4CEAA 1JL1A 1QQCA 4KAZA 1BCMA 2ZD1A 1RT5A 4E7LA 3SJJA 2Z1JA 3MECA 3IAYA 4I2PA 3CQ8A 4GVMA 4DFMA 3LAMA 3HT3A 4C8NA 1NKBA 4CJ3A 4ZHRA 1IKVA 2HVIA 4OPJA 1T03A 4QOZB 4CK1A 1I39A 1KVCA 1RDBA 3O3HA 3IS9A 3KKSA 3RMCA 3AVGA 1DTTA 1QHTA 2B4JA 3WNGA 4KHSA 1A5XA 4AHUA 1BI4B 3QIPA 4FJ9A 4WE1A 5KRTA 3VN5A 1XHZA 1HNVA 3MAQA 1RCHA 1NJXA 1LWFA 1J54A 5HRSA 4CJLA 3QNOA 4IDKA 1HQEA 4AHSA 2OPSA 3KK3A 5FRNA 2HHSA 1Y97A 3KTQA 4Z0UA 1NJZA 1RT6A 2D0CA 1CXQA 4DSKA 3AVMA 3S3NA 3O3FA 3OYCA 4FM1A 4B8CA 4CCHA 4ELTA 1L3UA 4MQ3A 3KK1A 4OVLA 3NH2A 2HNZA 1L5UA 1WSEA 3LP2A 4KTWA 1FK9A 3HPHA 3B6PA 4LH4A 1KLNA 4O5BA 2OZSA 5CZ2A 2XY5A 3VQ7A 3TABA 1IH7A 1TL1A 4BE2A 4CHNA 4J2EA 2KFZA 1C0MA 1DLOA 4FLTA 3ZSOA 1N6QA 3HL8A 1JLQA 4FZZA 4Y1DA 3K58A 3HPOA 5HRRA 4I9LA 4NCBA 4CGHA 4CJFA 1RBSA 3MEEA 3VA0A 1UOCA 1VSIA 3AVHA 2XY8A 3AVAA 4DSJA 4LH5A 3TWHA 4FLXA 1RTIA 2HHTA 3QEWA 1YVUA 4KV8A 4CECA 4ZTJA 1CLQA 4IBNA 2RN2A 4DSIA 3T1AA 3EZ5A 4QCLA 2RPIA 1JKHA 1D9DA 2E4LA 1R0AA 4M3ZA 1HNIA 3L3UA 1J5OA 1TGOA 3AVCA 4FLUA 1BQNA 5DMRA 1LV5A 4LSLA 3VQ5A 5SWMA 4M3UA 3KK2A 4DFJA 5FRMA 2YNHA 4N5SA 2BDPA 4L8RB 5HROA 3C94A 3CM5A 3T3FA 2G8UA 4R5PA 4E7KA 3S3OA 4CIFA 3V1RA 4CK2A 1X9MA 3ZT3A 2E6MA 3QLHA 3LANA 2F8TA 2ATQA 1WSIA 2KW4A 4AHVA 3TAMA 3M8SA 4BE0A 1QTMA 4DF4A 3V9ZA 3SQ1A 3ULDA 1BL3A 3TAEA 1NK8A 1NOYA 1RILA 2HB5A 4N76A 1IO2A 1BGXT 1GOBA 4DQQA 1X9WA 4DTNA 1L3SA 2XHBA 3ALYA 3ITHA 4KO0A 3ZT4A 4HUGA 4CEEA 4CJSA 3NF9A 3V9WA 4CFCA 4CF8A 2BGGA 3MXIA 1GOCA 3BGRA 3LAKA 3IRXA 3DMJA 1SKRA 3AA3A 2OPQA 4FJLA 1N5YA 4CJEA 4OPKA 1RBVA 1RDAA 1YTAA 3SPZA 2HHXA 4F3OA 3OYHA 5J2MA 2IOCA 1RBTA 4O44A 2HMIA 4CGFA 4Z4GA 1BCOA 3UIQA 5KI6A 4AHRA 4O0IA 4E7HA 2KQ2A 2Q3SA 1LAVA 3RWUA 4N41A 4HHTA 1VRTA 5SZTA 2G8VA 4O55A 2W42A 1TKDA 1RDCA 4HTUA 2DFFA 4KPYA 2LSNA 2F8SA 1C1BA 3EY1A 1BIUA 1LAWA 3ZSYA 4J2DA 4RG8A 4Z4EA 3KKRA 3AA2A 4W5RA 1X9SA 1BIZA 4CFBA 5J1EA 1VSEA 3CFOA 4CHYA 2YV0X 3SUQA 4CEFA 1C6VA 4W5OA 3RTVA 1T05A 5I3UA 2WOMA 4KHWA 3LPUA 2PYJA 4OLBA 1XWLA 1S1TA 2BANA 1SL2A 3TR8A 2G8FA 2D0AA 2OA8A 1U4BA 1KLMA 3AVJA 1SKSA 3ZSVA 3AO4A 1TK5A 4YFUA 3NF6A 4CJTA 1U45A 4DLGA 5CY4A 3NGZA 4CEQA 4CEDA 1RNHA 3O4NA 3TAGA 3PX0A 4B9MA 1JXEA 5I42A 3RR8A 4CGJA 1TAUA 1S1UA 1RT1A 1HRHA 3V1QA 3VQQA 3HM9A 3SQ2A 1NK4A 1TV6A 3NAEA 3HXMA 1HMVA 1BI4A 4KHUA 4DS4A 1Z26A 3K59A 3SQ4A 4DU3A 4F2RA 1TKTA 3VQ8A 3HJFA 3AVFA 3MEGA 4O0JA 3KLEA 3C6UA 1GOAA 2EX3A 3ZT2A 4RW7A 1UAXA 4KKOA 1T7PA 3K5NA 4E7IA 4PY5A 4DTSA 1VRUA 2YHAA 3SV4A 4E7JA 3OYGA 1NK7A 1Q8IA 4IFYA 4LSNA 4CJVA 3K57A 4FJ7A 4B3OA 4M45A 2QK9A 4DWIA 2IS3A 1ZYQA 4CFDA 4OGEA 1JLAA 4CJRA 3RMDA 1WSHA 3VQEA 2GBZA 1S6PA 4CF1A 3A2FA 3PUFA 2I5JA 4CFAA 4CHZA 3VQPA 3DOLA 1DTQA 3VQBA 4K8XA 4N56A 4OKJA 3V81A 1WLJA 1IKWA 1RBRA 3C6TA 1UA1A 4CJKA 3L2VA 3QEVA 2XY7A 2QKKA 4ID1A 3AO1A 1EX4A 2IDOA 3AA5X 5T7BA 4KHYA 4NCAA 1EXQA 4F4KA 1WN7A 4IFVA 4FK2A 1JXBA 5D3GA 1ITGA 1C1AA 4FYDA 1YT3A 3AVLA 3OYFA 1IKXA 5C42A 3ZT0A 3OS0A 4FZXC 4KREA 3AO3A 3RR7A 2X78A 1LW0A 2HVHA 5CZ1A 5C25A 3SPYA 4H4OA 1BHLA 3TAPA 2PZSA 3ZCMA 4E0DA 3MXMA 3NGYA 4RW6A 1SL1A 4Q0BA 4E1NA 3KLHA 1K6YA 1S5JA 3HYFA 2PYLA 5HP1A 1RT3A 1T8EA 4ELVA 4CF9A 3TAFA 1UA0A 3L3VA 1TAQA 3E01A 1KVBA 3F9KA 1RT4A 4IKFA 2HNYA 3OYBA 4FJ5A 4J2BA 4Z4HA 3I0RA 3B6OA 3NBPA 3QEXA 4Z4CA 3SNNA 4FJKA 4W5NA 1C1CA 1LWCA 3LZJA 3SUNA 1HYSA 1HQUA 1NKEA 2HW3A 4BDZA 3PX6A 2YHBA 1NK6A 4M42A 2B5JA 3LP1A 4GMJB 3HP9A 3F73A 3RRHA 1J53A 4OLAA 3ASMA 3OY9A 4PWDA 4M41A 3NCIA 2P1JA 4KRFA 4RW4A 1NK0A 4EP4A 3ZSXA 3VQCA 3LALA 3O4QA 4GW6A 3DLGA 3QEPA 3QO9A 4CEZA 2HHQA 1TKXA 3NHGA 1VSDA 3AV9A 1KSPA 2XRIA 4HCBA 2RKIA 4KHNA 3ZT1A 1TVRA 3VQAA 3SZ2A 1VSHA 2KFNA 1VSLA 3HSTB 5FROA 4DG1A 1A5WA 3OJUA 5J2QA 3QNNA 2QKBA 4EZ9A 4FM2A 3OYDA 2D0BA 3KIOA 4CIEA 2FBXA 4FM0A 4FJMA 3HO1A 2FBVA 2OPRA 2IAJA 2OPPA 3KD5E 1NK5A 3DLKA 1XC9A 2X6SA 4M3YA 2G8WA 1NK9A 1XHXA 1KFSA 2VWKA 1ZBIA 1RTJA 1UWBA 5J2NA 1Q9YA 4AILC 1W9HA 2NUBA 2WONA 3NDKA 4FW2A 4DU1A 3PX4A 1ASVA 3K5OA 1B9DA 2O4GA 4BACA 2ITGA 3G10A 3LDSA 4FCYA 5HLFA 2P51A 1CXUA 2VWJA 2Y1JA 2ZE2A 3QETA 3RMBA 3L2RA 1ZBLA 3OYJA 2QXFA 4HVJA 1QSYA 2G8KA 4FK0A 3D45A 4HUEA 3HVTA 4DQPA 1HYZA 3DRSA 2Y1IA 4FJXA 4BWMA 3NH1A 4FVMA 4IG0A 3KJVA 1HPZA 1WSFA 3I8DA 3ZSQA 1EKEA 3KD1E 4KI6A 3DLEA 3H08A 2Z1IA 4CJ5A 4FLVA 3SI6A 4DSLA 3K2PA 2DFHA 4KFBA 1LW2A 3S3MA 1D5AA 2Z1HA 1S1XA 3AVKA 3M8PA 4H8KA 3U6FA 4BWJA 3MXJA 4QAGA 3V9UA 1X1PA 4NCGA 4B08A 4EP5A 4DTUA 4FJIA 1TKZA 3RMAA 4JS5A 4CHOA 3CFPA 1VSMA 4FJ8A 3OYAA 1FKOA 2IC3A 4KTZA 4FZYA 3CM6A 3TARA 3DI6A 3DOKA 4IG3A 1C0TA 2IGIA 3RRGA 1ZBHA 3T19A 2DTUA 2ZQBA 1REVA 4CJWA 2PY5A 4BDYA 1RT2A 1L3TA 3QEIA 3HPGA 3PO5A 4AHTA 2O4IA 3OJSA 3CFRA 4DFPA 3VA3A 4B9VA 2A1SA 2F96A 1D9FA 1BISA 1WSJA 1TK0A 4M3XA 1S6QA 4DLEA 5E41A 4ID5A 4I7FA 1EP4A 4CE9A 4CHQA 1I3AA 2VG6A 3U3YA 3ZSWA 4ZTFA 5DK5A 1RT7A 4MFBA 2ETJA 1JLCA 4DTMA 3QERA 2XO7A 1L3VA 4M3WA 3NFAA 1U47A 3DRPA 3LPTA 3V9XA 4FK4A 4F3TA 1JLGA 5K14A 4DSFA 2RF2A 1EETA 3AO5A 4LD0A 3SYZA 1C0UA 5C24A 2YNGA 5KGWA 2GV9A 4DQSA 3OYMA 2FBTA 4C8OA 4DS5A 3TI0A 4FXDA 3DRRA 4Z4FA 1QS4A 4DQIA 3DYAA 4CJPA 1S9GA 4TSXA 4CGIA 2YNFA 2HHWA 4I9QA 4AH9A 4CK3A 5KGXA 1NJYA 3VQDA 4E89A 2XY6A 5HRNA 1U48A 1YTUA 5J2PA 3IG1A 2E6LA 4B9NA 4OKKA 4EZ6A 3CYMA 4F2SA 4AHCA 1TL3A 4B9SA 5HBMA 3TAQA 1QSLA 1A5VA 5CYMA 3HK2A 5EU7A 4CEBA 4E1MA 4Z4IA 1IKYA 4JLHA 4KHQA 4N47A 4E19A 2YKNA 5CYQA 3V1OA 4DF8A 1TK8A 4W5TA 3AA4A 3C95A 3O3GA 3NE6A 2G8HA 1S1VA 3ISNC 3PY8A 4LY7A 3KLIA 3LP0A 1JL2A 4G1QA 2X74A 4FLYA 3NH0A 4PA1A 1KVAA 4UQGA 1NJWA 3QIOA 4ELUA 2FBYA 3WNHA 3CG7A 3VQ9A 4CF2A 1Q9XA 1BQMA 3P5JA 4M3RA 3NGIA 4E3SA 1QSSA 4PQUA 1SKWA 1NKCA 2VG5A 1MU2A 4C8KA 4CJUA 4B9UA 4DTXA 2EHGA 3L2WA 2OYQA 4BDPA 3V6DA 2HHVA 4B9LA 4J2AA 1FKPA 1RDDA 5KRSA 4C8MA 1S9EA 3WNEA 1F21A 4NYNA 4OGCA 4JRQA 1JLFA 3WNFA 1IG9A 4F8RA 4DTPA 4OJRA 3M8RA 3TANA 3SV3A 4FJJA 4B9TA 4HCCA 3KLFA 1VSKA 4CGGA 3DLHA 1WSGA 3OVNA 4FJHA 4Q5VA 2G8IA 1VK0A 4FW1A 4NYFA 3MEDA 1LWEA 4JS4A 1KRPA 1ASUA 1WAFA 2YKMA 2R7YA 3DM2A 1J9AA 3ZSRA 5HRPA 2JLEA 1NOZA 5KTQA 3L2QA 3LWMA 4DTOA 2P5OA 3K5MA 2AJQA 4KTQA 3VQ4A 4DSEA 1B9FA 1WNSA 3ZSZA 1B92A 3LWLA 1RTHA 2X6NA 2KTQA 3PV8A 4CGDA 2P5GA 3JSMA 4Y1CA 1D8YA 2JGUA 4DMNA 1KTQA 5FDLA 3OS1A 3L2UA 3HP6A 2A1RA 4B8AB 1ZBFA 3OYNA 1SUQA 3DLRA 4CJ4A 1RTDA 2DY4A 1CZBA 1XI1A 1KFDA 1G15A 4CERA 3JYTA 3P83D 4BE1A 4CIGA 3AVBA 4YNQA
chains in the Genus database with same CATH superfamily
3QESA 2KZMA 2ZGYA 1KAZA 4DHYA 4FJGA 2HNDA 1JLBA 3NF8A 3NF7A 3W0LA 4C8LA 5AQJA 3FZKA 3SMSA 4RW8A 4BRHA 3AVIA 3FFIA 4CZEA 4CZLA 4C23A 3D0PA 4IOCL 2YNIA 5JS2A 3JXUA 3QDKA 1SV5A 3OS2A 3QINA 5KQ8A 1FJGK 5EVZA 1V4SA 3OYIA 3CCLN 3DLBA 1RDWX 3SCXA 3V9SA 1WBDA 4B1ZA 3TTCA 2VG7A 5E26A 4BR0A 1U49A 1HLUA 3I0SA 3FE1A 2QWRA 1HYVA 4FLZA 1U04A 4KAZA 3RVCA 4CEAA 3QB0A 3SJJA 1RT5A 1P8ZA 1ZBSA 5LMNK 4DFMA 4C8NA 2HBMA 3L4IA 1T03A 4QOZB 2E1ZA 1X3NA 3KKSA 1QHTA 4FJ9A 3MK6A 3EZWA 2ZJPL 4YOVA 1LWFA 1J54A 4CJLA 2HHSA 2VGNA 5FRNA 1RT6A 2D0CA 1CXQA 1XUPO 4CZFA 1L3UA 4MQ3A 3KK1A 4OVLA 3NH2A 3LP2A 2Q97A 4LH4A 5AQUA 3FGUA 2P9NB 3ID6A 3VQ7A 5ADXA 3TABA 4BRLA 4B3MK 4BE2A 4J2EA 2KFZA 3UKUB 1DLOA 5ADXH 1QZ5A 3HL8A 4FZZA 3K58A 2W41A 5A2QO 3ENHA 2UUAK 4WFNL 1YVUA 4KV8A 3ULEA 2RN2A 3T1AA 3EZ5A 4QCLA 4K25A 2RPIA 4AQYK 1D9DA 1R0AA 3L3UA 3VTIA 1J5OA 3H1QA 3Q7BA 3HOSA 2WBNA 1BQNA 1LV5A 4LSLA 3VQ5A 1U6ZA 1YF5L 4DFJA 3ZX3A 1NGCA 2FF6A 5HROA 3C94A 4R5PA 5C12A 4E7KA 3S3OA 4CIFA 4CK2A 1X9MA 2PFUA 2E6MA 2F8TA 2ATQA 4FPAA 1OKJA 3P39A 4K43A 5AZIA 3H6EA 1BL3A 4EAHD 3ULDA 3TAEA 2HB5A 3L6QA 4DQQA 1X9WA 4DTNA 2OTLN 4KO0A 3V9WA 1N33K 3NF9A 1GOCA 3BGRA 1TUYA 5B8HA 3IRXA 5AQWA 3ATVA 4CJEA 3SPZA 4DV2K 1VQPN 4Z4GA 1BCOA 4BVPA 4LF9K 3C6AA 2Q3SA 4N41A 2G8VA 5SZTA 1NJIO 4YHHK 4HTUA 2QWQA 1C1BA 1YHQN 3WXIA 4BC4A 4BC3A 3KKRA 3TPQA 4CBUA 1BIZA 3SUQA 3CFOA 1ZBIA 4BR4A 1C6VA 4W5OA 1T05A 5I3UA 4NXMK 4KHWA 5JICA 1SL2A 2D0AA 4PL7A 1SKSA 4QS7A 3ZSVA 4I6MB 2ZJQL 5CY4A 3NGZA 5FPEA 3O4NA 3EL2A 3PX0A 4B9MA 4DV4K 4BVOA 4CZIA 2P9UB 2VQFK 1NK4A 4KHUA 4A59A 1DEJA 3MEGA 3KLEA 3C6UA 1EWRA 5HL7L 1T7PA 3K5NA 3K9KA 4E7IA 4DTSA 1VRUA 2YHAA 1YJ9N 2E8AA 4B3OA 2QK9A 3ZLJA 3UKUA 4V19S 3CD6N 4ISGA 4CFAA 2D4WA 2P9KB 3SK3A 4A5BA 3VQPA 5AFUH 2E20A 3VQBA 4N56A 3FFKB 3V81A 5JVHL 3CCUN 1IKWA 1UA1A 4BRPA 4U7BA 3P4IA 2XY7A 1KC8O 1BUPA 3EKSA 5GINA 5T7BA 3O1BA 1EXQA 4FWQA 4BC2A 1ILYA 5D3GA 2IIRA 2O8FB 4JI6K 5C42A 4A57A 3RR7A 1LW0A 4RW6A 4WQ4A 1RGIA 3WXMB 1RT3A 4DB3A 5KQDA 3CCMN 1T8EA 1GLBG 1GLDG 1UA0A 3NMUA 3E01A 1XC3A 1NGFA 2HNYA 4BG9A 4FJ5A 3CCJN 5CR4A 5BPMA 3CCEN 1C1CA 1HYSA 1BU6O 1HQUA 2HW3A 2QEXN 4BDZA 3PX6A 3OBWA 4M42A 3F73A 5FPDA 3HP9A 4FWLA 3S41A 1NK0A 3VEXA 5BN8A 2UUCK 3C65A 3MMVA 2HHQA 2ASPA 3P31A 4DV0K 2RKIA 4H03B 3ZT1A 4ILHA 4KH6A 2KFNA 5FROA 1A5WA 4EZ9A 3OYDA 3KIOA 3HO1A 4YOTA 4H0VB 1QVGM 2X6SA 1NK9A 2VWKA 3MWPA 5AQZA 4DUYK 5J2NA 4AILC 2NUBA 4DU1A 3LDSA 4FCYA 4I6MA 2P51A 1QSYA 5AQNA 1GLCG 4JI5K 2QXFA 4FK0A 4HUEA 1NGAA 1HYZA 5JMVA 4IG0A 1HPZA 1XQSC 4JI7K 2P9UA 3MN9A 1OH5A 3LM2A 2P9LB 4KI6A 1OVQA 4FLVA 2Z1IA 2WTUA 4DSLA 3K2PA 2P9SB 2V51B 2Z1HA 3U6FA 4H8KA 3CMAN 1X1PA 5FLXO 4FJ8A 1EQYA 2IC3A 1YITN 4NXNK 1C0TA 5LY3A 3U4LA 3RRGA 4NO7A 3O8MA 1REVA 3PO5A 4AHTA 2P9KA 3VEYA 5MLCQ 1D9FA 1KD1O 3H46O 4HTLA 5E41A 4ID5A 1QVFM 3DWLA 3GBTA 2A40A 4ZTFA 3VMFB 4DR5K 5DK5A 2E88A 2D0OA 2HBJA 2O8FA 1JLCA 1DKGD 3NFAA 1EO1A 1JLGA 1EETA 3AAQA 3AO5A 4C8OA 5C24A 3CCQN 3THXB 2FBTA 3DRRA 3D2FB 4CJPA 1BO5O 2YNFA 3GL1A 4I9QA 2A41A 4JN4A 5HRNA 4B1UB 2OCEA 5BRFA 3MN6A 4DUZK 2QWOA 2UXBK 4EZ6A 3PIPL 4F2SA 3I33A 4M63C 4DV1K 2GWKA 1S1VA 4FWRA 4LY7A 1IBMK 2X74A 3VGMA 4X66K 2FBYA 3CG7A 1Q9XA 3P5JA 4FPBA 4E3SA 4EIAA 4DR2K 5GAEP 4B9UA 3L2WA 2OYQA 2HHVA 4BDPA 2NRRA 1VQNN 2PAVA 5KRSA 4C8MA 1F21A 4NYNA 4HWIA 3WNFA 4DV3K 1IG9A 4F8RA 4OJRA 4B9TA 4HCCA 1VK0A 1KRPA 2Q31A 2R7YA 1BDGA 3K9JA 3DM2A 3LWMA 2JLEA 5KTQA 4DTOA 4H5WA 4BRQA 3D6RA 2P9LA 3CC2N 3WEEB 4O8UA 1RTHA 1ESVA 1V4TA 3U8XA 3L2UA 1ZBFA 3OYNA 4AM6A 3J7AP 3DLRA 3CXCM 1KFDA 5JLHA 3JYTA 3AAPA 1G99A 1SQKA 1RILA 4H4MA 5C2DA 3OYEA 3M8QA 1VSFA 5LL6Z 1VQ6N 4EFHA 4I2QA 1O1WA 4FL9A 3C6HA 3K5LA 4A61A 2BE2A 4M7XA 4FJNA 3FZFA 2B6AA 3G0ZA 4ICLA 1RBUA 3LP3A 2YHYA 4JKGB 2FC0A 3R8EA 1CZ9A 4FLWA 2BUPA 4KB1A 4HUFA 3ZX0A 4XH1A 4DQRA 4KI4A 1MWKA 3LZIA 1VQ7N 4EHUA 3HVRA 3THXA 4IO8A 2GUIA 3AO2A 4KB0A 4DTJA 2ZWHA 1JCEA 3THVA 4GKJK 5AQLA 4JI3K 3E9LA 1NGJA 4H5RA 2ZD1A 2Z1JA 4JNEA 4I2PA 2Q1NA 3J8AA 4GVMA 4M7YA 1NKBA 3ENBA 4CJ3A 4ZHRA 1IKVA 2FXUA 4OPJA 1E4FT 1KVCA 1RDBA 3IS9A 3RMCA 1DTTA 3WNGA 3OHRA 4B3SK 3CERA 2O8DA 1A5XA 1YJNN 4WE1A 1XHZA 5DM6L 1HNVA 1Q81O 3QNOA 1HQEA 3KK3A 4Z0UA 1HJOA 4FM1A 4OPHA 3CIPA 4ELTA 2HNZA 1RDUA 1WSEA 5GIOA 2OZSA 1FK9A 3HPHA 4OLBA 4O5BA 1IH7A 1TL1A 4CHNA 2V7YA 3WQTA 3CI5A 3ZSOA 3CJAA 1JLQA 3VENA 3HPOA 3P38A 1UOCA 1Q18A 3AVHA 2XY8A 1YAGA 4LH5A 4BGAA 4ZTJA 1CLQA 4IBNA 3F5TA 3VGKA 1HNIA 1H1VA 3AVCA 3BUZB 4MLEA 1OH8A 3WEEA 4FLUA 5SWMA 2CH6A 5FRMA 2YNHA 3DXMB 4L3QA 4J8FA 3AGKA 3T3FA 2G8UA 3UB5A 2QWMA 2FSJA 3QLHA 3LANA 2P9PB 2KW4A 1QTMA 3OBYA 3SQ1A 1K8AO 1QQNA 1WOQA 1NOYA 2YHXA 4LFAK 3LL3A 5AZJB 5AJ3K 3GG4A 5BPNA 4BROA 2XHBA 3ZT4A 4CEEA 4CJSA 1NM1A 4JKGA 1NU0A 2I7PA 4CZJA 4OPKA 1RDAA 1YTAA 4F3OA 2WC9A 3OYHA 2QWNA 1RBTA 4BRMA 4BRGA 3BF1A 3UIQA 5KI6A 4AHRA 4JAXA 4E7HA 4BR9A 4O55A 1GLLO 1RDCA 3A5OC 3HM8A 5GADP 2JWLA 2LSNA 3E1YA 4Z4EA 1X9SA 4CHYA 4CEFA 4IXCA 1XWLA 2NZTA 1TK5A 3IDHA 3NF6A 1U45A 4CEQA 4CEDA 3M5RA 3CPWM 3TAGA 1HX1A 4CGJA 1HRHA 1HPMA 3HM9A 3AGRA 3SQ2A 3KHYA 1TV6A 3NAEA 1HMVA 3M1FA 3BEXA 1Z26A 3SQ4A 4F2RA 4DU3A 3HJFA 1TKTA 3VQ8A 4IJNA 4LC9B 2YJEA 5BN9A 3ZT2A 3EO3A 2CGLA 3OYGA 3PSFA 3UKRB 4CJVA 4IFYA 4JD2B 4FJ7A 4DWIA 2IS3A 1ZYQA 4CFDA 4OGEA 2WFBA 4NLBA 1HKGA 1S6PA 4YORA 4RWTA 4JKEA 3VEVA 3PUFA 4B1VA 5I9EB 2W6LA 1NG9A 5C2FA 2QWLA 4K8XA 4IFEA 3G25A 4R79A 1WLJA 3C6TA 2I7NA 3L2VA 4BR2A 1NMDA 4BREA 4KHYA 4F4KA 3H3NO 1JXBA 1ITGA 4XH5A 1YT3A 4MDBA 3I55N 2Q2RA 3AO3A 3DXMA 5CZ1A 4H4OA 3ZCMA 4GY2B 3MXMA 1SL1A 4DKWA 2UU9K 2P9PA 5AQSA 4ELVA 4CF9A 2HSTA 3L3VA 4KBOA 1QHAA 1W2BM 1TAQA 3F9KA 1Q82O 4IKFA 4H0TB 4JKBA 3I0RA 3NBPA 3QEXA 4FWSA 5AZJA 4FJKA 4W5NA 3LZJA 4PKHA 4WYBA 5CHIA 3SUNA 1NKEA 1NK6A 2B5JA 3LP1A 3IUCA 4OLAA 3NCIA 5EY4A 4BRNA 1QQOA 3VQCA 1XNQK 3QEPA 3QO9A 4ISFA 3NHGA 1Y64A 3O9RA 3TU5A 1TVRA 1N36K 3VQAA 3SZ2A 3K0SA 1WB9A 2QKBA 3OJUA 1WUAA 4FM2A 5AQRA 2FBXA 2OPRA 2KLAA 2OPPA 1NK5A 2O8EB 2BTFA 5C15A 1RTJA 1UWBA 1VQ9N 1W9HA 2EWSA 2RE2A 3NDKA 4IOXA 3PX4A 1U2VB 2O4GA 4BACA 2ITGA 3WXKA 3RMBA 3OYJA 3VEOA 3DRSA 4BWMA 3KJVA 4CJ5A 4KFBA 5AQKA 1LW2A 3AVKA 3M8PA 2E1YA 4BWJA 4IOAL 3RMAA 4CHOA 3CFPA 4LF6K 1HNZK 3UKRA 3OYAA 4FZYA 3RSEB 4JD2A 3ATUA 3TARA 3DI6A 3DOKA 4PKGA 4PHTX 4MO5A 3T19A 2DTUA 1GLAG 1L3TA 3DLLL 2IVOA 2IVPA 1NGEA 4CD1A 2E2PA 4DFPA 4B9VA 2A1SA 4DQ8A 2VYPA 1TK0A 4BGBA 1S6QA 1YVNA 4I7FA 1EP4A 4CHQA 2VG6A 3WUHA 3ZSWA 3MCAB 4X65K 1RT7A 4IJAA 2ETJA 3IKMA 3IMXA 3QERA 1YUWA 4DR6K 4FK4A 4F3TA 5K14A 4B1XB 4DSFA 2RF2A 4LD0A 2YNGA 5KGWA 4A5AA 4DQSA 3TI0A 4Z4FA 5AQXA 1QS4A 4DQIA 1S9GA 3M6GA 4CGIA 4DV5K 3PLAA 5KGXA 3FR0A 4NB4A 3VQDA 2XY6A 3O9QA 4BR5A 4AHCA 1QSLA 1A5VA 5CYMA 4B1WB 3HK2A 4CEBA 4Z4IA 4N47A 4E19A 3V1OA 2UYTA 3C95A 3O3GA 3NE6A 3ISNC 2NRWA 3NH0A 4PA1A 4ELUA 2QWPA 3VQ9A 4CF2A 1QSSA 4H0XB 1SKWA 5H1SQ 4GV9A 2VG5A 5LJVA 3V6DA 2O8EA 1VQ4N 3CC4N 1S9EA 1GLJO 3KVGA 4A2BA 3CPEA 3VOVA 1U2VA 2WUSA 1NGBA 1ZC6A 2QW9A 3KLFA 1NGIA 1VSKA 4CGGA 4FW1A 4NYFA 1LWEA 2A3ZA 1K8KB 1D4XA 2YKMA 1GLEG 3CJ1A 1NOZA 2P5OA 5AQVA 1NGDA 3WT0A 3K5MA 3VQ4A 4YY3K 1B9FA 3ZSZA 1YI2N 1B92A 3I8BA 4F9OA 2X6NA 3A8YA 3THYB 4JKAA 2JGUA 3WXLA 2AA4A 3QFPA 4B8AB 1SUQA 2KHOA 3RSEA 1RTDA 3CJ9A 4A2AA 1WBBA 3DLHA 5KPRA 4CVNE 1FXXA 2ASMA 4CJQA 4DTRA 4C1NK 4DR4K 1JJ2M 1Z25A 1S1WA 3HZ6A 1OH7A 1W0HA 4XIUA 4Y0WA 3VQ6A 3V4IA 5AQQA 5M1KA 3EYZA 4Z94A 1KAXA 2OANA 4OKEA 3B8AX 4O4GA 4LF5K 3OYKA 4CEOA 3T1HK 4YOUA 4LFCK 1JLEA 1E4GT 3O6WA 4FOIA 4YDUC 3L8BA 3SUPA 2D5RA 2KKZA 4CF0A 3PO4A 4LFBK 4JK8A 3R1XA 4FVUA 5GAGP 4RW9A 4CHPA 4W5QA 1WAJA 3L0QA 3SQ0A 1JL1A 1QQCA 4JKCA 3MX2A 1BCMA 2GEMA 3MECA 3CQ8A 5AQTA 3HT3A 5KPTA 2CGKA 2HVIA 1I39A 5E84A 2B4JA 4KHPK 4AHUA 1BI4B 4CW7B 5KRTA 4WQ5C 3BZKA 1RCHA 1IJJA 3HRGA 3F9MA 2OPSA 5HOOA 1Y97A 2GELA 3KTQA 1NJZA 1QZ6A 1S3XA 2A6AA 3S3NA 3O3FA 4UY8O 4CCHA 4MLHA 3PIOL 4JYAK 1L5UA 1KLNA 4KTWA 5IT9O 3B6PA 2O8DB 3HTVA 4QS9A 4ISEA 2UXDK 3AARA 3C7NB 4O5FA 1BA0A 4I9LA 4CGHA 2P9IB 3VA0A 1VSIA 3A5LC 3TWHA 4CZKA 4LF8K 2HHTA 1K8KA 3QEWA 1DGKN 3FLCO 4CECA 1MA9B 1W7AA 4DSIA 5JLFA 1JKHA 2W40A 4M3ZA 1ZXOA 2O8CB 3J81O 4JKHA 5DMRA 4GVEA 4M3UA 4LF4K 3D2EB 5AQPA 3THYA 3CM5A 4FSVA 3V1RA 3R6MA 3TSUA 4YOXA 3ZT3A 1WSIA 3M8SA 4AHVA 3TAMA 1N32K 3V9ZA 4IWVA 4JK7A 1M1KO 2E2OA 1NK8A 1BGXT 1GOBA 1W97L 3ALYA 3ITHA 4CFCA 4CJ7A 2NRZA 3MXIA 4IEIA 1SKRA 3SAGA 3AA3A 2OPQA 4BRCA 4X64K 2CH5A 5J2MA 2IOCA 4O44A 2HMIA 4IZ9A 2J4RA 3O9UA 1LAVA 4HHTA 3R9PA 4K0KK 1TKDA 4GV6A 3EY1A 1BIUA 3O80A 4J2DA 4RG8A 3AA2A 4W5RA 2ASOA 4CFBA 4CI6A 5J1EA 2YV0X 3RTVA 2WOMA 3BY5A 3LPUA 3KWIA 5CE3A 3VERA 1S1TA 2BANA 1EWQA 1U4BA 3AVJA 3AO4A 4DR7K 4IDHA 2NRTA 1RNHA 4FWKA 5AQIA 1JXEA 5I42A 3RR8A 1TAUA 1S1UA 3FZLA 4XH4A 3VQQA 3MWTA 3V1QA 1BI4A 3K59A 3SMPA 2QTDA 1VQ8N 1GOAA 4FWMA 3LM9A 5AQFA 4C1NI 1M90O 4GV3A 2A42A 4KKOA 5LMUK 1ATSA 5BR9A 3SV4A 4E7JA 2HOEA 3D7EO 4JK9A 1Q8IA 4MO4A 1BG3A 3K57A 4CJRA 3VQEA 5GIPA 4CF1A 3TTFA 3C7NA 2I5JA 4CHZA 4ILJA 2P9IA 3DOLA 3KZBA 1DTQA 1OVYA 5AQOA 4OKJA 1RBRA 3FZMA 3ZETA 5IWAK 3AO1A 1EX4A 2IDOA 5BPLA 1WN7A 4IFVA 1YJWN 3WQUA 2O8CA 3JS6A 3AVLA 3OYFA 1IKXA 4FZXC 3ZT0A 4KREA 4OPAA 3D2EA 2HVHA 5C25A 3TAPA 1MWMA 1X9JA 1BHLA 3SPYA 4E0DA 4JI0K 3NGYA 4Q0BA 4E1NA 3KLHA 1K6YA 2OTJN 1S5JA 2PYLA 5HP1A 4BC5A 2IVNA 2H3GX 1HNWK 4WF9L 3VF4A 1T3VA 3O5BA 4J2BA 1KXPA 3VGLA 4O8KA 1C0GA 1BOTO 3SAFA 3SNNA 1LWCA 4GMJB 1J53A 3ASMA 3OY9A 1N8RO 4PWDA 4B3TK 2P1JA 4KRFA 3LDLA 4EP4A 1OH6A 3DLGA 3LDPA 3ZX2A 1TKXA 3AV9A 2FF3B 1KSPA 1TUUA 4BRDA 1VSLA 5J2QA 2F9TA 1NMNA 4FM0A 4FJMA 2FBVA 1K9MO 2IAJA 3KD5E 3M3ZA 2G8WA 1KFSA 4CZMA 2WONA 1NJXA 1ASVA 1B9DA 5F0XA 3TSPA 4MDAA 3G10A 4E1JA 2VWJA 2Y1JA 2ZE2A 2ZF5O 3L2RA 4HVJA 1ATNA 3HVTA 4DV7K 3L4QA 3NH1A 1BA1A 1WSFA 3Q7CA 3I8DA 3ZSQA 1EKEA 4NLCA 3KD1E 3H08A 3MCPA 2FLOA 3S3MA 1D5AA 4G9ZA 3LDOA 4NCGA 4B08A 4DTUA 2QA4N 1TKZA 4RCHA 3QBXA 4OX9K 1VSMA 4IO9L 1FKOA 4IG3A 3O4WA 5BR8K 4JHDB 1ZBHA 4JKFA 2ZQBA 4CJWA 4X62K 1VQ5N 2PY5A 3HPGA 3CFRA 3VA3A 2F96A 3H1VX 2NRXA 1WSJA 4M3XA 4A62A 3J7YP 4BRFA 3CCRN 4CE9A 1I3AA 3N4PA 3U3YA 2YCHA 5AQMA 3LDQA 4M3WA 3CJBA 3DRPA 5TKWA 3LPTA 3V9XA 4JI1K 3SYZA 1C0UA 2GV9A 1Q86O 4YOYA 3DYAA 3A5NC 3G6EN 2ITMA 2HHWA 4CK3A 1NJYA 4E89A 4JI2K 3IG1A 2E6LA 4H5TA 4PKIA 3LDNA 3CYMA 3AY9A 2V52B 3TAQA 5EU7A 4E1MA 1IKYA 4JLHA 4KHQA 3O9SA 1R59O 1TK8A 1HUXA 3AA4A 2G8HA 1CZAN 3KLIA 3LP0A 4G1QA 1KVAA 4UQGA 1NJWA 3HI0A 5F2RA 1ATRA 3WNHA 1BQMA 4M3RA 1VQON 1NKCA 4C8KA 5M1PA 4DTXA 1NGGA 3SBTA 2EHGA 2YJFA 1FKPA 1RDDA 3G4SN 3WNEA 5AQHA 4FJJA 1TYQB 4DTPA 3M8RA 5GAHP 3J80O 3SV3A 5M1FA 2F4VK 1SAZA 1VHXA 4QS8A 1NGHA 4Q5VA 2G8IA 4JS4A 1Q7YO 3MEDA 3WXJA 1WAFA 4WFBL 2FSNA 4U67L 5M1OA 2AJQA 4KTQA 2YI1A 1KAYA 4BY9C 5AQYA 3PV8A 4CGDA 4Y1CA 1D8YA 3O1WA 3OS1A 3HP6A 2A1RA 1NNEA 5F1XA 3MX5A 2DY4A 1XI1A 4JHDA 4JEPA 4CERA 4CIGA 3AVBA 4YNQA 5FPNA 3P1GA 2VQEK 2HHUA 1HNXK 1YXQA 1HJRA 1ASWA 2VCPA 4JRPA 2W6KA 2HHXA 1VQKN 1ZBUA 2DPNA 2CGJA 4DU4A 3VESA 1T6DA 3AVNA 4PUOA 1QE1A 4K8ZA 2KZZA 3BDPA 4M3TA 5JS1A 2D1KA 2OZMA 2ZM6K 3UE5A 4CD3A 4JKDA 3OYLA 1IBKK 3CQYA 1SL0A 4KH5A 1KCFA 3S9HA 3T1YK 3KLGA 2DFEA 4CESA 2A5XA 4WCEL 5EOYA 4WQ4C 4DFKA 3U3GA 1VSJA 2Z1GA 3SUOA 5BRHA 1E3MA 3CHWA 4E7LA 3IAYA 2VGMA 3CQXA 2NRHA 3LAMA 4DV6K 2GTDA 4BRAA 4CK1A 4PL8A 2D0PA 3O3HA 3AVGA 1MDUB 4KHSA 2P9NA 3QIPA 5TKYA 3VN5A 2HMPA 3MAQA 5AFUA 5HRSA 4IDKA 4AHSA 2QM1A 3ZEUB 4B9QA 4DSKA 3AVMA 1X3MA 3OYCA 4B8CA 2BH1A 3THWB 3H3OB 3CF5L 5CZ2A 3U9ZA 2XY5A 3R3LA 3DJCA 3VTHA 2Q0RA 3TTDA 1C0MA 4FLTA 1DT9A 1TYQA 1N6QA 3FZHA 4FO0A 4Y1DA 4LF7K 2Q0UA 5HRRA 4NCBA 4CJFA 1RBSA 3MEEA 3KWGA 4DSJA 3AVAA 3W3DA 4FLXA 1RTIA 1HKBA 2NRVA 2E4LA 4ILGB 3VEWA 1TGOA 2NNWA 5EX5A 3KK2A 3HBTA 4N5SA 2BDPA 4L8RB 2HBLA 3QICA 4XEIA 4BQZA 1GLFO 3QBWA 4JI8K 3EE8A 5DM7L 4BE0A 4DF4A 2YX6A 4FOEA 1QQMA 4DR1K 1IO2A 1IG8A 3SLCA 1L3SA 2F9WA 3SJHA 4K42A 4HUGA 4CF8A 3MN5A 2BGGA 3LAKA 3U9DA 3DMJA 3JAMO 3CMEN 3T7ZA 4FJLA 1K73O 1N5YA 1RBVA 3J7ZO 5JVGL 4JI4K 4CGFA 4FWPA 2V7ZA 4O0IA 4JV5K 2KQ2A 3RWUA 4FWOA 1VRTA 2W42A 3VF2A 2DFFA 4KPYA 2F8SA 2NLXA 1LAWA 3ZSYA 1VSEA 2HF4A 2E2NA 2PYJA 2G8FA 3TR8A 2OA8A 1KLMA 4YFUA 3CETA 4CJTA 4DLGA 1KQSM 3EKUA 4EHTA 2YHWA 1RT1A 3PSIA 3HXMA 3VETA 4DR3K 4DS4A 4GKKK 4CZGA 3AVFA 4O0JA 3QMLA 4CBWA 2EX3A 3ZEUA 4RW7A 1UAXA 3T69A 1HR0K 2F7TA 4PY5A 3THWA 2AP1A 3BZCA 1NK7A 4LSNA 4M45A 1NBWA 3RMDA 1JLAA 4BRIA 1WSHA 5BREA 2GBZA 3A2FA 3QFUA 2RHKA 2ZJRL 3VEZA 2HHHK 4KH4A 1T44A 2QXLA 4CJKA 3QEVA 2QKKA 4ID1A 3OA9A 3AA5X 1FW6A 3N4QA 4NCAA 4FK2A 3TSQA 1C1AA 4FYDA 3SBGA 3OS0A 2X78A 2PZSA 4YDUA 2E5LK 4N76A 3NVKA 3HYFA 3BF3A 4IEEA 3ZETB 4AM7A 2UUBK 3TAFA 1S72N 1KVBA 4CBXA 1RT4A 4YOWA 1JCFA 4BQLA 3OYBA 4Z4HA 3GOIA 5AQGA 3B6OA 3HSCA 4Z4CA 4H0YB 2YHBA 3RRHA 3DXKB 4H5NA 4WQ5A 4M41A 1VQLN 2QI2A 4RW4A 1XMOK 2HBKA 3ZSXA 3LALA 3O4QA 4GW6A 4CEZA 3A5MC 1VSDA 3GDQA 5ELZA 2XRIA 4HCBA 4KHNA 3NVMA 1VSHA 3CJCA 3HSTB 4DG1A 3QNNA 1I94K 3CJ7A 3ZYYX 4FWNA 3ID8A 2D0BA 4CIEA 2VWBA 3OTOK 2GX9A 3GE1A 2FSKA 3DLKA 1XC9A 1IBLK 4M3YA 1XHXA 3O08A 3CCVN 1Q9YA 2P9SA 4FW2A 3K5OA 1LOTB 2UXCK 2HF3A 3HOTA 3VPZA 5HLFA 2O8BB 1CXUA 1ZBLA 3QETA 3MN7A 2G8KA 3D45A 4DQPA 2Y1IA 4FJXA 4H5VA 2E2QA 4FVMA 3SAHA 3KK7A 4WFAL 3DLEA 4RTFD 3SI6A 2DFHA 4GNIA 1P90A 5M1QA 1S1XA 1N34K 1VAZA 3MXJA 4QAGA 3V9UA 4EP5A 3E9PA 4FJIA 4JS5A 5C10A 3A0IX 3F2KA 4KTZA 3CM6A 1Z6RA 4BR7A 2IGIA 5M1NA 3IFRA 4H0OA 4BDYA 1RT2A 1BWFO 3EE9A 3H45C 5LJWA 3QEIA 2O4IA 3OJSA 1J6ZA 1BISA 4DLEA 3I56N 3E66A 1O13A 3D2FA 5AR0A 3E9OA 4MFBA 4DTMA 3O9TA 2XO7A 1L3VA 1U47A 4BRKA 3OYMA 4FXDA 4DS5A 3VF6A 4TSXA 1Z05A 4AH9A 1XNRK 4K41A 1U48A 1YTUA 5J2PA 4DCHA 4B9NA 4OKKA 1TL3A 4B9SA 5HBMA 4AF1A 4CZHA 3DXKA 2GWJA 2YKNA 5CYQA 3C0BA 4DF8A 5KPZA 4W5TA 1C0FA 3PY8A 2PBDA 1JCGA 1NWKA 1JL2A 1LCUA 4FLYA 3QIOA 1NLVA 3BP8A 1VQMN 2Q36A 3NGIA 5BRDA 4PQUA 1IV0A 1SS6A 1MU2A 4BG8A 4CJUA 4H0PA 1J5EK 1YIJN 1SZ2A 4B9LA 4J2AA 4OGCA 3CCSN 3EEQA 1JLFA 4JRQA 3TANA 3G71N 3CC7N 2O8BA 1WSGA 3OVNA 4FJHA 1ASUA 5C0YA 3ULEB 1HKCA 1J9AA 2GUPA 2JWKA 3ZSRA 5HRPA 3L2QA 3MDQA 1XMQK 1RFQA 4B3RK 4DSEA 1WNSA 1T6CA 3LWLA 3EN9A 2KTQA 4OO1J 2P5GA 1S22A 3JSMA 4DMNA 4B1YB 5FPMA 1KTQA 5FDLA 3OW2M 3ENOA 5EXWA 4CJ4A 1CZBA 3DAWA 2ZGZA 1G15A 3P83D 5AZIB 4BE1A
chains in the Genus database with same CATH topology
4H4MA 3QESA 3OYEA 2KZMA 1FXXA 3M8QA 1VSFA 4FJGA 3P1GA 2HHUA 4CJQA 2HNDA 4I2QA 1JLBA 1O1WA 3NF8A 4DTRA 3NF7A 1HJRA 3K5LA 1ASWA 4JRPA 4C8LA 2BE2A 4RW8A 4FJNA 1Z25A 2B6AA 3G0ZA 4ICLA 1RBUA 1S1WA 1ZBUA 3AVIA 3FFIA 3LP3A 1W0HA 4XIUA 4DU4A 3AVNA 3VQ6A 4PUOA 1QE1A 4K8ZA 2KZZA 2FC0A 3V4IA 3D0PA 3BDPA 4M3TA 2YNIA 5JS1A 5JS2A 1SV5A 3OS2A 3EYZA 3QINA 1CZ9A 2OZMA 4FLWA 4OKEA 4KB1A 4O4GA 3OYLA 4HUFA 1SL0A 4DQRA 4KI4A 3LZIA 3OYIA 1KCFA 3OYKA 3S9HA 4CEOA 3DLBA 3HVRA 1JLEA 3KLGA 2DFEA 3SCXA 4CESA 3V9SA 3L8BA 3SUPA 2D5RA 2GUIA 3AO2A 4DTJA 4CF0A 4DFKA 4KB0A 2VG7A 3PO4A 3U3GA 3THVA 1VSJA 2Z1GA 1U49A 3I0SA 4RW9A 4CHPA 3SUOA 4W5QA 1WAJA 1HYVA 4FLZA 1U04A 3SQ0A 4CEAA 1JL1A 1QQCA 4KAZA 1BCMA 2ZD1A 1RT5A 4E7LA 3SJJA 2Z1JA 3MECA 3IAYA 4I2PA 3CQ8A 4GVMA 4DFMA 3LAMA 3HT3A 4C8NA 1NKBA 4CJ3A 4ZHRA 1IKVA 2HVIA 4OPJA 1T03A 4QOZB 4CK1A 1I39A 1KVCA 1RDBA 3O3HA 3IS9A 3KKSA 3RMCA 3AVGA 1DTTA 1QHTA 2B4JA 3WNGA 4KHSA 1A5XA 4AHUA 1BI4B 3QIPA 4FJ9A 4WE1A 5KRTA 3VN5A 1XHZA 1HNVA 3MAQA 1RCHA 1NJXA 1LWFA 1J54A 5HRSA 4CJLA 3QNOA 4IDKA 1HQEA 4AHSA 2OPSA 3KK3A 5FRNA 2HHSA 1Y97A 3KTQA 4Z0UA 1NJZA 1RT6A 2D0CA 1CXQA 4DSKA 3AVMA 3S3NA 3O3FA 3OYCA 4FM1A 4B8CA 4CCHA 4ELTA 1L3UA 4MQ3A 3KK1A 4OVLA 3NH2A 2HNZA 1L5UA 1WSEA 3LP2A 4KTWA 1FK9A 3HPHA 3B6PA 4LH4A 1KLNA 4O5BA 2OZSA 5CZ2A 2XY5A 3VQ7A 3TABA 1IH7A 1TL1A 4BE2A 4CHNA 4J2EA 2KFZA 1C0MA 1DLOA 4FLTA 3ZSOA 1N6QA 3HL8A 1JLQA 4FZZA 4Y1DA 3K58A 3HPOA 5HRRA 4I9LA 4NCBA 4CGHA 4CJFA 1RBSA 3MEEA 3VA0A 1UOCA 1VSIA 3AVHA 2XY8A 3AVAA 4DSJA 4LH5A 3TWHA 4FLXA 1RTIA 2HHTA 3QEWA 1YVUA 4KV8A 4CECA 4ZTJA 1CLQA 4IBNA 2RN2A 4DSIA 3T1AA 3EZ5A 4QCLA 2RPIA 1JKHA 1D9DA 2E4LA 1R0AA 4M3ZA 1HNIA 3L3UA 1J5OA 1TGOA 3AVCA 4FLUA 1BQNA 5DMRA 1LV5A 4LSLA 3VQ5A 5SWMA 4M3UA 3KK2A 4DFJA 5FRMA 2YNHA 4N5SA 2BDPA 4L8RB 5HROA 3C94A 3CM5A 3T3FA 2G8UA 4R5PA 4E7KA 3S3OA 4CIFA 3V1RA 4CK2A 1X9MA 3ZT3A 2E6MA 3QLHA 3LANA 2F8TA 2ATQA 1WSIA 2KW4A 4AHVA 3TAMA 3M8SA 4BE0A 1QTMA 4DF4A 3V9ZA 3SQ1A 3ULDA 1BL3A 3TAEA 1NK8A 1NOYA 1RILA 2HB5A 4N76A 1IO2A 1BGXT 1GOBA 4DQQA 1X9WA 4DTNA 1L3SA 2XHBA 3ALYA 3ITHA 4KO0A 3ZT4A 4HUGA 4CEEA 4CJSA 3NF9A 3V9WA 4CFCA 4CF8A 2BGGA 3MXIA 1GOCA 3BGRA 3LAKA 3IRXA 3DMJA 1SKRA 3AA3A 2OPQA 4FJLA 1N5YA 4CJEA 4OPKA 1RBVA 1RDAA 1YTAA 3SPZA 2HHXA 4F3OA 3OYHA 5J2MA 2IOCA 1RBTA 4O44A 2HMIA 4CGFA 4Z4GA 1BCOA 3UIQA 5KI6A 4AHRA 4O0IA 4E7HA 2KQ2A 2Q3SA 1LAVA 3RWUA 4N41A 4HHTA 1VRTA 5SZTA 2G8VA 4O55A 2W42A 1TKDA 1RDCA 4HTUA 2DFFA 4KPYA 2LSNA 2F8SA 1C1BA 3EY1A 1BIUA 1LAWA 3ZSYA 4J2DA 4RG8A 4Z4EA 3KKRA 3AA2A 4W5RA 1X9SA 1BIZA 4CFBA 5J1EA 1VSEA 3CFOA 4CHYA 2YV0X 3SUQA 4CEFA 1C6VA 4W5OA 3RTVA 1T05A 5I3UA 2WOMA 4KHWA 3LPUA 2PYJA 4OLBA 1XWLA 1S1TA 2BANA 1SL2A 3TR8A 2G8FA 2D0AA 2OA8A 1U4BA 1KLMA 3AVJA 1SKSA 3ZSVA 3AO4A 1TK5A 4YFUA 3NF6A 4CJTA 1U45A 4DLGA 5CY4A 3NGZA 4CEQA 4CEDA 1RNHA 3O4NA 3TAGA 3PX0A 4B9MA 1JXEA 5I42A 3RR8A 4CGJA 1TAUA 1S1UA 1RT1A 1HRHA 3V1QA 3VQQA 3HM9A 3SQ2A 1NK4A 1TV6A 3NAEA 3HXMA 1HMVA 1BI4A 4KHUA 4DS4A 1Z26A 3K59A 3SQ4A 4DU3A 4F2RA 1TKTA 3VQ8A 3HJFA 3AVFA 3MEGA 4O0JA 3KLEA 3C6UA 1GOAA 2EX3A 3ZT2A 4RW7A 1UAXA 4KKOA 1T7PA 3K5NA 4E7IA 4PY5A 4DTSA 1VRUA 2YHAA 3SV4A 4E7JA 3OYGA 1NK7A 1Q8IA 4IFYA 4LSNA 4CJVA 3K57A 4FJ7A 4B3OA 4M45A 2QK9A 4DWIA 2IS3A 1ZYQA 4CFDA 4OGEA 1JLAA 4CJRA 3RMDA 1WSHA 3VQEA 2GBZA 1S6PA 4CF1A 3A2FA 3PUFA 2I5JA 4CFAA 4CHZA 3VQPA 3DOLA 1DTQA 3VQBA 4K8XA 4N56A 4OKJA 3V81A 1WLJA 1IKWA 1RBRA 3C6TA 1UA1A 4CJKA 3L2VA 3QEVA 2XY7A 2QKKA 4ID1A 3AO1A 1EX4A 2IDOA 3AA5X 5T7BA 4KHYA 4NCAA 1EXQA 4F4KA 1WN7A 4IFVA 4FK2A 1JXBA 5D3GA 1ITGA 1C1AA 4FYDA 1YT3A 3AVLA 3OYFA 1IKXA 5C42A 3ZT0A 3OS0A 4FZXC 4KREA 3AO3A 3RR7A 2X78A 1LW0A 2HVHA 5CZ1A 5C25A 3SPYA 4H4OA 1BHLA 3TAPA 2PZSA 3ZCMA 4E0DA 3MXMA 3NGYA 4RW6A 1SL1A 4Q0BA 4E1NA 3KLHA 1K6YA 1S5JA 3HYFA 2PYLA 5HP1A 1RT3A 1T8EA 4ELVA 4CF9A 3TAFA 1UA0A 3L3VA 1TAQA 3E01A 1KVBA 3F9KA 1RT4A 4IKFA 2HNYA 3OYBA 4FJ5A 4J2BA 4Z4HA 3I0RA 3B6OA 3NBPA 3QEXA 4Z4CA 3SNNA 4FJKA 4W5NA 1C1CA 1LWCA 3LZJA 3SUNA 1HYSA 1HQUA 1NKEA 2HW3A 4BDZA 3PX6A 2YHBA 1NK6A 4M42A 2B5JA 3LP1A 4GMJB 3HP9A 3F73A 3RRHA 1J53A 4OLAA 3ASMA 3OY9A 4PWDA 4M41A 3NCIA 2P1JA 4KRFA 4RW4A 1NK0A 4EP4A 3ZSXA 3VQCA 3LALA 3O4QA 4GW6A 3DLGA 3QEPA 3QO9A 4CEZA 2HHQA 1TKXA 3NHGA 1VSDA 3AV9A 1KSPA 2XRIA 4HCBA 2RKIA 4KHNA 3ZT1A 1TVRA 3VQAA 3SZ2A 1VSHA 2KFNA 1VSLA 3HSTB 5FROA 4DG1A 1A5WA 3OJUA 5J2QA 3QNNA 2QKBA 4EZ9A 4FM2A 3OYDA 2D0BA 3KIOA 4CIEA 2FBXA 4FM0A 4FJMA 3HO1A 2FBVA 2OPRA 2IAJA 2OPPA 3KD5E 1NK5A 3DLKA 1XC9A 2X6SA 4M3YA 2G8WA 1NK9A 1XHXA 1KFSA 2VWKA 1ZBIA 1RTJA 1UWBA 5J2NA 1Q9YA 4AILC 1W9HA 2NUBA 2WONA 3NDKA 4FW2A 4DU1A 3PX4A 1ASVA 3K5OA 1B9DA 2O4GA 4BACA 2ITGA 3G10A 3LDSA 4FCYA 5HLFA 2P51A 1CXUA 2VWJA 2Y1JA 2ZE2A 3QETA 3RMBA 3L2RA 1ZBLA 3OYJA 2QXFA 4HVJA 1QSYA 2G8KA 4FK0A 3D45A 4HUEA 3HVTA 4DQPA 1HYZA 3DRSA 2Y1IA 4FJXA 4BWMA 3NH1A 4FVMA 4IG0A 3KJVA 1HPZA 1WSFA 3I8DA 3ZSQA 1EKEA 3KD1E 4KI6A 3DLEA 3H08A 2Z1IA 4CJ5A 4FLVA 3SI6A 4DSLA 3K2PA 2DFHA 4KFBA 1LW2A 3S3MA 1D5AA 2Z1HA 1S1XA 3AVKA 3M8PA 4H8KA 3U6FA 4BWJA 3MXJA 4QAGA 3V9UA 1X1PA 4NCGA 4B08A 4EP5A 4DTUA 4FJIA 1TKZA 3RMAA 4JS5A 4CHOA 3CFPA 1VSMA 4FJ8A 3OYAA 1FKOA 2IC3A 4KTZA 4FZYA 3CM6A 3TARA 3DI6A 3DOKA 4IG3A 1C0TA 2IGIA 3RRGA 1ZBHA 3T19A 2DTUA 2ZQBA 1REVA 4CJWA 2PY5A 4BDYA 1RT2A 1L3TA 3QEIA 3HPGA 3PO5A 4AHTA 2O4IA 3OJSA 3CFRA 4DFPA 3VA3A 4B9VA 2A1SA 2F96A 1D9FA 1BISA 1WSJA 1TK0A 4M3XA 1S6QA 4DLEA 5E41A 4ID5A 4I7FA 1EP4A 4CE9A 4CHQA 1I3AA 2VG6A 3U3YA 3ZSWA 4ZTFA 5DK5A 1RT7A 4MFBA 2ETJA 1JLCA 4DTMA 3QERA 2XO7A 1L3VA 4M3WA 3NFAA 1U47A 3DRPA 3LPTA 3V9XA 4FK4A 4F3TA 1JLGA 5K14A 4DSFA 2RF2A 1EETA 3AO5A 4LD0A 3SYZA 1C0UA 5C24A 2YNGA 5KGWA 2GV9A 4DQSA 3OYMA 2FBTA 4C8OA 4DS5A 3TI0A 4FXDA 3DRRA 4Z4FA 1QS4A 4DQIA 3DYAA 4CJPA 1S9GA 4TSXA 4CGIA 2YNFA 2HHWA 4I9QA 4AH9A 4CK3A 5KGXA 1NJYA 3VQDA 4E89A 2XY6A 5HRNA 1U48A 1YTUA 5J2PA 3IG1A 2E6LA 4B9NA 4OKKA 4EZ6A 3CYMA 4F2SA 4AHCA 1TL3A 4B9SA 5HBMA 3TAQA 1QSLA 1A5VA 5CYMA 3HK2A 5EU7A 4CEBA 4E1MA 4Z4IA 1IKYA 4JLHA 4KHQA 4N47A 4E19A 2YKNA 5CYQA 3V1OA 4DF8A 1TK8A 4W5TA 3AA4A 3C95A 3O3GA 3NE6A 2G8HA 1S1VA 3ISNC 3PY8A 4LY7A 3KLIA 3LP0A 1JL2A 4G1QA 2X74A 4FLYA 3NH0A 4PA1A 1KVAA 4UQGA 1NJWA 3QIOA 4ELUA 2FBYA 3WNHA 3CG7A 3VQ9A 4CF2A 1Q9XA 1BQMA 3P5JA 4M3RA 3NGIA 4E3SA 1QSSA 4PQUA 1SKWA 1NKCA 2VG5A 1MU2A 4C8KA 4CJUA 4B9UA 4DTXA 2EHGA 3L2WA 2OYQA 4BDPA 3V6DA 2HHVA 4B9LA 4J2AA 1FKPA 1RDDA 5KRSA 4C8MA 1S9EA 3WNEA 1F21A 4NYNA 4OGCA 4JRQA 1JLFA 3WNFA 1IG9A 4F8RA 4DTPA 4OJRA 3M8RA 3TANA 3SV3A 4FJJA 4B9TA 4HCCA 3KLFA 1VSKA 4CGGA 3DLHA 1WSGA 3OVNA 4FJHA 4Q5VA 2G8IA 1VK0A 4FW1A 4NYFA 3MEDA 1LWEA 4JS4A 1KRPA 1ASUA 1WAFA 2YKMA 2R7YA 3DM2A 1J9AA 3ZSRA 5HRPA 2JLEA 1NOZA 5KTQA 3L2QA 3LWMA 4DTOA 2P5OA 3K5MA 2AJQA 4KTQA 3VQ4A 4DSEA 1B9FA 1WNSA 3ZSZA 1B92A 3LWLA 1RTHA 2X6NA 2KTQA 3PV8A 4CGDA 2P5GA 3JSMA 4Y1CA 1D8YA 2JGUA 4DMNA 1KTQA 5FDLA 3OS1A 3L2UA 3HP6A 2A1RA 4B8AB 1ZBFA 3OYNA 1SUQA 3DLRA 4CJ4A 1RTDA 2DY4A 1CZBA 1XI1A 1KFDA 1G15A 4CERA 3JYTA 3P83D 4BE1A 4CIGA 3AVBA 4YNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4M A;  3QES A;  3OYE A;  2KZM A;  1FXX A;  3M8Q A;  1VSF A;  4FJG A;  3P1G A;  2HHU A;  4CJQ A;  2HND A;  4I2Q A;  1JLB A;  1O1W A;  3NF8 A;  4DTR A;  3NF7 A;  1HJR A;  3K5L A;  1ASW A;  4JRP A;  4C8L A;  2BE2 A;  4RW8 A;  4FJN A;  1Z25 A;  2B6A A;  3G0Z A;  4ICL A;  1RBU A;  1S1W A;  1ZBU A;  3AVI A;  3FFI A;  3LP3 A;  1W0H A;  4XIU A;  4DU4 A;  3AVN A;  3VQ6 A;  4PUO A;  1QE1 A;  4K8Z A;  2KZZ A;  2FC0 A;  3V4I A;  3D0P A;  3BDP A;  4M3T A;  2YNI A;  5JS1 A;  5JS2 A;  1SV5 A;  3OS2 A;  3EYZ A;  3QIN A;  1CZ9 A;  2OZM A;  4FLW A;  4OKE A;  4KB1 A;  4O4G A;  3OYL A;  4HUF A;  1SL0 A;  4DQR A;  4KI4 A;  3LZI A;  3OYI A;  1KCF A;  3OYK A;  3S9H A;  4CEO A;  3DLB A;  3HVR A;  1JLE A;  3KLG A;  2DFE A;  3SCX A;  4CES A;  3V9S A;  3L8B A;  3SUP A;  2D5R A;  2GUI A;  3AO2 A;  4DTJ A;  4CF0 A;  4DFK A;  4KB0 A;  2VG7 A;  3PO4 A;  3U3G A;  3THV A;  1VSJ A;  2Z1G A;  1U49 A;  3I0S A;  4RW9 A;  4CHP A;  3SUO A;  4W5Q A;  1WAJ A;  1HYV A;  4FLZ A;  1U04 A;  3SQ0 A;  4CEA A;  1JL1 A;  1QQC A;  4KAZ A;  1BCM A;  2ZD1 A;  1RT5 A;  4E7L A;  3SJJ A;  2Z1J A;  3MEC A;  3IAY A;  4I2P A;  3CQ8 A;  4GVM A;  4DFM A;  3LAM A;  3HT3 A;  4C8N A;  1NKB A;  4CJ3 A;  4ZHR A;  1IKV A;  2HVI A;  4OPJ A;  1T03 A;  4QOZ B;  4CK1 A;  1I39 A;  1KVC A;  1RDB A;  3O3H A;  3IS9 A;  3KKS A;  3RMC A;  3AVG A;  1DTT A;  1QHT A;  2B4J A;  3WNG A;  4KHS A;  1A5X A;  4AHU A;  1BI4 B;  3QIP A;  4FJ9 A;  4WE1 A;  5KRT A;  3VN5 A;  1XHZ A;  1HNV A;  3MAQ A;  1RCH A;  1NJX A;  1LWF A;  1J54 A;  5HRS A;  4CJL A;  3QNO A;  4IDK A;  1HQE A;  4AHS A;  2OPS A;  3KK3 A;  5FRN A;  2HHS A;  1Y97 A;  3KTQ A;  4Z0U A;  1NJZ A;  1RT6 A;  2D0C A;  1CXQ A;  4DSK A;  3AVM A;  3S3N A;  3O3F A;  3OYC A;  4FM1 A;  4B8C A;  4CCH A;  4ELT A;  1L3U A;  4MQ3 A;  3KK1 A;  4OVL A;  3NH2 A;  2HNZ A;  1L5U A;  1WSE A;  3LP2 A;  4KTW A;  1FK9 A;  3HPH A;  3B6P A;  4LH4 A;  1KLN A;  4O5B A;  2OZS A;  5CZ2 A;  2XY5 A;  3VQ7 A;  3TAB A;  1IH7 A;  1TL1 A;  4BE2 A;  4CHN A;  4J2E A;  2KFZ A;  1C0M A;  1DLO A;  4FLT A;  3ZSO A;  1N6Q A;  3HL8 A;  1JLQ A;  4FZZ A;  4Y1D A;  3K58 A;  3HPO A;  5HRR A;  4I9L A;  4NCB A;  4CGH A;  4CJF A;  1RBS A;  3MEE A;  3VA0 A;  1UOC A;  1VSI A;  3AVH A;  2XY8 A;  3AVA A;  4DSJ A;  4LH5 A;  3TWH A;  4FLX A;  1RTI A;  2HHT A;  3QEW A;  1YVU A;  4KV8 A;  4CEC A;  4ZTJ A;  1CLQ A;  4IBN A;  2RN2 A;  4DSI A;  3T1A A;  3EZ5 A;  4QCL A;  2RPI A;  1JKH A;  1D9D A;  2E4L A;  1R0A A;  4M3Z A;  1HNI A;  3L3U A;  1J5O A;  1TGO A;  3AVC A;  4FLU A;  1BQN A;  5DMR A;  1LV5 A;  4LSL A;  3VQ5 A;  5SWM A;  4M3U A;  3KK2 A;  4DFJ A;  5FRM A;  2YNH A;  4N5S A;  2BDP A;  4L8R B;  5HRO A;  3C94 A;  3CM5 A;  3T3F A;  2G8U A;  4R5P A;  4E7K A;  3S3O A;  4CIF A;  3V1R A;  4CK2 A;  1X9M A;  3ZT3 A;  2E6M A;  3QLH A;  3LAN A;  2F8T A;  2ATQ A;  1WSI A;  2KW4 A;  4AHV A;  3TAM A;  3M8S A;  4BE0 A;  1QTM A;  4DF4 A;  3V9Z A;  3SQ1 A;  3ULD A;  1BL3 A;  3TAE A;  1NK8 A;  1NOY A;  1RIL A;  2HB5 A;  4N76 A;  1IO2 A;  1BGX T;  1GOB A;  4DQQ A;  1X9W A;  4DTN A;  1L3S A;  2XHB A;  3ALY A;  3ITH A;  4KO0 A;  3ZT4 A;  4HUG A;  4CEE A;  4CJS A;  3NF9 A;  3V9W A;  4CFC A;  4CF8 A;  2BGG A;  3MXI A;  1GOC A;  3BGR A;  3LAK A;  3IRX A;  3DMJ A;  1SKR A;  3AA3 A;  2OPQ A;  4FJL A;  1N5Y A;  4CJE A;  4OPK A;  1RBV A;  1RDA A;  1YTA A;  3SPZ A;  2HHX A;  4F3O A;  3OYH A;  5J2M A;  2IOC A;  1RBT A;  4O44 A;  2HMI A;  4CGF A;  4Z4G A;  1BCO A;  3UIQ A;  5KI6 A;  4AHR A;  4O0I A;  4E7H A;  2KQ2 A;  2Q3S A;  1LAV A;  3RWU A;  4N41 A;  4HHT A;  1VRT A;  5SZT A;  2G8V A;  4O55 A;  2W42 A;  1TKD A;  1RDC A;  4HTU A;  2DFF A;  4KPY A;  2LSN A;  2F8S A;  1C1B A;  3EY1 A;  1BIU A;  1LAW A;  3ZSY A;  4J2D A;  4RG8 A;  4Z4E A;  3KKR A;  3AA2 A;  4W5R A;  1X9S A;  1BIZ A;  4CFB A;  5J1E A;  1VSE A;  3CFO A;  4CHY A;  2YV0 X;  3SUQ A;  4CEF A;  1C6V A;  4W5O A;  3RTV A;  1T05 A;  5I3U A;  2WOM A;  4KHW A;  3LPU A;  2PYJ A;  4OLB A;  1XWL A;  1S1T A;  2BAN A;  1SL2 A;  3TR8 A;  2G8F A;  2D0A A;  2OA8 A;  1U4B A;  1KLM A;  3AVJ A;  1SKS A;  3ZSV A;  3AO4 A;  1TK5 A;  4YFU A;  3NF6 A;  4CJT A;  1U45 A;  4DLG A;  5CY4 A;  3NGZ A;  4CEQ A;  4CED A;  1RNH A;  3O4N A;  3TAG A;  3PX0 A;  4B9M A;  1JXE A;  5I42 A;  3RR8 A;  4CGJ A;  1TAU A;  1S1U A;  1RT1 A;  1HRH A;  3V1Q A;  3VQQ A;  3HM9 A;  3SQ2 A;  1NK4 A;  1TV6 A;  3NAE A;  3HXM A;  1HMV A;  1BI4 A;  4KHU A;  4DS4 A;  1Z26 A;  3K59 A;  3SQ4 A;  4DU3 A;  4F2R A;  1TKT A;  3VQ8 A;  3HJF A;  3AVF A;  3MEG A;  4O0J A;  3KLE A;  3C6U A;  1GOA A;  2EX3 A;  3ZT2 A;  4RW7 A;  1UAX A;  4KKO A;  1T7P A;  3K5N A;  4E7I A;  4PY5 A;  4DTS A;  1VRU A;  2YHA A;  3SV4 A;  4E7J A;  3OYG A;  1NK7 A;  1Q8I A;  4IFY A;  4LSN A;  4CJV A;  3K57 A;  4FJ7 A;  4B3O A;  4M45 A;  2QK9 A;  4DWI A;  2IS3 A;  1ZYQ A;  4CFD A;  4OGE A;  1JLA A;  4CJR A;  3RMD A;  1WSH A;  3VQE A;  2GBZ A;  1S6P A;  4CF1 A;  3A2F A;  3PUF A;  2I5J A;  4CFA A;  4CHZ A;  3VQP A;  3DOL A;  1DTQ A;  3VQB A;  4K8X A;  4N56 A;  4OKJ A;  3V81 A;  1WLJ A;  1IKW A;  1RBR A;  3C6T A;  1UA1 A;  4CJK A;  3L2V A;  3QEV A;  2XY7 A;  2QKK A;  4ID1 A;  3AO1 A;  1EX4 A;  2IDO A;  3AA5 X;  5T7B A;  4KHY A;  4NCA A;  1EXQ A;  4F4K A;  1WN7 A;  4IFV A;  4FK2 A;  1JXB A;  5D3G A;  1ITG A;  1C1A A;  4FYD A;  1YT3 A;  3AVL A;  3OYF A;  1IKX A;  5C42 A;  3ZT0 A;  3OS0 A;  4FZX C;  4KRE A;  3AO3 A;  3RR7 A;  2X78 A;  1LW0 A;  2HVH A;  5CZ1 A;  5C25 A;  3SPY A;  4H4O A;  1BHL A;  3TAP A;  2PZS A;  3ZCM A;  4E0D A;  3MXM A;  3NGY A;  4RW6 A;  1SL1 A;  4Q0B A;  4E1N A;  3KLH A;  1K6Y A;  1S5J A;  3HYF A;  2PYL A;  5HP1 A;  1RT3 A;  1T8E A;  4ELV A;  4CF9 A;  3TAF A;  1UA0 A;  3L3V A;  1TAQ A;  3E01 A;  1KVB A;  3F9K A;  1RT4 A;  4IKF A;  2HNY A;  3OYB A;  4FJ5 A;  4J2B A;  4Z4H A;  3I0R A;  3B6O A;  3NBP A;  3QEX A;  4Z4C A;  3SNN A;  4FJK A;  4W5N A;  1C1C A;  1LWC A;  3LZJ A;  3SUN A;  1HYS A;  1HQU A;  1NKE A;  2HW3 A;  4BDZ A;  3PX6 A;  2YHB A;  1NK6 A;  4M42 A;  2B5J A;  3LP1 A;  4GMJ B;  3HP9 A;  3F73 A;  3RRH A;  1J53 A;  4OLA A;  3ASM A;  3OY9 A;  4PWD A;  4M41 A;  3NCI A;  2P1J A;  4KRF A;  4RW4 A;  1NK0 A;  4EP4 A;  3ZSX A;  3VQC A;  3LAL A;  3O4Q A;  4GW6 A;  3DLG A;  3QEP A;  3QO9 A;  4CEZ A;  2HHQ A;  1TKX A;  3NHG A;  1VSD A;  3AV9 A;  1KSP A;  2XRI A;  4HCB A;  2RKI A;  4KHN A;  3ZT1 A;  1TVR A;  3VQA A;  3SZ2 A;  1VSH A;  2KFN A;  1VSL A;  3HST B;  5FRO A;  4DG1 A;  1A5W A;  3OJU A;  5J2Q A;  3QNN A;  2QKB A;  4EZ9 A;  4FM2 A;  3OYD A;  2D0B A;  3KIO A;  4CIE A;  2FBX A;  4FM0 A;  4FJM A;  3HO1 A;  2FBV A;  2OPR A;  2IAJ A;  2OPP A;  3KD5 E;  1NK5 A;  3DLK A;  1XC9 A;  2X6S A;  4M3Y A;  2G8W A;  1NK9 A;  1XHX A;  1KFS A;  2VWK A;  1ZBI A;  1RTJ A;  1UWB A;  5J2N A;  1Q9Y A;  4AIL C;  1W9H A;  2NUB A;  2WON A;  3NDK A;  4FW2 A;  4DU1 A;  3PX4 A;  1ASV A;  3K5O A;  1B9D A;  2O4G A;  4BAC A;  2ITG A;  3G10 A;  3LDS A;  4FCY A;  5HLF A;  2P51 A;  1CXU A;  2VWJ A;  2Y1J A;  2ZE2 A;  3QET A;  3RMB A;  3L2R A;  1ZBL A;  3OYJ A;  2QXF A;  4HVJ A;  1QSY A;  2G8K A;  4FK0 A;  3D45 A;  4HUE A;  3HVT A;  4DQP A;  1HYZ A;  3DRS A;  2Y1I A;  4FJX A;  4BWM A;  3NH1 A;  4FVM A;  4IG0 A;  3KJV A;  1HPZ A;  1WSF A;  3I8D A;  3ZSQ A;  1EKE A;  3KD1 E;  4KI6 A;  3DLE A;  3H08 A;  2Z1I A;  4CJ5 A;  4FLV A;  3SI6 A;  4DSL A;  3K2P A;  2DFH A;  4KFB A;  1LW2 A;  3S3M A;  1D5A A;  2Z1H A;  1S1X A;  3AVK A;  3M8P A;  4H8K A;  3U6F A;  4BWJ A;  3MXJ A;  4QAG A;  3V9U A;  1X1P A;  4NCG A;  4B08 A;  4EP5 A;  4DTU A;  4FJI A;  1TKZ A;  3RMA A;  4JS5 A;  4CHO A;  3CFP A;  1VSM A;  4FJ8 A;  3OYA A;  1FKO A;  2IC3 A;  4KTZ A;  4FZY A;  3CM6 A;  3TAR A;  3DI6 A;  3DOK A;  4IG3 A;  1C0T A;  2IGI A;  3RRG A;  1ZBH A;  3T19 A;  2DTU A;  2ZQB A;  1REV A;  4CJW A;  2PY5 A;  4BDY A;  1RT2 A;  1L3T A;  3QEI A;  3HPG A;  3PO5 A;  4AHT A;  2O4I A;  3OJS A;  3CFR A;  4DFP A;  3VA3 A;  4B9V A;  2A1S A;  2F96 A;  1D9F A;  1BIS A;  1WSJ A;  1TK0 A;  4M3X A;  1S6Q A;  4DLE A;  5E41 A;  4ID5 A;  4I7F A;  1EP4 A;  4CE9 A;  4CHQ A;  1I3A A;  2VG6 A;  3U3Y A;  3ZSW A;  4ZTF A;  5DK5 A;  1RT7 A;  4MFB A;  2ETJ A;  1JLC A;  4DTM A;  3QER A;  2XO7 A;  1L3V A;  4M3W A;  3NFA A;  1U47 A;  3DRP A;  3LPT A;  3V9X A;  4FK4 A;  4F3T A;  1JLG A;  5K14 A;  4DSF A;  2RF2 A;  1EET A;  3AO5 A;  4LD0 A;  3SYZ A;  1C0U A;  5C24 A;  2YNG A;  5KGW A;  2GV9 A;  4DQS A;  3OYM A;  2FBT A;  4C8O A;  4DS5 A;  3TI0 A;  4FXD A;  3DRR A;  4Z4F A;  1QS4 A;  4DQI A;  3DYA A;  4CJP A;  1S9G A;  4TSX A;  4CGI A;  2YNF A;  2HHW A;  4I9Q A;  4AH9 A;  4CK3 A;  5KGX A;  1NJY A;  3VQD A;  4E89 A;  2XY6 A;  5HRN A;  1U48 A;  1YTU A;  5J2P A;  3IG1 A;  2E6L A;  4B9N A;  4OKK A;  4EZ6 A;  3CYM A;  4F2S A;  4AHC A;  1TL3 A;  4B9S A;  5HBM A;  3TAQ A;  1QSL A;  1A5V A;  5CYM A;  3HK2 A;  5EU7 A;  4CEB A;  4E1M A;  4Z4I A;  1IKY A;  4JLH A;  4KHQ A;  4N47 A;  4E19 A;  2YKN A;  5CYQ A;  3V1O A;  4DF8 A;  1TK8 A;  4W5T A;  3AA4 A;  3C95 A;  3O3G A;  3NE6 A;  2G8H A;  1S1V A;  3ISN C;  3PY8 A;  4LY7 A;  3KLI A;  3LP0 A;  1JL2 A;  4G1Q A;  2X74 A;  4FLY A;  3NH0 A;  4PA1 A;  1KVA A;  4UQG A;  1NJW A;  3QIO A;  4ELU A;  2FBY A;  3WNH A;  3CG7 A;  3VQ9 A;  4CF2 A;  1Q9X A;  1BQM A;  3P5J A;  4M3R A;  3NGI A;  4E3S A;  1QSS A;  4PQU A;  1SKW A;  1NKC A;  2VG5 A;  1MU2 A;  4C8K A;  4CJU A;  4B9U A;  4DTX A;  2EHG A;  3L2W A;  2OYQ A;  4BDP A;  3V6D A;  2HHV A;  4B9L A;  4J2A A;  1FKP A;  1RDD A;  5KRS A;  4C8M A;  1S9E A;  3WNE A;  1F21 A;  4NYN A;  4OGC A;  4JRQ A;  1JLF A;  3WNF A;  1IG9 A;  4F8R A;  4DTP A;  4OJR A;  3M8R A;  3TAN A;  3SV3 A;  4FJJ A;  4B9T A;  4HCC A;  3KLF A;  1VSK A;  4CGG A;  3DLH A;  1WSG A;  3OVN A;  4FJH A;  4Q5V A;  2G8I A;  1VK0 A;  4FW1 A;  4NYF A;  3MED A;  1LWE A;  4JS4 A;  1KRP A;  1ASU A;  1WAF A;  2YKM A;  2R7Y A;  3DM2 A;  1J9A A;  3ZSR A;  5HRP A;  2JLE A;  1NOZ A;  5KTQ A;  3L2Q A;  3LWM A;  4DTO A;  2P5O A;  3K5M A;  2AJQ A;  4KTQ A;  3VQ4 A;  4DSE A;  1B9F A;  1WNS A;  3ZSZ A;  1B92 A;  3LWL A;  1RTH A;  2X6N A;  2KTQ A;  3PV8 A;  4CGD A;  2P5G A;  3JSM A;  4Y1C A;  1D8Y A;  2JGU A;  4DMN A;  1KTQ A;  5FDL A;  3OS1 A;  3L2U A;  3HP6 A;  2A1R A;  4B8A B;  1ZBF A;  3OYN A;  1SUQ A;  3DLR A;  4CJ4 A;  1RTD A;  2DY4 A;  1CZB A;  1XI1 A;  1KFD A;  1G15 A;  4CER A;  3JYT A;  3P83 D;  4BE1 A;  4CIG A;  3AVB A;  4YNQ A; 
#chains in the Genus database with same CATH topology
 3QES A;  2KZM A;  2ZGY A;  1KAZ A;  4DHY A;  4FJG A;  2HND A;  1JLB A;  3NF8 A;  3NF7 A;  3W0L A;  4C8L A;  5AQJ A;  3FZK A;  3SMS A;  4RW8 A;  4BRH A;  3AVI A;  3FFI A;  4CZE A;  4CZL A;  4C23 A;  3D0P A;  4IOC L;  2YNI A;  5JS2 A;  3JXU A;  3QDK A;  1SV5 A;  3OS2 A;  3QIN A;  5KQ8 A;  1FJG K;  5EVZ A;  1V4S A;  3OYI A;  3CCL N;  3DLB A;  1RDW X;  3SCX A;  3V9S A;  1WBD A;  4B1Z A;  3TTC A;  2VG7 A;  5E26 A;  4BR0 A;  1U49 A;  1HLU A;  3I0S A;  3FE1 A;  2QWR A;  1HYV A;  4FLZ A;  1U04 A;  4KAZ A;  3RVC A;  4CEA A;  3QB0 A;  3SJJ A;  1RT5 A;  1P8Z A;  1ZBS A;  5LMN K;  4DFM A;  4C8N A;  2HBM A;  3L4I A;  1T03 A;  4QOZ B;  2E1Z A;  1X3N A;  3KKS A;  1QHT A;  4FJ9 A;  3MK6 A;  3EZW A;  2ZJP L;  4YOV A;  1LWF A;  1J54 A;  4CJL A;  2HHS A;  2VGN A;  5FRN A;  1RT6 A;  2D0C A;  1CXQ A;  1XUP O;  4CZF A;  1L3U A;  4MQ3 A;  3KK1 A;  4OVL A;  3NH2 A;  3LP2 A;  2Q97 A;  4LH4 A;  5AQU A;  3FGU A;  2P9N B;  3ID6 A;  3VQ7 A;  5ADX A;  3TAB A;  4BRL A;  4B3M K;  4BE2 A;  4J2E A;  2KFZ A;  3UKU B;  1DLO A;  5ADX H;  1QZ5 A;  3HL8 A;  4FZZ A;  3K58 A;  2W41 A;  5A2Q O;  3ENH A;  2UUA K;  4WFN L;  1YVU A;  4KV8 A;  3ULE A;  2RN2 A;  3T1A A;  3EZ5 A;  4QCL A;  4K25 A;  2RPI A;  4AQY K;  1D9D A;  1R0A A;  3L3U A;  3VTI A;  1J5O A;  3H1Q A;  3Q7B A;  3HOS A;  2WBN A;  1BQN A;  1LV5 A;  4LSL A;  3VQ5 A;  1U6Z A;  1YF5 L;  4DFJ A;  3ZX3 A;  1NGC A;  2FF6 A;  5HRO A;  3C94 A;  4R5P A;  5C12 A;  4E7K A;  3S3O A;  4CIF A;  4CK2 A;  1X9M A;  2PFU A;  2E6M A;  2F8T A;  2ATQ A;  4FPA A;  1OKJ A;  3P39 A;  4K43 A;  5AZI A;  3H6E A;  1BL3 A;  4EAH D;  3ULD A;  3TAE A;  2HB5 A;  3L6Q A;  4DQQ A;  1X9W A;  4DTN A;  2OTL N;  4KO0 A;  3V9W A;  1N33 K;  3NF9 A;  1GOC A;  3BGR A;  1TUY A;  5B8H A;  3IRX A;  5AQW A;  3ATV A;  4CJE A;  3SPZ A;  4DV2 K;  1VQP N;  4Z4G A;  1BCO A;  4BVP A;  4LF9 K;  3C6A A;  2Q3S A;  4N41 A;  2G8V A;  5SZT A;  1NJI O;  4YHH K;  4HTU A;  2QWQ A;  1C1B A;  1YHQ N;  3WXI A;  4BC4 A;  4BC3 A;  3KKR A;  3TPQ A;  4CBU A;  1BIZ A;  3SUQ A;  3CFO A;  1ZBI A;  4BR4 A;  1C6V A;  4W5O A;  1T05 A;  5I3U A;  4NXM K;  4KHW A;  5JIC A;  1SL2 A;  2D0A A;  4PL7 A;  1SKS A;  4QS7 A;  3ZSV A;  4I6M B;  2ZJQ L;  5CY4 A;  3NGZ A;  5FPE A;  3O4N A;  3EL2 A;  3PX0 A;  4B9M A;  4DV4 K;  4BVO A;  4CZI A;  2P9U B;  2VQF K;  1NK4 A;  4KHU A;  4A59 A;  1DEJ A;  3MEG A;  3KLE A;  3C6U A;  1EWR A;  5HL7 L;  1T7P A;  3K5N A;  3K9K A;  4E7I A;  4DTS A;  1VRU A;  2YHA A;  1YJ9 N;  2E8A A;  4B3O A;  2QK9 A;  3ZLJ A;  3UKU A;  4V19 S;  3CD6 N;  4ISG A;  4CFA A;  2D4W A;  2P9K B;  3SK3 A;  4A5B A;  3VQP A;  5AFU H;  2E20 A;  3VQB A;  4N56 A;  3FFK B;  3V81 A;  5JVH L;  3CCU N;  1IKW A;  1UA1 A;  4BRP A;  4U7B A;  3P4I A;  2XY7 A;  1KC8 O;  1BUP A;  3EKS A;  5GIN A;  5T7B A;  3O1B A;  1EXQ A;  4FWQ A;  4BC2 A;  1ILY A;  5D3G A;  2IIR A;  2O8F B;  4JI6 K;  5C42 A;  4A57 A;  3RR7 A;  1LW0 A;  4RW6 A;  4WQ4 A;  1RGI A;  3WXM B;  1RT3 A;  4DB3 A;  5KQD A;  3CCM N;  1T8E A;  1GLB G;  1GLD G;  1UA0 A;  3NMU A;  3E01 A;  1XC3 A;  1NGF A;  2HNY A;  4BG9 A;  4FJ5 A;  3CCJ N;  5CR4 A;  5BPM A;  3CCE N;  1C1C A;  1HYS A;  1BU6 O;  1HQU A;  2HW3 A;  2QEX N;  4BDZ A;  3PX6 A;  3OBW A;  4M42 A;  3F73 A;  5FPD A;  3HP9 A;  4FWL A;  3S41 A;  1NK0 A;  3VEX A;  5BN8 A;  2UUC K;  3C65 A;  3MMV A;  2HHQ A;  2ASP A;  3P31 A;  4DV0 K;  2RKI A;  4H03 B;  3ZT1 A;  4ILH A;  4KH6 A;  2KFN A;  5FRO A;  1A5W A;  4EZ9 A;  3OYD A;  3KIO A;  3HO1 A;  4YOT A;  4H0V B;  1QVG M;  2X6S A;  1NK9 A;  2VWK A;  3MWP A;  5AQZ A;  4DUY K;  5J2N A;  4AIL C;  2NUB A;  4DU1 A;  3LDS A;  4FCY A;  4I6M A;  2P51 A;  1QSY A;  5AQN A;  1GLC G;  4JI5 K;  2QXF A;  4FK0 A;  4HUE A;  1NGA A;  1HYZ A;  5JMV A;  4IG0 A;  1HPZ A;  1XQS C;  4JI7 K;  2P9U A;  3MN9 A;  1OH5 A;  3LM2 A;  2P9L B;  4KI6 A;  1OVQ A;  4FLV A;  2Z1I A;  2WTU A;  4DSL A;  3K2P A;  2P9S B;  2V51 B;  2Z1H A;  3U6F A;  4H8K A;  3CMA N;  1X1P A;  5FLX O;  4FJ8 A;  1EQY A;  2IC3 A;  1YIT N;  4NXN K;  1C0T A;  5LY3 A;  3U4L A;  3RRG A;  4NO7 A;  3O8M A;  1REV A;  3PO5 A;  4AHT A;  2P9K A;  3VEY A;  5MLC Q;  1D9F A;  1KD1 O;  3H46 O;  4HTL A;  5E41 A;  4ID5 A;  1QVF M;  3DWL A;  3GBT A;  2A40 A;  4ZTF A;  3VMF B;  4DR5 K;  5DK5 A;  2E88 A;  2D0O A;  2HBJ A;  2O8F A;  1JLC A;  1DKG D;  3NFA A;  1EO1 A;  1JLG A;  1EET A;  3AAQ A;  3AO5 A;  4C8O A;  5C24 A;  3CCQ N;  3THX B;  2FBT A;  3DRR A;  3D2F B;  4CJP A;  1BO5 O;  2YNF A;  3GL1 A;  4I9Q A;  2A41 A;  4JN4 A;  5HRN A;  4B1U B;  2OCE A;  5BRF A;  3MN6 A;  4DUZ K;  2QWO A;  2UXB K;  4EZ6 A;  3PIP L;  4F2S A;  3I33 A;  4M63 C;  4DV1 K;  2GWK A;  1S1V A;  4FWR A;  4LY7 A;  1IBM K;  2X74 A;  3VGM A;  4X66 K;  2FBY A;  3CG7 A;  1Q9X A;  3P5J A;  4FPB A;  4E3S A;  4EIA A;  4DR2 K;  5GAE P;  4B9U A;  3L2W A;  2OYQ A;  2HHV A;  4BDP A;  2NRR A;  1VQN N;  2PAV A;  5KRS A;  4C8M A;  1F21 A;  4NYN A;  4HWI A;  3WNF A;  4DV3 K;  1IG9 A;  4F8R A;  4OJR A;  4B9T A;  4HCC A;  1VK0 A;  1KRP A;  2Q31 A;  2R7Y A;  1BDG A;  3K9J A;  3DM2 A;  3LWM A;  2JLE A;  5KTQ A;  4DTO A;  4H5W A;  4BRQ A;  3D6R A;  2P9L A;  3CC2 N;  3WEE B;  4O8U A;  1RTH A;  1ESV A;  1V4T A;  3U8X A;  3L2U A;  1ZBF A;  3OYN A;  4AM6 A;  3J7A P;  3DLR A;  3CXC M;  1KFD A;  5JLH A;  3JYT A;  3AAP A;  1G99 A;  1SQK A;  1RIL A;  4H4M A;  5C2D A;  3OYE A;  3M8Q A;  1VSF A;  5LL6 Z;  1VQ6 N;  4EFH A;  4I2Q A;  1O1W A;  4FL9 A;  3C6H A;  3K5L A;  4A61 A;  2BE2 A;  4M7X A;  4FJN A;  3FZF A;  2B6A A;  3G0Z A;  4ICL A;  1RBU A;  3LP3 A;  2YHY A;  4JKG B;  2FC0 A;  3R8E A;  1CZ9 A;  4FLW A;  2BUP A;  4KB1 A;  4HUF A;  3ZX0 A;  4XH1 A;  4DQR A;  4KI4 A;  1MWK A;  3LZI A;  1VQ7 N;  4EHU A;  3HVR A;  3THX A;  4IO8 A;  2GUI A;  3AO2 A;  4KB0 A;  4DTJ A;  2ZWH A;  1JCE A;  3THV A;  4GKJ K;  5AQL A;  4JI3 K;  3E9L A;  1NGJ A;  4H5R A;  2ZD1 A;  2Z1J A;  4JNE A;  4I2P A;  2Q1N A;  3J8A A;  4GVM A;  4M7Y A;  1NKB A;  3ENB A;  4CJ3 A;  4ZHR A;  1IKV A;  2FXU A;  4OPJ A;  1E4F T;  1KVC A;  1RDB A;  3IS9 A;  3RMC A;  1DTT A;  3WNG A;  3OHR A;  4B3S K;  3CER A;  2O8D A;  1A5X A;  1YJN N;  4WE1 A;  1XHZ A;  5DM6 L;  1HNV A;  1Q81 O;  3QNO A;  1HQE A;  3KK3 A;  4Z0U A;  1HJO A;  4FM1 A;  4OPH A;  3CIP A;  4ELT A;  2HNZ A;  1RDU A;  1WSE A;  5GIO A;  2OZS A;  1FK9 A;  3HPH A;  4OLB A;  4O5B A;  1IH7 A;  1TL1 A;  4CHN A;  2V7Y A;  3WQT A;  3CI5 A;  3ZSO A;  3CJA A;  1JLQ A;  3VEN A;  3HPO A;  3P38 A;  1UOC A;  1Q18 A;  3AVH A;  2XY8 A;  1YAG A;  4LH5 A;  4BGA A;  4ZTJ A;  1CLQ A;  4IBN A;  3F5T A;  3VGK A;  1HNI A;  1H1V A;  3AVC A;  3BUZ B;  4MLE A;  1OH8 A;  3WEE A;  4FLU A;  5SWM A;  2CH6 A;  5FRM A;  2YNH A;  3DXM B;  4L3Q A;  4J8F A;  3AGK A;  3T3F A;  2G8U A;  3UB5 A;  2QWM A;  2FSJ A;  3QLH A;  3LAN A;  2P9P B;  2KW4 A;  1QTM A;  3OBY A;  3SQ1 A;  1K8A O;  1QQN A;  1WOQ A;  1NOY A;  2YHX A;  4LFA K;  3LL3 A;  5AZJ B;  5AJ3 K;  3GG4 A;  5BPN A;  4BRO A;  2XHB A;  3ZT4 A;  4CEE A;  4CJS A;  1NM1 A;  4JKG A;  1NU0 A;  2I7P A;  4CZJ A;  4OPK A;  1RDA A;  1YTA A;  4F3O A;  2WC9 A;  3OYH A;  2QWN A;  1RBT A;  4BRM A;  4BRG A;  3BF1 A;  3UIQ A;  5KI6 A;  4AHR A;  4JAX A;  4E7H A;  4BR9 A;  4O55 A;  1GLL O;  1RDC A;  3A5O C;  3HM8 A;  5GAD P;  2JWL A;  2LSN A;  3E1Y A;  4Z4E A;  1X9S A;  4CHY A;  4CEF A;  4IXC A;  1XWL A;  2NZT A;  1TK5 A;  3IDH A;  3NF6 A;  1U45 A;  4CEQ A;  4CED A;  3M5R A;  3CPW M;  3TAG A;  1HX1 A;  4CGJ A;  1HRH A;  1HPM A;  3HM9 A;  3AGR A;  3SQ2 A;  3KHY A;  1TV6 A;  3NAE A;  1HMV A;  3M1F A;  3BEX A;  1Z26 A;  3SQ4 A;  4F2R A;  4DU3 A;  3HJF A;  1TKT A;  3VQ8 A;  4IJN A;  4LC9 B;  2YJE A;  5BN9 A;  3ZT2 A;  3EO3 A;  2CGL A;  3OYG A;  3PSF A;  3UKR B;  4CJV A;  4IFY A;  4JD2 B;  4FJ7 A;  4DWI A;  2IS3 A;  1ZYQ A;  4CFD A;  4OGE A;  2WFB A;  4NLB A;  1HKG A;  1S6P A;  4YOR A;  4RWT A;  4JKE A;  3VEV A;  3PUF A;  4B1V A;  5I9E B;  2W6L A;  1NG9 A;  5C2F A;  2QWL A;  4K8X A;  4IFE A;  3G25 A;  4R79 A;  1WLJ A;  3C6T A;  2I7N A;  3L2V A;  4BR2 A;  1NMD A;  4BRE A;  4KHY A;  4F4K A;  3H3N O;  1JXB A;  1ITG A;  4XH5 A;  1YT3 A;  4MDB A;  3I55 N;  2Q2R A;  3AO3 A;  3DXM A;  5CZ1 A;  4H4O A;  3ZCM A;  4GY2 B;  3MXM A;  1SL1 A;  4DKW A;  2UU9 K;  2P9P A;  5AQS A;  4ELV A;  4CF9 A;  2HST A;  3L3V A;  4KBO A;  1QHA A;  1W2B M;  1TAQ A;  3F9K A;  1Q82 O;  4IKF A;  4H0T B;  4JKB A;  3I0R A;  3NBP A;  3QEX A;  4FWS A;  5AZJ A;  4FJK A;  4W5N A;  3LZJ A;  4PKH A;  4WYB A;  5CHI A;  3SUN A;  1NKE A;  1NK6 A;  2B5J A;  3LP1 A;  3IUC A;  4OLA A;  3NCI A;  5EY4 A;  4BRN A;  1QQO A;  3VQC A;  1XNQ K;  3QEP A;  3QO9 A;  4ISF A;  3NHG A;  1Y64 A;  3O9R A;  3TU5 A;  1TVR A;  1N36 K;  3VQA A;  3SZ2 A;  3K0S A;  1WB9 A;  2QKB A;  3OJU A;  1WUA A;  4FM2 A;  5AQR A;  2FBX A;  2OPR A;  2KLA A;  2OPP A;  1NK5 A;  2O8E B;  2BTF A;  5C15 A;  1RTJ A;  1UWB A;  1VQ9 N;  1W9H A;  2EWS A;  2RE2 A;  3NDK A;  4IOX A;  3PX4 A;  1U2V B;  2O4G A;  4BAC A;  2ITG A;  3WXK A;  3RMB A;  3OYJ A;  3VEO A;  3DRS A;  4BWM A;  3KJV A;  4CJ5 A;  4KFB A;  5AQK A;  1LW2 A;  3AVK A;  3M8P A;  2E1Y A;  4BWJ A;  4IOA L;  3RMA A;  4CHO A;  3CFP A;  4LF6 K;  1HNZ K;  3UKR A;  3OYA A;  4FZY A;  3RSE B;  4JD2 A;  3ATU A;  3TAR A;  3DI6 A;  3DOK A;  4PKG A;  4PHT X;  4MO5 A;  3T19 A;  2DTU A;  1GLA G;  1L3T A;  3DLL L;  2IVO A;  2IVP A;  1NGE A;  4CD1 A;  2E2P A;  4DFP A;  4B9V A;  2A1S A;  4DQ8 A;  2VYP A;  1TK0 A;  4BGB A;  1S6Q A;  1YVN A;  4I7F A;  1EP4 A;  4CHQ A;  2VG6 A;  3WUH A;  3ZSW A;  3MCA B;  4X65 K;  1RT7 A;  4IJA A;  2ETJ A;  3IKM A;  3IMX A;  3QER A;  1YUW A;  4DR6 K;  4FK4 A;  4F3T A;  5K14 A;  4B1X B;  4DSF A;  2RF2 A;  4LD0 A;  2YNG A;  5KGW A;  4A5A A;  4DQS A;  3TI0 A;  4Z4F A;  5AQX A;  1QS4 A;  4DQI A;  1S9G A;  3M6G A;  4CGI A;  4DV5 K;  3PLA A;  5KGX A;  3FR0 A;  4NB4 A;  3VQD A;  2XY6 A;  3O9Q A;  4BR5 A;  4AHC A;  1QSL A;  1A5V A;  5CYM A;  4B1W B;  3HK2 A;  4CEB A;  4Z4I A;  4N47 A;  4E19 A;  3V1O A;  2UYT A;  3C95 A;  3O3G A;  3NE6 A;  3ISN C;  2NRW A;  3NH0 A;  4PA1 A;  4ELU A;  2QWP A;  3VQ9 A;  4CF2 A;  1QSS A;  4H0X B;  1SKW A;  5H1S Q;  4GV9 A;  2VG5 A;  5LJV A;  3V6D A;  2O8E A;  1VQ4 N;  3CC4 N;  1S9E A;  1GLJ O;  3KVG A;  4A2B A;  3CPE A;  3VOV A;  1U2V A;  2WUS A;  1NGB A;  1ZC6 A;  2QW9 A;  3KLF A;  1NGI A;  1VSK A;  4CGG A;  4FW1 A;  4NYF A;  1LWE A;  2A3Z A;  1K8K B;  1D4X A;  2YKM A;  1GLE G;  3CJ1 A;  1NOZ A;  2P5O A;  5AQV A;  1NGD A;  3WT0 A;  3K5M A;  3VQ4 A;  4YY3 K;  1B9F A;  3ZSZ A;  1YI2 N;  1B92 A;  3I8B A;  4F9O A;  2X6N A;  3A8Y A;  3THY B;  4JKA A;  2JGU A;  3WXL A;  2AA4 A;  3QFP A;  4B8A B;  1SUQ A;  2KHO A;  3RSE A;  1RTD A;  3CJ9 A;  4A2A A;  1WBB A;  3DLH A;  5KPR A;  4CVN E;  1FXX A;  2ASM A;  4CJQ A;  4DTR A;  4C1N K;  4DR4 K;  1JJ2 M;  1Z25 A;  1S1W A;  3HZ6 A;  1OH7 A;  1W0H A;  4XIU A;  4Y0W A;  3VQ6 A;  3V4I A;  5AQQ A;  5M1K A;  3EYZ A;  4Z94 A;  1KAX A;  2OAN A;  4OKE A;  3B8A X;  4O4G A;  4LF5 K;  3OYK A;  4CEO A;  3T1H K;  4YOU A;  4LFC K;  1JLE A;  1E4G T;  3O6W A;  4FOI A;  4YDU C;  3L8B A;  3SUP A;  2D5R A;  2KKZ A;  4CF0 A;  3PO4 A;  4LFB K;  4JK8 A;  3R1X A;  4FVU A;  5GAG P;  4RW9 A;  4CHP A;  4W5Q A;  1WAJ A;  3L0Q A;  3SQ0 A;  1JL1 A;  1QQC A;  4JKC A;  3MX2 A;  1BCM A;  2GEM A;  3MEC A;  3CQ8 A;  5AQT A;  3HT3 A;  5KPT A;  2CGK A;  2HVI A;  1I39 A;  5E84 A;  2B4J A;  4KHP K;  4AHU A;  1BI4 B;  4CW7 B;  5KRT A;  4WQ5 C;  3BZK A;  1RCH A;  1IJJ A;  3HRG A;  3F9M A;  2OPS A;  5HOO A;  1Y97 A;  2GEL A;  3KTQ A;  1NJZ A;  1QZ6 A;  1S3X A;  2A6A A;  3S3N A;  3O3F A;  4UY8 O;  4CCH A;  4MLH A;  3PIO L;  4JYA K;  1L5U A;  1KLN A;  4KTW A;  5IT9 O;  3B6P A;  2O8D B;  3HTV A;  4QS9 A;  4ISE A;  2UXD K;  3AAR A;  3C7N B;  4O5F A;  1BA0 A;  4I9L A;  4CGH A;  2P9I B;  3VA0 A;  1VSI A;  3A5L C;  3TWH A;  4CZK A;  4LF8 K;  2HHT A;  1K8K A;  3QEW A;  1DGK N;  3FLC O;  4CEC A;  1MA9 B;  1W7A A;  4DSI A;  5JLF A;  1JKH A;  2W40 A;  4M3Z A;  1ZXO A;  2O8C B;  3J81 O;  4JKH A;  5DMR A;  4GVE A;  4M3U A;  4LF4 K;  3D2E B;  5AQP A;  3THY A;  3CM5 A;  4FSV A;  3V1R A;  3R6M A;  3TSU A;  4YOX A;  3ZT3 A;  1WSI A;  3M8S A;  4AHV A;  3TAM A;  1N32 K;  3V9Z A;  4IWV A;  4JK7 A;  1M1K O;  2E2O A;  1NK8 A;  1BGX T;  1GOB A;  1W97 L;  3ALY A;  3ITH A;  4CFC A;  4CJ7 A;  2NRZ A;  3MXI A;  4IEI A;  1SKR A;  3SAG A;  3AA3 A;  2OPQ A;  4BRC A;  4X64 K;  2CH5 A;  5J2M A;  2IOC A;  4O44 A;  2HMI A;  4IZ9 A;  2J4R A;  3O9U A;  1LAV A;  4HHT A;  3R9P A;  4K0K K;  1TKD A;  4GV6 A;  3EY1 A;  1BIU A;  3O80 A;  4J2D A;  4RG8 A;  3AA2 A;  4W5R A;  2ASO A;  4CFB A;  4CI6 A;  5J1E A;  2YV0 X;  3RTV A;  2WOM A;  3BY5 A;  3LPU A;  3KWI A;  5CE3 A;  3VER A;  1S1T A;  2BAN A;  1EWQ A;  1U4B A;  3AVJ A;  3AO4 A;  4DR7 K;  4IDH A;  2NRT A;  1RNH A;  4FWK A;  5AQI A;  1JXE A;  5I42 A;  3RR8 A;  1TAU A;  1S1U A;  3FZL A;  4XH4 A;  3VQQ A;  3MWT A;  3V1Q A;  1BI4 A;  3K59 A;  3SMP A;  2QTD A;  1VQ8 N;  1GOA A;  4FWM A;  3LM9 A;  5AQF A;  4C1N I;  1M90 O;  4GV3 A;  2A42 A;  4KKO A;  5LMU K;  1ATS A;  5BR9 A;  3SV4 A;  4E7J A;  2HOE A;  3D7E O;  4JK9 A;  1Q8I A;  4MO4 A;  1BG3 A;  3K57 A;  4CJR A;  3VQE A;  5GIP A;  4CF1 A;  3TTF A;  3C7N A;  2I5J A;  4CHZ A;  4ILJ A;  2P9I A;  3DOL A;  3KZB A;  1DTQ A;  1OVY A;  5AQO A;  4OKJ A;  1RBR A;  3FZM A;  3ZET A;  5IWA K;  3AO1 A;  1EX4 A;  2IDO A;  5BPL A;  1WN7 A;  4IFV A;  1YJW N;  3WQU A;  2O8C A;  3JS6 A;  3AVL A;  3OYF A;  1IKX A;  4FZX C;  3ZT0 A;  4KRE A;  4OPA A;  3D2E A;  2HVH A;  5C25 A;  3TAP A;  1MWM A;  1X9J A;  1BHL A;  3SPY A;  4E0D A;  4JI0 K;  3NGY A;  4Q0B A;  4E1N A;  3KLH A;  1K6Y A;  2OTJ N;  1S5J A;  2PYL A;  5HP1 A;  4BC5 A;  2IVN A;  2H3G X;  1HNW K;  4WF9 L;  3VF4 A;  1T3V A;  3O5B A;  4J2B A;  1KXP A;  3VGL A;  4O8K A;  1C0G A;  1BOT O;  3SAF A;  3SNN A;  1LWC A;  4GMJ B;  1J53 A;  3ASM A;  3OY9 A;  1N8R O;  4PWD A;  4B3T K;  2P1J A;  4KRF A;  3LDL A;  4EP4 A;  1OH6 A;  3DLG A;  3LDP A;  3ZX2 A;  1TKX A;  3AV9 A;  2FF3 B;  1KSP A;  1TUU A;  4BRD A;  1VSL A;  5J2Q A;  2F9T A;  1NMN A;  4FM0 A;  4FJM A;  2FBV A;  1K9M O;  2IAJ A;  3KD5 E;  3M3Z A;  2G8W A;  1KFS A;  4CZM A;  2WON A;  1NJX A;  1ASV A;  1B9D A;  5F0X A;  3TSP A;  4MDA A;  3G10 A;  4E1J A;  2VWJ A;  2Y1J A;  2ZE2 A;  2ZF5 O;  3L2R A;  4HVJ A;  1ATN A;  3HVT A;  4DV7 K;  3L4Q A;  3NH1 A;  1BA1 A;  1WSF A;  3Q7C A;  3I8D A;  3ZSQ A;  1EKE A;  4NLC A;  3KD1 E;  3H08 A;  3MCP A;  2FLO A;  3S3M A;  1D5A A;  4G9Z A;  3LDO A;  4NCG A;  4B08 A;  4DTU A;  2QA4 N;  1TKZ A;  4RCH A;  3QBX A;  4OX9 K;  1VSM A;  4IO9 L;  1FKO A;  4IG3 A;  3O4W A;  5BR8 K;  4JHD B;  1ZBH A;  4JKF A;  2ZQB A;  4CJW A;  4X62 K;  1VQ5 N;  2PY5 A;  3HPG A;  3CFR A;  3VA3 A;  2F96 A;  3H1V X;  2NRX A;  1WSJ A;  4M3X A;  4A62 A;  3J7Y P;  4BRF A;  3CCR N;  4CE9 A;  1I3A A;  3N4P A;  3U3Y A;  2YCH A;  5AQM A;  3LDQ A;  4M3W A;  3CJB A;  3DRP A;  5TKW A;  3LPT A;  3V9X A;  4JI1 K;  3SYZ A;  1C0U A;  2GV9 A;  1Q86 O;  4YOY A;  3DYA A;  3A5N C;  3G6E N;  2ITM A;  2HHW A;  4CK3 A;  1NJY A;  4E89 A;  4JI2 K;  3IG1 A;  2E6L A;  4H5T A;  4PKI A;  3LDN A;  3CYM A;  3AY9 A;  2V52 B;  3TAQ A;  5EU7 A;  4E1M A;  1IKY A;  4JLH A;  4KHQ A;  3O9S A;  1R59 O;  1TK8 A;  1HUX A;  3AA4 A;  2G8H A;  1CZA N;  3KLI A;  3LP0 A;  4G1Q A;  1KVA A;  4UQG A;  1NJW A;  3HI0 A;  5F2R A;  1ATR A;  3WNH A;  1BQM A;  4M3R A;  1VQO N;  1NKC A;  4C8K A;  5M1P A;  4DTX A;  1NGG A;  3SBT A;  2EHG A;  2YJF A;  1FKP A;  1RDD A;  3G4S N;  3WNE A;  5AQH A;  4FJJ A;  1TYQ B;  4DTP A;  3M8R A;  5GAH P;  3J80 O;  3SV3 A;  5M1F A;  2F4V K;  1SAZ A;  1VHX A;  4QS8 A;  1NGH A;  4Q5V A;  2G8I A;  4JS4 A;  1Q7Y O;  3MED A;  3WXJ A;  1WAF A;  4WFB L;  2FSN A;  4U67 L;  5M1O A;  2AJQ A;  4KTQ A;  2YI1 A;  1KAY A;  4BY9 C;  5AQY A;  3PV8 A;  4CGD A;  4Y1C A;  1D8Y A;  3O1W A;  3OS1 A;  3HP6 A;  2A1R A;  1NNE A;  5F1X A;  3MX5 A;  2DY4 A;  1XI1 A;  4JHD A;  4JEP A;  4CER A;  4CIG A;  3AVB A;  4YNQ A;  5FPN A;  3P1G A;  2VQE K;  2HHU A;  1HNX K;  1YXQ A;  1HJR A;  1ASW A;  2VCP A;  4JRP A;  2W6K A;  2HHX A;  1VQK N;  1ZBU A;  2DPN A;  2CGJ A;  4DU4 A;  3VES A;  1T6D A;  3AVN A;  4PUO A;  1QE1 A;  4K8Z A;  2KZZ A;  3BDP A;  4M3T A;  5JS1 A;  2D1K A;  2OZM A;  2ZM6 K;  3UE5 A;  4CD3 A;  4JKD A;  3OYL A;  1IBK K;  3CQY A;  1SL0 A;  4KH5 A;  1KCF A;  3S9H A;  3T1Y K;  3KLG A;  2DFE A;  4CES A;  2A5X A;  4WCE L;  5EOY A;  4WQ4 C;  4DFK A;  3U3G A;  1VSJ A;  2Z1G A;  3SUO A;  5BRH A;  1E3M A;  3CHW A;  4E7L A;  3IAY A;  2VGM A;  3CQX A;  2NRH A;  3LAM A;  4DV6 K;  2GTD A;  4BRA A;  4CK1 A;  4PL8 A;  2D0P A;  3O3H A;  3AVG A;  1MDU B;  4KHS A;  2P9N A;  3QIP A;  5TKY A;  3VN5 A;  2HMP A;  3MAQ A;  5AFU A;  5HRS A;  4IDK A;  4AHS A;  2QM1 A;  3ZEU B;  4B9Q A;  4DSK A;  3AVM A;  1X3M A;  3OYC A;  4B8C A;  2BH1 A;  3THW B;  3H3O B;  3CF5 L;  5CZ2 A;  3U9Z A;  2XY5 A;  3R3L A;  3DJC A;  3VTH A;  2Q0R A;  3TTD A;  1C0M A;  4FLT A;  1DT9 A;  1TYQ A;  1N6Q A;  3FZH A;  4FO0 A;  4Y1D A;  4LF7 K;  2Q0U A;  5HRR A;  4NCB A;  4CJF A;  1RBS A;  3MEE A;  3KWG A;  4DSJ A;  3AVA A;  3W3D A;  4FLX A;  1RTI A;  1HKB A;  2NRV A;  2E4L A;  4ILG B;  3VEW A;  1TGO A;  2NNW A;  5EX5 A;  3KK2 A;  3HBT A;  4N5S A;  2BDP A;  4L8R B;  2HBL A;  3QIC A;  4XEI A;  4BQZ A;  1GLF O;  3QBW A;  4JI8 K;  3EE8 A;  5DM7 L;  4BE0 A;  4DF4 A;  2YX6 A;  4FOE A;  1QQM A;  4DR1 K;  1IO2 A;  1IG8 A;  3SLC A;  1L3S A;  2F9W A;  3SJH A;  4K42 A;  4HUG A;  4CF8 A;  3MN5 A;  2BGG A;  3LAK A;  3U9D A;  3DMJ A;  3JAM O;  3CME N;  3T7Z A;  4FJL A;  1K73 O;  1N5Y A;  1RBV A;  3J7Z O;  5JVG L;  4JI4 K;  4CGF A;  4FWP A;  2V7Z A;  4O0I A;  4JV5 K;  2KQ2 A;  3RWU A;  4FWO A;  1VRT A;  2W42 A;  3VF2 A;  2DFF A;  4KPY A;  2F8S A;  2NLX A;  1LAW A;  3ZSY A;  1VSE A;  2HF4 A;  2E2N A;  2PYJ A;  2G8F A;  3TR8 A;  2OA8 A;  1KLM A;  4YFU A;  3CET A;  4CJT A;  4DLG A;  1KQS M;  3EKU A;  4EHT A;  2YHW A;  1RT1 A;  3PSI A;  3HXM A;  3VET A;  4DR3 K;  4DS4 A;  4GKK K;  4CZG A;  3AVF A;  4O0J A;  3QML A;  4CBW A;  2EX3 A;  3ZEU A;  4RW7 A;  1UAX A;  3T69 A;  1HR0 K;  2F7T A;  4PY5 A;  3THW A;  2AP1 A;  3BZC A;  1NK7 A;  4LSN A;  4M45 A;  1NBW A;  3RMD A;  1JLA A;  4BRI A;  1WSH A;  5BRE A;  2GBZ A;  3A2F A;  3QFU A;  2RHK A;  2ZJR L;  3VEZ A;  2HHH K;  4KH4 A;  1T44 A;  2QXL A;  4CJK A;  3QEV A;  2QKK A;  4ID1 A;  3OA9 A;  3AA5 X;  1FW6 A;  3N4Q A;  4NCA A;  4FK2 A;  3TSQ A;  1C1A A;  4FYD A;  3SBG A;  3OS0 A;  2X78 A;  2PZS A;  4YDU A;  2E5L K;  4N76 A;  3NVK A;  3HYF A;  3BF3 A;  4IEE A;  3ZET B;  4AM7 A;  2UUB K;  3TAF A;  1S72 N;  1KVB A;  4CBX A;  1RT4 A;  4YOW A;  1JCF A;  4BQL A;  3OYB A;  4Z4H A;  3GOI A;  5AQG A;  3B6O A;  3HSC A;  4Z4C A;  4H0Y B;  2YHB A;  3RRH A;  3DXK B;  4H5N A;  4WQ5 A;  4M41 A;  1VQL N;  2QI2 A;  4RW4 A;  1XMO K;  2HBK A;  3ZSX A;  3LAL A;  3O4Q A;  4GW6 A;  4CEZ A;  3A5M C;  1VSD A;  3GDQ A;  5ELZ A;  2XRI A;  4HCB A;  4KHN A;  3NVM A;  1VSH A;  3CJC A;  3HST B;  4DG1 A;  3QNN A;  1I94 K;  3CJ7 A;  3ZYY X;  4FWN A;  3ID8 A;  2D0B A;  4CIE A;  2VWB A;  3OTO K;  2GX9 A;  3GE1 A;  2FSK A;  3DLK A;  1XC9 A;  1IBL K;  4M3Y A;  1XHX A;  3O08 A;  3CCV N;  1Q9Y A;  2P9S A;  4FW2 A;  3K5O A;  1LOT B;  2UXC K;  2HF3 A;  3HOT A;  3VPZ A;  5HLF A;  2O8B B;  1CXU A;  1ZBL A;  3QET A;  3MN7 A;  2G8K A;  3D45 A;  4DQP A;  2Y1I A;  4FJX A;  4H5V A;  2E2Q A;  4FVM A;  3SAH A;  3KK7 A;  4WFA L;  3DLE A;  4RTF D;  3SI6 A;  2DFH A;  4GNI A;  1P90 A;  5M1Q A;  1S1X A;  1N34 K;  1VAZ A;  3MXJ A;  4QAG A;  3V9U A;  4EP5 A;  3E9P A;  4FJI A;  4JS5 A;  5C10 A;  3A0I X;  3F2K A;  4KTZ A;  3CM6 A;  1Z6R A;  4BR7 A;  2IGI A;  5M1N A;  3IFR A;  4H0O A;  4BDY A;  1RT2 A;  1BWF O;  3EE9 A;  3H45 C;  5LJW A;  3QEI A;  2O4I A;  3OJS A;  1J6Z A;  1BIS A;  4DLE A;  3I56 N;  3E66 A;  1O13 A;  3D2F A;  5AR0 A;  3E9O A;  4MFB A;  4DTM A;  3O9T A;  2XO7 A;  1L3V A;  1U47 A;  4BRK A;  3OYM A;  4FXD A;  4DS5 A;  3VF6 A;  4TSX A;  1Z05 A;  4AH9 A;  1XNR K;  4K41 A;  1U48 A;  1YTU A;  5J2P A;  4DCH A;  4B9N A;  4OKK A;  1TL3 A;  4B9S A;  5HBM A;  4AF1 A;  4CZH A;  3DXK A;  2GWJ A;  2YKN A;  5CYQ A;  3C0B A;  4DF8 A;  5KPZ A;  4W5T A;  1C0F A;  3PY8 A;  2PBD A;  1JCG A;  1NWK A;  1JL2 A;  1LCU A;  4FLY A;  3QIO A;  1NLV A;  3BP8 A;  1VQM N;  2Q36 A;  3NGI A;  5BRD A;  4PQU A;  1IV0 A;  1SS6 A;  1MU2 A;  4BG8 A;  4CJU A;  4H0P A;  1J5E K;  1YIJ N;  1SZ2 A;  4B9L A;  4J2A A;  4OGC A;  3CCS N;  3EEQ A;  1JLF A;  4JRQ A;  3TAN A;  3G71 N;  3CC7 N;  2O8B A;  1WSG A;  3OVN A;  4FJH A;  1ASU A;  5C0Y A;  3ULE B;  1HKC A;  1J9A A;  2GUP A;  2JWK A;  3ZSR A;  5HRP A;  3L2Q A;  3MDQ A;  1XMQ K;  1RFQ A;  4B3R K;  4DSE A;  1WNS A;  1T6C A;  3LWL A;  3EN9 A;  2KTQ A;  4OO1 J;  2P5G A;  1S22 A;  3JSM A;  4DMN A;  4B1Y B;  5FPM A;  1KTQ A;  5FDL A;  3OW2 M;  3ENO A;  5EXW A;  4CJ4 A;  1CZB A;  3DAW A;  2ZGZ A;  1G15 A;  3P83 D;  5AZI B;  4BE1 A; 
#chains in the Genus database with same CATH homology
 4H4M A;  3QES A;  3OYE A;  2KZM A;  1FXX A;  3M8Q A;  1VSF A;  4FJG A;  3P1G A;  2HHU A;  4CJQ A;  2HND A;  4I2Q A;  1JLB A;  1O1W A;  3NF8 A;  4DTR A;  3NF7 A;  1HJR A;  3K5L A;  1ASW A;  4JRP A;  4C8L A;  2BE2 A;  4RW8 A;  4FJN A;  1Z25 A;  2B6A A;  3G0Z A;  4ICL A;  1RBU A;  1S1W A;  1ZBU A;  3AVI A;  3FFI A;  3LP3 A;  1W0H A;  4XIU A;  4DU4 A;  3AVN A;  3VQ6 A;  4PUO A;  1QE1 A;  4K8Z A;  2KZZ A;  2FC0 A;  3V4I A;  3D0P A;  3BDP A;  4M3T A;  2YNI A;  5JS1 A;  5JS2 A;  1SV5 A;  3OS2 A;  3EYZ A;  3QIN A;  1CZ9 A;  2OZM A;  4FLW A;  4OKE A;  4KB1 A;  4O4G A;  3OYL A;  4HUF A;  1SL0 A;  4DQR A;  4KI4 A;  3LZI A;  3OYI A;  1KCF A;  3OYK A;  3S9H A;  4CEO A;  3DLB A;  3HVR A;  1JLE A;  3KLG A;  2DFE A;  3SCX A;  4CES A;  3V9S A;  3L8B A;  3SUP A;  2D5R A;  2GUI A;  3AO2 A;  4DTJ A;  4CF0 A;  4DFK A;  4KB0 A;  2VG7 A;  3PO4 A;  3U3G A;  3THV A;  1VSJ A;  2Z1G A;  1U49 A;  3I0S A;  4RW9 A;  4CHP A;  3SUO A;  4W5Q A;  1WAJ A;  1HYV A;  4FLZ A;  1U04 A;  3SQ0 A;  4CEA A;  1JL1 A;  1QQC A;  4KAZ A;  1BCM A;  2ZD1 A;  1RT5 A;  4E7L A;  3SJJ A;  2Z1J A;  3MEC A;  3IAY A;  4I2P A;  3CQ8 A;  4GVM A;  4DFM A;  3LAM A;  3HT3 A;  4C8N A;  1NKB A;  4CJ3 A;  4ZHR A;  1IKV A;  2HVI A;  4OPJ A;  1T03 A;  4QOZ B;  4CK1 A;  1I39 A;  1KVC A;  1RDB A;  3O3H A;  3IS9 A;  3KKS A;  3RMC A;  3AVG A;  1DTT A;  1QHT A;  2B4J A;  3WNG A;  4KHS A;  1A5X A;  4AHU A;  1BI4 B;  3QIP A;  4FJ9 A;  4WE1 A;  5KRT A;  3VN5 A;  1XHZ A;  1HNV A;  3MAQ A;  1RCH A;  1NJX A;  1LWF A;  1J54 A;  5HRS A;  4CJL A;  3QNO A;  4IDK A;  1HQE A;  4AHS A;  2OPS A;  3KK3 A;  5FRN A;  2HHS A;  1Y97 A;  3KTQ A;  4Z0U A;  1NJZ A;  1RT6 A;  2D0C A;  1CXQ A;  4DSK A;  3AVM A;  3S3N A;  3O3F A;  3OYC A;  4FM1 A;  4B8C A;  4CCH A;  4ELT A;  1L3U A;  4MQ3 A;  3KK1 A;  4OVL A;  3NH2 A;  2HNZ A;  1L5U A;  1WSE A;  3LP2 A;  4KTW A;  1FK9 A;  3HPH A;  3B6P A;  4LH4 A;  1KLN A;  4O5B A;  2OZS A;  5CZ2 A;  2XY5 A;  3VQ7 A;  3TAB A;  1IH7 A;  1TL1 A;  4BE2 A;  4CHN A;  4J2E A;  2KFZ A;  1C0M A;  1DLO A;  4FLT A;  3ZSO A;  1N6Q A;  3HL8 A;  1JLQ A;  4FZZ A;  4Y1D A;  3K58 A;  3HPO A;  5HRR A;  4I9L A;  4NCB A;  4CGH A;  4CJF A;  1RBS A;  3MEE A;  3VA0 A;  1UOC A;  1VSI A;  3AVH A;  2XY8 A;  3AVA A;  4DSJ A;  4LH5 A;  3TWH A;  4FLX A;  1RTI A;  2HHT A;  3QEW A;  1YVU A;  4KV8 A;  4CEC A;  4ZTJ A;  1CLQ A;  4IBN A;  2RN2 A;  4DSI A;  3T1A A;  3EZ5 A;  4QCL A;  2RPI A;  1JKH A;  1D9D A;  2E4L A;  1R0A A;  4M3Z A;  1HNI A;  3L3U A;  1J5O A;  1TGO A;  3AVC A;  4FLU A;  1BQN A;  5DMR A;  1LV5 A;  4LSL A;  3VQ5 A;  5SWM A;  4M3U A;  3KK2 A;  4DFJ A;  5FRM A;  2YNH A;  4N5S A;  2BDP A;  4L8R B;  5HRO A;  3C94 A;  3CM5 A;  3T3F A;  2G8U A;  4R5P A;  4E7K A;  3S3O A;  4CIF A;  3V1R A;  4CK2 A;  1X9M A;  3ZT3 A;  2E6M A;  3QLH A;  3LAN A;  2F8T A;  2ATQ A;  1WSI A;  2KW4 A;  4AHV A;  3TAM A;  3M8S A;  4BE0 A;  1QTM A;  4DF4 A;  3V9Z A;  3SQ1 A;  3ULD A;  1BL3 A;  3TAE A;  1NK8 A;  1NOY A;  1RIL A;  2HB5 A;  4N76 A;  1IO2 A;  1BGX T;  1GOB A;  4DQQ A;  1X9W A;  4DTN A;  1L3S A;  2XHB A;  3ALY A;  3ITH A;  4KO0 A;  3ZT4 A;  4HUG A;  4CEE A;  4CJS A;  3NF9 A;  3V9W A;  4CFC A;  4CF8 A;  2BGG A;  3MXI A;  1GOC A;  3BGR A;  3LAK A;  3IRX A;  3DMJ A;  1SKR A;  3AA3 A;  2OPQ A;  4FJL A;  1N5Y A;  4CJE A;  4OPK A;  1RBV A;  1RDA A;  1YTA A;  3SPZ A;  2HHX A;  4F3O A;  3OYH A;  5J2M A;  2IOC A;  1RBT A;  4O44 A;  2HMI A;  4CGF A;  4Z4G A;  1BCO A;  3UIQ A;  5KI6 A;  4AHR A;  4O0I A;  4E7H A;  2KQ2 A;  2Q3S A;  1LAV A;  3RWU A;  4N41 A;  4HHT A;  1VRT A;  5SZT A;  2G8V A;  4O55 A;  2W42 A;  1TKD A;  1RDC A;  4HTU A;  2DFF A;  4KPY A;  2LSN A;  2F8S A;  1C1B A;  3EY1 A;  1BIU A;  1LAW A;  3ZSY A;  4J2D A;  4RG8 A;  4Z4E A;  3KKR A;  3AA2 A;  4W5R A;  1X9S A;  1BIZ A;  4CFB A;  5J1E A;  1VSE A;  3CFO A;  4CHY A;  2YV0 X;  3SUQ A;  4CEF A;  1C6V A;  4W5O A;  3RTV A;  1T05 A;  5I3U A;  2WOM A;  4KHW A;  3LPU A;  2PYJ A;  4OLB A;  1XWL A;  1S1T A;  2BAN A;  1SL2 A;  3TR8 A;  2G8F A;  2D0A A;  2OA8 A;  1U4B A;  1KLM A;  3AVJ A;  1SKS A;  3ZSV A;  3AO4 A;  1TK5 A;  4YFU A;  3NF6 A;  4CJT A;  1U45 A;  4DLG A;  5CY4 A;  3NGZ A;  4CEQ A;  4CED A;  1RNH A;  3O4N A;  3TAG A;  3PX0 A;  4B9M A;  1JXE A;  5I42 A;  3RR8 A;  4CGJ A;  1TAU A;  1S1U A;  1RT1 A;  1HRH A;  3V1Q A;  3VQQ A;  3HM9 A;  3SQ2 A;  1NK4 A;  1TV6 A;  3NAE A;  3HXM A;  1HMV A;  1BI4 A;  4KHU A;  4DS4 A;  1Z26 A;  3K59 A;  3SQ4 A;  4DU3 A;  4F2R A;  1TKT A;  3VQ8 A;  3HJF A;  3AVF A;  3MEG A;  4O0J A;  3KLE A;  3C6U A;  1GOA A;  2EX3 A;  3ZT2 A;  4RW7 A;  1UAX A;  4KKO A;  1T7P A;  3K5N A;  4E7I A;  4PY5 A;  4DTS A;  1VRU A;  2YHA A;  3SV4 A;  4E7J A;  3OYG A;  1NK7 A;  1Q8I A;  4IFY A;  4LSN A;  4CJV A;  3K57 A;  4FJ7 A;  4B3O A;  4M45 A;  2QK9 A;  4DWI A;  2IS3 A;  1ZYQ A;  4CFD A;  4OGE A;  1JLA A;  4CJR A;  3RMD A;  1WSH A;  3VQE A;  2GBZ A;  1S6P A;  4CF1 A;  3A2F A;  3PUF A;  2I5J A;  4CFA A;  4CHZ A;  3VQP A;  3DOL A;  1DTQ A;  3VQB A;  4K8X A;  4N56 A;  4OKJ A;  3V81 A;  1WLJ A;  1IKW A;  1RBR A;  3C6T A;  1UA1 A;  4CJK A;  3L2V A;  3QEV A;  2XY7 A;  2QKK A;  4ID1 A;  3AO1 A;  1EX4 A;  2IDO A;  3AA5 X;  5T7B A;  4KHY A;  4NCA A;  1EXQ A;  4F4K A;  1WN7 A;  4IFV A;  4FK2 A;  1JXB A;  5D3G A;  1ITG A;  1C1A A;  4FYD A;  1YT3 A;  3AVL A;  3OYF A;  1IKX A;  5C42 A;  3ZT0 A;  3OS0 A;  4FZX C;  4KRE A;  3AO3 A;  3RR7 A;  2X78 A;  1LW0 A;  2HVH A;  5CZ1 A;  5C25 A;  3SPY A;  4H4O A;  1BHL A;  3TAP A;  2PZS A;  3ZCM A;  4E0D A;  3MXM A;  3NGY A;  4RW6 A;  1SL1 A;  4Q0B A;  4E1N A;  3KLH A;  1K6Y A;  1S5J A;  3HYF A;  2PYL A;  5HP1 A;  1RT3 A;  1T8E A;  4ELV A;  4CF9 A;  3TAF A;  1UA0 A;  3L3V A;  1TAQ A;  3E01 A;  1KVB A;  3F9K A;  1RT4 A;  4IKF A;  2HNY A;  3OYB A;  4FJ5 A;  4J2B A;  4Z4H A;  3I0R A;  3B6O A;  3NBP A;  3QEX A;  4Z4C A;  3SNN A;  4FJK A;  4W5N A;  1C1C A;  1LWC A;  3LZJ A;  3SUN A;  1HYS A;  1HQU A;  1NKE A;  2HW3 A;  4BDZ A;  3PX6 A;  2YHB A;  1NK6 A;  4M42 A;  2B5J A;  3LP1 A;  4GMJ B;  3HP9 A;  3F73 A;  3RRH A;  1J53 A;  4OLA A;  3ASM A;  3OY9 A;  4PWD A;  4M41 A;  3NCI A;  2P1J A;  4KRF A;  4RW4 A;  1NK0 A;  4EP4 A;  3ZSX A;  3VQC A;  3LAL A;  3O4Q A;  4GW6 A;  3DLG A;  3QEP A;  3QO9 A;  4CEZ A;  2HHQ A;  1TKX A;  3NHG A;  1VSD A;  3AV9 A;  1KSP A;  2XRI A;  4HCB A;  2RKI A;  4KHN A;  3ZT1 A;  1TVR A;  3VQA A;  3SZ2 A;  1VSH A;  2KFN A;  1VSL A;  3HST B;  5FRO A;  4DG1 A;  1A5W A;  3OJU A;  5J2Q A;  3QNN A;  2QKB A;  4EZ9 A;  4FM2 A;  3OYD A;  2D0B A;  3KIO A;  4CIE A;  2FBX A;  4FM0 A;  4FJM A;  3HO1 A;  2FBV A;  2OPR A;  2IAJ A;  2OPP A;  3KD5 E;  1NK5 A;  3DLK A;  1XC9 A;  2X6S A;  4M3Y A;  2G8W A;  1NK9 A;  1XHX A;  1KFS A;  2VWK A;  1ZBI A;  1RTJ A;  1UWB A;  5J2N A;  1Q9Y A;  4AIL C;  1W9H A;  2NUB A;  2WON A;  3NDK A;  4FW2 A;  4DU1 A;  3PX4 A;  1ASV A;  3K5O A;  1B9D A;  2O4G A;  4BAC A;  2ITG A;  3G10 A;  3LDS A;  4FCY A;  5HLF A;  2P51 A;  1CXU A;  2VWJ A;  2Y1J A;  2ZE2 A;  3QET A;  3RMB A;  3L2R A;  1ZBL A;  3OYJ A;  2QXF A;  4HVJ A;  1QSY A;  2G8K A;  4FK0 A;  3D45 A;  4HUE A;  3HVT A;  4DQP A;  1HYZ A;  3DRS A;  2Y1I A;  4FJX A;  4BWM A;  3NH1 A;  4FVM A;  4IG0 A;  3KJV A;  1HPZ A;  1WSF A;  3I8D A;  3ZSQ A;  1EKE A;  3KD1 E;  4KI6 A;  3DLE A;  3H08 A;  2Z1I A;  4CJ5 A;  4FLV A;  3SI6 A;  4DSL A;  3K2P A;  2DFH A;  4KFB A;  1LW2 A;  3S3M A;  1D5A A;  2Z1H A;  1S1X A;  3AVK A;  3M8P A;  4H8K A;  3U6F A;  4BWJ A;  3MXJ A;  4QAG A;  3V9U A;  1X1P A;  4NCG A;  4B08 A;  4EP5 A;  4DTU A;  4FJI A;  1TKZ A;  3RMA A;  4JS5 A;  4CHO A;  3CFP A;  1VSM A;  4FJ8 A;  3OYA A;  1FKO A;  2IC3 A;  4KTZ A;  4FZY A;  3CM6 A;  3TAR A;  3DI6 A;  3DOK A;  4IG3 A;  1C0T A;  2IGI A;  3RRG A;  1ZBH A;  3T19 A;  2DTU A;  2ZQB A;  1REV A;  4CJW A;  2PY5 A;  4BDY A;  1RT2 A;  1L3T A;  3QEI A;  3HPG A;  3PO5 A;  4AHT A;  2O4I A;  3OJS A;  3CFR A;  4DFP A;  3VA3 A;  4B9V A;  2A1S A;  2F96 A;  1D9F A;  1BIS A;  1WSJ A;  1TK0 A;  4M3X A;  1S6Q A;  4DLE A;  5E41 A;  4ID5 A;  4I7F A;  1EP4 A;  4CE9 A;  4CHQ A;  1I3A A;  2VG6 A;  3U3Y A;  3ZSW A;  4ZTF A;  5DK5 A;  1RT7 A;  4MFB A;  2ETJ A;  1JLC A;  4DTM A;  3QER A;  2XO7 A;  1L3V A;  4M3W A;  3NFA A;  1U47 A;  3DRP A;  3LPT A;  3V9X A;  4FK4 A;  4F3T A;  1JLG A;  5K14 A;  4DSF A;  2RF2 A;  1EET A;  3AO5 A;  4LD0 A;  3SYZ A;  1C0U A;  5C24 A;  2YNG A;  5KGW A;  2GV9 A;  4DQS A;  3OYM A;  2FBT A;  4C8O A;  4DS5 A;  3TI0 A;  4FXD A;  3DRR A;  4Z4F A;  1QS4 A;  4DQI A;  3DYA A;  4CJP A;  1S9G A;  4TSX A;  4CGI A;  2YNF A;  2HHW A;  4I9Q A;  4AH9 A;  4CK3 A;  5KGX A;  1NJY A;  3VQD A;  4E89 A;  2XY6 A;  5HRN A;  1U48 A;  1YTU A;  5J2P A;  3IG1 A;  2E6L A;  4B9N A;  4OKK A;  4EZ6 A;  3CYM A;  4F2S A;  4AHC A;  1TL3 A;  4B9S A;  5HBM A;  3TAQ A;  1QSL A;  1A5V A;  5CYM A;  3HK2 A;  5EU7 A;  4CEB A;  4E1M A;  4Z4I A;  1IKY A;  4JLH A;  4KHQ A;  4N47 A;  4E19 A;  2YKN A;  5CYQ A;  3V1O A;  4DF8 A;  1TK8 A;  4W5T A;  3AA4 A;  3C95 A;  3O3G A;  3NE6 A;  2G8H A;  1S1V A;  3ISN C;  3PY8 A;  4LY7 A;  3KLI A;  3LP0 A;  1JL2 A;  4G1Q A;  2X74 A;  4FLY A;  3NH0 A;  4PA1 A;  1KVA A;  4UQG A;  1NJW A;  3QIO A;  4ELU A;  2FBY A;  3WNH A;  3CG7 A;  3VQ9 A;  4CF2 A;  1Q9X A;  1BQM A;  3P5J A;  4M3R A;  3NGI A;  4E3S A;  1QSS A;  4PQU A;  1SKW A;  1NKC A;  2VG5 A;  1MU2 A;  4C8K A;  4CJU A;  4B9U A;  4DTX A;  2EHG A;  3L2W A;  2OYQ A;  4BDP A;  3V6D A;  2HHV A;  4B9L A;  4J2A A;  1FKP A;  1RDD A;  5KRS A;  4C8M A;  1S9E A;  3WNE A;  1F21 A;  4NYN A;  4OGC A;  4JRQ A;  1JLF A;  3WNF A;  1IG9 A;  4F8R A;  4DTP A;  4OJR A;  3M8R A;  3TAN A;  3SV3 A;  4FJJ A;  4B9T A;  4HCC A;  3KLF A;  1VSK A;  4CGG A;  3DLH A;  1WSG A;  3OVN A;  4FJH A;  4Q5V A;  2G8I A;  1VK0 A;  4FW1 A;  4NYF A;  3MED A;  1LWE A;  4JS4 A;  1KRP A;  1ASU A;  1WAF A;  2YKM A;  2R7Y A;  3DM2 A;  1J9A A;  3ZSR A;  5HRP A;  2JLE A;  1NOZ A;  5KTQ A;  3L2Q A;  3LWM A;  4DTO A;  2P5O A;  3K5M A;  2AJQ A;  4KTQ A;  3VQ4 A;  4DSE A;  1B9F A;  1WNS A;  3ZSZ A;  1B92 A;  3LWL A;  1RTH A;  2X6N A;  2KTQ A;  3PV8 A;  4CGD A;  2P5G A;  3JSM A;  4Y1C A;  1D8Y A;  2JGU A;  4DMN A;  1KTQ A;  5FDL A;  3OS1 A;  3L2U A;  3HP6 A;  2A1R A;  4B8A B;  1ZBF A;  3OYN A;  1SUQ A;  3DLR A;  4CJ4 A;  1RTD A;  2DY4 A;  1CZB A;  1XI1 A;  1KFD A;  1G15 A;  4CER A;  3JYT A;  3P83 D;  4BE1 A;  4CIG A;  3AVB A;  4YNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...