1RDAA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTNGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdaA00
1UWBA 5EU7A 4C8NA 2EHGA 4HVJA 3NDKA 3U3YA 2DY4A 1JKHA 3ZT1A 2B6AA 3NF8A 4Y1CA 1VSKA 4CEEA 4CJ4A 4Z4IA 4OKKA 1YTUA 1T03A 3NBPA 3TAMA 4DSJA 2F8TA 1U48A 1WLJA 3KD1E 4CJUA 1UA0A 3LPTA 1ZBIA 1S1UA 4CJLA 2I5JA 1NKEA 4F3OA 4NCBA 2HHWA 3M8PA 4DS4A 3OYKA 4CK2A 2D5RA 4E19A 5I3UA 4ELVA 4FJIA 3VA3A 5DMRA 3ZT0A 5HRNA 3K5MA 3QEXA 1DTTA 2HNDA 2G8WA 5KGWA 3MAQA 4QCLA 2O4GA 3V1QA 1LWCA 1RT7A 1TL1A 4PUOA 3NAEA 1RBTA 3WNHA 3NFAA 1KSPA 1ZYQA 2RN2A 1C0UA 2YNGA 4IFYA 3M8RA 3AVHA 3KLFA 2VWJA 5J2MA 4B9SA 2KTQA 3AVMA 5CYQA 1NK6A 2BANA 4DQQA 4N47A 3OY9A 1HYZA 1L3UA 3ITHA 4IG3A 3ZSOA 4YFUA 1RTDA 1J54A 3V4IA 1WSGA 4LD0A 4CF1A 2RKIA 4DQIA 4HCBA 4E7KA 1C0TA 1S1VA 4OLBA 1REVA 1VSLA 1HNIA 4OKEA 3VQ9A 4DS5A 3QLHA 1L5UA 1RCHA 2HVIA 4AHCA 4DSIA 1TL3A 4DF4A 1EP4A 4FZYA 3HK2A 3HSTB 4N56A 4DSEA 4BE1A 4Q0BA 3SV4A 1TKTA 1RT2A 4CEQA 5J2PA 4KB1A 4OGEA 4RW9A 4M3TA 5D3GA 5C24A 2Z1JA 4CHPA 4HHTA 4HUFA 3QEVA 1QSLA 2OZMA 2ATQA 1JL1A 2A1SA 4DFJA 3V9XA 4CGJA 4CEDA 1RT6A 1WSJA 1QSSA 1VSJA 4FM2A 2OPRA 4AH9A 2D0AA 5CZ1A 4CHOA 1TKDA 1W0HA 3IAYA 3SUPA 1KVCA 3SJJA 3HM9A 3KLIA 1U47A 4B9MA 3HVTA 1EETA 3PV8A 4O5BA 1HJRA 3KIOA 5FDLA 4AILC 2IOCA 4QOZB 1HNVA 3D0PA 4C8OA 3OYAA 2YNIA 3LP3A 1X1PA 4CERA 2D0BA 3OYMA 4BWJA 4DTOA 3OJSA 3PX6A 4O44A 2PZSA 4BDZA 4Z4EA 4LY7A 3OS0A 4FLTA 3SUQA 3OVNA 3V9UA 1LWEA 3S9HA 4FJNA 4C8KA 1B9DA 2HHXA 4CF8A 2FBTA 4CHZA 4CFCA 4R5PA 3IRXA 4JRQA 1CZ9A 3IG1A 3TAPA 1T8EA 2X6SA 3RMDA 1HPZA 3QEPA 4FZXC 3NGIA 3AA2A 4DQRA 2KFZA 1EKEA 1KLNA 2Q3SA 1BQNA 3MEGA 2YNFA 1BCOA 1IKWA 1SL0A 3PY8A 2YHBA 4CJFA 1HRHA 4J2EA 2HVHA 3KK3A 2IDOA 3VQDA 4I9LA 1JLEA 1WSHA 3V1OA 4BE2A 2HHTA 1A5VA 4FK0A 4TSXA 4E7JA 4B9UA 4KI6A 2FC0A 2VG7A 3QESA 4DFMA 5DK5A 4FJ8A 3TAEA 1NKCA 3NF7A 3AO1A 1L3TA 2YHAA 3T3FA 2FBYA 3K5NA 3G10A 4FJHA 2PYLA 4F2SA 4NYFA 4CJTA 3C94A 3A2FA 4EZ6A 5HROA 1VSDA 2DFEA 4GW6A 4LH5A 3WNGA 1EXQA 4DU1A 1SL1A 4DSLA 3L2UA 4M41A 3ZT4A 3EYZA 3NE6A 3S3OA 3OS2A 1GOAA 1S6QA 2ZD1A 4M45A 2HMIA 1NK7A 1IH7A 2NUBA 4OPKA 1NJXA 4CCHA 4KPYA 4L8RB 1Y97A 3SV3A 3OYHA 4IG0A 2E6MA 4Z4CA 1C1CA 3KLEA 1D9FA 3BDPA 3LZIA 1T7PA 2P1JA 3OYDA 4KB0A 3AVFA 3SUNA 1ZBHA 4KI4A 4CJKA 4ZTFA 2ZQBA 4XIUA 1RNHA 1Z25A 4E7HA 2Y1JA 4AHUA 3UIQA 1WNSA 4CGDA 1RTHA 1RT1A 1T05A 3I0SA 1IKXA 4NCGA 3TARA 1NOYA 3OYFA 4DTXA 1VRUA 1B92A 2LSNA 3ISNC 3T1AA 4CEFA 3EY1A 3RMAA 3SPYA 4DQPA 3QIOA 1YVUA 1JLGA 1RDDA 3K5OA 4LSNA 3CFRA 4B9NA 1XC9A 3AO5A 1S1WA 4CECA 3AVIA 4FLYA 5FRMA 4KREA 4DSFA 2XRIA 3L2RA 2RF2A 4CEZA 4N76A 4FYDA 3DLRA 1LAWA 3AO3A 4O0JA 4DQSA 3DLHA 2YNHA 3SZ2A 2P5GA 5KRTA 4B9TA 5KGXA 4H4OA 3OJUA 4M3UA 1A5XA 2R7YA 1Q9XA 3F73A 4BDPA 4Z0UA 4CF0A 5I42A 2HHQA 4FLVA 1UAXA 3MEDA 3P83D 1RBRA 4CJ5A 2G8VA 3SCXA 4C8LA 3L3UA 4OVLA 3BGRA 1RT3A 2DFFA 1SKRA 2G8FA 3DLGA 1FKOA 2OA8A 3C6UA 2VG6A 3THVA 1FKPA 2YKMA 1Z26A 1NK9A 4IBNA 3I8DA 1RDAA 4CK3A 3TAFA 1SL2A 1RTIA 4OKJA 3OYEA 4OPJA 3QETA 2QKKA 2HHSA 2KFNA 4E7IA 1LV5A 3OS1A 3ASMA 3ZCMA 2ZE2A 3SQ4A 4H4MA 1L3VA 5HBMA 4K8XA 4DFKA 3PX0A 1KLMA 2A1RA 2IAJA 1TAQA 4AHSA 3O3FA 4KHUA 3L3VA 3ULDA 2DTUA 1TKXA 3ZT3A 4EP5A 1IKVA 2JLEA 3KKSA 1S5JA 3RWUA 2XHBA 3FFIA 4LH4A 2PYJA 4KHQA 4W5NA 3OYGA 3LAKA 3PO5A 3ZSYA 4FJKA 5J1EA 4I7FA 4QAGA 1DLOA 5HP1A 2KZZA 2Z1HA 4F8RA 2JGUA 1WSEA 4KO0A 2X74A 1ASUA 2GV9A 1VSIA 1I3AA 1F21A 1CXUA 1W9HA 4AHRA 4DF8A 3DLKA 1S9EA 1WAFA 3SI6A 2E4LA 2Z1GA 1HYSA 3AA4A 4C8MA 3V9ZA 4RW6A 2WOMA 4W5QA 2EX3A 2YKNA 3OYLA 4BE0A 1X9WA 4EP4A 2HHVA 4M3ZA 3O3HA 1IKYA 1S6PA 3DOKA 4CFBA 4W5OA 3PUFA 2Y1IA 1LAVA 3HPGA 1MU2A 3LPUA 1VSFA 3QIPA 4FJXA 4E0DA 3RRHA 4KTWA 1ASWA 4DU4A 3LAMA 3PO4A 3CYMA 3K58A 4CJRA 4HUEA 3CQ8A 2BGGA 1B9FA 3NH2A 1RBSA 2Z1IA 3AVLA 4M3XA 1Q8IA 5KI6A 2B4JA 1LWFA 1EX4A 2W42A 3EZ5A 1IG9A 3C6TA 3LANA 4I2PA 3MEEA 1SKSA 2IS3A 4FM1A 4FJ5A 4KTZA 1N6QA 5J2QA 2XY6A 4CJSA 3TI0A 4IKFA 3VQCA 3S3NA 4RW7A 5CZ2A 4FJMA 1JXBA 4FLXA 1BISA 1XWLA 4FLWA 4ICLA 4DTRA 4E7LA 1FXXA 2YV0X 3HP9A 3VN5A 2E6LA 1SV5A 4FXDA 1YT3A 3M8QA 5FRNA 5HRSA 4OLAA 4CJVA 3OYCA 4O4GA 4F2RA 2G8IA 3M8SA 3KLGA 3MXMA 3RRGA 4K8ZA 3SQ2A 3K59A 4E1NA 4HCCA 4ZHRA 3VQAA 3I0RA 1VK0A 4CE9A 3NF9A 3TWHA 1U45A 2OYQA 3OYBA 1QSYA 1VSMA 2HB5A 3LWMA 1KFDA 3LP0A 3DM2A 3H08A 3VQEA 4CEAA 4RW8A 3AO4A 3DOLA 4CK1A 1C0MA 4LSLA 4E89A 4N5SA 2GUIA 3NCIA 1NK0A 2AJQA 3C95A 1LW0A 2HNYA 3AA5X 4M3RA 1XHXA 4F3TA 4DTJA 1NJZA 4KHWA 5E41A 3NHGA 2X78A 1VSHA 4RG8A 1NK8A 3TR8A 1D9DA 1KFSA 3AVNA 4Z4HA 3KD5E 4Z4GA 1BGXT 1S1TA 3AVKA 1VRTA 1BIZA 4FM0A 2P51A 1KTQA 4HUGA 4MQ3A 3VQ5A 4DTNA 1N5YA 5T7BA 4B9LA 4DU3A 1WSFA 4NYNA 1TGOA 4CF2A 3CFOA 1RILA 2IGIA 3QINA 4ID5A 1BI4A 3KLHA 2PY5A 4UQGA 1I39A 4PA1A 3NH1A 4CHYA 3RTVA 4I2QA 4DTMA 4J2DA 4PWDA 1K6YA 1YTAA 4FLUA 4DMNA 1NJYA 3O3GA 3O4QA 3CM5A 3SUOA 3HT3A 3WNFA 1R0AA 3AVAA 3ALYA 4KFBA 3SYZA 4DFPA 1TVRA 1WSIA 5C25A 4CIFA 3HXMA 4KTQA 3U6FA 3AO2A 1WAJA 4E3SA 1BHLA 3TAGA 3SNNA 3QO9A 4BDYA 1J5OA 2O4IA 3VA0A 5K14A 4KAZA 3NGYA 5HLFA 3V9WA 2BDPA 3V6DA 2ITGA 3HPOA 1KVBA 4B08A 1TK5A 1TAUA 4CGGA 4CJPA 3KK1A 3JSMA 1RTJA 3TABA 3DLBA 2WONA 1VSEA 1A5WA 1UOCA 5CY4A 4CGFA 3VQ6A 1BI4B 4JRPA 1ZBLA 1ZBUA 4G1QA 3HP6A 3DI6A 3ZT2A 3QNOA 3WNEA 3ZSZA 3SQ0A 3TANA 3VQ4A 1S1XA 1C1BA 3RR7A 1D5AA 4B9VA 1TK0A 1QS4A 4FVMA 1QHTA 3L8BA 2HHUA 1NJWA 3AVJA 4BACA 3HJFA 4FW1A 2OPPA 4OJRA 4FZZA 2D0CA 4H8KA 4PY5A 4O55A 4AHVA 3MXJA 2QXFA 4AHTA 3AA3A 3LALA 4BWMA 2OPSA 3E01A 3MECA 4I9QA 3F9KA 1JLFA 1TKZA 4GVMA 3VQQA 1HMVA 2FBVA 4FCYA 3SPZA 5CYMA 3CFPA 3HO1A 3DYAA 4GMJB 4JLHA 4MFBA 4DTPA 3HPHA 4OGCA 3OYNA 3AVGA 3CM6A 3ZSRA 4ID1A 1BL3A 1DTQA 1S9GA 3L2VA 3NF6A 4KKOA 1X9SA 5C42A 3ZSXA 4HTUA 3VQBA 4N41A 1QQCA 4CHQA 3DRSA 4DSKA 2BE2A 4FK2A 4CIGA 5HRPA 3QEWA 3L2WA 3IS9A 1X9MA 1ASVA 1RBUA 4IDKA 3KTQA 1NOZA 4J2BA 3DRRA 4B8AB 3T19A 4B3OA 1IO2A 2B5JA 4YNQA 4KRFA 4KHSA 1BCMA 2X6NA 3PX4A 3VQ8A 4W5TA 4ZTJA 1C1AA 1JLBA 1JLCA 1WN7A 1LW2A 2XY7A 3U3GA 1GOBA 3K5LA 1O1WA 3B6PA 3QNNA 2QKBA 1HQEA 4DTUA 2XY8A 4E1MA 1L3SA 4FJLA 2XY5A 4IFVA 3B6OA 4WE1A 4CHNA 1C6VA 2XO7A 4FJGA 5SWMA 4DLGA 5JS2A 1GOCA 4DTSA 3LDSA 4ELUA 3S3MA 1SKWA 2P5OA 4CJWA 2G8UA 1G15A 3ZSQA 4NCAA 2GBZA 1TV6A 4CFAA 3HVRA 1KVAA 4M3WA 3RMBA 1FK9A 1TK8A 3K2PA 3ZSWA 4ELTA 4CF9A 3V81A 2RPIA 3HYFA 3V1RA 4CJQA 3TAQA 4M3YA 1KRPA 2HW3A 2QK9A 2FBXA 1SUQA 4CGHA 5SZTA 4FJ7A 3P1GA 5J2NA 3O4NA 5FROA 4B8CA 4W5RA 1U4BA 3VQPA 3G0ZA 1JL2A 1HYVA 4CESA 1QE1A 4CFDA 5KTQA 3AVBA 4KHYA 1ZBFA 1HQUA 1JXEA 3ZSVA 4CEOA 1UA1A 4DG1A 4CGIA 3AV9A 2G8KA 4EZ9A 3DMJA 3KK2A 1D8YA 2OZSA 3JYTA 4JS5A 1RT4A 4FJ9A 1BQMA 3DLEA 3KJVA 4PQUA 2OPQA 3QEIA 3OYJA 3L2QA 3MXIA 1BIUA 3QERA 1CZBA 1XHZA 4KHNA 4M42A 1Q9YA 1J53A 3LP2A 5KRSA 4F4KA 5JS1A 3RMCA 1RDBA 1CLQA 2KZMA 1CXQA 3NGZA 4FLZA 3NH0A 4KV8A 3LWLA 2IC3A 3RR8A 4CIEA 1RDCA 3LP1A 4J2AA 3AVCA 1KCFA 4RW4A 2KQ2A 3VQ7A 3DRPA 4CJ3A 3LZJA 4JS4A 3V9SA 4DWIA 2KW4A 2HNZA 2ETJA 3D45A 1U04A 4CEBA 2DFHA 1RBVA 3KKRA 4O0IA 3OYIA 4DLEA 3SQ1A 2VG5A 4FW2A 1XI1A 4Y1DA 1NKBA 1QTMA 2VWKA 1NK4A 2F96A 4Q5VA 3P5JA 4Z4FA 4FJJA 1NK5A 3HL8A 1ITGA 3K57A 1J9AA 1RT5A 2F8SA 1JLQA 4FK4A 5HRRA 2G8HA 3CG7A 1U49A 4CJEA 1JLAA
chains in the Genus database with same CATH superfamily
3CPEA 4WFBL 3D2FB 1NGCA 2EHGA 3L0QA 4DR6K 5AR0A 3T69A 4PKHA 4CZEA 3NF8A 4CEEA 3NMUA 4BG9A 3CCJN 2GEMA 1T03A 2F8TA 2QXLA 4CZKA 2I5JA 4XH5A 4F3OA 2HHWA 1E3MA 4E19A 4A2AA 3VA3A 3QEXA 3ENOA 5KGWA 2A6AA 1TL1A 2CGJA 5AQYA 2RN2A 2VWJA 4B9SA 5CYQA 1NJIO 3J81O 4DQQA 1KD1O 1L3UA 3ITHA 4YFUA 3ZSOA 4B1WB 3V4IA 4LD0A 4DQIA 2WC9A 4OLBA 2J4RA 4OKEA 4DS5A 3QLHA 1L5UA 3KWIA 2P9NA 3HK2A 1W97L 4YOUA 4N56A 3SV4A 3FGUA 4YOVA 1JL1A 2P9KA 4CGJA 1WSJA 1QSSA 5CZ1A 1TKDA 3SJJA 1EETA 3PV8A 5FDLA 3OYAA 1RDWX 2YNIA 3OYMA 4DTOA 2HHHK 1S3XA 1EO1A 4LY7A 4FJNA 3ENBA 3OVNA 1C0GA 1LWEA 3HZ6A 4C8KA 1B9DA 3ZETA 1BA1A 4O8KA 1QQNA 2FBTA 3O9SA 1KXPA 1T8EA 2X6SA 1YJ9N 1Q82O 3NGIA 4DQRA 2GX9A 4X66K 1BQNA 3J80O 4CZLA 4I9LA 1WSHA 2HHTA 1A5VA 2ZM6K 4TSXA 3VPZA 2VG7A 4B9QA 4BROA 3U9ZA 1VHXA 4DV0K 2V7ZA 3G71N 2YHAA 3DXMB 4CBUA 4AM6A 4IEEA 4FJHA 4KH5A 4F2SA 4NYFA 1VQLN 4GV3A 4CJTA 5H1SQ 3A2FA 4EZ6A 4GW6A 1EXQA 1EWQA 4JK7A 3L2UA 3WQUA 3S3OA 2YHWA 1GLJO 5AQFA 1NK7A 3ZYYX 2VQEK 2NUBA 4CCHA 1NJXA 4KPYA 1Y97A 1N33K 5BRDA 1C1CA 3BDPA 3OW2M 2P1JA 4BR0A 4KB0A 3LL3A 4RCHA 3BY5A 3E9LA 3W0LA 3QBXA 4JD2A 3EEQA 4OX9K 1LCUA 1HNZK 1NOYA 3T1AA 4B1YB 3CJ9A 4A61A 3QIOA 1YVUA 3TU5A 4LSNA 1X3NA 2D0PA 1S1WA 1QVGM 2A5XA 2E2OA 5M1FA 4FLYA 5FRMA 1NMNA 5AZJB 4CEZA 1Q7YO 1YJWN 3N4PA 3AO3A 4JHDB 4DQSA 3WT0A 3CMEN 3ZX2A 3BP8A 4M3UA 4BDPA 4Z0UA 4CF0A 4YDUA 5AQMA 1HKBA 3L3UA 3BGRA 3D2EB 1RT3A 4JKBA 3C6UA 4BVPA 4X64K 2HHSA 1XC3A 1K8KB 4E7IA 1VQON 4FL9A 3GL1A 3ZCMA 5HBMA 2WBNA 2OTLN 5BREA 2DTUA 1IKVA 2JLEA 3RWUA 4KHQA 2XHBA 3FFIA 4LH4A 3LAKA 4FJKA 4IOXA 1DLOA 1WSEA 1VSIA 3DLKA 3SI6A 4B3SK 2E4LA 1HYSA 3QFPA 3VGKA 3TSPA 5I9EB 5C0YA 1JCEA 2WOMA 1DKGD 2YKNA 2UXBK 4JK9A 2I7NA 4BRGA 1S6PA 4W5OA 3HPGA 4IJAA 4MO4A 5JLFA 4MLEA 4NXMK 4CZFA 3CQ8A 3AVLA 5KI6A 2KHOA 4K41A 4FM1A 2XY6A 3TI0A 3VQCA 5CZ2A 4FJMA 1NGAA 1NWKA 4ISGA 3IUCA 1FXXA 1SV5A 1VQ9N 1OH6A 3UB5A 4CJVA 3VTIA 3OYCA 3SLCA 2HBJA 4CJ7A 2W6LA 3KLGA 3RRGA 4K8ZA 1XMQK 3O80A 3LWMA 4OPAA 4BRNA 3VMFB 3DM2A 3KHYA 1MWKA 4RW8A 4WQ4C 3G4SN 1C0MA 3HSCA 1K8AO 1LW0A 3C95A 3AA5X 3SMPA 4K42A 3CJBA 3HOTA 3TR8A 5AQLA 3R1XA 4Z4HA 4Z4GA 1VRTA 4FM0A 2ZF5O 4R79A 4DU3A 3T1YK 1TGOA 1T6DA 3RTVA 4DTMA 5BR8K 4PWDA 1YTAA 4H0VB 3E9PA 3A5LC 1R0AA 3ALYA 4BR2A 1TVRA 3P4IA 3ULEA 3VERA 1GLEG 3AO2A 3ULEB 3VTHA 4H5NA 4IDHA 3VGMA 2QWNA 1TAUA 2Q97A 3PIOL 3JSMA 3TABA 2NRWA 4BREA 4NB4A 4PL8A 4JI8K 2BUPA 4WF9L 2PAVA 3IMXA 4BRIA 2A3ZA 4JRPA 4B1UB 1Z05A 3TTFA 3DI6A 3QNOA 1JCFA 1S1XA 4B9VA 1QHTA 1P8ZA 3VENA 4BACA 3HJFA 4B3RK 1IV0A 4OJRA 2D0CA 4QS7A 3O4WA 3E01A 3IKMA 3UKRA 1YVNA 4GVMA 1HMVA 2FBVA 3ZLJA 4DV6K 1K73O 3CM6A 3O1BA 3ZSXA 4N41A 3MN5A 4DSKA 3KTQA 3FZFA 4DHYA 4J2BA 3DRRA 5AFUA 3T19A 3FE1A 4LF6K 4KRFA 5ADXH 1NGIA 4ZTJA 1JLCA 1WN7A 1LW2A 3U3GA 1OH5A 1GOBA 3K5LA 2QKBA 4IXCA 1L3SA 4FJLA 5FPNA 1X9JA 2E1ZA 1C6VA 2XO7A 4JKEA 1GOCA 4DTSA 2O8EB 4MO5A 2D4WA 2P5OA 4CJWA 1LOTB 1G15A 2E5LK 4O5FA 1KVAA 4M7XA 3AAQA 3QICA 1VQPN 4LFAK 1QVFM 3V81A 2RPIA 3V1RA 4CJQA 3TAQA 3SJHA 1SUQA 2WFBA 3O4NA 4W5RA 3VQPA 2CGKA 1VQMN 1QE1A 3WUHA 4JI4K 3AVBA 1UA1A 4MDAA 3CMAN 3JYTA 4C1NI 4XH4A 4PQUA 3TPQA 4M42A 1K8KA 1OKJA 1CLQA 2KZMA 1CXQA 3NGZA 4FLZA 3LWLA 3FFKB 2UUCK 1R59O 1RDCA 4WFAL 4J2AA 4CJ3A 4RW4A 3V9SA 4FZXC 4BGAA 3I8BA 5EVZA 3OYIA 3KKRA 3KVGA 4Y1DA 1NK4A 3WXIA 3O9RA 3P5JA 4Z4FA 1ITGA 3CJ7A 1U49A 1UWBA 5CR4A 5EU7A 4IOCL 2UYTA 2A41A 3U3YA 3ZT1A 4OKKA 1N36K 2UXDK 1WLJA 3VESA 3LDPA 1UA0A 5E84A 1YAGA 4NCBA 3M8PA 4DS4A 3OYKA 5I3UA 4ELVA 4UY8O 3L4IA 2O4GA 3WXLA 2Q1NA 3V1QA 1LWCA 3NAEA 3CXCM 3A5MC 5J2MA 4IFYA 3AVHA 2KTQA 3M6GA 2BTFA 2BANA 5IT9O 3VF4A 4DV4K 1J54A 3L4QA 3ZX0A 2ZGZA 2P9SB 4CF1A 4AM7A 4E7KA 1C0TA 1S1VA 2FF3B 1VSLA 3DXMA 1HNIA 1ATSA 1E4GT 4IOAL 2HVIA 2D0OA 4AHCA 4DSIA 1EP4A 4Q0BA 5J2PA 1RT2A 2O8EA 4M3TA 4OGEA 4RW9A 4HUFA 3A0IX 3QEVA 1NU0A 5M1KA 3H1VX 3V9XA 1NGBA 2QW9A 1N8RO 4FWSA 5AQVA 5AQQA 1YI2N 4K43A 4WQ5A 1T3VA 3KLIA 3HM9A 3R9PA 1NGFA 1HJRA 3KIOA 1HNVA 2QI2A 5LJWA 1T6CA 4LF9K 4CERA 4NLCA 4BWJA 4A62A 3OJSA 3CCUN 2PZSA 1YHQN 2FF6A 3PLAA 4BDZA 4Z4EA 3M1FA 2RHKA 3OS0A 3S9HA 3V9UA 3CCQN 2HHXA 4CF8A 5GAHP 2E2NA 4CFCA 3CETA 3LDLA 3IG1A 3RMDA 4BRHA 5KPRA 2Q3SA 1SL0A 1BCOA 2YNFA 4CJFA 4H03B 1VQ6N 3VQDA 2P9KB 1WUAA 3GBTA 4FK0A 4JI6K 3EKUA 4O8UA 4B9UA 3VEOA 4KI6A 4DFMA 1NKCA 3AO1A 1QQOA 1L3TA 2FBYA 3K5NA 4FPAA 1HKCA 3H46O 4KH4A 3B8AX 3C94A 5HROA 4CD3A 4DSLA 4BRLA 3OS2A 1GOAA 4FWKA 4M45A 3MX2A 2GUPA 4L8RB 1QQMA 4IG0A 4Z4CA 2E88A 4XIUA 1NM1A 1Z25A 4E7HA 4BGBA 2BH1A 3UIQA 5A2QO 2QWMA 4BRMA 3FZHA 4DTXA 2LSNA 3ISNC 4DQPA 1BOTO 4BVOA 1JLGA 3K5OA 3L6QA 4BC4A 1XC9A 1YIJN 3AO5A 3ATUA 3AVIA 2XRIA 3L2RA 4EIAA 1NGHA 4O0JA 2YNHA 2P5GA 5KRTA 4H4OA 4DR2K 1A5XA 1Q9XA 3NVKA 3F73A 4FWMA 5I42A 2CH5A 4BRCA 1RBRA 5FPEA 4CJ5A 2G8VA 4C8LA 2DFFA 2OA8A 3IDHA 2VG6A 4K25A 3GDQA 4M63C 2GELA 4EHTA 4DB3A 3CCRN 3THWA 3ASMA 3RSEB 3SQ4A 4H4MA 1L3VA 1DT9A 4DFKA 1TAQA 1TKXA 3KKSA 3ATVA 2GWKA 1S5JA 5GIOA 3ZSYA 2ZJRL 2Q2RA 1BU6O 3THXB 5HP1A 4DUZK 2KZZA 4F8RA 4JV5K 4KO0A 5LY3A 1FW6A 3O9TA 3ZEUB 4YY3K 1WAFA 2Z1GA 4DR4K 1KQSM 3V9ZA 2HHVA 2EX3A 3UKUB 3OYLA 4CFBA 4YOXA 3PUFA 1MU2A 3LPUA 3WXMB 1YF5L 1HPMA 4KTWA 1ASWA 3CYMA 2E20A 4CJRA 3C6HA 2CH6A 2JWLA 3G6EN 2BGGA 4M3XA 1RBSA 2O8CA 2B4JA 1LWFA 5HL7L 3EZ5A 1RGIA 4I2PA 1SKSA 4KTZA 5J2QA 3S3NA 2P9IB 2W41A 4FLXA 1XWLA 4FLWA 4E7LA 4FXDA 3HP9A 4FWLA 4X65K 4O4GA 3MK6A 3SQ2A 4JI7K 4H5WA 2Q36A 2I7PA 3I0RA 4CE9A 1SAZA 3D2EA 3IFRA 2Q0RA 4U67L 4YHHK 1VSMA 2HF4A 3OYBA 1QSYA 1NLVA 1BG3A 3H08A 4N5SA 4FZYA 1NGEA 3NCIA 4E89A 1NK0A 3G25A 1YITN 2QWPA 3P38A 4F3TA 4JHDA 3U9DA 1NJZA 5E41A 1ZXOA 3KD5E 1BIZA 1KTQA 3VQ5A 3ID6A 1MWMA 1P90A 4NYNA 4CF2A 3CFOA 2IGIA 5EOYA 4UQGA 1GLAG 1I39A 5FPDA 1V4TA 3CJCA 3MDQA 1K6YA 4FLUA 1NGJA 3O3GA 3CM5A 3WNFA 1J5EK 1WSIA 5C25A 3HXMA 4JKGB 3F9MA 1QHAA 4BG8A 3SNNA 2IVOA 2QEXN 2BDPA 3A8YA 3V6DA 2ITGA 1O13A 4JI2K 5JVHL 4B08A 2QWRA 3HBTA 4CGGA 1RTJA 4BQLA 4BC3A 4HWIA 3WXJA 5CY4A 5F2RA 3CJAA 3HP6A 3TANA 3ZSZA 4CZIA 1C1BA 4FWRA 2HHUA 1NJWA 3AVJA 1YUWA 2IIRA 4FZZA 3DLLL 4H8KA 1VQKN 3DAWA 4GV6A 4AHVA 4AHTA 3AA3A 4BRQA 4DQ8A 1NNEA 1Q81O 4FCYA 3SPZA 4GMJB 3HPHA 4OGCA 3AVGA 1BL3A 1KAZA 3CCVN 4CHQA 3KWGA 3EE9A 3QEWA 2NLXA 3IS9A 1NOZA 3VGLA 3THYB 4CZGA 3CC2N 1TYQB 3AGKA 1SZ2A 2X6NA 3PX4A 2A42A 3VQ8A 1C1AA 1JLBA 2NNWA 3DJCA 3FR0A 2XY5A 4FJGA 5SWMA 4DLGA 2Q31A 5JS2A 2NRTA 1BO5O 3TSQA 4PL7A 3JXUA 4ELUA 3S3MA 2P9NB 5GINA 2G8UA 1N32K 4IO8A 3ZSQA 4CFAA 1TV6A 3OA9A 3WXKA 4BR4A 4YOWA 3BZCA 5F0XA 3K2PA 4JI3K 3ZSWA 2VGNA 4CF9A 3HYFA 3UKUA 3PSFA 4FJ7A 2E2QA 3K0SA 3ZEUA 1TUUA 4CESA 5KTQA 4CEOA 1HQUA 4KHPK 5TKYA 4EZ9A 3R3LA 4CI6A 4LFCK 1RT4A 3KJVA 2OPQA 1H1VA 4HTLA 3L2QA 3I56N 2UU9K 5JS1A 4BRKA 5B8HA 2YJFA 4KV8A 3LP1A 3PSIA 5KPZA 1KCFA 1YXQA 3VQ7A 1VQ4N 2ETJA 2HNZA 4CEBA 1U04A 2DFHA 1XI1A 3TTCA 4FW2A 1NKBA 3MCAB 2F96A 4Q5VA 3EN9A 1NK5A 4BC2A 4BR9A 3CJ1A 4YORA 4QS8A 4FK4A 3P31A 5HOOA 1KC8O 1JLAA 3K9KA 4C8NA 3VEVA 1JKHA 3CC7N 2B6AA 4Z4IA 4Y1CA 1VSKA 4CJ4A 4DR5K 3NBPA 3TAMA 4DSJA 3I55N 4CJUA 4DV3K 1ZBIA 4CJLA 1NKEA 4CZMA 4CK2A 2D5RA 3P39A 3F5TA 4E1JA 4QOZB 5HRNA 3VETA 4QCLA 4IFEA 2PFUA 1RT7A 3MN9A 4A5BA 4PUOA 1RBTA 3WNHA 3VEXA 1ZYQA 1C0UA 3M8RA 3KLFA 3AVMA 4RWTA 3H3OB 3OY9A 4IG3A 1RTDA 3EO3A 1WSGA 1IJJA 4HCBA 4F9OA 5AQZA 3VOVA 5BN8A 4WQ4A 4AF1A 2V7YA 3VQ9A 1RCHA 3I33A 4BE1A 1TKTA 4KB1A 5D3GA 2OZMA 4CHPA 1M1KO 4DFJA 1BA0A 1V4SA 3J7ZO 1RT6A 1VSJA 4WFNL 3HOSA 1ZBSA 2OPRA 4FM2A 2D0AA 3IAYA 1W0HA 3SUPA 1U47A 1DEJA 3AARA 3VEZA 3HVTA 2W6KA 4O5BA 1GLLO 3HI0A 5LMUK 3D0PA 4XEIA 1TYQA 1ESVA 3LP3A 1X1PA 4ISEA 5DM7L 3FZKA 4ILJA 4JKDA 4JKCA 4H0OA 4DR7K 2NZTA 1S22A 4CHZA 3LM9A 2HBMA 1CZ9A 5AJ3K 4JKHA 4Z94A 1RFQA 5KPTA 5AQIA 2ZJPL 2NRHA 3QEPA 5M1NA 2KFZA 3AY9A 3MEGA 4EHUA 1IKWA 3M3ZA 2YHBA 2IDOA 1CZAN 1JLEA 3V1OA 4BQZA 2HBKA 2P9LA 5DK5A 4FJ8A 1U6ZA 1U2VA 4MLHA 3T3FA 3D6RA 5LJVA 2NRZA 4H0TB 2NRRA 3G10A 5E26A 2P9SA 5M1QA 1VSDA 2DFEA 4LH5A 4B1VA 4NXNK 4DU1A 3OBYA 1S6QA 3LDOA 4OPKA 2E6MA 3HTVA 3LZIA 1NBWA 3OYDA 3AVFA 4DR1K 1RNHA 2OTJN 3C7NA 1GLDG 1RT1A 3I0SA 1IKXA 3TARA 2ZGYA 3OYFA 4CEFA 3EY1A 2W40A 3CF5L 3SPYA 4CBWA 1HNXK 1RDDA 3CFRA 4IWVA 3J7AP 3H3NO 4CECA 4DSFA 4LFBK 2RF2A 4FYDA 5DM6L 5EY4A 1LAWA 3DLHA 3SZ2A 4B9TA 3OJUA 5AZIB 1HJOA 4BY9C 4JKAA 3P83D 5MLCQ 3BEXA 5BR9A 1ILYA 5AFUH 1SKRA 2G8FA 1FKOA 3DLGA 3PY8A 1Z26A 4IBNA 3TAFA 4A59A 1S72N 4OKJA 2HOEA 3QETA 2QKKA 4I6MB 2QWOA 4MDBA 2KFNA 2CGLA 3OS1A 2ZE2A 5AQHA 2P9IA 1KLMA 3PX0A 2A1RA 2IAJA 4AHSA 3O3FA 4KHUA 3L3VA 3ULDA 1XNRK 4YOTA 3ZT3A 4DV2K 4W5NA 3OYGA 3PO5A 4B1XB 4QAGA 4JN4A 2Z1HA 1ASUA 2GV9A 4FWQA 1I3AA 1F21A 1CXUA 1W9HA 3CIPA 4AHRA 3UE5A 5F1XA 1S9EA 5ADXA 3AA4A 3EL2A 4RW6A 4W5QA 4C23A 1X9WA 4M3ZA 3O3HA 3DOKA 3R6MA 2Y1IA 1LAVA 2FLOA 3RRHA 3LAMA 3QDKA 3K58A 2FXUA 1RDUA 4HUEA 3C6AA 3NH2A 1Q8IA 4CZJA 2W42A 2HBLA 4BRAA 5C2FA 4FSVA 4FJ5A 1XQSC 2NRXA 1N6QA 4IKFA 4CJSA 3CCMN 4RW7A 1JXBA 3R8EA 1BISA 3RSEA 4ICLA 2YV0X 2E6LA 3M8QA 5GAGP 1BWFO 2GWJA 3M8SA 3K59A 2ZJQL 4HCCA 4ZHRA 3TWHA 1U45A 1GLBG 2HB5A 1VQ7N 1KFDA 4CK1A 4CEAA 4LSLA 3A5NC 3UKRB 4M3RA 4DTJA 4DV7K 3NHGA 1NK8A 1VSHA 4RG8A 5BRHA 1D9DA 5JLHA 2KKZA 3AVNA 1BGXT 3AVKA 1WBBA 1EQYA 4PKGA 2P51A 1N5YA 4MQ3A 4DTNA 3O8MA 4GNIA 5M1OA 2O8FA 3F2KA 4ID5A 4EFHA 1BI4A 3KLHA 4BRDA 3FZMA 4PA1A 3NH1A 4OO1J 1OVQA 4J2DA 2P9PA 1K9MO 1NJYA 3O4QA 4KFBA 5IWAK 3MCPA 4KTQA 2QA4N 1VAZA 4JKFA 5C12A 2YX6A 3HM8A 1WAJA 4E3SA 1BHLA 3SK3A 1J5OA 3QO9A 4BDYA 4DR3K 3VA0A 5K14A 3NGYA 5HLFA 3V9WA 3SMSA 5GIPA 2O8BB 3FLCO 4CJPA 5JICA 3KK1A 2P9PB 4X62K 4CBXA 3AGRA 1VSEA 4ILHA 1A5WA 3VQ6A 1BI4B 3CQYA 1ZBLA 3ZT2A 2HF3A 3VQ4A 3RR7A 1D5AA 1QS4A 4KH6A 5AQUA 2OPPA 3DXKA 3QMLA 5C10A 2QXFA 4BR7A 4U7BA 1HKGA 3BUZB 4I9QA 2YHYA 1E4FT 3LDNA 3WQTA 5CYMA 3T7ZA 4JLHA 3HO1A 1VQ8N 4DTPA 3H6EA 3OYNA 4ID1A 1DTQA 3QBWA 3L2VA 3K9JA 1OH8A 3NF6A 4KKOA 5C42A 4LF5K 1QQCA 4CIGA 1X9MA 1ASVA 1RBUA 3MX5A 4GVEA 4IDKA 3CHWA 5KQDA 3AAPA 2JWKA 4B3OA 5AQJA 1IO2A 3MWPA 2B5JA 1IG8A 4YNQA 4KHSA 1QZ6A 2OCEA 2XY7A 2VQFK 1MA9B 3QNNA 2VGMA 1HQEA 4DTUA 2XY8A 4E1MA 4BR5A 4IFVA 3B6OA 4GY2B 4CHNA 4QS9A 3LDQA 3O08A 3LDSA 4WYBA 1SKWA 1NMDA 2RE2A 1FK9A 2E1YA 1TK8A 1KRPA 2FBXA 5SZTA 3P1GA 1TUYA 1U4BA 4YDUC 2ASOA 4JI0K 4KHYA 3ZSVA 4DG1A 3AV9A 3DMJA 3KK2A 3CCSN 4JS5A 4H5VA 3DLEA 4NLBA 3QEIA 3MXIA 1BIUA 3QERA 1CZBA 4L3QA 1J53A 3U8XA 2AA4A 4B3TK 3RMCA 1RDBA 2IVPA 4I6MA 3NH0A 2IC3A 3RR8A 3PIPL 3BZKA 3C65A 3EZWA 2QTDA 3LZJA 2KQ2A 4KBOA 3VF2A 2Q0UA 3DRPA 3N4QA 4JS4A 4DWIA 2KW4A 2F9TA 3D45A 4O0IA 1RBVA 1QTMA 1MDUB 5AZIA 1J9AA 2F8SA 3OTOK 1JLQA 1IBMK 3EE8A 3KZBA 3CG7A 1J6ZA 2G8HA 4LF7K 3CERA 2A40A 3CPWM 4GKJK 4HVJA 3NDKA 2DY4A 3E66A 1IBLK 5GADP 1YTUA 4LF4K 4LC9B 1U48A 1Q18A 3KD1E 1HNWK 3LPTA 1S1UA 1GLFO 4JK8A 1HX1A 4JD2B 4FJIA 5DMRA 3ZT0A 2G8WA 3K5MA 1DTTA 2HNDA 3MAQA 2V52B 4IEIA 3HRGA 4DKWA 2E8AA 4DCHA 5BPLA 3ENHA 4FWPA 1W7AA 3NFAA 1KSPA 2YNGA 4ISFA 5CHIA 2YJEA 3TTDA 3CD6N 4FVUA 1NK6A 5LL6Z 4N47A 3GOIA 1HYZA 2V51B 3EKSA 4OPHA 2RKIA 1REVA 2AP1A 3MMVA 3O5BA 4CW7B 4BC5A 1ATRA 1TL3A 4DF4A 3HSTB 4DSEA 4CEQA 1IBKK 5C24A 2Z1JA 4HHTA 4WCEL 1QSLA 2ATQA 2A1SA 1YJNN 4CEDA 2VWBA 3MN6A 4AH9A 4CHOA 3FZLA 1KVCA 4B9MA 2KLAA 4AILC 2IOCA 4C8OA 3S41A 3ZETB 2D0BA 1SQKA 3PX6A 4O44A 1G99A 1OVYA 4DV5K 4FLTA 2ASPA 3SUQA 4V19S 2OANA 2VYPA 4R5PA 4H5TA 3IRXA 4K0KK 4JRQA 5AQXA 3TAPA 1HPZA 1C0FA 1KAYA 3AA2A 1EKEA 1KLNA 1JCGA 3E1YA 1HRHA 4RTFD 3DXKB 4J2EA 3KK3A 2HVHA 4BE2A 3ID8A 3J8AA 4E7JA 3SBTA 2WUSA 2FC0A 5AQTA 3QESA 1N34K 4IZ9A 3TAEA 2WTUA 3NF7A 1JJ2M 2PYLA 3SBGA 4A5AA 5KQ8A 3OBWA 3JS6A 2O8BA 3WNGA 5LMNK 1SL1A 3Q7CA 4M41A 3ZT4A 3EYZA 3NE6A 3KK7A 4IO9L 2ZD1A 2UUBK 2UXCK 2HMIA 3VF6A 1IH7A 2GTDA 5AQKA 3SV3A 4JAXA 3OYHA 3KLEA 1D9FA 1T7PA 2QWQA 3SUNA 3SAFA 1ZBHA 4KI4A 4CJKA 1XNQK 4ZTFA 2ZQBA 2EWSA 5AQPA 2Y1JA 2PBDA 4AHUA 1WNSA 4B1ZA 4CGDA 1RTHA 1T05A 3GE1A 4H0XB 4NCGA 4J8FA 1VRUA 1B92A 3RMAA 3GG4A 3M5RA 2O8FB 3SAGA 3O9QA 4B9NA 3SAHA 1W2BM 4KREA 4N76A 3DLRA 3J7YP 4GV9A 5AQOA 1XMOK 5KGXA 3WEEA 2R7YA 5C15A 3CCEN 2HHQA 4FLVA 1UAXA 3MEDA 3SCXA 1I94K 4OVLA 3CCLN 3THVA 1FKPA 2YKMA 1NK9A 1VQNN 3I8DA 1SL2A 1RDAA 4CK3A 4G9ZA 3BF1A 1ATNA 1RTIA 3OYEA 4OPJA 2D1KA 1LV5A 2VCPA 4LF8K 1X3MA 4K8XA 3CQXA 4EP5A 2HSTA 5ELZA 2PYJA 4Y0WA 1NGGA 5J1EA 4I7FA 1DGKN 4FWNA 4FOEA 2JGUA 2X74A 4XH1A 4DF8A 2YHXA 4C8MA 4CD1A 2QM1A 3BF3A 4BE0A 1EWRA 4EP4A 1IKYA 5BRFA 1VSFA 3QIPA 4FJXA 4E0DA 4DU4A 3TSUA 3PO4A 2F7TA 5BPNA 5AQRA 3CC4N 1B9FA 1BUPA 2Z1IA 2P9UB 1IG9A 1EX4A 4JYAK 5JVGL 2F9WA 3C6TA 1Z6RA 3LANA 3MEEA 2IS3A 1Y64A 5TKWA 1QZ5A 4FO0A 4JNEA 5GAEP 4H0PA 3NVMA 4DTRA 3VN5A 3MN7A 1YT3A 3THYA 4YOYA 5FRNA 5HRSA 3VEYA 3O9UA 4OLAA 3VEWA 4F2RA 2G8IA 3MXMA 1NGDA 2IVNA 4FOIA 4E1NA 3MWTA 3VQAA 1VK0A 3NF9A 2OYQA 3LP0A 3VQEA 3AO4A 3DOLA 4JI5K 2GUIA 2AJQA 2HNYA 1XHXA 4KHWA 2X78A 1WOQA 1KFSA 5AZJA 1S1TA 4HUGA 5T7BA 4B9LA 2NRVA 1WSFA 2ITMA 1XUPO 1FJGK 4JEPA 1RILA 4FPBA 4A57A 3QINA 3LM2A 2PY5A 3ZX3A 3A5OC 4CHYA 1ZC6A 2O8DA 5CE3A 4I2QA 3C7NB 2DPNA 3OHRA 2F4VK 4DMNA 3SUOA 1WBDA 3HT3A 3AVAA 5JMVA 3SYZA 4DFPA 4CIFA 3H45C 3U6FA 2ZWHA 3TAGA 2O4IA 4JKGA 5M1PA 4KAZA 3HPOA 1KVBA 1HLUA 1TK5A 4JI1K 5AQNA 3DLBA 2WONA 2O8DB 1UOCA 4CGFA 1U2VB 1OH7A 5FLXO 4AQYK 1WB9A 3QFUA 1ZBUA 4G1QA 2P9LB 4IJNA 3DWLA 3WNEA 3SQ0A 4BRPA 1TK0A 4FVMA 3RVCA 3T1HK 3L8BA 3D7EO 1SS6A 4FW1A 4PY5A 4O55A 3MXJA 3LALA 4BWMA 3MECA 2OPSA 1BDGA 3VQQA 3F9KA 1JLFA 1TKZA 5EXWA 1NG9A 3CFPA 3DYAA 4MFBA 4PHTX 3ZSRA 5EX5A 1S9GA 4ILGB 4WQ5C 1X9SA 4HTUA 3VQBA 4FWOA 3CI5A 3DRSA 2BE2A 4FK2A 5HRPA 3L2WA 4H0YB 4B8AB 3O6WA 5AQWA 4PKIA 2YCHA 2UUAK 1HUXA 1BCMA 1Q86O 2FSKA 4W5TA 3H1QA 1O1WA 3B6PA 5BN9A 1KAXA 2FSNA 3U4LA 4WE1A 3O1WA 4DUYK 3C0BA 4EAHD 2P9UA 2YI1A 3W3DA 2O8CB 1HR0K 3Q7BA 5BPMA 4NCAA 2GBZA 3HVRA 4M3WA 3RMBA 2E2PA 4ELTA 4DV1K 4CVNE 2ASMA 1GLCG 4M3YA 2HW3A 2QK9A 4CGHA 4NO7A 5FPMA 2H3GX 1VQ5N 4H5RA 5J2NA 2HMPA 5FROA 4B8CA 3G0ZA 1JL2A 1HYVA 5C2DA 3THXA 4CFDA 1M90O 1ZBFA 1JXEA 4CGIA 2G8KA 4CZHA 1D8YA 2FSJA 3JAMO 2OZSA 4B3MK 4BRFA 4FJ9A 1BQMA 3OYJA 1XHZA 5AQGA 4KHNA 1T44A 1Q9YA 3LP2A 5KRSA 4F4KA 3THWB 4CIEA 3AVCA 2QWLA 4A2BA 4DLEA 3D2FA 3E9OA 5AQSA 3SQ1A 2VG5A 4C1NK 2VWKA 3QB0A 4GKKK 3WEEB 4FJJA 3HL8A 3K57A 1RT5A 4M7YA 1D4XA 5HRRA 4CJEA
chains in the Genus database with same CATH topology
1UWBA 5EU7A 4C8NA 2EHGA 4HVJA 3NDKA 3U3YA 2DY4A 1JKHA 3ZT1A 2B6AA 3NF8A 4Y1CA 1VSKA 4CEEA 4CJ4A 4Z4IA 4OKKA 1YTUA 1T03A 3NBPA 3TAMA 4DSJA 2F8TA 1U48A 1WLJA 3KD1E 4CJUA 1UA0A 3LPTA 1ZBIA 1S1UA 4CJLA 2I5JA 1NKEA 4F3OA 4NCBA 2HHWA 3M8PA 4DS4A 3OYKA 4CK2A 2D5RA 4E19A 5I3UA 4ELVA 4FJIA 3VA3A 5DMRA 3ZT0A 5HRNA 3K5MA 3QEXA 1DTTA 2HNDA 2G8WA 5KGWA 3MAQA 4QCLA 2O4GA 3V1QA 1LWCA 1RT7A 1TL1A 4PUOA 3NAEA 1RBTA 3WNHA 3NFAA 1KSPA 1ZYQA 2RN2A 1C0UA 2YNGA 4IFYA 3M8RA 3AVHA 3KLFA 2VWJA 5J2MA 4B9SA 2KTQA 3AVMA 5CYQA 1NK6A 2BANA 4DQQA 4N47A 3OY9A 1HYZA 1L3UA 3ITHA 4IG3A 3ZSOA 4YFUA 1RTDA 1J54A 3V4IA 1WSGA 4LD0A 4CF1A 2RKIA 4DQIA 4HCBA 4E7KA 1C0TA 1S1VA 4OLBA 1REVA 1VSLA 1HNIA 4OKEA 3VQ9A 4DS5A 3QLHA 1L5UA 1RCHA 2HVIA 4AHCA 4DSIA 1TL3A 4DF4A 1EP4A 4FZYA 3HK2A 3HSTB 4N56A 4DSEA 4BE1A 4Q0BA 3SV4A 1TKTA 1RT2A 4CEQA 5J2PA 4KB1A 4OGEA 4RW9A 4M3TA 5D3GA 5C24A 2Z1JA 4CHPA 4HHTA 4HUFA 3QEVA 1QSLA 2OZMA 2ATQA 1JL1A 2A1SA 4DFJA 3V9XA 4CGJA 4CEDA 1RT6A 1WSJA 1QSSA 1VSJA 4FM2A 2OPRA 4AH9A 2D0AA 5CZ1A 4CHOA 1TKDA 1W0HA 3IAYA 3SUPA 1KVCA 3SJJA 3HM9A 3KLIA 1U47A 4B9MA 3HVTA 1EETA 3PV8A 4O5BA 1HJRA 3KIOA 5FDLA 4AILC 2IOCA 4QOZB 1HNVA 3D0PA 4C8OA 3OYAA 2YNIA 3LP3A 1X1PA 4CERA 2D0BA 3OYMA 4BWJA 4DTOA 3OJSA 3PX6A 4O44A 2PZSA 4BDZA 4Z4EA 4LY7A 3OS0A 4FLTA 3SUQA 3OVNA 3V9UA 1LWEA 3S9HA 4FJNA 4C8KA 1B9DA 2HHXA 4CF8A 2FBTA 4CHZA 4CFCA 4R5PA 3IRXA 4JRQA 1CZ9A 3IG1A 3TAPA 1T8EA 2X6SA 3RMDA 1HPZA 3QEPA 4FZXC 3NGIA 3AA2A 4DQRA 2KFZA 1EKEA 1KLNA 2Q3SA 1BQNA 3MEGA 2YNFA 1BCOA 1IKWA 1SL0A 3PY8A 2YHBA 4CJFA 1HRHA 4J2EA 2HVHA 3KK3A 2IDOA 3VQDA 4I9LA 1JLEA 1WSHA 3V1OA 4BE2A 2HHTA 1A5VA 4FK0A 4TSXA 4E7JA 4B9UA 4KI6A 2FC0A 2VG7A 3QESA 4DFMA 5DK5A 4FJ8A 3TAEA 1NKCA 3NF7A 3AO1A 1L3TA 2YHAA 3T3FA 2FBYA 3K5NA 3G10A 4FJHA 2PYLA 4F2SA 4NYFA 4CJTA 3C94A 3A2FA 4EZ6A 5HROA 1VSDA 2DFEA 4GW6A 4LH5A 3WNGA 1EXQA 4DU1A 1SL1A 4DSLA 3L2UA 4M41A 3ZT4A 3EYZA 3NE6A 3S3OA 3OS2A 1GOAA 1S6QA 2ZD1A 4M45A 2HMIA 1NK7A 1IH7A 2NUBA 4OPKA 1NJXA 4CCHA 4KPYA 4L8RB 1Y97A 3SV3A 3OYHA 4IG0A 2E6MA 4Z4CA 1C1CA 3KLEA 1D9FA 3BDPA 3LZIA 1T7PA 2P1JA 3OYDA 4KB0A 3AVFA 3SUNA 1ZBHA 4KI4A 4CJKA 4ZTFA 2ZQBA 4XIUA 1RNHA 1Z25A 4E7HA 2Y1JA 4AHUA 3UIQA 1WNSA 4CGDA 1RTHA 1RT1A 1T05A 3I0SA 1IKXA 4NCGA 3TARA 1NOYA 3OYFA 4DTXA 1VRUA 1B92A 2LSNA 3ISNC 3T1AA 4CEFA 3EY1A 3RMAA 3SPYA 4DQPA 3QIOA 1YVUA 1JLGA 1RDDA 3K5OA 4LSNA 3CFRA 4B9NA 1XC9A 3AO5A 1S1WA 4CECA 3AVIA 4FLYA 5FRMA 4KREA 4DSFA 2XRIA 3L2RA 2RF2A 4CEZA 4N76A 4FYDA 3DLRA 1LAWA 3AO3A 4O0JA 4DQSA 3DLHA 2YNHA 3SZ2A 2P5GA 5KRTA 4B9TA 5KGXA 4H4OA 3OJUA 4M3UA 1A5XA 2R7YA 1Q9XA 3F73A 4BDPA 4Z0UA 4CF0A 5I42A 2HHQA 4FLVA 1UAXA 3MEDA 3P83D 1RBRA 4CJ5A 2G8VA 3SCXA 4C8LA 3L3UA 4OVLA 3BGRA 1RT3A 2DFFA 1SKRA 2G8FA 3DLGA 1FKOA 2OA8A 3C6UA 2VG6A 3THVA 1FKPA 2YKMA 1Z26A 1NK9A 4IBNA 3I8DA 1RDAA 4CK3A 3TAFA 1SL2A 1RTIA 4OKJA 3OYEA 4OPJA 3QETA 2QKKA 2HHSA 2KFNA 4E7IA 1LV5A 3OS1A 3ASMA 3ZCMA 2ZE2A 3SQ4A 4H4MA 1L3VA 5HBMA 4K8XA 4DFKA 3PX0A 1KLMA 2A1RA 2IAJA 1TAQA 4AHSA 3O3FA 4KHUA 3L3VA 3ULDA 2DTUA 1TKXA 3ZT3A 4EP5A 1IKVA 2JLEA 3KKSA 1S5JA 3RWUA 2XHBA 3FFIA 4LH4A 2PYJA 4KHQA 4W5NA 3OYGA 3LAKA 3PO5A 3ZSYA 4FJKA 5J1EA 4I7FA 4QAGA 1DLOA 5HP1A 2KZZA 2Z1HA 4F8RA 2JGUA 1WSEA 4KO0A 2X74A 1ASUA 2GV9A 1VSIA 1I3AA 1F21A 1CXUA 1W9HA 4AHRA 4DF8A 3DLKA 1S9EA 1WAFA 3SI6A 2E4LA 2Z1GA 1HYSA 3AA4A 4C8MA 3V9ZA 4RW6A 2WOMA 4W5QA 2EX3A 2YKNA 3OYLA 4BE0A 1X9WA 4EP4A 2HHVA 4M3ZA 3O3HA 1IKYA 1S6PA 3DOKA 4CFBA 4W5OA 3PUFA 2Y1IA 1LAVA 3HPGA 1MU2A 3LPUA 1VSFA 3QIPA 4FJXA 4E0DA 3RRHA 4KTWA 1ASWA 4DU4A 3LAMA 3PO4A 3CYMA 3K58A 4CJRA 4HUEA 3CQ8A 2BGGA 1B9FA 3NH2A 1RBSA 2Z1IA 3AVLA 4M3XA 1Q8IA 5KI6A 2B4JA 1LWFA 1EX4A 2W42A 3EZ5A 1IG9A 3C6TA 3LANA 4I2PA 3MEEA 1SKSA 2IS3A 4FM1A 4FJ5A 4KTZA 1N6QA 5J2QA 2XY6A 4CJSA 3TI0A 4IKFA 3VQCA 3S3NA 4RW7A 5CZ2A 4FJMA 1JXBA 4FLXA 1BISA 1XWLA 4FLWA 4ICLA 4DTRA 4E7LA 1FXXA 2YV0X 3HP9A 3VN5A 2E6LA 1SV5A 4FXDA 1YT3A 3M8QA 5FRNA 5HRSA 4OLAA 4CJVA 3OYCA 4O4GA 4F2RA 2G8IA 3M8SA 3KLGA 3MXMA 3RRGA 4K8ZA 3SQ2A 3K59A 4E1NA 4HCCA 4ZHRA 3VQAA 3I0RA 1VK0A 4CE9A 3NF9A 3TWHA 1U45A 2OYQA 3OYBA 1QSYA 1VSMA 2HB5A 3LWMA 1KFDA 3LP0A 3DM2A 3H08A 3VQEA 4CEAA 4RW8A 3AO4A 3DOLA 4CK1A 1C0MA 4LSLA 4E89A 4N5SA 2GUIA 3NCIA 1NK0A 2AJQA 3C95A 1LW0A 2HNYA 3AA5X 4M3RA 1XHXA 4F3TA 4DTJA 1NJZA 4KHWA 5E41A 3NHGA 2X78A 1VSHA 4RG8A 1NK8A 3TR8A 1D9DA 1KFSA 3AVNA 4Z4HA 3KD5E 4Z4GA 1BGXT 1S1TA 3AVKA 1VRTA 1BIZA 4FM0A 2P51A 1KTQA 4HUGA 4MQ3A 3VQ5A 4DTNA 1N5YA 5T7BA 4B9LA 4DU3A 1WSFA 4NYNA 1TGOA 4CF2A 3CFOA 1RILA 2IGIA 3QINA 4ID5A 1BI4A 3KLHA 2PY5A 4UQGA 1I39A 4PA1A 3NH1A 4CHYA 3RTVA 4I2QA 4DTMA 4J2DA 4PWDA 1K6YA 1YTAA 4FLUA 4DMNA 1NJYA 3O3GA 3O4QA 3CM5A 3SUOA 3HT3A 3WNFA 1R0AA 3AVAA 3ALYA 4KFBA 3SYZA 4DFPA 1TVRA 1WSIA 5C25A 4CIFA 3HXMA 4KTQA 3U6FA 3AO2A 1WAJA 4E3SA 1BHLA 3TAGA 3SNNA 3QO9A 4BDYA 1J5OA 2O4IA 3VA0A 5K14A 4KAZA 3NGYA 5HLFA 3V9WA 2BDPA 3V6DA 2ITGA 3HPOA 1KVBA 4B08A 1TK5A 1TAUA 4CGGA 4CJPA 3KK1A 3JSMA 1RTJA 3TABA 3DLBA 2WONA 1VSEA 1A5WA 1UOCA 5CY4A 4CGFA 3VQ6A 1BI4B 4JRPA 1ZBLA 1ZBUA 4G1QA 3HP6A 3DI6A 3ZT2A 3QNOA 3WNEA 3ZSZA 3SQ0A 3TANA 3VQ4A 1S1XA 1C1BA 3RR7A 1D5AA 4B9VA 1TK0A 1QS4A 4FVMA 1QHTA 3L8BA 2HHUA 1NJWA 3AVJA 4BACA 3HJFA 4FW1A 2OPPA 4OJRA 4FZZA 2D0CA 4H8KA 4PY5A 4O55A 4AHVA 3MXJA 2QXFA 4AHTA 3AA3A 3LALA 4BWMA 2OPSA 3E01A 3MECA 4I9QA 3F9KA 1JLFA 1TKZA 4GVMA 3VQQA 1HMVA 2FBVA 4FCYA 3SPZA 5CYMA 3CFPA 3HO1A 3DYAA 4GMJB 4JLHA 4MFBA 4DTPA 3HPHA 4OGCA 3OYNA 3AVGA 3CM6A 3ZSRA 4ID1A 1BL3A 1DTQA 1S9GA 3L2VA 3NF6A 4KKOA 1X9SA 5C42A 3ZSXA 4HTUA 3VQBA 4N41A 1QQCA 4CHQA 3DRSA 4DSKA 2BE2A 4FK2A 4CIGA 5HRPA 3QEWA 3L2WA 3IS9A 1X9MA 1ASVA 1RBUA 4IDKA 3KTQA 1NOZA 4J2BA 3DRRA 4B8AB 3T19A 4B3OA 1IO2A 2B5JA 4YNQA 4KRFA 4KHSA 1BCMA 2X6NA 3PX4A 3VQ8A 4W5TA 4ZTJA 1C1AA 1JLBA 1JLCA 1WN7A 1LW2A 2XY7A 3U3GA 1GOBA 3K5LA 1O1WA 3B6PA 3QNNA 2QKBA 1HQEA 4DTUA 2XY8A 4E1MA 1L3SA 4FJLA 2XY5A 4IFVA 3B6OA 4WE1A 4CHNA 1C6VA 2XO7A 4FJGA 5SWMA 4DLGA 5JS2A 1GOCA 4DTSA 3LDSA 4ELUA 3S3MA 1SKWA 2P5OA 4CJWA 2G8UA 1G15A 3ZSQA 4NCAA 2GBZA 1TV6A 4CFAA 3HVRA 1KVAA 4M3WA 3RMBA 1FK9A 1TK8A 3K2PA 3ZSWA 4ELTA 4CF9A 3V81A 2RPIA 3HYFA 3V1RA 4CJQA 3TAQA 4M3YA 1KRPA 2HW3A 2QK9A 2FBXA 1SUQA 4CGHA 5SZTA 4FJ7A 3P1GA 5J2NA 3O4NA 5FROA 4B8CA 4W5RA 1U4BA 3VQPA 3G0ZA 1JL2A 1HYVA 4CESA 1QE1A 4CFDA 5KTQA 3AVBA 4KHYA 1ZBFA 1HQUA 1JXEA 3ZSVA 4CEOA 1UA1A 4DG1A 4CGIA 3AV9A 2G8KA 4EZ9A 3DMJA 3KK2A 1D8YA 2OZSA 3JYTA 4JS5A 1RT4A 4FJ9A 1BQMA 3DLEA 3KJVA 4PQUA 2OPQA 3QEIA 3OYJA 3L2QA 3MXIA 1BIUA 3QERA 1CZBA 1XHZA 4KHNA 4M42A 1Q9YA 1J53A 3LP2A 5KRSA 4F4KA 5JS1A 3RMCA 1RDBA 1CLQA 2KZMA 1CXQA 3NGZA 4FLZA 3NH0A 4KV8A 3LWLA 2IC3A 3RR8A 4CIEA 1RDCA 3LP1A 4J2AA 3AVCA 1KCFA 4RW4A 2KQ2A 3VQ7A 3DRPA 4CJ3A 3LZJA 4JS4A 3V9SA 4DWIA 2KW4A 2HNZA 2ETJA 3D45A 1U04A 4CEBA 2DFHA 1RBVA 3KKRA 4O0IA 3OYIA 4DLEA 3SQ1A 2VG5A 4FW2A 1XI1A 4Y1DA 1NKBA 1QTMA 2VWKA 1NK4A 2F96A 4Q5VA 3P5JA 4Z4FA 4FJJA 1NK5A 3HL8A 1ITGA 3K57A 1J9AA 1RT5A 2F8SA 1JLQA 4FK4A 5HRRA 2G8HA 3CG7A 1U49A 4CJEA 1JLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWB A;  5EU7 A;  4C8N A;  2EHG A;  4HVJ A;  3NDK A;  3U3Y A;  2DY4 A;  1JKH A;  3ZT1 A;  2B6A A;  3NF8 A;  4Y1C A;  1VSK A;  4CEE A;  4CJ4 A;  4Z4I A;  4OKK A;  1YTU A;  1T03 A;  3NBP A;  3TAM A;  4DSJ A;  2F8T A;  1U48 A;  1WLJ A;  3KD1 E;  4CJU A;  1UA0 A;  3LPT A;  1ZBI A;  1S1U A;  4CJL A;  2I5J A;  1NKE A;  4F3O A;  4NCB A;  2HHW A;  3M8P A;  4DS4 A;  3OYK A;  4CK2 A;  2D5R A;  4E19 A;  5I3U A;  4ELV A;  4FJI A;  3VA3 A;  5DMR A;  3ZT0 A;  5HRN A;  3K5M A;  3QEX A;  1DTT A;  2HND A;  2G8W A;  5KGW A;  3MAQ A;  4QCL A;  2O4G A;  3V1Q A;  1LWC A;  1RT7 A;  1TL1 A;  4PUO A;  3NAE A;  1RBT A;  3WNH A;  3NFA A;  1KSP A;  1ZYQ A;  2RN2 A;  1C0U A;  2YNG A;  4IFY A;  3M8R A;  3AVH A;  3KLF A;  2VWJ A;  5J2M A;  4B9S A;  2KTQ A;  3AVM A;  5CYQ A;  1NK6 A;  2BAN A;  4DQQ A;  4N47 A;  3OY9 A;  1HYZ A;  1L3U A;  3ITH A;  4IG3 A;  3ZSO A;  4YFU A;  1RTD A;  1J54 A;  3V4I A;  1WSG A;  4LD0 A;  4CF1 A;  2RKI A;  4DQI A;  4HCB A;  4E7K A;  1C0T A;  1S1V A;  4OLB A;  1REV A;  1VSL A;  1HNI A;  4OKE A;  3VQ9 A;  4DS5 A;  3QLH A;  1L5U A;  1RCH A;  2HVI A;  4AHC A;  4DSI A;  1TL3 A;  4DF4 A;  1EP4 A;  4FZY A;  3HK2 A;  3HST B;  4N56 A;  4DSE A;  4BE1 A;  4Q0B A;  3SV4 A;  1TKT A;  1RT2 A;  4CEQ A;  5J2P A;  4KB1 A;  4OGE A;  4RW9 A;  4M3T A;  5D3G A;  5C24 A;  2Z1J A;  4CHP A;  4HHT A;  4HUF A;  3QEV A;  1QSL A;  2OZM A;  2ATQ A;  1JL1 A;  2A1S A;  4DFJ A;  3V9X A;  4CGJ A;  4CED A;  1RT6 A;  1WSJ A;  1QSS A;  1VSJ A;  4FM2 A;  2OPR A;  4AH9 A;  2D0A A;  5CZ1 A;  4CHO A;  1TKD A;  1W0H A;  3IAY A;  3SUP A;  1KVC A;  3SJJ A;  3HM9 A;  3KLI A;  1U47 A;  4B9M A;  3HVT A;  1EET A;  3PV8 A;  4O5B A;  1HJR A;  3KIO A;  5FDL A;  4AIL C;  2IOC A;  4QOZ B;  1HNV A;  3D0P A;  4C8O A;  3OYA A;  2YNI A;  3LP3 A;  1X1P A;  4CER A;  2D0B A;  3OYM A;  4BWJ A;  4DTO A;  3OJS A;  3PX6 A;  4O44 A;  2PZS A;  4BDZ A;  4Z4E A;  4LY7 A;  3OS0 A;  4FLT A;  3SUQ A;  3OVN A;  3V9U A;  1LWE A;  3S9H A;  4FJN A;  4C8K A;  1B9D A;  2HHX A;  4CF8 A;  2FBT A;  4CHZ A;  4CFC A;  4R5P A;  3IRX A;  4JRQ A;  1CZ9 A;  3IG1 A;  3TAP A;  1T8E A;  2X6S A;  3RMD A;  1HPZ A;  3QEP A;  4FZX C;  3NGI A;  3AA2 A;  4DQR A;  2KFZ A;  1EKE A;  1KLN A;  2Q3S A;  1BQN A;  3MEG A;  2YNF A;  1BCO A;  1IKW A;  1SL0 A;  3PY8 A;  2YHB A;  4CJF A;  1HRH A;  4J2E A;  2HVH A;  3KK3 A;  2IDO A;  3VQD A;  4I9L A;  1JLE A;  1WSH A;  3V1O A;  4BE2 A;  2HHT A;  1A5V A;  4FK0 A;  4TSX A;  4E7J A;  4B9U A;  4KI6 A;  2FC0 A;  2VG7 A;  3QES A;  4DFM A;  5DK5 A;  4FJ8 A;  3TAE A;  1NKC A;  3NF7 A;  3AO1 A;  1L3T A;  2YHA A;  3T3F A;  2FBY A;  3K5N A;  3G10 A;  4FJH A;  2PYL A;  4F2S A;  4NYF A;  4CJT A;  3C94 A;  3A2F A;  4EZ6 A;  5HRO A;  1VSD A;  2DFE A;  4GW6 A;  4LH5 A;  3WNG A;  1EXQ A;  4DU1 A;  1SL1 A;  4DSL A;  3L2U A;  4M41 A;  3ZT4 A;  3EYZ A;  3NE6 A;  3S3O A;  3OS2 A;  1GOA A;  1S6Q A;  2ZD1 A;  4M45 A;  2HMI A;  1NK7 A;  1IH7 A;  2NUB A;  4OPK A;  1NJX A;  4CCH A;  4KPY A;  4L8R B;  1Y97 A;  3SV3 A;  3OYH A;  4IG0 A;  2E6M A;  4Z4C A;  1C1C A;  3KLE A;  1D9F A;  3BDP A;  3LZI A;  1T7P A;  2P1J A;  3OYD A;  4KB0 A;  3AVF A;  3SUN A;  1ZBH A;  4KI4 A;  4CJK A;  4ZTF A;  2ZQB A;  4XIU A;  1RNH A;  1Z25 A;  4E7H A;  2Y1J A;  4AHU A;  3UIQ A;  1WNS A;  4CGD A;  1RTH A;  1RT1 A;  1T05 A;  3I0S A;  1IKX A;  4NCG A;  3TAR A;  1NOY A;  3OYF A;  4DTX A;  1VRU A;  1B92 A;  2LSN A;  3ISN C;  3T1A A;  4CEF A;  3EY1 A;  3RMA A;  3SPY A;  4DQP A;  3QIO A;  1YVU A;  1JLG A;  1RDD A;  3K5O A;  4LSN A;  3CFR A;  4B9N A;  1XC9 A;  3AO5 A;  1S1W A;  4CEC A;  3AVI A;  4FLY A;  5FRM A;  4KRE A;  4DSF A;  2XRI A;  3L2R A;  2RF2 A;  4CEZ A;  4N76 A;  4FYD A;  3DLR A;  1LAW A;  3AO3 A;  4O0J A;  4DQS A;  3DLH A;  2YNH A;  3SZ2 A;  2P5G A;  5KRT A;  4B9T A;  5KGX A;  4H4O A;  3OJU A;  4M3U A;  1A5X A;  2R7Y A;  1Q9X A;  3F73 A;  4BDP A;  4Z0U A;  4CF0 A;  5I42 A;  2HHQ A;  4FLV A;  1UAX A;  3MED A;  3P83 D;  1RBR A;  4CJ5 A;  2G8V A;  3SCX A;  4C8L A;  3L3U A;  4OVL A;  3BGR A;  1RT3 A;  2DFF A;  1SKR A;  2G8F A;  3DLG A;  1FKO A;  2OA8 A;  3C6U A;  2VG6 A;  3THV A;  1FKP A;  2YKM A;  1Z26 A;  1NK9 A;  4IBN A;  3I8D A;  1RDA A;  4CK3 A;  3TAF A;  1SL2 A;  1RTI A;  4OKJ A;  3OYE A;  4OPJ A;  3QET A;  2QKK A;  2HHS A;  2KFN A;  4E7I A;  1LV5 A;  3OS1 A;  3ASM A;  3ZCM A;  2ZE2 A;  3SQ4 A;  4H4M A;  1L3V A;  5HBM A;  4K8X A;  4DFK A;  3PX0 A;  1KLM A;  2A1R A;  2IAJ A;  1TAQ A;  4AHS A;  3O3F A;  4KHU A;  3L3V A;  3ULD A;  2DTU A;  1TKX A;  3ZT3 A;  4EP5 A;  1IKV A;  2JLE A;  3KKS A;  1S5J A;  3RWU A;  2XHB A;  3FFI A;  4LH4 A;  2PYJ A;  4KHQ A;  4W5N A;  3OYG A;  3LAK A;  3PO5 A;  3ZSY A;  4FJK A;  5J1E A;  4I7F A;  4QAG A;  1DLO A;  5HP1 A;  2KZZ A;  2Z1H A;  4F8R A;  2JGU A;  1WSE A;  4KO0 A;  2X74 A;  1ASU A;  2GV9 A;  1VSI A;  1I3A A;  1F21 A;  1CXU A;  1W9H A;  4AHR A;  4DF8 A;  3DLK A;  1S9E A;  1WAF A;  3SI6 A;  2E4L A;  2Z1G A;  1HYS A;  3AA4 A;  4C8M A;  3V9Z A;  4RW6 A;  2WOM A;  4W5Q A;  2EX3 A;  2YKN A;  3OYL A;  4BE0 A;  1X9W A;  4EP4 A;  2HHV A;  4M3Z A;  3O3H A;  1IKY A;  1S6P A;  3DOK A;  4CFB A;  4W5O A;  3PUF A;  2Y1I A;  1LAV A;  3HPG A;  1MU2 A;  3LPU A;  1VSF A;  3QIP A;  4FJX A;  4E0D A;  3RRH A;  4KTW A;  1ASW A;  4DU4 A;  3LAM A;  3PO4 A;  3CYM A;  3K58 A;  4CJR A;  4HUE A;  3CQ8 A;  2BGG A;  1B9F A;  3NH2 A;  1RBS A;  2Z1I A;  3AVL A;  4M3X A;  1Q8I A;  5KI6 A;  2B4J A;  1LWF A;  1EX4 A;  2W42 A;  3EZ5 A;  1IG9 A;  3C6T A;  3LAN A;  4I2P A;  3MEE A;  1SKS A;  2IS3 A;  4FM1 A;  4FJ5 A;  4KTZ A;  1N6Q A;  5J2Q A;  2XY6 A;  4CJS A;  3TI0 A;  4IKF A;  3VQC A;  3S3N A;  4RW7 A;  5CZ2 A;  4FJM A;  1JXB A;  4FLX A;  1BIS A;  1XWL A;  4FLW A;  4ICL A;  4DTR A;  4E7L A;  1FXX A;  2YV0 X;  3HP9 A;  3VN5 A;  2E6L A;  1SV5 A;  4FXD A;  1YT3 A;  3M8Q A;  5FRN A;  5HRS A;  4OLA A;  4CJV A;  3OYC A;  4O4G A;  4F2R A;  2G8I A;  3M8S A;  3KLG A;  3MXM A;  3RRG A;  4K8Z A;  3SQ2 A;  3K59 A;  4E1N A;  4HCC A;  4ZHR A;  3VQA A;  3I0R A;  1VK0 A;  4CE9 A;  3NF9 A;  3TWH A;  1U45 A;  2OYQ A;  3OYB A;  1QSY A;  1VSM A;  2HB5 A;  3LWM A;  1KFD A;  3LP0 A;  3DM2 A;  3H08 A;  3VQE A;  4CEA A;  4RW8 A;  3AO4 A;  3DOL A;  4CK1 A;  1C0M A;  4LSL A;  4E89 A;  4N5S A;  2GUI A;  3NCI A;  1NK0 A;  2AJQ A;  3C95 A;  1LW0 A;  2HNY A;  3AA5 X;  4M3R A;  1XHX A;  4F3T A;  4DTJ A;  1NJZ A;  4KHW A;  5E41 A;  3NHG A;  2X78 A;  1VSH A;  4RG8 A;  1NK8 A;  3TR8 A;  1D9D A;  1KFS A;  3AVN A;  4Z4H A;  3KD5 E;  4Z4G A;  1BGX T;  1S1T A;  3AVK A;  1VRT A;  1BIZ A;  4FM0 A;  2P51 A;  1KTQ A;  4HUG A;  4MQ3 A;  3VQ5 A;  4DTN A;  1N5Y A;  5T7B A;  4B9L A;  4DU3 A;  1WSF A;  4NYN A;  1TGO A;  4CF2 A;  3CFO A;  1RIL A;  2IGI A;  3QIN A;  4ID5 A;  1BI4 A;  3KLH A;  2PY5 A;  4UQG A;  1I39 A;  4PA1 A;  3NH1 A;  4CHY A;  3RTV A;  4I2Q A;  4DTM A;  4J2D A;  4PWD A;  1K6Y A;  1YTA A;  4FLU A;  4DMN A;  1NJY A;  3O3G A;  3O4Q A;  3CM5 A;  3SUO A;  3HT3 A;  3WNF A;  1R0A A;  3AVA A;  3ALY A;  4KFB A;  3SYZ A;  4DFP A;  1TVR A;  1WSI A;  5C25 A;  4CIF A;  3HXM A;  4KTQ A;  3U6F A;  3AO2 A;  1WAJ A;  4E3S A;  1BHL A;  3TAG A;  3SNN A;  3QO9 A;  4BDY A;  1J5O A;  2O4I A;  3VA0 A;  5K14 A;  4KAZ A;  3NGY A;  5HLF A;  3V9W A;  2BDP A;  3V6D A;  2ITG A;  3HPO A;  1KVB A;  4B08 A;  1TK5 A;  1TAU A;  4CGG A;  4CJP A;  3KK1 A;  3JSM A;  1RTJ A;  3TAB A;  3DLB A;  2WON A;  1VSE A;  1A5W A;  1UOC A;  5CY4 A;  4CGF A;  3VQ6 A;  1BI4 B;  4JRP A;  1ZBL A;  1ZBU A;  4G1Q A;  3HP6 A;  3DI6 A;  3ZT2 A;  3QNO A;  3WNE A;  3ZSZ A;  3SQ0 A;  3TAN A;  3VQ4 A;  1S1X A;  1C1B A;  3RR7 A;  1D5A A;  4B9V A;  1TK0 A;  1QS4 A;  4FVM A;  1QHT A;  3L8B A;  2HHU A;  1NJW A;  3AVJ A;  4BAC A;  3HJF A;  4FW1 A;  2OPP A;  4OJR A;  4FZZ A;  2D0C A;  4H8K A;  4PY5 A;  4O55 A;  4AHV A;  3MXJ A;  2QXF A;  4AHT A;  3AA3 A;  3LAL A;  4BWM A;  2OPS A;  3E01 A;  3MEC A;  4I9Q A;  3F9K A;  1JLF A;  1TKZ A;  4GVM A;  3VQQ A;  1HMV A;  2FBV A;  4FCY A;  3SPZ A;  5CYM A;  3CFP A;  3HO1 A;  3DYA A;  4GMJ B;  4JLH A;  4MFB A;  4DTP A;  3HPH A;  4OGC A;  3OYN A;  3AVG A;  3CM6 A;  3ZSR A;  4ID1 A;  1BL3 A;  1DTQ A;  1S9G A;  3L2V A;  3NF6 A;  4KKO A;  1X9S A;  5C42 A;  3ZSX A;  4HTU A;  3VQB A;  4N41 A;  1QQC A;  4CHQ A;  3DRS A;  4DSK A;  2BE2 A;  4FK2 A;  4CIG A;  5HRP A;  3QEW A;  3L2W A;  3IS9 A;  1X9M A;  1ASV A;  1RBU A;  4IDK A;  3KTQ A;  1NOZ A;  4J2B A;  3DRR A;  4B8A B;  3T19 A;  4B3O A;  1IO2 A;  2B5J A;  4YNQ A;  4KRF A;  4KHS A;  1BCM A;  2X6N A;  3PX4 A;  3VQ8 A;  4W5T A;  4ZTJ A;  1C1A A;  1JLB A;  1JLC A;  1WN7 A;  1LW2 A;  2XY7 A;  3U3G A;  1GOB A;  3K5L A;  1O1W A;  3B6P A;  3QNN A;  2QKB A;  1HQE A;  4DTU A;  2XY8 A;  4E1M A;  1L3S A;  4FJL A;  2XY5 A;  4IFV A;  3B6O A;  4WE1 A;  4CHN A;  1C6V A;  2XO7 A;  4FJG A;  5SWM A;  4DLG A;  5JS2 A;  1GOC A;  4DTS A;  3LDS A;  4ELU A;  3S3M A;  1SKW A;  2P5O A;  4CJW A;  2G8U A;  1G15 A;  3ZSQ A;  4NCA A;  2GBZ A;  1TV6 A;  4CFA A;  3HVR A;  1KVA A;  4M3W A;  3RMB A;  1FK9 A;  1TK8 A;  3K2P A;  3ZSW A;  4ELT A;  4CF9 A;  3V81 A;  2RPI A;  3HYF A;  3V1R A;  4CJQ A;  3TAQ A;  4M3Y A;  1KRP A;  2HW3 A;  2QK9 A;  2FBX A;  1SUQ A;  4CGH A;  5SZT A;  4FJ7 A;  3P1G A;  5J2N A;  3O4N A;  5FRO A;  4B8C A;  4W5R A;  1U4B A;  3VQP A;  3G0Z A;  1JL2 A;  1HYV A;  4CES A;  1QE1 A;  4CFD A;  5KTQ A;  3AVB A;  4KHY A;  1ZBF A;  1HQU A;  1JXE A;  3ZSV A;  4CEO A;  1UA1 A;  4DG1 A;  4CGI A;  3AV9 A;  2G8K A;  4EZ9 A;  3DMJ A;  3KK2 A;  1D8Y A;  2OZS A;  3JYT A;  4JS5 A;  1RT4 A;  4FJ9 A;  1BQM A;  3DLE A;  3KJV A;  4PQU A;  2OPQ A;  3QEI A;  3OYJ A;  3L2Q A;  3MXI A;  1BIU A;  3QER A;  1CZB A;  1XHZ A;  4KHN A;  4M42 A;  1Q9Y A;  1J53 A;  3LP2 A;  5KRS A;  4F4K A;  5JS1 A;  3RMC A;  1RDB A;  1CLQ A;  2KZM A;  1CXQ A;  3NGZ A;  4FLZ A;  3NH0 A;  4KV8 A;  3LWL A;  2IC3 A;  3RR8 A;  4CIE A;  1RDC A;  3LP1 A;  4J2A A;  3AVC A;  1KCF A;  4RW4 A;  2KQ2 A;  3VQ7 A;  3DRP A;  4CJ3 A;  3LZJ A;  4JS4 A;  3V9S A;  4DWI A;  2KW4 A;  2HNZ A;  2ETJ A;  3D45 A;  1U04 A;  4CEB A;  2DFH A;  1RBV A;  3KKR A;  4O0I A;  3OYI A;  4DLE A;  3SQ1 A;  2VG5 A;  4FW2 A;  1XI1 A;  4Y1D A;  1NKB A;  1QTM A;  2VWK A;  1NK4 A;  2F96 A;  4Q5V A;  3P5J A;  4Z4F A;  4FJJ A;  1NK5 A;  3HL8 A;  1ITG A;  3K57 A;  1J9A A;  1RT5 A;  2F8S A;  1JLQ A;  4FK4 A;  5HRR A;  2G8H A;  3CG7 A;  1U49 A;  4CJE A;  1JLA A; 
#chains in the Genus database with same CATH topology
 3CPE A;  4WFB L;  3D2F B;  1NGC A;  2EHG A;  3L0Q A;  4DR6 K;  5AR0 A;  3T69 A;  4PKH A;  4CZE A;  3NF8 A;  4CEE A;  3NMU A;  4BG9 A;  3CCJ N;  2GEM A;  1T03 A;  2F8T A;  2QXL A;  4CZK A;  2I5J A;  4XH5 A;  4F3O A;  2HHW A;  1E3M A;  4E19 A;  4A2A A;  3VA3 A;  3QEX A;  3ENO A;  5KGW A;  2A6A A;  1TL1 A;  2CGJ A;  5AQY A;  2RN2 A;  2VWJ A;  4B9S A;  5CYQ A;  1NJI O;  3J81 O;  4DQQ A;  1KD1 O;  1L3U A;  3ITH A;  4YFU A;  3ZSO A;  4B1W B;  3V4I A;  4LD0 A;  4DQI A;  2WC9 A;  4OLB A;  2J4R A;  4OKE A;  4DS5 A;  3QLH A;  1L5U A;  3KWI A;  2P9N A;  3HK2 A;  1W97 L;  4YOU A;  4N56 A;  3SV4 A;  3FGU A;  4YOV A;  1JL1 A;  2P9K A;  4CGJ A;  1WSJ A;  1QSS A;  5CZ1 A;  1TKD A;  3SJJ A;  1EET A;  3PV8 A;  5FDL A;  3OYA A;  1RDW X;  2YNI A;  3OYM A;  4DTO A;  2HHH K;  1S3X A;  1EO1 A;  4LY7 A;  4FJN A;  3ENB A;  3OVN A;  1C0G A;  1LWE A;  3HZ6 A;  4C8K A;  1B9D A;  3ZET A;  1BA1 A;  4O8K A;  1QQN A;  2FBT A;  3O9S A;  1KXP A;  1T8E A;  2X6S A;  1YJ9 N;  1Q82 O;  3NGI A;  4DQR A;  2GX9 A;  4X66 K;  1BQN A;  3J80 O;  4CZL A;  4I9L A;  1WSH A;  2HHT A;  1A5V A;  2ZM6 K;  4TSX A;  3VPZ A;  2VG7 A;  4B9Q A;  4BRO A;  3U9Z A;  1VHX A;  4DV0 K;  2V7Z A;  3G71 N;  2YHA A;  3DXM B;  4CBU A;  4AM6 A;  4IEE A;  4FJH A;  4KH5 A;  4F2S A;  4NYF A;  1VQL N;  4GV3 A;  4CJT A;  5H1S Q;  3A2F A;  4EZ6 A;  4GW6 A;  1EXQ A;  1EWQ A;  4JK7 A;  3L2U A;  3WQU A;  3S3O A;  2YHW A;  1GLJ O;  5AQF A;  1NK7 A;  3ZYY X;  2VQE K;  2NUB A;  4CCH A;  1NJX A;  4KPY A;  1Y97 A;  1N33 K;  5BRD A;  1C1C A;  3BDP A;  3OW2 M;  2P1J A;  4BR0 A;  4KB0 A;  3LL3 A;  4RCH A;  3BY5 A;  3E9L A;  3W0L A;  3QBX A;  4JD2 A;  3EEQ A;  4OX9 K;  1LCU A;  1HNZ K;  1NOY A;  3T1A A;  4B1Y B;  3CJ9 A;  4A61 A;  3QIO A;  1YVU A;  3TU5 A;  4LSN A;  1X3N A;  2D0P A;  1S1W A;  1QVG M;  2A5X A;  2E2O A;  5M1F A;  4FLY A;  5FRM A;  1NMN A;  5AZJ B;  4CEZ A;  1Q7Y O;  1YJW N;  3N4P A;  3AO3 A;  4JHD B;  4DQS A;  3WT0 A;  3CME N;  3ZX2 A;  3BP8 A;  4M3U A;  4BDP A;  4Z0U A;  4CF0 A;  4YDU A;  5AQM A;  1HKB A;  3L3U A;  3BGR A;  3D2E B;  1RT3 A;  4JKB A;  3C6U A;  4BVP A;  4X64 K;  2HHS A;  1XC3 A;  1K8K B;  4E7I A;  1VQO N;  4FL9 A;  3GL1 A;  3ZCM A;  5HBM A;  2WBN A;  2OTL N;  5BRE A;  2DTU A;  1IKV A;  2JLE A;  3RWU A;  4KHQ A;  2XHB A;  3FFI A;  4LH4 A;  3LAK A;  4FJK A;  4IOX A;  1DLO A;  1WSE A;  1VSI A;  3DLK A;  3SI6 A;  4B3S K;  2E4L A;  1HYS A;  3QFP A;  3VGK A;  3TSP A;  5I9E B;  5C0Y A;  1JCE A;  2WOM A;  1DKG D;  2YKN A;  2UXB K;  4JK9 A;  2I7N A;  4BRG A;  1S6P A;  4W5O A;  3HPG A;  4IJA A;  4MO4 A;  5JLF A;  4MLE A;  4NXM K;  4CZF A;  3CQ8 A;  3AVL A;  5KI6 A;  2KHO A;  4K41 A;  4FM1 A;  2XY6 A;  3TI0 A;  3VQC A;  5CZ2 A;  4FJM A;  1NGA A;  1NWK A;  4ISG A;  3IUC A;  1FXX A;  1SV5 A;  1VQ9 N;  1OH6 A;  3UB5 A;  4CJV A;  3VTI A;  3OYC A;  3SLC A;  2HBJ A;  4CJ7 A;  2W6L A;  3KLG A;  3RRG A;  4K8Z A;  1XMQ K;  3O80 A;  3LWM A;  4OPA A;  4BRN A;  3VMF B;  3DM2 A;  3KHY A;  1MWK A;  4RW8 A;  4WQ4 C;  3G4S N;  1C0M A;  3HSC A;  1K8A O;  1LW0 A;  3C95 A;  3AA5 X;  3SMP A;  4K42 A;  3CJB A;  3HOT A;  3TR8 A;  5AQL A;  3R1X A;  4Z4H A;  4Z4G A;  1VRT A;  4FM0 A;  2ZF5 O;  4R79 A;  4DU3 A;  3T1Y K;  1TGO A;  1T6D A;  3RTV A;  4DTM A;  5BR8 K;  4PWD A;  1YTA A;  4H0V B;  3E9P A;  3A5L C;  1R0A A;  3ALY A;  4BR2 A;  1TVR A;  3P4I A;  3ULE A;  3VER A;  1GLE G;  3AO2 A;  3ULE B;  3VTH A;  4H5N A;  4IDH A;  3VGM A;  2QWN A;  1TAU A;  2Q97 A;  3PIO L;  3JSM A;  3TAB A;  2NRW A;  4BRE A;  4NB4 A;  4PL8 A;  4JI8 K;  2BUP A;  4WF9 L;  2PAV A;  3IMX A;  4BRI A;  2A3Z A;  4JRP A;  4B1U B;  1Z05 A;  3TTF A;  3DI6 A;  3QNO A;  1JCF A;  1S1X A;  4B9V A;  1QHT A;  1P8Z A;  3VEN A;  4BAC A;  3HJF A;  4B3R K;  1IV0 A;  4OJR A;  2D0C A;  4QS7 A;  3O4W A;  3E01 A;  3IKM A;  3UKR A;  1YVN A;  4GVM A;  1HMV A;  2FBV A;  3ZLJ A;  4DV6 K;  1K73 O;  3CM6 A;  3O1B A;  3ZSX A;  4N41 A;  3MN5 A;  4DSK A;  3KTQ A;  3FZF A;  4DHY A;  4J2B A;  3DRR A;  5AFU A;  3T19 A;  3FE1 A;  4LF6 K;  4KRF A;  5ADX H;  1NGI A;  4ZTJ A;  1JLC A;  1WN7 A;  1LW2 A;  3U3G A;  1OH5 A;  1GOB A;  3K5L A;  2QKB A;  4IXC A;  1L3S A;  4FJL A;  5FPN A;  1X9J A;  2E1Z A;  1C6V A;  2XO7 A;  4JKE A;  1GOC A;  4DTS A;  2O8E B;  4MO5 A;  2D4W A;  2P5O A;  4CJW A;  1LOT B;  1G15 A;  2E5L K;  4O5F A;  1KVA A;  4M7X A;  3AAQ A;  3QIC A;  1VQP N;  4LFA K;  1QVF M;  3V81 A;  2RPI A;  3V1R A;  4CJQ A;  3TAQ A;  3SJH A;  1SUQ A;  2WFB A;  3O4N A;  4W5R A;  3VQP A;  2CGK A;  1VQM N;  1QE1 A;  3WUH A;  4JI4 K;  3AVB A;  1UA1 A;  4MDA A;  3CMA N;  3JYT A;  4C1N I;  4XH4 A;  4PQU A;  3TPQ A;  4M42 A;  1K8K A;  1OKJ A;  1CLQ A;  2KZM A;  1CXQ A;  3NGZ A;  4FLZ A;  3LWL A;  3FFK B;  2UUC K;  1R59 O;  1RDC A;  4WFA L;  4J2A A;  4CJ3 A;  4RW4 A;  3V9S A;  4FZX C;  4BGA A;  3I8B A;  5EVZ A;  3OYI A;  3KKR A;  3KVG A;  4Y1D A;  1NK4 A;  3WXI A;  3O9R A;  3P5J A;  4Z4F A;  1ITG A;  3CJ7 A;  1U49 A;  1UWB A;  5CR4 A;  5EU7 A;  4IOC L;  2UYT A;  2A41 A;  3U3Y A;  3ZT1 A;  4OKK A;  1N36 K;  2UXD K;  1WLJ A;  3VES A;  3LDP A;  1UA0 A;  5E84 A;  1YAG A;  4NCB A;  3M8P A;  4DS4 A;  3OYK A;  5I3U A;  4ELV A;  4UY8 O;  3L4I A;  2O4G A;  3WXL A;  2Q1N A;  3V1Q A;  1LWC A;  3NAE A;  3CXC M;  3A5M C;  5J2M A;  4IFY A;  3AVH A;  2KTQ A;  3M6G A;  2BTF A;  2BAN A;  5IT9 O;  3VF4 A;  4DV4 K;  1J54 A;  3L4Q A;  3ZX0 A;  2ZGZ A;  2P9S B;  4CF1 A;  4AM7 A;  4E7K A;  1C0T A;  1S1V A;  2FF3 B;  1VSL A;  3DXM A;  1HNI A;  1ATS A;  1E4G T;  4IOA L;  2HVI A;  2D0O A;  4AHC A;  4DSI A;  1EP4 A;  4Q0B A;  5J2P A;  1RT2 A;  2O8E A;  4M3T A;  4OGE A;  4RW9 A;  4HUF A;  3A0I X;  3QEV A;  1NU0 A;  5M1K A;  3H1V X;  3V9X A;  1NGB A;  2QW9 A;  1N8R O;  4FWS A;  5AQV A;  5AQQ A;  1YI2 N;  4K43 A;  4WQ5 A;  1T3V A;  3KLI A;  3HM9 A;  3R9P A;  1NGF A;  1HJR A;  3KIO A;  1HNV A;  2QI2 A;  5LJW A;  1T6C A;  4LF9 K;  4CER A;  4NLC A;  4BWJ A;  4A62 A;  3OJS A;  3CCU N;  2PZS A;  1YHQ N;  2FF6 A;  3PLA A;  4BDZ A;  4Z4E A;  3M1F A;  2RHK A;  3OS0 A;  3S9H A;  3V9U A;  3CCQ N;  2HHX A;  4CF8 A;  5GAH P;  2E2N A;  4CFC A;  3CET A;  3LDL A;  3IG1 A;  3RMD A;  4BRH A;  5KPR A;  2Q3S A;  1SL0 A;  1BCO A;  2YNF A;  4CJF A;  4H03 B;  1VQ6 N;  3VQD A;  2P9K B;  1WUA A;  3GBT A;  4FK0 A;  4JI6 K;  3EKU A;  4O8U A;  4B9U A;  3VEO A;  4KI6 A;  4DFM A;  1NKC A;  3AO1 A;  1QQO A;  1L3T A;  2FBY A;  3K5N A;  4FPA A;  1HKC A;  3H46 O;  4KH4 A;  3B8A X;  3C94 A;  5HRO A;  4CD3 A;  4DSL A;  4BRL A;  3OS2 A;  1GOA A;  4FWK A;  4M45 A;  3MX2 A;  2GUP A;  4L8R B;  1QQM A;  4IG0 A;  4Z4C A;  2E88 A;  4XIU A;  1NM1 A;  1Z25 A;  4E7H A;  4BGB A;  2BH1 A;  3UIQ A;  5A2Q O;  2QWM A;  4BRM A;  3FZH A;  4DTX A;  2LSN A;  3ISN C;  4DQP A;  1BOT O;  4BVO A;  1JLG A;  3K5O A;  3L6Q A;  4BC4 A;  1XC9 A;  1YIJ N;  3AO5 A;  3ATU A;  3AVI A;  2XRI A;  3L2R A;  4EIA A;  1NGH A;  4O0J A;  2YNH A;  2P5G A;  5KRT A;  4H4O A;  4DR2 K;  1A5X A;  1Q9X A;  3NVK A;  3F73 A;  4FWM A;  5I42 A;  2CH5 A;  4BRC A;  1RBR A;  5FPE A;  4CJ5 A;  2G8V A;  4C8L A;  2DFF A;  2OA8 A;  3IDH A;  2VG6 A;  4K25 A;  3GDQ A;  4M63 C;  2GEL A;  4EHT A;  4DB3 A;  3CCR N;  3THW A;  3ASM A;  3RSE B;  3SQ4 A;  4H4M A;  1L3V A;  1DT9 A;  4DFK A;  1TAQ A;  1TKX A;  3KKS A;  3ATV A;  2GWK A;  1S5J A;  5GIO A;  3ZSY A;  2ZJR L;  2Q2R A;  1BU6 O;  3THX B;  5HP1 A;  4DUZ K;  2KZZ A;  4F8R A;  4JV5 K;  4KO0 A;  5LY3 A;  1FW6 A;  3O9T A;  3ZEU B;  4YY3 K;  1WAF A;  2Z1G A;  4DR4 K;  1KQS M;  3V9Z A;  2HHV A;  2EX3 A;  3UKU B;  3OYL A;  4CFB A;  4YOX A;  3PUF A;  1MU2 A;  3LPU A;  3WXM B;  1YF5 L;  1HPM A;  4KTW A;  1ASW A;  3CYM A;  2E20 A;  4CJR A;  3C6H A;  2CH6 A;  2JWL A;  3G6E N;  2BGG A;  4M3X A;  1RBS A;  2O8C A;  2B4J A;  1LWF A;  5HL7 L;  3EZ5 A;  1RGI A;  4I2P A;  1SKS A;  4KTZ A;  5J2Q A;  3S3N A;  2P9I B;  2W41 A;  4FLX A;  1XWL A;  4FLW A;  4E7L A;  4FXD A;  3HP9 A;  4FWL A;  4X65 K;  4O4G A;  3MK6 A;  3SQ2 A;  4JI7 K;  4H5W A;  2Q36 A;  2I7P A;  3I0R A;  4CE9 A;  1SAZ A;  3D2E A;  3IFR A;  2Q0R A;  4U67 L;  4YHH K;  1VSM A;  2HF4 A;  3OYB A;  1QSY A;  1NLV A;  1BG3 A;  3H08 A;  4N5S A;  4FZY A;  1NGE A;  3NCI A;  4E89 A;  1NK0 A;  3G25 A;  1YIT N;  2QWP A;  3P38 A;  4F3T A;  4JHD A;  3U9D A;  1NJZ A;  5E41 A;  1ZXO A;  3KD5 E;  1BIZ A;  1KTQ A;  3VQ5 A;  3ID6 A;  1MWM A;  1P90 A;  4NYN A;  4CF2 A;  3CFO A;  2IGI A;  5EOY A;  4UQG A;  1GLA G;  1I39 A;  5FPD A;  1V4T A;  3CJC A;  3MDQ A;  1K6Y A;  4FLU A;  1NGJ A;  3O3G A;  3CM5 A;  3WNF A;  1J5E K;  1WSI A;  5C25 A;  3HXM A;  4JKG B;  3F9M A;  1QHA A;  4BG8 A;  3SNN A;  2IVO A;  2QEX N;  2BDP A;  3A8Y A;  3V6D A;  2ITG A;  1O13 A;  4JI2 K;  5JVH L;  4B08 A;  2QWR A;  3HBT A;  4CGG A;  1RTJ A;  4BQL A;  4BC3 A;  4HWI A;  3WXJ A;  5CY4 A;  5F2R A;  3CJA A;  3HP6 A;  3TAN A;  3ZSZ A;  4CZI A;  1C1B A;  4FWR A;  2HHU A;  1NJW A;  3AVJ A;  1YUW A;  2IIR A;  4FZZ A;  3DLL L;  4H8K A;  1VQK N;  3DAW A;  4GV6 A;  4AHV A;  4AHT A;  3AA3 A;  4BRQ A;  4DQ8 A;  1NNE A;  1Q81 O;  4FCY A;  3SPZ A;  4GMJ B;  3HPH A;  4OGC A;  3AVG A;  1BL3 A;  1KAZ A;  3CCV N;  4CHQ A;  3KWG A;  3EE9 A;  3QEW A;  2NLX A;  3IS9 A;  1NOZ A;  3VGL A;  3THY B;  4CZG A;  3CC2 N;  1TYQ B;  3AGK A;  1SZ2 A;  2X6N A;  3PX4 A;  2A42 A;  3VQ8 A;  1C1A A;  1JLB A;  2NNW A;  3DJC A;  3FR0 A;  2XY5 A;  4FJG A;  5SWM A;  4DLG A;  2Q31 A;  5JS2 A;  2NRT A;  1BO5 O;  3TSQ A;  4PL7 A;  3JXU A;  4ELU A;  3S3M A;  2P9N B;  5GIN A;  2G8U A;  1N32 K;  4IO8 A;  3ZSQ A;  4CFA A;  1TV6 A;  3OA9 A;  3WXK A;  4BR4 A;  4YOW A;  3BZC A;  5F0X A;  3K2P A;  4JI3 K;  3ZSW A;  2VGN A;  4CF9 A;  3HYF A;  3UKU A;  3PSF A;  4FJ7 A;  2E2Q A;  3K0S A;  3ZEU A;  1TUU A;  4CES A;  5KTQ A;  4CEO A;  1HQU A;  4KHP K;  5TKY A;  4EZ9 A;  3R3L A;  4CI6 A;  4LFC K;  1RT4 A;  3KJV A;  2OPQ A;  1H1V A;  4HTL A;  3L2Q A;  3I56 N;  2UU9 K;  5JS1 A;  4BRK A;  5B8H A;  2YJF A;  4KV8 A;  3LP1 A;  3PSI A;  5KPZ A;  1KCF A;  1YXQ A;  3VQ7 A;  1VQ4 N;  2ETJ A;  2HNZ A;  4CEB A;  1U04 A;  2DFH A;  1XI1 A;  3TTC A;  4FW2 A;  1NKB A;  3MCA B;  2F96 A;  4Q5V A;  3EN9 A;  1NK5 A;  4BC2 A;  4BR9 A;  3CJ1 A;  4YOR A;  4QS8 A;  4FK4 A;  3P31 A;  5HOO A;  1KC8 O;  1JLA A;  3K9K A;  4C8N A;  3VEV A;  1JKH A;  3CC7 N;  2B6A A;  4Z4I A;  4Y1C A;  1VSK A;  4CJ4 A;  4DR5 K;  3NBP A;  3TAM A;  4DSJ A;  3I55 N;  4CJU A;  4DV3 K;  1ZBI A;  4CJL A;  1NKE A;  4CZM A;  4CK2 A;  2D5R A;  3P39 A;  3F5T A;  4E1J A;  4QOZ B;  5HRN A;  3VET A;  4QCL A;  4IFE A;  2PFU A;  1RT7 A;  3MN9 A;  4A5B A;  4PUO A;  1RBT A;  3WNH A;  3VEX A;  1ZYQ A;  1C0U A;  3M8R A;  3KLF A;  3AVM A;  4RWT A;  3H3O B;  3OY9 A;  4IG3 A;  1RTD A;  3EO3 A;  1WSG A;  1IJJ A;  4HCB A;  4F9O A;  5AQZ A;  3VOV A;  5BN8 A;  4WQ4 A;  4AF1 A;  2V7Y A;  3VQ9 A;  1RCH A;  3I33 A;  4BE1 A;  1TKT A;  4KB1 A;  5D3G A;  2OZM A;  4CHP A;  1M1K O;  4DFJ A;  1BA0 A;  1V4S A;  3J7Z O;  1RT6 A;  1VSJ A;  4WFN L;  3HOS A;  1ZBS A;  2OPR A;  4FM2 A;  2D0A A;  3IAY A;  1W0H A;  3SUP A;  1U47 A;  1DEJ A;  3AAR A;  3VEZ A;  3HVT A;  2W6K A;  4O5B A;  1GLL O;  3HI0 A;  5LMU K;  3D0P A;  4XEI A;  1TYQ A;  1ESV A;  3LP3 A;  1X1P A;  4ISE A;  5DM7 L;  3FZK A;  4ILJ A;  4JKD A;  4JKC A;  4H0O A;  4DR7 K;  2NZT A;  1S22 A;  4CHZ A;  3LM9 A;  2HBM A;  1CZ9 A;  5AJ3 K;  4JKH A;  4Z94 A;  1RFQ A;  5KPT A;  5AQI A;  2ZJP L;  2NRH A;  3QEP A;  5M1N A;  2KFZ A;  3AY9 A;  3MEG A;  4EHU A;  1IKW A;  3M3Z A;  2YHB A;  2IDO A;  1CZA N;  1JLE A;  3V1O A;  4BQZ A;  2HBK A;  2P9L A;  5DK5 A;  4FJ8 A;  1U6Z A;  1U2V A;  4MLH A;  3T3F A;  3D6R A;  5LJV A;  2NRZ A;  4H0T B;  2NRR A;  3G10 A;  5E26 A;  2P9S A;  5M1Q A;  1VSD A;  2DFE A;  4LH5 A;  4B1V A;  4NXN K;  4DU1 A;  3OBY A;  1S6Q A;  3LDO A;  4OPK A;  2E6M A;  3HTV A;  3LZI A;  1NBW A;  3OYD A;  3AVF A;  4DR1 K;  1RNH A;  2OTJ N;  3C7N A;  1GLD G;  1RT1 A;  3I0S A;  1IKX A;  3TAR A;  2ZGY A;  3OYF A;  4CEF A;  3EY1 A;  2W40 A;  3CF5 L;  3SPY A;  4CBW A;  1HNX K;  1RDD A;  3CFR A;  4IWV A;  3J7A P;  3H3N O;  4CEC A;  4DSF A;  4LFB K;  2RF2 A;  4FYD A;  5DM6 L;  5EY4 A;  1LAW A;  3DLH A;  3SZ2 A;  4B9T A;  3OJU A;  5AZI B;  1HJO A;  4BY9 C;  4JKA A;  3P83 D;  5MLC Q;  3BEX A;  5BR9 A;  1ILY A;  5AFU H;  1SKR A;  2G8F A;  1FKO A;  3DLG A;  3PY8 A;  1Z26 A;  4IBN A;  3TAF A;  4A59 A;  1S72 N;  4OKJ A;  2HOE A;  3QET A;  2QKK A;  4I6M B;  2QWO A;  4MDB A;  2KFN A;  2CGL A;  3OS1 A;  2ZE2 A;  5AQH A;  2P9I A;  1KLM A;  3PX0 A;  2A1R A;  2IAJ A;  4AHS A;  3O3F A;  4KHU A;  3L3V A;  3ULD A;  1XNR K;  4YOT A;  3ZT3 A;  4DV2 K;  4W5N A;  3OYG A;  3PO5 A;  4B1X B;  4QAG A;  4JN4 A;  2Z1H A;  1ASU A;  2GV9 A;  4FWQ A;  1I3A A;  1F21 A;  1CXU A;  1W9H A;  3CIP A;  4AHR A;  3UE5 A;  5F1X A;  1S9E A;  5ADX A;  3AA4 A;  3EL2 A;  4RW6 A;  4W5Q A;  4C23 A;  1X9W A;  4M3Z A;  3O3H A;  3DOK A;  3R6M A;  2Y1I A;  1LAV A;  2FLO A;  3RRH A;  3LAM A;  3QDK A;  3K58 A;  2FXU A;  1RDU A;  4HUE A;  3C6A A;  3NH2 A;  1Q8I A;  4CZJ A;  2W42 A;  2HBL A;  4BRA A;  5C2F A;  4FSV A;  4FJ5 A;  1XQS C;  2NRX A;  1N6Q A;  4IKF A;  4CJS A;  3CCM N;  4RW7 A;  1JXB A;  3R8E A;  1BIS A;  3RSE A;  4ICL A;  2YV0 X;  2E6L A;  3M8Q A;  5GAG P;  1BWF O;  2GWJ A;  3M8S A;  3K59 A;  2ZJQ L;  4HCC A;  4ZHR A;  3TWH A;  1U45 A;  1GLB G;  2HB5 A;  1VQ7 N;  1KFD A;  4CK1 A;  4CEA A;  4LSL A;  3A5N C;  3UKR B;  4M3R A;  4DTJ A;  4DV7 K;  3NHG A;  1NK8 A;  1VSH A;  4RG8 A;  5BRH A;  1D9D A;  5JLH A;  2KKZ A;  3AVN A;  1BGX T;  3AVK A;  1WBB A;  1EQY A;  4PKG A;  2P51 A;  1N5Y A;  4MQ3 A;  4DTN A;  3O8M A;  4GNI A;  5M1O A;  2O8F A;  3F2K A;  4ID5 A;  4EFH A;  1BI4 A;  3KLH A;  4BRD A;  3FZM A;  4PA1 A;  3NH1 A;  4OO1 J;  1OVQ A;  4J2D A;  2P9P A;  1K9M O;  1NJY A;  3O4Q A;  4KFB A;  5IWA K;  3MCP A;  4KTQ A;  2QA4 N;  1VAZ A;  4JKF A;  5C12 A;  2YX6 A;  3HM8 A;  1WAJ A;  4E3S A;  1BHL A;  3SK3 A;  1J5O A;  3QO9 A;  4BDY A;  4DR3 K;  3VA0 A;  5K14 A;  3NGY A;  5HLF A;  3V9W A;  3SMS A;  5GIP A;  2O8B B;  3FLC O;  4CJP A;  5JIC A;  3KK1 A;  2P9P B;  4X62 K;  4CBX A;  3AGR A;  1VSE A;  4ILH A;  1A5W A;  3VQ6 A;  1BI4 B;  3CQY A;  1ZBL A;  3ZT2 A;  2HF3 A;  3VQ4 A;  3RR7 A;  1D5A A;  1QS4 A;  4KH6 A;  5AQU A;  2OPP A;  3DXK A;  3QML A;  5C10 A;  2QXF A;  4BR7 A;  4U7B A;  1HKG A;  3BUZ B;  4I9Q A;  2YHY A;  1E4F T;  3LDN A;  3WQT A;  5CYM A;  3T7Z A;  4JLH A;  3HO1 A;  1VQ8 N;  4DTP A;  3H6E A;  3OYN A;  4ID1 A;  1DTQ A;  3QBW A;  3L2V A;  3K9J A;  1OH8 A;  3NF6 A;  4KKO A;  5C42 A;  4LF5 K;  1QQC A;  4CIG A;  1X9M A;  1ASV A;  1RBU A;  3MX5 A;  4GVE A;  4IDK A;  3CHW A;  5KQD A;  3AAP A;  2JWK A;  4B3O A;  5AQJ A;  1IO2 A;  3MWP A;  2B5J A;  1IG8 A;  4YNQ A;  4KHS A;  1QZ6 A;  2OCE A;  2XY7 A;  2VQF K;  1MA9 B;  3QNN A;  2VGM A;  1HQE A;  4DTU A;  2XY8 A;  4E1M A;  4BR5 A;  4IFV A;  3B6O A;  4GY2 B;  4CHN A;  4QS9 A;  3LDQ A;  3O08 A;  3LDS A;  4WYB A;  1SKW A;  1NMD A;  2RE2 A;  1FK9 A;  2E1Y A;  1TK8 A;  1KRP A;  2FBX A;  5SZT A;  3P1G A;  1TUY A;  1U4B A;  4YDU C;  2ASO A;  4JI0 K;  4KHY A;  3ZSV A;  4DG1 A;  3AV9 A;  3DMJ A;  3KK2 A;  3CCS N;  4JS5 A;  4H5V A;  3DLE A;  4NLB A;  3QEI A;  3MXI A;  1BIU A;  3QER A;  1CZB A;  4L3Q A;  1J53 A;  3U8X A;  2AA4 A;  4B3T K;  3RMC A;  1RDB A;  2IVP A;  4I6M A;  3NH0 A;  2IC3 A;  3RR8 A;  3PIP L;  3BZK A;  3C65 A;  3EZW A;  2QTD A;  3LZJ A;  2KQ2 A;  4KBO A;  3VF2 A;  2Q0U A;  3DRP A;  3N4Q A;  4JS4 A;  4DWI A;  2KW4 A;  2F9T A;  3D45 A;  4O0I A;  1RBV A;  1QTM A;  1MDU B;  5AZI A;  1J9A A;  2F8S A;  3OTO K;  1JLQ A;  1IBM K;  3EE8 A;  3KZB A;  3CG7 A;  1J6Z A;  2G8H A;  4LF7 K;  3CER A;  2A40 A;  3CPW M;  4GKJ K;  4HVJ A;  3NDK A;  2DY4 A;  3E66 A;  1IBL K;  5GAD P;  1YTU A;  4LF4 K;  4LC9 B;  1U48 A;  1Q18 A;  3KD1 E;  1HNW K;  3LPT A;  1S1U A;  1GLF O;  4JK8 A;  1HX1 A;  4JD2 B;  4FJI A;  5DMR A;  3ZT0 A;  2G8W A;  3K5M A;  1DTT A;  2HND A;  3MAQ A;  2V52 B;  4IEI A;  3HRG A;  4DKW A;  2E8A A;  4DCH A;  5BPL A;  3ENH A;  4FWP A;  1W7A A;  3NFA A;  1KSP A;  2YNG A;  4ISF A;  5CHI A;  2YJE A;  3TTD A;  3CD6 N;  4FVU A;  1NK6 A;  5LL6 Z;  4N47 A;  3GOI A;  1HYZ A;  2V51 B;  3EKS A;  4OPH A;  2RKI A;  1REV A;  2AP1 A;  3MMV A;  3O5B A;  4CW7 B;  4BC5 A;  1ATR A;  1TL3 A;  4DF4 A;  3HST B;  4DSE A;  4CEQ A;  1IBK K;  5C24 A;  2Z1J A;  4HHT A;  4WCE L;  1QSL A;  2ATQ A;  2A1S A;  1YJN N;  4CED A;  2VWB A;  3MN6 A;  4AH9 A;  4CHO A;  3FZL A;  1KVC A;  4B9M A;  2KLA A;  4AIL C;  2IOC A;  4C8O A;  3S41 A;  3ZET B;  2D0B A;  1SQK A;  3PX6 A;  4O44 A;  1G99 A;  1OVY A;  4DV5 K;  4FLT A;  2ASP A;  3SUQ A;  4V19 S;  2OAN A;  2VYP A;  4R5P A;  4H5T A;  3IRX A;  4K0K K;  4JRQ A;  5AQX A;  3TAP A;  1HPZ A;  1C0F A;  1KAY A;  3AA2 A;  1EKE A;  1KLN A;  1JCG A;  3E1Y A;  1HRH A;  4RTF D;  3DXK B;  4J2E A;  3KK3 A;  2HVH A;  4BE2 A;  3ID8 A;  3J8A A;  4E7J A;  3SBT A;  2WUS A;  2FC0 A;  5AQT A;  3QES A;  1N34 K;  4IZ9 A;  3TAE A;  2WTU A;  3NF7 A;  1JJ2 M;  2PYL A;  3SBG A;  4A5A A;  5KQ8 A;  3OBW A;  3JS6 A;  2O8B A;  3WNG A;  5LMN K;  1SL1 A;  3Q7C A;  4M41 A;  3ZT4 A;  3EYZ A;  3NE6 A;  3KK7 A;  4IO9 L;  2ZD1 A;  2UUB K;  2UXC K;  2HMI A;  3VF6 A;  1IH7 A;  2GTD A;  5AQK A;  3SV3 A;  4JAX A;  3OYH A;  3KLE A;  1D9F A;  1T7P A;  2QWQ A;  3SUN A;  3SAF A;  1ZBH A;  4KI4 A;  4CJK A;  1XNQ K;  4ZTF A;  2ZQB A;  2EWS A;  5AQP A;  2Y1J A;  2PBD A;  4AHU A;  1WNS A;  4B1Z A;  4CGD A;  1RTH A;  1T05 A;  3GE1 A;  4H0X B;  4NCG A;  4J8F A;  1VRU A;  1B92 A;  3RMA A;  3GG4 A;  3M5R A;  2O8F B;  3SAG A;  3O9Q A;  4B9N A;  3SAH A;  1W2B M;  4KRE A;  4N76 A;  3DLR A;  3J7Y P;  4GV9 A;  5AQO A;  1XMO K;  5KGX A;  3WEE A;  2R7Y A;  5C15 A;  3CCE N;  2HHQ A;  4FLV A;  1UAX A;  3MED A;  3SCX A;  1I94 K;  4OVL A;  3CCL N;  3THV A;  1FKP A;  2YKM A;  1NK9 A;  1VQN N;  3I8D A;  1SL2 A;  1RDA A;  4CK3 A;  4G9Z A;  3BF1 A;  1ATN A;  1RTI A;  3OYE A;  4OPJ A;  2D1K A;  1LV5 A;  2VCP A;  4LF8 K;  1X3M A;  4K8X A;  3CQX A;  4EP5 A;  2HST A;  5ELZ A;  2PYJ A;  4Y0W A;  1NGG A;  5J1E A;  4I7F A;  1DGK N;  4FWN A;  4FOE A;  2JGU A;  2X74 A;  4XH1 A;  4DF8 A;  2YHX A;  4C8M A;  4CD1 A;  2QM1 A;  3BF3 A;  4BE0 A;  1EWR A;  4EP4 A;  1IKY A;  5BRF A;  1VSF A;  3QIP A;  4FJX A;  4E0D A;  4DU4 A;  3TSU A;  3PO4 A;  2F7T A;  5BPN A;  5AQR A;  3CC4 N;  1B9F A;  1BUP A;  2Z1I A;  2P9U B;  1IG9 A;  1EX4 A;  4JYA K;  5JVG L;  2F9W A;  3C6T A;  1Z6R A;  3LAN A;  3MEE A;  2IS3 A;  1Y64 A;  5TKW A;  1QZ5 A;  4FO0 A;  4JNE A;  5GAE P;  4H0P A;  3NVM A;  4DTR A;  3VN5 A;  3MN7 A;  1YT3 A;  3THY A;  4YOY A;  5FRN A;  5HRS A;  3VEY A;  3O9U A;  4OLA A;  3VEW A;  4F2R A;  2G8I A;  3MXM A;  1NGD A;  2IVN A;  4FOI A;  4E1N A;  3MWT A;  3VQA A;  1VK0 A;  3NF9 A;  2OYQ A;  3LP0 A;  3VQE A;  3AO4 A;  3DOL A;  4JI5 K;  2GUI A;  2AJQ A;  2HNY A;  1XHX A;  4KHW A;  2X78 A;  1WOQ A;  1KFS A;  5AZJ A;  1S1T A;  4HUG A;  5T7B A;  4B9L A;  2NRV A;  1WSF A;  2ITM A;  1XUP O;  1FJG K;  4JEP A;  1RIL A;  4FPB A;  4A57 A;  3QIN A;  3LM2 A;  2PY5 A;  3ZX3 A;  3A5O C;  4CHY A;  1ZC6 A;  2O8D A;  5CE3 A;  4I2Q A;  3C7N B;  2DPN A;  3OHR A;  2F4V K;  4DMN A;  3SUO A;  1WBD A;  3HT3 A;  3AVA A;  5JMV A;  3SYZ A;  4DFP A;  4CIF A;  3H45 C;  3U6F A;  2ZWH A;  3TAG A;  2O4I A;  4JKG A;  5M1P A;  4KAZ A;  3HPO A;  1KVB A;  1HLU A;  1TK5 A;  4JI1 K;  5AQN A;  3DLB A;  2WON A;  2O8D B;  1UOC A;  4CGF A;  1U2V B;  1OH7 A;  5FLX O;  4AQY K;  1WB9 A;  3QFU A;  1ZBU A;  4G1Q A;  2P9L B;  4IJN A;  3DWL A;  3WNE A;  3SQ0 A;  4BRP A;  1TK0 A;  4FVM A;  3RVC A;  3T1H K;  3L8B A;  3D7E O;  1SS6 A;  4FW1 A;  4PY5 A;  4O55 A;  3MXJ A;  3LAL A;  4BWM A;  3MEC A;  2OPS A;  1BDG A;  3VQQ A;  3F9K A;  1JLF A;  1TKZ A;  5EXW A;  1NG9 A;  3CFP A;  3DYA A;  4MFB A;  4PHT X;  3ZSR A;  5EX5 A;  1S9G A;  4ILG B;  4WQ5 C;  1X9S A;  4HTU A;  3VQB A;  4FWO A;  3CI5 A;  3DRS A;  2BE2 A;  4FK2 A;  5HRP A;  3L2W A;  4H0Y B;  4B8A B;  3O6W A;  5AQW A;  4PKI A;  2YCH A;  2UUA K;  1HUX A;  1BCM A;  1Q86 O;  2FSK A;  4W5T A;  3H1Q A;  1O1W A;  3B6P A;  5BN9 A;  1KAX A;  2FSN A;  3U4L A;  4WE1 A;  3O1W A;  4DUY K;  3C0B A;  4EAH D;  2P9U A;  2YI1 A;  3W3D A;  2O8C B;  1HR0 K;  3Q7B A;  5BPM A;  4NCA A;  2GBZ A;  3HVR A;  4M3W A;  3RMB A;  2E2P A;  4ELT A;  4DV1 K;  4CVN E;  2ASM A;  1GLC G;  4M3Y A;  2HW3 A;  2QK9 A;  4CGH A;  4NO7 A;  5FPM A;  2H3G X;  1VQ5 N;  4H5R A;  5J2N A;  2HMP A;  5FRO A;  4B8C A;  3G0Z A;  1JL2 A;  1HYV A;  5C2D A;  3THX A;  4CFD A;  1M90 O;  1ZBF A;  1JXE A;  4CGI A;  2G8K A;  4CZH A;  1D8Y A;  2FSJ A;  3JAM O;  2OZS A;  4B3M K;  4BRF A;  4FJ9 A;  1BQM A;  3OYJ A;  1XHZ A;  5AQG A;  4KHN A;  1T44 A;  1Q9Y A;  3LP2 A;  5KRS A;  4F4K A;  3THW B;  4CIE A;  3AVC A;  2QWL A;  4A2B A;  4DLE A;  3D2F A;  3E9O A;  5AQS A;  3SQ1 A;  2VG5 A;  4C1N K;  2VWK A;  3QB0 A;  4GKK K;  3WEE B;  4FJJ A;  3HL8 A;  3K57 A;  1RT5 A;  4M7Y A;  1D4X A;  5HRR A;  4CJE A; 
#chains in the Genus database with same CATH homology
 1UWB A;  5EU7 A;  4C8N A;  2EHG A;  4HVJ A;  3NDK A;  3U3Y A;  2DY4 A;  1JKH A;  3ZT1 A;  2B6A A;  3NF8 A;  4Y1C A;  1VSK A;  4CEE A;  4CJ4 A;  4Z4I A;  4OKK A;  1YTU A;  1T03 A;  3NBP A;  3TAM A;  4DSJ A;  2F8T A;  1U48 A;  1WLJ A;  3KD1 E;  4CJU A;  1UA0 A;  3LPT A;  1ZBI A;  1S1U A;  4CJL A;  2I5J A;  1NKE A;  4F3O A;  4NCB A;  2HHW A;  3M8P A;  4DS4 A;  3OYK A;  4CK2 A;  2D5R A;  4E19 A;  5I3U A;  4ELV A;  4FJI A;  3VA3 A;  5DMR A;  3ZT0 A;  5HRN A;  3K5M A;  3QEX A;  1DTT A;  2HND A;  2G8W A;  5KGW A;  3MAQ A;  4QCL A;  2O4G A;  3V1Q A;  1LWC A;  1RT7 A;  1TL1 A;  4PUO A;  3NAE A;  1RBT A;  3WNH A;  3NFA A;  1KSP A;  1ZYQ A;  2RN2 A;  1C0U A;  2YNG A;  4IFY A;  3M8R A;  3AVH A;  3KLF A;  2VWJ A;  5J2M A;  4B9S A;  2KTQ A;  3AVM A;  5CYQ A;  1NK6 A;  2BAN A;  4DQQ A;  4N47 A;  3OY9 A;  1HYZ A;  1L3U A;  3ITH A;  4IG3 A;  3ZSO A;  4YFU A;  1RTD A;  1J54 A;  3V4I A;  1WSG A;  4LD0 A;  4CF1 A;  2RKI A;  4DQI A;  4HCB A;  4E7K A;  1C0T A;  1S1V A;  4OLB A;  1REV A;  1VSL A;  1HNI A;  4OKE A;  3VQ9 A;  4DS5 A;  3QLH A;  1L5U A;  1RCH A;  2HVI A;  4AHC A;  4DSI A;  1TL3 A;  4DF4 A;  1EP4 A;  4FZY A;  3HK2 A;  3HST B;  4N56 A;  4DSE A;  4BE1 A;  4Q0B A;  3SV4 A;  1TKT A;  1RT2 A;  4CEQ A;  5J2P A;  4KB1 A;  4OGE A;  4RW9 A;  4M3T A;  5D3G A;  5C24 A;  2Z1J A;  4CHP A;  4HHT A;  4HUF A;  3QEV A;  1QSL A;  2OZM A;  2ATQ A;  1JL1 A;  2A1S A;  4DFJ A;  3V9X A;  4CGJ A;  4CED A;  1RT6 A;  1WSJ A;  1QSS A;  1VSJ A;  4FM2 A;  2OPR A;  4AH9 A;  2D0A A;  5CZ1 A;  4CHO A;  1TKD A;  1W0H A;  3IAY A;  3SUP A;  1KVC A;  3SJJ A;  3HM9 A;  3KLI A;  1U47 A;  4B9M A;  3HVT A;  1EET A;  3PV8 A;  4O5B A;  1HJR A;  3KIO A;  5FDL A;  4AIL C;  2IOC A;  4QOZ B;  1HNV A;  3D0P A;  4C8O A;  3OYA A;  2YNI A;  3LP3 A;  1X1P A;  4CER A;  2D0B A;  3OYM A;  4BWJ A;  4DTO A;  3OJS A;  3PX6 A;  4O44 A;  2PZS A;  4BDZ A;  4Z4E A;  4LY7 A;  3OS0 A;  4FLT A;  3SUQ A;  3OVN A;  3V9U A;  1LWE A;  3S9H A;  4FJN A;  4C8K A;  1B9D A;  2HHX A;  4CF8 A;  2FBT A;  4CHZ A;  4CFC A;  4R5P A;  3IRX A;  4JRQ A;  1CZ9 A;  3IG1 A;  3TAP A;  1T8E A;  2X6S A;  3RMD A;  1HPZ A;  3QEP A;  4FZX C;  3NGI A;  3AA2 A;  4DQR A;  2KFZ A;  1EKE A;  1KLN A;  2Q3S A;  1BQN A;  3MEG A;  2YNF A;  1BCO A;  1IKW A;  1SL0 A;  3PY8 A;  2YHB A;  4CJF A;  1HRH A;  4J2E A;  2HVH A;  3KK3 A;  2IDO A;  3VQD A;  4I9L A;  1JLE A;  1WSH A;  3V1O A;  4BE2 A;  2HHT A;  1A5V A;  4FK0 A;  4TSX A;  4E7J A;  4B9U A;  4KI6 A;  2FC0 A;  2VG7 A;  3QES A;  4DFM A;  5DK5 A;  4FJ8 A;  3TAE A;  1NKC A;  3NF7 A;  3AO1 A;  1L3T A;  2YHA A;  3T3F A;  2FBY A;  3K5N A;  3G10 A;  4FJH A;  2PYL A;  4F2S A;  4NYF A;  4CJT A;  3C94 A;  3A2F A;  4EZ6 A;  5HRO A;  1VSD A;  2DFE A;  4GW6 A;  4LH5 A;  3WNG A;  1EXQ A;  4DU1 A;  1SL1 A;  4DSL A;  3L2U A;  4M41 A;  3ZT4 A;  3EYZ A;  3NE6 A;  3S3O A;  3OS2 A;  1GOA A;  1S6Q A;  2ZD1 A;  4M45 A;  2HMI A;  1NK7 A;  1IH7 A;  2NUB A;  4OPK A;  1NJX A;  4CCH A;  4KPY A;  4L8R B;  1Y97 A;  3SV3 A;  3OYH A;  4IG0 A;  2E6M A;  4Z4C A;  1C1C A;  3KLE A;  1D9F A;  3BDP A;  3LZI A;  1T7P A;  2P1J A;  3OYD A;  4KB0 A;  3AVF A;  3SUN A;  1ZBH A;  4KI4 A;  4CJK A;  4ZTF A;  2ZQB A;  4XIU A;  1RNH A;  1Z25 A;  4E7H A;  2Y1J A;  4AHU A;  3UIQ A;  1WNS A;  4CGD A;  1RTH A;  1RT1 A;  1T05 A;  3I0S A;  1IKX A;  4NCG A;  3TAR A;  1NOY A;  3OYF A;  4DTX A;  1VRU A;  1B92 A;  2LSN A;  3ISN C;  3T1A A;  4CEF A;  3EY1 A;  3RMA A;  3SPY A;  4DQP A;  3QIO A;  1YVU A;  1JLG A;  1RDD A;  3K5O A;  4LSN A;  3CFR A;  4B9N A;  1XC9 A;  3AO5 A;  1S1W A;  4CEC A;  3AVI A;  4FLY A;  5FRM A;  4KRE A;  4DSF A;  2XRI A;  3L2R A;  2RF2 A;  4CEZ A;  4N76 A;  4FYD A;  3DLR A;  1LAW A;  3AO3 A;  4O0J A;  4DQS A;  3DLH A;  2YNH A;  3SZ2 A;  2P5G A;  5KRT A;  4B9T A;  5KGX A;  4H4O A;  3OJU A;  4M3U A;  1A5X A;  2R7Y A;  1Q9X A;  3F73 A;  4BDP A;  4Z0U A;  4CF0 A;  5I42 A;  2HHQ A;  4FLV A;  1UAX A;  3MED A;  3P83 D;  1RBR A;  4CJ5 A;  2G8V A;  3SCX A;  4C8L A;  3L3U A;  4OVL A;  3BGR A;  1RT3 A;  2DFF A;  1SKR A;  2G8F A;  3DLG A;  1FKO A;  2OA8 A;  3C6U A;  2VG6 A;  3THV A;  1FKP A;  2YKM A;  1Z26 A;  1NK9 A;  4IBN A;  3I8D A;  1RDA A;  4CK3 A;  3TAF A;  1SL2 A;  1RTI A;  4OKJ A;  3OYE A;  4OPJ A;  3QET A;  2QKK A;  2HHS A;  2KFN A;  4E7I A;  1LV5 A;  3OS1 A;  3ASM A;  3ZCM A;  2ZE2 A;  3SQ4 A;  4H4M A;  1L3V A;  5HBM A;  4K8X A;  4DFK A;  3PX0 A;  1KLM A;  2A1R A;  2IAJ A;  1TAQ A;  4AHS A;  3O3F A;  4KHU A;  3L3V A;  3ULD A;  2DTU A;  1TKX A;  3ZT3 A;  4EP5 A;  1IKV A;  2JLE A;  3KKS A;  1S5J A;  3RWU A;  2XHB A;  3FFI A;  4LH4 A;  2PYJ A;  4KHQ A;  4W5N A;  3OYG A;  3LAK A;  3PO5 A;  3ZSY A;  4FJK A;  5J1E A;  4I7F A;  4QAG A;  1DLO A;  5HP1 A;  2KZZ A;  2Z1H A;  4F8R A;  2JGU A;  1WSE A;  4KO0 A;  2X74 A;  1ASU A;  2GV9 A;  1VSI A;  1I3A A;  1F21 A;  1CXU A;  1W9H A;  4AHR A;  4DF8 A;  3DLK A;  1S9E A;  1WAF A;  3SI6 A;  2E4L A;  2Z1G A;  1HYS A;  3AA4 A;  4C8M A;  3V9Z A;  4RW6 A;  2WOM A;  4W5Q A;  2EX3 A;  2YKN A;  3OYL A;  4BE0 A;  1X9W A;  4EP4 A;  2HHV A;  4M3Z A;  3O3H A;  1IKY A;  1S6P A;  3DOK A;  4CFB A;  4W5O A;  3PUF A;  2Y1I A;  1LAV A;  3HPG A;  1MU2 A;  3LPU A;  1VSF A;  3QIP A;  4FJX A;  4E0D A;  3RRH A;  4KTW A;  1ASW A;  4DU4 A;  3LAM A;  3PO4 A;  3CYM A;  3K58 A;  4CJR A;  4HUE A;  3CQ8 A;  2BGG A;  1B9F A;  3NH2 A;  1RBS A;  2Z1I A;  3AVL A;  4M3X A;  1Q8I A;  5KI6 A;  2B4J A;  1LWF A;  1EX4 A;  2W42 A;  3EZ5 A;  1IG9 A;  3C6T A;  3LAN A;  4I2P A;  3MEE A;  1SKS A;  2IS3 A;  4FM1 A;  4FJ5 A;  4KTZ A;  1N6Q A;  5J2Q A;  2XY6 A;  4CJS A;  3TI0 A;  4IKF A;  3VQC A;  3S3N A;  4RW7 A;  5CZ2 A;  4FJM A;  1JXB A;  4FLX A;  1BIS A;  1XWL A;  4FLW A;  4ICL A;  4DTR A;  4E7L A;  1FXX A;  2YV0 X;  3HP9 A;  3VN5 A;  2E6L A;  1SV5 A;  4FXD A;  1YT3 A;  3M8Q A;  5FRN A;  5HRS A;  4OLA A;  4CJV A;  3OYC A;  4O4G A;  4F2R A;  2G8I A;  3M8S A;  3KLG A;  3MXM A;  3RRG A;  4K8Z A;  3SQ2 A;  3K59 A;  4E1N A;  4HCC A;  4ZHR A;  3VQA A;  3I0R A;  1VK0 A;  4CE9 A;  3NF9 A;  3TWH A;  1U45 A;  2OYQ A;  3OYB A;  1QSY A;  1VSM A;  2HB5 A;  3LWM A;  1KFD A;  3LP0 A;  3DM2 A;  3H08 A;  3VQE A;  4CEA A;  4RW8 A;  3AO4 A;  3DOL A;  4CK1 A;  1C0M A;  4LSL A;  4E89 A;  4N5S A;  2GUI A;  3NCI A;  1NK0 A;  2AJQ A;  3C95 A;  1LW0 A;  2HNY A;  3AA5 X;  4M3R A;  1XHX A;  4F3T A;  4DTJ A;  1NJZ A;  4KHW A;  5E41 A;  3NHG A;  2X78 A;  1VSH A;  4RG8 A;  1NK8 A;  3TR8 A;  1D9D A;  1KFS A;  3AVN A;  4Z4H A;  3KD5 E;  4Z4G A;  1BGX T;  1S1T A;  3AVK A;  1VRT A;  1BIZ A;  4FM0 A;  2P51 A;  1KTQ A;  4HUG A;  4MQ3 A;  3VQ5 A;  4DTN A;  1N5Y A;  5T7B A;  4B9L A;  4DU3 A;  1WSF A;  4NYN A;  1TGO A;  4CF2 A;  3CFO A;  1RIL A;  2IGI A;  3QIN A;  4ID5 A;  1BI4 A;  3KLH A;  2PY5 A;  4UQG A;  1I39 A;  4PA1 A;  3NH1 A;  4CHY A;  3RTV A;  4I2Q A;  4DTM A;  4J2D A;  4PWD A;  1K6Y A;  1YTA A;  4FLU A;  4DMN A;  1NJY A;  3O3G A;  3O4Q A;  3CM5 A;  3SUO A;  3HT3 A;  3WNF A;  1R0A A;  3AVA A;  3ALY A;  4KFB A;  3SYZ A;  4DFP A;  1TVR A;  1WSI A;  5C25 A;  4CIF A;  3HXM A;  4KTQ A;  3U6F A;  3AO2 A;  1WAJ A;  4E3S A;  1BHL A;  3TAG A;  3SNN A;  3QO9 A;  4BDY A;  1J5O A;  2O4I A;  3VA0 A;  5K14 A;  4KAZ A;  3NGY A;  5HLF A;  3V9W A;  2BDP A;  3V6D A;  2ITG A;  3HPO A;  1KVB A;  4B08 A;  1TK5 A;  1TAU A;  4CGG A;  4CJP A;  3KK1 A;  3JSM A;  1RTJ A;  3TAB A;  3DLB A;  2WON A;  1VSE A;  1A5W A;  1UOC A;  5CY4 A;  4CGF A;  3VQ6 A;  1BI4 B;  4JRP A;  1ZBL A;  1ZBU A;  4G1Q A;  3HP6 A;  3DI6 A;  3ZT2 A;  3QNO A;  3WNE A;  3ZSZ A;  3SQ0 A;  3TAN A;  3VQ4 A;  1S1X A;  1C1B A;  3RR7 A;  1D5A A;  4B9V A;  1TK0 A;  1QS4 A;  4FVM A;  1QHT A;  3L8B A;  2HHU A;  1NJW A;  3AVJ A;  4BAC A;  3HJF A;  4FW1 A;  2OPP A;  4OJR A;  4FZZ A;  2D0C A;  4H8K A;  4PY5 A;  4O55 A;  4AHV A;  3MXJ A;  2QXF A;  4AHT A;  3AA3 A;  3LAL A;  4BWM A;  2OPS A;  3E01 A;  3MEC A;  4I9Q A;  3F9K A;  1JLF A;  1TKZ A;  4GVM A;  3VQQ A;  1HMV A;  2FBV A;  4FCY A;  3SPZ A;  5CYM A;  3CFP A;  3HO1 A;  3DYA A;  4GMJ B;  4JLH A;  4MFB A;  4DTP A;  3HPH A;  4OGC A;  3OYN A;  3AVG A;  3CM6 A;  3ZSR A;  4ID1 A;  1BL3 A;  1DTQ A;  1S9G A;  3L2V A;  3NF6 A;  4KKO A;  1X9S A;  5C42 A;  3ZSX A;  4HTU A;  3VQB A;  4N41 A;  1QQC A;  4CHQ A;  3DRS A;  4DSK A;  2BE2 A;  4FK2 A;  4CIG A;  5HRP A;  3QEW A;  3L2W A;  3IS9 A;  1X9M A;  1ASV A;  1RBU A;  4IDK A;  3KTQ A;  1NOZ A;  4J2B A;  3DRR A;  4B8A B;  3T19 A;  4B3O A;  1IO2 A;  2B5J A;  4YNQ A;  4KRF A;  4KHS A;  1BCM A;  2X6N A;  3PX4 A;  3VQ8 A;  4W5T A;  4ZTJ A;  1C1A A;  1JLB A;  1JLC A;  1WN7 A;  1LW2 A;  2XY7 A;  3U3G A;  1GOB A;  3K5L A;  1O1W A;  3B6P A;  3QNN A;  2QKB A;  1HQE A;  4DTU A;  2XY8 A;  4E1M A;  1L3S A;  4FJL A;  2XY5 A;  4IFV A;  3B6O A;  4WE1 A;  4CHN A;  1C6V A;  2XO7 A;  4FJG A;  5SWM A;  4DLG A;  5JS2 A;  1GOC A;  4DTS A;  3LDS A;  4ELU A;  3S3M A;  1SKW A;  2P5O A;  4CJW A;  2G8U A;  1G15 A;  3ZSQ A;  4NCA A;  2GBZ A;  1TV6 A;  4CFA A;  3HVR A;  1KVA A;  4M3W A;  3RMB A;  1FK9 A;  1TK8 A;  3K2P A;  3ZSW A;  4ELT A;  4CF9 A;  3V81 A;  2RPI A;  3HYF A;  3V1R A;  4CJQ A;  3TAQ A;  4M3Y A;  1KRP A;  2HW3 A;  2QK9 A;  2FBX A;  1SUQ A;  4CGH A;  5SZT A;  4FJ7 A;  3P1G A;  5J2N A;  3O4N A;  5FRO A;  4B8C A;  4W5R A;  1U4B A;  3VQP A;  3G0Z A;  1JL2 A;  1HYV A;  4CES A;  1QE1 A;  4CFD A;  5KTQ A;  3AVB A;  4KHY A;  1ZBF A;  1HQU A;  1JXE A;  3ZSV A;  4CEO A;  1UA1 A;  4DG1 A;  4CGI A;  3AV9 A;  2G8K A;  4EZ9 A;  3DMJ A;  3KK2 A;  1D8Y A;  2OZS A;  3JYT A;  4JS5 A;  1RT4 A;  4FJ9 A;  1BQM A;  3DLE A;  3KJV A;  4PQU A;  2OPQ A;  3QEI A;  3OYJ A;  3L2Q A;  3MXI A;  1BIU A;  3QER A;  1CZB A;  1XHZ A;  4KHN A;  4M42 A;  1Q9Y A;  1J53 A;  3LP2 A;  5KRS A;  4F4K A;  5JS1 A;  3RMC A;  1RDB A;  1CLQ A;  2KZM A;  1CXQ A;  3NGZ A;  4FLZ A;  3NH0 A;  4KV8 A;  3LWL A;  2IC3 A;  3RR8 A;  4CIE A;  1RDC A;  3LP1 A;  4J2A A;  3AVC A;  1KCF A;  4RW4 A;  2KQ2 A;  3VQ7 A;  3DRP A;  4CJ3 A;  3LZJ A;  4JS4 A;  3V9S A;  4DWI A;  2KW4 A;  2HNZ A;  2ETJ A;  3D45 A;  1U04 A;  4CEB A;  2DFH A;  1RBV A;  3KKR A;  4O0I A;  3OYI A;  4DLE A;  3SQ1 A;  2VG5 A;  4FW2 A;  1XI1 A;  4Y1D A;  1NKB A;  1QTM A;  2VWK A;  1NK4 A;  2F96 A;  4Q5V A;  3P5J A;  4Z4F A;  4FJJ A;  1NK5 A;  3HL8 A;  1ITG A;  3K57 A;  1J9A A;  1RT5 A;  2F8S A;  1JLQ A;  4FK4 A;  5HRR A;  2G8H A;  3CG7 A;  1U49 A;  4CJE A;  1JLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...