2F4VK

30s ribosome + designer antibiotic
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2f4vK00
2UU9K 4DUZK 2HHHK 3T1YK 4LFAK 1HNXK 4JYAK 4GKJK 4V19S 2UUAK 1XNQK 4DR2K 4DUYK 3J7YP 2ZM6K 2VQFK 4JI1K 4LF5K 4JI5K 4JI7K 4DR7K 4DV2K 3J80O 1J5EK 4X64K 1IBMK 4LF8K 4K0KK 4JI8K 3J81O 4DV5K 4CVNE 1XMQK 4X62K 4LFCK 1N34K 3OTOK 4JI0K 1N36K 4YHHK 4NXNK 3JAMO 5AJ3K 4CW7B 4DV4K 1N33K 5IT9O 1FJGK 2F4VK 4X66K 4GKKK 3J7AP 1XNRK 4X65K 4AQYK 4JI3K 4LF6K 4DR1K 1HNWK 4DV1K 1HNZK 4JI6K 4DR4K 4DR6K 4OX9K 4DV7K 2UUCK 5FLXO 1IBLK 4B3RK 2VQEK 3T1HK 2UXCK 5IWAK 5LMNK 4JI2K 5A2QO 4YY3K 4LF4K 2UUBK 2UXBK 1I94K 4DR3K 1XMOK 2E5LK 4B3MK 5LL6Z 2UXDK 1N32K 4DV3K 4KHPK 4LF9K 1IBKK 1HR0K 4NXMK 5BR8K 4JV5K 4DV0K 5LMUK 4B3SK 4B3TK 4DV6K 4LF7K 4JI4K 4DR5K 4LFBK
chains in the Genus database with same CATH superfamily
3CYMA 1VQ7N 4M3RA 3VF6A 1YTUA 1QQNA 3CC7N 3QIPA 3UKRA 5C10A 4CF2A 3DM2A 2GEMA 2B6AA 5AFUH 2HNZA 1DLOA 4DUYK 4FVMA 3VQCA 4YOYA 1NGFA 4BR2A 4B8AB 1RBSA 2QWPA 1BA0A 2YNHA 2EX3A 4ID1A 4PKGA 1KC8O 3AA2A 2Z1JA 4HTLA 3OYGA 4RWTA 3RR7A 2E2NA 4CVNE 3CCSN 4J2AA 4KHUA 2ZGZA 3P38A 4FJJA 3GOIA 4MFBA 1FKOA 3VEZA 4FJIA 3MEGA 3U3GA 1QZ6A 4PKIA 1TUUA 3O08A 1GLJO 2PY5A 3MWPA 1NK5A 4DSFA 3SUOA 1XNRK 1HKGA 4A62A 2D0BA 2XY8A 3K5MA 3NF9A 3OJSA 2CH5A 3D6RA 1TL3A 3LP0A 4DTXA 2NRRA 4LF6K 3TARA 3B6OA 3AVGA 3C95A 3OYMA 3WEEB 3DLKA 3I56N 1K8KA 2G8HA 3MK6A 3PSFA 4JK7A 3WNHA 4FZYA 4BRMA 5E84A 4F2SA 4BC2A 4OKJA 5AR0A 4JS5A 4B1YB 2KZMA 3JXUA 5BREA 1RBTA 3A5LC 4Z0UA 3NFAA 5KRTA 1SS6A 3O3GA 1JLFA 1D9FA 1XWLA 5BN9A 1E4FT 3VPZA 3FFIA 4DQSA 2UXDK 3CCRN 2O8EB 3DAWA 3A8YA 3CM5A 3ID8A 1VSFA 2LSNA 5K14A 4KB0A 4BQZA 3IRXA 1SQKA 3T19A 4BRKA 1GLEG 4CE9A 5DM6L 1S9EA 1FW6A 1Z25A 3JYTA 3WXMB 1KFDA 5GIPA 1CZAN 3D45A 1JLGA 5TKWA 1LV5A 1NGHA 4H8KA 3SZ2A 5BPNA 5BPMA 3VQEA 3E1YA 4CEDA 4LC9B 3C6AA 3CJCA 4MO4A 4DG1A 3V9ZA 1RTDA 4R79A 4LSNA 5J2MA 5T7BA 3NAEA 4K25A 3OYCA 5H1SQ 3TAGA 3L2RA 4CZKA 1NJWA 1ATNA 5DK5A 3U9ZA 2RN2A 3RMAA 4M7YA 1Q9XA 3PY8A 1T6CA 3ZT4A 5AQHA 4AHCA 2G8UA 1CLQA 1ZBLA 5M1PA 1N6QA 1DKGD 2ZE2A 4HWIA 4OGEA 1DTTA 1U49A 1W97L 3O4WA 3CFOA 4CF0A 1TAQA 3OBYA 4H0PA 4ELVA 4F2RA 3ZT2A 3RTVA 1K73O 3MECA 3QB0A 3HK2A 5AQNA 4CEFA 4KREA 1HNVA 4AH9A 1IKYA 3TPQA 2IOCA 2QWLA 2DFEA 3O9SA 3DJCA 1BCOA 4FWNA 4KI4A 3IFRA 3LDLA 3PX6A 1GLLO 4NCAA 2HW3A 4BRLA 4DTUA 2AP1A 1RBUA 2I7PA 3C65A 3RR8A 1YJNN 4M3XA 4FOIA 3D7EO 1NOYA 4M3UA 2F9TA 4RW6A 3V4IA 4CFBA 3K5NA 3L4QA 4KTQA 4FWKA 5FPEA 2ASPA 2ETJA 2CGKA 1HKCA 4I9QA 1NKBA 2QWRA 5CYMA 1ZBIA 3ITHA 4LFBK 4B9VA 1S1UA 4Z4CA 3LDNA 1Q9YA 3ISNC 1UOCA 3MDQA 2OANA 2QXFA 2RHKA 4GKJK 3AGRA 1NNEA 3SYZA 4DF8A 2G8IA 2ZM6K 4ZHRA 4PWDA 4BY9C 3CPEA 4M45A 4IOAL 5JICA 2HHXA 4PA1A 4W5TA 3NGIA 4B1VA 3O9RA 5EX5A 2I5JA 4U67L 3H3OB 3UE5A 3TAFA 5I3UA 4I6MB 3L2VA 3N4QA 4ELTA 2QWOA 2WOMA 4BRPA 3GBTA 4IJNA 3SPZA 3CQYA 4NLCA 4IDHA 1VRUA 3CD6N 5GAHP 2KZZA 4H5TA 3W0LA 2YNGA 3NF8A 3BY5A 1WSIA 1JJ2M 3FZHA 2EHGA 4CCHA 4ILGB 1S3XA 4H5VA 3HZ6A 2NLXA 3WXKA 5KPZA 4CFAA 2X74A 4BQLA 3AVAA 2KKZA 1Z26A 1RT3A 3BUZB 1VQMN 3AY9A 1HNWK 1YAGA 4FLZA 1T03A 3K2PA 1C1CA 1EETA 4JKHA 4FPAA 2HBKA 4DU4A 1X3MA 3QNOA 4HUGA 2VGNA 4FXDA 3H45C 2UUCK 3AAQA 1C6VA 1NWKA 4G1QA 5FLXO 1KAYA 1B92A 1EWRA 3PX0A 4JAXA 1T3VA 3HPHA 1RBVA 1GOBA 3B8AX 3I33A 4OVLA 1C0FA 3HSTB 3KZBA 2AA4A 4CJPA 1I3AA 3TANA 2FSJA 2VGMA 4DTRA 2I7NA 3SV3A 1TGOA 3CPWM 1IO2A 1GLAG 1C0GA 2FLOA 4FJNA 2GX9A 2WUSA 2FC0A 3KWIA 5EU7A 1IBKK 1WNSA 1U04A 1B9FA 1MA9B 4DV0K 4DWIA 4WFAL 4OJRA 3WNGA 3M1FA 4FLWA 2IAJA 3QERA 5SWMA 4CHPA 3VQPA 3DLHA 1IKWA 1ZBFA 4DQ8A 3A0IX 3AVKA 4FJGA 1G15A 2UUAK 1YF5L 1OKJA 4FZZA 5TKYA 3V1OA 2EWSA 4EP4A 4CIEA 4WFBL 1TKTA 3M8SA 3VTIA 3FZLA 3OYJA 4DV2K 4DTSA 1U45A 2XHBA 3VQDA 4GV3A 4CFDA 2VG6A 2V7YA 3SUQA 2F8SA 4E3SA 1IBMK 1UAXA 4K0KK 4JKAA 1NK4A 2BTFA 1OVYA 3S9HA 2NRXA 3VEOA 3MN9A 3AVNA 5GAGP 4CZMA 2OTJN 3C0BA 2Z1GA 4GNIA 4YOVA 3I8BA 4ICLA 2BANA 4M41A 1R59O 4CW7B 3CFRA 3P83D 3CJ9A 1FJGK 1KTQA 3SMPA 4FJ9A 1K8KB 5AQIA 3GL1A 2PYLA 1FKPA 1WBDA 2HHVA 2P9UA 1L3VA 4E19A 3EZ5A 3SQ4A 2HBJA 1LCUA 1KAXA 1Q8IA 3HI0A 3VGMA 4CECA 3LDPA 3DXMA 4J8FA 3P5JA 2IS3A 3LM9A 4DSKA 1NKCA 1ZBUA 4BRFA 3VEXA 3NCIA 2A41A 5CZ2A 3K9KA 4JI6K 3HYFA 2HHTA 4BC3A 1QS4A 5KI6A 3I8DA 4OX9K 4IOCL 4EAHD 3THVA 2BGGA 3FGUA 4DFKA 3OS0A 3NE6A 1U48A 4CEZA 4HCCA 4YOWA 1NK6A 5EOYA 3RMDA 1T8EA 3LWMA 4F3OA 3C6HA 1WAJA 2UXBK 1JLCA 2O8CB 4BRDA 1QE1A 4DR3K 2IVPA 4DV3K 1C0MA 5FRNA 3QEPA 3TAPA 1YI2N 2IIRA 1ZC6A 5ELZA 3AVHA 3MN5A 3TSQA 1SKSA 3AGKA 5GIOA 2O8CA 4B3SK 4B1ZA 3OJUA 3O1BA 1ITGA 3A5OC 5JMVA 3MXMA 3AO3A 4C8KA 4FZXC 2RKIA 1Q7YO 4OKEA 1EP4A 2HBLA 4CZJA 2QA4N 1BWFO 2DY4A 3HP9A 1KXPA 3SBGA 4DQQA 1TK8A 3CQXA 4BR9A 1JCEA 4ZTFA 1JLQA 2QKBA 5CR4A 4DFPA 3R6MA 5SZTA 4BRQA 4IZ9A 3J81O 2NRTA 4CJUA 3HPGA 5JLHA 1ATRA 3RMCA 4E1JA 3NGYA 4CD3A 4K43A 1TKZA 4J2DA 1IKVA 2A40A 5HRNA 4OLBA 2VYPA 4JRQA 3TR8A 2FBYA 2F4VK 2PAVA 4O8KA 5C42A 1NK9A 3C6UA 3H46O 4IDKA 1GLBG 3OYLA 4Z4FA 1BDGA 1YT3A 1EX4A 2YJFA 1BCMA 1S6PA 3DXKA 5EY4A 2BE2A 5KRSA 4KAZA 1WOQA 2NRHA 4CJEA 2QW9A 3CXCM 4KPYA 3CCLN 3L0QA 1ATSA 3TI0A 2PZSA 3CCUN 3S3OA 5F1XA 3EE8A 4BC4A 4RW4A 1WLJA 1HLUA 3THXB 2YHAA 1BL3A 3O3FA 5AQJA 1KCFA 3VF4A 3PIOL 2XRIA 3KK1A 4K8ZA 4FW1A 3HJFA 4YY3K 3LM2A 3EY1A 4CJRA 3EN9A 4F8RA 1I94K 3QLHA 1HYSA 4RTFD 4C1NK 4LF9K 3RMBA 3KJVA 5J2QA 3OVNA 4JKBA 4DLEA 2ITGA 3K5OA 4E7LA 1XHZA 1HPMA 3NGZA 3HXMA 2P9IB 4H0YB 4QAGA 3VF2A 5M1NA 4DSLA 1VSEA 3Q7CA 3SMSA 4MDBA 2J4RA 3F73A 3BZCA 1NKEA 1EO1A 1GLFO 2ZJQL 1HPZA 5EXWA 4BRHA 2E6LA 4LF8K 4NCBA 4JI8K 1RDAA 2E88A 3QETA 1ESVA 1NMDA 4IFYA 3F9KA 2CH6A 3M8RA 3E9PA 4CJLA 1NJIO 2GWJA 5M1KA 2P5OA 1LWCA 2OPQA 2G8WA 2P9NA 4WYBA 1ZXOA 2A3ZA 1LAWA 4FWMA 3MAQA 1JXEA 4X66K 4E7IA 3ZSQA 1KQSM 4WFNL 4N5SA 3VETA 3C7NB 4B9QA 2DFFA 1RFQA 4X65K 3DI6A 3U3YA 5GAEP 4DTJA 3DXMB 3QMLA 4CJWA 3CQ8A 5CHIA 4J2BA 1ZBHA 1O1WA 2IGIA 2OZMA 1UA0A 1E3MA 4FJMA 1YJWN 4CGDA 4DR6K 1X3NA 1NK0A 4CGFA 5F0XA 3L8BA 4BRCA 5AQOA 1YXQA 1HKBA 5FDLA 4MQ3A 1X1PA 5C15A 3T1AA 1VQ4N 2X6SA 3CETA 4DTOA 3HO1A 5ADXH 5BRFA 4GV9A 2G8FA 2E5LK 4B3MK 5LL6Z 3VQ6A 4Q5VA 2P9UB 4KHQA 4H0OA 2ZF5O 2PYJA 4IBNA 3NMUA 1HQEA 4O44A 5AZJA 2D1KA 3MXIA 1LOTB 4RW8A 4CJFA 1C1BA 4CGGA 1HRHA 4B3TK 5J2PA 4LF7K 4AILC 2Q2RA 3KLGA 4DUZK 1H1VA 3HSCA 3U8XA 3L2WA 3KLHA 1HNXK 1RTJA 4FLTA 2V7ZA 1S6QA 2VG7A 3VQ7A 4JLHA 3V9WA 3HVTA 3HM9A 2VWBA 3ASMA 3J80O 3D2EA 3O9TA 4DKWA 4EHUA 5JVHL 4CF1A 3CI5A 2KHOA 4IFEA 4YFUA 2F7TA 1BI4B 5BR9A 4Y1CA 4JNEA 1NLVA 2ZJPL 1Y64A 4FWRA 1D8YA 1XHXA 3WNFA 1B9DA 2KW4A 2G8VA 4EFHA 1U47A 3NHGA 3PV8A 4A5BA 3HPOA 3DLEA 3VA0A 3N4PA 4KTWA 1R0AA 3L2UA 4AQYK 4NB4A 5JS1A 2A1RA 3SUNA 5LJVA 3O4QA 5M1FA 3CMEN 4DSJA 2E2PA 5FPDA 2VWKA 4FLVA 3NH0A 3C7NA 4CEEA 3KLFA 2FBTA 2W42A 1KVAA 1O13A 1MDUB 2OPRA 2HSTA 4DR4K 1P8ZA 3AARA 2P9NB 4H4MA 4LY7A 1ZYQA 1UWBA 3H3NO 1RDCA 3O1WA 4O4GA 1X9WA 5F2RA 1IBLK 4CJ3A 4O5BA 1JXBA 4BREA 4NCGA 4WCEL 2YHBA 3E9OA 2Z1IA 5I42A 5AQTA 2QXLA 4O8UA 3HP6A 5AQSA 4Z4HA 1BOTO 4BACA 1VQ9N 1RT6A 5HBMA 2HHQA 3P39A 4CERA 3IS9A 4IWVA 5BR8K 1SUQA 3V9UA 3EKUA 3ALYA 3M8QA 5LMUK 4AHSA 4PL7A 4H5NA 4DR5K 3PX4A 1X9SA 4A2BA 3CCEN 3TWHA 4H4OA 4CZFA 1LWFA 1F21A 2HNYA 5E26A 3ZX3A 4CIGA 4JI7K 3G10A 4FWPA 2Q3SA 3HL8A 3V1QA 2YJEA 4DF4A 5AQQA 5LY3A 5AZIB 4KRFA 1C1AA 5I9EB 5D3GA 3S3MA 3D2FB 3UKRB 1JLEA 3CF5L 4CF8A 5HROA 4JK8A 2A42A 3VTHA 4RW7A 1V4TA 4GKKK 3J7AP 4I7FA 2D0OA 4CZHA 1WUAA 4QS9A 4ZTJA 3UB5A 3H1VX 1BIUA 2FBXA 4F3TA 2NRZA 3SCXA 4CD1A 3ATUA 1A5XA 2Y1IA 1M1KO 5CE3A 3KD1E 1RNHA 5C24A 4OLAA 3DOLA 3RVCA 3FZKA 4BR7A 4AHTA 3LDOA 1S1WA 3HOSA 3AVLA 1KVCA 3VERA 1JLBA 3CM6A 3SQ2A 3F5TA 3LP1A 4OKKA 5KQ8A 2UXCK 1IKXA 1RT5A 2KLAA 3ENBA 4DLGA 4H0XB 2Q1NA 5AQLA 1RGIA 1X9JA 2ASMA 3L3VA 3EZWA 5FPNA 4LF4K 3IKMA 3UKUB 4E7JA 2CGJA 1WN7A 2P9SB 3CCJN 4FM2A 3THWB 3OS2A 4L8RB 3VQ8A 3T69A 3LDQA 1LW2A 3QDKA 4CF9A 1L3TA 1LWEA 4DTPA 3HT3A 2BDPA 4IXCA 4UQGA 3RSEB 1NGJA 3TTCA 4BG9A 1TKDA 2HHHK 4QCLA 1KAZA 1VSDA 4DU3A 4BRGA 1YUWA 4F9OA 3HVRA 4FLXA 3J7YP 2YNIA 1QSYA 1M90O 3K5LA 5ADXA 5LJWA 4HCBA 3SLCA 2HNDA 3E01A 3K0SA 1DT9A 2GTDA 4KH4A 2RPIA 1QVGM 4B9NA 4J2EA 3ZT0A 3O8MA 4M42A 2NRVA 4C23A 4JRPA 5AJ3K 3IDHA 3HOTA 2QWMA 2O8BB 5GADP 2DFHA 2X78A 3FZMA 3PO4A 3SUPA 5BN8A 5CYQA 3B6PA 1KFSA 1V4SA 5C2FA 1BIZA 2VG5A 1YHQN 1RT7A 1Y97A 1XC9A 3ZLJA 2QWNA 3LZJA 4B08A 1HX1A 4Z4EA 3BP8A 3VQ5A 3VEWA 1U2VA 3ZSOA 1WBBA 3SNNA 1K8AO 2O8BA 1OH7A 2E8AA 1X9MA 1MU2A 4MO5A 4M3TA 2Q0UA 1EKEA 2QI2A 1J9AA 2XY5A 3R1XA 1QQCA 5IWAK 3J7ZO 3DLRA 4IG0A 1Q82O 2HOEA 5AQWA 3S3NA 2AJQA 1DGKN 3S41A 4M7XA 2P9KB 3P4IA 4WF9L 1XMOK 2D5RA 3AA5X 5MLCQ 1ASUA 4B8CA 1JKHA 4I6MA 4ELUA 1NOZA 1HR0K 2E1YA 3BZKA 4DS5A 4BGAA 3IG1A 1TYQA 4CJ4A 1WSHA 4CIFA 1D4XA 3QEWA 4BDYA 4JI4K 3EEQA 3AO4A 4OO1J 3NH2A 1CZ9A 1NGAA 1LW0A 4JD2B 4FWSA 3T1YK 1J53A 1VRTA 4V19S 1S72N 3LWLA 2XO7A 3ZSYA 2ATQA 3ZEUB 2IVNA 1J5OA 3HBTA 2UYTA 3VQAA 5EVZA 1KLMA 3VGKA 3OYHA 4CGHA 3QBWA 4FLUA 4B9LA 3TTFA 3DLBA 1QQMA 1REVA 3RRHA 2D0AA 1HYZA 3ENOA 3CJAA 3TTDA 1RT4A 1TKXA 3OA9A 4YHHK 2JWLA 4WQ5C 3JAMO 1FXXA 5AQYA 4FL9A 4AHUA 4N47A 1BGXT 1JCGA 2P9LB 1D5AA 1J54A 3L2QA 3NF7A 4JEPA 2QK9A 1KVBA 2V51B 2HBMA 1TK0A 3OYEA 3V9XA 3THWA 4JI3K 3ZSRA 4FSVA 4XH1A 3WQUA 3VEYA 2Q36A 3WXIA 4FWLA 3ZT1A 1RILA 2RF2A 3E66A 3NBPA 1SL2A 3PO5A 4CBUA 3VEVA 3CC4N 3J8AA 3LZIA 3WXLA 3RRGA 3NVMA 1QHTA 4CHOA 4IOXA 4E1NA 4FCYA 3DXKB 1C0TA 2E20A 2XY7A 4JKGB 4DQRA 1VAZA 4CBXA 3T1HK 3AA3A 3LAKA 2HMPA 2ZD1A 5BPLA 4GY2B 2HHUA 5LMNK 1S22A 4W5NA 5AQGA 4A61A 4E1MA 4GVMA 1W2BM 1BISA 4FJ8A 2WONA 1YVUA 1NBWA 5AQZA 3MX2A 3NF6A 1VQ5N 3WUHA 4Y1DA 3K59A 1TK5A 1W0HA 3ATVA 3C6TA 2ITMA 4O0JA 5GINA 4NXMK 3VGLA 4JKEA 2OCEA 4CGIA 3DLGA 2PFUA 4KO0A 4EZ9A 2GELA 4YDUA 3ZSXA 3KLEA 3SV4A 3A5MC 3QNNA 3ULDA 1VQPN 4BRIA 2O8FA 4JI1K 4AM7A 4JI5K 3LANA 1SL0A 4K8XA 3CCQN 4MLEA 4BWJA 4K41A 4FJXA 1TYQB 4ILHA 3CERA 3V1RA 3M3ZA 3H08A 4YOTA 3A2FA 3VQ4A 3MWTA 4DB3A 1NGGA 5BRDA 1RCHA 2FSKA 3VQ9A 5HL7L 1SAZA 3VN5A 4M3WA 1W9HA 3F9MA 4CI6A 4HHTA 4UY8O 1XI1A 4IFVA 2NUBA 4MLHA 4FJLA 1VSKA 4XEIA 1BG3A 2Q31A 3ZX0A 3PLAA 3O9UA 4E7HA 4FK0A 4Y0WA 4FOEA 1SKWA 3BEXA 4N76A 4W5OA 4CHZA 2P1JA 1VSHA 4CK2A 5AQUA 3AVBA 1WSEA 1JL2A 3KTQA 1U2VB 1NGEA 3WT0A 4IO9L 1CXUA 4LSLA 3L4IA 2NNWA 1K9MO 4DTMA 3QIOA 2IDOA 2D0PA 4JHDB 3NDKA 4DSIA 1XQSC 3W3DA 3H6EA 1QSLA 2BH1A 4YDUC 1MWKA 4B1WB 2HHWA 2W41A 5DMRA 3CJ1A 4JI2K 2W6LA 3P1GA 4OGCA 2B5JA 2BUPA 3SQ0A 5BRHA 1IG9A 2UUBK 1WSFA 4LH4A 1T6DA 1QVFM 4K42A 2V52B 3FFKB 4B3OA 3TAMA 4BGBA 1ZBSA 1NGDA 2OZSA 1XC3A 4JHDA 2ASOA 3THYA 3G6EN 2H3GX 1NGBA 4F4KA 2FBVA 1P90A 2UU9K 2P9LA 3C94A 3VQBA 3VA3A 1NG9A 3KK2A 4C8OA 2HVHA 3KKSA 4DCHA 3EO3A 2QTDA 2RE2A 3OBWA 4Q0BA 4H5RA 1VHXA 1UA1A 3K57A 4DS4A 2VQFK 2F9WA 5CZ1A 1NJXA 2WC9A 2CGLA 4W5RA 2WFBA 1J5EK 4X64K 1A5VA 4EIAA 4DMNA 1RTIA 5HOOA 4N56A 4IKFA 4WE1A 5FROA 3DWLA 3QINA 3JSMA 1RT2A 4PHTX 1NM1A 3T7ZA 4EP5A 4X62K 3I0RA 3NH1A 1TAUA 4Z4IA 4E89A 3OTOK 4BRNA 3O3HA 3MX5A 1NJZA 4NXNK 2R7YA 1YIJN 4BDPA 5AQKA 1WAFA 3AVFA 3HRGA 4HUEA 3QESA 2P9PB 3IMXA 3WEEA 3SPYA 3R3LA 4KV8A 2P5GA 1Z05A 1QQOA 1TV6A 2DPNA 3LPTA 1N5YA 3EL2A 1S1XA 3M8PA 1U4BA 3AA4A 1CXQA 3GDQA 4DR1K 4QS7A 5HRPA 3OYKA 4CJKA 2P9KA 3BGRA 1YVNA 3SAHA 1GOCA 4YOXA 4C8NA 3DLLL 4KH6A 3MCPA 2YKNA 1VQON 4DV7K 1QSSA 3TSPA 4PKHA 1ASWA 1BQNA 2QWQA 4CFCA 4HVJA 4Z4GA 1NGIA 4CJTA 4A2AA 3Q7BA 3AO1A 2ZWHA 1RTHA 1VSJA 3ID6A 4ISGA 4M3ZA 1KD1O 1U6ZA 1GLDG 4JV5K 3LAMA 4QS8A 3SAFA 4NYNA 4B9UA 1JL1A 4BROA 1Z6RA 3MXJA 3KVGA 4LH5A 3FLCO 3CMAN 4FJHA 5C25A 2OYQA 1BO5O 4H5WA 4C8MA 4FPBA 3G4SN 1RBRA 3KLIA 3SI6A 1GLCG 2KTQA 2HHSA 2YHXA 1HQUA 2OPSA 4AF1A 4PQUA 3LP2A 2YHWA 2X6NA 5HP1A 3O5BA 1XUPO 4C1NI 4CEAA 3V81A 3QFPA 5AZJB 4M3YA 4ID5A 4FM0A 4GVEA 4YNQA 1YJ9N 3T3FA 1VSLA 1S1TA 3TAQA 4PUOA 3IUCA 4CZEA 1HJOA 2E2QA 5KGWA 4DV4K 4XIUA 4BVOA 4H0TB 4AHVA 3K58A 2OTLN 4KHYA 1BA1A 1IH7A 1NU0A 3ZX2A 4CGJA 4CK1A 3ZCMA 3TU5A 4KHSA 1S1VA 1RT1A 3ZEUA 5JS2A 4B9MA 4CK3A 4HUFA 2KFZA 4CHNA 4W5QA 3AVIA 3MN7A 4ISEA 1BI4A 3AVMA 4KHNA 2GWKA 3BDPA 4Z94A 4CEQA 3UKUA 3EYZA 4DV1K 4C8LA 3D2EB 1HNZK 3LALA 4BC5A 1MWMA 2PBDA 4CJ5A 4GV6A 4WQ4C 3CFPA 4ILJA 4DFJA 4KI6A 1KRPA 5AQPA 2FSNA 1SL1A 4OPAA 5HLFA 4XH5A 2IC3A 3ZT3A 2VQEK 3ZSVA 3OS1A 2HMIA 4E0DA 4BR4A 3QEIA 2QKKA 3U6FA 1LAVA 1ASVA 4A5AA 1T05A 5KGXA 3KKRA 3ZETB 1QHAA 5C12A 3SBTA 3M6GA 4FJKA 4BE0A 3MEDA 3PUFA 3LDSA 4CZGA 3OYDA 1N32K 3L6QA 5C2DA 1KSPA 1SZ2A 1HNIA 3DYAA 4FLYA 3O4NA 3ULEB 3VESA 3O6WA 5B8HA 2VWJA 1KLNA 2A6AA 2B4JA 3CJBA 3VMFB 4JKFA 4QOZB 4EZ6A 3VOVA 3SQ1A 1WB9A 3G0ZA 3CJ7A 3E9LA 3JS6A 4B9TA 3FR0A 3PSIA 3TABA 1XNQK 3G71N 3QFUA 1RDWX 1TUYA 4DTNA 5JVGL 4FM1A 2O4IA 4I9LA 1HMVA 4KB1A 4BVPA 4CHQA 3AO2A 3DRSA 5HRRA 1L5UA 4FO0A 4NYFA 3CG7A 4CJQA 4L3QA 1A5WA 1VQKN 3R9PA 3OYIA 1HUXA 4IEEA 4HTUA 5KPTA 4KH5A 4KTZA 5AQFA 3ULEA 3WXJA 3MMVA 4KHWA 4LFCK 4DQPA 4CEOA 1GOAA 3KK7A 4WQ4A 4BDZA 2F96A 3IAYA 3I55N 4G9ZA 2HVIA 1N33K 3M5RA 1DTQA 2ZGYA 3EE9A 2YV0X 3WQTA 3TSUA 4CJ7A 5CY4A 4XH4A 1S5JA 4OPKA 4IEIA 3TAEA 2FF3B 3OW2M 2P51A 2VCPA 3PIPL 3MEEA 2F8TA 4RW9A 4PL8A 4YOUA 1OH6A 4JKDA 4M63C 5E41A 4KFBA 2YCHA 3ZYYX 3DOKA 4CJSA 4JKGA 4DSEA 4I2QA 1WSJA 1C0UA 2YKMA 3QO9A 4JK9A 2KFNA 2OPPA 3KHYA 4FWQA 1IG8A 2ZQBA 1VK0A 5M1OA 1SKRA 4GW6A 3CCVN 1Q86O 1FK9A 4NLBA 5AFUA 1NK7A 4BR5A 1OH5A 1BHLA 2W40A 2YNFA 1T7PA 5AQXA 3QEXA 4IO8A 3NVKA 5J2NA 4LFAK 4MDAA 4CEBA 2Y1JA 3WNEA 4FVUA 4AM6A 2YHYA 4LF5K 3D0PA 4DR7K 1K6YA 3I0SA 1NMNA 2Z1HA 2G8KA 1EWQA 4CBWA 3AAPA 3O9QA 5AQMA 4N41A 3AV9A 3HM8A 4AHRA 3SAGA 4U7BA 1VQ8N 3OYAA 4KKOA 1L3UA 4JN4A 3K9JA 1XMQK 5M1QA 4B1UB 1WSGA 4OPHA 4DQIA 4JI0K 4JS4A 1OH8A 1IV0A 3O80A 1L3SA 5IT9O 2E6MA 5KTQA 2HF3A 1I39A 2JWKA 5JLFA 3HTVA 4A59A 1NK8A 4H03B 4CHYA 2GV9A 5FRMA 1HJRA 3THXA 4IG3A 2E2OA 5KQDA 2GUPA 1TL1A 3KD5E 2Q97A 2O8EA 3CHWA 2A1SA 4PY5A 1EXQA 2D4WA 4O5FA 3DMJA 3CC2N 3L3UA 3MCAB 3VENA 3OYBA 2JLEA 1VQNN 5DM7L 1J6ZA 1VSIA 2D0CA 4FWOA 4WQ5A 3UIQA 4FJ5A 3V6DA 3ENHA 3OY9A 4GMJB 1BQMA 3LP3A 1VQ6N 4B3RK 2KQ2A 4R5PA 3H1QA 4FJ7A 2OA8A 1ILYA 2QM1A 2GUIA 3AVJA 4FYDA 1T44A 4KBOA 3D2FA 3SJHA 5AZIA 4CZIA 2DTUA 1VSMA 3SJJA 5AQVA 2O4GA 1E4GT 1EQYA 3DRPA 1Q18A 3DRRA 2E1ZA 4NO7A 2YI1A 4FK2A 4DFMA 2E4LA 2P9IA 5C0YA 5FPMA 3KWGA 1BUPA 1G99A 4I2PA 4JYAK 1OVQA 4E7KA 4DR2K 3U9DA 3BF1A 4RG8A 1W7AA 4OPJA 1CZBA 2NRWA 3KIOA 3R8EA 4TSXA 3KK3A 3ZETA 2WTUA 4B9SA 3SK3A 1NGCA 4BWMA 4DV5K 2O8FB 1RDBA 1HYVA 3QICA 2FXUA 3CCMN 1N34K 5KPRA 1N36K 2JGUA 3QEVA 3U4LA 2P9SA 2WBNA 2P9PA 1Q81O 1IJJA 2YX6A 3RSEA 4BRAA 3GG4A 3OYNA 2W6KA 1TVRA 1NJYA 3AO5A 3AVCA 2NZTA 3LL3A 4YORA 5AQRA 3MN6A 4BG8A 1QZ5A 4A57A 4FW2A 2HF4A 1JLAA 5HRSA 2ZJRL 4JKCA 3VQQA 4EHTA 3BF3A 1YITN 3P31A 4BE2A 5J1EA 4RCHA 4BR0A 1VQLN 4B1XB 2IVOA 1BU6O 2Q0RA 1N8RO 4O55A 3F2KA 1QTMA 1DEJA 3GE1A 4DU1A 2FF6A 3LPUA 4CJVA 1RDDA 1YTAA 4FK4A 3QBXA 5A2QO 1D9DA 4CESA 3CIPA 2XY6A 4ISFA 2GBZA 3FZFA 3THYB 4BE1A 1RDUA 3OHRA 4O0IA 2O8DA 4H0VB 1S9GA 2QEXN 3FE1A 4KHPK 4DHYA 3OYFA 3A5NC 2A5XA 1SV5A 4IJAA 2O8DB 3ZSZA 4CZLA 2HB5A 4LD0A 4JD2A 3EKSA 3ZSWA 3G25A 4DV6K 3RWUA 1JCFA 3V9SA
chains in the Genus database with same CATH topology
2UU9K 4DUZK 2HHHK 3T1YK 4LFAK 1HNXK 4JYAK 4GKJK 4V19S 2UUAK 1XNQK 4DR2K 4DUYK 3J7YP 2ZM6K 2VQFK 4JI1K 4LF5K 4JI5K 4JI7K 4DR7K 4DV2K 3J80O 1J5EK 4X64K 1IBMK 4LF8K 4K0KK 4JI8K 3J81O 4DV5K 4CVNE 1XMQK 4X62K 4LFCK 1N34K 3OTOK 4JI0K 1N36K 4YHHK 4NXNK 3JAMO 5AJ3K 4CW7B 4DV4K 1N33K 5IT9O 1FJGK 2F4VK 4X66K 4GKKK 3J7AP 1XNRK 4X65K 4AQYK 4JI3K 4LF6K 4DR1K 1HNWK 4DV1K 1HNZK 4JI6K 4DR4K 4DR6K 4OX9K 4DV7K 2UUCK 5FLXO 1IBLK 4B3RK 2VQEK 3T1HK 2UXCK 5IWAK 5LMNK 4JI2K 5A2QO 4YY3K 4LF4K 2UUBK 2UXBK 1I94K 4DR3K 1XMOK 2E5LK 4B3MK 5LL6Z 2UXDK 1N32K 4DV3K 4KHPK 4LF9K 1IBKK 1HR0K 4NXMK 5BR8K 4JV5K 4DV0K 5LMUK 4B3SK 4B3TK 4DV6K 4LF7K 4JI4K 4DR5K 4LFBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4DUZ K;  2HHH K;  3T1Y K;  4LFA K;  1HNX K;  4JYA K;  4GKJ K;  4V19 S;  2UUA K;  1XNQ K;  4DR2 K;  4DUY K;  3J7Y P;  2ZM6 K;  2VQF K;  4JI1 K;  4LF5 K;  4JI5 K;  4JI7 K;  4DR7 K;  4DV2 K;  3J80 O;  1J5E K;  4X64 K;  1IBM K;  4LF8 K;  4K0K K;  4JI8 K;  3J81 O;  4DV5 K;  4CVN E;  1XMQ K;  4X62 K;  4LFC K;  1N34 K;  3OTO K;  4JI0 K;  1N36 K;  4YHH K;  4NXN K;  3JAM O;  5AJ3 K;  4CW7 B;  4DV4 K;  1N33 K;  5IT9 O;  1FJG K;  2F4V K;  4X66 K;  4GKK K;  3J7A P;  1XNR K;  4X65 K;  4AQY K;  4JI3 K;  4LF6 K;  4DR1 K;  1HNW K;  4DV1 K;  1HNZ K;  4JI6 K;  4DR4 K;  4DR6 K;  4OX9 K;  4DV7 K;  2UUC K;  5FLX O;  1IBL K;  4B3R K;  2VQE K;  3T1H K;  2UXC K;  5IWA K;  5LMN K;  4JI2 K;  5A2Q O;  4YY3 K;  4LF4 K;  2UUB K;  2UXB K;  1I94 K;  4DR3 K;  1XMO K;  2E5L K;  4B3M K;  5LL6 Z;  2UXD K;  1N32 K;  4DV3 K;  4KHP K;  4LF9 K;  1IBK K;  1HR0 K;  4NXM K;  5BR8 K;  4JV5 K;  4DV0 K;  5LMU K;  4B3S K;  4B3T K;  4DV6 K;  4LF7 K;  4JI4 K;  4DR5 K;  4LFB K; 
#chains in the Genus database with same CATH topology
 3CYM A;  1VQ7 N;  4M3R A;  3VF6 A;  1YTU A;  1QQN A;  3CC7 N;  3QIP A;  3UKR A;  5C10 A;  4CF2 A;  3DM2 A;  2GEM A;  2B6A A;  5AFU H;  2HNZ A;  1DLO A;  4DUY K;  4FVM A;  3VQC A;  4YOY A;  1NGF A;  4BR2 A;  4B8A B;  1RBS A;  2QWP A;  1BA0 A;  2YNH A;  2EX3 A;  4ID1 A;  4PKG A;  1KC8 O;  3AA2 A;  2Z1J A;  4HTL A;  3OYG A;  4RWT A;  3RR7 A;  2E2N A;  4CVN E;  3CCS N;  4J2A A;  4KHU A;  2ZGZ A;  3P38 A;  4FJJ A;  3GOI A;  4MFB A;  1FKO A;  3VEZ A;  4FJI A;  3MEG A;  3U3G A;  1QZ6 A;  4PKI A;  1TUU A;  3O08 A;  1GLJ O;  2PY5 A;  3MWP A;  1NK5 A;  4DSF A;  3SUO A;  1XNR K;  1HKG A;  4A62 A;  2D0B A;  2XY8 A;  3K5M A;  3NF9 A;  3OJS A;  2CH5 A;  3D6R A;  1TL3 A;  3LP0 A;  4DTX A;  2NRR A;  4LF6 K;  3TAR A;  3B6O A;  3AVG A;  3C95 A;  3OYM A;  3WEE B;  3DLK A;  3I56 N;  1K8K A;  2G8H A;  3MK6 A;  3PSF A;  4JK7 A;  3WNH A;  4FZY A;  4BRM A;  5E84 A;  4F2S A;  4BC2 A;  4OKJ A;  5AR0 A;  4JS5 A;  4B1Y B;  2KZM A;  3JXU A;  5BRE A;  1RBT A;  3A5L C;  4Z0U A;  3NFA A;  5KRT A;  1SS6 A;  3O3G A;  1JLF A;  1D9F A;  1XWL A;  5BN9 A;  1E4F T;  3VPZ A;  3FFI A;  4DQS A;  2UXD K;  3CCR N;  2O8E B;  3DAW A;  3A8Y A;  3CM5 A;  3ID8 A;  1VSF A;  2LSN A;  5K14 A;  4KB0 A;  4BQZ A;  3IRX A;  1SQK A;  3T19 A;  4BRK A;  1GLE G;  4CE9 A;  5DM6 L;  1S9E A;  1FW6 A;  1Z25 A;  3JYT A;  3WXM B;  1KFD A;  5GIP A;  1CZA N;  3D45 A;  1JLG A;  5TKW A;  1LV5 A;  1NGH A;  4H8K A;  3SZ2 A;  5BPN A;  5BPM A;  3VQE A;  3E1Y A;  4CED A;  4LC9 B;  3C6A A;  3CJC A;  4MO4 A;  4DG1 A;  3V9Z A;  1RTD A;  4R79 A;  4LSN A;  5J2M A;  5T7B A;  3NAE A;  4K25 A;  3OYC A;  5H1S Q;  3TAG A;  3L2R A;  4CZK A;  1NJW A;  1ATN A;  5DK5 A;  3U9Z A;  2RN2 A;  3RMA A;  4M7Y A;  1Q9X A;  3PY8 A;  1T6C A;  3ZT4 A;  5AQH A;  4AHC A;  2G8U A;  1CLQ A;  1ZBL A;  5M1P A;  1N6Q A;  1DKG D;  2ZE2 A;  4HWI A;  4OGE A;  1DTT A;  1U49 A;  1W97 L;  3O4W A;  3CFO A;  4CF0 A;  1TAQ A;  3OBY A;  4H0P A;  4ELV A;  4F2R A;  3ZT2 A;  3RTV A;  1K73 O;  3MEC A;  3QB0 A;  3HK2 A;  5AQN A;  4CEF A;  4KRE A;  1HNV A;  4AH9 A;  1IKY A;  3TPQ A;  2IOC A;  2QWL A;  2DFE A;  3O9S A;  3DJC A;  1BCO A;  4FWN A;  4KI4 A;  3IFR A;  3LDL A;  3PX6 A;  1GLL O;  4NCA A;  2HW3 A;  4BRL A;  4DTU A;  2AP1 A;  1RBU A;  2I7P A;  3C65 A;  3RR8 A;  1YJN N;  4M3X A;  4FOI A;  3D7E O;  1NOY A;  4M3U A;  2F9T A;  4RW6 A;  3V4I A;  4CFB A;  3K5N A;  3L4Q A;  4KTQ A;  4FWK A;  5FPE A;  2ASP A;  2ETJ A;  2CGK A;  1HKC A;  4I9Q A;  1NKB A;  2QWR A;  5CYM A;  1ZBI A;  3ITH A;  4LFB K;  4B9V A;  1S1U A;  4Z4C A;  3LDN A;  1Q9Y A;  3ISN C;  1UOC A;  3MDQ A;  2OAN A;  2QXF A;  2RHK A;  4GKJ K;  3AGR A;  1NNE A;  3SYZ A;  4DF8 A;  2G8I A;  2ZM6 K;  4ZHR A;  4PWD A;  4BY9 C;  3CPE A;  4M45 A;  4IOA L;  5JIC A;  2HHX A;  4PA1 A;  4W5T A;  3NGI A;  4B1V A;  3O9R A;  5EX5 A;  2I5J A;  4U67 L;  3H3O B;  3UE5 A;  3TAF A;  5I3U A;  4I6M B;  3L2V A;  3N4Q A;  4ELT A;  2QWO A;  2WOM A;  4BRP A;  3GBT A;  4IJN A;  3SPZ A;  3CQY A;  4NLC A;  4IDH A;  1VRU A;  3CD6 N;  5GAH P;  2KZZ A;  4H5T A;  3W0L A;  2YNG A;  3NF8 A;  3BY5 A;  1WSI A;  1JJ2 M;  3FZH A;  2EHG A;  4CCH A;  4ILG B;  1S3X A;  4H5V A;  3HZ6 A;  2NLX A;  3WXK A;  5KPZ A;  4CFA A;  2X74 A;  4BQL A;  3AVA A;  2KKZ A;  1Z26 A;  1RT3 A;  3BUZ B;  1VQM N;  3AY9 A;  1HNW K;  1YAG A;  4FLZ A;  1T03 A;  3K2P A;  1C1C A;  1EET A;  4JKH A;  4FPA A;  2HBK A;  4DU4 A;  1X3M A;  3QNO A;  4HUG A;  2VGN A;  4FXD A;  3H45 C;  2UUC K;  3AAQ A;  1C6V A;  1NWK A;  4G1Q A;  5FLX O;  1KAY A;  1B92 A;  1EWR A;  3PX0 A;  4JAX A;  1T3V A;  3HPH A;  1RBV A;  1GOB A;  3B8A X;  3I33 A;  4OVL A;  1C0F A;  3HST B;  3KZB A;  2AA4 A;  4CJP A;  1I3A A;  3TAN A;  2FSJ A;  2VGM A;  4DTR A;  2I7N A;  3SV3 A;  1TGO A;  3CPW M;  1IO2 A;  1GLA G;  1C0G A;  2FLO A;  4FJN A;  2GX9 A;  2WUS A;  2FC0 A;  3KWI A;  5EU7 A;  1IBK K;  1WNS A;  1U04 A;  1B9F A;  1MA9 B;  4DV0 K;  4DWI A;  4WFA L;  4OJR A;  3WNG A;  3M1F A;  4FLW A;  2IAJ A;  3QER A;  5SWM A;  4CHP A;  3VQP A;  3DLH A;  1IKW A;  1ZBF A;  4DQ8 A;  3A0I X;  3AVK A;  4FJG A;  1G15 A;  2UUA K;  1YF5 L;  1OKJ A;  4FZZ A;  5TKY A;  3V1O A;  2EWS A;  4EP4 A;  4CIE A;  4WFB L;  1TKT A;  3M8S A;  3VTI A;  3FZL A;  3OYJ A;  4DV2 K;  4DTS A;  1U45 A;  2XHB A;  3VQD A;  4GV3 A;  4CFD A;  2VG6 A;  2V7Y A;  3SUQ A;  2F8S A;  4E3S A;  1IBM K;  1UAX A;  4K0K K;  4JKA A;  1NK4 A;  2BTF A;  1OVY A;  3S9H A;  2NRX A;  3VEO A;  3MN9 A;  3AVN A;  5GAG P;  4CZM A;  2OTJ N;  3C0B A;  2Z1G A;  4GNI A;  4YOV A;  3I8B A;  4ICL A;  2BAN A;  4M41 A;  1R59 O;  4CW7 B;  3CFR A;  3P83 D;  3CJ9 A;  1FJG K;  1KTQ A;  3SMP A;  4FJ9 A;  1K8K B;  5AQI A;  3GL1 A;  2PYL A;  1FKP A;  1WBD A;  2HHV A;  2P9U A;  1L3V A;  4E19 A;  3EZ5 A;  3SQ4 A;  2HBJ A;  1LCU A;  1KAX A;  1Q8I A;  3HI0 A;  3VGM A;  4CEC A;  3LDP A;  3DXM A;  4J8F A;  3P5J A;  2IS3 A;  3LM9 A;  4DSK A;  1NKC A;  1ZBU A;  4BRF A;  3VEX A;  3NCI A;  2A41 A;  5CZ2 A;  3K9K A;  4JI6 K;  3HYF A;  2HHT A;  4BC3 A;  1QS4 A;  5KI6 A;  3I8D A;  4OX9 K;  4IOC L;  4EAH D;  3THV A;  2BGG A;  3FGU A;  4DFK A;  3OS0 A;  3NE6 A;  1U48 A;  4CEZ A;  4HCC A;  4YOW A;  1NK6 A;  5EOY A;  3RMD A;  1T8E A;  3LWM A;  4F3O A;  3C6H A;  1WAJ A;  2UXB K;  1JLC A;  2O8C B;  4BRD A;  1QE1 A;  4DR3 K;  2IVP A;  4DV3 K;  1C0M A;  5FRN A;  3QEP A;  3TAP A;  1YI2 N;  2IIR A;  1ZC6 A;  5ELZ A;  3AVH A;  3MN5 A;  3TSQ A;  1SKS A;  3AGK A;  5GIO A;  2O8C A;  4B3S K;  4B1Z A;  3OJU A;  3O1B A;  1ITG A;  3A5O C;  5JMV A;  3MXM A;  3AO3 A;  4C8K A;  4FZX C;  2RKI A;  1Q7Y O;  4OKE A;  1EP4 A;  2HBL A;  4CZJ A;  2QA4 N;  1BWF O;  2DY4 A;  3HP9 A;  1KXP A;  3SBG A;  4DQQ A;  1TK8 A;  3CQX A;  4BR9 A;  1JCE A;  4ZTF A;  1JLQ A;  2QKB A;  5CR4 A;  4DFP A;  3R6M A;  5SZT A;  4BRQ A;  4IZ9 A;  3J81 O;  2NRT A;  4CJU A;  3HPG A;  5JLH A;  1ATR A;  3RMC A;  4E1J A;  3NGY A;  4CD3 A;  4K43 A;  1TKZ A;  4J2D A;  1IKV A;  2A40 A;  5HRN A;  4OLB A;  2VYP A;  4JRQ A;  3TR8 A;  2FBY A;  2F4V K;  2PAV A;  4O8K A;  5C42 A;  1NK9 A;  3C6U A;  3H46 O;  4IDK A;  1GLB G;  3OYL A;  4Z4F A;  1BDG A;  1YT3 A;  1EX4 A;  2YJF A;  1BCM A;  1S6P A;  3DXK A;  5EY4 A;  2BE2 A;  5KRS A;  4KAZ A;  1WOQ A;  2NRH A;  4CJE A;  2QW9 A;  3CXC M;  4KPY A;  3CCL N;  3L0Q A;  1ATS A;  3TI0 A;  2PZS A;  3CCU N;  3S3O A;  5F1X A;  3EE8 A;  4BC4 A;  4RW4 A;  1WLJ A;  1HLU A;  3THX B;  2YHA A;  1BL3 A;  3O3F A;  5AQJ A;  1KCF A;  3VF4 A;  3PIO L;  2XRI A;  3KK1 A;  4K8Z A;  4FW1 A;  3HJF A;  4YY3 K;  3LM2 A;  3EY1 A;  4CJR A;  3EN9 A;  4F8R A;  1I94 K;  3QLH A;  1HYS A;  4RTF D;  4C1N K;  4LF9 K;  3RMB A;  3KJV A;  5J2Q A;  3OVN A;  4JKB A;  4DLE A;  2ITG A;  3K5O A;  4E7L A;  1XHZ A;  1HPM A;  3NGZ A;  3HXM A;  2P9I B;  4H0Y B;  4QAG A;  3VF2 A;  5M1N A;  4DSL A;  1VSE A;  3Q7C A;  3SMS A;  4MDB A;  2J4R A;  3F73 A;  3BZC A;  1NKE A;  1EO1 A;  1GLF O;  2ZJQ L;  1HPZ A;  5EXW A;  4BRH A;  2E6L A;  4LF8 K;  4NCB A;  4JI8 K;  1RDA A;  2E88 A;  3QET A;  1ESV A;  1NMD A;  4IFY A;  3F9K A;  2CH6 A;  3M8R A;  3E9P A;  4CJL A;  1NJI O;  2GWJ A;  5M1K A;  2P5O A;  1LWC A;  2OPQ A;  2G8W A;  2P9N A;  4WYB A;  1ZXO A;  2A3Z A;  1LAW A;  4FWM A;  3MAQ A;  1JXE A;  4X66 K;  4E7I A;  3ZSQ A;  1KQS M;  4WFN L;  4N5S A;  3VET A;  3C7N B;  4B9Q A;  2DFF A;  1RFQ A;  4X65 K;  3DI6 A;  3U3Y A;  5GAE P;  4DTJ A;  3DXM B;  3QML A;  4CJW A;  3CQ8 A;  5CHI A;  4J2B A;  1ZBH A;  1O1W A;  2IGI A;  2OZM A;  1UA0 A;  1E3M A;  4FJM A;  1YJW N;  4CGD A;  4DR6 K;  1X3N A;  1NK0 A;  4CGF A;  5F0X A;  3L8B A;  4BRC A;  5AQO A;  1YXQ A;  1HKB A;  5FDL A;  4MQ3 A;  1X1P A;  5C15 A;  3T1A A;  1VQ4 N;  2X6S A;  3CET A;  4DTO A;  3HO1 A;  5ADX H;  5BRF A;  4GV9 A;  2G8F A;  2E5L K;  4B3M K;  5LL6 Z;  3VQ6 A;  4Q5V A;  2P9U B;  4KHQ A;  4H0O A;  2ZF5 O;  2PYJ A;  4IBN A;  3NMU A;  1HQE A;  4O44 A;  5AZJ A;  2D1K A;  3MXI A;  1LOT B;  4RW8 A;  4CJF A;  1C1B A;  4CGG A;  1HRH A;  4B3T K;  5J2P A;  4LF7 K;  4AIL C;  2Q2R A;  3KLG A;  4DUZ K;  1H1V A;  3HSC A;  3U8X A;  3L2W A;  3KLH A;  1HNX K;  1RTJ A;  4FLT A;  2V7Z A;  1S6Q A;  2VG7 A;  3VQ7 A;  4JLH A;  3V9W A;  3HVT A;  3HM9 A;  2VWB A;  3ASM A;  3J80 O;  3D2E A;  3O9T A;  4DKW A;  4EHU A;  5JVH L;  4CF1 A;  3CI5 A;  2KHO A;  4IFE A;  4YFU A;  2F7T A;  1BI4 B;  5BR9 A;  4Y1C A;  4JNE A;  1NLV A;  2ZJP L;  1Y64 A;  4FWR A;  1D8Y A;  1XHX A;  3WNF A;  1B9D A;  2KW4 A;  2G8V A;  4EFH A;  1U47 A;  3NHG A;  3PV8 A;  4A5B A;  3HPO A;  3DLE A;  3VA0 A;  3N4P A;  4KTW A;  1R0A A;  3L2U A;  4AQY K;  4NB4 A;  5JS1 A;  2A1R A;  3SUN A;  5LJV A;  3O4Q A;  5M1F A;  3CME N;  4DSJ A;  2E2P A;  5FPD A;  2VWK A;  4FLV A;  3NH0 A;  3C7N A;  4CEE A;  3KLF A;  2FBT A;  2W42 A;  1KVA A;  1O13 A;  1MDU B;  2OPR A;  2HST A;  4DR4 K;  1P8Z A;  3AAR A;  2P9N B;  4H4M A;  4LY7 A;  1ZYQ A;  1UWB A;  3H3N O;  1RDC A;  3O1W A;  4O4G A;  1X9W A;  5F2R A;  1IBL K;  4CJ3 A;  4O5B A;  1JXB A;  4BRE A;  4NCG A;  4WCE L;  2YHB A;  3E9O A;  2Z1I A;  5I42 A;  5AQT A;  2QXL A;  4O8U A;  3HP6 A;  5AQS A;  4Z4H A;  1BOT O;  4BAC A;  1VQ9 N;  1RT6 A;  5HBM A;  2HHQ A;  3P39 A;  4CER A;  3IS9 A;  4IWV A;  5BR8 K;  1SUQ A;  3V9U A;  3EKU A;  3ALY A;  3M8Q A;  5LMU K;  4AHS A;  4PL7 A;  4H5N A;  4DR5 K;  3PX4 A;  1X9S A;  4A2B A;  3CCE N;  3TWH A;  4H4O A;  4CZF A;  1LWF A;  1F21 A;  2HNY A;  5E26 A;  3ZX3 A;  4CIG A;  4JI7 K;  3G10 A;  4FWP A;  2Q3S A;  3HL8 A;  3V1Q A;  2YJE A;  4DF4 A;  5AQQ A;  5LY3 A;  5AZI B;  4KRF A;  1C1A A;  5I9E B;  5D3G A;  3S3M A;  3D2F B;  3UKR B;  1JLE A;  3CF5 L;  4CF8 A;  5HRO A;  4JK8 A;  2A42 A;  3VTH A;  4RW7 A;  1V4T A;  4GKK K;  3J7A P;  4I7F A;  2D0O A;  4CZH A;  1WUA A;  4QS9 A;  4ZTJ A;  3UB5 A;  3H1V X;  1BIU A;  2FBX A;  4F3T A;  2NRZ A;  3SCX A;  4CD1 A;  3ATU A;  1A5X A;  2Y1I A;  1M1K O;  5CE3 A;  3KD1 E;  1RNH A;  5C24 A;  4OLA A;  3DOL A;  3RVC A;  3FZK A;  4BR7 A;  4AHT A;  3LDO A;  1S1W A;  3HOS A;  3AVL A;  1KVC A;  3VER A;  1JLB A;  3CM6 A;  3SQ2 A;  3F5T A;  3LP1 A;  4OKK A;  5KQ8 A;  2UXC K;  1IKX A;  1RT5 A;  2KLA A;  3ENB A;  4DLG A;  4H0X B;  2Q1N A;  5AQL A;  1RGI A;  1X9J A;  2ASM A;  3L3V A;  3EZW A;  5FPN A;  4LF4 K;  3IKM A;  3UKU B;  4E7J A;  2CGJ A;  1WN7 A;  2P9S B;  3CCJ N;  4FM2 A;  3THW B;  3OS2 A;  4L8R B;  3VQ8 A;  3T69 A;  3LDQ A;  1LW2 A;  3QDK A;  4CF9 A;  1L3T A;  1LWE A;  4DTP A;  3HT3 A;  2BDP A;  4IXC A;  4UQG A;  3RSE B;  1NGJ A;  3TTC A;  4BG9 A;  1TKD A;  2HHH K;  4QCL A;  1KAZ A;  1VSD A;  4DU3 A;  4BRG A;  1YUW A;  4F9O A;  3HVR A;  4FLX A;  3J7Y P;  2YNI A;  1QSY A;  1M90 O;  3K5L A;  5ADX A;  5LJW A;  4HCB A;  3SLC A;  2HND A;  3E01 A;  3K0S A;  1DT9 A;  2GTD A;  4KH4 A;  2RPI A;  1QVG M;  4B9N A;  4J2E A;  3ZT0 A;  3O8M A;  4M42 A;  2NRV A;  4C23 A;  4JRP A;  5AJ3 K;  3IDH A;  3HOT A;  2QWM A;  2O8B B;  5GAD P;  2DFH A;  2X78 A;  3FZM A;  3PO4 A;  3SUP A;  5BN8 A;  5CYQ A;  3B6P A;  1KFS A;  1V4S A;  5C2F A;  1BIZ A;  2VG5 A;  1YHQ N;  1RT7 A;  1Y97 A;  1XC9 A;  3ZLJ A;  2QWN A;  3LZJ A;  4B08 A;  1HX1 A;  4Z4E A;  3BP8 A;  3VQ5 A;  3VEW A;  1U2V A;  3ZSO A;  1WBB A;  3SNN A;  1K8A O;  2O8B A;  1OH7 A;  2E8A A;  1X9M A;  1MU2 A;  4MO5 A;  4M3T A;  2Q0U A;  1EKE A;  2QI2 A;  1J9A A;  2XY5 A;  3R1X A;  1QQC A;  5IWA K;  3J7Z O;  3DLR A;  4IG0 A;  1Q82 O;  2HOE A;  5AQW A;  3S3N A;  2AJQ A;  1DGK N;  3S41 A;  4M7X A;  2P9K B;  3P4I A;  4WF9 L;  1XMO K;  2D5R A;  3AA5 X;  5MLC Q;  1ASU A;  4B8C A;  1JKH A;  4I6M A;  4ELU A;  1NOZ A;  1HR0 K;  2E1Y A;  3BZK A;  4DS5 A;  4BGA A;  3IG1 A;  1TYQ A;  4CJ4 A;  1WSH A;  4CIF A;  1D4X A;  3QEW A;  4BDY A;  4JI4 K;  3EEQ A;  3AO4 A;  4OO1 J;  3NH2 A;  1CZ9 A;  1NGA A;  1LW0 A;  4JD2 B;  4FWS A;  3T1Y K;  1J53 A;  1VRT A;  4V19 S;  1S72 N;  3LWL A;  2XO7 A;  3ZSY A;  2ATQ A;  3ZEU B;  2IVN A;  1J5O A;  3HBT A;  2UYT A;  3VQA A;  5EVZ A;  1KLM A;  3VGK A;  3OYH A;  4CGH A;  3QBW A;  4FLU A;  4B9L A;  3TTF A;  3DLB A;  1QQM A;  1REV A;  3RRH A;  2D0A A;  1HYZ A;  3ENO A;  3CJA A;  3TTD A;  1RT4 A;  1TKX A;  3OA9 A;  4YHH K;  2JWL A;  4WQ5 C;  3JAM O;  1FXX A;  5AQY A;  4FL9 A;  4AHU A;  4N47 A;  1BGX T;  1JCG A;  2P9L B;  1D5A A;  1J54 A;  3L2Q A;  3NF7 A;  4JEP A;  2QK9 A;  1KVB A;  2V51 B;  2HBM A;  1TK0 A;  3OYE A;  3V9X A;  3THW A;  4JI3 K;  3ZSR A;  4FSV A;  4XH1 A;  3WQU A;  3VEY A;  2Q36 A;  3WXI A;  4FWL A;  3ZT1 A;  1RIL A;  2RF2 A;  3E66 A;  3NBP A;  1SL2 A;  3PO5 A;  4CBU A;  3VEV A;  3CC4 N;  3J8A A;  3LZI A;  3WXL A;  3RRG A;  3NVM A;  1QHT A;  4CHO A;  4IOX A;  4E1N A;  4FCY A;  3DXK B;  1C0T A;  2E20 A;  2XY7 A;  4JKG B;  4DQR A;  1VAZ A;  4CBX A;  3T1H K;  3AA3 A;  3LAK A;  2HMP A;  2ZD1 A;  5BPL A;  4GY2 B;  2HHU A;  5LMN K;  1S22 A;  4W5N A;  5AQG A;  4A61 A;  4E1M A;  4GVM A;  1W2B M;  1BIS A;  4FJ8 A;  2WON A;  1YVU A;  1NBW A;  5AQZ A;  3MX2 A;  3NF6 A;  1VQ5 N;  3WUH A;  4Y1D A;  3K59 A;  1TK5 A;  1W0H A;  3ATV A;  3C6T A;  2ITM A;  4O0J A;  5GIN A;  4NXM K;  3VGL A;  4JKE A;  2OCE A;  4CGI A;  3DLG A;  2PFU A;  4KO0 A;  4EZ9 A;  2GEL A;  4YDU A;  3ZSX A;  3KLE A;  3SV4 A;  3A5M C;  3QNN A;  3ULD A;  1VQP N;  4BRI A;  2O8F A;  4JI1 K;  4AM7 A;  4JI5 K;  3LAN A;  1SL0 A;  4K8X A;  3CCQ N;  4MLE A;  4BWJ A;  4K41 A;  4FJX A;  1TYQ B;  4ILH A;  3CER A;  3V1R A;  3M3Z A;  3H08 A;  4YOT A;  3A2F A;  3VQ4 A;  3MWT A;  4DB3 A;  1NGG A;  5BRD A;  1RCH A;  2FSK A;  3VQ9 A;  5HL7 L;  1SAZ A;  3VN5 A;  4M3W A;  1W9H A;  3F9M A;  4CI6 A;  4HHT A;  4UY8 O;  1XI1 A;  4IFV A;  2NUB A;  4MLH A;  4FJL A;  1VSK A;  4XEI A;  1BG3 A;  2Q31 A;  3ZX0 A;  3PLA A;  3O9U A;  4E7H A;  4FK0 A;  4Y0W A;  4FOE A;  1SKW A;  3BEX A;  4N76 A;  4W5O A;  4CHZ A;  2P1J A;  1VSH A;  4CK2 A;  5AQU A;  3AVB A;  1WSE A;  1JL2 A;  3KTQ A;  1U2V B;  1NGE A;  3WT0 A;  4IO9 L;  1CXU A;  4LSL A;  3L4I A;  2NNW A;  1K9M O;  4DTM A;  3QIO A;  2IDO A;  2D0P A;  4JHD B;  3NDK A;  4DSI A;  1XQS C;  3W3D A;  3H6E A;  1QSL A;  2BH1 A;  4YDU C;  1MWK A;  4B1W B;  2HHW A;  2W41 A;  5DMR A;  3CJ1 A;  4JI2 K;  2W6L A;  3P1G A;  4OGC A;  2B5J A;  2BUP A;  3SQ0 A;  5BRH A;  1IG9 A;  2UUB K;  1WSF A;  4LH4 A;  1T6D A;  1QVF M;  4K42 A;  2V52 B;  3FFK B;  4B3O A;  3TAM A;  4BGB A;  1ZBS A;  1NGD A;  2OZS A;  1XC3 A;  4JHD A;  2ASO A;  3THY A;  3G6E N;  2H3G X;  1NGB A;  4F4K A;  2FBV A;  1P90 A;  2UU9 K;  2P9L A;  3C94 A;  3VQB A;  3VA3 A;  1NG9 A;  3KK2 A;  4C8O A;  2HVH A;  3KKS A;  4DCH A;  3EO3 A;  2QTD A;  2RE2 A;  3OBW A;  4Q0B A;  4H5R A;  1VHX A;  1UA1 A;  3K57 A;  4DS4 A;  2VQF K;  2F9W A;  5CZ1 A;  1NJX A;  2WC9 A;  2CGL A;  4W5R A;  2WFB A;  1J5E K;  4X64 K;  1A5V A;  4EIA A;  4DMN A;  1RTI A;  5HOO A;  4N56 A;  4IKF A;  4WE1 A;  5FRO A;  3DWL A;  3QIN A;  3JSM A;  1RT2 A;  4PHT X;  1NM1 A;  3T7Z A;  4EP5 A;  4X62 K;  3I0R A;  3NH1 A;  1TAU A;  4Z4I A;  4E89 A;  3OTO K;  4BRN A;  3O3H A;  3MX5 A;  1NJZ A;  4NXN K;  2R7Y A;  1YIJ N;  4BDP A;  5AQK A;  1WAF A;  3AVF A;  3HRG A;  4HUE A;  3QES A;  2P9P B;  3IMX A;  3WEE A;  3SPY A;  3R3L A;  4KV8 A;  2P5G A;  1Z05 A;  1QQO A;  1TV6 A;  2DPN A;  3LPT A;  1N5Y A;  3EL2 A;  1S1X A;  3M8P A;  1U4B A;  3AA4 A;  1CXQ A;  3GDQ A;  4DR1 K;  4QS7 A;  5HRP A;  3OYK A;  4CJK A;  2P9K A;  3BGR A;  1YVN A;  3SAH A;  1GOC A;  4YOX A;  4C8N A;  3DLL L;  4KH6 A;  3MCP A;  2YKN A;  1VQO N;  4DV7 K;  1QSS A;  3TSP A;  4PKH A;  1ASW A;  1BQN A;  2QWQ A;  4CFC A;  4HVJ A;  4Z4G A;  1NGI A;  4CJT A;  4A2A A;  3Q7B A;  3AO1 A;  2ZWH A;  1RTH A;  1VSJ A;  3ID6 A;  4ISG A;  4M3Z A;  1KD1 O;  1U6Z A;  1GLD G;  4JV5 K;  3LAM A;  4QS8 A;  3SAF A;  4NYN A;  4B9U A;  1JL1 A;  4BRO A;  1Z6R A;  3MXJ A;  3KVG A;  4LH5 A;  3FLC O;  3CMA N;  4FJH A;  5C25 A;  2OYQ A;  1BO5 O;  4H5W A;  4C8M A;  4FPB A;  3G4S N;  1RBR A;  3KLI A;  3SI6 A;  1GLC G;  2KTQ A;  2HHS A;  2YHX A;  1HQU A;  2OPS A;  4AF1 A;  4PQU A;  3LP2 A;  2YHW A;  2X6N A;  5HP1 A;  3O5B A;  1XUP O;  4C1N I;  4CEA A;  3V81 A;  3QFP A;  5AZJ B;  4M3Y A;  4ID5 A;  4FM0 A;  4GVE A;  4YNQ A;  1YJ9 N;  3T3F A;  1VSL A;  1S1T A;  3TAQ A;  4PUO A;  3IUC A;  4CZE A;  1HJO A;  2E2Q A;  5KGW A;  4DV4 K;  4XIU A;  4BVO A;  4H0T B;  4AHV A;  3K58 A;  2OTL N;  4KHY A;  1BA1 A;  1IH7 A;  1NU0 A;  3ZX2 A;  4CGJ A;  4CK1 A;  3ZCM A;  3TU5 A;  4KHS A;  1S1V A;  1RT1 A;  3ZEU A;  5JS2 A;  4B9M A;  4CK3 A;  4HUF A;  2KFZ A;  4CHN A;  4W5Q A;  3AVI A;  3MN7 A;  4ISE A;  1BI4 A;  3AVM A;  4KHN A;  2GWK A;  3BDP A;  4Z94 A;  4CEQ A;  3UKU A;  3EYZ A;  4DV1 K;  4C8L A;  3D2E B;  1HNZ K;  3LAL A;  4BC5 A;  1MWM A;  2PBD A;  4CJ5 A;  4GV6 A;  4WQ4 C;  3CFP A;  4ILJ A;  4DFJ A;  4KI6 A;  1KRP A;  5AQP A;  2FSN A;  1SL1 A;  4OPA A;  5HLF A;  4XH5 A;  2IC3 A;  3ZT3 A;  2VQE K;  3ZSV A;  3OS1 A;  2HMI A;  4E0D A;  4BR4 A;  3QEI A;  2QKK A;  3U6F A;  1LAV A;  1ASV A;  4A5A A;  1T05 A;  5KGX A;  3KKR A;  3ZET B;  1QHA A;  5C12 A;  3SBT A;  3M6G A;  4FJK A;  4BE0 A;  3MED A;  3PUF A;  3LDS A;  4CZG A;  3OYD A;  1N32 K;  3L6Q A;  5C2D A;  1KSP A;  1SZ2 A;  1HNI A;  3DYA A;  4FLY A;  3O4N A;  3ULE B;  3VES A;  3O6W A;  5B8H A;  2VWJ A;  1KLN A;  2A6A A;  2B4J A;  3CJB A;  3VMF B;  4JKF A;  4QOZ B;  4EZ6 A;  3VOV A;  3SQ1 A;  1WB9 A;  3G0Z A;  3CJ7 A;  3E9L A;  3JS6 A;  4B9T A;  3FR0 A;  3PSI A;  3TAB A;  1XNQ K;  3G71 N;  3QFU A;  1RDW X;  1TUY A;  4DTN A;  5JVG L;  4FM1 A;  2O4I A;  4I9L A;  1HMV A;  4KB1 A;  4BVP A;  4CHQ A;  3AO2 A;  3DRS A;  5HRR A;  1L5U A;  4FO0 A;  4NYF A;  3CG7 A;  4CJQ A;  4L3Q A;  1A5W A;  1VQK N;  3R9P A;  3OYI A;  1HUX A;  4IEE A;  4HTU A;  5KPT A;  4KH5 A;  4KTZ A;  5AQF A;  3ULE A;  3WXJ A;  3MMV A;  4KHW A;  4LFC K;  4DQP A;  4CEO A;  1GOA A;  3KK7 A;  4WQ4 A;  4BDZ A;  2F96 A;  3IAY A;  3I55 N;  4G9Z A;  2HVI A;  1N33 K;  3M5R A;  1DTQ A;  2ZGY A;  3EE9 A;  2YV0 X;  3WQT A;  3TSU A;  4CJ7 A;  5CY4 A;  4XH4 A;  1S5J A;  4OPK A;  4IEI A;  3TAE A;  2FF3 B;  3OW2 M;  2P51 A;  2VCP A;  3PIP L;  3MEE A;  2F8T A;  4RW9 A;  4PL8 A;  4YOU A;  1OH6 A;  4JKD A;  4M63 C;  5E41 A;  4KFB A;  2YCH A;  3ZYY X;  3DOK A;  4CJS A;  4JKG A;  4DSE A;  4I2Q A;  1WSJ A;  1C0U A;  2YKM A;  3QO9 A;  4JK9 A;  2KFN A;  2OPP A;  3KHY A;  4FWQ A;  1IG8 A;  2ZQB A;  1VK0 A;  5M1O A;  1SKR A;  4GW6 A;  3CCV N;  1Q86 O;  1FK9 A;  4NLB A;  5AFU A;  1NK7 A;  4BR5 A;  1OH5 A;  1BHL A;  2W40 A;  2YNF A;  1T7P A;  5AQX A;  3QEX A;  4IO8 A;  3NVK A;  5J2N A;  4LFA K;  4MDA A;  4CEB A;  2Y1J A;  3WNE A;  4FVU A;  4AM6 A;  2YHY A;  4LF5 K;  3D0P A;  4DR7 K;  1K6Y A;  3I0S A;  1NMN A;  2Z1H A;  2G8K A;  1EWQ A;  4CBW A;  3AAP A;  3O9Q A;  5AQM A;  4N41 A;  3AV9 A;  3HM8 A;  4AHR A;  3SAG A;  4U7B A;  1VQ8 N;  3OYA A;  4KKO A;  1L3U A;  4JN4 A;  3K9J A;  1XMQ K;  5M1Q A;  4B1U B;  1WSG A;  4OPH A;  4DQI A;  4JI0 K;  4JS4 A;  1OH8 A;  1IV0 A;  3O80 A;  1L3S A;  5IT9 O;  2E6M A;  5KTQ A;  2HF3 A;  1I39 A;  2JWK A;  5JLF A;  3HTV A;  4A59 A;  1NK8 A;  4H03 B;  4CHY A;  2GV9 A;  5FRM A;  1HJR A;  3THX A;  4IG3 A;  2E2O A;  5KQD A;  2GUP A;  1TL1 A;  3KD5 E;  2Q97 A;  2O8E A;  3CHW A;  2A1S A;  4PY5 A;  1EXQ A;  2D4W A;  4O5F A;  3DMJ A;  3CC2 N;  3L3U A;  3MCA B;  3VEN A;  3OYB A;  2JLE A;  1VQN N;  5DM7 L;  1J6Z A;  1VSI A;  2D0C A;  4FWO A;  4WQ5 A;  3UIQ A;  4FJ5 A;  3V6D A;  3ENH A;  3OY9 A;  4GMJ B;  1BQM A;  3LP3 A;  1VQ6 N;  4B3R K;  2KQ2 A;  4R5P A;  3H1Q A;  4FJ7 A;  2OA8 A;  1ILY A;  2QM1 A;  2GUI A;  3AVJ A;  4FYD A;  1T44 A;  4KBO A;  3D2F A;  3SJH A;  5AZI A;  4CZI A;  2DTU A;  1VSM A;  3SJJ A;  5AQV A;  2O4G A;  1E4G T;  1EQY A;  3DRP A;  1Q18 A;  3DRR A;  2E1Z A;  4NO7 A;  2YI1 A;  4FK2 A;  4DFM A;  2E4L A;  2P9I A;  5C0Y A;  5FPM A;  3KWG A;  1BUP A;  1G99 A;  4I2P A;  4JYA K;  1OVQ A;  4E7K A;  4DR2 K;  3U9D A;  3BF1 A;  4RG8 A;  1W7A A;  4OPJ A;  1CZB A;  2NRW A;  3KIO A;  3R8E A;  4TSX A;  3KK3 A;  3ZET A;  2WTU A;  4B9S A;  3SK3 A;  1NGC A;  4BWM A;  4DV5 K;  2O8F B;  1RDB A;  1HYV A;  3QIC A;  2FXU A;  3CCM N;  1N34 K;  5KPR A;  1N36 K;  2JGU A;  3QEV A;  3U4L A;  2P9S A;  2WBN A;  2P9P A;  1Q81 O;  1IJJ A;  2YX6 A;  3RSE A;  4BRA A;  3GG4 A;  3OYN A;  2W6K A;  1TVR A;  1NJY A;  3AO5 A;  3AVC A;  2NZT A;  3LL3 A;  4YOR A;  5AQR A;  3MN6 A;  4BG8 A;  1QZ5 A;  4A57 A;  4FW2 A;  2HF4 A;  1JLA A;  5HRS A;  2ZJR L;  4JKC A;  3VQQ A;  4EHT A;  3BF3 A;  1YIT N;  3P31 A;  4BE2 A;  5J1E A;  4RCH A;  4BR0 A;  1VQL N;  4B1X B;  2IVO A;  1BU6 O;  2Q0R A;  1N8R O;  4O55 A;  3F2K A;  1QTM A;  1DEJ A;  3GE1 A;  4DU1 A;  2FF6 A;  3LPU A;  4CJV A;  1RDD A;  1YTA A;  4FK4 A;  3QBX A;  5A2Q O;  1D9D A;  4CES A;  3CIP A;  2XY6 A;  4ISF A;  2GBZ A;  3FZF A;  3THY B;  4BE1 A;  1RDU A;  3OHR A;  4O0I A;  2O8D A;  4H0V B;  1S9G A;  2QEX N;  3FE1 A;  4KHP K;  4DHY A;  3OYF A;  3A5N C;  2A5X A;  1SV5 A;  4IJA A;  2O8D B;  3ZSZ A;  4CZL A;  2HB5 A;  4LD0 A;  4JD2 A;  3EKS A;  3ZSW A;  3G25 A;  4DV6 K;  3RWU A;  1JCF A;  3V9S A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4DUZ K;  2HHH K;  3T1Y K;  4LFA K;  1HNX K;  4JYA K;  4GKJ K;  4V19 S;  2UUA K;  1XNQ K;  4DR2 K;  4DUY K;  3J7Y P;  2ZM6 K;  2VQF K;  4JI1 K;  4LF5 K;  4JI5 K;  4JI7 K;  4DR7 K;  4DV2 K;  3J80 O;  1J5E K;  4X64 K;  1IBM K;  4LF8 K;  4K0K K;  4JI8 K;  3J81 O;  4DV5 K;  4CVN E;  1XMQ K;  4X62 K;  4LFC K;  1N34 K;  3OTO K;  4JI0 K;  1N36 K;  4YHH K;  4NXN K;  3JAM O;  5AJ3 K;  4CW7 B;  4DV4 K;  1N33 K;  5IT9 O;  1FJG K;  2F4V K;  4X66 K;  4GKK K;  3J7A P;  1XNR K;  4X65 K;  4AQY K;  4JI3 K;  4LF6 K;  4DR1 K;  1HNW K;  4DV1 K;  1HNZ K;  4JI6 K;  4DR4 K;  4DR6 K;  4OX9 K;  4DV7 K;  2UUC K;  5FLX O;  1IBL K;  4B3R K;  2VQE K;  3T1H K;  2UXC K;  5IWA K;  5LMN K;  4JI2 K;  5A2Q O;  4YY3 K;  4LF4 K;  2UUB K;  2UXB K;  1I94 K;  4DR3 K;  1XMO K;  2E5L K;  4B3M K;  5LL6 Z;  2UXD K;  1N32 K;  4DV3 K;  4KHP K;  4LF9 K;  1IBK K;  1HR0 K;  4NXM K;  5BR8 K;  4JV5 K;  4DV0 K;  5LMU K;  4B3S K;  4B3T K;  4DV6 K;  4LF7 K;  4JI4 K;  4DR5 K;  4LFB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...