2F4VK

30s ribosome + designer antibiotic
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2f4vK00
4CW7B 3J81O 1N34K 1HR0K 4JI2K 3JAMO 4DR5K 1N33K 4LF4K 4JI5K 4DV5K 1FJGK 1J5EK 4JV5K 4NXMK 4OX9K 2UXBK 2E5LK 4DV3K 1HNZK 4X66K 4LFBK 4B3TK 5AJ3K 4YHHK 4LF8K 4LF9K 4DV1K 2VQFK 4DR4K 5IT9O 5LMUK 1XNRK 4X64K 4JI8K 1IBKK 1I94K 4NXNK 4DR1K 4JI0K 5A2QO 4K0KK 2UXCK 3OTOK 4DUYK 4JI3K 2F4VK 2VQEK 4DV0K 4LFAK 2UUAK 3J7YP 2UXDK 4JI6K 4DR6K 4B3SK 3J80O 2UU9K 4GKKK 4DR2K 4GKJK 3T1YK 1XNQK 4YY3K 4X65K 4X62K 4LF5K 4LF7K 4LFCK 4DV6K 4DV7K 4B3MK 4DR7K 5LMNK 4JI4K 2UUBK 5BR8K 4DV2K 3J7AP 4B3RK 4JYAK 1XMOK 4JI7K 4AQYK 1IBLK 2UUCK 4JI1K 1HNWK 4CVNE 4DV4K 4LF6K 1XMQK 5FLXO 1N32K 5LL6Z 4V19S 1IBMK 4DUZK 1N36K 4KHPK 3T1HK 4DR3K 2HHHK 2ZM6K 5IWAK 1HNXK
chains in the Genus database with same CATH superfamily
4GMJB 4DQ8A 2VG5A 2FBVA 4KI6A 4DR5K 3VGKA 4IFVA 3QERA 1G99A 4M42A 2X6SA 2G8FA 4OO1J 4GW6A 3VOVA 3DJCA 3RVCA 3T69A 1RNHA 4KBOA 3NVKA 2HF3A 2A42A 1IH7A 1K73O 1EP4A 3M3ZA 3WXIA 2IC3A 3LP2A 4HWIA 3AVMA 3PX0A 4DSIA 3VEXA 5AJ3K 3DRSA 2HVHA 3U9DA 2YHAA 3E9OA 4FPBA 2E8AA 1GLDG 2P1JA 4ICLA 3Q7BA 4EHUA 1XNRK 1KD1O 2D5RA 3TAGA 2WFBA 1NU0A 3OTOK 3OYKA 2LSNA 3ZT3A 1L3TA 1X9WA 2CH5A 3MEDA 4WCEL 4AHVA 2RPIA 3R9PA 2HNYA 3NHGA 2O4IA 3C6TA 1JCGA 3M6GA 3TPQA 3SZ2A 1IG9A 1RBTA 4XEIA 4GKJK 2W40A 1TKZA 4A2AA 3OJSA 3V9ZA 4LF7K 1QHAA 3O9TA 2QWLA 5I3UA 4DR7K 5GAGP 2OA8A 4B9UA 1S3XA 2WC9A 2ZGZA 3MXJA 4CHYA 3CCMN 4B08A 4XH4A 1MDUB 4YORA 5M1FA 3AVFA 4KI4A 3PIPL 2X78A 2YI1A 3AVIA 3VPZA 1JXEA 4CGFA 1EETA 3T7ZA 3ISNC 5AQIA 3RMDA 4FWOA 1BIUA 3KTQA 1RT2A 1HKCA 1KLNA 5BPMA 2O4GA 3A5LC 3JSMA 3MCPA 3BEXA 3L2UA 5DM6L 1UA1A 5GIPA 4JD2A 3VF2A 1NJZA 5JICA 1SL0A 3BY5A 1BIZA 3OA9A 1TK8A 4ZTJA 1MU2A 3LANA 3FFIA 2HF4A 2FF3B 3WNEA 3NFAA 3ZT0A 3AA4A 3CJ9A 4ID1A 3G6EN 4H0TB 3WXLA 5AQHA 4XH1A 3L3UA 2E5LK 1S1XA 3QINA 3THXA 1QQOA 4FJGA 3IFRA 2O8DA 1NWKA 4JHDA 3CFPA 4HTUA 4CJFA 1S1VA 4DQQA 3VA0A 3V4IA 4B1WB 2QKKA 2QM1A 1RDWX 5FROA 3ZSVA 4FL9A 4K8ZA 4KHQA 4G1QA 3FZMA 1VSIA 1NJIO 4IJNA 3AARA 1NGIA 3SUNA 3FZFA 1TUUA 5CYQA 3D0PA 3ZSRA 1HYZA 1ASVA 2HHXA 1WSGA 3D2FA 5FRMA 3FE1A 4Z4IA 1KFDA 1D4XA 4H5WA 3CD6N 2OPQA 2P9UA 4DR2K 3SYZA 3MCAB 3L4QA 1SZ2A 1YJWN 3H1VX 2FBXA 2JWKA 2XHBA 4KHUA 3H46O 4CJWA 2Z1JA 4JI4K 1SKSA 2W42A 4HTLA 4J2BA 1VAZA 4UY8O 2PY5A 1T6CA 3PO4A 4DTPA 3GOIA 4BRIA 1XC3A 4JI7K 5CYMA 1S22A 2YKMA 4BGBA 5KRSA 4H5RA 4M3TA 4I2PA 4M45A 4RW4A 1NG9A 1N32K 1IV0A 3R3LA 5J2NA 5LL6Z 3K57A 4FPAA 4CERA 3THVA 1KVCA 3ITHA 3R1XA 4CD3A 3H1QA 4DTJA 1HNXK 3LDQA 3DLBA 2KLAA 1KQSM 3WNFA 1RTHA 2XY8A 1BO5O 4E0DA 3A2FA 2AJQA 3TAQA 3NAEA 4WE1A 5BRFA 2ZWHA 3T19A 4CEZA 4C8MA 3AGKA 4DTOA 1HRHA 2OPRA 3P5JA 1XWLA 3CPEA 2YV0X 2YJFA 1C0UA 1Q7YO 5AQUA 3KHYA 1E4GT 5CE3A 2A6AA 3ZX0A 1JJ2M 4H8KA 1GOBA 3H6EA 4FYDA 4RG8A 1HNZK 4FK4A 2Z1HA 1KC8O 1GLBG 4C8NA 3CCJN 1J54A 1VSEA 3NCIA 2Q31A 2G8UA 3VQCA 4O8KA 4C8KA 5JVHL 4F3TA 4FLUA 3PUFA 1JLGA 2AP1A 3QICA 4CJ4A 1WBDA 5A2QO 2QTDA 4IEIA 4Z0UA 5E41A 1KXPA 3LZJA 4FJ9A 3T1AA 4LFAK 3SV4A 3C7NA 4CEEA 1NMNA 3EKSA 3OS1A 3ALYA 1GLEG 5KTQA 4HHTA 3CJCA 4FJ7A 1QSSA 3FZLA 2ITMA 1TYQA 1ZBHA 2YCHA 4JD2B 3PO5A 2I7NA 2UYTA 4CJRA 1TV6A 3QETA 1N6QA 3CM5A 3ZSXA 3LP3A 1X9JA 3JXUA 3CFOA 1SKRA 4BRFA 3O1WA 1GLJO 2GEMA 1EWRA 4KB1A 2F96A 3TARA 2BGGA 3GDQA 3TWHA 4B3RK 2O8BA 3THXB 4BRLA 1KAXA 4AQYK 1IBLK 4H4MA 4E3SA 4ELUA 4BACA 1QQMA 4YOTA 2O8DB 1Y64A 1HNWK 3OYIA 1WLJA 1C1BA 1HJOA 4V19S 4C8OA 1CZAN 3HSTB 3J8AA 3U8XA 3K5NA 3L8BA 3SV3A 4JKBA 1YAGA 4JKGA 2KFZA 4AHUA 1VQ4N 1V4SA 2KKZA 4O0IA 1JLFA 1WSEA 4LY7A 2ASMA 3JAMO 4PL7A 2OPPA 1N33K 2Q3SA 4BG8A 4C1NI 1Q8IA 3D2FB 3WEEA 4KTWA 3TI0A 2P9UB 3PV8A 4Z94A 3LDNA 4DTNA 3N4PA 1WSIA 1T6DA 2UXBK 1ZBUA 4M63C 1XUPO 3NF9A 1RBUA 1JLAA 4BRPA 3M8SA 4GNIA 3QEIA 4BDYA 4PY5A 4DSJA 5J1EA 3E66A 4LF9K 1HLUA 1VRUA 3OY9A 2QA4N 1RDAA 2P9PA 2V7ZA 3M5RA 4FWLA 4NCBA 1QQNA 1ZBFA 5HOOA 3U9ZA 3QBWA 5I9EB 4YFUA 3VTHA 4OJRA 1IBKK 1NJXA 4ELVA 4DU4A 3H08A 4BE0A 4JI3K 2Q36A 4CJSA 4IFYA 4H0YB 4IBNA 2VQEK 3CCVN 4FZXC 4OKEA 4DV0K 3HOSA 4KRFA 2QWQA 3J7YP 4E7HA 4OLAA 4CGJA 3U3GA 2Y1JA 3G71N 1NOYA 1VQ6N 5CZ1A 4NLCA 4RW9A 1KVBA 2Z1GA 1FW6A 3CFRA 3DLHA 1XNQK 2HHSA 3S3MA 4X62K 4G9ZA 1HNVA 2OYQA 4JK9A 1LCUA 4KREA 3OBYA 3FFKB 4YOWA 1C0GA 3HI0A 3NGYA 5AQRA 1J9AA 3Q7CA 2IIRA 5AQTA 5KGWA 1MWMA 2OTLN 4CE9A 2FBYA 1OH5A 1T3VA 4FZZA 4JLHA 4JAXA 1Z25A 2E1ZA 4CGDA 3DI6A 3IKMA 3O3GA 3F5TA 1YTAA 3VQ4A 4DF4A 4AHRA 3VGLA 3LDSA 3O8MA 3DOKA 4ZHRA 5HP1A 3MN6A 4DQPA 1WSHA 1VQKN 1LAWA 4CZEA 3C7NB 3K9JA 3MDQA 3O4WA 1QQCA 4O55A 3AO4A 3M8PA 4IO9L 3MWPA 1JLEA 4BR7A 1VRTA 1TYQB 3OHRA 4JKDA 3FR0A 1S9GA 4JKAA 3WXKA 1KVAA 1A5WA 3DLGA 4O4GA 4DTMA 2XY5A 3H45C 3OYBA 1WAFA 3MEEA 1DLOA 3LP1A 3O4QA 3S3NA 4LFBK 1P90A 3NGZA 1O13A 5EU7A 5GIOA 1C1CA 1LWEA 3TANA 2O8BB 4YDUC 1RTDA 3ZYYX 1C6VA 4FWNA 5SZTA 3QB0A 4JS4A 2IVPA 3V81A 4CZFA 3A5MC 4X64K 4BC5A 1I94K 4CZGA 1NJYA 2JWLA 1U6ZA 3K5LA 4NO7A 1O1WA 4F2RA 4M3ZA 1YTUA 4E7LA 2PBDA 4GV3A 4IWVA 3CIPA 2WBNA 4N41A 4JKGB 4I9LA 4BR2A 2IAJA 2BDPA 5AR0A 3LAMA 4CJ7A 3VENA 1LWFA 2BANA 4RTFD 5JLFA 3WEEB 4AHCA 3NH2A 4C1NK 2HVIA 2PYJA 3OYCA 3HTVA 4DSFA 4QS9A 3CCEN 1JCFA 2ZGYA 2YNGA 3E1YA 1BCOA 2DPNA 1RDUA 1RBVA 1Z6RA 3KWIA 2RF2A 3MEGA 5KQDA 4M41A 4KHWA 3AGRA 4CZHA 1L5UA 1TAUA 2O8CA 4GVEA 4WQ4A 3KK2A 2RN2A 4KV8A 1YVNA 1WUAA 2P9PB 4CEOA 2RE2A 3SLCA 4M3RA 4DUZK 1ZBSA 3P31A 2D0OA 4LC9B 4N76A 2KZZA 4IKFA 1I3AA 3MN5A 2HHTA 3AA3A 3ULEA 3HYFA 1X9MA 5C2DA 1ATSA 4DV5K 4BWJA 3ID8A 1SKWA 3CCRN 5BRDA 3LL3A 4CK3A 5JVGL 1K9MO 3IRXA 4KTZA 3KLIA 3OYMA 2NRTA 1VQ8N 1BQNA 1DTTA 5EX5A 1R0AA 3C65A 4M3WA 3TAMA 1HQUA 3UKRA 4IG0A 4EHTA 2QW9A 5AQLA 3ZX2A 1NK5A 3DLKA 4E7KA 3DAWA 4DR4K 2IVNA 2YJEA 3AO1A 4EP4A 4CEFA 1Q81O 1QVGM 5LMUK 1S1WA 3WT0A 1NGJA 5AQXA 2ZJRL 4JI8K 3ZX3A 3ENHA 2Q2RA 2HHUA 5T7BA 3CJ7A 5CR4A 3FZKA 1OH6A 3NF8A 4BRGA 4EZ6A 3CHWA 4CF8A 4FJMA 4BRCA 4B3SK 3VQ9A 3LPTA 2QI2A 3O5BA 1KFSA 2HMIA 3GBTA 1IKWA 2NZTA 2A1SA 4IFEA 3SMSA 3TTCA 1QSYA 2QWOA 4OPAA 3WXMB 4BRAA 4CESA 4XIUA 1BCMA 3NVMA 4AF1A 2YNFA 4DV6K 3MX5A 4OGCA 2RKIA 1NBWA 2XRIA 4H4OA 1T8EA 4Z4EA 1JL2A 2ASOA 5E26A 4M3XA 4A2BA 4PUOA 3O3HA 4CFCA 3SMPA 4O0JA 3BZKA 3DWLA 5C15A 2HBKA 2P9KA 4LH5A 3T1HK 3P83D 3CXCM 1RTJA 4DWIA 2V52B 4JS5A 2FBTA 3PSFA 4AHSA 1N34K 1K8AO 5AQVA 4R5PA 5B8HA 3HPOA 4W5NA 2I5JA 4CJKA 1VSMA 1FJGK 1XC9A 1J5EK 2NRZA 4TSXA 1RT6A 3ZT2A 2HHQA 4PL8A 2D0CA 5AQFA 4DCHA 3SQ1A 2Q0RA 1NMDA 4H0OA 2E2OA 2Z1IA 2F9WA 3TSQA 4OLBA 4RW8A 3HM8A 3O9SA 3HZ6A 3QIOA 2ZJQL 1X3NA 4FO0A 2VQFK 2VG6A 2P9SA 2O8CB 4O5BA 3WNGA 1QTMA 3EO3A 4DR1K 1LWCA 3CJ1A 3DYAA 4Z4CA 5AQQA 3LM9A 1FK9A 3ZSQA 4KTQA 1C0FA 1IG8A 2D0AA 5M1KA 4J8FA 1RCHA 4IJAA 3KWGA 1A5VA 1NNEA 3ULEB 3BF1A 3J80O 2YHXA 4IDHA 3MWTA 2KW4A 4JK7A 1LOTB 4BRKA 3I8BA 4FM1A 4YY3K 3RR8A 4Q0BA 2BH1A 5BN8A 2NUBA 3R8EA 1DTQA 3KKSA 3EZWA 3N4QA 4BDPA 3UKRB 4MO4A 1YITN 1FXXA 3EE8A 3OYEA 4JI1K 4BREA 3OYAA 3AVBA 4Z4FA 4EAHD 1RGIA 4PQUA 2HB5A 3OW2M 3HSCA 4CZIA 1S1UA 3L0QA 4KAZA 3S9HA 2QWMA 3SAHA 3NE6A 1SUQA 4YNQA 1M1KO 4F9OA 3B6PA 4CBWA 4CJTA 1WSFA 3MK6A 4JI5K 4JKHA 2WONA 3KVGA 3U4LA 5AZJA 3CMAN 1VQMN 2VWJA 1I39A 3SAFA 2Y1IA 3VQ5A 4Z4HA 4DSLA 4CBXA 2NRRA 1Z26A 4IZ9A 3KLEA 4CHQA 3G0ZA 3KK1A 4GY2B 3P38A 1ITGA 4DV1K 5JMVA 2ATQA 3DMJA 4YOVA 3P39A 3UE5A 3H3NO 4U7BA 1VSDA 3CYMA 3VQQA 2DFEA 4BR5A 4EIAA 4CGIA 5TKYA 1NJWA 4FJIA 2P9KB 2PYLA 1OH8A 4Y1CA 1QSLA 1BA1A 2X74A 3OYLA 3L3VA 2GBZA 1YT3A 3VQBA 3DXMA 4CBUA 3U6FA 3PLAA 4FZYA 1DGKN 4O44A 3OYFA 4QOZB 3QEPA 1HMVA 3M8QA 3C0BA 2NRVA 1HJRA 1ZC6A 3AVJA 2P5GA 1JLBA 4MFBA 4DV7K 2J4RA 4CZKA 1B92A 4IO8A 3FGUA 2XY7A 4GV6A 1UA0A 5HBMA 2KTQA 5AQYA 4BVOA 3SBTA 4FWMA 3VQ7A 3HK2A 3AVNA 4FVUA 4B9MA 3ATVA 2P9SB 1K8KA 1TAQA 4B1ZA 2HBLA 1NKCA 4CF1A 4DFJA 4QCLA 4DF8A 4CEAA 5KPTA 2ZM6K 2W41A 4B9SA 1DT9A 4ILGB 5C0YA 4CEQA 1R59O 4CHPA 5F1XA 1IKVA 4IXCA 3TAEA 1L3SA 3SUQA 2OANA 1ZXOA 3QEXA 1L3VA 4KB0A 1P8ZA 4I6MA 4WQ5C 2AA4A 2G8IA 1VQPN 4MO5A 3HO1A 3W0LA 2GWJA 5BPLA 3CQXA 4EFHA 5FPNA 3CJBA 2YNIA 4FLWA 4B9NA 4KHNA 4BRMA 1U49A 1BQMA 2KFNA 4L8RB 3WNHA 4WFBL 3J7ZO 5E84A 3I55N 1RT3A 2ZD1A 3A5OC 1Z05A 1EO1A 4DFMA 4B8AB 1D5AA 4CF0A 3SBGA 1U2VA 3HT3A 1RT1A 2HBMA 3V6DA 1TKTA 3IUCA 1HYSA 3SUOA 5DK5A 1SAZA 3C6UA 3MAQA 3O4NA 4L3QA 4JI0K 3QEWA 3VF6A 4FWQA 2DTUA 1LW0A 3CQ8A 1NK8A 2P5OA 4W5QA 3AO3A 1VHXA 1C0MA 1NK0A 3HJFA 4DS5A 3L2WA 3RWUA 2WOMA 1JCEA 1HQEA 4BWMA 4BRQA 3F73A 5HRNA 5AZJB 4NCGA 1JLQA 2HHWA 3LDOA 1HNIA 2EX3A 1HKBA 2IOCA 3NDKA 4HVJA 1NKEA 5ELZA 1NOZA 3O9QA 1CZBA 5BR9A 3AVGA 3ZETA 3A8YA 4QS7A 2CGLA 5KGXA 4BRNA 3EE9A 3V1RA 5JLHA 3C6AA 1RFQA 1QS4A 4DTUA 1HUXA 5AQNA 3O1BA 3SJHA 2ETJA 2NLXA 4CZLA 3BF3A 2VWKA 4CVNE 3KIOA 2A41A 4OPHA 3BUZB 4R79A 2NRXA 4JKEA 1UWBA 4HCCA 3D45A 1K6YA 4DR3K 1GLAG 4W5RA 3WUHA 5AFUA 4DS4A 2O8EA 4BQZA 4JKCA 3HPHA 1SL2A 1GLLO 3DXMB 1ASUA 4CFAA 3SQ4A 4CEDA 4O5FA 4CJEA 3EN9A 4FJXA 4KHYA 1SV5A 4B1UB 4JV5K 4FXDA 5AQWA 2VGNA 3P4IA 4M7XA 1BU6O 1LW2A 3O3FA 1VSKA 1NGEA 2P9LA 4X66K 2W6LA 4MLEA 3HBTA 5GADP 4FLVA 4C23A 3LM2A 4JEPA 5K14A 3VMFB 5KPRA 4CF2A 2FF6A 2DFFA 4K41A 2D0PA 1W9HA 2B6AA 3U3YA 4DTRA 4NXNK 1K8KB 1J6ZA 4FSVA 4DFPA 2QWPA 3CF5L 1OKJA 3VGMA 1NGCA 3OYJA 4JI6K 3NBPA 1J53A 5FRNA 3D2EA 1RTIA 3F2KA 3K2PA 2HHVA 1KAZA 3CC4N 1V4TA 4GKKK 1SL1A 1RT7A 5M1OA 4FWKA 2ZQBA 1YHQN 4PKGA 4I6MB 4M3YA 1Q9XA 2CGJA 3K59A 3NF6A 1VQ5N 3SCXA 1SS6A 5TKWA 3ZSOA 2FLOA 4H03B 3VESA 5AQGA 2XY6A 4HCBA 2DY4A 1N8RO 1NGHA 1WNSA 3I8DA 4A57A 3ASMA 3A5NC 1H1VA 2A5XA 2A3ZA 1BI4B 2DFHA 1NK9A 2G8WA 4IEEA 3L4IA 3AY9A 1JXBA 4QS8A 5CY4A 4MDBA 1U48A 1U2VB 3AV9A 3B8AX 4E7JA 2F8TA 4UQGA 4FJ8A 4OPJA 4B9QA 2OTJN 1QVFM 2E20A 1GOAA 3RMCA 1KSPA 1KTQA 1GLFO 1XHZA 3M8RA 3V9WA 4YDUA 4B9LA 1HR0K 3FZHA 1KLMA 4JKFA 2BTFA 4I2QA 1W2BM 3SPZA 2ZF5O 3AVLA 3PIOL 5JS2A 3RRHA 1IKXA 4KPYA 3DRRA 1HKGA 3LP0A 3VEVA 2Q97A 3IS9A 1IJJA 4CJUA 3IMXA 4DFKA 1Q86O 2HMPA 4FCYA 4CCHA 3HL8A 1KCFA 4DV3K 4K8XA 3LWMA 3NH1A 5BN9A 5KI6A 3ZETB 2BUPA 5J2MA 1CXUA 4DLGA 1VQNN 2E2PA 3TU5A 1IKYA 1S72N 1BUPA 2H3GX 3H3OB 3RMBA 3SJJA 4A5AA 1NKBA 4PHTX 4BGAA 4N56A 1U47A 2CGKA 2F7TA 1EX4A 5AQPA 2E2QA 4CZMA 2UXCK 5CZ2A 1TK5A 4DQSA 1YI2N 4CF9A 1YJ9N 1G15A 3DRPA 1TL1A 4A62A 5AQSA 1NK4A 4DR6K 4F3OA 1WOQA 3HVTA 2O8EB 1WN7A 4ISGA 3E9PA 3KJVA 1C1AA 4DHYA 3ZEUA 3NMUA 1YIJN 2HOEA 5KRTA 1NK7A 4FK2A 4CZJA 3I33A 4EP5A 4B3OA 3VQDA 4BC3A 3L2RA 2G8HA 4LFCK 1VSJA 4HUFA 2E6LA 3ZCMA 4B9VA 2Q1NA 4AM6A 1BISA 3LDLA 4KKOA 4JYAK 2P9LB 1XMOK 3EEQA 1WAJA 2OZMA 3CERA 1IO2A 1TVRA 3VEWA 4FLZA 4CIGA 4BE1A 3THWA 1QZ5A 2I7PA 4LF6K 2IGIA 2FXUA 5HRPA 4MLHA 2KQ2A 2F9TA 2E88A 5M1NA 3GE1A 5SWMA 3PX4A 2KZMA 4DQIA 3AVCA 1ILYA 4CIFA 4Q5VA 3GG4A 3B6OA 3TR8A 1NGBA 3P1GA 4F8RA 4BY9C 4H0PA 2XO7A 4BRHA 1S1TA 3VETA 3C6HA 3D2EB 1Q82O 1W7AA 4Z4GA 1S6PA 4F4KA 4B8CA 3JS6A 2NRWA 4AHTA 3HVRA 4FLTA 5J2QA 1E3MA 4FLYA 3BGRA 3IDHA 4OGEA 3EL2A 5LJVA 1VQ7N 4J2AA 1NM1A 5AQZA 5H1SQ 1D9DA 4OX9K 4WYBA 4FOEA 2GUPA 3KD5E 3SAGA 4CJ3A 3EZ5A 2D0BA 3QLHA 4A59A 3QEVA 4ILHA 1RT4A 2OZSA 4E1JA 5I42A 1HPZA 3L2VA 3HOTA 4ID5A 2R7YA 3KD1E 5IT9O 3HP9A 3AO2A 1HYVA 2P9IA 4BR0A 1U04A 4ZTFA 1U45A 2YNHA 4CIEA 2OPSA 4CK1A 4M3UA 4BQLA 3QDKA 2GWKA 3ENBA 5C10A 4M7YA 2QWNA 1QE1A 3QO9A 2IDOA 3CCQN 3UKUA 4CGHA 3OYNA 1ATRA 4OPKA 5KQ8A 4MDAA 5HLFA 4BC2A 2QKBA 4ILJA 5C12A 3CG7A 4LD0A 4BDZA 1OVQA 4RW7A 1UAXA 4OKJA 5AZIA 2W6KA 4FWRA 4E89A 3CCLN 1CXQA 5EY4A 1ATNA 3OBWA 3ZSYA 3DLLL 4LH4A 2ZJPL 3RMAA 3EYZA 4B1VA 4ISEA 4DV2K 5AQMA 1ZBLA 2B4JA 3TTFA 4CJLA 4MQ3A 3DLRA 1B9FA 5HRRA 4XH5A 4DMNA 2O8FA 4DV4K 2VYPA 4PKHA 3V9XA 2PAVA 3CETA 2QK9A 3D6RA 4CHZA 5IWAK 4FK0A 5BRHA 5LJWA 4F2SA 4FWPA 4DU3A 3O9RA 2OCEA 2A1RA 4JI2K 3LWLA 3PY8A 3E01A 3O9UA 3LPUA 3D7EO 4IDKA 1EKEA 5F2RA 3OYHA 3THYA 3VERA 3MN7A 4CJPA 3CPWM 3VQ8A 1SQKA 3BZCA 3ZEUB 1UOCA 2D4WA 3OYDA 4KH5A 3IAYA 1W0HA 4NXMK 4J2EA 3S3OA 3V1OA 1VSFA 3OYGA 4FVMA 3M1FA 4NYFA 5DMRA 3TSUA 3F9KA 2G8KA 3MN9A 3LDPA 1HX1A 3F9MA 3MX2A 4N5SA 1VQ9N 1NK6A 4GVMA 3THWB 2P9NA 3E9LA 3AA2A 4K25A 5J2PA 1GLCG 3SNNA 3TABA 4E7IA 4J2DA 1EWQA 3VF4A 3OVNA 3AVHA 3L2QA 3O80A 1VK0A 1YJNN 3V1QA 1T03A 2UUAK 3GL1A 4H5VA 4FJ5A 2E2NA 4NCAA 2UXDK 3SPYA 2BE2A 3PX6A 1TL3A 4RW6A 3QNNA 2YHYA 3BP8A 3I0RA 4BROA 5C2FA 4ISFA 2IS3A 3KZBA 1S6QA 2D1KA 4WFAL 2QWRA 5AQJA 1YXQA 2KHOA 3VQPA 4W5OA 4QAGA 4FLXA 4OKKA 4FWSA 4CJQA 5GAEP 2JGUA 1YF5L 1RDDA 3K5OA 4K42A 3ID6A 4O8UA 4B3MK 4WFNL 2CH6A 2V7YA 3MMVA 4A61A 1MWKA 3QIPA 2UUBK 1S9EA 4AILC 2ZE2A 1REVA 3VEYA 1U4BA 3DOLA 2HSTA 4BC4A 1JLCA 3CI5A 4NB4A 1RT5A 3VQEA 1NGDA 5ADXH 3OS2A 3ULDA 4PWDA 3SQ2A 5DM7L 5D3GA 4H0XB 1OH7A 3G4SN 2GELA 1YUWA 2P9IB 3VA3A 4JRPA 5EXWA 1L3UA 1RILA 4BR4A 5C42A 4Y0WA 2F8SA 1BA0A 3LALA 4CW7B 5C24A 4FM0A 1D8YA 3VEZA 3UKUB 3KLFA 5AFUH 3JYTA 1T44A 1J5OA 5BREA 4DU1A 4CFBA 4DTXA 1E4FT 3KK3A 2QEXN 4KH6A 3SI6A 5AZIB 5FPMA 3RSEA 1BHLA 4YOUA 1ZBIA 2FC0A 3CCUN 5EOYA 4BR9A 5KPZA 4KO0A 4BE2A 4FJLA 4H0VB 3TTDA 4KH4A 2GUIA 2E1YA 4B3TK 3TAFA 3S41A 4IG3A 2P51A 4CEBA 5LY3A 1N5YA 1JKHA 1DKGD 4PKIA 4E1MA 3RTVA 2GX9A 1NGFA 3AO5A 2O8FB 1BOTO 3WQUA 2F4VK 4IOAL 3EY1A 3R6MA 3RR7A 4U67L 5AQKA 3AAQA 2HBJA 4RWTA 3K5MA 1XHXA 1S5JA 1BI4A 2VG7A 4Y1DA 2PFUA 4DB3A 2VWBA 3DXKA 4JHDB 5EVZA 4KHSA 2FSJA 1TUYA 3LZIA 3WQTA 3THYB 2HNDA 3EKUA 4B1YB 4FW1A 1BDGA 2E6MA 3KLGA 1WBBA 1TKDA 1QHTA 1X3MA 3VQ6A 1CLQA 2GTDA 5HL7L 3MXIA 4N47A 2YHWA 4B9TA 3KKRA 1NGAA 4AM7A 1M90O 4CHOA 1VSHA 2FSNA 4DLEA 5FPDA 3TSPA 4WQ5A 4YOYA 1C0TA 4NLBA 2B5JA 4NYNA 4FJNA 1NGGA 1BGXT 5FLXO 1XMQK 3K9KA 1DEJA 4HUGA 2PZSA 3ZT4A 1ASWA 3NF7A 4WF9L 2P9NB 2YX6A 3V9UA 1T05A 2G8VA 2A40A 4LSNA 3HM9A 3L6QA 2Q0UA 3J81O 3KLHA 1B9DA 3O08A 1TKXA 4HUEA 1WSJA 3C95A 5ADXA 2WUSA 3QESA 2NNWA 1NLVA 5C25A 3O6WA 1KRPA 4K43A 3CQYA 4CI6A 3ZSWA 4CJVA 1VSLA 1W97L 3CC7N 5GINA 1F21A 4KFBA 4RCHA 3QNOA 1BWFO 2FSKA 4FW2A 3SK3A 3K0SA 3DM2A 3HPGA 1T7PA 2EWSA 2QXFA 1EQYA 3A0IX 4LSLA 5M1PA 2ASPA 3VTIA 5HROA 3AA5X 4ELTA 1VQON 4DG1A 5FPEA 4FJJA 3ATUA 3G25A 4DUYK 4CD1A 5FDLA 1LV5A 3IG1A 4JK8A 3NH0A 1RBSA 2HNZA 3RRGA 2EHGA 4CHNA 4H5NA 1D9FA 1CZ9A 3HXMA 3OJUA 3KK7A 2YKNA 3T1YK 4OVLA 4I7FA 4X65K 2YHBA 3HRGA 3MXMA 4LF5K 5GAHP 1ESVA 3ZSZA 4I9QA 3RSEB 5CHIA 4A5BA 3MECA 3ZLJA 2WTUA 5M1QA 5BR8K 2GV9A 1FKOA 1BL3A 2NRHA 2UUCK 4CGGA 4AH9A 4EZ9A 2ITGA 4DSEA 3OS0A 4DSKA 4CJ5A 1YVUA 2V51B 3ENOA 4FOIA 1MA9B 4PA1A 4KHPK 4YOXA 1BG3A 3VN5A 2HHHK 4BVPA 4DKWA 3BDPA 4W5TA 1X1PA 5JS1A 4E19A 4FJKA 1XQSC 2HW3A 1VQLN 3C94A 2IVOA 3CCSN 1FKPA 1QZ6A 3QMLA 4LF4K 3AAPA 3WXJA 1GOCA 1XI1A 4FJHA 3DXKB 3CMEN 3QFUA 4GV9A 4IOCL 4WQ4C 3CM6A 5BPNA 5F0XA 1KAYA 4JRQA 1ZYQA 1A5XA 3CC2N 3PSIA 3UIQA 1OVYA 4C8LA 3UB5A 1JL1A 3AVAA 4YHHK 4LF8K 1LAVA 3W3DA 4B1XB 1Y97A 4CECA 4BRDA 3DLEA 1EXQA 2VGMA 1Q9YA 4IOXA 5HRSA 4K0KK 4CK2A 1HPMA 3AVKA 3V9SA 4JNEA 1RBRA 4BG9A 4E1NA 1TK0A 3LAKA 4CFDA 2UU9K 3G10A 3SUPA 2E4LA 2QXLA 3SQ0A 3ZT1A 1WB9A 3FLCO 1RDBA 3TAPA 3K58A 4FM2A 4DTSA 3T3FA 3I56N 5LMNK 3HP6A 1Q18A 3J7AP 3QBXA 5MLCQ 3QFPA 1X9SA 2VCPA 2RHKA 3VEOA 3I0SA 1TGOA 3CJAA 5AQOA 2X6NA 1RDCA 2JLEA 4JN4A 4DQRA 4H5TA 3NGIA 1IBMK 3VQAA 1N36K
chains in the Genus database with same CATH topology
4CW7B 3J81O 1N34K 1HR0K 4JI2K 3JAMO 4DR5K 1N33K 4LF4K 4JI5K 4DV5K 1FJGK 1J5EK 4JV5K 4NXMK 4OX9K 2UXBK 2E5LK 4DV3K 1HNZK 4X66K 4LFBK 4B3TK 5AJ3K 4YHHK 4LF8K 4LF9K 4DV1K 2VQFK 4DR4K 5IT9O 5LMUK 1XNRK 4X64K 4JI8K 1IBKK 1I94K 4NXNK 4DR1K 4JI0K 5A2QO 4K0KK 2UXCK 3OTOK 4DUYK 4JI3K 2F4VK 2VQEK 4DV0K 4LFAK 2UUAK 3J7YP 2UXDK 4JI6K 4DR6K 4B3SK 3J80O 2UU9K 4GKKK 4DR2K 4GKJK 3T1YK 1XNQK 4YY3K 4X65K 4X62K 4LF5K 4LF7K 4LFCK 4DV6K 4DV7K 4B3MK 4DR7K 5LMNK 4JI4K 2UUBK 5BR8K 4DV2K 3J7AP 4B3RK 4JYAK 1XMOK 4JI7K 4AQYK 1IBLK 2UUCK 4JI1K 1HNWK 4CVNE 4DV4K 4LF6K 1XMQK 5FLXO 1N32K 5LL6Z 4V19S 1IBMK 4DUZK 1N36K 4KHPK 3T1HK 4DR3K 2HHHK 2ZM6K 5IWAK 1HNXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW7 B;  3J81 O;  1N34 K;  1HR0 K;  4JI2 K;  3JAM O;  4DR5 K;  1N33 K;  4LF4 K;  4JI5 K;  4DV5 K;  1FJG K;  1J5E K;  4JV5 K;  4NXM K;  4OX9 K;  2UXB K;  2E5L K;  4DV3 K;  1HNZ K;  4X66 K;  4LFB K;  4B3T K;  5AJ3 K;  4YHH K;  4LF8 K;  4LF9 K;  4DV1 K;  2VQF K;  4DR4 K;  5IT9 O;  5LMU K;  1XNR K;  4X64 K;  4JI8 K;  1IBK K;  1I94 K;  4NXN K;  4DR1 K;  4JI0 K;  5A2Q O;  4K0K K;  2UXC K;  3OTO K;  4DUY K;  4JI3 K;  2F4V K;  2VQE K;  4DV0 K;  4LFA K;  2UUA K;  3J7Y P;  2UXD K;  4JI6 K;  4DR6 K;  4B3S K;  3J80 O;  2UU9 K;  4GKK K;  4DR2 K;  4GKJ K;  3T1Y K;  1XNQ K;  4YY3 K;  4X65 K;  4X62 K;  4LF5 K;  4LF7 K;  4LFC K;  4DV6 K;  4DV7 K;  4B3M K;  4DR7 K;  5LMN K;  4JI4 K;  2UUB K;  5BR8 K;  4DV2 K;  3J7A P;  4B3R K;  4JYA K;  1XMO K;  4JI7 K;  4AQY K;  1IBL K;  2UUC K;  4JI1 K;  1HNW K;  4CVN E;  4DV4 K;  4LF6 K;  1XMQ K;  5FLX O;  1N32 K;  5LL6 Z;  4V19 S;  1IBM K;  4DUZ K;  1N36 K;  4KHP K;  3T1H K;  4DR3 K;  2HHH K;  2ZM6 K;  5IWA K;  1HNX K; 
#chains in the Genus database with same CATH topology
 4GMJ B;  4DQ8 A;  2VG5 A;  2FBV A;  4KI6 A;  4DR5 K;  3VGK A;  4IFV A;  3QER A;  1G99 A;  4M42 A;  2X6S A;  2G8F A;  4OO1 J;  4GW6 A;  3VOV A;  3DJC A;  3RVC A;  3T69 A;  1RNH A;  4KBO A;  3NVK A;  2HF3 A;  2A42 A;  1IH7 A;  1K73 O;  1EP4 A;  3M3Z A;  3WXI A;  2IC3 A;  3LP2 A;  4HWI A;  3AVM A;  3PX0 A;  4DSI A;  3VEX A;  5AJ3 K;  3DRS A;  2HVH A;  3U9D A;  2YHA A;  3E9O A;  4FPB A;  2E8A A;  1GLD G;  2P1J A;  4ICL A;  3Q7B A;  4EHU A;  1XNR K;  1KD1 O;  2D5R A;  3TAG A;  2WFB A;  1NU0 A;  3OTO K;  3OYK A;  2LSN A;  3ZT3 A;  1L3T A;  1X9W A;  2CH5 A;  3MED A;  4WCE L;  4AHV A;  2RPI A;  3R9P A;  2HNY A;  3NHG A;  2O4I A;  3C6T A;  1JCG A;  3M6G A;  3TPQ A;  3SZ2 A;  1IG9 A;  1RBT A;  4XEI A;  4GKJ K;  2W40 A;  1TKZ A;  4A2A A;  3OJS A;  3V9Z A;  4LF7 K;  1QHA A;  3O9T A;  2QWL A;  5I3U A;  4DR7 K;  5GAG P;  2OA8 A;  4B9U A;  1S3X A;  2WC9 A;  2ZGZ A;  3MXJ A;  4CHY A;  3CCM N;  4B08 A;  4XH4 A;  1MDU B;  4YOR A;  5M1F A;  3AVF A;  4KI4 A;  3PIP L;  2X78 A;  2YI1 A;  3AVI A;  3VPZ A;  1JXE A;  4CGF A;  1EET A;  3T7Z A;  3ISN C;  5AQI A;  3RMD A;  4FWO A;  1BIU A;  3KTQ A;  1RT2 A;  1HKC A;  1KLN A;  5BPM A;  2O4G A;  3A5L C;  3JSM A;  3MCP A;  3BEX A;  3L2U A;  5DM6 L;  1UA1 A;  5GIP A;  4JD2 A;  3VF2 A;  1NJZ A;  5JIC A;  1SL0 A;  3BY5 A;  1BIZ A;  3OA9 A;  1TK8 A;  4ZTJ A;  1MU2 A;  3LAN A;  3FFI A;  2HF4 A;  2FF3 B;  3WNE A;  3NFA A;  3ZT0 A;  3AA4 A;  3CJ9 A;  4ID1 A;  3G6E N;  4H0T B;  3WXL A;  5AQH A;  4XH1 A;  3L3U A;  2E5L K;  1S1X A;  3QIN A;  3THX A;  1QQO A;  4FJG A;  3IFR A;  2O8D A;  1NWK A;  4JHD A;  3CFP A;  4HTU A;  4CJF A;  1S1V A;  4DQQ A;  3VA0 A;  3V4I A;  4B1W B;  2QKK A;  2QM1 A;  1RDW X;  5FRO A;  3ZSV A;  4FL9 A;  4K8Z A;  4KHQ A;  4G1Q A;  3FZM A;  1VSI A;  1NJI O;  4IJN A;  3AAR A;  1NGI A;  3SUN A;  3FZF A;  1TUU A;  5CYQ A;  3D0P A;  3ZSR A;  1HYZ A;  1ASV A;  2HHX A;  1WSG A;  3D2F A;  5FRM A;  3FE1 A;  4Z4I A;  1KFD A;  1D4X A;  4H5W A;  3CD6 N;  2OPQ A;  2P9U A;  4DR2 K;  3SYZ A;  3MCA B;  3L4Q A;  1SZ2 A;  1YJW N;  3H1V X;  2FBX A;  2JWK A;  2XHB A;  4KHU A;  3H46 O;  4CJW A;  2Z1J A;  4JI4 K;  1SKS A;  2W42 A;  4HTL A;  4J2B A;  1VAZ A;  4UY8 O;  2PY5 A;  1T6C A;  3PO4 A;  4DTP A;  3GOI A;  4BRI A;  1XC3 A;  4JI7 K;  5CYM A;  1S22 A;  2YKM A;  4BGB A;  5KRS A;  4H5R A;  4M3T A;  4I2P A;  4M45 A;  4RW4 A;  1NG9 A;  1N32 K;  1IV0 A;  3R3L A;  5J2N A;  5LL6 Z;  3K57 A;  4FPA A;  4CER A;  3THV A;  1KVC A;  3ITH A;  3R1X A;  4CD3 A;  3H1Q A;  4DTJ A;  1HNX K;  3LDQ A;  3DLB A;  2KLA A;  1KQS M;  3WNF A;  1RTH A;  2XY8 A;  1BO5 O;  4E0D A;  3A2F A;  2AJQ A;  3TAQ A;  3NAE A;  4WE1 A;  5BRF A;  2ZWH A;  3T19 A;  4CEZ A;  4C8M A;  3AGK A;  4DTO A;  1HRH A;  2OPR A;  3P5J A;  1XWL A;  3CPE A;  2YV0 X;  2YJF A;  1C0U A;  1Q7Y O;  5AQU A;  3KHY A;  1E4G T;  5CE3 A;  2A6A A;  3ZX0 A;  1JJ2 M;  4H8K A;  1GOB A;  3H6E A;  4FYD A;  4RG8 A;  1HNZ K;  4FK4 A;  2Z1H A;  1KC8 O;  1GLB G;  4C8N A;  3CCJ N;  1J54 A;  1VSE A;  3NCI A;  2Q31 A;  2G8U A;  3VQC A;  4O8K A;  4C8K A;  5JVH L;  4F3T A;  4FLU A;  3PUF A;  1JLG A;  2AP1 A;  3QIC A;  4CJ4 A;  1WBD A;  5A2Q O;  2QTD A;  4IEI A;  4Z0U A;  5E41 A;  1KXP A;  3LZJ A;  4FJ9 A;  3T1A A;  4LFA K;  3SV4 A;  3C7N A;  4CEE A;  1NMN A;  3EKS A;  3OS1 A;  3ALY A;  1GLE G;  5KTQ A;  4HHT A;  3CJC A;  4FJ7 A;  1QSS A;  3FZL A;  2ITM A;  1TYQ A;  1ZBH A;  2YCH A;  4JD2 B;  3PO5 A;  2I7N A;  2UYT A;  4CJR A;  1TV6 A;  3QET A;  1N6Q A;  3CM5 A;  3ZSX A;  3LP3 A;  1X9J A;  3JXU A;  3CFO A;  1SKR A;  4BRF A;  3O1W A;  1GLJ O;  2GEM A;  1EWR A;  4KB1 A;  2F96 A;  3TAR A;  2BGG A;  3GDQ A;  3TWH A;  4B3R K;  2O8B A;  3THX B;  4BRL A;  1KAX A;  4AQY K;  1IBL K;  4H4M A;  4E3S A;  4ELU A;  4BAC A;  1QQM A;  4YOT A;  2O8D B;  1Y64 A;  1HNW K;  3OYI A;  1WLJ A;  1C1B A;  1HJO A;  4V19 S;  4C8O A;  1CZA N;  3HST B;  3J8A A;  3U8X A;  3K5N A;  3L8B A;  3SV3 A;  4JKB A;  1YAG A;  4JKG A;  2KFZ A;  4AHU A;  1VQ4 N;  1V4S A;  2KKZ A;  4O0I A;  1JLF A;  1WSE A;  4LY7 A;  2ASM A;  3JAM O;  4PL7 A;  2OPP A;  1N33 K;  2Q3S A;  4BG8 A;  4C1N I;  1Q8I A;  3D2F B;  3WEE A;  4KTW A;  3TI0 A;  2P9U B;  3PV8 A;  4Z94 A;  3LDN A;  4DTN A;  3N4P A;  1WSI A;  1T6D A;  2UXB K;  1ZBU A;  4M63 C;  1XUP O;  3NF9 A;  1RBU A;  1JLA A;  4BRP A;  3M8S A;  4GNI A;  3QEI A;  4BDY A;  4PY5 A;  4DSJ A;  5J1E A;  3E66 A;  4LF9 K;  1HLU A;  1VRU A;  3OY9 A;  2QA4 N;  1RDA A;  2P9P A;  2V7Z A;  3M5R A;  4FWL A;  4NCB A;  1QQN A;  1ZBF A;  5HOO A;  3U9Z A;  3QBW A;  5I9E B;  4YFU A;  3VTH A;  4OJR A;  1IBK K;  1NJX A;  4ELV A;  4DU4 A;  3H08 A;  4BE0 A;  4JI3 K;  2Q36 A;  4CJS A;  4IFY A;  4H0Y B;  4IBN A;  2VQE K;  3CCV N;  4FZX C;  4OKE A;  4DV0 K;  3HOS A;  4KRF A;  2QWQ A;  3J7Y P;  4E7H A;  4OLA A;  4CGJ A;  3U3G A;  2Y1J A;  3G71 N;  1NOY A;  1VQ6 N;  5CZ1 A;  4NLC A;  4RW9 A;  1KVB A;  2Z1G A;  1FW6 A;  3CFR A;  3DLH A;  1XNQ K;  2HHS A;  3S3M A;  4X62 K;  4G9Z A;  1HNV A;  2OYQ A;  4JK9 A;  1LCU A;  4KRE A;  3OBY A;  3FFK B;  4YOW A;  1C0G A;  3HI0 A;  3NGY A;  5AQR A;  1J9A A;  3Q7C A;  2IIR A;  5AQT A;  5KGW A;  1MWM A;  2OTL N;  4CE9 A;  2FBY A;  1OH5 A;  1T3V A;  4FZZ A;  4JLH A;  4JAX A;  1Z25 A;  2E1Z A;  4CGD A;  3DI6 A;  3IKM A;  3O3G A;  3F5T A;  1YTA A;  3VQ4 A;  4DF4 A;  4AHR A;  3VGL A;  3LDS A;  3O8M A;  3DOK A;  4ZHR A;  5HP1 A;  3MN6 A;  4DQP A;  1WSH A;  1VQK N;  1LAW A;  4CZE A;  3C7N B;  3K9J A;  3MDQ A;  3O4W A;  1QQC A;  4O55 A;  3AO4 A;  3M8P A;  4IO9 L;  3MWP A;  1JLE A;  4BR7 A;  1VRT A;  1TYQ B;  3OHR A;  4JKD A;  3FR0 A;  1S9G A;  4JKA A;  3WXK A;  1KVA A;  1A5W A;  3DLG A;  4O4G A;  4DTM A;  2XY5 A;  3H45 C;  3OYB A;  1WAF A;  3MEE A;  1DLO A;  3LP1 A;  3O4Q A;  3S3N A;  4LFB K;  1P90 A;  3NGZ A;  1O13 A;  5EU7 A;  5GIO A;  1C1C A;  1LWE A;  3TAN A;  2O8B B;  4YDU C;  1RTD A;  3ZYY X;  1C6V A;  4FWN A;  5SZT A;  3QB0 A;  4JS4 A;  2IVP A;  3V81 A;  4CZF A;  3A5M C;  4X64 K;  4BC5 A;  1I94 K;  4CZG A;  1NJY A;  2JWL A;  1U6Z A;  3K5L A;  4NO7 A;  1O1W A;  4F2R A;  4M3Z A;  1YTU A;  4E7L A;  2PBD A;  4GV3 A;  4IWV A;  3CIP A;  2WBN A;  4N41 A;  4JKG B;  4I9L A;  4BR2 A;  2IAJ A;  2BDP A;  5AR0 A;  3LAM A;  4CJ7 A;  3VEN A;  1LWF A;  2BAN A;  4RTF D;  5JLF A;  3WEE B;  4AHC A;  3NH2 A;  4C1N K;  2HVI A;  2PYJ A;  3OYC A;  3HTV A;  4DSF A;  4QS9 A;  3CCE N;  1JCF A;  2ZGY A;  2YNG A;  3E1Y A;  1BCO A;  2DPN A;  1RDU A;  1RBV A;  1Z6R A;  3KWI A;  2RF2 A;  3MEG A;  5KQD A;  4M41 A;  4KHW A;  3AGR A;  4CZH A;  1L5U A;  1TAU A;  2O8C A;  4GVE A;  4WQ4 A;  3KK2 A;  2RN2 A;  4KV8 A;  1YVN A;  1WUA A;  2P9P B;  4CEO A;  2RE2 A;  3SLC A;  4M3R A;  4DUZ K;  1ZBS A;  3P31 A;  2D0O A;  4LC9 B;  4N76 A;  2KZZ A;  4IKF A;  1I3A A;  3MN5 A;  2HHT A;  3AA3 A;  3ULE A;  3HYF A;  1X9M A;  5C2D A;  1ATS A;  4DV5 K;  4BWJ A;  3ID8 A;  1SKW A;  3CCR N;  5BRD A;  3LL3 A;  4CK3 A;  5JVG L;  1K9M O;  3IRX A;  4KTZ A;  3KLI A;  3OYM A;  2NRT A;  1VQ8 N;  1BQN A;  1DTT A;  5EX5 A;  1R0A A;  3C65 A;  4M3W A;  3TAM A;  1HQU A;  3UKR A;  4IG0 A;  4EHT A;  2QW9 A;  5AQL A;  3ZX2 A;  1NK5 A;  3DLK A;  4E7K A;  3DAW A;  4DR4 K;  2IVN A;  2YJE A;  3AO1 A;  4EP4 A;  4CEF A;  1Q81 O;  1QVG M;  5LMU K;  1S1W A;  3WT0 A;  1NGJ A;  5AQX A;  2ZJR L;  4JI8 K;  3ZX3 A;  3ENH A;  2Q2R A;  2HHU A;  5T7B A;  3CJ7 A;  5CR4 A;  3FZK A;  1OH6 A;  3NF8 A;  4BRG A;  4EZ6 A;  3CHW A;  4CF8 A;  4FJM A;  4BRC A;  4B3S K;  3VQ9 A;  3LPT A;  2QI2 A;  3O5B A;  1KFS A;  2HMI A;  3GBT A;  1IKW A;  2NZT A;  2A1S A;  4IFE A;  3SMS A;  3TTC A;  1QSY A;  2QWO A;  4OPA A;  3WXM B;  4BRA A;  4CES A;  4XIU A;  1BCM A;  3NVM A;  4AF1 A;  2YNF A;  4DV6 K;  3MX5 A;  4OGC A;  2RKI A;  1NBW A;  2XRI A;  4H4O A;  1T8E A;  4Z4E A;  1JL2 A;  2ASO A;  5E26 A;  4M3X A;  4A2B A;  4PUO A;  3O3H A;  4CFC A;  3SMP A;  4O0J A;  3BZK A;  3DWL A;  5C15 A;  2HBK A;  2P9K A;  4LH5 A;  3T1H K;  3P83 D;  3CXC M;  1RTJ A;  4DWI A;  2V52 B;  4JS5 A;  2FBT A;  3PSF A;  4AHS A;  1N34 K;  1K8A O;  5AQV A;  4R5P A;  5B8H A;  3HPO A;  4W5N A;  2I5J A;  4CJK A;  1VSM A;  1FJG K;  1XC9 A;  1J5E K;  2NRZ A;  4TSX A;  1RT6 A;  3ZT2 A;  2HHQ A;  4PL8 A;  2D0C A;  5AQF A;  4DCH A;  3SQ1 A;  2Q0R A;  1NMD A;  4H0O A;  2E2O A;  2Z1I A;  2F9W A;  3TSQ A;  4OLB A;  4RW8 A;  3HM8 A;  3O9S A;  3HZ6 A;  3QIO A;  2ZJQ L;  1X3N A;  4FO0 A;  2VQF K;  2VG6 A;  2P9S A;  2O8C B;  4O5B A;  3WNG A;  1QTM A;  3EO3 A;  4DR1 K;  1LWC A;  3CJ1 A;  3DYA A;  4Z4C A;  5AQQ A;  3LM9 A;  1FK9 A;  3ZSQ A;  4KTQ A;  1C0F A;  1IG8 A;  2D0A A;  5M1K A;  4J8F A;  1RCH A;  4IJA A;  3KWG A;  1A5V A;  1NNE A;  3ULE B;  3BF1 A;  3J80 O;  2YHX A;  4IDH A;  3MWT A;  2KW4 A;  4JK7 A;  1LOT B;  4BRK A;  3I8B A;  4FM1 A;  4YY3 K;  3RR8 A;  4Q0B A;  2BH1 A;  5BN8 A;  2NUB A;  3R8E A;  1DTQ A;  3KKS A;  3EZW A;  3N4Q A;  4BDP A;  3UKR B;  4MO4 A;  1YIT N;  1FXX A;  3EE8 A;  3OYE A;  4JI1 K;  4BRE A;  3OYA A;  3AVB A;  4Z4F A;  4EAH D;  1RGI A;  4PQU A;  2HB5 A;  3OW2 M;  3HSC A;  4CZI A;  1S1U A;  3L0Q A;  4KAZ A;  3S9H A;  2QWM A;  3SAH A;  3NE6 A;  1SUQ A;  4YNQ A;  1M1K O;  4F9O A;  3B6P A;  4CBW A;  4CJT A;  1WSF A;  3MK6 A;  4JI5 K;  4JKH A;  2WON A;  3KVG A;  3U4L A;  5AZJ A;  3CMA N;  1VQM N;  2VWJ A;  1I39 A;  3SAF A;  2Y1I A;  3VQ5 A;  4Z4H A;  4DSL A;  4CBX A;  2NRR A;  1Z26 A;  4IZ9 A;  3KLE A;  4CHQ A;  3G0Z A;  3KK1 A;  4GY2 B;  3P38 A;  1ITG A;  4DV1 K;  5JMV A;  2ATQ A;  3DMJ A;  4YOV A;  3P39 A;  3UE5 A;  3H3N O;  4U7B A;  1VSD A;  3CYM A;  3VQQ A;  2DFE A;  4BR5 A;  4EIA A;  4CGI A;  5TKY A;  1NJW A;  4FJI A;  2P9K B;  2PYL A;  1OH8 A;  4Y1C A;  1QSL A;  1BA1 A;  2X74 A;  3OYL A;  3L3V A;  2GBZ A;  1YT3 A;  3VQB A;  3DXM A;  4CBU A;  3U6F A;  3PLA A;  4FZY A;  1DGK N;  4O44 A;  3OYF A;  4QOZ B;  3QEP A;  1HMV A;  3M8Q A;  3C0B A;  2NRV A;  1HJR A;  1ZC6 A;  3AVJ A;  2P5G A;  1JLB A;  4MFB A;  4DV7 K;  2J4R A;  4CZK A;  1B92 A;  4IO8 A;  3FGU A;  2XY7 A;  4GV6 A;  1UA0 A;  5HBM A;  2KTQ A;  5AQY A;  4BVO A;  3SBT A;  4FWM A;  3VQ7 A;  3HK2 A;  3AVN A;  4FVU A;  4B9M A;  3ATV A;  2P9S B;  1K8K A;  1TAQ A;  4B1Z A;  2HBL A;  1NKC A;  4CF1 A;  4DFJ A;  4QCL A;  4DF8 A;  4CEA A;  5KPT A;  2ZM6 K;  2W41 A;  4B9S A;  1DT9 A;  4ILG B;  5C0Y A;  4CEQ A;  1R59 O;  4CHP A;  5F1X A;  1IKV A;  4IXC A;  3TAE A;  1L3S A;  3SUQ A;  2OAN A;  1ZXO A;  3QEX A;  1L3V A;  4KB0 A;  1P8Z A;  4I6M A;  4WQ5 C;  2AA4 A;  2G8I A;  1VQP N;  4MO5 A;  3HO1 A;  3W0L A;  2GWJ A;  5BPL A;  3CQX A;  4EFH A;  5FPN A;  3CJB A;  2YNI A;  4FLW A;  4B9N A;  4KHN A;  4BRM A;  1U49 A;  1BQM A;  2KFN A;  4L8R B;  3WNH A;  4WFB L;  3J7Z O;  5E84 A;  3I55 N;  1RT3 A;  2ZD1 A;  3A5O C;  1Z05 A;  1EO1 A;  4DFM A;  4B8A B;  1D5A A;  4CF0 A;  3SBG A;  1U2V A;  3HT3 A;  1RT1 A;  2HBM A;  3V6D A;  1TKT A;  3IUC A;  1HYS A;  3SUO A;  5DK5 A;  1SAZ A;  3C6U A;  3MAQ A;  3O4N A;  4L3Q A;  4JI0 K;  3QEW A;  3VF6 A;  4FWQ A;  2DTU A;  1LW0 A;  3CQ8 A;  1NK8 A;  2P5O A;  4W5Q A;  3AO3 A;  1VHX A;  1C0M A;  1NK0 A;  3HJF A;  4DS5 A;  3L2W A;  3RWU A;  2WOM A;  1JCE A;  1HQE A;  4BWM A;  4BRQ A;  3F73 A;  5HRN A;  5AZJ B;  4NCG A;  1JLQ A;  2HHW A;  3LDO A;  1HNI A;  2EX3 A;  1HKB A;  2IOC A;  3NDK A;  4HVJ A;  1NKE A;  5ELZ A;  1NOZ A;  3O9Q A;  1CZB A;  5BR9 A;  3AVG A;  3ZET A;  3A8Y A;  4QS7 A;  2CGL A;  5KGX A;  4BRN A;  3EE9 A;  3V1R A;  5JLH A;  3C6A A;  1RFQ A;  1QS4 A;  4DTU A;  1HUX A;  5AQN A;  3O1B A;  3SJH A;  2ETJ A;  2NLX A;  4CZL A;  3BF3 A;  2VWK A;  4CVN E;  3KIO A;  2A41 A;  4OPH A;  3BUZ B;  4R79 A;  2NRX A;  4JKE A;  1UWB A;  4HCC A;  3D45 A;  1K6Y A;  4DR3 K;  1GLA G;  4W5R A;  3WUH A;  5AFU A;  4DS4 A;  2O8E A;  4BQZ A;  4JKC A;  3HPH A;  1SL2 A;  1GLL O;  3DXM B;  1ASU A;  4CFA A;  3SQ4 A;  4CED A;  4O5F A;  4CJE A;  3EN9 A;  4FJX A;  4KHY A;  1SV5 A;  4B1U B;  4JV5 K;  4FXD A;  5AQW A;  2VGN A;  3P4I A;  4M7X A;  1BU6 O;  1LW2 A;  3O3F A;  1VSK A;  1NGE A;  2P9L A;  4X66 K;  2W6L A;  4MLE A;  3HBT A;  5GAD P;  4FLV A;  4C23 A;  3LM2 A;  4JEP A;  5K14 A;  3VMF B;  5KPR A;  4CF2 A;  2FF6 A;  2DFF A;  4K41 A;  2D0P A;  1W9H A;  2B6A A;  3U3Y A;  4DTR A;  4NXN K;  1K8K B;  1J6Z A;  4FSV A;  4DFP A;  2QWP A;  3CF5 L;  1OKJ A;  3VGM A;  1NGC A;  3OYJ A;  4JI6 K;  3NBP A;  1J53 A;  5FRN A;  3D2E A;  1RTI A;  3F2K A;  3K2P A;  2HHV A;  1KAZ A;  3CC4 N;  1V4T A;  4GKK K;  1SL1 A;  1RT7 A;  5M1O A;  4FWK A;  2ZQB A;  1YHQ N;  4PKG A;  4I6M B;  4M3Y A;  1Q9X A;  2CGJ A;  3K59 A;  3NF6 A;  1VQ5 N;  3SCX A;  1SS6 A;  5TKW A;  3ZSO A;  2FLO A;  4H03 B;  3VES A;  5AQG A;  2XY6 A;  4HCB A;  2DY4 A;  1N8R O;  1NGH A;  1WNS A;  3I8D A;  4A57 A;  3ASM A;  3A5N C;  1H1V A;  2A5X A;  2A3Z A;  1BI4 B;  2DFH A;  1NK9 A;  2G8W A;  4IEE A;  3L4I A;  3AY9 A;  1JXB A;  4QS8 A;  5CY4 A;  4MDB A;  1U48 A;  1U2V B;  3AV9 A;  3B8A X;  4E7J A;  2F8T A;  4UQG A;  4FJ8 A;  4OPJ A;  4B9Q A;  2OTJ N;  1QVF M;  2E20 A;  1GOA A;  3RMC A;  1KSP A;  1KTQ A;  1GLF O;  1XHZ A;  3M8R A;  3V9W A;  4YDU A;  4B9L A;  1HR0 K;  3FZH A;  1KLM A;  4JKF A;  2BTF A;  4I2Q A;  1W2B M;  3SPZ A;  2ZF5 O;  3AVL A;  3PIO L;  5JS2 A;  3RRH A;  1IKX A;  4KPY A;  3DRR A;  1HKG A;  3LP0 A;  3VEV A;  2Q97 A;  3IS9 A;  1IJJ A;  4CJU A;  3IMX A;  4DFK A;  1Q86 O;  2HMP A;  4FCY A;  4CCH A;  3HL8 A;  1KCF A;  4DV3 K;  4K8X A;  3LWM A;  3NH1 A;  5BN9 A;  5KI6 A;  3ZET B;  2BUP A;  5J2M A;  1CXU A;  4DLG A;  1VQN N;  2E2P A;  3TU5 A;  1IKY A;  1S72 N;  1BUP A;  2H3G X;  3H3O B;  3RMB A;  3SJJ A;  4A5A A;  1NKB A;  4PHT X;  4BGA A;  4N56 A;  1U47 A;  2CGK A;  2F7T A;  1EX4 A;  5AQP A;  2E2Q A;  4CZM A;  2UXC K;  5CZ2 A;  1TK5 A;  4DQS A;  1YI2 N;  4CF9 A;  1YJ9 N;  1G15 A;  3DRP A;  1TL1 A;  4A62 A;  5AQS A;  1NK4 A;  4DR6 K;  4F3O A;  1WOQ A;  3HVT A;  2O8E B;  1WN7 A;  4ISG A;  3E9P A;  3KJV A;  1C1A A;  4DHY A;  3ZEU A;  3NMU A;  1YIJ N;  2HOE A;  5KRT A;  1NK7 A;  4FK2 A;  4CZJ A;  3I33 A;  4EP5 A;  4B3O A;  3VQD A;  4BC3 A;  3L2R A;  2G8H A;  4LFC K;  1VSJ A;  4HUF A;  2E6L A;  3ZCM A;  4B9V A;  2Q1N A;  4AM6 A;  1BIS A;  3LDL A;  4KKO A;  4JYA K;  2P9L B;  1XMO K;  3EEQ A;  1WAJ A;  2OZM A;  3CER A;  1IO2 A;  1TVR A;  3VEW A;  4FLZ A;  4CIG A;  4BE1 A;  3THW A;  1QZ5 A;  2I7P A;  4LF6 K;  2IGI A;  2FXU A;  5HRP A;  4MLH A;  2KQ2 A;  2F9T A;  2E88 A;  5M1N A;  3GE1 A;  5SWM A;  3PX4 A;  2KZM A;  4DQI A;  3AVC A;  1ILY A;  4CIF A;  4Q5V A;  3GG4 A;  3B6O A;  3TR8 A;  1NGB A;  3P1G A;  4F8R A;  4BY9 C;  4H0P A;  2XO7 A;  4BRH A;  1S1T A;  3VET A;  3C6H A;  3D2E B;  1Q82 O;  1W7A A;  4Z4G A;  1S6P A;  4F4K A;  4B8C A;  3JS6 A;  2NRW A;  4AHT A;  3HVR A;  4FLT A;  5J2Q A;  1E3M A;  4FLY A;  3BGR A;  3IDH A;  4OGE A;  3EL2 A;  5LJV A;  1VQ7 N;  4J2A A;  1NM1 A;  5AQZ A;  5H1S Q;  1D9D A;  4OX9 K;  4WYB A;  4FOE A;  2GUP A;  3KD5 E;  3SAG A;  4CJ3 A;  3EZ5 A;  2D0B A;  3QLH A;  4A59 A;  3QEV A;  4ILH A;  1RT4 A;  2OZS A;  4E1J A;  5I42 A;  1HPZ A;  3L2V A;  3HOT A;  4ID5 A;  2R7Y A;  3KD1 E;  5IT9 O;  3HP9 A;  3AO2 A;  1HYV A;  2P9I A;  4BR0 A;  1U04 A;  4ZTF A;  1U45 A;  2YNH A;  4CIE A;  2OPS A;  4CK1 A;  4M3U A;  4BQL A;  3QDK A;  2GWK A;  3ENB A;  5C10 A;  4M7Y A;  2QWN A;  1QE1 A;  3QO9 A;  2IDO A;  3CCQ N;  3UKU A;  4CGH A;  3OYN A;  1ATR A;  4OPK A;  5KQ8 A;  4MDA A;  5HLF A;  4BC2 A;  2QKB A;  4ILJ A;  5C12 A;  3CG7 A;  4LD0 A;  4BDZ A;  1OVQ A;  4RW7 A;  1UAX A;  4OKJ A;  5AZI A;  2W6K A;  4FWR A;  4E89 A;  3CCL N;  1CXQ A;  5EY4 A;  1ATN A;  3OBW A;  3ZSY A;  3DLL L;  4LH4 A;  2ZJP L;  3RMA A;  3EYZ A;  4B1V A;  4ISE A;  4DV2 K;  5AQM A;  1ZBL A;  2B4J A;  3TTF A;  4CJL A;  4MQ3 A;  3DLR A;  1B9F A;  5HRR A;  4XH5 A;  4DMN A;  2O8F A;  4DV4 K;  2VYP A;  4PKH A;  3V9X A;  2PAV A;  3CET A;  2QK9 A;  3D6R A;  4CHZ A;  5IWA K;  4FK0 A;  5BRH A;  5LJW A;  4F2S A;  4FWP A;  4DU3 A;  3O9R A;  2OCE A;  2A1R A;  4JI2 K;  3LWL A;  3PY8 A;  3E01 A;  3O9U A;  3LPU A;  3D7E O;  4IDK A;  1EKE A;  5F2R A;  3OYH A;  3THY A;  3VER A;  3MN7 A;  4CJP A;  3CPW M;  3VQ8 A;  1SQK A;  3BZC A;  3ZEU B;  1UOC A;  2D4W A;  3OYD A;  4KH5 A;  3IAY A;  1W0H A;  4NXM K;  4J2E A;  3S3O A;  3V1O A;  1VSF A;  3OYG A;  4FVM A;  3M1F A;  4NYF A;  5DMR A;  3TSU A;  3F9K A;  2G8K A;  3MN9 A;  3LDP A;  1HX1 A;  3F9M A;  3MX2 A;  4N5S A;  1VQ9 N;  1NK6 A;  4GVM A;  3THW B;  2P9N A;  3E9L A;  3AA2 A;  4K25 A;  5J2P A;  1GLC G;  3SNN A;  3TAB A;  4E7I A;  4J2D A;  1EWQ A;  3VF4 A;  3OVN A;  3AVH A;  3L2Q A;  3O80 A;  1VK0 A;  1YJN N;  3V1Q A;  1T03 A;  2UUA K;  3GL1 A;  4H5V A;  4FJ5 A;  2E2N A;  4NCA A;  2UXD K;  3SPY A;  2BE2 A;  3PX6 A;  1TL3 A;  4RW6 A;  3QNN A;  2YHY A;  3BP8 A;  3I0R A;  4BRO A;  5C2F A;  4ISF A;  2IS3 A;  3KZB A;  1S6Q A;  2D1K A;  4WFA L;  2QWR A;  5AQJ A;  1YXQ A;  2KHO A;  3VQP A;  4W5O A;  4QAG A;  4FLX A;  4OKK A;  4FWS A;  4CJQ A;  5GAE P;  2JGU A;  1YF5 L;  1RDD A;  3K5O A;  4K42 A;  3ID6 A;  4O8U A;  4B3M K;  4WFN L;  2CH6 A;  2V7Y A;  3MMV A;  4A61 A;  1MWK A;  3QIP A;  2UUB K;  1S9E A;  4AIL C;  2ZE2 A;  1REV A;  3VEY A;  1U4B A;  3DOL A;  2HST A;  4BC4 A;  1JLC A;  3CI5 A;  4NB4 A;  1RT5 A;  3VQE A;  1NGD A;  5ADX H;  3OS2 A;  3ULD A;  4PWD A;  3SQ2 A;  5DM7 L;  5D3G A;  4H0X B;  1OH7 A;  3G4S N;  2GEL A;  1YUW A;  2P9I B;  3VA3 A;  4JRP A;  5EXW A;  1L3U A;  1RIL A;  4BR4 A;  5C42 A;  4Y0W A;  2F8S A;  1BA0 A;  3LAL A;  4CW7 B;  5C24 A;  4FM0 A;  1D8Y A;  3VEZ A;  3UKU B;  3KLF A;  5AFU H;  3JYT A;  1T44 A;  1J5O A;  5BRE A;  4DU1 A;  4CFB A;  4DTX A;  1E4F T;  3KK3 A;  2QEX N;  4KH6 A;  3SI6 A;  5AZI B;  5FPM A;  3RSE A;  1BHL A;  4YOU A;  1ZBI A;  2FC0 A;  3CCU N;  5EOY A;  4BR9 A;  5KPZ A;  4KO0 A;  4BE2 A;  4FJL A;  4H0V B;  3TTD A;  4KH4 A;  2GUI A;  2E1Y A;  4B3T K;  3TAF A;  3S41 A;  4IG3 A;  2P51 A;  4CEB A;  5LY3 A;  1N5Y A;  1JKH A;  1DKG D;  4PKI A;  4E1M A;  3RTV A;  2GX9 A;  1NGF A;  3AO5 A;  2O8F B;  1BOT O;  3WQU A;  2F4V K;  4IOA L;  3EY1 A;  3R6M A;  3RR7 A;  4U67 L;  5AQK A;  3AAQ A;  2HBJ A;  4RWT A;  3K5M A;  1XHX A;  1S5J A;  1BI4 A;  2VG7 A;  4Y1D A;  2PFU A;  4DB3 A;  2VWB A;  3DXK A;  4JHD B;  5EVZ A;  4KHS A;  2FSJ A;  1TUY A;  3LZI A;  3WQT A;  3THY B;  2HND A;  3EKU A;  4B1Y B;  4FW1 A;  1BDG A;  2E6M A;  3KLG A;  1WBB A;  1TKD A;  1QHT A;  1X3M A;  3VQ6 A;  1CLQ A;  2GTD A;  5HL7 L;  3MXI A;  4N47 A;  2YHW A;  4B9T A;  3KKR A;  1NGA A;  4AM7 A;  1M90 O;  4CHO A;  1VSH A;  2FSN A;  4DLE A;  5FPD A;  3TSP A;  4WQ5 A;  4YOY A;  1C0T A;  4NLB A;  2B5J A;  4NYN A;  4FJN A;  1NGG A;  1BGX T;  5FLX O;  1XMQ K;  3K9K A;  1DEJ A;  4HUG A;  2PZS A;  3ZT4 A;  1ASW A;  3NF7 A;  4WF9 L;  2P9N B;  2YX6 A;  3V9U A;  1T05 A;  2G8V A;  2A40 A;  4LSN A;  3HM9 A;  3L6Q A;  2Q0U A;  3J81 O;  3KLH A;  1B9D A;  3O08 A;  1TKX A;  4HUE A;  1WSJ A;  3C95 A;  5ADX A;  2WUS A;  3QES A;  2NNW A;  1NLV A;  5C25 A;  3O6W A;  1KRP A;  4K43 A;  3CQY A;  4CI6 A;  3ZSW A;  4CJV A;  1VSL A;  1W97 L;  3CC7 N;  5GIN A;  1F21 A;  4KFB A;  4RCH A;  3QNO A;  1BWF O;  2FSK A;  4FW2 A;  3SK3 A;  3K0S A;  3DM2 A;  3HPG A;  1T7P A;  2EWS A;  2QXF A;  1EQY A;  3A0I X;  4LSL A;  5M1P A;  2ASP A;  3VTI A;  5HRO A;  3AA5 X;  4ELT A;  1VQO N;  4DG1 A;  5FPE A;  4FJJ A;  3ATU A;  3G25 A;  4DUY K;  4CD1 A;  5FDL A;  1LV5 A;  3IG1 A;  4JK8 A;  3NH0 A;  1RBS A;  2HNZ A;  3RRG A;  2EHG A;  4CHN A;  4H5N A;  1D9F A;  1CZ9 A;  3HXM A;  3OJU A;  3KK7 A;  2YKN A;  3T1Y K;  4OVL A;  4I7F A;  4X65 K;  2YHB A;  3HRG A;  3MXM A;  4LF5 K;  5GAH P;  1ESV A;  3ZSZ A;  4I9Q A;  3RSE B;  5CHI A;  4A5B A;  3MEC A;  3ZLJ A;  2WTU A;  5M1Q A;  5BR8 K;  2GV9 A;  1FKO A;  1BL3 A;  2NRH A;  2UUC K;  4CGG A;  4AH9 A;  4EZ9 A;  2ITG A;  4DSE A;  3OS0 A;  4DSK A;  4CJ5 A;  1YVU A;  2V51 B;  3ENO A;  4FOI A;  1MA9 B;  4PA1 A;  4KHP K;  4YOX A;  1BG3 A;  3VN5 A;  2HHH K;  4BVP A;  4DKW A;  3BDP A;  4W5T A;  1X1P A;  5JS1 A;  4E19 A;  4FJK A;  1XQS C;  2HW3 A;  1VQL N;  3C94 A;  2IVO A;  3CCS N;  1FKP A;  1QZ6 A;  3QML A;  4LF4 K;  3AAP A;  3WXJ A;  1GOC A;  1XI1 A;  4FJH A;  3DXK B;  3CME N;  3QFU A;  4GV9 A;  4IOC L;  4WQ4 C;  3CM6 A;  5BPN A;  5F0X A;  1KAY A;  4JRQ A;  1ZYQ A;  1A5X A;  3CC2 N;  3PSI A;  3UIQ A;  1OVY A;  4C8L A;  3UB5 A;  1JL1 A;  3AVA A;  4YHH K;  4LF8 K;  1LAV A;  3W3D A;  4B1X B;  1Y97 A;  4CEC A;  4BRD A;  3DLE A;  1EXQ A;  2VGM A;  1Q9Y A;  4IOX A;  5HRS A;  4K0K K;  4CK2 A;  1HPM A;  3AVK A;  3V9S A;  4JNE A;  1RBR A;  4BG9 A;  4E1N A;  1TK0 A;  3LAK A;  4CFD A;  2UU9 K;  3G10 A;  3SUP A;  2E4L A;  2QXL A;  3SQ0 A;  3ZT1 A;  1WB9 A;  3FLC O;  1RDB A;  3TAP A;  3K58 A;  4FM2 A;  4DTS A;  3T3F A;  3I56 N;  5LMN K;  3HP6 A;  1Q18 A;  3J7A P;  3QBX A;  5MLC Q;  3QFP A;  1X9S A;  2VCP A;  2RHK A;  3VEO A;  3I0S A;  1TGO A;  3CJA A;  5AQO A;  2X6N A;  1RDC A;  2JLE A;  4JN4 A;  4DQR A;  4H5T A;  3NGI A;  1IBM K;  3VQA A;  1N36 K; 
#chains in the Genus database with same CATH homology
 4CW7 B;  3J81 O;  1N34 K;  1HR0 K;  4JI2 K;  3JAM O;  4DR5 K;  1N33 K;  4LF4 K;  4JI5 K;  4DV5 K;  1FJG K;  1J5E K;  4JV5 K;  4NXM K;  4OX9 K;  2UXB K;  2E5L K;  4DV3 K;  1HNZ K;  4X66 K;  4LFB K;  4B3T K;  5AJ3 K;  4YHH K;  4LF8 K;  4LF9 K;  4DV1 K;  2VQF K;  4DR4 K;  5IT9 O;  5LMU K;  1XNR K;  4X64 K;  4JI8 K;  1IBK K;  1I94 K;  4NXN K;  4DR1 K;  4JI0 K;  5A2Q O;  4K0K K;  2UXC K;  3OTO K;  4DUY K;  4JI3 K;  2F4V K;  2VQE K;  4DV0 K;  4LFA K;  2UUA K;  3J7Y P;  2UXD K;  4JI6 K;  4DR6 K;  4B3S K;  3J80 O;  2UU9 K;  4GKK K;  4DR2 K;  4GKJ K;  3T1Y K;  1XNQ K;  4YY3 K;  4X65 K;  4X62 K;  4LF5 K;  4LF7 K;  4LFC K;  4DV6 K;  4DV7 K;  4B3M K;  4DR7 K;  5LMN K;  4JI4 K;  2UUB K;  5BR8 K;  4DV2 K;  3J7A P;  4B3R K;  4JYA K;  1XMO K;  4JI7 K;  4AQY K;  1IBL K;  2UUC K;  4JI1 K;  1HNW K;  4CVN E;  4DV4 K;  4LF6 K;  1XMQ K;  5FLX O;  1N32 K;  5LL6 Z;  4V19 S;  1IBM K;  4DUZ K;  1N36 K;  4KHP K;  3T1H K;  4DR3 K;  2HHH K;  2ZM6 K;  5IWA K;  1HNX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...