2F4VK

30s ribosome + designer antibiotic
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2f4vK00
4DV1K 4JI8K 2UU9K 4DV5K 5IWAK 4OX9K 4GKJK 4DR5K 4DV7K 4X62K 4LF4K 4JYAK 2UXDK 4JI2K 1XMOK 1XMQK 4DV2K 1N36K 1IBKK 1IBLK 4DR6K 4X64K 4B3SK 5IT9O 4X65K 5A2QO 4YHHK 3OTOK 2HHHK 5FLXO 4AQYK 3J80O 4JV5K 4LF8K 1FJGK 1N33K 3J7AP 4YY3K 4K0KK 4B3RK 4JI7K 4DUZK 4JI5K 4GKKK 4DR3K 4DV4K 2VQEK 2VQFK 5BR8K 4DR4K 4DR1K 2UUBK 4LF6K 3T1YK 4LFCK 4CVNE 2UXBK 5AJ3K 4JI0K 3T1HK 1N34K 1XNRK 2UUAK 4LFBK 4DV6K 4JI6K 5LMNK 4B3MK 1N32K 3JAMO 2UUCK 1IBMK 4V19S 3J81O 4CW7B 1HNZK 4JI4K 4DUYK 1J5EK 1HNXK 3J7YP 1I94K 4DV3K 4DR2K 2E5LK 2F4VK 4DV0K 4NXNK 4JI1K 1XNQK 5LL6Z 5LMUK 4LFAK 4B3TK 4NXMK 4LF9K 4LF7K 4JI3K 1HNWK 4DR7K 4KHPK 4X66K 2UXCK 4LF5K 2ZM6K 1HR0K
chains in the Genus database with same CATH superfamily
4JKBA 3U3YA 1Q8IA 1HUXA 4N76A 3QESA 3P31A 4EHUA 3LAMA 1J5OA 1QSLA 4C8OA 1E3MA 2E6MA 3AVIA 4YFUA 4DTNA 4DSFA 3WXLA 1N36K 2YJFA 3QEVA 3H08A 1WBDA 3FZMA 4KHYA 4FWLA 2YNHA 4B3SK 4DQSA 4KH6A 2YKNA 5E84A 2OZMA 3KLGA 3LPUA 5AQGA 1N33K 2VGNA 2KHOA 3ATVA 1EO1A 1SS6A 3ZSRA 4K8ZA 1LW2A 5EY4A 4PUOA 4DR3K 1U2VB 3CM6A 2HMIA 4ID1A 4GV3A 4JKDA 2YHXA 3WNGA 3CJ7A 4FW1A 5AQIA 4CEFA 3FZFA 4DTPA 4DFJA 4J2DA 2KFNA 3PUFA 3TARA 2X6SA 4CERA 3G25A 4ISEA 2X6NA 3I0RA 3N4QA 4CK2A 3NH0A 3S9HA 1IKVA 1RBSA 1R59O 5FROA 4FW2A 4CF1A 4CF8A 4O5FA 3C95A 4NB4A 4I6MB 4DSEA 3VEVA 3VMFB 1C0MA 2A42A 3CFOA 4B9NA 4JI6K 3EZWA 4BG9A 4A61A 4BG8A 2QKKA 3MDQA 3SV4A 1WN7A 4BRKA 3OY9A 1WOQA 5K14A 3DLLL 3KVGA 5SZTA 4IFEA 3NBPA 2Q97A 4CZLA 4L3QA 2E1YA 1NGCA 3HPGA 1DLOA 1RTHA 3FR0A 4DR2K 2E5LK 4DTJA 2ZJRL 4JI1K 1D5AA 2O8DA 5GADP 3CHWA 3RSEA 3U6FA 1VSIA 3E9LA 1NJZA 3C7NB 4KB0A 1C0UA 5JVHL 3DLHA 2UXCK 5I9EB 4OJRA 2GELA 4I2QA 2NRVA 1NKBA 3H1QA 1TYQB 1RILA 1TK8A 1SUQA 3MXJA 3E66A 4JD2A 4DV1K 5DM7L 2P9LA 4OLBA 4J2EA 1U48A 1VQ8N 2V7ZA 1N8RO 4FJGA 4F4KA 2P9IA 2W42A 4CECA 4JKHA 3VQBA 4DTUA 1VRTA 3HJFA 3VF4A 1XMQK 4DS4A 4FJJA 2Z1GA 3K59A 2HF4A 3AA2A 3FLCO 1MU2A 2PBDA 4ZTJA 4DLEA 4FWKA 1OKJA 5FPMA 1FJGK 3VQQA 3OYHA 4E19A 1RTIA 3FFKB 4O44A 3LALA 3THWA 3VQDA 4DFMA 5EOYA 4WF9L 1Y97A 3DRRA 2IDOA 2BGGA 3TU5A 5C10A 4CHYA 4JNEA 1BU6O 3TI0A 1U4BA 1HPMA 4M45A 1T6CA 2DFHA 4CFAA 3TSQA 1GLLO 3UKRA 3HVTA 5AQRA 1HPZA 5BN9A 1HYSA 1UWBA 4JKAA 4Z94A 3L2RA 1XNRK 2JWLA 4M3RA 3VEWA 3SQ4A 2HHUA 3ZX3A 4O0JA 3U9DA 4FZZA 2NNWA 4KH5A 4DFPA 1HQUA 1RDDA 3EEQA 2EHGA 4OGCA 3VENA 4GY2B 1FW6A 4M3XA 3RR7A 2I5JA 1NG9A 3M8QA 3NF6A 2RE2A 3VQ4A 2DPNA 1W9HA 1X3NA 2YHWA 5JICA 1EP4A 5AQLA 4CHQA 5LL6Z 4FJKA 3NFAA 2ZJQL 3KTQA 4YORA 3BY5A 4BR5A 5BREA 1BQMA 2JWKA 4ILHA 4E3SA 1TL1A 3AO2A 2P9LB 4CFDA 2KZMA 2E2NA 4IFYA 3VQPA 4CEEA 1VQNN 1BCMA 1X9JA 4UQGA 5BPLA 4HTUA 5HRNA 3OS1A 1YTAA 2QM1A 4DTMA 4XEIA 4DR5K 1SL2A 4B1VA 2V51B 4JHDA 4H0OA 3LM9A 3CCEN 1VSDA 3LM2A 4CZHA 1I39A 5JS1A 4YHHK 3AO5A 2QXLA 4OKKA 3HZ6A 3Q7CA 2HHHK 5JS2A 3VERA 3ZT1A 1S72N 3H45C 4LSLA 2QA4N 1G15A 4CJ5A 3L8BA 3MX5A 3QB0A 1UAXA 5DMRA 3VTIA 3KK2A 5KGXA 4F9OA 3CCVN 3SLCA 3ISNC 4O55A 1WAFA 2NZTA 4CHNA 1NGJA 2UUBK 1S1VA 3BEXA 1NK6A 3M8RA 1KAZA 3HP9A 4BVPA 1QZ5A 3CC2N 4IBNA 3CCJN 3T1HK 2KKZA 3P38A 1EQYA 1G99A 3I8DA 2A41A 2Z1HA 5BRHA 3HOTA 4BVOA 1IBMK 3AY9A 1JKHA 2V52B 3MEDA 2IIRA 3LP3A 4CW7B 4NYFA 3AO3A 4FWOA 4IOAL 3QFUA 3OJSA 4DTRA 1T6DA 2QW9A 3SV3A 2BE2A 5AQYA 4DV3K 2G8VA 4DV0K 3TAGA 1RBVA 1GLAG 2YHYA 3TTDA 2W40A 4HHTA 3A5MC 5AFUH 3NVMA 4N5SA 1DTTA 1ZYQA 3K9KA 4DS5A 4B3TK 4J2AA 4BR0A 1K8KB 4JK9A 3KLIA 3IRXA 2E2QA 2H3GX 5JMVA 2EWSA 4LF7K 4MO4A 1NGDA 1T05A 3O1BA 3UIQA 2WTUA 1N5YA 4FK0A 4M63C 2O8FA 1QVGM 3IFRA 3GL1A 4M7XA 1P8ZA 1GLEG 4N47A 1ITGA 2ZE2A 3GOIA 4QCLA 3SPZA 2P5GA 4H0PA 4CZGA 3TAQA 4QAGA 4FOEA 4FM0A 4IKFA 3WXKA 2HHQA 3J80O 3QFPA 1RGIA 3KZBA 2KQ2A 4CZFA 1D9FA 1VRUA 3D2EA 3LDQA 3ULEA 3BGRA 1NGAA 1NK9A 5KPRA 3VQ6A 1ATSA 2VQEK 3NF7A 5C24A 1CLQA 1C1AA 5GINA 3SBGA 1U47A 4B1WB 4M7YA 2P1JA 4IWVA 4CJVA 2P5OA 3NF8A 2VG6A 3HPOA 3L2WA 5HRSA 3GDQA 3H1VX 3ZEUB 4BGAA 1VK0A 5H1SQ 2OYQA 4E89A 4FLZA 3NMUA 1JLAA 2Q0UA 3PIOL 1J53A 1NK7A 4IXCA 5LMNK 4MLEA 1T7PA 1TKDA 1UOCA 3BZCA 1E4FT 1KXPA 4CEOA 3EKSA 3U4LA 5JLHA 1HJOA 3CIPA 2F96A 3LDOA 1QS4A 3BP8A 5HBMA 4FJ8A 4M42A 3VQ5A 5LMUK 4RTFD 4CEDA 3TAEA 4E0DA 4KHUA 5AQXA 4F8RA 5ELZA 2O8FB 1BA1A 5F0XA 1NK4A 4FLVA 3DI6A 3V1OA 3P83D 3VGLA 5HP1A 2RN2A 2HSTA 2UU9K 1NGEA 3C6HA 1M1KO 3M5RA 3VESA 4CJEA 4DV7K 2PYJA 4M3WA 4DQQA 1IBKK 4FZYA 5AQPA 2KLAA 2PFUA 1FK9A 2GV9A 4DQ8A 3DLKA 4BE1A 1F21A 3ZSYA 4JAXA 3UKUA 5KI6A 4KREA 4E7KA 3R6MA 3AO1A 3ULEB 1ATRA 4AHVA 4E1NA 3ENOA 2J4RA 1NJXA 4B9SA 3HP6A 1IG9A 3MECA 2HBLA 3VN5A 1T3VA 4CJSA 3NGYA 5HL7L 1HLUA 3QO9A 4ELVA 4JN4A 1GOBA 4DTOA 3HM9A 1KAXA 4EP5A 3OYJA 1J6ZA 3CQXA 4BDPA 2FC0A 2XY5A 2YKMA 4Z4FA 5GAEP 4O8KA 5KPTA 3CPWM 2NRHA 3NVKA 1YTUA 4DKWA 5C2DA 3L3VA 1WSIA 3T7ZA 3LP2A 4BRDA 4KI4A 2W41A 1TL3A 3U9ZA 1J5EK 1LWCA 3NAEA 5MLCQ 4FWSA 3ZSVA 4I2PA 4W5QA 3OYDA 2OPQA 4AHTA 2D0BA 4H5NA 1BDGA 1C1CA 1NKCA 3AVHA 2F4VK 1BA0A 1GLJO 3CQ8A 2W6KA 3HXMA 3C6UA 4W5OA 1OH8A 1J9AA 2HF3A 3IKMA 5C0YA 2Y1JA 4E1MA 3KWGA 1K6YA 4RCHA 4KTWA 5J2MA 2RHKA 4KHQA 3G4SN 4DB3A 3TAMA 4FSVA 4BRAA 2XY8A 4YNQA 4E7IA 1ILYA 4XIUA 1S9GA 4OPJA 3OYCA 3OW2M 2NRZA 4BRHA 3CCRN 4BRGA 4AM6A 3OVNA 3H3NO 3S3NA 3SQ0A 4NO7A 2HVIA 4CZKA 1XQSC 4DG1A 3V9UA 4CCHA 4LF4K 3FZLA 4EFHA 3C94A 3ID8A 3VA0A 3NH2A 5HRRA 2NRRA 5AQOA 5AQUA 1BOTO 4CJQA 4JV5K 3CXCM 4LF8K 3P39A 1X9SA 3ZT0A 1YAGA 5BRDA 3K0SA 1HKBA 4CEAA 4M3ZA 5E26A 4FPBA 1UA1A 1YHQN 1YI2N 1S1TA 4O5BA 3ZX2A 3EE8A 3KWIA 1NGIA 2QXFA 3THVA 5B8HA 1WBBA 3V4IA 4GMJB 1D4XA 2D0OA 1TUUA 4BRFA 3MMVA 2HBJA 4KTZA 2CGJA 3TWHA 3T1YK 4E7HA 4JI0K 1SQKA 1GLFO 3K5OA 1CXQA 1BIZA 2GUPA 3OA9A 1DT9A 4CD3A 3O5BA 4DV6K 4PQUA 4CZEA 2QTDA 2FBYA 5AQFA 2NLXA 4OKEA 3AVMA 4F2RA 2G8UA 2F9WA 4C8MA 4K25A 2A1SA 1JCEA 1TGOA 4DUYK 1NGBA 3MEGA 3OBYA 4FYDA 1S5JA 4MO5A 3O6WA 3NHGA 1SKWA 4OPAA 3OYFA 2FBXA 4PHTX 3H6EA 2KFZA 2FLOA 4IOXA 3KK7A 1K8AO 3ZSZA 1SZ2A 4BRQA 1Q86O 2HBMA 3J8AA 3I0SA 3QEPA 1KAYA 5ADXA 3SQ2A 1U45A 4CBUA 3CG7A 3M8SA 4B1ZA 1WB9A 1FKPA 1S6PA 3VF2A 3HI0A 2OTLN 2GBZA 3WEEA 3A2FA 3R8EA 2QWPA 2ATQA 3TTCA 3EE9A 4BC5A 5AQTA 4RW4A 4Z4EA 4FJNA 3DOLA 3JS6A 4FLUA 3VQ7A 3CPEA 4W5TA 2ZGZA 3T1AA 4NCAA 4FPAA 4OO1J 2P9NB 3HT3A 5IT9O 4X65K 2YJEA 5C12A 4DLGA 4XH5A 2YX6A 3IMXA 1VSKA 1Q9XA 4KH4A 4DFKA 2YNFA 1LV5A 3J7AP 4BGBA 4IEIA 4KV8A 3F73A 4HUFA 3HO1A 3SZ2A 4JI5K 3HSCA 2Z1JA 3QBXA 4JKFA 3W0LA 5BR8K 4CGIA 5M1OA 5BR9A 3SI6A 3WXMB 4CZIA 4DTXA 2UYTA 3S3MA 1XUPO 1EXQA 3ZETA 3HBTA 3TSPA 4GW6A 3WQTA 5GIPA 1GOAA 2WFBA 5AZJA 4BQLA 2FF3B 2HHTA 3SUPA 4FLWA 4M3UA 4K42A 3P1GA 4CESA 3CC4N 2Q36A 1KRPA 5AQHA 1RT7A 1NJIO 3VEYA 2GUIA 4IO8A 3AVBA 3FZKA 4H5RA 1A5XA 1NWKA 3EN9A 3I55N 3CMEN 2A5XA 1ASVA 1JJ2M 5FPDA 1RTDA 5I42A 2P9PA 3NF9A 1BGXT 1XC9A 4KKOA 2D0CA 2P9UA 2E1ZA 3ZYYX 1KFDA 4NXNK 3QINA 3I33A 1RBUA 2DFFA 4R79A 1REVA 1VSEA 4B1UB 1JLEA 3TR8A 3PX6A 3OS2A 3HYFA 1L3SA 3ALYA 3K58A 2Y1IA 3E01A 2G8HA 1M90O 2HNDA 1WSEA 4ILGB 3R9PA 3PLAA 2FBTA 2O8DB 4Z4GA 1NOYA 3AVFA 5DK5A 3RSEB 1DEJA 1C6VA 3CJAA 3QLHA 4CGGA 1U49A 1EX4A 3DXMA 4IZ9A 1HQEA 4BRPA 3VEXA 1Q81O 5AZIA 3VQCA 1QQOA 1GLDG 4B9LA 4CF2A 1XHXA 3CC7N 3PSFA 4JD2B 4KO0A 4AQYK 4BR2A 2A40A 3N4PA 4MQ3A 4H5WA 4DQIA 2P9IB 5CYMA 4FM1A 4BRLA 5ADXH 3PIPL 4HVJA 4KAZA 1O1WA 4B8AB 2ZGYA 4B9QA 1HYVA 3DYAA 1NK0A 2O8EA 2KW4A 3V1QA 4TSXA 2YV0X 2D0AA 3PV8A 3ZETB 4NCBA 4CIEA 3UE5A 3T69A 3ZSQA 3QEIA 2RF2A 4FCYA 3RMCA 2PZSA 4DU4A 4WYBA 2CH6A 3THWB 5KTQA 4QS8A 3SUNA 3MXIA 4CBWA 5GAHP 2OZSA 4WCEL 4RW8A 3H46O 3VA3A 1OH7A 5AR0A 4AHSA 1GLBG 4JRPA 1S6QA 3V9ZA 1VQMN 3F9KA 3QERA 3QEXA 3LP1A 4JEPA 3CM5A 4PKIA 3SNNA 4PKGA 3SUOA 1HYZA 3SJHA 1NK5A 4KHWA 5BPNA 4GVMA 3UKRB 2LSNA 2P9UB 3K9JA 3EL2A 3L2UA 1QTMA 4CJRA 3KJVA 3SAFA 1IKXA 5AQJA 1RDUA 1JLFA 3MWPA 4JLHA 4RW7A 3SMSA 3AGRA 5C15A 1HMVA 4Z4CA 1E4GT 4JRQA 5AQZA 4CJTA 4ISGA 1K73O 4FL9A 4OLAA 1Y64A 3BZKA 1TK5A 4M3TA 1BI4A 4JK8A 5M1KA 4Z0UA 4YOXA 4DSKA 4KRFA 3KLHA 2G8KA 1VQPN 4M41A 1YITN 5AQSA 1BO5O 2GWJA 1IJJA 4B1YB 2VCPA 4GKJK 2GX9A 4B08A 4BRCA 1XMOK 4HCBA 4GVEA 5D3GA 1B9DA 4K43A 4U67L 3IDHA 4FVUA 5A2QO 3ID6A 4DF8A 3K5MA 1VQ7N 5CY4A 2R7YA 2I7PA 3CI5A 4A62A 1T03A 4G9ZA 3O9SA 3O80A 1GOCA 2NRWA 3KIOA 2OPPA 1IG8A 3V81A 4IJNA 4CEZA 4JHDB 4FJMA 3AVKA 2D5RA 1HX1A 3LPTA 2YNIA 3P4IA 1NBWA 4YOTA 2OPRA 4BC4A 2IVNA 2ZQBA 4CI6A 3OJUA 3OYGA 3GBTA 4DR1K 4C1NI 2HB5A 5CZ1A 2XHBA 4LF6K 1JLCA 1U6ZA 2CH5A 2ZWHA 2JGUA 5KQDA 2UXBK 5M1NA 3QIOA 1VSHA 5HLFA 3E9OA 3LZJA 4B8CA 4BC2A 4KPYA 2P9KA 4BWJA 4QS9A 3U3GA 1QHAA 4PA1A 5BPMA 3O4WA 4HWIA 4JKGA 3QMLA 5J2NA 4FWQA 3TAFA 3IUCA 4FJ5A 3ZT2A 4IDHA 4B1XB 2D0PA 1NOZA 1KTQA 4PL8A 3O9TA 3NE6A 3MN9A 4CIFA 4AH9A 2BDPA 3VQ8A 3AV9A 3L3UA 3DRPA 2NRTA 5T7BA 1RNHA 3LANA 2E8AA 4R5PA 5AQMA 3F2KA 5AQKA 1JL1A 4ZTFA 3KD5E 5BRFA 3IG1A 2Q3SA 3BDPA 4Q0BA 3FE1A 3TPQA 2QWNA 2BANA 4W5NA 4JKEA 3QNOA 3ITHA 3GG4A 3NDKA 1S1UA 2E4LA 3PX0A 3KK3A 3RR8A 5BN8A 3EKUA 4JS4A 3ZSWA 4BR9A 4FO0A 3U8XA 2VYPA 1ZBFA 3TSUA 4A2BA 1S1WA 3I56N 4KB1A 1JXEA 1RT6A 2HBKA 4EZ9A 3O9RA 1SAZA 3DXKA 1BUPA 3H3OB 3O08A 4YY3K 4H8KA 2FXUA 4LC9B 4WQ4A 1YJNN 3O9UA 3DLGA 4FZXC 1DKGD 2ITGA 3ZSXA 3ZSOA 2ZJPL 5M1PA 1WSJA 2D4WA 5HOOA 1JCFA 4Y1DA 2IVOA 4KFBA 2P9SA 3DMJA 4CGDA 4BDZA 1J54A 4RG8A 4BC3A 1D9DA 3R1XA 4CK3A 2AP1A 3F5TA 2E6LA 3THYA 4Z4IA 1X3MA 4AILC 3D2EB 4LFCK 2P9KB 4YOVA 3PSIA 2EX3A 3CCQN 4C23A 2VG7A 2HHVA 1HNVA 1EWRA 4O8UA 2RKIA 3E1YA 3QICA 2OANA 3CF5L 4DF4A 1A5WA 1LAWA 3V9WA 5EX5A 1QE1A 4FVMA 2IGIA 3CFRA 4JI4K 1S9EA 1TKZA 4JKCA 1QVFM 3M8PA 2X78A 2O4IA 3D2FA 3ASMA 3ZCMA 2I7NA 2HHXA 3G71N 3AARA 1IV0A 3UB5A 2QWRA 3IS9A 4Y0WA 2G8IA 4LFAK 3MEEA 4B9UA 1EKEA 1RDCA 2GWKA 5C25A 3VTHA 1DTQA 2B6AA 1W7AA 5J2PA 3CJ1A 1IKWA 1WSHA 4ID5A 5KPZA 1WAJA 5J2QA 3K5LA 3RMAA 1JL2A 1R0AA 1OH6A 3M1FA 4BRNA 4BR4A 1SV5A 1K9MO 4YDUA 2CGLA 2NRXA 4EP4A 1QQCA 4CD1A 4FWRA 1B92A 1NLVA 4JYAK 2B5JA 1ZC6A 5F2RA 4I9LA 4H0YB 3OYAA 4IO9L 3L4QA 1U2VA 1QQMA 4CE9A 3DOKA 1N6QA 3DLRA 5FRMA 3AVLA 4ISFA 3D0PA 1VSMA 4K41A 4CBXA 4XH4A 1W0HA 3RTVA 1TAUA 2PY5A 5AQNA 3M3ZA 3A5NC 3OYBA 1BIUA 3HK2A 4OPKA 4CFBA 2BH1A 2P9SB 3O4QA 3VEOA 4DV4K 4A5AA 2QKBA 2JLEA 3O4NA 2V7YA 2WUSA 3UKUB 3BF1A 3V9SA 1ESVA 4H0VB 1NJYA 3SQ1A 1BG3A 1BHLA 5LJWA 1T44A 4HUEA 2ZD1A 2GEMA 4CVNE 1MA9B 2OPSA 1NU0A 3OYNA 4DTSA 1RDWX 3B6PA 1X1PA 3OYEA 2DY4A 2E2OA 3F9MA 1TV6A 3PO4A 4DSIA 3MN7A 1UA0A 2Q0RA 3OHRA 4BDYA 3QNNA 2F8TA 1LW0A 4CZJA 3T3FA 4OKJA 5GAGP 3C7NA 1CZAN 4FJHA 1HNXK 4UY8O 4FJIA 2FSJA 1NGFA 3KD1E 4PKHA 3C0BA 1TYQA 4CJUA 1A5VA 2QWQA 1QQNA 5CE3A 1VQ5N 1Z25A 4LD0A 4DU1A 5I3UA 3WUHA 3RRGA 4YOWA 3K5NA 3ENHA 1XI1A 4PL7A 1BCOA 1P90A 4LF5K 1KLMA 4OPHA 4CJWA 4BREA 2IAJA 4B9MA 3CJBA 5M1FA 3CYMA 1HR0K 4FJLA 2OCEA 1WNSA 1OVQA 4WE1A 4AHRA 2WONA 4BRIA 3ATUA 2FSNA 4W5RA 3MXMA 4QS7A 5FRNA 4BE2A 4OX9K 1IO2A 2B4JA 1XHZA 3MK6A 1L3TA 2YCHA 1VSLA 3J7ZO 4DR6K 1HKCA 1FXXA 4GNIA 4FLYA 1ASWA 3W3DA 2Z1IA 4DSJA 4PWDA 4G1QA 1Q18A 3WNFA 4WFAL 3HSTB 4FWNA 2A1RA 3CCSN 2HW3A 4CEQA 4QOZB 1LWEA 5LY3A 3WT0A 1VHXA 3JSMA 4H5TA 3VEZA 2HMPA 5TKYA 1YXQA 1RFQA 3SJJA 3SYZA 3KKSA 2KTQA 4BWMA 2OTJN 1YT3A 4DR4K 3DM2A 5J1EA 3EYZA 4FJ7A 4CHOA 3PX4A 3A5LC 3MN5A 4I9QA 4CK1A 4BE0A 1RT2A 3MN6A 3VQEA 5CHIA 2OA8A 1IH7A 2BTFA 4KI6A 2HHWA 4B3OA 5CR4A 4CJLA 1VAZA 4KTQA 1Q9YA 4L8RB 4C8NA 4CJ3A 4B3MK 5KRTA 2G8FA 2WOMA 1W97L 3SPYA 3NH1A 3CETA 4V19S 1ZBIA 4O0IA 1NMNA 1KSPA 2RPIA 3ENBA 1S1XA 1YIJN 4DU3A 2ETJA 3IAYA 3C6AA 3C6TA 5AQQA 1YUWA 3TABA 3OS0A 3AVGA 1SKSA 2WC9A 5EXWA 4B9TA 2Q31A 1TKTA 3S3OA 3AAQA 2F9TA 1LOTB 1IKYA 4IG3A 2QWMA 1KCFA 3NGZA 3EO3A 1HNWK 1C0GA 1RDBA 3A8YA 4ELUA 4FWMA 1NNEA 1VQKN 4K8XA 2O8CA 4JK7A 2O4GA 1C0FA 5FDLA 4DHYA 1HRHA 3HVRA 4X62K 1ZBLA 3MCPA 4CIGA 4GV6A 3CJCA 3AVAA 3L4IA 1TKXA 4OVLA 1YF5L 2X74A 5AFUA 3L0QA 5JVGL 3QETA 4LH4A 1SL0A 3LDSA 2FF6A 5CYQA 3WEEB 4FLTA 4LSNA 2QI2A 1NJWA 3WXIA 4A2AA 3LDLA 3RRHA 4ICLA 4CF0A 3PY8A 5GIOA 4J8FA 4BRMA 3FZHA 2WBNA 1BL3A 1LWFA 4MDBA 1QSYA 3ZLJA 5JLFA 3CQYA 3L2VA 1L5UA 4BACA 3VQAA 1JLQA 1T8EA 5AJ3K 2E20A 1VSFA 3AAPA 4E7JA 1NGHA 4CGHA 3KHYA 3SBTA 3DWLA 1KC8O 3SUQA 1N32K 1RT3A 3R3LA 4H0TB 3AA3A 4J2BA 1MWMA 1K8KA 1NKEA 1VQ9N 2IS3A 1YJWN 3LAKA 2XO7A 3E9PA 4AF1A 3AVNA 5AZJB 1ATNA 1I94K 4H5VA 2E88A 2FBVA 4Z4HA 4CHZA 3CMAN 3RVCA 1GLCG 4IJAA 3ZX0A 4JS5A 3AVCA 3SK3A 3AA4A 2P51A 5FPEA 2FSKA 4AHCA 4IDKA 1KFSA 3SMPA 3O3HA 4DR7K 3QEWA 2P9PB 4NYNA 1QSSA 1CZ9A 1RT1A 4O4GA 1WUAA 2O8CB 4FK4A 4WQ5C 3DJCA 3O8MA 3VGKA 1NMDA 1KLNA 1JXBA 4YOUA 2A3ZA 5CZ2A 4IG0A 2G8WA 1L3VA 1LAVA 1I3AA 3ZT4A 2F8SA 3VOVA 2ASMA 3QDKA 2W6LA 3KLEA 1Z6RA 3FFIA 2HOEA 1RT4A 2ASOA 4EAHD 4Q5VA 3ZEUA 2AA4A 2PYLA 3HRGA 1L3UA 3DXMB 3OYKA 2CGKA 3D6RA 3LWLA 1KVCA 3S41A 4XH1A 5AZIB 1Z05A 1Q82O 4CGFA 2IVPA 2XY6A 3ULDA 3K2PA 1V4SA 4WQ4C 1TK0A 3DLEA 1KVBA 4BQZA 2AJQA 4IEEA 5C2FA 4F3OA 1VQ6N 4WFNL 2GTDA 1W2BM 3B6OA 2XRIA 4H03B 4DQPA 3HTVA 1SKRA 4GV9A 1FKOA 2O8EB 1NM1A 3SAGA 3GE1A 4CZMA 2VWKA 3TTFA 1XWLA 3WNHA 3JAMO 4HUGA 1ZBSA 2UUCK 5HRPA 3MX2A 2QWLA 3TANA 3RWUA 4C8LA 3A0IX 1HNZK 4H4OA 1Z26A 4NCGA 1TVRA 3MCAB 5TKWA 1DGKN 2BUPA 3AA5X 3J7YP 4ELTA 4H4MA 3RMBA 1X9WA 4CJ7A 2IC3A 2NUBA 4BR7A 3M6GA 4HTLA 4HCCA 3V6DA 1OVYA 1WSGA 4MFBA 4CJFA 4I7FA 5M1QA 4NXMK 1CXUA 3AGKA 4FXDA 5E41A 3LDNA 3EZ5A 4YOYA 4N56A 4JI3K 4LH5A 2VWBA 4ZHRA 4KHNA 4M3YA 3ZT3A 4EHTA 1O13A 3HPHA 4FWPA 2ZF5O 3Q7BA 4FJ9A 1HKGA 2ITMA 4KBOA 1MDUB 3LDPA 1KD1O 1VSJA 4AHUA 4N41A 3P5JA 3BUZB 3LL3A 2YI1A 3WXJA 2QWOA 3MWTA 4DV2K 4WQ5A 3K57A 3AVJA 4H0XB 2IOCA 4RW9A 3A5OC 4X64K 1RT5A 4YDUC 4FJXA 1BI4B 3HM8A 3OTOK 4C8KA 3OYLA 5FLXO 1LCUA 2QK9A 1RTJA 1YVNA 1S22A 2F7TA 1C0TA 2VGMA 2PAVA 3NGIA 2YNGA 3THXA 4K0KK 4B3RK 3B8AX 4DUZK 5KQ8A 3LP0A 4GKKK 4EIAA 4KHSA 2DFEA 1EETA 3O3FA 3CERA 4F2SA 3NCIA 1ASUA 1RBRA 2VQFK 4DWIA 4FK2A 3CCUN 4MDAA 5EVZA 4FOIA 4IFVA 4ILJA 2HNZA 3QIPA 3C65A 3QBWA 4CF9A 1X9MA 4PY5A 4MLHA 2O8BA 1U04A 3WNEA 3L6QA 3EY1A 3KK1A 4FLXA 4CFCA 1OH5A 1WSFA 1MWKA 3FGUA 3JXUA 4A5BA 1HJRA 4OGEA 5F1XA 3LZIA 2UUAK 3PO5A 1H1VA 3D45A 1RCHA 1B9FA 3JYTA 1KQSM 3RMDA 1TAQA 3J81O 1TUYA 3VQ9A 2DTUA 1JLGA 4NLCA 3O1WA 4CJKA 2YHAA 4CHPA 3G0ZA 3SCXA 1D8YA 1NGGA 3I8BA 1S3XA 4A57A 3DRSA 1BQNA 5LJVA 4NLBA 4JKGB 4CGJA 1VQ4N 2Q1NA 3CCMN 4LF9K 3TAPA 5EU7A 3OBWA 5KGWA 3KKRA 5AQVA 1XC3A 4KHPK 2A6AA 4Y1CA 1V4TA 4CEBA 2ZM6K 4EZ6A 1BISA 4CJ4A 1YVUA 4F3TA 4JI8K 4RWTA 3G10A 2Q2RA 3VGMA 4DV5K 4BY9C 5IWAK 4LY7A 2ASPA 5AQWA 3SAHA 4WFBL 2UXDK 3V9XA 2QEXN 3LWMA 4JI2K 3T19A 4FM2A 3BF3A 1IBLK 4CJPA 1VQON 3O9QA 1KVAA 5DM6L 3THXB 4DMNA 1QZ6A 5KRSA 1BWFO 1RDAA 4B9VA 2XY7A 4JI7K 1JLBA 3O3GA 1VQLN 3VPZA 4BROA 1Q7YO 3CD6N 1NK8A 2O8BB 2VG5A 4DQRA 5SWMA 1CZBA 3CFPA 3CCLN 4E1JA 3WQUA 3VF6A 4DSLA 3DXKB 5HROA 5C42A 3D7EO 3MAQA 1WLJA 1N34K 4DCHA 3VETA 3DAWA 4U7BA 4LFBK 3OYMA 2VWJA 4I6MA 1ZXOA 3L2QA 2D1KA 4C1NK 1RBTA 3THYB 1JCGA 1HNIA 4IOCL 1QHTA 3HOSA 4RW6A 3KLFA 2KZZA 4AM7A 1ZBUA 2HVHA 3CJ9A 2HHSA 2E2PA 3HL8A 2HNYA 1XNQK 3AO4A 1YJ9N 3OYIA 1ZBHA 3DLBA 3V1RA 4E7LA 3G6EN 1SL1A 1EWQA 1C1BA 4A59A 2YHBA 4X66K 2P9NA 3D2FB 5FPNA
chains in the Genus database with same CATH topology
4DV1K 4JI8K 2UU9K 4DV5K 5IWAK 4OX9K 4GKJK 4DR5K 4DV7K 4X62K 4LF4K 4JYAK 2UXDK 4JI2K 1XMOK 1XMQK 4DV2K 1N36K 1IBKK 1IBLK 4DR6K 4X64K 4B3SK 5IT9O 4X65K 5A2QO 4YHHK 3OTOK 2HHHK 5FLXO 4AQYK 3J80O 4JV5K 4LF8K 1FJGK 1N33K 3J7AP 4YY3K 4K0KK 4B3RK 4JI7K 4DUZK 4JI5K 4GKKK 4DR3K 4DV4K 2VQEK 2VQFK 5BR8K 4DR4K 4DR1K 2UUBK 4LF6K 3T1YK 4LFCK 4CVNE 2UXBK 5AJ3K 4JI0K 3T1HK 1N34K 1XNRK 2UUAK 4LFBK 4DV6K 4JI6K 5LMNK 4B3MK 1N32K 3JAMO 2UUCK 1IBMK 4V19S 3J81O 4CW7B 1HNZK 4JI4K 4DUYK 1J5EK 1HNXK 3J7YP 1I94K 4DV3K 4DR2K 2E5LK 2F4VK 4DV0K 4NXNK 4JI1K 1XNQK 5LL6Z 5LMUK 4LFAK 4B3TK 4NXMK 4LF9K 4LF7K 4JI3K 1HNWK 4DR7K 4KHPK 4X66K 2UXCK 4LF5K 2ZM6K 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 K;  4JI8 K;  2UU9 K;  4DV5 K;  5IWA K;  4OX9 K;  4GKJ K;  4DR5 K;  4DV7 K;  4X62 K;  4LF4 K;  4JYA K;  2UXD K;  4JI2 K;  1XMO K;  1XMQ K;  4DV2 K;  1N36 K;  1IBK K;  1IBL K;  4DR6 K;  4X64 K;  4B3S K;  5IT9 O;  4X65 K;  5A2Q O;  4YHH K;  3OTO K;  2HHH K;  5FLX O;  4AQY K;  3J80 O;  4JV5 K;  4LF8 K;  1FJG K;  1N33 K;  3J7A P;  4YY3 K;  4K0K K;  4B3R K;  4JI7 K;  4DUZ K;  4JI5 K;  4GKK K;  4DR3 K;  4DV4 K;  2VQE K;  2VQF K;  5BR8 K;  4DR4 K;  4DR1 K;  2UUB K;  4LF6 K;  3T1Y K;  4LFC K;  4CVN E;  2UXB K;  5AJ3 K;  4JI0 K;  3T1H K;  1N34 K;  1XNR K;  2UUA K;  4LFB K;  4DV6 K;  4JI6 K;  5LMN K;  4B3M K;  1N32 K;  3JAM O;  2UUC K;  1IBM K;  4V19 S;  3J81 O;  4CW7 B;  1HNZ K;  4JI4 K;  4DUY K;  1J5E K;  1HNX K;  3J7Y P;  1I94 K;  4DV3 K;  4DR2 K;  2E5L K;  2F4V K;  4DV0 K;  4NXN K;  4JI1 K;  1XNQ K;  5LL6 Z;  5LMU K;  4LFA K;  4B3T K;  4NXM K;  4LF9 K;  4LF7 K;  4JI3 K;  1HNW K;  4DR7 K;  4KHP K;  4X66 K;  2UXC K;  4LF5 K;  2ZM6 K;  1HR0 K; 
#chains in the Genus database with same CATH topology
 4JKB A;  3U3Y A;  1Q8I A;  1HUX A;  4N76 A;  3QES A;  3P31 A;  4EHU A;  3LAM A;  1J5O A;  1QSL A;  4C8O A;  1E3M A;  2E6M A;  3AVI A;  4YFU A;  4DTN A;  4DSF A;  3WXL A;  1N36 K;  2YJF A;  3QEV A;  3H08 A;  1WBD A;  3FZM A;  4KHY A;  4FWL A;  2YNH A;  4B3S K;  4DQS A;  4KH6 A;  2YKN A;  5E84 A;  2OZM A;  3KLG A;  3LPU A;  5AQG A;  1N33 K;  2VGN A;  2KHO A;  3ATV A;  1EO1 A;  1SS6 A;  3ZSR A;  4K8Z A;  1LW2 A;  5EY4 A;  4PUO A;  4DR3 K;  1U2V B;  3CM6 A;  2HMI A;  4ID1 A;  4GV3 A;  4JKD A;  2YHX A;  3WNG A;  3CJ7 A;  4FW1 A;  5AQI A;  4CEF A;  3FZF A;  4DTP A;  4DFJ A;  4J2D A;  2KFN A;  3PUF A;  3TAR A;  2X6S A;  4CER A;  3G25 A;  4ISE A;  2X6N A;  3I0R A;  3N4Q A;  4CK2 A;  3NH0 A;  3S9H A;  1IKV A;  1RBS A;  1R59 O;  5FRO A;  4FW2 A;  4CF1 A;  4CF8 A;  4O5F A;  3C95 A;  4NB4 A;  4I6M B;  4DSE A;  3VEV A;  3VMF B;  1C0M A;  2A42 A;  3CFO A;  4B9N A;  4JI6 K;  3EZW A;  4BG9 A;  4A61 A;  4BG8 A;  2QKK A;  3MDQ A;  3SV4 A;  1WN7 A;  4BRK A;  3OY9 A;  1WOQ A;  5K14 A;  3DLL L;  3KVG A;  5SZT A;  4IFE A;  3NBP A;  2Q97 A;  4CZL A;  4L3Q A;  2E1Y A;  1NGC A;  3HPG A;  1DLO A;  1RTH A;  3FR0 A;  4DR2 K;  2E5L K;  4DTJ A;  2ZJR L;  4JI1 K;  1D5A A;  2O8D A;  5GAD P;  3CHW A;  3RSE A;  3U6F A;  1VSI A;  3E9L A;  1NJZ A;  3C7N B;  4KB0 A;  1C0U A;  5JVH L;  3DLH A;  2UXC K;  5I9E B;  4OJR A;  2GEL A;  4I2Q A;  2NRV A;  1NKB A;  3H1Q A;  1TYQ B;  1RIL A;  1TK8 A;  1SUQ A;  3MXJ A;  3E66 A;  4JD2 A;  4DV1 K;  5DM7 L;  2P9L A;  4OLB A;  4J2E A;  1U48 A;  1VQ8 N;  2V7Z A;  1N8R O;  4FJG A;  4F4K A;  2P9I A;  2W42 A;  4CEC A;  4JKH A;  3VQB A;  4DTU A;  1VRT A;  3HJF A;  3VF4 A;  1XMQ K;  4DS4 A;  4FJJ A;  2Z1G A;  3K59 A;  2HF4 A;  3AA2 A;  3FLC O;  1MU2 A;  2PBD A;  4ZTJ A;  4DLE A;  4FWK A;  1OKJ A;  5FPM A;  1FJG K;  3VQQ A;  3OYH A;  4E19 A;  1RTI A;  3FFK B;  4O44 A;  3LAL A;  3THW A;  3VQD A;  4DFM A;  5EOY A;  4WF9 L;  1Y97 A;  3DRR A;  2IDO A;  2BGG A;  3TU5 A;  5C10 A;  4CHY A;  4JNE A;  1BU6 O;  3TI0 A;  1U4B A;  1HPM A;  4M45 A;  1T6C A;  2DFH A;  4CFA A;  3TSQ A;  1GLL O;  3UKR A;  3HVT A;  5AQR A;  1HPZ A;  5BN9 A;  1HYS A;  1UWB A;  4JKA A;  4Z94 A;  3L2R A;  1XNR K;  2JWL A;  4M3R A;  3VEW A;  3SQ4 A;  2HHU A;  3ZX3 A;  4O0J A;  3U9D A;  4FZZ A;  2NNW A;  4KH5 A;  4DFP A;  1HQU A;  1RDD A;  3EEQ A;  2EHG A;  4OGC A;  3VEN A;  4GY2 B;  1FW6 A;  4M3X A;  3RR7 A;  2I5J A;  1NG9 A;  3M8Q A;  3NF6 A;  2RE2 A;  3VQ4 A;  2DPN A;  1W9H A;  1X3N A;  2YHW A;  5JIC A;  1EP4 A;  5AQL A;  4CHQ A;  5LL6 Z;  4FJK A;  3NFA A;  2ZJQ L;  3KTQ A;  4YOR A;  3BY5 A;  4BR5 A;  5BRE A;  1BQM A;  2JWK A;  4ILH A;  4E3S A;  1TL1 A;  3AO2 A;  2P9L B;  4CFD A;  2KZM A;  2E2N A;  4IFY A;  3VQP A;  4CEE A;  1VQN N;  1BCM A;  1X9J A;  4UQG A;  5BPL A;  4HTU A;  5HRN A;  3OS1 A;  1YTA A;  2QM1 A;  4DTM A;  4XEI A;  4DR5 K;  1SL2 A;  4B1V A;  2V51 B;  4JHD A;  4H0O A;  3LM9 A;  3CCE N;  1VSD A;  3LM2 A;  4CZH A;  1I39 A;  5JS1 A;  4YHH K;  3AO5 A;  2QXL A;  4OKK A;  3HZ6 A;  3Q7C A;  2HHH K;  5JS2 A;  3VER A;  3ZT1 A;  1S72 N;  3H45 C;  4LSL A;  2QA4 N;  1G15 A;  4CJ5 A;  3L8B A;  3MX5 A;  3QB0 A;  1UAX A;  5DMR A;  3VTI A;  3KK2 A;  5KGX A;  4F9O A;  3CCV N;  3SLC A;  3ISN C;  4O55 A;  1WAF A;  2NZT A;  4CHN A;  1NGJ A;  2UUB K;  1S1V A;  3BEX A;  1NK6 A;  3M8R A;  1KAZ A;  3HP9 A;  4BVP A;  1QZ5 A;  3CC2 N;  4IBN A;  3CCJ N;  3T1H K;  2KKZ A;  3P38 A;  1EQY A;  1G99 A;  3I8D A;  2A41 A;  2Z1H A;  5BRH A;  3HOT A;  4BVO A;  1IBM K;  3AY9 A;  1JKH A;  2V52 B;  3MED A;  2IIR A;  3LP3 A;  4CW7 B;  4NYF A;  3AO3 A;  4FWO A;  4IOA L;  3QFU A;  3OJS A;  4DTR A;  1T6D A;  2QW9 A;  3SV3 A;  2BE2 A;  5AQY A;  4DV3 K;  2G8V A;  4DV0 K;  3TAG A;  1RBV A;  1GLA G;  2YHY A;  3TTD A;  2W40 A;  4HHT A;  3A5M C;  5AFU H;  3NVM A;  4N5S A;  1DTT A;  1ZYQ A;  3K9K A;  4DS5 A;  4B3T K;  4J2A A;  4BR0 A;  1K8K B;  4JK9 A;  3KLI A;  3IRX A;  2E2Q A;  2H3G X;  5JMV A;  2EWS A;  4LF7 K;  4MO4 A;  1NGD A;  1T05 A;  3O1B A;  3UIQ A;  2WTU A;  1N5Y A;  4FK0 A;  4M63 C;  2O8F A;  1QVG M;  3IFR A;  3GL1 A;  4M7X A;  1P8Z A;  1GLE G;  4N47 A;  1ITG A;  2ZE2 A;  3GOI A;  4QCL A;  3SPZ A;  2P5G A;  4H0P A;  4CZG A;  3TAQ A;  4QAG A;  4FOE A;  4FM0 A;  4IKF A;  3WXK A;  2HHQ A;  3J80 O;  3QFP A;  1RGI A;  3KZB A;  2KQ2 A;  4CZF A;  1D9F A;  1VRU A;  3D2E A;  3LDQ A;  3ULE A;  3BGR A;  1NGA A;  1NK9 A;  5KPR A;  3VQ6 A;  1ATS A;  2VQE K;  3NF7 A;  5C24 A;  1CLQ A;  1C1A A;  5GIN A;  3SBG A;  1U47 A;  4B1W B;  4M7Y A;  2P1J A;  4IWV A;  4CJV A;  2P5O A;  3NF8 A;  2VG6 A;  3HPO A;  3L2W A;  5HRS A;  3GDQ A;  3H1V X;  3ZEU B;  4BGA A;  1VK0 A;  5H1S Q;  2OYQ A;  4E89 A;  4FLZ A;  3NMU A;  1JLA A;  2Q0U A;  3PIO L;  1J53 A;  1NK7 A;  4IXC A;  5LMN K;  4MLE A;  1T7P A;  1TKD A;  1UOC A;  3BZC A;  1E4F T;  1KXP A;  4CEO A;  3EKS A;  3U4L A;  5JLH A;  1HJO A;  3CIP A;  2F96 A;  3LDO A;  1QS4 A;  3BP8 A;  5HBM A;  4FJ8 A;  4M42 A;  3VQ5 A;  5LMU K;  4RTF D;  4CED A;  3TAE A;  4E0D A;  4KHU A;  5AQX A;  4F8R A;  5ELZ A;  2O8F B;  1BA1 A;  5F0X A;  1NK4 A;  4FLV A;  3DI6 A;  3V1O A;  3P83 D;  3VGL A;  5HP1 A;  2RN2 A;  2HST A;  2UU9 K;  1NGE A;  3C6H A;  1M1K O;  3M5R A;  3VES A;  4CJE A;  4DV7 K;  2PYJ A;  4M3W A;  4DQQ A;  1IBK K;  4FZY A;  5AQP A;  2KLA A;  2PFU A;  1FK9 A;  2GV9 A;  4DQ8 A;  3DLK A;  4BE1 A;  1F21 A;  3ZSY A;  4JAX A;  3UKU A;  5KI6 A;  4KRE A;  4E7K A;  3R6M A;  3AO1 A;  3ULE B;  1ATR A;  4AHV A;  4E1N A;  3ENO A;  2J4R A;  1NJX A;  4B9S A;  3HP6 A;  1IG9 A;  3MEC A;  2HBL A;  3VN5 A;  1T3V A;  4CJS A;  3NGY A;  5HL7 L;  1HLU A;  3QO9 A;  4ELV A;  4JN4 A;  1GOB A;  4DTO A;  3HM9 A;  1KAX A;  4EP5 A;  3OYJ A;  1J6Z A;  3CQX A;  4BDP A;  2FC0 A;  2XY5 A;  2YKM A;  4Z4F A;  5GAE P;  4O8K A;  5KPT A;  3CPW M;  2NRH A;  3NVK A;  1YTU A;  4DKW A;  5C2D A;  3L3V A;  1WSI A;  3T7Z A;  3LP2 A;  4BRD A;  4KI4 A;  2W41 A;  1TL3 A;  3U9Z A;  1J5E K;  1LWC A;  3NAE A;  5MLC Q;  4FWS A;  3ZSV A;  4I2P A;  4W5Q A;  3OYD A;  2OPQ A;  4AHT A;  2D0B A;  4H5N A;  1BDG A;  1C1C A;  1NKC A;  3AVH A;  2F4V K;  1BA0 A;  1GLJ O;  3CQ8 A;  2W6K A;  3HXM A;  3C6U A;  4W5O A;  1OH8 A;  1J9A A;  2HF3 A;  3IKM A;  5C0Y A;  2Y1J A;  4E1M A;  3KWG A;  1K6Y A;  4RCH A;  4KTW A;  5J2M A;  2RHK A;  4KHQ A;  3G4S N;  4DB3 A;  3TAM A;  4FSV A;  4BRA A;  2XY8 A;  4YNQ A;  4E7I A;  1ILY A;  4XIU A;  1S9G A;  4OPJ A;  3OYC A;  3OW2 M;  2NRZ A;  4BRH A;  3CCR N;  4BRG A;  4AM6 A;  3OVN A;  3H3N O;  3S3N A;  3SQ0 A;  4NO7 A;  2HVI A;  4CZK A;  1XQS C;  4DG1 A;  3V9U A;  4CCH A;  4LF4 K;  3FZL A;  4EFH A;  3C94 A;  3ID8 A;  3VA0 A;  3NH2 A;  5HRR A;  2NRR A;  5AQO A;  5AQU A;  1BOT O;  4CJQ A;  4JV5 K;  3CXC M;  4LF8 K;  3P39 A;  1X9S A;  3ZT0 A;  1YAG A;  5BRD A;  3K0S A;  1HKB A;  4CEA A;  4M3Z A;  5E26 A;  4FPB A;  1UA1 A;  1YHQ N;  1YI2 N;  1S1T A;  4O5B A;  3ZX2 A;  3EE8 A;  3KWI A;  1NGI A;  2QXF A;  3THV A;  5B8H A;  1WBB A;  3V4I A;  4GMJ B;  1D4X A;  2D0O A;  1TUU A;  4BRF A;  3MMV A;  2HBJ A;  4KTZ A;  2CGJ A;  3TWH A;  3T1Y K;  4E7H A;  4JI0 K;  1SQK A;  1GLF O;  3K5O A;  1CXQ A;  1BIZ A;  2GUP A;  3OA9 A;  1DT9 A;  4CD3 A;  3O5B A;  4DV6 K;  4PQU A;  4CZE A;  2QTD A;  2FBY A;  5AQF A;  2NLX A;  4OKE A;  3AVM A;  4F2R A;  2G8U A;  2F9W A;  4C8M A;  4K25 A;  2A1S A;  1JCE A;  1TGO A;  4DUY K;  1NGB A;  3MEG A;  3OBY A;  4FYD A;  1S5J A;  4MO5 A;  3O6W A;  3NHG A;  1SKW A;  4OPA A;  3OYF A;  2FBX A;  4PHT X;  3H6E A;  2KFZ A;  2FLO A;  4IOX A;  3KK7 A;  1K8A O;  3ZSZ A;  1SZ2 A;  4BRQ A;  1Q86 O;  2HBM A;  3J8A A;  3I0S A;  3QEP A;  1KAY A;  5ADX A;  3SQ2 A;  1U45 A;  4CBU A;  3CG7 A;  3M8S A;  4B1Z A;  1WB9 A;  1FKP A;  1S6P A;  3VF2 A;  3HI0 A;  2OTL N;  2GBZ A;  3WEE A;  3A2F A;  3R8E A;  2QWP A;  2ATQ A;  3TTC A;  3EE9 A;  4BC5 A;  5AQT A;  4RW4 A;  4Z4E A;  4FJN A;  3DOL A;  3JS6 A;  4FLU A;  3VQ7 A;  3CPE A;  4W5T A;  2ZGZ A;  3T1A A;  4NCA A;  4FPA A;  4OO1 J;  2P9N B;  3HT3 A;  5IT9 O;  4X65 K;  2YJE A;  5C12 A;  4DLG A;  4XH5 A;  2YX6 A;  3IMX A;  1VSK A;  1Q9X A;  4KH4 A;  4DFK A;  2YNF A;  1LV5 A;  3J7A P;  4BGB A;  4IEI A;  4KV8 A;  3F73 A;  4HUF A;  3HO1 A;  3SZ2 A;  4JI5 K;  3HSC A;  2Z1J A;  3QBX A;  4JKF A;  3W0L A;  5BR8 K;  4CGI A;  5M1O A;  5BR9 A;  3SI6 A;  3WXM B;  4CZI A;  4DTX A;  2UYT A;  3S3M A;  1XUP O;  1EXQ A;  3ZET A;  3HBT A;  3TSP A;  4GW6 A;  3WQT A;  5GIP A;  1GOA A;  2WFB A;  5AZJ A;  4BQL A;  2FF3 B;  2HHT A;  3SUP A;  4FLW A;  4M3U A;  4K42 A;  3P1G A;  4CES A;  3CC4 N;  2Q36 A;  1KRP A;  5AQH A;  1RT7 A;  1NJI O;  3VEY A;  2GUI A;  4IO8 A;  3AVB A;  3FZK A;  4H5R A;  1A5X A;  1NWK A;  3EN9 A;  3I55 N;  3CME N;  2A5X A;  1ASV A;  1JJ2 M;  5FPD A;  1RTD A;  5I42 A;  2P9P A;  3NF9 A;  1BGX T;  1XC9 A;  4KKO A;  2D0C A;  2P9U A;  2E1Z A;  3ZYY X;  1KFD A;  4NXN K;  3QIN A;  3I33 A;  1RBU A;  2DFF A;  4R79 A;  1REV A;  1VSE A;  4B1U B;  1JLE A;  3TR8 A;  3PX6 A;  3OS2 A;  3HYF A;  1L3S A;  3ALY A;  3K58 A;  2Y1I A;  3E01 A;  2G8H A;  1M90 O;  2HND A;  1WSE A;  4ILG B;  3R9P A;  3PLA A;  2FBT A;  2O8D B;  4Z4G A;  1NOY A;  3AVF A;  5DK5 A;  3RSE B;  1DEJ A;  1C6V A;  3CJA A;  3QLH A;  4CGG A;  1U49 A;  1EX4 A;  3DXM A;  4IZ9 A;  1HQE A;  4BRP A;  3VEX A;  1Q81 O;  5AZI A;  3VQC A;  1QQO A;  1GLD G;  4B9L A;  4CF2 A;  1XHX A;  3CC7 N;  3PSF A;  4JD2 B;  4KO0 A;  4AQY K;  4BR2 A;  2A40 A;  3N4P A;  4MQ3 A;  4H5W A;  4DQI A;  2P9I B;  5CYM A;  4FM1 A;  4BRL A;  5ADX H;  3PIP L;  4HVJ A;  4KAZ A;  1O1W A;  4B8A B;  2ZGY A;  4B9Q A;  1HYV A;  3DYA A;  1NK0 A;  2O8E A;  2KW4 A;  3V1Q A;  4TSX A;  2YV0 X;  2D0A A;  3PV8 A;  3ZET B;  4NCB A;  4CIE A;  3UE5 A;  3T69 A;  3ZSQ A;  3QEI A;  2RF2 A;  4FCY A;  3RMC A;  2PZS A;  4DU4 A;  4WYB A;  2CH6 A;  3THW B;  5KTQ A;  4QS8 A;  3SUN A;  3MXI A;  4CBW A;  5GAH P;  2OZS A;  4WCE L;  4RW8 A;  3H46 O;  3VA3 A;  1OH7 A;  5AR0 A;  4AHS A;  1GLB G;  4JRP A;  1S6Q A;  3V9Z A;  1VQM N;  3F9K A;  3QER A;  3QEX A;  3LP1 A;  4JEP A;  3CM5 A;  4PKI A;  3SNN A;  4PKG A;  3SUO A;  1HYZ A;  3SJH A;  1NK5 A;  4KHW A;  5BPN A;  4GVM A;  3UKR B;  2LSN A;  2P9U B;  3K9J A;  3EL2 A;  3L2U A;  1QTM A;  4CJR A;  3KJV A;  3SAF A;  1IKX A;  5AQJ A;  1RDU A;  1JLF A;  3MWP A;  4JLH A;  4RW7 A;  3SMS A;  3AGR A;  5C15 A;  1HMV A;  4Z4C A;  1E4G T;  4JRQ A;  5AQZ A;  4CJT A;  4ISG A;  1K73 O;  4FL9 A;  4OLA A;  1Y64 A;  3BZK A;  1TK5 A;  4M3T A;  1BI4 A;  4JK8 A;  5M1K A;  4Z0U A;  4YOX A;  4DSK A;  4KRF A;  3KLH A;  2G8K A;  1VQP N;  4M41 A;  1YIT N;  5AQS A;  1BO5 O;  2GWJ A;  1IJJ A;  4B1Y B;  2VCP A;  4GKJ K;  2GX9 A;  4B08 A;  4BRC A;  1XMO K;  4HCB A;  4GVE A;  5D3G A;  1B9D A;  4K43 A;  4U67 L;  3IDH A;  4FVU A;  5A2Q O;  3ID6 A;  4DF8 A;  3K5M A;  1VQ7 N;  5CY4 A;  2R7Y A;  2I7P A;  3CI5 A;  4A62 A;  1T03 A;  4G9Z A;  3O9S A;  3O80 A;  1GOC A;  2NRW A;  3KIO A;  2OPP A;  1IG8 A;  3V81 A;  4IJN A;  4CEZ A;  4JHD B;  4FJM A;  3AVK A;  2D5R A;  1HX1 A;  3LPT A;  2YNI A;  3P4I A;  1NBW A;  4YOT A;  2OPR A;  4BC4 A;  2IVN A;  2ZQB A;  4CI6 A;  3OJU A;  3OYG A;  3GBT A;  4DR1 K;  4C1N I;  2HB5 A;  5CZ1 A;  2XHB A;  4LF6 K;  1JLC A;  1U6Z A;  2CH5 A;  2ZWH A;  2JGU A;  5KQD A;  2UXB K;  5M1N A;  3QIO A;  1VSH A;  5HLF A;  3E9O A;  3LZJ A;  4B8C A;  4BC2 A;  4KPY A;  2P9K A;  4BWJ A;  4QS9 A;  3U3G A;  1QHA A;  4PA1 A;  5BPM A;  3O4W A;  4HWI A;  4JKG A;  3QML A;  5J2N A;  4FWQ A;  3TAF A;  3IUC A;  4FJ5 A;  3ZT2 A;  4IDH A;  4B1X B;  2D0P A;  1NOZ A;  1KTQ A;  4PL8 A;  3O9T A;  3NE6 A;  3MN9 A;  4CIF A;  4AH9 A;  2BDP A;  3VQ8 A;  3AV9 A;  3L3U A;  3DRP A;  2NRT A;  5T7B A;  1RNH A;  3LAN A;  2E8A A;  4R5P A;  5AQM A;  3F2K A;  5AQK A;  1JL1 A;  4ZTF A;  3KD5 E;  5BRF A;  3IG1 A;  2Q3S A;  3BDP A;  4Q0B A;  3FE1 A;  3TPQ A;  2QWN A;  2BAN A;  4W5N A;  4JKE A;  3QNO A;  3ITH A;  3GG4 A;  3NDK A;  1S1U A;  2E4L A;  3PX0 A;  3KK3 A;  3RR8 A;  5BN8 A;  3EKU A;  4JS4 A;  3ZSW A;  4BR9 A;  4FO0 A;  3U8X A;  2VYP A;  1ZBF A;  3TSU A;  4A2B A;  1S1W A;  3I56 N;  4KB1 A;  1JXE A;  1RT6 A;  2HBK A;  4EZ9 A;  3O9R A;  1SAZ A;  3DXK A;  1BUP A;  3H3O B;  3O08 A;  4YY3 K;  4H8K A;  2FXU A;  4LC9 B;  4WQ4 A;  1YJN N;  3O9U A;  3DLG A;  4FZX C;  1DKG D;  2ITG A;  3ZSX A;  3ZSO A;  2ZJP L;  5M1P A;  1WSJ A;  2D4W A;  5HOO A;  1JCF A;  4Y1D A;  2IVO A;  4KFB A;  2P9S A;  3DMJ A;  4CGD A;  4BDZ A;  1J54 A;  4RG8 A;  4BC3 A;  1D9D A;  3R1X A;  4CK3 A;  2AP1 A;  3F5T A;  2E6L A;  3THY A;  4Z4I A;  1X3M A;  4AIL C;  3D2E B;  4LFC K;  2P9K B;  4YOV A;  3PSI A;  2EX3 A;  3CCQ N;  4C23 A;  2VG7 A;  2HHV A;  1HNV A;  1EWR A;  4O8U A;  2RKI A;  3E1Y A;  3QIC A;  2OAN A;  3CF5 L;  4DF4 A;  1A5W A;  1LAW A;  3V9W A;  5EX5 A;  1QE1 A;  4FVM A;  2IGI A;  3CFR A;  4JI4 K;  1S9E A;  1TKZ A;  4JKC A;  1QVF M;  3M8P A;  2X78 A;  2O4I A;  3D2F A;  3ASM A;  3ZCM A;  2I7N A;  2HHX A;  3G71 N;  3AAR A;  1IV0 A;  3UB5 A;  2QWR A;  3IS9 A;  4Y0W A;  2G8I A;  4LFA K;  3MEE A;  4B9U A;  1EKE A;  1RDC A;  2GWK A;  5C25 A;  3VTH A;  1DTQ A;  2B6A A;  1W7A A;  5J2P A;  3CJ1 A;  1IKW A;  1WSH A;  4ID5 A;  5KPZ A;  1WAJ A;  5J2Q A;  3K5L A;  3RMA A;  1JL2 A;  1R0A A;  1OH6 A;  3M1F A;  4BRN A;  4BR4 A;  1SV5 A;  1K9M O;  4YDU A;  2CGL A;  2NRX A;  4EP4 A;  1QQC A;  4CD1 A;  4FWR A;  1B92 A;  1NLV A;  4JYA K;  2B5J A;  1ZC6 A;  5F2R A;  4I9L A;  4H0Y B;  3OYA A;  4IO9 L;  3L4Q A;  1U2V A;  1QQM A;  4CE9 A;  3DOK A;  1N6Q A;  3DLR A;  5FRM A;  3AVL A;  4ISF A;  3D0P A;  1VSM A;  4K41 A;  4CBX A;  4XH4 A;  1W0H A;  3RTV A;  1TAU A;  2PY5 A;  5AQN A;  3M3Z A;  3A5N C;  3OYB A;  1BIU A;  3HK2 A;  4OPK A;  4CFB A;  2BH1 A;  2P9S B;  3O4Q A;  3VEO A;  4DV4 K;  4A5A A;  2QKB A;  2JLE A;  3O4N A;  2V7Y A;  2WUS A;  3UKU B;  3BF1 A;  3V9S A;  1ESV A;  4H0V B;  1NJY A;  3SQ1 A;  1BG3 A;  1BHL A;  5LJW A;  1T44 A;  4HUE A;  2ZD1 A;  2GEM A;  4CVN E;  1MA9 B;  2OPS A;  1NU0 A;  3OYN A;  4DTS A;  1RDW X;  3B6P A;  1X1P A;  3OYE A;  2DY4 A;  2E2O A;  3F9M A;  1TV6 A;  3PO4 A;  4DSI A;  3MN7 A;  1UA0 A;  2Q0R A;  3OHR A;  4BDY A;  3QNN A;  2F8T A;  1LW0 A;  4CZJ A;  3T3F A;  4OKJ A;  5GAG P;  3C7N A;  1CZA N;  4FJH A;  1HNX K;  4UY8 O;  4FJI A;  2FSJ A;  1NGF A;  3KD1 E;  4PKH A;  3C0B A;  1TYQ A;  4CJU A;  1A5V A;  2QWQ A;  1QQN A;  5CE3 A;  1VQ5 N;  1Z25 A;  4LD0 A;  4DU1 A;  5I3U A;  3WUH A;  3RRG A;  4YOW A;  3K5N A;  3ENH A;  1XI1 A;  4PL7 A;  1BCO A;  1P90 A;  4LF5 K;  1KLM A;  4OPH A;  4CJW A;  4BRE A;  2IAJ A;  4B9M A;  3CJB A;  5M1F A;  3CYM A;  1HR0 K;  4FJL A;  2OCE A;  1WNS A;  1OVQ A;  4WE1 A;  4AHR A;  2WON A;  4BRI A;  3ATU A;  2FSN A;  4W5R A;  3MXM A;  4QS7 A;  5FRN A;  4BE2 A;  4OX9 K;  1IO2 A;  2B4J A;  1XHZ A;  3MK6 A;  1L3T A;  2YCH A;  1VSL A;  3J7Z O;  4DR6 K;  1HKC A;  1FXX A;  4GNI A;  4FLY A;  1ASW A;  3W3D A;  2Z1I A;  4DSJ A;  4PWD A;  4G1Q A;  1Q18 A;  3WNF A;  4WFA L;  3HST B;  4FWN A;  2A1R A;  3CCS N;  2HW3 A;  4CEQ A;  4QOZ B;  1LWE A;  5LY3 A;  3WT0 A;  1VHX A;  3JSM A;  4H5T A;  3VEZ A;  2HMP A;  5TKY A;  1YXQ A;  1RFQ A;  3SJJ A;  3SYZ A;  3KKS A;  2KTQ A;  4BWM A;  2OTJ N;  1YT3 A;  4DR4 K;  3DM2 A;  5J1E A;  3EYZ A;  4FJ7 A;  4CHO A;  3PX4 A;  3A5L C;  3MN5 A;  4I9Q A;  4CK1 A;  4BE0 A;  1RT2 A;  3MN6 A;  3VQE A;  5CHI A;  2OA8 A;  1IH7 A;  2BTF A;  4KI6 A;  2HHW A;  4B3O A;  5CR4 A;  4CJL A;  1VAZ A;  4KTQ A;  1Q9Y A;  4L8R B;  4C8N A;  4CJ3 A;  4B3M K;  5KRT A;  2G8F A;  2WOM A;  1W97 L;  3SPY A;  3NH1 A;  3CET A;  4V19 S;  1ZBI A;  4O0I A;  1NMN A;  1KSP A;  2RPI A;  3ENB A;  1S1X A;  1YIJ N;  4DU3 A;  2ETJ A;  3IAY A;  3C6A A;  3C6T A;  5AQQ A;  1YUW A;  3TAB A;  3OS0 A;  3AVG A;  1SKS A;  2WC9 A;  5EXW A;  4B9T A;  2Q31 A;  1TKT A;  3S3O A;  3AAQ A;  2F9T A;  1LOT B;  1IKY A;  4IG3 A;  2QWM A;  1KCF A;  3NGZ A;  3EO3 A;  1HNW K;  1C0G A;  1RDB A;  3A8Y A;  4ELU A;  4FWM A;  1NNE A;  1VQK N;  4K8X A;  2O8C A;  4JK7 A;  2O4G A;  1C0F A;  5FDL A;  4DHY A;  1HRH A;  3HVR A;  4X62 K;  1ZBL A;  3MCP A;  4CIG A;  4GV6 A;  3CJC A;  3AVA A;  3L4I A;  1TKX A;  4OVL A;  1YF5 L;  2X74 A;  5AFU A;  3L0Q A;  5JVG L;  3QET A;  4LH4 A;  1SL0 A;  3LDS A;  2FF6 A;  5CYQ A;  3WEE B;  4FLT A;  4LSN A;  2QI2 A;  1NJW A;  3WXI A;  4A2A A;  3LDL A;  3RRH A;  4ICL A;  4CF0 A;  3PY8 A;  5GIO A;  4J8F A;  4BRM A;  3FZH A;  2WBN A;  1BL3 A;  1LWF A;  4MDB A;  1QSY A;  3ZLJ A;  5JLF A;  3CQY A;  3L2V A;  1L5U A;  4BAC A;  3VQA A;  1JLQ A;  1T8E A;  5AJ3 K;  2E20 A;  1VSF A;  3AAP A;  4E7J A;  1NGH A;  4CGH A;  3KHY A;  3SBT A;  3DWL A;  1KC8 O;  3SUQ A;  1N32 K;  1RT3 A;  3R3L A;  4H0T B;  3AA3 A;  4J2B A;  1MWM A;  1K8K A;  1NKE A;  1VQ9 N;  2IS3 A;  1YJW N;  3LAK A;  2XO7 A;  3E9P A;  4AF1 A;  3AVN A;  5AZJ B;  1ATN A;  1I94 K;  4H5V A;  2E88 A;  2FBV A;  4Z4H A;  4CHZ A;  3CMA N;  3RVC A;  1GLC G;  4IJA A;  3ZX0 A;  4JS5 A;  3AVC A;  3SK3 A;  3AA4 A;  2P51 A;  5FPE A;  2FSK A;  4AHC A;  4IDK A;  1KFS A;  3SMP A;  3O3H A;  4DR7 K;  3QEW A;  2P9P B;  4NYN A;  1QSS A;  1CZ9 A;  1RT1 A;  4O4G A;  1WUA A;  2O8C B;  4FK4 A;  4WQ5 C;  3DJC A;  3O8M A;  3VGK A;  1NMD A;  1KLN A;  1JXB A;  4YOU A;  2A3Z A;  5CZ2 A;  4IG0 A;  2G8W A;  1L3V A;  1LAV A;  1I3A A;  3ZT4 A;  2F8S A;  3VOV A;  2ASM A;  3QDK A;  2W6L A;  3KLE A;  1Z6R A;  3FFI A;  2HOE A;  1RT4 A;  2ASO A;  4EAH D;  4Q5V A;  3ZEU A;  2AA4 A;  2PYL A;  3HRG A;  1L3U A;  3DXM B;  3OYK A;  2CGK A;  3D6R A;  3LWL A;  1KVC A;  3S41 A;  4XH1 A;  5AZI B;  1Z05 A;  1Q82 O;  4CGF A;  2IVP A;  2XY6 A;  3ULD A;  3K2P A;  1V4S A;  4WQ4 C;  1TK0 A;  3DLE A;  1KVB A;  4BQZ A;  2AJQ A;  4IEE A;  5C2F A;  4F3O A;  1VQ6 N;  4WFN L;  2GTD A;  1W2B M;  3B6O A;  2XRI A;  4H03 B;  4DQP A;  3HTV A;  1SKR A;  4GV9 A;  1FKO A;  2O8E B;  1NM1 A;  3SAG A;  3GE1 A;  4CZM A;  2VWK A;  3TTF A;  1XWL A;  3WNH A;  3JAM O;  4HUG A;  1ZBS A;  2UUC K;  5HRP A;  3MX2 A;  2QWL A;  3TAN A;  3RWU A;  4C8L A;  3A0I X;  1HNZ K;  4H4O A;  1Z26 A;  4NCG A;  1TVR A;  3MCA B;  5TKW A;  1DGK N;  2BUP A;  3AA5 X;  3J7Y P;  4ELT A;  4H4M A;  3RMB A;  1X9W A;  4CJ7 A;  2IC3 A;  2NUB A;  4BR7 A;  3M6G A;  4HTL A;  4HCC A;  3V6D A;  1OVY A;  1WSG A;  4MFB A;  4CJF A;  4I7F A;  5M1Q A;  4NXM K;  1CXU A;  3AGK A;  4FXD A;  5E41 A;  3LDN A;  3EZ5 A;  4YOY A;  4N56 A;  4JI3 K;  4LH5 A;  2VWB A;  4ZHR A;  4KHN A;  4M3Y A;  3ZT3 A;  4EHT A;  1O13 A;  3HPH A;  4FWP A;  2ZF5 O;  3Q7B A;  4FJ9 A;  1HKG A;  2ITM A;  4KBO A;  1MDU B;  3LDP A;  1KD1 O;  1VSJ A;  4AHU A;  4N41 A;  3P5J A;  3BUZ B;  3LL3 A;  2YI1 A;  3WXJ A;  2QWO A;  3MWT A;  4DV2 K;  4WQ5 A;  3K57 A;  3AVJ A;  4H0X B;  2IOC A;  4RW9 A;  3A5O C;  4X64 K;  1RT5 A;  4YDU C;  4FJX A;  1BI4 B;  3HM8 A;  3OTO K;  4C8K A;  3OYL A;  5FLX O;  1LCU A;  2QK9 A;  1RTJ A;  1YVN A;  1S22 A;  2F7T A;  1C0T A;  2VGM A;  2PAV A;  3NGI A;  2YNG A;  3THX A;  4K0K K;  4B3R K;  3B8A X;  4DUZ K;  5KQ8 A;  3LP0 A;  4GKK K;  4EIA A;  4KHS A;  2DFE A;  1EET A;  3O3F A;  3CER A;  4F2S A;  3NCI A;  1ASU A;  1RBR A;  2VQF K;  4DWI A;  4FK2 A;  3CCU N;  4MDA A;  5EVZ A;  4FOI A;  4IFV A;  4ILJ A;  2HNZ A;  3QIP A;  3C65 A;  3QBW A;  4CF9 A;  1X9M A;  4PY5 A;  4MLH A;  2O8B A;  1U04 A;  3WNE A;  3L6Q A;  3EY1 A;  3KK1 A;  4FLX A;  4CFC A;  1OH5 A;  1WSF A;  1MWK A;  3FGU A;  3JXU A;  4A5B A;  1HJR A;  4OGE A;  5F1X A;  3LZI A;  2UUA K;  3PO5 A;  1H1V A;  3D45 A;  1RCH A;  1B9F A;  3JYT A;  1KQS M;  3RMD A;  1TAQ A;  3J81 O;  1TUY A;  3VQ9 A;  2DTU A;  1JLG A;  4NLC A;  3O1W A;  4CJK A;  2YHA A;  4CHP A;  3G0Z A;  3SCX A;  1D8Y A;  1NGG A;  3I8B A;  1S3X A;  4A57 A;  3DRS A;  1BQN A;  5LJV A;  4NLB A;  4JKG B;  4CGJ A;  1VQ4 N;  2Q1N A;  3CCM N;  4LF9 K;  3TAP A;  5EU7 A;  3OBW A;  5KGW A;  3KKR A;  5AQV A;  1XC3 A;  4KHP K;  2A6A A;  4Y1C A;  1V4T A;  4CEB A;  2ZM6 K;  4EZ6 A;  1BIS A;  4CJ4 A;  1YVU A;  4F3T A;  4JI8 K;  4RWT A;  3G10 A;  2Q2R A;  3VGM A;  4DV5 K;  4BY9 C;  5IWA K;  4LY7 A;  2ASP A;  5AQW A;  3SAH A;  4WFB L;  2UXD K;  3V9X A;  2QEX N;  3LWM A;  4JI2 K;  3T19 A;  4FM2 A;  3BF3 A;  1IBL K;  4CJP A;  1VQO N;  3O9Q A;  1KVA A;  5DM6 L;  3THX B;  4DMN A;  1QZ6 A;  5KRS A;  1BWF O;  1RDA A;  4B9V A;  2XY7 A;  4JI7 K;  1JLB A;  3O3G A;  1VQL N;  3VPZ A;  4BRO A;  1Q7Y O;  3CD6 N;  1NK8 A;  2O8B B;  2VG5 A;  4DQR A;  5SWM A;  1CZB A;  3CFP A;  3CCL N;  4E1J A;  3WQU A;  3VF6 A;  4DSL A;  3DXK B;  5HRO A;  5C42 A;  3D7E O;  3MAQ A;  1WLJ A;  1N34 K;  4DCH A;  3VET A;  3DAW A;  4U7B A;  4LFB K;  3OYM A;  2VWJ A;  4I6M A;  1ZXO A;  3L2Q A;  2D1K A;  4C1N K;  1RBT A;  3THY B;  1JCG A;  1HNI A;  4IOC L;  1QHT A;  3HOS A;  4RW6 A;  3KLF A;  2KZZ A;  4AM7 A;  1ZBU A;  2HVH A;  3CJ9 A;  2HHS A;  2E2P A;  3HL8 A;  2HNY A;  1XNQ K;  3AO4 A;  1YJ9 N;  3OYI A;  1ZBH A;  3DLB A;  3V1R A;  4E7L A;  3G6E N;  1SL1 A;  1EWQ A;  1C1B A;  4A59 A;  2YHB A;  4X66 K;  2P9N A;  3D2F B;  5FPN A; 
#chains in the Genus database with same CATH homology
 4DV1 K;  4JI8 K;  2UU9 K;  4DV5 K;  5IWA K;  4OX9 K;  4GKJ K;  4DR5 K;  4DV7 K;  4X62 K;  4LF4 K;  4JYA K;  2UXD K;  4JI2 K;  1XMO K;  1XMQ K;  4DV2 K;  1N36 K;  1IBK K;  1IBL K;  4DR6 K;  4X64 K;  4B3S K;  5IT9 O;  4X65 K;  5A2Q O;  4YHH K;  3OTO K;  2HHH K;  5FLX O;  4AQY K;  3J80 O;  4JV5 K;  4LF8 K;  1FJG K;  1N33 K;  3J7A P;  4YY3 K;  4K0K K;  4B3R K;  4JI7 K;  4DUZ K;  4JI5 K;  4GKK K;  4DR3 K;  4DV4 K;  2VQE K;  2VQF K;  5BR8 K;  4DR4 K;  4DR1 K;  2UUB K;  4LF6 K;  3T1Y K;  4LFC K;  4CVN E;  2UXB K;  5AJ3 K;  4JI0 K;  3T1H K;  1N34 K;  1XNR K;  2UUA K;  4LFB K;  4DV6 K;  4JI6 K;  5LMN K;  4B3M K;  1N32 K;  3JAM O;  2UUC K;  1IBM K;  4V19 S;  3J81 O;  4CW7 B;  1HNZ K;  4JI4 K;  4DUY K;  1J5E K;  1HNX K;  3J7Y P;  1I94 K;  4DV3 K;  4DR2 K;  2E5L K;  2F4V K;  4DV0 K;  4NXN K;  4JI1 K;  1XNQ K;  5LL6 Z;  5LMU K;  4LFA K;  4B3T K;  4NXM K;  4LF9 K;  4LF7 K;  4JI3 K;  1HNW K;  4DR7 K;  4KHP K;  4X66 K;  2UXC K;  4LF5 K;  2ZM6 K;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...