2F4VK

30s ribosome + designer antibiotic
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2f4vK00
2E5LK 4JI5K 4JI0K 1IBLK 4LF7K 2VQEK 5A2QO 1IBKK 4DV3K 4JV5K 4B3RK 4AQYK 1I94K 4LF4K 2UXCK 1XNQK 4YHHK 4JI8K 2ZM6K 5LMUK 1HR0K 1N33K 3J81O 4DR7K 4DV2K 4JI2K 4JI3K 2UUAK 5BR8K 4X64K 4JI1K 1N32K 3T1HK 4DR6K 4DV6K 4B3MK 1XNRK 4LF8K 2UUCK 4DV1K 4JI6K 4LFBK 4NXMK 2UXDK 4DR2K 4X62K 4X65K 4B3SK 4V19S 3J7AP 5AJ3K 4DR5K 4DV4K 3J7YP 1XMQK 4DR4K 4JI4K 4NXNK 3JAMO 3J80O 1J5EK 3T1YK 5FLXO 2UUBK 4OX9K 4DUZK 4LF9K 1IBMK 4DV0K 1N34K 4LF6K 2F4VK 4GKKK 3OTOK 4DUYK 5LMNK 2HHHK 4KHPK 1HNXK 1N36K 4LF5K 4DR3K 2VQFK 4GKJK 4B3TK 4JI7K 4X66K 2UXBK 4JYAK 4CVNE 4DV7K 4LFCK 4CW7B 1HNZK 4LFAK 1HNWK 4DV5K 4DR1K 5IWAK 5LL6Z 5IT9O 4K0KK 2UU9K 4YY3K 1XMOK 1FJGK
chains in the Genus database with same CATH superfamily
4DHYA 5BPNA 5HRNA 3ZSWA 4RW4A 4K42A 4CZIA 1U04A 4DTXA 4EHUA 3KLFA 4JHDA 3DRRA 1TL3A 3MN6A 4N41A 1J54A 4BGAA 4YNQA 4G9ZA 4B3RK 4BE2A 2O4GA 1V4TA 2QWRA 4HVJA 4B8AB 3QEWA 2YCHA 1T03A 4CBUA 1QQNA 1Q9YA 4CHZA 2FLOA 4FK2A 3CCUN 3SMPA 1HJOA 4DR7K 3VETA 4XH5A 2Q0UA 5BR9A 1M1KO 1ZBFA 4X64K 4O0IA 1N32K 4JD2B 3VMFB 4IDHA 3CQYA 4B3MK 4CGIA 5TKWA 3THYB 3V9UA 2ASMA 1T7PA 4FJIA 3M6GA 3SK3A 2O8CB 3AA5X 3C95A 2NRWA 3AVAA 4KBOA 4IKFA 2QWMA 3NGZA 2E2PA 3MN9A 4DSJA 1LCUA 3R8EA 5C0YA 4AHVA 2P9IB 4I6MA 2IDOA 4I9QA 3CCQN 2YX6A 3WXIA 3MEEA 4A61A 4IFYA 3V6DA 4KRFA 2ZJRL 3QFUA 2HVHA 3KZBA 3BF3A 3OYFA 3QETA 3HVTA 4B9LA 4B9NA 4GVMA 1LW2A 2GWJA 4QAGA 3O4WA 2Q0RA 4FWPA 3DLKA 2HHHK 1TUYA 2E1YA 4CZMA 5J2PA 4DR3K 4DTOA 5K14A 1H1VA 2ZGYA 4NYFA 3ZX2A 3HM9A 2CH5A 1IV0A 3L2QA 4CJ3A 4CW7B 3B6PA 4PA1A 4FWNA 4A62A 3Q7CA 3HL8A 3V1OA 3CCVN 3K2PA 2HHSA 5FRNA 4CEAA 5IT9O 3OYKA 3SJHA 1BI4A 3D0PA 1SKSA 2UU9K 1VSJA 1QQMA 3M5RA 4CFCA 4CJSA 1UWBA 2BH1A 3CJ7A 4R79A 1LOTB 5DM6L 3P39A 4CBWA 4KHUA 3RTVA 3PX0A 4EZ9A 2A1SA 5C12A 4FLTA 1GLLO 1HKBA 2VCPA 1FXXA 3I33A 1W2BM 2GV9A 5JLFA 3HSCA 3OS0A 1GLDG 3DRPA 2KTQA 4B9VA 4XIUA 3P83D 1JLAA 4DTSA 1NJXA 2P9KB 4UY8O 3T19A 3NF8A 1YAGA 3HOTA 3K5MA 4M3XA 1S1UA 3OYDA 3T1HK 4QOZB 2RKIA 3GE1A 1FKOA 4F9OA 2QWOA 5AQUA 3CCLN 4NXMK 3MN5A 4LC9B 1VRUA 3OYMA 3KK7A 3CMAN 1QVFM 1VRTA 5AQMA 3RMAA 4Q5VA 3NF9A 4CEZA 4BROA 4CHNA 4M3TA 2WONA 4QS9A 3VQEA 3J7YP 4JKGA 3VGLA 4WE1A 5AZJA 4OLAA 4KHWA 2HHWA 3E9LA 4JI4K 4DS5A 3P4IA 3R9PA 2P9PA 3JAMO 4W5QA 2E2OA 4CERA 1RT6A 3T1YK 4FJMA 4H5NA 1KSPA 3NGIA 4WYBA 1JLEA 1YI2N 1RCHA 3SAGA 1VQPN 3WXKA 5JICA 5M1PA 2XHBA 1K8KA 3RR7A 3HVRA 1BDGA 2GELA 4Y0WA 4CE9A 3O80A 3KK2A 1VSEA 1N36K 4BE0A 2CH6A 3EE9A 4B3TK 2E2QA 3AVHA 4JI7K 3ULEB 4B1WB 3K9JA 5F0XA 1HNZK 1L3VA 1K9MO 4DB3A 4YOWA 1RDDA 2G8UA 3QIOA 1YIJN 3HK2A 2GTDA 4BE1A 4F2RA 1Q9XA 3H3OB 3DLHA 4MO4A 3ID6A 1RT4A 4Z4EA 4DKWA 3OYGA 4IO9L 4N76A 3AVFA 4YDUC 1NK4A 3FLCO 3OYNA 1XUPO 2DY4A 1W9HA 2HBLA 1NJZA 4JV5K 3QB0A 3HT3A 2Q3SA 3VEOA 1VQMN 2NRTA 5ADXH 2KZMA 4AM7A 5F1XA 1KAZA 4E7LA 1D4XA 3FFKB 1C0UA 1XHZA 3WNHA 4IJAA 2YV0X 4WQ5A 1CZAN 5CZ2A 3V1RA 3KD5E 4CF9A 4JKAA 3O9SA 4CF8A 2HOEA 3CHWA 4C8KA 3ENBA 4M3YA 4LFBK 4A2BA 3ZETB 4YOYA 3AA4A 4BVPA 1VHXA 3LDSA 2ITGA 1MU2A 4FO0A 4M3WA 4NB4A 3AVGA 5FDLA 3H08A 1I3AA 3LP3A 1TAQA 3FFIA 3AGRA 1P8ZA 1X1PA 1WSJA 4FLXA 3DMJA 1IJJA 4NXNK 4DU3A 4BWMA 5GAEP 3H6EA 1KVBA 3TAFA 2YKMA 3ZT3A 4CECA 1X3NA 4BRMA 2P5GA 4DTMA 3THWB 4WF9L 3AVKA 3ATVA 3J7ZO 4U67L 4CIGA 3MX5A 3IFRA 4OKKA 2HMPA 3A5LC 1Q8IA 4FM2A 4JKEA 1VSDA 4ILJA 2NRZA 5I9EB 3MAQA 3WQTA 3UKUA 4EP4A 4PL7A 1D9DA 1DTTA 1EWQA 2QKBA 3H46O 3CFOA 2IOCA 4H0PA 2VG7A 1SV5A 1SKRA 1VSFA 1OVYA 4Z4IA 5FPEA 3JS6A 5CZ1A 1TKXA 1FJGK 1RT3A 3NF7A 2Z1JA 1TKDA 1RT1A 2QWQA 1DEJA 2CGJA 2E1ZA 1HKCA 2CGLA 2VQEK 1Q18A 4H0YB 3TSQA 2KFZA 4L8RB 3MN7A 2PYJA 4HWIA 4K43A 2I7NA 3QNNA 2GUIA 3R6MA 3WXMB 5HP1A 1MA9B 4LY7A 2FBXA 5KPRA 3KKRA 4IO8A 1BA1A 5AQTA 4MDBA 1RT7A 3VQQA 1Q81O 3O9QA 1VQ7N 2HHXA 1WSGA 1TYQB 1QSYA 4KB1A 4PY5A 4DMNA 3PIOL 2FSKA 3SJJA 3VQ9A 4H5VA 3QLHA 2XY8A 5J2NA 2FBVA 4CFAA 3EYZA 3UKRA 4N56A 3L2RA 2VYPA 3AAQA 4FJ5A 4JS4A 1L3TA 1GOCA 3VOVA 5FLXO 4DTNA 4OX9K 3C6HA 2YHBA 3EKUA 4FWOA 4BDYA 4F3TA 4E7HA 3QICA 3OYLA 2VWBA 4NCGA 2FC0A 2YHXA 4BC3A 5GIPA 3MWPA 3BY5A 4J2BA 5CHIA 5AQFA 4JLHA 5GINA 4CI6A 4RW7A 2LSNA 3TSUA 3VGMA 1GLAG 4OGCA 1J5OA 2D4WA 1NK5A 1W0HA 1VQ4N 3OJSA 1HRHA 1Q7YO 3HPHA 3NGYA 3ZT2A 3O3GA 2QWNA 1QS4A 3THVA 4FVUA 4BRNA 3U4LA 3ZT4A 1XMOK 1QQOA 2P9NA 1ZC6A 3DYAA 2PY5A 2HBJA 3IS9A 1L3SA 4PL8A 1VQNN 3LALA 4LF7K 4CJEA 1A5XA 3VF2A 3AY9A 4WFBL 1VQ9N 3BDPA 2OPQA 3RVCA 4BR5A 1NM1A 3AAPA 4AQYK 1WBBA 4YOUA 3VQ4A 4IFEA 1TK0A 1IH7A 4GV9A 3FGUA 1S1WA 1U4BA 4IJNA 5LMUK 2IS3A 1HMVA 1S1VA 4O5BA 1S9GA 5KGWA 2GX9A 3SQ4A 2NUBA 4K41A 2O8EA 4H5WA 5BR8K 3G25A 3J8AA 2QTDA 1WNSA 4OPAA 1ATRA 1RDUA 1YHQN 1SQKA 1YVNA 3VEZA 3DLBA 4G1QA 3LDLA 3MWTA 1V4SA 1U45A 1SZ2A 1J9AA 2F9WA 4W5NA 1EWRA 1S5JA 1T05A 3CQ8A 4FJHA 4CJUA 1XMQK 3ALYA 4JK9A 3V81A 1RT2A 2IC3A 2RE2A 2J4RA 4XH4A 3AA2A 1CLQA 1VK0A 1CXQA 2P9LB 3F9KA 3AVLA 3ITHA 3MX2A 1W7AA 3O3HA 1B9DA 3PX4A 2WOMA 5AQNA 3EO3A 4C8MA 4B3OA 3LM9A 3QEIA 5CE3A 3A5MC 4OLBA 4ILHA 4CHYA 3O4QA 1KCFA 1RTIA 3V9SA 4FZYA 3DLEA 1RDCA 1HNVA 4KI6A 3C0BA 2UXBK 1NJWA 2E6LA 1JKHA 3ID8A 3OYBA 1OKJA 3OYIA 3SI6A 3LZIA 2O8DB 3M1FA 2HHUA 3SZ2A 4CJ5A 3K58A 1KTQA 4C1NK 4BDPA 3VF6A 1S22A 3DOKA 4JD2A 1DLOA 2RHKA 3LAMA 3LP0A 4M42A 2EHGA 2YNFA 4JI0K 3S9HA 5FPDA 3RSEB 3CYMA 4LSLA 4W5RA 3BUZB 2AJQA 3THYA 4CJPA 3NH1A 2O8CA 1IBKK 2RN2A 4JNEA 2BDPA 5CR4A 3CXCM 2UXCK 5KGXA 1C1AA 3S41A 4DWIA 1RDAA 5KRTA 4NLBA 1NMDA 1X3MA 1NK9A 2P9IA 1IG9A 2ZE2A 1WBDA 3CG7A 1ASVA 1HQEA 4DV2K 1SKWA 1HYVA 4M7YA 3DXMB 4AHTA 4M7XA 3KIOA 4RG8A 5C24A 1NGIA 1KD1O 4NO7A 4IFVA 4HCBA 4DV1K 2I5JA 1FK9A 3L6QA 1A5VA 1YF5L 3PY8A 3L2WA 2BUPA 2FXUA 1T6DA 3R1XA 4HUGA 2RF2A 2A42A 1N8RO 5E41A 3CMEN 4CEQA 3TARA 4JEPA 4B1VA 4BQLA 4DSLA 4DFMA 1MWKA 1JLFA 3VEWA 3GOIA 3K5NA 1XC9A 4J8FA 5AQQA 1UA1A 1F21A 4Z94A 4M3RA 3I0RA 2P1JA 2FBTA 1EP4A 2G8HA 2G8WA 2O8BA 4DSEA 1HUXA 2B4JA 2GEMA 2A3ZA 4PWDA 3MEGA 5TKYA 1O13A 3CPWM 2ASPA 1BGXT 3ZEUB 2HMIA 4BC2A 3QIPA 2JLEA 4OPKA 5KQ8A 3CCMN 4CJVA 3ASMA 5KPTA 1IG8A 3HI0A 1JLQA 2KFNA 3G71N 1QSLA 3HJFA 3ZSRA 5LL6Z 1ZBSA 2P9KA 4M63C 1OH6A 1ASWA 2BGGA 5EVZA 3CPEA 4FJJA 4WQ5C 2VWKA 2AP1A 3AGKA 4JKFA 1OH7A 2D0OA 4F8RA 4FJXA 5AQWA 1RBTA 2VWJA 4FPAA 1RBUA 2ZD1A 3F5TA 3C6AA 1J6ZA 4KPYA 3QEVA 4B9QA 2IVOA 4E0DA 3IUCA 1E4FT 2OPPA 4YHHK 4CZGA 4BVOA 1RDWX 3H1VX 3NVMA 4I9LA 1N33K 3CM6A 1QSSA 5KI6A 2E4LA 4BR9A 3EY1A 4JI2K 1T6CA 3AVMA 4ELUA 4YOXA 5I42A 1BL3A 1U48A 3A2FA 1R0AA 4DR6K 4PUOA 2XY5A 3RWUA 3AO1A 4H0VB 2ZF5O 4JI6K 2OZMA 2OPSA 1C0MA 3H45C 2E88A 3EL2A 3SMSA 2KHOA 3HP6A 2PBDA 1S9EA 3WEEB 1DGKN 4KKOA 4V19S 1C6VA 5AQHA 3ULEA 1LWCA 1GLJO 1NMNA 2YNGA 1S6QA 1VQ5N 1XWLA 3ZYYX 4AHUA 4KTZA 5I3UA 1RTJA 3P5JA 4JN4A 3VQDA 3M3ZA 1GLEG 1KLNA 2FSNA 1IO2A 3I0SA 4FLUA 1A5WA 1T3VA 2HNDA 2PAVA 1NLVA 3M8PA 5BRHA 4JRQA 5AZIB 3SAFA 4GV6A 4Z4CA 3VERA 1S6PA 1IKWA 4CF0A 4B8CA 2IGIA 4E1JA 1U49A 3EZWA 4Z4HA 4CF2A 3F2KA 2FF6A 2ATQA 4JS5A 3A5OC 2XY7A 2QK9A 3NDKA 5C10A 4JRPA 1YT3A 4MFBA 3SBTA 4H0OA 3G10A 3O8MA 1NK7A 5CY4A 4DQQA 1UAXA 1EO1A 2OA8A 2WFBA 5DK5A 2HHVA 3DM2A 1ESVA 4DFPA 3SV3A 3D2EB 3DXKB 1YJNN 3E9OA 4JKBA 1IBLK 1Q82O 4LD0A 3ZETA 3I55N 4KHNA 1Q86O 4AH9A 3CJCA 4CEDA 4FK0A 3TPQA 2FBYA 4L3QA 4MLHA 4KTQA 3VQ6A 1I94K 4J2EA 3KLEA 4CD3A 1XQSC 5AQZA 3VQCA 4J2AA 4FWMA 3FZMA 3RRHA 1TUUA 1QZ5A 3VTHA 1WAFA 4IOAL 1KVAA 2EX3A 5C15A 5AQLA 1XNRK 1D8YA 1HPZA 3U9ZA 1KRPA 2F8TA 3THWA 3W0LA 1U47A 1TKZA 3OYEA 1WSHA 3GG4A 4FVMA 2W41A 1SL1A 4CJTA 3WNEA 5C42A 1BO5O 2KZZA 3TAQA 5JMVA 4CZEA 4FM0A 4GNIA 3BEXA 4KHQA 4KH6A 5AFUH 1U2VB 3SUQA 2QEXN 3PO4A 4CBXA 3OBYA 4CJLA 5SZTA 4AHRA 5E84A 3MK6A 2JWLA 3SAHA 4LH4A 4U7BA 3OYHA 2E20A 3Q7BA 4IWVA 4JK7A 2BTFA 3NVKA 4FJ9A 3JXUA 4FL9A 2WTUA 3N4PA 1E3MA 1C0FA 4IBNA 2VGNA 3KHYA 2VQFK 3U3YA 4MQ3A 5DMRA 3O5BA 5AQKA 1CZ9A 2Y1JA 1CXUA 5EX5A 5CYMA 4Y1CA 3LPUA 4C23A 2D5RA 5BRDA 1OVQA 5AQSA 1Z26A 2HF3A 3NH0A 2YHWA 4CFDA 5FROA 1CZBA 4A5BA 3AVNA 4MO5A 4O8KA 3KVGA 1OH8A 1NOZA 2HBKA 5M1QA 1TYQA 3OJUA 4H8KA 1X9SA 3O6WA 4CJ4A 4FJNA 1HNIA 3AVCA 3CIPA 4E1NA 4CJKA 3HSTB 4CGDA 4CJWA 1NJYA 4FWRA 2P9UB 5CYQA 4B9TA 4E7KA 1HYZA 2D1KA 1XI1A 2IVPA 4CESA 2ZWHA 2NLXA 3NAEA 1NGJA 3LAKA 1EQYA 3NH2A 4CD1A 2H3GX 3MCAB 5ADXA 4BRDA 1B9FA 3LDPA 3LM2A 4J2DA 3L4IA 4FJ7A 4BG9A 4ELVA 3DAWA 3QFPA 2NRHA 1YVUA 4FYDA 4B1ZA 3EE8A 4FJKA 4DR2K 1NNEA 3NF6A 3B8AX 3QBWA 5HROA 2YHAA 4BR4A 4JKHA 4F2SA 3GBTA 3M8RA 4MLEA 4BDZA 1N6QA 4JKCA 3NE6A 4H5TA 1NBWA 1SAZA 4DQSA 4W5TA 3C6UA 2KKZA 3WT0A 1WLJA 1UA0A 2VGMA 1BCMA 4WFNL 3PV8A 4RWTA 3HRGA 4CZFA 3C7NB 4GW6A 1KFDA 3CFPA 1FW6A 4BRCA 4FCYA 4KHYA 5KTQA 3CC2N 3CC4N 4I2PA 2HVIA 2HNZA 4QS7A 5EXWA 2QWPA 4CGGA 1HNXK 3BF1A 4TSXA 1HX1A 2V51B 3O9UA 4X66K 3IRXA 4XH1A 5FRMA 3I8BA 2OCEA 3VQBA 4KB0A 1Y64A 5JVGL 1VSHA 4OO1J 2YNHA 3U3GA 3E66A 4E7IA 3AO5A 1TKTA 4E3SA 3CM5A 1ZXOA 3IG1A 1ZBLA 2E5LK 3OYCA 4HTUA 3AO3A 3L8BA 4C8NA 2XO7A 5A2QO 2AA4A 1BISA 1I39A 2HBMA 3ZT0A 4HUEA 3S3NA 5LJWA 3MEDA 1JCEA 3D2FB 3P1GA 3QMLA 2QM1A 4CFBA 1VQON 1M90O 3LP2A 2P9LA 4KI4A 1KAXA 1X9JA 3L2VA 1QTMA 1D5AA 2QW9A 4BRFA 4LF8K 3ZSVA 1ZYQA 2QA4N 4ID5A 3EZ5A 3RMDA 2HB5A 4AHCA 4YFUA 4B3SK 4KHSA 4DQ8A 4JAXA 5C2DA 3KK1A 4Z4GA 4K25A 2ZJQL 4EAHD 4FK4A 2NRVA 3THXB 1C0GA 4RCHA 3QBXA 3AARA 3ULDA 2O8DA 5AQVA 2QKKA 3U8XA 1ITGA 3KWIA 2JGUA 3FE1A 5LJVA 5C2FA 4E19A 4DUZK 4ILGB 3HTVA 1NGBA 3LDOA 1RFQA 3C94A 2WC9A 3FZKA 3ZLJA 3RSEA 2DFHA 5LMNK 2ETJA 2P5OA 4KHPK 3A0IX 3O9TA 1IKVA 4H0TB 4FSVA 2JWKA 1YXQA 2W6KA 3FZFA 4IZ9A 2OYQA 1MDUB 3P38A 3L3UA 1HKGA 3CCEN 4AM6A 2DFFA 4JK8A 5HRRA 4BRHA 4QCLA 1LW0A 4B1XB 5GAGP 4DCHA 3TAMA 3DXMA 5M1NA 3O4NA 2Q36A 2NRRA 1NK8A 3IAYA 1GLFO 3FR0A 3FZHA 4CJFA 3D45A 4FWKA 1RBRA 1JLCA 3G6EN 3WQUA 5HL7L 3WNGA 3OYJA 1YTAA 3O9RA 3KLHA 3M8SA 1RTHA 4H4MA 4A2AA 3E1YA 3IMXA 4B9SA 5AQJA 2F96A 1NG9A 5AQIA 3VPZA 2ITMA 3ZSYA 1KXPA 1C0TA 2O8FB 3GDQA 1BIUA 2DTUA 1ATNA 2Z1GA 1ZBUA 2BE2A 1KQSM 2IVNA 4O0JA 2YHYA 3VQPA 3DRSA 3NFAA 3SNNA 3DLGA 3HPOA 1QZ6A 4E89A 3ZEUA 3SUOA 4DFJA 4DR5K 1R59O 4KREA 4BR2A 5AQXA 4PKIA 1KLMA 5J2MA 4RTFD 4BRKA 3PUFA 2B5JA 4OKEA 3IKMA 4PKGA 3HBTA 4WQ4A 4DU1A 4F3OA 5AQYA 3M8QA 2ZJPL 3WXLA 3CCRN 4DLEA 2V7YA 4F4KA 2CGKA 2EWSA 4I7FA 4CEFA 1XC3A 1K8AO 3KD1E 4FOIA 3SPYA 1EX4A 1WSFA 1WSEA 3K5LA 2P9SB 4GY2B 4GKJK 5KPZA 2Q2RA 1LAVA 3LPTA 1LAWA 4EP5A 1SL0A 4DV7K 1X9MA 4K8XA 2VG6A 1RBVA 5GADP 2E2NA 4RW8A 3R3LA 1HNWK 4DR1K 2HHTA 5BN9A 1LWEA 3LL3A 1NK6A 2R7YA 5M1OA 4JKDA 5FPNA 3A8YA 2XY6A 4FWLA 3CQXA 4UQGA 4M45A 3BZCA 1SS6A 5EU7A 2HNYA 4JI5K 4HTLA 5H1SQ 3ZCMA 4BREA 5HLFA 4DTPA 4FXDA 1ASUA 4DSFA 1DTQA 2IAJA 3WEEA 3TU5A 3GL1A 2NRXA 3MCPA 1S72N 3QERA 1NGHA 1REVA 1VSIA 3EEQA 4A57A 3CD6N 4WCEL 1KAYA 3HPGA 5KQDA 4C8LA 1BQNA 1GLBG 2KW4A 4CEEA 2ZM6K 3VA3A 3SPZA 4DTUA 3WNFA 1XHXA 3KJVA 3SCXA 4FLVA 1SUQA 3OVNA 2FF3B 5AZIA 5T7BA 4Z0UA 3V4IA 4BQZA 3W3DA 3QEXA 4DV6K 2HF4A 4B08A 4FLZA 1EETA 1TGOA 1VSKA 4GV3A 4OKJA 3PSIA 3LZJA 3VENA 3CCSN 3SLCA 2PFUA 2G8IA 2Q31A 2V7ZA 4X65K 4JHDB 5E26A 2Y1IA 5JLHA 5AQGA 3UE5A 5AJ3K 1TK8A 4DR4K 3SUNA 3HOSA 3O08A 3ZSQA 3JYTA 3MXJA 1JXEA 1N5YA 1NGFA 3KWGA 4O55A 2HSTA 3ENOA 3B6OA 4EIAA 3TABA 4M3UA 5BREA 1RGIA 3OBWA 4H4OA 4LF9K 1IBMK 4BWJA 4FWQA 3D2EA 3DXKA 1LWFA 3A5NC 3V9ZA 3MECA 3OTOK 3P31A 4I2QA 1BCOA 1J53A 1Z25A 2YJFA 3VEYA 4ZTFA 4BR0A 3RR8A 3KKSA 3VN5A 4CZJA 2O8BB 4DF4A 3V1QA 3U9DA 1L5UA 3ZSOA 3PIPL 4CZHA 5DM7L 4CVNE 4Y1DA 3LWLA 4O4GA 1B92A 4FZZA 3EKSA 2OANA 1NK0A 4CK3A 3S3MA 4I6MB 4IEEA 4B9MA 4CJQA 3NMUA 4B1YB 3CC7N 4DLGA 1RILA 2Q97A 1NGAA 1YUWA 1BU6O 4BRLA 1TK5A 4KO0A 3VQAA 3O3FA 3T3FA 3VEXA 4BRAA 4BRIA 3DLRA 4BC5A 2BANA 3OA9A 4HCCA 3PLAA 1S3XA 1BA0A 4ISEA 4CIEA 1QVGM 2DPNA 4IOXA 1YITN 4PKHA 4PHTX 1ZBIA 1BI4B 1U2VA 4CGJA 5LY3A 3RRGA 2PYLA 1RT5A 2NZTA 5J1EA 1ZBHA 1NGDA 2WBNA 3LDQA 4CF1A 5AQPA 5M1KA 1NJIO 1KFSA 2A5XA 4BRPA 3CI5A 3G0ZA 4DV4K 3BP8A 4BRGA 4HHTA 4B1UB 1TV6A 3V9XA 5D3GA 5AQRA 1RTDA 4FW2A 1HPMA 4A59A 2F8SA 3WUHA 1NWKA 2HHQA 4GMJB 3OW2M 3H1QA 1W97L 1GOAA 3K5OA 4A5AA 1TL1A 2F4VK 3K9KA 2NNWA 3VEVA 1HYSA 2QWLA 4DUYK 3KTQA 3CJBA 1VSMA 3OHRA 4BRQA 1HQUA 1VQLN 4IG3A 3ZX0A 3ZSXA 4JKGB 3SV4A 5AZJB 4CGHA 1JCFA 3UIQA 2P9UA 1OH5A 4ZTJA 4LFAK 3FZLA 4AILC 4E7JA 4FM1A 2G8VA 5IWAK 1C1CA 3QO9A 3DJCA 4DU4A 2P9PB 3AA3A 5F2RA 4DS4A 2OPRA 5EY4A 2Z1HA 5B8HA 4O8UA 4CZLA 1NGGA 4C8OA 4FLYA 3SQ0A 4H03B 2Q1NA 1DKGD 3TSPA 3HYFA 1FKPA 4DTRA 1K8KB 4CHQA 2HW3A 4FW1A 2A41A 1LV5A 1WB9A 2RPIA 4NLCA 3CJ1A 4LF4K 3VTIA 1XNQK 4ICLA 4FZXC 4O5FA 2WUSA 2X74A 1G15A 2IIRA 4JI8K 1TAUA 4K8ZA 4C1NI 1ILYA 1HJRA 1MWMA 4MDAA 2OZSA 4YOTA 3IDHA 5GIOA 1DT9A 3TR8A 1JCGA 4OPHA 2V52B 1T8EA 1NGCA 4JI1K 3CF5L 3C7NA 2I7PA 1BHLA 1WOQA 2A6AA 2X6NA 1JL1A 1NOYA 1NU0A 3MMVA 4CZKA 1VQKN 3LDNA 4EZ6A 4H0XB 4X62K 2YKNA 3CETA 4IXCA 3CFRA 3C6TA 1SL2A 4ISFA 5JS2A 3J7AP 4DQIA 3N4QA 4CGFA 1RDBA 5AR0A 4AHSA 2FSJA 4CIFA 4XEIA 3F73A 1JLBA 4HUFA 1K73O 4DF8A 4Q0BA 4KAZA 3TANA 5M1FA 1BIZA 3H3NO 3TWHA 3ZSZA 2G8FA 4DV0K 3T1AA 4ID1A 2XRIA 4R5PA 3CJAA 1WSIA 4CCHA 4LF6K 4GKKK 3MDQA 5BRFA 1L3UA 5AFUA 5JS1A 3AO4A 2D0PA 3O1WA 4OVLA 2GUPA 3LP1A 1S1XA 4RW6A 4KH4A 3SBGA 4JYAK 3AVIA 4CEBA 4Z4FA 1WN7A 3D2FA 1JLGA 4FLWA 4CHOA 3OS2A 3BGRA 1BOTO 2QI2A 1T44A 3U6FA 4EHTA 2D0CA 4DSIA 3PX6A 1YTUA 1NKCA 4FWSA 3NHGA 1NKEA 4FJLA 4LH5A 4GVEA 1NGEA 3EN9A 3L3VA 4ELTA 5KRSA 4DTJA 2D0AA 1Z05A 4ZHRA 2F9TA 4FJ8A 3VF4A 3THXA 1YJWN 5FPMA 3E9PA 5BPLA 4DG1A 3F9MA 1UOCA 3UKUB 1HR0K 3SUPA 4IEIA 3VQ7A 2OTLN 4YDUA 2UUAK 4CEOA 3ATUA 4RW9A 3HM8A 3ZT1A 3VQ5A 4DSKA 4WQ4C 2UUCK 3OYAA 2UXDK 1QHAA 2KLAA 1IKXA 3VGKA 1VQ6N 2Z1IA 4CK1A 4CJRA 1VQ8N 3D6RA 5BPMA 2X6SA 1VAZA 3TAPA 1JL2A 4OPJA 2OTJN 1GOBA 2QXFA 4OJRA 3K0SA 4N5SA 3E01A 1U6ZA 3RMCA 2F7TA 3SQ1A 1RNHA 4M3ZA 1HLUA 3CCJN 1YJ9N 2QXLA 4WFAL 4AF1A 3S3OA 3J80O 3CJ9A 4W5OA 2KQ2A 4N47A 1J5EK 1QHTA 3VQ8A 4CK2A 4BG8A 1K6YA 1D9FA 4BGBA 1Y97A 1BG3A 3TI0A 3VESA 4YORA 1P90A 2A40A 3WXJA 3ISNC 2YJEA 4FPBA 2YNIA 3T69A 3ZX3A 2ASOA 4KV8A 3DWLA 4LFCK 3KLGA 3MXMA 5HOOA 2A1RA 3UKRB 3VA0A 4E1MA 4DV5K 4KH5A 1JJ2M 4IDKA 4QS8A 1IKYA 4IG0A 2GBZA 2B6AA 4H5RA 3SQ2A 4K0KK 2X78A 2O8FA 4YY3K 2W6LA 1VSLA 5HRSA 3KLIA 2W42A 3AVJA 3DLLL 3RMBA 5HRPA 3O1BA 5EOYA 2E8AA 2YI1A 1O1WA 3AV9A 3I8DA 3BZKA 4DV3K 2VG5A 3OS1A 4M41A 4IOCL 2ZGZA 3CERA 4DFKA 3NCIA 3AO2A 4BC4A 1ATSA 3QEPA 5HBMA 5SWMA 4LSNA 5AQOA 3J81O 3D7EO 3L4QA 1KC8O 4BACA 3K59A 1Z6RA 3L0QA 4KTWA 3T7ZA 4JI3K 3TAEA 3PSFA 4FOEA 3NBPA 2E6MA 3QDKA 2P9NB 3HO1A 4PQUA 1G99A 3HP9A 3SYZA 4ISGA 4B9UA 3G4SN 1WUAA 2P51A 4KFBA 4O44A 4NCAA 2G8KA 3OY9A 1RBSA 2P9SA 4BY9C 1EKEA 3TAGA 3V9WA 3I56N 1JXBA 4DQRA 4CHPA 3UB5A 2UYTA 4NYNA 3HXMA 1X9WA 3LWMA 5JVHL 1TVRA 1S1TA 3DOLA 3DI6A 5MLCQ 2O4IA 1EXQA 3KK3A 1BWFO 2O8EB 3MXIA 2UUBK 1BUPA 5BN8A 3HZ6A 1N34K 3AVBA 4YOVA 3TTFA 3ENHA 1QQCA 1WAJA 3L2UA 2W40A 1KVCA 3QINA 2DFEA 5J2QA 4EFHA 3K57A 1QE1A 4OGEA 5ELZA 4LF5K 4FJGA 1GLCG 3JSMA 5C25A 1BQMA 3QNOA 1NKBA 2PZSA 1E4GT 3TTCA 3TTDA 2ZQBA 3LANA 4NCBA 5GAHP 2D0BA 3QESA 3C65A 1C1BA 4CJ7A 4DQPA 3PO5A 4BR7A 2GWKA
chains in the Genus database with same CATH topology
2E5LK 4JI5K 4JI0K 1IBLK 4LF7K 2VQEK 5A2QO 1IBKK 4DV3K 4JV5K 4B3RK 4AQYK 1I94K 4LF4K 2UXCK 1XNQK 4YHHK 4JI8K 2ZM6K 5LMUK 1HR0K 1N33K 3J81O 4DR7K 4DV2K 4JI2K 4JI3K 2UUAK 5BR8K 4X64K 4JI1K 1N32K 3T1HK 4DR6K 4DV6K 4B3MK 1XNRK 4LF8K 2UUCK 4DV1K 4JI6K 4LFBK 4NXMK 2UXDK 4DR2K 4X62K 4X65K 4B3SK 4V19S 3J7AP 5AJ3K 4DR5K 4DV4K 3J7YP 1XMQK 4DR4K 4JI4K 4NXNK 3JAMO 3J80O 1J5EK 3T1YK 5FLXO 2UUBK 4OX9K 4DUZK 4LF9K 1IBMK 4DV0K 1N34K 4LF6K 2F4VK 4GKKK 3OTOK 4DUYK 5LMNK 2HHHK 4KHPK 1HNXK 1N36K 4LF5K 4DR3K 2VQFK 4GKJK 4B3TK 4JI7K 4X66K 2UXBK 4JYAK 4CVNE 4DV7K 4LFCK 4CW7B 1HNZK 4LFAK 1HNWK 4DV5K 4DR1K 5IWAK 5LL6Z 5IT9O 4K0KK 2UU9K 4YY3K 1XMOK 1FJGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L K;  4JI5 K;  4JI0 K;  1IBL K;  4LF7 K;  2VQE K;  5A2Q O;  1IBK K;  4DV3 K;  4JV5 K;  4B3R K;  4AQY K;  1I94 K;  4LF4 K;  2UXC K;  1XNQ K;  4YHH K;  4JI8 K;  2ZM6 K;  5LMU K;  1HR0 K;  1N33 K;  3J81 O;  4DR7 K;  4DV2 K;  4JI2 K;  4JI3 K;  2UUA K;  5BR8 K;  4X64 K;  4JI1 K;  1N32 K;  3T1H K;  4DR6 K;  4DV6 K;  4B3M K;  1XNR K;  4LF8 K;  2UUC K;  4DV1 K;  4JI6 K;  4LFB K;  4NXM K;  2UXD K;  4DR2 K;  4X62 K;  4X65 K;  4B3S K;  4V19 S;  3J7A P;  5AJ3 K;  4DR5 K;  4DV4 K;  3J7Y P;  1XMQ K;  4DR4 K;  4JI4 K;  4NXN K;  3JAM O;  3J80 O;  1J5E K;  3T1Y K;  5FLX O;  2UUB K;  4OX9 K;  4DUZ K;  4LF9 K;  1IBM K;  4DV0 K;  1N34 K;  4LF6 K;  2F4V K;  4GKK K;  3OTO K;  4DUY K;  5LMN K;  2HHH K;  4KHP K;  1HNX K;  1N36 K;  4LF5 K;  4DR3 K;  2VQF K;  4GKJ K;  4B3T K;  4JI7 K;  4X66 K;  2UXB K;  4JYA K;  4CVN E;  4DV7 K;  4LFC K;  4CW7 B;  1HNZ K;  4LFA K;  1HNW K;  4DV5 K;  4DR1 K;  5IWA K;  5LL6 Z;  5IT9 O;  4K0K K;  2UU9 K;  4YY3 K;  1XMO K;  1FJG K; 
#chains in the Genus database with same CATH topology
 4DHY A;  5BPN A;  5HRN A;  3ZSW A;  4RW4 A;  4K42 A;  4CZI A;  1U04 A;  4DTX A;  4EHU A;  3KLF A;  4JHD A;  3DRR A;  1TL3 A;  3MN6 A;  4N41 A;  1J54 A;  4BGA A;  4YNQ A;  4G9Z A;  4B3R K;  4BE2 A;  2O4G A;  1V4T A;  2QWR A;  4HVJ A;  4B8A B;  3QEW A;  2YCH A;  1T03 A;  4CBU A;  1QQN A;  1Q9Y A;  4CHZ A;  2FLO A;  4FK2 A;  3CCU N;  3SMP A;  1HJO A;  4DR7 K;  3VET A;  4XH5 A;  2Q0U A;  5BR9 A;  1M1K O;  1ZBF A;  4X64 K;  4O0I A;  1N32 K;  4JD2 B;  3VMF B;  4IDH A;  3CQY A;  4B3M K;  4CGI A;  5TKW A;  3THY B;  3V9U A;  2ASM A;  1T7P A;  4FJI A;  3M6G A;  3SK3 A;  2O8C B;  3AA5 X;  3C95 A;  2NRW A;  3AVA A;  4KBO A;  4IKF A;  2QWM A;  3NGZ A;  2E2P A;  3MN9 A;  4DSJ A;  1LCU A;  3R8E A;  5C0Y A;  4AHV A;  2P9I B;  4I6M A;  2IDO A;  4I9Q A;  3CCQ N;  2YX6 A;  3WXI A;  3MEE A;  4A61 A;  4IFY A;  3V6D A;  4KRF A;  2ZJR L;  3QFU A;  2HVH A;  3KZB A;  3BF3 A;  3OYF A;  3QET A;  3HVT A;  4B9L A;  4B9N A;  4GVM A;  1LW2 A;  2GWJ A;  4QAG A;  3O4W A;  2Q0R A;  4FWP A;  3DLK A;  2HHH K;  1TUY A;  2E1Y A;  4CZM A;  5J2P A;  4DR3 K;  4DTO A;  5K14 A;  1H1V A;  2ZGY A;  4NYF A;  3ZX2 A;  3HM9 A;  2CH5 A;  1IV0 A;  3L2Q A;  4CJ3 A;  4CW7 B;  3B6P A;  4PA1 A;  4FWN A;  4A62 A;  3Q7C A;  3HL8 A;  3V1O A;  3CCV N;  3K2P A;  2HHS A;  5FRN A;  4CEA A;  5IT9 O;  3OYK A;  3SJH A;  1BI4 A;  3D0P A;  1SKS A;  2UU9 K;  1VSJ A;  1QQM A;  3M5R A;  4CFC A;  4CJS A;  1UWB A;  2BH1 A;  3CJ7 A;  4R79 A;  1LOT B;  5DM6 L;  3P39 A;  4CBW A;  4KHU A;  3RTV A;  3PX0 A;  4EZ9 A;  2A1S A;  5C12 A;  4FLT A;  1GLL O;  1HKB A;  2VCP A;  1FXX A;  3I33 A;  1W2B M;  2GV9 A;  5JLF A;  3HSC A;  3OS0 A;  1GLD G;  3DRP A;  2KTQ A;  4B9V A;  4XIU A;  3P83 D;  1JLA A;  4DTS A;  1NJX A;  2P9K B;  4UY8 O;  3T19 A;  3NF8 A;  1YAG A;  3HOT A;  3K5M A;  4M3X A;  1S1U A;  3OYD A;  3T1H K;  4QOZ B;  2RKI A;  3GE1 A;  1FKO A;  4F9O A;  2QWO A;  5AQU A;  3CCL N;  4NXM K;  3MN5 A;  4LC9 B;  1VRU A;  3OYM A;  3KK7 A;  3CMA N;  1QVF M;  1VRT A;  5AQM A;  3RMA A;  4Q5V A;  3NF9 A;  4CEZ A;  4BRO A;  4CHN A;  4M3T A;  2WON A;  4QS9 A;  3VQE A;  3J7Y P;  4JKG A;  3VGL A;  4WE1 A;  5AZJ A;  4OLA A;  4KHW A;  2HHW A;  3E9L A;  4JI4 K;  4DS5 A;  3P4I A;  3R9P A;  2P9P A;  3JAM O;  4W5Q A;  2E2O A;  4CER A;  1RT6 A;  3T1Y K;  4FJM A;  4H5N A;  1KSP A;  3NGI A;  4WYB A;  1JLE A;  1YI2 N;  1RCH A;  3SAG A;  1VQP N;  3WXK A;  5JIC A;  5M1P A;  2XHB A;  1K8K A;  3RR7 A;  3HVR A;  1BDG A;  2GEL A;  4Y0W A;  4CE9 A;  3O80 A;  3KK2 A;  1VSE A;  1N36 K;  4BE0 A;  2CH6 A;  3EE9 A;  4B3T K;  2E2Q A;  3AVH A;  4JI7 K;  3ULE B;  4B1W B;  3K9J A;  5F0X A;  1HNZ K;  1L3V A;  1K9M O;  4DB3 A;  4YOW A;  1RDD A;  2G8U A;  3QIO A;  1YIJ N;  3HK2 A;  2GTD A;  4BE1 A;  4F2R A;  1Q9X A;  3H3O B;  3DLH A;  4MO4 A;  3ID6 A;  1RT4 A;  4Z4E A;  4DKW A;  3OYG A;  4IO9 L;  4N76 A;  3AVF A;  4YDU C;  1NK4 A;  3FLC O;  3OYN A;  1XUP O;  2DY4 A;  1W9H A;  2HBL A;  1NJZ A;  4JV5 K;  3QB0 A;  3HT3 A;  2Q3S A;  3VEO A;  1VQM N;  2NRT A;  5ADX H;  2KZM A;  4AM7 A;  5F1X A;  1KAZ A;  4E7L A;  1D4X A;  3FFK B;  1C0U A;  1XHZ A;  3WNH A;  4IJA A;  2YV0 X;  4WQ5 A;  1CZA N;  5CZ2 A;  3V1R A;  3KD5 E;  4CF9 A;  4JKA A;  3O9S A;  4CF8 A;  2HOE A;  3CHW A;  4C8K A;  3ENB A;  4M3Y A;  4LFB K;  4A2B A;  3ZET B;  4YOY A;  3AA4 A;  4BVP A;  1VHX A;  3LDS A;  2ITG A;  1MU2 A;  4FO0 A;  4M3W A;  4NB4 A;  3AVG A;  5FDL A;  3H08 A;  1I3A A;  3LP3 A;  1TAQ A;  3FFI A;  3AGR A;  1P8Z A;  1X1P A;  1WSJ A;  4FLX A;  3DMJ A;  1IJJ A;  4NXN K;  4DU3 A;  4BWM A;  5GAE P;  3H6E A;  1KVB A;  3TAF A;  2YKM A;  3ZT3 A;  4CEC A;  1X3N A;  4BRM A;  2P5G A;  4DTM A;  3THW B;  4WF9 L;  3AVK A;  3ATV A;  3J7Z O;  4U67 L;  4CIG A;  3MX5 A;  3IFR A;  4OKK A;  2HMP A;  3A5L C;  1Q8I A;  4FM2 A;  4JKE A;  1VSD A;  4ILJ A;  2NRZ A;  5I9E B;  3MAQ A;  3WQT A;  3UKU A;  4EP4 A;  4PL7 A;  1D9D A;  1DTT A;  1EWQ A;  2QKB A;  3H46 O;  3CFO A;  2IOC A;  4H0P A;  2VG7 A;  1SV5 A;  1SKR A;  1VSF A;  1OVY A;  4Z4I A;  5FPE A;  3JS6 A;  5CZ1 A;  1TKX A;  1FJG K;  1RT3 A;  3NF7 A;  2Z1J A;  1TKD A;  1RT1 A;  2QWQ A;  1DEJ A;  2CGJ A;  2E1Z A;  1HKC A;  2CGL A;  2VQE K;  1Q18 A;  4H0Y B;  3TSQ A;  2KFZ A;  4L8R B;  3MN7 A;  2PYJ A;  4HWI A;  4K43 A;  2I7N A;  3QNN A;  2GUI A;  3R6M A;  3WXM B;  5HP1 A;  1MA9 B;  4LY7 A;  2FBX A;  5KPR A;  3KKR A;  4IO8 A;  1BA1 A;  5AQT A;  4MDB A;  1RT7 A;  3VQQ A;  1Q81 O;  3O9Q A;  1VQ7 N;  2HHX A;  1WSG A;  1TYQ B;  1QSY A;  4KB1 A;  4PY5 A;  4DMN A;  3PIO L;  2FSK A;  3SJJ A;  3VQ9 A;  4H5V A;  3QLH A;  2XY8 A;  5J2N A;  2FBV A;  4CFA A;  3EYZ A;  3UKR A;  4N56 A;  3L2R A;  2VYP A;  3AAQ A;  4FJ5 A;  4JS4 A;  1L3T A;  1GOC A;  3VOV A;  5FLX O;  4DTN A;  4OX9 K;  3C6H A;  2YHB A;  3EKU A;  4FWO A;  4BDY A;  4F3T A;  4E7H A;  3QIC A;  3OYL A;  2VWB A;  4NCG A;  2FC0 A;  2YHX A;  4BC3 A;  5GIP A;  3MWP A;  3BY5 A;  4J2B A;  5CHI A;  5AQF A;  4JLH A;  5GIN A;  4CI6 A;  4RW7 A;  2LSN A;  3TSU A;  3VGM A;  1GLA G;  4OGC A;  1J5O A;  2D4W A;  1NK5 A;  1W0H A;  1VQ4 N;  3OJS A;  1HRH A;  1Q7Y O;  3HPH A;  3NGY A;  3ZT2 A;  3O3G A;  2QWN A;  1QS4 A;  3THV A;  4FVU A;  4BRN A;  3U4L A;  3ZT4 A;  1XMO K;  1QQO A;  2P9N A;  1ZC6 A;  3DYA A;  2PY5 A;  2HBJ A;  3IS9 A;  1L3S A;  4PL8 A;  1VQN N;  3LAL A;  4LF7 K;  4CJE A;  1A5X A;  3VF2 A;  3AY9 A;  4WFB L;  1VQ9 N;  3BDP A;  2OPQ A;  3RVC A;  4BR5 A;  1NM1 A;  3AAP A;  4AQY K;  1WBB A;  4YOU A;  3VQ4 A;  4IFE A;  1TK0 A;  1IH7 A;  4GV9 A;  3FGU A;  1S1W A;  1U4B A;  4IJN A;  5LMU K;  2IS3 A;  1HMV A;  1S1V A;  4O5B A;  1S9G A;  5KGW A;  2GX9 A;  3SQ4 A;  2NUB A;  4K41 A;  2O8E A;  4H5W A;  5BR8 K;  3G25 A;  3J8A A;  2QTD A;  1WNS A;  4OPA A;  1ATR A;  1RDU A;  1YHQ N;  1SQK A;  1YVN A;  3VEZ A;  3DLB A;  4G1Q A;  3LDL A;  3MWT A;  1V4S A;  1U45 A;  1SZ2 A;  1J9A A;  2F9W A;  4W5N A;  1EWR A;  1S5J A;  1T05 A;  3CQ8 A;  4FJH A;  4CJU A;  1XMQ K;  3ALY A;  4JK9 A;  3V81 A;  1RT2 A;  2IC3 A;  2RE2 A;  2J4R A;  4XH4 A;  3AA2 A;  1CLQ A;  1VK0 A;  1CXQ A;  2P9L B;  3F9K A;  3AVL A;  3ITH A;  3MX2 A;  1W7A A;  3O3H A;  1B9D A;  3PX4 A;  2WOM A;  5AQN A;  3EO3 A;  4C8M A;  4B3O A;  3LM9 A;  3QEI A;  5CE3 A;  3A5M C;  4OLB A;  4ILH A;  4CHY A;  3O4Q A;  1KCF A;  1RTI A;  3V9S A;  4FZY A;  3DLE A;  1RDC A;  1HNV A;  4KI6 A;  3C0B A;  2UXB K;  1NJW A;  2E6L A;  1JKH A;  3ID8 A;  3OYB A;  1OKJ A;  3OYI A;  3SI6 A;  3LZI A;  2O8D B;  3M1F A;  2HHU A;  3SZ2 A;  4CJ5 A;  3K58 A;  1KTQ A;  4C1N K;  4BDP A;  3VF6 A;  1S22 A;  3DOK A;  4JD2 A;  1DLO A;  2RHK A;  3LAM A;  3LP0 A;  4M42 A;  2EHG A;  2YNF A;  4JI0 K;  3S9H A;  5FPD A;  3RSE B;  3CYM A;  4LSL A;  4W5R A;  3BUZ B;  2AJQ A;  3THY A;  4CJP A;  3NH1 A;  2O8C A;  1IBK K;  2RN2 A;  4JNE A;  2BDP A;  5CR4 A;  3CXC M;  2UXC K;  5KGX A;  1C1A A;  3S41 A;  4DWI A;  1RDA A;  5KRT A;  4NLB A;  1NMD A;  1X3M A;  1NK9 A;  2P9I A;  1IG9 A;  2ZE2 A;  1WBD A;  3CG7 A;  1ASV A;  1HQE A;  4DV2 K;  1SKW A;  1HYV A;  4M7Y A;  3DXM B;  4AHT A;  4M7X A;  3KIO A;  4RG8 A;  5C24 A;  1NGI A;  1KD1 O;  4NO7 A;  4IFV A;  4HCB A;  4DV1 K;  2I5J A;  1FK9 A;  3L6Q A;  1A5V A;  1YF5 L;  3PY8 A;  3L2W A;  2BUP A;  2FXU A;  1T6D A;  3R1X A;  4HUG A;  2RF2 A;  2A42 A;  1N8R O;  5E41 A;  3CME N;  4CEQ A;  3TAR A;  4JEP A;  4B1V A;  4BQL A;  4DSL A;  4DFM A;  1MWK A;  1JLF A;  3VEW A;  3GOI A;  3K5N A;  1XC9 A;  4J8F A;  5AQQ A;  1UA1 A;  1F21 A;  4Z94 A;  4M3R A;  3I0R A;  2P1J A;  2FBT A;  1EP4 A;  2G8H A;  2G8W A;  2O8B A;  4DSE A;  1HUX A;  2B4J A;  2GEM A;  2A3Z A;  4PWD A;  3MEG A;  5TKY A;  1O13 A;  3CPW M;  2ASP A;  1BGX T;  3ZEU B;  2HMI A;  4BC2 A;  3QIP A;  2JLE A;  4OPK A;  5KQ8 A;  3CCM N;  4CJV A;  3ASM A;  5KPT A;  1IG8 A;  3HI0 A;  1JLQ A;  2KFN A;  3G71 N;  1QSL A;  3HJF A;  3ZSR A;  5LL6 Z;  1ZBS A;  2P9K A;  4M63 C;  1OH6 A;  1ASW A;  2BGG A;  5EVZ A;  3CPE A;  4FJJ A;  4WQ5 C;  2VWK A;  2AP1 A;  3AGK A;  4JKF A;  1OH7 A;  2D0O A;  4F8R A;  4FJX A;  5AQW A;  1RBT A;  2VWJ A;  4FPA A;  1RBU A;  2ZD1 A;  3F5T A;  3C6A A;  1J6Z A;  4KPY A;  3QEV A;  4B9Q A;  2IVO A;  4E0D A;  3IUC A;  1E4F T;  2OPP A;  4YHH K;  4CZG A;  4BVO A;  1RDW X;  3H1V X;  3NVM A;  4I9L A;  1N33 K;  3CM6 A;  1QSS A;  5KI6 A;  2E4L A;  4BR9 A;  3EY1 A;  4JI2 K;  1T6C A;  3AVM A;  4ELU A;  4YOX A;  5I42 A;  1BL3 A;  1U48 A;  3A2F A;  1R0A A;  4DR6 K;  4PUO A;  2XY5 A;  3RWU A;  3AO1 A;  4H0V B;  2ZF5 O;  4JI6 K;  2OZM A;  2OPS A;  1C0M A;  3H45 C;  2E88 A;  3EL2 A;  3SMS A;  2KHO A;  3HP6 A;  2PBD A;  1S9E A;  3WEE B;  1DGK N;  4KKO A;  4V19 S;  1C6V A;  5AQH A;  3ULE A;  1LWC A;  1GLJ O;  1NMN A;  2YNG A;  1S6Q A;  1VQ5 N;  1XWL A;  3ZYY X;  4AHU A;  4KTZ A;  5I3U A;  1RTJ A;  3P5J A;  4JN4 A;  3VQD A;  3M3Z A;  1GLE G;  1KLN A;  2FSN A;  1IO2 A;  3I0S A;  4FLU A;  1A5W A;  1T3V A;  2HND A;  2PAV A;  1NLV A;  3M8P A;  5BRH A;  4JRQ A;  5AZI B;  3SAF A;  4GV6 A;  4Z4C A;  3VER A;  1S6P A;  1IKW A;  4CF0 A;  4B8C A;  2IGI A;  4E1J A;  1U49 A;  3EZW A;  4Z4H A;  4CF2 A;  3F2K A;  2FF6 A;  2ATQ A;  4JS5 A;  3A5O C;  2XY7 A;  2QK9 A;  3NDK A;  5C10 A;  4JRP A;  1YT3 A;  4MFB A;  3SBT A;  4H0O A;  3G10 A;  3O8M A;  1NK7 A;  5CY4 A;  4DQQ A;  1UAX A;  1EO1 A;  2OA8 A;  2WFB A;  5DK5 A;  2HHV A;  3DM2 A;  1ESV A;  4DFP A;  3SV3 A;  3D2E B;  3DXK B;  1YJN N;  3E9O A;  4JKB A;  1IBL K;  1Q82 O;  4LD0 A;  3ZET A;  3I55 N;  4KHN A;  1Q86 O;  4AH9 A;  3CJC A;  4CED A;  4FK0 A;  3TPQ A;  2FBY A;  4L3Q A;  4MLH A;  4KTQ A;  3VQ6 A;  1I94 K;  4J2E A;  3KLE A;  4CD3 A;  1XQS C;  5AQZ A;  3VQC A;  4J2A A;  4FWM A;  3FZM A;  3RRH A;  1TUU A;  1QZ5 A;  3VTH A;  1WAF A;  4IOA L;  1KVA A;  2EX3 A;  5C15 A;  5AQL A;  1XNR K;  1D8Y A;  1HPZ A;  3U9Z A;  1KRP A;  2F8T A;  3THW A;  3W0L A;  1U47 A;  1TKZ A;  3OYE A;  1WSH A;  3GG4 A;  4FVM A;  2W41 A;  1SL1 A;  4CJT A;  3WNE A;  5C42 A;  1BO5 O;  2KZZ A;  3TAQ A;  5JMV A;  4CZE A;  4FM0 A;  4GNI A;  3BEX A;  4KHQ A;  4KH6 A;  5AFU H;  1U2V B;  3SUQ A;  2QEX N;  3PO4 A;  4CBX A;  3OBY A;  4CJL A;  5SZT A;  4AHR A;  5E84 A;  3MK6 A;  2JWL A;  3SAH A;  4LH4 A;  4U7B A;  3OYH A;  2E20 A;  3Q7B A;  4IWV A;  4JK7 A;  2BTF A;  3NVK A;  4FJ9 A;  3JXU A;  4FL9 A;  2WTU A;  3N4P A;  1E3M A;  1C0F A;  4IBN A;  2VGN A;  3KHY A;  2VQF K;  3U3Y A;  4MQ3 A;  5DMR A;  3O5B A;  5AQK A;  1CZ9 A;  2Y1J A;  1CXU A;  5EX5 A;  5CYM A;  4Y1C A;  3LPU A;  4C23 A;  2D5R A;  5BRD A;  1OVQ A;  5AQS A;  1Z26 A;  2HF3 A;  3NH0 A;  2YHW A;  4CFD A;  5FRO A;  1CZB A;  4A5B A;  3AVN A;  4MO5 A;  4O8K A;  3KVG A;  1OH8 A;  1NOZ A;  2HBK A;  5M1Q A;  1TYQ A;  3OJU A;  4H8K A;  1X9S A;  3O6W A;  4CJ4 A;  4FJN A;  1HNI A;  3AVC A;  3CIP A;  4E1N A;  4CJK A;  3HST B;  4CGD A;  4CJW A;  1NJY A;  4FWR A;  2P9U B;  5CYQ A;  4B9T A;  4E7K A;  1HYZ A;  2D1K A;  1XI1 A;  2IVP A;  4CES A;  2ZWH A;  2NLX A;  3NAE A;  1NGJ A;  3LAK A;  1EQY A;  3NH2 A;  4CD1 A;  2H3G X;  3MCA B;  5ADX A;  4BRD A;  1B9F A;  3LDP A;  3LM2 A;  4J2D A;  3L4I A;  4FJ7 A;  4BG9 A;  4ELV A;  3DAW A;  3QFP A;  2NRH A;  1YVU A;  4FYD A;  4B1Z A;  3EE8 A;  4FJK A;  4DR2 K;  1NNE A;  3NF6 A;  3B8A X;  3QBW A;  5HRO A;  2YHA A;  4BR4 A;  4JKH A;  4F2S A;  3GBT A;  3M8R A;  4MLE A;  4BDZ A;  1N6Q A;  4JKC A;  3NE6 A;  4H5T A;  1NBW A;  1SAZ A;  4DQS A;  4W5T A;  3C6U A;  2KKZ A;  3WT0 A;  1WLJ A;  1UA0 A;  2VGM A;  1BCM A;  4WFN L;  3PV8 A;  4RWT A;  3HRG A;  4CZF A;  3C7N B;  4GW6 A;  1KFD A;  3CFP A;  1FW6 A;  4BRC A;  4FCY A;  4KHY A;  5KTQ A;  3CC2 N;  3CC4 N;  4I2P A;  2HVI A;  2HNZ A;  4QS7 A;  5EXW A;  2QWP A;  4CGG A;  1HNX K;  3BF1 A;  4TSX A;  1HX1 A;  2V51 B;  3O9U A;  4X66 K;  3IRX A;  4XH1 A;  5FRM A;  3I8B A;  2OCE A;  3VQB A;  4KB0 A;  1Y64 A;  5JVG L;  1VSH A;  4OO1 J;  2YNH A;  3U3G A;  3E66 A;  4E7I A;  3AO5 A;  1TKT A;  4E3S A;  3CM5 A;  1ZXO A;  3IG1 A;  1ZBL A;  2E5L K;  3OYC A;  4HTU A;  3AO3 A;  3L8B A;  4C8N A;  2XO7 A;  5A2Q O;  2AA4 A;  1BIS A;  1I39 A;  2HBM A;  3ZT0 A;  4HUE A;  3S3N A;  5LJW A;  3MED A;  1JCE A;  3D2F B;  3P1G A;  3QML A;  2QM1 A;  4CFB A;  1VQO N;  1M90 O;  3LP2 A;  2P9L A;  4KI4 A;  1KAX A;  1X9J A;  3L2V A;  1QTM A;  1D5A A;  2QW9 A;  4BRF A;  4LF8 K;  3ZSV A;  1ZYQ A;  2QA4 N;  4ID5 A;  3EZ5 A;  3RMD A;  2HB5 A;  4AHC A;  4YFU A;  4B3S K;  4KHS A;  4DQ8 A;  4JAX A;  5C2D A;  3KK1 A;  4Z4G A;  4K25 A;  2ZJQ L;  4EAH D;  4FK4 A;  2NRV A;  3THX B;  1C0G A;  4RCH A;  3QBX A;  3AAR A;  3ULD A;  2O8D A;  5AQV A;  2QKK A;  3U8X A;  1ITG A;  3KWI A;  2JGU A;  3FE1 A;  5LJV A;  5C2F A;  4E19 A;  4DUZ K;  4ILG B;  3HTV A;  1NGB A;  3LDO A;  1RFQ A;  3C94 A;  2WC9 A;  3FZK A;  3ZLJ A;  3RSE A;  2DFH A;  5LMN K;  2ETJ A;  2P5O A;  4KHP K;  3A0I X;  3O9T A;  1IKV A;  4H0T B;  4FSV A;  2JWK A;  1YXQ A;  2W6K A;  3FZF A;  4IZ9 A;  2OYQ A;  1MDU B;  3P38 A;  3L3U A;  1HKG A;  3CCE N;  4AM6 A;  2DFF A;  4JK8 A;  5HRR A;  4BRH A;  4QCL A;  1LW0 A;  4B1X B;  5GAG P;  4DCH A;  3TAM A;  3DXM A;  5M1N A;  3O4N A;  2Q36 A;  2NRR A;  1NK8 A;  3IAY A;  1GLF O;  3FR0 A;  3FZH A;  4CJF A;  3D45 A;  4FWK A;  1RBR A;  1JLC A;  3G6E N;  3WQU A;  5HL7 L;  3WNG A;  3OYJ A;  1YTA A;  3O9R A;  3KLH A;  3M8S A;  1RTH A;  4H4M A;  4A2A A;  3E1Y A;  3IMX A;  4B9S A;  5AQJ A;  2F96 A;  1NG9 A;  5AQI A;  3VPZ A;  2ITM A;  3ZSY A;  1KXP A;  1C0T A;  2O8F B;  3GDQ A;  1BIU A;  2DTU A;  1ATN A;  2Z1G A;  1ZBU A;  2BE2 A;  1KQS M;  2IVN A;  4O0J A;  2YHY A;  3VQP A;  3DRS A;  3NFA A;  3SNN A;  3DLG A;  3HPO A;  1QZ6 A;  4E89 A;  3ZEU A;  3SUO A;  4DFJ A;  4DR5 K;  1R59 O;  4KRE A;  4BR2 A;  5AQX A;  4PKI A;  1KLM A;  5J2M A;  4RTF D;  4BRK A;  3PUF A;  2B5J A;  4OKE A;  3IKM A;  4PKG A;  3HBT A;  4WQ4 A;  4DU1 A;  4F3O A;  5AQY A;  3M8Q A;  2ZJP L;  3WXL A;  3CCR N;  4DLE A;  2V7Y A;  4F4K A;  2CGK A;  2EWS A;  4I7F A;  4CEF A;  1XC3 A;  1K8A O;  3KD1 E;  4FOI A;  3SPY A;  1EX4 A;  1WSF A;  1WSE A;  3K5L A;  2P9S B;  4GY2 B;  4GKJ K;  5KPZ A;  2Q2R A;  1LAV A;  3LPT A;  1LAW A;  4EP5 A;  1SL0 A;  4DV7 K;  1X9M A;  4K8X A;  2VG6 A;  1RBV A;  5GAD P;  2E2N A;  4RW8 A;  3R3L A;  1HNW K;  4DR1 K;  2HHT A;  5BN9 A;  1LWE A;  3LL3 A;  1NK6 A;  2R7Y A;  5M1O A;  4JKD A;  5FPN A;  3A8Y A;  2XY6 A;  4FWL A;  3CQX A;  4UQG A;  4M45 A;  3BZC A;  1SS6 A;  5EU7 A;  2HNY A;  4JI5 K;  4HTL A;  5H1S Q;  3ZCM A;  4BRE A;  5HLF A;  4DTP A;  4FXD A;  1ASU A;  4DSF A;  1DTQ A;  2IAJ A;  3WEE A;  3TU5 A;  3GL1 A;  2NRX A;  3MCP A;  1S72 N;  3QER A;  1NGH A;  1REV A;  1VSI A;  3EEQ A;  4A57 A;  3CD6 N;  4WCE L;  1KAY A;  3HPG A;  5KQD A;  4C8L A;  1BQN A;  1GLB G;  2KW4 A;  4CEE A;  2ZM6 K;  3VA3 A;  3SPZ A;  4DTU A;  3WNF A;  1XHX A;  3KJV A;  3SCX A;  4FLV A;  1SUQ A;  3OVN A;  2FF3 B;  5AZI A;  5T7B A;  4Z0U A;  3V4I A;  4BQZ A;  3W3D A;  3QEX A;  4DV6 K;  2HF4 A;  4B08 A;  4FLZ A;  1EET A;  1TGO A;  1VSK A;  4GV3 A;  4OKJ A;  3PSI A;  3LZJ A;  3VEN A;  3CCS N;  3SLC A;  2PFU A;  2G8I A;  2Q31 A;  2V7Z A;  4X65 K;  4JHD B;  5E26 A;  2Y1I A;  5JLH A;  5AQG A;  3UE5 A;  5AJ3 K;  1TK8 A;  4DR4 K;  3SUN A;  3HOS A;  3O08 A;  3ZSQ A;  3JYT A;  3MXJ A;  1JXE A;  1N5Y A;  1NGF A;  3KWG A;  4O55 A;  2HST A;  3ENO A;  3B6O A;  4EIA A;  3TAB A;  4M3U A;  5BRE A;  1RGI A;  3OBW A;  4H4O A;  4LF9 K;  1IBM K;  4BWJ A;  4FWQ A;  3D2E A;  3DXK A;  1LWF A;  3A5N C;  3V9Z A;  3MEC A;  3OTO K;  3P31 A;  4I2Q A;  1BCO A;  1J53 A;  1Z25 A;  2YJF A;  3VEY A;  4ZTF A;  4BR0 A;  3RR8 A;  3KKS A;  3VN5 A;  4CZJ A;  2O8B B;  4DF4 A;  3V1Q A;  3U9D A;  1L5U A;  3ZSO A;  3PIP L;  4CZH A;  5DM7 L;  4CVN E;  4Y1D A;  3LWL A;  4O4G A;  1B92 A;  4FZZ A;  3EKS A;  2OAN A;  1NK0 A;  4CK3 A;  3S3M A;  4I6M B;  4IEE A;  4B9M A;  4CJQ A;  3NMU A;  4B1Y B;  3CC7 N;  4DLG A;  1RIL A;  2Q97 A;  1NGA A;  1YUW A;  1BU6 O;  4BRL A;  1TK5 A;  4KO0 A;  3VQA A;  3O3F A;  3T3F A;  3VEX A;  4BRA A;  4BRI A;  3DLR A;  4BC5 A;  2BAN A;  3OA9 A;  4HCC A;  3PLA A;  1S3X A;  1BA0 A;  4ISE A;  4CIE A;  1QVG M;  2DPN A;  4IOX A;  1YIT N;  4PKH A;  4PHT X;  1ZBI A;  1BI4 B;  1U2V A;  4CGJ A;  5LY3 A;  3RRG A;  2PYL A;  1RT5 A;  2NZT A;  5J1E A;  1ZBH A;  1NGD A;  2WBN A;  3LDQ A;  4CF1 A;  5AQP A;  5M1K A;  1NJI O;  1KFS A;  2A5X A;  4BRP A;  3CI5 A;  3G0Z A;  4DV4 K;  3BP8 A;  4BRG A;  4HHT A;  4B1U B;  1TV6 A;  3V9X A;  5D3G A;  5AQR A;  1RTD A;  4FW2 A;  1HPM A;  4A59 A;  2F8S A;  3WUH A;  1NWK A;  2HHQ A;  4GMJ B;  3OW2 M;  3H1Q A;  1W97 L;  1GOA A;  3K5O A;  4A5A A;  1TL1 A;  2F4V K;  3K9K A;  2NNW A;  3VEV A;  1HYS A;  2QWL A;  4DUY K;  3KTQ A;  3CJB A;  1VSM A;  3OHR A;  4BRQ A;  1HQU A;  1VQL N;  4IG3 A;  3ZX0 A;  3ZSX A;  4JKG B;  3SV4 A;  5AZJ B;  4CGH A;  1JCF A;  3UIQ A;  2P9U A;  1OH5 A;  4ZTJ A;  4LFA K;  3FZL A;  4AIL C;  4E7J A;  4FM1 A;  2G8V A;  5IWA K;  1C1C A;  3QO9 A;  3DJC A;  4DU4 A;  2P9P B;  3AA3 A;  5F2R A;  4DS4 A;  2OPR A;  5EY4 A;  2Z1H A;  5B8H A;  4O8U A;  4CZL A;  1NGG A;  4C8O A;  4FLY A;  3SQ0 A;  4H03 B;  2Q1N A;  1DKG D;  3TSP A;  3HYF A;  1FKP A;  4DTR A;  1K8K B;  4CHQ A;  2HW3 A;  4FW1 A;  2A41 A;  1LV5 A;  1WB9 A;  2RPI A;  4NLC A;  3CJ1 A;  4LF4 K;  3VTI A;  1XNQ K;  4ICL A;  4FZX C;  4O5F A;  2WUS A;  2X74 A;  1G15 A;  2IIR A;  4JI8 K;  1TAU A;  4K8Z A;  4C1N I;  1ILY A;  1HJR A;  1MWM A;  4MDA A;  2OZS A;  4YOT A;  3IDH A;  5GIO A;  1DT9 A;  3TR8 A;  1JCG A;  4OPH A;  2V52 B;  1T8E A;  1NGC A;  4JI1 K;  3CF5 L;  3C7N A;  2I7P A;  1BHL A;  1WOQ A;  2A6A A;  2X6N A;  1JL1 A;  1NOY A;  1NU0 A;  3MMV A;  4CZK A;  1VQK N;  3LDN A;  4EZ6 A;  4H0X B;  4X62 K;  2YKN A;  3CET A;  4IXC A;  3CFR A;  3C6T A;  1SL2 A;  4ISF A;  5JS2 A;  3J7A P;  4DQI A;  3N4Q A;  4CGF A;  1RDB A;  5AR0 A;  4AHS A;  2FSJ A;  4CIF A;  4XEI A;  3F73 A;  1JLB A;  4HUF A;  1K73 O;  4DF8 A;  4Q0B A;  4KAZ A;  3TAN A;  5M1F A;  1BIZ A;  3H3N O;  3TWH A;  3ZSZ A;  2G8F A;  4DV0 K;  3T1A A;  4ID1 A;  2XRI A;  4R5P A;  3CJA A;  1WSI A;  4CCH A;  4LF6 K;  4GKK K;  3MDQ A;  5BRF A;  1L3U A;  5AFU A;  5JS1 A;  3AO4 A;  2D0P A;  3O1W A;  4OVL A;  2GUP A;  3LP1 A;  1S1X A;  4RW6 A;  4KH4 A;  3SBG A;  4JYA K;  3AVI A;  4CEB A;  4Z4F A;  1WN7 A;  3D2F A;  1JLG A;  4FLW A;  4CHO A;  3OS2 A;  3BGR A;  1BOT O;  2QI2 A;  1T44 A;  3U6F A;  4EHT A;  2D0C A;  4DSI A;  3PX6 A;  1YTU A;  1NKC A;  4FWS A;  3NHG A;  1NKE A;  4FJL A;  4LH5 A;  4GVE A;  1NGE A;  3EN9 A;  3L3V A;  4ELT A;  5KRS A;  4DTJ A;  2D0A A;  1Z05 A;  4ZHR A;  2F9T A;  4FJ8 A;  3VF4 A;  3THX A;  1YJW N;  5FPM A;  3E9P A;  5BPL A;  4DG1 A;  3F9M A;  1UOC A;  3UKU B;  1HR0 K;  3SUP A;  4IEI A;  3VQ7 A;  2OTL N;  4YDU A;  2UUA K;  4CEO A;  3ATU A;  4RW9 A;  3HM8 A;  3ZT1 A;  3VQ5 A;  4DSK A;  4WQ4 C;  2UUC K;  3OYA A;  2UXD K;  1QHA A;  2KLA A;  1IKX A;  3VGK A;  1VQ6 N;  2Z1I A;  4CK1 A;  4CJR A;  1VQ8 N;  3D6R A;  5BPM A;  2X6S A;  1VAZ A;  3TAP A;  1JL2 A;  4OPJ A;  2OTJ N;  1GOB A;  2QXF A;  4OJR A;  3K0S A;  4N5S A;  3E01 A;  1U6Z A;  3RMC A;  2F7T A;  3SQ1 A;  1RNH A;  4M3Z A;  1HLU A;  3CCJ N;  1YJ9 N;  2QXL A;  4WFA L;  4AF1 A;  3S3O A;  3J80 O;  3CJ9 A;  4W5O A;  2KQ2 A;  4N47 A;  1J5E K;  1QHT A;  3VQ8 A;  4CK2 A;  4BG8 A;  1K6Y A;  1D9F A;  4BGB A;  1Y97 A;  1BG3 A;  3TI0 A;  3VES A;  4YOR A;  1P90 A;  2A40 A;  3WXJ A;  3ISN C;  2YJE A;  4FPB A;  2YNI A;  3T69 A;  3ZX3 A;  2ASO A;  4KV8 A;  3DWL A;  4LFC K;  3KLG A;  3MXM A;  5HOO A;  2A1R A;  3UKR B;  3VA0 A;  4E1M A;  4DV5 K;  4KH5 A;  1JJ2 M;  4IDK A;  4QS8 A;  1IKY A;  4IG0 A;  2GBZ A;  2B6A A;  4H5R A;  3SQ2 A;  4K0K K;  2X78 A;  2O8F A;  4YY3 K;  2W6L A;  1VSL A;  5HRS A;  3KLI A;  2W42 A;  3AVJ A;  3DLL L;  3RMB A;  5HRP A;  3O1B A;  5EOY A;  2E8A A;  2YI1 A;  1O1W A;  3AV9 A;  3I8D A;  3BZK A;  4DV3 K;  2VG5 A;  3OS1 A;  4M41 A;  4IOC L;  2ZGZ A;  3CER A;  4DFK A;  3NCI A;  3AO2 A;  4BC4 A;  1ATS A;  3QEP A;  5HBM A;  5SWM A;  4LSN A;  5AQO A;  3J81 O;  3D7E O;  3L4Q A;  1KC8 O;  4BAC A;  3K59 A;  1Z6R A;  3L0Q A;  4KTW A;  3T7Z A;  4JI3 K;  3TAE A;  3PSF A;  4FOE A;  3NBP A;  2E6M A;  3QDK A;  2P9N B;  3HO1 A;  4PQU A;  1G99 A;  3HP9 A;  3SYZ A;  4ISG A;  4B9U A;  3G4S N;  1WUA A;  2P51 A;  4KFB A;  4O44 A;  4NCA A;  2G8K A;  3OY9 A;  1RBS A;  2P9S A;  4BY9 C;  1EKE A;  3TAG A;  3V9W A;  3I56 N;  1JXB A;  4DQR A;  4CHP A;  3UB5 A;  2UYT A;  4NYN A;  3HXM A;  1X9W A;  3LWM A;  5JVH L;  1TVR A;  1S1T A;  3DOL A;  3DI6 A;  5MLC Q;  2O4I A;  1EXQ A;  3KK3 A;  1BWF O;  2O8E B;  3MXI A;  2UUB K;  1BUP A;  5BN8 A;  3HZ6 A;  1N34 K;  3AVB A;  4YOV A;  3TTF A;  3ENH A;  1QQC A;  1WAJ A;  3L2U A;  2W40 A;  1KVC A;  3QIN A;  2DFE A;  5J2Q A;  4EFH A;  3K57 A;  1QE1 A;  4OGE A;  5ELZ A;  4LF5 K;  4FJG A;  1GLC G;  3JSM A;  5C25 A;  1BQM A;  3QNO A;  1NKB A;  2PZS A;  1E4G T;  3TTC A;  3TTD A;  2ZQB A;  3LAN A;  4NCB A;  5GAH P;  2D0B A;  3QES A;  3C65 A;  1C1B A;  4CJ7 A;  4DQP A;  3PO5 A;  4BR7 A;  2GWK A; 
#chains in the Genus database with same CATH homology
 2E5L K;  4JI5 K;  4JI0 K;  1IBL K;  4LF7 K;  2VQE K;  5A2Q O;  1IBK K;  4DV3 K;  4JV5 K;  4B3R K;  4AQY K;  1I94 K;  4LF4 K;  2UXC K;  1XNQ K;  4YHH K;  4JI8 K;  2ZM6 K;  5LMU K;  1HR0 K;  1N33 K;  3J81 O;  4DR7 K;  4DV2 K;  4JI2 K;  4JI3 K;  2UUA K;  5BR8 K;  4X64 K;  4JI1 K;  1N32 K;  3T1H K;  4DR6 K;  4DV6 K;  4B3M K;  1XNR K;  4LF8 K;  2UUC K;  4DV1 K;  4JI6 K;  4LFB K;  4NXM K;  2UXD K;  4DR2 K;  4X62 K;  4X65 K;  4B3S K;  4V19 S;  3J7A P;  5AJ3 K;  4DR5 K;  4DV4 K;  3J7Y P;  1XMQ K;  4DR4 K;  4JI4 K;  4NXN K;  3JAM O;  3J80 O;  1J5E K;  3T1Y K;  5FLX O;  2UUB K;  4OX9 K;  4DUZ K;  4LF9 K;  1IBM K;  4DV0 K;  1N34 K;  4LF6 K;  2F4V K;  4GKK K;  3OTO K;  4DUY K;  5LMN K;  2HHH K;  4KHP K;  1HNX K;  1N36 K;  4LF5 K;  4DR3 K;  2VQF K;  4GKJ K;  4B3T K;  4JI7 K;  4X66 K;  2UXB K;  4JYA K;  4CVN E;  4DV7 K;  4LFC K;  4CW7 B;  1HNZ K;  4LFA K;  1HNW K;  4DV5 K;  4DR1 K;  5IWA K;  5LL6 Z;  5IT9 O;  4K0K K;  2UU9 K;  4YY3 K;  1XMO K;  1FJG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...