2F4VK

30s ribosome + designer antibiotic
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 23
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2f4vK00
4X65K 4JYAK 1IBLK 5FLXO 2UXCK 2VQFK 4DUYK 4DUZK 2UUCK 1HR0K 4DV2K 1N36K 4DV1K 4DR5K 2VQEK 3T1HK 2UU9K 4X66K 4JV5K 4LF8K 5IWAK 1IBKK 4JI8K 4CVNE 3J7YP 4JI3K 4B3RK 2HHHK 4DV4K 1I94K 1IBMK 2F4VK 5AJ3K 1N34K 5LL6Z 4K0KK 1FJGK 2ZM6K 3J7AP 4CW7B 4LF7K 4DV7K 4JI4K 1N32K 1N33K 5LMNK 4DV5K 3J81O 4X64K 1XMOK 4JI1K 4GKKK 4LF5K 3T1YK 1HNWK 2UUBK 4X62K 4GKJK 4DR4K 4LFCK 4DR3K 4B3SK 1HNZK 4JI0K 4LF6K 2UUAK 4KHPK 4DR2K 4B3TK 5IT9O 4DR6K 1XNQK 4DR7K 1XNRK 4DV0K 2E5LK 4DV3K 4YHHK 1HNXK 2UXBK 4DV6K 1XMQK 4LFAK 4NXMK 5BR8K 5A2QO 4JI6K 3J80O 4NXNK 4OX9K 4LF4K 2UXDK 5LMUK 4JI7K 4JI5K 4AQYK 4YY3K 4JI2K 4DR1K 4B3MK 4LF9K 4LFBK 3OTOK 4V19S 1J5EK 3JAMO
chains in the Genus database with same CATH superfamily
4CF2A 3IAYA 3VQAA 4CEZA 2YI1A 4B8AB 3CJCA 3K9JA 4N56A 4B9VA 2YHAA 4DCHA 4DTUA 4U67L 3G71N 1RT3A 3O08A 1IH7A 3SMPA 2B4JA 3MN5A 3G0ZA 3THXA 4HCBA 4EIAA 4MQ3A 1OKJA 4IBNA 3RMBA 5B8HA 3DXKA 1LW2A 3IMXA 2HW3A 3K0SA 1A5XA 3QBXA 2G8IA 3LANA 1NK8A 1VSIA 3MMVA 1VSDA 3E9OA 4M3YA 3KD1E 1SL1A 1LWEA 4OJRA 1RT6A 3BUZB 4A61A 2P9SB 4Z4IA 2O8DA 1Q9XA 3QESA 4BDYA 3TABA 4DFKA 1WB9A 1VAZA 4OPHA 2QXFA 4KHYA 4GNIA 1XNQK 4PHTX 1DGKN 5AQIA 4H0PA 4HUFA 4H5RA 2B5JA 5AZIB 3LZIA 4LY7A 2VCPA 1HNXK 4BRFA 4YOXA 1C1BA 4BR4A 1SL0A 1S5JA 3ZSQA 3CETA 1ATRA 4QCLA 3Q7CA 3TI0A 3FZLA 2FSNA 3CFOA 1NKBA 2FF3B 3LAKA 1L3SA 2E6MA 1K8AO 4LD0A 3TSQA 2P9UA 4E7HA 3WUHA 5SZTA 1T03A 1LWFA 1Q18A 1UA0A 1EWQA 4HUGA 2JWKA 3J7ZO 3L2VA 3ATUA 3DRSA 3FFKB 3KZBA 3F73A 4AHVA 3HZ6A 3AVGA 4HTUA 5C42A 5JS1A 4CD1A 4CHNA 1NJXA 3LM9A 4M3WA 1VSFA 4ILGB 5CYQA 4QS8A 2I5JA 2Q36A 3AARA 4DR5K 4JV5K 4AHUA 4IZ9A 3VETA 2PYJA 3PX6A 2YNFA 4CCHA 2NRRA 4DF4A 5GIPA 4OGCA 5CZ1A 1Q82O 3AGRA 2HHHK 3H6EA 4CZEA 1IBMK 1HKGA 3VTHA 2JLEA 2BDPA 4FZXC 4BC3A 2XY8A 3DM2A 3CPWM 1D8YA 4B9MA 1QSLA 4FWSA 4B1VA 4AF1A 1TUYA 1EO1A 3PO5A 1KD1O 4JKFA 1MU2A 1WBBA 4B9NA 1CZBA 3P4IA 3O5BA 1QVFM 2GELA 3CCQN 2FBTA 3HPGA 3NGYA 3ULEB 3O80A 4OVLA 3KK7A 2XY6A 3AY9A 3NF6A 4LF6K 3OS2A 1LWCA 2A40A 4LH5A 4BWMA 1NK6A 5D3GA 1YHQN 1SQKA 4FO0A 3AO1A 1UWBA 4H5NA 4BRAA 4RTFD 3SUQA 5AQPA 4K8XA 1TUUA 3U3GA 3LZJA 2YV0X 3D0PA 3DXMB 3MCAB 4W5TA 2P9NA 1KAYA 2HBLA 3OYFA 3AGKA 4NXMK 1WSHA 2GBZA 3L3VA 1HLUA 2GUIA 2HBKA 5C25A 1CZAN 3QIOA 4W5RA 3I8BA 3KLFA 4YORA 1X9MA 1TKZA 5K14A 5BPLA 2KHOA 4Z4FA 4RWTA 2VG7A 1QE1A 4FWQA 4H4MA 5I3UA 3FGUA 3ZSVA 1S1WA 1FXXA 3LDQA 4E1NA 3HM9A 3C6TA 3KTQA 2G8WA 3WEEB 1BO5O 3VQDA 4CHYA 4E7LA 1X9WA 4CZGA 2P5GA 1WAJA 3AO3A 3TWHA 1ZBLA 1G15A 1HJRA 1XUPO 2E20A 2HHQA 3O4WA 3NVKA 2FSKA 3IUCA 3CFRA 3GOIA 3O1WA 3WXLA 2G8KA 2DFFA 1VQMN 1ILYA 1EQYA 3DLGA 4CHPA 1RT5A 4ISFA 4BR0A 1JLFA 3PIOL 1NM1A 4JAXA 4EZ6A 1Q86O 5FPMA 4JLHA 3VF2A 3LP3A 3JXUA 4Q0BA 1YT3A 2R7YA 5AZJA 3S3OA 4FK4A 2F4VK 3RSEA 1VSHA 2IGIA 1CLQA 4K42A 2HOEA 2YJFA 3ENBA 3KIOA 4TSXA 1C6VA 4MLEA 2E2NA 4E1MA 1HPMA 5GAGP 3TAQA 5JVHL 2PY5A 4DU4A 1IV0A 5F2RA 4YOVA 2QWOA 2VWKA 4Z4GA 5HRNA 3ZX0A 1QZ5A 3ID8A 4EAHD 4DHYA 3CFPA 2HHWA 2W42A 3CYMA 4I2QA 4DTSA 2HF3A 2RPIA 2DY4A 4CZHA 4BY9C 1IO2A 2A41A 1K9MO 4M45A 1KTQA 1KVAA 2KFNA 3MX5A 2O8FB 4NYFA 2YCHA 2ITGA 3U8XA 3OYCA 1KFSA 3A5NC 4FJKA 3NF8A 2A1RA 4LFAK 1NKEA 4GVEA 4BVOA 3AVAA 3QERA 1NK4A 4CBWA 1TGOA 1JKHA 4BQZA 2UXDK 2GWJA 4CJUA 4NCAA 1UA1A 2ETJA 4Y1CA 4B3OA 5AQQA 2HVHA 1W2BM 4KI6A 5AQVA 3QETA 3OHRA 3TSUA 1QTMA 4I6MA 5M1QA 1W97L 3L2WA 3SAGA 3KLIA 1DEJA 4FLXA 3THWB 4YOWA 3K9KA 3CHWA 5I9EB 4BVPA 4GMJB 1NMDA 5M1OA 3MXMA 3EYZA 3K57A 5JICA 1RTHA 2D0CA 5AQTA 4FLZA 4CJEA 4KHSA 3O4QA 2OPSA 4CJVA 3M8RA 1VSLA 1EX4A 2P9IB 1QZ6A 3BDPA 4I2PA 1NGFA 3ALYA 2RHKA 4ZTFA 3ZX2A 3AA3A 3EE9A 4EHTA 1XC9A 4FPAA 1U04A 1EWRA 3TAMA 2NRHA 1U6ZA 2BH1A 1NK5A 3LWLA 2HNZA 2P9PA 3K59A 3OYMA 3M3ZA 5AQMA 1IKWA 3A2FA 4JHDA 3MDQA 3TTDA 2NLXA 3EZWA 4H0TB 3C65A 3CC7N 3EO3A 5KQDA 3SQ0A 3MECA 2JWLA 3RR7A 2OA8A 2HB5A 3QFUA 4IEEA 2YJEA 4KTQA 1VSEA 1VQ5N 3U9ZA 3UE5A 5DM6L 1M1KO 4CIEA 3L2UA 4FM0A 2WC9A 4CHQA 4PY5A 1RT4A 3KLHA 3KK1A 1NK9A 1TV6A 1JLBA 4KHUA 4DSLA 4C8LA 4CEOA 4YOTA 3KLEA 1HKBA 4FWMA 1GLFO 5BR8K 4F3OA 4M3TA 4B9SA 3F9MA 4H4OA 4PL8A 1YIJN 4DQIA 1TYQB 1NGIA 4E3SA 3LP2A 4DFMA 3OYDA 1YXQA 5CYMA 3CMEN 2ZGZA 4BDPA 4B8CA 3H1VX 4J2EA 4E89A 5EY4A 4JI2K 2ZJQL 1LAWA 1Y64A 2V51B 1JLCA 4AHRA 2WONA 3SV3A 3SV4A 1REVA 4KTZA 1IG8A 3PO4A 4GW6A 3WQTA 3UKRA 4FJHA 4FSVA 2O4IA 4X65K 1SKWA 2Y1IA 4CK2A 3GBTA 4WQ5C 3SCXA 5J2MA 4YNQA 4EZ9A 1NBWA 3AVKA 3VN5A 4LH4A 3SLCA 1HKCA 1SAZA 3DI6A 3L6QA 4WFBL 2VWJA 3NVMA 4E7IA 4WE1A 3CF5L 2ZE2A 1N5YA 4C8KA 4KRFA 5GINA 4R79A 2EX3A 4ILHA 3ZX3A 3HVTA 5IWAK 2O4GA 3S3NA 3F5TA 1WLJA 3TAFA 4BACA 4FZYA 2GUPA 4KHWA 1ZC6A 1HYZA 4FJ8A 3OVNA 3OJSA 5ADXA 1K73O 1QSSA 4WFNL 1FJGK 3N4PA 1B9DA 1JLAA 1NLVA 4LSLA 4BR9A 1BDGA 4YDUA 4HVJA 4KHQA 2QWMA 2YNHA 3OA9A 2A3ZA 2XY7A 3OYEA 3H3NO 5CR4A 4O0IA 1J6ZA 5BN8A 4FL9A 1E3MA 4BRMA 1MWMA 3QICA 1ASUA 4CJ3A 4AILC 3SQ4A 2Q1NA 3UKUA 3O8MA 1K6YA 4JS4A 1RILA 2EWSA 2P9LA 5HRSA 4CEBA 2QKBA 3R9PA 1BA0A 2FBVA 2AJQA 1NGCA 2D4WA 2YX6A 2VG5A 3A5MC 4CGFA 2WOMA 1BISA 4KB0A 3HP6A 1LV5A 1UAXA 1VSMA 4BQLA 2PFUA 4KH6A 2KLAA 3NF7A 5M1PA 3VQ7A 4EHUA 3WNHA 4JI7K 4A57A 1Z6RA 1MWKA 4JI5K 3ZT0A 4KH5A 1Q81O 4DQQA 1X1PA 4BGBA 4LF9K 4JD2A 1YITN 3I33A 2NRZA 2CGKA 3E1YA 3M8QA 4CE9A 1U2VB 4C8OA 3OYNA 2DTUA 1VQLN 1CZ9A 3DWLA 2P9KB 2KKZA 4JYAK 4F2SA 1W0HA 3FR0A 3SAFA 4NCBA 5KGWA 1XHXA 2PAVA 1SL2A 4PL7A 4FK2A 1TVRA 4DTNA 4MFBA 1XQSC 2W6KA 3VENA 5HL7L 1WNSA 1C0MA 1VQ8N 2OCEA 4E7JA 1I3AA 1ZBSA 2GV9A 2HHTA 1W9HA 4C23A 1GLAG 1HX1A 1WN7A 4E1JA 4W5OA 3DJCA 4CJQA 4UY8O 4B1WB 4LF7K 1NJWA 4B9TA 1K8KB 4IDKA 5KI6A 1TAUA 4CJLA 2GX9A 3O9UA 4JKBA 5E84A 4LF5K 2QI2A 4CZFA 3IG1A 4X62K 1QHAA 1RCHA 1QHTA 1T05A 3M6GA 2HHSA 5HRPA 2O8BB 3HP9A 4RW7A 4CFBA 4FJGA 1YAGA 4CF9A 1ZBIA 4FW2A 1G99A 2RKIA 3THYA 1NGBA 5C2FA 3O3GA 1NGGA 4NLBA 1LOTB 3P1GA 1HPZA 5GAEP 1U47A 4ELVA 2HBMA 3UIQA 1S1TA 2YHBA 2G8FA 3CMAN 1VQ4N 3T19A 3J80O 1WSGA 4NXNK 3ZT1A 1WSJA 3DXKB 2VGMA 1YTAA 3ZLJA 2HVIA 3EEQA 4YY3K 3V9WA 4JK8A 3R3LA 4FXDA 4L8RB 4FWNA 1JXBA 3QDKA 3D45A 4QS9A 3VF4A 5FPDA 1VQPN 1EETA 3ZSOA 1T3VA 3H1QA 1RTDA 4IO8A 3GL1A 1NGEA 4DFPA 5AQNA 5AR0A 2IC3A 3HT3A 3UB5A 5FLXO 3KD5E 5EXWA 3VESA 1IG9A 3C6UA 1ATNA 2E2QA 3OS0A 1ASWA 2UUCK 4M42A 4CI6A 1N36K 1DKGD 5EU7A 1BG3A 3LDSA 3ZYYX 1RT7A 5M1KA 5GIOA 4CVNE 3V1RA 1P90A 3LPTA 4FYDA 4PKIA 4FLTA 3M5RA 3LDPA 4BRKA 4BE2A 4JKCA 2D0OA 3B6OA 3PX4A 1ZBHA 1WAFA 5HROA 1SV5A 2ASOA 2DFEA 2VWBA 1HUXA 1BIUA 3DOLA 3K58A 4BRDA 5BRFA 1OVYA 3VGLA 5LJWA 4KPYA 1HNIA 1GOBA 4CEDA 4JI4K 4M3RA 3VA0A 4H0YB 2X78A 3TAPA 2E1YA 2ATQA 4CECA 4BE0A 4DQRA 4C1NI 1BI4B 2UUAK 4DR2K 4DSEA 2BTFA 1U49A 1J53A 1YJWN 5C0YA 3V1QA 4I7FA 4YHHK 3OYAA 1NOYA 4HHTA 4J8FA 4OGEA 3D6RA 5AQFA 4CZJA 4H0VB 1S6PA 2OYQA 4DV6K 2NRXA 4AHSA 4UQGA 2HMIA 3TARA 3L3UA 3BF3A 4WF9L 1NGAA 1KXPA 3DXMA 3FZFA 4LF4K 3O3FA 2A6AA 2IS3A 4XH1A 2KQ2A 3NH1A 4NO7A 3HBTA 3RWUA 1VQ7N 1RNHA 3S41A 4V19S 1IKVA 3NCIA 2IVNA 3NE6A 2OPRA 4N5SA 3ZSRA 4MO4A 3CC4N 3VQCA 1YVUA 5AQLA 4BC2A 3V4IA 2FC0A 4IEIA 2QK9A 4DSFA 3WEEA 4DV2K 2Q0RA 3T1HK 4A2AA 3NAEA 1JLGA 2XRIA 2YHYA 1NWKA 2P51A 4WQ4C 3HTVA 3BF1A 3VQEA 2A1SA 4A5BA 3I56N 2D5RA 1I94K 3QO9A 3P39A 3VQ9A 4FOEA 1T6CA 1LAVA 3ZSYA 3H08A 1RBVA 4JEPA 3SUNA 4DU1A 3LDOA 1VQKN 2HMPA 1BQNA 4NLCA 1QVGM 2FBYA 4IFYA 1NK0A 3WXIA 5AQUA 5BRHA 3NMUA 5TKYA 3J81O 1BUPA 4H0XB 1NOZA 4GKKK 1L3TA 2IVOA 1VQ9N 3L2QA 1KQSM 1HQEA 3SBTA 4XH4A 2CGLA 1R0AA 3AVCA 5IT9O 4DR6K 3RMCA 3V9UA 1XWLA 2QWLA 4CFCA 3I0RA 4CBUA 1BQMA 4CJFA 5J2NA 1T8EA 1ZBFA 5DMRA 5DM7L 4IFEA 5AQZA 3U3YA 4KAZA 1L3VA 3OYIA 2HHXA 2O8FA 4FWOA 3CJBA 3JSMA 4K43A 1BWFO 3VGMA 4CJ5A 1Z25A 2QWNA 2HBJA 3CPEA 4KFBA 1TL3A 2OZMA 1Q7YO 1C1CA 4DF8A 1YJNN 4C8MA 4DSIA 1TAQA 3PLAA 4DR1K 3SMSA 4LFBK 4ISEA 2RN2A 5AQXA 4KH4A 1RFQA 1BIZA 2FLOA 4JRQA 3QMLA 4JK7A 1ATSA 3VF6A 3A5LC 4FZZA 1RTIA 3SUOA 1Q8IA 2F8TA 4Y0WA 4YOUA 3EN9A 3THWA 2HNYA 2QA4N 3HO1A 2OPPA 2YKNA 3PIPL 4X66K 4B1ZA 3CCMN 4FLUA 4J2AA 3FFIA 3GE1A 2D0PA 5EX5A 1IBKK 2YNGA 3RMAA 4FLYA 3O6WA 1BOTO 1RDUA 4Z4CA 1TKTA 5HRRA 3E9LA 3EY1A 3CQXA 4JRPA 4WFAL 4B9LA 1DT9A 1N34K 5LL6Z 5BPMA 4C1NK 3M1FA 2IOCA 4K0KK 4K8ZA 3V1OA 3V81A 3J7AP 1S9EA 2P1JA 5E41A 1HNVA 2F96A 3AA5X 3HL8A 4IG0A 1RT2A 2ASPA 4GKJK 4BRNA 3TSPA 1WOQA 3RRHA 3AVHA 3D2FB 3SPZA 3V9XA 3OY9A 4JI0K 1JLEA 3KJVA 1TL1A 2XO7A 4GV9A 4Z4EA 4DR7K 1RBTA 4BREA 4DV3K 2Z1JA 3H46O 2Q3SA 4XEIA 4CGJA 3TPQA 4MDAA 1XMQK 3LDNA 3HYFA 2OTLN 3VOVA 2RF2A 2ZWHA 4M3ZA 1GLDG 3VQ4A 1FW6A 1NJYA 3MEGA 1DTTA 5LMUK 1VSKA 4CJ7A 5M1FA 3QB0A 4B08A 1OH6A 4BC5A 3QNOA 4CZKA 4O55A 5CY4A 4F8RA 3I0SA 2W6LA 2YHWA 2NZTA 4L3QA 3LP1A 4AH9A 5J1EA 3KHYA 3AO5A 1KAXA 2BUPA 4KTWA 2QW9A 4JKGB 4DQSA 4DSJA 3E66A 4CGDA 3FLCO 5TKWA 3G10A 3O1BA 4JKDA 3DMJA 4DQ8A 1HR0K 2HNDA 4DSKA 4A62A 4WCEL 4JKHA 4O44A 1S1VA 3O9QA 4Z94A 3RTVA 1LCUA 4CJRA 2XHBA 3QEXA 3NDKA 4DWIA 3ENHA 4B9UA 1T7PA 1WSEA 1KC8O 4G9ZA 4LC9B 4FLVA 4RW9A 2P5OA 3LP0A 3CM6A 3AVNA 3T3FA 5LJVA 3EZ5A 4ID1A 4DLGA 1OVQA 1S1UA 1KFDA 1VQ6N 4E19A 2ZM6K 4CK3A 4BR7A 5FROA 1KLMA 4CERA 4NCGA 4BDZA 4ID5A 4GVMA 2I7PA 4FPBA 1RGIA 5AQWA 2KTQA 4KBOA 4OLBA 3P83D 3I55N 4RW8A 3GDQA 4H0OA 4M41A 1WSIA 3WQUA 3L4QA 1S6QA 4CJPA 1JL2A 4FJ9A 4ISGA 3SZ2A 3AA4A 3VGKA 1SKSA 2V52B 2GEMA 4YDUC 3WXKA 3DAWA 2VGNA 4IOCL 4CIFA 2AP1A 1FKPA 1VQON 2A5XA 4CJ4A 2F8SA 1KCFA 3U6FA 5F1XA 3QNNA 1JCGA 5AQKA 2CGJA 3CCSN 5HLFA 4BG8A 2QWRA 2UYTA 4I9LA 4B1UB 5AQYA 3DOKA 4DTXA 4ELTA 4JI6K 4BR5A 3HOSA 1TKXA 2Y1JA 4CEFA 4GV3A 2B6AA 4KREA 5CHIA 3AVJA 1N6QA 4H5TA 2FXUA 2IAJA 5LY3A 4J2DA 4CFDA 4CIGA 2O8EB 1KVBA 2OPQA 4IJNA 4FJJA 4M3UA 3CCLN 3FZHA 3C7NB 3OYHA 3S3MA 1BL3A 3L2RA 2E1ZA 1U2VA 3A8YA 3MCPA 5JLFA 4PKGA 3QLHA 3ZEUB 5CZ2A 1RT1A 2BE2A 3OYGA 2P9KA 3DLRA 2JGUA 4AM7A 4DV1K 1A5VA 2F9WA 1VSJA 4CJKA 4FM1A 1JJ2M 3KWGA 3Q7BA 1S9GA 1NJZA 4FJ7A 3UKUB 4M7YA 1L3UA 2QTDA 4MLHA 3EKUA 4DV4K 1SKRA 2G8UA 3OJUA 2O8CB 5KGXA 4CZIA 4DS5A 3BP8A 3AA2A 3SQ1A 4DV5K 4NB4A 3O9RA 2FF6A 3HSTB 3ZETB 1N8RO 1IKXA 5AQSA 1A5WA 1K8KA 4BR2A 4FW1A 3D2EB 1RDCA 1X9SA 4BG9A 4XIUA 3R8EA 4EP5A 3PX0A 2NRVA 3VPZA 3MK6A 3JS6A 2NUBA 1E4GT 2ZJPL 3FZMA 5C24A 3PV8A 3O9TA 5AFUA 3P31A 1X9JA 2YKMA 2WBNA 4CJSA 3CCJN 1S3XA 4E0DA 2BGGA 3HPHA 5A2QO 1VK0A 1W7AA 3VQQA 1D5AA 3LL3A 4DS4A 1BCMA 1GOCA 3O9SA 2P9SA 5AQOA 1RBSA 5GADP 5C15A 3FZKA 3QEWA 4AQYK 2PZSA 3W0LA 1Q9YA 3S9HA 3CJAA 1RDBA 4AM6A 3DLEA 1XHZA 4CBXA 5AZIA 1RBRA 2PBDA 3AVBA 1JCEA 4FJMA 3KKSA 3THXB 4LSNA 3BZKA 2IDOA 1QSYA 4OKJA 4CZMA 3WNEA 4H8KA 3J8AA 3MXIA 3ASMA 1BU6O 4A2BA 3VEWA 4H5WA 1F21A 2Z1GA 3CIPA 5C10A 2LSNA 1FK9A 4N76A 3J7YP 3AVMA 1WBDA 3MAQA 3L4IA 2CH5A 5KRTA 3THYB 4BE1A 3KKRA 3CD6N 3F9KA 3QEVA 3C6AA 2GTDA 2QWPA 3E01A 5AJ3K 5BR9A 4FJIA 4IXCA 4M63C 1KSPA 4YOYA 3MN6A 2KZMA 4KKOA 5KRSA 4IFVA 4CEEA 5J2QA 4KI4A 2O8DB 4CW7B 2W41A 4O8KA 2I7NA 3HXMA 2G8VA 3I8DA 4G1QA 3SAHA 3ZT3A 2VYPA 4B9QA 5KTQA 1U4BA 3F2KA 3C6HA 4DTMA 5HOOA 3SQ2A 1NG9A 4FJ5A 3PUFA 4A59A 4B3SK 1O1WA 3T7ZA 3BGRA 4H5VA 2KFZA 1C1AA 3MEDA 4B3TK 2Q0UA 2ZGYA 4OPJA 3TU5A 1X3MA 1M90O 1RTJA 1BI4A 4RW4A 1C0UA 3AVFA 3KLGA 4BROA 3QEIA 3G4SN 3CXCM 2KZZA 3VEZA 1B9FA 2Q97A 4IWVA 2UXBK 5AQHA 3ZSZA 1D4XA 4BRQA 4BRPA 5JS2A 4CHOA 2P9UB 4J2BA 1QQCA 4MDBA 3K5MA 4DTRA 4W5QA 3RRGA 4CF8A 5HP1A 1HYVA 3OYBA 4JS5A 4IJAA 2V7ZA 3ULEA 3LM2A 4FWKA 3AAQA 3SK3A 3WNFA 4KHNA 5GAHP 3OTOK 2KW4A 1UOCA 3C0BA 5DK5A 1KAZA 3TTFA 4JK9A 3A0IX 5KPRA 3O3HA 3RR8A 3JAMO 5SWMA 3MXJA 3WNGA 2Q31A 3K2PA 4ZHRA 5C12A 1NK7A 1VRTA 2QXLA 2ZJRL 3SNNA 4DB3A 5J2PA 3ID6A 4K25A 3HM8A 4O5FA 1RDDA 3VA3A 3QBWA 1JCFA 1L5UA 4N47A 2HHVA 2Z1IA 4JI8K 4JI3K 3THVA 2X6SA 3LWMA 4B3RK 4DLEA 3WXJA 1CXUA 1V4TA 3MWTA 4HCCA 2ASMA 5KPZA 3CJ1A 3B6PA 1C0TA 3P5JA 4OKEA 2X6NA 3R1XA 1BA1A 3E9PA 1QQOA 5AQGA 4CF0A 1N33K 2RE2A 5HBMA 3DLKA 3HRGA 1HQUA 2UUBK 3VQBA 3JYTA 1YI2N 3B8AX 5FDLA 4BC4A 1HNZK 4B1YB 5ADXH 3VEXA 2V7YA 3G6EN 2YNIA 1J9AA 4KHPK 1ZXOA 5ELZA 1OH7A 3NBPA 3HOTA 4CD3A 3A5OC 4FCYA 1I39A 4DTJA 1XNRK 3MN9A 2P9NB 2E5LK 4CFAA 3CCEN 3HJFA 2OTJN 1IKYA 3AV9A 4WQ4A 1IJJA 1Z05A 1U48A 1CXQA 5M1NA 3C95A 4CHZA 4R5PA 1DTQA 5KPTA 2J4RA 1NJIO 4NYNA 5I42A 1SUQA 4OX9K 4K41A 1Y97A 4AHTA 3OYLA 1YUWA 4B3MK 2F9TA 1NGDA 1SS6A 1YTUA 4F3TA 4HUEA 4CEAA 5AQRA 3IFRA 1XI1A 1JXEA 4YFUA 4BRIA 4FLWA 1ZYQA 1YF5L 4OPAA 3AAPA 3NHGA 1IBLK 3L0QA 4ICLA 4BRLA 4CGIA 3FE1A 4PA1A 4CK1A 4DUZK 2E6LA 2E2PA 4DG1A 1GOAA 3R6MA 3VEYA 1J54A 2VQEK 2UU9K 3AO4A 3ITHA 3OBYA 3SBGA 2PYLA 3H45C 5AZJB 4IDHA 3RSEB 5AQJA 2DPNA 1S22A 4IOAL 3OYJA 3CERA 4N41A 3P38A 1XC3A 3RMDA 3O4NA 3G25A 3DLBA 3V9SA 4RCHA 2ZD1A 5BN9A 3CCVN 4ELUA 3CC2N 4BWJA 5FPNA 3HVRA 1MA9B 3VQ6A 2D0AA 4DV7K 2NRWA 3T1AA 3DRRA 3SI6A 1XMOK 2XY5A 4Q5VA 1B92A 3TTCA 2HF4A 4FM2A 1YJ9N 2QKKA 4CESA 2E2OA 1QQNA 3CQYA 4DR3K 4DTPA 1MDUB 4CGGA 4CEQA 4M3XA 2P9IA 1QQMA 4CF1A 4KO0A 3VEVA 3KWIA 3NH2A 3DLHA 4F2RA 2IIRA 3D2FA 2QEXN 3ULDA 3AO2A 4HTLA 5AFUH 1NGJA 2Z1HA 1WSFA 4IG3A 1GLJO 2QWQA 4H03B 3MWPA 1NNEA 5EVZA 1V4SA 1BHLA 1RDWX 2CH6A 2IVPA 3SJJA 3KVGA 1TK8A 1T6DA 4I6MB 3GG4A 1VQNN 3SYZA 4F9OA 4JNEA 2NRTA 3EE8A 1KRPA 3SUPA 2VG6A 4OPKA 2BANA 1RDAA 1J5EK 4GY2B 3V6DA 2EHGA 3VQ5A 2FBXA 3DYAA 3ZT4A 3D7EO 5FRMA 1TK0A 4EP4A 3IS9A 2ZQBA 2VQFK 4IKFA 1JLQA 2F7TA 5KQ8A 1GLEG 1Z26A 2QM1A 4JKGA 3T69A 4QOZB 4HWIA 1GLCG 1JL1A 3TR8A 3HI0A 1TYQA 4DQPA 2E88A 4PKHA 3PY8A 3TAEA 1YVNA 1DLOA 1TK5A 5EOYA 5JLHA 3VERA 3MEEA 4W5NA 4FJXA 4DFJA 3VMFB 1KVCA 4OLAA 1O13A 2P9PB 4M7XA 1KLNA 3MX2A 3NF9A 3PSIA 2E4LA 3OS1A 4JHDB 4IO9L 3VQPA 1ESVA 4BRHA 4FJNA 3PSFA 4E7KA 4DKWA 5F0XA 4OO1J 3LPUA 1N32K 3KK3A 4KV8A 4X64K 4JI1K 3T1YK 1X3NA 1D9DA 1U45A 3V9ZA 4DR4K 3N4QA 4LFCK 5BRDA 3ZSWA 4BGAA 1OH5A 2HHUA 4CZLA 1OH8A 3CM5A 3CJ7A 1TKDA 3KK2A 5FRNA 1RBUA 4O5BA 4FWLA 4QAGA 3ENOA 3H3OB 1EKEA 3U9DA 2OZSA 3TAGA 1E4FT 3QFPA 4AHCA 2ITMA 2WFBA 3NGZA 3ZT2A 4Z0UA 2FSJA 4OKKA 1C0GA 3L8BA 4XH5A 3LAMA 1EXQA 3HSCA 5E26A 3WXMB 5H1SQ 4KB1A 1GLLO 3SPYA 4CGHA 3BEXA 1NU0A 3WT0A 4WQ5A 3CCUN 1NGHA 1FKOA 4FK0A 3EKSA 3AVLA 5FPEA 3SJHA 3UKRB 2HSTA 4DMNA 3ZCMA 2DFHA 1C0FA 3RVCA 1HJOA 3LDLA 4JKAA 5BPNA 3DLLL 3OW2M 1BGXT 4I9QA 3M8PA 3CCRN 4ILJA 3ZSXA 1S1XA 1HNWK 4Y1DA 3OYKA 1WUAA 2O8EA 4RW6A 2WTUA 4JN4A 4FWPA 4ZTJA 2UXCK 2H3GX 3K5NA 3C7NA 4DUYK 3K5OA 3QINA 4BRCA 2AA4A 4F4KA 2NNWA 1D9FA 5CE3A 3CQ8A 5MLCQ 2G8HA 1NMNA 4LF8K 3ZEUA 4O0JA 5T7BA 4FJLA 1S72N 5JVGL 4JKEA 4DU3A 2X74A 3U4LA 3EL2A 4B1XB 1H1VA 1HYSA 1HRHA 3CI5A 1R59O 4FVUA 1LW0A 2W40A 3NH0A 1ASVA 1J5OA 1P8ZA 1T44A 1VHXA 3IRXA 1HMVA 1VRUA 4PWDA 5LMNK 2O8CA 3ATVA 2E8AA 4CJWA 3VEOA 3AVIA 3QIPA 4A5AA 4GV6A 4WYBA 5BREA 1SZ2A 3QEPA 5C2DA 2P9LB 3K5LA 2GWKA 3ISNC 1EP4A 3ZETA 3HK2A 2D1KA 4MO5A 1NKCA 3C94A 4C8NA 1BCOA 3VQ8A 1ITGA 1GLBG 2Q2RA 3D2EA 4DV0K 3IKMA 4FWRA 2WUSA 4EFHA 3OBWA 3BZCA 3CG7A 3BY5A 3MN7A 4FOIA 4O8UA 4U7BA 4DTOA 3NFAA 4BRGA 4CJTA 4O4GA 3NGIA 2OANA 4Z4HA 1QS4A 4JD2B 3HPOA 4RG8A 3VTIA 1ZBUA 3TANA 4QS7A 3DRPA 4PQUA 3IDHA 3M8SA 2A42A 3LALA 2O8BA 3W3DA 2ZF5O 2YHXA 2D0BA 4PUOA 4IOXA 4FVMA 5JMVA 3CJ9A
chains in the Genus database with same CATH topology
4X65K 4JYAK 1IBLK 5FLXO 2UXCK 2VQFK 4DUYK 4DUZK 2UUCK 1HR0K 4DV2K 1N36K 4DV1K 4DR5K 2VQEK 3T1HK 2UU9K 4X66K 4JV5K 4LF8K 5IWAK 1IBKK 4JI8K 4CVNE 3J7YP 4JI3K 4B3RK 2HHHK 4DV4K 1I94K 1IBMK 2F4VK 5AJ3K 1N34K 5LL6Z 4K0KK 1FJGK 2ZM6K 3J7AP 4CW7B 4LF7K 4DV7K 4JI4K 1N32K 1N33K 5LMNK 4DV5K 3J81O 4X64K 1XMOK 4JI1K 4GKKK 4LF5K 3T1YK 1HNWK 2UUBK 4X62K 4GKJK 4DR4K 4LFCK 4DR3K 4B3SK 1HNZK 4JI0K 4LF6K 2UUAK 4KHPK 4DR2K 4B3TK 5IT9O 4DR6K 1XNQK 4DR7K 1XNRK 4DV0K 2E5LK 4DV3K 4YHHK 1HNXK 2UXBK 4DV6K 1XMQK 4LFAK 4NXMK 5BR8K 5A2QO 4JI6K 3J80O 4NXNK 4OX9K 4LF4K 2UXDK 5LMUK 4JI7K 4JI5K 4AQYK 4YY3K 4JI2K 4DR1K 4B3MK 4LF9K 4LFBK 3OTOK 4V19S 1J5EK 3JAMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 K;  4JYA K;  1IBL K;  5FLX O;  2UXC K;  2VQF K;  4DUY K;  4DUZ K;  2UUC K;  1HR0 K;  4DV2 K;  1N36 K;  4DV1 K;  4DR5 K;  2VQE K;  3T1H K;  2UU9 K;  4X66 K;  4JV5 K;  4LF8 K;  5IWA K;  1IBK K;  4JI8 K;  4CVN E;  3J7Y P;  4JI3 K;  4B3R K;  2HHH K;  4DV4 K;  1I94 K;  1IBM K;  2F4V K;  5AJ3 K;  1N34 K;  5LL6 Z;  4K0K K;  1FJG K;  2ZM6 K;  3J7A P;  4CW7 B;  4LF7 K;  4DV7 K;  4JI4 K;  1N32 K;  1N33 K;  5LMN K;  4DV5 K;  3J81 O;  4X64 K;  1XMO K;  4JI1 K;  4GKK K;  4LF5 K;  3T1Y K;  1HNW K;  2UUB K;  4X62 K;  4GKJ K;  4DR4 K;  4LFC K;  4DR3 K;  4B3S K;  1HNZ K;  4JI0 K;  4LF6 K;  2UUA K;  4KHP K;  4DR2 K;  4B3T K;  5IT9 O;  4DR6 K;  1XNQ K;  4DR7 K;  1XNR K;  4DV0 K;  2E5L K;  4DV3 K;  4YHH K;  1HNX K;  2UXB K;  4DV6 K;  1XMQ K;  4LFA K;  4NXM K;  5BR8 K;  5A2Q O;  4JI6 K;  3J80 O;  4NXN K;  4OX9 K;  4LF4 K;  2UXD K;  5LMU K;  4JI7 K;  4JI5 K;  4AQY K;  4YY3 K;  4JI2 K;  4DR1 K;  4B3M K;  4LF9 K;  4LFB K;  3OTO K;  4V19 S;  1J5E K;  3JAM O; 
#chains in the Genus database with same CATH topology
 4CF2 A;  3IAY A;  3VQA A;  4CEZ A;  2YI1 A;  4B8A B;  3CJC A;  3K9J A;  4N56 A;  4B9V A;  2YHA A;  4DCH A;  4DTU A;  4U67 L;  3G71 N;  1RT3 A;  3O08 A;  1IH7 A;  3SMP A;  2B4J A;  3MN5 A;  3G0Z A;  3THX A;  4HCB A;  4EIA A;  4MQ3 A;  1OKJ A;  4IBN A;  3RMB A;  5B8H A;  3DXK A;  1LW2 A;  3IMX A;  2HW3 A;  3K0S A;  1A5X A;  3QBX A;  2G8I A;  3LAN A;  1NK8 A;  1VSI A;  3MMV A;  1VSD A;  3E9O A;  4M3Y A;  3KD1 E;  1SL1 A;  1LWE A;  4OJR A;  1RT6 A;  3BUZ B;  4A61 A;  2P9S B;  4Z4I A;  2O8D A;  1Q9X A;  3QES A;  4BDY A;  3TAB A;  4DFK A;  1WB9 A;  1VAZ A;  4OPH A;  2QXF A;  4KHY A;  4GNI A;  1XNQ K;  4PHT X;  1DGK N;  5AQI A;  4H0P A;  4HUF A;  4H5R A;  2B5J A;  5AZI B;  3LZI A;  4LY7 A;  2VCP A;  1HNX K;  4BRF A;  4YOX A;  1C1B A;  4BR4 A;  1SL0 A;  1S5J A;  3ZSQ A;  3CET A;  1ATR A;  4QCL A;  3Q7C A;  3TI0 A;  3FZL A;  2FSN A;  3CFO A;  1NKB A;  2FF3 B;  3LAK A;  1L3S A;  2E6M A;  1K8A O;  4LD0 A;  3TSQ A;  2P9U A;  4E7H A;  3WUH A;  5SZT A;  1T03 A;  1LWF A;  1Q18 A;  1UA0 A;  1EWQ A;  4HUG A;  2JWK A;  3J7Z O;  3L2V A;  3ATU A;  3DRS A;  3FFK B;  3KZB A;  3F73 A;  4AHV A;  3HZ6 A;  3AVG A;  4HTU A;  5C42 A;  5JS1 A;  4CD1 A;  4CHN A;  1NJX A;  3LM9 A;  4M3W A;  1VSF A;  4ILG B;  5CYQ A;  4QS8 A;  2I5J A;  2Q36 A;  3AAR A;  4DR5 K;  4JV5 K;  4AHU A;  4IZ9 A;  3VET A;  2PYJ A;  3PX6 A;  2YNF A;  4CCH A;  2NRR A;  4DF4 A;  5GIP A;  4OGC A;  5CZ1 A;  1Q82 O;  3AGR A;  2HHH K;  3H6E A;  4CZE A;  1IBM K;  1HKG A;  3VTH A;  2JLE A;  2BDP A;  4FZX C;  4BC3 A;  2XY8 A;  3DM2 A;  3CPW M;  1D8Y A;  4B9M A;  1QSL A;  4FWS A;  4B1V A;  4AF1 A;  1TUY A;  1EO1 A;  3PO5 A;  1KD1 O;  4JKF A;  1MU2 A;  1WBB A;  4B9N A;  1CZB A;  3P4I A;  3O5B A;  1QVF M;  2GEL A;  3CCQ N;  2FBT A;  3HPG A;  3NGY A;  3ULE B;  3O80 A;  4OVL A;  3KK7 A;  2XY6 A;  3AY9 A;  3NF6 A;  4LF6 K;  3OS2 A;  1LWC A;  2A40 A;  4LH5 A;  4BWM A;  1NK6 A;  5D3G A;  1YHQ N;  1SQK A;  4FO0 A;  3AO1 A;  1UWB A;  4H5N A;  4BRA A;  4RTF D;  3SUQ A;  5AQP A;  4K8X A;  1TUU A;  3U3G A;  3LZJ A;  2YV0 X;  3D0P A;  3DXM B;  3MCA B;  4W5T A;  2P9N A;  1KAY A;  2HBL A;  3OYF A;  3AGK A;  4NXM K;  1WSH A;  2GBZ A;  3L3V A;  1HLU A;  2GUI A;  2HBK A;  5C25 A;  1CZA N;  3QIO A;  4W5R A;  3I8B A;  3KLF A;  4YOR A;  1X9M A;  1TKZ A;  5K14 A;  5BPL A;  2KHO A;  4Z4F A;  4RWT A;  2VG7 A;  1QE1 A;  4FWQ A;  4H4M A;  5I3U A;  3FGU A;  3ZSV A;  1S1W A;  1FXX A;  3LDQ A;  4E1N A;  3HM9 A;  3C6T A;  3KTQ A;  2G8W A;  3WEE B;  1BO5 O;  3VQD A;  4CHY A;  4E7L A;  1X9W A;  4CZG A;  2P5G A;  1WAJ A;  3AO3 A;  3TWH A;  1ZBL A;  1G15 A;  1HJR A;  1XUP O;  2E20 A;  2HHQ A;  3O4W A;  3NVK A;  2FSK A;  3IUC A;  3CFR A;  3GOI A;  3O1W A;  3WXL A;  2G8K A;  2DFF A;  1VQM N;  1ILY A;  1EQY A;  3DLG A;  4CHP A;  1RT5 A;  4ISF A;  4BR0 A;  1JLF A;  3PIO L;  1NM1 A;  4JAX A;  4EZ6 A;  1Q86 O;  5FPM A;  4JLH A;  3VF2 A;  3LP3 A;  3JXU A;  4Q0B A;  1YT3 A;  2R7Y A;  5AZJ A;  3S3O A;  4FK4 A;  2F4V K;  3RSE A;  1VSH A;  2IGI A;  1CLQ A;  4K42 A;  2HOE A;  2YJF A;  3ENB A;  3KIO A;  4TSX A;  1C6V A;  4MLE A;  2E2N A;  4E1M A;  1HPM A;  5GAG P;  3TAQ A;  5JVH L;  2PY5 A;  4DU4 A;  1IV0 A;  5F2R A;  4YOV A;  2QWO A;  2VWK A;  4Z4G A;  5HRN A;  3ZX0 A;  1QZ5 A;  3ID8 A;  4EAH D;  4DHY A;  3CFP A;  2HHW A;  2W42 A;  3CYM A;  4I2Q A;  4DTS A;  2HF3 A;  2RPI A;  2DY4 A;  4CZH A;  4BY9 C;  1IO2 A;  2A41 A;  1K9M O;  4M45 A;  1KTQ A;  1KVA A;  2KFN A;  3MX5 A;  2O8F B;  4NYF A;  2YCH A;  2ITG A;  3U8X A;  3OYC A;  1KFS A;  3A5N C;  4FJK A;  3NF8 A;  2A1R A;  4LFA K;  1NKE A;  4GVE A;  4BVO A;  3AVA A;  3QER A;  1NK4 A;  4CBW A;  1TGO A;  1JKH A;  4BQZ A;  2UXD K;  2GWJ A;  4CJU A;  4NCA A;  1UA1 A;  2ETJ A;  4Y1C A;  4B3O A;  5AQQ A;  2HVH A;  1W2B M;  4KI6 A;  5AQV A;  3QET A;  3OHR A;  3TSU A;  1QTM A;  4I6M A;  5M1Q A;  1W97 L;  3L2W A;  3SAG A;  3KLI A;  1DEJ A;  4FLX A;  3THW B;  4YOW A;  3K9K A;  3CHW A;  5I9E B;  4BVP A;  4GMJ B;  1NMD A;  5M1O A;  3MXM A;  3EYZ A;  3K57 A;  5JIC A;  1RTH A;  2D0C A;  5AQT A;  4FLZ A;  4CJE A;  4KHS A;  3O4Q A;  2OPS A;  4CJV A;  3M8R A;  1VSL A;  1EX4 A;  2P9I B;  1QZ6 A;  3BDP A;  4I2P A;  1NGF A;  3ALY A;  2RHK A;  4ZTF A;  3ZX2 A;  3AA3 A;  3EE9 A;  4EHT A;  1XC9 A;  4FPA A;  1U04 A;  1EWR A;  3TAM A;  2NRH A;  1U6Z A;  2BH1 A;  1NK5 A;  3LWL A;  2HNZ A;  2P9P A;  3K59 A;  3OYM A;  3M3Z A;  5AQM A;  1IKW A;  3A2F A;  4JHD A;  3MDQ A;  3TTD A;  2NLX A;  3EZW A;  4H0T B;  3C65 A;  3CC7 N;  3EO3 A;  5KQD A;  3SQ0 A;  3MEC A;  2JWL A;  3RR7 A;  2OA8 A;  2HB5 A;  3QFU A;  4IEE A;  2YJE A;  4KTQ A;  1VSE A;  1VQ5 N;  3U9Z A;  3UE5 A;  5DM6 L;  1M1K O;  4CIE A;  3L2U A;  4FM0 A;  2WC9 A;  4CHQ A;  4PY5 A;  1RT4 A;  3KLH A;  3KK1 A;  1NK9 A;  1TV6 A;  1JLB A;  4KHU A;  4DSL A;  4C8L A;  4CEO A;  4YOT A;  3KLE A;  1HKB A;  4FWM A;  1GLF O;  5BR8 K;  4F3O A;  4M3T A;  4B9S A;  3F9M A;  4H4O A;  4PL8 A;  1YIJ N;  4DQI A;  1TYQ B;  1NGI A;  4E3S A;  3LP2 A;  4DFM A;  3OYD A;  1YXQ A;  5CYM A;  3CME N;  2ZGZ A;  4BDP A;  4B8C A;  3H1V X;  4J2E A;  4E89 A;  5EY4 A;  4JI2 K;  2ZJQ L;  1LAW A;  1Y64 A;  2V51 B;  1JLC A;  4AHR A;  2WON A;  3SV3 A;  3SV4 A;  1REV A;  4KTZ A;  1IG8 A;  3PO4 A;  4GW6 A;  3WQT A;  3UKR A;  4FJH A;  4FSV A;  2O4I A;  4X65 K;  1SKW A;  2Y1I A;  4CK2 A;  3GBT A;  4WQ5 C;  3SCX A;  5J2M A;  4YNQ A;  4EZ9 A;  1NBW A;  3AVK A;  3VN5 A;  4LH4 A;  3SLC A;  1HKC A;  1SAZ A;  3DI6 A;  3L6Q A;  4WFB L;  2VWJ A;  3NVM A;  4E7I A;  4WE1 A;  3CF5 L;  2ZE2 A;  1N5Y A;  4C8K A;  4KRF A;  5GIN A;  4R79 A;  2EX3 A;  4ILH A;  3ZX3 A;  3HVT A;  5IWA K;  2O4G A;  3S3N A;  3F5T A;  1WLJ A;  3TAF A;  4BAC A;  4FZY A;  2GUP A;  4KHW A;  1ZC6 A;  1HYZ A;  4FJ8 A;  3OVN A;  3OJS A;  5ADX A;  1K73 O;  1QSS A;  4WFN L;  1FJG K;  3N4P A;  1B9D A;  1JLA A;  1NLV A;  4LSL A;  4BR9 A;  1BDG A;  4YDU A;  4HVJ A;  4KHQ A;  2QWM A;  2YNH A;  3OA9 A;  2A3Z A;  2XY7 A;  3OYE A;  3H3N O;  5CR4 A;  4O0I A;  1J6Z A;  5BN8 A;  4FL9 A;  1E3M A;  4BRM A;  1MWM A;  3QIC A;  1ASU A;  4CJ3 A;  4AIL C;  3SQ4 A;  2Q1N A;  3UKU A;  3O8M A;  1K6Y A;  4JS4 A;  1RIL A;  2EWS A;  2P9L A;  5HRS A;  4CEB A;  2QKB A;  3R9P A;  1BA0 A;  2FBV A;  2AJQ A;  1NGC A;  2D4W A;  2YX6 A;  2VG5 A;  3A5M C;  4CGF A;  2WOM A;  1BIS A;  4KB0 A;  3HP6 A;  1LV5 A;  1UAX A;  1VSM A;  4BQL A;  2PFU A;  4KH6 A;  2KLA A;  3NF7 A;  5M1P A;  3VQ7 A;  4EHU A;  3WNH A;  4JI7 K;  4A57 A;  1Z6R A;  1MWK A;  4JI5 K;  3ZT0 A;  4KH5 A;  1Q81 O;  4DQQ A;  1X1P A;  4BGB A;  4LF9 K;  4JD2 A;  1YIT N;  3I33 A;  2NRZ A;  2CGK A;  3E1Y A;  3M8Q A;  4CE9 A;  1U2V B;  4C8O A;  3OYN A;  2DTU A;  1VQL N;  1CZ9 A;  3DWL A;  2P9K B;  2KKZ A;  4JYA K;  4F2S A;  1W0H A;  3FR0 A;  3SAF A;  4NCB A;  5KGW A;  1XHX A;  2PAV A;  1SL2 A;  4PL7 A;  4FK2 A;  1TVR A;  4DTN A;  4MFB A;  1XQS C;  2W6K A;  3VEN A;  5HL7 L;  1WNS A;  1C0M A;  1VQ8 N;  2OCE A;  4E7J A;  1I3A A;  1ZBS A;  2GV9 A;  2HHT A;  1W9H A;  4C23 A;  1GLA G;  1HX1 A;  1WN7 A;  4E1J A;  4W5O A;  3DJC A;  4CJQ A;  4UY8 O;  4B1W B;  4LF7 K;  1NJW A;  4B9T A;  1K8K B;  4IDK A;  5KI6 A;  1TAU A;  4CJL A;  2GX9 A;  3O9U A;  4JKB A;  5E84 A;  4LF5 K;  2QI2 A;  4CZF A;  3IG1 A;  4X62 K;  1QHA A;  1RCH A;  1QHT A;  1T05 A;  3M6G A;  2HHS A;  5HRP A;  2O8B B;  3HP9 A;  4RW7 A;  4CFB A;  4FJG A;  1YAG A;  4CF9 A;  1ZBI A;  4FW2 A;  1G99 A;  2RKI A;  3THY A;  1NGB A;  5C2F A;  3O3G A;  1NGG A;  4NLB A;  1LOT B;  3P1G A;  1HPZ A;  5GAE P;  1U47 A;  4ELV A;  2HBM A;  3UIQ A;  1S1T A;  2YHB A;  2G8F A;  3CMA N;  1VQ4 N;  3T19 A;  3J80 O;  1WSG A;  4NXN K;  3ZT1 A;  1WSJ A;  3DXK B;  2VGM A;  1YTA A;  3ZLJ A;  2HVI A;  3EEQ A;  4YY3 K;  3V9W A;  4JK8 A;  3R3L A;  4FXD A;  4L8R B;  4FWN A;  1JXB A;  3QDK A;  3D45 A;  4QS9 A;  3VF4 A;  5FPD A;  1VQP N;  1EET A;  3ZSO A;  1T3V A;  3H1Q A;  1RTD A;  4IO8 A;  3GL1 A;  1NGE A;  4DFP A;  5AQN A;  5AR0 A;  2IC3 A;  3HT3 A;  3UB5 A;  5FLX O;  3KD5 E;  5EXW A;  3VES A;  1IG9 A;  3C6U A;  1ATN A;  2E2Q A;  3OS0 A;  1ASW A;  2UUC K;  4M42 A;  4CI6 A;  1N36 K;  1DKG D;  5EU7 A;  1BG3 A;  3LDS A;  3ZYY X;  1RT7 A;  5M1K A;  5GIO A;  4CVN E;  3V1R A;  1P90 A;  3LPT A;  4FYD A;  4PKI A;  4FLT A;  3M5R A;  3LDP A;  4BRK A;  4BE2 A;  4JKC A;  2D0O A;  3B6O A;  3PX4 A;  1ZBH A;  1WAF A;  5HRO A;  1SV5 A;  2ASO A;  2DFE A;  2VWB A;  1HUX A;  1BIU A;  3DOL A;  3K58 A;  4BRD A;  5BRF A;  1OVY A;  3VGL A;  5LJW A;  4KPY A;  1HNI A;  1GOB A;  4CED A;  4JI4 K;  4M3R A;  3VA0 A;  4H0Y B;  2X78 A;  3TAP A;  2E1Y A;  2ATQ A;  4CEC A;  4BE0 A;  4DQR A;  4C1N I;  1BI4 B;  2UUA K;  4DR2 K;  4DSE A;  2BTF A;  1U49 A;  1J53 A;  1YJW N;  5C0Y A;  3V1Q A;  4I7F A;  4YHH K;  3OYA A;  1NOY A;  4HHT A;  4J8F A;  4OGE A;  3D6R A;  5AQF A;  4CZJ A;  4H0V B;  1S6P A;  2OYQ A;  4DV6 K;  2NRX A;  4AHS A;  4UQG A;  2HMI A;  3TAR A;  3L3U A;  3BF3 A;  4WF9 L;  1NGA A;  1KXP A;  3DXM A;  3FZF A;  4LF4 K;  3O3F A;  2A6A A;  2IS3 A;  4XH1 A;  2KQ2 A;  3NH1 A;  4NO7 A;  3HBT A;  3RWU A;  1VQ7 N;  1RNH A;  3S41 A;  4V19 S;  1IKV A;  3NCI A;  2IVN A;  3NE6 A;  2OPR A;  4N5S A;  3ZSR A;  4MO4 A;  3CC4 N;  3VQC A;  1YVU A;  5AQL A;  4BC2 A;  3V4I A;  2FC0 A;  4IEI A;  2QK9 A;  4DSF A;  3WEE A;  4DV2 K;  2Q0R A;  3T1H K;  4A2A A;  3NAE A;  1JLG A;  2XRI A;  2YHY A;  1NWK A;  2P51 A;  4WQ4 C;  3HTV A;  3BF1 A;  3VQE A;  2A1S A;  4A5B A;  3I56 N;  2D5R A;  1I94 K;  3QO9 A;  3P39 A;  3VQ9 A;  4FOE A;  1T6C A;  1LAV A;  3ZSY A;  3H08 A;  1RBV A;  4JEP A;  3SUN A;  4DU1 A;  3LDO A;  1VQK N;  2HMP A;  1BQN A;  4NLC A;  1QVG M;  2FBY A;  4IFY A;  1NK0 A;  3WXI A;  5AQU A;  5BRH A;  3NMU A;  5TKY A;  3J81 O;  1BUP A;  4H0X B;  1NOZ A;  4GKK K;  1L3T A;  2IVO A;  1VQ9 N;  3L2Q A;  1KQS M;  1HQE A;  3SBT A;  4XH4 A;  2CGL A;  1R0A A;  3AVC A;  5IT9 O;  4DR6 K;  3RMC A;  3V9U A;  1XWL A;  2QWL A;  4CFC A;  3I0R A;  4CBU A;  1BQM A;  4CJF A;  5J2N A;  1T8E A;  1ZBF A;  5DMR A;  5DM7 L;  4IFE A;  5AQZ A;  3U3Y A;  4KAZ A;  1L3V A;  3OYI A;  2HHX A;  2O8F A;  4FWO A;  3CJB A;  3JSM A;  4K43 A;  1BWF O;  3VGM A;  4CJ5 A;  1Z25 A;  2QWN A;  2HBJ A;  3CPE A;  4KFB A;  1TL3 A;  2OZM A;  1Q7Y O;  1C1C A;  4DF8 A;  1YJN N;  4C8M A;  4DSI A;  1TAQ A;  3PLA A;  4DR1 K;  3SMS A;  4LFB K;  4ISE A;  2RN2 A;  5AQX A;  4KH4 A;  1RFQ A;  1BIZ A;  2FLO A;  4JRQ A;  3QML A;  4JK7 A;  1ATS A;  3VF6 A;  3A5L C;  4FZZ A;  1RTI A;  3SUO A;  1Q8I A;  2F8T A;  4Y0W A;  4YOU A;  3EN9 A;  3THW A;  2HNY A;  2QA4 N;  3HO1 A;  2OPP A;  2YKN A;  3PIP L;  4X66 K;  4B1Z A;  3CCM N;  4FLU A;  4J2A A;  3FFI A;  3GE1 A;  2D0P A;  5EX5 A;  1IBK K;  2YNG A;  3RMA A;  4FLY A;  3O6W A;  1BOT O;  1RDU A;  4Z4C A;  1TKT A;  5HRR A;  3E9L A;  3EY1 A;  3CQX A;  4JRP A;  4WFA L;  4B9L A;  1DT9 A;  1N34 K;  5LL6 Z;  5BPM A;  4C1N K;  3M1F A;  2IOC A;  4K0K K;  4K8Z A;  3V1O A;  3V81 A;  3J7A P;  1S9E A;  2P1J A;  5E41 A;  1HNV A;  2F96 A;  3AA5 X;  3HL8 A;  4IG0 A;  1RT2 A;  2ASP A;  4GKJ K;  4BRN A;  3TSP A;  1WOQ A;  3RRH A;  3AVH A;  3D2F B;  3SPZ A;  3V9X A;  3OY9 A;  4JI0 K;  1JLE A;  3KJV A;  1TL1 A;  2XO7 A;  4GV9 A;  4Z4E A;  4DR7 K;  1RBT A;  4BRE A;  4DV3 K;  2Z1J A;  3H46 O;  2Q3S A;  4XEI A;  4CGJ A;  3TPQ A;  4MDA A;  1XMQ K;  3LDN A;  3HYF A;  2OTL N;  3VOV A;  2RF2 A;  2ZWH A;  4M3Z A;  1GLD G;  3VQ4 A;  1FW6 A;  1NJY A;  3MEG A;  1DTT A;  5LMU K;  1VSK A;  4CJ7 A;  5M1F A;  3QB0 A;  4B08 A;  1OH6 A;  4BC5 A;  3QNO A;  4CZK A;  4O55 A;  5CY4 A;  4F8R A;  3I0S A;  2W6L A;  2YHW A;  2NZT A;  4L3Q A;  3LP1 A;  4AH9 A;  5J1E A;  3KHY A;  3AO5 A;  1KAX A;  2BUP A;  4KTW A;  2QW9 A;  4JKG B;  4DQS A;  4DSJ A;  3E66 A;  4CGD A;  3FLC O;  5TKW A;  3G10 A;  3O1B A;  4JKD A;  3DMJ A;  4DQ8 A;  1HR0 K;  2HND A;  4DSK A;  4A62 A;  4WCE L;  4JKH A;  4O44 A;  1S1V A;  3O9Q A;  4Z94 A;  3RTV A;  1LCU A;  4CJR A;  2XHB A;  3QEX A;  3NDK A;  4DWI A;  3ENH A;  4B9U A;  1T7P A;  1WSE A;  1KC8 O;  4G9Z A;  4LC9 B;  4FLV A;  4RW9 A;  2P5O A;  3LP0 A;  3CM6 A;  3AVN A;  3T3F A;  5LJV A;  3EZ5 A;  4ID1 A;  4DLG A;  1OVQ A;  1S1U A;  1KFD A;  1VQ6 N;  4E19 A;  2ZM6 K;  4CK3 A;  4BR7 A;  5FRO A;  1KLM A;  4CER A;  4NCG A;  4BDZ A;  4ID5 A;  4GVM A;  2I7P A;  4FPB A;  1RGI A;  5AQW A;  2KTQ A;  4KBO A;  4OLB A;  3P83 D;  3I55 N;  4RW8 A;  3GDQ A;  4H0O A;  4M41 A;  1WSI A;  3WQU A;  3L4Q A;  1S6Q A;  4CJP A;  1JL2 A;  4FJ9 A;  4ISG A;  3SZ2 A;  3AA4 A;  3VGK A;  1SKS A;  2V52 B;  2GEM A;  4YDU C;  3WXK A;  3DAW A;  2VGN A;  4IOC L;  4CIF A;  2AP1 A;  1FKP A;  1VQO N;  2A5X A;  4CJ4 A;  2F8S A;  1KCF A;  3U6F A;  5F1X A;  3QNN A;  1JCG A;  5AQK A;  2CGJ A;  3CCS N;  5HLF A;  4BG8 A;  2QWR A;  2UYT A;  4I9L A;  4B1U B;  5AQY A;  3DOK A;  4DTX A;  4ELT A;  4JI6 K;  4BR5 A;  3HOS A;  1TKX A;  2Y1J A;  4CEF A;  4GV3 A;  2B6A A;  4KRE A;  5CHI A;  3AVJ A;  1N6Q A;  4H5T A;  2FXU A;  2IAJ A;  5LY3 A;  4J2D A;  4CFD A;  4CIG A;  2O8E B;  1KVB A;  2OPQ A;  4IJN A;  4FJJ A;  4M3U A;  3CCL N;  3FZH A;  3C7N B;  3OYH A;  3S3M A;  1BL3 A;  3L2R A;  2E1Z A;  1U2V A;  3A8Y A;  3MCP A;  5JLF A;  4PKG A;  3QLH A;  3ZEU B;  5CZ2 A;  1RT1 A;  2BE2 A;  3OYG A;  2P9K A;  3DLR A;  2JGU A;  4AM7 A;  4DV1 K;  1A5V A;  2F9W A;  1VSJ A;  4CJK A;  4FM1 A;  1JJ2 M;  3KWG A;  3Q7B A;  1S9G A;  1NJZ A;  4FJ7 A;  3UKU B;  4M7Y A;  1L3U A;  2QTD A;  4MLH A;  3EKU A;  4DV4 K;  1SKR A;  2G8U A;  3OJU A;  2O8C B;  5KGX A;  4CZI A;  4DS5 A;  3BP8 A;  3AA2 A;  3SQ1 A;  4DV5 K;  4NB4 A;  3O9R A;  2FF6 A;  3HST B;  3ZET B;  1N8R O;  1IKX A;  5AQS A;  1A5W A;  1K8K A;  4BR2 A;  4FW1 A;  3D2E B;  1RDC A;  1X9S A;  4BG9 A;  4XIU A;  3R8E A;  4EP5 A;  3PX0 A;  2NRV A;  3VPZ A;  3MK6 A;  3JS6 A;  2NUB A;  1E4G T;  2ZJP L;  3FZM A;  5C24 A;  3PV8 A;  3O9T A;  5AFU A;  3P31 A;  1X9J A;  2YKM A;  2WBN A;  4CJS A;  3CCJ N;  1S3X A;  4E0D A;  2BGG A;  3HPH A;  5A2Q O;  1VK0 A;  1W7A A;  3VQQ A;  1D5A A;  3LL3 A;  4DS4 A;  1BCM A;  1GOC A;  3O9S A;  2P9S A;  5AQO A;  1RBS A;  5GAD P;  5C15 A;  3FZK A;  3QEW A;  4AQY K;  2PZS A;  3W0L A;  1Q9Y A;  3S9H A;  3CJA A;  1RDB A;  4AM6 A;  3DLE A;  1XHZ A;  4CBX A;  5AZI A;  1RBR A;  2PBD A;  3AVB A;  1JCE A;  4FJM A;  3KKS A;  3THX B;  4LSN A;  3BZK A;  2IDO A;  1QSY A;  4OKJ A;  4CZM A;  3WNE A;  4H8K A;  3J8A A;  3MXI A;  3ASM A;  1BU6 O;  4A2B A;  3VEW A;  4H5W A;  1F21 A;  2Z1G A;  3CIP A;  5C10 A;  2LSN A;  1FK9 A;  4N76 A;  3J7Y P;  3AVM A;  1WBD A;  3MAQ A;  3L4I A;  2CH5 A;  5KRT A;  3THY B;  4BE1 A;  3KKR A;  3CD6 N;  3F9K A;  3QEV A;  3C6A A;  2GTD A;  2QWP A;  3E01 A;  5AJ3 K;  5BR9 A;  4FJI A;  4IXC A;  4M63 C;  1KSP A;  4YOY A;  3MN6 A;  2KZM A;  4KKO A;  5KRS A;  4IFV A;  4CEE A;  5J2Q A;  4KI4 A;  2O8D B;  4CW7 B;  2W41 A;  4O8K A;  2I7N A;  3HXM A;  2G8V A;  3I8D A;  4G1Q A;  3SAH A;  3ZT3 A;  2VYP A;  4B9Q A;  5KTQ A;  1U4B A;  3F2K A;  3C6H A;  4DTM A;  5HOO A;  3SQ2 A;  1NG9 A;  4FJ5 A;  3PUF A;  4A59 A;  4B3S K;  1O1W A;  3T7Z A;  3BGR A;  4H5V A;  2KFZ A;  1C1A A;  3MED A;  4B3T K;  2Q0U A;  2ZGY A;  4OPJ A;  3TU5 A;  1X3M A;  1M90 O;  1RTJ A;  1BI4 A;  4RW4 A;  1C0U A;  3AVF A;  3KLG A;  4BRO A;  3QEI A;  3G4S N;  3CXC M;  2KZZ A;  3VEZ A;  1B9F A;  2Q97 A;  4IWV A;  2UXB K;  5AQH A;  3ZSZ A;  1D4X A;  4BRQ A;  4BRP A;  5JS2 A;  4CHO A;  2P9U B;  4J2B A;  1QQC A;  4MDB A;  3K5M A;  4DTR A;  4W5Q A;  3RRG A;  4CF8 A;  5HP1 A;  1HYV A;  3OYB A;  4JS5 A;  4IJA A;  2V7Z A;  3ULE A;  3LM2 A;  4FWK A;  3AAQ A;  3SK3 A;  3WNF A;  4KHN A;  5GAH P;  3OTO K;  2KW4 A;  1UOC A;  3C0B A;  5DK5 A;  1KAZ A;  3TTF A;  4JK9 A;  3A0I X;  5KPR A;  3O3H A;  3RR8 A;  3JAM O;  5SWM A;  3MXJ A;  3WNG A;  2Q31 A;  3K2P A;  4ZHR A;  5C12 A;  1NK7 A;  1VRT A;  2QXL A;  2ZJR L;  3SNN A;  4DB3 A;  5J2P A;  3ID6 A;  4K25 A;  3HM8 A;  4O5F A;  1RDD A;  3VA3 A;  3QBW A;  1JCF A;  1L5U A;  4N47 A;  2HHV A;  2Z1I A;  4JI8 K;  4JI3 K;  3THV A;  2X6S A;  3LWM A;  4B3R K;  4DLE A;  3WXJ A;  1CXU A;  1V4T A;  3MWT A;  4HCC A;  2ASM A;  5KPZ A;  3CJ1 A;  3B6P A;  1C0T A;  3P5J A;  4OKE A;  2X6N A;  3R1X A;  1BA1 A;  3E9P A;  1QQO A;  5AQG A;  4CF0 A;  1N33 K;  2RE2 A;  5HBM A;  3DLK A;  3HRG A;  1HQU A;  2UUB K;  3VQB A;  3JYT A;  1YI2 N;  3B8A X;  5FDL A;  4BC4 A;  1HNZ K;  4B1Y B;  5ADX H;  3VEX A;  2V7Y A;  3G6E N;  2YNI A;  1J9A A;  4KHP K;  1ZXO A;  5ELZ A;  1OH7 A;  3NBP A;  3HOT A;  4CD3 A;  3A5O C;  4FCY A;  1I39 A;  4DTJ A;  1XNR K;  3MN9 A;  2P9N B;  2E5L K;  4CFA A;  3CCE N;  3HJF A;  2OTJ N;  1IKY A;  3AV9 A;  4WQ4 A;  1IJJ A;  1Z05 A;  1U48 A;  1CXQ A;  5M1N A;  3C95 A;  4CHZ A;  4R5P A;  1DTQ A;  5KPT A;  2J4R A;  1NJI O;  4NYN A;  5I42 A;  1SUQ A;  4OX9 K;  4K41 A;  1Y97 A;  4AHT A;  3OYL A;  1YUW A;  4B3M K;  2F9T A;  1NGD A;  1SS6 A;  1YTU A;  4F3T A;  4HUE A;  4CEA A;  5AQR A;  3IFR A;  1XI1 A;  1JXE A;  4YFU A;  4BRI A;  4FLW A;  1ZYQ A;  1YF5 L;  4OPA A;  3AAP A;  3NHG A;  1IBL K;  3L0Q A;  4ICL A;  4BRL A;  4CGI A;  3FE1 A;  4PA1 A;  4CK1 A;  4DUZ K;  2E6L A;  2E2P A;  4DG1 A;  1GOA A;  3R6M A;  3VEY A;  1J54 A;  2VQE K;  2UU9 K;  3AO4 A;  3ITH A;  3OBY A;  3SBG A;  2PYL A;  3H45 C;  5AZJ B;  4IDH A;  3RSE B;  5AQJ A;  2DPN A;  1S22 A;  4IOA L;  3OYJ A;  3CER A;  4N41 A;  3P38 A;  1XC3 A;  3RMD A;  3O4N A;  3G25 A;  3DLB A;  3V9S A;  4RCH A;  2ZD1 A;  5BN9 A;  3CCV N;  4ELU A;  3CC2 N;  4BWJ A;  5FPN A;  3HVR A;  1MA9 B;  3VQ6 A;  2D0A A;  4DV7 K;  2NRW A;  3T1A A;  3DRR A;  3SI6 A;  1XMO K;  2XY5 A;  4Q5V A;  1B92 A;  3TTC A;  2HF4 A;  4FM2 A;  1YJ9 N;  2QKK A;  4CES A;  2E2O A;  1QQN A;  3CQY A;  4DR3 K;  4DTP A;  1MDU B;  4CGG A;  4CEQ A;  4M3X A;  2P9I A;  1QQM A;  4CF1 A;  4KO0 A;  3VEV A;  3KWI A;  3NH2 A;  3DLH A;  4F2R A;  2IIR A;  3D2F A;  2QEX N;  3ULD A;  3AO2 A;  4HTL A;  5AFU H;  1NGJ A;  2Z1H A;  1WSF A;  4IG3 A;  1GLJ O;  2QWQ A;  4H03 B;  3MWP A;  1NNE A;  5EVZ A;  1V4S A;  1BHL A;  1RDW X;  2CH6 A;  2IVP A;  3SJJ A;  3KVG A;  1TK8 A;  1T6D A;  4I6M B;  3GG4 A;  1VQN N;  3SYZ A;  4F9O A;  4JNE A;  2NRT A;  3EE8 A;  1KRP A;  3SUP A;  2VG6 A;  4OPK A;  2BAN A;  1RDA A;  1J5E K;  4GY2 B;  3V6D A;  2EHG A;  3VQ5 A;  2FBX A;  3DYA A;  3ZT4 A;  3D7E O;  5FRM A;  1TK0 A;  4EP4 A;  3IS9 A;  2ZQB A;  2VQF K;  4IKF A;  1JLQ A;  2F7T A;  5KQ8 A;  1GLE G;  1Z26 A;  2QM1 A;  4JKG A;  3T69 A;  4QOZ B;  4HWI A;  1GLC G;  1JL1 A;  3TR8 A;  3HI0 A;  1TYQ A;  4DQP A;  2E88 A;  4PKH A;  3PY8 A;  3TAE A;  1YVN A;  1DLO A;  1TK5 A;  5EOY A;  5JLH A;  3VER A;  3MEE A;  4W5N A;  4FJX A;  4DFJ A;  3VMF B;  1KVC A;  4OLA A;  1O13 A;  2P9P B;  4M7X A;  1KLN A;  3MX2 A;  3NF9 A;  3PSI A;  2E4L A;  3OS1 A;  4JHD B;  4IO9 L;  3VQP A;  1ESV A;  4BRH A;  4FJN A;  3PSF A;  4E7K A;  4DKW A;  5F0X A;  4OO1 J;  3LPU A;  1N32 K;  3KK3 A;  4KV8 A;  4X64 K;  4JI1 K;  3T1Y K;  1X3N A;  1D9D A;  1U45 A;  3V9Z A;  4DR4 K;  3N4Q A;  4LFC K;  5BRD A;  3ZSW A;  4BGA A;  1OH5 A;  2HHU A;  4CZL A;  1OH8 A;  3CM5 A;  3CJ7 A;  1TKD A;  3KK2 A;  5FRN A;  1RBU A;  4O5B A;  4FWL A;  4QAG A;  3ENO A;  3H3O B;  1EKE A;  3U9D A;  2OZS A;  3TAG A;  1E4F T;  3QFP A;  4AHC A;  2ITM A;  2WFB A;  3NGZ A;  3ZT2 A;  4Z0U A;  2FSJ A;  4OKK A;  1C0G A;  3L8B A;  4XH5 A;  3LAM A;  1EXQ A;  3HSC A;  5E26 A;  3WXM B;  5H1S Q;  4KB1 A;  1GLL O;  3SPY A;  4CGH A;  3BEX A;  1NU0 A;  3WT0 A;  4WQ5 A;  3CCU N;  1NGH A;  1FKO A;  4FK0 A;  3EKS A;  3AVL A;  5FPE A;  3SJH A;  3UKR B;  2HST A;  4DMN A;  3ZCM A;  2DFH A;  1C0F A;  3RVC A;  1HJO A;  3LDL A;  4JKA A;  5BPN A;  3DLL L;  3OW2 M;  1BGX T;  4I9Q A;  3M8P A;  3CCR N;  4ILJ A;  3ZSX A;  1S1X A;  1HNW K;  4Y1D A;  3OYK A;  1WUA A;  2O8E A;  4RW6 A;  2WTU A;  4JN4 A;  4FWP A;  4ZTJ A;  2UXC K;  2H3G X;  3K5N A;  3C7N A;  4DUY K;  3K5O A;  3QIN A;  4BRC A;  2AA4 A;  4F4K A;  2NNW A;  1D9F A;  5CE3 A;  3CQ8 A;  5MLC Q;  2G8H A;  1NMN A;  4LF8 K;  3ZEU A;  4O0J A;  5T7B A;  4FJL A;  1S72 N;  5JVG L;  4JKE A;  4DU3 A;  2X74 A;  3U4L A;  3EL2 A;  4B1X B;  1H1V A;  1HYS A;  1HRH A;  3CI5 A;  1R59 O;  4FVU A;  1LW0 A;  2W40 A;  3NH0 A;  1ASV A;  1J5O A;  1P8Z A;  1T44 A;  1VHX A;  3IRX A;  1HMV A;  1VRU A;  4PWD A;  5LMN K;  2O8C A;  3ATV A;  2E8A A;  4CJW A;  3VEO A;  3AVI A;  3QIP A;  4A5A A;  4GV6 A;  4WYB A;  5BRE A;  1SZ2 A;  3QEP A;  5C2D A;  2P9L B;  3K5L A;  2GWK A;  3ISN C;  1EP4 A;  3ZET A;  3HK2 A;  2D1K A;  4MO5 A;  1NKC A;  3C94 A;  4C8N A;  1BCO A;  3VQ8 A;  1ITG A;  1GLB G;  2Q2R A;  3D2E A;  4DV0 K;  3IKM A;  4FWR A;  2WUS A;  4EFH A;  3OBW A;  3BZC A;  3CG7 A;  3BY5 A;  3MN7 A;  4FOI A;  4O8U A;  4U7B A;  4DTO A;  3NFA A;  4BRG A;  4CJT A;  4O4G A;  3NGI A;  2OAN A;  4Z4H A;  1QS4 A;  4JD2 B;  3HPO A;  4RG8 A;  3VTI A;  1ZBU A;  3TAN A;  4QS7 A;  3DRP A;  4PQU A;  3IDH A;  3M8S A;  2A42 A;  3LAL A;  2O8B A;  3W3D A;  2ZF5 O;  2YHX A;  2D0B A;  4PUO A;  4IOX A;  4FVM A;  5JMV A;  3CJ9 A; 
#chains in the Genus database with same CATH homology
 4X65 K;  4JYA K;  1IBL K;  5FLX O;  2UXC K;  2VQF K;  4DUY K;  4DUZ K;  2UUC K;  1HR0 K;  4DV2 K;  1N36 K;  4DV1 K;  4DR5 K;  2VQE K;  3T1H K;  2UU9 K;  4X66 K;  4JV5 K;  4LF8 K;  5IWA K;  1IBK K;  4JI8 K;  4CVN E;  3J7Y P;  4JI3 K;  4B3R K;  2HHH K;  4DV4 K;  1I94 K;  1IBM K;  2F4V K;  5AJ3 K;  1N34 K;  5LL6 Z;  4K0K K;  1FJG K;  2ZM6 K;  3J7A P;  4CW7 B;  4LF7 K;  4DV7 K;  4JI4 K;  1N32 K;  1N33 K;  5LMN K;  4DV5 K;  3J81 O;  4X64 K;  1XMO K;  4JI1 K;  4GKK K;  4LF5 K;  3T1Y K;  1HNW K;  2UUB K;  4X62 K;  4GKJ K;  4DR4 K;  4LFC K;  4DR3 K;  4B3S K;  1HNZ K;  4JI0 K;  4LF6 K;  2UUA K;  4KHP K;  4DR2 K;  4B3T K;  5IT9 O;  4DR6 K;  1XNQ K;  4DR7 K;  1XNR K;  4DV0 K;  2E5L K;  4DV3 K;  4YHH K;  1HNX K;  2UXB K;  4DV6 K;  1XMQ K;  4LFA K;  4NXM K;  5BR8 K;  5A2Q O;  4JI6 K;  3J80 O;  4NXN K;  4OX9 K;  4LF4 K;  2UXD K;  5LMU K;  4JI7 K;  4JI5 K;  4AQY K;  4YY3 K;  4JI2 K;  4DR1 K;  4B3M K;  4LF9 K;  4LFB K;  3OTO K;  4V19 S;  1J5E K;  3JAM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...