1C0UA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
539
structure length
538
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 136
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0uA05
1UA0A 3TAGA 3F9KA 4ED2A 4H4MB 1KVAA 2XY6A 1HQEA 4I2QA 1X9WA 1N6QB 5K14B 3KLHB 2KZMA 3ZSXA 3CIZA 4ZVEA 3LDSA 3I5CA 3AVAA 4BE0A 1YTUA 1TVRB 1LWCB 3VQ7A 1S1UB 4RNNA 1K1SA 3OYIA 2XCAA 3AVLA 4K4WA 3FFIA 4LQ3A 2IBKA 3GIIA 4L8RB 1HNIA 3THVA 3KJVA 1C0TA 4K4ZA 3FQKA 4O3RA 4ECUA 4RNOA 4CJTA 3HL8A 3RB4A 3IG1A 1KLMB 1S10A 2D5RA 2FBTA 4CJ3A 5F8LA 1J9AA 2W9CB 1WSJA 3TABA 3E51A 2FJWA 2FVRA 1JX4A 1W25A 3BQ0A 1VK0A 3HVTA 4WFZA 4TY8A 1NJWA 3WNGA 4DF4A 3VA0A 4MK8A 4CJEA 3SCXA 3PW5A 3RMCA 3QO9B 2ILZA 5J2NA 4XPCA 5CYQA 5L1LA 3UPFA 3C6TA 1FK9B 1VRUA 3PX6A 3HSTB 3TAQA 4KO0B 2HVHA 4NLDA 3GIJA 4C8MA 1MMLA 4LSLA 1TL1B 3DM2B 3RB0A 3PY8A 1C1CA 1XHZA 3V1OA 4AHSA 1DTQB 3ZT0A 4ICLB 2BANA 4BDYA 3IAYA 3M8SA 1QS4A 1KTQA 3KIOA 2VG5A 1SH0A 2AWZA 1S48A 4GC7A 2W8KA 1NK5A 3VA3A 3PZPA 1N6QA 2OPQA 1FKOB 2D0AA 1WAJA 1R0AB 3G86A 2W9BA 1CZ9A 3AVHA 2BDPA 4J9MA 1TVRA 4TYAA 1LWCA 4B8AB 1TKTA 2XI2A 4TXSA 2ASJA 3EYZA 4PY5A 4ZHRB 2IAJB 3RTVA 1SH2A 3SV4A 4AHTA 1XR6A 3QIDA 1MU2A 1VSHA 4I9QA 4ECYA 5KFQA 3V81B 5KTQA 3PUFA 3DDKA 1U09A 1QHTA 3MFHA 3G6VA 5KFHA 4ZVFA 1JLFB 2ASLA 4IG0B 4NRTA 4J9LA 3KMQA 2BRKA 4G1QB 3SV3A 4ED3A 2W9CA 4F4YA 4ZTJA 5JUMA 1BQNB 3RRHA 4CGFA 5HP1B 1VSIA 3V9ZA 4IKFA 4KREA 3OHBA 3V4IB 3BQ1A 5J2QA 3O3FA 2OZSA 3AVFA 3G10A 3LANA 1JLCA 4FW1A 3MECB 3AA4A 2OPSA 4O4GA 2FJXA 3L2RA 1DTTB 1NOZA 3ZSWA 3K59A 3KMSA 1FK9A 2KZZA 4KO0A 4I7FB 5EUHA 3MR6A 3KLFA 4NLSA 1SH3A 4NCBA 4AHUA 1C6VA 3VQAA 2YV0X 3RAXA 4R8UA 4KE5A 1Z25A 3TANA 3DRSA 4DTMA 4FLWA 3HT3A 2HHQA 5KG0A 2R2TA 4DG1B 2C28A 1DTQA 4ICLA 2YKNA 3VQ4A 5J2PB 4DL2A 3C94A 1N5YB 4J9QA 4CGGA 1G15A 1YTAA 3K5OA 2HHVA 4BACA 4EZ6A 2IMWP 3KLEA 3EZUA 2P5GA 4JV1A 4FM1A 1TAQA 4M45A 3NF7A 2Z1IA 2WB4A 2GC8A 1FKOA 5KG2A 1R0AA 1VSMA 3NFAA 2V9WA 3OYHA 3RR7A 4K8ZA 2OH2A 2OZMA 4RNMA 4M3YA 4DLGA 4WFXA 1YVFA 4KHSA 2YNHB 3SZ2A 3PJXA 5T7BA 4ID5A 4CHZA 4E0DA 4EBEA 1RT6B 5KFJA 3U6FA 1JLFA 3Q8RB 4OVLA 3PX4A 4E7JA 2D0CA 3NF8A 1EETB 3DOKB 3NHGA 4JRPA 1D1UA 3HVRA 4M42A 1JXBA 3LWMA 2C2RA 5HBMA 1IKYB 3LP3A 4RW4A 5DMRA 4TLRA 4B9LA 3V4IA 3V9SA 3DMJB 1HYSB 5EWEA 3VQQA 1T3NA 1KHWA 1U49A 3ITHB 3MECA 2Z1HA 1L3UA 2HHUA 4CGDA 1K1QA 4C8KA 4AH9A 5KT7A 4PWDB 4O3QA 1ZETA 5KFGA 3LWLA 3OYJA 3AA5X 3NCIA 1L3TA 2QKKA 3PR5B 3KHHA 3G0ZA 1J53A 1KFSA 1WN7A 3P5JA 2NUBA 4FS1A 2XHBA 3TAFA 3QEWA 1TGOA 1N5YA 1IKVA 3GIKA 2W8LA 5KGWA 1QE1B 4F4XA 3HP9A 1LAWA 4M3RA 4BE2A 3TI0A 4YR3A 4YNQA 4HKQA 2J6UA 4CEEA 5CYMA 3O3HA 5I3UB 4CEBA 3PW2A 1I39A 3Q8QB 3OS2A 4B9MA 4MKBA 1S6PB 4GMJB 4KRFA 4FM2A 4RW7B 4W5TA 1JLAB 5KT5A 4O4RA 1QUVA 2JEIA 4JLHA 3KNAA 3QGGA 1S9GB 3KK3B 3TQ1A 1RDBA 2FBYA 4CJKA 3V6JA 1LAVA 1S1TA 3MF5A 3TAMB 4R0EA 1S0OA 3SJJA 1NKEA 4OPKA 3AVIA 3OYLA 4CK3A 3IS9B 1T94A 2E9TA 3DMJA 2ALZA 4WZQA 5T14A 3I0SB 2W42A 3LP2A 1Z4UA 5KFPA 3PW4A 1S4FA 4ZPCA 3RAQA 4FJMA 2HHWA 2GBZA 1YT3A 4ECSA 2XO7A 4IBNA 3KKRA 3KLIA 5J1EA 4N5SA 3RB6A 4TSXA 2JLEA 2DFFA 1B9FA 3P83D 4CHYA 4M3TA 1D5AA 4ECXA 4LY7A 3QEVA 3L2VA 2B4JA 4B08A 5L1IA 4HUFA 3K5LA 2VG7A 5C25B 3NH0A 3JSMB 4IRKA 3DLRA 1EX4A 4B9SA 4GC6A 5KG7A 1A5VA 1SKSA 1NOYA 3ZT1A 4FYDA 4Z4HA 1QSYA 2FVQA 3M8RA 4CIEA 3CYMA 4DTSA 1BI4B 5D3GB 2WHOA 3SPZA 3V9UA 3H4BA 2DY4A 2R2RA 4J9OA 3EY1A 3LPTA 5KFRA 1S1XB 1ASWA 3NAEA 5C5JA 1S9EA 1U45A 3PR4A 4QWAA 4IDKB 3H08A 1RA7A 3L3UA 4CEZA 4CJRA 4LQ9A 3BGRB 4ZPAA 4O0IA 3V1QA 4FZZA 4KHNA 4CF1A 1S6QA 1IG9A 1LV5A 4DL4A 4QWDA 3I8DA 3QGHA 4J9NA 4QPXA 3IRXB 4B3OB 4ID1A 3IS9A 5CY4A 4FK4A 2RKIB 4EYIB 3BSOA 3I0SA 3QNOA 1KSPA 2FLPA 2FVCA 5KFUA 2XGQA 3OS0A 3CVKA 4QAGA 5JS1A 2QV6A 4ECWA 1T05B 1RILA 4ECVA 2BQ3A 3VQPA 4ZP8A 4NLVA 1FXXA 3ISNC 4IFVA 4U7CA 1FKPB 2RPIA 1BQMA 2RN2A 5CZ1A 4Q43A 3HJFA 3OYGA 2FBVA 4NLYA 3OYMA 3RMDA 4CHOA 1RTJA 1Z26A 1TKDA 3OS1A 4DQQA 1T7PA 2XCPA 3UIQA 2W9AA 3SYZA 3JSMA 4C8LA 1SL0A 4CESA 5SWMA 4Y3CA 4J9SA 1C1BB 2G8IA 5HROA 4WE1A 2O4IA 4LH5A 3H4DA 2IDOA 4OKEA 2HNYA 4CGJA 2IJFA 4KV8A 1O1WA 3QYYA 5D3GA 1HNVB 3L8BA 1C1AA 1HMVB 5KT2A 2P51A 4TYBA 1J5OB 3OL6A 1SKRA 4JUZA 2QKBA 3DRPA 4FXDA 3OYFA 4QW9A 3PVXA 3KLVA 4FBTA 4KKOB 2YKMB 2B5JB 1W9HA 4ECTA 3AO1A 4CHPA 1CXUA 4GVMA 3BGRA 2WONA 4DWIA 4RNHA 3O3GA 2OPPB 1ZBIA 2R2SA 2GUIA 1UA1A 1NKBA 1ASVA 4IQXA 2FC0A 4DL7A 1GOCA 4CJ5A 3IRXA 3OJUA 2R7YA 4MK7A 3OY9A 5JS2A 2YNFA 4M95A 3KD1E 4YR0A 1IKXB 4NYNA 1L3VA 1VSFA 4IR9A 5I42B 4IOBA 5DQHA 1TKXB 1L5UA 4IH6A 5KRSA 4ED7A 4YMEA 2I5JB 3RB3A 2E9ZA 1NK6A 4DQSA 1T05A 4FJLA 1KLNA 5L1KA 4Z4EA 3TAPA 1RNHA 4OLBA 4FJGA 4ZVHA 1IKWA 3CDWA 2JGUA 4DLEA 2PZSA 4TN2A 2B6AA 4HCCA 1VRTB 4J9KA 4TQSA 4TY9A 2AGOA 3QEIA 1JKHA 1LW2A 4Q0BA 2QE5A 4KHWA 2IC3A 4NLOA 5J2MB 1C1BA 5KFSA 3NDKA 1JLQB 3CDUA 1RT3B 3HVAA 1X1PA 4H4MA 1HARA 2HB5A 3OL7A 3KHRA 4OPJA 1RBTA 3JYTB 3T19A 4CE9A 5K14A 4FZYA 2JEJA 4B9NA 1CLQA 3KLHA 4PQUB 1EP4B 3O4QA 1SUQB 4DL6A 4O44B 5KFOA 3C6UB 4KI4A 5DQIA 1S1UA 3MEEB 1RA6A 3DLKB 3SNNA 4Q5VA 4Q8EA 1LW0B 4KKOA 3GV5B 1WLJA 1NK9A 2IM2A 1JL2A 3K2PA 3E01B 4E7HA 3NKYA 2AQ4A 3TVKA 1DLOB 4B9VA 1UWBB 2HHTA 3AO5A 1KLMA 4F8RA 3DLHA 1EKEA 2PY5A 2GV9A 2KTQA 3CJ3A 2KQ2A 3PX0A 3QLHB 5EU7A 4FLVA 2VG6B 3IGVA 3DRRB 3MR5A 4CFDA 3H59A 5HRPA 1U4BA 1IKXA 1J54A 5I42A 4QCLA 3QO9A 1TL3B 1TKXA 3M9NB 4G3IA 3MXIA 2F8EX 3H5YA 1NK8A 4ECZA 4TQRA 3BQ2A 1JLBB 3KHLA 1SV5B 2VWJA 4WZMA 3CJ5A 4NLPA 3ZSYA 1REVB 4OKKA 2G8UA 3IGNA 4KHQA 2R8IA 1TKZB 1TL1A 3DM2A 4B8CA 3ISND 4AILC 4AHVA 1VRTA 3OVNA 4DU4A 4Q8FA 4DTOA 4IRCA 4K4VA 1RCHA 4F4KA 1CZBA 1SKWA 2BQUA 3OYCA 4I2PB 3ZT3A 4F50A 4CF2A 4JRQA 4YFUA 3AVNA 2G8HA 2YHAA 1A5WA 3V6DB 3U3GA 4CECA 4CHNA 1IM4A 4O3SA 3M8PB 4UQGA 4IFYB 3KK1B 3D45A 4PQUA 2XC9A 5KG4A 4FJXA 3MEEA 4XO0A 4ZHRA 3H2LA 2IAJA 4Y34A 4FJIA 4FK0A 3NBPB 1U48A 3V81A 4FW2A 3SQ0A 1LW0A 2WK4A 3DYAB 2D3ZA 4FJNA 3RR8A 1WSEA 2E4LA 4J2EA 3Q8PB 4LH4A 3E01A 3RWUA 4IG0A 4KFBB 1DLOA 1UWBA 1BCOA 1VSEA 4E1MA 5KFFA 4G1QA 3CG7A 5F9LA 2O4GA 1JXEA 1B9DA 3ZSRA 1BQNA 3DRRA 5HP1A 1ZYQA 3LALA 2JC1A 4Z4GA 2A1RA 2C22A 1D9DA 4CCHA 3CM5A 4WXWA 1ZTWA 4DL5A 1CSJA 4YR2A 1JL1A 3LZJA 5L9XA 1DTTA 4KTQA 1UAXA 2BR0A 3H5XA 4FLTA 4KB7A 4CJVA 4I7FA 1BIUA 5DGBA 1REVA 5F8HA 3FRZA 4OGCA 3FSIA 3MAQA 4LSNB 4ZP6A 4WFYA 4J9PA 1TKZA 1VSDA 4Q44A 2IA6A 5KG3A 3CJ2A 4DG1A 3GV8B 4CF8A 4NCGB 2FLNA 3RBDA 4ZPDA 5KFVA 5J2PA 3AVKA 4CK2A 3MXMA 1JIHA 2BQRA 3QEPA 3V9XA 2DFHA 4CJLA 4E3SA 4NRUA 4AHCA 1XC9A 4W5NA 1YVUA 4RW8B 4ZP7A 3RMAA 4FJ5A 1WNEA 2Y1IA 5C24B 4NLRA 4IFYA 3KK1A 4OGEA 1Q9XA 1CXQA 5KFAA 3QETA 4FJ7A 1XHXA 2UVUA 4HHTA 3T3FA 1NK0A 1QSLA 2HNDB 2X6SA 2YNHA 4E1NA 4KSEB 4MH8A 1S0MA 3LPUA 3DYAA 3RRGA 2V4QA 1BL3A 3BJYA 5KRTA 1RT6A 2UUWA 5KFCA 4DL3A 4DFPA 1QQCA 1NKCA 3OL8A 5DG8A 4HVJA 3F73A 5F8IA 3H98A 2VA2A 2RF2B 4WXOA 1EETA 4CIFA 3DOKA 3NE6A 3HVWA 2R2UA 4IRDA 3NH2A 5FDLB 2ZKUA 2XGPA 2XRIA 1IKYA 3KK2B 5HLFB 3QERA 4DFMA 4CJPA 1RTHB 2ZE2B 4FLZA 4FJJA 4NYZA 1HYSA 3SI6A 1HQUB 3QESA 2AGPA 1K6YA 3ITHA 4I9LA 4PA1A 4KHRA 1B92A 4E7IA 4K4UA 4DTJA 5HRRA 3T5HA 4AHRA 3N6MA 4MQ3A 4O3PA 4PWDA 3HYFA 3LP1B 1WSGA 1Q9YA 1IH7A 4X2BA 3FDSA 2RDJA 3NGIA 2R8HA 4DQPA 2O5DA 4LSNA 1XR7A 3HXMA 5KT6A 3AO2A 2X78A 4FJKA 4FZXC 2G8FA 2LSNA 1NJXA 3KTQA 2HW3A 4HYKA 4CEQA 5KFDA 5KFMA 1TK8A 4RU9A 2F8SA 2PYLA 1QE1A 4KB0A 3PHEA 3TAEA 1JLEB 4RW8A 5C24A 1HYZA 5I3UA 2HAIA 4KHMA 1T03B 5HRNA 1S1WB 2W7PA 4FBUA 4MFBB 4RZRA 3ULDA 1LWEB 3BR9A 1S6PA 5KG5A 2D7SA 3SI8A 4F4WA 3I0RB 3SUPA 4RW7A 3VQ5A 2IM0A 2XI3A 1JLAA 1HYVA 4DS5A 4DTXA 3TR8A 2IS3A 2XY8A 4I2QB 3MEDB 1W0HA 1NJZA 4DFJA 2HHXA 3NGZA 1RDCA 4F2RA 4K4YA 4E89A 1L3SA 4F3OA 1S9GA 4K4XA 3VQ6A 4MIAA 3KK3A 2ATQA 2W7OA 3U3YA 2YNIB 3UDLA 4DSEA 4MIBA 3RMBA 1C0UB 3TAMA 3CQ8A 2WTFA 4FM0A 3PV8A 2R8JA 3ZSVA 3FFIB 3KK2A 5HLFA 4BWMA 4DQIA 3Q8SB 3SPYA 1RTHA 3AVMA 3OYBA 3PW0A 2ZE2A 3KJVB 1S49A 4MKAA 1HQUA 3L2UA 3PJWA 2DPJA 3EPIA 2C2DA 3K5MA 2FVSA 4IR1A 4EZ9A 4JV0A 3CDEA 3KLGB 3QNNA 2HHSA 5DGAA 3GIMA 2YNGB 5EWFA 1NHUA 3HVTB 4TY8B 1BISA 1RBVA 4DTPA 2FVPA 2HWHA 3H40A 4N76A 2F8TA 3ICLA 3OL9A 5J2NB 2CKWA 4Q45A 3DOLB 4OJRA 4KI6A 3BSCA 4E19A 3GV7B 1VRUB 5C25A 1QAIA 3AA3A 1JLEA 3HP6A 3OYEA 2BRLA 3OHAA 1SL2A 3CFPA 4NZ0A 5FRMA 3HM9A 1C1CB 2OA8A 4HTUA 4FJHA 1ZBHA 1NK4A 2E6LA 3DI6B 4MFBA 5DLFA 2EX3A 4WYWA 1BI4A 1KVBA 3QINA 4ZTFA 4FCYA 2OPRB 2J6SA 1S1XA 3I0RA 2GIQA 2X74A 5F8JA 4M3UA 5KG1A 3LP0B 4DU3A 4ED8A 4ELTA 4O0JA 4IDKA 3MEDA 2OPQB 2W9BB 2P1JA 3TWHA 2C2EA 1VSKA 1TKTB 4O3OA 2DFEA 2YNIA 2FJVA 4IKAA 1C0UA 3NAHA 5HRSA 4F4ZA 4RNFA 4B3OA 4ZPBA 5KFEA 1MU2B 1A5XA 3MXJA 1RYRA 1IO2A 3T5LA 2RKIA 4OKJA 4LD0A 4CGHA 3C95A 4E7KA 4DSKA 2ZQBA 3KLGA 4FJ8A 1NK7A 3S9HA 3V1RA 3HHKA 5DQGA 1TP7A 4OL8A 3WNEA 4EP4A 2YNGA 4N47A 2UUTA 3HPHA 3S3NA 4QWCA 2DPIA 4DTNA 4RW9B 1I3AA 5J2QB 1NNDA 1FKPA 2IGIA 1RYSA 1RT5B 1TV6B 4DQRA 1JLCB 3DLBA 1ZTTA 1OS5A 3DOLA 4FLUA 1I6JA 2OPSB 4O4GB 4C8OA 1EXQA 3UQSA 5KI6A 5KFZA 4DFKA 3QIPB 3KLFB 4FVMA 4CF9A 4NLXA 5FRNA 4JV2A 1S1VB 2AX1A 4ZP9A 3TARA 4R8UB 2ZD1B 5KT3A 3ZSOA 3DRSB 3K5NA 1TK0A 3AVJA 4EO6A 3I5AA 4EBCA 2RDIA 3DI6A 4H8KA 1LWFB 2G8WA 2WCXA 1HNVA 1WSHA 2YKNB 3OSNA 1BIZA 4O55A 1HMVA 4IG3B 2ILYA 3MR2A 2OPRA 2UVRA 2QXFA 3HK2A 1ASUA 1J5OA 4FK2A 4KTZA 3M9OB 2PYJA 4BDZA 4DTUA 2YHBA 3LP0A 3KLEB 3AV9A 1XWLA 3SUOA 2YKMA 2B5JA 3S3OA 1RTDB 2ETJA 3BDPA 3CFOA 1N4LA 2OPPA 2AJQA 4Z4FA 1VSJA 3OYKA 1QAJA 4ID5B 2HMIB 1S5JA 4HCBA 4J9RA 3LAKA 3VQEA 4ECQA 4QWBA 2I1RA 4IH7A 3S3MA 3WNHA 1Q8IA 3P1GA 1WNSA 1GX6A 4Y2AA 4J2AA 1GOBA 3D28A 5KG6A 2EC0A 4PUOB 4EEYA 3B6OA 1JLGB 2VWKA 3ZT2A 2I5JA 5HBMB 1D8YA 4RW4B 3SUQA 1RT2B 3AO3A 3M9MB 4RW9A 2FLLA 4KTWA 1RDDA 1S9FA 3GYNA 4KBIA 1HJRA 1RT5A 1TV6A 2UVWA 2XY7A 3B6PA 3M8QB 3HPOA 2HNZB 4KHYA 4RG8A 3SFGA 4J2DA 4HUGA 2ITGA 1RT1B 3QIPA 3PW7A 4CIGA 3T5KA 1BGXT 4NLGA 4OLAA 4KPYA 2HVIA 1S1VA 3NL0A 5J2MA 2AX0A 1JLQA 3G6YA 2ZD1A 1RT3A 4JS5A 3CFRA 4M41A 3LZIA 4Y2CA 3JYTA 4EP5A 2KW4A 1KRPA 1LWFA 4RUCA 2BE2B 1BHLA 4XIUA 1EP4A 1SUQA 4IG3A 1IKVB 3N6LA 4HUEA 4O44A 3C6UA 3KD5E 4CF0A 2Y1JA 3DLKA 4O5BA 2XWYA 4ELUA 4URGA 3SFUA 3QZ8A 1ITGA 1S97A 5CYMB 5KFYA 3IN5A 2J6TA 1RTDA 1C0MA 3O4NA 4Z4CA 3T1AA 3MFIA 4QW8A 3AVCA 1KCFA 4DMNA 5DG9A 4NCAA 3D0PA 3SUNA 3HPGA 2V0NA 4H4OB 3NAIA 1S0NA 3NF9A 4MK9A 3KHGA 5L1JA 3OYDA 3NGDA 2HMIA 2IM3A 3QLHA 2VG6A 3GQCA 1WAFA 4DS4A 1D0EA 3ALYA 3V6HA 3MEGB 4B9TA 4KB1A 1TL3A 1HRHA 1XI1A 1VSLA 2G8KA 4PUOA 1RT4B 4CJ4A 1RTIB 1D9FA 1WSFA 1JLGA 1S1TB 2Z1GA 2JEGA 1JLBA 5SZTA 1N48A 1SV5A 4CFBA 1RT2A 3ZSQA 1C2PA 4B9UA 2D41A 2KFZA 4URSA 1HPZB 4CJSA 3CWJA 4W5OA 4K50A 3M8QA 4NLWA 4E7LA 2A1SA 3LP2B 1RDRA 4K4SA 2HNZA 1RAJA 1X9MA 5F8NA 4RUAA 2JEFA 3FQLA 1RT1A 2XY5A 2OYQA 5C42B 1RBSA 1U47A 4CEFA 1RT7B 3OJSA 4WYLA 4I2PA 3KLIB 5J1EB 3H5SA 1SL1A 3CJ4A 4KAIA 5KFNA 3T5JA 3K57A 3V6DA 4CFCA 3CO9A 5KGXA 3BREA 2IOCA 3M8PA 4ED6A 2BE2A 1TK5A 1RDAA 2ATLA 4J2BA 2D0BA 3SQ4A 4CJQA 3HO1A 2VG7B 5KFIA 4CJWA 4CK1A 3ZSZA 3NBPA 2G8VA 3KKSA 2X6NA 1KVCA 3DLEB 5DG7A 4FLXA 3ZT4A 3SQ1A 3OLAA 2B43A 3AO4A 1ZBLA 4DSLA 5KFLA 3AVBA 3DLGB 4DF8A 4W5RA 2WOMB 2P5OA 4DEZA 4KFBA 5KFBA 4EYHB 4H4OA 5F9NA 3L2QA 3NMAA 4M3WA 3NH1A 3WNFA 3VQ9A 4O3NA 3VN5A 3VQSA 1S9EB 3AA2A 4Z0UA 2DTUA 2FBXA 4FLYA 4M3ZA 4CJUA 3I5BA 3K58A 3MEGA 3EZ5A 4BWJA 2IM1A 4ELVA 2IJNA 1RT4A 4FS2A 1RTIA 4CFAA 5JXSA 1S6QB 1ZBFA 3MR3A 1Y97A 4CJFA 4YQWA 1RBUA 4Z4IA 4XPEA 3KOAA 4M94A 1KFDA 3QZ7A 3VQCA 4H54A 3AVGA 1HPZA 4F2SA 2CJQA 4RW6B 1U04A 3PO4A 3ASMA 4QWEA 4R5PB 3HKWA 3BSNA 4Y1CA 4NCGA 1WSIA 5KFKA 4CEAA 3NF6A 2V4RA 5F8GA 4K4TA 5KFTA 2EHGA 5C42A 2WRMA 4EBDA 4N56A 1RT7A 4NLUA 5FROA 4U6PA 5KT4A 2E9RX 2HWIA 3EPGA 4JS4A 4M3XA 4IFVB 1BQMB 1KHVA 4NYFA 3V6KA 3QIOA 4FJ9A 4NLTA 4DTRA 3LAMA 1RBRA 1RTJB 1ZBUA 3A2FA 5KFWA 1X9SA 2HNDA 5DLGA 3DLEA 4C8NA 4K8XA 5HROB 4WE1B 3MTKA 2BGGA 4IH5A 2E6MA 1HQEB 4BE1A 2HNYB 1QTMA 3DLGA 3VQDA 2WOMA 4KV8B 1N56A 4KHUA 4ZVGA 2RF2A 4QOZB 4N41A 4GW6A 2GIRA 2R8GA 2KFNA 3CJ0A 5FDLA 3DRPB 1GOAA 2QK9A 3OYAA 4CEDA 1HNIB 3H5UA 4CGIA 3NGYA 2D3UA 4DU1A 3D5MA 3VQ8A 1C0TB 2WONB 2R8KA 5KFXA 3OSPA 3N6NA 1UOCA 5CZ2A 5EWGA 3IG1B 3L2WA 3UR0A 2ASDA 3LP1A 2Q3SA 4DSIA 3BSAA 1XR5A 2YNFB 4F3TA 3G6XA 4KAZA 4BDPA 4RW6A 3OYNA 4R5PA 3QEXA 2AGQA 3OLBA 1JXLA 1QSSA 5EDWA 3SQ2A 2UVVA 4URQU 1GX5A 1F21A 2JC0A 5CYQB 3RBEA 4DSFA 4DSJA 4EO8A 4Y1DA 3C6TB 4ED0A 3V9WA 4ZMMA 1BCMA 3L3VA 4CEOA 2AU0A 2Z1JA 4CHQA 4LSLB 1IKWB 1NHVA 4YP3A 3GILA 5DK5A 4ED1A 3QGIA 1NJYA 1T8EA 1TAUA 4NLQA 1T03A 2B6AB 4W5QA 1S1WA 2F96A 5F8MA 2BANB 4ECRA 5E41A 2VA3A 1JKHB 1LW2B 4Q0BB 1LWEA 3ZCMA 2IC3B 2VG5B 4CERA 3VQBA 3CM6A 3PO5A 1TQLA
chains in the Genus database with same CATH superfamily
2GX8A 1WEYA 1KN6A 3F9KA 4ED2A 4H4MB 5GAHP 2XY6A 1XERA 5LMUF 3BF1A 3TA1A 2EWHA 3KLHB 4DR5K 4ZVEA 3AVAA 5AQXA 2RUGA 4DR3J 2CJKA 2XMTA 5E2QA 1K1SA 3OYIA 2OJ3A 4LQ3A 2PIIA 2YQ0A 1X5PA 3J7A1 1WORA 3PYFA 2GEMA 4JK9A 4KIAA 2BOAA 2FBTA 5D4OA 5F8LA 2HS3A 4JP8A 4C0BA 4C3MA 1J9AA 1QHAA 3M30B 1WSJA 3PTWA 2RJZA 3MMAA 2FJWA 1JX4A 3ZTRA 4KPCA 4WFZA 4UW2A 1RHMB 5AJ3F 2XMJA 4MK8A 4Q2MA 1X5SA 1UP1A 1OH8A 3IMQJ 3PX6A 1FK9B 1VRUA 4FOEA 5HN0A 3B8AX 4NLDA 3GIJA 4USJC 4DR3K 2HKEA 3DM2B 4X4NA 1C1CA 5M1OA 4GVBA 4AHSA 4L74A 2I7PA 1DTQB 1WC6A 1KTQA 3CCJN 1X3NA 3KIOA 3MM7A 4ID8A 3TUPA 1DQ9A 1OYEA 1NK5A 4Y0FA 3VA3A 5AT1B 3B6BA 2KVQE 3TSUA 1Q82T 3P5TL 1KONA 4P72A 1N6QA 1WI6A 2L3MA 1FA0A 2DISA 2OSQA 4AUKA 2BDPA 1P27B 4F3QA 1FEEA 4DV7F 2XTJP 2ASJA 2IAJB 1T9WA 1Z2LA 2AEMA 1GTHA 4AHTA 1XR6A 1VQPN 1YJ9N 1VSHA 1J27A 4ECYA 4O5FA 3V81B 3PUFA 3ENQA 3DDKA 1QHTA 2ZOMA 4ISEA 4UOCA 3NGKA 1QLNA 5KFHA 3RRKA 1NDLA 4ZVFA 3IBCB 3QJPA 2BRKA 3SAGA 1WC1A 4G1QB 4P73A 5DDRC 5GVQA 2W01A 4I6WA 1FXLA 4I56A 1RABB 5T7LB 5BRDA 5HP1B 4IKFA 3FNNA 3BQ1A 3TEHB 3J7AN 3JQKA 2LQ9A 3MUTP 1K73O 4TVAB 2XMKA 2V2ZA 4KY3A 2W2PP 3A8JA 4N8OA 4KO0A 1VQ9S 2ZNZA 4I7FB 2G0IA 4PRFA 3RBXA 3H3NO 3KLFA 1YJUA 4NLSA 1Y4ZB 5MLCQ 5GAEU 4NCBA 1SI9A 3K2YA 3VAMA 4KE5A 3GCWP 3TANA 2W25A 3PLAA 3HFVA 4CTAB 3UDEA 4DL2A 2AJFE 5C2CA 4V1Ak 1XNQF 2ZKTA 1G15A 1R27B 3PM9A 3C2PA 2HHVA 3MX2A 3ZYYX 3M1VA 2P5GA 2WB1D 4M45A 3NF7A 2Z1IA 2WB4A 1FKOA 3VMFB 1FVQA 1R0AA 1VJQA 1Z6RA 3HZGA 4K8ZA 4PG5A 4WFXA 2NZ4A 5M2PA 5B08A 4TLQA 2PFUA 3PJXA 3HBTA 3K9JA 4CHZA 3RSEA 4OZ1A 2IVYA 4E0DA 5KAKA 1NGFA 4BG9A 1G2EA 2ZOGA 4NMLA 1JLFA 4JKFA 2OP5A 2D0CA 1IJFB 5K8NA 5AXNA 3NF8A 2HF4A 1HBMB 2GJ2A 2B8QA 2GJIA 4M42A 4OI2A 3BY5A 1JXBA 2V2QA 2C2RA 4K0KJ 4F0HA 4F25A 4TLRA 3SSQA 3MTJA 2DNQA 3PKMA 1KHWA 4YY3J 4FF2A 1NRKA 1L3UA 2HHUA 3LO3A 1K1QA 1VQ5N 2WSCC 3O8MA 2BABA 1NM1A 5ETVA 5KFGA 4JI1J 3LWLA 1XJWB 3PRVA 3MM9B 1L3TA 2VQFF 3G0ZA 3CJSA 4X4RA 4FS1A 3I31A 4A5AA 3QEWA 3KFWX 3QB0A 1N5YA 3GIKA 2W8LA 2Y0SD 1QE1B 3FR0A 1LAWA 4WQ4A 1WOPA 2YJEA 4PXCA 5LMNJ 3M2RB 4YNQA 3I87A 2J6UA 4CEEA 5I3UB 2MZQA 4CEBA 4K0KK 2UUAJ 3TU5A 1MN7A 4X62J 4B9MA 4ZCMA 4XEIA 1S6PB 2OI2A 1T3VA 4ZS6A 4YY3K 4RW7B 4DPYA 3C65A 5KT5A 3QFHA 1QUVA 1WHXA 1T6DA 5JVGQ 1YK9A 1WBDA 5CE3A 1CS4B 4JI1K 4C2MA 4GVLA 1S9GB 1F6TA 1R89A 3Q7CA 2YWKA 4CJKA 4AT1B 3V6JA 3TAMB 2FJAB 3QBCA 3SJJA 4OYIA 4JI5J 3L7OA 3ZNJ1 3D3BJ 2E9TA 1Q7LB 3IWNC 3FJ2A 5LXRA 2MKCA 1HW9A 4TU9A 2W41A 4XTTA 5E3QA 4B17A 2E5LJ 5LMNK 4ZPCA 1B64A 4PWWA 4KGXB 2HHWA 2GBZA 4A8MP 1I94J 4QR0A 1YT3A 2R42A 2UUAK 4X62K 4WJBA 3RB6A 2O66A 1B9FA 2LQ8A 3P83D 5E84A 4LY7A 3FE1A 4FKYA 3AGKA 2BUNA 3L2VA 3CCZA 2B4JA 1RLDA 5M1PA 2DRAA 3LDPA 4KGZB 5C25B 3GYXB 4A8OA 3J81j 5KG7A 1NOYA 3L09A 4JI5K 4ALZA 3WXKA 1R8BA 2QX0A 3CYMA 5B0BA 1BI4B 2FYXA 4DV3F 2R2RA 3LPTA 1S1XB 3DC2A 4FOIA 2E5LK 1U0HB 1U6FA 3PR4A 5IV4A 3W1YC 2LLZA 2DGUA 3L3UA 5LJWA 3U02A 3W2VB 1I94K 2KJWA 2IVMA 5CH7B 1M5VC 3P49B 4FWQA 4DHVA 3GE1A 1LV5A 4DL4A 2HWTA 1VMBA 3IRXB 4MO5A 1YJ7A 4F7VA 4ISFA 3CULA 4FK4A 1G3OA 1NMNA 1O8BA 2D9OA 1KSPA 2FLPA 3AJ1A 3C16B 2GQ2A 1RBLA 1F5BA 1M5KC 4HEA9 4WFNL 2ROPA 3OVSA 1LFPA 3IRWP 4W4MA 1T02A 2EKNA 3KKFA 1FJ7A 3UDCA 4ECVA 2F7TA 3VQPA 4FPIA 4ZP8A 3QT6A 4NLVA 4I1TA 4LF6F 3ISNC 4IFVA 4U7CA 3L7UA 1QAYA 1BQMA 3SDEA 4DPTA 3EDQB 3GR1A 3SQGA 1BE4A 4E1JA 3R1HA 3GU0A 3OYGA 3KG0A 4CHOA 1TKDA 3NCRA 2APOA 1W7AA 3SYZA 3JSMA 4RUBA 1SL0A 4ZPVR 5EY4A 4AM7A 2G8IA 2ZWPA 4LH5A 4YOWA 4CGJA 1R8AA 2WVCA 5ETRA 1O1WA 5B0GA 4CZFA 1VQ8N 5D3GA 2O67A 1C1AA 1HMVB 5KT2A 2E7WA 3P4UB 4L75A 4TYBA 1J5OB 4YHHJ 4USUA 2NXJA 4JUZA 1U1OA 2QKBA 4NEYA 3OYFA 1UJ5A 2G13A 2HGLA 2HVZA 2CYYA 1HBUA 1W9HA 3AXMA 2AP6A 4CHPA 4YDXA 2R7QA 2WONA 1CZAN 5ETMA 1FT8A 2LDIA 3M8ZA 3ENBA 2BYCA 2A6MA 3FUYA 2DGWA 1U25A 1E3MA 3G96A 3DGPB 1FRIA 2ZH1A 4M95A 3TTFA 3DOMB 3I9V9 4NYNA 4UOGA 4B3RF 1L3VA 1VSFA 4IR9A 5I42B 4B3MJ 3W61A 2X7IA 2B4UA 3D3CJ 5AR0A 5KRSA 1YRXA 3BH7B 3AHPA 1Z2ZA 1APSA 4E2FB 1QVGM 4DQSA 1T05A 5DJBA 2MZ1A 5MLCV 4Z4EA 3TAPA 4ZLPA 3VTIA 2Q6BA 4ZVHA 4YHHK 2FTRA 2QW9A 4PABA 1U8SA 2O8DA 2X3DA 2DR6A 2YX6A 2JX2A 4JKGA 1HNWJ 2P9EA 3ZTSA 5CR4A 2YX7A 4NLOA 2OD6A 1C1BA 2M9KA 1BLUA 1RT3B 4H4MA 2H4WB 3D6FB 2ZVSA 3QSYB 2E2NA 2C3YA 1CLQA 3KLHA 3J7Z5 4M5IA 5K5MA 2MZRA 4LF4J 3O4QA 2IDEA 5ADXA 1NMDA 3GZ7A 4O44B 4KI4A 1AZSB 3D54A 3ENWA 1U1QA 2GWKA 4B3MK 3MD1A 2B51A 1PC5A 2F8MA 4WK1A 2PEHA 3S8SA 4KKOA 4GNIA 3D6HB 2DR5A 3FBFA 5FPEA 2IM2A 3K2PA 3E01B 2HK3A 1MNEA 3EGVA 1NGDA 4EHTA 3DLHA 2H5JB 1UVJA 3M30A 2Z2YB 2YKOA 3CJ3A 2XMWA 2LDYA 4DU8A 4CFDA 2KO1A 2V8VA 1HNWK 3W9HA 1E6YB 2RHSB 1TL3B 1IN0A 4JI8F 3M9NB 3BGUA 4G3IA 3CJ9A 4M5DA 2DR8A 1NK8A 1O13A 4ECZA 5CCLA 1S7IA 2C2ZB 1JLBB 2YY3A 3KHLA 1H7WA 1Q8KA 4NO7A 2GGPB 2FY8A 4C7QA 3BBBA 4OKKA 3AOCA 4LF4K 4MO4A 1XC3A 4KHQA 7FDRA 3DM2A 3ATVA 2DNHA 1TELA 4DTOA 3QAEA 2QA4G 1HD0A 1SKWA 2JLFA 3R8EA 4I2PB 4F50A 4CF2A 1N5TA 4OX9J 2P9IB 1X4EA 4CH7A 1A5WA 4CECA 4CBWA 2GAHC 1F2HA 4O3SA 3KK1B 3D45A 3W5YA 5KG4A 4KT0C 4M5NA 1JNZB 3MEEA 4XO0A 2DGVA 3H2LA 2IAJA 4Y34A 2DYAA 4JKBA 3BKTA 1YBAA 1ICEB 3B8HA 3C14B 2O8FA 3CF5Q 3V81A 1ILYA 2RE2A 4ZCLA 4J2EA 3I8BA 3Q8PB 3RWUA 4OHYA 4JKHA 3TZZA 5FPMA 3ZZZA 4EUVA 4YS2A 1BCOA 4G1QA 2KHOA 5KQDA 3CG7A 2E1YA 1JXEA 5T7LA 3J7AP 1MWQA 2IPOB 5HP1A 5GIPA 4B1WB 2A1RA 2C22A 4PAAA 4D3GA 4HTJA 3CCRS 1D9DA 2JVRA 2VUGA 4CYUB 4LRCA 4DL5A 4OX9K 3QT8A 1JL1A 4WU2A 3W66A 2ZBCA 2ZH9A 4KTQA 1UAXA 3RAMA 1CQMA 4EFHA 3J7YP 4I7FA 5AQGA 1BIUA 5HK4A 5F8HA 3FSIA 4BRHA 4ZP6A 3Q2TC 2IVFB 3S1TA 1QAXA 4Q44A 3GV8B 1OMSA 4CTAA 3RBDA 2NZTA 4WCEQ 5AQJA 1WUUA 1EWQA 4LJMA 3AVKA 2O8EB 1GQEA 3TTCA 2EI5A 3I9ZA 2PGCA 2ZM6J 5DRKA 4BHQA 1WNEA 4X4OA 2LP4A 3Q2SC 2KXFA 4QIFA 3NOCA 5C10A 4OGEA 1UPPA 1LK5A 3T3FA 3VGSA 1QSLA 2D69A 4BLGA 2VC1A 4LFCF 1BXNA 2X6SA 3DCAA 2IIHA 1URNA 4EIAA 2V4QA 2UUWA 1QQCA 3F73A 3H98A 4FWMA 3G9CA 1X31C 4JYAJ 4WP8A 3NH2A 1TFYA 5FDLB 2ZKUA 3FZHA 5G0RB 2VKRA 2XGPA 2XRIA 3QERA 1XNRF 3I96A 1WBBA 2WW8A 3H8YA 3SI6A 4GV9A 3H2UB 4CNYA 3QESA 1WC0A 3R6LB 4LVNP 1Z05A 2ZM6K 2RD5C 2WW4A 3N6MA 1WKKA 1WSGA 1U6ZA 4X2BA 3NGIA 2HIQA 2OMOA 5HVHA 1XR7A 3MM9A 4LBHA 2UXCF 2V52B 2H5IB 3KDNA 4FJKA 1PGZA 1RLCL 2ZNYA 1UEKA 3BPDA 5KFDA 3W3DA 4LFAF 1TK8A 2PYLA 1QE1A 4KB0A 4NXNJ 1KBRA 1XN9A 1TR0A 4RW8A 4X64F 1F5CA 4MYUA 1HYZA 4TNOA 5I3UA 4JYAK 3IFEA 1FX4A 2QLXA 1ESVA 3SCLE 2DHSA 3ULDA 3BR9A 1C4AA 1I1GA 4DN9A 4ZCIA 1S6PA 1TU0B 5KG5A 4F4WA 3I0RB 3SUPA 4RW7A 3VQ5A 2IM0A 2CPZA 4BC5A 1MW7A 1PKUA 4I2QB 4WP9A 1W0HA 4EFAC 1NJZA 3O4WA 4M8LA 4E89A 1L3SA 2K7KA 1S9GA 3VQ6A 4MIAA 3A0IX 2W7OA 3U3YA 3UDLA 4MIBA 3TAMA 3CQ8A 1HPMA 3KK2A 3MMVA 2G0CA 1YRTA 4EHUA 2EPIA 2ZE2A 4MKAA 3WIVA 3PJWA 4J9VA 2CQCA 1IR0A 2C2DA 1TUWA 3K5MA 4DX7A 4IR1A 4JV0A 3CDEA 4NXNK 1K8AT 3R5GA 4WQ5A 5IV3A 1VAZA 4C97A 1BISA 2RQMA 5JICA 4B3TF 2F8TA 3ICLA 2J0WA 5IT9O 2CKWA 4Q45A 5FPNA 2E7VA 3GV7B 1VQON 1YX2A 3SMPA 5HQLA 1SS6A 5C25A 2YHXA 3CDBA 4XAKA 1SL2A 5ETLA 2AIRB 4HTUA 4AL7A 4FJHA 3I56S 3ZTPA 3MCOA 3EE8A 4MFBA 1NWKA 4WYWA 4I67A 1BI4A 1KVBA 3DXMB 3A4TA 4C3LA 4NXMJ 2AZ1A 1S1XA 4KHPF 5B0FA 2QXLA 1OY6A 1S6OA 3CD0A 3QQCD 3JXUA 1NBEB 2OPQB 5AQZA 2KXHA 3W2VA 2P1JA 3TWHA 2GO9A 5AQYA 2YNIA 4IKAA 1C0UA 2Q1LA 5KFEA 3NCPA 1IO2A 3T5LA 4BY9C 3IM8A 4LD0A 4CGHA 4FWOA 4BRNA 1S99A 1YAGA 4DSKA 3C16A 4ERDA 3KLGA 3JAMO 2HFZA 3HHKA 5IM0A 3DLLL 1TP7A 1NSPA 5M2UA 2FGOA 3S3NA 2DPIA 1S5ZA 3T1YJ 4PG6A 1W2BR 2XLKA 2DNYA 5J2QB 1NNDA 4NXMK 1URRA 4MAKA 3T41A 1TV6B 2MDAA 1JLCB 1ZTTA 3IXQA 4H4KA 5IQQA 3DOLA 2OPSB 4C8OA 4A8QA 3MI7X 1EXQA 5K20B 3AJDA 3UQSA 3OW2R 5KI6A 2HQDA 1NH8A 3R2CJ 4NLXA 3IAM9 2GHPA 4R8UB 2ZD1B 3OQ2A 5D8HB 3ZSOA 1TK0A 1MMDA 4PHTX 4EBCA 3OA9A 2AP1A 2G8WA 1UZHA 2WCXA 3E8OA 3RUBL 1HMVA 4IG3B 2PD1A 4J7CA 2OPRA 3MR2A 2QXFA 4MLEA 1J5OA 2W6KA 1FWPA 2PYJA 3LP0A 3KLEB 4YOEA 1OQ6A 3AV9A 3I32A 2K1RB 3RVCA 2MGZB 3E9PA 5D0GA 4LF5J 3MOJB 2ETJA 5JMVA 3BDPA 3HHEA 3U27A 1CC8A 1X4CA 2F65A 2M0GB 2AJQA 3T1YK 3DWLA 4Z4FA 2DHAA 5FJ4A 1LNQA 2PA3A 4ED5A 4ID5B 5IWAJ 1S5JA 3DGPA 4J9RA 2JDJA 2DHXA 1BC6A 5B0DA 3VQEA 2I1RA 3WNHA 1Q8IA 1U1PA 5IT9U 2VQEJ 2EC0A 1XBWA 1CULA 5BPNA 3POTB 4FWPA 4RW4B 3SUQA 3M9MB 4KTWA 1ZOTA 7FD1A 3D6RA 1RT5A 2UVWA 2XY7A 3J80U 1YIJS 4X4PA 4KHYA 4A57A 3SFGA 2VFVA 1YZ6A 4LF5K 1MMNA 2HVIA 3O5BA 1S1VA 1M5OC 4OX7A 2B4PA 3GP9A 3DXBA 4X65J 1RT3A 1MWKA 3CFRA 3KHYA 5AFUH 1KRPA 4BGBA 3DDNA 5IWAK 2E1ZA 1IKVB 1R6VA 4F04B 4O44A 4PG7A 1AZSA 2J9DA 2Y1JA 2CJBA 2MZJA 3EXCX 2J8SA 2XWYA 2YX1A 2VQEK 4H5TA 2J9CA 4ELUA 4YOYA 1X0FA 4ZPWR 2ALYB 1C0MA 1RAEB 4CNZA 2DNMA 1QY7A 3LGNA 3AVCA 5H9FJ 1EKSA 4NCAA 3D0PA 3B4DA 2YWHA 3CMES 3HPGA 2HRYA 3UKUB 1Q5VA 4MK9A 3OYDA 4YOXA 3PIPQ 1VQ9N 5AQIA 3GQCA 5J1NA 3M2UB 4B9TA 4M63C 1TL3A 4DCJB 1RT4B 2UXDF 1JLGA 4X65K 4LRAA 4BBYA 1JLBA 3MDQA 2RT3A 2GGPA 1RT2A 3MN9A 2JFKA 3ELHA 2KFZA 2XSJB 3MN6A 4W5OA 1W7WA 1R8HA 3D0HE 3M8QA 4WU3A 4NLWA 2ZZMA 3LP2B 4K4SA 2XLJA 4WKRA 2ASPA 3S7RA 4ZLNA 3CJCA 2EFGA 3J8AA 5C42B 2Z4PA 1FKAF 3LL3A 4I2PA 3KLIB 3TJ8A 4F67A 4ZPTR 3ZZRA 5H9FK 2X1BA 3IC1A 2P9IA 2CUYA 4BC7A 4CLSA 2X3GA 3TZWA 4ED6A 2QA4S 3VGMA 3CPWM 4EK2A 3A5NC 2RS8A 3W9IA 1OH6A 4BC4A 3KJFB 1KVCA 3G8SA 1N34F 3DLEB 1NPKA 4H0PA 4BRPA 3UE2A 3ZT4A 3SQ1A 4DUZJ 2D4WA 1ZBLA 2Q36A 4DSLA 3DLGB 2F5GA 2PI4A 1DRZA 5KOWA 4DR7F 4PKIA 3CCVS 2HQ3A 5ETPA 3L2QA 8RUCA 4M3WA 5E26A 4I6MB 2K7JA 4DCHA 3UN3A 3O3LA 2Y8WA 2PI5A 4LRFA 5GAGI 2MQQA 2WUSA 3MEGA 3GL1A 4A8XA 2IM1A 4ELVA 4CYUA 1RTIA 5CAAA 1S6QB 4CJFA 4Z4IA 1KD1T 1KQSR 4M94A 3TPQA 2A2CA 1YHQS 1PJ7A 1UJ4A 1IQTA 1U6BA 2AHOB 1FRLA 1T6CA 2KG0A 3FSXA 4RW6B 1U04A 2V2VA 4CEAA 3NF6A 4Z2XA 2HLUA 2KKHA 4DUZK 5KFTA 2WRMA 2KN4A 3LF0A 3QWUA 4BCAA 4NLUA 5T41A 1PYTA 5LL6d 3TNVA 1F0XA 4ZVOB 2E9RX 1RWUA 3KUHA 3HSZA 4AQYF 2VODA 2D3O1 2D1CA 3SEOA 3R2DJ 3CJRA 4CLTA 2VHGA 1RBRA 1RAFB 2OFHX 2FSJA 3EGZA 4C8NA 2AA4A 5L38A 2QTWA 3OVAA 4WE1B 2ZZTA 3THWB 2BGGA 4P7VA 2UUBF 4A4JA 1HQEB 4M7YA 5I3PA 2WOMA 5DDOC 5AE2A 3C66A 4KHUA 2F7VA 2LKZA 4GW6A 2R8GA 3HF5A 2GO8A 5FDLA 4DQ8A 3DRPB 5G0RA 1C0FA 3H5UA 3D2EB 2ZUAA 4BRLA 3NLCA 5M1KA 2KYXA 1H6KX 3D5MA 4JI2J 1C0TB 2ZDPA 5KFXA 3UKRB 1JXVA 2Z58B 4DV4J 1FF2A 2BJ7A 3UR0A 2ASDA 3VWSA 3CB4A 5GADP 4IZ9A 3QRRA 5G4DA 1A9NB 2Z2LA 2YNFB 4F3TA 4KAZA 4BDPA 5IT9Y 1K9MT 4NOHA 3O2IA 2F4VJ 1WF0A 1NJIT 3WX8A 1GX5A 3CCQS 1F21A 4K5RA 1YRUA 3MK6A 4DSFA 4EO8A 4Y1DA 1QQMA 2ZHOA 4CD3A 2QA1A 3IBFB 2DH8A 3DFEA 1XMQF 1RADB 4CHQA 2BJDA 1Y7PA 1N8RO 2QWNA 3PACA 1T8EA 1RDWX 1XMOK 5GMEA 4W5QA 2NRHA 3BR8A 2GQQA 5F8MA 2KRBA 1RHJB 1JKHB 2VA3A 1LW2B 4Q0BB 4OYOA 4JI2K 2X1GA 4U7BA 2KVIA 4CERA 2FXUA 3VQBA 3CM6A 3AY0A 5MAOA 1FNXH 4YB5A 4DV4K 2ZH6A 1DHMA 1FD8A 4I2QA 3OTOF 5DDQC 1KVIA 4QS9A 3M6XA 3ZSXA 5CCMA 3LDSA 3OTDA 1YTUA 5C12A 1O0PA 1LWCB 4HWIA 1Q8BA 2H65B 4IEIA 3UO0A 2QL5B 5LJ3Y 2QL9B 2LXFA 2XCAA 2JWNA 3SCKE 3AVLA 3T7ZA 1MN9A 2F4VK 2IBKA 5TKWA 1XK8A 4YOUA 4CO4A 2OSRA 4K8RA 1HBNB 3THVA 3JAMY 2OELA 4OYXA 3B54A 1FNOA 4X66F 2CVIA 2ZJQQ 1CJUA 2E1PA 3FQKA 1KC8T 4O3RA 3AD9C 2ZWHA 4RNOA 4CJTA 2JFDA 3RB4A 3IG1A 2KG1A 1KLMB 2DO0A 1S10A 2D5RA 3CJ8A 1Z1ZA 2W9CB 3TABA 2HQIA 4HHJA 1Q86T 2DNGA 2P9NA 3HLUA 4HI2A 4DF4A 3VA0A 3PW5A 3VZHA 1WTFA 3QO9B 1WJ9A 5H9EJ 1VS3A 2YWFA 5A8RA 3ZNUA 1N36F 5CYQA 5L1LA 2MHEA 3UPFA 3C6TA 5D4PA 1YKWA 3ZEUA 2K3IA 4DXLA 1MMLA 4LSLA 4CLPA 3RB0A 3PY8A 1ZAVA 5C2GA 3V1OA 1D9AA 5D4NA 2QG9B 1RWOB 1V5IB 3DXMA 3M8SA 1QS4A 1WSVA 2CH5A 2KHCA 2VG5A 1S48A 3JQJA 4UY8O 4U9RA 4WTYA 3IBWA 2OPQA 3KYLA 2D0AA 1RWKB 5CABA 1RFQA 5LL6Z 5ETOA 5IS2A 4J9MA 3PJ9A 1TVRA 4TYAA 1W2IA 4ZHRB 5AQFA 4JV5J 2UU9F 2WSEC 1N33J 5H9EK 3Q86A 4CLUA 4I9QA 2NRTA 3FZLA 3FLCO 1X4BA 2YBVA 1ZZNA 1U09A 3MFHA 3G6VA 4KRWA 3US5A 2QWPA 2NLWA 2NRZA 4DCPB 1XIQA 1QUPA 6AT1B 1NSAA 2NXNA 3TZXA 5D78A 1BQNB 3RRHA 4C23A 1YI2S 3NNHA 3V9ZA 5J2QA 2KM8C 3O3FA 2QWOA 3DRYA 3X3UA 1C0GA 2B9YA 1JLCA 2R7UA 4IQMA 1VBYA 4FW1A 3W0LA 3AA4A 5BN9A 2OPSA 3M8YA 4JB8B 2UXBF 1DTTB 1NOZA 3ZSWA 3CXCM 4DL0C 1WF1A 3IKMA 2HLTA 1C6VA 1YGYA 4DV1J 2EEYA 3BZCA 2YV0X 3CF5L 2VIHA 4R8UA 5AZIB 1OVQA 1Z25A 4JV5K 2QN6B 2HHQA 5KG0A 1N33K 3GJQB 1HJOA 3QRPA 4ICLA 3VQ4A 4O23A 2VYPA 2HVDA 4NYOA 4CGGA 1NLVA 1CJKB 1RP5A 2OTJN 3WIUA 1YTAA 1I5OB 4BACA 4EZ6A 3CETA 3MWPA 3KLEA 1F2GA 4FM1A 1KVJA 1TAQA 1VQLS 1WELA 2ZH5A 3W8GA 1PSDA 2GFFA 3JTNA 2GS8A 2EBGA 1FVSA 2OZMA 4M3YA 4NEZA 3HX9A 4F0KA 3H20A 4ZN3A 1B7FA 1C4CA 2P9SB 1KQKA 2YNHB 3SZ2A 2CAJA 5T7BA 4ID5A 3AT1B 4EBEA 2HHHJ 3Q8RB 4OVLA 4DV1K 5IC4B 2HFNA 4WCEL 2AF6A 5LY3A 3POTA 3HVRA 1D4XA 3AAWB 3BUZB 1LXNA 5GAHU 1NDCA 4RW4A 2BM0A 2MJUA 3V4IA 5B7WA 1XEZA 2H1YA 4FL9A 5ELZA 2C3PA 5EWEA 3VQQA 2MLXA 3MECA 1P8GA 2F8HA 4CGDA 3AD8C 4O3QA 1ZETA 2DCLA 1OVYA 2YKPA 3NCIA 3BF4A 3NG8A 4ZVRB 4DMZA 1J53A 2ACMA 4MKYA 1Y00A 2FDNA 2ZOFA 2HOEA 1TGOA 1IKVA 2DIVA 2Q1NA 2HHHK 1WACA 1M1HA 4PXBA 1FRKA 5ADZA 3DU6A 2LEAA 3TI0A 2Z56B 1EX8A 3O3HA 5AQLA 3ILJA 1CBKA 5F3TA 4LIWA 4OI4A 3CJKB 2GA7A 3HFZB 3N5BA 2XO6A 2DCUB 4LR8A 3UKUA 4BC2A 5KPTA 4GMJB 3UI3A 4KRFA 4L73A 5D77A 2PT0A 4W5TA 1JLAB 1TUYA 2GCFA 1VI7A 3QGGA 3CDAA 2ZH3A 3UD3P 1RDBA 2FBYA 2AJ2A 2ZVIA 4JI1F 1G7CB 3HTVA 1NKEA 4WWSA 4LBIA 2MTLA 4CK3A 4RJVA 2A1BA 2FHMA 3IS9B 3EDRB 1T94A 2G4BA 1VRQC 2CG4A 1YITS 3DMJA 3LPEA 2ALZA 1QZ5A 1YUWA 2W42A 3L7PA 3LP2A 2GAGC 4YUDA 4ZVPB 2I9SA 1SQKA 3G71S 2DRDA 2XZTB 5GAEI 2M7SA 2PN6A 1GMVA 2JWKA 2XO7A 4IBNA 3CD6S 3KKRA 1ATRA 1SAZA 3KLIA 4X4SA 2DFFA 2UUAF 4M3TA 3FKBA 1D5AA 4ES1A 2C2MB 3QEVA 2CPJA 5EXWA 1ITPA 3SSSA 2ASYA 5AFUA 3K5LA 2AEFA 3NH0A 2HBJA 2F3JA 1A5VA 1SKSA 1WG4A 4WFAL 1Q4RA 3AXKA 1R7IA 1NUEA 2MQPA 1S57A 4CIEA 2R7SA 2WHOA 3SPZA 3SIPB 4PKHA 4J9OA 1KTVA 3VALA 1ASWA 5C5JA 3EGNA 3CC7S 2H5EA 1U45A 1VQKS 2RS2A 3H08A 3MZIA 3UE5A 3GPAA 4CEZA 4OZ3A 2E5LF 4DV5J 4CJRA 4LQ9A 1WB9A 4JI4F 1Y5LB 4A2AA 2VV5A 1I94F 4KHNA 1S6QA 1QJHA 1IG9A 2ZBRA 1SC6A 2VB6A 3CHWA 3QGHA 4QPXA 1UVIA 4EYIB 2CJ9A 4YDUA 2MLYA 5DO2A 3I0SA 2FVCA 5KFUA 2MB0B 3OS0A 4DOZA 2DT9A 1OH7A 4LR7A 2C2NA 4JI3J 5JS1A 1U24A 2BQ3A 2GW8A 3IP0A 1MA9B 1FXXA 3SAHA 4OHZA 1Q81T 2RPIA 2RN2A 5CZ1A 5AJ3J 5JJBA 4ZIVA 1GAOA 2WVEA 2FBVA 3OYMA 2LVWA 3RMDA 3OS1A 4Z94A 4DQQA 2VGNA 4DV5K 3UIQA 4BC3A 3VEZA 4CESA 4AYBD 4WE1A 2VL1A 2D0PA 3THWA 3H4DA 2IDOA 2X1FA 4OKEA 2U2FA 3KVGA 2IJFA 3NNCA 2DNPA 4XDDA 2XM3A 2J0SD 1H0HB 5A8WB 4WFNQ 2RQ4A 3GFZA 2P9PB 3DRPA 2ZH2A 3O6QA 4QW9A 3PVXA 3R5CA 3VTHA 1RB0A 3WEEB 4FBTA 2WBNA 2ZC3A 3NP5A 4YN3B 5B09A 3VAIA 4JI3K 3ZZPA 4GVMA 3BGRA 5AQTA 1KQGB 4RNHA 4HACB 3UKRA 3MMBB 2OPPB 4NMXA 1T9UA 1ZBIA 1UA1A 3M6UA 1NKBA 1ASVA 4ANEA 4CLLA 1GOCA 4CJ5A 6FD1A 3TX8A 2DH9A 2VF3A 2R7YA 5AJ3K 2Y9HA 4MK7A 1T44A 5JS2A 2YNFA 3EVMA 1U1LA 1GLLO 1SPBP 4YR0A 1HI8A 3AQPA 1IKXB 2QWMA 3CD5A 1FRMA 5DQHA 3MPUB 1TKXB 1Q18A 3A8EA 4G6VB 5A8KB 3I56N 3NGTA 2I5JB 2Q3PA 2E9ZA 5F1XA 2RQKA 3P45B 1M1KT 4FJLA 5L1KA 2XYPB 4FJGA 4LR9A 5HVGA 3KG4A 2JGUA 4DLEA 5M1FA 3VEYA 1VRTB 4YHHF 2MYFA 4JKDA 4J9KA 1FDNA 2IRUA 4ZITA 2AGOA 1JKHA 2WAQD 1LW2A 4Q0BA 2QE5A 1GK8A 5J2MB 3QT7A 5B0EA 3CDUA 2EFNA 1HARA 2V9KA 4OPJA 3JYTB 2RDDA 3T19A 4CE9A 4FZYA 1NM2A 4B9NA 3QWPA 1DBDA 4PQUB 1SUQB 2IYIA 2GMLA 2N7YA 4DL6A 5KFOA 3C6UB 2V2KA 4CLWA 1RBAA 4DDFA 1H1VA 3Q24A 1XNQJ 1LW0B 4H03B 1HBNA 2DEIA 2BKOA 4PG8A 1A7GE 5BRHA 3D67A 2AQ4A 3TVKA 1DLOB 1UWBB 3CC4N 4IOAL 1KLMA 4F8RA 3D2WA 3NWRA 1JJCB 2KQ2A 4ZA1A 1Q79A 2FIUA 1P9YA 5EU7A 2VG6B 4PPDA 3MR5A 1QVFR 3H59A 1U4BA 5HRPA 3LW5C 2I2YA 3FGVA 2IJRA 4QCLA 3QO9A 4CI6A 4H0YB 3MXIA 2F8EX 1HNWF 4UTGA 3HD2A 3GG4A 4Y0WA 4I68A 2IRXA 1VGYA 2Y1RI 4WZMA 3ZSYA 3CJQA 3J7ZT 1GLEG 3TYTA 2HPUA 2P9KA 2QFIA 2D3OR 2RVJA 4B8CA 2FJDB 3ISND 2CNOB 1VR6A 2FZGB 1S77D 2ADBA 4ILHA 1ZM2A 2CADA 5E5NA 3OVNA 4Q8FA 1XNQK 1VIOA 1WDDA 4IRCA 3R5AA 2V7ZA 1NXIA 3K0SA 1AYEA 3OYCA 2AYMA 3ZT3A 1HX1A 1ZC6A 4YFUA 2HFUA 3PIPL 5E3PA 3V6DB 1VDHA 4CHNA 1IM4A 3M8PB 4O8KA 4IFYB 1YJWN 4ZHRA 4ETZA 5DDPC 1X5TA 2P6SA 2M3DA 4CO1A 4Y2MA 3SQ0A 4FJNA 1WSEA 2MY8A 2E2QA 2E4LA 2BE9B 3V2UC 3O9RA 5IOLA 1OSDA 3LM2A 3PFOA 2R7XA 1VSEA 1B0VA 4DR1F 1V3SA 1HQ2A 2O4GA 1RAAB 1ZM4A 2HRUA 1BQNA 4QPTA 3DRRA 4WBFA 4FWLA 2MMYA 4Z37A 4Z4GA 1BG3A 4BRDA 4CCHA 4FXWA 5B8HA 5L9XA 1DTTA 2E5IA 3CMQA 3GJSB 2BR0A 2BKNA 4KB7A 3LM9A 5DGBA 3ILIA 1REVA 3SQOP 3SBMA 4LSNB 1IWAA 4CZCA 1TKZA 5AZIA 4CZKA 2EFPA 4K59A 1JCFA 2IA6A 5KG3A 3CJ2A 2XYGB 3ULEA 4L3KA 4USVA 2LXIA 3VETA 1CJKA 3MUVP 4BR9A 3CMAN 3V9XA 5DZ6A 1IM6A 2RMLA 4KGKA 2NR0A 2QWQA 4AHCA 2YQ3A 4IO1A 4E3SA 2ZBIA 2YQ1A 1Q82O 3RMAA 4ZP7A 4FJ5A 4JN4A 5RUBA 4NLRA 4NYPA 1TYQB 2XMMA 2ZZNA 3HFKA 3OR1B 1LCUA 4R0JA 1LXJA 5C7PA 1HD1A 1FJCA 2UVUA 4HHTA 1K0VA 1EHWA 2HQGA 2P9SA 5JVHL 2YNHA 1ELOA 1FRHA 4MH8A 1S0MA 3LPUA 4NX9A 3PIOL 3DYAA 3TVYA 2AW0A 4BR7A 2YWEA 2EWSA 4GKKF 5KRTA 3BJYA 2FSKA 4ILGB 3OL8A 1XMBA 5DG8A 3G6ES 4HVJA 2XWXA 4WXOA 1K47A 2GUPA 2JNJA 4CIFA 2HFOA 3J81O 2R2UA 1DY3A 4CZEA 3BM7A 1R6YA 1EIYB 4DV3J 4C11B 4BR0A 1RTHB 2V34A 2O1PA 1S59A 1HQUB 1NG9A 3KNGA 1AT1B 3D4JA 4H5NA 1B92A 4E7IA 4K4UA 2BMBA 3ILLA 2K2PA 2QA4N 4O3PA 2ZM6F 3LP1B 1Q9YA 3R27A 2YXLA 1NSKL 2R8HA 2HVEA 2O5DA 2M8DB 2MEWA 2H3GX 2PC6A 1NGGA 2OEKA 5KT6A 5E0OA 4FDFA 3THYB 3I4PA 1LKZA 2PMHA 2G8FA 3GDQA 2LSNA 3KTQA 2XZWA 2HW3A 4CEQA 2HBRB 3ETMA 1YJNN 3TUZC 1S79A 3PNIA 2WSFC 3D0IE 4BVOA 1EQMA 3TAEA 4P7TA 3R6GB 4DN0A 2NXCA 5C24A 2CPXA 3D1QA 1JK9B 2BZ2A 4LF6J 3VVUA 4DV3K 2G2OA 4LIRA 3CJKA 1FO1A 4KC5A 4FBUA 3C15A 2MQLA 1LWEB 5HATA 3SI8A 1X8DA 1JLAA 2VBWA 2XI3A 3GOIA 1TUVA 2IS3A 3MEDB 4DFJA 4EMDA 3G25A 1X7VA 4JAXA 4YOTA 4P74A 3UB5A 4CZMA 4ZCKA 4K4XA 3R6MA 4AXJA 3FC9A 3U7JA 1DT9A 4DSEA 3JXOA 1F9FA 1XQSC 2WTFA 4FM0A 2R8JA 3ZSVA 1RWNB 5HLFA 1FRJA 3CT9A 3AVMA 3NWGA 1HNZF 3KJVB 1S49A 1H98A 1DQ8A 3EPIA 2FZKB 2B3TB 2FVSA 2BKPA 5DGAA 2H48B 3UVJB 5HMYA 3T1HJ 2WC9A 3FZFA 2YNGB 2W6LA 4LF6K 5HOOA 3HVTB 4N77A 5EOYA 1Q5YA 1RBVA 3JQMA 3QT5A 2HWHA 3GJTB 4RWTA 5J2NB 4JD2A 1X0PA 1QQOA 3BSCA 3O5TB 1PBUA 4B3RJ 3BPSP 2NRRA 3QICA 4Y6IA 1QAIA 3AA3A 1JLEA 3HP6A 3ZLJA 2QO3A 4NA2A 5D15A 5HJXA 4NZ0A 3HM9A 2OA8A 2CDQA 4WYBA 4F26A 1NK4A 2J7WA 3I33A 5KPRA 3J7YU 2EK1A 1OJ4A 3QINA 4ILMA 2PFFB 5F8JA 2IYGA 5KG1A 1OYDA 3CO0P 1BWEA 4HDHA 4ED8A 2Y1LB 2QI2A 1OKJA 1E4FT 3T1HK 5FLXO 1CJTB 2HYIB 1V3ZA 4JBCA 2E2PA 1YBUA 2K3KA 3HKZD 1VSKA 2DFEA 2CNNB 3NAHA 5HRSA 3MAAB 5A6PA 1MU2B 3AFGA 4JI6F 2BE7D 5M2RA 4OKJA 4B3RK 4U8YA 3WQUA 4WIIA 1LK7A 2CQ3A 1UMJA 5DQGA 4OL8A 1YJ9S 1G99A 2RUSA 3EVOA 1TL7B 2VDHA 1I3AA 4B3SF 2OLWA 4KGMA 4MLHA 3QFUA 2HGMA 4C8YA 4DQRA 3DLBA 1KWMA 1FD2A 1M5PC 2BW7A 1YTYA 4JI8J 4DFKA 2RRNA 5IQ6A 5FRNA 5KPZA 3A5MC 2PAVA 2AX1A 1V6HA 2ITMA 2M88A 2Q43A 1Y64A 1RAHB 4EO6A 3I5AA 1HLUA 2RDIA 3BN4A 3DI6A 3EVWA 1LWFB 4ZVTB 1WSHA 5A8WA 3DLLQ 2YKNB 1P6TA 3HK2A 1HBOB 2LEBA 1ZA2B 2YHBA 4OJ3A 2YPYA 1XWLA 3AQOA 4BVPA 2CNKB 4HTLA 3WEEA 4B9QA 2V67A 1RTDB 3MMBA 3THXB 2OPPA 3BEXA 2GTDA 3C6AA 4BS2A 2J7UA 3T1YF 1NCLA 4JK8A 1P90A 4ECQA 5AQUA 4JI8K 2PMWA 1UW4A 1GX6A 4Y2AA 4A8SA 4J2AA 3D28A 3MMCA 1PYOB 3GIRA 4PUOB 3B6OA 5AQVA 1J5EJ 1REGX 4KR0B 2QLBB 2I5JA 3RW6A 5HBMB 3T6JA 1SJQA 1D8YA 3UNGC 2B9EA 3CEDA 4RW9A 1Q8LA 4CRJA 2FLLA 3F9MA 2R3VA 2Q66A 3MXHP 3Q23A 3GYNA 4KBIA 1LOTB 3B6PA 1E6VB 1WOSA 3FBCA 2JOQA 1BU6O 3HPOA 1UVLA 3HDSA 1H2UX 4DKWA 3SAFA 5L9NA 4QYZJ 2ITGA 1RT1B 3QIPA 2KH9A 2F9DA 3T5KA 4OLAA 4KPYA 3X1LB 2BV3A 2V8HA 3NL0A 2HZAA 5J2MA 1DGKN 4FYWB 5BPMA 2OMLA 1U0SA 3RZAA 4FVUA 5H1SQ 3LZIA 4Q2LA 3JYTA 4UOFA 2KW4A 2VOOA 2KJVA 4YOVA 4FZVA 4BQLA 1BHLA 4XIUA 1SUQA 2L9WA 2H54B 1HHSA 3C6UA 1RAIB 3KD5E 2NREA 3OTBA 4BROA 4O5BA 2POKA 4HH1A 2P9UB 4E98A 4URGA 3HOTA 3QZ8A 4OZ2A 1X5OA 1ITGA 5AQRA 1J5EK 1YI2N 4OJHA 4ZDNA 4ZVSB 3O4NA 4Z4CA 2VOPA 1J2VA 3G82A 3R1LA 4DMNA 3CW2C 3SUNA 2DNLA 2V0NA 3OVBA 1RXOB 4CDIA 3BV8A 3KHGA 2HMIA 2VG6A 3L6QA 1FW6A 1UVNA 3JSBA 4LFCJ 4QYZK 3ALYA 1U2VB 5C2DA 3V6HA 5K9FA 2C42A 4CJ4A 4CZGA 3WXLA 4DV6J 3H7HB 1GXLA 1HNXF 2Z1GA 2JEGA 2P5VA 5SZTA 4CVNE 3ZSQA 5CA5A 3PRDA 3WX4A 2D41A 4BRCA 4URSA 3FGUA 2KKZA 2R7OA 4RUHA 1RU2A 5DM7Q 1U1RA 2HNZA 5F8NA 2W7AA 4RUAA 2CQ2A 4TU8A 2XY5A 4Z7YA 2OYQA 1E4GT 3VAJA 2CWKA 2HBQB 5F0WA 1QVGR 2ZDOA 4M5MA 1NNEA 1KS2A 2CQHA 3K57A 3V6DA 4CFCA 3CJBA 3CO9A 5KGXA 3GFXA 3M8PA 4LSZB 2BE2A 2UXCJ 1Y11A 2KM8B 4J2BA 3SQ4A 4CJQA 4FVCA 4LFCK 4HLBA 2YCHA 2DNRA 2VG7B 5KFIA 2G8VA 3WXJA 2VU5A 3VAHA 3PRBA 3D66A 4LFAJ 2B43A 4DV6K 4U96A 1SZ2A 2YHWA 5D4LA 4QS8A 2CPFA 4G1IA 5KFLA 1PYSB 2AYEA 2DTJA 1Y5IB 5M1QA 4X64J 4OI0A 4P2MA 3J81Y 4A62A 2FHJD 2P9LB 2VASA 4H4OA 3QNWB 4IO9L 3NMAA 3VCDA 2FD2A 4O3NA 1S9EB 4CJUA 2HBYB 1B99A 3I5BA 1H2TZ 3G4SS 4DV0J 3SSRA 3BO4A 3R9PA 1VLOA 1NHKL 2IJNA 3HI0A 2NCKL 2J8AA 1ZBFA 1ZH5A 2F9TA 4XPEA 2DY9A 1VISA 2FHJA 2UXCK 3SCIE 3LTOA 1PBAA 3LQVA 3VQCA 3ZX0A 3BO2A 1HPZA 3AA8A 2W4PA 3ASMA 4R5PB 2GVZB 4I0WA 4Y1CA 2XMAA 3OTEA 4LFAK 1BHNA 1FDBA 4K4TA 5AQQA 1RWWB 1RT7A 4DUZF 5FROA 4X64K 3NGRA 4LMZA 3O9QA 4RBVA 4JS4A 4M3XA 2HS0A 1UVKA 1H7XA 4DX6A 4NYFA 2IDLA 4UZCA 1TYQA 3R7SB 1UWAA 4C48A 2W2OP 3W5XA 4B3TJ 4PQAA 2RH3A 4YDDB 1RTJB 1V4SA 3A2FA 2VBXA 2DNOA 4DV0K 1X9SA 3SMSA 4ER8A 5DLGA 1H38A 1YXQA 5EX5A 4K8XA 5HROB 2CPHA 3ZTQA 2KDOA 2A0FB 4TU7A 5IT4A 1N56A 4BREA 1FJGJ 4DV2F 1IBKF 2AYBA 4UZBA 4GVEA 2E7XA 1GOAA 3OBYA 5FIIA 4OYAA 4Y2IA 3CIMA 2NSCA 4KHPJ 4I69A 3CD6N 1GMWD 2J4RA 3VQ8A 4NL5A 2R8KA 1BMQB 1R8PA 4A59A 2V51B 3A8KA 3CC2S 3K9KA 1HI1A 5EWGA 3THTA 1RAOA 3LP1A 4G9ZA 2Q3SA 3MMAB 1VBKA 3LUYA 4BGAA 4CBXA 4B3TK 1H3DA 3R5JB 3OYNA 3QEXA 1X60A 4IO8A 1CC7A 1QSSA 1GMWA 2UVVA 2CG8A 4OZ5A 2FUG9 3V9WA 4M63A 1BCMA 3PYEA 3B82A 4QIGA 1T9TA 3U9ZA 1FJGK 4B1YB 1IKWB 4YP3A 2JZ5A 3CC7N 4L3NA 1G6BA 1NJYA 2DGXA 1VQKN 5HAOA 3MD3A 1YQHA 1RACB 4P2XA 2OKQA 3CERA 5BYQA 4KHPK 3NS7B 2XBPA 2RU9A 3PEJA 3T9ZA 1LWEA 3ZCMA 5ETQA 3PO5A 1TQLA 4UF4A 4JI2F 5FLXY 1UA0A 1BO5O 4GRSA 3TAGA 4HL9A 3A1YG 1X9WA 1N6QB 1TL5A 2KZMA 3MGJA 3I5CA 4BE0A 2I6WA 1WEXA 1VOMA 3UD5A 1GH8A 4K4WA 3VF0B 3LGHA 2N7CA 3GIIA 1HNIA 4IOXA 3KJVA 3F2KA 4K4ZA 2VFRA 4MDAA 3F0NA 2F9WA 3GSDA 4DR2F 3HL8A 3UVJA 1U1NA 4QS7A 2VKZG 4JKEA 3E51A 2FVRA 3EUNA 4RWXA 1VK0A 2MKYA 3HVTA 1NJWA 2KT5A 3WNGA 1WEZA 3SCXA 5L46A 5LSRA 2Q0RA 2ILZA 1GLDG 5J2NA 2I7NA 2AZ3A 3WXMB 2A6OA 2VJVA 3KDOA 3HSTB 4KO0B 2HVHA 1SIWB 3OUYA 4DR6F 4C8MA 1TL1B 4Y00A 4A46A 2C2KB 3M8WA 4ZVUB 4ZLLA 1VBXA 1NPPA 2BANA 2BJ9A 4BDYA 4OZJA 3IAYA 2DXFA 3MMJA 4RPFA 2AWZA 1WC4A 4LF2A 3M5RA 1KXPA 3R8YA 2FHKA 2W8KA 4CD1A 3M1VB 2KHDA 5ETSA 1FKOB 1AFJA 1R0AB 3QFPA 1CZ9A 3A8YA 3AVHA 3H1QA 8AT1B 1NU4A 1VQYA 2XI2A 1DURA 3IWXA 2QYCA 4PY5A 2E8AA 1SH2A 2CQIA 1MU2A 1SJ3P 4P75A 5KTQA 3RSEB 2HRTA 4EU0A 4B1ZA 1JLFB 4NRTA 3KMQA 3MM8B 1K8AO 4ED3A 3UCGA 3E9OA 2CZVC 3G8TA 4F4YA 3ZETB 3AH6A 4KREA 3OHBA 5LOQA 3VOVA 3G10A 3LANA 3MN5A 2FJXA 3L2RA 2DITA 3KMSA 1FK9A 2KZZA 2UP1A 3MR6A 4M5KA 3QGPA 1SH3A 4CO3A 3ZXWA 3VQAA 1IWGA 3RAXA 1VQMN 1T9YA 4V19X 1JWWA 4ZOSA 2R2TA 3ZZOA 4DG1B 3PYGA 2C28A 3TSQA 1DTQA 1U02A 3TR5A 3VAFA 2YKNA 5GADU 3DGVA 4CQ1A 3T6BA 1N5YB 4J9QA 4JI0J 3K5OA 4KYZA 1HBOA 2W2NP 3VEVA 2IVPA 3D2FB 3H42A 2IMWP 3L95X 4UUWA 3CCLS 1YZ7A 4DR4F 3ATUA 1YSJA 5IC6B 2GC8A 5KG2A 2CWXA 1F60B 3NFAA 2IMOA 3M6VA 2V9WA 3BH6B 3RR7A 1B7YB 3THXA 2OH2A 3UWTA 4DLGA 1YVFA 3AD7C 1V9OA 2VPXB 2CJXB 1NGEA 5KFJA 2CNLB 3CCTA 3D7EO 5HI7A 1N34J 3U6FA 3PX4A 4E7JA 3UFCX 1EETB 4BQZA 3FFKB 3DOKB 4JRPA 1D1UA 3LWMA 5HBMA 3F44A 3FMWA 1IKYB 3LP3A 2BJ1A 4B9LA 3V9SA 2VBYA 1TFWA 4JI0K 1E6VA 1U49A 2DHGA 1H2VZ 2NZCA 1WOQA 4PWDB 1DARA 3TUIC 1Y10A 4J9UE 3THPA 1NSQA 3C3LA 2O8CB 3AA5X 2QKKA 2LCWA 1Q78A 2JWLA 1KFSA 1YBTA 2NUBA 2PMZD 2XHBA 4A2BA 1EJ7L 4M5LA 1YJTA 3AA9A 3MCPA 2CQBA 5F2RA 1N34K 4M3RA 2HHHF 4J5OA 4YR3A 2P9UA 3ZZYA 2XNQA 4HKQA 1I39A 3Q8QB 1SKUB 1Q16B 3OS2A 1FNMA 4AQYJ 4HHHA 4RU2A 3PKYA 1NMEB 4V19J 2JLGA 4USKA 4FM2A 2N4CA 3O44A 4RL1A 4PXDA 2EW9A 5D0HA 2OEMA 4JLHA 1VQ6N 1U2VA 3KNAA 1S6UA 1HI0P 1PAUB 2F40A 5AE3A 2UUBJ 2PDAA 2KYZA 1HBMA 2BJ8A 4O8UA 4FWSA 3MF5A 4ZVQB 1PAEX 3AVIA 2CIMA 3OYLA 1RWMB 2VWBA 5EHHA 1FFGB 4OYBA 5T14A 3PW4A 3PCOB 1GLJO 3U4LA 4DB3A 3EZOA 3MX5A 4OYWA 2VPYB 2BX6A 1RI7A 4ECSA 2F9JA 1RHKB 1BWFO 4NLBA 4AQYK 5FD1A 3I4HX 3GONA 2KLAA 4LF7F 3L3CA 3KWMA 4CHYA 2H51B 3OBIA 3O9TA 4ECXA 2N3OA 3AARA 1NPRA 1B4SA 3G6EN 4B08A 1FTCA 5L1IA 3EICA 3MWBA 1RDUA 2VG7A 3D7SB 2E20A 3P3DA 3JSMB 4IRKA 2UUBK 2EKYA 3M2RA 3P4IA 3ENOA 3ZT1A 4BRFA 4DUTA 5ADXH 1NB2A 4U67L 4FYDA 3H0PA 4Z4HA 4KH1B 1QSYA 2OTLS 2FVQA 3M8RA 1UEVA 3OFGA 4DTSA 5D3GB 1GLAG 3EY1A 1O51A 2R7RA 2WVFA 1S9EA 1QZ6A 5AQWA 3TQEA 2IRYA 2J0QD 2V8GA 2QA2A 1CS4A 1D8ZA 2WVDA 4ZPAA 5BREA 1KQFB 5GAHI 1HHQA 1JQGA 3OTOJ 5ITHA 2GMHA 3NEKA 2ZEJA 4CF1A 4QWDA 3I8DA 4I4BA 4ISGA 4B3OB 2MKIA 2CXEA 5CY4A 3R5BA 3GJRB 2RKIB 4WFAQ 4PR6A 3BSOA 3SXLA 4X84A 2E1AA 1Q7YT 3QNOA 4PXEA 2AD9A 4X66J 3CVKA 2A40A 4QAGA 2FSNA 2VFTA 1T05B 1RILA 1CEZA 1GTEA 1PCAA 3V4MA 1FKPB 4LFBJ 4MDBA 4CT9A 4J91A 4K41A 4IOCL 1EWRA 3E2EA 2M4MA 3H90A 1N5VA 4NLYA 4G1PA 1RTJA 5IXUA 4J37A 1T7PA 2NPIA 1N36J 3OHRA 4C8LA 2SXLA 2QMWA 5SWMA 1C1BB 5HROA 3OTOK 2O4IA 2C2OB 2GMJA 2V63A 1QDUB 3QYYA 1Y5NB 3TEGA 3AOAA 1X4GA 3CPWR 1ZM9A 2P51A 3CGIA 3OL6A 3KJQB 1GLFO 1SKRA 5F0XA 1VQNS 1U0HA 3E66A 2EG1A 2FJBB 4X66K 3H46O 4KKOB 1BDGA 2YKMB 4ECTA 3AO1A 1CXUA 1VQ4N 2KU7A 2LA6A 4DWIA 4EGLA 4B1UB 4B1XB 4JI3F 2GUIA 3IA0A 3R3LA 1VC6A 3MN7A 4DL7A 1KD1O 4LFBK 3IRXA 1VQ7S 3OY9A 5I3QA 2UU9J 1BA1A 3KD1E 3PEHA 4NZ7A 4FP9A 2MKHA 3K7RA 4FWNA 3O9UA 4HTIA 1N36K 4P10A 3VZIA 1L5UA 3ENHA 4M5DB 4FNHA 2NPFA 4ED7A 2BA9A 4YMEA 2DY1A 2AJ1A 3RB3A 1NK6A 2MPUA 1HWLA 2DIUA 3HI9A 1OSCA 1FXRA 3QJJA 3VEXA 1RNHA 5LXYA 4OLBA 1IKWA 4Y2KA 3CDWA 4HH0A 2PZSA 3KG1A 5BXIA 2HFSA 3QEIA 2FLOA 2M52A 4KHWA 2UXBJ 4BC9A 1MLAA 5KFSA 1JLQB 1X1PA 3HT0A 1CVJA 3OL7A 3KHRA 2MKKA 1RBTA 3OV7A 3CQXA 2AMCB 2J9DE 1EP4B 4OI3A 2QEXS 3P6YC 2UU9K 3MEEB 4LVOP 1F1BB 3DLKB 2E1CA 3SNNA 4G65A 4Q5VA 2O8FB 3FSYA 2HBLA 3GV5B 2CZ9A 1JL2A 4E7HA 2ASMA 3NKYA 3AO5A 1R3NA 3R9LA 1BQXA 2YKQA 1QQNA 1AXQA 3QLHB 4FLVA 3IGVA 1WG1A 2YVSA 2MKJA 3DOMA 1K9MO 1J54A 2HURA 5I42A 1T3OA 1NJIO 2AKWB 2UUCJ 1OPZA 1Q1KA 2YTCA 2UXBK 3H5YA 3GG1A 2FF3B 3BQ2A 3GFHA 3CJ5A 4NLPA 3IGNA 1IXKA 2DB1A 2XEXA 4C9DA 4AD6A 1TL1A 2QT7A 2VDIA 4AILC 4AHVA 3ID6A 4EI2A 5TKYA 4M1KA 4OYPA 4IOAQ 1ATSA 4DU4A 4K4VA 1RCHA 3HSJA 4B02A 3VF6A 5GMKa 4JRQA 3W7BA 3AVNA 2G8HA 1F9EB 3Q8VA 3C46A 3U3GA 1BUXA 1OY9A 2R9LA 4UQGA 2ROEA 2JH3A 4UOHA 4BRIA 2PEBA 2OEJA 3DHXA 3RG6A 4Y65A 1SIZA 4YDUC 4XK8C 4FK0A 3NBPB 2UUCK 3D1HA 1OQ3A 2QZ8A 4FW2A 4HT5A 3CCUS 2WK4A 3F41A 2D3ZA 3RR8A 5E3CA 2YWWA 4LH4A 5DM7L 3E01A 4P2FA 3JAMU 1KC8O 9RUBA 3AB4B 3MM8A 1H74A 4GKJF 5KFFA 3VAKA 5F9LA 1X3MA 1LOUA 1B9DA 2EK6A 3ZSRA 2VC0A 1Q86O 3NGSA 3ZETA 1ZYQA 3LALA 2JC1A 3VGLA 4FNIA 5GMDA 2D74B 4X4TA 1E6YA 2XMVA 4BR2A 3CM5A 4WXWA 2H4YB 1DJ0A 2KT2A 1CSJA 4J90A 3LZJA 1RUSA 3H5XA 4FLTA 4CJVA 2FHOB 2LECA 1CG2A 1VBZA 4DX5A 4DPXA 2EVZA 3FRZA 4ILLA 5BN8A 3MAQA 1KAXA 4WFYA 4J9PA 1RE1B 2FZCB 3MM6B 1P9QC 1IBLF 1UVMA 2PSZA 4DG1A 3N79A 5BYRA 1N32F 4F3MA 4ZPDA 5KFVA 4CK2A 1EO1A 2BQRA 1ZBSA 3QEPA 1FX2A 3TZYA 3D2FA 2DFHA 4NRUA 2C3OA 4OYMA 4CM2A 1XC9A 4RWWA 4C1NK 4RW8B 3KK1A 3EWGA 5D6GA 2UV8G 5AQOA 1ZA1B 2RILA 1CXQA 5KFAA 1KNZA 4WP3A 1XHXA 3KUEA 3H6EA 1RGVA 4PPZA 4FF4A 3CD7A 3C14A 2HNDB 1OPIA 4CH1A 2NRVA 1IV0A 2NSBA 3RRGA 1BL3A 2HS4A 2GHWA 4DFPA 1OWXA 5F8IA 1U2CA 2VA2A 3GG0A 1IBMF 2RF2B 3ZZ0A 1EETA 2B9XA 2P9CA 3DOKA 3NE6A 4LF8F 3BP8A 4OV1A 4IRDA 4OYZA 1PO6A 1M1GA 2Y8YA 3CPEA 4OPHA 1IKYA 3KK2B 3EGWB 3CJTA 2ZE2B 3BGFA 2G0JA 4FLZA 4FJJA 1SBRA 1IG8A 1UCNA 2RRAA 1K6YA 2C3MA 4I9LA 4PA1A 4JI7F 4UY85 5HRRA 3T5HA 1RK8A 3P31A 3HCXA 4MQ3A 4PWDA 4JI4J 5JVHQ 3HYFA 3FDSA 2HIYA 1EARA 4D3HA 3PIOQ 2O8CA 3DRXA 3JSYA 2DGOA 4ZK7M 3AO2A 3PSFA 5AXKA 3CE8A 1AW0A 1RTZA 2NYIA 1NJXA 1PILA 3EXYA 1JCEA 4HYKA 2O8EA 3CXCR 4ANDA 5KFMA 4GMKA 2RE1A 5F3ZA 2F8SA 2DGTA 4P2SA 2OUGA 1Q53A 1WKLA 3UW1A 2XQCA 1HLWA 3ZC4A 4K25A 2Q0UA 2HAIA 4H5WA 2Z2ZA 1SXLA 3T9NA 5HRNA 1PJ5A 5ETTA 3R7NB 4CM0A 5LSOA 4W90B 1S1WB 3G4SN 2W7PA 2B4OA 2NYHA 1FRXA 4MFBB 3GYGA 4LF9F 4RZRA 5GAGP 2QWLA