1C0UA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 136
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0uA05
3KK3B 1KLMA 3SFGA 3M9MB 1JX4A 1KFSA 3KD5E 1TVRB 5KFVA 3WNFA 3DMJA 3OL8A 1ITGA 3HPOA 3PHEA 2XGQA 3QGIA 4UQGA 3O3GA 4RUCA 2R2TA 1RBVA 1SH2A 1C0UB 1C1BA 5HLFB 3VQ8A 4MFBA 3EPIA 1ZETA 3G6YA 4E1MA 1IKWA 3C95A 5KFHA 3MAQA 3SUOA 2ASDA 3NGDA 4NLUA 4FLTA 5KFRA 4J9SA 3D28A 1S1TA 4J2AA 3AV9A 3B6PA 4AHCA 2OPRA 4J9QA 4ECQA 2IAJB 1LWEA 2RF2A 4LSNB 1JLEB 4NCAA 4J9KA 1ZYQA 1LAWA 3FFIB 2E6LA 1VSDA 2RDJA 1NOYA 4DLGA 3KJVB 3I0SA 3EY1A 4KHRA 5L1IA 4E0DA 3QO9A 4K4ZA 1NK5A 4H4MA 2BDPA 2IA6A 4LQ3A 3VA0A 1C2PA 3K58A 2W9BA 3KLHB 4OLBA 4N47A 3SCXA 1KVBA 3WNEA 1IKWB 2RKIA 2G8IA 3KHLA 1C6VA 4F50A 1EP4B 1FKPA 4TLRA 1WSEA 4HVJA 4FW2A 3CJ2A 2HHVA 4CJWA 3QGGA 1K6YA 2P1JA 4M95A 3AA2A 1TK0A 3D0PA 2ALZA 5F8JA 5F8MA 5KFCA 4ZP8A 3I5BA 1S9FA 4CFAA 4NLWA 3V6DA 4LH5A 4IFYA 1IKXA 1ZTTA 3DYAB 4NYNA 4EP5A 2WONA 1TV6A 4CF0A 5KGXA 4DMNA 1BIUA 5T7BA 4H4OA 2IM0A 4LD0A 4X2BA 4KV8A 2W9BB 3OYDA 3CDWA 4I9LA 4NRUA 3RMCA 4Q8FA 5C42A 4ED8A 1RNHA 4NCBA 2GBZA 3RMDA 3KK1A 5F8HA 3ICLA 1C0MA 4B9SA 4FLXA 4FXDA 1D0EA 3H5UA 3NGIA 3HVTA 1JLEA 3NL0A 5K14A 4CEEA 4KO0B 3DRPA 4F8RA 3WNHA 4PQUA 1WLJA 1IO2A 4Q8EA 4PUOA 3LPTA 3OYNA 4IH7A 2OPQB 4DQQA 2OZMA 4IDKA 4DSFA 1YT3A 3L3UA 4NCGA 2EC0A 4KRFA 4EEYA 4DL7A 4CK2A 4IBNA 3LP2A 1SKSA 2QK9A 1Q9XA 4EZ9A 3C6TA 2BANB 2HNDB 1DLOA 3ZT0A 4DL6A 1WAJA 5C42B 2AWZA 1QHTA 3F9KA 1SUQA 4CJ4A 3UPFA 3T5JA 4Y2AA 2W42A 3DLEB 4O4GB 3DLBA 1UAXA 2G8WA 1D5AA 1NNDA 4KB7A 4CJFA 5DQGA 3I5AA 3AO2A 4FJ8A 3UR0A 4CHOA 1C0TB 2IM1A 1K1SA 4DSLA 3PX0A 4BWJA 4QWBA 3V6DB 3OJUA 4Y34A 3HKWA 4DU1A 4PWDB 3S9HA 3GILA 3HVTB 4JRQA 4ED6A 2VG5A 1IKYA 3OSNA 2KFZA 5EWFA 5DLFA 3H5SA 5C25B 5KG4A 4CF2A 2D7SA 4F4XA 2QKKA 4RW7A 1I6JA 3NAIA 1FKPB 4FCYA 3QIPA 4DFKA 3ALYA 3U6FA 4K4TA 4LQ9A 4FS1A 4R5PA 3VQPA 4JS5A 4JV2A 5I3UA 3DLEA 5EWEA 1TKDA 4MKAA 3M8RA 3NFAA 4DTNA 4TYBA 2G8UA 4F3TA 3V9SA 1LWFA 4DTUA 4M3RA 3V9WA 4RUAA 4C8NA 2QV6A 3IGVA 3OYKA 3K5NA 3ZSRA 1A5VA 4M3ZA 4ICLA 2EHGA 4PWDA 2UVVA 4K4WA 3MEEB 2HWHA 2UUTA 4ED1A 2FVCA 3BREA 3Q8RB 3NDKA 1XHXA 1TKZA 2R7YA 3OYLA 1BHLA 4FM1A 4I2QA 5CYQB 2F8TA 4CK3A 4IG3A 3ZSZA 3H40A 1RYSA 2RDIA 4ECUA 3RBDA 4CJRA 3PW2A 3KK2A 4JV1A 4YFUA 1HNVA 3GV7B 5KT7A 3RAXA 4CJLA 2R2UA 5EU7A 4RW7B 3HT3A 3BJYA 1RTIB 4BE0A 4ZPAA 4CE9A 2YHBA 3PO5A 2FVSA 1LW0B 2FLNA 4GC6A 5F8LA 1BQMB 4DTPA 2B5JB 1WNEA 3VA3A 1EETA 2IM2A 4DQIA 4PY5A 1FKOA 2ZQBA 1T3NA 4OKJA 4URGA 4J2BA 4DL2A 2V4RA 3V6HA 4CGFA 4JLHA 3RAQA 4WYWA 1TV6B 4ECYA 3LWMA 1VSJA 4CIFA 2HMIA 3MEGA 5DQIA 5JUMA 4TQRA 1UWBA 1RT5B 2IM3A 4FS2A 3VQ7A 4FJJA 3IS9A 4OPJA 3TAGA 5KRSA 5J1EB 3CJ5A 1BI4B 3V4IA 3SPYA 4Z4CA 4KHNA 1JIHA 1XHZA 2QKBA 3OL6A 3DRSB 4EBEA 3U3GA 1RCHA 5KFQA 3S3NA 5EUHA 2D0CA 3D5MA 2VG5B 3AVJA 3OS2A 2YNHB 1WSHA 4M94A 4HTUA 4OKEA 1D8YA 2XWYA 1T05A 4AHSA 1R0AB 3LP3A 2R8IA 1YTAA 4QOZB 3QNOA 4DSIA 4YR3A 4YNQA 5D3GB 4LH4A 4FM0A 4HHTA 4ECTA 3QETA 3TWHA 4HCBA 1WAFA 4CJVA 1N6QA 2GUIA 5DQHA 1L5UA 4GMJB 1LW2B 4M3WA 5HROB 2E4LA 2KTQA 1HYZA 3BQ2A 1KTQA 3V4IB 3NF7A 1C1CB 1DTTA 2A1RA 3CQ8A 3LP2B 1S0MA 3AVMA 4M3TA 4K50A 1RILA 5KI6A 1OS5A 5FDLB 2E9ZA 3DI6A 4CJ3A 2B6AB 1W25A 1UA0A 4Q45A 5KFXA 4B9VA 4CJKA 4GVMA 4OPKA 1FKOB 2HNYA 1RT6B 3KTQA 1EXQA 1VRTA 1S6PB 1G15A 3LP0A 4J9PA 3M8QB 4ZVEA 2ITGA 4JRPA 1TAUA 4AHTA 5KG7A 2C28A 1IKVB 4Z0UA 1NHUA 4CK1A 1VSIA 1QE1A 2A1SA 3DOKA 1RTDB 4LSLB 5KFYA 3BSNA 3DOLB 2W9AA 3ZSXA 4DTRA 3HVAA 3PO4A 2P5OA 5KFAA 4AHUA 4TQSA 4CHPA 3L2WA 5I42B 2IS3A 4WFYA 4DL5A 3AVHA 1VRUA 1SV5B 3G6VA 1HPZB 3K2PA 3KJVA 1KRPA 1RTHA 3BSCA 4ZTJA 4ZP6A 2E9TA 1J5OB 4FZXC 3HO1A 4NLQA 2IOCA 3CIZA 2RF2B 3GYNA 2D3UA 1TQLA 4KSEB 1TL3B 1UOCA 3NF9A 4WXWA 5HP1A 3K5MA 1I3AA 2JEJA 5HBMA 3PR5B 2ZKUA 4CF9A 5KFIA 3OYAA 2HHSA 1LWCB 1HQUA 1TKXA 1C1AA 3SUNA 3SYZA 4CCHA 4W5TA 1TL1A 4CEOA 2AX0A 2FVRA 2JGUA 3QLHA 2OYQA 4H54A 4KB0A 1JXLA 1XI1A 3HM9A 1RT2A 3PJXA 5EWGA 4ID5A 1RT6A 3PW0A 1N5YB 3BGRA 5DGBA 2HVIA 3LPUA 3QNNA 1TGOA 2VG7B 4Z4EA 5KFPA 2KQ2A 4ZHRA 4OLAA 5KFZA 2WONB 1NK4A 1W9HA 3JYTA 1CXUA 3KLVA 3H5XA 1T94A 4IQXA 1RDRA 2I5JA 2YKNA 2BE2B 2G8VA 4CFDA 2DFFA 4FJXA 1QAIA 1S4FA 4RW4A 2OPPB 2FLLA 5KG5A 2WB4A 1NJYA 3CG7A 3EZ5A 4QWAA 4ED3A 1D1UA 2IJFA 1LW0A 3MF5A 1TK5A 3C6TB 4K4SA 1Y97A 2FVPA 3O4NA 1RBTA 4URQU 1BQNA 1BCMA 3OYJA 2UVUA 4OVLA 2HHUA 1HQUB 1TKXB 4I7FB 3SUQA 1S1UA 1QUVA 4RNNA 2D3ZA 2ASJA 4IH6A 1KCFA 5HBMB 1U48A 4Y1DA 4IG3B 3SQ2A 1JLBA 3PV8A 3KLEA 2YHAA 3FDSA 4Q44A 4DG1B 3V1RA 4CJEA 4OJRA 5E41A 1BI4A 4W5RA 3CJ4A 1NHVA 3AO5A 4CGHA 3T5LA 5DLGA 1RBSA 1YTUA 3TARA 3HPHA 2X6SA 3V81A 3GIMA 3VN5A 1WSIA 2WCXA 4TXSA 3LAKA 3NKYA 4FVMA 2JLEA 4TN2A 3SI6A 3TAMA 4ED2A 4FK4A 3WNGA 5KFUA 3FFIA 1RTJA 2AGQA 1JLFA 1S9GA 4KHMA 1LAVA 4I2PA 2D0BA 3QINA 3KMSA 5J1EA 1JL1A 3L2UA 1S5JA 2FJVA 4HUGA 3Q8QB 4WFZA 1SKRA 3IG1A 4K8ZA 1MU2A 2XHBA 3QLHB 4B3OA 1S9EA 3DOLA 1NJXA 4KI6A 4FLYA 3M8PB 1TAQA 5KFWA 3VQ9A 1SH0A 4YR0A 1S1UB 2QE5A 2JEFA 4URSA 1RT3B 5KFDA 4CEQA 2WK4A 4BACA 4E89A 2P51A 1B9FA 1TK8A 4G1QA 3QEVA 4KI4A 4F4ZA 3OY9A 1NKEA 1XWLA 4B9TA 1S1WA 4CEAA 4RNFA 1YVUA 4KV8B 3KLFA 3TAQA 4DG1A 4DWIA 5KT6A 3RR7A 4ECVA 1WN7A 4N56A 1RT4A 3H59A 4W5OA 4LSLA 4RW9B 1X1PA 3OYHA 4QWDA 2DFHA 3UIQA 3D45A 3C6UB 5J2QB 3P5JA 2R8HA 3OLAA 3MR6A 3GIJA 2VA2A 5HRRA 2KZZA 4E7LA 5KFEA 4OGCA 3MXMA 3KKSA 3SQ4A 3ZSYA 2YNGB 4RW6B 4J2DA 1RT3A 1REVA 1Z26A 3N6NA 3KK3A 4B8AB 4DQRA 2XI3A 3P1GA 4ZMMA 4CFBA 3HP6A 5J2MB 1VSEA 2FBTA 3PY8A 3AO1A 4F3OA 4FK2A 2AJQA 1A5WA 4M3YA 4QAGA 2BRLA 3BGRB 1QSLA 2F96A 4NLDA 3ULDA 3VQ6A 2ASLA 1XR7A 3GIIA 2BRKA 2R2RA 1U4BA 3KLIB 3GV5B 2D0AA 5JS2A 5J2PB 4YMEA 3O3HA 2X78A 2X74A 5FROA 4O0JA 4HKQA 2AX1A 1XR6A 3MR3A 1U45A 1C0TA 3E01B 4N76A 4DF8A 1JKHA 3OYFA 2B6AA 3M9OB 4IDKB 4Q5VA 2XI2A 1SL2A 1B9DA 2YNGA 3QO9B 5CZ1A 5SZTA 2FVQA 4TSXA 4F2SA 3SI8A 3NF6A 2D41A 3V6KA 1RDAA 1NK6A 3DLGA 3C6UA 3KHRA 4XIUA 4C8OA 1BISA 3TANA 1NK7A 1CLQA 1ZBHA 3T19A 2W8KA 3CJ3A 3H5YA 3VQEA 3ASMA 4AH9A 2VG6A 5HRPA 2CJQA 4DTXA 3ZT4A 4ID1A 4F4KA 4ELTA 1QSSA 2OPRB 2NUBA 3ISNC 3ZCMA 1R0AA 2BQRA 4KTZA 1XC9A 3MEDA 2ZD1A 3OYIA 2O4GA 1QTMA 1S1WB 3OLBA 5L1LA 3TR8A 1CSJA 2AQ4A 2Z1GA 4I7FA 4QPXA 3KK1B 1YVFA 3NGZA 2FLPA 2KFNA 1IKYB 3MTKA 4DU3A 1ASVA 4EYIB 3K57A 4DTJA 2E9RX 1J5OA 1VSFA 3GIKA 1HJRA 1JLGB 4E7HA 5KFGA 5FRMA 3VQ4A 3RTVA 1HARA 3G86A 4EP4A 4HUEA 4ECRA 5J2NB 1A5XA 1RT7B 3A2FA 1NKCA 2B43A 3KHHA 3OYBA 4O3PA 1WNSA 2JC0A 4BDPA 4Z4IA 4KREA 4CERA 4YR2A 1NK8A 2HHXA 3V81B 3TI0A 2W9CA 5SWMA 3H98A 3KD1E 2R2SA 2I1RA 3LALA 3HVWA 3G6XA 4C8MA 5K14B 3QIDA 2HNDA 3DYAA 3EPGA 1JLCA 4TY9A 1N48A 4ICLB 3SV4A 3E01A 4DL3A 1ASUA 4O5BA 3PX4A 4DQSA 4ED0A 4E3SA 4F4YA 1I39A 4WZMA 3KLGA 4O3SA 4ZVFA 4J9LA 3BDPA 5HRSA 4Q0BA 1J9AA 1L3UA 5I42A 3RRGA 3MECA 1S1VA 1UWBB 1HNIB 5KRTA 4F4WA 3DRRB 3N6MA 1RT7A 1U09A 3DLKA 1RAJA 4Y3CA 3ZT2A 2PYLA 4ID5B 3CWJA 2WOMB 3K5OA 3VQAA 4O4GA 4RZRA 2XCPA 3PX6A 1HRHA 4DS4A 4RNMA 2VWJA 4CEBA 3SQ1A 3DMJB 3RR8A 1EETB 4CHNA 3THVA 4FJNA 4J9NA 2RN2A 1D9FA 3DLRA 4E19A 3ZSOA 3NBPA 3O3FA 3H4DA 3OVNA 1SL1A 4FK0A 1TVRA 3KLFB 4HYKA 5C5JA 4CJUA 4BDZA 3NCIA 3KOAA 3SUPA 4MQ3A 3DRRA 2XCAA 3JYTB 4K4XA 1HQEB 2VG7A 4DSJA 2JEGA 5HROA 1DLOB 4CEFA 4MFBB 4CHYA 5KG3A 1NJWA 2O4IA 2BANA 2GC8A 5KG2A 3V9ZA 3JSMB 2BQUA 3CJ0A 4EYHB 1RT2B 1EP4A 3TVKA 1S0OA 5KFBA 4TY8A 3QEWA 1IG9A 5KT4A 2YKNB 3H2LA 1GOAA 4B08A 4DS5A 4IG0A 5KFTA 3H4BA 1LWFB 4RW4B 3DDKA 3Q8PB 1JLAB 4IFYB 5F8IA 2J6SA 2BGGA 1RDCA 1S1VB 4E7IA 1S1XB 3AVBA 3L3VA 1X9MA 2F8SA 4IFVB 4BWMA 1BL3A 2Q3SA 4ZPCA 4E7KA 5KFMA 4KPYA 3QYYA 4CJQA 1QE1B 4R5PB 3RWUA 4KHYA 3NBPB 2UVWA 1LW2A 1U47A 4ZVGA 4IR1A 1EX4A 3LZIA 4ECXA 2ILYA 4FJHA 2PYJA 3HJFA 4DF4A 3DLKB 3TAPA 3KK2B 1K1QA 1HQEA 4CGGA 4M42A 3UDLA 3CFRA 3NH2A 4FJMA 3L8BA 3IRXA 1RTHB 4DTOA 3VQDA 4NLPA 3NGYA 5J2MA 3I5CA 4PQUB 3NF8A 3V9XA 4CJSA 2IBKA 3T5HA 2IC3A 3LP1B 5KTQA 3AVIA 4MK7A 2Y1IA 1KVCA 4OKKA 4J9MA 3HK2A 4I9QA 5HRNA 1L3VA 4FJKA 3OYMA 1TL3A 1ZBUA 4N5SA 2ETJA 1Z4UA 3I0RB 2XGPA 1HNVB 2IDOA 5DG8A 3AVCA 2XRIA 1JLGA 4HCCA 5EDWA 1QQCA 3AA4A 3QEPA 4Z4GA 3KIOA 4CJTA 5KT3A 4KFBA 4ZTFA 3AVFA 3B6OA 4FW1A 4FJIA 1DTQA 4EBCA 1CXQA 4Y1CA 2HHQA 2BQ3A 2J6TA 1IKXB 2XY6A 1JL2A 2YNHA 2UUWA 5KFKA 3QZ7A 5CYMA 4QWCA 4IKAA 2FBYA 3T5KA 3E51A 2IMWP 2YNFB 3OL7A 2B5JA 3SPZA 2IJNA 4XPCA 3KMQA 4FJ9A 1RT1A 3HXMA 5L1JA 3DM2B 4ECWA 3CYMA 4IRCA 1X9WA 3M8QA 1RDBA 4QW9A 4RW9A 3V1OA 3QIPB 3GQCA 1C1CA 5F8NA 3MR5A 3SZ2A 4R8UA 4FJ5A 4WYLA 3FSIA 3ZSQA 2OPPA 4C8LA 1HYSB 4DTSA 4NLRA 3MXJA 5KG0A 2XY8A 4WFXA 2KZMA 1JXBA 4O3NA 1WSGA 4CIGA 1X9SA 3KLIA 4CECA 2AGPA 3CDEA 3NMAA 3U3YA 4C8KA 3NAEA 1QS4A 4M3XA 4J2EA 4RW8B 5J2QA 4IOBA 4ZHRB 4DTMA 2V0NA 3V9UA 4O3QA 3BQ1A 4H4MB 2VA3A 4KHWA 4KTWA 2FC0A 1BIZA 3ITHB 1TKZB 2QXFA 2ATLA 2C2EA 4U7CA 4HUFA 1RDDA 1CZBA 4FZZA 4R0EA 1NK9A 3ZSVA 4CHZA 1SH3A 3AVKA 2RKIB 2YNFA 1EKEA 1S49A 1TKTB 2GV9A 3H08A 2W7PA 5KFOA 1BQMA 3OYGA 3CFOA 1LWCA 1HMVA 1ZBIA 4CGJA 5KFNA 2C2DA 4KHQA 2P5GA 2F8EX 3QZ8A 1VRUB 3OHAA 4DSEA 4DEZA 4O44B 4EO8A 5CYQA 4PA1A 4B9NA 2XC9A 4YP3A 4J9RA 3RBEA 2G8KA 5JXSA 4KHUA 1JLAA 2GIQA 1KFDA 3TAFA 4RW8A 3DLGB 3IG1B 3SJJA 1RTDA 2ZE2A 4EBDA 1S48A 3FQLA 3S3OA 2W7OA 5KGWA 5F9LA 1BGXT 3AA3A 4MKBA 3AO3A 4I2PB 2XY7A 3SNNA 2HHTA 2HVHA 4DFPA 1SL0A 3TAEA 4DLEA 4CEZA 3OJSA 3P83D 2R8GA 1S10A 4JV0A 4O0IA 1T7PA 1SV5A 4JUZA 3MEGB 1QAJA 1Q9YA 4ELUA 1RT4B 1S6QA 3TQ1A 3LWLA 4IKFA 3NHGA 5DK5A 1S9EB 4IFVA 4B9LA 1Z25A 4IG0B 4ZVHA 4Y2CA 3LZJA 2X6NA 2R8JA 3LAMA 1XR5A 1TKTA 2PY5A 4K4YA 1KSPA 3PUFA 1BQNB 4MH8A 3HP9A 4DL4A 4BE1A 4MK8A 3RB6A 3ITHA 1N4LA 4MIAA 3M9NB 3HSTB 4O3OA 4IRDA 3L2VA 3RB3A 1FK9A 1T03B 3MEDB 1HYVA 2W9CB 3DRPB 3SFUA 3DI6B 3VQCA 2HB5A 2HHWA 2DFEA 4PUOB 4FLVA 4DFJA 4ED7A 3CM5A 1NKBA 1JLQA 5J2PA 2HNZA 2YNIA 3CDUA 2VWKA 5CYMB 4JS4A 3T3FA 4CESA 1IM4A 2FBVA 1N5YA 2OZSA 2HAIA 1ZBLA 3T1AA 4DQPA 2HMIB 4M41A 3IAYA 4N41A 1GOBA 1VSHA 5C25A 2CKWA 1UA1A 3QEXA 4FYDA 3HHKA 5CY4A 3MXIA 3QERA 3KHGA 3OHBA 4Z4HA 1GX6A 1MMLA 4FBUA 2WOMA 4NLSA 3ZSWA 4FM2A 5KFSA 1KVAA 2HW3A 4ZPBA 2HWIA 4LY7A 2KW4A 4AHRA 1ZBFA 3MFHA 4KFBB 4MIBA 3V6JA 3ZT3A 5JS1A 4QWEA 3L2QA 4Z4FA 4WE1A 3V1QA 4CIEA 1FK9B 4YQWA 5C24A 1RT1B 4B8CA 2R8KA 3JSMA 4Q0BB 4CJPA 3HL8A 4FBTA 5D3GA 5KT2A 4KAIA 2HNZB 3LP0B 2YNIB 4WXOA 2UVRA 3SQ0A 1J54A 4KB1A 2OPSB 4G3IA 4I2QB 1JLQB 3CVKA 4NLTA 4FJGA 1U04A 3LDSA 1VSMA 3TAMB 2DPIA 1QSYA 5KFJA 4B9UA 2DPJA 5KT5A 4CF8A 4GC7A 3NE6A 3DLHA 2Z1IA 2OPQA 4G1QB 4BDYA 2WHOA 3OYCA 4GW6A 3EYZA 1MU2B 4CFCA 1B92A 3AO4A 4Q43A 5F8GA 3M8SA 3AA5X 4IR9A 4FLWA 2J6UA 3HVRA 5C24B 4NRTA 3RMBA 1RT5A 1NK0A 4O3RA 2WTFA 2ZD1B 2C2RA 4DU4A 3Q8SB 2ATQA 2OA8A 4NCGB 4DFMA 2JC1A 4NLOA 3UQSA 4FJ7A 3IN5A 1L3TA 4KTQA 4KKOB 1KLNA 3FQKA 1FXXA 1S1XA 5L1KA 1BCOA 4CHQA 4KO0A 1RBUA 4W5NA 3FRZA 1ZTWA 1L3SA 2VG6B 4U6PA 2OPSA 4NLYA 3QESA 4FLZA 1S97A 4RU9A 4FLUA 2ILZA 3ISND 3NAHA 4KAZA 4AILC 4CGIA 4K8XA 2W8LA 3S3MA 1N56A 1TL1B 2IC3B 1HNIA 3PZPA 3AVNA 3AVAA 3KLHA 3OS1A 2O5DA 3KKRA 3CFPA 5KFLA 4DSKA 1D9DA 1RBRA 1DTTB 1DTQB 3GV8B 4FJLA 3QGHA 4W5QA 2AGOA 2IGIA 4OL8A 1SKWA 3NH0A 3SV3A 1JXEA 5F9NA 2PZSA 4E7JA 2AU0A 3NH1A 1S0NA 1TP7A 1C1BB 3KNAA 2I5JB 1S6PA 2LSNA 1KHVA 4K4VA 1S1TB 3RB0A 4TYAA 3OSPA 3PW5A 5J2NA 2BE2A 4FZYA 1KHWA 2XY5A 4LSNA 2XO7A 3DM2A 3MFIA 3MECB 5KG6A 5FDLA 3OL9A 3RMAA 1IH7A 1REVB 1RA7A 2HNYB 4CJ5A 4WZQA 3DOKB 1VSLA 3KLGB 2V4QA 3C94A 3HYFA 1GX5A 4M45A 4BE2A 4NLXA 4J9OA 3PVXA 3I0SB 1HPZA 4TY8B 4NLGA 1CZ9A 3AVLA 3L2RA 4K4UA 2BR0A 2D5RA 4KHSA 4XO0A 3I8DA 4E1NA 1W0HA 4NZ0A 2C22A 3KLEB 4EZ6A 1RTJB 1GOCA 5CZ2A 3O4QA 5T14A 4B9MA 3VQBA 5HP1B 4NYFA 3BSOA 2DY4A 4CEDA 1VK0A 3BQ0A 1T03A 2YKMB 4QCLA 1ASWA 1VRTB 3RRHA 4B3OB 1VSKA 4NLVA 5L9XA 4WE1B 2Z1HA 1IKVA 1RYRA 5DMRA 2OH2A 1WSJA 2Y1JA 4L8RB 3QIOA 4AHVA 1HYSA 2WRMA 1JLFB 1S9GB 4IH5A 1RTIA 3AVGA 5KFFA 3K5LA 3OYEA 4CF1A 4H4OB 1J53A 2EX3A 2GIRA 5DGAA 3LP1A 5DG9A 3VQ5A 1T05B 4QW8A 3M8PA 3PW7A 3CO9A 3G0ZA 4EO6A 4RG8A 3G10A 4O55A 4F2RA 2G8HA 3LANA 4ZP9A 1T8EA 1HMVB 3VQQA 3I0RA 2YKMA 3IS9B 2FBXA 2E6MA 3DRSA 5DG7A 1NJZA 4O4RA 1RA6A 1Q8IA 3CM6A 2FJXA 4KE5A 5FRNA 3IRXB 1KLMB 2IAJA 4KBIA 3HPGA 3N6LA 1WSFA 3BSAA 3PW4A 3BR9A 3OS0A 5HLFA 4ECSA 3MR2A 3RB4A 3QEIA 2Z1JA 3VQSA 1SUQB 4RNOA 3IGNA 1F21A 2B4JA 4NYZA 1C0UA 4XPEA 3K59A 3TABA 4OGEA 2ZE2B 2FJWA 4RNHA 2V9WA 1O1WA 2G8FA 1NOZA 3MEEA 2JEIA 1N6QB 4CGDA 3F73A 4M3UA 1LWEB 3PJWA 4ECZA 1U49A 2DTUA 3ZT1A 5KG1A 2YV0X 4ELVA 4ZP7A 4ZPDA 3EZUA 5I3UB 1JLCB 4O44A 4MK9A 4KKOA 1S6QB 4H8KA 1LV5A 1JLBB 4RW6A 2RPIA 4IRKA 4R8UB 3PR4A 1JKHB
chains in the Genus database with same CATH superfamily
1P6TA 1JX4A 1GH8A 4C0HA 4YB1P 5K8OA 2WVEA 3OL8A 1E6YA 1ITGA 4GV9A 4DQ8A 3FEXB 4E98A 2GMJA 3OW2M 2A18A 4MDBA 2MKKA 4BRKA 3Q0AA 2RRNA 5HLFB 3VQ8A 3TZYA 1R8PA 4CZGA 2NRWA 1OSCA 4LC9B 1UVKA 4FLTA 4X4TA 5AQHA 1PO6A 3N5FA 1HI8A 1N36J 3VAJA 3HSGA 3B6PA 2OPRA 2QL9B 4PR6A 3JAMO 4J9QA 4LF2A 4LFCF 4KIAA 3FC9A 2OI2A 4CH1A 3SBGA 2HBYB 1JLEB 2B9YA 1MWZA 2YX4A 3PKMA 5EX5A 1ZYQA 5JVHQ 1LAWA 3H45C 2E6LA 3SCIE 4OZ2A 5LXYA 2Q2RA 1V3SA 4J9UE 3IFEA 2IA6A 1ACMB 3K8WA 1C2PA 3K58A 2W9BA 3C7NA 4DV4K 5HN0A 3UWTA 5HMXA 4DV2F 2G8IA 2AJFE 2MY7A 3CETA 3J7ZT 4KHPJ 3UD5A 4DX7A 2J76E 4FW2A 3QGGA 1YJWS 2ZC3A 4DHYA 1LXJA 2DD8S 4I68A 1UVJA 3I5BA 3MN5A 4NLWA 3CCSS 3V6DA 4IFYA 1IKXA 3DYAB 1YTYA 1U1OA 1M90O 2ZM6J 1F1BB 2Z2ZA 5I3PA 3ZZUA 4DMNA 3NNCA 1BIUA 5CHIA 1IBLJ 2IM0A 4ENOA 3L4QA 3R5CA 2D9PA 2EWHA 3NCRA 4F04B 4AQYF 3FFKB 2OTLS 5G0RA 4N8OA 2UU9F 4ED8A 3ZETB 2OTJN 1YLXA 2P9NB 3ICLA 1FWLA 1RWNB 4B9SA 1D0EA 4V19S 3QFWA 4FO0A 5K14A 2YBVA 3DRPA 4PQUA 1WLJA 2V2QA 4Q8EA 4EWTA 4PUOA 3E66A 2OPQB 1YVNA 4BHQA 4DQQA 4LFBK 1AT1B 4MO4A 1RB0A 3WQTA 2E1ZA 4NCGA 2EC0A 4UOGA 4AQYJ 2XBPA 2LQ9A 2QK9A 4USWA 4DV4F 4JI2F 1K9MT 4QR0A 4AT1B 1SUQA 4ZCIA 5I4MA 4DV1K 2ZKTA 2Q6BA 1TUYA 4O4GB 1HNXK 1QVFR 3DLLQ 5GAEP 2KLAA 4HVZA 4KB7A 2VICA 5JVGQ 2Z2LA 2ZBPA 3L7PA 5AQRA 2YQ3A 1K1SA 4XDDA 4B3SJ 3JAMY 5BPLA 3WBZA 3JQKA 1IKYA 5EWFA 3N9UC 1M5HA 5KG4A 4F4XA 3OQ2A 1BHNA 1FE4A 3LO3A 2PE8A 4WKYA 2FB0A 1Q86T 2DGXA 1VR6A 2O8DA 3VV2B 5CD4H 1LOTB 1XMQF 4JV2A 1FXLA 5EWEA 1YWXA 5EXWA 4CQ1A 3W64A 2FHJA 2G8UA 3V9SA 1LWFA 2BABA 2QV6A 3Q2SC 3IAS9 1B99A 3LPYA 1KOOA 2A41A 2UVVA 4QR1A 3MEEB 3ZX3A 3BREA 3I55N 3Q8RB 3NDKA 4FWSA 4EGLA 2NXJA 4JI1K 2O8FA 3CCVN 2A42A 2E29A 1RYSA 2RDIA 3RBDA 3FCHA 2R7WA 4TVAB 1OY8A 1HNVA 1GLAG 3GFYA 5KT7A 3HT3A 1FI4A 3BJYA 1SXLA 4JI0K 1BQMB 4DTPA 2IM2A 5H9EK 3DAWA 3TOQA 2ZQBA 2O8EB 4U96A 4URGA 1V9OA 2BEFA 1NMDA 6FDRA 2V4RA 3V6HA 1SC1B 5CCLA 3VTIA 3RAQA 1ICEB 1TV6B 4OLPA 4RPFA 1VSJA 3CD5A 2QTDA 4X66K 2HMIA 3MEGA 4WQ4C 3I87A 1UWBA 1RT5B 2IM3A 5DDQC 5IXUA 2EFPA 2CIMA 4CZFA 3A8EA 4DN0A 4DPWA 4JV5J 2CRLA 1CJUB 5J1EB 1P8GA 2CH6A 4KHNA 3P38A 1OSDA 3DRSB 3U3GA 2V9KA 1VQ4N 4NMXA 1O0PA 3DNCA 3S3NA 3TA2A 1FRIA 4NL5A 3D5MA 3ZXWA 1FFSB 1RLDA 3OT9A 5AT1B 3SBMA 3LGMA 2O01C 3CJ9A 4AHSA 1R0AB 2F63A 2R8IA 1FFGB 1YTAA 3GE9A 2PAVA 1VQON 2CJYB 4K0KK 3ZEUA 1QY7A 4WU2A 4JI6K 3TA1A 1PKUA 4ECTA 1VQ6N 4HCBA 1CC7A 1WAFA 5H9FJ 5DQHA 3GSIA 1L5UA 4GMJB 2R7OA 1HYZA 3BQ2A 4BY9C 3NF7A 3MUVP 2PMWA 4WFNL 1C1CB 2IPOB 2G1DA 1S0MA 2F4VF 2Q79A 4K50A 3PSFA 2E9ZA 4BR2A 3DI6A 2AEJA 4DV7F 4BR4A 1M1HA 5KFXA 4MDAA 3D9BA 4OPKA 3BF4A 1IR0A 4QZVB 2GX8A 2FHMA 4IQMA 1EXQA 5D0RA 4K5RA 3AY0A 1IKVB 3SAGA 2ZH8A 3IM8A 3CC7N 2F9WA 1Q86O 2K3KA 3DOKA 1S0VA 7FDRA 4XEIA 4DTRA 4YOWA 3PO4A 1U25A 3OTCA 3E9PA 2PSZA 5KFAA 4AHUA 2Y1LB 4MJKA 5E5NA 3L2WA 5FD1A 4IEEA 2IS3A 2ZF5O 4A5AA 1SIWB 2P9IB 2GW8A 3U1LA 4YOVA 3AVHA 3BPSP 2G1HA 5H9EJ 3L9ZA 1WELA 4KGZB 3KXDA 1FD2A 2HF4A 4NLQA 3CF5Q 2A2DA 3SSRA 4CLYA 1MN9A 3TA0A 4PEOA 3C0BA 3Q2TC 3WT0A 3GYNA 4FZVA 2D3UA 4JI6F 2EFVA 1N52B 1TQLA 4MO5A 4WFAL 1NB7A 2WAQD 2HURA 4W4MA 3PYDA 3BO3A 4GVLA 3BKUA 1KAYA 4CCHA 4W5TA 4MYTA 1TL1A 4CEOA 2AX0A 3CCQS 3UE2A 2ZGYA 1WUAA 1GXUA 3BN4A 5C2GA 3B78A 1U02A 3TYTA 5HQ8A 1QQMA 1VQ5S 2OANA 3BGRA 2YXLA 2HVIA 5B8HA 2RUSA 1IG8A 5KFPA 1R43A 2CNLB 1MWMA 1W9HA 2O8FB 4DUZF 2HIYA 1VHXA 4IQXA 2YKNA 2L48A 2BE7D 4CFDA 2RRBA 5ADZA 1QAIA 3HFVA 4RW4A 4LRFA 2MJNA 2WB4A 1VGYA 5A8WB 3OFFA 3CG7A 4QWAA 4ED3A 5LXRA 1TK5A 2RH3A 1VC6A 1Y97A 3RW7A 3I56N 3D68A 1RBTA 3DRYA 1H98A 4M5IA 1BQNA 2IRYA 2UVUA 3I33A 4CIOA 2HHUA 1TKXB 3SUQA 1VCTA 2D0OA 1WC1A 3NWRA 4DN9A 3D54A 4IH6A 2RS8A 3H25A 2CZVC 5AQXA 5D15A 4BVOA 2XM3A 1H3DA 3KLEA 2OD6A 2YHAA 4PL8A 2O8BA 2MGZB 4C1NI 1BU6O 1IBKK 1W2IA 3CCTA 5IZHA 4OJRA 3TUZC 4C0BA 3T5LA 1CBKA 3GG4A 2MHNA 1N8RT 5FLXO 3TARA 3HPHA 1S3XA 2X6SA 3V81A 3GIMA 1X4CA 1K9MO 4TXSA 3LAKA 4BQZA 5D0GA 2LFVA 2GMHA 2FIUA 3CCRS 3SI6A 3TAMA 3P8BB 4FK4A 4QS8A 1MROB 2AGQA 3FGUA 3H20A 2BM1A 1RGIA 4CZCA 1WDTA 4KHMA 4I0WA 1N33K 1WHVA 2C2KB 4MIWA 2CQCA 1FD8A 2P8IA 2CG4A 1SKRA 3IG1A 4K8ZA 1VLYA 1MU2A 2CJBA 3QLHB 2ZVSA 2XHBA 1CS4B 2OGUA 2VFVA 2MGZA 2X3GA 1NJXA 4FLYA 1WC3A 5BRDA 1P8ZA 1HA1A 3VQ9A 1SH0A 4DV2K 3B54A 3TEGA 1XTZA 3CIMA 4Y00A 4URSA 3B4MA 3GIRA 2DNMA 2ZH2A 2K1RB 2P51A 3NP5A 1B9FA 1TK8A 4G1QA 1RZMA 4KYZA 2QFIA 1NKEA 1XWLA 4B9TA 3QWPA 4CEAA 2HFZA 5IV3A 3CO0P 2YQ1A 3H59A 3J7ZO 3ZX2A 4LUBA 3OYHA 1DY3A 1Y5NB 1P90A 2DFHA 2ZC4A 4BR0A 3R1HA 2WB1D 3IDHA 3D45A 1XNRF 2B56A 2R8HA 3UDVA 5M2RA 3GIJA 4NXNJ 5HRRA 1EWQA 5KFEA 4OGCA 3MXMA 3KUGA 3KKSA 5BR8K 2RSQA 2XYHB 1Z26A 2MLZA 2UUBJ 2OSRA 4LF4K 2OO4A 4ZMMA 3HHEA 5J2MB 1VSEA 4PG7A 1VBYA 2AJQA 3ENWA 3OA9A 4YOXA 2ZM6K 4ZJQA 1JQGA 3ULDA 2QA4G 1TYQB 3VAFA 2HQCA 2HSEB 2ASLA 1CC8A 1XR7A 4LBIA 2P2CB 4NA2A 3BDEA 3KLIB 2JH3A 4YMEA 3GR1A 1DJ0A 2ZZNA 3SAFA 4F36A 4CO0A 2XMMA 2X78A 3H2UB 2R3VA 2IVPA 1EO1A 1I94J 3AAQA 3EE9A 4DPYA 3RVCA 4OPAA 1NSAA 3MPUB 1DQ8A 4CYUA 1FEEA 1C0TA 3BGLA 1WWHA 3E01B 4DF8A 1YX2A 4IXCA 4Z2XA 5GADI 2AJ1A 3M9OB 2ERRA 3JXUA 3QO9B 5SZTA 4EAHD 2FVQA 2XSJB 1S4EA 1NK6A 3DLGA 3BY5A 3C6UA 3KHRA 4C8OA 1BISA 3M6GA 1CLQA 1PYTA 2DR5A 3CJ3A 3H5YA 2XMJA 5MLCV 3ASMA 5B0CA 1P1TA 2VG6A 5HRPA 2CJQA 2LDYA 5LMUJ 3D2FB 3ISNC 2HQFA 4OYMA 4EFHA 3JTOA 1XC9A 1S1WB 2FF6A 3TR8A 4CYUB 2AQ4A 4QPXA 4KGMA 1YVFA 4E8UA 3A3OB 1IKYB 2KVIA 2CH5A 4DU3A 1SVDA 1XMOF 1B7YB 4RWXA 5AZIB 1VSFA 3U9ZA 2M2BA 2OIHA 3M8YA 4B3TJ 2OFHX 2RU9A 3RTVA 3C7NB 3G86A 4EP4A 2HGLA 3A2FA 5AQIA 1OYEA 1WNSA 2DR6A 3T6JA 2HHXA 1NK8A 5SWMA 3G6XA 4LF9J 4ICLB 4DL3A 1RSCA 1Q16B 3M30B 2PMHA 2F1FA 4RBUA 4ED0A 2J0WA 4CWBA 4ZVFA 2V2ZA 2IYGA 1J5EJ 2DJWA 5D0HA 3S7RA 2ZOGA 4WF9Q 4LIWA 1L3UA 4YEAA 3GONA 5IQQA 4V19X 1ATNA 2QEXN 3MECA 1S1VA 1UWBB 1HR0F 4CLWA 2BKOA 4MAKA 3POTB 4F4WA 5AZJA 5HAOA 3D2FA 1VQPN 4DV7J 3MCPA 3P96A 4H0YB 1FW6A 3CJ7A 1UZDA 2M4MA 4J5OA 3VQAA 4O4GA 4RZRA 2QWPA 4LF8K 4BRCA 3MHYA 2O8EA 4RNMA 3P4UB 2VDIA 4CEBA 3SQ1A 3RR8A 1YXQA 2EPIA 4K7QA 4CHNA 4ES1A 1TL4A 3WIUA 3THVA 2UUBK 1XQSC 2FZGB 1M1KT 2M0GB 3H4DA 4FKYA 5A8RA 4WKRA 2FZCB 3J80O 4FK0A 4CD1A 2BYCA 2ZOMA 4PYDA 1YDLA 3QT7A 3DRRA 4DSJA 3HM8A 5BPNA 2BANA 2GC8A 4X84A 3JSMB 2YPYA 3WXKA 2VCPA 2K8GA 1UTAA 1P1LA 1WOOA 1WSVA 1Y3KA 1IG9A 4BRQA 4X64K 3MN9A 4YHHK 2YJFA 4DS5A 3G9CA 1LWFB 4RKUC 2BGGA 4DV7K 1K0VA 1S1VB 4ISEA 3VOVA 1AZSA 3L3VA 4RL1A 3VTHA 1C4CA 1J6ZA 1BL3A 4KPYA 1VQKS 1WI8A 2KM8B 5IT9O 2O8DB 2MLYA 2DGSA 2UXBF 2UVWA 1LW2A 1E6VA 1U47A 5E7OB 4IFEA 4ECXA 2PYJA 2HK2A 4DF4A 3P31A 3CJ8A 5LMUK 2A3ZA 1H0HB 3TAPA 3H1QA 3KK2B 1AYEA 4CGGA 3CCWA 4LF6J 3PG9A 4NYOA 2IFXA 2LQ5A 4FJMA 2B7CB 3VQDA 2HHHJ 2MKYA 5J2MA 3V9XA 3LP1B 2J9CA 4MK7A 2Y1IA 1KVCA 5M1QA 4F4AA 4ZK7M 2LP4A 1TL3A 3OV7A 3CC4N 1ZBUA 3O6QA 3FJ2A 2ZH3A 4OX8A 5ETTA 1BWEA 3BF1A 2XRIA 3EE3A 5EDWA 4CJTA 2FHKA 1WKKA 4LVOP 4ZTFA 3W62A 3G8QA 5L46A 3HJVA 2R7VA 4FJIA 4H5TA 3O9SA 2HHQA 2BQ3A 1I94F 1JL2A 1HFEL 3QZ7A 5CYMA 3WXIA 4JI0J 1PBAA 1GTHA 2J5AA 2YNFB 2C2MB 2W4DA 2VDHA 2UV8G 1Y10A 3SPZA 1U2RA 3PEJA 4LF4J 2B4UA 1VMBA 5AQUA 1KD1O 2IVNA 3M6VA 3T1YJ 3DM2B 4UTGA 2PFDA 1X9WA 2BJ1A 4X65F 1YJRA 4B02A 4OI1A 4RW9A 1PIEA 3V1OA 3IXQA 2DNOA 3OR2A 3GQCA 3MR5A 4R8UA 4WYLA 3ZSQA 4FSVA 4WTOB 1ITPA 1B0VA 3TZWA 4O3NA 3BKFA 3KLIA 5IS2A 4CECA 3CDEA 1VC0A 1S57A 1HW8A 1NDCA 3ET6B 5ADXA 3NAEA 2RDDA 5J2QA 2Z4PA 3PLAA 3BF3A 2J8SA 4DTMA 4DU8A 1U2CA 2WVBA 3Q86A 4ANEA 3V9UA 4O3QA 4KHWA 1MW7A 2VA3A 2DISA 4KTWA 3I4HX 2DXEA 2FHOB 1XNQF 1TL7A 5K5MA 2FC0A 1BIZA 4WBFA 3ITHB 1TKZB 2ATLA 4U7CA 2MEWA 2DGVA 1M5VC 2GVZB 3L95X 2Y3YA 1ATRA 3MM9A 3AVKA 1W7WA 3FZFA 2YHWA 1H73A 1S49A 1GK8A 5CYJA 5JICA 3MPYA 4OYIA 3OYGA 1X8DA 4CGJA 1WBBA 2VB6A 5KFNA 4X4OA 4B3SF 3ENOA 3R9PA 1PSDA 2NLXA 1WKLA 2ITMA 4DEZA 1XNQJ 2A10A 2XC9A 1AZSB 2XO6A 4J9RA 1UL3A 3T69A 3OTOK 2G8KA 4BC2A 4KHUA 2ZWHA 3DLGB 4MKYA 2ZE2A 4EBDA 2FYXA 2W7OA 1TL7B 4G1IA 1BGXT 1EQMA 5F9LA 3O8MA 5HMWA 2Q3PA 4DHVA 4LBPA 3MR7A 5IQ6A 5IOLA 4K2JA 3DCAA 3P83D 4IZ9A 1HNWK 1GLEG 3W9JA 1SV5A 2X51A 5J1NA 3ZNUA 3P4IA 3ZNJ1 3LWLA 1BA0A 5DK5A 2HZAA 5M1PA 2ASOA 4IG0B 1X5TA 4Y2CA 2X6NA 4J9VA 5L8RC 2F40A 1TKTA 4K4YA 2CJXB 3UFCX 4QIEA 5B0BA 3HHNB 1O8BA 4MH8A 4DL4A 4BE1A 4YDDB 2DITA 4MIAA 3HSTB 5F3ZA 2E7WA 1FDAA 1FK9A 4MKVA 3GWCA 2NRZA 1BMQB 3S41A 2ALYB 4LRDA 1HYVA 1HR0K 1YSJA 3SFUA 4FL9A 3ZTOA 1X0FA 2DFEA 4B3RF 3BZQA 4KH5A 2BXJA 1JLQA 1CLFA 2MKSA 2AP1A 2O8CA 4ZKAA 4LFBF 3OD2A 1S76D 2YNIA 1GLLO 5A8WA 5CYMB 2GV1A 4ES3A 4WTYA 4DV0J 2L9WA 3LPEA 2EK6A 2OZSA 3EKUA 1ZBLA 3M8ZA 8ATCB 2CJAA 2H1YA 3SCKE 5C25A 1PJ7A 1UA1A 4DPTA 3MXIA 3M30A 3KHGA 3OHBA 3KDOA 1MMLA 2XNQA 4HT7A 4FBUA 5KQ8A 3ZSWA 1MWQA 2G0IA 1GTEA 2PD1A 2RD5C 1IJFB 4KH0B 5DETA 2BUNA 4F67A 3D0HE 3THYB 4CI0B 2KT5A 3QQCD 4WE1A 4JI1F 4CIEA 4YQWA 3SAHA 1IJJA 4B8CA 3HMJG 4CJPA 3MWTA 2F65A 2HS3A 3FR0A 2HNZB 3J81j 2DR7A 3K89A 2OCEA 2V5HG 2DPIA 3IC1A 1ZM3A 3TO8A 2CXEA 1R6VA 1HNZF 2E2QA 1FCAA 3DKDA 3MD1A 3OYCA 4GW6A 2ZBCA 2EI5A 5F8GA 4A8XA 5BRFA 4NRTA 1RT5A 2DGQA 2WTFA 2C2RA 2AF6A 2CQ0A 1LK5A 4A2AA 4FJ7A 2VFSA 4LRCA 4F0HA 1KLNA 1S1XA 2UXDF 2EFNA 3RRKA 2G4BA 1NM1A 4W5NA 1Q1KA 3FRZA 1UCNA 4PCQA 1L3SA 4ZOSA 4GMKA 4CLKA 2EKNA 1R3NA 5GMEA 3FKBA 3QESA 1U1QA 3QATA 3C3LA 1RWWB 3DHWC 4FLZA 1IQZA 4JI4F 3AODA 4CP5A 4X4RA 2DIVA 3QMQA 1Q7YT 3HT0A 1GT8A 1F9EB 3SBTA 2IC3B 4DV5F 4B3MF 3AVNA 3R8EA 3KLHA 2IVFB 2CNOB 3R5JB 2WW4A 3CFPA 2AJ2A 3JSBA 5E2QA 3PIOL 2FF3B 4LFAF 4FJLA 4W5QA 3VF4A 4Z94A 1SKWA 3FMWA 3NH0A 3SV3A 2ZWPA 1S0NA 1TP7A 2H9ZA 3EWGA 4H4KC 2LSNA 4N8NA 4IYQA 1TFYA 4ISGA 2HFSA 3OSPA 2RHSB 3HHLB 5J2NA 3KG1A 1N5SA 4LSNA 3R97A 3MFIA 4PXCA 5KG6A 3GJSB 1QUPA 1DEJA 1RA7A 2V4QA 3C94A 3MM8B 4M45A 2ZDOA 4J9OA 3I0SB 1PILA 5DDPC 1CZ9A 3OTEA 3PSIA 2HFOA 3L2RA 2D5RA 4XO0A 4DR4K 3ZFVA 2QL5B 1W0HA 2C22A 2E5LK 2AHOB 2CJKA 4B9MA 5A76A 4OQJA 2XS2A 2CPFA 4LRBA 2VF3A 3VEVA 1CJKA 2IDEA 1HHSA 3IFRA 1APSA 1T03A 1J5EK 4GO5X 2YKMB 2CQPA 1VRTB 2HHPA 2Z1HA 1RYRA 1RQ0A 2Y1JA 4L8RB 3QIOA 2Q43A 4YHHF 3BGFA 3UDCA 1S9GB 2NNWA 1RTIA 3CCSN 5AXKA 2MLXA 1KQFB 2KN4A 5KFFA 3OYEA 4CZKA 1QQNA 2KXHA 2NUUG 3W61A 3NMRA 1D8ZA 2GIRA 2E1AA 4PG6A 3RSEB 3VQ5A 2XMVA 3CO9A 1UVIA 3EGNA 3A12A 1NJIT 2CYYA 5C10A 2H5EA 1IQTA 4ZP9A 1T8EA 3QJLA 1HMVB 3I0RA 2E6MA 5DG7A 5C2CA 1NJZA 1KAXA 6FD1A 1RA6A 2E1CA 1RDWX 3VETA 2RILA 3CERA 4B3RJ 1H74A 4JI3J 4FNIA 2HGMA 1N34K 2FJXA 4NO7A 3OXFA 5FRNA 4CNZA 4KBIA 4DDFA 3N6LA 4PXDA 1YF5L 3BSAA 2K7JA 4GRSA 5H9FK 3M4XA 4ECSA 3SCLE 3MN6A 1NNEA 1VK8A 4WFBQ 3C14B 3Q7CA 5BYQA 1QQOA 3QEIA 2QGFB 4RNOA 3CCLS 1F21A 4B3TK 3D1HA 3BZCA 1C0UA 1N5TA 2ZE2B 2V9WA 3O1WA 3MEEA 4YY3J 1DBDA 2JEIA 3L3CA 2O1PA 1TELA 2E2PA 1LWEB 4I6YA 3W2WA 2YKQA 2CUYA 1JLCB 3UKUA 2YHXA 4MK9A 3O9RA 4KKOA 2WSCC 1S6QB 4H8KA 1JLBB 2RIJA 4IRKA 3PR4A 3GFXA 4DUTA 3SFGA 1KLMA 3UI3A 1VQNS 1RU2A 1YJUA 1KFSA 2L9NA 2HBZB 1TVRB 3DMJA 3I9ZA 3HPOA 3FSYA 5DDOC 1S72S 3SJHA 4RUCA 2R2TA 1RBVA 1SH2A 1GQEA 5GAGI 4MFBA 3EPIA 3QFHA 1SQKA 4ZDNA 3G6YA 5KFHA 2KJWA 2O67A 4X4NA 1FTRA 2ASDA 3O9UA 4NLUA 4Y2KA 3JAMU 4X64F 1S1TA 1B3TA 2P9NA 4CZLA 4IDHA 2W24A 2IAJB 3N5BA 2GJ2A 2JX2A 1WDDA 2FGCA 2B51A 2QWNA 3D4JA 2ZVIA 3KJVB 4JHDB 3RU0A 4NLCA 4KHRA 2VOPA 1RHKB 4CVNE 1BOTO 1NK5A 3I55S 4H4MA 2FJBB 4Y6IA 3VA0A 4DV6F 2JWLA 3CCVS 4N47A 3K9JA 3SCXA 2G2YA 1MN7A 1IVZA 1KVBA 2BA9A 3NGRA 3CD0A 2RKIA 3K9KA 1C6VA 1P27B 4YOTA 1FKPA 3CW2C 1HLUA 2HHVA 2ZH6A 5IWAJ 3QBCA 4O23A 1TK0A 3AD8C 2ALZA 3THWB 3GE1A 5L38A 3VEYA 3ETMA 2E1PA 4ZP8A 1S9FA 4CFAA 1ZTTA 1DAXA 3MEKA 4BRAA 4EP5A 4JKFA 1F9HA 4NXMF 4H4OA 3UO0A 1Y7PA 4LD0A 4U8VA 2UZAA 1B4SA 2MZSA 5IT9Y 2EWSA 3OYDA 4I9LA 2ASYA 4ZCLA 2VL1A 2B4PA 1VQ7N 3MPVA 1V3RA 1YJ7A 4NCBA 2GBZA 4KRWA 3HOTA 3FZ2A 1YJVA 4ZVQB 3KK1A 5F8HA 1C0MA 4FXDA 4FLXA 4UW2A 1D09B 3BBFA 2YCHA 3HVTA 2VBWA 1U26A 3NL0A 3FSXA 4KO0B 4F8RA 2XQCA 1RKIA 3JQMA 1ZBSA 1IO2A 2E20A 4PPZA 4BC5A 3LPTA 3OYNA 3R1XA 4OZJA 4WFNQ 3MDFA 4IDKA 4OJGA 4DSFA 1YT3A 4DL7A 4CK2A 2AV5A 3US5A 5HI7A 5HVGA 4H03B 4K42A 3D66A 4HTIA 4NB4A 4N77A 4BC4A 1KOHA 3C6TA 2BANB 3KWIA 1NSKL 2DO0A 3ZT0A 1WAJA 4FWQA 2HFVA 3FNNA 1CPZA 3PIPQ 4CRJA 3T5JA 2ZBQA 2W42A 3HHLA 3DLBA 2KYZA 1QM9A 3NOGA 2O8CB 1WBDA 3QRPA 5DQGA 4RUBA 3AO2A 3MOZA 1BDGA 3UR0A 1V5IB 1RBLA 4DSLA 3TUIC 4BWJA 2JSXA 4YOEA 3QBWA 4OV1A 2AA4A 4DU1A 2FLOA 3HKWA 4PWDB 4NPOA 5CCMA 4JRQA 3HVTB 3S9HA 2D1CA 1K8AO 3OSNA 4PKIA 3M2RB 4DPUA 4NXMK 3QAEA 3H5SA 2DRAA 4HI2A 2D7SA 2ROGA 1FKPB 3VQTA 3U6FA 3SDEA 4K4TA 1YZ6A 2A6OA 3CF5L 1EZZB 2P9UB 2VC1A 3EDQB 4F26A 3MUTP 2GFFA 3W5XA 3RW6A 5AE2A 1U6BA 3J7YP 4A57A 3U8XA 3PKYA 4LF5F 1FXDA 1G4CA 4F3TA 4QR2A 5FLXU 4JI5K 3GYXB 5AQGA 4RUAA 3IGVA 3J81O 3K5NA 2KB2A 3TVZA 4ICLA 1Q81O 2EHGA 4PWDA 5I3QA 3NVKA 2HWHA 1U8WA 4FWPA 4GV3A 1NPPA 2PT0A 4ED1A 2FVCA 3FZLA 5B7WA 3UR3C 1NBEB 4DXLA 3VENA 4FM1A 4CK3A 4IG3A 1JCFA 2GGPB 3H40A 1N88A 3ILJA 3BO2A 3KK2A 3EDRB 3BS9A 5A8KB 3ENAA 2P9KA 3MM5B 4PPDA 3FE1A 1RTIB 4ZPAA 1VQSA 2YWKA 3W1YC 1KWMA 1LW0B 2FLNA 5F8LA 4GKJF 1WNEA 3MCNA 3VA3A 1EETA 1XMOK 3NOCA 4ILHA 1C4AA 1T3NA 2VPZB 3EXCX 4U67Q 5M2PA 3F44A 4OX9F 1BUPA 4CGFA 1T9TA 3LWMA 4ECYA 2XMUA 5D77A 2I2YA 1R31A 4TQRA 2OTLN 2GQQA 2DY1A 3VQ7A 4OPJA 2OTJS 4HHJA 3V4IA 1S6OA 2F4VK 1XHZA 2QKBA 1RCHA 5EUHA 3TJAA 1M1GA 2VG5B 3B4DA 4BCAA 2H4YB 3OS2A 3PRBA 1D8YA 2XWYA 4JI8J 1XK8A 3LP3A 2A3JA 5T7LB 4YS2A 4BQLA 2H48B 2X1GA 1N5VA 4C11A 4QOZB 4FPIA 1ZA2B 3QNOA 4YR3A 5D3GB 4LH4A 2A0FB 4B1ZA 3TWHA 2AZ1A 1UEUA 2YWGA 1JCGA 4P74A 4M3WA 1Y9OA 5HROB 4DX5A 2KTQA 5E26A 1KTQA 3C46A 2KFYA 3CQ8A 3LP2B 4FVCA 3HULA 1SJRA 1RILA 1OS5A 1RWMB 1UA0A 1W25A 3AH6A 1YRXA 3S01A 4B9VA 3SXLA 3CDAA 1NPRA 1ZXOA 3O1LA 1VRTA 1S6PB 3LP0A 3M8QB 3VMFB 5CABA 5KG7A 2NQPA 4M63A 4CK1A 1VSIA 1ZM2A 1SQEA 2VV5A 2CQ1A 1C0GA 2YH0A 4C9DA 2F8HA 2XS7A 4ED5A 2PDAA 4IOCQ 4L72B 1Y5LB 3DOLB 3J81Y 3KFWX 1XQIA 2P5OA 5JVHL 3HFKA 4P6QA 2KDOA 4TQSA 4K0KJ 5I42B 4WFYA 4DL5A 1NU0A 4ZN3A 4DOZA 2XTJP 3G6VA 3K2PA 3BSCA 3J7AP 4ZTJA 3HO1A 2V8HA 3W66A 4AL7A 2F9TA 4M5JA 1RAGB 4ANCA 4JK7A 3IR6B 1GLCG 3J81U 2K06A 4KSEB 4H5WA 5BJRA 3NF9A 4WXWA 3K5MA 3WEEB 2W4CA 1I3AA 3OR1A 2Q31A 4CF9A 3AFGA 3M6WA 1MDUB 1HW9A 5E3QA 1KQKA 4I6MA 1TKXA 3PFOA 1RHRB 5E0OA 3ZZRA 3SUNA 3CD7A 2QWOA 3BKTA 2FVRA 2JGUA 1RCOB 2OAUA 2XULA 2OYQA 4H54A 1JXLA 2ZOFA 4ZS6A 3UCUP 4I67A 1ZA1B 3HM9A 5EWGA 1RT6A 3PW0A 1N5YB 2MZJA 1N32F 5DGBA 2VUGA 5FLXY 1LWXA 1AXQA 1TGOA 4NEYA 3KWMA 3FCVA 3ULEA 2E1MC 2V2VA 5KFZA 2WONB 3THTA 1CXUA 3WQPA 1Q5VA 1RDRA 2UXDJ 2I5JA 2WBNA 5CR4A 4FPRA 2G8VA 3AXMA 2EK1A 2DFFA 1RLCL 2Z57B 4CO2A 4C6AA 1S4FA 4ZCMA 4AFFA 2BJ9A 1NJYA 3F0NA 4LRAA 1D1UA 1N32J 2KVQE 4CZMA 4JP8A 3O4NA 1RWOB 4TKTA 4F02A 3OYJA 1LXNA 4OVLA 1S1UA 1T0TV 4JI8K 4K59A 1YJNS 1KCFA 1U48A 4OJHA 4DR5F 3PV8A 2JFDA 1DARA 5E41A 1BI4A 1SPBP 4JAXA 2DCUB 3NLCA 4DUYK 3MDQA 4CGHA 4C98A 5DLGA 1VYAA 1RBSA 3CC2N 2ZZMA 3A5NC 3ILIA 3VN5A 3QBXA 2H3EB 4OHVA 4S0MA 3G82A 2MYFA 5BR8J 2JLEA 3DFEA 5L9NA 4ZLPA 5GAEI 2QXLA 4ED2A 3WNGA 1UMJA 5AQJA 1KQSR 3FFIA 1BA1A 1YJNN 5A0YB 2O3DA 4CDIA 3DU6A 2QLBB 1LAVA 5IC4B 3QINA 3KMSA 1Y00A 3L2UA 1I1GA 2QMWA 4WP8A 5B09A 3MWPA 1QVFM 3TRGA 4LREA 4B3OA 1GLFO 2PO4A 3DOLA 4KI6A 1F9FA 2DHGA 1TAQA 2HSTA 2QLWA 2HKEA 2DRBA 2C1EB 4OZLA 3K8VA 2YHYA 1C0FA 1RWUA 3O4WA 2JEFA 1RT3B 3ETOA 1RWKB 3LF0A 5LSLA 4CEQA 2WK4A 2YX7A 4HHUA 4BACA 4E89A 1BC6A 5LSOA 3WC2A 2ZBRA 4KI4A 2OELA 1Q95G 3EZWA 2J0SD 4RNFA 1PJ5A 3KLFA 5EOYA 2PEBA 5KT6A 3RSEA 1RT4A 1UZHA 1IBMK 3D67A 4TLQA 1ZPWX 4QWDA 2J9EA 4DR6F 2ASMA 5CHCB 4LF7K 5J2QB 2NREA 3LM2A 5GIPA 2JL9A 2KZZA 4RCHA 4E7LA 1VQ5N 3ZSYA 3VALA 2M88A 4J37A 5FPEA 1RT3A 4JI3F 4B8AB 4DQRA 1WUUA 2H5JB 2XI3A 4U8YA 3R5DA 1HI0P 5DRKA 3HP6A 3MPWA 1SIZA 4F3OA 4V19J 2Q66A 3D7SB 2B9EA 3VGUA 1HBMB 3HCXA 2JVOA 4RBVA 3D6MB 5AQSA 1I5OB 3VEOA 3GIIA 2R2RA 1U4BA 2KHDA 3NMUA 2AJ0A 1FRHA 5D4LA 4M5DA 3O3HA 3V2UC 2LU1A 4HACA 4DR2F 5FROA 1RWVB 4XH4A 3CXCR 1FE0A 1EARA 1DHMA 3OXGA 1HNZK 3QT6A 2FDNA 2FC8A 4N76A 4C3KA 1JJ2M 1JKHA 4JBCA 3H2VE 2XI2A 5AQNA 3SQGA 1WTBA 4W98A 4MLHA 2YNGA 5JJBA 2GVZA 5CZ1A 3SI8A 2D41A 2LQ8A 5IT9U 3EXYA 3UNYA 3J7Z5 1NK7A 4QPTA 3T19A 2UXDK 1WEYA 2DNLA 3ZT4A 3T6BA 4F4KA 2NUBA 3ZCMA 1R0AA 2BQRA 1NGCA 4KTZA 3VAGA 5BRHA 3OYIA 2O4GA 1QTMA 4H5RA 3AHPA 5L1LA 1CSJA 2OHDA 2Z1GA 2VQFJ 3KK1B 1HHQA 3NGZA 2KFNA 2YI1A 1P9YA 3S8SA 1ASVA 4WIIA 3K57A 3CC4S 4H0PA 1ZZNA 1HJRA 1JLGB 3C15B 1DT9A 3RUBL 5BN9A 1IBCB 1T6DA 1HARA 1BG3A 3QSIA 4ECRA 3HBTA 1A5XA 1RT7B 2B43A 4O3PA 2JC0A 4KREA 2UUCF 1REGX 3TI0A 1MROA 3H98A 3G8SA 2J7WA 4C8MA 4CTAB 5K14B 3EPGA 2HNDA 1CJTA 3THWA 4KH4A 4TY9A 3SV4A 2GVDB 1RTZA 1FF2A 2F3JA 1ASUA 4O5BA 2CGKA 1I39A 2NPFA 1A6LA 3KLGA 3KDNA 3FBFA 3A1YG 4J9LA 1Z2LA 4K2XA 1CJVA 1K47A 3TUPA 4WCEQ 1MG7A 3B8AX 5KRTA 1HNIB 4YUDA 4X66F 4NA3A 3DRRB 3TVYA 4B3MK 5D4NA 3DLKA 4OO1J 2MY8A 3BGOP 3MM7A 4CLSA 2PYLA 3EVMA 3I6PA 2WOMB 3MI7X 1IJEB 2E5LF 2C2NA 2JOQA 4OJ1A 5DS7A 2VKZG 1HKCA 5MLCQ 1RAAB 1B0TA 4CZJA 2H65B 5GAGU 2RN2A 1D9FA 3MAAA 4NMLA 3RG6A 3ZSOA 3AQOA 1UKUA 3NNAA 4DR3J 1YI2N 3KNGA 3HOSA 1ULRA 3NCIA 4OI6A 3OHRA 3SUPA 4MQ3A 1GLBG 4DR1K 2XCAA 2VG7A 3IBCB 1KD1T 1JJHA 1QZ6A 2HRUA 1X60A 3THXB 3PYFA 3VGMA 5KG3A 3F56A 5LMUF 1S0OA 1EP4A 4HTJA 3VPZA 5KFBA 4JI4K 5KT4A 4M8LA 1GOAA 3B8HA 1VBXA 3H4BA 4JKDA 2PEHA 1RHUB 1SQFA 2J6SA 2CZ4A 3J7YU 1RADB 5T41A 3AVBA 3MK6A 4UQTA 1YI2S 3PIPL 4IFVB 4BWMA 2Q3SA 1N34F 4CJQA 1FTCA 2Z0GA 2HRYA 3RWUA 4JKGB 4OI4A 3NBPB 3PIOQ 4ZVGA 3W65A 2DR9A 1GMUA 1EX4A 3D0IE 3LZIA 4KJIA 3GCWP 3DLKB 4GKKJ 3TTDA 4I56A 2UUBF 3UDLA 1FRLA 4OYXA 3CFRA 2J9DE 3L8BA 3OTBA 4NLPA 2YY3A 3I5CA 5F2RA 4PQUB 2XMTA 2IBKA 1YJ9N 2UU9K 4LF6K 1F3VA 1AA1B 3D2EA 2XHWA 2BACA 3HK2A 4I9QA 4BGAA 5DM7L 4PABA 2IHR1 1XBWA 3G4SN 4N5SA 2RQCA 2XGPA 2IDOA 3NS7B 3AVCA 3HFZB 2R42A 2QLJB 3PJ9A 4Z4GA 3KIOA 2BVZA 4KFBA 2CNNB 3BGUA 2GQ2A 3AVFA 4FW1A 1DTQA 1N54B 2ZWOA 1U0SA 1KXPA 3OR1B 2RE2A 2N3OA 3FCWA 1Y0HA 1OJ4A 1IKXB 4L75A 4CO5A 4H5NA 3GFHA 2UUWA 3T1HK 2KYXA 1Q82O 3TWZA 2ADBA 4UUWA 3OL7A 3MOJB 3D1OA 1RE1B 5ETPA 3R3LA 4QS9A 4GY2B 4XPCA 4G65A 3KMQA 4FJ9A 3HXMA 1CJKB 1I94K 5L1JA 4JKHA 2QWMA 3VGTA 2JHEA 2QL7B 2QW9A 4CT9A 2QA4S 3L4BC 3HZGA 3Q24A 4EHUA 3QIPB 2KT2A 5F8NA 1KNZA 3CJAA 3FSIA 5KPZA 4QOTA 4C8LA 1QAYA 4DTSA 2VPXB 4LVNP 2KZMA 2KT3A 2DTJA 3MM7B 1RAEB 3F2KA 1FESA 2MJUA 4MT1A 2CPXA 4USJC 4AUKA 1QS4A 4M3XA 4RW8B 1NDPA 2BKPA 1UPMB 3W9IA 2V0NA 1OVYA 1VAZA 1S12A 2A6MA 3D6TB 1G99A 2CGLA 5J1PA 4YDUA 2I38A 3IAM9 2QXFA 4GO7X 4H0TB 3TPQA 3UD4P 1RKJA 3K2YA 1RDDA 3O08A 4NZ7A 2VGNA 3O2IA 4F0KA 4CHZA 2OKQA 3E3XA 2RKIB 2YNFA 1EKEA 4A62A 4R25A 3NGKA 3H08A 1OY6A 2W7PA 1BQMA 2DGTA 4F25A 3CFOA 4B17A 3IA0A 1ZBIA 2B4VA 3PEHA 3ZYYX 2P5GA 2V8DA 1VRUB 3QAUA 4O44B 2DR8A 1HHTP 1Q8LA 2RB7A 3CGIA 5JXSA 4WP3A 2GIQA 3TAFA 4RW8A 3A8YA 3IG1B 1RTDA 1XJWB 5KGWA 3DXSX 4ZJOA 1RP5A 1YGYA 4MKBA 3J80U 3AO3A 3PRDA 2XY7A 4F3MA 2HVHA 2P9IA 3TAEA 3OJSA 2XLIA 4CEZA 3N4QA 3OBIA 1S10A 4RWWA 2IVYA 3OTOF 3AA9A 4JV0A 4O0IA 1T7PA 4L76A 4JUZA 1QAJA 2VQEK 1T02A 1Q9YA 1RT4B 4TU8A 4BG8A 4IKFA 3NHGA 4IFVA 2QJ3A 4ZVHA 4FYYB 4DV1F 5D8HB 3LZJA 2R8JA 1T44A 3IWLA 5HANA 4OMFG 4YORA 3R5AA 4Q7AA 2PY5A 1KSPA 3EE8A 5AZIA 3R1LA 2M52A 3EICA 1HD0A 4MK8A 3IWXA 2D0PA 1F5BA 5HJYA 2HBKA 5JVGL 4O3OA 4QYRA 3HDSA 2C42A 3L2VA 2FHJD 4LF1A 2QWLA 2YJEA 2N7CA 1Q81T 1T03B 3GJTB 4DV6K 3DRPB 1ZOTA 3VQCA 1F0XA 4WF9L 1NKBA 1FRMA 3QT8A 4USMA 1TUGB 2HYIB 3T3FA 1VIOA 2MQMA 1A9NB 2D69A 4DQPA 1HNWJ 1VSHA 3JQJA 4WYBA 4HR2A 3HSJA 3L7OA 3QERA 4Z4HA 1GX6A 5AE3A 4OPHA 3N01A 2PI5A 2WOMA 2ACYA 3W2VA 4LMZA 5KFSA 1FRJA 1TMJA 5TKWA 1JXVA 4AHRA 5HQMA 2H54B 1ZBFA 3T1HF 1WG4A 4KFBB 2IA0A 4BC3A 5C24A 4A4JA 1RT1B 4OHWA 2L9DA 3CMAS 4GV6A 4FBTA 1V5VA 5CZXA 2I7PA 3HF5A 3SQ0A 4KB1A 5E3CA 2HQ3A 2OPSB 4G3IA 1TL5A 4I2QB 2Q36A 2ZFHA 1ELOA 1VSMA 3TAMB 1XMBA 3CPWM 1VHFA 2AW0A 5KT5A 4CF8A 2R7QA 4OJ3A 3DLHA 3BN7A 5D0EA 2DKOB 2WHOA 1R59O 3EYZA 3EEQA 3OBYA 1MU2B 1U1NA 3THXA 3AO4A 3M8SA 1BD6A 3AA5X 2BTFA 2X1AA 2V67A 3WHIA 3HVRA 2A5XA 3RMBA 4O3RA 2MSSA 4I4BA 3NNHA 3Q8SB 2OA8A 2DY9A 4DFMA 4EK2A 4LFAK 3C6HA 4NLOA 1H7XA 2W2OP 4KKOB 3NY0A 5AXLA 2ZZTA 4KO0A 1PJ6A 4BRLA 2OMLA 3P45B 1R0CB 4Z7YA 2YWWA 3MM8A 5EGYA 3EN9A 4FLUA 4AILC 2R7UA 4LF7J 4CGIA 4K8XA 5AXNA 2W8LA 2CQ4A 1U1KA 1N56A 1NB2A 1QVGR 1HNIA 2F7VA 1U2VA 2P9EA 4JI7J 2DRDA 5ADXH 2EG2A 3KKRA 3CJRA 3MMVA 1D9DA 4HDGA 5E33A 1RBRA 1DTQB 1NLKL 3GV8B 1QVGM 5AFUH 4OL8A 3ZO7A 1N36K 1JXEA 3GG0A 3GU0A 5CXTA 3C16B 4E7JA 2AU0A 1IM6A 1UW4A 2CPZA 4TYAA 1I3OB 2JWKA 1NHKL 4JK9A 2XY5A 3QFPA 1U0HA 2GQCA 3ENQA 3MECB 5FDLA 4CJ5A 2HNYB 4ZLLA 1F5CA 3FZMA 5AXMA 1GX5A 2V7ZA 2EBEA 4WP9A 3QDKA 3Q83A 4M7YA 3CMQA 4TY8B 4NLGA 2G0JA 1NEEA 2KKHA 3C8YA 2CWKA 4BRPA 2NZCA 3KG4A 4M63C 3J7AN 1URNA 1JJCB 3KLEB 2IVOA 3LDOA 3O44A 2QX0A 5T14A 3UCZP 1HI1A 2HHHK 5HP1B 5FIIA 3TX0A 2GTDA 4NYFA 1KVIA 1UJ4A 2DY4A 4HWIA 1PYSB 1RAIB 2KO1A 4QCLA 1N8RO 2G0CA 1VSKA 3RGIA 5L9XA 4BC7A 1DGKN 4FOEA 1IKVA 5DMRA 2GA7A 2MPUA 1HYSA 1KONA 2BOAA 1JLFB 4IH5A 4Y0FA 3ENVA 2IJRA 1WC5A 4H4OB 1NMNA 2EX3A 1SJQA 3VVTA 5DGAA 4DCJB 3VZHA 1T05B 1S79A 5LT5A 3PW7A 5E84A 3VESA 2ZH4A 1ZM4A 4RG8A 5IV4A 2G8HA 4TU7A 4OLOA 4FWLA 1KC8T 1KVKA 3Q8YA 1AFJA 5KOWA 4IUFA 2EXUA 4DR1J 5LL6d 3HPGA 5K8PA 3VGVA 2D3O1 1WSFA 1R89A 3PNIA 1P9QC 4LSZB 2XLKA 5BYRA 5IT4A 4UZBA 3RB4A 4AL6A 3JSYA 4CO3A 3VQSA 4ZA1A 2B4JA 2HBJA 1FDBA 4OGEA 1O1WA 2G8FA 4IOAQ 4LF4F 4CGDA 4M5DB 5DO2A 1R8BA 2DTUA 5ETKA 4ELVA 3A4TA 3EZUA 3RAMA 5I3UB 3GTYX 5AE1A 2HWTA 3A3PB 1LV5A 5AR0A 2HZCA 3M9MB 2NZ4A 3AB2B 2BJDA 4BC9A 3AOAA 5GINA 4A2BA 3H90A 4AM6A 3CJTA 3QGIA 3T7ZA 5AQKA 5HL7Q 4UQGA 3O3GA 2CQ3A 2M8DB 1A0OB 4E1MA 5AQWA 4DR6J 3SUOA 3NGDA 1U2VB 3BR8A 1S7IA 5KFRA 4J9SA 4CM0A 3UKUB 1NGAA 1N5QA 4NZ6A 2N7YA 4AHCA 1U7LA 4WJBA 1LWEA 2RF2A 3MAAB 4NCAA 3D3BJ 4J9KA 3ZLJA 1G6BA 1FNOA 3FFIB 1UETA 1NOYA 4B3TF 4BR5A 3CQYA 3I0SA 1K8KB 1NRKA 7FD1A 3EY1A 1GFWB 4OHYA 3C16A 2J4RA 5L1IA 4E0DA 4K4ZA 1SJ4P 4P2SA 2BDPA 2I9SA 4JYAK 2Z2MA 3PYEA 4OLBA 1QZ5A 3TTFA 2OMOA 1WHWA 4A48A 4DKWA 3WNEA 1CULA 1IKWB 3KHLA 3G2XA 4YB6A 3N79A 3GB0A 1H1VA 4TLRA 1S59A 1WSEA 2XZTB 4HVJA 2VZ9A 2B8PA 2UU9J 3CJ2A 4CJWA 2LA4A 2P1JA 4M95A 2XS5A 1FWPA 3D0PA 5F8JA 3U4LA 5I9EB 4PXEA 1OVQA 3UN2A 3ISZA 3MM6B 2HZVA 2V52B 1TV6A 1HNXJ 2CZ9A 4XH5A 5T7BA 4PKDB 1OH5A 2XZDB 4XH1A 4X2BA 4KV8A 2W9BB 2P9LB 2DYAA 3CDWA 1NMEB 2CQIA 2OD4A 3HZEA 4L3QA 4Q8FA 1NSPA 2B7BB 3GPAA 5LJ3Y 1RNHA 2CG8A 3CSKA 3JTPA 5B0EA 3ATUA 3QJPA 1Q78A 5AQFA 1FX2A 1F6TA 1RJJA 2P6SA 1WG5A 2C3OA 4GNIA 4R79A 1YJWN 3B6BA 1T3OA 5EX3A 2DH8A 1JLEA 3SK3A 4CEEA 2JLGA 4U7UK 4M7XA 2M8HA 1FHTA 1Y4ZB 2AYEA 4A59A 1X5PA 4UUXA 4KGXB 4IH7A 2XSFA 4ZVOB 2OZMA 3L3UA 4KRFA 1CG2A 2APOA 4IBNA 4A46A 5HOOA 4PHTX 2YQ0A 3LP2A 1X4EA 2XSJA 3R9LA 3BYPA 1VLOA 4NASA 1DLOA 2FY8A 3AQPA 2AWZA 1QHTA 5DM7Q 1HLWA 3X1LB 3S6EA 3F5TA 3UPFA 4CJ4A 1X4FA 4DCOB 3CHWA 4EU0A 2VKRA 1AROP 1XNRJ 3GZ7A 3C6AA 1QAXA 3RJMB 2G8WA 1D5AA 1A7GE 2V63A 3MMAB 4FJ8A 1V6HA 4CHOA 2FC9A 2IM1A 1NU4A 3PX0A 2HMPA 4QWBA 3V6DB 4Y34A 4BRMA 3GILA 3D1QA 2VG5A 2KFZA 1UP1A 4W92B 4ZITA 4A8WA 1X31C 2DPNA 4CF2A 3OPKA 4RW7A 1I6JA 4ZPWR 4FCYA 1YQHA 3QIPA 2MKIA 4DFKA 4LQ9A 4R5PA 4ILGB 1VBZA 4JS5A 1J2VA 1X4AA 1XUPO 1TKDA 2F9DA 4MKAA 3NFAA 4DTNA 4GKJK 1MNEA 2IRUA 4R0JA 3SSSA 4DTUA 4M3RA 4DR3F 1E4GT 3V9WA 4C8NA 3I32A 3OYKA 2LVWA 3ENBA 1UEKA 4M1KA 5CZVA 4QJVA 1KN6A 4M3ZA 2UYTA 3JS9A 4K4WA 1YUWA 1N34J 3QNWB 1ZS6A 2UUTA 4JI3K 4USIA 2KKZA 1YK9A 2N82B 4J90A 2RT3A 1TKZA 2R7YA 4I2QA 5CYQB 1R8AA 4USKA 2CPHA 3WX4A 4ECUA 2NRVA 1RCXB 3AAWB 4D3GA 4QU6A 2V6AA 4JV1A 2DK2A 4FXVA 5CD4A 3RAXA 3CT9A 5EU7A 4RW7B 2DEIA 4BE0A 4CE9A 2YHBA 2XYGB 3WDOA 1VQ4S 3PO5A 2FVSA 3FBEA 4NI2B 4C11B 4DQIA 4PY5A 3HKZD 4V1Ak 4OKJA 4DL2A 2Z56B 4PZVA 4DL0C 1VQOS 2KRRA 1PGZA 3SDEB 4JLHA 2RHKA 4WYWA 4JKCA 1T95A 4CT8A 3DXKA 4LFAJ 5DM6Q 2ZJRL 4BRGA 3TSQA 2FD2A 4CLTA 5A8RB 5DQIA 4BS2A 2DO4A 2QA2A 2HBLA 4UOCA 4FJJA 5KRSA 3CJ5A 1LK7A 1WACA 2CPJA 1G1XA 3SPYA 1JIHA 2GJFA 1WI6A 2V8VA 2NPIA 2B9XA 1X5SA 1WSHA 4HTUA 4OKEA 1T05A 1FO1A 1OYDA 2WBMA 1UVNA 5AQOA 3AT1B 4DSIA 1U1PA 1EKRA 4C2MA 1MSWD 2J8AA 3P5BP 5D4PA 3QETA 3EX7B 1DQAA 1NAQA 1LW2B 1E6VB 2KI2A 2G2OA 2VYPA 3V4IB 4X4UA 1DTTA 2GO8A 3CCES 3AVMA 3ELHA 2MSTA 2XYPB 3UN5A 4U95A 4CJ3A 2B6AB 1YBTA 4Q45A 3M2VA 4USHA 1U6ZA 2MZQA 3LOUA 1YAGA 2WC9A 1G15A 1RABB 2QT7A 4JRPA 2W40A 2ZGZA 4AHTA 1IBLK 8AT1B 3UNGC 3QJJA 2E2NA 3GCXP 1QE1A 4FKXA 4ERDA 1NG9A 2PFUA 5GAHI 4H0XB 1RTDB 4F3QA 4LSLB 3ZSXA 3W5ZA 1NLVA 2CPYA 3AY9A 3R5GA 2AD9A 5AQTA 2CQBA 5AQMA 2DEJA 4CHPA 2YKAA 5BPMA 3QSYB 2GO9A 1VRUA 1SV5B 2BJ8A 3LA0A 1KRPA 1HBOB 4ZP6A 2E9TA 1JMTA 1UEVA 5K9FA 1Z2ZA 3LTOA 3IO1A 3M2RA 1AUSL 2CDQA 2RF2B 4AD6A 2EC2A 3J8AA 4FF3A 2JLFA 5GVQA 2UXBJ 2QSWA 2MXYA 3PR5B 1HJOA 4WIQA 2ZKUA 2ZJQL 2LXFA 4LIRA 2E5GA 2ZHOA 2HHSA 4C48A 1HQUA 3AOCA 2F9JA 4Z7CA 2GEMA 4OX7A 2NR0A 4CH7A 3BBBA 1RAHB 3QLHA 2NUHA 1RT2A 1HUXA 3EVWA 2PMZD 3AD9C 3M7VA 3BBCA 4Y65A 5E3PA 3LPUA 2P9LA 3U1NA 2G2ZA 3D2WA 2NRTA 4Z4EA 3AJ1A 2KQ2A 5D6GA 3EO3A 1HQ2A 4ZHRA 1HX1A 4J91A 1RBOB 2P9SB 4OLAA 3KKFA 3WXMB 2RRAA 3JTNA 3JYTA 3KLVA 4UY85 5LMNK 3KYLA 2LXUA 2QIFA 2H4WB 2BE2B 2PC6A 3VGKA 2VONA 3A3NB 4UOFA 2OPPB 2FLLA 5G4DA 1G2EA 2MMYA 1LW0A 2ZNZA 3MF5A 3C6TB 4L74A 2FVPA 3G25A 4DV1J 3RBZA 3NS5A 1R0BG 3H6EA 1QDUB 2GJIA 4RNNA 2DNYA 2VFUA 4OYAA 2MQPA 3DXMB 1KTVA 4B1YB 2UXCK 5L39A 5HBMB 1VQMS 2BX6A 4IG3B 2WBRA 5GAHU 3SQ2A 1JLBA 4AM7A 4Q44A 4DV2J 4FVUA 4JI6J 1QHAA 1X9JA 2QLXA 4FWNA 4W5RA 3VCDA 4USTA 1SS6A 1NHVA 2FTRA 2F7TA 2WTUA 4WQ4A 2UV8A 2Z2YB 2RQ4A 4PG8A 4A8QA 1RHJB 5M1NA 4EFAC 3QGPA 5K8MA 2VC0A 2KG0A 4K41A 2WCXA 3J7A1 2X1BA 1FNMA 3HX9A 3M32B 3P3DA 4OZ5A 1RU1A 2AT1B 2Q97A 2FJDB 1VI7A 4DCPB 3G71N 4BREA 4CLLA 1JLFA 1SKUB 1HWKA 1SC6A 3FBBA 4NA1A 4QIGA 2I6WA 2WUSA 2D0BA 4F7VA 5RUBA 4CBXA 3DHXA 1RHMB 2WVFA 1S5JA 3RZAA 4HUGA 3Q8QB 4WFZA 3W8GA 1FERA 3ZTQA 1FJGJ 4O8UA 2Y0BB 1WB9A 1S9EA 4JEPA 3V4MA 2AKWB 5IWAK 2BM0A 2ATCB 4EIAA 1OH8A 4JI8F 3POTA 5AZJB 5KFWA 2PIIA 5HJXA 3CCRN 2DGUA 4DUZK 4RR5A 4RO0A 3M2UB 2R7TA 4DR7F 5BXIA 2H51B 3G71S 1URRA 4J7CA 2CFXA 1K8AT 3QEVA 2H3GX 1UJ6A 4KV8B 5GMDA 3RR7A 4X4VA 4ECVA 1WN7A 4NE9C 1RFQA 3N4PA 3MM6A 4ITSA 3EMTA 4A8SA 1X1PA 1HKGA 2A1BA 2MDAA 3ZZZA 3UIQA 3VVUA 3W2WB 3H0PA 1VOMA 3P5JA 4JI7F 3OLAA 2VA2A 1SB6A 1NSQA 3IBFB 2PA8D 4JD2B 1IBMF 3SQ4A 3BZKA 2YNGB 4RW6B 4J2DA 1K0TA 3DXKB 5FJ4A 3W8PA 4JK8A 4BRFA 2W4PA 1KC8O 3C14A 4CNYA 3R7SB 2FBTA 4WPAA 5C2FA 1IV0A 3BGRB 1QSLA 3AB4B 4I69A 9ATCB 5JLHA 3DGVA 4NLDA 1NO8A 3N4WA 2XB2D 2BRKA 3R2DJ 5DJBA 2ZHAA 4IJNA 2OLWA 3GV5B 4BRIA 1NZAA 3Q8VA 5JS2A 1UWAA 5FPMA 2BW2A 1VQ9S 2HIQA 4C1NK 2RNEA 4CTAA 5AQQA 2WSFC 4HKQA 3U1MA 2VQEJ 3Q22A 3DC2A 4USVA 3ZX0A 1XR6A 2BOPA 3MR3A 1U45A 2GVDA 1D9AA 3UDEA 4KHPK 4Q5VA 2LYVA 2COLA 1B9DA 1IBKJ 2VGMA 3LDNA 3IBWA 2AJ4A 2QLFB 2P9CA 3NF6A 2X7IA 4JYAF 4XK8C 1RDAA 2DCLA 3C66A 1BWFO 5IM0B 2K3IA 4P73A 3TANA 2HAFA 1WF0A 2W8KA 1VQ9N 3M2UA 3PHTA 4DTXA 4CO1A 2Q0RA 2GS8A 2UXCJ 1TYQA 4ID1A 4ELTA 4A8FA 1KEKA 4K43A 1EX8A 3MEDA 1O13A 2ZEJA 3OLBA 3CMES 1YJ9S 4K25A 1ROFA 3CCUS 2FLPA 2KRBA 2LKZA 3TNVA 2P6TA 2CVEA 3MTKA 3PXGa 1VRQC 4EYIB 2V2KA 1LQ9A 1CQNA 4DTJA 3G4SS 1J5OA 1MMDA 4OZ3A 4PWWA 2E66A 2QEXS 5FRMA 5F0XA 1XMQK 5K8NA 5BR8F 2F5GA 5J2NB 1NGDA 4BDPA 4Z4IA 2LEPA 4CERA 4YR2A 2W9CA 3KD1E 2R2SA 2I1RA 2LEAA 2W2MP 5B08A 1JLCA 1NZ8A 3EGVA 1TZ0A 4PXBA 3CMEN 4E3SA 4F4YA 2FZKB 1UJ5A 2ROPA 4O3SA 4RWTA 5AQZA 2UUCK 2OEJA 3BDPA 5HRSA 4ZVSB 1OO0B 3L7UA 1PC4A 5I42A 3NGUA 3RRGA 3KZBA 5ETNA 3G82B 2OEMA 2IIRA 1RAJA 5D78A 4KQZA 3ZT2A 4ID5B 3K5OA 2CPIA 2XCPA 3PX6A 1HRHA 4DS4A 1VIXA 2VWJA 1YRUA 3O1BA 3M1VA 2HHHF 1X0PA 4A8KA 2CJ9A 4J9NA 2YVSA 1EQYA 3DGPB 3NBPA 1BO5O 2R9LA 1BWVA 2VIHA 3JB9k 2DVIA 1SL1A 2J7KA 1IWGA 4ZPTR 3KLFB 4HYKA 2MQLA 4CJUA 3UE5A 1Q5YA 3KG0A 4OI0A 1HQEB 4YN3B 5HROA 1JK9B 2AEFA 2H5IB 2LMIA 4MFBB 4CHYA 3EGZA 5KG2A 2J7UA 3V9ZA 2BQUA 4EYHB 4NX9A 1RT2B 3BB5A 4TY8A 4H0VB 3QEWA 3QB0A 3H2LA 2LDIA 1W26A 5E3RA 4IG0A 3VR1A 4L6V3 2VD3A