1C0UA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 136
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0uA05
4IG0A 3ZSRA 3AO5A 5T7BA 2FBTA 1IG9A 3VQPA 3M9MB 4IDKA 3LAMA 3Q8RB 4NLDA 5KT3A 4NRUA 2XRIA 1ZBHA 4J9KA 4CF9A 3DLHA 2WOMA 1NK6A 1K1SA 4CJSA 5K14A 4L8RB 1W9HA 4U7CA 4GMJB 2OPRA 2KW4A 5KFCA 5L1KA 4OPJA 4W5TA 3AVNA 3ULDA 3HO1A 3NL0A 3L3UA 4HUFA 3V81A 2ATQA 1HMVB 2E6MA 1VRTB 1RILA 4WFZA 3T5JA 5J2MA 1T7PA 4B8AB 4M3RA 2XHBA 4O3SA 3TI0A 3NKYA 1S1TA 3M8RA 4YMEA 4KI6A 1ZTWA 4HUEA 3MR3A 4KFBA 4YR3A 3ZT3A 1NNDA 4MFBB 2YNGA 2R8KA 2XGPA 2RF2A 1RDDA 4TY8B 3TR8A 4ECWA 1SH2A 4PWDB 4J9OA 4ECZA 3KKRA 1S97A 1GOBA 3TANA 1BCOA 2IM2A 1HNIA 3SPZA 3P83D 5SWMA 1HYZA 3CM6A 2RF2B 3E01A 5K14B 4CJ3A 4CJLA 1MMLA 3V9XA 4K4VA 2RPIA 4EO6A 4C8MA 5KFYA 3BJYA 4ED6A 1KCFA 2AU0A 3N6NA 4IG3B 3PJXA 3PX6A 4E1NA 3NFAA 1IH7A 4NYNA 3V81B 1TK0A 3DYAB 3GV7B 1C2PA 1QSYA 1OS5A 4O0IA 2JGUA 1ASUA 3BREA 3L2QA 3NE6A 2IAJB 4K8XA 2C2EA 3OYLA 4M3YA 3KLEA 4DTRA 4ECVA 5KFRA 3LAKA 4IDKB 2HHSA 4JUZA 4CGDA 2J6UA 4IRKA 2HHWA 5KFVA 2HHTA 1Q9XA 3HSTB 1IKVA 4ELTA 4NLSA 3SPYA 3MFHA 1HNVA 4AHTA 1WN7A 3SUQA 2HNZA 4N56A 2YV0X 1QE1B 4O4GB 4LY7A 3TWHA 3MEGB 4DQPA 1K1QA 4CGGA 3PJWA 4Z4HA 5KFFA 3M9OB 1JLQA 4DL6A 1UAXA 1EP4A 1KHVA 1RT4B 1REVA 1S0OA 1WSJA 4G1QB 2D5RA 5EWFA 3IAYA 4DF8A 3HPGA 4YR2A 4M42A 1JLEA 4O3OA 1CXUA 2CKWA 4IKAA 4IRDA 3OYMA 5KFIA 4ED8A 4F50A 4E89A 1IKXB 4KTWA 4E7IA 2AX1A 4URGA 1HRHA 4K4ZA 4CK1A 4OLBA 4RW6A 3CJ5A 1NK4A 1N48A 1XHZA 1TP7A 2DPJA 3I5BA 3TABA 3K5LA 1L3SA 3AO3A 5KFOA 3NH0A 1T94A 2VWJA 2YHAA 3QIPB 4KBIA 4R0EA 4RW6B 4ZHRA 3CYMA 4DEZA 5I42B 5E41A 4KB0A 2G8WA 1XR6A 4GC7A 4CGIA 1ZYQA 4AHRA 4CFBA 4CFAA 4ZHRB 4ZP8A 2CJQA 4CJRA 1QHTA 3OLAA 3ZSZA 4LSLB 1N56A 2ETJA 3ZSXA 1TKTA 2OPPB 3RB3A 3NMAA 3RTVA 5EWEA 2V0NA 1RBSA 3QEWA 1YTUA 1I39A 2UVRA 1C0TB 4RUAA 4K50A 3V6JA 4KHWA 4M3ZA 3I0SB 3V6HA 2JEJA 3QZ7A 2F8TA 5J2NA 3ZSYA 5KFTA 4I2PA 2ILYA 4Q0BA 3AVLA 2KFNA 1RT5B 3V4IB 4BE1A 2FVCA 4QWEA 1W25A 1RT6A 2YNHA 4CIGA 3HXMA 2IM3A 1FKOA 2XY6A 3QIOA 4IFVB 5DQIA 1KFSA 2B5JA 1S9EA 3FQKA 3DLEB 3M8PB 2AWZA 1HQUB 2UVWA 2C2DA 3RMBA 1BQNB 5F9NA 3V6DA 4WFYA 2R2SA 5F8JA 1RT1B 4FS2A 1LWFB 1D8YA 3DOLA 4J9LA 2YKMA 3DMJA 3KJVB 3RB0A 1RTIA 3BGRA 1JLBB 3QYYA 2W8KA 4K4SA 2D0CA 4I2PB 3DDKA 1X9SA 3VQSA 5J2NB 1JLAB 2XY7A 4Z4CA 4KE5A 3QGGA 4ED2A 2JC0A 1FK9B 2IGIA 3AVKA 4RG8A 3CFPA 5EU7A 3CWJA 4KV8A 4CF8A 3RRGA 4JS4A 4XPEA 2R2UA 3KHHA 4IQXA 4FW2A 5L9XA 3A2FA 3VQ8A 3LANA 4YFUA 4DS5A 2JLEA 4FLWA 5F8MA 4C8KA 3P1GA 3MEGA 3SCXA 1LWFA 5KFDA 4Z4FA 2O4IA 2G8UA 1KTQA 3AO4A 3MR5A 3RR8A 1N6QB 3EZUA 3TAMA 3C95A 3OYKA 1LWCA 3KLEB 1I3AA 4CK3A 3HVWA 3BDPA 4ELVA 3HK2A 1S1VA 3VQ6A 1LAVA 3TAEA 1RTJA 2BRKA 2G8KA 4FM2A 1SL0A 4CEQA 1U04A 2DFHA 4FM0A 2FVRA 1HARA 4TLRA 5KG7A 1Q9YA 4FJLA 4WYLA 4DG1B 3TAFA 4KHMA 1TV6B 4H4OB 3QEPA 3O3HA 3AVAA 3NH2A 2ZQBA 4DTNA 4CFCA 2B4JA 5KG6A 3MR6A 2W9BB 5HRNA 3OYDA 3IGVA 2FLPA 3OHAA 4GC6A 3VN5A 4Z4IA 1BI4A 1WSFA 4FLXA 2YHBA 3RR7A 1T3NA 1S0MA 4KHYA 4IBNA 4RNFA 2WK4A 2GV9A 3MECB 1RTHB 4NLGA 1HYSB 2J6SA 4CJQA 2FVQA 3H5YA 3I5CA 5KG2A 4Z4EA 2E9ZA 5D3GA 2VWKA 3C6UA 1NKEA 1GX6A 2HNDB 1R0AA 1DLOB 3O4NA 4FJNA 5F8IA 3Q8PB 2I5JB 2G8HA 4RZRA 3RB6A 2IDOA 1RT5A 1L5UA 5DK5A 3VQDA 1VSIA 4R5PB 2ASDA 2W7OA 2FLNA 4WXWA 3QIDA 1SUQB 2IA6A 4ZTJA 1SL1A 3QLHB 2OPPA 3L3VA 1JLAA 3DLRA 4NZ0A 3GYNA 2BANB 3OYNA 4Y2CA 3KD5E 4O44B 3NBPB 4HVJA 3H4BA 4PQUB 3IRXB 3PW7A 2NUBA 4FZYA 3KLFB 3QGHA 3AO2A 5DLFA 3KMQA 4PUOB 1NKCA 5EWGA 4CFDA 3CDUA 4R8UA 4E3SA 1D5AA 3KLFA 4QW9A 4CJFA 4FBTA 3KD1E 1U49A 3M8SA 1EETA 2W42A 3AVJA 5KFJA 2WRMA 3QEIA 1RT4A 5CYMB 1SUQA 4FK0A 2YNIA 2UUWA 3BSCA 3WNEA 1SKWA 3HHKA 3MXMA 1JL2A 4IFYB 2HHVA 5KFZA 3AVMA 2OZSA 3DLKA 1S48A 1TL3B 3QESA 4R8UB 1X9MA 3C6TB 5C42A 4K4TA 1S6QA 3ZSOA 1NOYA 4DSLA 4N47A 3NGZA 4FJ7A 1VSHA 4QWDA 2V4RA 1S6PB 2DFEA 3HYFA 2AGOA 1RDCA 4CE9A 1XC9A 4FCYA 2D41A 4BDYA 4WE1B 2GIQA 2FVSA 4EYHB 3IGNA 3NF6A 1XWLA 4BWJA 3U3YA 3VQ9A 4CJUA 4NLUA 4M3UA 5KGXA 1HYVA 1W0HA 1ZTTA 4IR9A 4Y2AA 2D3UA 4IOBA 3PUFA 4FLYA 5CY4A 4RW8B 4HUGA 3FQLA 3F9KA 3C6TA 5C42B 1RT3A 3AA3A 2UVUA 1A5XA 1WNSA 3AO1A 4W5QA 4OL8A 1SKRA 4W5NA 4CCHA 3OY9A 4TXSA 4WFXA 1UOCA 1TQLA 3DYAA 5KFMA 2QKBA 4WXOA 3UQSA 4H8KA 4Z0UA 4MQ3A 3SQ4A 4HTUA 5KGWA 1TV6A 3QERA 3ZCMA 1D1UA 2IJNA 2E6LA 3CM5A 2DPIA 4I2QB 3DM2A 4J2AA 3LP2A 4CGJA 1G15A 3DRPB 4DFPA 2ITGA 3KKSA 2IMWP 2GC8A 1TAUA 4RNNA 4LSLA 2QE5A 2I1RA 4ZPBA 4ECXA 4CJEA 4NCGA 2YNGB 4H4MA 1TKDA 4NLRA 1LW2B 5C24A 3OYJA 4KSEB 1JLFA 4ICLB 1S1XB 4I9QA 4ID5A 4ZPAA 1YT3A 2WONB 2OPQA 1WSIA 3OYCA 3NDKA 4NCAA 1RT7B 2D7SA 4OJRA 1ZBIA 4F4ZA 3RRHA 1B92A 4KHNA 1S10A 4MKAA 1LV5A 2W9CA 4ZP6A 1IKXA 3RMCA 4F4WA 2F8SA 1RCHA 3VQAA 1J53A 2KQ2A 1VSFA 4H4OA 4H4MB 4K4UA 3QO9B 2WHOA 4NLWA 3UDLA 3LALA 3U6FA 2HVIA 5FRNA 1HNVB 3AVGA 3H5UA 3ZSWA 4URQU 1S1WA 5J2PA 1QE1A 3LZJA 3V6DB 4NLQA 1JLFB 4ICLA 2R8GA 2VG7B 2QK9A 1SH0A 4QWAA 3V1QA 4WE1A 4CJ5A 2P51A 1DTTB 4ZMMA 2IM1A 4M3TA 3AVCA 4MFBA 4K8ZA 2V4QA 3OL8A 3LP3A 2PY5A 3NH1A 4DG1A 4FS1A 1JLCB 4DTJA 4RW9A 4Y1CA 3NGIA 1JXLA 4ZVEA 4G1QA 3JYTB 2OPRB 1TK5A 3V9UA 1EKEA 4CIEA 5SZTA 3PX0A 4ID5B 4N41A 4RW7B 1CZBA 4DSIA 1HQEB 5CYQB 3OSPA 1S1VB 3H5XA 2YKMB 3DMJB 3KJVA 3L8BA 1LAWA 5KT2A 2HHXA 3OYAA 1RA6A 3BSOA 1C1CA 3DI6A 3HJFA 1JL1A 3SV3A 1XR5A 3OVNA 5C25A 5KTQA 4K4XA 2OYQA 3KK1B 4EZ6A 1RBRA 2OPSA 1X9WA 3RWUA 1IKYB 4CEZA 3QO9A 4HCBA 4DQIA 4Q0BB 3NF7A 5C5JA 3OJUA 3AVIA 4FLTA 2IBKA 5F8LA 4OVLA 5KFSA 3NGYA 2HW3A 3KHRA 2W7PA 1C0MA 5HROA 1JX4A 4XO0A 3PO5A 4XIUA 2OH2A 3MR2A 1JXEA 4CJ4A 2IJFA 3K58A 4CIFA 1VSJA 5KFGA 1ZBLA 4EO8A 3OS2A 4PWDA 4ZVGA 3ASMA 5I3UB 2C2RA 3DI6B 4TN2A 2YKNB 4PQUA 2BE2A 4CHOA 4DWIA 4OPKA 1KVCA 4CEAA 3OLBA 1BHLA 3DM2B 3IN5A 2OA8A 3WNFA 4PUOA 3ZT2A 4EBDA 3AA2A 3S3NA 4IR1A 4CHQA 2YKNA 2YNFA 4JV1A 1CZ9A 4NLYA 4IKFA 3GIIA 3V1RA 4I7FB 2ILZA 4F3TA 3QEXA 3KK3B 1NJZA 3LPTA 5HROB 2IM0A 4EEYA 5KG0A 4O0JA 4ECSA 4JLHA 5KG4A 1WNEA 3P5JA 1KLMA 1ASWA 2R8JA 5KG3A 2HWHA 5L1IA 4OKKA 4DTUA 4JV0A 1UA0A 2FJWA 3KLGB 2AX0A 4M41A 1C0TA 3KK1A 3LPUA 4AHUA 1RTJB 3VA3A 4W5OA 3K57A 3FRZA 3ISND 3MFIA 4JS5A 4B9MA 4DTXA 3PW4A 1R0AB 4CEDA 4DL5A 1NK9A 3C6UB 1XR7A 1RT6B 2YNHB 4CECA 3I0RB 3E51A 1EXQA 1QAIA 4O3NA 3DRPA 4NRTA 3G0ZA 4KHQA 4DMNA 4F2SA 2AGQA 4GW6A 4O5BA 3JYTA 1KLMB 4CF1A 4IFYA 3SQ0A 3OL9A 3MEEA 2B6AB 2ZD1B 2VA3A 1S5JA 3SNNA 3G10A 5KFQA 4RUCA 3AVHA 3NF8A 2WOMB 3TAGA 4NYFA 1JLBA 3CDWA 1VSEA 5KFUA 1JLCA 4Q8EA 4DTMA 4E7JA 2C28A 3V9WA 3SV4A 4FLVA 4F4XA 1U4BA 4QOZB 4UQGA 2Y1JA 4FK2A 3DOKB 4BDZA 1BIZA 3IS9B 5HBMA 4IRCA 1DLOA 3KLVA 1RBVA 4ZTFA 4BDPA 5KFWA 3BQ2A 4U6PA 3HM9A 2VG6B 4YNQA 2BQUA 2AGPA 1RDBA 3G6VA 2BQRA 3QNNA 1U48A 2IC3A 1J9AA 3M8QA 3CVKA 5KFBA 5DGAA 3OJSA 1N5YA 3OYGA 4H54A 5F8NA 5KT6A 3SFUA 2HNYB 4CJTA 4FZXC 3SQ1A 3BSNA 4TY9A 4KTZA 3G6XA 1T05A 3AV9A 4BWMA 1TK8A 1KSPA 4J9NA 2A1SA 4MK8A 4ZPDA 1BGXT 3HP9A 4BACA 4FJMA 5JS1A 5HBMB 1VSLA 2YNFB 1RDRA 1RYSA 2OPQB 4WYWA 2EX3A 2PYJA 1S4FA 2V9WA 4Q45A 2FJXA 4DQQA 4M3WA 1RT7A 1LW2A 1JLGA 5C24B 1KHWA 3T5HA 1BIUA 4DS4A 3ISNC 2GIRA 4DSKA 2IC3B 4WZMA 4FJ5A 4IH6A 1HQEA 3AA5X 3LP0B 5CYQA 1L3VA 4FYDA 3NAIA 1RDAA 4TYAA 4DL2A 3D5MA 4M95A 3HVAA 1FK9A 2UVVA 5J2QB 3FFIB 3G86A 3HPHA 3ITHB 2F8EX 1IKWA 5HLFA 3MTKA 2X78A 1LWEA 2WB4A 4FW1A 4KHRA 1UA1A 4FJJA 4ZP9A 3I8DA 1ASVA 4E0DA 5KFLA 1TKXB 3LDSA 3CIZA 4ECUA 3KK2B 1TAQA 1WAJA 4F3OA 3NGDA 4XPCA 3NAEA 1B9FA 4QWCA 5HRSA 5J1EA 1NHUA 3U3GA 4NCGB 4HCCA 2QV6A 4RW4A 3H5SA 4W5RA 3DLGB 4QWBA 5KFHA 1NJWA 5JXSA 3SI6A 4QAGA 3O3GA 4CHPA 1HQUA 1QSLA 2G8VA 3OS1A 3BGRB 1SV5B 4KO0A 3SUPA 2FBVA 4MK9A 1BCMA 3S3MA 4MKBA 1RTHA 2IS3A 4WZQA 1WSHA 3K2PA 4AHSA 2XCPA 5I3UA 3D28A 3PHEA 3IRXA 1RYRA 2HAIA 4KHUA 4KO0B 4KB1A 4K4YA 4FJIA 4ECRA 4PY5A 5J1EB 3UIQA 1WLJA 1GOAA 4FXDA 3VQQA 3SUOA 3SQ2A 5T14A 3DLGA 4DU4A 1T05B 4DLGA 1EP4B 1RAJA 5CZ2A 3CJ3A 4LQ3A 3ZT1A 5HRRA 5DLGA 3MEDB 4LH5A 4QW8A 3PW0A 3RBDA 5KRSA 3H2LA 3AA4A 2FLLA 2VA2A 5KFAA 1BL3A 4M94A 4DF4A 1X1PA 1YVUA 3BSAA 3IG1A 4DU1A 2B5JB 2QXFA 1C1BA 3LWMA 4EBCA 1CSJA 4ECYA 1BISA 3QZ8A 4FJKA 4DSEA 5D3GB 3ITHA 4IG0B 2O5DA 4TYBA 2BE2B 4FJHA 3K5MA 4F8RA 4DL7A 4RNMA 5CZ1A 4FK4A 4M45A 3D45A 1KRPA 3CJ2A 4B8CA 3LP2B 1VK0A 4B3OA 5KT7A 4RW9B 3Q8QB 4CJVA 4IG3A 3GQCA 2O4GA 4J9RA 2G8FA 1T03B 3ICLA 1KVAA 4QPXA 3MEDA 4FBUA 1C0UB 2BR0A 4KI4A 1BI4B 5J2QA 3CDEA 2JEGA 3C94A 1U45A 1DTQA 3V9ZA 1TKTB 4DFJA 3L2WA 3CJ0A 4EBEA 4CEBA 1TVRB 3D0PA 3VQ7A 1RTIB 1RTDB 1LWCB 4DQSA 4B3OB 3KLIA 2D0BA 1IKVB 4ID1A 2QKKA 2HNDA 4CF2A 2Y1IA 4ED7A 1N4LA 2ZE2B 1DTTA 5J2PB 1U09A 1MU2A 3VQBA 1IKYA 4EP5A 5HP1B 2UUTA 5L1JA 4E7HA 4CHNA 2FJVA 3PY8A 3OL7A 4FVMA 4FJXA 3EPIA 2ATLA 1DTQB 4DFKA 2ASLA 4J2BA 3SYZA 3B6PA 5KT4A 3IS9A 3SJJA 4IH7A 4R5PA 4PA1A 4DL4A 2ALZA 2P1JA 3DLKB 2JEIA 3JSMA 1NHVA 4Y34A 3RBEA 1UWBA 3NCIA 4NYZA 3FFIA 3ALYA 4O44A 3ZT4A 5DQGA 3V9SA 2RKIB 3HKWA 1LWEB 4NLVA 2OZMA 4Q5VA 3OYEA 1HYSA 2W8LA 1NJXA 5JUMA 1NJYA 5HP1A 3NAHA 3HP6A 2ZKUA 4I2QA 2XWYA 3N6MA 3MXJA 3BQ0A 1VRTA 3RMDA 3CJ4A 5L1LA 2XGQA 3CFOA 3L2RA 4E7LA 4AHVA 3TAMB 4B9NA 1S1WB 3V6KA 3DLBA 2VG6A 3KTQA 1WAFA 3KLHB 4RNHA 2FVPA 4DQRA 2F96A 1EX4A 3HVTB 4ZVHA 3H59A 1NOZA 4F4YA 4ZPCA 4CGHA 4ED3A 3KK3A 1UWBB 1RTDA 3AVFA 3ZSVA 4CJPA 1Z26A 1S6PA 3N6LA 3QLHA 2RKIA 5KFNA 3IG1B 4CERA 4N5SA 2RN2A 3TVKA 1S6QB 2R8HA 4LH4A 4CF0A 2Z1JA 1T8EA 4CJWA 3Q8SB 2XO7A 1O1WA 1T03A 2P5GA 3TQ1A 3L2UA 1CLQA 3OYIA 2KFZA 4ED0A 4B9SA 2P5OA 3KOAA 2KZMA 2W9BA 4I9LA 3QETA 2DY4A 3QIPA 3O4QA 5DG9A 3KLHA 4J9MA 4Q44A 4B9LA 3VQCA 5F8GA 3I0RA 4DFMA 4K4WA 4C8LA 3FDSA 4J9PA 1RT2B 1RBUA 2EC0A 5FROA 1QQCA 5FRMA 3MF5A 3KHGA 4X2BA 1SKSA 3K59A 3KLIB 3HPOA 2DFFA 2LSNA 3LP1B 3VQ4A 1RT1A 5J2MB 1L3TA 4OGCA 1XHXA 3BR9A 4DU3A 4KREA 2HVHA 2J6TA 4CEEA 1SV5A 4FJGA 2ZD1A 1S49A 1NK8A 3DRRA 4ED1A 4CEOA 2E9RX 1TL3A 4NLPA 4MK7A 2AJQA 2XCAA 2Z1IA 3KLGA 2IOCA 4DL3A 3OHBA 3CFRA 2D3ZA 3GV8B 3NF9A 3VQEA 3HT3A 5CYMA 2HWIA 3G6YA 4O55A 3AVBA 1JKHA 4CHYA 4FZZA 4KKOB 4HYKA 4B9TA 3M8PA 1JLEB 3DRSA 1QUVA 1J5OA 2FBXA 4CGFA 3M9NB 4IFVA 3RMAA 4RU9A 1VSKA 3LP0A 3SI8A 5KT5A 4YP3A 3GIMA 3NBPA 2IAJA 1YVFA 3VA0A 5DQHA 1WSGA 1NK7A 3L2VA 3MECA 2XY8A 4CK2A 2ZE2A 1S1TB 4O3RA 2HNYA 2BGGA 1B9DA 1TKXA 2KTQA 3KK2A 4BE0A 3EY1A 4CEFA 1REVB 5KG5A 1WSEA 4F4KA 3V4IA 4KB7A 3SFGA 1VSMA 4O3PA 2R7YA 2Q3SA 3GV5B 4KKOA 3K5NA 1RBTA 2GUIA 1TKZA 3ZT0A 1C6VA 5KFXA 4EYIB 4EP4A 1L3UA 2EHGA 4KRFA 4OGEA 1FXXA 2WONA 4OKJA 3RAQA 1D9FA 4J9SA 4F2RA 2YNIB 4QCLA 1BQMB 1S0NA 3H98A 4BE2A 4OLAA 3E01B 4E19A 3M8QB 2HMIA 5KI6A 5KFKA 3TAQA 1NKBA 4B9VA 3GIJA 1IO2A 3MAQA 4ZP7A 1FKPA 1ZETA 4DSFA 1BQMA 1IM4A 1VRUA 2HNZB 3PO4A 2E4LA 3OL6A 1Z25A 4YQWA 4URSA 1MU2B 1SH3A 1A5VA 4J9QA 4Z4GA 1KVBA 3KMSA 4LD0A 3LWLA 4AH9A 4JRQA 3RAXA 4M3XA 2E9TA 4KV8B 1LW0B 1RA7A 1SL2A 4RW4B 2PYLA 3HVTA 4HHTA 4LQ9A 3V1OA 1S1XA 4AILC 2VG5A 4AHCA 4TQSA 2GBZA 5KFEA 3OSNA 3JSMB 3MEEB 3PR4A 2C22A 4OKEA 1C1CB 4G3IA 3PV8A 4Q43A 2XC9A 2X6NA 3S3OA 3EPGA 3KNAA 2R8IA 4NCBA 1N6QA 3QINA 4O3QA 5FDLA 1HNIB 1J54A 1KLNA 1GOCA 5DGBA 5JS2A 5FDLB 3DOKA 1S9EB 5HRPA 3EZ5A 4NLTA 2HHUA 1QS4A 1FKOB 3GIKA 4KAIA 5F9LA 4KPYA 4CHZA 1LW0A 3HVRA 1C0UA 2VG7A 1JKHB 2BANA 2VG5B 4ZVFA 4JRPA 1GX5A 1TVRA 1I6JA 3UR0A 1Q8IA 4FLZA 1S9GA 2X74A 5DG7A 2R2RA 3PVXA 1YTAA 3DOLB 1HMVA 3TARA 1TKZB 2BDPA 3VQ5A 4ELUA 4DTSA 4MIAA 3WNGA 4GVMA 5DG8A 2KZZA 4DLEA 1K6YA 1IKWB 1S9FA 1FKPB 5HLFB 1HPZA 1TL1B 1F21A 3PR5B 2B6AA 3F73A 3H40A 3PW5A 1JXBA 2XI2A 4TY8A 2HMIB 2AQ4A 4O4GA 1D9DA 3K5OA 1D0EA 4C8NA 3OYBA 5I42A 2A1RA 1HJRA 2WTFA 3CO9A 2R2TA 4LSNA 2WCXA 3THVA 3DLEA 4B08A 4DTOA 3QNOA 4MIBA 3ZSQA 4DTPA 3MXIA 3I0SA 3PX4A 4Y1DA 1NK5A 1HPZB 1TL1A 2Z1GA 2D0AA 2G8IA 1ZBUA 5EDWA 2RDJA 3TAPA 4FJ9A 3PW2A 4KAZA 3NHGA 3QEVA 3GILA 4ECQA 1Y97A 3H08A 3CG7A 1U47A 1VSDA 4CJKA 3UPFA 3KIOA 1RNHA 1C1AA 1N5YB 3WNHA 2W9CB 1KFDA 2ASJA 3RB4A 2HHQA 1S1UA 1JIHA 2XY5A 3CQ8A 1XI1A 1VRUB 1BQNA 1QSSA 4KTQA 4JV2A 2XI3A 4EZ9A 4LSNB 3EYZA 1EETB 1C1BB 3OYHA 1RT3B 2B43A 4J2EA 3H4DA 4IH5A 4N76A 1J5OB 3DRSB 4RW8A 3T1AA 1TGOA 2W9AA 2PZSA 5EUHA 3OS0A 4KFBB 4FM1A 1Z4UA 3BQ1A 2JEFA 4Q8FA 1RT2A 2RDIA 4MH8A 3T5KA 4RW7A 3B6OA 5DMRA 4TQRA 4FJ8A 4ECTA 4NLOA 2DTUA 4E7KA 3I5AA 3PZPA 3DRRB 4KHSA 5KG1A 3QGIA 2OPSB 1ITGA 2FC0A 1QTMA 1NK0A 3S9HA 4Y3CA 1JLQB 1S1UB 5KFPA 4DSJA 5F8HA 5C25B 2BRLA 3T3FA 4NLXA 2JC1A 4C8OA 1S9GB 3O3FA 1ZBFA 4RNOA 3T5LA 3SUNA 2I5JA 4HKQA 4I7FA 3HL8A 3FSIA 3LP1A 1JLGB 4B9UA 5KRTA 1A5WA 4FLUA 2X6SA 4YR0A 3T19A 2Z1HA 3KHLA 4E1MA 3LZIA 1CXQA 4TSXA 4J2DA 2BQ3A 2HB5A 3OYFA 1QAJA 4O4RA 4CESA 3SZ2A 2FBYA
chains in the Genus database with same CATH superfamily
3AO5A 3HHLC 4JKBA 4ZVSB 4LFBF 1IG9A 4ZN3A 2PI5A 3M9MB 3DXMA 5IS2A 4PG5A 4NLDA 2VWBA 5KT3A 5B08A 2HGLA 2VF3A 3BGLA 3QATA 4K42A 2HS0A 2J7WA 3NXZA 1NK6A 1PJ5A 1K1SA 4DR4J 4CJSA 1NPPA 3E9PA 4GMJB 1R59O 4KIAA 1GQEA 4OPJA 3P8BB 5C2CA 4JV5F 1V4TA 3ULDA 2LQBA 4JI2K 3HO1A 3NL0A 2EFQA 2DIUA 5A8WA 2JNJA 1NO8A 1RILA 1T7PA 4DX8H 4M3RA 4O3SA 3QSYB 4A2BA 1CJTA 1S1TA 3M8RA 1DFDA 4YMEA 4KI6A 3QICA 3PLAA 1VIOA 4C4WA 4A8XA 1WDTA 4B1UB 2CFXA 4BLGA 2MKCA 3TR8A 1PC5A 4ECWA 4RWWA 3CW2C 3KKRA 4ECZA 1XMOJ 2PIIA 3TANA 3SPZA 5SWMA 2ASMA 4BRCA 2NRTA 5K14B 2FYXA 4CJ3A 4CJLA 3L09A 5J1PA 2G2ZA 5KFYA 4DPXA 2VH7A 1N52B 1GXTA 4IG3B 1UETA 3PJXA 1FFWB 4RX6A 4U7UD 3CMES 3QFPA 2V8PA 3DYAB 2H5IB 1SC6A 1C2PA 3MCMA 1OS5A 2DH8A 4O0IA 2HBYB 2IAJB 3K0JA 3OYLA 3RAMA 2RD5C 3ZZRA 2OP5A 1RP5A 5KFRA 5IFMA 2P9UA 3TNVA 2HHWA 4OIXA 2HHTA 3BZKA 1IKVA 1LEOA 2VYPA 3MFHA 5I3QA 2MY8A 4AHTA 1X8DA 1B4SA 5B7WA 3J7ZO 1QE1B 4DQPA 1TELA 2I0XA 4CGGA 1IJJA 4Z4HA 4YOYA 4X65J 1CJKB 4DL6A 2DR5A 3W2WB 2PT0A 2Y9HA 2YPYA 2KHOA 4G1QB 3D6MB 2O8BA 3QT5A 3IAYA 4YR2A 1GLLO 4PCQA 4JI8K 1B0TA 2KT2A 1MWMA 1JLEA 3MK6A 4O3OA 4IRDA 3MN7A 5KFIA 3TX8A 2R7RA 1SZ2A 4URGA 4NL5A 3HMJG 4GV6A 1YBTA 4CK1A 5AJ3F 4B3RK 2WVFA 3UVJB 1TP7A 1CJKA 3ELHA 4LBHA 2QGFB 1Q78A 2C42A 2NSCA 2FUG9 2M2BA 4DV6K 1NPKA 1VFJA 4KBIA 2HMPA 1NGAA 3CT9A 5FIIA 1RUSA 1ZYQA 4DJBA 3MD3A 2B51A 2SXLA 2E20A 2IBOA 2CJQA 2OMOA 3OLAA 2YWKA 1N56A 1YJNS 1WHVA 2OPPB 4DV6F 3RB3A 4W98A 2V0NA 3AY9A 3QEWA 1YTUA 4RUAA 3V6JA 3I0SB 3V6HA 2F8TA 1VQKN 2V51B 4B3TJ 3CQYA 4EAHD 3V4IB 5J1NA 1RABB 2QA4S 4BE1A 4EMDA 2HHHF 3ZTRA 3MMJA 1SVDA 3HBTA 3SAFA 3LPEA 1SQEA 4IFVB 3FR0A 3M8PB 2CQHA 2MQLA 1Q86O 2UVWA 3SMSA 2R2SA 2W2PP 4MDBA 4FS2A 1LWFB 4IJAA 4J9LA 3GTYX 2XBPA 3BGRA 5AQJA 4K4SA 5L9NA 2H5EA 3RU0A 4DV4F 1X9SA 1H1VA 3GR1A 5H9EJ 4ILGB 4ED2A 3QWUA 1BY9A 3CFPA 5EU7A 2MSSA 4KV8A 3RRGA 2W01A 3OW2R 5IV3A 1U8WA 4JI1K 3U4LA 4EFHA 2F63A 5L9XA 4TU7A 3VQ8A 1WHXA 4AFFA 1VQ8N 4GY2B 4C8KA 3MEGA 1LWFA 5IT4A 3H42A 3MR5A 3RR8A 5B0DA 3C95A 1WDDA 1WOSA 3KLEB 1I3AA 1DEJA 1NMNA 3BDPA 3HK2A 5L46A 1BD6A 4ZCKA 1LAVA 1HBUB 4CH1A 4KJIA 2MB0B 3TAEA 1SIZA 4FM2A 4JI7F 2HAFA 4LF4K 9ATCB 1U04A 4FM0A 2KH9A 4NXMJ 1HARA 4WP3A 1XMQK 5KG7A 1JWWA 4WYLA 3TAFA 4RLEA 5IC6B 3BKTA 3AVAA 2O1PA 3NH2A 2VIHA 5IWAF 3ID6A 4DTNA 3R8YA 3WXMB 5LL6Z 3N5FA 2N7CA 2YHYA 1FEHA 3OHAA 3ZZYA 2YTCA 1YGYA 4Z4IA 4FLXA 3RR7A 3TUJC 3S8SA 1S0MA 1QVGR 5U47A 4IBNA 4RNFA 5BR8F 2ZOGA 2WK4A 2WW8A 2GV9A 3MECB 2F65A 1RTHB 3OQ2A 4NLGA 2XYHB 1G2EA 4CI0B 3I5CA 5KG2A 2E9ZA 4BVPA 2VBXA 4ANDA 2P9UB 5K20B 3O8MA 3C6UA 2L3MA 5HJXA 1KQGB 1H98A 3O4NA 3JQKA 4AM6A 2JZ5A 2BJ7A 5F8IA 1NGIA 5AQVA 3AAPA 3MCAB 5DK5A 3C66A 4GKKK 3MMAB 4YS2A 1WOPA 2ASDA 2W7OA 1NGBA 1RGIA 4WKRA 3L3VA 2O8BB 1JLAA 3DLRA 4OX7A 4ILRA 3H3NO 4NPOA 2ZJQL 1FI4A 3GYNA 1HHQA 1LKZA 4X4UA 1U0HA 2ZBIA 3KD5E 1QUPA 2FD2A 2HLUA 1X5PA 4IYQA 3FEYB 1Y4ZB 4HVJA 2HFZA 2OTJN 3QBWA 1A9NB 2NUBA 4QS9A 3KLFB 3AJ1A 2VQFF 3P38A 1FNOA 3Q2SC 4C2MA 2XULA 3DFEA 4E3SA 3PEHA 3JTNA 3KLFA 2AP1A 3MI7X 3SBGA 3HFKA 4QIWD 1C4CA 1Q5YA 4N8NA 1N33F 4OHYA 2OTJS 2UUWA 3BSCA 1REGX 4JI0F 1SKWA 1QAXA 2PO4A 2V50A 2LYVA 4LF6J 4K4TA 4JV5J 4DN0A 1S6QA 2Y0SD 2IDEA 3K2YA 4EFAC 4DV3F 1HNXJ 1J6ZA 3NMRA 2V4RA 4XDCA 3HYFA 2MLXA 4BDYA 1S72N 2GIQA 2FVSA 4ISEA 4OHVA 1WC0A 1QJHA 3TP2A 4JI4F 3MPUB 1HI0P 4BRLA 1N8RT 1EO1A 1P8GA 3H2UB 1SQFA 1VRQC 3PM9A 4HUGA 2VC0A 3FE1A 2VHGA 3HD1A 2JL9A 3A0IX 4W5QA 1CC7A 1SKRA 4CCHA 3CULA 2YH1A 2YWHA 4TXSA 4WFXA 3I8BA 1TQLA 3BKFA 3PJ9A 5KFMA 1V3RA 1WBDA 4Z0UA 3ENAA 4HTUA 2E5LK 5KGWA 2KO1A 3C7NB 2IJNA 4M5DA 3HM8A 4DZ6A 3O9RA 4CGJA 1RWKB 3LUYA 2ITGA 4QU7A 1RAIB 3I87A 2IMWP 2OFGX 4RNNA 4LSLA 2QE5A 2V8GA 1KQKA 1X31C 1X7VA 2YNGB 4NLRA 4KSEB 3QPIA 1JLFA 1KOOA 4E1JA 3U7JA 4ZPAA 5CCMA 2WONB 1N32F 1SS6A 2XZDB 4NCAA 1NSKL 5M2UA 2Z30B 2D7SA 5LM7E 3C7NA 5F0UA 1B92A 5LJWA 4MKAA 1T02A 2AYMA 4ISGA 1B0VA 4W4MA 1VLOA 3R2CJ 1CPZA 3RMCA 1CC8A 4F4WA 2HQ3A 3AA9A 3AD8C 1J53A 3OFHA 2A3ZA 2FJAB 1GLJO 3U1MA 3QO9B 3TUIC 4BR0A 4V19S 4NLWA 3UDLA 4LMZA 5FRNA 3AVGA 4URQU 1S1WA 3N9UC 4ALZA 3CNQP 4I1TA 3IR7B 3D7EO 3N4QA 4NLQA 4ICLA 4ZVPB 2R8GA 2VG7B 3VAIA 5HVHA 2DGOA 5F41A 3UN3A 2QL9B 3V1QA 1Y5LB 4E8UA 4CJ5A 1B99A 3DDIA 1DTTB 5GAEP 1WC4A 4OZ1A 3EGVA 5A2QY 2IM1A 3PIPQ 2KT5A 1OY9A 1KQFB 4U9RA 4F36A 3ULEA 3VF2A 2MKJA 5M1QA 2PY5A 1F3FA 5AQLA 4DV2J 3ZX0A 1HHTP 3WXJA 2HGNA 1SJ1A 1X4HA 3C46A 4A8YA 4DTJA 4DV4J 2LU2A 2OUGA 4FSVA 2QI2A 2UUBJ 2ADBA 4G1QA 4Q7AA 3C16A 2OPRB 4Z7YA 3V9UA 4CIEA 4U95A 3CJTA 3R3TA 5SZTA 3EDRB 4ID5B 1XNQK 1Z2ZA 3VENA 4I6MB 1DURA 1HNWK 1ZS6A 3LOUA 2RRAA 2YWFA 1HQEB 2IIHA 2ZH8A 3OV7A 3OSPA 4MO4A 4CW7B 2O8FB 3P49B 3DMJB 3KJVA 2V8VA 3ZEUA 4CTAA 1Y3JA 2WFBA 2MJNA 5BN9A 3GFHA 3OYAA 4HR2A 1YLXA 5BR9A 3DI6A 1LOUA 5D4NA 2N4CA 1TUYA 4U96A 3HJFA 3R6LB 3SV3A 1LK7A 5C25A 3FZ2A 1GMWD 5EX0A 2OPSA 2VKZG 4DUZJ 3D3CJ 4Q0BB 4WFBQ 5HL7Q 4CLYA 1FTRA 1XERA 4X4NA 3NGYA 2VBWA 2HW3A 4L3QA 1MN7A 1F9FA 5A8KA 1DBDA 2RQ4A 1JX4A 3M2UA 4XO0A 3A12A 3C0BA 1T9VA 2A5XA 2YJFA 4G65A 3SAHA 3BGOP 4H4KC 5LMNK 2CA9A 2O8CB 2EPIA 4PWDA 3PYEA 5KOXA 2C2RA 4TN2A 5E84A 4JD2B 5BRHA 3GJSB 3SSQA 3DM2B 3IN5A 2E2QA 3DXMB 3UR3C 4BG9A 2DHAA 2J7UA 4IR1A 1W97L 1S76D 4JV1A 1CZ9A 1HLUA 4AT1B 1X3NA 2QSWA 5HMZA 4F3TA 4CO4A 3OVSA 5HROB 3ZTSA 4O0JA 4JI3K 5KG4A 2HF3A 3BYPA 4CZLA 1XC3A 1KLMA 1CBKA 2GELA 3FLCO 1K8KB 1JJ4A 4G6VB 2HHHJ 4HTIA 4JV0A 5IXUA 3M5RA 4BRFA 5LXRA 1C0TA 3A3PB 4AHUA 5CCLA 1V4SA 3ENWA 4YN3B 3PW4A 4CEDA 3CCUN 1JQGA 1TZ0A 4C8ZA 3C6UB 4DX7A 5AQIA 4CECA 2AYGA 3ADAC 1EB0A 2O8DA 1QAIA 2QL5B 3KUHA 2CDQA 3G0ZA 5LL6d 1NSQA 4GV3A 4PRFA 3OUYB 4O5BA 4CZMA 2W1BA 4CF1A 4IFYA 3SQ0A 2JRSA 2B6AB 2G0CA 2VA3A 4OI4A 1S5JA 3MM9A 5KFQA 3AVHA 5I4MA 4ZIVA 4LVOP 2H51B 4NYFA 2ZBPA 3MURP 1XMBA 1VSEA 3BB5A 3TTCA 4WCEL 4A5BA 5HMWA 1S6OA 4FLVA 4MTPA 3OXFA 4F4XA 4Y2IA 2RILA 4UQGA 3IS9B 1RBVA 4ZTFA 2OELA 5KFWA 4WQ5C 1WJ9A 3J80Y 4U6PA 2VG6B 2Z2ZA 2RSQA 2AGPA 3MM7B 2BKPA 1FCAA 3G6VA 1YXQA 2BQRA 2BW7A 1J9AA 3QMLA 4RR5A 1E6VB 2DGXA 2ZWOA 1H6KX 3J7ZT 4ANEA 3G96A 2E1CA 1KXPA 4OX6A 5ETRA 3P5BP 5DRKA 2V34A 2CQ4A 4FZXC 1H72C 1KSPA 2C3UA 1RDWX 1ZBSA 3FZHA 2RIJA 2V9WA 3D2FB 4MO5A 3CIPA 4DU8A 4HEA9 4HHJA 4DSKA 4WZMA 1IV0A 3BGUA 3BS9A 3AA5X 3ZNUA 4FYDA 3THPA 1LXNA 3M3ZA 3E3XA 4PYAA 4M95A 3HVAA 2UVVA 3OXGA 5K8PA 2J9DA 5ETVA 4OYIA 3TEGA 1IKWA 4CBXA 1DQ9A 4JBCA 1LWXA 2G9OA 5KFLA 1TKXB 3GE1A 1V5VA 2U1AA 3DKDA 4ECUA 3KK2B 1BXNA 3OR1A 4K5SA 2R7TA 3J80U 4XPCA 2QFIA 1YI2N 5J1EA 3UDEA 4HCCA 3NNHA 1P8ZA 3O3GA 4CHPA 2G8VA 4BGBA 2HKEA 1XUPO 5AXKA 4WFNQ 2OEJA 1BCMA 1OJ4A 3AB4B 3P3DA 4PL7A 1UVLA 3D28A 1FTCA 3IRXA 4P7TA 2WVEA 4OHZA 4K4YA 3CCTA 4ECRA 1VQ5N 5J1EB 3BN7A 1QDUB 3SUOA 1S7HA 2DY1A 3A8EA 3DXKB 4DLGA 2Z4PA 1DZ5A 3R6GB 1SPBP 4UY85 3HHNB 5HRRA 4LFAF 5TKWA 1ROFA 3I56N 3H90A 2K2PA 2AJFE 2YBVA 4F0MA 1MNEA 4C3LA 4PL8A 4WIIA 3S7RA 3LWMA 4EBCA 4DR5K 3ITHA 4P6QA 2NPFA 3EMTA 2GJFA 4C3KA 5CZ1A 4FK4A 1VI7A 2CQIA 1KRPA 3PYDA 3FNNA 1PYTA 4LF5F 4B3OA 5KT7A 4YDUC 1O5JA 2R7VA 4IG3A 4LF6F 4ZK7M 3AHPA 4A47A 5H1SQ 3PRVA 2G8FA 1T03B 2H4YB 2QLBB 2BVZA 4FBUA 3OFGA 1BI4B 5J2QA 3QRQA 1DTQA 1PYOB 2ASOA 2XSJA 2W2MP 3CJ0A 4EBEA 3UCUP 1TVRB 2E1MC 3BO2A 4GKJK 1IBCB 1LWCB 3WZ0A 4B3OB 2HHPA 5EOYA 2HNDA 4CF2A 2O8FA 4DV1J 1NGDA 1DTTA 3Q0AA 4XAKA 1DGKN 2MEWA 4JKHA 3VQBA 2V2VA 2P9KA 4FPRA 1CJUB 1M5VC 5HP1B 5L1JA 5ETOA 2IDLA 2KXFA 3OL7A 5IT9O 4IFEA 2KFYA 1OO0B 5KT4A 2FB0A 3DAWA 3SJJA 4PA1A 4WFBL 2PI4A 3O2IA 2ALZA 2CQDA 3BH7B 2JEIA 1ITPA 3J81O 2VICA 1SXLA 4Y34A 3RBEA 1T6DA 3K5PA 1UWBA 3R1HA 2GX9A 3O6WA 4CYUB 3NCIA 4JNEA 2QFJA 2RKIB 3HKWA 1B7FA 1U1KA 2BJ8A 3HX9A 4NLVA 5GVQA 1BQXA 2J0XA 4Q5VA 1KD1T 4B3MJ 3AFGA 1FXDA 3SCKE 4A59A 1HYSA 1FJGJ 2PAVA 5JUMA 3K17A 5DZ7A 4KH1B 1NJYA 1SCJB 4PHTX 2VDIA 3CCUS 1UP1A 4R0JA 4I2QA 2Y1RI 3W9JA 1Z6RA 3D1QA 3N6MA 1VRTA 4GMKA 1FX2A 3HFVA 2XNQA 3CJ4A 2FHKA 2XGQA 4KGVB 2UU9J 2KL8A 4E7LA 3R5DA 3TAMB 2VG6A 4JI5K 2FVPA 1YWXA 2F96A 1NOZA 4ZPCA 2QA4G 4CGHA 2NRVA 1UWBB 1X4FA 2YHXA 4CJPA 1Z26A 2RKIA 1HD1A 4QIVA 1WOOA 2R8HA 2Z1JA 2DJWA 1T8EA 3M05A 4CJWA 3Q8SB 1O1WA 2DCLA 2CXEA 2VZ9A 1JNZB 2NRXA 4B9SA 2CQPA 1WBBA 4M5GA 3KOAA 2V52B 4LF7K 3QETA 4UT4A 3O4QA 2C2MB 5GAGI 3US5A 2EG1A 4Q44A 5F8GA 4P72A 3FDSA 5FROA 1FDNA 1SKSA 2LSNA 3IC1A 1HNZJ 1L3TA 1XHXA 2MJUA 4PG7A 3D2EB 1R8CA 2B56A 2A18A 3NG8A 2XO6A 5CHCB 2HFVA 2YKOA 4CEEA 2E5GA 4FJGA 1QQMA 2ZD1A 4ZLPA 5DM7L 3DU5A 2OSQA 2AJQA 2DHHA 2I2YA 2Z1IA 5K8MA 2IOCA 4DL3A 3AQOA 3CFRA 3GV8B 4H5TA 3G6YA 4O55A 5GAHI 1FWPA 3GFXA 2JFKA 2LQ8A 2UXBJ 1MN9A 4ZVUB 4B9TA 1X4GA 4DV3K 3DRSA 1QUVA 1J5OA 2KDOA 3GP9A 3OTBA 3RMAA 4RU9A 2CWXA 2B9YA 5KT5A 1WHYA 1N36F 3TZXA 4YP3A 3GIMA 3NBPA 1YVFA 2LECA 1HBMA 3B8AX 3CJ1A 4FPAA 4FWPA 1S1TB 2ZGZA 5GAEU 2BGGA 1AROP 3K8VA 2IVFB 2VODA 2Q79A 3Q7BA 3MM5B 4U67L 1CQNA 2MZSA 3N0VA 3SFGA 3GL1A 3Q7CA 4JOUA 3P96A 4DV6J 2ROPA 3FGUA 3K5NA 2NUUG 2Z2MA 3HSDA 3PDNA 2NRRA 3ZT0A 5KFXA 4EYIB 2HZVA 1P1LA 2EHGA 4KRFA 5LMUK 1FXXA 1YJRA 4ERDA 4HVZA 4DUYF 4J9SA 4F2RA 1F5AA 5IV4A 3G82A 4C98A 5D15A 4B9QA 2W25A 3M8QB 2P9NB 3MPDA 4FNIA 1WACA 3J7AN 2PA3A 5GADP 2JLGA 1IM4A 2BOAA 3W63A 3AA8A 5KOWA 3CEDA 5ITHA 4YQWA 2AJ4A 1A5VA 3SBMA 3MMCB 2ZGYA 4NA1A 3VEZA 3MAAB 4B1VA 4JRQA 3RAXA 2E9TA 1RA7A 3ETOA 2HF4A 5AZJB 4RW4B 3HVTA 4QR1A 3L0QA 4AILC 4TQSA 2CGJA 2YX1A 3D6RA 2DRBA 4I69A 3UKRB 4CZHA 1C1CB 3C6HA 5AZJA 3CCSS 4Q43A 1HIYA 2XC9A 3VEXA 3CF5L 4JK9A 3S3OA 3KNAA 4L75A 3J81U 3THXA 3FSYA 3H25A 1VHIA 1ZPVA 4YOWA 1EKRA 1GOCA 1SIWB 5LXYA 5JS2A 5FDLB 4X4SA 3N4WA 2QMUB 1S9EB 1X4BA 1XNQF 4NYOA 4WJBA 1FKOB 2ZHOA 4IDHA 3C16B 4CHZA 1LW0A 2Y8WA 1C0UA 2E2PA 5C2FA 3RBXA 1T9UA 1GX5A 1FVQA 2I7NA 3UNYA 1S9GA 4H0PA 3W65A 1HR0K 1YG0A 4DV1F 3TARA 5HMXA 3LTOA 1GXUA 3B4DA 5GAEI 1UW4A 5DG8A 1K6YA 1FDBA 1IKWB 1FKPB 3H40A 5D78A 2Q2RA 1I94J 3C15B 4O4GA 4NMXA 1D9DA 3K5OA 3QRPA 4C8NA 2WTFA 2D4WA 2BOPA 2R2TA 3D2FA 2DNZA 5LSOA 1XNRF 2PBDA 4CZCA 2ASYA 4DTPA 3MXIA 3I0SA 1NK5A 5LSLA 4FWRA 2WW4A 4L3NA 2Z1GA 5EDWA 2RDJA 1U7LA 2DHXA 3TAPA 3DWLA 3PW2A 3QEVA 3Q89A 1N34K 2QWRA 1VQ7S 4KGKA 3BBFA 3VF4A 1VJWA 4BR5A 3HI9A 1FT8A 2ASJA 1VQMS 3BZQA 1UKUA 3M8WA 3Q8UA 4WFAL 3FC9A 5ETQA 2N3LA 3L7OA 4LF6K 3CQ8A 3I31A 4GVLA 4CRJA 2EWHA 3V5RA 4UY8O 3TUPA 4DR7F 4DV7J 4EZ9A 4LSNB 3EYZA 2P9LA 2BKNA 3OYHA 1SAZA 2RUSA 4M7YA 4N76A 2MGZB 4RW8A 1BLUA 1TGOA 4DV7K 2PZSA 4KFBB 3UDCA 1FJEB 2BJ9A 2JEFA 3VF0B 4NLBA 4JYAJ 1K73O 3DGPB 3IBWA 2YQ1A 4QYZJ 1P27B 1HWIA 1K8KA 3UCZP 4E7KA 2BZ2A 1HWKA 3RUBL 2BX6A 3AARA 5BYQA 1NEEA 4C9DA 3R9LA 3PZPA 3DRRB 5KG1A 1NK0A 5HK4A 2UXCF 1ZM9A 5AQMA 2BRLA 2DNHA 3T5LA 3DHXA 2V9KA 4I7FA 4LC9B 2DGQA 3FSIA 1N33J 4K0KJ 2AV5A 1WC6A 5D0EA 5KRTA 1A5WA 3THYA 3SIPB 1CZAN 3UE2A 1VR6A 4E1MA 3LZIA 4R79A 1UPPA 5RUBA 3AOBA 4LFCJ 2BQ3A 2DEJA 4IOAL 4ZLNA 2K7JA 4IO8A 5G0RA 2Q1LA 5DDRC 2FHMA 1E4GT 4JI3F 2MKIA 1FRIA 1AFIA 1MWZA 1UJ6A 3HF5A 2RB7A 4X4RA 2RT3A 3MEKA 5T7BA 5AFUA 1XBWA 1HBOA 2DT9A 4ZPTR 2ERRA 4NRUA 2XRIA 2BE9B 4J9KA 3LF0A 4CF9A 2WOMA 4OZJA 2PFFB 3AAQA 1RHQB 2VB6A 5K14A 1MWYA 3CJCA 2XHCA 2J0WA 2ZC4A 2VPYB 4HACB 4ZCLA 4AQYF 3V81A 1HMVB 4IEIA 2GJIA 4WFZA 1I3OB 4L76A 1FA0A 4WP9A 2XHBA 4NO7A 3KDNA 3PACA 4DV2K 4YR3A 2CPIA 4MFBB 3TSUA 3R27A 2HVDA 3J7AP 4X4QA 3EXCX 5F3TA 4PWDB 5C0YA 4M5NA 3KJFB 3MX2A 2CGKA 3HJVA 1HYZA 2EVZA 3E01A 2Y3YA 3D4JA 3M2RA 1R0CB 2BABA 3MDFA 4K4VA 2RPIA 4EO6A 2GWJA 2HBKA 3H1VX 1GMWA 4ED6A 2LEBA 1Y10A 3OTEA 4C7QA 3PCOB 4NI2A 1X4DA 2R3VA 3N6NA 4GKKF 1Q82O 3PX6A 1QY7A 4L74A 2HQDA 4NYNA 5IC4B 3V81B 4QBUA 1TK0A 1HX1A 3J7YU 4LF9K 3VEVA 2BJDA 2E29A 1ASUA 2AJ0A 3BREA 3L2QA 5AQSA 3O9QA 2F4VF 4M3YA 4DTRA 1LXJA 2HPUA 1S5ZA 4CGDA 1NGHA 1SJQA 1R6VA 2FF6A 3HSTB 1R27B 1BHNA 4NLSA 4ELTA 3CETA 1HNVA 3D6TB 4LFCF 2HNZA 4N56A 3KWIA 2DNNA 4P9SA 5E3AA 1HLWA 3K8WA 3KFWX 2HRUA 1HUXA 1UAXA 1KHVA 5AE1A 3WEEB 3G8QA 2RHSB 1FFGB 2D5RA 1RDUA 3HPGA 4JI1J 1TUGB 4BRIA 5H9FJ 1SQKA 2DR8A 2CKWA 1I5OB 4ED8A 2ZH3A 4JYAF 2AX1A 1HRHA 4K4ZA 3F41A 2PFDA 1RAEB 2BE7D 2AYBA 3TO8A 4Z2XA 3FK4A 3TABA 1G6BA 3K5LA 1L3SA 3AO3A 4P74A 2IVYA 2ZJPL 4ZHRA 4X66J 2E5LJ 4R25A 5E41A 4KB0A 4Q2LA 2G8WA 2DGWA 1KOHA 4CGIA 5HATA 3ZZZA 4ZHRB 3EVOA 1Q79A 4G1IA 4LSLB 1EX8A 3ZSXA 1TKTA 4B1YB 2CJAA 1N8RO 1RBSA 1C0TB 2VASA 1T0TV 3ZSYA 2F1FA 2ROEA 3UN2A 2ILYA 1HNZK 3CF5Q 3JSRA 3CCES 2FSKA 2QEXS 2CPYA 3Q2TC 1RT5B 4JI6J 1WF0A 3CCVS 2JWKA 4H0VB 3ENVA 4QWEA 2EI5A 2YNHA 4CIGA 2IM3A 1X0PA 2KT3A 1CEZA 3QIOA 1Z05A 3GE9A 3FQKA 2AWZA 4KRWA 1YJ9S 3RSEB 4PYDA 1VK8A 5A0YA 1ZAWA 2M9KA 4NX9A 5B0GA 3CE8A 4BRKA 2YKMA 3I56S 2BTFA 4QQBA 3RB0A 2MLZA 4FWQA 3D0IE 4FYYB 2W8KA 4NE9C 3R8EA 2MZJA 3DDKA 2HRTA 1JLAB 4GRSA 1Q8LA 4Z4CA 3LM2A 4DR3F 3QGGA 2JC0A 3AVKA 2R42A 4J5OA 3EVMA 1WG1A 2CPJA 5FPMA 3D6HB 2ZJRL 4XPEA 2B9EA 4IQXA 4FW2A 1R6YA 2XYGB 1BUXA 3PSFA 5GIOA 2ZUGA 2K1RB 2JLEA 1R89A 5F8MA 1PBAA 2WVDA 1ZH5A 4Z4FA 2G8UA 1APSA 1FESA 2KKZA 5D4PA 3PYFA 3TTFA 3EZUA 1IVZA 4FVUA 1LWCA 1BU6O 3OFFA 1NG9A 3HVWA 1S1VA 4OPHA 3FMBA 1YIJS 3AAWB 4OYOA 2G8KA 2DO4A 2FVRA 4TLRA 1WWHA 3LPYA 4OFZA 4DG1B 4PXEA 1TV6B 4PWWA 4H4OB 3AB2B 3TSPA 2ZNYA 3GFYA 1H73A 4K2JA 2B4JA 3HHLA 2ZVIA 3MR6A 4WBFA 4FWNA 2LDIA 7FDRA 2A6AA 2VQFJ 5C2GA 1DKGD 3IGVA 3O1WA 2B4VA 4GC6A 2FHJA 1RWOB 1PAEX 5GIPA 5LT5A 5AJ3J 4MKVA 2IRXA 4KHYA 1VJQA 1K0TA 4FOEA 3TQEA 3KNGA 2NYIA 4M63A 3FCHA 4IEEA 5BRFA 5A8WB 3NGTA 4CJQA 4HDHA 3H5YA 2CQBA 4USIA 4Z4EA 4LRCA 2VWKA 3ZTOA 2O8CA 4JI2F 1W2BM 1GX6A 3E9OA 3TWZA 4I0WA 1DLOB 4X65F 2WUSA 2GO9A 2YWWA 4MKYA 3C8YA 3KVGA 3RB6A 4GKJJ 1NMDA 2B4PA 2AZ1A 5D0GA 1U2VB 1NHKL 1FRLA 2FLNA 4WXWA 3RVCA 3QIDA 1SUQB 3SAGA 2DNYA 4ZTJA 1Y7PA 2D74B 3PFOA 2BANB 2FXUA 3OYNA 3WBZA 3LH2S 2HG4A 3NBPB 2E2NA 4PQUB 3IRXB 3PW7A 5CH7B 4CLFA 3AO2A 4PUOB 3NS6A 3MM6A 2LEPA 1NKCA 4F7VA 1NSPA 4R8UA 2YKQA 3M6WA 1D5AA 1NAQA 1CJVB 4FBTA 2M0GB 1U49A 1WSRA 3Q83A 1QHAA 1QVFR 2YNIA 3WNEA 3HHKA 3MXMA 5DJBA 4F0HA 3QQCD 3AVMA 2OZSA 2KN4A 3DLKA 1NLKL 3GMGA 4KGZB 1X9MA 3C6TB 5C42A 3P6YC 4BQLA 1FJGF 3IAM9 1UVMA 4FJ7A 3W64A 1S6PB 2DFEA 3TEHB 3BF4A 4DR2K 5L8RC 4N77A 4JI0J 4FCYA 2D41A 3LW5C 2DXFA 4JHDA 3MN6A 1OH5A 2C2NA 1U02A 4LREA 3OVAA 4M3UA 2RDDA 1HYVA 5ETNA 2EBEA 2UUAK 1ZTTA 4P73A 4IOBA 4RW8B 2AEJA 3FQLA 4M1KA 3C6TA 5C42B 1A5XA 2F4VJ 2BW2A 1WI6A 2EK1A 1IG8A 1KR4A 2KRRA 3KJNB 2QKBA 4XDDA 1WEZA 3KG0A 3WC0A 3P39A 3UN5A 3QERA 3ZCMA 2DIVA 1P9QC 4V19J 3CM5A 4I2QB 4JAXA 1N0UA 1VISA 4J2AA 1VQKS 3HSZA 3DRPB 4I6YA 1UFWA 2AIRB 4PKGA 3KKSA 1U8SA 4DUYJ 4ZPBA 2HS4A 3R5GA 1LW2B 2WTUA 1MMDA 2X3GA 1UEVA 1HBNA 3F2KA 2VV5A 2LXFA 1WSIA 3UCGA 4DR1F 1RT7B 3RRHA 2VQEJ 4JI5J 3PTWA 4AQYJ 3BP8A 1RHJB 2HBQB 4FPIA 4IXCA 3VQAA 2P2CB 3MX5A 2WSEC 4PABA 4H4OA 4H4MB 2P6TA 1WC1A 3LALA 1M90T 3U6FA 3ZSWA 5J2PA 1ELOA 2JX2A 3V6DB 2ZJPQ 1VQ6N 3BV8A 1FRMA 4WTYA 3KWGA 2GS8A 2QK9A 3MR7A 2DVIA 4X64F 4QWAA 2A6OA 4FN5A 1CULB 2P51A 3EKSA 3G4SS 4QS7A 3IR5B 3RW7A 4ZMMA 2IA0A 2DGVA 2K06A 3AVCA 2QLJB 1LQ9A 4OYWA 4K0KF 3LP3A 2YX7A 1X5TA 4LR9A 4JI4K 4K59A 3MCPA 1AZSB 4DG1A 2UV8A 5A8RA 5M1PA 3VGTA 3H2VE 2MQPA 2E88A 1HPMA 2QXLA 4LFCK 1A0OB 3IFEA 4LF9J 2DXDA 3JYTB 3W5ZA 3PX0A 1CZBA 1O6XA 5CYQB 2A10A 2ATCB 2VBZA 4UQTA 2BJEA 4JI2J 3TTDA 1MMNA 4ZLLA 1JL1A 3HOTA 5IT9U 4K4XA 4DR7J 3KK1B 3CCJS 4C8YA 1IKYB 3JAMU 2VKRA 3NF7A 2P8IA 5C5JA 2G2YA 3OJUA 2XLKA 4CDIA 4FLTA 2BJ1A 2ZH1A 2IBKA 4JI4J 2NS1B 1G99A 2HK3A 2ZJRQ 4OO1J 2VPXB 2D69A 3MUMP 2DHSA 5B0FA 1C0MA 1RACB 4A5AA 5HN0A 4XIUA 1HNXF 5EGYA 4UOFA 3F5TA 4CJ4A 2IJFA 4NZ6A 3GWCA 1VSJA 1ZBLA 4EO8A 2L9WA 3DI6B 5H1SV 2YKNB 5B0BA 4PXBA 1KVCA 4CEAA 2VQFK 3TVYA 1RZMA 5HQMA 3FZFA 2KM8C 1KP6A 4B3MF 1UW9A 3S3NA 2CYYA 3ENOA 3IWXA 2YKNA 3NNAA 1NDCA 2EWSA 4F4AA 3PHTA 1ILYA 4IKFA 2G1HA 4I7FB 5T41A 3PIOL 1YUWA 1XQIA 3C65A 4HACA 3QEXA 4I6MA 1NNEA 5A2QO 3KK3B 3MD1A 4H0YB 3UWTA 3H45C 4MAKA 2XMKA 4JLHA 3VCDA 3ZYYX 1VYAA 3CMEN 3P5JA 3CCQN 3TOQA 1YSJA 4P2SA 1V9OA 3CJSA 4OKKA 3TZZA 4DTUA 3W1YC 2FJWA 2AX0A 2MXYA 1VDHA 5CR4A 1VC0A 1M5OC 4WF9L 1KVJA 3CCMN 3MFIA 1JCGA 1UMJA 1RB0A 3B4MA 4Y65A 2YNHB 1T3OA 3E51A 4LF8F 1EXQA 4O3NA 4BGAA 1PKUA 4DMNA 1I51B 4YB1P 4Y6IA 4X84A 3NEKA 3NWRA 4GW6A 1GFWB 1KLMB 4CH7A 2AZ3A 1QD1A 1XQSC 3O5TB 1K9MT 3TAGA 1VBKA 1RAGB 2D3O1 4DR1K 1M90O 2APOA 1FD2A 3KG4A 5KFUA 1H74A 2M3DA 1G7CB 4E7JA 2C28A 1EJ7L 1F5BA 1UTAA 4RU2A 4DR7K 1U4BA 3MOJB 3QRRA 2H65B 4QOZB 1IBMJ 1FJ7A 4FK2A 3DOKB 5HBMA 1DLOA 1KD1O 3KLVA 2QN6B 2PFUA 4YNQA 2BQUA 2XMAA 2DCUB 2E5LF 4BRMA 4LRAA 1F0XA 1U48A 4LF7F 2IC3A 2G1DA 4BBYA 1WOQA 3HHEA 2QC3A 2O01C 1YI2S 1U0SA 1FKAF 2V7YA 4H54A 4DV5J 5F8NA 1RSCA 2HNYB 3M8YA 4CJTA 3OR2A 4ES1A 4CT9A 3FGVA 4HI1A 4I67A 2V94A 2L9DA 4J9NA 3CSKA 4BHQA 3G6EN 4KGMA 3JQMA 3QFHA 3PIPL 2VGNA 1BGXT 3K89A 1R0BG 4GKJF 1MSWD 1VSLA 4A8SA 5D0RA 2W41A 3EGWB 3CCMS 2OPQB 4WYWA 2EX3A 2CRLA 2GV1A 2XMJA 2XTJP 5D4LA 4C0OC 5C24B 3DJCA 4F04B 1JJ2M 2N4DA 3ISNC 2GIRA 4FJ5A 4IH6A 4K5RA 2I9SA 5CYQA 4OI3A 1RDAA 3D5MA 3ZETB 3CGIA 1FK9A 5J2QB 3FFIB 2R7UA 3TPQA 3ITHB 4HHUA 1PAUB 4TU9A 1GK8A 1GMUA 2J5AA 1LWEA 1SC1B 4FW1A 3C14B 2CJXB 4P2MA 1UA1A 4DX5A 1NXIA 2WBRA 3DLLL 2MHEA 4DR3J 2D3OR 1WC5A 2ZH5A 3R1XA 1SB6A 2CZ9A 1WAJA 2QIFA 3A1YG 3NAEA 1B9FA 4QWCA 5HRSA 1EHWA 1F6TA 4NCGB 3U3GA 2QV6A 4LVNP 1OKJA 4W5RA 3DLGB 4QWBA 1IWGA 1NJWA 3SI6A 3VMFB 2HBMA 1Y3KA 1M5SA 4JV5K 4MK9A 5M1NA 2CPFA 2HLTA 4DPYA 2LU1A 3ZC4A 4AQYK 1RTHA 2RU3A 3K2PA 5I3UA 2XCPA 3PHEA 2Z56B 2HAIA 3IP0A 2GVDB 4OX9J 2P9GA 4QJVA 3UIQA 1RWNB 2XYPB 4DBQA 3VQQA 3SQ2A 3DLGA 1T05B 4BROA 4F67A 1ZC6A 3CJ3A 3ZT1A 2GW8A 5DLGA 2CQCA 4GVBB 4IOAQ 4QW8A 4USMA 2HOEA 3RBDA 2J9DE 2Y1LB 4DR2J 1FNXH 5KRSA 3H2LA 2FLLA 3MCOA 3VHQA 1BL3A 3BSAA 3T1YJ 4AM7A 2QTWA 1C1BA 4J7CA 4RCHA 2UU9K 4ECYA 1X60A 1BISA 3EXYA 4FJKA 4NEZA 5A2QU 2O5DA 1MWQA 2KB2A 1ZZNA 5E7OB 2QTDA 2R7XA 4YOTA 1IQTA 2BE2B 1R8HA 5KPZA 2YJEA 4CLTA 4RNMA 4KC5A 3CJ2A 4B8CA 2F4VK 1VOMA 2C2KB 5HOOA 3CO0P 1FNMA 3HZGA 3GQCA 2OTLN 2Q1NA 4J9RA 3F56A 1KVAA 3M30B 5DDOC 2PMHA 4QZVB 1PBUA 2BR0A 2CZ4A 4CZIA 3CDEA 4G1PA 1U25A 1U45A 4DFJA 3M30A 4OYXA 3DHWC 4FZVA 4P10A 2C3OA 5T7LA 3KLIA 4ID1A 1CG2A 4PPDA 2Y1IA 1N4LA 4F9OA 1U2RA 4PG8A 2VUGA 1PYSB 3NMUA 5AE2A 3L3CA 4EP5A 1VQ9S 4E7HA 2A40A 3PY8A 1KWMA 5BPLA 4DFKA 4J2BA 4M7XA 4QS8A 2XS5A 4WCEQ 1EIYB 5AQWA 2Q0RA 2P9SA 3BKUA 1XMOF 4K0KK 2IFXA 5EXWA 3P5TL 3JSMA 4PZVA 1VBXA 1FDDA 3QFUA 4JI3J 4X66F 2MQOA 5AFUH 3H0PA 4ZCMA 3TUZC 3FFIA 2OTLS 3ZT4A 2OKQA 1RHKB 3GSDA 5DQGA 4F02A 1FXRA 4U8VA 1RTZA 3CPWR 4BR9A 3O9TA 3B78A 3D1OA 4JKGA 1RCXB 4O0NA 3WDOA 1VQPN 3NAHA 1KAYA 5K9FA 2MZ1A 1PG5B 4NLCA 3KZBA 1S1WB 1HWUA 1YJNN 2YWEA 3OXLA 4DQRA 2CNLB 3HVTB 4ZVHA 3H59A 4F4YA 2AYEA 2CPHA 3KK3A 4L73A 4YDDB 3N6LA 2V2ZA 1VS3A 5KFNA 3IG1B 3JXOA 1HKCA 4CERA 2VL1A 3CD6S 3OBWA 1V3ZA 3X3UA 4KHPF 4CF0A 2D0OA 5C10A 1Q81T 1ZAXA 2WAQD 4DV7F 3VERA 1GLAG 2P5GA 2G4BA 3BDEA 3MN5A 5JVHQ 1CLQA 3OYIA 4D3HA 1M5KC 3N01A 2P5OA 5AQXA 3ZZTA 2KZMA 2W9BA 2XMTA 5DG9A 3KLHA 1JCEA 4J9MA 1HWJA 4DFMA 4EI2A 4K4WA 4J9PA 1RT2B 3VQTA 1RBUA 2MQMA 2DPNA 1RI7A 1ACMB 2EC0A 1QQCA 3RSEA 5GAGU 3MF5A 1Y64A 3KHGA 3HPOA 3LP1B 3M2VB 5JJBA 4MYUA 4OGCA 3BR9A 4DU3A 1IBKJ 4KREA 4HH0A 2N3OA 1KC8T 3R9PA 3MM6B 5EX5A 3M6UA 2YXLA 4FXWA 4PKDB 1YJWS 4BREA 1S49A 1H2VZ 2PC6A 2DISA 4CZKA 4A4JA 5F0WA 2FSJA 3E2EA 1TL3A 4NLPA 2XCAA 4YB5A 4B3SK 4CD3A 2UUAF 3GB0A 1NPRA 2K1RA 3R97A 1KTVA 1K0VA 2D3ZA 3NF9A 5CYMA 2HWIA 4OMFG 3FCVA 3AVBA 4FZZA 2MHNA 2OD4A 1JLEB 2WB1D 1YJ7A 1NU0A 1YZ7A 4YOVA 1GAOA 1NGGA 2V63A 3ENBA 4CZJA 3J7YI 4HL9A 2ZE2A 3GR0A 5LJVA 1S22A 2N7YA 2KTQA 2UU9F 4JD2A 4LF4J 4BE0A 2G0JA 4C0HA 1GLBG 4DX6A 3EY1A 7FD1A 1SI9A 1REVB 1WSEA 2V5HG 3BEXA 1VSMA 2Q3SA 1RBTA 2GUIA 2F7VA 4V1Ak 1YRTA 1NGEA 1TKZA 3OVBA 3JS9A 1RBAA 2XLJA 4B1ZA 3NS5A 4EP4A 4NI2B 5AQRA 1BOTO 2ZBQA 3IKMA 1PJ6A 3HI0A 3E01B 3TAQA 2HGMA 1S7IA 1XTZA 3G8TA 3R5CA 3GIJA 1IO2A 4DSFA 1ZPWX 1FKPA 4ZP7A 3MAQA 4QPTA 2HBRB 3BGFA 3CUNA 2E4LA 4C1NK 1RE1B 4XK8C 4URSA 1MU2B 1SH3A 1RAAB 4J9QA 4Z4GA 3CCSN 1HJOA 4JP8A 1QZ5A 3KMSA 2UP1A 4AH9A 4KV8B 3AXKA 1SL2A 1U6BA 1NUEA 2ZDPA 1OWXA 3W60A 2VG5A 4AHCA 1YK9A 2GBZA 2CQ3A 1MA9B 3WQUA 3OSNA 3OR2B 3JSMB 3OUYA 3DDNA 5A6WA 3HZ6A 2X6NA 2R8IA 1N32K 5LMNF 1KNZA 1HNIB 4WU3A 4NXNF 1UFKA 4C1NI 1HBOB 2E7XA 2RQMA 1T11A 5GMKa 1IR1A 3O9SA 2LP4A 1TUVA 3SCLE 3GIKA 2JWLA 1SC3B 2HEKA 4FKXA 1XMQJ 3ZLJA 1RKJA 2VG7A 1JKHB 2BANA 4ZDNA 4UZBA 1NGJA 1EZZB 4JRPA 4J90A 3AOCA 2X74A 4OZLA 4DR5J 3DOLB 1WF2A 1D3WA 2DNLA 4C11B 3HDSA 3NGSA 3VQ5A 4ELUA 2LMIA 4BR2A 4DHVA 3OBIA 5E3QA 4BRDA 4AD6A 1VQ8S 2W24A 1E6VA 3MMBA 4DLEA 1YBAA 1S9FA 3QJLA 5HLFB 1TL1B 2GHPA 1F21A 2QA2A 2B6AA 2QWLA 2P9NA 4RBVA 2AQ4A 3UO0A 1RCOB 2HFSA 2J76E 5M1OA 5GADI 2M70A 4H5RA 3MTJA 3HHDA 1HJRA 3WUHA 3W3SA 1FWLA 4GNIA 5G0RB 2V69A 4H0XB 3DLEA 1EWRA 3QNOA 3ZSQA 4Y1DA 2R7SA 1HPZB 2W4DA 2D0AA 3O9UA 2G8IA 1ZBUA 2FPHX 3MWBA 1W2BR 1NZ8A 3NHGA 3DRXA 2M5YA 1Y97A 5JLHA 4USKA 3D6FB 1HQ2A 3CXCR 1VSDA 4CJKA 1AT1B 2C3PA 3KIOA 1AXQA 2W4PA 4WIQA 1H2UX 1SC4B 3C14A 2W9CB 2C3YA 3RB4A 1RBLA 1S1UA 5LSRA 2GMLA 1N33K 1JIHA 1WEYA 4FOIA 4JK7A 2W40A 1XI1A 1VQPS 1BQNA 1QSSA 4JV2A 4UY8T 2EEYA 5KQ8A 1RT3B 3H4DA 2FGOA 4ES3A 3T1AA 2KXNB 5EUHA 3THXB 4MJKA 4FM1A 3SEOA 4LR8A 1VBZA 4B1XB 4UUXA 3OTCA 3QWPA 2RDIA 3T5KA 5DMRA 4Y2MA 3B6OA 4TQRA 4FJ8A 4ECTA 2CGLA 4J9UE 5E26A 3X1LB 3CC4N 3I5AA 2GIFA 4J91A 3QGIA 2OPSB 1QTMA 1ZOTA 5HQ8A 2LEAA 3S9HA 1S1UB 2BMBA 4USVA 5LY3A 2XB2D 4CLZA 3GFZA 1X5OA 4PG6A 2MQNA 4C8OA 1ZBFA 2VFVA 2I5JA 1KVIA 5HL7L 4NXMK 2GMHA 2JWNA 3HL8A 4A8WA 3LP1A 1JLGB 2QSFA 2GNKA 2P9PB 1NSAA 4YR0A 5K8NA 3T19A 3KHLA 2NREA 2LFVA 2FZKB 2HB5A 3WHIA 1UVNA 1QAJA 2E5IA 4CM2A 1VQ6S 3QT7A 4ISFA 2VPWB 1B3TA 4OQJA 2FBYA 3QJPA 4IG0A 1X3MA 4FF2A 2CQ2A 2YPZA 2FBTA 1VIXA 4IDKA 3LAMA 2E1AA 3Q8RB 3GG4A 5B8HA 5ELZA 3P45B 4V19X 1YJUA 5CZVA 5H9EK 5JVHL 4U7CA 2KW4A 3T7ZA 5KFCA 5L1KA 3A8YA 3DXKA 3TJ9A 1X9JA 2ATQA 3D1HA 2E6MA 3T5JA 3DGPA 1UVIA 2P9EA 4DDFA 3CB4A 3NKYA 3K7RA 2B0GA 2RHQB 2P9IB 3QT8A 1WKLA 4HUEA 4KFBA 3ZT3A 1NNDA 4YY3J 1OVQA 2YNGA 3A5OC 4DUZK 5F1XA 2KJWA 4IOCQ 2QT7A 5IWAK 5F0XA 4J9OA 4RO0A 4DV3J 1S97A 1TU0B 1GOBA 2IM2A 2DR6A 1HNIA 2QRRA 3CM6A 3B8HA 4OZ0A 4YOEA 4LIRA 2K3IA 2MYFA 3POTA 2CG4A 4J37A 1F3VA 2OLWA 2X51A 2AU0A 3U1LA 3D67A 1QVFM 4KH4A 3R5BA 4OX8A 2DTJA 2EKYA 3T41A 3GV7B 1QSYA 1RLDA 2JGUA 4PQAA 2FJDB 4HT7A 3NE6A 2C2EA 2QMWA 4ZPVR 3KLEA 3VAGA 3LAKA 2X1GA 4A46A 2J6UA 4IRKA 2MKKA 1Q9XA 2JFDA 3ATUA 3SPYA 5GAHU 2W6KA 3D0HE 5HAOA 4LY7A 3TWHA 1K1QA 4EUVA 3PJWA 5KFFA 4PPZA 1JLQA 3VALA 2UUBF 1RT4B 8RUCA 2XZWA 1REVA 1WSJA 2GGPA 3UB5A 4DF8A 3M32A 3NLCA 2B4OA 1DY3A 2ZHAA 1CXUA 1BC6A 4IKAA 3OYMA 3HSGA 3K9KA 3UKRA 1RWMB 3JTOA 1H0HB 2DO0A 1FJCA 1GLEG 1XHZA 3G25A 1CJUA 3I5BA 1YJTA 5KFOA 4RUBA 5AQZA 2VWJA 2E1PA 1NH7A 1HR0F 2HURA 3CYMA 3M6XA 3VZHA 4LR7A 3ZX2A 1XR6A 4GC7A 1OMSA 4UF4A 4CFBA 4WFAQ 2E2OA 2LKZA 3UD3P 4EU0A 4CJRA 1QHTA 1V3SA 4OYAA 3AY0A 2CZVC 3RTVA 2UVRA 3MM8A 4K50A 4KHWA 1FD8A 5J2NA 4Q2MA 5KFTA 4I2PA 3NOCA 1NDKA 2Y8YA 1UEUA 4Q0BA 5K5MA 3T6BA 4OJ3A 3AVLA 4IUFA 2LXUA 1YRUA 3QNWB 2CJBA 3D54A 4UUWA 3VETA 4LT6A 5M2PA 2FVCA 4DR4K 2BEFA 1IN0A 1W25A 3HXMA 4NEYA 3DCAA 1FKOA 5DQIA 1KFSA 1ATRA 2HQIA 3KUEA 3TVZA 3GG1A 1HQUB 3EEQA 3RMBA 4WFYA 1RT1B 1D8YA 2V7ZA 3THWA 1RTIA 3A3OB 3MM8B 2J4RA 3QYYA 4DR4F 4BQZA 5J2NB 3CJQA 3VAKA 1TL7B 2XY7A 1S79A 1FK9B 2IGIA 5E33A 4RG8A 3CWJA 4LSZB 1XIQA 2D0PA 3SMPA 4JS4A 3S41A 2V68A 4JEPA 2QLWA 4FF4A 5A8KB 3A2FA 4YFUA 3MCNA 1WSVA 3QDKA 4FLWA 3P1GA 5K8OA 6FDRA 3SCXA 2UXBF 5KFDA 2O4IA 3ILJA 1KTQA 3DRYA 1U1QA 4C3MA 1Y5IB 4N7TA 5GAGP 4OV6A 4BC9A 4CK3A 2HFOA 3E8OA 4ELVA 3VQ6A 3W62A 4L3KA 2D9OA 1IUJA 2F9TA 1RTJA 1N32J 2BRKA 5F2RA 2ZM6J 2I7PA 2I38A 1WG4A 3BF1A 4G9ZA 4TLQA 1TL7A 2VPZB 1Q9YA 4KHMA 1PJ7A 2W2OP 2FY1A 2RE1A 3NNCA 3ATVA 2VQEF 3EL2A 2F3JA 4ZA1A 4JK8A 3WXKA 3OFEA 5KG6A 2W9BB 2ZF5O 2WZ1A 3CMAS 3EGNA 4YDUA 3OYDA 4CD1A 2QM1A 2FLPA 3OHRA 3CCQS 3W5XA 3VN5A 4UOGA 4C97A 1BI4A 1D09B 2HWTA 2YHBA 3I6PA 4LUBA 2J0QD 2RH3A 2ZH9A 1T3NA 2AP6A 4B3TK 1HBNB 3OPKA 4PKIA 1D8ZA 4Y0FA 1UEKA 2J6SA 1OPZA 2FVQA 1WKKA 2V4JA 3HCXA 1NKEA 3HFZB 5THWA 3L4BC 4FJNA 4FWLA 3Q8PB 4DUYK 2VONA 2KXHA 4RZRA 4OLOA 1RT5A 4UW2A 3AD7C 3IRWP 1BWFO 2IA6A 1SL1A 3QLHB 2OPPA 4X4VA 1MW7A 3MM9B 2ZWPA 4XH4A 1KBRA 3Q8VA 3OA9A 2H3GX 3H4BA 3VV2B 3I96A 2HS3A 1TYQB 1T95A 5AZIB 4EHTA 3KMQA 2JLFA 4KHPK 4P2XA 2CQ1A 5KAKA 5T7LB 5EWGA 2QLXA 3CCWA 4A8KA 1VQ9N 4XEIA 3ZZUA 2GZOA 2GQ2A 3KD1E 1F9HA 4BRPA 1QTNB 2F8HA 3AVJA 2RS8A 2NLWA 5KFJA 2WRMA 3QEIA 1RT4A 3GJTB 4FK0A 3W8PA 2ZH2A 1VAZA 1JL2A 2HHVA 5KFZA 2EW9A 4AXIA 4MLEA 1S48A 1TL3B 3BPSP 4ILJA 2BBEA 3ZSOA 2QA4N 3CJKB 3FMWA 3NGZA 4QWDA 3THTA 2AGOA 1UJ4A 4DQ8A 4CE9A 3MZIA 3CC4S 4WE1B 3QBCA 4EYHB 2V8HA 4IQMA 2L41A 3NF6A 3EJMA 1XWLA 1JK9B 4BWJA 1S6UA 4CJUA 2B8PA 4X66K 3BPDA 3GDQA 3ISZA 1W0HA 5CQGA 4JI6F 4IR9A 3CERA 4Y2AA 2OD6A 5CY4A 2QWOA 1OH7A 1IR2A 1R7IA 5FLXU 3POTB 3AA3A 3S6EA 4AUKA 3OTOF 2XSJB 3OY9A 2HSTA 2V2QA 4U7BA 1UOCA 3DYAA 1HHSA 1FF2A 3HRGA 2YKPA 2QYGA 1JXVA 5DM7Q 3UQSA 1IXKA 3GONA 4WYBA 4H8KA 4KYZA 4MQ3A 2AEMA 1AZSA 3LDNA 4P52A 1GLFO 1TV6A 1FEEA 1HW8A 3ZFVA 2CNOB 3W2VA 1D1UA 1S3XA 2QLFB 2HVEA 3ZXWA 1KQSM 3RW6A 3DM2A 4LRFA 3SCJE 1G15A 4OHXA 4RL1A 2FIUA 4A48A 1Q7YO 4DFPA 1X4EA 2WSFC 2GC8A 1TAUA 1UFLA 2WBNA 3M4XA 4ECXA 4CJEA 4NCGA 1TKDA 2ZZTA 5C24A 4GO5X 3HSJA 4A8QA 3TW0A 5CD4A 1S1XB 2DH9A 1CJTB 1KDNA 2OPQA 1FRJA 3W2VB 1ZBIA 1DT9A 4QIEA 4KHNA 1S10A 2Q6CA 1LV5A 1ZM3A 5M1FA 3G9CA 4ZP6A 3R5JB 3G71S 3MN9A 4HT5A 3LL3A 1S57A 4FWKA 2QWPA 3WQPA 1N5TA 1ZA2B 1RCHA 3EICA 3G6ES 2NCKL 4U67Q 2KQ2A 2NRWA 2RNEA 4OX9F 1VSFA 2GHVC 2WHOA 2NXUA 4RBUA 2HVIA 3Q23A 3W5YA 3H5UA 5ADXA 2QW9A 3EX7B 2KHDA 1QE1A 3LZJA 2CWKA 3J7A1 4ZVTB 1SH0A 1IM6A 2LDYA 3MUTP 2A42A 1RWXB 3WC2A 2GAGC 1I94K 1Q82T 4ZVOB 2MKYA 4OZ2A 2R7WA 1BG3A 2PN6A 1BA1A 2MLYA 1Z2LA 2YI1A 5HVGA 1IBKK 3SLCA 4FWSA 4Z37A 4MFBA 2LQJA 3OL8A 1N5QA 4K41A 2NYHA 3ONQA 2ZZNA 1B70B 1JLCB 3NP5A 4Y1CA 1JXLA 3KG1A 2W4CA 1RLCL 4CLPA 2QJ3A 2GGPB 1EKEA 2ZH4A 4N41A 2RJZA 4DSIA 5CXTA 2KVQE 3P4UB 1CULA 1BDGA 2JVOA 1RWWB 1S1VB 3FZLA 2GVDA 2FZGB 4H5NA 2YKMB 1FHTA 1LAWA 5KT2A 2HHXA 4F3QA 3BSOA 4ETXA 1FRKA 2PE8A 1XR5A 3OVNA 3IM8A 3K0SA 1RBRA 1X9WA 2NLXA 1NGCA 3RWUA 4CLWA 2A2CA 3PEJA 4HCBA 2BUNA 1F2GA 3L95X 1DJ0A 3AVIA 1T9TA 3LDLA 4OVLA 2KLAA 4F0KA 4HDGA 3KHRA 1QZ6A 4XH5A 2OI2A 4KGXB 3W61A 4ZN1A 5HROA 2RQCA 1NM1A 3CI5A 4FDFA 1JXEA 3BN4A 2DY9A 3K58A 3AT1B 4CIFA 5KFGA 2OANA 4BC2A 3F0NA 1JJ2R 2W2QP 3OS2A 3ASMA 1HBMB 2ROGA 3H20A 2R4FA 5ETSA 3MGJA 4OPKA 2MQ8A 3OLBA 2IIRA 4DV0F 3C3LA 3J80O 2OA8A 4IOXA 1U2FA 4QYZK 3AA2A 3LDOA 4WTOB 3IWLA 1WHWA 5BYRA 2YNFA 1NU4A 2XG8A 5CA5A 4BY9C 1YIJN 2NXEA 3GIIA 3MPVA 2ACMA 4BR4A 3OW2M 3WEEA 4RJVA 3HOSA 3O1LA 2P9CA 1YJ9N 4CO3A 5KG3A 2HWHA 2CPDA 5L1IA 1VGYA 5IOLA 1OPIA 3KLGB 1KQSR 1Q7YT 4M41A 1CJVA 1KAZA 1KEKA 4A8MP 3KK1A 5TKYA 3RJMB 3W9HA 3H46O 1RTJB 2O8DB 2BYCA 5ETMA 3FRZA 5ETLA 4B9MA 1U1LA 1ATSA 1R0AB 1VQSA 1AB8A 5I9EB 4DL5A 3CCEN 1XR7A 2CNNB 2XZTB 3CD5A 1KVKA 1Q86T 4NXMF 4XTTA 5I3PA 4KHQA 2OSRA 1P90A 2LVWA 2XMUA 1XN9A 3I55S 1SQGA 3MHYA 4K7QA 2AGQA 1VQON 2K3KA 3JYTA 2KKHA 1S99A 3NCRA 3ZTQA 2YKAA 3EWGA 3U9ZA 3C6AA 2C1EB 3SNNA 2QG9B 1HR0J 3A5MC 3T1HK 2J8AA 1RJJA 3W7BA 1G1XA 1JLBA 5AQOA 1S4EA 3OTOJ 2P9KB 1JLCA 4JI5F 2LQ9A 4HWIA 4Q8EA 4LF1A 3V9WA 3SCIE 3SV4A 3BBBA 3L7UA 2E66A 2AF6A 1E6YB 2A41A 1S77D 2O67A 4IRCA 4BDPA 3BQ2A 3G4SN 5A6PA 3UD4P 1HI8A 3WXLA 2ALYB 1H38A 4KBOA 2RUGA 3QFWA 2ZH6A 1OSCA 2ZHBA 3QNNA 2KHCA 2Q43A 5GINA 3M8QA 1HNWJ 2RU9A 5AXMA 5KFBA 5DGAA 3A8KA 1N5YA 2KVIA 3OYGA 3O6QA 3N5BA 2KU7A 3SFUA 3A3NB 4UZCA 4DV4K 3SQ1A 3UI3A 4OX9K 3E1YA 1T05A 2JH3A 2VU5A 4O8UA 1VC5A 4A57A 4MK8A 2FTRA 4ZPDA 3RGIA 2CVIA 3DNCA 3EZWA 3T69A 5JS1A 1RDRA 1RYSA 2PYJA 1S4FA 1RU2A 1NCLA 2FJXA 4M3WA 1BIUA 1LW2A 1JLGA 3RRKA 4DS4A 4BRQA 1YITS 2E1ZA 3VGUA 3VESA 4DN9A 3GG0A 1HQEA 3N28A 1RBOB 3NAIA 2EFVA 4DI6A 4DL2A 3GJQB 3R5AA 1MWKA 3G86A 3D2WA 2IVNA 4BRHA 1RWPB 2X78A 2PMWA 1VQLN 4FJJA 1Q8KA 4ZP9A 3I8DA 1ASVA 4AYBD 4JI8J