1C0UA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 136
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0uA05
5L1KA 2RN2A 4NYNA 2WOMA 4NCGA 4FK0A 2WTFA 2ATLA 3DOLA 4O0JA 1LW0B 4AHRA 2YNHB 4IR9A 2OPRB 4NZ0A 4URGA 1FXXA 3CG7A 3I0RA 4K4XA 4DFPA 4FJIA 2KFNA 4WZQA 4MK9A 2IS3A 4HUEA 2UUWA 5I3UB 5KFKA 3K59A 1HQEB 3AA3A 2FBVA 1U49A 4TY8A 2IM0A 4C8MA 2JEJA 2G8UA 1QHTA 2C28A 3IRXB 4F3OA 2VG5A 1CXQA 3BSNA 4Z4GA 1S0MA 4HTUA 3MFHA 2W7PA 2EC0A 1S1TA 3DI6A 1FKPB 2AWZA 1S9GA 2HHWA 4CEFA 4DTSA 5KFCA 4FLXA 3KHGA 4DTPA 5J2NA 2AJQA 3QO9B 2BANA 4MIAA 2KZMA 2V9WA 2QXFA 2W9AA 3ZSWA 3QEXA 4B08A 3LAMA 2IGIA 4CHQA 1LWFB 4CIGA 3HVTA 3T19A 1S1VB 4DSEA 1JXEA 4DTXA 2O4IA 3LZIA 3PJWA 5CZ1A 2XWYA 5F8LA 4H4MB 1RT1A 1B9FA 3KMSA 2FJXA 4I2QA 4ECZA 1VSHA 4RG8A 4ZPCA 1MMLA 4NLOA 2B5JB 4KV8B 5EWEA 3HHKA 3AO5A 3UPFA 3AO2A 1UAXA 3V1RA 1CXUA 4DF8A 4EYHB 2WK4A 4HUGA 3RB4A 3VQQA 2WHOA 3LWMA 4XIUA 1C0TB 4QPXA 4F3TA 2EHGA 1JLQA 3DOKB 2R2TA 3QESA 3CVKA 4K4UA 2YNGA 2ASLA 5F8HA 1HNVB 4ZP9A 4DFKA 1IKWA 4FJLA 2HHXA 4O44A 3VQDA 4ZTJA 1RT4A 3SV3A 4ED8A 3LWLA 3H5XA 1TV6A 4RNMA 5KG5A 1TKDA 3UDLA 4EBCA 3OJUA 1JLBB 4DU4A 1SKWA 3B6OA 2WONA 4PUOA 3BQ2A 1C6VA 3TAMB 3V6DA 3WNFA 3SV4A 3FFIB 5SZTA 3DRRB 3WNHA 1C1BA 4XPEA 3VQ6A 3ICLA 1HPZB 2HMIB 2D3UA 1A5WA 3V6JA 1HMVA 1TK5A 1D5AA 5DG9A 4CHYA 2UVWA 4AHVA 4OVLA 4NLYA 4WYWA 3KLEA 2BRLA 1JLCB 3UQSA 2J6SA 3CYMA 3V9ZA 4KTWA 4I2PA 4Y2CA 5KFPA 3AVJA 5HRRA 1T05A 1D1UA 3RTVA 1TKTB 3CFRA 2F8TA 3C95A 2FC0A 2JC1A 4O4GB 1SL1A 2KQ2A 1JX4A 2JEFA 4NLXA 4B9MA 2W8KA 4OLAA 3H40A 5L1JA 3OL7A 4IH5A 1NHUA 3OS2A 1JXBA 3NF7A 3VQAA 3JYTB 4CFBA 4FJNA 4WFZA 4CJRA 4F2RA 4IG0B 3CO9A 4ZP7A 3HM9A 1C1CB 3KJVB 1Q8IA 4KHRA 1X9WA 4QWCA 3I5AA 4G1QA 3THVA 2XRIA 1L3SA 1HQUA 2Z1HA 3MEEA 4NLRA 4QWEA 4FXDA 5HBMA 2R8GA 2XGQA 1K1QA 2HNZB 2W8LA 4NLUA 4ECWA 4E1NA 4F50A 3NAHA 3IGNA 4N76A 3DLGA 3OYHA 4ZP6A 5JXSA 3NHGA 2FVCA 3CJ2A 1C0UB 1XWLA 1WSEA 3SQ4A 1X1PA 4AHUA 1XHZA 3TABA 2WCXA 1JLEA 3MF5A 5KFVA 3SPZA 5J2PB 3ITHA 2ETJA 4LH5A 3DM2A 4IFYA 1QUVA 2IAJA 2HNYB 5FDLA 4RNNA 3BJYA 3QETA 1YVUA 2C2EA 1RTDB 1U47A 3KLGB 4OL8A 3AVIA 3O3GA 3LP2A 4M42A 3DDKA 2VA2A 5CYMB 3NH1A 2BR0A 1LWCA 1RTJA 3SI6A 3DLKB 4C8LA 4RUAA 4WXOA 3I5CA 3S9HA 1BISA 3TAPA 3ZSOA 5KT7A 2FJVA 4LSNB 4KHQA 1NK4A 5KFXA 3WNGA 4Z4CA 3L8BA 4KHWA 1KVCA 2FVRA 4XO0A 3HL8A 1T7PA 1W9HA 3ZSXA 1R0AA 4BDZA 3MR5A 1XC9A 3DMJA 4CGIA 3VQCA 3NCIA 4FYDA 4EP5A 2Q3SA 3SCXA 3G6XA 2Z1GA 3L3UA 4TQSA 4GVMA 3D0PA 2BQUA 2GIRA 1RILA 2ATQA 4IDKB 4MKBA 1FKOB 5HROA 4DU1A 1B9DA 1N5YA 3AO3A 2YNIA 1LV5A 4TN2A 1Z25A 4X2BA 2IM3A 3OYEA 2VG6B 5C25A 4IBNA 4CE9A 1YVFA 4M3XA 2B6AA 4M3ZA 4DMNA 5D3GB 4NLDA 4GW6A 3NF8A 4MK8A 2VG7B 4E7LA 3UR0A 1K6YA 1S6PA 4IKFA 5KTQA 4CEOA 3MR2A 5KFEA 4ZP8A 2W9CB 1X9MA 2DPJA 1QAIA 3HYFA 1JLGB 3CDWA 4ECXA 3LP1B 1BIZA 4O5BA 3CJ5A 5L1LA 2Z1JA 3LANA 1LW2A 5HRSA 1U45A 4TYBA 3SFGA 1IKVB 1BQMB 3GIKA 2FLNA 3C6TA 3G0ZA 3LP0B 1L3TA 3L2QA 1Q9YA 1MU2A 4ID5B 5DLGA 2IC3B 3CJ3A 2PYLA 2X6SA 2WOMB 1S0OA 5JS2A 2HVHA 3JSMA 4O3SA 1I6JA 3NGYA 2R2UA 4AH9A 3AA5X 1N4LA 2FLPA 4FBTA 4RW8A 4NLVA 3I0RB 2DFHA 2AGQA 5C42B 3OHAA 1T94A 4IKAA 3E01A 4QCLA 4TY8B 2J6TA 3FQLA 4EP4A 3O4NA 4CEQA 4TXSA 1A5XA 3M8RA 3KOAA 2VG5B 2AQ4A 2JEGA 1WSFA 3OSPA 2BE2A 3K57A 1RDBA 3KK2B 1T8EA 2G8WA 4EZ9A 4FJMA 1S9EA 4Q8EA 3DLBA 4FJGA 4HYKA 3QIPA 3PO5A 4W5QA 1QSYA 4OJRA 3PZPA 5J2NB 5KFGA 1JLFB 4DQQA 2R2RA 4BE1A 3MTKA 4ED7A 3KK3B 3NGIA 2P5GA 2HW3A 3MR6A 1HARA 1SKRA 4ID1A 1RT6B 4E7HA 3KLIA 3ASMA 3MXIA 1SUQA 3PUFA 2W9BA 1TL3B 3CFOA 3OYFA 4K4ZA 4RW9A 4B9VA 5J2QB 4K50A 1RT1B 4I2QB 1TKXB 4ICLA 4NRUA 2KFZA 1DTTA 4M45A 1C2PA 2AX1A 4KO0B 4FJJA 4FLWA 1RAJA 3IGVA 5F8NA 4F4WA 4CK1A 4DLGA 1SKSA 4O3RA 3PW0A 3BQ0A 4J9LA 4DS5A 4RNOA 4J9PA 3EYZA 1WAJA 2P51A 3KKRA 1JLQB 3OL8A 3AA4A 2JEIA 4DFJA 4J9NA 5J1EA 5EUHA 2JLEA 5L9XA 1LWEA 1GX6A 2YNGB 1UA1A 3KLFA 2E6LA 1SV5A 2XCAA 4FM1A 4DEZA 4HCCA 1IKWB 1VSDA 1S1UA 3QZ8A 4ECVA 4J2AA 2RF2A 4O44B 1TKZB 2D7SA 3NGZA 1WNEA 1BI4B 1RT4B 4Z4FA 3S3NA 5K14B 3O3FA 1S1XA 1CLQA 4UQGA 3G86A 5I42B 1HNIA 4U7CA 4DSKA 2WONB 4FLTA 4CGDA 4PUOB 2UVUA 3V9UA 3PV8A 3V6DB 2W42A 3BDPA 1TL1A 4NYZA 2HWHA 2A1SA 4CFDA 3OYLA 1WSIA 3C94A 1REVA 1C1BB 4WYLA 4AHCA 3QLHA 4O0IA 1X9SA 2IBKA 2ZD1B 1XR5A 1JLAA 4BWJA 1WNSA 4F8RA 4FLUA 2XY6A 1Z4UA 2I5JA 4Q5VA 3TAEA 3TI0A 2QKBA 3FRZA 4CF0A 4Y1CA 3KLEB 3PX0A 1IM4A 4ZVGA 1SL0A 3AV9A 2AGPA 2OZSA 1T05B 1TAQA 1RBVA 2I1RA 2R8IA 4ED3A 4W5NA 3MFIA 1U09A 2C2DA 3U3YA 4CJEA 1ZBUA 2HNDA 5HLFA 4KAZA 2D5RA 1NKCA 5CZ2A 1ZETA 1B92A 4FJKA 3RAXA 3OYAA 4IG3A 4FJ9A 3NMAA 4F4YA 3M8QA 3M9NB 1S4FA 4B8CA 3RB3A 4E1MA 3DYAA 4CEZA 4Z4EA 3G6VA 3BGRB 2OPSA 2IM2A 3AVNA 3PHEA 4G1QB 4KHUA 4GC7A 3OVNA 3MECA 1HQUB 3ZT1A 1OS5A 3MEEB 4KSEB 1HJRA 1I39A 2UVVA 1IO2A 1RT7A 3MEDA 4KB7A 1NOZA 4CJWA 1VSKA 4URSA 1BQNA 5KFZA 3SUOA 4LQ9A 2YNFA 5T14A 1ZYQA 3QINA 3ISNC 1RTIA 1J9AA 3VN5A 3ITHB 3N6LA 1ZTTA 1DTQA 4IR1A 4HKQA 4BDYA 4R0EA 1KLMB 3NAIA 3V1QA 2KZZA 2BDPA 4KTZA 5FDLB 3QIDA 3M9MB 5C24A 4CJSA 3HO1A 1IKXB 1TQLA 2B43A 2HB5A 4C8OA 1LWCB 4EBDA 4CJ3A 4ZHRA 4H8KA 4EZ6A 1IH7A 2R7YA 3FQKA 3SUPA 3MEGA 4CJLA 1J5OA 3BSCA 3OL9A 1SH3A 3OYNA 4EEYA 4OPJA 4DTUA 5JS1A 4BDPA 4Y2AA 4ZVFA 1QE1A 4DG1A 1JKHA 1J54A 2G8KA 4ZPAA 1RT2B 1LAWA 3RRGA 5J2MA 3QEWA 3AVBA 4FK2A 3QGIA 3CIZA 2AX0A 3H59A 2P5OA 4NCAA 4DQPA 3NH0A 4YQWA 3FDSA 4OGEA 4M3RA 1N5YB 1D9DA 4OGCA 4CIFA 3C6UA 3U6FA 2G8IA 1T03A 3K5LA 1WSGA 5KFHA 1EETA 5DGBA 4CF9A 4KTQA 3A2FA 1NK0A 3KK1A 3KMQA 1GOAA 4KFBB 4YMEA 2GC8A 3V81A 4AILC 2FLLA 4FM0A 3KLHA 1JL1A 3EPGA 5KT4A 3HVRA 3QEVA 2OPPB 4B9SA 4FZZA 5F9NA 2YKMA 1S97A 4YP3A 1RT5B 3CM6A 3Q8PB 1FK9A 2JC0A 4NLPA 5KFUA 3C6TB 4JLHA 4KB1A 4K4TA 3NL0A 3CFPA 3H4BA 1VRTA 4I7FA 2F8EX 4O55A 4RW6A 3EZUA 3KKSA 4ED0A 3HVAA 3HPGA 4MFBA 2XHBA 2XY8A 3UIQA 4DQRA 2KW4A 4EBEA 4MIBA 1KHWA 2PZSA 3DRSA 2ASDA 1F21A 3VQ5A 2R8HA 3P83D 3VQ7A 5KFNA 2O5DA 3H2LA 4IH6A 1XHXA 4IRKA 5DK5A 4DSLA 3GIIA 1QSSA 2CKWA 4QWAA 3H5SA 1RDCA 3V9SA 3PW5A 3AVFA 2KTQA 2BE2B 3KLVA 4CK2A 1D8YA 2R8KA 1S9EB 5KFRA 4ECYA 3AO1A 4KB0A 3T3FA 2FVSA 1LW0A 5KT2A 3NDKA 4PWDB 3QNOA 3PR4A 2YNHA 4RZRA 2OPRA 3ZT4A 3VQ9A 3LDSA 3MAQA 4Z0UA 3HP9A 3SZ2A 5I3UA 1HQEA 1CSJA 5DQHA 5DG8A 1JXLA 4I9QA 1SUQB 4WE1B 2W9BB 3NBPA 4F4ZA 3PO4A 2ASJA 4RW9B 3M9OB 1VRUA 1FKPA 1KLNA 3HPOA 3HPHA 4DS4A 5KG2A 1N6QA 4DL5A 1DLOB 2XI2A 4W5TA 3T5JA 3PW2A 4FJ5A 1A5VA 2OZMA 4AHTA 1RT3B 4J2BA 4CIEA 4J9RA 3OYDA 4E7KA 4FS1A 1NK5A 4LSLA 4ED2A 1NOYA 1S1VA 2Y1IA 5KT3A 4CECA 4FM2A 3P1GA 3MR3A 3PW4A 4H4MA 1C1AA 5J1EB 2ZE2A 1L5UA 1RA6A 3OLAA 2B5JA 1SV5B 4KV8A 3M8PB 2XY5A 2F96A 4FJ8A 2RF2B 3OSNA 1U04A 3NKYA 3QGGA 4O4RA 5DG7A 3M8SA 2HHSA 4QW9A 4FZYA 3DLEB 1JL2A 1NJZA 4WFYA 4DTJA 1K1SA 4CF1A 3IG1B 4NLQA 1TK0A 4KREA 4E19A 4DL7A 5KG3A 4OPKA 3ZSQA 5KT5A 5EU7A 2HVIA 4NYFA 2E9RX 3DOKA 2E9ZA 4O3NA 4ED1A 2GUIA 4BWMA 3SNNA 2GV9A 4FK4A 4OKJA 1EKEA 4NLTA 4IQXA 4C8KA 1HNVA 3QNNA 4TY9A 2RKIA 1ITGA 1VSIA 1VSMA 1RCHA 4B8AB 4W5OA 4N56A 5FROA 1S6QB 4PQUB 3H08A 4RNFA 2DFEA 5E41A 3DRPA 4R8UA 4Y3CA 4DTMA 1VSJA 3BR9A 1JLBA 4HHTA 4ELVA 2FBTA 3RR8A 4JV0A 2YKNB 4RW4B 4FVMA 1L3UA 3KHHA 3TR8A 1NK8A 4F4KA 2ILYA 3QIOA 3WNEA 1NJXA 3KD5E 4K8ZA 5HRPA 4NCGB 1KFSA 4H54A 3DRRA 4H4OA 3DOLB 3LZJA 4DU3A 2HNDB 4NRTA 3RR7A 1XR7A 2HMIA 3AVHA 3D45A 4DF4A 4IG3B 3M8QB 4JV1A 4B9NA 3DYAB 1Q9XA 3OY9A 3PW7A 3V1OA 3GQCA 4KI4A 5KFTA 1EP4A 3LPTA 3VQSA 4YR2A 1JLCA 2YHAA 1RBTA 2WRMA 4DL4A 1S1TB 3DI6B 1S9GB 4IFVA 4W5RA 2ZKUA 5C5JA 5HP1A 3ISND 3HSTB 5EDWA 4Z4IA 2BANB 4YNQA 1WAFA 2OPQA 4TSXA 4M41A 2YNFB 4FJXA 1VSFA 3VQEA 2G8FA 3L2RA 1UWBA 3HVTB 3JYTA 4K4SA 5DQGA 5KFMA 3SFUA 4MH8A 3MXJA 3T5HA 5KFYA 4RW7A 1C1CA 3KJVA 4ECRA 3QEIA 2DFFA 4CF2A 3RMCA 2XC9A 5C24B 2D0AA 4J9SA 2NUBA 4ZHRB 2ALZA 2QKKA 5F8IA 4YFUA 4J9QA 3ULDA 3OS1A 1NKEA 1GOCA 3HK2A 2IDOA 3MEGB 3Q8RB 1CZ9A 4ZPBA 3Q8SB 4CHPA 3SQ2A 1C0UA 2D41A 3K5OA 1HYVA 3KTQA 5EWFA 5J2PA 2FVQA 1QE1B 1WSHA 3CQ8A 1JKHB 2B4JA 4MKAA 4HVJA 5J2MB 2E4LA 4DSJA 2IJFA 3T5LA 3KIOA 3KLGA 4Y34A 3RRHA 3KHRA 5CYMA 4CGGA 4FLVA 3K58A 2HHQA 3H4DA 3DLKA 5KFBA 1NK6A 3O4QA 1KHVA 3H5YA 1VK0A 1T03B 3IS9A 3SPYA 4LSNA 4JS4A 4K4WA 4QW8A 3RMDA 3NE6A 3ZT0A 3S3OA 1TV6B 3KK1B 2PYJA 3PY8A 3AA2A 5KFFA 4CHZA 4KHMA 4PY5A 3Q8QB 3GYNA 4DSFA 1TVRA 4CEAA 4Q43A 2YV0X 4EYIB 3V81B 3CM5A 2C2RA 3KLHB 4Z4HA 4KKOA 3FSIA 3T1AA 2GIQA 5DLFA 4ED6A 3GILA 1RBUA 4Q8FA 1BHLA 1KTQA 1FKOA 4LD0A 2VWJA 3QEPA 1UOCA 3K5NA 1BCMA 2D0BA 4FZXC 2AGOA 1HMVB 1BGXT 2VG6A 3OYCA 4DQIA 2XCPA 1W0HA 4MFBB 5D3GA 1QTMA 4NCBA 2VG7A 3RBDA 3SQ1A 4HCBA 4QOZB 4KPYA 1N48A 2HHTA 4E7IA 4B3OA 5F8JA 3PX6A 3T5KA 3NF9A 4I2PB 3OYMA 5HRNA 3RBEA 4ECSA 4CJFA 1S1WA 1GX5A 4IH7A 4PA1A 3LP0A 3SYZA 4OLBA 2E9TA 4CGJA 4ID5A 3EPIA 3OS0A 3TAQA 3TARA 1NK9A 4QWDA 2PY5A 4URQU 3OHBA 3PJXA 3I5BA 4KAIA 5KG1A 5HBMB 3NAEA 5C42A 3F9KA 3OLBA 2G8HA 4TYAA 5KRTA 4J9MA 4DQSA 4KRFA 3DLGB 1EX4A 4AHSA 1NNDA 3NBPB 2R8JA 3RMAA 1JLEB 2XGPA 4HUFA 1VRUB 3L2VA 3KK2A 3G6YA 3DM2B 1N6QB 4IFYB 4LQ3A 4DSIA 3ZSZA 1RNHA 2LSNA 2IAJB 1JLFA 4KBIA 1RBSA 2FBYA 4ECQA 5KG6A 3LP2B 4FLZA 1KFDA 3KK3A 1RTJB 1NHVA 3SI8A 1W25A 4LSLB 4DL6A 4BE0A 3L2UA 5F8MA 1RT6A 4M3UA 3VQ4A 4TQRA 4ELTA 1TL3A 3GV7B 5J2QA 4FJ7A 3N6MA 2ZE2B 5KGXA 1TKXA 4R5PA 4CJUA 2ILZA 1R0AB 1D9FA 3TQ1A 3DMJB 3V4IA 4KO0A 4Q0BA 4RNHA 3AVCA 4JRQA 3GV8B 4FCYA 1S10A 2DTUA 2J6UA 4XPCA 4FS2A 4M3TA 4LY7A 4ZPDA 4Q45A 3EY1A 1WSJA 4NLSA 3N6NA 4J9KA 5HROB 2YNIB 1SH2A 1ASVA 4FW2A 4B9TA 4CHOA 4MK7A 2WB4A 5C25B 2B6AB 4CEBA 4F2SA 2O4GA 3HT3A 2HAIA 4CFCA 1S6PB 2RKIB 3LALA 3CDEA 1TKZA 4CJQA 4EO8A 1BI4A 5F9LA 4EO6A 3L2WA 5CYQA 5K14A 3PVXA 1LW2B 3DRPB 3I0SA 1UA0A 4R8UB 1S0NA 3VQ8A 4JV2A 3OYKA 2E6MA 5I42A 2OYQA 4N47A 1U48A 2IA6A 4N5SA 4E7JA 3MXMA 2IJNA 4J9OA 1MU2B 1HYSA 1IKYA 5KG4A 4DL3A 5F8GA 3K2PA 1KSPA 3JSMB 3IN5A 4O3PA 4H4OB 1RTHA 2OH2A 2X78A 4J2EA 4DTRA 4QWBA 4Q44A 2ZD1A 4RW8B 4O3QA 3SQ0A 3E01B 1QS4A 1XR6A 3CWJA 3CDUA 1O1WA 2VA3A 2VWKA 1ZBHA 3L3VA 3ZT3A 1EP4B 3VA3A 1U4BA 4C8NA 1VSLA 4FLYA 4JS5A 4IFVB 2F8SA 4DTOA 3KHLA 5HP1B 2IMWP 3QIPB 2R2SA 5KFJA 5KI6A 4CJ5A 3D28A 1C0MA 3HKWA 1ASUA 1CZBA 1TGOA 2OPQB 1Z26A 1RDRA 2FVPA 5DMRA 1UWBB 2X74A 5T7BA 1ZBIA 1NJWA 3KLIB 1KRPA 3BGRA 4RW7B 2YHBA 3B6PA 4IOBA 3IRXA 3AVMA 4E0DA 4KHNA 3H98A 1I3AA 2FJWA 2CJQA 3K5MA 4ECTA 4ICLB 1DTTB 3TVKA 3AVLA 3SUNA 3TAFA 4O3OA 4ZTFA 3TANA 4F4XA 3QO9A 2FBXA 1T3NA 5DGAA 3G10A 4RUCA 5SWMA 1VSEA 2JGUA 1LWFA 1TP7A 4K8XA 1KLMA 3ZCMA 2V4RA 2DY4A 2G8VA 1IKXA 5FRMA 1LWEB 3KLFB 3QZ7A 3BSAA 4CERA 3BREA 4K4VA 1S1UB 2V4QA 3HP6A 3IS9B 4BACA 4FJHA 4ZMMA 4CF8A 1WLJA 1YT3A 3AVGA 3NH2A 1S1XB 1C0TA 1IG9A 4M3YA 4CGHA 4DTNA 1HNIB 1RT2A 3OYGA 1TVRB 5KFWA 3GIMA 4IRCA 4OKEA 3ZT2A 4KKOB 3HXMA 1KVBA 4YR0A 3SUQA 1TL1B 4DWIA 5KRSA 2D0CA 1SL2A 1REVB 2EX3A 5KFSA 4KI6A 3QLHB 3IAYA 4M95A 3EZ5A 4CK3A 1RYRA 1NKBA 1JLAB 5JUMA 1EXQA 3V6KA 3LPUA 2D3ZA 2RDIA 2UUTA 2I5JB 4WFXA 3DLHA 3V6HA 4FBUA 2BRKA 4KFBA 3CJ4A 2IOCA 1TAUA 2V0NA 3RMBA 4CJ4A 3CJ0A 2AU0A 4ECUA 5KFAA 1QQCA 1RDAA 5KFLA 1BCOA 4CJKA 1JIHA 4B3OB 2OPPA 3TAMA 2HHVA 1L3VA 1S5JA 2BGGA 1QAJA 4CCHA 1RT5A 3VA0A 3FFIA 3RB6A 3VQPA 3LP3A 4CJPA 1S1WB 3QGHA 4CJVA 2XY7A 2RPIA 3ZSVA 4CFAA 2QK9A 1HPZA 5HLFB 5KFDA 3SJJA 3GIJA 5KT6A 4KHYA 4ZVHA 2Z1IA 4RU9A 2OPSB 4ELUA 1YTUA 3BQ1A 2HWIA 1GOBA 1XI1A 3MECB 4ZVEA 3TWHA 2QV6A 3KD1E 5KG0A 4CESA 3NF6A 1RT7B 3MEDB 1TKTA 3ZSYA 5KFOA 1ASWA 4I9LA 4J2DA 5KG7A 4O4GA 4E3SA 1BQNB 5KFQA 1ZBLA 4M3WA 1RTIB 5FRNA 3ZSRA 4IG0A 1DTQB 4GC6A 3V9WA 1KCFA 4WZMA 3QYYA 3OJSA 4PWDA 3OL6A 2C22A 1J53A 3F73A 3ALYA 1RA7A 4LH4A 2HNZA 4OKKA 1HRHA 3RB0A 1SH0A 4U6PA 3U3GA 4DFMA 1J5OB 4WE1A 5CY4A 1NK7A 1BIUA 2W7OA 1RBRA 1TK8A 4DLEA 3LAKA 3PX4A 3I8DA 4MQ3A 3TAGA 4R5PB 3RAQA 4DG1B 4TLRA 3NFAA 3V4IB 1DLOA 4Q0BB 2ZQBA 4QAGA 1YTAA 2HNYA 4L8RB 1D0EA 2UVRA 3KNAA 1RTDA 4JRPA 4BE2A 1RT3A 4B9LA 3HVWA 2OA8A 3OYBA 3PR5B 2GBZA 4N41A 3QERA 2Y1JA 4KE5A 5EWGA 1S49A 3C6UB 2X6NA 4M94A 3E51A 4WXWA 4K4YA 5KFIA 3GV5B 1EETB 2BQ3A 3OYJA 1N56A 4NLWA 1RDDA 2QE5A 3O3HA 4KHSA 3AVKA 3D5MA 5KGWA 1G15A 3M8PA 2DPIA 2BQRA 4CGFA 4NLGA 2YKMB 2P1JA 5CYQB 1ZBFA 4CHNA 3I0SB 3DLEA 2XI3A 1QSLA 4IDKA 1FK9B 4CEEA 2A1RA 3IG1A 4CJTA 1ZTWA 1NJYA 1HYZA 1BL3A 3AO4A 3HJFA 4JUZA 4DL2A 1VRTB 4I7FB 4RW6B 1IKYB 1HYSB 1RYSA 3S3MA 3OYIA 1WN7A 3BSOA 1S9FA 1Y97A 4FW1A 2IM1A 4Y1DA 2RDJA 1RTHB 3DRSB 4CEDA 1KVAA 2W9CA 2XO7A 4E89A 5L1IA 3P5JA 1JLGA 1S6QA 3LP1A 4PQUA 1S48A 4GMJB 4G3IA 2ITGA 3AVAA 3VQBA 4YR3A 4B9UA 3H5UA 1IKVA 1BQMA 3DLRA 3RWUA 3V9XA 3NGDA 4IRDA 5DQIA 2YKNA 4RW4A 1LAVA 2HHUA 2IC3A
chains in the Genus database with same CATH superfamily
2RN2A 2N3LA 4NCGA 3RJMB 1HKGA 1GNKA 4FK0A 3MM7A 1CJVA 4O0JA 2PBDA 2BW7A 4IR9A 4URGA 2VQEJ 3I0RA 1CJTA 4FJIA 4WZQA 4TU9A 3BEXA 5KFKA 4C2MA 3K59A 4CLSA 2FBVA 3IDHA 2IM0A 4C8MA 4ZCKA 2MQOA 2JEJA 2G8UA 4ZPWR 1CXQA 2MQPA 3BSNA 4HTUA 2R9LA 2EWSA 3MFHA 1S1TA 4UTGA 1ACMB 2UV8A 5JJBA 5CHIA 1BO5O 3ID6A 1TYQB 3I82A 2OSQA 4DTPA 2B56A 3QO9B 2L41A 4P2FA 5AQHA 4MIAA 2KYXA 4WFAQ 1K73O 1V3SA 4FL9A 2D9PA 4IOCQ 1VQ8N 2W9AA 4B08A 5BR8J 4BGAA 3MX5A 1WOOA 4CYUA 2RSQA 3BV8A 4ZVOB 5BPNA 1UW4A 4DTXA 5GMDA 1RWXB 1JJCB 2QLWA 5CZ1A 4H4MB 1RT1A 1B9FA 1HFEL 4OIXA 5CD4H 3KMSA 3CCVS 3B54A 3N9UC 5HVGA 4RG8A 5B0EA 1MMLA 4NLOA 5F3TA 3CJ1A 1HNXF 2WVBA 4DV7F 1BUPA 3V1RA 4EYHB 2NPFA 3E9OA 1M5KC 3VQQA 5AQQA 3MMAB 1C0TB 4G6VB 4QPXA 2AJ2A 4LBPA 2B4PA 2DHSA 4F3TA 1U1NA 3WIUA 2EHGA 2L9DA 4H5RA 5KQ8A 2YNGA 3SSSA 2OTLS 5F8HA 3MM6B 1SZ2A 2VDIA 3BP8A 2HHXA 4O44A 3HX9A 4ED8A 1EQYA 2XHCA 3H5XA 3R3LA 1NLVA 3FEZA 3PNIA 3E3XA 5LJWA 4USVA 3UDLA 3OJUA 1JLBB 5F0WA 2D0PA 5AXNA 4YDUA 3AB2B 4LF9F 3K7RA 2EKYA 3B6OA 4CW7B 1WG5A 4ILMA 2ZJPL 2ZBRA 4FDFA 3WNFA 1A9NB 2CPEA 4HHUA 1DEJA 3DRRB 2OKQA 2RDDA 3VQ6A 4DHVA 3WHIA 3GB0A 4NX9A 3WXLA 3RVCA 4A48A 3MURP 1A5WA 4A8SA 1TK5A 1PIEA 5DG9A 2BJEA 2ZHBA 5BYRA 1TUYA 1Z05A 2A0FB 4QR2A 3HD2A 2CZ9A 1UVLA 3KHYA 2KFYA 4BC3A 5I4MA 2YHWA 2KHDA 4LRBA 2GTDA 1D1UA 1P8ZA 3MPYA 3CFRA 2F8TA 4CWBA 2JC1A 4WK3A 2JEFA 2AJ4A 4NLXA 5HQ8A 4B9MA 3LDLA 2W8KA 4OLAA 3H40A 1FJEB 3QFPA 3TUPA 3TSPA 4WFZA 4IG0B 5A8KB 1XNRJ 1ITPA 3QAEA 3M8YA 4ZN1A 3HM9A 1D3WA 2CWXA 1X3NA 4KHRA 3FKBA 5HMYA 3I5AA 4G1QA 2FJEB 1HQUA 4ANEA 4X4QA 1N52B 3QBXA 2J0SD 2VF3A 2G1HA 4LRCA 3FUYA 4E1NA 4F50A 3ET6B 3NAHA 3IGNA 4N76A 2PMWA 4ZJOA 5JXSA 3PDNA 4CI6A 3IFRA 2HIQA 3QFWA 3D2FA 5KFVA 4PPZA 3K89A 4ZLNA 1QUVA 4LFCF 1N5VA 2HNYB 5FDLA 1BDGA 3QETA 3MK6A 4C97A 4A8OA 3KLGB 3O3GA 4LF4J 2VA2A 1TMJA 2C2OB 2F40A 1U1OA 4RLEA 2DIVA 3W9IA 1KVKA 4KHQA 1SJ1A 5KFXA 2ZM6J 5ETNA 4LF5J 2ZBQA 4BQZA 4Z4CA 1Q81T 2FY1A 3HL8A 2O3DA 1W9HA 1RU1A 2IFXA 3AAQA 5M1QA 3MR5A 1WF1A 4L75A 4RBUA 1E3MA 3EWGA 3G6XA 2Z1GA 4YB1P 1N0VC 4TQSA 3D0PA 3A3OB 1KQGB 3PLAA 2V63A 2GIRA 2RE1A 1RILA 1LV5A 1Z25A 3DOMA 3AJDA 1YVFA 4M3XA 3A8JA 4M3ZA 1F2HA 2LXFA 5D3GB 3R5CA 1PJ6A 5HMWA 2PO4A 5BJRA 2VG7B 1RLDA 4CLTA 4IKFA 3THYA 3SBTA 4JI2J 2X1AA 4ZP8A 2W9CB 1QAIA 2V69A 8AT1B 4DV0K 3LP1B 1BIZA 1Y5NB 3CUNA 2P9LA 2GEMA 1L3TA 2AJ0A 1Q9YA 5HANA 2ZKTA 4ID5B 1UETA 2ZC3A 3CJ3A 5JMNA 1KAYA 2DGQA 3M2RB 1S0OA 1X4CA 4AH9A 2V68A 3R1HA 3UN5A 3SAGA 3C16B 1WC4A 3BZCA 3UCZP 2DFHA 2AGQA 1K9MO 4WQ4A 1WHWA 1Q8KA 3U9ZA 3O6WA 2F8MA 1UFLA 2ZHOA 4TY8B 4NEZA 4HH1A 2JDJA 4WFAL 1UJ6A 4IOCL 1ILYA 4TXSA 1RAOA 1FRLA 2VG5B 5I3PA 2JEGA 4DX6A 1T9YA 2UXCJ 3KK2B 1T8EA 4FOEA 3AQOA 1WF0A 4FJGA 2BMBA 1ZS6A 4DQQA 3ATUA 1BA0A 3MTKA 2V8HA 5BPMA 1N33K 4XTTA 3SQGA 1QVFM 4YUDA 1BU6O 1VQ7N 2C42A 1M5OC 3OYFA 4K50A 2CRLA 2BACA 1LXJA 1TKXB 4NRUA 4M45A 2CQPA 1C2PA 3R3TA 4RL1A 5CR4A 2QA4S 2OTJS 2CPYA 2EVZA 3OVAA 2VASA 3IGVA 3W1YC 3O1LA 2DR7A 2X1FA 2NPIA 4DLGA 4UOGA 3PW0A 2MKCA 2CGKA 3O9QA 2R7WA 3TZYA 1N5QA 3UE2A 1C4CA 1WAJA 4CZLA 5ETLA 2R7UA 3OL8A 1FFGB 2QMWA 3DXSX 4F3QA 4DFJA 5J1EA 2O8CB 2GNKA 1LWEA 3QWUA 2A18A 1SV5A 1V6HA 3Q7CA 2JH3A 3G6ES 1NMDA 1M0SA 1S1UA 2GMJA 3QZ8A 4J2AA 5AQSA 2RF2A 4DUYF 4OYIA 1BI4B 5JVGQ 1OSCA 3Q24A 1XMOK 2IY5B 4X4RA 1FESA 5K14B 2RRAA 4UQGA 5I42B 2DD8S 2KVIA 2J0XA 2QM1A 1T95A 4G1PA 4PUOB 3V9UA 4C0OC 2UXDJ 3BDPA 3F9MA 2CPJA 2W42A 1TL1A 2HWHA 4DV1F 2A1SA 3WXKA 1ZAWA 2W40A 4WU2A 4FVUA 2QIFA 4WYLA 3CJKB 3LGNA 2ZD1B 1I51B 2PE8A 4FLUA 1WTBA 5U47A 2P9UA 2YCHA 3LDNA 2QA4G 4PZVA 3DDNA 4ZVGA 3HKZD 2DY9A 1SL0A 4QIEA 4ZA1A 2Y1RI 3CMES 3MUVP 3M32A 1RBVA 2I1RA 2PSZA 2YJFA 2CJAA 3MFIA 3U3YA 2LQ9A 4Y2IA 2HNDA 3RRKA 4FJ9A 2HS4A 4B8CA 4UF4A 4CEZA 2CQHA 4ZVPB 1H72C 2HLUA 3L3CA 3AVNA 3RSEA 3ZZPA 3PHEA 4TKTA 1SQKA 3MEEB 4KSEB 1HJRA 1I39A 1IO2A 1CJKB 1SC6A 3MEDA 1NOZA 2PGCA 1ZOTA 4YHHK 1NBEB 1XBWA 1CZAN 1BQNA 3ZX2A 3SUOA 2Y1LB 1EKSA 3QINA 4DV0F 4OI1A 3ITHB 4JKGB 3UCUP 2YWHA 1U25A 3OXFA 3V1QA 3G82A 4M5MA 1TQLA 4C8OA 2IHR1 3D1QA 2JVRA 2XQCA 2R7YA 1EARA 1FI4A 2PEBA 1X4EA 2YKQA 3SUPA 2ZF5O 1UVMA 3BSCA 3OL9A 1SH3A 1KWMA 3CD7A 4BDPA 1RWWB 1HBUA 1E6VA 2VFUA 4Y2AA 1NGCA 4DV6F 4ZVRB 5JICA 1QE1A 4ZVUB 4DG1A 3CMAS 4B1ZA 3VZHA 5J2MA 4IWVA 2COLA 1Q82O 4K0KJ 2V9KA 3AOCA 1YJ7A 2MQNA 2VB6A 3HLUA 2WAQD 4YQWA 4P71A 3AODA 3MM8B 1N5YB 1OY8A 3DRXA 4OGCA 3U6FA 3THWA 1T03A 1WSGA 1ZAVA 3CCTA 5KFHA 1EETA 1W7AA 5DGBA 4KTQA 1B0VA 3A2FA 4JV5K 2IPOB 1CQNA 1O8BA 1N33F 3MI7X 2BOPA 4AILC 3KLHA 4C11A 2RVJA 4GVBA 4V19X 5IQQA 5F9NA 2YKMA 2PFDA 4ID8A 5DZ7A 5IM0A 3A5LC 3CM6A 2HEKA 3C6TB 2A5XA 4JLHA 3JS9A 3NL0A 1N34J 3H4BA 2M8HA 5AQUA 3H42A 2C3OA 2M9KA 3HVAA 5HJYA 3HPGA 3T7ZA 2XHBA 2XY8A 1FRKA 1GMWA 1NO8A 2NSCA 2ZH6A 1QVGM 4EBEA 1FJGJ 2XSJB 2ASDA 2CGJA 3VQ7A 4FNIA 1FD2A 5CZVA 1VYAA 2EFPA 5E3PA 4E2FB 1AZSA 4IH6A 4DN0A 3WUHA 3FGVA 4CO2A 5KPRA 1NRKA 4QWAA 2CJ9A 3AB4B 3V9SA 2J8SA 5LMNF 3BPSP 1VQMN 1XMOF 3D9BA 1VI7A 4CK2A 2DRBA 1S9EB 4KB0A 5D4NA 4DV2K 2HIYA 3HJVA 4XEIA 4LF6K 2IYGA 2FVSA 3IM8A 4USKA 2H9ZA 2I0XA 5KT2A 2G0IA 3QNOA 3N4WA 4RZRA 2CPXA 2D3OR 3LDSA 2R4FA 1DQ9A 2CQCA 1HQEA 3MWBA 5DQHA 4WE1B 3CCLS 4EIAA 4DR4K 3GG1A 3ILIA 1HI1A 1VRUA 1KLNA 3HPOA 4LF8J 1QHAA 1F5AA 2HK2A 3THPA 4N8OA 4Y2MA 4X4VA 3MMBA 4P7TA 1KTVA 4CIEA 1YJUA 2DNYA 3OYDA 4J8FA 4CZCA 1R0CB 1R31A 1NOYA 1VQ4S 1S1VA 3VERA 5JVGL 1REGX 3P1GA 2BOAA 1XMQK 3OHRA 3ZNJ1 3TU5A 2DR6A 1NXIA 2B5JA 2MY8A 3AT1B 1J6ZA 2IVMA 2ROEA 4JI3K 3CCJN 4FJ8A 3OSNA 2V6AA 3NKYA 2HHSA 1NJIO 5GAEP 4PG5A 1JL2A 2MMYA 4LFAJ 1K1SA 2JL9A 2B51A 2CPFA 3ZTSA 5KG3A 4YB5A 4YHHF 1XNRK 2HZCA 1W2BR 4BWMA 4CBUA 3SNNA 2Q43A 4OKJA 4JI8K 1FE4A 3GDQA 2CDQA 2VQFK 1W26A 2OO4A 4JI6K 4N56A 1S6QB 4PQUB 2Y3YA 2O8BB 1GK8A 4Y3CA 3VAIA 1FDNA 5AE2A 3JXUA 3Q22A 3RR8A 5CABA 4QU7A 4JV0A 4FVMA 1YF5L 4CZHA 2HQ3A 3KHHA 4XAKA 5C2CA 4BVOA 3TR8A 4F4KA 3QIOA 3I31A 3D2EB 4F67A 4CM2A 2HHHK 4KIAA 3KKFA 2A6OA 3PG9A 2HMIA 2VPXB 4CZKA 1RU2A 1HW9A 2P9PB 3CD0A 4EWTA 4JV1A 3DYAB 1Q9XA 2MSSA 3PW7A 1VJQA 2G0JA 4QIGA 3BF3A 5AJ3J 1LOTB 4CBXA 2NUHA 4ZPTR 2ZVIA 1SBRA 4PXBA 4UW2A 1JLCA 2ZJRQ 3D7SB 2PI5A 1RBTA 4DL4A 3DI6B 1GLJO 3K9JA 4B3RK 5C5JA 4JV5F 3TVYA 4IO1A 5DM6Q 3Q89A 5AQXA 2J76E 2L9WA 2CGLA 2MLZA 1VSFA 3VQEA 3VGVA 3L2RA 2BW2A 2RQMA 3G71N 2ATCB 3SFUA 3CC7N 1RHKB 2P9KB 3ENVA 4NI2A 2XC9A 2D0AA 2NUBA 3VESA 3ENWA 4X66J 3L4BC 3DCAA 1HHQA 1NKEA 3HK2A 1GOCA 1PC5A 4CLWA 3MEGB 3KNGA 3NP5A 3Q8RB 2HSTA 1CZ9A 1TZ0A 1YAGA 4EGLA 1ATSA 3SQ2A 3P5BP 4AL7A 2D41A 3K5OA 3WX4A 3HRGA 2RUSA 5EWFA 2HS3A 5J2PA 1I1GA 1WSHA 2D69A 5GADU 5LY3A 3MZIA 2B7BB 1ULRA 3NLCA 4WP8A 3OTEA 2B3TB 3CMQA 4Y34A 3KHRA 4AT1B 3QBCA 1IBMJ 2GJFA 2YY3A 4FLVA 3H4DA 3K2YA 3O80A 3CIPA 4GKJF 5B0AA 1VK0A 4DV2F 1HA1A 4LSNA 4JS4A 3UDEA 3K0JA 1HJOA 2BV3A 1I5OB 3ZT0A 3S3OA 3KK1B 3ULEB 1HNWK 4BRGA 1VK3A 2MEWA 2CQDA 1TVRA 3H0PA 2YV0X 3V81B 1FRJA 1S12A 2PD1A 3GE9A 3WIVA 2N3OA 3WXJA 2G1DA 1WB9A 3ZETB 4OZ0A 3T1AA 1HWJA 5DLFA 1RBUA 1LK7A 2JLFA 1HBMA 1FKOA 2IIRA 1FEHA 2IVOA 3DGPB 1WSRA 2JX2A 4IJNA 4QYZK 1JQGA 2UUBK 4FZXC 2AGOA 2VG6A 2XCPA 5LSRA 2PEHA 5M1NA 1QTMA 4C4WA 2XS5A 2BKOA 5C2GA 2HHTA 3QGPA 3NF9A 4I2PB 4C48A 2XSFA 3MOJB 1S1WA 4IH7A 4PKHA 4BR4A 4C3MA 3LP0A 2O8DA 4B1XB 4FN5A 3O5BA 3MCSA 1R6VA 4JI3F 3OS0A 2LU1A 4H5WA 3TZWA 5H1SV 3OR2A 4PL8A 2V8DA 2QEXN 3HOSA 3PJXA 3I5BA 4KAIA 5KG1A 3FCWA 2F4VK 2K06A 3R9LA 3CTRA 3FCHA 5C42A 2F9TA 3AY9A 3OLBA 2G8HA 1Y4ZB 3QAUA 4TYAA 2K8GA 4J9MA 2H3GX 3DLGB 2CQ1A 1NSKL 1EX4A 5IT4A 4MYUA 4JI8F 2LQJA 3IR5B 4WQ5C 1NLKL 3NS6A 5CZXA 2VQFF 4JI6F 1YZ6A 4JD2B 1Q16B 1HR0K 2XGPA 4FF3A 1ZM3A 3R6LB 5D78A 4OHVA 1N6QB 4JYAF 2CQ2A 4IFYB 4DSIA 1MN7A 4ZKAA 5EX5A 4CVNE 4F25A 5T7LB 1JLFA 4OZLA 4ECQA 4WIQA 3MR7A 2BYCA 3GFYA 3HULA 4DJBA 1UPPA 1NHVA 3SI8A 4LSLB 3BF4A 3GTYX 1N36J 2XS7A 4GKKF 4ELTA 4A8MP 2QFJA 1WG1A 3GV7B 2QWNA 4ITSA 3IWLA 3N5FA 5KGXA 4DMZA 2P9CA 4R5PA 1FRHA 2ILZA 1W2IA 1GLEG 1RHRB 3V4IA 4RNHA 2MY7A 1S10A 2DTUA 2DGUA 4OLOA 5HATA 1BMQB 4FS2A 1SS6A 3CC2S 2CYYA 3N6NA 4B3RF 2W01A 2VPYB 2YNIB 1ASVA 2A2CA 3QT7A 3VEOA 2IDLA 4CHOA 3C14A 2ZH5A 2KO1A 1YJ9S 2WB4A 1SIZA 2KJVA 3FZBA 4U8YA 4M5DB 2BUNA 3J7ZT 1J5EJ 2HAIA 2W4DA 3NG8A 5ETPA 2HBLA 4OYZA 1OO0B 2B9XA 4LFBJ 2RKIB 3CDEA 1XK8A 2FHKA 4CJQA 3D68A 3QSIA 3P31A 1UA0A 4R8UB 1S0NA 3TTCA 3W66A 5GADI 3HI0A 5THWA 4DV4K 2OYQA 2HK3A 3W2WA 3F0NA 3R5DA 2IJNA 1IKYA 2XLIA 5KG4A 5F8GA 1NG9A 4I0WA 2ZWHA 3IN5A 3FEYB 2RUGA 4O3PA 1VBKA 4H4OB 2ZJRL 3NEKA 2ZC4A 4J7CA 4ISGA 4QWBA 3A8EA 1E6YA 3ZZOA 1TL7B 5DM6L 3T9ZA 4O3QA 5LXYA 5DDPC 2DCLA 3L7PA 3DDIA 3CDUA 2VA3A 2KKZA 2CWKA 3ZT3A 2BKNA 2FC8A 1VRQC 1KXPA 2UUCJ 4C8NA 2CA9A 1C4AA 3CPEA 4JS5A 3R7BB 2IMWP 2MDAA 2CQ0A 4OJ3A 5KFJA 4NXNK 4HLBA 1C0MA 1WJ9A 4KHPK 1RXOB 3HKWA 5BPLA 2OTLN 1RDRA 3LA0A 2LLZA 5DMRA 2FZGB 5T7BA 4M5LA 5HN0A 1U2VA 1V5IB 3CCRS 3IWNC 3EE8A 3BGRA 4KGVB 3TWZA 1S3XA 5IWAK 4FWNA 3AVMA 4E0DA 3TYTA 1WC0A 1I3AA 3T1YJ 4Z7YA 2OEMA 2XYHB 3KUHA 2FJWA 3LQVA 3K5MA 4ECTA 4ER8A 3C6HA 1TYQA 3SUNA 1K47A 4ZTFA 1NGHA 3QO9A 4JHDA 2IVPA 4CTAA 3TA2A 2ZBPA 3BKTA 1MLAA 3PFEA 4K2JA 5ETOA 3OTCA 5HMXA 5GAHU 4DR7K 1TP7A 4JKCA 3ZCMA 4LMZA 1X4FA 2DY4A 4FWRA 2G8VA 4Y28C 5K8OA 1Q5YA 3BSAA 3BREA 4J9UE 2R42A 2ITMA 4U7BA 4CT9A 3IS9B 4BACA 4NMXA 2KVQE 4C98A 3O9TA 3JTNA 4ZMMA 2M2BA 3GJRB 3EE9A 1JJ2M 2I6WA 1O6XA 1C0TA 5BXIA 1HNIB 3NXZA 2ZUGA 5B8HA 5HI7A 4KKOB 2PMHA 2NZTA 2FDNA 2W6KA 3VF0B 3MD3A 5IC4B 2HGNA 5IC6B 5EX3A 3JSRA 4OHWA 5ITHA 3MM6A 1S5ZA 1RBAA 3DLJA 4X4NA 3EZ5A 4CK3A 2YHXA 1KQSM 4KGZB 4DR6J 2MXYA 1JLAB 1PJ7A 1QQNA 1FXDA 2D3ZA 2RDIA 5K8NA 2UUTA 2I5JB 3DLHA 2GMHA 3V6HA 1IQTA 4FSVA 3NGKA 2GAHC 4OV6A 4KFBA 2Q6BA 3EKSA 2XMMA 1U0SA 3ENQA 1YJNS 5KFAA 1QQCA 1RDAA 5AQOA 1T11A 3BS9A 4WK1A 3UD3P 4CCHA 2PFFB 3OFHA 1CS4B 2RPIA 1K8KB 1O13A 5KFDA 3SJJA 3GIJA 3VEWA 4KHYA 5C7PA 5GMKa 4CZIA 4NWBA 1F60B 2AEMA 4ELUA 1YTUA 1P9YA 4I69A 1VQ5S 4CP5A 2VFSA 2W1BA 1NGDA 2QV6A 5KG0A 2VGNA 3MCOA 5FJ4A 2ZITA 3SBMA 3R5BA 1Q0NA 1PBUA 2MZ1A 5KFQA 1SJ3P 2CQBA 4M3WA 2GVZA 3Q2TC 1RTIB 4IG0A 2M88A 5A8KA 3RBZA 3W9HA 1KCFA 4MTPA 5ETKA 2A42A 2HQDA 3V2UC 1YRXA 3Q0AA 3DU6A 2MJUA 2MGZA 3UN3A 3FFKB 1PILA 2F9DA 3G87A 3RG6A 1J5OB 4FXVA 2FIUA 1HNZF 4PQAA 2PN6A 4DLEA 2LA6A 1RABB 3DFEA 2L48A 2QI2A 2HNYA 1YX2A 1YHQS 2MKKA 3KNAA 3GJSB 1L3KA 3I32A 3IBFB 3AGKA 3PR5B 3BH6B 2UUAK 3QERA 2OANA 5ADXH 1KC8T 3W0LA 4QS8A 5EWGA 1S49A 4WXWA 3HF5A 4DUTA 4KHPF 3NGSA 3Q7BA 1RDDA 3AVKA 2B8QA 2WW4A 2DGSA 1H2TZ 4GVEA 3GG0A 1FCAA 2CJKA 1G15A 4QU6A 3B8AX 2BQRA 5IWAF 4NLGA 2P1JA 3NCQA 3I4HX 3O5TB 1ZBFA 2FGCA 4FWLA 3I0SB 1P27B 2W4PA 2NQPA 3BO3A 5GAHI 4AQYJ 2B7CB 4CJTA 1ZTWA 1NJYA 2E5GA 3L9ZA 1Q81O 4JUZA 3LUYA 4DL2A 4I7FB 3OFFA 1HYSB 2CQIA 1WN7A 5AFUA 1RDWX 4NLCA 3JXOA 2J9EA 4OI6A 3L4IA 2OELA 3TOQA 1NH7A 2RDJA 3SCIE 1RTHB 3IAM9 4CEDA 2OFHX 4X65J 1KVAA 1ELOA 2W9CA 5DS7A 4E89A 3D0IE 3VHQA 4Z37A 3LP1A 4P52A 2QA4N 4B9UA 1VHXA 4Q2MA 1E4FT 2HVEA 2AYGA 1G99A 4BRFA 4NYNA 4RWWA 1U1QA 4DCPB 4FWOA 3DOLA 1LW0B 1YI2N 2ZNYA 1YJWS 4AHRA 1TR0A 2OPRB 2KHCA 3THXB 1RWKB 1FXXA 2KFNA 2E1MC 2BJ3A 2IS3A 2MZTA 2UUWA 3G6EN 2VDHA 2FC9A 4TY8A 4OFZA 2N4DA 3QQCD 2J9DA 2VG5A 2HG4A 1Y5IB 2UXBJ 3CSKA 3MPDA 2EC0A 5CH7B 2AWZA 2XLKA 2HHWA 4CEFA 5K9FA 4C3LA 5KFCA 4FLXA 5TKYA 4A5BA 2OD6A 4NEYA 3FZMA 4DR2K 1Q18A 2QL7B 2KZMA 2O8EB 3QRRA 2V9WA 3W8PA 1M5VC 3ZSWA 2A6AA 3LAMA 4CHQA 3PEJA 1RWUA 2WBNA 3VZIA 4L73A 3R2DJ 3D6HB 3TO8A 4CZMA 3MM9B 2D3O1 4DSEA 3AJ1A 2JZ5A 2O4IA 3LZIA 1GXLA 3NNHA 2XWYA 3DN9A 3ZYYX 2FJXA 4BHQA 4ECZA 3MTJA 2VBYA 4ZPCA 3OTOJ 3IR7B 3TRGA 4KV8B 4BS2A 1VQPS 1VQON 2Q1NA 5LOQA 4LF7J 2RQ4A 3FEXB 5D4OA 3AO2A 1EJ7L 4H4KC 3CMEN 1I94F 1VFJA 1VHIA 2HQCA 1QQOA 2MKYA 5A8WB 4QIVA 1UZHA 4NLBA 3DOKB 1IBCB 4EI2A 3ILLA 1NCLA 3VVTA 4K4UA 1NGEA 3M3ZA 5BYQA 2V34A 4FJLA 3VQDA 1S76D 3AOBA 4QJVA 3E1YA 4RNMA 1XEZA 4F0HA 1S77D 2DGWA 3MXHP 5FLXY 2QLXA 2VCPA 4OZ5A 4PUOA 3M5RA 2JSXA 1SJFA 3VVUA 2UU9K 5SZTA 3EGZA 5CAAA 3DXBA 4XPEA 1K9MT 2ASPA 4NPOA 3ICLA 1X7VA 4CDIA 5F0XA 4RO0A 4OYMA 1GTEA 2DNQA 4NLYA 1AROP 4CLLA 3AA9A 2J6SA 3CYMA 4X84A 3V9ZA 4KTWA 2YKAA 5A8RA 5KFPA 5HRRA 3HSGA 3EMTA 1PGZA 1IBKK 2FC0A 4YDXA 4F7VA 1SL1A 2KQ2A 2AJFE 1OMSA 3IBCB 3OL7A 4DZDA 4PKGA 3VQAA 3JYTB 4WP9A 4L74A 3D7EO 4ZP7A 3KJVB 4QWCA 1L3SA 4BR0A 3MEEA 2VJUA 4QWEA 4FXDA 5HBMA 2HNZB 2W8LA 4NLUA 3O2IA 2WVDA 1DY3A 2FVCA 2FYXA 2DNKA 3IC1A 3CJ2A 4H03B 4ETXA 3KWIA 1X1PA 4CO3A 4DV3F 4PG8A 5ELZA 1Q53A 3ITHA 4JKGA 1FT8A 1P8GA 3DM2A 4DR1K 2HFNA 2J5AA 1UVIA 3J7A1 2IAJA 4LREA 3R7SB 3BJYA 1RTDB 3GSDA 4X4TA 3J7AP 4M42A 3AVIA 3LP2A 5CYMB 5IT9Y 1RTJA 4FP9A 3DLKB 2WUSA 4RUAA 4WXOA 3K8VA 2FJVA 4DCHA 3QT8A 3R1XA 3AHPA 4XO0A 1H38A 3I33A 1T7PA 1X5TA 3ZZYA 3ZSXA 1R0AA 2NRTA 2HQIA 4BRAA 3ETMA 5FLXO 3VQCA 3H2VE 4HR2A 1RP5A 1GFWB 2GHWA 1IJEB 3L3UA 4YOUA 1RWPB 3AARA 1IN0A 4DU1A 1B9DA 2A3ZA 1N5YA 4TN2A 3T41A 4B1WB 2IM3A 2SXLA 4DR2F 3OYEA 5C25A 4CE9A 4JEPA 2B6AA 3TR5A 3OR1A 4GW6A 3NGUA 4MK8A 3HHLD 3CCLN 3UR0A 4KYZA 3OUYB 5KTQA 4OI0A 2C2MB 4WF9Q 5KFEA 2UP1A 4G9ZA 3N01A 1VQ7S 4LF9J 5C2DA 3HYFA 3CJ5A 5L1LA 1LW2A 1GMUA 1U45A 5HRSA 2KU7A 3HFKA 2FLNA 3C6TA 3J7YP 2QLFB 5D8HB 3VEVA 4RCHA 3UR3C 1MU2A 2HRTA 3POTB 2IC3B 3GCWP 1VQ6N 2CDRB 5JS2A 3A13A 3JSMA 1I6JA 1WEXA 2R2UA 4I6WA 2QG9B 3WC0A 4USHA 2GCFA 4RW8A 4DV5K 3DU5A 3C66A 3OHAA 1DQ8A 3CCUS 3MOZA 2J6TA 2E1PA 5D4PA 4GO5X 4M7YA 3D66A 4UUXA 3NCRA 3KOAA 1WHXA 2EWHA 3OSPA 3K57A 3OFGA 1Y3KA 4W98A 4ZS6A 2G8WA 4EZ9A 1S9EA 4Q8EA 3QIPA 1WOPA 2ZHAA 4OJRA 3PZPA 5KFGA 2E1CA 5IXUA 1HBOB 4BE1A 3KK3B 2VD3A 3NGIA 2HW3A 3MR6A 4OX9K 1HARA 2GMLA 5LM7E 1NB7A 5IT9O 3QSYB 4ID1A 1RT6B 1CJUA 2UU9F 3KLIA 3PUFA 1VIOA 2BZ2A 2VC1A 4PG7A 1Z2ZA 3DXMB 3AAPA 2NNWA 1Q86O 1Q82T 2HF4A 5D0RA 4ICLA 2KFZA 2BA9A 5J1PA 2HLTA 4FJJA 4KO0B 5L46A 1RHMB 2WW8A 2YKPA 2B4OA 4F4WA 4LFCJ 5A6WA 4CK1A 4O3RA 1R8HA 4J9LA 4DS5A 1AUSL 3ENOA 4FYWB 2K1RA 4J9PA 1HWLA 3M1VB 4BREA 1FVSA 3KKRA 1JLQB 4RBVA 2RHQB 3BB5A 3GFXA 1X60A 4J9NA 5L9XA 4LIRA 2JLEA 1GX6A 2BBEA 4F0KA 3KLFA 1YITS 5IOLA 2XCAA 1QAXA 2OHDA 4FWKA 1TKZB 3FRYA 4FWQA 4Z4FA 3J80Y 3O3FA 2FJDB 4OV1A 2HFOA 1S1XA 2XMJA 4HHHA 4OHZA 3WC2A 5K8PA 2WONB 4BRKA 1N88A 3CCMN 3PV8A 4CGDA 2HKEA 1ZC6A 4ILHA 1WC1A 4NYZA 3I9V9 3LDQA 1X8DA 1WSIA 3C94A 1C1BB 1T3OA 1VIXA 4EU0A 4DR1F 1X9SA 1BD6A 4O0IA 3RU0A 2DHGA 4FOIA 2IBKA 2G13A 1G2EA 2EC2A 1FJ7A 1XR5A 1YBUA 1RWMB 2EFNA 2KDOA 3GWCA 3MAAB 2O8BA 1VBYA 2XY6A 1Z4UA 2YHYA 3G8QA 4Q5VA 3TAEA 4QPTA 4UOHA 4CF0A 3KLEB 3PX0A 1RSCA 4OJHA 1T02A 2AGPA 3G8SA 4OPHA 1T05B 1TAQA 4NXMK 1V4SA 1U09A 2C2DA 2RRNA 2W25A 4KAZA 2UZAA 2VODA 1QZ6A 1B92A 1YXQA 5J1NA 3Q86A 3U1MA 2ZH4A 4QOTA 3RAXA 4F4YA 1PAUB 4FJKA 1S4FA 3DYAA 1Q7YO 1Q79A 1Z1ZA 3THTA 2HZVA 4QR1A 3WQTA 4KHUA 3OVNA 1CC8A 3ZT1A 4I6YA 5IV3A 3FGUA 1PKUA 2E7WA 4KB7A 2VH7A 4CJWA 1P90A 1VSKA 4URSA 1UVJA 1ZYQA 3H46O 4YB7A 3ISNC 5MLCV 3DNCA 4X64K 3VN5A 1ZTTA 4KGMA 4IR1A 2P9KA 2FF3B 2RE2A 5LMUK 1RHQB 4R0EA 3P4IA 1KLMB 3NAIA 2KZZA 4LF4F 4KTZA 3WEEA 3M9MB 2WBMA 1RWVB 2P9NA 1IKXB 3UKRA 2B43A 2JWNA 1LWCB 5MAOA 3BBBA 2GJIA 4OX8A 2GO9A 1NJIT 1HQ2A 3FQKA 3MEGA 1MROA 3AGRA 4QIWD 4QS7A 3OYNA 4EEYA 3UE5A 4OPJA 1OH7A 3J80O 4DV5F 5KPZA 1MN9A 4WWSA 2LXUA 4F0MA 4OZJA 1FRMA 1YG0A 3S6EA 1RT2B 1MMNA 3QEWA 5BRHA 3AVBA 4FK2A 3QGIA 3CIZA 4IJAA 4NCAA 3SMSA 3D6MB 5AQVA 4WF9L 3CXCR 2ZJQQ 3ZTPA 2G8IA 5HMZA 5CXTA 2P9IA 4CF9A 3O8WA 1NK0A 3KK1A 3ULEA 4JI2F 1DJ0A 2XYGB 3KMQA 1GOAA 3K5PA 5A2QY 2R7XA 3V81A 4FM0A 3HI9A 5ETTA 2OPPB 2M70A 3S7RA 4DR5K 4FZZA 5CQGA 1S97A 1X3MA 4K5SA 3TTFA 2GFFA 4NLPA 4K4TA 1A0OB 4BR7A 2HBYB 2CJYB 4O55A 3EZUA 4OX6A 4ED0A 5DM7Q 1FEEA 3UWTA 3UIQA 1OSDA 4OYOA 2QGFB 1KHWA 2NYHA 3H45C 2PZSA 3UW1A 1IQZA 3M2UB 3VAKA 3VQ5A 5F3ZA 3HSCA 5KFNA 3H2LA 2BX6A 1XHXA 2EW9A 3WT0A 2AYEA 1UFWA 4IRKA 2UXCF 1RISA 3VGSA 1QSSA 5AQNA 3PW5A 2AIRB 3EE3A 2R8KA 4LC9B 1TFWA 2C3UA 5JMVA 4YDUC 3T3FA 2ERRA 4PWDB 2YNHA 3JSBA 3VQ9A 2XMAA 3SZ2A 3EZWA 2JHEA 5I3UA 3NS5A 1CSJA 5DG8A 2DXFA 3ZZZA 4B1UB 4B3SF 2W9BB 4F4ZA 3I56S 3BR8A 4P7VA 2BABA 4RW9B 5AXMA 3PFOA 3M9OB 1FKPA 4O8UA 1HHSA 1N6QA 5KG2A 4DL5A 1KNZA 3VPZA 3ADAC 1DLOB 1U0HA 4DV0J 5AZIA 3T5JA 4FJ5A 3C65A 1A5VA 3HOTA 1RT3B 4J2BA 2O8FB 2E5LK 5CCMA 4ZJLA 3UNYA 4M5IA 1IXKA 4E7KA 3VEXA 4LSLA 2FUG9 4YOEA 2Y1IA 1KS2A 1RB0A 1YVNA 4MDAA 3MR3A 1DAXA 1R43A 5CCLA 4DV6J 5A2QO 1FO1A 1U04A 1MWKA 4O4RA 3BO4A 1WSVA 4FZYA 4H0XB 1NM1A 1NJZA 2BM0A 1ROFA 3IG1B 4NLQA 3ZLJA 2YXLA 1WI6A 4OPKA 2E2NA 4J9VA 2ZZNA 2E2OA 2E9RX 3A8IA 2E9ZA 1RWOB 3IA0A 4O3NA 2OMLA 3MUTP 4X64F 1ZAXA 3HHEA 3LGMA 1HNVA 4TY9A 2UV8G 2RKIA 3R6MA 3BUZB 1N33J 4JI7K 1VSIA 2QYGA 4B8AB 5FROA 2H5JB 2DFEA 1GAOA 4R8UA 2AP1A 1QM9A 3BR9A 2FBTA 2KL8A 3EDQB 4RW4B 2CH6A 3J7ZO 1NK8A 2Q0UA 1NJXA 3WNEA 2H48B 2QLBB 4NCGB 2Z2YB 4BC9A 3FK4A 1T9XA 2KG1A 3LO3A 2AEFA 4H4OA 3LZJA 4ZCLA 1RJJA 4DU3A 1NDLA 4NRTA 3AVHA 5E0OA 4IG3B 2LQ8A 3TP2A 2RD5C 1YBAA 3OY9A 1F6TA 1VQ9N 1HNXK 1FHTA 1S79A 4DV7K 2JOQA 4KI4A 1YZ7A 2HBMA 3VQSA 3G4SS 2YHAA 5EN1A 1S1TB 3PCOB 1EB0A 4NYPA 2AKWB 3ISND 2QWPA 3CCQN 1XMOJ 4KPCA 4PKDB 3CDAA 1MWYA 1G7CB 4YNQA 2GGPB 4NO7A 3TUZC 4M41A 4LR8A 2G8FA 1NGFA 3UDVA 4C9DA 3A1YG 4K4SA 4CYUB 1XIQA 3T5HA 5KFYA 1C1CA 2K7JA 2HFSA 3VWSA 2GS8A 1NM2A 3RMCA 5C24B 2W2QP 3NMUA 2DVIA 3FC9A 4K25A 4CZEA 2QKKA 5F8IA 4LF9K 3ULDA 2OEJA 3OS1A 2IDOA 2MLYA 4PG4A 5LJ5Y 4CHPA 1C0UA 3R9PA 1SQGA 4WQ4C 2ZJQL 2FVQA 1U2RA 3SEOA 1FDAA 2IJFA 2EFQA 3KIOA 3OXLA 1NU0A 2GHPA 3CCWA 4XH4A 3RRHA 2CG4A 3K58A 1NK6A 2GIFA 3O4QA 4PYAA 1KHVA 3H5YA 2DR9A 3C0BA 3HZ6A 3IS9A 3L95X 2QEXS 1Q5VA 2KM8C 5IQ6A 4JK9A 5DDRC 2PYJA 2XULA 4K43A 4PY5A 4F9OA 3Q8QB 4DSFA 4CEAA 4EYIB 4Z4HA 4ERDA 4KKOA 1ZH5A 2GIQA 5DM7L 2RJZA 4ED6A 4LSZB 1WEYA 4YHHJ 4U8VA 1HIYA 1NSPA 4P2XA 1BHLA 2CJBA 5ADZA 3ILOA 2VWJA 5AZJA 2F3JA 3ENAA 2D0BA 1LWXA 2FLOA 1BGXT 4DQIA 2E5LF 3LGHA 4MFBB 1Q8BA 4NCBA 2VBXA 2XMWA 3S1TA 3ZNUA 3RBDA 2ZGZA 3H8YA 1HUXA 4M5KA 4A46A 5AQKA 4KPYA 4ETZA 4E7IA 5F8JA 3PX6A 1HWKA 2VU5A 2ACYA 3T5KA 1AYEA 2NSBA 2O1PA 3RBEA 5HRNA 4ECSA 1GX5A 2DGOA 4M1KA 3SMPA 1S7HA 4LFCK 2H54B 1HLUA 3VTIA 1J2VA 1YJVA 3SYZA 1WD6A 2M4MA 3M2VA 2XB2D 2X3DA 3EXCX 1QVFR 2E9TA 1Q78A 2A2DA 1H7WA 4TVAB 3TAQA 4DR3K 1PYSB 4EAHD 4QWDA 4NA3A 1VLOA 4LRAA 5KQDA 4URQU 4BC4A 2FHJD 4H0OA 2JWLA 2HMPA 2Z8QA 2RIJA 1FX2A 3F9KA 3TUJC 5KRTA 4DQSA 4KRFA 3X1LB 4JV5J 1A6LA 3CJ7A 3NBPB 3VAFA 2R8JA 1XQSC 1U1KA 4JI7F 3D6RA 3RMAA 4BRLA 1HPMA 3D2FB 3IP0A 3G6YA 1H1VA 4JI4K 2LSNA 4NZ7A 1RBSA 4Q2LA 1S6UA 3MD1A 1W25A 4E8UA 2E29A 4B3MK 3VQ4A 5F41A 1NPPA 1TL3A 4ANDA 1OKJA 5J2QA 4UZCA 2DRAA 3QMQA 4IDHA 2P6SA 3RZAA 1WEZA 2XZWA 1MNEA 1D9FA 2KYZA 4FCYA 2J6UA 4GVLA 4XPCA 4LY7A 3C19A 2IRYA 1KKHA 5FIIA 1YJWN 3O4WA 2A40A 4PWWA 5B0DA 3WXIA 2GVDB 2MQ8A 4OPAA 4MK7A 1X4AA 2PDAA 1B7FA 4DV2J 4ZN3A 3PRDA 4LF6J 4NL5A 5D0HA 5L38A 4BRNA 3HT3A 2O4GA 3OT9A 4DCOB 3G2XA 4CFCA 2JRSA 3OVSA 3THYB 1TL5A 2HSEB 3P4UB 1D09B 3ILJA 4EO8A 2J0WA 2XYPB 4MIWA 1RZMA 1K0VA 1BQXA 1KC8O 3I0SA 2MJNA 2DHHA 1WBDA 3IO1A 2P9LB 4DR4J 3EJMA 1UAWA 1ATNA 4P10A 1U48A 2IA6A 4N5SA 3MXMA 2GELA 1HYSA 4A2BA 2G2OA 3EICA 2WC9A 1X0PA 1RTHA 2WVFA 2OH2A 3QMLA 4WBFA 4V19J 3PHTA 5TKWA 2BE7D 1VQPN 2N82B 1QS4A 3A8KA 1F1BB 1XMQJ 4K42A 4DPUA 5LL6Z 2EFVA 1WOQA 1ZBHA 3L3VA 4LUBA 3JTOA 3OD2A 1NPRA 4C1NK 2LYVA 5AQZA 4MMOA 4IFVB 2F8SA 4USUA 4JI3J 2R2SA 2QLJB 4CJ5A 3D28A 2HQFA 1YGYA 3K8WA 1ASUA 2KM8B 3THXA 2OPQB 4R79A 4K7QA 2FVPA 1TUUA 4JAXA 1UWBB 5F0UA 3SQGB 1ZBIA 2HS0A 3J7Z5 2YHBA 4DUYK 4IOBA 4A8QA 3O08A 4FWSA 3QDKA 1B7YB 3PXGa 4JI8J 4XDCA 2RHSB 2VQFJ 3OVBA 3AVLA 4JI6J 3ZO7A 4O3OA 3TANA 4JI5K 1FRXA 4JYAJ 4B17A 2FBXA 4M63A 3D4JA 3G10A 3NNCA 1BC6A 5F2RA 4DV1K 5SWMA 1VSEA 3H2UB 2JGUA 5A76A 3BYRA 1U6FA 3MM9A 1NMNA 2ZZMA 4IEIA 2MSTA 3FLCO 1NUEA 4C7QA 5DDOC 5A0YB 1IBMF 3SQOP 4GKKJ 2HHHJ 1IWAA 1LWEB 3QZ7A 4DR3F 4I1TA 3B4DA 1NDCA 2LA4A 4CT8A 3E9PA 1S1UB 3QFUA 2V4QA 1R0BG 4FJHA 3CJ9A 4IEEA 4CF8A 5AT1B 2NXNA 2PI4A 5A8WA 2B9WA 4CGHA 4M3YA 4ILGB 4DTNA 2VGMA 4EMDA 1Y00A 4B3RJ 3ZT2A 5AQFA 1KVBA 1QVGR 1TL1B 4DWIA 2ALYB 4KY3A 4BC7A 2ZH2A 1SL2A 5G0RA 2B4UA 2EX3A 4B1VA 3IAYA 4NMLA 4JI4F 3Q8VA 3A12A 5L39A 3LPUA 2P9UB 2KI2A 4M5JA 4WCEQ 2BRKA 4RR5A 2IOCA 4B3MF 1RQ0A 3RMBA 4FYYB 2AU0A 3A0IX 1JIHA 4B3OB 3C7NB 1QZ5A 4DL0C 1KBRA 2HHVA 1L3VA 1S5JA 2BGGA 2NCKL 1QAJA 1RT5A 3VA0A 4FO0A 1FERA 3RAMA 3BGOP 3PIPQ 3R2CJ 4X4SA 5I9EB 2XY7A 3N28A 4MDBA 1QAYA 2DISA 5EY4A 1UCNA 2VYPA 4NASA 2VKZG 4KH5A 3DWLA 3BQ1A 5AR0A 2N7CA 1XI1A 4K8RA 2IVFB 1RFQA 5AQTA 3TQEA 3KD1E 4L3QA 4CESA 4DV6K 4CLYA 1F5BA 4C8ZA 3DHXA 4JNEA 3C3LA 3MEDB 3ZSYA 5KFOA 4I9LA 3SDEA 1RHJB 1BQNB 1HNWJ 9ATCB 1JJ4A 2DNLA 3W7BA 1YLXA 2KN4A 1X5OA 4ZIVA 3V9WA 3G82B 3QYYA 3OJSA 3JAMY 3OL6A 4KT0C 2C22A 1GMVA 3I4PA 3F73A 1N36F 1JCGA 3ALYA 2HNZA 3TW0A 1IM6A 3VGTA 1PJ5A 4OKKA 2BVZA 1V3RA 4QYZJ 2UUBJ 2YPZA 3CULA 2PFUA 3U3GA 1K8AO 1CPZA 2W7OA 1TK8A 1E6VB 4MQ3A 3LF0A 3W61A 1VC0A 4DG1B 3NFAA 4HTLA 1OVYA 4QAGA 1WOSA 1LNQA 1RTDA 4JRPA 4BE2A 2YWEA 3VGMA 3FBEA 1NDPA 4CM0A 2N7YA 3HHLA 3HVWA 1NBWA 2B8PA 3QBWA 2ZDOA 1AA1B 2GAGC 2XMVA 3BKUA 1T6CA 1AXQA 3U4LA 2Y1JA 5CYJA 3THWB 3E51A 4RWXA 5E3RA 4BVPA 4IXCA 3UI3A 4B02A 1EETB 3GV5B 1J5EF 1YI2S 3CCUN 1N56A 2QL5B 4NLWA 3O3HA 4LFBF 5AQGA 3T69A 4ZCIA 2R7QA 2F4VJ 1U24A 5AE3A 3M8PA 2DPIA 2QWMA 4C11B 1DGKN 2YKMB 5LMNK 1HWIA 3PRBA 5CYQB 3OW2M 3SSRA 2OSRA 1GLLO 1X4HA 3DLEA 4CEEA 2WSEC 2AV5A 3G9CA 1H2UX 1HYZA 2Q2RA 1HR0J 3J81Y 3HJFA 4JI5F 2FSJA 2W2NP 3NRBA 1RYSA 3ELHA 3CQYA 1BE4A 3UKUB 3OYIA 4YEAA 1S9FA 2Z58B 3PYGA 3QRPA 5AFUH 3U1NA 3OUYA 4A2AA 3VALA 2G0CA 2CVIA 3N5BA 5L1IA 3SCJE 2ITGA 3VQBA 2FTRA 5FPEA 1AZSB 4YDDB 3H5UA 4U95A 3DRYA 3GR0A 2ADBA 2XMTA 3V9XA 2WBRA 1VQOS 3KYLA 1Q8LA 2YKNA 1S99A 2HHUA 2Z30B 1M5PC 2Q6CA 2IC3A 5L1KA 3U7JA 2ATLA 1RADB 4KH6A 3W8GA 4QIFA 2N4CA 2E1RA 1DURA 3JAMO 3H3NO 2XZDB 4NZ0A 3CG7A 4K4XA 4DFPA 1YITN 2DR8A 4HUEA 1EO1A 1HQEB 2CH5A 1U49A 4OJ1A 3EM1A 3EL2A 1QHTA 2C28A 3AAWB 3IRXB 2QX0A 3EUNA 4F3OA 2ZFHA 4Z4GA 5AQLA 3M8ZA 1S9GA 1VMBA 4DTSA 2EBGA 1PCAA 3VMFB 1I3OB 3KHGA 2HHPA 1CEZA 5E5NA 2BANA 4J91A 1HBOA 3W2VB 5K8MA 2DNGA 3T1HK 4DV4J 3O1BA 1LWFB 4Q7AA 3HVTA 1HWUA 3BYPA 3OXGA 1S1VB 4JI0K 2YX6A 1U7LA 3JB9k 4C8YA 4BCAA 3DXMA 3HM8A 1VSHA 1QUPA 2B5JB 4AL6A 5EWEA 4WJBA 4P2MA 3UPFA 2IA0A 1YUWA 1UAXA 3D3CJ 2ADCA 3CPWM 4YOWA 2NRXA 3LWMA 4ILLA 2QSFA 1WHYA 3QATA 4I6MB 3NOCA 3J81O 1JLQA 3BEGB 2DK2A 3W5ZA 3QESA 1Z2LA 4AXIA 1T6DA 4WCEL 4NXNJ 2W2PP 4KHPJ 2YVSA 4ZP9A 1GLCG 4V19S 4LT6A 3R8YA 3LWLA 3PIPL 1TV6A 5IWAJ 1EWQA 4AD6A 1UJ5A 4LIWA 5KG5A 4EBCA 2I7PA 2YWFA 4B3TK 4CH7A 4F04B 1BWFO 3BKFA 2CPHA 3TEGA 2WONA 2HOEA 3BQ2A 3TAMB 5B7WA 3SV4A 3FFIB 1B70B 2Y9HA 2CZ4A 3WQPA 1U1MA 1C1BA 3O9SA 2QZ8A 4JKEA 1TTHB 2Q97A 1S22A 2HMIB 2D3UA 4DR7J 1HMVA 1D5AA 4CHYA 3MAHA 2UVWA 1SQEA 4AHVA 4DHYA 3EX7B 3KLEA 4A59A 2BRLA 1JLCB 3UQSA 3SMZA 3IMXA 1RAIB 3CEDA 4C6AA 2LMIA 3KJFB 3AVJA 3GLJA 1T05A 3RTVA 1TKTB 2YH0A 1OYEA 2FD2A 2DGTA 2QMUB 2VHGA 4ZJQA 1NHUA 3OS2A 1JXBA 4CFBA 4FJNA 2DNRA 4CJRA 4F2RA 4GKJK 1WKJA 3CO9A 1Q86T 3UCGA 1RAFB 1NEEA 3C8YA 1JCEA 3EKUA 1TUWA 2DNMA 2XRIA 2Z1HA 3PKMA 4DQ8A 4NLRA 2R8GA 2XGQA 1K1QA 4J5OA 4HDGA 2IMOA 3L7OA 4ZVTB 2QXLA 1G6BA 3GPAA 1RBLA 3P5TL 4ZCMA 2G2YA 2NRHA 1WSEA 3OBYA 4AHUA 8ATCB 2LEBA 3TABA 2WCXA 1JLEA 3F56A 3SXLA 5J2PB 4DDFA 4JBCA 4CD1A 1YDLA 3MN5A 4LH5A 1CG2A 1RGVA 4TU7A 7FD1A 2C2EA 2DB1A 1JB0C 2AMCB 1UJ4A 2EXUA 1FWPA 3DDKA 1U8SA 1LWCA 4C8LA 1VQ6S 2YX1A 3I5CA 1WUUA 1FFSB 1BISA 3ZSOA 4LSNB 3W60A 3WNGA 4KHWA 2GQ2A 1CQMA 4B1YB 3UB5A 3AQPA 4BDZA 1CULB 3W3DA 1DT9A 1XC9A 3DMJA 4AM6A 4FYDA 4EP5A 2Q3SA 3SCXA 4ZLPA 4GVMA 2BQUA 1H3DA 4DX5A 1UEUA 1WHVA 2RS8A 4ENOA 2YJEA 1HBMB 1IJFB 4MKBA 1FKOB 5HROA 3FZFA 1OH8A 2VG6B 2BUPA 4IBNA 1CC7A 3JAMU 3GL1A 4DMNA 4FPAA 2HBJA 4C23A 3T1HF 3NF8A 1UWAA 2B0GA 2V67A 4BC2A 3I56N 1S6PA 3LH2S 4CEOA 1UEVA 3T6BA 3M6WA 2DPJA 4JI0F 1F3FA 2NXCA 4YN3B 3CDWA 2Y0SD 1AT1B 3D6TB 4JYAK 3H90A 4TYBA 1BQMB 2J7KA 2AP6A 1Q7YT 4H5VA 3LP0B 4BGBA 1EAYC 2AEJA 1QY7A 1IBLK 3L2QA 5DLGA 1KVJA 1IR1A 2WOMB 2DH7A 4HTIA 1OY6A 1V4TA 2P9EA 3OR2B 3BGLA 4GKKK 1O51A 3IXQA 1N4LA 1FA0A 2FLPA 4FBTA 4GV3A 2UUAJ 2CPIA 1M1HA 2O01C 4UY8O 5E3AA 5C42B 1OWXA 3DJCA 4CRJA 4IKAA 3E01A 4QCLA 4IOXA 4CEQA 2AQ4A 3MGJA 4LBIA 4B9QA 2E1ZA 3PO5A 4W5QA 1QSYA 4B3TF 4QBUA 5J2NB 3W3SA 1JLFB 1RBOB 2R2RA 2DIUA 2K7KA 4ED7A 2P5GA 4UOCA 2CNKB 1QJHA 3P38A 3CCMS 1SKRA 5EVZA 2JLGA 2OP5A 5DETA 3ASMA 5BN9A 4X4OA 1JJ2R 2W9BA 3EVOA 4K4ZA 4RW9A 3AH6A 2P9SB 2Q1LA 4H0PA 2QTWA 2G4BA 4C0HA 2QMXA 1HI0P 4I2QB 4FF2A 2OLWA 1DTTA 1DZ5A 4LF7F 1T3VA 2AX1A 5IFMA 3A4TA 3VF6A 4PG6A 5F8NA 1OJ4A 5AXKA 2O8FA 1TL4A 1M1GA 4KH0B 3BQ0A 4KBOA 3AA8A 2NUUG 2XLJA 2EKNA 1KQSR 2LCWA 4H5TA 3PRVA 2EG2A 5B0CA 4U96A 2P51A 2DNOA 3C14B 3AA4A 4USJC 1FE0A 2JEIA 2F7VA 5EUHA 3NGTA 2CNLB 3ETOA 2E6LA 5H9FK 3NNAA 4CLFA 4ZK7M 4DEZA 4PKIA 4HCCA 1IKWB 3H1QA 3G4SN 3R6GB 2D7SA 2DEJA 3NGZA 3S01A 1RT4B 2H65B 3S3NA 1VDHA 3B78A 3GOIA 2VFTA 1WKKA 2DH9A 2FHMA 3G86A 4CZGA 1R8BA 4U7CA 4DSKA 4FLTA 2UVUA 2Q79A 3V6DB 1NGJA 2CUYA 1FF2A 4DR2J 4Z94A 5H9EK 4CFDA 3OYLA 5I3QA 1REVA 1WI8A 4KH4A 3GJTB 3P8BB 4AHCA 3QLHA 3ZXWA 4A57A 2VKRA 2HYIB 2QSWA 2I8EA 4ISEA 1FD8A 3OQ2A 2DBBA 5GINA 1H6KX 1AFJA 5L8RC 2QFIA 4BWJA 1M90T 4F8RA 1WNSA 2YBVA 4AXJA 1NU4A 3L7UA 3CJ8A 4ZOSA 2QKBA 4BQLA 1G3OA 3FRZA 4Y1CA 5GVQA 3J81j 3HBTA 5E7OB 2JVOA 4WKRA 4W5NA 2PC6A 2CG8A 3BO2A 5HLFA 3HHDA 1NKCA 5CZ2A 1ZETA 1PSDA 4IG3A 3M9NB 3LL3A 4E1MA 1ZA1B 1UVNA 1NPKA 1U2VB 3CD6N 1XMBA 4IUFA 3RGIA 1M1KO 3BGRB 2OPSA 5BRFA 1F9FA 2W7AA 2IM2A 3MECA 5FPMA 1OS5A 2DPNA 2NXJA 1EKRA 3CI5A 1RT7A 2AZ3A 2E66A 4LR9A 4JHDB 3QNWB 4CTAB 4OMFG 3ENBA 2GGPA 1ZXOA 5T14A 1RAGB 2MB0B 3N6LA 3ULHA 3CJBA 1DTQA 4HKQA 4BDYA 2EG1A 3FVYA 2BDPA 3QIDA 2UU9J 3I55N 5C24A 3MWPA 4CJSA 1IBLF 3JQMA 2M0GB 1GEHA 4LF1A 4EZ6A 1IH7A 4KC5A 2AYBA 4BRCA 3HSDA 2FZCB 3QFHA 4CJLA 4KGXB 3TX8A 3HMJG 3DGVA 4FWPA 4DTUA 5JS1A 1U2FA 2ACMA 2OEKA 3VEYA 3NCPA 2HBZB 3HD1A 4OQJA 4MO5A 2RS2A 2G8KA 4ZPAA 3B8HA 1LAWA 2P5VA 2U1AA 3RRGA 4FF4A 2H5EA 3H59A 4I56A 1Z6RA 4A8YA 1IBKJ 1O0PA 3VENA 2GWJA 3NH0A 1F3VA 1A7GE 2HVZA 3MM5A 4M3RA 1D9DA 2W4CA 4AYBD 3C6UA 4DCJB 4YY3K 3K5LA 1IV0A 3UVJA 1H73A 2H51B 2C3PA 3A3NB 5E84A 4KFBB 4YMEA 2XTJP 1ZZFA 2GC8A 5K20B 1U1RA 1WDDA 3W5YA 1SC3B 2FLLA 3EPGA 3HVRA 3RYLA 4B9SA 3EVWA 4IZ9A 2FHJA 1FK9A 4DPOA 3CFPA 4CH1A 3M6XA 2F9WA 1VRTA 4DR1J 4RW6A 3KKSA 4NOHA 4ANCA 4CNZA 4MFBA 4HACB 4DQRA 1WC3A 4Z7CA 1HNZK 4MIBA 3G96A 3DRSA 1Y64A 1IWGA 1F21A 2NS1B 3P83D 4JKDA 2O5DA 2QRRA 4M5NA 4CQ1A 1S57A 2U2FA 2QYCA 1F0XA 3KVGA 4DSLA 5DK5A 3GIIA 2CKWA 4OHYA 1E4GT 4L3NA 2GVZB 2KTQA 3AVFA 2BE2B 1RHUB 4W92B 3QT5A 1VLYA 3NVMA 3MCNA 3KLVA 3UD4P 3AO1A 3M30B 3M6GA 1HBNB 1KQFB 1GTHA 1PYTA 2MGZB 2X7IA 2E1AA 1D8ZA 4N7TA 4EUVA 3ZT4A 3MAQA 4KH1B 3ZC4A 4Z0UA 3B4MA 4MKYA 1JXLA 4I9QA 1SUQB 3NBPA 3RBXA 3PO4A 4OZNA 3DKDA 2YTCA 2KXNB 5AQIA 3HPHA 2APOA 4DS4A 3NGRA 5HJXA 1XUPO 1RWNB 3GU0A 4UY85 4W5TA 2A10A 1Q4RA 4W4MA 3TJAA 1G1XA 4AHTA 2IVYA 4FS1A 1R3NA 3HT0A 4HL9A 2G2ZA 3BN7A 3CW2C 2GX9A 4GNIA 3VF2A 1VQYA 5KT3A 4CECA 3PW4A 4H4MA 1C1AA 5M2UA 1WDTA 2NRWA 4YOXA 3PYEA 2AA4A 3R5GA 1RA6A 4QZVB 3KK7A 4DV5J 4M5HA 1VQ9S 2F96A 5ETVA 5DZ6A 2E2PA 3O44A 2XS2A 1B0PA 3LM2A 3QGGA 1WORA 5DG7A 3M8SA 3F5TA 4QW9A 2ZH9A 4WFYA 4DTJA 3FJ2A 2BM1A 3MMAA 4UUWA 2AZ1A 3MMCB 4KREA 4DL7A 4AL5A 3ZSQA 2HGLA 1MMDA 5EU7A 2HVIA 3CCQS 2GVDA 2QA2A 2QWLA 1VQKN 4P75A 3X3UA 2GV9A 4FK4A 1SB6A 4F26A 4OYPA 1EKEA 4NLTA 2YKOA 1YIJS 4OX9J 3QNNA 2EK1A 1VSMA 4H0VB 4ZLLA 5HK4A 1MWQA 4RNFA 5E41A 3VV2B 4DTMA 2H5IB 4JK8A 1VSJA 1JLBA 4ELVA 1JMTA 6FDRA 2NLWA 1L3UA 1OQ6A 2D1KA 3F41A 1WELA 2M5YA 2ILYA 3KD5E 4K8ZA 2CADA 4JN4A 4NYOA 4DI6A 4A8WA 4ALZA 3DRRA 2YWWA 1OH6A 2UYTA 3DOLB 5GAEU 3RR7A 2M8DB 2AF6A 4DF4A 4PCQA 1XERA 3E9LA 3M8QB 1SJQA 4B9NA 3QICA 4YORA 2E5JA 1EHWA 3V1OA 2C3MA 4KJIA 1JWWA 2DXEA 2E88A 4X62K 5KFTA 4YB6A 3AD9C 3LPTA 5GADP 4YR2A 2ZOGA 4YY3F 2W2OP 1I94K 5E2QA 1X4BA 4IFVA 2ZKUA 3HCXA 4DPWA 3HSTB 2