1C0UA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+50.0934
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 136
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0uA05
4MKBA 1EX4A 1BL3A 5T14A 3KJVA 1HNVB 3Q8SB 1SUQB 4KAIA 1JXBA 4OGCA 3RMCA 1TKXA 3DLBA 5F8JA 4QOZB 1VSLA 4O4GA 4J9QA 4IG0B 4IDKB 2AGQA 1S1TB 2HB5A 1WSIA 3G10A 3T5KA 4BWMA 2BR0A 5KG7A 4CJUA 2VWKA 1S0MA 4CHZA 3OYKA 4Y2CA 1L3TA 4M94A 3DLHA 4ELVA 4QPXA 5KFPA 4DLGA 5K14B 3BGRB 4NLWA 4K4VA 3VQQA 1QQCA 1REVA 1RILA 2W8LA 4NLOA 3MTKA 2XY5A 2ATLA 2B5JA 1JLQB 2LSNA 1RT2A 2VA2A 2HMIA 3V1QA 3TI0A 5D3GA 1TV6A 4PUOA 4DSLA 3V6DB 3NF6A 3H08A 2DY4A 4ZPCA 3DLEB 1S1UB 1LV5A 1IKWB 4CJTA 1LWFB 3NGYA 4M45A 3KLEB 4C8LA 2XI3A 3P5JA 4E7HA 4KFBB 4BACA 3LP3A 5J2QA 1DTQB 3MEGA 4F4ZA 3NL0A 3IGNA 3H40A 5FROA 3ZSWA 5JUMA 3PVXA 3KLHA 1ZBIA 4OVLA 3MXJA 2R8IA 4IKAA 4CJEA 3RMDA 4Y2AA 4NCBA 4DS4A 3ALYA 4XO0A 4RUCA 2R2SA 3PW4A 2KFZA 4RW6B 4F4XA 3KK1B 3ZSZA 2IAJA 4PY5A 3ITHA 3M8PA 4PWDA 4OPKA 3CVKA 2WONA 3NAIA 3VQBA 1RYSA 1RDCA 1NK4A 1JKHA 2P5GA 3TAPA 4KE5A 3L2QA 2ZD1B 3SQ1A 1S1XB 3E01A 3H4DA 2XCAA 3ZT3A 3LALA 1SV5B 3K58A 1U45A 1BQNA 3PJWA 4O4GB 3ZT2A 4QAGA 4NLXA 2DPJA 2FLPA 1C0TB 5FDLB 1RBSA 3CFPA 1JLBA 5J2PA 4CE9A 1JLEA 3M9MB 3ZSXA 3OYJA 3CJ2A 1JIHA 3OL8A 2YKNA 3QEWA 2EX3A 3KK2B 5DLGA 1S0NA 4K4UA 1FXXA 3GV7B 3SPYA 4TQRA 2VG5B 3T3FA 1RT2B 1VSFA 3PO5A 2X74A 3PZPA 3VQPA 1Z4UA 1JLGA 3H5XA 3DLGA 4O44B 1HYZA 2D0BA 4NCGB 3PW5A 1MMLA 1JX4A 1FKPA 2B6AA 3RR7A 2ASJA 4WFYA 4RW4B 1RTDA 5I3UB 3JYTA 3IGVA 5T7BA 4H54A 2VG6B 4FLXA 3MEGB 3C6TA 3VQCA 4OGEA 2RDIA 4J2BA 4ZP7A 4CGGA 2DFHA 3C94A 4FJ5A 2AX1A 1LW0B 4DQPA 4OPJA 3CG7A 2HHSA 5CYMA 3VN5A 4DL2A 4ECVA 4YFUA 5KFZA 4DQIA 1R0AB 3NE6A 2IJNA 4K8ZA 3RRGA 3SFGA 2GC8A 4F3OA 1NKCA 5CZ2A 1QSYA 1IH7A 1CZBA 2HHUA 1YTAA 2WONB 3OLAA 4HTUA 2OPQA 2D3UA 3RB0A 3H2LA 3V81A 2P5OA 4CECA 3ZT0A 3RTVA 2W9AA 1S97A 4PQUA 5DQHA 3VQ4A 1WN7A 1XHZA 1SL1A 5HP1A 3V6JA 2BQRA 5DK5A 3HVAA 4J2EA 4RW7B 1RDBA 3KLFB 3QERA 4YP3A 4JRQA 1GX6A 1S1VA 3RBEA 5L1JA 1TVRA 1JLBB 2WB4A 3KLIB 4FLYA 2GIQA 3O4QA 1QAJA 4EO6A 1TKZA 2R8HA 5KRTA 3LP2B 5DQIA 3NF7A 3H5YA 1KSPA 2HWHA 3DRRB 2CKWA 1UOCA 1HQUA 3HVTA 2W7PA 1S9FA 4FK2A 4WE1B 2HHVA 3QGHA 1TK8A 4LSNA 1W25A 3MF5A 2E9TA 3ZCMA 3SUNA 2IMWP 4AHSA 2VG7B 3DRSB 3AVLA 2IM3A 4DF4A 1FKPB 1XC9A 1D9DA 4IH5A 2J6SA 4CF0A 2XY6A 1CZ9A 1B92A 4B9MA 5DMRA 4CJLA 5F8IA 2E4LA 5F8GA 1MU2B 4HKQA 4MK9A 4ICLA 3UQSA 3QNNA 1EP4B 3LWLA 4E7KA 1HMVB 5HROB 3EPIA 1RTJB 4KHYA 1ZBLA 4CF1A 2RKIA 1O1WA 4ZPDA 3L2RA 1GOBA 4YR2A 4DTXA 3LP0B 4J9NA 3IRXA 2WOMA 4G1QA 4H4OB 5KFVA 4I7FB 3I0SB 1RTIA 1KVCA 2YHBA 2I1RA 1HPZB 1T7PA 1BQMA 4ED0A 3VQEA 1ZBFA 4NYFA 4BE0A 2J6UA 2F96A 4XPEA 4URQU 2HHWA 1JLCA 3NBPA 5DGBA 5KFIA 2C2EA 1K1SA 3D45A 3KKSA 4NRUA 2FJWA 3K57A 1TP7A 1ZYQA 4CCHA 5F9LA 5F8HA 3EY1A 1T03B 4O55A 4DFMA 4FBUA 1S6PA 1JLAB 2EHGA 4FM1A 3VQ8A 4J9OA 3QZ7A 5JS1A 2HNYB 1ZTTA 4FS1A 1HYSB 3NKYA 2OZSA 1HNIB 3AVAA 1TKZB 3AO5A 5HRSA 2AGPA 2VWJA 2IDOA 1NJYA 4NCAA 4FBTA 5KG1A 3CJ3A 3NGIA 3HVTB 2W9CB 1S10A 4DTUA 3G6XA 4I2PA 1D8YA 2QK9A 2C28A 4JV1A 3AVIA 4O3PA 3AVMA 2JEGA 1N48A 4Q43A 1TKDA 1KFSA 3ASMA 4WZMA 4HUFA 4IQXA 1WAFA 3QGGA 4BE2A 5KT6A 4FM0A 4MKAA 3I5CA 4BDYA 3PX6A 3S3NA 3TARA 4RU9A 5KI6A 4DL7A 1ZTWA 4FM2A 3M9OB 2JEJA 2WRMA 3U6FA 4B8CA 4OJRA 3ZSOA 4U6PA 3NH1A 4R8UA 5J2NB 4FJGA 2ZQBA 4CK3A 4TSXA 1Z25A 2NUBA 1ASVA 4TQSA 3P83D 3V9UA 3V6HA 2E9RX 4CEBA 4M3ZA 2HHTA 2WOMB 2BANA 5KG5A 4Z4FA 5E41A 1RT7A 1IKVA 1S6QB 3QNOA 3AVNA 1S1WB 3CIZA 2Y1JA 4DSJA 3RWUA 4CERA 4K4TA 4N76A 3LANA 1UAXA 3O3GA 1RCHA 4TYBA 1WAJA 4ECXA 2UUWA 3KNAA 4MH8A 1J5OA 2IM0A 1RNHA 2Z1HA 4J9LA 4IFVA 4CFBA 3IG1A 4JUZA 4ZVEA 5KFWA 4ECSA 3AVGA 5C25A 3OHAA 1RDDA 1RT4A 4YR0A 4ID5B 1U04A 4NLUA 5KFRA 4IBNA 4RW8A 3VQ7A 4I2QA 3AA4A 4O3RA 3L8BA 2YNIB 1UWBB 1RAJA 4DTPA 1N5YB 2IC3A 3TAMB 2HHQA 2YKMB 1IKYA 3TAGA 3RAXA 3KIOA 3MR3A 4O5BA 4DTSA 4RW9A 2E6LA 5J2MA 2RPIA 3KLGB 3A2FA 4FW1A 3T5LA 3FQLA 3OHBA 4CEDA 4KKOB 1WSHA 4M42A 4UQGA 4FLUA 4CJPA 2FJXA 5KFJA 1DTTA 1T8EA 4CGIA 3M8QB 3HYFA 1VRTA 4N5SA 3GYNA 1BCOA 3MEEA 1U47A 2HVIA 1TL3B 3BJYA 1WLJA 2AU0A 4B9NA 4AHCA 2BRLA 1EKEA 2ALZA 3MEDB 5C24A 4TN2A 3RAQA 2DFEA 3DI6B 4EP5A 1RA7A 5KFEA 4RUAA 2A1SA 3OYGA 2R2TA 2ILZA 3HHKA 4CFCA 4AILC 2UVUA 1KFDA 2KTQA 5SWMA 2D3ZA 5DG9A 1RT5B 3OSNA 3V4IB 3V9XA 1J54A 4F2RA 3S3OA 4DL4A 2KQ2A 4MIBA 5CY4A 4MK8A 4KSEB 4DSIA 3AVFA 4TXSA 1C0UB 4ZMMA 5KG6A 5EU7A 2BE2A 1WNSA 1C1CA 2XCPA 2KZZA 3DMJA 1NHVA 5KFGA 2ATQA 1HQEA 1N6QA 5HLFB 1A5WA 3LAMA 4RW8B 4I2QB 1S9EB 2IC3B 4HUGA 4R5PA 3FFIB 4K4ZA 4FW2A 3SQ2A 5KT3A 1X1PA 4YQWA 3BSOA 2W9BB 3MXMA 2O4GA 5KT4A 1TAQA 4CGDA 3FQKA 1FKOB 3DLKB 1NK8A 3NAEA 4IG3A 2ZKUA 1JXEA 3AVJA 3SQ0A 4N56A 4HCCA 5KFCA 1RDRA 2DTUA 3K59A 3OYFA 3CDUA 3LZJA 1W0HA 3OJUA 1NOYA 4B9SA 4F4KA 2PZSA 4Y34A 1IM4A 3F73A 3AO3A 1K1QA 3EPGA 3OYEA 3QEIA 4M3XA 1BI4B 3TAQA 2G8KA 1DLOA 3ZSYA 4DTJA 2YNHB 4B3OB 2Z1JA 4KRFA 4DLEA 2XGPA 5KFXA 1TQLA 3SZ2A 1VRUA 4AHUA 4MIAA 3OYCA 2UUTA 4W5NA 4Q0BB 1QSSA 1RDAA 3H59A 4FK4A 3H5UA 5EDWA 4CHOA 3NAHA 2IOCA 2FBYA 5C5JA 4DWIA 4NLSA 3LDSA 4FJLA 1LW2A 1TKTA 3H4BA 3SI6A 1SH2A 4H4MB 3M8SA 4EBEA 3TWHA 3PHEA 4NLGA 5KFQA 3KJVB 3FDSA 2YV0X 1XWLA 3AA5X 4GVMA 2R2RA 1TKXB 4AHRA 2QE5A 4K4WA 1TGOA 3QO9A 4EBDA 1TAUA 1LWCA 2YHAA 4RZRA 3OYBA 5KG0A 5L9XA 4CJFA 3UR0A 1S4FA 5L1LA 1LWEA 3DMJB 2DPIA 2XY7A 2W42A 4CIEA 2W8KA 4KB1A 4RNFA 1REVB 5KFSA 3V9ZA 5KFHA 3CDEA 2B5JB 1QUVA 1C0MA 4EZ6A 3TABA 2BGGA 5KG3A 4RNMA 2HMIB 4E89A 5D3GB 1XHXA 1TV6B 4PUOB 4M3UA 3SUOA 4FLWA 1RBUA 4FCYA 5HBMA 3MR6A 2G8WA 4O3SA 1QAIA 2HNDA 4B9LA 4KV8A 1HYVA 3DLRA 4J9KA 3T1AA 4NYNA 1NK7A 5J2QB 3GIKA 2IBKA 3OY9A 4CK2A 1UA0A 4KHMA 5HRNA 4TLRA 1ZETA 3KLHB 1EETA 1RT1A 4CIFA 3NCIA 3GIIA 3AO4A 2CJQA 4FJHA 4KI4A 4EYIB 3HVWA 3CFRA 3L3VA 5EWGA 4ZTJA 2ASLA 3HSTB 2IM1A 4WXWA 2B4JA 4NLRA 4U7CA 4DU4A 1I6JA 4E1MA 4KHWA 3CJ5A 1VSDA 4QW9A 3N6NA 2IAJB 3ITHB 3M8PB 4PWDB 5KFYA 4KTZA 4ED6A 4Q8FA 3PO4A 4E19A 3GIJA 3V9WA 4YMEA 4FJMA 1JKHB 4DSEA 4CEOA 3MAQA 3IAYA 4ELUA 3E01B 4ZPAA 2QXFA 4DFJA 2FVSA 1BQNB 3UDLA 3DOKA 3I0RA 4CJ5A 1RT6A 2YNFA 3K5MA 5CZ1A 1ZBHA 4ECYA 3QIPA 4KO0A 3TVKA 4FLZA 1YT3A 3SCXA 1FK9A 5J2PB 2XI2A 3N6LA 4RNOA 4KI6A 3M8RA 3OS0A 1N56A 1JLEB 2HVHA 4M95A 3NF9A 4W5OA 1BIZA 1W9HA 4TYAA 3GV5B 3BR9A 2JGUA 2YKNB 3BSNA 3G6VA 4FJNA 5HRPA 2IA6A 5HRRA 3U3GA 3CYMA 3QYYA 4I9LA 3AV9A 2HWIA 3TR8A 3TAEA 4QWCA 4CHPA 3OSPA 1U09A 3E51A 4GW6A 1L3UA 3RB4A 4FJIA 1KLMA 1JLGB 2I5JA 2ZE2A 3DLGB 3WNGA 2B6AB 3CQ8A 4IOBA 1D9FA 1KTQA 2FC0A 4J2DA 3NH2A 3SYZA 1WNEA 1RTDB 4DSKA 1HRHA 3JYTB 1RTHA 1XR6A 4IRKA 4ECTA 4CF2A 4CHQA 4K4SA 3CM5A 2EC0A 4WYLA 3C6TB 1X9SA 3V9SA 1RYRA 4HUEA 1S9GA 3OYLA 4KBIA 1EETB 2XC9A 2GV9A 4K4XA 2OYQA 3VA0A 4DG1A 5CYMB 1Q8IA 2BQ3A 3HL8A 5KTQA 4QWDA 2XY8A 2KW4A 3C6UA 3DRPA 3M9NB 3AVBA 4F3TA 4WYWA 4ZP9A 2X78A 1JLFA 1Y97A 1EXQA 3DYAA 2OPQB 3V81B 3BSAA 4BWJA 5J1EA 4CJVA 4KB7A 4PQUB 4B8AB 2RF2A 1C1BA 2FVQA 2FBVA 5HP1B 1T05A 1VK0A 4XPCA 4J9SA 1ASWA 1L5UA 4CGFA 1NNDA 4KO0B 1S1VB 4B9UA 4LSLA 1NJWA 1SKSA 1TVRB 4CESA 3VQ6A 4TY8A 5DG7A 4C8KA 1SH3A 1KHWA 3VQ5A 1NJZA 2GBZA 1HQUB 3DM2A 2ETJA 4K50A 4IFYA 3ZSQA 3VQDA 3B6PA 4Q45A 4LSNB 3OYNA 4ED1A 4ZHRA 1RT3A 3SFUA 5F8LA 2ZE2B 2WHOA 3Q8RB 4W5RA 4OLBA 1D5AA 4KB0A 3UIQA 1NK6A 3QLHA 4DU3A 1X9MA 2GUIA 5KFUA 2YNGA 4ED7A 3QIDA 1RTHB 4DTOA 3NF8A 4ICLB 1QE1A 2V4RA 4HYKA 4G3IA 4KHUA 4CFAA 4OKKA 2VA3A 4EYHB 1HARA 3D5MA 4F50A 2RKIB 4DFPA 3SQ4A 3GQCA 4MFBA 3IRXB 5C42A 4G1QB 4ECRA 3O3FA 1RTIB 3ISND 1BQMB 4CF8A 4HVJA 1S48A 2OA8A 4O3NA 3PY8A 4JS5A 4AHTA 1JLCB 3NBPB 4C8NA 4DMNA 3SV3A 2C2RA 5DGAA 4IRDA 1JL2A 5EWEA 4URGA 4W5TA 5F8NA 1C1BB 1HNVA 1J53A 1WSGA 2R2UA 1A5VA 4IR1A 3OS1A 2JLEA 5KFDA 1S6PB 4DEZA 4JS4A 4IG0A 4IDKA 4LSLB 2FJVA 1S1TA 1C2PA 3GIMA 4K4YA 4O0JA 4C8MA 4EO8A 4BDPA 1A5XA 4YNQA 3SI8A 3PV8A 4MK7A 2P51A 4E7JA 4F2SA 4NLYA 5K14A 4I2PB 3BGRA 4QW8A 2V0NA 1ZBUA 4DQRA 3EZ5A 3HK2A 2AGOA 1KLNA 2UVRA 1KCFA 1NK5A 5KG2A 4XIUA 1JLQA 1JXLA 4IH7A 3G0ZA 2FBTA 4CJRA 3HP6A 4OKJA 3V6DA 3QLHB 3KHGA 3PW0A 3KD5E 2OH2A 1S1UA 1IKWA 4CJQA 3MFHA 1LWFA 4M3WA 5KFBA 1QE1B 1CXUA 3KLEA 4C8OA 1VSKA 2F8EX 5KFOA 4R8UB 1RBVA 4OKEA 3V6KA 4K8XA 4FS2A 1DTQA 4CJKA 4ZPBA 2FVCA 4EEYA 2KFNA 2AWZA 2XWYA 2BQUA 4NLTA 3WNHA 4GC7A 3CM6A 1WSJA 4DTRA 2WK4A 3I8DA 4CEEA 3SV4A 1IKXA 3UPFA 5KGXA 2BANB 4CJSA 2O4IA 4LY7A 1KVAA 1RT7B 4DFKA 4CGHA 3NGDA 5CYQA 5KFKA 1IKVB 5KGWA 3PX4A 5EUHA 1XI1A 1Z26A 4J9RA 4RW6A 3KK1A 3VQAA 3SUPA 3RB6A 3PR5B 2PYJA 1J5OB 2Y1IA 4CEAA 3LAKA 3ICLA 4Q5VA 4ECUA 4CJWA 3TANA 4IFVB 3QEPA 3FSIA 4BDZA 3IG1B 4Z4IA 1SL0A 2ZD1A 4N47A 2G8HA 1S1XA 5C25B 1RT4B 3TQ1A 1I3AA 1KRPA 1SV5A 5KFMA 3KKRA 3QEXA 3ZT1A 4KPYA 2J6TA 2JC1A 3BDPA 4GC6A 2IJFA 3KOAA 1C0TA 5FDLA 4DL6A 1IKYB 4QWEA 1SH0A 1TK5A 5KG4A 3EYZA 3ZT4A 4RW9B 3PUFA 4GMJB 5J2MB 1X9WA 1BCMA 1LAWA 5KT5A 3OYAA 4Y1CA 3NGZA 3KK2A 3HT3A 4CEFA 3BQ0A 4EP4A 4LH4A 4E7IA 2VG5A 3N6MA 3K5OA 3H5SA 4Z4EA 2AJQA 5F9NA 4IH6A 1DTTB 4O44A 3G6YA 3QINA 1VRTB 4NCGA 1VSIA 4NLPA 4FJ8A 3OJSA 4B9TA 1N4LA 3MEEB 2OPRA 1ITGA 4RW4A 1TL1A 5I3UA 2VG6A 3Q8PB 5C24B 5F8MA 3D28A 3PX0A 1LW0A 5DQGA 4FYDA 1L3SA 1IKXB 4KTWA 1B9DA 2HAIA 3T5JA 2O5DA 2ILYA 4ECQA 5CYQB 4J9MA 1R0AA 3QGIA 4FVMA 4ZVGA 3EZUA 1Q9YA 1XR7A 3C95A 3AO2A 4QWAA 4FZZA 3HPOA 2IM2A 3L2UA 2X6NA 1IG9A 4DS5A 1K6YA 4DSFA 5DLFA 1KVBA 3LP1A 2BE2B 3CDWA 4DF8A 1C1CB 2UVWA 4J2AA 3OYDA 3QETA 3ULDA 1YTUA 3VQSA 4CIGA 1HQEB 1N6QB 3HVRA 4RW7A 1G15A 3NH0A 4DQSA 1QS4A 3KLFA 2D41A 4R5PB 2OPPA 5EWFA 3L2WA 3QIOA 2OPSA 3KLIA 2Q3SA 4N41A 4KTQA 3LP2A 5SZTA 5KT2A 3AVHA 3D0PA 3H98A 4ZTFA 4CHNA 1ASUA 5DG8A 3DRRA 4JV0A 4KHNA 3WNFA 4IG3B 5KFNA 3IS9A 2ASDA 1B9FA 3RMAA 4FJ9A 4WE1A 4X2BA 3QESA 4TY9A 4ID1A 2XO7A 3MFIA 3T5HA 3THVA 3RRHA 3HO1A 2VG7A 1I39A 2FVPA 3DRSA 2PYLA 3OL9A 2B43A 2RDJA 3CO9A 2OPRB 2BRKA 1TL1B 4DU1A 1SL2A 4HHTA 3I5AA 1DLOB 4DTNA 1MU2A 4CGJA 4FZXC 1EP4A 3AA2A 1VRUB 4EBCA 2V9WA 3G86A 1HMVA 5HROA 2QKKA 1RTJA 2Z1GA 4R0EA 1D0EA 1LW2B 1TKTB 4CFDA 1VSMA 4W5QA 3V1RA 2RN2A 4RG8A 4B9VA 3QZ8A 3LP0A 4LH5A 2C2DA 4H4OA 4FXDA 3RMBA 4ZVHA 4I7FA 4JLHA 4DL3A 3I0SA 3SNNA 3KMSA 4E1NA 1HPZA 3JSMA 3RR8A 3L2VA 4Z4GA 2IS3A 3BQ2A 3QO9B 4CF9A 4ECWA 2E9ZA 2R7YA 1LWCB 5I42A 3GV8B 1T94A 4I9QA 2XRIA 3RB3A 3GILA 3KHHA 3VA3A 1TK0A 3LP1B 4AH9A 2R8KA 3PW2A 4H8KA 1LWEB 2G8FA 1CXQA 1T03A 3KLVA 4PA1A 4F4WA 5L1KA 1JLAA 3K5NA 3MR2A 3KK3A 5L1IA 2OPPB 4Z0UA 2OPSB 1GOCA 5JS2A 2HNYA 2HW3A 4RNHA 1HYSA 1HNIA 4WXOA 4J9PA 2GIRA 5HBMB 2W9CA 3IS9B 1VSJA 2OZMA 2R8GA 2HNDB 4KV8B 4KREA 1UA1A 4NZ0A 4FK0A 3OYHA 3OYMA 1NK9A 3AVKA 3ZSVA 4FJKA 1C1AA 3LWMA 4F4YA 4CK1A 4AHVA 4O3QA 3K2PA 2WTFA 1QHTA 4DQQA 1RT1B 2BDPA 2PY5A 4KHRA 3NDKA 4L8RB 1NJXA 3BSCA 2JC0A 1QSLA 5KFLA 5J2NA 1YVUA 4Q8EA 1BISA 2G8IA 3P1GA 4YR3A 4ED2A 1CSJA 2AQ4A 2R8JA 3HM9A 5FRMA 5FRNA 4Y1DA 3AO1A 2UVVA 3LPTA 4FLVA 1QTMA 1T3NA 3JSMB 3PR4A 1S6QA 3L3UA 4CEZA 4KHQA 1S1WA 3DOKB 3CJ4A 3VQ9A 3I0RB 3ZSRA 4NRTA 1RT6B 2YNFB 5I42B 3KMQA 2FBXA 4IRCA 3QIPB 4URSA 4FZYA 4LQ3A 4ZP6A 1L3VA 4FLTA 4M41A 1SKRA 3OS2A 1FK9B 4ED3A 4E3SA 4E0DA 2D0AA 1RBTA 2WCXA 4MQ3A 5KRSA 1GX5A 4ID5A 3F9KA 1BGXT 3B6OA 3CJ0A 1VSHA 3KK3B 1NKBA 4ELTA 3CFOA 1JL1A 3LZIA 2YNIA 1UWBA 1RBRA 1C6VA 4M3RA 1N5YA 3TAMA 2DFFA 1KLMB 2I5JB 2YKMA 3V1OA 4ED8A 1OS5A 3BREA 1CLQA 4E7LA 1RA6A 3KLGA 2KZMA 2QV6A 3O3HA 4CJ4A 3PJXA 1S49A 3HJFA 4KKOA 3HPGA 3MR5A 1VSEA 3IN5A 2D5RA 1BHLA 1S9GB 4M3YA 3NFAA 4FJXA 2W7OA 3M8QA 3KD1E 4O3OA 4DG1B 3QEVA 2ITGA 2XGQA 3DOLA 4CJ3A 4WFZA 3PW7A 1S0OA 2F8TA 1TL3A 3HPHA 3MECA 1NK0A 3C6UB 3NHGA 4KAZA 3DRPB 1U48A 5KFTA 3MEDA 1JLFB 2XHBA 3HXMA 2G8VA 2D7SA 3OL7A 3DI6A 2FLLA 3DYAB 2C22A 1IO2A 4EZ9A 4NLQA 4ZVFA 2HNZA 1U49A 4JV2A 5JXSA 5KFFA 2FLNA 3S3MA 4FJ7A 2F8SA 5J1EB 3LPUA 4ZP8A 2RF2B 2AX0A 3KHRA 3WNEA 1SUQA 3T19A 1T05B 4HCBA 3U3YA 1RT5A 2E6MA 3NMAA 1SKWA 3V4IA 3TAFA 1J9AA 4FJJA 4Z4CA 3DDKA 4B08A 2HHXA 4NYZA 2D0CA 4LQ9A 4LD0A 3S9HA 4IKFA 3HP9A 4QCLA 1C0UA 4TY8B 3KTQA 1D1UA 1NHUA 4WZQA 5KFAA 3DM2B 3FRZA 2JEFA 4IFYB 3BQ1A 3OVNA 3OLBA 5HLFA 3AVCA 2G8UA 4BE1A 4ZHRB 1S9EA 1RT3B 3HKWA 2JEIA 1XR5A 3CWJA 4IR9A 3FFIA 3RBDA 1GOAA 1WSEA 3OYIA 3SJJA 4JRPA 4RNNA 3ISNC 2W9BA 4M3TA 4CEQA 1WSFA 4DL5A 2P1JA 3DLEA 3K5LA 2YNGB 1FKOA 3DLKA 4ECZA 4Q44A 4CHYA 1BIUA 1HJRA 4DTMA 4Z4HA 4NLVA 3KHLA 4KFBA 4Y3CA 4NLDA 3AA3A 3Q8QB 2IGIA 3OL6A 1KHVA 1Q9XA 4WFXA 4F8RA 2FVRA 4O0IA 3DOLB 2A1RA 4MFBB 5KT7A 2QKBA 1BI4A 3I5BA 5C42B 2Z1IA 3MECB 2V4QA 1U4BA 2YNHA 4B3OA 1YVFA 1S5JA 4KHSA 1F21A 4OLAA 4O4RA 3SPZA 4Q0BA 4OL8A 3SUQA 2X6SA 1NOZA 3MXIA 3O4NA 2HNZB 1LAVA 1NKEA 4QWBA 4H4MA
chains in the Genus database with same CATH superfamily
1EX4A 3OTCA 5T14A 4ZDNA 1CJUB 4KAIA 2O8CA 4QOZB 1VSLA 4O4GA 4IG0B 2HB5A 4C8YA 3T5KA 4BWMA 1WI8A 4CHZA 4YB7A 4Y2CA 1NDCA 4IYQA 2RE1A 3PCOB 4DLGA 4LJMA 1Y3KA 3CC2S 3VQQA 1T9WA 1REVA 2W8LA 3MTKA 2XY5A 4A2BA 4DUZK 4QYZJ 3QBXA 3MN9A 1GMVA 2B5JA 2Q0RA 1Z6RA 2Q79A 1YJ9N 1RT2A 3H1QA 3ILLA 2Y1LB 4DSLA 3NF6A 3NWRA 1VLYA 3H08A 3DLEB 2W2OP 1LV5A 1IKWB 1LWFB 3DKDA 4M45A 3KLEB 4KFBB 1KAXA 3NWGA 4HDGA 4BACA 5AE1A 2JX2A 1BWVA 4LFAJ 3H40A 3ZSWA 2R7XA 4DV4K 1W7AA 3KLHA 3H42A 1FVSA 1DURA 4MDAA 3D7SB 1UPPA 3KFWX 4O23A 4CJEA 1YJWN 5GAHI 4RU2A 4DS4A 3S1TA 3MURP 1N5SA 3PW4A 3U02A 2UXDK 3ZZRA 3EJMA 4RW6B 4F4XA 5I9EB 3LW5C 4CTAA 3N01A 3Q7BA 3DNCA 3J81U 1RYSA 2VBXA 1RDCA 2CQ3A 1NHKL 1BXNA 4Q7AA 4A47A 1NNEA 3TAPA 1YK9A 2KT2A 1S1XB 2XCAA 3ZT3A 3LALA 5ETKA 1U45A 4O4GB 1RI7A 3KJQB 2JWKA 4QAGA 3ZT2A 3R8EA 3BDEA 4NLXA 4F0HA 4A8YA 4X4TA 4FWSA 4IJNA 5FDLB 3NS5A 3CFPA 1Q8BA 4RJVA 2QA1A 4USJC 1R27B 1YZ6A 3M9MB 3ZSXA 3OYJA 5GIPA 2C3UA 4L3QA 1JIHA 4JI8K 4QBUA 3WIUA 4A8OA 5DLGA 1YG0A 4K4UA 3A3OB 4ZVSB 2VG5B 1RT2B 1I3OB 2XLJA 3PZPA 2F1FA 3VQPA 1Z4UA 3DLGA 4O44B 1KOOA 2XYPB 5EX3A 3K8VA 4G65A 1MMLA 3TP2A 2XULA 5GAEP 4WFYA 1RTDA 4PWUA 4HACB 2P9LA 1OH7A 3MCOA 4H4KA 1LW0B 1MNEA 2J5AA 2L9NA 2Z56B 4BCAA 5CYMA 2YQ3A 2CXEA 2J9EA 4DQIA 1R0AB 3NE6A 2IJNA 1UVIA 3MEKA 2FJAB 1HNZF 5D4LA 3KNGA 1WI6A 5FLXU 3Q8YA 1OY8A 2XMVA 1SBRA 2W9AA 3CJ9A 3EVWA 2ZDPA 3VAGA 1VQPN 3NVKA 2ZOFA 4RW7B 2FZCB 4ZVOB 2HG4A 4CVNE 3G8TA 4JRQA 3RBEA 3RG6A 5L1JA 4IZ9A 5F3TA 4FLYA 4QU6A 1N0UA 1Q7YO 1TKZA 1T95A 1Q8KA 5DQIA 3FBCA 2CKWA 4HDHA 1UWAA 1HWLA 4FK2A 1XNQK 2HHVA 4YY3J 1H2VZ 5GAHU 4IFEA 3QGHA 4DPTA 1Q8LA 1YJ9S 3MCAB 2IMWP 1KP6A 2G4BA 4GV3A 1S77D 2IM3A 1PAUB 4YB5A 3GONA 3OVBA 4C11B 2J6SA 5AXNA 4B9MA 3MUTP 4CJLA 5F8GA 1MU2B 4MK9A 2P9LB 2JRSA 3LWLA 1Y00A 4PL8A 1HMVB 4FPAA 1XMQF 1RTJB 4OPAA 1U1RA 3WZ0A 3EXYA 2R7QA 3GYXB 1NBWA 3L2RA 3HSZA 1RWMB 2FHJD 3KUHA 4CO4A 2G2OA 1YJWS 2CJ9A 3A3NB 5AZIB 2A5XA 4I7FB 5MLCQ 4BBYA 5DZ6A 3VVTA 2L41A 1BQMA 3VQEA 3TA2A 4DR3J 4BE0A 2F96A 3J80U 2QYCA 1UVKA 2HKEA 5KFIA 2KG1A 4BRPA 1OWXA 2CGLA 2C2EA 4GV9A 5HMYA 5GAEI 2A1BA 1WSVA 1SQGA 4CCHA 2AEMA 1AROP 3CD7A 4DV1F 4FBUA 4DUZJ 2WVEA 4RO0A 1ZM2A 4FM1A 3VQ8A 1U25A 4KT0C 3TJ9A 3SAHA 5JS1A 1NLKL 3WBZA 3SDEB 3NKYA 3RVCA 5FPDA 1TKZB 2MJUA 3CO0P 5HRSA 2PMHA 5KG1A 3VGKA 2MGZB 3NGIA 2V52B 4QR2A 3SAFA 4DR6K 2F4VF 1TUVA 4O3PA 3M2UB 3ASMA 1SI9A 3W5XA 1N36F 1UFLA 4DV4J 3EUNA 2YKQA 3N5BA 4BE2A 3QFUA 4FM0A 4MKAA 1PJ7A 5E2QA 1XJWB 3HI9A 3VTIA 3I56N 4ZLNA 2JEJA 2WRMA 4OJRA 2UXDJ 3ZSOA 3O8MA 4WTYA 2K1RB 1VJQA 2BJ9A 3RJMB 4R8UA 5J2NB 4GKKK 5AQLA 3QJPA 3UO0A 3P83D 3TWZA 2PMWA 3V6HA 3ZEUB 4V1Ak 3TX0A 3ZZUA 2HHTA 2GCFA 2NLWA 4LF5K 3GE9A 2VBYA 3HSDA 4J9VA 3C7NA 4FWLA 5JMNA 2PE8A 4K4TA 2FF3B 4X62K 1RCHA 1TU0B 4OYBA 5MLCV 3PYFA 5JJBA 4U7UD 4ECXA 2FF6A 2VGMA 4I6MA 2IM0A 1T9TA 2CZVC 4BR9A 2Z1HA 1HBOA 4IEIA 4U67Q 3HHLD 3VGVA 4JI8J 3G96A 5C25A 1RDDA 4UOGA 2ZZTA 1U04A 5KFRA 4IBNA 4EWTA 4DCHA 1QDUB 2DXEA 3KWMA 4O3RA 3K9JA 4DKWA 1N0VC 2J4RA 1N5YB 3BEXA 1OYDA 2O8FB 3J7ZO 3RAXA 4CLYA 3MR3A 1WEXA 1EAYC 2MSTA 2VYPA 5J2MA 4JI0J 2MY8A 2RPIA 3JAMY 3CCES 3VESA 4JV5F 1DFDA 1YIJS 1EARA 2C2NA 3SSSA 3OHBA 4CZIA 3LPEA 1WSHA 3AXKA 4M42A 4UQGA 1X4EA 1I94K 2FJXA 3SQGB 4JKEA 1CPZA 2UUBF 3DLLQ 4WYBA 4CGIA 3M8QB 5LOQA 3TTDA 1BCOA 3ZX2A 3JSBA 3ATVA 2AU0A 4AHCA 5JVHQ 3N5FA 3OW2M 1C0FA 3MEDB 3RAQA 1ULRA 3DI6B 2HFZA 5F0XA 5B09A 2R2TA 2ILZA 1HBUB 4ZLLA 3HHLB 2UVUA 1Y11A 4FWKA 1KEKA 3A4TA 2ZVSA 2DXDA 1ILYA 3V4IB 5LL6d 5AQVA 4ATNA 2DNNA 4ZK7M 4F2RA 3V9XA 2DEIA 1MMNA 4DR4J 2KQ2A 2DH7A 3NRBA 1OVQA 2LYVA 2QLFB 2ZH8A 4KSEB 4FL9A 4ZMMA 4E2FB 5EU7A 1OKJA 3Q2TC 3N4PA 2XCPA 2KZZA 4JD2A 1XNQJ 1RAOA 3LDLA 1X5OA 3UDCA 1U0HA 5A6WA 2E1PA 5HLFB 3P4UB 4KH4A 2OEMA 1T9YA 1RACB 4QQBA 3WXLA 2J0WA 1EO1A 2W9BB 1VQ9S 3BY5A 3PFOA 2O4GA 4OZNA 2XZTB 1FKOB 3DLKB 2YPZA 4P10A 2X51A 3NAEA 3CC7S 3AVJA 5AQPA 2E1CA 1RDRA 3K59A 3ILJA 1QLNA 2NXUA 3LZJA 3OJUA 4X64F 4B9SA 3IBCB 4EU0A 1RJJA 1K1QA 1QVFM 2LXUA 3OYEA 3I82A 2NXEA 3J81O 4L73A 4JB8B 1R43A 3CJKA 2LP4A 4ANEA 3ZZYA 3ZSYA 4B3OB 2Z1JA 2O8BB 4Q0BB 2GNKA 3MPUB 5BYSA 3M6GA 2B4OA 1LW2A 2AF6A 4EBEA 3TWHA 1D8ZA 3ILIA 2FJBB 1MLAA 2JWNA 3H3OB 3FDSA 3AA5X 2KYZA 3UCUP 2R2RA 2ZJRL 3SCKE 3FEYB 3QO9A 4EBDA 3KG1A 3I33A 4J91A 1YJTA 1KC8T 5LMNJ 4V19X 2CPEA 4RZRA 3O8WA 1CZAN 4WFNQ 1T9VA 1SXLA 2MJNA 4CJFA 4BS2A 4X4UA 2QFJA 1RCOB 3THXA 2HHPA 1P1TA 2ALYB 1VQ5S 2N82B 1U0HB 4DR6J 2W8KA 1X60A 2HS3A 1Q0NA 3H8YA 4RNFA 2ZH3A 5KFSA 4P72A 1RGIA 4EZ6A 2HMIB 5D3GB 1XHXA 4PUOB 4TLQA 4AL5A 3H45C 5E0OA 4PXEA 4DPWA 4C6AA 5HBMA 1RHQB 4OYOA 1IBMK 3O5TB 4O3SA 2DR8A 6FDRA 3GFZA 1RK8A 4JI3J 4LFAF 2HNDA 4J9KA 3T1AA 4NYNA 1KAYA 3D6FB 1NK7A 3IDHA 2IBKA 2L08A 3OY9A 5FLXO 5DO2A 2DJWA 3OTDA 4KGMA 4CIFA 1D9AA 3R5BA 2E88A 4F26A 3O9UA 3UNGC 1FE4A 3GIIA 5AQKA 3TX8A 4FJHA 3MM5A 4KI4A 4LF6K 4LF5J 3CFRA 4CLLA 4JKHA 2ASLA 3HSTB 5ITHA 2B4JA 2YH0A 3P8BB 3LPYA 1C0GA 1I6JA 4E1MA 3CJ5A 1VLOA 3M8PB 5BR8F 4N8OA 3P3DA 3TJ8A 4KTZA 2BVZA 3PO4A 4E19A 4YMEA 2HQFA 3A3PB 4WF9Q 4NA3A 1SCJB 4ELUA 3E01B 1H1VA 4P2FA 1GH8A 5FPMA 2P9CA 1RT6A 5CZ1A 4IOCL 3Q8VA 1YJNN 3D4JA 3NXZA 1HWIA 3CD6N 5J2PB 1GXUA 4F3QA 4RNOA 2QWQA 1N56A 1JLEB 4M95A 2B8QA 4RWWA 2X1AA 1LK5A 4TYAA 2JGUA 3B4DA 2YKNB 2YWHA 5HRPA 3MWBA 5HRRA 1WD6A 3U3GA 2VHGA 1HBNA 3TAEA 1E6VA 1I94J 1U09A 3Q8UA 3E51A 1BA0A 3EGNA 2PEHA 2YH1A 1KLMA 2E2QA 1JLGB 4ZPTR 4CLUA 3K89A 1W97L 4J2DA 2GQCA 4DUTA 1XR6A 4IRKA 4IQMA 1G3OA 3CM5A 1M5VC 4C23A 3GR1A 3I55N 3FZ2A 2B9EA 4HUEA 4NLBA 3OYLA 4NI2A 1FRJA 4A8SA 1RU1A 2GVDA 5HVFA 3QRQA 3HSCA 5CCLA 4X4SA 3MM5B 3K5PA 1Q8IA 1AFIA 3GCXP 5C10A 4K25A 1RXOB 4UZCA 4QWDA 3JSYA 2WVDA 2QWNA 1GLEG 4GVBA 2V7ZA 1WHWA 4GKJK 4RX6A 4I68A 4A5BA 3DYAA 4OYMA 1K73T 3M6WA 4BWJA 3NNCA 3NLCA 4JI6K 4CJVA 3GB0A 1OY9A 1EKRA 3CNQP 4PG5A 5JLFA 5HP1B 1T05A 4BRKA 2MKCA 4XPCA 2X1GA 2W6KA 5CQGA 3L4QA 1L5UA 1ZZNA 2VOOA 4BRLA 3MXHP 3SK3A 2H3EB 4LSLA 5HOOA 2ADBA 2EK6A 1HW8A 2EFQA 2NRRA 2LU1A 3VQ6A 5DG7A 4C8KA 4YY3F 1SH3A 1KHWA 3U1MA 2H5JB 3DM2A 1DJ0A 4K50A 3MUVP 2HWTA 1NG9A 4Q45A 4OJ1A 4LSNB 4ED1A 1JCFA 4ZHRA 1RT3A 5AQOA 1FXDA 5F8LA 3IAS9 5ADXA 4IO1A 2WHOA 3OHRA 1V9OA 4OLBA 4CZEA 2GIFA 5C2CA 1IXKA 1ZC6A 2YNGA 4ED7A 4XTTA 3JTPA 3ENBA 2YI1A 3NF8A 3ZTOA 3TA1A 4WCEQ 1BU6O 4G3IA 1FE0A 3NS6A 4OKKA 2XG8A 2WUSA 5CD4H 2DCUB 4CO1A 5F0UA 2OEJA 3D1HA 1UP1A 4LRFA 1W2BM 3MPDA 3SQ4A 4M8LA 4DR3F 5C42A 4QPTA 3FC9A 3O3FA 4GVBB 3MDQA 2VH7A 2MQQA 4HVJA 3PY8A 5TKYA 3UDVA 3W2VB 3AOCA 4C8NA 2J8SA 2M9KA 3PKMA 3CQYA 1UL3A 2LXIA 2EKNA 4DUZF 5F8NA 4HTLA 1FNOA 2GX8A 2H51B 2E7XA 3P5TL 1S57A 2QL9B 4KH6A 3S7RA 4DEZA 3UW1A 4P2MA 3BO2A 4IDKA 4LSLB 3GIMA 2XS5A 1KQSM 2QL5B 4QIGA 1YBUA 2ZH4A 4EHTA 1IBMJ 1MWQA 4MK7A 4NLYA 5K14A 4I2PB 3BGRA 4DV4F 3VEVA 1UW9A 4QW8A 1VHXA 4KBOA 3TU5A 1YI2N 3EZ5A 2AGOA 4B1VA 5KG2A 2RH3A 3PRBA 1JLQA 2XBPA 1F9FA 4IH7A 3QFPA 3I9V9 3MN7A 5L38A 2VC0A 1SQKA 4OHYA 1LFPA 4LF6J 1S1UA 1RHRB 1T3VA 1CXUA 1R59O 1VSKA 1NGFA 3PEJA 2M52A 4FS2A 1DTQA 1U6FA 4C7QA 2KFNA 3UVJA 2AWZA 2XWYA 1HBMB 3CM6A 4JK9A 1GXLA 3I8DA 4CRJA 3SV4A 4CEEA 4F0MA 4J7CA 2W41A 2X7IA 5KGXA 1IJEB 4LY7A 1RT7B 2ZH5A 4CGHA 3TA0A 5KFKA 3OTEA 1IKVB 1F9HA 4B3SF 4NLCA 2K7JA 3NCPA 4UF4A 3UDEA 3HZGA 4JI8F 4C97A 4YHHJ 3CJBA 1NSQA 3O44A 2WZ1A 4M5HA 5BN9A 3O2IA 1DAXA 4ECUA 3DOMB 3M30B 3IG1B 5H9FK 5AQMA 5B0CA 2HBQB 3TQ1A 4QIWD 1PILA 2QSWA 4Y2IA 4RL1A 3NOGA 4B1UB 1V5VA 4GC6A 2KVQE 3HX9A 4JI0F 2DB1A 1JJ2M 1WDDA 1M1KO 3J8AA 3EYZA 4GVLA 1X9WA 5IT0A 3A8KA 3NGZA 1U2FA 1Q7YT 4PWWA 4CEFA 4P7TA 3EXCX 3N6MA 3JB9k 4IH6A 1XC3A 4PXDA 1ACMB 3G6YA 3AGKA 3WT0A 4FJ8A 3OV7A 1KOHA 3MEEB 2BMBA 5I3UA 2HBKA 1LEOA 3ZETB 2CQIA 5LMUK 3Q8PB 3IFRA 3CJRA 5C24B 3OA9A 2IVOA 5DQGA 4K2JA 4ZCIA 1MN7A 1FRHA 4QOTA 2VFSA 2VBZA 4KTWA 4AUKA 4JI6J 5AR0A 2VOPA 3PRVA 5ETLA 2O5DA 3MD3A 1RWVB 2E1ZA 4F04B 2BM1A 5LJWA 1G1XA 1OSDA 4DR4F 4OX9J 2RT3A 4KC5A 4ZIVA 3HMJG 1Q9YA 1J2VA 2AYMA 3C95A 2IM2A 4TVAB 4DS5A 4X66K 2IHR1 1XNQF 2HQCA 4RBUA 1DQ8A 5DLFA 4A8MP 1KVBA 2XNQA 3THWB 4Z7YA 4DF8A 2QIFA 2G1HA 3R5DA 5GVQA 1HQEB 2DHAA 2QA2A 5AQJA 4YOUA 3HVRA 1FDNA 4DQSA 3KLFA 3CUNA 4NXMK 4HWIA 2FIUA 2YY3A 4R5PB 4K5RA 2OPPA 3L2WA 2OPSA 3KLIA 2Q3SA 2GUPA 1Q82O 3ENAA 5SZTA 5KT2A 4CJ7A 1ZXOA 1UCNA 4OI6A 1F2HA 4NOHA 4WIIA 3DRRA 2J9DA 1PBUA 3AB2B 3UD4P 4ALZA 2UUAK 2NREA 1P1LA 4KIAA 4ID1A 3WEEB 1AUDA 3CMEN 1TUWA 4C0OC 1N52B 3HO1A 2VG7A 1YF5L 1I39A 2FVPA 2P9KB 1JWWA 2AMCB 2B3TB 3CHWA 1HD1A 3QAEA 4HHTA 3Q7CA 3PYDA 3QB0A 1WKKA 3A1YG 2BW2A 1EP4A 2RQCA 4EBCA 3G86A 1P9YA 3GG4A 3TZXA 5H1SQ 3POTB 5GMDA 4H4OA 4ZKAA 3ZTSA 2J76E 4ZVHA 2RHSB 2RU3A 4E1NA 5AXLA 2XYHB 5A8WA 5LMNF 5CZXA 3LM9A 3L2VA 2IMOA 5BPLA 2RB7A 3CB4A 4ECWA 4EK2A 4I9QA 2NRTA 4P7VA 1TK0A 3VERA 4AH9A 3TSQA 3MM9B 4X84A 4H8KA 2BH1A 4DL0C 1HR0K 1RUSA 3ID8A 1R6VA 2ZH6A 1T03A 3GJQB 3KLVA 5L1KA 3KK3A 3QQCD 1YJUA 3MI7X 5L1IA 2OPPB 1IWAA 2OPSB 2OTLS 1GOCA 5E3CA 4U67L 4JI3F 5ELZA 1S7HA 2DR7A 4ZLPA 4X65K 3MAAA 2VPZB 4KREA 3QT7A 3VR1A 1NMEB 1UA1A 4OPHA 4FK0A 2M70A 3OYMA 3CCVN 2FY1A 5AQFA 3C19A 2XSJA 4WBFA 5DS7A 3S41A 3TVZA 3FKBA 1C1AA 3LWMA 3I6PA 2B4UA 4CK1A 4O3QA 3K2PA 2WTFA 1QHTA 4LF5F 1RT1B 1NGIA 2PY5A 2E7WA 3D3BJ 3NDKA 3VQTA 3W7BA 4M1KA 2B56A 2F3JA 5KFLA 4YDDB 4BREA 1OIAA 4IJAA 3C66A 2ATCB 4M63C 1YZ7A 4DPYA 3PIOQ 2G8IA 2NRXA 4PXCA 3DLLL 4CBXA 2J9DE 3R27A 2CRLA 5GADU 3CJTA 5FRMA 5HSPA 5EOYA 2MQNA 2MLYA 2QWLA 4Y1DA 2Y8WA 1WG5A 3B8HA 4GY2B 3LPTA 4FLVA 5JVHL 4JI4K 1S6QA 3L3UA 4OHXA 5BRDA 4BC2A 2YXLA 3I0RB 3ZSRA 4NRTA 5H1SV 1S72S 3VV2B 1VQNN 1B70B 3BGLA 1L3VA 2QEXN 1FD2A 4M41A 2DRAA 3OS2A 4PRFA 4E3SA 1VOMA 4E0DA 2D0AA 1YKWA 4DV3K 3ZFVA 1Y0HA 1FFGB 1I94F 1GX5A 4C1NK 3VEZA 2KXHA 3FNNA 3GZ7A 3F9KA 1BGXT 2HFUA 3B6OA 1VQON 3KK3B 4MLEA 1FX4A 2QA4S 4M3RA 2HEKA 4R0JA 3UN5A 5H9EK 1YGYA 2DFFA 2YKMA 3BREA 4FYXB 2H48B 2BOAA 4MDBA 4YOXA 1VQMN 4Z37A 4NA2A 4CYUB 1S7IA 2JWLA 1RA6A 2Q0UA 3KLGA 3FZHA 5LJVA 1XQIA 2KZMA 3OUYB 2QV6A 1YHQN 3UKUB 5LMUJ 3E9LA 1IBKK 3PJXA 1S49A 3CCSS 3HJFA 1P8GA 2Y0BB 3IN5A 1TMMA 2D5RA 1S9GB 2H65B 1DARA 4DBQA 4FPRA 3MWPA 4FJXA 3DXSX 3KD1E 2H9ZA 3CCJS 3ONQA 2B7CB 2KM8C 1EQMA 1HI0P 2XGQA 4WFZA 1NZ8A 2R7WA 2JZ5A 2CPFA 2CZ4A 3CJQA 3WXIA 2B9YA 3C6UB 2CDRB 4RBVA 4X4OA 3DRPB 4M5DA 1GK8A 3IMQJ 5KFTA 1JLFB 2XHBA 3HXMA 3PYEA 4ZJOA 3VMFB 4OJGA 5IT9Y 4DV2K 4X4QA 4QIFA 2HF3A 2C22A 1X4CA 4ZVFA 5JXSA 3S3MA 2FLNA 5F41A 3VEOA 2WC9A 2F8SA 1B0PA 1JCGA 2E5LJ 3UD3P 2KG0A 3T19A 4TNOA 2LA6A 4DX7A 2E6MA 3NMAA 1HHSA 4NXMJ 3EGZA 3R97A 2EW9A 2JSXA 5D78A 2KHDA 4OLPA 4NYZA 1SPBP 2D0CA 4LQ9A 3HHEA 4LD0A 2KLAA 3T6BA 2MTLA 2P9GA 3MCSA 4BRDA 5EN1A 4QCLA 3CEDA 4TY8B 1D1UA 1NHUA 4RKUC 2AZ3A 1S3XA 3FBBA 3OTOK 3MCPA 2UUAJ 4J9UE 3AVCA 2G8UA 4ILLA 1ZAVA 3ET6A 4WFNL 3CERA 3GSIA 1VS3A 1NGGA 1X4DA 3SJJA 1N8RO 3ISNC 4DV6K 3HM8A 2V8HA 3GSDA 1WSFA 3A8IA 3K5LA 5HMZA 4CNZA 1AZSB 1T44A 4NLVA 3GMGA 5AXMA 3AA3A 3G6ES 1VQLS 2P9SA 3EMTA 1KONA 4OYPA 2PO4A 2VU5A 1O5JA 3AOAA 4A8FA 2FVRA 3OPKA 5GAGU 4MFBB 3RBXA 4DHYA 1BI4A 3I5BA 3UE5A 1N34K 4LF9K 1I51B 2QX0A 2J9CA 3FSXA 1NXIA 2KJVA 2MEWA 2YNHA 1HQ2A 4QIEA 1NDKA 4WQ5A 3NMUA 4O4RA 3SPZA 4NWBA 4DV5J 3SUQA 3LUYA 1VI7A 2HHHF 3MXIA 3BB5A 5G4DA 2ZOGA 1NKEA 4FPBA 1HR0J 3KJVA 1HNVB 2KDOA 4OGCA 1A9NB 4B3MK 4WQ4A 2ZWHA 4CM2A 3DLBA 4QJVA 3MMBA 5F8JA 3D0IE 4NB4A 4UOCA 1VQ4S 2DNHA 2AGQA 3FGUA 1S1TB 3M05A 2HVZA 1WSIA 1YJ7A 1IBMF 3KDOA 2BJEA 2BR0A 4AM6A 2AYBA 4WF9L 4CJUA 2VWKA 4JNEA 2D3O1 1L3TA 2DHGA 4X65J 2ZC3A 2BW7A 4FF4A 3WQTA 3ADAC 1KR4A 3VWSA 4K4VA 1QQCA 4DV0K 1AXQA 1RILA 2H54B 3CF5Q 2ATLA 4GNIA 5ETVA 2ZM6F 2KT3A 4LF6F 2VA2A 3RSEB 3O6QA 1KN6A 3V6DB 1BDGA 2OD6A 4DR2K 1NB7A 3SMSA 1BHNA 2E5IA 2DY4A 5FJ4A 4A8KA 4XEIA 3LGHA 2ZC4A 3I4PA 2XI3A 3P5JA 4EFHA 3LP3A 2RRAA 2Q43A 5AQGA 2FY8A 2YWEA 3IGNA 1P8ZA 5JUMA 3C46A 2VQFF 4GRSA 2KH9A 4OVLA 2V69A 4IKAA 4Y2AA 3LDPA 4JI4J 4XO0A 5IC6B 4RUCA 2R2SA 2ASOA 2Q6BA 2JNJA 2CVIA 1K9MO 4YHHF 2HZAA 1GAOA 3H20A 5A8KB 3HFVA 3PTWA 3ITHA 1H38A 1RAFB 4DV3J 2DIVA 1JKHA 3L09A 4KE5A 3QGPA 3SQ1A 3FEXB 4DR7J 5H9EJ 2PT0A 2FC9A 1C0TB 1R7IA 2PN6A 4CE9A 2UV8A 3MPVA 3KG0A 2QFIA 3OL8A 1HNWJ 3QEWA 3KK2B 1U1KA 2NS1B 3T3FA 3PO5A 4A48A 2X74A 3EKSA 2CVEA 4NZ6A 4QS8A 3H5XA 1HYZA 2CH6A 2D0BA 4NCGB 4PAAA 3ILOA 1FKPA 4AF1A 3CCQN 4CZCA 2J7WA 5BPMA 2P9NB 1ZBTA 1NDPA 1U1NA 5T7BA 4FLXA 4OGEA 2RDIA 4FOIA 2CIMA 4JI6F 2AW0A 3C94A 1MWYA 4ZJQA 2FXUA 1CJKA 4YUDA 5KPZA 4LREA 4LFBK 4OX9F 2HHSA 4WCEL 3IKMA 4HR2A 7AT1B 4K8ZA 2C2KB 4OX6A 1TUGB 1URNA 3CCRN 1Q5YA 4X4RA 1RBOB 2V2KA 4UTGA 1IH7A 2HHUA 3FCVA 2LKZA 2WBNA 3OLAA 3RB0A 2AD9A 3V81A 4OO1J 4OFZA 4CECA 3EWGA 3K8WA 3RTVA 1FWPA 1XQSC 1S97A 5DQHA 5K8MA 2E66A 3OTOJ 1WN7A 3K9KA 1Q86T 5IXUA 2BQRA 4G1PA 3GR0A 3AT1B 4J2EA 2LVWA 4DOZA 2YQ1A 1RDBA 2P6TA 4ETZA 2N4DA 2DKOB 4QYRA 1BWFO 1RLDA 3FUYA 2CAJA 4DV6J 4BC9A 4XAKA 2R8HA 5KRTA 3LP2B 1VC5A 3NF7A 1KSPA 1Q81O 2HWHA 1UOCA 2W7PA 1S9FA 1PSDA 4WE1B 1PYTA 1YITS 2VONA 4LF8K 1M90O 1TK8A 3MMAB 3MF5A 1NMDA 2JVRA 3SUNA 4YDUC 4AHSA 2QMXA 4A62A 3DRSB 3T1YK 2VD3A 2D9PA 2NXCA 2D1KA 1FKPB 4LBHA 2XY6A 4HTIA 4LF9J 5G0RA 4YOYA 1FJGJ 2YX4A 5F8IA 2E4LA 2A2DA 3OW2R 4HKQA 4ICLA 3UQSA 2JVOA 1IQZA 2VV5A 4BRMA 5B0FA 4E7KA 1VBXA 5ETPA 3LDQA 4ILRA 3CCMS 4W90B 5HROB 1C4CA 3MK6A 3M1VA 1O1WA 1JNRB 1JB0C 4DTXA 5ETSA 2O8DA 3LP0B 3QNWB 2GW8A 5KFVA 1RTIA 1KVCA 2YHBA 1T7PA 4ED0A 1B7YB 2BX6A 4DZDA 3J7A1 4NYFA 2ZNYA 2HHWA 2F4FA 1JLCA 3M8ZA 1X3NA 3A5OC 1K1SA 3D45A 3BKUA 2QN6B 2RHQB 1NMNA 4AQYJ 4DFMA 1K0VA 4O55A 5THWA 1S6PA 3EZOA 5SUHA 2KRBA 1GLCG 4JAXA 4J9OA 3QZ7A 2HNYB 1HYSB 3RW7A 3AVAA 1RABB 2BJ1A 4M5GA 5E7OB 2ACMA 3AJDA 1X9JA 4FBTA 3HTVA 2W9CB 4DTUA 4F36A 3G6XA 3PRDA 1D8YA 2QK9A 3U1LA 3AVMA 4RUBA 2JEGA 4FP9A 1N48A 1FTRA 1WTBA 4IQXA 4JN4A 2A42A 4XDCA 3I5CA 4BDYA 3PX6A 3AAQA 3S3NA 3TARA 2KL8A 5KI6A 3J7Z5 1TL7B 4H0YB 3BV8A 3FMWA 3M9OB 2N3OA 1XMOF 4B8CA 5IM0A 1NGHA 1UZDA 1DBDA 1ASVA 2CNNB 2RAQA 2P9UB 2EXUA 2V8VA 2E9RX 4I69A 4CEBA 4M3ZA 1GNKA 1CQMA 2BANA 1HX1A 2L9WA 4DUYK 3MHYA 1TUYA 3HKZD 2Q1LA 3KJFB 1UJ5A 4YB1P 1S1WB 1RKIA 1CS4B 3CIZA 2Y1JA 1CBKA 3RWUA 1ZBSA 2W6LA 3O3GA 4A8QA 4J37A 3H90A 2UUWA 4MH8A 1J5OA 1VR6A 5IQ6A 3CQXA 4IFVA 3AHPA 5KFWA 3OHAA 1RT4A 3C15A 4YR0A 4ID5B 5M1KA 3P49B 3A5MC 1UWBB 2IC3A 1KXPA 1IKYA 4L6V3 3DGPB 2WBMA 5LMUF 2OSQA 4O5BA 4DTSA 4OZ1A 3UKRA 4RW9A 2M2BA 3W2WA 3QRRA 1YBAA 2EFNA 2GMHA 1K8KB 4OYAA 1IR0A 3PSIA 4FLUA 4FSVA 2W4CA 1KVIA 1RHUB 1DTTA 5IS2A 1OVYA 3KWIA 4RBTA 2NPIA 3HDSA 1VRTA 2C2ZB 1UJ4A 1ATNA 3TR5A 1WLJA 1Q95G 2B51A 2AZ1A 2B4PA 2FB0A 5ETTA 4B9NA 3IO1A 3ZTRA 5EX0A 2ALZA 3IXQA 1PCAA 4I6YA 1NJIO 3X1LB 2E5LF 1RA7A 2CQGA 2Y1RI 1Y7PA 2PSZA 2CPHA 3EZWA 2KTQA 4NXMF 3BR8A 2CNLB 2JFDA 2ERRA 1LKZA 5A0YA 3GDQA 1RT5B 2M88A 1RLCL 1VIXA 1V3SA 3ZX0A 1CJTB 3D66A 2CPXA 2ZWPA 4MIBA 1FXLA 5CY4A 5HATA 2WSEC 1VISA 1QQNA 3IR5B 1JXVA 4TXSA 1VHFA 5KG6A 2BE2A 1N33K 1WNSA 1C1CA 4FYWB 1NHVA 2FSJA 5KFGA 2ATQA 1N6QA 4LF8J 5M1PA 1A5WA 4DPOA 3F41A 1MROB 3T7ZA 1EWRA 2IC3B 4HUGA 3FE1A 4FW2A 4ED5A 3SQ2A 1X1PA 2ASYA 1HLWA 5HK4A 3MXMA 3TEHB 5KT4A 4YN3B 1TAQA 3G82B 1NK8A 4BR2A 4IG3A 2LXFA 1JXEA 2OSRA 2ZKUA 3EDQB 3GG0A 4BHQA 1FT8A 4N56A 2MKHA 3LDOA 4MLHA 3CDUA 3MM7A 4F4KA 3Q0AA 4CZKA 4Y34A 4DHVA 3AO3A 2G8KA 2FZKB 1DLOA 4DV5F 2DK2A 1UJ6A 3OBIA 4DLEA 1TQLA 1LK7A 2UUTA 4P71A 1U7LA 1QSSA 4FK4A 3H5UA 5C7PA 3H6EA 4CHOA 3NAHA 3OR1A 3TYTA 5C5JA 2FBYA 4XH5A 4NLSA 1HUXA 4FJLA 4Y6IA 1WG4A 3N0VA 2LEAA 1YTYA 4H4MB 3M8SA 3O1LA 4BRCA 3R5JB 5D4OA 1SS6A 5KFQA 5C2DA 5A0YB 4PR6A 3THTA 1FO1A 5IWAK 2JJ4D 2CQDA 2H5EA 3PIOL 3TUPA 1TKXB 3UCZP 1FJEB 2DVIA 3L4BC 4K4WA 4OZ5A 3G87A 4AL6A 1LWCA 3EVOA 4HVZA 4QS9A 4OMFG 5KG0A 2UU9K 2WFBA 4RR5A 5L1LA 2O8EA 1Y10A 4NMXA 4B3RK 5CXTA 2XY7A 4CIEA 4DJBA 4TU9A 2MZ1A 3CDEA 1BY9A 1FTCA 4DR5K 1QUVA 4RNMA 2XB2D 4E89A 5BRHA 1TV6B 1XBWA 4LRDA 3AODA 3EICA 4XH4A 2BBEA 4OZ0A 3MR6A 1PGZA 2J0QD 2OANA 4H5WA 4KV8A 4AT1B 1U8SA 3DLRA 4ZPWR 1U24A 5J2QB 3GIKA 1V3ZA 4M5IA 3G4SS 5AZJA 3QATA 5HRNA 4W98A 2ADCA 5BXIA 3ZZOA 2ZBPA 2RQ4A 3AA9A 2G2YA 4DUYJ 1WUAA 3FLCO 2BJ3A 3L3VA 2CNKB 4ZTJA 3E3XA 2VBWA 4WXWA 4A59A 3RZAA 3O9QA 1P9QC 1RE1B 1DT9A 2W2QP 1Q1KA 3N6NA 4DV3F 2IAJB 2CJBA 4P2XA 3RGIA 5KFYA 4PWDB 3CJ8A 1WB9A 2XMTA 4Q8FA 4NE9C 4DV7F 5KOWA 4FWMA 3EN9A 4CEOA 4DR7F 2A18A 3WX4A 2COLA 1FRKA 5JICA 1BQNB 3DRXA 3DOKA 3UDLA 2QWMA 3K5MA 3QIPA 3FCHA 1KQSR 2RDDA 4JEPA 1F6TA 3HULA 3RU0A 1OH6A 4X4NA 4FLZA 3O4WA 1HNWF 2PGCA 4K8RA 2XI2A 1MDUB 3PIPL 3M8RA 5IV4A 1SJ3P 3OS0A 3CGIA 1S12A 2F40A 1NGJA 3GV5B 1LCUA 1N5VA 2PFUA 4FJNA 1KNZA 2EPIA 3D2EA 3CYMA 2IVNA 3QYYA 3M3ZA 3TR8A 2DY9A 2HWIA 1U1MA 3R8YA 4GW6A 5K8NA 2KT5A 3OR2A 4FJIA 1F3VA 5HMXA 2OMLA 4NX9A 2B6AB 1D9FA 4OQJA 1KTQA 4E98A 3NH2A 3CULA 4B1WB 3JYTB 5B0EA 4CH7A 4K4SA 5LL6Z 4WYLA 4HI2A 3C6TB 1DHMA 1RCXB 4LIRA 4PKIA 2UUCK 2GHPA 3FZBA 5B0AA 4K4XA 3VA0A 4DG1A 2KXNB 2BQ3A 3HL8A 1Q18A 4H0TB 2XY8A 4ITSA 2KW4A 1TZ0A 2A41A 3EM1A 3M9NB 2DH9A 3AVBA 4F3TA 5KPRA 2GHWA 4WYWA 4ZP9A 2X78A 3PACA 1FRXA 4ZVQB 3DXKB 2U2FA 4BC3A 2DR5A 2R7OA 4PKHA 2OPQB 3OTOF 2V34A 1H72C 1IBLK 1N33J 4PQUB 5LXYA 1XUPO 1C1BA 3CTRA 4U8VA 2ZUAA 1B64A 3R2DJ 4JYAK 4DV6F 2J7UA 2XZDB 1JJ2R 1S1VB 1JK9B 1TVRB 1X0FA 3RW6A 4PG7A 2RUGA 3B8AX 3CC2N 5B7WA 1HQUB 3SAGA 1TR0A 4JKBA 3B6PA 4TKTA 2KXFA 5LJ5Y 4LF9F 4A8WA 2IY5B 4JI7K 4CZMA 1FJGF 1BE4A 2ZJQQ 1D5AA 4F3MA 2R7RA 4KB0A 3UIQA 1NK6A 3QLHA 5KFUA 4B3TK 3CF5L 1HIYA 4GV6A 4HYKA 4KHUA 4H5VA 2VA3A 3CCWA 1HARA 3T1HK 1HWUA 1B3TA 2E1YA 3QMLA 2RKIB 1XNRK 5LSOA 4JI5K 2N7YA 4F7VA 1IQTA 3IRXB 2CQ0A 1J6ZA 5AQRA 4G1QB 3OBWA 5IWAJ 4R79A 9RUBA 1UVLA 1Z1ZA 2VJUA 3ISND 2KM8B 1S48A 2OA8A 3VF2A 3NNHA 5HO4A 1X5PA 1X4BA 4JS5A 2QTWA 3NBPB 2C2RA 2UU9J 1O51A 4BQLA 4USVA 4CLKA 1F3FA 4AQYF 4IRDA 4KHPF 3SBGA 2W4PA 4P9SA 1VQ8N 2Q31A 3AD7C 5JMVA 1C1BB 1CJUA 3G25A 2DGUA 3NVMA 3QICA 1S5ZA 2QRRA 3OS1A 2L9DA 5KFDA 4JS4A 2HFNA 4IG0A 2VQEK 2W25A 2FLOA 1TMJA 4C8MA 4USIA 2IPOB 1UTAA 4EO8A 1TYQB 1H98A 3VGUA 1ESVA 2Z2ZA 3NP5A 5GAHP 1VRQC 2V8PA 3MX2A 4F2SA 5M2RA 3THYA 2XS2A 3HLUA 3NS7B 2KHCA 1MMDA 1WORA 3MPWA 2FBTA 3GFXA 4OKJA 3FSYA 2ZDOA 3MR7A 3QLHB 4L72B 2KO1A 3MOZA 4NXNK 3ZO7A 1IKWA 1LWFA 2ROGA 4DZ6A 2ZH9A 3KLEA 4C8OA 1MWMA 3C6AA 1RBVA 4K8XA 3VEXA 2Y9HA 2M8HA 4EEYA 4FPIA 3M2RB 2KFYA 1SC3B 4DTRA 1K44A 1KVAA 3S6EA 2DNGA 4NL5A 2W7AA 4LF2A 5KGWA 5EUHA 3AAPA 1XI1A 4J9RA 1VQ7S 4RW6A 3CCUS 1WELA 3HSGA 5IT4A 2BM0A 4U9RA 2Y1IA 3LAKA 1ZPVA 3ICLA 4Q5VA 5LT5A 1K8AO 1YJVA 1SL0A 2F8MA 1R3NA 1KBRA 1S1XA 3ZYYX 3BUZB 2VL1A 5KFMA 2BTFA 1DZ5A 3QEXA 5A2QY 2DRBA 1VHIA 4NEYA 1QTNB 4KPCA 3HF5A 2ZZNA 4B1YB 5FDLA 5CABA 4O5FA 1TK5A 4B17A 5KG4A 3IUCA 3MN5A 5HQMA 4ZN1A 3W3SA 5HVHA 3PUFA 1X4AA 3O9SA 1Y64A 3THYB 3OYAA 2CQBA 5BYRA 4H5TA 4ERDA 1WF1A 4E7IA 1S22A 2VG5A 3H5SA 3LTOA 4JP8A 5CAAA 1Q81T 5CE3A 4Z4EA 5LXRA 3KHYA 4N77A 4O44A 1BUXA 1M90T 1VSIA 2HLTA 4NLPA 2QLWA 3LA0A 5HI7A 4HTJA 1ITGA 4ES2A 1XTZA 4KYZA 4HACA 2MYFA 3D28A 4Z2XA 1LW0A 4FYDA 1L3SA 3F0NA 1FDAA 2HRTA 5C12A 5FPEA 5EXWA 1IBLJ 3R5AA 3ZNJ1 4ECQA 3AH6A 4J9MA 1R0AA 2CQ2A 4FVMA 4OHVA 2V4JB 4JYAJ 1FKAF 5I3PA 1LNQA 1SJFA 3ENOA 2VICA 3EGWB 2MLZA 1T9UA 4FZZA 3G9CA 3L2UA 1K6YA 1KWMA 3IMXA 1V4TA 5HL7L 5K8OA 3PHTA 2DXFA 2NYIA 5ETQA 3LP1A 2WTUA 1VQ8S 5K9FA 4PYAA 2MKJA 2UVWA 4J2AA 5EGYA 8RUCA 3Q2SC 1YTUA 3ULDA 4CIGA 4RW7A 1G15A 1QZ5A 1Q79A 1N32J 2D41A 2JHEA 2UXBF 1DGKN 4JI7J 4CDIA 3OD2A 3E1YA 3AVHA 4WP9A 3H98A 2GX9A 4ZTFA 4B3TJ 1ASUA 4CHNA 2V94A 5DG8A 1MG7A 4JV0A 2I9SA 1B9FA 3JQKA 1F60B 4LVNP 5KQ8A 4LMZA 2XTJP 4BVPA 4NA1A 2MZQA 3A8JA 5KPTA 3T1HJ 4MYUA 2CUYA 3FMBA 3TTFA 2MXYA 1RFQA 4O8KA 2RQKA 3FZKA 2PYLA 1AUSL 4C11A 3OL9A 2NRWA 2B43A 4GO7X 3I5AA 3WIVA 3W9HA 4YDUA 2QW9A 4MT1A 4DTNA 1MU2A 4UZBA 2HLUA 1PC5A 1GLFO 4KGXB 3AA2A 1VRUB 3GE1A 2HURA 4FWNA 2G0CA 3D6MB 1HMVA 4PABA 1RTJA 4R0EA 3WXMB 1TKTB 4CFDA 2X1BA 1VSMA 2RN2A 3QZ8A 4CD3A 2C2DA 3ENWA 3OFEA 1HI8A 1WKJA 1A0OB 5AZIA 4I7FA 3M2VB 4DL3A 1WBDA 1CULA 3MM8B 4DU7A 1VBKA 3DXBA 1OO0B 2ZH7A 2VKRA 2VQEJ 4OI3A 4CT9A 2E9ZA 5I42A 3H46O 3RB3A 3VA3A 3LP1B 5C2FA 3PW2A 2HMPA 1LWEB 3KZBA 2G8FA 5TKWA 2A3ZA 2ABYA 1RU2A 3VGMA 3BKFA 1CXQA 5E84A 3W65A 4PA1A 3CJCA 2EI5A 3E2EA 3K5NA 3N9UC 1FFWB 1NCLA 1G2EA 3DHXA 3SDEA 2HW3A 1VBZA 2YJEA 2GJIA 2AIRB 2Z4PA 3CCEN 4LVOP 5LSRA 2MGZA 3MM6B 3DXMB 4Z7CA 1YIJN 4H4KC 4JK7A 2PMZD 4FWQA 1CG2A 3M2UA 1VK3A 3FCWA 2OD4A 1CQNA 4F4YA 2LEPA 2XS7A 4DQQA 3T41A 2BDPA 1GMWD 4WFAQ 1UETA 2FHJA 2Q97A 3IM8A 2P9PA 2K1RA 1VC0A 4OV1A 4JHDA 5J2NA 1YVUA 2MKIA 3P1GA 5BRFA 3V4MA 1NU0A 1CSJA 2AQ4A 3HM9A 3ZEUA 2BV3A 3AO1A 3CPEA 1NJIT 1CULB 1QTMA 3A12A 4LRBA 4LF7K 4CEZA 4KHQA 1TFWA 4DCJB 3CCLS 5CCMA 2YNFB 5I42B 3KMQA 5EX5A 2PEBA 2DR9A 1FK9B 1HNZK 4ED3A 4UOFA 4Y2MA 5A8RA 3IA0A 4MO5A 5I4MA 2HBRB 5KRSA 1B4SA 4ANCA 3B82A 1ZM4A 3FFKB 3CJ0A 2M3DA 1VSHA 3LZIA 2HQDA 1N5YA 5T7LA 2I5JB 3NOCA 3V1OA 2O8FA 1VQ9N 2KHOA 1CLQA 2AP6A 2ZBIA 2DNOA 4E7LA 3OQ2A 4M7YA 3L7PA 1HA1A 2CWXA 4FF3A 3CC7N 4ZS6A 3KDNA 4EAHD 3U9ZA 4DMZA 1VSEA 2C3MA 4K2XA 4E1JA 2N7CA 3SQGA 4M3YA 3T9ZA 2UXCF 3BH7B 3M1FA 3M8QA 4R25A 3J7YU 2Q1NA 1BQXA 2ITGA 3HT0A 2P9PB 5BR9A 2CH5A 5C2GA 2HQ3A 1ZAWA 2J0SD 3NHGA 3CMAS 1HWJA 4JHDB 4CO5A 3FBFA 4KAZA 1O6XA 2WSCC 4JKGB 1U48A 3MEDA 3LH2S 4M5KA 1QHAA 3EKUA 1N33F 3SXLA 3DI6A 3B4MA 1LXNA 1ZS6A 2FLLA 1HL6A 1U49A 2HNZA 1UZHA 5KFFA 1HBUA 2VB6A 1UVJA 5J1EB 3HHLA 4RUHA 3LPUA 1XMQK 2RF2B 2AX0A 1DY3A 3OVAA 4WJBA 1SUQA 4CZHA 1SKWA 3V4IA 2VFVA 3TAFA 3DDNA 3D3CJ 3N4WA 3DDKA 4B08A 2HHXA 4CI0B 2G9OA 4IKFA 5A8RB 3HP9A 1VQ5N 5KFAA 4IFYB 2GMLA 3OLBA 5HLFA 2VFTA 2GVZB 3EO3A 2NYHA 2V2VA 4BE1A 1EWQA 3WXKA 1XMBA 2VWBA 2JEIA 5T7LB 4IR9A 3OYIA 4DV1K 4RNNA 3HHDA 2W9BA 3MZIA 4E8UA 1EZZB 4CEQA 1P90A 2GO9A 1FKOA 3DLKA 4CHYA 4Z4HA 3WX8A 4PZVA 1AB8A 4Y3CA 1H6KX 3Q8QB 1FEHA 2RD5C 5E3PA 4AXIA 1Q9XA 2A40A 4WFXA 4CO0A 5IWAF 4F8RA 2F4VK 3BPDA 2GFFA 4WU3A 2A1RA 5CH7B 1N36K 1FNXH 4U7BA 2V4QA 1NGEA 4B3OA 4KHSA 2UU9F 2RHKA 3EE3A 3PG9A 2O8BA 4Q0BA 2ZF5O 5IC4B 1NOZA 1FHTA 1SC1B 1NSAA 2HNZB 4F0KA 2G2ZA 4QWBA 3CPWR 2FGCA 3HFZB 1BL3A 1NH8A 2I0XA 3G71S 1SUQB 2QG9B 4FVCA 3RMCA 2IIHA 1BLUA 4AE5A 5HANA 2DNQA 3WDOA 2OHDA 3G10A 1HD0A 2XMMA 3QWUA 5KG7A 1S0MA 3OYKA 3SMPA 3HZ6A 1KD1T 4DPXA 4ELVA 1VIOA 3D1QA 2B9XA 2ROPA 2EBGA 3VGLA 1R0BG 2LSNA 1YBTA 2ZBCA 2Q2RA 2HMIA 3V1QA 3TI0A 5D3GA 5C0YA 1FCAA 4PUOA 2QLBB 4MYTA 3WQUA 3U9DA 4CJTA 3AGRA 3BPSP 3NGYA 4FO0A 4Q2LA 4FYYB 3IFEA 4C8LA 4E7HA 2LQ5A 3D68A 2HBYB 2PDAA 3ZX3A 2LQ8A 1RGVA 3MXJA 3RMDA 1D09B 1FDBA 4KH1B 4NMLA 2UUBK 4LF7J 2IVPA 3W5ZA 3BEGB 1F5BA 5DRKA 3KK1B 5EY4A 3LL3A 3PJ9A 3RYLA 4CH0S 1X4HA 2DISA 3ZSZA 5ADXH 3KUGA 3M8PA 4OPKA 3NAIA 2WONA 2YWKA 3VQBA 4PG4A 1WHYA 2YQ0A 2P5GA 3U27A 2BYCA 2ZD1B 3L2QA 3E01A 3D7EO 2IVYA 3H4DA 1SV5B 3K58A 3R2CJ 3R7NB 3PJWA 3DU6A 2O66A 4OZJA 1NSPA 3JQMA 4OX8A 4MTPA 3BKTA 1JLBA 5J2PA 2R42A 1BC6A 1JLEA 4EHUA 2AJFE 1QQOA 3BBFA 3AQPA 2Z57B 4A2AA 3CJ7A 2YKNA 4Z94A 2QZ8A 3D2WA 1FXXA 2BZ2A 3GV7B 3SPYA 1W7WA 4TQRA 2XSFA 2KU7A 1RBLA 3UN3A 3QJLA 1LOTB 1JLGA 2W2NP 4KGZB 4LR7A 4PCQA 3PW5A 1JX4A 3B6BA 3FGVA 4JK8A 3D9BA 3VAMA 1RHJB 4RW4B 4MAKA 3IGVA 4GKKJ 2VG6B 3VQCA 1IBLF 4USHA 1M1HA 2DFHA 2ZJQL 2AX1A 4DQPA 5GMKa 3EEQA 2KYXA 4CLZA 1BOTO 4ECVA 3L0QA 4X64K 4I64A 2GJFA 4USMA 4F3OA 3VALA 1Y5LB 4X62J 1M1GA 4OI0A 2OFGX 5CZ2A 1H0HB 3K7RA 1QSYA 1CZBA 4FWRA 1YTAA 2WONB 2JFKA 1UPMB 2NUUG 3H2LA 2P5OA 3ZT0A 3ZTPA 2HGLA 3ZZZA 1N32F 1SL1A 5HP1A 1P6TA 4JI7F 3V6JA 2MQLA 3HVAA 2CG8A 1T11A 1T6CA 3CIPA 1N88A 3QERA 4YP3A 4HH0A 1EB0A 4RTFD 3JAMO 1GX6A 5LSLA 4DV1J 3O80A 4B3TF 1JLBB 1UFWA 3O4QA 1QAJA 4EO6A 2BABA 3H5YA 3O9RA 3HVTA 3A13A 3GG1A 3E66A 3F44A 4LSNA 1W25A 3P38A 2H4YB 2E9TA 1RQ0A 1IVZA 3P45B 1WOSA 4K41A 3TZZA 4CD1A 2F4VJ 3AVLA 3DFEA 2XMUA 4DF4A 3CI5A 2QLXA 3BN4A 4A46A 1OH5A 1D9DA 1U2VB 4IH5A 4CF0A 4I56A 4P2SA 1N36J 1B92A 5DMRA 3CSKA 2RE2A 2K3IA 3QNNA 3CXCR 1VQKS 3EPIA 1FRLA 4KHYA 4CF1A 4LFAK 3VF4A 1IBCB 4CP5A 4C8ZA 1GOBA 4YR2A 2WW8A 2EG2A 2WOMA 3C16B 3I0SB 1HPZB 5IQQA 1NU4A 5J1PA 3P6YC 2HS4A 2XLKA 3VAIA 1KC8O 4ZPVR 2HF4A 1ZBFA 3QDKA 2J6UA 1RAGB 4ZJLA 3W2VA 3DC2A 5DGBA 4OJ3A 2OCEA 4NRUA 2FJWA 5AQWA 2DGWA 1OPZA 1TP7A 1ZYQA 4RCHA 4A61A 5F9LA 3EY1A 5BR8K 1URRA 2LU2A 1JLAB 1K8AT 2EHGA 4JI2K 4B1XB 3VEWA 1ZTTA 4FS1A 3DDIA 2V67A 2OZSA 1HNIB 3AO5A 1E3MA 4A57A 2IDOA 4HHHA 1XEZA 3CJ3A 3HVTB 1VMBA 2LQBA 3JQJA 2IVMA 2BE9B 4BG9A 4I2PA 1D4XA 2P2CB 2GGPB 5F3ZA 3AVIA 3J7AN 2NXNA 2KKZA 3PKYA 4Q43A 1TKDA 1CJVB 1KFSA 1SKUB 5M1NA 3PEHA 1WF0A 2V9KA 4CLSA 5KT6A 3MMCB 4RU9A 5B0GA 1F5CA 3KJNB 3NGRA 3BYPA 1PKUA 3NH1A 2OEKA 4FJGA 1UKUA 2ZQBA 1YQHA 4TSXA 4KH5A 1WEZA 1HBMA 3SIPB 3GFHA 3V9UA 2WOMB 4LF4K 5KG5A 1RT7A 2P9IB 3ENVA 3IBWA 3TZYA 1IKVA 1B0TA 2OO4A 2W01A 4CERA 4N76A 1UAXA 5L39A 2E1MC 2MQPA 1KTVA 4ZVTB 1WAJA 1RNHA 2QT7A 3DOMA 4UUWA 1VQYA 1XERA 4CFBA 2MZTA 3R1XA 3M30A 3IG1A 4JUZA 4ZVEA 4ECSA 2NNWA 3FZLA 2LQ9A 4YB6A 4RW8A 3VQ7A 2YNIB 4RPFA 3TAMB 1KS2A 1NGBA 4BRHA 2YWFA 4HT7A 3SEOA 4HEA9 3M5RA 1ZAXA 1H73A 3DJCA 1A6LA 5J1NA 4FW1A 3T5LA 2F63A 5M1FA 4L74A 1S6UA 4HHUA 4CEDA 4MJKA 4KKOB 4YY3K 4CJPA 3NG8A 1KDNA 2PC6A 1T8EA 1SJ1A 2UXDF 3HYFA 4FVUA 3BGUA 2OI2A 4BQZA 3BBBA 4N5SA 1T02A 3VZIA 3MEEA 2RIJA 4X64J 1TL3B 1RDWX 1WWHA 2DHHA 4ZIWA 3ZTQA 3AY9A 5AQZA 2BKNA 3ZETA 5AFUA 5GADP 2BRLA 1CC8A 5C24A 1VBYA 2EWHA 2DFEA 1CC7A 3CCTA 4EP5A 5KFEA 4RUAA 2A1SA 3BH6B 4DXLA 1O13A 2D3ZA 2L48A 3OVSA 5DG9A 4OX7A 3ULEB 1J54A 3SCLE 3S3OA 4DR3K 3QBCA 2A0FB 4MK8A 2CJYB 2CFXA 1C0UB 3THWA 3SBTA 5CHIA 2WVBA 3TUZC 1R8BA 1HQEA 2CPJA 4RW8B 1LXJA 3F5TA 1S9EB 2OTLN 4R5PA 3FFIB 3NNAA 5KT3A 4YQWA 3DGVA 3U8XA 3I9ZA 3FQKA 1F2GA 2YHYA 3C14B 3GOIA 1YJRA 4XK8C 4OI1A 1V6HA 3WC0A 3SQ0A 4DR1K 4HCCA 4W92B 3WEEA 3QWPA 3LF0A 3OYFA 1FJCA 4ENOA 1QAXA 2OUGA 2P9KA 2NUHA 2PZSA 1IM4A 2F7VA 1WF2A 1Q4RA 1KVJA 4OYIA 3EPGA 3QEIA 3TAQA 4Q2MA 4IOXA 2K06A 2FHOB 1JQGA 4DTJA 4GKJJ 2EFOA 5KFXA 4MIAA 3LQVA 2NZCA 4ED4A 1R0CB 3VHQA 2NZ4A 5RUBA 1RDAA 4DI6A 3R7SB 5EDWA 4WFAL 1NZAA 2VZ9A 4DWIA 2MZJA 4LFCK 2QMUB 3H4BA 2K7KA 3SI6A 4D3GA 2GV1A 3POTA 4B1ZA 2R4FA 2LEBA 1GT8A 4ILJA 3NCQA 2DNLA 2YV0X 1XWLA 5BR8J 2AJ4A 1S72N 2QGFB 2O8CB 4AHRA 1N54B 4JI2J 3TO8A 2DGOA 3OYBA 5L9XA 2QYGA 1LOUA 5HN0A 4B3SK 3UR0A 4CO2A 2AEJA 3VPZA 3FVYA 3MM9A 2CQPA 5D77A 2DNRA 4O0NA 2K3KA 2DPIA 1OH8A 2W42A 5GADI 1SJQA 1FEEA 5AQYA 1WC0A 5A76A 4ZLJA 3Q86A 1REVB 5DDQC 1BWEA 2QA4N 2AT1B 2B5JB 3BGOP 3TABA 2IJRA 2R7UA 5KG3A 2BGGA 3AB4B 2Q3PA 2EKYA 4CH1A 3UWTA 1BUPA 1VQ6S 3SUOA 1RBUA 4FCYA 3KYLA 1QAIA 2ZVIA 4JI0K 2R7SA 3CCSN 2VF3A 3BZQA 2I38A 5GAGP 2B8PA 3TSPA 1ZETA 3KLHB 1EETA 1FX2A 1YRXA 3CCJN 1RT1A 3K0SA 1U6BA 4LF7F 4LF4J 4I1TA 1HKGA 2CJQA 4BC7A 3AO4A 5KQDA 2PD1A 4NO7A 1HI1A 2H4WB 2IM1A 2XMKA 3ENHA 1J5EK 4NLRA 2HFSA 4DU4A 4AL7A 1QD1A 4CTAB 4KHWA 2HBLA 1VSDA 2PA8D 2RRNA 1PIEA 4OYZA 4ED6A 4I0WA 1HKAA 3GIJA 4FJMA 5IT9U 4DSEA 2YWWA 1U8WA 1OYEA 4OZLA 3IAYA 9ATCB 4EUVA 2QXFA 4DFJA 4F4AA 1QVGR 5ADZA 3I0RA 3OXGA 2OKQA 4JKAA 4OZ2A 1J27A 4U8YA 2YHWA 4ECYA 4KO0A 3TVKA 2KRRA 4DR4K 4DR6F 1CLFA 4ZN3A 3SCXA 3N6LA 2KI2A 3NF9A 1BIZA 1W9HA 2V2QA 1I1GA 3BSNA 5AE2A 3IR7B 5FD1A 4ILMA 4CHPA 2IRYA 1KQKA 1L3UA 2M0GB 2ZE2A 2DIUA 2MZRA 3DLGB 2GMJA 3NCRA 3ZZ0A 4LSZB 2I7PA 4GKKF 4CYUA 3CQ8A 2W24A 1WNEA 1RTDB 3J7ZT 3OUYA 4DSKA 2IIRA 1HRHA 1H74A 1RTHA 1N5QA 2FQQB 2HSEB 3UKUA 5E3QA 4CF2A 4USTA 3G6EN 1VQLN 4CZFA 1X9SA 3TNVA 3DLJA 1S9GA 1Y3JA 1EETB 2XC9A 3WHIA 4JKFA 5DETA 1WC4A 3P4IA 5CYMB 2KN4A 4X62F 5KTQA 3C6UA 2G0JA 2ZBRA 1T3OA 3ID6A 3DRPA 2L3MA 1R8CA 1JLFA 1RB0A 2DYAA 3L7UA 3J81Y 2VASA 2LMIA 4FNIA 1EXQA 5AQSA 4WKYA 2VPYB 4CQ1A 3M4XA 2YKPA 4CWBA 1U1OA 4KB7A 5H9FJ 4ZVRB 4P52A 4FNHA 2RU9A 2VC1A 2FVQA 1FD8A 2R7VA 2MKKA 1HNXK 1ASWA 3X3UA 1VQ4N 1AFJA 1RWPB 2W1BA 5GAGI 1MA9B 2DGQA 4KO0B 4NYPA 3O9TA 4B9UA 1SKSA 1FNMA 2DH8A 3F2KA 3RBZA 2HFOA 4CESA 2QI2A 5LMNK 4TY8A 5CZVA 2JLGA 1H2TZ 3IP0A 3OFFA 2WB1D 1NJZA 1UVMA 2DCLA 2ETJA 1QJHA 4DR1J 3ZSQA 3W0LA 3V2UC 2HGNA 3LM2A 1RISA 2ZE2B 7FDRA 3Q8RB 4W5RA 3ZLJA 4KRWA 3THPA 1RWXB