3V9XA

Crystal structure of rnase t in complex with a preferred ssdna (aaa) with two mg in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
211
Chain Sequence
AQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 65
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9xA00
2KW4A 1C0UA 1UAXA 1ASWA 1TKZA 1C1CA 1RTJA 3SV4A 1NOZA 1BI4B 3ISNC 4DSIA 4Z4CA 3V6DA 3ZSWA 1RBTA 1JLCA 4KFBA 4DTUA 1L3UA 4IG3A 2Z1GA 2XY8A 2JGUA 4F8RA 1FKOA 4F3TA 1TV6A 3K2PA 4HUEA 3SCXA 2HHQA 4Z0UA 4E7KA 4B9TA 2D0CA 1RBSA 3DOKA 4BE2A 3K5OA 4CJ4A 4CGHA 1QTMA 4Y1CA 1LV5A 3NF9A 3LAMA 4CF2A 2KFNA 1DLOA 3AO1A 4KTQA 4CIFA 3L8BA 4M41A 4CGFA 3C94A 4RW6A 4RG8A 3RMDA 3O4QA 4J2AA 3VQ8A 3DRPA 2HNZA 3CG7A 3S3OA 2Z1IA 3QEXA 3SYZA 3SNNA 1F21A 3KD1E 4BWJA 4JLHA 3S3NA 4AHCA 4I7FA 3L2WA 3NGYA 4YNQA 4CF9A 4RW4A 5HP1A 3WNHA 3K5MA 2Q3SA 5DK5A 3QEVA 1JL1A 4CJ3A 3O3HA 3CYMA 3DLKA 4RW9A 4I2PA 3ZCMA 1TK5A 2LSNA 4B9SA 3UIQA 1A5XA 4KPYA 2KZMA 3ZSOA 2ETJA 1I39A 3CFOA 2XO7A 3U6FA 4AH9A 3CM6A 4M3ZA 1J53A 2R7YA 3DLGA 1G15A 3KLHA 3LZJA 4XIUA 2F8TA 4R5PA 3M8SA 4W5OA 1JLBA 4CEAA 3ASMA 3LWMA 4JS4A 2XY6A 3D0PA 4HCBA 3LP1A 2GBZA 1Q8IA 1HQUA 4F2SA 4DS5A 4CEBA 3KKSA 1NK4A 4M3TA 2HW3A 2DFHA 1TK0A 3SQ2A 3F73A 3VQ6A 2G8HA 4E0DA 4F3OA 2OPSA 4CJQA 1XHXA 1B92A 1S6PA 2VG7A 4G1QA 4FJGA 3QLHA 1MU2A 4FJ5A 4ELUA 2X78A 4ID5A 2DTUA 3ZSQA 4LSLA 4CK3A 3ZSRA 4CIGA 3SJJA 5KRTA 4KHWA 3DLBA 3ZSXA 4CHYA 1VSLA 1ASUA 1L3SA 4KI6A 3PUFA 3RMCA 2ZQBA 3D45A 3O4NA 5J1EA 3OYIA 1JXEA 1NK8A 4FJ7A 1VSMA 4CJRA 3TAPA 3KK1A 1QSSA 1LW0A 1NK0A 3AVFA 4I2QA 1WNSA 4DTSA 3LZIA 1WSIA 1DTTA 3NBPA 4M3RA 4N5SA 1LWEA 4O4GA 4FJNA 2OA8A 3NH0A 1JLQA 5HRPA 1EKEA 5I42A 1WSJA 1QE1A 4DQSA 1JKHA 1YVUA 4CJKA 4BE1A 1JLEA 1BIZA 2Y1JA 2XY7A 3HYFA 3TARA 1W9HA 3AVAA 4GMJB 4E7JA 2Y1IA 3MXJA 2YNFA 3V1RA 1VSKA 1HNIA 4IG0A 3ZT1A 2YKNA 4DSFA 3ZSYA 4FZXC 4GW6A 1CXUA 4FLXA 3MEGA 2NUBA 4CHZA 4TSXA 1X9MA 3QETA 4FK0A 1S1XA 4CK1A 3AVJA 4Q0BA 1L5UA 1DTQA 5T7BA 1T03A 2KFZA 1KCFA 3M8RA 2QKBA 4IFYA 2OPQA 3OJUA 1UA1A 1B9DA 2HHTA 3IG1A 4CHNA 3HO1A 2GUIA 5C42A 4OKEA 3OYEA 4DF4A 1SL0A 1U47A 1JL2A 1LAWA 4Z4IA 1VRUA 4CF8A 3IAYA 2JLEA 1J9AA 3VQ7A 1GOAA 1TKTA 3HL8A 3A2FA 3LPTA 1CXQA 3ZT4A 3HM9A 2Z1JA 1SKSA 3KTQA 2GV9A 4KHUA 3LALA 3NF6A 3OVNA 4C8LA 4KO0A 1RT1A 4BDYA 4M42A 1RDDA 1YT3A 1Q9XA 1TKDA 4LSNA 3OYCA 2IOCA 4LD0A 3TANA 3HP9A 3C95A 3AA2A 3MECA 1RDBA 1QS4A 3ITHA 4CFAA 3AVHA 3ZSZA 1REVA 3LWLA 4DQPA 1VK0A 4M3WA 4KREA 4W5NA 1WN7A 1TVRA 3NHGA 1NJYA 5FRNA 3DYAA 4WE1A 2WONA 4CEEA 1NK7A 4B9NA 4CJ5A 4BDZA 4N47A 3VQ4A 2VWJA 3VQQA 3H08A 4BDPA 1ZBHA 4M45A 1EETA 3WNFA 3L2RA 4KHYA 1HYSA 1D9DA 3PO5A 2FBVA 4CEOA 1TKXA 4E89A 1K6YA 1NJWA 4F2RA 1RT5A 4N41A 1ZBFA 2G8FA 4B9LA 1S1VA 1VSDA 2A1SA 1SKWA 3VQDA 3RTVA 4DS4A 1IKXA 4MFBA 4DWIA 4FW2A 4LH4A 3AO5A 5SWMA 4K8ZA 4J2BA 4B3OA 3OYJA 1N6QA 1KFDA 3NFAA 4CFCA 2G8WA 2DFEA 1JLFA 2VG5A 3LAKA 3SV3A 2HHXA 3OYBA 3V81A 3O3GA 1KFSA 4DLEA 4DSJA 4DG1A 1EXQA 2RN2A 4ID1A 4FJLA 3QNOA 1BQMA 4DLGA 2O4GA 2HHUA 3AVCA 4DF8A 4OLBA 1CZBA 3QEIA 3HVTA 4CESA 4FXDA 5CZ1A 2HVHA 4W5RA 4BWMA 3VQEA 3SUNA 3T3FA 3ZSVA 4K8XA 1VSIA 3RRHA 5J2QA 4FJXA 3CM5A 2KQ2A 5KGXA 3NH2A 4ICLA 2D5RA 1U04A 5HRSA 1RT2A 4Y1DA 1BIUA 4AILC 4CF1A 5J2NA 3HPHA 1T05A 1NK5A 2KZZA 1HJRA 3DMJA 1XI1A 1BCOA 2P1JA 1KVAA 4ELVA 2HHVA 4DSKA 3JSMA 4Z4GA 3SUOA 4Z4FA 1KRPA 2X6NA 3L3VA 4OVLA 5HRRA 1KVCA 1J5OA 2YHAA 3QINA 4PWDA 4M3UA 5CY4A 4N56A 3OS1A 2XRIA 1TAQA 3JYTA 4UQGA 4B8AB 2HMIA 3DRRA 4OPKA 3RR8A 4NCBA 3SQ1A 4KAZA 2RPIA 3AA3A 4KTWA 1S9EA 4MQ3A 3TAMA 5HRNA 1R0AA 4DTPA 3TR8A 3S3MA 1VSHA 2F8SA 3WNGA 5HLFA 1KSPA 3SUPA 3FFIA 1GOBA 4DFMA 4B9UA 1ZBIA 3AVIA 2BDPA 1WAJA 4C8OA 1J54A 2YNGA 5DMRA 4KHNA 3SQ0A 2QK9A 4C8KA 1KLNA 4ELTA 3V9ZA 4QAGA 3KKRA 3HT3A 2B5JA 2B6AA 3KJVA 3HVRA 2P51A 1I3AA 1RILA 4CEZA 3QEPA 2ZD1A 4EZ9A 4KHSA 2HNDA 3VQCA 3U3GA 2QKKA 5J2PA 4BACA 1YTAA 3HP6A 1Z26A 3PO4A 3NF7A 3VQ9A 3NAEA 1WSEA 3CQ8A 1B9FA 4DQQA 4E7HA 3ZT3A 3HSTB 4CF0A 1FKPA 2FBYA 3L2QA 3EYZA 1BCMA 3DLHA 2DY4A 4KTZA 4B8CA 1QSYA 2WOMA 2E6LA 4O0IA 1YTUA 3AV9A 4HVJA 5I3UA 1RT4A 3OYNA 1RBRA 2Z1HA 3V9WA 1BGXT 4C8MA 4CJEA 4FM2A 4FZZA 1GOCA 1EP4A 3AA5X 4QOZB 4E7IA 4FYDA 1W0HA 3K59A 4FW1A 1Y97A 4IBNA 1X9SA 4IFVA 3LP2A 4OKKA 5E41A 5KTQA 1JLGA 3OYDA 4HTUA 3DI6A 4DSEA 3V4IA 3OY9A 1LWFA 3RWUA 3AVGA 4NYFA 5CYMA 1CZ9A 3DM2A 3VQAA 4E7LA 2IAJA 2RKIA 1NKEA 1RTDA 4O0JA 1N5YA 2KTQA 2YV0X 4CGDA 4Z4HA 1RTHA 1NOYA 2G8IA 1X9WA 1JXBA 4DTXA 4B9VA 3KLFA 4B9MA 2ATQA 3ALYA 1IG9A 4IDKA 3NGZA 1RT3A 4I9QA 3HPGA 3PX6A 3DLEA 3TABA 4O5BA 1FK9A 5KRSA 1NKCA 3PY8A 1ZYQA 4OLAA 3I0SA 1RT6A 4FVMA 3T19A 4CJSA 1L3TA 3PX0A 3I0RA 3SQ4A 1D5AA 4HHTA 4E1NA 4LH5A 4AHUA 3NH1A 2YNHA 3TWHA 3RMBA 4CIEA 3HK2A 2YKMA 4CERA 4JRQA 2PYLA 4FJ8A 1VSEA 4Z4EA 3KK2A 1A5WA 4NCGA 4ZHRA 1S5JA 1WSFA 4KB1A 3G0ZA 3HPOA 3NCIA 1Z25A 3MAQA 2VG6A 3QNNA 5FDLA 3VQBA 3OYHA 3CFRA 4DTRA 1HMVA 4PUOA 4M3YA 2P5GA 2X74A 3M8PA 1HRHA 1CLQA 5HROA 4NYNA 1BHLA 1NK6A 1HQEA 3NGIA 4O55A 1ITGA 3OYLA 3HJFA 1ASVA 3E01A 1XC9A 1ZBUA 1S1UA 1TL1A 1SL2A 1BISA 3T1AA 1VSFA 4CJLA 1EX4A 2YNIA 1IH7A 1NJZA 4J2EA 4CJWA 3BGRA 4N76A 3LDSA 1C1BA 3AO2A 4Q5VA 1SL1A 1KLMA 3P1GA 4FJKA 1S6QA 2G8UA 3OJSA 3RR7A 1LWCA 4E19A 1NK9A 2QXFA 1RTIA 2BANA 4FCYA 5J2MA 1KVBA 3LP3A 3MXIA 3P5JA 3NE6A 4OKJA 2XHBA 2I5JA 3QERA 4QCLA 4CECA 1UA0A 2OPPA 2G8KA 3IS9A 5KI6A 2OYQA 1JLAA 3ZT0A 3LP0A 2A1RA 2RF2A 3LPUA 4PA1A 1SV5A 3C6UA 4O44A 4CGGA 1VRTA 2BE2A 3AVMA 3KLIA 1S1TA 4RW8A 4YFUA 3KLEA 3EZ5A 4DTJA 2ZE2A 4M3XA 4DMNA 5D3GA 1UOCA 4AHTA 3V9XA 4CHQA 1RBUA 3KLGA 1LW2A 4OPJA 3AVNA 1WSHA 2HHSA 3DLRA 3QEWA 4CJFA 1S9GA 4CHOA 1SKRA 1A5VA 5KGWA 4CE9A 2DFFA 4ZTJA 4LY7A 3BDPA 4DU3A 2W42A 1FXXA 4CK2A 2P5OA 1HNVA 4IKFA 1QQCA 3QESA 4PQUA 3AO3A 3CFPA 4DTNA 3NDKA 4FLVA 2EX3A 3V1QA 4DQRA 4AHSA 3MXMA 4ZTFA 5FRMA 2BGGA 1TGOA 1IKVA 2VWKA 3KK3A 1C6VA 4FLZA 3V9UA 3PX4A 4GVMA 3SI6A 1NKBA 4CHPA 4FLTA 4B08A 4KRFA 3F9KA 3VN5A 3SZ2A 4OGEA 3AO4A 3HXMA 3WNEA 4AHRA 1HYZA 3AA4A 3OYKA 3OYAA 3ULDA 4BE0A 4L8RB 5JS1A 3SUQA 1Q9YA 5SZTA 1T8EA 4F4KA 1RNHA 1U48A 4H4OA 1WSGA 4CFDA 3RRGA 4PY5A 3S9HA 1L3VA 3KD5E 3I8DA 1WLJA 2AJQA 4FLWA 3OS2A 3DOLA 4DQIA 2B4JA 1HYVA 3TI0A 2PZSA 4JS5A 3B6PA 4CEDA 3TAQA 4FK2A 3K58A 2OPRA 4C8NA 1TK8A 4HUFA 1RCHA 4OGCA 3TAEA 3TAFA 1QHTA 1U4BA 4CGIA 2HNYA 4CCHA 4HCCA 2D0BA 1KTQA 1C1AA 2FBXA 2IDOA 3MEDA 4H8KA 2OZSA 4DSLA 3L3UA 3P83D 2XY5A 1HPZA 1SUQA 3K5NA 4CJUA 3QIPA 4DU4A 4FJHA 2X6SA 3K5LA 1LAVA 1ZBLA 4CJTA 4CJVA 2O4IA 1BI4A 3AVLA 2HB5A 4FLYA 4DTOA 3L2VA 2FC0A 4NCAA 1XWLA 1RDCA 2E4LA 3G10A 3OYGA 5K14A 2D0AA 4RW7A 2PY5A 4J2DA 3SPYA 3PV8A 3IRXA 3MEEA 4HUGA 1TL3A 2OZMA 3K57A 4AHVA 1RT7A 4CJPA 2ITGA 5HBMA 3AVKA 3U3YA 1RDAA 1D9FA 1IKWA 1C0TA 4FK4A 4FM1A 1BL3A 2F96A 3M8QA 4KKOA 1S1WA 4DFPA 4DFJA 4OJRA 4EZ6A 1WAFA 4FJIA 1IO2A 4CEQA 1U49A 5EU7A 1IKYA 4E1MA 2IGIA 5C25A 2E6MA 4EP5A 3VQPA 3SPZA 2IC3A 4KI4A 3B6OA 1BQNA 3KIOA 4DFKA 4CFBA 2EHGA 3THVA 3EY1A 3OYFA 3OS0A 4EP4A 3DRSA 4JRPA 2IS3A 3VQ5A 4FM0A 4CEFA 4I9LA 1UWBA 4H4MA 4FLUA 4E3SA 3TAGA 4FJJA 4FJ9A 4KB0A 5CYQA 1NJXA 2FBTA 3NF8A 3AVBA 3VA0A 3ZT2A 5FROA 3LANA 4W5QA 3OYMA 4DU1A 5JS2A 1XHZA 3QO9A 3L2UA 1O1WA 1X1PA 5C24A 1VSJA 2HHWA 4FZYA 4CGJA 3VA3A 1TAUA 3O3FA 3RMAA 4DTMA 4KV8A 4KHQA 1C0MA 2PYJA 2YHBA 3V9SA 1QSLA 1D8YA 1T7PA 2HVIA 3C6TA 3V1OA 2G8VA 4W5TA 1U45A 4FJMA 3QIOA 1RBVA 5CZ2A
chains in the Genus database with same CATH superfamily
3QB0A 1C1CA 3SV4A 1BI4B 3V6DA 4BRCA 1NJIO 3VEZA 4B3RK 4DTUA 1YIJN 2Z1GA 4BRMA 3I55N 1JJ2M 4F8RA 4F3TA 3H1QA 1RBSA 2A3ZA 3QDKA 2NZTA 4H5WA 2KFNA 2EWSA 5M1FA 2ASOA 4CIFA 4CGFA 4RW6A 4B1YB 4J2AA 3DRPA 5LMNK 4C23A 1F21A 3MX5A 3O6WA 2QW9A 4CF9A 5HP1A 3KWGA 3WNHA 3K5MA 4E1JA 2Q3SA 1IBLK 3QEVA 4CJ3A 3O3HA 3PSIA 3CPEA 3CYMA 5AQYA 3DLKA 4RW9A 3ZCMA 5JLHA 2KZMA 3CFOA 3U6FA 2NRRA 1NMDA 2YHXA 5KQ8A 3PSFA 1HKCA 4BRLA 3I33A 4XIUA 1WBBA 3G25A 3CJ9A 1JLBA 4JS4A 3D0PA 3W0LA 5GIOA 4DR2K 2GBZA 4HCBA 1Q8IA 1HQUA 4F2SA 4M3TA 2DFHA 2G8HA 1WUAA 5BR9A 4G1QA 1VQLN 2FLOA 4ID5A 4A62A 4ILHA 5KRTA 3DLBA 4CHYA 4XH5A 4KI6A 3RMCA 3K9JA 3O4NA 2IVNA 3TPQA 1NK0A 4A5AA 3AVFA 4DTSA 3LZIA 4N5SA 4NLCA 4O4GA 5HRPA 2Q97A 1JKHA 4CJKA 1BIZA 2Y1JA 1W9HA 3T7ZA 3MXJA 1N36K 5C15A 5LJVA 3R1XA 4IG0A 4JI7K 3ZSYA 1X9MA 1CXUA 2E2NA 1RDUA 4CZFA 4DQ8A 2E8AA 4CK1A 4Q0BA 1L5UA 1DTQA 2P9SA 3CCVN 1KCFA 3M8RA 1YITN 3A8YA 4WQ4A 3BY5A 3OYEA 1JL2A 4DV7K 2JLEA 4GNIA 1CXQA 4A57A 2V52B 4H0VB 1SKSA 4MLEA 4V19S 4FL9A 1T3VA 3E1YA 4KO0A 5ELZA 4M42A 1RDDA 3CERA 4LD0A 3AA2A 2F9WA 3MECA 1RDBA 3AVHA 1GLJO 5AQIA 1YUWA 5BRFA 5FRNA 3Q7BA 2NNWA 4BDZA 3VQ4A 4DR3K 4C1NK 4JI5K 1N34K 3L2RA 3NVKA 3UB5A 3NMUA 4YOVA 3H45C 2FBVA 1NJWA 1VQ8N 2A1SA 1SKWA 2QA4N 4JHDA 4MFBA 4DWIA 3AO5A 3EO3A 3L6QA 4B3OA 3O9TA 4BRKA 3LAKA 5AQFA 5LJWA 3QNOA 2UYTA 2HHUA 4DF8A 3D2EB 3T1HK 4OLBA 3HVTA 2UXCK 4DHYA 4BWMA 3T3FA 4K8XA 2CGLA 3RRHA 4FJXA 3CM5A 2KQ2A 5KGXA 3TSUA 1U04A 4AM6A 1BIUA 2KZZA 3HPHA 1NK5A 4YORA 3FR0A 1ZXOA 3DMJA 2HHVA 4ELVA 3EKSA 3JSMA 4Z4GA 4CW7B 1OH8A 3L3VA 3VEVA 4FWMA 3LDPA 3ULEA 2BH1A 4B8AB 3RR8A 1Z6RA 5KPZA 3AA3A 4KTWA 1S9EA 4MQ3A 3TAMA 5HRNA 1R0AA 3VENA 1SS6A 1VSHA 2P9LB 5CR4A 1HUXA 2BDPA 1J54A 2YNGA 3OBWA 3SQ0A 3CHWA 1KLNA 4DR4K 3V9ZA 2E2OA 4JYAK 3HT3A 2B6AA 1RILA 4CEZA 3QEPA 3VEXA 1R59O 1XQSC 1GLBG 1S3XA 1Z26A 3VQ9A 3TTFA 1WSEA 4K0KK 3ZT3A 1X9JA 3EYZA 4KTZA 4IOAL 4O0IA 1YTUA 2PBDA 3AV9A 4HVJA 4FM2A 1YHQN 3AA5X 4E7IA 4FYDA 4IDHA 4BQLA 1Y97A 1X9SA 4IFVA 1ZBSA 4OKKA 3UKRB 1LWFA 2O8BA 3EEQA 5CYMA 3H6EA 4YOWA 1RTDA 4FVUA 2FF3B 1ATNA 4CGDA 1NOYA 2FXUA 4ISEA 4CZHA 3KLFA 4B9MA 2ATQA 5GIPA 4U7BA 1HKBA 4A2BA 3NGZA 1RT3A 3DLEA 3PY8A 4O5BA 5KRSA 2BTFA 2AJQA 3EKUA 3P39A 4NLBA 1L3TA 1ESVA 3SAGA 3KHYA 3N4PA 2VQEK 4NCGA 1RDWX 1S5JA 1HNZK 4KB1A 5FDLA 3VQBA 4DTRA 3CFRA 4PUOA 4M3YA 4H03B 2X74A 1IJJA 4CZEA 5AQZA 5HROA 4NYNA 1ASVA 2W40A 5E26A 1YAGA 1TL1A 5BPLA 4IZ9A 2GWJA 4CJWA 4FWPA 3CCJN 3LDSA 3THYB 1SL1A 2QWNA 3ATUA 3A5MC 4BR0A 2G8UA 5HL7L 1LWCA 4E19A 1NK9A 2QXFA 5J2MA 2BANA 2P9NB 2VWBA 3NE6A 2OPPA 2OYQA 2WBNA 3BZKA 3GE1A 3E66A 2RF2A 3LPUA 4CGGA 1TYQB 4RW8A 1VRTA 4O8KA 4DR6K 3KLEA 1NMNA 4DTJA 3JS6A 2ZE2A 1UOCA 4WFBL 3G71N 3D2FB 5AQJA 1M1KO 1LW2A 3Q7CA 1T6CA 2HHSA 3MCPA 3QMLA 1S9GA 4CHOA 1W2BM 2A6AA 2NLXA 4ZTJA 4CK2A 2YX6A 1HNVA 4MDBA 3CCRN 3VGKA 4DQRA 4FLVA 3MXMA 4ZTFA 4IJAA 1TGOA 3V9UA 3SI6A 3AAPA 4CHPA 4KRFA 5H1SQ 3SZ2A 3AO4A 3HXMA 3M3ZA 4AHRA 4DKWA 2UXDK 4BVOA 1Q9YA 5SZTA 1RNHA 5TKYA 1VQKN 5AQGA 1L3VA 3I8DA 3CCMN 2ASMA 3DOLA 4DQIA 2B4JA 1EO1A 1HYVA 3U8XA 1KAZA 3B6PA 4M7YA 2KKZA 3K58A 4C8NA 4OGCA 3TAFA 1QHTA 3TTCA 4GV3A 1LOTB 4HCCA 2FBXA 1KTQA 3MEDA 3L3UA 3P83D 4JKAA 5FPNA 4DU4A 2XY5A 3OBYA 3QIPA 1U2VA 2ZJQL 2ZM6K 1ZBLA 4CJTA 2O4IA 4RTFD 4FWKA 4KBOA 3L2VA 1XWLA 2ASPA 4BR4A 4IXCA 4J2DA 1N32K 4ISGA 3SPYA 3PV8A 3EE9A 2OZMA 3HBTA 3SJHA 4WCEL 1BL3A 2F96A 3M8QA 4CZLA 1S1WA 4DFJA 4EZ6A 2FSJA 1U49A 4JI3K 2E6MA 2P9PA 4EP5A 4DV0K 3SPZA 2IC3A 4KI4A 2O8DA 3M5RA 2P9IB 3H46O 4CFBA 3DXKB 4JRPA 4E3SA 3VERA 5CYQA 4BRHA 2FBTA 3NF8A 3ZT2A 2AP1A 5JS2A 3FGUA 3BP8A 3LL3A 3QO9A 3L2UA 4FZYA 3RMAA 3VGMA 2O8CB 2NRTA 2HVIA 3V9SA 3C6TA 4W5TA 1U45A 2HHTA 2KW4A 2A40A 1HJOA 1RTJA 1NOZA 5FPMA 3C7NA 4DSIA 1RBTA 4H0YB 2P9UB 4IG3A 2XY8A 4YHHK 3SCXA 4B9TA 4JKFA 4BE2A 4CGHA 3VOVA 2HF3A 3AO1A 2D4WA 1KAYA 3C94A 4RG8A 3G4SN 3RMDA 3O4QA 3VQ8A 4FO0A 3CG7A 4GV6A 4CBWA 4BWJA 4A2AA 4IO9L 3IDHA 3I8BA 3NGYA 4YOTA 3CCEN 5DK5A 2P9KB 4IFEA 4F9OA 2CH6A 3CJ1A 2LSNA 2DPNA 3SBGA 2E88A 4AH9A 3CM6A 4M3ZA 4CI6A 3CF5L 4JI1K 3P31A 3DLGA 3VEOA 3LZJA 2F8TA 1VAZA 4W5OA 2HBLA 1TUYA 2HW3A 4BGBA 4CEBA 5BREA 4DS5A 3ID8A 3VQ6A 4E0DA 1N8RO 4LF9K 1B92A 3U9DA 3WQTA 5AQHA 4Y0WA 4FJ5A 4ELUA 4JAXA 1NBWA 2X78A 5AQWA 2DTUA 3ZSQA 4CK3A 4CIGA 3SMPA 3ZSXA 1VSLA 1L3SA 4H5NA 3OYIA 3KK7A 5J1EA 4JHDB 1JXEA 5HOOA 1VSMA 4CJRA 3KK1A 1Q86O 1QSSA 1LW0A 3SK3A 3JAMO 5AZJA 3IFRA 1WSIA 3NBPA 1EKEA 4BRQA 3GDQA 4DQSA 5IT9O 2XY7A 2FSKA 3HYFA 4I6MB 4GMJB 1XC3A 2YNFA 3CIPA 1VSKA 1V4SA 1K73O 4DSFA 3EL2A 3W3DA 4FZXC 4FLXA 2NUBA 4CHZA 2QWOA 1FJGK 4FK0A 4LF7K 3AVJA 1T03A 1E3MA 2QKBA 2OPQA 3RSEA 3FZMA 4M7XA 3IG1A 4CHNA 3HO1A 3ULEB 3EN9A 5ADXA 1SL0A 4DR7K 1VRUA 3AGKA 4WQ5C 4CF8A 3IAYA 3BZCA 4LF8K 1TKTA 3HL8A 3HM9A 3KTQA 2Z1JA 2YHWA 4JKGB 4KHUA 3HOTA 3DXMA 3CD6N 3LALA 3TU5A 4YOUA 4JI8K 1RT1A 5B8HA 1YT3A 1Q9XA 1TKDA 4LSNA 1QS4A 1NGJA 4CFAA 3ZSZA 1REVA 3K9KA 3LWLA 4DQPA 4KREA 3DYAA 1YJ9N 1VHXA 1NK7A 1YJNN 4H0PA 2VWJA 3H08A 1ZBHA 3WNFA 1HYSA 3CCLN 4CVNE 1QVGM 1TKXA 1U6ZA 4F2RA 5C2DA 3F5TA 2ZJRL 4DV6K 1S1VA 1WBDA 5AJ3K 3VQDA 3RTVA 3BUZB 4J2BA 2F4VK 4CFCA 2VG5A 1OVQA 4JKBA 4DSJA 2RN2A 4ID1A 3ZEUA 1BQMA 4BROA 4PL7A 5LL6Z 4BC2A 5CZ1A 5AQMA 4W5RA 2HBMA 3VF4A 3ZSVA 1W7AA 4JD2B 2WFBA 4K43A 4RWTA 3THWB 4AILC 3FZLA 5J2NA 1T05A 5F2RA 1BCOA 4JEPA 4DSKA 4OVLA 2VCPA 3DJCA 3VETA 4M3UA 1V4TA 4N56A 1TAQA 3G6EN 5AQKA 3KWIA 4JKDA 3CJAA 4DTPA 4BRPA 3S3MA 1EWRA 2CH5A 3O9QA 3O9UA 4DFMA 3AVIA 5DMRA 4PKIA 4C8KA 3HVRA 2P51A 2ZD1A 5FPEA 3GOIA 4KHSA 4H5RA 3U3GA 2QKKA 3QFUA 1NNEA 3VEWA 3PO4A 3L2QA 1FKPA 1JCGA 4B8CA 3H1VX 3I56N 4YDUC 1HLUA 4XH4A 2V7ZA 5I3UA 1RBRA 2UXBK 4FZZA 3ZX0A 3HSCA 1GOCA 1W0HA 4FW1A 4IBNA 5BR8K 3V4IA 1JLGA 3F9MA 4DSEA 2UUBK 3RWUA 4CBXA 2ITMA 4NYFA 4E7LA 3DM2A 4LFCK 1P8ZA 3T69A 1NKEA 1N5YA 2KTQA 4NB4A 4Z4HA 1JXBA 4JK7A 3CJ7A 4B3MK 4IDKA 2O8FB 4I9QA 3HPGA 3I0SA 2ZWHA 3GL1A 4HHTA 1NGIA 2QI2A 3VMFB 4E1NA 2QWLA 3RMBA 3J81O 2YKMA 4JRQA 1VSEA 3SBTA 4Z4EA 3KK2A 4MO4A 1BA1A 3G0ZA 3HPOA 3QNNA 3MAQA 2VG6A 3CXCM 2P5GA 4HWIA 2IVOA 3M8PA 1HRHA 3TTDA 4FWRA 5AQQA 3OYLA 5GINA 5M1QA 4JK8A 4FWSA 2KHOA 4CJLA 1EX4A 2YNIA 3BGRA 1TUUA 4IOCL 3AO2A 1M90O 3MWTA 4FJKA 1S6QA 3CC2N 1KVBA 3LP3A 5GAGP 3MXIA 3J80O 4ILGB 3J7ZO 1YVNA 4NXNK 4PA1A 1SV5A 1XNQK 4YFUA 2BE2A 3AVMA 3KLIA 1S1TA 5D3GA 4B1UB 1BA0A 4AHTA 3V9XA 4CHQA 5AQPA 4OPJA 3WXKA 1WSHA 1HR0K 4CJFA 4RCHA 3VPZA 4LY7A 4DU3A 3ZETA 1FXXA 2W42A 4LFBK 3E9LA 5JVHL 4PQUA 1VQPN 4JKHA 2BGGA 3KK3A 1IKVA 1C6VA 4FLZA 4EHTA 2ZGZA 3PX4A 3F9KA 3VN5A 5C0YA 1DKGD 2Q0RA 1SZ2A 3ULDA 3OYAA 4GV9A 4K41A 4H4OA 4CFDA 4IWVA 3KD5E 4FLWA 5AQUA 4JS5A 1WOQA 3TAQA 1OH5A 1RGIA 3TAEA 3E9PA 2HNYA 1RFQA 2IDOA 3LDQA 3D7EO 1SUQA 3K5NA 4BG8A 5EXWA 3K5LA 4U67L 1BI4A 2HB5A 4NCAA 3VGLA 4OO1J 5JICA 5K14A 4FWNA 2VGMA 3MEEA 4AHVA 1NGBA 5HBMA 3WXMB 5BRDA 3U3YA 3AAQA 1I94K 1IKWA 4DR5K 3L4IA 4FM1A 2NRHA 2QWPA 4DFPA 1WAFA 1HX1A 2GEMA 4FJIA 5EU7A 5C25A 4PL8A 5LY3A 4JKEA 3EY1A 3OYFA 3QFPA 3LDNA 3DRSA 1DT9A 3VQ5A 4FM0A 4L8RB 4H4MA 4FJ9A 1Y64A 5KQDA 3ZYYX 3VA0A 4W5QA 3OYMA 1NWKA 1O1WA 1X1PA 1TAUA 3VA3A 3O3FA 4H0TB 1T7PA 2OANA 2A41A 2G8VA 4IEEA 3QIOA 2PFUA 5FLXO 5CZ2A 3FLCO 1C0UA 1UAXA 1ASWA 2QWQA 3ISNC 4Z4CA 1P90A 3VTIA 3ZSWA 1JLCA 1L3UA 4K42A 4CBUA 1IV0A 4GVEA 2JGUA 1FKOA 3K2PA 4HUEA 1VQON 2HHQA 4Z0UA 4E7KA 4JI2K 2D0CA 3DOKA 1GLEG 4CJ4A 5AQOA 1QTMA 4Y1CA 1JCFA 3MN6A 1KQSM 4KTQA 3PIPL 4BRAA 1FW6A 4M41A 1SAZA 3TSQA 3QEXA 3SYZA 3UKUA 3RSEB 4BGAA 2I7NA 3A5OC 4AHCA 2ZF5O 4I7FA 3L2WA 5EX5A 4DV1K 3MX2A 4RW4A 5M1OA 1JL1A 5BPNA 2UUAK 3WEEB 3DXMB 3UIQA 5DM7L 1YI2N 4B9SA 1A5XA 1I39A 2XO7A 4MLHA 5BN8A 1J53A 2R7YA 4ILJA 3KLHA 4A61A 1QQMA 3LWMA 2XY6A 4CZIA 3LP1A 5KPTA 1NK4A 3KKSA 2HBJA 2HSTA 3L0QA 4X66K 4F3OA 4CJQA 1XHXA 3F2KA 1S6PA 2VG7A 3QLHA 4LC9B 4WFNL 5TKWA 3MWPA 3ZSRA 4LF4K 2J4RA 4KHWA 1KD1O 4FWQA 3PUFA 1GLLO 1NU0A 1NK8A 1NGEA 4FJ7A 4PHTX 1YJWN 4B3TK 1EWQA 4I2QA 2GELA 1NGGA 4FJNA 3ZEUB 5I42A 4BR5A 1QE1A 3HZ6A 1YVUA 1JLEA 3TARA 3AVAA 3U4LA 4BQZA 4WYBA 2HBKA 2YHYA 3ZT1A 5ADXH 2YCHA 3AARA 3MEGA 3VTHA 4TSXA 3QETA 5M1PA 1J5EK 1S1XA 2FSNA 4MO5A 5GAHP 5T7BA 1Z05A 4H0XB 3L4QA 3O9SA 1UA1A 1B9DA 2GX9A 2GUIA 5C42A 4DF4A 1U47A 2BUPA 1J9AA 3VQ7A 1GOAA 3LPTA 5AFUA 3D2EA 3ZT4A 1KC8O 2GV9A 5I9EB 4C8LA 1XMOK 4BDYA 3IUCA 3OYCA 1Q18A 3TANA 3HP9A 3P4IA 3ITHA 4FSVA 3BF1A 5AQXA 1GLCG 4M3WA 4W5NA 1TVRA 3DWLA 4WE1A 3IMXA 2OCEA 4CEEA 4B9NA 4JV5K 4CJ5A 3VQQA 4BDPA 1Q81O 4M45A 1EETA 4B1WB 2WTUA 1D9DA 3PO5A 5AR0A 4E89A 1K6YA 3CQXA 1ZBFA 2P9LA 5AQLA 4B9LA 2UU9K 5GAEP 2P9SB 2IVPA 4CZJA 1IKXA 1K8KA 4LH4A 4DB3A 4K8ZA 1OVYA 1N6QA 1KFDA 2DFEA 1JLFA 3C6AA 5AQSA 3OYBA 3V81A 1KFSA 4DLGA 3AVCA 1BDGA 3QEIA 3U9ZA 1VSIA 4BR7A 4CF1A 4H5TA 4X65K 2NRVA 1XI1A 2P1JA 1KVAA 3MK6A 3UKRA 1KRPA 5HRRA 1J5OA 1KVCA 4X62K 1OH6A 4PWDA 4UY8O 4MDAA 3OS1A 2XRIA 4NCBA 5F1XA 3DRRA 4OPKA 2RPIA 3WUHA 3OHRA 4O5FA 5AZIA 2F8SA 3HI0A 1GOBA 4B9UA 1ZBIA 4CJ7A 1WAJA 1VQMN 4KHNA 1GLDG 2GUPA 5C10A 3MN5A 2E20A 4QAGA 3KKRA 3KJVA 2B5JA 1I3AA 2GWKA 4EZ9A 4OPHA 1XMQK 1N33K 5J2PA 4BACA 5M1NA 4BRNA 3HP6A 3D6RA 3NAEA 4JK9A 1B9FA 3CQ8A 4CF0A 3HSTB 2DY4A 1QSYA 2WOMA 3WXJA 1NG9A 1XNRK 3OYNA 4AF1A 1BGXT 4C8MA 4CJEA 3VESA 1EP4A 4QOZB 1MDUB 3A0IX 4HTUA 5KTQA 3OY9A 3AVGA 3VF6A 5JVGL 5LMUK 3VQAA 4CD1A 1VQNN 3M6GA 3N4QA 4L3QA 4WQ5A 4YOYA 4XEIA 2P9NA 2QWRA 4DTXA 3ALYA 1IG9A 1JCEA 3HOSA 3UE5A 4H0OA 3R8EA 3TABA 3WXIA 5F0XA 1FK9A 4OLAA 1ZYQA 4FVMA 2ZJPL 4CJSA 1TYQA 3PX0A 3I0RA 4DR1K 1J6ZA 3HM8A 4LH5A 2YNHA 3D2FA 3HK2A 4CERA 2PYLA 1A5WA 3FFKB 1KAXA 3NCIA 4PKHA 4BRFA 1QZ5A 2Q0UA 1HQEA 4O55A 3HJFA 1XC9A 3RVCA 1S1UA 1SL2A 1BISA 4FOIA 4N76A 4WFAL 1NJZA 4DV4K 4LFAK 2O8BB 1C1BA 3NVMA 4Q5VA 1KLMA 3OJSA 2D0PA 4FCYA 1RTIA 3P5JA 3QERA 2XHBA 3C0BA 4QCLA 1BU6O 4CECA 1UA0A 2G8KA 4Z94A 3ZT0A 3BF3A 3LP0A 4FJGA 3O80A 1QHAA 4M3XA 4DMNA 3CJBA 3FZHA 4KHPK 2NRXA 1RBUA 3ZX2A 1K8AO 1NGDA 3DLRA 3MCAB 5BPMA 1SKRA 5DM6L 2H3GX 2HOEA 2P5OA 4JNEA 4IKFA 4GKKK 2I7PA 3AO3A 4DTNA 4FWLA 3NDKA 2EX3A 5FRMA 4AHSA 5AQNA 1BG3A 4FLTA 2A42A 4AM7A 4OGEA 4J8FA 3WNEA 5MLCQ 3OYKA 4BE0A 5JS1A 2P9IA 3OA9A 3SUQA 3DXKA 3VEYA 3RRGA 3S9HA 4LF5K 1D4XA 2PZSA 3LM2A 4CEDA 2OTLN 1HKGA 4FK2A 4YDUA 4JN4A 4B1XB 1TK8A 4HUFA 3CCQN 2O8CA 1U4BA 4H8KA 1IBMK 3UKUB 4FJHA 2X6SA 1LAVA 4CJVA 3AVLA 2NRZA 4FLYA 4DTOA 2E5LK 3SAFA 2E4LA 2P9UA 3G10A 2PY5A 3CC7N 5BRHA 3IRXA 1TL3A 1RT7A 4CJPA 2ITGA 1RDAA 1C0GA 1C0TA 3CQYA 5KPRA 4OJRA 3THXA 1IO2A 4CEQA 2CGKA 2W6LA 3DAWA 3VQPA 4DV5K 3QBWA 4JI4K 4DFKA 4ISFA 1NGAA 1YF5L 2HHWA 4CZGA 3TAGA 4I9LA 4IOXA 1BOTO 2F9TA 1MA9B 4WQ4C 1YXQA 3AVBA 4DU1A 2P9KA 1XHZA 2OTJN 2Q31A 1VSJA 4CGJA 5C12A 4R79A 3VF2A 2KLAA 2D1KA 4KV8A 1C0MA 1GLFO 2YHBA 3V1OA 3FZKA 4FJMA 2V51B 2WUSA 1RBVA 1U2VB 1TKZA 4H5VA 2HMPA 4BR9A 3O5BA 4KFBA 4G9ZA 2Q2RA 4IO8A 4BG9A 1TV6A 2A5XA 3K5OA 3IKMA 1LV5A 3GG4A 3NF9A 3A5NC 3LAMA 4CF2A 4QS9A 5CHIA 5JMVA 1DLOA 3L8BA 4BR2A 2P9PB 2O8EA 2YJEA 2O8DB 2HNZA 1DGKN 3S3OA 2Z1IA 3SNNA 1ATSA 3KD1E 2QTDA 4NO7A 3S3NA 4JLHA 4YNQA 1E4GT 4WF9L 5BN9A 4B1ZA 3J7YP 4YY3K 2V7YA 4I2PA 4I6MA 1HPMA 4OPAA 1TK5A 3AY9A 3ENHA 3HRGA 4KPYA 3ZSOA 2ETJA 1QQNA 4BC5A 5A2QO 1HNWK 4JKCA 4XH1A 3H3OB 1G15A 3O1WA 1NGFA 4R5PA 1XUPO 3M8SA 3C7NB 3O08A 2RHKA 4EFHA 5C2FA 4CEAA 3ZLJA 3ASMA 4JI6K 4FPBA 1TK0A 3SQ2A 3F73A 2OPSA 4QS8A 2HHHK 1MU2A 1Q82O 4LSLA 4DUZK 1MWMA 3CJCA 3SJJA 4JKGA 1ASUA 3E9OA 1SQKA 2ZQBA 3D45A 1K8KB 3TAPA 1NLVA 3MDQA 3H3NO 2YJFA 1WNSA 4FOEA 1DTTA 4M3RA 4B1VA 1LWEA 3QICA 2OA8A 3NH0A 1JLQA 1WSJA 4BE1A 3GBTA 2Y1IA 4E7JA 3V1RA 1HNIA 3M1FA 2VGNA 2YKNA 1IG8A 2W6KA 4GW6A 4BREA 1ATRA 5AFUH 3CCUN 1QVFM 1ZC6A 2KFZA 3B8AX 4LF6K 3J7AP 4IFYA 3OJUA 4KH6A 3CI5A 5GADP 4OKEA 1LAWA 4Z4IA 4IJNA 5EVZA 5AZIB 3A2FA 3ATVA 3CC4N 2HF4A 3NF6A 3OVNA 4JD2A 4CZKA 3THWA 2IOCA 4YOXA 3C95A 5AZJB 3DLLL 5CE3A 1VK0A 2ZGYA 1WN7A 3QBXA 3NHGA 1NJYA 2WONA 1GLAG 3R6MA 4N47A 5AQVA 1O13A 4KHYA 3AGRA 4CEOA 1RT5A 4N41A 2G8FA 4EAHD 1VSDA 2RE2A 4DV3K 2JWLA 3HTVA 4DS4A 4FW2A 5SWMA 5FPDA 1H1VA 3OYJA 3NFAA 2G8WA 3SV3A 2HHXA 3O3GA 4DLEA 2AA4A 1EXQA 4DG1A 4EIAA 4FJLA 2O4GA 4X64K 2IIRA 1CZBA 3T1YK 4FXDA 4CESA 2HVHA 2NRWA 3ZX3A 2VQFK 4DUYK 1VQ7N 3VQEA 3SUNA 5J2QA 3NH2A 4ICLA 3PLAA 5E84A 2D5RA 5HRSA 1RT2A 4Y1DA 3K0SA 1VQ6N 1HJRA 2PAVA 3LDLA 3SUOA 4Z4FA 1W97L 2X6NA 1C0FA 2YHAA 3QINA 4BC4A 1S72N 5CY4A 3JYTA 4UQGA 2HMIA 3TSPA 3SQ1A 4KAZA 1NGCA 3TR8A 3WNGA 3SAHA 5HLFA 1KSPA 3SUPA 2O8FA 3FFIA 3CMEN 4C8OA 3JXUA 2QK9A 4ELTA 1EQYA 1KXPA 3P38A 4DCHA 2HNDA 5EY4A 3VQCA 3OTOK 4B3SK 1NGHA 1YTAA 4FWOA 3NF7A 4M63C 3OW2M 4DQQA 4E7HA 2VYPA 2FBYA 5AQRA 2E2QA 1BCMA 3DLHA 2E6LA 2QEXN 2F7TA 1BO5O 1RT4A 3V9WA 2Z1HA 5IWAK 3R9PA 3WXLA 4EHUA 3K59A 1MWKA 3LP2A 3SMSA 5M1KA 5E41A 3OYDA 4DV2K 1ILYA 3DI6A 1CZ9A 2IAJA 2RKIA 4O0JA 2YV0X 1RTHA 2G8IA 1X9WA 3KVGA 4B9VA 3EZWA 4CD3A 1LCUA 3PX6A 1VQ5N 1NKCA 2E1YA 3T19A 1RT6A 1X3MA 3C6HA 1X3NA 3SQ4A 1HNXK 1D5AA 4AHUA 3NH1A 3TWHA 4BY9C 4CIEA 1WB9A 1IBKK 1BWFO 4FJ8A 4B9QA 2FF6A 4ZHRA 1G99A 1WSFA 1Z25A 3PIOL 3OYHA 1HMVA 4JI0K 2E1ZA 2GTDA 1CLQA 1VQ4N 1BHLA 3J8AA 3NGIA 1NK6A 1ITGA 3LDOA 3E01A 1ZBUA 4GY2B 3MN7A 3T1AA 1VSFA 5JLFA 1OKJA 2QM1A 1IH7A 4J2EA 4GKJK 3P1GA 4NXMK 3RR7A 4OKJA 1K9MO 2I5JA 4HTLA 2Q36A 2W41A 3S41A 4IEIA 3IS9A 5KI6A 4BC3A 1JLAA 3THXB 4K25A 2A1RA 2UUCK 2CGJA 3OS0A 3C6UA 4O44A 4CZMA 3EZ5A 1QZ6A 3ENOA 2QWMA 3KLGA 3AVNA 4BVPA 3QEWA 1A5VA 5KGWA 4CE9A 2DFFA 3O1BA 1VQ9N 3BDPA 2Q1NA 3A5LC 1QQCA 3QESA 3CFPA 3V1QA 1E4FT 3MN9A 2VWKA 1NKBA 4GVMA 2D0OA 1QQOA 4B08A 4KH5A 4A59A 1HYZA 3AA4A 1DEJA 4OX9K 3C65A 1T8EA 4QS7A 4F4KA 4PKGA 1U48A 4PY5A 1WSGA 2QXLA 3CETA 1T6DA 1OH7A 3R3LA 1WLJA 3OS2A 3TI0A 3O4WA 3KZBA 1Q7YO 2OPRA 3BEXA 1RCHA 3WQUA 3CCSN 2O8EB 4BRGA 4CGIA 4CCHA 2D0BA 2OZSA 1C1AA 4DSLA 1HPZA 3WT0A 4CJUA 1CZAN 3ID6A 4O8UA 4AQYK 3MMVA 2FC0A 1RDCA 1S22A 3ZETB 3THYA 3OYGA 2D0AA 4RW7A 4HUGA 3K57A 3CPWM 3EE8A 3SLCA 1BUPA 3AVKA 4BRIA 3O9RA 5AQTA 1D9FA 4FK4A 4KKOA 1T44A 1IKYA 4E1MA 2IGIA 3FZFA 3ENBA 3B6OA 1BQNA 3KIOA 2EHGA 3THVA 2JWKA 4EP4A 2IS3A 4FLUA 3FE1A 4CEFA 1UWBA 4FJJA 4FPAA 4KB0A 5EOYA 1NJXA 1NM1A 5FROA 3LANA 3O8MA 5C24A 2WC9A 4C1NI 3LM9A 3WEEA 4A5BA 4DTMA 4KHQA 4BRDA 2PYJA 4KH4A 1QSLA 1D8YA 2E2PA 2YI1A 3CMAN
chains in the Genus database with same CATH topology
2KW4A 1C0UA 1UAXA 1ASWA 1TKZA 1C1CA 1RTJA 3SV4A 1NOZA 1BI4B 3ISNC 4DSIA 4Z4CA 3V6DA 3ZSWA 1RBTA 1JLCA 4KFBA 4DTUA 1L3UA 4IG3A 2Z1GA 2XY8A 2JGUA 4F8RA 1FKOA 4F3TA 1TV6A 3K2PA 4HUEA 3SCXA 2HHQA 4Z0UA 4E7KA 4B9TA 2D0CA 1RBSA 3DOKA 4BE2A 3K5OA 4CJ4A 4CGHA 1QTMA 4Y1CA 1LV5A 3NF9A 3LAMA 4CF2A 2KFNA 1DLOA 3AO1A 4KTQA 4CIFA 3L8BA 4M41A 4CGFA 3C94A 4RW6A 4RG8A 3RMDA 3O4QA 4J2AA 3VQ8A 3DRPA 2HNZA 3CG7A 3S3OA 2Z1IA 3QEXA 3SYZA 3SNNA 1F21A 3KD1E 4BWJA 4JLHA 3S3NA 4AHCA 4I7FA 3L2WA 3NGYA 4YNQA 4CF9A 4RW4A 5HP1A 3WNHA 3K5MA 2Q3SA 5DK5A 3QEVA 1JL1A 4CJ3A 3O3HA 3CYMA 3DLKA 4RW9A 4I2PA 3ZCMA 1TK5A 2LSNA 4B9SA 3UIQA 1A5XA 4KPYA 2KZMA 3ZSOA 2ETJA 1I39A 3CFOA 2XO7A 3U6FA 4AH9A 3CM6A 4M3ZA 1J53A 2R7YA 3DLGA 1G15A 3KLHA 3LZJA 4XIUA 2F8TA 4R5PA 3M8SA 4W5OA 1JLBA 4CEAA 3ASMA 3LWMA 4JS4A 2XY6A 3D0PA 4HCBA 3LP1A 2GBZA 1Q8IA 1HQUA 4F2SA 4DS5A 4CEBA 3KKSA 1NK4A 4M3TA 2HW3A 2DFHA 1TK0A 3SQ2A 3F73A 3VQ6A 2G8HA 4E0DA 4F3OA 2OPSA 4CJQA 1XHXA 1B92A 1S6PA 2VG7A 4G1QA 4FJGA 3QLHA 1MU2A 4FJ5A 4ELUA 2X78A 4ID5A 2DTUA 3ZSQA 4LSLA 4CK3A 3ZSRA 4CIGA 3SJJA 5KRTA 4KHWA 3DLBA 3ZSXA 4CHYA 1VSLA 1ASUA 1L3SA 4KI6A 3PUFA 3RMCA 2ZQBA 3D45A 3O4NA 5J1EA 3OYIA 1JXEA 1NK8A 4FJ7A 1VSMA 4CJRA 3TAPA 3KK1A 1QSSA 1LW0A 1NK0A 3AVFA 4I2QA 1WNSA 4DTSA 3LZIA 1WSIA 1DTTA 3NBPA 4M3RA 4N5SA 1LWEA 4O4GA 4FJNA 2OA8A 3NH0A 1JLQA 5HRPA 1EKEA 5I42A 1WSJA 1QE1A 4DQSA 1JKHA 1YVUA 4CJKA 4BE1A 1JLEA 1BIZA 2Y1JA 2XY7A 3HYFA 3TARA 1W9HA 3AVAA 4GMJB 4E7JA 2Y1IA 3MXJA 2YNFA 3V1RA 1VSKA 1HNIA 4IG0A 3ZT1A 2YKNA 4DSFA 3ZSYA 4FZXC 4GW6A 1CXUA 4FLXA 3MEGA 2NUBA 4CHZA 4TSXA 1X9MA 3QETA 4FK0A 1S1XA 4CK1A 3AVJA 4Q0BA 1L5UA 1DTQA 5T7BA 1T03A 2KFZA 1KCFA 3M8RA 2QKBA 4IFYA 2OPQA 3OJUA 1UA1A 1B9DA 2HHTA 3IG1A 4CHNA 3HO1A 2GUIA 5C42A 4OKEA 3OYEA 4DF4A 1SL0A 1U47A 1JL2A 1LAWA 4Z4IA 1VRUA 4CF8A 3IAYA 2JLEA 1J9AA 3VQ7A 1GOAA 1TKTA 3HL8A 3A2FA 3LPTA 1CXQA 3ZT4A 3HM9A 2Z1JA 1SKSA 3KTQA 2GV9A 4KHUA 3LALA 3NF6A 3OVNA 4C8LA 4KO0A 1RT1A 4BDYA 4M42A 1RDDA 1YT3A 1Q9XA 1TKDA 4LSNA 3OYCA 2IOCA 4LD0A 3TANA 3HP9A 3C95A 3AA2A 3MECA 1RDBA 1QS4A 3ITHA 4CFAA 3AVHA 3ZSZA 1REVA 3LWLA 4DQPA 1VK0A 4M3WA 4KREA 4W5NA 1WN7A 1TVRA 3NHGA 1NJYA 5FRNA 3DYAA 4WE1A 2WONA 4CEEA 1NK7A 4B9NA 4CJ5A 4BDZA 4N47A 3VQ4A 2VWJA 3VQQA 3H08A 4BDPA 1ZBHA 4M45A 1EETA 3WNFA 3L2RA 4KHYA 1HYSA 1D9DA 3PO5A 2FBVA 4CEOA 1TKXA 4E89A 1K6YA 1NJWA 4F2RA 1RT5A 4N41A 1ZBFA 2G8FA 4B9LA 1S1VA 1VSDA 2A1SA 1SKWA 3VQDA 3RTVA 4DS4A 1IKXA 4MFBA 4DWIA 4FW2A 4LH4A 3AO5A 5SWMA 4K8ZA 4J2BA 4B3OA 3OYJA 1N6QA 1KFDA 3NFAA 4CFCA 2G8WA 2DFEA 1JLFA 2VG5A 3LAKA 3SV3A 2HHXA 3OYBA 3V81A 3O3GA 1KFSA 4DLEA 4DSJA 4DG1A 1EXQA 2RN2A 4ID1A 4FJLA 3QNOA 1BQMA 4DLGA 2O4GA 2HHUA 3AVCA 4DF8A 4OLBA 1CZBA 3QEIA 3HVTA 4CESA 4FXDA 5CZ1A 2HVHA 4W5RA 4BWMA 3VQEA 3SUNA 3T3FA 3ZSVA 4K8XA 1VSIA 3RRHA 5J2QA 4FJXA 3CM5A 2KQ2A 5KGXA 3NH2A 4ICLA 2D5RA 1U04A 5HRSA 1RT2A 4Y1DA 1BIUA 4AILC 4CF1A 5J2NA 3HPHA 1T05A 1NK5A 2KZZA 1HJRA 3DMJA 1XI1A 1BCOA 2P1JA 1KVAA 4ELVA 2HHVA 4DSKA 3JSMA 4Z4GA 3SUOA 4Z4FA 1KRPA 2X6NA 3L3VA 4OVLA 5HRRA 1KVCA 1J5OA 2YHAA 3QINA 4PWDA 4M3UA 5CY4A 4N56A 3OS1A 2XRIA 1TAQA 3JYTA 4UQGA 4B8AB 2HMIA 3DRRA 4OPKA 3RR8A 4NCBA 3SQ1A 4KAZA 2RPIA 3AA3A 4KTWA 1S9EA 4MQ3A 3TAMA 5HRNA 1R0AA 4DTPA 3TR8A 3S3MA 1VSHA 2F8SA 3WNGA 5HLFA 1KSPA 3SUPA 3FFIA 1GOBA 4DFMA 4B9UA 1ZBIA 3AVIA 2BDPA 1WAJA 4C8OA 1J54A 2YNGA 5DMRA 4KHNA 3SQ0A 2QK9A 4C8KA 1KLNA 4ELTA 3V9ZA 4QAGA 3KKRA 3HT3A 2B5JA 2B6AA 3KJVA 3HVRA 2P51A 1I3AA 1RILA 4CEZA 3QEPA 2ZD1A 4EZ9A 4KHSA 2HNDA 3VQCA 3U3GA 2QKKA 5J2PA 4BACA 1YTAA 3HP6A 1Z26A 3PO4A 3NF7A 3VQ9A 3NAEA 1WSEA 3CQ8A 1B9FA 4DQQA 4E7HA 3ZT3A 3HSTB 4CF0A 1FKPA 2FBYA 3L2QA 3EYZA 1BCMA 3DLHA 2DY4A 4KTZA 4B8CA 1QSYA 2WOMA 2E6LA 4O0IA 1YTUA 3AV9A 4HVJA 5I3UA 1RT4A 3OYNA 1RBRA 2Z1HA 3V9WA 1BGXT 4C8MA 4CJEA 4FM2A 4FZZA 1GOCA 1EP4A 3AA5X 4QOZB 4E7IA 4FYDA 1W0HA 3K59A 4FW1A 1Y97A 4IBNA 1X9SA 4IFVA 3LP2A 4OKKA 5E41A 5KTQA 1JLGA 3OYDA 4HTUA 3DI6A 4DSEA 3V4IA 3OY9A 1LWFA 3RWUA 3AVGA 4NYFA 5CYMA 1CZ9A 3DM2A 3VQAA 4E7LA 2IAJA 2RKIA 1NKEA 1RTDA 4O0JA 1N5YA 2KTQA 2YV0X 4CGDA 4Z4HA 1RTHA 1NOYA 2G8IA 1X9WA 1JXBA 4DTXA 4B9VA 3KLFA 4B9MA 2ATQA 3ALYA 1IG9A 4IDKA 3NGZA 1RT3A 4I9QA 3HPGA 3PX6A 3DLEA 3TABA 4O5BA 1FK9A 5KRSA 1NKCA 3PY8A 1ZYQA 4OLAA 3I0SA 1RT6A 4FVMA 3T19A 4CJSA 1L3TA 3PX0A 3I0RA 3SQ4A 1D5AA 4HHTA 4E1NA 4LH5A 4AHUA 3NH1A 2YNHA 3TWHA 3RMBA 4CIEA 3HK2A 2YKMA 4CERA 4JRQA 2PYLA 4FJ8A 1VSEA 4Z4EA 3KK2A 1A5WA 4NCGA 4ZHRA 1S5JA 1WSFA 4KB1A 3G0ZA 3HPOA 3NCIA 1Z25A 3MAQA 2VG6A 3QNNA 5FDLA 3VQBA 3OYHA 3CFRA 4DTRA 1HMVA 4PUOA 4M3YA 2P5GA 2X74A 3M8PA 1HRHA 1CLQA 5HROA 4NYNA 1BHLA 1NK6A 1HQEA 3NGIA 4O55A 1ITGA 3OYLA 3HJFA 1ASVA 3E01A 1XC9A 1ZBUA 1S1UA 1TL1A 1SL2A 1BISA 3T1AA 1VSFA 4CJLA 1EX4A 2YNIA 1IH7A 1NJZA 4J2EA 4CJWA 3BGRA 4N76A 3LDSA 1C1BA 3AO2A 4Q5VA 1SL1A 1KLMA 3P1GA 4FJKA 1S6QA 2G8UA 3OJSA 3RR7A 1LWCA 4E19A 1NK9A 2QXFA 1RTIA 2BANA 4FCYA 5J2MA 1KVBA 3LP3A 3MXIA 3P5JA 3NE6A 4OKJA 2XHBA 2I5JA 3QERA 4QCLA 4CECA 1UA0A 2OPPA 2G8KA 3IS9A 5KI6A 2OYQA 1JLAA 3ZT0A 3LP0A 2A1RA 2RF2A 3LPUA 4PA1A 1SV5A 3C6UA 4O44A 4CGGA 1VRTA 2BE2A 3AVMA 3KLIA 1S1TA 4RW8A 4YFUA 3KLEA 3EZ5A 4DTJA 2ZE2A 4M3XA 4DMNA 5D3GA 1UOCA 4AHTA 3V9XA 4CHQA 1RBUA 3KLGA 1LW2A 4OPJA 3AVNA 1WSHA 2HHSA 3DLRA 3QEWA 4CJFA 1S9GA 4CHOA 1SKRA 1A5VA 5KGWA 4CE9A 2DFFA 4ZTJA 4LY7A 3BDPA 4DU3A 2W42A 1FXXA 4CK2A 2P5OA 1HNVA 4IKFA 1QQCA 3QESA 4PQUA 3AO3A 3CFPA 4DTNA 3NDKA 4FLVA 2EX3A 3V1QA 4DQRA 4AHSA 3MXMA 4ZTFA 5FRMA 2BGGA 1TGOA 1IKVA 2VWKA 3KK3A 1C6VA 4FLZA 3V9UA 3PX4A 4GVMA 3SI6A 1NKBA 4CHPA 4FLTA 4B08A 4KRFA 3F9KA 3VN5A 3SZ2A 4OGEA 3AO4A 3HXMA 3WNEA 4AHRA 1HYZA 3AA4A 3OYKA 3OYAA 3ULDA 4BE0A 4L8RB 5JS1A 3SUQA 1Q9YA 5SZTA 1T8EA 4F4KA 1RNHA 1U48A 4H4OA 1WSGA 4CFDA 3RRGA 4PY5A 3S9HA 1L3VA 3KD5E 3I8DA 1WLJA 2AJQA 4FLWA 3OS2A 3DOLA 4DQIA 2B4JA 1HYVA 3TI0A 2PZSA 4JS5A 3B6PA 4CEDA 3TAQA 4FK2A 3K58A 2OPRA 4C8NA 1TK8A 4HUFA 1RCHA 4OGCA 3TAEA 3TAFA 1QHTA 1U4BA 4CGIA 2HNYA 4CCHA 4HCCA 2D0BA 1KTQA 1C1AA 2FBXA 2IDOA 3MEDA 4H8KA 2OZSA 4DSLA 3L3UA 3P83D 2XY5A 1HPZA 1SUQA 3K5NA 4CJUA 3QIPA 4DU4A 4FJHA 2X6SA 3K5LA 1LAVA 1ZBLA 4CJTA 4CJVA 2O4IA 1BI4A 3AVLA 2HB5A 4FLYA 4DTOA 3L2VA 2FC0A 4NCAA 1XWLA 1RDCA 2E4LA 3G10A 3OYGA 5K14A 2D0AA 4RW7A 2PY5A 4J2DA 3SPYA 3PV8A 3IRXA 3MEEA 4HUGA 1TL3A 2OZMA 3K57A 4AHVA 1RT7A 4CJPA 2ITGA 5HBMA 3AVKA 3U3YA 1RDAA 1D9FA 1IKWA 1C0TA 4FK4A 4FM1A 1BL3A 2F96A 3M8QA 4KKOA 1S1WA 4DFPA 4DFJA 4OJRA 4EZ6A 1WAFA 4FJIA 1IO2A 4CEQA 1U49A 5EU7A 1IKYA 4E1MA 2IGIA 5C25A 2E6MA 4EP5A 3VQPA 3SPZA 2IC3A 4KI4A 3B6OA 1BQNA 3KIOA 4DFKA 4CFBA 2EHGA 3THVA 3EY1A 3OYFA 3OS0A 4EP4A 3DRSA 4JRPA 2IS3A 3VQ5A 4FM0A 4CEFA 4I9LA 1UWBA 4H4MA 4FLUA 4E3SA 3TAGA 4FJJA 4FJ9A 4KB0A 5CYQA 1NJXA 2FBTA 3NF8A 3AVBA 3VA0A 3ZT2A 5FROA 3LANA 4W5QA 3OYMA 4DU1A 5JS2A 1XHZA 3QO9A 3L2UA 1O1WA 1X1PA 5C24A 1VSJA 2HHWA 4FZYA 4CGJA 3VA3A 1TAUA 3O3FA 3RMAA 4DTMA 4KV8A 4KHQA 1C0MA 2PYJA 2YHBA 3V9SA 1QSLA 1D8YA 1T7PA 2HVIA 3C6TA 3V1OA 2G8VA 4W5TA 1U45A 4FJMA 3QIOA 1RBVA 5CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW4 A;  1C0U A;  1UAX A;  1ASW A;  1TKZ A;  1C1C A;  1RTJ A;  3SV4 A;  1NOZ A;  1BI4 B;  3ISN C;  4DSI A;  4Z4C A;  3V6D A;  3ZSW A;  1RBT A;  1JLC A;  4KFB A;  4DTU A;  1L3U A;  4IG3 A;  2Z1G A;  2XY8 A;  2JGU A;  4F8R A;  1FKO A;  4F3T A;  1TV6 A;  3K2P A;  4HUE A;  3SCX A;  2HHQ A;  4Z0U A;  4E7K A;  4B9T A;  2D0C A;  1RBS A;  3DOK A;  4BE2 A;  3K5O A;  4CJ4 A;  4CGH A;  1QTM A;  4Y1C A;  1LV5 A;  3NF9 A;  3LAM A;  4CF2 A;  2KFN A;  1DLO A;  3AO1 A;  4KTQ A;  4CIF A;  3L8B A;  4M41 A;  4CGF A;  3C94 A;  4RW6 A;  4RG8 A;  3RMD A;  3O4Q A;  4J2A A;  3VQ8 A;  3DRP A;  2HNZ A;  3CG7 A;  3S3O A;  2Z1I A;  3QEX A;  3SYZ A;  3SNN A;  1F21 A;  3KD1 E;  4BWJ A;  4JLH A;  3S3N A;  4AHC A;  4I7F A;  3L2W A;  3NGY A;  4YNQ A;  4CF9 A;  4RW4 A;  5HP1 A;  3WNH A;  3K5M A;  2Q3S A;  5DK5 A;  3QEV A;  1JL1 A;  4CJ3 A;  3O3H A;  3CYM A;  3DLK A;  4RW9 A;  4I2P A;  3ZCM A;  1TK5 A;  2LSN A;  4B9S A;  3UIQ A;  1A5X A;  4KPY A;  2KZM A;  3ZSO A;  2ETJ A;  1I39 A;  3CFO A;  2XO7 A;  3U6F A;  4AH9 A;  3CM6 A;  4M3Z A;  1J53 A;  2R7Y A;  3DLG A;  1G15 A;  3KLH A;  3LZJ A;  4XIU A;  2F8T A;  4R5P A;  3M8S A;  4W5O A;  1JLB A;  4CEA A;  3ASM A;  3LWM A;  4JS4 A;  2XY6 A;  3D0P A;  4HCB A;  3LP1 A;  2GBZ A;  1Q8I A;  1HQU A;  4F2S A;  4DS5 A;  4CEB A;  3KKS A;  1NK4 A;  4M3T A;  2HW3 A;  2DFH A;  1TK0 A;  3SQ2 A;  3F73 A;  3VQ6 A;  2G8H A;  4E0D A;  4F3O A;  2OPS A;  4CJQ A;  1XHX A;  1B92 A;  1S6P A;  2VG7 A;  4G1Q A;  4FJG A;  3QLH A;  1MU2 A;  4FJ5 A;  4ELU A;  2X78 A;  4ID5 A;  2DTU A;  3ZSQ A;  4LSL A;  4CK3 A;  3ZSR A;  4CIG A;  3SJJ A;  5KRT A;  4KHW A;  3DLB A;  3ZSX A;  4CHY A;  1VSL A;  1ASU A;  1L3S A;  4KI6 A;  3PUF A;  3RMC A;  2ZQB A;  3D45 A;  3O4N A;  5J1E A;  3OYI A;  1JXE A;  1NK8 A;  4FJ7 A;  1VSM A;  4CJR A;  3TAP A;  3KK1 A;  1QSS A;  1LW0 A;  1NK0 A;  3AVF A;  4I2Q A;  1WNS A;  4DTS A;  3LZI A;  1WSI A;  1DTT A;  3NBP A;  4M3R A;  4N5S A;  1LWE A;  4O4G A;  4FJN A;  2OA8 A;  3NH0 A;  1JLQ A;  5HRP A;  1EKE A;  5I42 A;  1WSJ A;  1QE1 A;  4DQS A;  1JKH A;  1YVU A;  4CJK A;  4BE1 A;  1JLE A;  1BIZ A;  2Y1J A;  2XY7 A;  3HYF A;  3TAR A;  1W9H A;  3AVA A;  4GMJ B;  4E7J A;  2Y1I A;  3MXJ A;  2YNF A;  3V1R A;  1VSK A;  1HNI A;  4IG0 A;  3ZT1 A;  2YKN A;  4DSF A;  3ZSY A;  4FZX C;  4GW6 A;  1CXU A;  4FLX A;  3MEG A;  2NUB A;  4CHZ A;  4TSX A;  1X9M A;  3QET A;  4FK0 A;  1S1X A;  4CK1 A;  3AVJ A;  4Q0B A;  1L5U A;  1DTQ A;  5T7B A;  1T03 A;  2KFZ A;  1KCF A;  3M8R A;  2QKB A;  4IFY A;  2OPQ A;  3OJU A;  1UA1 A;  1B9D A;  2HHT A;  3IG1 A;  4CHN A;  3HO1 A;  2GUI A;  5C42 A;  4OKE A;  3OYE A;  4DF4 A;  1SL0 A;  1U47 A;  1JL2 A;  1LAW A;  4Z4I A;  1VRU A;  4CF8 A;  3IAY A;  2JLE A;  1J9A A;  3VQ7 A;  1GOA A;  1TKT A;  3HL8 A;  3A2F A;  3LPT A;  1CXQ A;  3ZT4 A;  3HM9 A;  2Z1J A;  1SKS A;  3KTQ A;  2GV9 A;  4KHU A;  3LAL A;  3NF6 A;  3OVN A;  4C8L A;  4KO0 A;  1RT1 A;  4BDY A;  4M42 A;  1RDD A;  1YT3 A;  1Q9X A;  1TKD A;  4LSN A;  3OYC A;  2IOC A;  4LD0 A;  3TAN A;  3HP9 A;  3C95 A;  3AA2 A;  3MEC A;  1RDB A;  1QS4 A;  3ITH A;  4CFA A;  3AVH A;  3ZSZ A;  1REV A;  3LWL A;  4DQP A;  1VK0 A;  4M3W A;  4KRE A;  4W5N A;  1WN7 A;  1TVR A;  3NHG A;  1NJY A;  5FRN A;  3DYA A;  4WE1 A;  2WON A;  4CEE A;  1NK7 A;  4B9N A;  4CJ5 A;  4BDZ A;  4N47 A;  3VQ4 A;  2VWJ A;  3VQQ A;  3H08 A;  4BDP A;  1ZBH A;  4M45 A;  1EET A;  3WNF A;  3L2R A;  4KHY A;  1HYS A;  1D9D A;  3PO5 A;  2FBV A;  4CEO A;  1TKX A;  4E89 A;  1K6Y A;  1NJW A;  4F2R A;  1RT5 A;  4N41 A;  1ZBF A;  2G8F A;  4B9L A;  1S1V A;  1VSD A;  2A1S A;  1SKW A;  3VQD A;  3RTV A;  4DS4 A;  1IKX A;  4MFB A;  4DWI A;  4FW2 A;  4LH4 A;  3AO5 A;  5SWM A;  4K8Z A;  4J2B A;  4B3O A;  3OYJ A;  1N6Q A;  1KFD A;  3NFA A;  4CFC A;  2G8W A;  2DFE A;  1JLF A;  2VG5 A;  3LAK A;  3SV3 A;  2HHX A;  3OYB A;  3V81 A;  3O3G A;  1KFS A;  4DLE A;  4DSJ A;  4DG1 A;  1EXQ A;  2RN2 A;  4ID1 A;  4FJL A;  3QNO A;  1BQM A;  4DLG A;  2O4G A;  2HHU A;  3AVC A;  4DF8 A;  4OLB A;  1CZB A;  3QEI A;  3HVT A;  4CES A;  4FXD A;  5CZ1 A;  2HVH A;  4W5R A;  4BWM A;  3VQE A;  3SUN A;  3T3F A;  3ZSV A;  4K8X A;  1VSI A;  3RRH A;  5J2Q A;  4FJX A;  3CM5 A;  2KQ2 A;  5KGX A;  3NH2 A;  4ICL A;  2D5R A;  1U04 A;  5HRS A;  1RT2 A;  4Y1D A;  1BIU A;  4AIL C;  4CF1 A;  5J2N A;  3HPH A;  1T05 A;  1NK5 A;  2KZZ A;  1HJR A;  3DMJ A;  1XI1 A;  1BCO A;  2P1J A;  1KVA A;  4ELV A;  2HHV A;  4DSK A;  3JSM A;  4Z4G A;  3SUO A;  4Z4F A;  1KRP A;  2X6N A;  3L3V A;  4OVL A;  5HRR A;  1KVC A;  1J5O A;  2YHA A;  3QIN A;  4PWD A;  4M3U A;  5CY4 A;  4N56 A;  3OS1 A;  2XRI A;  1TAQ A;  3JYT A;  4UQG A;  4B8A B;  2HMI A;  3DRR A;  4OPK A;  3RR8 A;  4NCB A;  3SQ1 A;  4KAZ A;  2RPI A;  3AA3 A;  4KTW A;  1S9E A;  4MQ3 A;  3TAM A;  5HRN A;  1R0A A;  4DTP A;  3TR8 A;  3S3M A;  1VSH A;  2F8S A;  3WNG A;  5HLF A;  1KSP A;  3SUP A;  3FFI A;  1GOB A;  4DFM A;  4B9U A;  1ZBI A;  3AVI A;  2BDP A;  1WAJ A;  4C8O A;  1J54 A;  2YNG A;  5DMR A;  4KHN A;  3SQ0 A;  2QK9 A;  4C8K A;  1KLN A;  4ELT A;  3V9Z A;  4QAG A;  3KKR A;  3HT3 A;  2B5J A;  2B6A A;  3KJV A;  3HVR A;  2P51 A;  1I3A A;  1RIL A;  4CEZ A;  3QEP A;  2ZD1 A;  4EZ9 A;  4KHS A;  2HND A;  3VQC A;  3U3G A;  2QKK A;  5J2P A;  4BAC A;  1YTA A;  3HP6 A;  1Z26 A;  3PO4 A;  3NF7 A;  3VQ9 A;  3NAE A;  1WSE A;  3CQ8 A;  1B9F A;  4DQQ A;  4E7H A;  3ZT3 A;  3HST B;  4CF0 A;  1FKP A;  2FBY A;  3L2Q A;  3EYZ A;  1BCM A;  3DLH A;  2DY4 A;  4KTZ A;  4B8C A;  1QSY A;  2WOM A;  2E6L A;  4O0I A;  1YTU A;  3AV9 A;  4HVJ A;  5I3U A;  1RT4 A;  3OYN A;  1RBR A;  2Z1H A;  3V9W A;  1BGX T;  4C8M A;  4CJE A;  4FM2 A;  4FZZ A;  1GOC A;  1EP4 A;  3AA5 X;  4QOZ B;  4E7I A;  4FYD A;  1W0H A;  3K59 A;  4FW1 A;  1Y97 A;  4IBN A;  1X9S A;  4IFV A;  3LP2 A;  4OKK A;  5E41 A;  5KTQ A;  1JLG A;  3OYD A;  4HTU A;  3DI6 A;  4DSE A;  3V4I A;  3OY9 A;  1LWF A;  3RWU A;  3AVG A;  4NYF A;  5CYM A;  1CZ9 A;  3DM2 A;  3VQA A;  4E7L A;  2IAJ A;  2RKI A;  1NKE A;  1RTD A;  4O0J A;  1N5Y A;  2KTQ A;  2YV0 X;  4CGD A;  4Z4H A;  1RTH A;  1NOY A;  2G8I A;  1X9W A;  1JXB A;  4DTX A;  4B9V A;  3KLF A;  4B9M A;  2ATQ A;  3ALY A;  1IG9 A;  4IDK A;  3NGZ A;  1RT3 A;  4I9Q A;  3HPG A;  3PX6 A;  3DLE A;  3TAB A;  4O5B A;  1FK9 A;  5KRS A;  1NKC A;  3PY8 A;  1ZYQ A;  4OLA A;  3I0S A;  1RT6 A;  4FVM A;  3T19 A;  4CJS A;  1L3T A;  3PX0 A;  3I0R A;  3SQ4 A;  1D5A A;  4HHT A;  4E1N A;  4LH5 A;  4AHU A;  3NH1 A;  2YNH A;  3TWH A;  3RMB A;  4CIE A;  3HK2 A;  2YKM A;  4CER A;  4JRQ A;  2PYL A;  4FJ8 A;  1VSE A;  4Z4E A;  3KK2 A;  1A5W A;  4NCG A;  4ZHR A;  1S5J A;  1WSF A;  4KB1 A;  3G0Z A;  3HPO A;  3NCI A;  1Z25 A;  3MAQ A;  2VG6 A;  3QNN A;  5FDL A;  3VQB A;  3OYH A;  3CFR A;  4DTR A;  1HMV A;  4PUO A;  4M3Y A;  2P5G A;  2X74 A;  3M8P A;  1HRH A;  1CLQ A;  5HRO A;  4NYN A;  1BHL A;  1NK6 A;  1HQE A;  3NGI A;  4O55 A;  1ITG A;  3OYL A;  3HJF A;  1ASV A;  3E01 A;  1XC9 A;  1ZBU A;  1S1U A;  1TL1 A;  1SL2 A;  1BIS A;  3T1A A;  1VSF A;  4CJL A;  1EX4 A;  2YNI A;  1IH7 A;  1NJZ A;  4J2E A;  4CJW A;  3BGR A;  4N76 A;  3LDS A;  1C1B A;  3AO2 A;  4Q5V A;  1SL1 A;  1KLM A;  3P1G A;  4FJK A;  1S6Q A;  2G8U A;  3OJS A;  3RR7 A;  1LWC A;  4E19 A;  1NK9 A;  2QXF A;  1RTI A;  2BAN A;  4FCY A;  5J2M A;  1KVB A;  3LP3 A;  3MXI A;  3P5J A;  3NE6 A;  4OKJ A;  2XHB A;  2I5J A;  3QER A;  4QCL A;  4CEC A;  1UA0 A;  2OPP A;  2G8K A;  3IS9 A;  5KI6 A;  2OYQ A;  1JLA A;  3ZT0 A;  3LP0 A;  2A1R A;  2RF2 A;  3LPU A;  4PA1 A;  1SV5 A;  3C6U A;  4O44 A;  4CGG A;  1VRT A;  2BE2 A;  3AVM A;  3KLI A;  1S1T A;  4RW8 A;  4YFU A;  3KLE A;  3EZ5 A;  4DTJ A;  2ZE2 A;  4M3X A;  4DMN A;  5D3G A;  1UOC A;  4AHT A;  3V9X A;  4CHQ A;  1RBU A;  3KLG A;  1LW2 A;  4OPJ A;  3AVN A;  1WSH A;  2HHS A;  3DLR A;  3QEW A;  4CJF A;  1S9G A;  4CHO A;  1SKR A;  1A5V A;  5KGW A;  4CE9 A;  2DFF A;  4ZTJ A;  4LY7 A;  3BDP A;  4DU3 A;  2W42 A;  1FXX A;  4CK2 A;  2P5O A;  1HNV A;  4IKF A;  1QQC A;  3QES A;  4PQU A;  3AO3 A;  3CFP A;  4DTN A;  3NDK A;  4FLV A;  2EX3 A;  3V1Q A;  4DQR A;  4AHS A;  3MXM A;  4ZTF A;  5FRM A;  2BGG A;  1TGO A;  1IKV A;  2VWK A;  3KK3 A;  1C6V A;  4FLZ A;  3V9U A;  3PX4 A;  4GVM A;  3SI6 A;  1NKB A;  4CHP A;  4FLT A;  4B08 A;  4KRF A;  3F9K A;  3VN5 A;  3SZ2 A;  4OGE A;  3AO4 A;  3HXM A;  3WNE A;  4AHR A;  1HYZ A;  3AA4 A;  3OYK A;  3OYA A;  3ULD A;  4BE0 A;  4L8R B;  5JS1 A;  3SUQ A;  1Q9Y A;  5SZT A;  1T8E A;  4F4K A;  1RNH A;  1U48 A;  4H4O A;  1WSG A;  4CFD A;  3RRG A;  4PY5 A;  3S9H A;  1L3V A;  3KD5 E;  3I8D A;  1WLJ A;  2AJQ A;  4FLW A;  3OS2 A;  3DOL A;  4DQI A;  2B4J A;  1HYV A;  3TI0 A;  2PZS A;  4JS5 A;  3B6P A;  4CED A;  3TAQ A;  4FK2 A;  3K58 A;  2OPR A;  4C8N A;  1TK8 A;  4HUF A;  1RCH A;  4OGC A;  3TAE A;  3TAF A;  1QHT A;  1U4B A;  4CGI A;  2HNY A;  4CCH A;  4HCC A;  2D0B A;  1KTQ A;  1C1A A;  2FBX A;  2IDO A;  3MED A;  4H8K A;  2OZS A;  4DSL A;  3L3U A;  3P83 D;  2XY5 A;  1HPZ A;  1SUQ A;  3K5N A;  4CJU A;  3QIP A;  4DU4 A;  4FJH A;  2X6S A;  3K5L A;  1LAV A;  1ZBL A;  4CJT A;  4CJV A;  2O4I A;  1BI4 A;  3AVL A;  2HB5 A;  4FLY A;  4DTO A;  3L2V A;  2FC0 A;  4NCA A;  1XWL A;  1RDC A;  2E4L A;  3G10 A;  3OYG A;  5K14 A;  2D0A A;  4RW7 A;  2PY5 A;  4J2D A;  3SPY A;  3PV8 A;  3IRX A;  3MEE A;  4HUG A;  1TL3 A;  2OZM A;  3K57 A;  4AHV A;  1RT7 A;  4CJP A;  2ITG A;  5HBM A;  3AVK A;  3U3Y A;  1RDA A;  1D9F A;  1IKW A;  1C0T A;  4FK4 A;  4FM1 A;  1BL3 A;  2F96 A;  3M8Q A;  4KKO A;  1S1W A;  4DFP A;  4DFJ A;  4OJR A;  4EZ6 A;  1WAF A;  4FJI A;  1IO2 A;  4CEQ A;  1U49 A;  5EU7 A;  1IKY A;  4E1M A;  2IGI A;  5C25 A;  2E6M A;  4EP5 A;  3VQP A;  3SPZ A;  2IC3 A;  4KI4 A;  3B6O A;  1BQN A;  3KIO A;  4DFK A;  4CFB A;  2EHG A;  3THV A;  3EY1 A;  3OYF A;  3OS0 A;  4EP4 A;  3DRS A;  4JRP A;  2IS3 A;  3VQ5 A;  4FM0 A;  4CEF A;  4I9L A;  1UWB A;  4H4M A;  4FLU A;  4E3S A;  3TAG A;  4FJJ A;  4FJ9 A;  4KB0 A;  5CYQ A;  1NJX A;  2FBT A;  3NF8 A;  3AVB A;  3VA0 A;  3ZT2 A;  5FRO A;  3LAN A;  4W5Q A;  3OYM A;  4DU1 A;  5JS2 A;  1XHZ A;  3QO9 A;  3L2U A;  1O1W A;  1X1P A;  5C24 A;  1VSJ A;  2HHW A;  4FZY A;  4CGJ A;  3VA3 A;  1TAU A;  3O3F A;  3RMA A;  4DTM A;  4KV8 A;  4KHQ A;  1C0M A;  2PYJ A;  2YHB A;  3V9S A;  1QSL A;  1D8Y A;  1T7P A;  2HVI A;  3C6T A;  3V1O A;  2G8V A;  4W5T A;  1U45 A;  4FJM A;  3QIO A;  1RBV A;  5CZ2 A; 
#chains in the Genus database with same CATH topology
 3QB0 A;  1C1C A;  3SV4 A;  1BI4 B;  3V6D A;  4BRC A;  1NJI O;  3VEZ A;  4B3R K;  4DTU A;  1YIJ N;  2Z1G A;  4BRM A;  3I55 N;  1JJ2 M;  4F8R A;  4F3T A;  3H1Q A;  1RBS A;  2A3Z A;  3QDK A;  2NZT A;  4H5W A;  2KFN A;  2EWS A;  5M1F A;  2ASO A;  4CIF A;  4CGF A;  4RW6 A;  4B1Y B;  4J2A A;  3DRP A;  5LMN K;  4C23 A;  1F21 A;  3MX5 A;  3O6W A;  2QW9 A;  4CF9 A;  5HP1 A;  3KWG A;  3WNH A;  3K5M A;  4E1J A;  2Q3S A;  1IBL K;  3QEV A;  4CJ3 A;  3O3H A;  3PSI A;  3CPE A;  3CYM A;  5AQY A;  3DLK A;  4RW9 A;  3ZCM A;  5JLH A;  2KZM A;  3CFO A;  3U6F A;  2NRR A;  1NMD A;  2YHX A;  5KQ8 A;  3PSF A;  1HKC A;  4BRL A;  3I33 A;  4XIU A;  1WBB A;  3G25 A;  3CJ9 A;  1JLB A;  4JS4 A;  3D0P A;  3W0L A;  5GIO A;  4DR2 K;  2GBZ A;  4HCB A;  1Q8I A;  1HQU A;  4F2S A;  4M3T A;  2DFH A;  2G8H A;  1WUA A;  5BR9 A;  4G1Q A;  1VQL N;  2FLO A;  4ID5 A;  4A62 A;  4ILH A;  5KRT A;  3DLB A;  4CHY A;  4XH5 A;  4KI6 A;  3RMC A;  3K9J A;  3O4N A;  2IVN A;  3TPQ A;  1NK0 A;  4A5A A;  3AVF A;  4DTS A;  3LZI A;  4N5S A;  4NLC A;  4O4G A;  5HRP A;  2Q97 A;  1JKH A;  4CJK A;  1BIZ A;  2Y1J A;  1W9H A;  3T7Z A;  3MXJ A;  1N36 K;  5C15 A;  5LJV A;  3R1X A;  4IG0 A;  4JI7 K;  3ZSY A;  1X9M A;  1CXU A;  2E2N A;  1RDU A;  4CZF A;  4DQ8 A;  2E8A A;  4CK1 A;  4Q0B A;  1L5U A;  1DTQ A;  2P9S A;  3CCV N;  1KCF A;  3M8R A;  1YIT N;  3A8Y A;  4WQ4 A;  3BY5 A;  3OYE A;  1JL2 A;  4DV7 K;  2JLE A;  4GNI A;  1CXQ A;  4A57 A;  2V52 B;  4H0V B;  1SKS A;  4MLE A;  4V19 S;  4FL9 A;  1T3V A;  3E1Y A;  4KO0 A;  5ELZ A;  4M42 A;  1RDD A;  3CER A;  4LD0 A;  3AA2 A;  2F9W A;  3MEC A;  1RDB A;  3AVH A;  1GLJ O;  5AQI A;  1YUW A;  5BRF A;  5FRN A;  3Q7B A;  2NNW A;  4BDZ A;  3VQ4 A;  4DR3 K;  4C1N K;  4JI5 K;  1N34 K;  3L2R A;  3NVK A;  3UB5 A;  3NMU A;  4YOV A;  3H45 C;  2FBV A;  1NJW A;  1VQ8 N;  2A1S A;  1SKW A;  2QA4 N;  4JHD A;  4MFB A;  4DWI A;  3AO5 A;  3EO3 A;  3L6Q A;  4B3O A;  3O9T A;  4BRK A;  3LAK A;  5AQF A;  5LJW A;  3QNO A;  2UYT A;  2HHU A;  4DF8 A;  3D2E B;  3T1H K;  4OLB A;  3HVT A;  2UXC K;  4DHY A;  4BWM A;  3T3F A;  4K8X A;  2CGL A;  3RRH A;  4FJX A;  3CM5 A;  2KQ2 A;  5KGX A;  3TSU A;  1U04 A;  4AM6 A;  1BIU A;  2KZZ A;  3HPH A;  1NK5 A;  4YOR A;  3FR0 A;  1ZXO A;  3DMJ A;  2HHV A;  4ELV A;  3EKS A;  3JSM A;  4Z4G A;  4CW7 B;  1OH8 A;  3L3V A;  3VEV A;  4FWM A;  3LDP A;  3ULE A;  2BH1 A;  4B8A B;  3RR8 A;  1Z6R A;  5KPZ A;  3AA3 A;  4KTW A;  1S9E A;  4MQ3 A;  3TAM A;  5HRN A;  1R0A A;  3VEN A;  1SS6 A;  1VSH A;  2P9L B;  5CR4 A;  1HUX A;  2BDP A;  1J54 A;  2YNG A;  3OBW A;  3SQ0 A;  3CHW A;  1KLN A;  4DR4 K;  3V9Z A;  2E2O A;  4JYA K;  3HT3 A;  2B6A A;  1RIL A;  4CEZ A;  3QEP A;  3VEX A;  1R59 O;  1XQS C;  1GLB G;  1S3X A;  1Z26 A;  3VQ9 A;  3TTF A;  1WSE A;  4K0K K;  3ZT3 A;  1X9J A;  3EYZ A;  4KTZ A;  4IOA L;  4O0I A;  1YTU A;  2PBD A;  3AV9 A;  4HVJ A;  4FM2 A;  1YHQ N;  3AA5 X;  4E7I A;  4FYD A;  4IDH A;  4BQL A;  1Y97 A;  1X9S A;  4IFV A;  1ZBS A;  4OKK A;  3UKR B;  1LWF A;  2O8B A;  3EEQ A;  5CYM A;  3H6E A;  4YOW A;  1RTD A;  4FVU A;  2FF3 B;  1ATN A;  4CGD A;  1NOY A;  2FXU A;  4ISE A;  4CZH A;  3KLF A;  4B9M A;  2ATQ A;  5GIP A;  4U7B A;  1HKB A;  4A2B A;  3NGZ A;  1RT3 A;  3DLE A;  3PY8 A;  4O5B A;  5KRS A;  2BTF A;  2AJQ A;  3EKU A;  3P39 A;  4NLB A;  1L3T A;  1ESV A;  3SAG A;  3KHY A;  3N4P A;  2VQE K;  4NCG A;  1RDW X;  1S5J A;  1HNZ K;  4KB1 A;  5FDL A;  3VQB A;  4DTR A;  3CFR A;  4PUO A;  4M3Y A;  4H03 B;  2X74 A;  1IJJ A;  4CZE A;  5AQZ A;  5HRO A;  4NYN A;  1ASV A;  2W40 A;  5E26 A;  1YAG A;  1TL1 A;  5BPL A;  4IZ9 A;  2GWJ A;  4CJW A;  4FWP A;  3CCJ N;  3LDS A;  3THY B;  1SL1 A;  2QWN A;  3ATU A;  3A5M C;  4BR0 A;  2G8U A;  5HL7 L;  1LWC A;  4E19 A;  1NK9 A;  2QXF A;  5J2M A;  2BAN A;  2P9N B;  2VWB A;  3NE6 A;  2OPP A;  2OYQ A;  2WBN A;  3BZK A;  3GE1 A;  3E66 A;  2RF2 A;  3LPU A;  4CGG A;  1TYQ B;  4RW8 A;  1VRT A;  4O8K A;  4DR6 K;  3KLE A;  1NMN A;  4DTJ A;  3JS6 A;  2ZE2 A;  1UOC A;  4WFB L;  3G71 N;  3D2F B;  5AQJ A;  1M1K O;  1LW2 A;  3Q7C A;  1T6C A;  2HHS A;  3MCP A;  3QML A;  1S9G A;  4CHO A;  1W2B M;  2A6A A;  2NLX A;  4ZTJ A;  4CK2 A;  2YX6 A;  1HNV A;  4MDB A;  3CCR N;  3VGK A;  4DQR A;  4FLV A;  3MXM A;  4ZTF A;  4IJA A;  1TGO A;  3V9U A;  3SI6 A;  3AAP A;  4CHP A;  4KRF A;  5H1S Q;  3SZ2 A;  3AO4 A;  3HXM A;  3M3Z A;  4AHR A;  4DKW A;  2UXD K;  4BVO A;  1Q9Y A;  5SZT A;  1RNH A;  5TKY A;  1VQK N;  5AQG A;  1L3V A;  3I8D A;  3CCM N;  2ASM A;  3DOL A;  4DQI A;  2B4J A;  1EO1 A;  1HYV A;  3U8X A;  1KAZ A;  3B6P A;  4M7Y A;  2KKZ A;  3K58 A;  4C8N A;  4OGC A;  3TAF A;  1QHT A;  3TTC A;  4GV3 A;  1LOT B;  4HCC A;  2FBX A;  1KTQ A;  3MED A;  3L3U A;  3P83 D;  4JKA A;  5FPN A;  4DU4 A;  2XY5 A;  3OBY A;  3QIP A;  1U2V A;  2ZJQ L;  2ZM6 K;  1ZBL A;  4CJT A;  2O4I A;  4RTF D;  4FWK A;  4KBO A;  3L2V A;  1XWL A;  2ASP A;  4BR4 A;  4IXC A;  4J2D A;  1N32 K;  4ISG A;  3SPY A;  3PV8 A;  3EE9 A;  2OZM A;  3HBT A;  3SJH A;  4WCE L;  1BL3 A;  2F96 A;  3M8Q A;  4CZL A;  1S1W A;  4DFJ A;  4EZ6 A;  2FSJ A;  1U49 A;  4JI3 K;  2E6M A;  2P9P A;  4EP5 A;  4DV0 K;  3SPZ A;  2IC3 A;  4KI4 A;  2O8D A;  3M5R A;  2P9I B;  3H46 O;  4CFB A;  3DXK B;  4JRP A;  4E3S A;  3VER A;  5CYQ A;  4BRH A;  2FBT A;  3NF8 A;  3ZT2 A;  2AP1 A;  5JS2 A;  3FGU A;  3BP8 A;  3LL3 A;  3QO9 A;  3L2U A;  4FZY A;  3RMA A;  3VGM A;  2O8C B;  2NRT A;  2HVI A;  3V9S A;  3C6T A;  4W5T A;  1U45 A;  2HHT A;  2KW4 A;  2A40 A;  1HJO A;  1RTJ A;  1NOZ A;  5FPM A;  3C7N A;  4DSI A;  1RBT A;  4H0Y B;  2P9U B;  4IG3 A;  2XY8 A;  4YHH K;  3SCX A;  4B9T A;  4JKF A;  4BE2 A;  4CGH A;  3VOV A;  2HF3 A;  3AO1 A;  2D4W A;  1KAY A;  3C94 A;  4RG8 A;  3G4S N;  3RMD A;  3O4Q A;  3VQ8 A;  4FO0 A;  3CG7 A;  4GV6 A;  4CBW A;  4BWJ A;  4A2A A;  4IO9 L;  3IDH A;  3I8B A;  3NGY A;  4YOT A;  3CCE N;  5DK5 A;  2P9K B;  4IFE A;  4F9O A;  2CH6 A;  3CJ1 A;  2LSN A;  2DPN A;  3SBG A;  2E88 A;  4AH9 A;  3CM6 A;  4M3Z A;  4CI6 A;  3CF5 L;  4JI1 K;  3P31 A;  3DLG A;  3VEO A;  3LZJ A;  2F8T A;  1VAZ A;  4W5O A;  2HBL A;  1TUY A;  2HW3 A;  4BGB A;  4CEB A;  5BRE A;  4DS5 A;  3ID8 A;  3VQ6 A;  4E0D A;  1N8R O;  4LF9 K;  1B92 A;  3U9D A;  3WQT A;  5AQH A;  4Y0W A;  4FJ5 A;  4ELU A;  4JAX A;  1NBW A;  2X78 A;  5AQW A;  2DTU A;  3ZSQ A;  4CK3 A;  4CIG A;  3SMP A;  3ZSX A;  1VSL A;  1L3S A;  4H5N A;  3OYI A;  3KK7 A;  5J1E A;  4JHD B;  1JXE A;  5HOO A;  1VSM A;  4CJR A;  3KK1 A;  1Q86 O;  1QSS A;  1LW0 A;  3SK3 A;  3JAM O;  5AZJ A;  3IFR A;  1WSI A;  3NBP A;  1EKE A;  4BRQ A;  3GDQ A;  4DQS A;  5IT9 O;  2XY7 A;  2FSK A;  3HYF A;  4I6M B;  4GMJ B;  1XC3 A;  2YNF A;  3CIP A;  1VSK A;  1V4S A;  1K73 O;  4DSF A;  3EL2 A;  3W3D A;  4FZX C;  4FLX A;  2NUB A;  4CHZ A;  2QWO A;  1FJG K;  4FK0 A;  4LF7 K;  3AVJ A;  1T03 A;  1E3M A;  2QKB A;  2OPQ A;  3RSE A;  3FZM A;  4M7X A;  3IG1 A;  4CHN A;  3HO1 A;  3ULE B;  3EN9 A;  5ADX A;  1SL0 A;  4DR7 K;  1VRU A;  3AGK A;  4WQ5 C;  4CF8 A;  3IAY A;  3BZC A;  4LF8 K;  1TKT A;  3HL8 A;  3HM9 A;  3KTQ A;  2Z1J A;  2YHW A;  4JKG B;  4KHU A;  3HOT A;  3DXM A;  3CD6 N;  3LAL A;  3TU5 A;  4YOU A;  4JI8 K;  1RT1 A;  5B8H A;  1YT3 A;  1Q9X A;  1TKD A;  4LSN A;  1QS4 A;  1NGJ A;  4CFA A;  3ZSZ A;  1REV A;  3K9K A;  3LWL A;  4DQP A;  4KRE A;  3DYA A;  1YJ9 N;  1VHX A;  1NK7 A;  1YJN N;  4H0P A;  2VWJ A;  3H08 A;  1ZBH A;  3WNF A;  1HYS A;  3CCL N;  4CVN E;  1QVG M;  1TKX A;  1U6Z A;  4F2R A;  5C2D A;  3F5T A;  2ZJR L;  4DV6 K;  1S1V A;  1WBD A;  5AJ3 K;  3VQD A;  3RTV A;  3BUZ B;  4J2B A;  2F4V K;  4CFC A;  2VG5 A;  1OVQ A;  4JKB A;  4DSJ A;  2RN2 A;  4ID1 A;  3ZEU A;  1BQM A;  4BRO A;  4PL7 A;  5LL6 Z;  4BC2 A;  5CZ1 A;  5AQM A;  4W5R A;  2HBM A;  3VF4 A;  3ZSV A;  1W7A A;  4JD2 B;  2WFB A;  4K43 A;  4RWT A;  3THW B;  4AIL C;  3FZL A;  5J2N A;  1T05 A;  5F2R A;  1BCO A;  4JEP A;  4DSK A;  4OVL A;  2VCP A;  3DJC A;  3VET A;  4M3U A;  1V4T A;  4N56 A;  1TAQ A;  3G6E N;  5AQK A;  3KWI A;  4JKD A;  3CJA A;  4DTP A;  4BRP A;  3S3M A;  1EWR A;  2CH5 A;  3O9Q A;  3O9U A;  4DFM A;  3AVI A;  5DMR A;  4PKI A;  4C8K A;  3HVR A;  2P51 A;  2ZD1 A;  5FPE A;  3GOI A;  4KHS A;  4H5R A;  3U3G A;  2QKK A;  3QFU A;  1NNE A;  3VEW A;  3PO4 A;  3L2Q A;  1FKP A;  1JCG A;  4B8C A;  3H1V X;  3I56 N;  4YDU C;  1HLU A;  4XH4 A;  2V7Z A;  5I3U A;  1RBR A;  2UXB K;  4FZZ A;  3ZX0 A;  3HSC A;  1GOC A;  1W0H A;  4FW1 A;  4IBN A;  5BR8 K;  3V4I A;  1JLG A;  3F9M A;  4DSE A;  2UUB K;  3RWU A;  4CBX A;  2ITM A;  4NYF A;  4E7L A;  3DM2 A;  4LFC K;  1P8Z A;  3T69 A;  1NKE A;  1N5Y A;  2KTQ A;  4NB4 A;  4Z4H A;  1JXB A;  4JK7 A;  3CJ7 A;  4B3M K;  4IDK A;  2O8F B;  4I9Q A;  3HPG A;  3I0S A;  2ZWH A;  3GL1 A;  4HHT A;  1NGI A;  2QI2 A;  3VMF B;  4E1N A;  2QWL A;  3RMB A;  3J81 O;  2YKM A;  4JRQ A;  1VSE A;  3SBT A;  4Z4E A;  3KK2 A;  4MO4 A;  1BA1 A;  3G0Z A;  3HPO A;  3QNN A;  3MAQ A;  2VG6 A;  3CXC M;  2P5G A;  4HWI A;  2IVO A;  3M8P A;  1HRH A;  3TTD A;  4FWR A;  5AQQ A;  3OYL A;  5GIN A;  5M1Q A;  4JK8 A;  4FWS A;  2KHO A;  4CJL A;  1EX4 A;  2YNI A;  3BGR A;  1TUU A;  4IOC L;  3AO2 A;  1M90 O;  3MWT A;  4FJK A;  1S6Q A;  3CC2 N;  1KVB A;  3LP3 A;  5GAG P;  3MXI A;  3J80 O;  4ILG B;  3J7Z O;  1YVN A;  4NXN K;  4PA1 A;  1SV5 A;  1XNQ K;  4YFU A;  2BE2 A;  3AVM A;  3KLI A;  1S1T A;  5D3G A;  4B1U B;  1BA0 A;  4AHT A;  3V9X A;  4CHQ A;  5AQP A;  4OPJ A;  3WXK A;  1WSH A;  1HR0 K;  4CJF A;  4RCH A;  3VPZ A;  4LY7 A;  4DU3 A;  3ZET A;  1FXX A;  2W42 A;  4LFB K;  3E9L A;  5JVH L;  4PQU A;  1VQP N;  4JKH A;  2BGG A;  3KK3 A;  1IKV A;  1C6V A;  4FLZ A;  4EHT A;  2ZGZ A;  3PX4 A;  3F9K A;  3VN5 A;  5C0Y A;  1DKG D;  2Q0R A;  1SZ2 A;  3ULD A;  3OYA A;  4GV9 A;  4K41 A;  4H4O A;  4CFD A;  4IWV A;  3KD5 E;  4FLW A;  5AQU A;  4JS5 A;  1WOQ A;  3TAQ A;  1OH5 A;  1RGI A;  3TAE A;  3E9P A;  2HNY A;  1RFQ A;  2IDO A;  3LDQ A;  3D7E O;  1SUQ A;  3K5N A;  4BG8 A;  5EXW A;  3K5L A;  4U67 L;  1BI4 A;  2HB5 A;  4NCA A;  3VGL A;  4OO1 J;  5JIC A;  5K14 A;  4FWN A;  2VGM A;  3MEE A;  4AHV A;  1NGB A;  5HBM A;  3WXM B;  5BRD A;  3U3Y A;  3AAQ A;  1I94 K;  1IKW A;  4DR5 K;  3L4I A;  4FM1 A;  2NRH A;  2QWP A;  4DFP A;  1WAF A;  1HX1 A;  2GEM A;  4FJI A;  5EU7 A;  5C25 A;  4PL8 A;  5LY3 A;  4JKE A;  3EY1 A;  3OYF A;  3QFP A;  3LDN A;  3DRS A;  1DT9 A;  3VQ5 A;  4FM0 A;  4L8R B;  4H4M A;  4FJ9 A;  1Y64 A;  5KQD A;  3ZYY X;  3VA0 A;  4W5Q A;  3OYM A;  1NWK A;  1O1W A;  1X1P A;  1TAU A;  3VA3 A;  3O3F A;  4H0T B;  1T7P A;  2OAN A;  2A41 A;  2G8V A;  4IEE A;  3QIO A;  2PFU A;  5FLX O;  5CZ2 A;  3FLC O;  1C0U A;  1UAX A;  1ASW A;  2QWQ A;  3ISN C;  4Z4C A;  1P90 A;  3VTI A;  3ZSW A;  1JLC A;  1L3U A;  4K42 A;  4CBU A;  1IV0 A;  4GVE A;  2JGU A;  1FKO A;  3K2P A;  4HUE A;  1VQO N;  2HHQ A;  4Z0U A;  4E7K A;  4JI2 K;  2D0C A;  3DOK A;  1GLE G;  4CJ4 A;  5AQO A;  1QTM A;  4Y1C A;  1JCF A;  3MN6 A;  1KQS M;  4KTQ A;  3PIP L;  4BRA A;  1FW6 A;  4M41 A;  1SAZ A;  3TSQ A;  3QEX A;  3SYZ A;  3UKU A;  3RSE B;  4BGA A;  2I7N A;  3A5O C;  4AHC A;  2ZF5 O;  4I7F A;  3L2W A;  5EX5 A;  4DV1 K;  3MX2 A;  4RW4 A;  5M1O A;  1JL1 A;  5BPN A;  2UUA K;  3WEE B;  3DXM B;  3UIQ A;  5DM7 L;  1YI2 N;  4B9S A;  1A5X A;  1I39 A;  2XO7 A;  4MLH A;  5BN8 A;  1J53 A;  2R7Y A;  4ILJ A;  3KLH A;  4A61 A;  1QQM A;  3LWM A;  2XY6 A;  4CZI A;  3LP1 A;  5KPT A;  1NK4 A;  3KKS A;  2HBJ A;  2HST A;  3L0Q A;  4X66 K;  4F3O A;  4CJQ A;  1XHX A;  3F2K A;  1S6P A;  2VG7 A;  3QLH A;  4LC9 B;  4WFN L;  5TKW A;  3MWP A;  3ZSR A;  4LF4 K;  2J4R A;  4KHW A;  1KD1 O;  4FWQ A;  3PUF A;  1GLL O;  1NU0 A;  1NK8 A;  1NGE A;  4FJ7 A;  4PHT X;  1YJW N;  4B3T K;  1EWQ A;  4I2Q A;  2GEL A;  1NGG A;  4FJN A;  3ZEU B;  5I42 A;  4BR5 A;  1QE1 A;  3HZ6 A;  1YVU A;  1JLE A;  3TAR A;  3AVA A;  3U4L A;  4BQZ A;  4WYB A;  2HBK A;  2YHY A;  3ZT1 A;  5ADX H;  2YCH A;  3AAR A;  3MEG A;  3VTH A;  4TSX A;  3QET A;  5M1P A;  1J5E K;  1S1X A;  2FSN A;  4MO5 A;  5GAH P;  5T7B A;  1Z05 A;  4H0X B;  3L4Q A;  3O9S A;  1UA1 A;  1B9D A;  2GX9 A;  2GUI A;  5C42 A;  4DF4 A;  1U47 A;  2BUP A;  1J9A A;  3VQ7 A;  1GOA A;  3LPT A;  5AFU A;  3D2E A;  3ZT4 A;  1KC8 O;  2GV9 A;  5I9E B;  4C8L A;  1XMO K;  4BDY A;  3IUC A;  3OYC A;  1Q18 A;  3TAN A;  3HP9 A;  3P4I A;  3ITH A;  4FSV A;  3BF1 A;  5AQX A;  1GLC G;  4M3W A;  4W5N A;  1TVR A;  3DWL A;  4WE1 A;  3IMX A;  2OCE A;  4CEE A;  4B9N A;  4JV5 K;  4CJ5 A;  3VQQ A;  4BDP A;  1Q81 O;  4M45 A;  1EET A;  4B1W B;  2WTU A;  1D9D A;  3PO5 A;  5AR0 A;  4E89 A;  1K6Y A;  3CQX A;  1ZBF A;  2P9L A;  5AQL A;  4B9L A;  2UU9 K;  5GAE P;  2P9S B;  2IVP A;  4CZJ A;  1IKX A;  1K8K A;  4LH4 A;  4DB3 A;  4K8Z A;  1OVY A;  1N6Q A;  1KFD A;  2DFE A;  1JLF A;  3C6A A;  5AQS A;  3OYB A;  3V81 A;  1KFS A;  4DLG A;  3AVC A;  1BDG A;  3QEI A;  3U9Z A;  1VSI A;  4BR7 A;  4CF1 A;  4H5T A;  4X65 K;  2NRV A;  1XI1 A;  2P1J A;  1KVA A;  3MK6 A;  3UKR A;  1KRP A;  5HRR A;  1J5O A;  1KVC A;  4X62 K;  1OH6 A;  4PWD A;  4UY8 O;  4MDA A;  3OS1 A;  2XRI A;  4NCB A;  5F1X A;  3DRR A;  4OPK A;  2RPI A;  3WUH A;  3OHR A;  4O5F A;  5AZI A;  2F8S A;  3HI0 A;  1GOB A;  4B9U A;  1ZBI A;  4CJ7 A;  1WAJ A;  1VQM N;  4KHN A;  1GLD G;  2GUP A;  5C10 A;  3MN5 A;  2E20 A;  4QAG A;  3KKR A;  3KJV A;  2B5J A;  1I3A A;  2GWK A;  4EZ9 A;  4OPH A;  1XMQ K;  1N33 K;  5J2P A;  4BAC A;  5M1N A;  4BRN A;  3HP6 A;  3D6R A;  3NAE A;  4JK9 A;  1B9F A;  3CQ8 A;  4CF0 A;  3HST B;  2DY4 A;  1QSY A;  2WOM A;  3WXJ A;  1NG9 A;  1XNR K;  3OYN A;  4AF1 A;  1BGX T;  4C8M A;  4CJE A;  3VES A;  1EP4 A;  4QOZ B;  1MDU B;  3A0I X;  4HTU A;  5KTQ A;  3OY9 A;  3AVG A;  3VF6 A;  5JVG L;  5LMU K;  3VQA A;  4CD1 A;  1VQN N;  3M6G A;  3N4Q A;  4L3Q A;  4WQ5 A;  4YOY A;  4XEI A;  2P9N A;  2QWR A;  4DTX A;  3ALY A;  1IG9 A;  1JCE A;  3HOS A;  3UE5 A;  4H0O A;  3R8E A;  3TAB A;  3WXI A;  5F0X A;  1FK9 A;  4OLA A;  1ZYQ A;  4FVM A;  2ZJP L;  4CJS A;  1TYQ A;  3PX0 A;  3I0R A;  4DR1 K;  1J6Z A;  3HM8 A;  4LH5 A;  2YNH A;  3D2F A;  3HK2 A;  4CER A;  2PYL A;  1A5W A;  3FFK B;  1KAX A;  3NCI A;  4PKH A;  4BRF A;  1QZ5 A;  2Q0U A;  1HQE A;  4O55 A;  3HJF A;  1XC9 A;  3RVC A;  1S1U A;  1SL2 A;  1BIS A;  4FOI A;  4N76 A;  4WFA L;  1NJZ A;  4DV4 K;  4LFA K;  2O8B B;  1C1B A;  3NVM A;  4Q5V A;  1KLM A;  3OJS A;  2D0P A;  4FCY A;  1RTI A;  3P5J A;  3QER A;  2XHB A;  3C0B A;  4QCL A;  1BU6 O;  4CEC A;  1UA0 A;  2G8K A;  4Z94 A;  3ZT0 A;  3BF3 A;  3LP0 A;  4FJG A;  3O80 A;  1QHA A;  4M3X A;  4DMN A;  3CJB A;  3FZH A;  4KHP K;  2NRX A;  1RBU A;  3ZX2 A;  1K8A O;  1NGD A;  3DLR A;  3MCA B;  5BPM A;  1SKR A;  5DM6 L;  2H3G X;  2HOE A;  2P5O A;  4JNE A;  4IKF A;  4GKK K;  2I7P A;  3AO3 A;  4DTN A;  4FWL A;  3NDK A;  2EX3 A;  5FRM A;  4AHS A;  5AQN A;  1BG3 A;  4FLT A;  2A42 A;  4AM7 A;  4OGE A;  4J8F A;  3WNE A;  5MLC Q;  3OYK A;  4BE0 A;  5JS1 A;  2P9I A;  3OA9 A;  3SUQ A;  3DXK A;  3VEY A;  3RRG A;  3S9H A;  4LF5 K;  1D4X A;  2PZS A;  3LM2 A;  4CED A;  2OTL N;  1HKG A;  4FK2 A;  4YDU A;  4JN4 A;  4B1X B;  1TK8 A;  4HUF A;  3CCQ N;  2O8C A;  1U4B A;  4H8K A;  1IBM K;  3UKU B;  4FJH A;  2X6S A;  1LAV A;  4CJV A;  3AVL A;  2NRZ A;  4FLY A;  4DTO A;  2E5L K;  3SAF A;  2E4L A;  2P9U A;  3G10 A;  2PY5 A;  3CC7 N;  5BRH A;  3IRX A;  1TL3 A;  1RT7 A;  4CJP A;  2ITG A;  1RDA A;  1C0G A;  1C0T A;  3CQY A;  5KPR A;  4OJR A;  3THX A;  1IO2 A;  4CEQ A;  2CGK A;  2W6L A;  3DAW A;  3VQP A;  4DV5 K;  3QBW A;  4JI4 K;  4DFK A;  4ISF A;  1NGA A;  1YF5 L;  2HHW A;  4CZG A;  3TAG A;  4I9L A;  4IOX A;  1BOT O;  2F9T A;  1MA9 B;  4WQ4 C;  1YXQ A;  3AVB A;  4DU1 A;  2P9K A;  1XHZ A;  2OTJ N;  2Q31 A;  1VSJ A;  4CGJ A;  5C12 A;  4R79 A;  3VF2 A;  2KLA A;  2D1K A;  4KV8 A;  1C0M A;  1GLF O;  2YHB A;  3V1O A;  3FZK A;  4FJM A;  2V51 B;  2WUS A;  1RBV A;  1U2V B;  1TKZ A;  4H5V A;  2HMP A;  4BR9 A;  3O5B A;  4KFB A;  4G9Z A;  2Q2R A;  4IO8 A;  4BG9 A;  1TV6 A;  2A5X A;  3K5O A;  3IKM A;  1LV5 A;  3GG4 A;  3NF9 A;  3A5N C;  3LAM A;  4CF2 A;  4QS9 A;  5CHI A;  5JMV A;  1DLO A;  3L8B A;  4BR2 A;  2P9P B;  2O8E A;  2YJE A;  2O8D B;  2HNZ A;  1DGK N;  3S3O A;  2Z1I A;  3SNN A;  1ATS A;  3KD1 E;  2QTD A;  4NO7 A;  3S3N A;  4JLH A;  4YNQ A;  1E4G T;  4WF9 L;  5BN9 A;  4B1Z A;  3J7Y P;  4YY3 K;  2V7Y A;  4I2P A;  4I6M A;  1HPM A;  4OPA A;  1TK5 A;  3AY9 A;  3ENH A;  3HRG A;  4KPY A;  3ZSO A;  2ETJ A;  1QQN A;  4BC5 A;  5A2Q O;  1HNW K;  4JKC A;  4XH1 A;  3H3O B;  1G15 A;  3O1W A;  1NGF A;  4R5P A;  1XUP O;  3M8S A;  3C7N B;  3O08 A;  2RHK A;  4EFH A;  5C2F A;  4CEA A;  3ZLJ A;  3ASM A;  4JI6 K;  4FPB A;  1TK0 A;  3SQ2 A;  3F73 A;  2OPS A;  4QS8 A;  2HHH K;  1MU2 A;  1Q82 O;  4LSL A;  4DUZ K;  1MWM A;  3CJC A;  3SJJ A;  4JKG A;  1ASU A;  3E9O A;  1SQK A;  2ZQB A;  3D45 A;  1K8K B;  3TAP A;  1NLV A;  3MDQ A;  3H3N O;  2YJF A;  1WNS A;  4FOE A;  1DTT A;  4M3R A;  4B1V A;  1LWE A;  3QIC A;  2OA8 A;  3NH0 A;  1JLQ A;  1WSJ A;  4BE1 A;  3GBT A;  2Y1I A;  4E7J A;  3V1R A;  1HNI A;  3M1F A;  2VGN A;  2YKN A;  1IG8 A;  2W6K A;  4GW6 A;  4BRE A;  1ATR A;  5AFU H;  3CCU N;  1QVF M;  1ZC6 A;  2KFZ A;  3B8A X;  4LF6 K;  3J7A P;  4IFY A;  3OJU A;  4KH6 A;  3CI5 A;  5GAD P;  4OKE A;  1LAW A;  4Z4I A;  4IJN A;  5EVZ A;  5AZI B;  3A2F A;  3ATV A;  3CC4 N;  2HF4 A;  3NF6 A;  3OVN A;  4JD2 A;  4CZK A;  3THW A;  2IOC A;  4YOX A;  3C95 A;  5AZJ B;  3DLL L;  5CE3 A;  1VK0 A;  2ZGY A;  1WN7 A;  3QBX A;  3NHG A;  1NJY A;  2WON A;  1GLA G;  3R6M A;  4N47 A;  5AQV A;  1O13 A;  4KHY A;  3AGR A;  4CEO A;  1RT5 A;  4N41 A;  2G8F A;  4EAH D;  1VSD A;  2RE2 A;  4DV3 K;  2JWL A;  3HTV A;  4DS4 A;  4FW2 A;  5SWM A;  5FPD A;  1H1V A;  3OYJ A;  3NFA A;  2G8W A;  3SV3 A;  2HHX A;  3O3G A;  4DLE A;  2AA4 A;  1EXQ A;  4DG1 A;  4EIA A;  4FJL A;  2O4G A;  4X64 K;  2IIR A;  1CZB A;  3T1Y K;  4FXD A;  4CES A;  2HVH A;  2NRW A;  3ZX3 A;  2VQF K;  4DUY K;  1VQ7 N;  3VQE A;  3SUN A;  5J2Q A;  3NH2 A;  4ICL A;  3PLA A;  5E84 A;  2D5R A;  5HRS A;  1RT2 A;  4Y1D A;  3K0S A;  1VQ6 N;  1HJR A;  2PAV A;  3LDL A;  3SUO A;  4Z4F A;  1W97 L;  2X6N A;  1C0F A;  2YHA A;  3QIN A;  4BC4 A;  1S72 N;  5CY4 A;  3JYT A;  4UQG A;  2HMI A;  3TSP A;  3SQ1 A;  4KAZ A;  1NGC A;  3TR8 A;  3WNG A;  3SAH A;  5HLF A;  1KSP A;  3SUP A;  2O8F A;  3FFI A;  3CME N;  4C8O A;  3JXU A;  2QK9 A;  4ELT A;  1EQY A;  1KXP A;  3P38 A;  4DCH A;  2HND A;  5EY4 A;  3VQC A;  3OTO K;  4B3S K;  1NGH A;  1YTA A;  4FWO A;  3NF7 A;  4M63 C;  3OW2 M;  4DQQ A;  4E7H A;  2VYP A;  2FBY A;  5AQR A;  2E2Q A;  1BCM A;  3DLH A;  2E6L A;  2QEX N;  2F7T A;  1BO5 O;  1RT4 A;  3V9W A;  2Z1H A;  5IWA K;  3R9P A;  3WXL A;  4EHU A;  3K59 A;  1MWK A;  3LP2 A;  3SMS A;  5M1K A;  5E41 A;  3OYD A;  4DV2 K;  1ILY A;  3DI6 A;  1CZ9 A;  2IAJ A;  2RKI A;  4O0J A;  2YV0 X;  1RTH A;  2G8I A;  1X9W A;  3KVG A;  4B9V A;  3EZW A;  4CD3 A;  1LCU A;  3PX6 A;  1VQ5 N;  1NKC A;  2E1Y A;  3T19 A;  1RT6 A;  1X3M A;  3C6H A;  1X3N A;  3SQ4 A;  1HNX K;  1D5A A;  4AHU A;  3NH1 A;  3TWH A;  4BY9 C;  4CIE A;  1WB9 A;  1IBK K;  1BWF O;  4FJ8 A;  4B9Q A;  2FF6 A;  4ZHR A;  1G99 A;  1WSF A;  1Z25 A;  3PIO L;  3OYH A;  1HMV A;  4JI0 K;  2E1Z A;  2GTD A;  1CLQ A;  1VQ4 N;  1BHL A;  3J8A A;  3NGI A;  1NK6 A;  1ITG A;  3LDO A;  3E01 A;  1ZBU A;  4GY2 B;  3MN7 A;  3T1A A;  1VSF A;  5JLF A;  1OKJ A;  2QM1 A;  1IH7 A;  4J2E A;  4GKJ K;  3P1G A;  4NXM K;  3RR7 A;  4OKJ A;  1K9M O;  2I5J A;  4HTL A;  2Q36 A;  2W41 A;  3S41 A;  4IEI A;  3IS9 A;  5KI6 A;  4BC3 A;  1JLA A;  3THX B;  4K25 A;  2A1R A;  2UUC K;  2CGJ A;  3OS0 A;  3C6U A;  4O44 A;  4CZM A;  3EZ5 A;  1QZ6 A;  3ENO A;  2QWM A;  3KLG A;  3AVN A;  4BVP A;  3QEW A;  1A5V A;  5KGW A;  4CE9 A;  2DFF A;  3O1B A;  1VQ9 N;  3BDP A;  2Q1N A;  3A5L C;  1QQC A;  3QES A;  3CFP A;  3V1Q A;  1E4F T;  3MN9 A;  2VWK A;  1NKB A;  4GVM A;  2D0O A;  1QQO A;  4B08 A;  4KH5 A;  4A59 A;  1HYZ A;  3AA4 A;  1DEJ A;  4OX9 K;  3C65 A;  1T8E A;  4QS7 A;  4F4K A;  4PKG A;  1U48 A;  4PY5 A;  1WSG A;  2QXL A;  3CET A;  1T6D A;  1OH7 A;  3R3L A;  1WLJ A;  3OS2 A;  3TI0 A;  3O4W A;  3KZB A;  1Q7Y O;  2OPR A;  3BEX A;  1RCH A;  3WQU A;  3CCS N;  2O8E B;  4BRG A;  4CGI A;  4CCH A;  2D0B A;  2OZS A;  1C1A A;  4DSL A;  1HPZ A;  3WT0 A;  4CJU A;  1CZA N;  3ID6 A;  4O8U A;  4AQY K;  3MMV A;  2FC0 A;  1RDC A;  1S22 A;  3ZET B;  3THY A;  3OYG A;  2D0A A;  4RW7 A;  4HUG A;  3K57 A;  3CPW M;  3EE8 A;  3SLC A;  1BUP A;  3AVK A;  4BRI A;  3O9R A;  5AQT A;  1D9F A;  4FK4 A;  4KKO A;  1T44 A;  1IKY A;  4E1M A;  2IGI A;  3FZF A;  3ENB A;  3B6O A;  1BQN A;  3KIO A;  2EHG A;  3THV A;  2JWK A;  4EP4 A;  2IS3 A;  4FLU A;  3FE1 A;  4CEF A;  1UWB A;  4FJJ A;  4FPA A;  4KB0 A;  5EOY A;  1NJX A;  1NM1 A;  5FRO A;  3LAN A;  3O8M A;  5C24 A;  2WC9 A;  4C1N I;  3LM9 A;  3WEE A;  4A5B A;  4DTM A;  4KHQ A;  4BRD A;  2PYJ A;  4KH4 A;  1QSL A;  1D8Y A;  2E2P A;  2YI1 A;  3CMA N; 
#chains in the Genus database with same CATH homology
 2KW4 A;  1C0U A;  1UAX A;  1ASW A;  1TKZ A;  1C1C A;  1RTJ A;  3SV4 A;  1NOZ A;  1BI4 B;  3ISN C;  4DSI A;  4Z4C A;  3V6D A;  3ZSW A;  1RBT A;  1JLC A;  4KFB A;  4DTU A;  1L3U A;  4IG3 A;  2Z1G A;  2XY8 A;  2JGU A;  4F8R A;  1FKO A;  4F3T A;  1TV6 A;  3K2P A;  4HUE A;  3SCX A;  2HHQ A;  4Z0U A;  4E7K A;  4B9T A;  2D0C A;  1RBS A;  3DOK A;  4BE2 A;  3K5O A;  4CJ4 A;  4CGH A;  1QTM A;  4Y1C A;  1LV5 A;  3NF9 A;  3LAM A;  4CF2 A;  2KFN A;  1DLO A;  3AO1 A;  4KTQ A;  4CIF A;  3L8B A;  4M41 A;  4CGF A;  3C94 A;  4RW6 A;  4RG8 A;  3RMD A;  3O4Q A;  4J2A A;  3VQ8 A;  3DRP A;  2HNZ A;  3CG7 A;  3S3O A;  2Z1I A;  3QEX A;  3SYZ A;  3SNN A;  1F21 A;  3KD1 E;  4BWJ A;  4JLH A;  3S3N A;  4AHC A;  4I7F A;  3L2W A;  3NGY A;  4YNQ A;  4CF9 A;  4RW4 A;  5HP1 A;  3WNH A;  3K5M A;  2Q3S A;  5DK5 A;  3QEV A;  1JL1 A;  4CJ3 A;  3O3H A;  3CYM A;  3DLK A;  4RW9 A;  4I2P A;  3ZCM A;  1TK5 A;  2LSN A;  4B9S A;  3UIQ A;  1A5X A;  4KPY A;  2KZM A;  3ZSO A;  2ETJ A;  1I39 A;  3CFO A;  2XO7 A;  3U6F A;  4AH9 A;  3CM6 A;  4M3Z A;  1J53 A;  2R7Y A;  3DLG A;  1G15 A;  3KLH A;  3LZJ A;  4XIU A;  2F8T A;  4R5P A;  3M8S A;  4W5O A;  1JLB A;  4CEA A;  3ASM A;  3LWM A;  4JS4 A;  2XY6 A;  3D0P A;  4HCB A;  3LP1 A;  2GBZ A;  1Q8I A;  1HQU A;  4F2S A;  4DS5 A;  4CEB A;  3KKS A;  1NK4 A;  4M3T A;  2HW3 A;  2DFH A;  1TK0 A;  3SQ2 A;  3F73 A;  3VQ6 A;  2G8H A;  4E0D A;  4F3O A;  2OPS A;  4CJQ A;  1XHX A;  1B92 A;  1S6P A;  2VG7 A;  4G1Q A;  4FJG A;  3QLH A;  1MU2 A;  4FJ5 A;  4ELU A;  2X78 A;  4ID5 A;  2DTU A;  3ZSQ A;  4LSL A;  4CK3 A;  3ZSR A;  4CIG A;  3SJJ A;  5KRT A;  4KHW A;  3DLB A;  3ZSX A;  4CHY A;  1VSL A;  1ASU A;  1L3S A;  4KI6 A;  3PUF A;  3RMC A;  2ZQB A;  3D45 A;  3O4N A;  5J1E A;  3OYI A;  1JXE A;  1NK8 A;  4FJ7 A;  1VSM A;  4CJR A;  3TAP A;  3KK1 A;  1QSS A;  1LW0 A;  1NK0 A;  3AVF A;  4I2Q A;  1WNS A;  4DTS A;  3LZI A;  1WSI A;  1DTT A;  3NBP A;  4M3R A;  4N5S A;  1LWE A;  4O4G A;  4FJN A;  2OA8 A;  3NH0 A;  1JLQ A;  5HRP A;  1EKE A;  5I42 A;  1WSJ A;  1QE1 A;  4DQS A;  1JKH A;  1YVU A;  4CJK A;  4BE1 A;  1JLE A;  1BIZ A;  2Y1J A;  2XY7 A;  3HYF A;  3TAR A;  1W9H A;  3AVA A;  4GMJ B;  4E7J A;  2Y1I A;  3MXJ A;  2YNF A;  3V1R A;  1VSK A;  1HNI A;  4IG0 A;  3ZT1 A;  2YKN A;  4DSF A;  3ZSY A;  4FZX C;  4GW6 A;  1CXU A;  4FLX A;  3MEG A;  2NUB A;  4CHZ A;  4TSX A;  1X9M A;  3QET A;  4FK0 A;  1S1X A;  4CK1 A;  3AVJ A;  4Q0B A;  1L5U A;  1DTQ A;  5T7B A;  1T03 A;  2KFZ A;  1KCF A;  3M8R A;  2QKB A;  4IFY A;  2OPQ A;  3OJU A;  1UA1 A;  1B9D A;  2HHT A;  3IG1 A;  4CHN A;  3HO1 A;  2GUI A;  5C42 A;  4OKE A;  3OYE A;  4DF4 A;  1SL0 A;  1U47 A;  1JL2 A;  1LAW A;  4Z4I A;  1VRU A;  4CF8 A;  3IAY A;  2JLE A;  1J9A A;  3VQ7 A;  1GOA A;  1TKT A;  3HL8 A;  3A2F A;  3LPT A;  1CXQ A;  3ZT4 A;  3HM9 A;  2Z1J A;  1SKS A;  3KTQ A;  2GV9 A;  4KHU A;  3LAL A;  3NF6 A;  3OVN A;  4C8L A;  4KO0 A;  1RT1 A;  4BDY A;  4M42 A;  1RDD A;  1YT3 A;  1Q9X A;  1TKD A;  4LSN A;  3OYC A;  2IOC A;  4LD0 A;  3TAN A;  3HP9 A;  3C95 A;  3AA2 A;  3MEC A;  1RDB A;  1QS4 A;  3ITH A;  4CFA A;  3AVH A;  3ZSZ A;  1REV A;  3LWL A;  4DQP A;  1VK0 A;  4M3W A;  4KRE A;  4W5N A;  1WN7 A;  1TVR A;  3NHG A;  1NJY A;  5FRN A;  3DYA A;  4WE1 A;  2WON A;  4CEE A;  1NK7 A;  4B9N A;  4CJ5 A;  4BDZ A;  4N47 A;  3VQ4 A;  2VWJ A;  3VQQ A;  3H08 A;  4BDP A;  1ZBH A;  4M45 A;  1EET A;  3WNF A;  3L2R A;  4KHY A;  1HYS A;  1D9D A;  3PO5 A;  2FBV A;  4CEO A;  1TKX A;  4E89 A;  1K6Y A;  1NJW A;  4F2R A;  1RT5 A;  4N41 A;  1ZBF A;  2G8F A;  4B9L A;  1S1V A;  1VSD A;  2A1S A;  1SKW A;  3VQD A;  3RTV A;  4DS4 A;  1IKX A;  4MFB A;  4DWI A;  4FW2 A;  4LH4 A;  3AO5 A;  5SWM A;  4K8Z A;  4J2B A;  4B3O A;  3OYJ A;  1N6Q A;  1KFD A;  3NFA A;  4CFC A;  2G8W A;  2DFE A;  1JLF A;  2VG5 A;  3LAK A;  3SV3 A;  2HHX A;  3OYB A;  3V81 A;  3O3G A;  1KFS A;  4DLE A;  4DSJ A;  4DG1 A;  1EXQ A;  2RN2 A;  4ID1 A;  4FJL A;  3QNO A;  1BQM A;  4DLG A;  2O4G A;  2HHU A;  3AVC A;  4DF8 A;  4OLB A;  1CZB A;  3QEI A;  3HVT A;  4CES A;  4FXD A;  5CZ1 A;  2HVH A;  4W5R A;  4BWM A;  3VQE A;  3SUN A;  3T3F A;  3ZSV A;  4K8X A;  1VSI A;  3RRH A;  5J2Q A;  4FJX A;  3CM5 A;  2KQ2 A;  5KGX A;  3NH2 A;  4ICL A;  2D5R A;  1U04 A;  5HRS A;  1RT2 A;  4Y1D A;  1BIU A;  4AIL C;  4CF1 A;  5J2N A;  3HPH A;  1T05 A;  1NK5 A;  2KZZ A;  1HJR A;  3DMJ A;  1XI1 A;  1BCO A;  2P1J A;  1KVA A;  4ELV A;  2HHV A;  4DSK A;  3JSM A;  4Z4G A;  3SUO A;  4Z4F A;  1KRP A;  2X6N A;  3L3V A;  4OVL A;  5HRR A;  1KVC A;  1J5O A;  2YHA A;  3QIN A;  4PWD A;  4M3U A;  5CY4 A;  4N56 A;  3OS1 A;  2XRI A;  1TAQ A;  3JYT A;  4UQG A;  4B8A B;  2HMI A;  3DRR A;  4OPK A;  3RR8 A;  4NCB A;  3SQ1 A;  4KAZ A;  2RPI A;  3AA3 A;  4KTW A;  1S9E A;  4MQ3 A;  3TAM A;  5HRN A;  1R0A A;  4DTP A;  3TR8 A;  3S3M A;  1VSH A;  2F8S A;  3WNG A;  5HLF A;  1KSP A;  3SUP A;  3FFI A;  1GOB A;  4DFM A;  4B9U A;  1ZBI A;  3AVI A;  2BDP A;  1WAJ A;  4C8O A;  1J54 A;  2YNG A;  5DMR A;  4KHN A;  3SQ0 A;  2QK9 A;  4C8K A;  1KLN A;  4ELT A;  3V9Z A;  4QAG A;  3KKR A;  3HT3 A;  2B5J A;  2B6A A;  3KJV A;  3HVR A;  2P51 A;  1I3A A;  1RIL A;  4CEZ A;  3QEP A;  2ZD1 A;  4EZ9 A;  4KHS A;  2HND A;  3VQC A;  3U3G A;  2QKK A;  5J2P A;  4BAC A;  1YTA A;  3HP6 A;  1Z26 A;  3PO4 A;  3NF7 A;  3VQ9 A;  3NAE A;  1WSE A;  3CQ8 A;  1B9F A;  4DQQ A;  4E7H A;  3ZT3 A;  3HST B;  4CF0 A;  1FKP A;  2FBY A;  3L2Q A;  3EYZ A;  1BCM A;  3DLH A;  2DY4 A;  4KTZ A;  4B8C A;  1QSY A;  2WOM A;  2E6L A;  4O0I A;  1YTU A;  3AV9 A;  4HVJ A;  5I3U A;  1RT4 A;  3OYN A;  1RBR A;  2Z1H A;  3V9W A;  1BGX T;  4C8M A;  4CJE A;  4FM2 A;  4FZZ A;  1GOC A;  1EP4 A;  3AA5 X;  4QOZ B;  4E7I A;  4FYD A;  1W0H A;  3K59 A;  4FW1 A;  1Y97 A;  4IBN A;  1X9S A;  4IFV A;  3LP2 A;  4OKK A;  5E41 A;  5KTQ A;  1JLG A;  3OYD A;  4HTU A;  3DI6 A;  4DSE A;  3V4I A;  3OY9 A;  1LWF A;  3RWU A;  3AVG A;  4NYF A;  5CYM A;  1CZ9 A;  3DM2 A;  3VQA A;  4E7L A;  2IAJ A;  2RKI A;  1NKE A;  1RTD A;  4O0J A;  1N5Y A;  2KTQ A;  2YV0 X;  4CGD A;  4Z4H A;  1RTH A;  1NOY A;  2G8I A;  1X9W A;  1JXB A;  4DTX A;  4B9V A;  3KLF A;  4B9M A;  2ATQ A;  3ALY A;  1IG9 A;  4IDK A;  3NGZ A;  1RT3 A;  4I9Q A;  3HPG A;  3PX6 A;  3DLE A;  3TAB A;  4O5B A;  1FK9 A;  5KRS A;  1NKC A;  3PY8 A;  1ZYQ A;  4OLA A;  3I0S A;  1RT6 A;  4FVM A;  3T19 A;  4CJS A;  1L3T A;  3PX0 A;  3I0R A;  3SQ4 A;  1D5A A;  4HHT A;  4E1N A;  4LH5 A;  4AHU A;  3NH1 A;  2YNH A;  3TWH A;  3RMB A;  4CIE A;  3HK2 A;  2YKM A;  4CER A;  4JRQ A;  2PYL A;  4FJ8 A;  1VSE A;  4Z4E A;  3KK2 A;  1A5W A;  4NCG A;  4ZHR A;  1S5J A;  1WSF A;  4KB1 A;  3G0Z A;  3HPO A;  3NCI A;  1Z25 A;  3MAQ A;  2VG6 A;  3QNN A;  5FDL A;  3VQB A;  3OYH A;  3CFR A;  4DTR A;  1HMV A;  4PUO A;  4M3Y A;  2P5G A;  2X74 A;  3M8P A;  1HRH A;  1CLQ A;  5HRO A;  4NYN A;  1BHL A;  1NK6 A;  1HQE A;  3NGI A;  4O55 A;  1ITG A;  3OYL A;  3HJF A;  1ASV A;  3E01 A;  1XC9 A;  1ZBU A;  1S1U A;  1TL1 A;  1SL2 A;  1BIS A;  3T1A A;  1VSF A;  4CJL A;  1EX4 A;  2YNI A;  1IH7 A;  1NJZ A;  4J2E A;  4CJW A;  3BGR A;  4N76 A;  3LDS A;  1C1B A;  3AO2 A;  4Q5V A;  1SL1 A;  1KLM A;  3P1G A;  4FJK A;  1S6Q A;  2G8U A;  3OJS A;  3RR7 A;  1LWC A;  4E19 A;  1NK9 A;  2QXF A;  1RTI A;  2BAN A;  4FCY A;  5J2M A;  1KVB A;  3LP3 A;  3MXI A;  3P5J A;  3NE6 A;  4OKJ A;  2XHB A;  2I5J A;  3QER A;  4QCL A;  4CEC A;  1UA0 A;  2OPP A;  2G8K A;  3IS9 A;  5KI6 A;  2OYQ A;  1JLA A;  3ZT0 A;  3LP0 A;  2A1R A;  2RF2 A;  3LPU A;  4PA1 A;  1SV5 A;  3C6U A;  4O44 A;  4CGG A;  1VRT A;  2BE2 A;  3AVM A;  3KLI A;  1S1T A;  4RW8 A;  4YFU A;  3KLE A;  3EZ5 A;  4DTJ A;  2ZE2 A;  4M3X A;  4DMN A;  5D3G A;  1UOC A;  4AHT A;  3V9X A;  4CHQ A;  1RBU A;  3KLG A;  1LW2 A;  4OPJ A;  3AVN A;  1WSH A;  2HHS A;  3DLR A;  3QEW A;  4CJF A;  1S9G A;  4CHO A;  1SKR A;  1A5V A;  5KGW A;  4CE9 A;  2DFF A;  4ZTJ A;  4LY7 A;  3BDP A;  4DU3 A;  2W42 A;  1FXX A;  4CK2 A;  2P5O A;  1HNV A;  4IKF A;  1QQC A;  3QES A;  4PQU A;  3AO3 A;  3CFP A;  4DTN A;  3NDK A;  4FLV A;  2EX3 A;  3V1Q A;  4DQR A;  4AHS A;  3MXM A;  4ZTF A;  5FRM A;  2BGG A;  1TGO A;  1IKV A;  2VWK A;  3KK3 A;  1C6V A;  4FLZ A;  3V9U A;  3PX4 A;  4GVM A;  3SI6 A;  1NKB A;  4CHP A;  4FLT A;  4B08 A;  4KRF A;  3F9K A;  3VN5 A;  3SZ2 A;  4OGE A;  3AO4 A;  3HXM A;  3WNE A;  4AHR A;  1HYZ A;  3AA4 A;  3OYK A;  3OYA A;  3ULD A;  4BE0 A;  4L8R B;  5JS1 A;  3SUQ A;  1Q9Y A;  5SZT A;  1T8E A;  4F4K A;  1RNH A;  1U48 A;  4H4O A;  1WSG A;  4CFD A;  3RRG A;  4PY5 A;  3S9H A;  1L3V A;  3KD5 E;  3I8D A;  1WLJ A;  2AJQ A;  4FLW A;  3OS2 A;  3DOL A;  4DQI A;  2B4J A;  1HYV A;  3TI0 A;  2PZS A;  4JS5 A;  3B6P A;  4CED A;  3TAQ A;  4FK2 A;  3K58 A;  2OPR A;  4C8N A;  1TK8 A;  4HUF A;  1RCH A;  4OGC A;  3TAE A;  3TAF A;  1QHT A;  1U4B A;  4CGI A;  2HNY A;  4CCH A;  4HCC A;  2D0B A;  1KTQ A;  1C1A A;  2FBX A;  2IDO A;  3MED A;  4H8K A;  2OZS A;  4DSL A;  3L3U A;  3P83 D;  2XY5 A;  1HPZ A;  1SUQ A;  3K5N A;  4CJU A;  3QIP A;  4DU4 A;  4FJH A;  2X6S A;  3K5L A;  1LAV A;  1ZBL A;  4CJT A;  4CJV A;  2O4I A;  1BI4 A;  3AVL A;  2HB5 A;  4FLY A;  4DTO A;  3L2V A;  2FC0 A;  4NCA A;  1XWL A;  1RDC A;  2E4L A;  3G10 A;  3OYG A;  5K14 A;  2D0A A;  4RW7 A;  2PY5 A;  4J2D A;  3SPY A;  3PV8 A;  3IRX A;  3MEE A;  4HUG A;  1TL3 A;  2OZM A;  3K57 A;  4AHV A;  1RT7 A;  4CJP A;  2ITG A;  5HBM A;  3AVK A;  3U3Y A;  1RDA A;  1D9F A;  1IKW A;  1C0T A;  4FK4 A;  4FM1 A;  1BL3 A;  2F96 A;  3M8Q A;  4KKO A;  1S1W A;  4DFP A;  4DFJ A;  4OJR A;  4EZ6 A;  1WAF A;  4FJI A;  1IO2 A;  4CEQ A;  1U49 A;  5EU7 A;  1IKY A;  4E1M A;  2IGI A;  5C25 A;  2E6M A;  4EP5 A;  3VQP A;  3SPZ A;  2IC3 A;  4KI4 A;  3B6O A;  1BQN A;  3KIO A;  4DFK A;  4CFB A;  2EHG A;  3THV A;  3EY1 A;  3OYF A;  3OS0 A;  4EP4 A;  3DRS A;  4JRP A;  2IS3 A;  3VQ5 A;  4FM0 A;  4CEF A;  4I9L A;  1UWB A;  4H4M A;  4FLU A;  4E3S A;  3TAG A;  4FJJ A;  4FJ9 A;  4KB0 A;  5CYQ A;  1NJX A;  2FBT A;  3NF8 A;  3AVB A;  3VA0 A;  3ZT2 A;  5FRO A;  3LAN A;  4W5Q A;  3OYM A;  4DU1 A;  5JS2 A;  1XHZ A;  3QO9 A;  3L2U A;  1O1W A;  1X1P A;  5C24 A;  1VSJ A;  2HHW A;  4FZY A;  4CGJ A;  3VA3 A;  1TAU A;  3O3F A;  3RMA A;  4DTM A;  4KV8 A;  4KHQ A;  1C0M A;  2PYJ A;  2YHB A;  3V9S A;  1QSL A;  1D8Y A;  1T7P A;  2HVI A;  3C6T A;  3V1O A;  2G8V A;  4W5T A;  1U45 A;  4FJM A;  3QIO A;  1RBV A;  5CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...