3V9XA

Crystal structure of rnase t in complex with a preferred ssdna (aaa) with two mg in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
211
Chain Sequence
AQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9xA00
3VQ8A 4DTMA 4CEBA 4CHPA 1TK8A 1W9HA 4XIUA 4LSLA 3OJUA 4J2AA 4AHCA 5T7BA 4O5BA 3C95A 4KHYA 4DF8A 4DQPA 3ASMA 3NF6A 3KLFA 1ASWA 2RPIA 4OLAA 3NDKA 3L8BA 1BHLA 3KK3A 3LZJA 3CFPA 1RT1A 2P5GA 2YKNA 2EX3A 4W5TA 4FZZA 4FJJA 3RR7A 3G0ZA 5C42A 3TARA 2PZSA 3AA2A 4KHUA 4HUEA 1JLBA 2W42A 1SL2A 2P1JA 3DLRA 4CJRA 1ASVA 1VSIA 3KTQA 1RBUA 4DSJA 1TKDA 1RBRA 2E6MA 2OYQA 1RTIA 1JXBA 4LD0A 3S9HA 2BDPA 3RWUA 2RF2A 3SJJA 3LDSA 1W0HA 1SL0A 4Z4HA 4JS5A 1XWLA 1D5AA 4CHQA 1HYZA 1WAFA 3V81A 3SPZA 3SNNA 1BQNA 3S3OA 3LAMA 3VQBA 3OS0A 1BISA 2ATQA 4OGEA 4FW1A 1L3UA 4FYDA 4KPYA 3V9SA 2D0CA 4HVJA 3NH0A 4OVLA 3RMBA 2D0AA 2F96A 4DFMA 3MEDA 4W5RA 3SUNA 4L8RB 4FJ9A 1JLFA 3CFOA 4IG0A 4FK0A 1SL1A 4JRPA 1QTMA 4ELTA 5D3GA 3HVTA 3KIOA 4DS5A 4ZHRA 3QEWA 4CIGA 1S1TA 4KTZA 3V6DA 2XY7A 4KB0A 4CK3A 4H4MA 1TAUA 2E6LA 3AVIA 4HUFA 1RT5A 4ZTFA 1WSIA 4B9TA 4E0DA 5CZ2A 3ZT2A 4KFBA 4DFJA 4M41A 3V9UA 4KI6A 1KVAA 1U04A 3M8QA 3OJSA 4FJ7A 1NK0A 3SPYA 2QK9A 4CEAA 1KCFA 1JL1A 5CYQA 4RW9A 1RBSA 3AVGA 3DRSA 4FW2A 4JLHA 2IDOA 3AA4A 1TKXA 3DM2A 3QERA 1U45A 4FJMA 3TAFA 3KLGA 3LP2A 1TKTA 3LP3A 3AVKA 2FBTA 1Q8IA 1TAQA 3NFAA 4LH5A 4CESA 1VSHA 1QQCA 5FDLA 4E89A 4C8NA 1VSKA 3VN5A 1L3SA 4E1MA 1JXEA 1UAXA 3LALA 4ELUA 5SZTA 4CJUA 1Q9XA 3IAYA 4FM0A 1TL1A 2Q3SA 2GBZA 2X6NA 4KAZA 5FROA 5DMRA 1U48A 4DTPA 3HO1A 3I0RA 4W5OA 3KKSA 3CM6A 4FCYA 3QEIA 1BIZA 1T03A 1SUQA 4DTXA 4J2DA 3VQ5A 1XI1A 4OKKA 4M42A 4N5SA 1UA1A 4KHWA 3OVNA 4FLXA 3I8DA 1NK4A 4HCCA 3BDPA 3WNHA 3LWMA 3M8SA 3TAEA 2IOCA 4W5QA 3SUQA 4ID1A 2OA8A 3VA3A 1C0TA 3V1RA 4NCBA 2B5JA 3SYZA 1DLOA 3CFRA 3AA5X 4DSKA 3SI6A 3CG7A 1TKZA 3MXJA 5CYMA 4CIEA 2XY8A 3OYMA 4DTNA 1X9SA 4FJ8A 3HPGA 1JLQA 4I2PA 3VQCA 1X1PA 2YNHA 3ZT1A 3WNGA 4CGHA 1B9FA 3M8RA 4MQ3A 4FJGA 2AJQA 1IKWA 2XY6A 1BIUA 3OYAA 2FC0A 1QHTA 2DFFA 4O4GA 3D0PA 3MEEA 3U3YA 2PY5A 1HQUA 3OS1A 4DS4A 4KRFA 2DFHA 3EYZA 3AVBA 2F8SA 2VG7A 4NYFA 3RMCA 3T3FA 1KLNA 1X9MA 4M3WA 2HNDA 4YNQA 4C8KA 4DSLA 3O3HA 2IGIA 3K59A 5EU7A 1LWFA 4H4OA 2EHGA 3KLIA 1VSEA 4BWMA 4JRQA 2OPQA 4EZ9A 2DTUA 3OYKA 4OKEA 1XC9A 4CGGA 1DTTA 3OYEA 3QEVA 3SQ1A 4DWIA 3V1QA 4CJTA 4J2BA 4PWDA 2YNFA 1BL3A 1IH7A 3ITHA 3C94A 3ZT3A 4CJEA 2OPSA 3P83D 4O0JA 2PYJA 3VQQA 4IKFA 3HP9A 3SZ2A 3RMDA 3HK2A 1XHZA 5KGWA 2ITGA 2HNZA 4FLTA 1TK5A 1ZBIA 4QAGA 3QLHA 1Q9YA 3KLEA 3HJFA 1NKBA 2KZZA 4ICLA 3L2QA 4ZTJA 1EXQA 4E1NA 4Q5VA 1QSSA 2VWJA 4CK2A 1DTQA 4F2SA 3OYFA 4OGCA 2G8IA 3V4IA 4IFYA 3EY1A 3ZCMA 1RNHA 1S9EA 2G8UA 1RDBA 4O44A 4CJWA 4CFCA 4E19A 4BE0A 2QKBA 4CF2A 4AHSA 4B9NA 2VG6A 5FRMA 4FJKA 4CJ5A 3SUOA 2IC3A 3QINA 2P51A 4RW7A 1MU2A 4DF4A 2Z1HA 1ZBUA 3HP6A 2BGGA 3NF7A 3ZT0A 4DU1A 2KFNA 1BQMA 4CEZA 3L3VA 4BACA 4AHTA 3OYLA 3SQ2A 3QIPA 1KFSA 4CFBA 1FK9A 1LW2A 5HLFA 1BI4A 4NCAA 4CK1A 4QOZB 1CXUA 3AO4A 3SCXA 1B9DA 1BCMA 2WOMA 3AO1A 1YT3A 3AVNA 3QIOA 1U49A 3PO5A 5FRNA 4CJQA 1HYSA 3SQ4A 4I9LA 1LW0A 3T19A 4CEOA 3OY9A 1SKRA 1WNSA 2R7YA 3ULDA 4CHYA 1GOCA 4CFAA 3KLHA 3RMAA 2YHAA 3V9WA 3DRPA 2YV0X 1CZ9A 1I39A 4CF8A 1TL3A 4BE1A 1HJRA 4E7HA 1C0MA 3H08A 4PUOA 2Z1IA 4H8KA 1NOYA 4CIFA 1EP4A 2VG5A 5JS1A 4CJFA 3SUPA 1EETA 4I2QA 4I7FA 1WN7A 4CGIA 2XY5A 4CHOA 3TI0A 3DYAA 1J54A 4FM1A 3B6OA 4IG3A 1O1WA 5HRNA 2Y1IA 5SWMA 3K5OA 2PYLA 1GOBA 2HHSA 1T7PA 3K5LA 4NCGA 3L3UA 4GMJB 4M45A 4Z4FA 4ID5A 3WNEA 4FJIA 1KRPA 5HP1A 2NUBA 5KGXA 4BDYA 4B3OA 1Z26A 1NK5A 3VQPA 4B8CA 1L5UA 3ZSYA 3KK2A 4I9QA 5C24A 3F9KA 2G8HA 2ZE2A 1A5WA 1RT3A 3E01A 1T8EA 4F3OA 1RBVA 1RBTA 1K6YA 4ELVA 3AVAA 3OYJA 2KQ2A 3OYDA 2F8TA 4EP5A 3LPTA 5HRRA 3RTVA 1CLQA 3TAQA 3TWHA 2HHQA 1NK9A 1HYVA 1N5YA 4Q0BA 4Z4GA 2OPRA 4K8ZA 1HQEA 4KHQA 3IRXA 1YTUA 3AVFA 4CF9A 2ETJA 3AVMA 4M3RA 3ZSQA 3RRHA 1WSHA 3CM5A 3QESA 3JYTA 4AHRA 1S1XA 2OPPA 1KSPA 3AVCA 2YNIA 1IKXA 2GUIA 3RRGA 4Y1DA 1D9FA 4BDZA 3IG1A 1NJZA 4N76A 2GV9A 2O4GA 4FLZA 3AA3A 5J2MA 1A5VA 4AH9A 4DSEA 3AVJA 1CXQA 1VSDA 1KVCA 3AO2A 3FFIA 4HHTA 2BANA 3JSMA 5HRPA 4Z4CA 4N47A 3DMJA 4DQQA 5DK5A 3OS2A 1TV6A 4E3SA 4FJNA 1YVUA 3D45A 1JLAA 3PX0A 5J1EA 2XRIA 3NGIA 4O0IA 4FLWA 2KTQA 1JL2A 3DOLA 1U4BA 4FLUA 4B9VA 2X78A 5KRTA 4M3UA 1WAJA 2HVIA 5JS2A 4DLEA 1LAWA 2KZMA 1D8YA 3CYMA 4KB1A 5J2QA 3QNNA 3SV3A 4FM2A 4B9SA 2HNYA 1HNVA 3VQ7A 1TK0A 3K5NA 3ZSVA 4OLBA 1TVRA 1N6QA 1HNIA 3ISNC 3M8PA 4Z0UA 4CJKA 5KRSA 4EP4A 4CGDA 2RN2A 1RCHA 5J2PA 3NAEA 4F8RA 3DOKA 4N56A 4FK2A 1RT2A 4RW6A 4M3ZA 1BCOA 4G1QA 4DFKA 4M3TA 1RDAA 3QO9A 4DG1A 3DI6A 5HBMA 4W5NA 3P1GA 1S9GA 4IDKA 4C8OA 1JLEA 3OYCA 4DTSA 3SQ0A 3HSTB 3NE6A 1QE1A 1VRTA 4Y1CA 3TANA 1VRUA 1U47A 3HPOA 3TAGA 2BE2A 1QSLA 4PY5A 1NJYA 5E41A 4AHUA 4BE2A 3UIQA 1FKPA 4CJSA 1ZYQA 4DTOA 4K8XA 3U6FA 4WE1A 5I42A 4DLGA 3QETA 4CERA 1RT7A 3K57A 1KVBA 2DY4A 1C0UA 3DLGA 3BGRA 4B9MA 4RW8A 3TAPA 3VQDA 4CFDA 1T05A 2Z1JA 5K14A 2HB5A 4HCBA 2G8WA 3MAQA 3THVA 4PA1A 1LWEA 3O4NA 1REVA 3DRRA 1ZBHA 1S1UA 1IKYA 4KREA 3A2FA 3DLHA 2X74A 3QEXA 4AHVA 1VSFA 4CJLA 4M3YA 3MEGA 2DFEA 5CZ1A 1C1AA 4CGFA 4UQGA 4EZ6A 1FXXA 4DSIA 5CY4A 4DTUA 3ALYA 3NF8A 5KI6A 4CF1A 4B8AB 1EKEA 3OYHA 1R0AA 4KI4A 1FKOA 3V9ZA 1B92A 2HW3A 2FBVA 4DU4A 4HTUA 4DFPA 4KTQA 4E7LA 2HHXA 1NOZA 3T1AA 2B4JA 3O4QA 3LZIA 1RTHA 3IS9A 4OPJA 4DTRA 3L2WA 1UA0A 2FBXA 4F2RA 3HT3A 3PX4A 1NKEA 3G10A 1RDCA 4DQSA 1S1VA 3VQAA 4B9LA 2Y1JA 1KLMA 1X9WA 4FVMA 1LV5A 4F4KA 4FZXC 1XHXA 1RILA 2JLEA 3HYFA 1VSJA 1WSGA 4RW4A 1HPZA 1VSMA 2IAJA 3LWLA 4NYNA 4KHSA 3VQEA 3HM9A 3K5MA 1RTDA 3AO5A 3ZSRA 4FXDA 1WLJA 3VQ6A 3QEPA 4E7KA 4FJLA 1JKHA 1BI4B 1C1CA 1J53A 3TAMA 3LAKA 2HHTA 1S1WA 5HRSA 4C8MA 3MECA 5KTQA 3V9XA 4CEFA 3NCIA 1S6QA 4TSXA 1NJXA 4CJPA 3NH2A 4FLYA 1A5XA 3PO4A 4FZYA 4GW6A 3DLEA 4J2EA 2VWKA 1L3VA 3AV9A 1NK6A 2YNGA 3NGYA 4CJVA 4DU3A 4FJXA 3VQ4A 1RDDA 3HPHA 3LP0A 3O3FA 4CGJA 1JLGA 2XO7A 3K58A 1GOAA 4F3TA 4CJ3A 3L2VA 2QXFA 4LY7A 3F73A 3ZSWA 3WNFA 1JLCA 1HMVA 2YHBA 1HRHA 1VSLA 2HHUA 4KTWA 2X6SA 1TGOA 2A1SA 3C6UA 2HVHA 3OYNA 4CCHA 4OPKA 2P5OA 1IKVA 3O3GA 1Z25A 2XHBA 4DQRA 2OZMA 1I3AA 2WONA 3B6PA 4CEDA 1J9AA 2ZD1A 1LWCA 2A1RA 2YKMA 1F21A 3KK1A 2B6AA 3LANA 3PV8A 3PX6A 1RTJA 1NK8A 2Z1GA 1Y97A 3KD1E 1UOCA 1ZBLA 1LAVA 4JS4A 4KV8A 4M3XA 4LH4A 3NGZA 3NBPA 1ZBFA 1ITGA 3OYBA 2HHWA 3DLKA 4CJ4A 3ZSXA 4CECA 3RR8A 2RKIA 5C25A 3KJVA 4MFBA 4B08A 3L2RA 3EZ5A 4LSNA 2KFZA 4R5PA 3LPUA 4CF0A 4E7JA 3TABA 4DTJA 4CEEA 3S3MA 4DQIA 4IFVA 4Z4EA 3C6TA 3NHGA 1YTAA 1L3TA 4HUGA 1RT4A 2QKKA 4B9UA 2JGUA 3U3GA 1G15A 3L2UA 1UWBA 5J2NA 1KFDA 1QSYA 2HMIA 4CHNA 1SV5A 4E7IA 4PQUA 3K2PA 1WSEA 3DLBA 4KHNA 4QCLA 2I5JA 2IS3A 1NJWA 1NK7A 1D9DA 1IG9A 3HL8A 1SKWA 1EX4A 2LSNA 3AO3A 4RG8A 4BWJA 1BGXT 2ZQBA 3AVHA 3ZSZA 3OYGA 4DSFA 3NF9A 3S3NA 3V1OA 2KW4A 2D5RA 3ZT4A 4KO0A 2E4LA 3HXMA 1ASUA 2O4IA 1NKCA 1WSFA 2D0BA 4KKOA 1C6VA 1J5OA 1S5JA 2G8VA 1RT6A 3P5JA 2G8FA 3PY8A 4FJ5A 3SV4A 5I3UA 3KD5E 4Z4IA 3I0SA 3PUFA 1C1BA 4AILC 2OZSA 2G8KA 1VK0A 4OJRA 1IO2A 1CZBA 3TR8A 2FBYA 3OYIA 3HVRA 3MXMA 4FJHA 4N41A 3AVLA 3ZSOA 4CHZA 3VA0A 3KKRA 3QNOA 2HHVA 4CEQA 1WSJA 3NH1A 3LP1A 4GVMA 4C8LA 5HROA 4OKJA 3VQ9A 4FLVA 4BDPA 4DMNA 1SKSA 4O55A 3CQ8A 4CE9A 4FK4A 1QS4A 1KTQA 4IBNA 4YFUA 3MXIA 1S6PA
chains in the Genus database with same CATH superfamily
4DTMA 4CEBA 1X3NA 3OJUA 4XIUA 4DF8A 1OH8A 3NVMA 3L6QA 5BPMA 4OLAA 3NDKA 5KQ8A 1RT1A 3WXIA 4B1UB 3CCQN 3G0ZA 5BRHA 4HUEA 2DPNA 1SL2A 2VGMA 1ASVA 4JV5K 3J7AP 2QTDA 1TKDA 4LD0A 2RF2A 5FPEA 1ZC6A 3ZETA 3SNNA 1BQNA 4A5BA 3LAMA 2ATQA 2ASOA 4KPYA 1MWMA 5JVHL 1DKGD 4MO5A 4BGBA 4H0TB 4L8RB 4FJ9A 1JLFA 4HWIA 3CFOA 4IG0A 4FK0A 5D3GA 4JRPA 1QHAA 4KB0A 2DTUA 4CIGA 1S1TA 4H4MA 1TAUA 5AQFA 2A40A 1RT5A 4B9TA 1WSIA 3H6EA 4DFJA 4KFBA 1KVAA 5AR0A 1NK0A 4CEAA 2E2PA 1KCFA 5CYQA 1YXQA 4A59A 4RW9A 1RBSA 3T69A 1U45A 4FJMA 3KLGA 3MN5A 3VF4A 5FPDA 2QWRA 1Q8IA 1HJOA 1TAQA 4CESA 5BR8K 4E89A 4C8NA 1VSKA 1L3SA 4MO4A 1TL1A 2Q3SA 2GBZA 2P9IB 2X6NA 5DMRA 1U48A 4DTPA 5AQWA 3QEIA 4FCYA 1SUQA 2A6AA 4J2DA 3GG4A 4WF9L 3VQ5A 4OKKA 4M42A 4N5SA 1UA1A 4FLXA 4HCCA 1EQYA 2OA8A 3O9UA 2B5JA 3SYZA 2NLXA 3THYB 3VOVA 4IJAA 4DTNA 1JLQA 3K58A 1X1PA 3WNGA 4WQ5A 5GAEP 2OCEA 2Q31A 1IKWA 5C12A 3R8EA 2XY6A 3OYAA 1VQNN 1QHTA 3U3YA 4O4GA 1NMNA 3WXKA 3QFUA 1HUXA 4YY3K 3OS1A 4DS4A 2PY5A 3AVBA 5A2QO 2VG7A 2O8EA 3PIOL 2IGIA 3R3LA 4JRQA 2VGNA 3O5BA 4DR2K 1DTTA 4DWIA 4J2BA 5GAHP 3O8MA 4PWDA 2YNFA 4LFBK 3QMLA 4O0JA 3RMDA 2Q2RA 4C23A 2OANA 5KGWA 1XHZA 1TK5A 4JI8K 4IOAL 1NGDA 5GIOA 1ZBIA 4CBXA 4WFAL 2AP1A 4ICLA 1DEJA 2ZGYA 3L2QA 4ZTJA 1QSSA 3L4QA 2ASMA 3EY1A 3ZCMA 1S9EA 4PKHA 4CFCA 3CCSN 2O8FB 4B1VA 4B9NA 3ENBA 3H3OB 2VG6A 2QWLA 4DV5K 3SUOA 4YORA 4IOCL 2W41A 4RW7A 3NF7A 3ZT0A 2KFNA 2A42A 3CCRN 4CEZA 3D2EB 4NLBA 3OYLA 4O8UA 3QIPA 1FK9A 4NCAA 2GWJA 4BRNA 4H5NA 1YT3A 3QIOA 1U49A 4BRCA 3SQ4A 1XMOK 3VESA 3FZMA 3ULDA 2HOEA 3QB0A 4CF8A 1CZ9A 1I39A 4R79A 3DXMA 3ZEUA 4PUOA 3EKSA 1EP4A 2VG5A 3AAQA 5JS1A 4AF1A 2E5LK 4I7FA 3J80O 3TI0A 4FWQA 4BREA 4CHOA 5C0YA 1YJNN 3B6OA 1O1WA 1KAXA 3O9QA 4LF8K 1GOBA 4IZ9A 3K5LA 3L3UA 4M45A 4Z4FA 4LF6K 3VEOA 4FJIA 2NUBA 4B3OA 1KAYA 3CPWM 5C24A 3ZETB 3CI5A 5KQDA 2G8HA 2ZE2A 3BEXA 3E01A 1T8EA 2GX9A 4JKBA 3O1WA 1ATNA 3LPTA 3RTVA 3SLCA 1CLQA 4JKAA 1ATRA 1N5YA 2OPRA 3THWA 1HLUA 4LF9K 4AHRA 1S3XA 1KC8O 4A57A 3KZBA 4YOYA 1NJZA 2OTJN 2O4GA 4FLZA 5J2MA 1RFQA 3FFIA 4N47A 3DMJA 2IVPA 4DQQA 5DK5A 3OS2A 4E3SA 3G4SN 3D45A 3CETA 1JLAA 5F2RA 2XRIA 1U4BA 2X78A 3QBXA 2HVIA 5JS2A 1LAWA 3N4PA 1HNZK 4FM2A 2E8AA 3O1BA 3ISNC 2NRZA 3EKUA 4CBWA 2RN2A 4FOIA 4M3ZA 2NRWA 1KXPA 4FO0A 2JWKA 1BCOA 5BREA 4M3TA 5LJVA 1BOTO 4DG1A 4W5NA 3TTFA 3P1GA 1NGCA 2QWNA 5C2DA 3ZX0A 3OYCA 2NRXA 5M1FA 3SQ0A 3NE6A 1QE1A 1QSLA 4BR9A 5CR4A 4CZGA 4DV3K 3LDNA 5I42A 3MX2A 3QETA 4CERA 1RT7A 4KH5A 2O8EB 4B9MA 4BR0A 1ESVA 3FZHA 3KWGA 3VQDA 4CFDA 4YOVA 3MAQA 1GLDG 3DRRA 2A3ZA 2X74A 4WCEL 3QEXA 4M3YA 4BROA 4BRMA 3NF8A 3VEXA 1EKEA 3KVGA 3O6WA 4DR3K 1EWQA 1FKOA 3V9ZA 3CQXA 1SQKA 4MLEA 4DU4A 4HTUA 4MDAA 5KPZA 2B4JA 4J8FA 3LZIA 4OX9K 4DTRA 3I8BA 1UA0A 3WT0A 1NKEA 3G10A 1RDCA 4UY8O 4B9LA 1X9JA 1S1VA 4E1JA 2QW9A 2Y1JA 4JK9A 2WC9A 1RILA 3HYFA 1VSJA 3CJCA 1HPZA 1VSMA 2IAJA 3LWLA 4NYNA 3VQEA 5B8HA 5HOOA 3K5MA 3D6RA 1RTDA 3QDKA 3LDPA 1YITN 4K41A 1HNXK 2QWQA 1Q81O 3A8YA 3LAKA 2HHTA 1S1WA 4C8MA 3VF2A 3V9XA 1S6QA 4IO9L 3FFKB 1L3VA 5DM6L 1NK6A 4BRQA 2YNGA 3NGYA 3UE5A 5TKWA 3HPHA 3LP0A 3O3FA 3DXMB 3CCUN 4WQ4C 3ZSWA 3WNFA 1VSLA 5HL7L 2E1ZA 3C6UA 4GV3A 4FPAA 4JKGA 1Z25A 2OZMA 4XH5A 2WONA 4CEDA 2YKMA 3MMVA 3KD1E 5AQPA 4JS4A 2HHWA 3ZSXA 2RKIA 4B08A 4BRHA 3L2RA 3EZ5A 3P31A 2KFZA 4R5PA 3LPUA 3TABA 3E9OA 1KD1O 4CEEA 3S3MA 4DQIA 4BR5A 4Z4EA 4JI3K 1OVQA 2E1YA 1YTAA 5IT9O 2Q0RA 3L2UA 3FZFA 2HMIA 1SV5A 3THWB 3L0QA 1U6ZA 3I55N 4K25A 2I5JA 1EX4A 1TUYA 4H0OA 4B3MK 3ZSZA 5AQVA 1SS6A 3R6MA 4KO0A 1NKCA 4BVOA 5AQOA 3E66A 2V7YA 2G8FA 3PY8A 4FJ5A 1C1BA 2IIRA 4AILC 2G8KA 4OJRA 1BG3A 3OYIA 2P9KA 3ENHA 3ZSOA 1XC3A 3I56N 4GVMA 4I6MA 5AQYA 4CE9A 4YFUA 4ILHA 1S6PA 4CHPA 1WUAA 4LSLA 4J2AA 4AHCA 4O5BA 3C95A 4KHYA 4DV1K 1GLLO 2RPIA 1XUPO 3L8BA 3KK3A 1EO1A 4FZZA 2YKNA 1J6ZA 4FJJA 2PZSA 1VQ9N 3AA2A 4HTLA 1JLBA 3G71N 3VEYA 1YJ9N 4LF4K 1SZ2A 1W7AA 2O8CA 2BDPA 1NJIO 1YAGA 4JS5A 1XWLA 1D5AA 3V81A 3CC4N 4FW1A 3NH0A 5JLFA 3RMBA 4DFMA 3W0LA 2VQFK 2ZWHA 3ATUA 3QBWA 2VWBA 3QEWA 3VMFB 2I7NA 4CI6A 4HUFA 5M1OA 5CZ2A 4X62K 3V9UA 1TYQB 2UU9K 1G99A 2NRVA 4A62A 2F7TA 3OJSA 3A5NC 3BF1A 1YIJN 3AVGA 3DRSA 4JLHA 2IDOA 3AA4A 3QERA 2F9WA 1GLCG 2QWOA 1TKTA 3LP3A 3HBTA 1QQCA 5FDLA 3VN5A 2NNWA 1UAXA 2Q97A 4ILJA 4ELUA 4CJUA 4FM0A 3SJHA 1RDWX 3JXUA 1NG9A 3HO1A 3F2KA 3KKSA 1T03A 3MDQA 1VQON 2GEMA 4NB4A 4KHWA 5JMVA 3OVNA 2FLOA 3I8DA 1NK4A 1OH5A 3WNHA 3LWMA 3SUQA 3CMAN 3V1RA 2Q1NA 1DLOA 3SI6A 3MXJA 5CYMA 4CIEA 3OYMA 1X9SA 4JKGB 3VQCA 3HPGA 4JK8A 3VTIA 4JKCA 3ZT1A 3FLCO 1VQ5N 3KK7A 2FC0A 2ZJPL 3R1XA 2F8SA 3RMCA 4M3WA 4DSLA 3K59A 5EU7A 1LWFA 5F0XA 1YVNA 3KLIA 1VSEA 1JCGA 2HF4A 3D2EA 3HSCA 5I9EB 3ITHA 1HKGA 2OPSA 3VQQA 2YJEA 4JKFA 3AGKA 3QLHA 1Q9YA 3MN9A 2E2QA 1VQ4N 4YOXA 4Q5VA 2VWJA 4JI5K 1KQSM 1DTQA 2FSKA 2YJFA 4OGCA 3T1YK 2YHXA 2ZJRL 3EZWA 2UUBK 4BE0A 4DV2K 4FJKA 2IC3A 4B1YB 1HX1A 3QINA 2P51A 4CZLA 2Z1HA 3TTCA 1ZBUA 1MDUB 2P9KB 3E9LA 3L3VA 1NMDA 4CFBA 4KH6A 4QOZB 4CK1A 1B9DA 3P4IA 2E2OA 4I6MB 4CJQA 3O08A 4DHYA 3FZLA 5JVGL 2HBJA 3T19A 4CEOA 1WNSA 2R7YA 3MCPA 3CERA 1GOCA 3V9WA 4B1WB 4E7HA 1TL3A 4GKKK 3H08A 4CZEA 3ID6A 2ZGZA 3VEVA 4WYBA 2YCHA 4YOUA 1EETA 4I2QA 5MLCQ 4FM1A 2QEXN 4IG3A 3K5OA 2PYLA 3EO3A 1T7PA 4NCGA 2O8CB 5HP1A 4BDYA 3K9JA 3ENOA 1NK5A 3VQPA 4B8CA 1L5UA 4JI4K 3ZSYA 3JS6A 4RWTA 4KHPK 4F3OA 2UXBK 3CC7N 1K6YA 4ELVA 4DB3A 3AVAA 1ZXOA 3PIPL 2F8TA 1H1VA 4EP5A 3BP8A 3TAQA 3TWHA 1QVGM 3CCMN 2HHQA 1NK9A 1HYVA 4BR4A 1HQEA 2CGKA 4WQ4A 3AVFA 4CF9A 2ETJA 4M3RA 3SMPA 3JYTA 2FXUA 1S1XA 2PAVA 2YNIA 4EAHD 1NGAA 1VQMN 5AQTA 3U9DA 5AQJA 4AH9A 4DSEA 1ATSA 3AVJA 1CXQA 1KVCA 2HBMA 4HHTA 4Z4CA 3P38A 2YHYA 3GDQA 5AQGA 4O0IA 4FLWA 1GLFO 3DLLL 1WAJA 3J8AA 2J4RA 3SBGA 1D8YA 4KB1A 5J2QA 1OVYA 4ISFA 4JKDA 2A5XA 4L3QA 1NM1A 3IFRA 3VPZA 1C0GA 3ZSVA 4FWPA 1N6QA 1E3MA 4Z0UA 4CJKA 4CGDA 5J2PA 4O8KA 4F8RA 2Q0UA 4BQLA 4ILGB 1RT2A 4RW6A 4FWMA 5KPTA 2NZTA 4WFBL 1JCEA 3B8AX 1NU0A 3C7NA 4BRLA 4DTSA 3HSTB 3TU5A 1VRUA 1Y64A 4PY5A 5E41A 3UIQA 1ZYQA 4K8XA 3U6FA 4WE1A 1VQLN 1ILYA 3K57A 3VENA 2DY4A 4IEEA 2D0OA 4GKJK 4RW8A 3TAPA 2JWLA 4H0YB 2HB5A 2G8WA 1LWEA 5BN9A 5AQLA 4KREA 3MN7A 5CZ1A 1C1AA 1FXXA 4FSVA 3KHYA 3KWIA 1U2VA 4DTUA 3OYHA 1Q7YO 1B92A 2FBVA 5C15A 4EHTA 4KTQA 4E7LA 4GVEA 1RTHA 3IS9A 5FPMA 4DR5K 5AQQA 2HF3A 2FBXA 4BG8A 3HI0A 4DV4K 3ZLJA 4F4KA 5GADP 4LFAK 3K0SA 1WSGA 4XEIA 2UUAK 4KHSA 3HM9A 3ZSRA 4IXCA 3C6AA 3QEPA 1NNEA 1R59O 1JKHA 2YHWA 5HRSA 5KTQA 4K8ZA 2E2NA 4JKHA 4CEFA 2EWSA 4FLYA 4FZYA 3ID8A 1T44A 3AV9A 4AM7A 4BRKA 4CJVA 3VGKA 3VQ4A 1RDDA 4JKEA 2XO7A 4F3TA 4CJ3A 4LY7A 1JLCA 1HMVA 2HHUA 3EE9A 1T6CA 4KTWA 1TGOA 4EIAA 4CCHA 4OPKA 1IKVA 2BUPA 2GELA 3O3GA 4JK7A 2P9SA 2ZD1A 3KK1A 4DV7K 1NK8A 2V51B 1UOCA 1ZBLA 3NBPA 1ITGA 1QQMA 2E88A 3DLKA 4CJ4A 3DXKA 4CECA 3OYBA 3RR8A 3KJVA 3I33A 4DV0K 4FWRA 2I7PA 5GINA 4CF0A 4DTJA 2WTUA 1L3TA 4ISGA 2QKKA 4B9UA 1KFDA 1N32K 4E7IA 4DR1K 3K2PA 1WSEA 2CGJA 2IS3A 1NJWA 2PBDA 1NK7A 3HL8A 1HKCA 2LSNA 4BWJA 4RG8A 1BGXT 3AVHA 3NF9A 1N36K 2KW4A 3WUHA 4F9OA 4B1XB 1C6VA 3SV4A 1HR0K 2HBLA 1BO5O 3HVRA 4N41A 4JNEA 3VA0A 2RE2A 4CEQA 5AQKA 1WB9A 3LP1A 5HROA 4BDPA 4DMNA 4FK4A 4IBNA 1KTQA 4A61A 3H45C 1TK8A 1W9HA 1RDUA 5T7BA 4DQPA 3ASMA 3TPQA 4IOXA 3NF6A 3KLFA 1ASWA 2NRTA 3FGUA 3CFPA 4W5TA 2EX3A 1NGHA 5AFUH 1QVFM 3C7NB 5C42A 3TARA 3K9KA 2RHKA 2W42A 2P9PA 3G6EN 1TYQA 4MDBA 3DLRA 1S22A 1VSIA 4DSJA 2E6MA 4CZHA 3RWUA 1RTIA 3S9HA 3LDSA 1SL0A 4EFHA 4CHQA 5AQZA 1BWFO 1K9MO 3S3OA 2PFUA 3RSEA 3V9SA 4OVLA 1KAZA 4OPHA 2F96A 3MEDA 4W5RA 3SUNA 3HM8A 1U2VB 1QTMA 4LF7K 3HVTA 4DS5A 4ZHRA 2XY7A 3NVKA 4KTZA 5FLXO 4CK3A 2E6LA 3AVIA 1YI2N 4BR2A 3ZT2A 3M8QA 2F9TA 3CXCM 1TKXA 3DM2A 3TAFA 2GTDA 3GE1A 3J7YP 2FBTA 1XNQK 3WQTA 1JXEA 4OO1J 5SZTA 3IAYA 3E1YA 4KAZA 3BF3A 3CM6A 1NGBA 1BIZA 4DTXA 2QXLA 4BVPA 3O9RA 5AJ3K 1K73O 3BDPA 3M8SA 3TAEA 2IOCA 1HKBA 4W5QA 1YHQN 3SMSA 1P90A 4NCBA 3O4WA 4H0XB 5BRFA 3AA5X 4DSKA 2XY8A 5JICA 1IV0A 4FJ8A 4I2PA 3HRGA 2YNHA 1K8KA 4MQ3A 3WQUA 2P9SB 4OPAA 2UXCK 4FJGA 2AJQA 5BPNA 3HZ6A 2KKZA 2DFHA 3EYZA 3CF5L 4NYFA 3OTOK 1D4XA 1KLNA 1X9MA 2HNDA 4C8KA 3C0BA 3DXKB 2QI2A 2P9UA 2OPQA 4EZ9A 2A41A 3OYKA 4OKEA 1XC9A 4CGGA 3V1QA 1DT9A 2VYPA 4M7YA 5M1KA 1BL3A 1IH7A 4CJEA 3P39A 3ZT3A 4IWVA 4X65K 3HK2A 1FJGK 2ITGA 2HNZA 4FLTA 4QAGA 3HJFA 3KLEA 2KZZA 1QZ6A 2HHHK 4CK2A 4BC2A 3VGMA 3OYFA 3V4IA 3M5RA 4IFYA 1RNHA 2G8UA 4O44A 4E19A 3ULEB 3EL2A 4CJ5A 2O8DA 4H5RA 3N4QA 4BC4A 3WXLA 3SQ2A 1KFSA 5HLFA 1BI4A 4BRPA 1CXUA 3SCXA 2WOMA 2VQEK 2GUPA 4BC3A 3PO5A 1E4GT 5FRNA 1HYSA 4M63C 3OY9A 1SKRA 4JN4A 4CHYA 3RMAA 3KLHA 3DRPA 4BE1A 4BGAA 4JI7K 4QS7A 4H8KA 1NOYA 4X66K 3CJAA 3SUPA 5AZIA 1WN7A 4CGIA 2XY5A 2P9PB 5HRNA 2Y1IA 3LDLA 3VERA 2ZJQL 4BG9A 4DR6K 4ID5A 5KGXA 3TSPA 1VQ8N 4I9QA 3F9KA 2FSJA 3R9PA 1A5WA 1RT3A 3IDHA 1RBVA 2CH5A 5KPRA 3RSEB 3BY5A 3BZKA 3OYJA 2E20A 3J7ZO 4JHDA 3A0IX 5HRRA 3CC2N 4PKIA 3U8XA 1K8AO 4Q0BA 1YTUA 3ZSQA 1QQNA 3CM5A 2VCPA 2OPPA 1KSPA 3AVCA 3RRGA 2GUIA 4Y1DA 5TKYA 5LL6Z 1T3VA 1IBKK 2GV9A 3AA3A 4FOEA 5LMUK 3O80A 1BA0A 3VTHA 1IBMK 3AO2A 3BUZB 4CZKA 5HRPA 3CHWA 3MK6A 5AQSA 3TSUA 1GLAG 1FW6A 3E9PA 3NGIA 4JAXA 2KTQA 1JL2A 3DOLA 3SAGA 1XQSC 4B9VA 4M3UA 5KRTA 4CZMA 3GBTA 5EOYA 3T1HK 3CYMA 1YJWN 4CJ7A 4B9SA 1HNVA 1N8RO 3K5NA 4H0PA 3S41A 3CCLN 5IWAK 1NGFA 1HNIA 3M8PA 3FZKA 5KRSA 4EP4A 3NAEA 3DOKA 4FK2A 4DFKA 5HBMA 3OW2M 1S9GA 2ZM6K 1MA9B 3MWTA 1JLEA 1U47A 1K8KB 4CZIA 3TAGA 2BE2A 4BE2A 2Q36A 4CJSA 4DTOA 4DLGA 3O9TA 5AQRA 3DLGA 4FWKA 2P9UB 2KLAA 1T05A 4K42A 4HCBA 4PA1A 3O4NA 1REVA 3LDOA 3Q7BA 3IMXA 1VSFA 3MEGA 4EZ6A 4CGFA 3NMUA 5CY4A 3ALYA 4CF1A 3THXA 4B8AB 1R0AA 1OH6A 4Y0WA 3UB5A 1N34K 3U9ZA 3SAHA 3ZX2A 2HW3A 1BDGA 2HHXA 3CMEN 1NOZA 3M3ZA 4IEIA 3O4QA 2ASPA 4OPJA 4F2RA 3L2WA 3CJ9A 3O9SA 4O5FA 3VQAA 3CJ7A 1KLMA 1X9WA 4FVMA 1LV5A 4NO7A 1XHXA 2O8DB 1XMQK 4K0KK 5GIPA 3AY9A 5AQUA 1HPMA 3QICA 4FXDA 3GL1A 4A5AA 4H5WA 1BI4B 1V4SA 2V52B 3VEWA 3CCVN 4XH4A 3UKRA 1VQ6N 1NJXA 3MECA 4B1ZA 3NCIA 4TSXA 3PO4A 4J2EA 1IJJA 3ZYYX 2VWKA 4NLCA 4ISEA 4FJXA 4U67L 1JLGA 4CBUA 1GOAA 2IVOA 3L2VA 5ADXH 4IJNA 1M90O 4M7XA 2X6SA 3OHRA 5LY3A 5AZIB 3OYNA 2WFBA 4DQRA 3B6PA 1J9AA 5GAGP 2A1RA 3PV8A 2B6AA 4RTFD 1TUUA 4LC9B 5BRDA 1Y97A 5AQIA 4LH4A 3NGZA 1ZBFA 3D7EO 4H5TA 5C25A 4MFBA 1X3MA 4JI0K 4LSNA 2GWKA 3BZCA 3D2FA 4IFVA 3H3NO 4JHDB 1ZBSA 1YF5L 1RT4A 1YUWA 2JGUA 3L4IA 1G15A 4WFNL 1UWBA 5J2NA 4DCHA 4CHNA 3EEQA 4PQUA 3A5MC 3DLBA 5JLHA 3UKUA 3T7ZA 1SKWA 2ZQBA 4LFCK 2QWMA 5AQXA 3WXMB 5DM7L 2E4LA 4QS9A 3HXMA 3RVCA 1WSFA 2D0BA 3OBYA 1J5OA 5I3UA 4Z4IA 4GV9A 1VK0A 3F9MA 1IO2A 4C1NI 2FBYA 3MXMA 1CZAN 3AVLA 4CHZA 2HHVA 1HNWK 2ZF5O 4FWSA 5M1NA 3NH1A 4YDUC 3AAPA 4C8LA 3VQ9A 4IDHA 4FLVA 4FLUA 1VQKN 2O8BA 3VF6A 3MXIA 3VQ8A 3FR0A 3SAFA 3H1VX 3ZX3A 4GNIA 2HMPA 4BQZA 1BHLA 3VETA 3LZJA 4DR7K 3DJCA 2P9NA 2P5GA 3RR7A 4NXMK 2BH1A 4KHUA 1Q18A 2P1JA 4CJRA 1RGIA 3KTQA 1RBUA 2WUSA 1RBRA 2OYQA 4CZFA 1JXBA 3SJJA 3HOTA 1W0HA 4JD2A 4Z4HA 1GLJO 1HYZA 1WAFA 5E84A 3SPZA 3W3DA 3VQBA 3OS0A 1BISA 1DGKN 4OGEA 1L3UA 3CJBA 3QFPA 1Z6RA 2D0CA 4HVJA 2IVNA 5LMNK 2D0AA 1Z05A 1SL1A 4ELTA 3KIOA 3V6DA 3THXB 3HTVA 5C2FA 1NWKA 4E0DA 4ZTFA 4H03B 4M41A 4KI6A 1U04A 1C0FA 4GY2B 3DAWA 4FJ7A 3IUCA 3SPYA 3CD6N 2QK9A 1JL1A 4FW2A 3EN9A 3M6GA 3LP2A 3AVKA 4A2AA 4LH5A 3NFAA 4Z94A 1BA1A 2FF3B 1VSHA 3J81O 5E26A 1S72N 1NGJA 4E1MA 1IBLK 1IG8A 5M1PA 3LALA 4B3RK 3TSQA 4FWLA 1Q9XA 2D4WA 5FROA 4PL7A 3UKRB 2YI1A 3I0RA 4W5OA 1WOQA 4BR7A 1XI1A 5AFUA 4MLHA 1SAZA 4DKWA 4ID1A 3VA3A 5BR9A 1C0TA 4B3TK 3MCAB 3CFRA 3CG7A 1TKZA 2H3GX 3CQYA 4CGHA 4DUZK 1B9FA 3M8RA 4V19S 2FF6A 1NGIA 1BIUA 2DFFA 3D0PA 4BRGA 3MEEA 4FVUA 4KRFA 1HQUA 4FPBA 4CD1A 3ULEA 3T3FA 4YNQA 3G25A 3O3HA 4XH1A 4H4OA 2EHGA 1NGGA 4BWMA 3IKMA 1GLEG 3D2FB 3OYEA 4RCHA 3QEVA 2AA4A 3SQ1A 4CJTA 3WEEA 3C94A 3P83D 4IKFA 2PYJA 3MWPA 4FWNA 3HP9A 3SZ2A 3C6HA 1NKBA 3UKUB 1EXQA 4E1NA 2KHOA 4F2SA 3TTDA 2G8IA 2W6KA 1RDBA 4CJWA 4DR4K 2CH6A 2QKBA 4CF2A 4AHSA 3C65A 4LF5K 5FRMA 1I94K 4GV6A 1MU2A 4DF4A 3HP6A 5EY4A 2BGGA 4DU1A 2UXDK 1BQMA 2FSNA 4C1NK 4BACA 2CGLA 4AHTA 1LW2A 3AGRA 4AQYK 1V4TA 3AO4A 3AO1A 1BCMA 3WXJA 3AVNA 4BRIA 3Q7CA 1T6DA 4I9LA 1LW0A 2O8BB 5BN8A 2HSTA 1VHXA 4CFAA 2YHAA 2YV0X 1HJRA 1C0MA 2Z1IA 5EX5A 2P9NB 4CIFA 5CHIA 4CJFA 5LJWA 3DYAA 1J54A 1M1KO 3FE1A 3CJ1A 3LM9A 5SWMA 2HHSA 4CW7B 3PLAA 4GMJB 3OBWA 1LCUA 3WNEA 1KRPA 3AARA 5AQMA 1BUPA 1Z26A 4JD2B 4PKGA 3MN6A 2NRHA 3KK2A 3GOIA 2V7ZA 1RBTA 1QZ5A 2KQ2A 3OYDA 1W2BM 3ZEUB 5EVZA 1GLBG 4DQ8A 4Z4GA 4KHQA 3IRXA 3AVMA 3RRHA 1WSHA 3QESA 4G9ZA 1IKXA 4BRDA 2D0PA 2P9LA 1D9FA 4X64K 4BDZA 3IG1A 4N76A 3SBTA 1A5VA 1NBWA 4BC5A 1VSDA 3F5TA 4WQ5C 3CCJN 2BANA 3JSMA 2UUCK 1JCFA 2F4VK 3A5LC 4H5VA 1TV6A 4FJNA 1QQOA 1YVUA 5AZJA 1Q86O 3PX0A 5AQHA 5J1EA 2NRRA 4CZJA 2W40A 4DLEA 2OTLN 2KZMA 4K43A 4DUYK 3QNNA 3SV3A 2HNYA 2QWPA 3VQ7A 1TK0A 4OLBA 1TVRA 3MX5A 4FWOA 1RCHA 4N56A 3H1QA 2W6LA 4G1QA 1N33K 1RDAA 3QO9A 3DI6A 4A2BA 4PHTX 4KH4A 4IDKA 4C8OA 3M1FA 4BY9C 3A5OC 1O13A 3DWLA 3TANA 1VRTA 4Y1CA 3HPOA 3PSFA 1NJYA 4JI1K 4AHUA 1FKPA 1WBBA 3H46O 1VQPN 1KVBA 1C0UA 3BGRA 4YDUA 1LOTB 2Z1JA 5K14A 1NLVA 3THVA 1ZBHA 4DV6K 1S1UA 1IKYA 5BPLA 3A2FA 3DLHA 3WEEB 4AHVA 4CJLA 4UQGA 2DFEA 5EXWA 4CVNE 4DSIA 5KI6A 1JJ2M 1NGEA 4KI4A 2QM1A 4DFPA 4EHUA 1Q82O 3LM2A 3LDQA 3T1AA 4YOWA 5H1SQ 4IFEA 2QA4N 3HT3A 3PX4A 3CPEA 4DQSA 3CIPA 4CD3A 4FZXC 1E4FT 2JLEA 5AQNA 4RW4A 4PL8A 4AM6A 1VAZA 4YHHK 3AO5A 4H0VB 1WLJA 3VQ6A 1W97L 4JYAK 4E7KA 4FJLA 1C1CA 1J53A 2P9IA 3TAMA 2WBNA 4FYDA 4BRFA 4CJPA 3NH2A 1A5XA 4GW6A 3DLEA 2UYTA 4DU3A 4CGJA 1OKJA 1VQ7N 2QXFA 3F73A 2YHBA 3EE8A 1HRHA 3PSIA 4YOTA 3LL3A 2A1SA 2HVHA 3THYA 2P5OA 1P8ZA 2XHBA 3OA9A 5FPNA 1I3AA 1LWCA 2HBKA 4B9QA 1F21A 3LANA 3JAMO 3PX6A 1RTJA 2Z1GA 4IO8A 1LAVA 4KV8A 4M3XA 4BRAA 4QS8A 4U7BA 4E7JA 3C6TA 3NHGA 4B3SK 4HUGA 2YX6A 3U3GA 1MWKA 1QSYA 4KHNA 2ITMA 5F1XA 4QCLA 5CE3A 1XNRK 1D9DA 5C10A 1OH7A 1IG9A 3VEZA 4JI2K 2P9LB 3AO3A 3OYGA 4DSFA 3U4LA 3S3NA 3V1OA 5ELZA 2D5RA 3ZT4A 1J5EK 1BU6O 4KBOA 2O8FA 1ASUA 2O4IA 2BTFA 2G8VA 4KKOA 3CCEN 1S5JA 1RT6A 3P5JA 3KD5E 5AZJB 1WBDA 3I0SA 4JEPA 3PUFA 4NXNK 2OZSA 2D1KA 1CZBA 4JI6K 3SK3A 3TR8A 3VGLA 4FJHA 5M1QA 3KKRA 3QNOA 1WSJA 4FL9A 4OKJA 1EWRA 3HOSA 1SKSA 4O55A 3CQ8A 1QS4A 3ATVA 5ADXA
chains in the Genus database with same CATH topology
3VQ8A 4DTMA 4CEBA 4CHPA 1TK8A 1W9HA 4XIUA 4LSLA 3OJUA 4J2AA 4AHCA 5T7BA 4O5BA 3C95A 4KHYA 4DF8A 4DQPA 3ASMA 3NF6A 3KLFA 1ASWA 2RPIA 4OLAA 3NDKA 3L8BA 1BHLA 3KK3A 3LZJA 3CFPA 1RT1A 2P5GA 2YKNA 2EX3A 4W5TA 4FZZA 4FJJA 3RR7A 3G0ZA 5C42A 3TARA 2PZSA 3AA2A 4KHUA 4HUEA 1JLBA 2W42A 1SL2A 2P1JA 3DLRA 4CJRA 1ASVA 1VSIA 3KTQA 1RBUA 4DSJA 1TKDA 1RBRA 2E6MA 2OYQA 1RTIA 1JXBA 4LD0A 3S9HA 2BDPA 3RWUA 2RF2A 3SJJA 3LDSA 1W0HA 1SL0A 4Z4HA 4JS5A 1XWLA 1D5AA 4CHQA 1HYZA 1WAFA 3V81A 3SPZA 3SNNA 1BQNA 3S3OA 3LAMA 3VQBA 3OS0A 1BISA 2ATQA 4OGEA 4FW1A 1L3UA 4FYDA 4KPYA 3V9SA 2D0CA 4HVJA 3NH0A 4OVLA 3RMBA 2D0AA 2F96A 4DFMA 3MEDA 4W5RA 3SUNA 4L8RB 4FJ9A 1JLFA 3CFOA 4IG0A 4FK0A 1SL1A 4JRPA 1QTMA 4ELTA 5D3GA 3HVTA 3KIOA 4DS5A 4ZHRA 3QEWA 4CIGA 1S1TA 4KTZA 3V6DA 2XY7A 4KB0A 4CK3A 4H4MA 1TAUA 2E6LA 3AVIA 4HUFA 1RT5A 4ZTFA 1WSIA 4B9TA 4E0DA 5CZ2A 3ZT2A 4KFBA 4DFJA 4M41A 3V9UA 4KI6A 1KVAA 1U04A 3M8QA 3OJSA 4FJ7A 1NK0A 3SPYA 2QK9A 4CEAA 1KCFA 1JL1A 5CYQA 4RW9A 1RBSA 3AVGA 3DRSA 4FW2A 4JLHA 2IDOA 3AA4A 1TKXA 3DM2A 3QERA 1U45A 4FJMA 3TAFA 3KLGA 3LP2A 1TKTA 3LP3A 3AVKA 2FBTA 1Q8IA 1TAQA 3NFAA 4LH5A 4CESA 1VSHA 1QQCA 5FDLA 4E89A 4C8NA 1VSKA 3VN5A 1L3SA 4E1MA 1JXEA 1UAXA 3LALA 4ELUA 5SZTA 4CJUA 1Q9XA 3IAYA 4FM0A 1TL1A 2Q3SA 2GBZA 2X6NA 4KAZA 5FROA 5DMRA 1U48A 4DTPA 3HO1A 3I0RA 4W5OA 3KKSA 3CM6A 4FCYA 3QEIA 1BIZA 1T03A 1SUQA 4DTXA 4J2DA 3VQ5A 1XI1A 4OKKA 4M42A 4N5SA 1UA1A 4KHWA 3OVNA 4FLXA 3I8DA 1NK4A 4HCCA 3BDPA 3WNHA 3LWMA 3M8SA 3TAEA 2IOCA 4W5QA 3SUQA 4ID1A 2OA8A 3VA3A 1C0TA 3V1RA 4NCBA 2B5JA 3SYZA 1DLOA 3CFRA 3AA5X 4DSKA 3SI6A 3CG7A 1TKZA 3MXJA 5CYMA 4CIEA 2XY8A 3OYMA 4DTNA 1X9SA 4FJ8A 3HPGA 1JLQA 4I2PA 3VQCA 1X1PA 2YNHA 3ZT1A 3WNGA 4CGHA 1B9FA 3M8RA 4MQ3A 4FJGA 2AJQA 1IKWA 2XY6A 1BIUA 3OYAA 2FC0A 1QHTA 2DFFA 4O4GA 3D0PA 3MEEA 3U3YA 2PY5A 1HQUA 3OS1A 4DS4A 4KRFA 2DFHA 3EYZA 3AVBA 2F8SA 2VG7A 4NYFA 3RMCA 3T3FA 1KLNA 1X9MA 4M3WA 2HNDA 4YNQA 4C8KA 4DSLA 3O3HA 2IGIA 3K59A 5EU7A 1LWFA 4H4OA 2EHGA 3KLIA 1VSEA 4BWMA 4JRQA 2OPQA 4EZ9A 2DTUA 3OYKA 4OKEA 1XC9A 4CGGA 1DTTA 3OYEA 3QEVA 3SQ1A 4DWIA 3V1QA 4CJTA 4J2BA 4PWDA 2YNFA 1BL3A 1IH7A 3ITHA 3C94A 3ZT3A 4CJEA 2OPSA 3P83D 4O0JA 2PYJA 3VQQA 4IKFA 3HP9A 3SZ2A 3RMDA 3HK2A 1XHZA 5KGWA 2ITGA 2HNZA 4FLTA 1TK5A 1ZBIA 4QAGA 3QLHA 1Q9YA 3KLEA 3HJFA 1NKBA 2KZZA 4ICLA 3L2QA 4ZTJA 1EXQA 4E1NA 4Q5VA 1QSSA 2VWJA 4CK2A 1DTQA 4F2SA 3OYFA 4OGCA 2G8IA 3V4IA 4IFYA 3EY1A 3ZCMA 1RNHA 1S9EA 2G8UA 1RDBA 4O44A 4CJWA 4CFCA 4E19A 4BE0A 2QKBA 4CF2A 4AHSA 4B9NA 2VG6A 5FRMA 4FJKA 4CJ5A 3SUOA 2IC3A 3QINA 2P51A 4RW7A 1MU2A 4DF4A 2Z1HA 1ZBUA 3HP6A 2BGGA 3NF7A 3ZT0A 4DU1A 2KFNA 1BQMA 4CEZA 3L3VA 4BACA 4AHTA 3OYLA 3SQ2A 3QIPA 1KFSA 4CFBA 1FK9A 1LW2A 5HLFA 1BI4A 4NCAA 4CK1A 4QOZB 1CXUA 3AO4A 3SCXA 1B9DA 1BCMA 2WOMA 3AO1A 1YT3A 3AVNA 3QIOA 1U49A 3PO5A 5FRNA 4CJQA 1HYSA 3SQ4A 4I9LA 1LW0A 3T19A 4CEOA 3OY9A 1SKRA 1WNSA 2R7YA 3ULDA 4CHYA 1GOCA 4CFAA 3KLHA 3RMAA 2YHAA 3V9WA 3DRPA 2YV0X 1CZ9A 1I39A 4CF8A 1TL3A 4BE1A 1HJRA 4E7HA 1C0MA 3H08A 4PUOA 2Z1IA 4H8KA 1NOYA 4CIFA 1EP4A 2VG5A 5JS1A 4CJFA 3SUPA 1EETA 4I2QA 4I7FA 1WN7A 4CGIA 2XY5A 4CHOA 3TI0A 3DYAA 1J54A 4FM1A 3B6OA 4IG3A 1O1WA 5HRNA 2Y1IA 5SWMA 3K5OA 2PYLA 1GOBA 2HHSA 1T7PA 3K5LA 4NCGA 3L3UA 4GMJB 4M45A 4Z4FA 4ID5A 3WNEA 4FJIA 1KRPA 5HP1A 2NUBA 5KGXA 4BDYA 4B3OA 1Z26A 1NK5A 3VQPA 4B8CA 1L5UA 3ZSYA 3KK2A 4I9QA 5C24A 3F9KA 2G8HA 2ZE2A 1A5WA 1RT3A 3E01A 1T8EA 4F3OA 1RBVA 1RBTA 1K6YA 4ELVA 3AVAA 3OYJA 2KQ2A 3OYDA 2F8TA 4EP5A 3LPTA 5HRRA 3RTVA 1CLQA 3TAQA 3TWHA 2HHQA 1NK9A 1HYVA 1N5YA 4Q0BA 4Z4GA 2OPRA 4K8ZA 1HQEA 4KHQA 3IRXA 1YTUA 3AVFA 4CF9A 2ETJA 3AVMA 4M3RA 3ZSQA 3RRHA 1WSHA 3CM5A 3QESA 3JYTA 4AHRA 1S1XA 2OPPA 1KSPA 3AVCA 2YNIA 1IKXA 2GUIA 3RRGA 4Y1DA 1D9FA 4BDZA 3IG1A 1NJZA 4N76A 2GV9A 2O4GA 4FLZA 3AA3A 5J2MA 1A5VA 4AH9A 4DSEA 3AVJA 1CXQA 1VSDA 1KVCA 3AO2A 3FFIA 4HHTA 2BANA 3JSMA 5HRPA 4Z4CA 4N47A 3DMJA 4DQQA 5DK5A 3OS2A 1TV6A 4E3SA 4FJNA 1YVUA 3D45A 1JLAA 3PX0A 5J1EA 2XRIA 3NGIA 4O0IA 4FLWA 2KTQA 1JL2A 3DOLA 1U4BA 4FLUA 4B9VA 2X78A 5KRTA 4M3UA 1WAJA 2HVIA 5JS2A 4DLEA 1LAWA 2KZMA 1D8YA 3CYMA 4KB1A 5J2QA 3QNNA 3SV3A 4FM2A 4B9SA 2HNYA 1HNVA 3VQ7A 1TK0A 3K5NA 3ZSVA 4OLBA 1TVRA 1N6QA 1HNIA 3ISNC 3M8PA 4Z0UA 4CJKA 5KRSA 4EP4A 4CGDA 2RN2A 1RCHA 5J2PA 3NAEA 4F8RA 3DOKA 4N56A 4FK2A 1RT2A 4RW6A 4M3ZA 1BCOA 4G1QA 4DFKA 4M3TA 1RDAA 3QO9A 4DG1A 3DI6A 5HBMA 4W5NA 3P1GA 1S9GA 4IDKA 4C8OA 1JLEA 3OYCA 4DTSA 3SQ0A 3HSTB 3NE6A 1QE1A 1VRTA 4Y1CA 3TANA 1VRUA 1U47A 3HPOA 3TAGA 2BE2A 1QSLA 4PY5A 1NJYA 5E41A 4AHUA 4BE2A 3UIQA 1FKPA 4CJSA 1ZYQA 4DTOA 4K8XA 3U6FA 4WE1A 5I42A 4DLGA 3QETA 4CERA 1RT7A 3K57A 1KVBA 2DY4A 1C0UA 3DLGA 3BGRA 4B9MA 4RW8A 3TAPA 3VQDA 4CFDA 1T05A 2Z1JA 5K14A 2HB5A 4HCBA 2G8WA 3MAQA 3THVA 4PA1A 1LWEA 3O4NA 1REVA 3DRRA 1ZBHA 1S1UA 1IKYA 4KREA 3A2FA 3DLHA 2X74A 3QEXA 4AHVA 1VSFA 4CJLA 4M3YA 3MEGA 2DFEA 5CZ1A 1C1AA 4CGFA 4UQGA 4EZ6A 1FXXA 4DSIA 5CY4A 4DTUA 3ALYA 3NF8A 5KI6A 4CF1A 4B8AB 1EKEA 3OYHA 1R0AA 4KI4A 1FKOA 3V9ZA 1B92A 2HW3A 2FBVA 4DU4A 4HTUA 4DFPA 4KTQA 4E7LA 2HHXA 1NOZA 3T1AA 2B4JA 3O4QA 3LZIA 1RTHA 3IS9A 4OPJA 4DTRA 3L2WA 1UA0A 2FBXA 4F2RA 3HT3A 3PX4A 1NKEA 3G10A 1RDCA 4DQSA 1S1VA 3VQAA 4B9LA 2Y1JA 1KLMA 1X9WA 4FVMA 1LV5A 4F4KA 4FZXC 1XHXA 1RILA 2JLEA 3HYFA 1VSJA 1WSGA 4RW4A 1HPZA 1VSMA 2IAJA 3LWLA 4NYNA 4KHSA 3VQEA 3HM9A 3K5MA 1RTDA 3AO5A 3ZSRA 4FXDA 1WLJA 3VQ6A 3QEPA 4E7KA 4FJLA 1JKHA 1BI4B 1C1CA 1J53A 3TAMA 3LAKA 2HHTA 1S1WA 5HRSA 4C8MA 3MECA 5KTQA 3V9XA 4CEFA 3NCIA 1S6QA 4TSXA 1NJXA 4CJPA 3NH2A 4FLYA 1A5XA 3PO4A 4FZYA 4GW6A 3DLEA 4J2EA 2VWKA 1L3VA 3AV9A 1NK6A 2YNGA 3NGYA 4CJVA 4DU3A 4FJXA 3VQ4A 1RDDA 3HPHA 3LP0A 3O3FA 4CGJA 1JLGA 2XO7A 3K58A 1GOAA 4F3TA 4CJ3A 3L2VA 2QXFA 4LY7A 3F73A 3ZSWA 3WNFA 1JLCA 1HMVA 2YHBA 1HRHA 1VSLA 2HHUA 4KTWA 2X6SA 1TGOA 2A1SA 3C6UA 2HVHA 3OYNA 4CCHA 4OPKA 2P5OA 1IKVA 3O3GA 1Z25A 2XHBA 4DQRA 2OZMA 1I3AA 2WONA 3B6PA 4CEDA 1J9AA 2ZD1A 1LWCA 2A1RA 2YKMA 1F21A 3KK1A 2B6AA 3LANA 3PV8A 3PX6A 1RTJA 1NK8A 2Z1GA 1Y97A 3KD1E 1UOCA 1ZBLA 1LAVA 4JS4A 4KV8A 4M3XA 4LH4A 3NGZA 3NBPA 1ZBFA 1ITGA 3OYBA 2HHWA 3DLKA 4CJ4A 3ZSXA 4CECA 3RR8A 2RKIA 5C25A 3KJVA 4MFBA 4B08A 3L2RA 3EZ5A 4LSNA 2KFZA 4R5PA 3LPUA 4CF0A 4E7JA 3TABA 4DTJA 4CEEA 3S3MA 4DQIA 4IFVA 4Z4EA 3C6TA 3NHGA 1YTAA 1L3TA 4HUGA 1RT4A 2QKKA 4B9UA 2JGUA 3U3GA 1G15A 3L2UA 1UWBA 5J2NA 1KFDA 1QSYA 2HMIA 4CHNA 1SV5A 4E7IA 4PQUA 3K2PA 1WSEA 3DLBA 4KHNA 4QCLA 2I5JA 2IS3A 1NJWA 1NK7A 1D9DA 1IG9A 3HL8A 1SKWA 1EX4A 2LSNA 3AO3A 4RG8A 4BWJA 1BGXT 2ZQBA 3AVHA 3ZSZA 3OYGA 4DSFA 3NF9A 3S3NA 3V1OA 2KW4A 2D5RA 3ZT4A 4KO0A 2E4LA 3HXMA 1ASUA 2O4IA 1NKCA 1WSFA 2D0BA 4KKOA 1C6VA 1J5OA 1S5JA 2G8VA 1RT6A 3P5JA 2G8FA 3PY8A 4FJ5A 3SV4A 5I3UA 3KD5E 4Z4IA 3I0SA 3PUFA 1C1BA 4AILC 2OZSA 2G8KA 1VK0A 4OJRA 1IO2A 1CZBA 3TR8A 2FBYA 3OYIA 3HVRA 3MXMA 4FJHA 4N41A 3AVLA 3ZSOA 4CHZA 3VA0A 3KKRA 3QNOA 2HHVA 4CEQA 1WSJA 3NH1A 3LP1A 4GVMA 4C8LA 5HROA 4OKJA 3VQ9A 4FLVA 4BDPA 4DMNA 1SKSA 4O55A 3CQ8A 4CE9A 4FK4A 1QS4A 1KTQA 4IBNA 4YFUA 3MXIA 1S6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ8 A;  4DTM A;  4CEB A;  4CHP A;  1TK8 A;  1W9H A;  4XIU A;  4LSL A;  3OJU A;  4J2A A;  4AHC A;  5T7B A;  4O5B A;  3C95 A;  4KHY A;  4DF8 A;  4DQP A;  3ASM A;  3NF6 A;  3KLF A;  1ASW A;  2RPI A;  4OLA A;  3NDK A;  3L8B A;  1BHL A;  3KK3 A;  3LZJ A;  3CFP A;  1RT1 A;  2P5G A;  2YKN A;  2EX3 A;  4W5T A;  4FZZ A;  4FJJ A;  3RR7 A;  3G0Z A;  5C42 A;  3TAR A;  2PZS A;  3AA2 A;  4KHU A;  4HUE A;  1JLB A;  2W42 A;  1SL2 A;  2P1J A;  3DLR A;  4CJR A;  1ASV A;  1VSI A;  3KTQ A;  1RBU A;  4DSJ A;  1TKD A;  1RBR A;  2E6M A;  2OYQ A;  1RTI A;  1JXB A;  4LD0 A;  3S9H A;  2BDP A;  3RWU A;  2RF2 A;  3SJJ A;  3LDS A;  1W0H A;  1SL0 A;  4Z4H A;  4JS5 A;  1XWL A;  1D5A A;  4CHQ A;  1HYZ A;  1WAF A;  3V81 A;  3SPZ A;  3SNN A;  1BQN A;  3S3O A;  3LAM A;  3VQB A;  3OS0 A;  1BIS A;  2ATQ A;  4OGE A;  4FW1 A;  1L3U A;  4FYD A;  4KPY A;  3V9S A;  2D0C A;  4HVJ A;  3NH0 A;  4OVL A;  3RMB A;  2D0A A;  2F96 A;  4DFM A;  3MED A;  4W5R A;  3SUN A;  4L8R B;  4FJ9 A;  1JLF A;  3CFO A;  4IG0 A;  4FK0 A;  1SL1 A;  4JRP A;  1QTM A;  4ELT A;  5D3G A;  3HVT A;  3KIO A;  4DS5 A;  4ZHR A;  3QEW A;  4CIG A;  1S1T A;  4KTZ A;  3V6D A;  2XY7 A;  4KB0 A;  4CK3 A;  4H4M A;  1TAU A;  2E6L A;  3AVI A;  4HUF A;  1RT5 A;  4ZTF A;  1WSI A;  4B9T A;  4E0D A;  5CZ2 A;  3ZT2 A;  4KFB A;  4DFJ A;  4M41 A;  3V9U A;  4KI6 A;  1KVA A;  1U04 A;  3M8Q A;  3OJS A;  4FJ7 A;  1NK0 A;  3SPY A;  2QK9 A;  4CEA A;  1KCF A;  1JL1 A;  5CYQ A;  4RW9 A;  1RBS A;  3AVG A;  3DRS A;  4FW2 A;  4JLH A;  2IDO A;  3AA4 A;  1TKX A;  3DM2 A;  3QER A;  1U45 A;  4FJM A;  3TAF A;  3KLG A;  3LP2 A;  1TKT A;  3LP3 A;  3AVK A;  2FBT A;  1Q8I A;  1TAQ A;  3NFA A;  4LH5 A;  4CES A;  1VSH A;  1QQC A;  5FDL A;  4E89 A;  4C8N A;  1VSK A;  3VN5 A;  1L3S A;  4E1M A;  1JXE A;  1UAX A;  3LAL A;  4ELU A;  5SZT A;  4CJU A;  1Q9X A;  3IAY A;  4FM0 A;  1TL1 A;  2Q3S A;  2GBZ A;  2X6N A;  4KAZ A;  5FRO A;  5DMR A;  1U48 A;  4DTP A;  3HO1 A;  3I0R A;  4W5O A;  3KKS A;  3CM6 A;  4FCY A;  3QEI A;  1BIZ A;  1T03 A;  1SUQ A;  4DTX A;  4J2D A;  3VQ5 A;  1XI1 A;  4OKK A;  4M42 A;  4N5S A;  1UA1 A;  4KHW A;  3OVN A;  4FLX A;  3I8D A;  1NK4 A;  4HCC A;  3BDP A;  3WNH A;  3LWM A;  3M8S A;  3TAE A;  2IOC A;  4W5Q A;  3SUQ A;  4ID1 A;  2OA8 A;  3VA3 A;  1C0T A;  3V1R A;  4NCB A;  2B5J A;  3SYZ A;  1DLO A;  3CFR A;  3AA5 X;  4DSK A;  3SI6 A;  3CG7 A;  1TKZ A;  3MXJ A;  5CYM A;  4CIE A;  2XY8 A;  3OYM A;  4DTN A;  1X9S A;  4FJ8 A;  3HPG A;  1JLQ A;  4I2P A;  3VQC A;  1X1P A;  2YNH A;  3ZT1 A;  3WNG A;  4CGH A;  1B9F A;  3M8R A;  4MQ3 A;  4FJG A;  2AJQ A;  1IKW A;  2XY6 A;  1BIU A;  3OYA A;  2FC0 A;  1QHT A;  2DFF A;  4O4G A;  3D0P A;  3MEE A;  3U3Y A;  2PY5 A;  1HQU A;  3OS1 A;  4DS4 A;  4KRF A;  2DFH A;  3EYZ A;  3AVB A;  2F8S A;  2VG7 A;  4NYF A;  3RMC A;  3T3F A;  1KLN A;  1X9M A;  4M3W A;  2HND A;  4YNQ A;  4C8K A;  4DSL A;  3O3H A;  2IGI A;  3K59 A;  5EU7 A;  1LWF A;  4H4O A;  2EHG A;  3KLI A;  1VSE A;  4BWM A;  4JRQ A;  2OPQ A;  4EZ9 A;  2DTU A;  3OYK A;  4OKE A;  1XC9 A;  4CGG A;  1DTT A;  3OYE A;  3QEV A;  3SQ1 A;  4DWI A;  3V1Q A;  4CJT A;  4J2B A;  4PWD A;  2YNF A;  1BL3 A;  1IH7 A;  3ITH A;  3C94 A;  3ZT3 A;  4CJE A;  2OPS A;  3P83 D;  4O0J A;  2PYJ A;  3VQQ A;  4IKF A;  3HP9 A;  3SZ2 A;  3RMD A;  3HK2 A;  1XHZ A;  5KGW A;  2ITG A;  2HNZ A;  4FLT A;  1TK5 A;  1ZBI A;  4QAG A;  3QLH A;  1Q9Y A;  3KLE A;  3HJF A;  1NKB A;  2KZZ A;  4ICL A;  3L2Q A;  4ZTJ A;  1EXQ A;  4E1N A;  4Q5V A;  1QSS A;  2VWJ A;  4CK2 A;  1DTQ A;  4F2S A;  3OYF A;  4OGC A;  2G8I A;  3V4I A;  4IFY A;  3EY1 A;  3ZCM A;  1RNH A;  1S9E A;  2G8U A;  1RDB A;  4O44 A;  4CJW A;  4CFC A;  4E19 A;  4BE0 A;  2QKB A;  4CF2 A;  4AHS A;  4B9N A;  2VG6 A;  5FRM A;  4FJK A;  4CJ5 A;  3SUO A;  2IC3 A;  3QIN A;  2P51 A;  4RW7 A;  1MU2 A;  4DF4 A;  2Z1H A;  1ZBU A;  3HP6 A;  2BGG A;  3NF7 A;  3ZT0 A;  4DU1 A;  2KFN A;  1BQM A;  4CEZ A;  3L3V A;  4BAC A;  4AHT A;  3OYL A;  3SQ2 A;  3QIP A;  1KFS A;  4CFB A;  1FK9 A;  1LW2 A;  5HLF A;  1BI4 A;  4NCA A;  4CK1 A;  4QOZ B;  1CXU A;  3AO4 A;  3SCX A;  1B9D A;  1BCM A;  2WOM A;  3AO1 A;  1YT3 A;  3AVN A;  3QIO A;  1U49 A;  3PO5 A;  5FRN A;  4CJQ A;  1HYS A;  3SQ4 A;  4I9L A;  1LW0 A;  3T19 A;  4CEO A;  3OY9 A;  1SKR A;  1WNS A;  2R7Y A;  3ULD A;  4CHY A;  1GOC A;  4CFA A;  3KLH A;  3RMA A;  2YHA A;  3V9W A;  3DRP A;  2YV0 X;  1CZ9 A;  1I39 A;  4CF8 A;  1TL3 A;  4BE1 A;  1HJR A;  4E7H A;  1C0M A;  3H08 A;  4PUO A;  2Z1I A;  4H8K A;  1NOY A;  4CIF A;  1EP4 A;  2VG5 A;  5JS1 A;  4CJF A;  3SUP A;  1EET A;  4I2Q A;  4I7F A;  1WN7 A;  4CGI A;  2XY5 A;  4CHO A;  3TI0 A;  3DYA A;  1J54 A;  4FM1 A;  3B6O A;  4IG3 A;  1O1W A;  5HRN A;  2Y1I A;  5SWM A;  3K5O A;  2PYL A;  1GOB A;  2HHS A;  1T7P A;  3K5L A;  4NCG A;  3L3U A;  4GMJ B;  4M45 A;  4Z4F A;  4ID5 A;  3WNE A;  4FJI A;  1KRP A;  5HP1 A;  2NUB A;  5KGX A;  4BDY A;  4B3O A;  1Z26 A;  1NK5 A;  3VQP A;  4B8C A;  1L5U A;  3ZSY A;  3KK2 A;  4I9Q A;  5C24 A;  3F9K A;  2G8H A;  2ZE2 A;  1A5W A;  1RT3 A;  3E01 A;  1T8E A;  4F3O A;  1RBV A;  1RBT A;  1K6Y A;  4ELV A;  3AVA A;  3OYJ A;  2KQ2 A;  3OYD A;  2F8T A;  4EP5 A;  3LPT A;  5HRR A;  3RTV A;  1CLQ A;  3TAQ A;  3TWH A;  2HHQ A;  1NK9 A;  1HYV A;  1N5Y A;  4Q0B A;  4Z4G A;  2OPR A;  4K8Z A;  1HQE A;  4KHQ A;  3IRX A;  1YTU A;  3AVF A;  4CF9 A;  2ETJ A;  3AVM A;  4M3R A;  3ZSQ A;  3RRH A;  1WSH A;  3CM5 A;  3QES A;  3JYT A;  4AHR A;  1S1X A;  2OPP A;  1KSP A;  3AVC A;  2YNI A;  1IKX A;  2GUI A;  3RRG A;  4Y1D A;  1D9F A;  4BDZ A;  3IG1 A;  1NJZ A;  4N76 A;  2GV9 A;  2O4G A;  4FLZ A;  3AA3 A;  5J2M A;  1A5V A;  4AH9 A;  4DSE A;  3AVJ A;  1CXQ A;  1VSD A;  1KVC A;  3AO2 A;  3FFI A;  4HHT A;  2BAN A;  3JSM A;  5HRP A;  4Z4C A;  4N47 A;  3DMJ A;  4DQQ A;  5DK5 A;  3OS2 A;  1TV6 A;  4E3S A;  4FJN A;  1YVU A;  3D45 A;  1JLA A;  3PX0 A;  5J1E A;  2XRI A;  3NGI A;  4O0I A;  4FLW A;  2KTQ A;  1JL2 A;  3DOL A;  1U4B A;  4FLU A;  4B9V A;  2X78 A;  5KRT A;  4M3U A;  1WAJ A;  2HVI A;  5JS2 A;  4DLE A;  1LAW A;  2KZM A;  1D8Y A;  3CYM A;  4KB1 A;  5J2Q A;  3QNN A;  3SV3 A;  4FM2 A;  4B9S A;  2HNY A;  1HNV A;  3VQ7 A;  1TK0 A;  3K5N A;  3ZSV A;  4OLB A;  1TVR A;  1N6Q A;  1HNI A;  3ISN C;  3M8P A;  4Z0U A;  4CJK A;  5KRS A;  4EP4 A;  4CGD A;  2RN2 A;  1RCH A;  5J2P A;  3NAE A;  4F8R A;  3DOK A;  4N56 A;  4FK2 A;  1RT2 A;  4RW6 A;  4M3Z A;  1BCO A;  4G1Q A;  4DFK A;  4M3T A;  1RDA A;  3QO9 A;  4DG1 A;  3DI6 A;  5HBM A;  4W5N A;  3P1G A;  1S9G A;  4IDK A;  4C8O A;  1JLE A;  3OYC A;  4DTS A;  3SQ0 A;  3HST B;  3NE6 A;  1QE1 A;  1VRT A;  4Y1C A;  3TAN A;  1VRU A;  1U47 A;  3HPO A;  3TAG A;  2BE2 A;  1QSL A;  4PY5 A;  1NJY A;  5E41 A;  4AHU A;  4BE2 A;  3UIQ A;  1FKP A;  4CJS A;  1ZYQ A;  4DTO A;  4K8X A;  3U6F A;  4WE1 A;  5I42 A;  4DLG A;  3QET A;  4CER A;  1RT7 A;  3K57 A;  1KVB A;  2DY4 A;  1C0U A;  3DLG A;  3BGR A;  4B9M A;  4RW8 A;  3TAP A;  3VQD A;  4CFD A;  1T05 A;  2Z1J A;  5K14 A;  2HB5 A;  4HCB A;  2G8W A;  3MAQ A;  3THV A;  4PA1 A;  1LWE A;  3O4N A;  1REV A;  3DRR A;  1ZBH A;  1S1U A;  1IKY A;  4KRE A;  3A2F A;  3DLH A;  2X74 A;  3QEX A;  4AHV A;  1VSF A;  4CJL A;  4M3Y A;  3MEG A;  2DFE A;  5CZ1 A;  1C1A A;  4CGF A;  4UQG A;  4EZ6 A;  1FXX A;  4DSI A;  5CY4 A;  4DTU A;  3ALY A;  3NF8 A;  5KI6 A;  4CF1 A;  4B8A B;  1EKE A;  3OYH A;  1R0A A;  4KI4 A;  1FKO A;  3V9Z A;  1B92 A;  2HW3 A;  2FBV A;  4DU4 A;  4HTU A;  4DFP A;  4KTQ A;  4E7L A;  2HHX A;  1NOZ A;  3T1A A;  2B4J A;  3O4Q A;  3LZI A;  1RTH A;  3IS9 A;  4OPJ A;  4DTR A;  3L2W A;  1UA0 A;  2FBX A;  4F2R A;  3HT3 A;  3PX4 A;  1NKE A;  3G10 A;  1RDC A;  4DQS A;  1S1V A;  3VQA A;  4B9L A;  2Y1J A;  1KLM A;  1X9W A;  4FVM A;  1LV5 A;  4F4K A;  4FZX C;  1XHX A;  1RIL A;  2JLE A;  3HYF A;  1VSJ A;  1WSG A;  4RW4 A;  1HPZ A;  1VSM A;  2IAJ A;  3LWL A;  4NYN A;  4KHS A;  3VQE A;  3HM9 A;  3K5M A;  1RTD A;  3AO5 A;  3ZSR A;  4FXD A;  1WLJ A;  3VQ6 A;  3QEP A;  4E7K A;  4FJL A;  1JKH A;  1BI4 B;  1C1C A;  1J53 A;  3TAM A;  3LAK A;  2HHT A;  1S1W A;  5HRS A;  4C8M A;  3MEC A;  5KTQ A;  3V9X A;  4CEF A;  3NCI A;  1S6Q A;  4TSX A;  1NJX A;  4CJP A;  3NH2 A;  4FLY A;  1A5X A;  3PO4 A;  4FZY A;  4GW6 A;  3DLE A;  4J2E A;  2VWK A;  1L3V A;  3AV9 A;  1NK6 A;  2YNG A;  3NGY A;  4CJV A;  4DU3 A;  4FJX A;  3VQ4 A;  1RDD A;  3HPH A;  3LP0 A;  3O3F A;  4CGJ A;  1JLG A;  2XO7 A;  3K58 A;  1GOA A;  4F3T A;  4CJ3 A;  3L2V A;  2QXF A;  4LY7 A;  3F73 A;  3ZSW A;  3WNF A;  1JLC A;  1HMV A;  2YHB A;  1HRH A;  1VSL A;  2HHU A;  4KTW A;  2X6S A;  1TGO A;  2A1S A;  3C6U A;  2HVH A;  3OYN A;  4CCH A;  4OPK A;  2P5O A;  1IKV A;  3O3G A;  1Z25 A;  2XHB A;  4DQR A;  2OZM A;  1I3A A;  2WON A;  3B6P A;  4CED A;  1J9A A;  2ZD1 A;  1LWC A;  2A1R A;  2YKM A;  1F21 A;  3KK1 A;  2B6A A;  3LAN A;  3PV8 A;  3PX6 A;  1RTJ A;  1NK8 A;  2Z1G A;  1Y97 A;  3KD1 E;  1UOC A;  1ZBL A;  1LAV A;  4JS4 A;  4KV8 A;  4M3X A;  4LH4 A;  3NGZ A;  3NBP A;  1ZBF A;  1ITG A;  3OYB A;  2HHW A;  3DLK A;  4CJ4 A;  3ZSX A;  4CEC A;  3RR8 A;  2RKI A;  5C25 A;  3KJV A;  4MFB A;  4B08 A;  3L2R A;  3EZ5 A;  4LSN A;  2KFZ A;  4R5P A;  3LPU A;  4CF0 A;  4E7J A;  3TAB A;  4DTJ A;  4CEE A;  3S3M A;  4DQI A;  4IFV A;  4Z4E A;  3C6T A;  3NHG A;  1YTA A;  1L3T A;  4HUG A;  1RT4 A;  2QKK A;  4B9U A;  2JGU A;  3U3G A;  1G15 A;  3L2U A;  1UWB A;  5J2N A;  1KFD A;  1QSY A;  2HMI A;  4CHN A;  1SV5 A;  4E7I A;  4PQU A;  3K2P A;  1WSE A;  3DLB A;  4KHN A;  4QCL A;  2I5J A;  2IS3 A;  1NJW A;  1NK7 A;  1D9D A;  1IG9 A;  3HL8 A;  1SKW A;  1EX4 A;  2LSN A;  3AO3 A;  4RG8 A;  4BWJ A;  1BGX T;  2ZQB A;  3AVH A;  3ZSZ A;  3OYG A;  4DSF A;  3NF9 A;  3S3N A;  3V1O A;  2KW4 A;  2D5R A;  3ZT4 A;  4KO0 A;  2E4L A;  3HXM A;  1ASU A;  2O4I A;  1NKC A;  1WSF A;  2D0B A;  4KKO A;  1C6V A;  1J5O A;  1S5J A;  2G8V A;  1RT6 A;  3P5J A;  2G8F A;  3PY8 A;  4FJ5 A;  3SV4 A;  5I3U A;  3KD5 E;  4Z4I A;  3I0S A;  3PUF A;  1C1B A;  4AIL C;  2OZS A;  2G8K A;  1VK0 A;  4OJR A;  1IO2 A;  1CZB A;  3TR8 A;  2FBY A;  3OYI A;  3HVR A;  3MXM A;  4FJH A;  4N41 A;  3AVL A;  3ZSO A;  4CHZ A;  3VA0 A;  3KKR A;  3QNO A;  2HHV A;  4CEQ A;  1WSJ A;  3NH1 A;  3LP1 A;  4GVM A;  4C8L A;  5HRO A;  4OKJ A;  3VQ9 A;  4FLV A;  4BDP A;  4DMN A;  1SKS A;  4O55 A;  3CQ8 A;  4CE9 A;  4FK4 A;  1QS4 A;  1KTQ A;  4IBN A;  4YFU A;  3MXI A;  1S6P A; 
#chains in the Genus database with same CATH topology
 4DTM A;  4CEB A;  1X3N A;  3OJU A;  4XIU A;  4DF8 A;  1OH8 A;  3NVM A;  3L6Q A;  5BPM A;  4OLA A;  3NDK A;  5KQ8 A;  1RT1 A;  3WXI A;  4B1U B;  3CCQ N;  3G0Z A;  5BRH A;  4HUE A;  2DPN A;  1SL2 A;  2VGM A;  1ASV A;  4JV5 K;  3J7A P;  2QTD A;  1TKD A;  4LD0 A;  2RF2 A;  5FPE A;  1ZC6 A;  3ZET A;  3SNN A;  1BQN A;  4A5B A;  3LAM A;  2ATQ A;  2ASO A;  4KPY A;  1MWM A;  5JVH L;  1DKG D;  4MO5 A;  4BGB A;  4H0T B;  4L8R B;  4FJ9 A;  1JLF A;  4HWI A;  3CFO A;  4IG0 A;  4FK0 A;  5D3G A;  4JRP A;  1QHA A;  4KB0 A;  2DTU A;  4CIG A;  1S1T A;  4H4M A;  1TAU A;  5AQF A;  2A40 A;  1RT5 A;  4B9T A;  1WSI A;  3H6E A;  4DFJ A;  4KFB A;  1KVA A;  5AR0 A;  1NK0 A;  4CEA A;  2E2P A;  1KCF A;  5CYQ A;  1YXQ A;  4A59 A;  4RW9 A;  1RBS A;  3T69 A;  1U45 A;  4FJM A;  3KLG A;  3MN5 A;  3VF4 A;  5FPD A;  2QWR A;  1Q8I A;  1HJO A;  1TAQ A;  4CES A;  5BR8 K;  4E89 A;  4C8N A;  1VSK A;  1L3S A;  4MO4 A;  1TL1 A;  2Q3S A;  2GBZ A;  2P9I B;  2X6N A;  5DMR A;  1U48 A;  4DTP A;  5AQW A;  3QEI A;  4FCY A;  1SUQ A;  2A6A A;  4J2D A;  3GG4 A;  4WF9 L;  3VQ5 A;  4OKK A;  4M42 A;  4N5S A;  1UA1 A;  4FLX A;  4HCC A;  1EQY A;  2OA8 A;  3O9U A;  2B5J A;  3SYZ A;  2NLX A;  3THY B;  3VOV A;  4IJA A;  4DTN A;  1JLQ A;  3K58 A;  1X1P A;  3WNG A;  4WQ5 A;  5GAE P;  2OCE A;  2Q31 A;  1IKW A;  5C12 A;  3R8E A;  2XY6 A;  3OYA A;  1VQN N;  1QHT A;  3U3Y A;  4O4G A;  1NMN A;  3WXK A;  3QFU A;  1HUX A;  4YY3 K;  3OS1 A;  4DS4 A;  2PY5 A;  3AVB A;  5A2Q O;  2VG7 A;  2O8E A;  3PIO L;  2IGI A;  3R3L A;  4JRQ A;  2VGN A;  3O5B A;  4DR2 K;  1DTT A;  4DWI A;  4J2B A;  5GAH P;  3O8M A;  4PWD A;  2YNF A;  4LFB K;  3QML A;  4O0J A;  3RMD A;  2Q2R A;  4C23 A;  2OAN A;  5KGW A;  1XHZ A;  1TK5 A;  4JI8 K;  4IOA L;  1NGD A;  5GIO A;  1ZBI A;  4CBX A;  4WFA L;  2AP1 A;  4ICL A;  1DEJ A;  2ZGY A;  3L2Q A;  4ZTJ A;  1QSS A;  3L4Q A;  2ASM A;  3EY1 A;  3ZCM A;  1S9E A;  4PKH A;  4CFC A;  3CCS N;  2O8F B;  4B1V A;  4B9N A;  3ENB A;  3H3O B;  2VG6 A;  2QWL A;  4DV5 K;  3SUO A;  4YOR A;  4IOC L;  2W41 A;  4RW7 A;  3NF7 A;  3ZT0 A;  2KFN A;  2A42 A;  3CCR N;  4CEZ A;  3D2E B;  4NLB A;  3OYL A;  4O8U A;  3QIP A;  1FK9 A;  4NCA A;  2GWJ A;  4BRN A;  4H5N A;  1YT3 A;  3QIO A;  1U49 A;  4BRC A;  3SQ4 A;  1XMO K;  3VES A;  3FZM A;  3ULD A;  2HOE A;  3QB0 A;  4CF8 A;  1CZ9 A;  1I39 A;  4R79 A;  3DXM A;  3ZEU A;  4PUO A;  3EKS A;  1EP4 A;  2VG5 A;  3AAQ A;  5JS1 A;  4AF1 A;  2E5L K;  4I7F A;  3J80 O;  3TI0 A;  4FWQ A;  4BRE A;  4CHO A;  5C0Y A;  1YJN N;  3B6O A;  1O1W A;  1KAX A;  3O9Q A;  4LF8 K;  1GOB A;  4IZ9 A;  3K5L A;  3L3U A;  4M45 A;  4Z4F A;  4LF6 K;  3VEO A;  4FJI A;  2NUB A;  4B3O A;  1KAY A;  3CPW M;  5C24 A;  3ZET B;  3CI5 A;  5KQD A;  2G8H A;  2ZE2 A;  3BEX A;  3E01 A;  1T8E A;  2GX9 A;  4JKB A;  3O1W A;  1ATN A;  3LPT A;  3RTV A;  3SLC A;  1CLQ A;  4JKA A;  1ATR A;  1N5Y A;  2OPR A;  3THW A;  1HLU A;  4LF9 K;  4AHR A;  1S3X A;  1KC8 O;  4A57 A;  3KZB A;  4YOY A;  1NJZ A;  2OTJ N;  2O4G A;  4FLZ A;  5J2M A;  1RFQ A;  3FFI A;  4N47 A;  3DMJ A;  2IVP A;  4DQQ A;  5DK5 A;  3OS2 A;  4E3S A;  3G4S N;  3D45 A;  3CET A;  1JLA A;  5F2R A;  2XRI A;  1U4B A;  2X78 A;  3QBX A;  2HVI A;  5JS2 A;  1LAW A;  3N4P A;  1HNZ K;  4FM2 A;  2E8A A;  3O1B A;  3ISN C;  2NRZ A;  3EKU A;  4CBW A;  2RN2 A;  4FOI A;  4M3Z A;  2NRW A;  1KXP A;  4FO0 A;  2JWK A;  1BCO A;  5BRE A;  4M3T A;  5LJV A;  1BOT O;  4DG1 A;  4W5N A;  3TTF A;  3P1G A;  1NGC A;  2QWN A;  5C2D A;  3ZX0 A;  3OYC A;  2NRX A;  5M1F A;  3SQ0 A;  3NE6 A;  1QE1 A;  1QSL A;  4BR9 A;  5CR4 A;  4CZG A;  4DV3 K;  3LDN A;  5I42 A;  3MX2 A;  3QET A;  4CER A;  1RT7 A;  4KH5 A;  2O8E B;  4B9M A;  4BR0 A;  1ESV A;  3FZH A;  3KWG A;  3VQD A;  4CFD A;  4YOV A;  3MAQ A;  1GLD G;  3DRR A;  2A3Z A;  2X74 A;  4WCE L;  3QEX A;  4M3Y A;  4BRO A;  4BRM A;  3NF8 A;  3VEX A;  1EKE A;  3KVG A;  3O6W A;  4DR3 K;  1EWQ A;  1FKO A;  3V9Z A;  3CQX A;  1SQK A;  4MLE A;  4DU4 A;  4HTU A;  4MDA A;  5KPZ A;  2B4J A;  4J8F A;  3LZI A;  4OX9 K;  4DTR A;  3I8B A;  1UA0 A;  3WT0 A;  1NKE A;  3G10 A;  1RDC A;  4UY8 O;  4B9L A;  1X9J A;  1S1V A;  4E1J A;  2QW9 A;  2Y1J A;  4JK9 A;  2WC9 A;  1RIL A;  3HYF A;  1VSJ A;  3CJC A;  1HPZ A;  1VSM A;  2IAJ A;  3LWL A;  4NYN A;  3VQE A;  5B8H A;  5HOO A;  3K5M A;  3D6R A;  1RTD A;  3QDK A;  3LDP A;  1YIT N;  4K41 A;  1HNX K;  2QWQ A;  1Q81 O;  3A8Y A;  3LAK A;  2HHT A;  1S1W A;  4C8M A;  3VF2 A;  3V9X A;  1S6Q A;  4IO9 L;  3FFK B;  1L3V A;  5DM6 L;  1NK6 A;  4BRQ A;  2YNG A;  3NGY A;  3UE5 A;  5TKW A;  3HPH A;  3LP0 A;  3O3F A;  3DXM B;  3CCU N;  4WQ4 C;  3ZSW A;  3WNF A;  1VSL A;  5HL7 L;  2E1Z A;  3C6U A;  4GV3 A;  4FPA A;  4JKG A;  1Z25 A;  2OZM A;  4XH5 A;  2WON A;  4CED A;  2YKM A;  3MMV A;  3KD1 E;  5AQP A;  4JS4 A;  2HHW A;  3ZSX A;  2RKI A;  4B08 A;  4BRH A;  3L2R A;  3EZ5 A;  3P31 A;  2KFZ A;  4R5P A;  3LPU A;  3TAB A;  3E9O A;  1KD1 O;  4CEE A;  3S3M A;  4DQI A;  4BR5 A;  4Z4E A;  4JI3 K;  1OVQ A;  2E1Y A;  1YTA A;  5IT9 O;  2Q0R A;  3L2U A;  3FZF A;  2HMI A;  1SV5 A;  3THW B;  3L0Q A;  1U6Z A;  3I55 N;  4K25 A;  2I5J A;  1EX4 A;  1TUY A;  4H0O A;  4B3M K;  3ZSZ A;  5AQV A;  1SS6 A;  3R6M A;  4KO0 A;  1NKC A;  4BVO A;  5AQO A;  3E66 A;  2V7Y A;  2G8F A;  3PY8 A;  4FJ5 A;  1C1B A;  2IIR A;  4AIL C;  2G8K A;  4OJR A;  1BG3 A;  3OYI A;  2P9K A;  3ENH A;  3ZSO A;  1XC3 A;  3I56 N;  4GVM A;  4I6M A;  5AQY A;  4CE9 A;  4YFU A;  4ILH A;  1S6P A;  4CHP A;  1WUA A;  4LSL A;  4J2A A;  4AHC A;  4O5B A;  3C95 A;  4KHY A;  4DV1 K;  1GLL O;  2RPI A;  1XUP O;  3L8B A;  3KK3 A;  1EO1 A;  4FZZ A;  2YKN A;  1J6Z A;  4FJJ A;  2PZS A;  1VQ9 N;  3AA2 A;  4HTL A;  1JLB A;  3G71 N;  3VEY A;  1YJ9 N;  4LF4 K;  1SZ2 A;  1W7A A;  2O8C A;  2BDP A;  1NJI O;  1YAG A;  4JS5 A;  1XWL A;  1D5A A;  3V81 A;  3CC4 N;  4FW1 A;  3NH0 A;  5JLF A;  3RMB A;  4DFM A;  3W0L A;  2VQF K;  2ZWH A;  3ATU A;  3QBW A;  2VWB A;  3QEW A;  3VMF B;  2I7N A;  4CI6 A;  4HUF A;  5M1O A;  5CZ2 A;  4X62 K;  3V9U A;  1TYQ B;  2UU9 K;  1G99 A;  2NRV A;  4A62 A;  2F7T A;  3OJS A;  3A5N C;  3BF1 A;  1YIJ N;  3AVG A;  3DRS A;  4JLH A;  2IDO A;  3AA4 A;  3QER A;  2F9W A;  1GLC G;  2QWO A;  1TKT A;  3LP3 A;  3HBT A;  1QQC A;  5FDL A;  3VN5 A;  2NNW A;  1UAX A;  2Q97 A;  4ILJ A;  4ELU A;  4CJU A;  4FM0 A;  3SJH A;  1RDW X;  3JXU A;  1NG9 A;  3HO1 A;  3F2K A;  3KKS A;  1T03 A;  3MDQ A;  1VQO N;  2GEM A;  4NB4 A;  4KHW A;  5JMV A;  3OVN A;  2FLO A;  3I8D A;  1NK4 A;  1OH5 A;  3WNH A;  3LWM A;  3SUQ A;  3CMA N;  3V1R A;  2Q1N A;  1DLO A;  3SI6 A;  3MXJ A;  5CYM A;  4CIE A;  3OYM A;  1X9S A;  4JKG B;  3VQC A;  3HPG A;  4JK8 A;  3VTI A;  4JKC A;  3ZT1 A;  3FLC O;  1VQ5 N;  3KK7 A;  2FC0 A;  2ZJP L;  3R1X A;  2F8S A;  3RMC A;  4M3W A;  4DSL A;  3K59 A;  5EU7 A;  1LWF A;  5F0X A;  1YVN A;  3KLI A;  1VSE A;  1JCG A;  2HF4 A;  3D2E A;  3HSC A;  5I9E B;  3ITH A;  1HKG A;  2OPS A;  3VQQ A;  2YJE A;  4JKF A;  3AGK A;  3QLH A;  1Q9Y A;  3MN9 A;  2E2Q A;  1VQ4 N;  4YOX A;  4Q5V A;  2VWJ A;  4JI5 K;  1KQS M;  1DTQ A;  2FSK A;  2YJF A;  4OGC A;  3T1Y K;  2YHX A;  2ZJR L;  3EZW A;  2UUB K;  4BE0 A;  4DV2 K;  4FJK A;  2IC3 A;  4B1Y B;  1HX1 A;  3QIN A;  2P51 A;  4CZL A;  2Z1H A;  3TTC A;  1ZBU A;  1MDU B;  2P9K B;  3E9L A;  3L3V A;  1NMD A;  4CFB A;  4KH6 A;  4QOZ B;  4CK1 A;  1B9D A;  3P4I A;  2E2O A;  4I6M B;  4CJQ A;  3O08 A;  4DHY A;  3FZL A;  5JVG L;  2HBJ A;  3T19 A;  4CEO A;  1WNS A;  2R7Y A;  3MCP A;  3CER A;  1GOC A;  3V9W A;  4B1W B;  4E7H A;  1TL3 A;  4GKK K;  3H08 A;  4CZE A;  3ID6 A;  2ZGZ A;  3VEV A;  4WYB A;  2YCH A;  4YOU A;  1EET A;  4I2Q A;  5MLC Q;  4FM1 A;  2QEX N;  4IG3 A;  3K5O A;  2PYL A;  3EO3 A;  1T7P A;  4NCG A;  2O8C B;  5HP1 A;  4BDY A;  3K9J A;  3ENO A;  1NK5 A;  3VQP A;  4B8C A;  1L5U A;  4JI4 K;  3ZSY A;  3JS6 A;  4RWT A;  4KHP K;  4F3O A;  2UXB K;  3CC7 N;  1K6Y A;  4ELV A;  4DB3 A;  3AVA A;  1ZXO A;  3PIP L;  2F8T A;  1H1V A;  4EP5 A;  3BP8 A;  3TAQ A;  3TWH A;  1QVG M;  3CCM N;  2HHQ A;  1NK9 A;  1HYV A;  4BR4 A;  1HQE A;  2CGK A;  4WQ4 A;  3AVF A;  4CF9 A;  2ETJ A;  4M3R A;  3SMP A;  3JYT A;  2FXU A;  1S1X A;  2PAV A;  2YNI A;  4EAH D;  1NGA A;  1VQM N;  5AQT A;  3U9D A;  5AQJ A;  4AH9 A;  4DSE A;  1ATS A;  3AVJ A;  1CXQ A;  1KVC A;  2HBM A;  4HHT A;  4Z4C A;  3P38 A;  2YHY A;  3GDQ A;  5AQG A;  4O0I A;  4FLW A;  1GLF O;  3DLL L;  1WAJ A;  3J8A A;  2J4R A;  3SBG A;  1D8Y A;  4KB1 A;  5J2Q A;  1OVY A;  4ISF A;  4JKD A;  2A5X A;  4L3Q A;  1NM1 A;  3IFR A;  3VPZ A;  1C0G A;  3ZSV A;  4FWP A;  1N6Q A;  1E3M A;  4Z0U A;  4CJK A;  4CGD A;  5J2P A;  4O8K A;  4F8R A;  2Q0U A;  4BQL A;  4ILG B;  1RT2 A;  4RW6 A;  4FWM A;  5KPT A;  2NZT A;  4WFB L;  1JCE A;  3B8A X;  1NU0 A;  3C7N A;  4BRL A;  4DTS A;  3HST B;  3TU5 A;  1VRU A;  1Y64 A;  4PY5 A;  5E41 A;  3UIQ A;  1ZYQ A;  4K8X A;  3U6F A;  4WE1 A;  1VQL N;  1ILY A;  3K57 A;  3VEN A;  2DY4 A;  4IEE A;  2D0O A;  4GKJ K;  4RW8 A;  3TAP A;  2JWL A;  4H0Y B;  2HB5 A;  2G8W A;  1LWE A;  5BN9 A;  5AQL A;  4KRE A;  3MN7 A;  5CZ1 A;  1C1A A;  1FXX A;  4FSV A;  3KHY A;  3KWI A;  1U2V A;  4DTU A;  3OYH A;  1Q7Y O;  1B92 A;  2FBV A;  5C15 A;  4EHT A;  4KTQ A;  4E7L A;  4GVE A;  1RTH A;  3IS9 A;  5FPM A;  4DR5 K;  5AQQ A;  2HF3 A;  2FBX A;  4BG8 A;  3HI0 A;  4DV4 K;  3ZLJ A;  4F4K A;  5GAD P;  4LFA K;  3K0S A;  1WSG A;  4XEI A;  2UUA K;  4KHS A;  3HM9 A;  3ZSR A;  4IXC A;  3C6A A;  3QEP A;  1NNE A;  1R59 O;  1JKH A;  2YHW A;  5HRS A;  5KTQ A;  4K8Z A;  2E2N A;  4JKH A;  4CEF A;  2EWS A;  4FLY A;  4FZY A;  3ID8 A;  1T44 A;  3AV9 A;  4AM7 A;  4BRK A;  4CJV A;  3VGK A;  3VQ4 A;  1RDD A;  4JKE A;  2XO7 A;  4F3T A;  4CJ3 A;  4LY7 A;  1JLC A;  1HMV A;  2HHU A;  3EE9 A;  1T6C A;  4KTW A;  1TGO A;  4EIA A;  4CCH A;  4OPK A;  1IKV A;  2BUP A;  2GEL A;  3O3G A;  4JK7 A;  2P9S A;  2ZD1 A;  3KK1 A;  4DV7 K;  1NK8 A;  2V51 B;  1UOC A;  1ZBL A;  3NBP A;  1ITG A;  1QQM A;  2E88 A;  3DLK A;  4CJ4 A;  3DXK A;  4CEC A;  3OYB A;  3RR8 A;  3KJV A;  3I33 A;  4DV0 K;  4FWR A;  2I7P A;  5GIN A;  4CF0 A;  4DTJ A;  2WTU A;  1L3T A;  4ISG A;  2QKK A;  4B9U A;  1KFD A;  1N32 K;  4E7I A;  4DR1 K;  3K2P A;  1WSE A;  2CGJ A;  2IS3 A;  1NJW A;  2PBD A;  1NK7 A;  3HL8 A;  1HKC A;  2LSN A;  4BWJ A;  4RG8 A;  1BGX T;  3AVH A;  3NF9 A;  1N36 K;  2KW4 A;  3WUH A;  4F9O A;  4B1X B;  1C6V A;  3SV4 A;  1HR0 K;  2HBL A;  1BO5 O;  3HVR A;  4N41 A;  4JNE A;  3VA0 A;  2RE2 A;  4CEQ A;  5AQK A;  1WB9 A;  3LP1 A;  5HRO A;  4BDP A;  4DMN A;  4FK4 A;  4IBN A;  1KTQ A;  4A61 A;  3H45 C;  1TK8 A;  1W9H A;  1RDU A;  5T7B A;  4DQP A;  3ASM A;  3TPQ A;  4IOX A;  3NF6 A;  3KLF A;  1ASW A;  2NRT A;  3FGU A;  3CFP A;  4W5T A;  2EX3 A;  1NGH A;  5AFU H;  1QVF M;  3C7N B;  5C42 A;  3TAR A;  3K9K A;  2RHK A;  2W42 A;  2P9P A;  3G6E N;  1TYQ A;  4MDB A;  3DLR A;  1S22 A;  1VSI A;  4DSJ A;  2E6M A;  4CZH A;  3RWU A;  1RTI A;  3S9H A;  3LDS A;  1SL0 A;  4EFH A;  4CHQ A;  5AQZ A;  1BWF O;  1K9M O;  3S3O A;  2PFU A;  3RSE A;  3V9S A;  4OVL A;  1KAZ A;  4OPH A;  2F96 A;  3MED A;  4W5R A;  3SUN A;  3HM8 A;  1U2V B;  1QTM A;  4LF7 K;  3HVT A;  4DS5 A;  4ZHR A;  2XY7 A;  3NVK A;  4KTZ A;  5FLX O;  4CK3 A;  2E6L A;  3AVI A;  1YI2 N;  4BR2 A;  3ZT2 A;  3M8Q A;  2F9T A;  3CXC M;  1TKX A;  3DM2 A;  3TAF A;  2GTD A;  3GE1 A;  3J7Y P;  2FBT A;  1XNQ K;  3WQT A;  1JXE A;  4OO1 J;  5SZT A;  3IAY A;  3E1Y A;  4KAZ A;  3BF3 A;  3CM6 A;  1NGB A;  1BIZ A;  4DTX A;  2QXL A;  4BVP A;  3O9R A;  5AJ3 K;  1K73 O;  3BDP A;  3M8S A;  3TAE A;  2IOC A;  1HKB A;  4W5Q A;  1YHQ N;  3SMS A;  1P90 A;  4NCB A;  3O4W A;  4H0X B;  5BRF A;  3AA5 X;  4DSK A;  2XY8 A;  5JIC A;  1IV0 A;  4FJ8 A;  4I2P A;  3HRG A;  2YNH A;  1K8K A;  4MQ3 A;  3WQU A;  2P9S B;  4OPA A;  2UXC K;  4FJG A;  2AJQ A;  5BPN A;  3HZ6 A;  2KKZ A;  2DFH A;  3EYZ A;  3CF5 L;  4NYF A;  3OTO K;  1D4X A;  1KLN A;  1X9M A;  2HND A;  4C8K A;  3C0B A;  3DXK B;  2QI2 A;  2P9U A;  2OPQ A;  4EZ9 A;  2A41 A;  3OYK A;  4OKE A;  1XC9 A;  4CGG A;  3V1Q A;  1DT9 A;  2VYP A;  4M7Y A;  5M1K A;  1BL3 A;  1IH7 A;  4CJE A;  3P39 A;  3ZT3 A;  4IWV A;  4X65 K;  3HK2 A;  1FJG K;  2ITG A;  2HNZ A;  4FLT A;  4QAG A;  3HJF A;  3KLE A;  2KZZ A;  1QZ6 A;  2HHH K;  4CK2 A;  4BC2 A;  3VGM A;  3OYF A;  3V4I A;  3M5R A;  4IFY A;  1RNH A;  2G8U A;  4O44 A;  4E19 A;  3ULE B;  3EL2 A;  4CJ5 A;  2O8D A;  4H5R A;  3N4Q A;  4BC4 A;  3WXL A;  3SQ2 A;  1KFS A;  5HLF A;  1BI4 A;  4BRP A;  1CXU A;  3SCX A;  2WOM A;  2VQE K;  2GUP A;  4BC3 A;  3PO5 A;  1E4G T;  5FRN A;  1HYS A;  4M63 C;  3OY9 A;  1SKR A;  4JN4 A;  4CHY A;  3RMA A;  3KLH A;  3DRP A;  4BE1 A;  4BGA A;  4JI7 K;  4QS7 A;  4H8K A;  1NOY A;  4X66 K;  3CJA A;  3SUP A;  5AZI A;  1WN7 A;  4CGI A;  2XY5 A;  2P9P B;  5HRN A;  2Y1I A;  3LDL A;  3VER A;  2ZJQ L;  4BG9 A;  4DR6 K;  4ID5 A;  5KGX A;  3TSP A;  1VQ8 N;  4I9Q A;  3F9K A;  2FSJ A;  3R9P A;  1A5W A;  1RT3 A;  3IDH A;  1RBV A;  2CH5 A;  5KPR A;  3RSE B;  3BY5 A;  3BZK A;  3OYJ A;  2E20 A;  3J7Z O;  4JHD A;  3A0I X;  5HRR A;  3CC2 N;  4PKI A;  3U8X A;  1K8A O;  4Q0B A;  1YTU A;  3ZSQ A;  1QQN A;  3CM5 A;  2VCP A;  2OPP A;  1KSP A;  3AVC A;  3RRG A;  2GUI A;  4Y1D A;  5TKY A;  5LL6 Z;  1T3V A;  1IBK K;  2GV9 A;  3AA3 A;  4FOE A;  5LMU K;  3O80 A;  1BA0 A;  3VTH A;  1IBM K;  3AO2 A;  3BUZ B;  4CZK A;  5HRP A;  3CHW A;  3MK6 A;  5AQS A;  3TSU A;  1GLA G;  1FW6 A;  3E9P A;  3NGI A;  4JAX A;  2KTQ A;  1JL2 A;  3DOL A;  3SAG A;  1XQS C;  4B9V A;  4M3U A;  5KRT A;  4CZM A;  3GBT A;  5EOY A;  3T1H K;  3CYM A;  1YJW N;  4CJ7 A;  4B9S A;  1HNV A;  1N8R O;  3K5N A;  4H0P A;  3S41 A;  3CCL N;  5IWA K;  1NGF A;  1HNI A;  3M8P A;  3FZK A;  5KRS A;  4EP4 A;  3NAE A;  3DOK A;  4FK2 A;  4DFK A;  5HBM A;  3OW2 M;  1S9G A;  2ZM6 K;  1MA9 B;  3MWT A;  1JLE A;  1U47 A;  1K8K B;  4CZI A;  3TAG A;  2BE2 A;  4BE2 A;  2Q36 A;  4CJS A;  4DTO A;  4DLG A;  3O9T A;  5AQR A;  3DLG A;  4FWK A;  2P9U B;  2KLA A;  1T05 A;  4K42 A;  4HCB A;  4PA1 A;  3O4N A;  1REV A;  3LDO A;  3Q7B A;  3IMX A;  1VSF A;  3MEG A;  4EZ6 A;  4CGF A;  3NMU A;  5CY4 A;  3ALY A;  4CF1 A;  3THX A;  4B8A B;  1R0A A;  1OH6 A;  4Y0W A;  3UB5 A;  1N34 K;  3U9Z A;  3SAH A;  3ZX2 A;  2HW3 A;  1BDG A;  2HHX A;  3CME N;  1NOZ A;  3M3Z A;  4IEI A;  3O4Q A;  2ASP A;  4OPJ A;  4F2R A;  3L2W A;  3CJ9 A;  3O9S A;  4O5F A;  3VQA A;  3CJ7 A;  1KLM A;  1X9W A;  4FVM A;  1LV5 A;  4NO7 A;  1XHX A;  2O8D B;  1XMQ K;  4K0K K;  5GIP A;  3AY9 A;  5AQU A;  1HPM A;  3QIC A;  4FXD A;  3GL1 A;  4A5A A;  4H5W A;  1BI4 B;  1V4S A;  2V52 B;  3VEW A;  3CCV N;  4XH4 A;  3UKR A;  1VQ6 N;  1NJX A;  3MEC A;  4B1Z A;  3NCI A;  4TSX A;  3PO4 A;  4J2E A;  1IJJ A;  3ZYY X;  2VWK A;  4NLC A;  4ISE A;  4FJX A;  4U67 L;  1JLG A;  4CBU A;  1GOA A;  2IVO A;  3L2V A;  5ADX H;  4IJN A;  1M90 O;  4M7X A;  2X6S A;  3OHR A;  5LY3 A;  5AZI B;  3OYN A;  2WFB A;  4DQR A;  3B6P A;  1J9A A;  5GAG P;  2A1R A;  3PV8 A;  2B6A A;  4RTF D;  1TUU A;  4LC9 B;  5BRD A;  1Y97 A;  5AQI A;  4LH4 A;  3NGZ A;  1ZBF A;  3D7E O;  4H5T A;  5C25 A;  4MFB A;  1X3M A;  4JI0 K;  4LSN A;  2GWK A;  3BZC A;  3D2F A;  4IFV A;  3H3N O;  4JHD B;  1ZBS A;  1YF5 L;  1RT4 A;  1YUW A;  2JGU A;  3L4I A;  1G15 A;  4WFN L;  1UWB A;  5J2N A;  4DCH A;  4CHN A;  3EEQ A;  4PQU A;  3A5M C;  3DLB A;  5JLH A;  3UKU A;  3T7Z A;  1SKW A;  2ZQB A;  4LFC K;  2QWM A;  5AQX A;  3WXM B;  5DM7 L;  2E4L A;  4QS9 A;  3HXM A;  3RVC A;  1WSF A;  2D0B A;  3OBY A;  1J5O A;  5I3U A;  4Z4I A;  4GV9 A;  1VK0 A;  3F9M A;  1IO2 A;  4C1N I;  2FBY A;  3MXM A;  1CZA N;  3AVL A;  4CHZ A;  2HHV A;  1HNW K;  2ZF5 O;  4FWS A;  5M1N A;  3NH1 A;  4YDU C;  3AAP A;  4C8L A;  3VQ9 A;  4IDH A;  4FLV A;  4FLU A;  1VQK N;  2O8B A;  3VF6 A;  3MXI A;  3VQ8 A;  3FR0 A;  3SAF A;  3H1V X;  3ZX3 A;  4GNI A;  2HMP A;  4BQZ A;  1BHL A;  3VET A;  3LZJ A;  4DR7 K;  3DJC A;  2P9N A;  2P5G A;  3RR7 A;  4NXM K;  2BH1 A;  4KHU A;  1Q18 A;  2P1J A;  4CJR A;  1RGI A;  3KTQ A;  1RBU A;  2WUS A;  1RBR A;  2OYQ A;  4CZF A;  1JXB A;  3SJJ A;  3HOT A;  1W0H A;  4JD2 A;  4Z4H A;  1GLJ O;  1HYZ A;  1WAF A;  5E84 A;  3SPZ A;  3W3D A;  3VQB A;  3OS0 A;  1BIS A;  1DGK N;  4OGE A;  1L3U A;  3CJB A;  3QFP A;  1Z6R A;  2D0C A;  4HVJ A;  2IVN A;  5LMN K;  2D0A A;  1Z05 A;  1SL1 A;  4ELT A;  3KIO A;  3V6D A;  3THX B;  3HTV A;  5C2F A;  1NWK A;  4E0D A;  4ZTF A;  4H03 B;  4M41 A;  4KI6 A;  1U04 A;  1C0F A;  4GY2 B;  3DAW A;  4FJ7 A;  3IUC A;  3SPY A;  3CD6 N;  2QK9 A;  1JL1 A;  4FW2 A;  3EN9 A;  3M6G A;  3LP2 A;  3AVK A;  4A2A A;  4LH5 A;  3NFA A;  4Z94 A;  1BA1 A;  2FF3 B;  1VSH A;  3J81 O;  5E26 A;  1S72 N;  1NGJ A;  4E1M A;  1IBL K;  1IG8 A;  5M1P A;  3LAL A;  4B3R K;  3TSQ A;  4FWL A;  1Q9X A;  2D4W A;  5FRO A;  4PL7 A;  3UKR B;  2YI1 A;  3I0R A;  4W5O A;  1WOQ A;  4BR7 A;  1XI1 A;  5AFU A;  4MLH A;  1SAZ A;  4DKW A;  4ID1 A;  3VA3 A;  5BR9 A;  1C0T A;  4B3T K;  3MCA B;  3CFR A;  3CG7 A;  1TKZ A;  2H3G X;  3CQY A;  4CGH A;  4DUZ K;  1B9F A;  3M8R A;  4V19 S;  2FF6 A;  1NGI A;  1BIU A;  2DFF A;  3D0P A;  4BRG A;  3MEE A;  4FVU A;  4KRF A;  1HQU A;  4FPB A;  4CD1 A;  3ULE A;  3T3F A;  4YNQ A;  3G25 A;  3O3H A;  4XH1 A;  4H4O A;  2EHG A;  1NGG A;  4BWM A;  3IKM A;  1GLE G;  3D2F B;  3OYE A;  4RCH A;  3QEV A;  2AA4 A;  3SQ1 A;  4CJT A;  3WEE A;  3C94 A;  3P83 D;  4IKF A;  2PYJ A;  3MWP A;  4FWN A;  3HP9 A;  3SZ2 A;  3C6H A;  1NKB A;  3UKU B;  1EXQ A;  4E1N A;  2KHO A;  4F2S A;  3TTD A;  2G8I A;  2W6K A;  1RDB A;  4CJW A;  4DR4 K;  2CH6 A;  2QKB A;  4CF2 A;  4AHS A;  3C65 A;  4LF5 K;  5FRM A;  1I94 K;  4GV6 A;  1MU2 A;  4DF4 A;  3HP6 A;  5EY4 A;  2BGG A;  4DU1 A;  2UXD K;  1BQM A;  2FSN A;  4C1N K;  4BAC A;  2CGL A;  4AHT A;  1LW2 A;  3AGR A;  4AQY K;  1V4T A;  3AO4 A;  3AO1 A;  1BCM A;  3WXJ A;  3AVN A;  4BRI A;  3Q7C A;  1T6D A;  4I9L A;  1LW0 A;  2O8B B;  5BN8 A;  2HST A;  1VHX A;  4CFA A;  2YHA A;  2YV0 X;  1HJR A;  1C0M A;  2Z1I A;  5EX5 A;  2P9N B;  4CIF A;  5CHI A;  4CJF A;  5LJW A;  3DYA A;  1J54 A;  1M1K O;  3FE1 A;  3CJ1 A;  3LM9 A;  5SWM A;  2HHS A;  4CW7 B;  3PLA A;  4GMJ B;  3OBW A;  1LCU A;  3WNE A;  1KRP A;  3AAR A;  5AQM A;  1BUP A;  1Z26 A;  4JD2 B;  4PKG A;  3MN6 A;  2NRH A;  3KK2 A;  3GOI A;  2V7Z A;  1RBT A;  1QZ5 A;  2KQ2 A;  3OYD A;  1W2B M;  3ZEU B;  5EVZ A;  1GLB G;  4DQ8 A;  4Z4G A;  4KHQ A;  3IRX A;  3AVM A;  3RRH A;  1WSH A;  3QES A;  4G9Z A;  1IKX A;  4BRD A;  2D0P A;  2P9L A;  1D9F A;  4X64 K;  4BDZ A;  3IG1 A;  4N76 A;  3SBT A;  1A5V A;  1NBW A;  4BC5 A;  1VSD A;  3F5T A;  4WQ5 C;  3CCJ N;  2BAN A;  3JSM A;  2UUC K;  1JCF A;  2F4V K;  3A5L C;  4H5V A;  1TV6 A;  4FJN A;  1QQO A;  1YVU A;  5AZJ A;  1Q86 O;  3PX0 A;  5AQH A;  5J1E A;  2NRR A;  4CZJ A;  2W40 A;  4DLE A;  2OTL N;  2KZM A;  4K43 A;  4DUY K;  3QNN A;  3SV3 A;  2HNY A;  2QWP A;  3VQ7 A;  1TK0 A;  4OLB A;  1TVR A;  3MX5 A;  4FWO A;  1RCH A;  4N56 A;  3H1Q A;  2W6L A;  4G1Q A;  1N33 K;  1RDA A;  3QO9 A;  3DI6 A;  4A2B A;  4PHT X;  4KH4 A;  4IDK A;  4C8O A;  3M1F A;  4BY9 C;  3A5O C;  1O13 A;  3DWL A;  3TAN A;  1VRT A;  4Y1C A;  3HPO A;  3PSF A;  1NJY A;  4JI1 K;  4AHU A;  1FKP A;  1WBB A;  3H46 O;  1VQP N;  1KVB A;  1C0U A;  3BGR A;  4YDU A;  1LOT B;  2Z1J A;  5K14 A;  1NLV A;  3THV A;  1ZBH A;  4DV6 K;  1S1U A;  1IKY A;  5BPL A;  3A2F A;  3DLH A;  3WEE B;  4AHV A;  4CJL A;  4UQG A;  2DFE A;  5EXW A;  4CVN E;  4DSI A;  5KI6 A;  1JJ2 M;  1NGE A;  4KI4 A;  2QM1 A;  4DFP A;  4EHU A;  1Q82 O;  3LM2 A;  3LDQ A;  3T1A A;  4YOW A;  5H1S Q;  4IFE A;  2QA4 N;  3HT3 A;  3PX4 A;  3CPE A;  4DQS A;  3CIP A;  4CD3 A;  4FZX C;  1E4F T;  2JLE A;  5AQN A;  4RW4 A;  4PL8 A;  4AM6 A;  1VAZ A;  4YHH K;  3AO5 A;  4H0V B;  1WLJ A;  3VQ6 A;  1W97 L;  4JYA K;  4E7K A;  4FJL A;  1C1C A;  1J53 A;  2P9I A;  3TAM A;  2WBN A;  4FYD A;  4BRF A;  4CJP A;  3NH2 A;  1A5X A;  4GW6 A;  3DLE A;  2UYT A;  4DU3 A;  4CGJ A;  1OKJ A;  1VQ7 N;  2QXF A;  3F73 A;  2YHB A;  3EE8 A;  1HRH A;  3PSI A;  4YOT A;  3LL3 A;  2A1S A;  2HVH A;  3THY A;  2P5O A;  1P8Z A;  2XHB A;  3OA9 A;  5FPN A;  1I3A A;  1LWC A;  2HBK A;  4B9Q A;  1F21 A;  3LAN A;  3JAM O;  3PX6 A;  1RTJ A;  2Z1G A;  4IO8 A;  1LAV A;  4KV8 A;  4M3X A;  4BRA A;  4QS8 A;  4U7B A;  4E7J A;  3C6T A;  3NHG A;  4B3S K;  4HUG A;  2YX6 A;  3U3G A;  1MWK A;  1QSY A;  4KHN A;  2ITM A;  5F1X A;  4QCL A;  5CE3 A;  1XNR K;  1D9D A;  5C10 A;  1OH7 A;  1IG9 A;  3VEZ A;  4JI2 K;  2P9L B;  3AO3 A;  3OYG A;  4DSF A;  3U4L A;  3S3N A;  3V1O A;  5ELZ A;  2D5R A;  3ZT4 A;  1J5E K;  1BU6 O;  4KBO A;  2O8F A;  1ASU A;  2O4I A;  2BTF A;  2G8V A;  4KKO A;  3CCE N;  1S5J A;  1RT6 A;  3P5J A;  3KD5 E;  5AZJ B;  1WBD A;  3I0S A;  4JEP A;  3PUF A;  4NXN K;  2OZS A;  2D1K A;  1CZB A;  4JI6 K;  3SK3 A;  3TR8 A;  3VGL A;  4FJH A;  5M1Q A;  3KKR A;  3QNO A;  1WSJ A;  4FL9 A;  4OKJ A;  1EWR A;  3HOS A;  1SKS A;  4O55 A;  3CQ8 A;  1QS4 A;  3ATV A;  5ADX A; 
#chains in the Genus database with same CATH homology
 3VQ8 A;  4DTM A;  4CEB A;  4CHP A;  1TK8 A;  1W9H A;  4XIU A;  4LSL A;  3OJU A;  4J2A A;  4AHC A;  5T7B A;  4O5B A;  3C95 A;  4KHY A;  4DF8 A;  4DQP A;  3ASM A;  3NF6 A;  3KLF A;  1ASW A;  2RPI A;  4OLA A;  3NDK A;  3L8B A;  1BHL A;  3KK3 A;  3LZJ A;  3CFP A;  1RT1 A;  2P5G A;  2YKN A;  2EX3 A;  4W5T A;  4FZZ A;  4FJJ A;  3RR7 A;  3G0Z A;  5C42 A;  3TAR A;  2PZS A;  3AA2 A;  4KHU A;  4HUE A;  1JLB A;  2W42 A;  1SL2 A;  2P1J A;  3DLR A;  4CJR A;  1ASV A;  1VSI A;  3KTQ A;  1RBU A;  4DSJ A;  1TKD A;  1RBR A;  2E6M A;  2OYQ A;  1RTI A;  1JXB A;  4LD0 A;  3S9H A;  2BDP A;  3RWU A;  2RF2 A;  3SJJ A;  3LDS A;  1W0H A;  1SL0 A;  4Z4H A;  4JS5 A;  1XWL A;  1D5A A;  4CHQ A;  1HYZ A;  1WAF A;  3V81 A;  3SPZ A;  3SNN A;  1BQN A;  3S3O A;  3LAM A;  3VQB A;  3OS0 A;  1BIS A;  2ATQ A;  4OGE A;  4FW1 A;  1L3U A;  4FYD A;  4KPY A;  3V9S A;  2D0C A;  4HVJ A;  3NH0 A;  4OVL A;  3RMB A;  2D0A A;  2F96 A;  4DFM A;  3MED A;  4W5R A;  3SUN A;  4L8R B;  4FJ9 A;  1JLF A;  3CFO A;  4IG0 A;  4FK0 A;  1SL1 A;  4JRP A;  1QTM A;  4ELT A;  5D3G A;  3HVT A;  3KIO A;  4DS5 A;  4ZHR A;  3QEW A;  4CIG A;  1S1T A;  4KTZ A;  3V6D A;  2XY7 A;  4KB0 A;  4CK3 A;  4H4M A;  1TAU A;  2E6L A;  3AVI A;  4HUF A;  1RT5 A;  4ZTF A;  1WSI A;  4B9T A;  4E0D A;  5CZ2 A;  3ZT2 A;  4KFB A;  4DFJ A;  4M41 A;  3V9U A;  4KI6 A;  1KVA A;  1U04 A;  3M8Q A;  3OJS A;  4FJ7 A;  1NK0 A;  3SPY A;  2QK9 A;  4CEA A;  1KCF A;  1JL1 A;  5CYQ A;  4RW9 A;  1RBS A;  3AVG A;  3DRS A;  4FW2 A;  4JLH A;  2IDO A;  3AA4 A;  1TKX A;  3DM2 A;  3QER A;  1U45 A;  4FJM A;  3TAF A;  3KLG A;  3LP2 A;  1TKT A;  3LP3 A;  3AVK A;  2FBT A;  1Q8I A;  1TAQ A;  3NFA A;  4LH5 A;  4CES A;  1VSH A;  1QQC A;  5FDL A;  4E89 A;  4C8N A;  1VSK A;  3VN5 A;  1L3S A;  4E1M A;  1JXE A;  1UAX A;  3LAL A;  4ELU A;  5SZT A;  4CJU A;  1Q9X A;  3IAY A;  4FM0 A;  1TL1 A;  2Q3S A;  2GBZ A;  2X6N A;  4KAZ A;  5FRO A;  5DMR A;  1U48 A;  4DTP A;  3HO1 A;  3I0R A;  4W5O A;  3KKS A;  3CM6 A;  4FCY A;  3QEI A;  1BIZ A;  1T03 A;  1SUQ A;  4DTX A;  4J2D A;  3VQ5 A;  1XI1 A;  4OKK A;  4M42 A;  4N5S A;  1UA1 A;  4KHW A;  3OVN A;  4FLX A;  3I8D A;  1NK4 A;  4HCC A;  3BDP A;  3WNH A;  3LWM A;  3M8S A;  3TAE A;  2IOC A;  4W5Q A;  3SUQ A;  4ID1 A;  2OA8 A;  3VA3 A;  1C0T A;  3V1R A;  4NCB A;  2B5J A;  3SYZ A;  1DLO A;  3CFR A;  3AA5 X;  4DSK A;  3SI6 A;  3CG7 A;  1TKZ A;  3MXJ A;  5CYM A;  4CIE A;  2XY8 A;  3OYM A;  4DTN A;  1X9S A;  4FJ8 A;  3HPG A;  1JLQ A;  4I2P A;  3VQC A;  1X1P A;  2YNH A;  3ZT1 A;  3WNG A;  4CGH A;  1B9F A;  3M8R A;  4MQ3 A;  4FJG A;  2AJQ A;  1IKW A;  2XY6 A;  1BIU A;  3OYA A;  2FC0 A;  1QHT A;  2DFF A;  4O4G A;  3D0P A;  3MEE A;  3U3Y A;  2PY5 A;  1HQU A;  3OS1 A;  4DS4 A;  4KRF A;  2DFH A;  3EYZ A;  3AVB A;  2F8S A;  2VG7 A;  4NYF A;  3RMC A;  3T3F A;  1KLN A;  1X9M A;  4M3W A;  2HND A;  4YNQ A;  4C8K A;  4DSL A;  3O3H A;  2IGI A;  3K59 A;  5EU7 A;  1LWF A;  4H4O A;  2EHG A;  3KLI A;  1VSE A;  4BWM A;  4JRQ A;  2OPQ A;  4EZ9 A;  2DTU A;  3OYK A;  4OKE A;  1XC9 A;  4CGG A;  1DTT A;  3OYE A;  3QEV A;  3SQ1 A;  4DWI A;  3V1Q A;  4CJT A;  4J2B A;  4PWD A;  2YNF A;  1BL3 A;  1IH7 A;  3ITH A;  3C94 A;  3ZT3 A;  4CJE A;  2OPS A;  3P83 D;  4O0J A;  2PYJ A;  3VQQ A;  4IKF A;  3HP9 A;  3SZ2 A;  3RMD A;  3HK2 A;  1XHZ A;  5KGW A;  2ITG A;  2HNZ A;  4FLT A;  1TK5 A;  1ZBI A;  4QAG A;  3QLH A;  1Q9Y A;  3KLE A;  3HJF A;  1NKB A;  2KZZ A;  4ICL A;  3L2Q A;  4ZTJ A;  1EXQ A;  4E1N A;  4Q5V A;  1QSS A;  2VWJ A;  4CK2 A;  1DTQ A;  4F2S A;  3OYF A;  4OGC A;  2G8I A;  3V4I A;  4IFY A;  3EY1 A;  3ZCM A;  1RNH A;  1S9E A;  2G8U A;  1RDB A;  4O44 A;  4CJW A;  4CFC A;  4E19 A;  4BE0 A;  2QKB A;  4CF2 A;  4AHS A;  4B9N A;  2VG6 A;  5FRM A;  4FJK A;  4CJ5 A;  3SUO A;  2IC3 A;  3QIN A;  2P51 A;  4RW7 A;  1MU2 A;  4DF4 A;  2Z1H A;  1ZBU A;  3HP6 A;  2BGG A;  3NF7 A;  3ZT0 A;  4DU1 A;  2KFN A;  1BQM A;  4CEZ A;  3L3V A;  4BAC A;  4AHT A;  3OYL A;  3SQ2 A;  3QIP A;  1KFS A;  4CFB A;  1FK9 A;  1LW2 A;  5HLF A;  1BI4 A;  4NCA A;  4CK1 A;  4QOZ B;  1CXU A;  3AO4 A;  3SCX A;  1B9D A;  1BCM A;  2WOM A;  3AO1 A;  1YT3 A;  3AVN A;  3QIO A;  1U49 A;  3PO5 A;  5FRN A;  4CJQ A;  1HYS A;  3SQ4 A;  4I9L A;  1LW0 A;  3T19 A;  4CEO A;  3OY9 A;  1SKR A;  1WNS A;  2R7Y A;  3ULD A;  4CHY A;  1GOC A;  4CFA A;  3KLH A;  3RMA A;  2YHA A;  3V9W A;  3DRP A;  2YV0 X;  1CZ9 A;  1I39 A;  4CF8 A;  1TL3 A;  4BE1 A;  1HJR A;  4E7H A;  1C0M A;  3H08 A;  4PUO A;  2Z1I A;  4H8K A;  1NOY A;  4CIF A;  1EP4 A;  2VG5 A;  5JS1 A;  4CJF A;  3SUP A;  1EET A;  4I2Q A;  4I7F A;  1WN7 A;  4CGI A;  2XY5 A;  4CHO A;  3TI0 A;  3DYA A;  1J54 A;  4FM1 A;  3B6O A;  4IG3 A;  1O1W A;  5HRN A;  2Y1I A;  5SWM A;  3K5O A;  2PYL A;  1GOB A;  2HHS A;  1T7P A;  3K5L A;  4NCG A;  3L3U A;  4GMJ B;  4M45 A;  4Z4F A;  4ID5 A;  3WNE A;  4FJI A;  1KRP A;  5HP1 A;  2NUB A;  5KGX A;  4BDY A;  4B3O A;  1Z26 A;  1NK5 A;  3VQP A;  4B8C A;  1L5U A;  3ZSY A;  3KK2 A;  4I9Q A;  5C24 A;  3F9K A;  2G8H A;  2ZE2 A;  1A5W A;  1RT3 A;  3E01 A;  1T8E A;  4F3O A;  1RBV A;  1RBT A;  1K6Y A;  4ELV A;  3AVA A;  3OYJ A;  2KQ2 A;  3OYD A;  2F8T A;  4EP5 A;  3LPT A;  5HRR A;  3RTV A;  1CLQ A;  3TAQ A;  3TWH A;  2HHQ A;  1NK9 A;  1HYV A;  1N5Y A;  4Q0B A;  4Z4G A;  2OPR A;  4K8Z A;  1HQE A;  4KHQ A;  3IRX A;  1YTU A;  3AVF A;  4CF9 A;  2ETJ A;  3AVM A;  4M3R A;  3ZSQ A;  3RRH A;  1WSH A;  3CM5 A;  3QES A;  3JYT A;  4AHR A;  1S1X A;  2OPP A;  1KSP A;  3AVC A;  2YNI A;  1IKX A;  2GUI A;  3RRG A;  4Y1D A;  1D9F A;  4BDZ A;  3IG1 A;  1NJZ A;  4N76 A;  2GV9 A;  2O4G A;  4FLZ A;  3AA3 A;  5J2M A;  1A5V A;  4AH9 A;  4DSE A;  3AVJ A;  1CXQ A;  1VSD A;  1KVC A;  3AO2 A;  3FFI A;  4HHT A;  2BAN A;  3JSM A;  5HRP A;  4Z4C A;  4N47 A;  3DMJ A;  4DQQ A;  5DK5 A;  3OS2 A;  1TV6 A;  4E3S A;  4FJN A;  1YVU A;  3D45 A;  1JLA A;  3PX0 A;  5J1E A;  2XRI A;  3NGI A;  4O0I A;  4FLW A;  2KTQ A;  1JL2 A;  3DOL A;  1U4B A;  4FLU A;  4B9V A;  2X78 A;  5KRT A;  4M3U A;  1WAJ A;  2HVI A;  5JS2 A;  4DLE A;  1LAW A;  2KZM A;  1D8Y A;  3CYM A;  4KB1 A;  5J2Q A;  3QNN A;  3SV3 A;  4FM2 A;  4B9S A;  2HNY A;  1HNV A;  3VQ7 A;  1TK0 A;  3K5N A;  3ZSV A;  4OLB A;  1TVR A;  1N6Q A;  1HNI A;  3ISN C;  3M8P A;  4Z0U A;  4CJK A;  5KRS A;  4EP4 A;  4CGD A;  2RN2 A;  1RCH A;  5J2P A;  3NAE A;  4F8R A;  3DOK A;  4N56 A;  4FK2 A;  1RT2 A;  4RW6 A;  4M3Z A;  1BCO A;  4G1Q A;  4DFK A;  4M3T A;  1RDA A;  3QO9 A;  4DG1 A;  3DI6 A;  5HBM A;  4W5N A;  3P1G A;  1S9G A;  4IDK A;  4C8O A;  1JLE A;  3OYC A;  4DTS A;  3SQ0 A;  3HST B;  3NE6 A;  1QE1 A;  1VRT A;  4Y1C A;  3TAN A;  1VRU A;  1U47 A;  3HPO A;  3TAG A;  2BE2 A;  1QSL A;  4PY5 A;  1NJY A;  5E41 A;  4AHU A;  4BE2 A;  3UIQ A;  1FKP A;  4CJS A;  1ZYQ A;  4DTO A;  4K8X A;  3U6F A;  4WE1 A;  5I42 A;  4DLG A;  3QET A;  4CER A;  1RT7 A;  3K57 A;  1KVB A;  2DY4 A;  1C0U A;  3DLG A;  3BGR A;  4B9M A;  4RW8 A;  3TAP A;  3VQD A;  4CFD A;  1T05 A;  2Z1J A;  5K14 A;  2HB5 A;  4HCB A;  2G8W A;  3MAQ A;  3THV A;  4PA1 A;  1LWE A;  3O4N A;  1REV A;  3DRR A;  1ZBH A;  1S1U A;  1IKY A;  4KRE A;  3A2F A;  3DLH A;  2X74 A;  3QEX A;  4AHV A;  1VSF A;  4CJL A;  4M3Y A;  3MEG A;  2DFE A;  5CZ1 A;  1C1A A;  4CGF A;  4UQG A;  4EZ6 A;  1FXX A;  4DSI A;  5CY4 A;  4DTU A;  3ALY A;  3NF8 A;  5KI6 A;  4CF1 A;  4B8A B;  1EKE A;  3OYH A;  1R0A A;  4KI4 A;  1FKO A;  3V9Z A;  1B92 A;  2HW3 A;  2FBV A;  4DU4 A;  4HTU A;  4DFP A;  4KTQ A;  4E7L A;  2HHX A;  1NOZ A;  3T1A A;  2B4J A;  3O4Q A;  3LZI A;  1RTH A;  3IS9 A;  4OPJ A;  4DTR A;  3L2W A;  1UA0 A;  2FBX A;  4F2R A;  3HT3 A;  3PX4 A;  1NKE A;  3G10 A;  1RDC A;  4DQS A;  1S1V A;  3VQA A;  4B9L A;  2Y1J A;  1KLM A;  1X9W A;  4FVM A;  1LV5 A;  4F4K A;  4FZX C;  1XHX A;  1RIL A;  2JLE A;  3HYF A;  1VSJ A;  1WSG A;  4RW4 A;  1HPZ A;  1VSM A;  2IAJ A;  3LWL A;  4NYN A;  4KHS A;  3VQE A;  3HM9 A;  3K5M A;  1RTD A;  3AO5 A;  3ZSR A;  4FXD A;  1WLJ A;  3VQ6 A;  3QEP A;  4E7K A;  4FJL A;  1JKH A;  1BI4 B;  1C1C A;  1J53 A;  3TAM A;  3LAK A;  2HHT A;  1S1W A;  5HRS A;  4C8M A;  3MEC A;  5KTQ A;  3V9X A;  4CEF A;  3NCI A;  1S6Q A;  4TSX A;  1NJX A;  4CJP A;  3NH2 A;  4FLY A;  1A5X A;  3PO4 A;  4FZY A;  4GW6 A;  3DLE A;  4J2E A;  2VWK A;  1L3V A;  3AV9 A;  1NK6 A;  2YNG A;  3NGY A;  4CJV A;  4DU3 A;  4FJX A;  3VQ4 A;  1RDD A;  3HPH A;  3LP0 A;  3O3F A;  4CGJ A;  1JLG A;  2XO7 A;  3K58 A;  1GOA A;  4F3T A;  4CJ3 A;  3L2V A;  2QXF A;  4LY7 A;  3F73 A;  3ZSW A;  3WNF A;  1JLC A;  1HMV A;  2YHB A;  1HRH A;  1VSL A;  2HHU A;  4KTW A;  2X6S A;  1TGO A;  2A1S A;  3C6U A;  2HVH A;  3OYN A;  4CCH A;  4OPK A;  2P5O A;  1IKV A;  3O3G A;  1Z25 A;  2XHB A;  4DQR A;  2OZM A;  1I3A A;  2WON A;  3B6P A;  4CED A;  1J9A A;  2ZD1 A;  1LWC A;  2A1R A;  2YKM A;  1F21 A;  3KK1 A;  2B6A A;  3LAN A;  3PV8 A;  3PX6 A;  1RTJ A;  1NK8 A;  2Z1G A;  1Y97 A;  3KD1 E;  1UOC A;  1ZBL A;  1LAV A;  4JS4 A;  4KV8 A;  4M3X A;  4LH4 A;  3NGZ A;  3NBP A;  1ZBF A;  1ITG A;  3OYB A;  2HHW A;  3DLK A;  4CJ4 A;  3ZSX A;  4CEC A;  3RR8 A;  2RKI A;  5C25 A;  3KJV A;  4MFB A;  4B08 A;  3L2R A;  3EZ5 A;  4LSN A;  2KFZ A;  4R5P A;  3LPU A;  4CF0 A;  4E7J A;  3TAB A;  4DTJ A;  4CEE A;  3S3M A;  4DQI A;  4IFV A;  4Z4E A;  3C6T A;  3NHG A;  1YTA A;  1L3T A;  4HUG A;  1RT4 A;  2QKK A;  4B9U A;  2JGU A;  3U3G A;  1G15 A;  3L2U A;  1UWB A;  5J2N A;  1KFD A;  1QSY A;  2HMI A;  4CHN A;  1SV5 A;  4E7I A;  4PQU A;  3K2P A;  1WSE A;  3DLB A;  4KHN A;  4QCL A;  2I5J A;  2IS3 A;  1NJW A;  1NK7 A;  1D9D A;  1IG9 A;  3HL8 A;  1SKW A;  1EX4 A;  2LSN A;  3AO3 A;  4RG8 A;  4BWJ A;  1BGX T;  2ZQB A;  3AVH A;  3ZSZ A;  3OYG A;  4DSF A;  3NF9 A;  3S3N A;  3V1O A;  2KW4 A;  2D5R A;  3ZT4 A;  4KO0 A;  2E4L A;  3HXM A;  1ASU A;  2O4I A;  1NKC A;  1WSF A;  2D0B A;  4KKO A;  1C6V A;  1J5O A;  1S5J A;  2G8V A;  1RT6 A;  3P5J A;  2G8F A;  3PY8 A;  4FJ5 A;  3SV4 A;  5I3U A;  3KD5 E;  4Z4I A;  3I0S A;  3PUF A;  1C1B A;  4AIL C;  2OZS A;  2G8K A;  1VK0 A;  4OJR A;  1IO2 A;  1CZB A;  3TR8 A;  2FBY A;  3OYI A;  3HVR A;  3MXM A;  4FJH A;  4N41 A;  3AVL A;  3ZSO A;  4CHZ A;  3VA0 A;  3KKR A;  3QNO A;  2HHV A;  4CEQ A;  1WSJ A;  3NH1 A;  3LP1 A;  4GVM A;  4C8L A;  5HRO A;  4OKJ A;  3VQ9 A;  4FLV A;  4BDP A;  4DMN A;  1SKS A;  4O55 A;  3CQ8 A;  4CE9 A;  4FK4 A;  1QS4 A;  1KTQ A;  4IBN A;  4YFU A;  3MXI A;  1S6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...