3IFRA

The crystal structure of xylulose kinase from rhodospirillum rubrum
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
492
structure length
488
Chain Sequence
RQVIGLDIGTTSTIAILVRLPDTVVAVASRPTTLSSPHPGWAEEDPAQWWDNARAVLAELKTTAGESDWRPGGICVTGMLPAVVLLDDRGAVLRPSIQQSDGRCGDEVAELRAEVDSEAFLARTGNGVTQQLVTAKLRWIERHEPAVFGAIATVCGSYDYINMLLTGERVVDRNWALEGGFIDLASGTVEADLVALAHIPPSAVPPAHPTHRVLGAVTAEAAALTGLPTGLPVYGGAADHIASALAAGITRPGDVLLKFGGAGDIIVASATAKSDPRLYLDYHLVPGLYAPNGCMAATGSALNWLAKLLAPEAGEAAHAQLDALAAEVPAGADGLVCLPYFLGEKDPFASGTFTGLSLSHTRGHLWRALLEAVALAFRHHVAVLDDIGHAPQRFFASDGGTRSRVWMGIMADVLQRPVQLLANPLGSAVGAAWVAAIGGGDDLGWDDVTALVRTGEKITPDPAKAEVYDRLYRDFSALYATLHPFFHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of xylulose kinase from Rhodospirillum rubrum
rcsb
source organism Rhodospirillum rubrum
molecule tags Transferase
molecule keywords Carbohydrate kinase, FGGY
total genus 144
structure length 488
sequence length 492
chains with identical sequence B
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA02
5BPMA 2HMPA 2Q0UA 2CH6A 3CI5A 5AQGA 4WQ5C 5E84A 1IG8A 4NB4A 4JD2A 2E2NA 1RDWX 1K8KB 3VEXA 1DGKN 2I7PA 2HF3A 1HKBA 3JXUA 4QS9A 4IXCA 1KAZA 5KPRA 3SLCA 3CJ1A 4FOEA 4BC3A 5I9EB 3MDQA 4K43A 2E2QA 1NGGA 2VWBA 4ISEA 5F0XA 1HX1A 4BVOA 4BRAA 5AQVA 3OHRA 4XEIA 3GBTA 3MN7A 4MO4A 1KAYA 1QQMA 2IVPA 4BR0A 4BR4A 5FPDA 3O1WA 1U2VB 2NZTA 4JHDB 4C23A 3TU5A 2YHWA 2CH5A 4DB3A 4JAXA 1MA9B 5AQQA 2FSNA 3W0LA 2E1ZA 1C0FA 4BREA 4FWKA 2QXLA 3AAPA 5EVZA 5AQMA 1XQSC 4JNEA 3ZETA 1BO5O 5EXWA 1BU6O 4WQ4A 3DXKA 3UB5A 2CGJA 3HBTA 4PKHA 5FPNA 3QBWA 1ATNA 5EOYA 3DXMA 5JLHA 2A41A 5AZIA 2E1YA 3AARA 5AQZA 3VPZA 1NMDA 3CHWA 3D2FB 1BG3A 1NGCA 5ELZA 4XH5A 4QS8A 3FZKA 3SMSA 4BRPA 1DEJA 1NGBA 1BA1A 3ULEB 2P9KB 3A8YA 4BRFA 2VCPA 3ULEA 3RSEB 1J6ZA 3CJBA 3VF4A 1HLUA 4MO5A 1OKJA 2GWJA 2PBDA 5BR9A 4H5WA 4M7YA 3I8BA 4CZHA 2AP1A 3CETA 5AQIA 4LC9B 3UKRB 5JLFA 4A2AA 5AQLA 3UKRA 2I7NA 3ZX0A 3IDHA 4FWQA 2Q2RA 3LM9A 3M1FA 4ISFA 3FZLA 3O5BA 4BRNA 1NGDA 2YJEA 4FPAA 3GE1A 4BRMA 4FL9A 5AQNA 1GLBG 2A3ZA 4BRHA 1X3MA 4M7XA 3HSCA 3VGLA 2ASOA 2YJFA 5KPZA 1Z6RA 3U9ZA 2ZGZA 4YDUC 2HOEA 1KAXA 1C0GA 3HM8A 2W41A 3QDKA 5FPEA 1JCGA 4RTFD 4BRCA 4KBOA 3ATVA 2FXUA 1WOQA 1TUYA 3P4IA 3ZX3A 2P9IB 3W3DA 3H3NO 1HUXA 1BUPA 3ENOA 3QB0A 5BPLA 5LJVA 5JICA 2YI1A 3WUHA 4IJAA 3A5NC 1GLDG 2FF6A 3VERA 2J4RA 1BWFO 1YXQA 5AQHA 1NGEA 5TKYA 4H0OA 4K42A 5LY3A 2ITMA 3CQYA 3LDPA 3DAWA 2D4WA 3FLCO 1ZXOA 4L3QA 2ZGYA 4BC2A 4BR5A 1X3NA 3EL2A 4CZGA 2QWQA 3FFKB 1G99A 5AZJB 3U4LA 3VEOA 2NLXA 1T44A 3CERA 1SQKA 2UYTA 3FR0A 4HTLA 3AAQA 1S3XA 4FWRA 3L4IA 3VENA 4MLHA 5BRHA 3UKUA 3IUCA 1CZAN 3DXKB 1D4XA 3MN6A 4EAHD 2D0OA 4EFHA 3DXMB 4BVPA 2GELA 3CQXA 4Z94A 4IJNA 2NRHA 4J8FA 2V51B 4WYBA 3BEXA 3GL1A 3H45C 5AFUA 3LM2A 3DJCA 1P8ZA 1YAGA 1XUPO 4FWMA 1BDGA 1BA0A 3HTVA 2P9LB 1DKGD 2P9KA 2P9UA 1NGFA 2P9LA 3L0QA 3C7NA 5B8HA 5AQFA 4JN4A 3VEZA 3S41A 3FZHA 3MN9A 2YCHA 3H3OB 3I33A 3MCPA 5AQPA 2ZF5O 4EHUA 5AQOA 1V4SA 1U2VA 4JHDA 1E4GT 3EZWA 4BRLA 3IMXA 2BUPA 3R8EA 2GUPA 1IJJA 3O08A 1NM1A 4CZLA 4CZKA 1QQOA 1T6CA 4RWTA 2D1KA 4FPBA 3EKUA 1H1VA 2QM1A 5ADXA 5KPTA 3EO3A 2QWPA 3FZFA 4H5VA 2A6AA 2IIRA 2P9NA 2CGKA 4HWIA 4BRIA 4FOIA 3WQUA 1LCUA 3LDQA 1NGIA 4WQ4C 5LJWA 3U9DA 2PAVA 4GNIA 1R59O 5CE3A 4CZJA 2QWOA 2GWKA 3A5OC 3BF1A 5AZIB 3GDQA 1WUAA 3R6MA 3J8AA 3O80A 3A5MC 3D2FA 2YHYA 2Q0RA 3BF3A 5BN9A 2EWSA 4B1UB 4CBWA 2E2OA 2KHOA 4IWVA 3ENHA 5KQ8A 3QMLA 4B1ZA 3MK6A 3RSEA 2BTFA 3D7EO 2A42A 1KXPA 4FWLA 3KVGA 3JS6A 1MDUB 4M63C 2P9SB 3WXLA 1HJOA 4I6MA 4RCHA 2Q36A 3KHYA 4CBUA 3O4WA 2YHXA 1NWKA 3FGUA 3WT0A 2W40A 4H5NA 4E1JA 4CZEA 1QHAA 4DQ8A 5KQDA 2DPNA 3CJ7A 3UKUB 4FWNA 4H0XB 1Q18A 1T6DA 5FPMA 3HZ6A 1E4FT 3QICA 3GOIA 1TYQB 3ATUA 4H0PA 1QQNA 2Q1NA 4BG9A 2P9PB 3A5LC 3WQTA 3WXJA 5E26A 3H1QA 2D0PA 3A0IX 3LL3A 2F9WA 3LDNA 3DWLA 3VEYA 4AM6A 3ZEUB 1TUUA 4QS7A 4H0YB 3FZMA 2P9IA 3MN5A 1EQYA 2P9UB 4PL7A 1JCFA 4MLEA 5BREA 3C7NB 1K8KA 3GG4A 4BGBA 4PKGA 2QWNA 3O1BA 5AQSA 4NO7A 4PL8A 3SJHA 4CD3A 4O8KA 1Z05A 1U6ZA 5F1XA 4BC5A 4Y0WA 4H5TA 4K41A 1ATRA 1RGIA 3VESA 4FO0A 2A5XA 5AZJA 5AQKA 1RFQA 2FLOA 3O8MA 3TPQA 5AQYA 3ZETB 1GLEG 2P9NB 4FSVA 2FSJA 4AM7A 4F9OA 3C0BA 5BRFA 3VGMA 4H0VB 3SK3A 1JCEA 4K25A 3CJCA 5AQTA 5EY4A 1S22A 5AR0A 4B1WB 4PKIA 3B8AX 3L6QA 5BN8A 3D2EA 2ASPA 4H0TB 3LDOA 2FF3B 3VGKA 4CZFA 3M3ZA 2GEMA 2A40A 2H3GX 1GLFO 4FWSA 3VF2A 4B1YB 1Y64A 2QWLA 3QFPA 4BG8A 4BRQA 1HPMA 3VOVA 3H46O 5AQXA 4JD2B 5EX5A 1ESVA 2QWMA 4EIAA 1X9JA 4EHTA 5AQUA 4BRDA 3CJAA 3EN9A 5AQJA 4BC4A 4H5RA 4DCHA 2E20A 2IVNA 4O5FA 4XH1A 4BR7A 4IZ9A 4BQZA 4DHYA 3U8XA 4BRGA 1YVNA 5BPNA 4B9QA 5F2RA 3WXIA 1GLAG 2VYPA 3QBXA 4FWPA 4WQ5A 2CGLA 3SMPA 4BR9A 1XC3A 1NGAA 1GLCG 2WUSA 3F9MA 4BGAA 4ISGA 1SAZA 3EKSA 2AA4A 3MMVA 4BR2A 3FE1A 4CI6A 1ATSA 2V52B 4XH4A 3VEVA 3ZEUA 5AQRA 4A2BA 1V4TA 2Q31A 1NLVA 2Q97A 2E8AA 4CJ7A 1YUWA 3LDLA 3VEWA 3AY9A 3ZX2A 3BUZB 4CBXA 2ASMA 2F9TA 2V7ZA 4YDUA 1QZ5A 3KZBA 3IFRA 5AQWA 3VETA 2HF4A 4CZIA 1QZ6A 1NBWA 2ZWHA 1ZC6A 4IO8A 2GTDA 1NGJA 5JMVA 2QWRA 5AFUH 1BOTO 1NGHA 2P9SA 2V7YA 4H03B 3CJ9A 4I6MB 5BRDA 4BROA 4CZMA 3UE5A 1HKGA 3R9PA 3QFUA 1LOTB 3WEEA 5ADXH 3G25A 1HKCA 1MWKA 2FSKA 3WEEB 1SZ2A 1GLJO 3CIPA 3O6WA 3BP8A 3H6EA 4B1VA 2P9PA 4BQLA 4A61A 1MWMA 2QW9A 4CD1A 2E88A 4B1XB 1TYQA 4A62A 1ZBSA 3M6GA 3HI0A 4FWOA 1GLLO 3ID8A 3D2EB 2IVOA 4GY2B 3WXKA 2E2PA 2OANA 3VF6A 4BRKA 3H1VX
chains in the Genus database with same CATH superfamily
2HMPA 5AQGA 4WQ5C 5E84A 1IG8A 4CGIA 1K8KB 3VEXA 2QXFA 4CJ4A 1CXQA 3I0RA 1KAZA 4FOEA 4CF9A 4N41A 3OHRA 1D9DA 4CJKA 4BR0A 4BR4A 3F9KA 2NZTA 4C23A 3ID6A 4E7LA 4GW6A 3DI6A 5HROA 4DB3A 4CEQA 4CF8A 2PY5A 1MA9B 5KTQA 3NF8A 4BDZA 4E89A 1CZBA 4BACA 3E9PA 4DR2K 3LZIA 5AQMA 2B6AA 1WSGA 3L2VA 2OTJN 4OJRA 1RBUA 4JI1K 4E19A 3QBWA 2F8SA 2E1YA 1S9GA 4JKBA 5T7BA 3CHWA 4OGEA 5H1SQ 1TKTA 1BG3A 2RN2A 1NGCA 4QAGA 4OPKA 4QS8A 3SUNA 1S5JA 4BRFA 3L4QA 4FK0A 2EHGA 3ULEA 5C2FA 3MXIA 1HLUA 5I3UA 3LWMA 1RTDA 1OKJA 2PBDA 4NLCA 4ZHRA 3T1HK 3CETA 3NGIA 5AQIA 3NF9A 3K58A 2HMIA 5AQLA 4ILJA 1ASVA 4KTWA 1U48A 5JS1A 3CXCM 3TAFA 1S6QA 2HHTA 3FZLA 3IS9A 3O5BA 1RDCA 2VG7A 4FPAA 2PYLA 3WNHA 4DQQA 1KC8O 4ILHA 2A3ZA 4BRHA 1X3MA 1NOZA 2NRWA 3VGLA 1S1TA 5KPZA 1Z6RA 4YDUC 4HUFA 1C0GA 3RMBA 3QDKA 4O8UA 3AO2A 3J7YP 3PV8A 3DLEA 4O0JA 4FJKA 2XY8A 1EP4A 2QK9A 4OX9K 1WOQA 4GV6A 1IKXA 3R1XA 3AA4A 4LF8K 1QE1A 3ZX3A 2P9IB 4CGFA 1S72N 3ZT2A 4EZ9A 3AVGA 5JICA 1L3SA 1HMVA 2HBLA 3RTVA 3SZ2A 1NGEA 4ICLA 4H0OA 4W5OA 4KH4A 4RW9A 4AH9A 2ZJQL 4KREA 3DAWA 4Z4CA 4L3QA 4BC2A 2ZGYA 1X3NA 4CEBA 3V9UA 1Y97A 1JLQA 3R3LA 3QNOA 3M8RA 3ZSRA 4GKJK 3O4QA 1G99A 5AZJB 3MXMA 3VEOA 3T19A 3CERA 2O8BB 2Y1IA 1A5XA 2UYTA 4LF4K 2QTDA 4HTLA 1S3XA 4FWRA 3MX5A 3L4IA 5BRHA 3UKUA 1LWCA 1KSPA 2UXCK 4DFPA 4FJ5A 2E4LA 1HQEA 3K5LA 4EAHD 4Y1CA 4AHVA 3CF5L 1VQ7N 4EFHA 1S1UA 5CZ2A 1ASWA 1HPZA 4BVPA 5HOOA 4Z94A 4J8FA 1GOCA 3HVRA 1LW0A 3DJCA 1P8ZA 1W2BM 5C42A 1YAGA 3CCUN 4FWMA 3WNEA 3M8SA 2P9KA 2I5JA 2P9UA 4CJLA 2P9LA 4DR7K 2UUAK 5AQFA 3S41A 3MN9A 3H3OB 3I33A 4W5NA 1REVA 1BGXT 1B9DA 4JKGA 1V4SA 3D45A 3SQ4A 5HLFA 3EZWA 2VQFK 4GV3A 1FXXA 4WCEL 2GUPA 4M3WA 1VRUA 2KTQA 2D1KA 1ASUA 2QWPA 2HNDA 3TAEA 3SUOA 2HB5A 4GKKK 2P9NA 4YOVA 3AVAA 2OPSA 4BRIA 1ZBFA 3SV4A 3O9SA 1VSFA 4WQ4C 3VQBA 5LJWA 4YFUA 3DRRA 1R59O 1UA1A 5AZIB 3V9SA 3J8AA 3A5MC 1NK5A 1S9EA 3BF3A 4B1UB 5KQ8A 2KHOA 2PFUA 3ENHA 4I2PA 4IWVA 3HOSA 3CCVN 2JWLA 3NF6A 1HYZA 1ZBHA 3TSUA 1NK0A 4N5SA 1A5WA 4LSNA 4BE1A 3KVGA 3O9TA 1J5EK 4JI6K 2YX6A 4M63C 1IO2A 3CPWM 3PSIA 4YOXA 3LDSA 3KHYA 1Q9XA 1NWKA 3OYCA 2W40A 3AVMA 2KLAA 1QHAA 4DQ8A 1NU0A 1WNSA 4H0XB 1Q18A 4DFKA 5FPMA 1A5VA 4G1QA 4CEAA 2NNWA 3NCIA 1DTQA 3C6AA 1QQNA 4BG9A 1N5YA 3WXJA 1U04A 5E26A 4DV5K 4H4OA 3KLHA 3A0IX 4CFDA 3BDPA 2VWJA 3AVHA 3BGRA 3AGRA 5C10A 3VEYA 4FLZA 4H0YB 3ZT3A 4CIEA 3ZCMA 2P9IA 4FJ8A 3MN5A 3J81O 4DV1K 1BISA 3V9ZA 2P51A 4DLEA 1BQMA 3GG4A 4BGBA 3ZSOA 3RRHA 4KI4A 4MQ3A 2QWNA 2FBXA 3SV3A 1CZ9A 1JLAA 4G9ZA 4LD0A 4C1NI 4LF7K 5AQSA 4PL8A 3SJHA 2RE2A 4CD3A 4O8KA 1VQ4N 1HYVA 4MDBA 4DV2K 4Y0WA 3TAGA 1NKCA 3NMUA 4K41A 3MEGA 5AZJA 1NJWA 4HCCA 3HM9A 4DTMA 1I39A 4L8RB 2Z1JA 3CC4N 2FLOA 1LWFA 5HL7L 3OYHA 4FSVA 4AM7A 3T1AA 4PUOA 1EKEA 3ZLJA 4IOCL 4KTZA 4CJ3A 5JS2A 4K25A 2HHHK 5AQTA 1TL1A 1RT1A 1VQ8N 3RMDA 1S22A 2WFBA 4BWMA 4AHUA 1OH7A 5BN8A 3VQ4A 5M1PA 2WTUA 1K8AO 4M3RA 1K9MO 1GLFO 1RBSA 3V6DA 2F96A 3QFPA 1L5UA 3TTDA 4JD2B 3I56N 1D5AA 5EX5A 5GINA 4OKEA 1HR0K 5AQUA 1VSKA 1YVUA 4U7BA 4FW1A 4BY9C 3OYIA 4O5FA 3PIOL 3S9HA 4OPAA 2HVIA 4LFBK 3CCRN 3AO1A 1YVNA 3M8QA 1F21A 2QEXN 2D0BA 3RR7A 4FYDA 2WOMA 4QOZB 4W5QA 3VQCA 1P90A 3AV9A 4LH5A 4CJEA 4KPYA 4DR4K 4WQ5A 3SMPA 3MCAB 4FJHA 2Y1JA 2WUSA 3F9MA 3SQ0A 4IG0A 3N4PA 2XHBA 3C94A 3MX2A 4KO0A 4CJFA 4GV9A 4U67L 4RW6A 1LW2A 3T1YK 1IV0A 3K2PA 1ATSA 3VEVA 1HRHA 1OH6A 4A2BA 5KGXA 2ZJPL 1YUWA 1J9AA 3NH2A 4JRPA 3ZX2A 4CBXA 2ASMA 3D6RA 3G71N 2V7ZA 3V1RA 3O9RA 1FKOA 5AQWA 3TR8A 1YF5L 3TANA 2X6SA 3PO5A 2HHWA 4LFAK 3ENBA 3KK3A 1M90O 2NRVA 4XIUA 1DTTA 1ZC6A 4FVUA 1XNQK 1TAQA 2ITGA 2QWRA 1NGHA 2P9SA 4O44A 4EZ6A 1HNIA 3AVBA 4H03B 4I6MB 4ZTJA 4GVMA 3HL8A 3SBTA 3SPZA 1L3VA 3WEEB 3OYNA 3CIPA 3LANA 3O6WA 3CYMA 4BQLA 3VTIA 3DYAA 4B1XB 1TYQA 3HI0A 3LP0A 4OLBA 3ID8A 1HNWK 4DR5K 1YT3A 2PYJA 4I2QA 3I0SA 5DM6L 3THYA 2OPQA 4FJ7A 4F4KA 3S3MA 2Q0UA 3KLIA 4NB4A 2X6NA 3HPHA 2E2NA 4JD2A 4EP5A 3JXUA 2VG5A 3CQ8A 1HJRA 3SLCA 4BC3A 3THWB 4K43A 2E2QA 1NGGA 1HX1A 3JAMO 4H8KA 4YOYA 4O0IA 4DLGA 4PWDA 4DMNA 4MO4A 4CECA 1WSIA 2DY4A 3O1WA 2EX3A 2KKZA 4B8AB 3DMJA 2CH5A 4KH6A 4JAXA 4JKCA 2O4IA 5AQQA 1IKWA 3PO4A 2E1ZA 4FJJA 1C1AA 4BREA 2QXLA 3AAPA 1IBLK 4CW7B 1T7PA 1XQSC 4AHSA 2XO7A 4B3MK 4WQ4A 4IDKA 1C1BA 2ATQA 3CFRA 3HBTA 5FPNA 3CCMN 3ZYYX 4A5AA 5JLHA 3PIPL 2QI2A 4DF8A 5AQZA 2BGGA 5FLXO 1NMDA 5ELZA 5CZ1A 3TAMA 4B9TA 4XH5A 3FZKA 3L2RA 1YJ9N 3DLLL 1NGBA 2P9KB 3A8YA 1DT9A 2NRTA 3HJFA 1VAZA 2VCPA 3NHGA 3VF4A 3L2QA 3O3GA 4I7FA 5BR9A 4M7YA 4CZHA 4CIGA 2NRRA 4LC9B 2HSTA 4CEOA 4CEDA 3QESA 2NUBA 1ZBLA 2B4JA 3M1FA 4B9SA 3CG7A 3NBPA 1NGDA 3SCXA 3GE1A 4B08A 2HHXA 1GLBG 3HSCA 1VSJA 2ZGZA 2HOEA 1J53A 3HM8A 4RTFD 4NXMK 4BRCA 2O8DA 3QNNA 3G6EN 3H3NO 1BUPA 3ENOA 3QB0A 5BR8K 2YI1A 3WUHA 4IJAA 2G8HA 1GLDG 2FF6A 3VERA 4DV6K 1BWFO 1YXQA 5D3GA 2ITMA 3ALYA 1TKZA 3T7ZA 3CQYA 3OYBA 4HVJA 3K9JA 3SAFA 3SNNA 4BR5A 4DR1K 3OYJA 4JI2K 3TSPA 5LMNK 3NH1A 3DRSA 4AILC 2QWQA 2YNIA 3LP1A 4AHTA 1T44A 4YOUA 3WNGA 1JKHA 4E1NA 4NYNA 4DU1A 4MLHA 3IKMA 1D4XA 3SJJA 3PUFA 1OH8A 4DV7K 1T3VA 3K5MA 3DXMB 5FROA 2GELA 4DTSA 3KLFA 1QHTA 3CPEA 1XC9A 2V51B 3BEXA 3GL1A 4E3SA 3E1YA 4LSLA 3LM2A 3KD5E 1K73O 3O3HA 4AQYK 1N8RO 4DWIA 1BDGA 3AVNA 4FW2A 4LFCK 2P9LB 4JN4A 3AO3A 2YCHA 3B6PA 1NNEA 5AQPA 3SAGA 3OBYA 4C8OA 1VSHA 4JHDA 2BUPA 1BQNA 4CZLA 2ZD1A 1LWEA 3EKUA 1VRTA 2QM1A 3OYLA 5ADXA 1KTQA 5KPTA 3FZFA 4FJLA 2A6AA 2IIRA 4KKOA 1Z26A 1KFDA 4OLAA 5KGWA 4V19S 1VQON 2X78A 2IC3A 3TWHA 2CGKA 3SYZA 4C8KA 4FOIA 3DLGA 4DS4A 1LCUA 1S6PA 5HRNA 4FCYA 1ZBUA 2PAVA 3HSTB 4FK2A 4OKJA 5LMUK 4FZYA 3A5OC 1OVYA 1WUAA 3O80A 2W6KA 4NCGA 5FRMA 1UOCA 4KHNA 4AHRA 2OPPA 3ZSZA 1Q82O 4CERA 2BTFA 1NK6A 1KXPA 2O8FB 1VQKN 4B3SK 1VSIA 1N32K 3WXLA 4R79A 1HJOA 2PZSA 4RCHA 3ZSVA 1WAJA 3ZT1A 4H5NA 3J7AP 3TSQA 3CJ7A 2G8VA 4FWNA 1RBTA 1EWRA 1T6DA 1UAXA 3TABA 3P31A 3ASMA 1T05A 1E4FT 3ATUA 4H0PA 2JWKA 2Q1NA 4FJMA 2P9PB 3A5LC 3NGZA 1XMOK 1YJNN 3H1QA 4CGHA 2F9WA 1KFSA 2KZZA 4AM6A 1TUUA 2KQ2A 4QS7A 5DK5A 2QKKA 4LF9K 2YHBA 3VA0A 1Q9YA 1EQYA 2P9UB 1VQ9N 4MLEA 5BREA 4FZXC 3G4SN 3LAMA 3IAYA 1BL3A 5DMRA 4CK1A 4J2AA 4IFYA 1S1XA 4H4MA 1NJYA 1TK0A 5GADP 5J2PA 3C65A 4BC5A 1EWQA 4H5TA 1D9FA 2A5XA 4B3RK 3ZT0A 5AQKA 2YKNA 4M45A 1TGOA 3V9WA 3OYDA 3OS1A 1RFQA 2O8BA 5KRSA 1QTMA 1KRPA 4WFBL 4CHNA 2P9NB 4B9VA 2FSJA 1KVAA 1Q86O 1U45A 4Y1DA 4DTPA 1HNZK 4BWJA 3U6FA 3PLAA 3S3NA 2GBZA 2F7TA 1XWLA 3NVMA 3L6QA 3OTOK 4DF4A 3VGKA 2FF3B 3RR8A 4I9QA 1XMQK 1Y64A 4BG8A 4K8XA 4JLHA 3H46O 3KIOA 3CC7N 2RPIA 2R7YA 2OCEA 3V1OA 1X9JA 4CESA 5E41A 4DUYK 4IEIA 4DCHA 4C8NA 2E6LA 2IVNA 4FM1A 4XH1A 4BR7A 2GUIA 2GV9A 3U8XA 1RNHA 4DTNA 3I55N 4E7HA 3O3FA 1C1CA 4FWPA 3CM5A 2CGLA 4BR9A 4KTQA 1XC3A 1SL1A 1TKXA 1N36K 3PX4A 4BGAA 3O9UA 4ISGA 4IEEA 3QO9A 4FJIA 3KLGA 3E01A 3FE1A 2IGIA 4CI6A 1IKVA 2V52B 4O4GA 1Z25A 2IAJA 1IBKK 4DSJA 1V4TA 1NLVA 2O8DB 2E8AA 1R0AA 4CJ7A 1U49A 3LDLA 3QEXA 2X74A 2OZSA 4KRFA 2HHUA 2XY5A 2F9TA 1QZ5A 3VQEA 4CZIA 1QZ6A 2HHQA 2ZWHA 4IO8A 4X62K 4J2EA 1EO1A 5AFUH 4DQIA 2YNFA 3CJ9A 1YJWN 4BROA 4KHYA 3UE5A 4YNQA 4RW8A 3QEWA 3DLHA 2ZE2A 3WEEA 3OBWA 2W42A 1QVGM 2Z1HA 3BP8A 4X64K 2P9PA 4A61A 1TL3A 3KTQA 1SS6A 1N34K 1ZBSA 2AJQA 1TV6A 3HP9A 3V81A 2IVOA 1BI4A 3EYZA 2E2PA 4JK9A 3H1VX 4JI4K 2WONA 5BPMA 4JS4A 4DU4A 3CI5A 3NH0A 4M41A 4DU3A 1ZYQA 1RDWX 4KB0A 1DGKN 2I7PA 5KPRA 3CJ1A 3J80O 4LH4A 5I9EB 5F0XA 2VWBA 4ISEA 1NG9A 4JKEA 3HRGA 5AQVA 1KAYA 1QQMA 3K5NA 1RDUA 5FPDA 1U2VB 1VQNN 2HNYA 2YHWA 1HQUA 4C8LA 3W0LA 1ZBIA 1B9FA 2HBJA 1C0FA 2UXBK 4FWKA 4Z0UA 3ZETA 4ZTFA 3G0ZA 5M1KA 3DXKA 2Q3SA 1NJIO 4YHHK 3MEDA 1I3AA 4MFBA 5AZIA 4J2DA 2IOCA 3SMSA 4BRPA 3OA9A 1DEJA 4KHQA 3AVIA 3ULEB 3RSEB 1EX4A 1RTHA 2A1RA 2KW4A 4IFEA 2F4VK 1EXQA 1S1VA 1RDDA 4MO5A 3KWGA 3CFPA 4JI3K 2GWJA 1FK9A 1X9SA 4H5WA 4ELVA 4CK2A 4KHUA 3C6HA 1JXBA 3UKRA 3NVKA 3LP2A 2Q2RA 3LM9A 1XNRK 4ISFA 4FJNA 2VQEK 1RTJA 2VGMA 4BRNA 4ELTA 2YJEA 4KHPK 4IBNA 4BRMA 2P1JA 3E9OA 5AQNA 1X9MA 4E0DA 4M7XA 2ASOA 4O55A 4CGJA 2W41A 3C95A 5FPEA 3RMCA 3AA5X 4KBOA 2KFZA 3ATVA 4FXDA 2KZMA 2YHAA 3P4IA 4M3ZA 1HUXA 5IT9O 5BPLA 3QEPA 4JI7K 3A5NC 3HP6A 1QSSA 2J4RA 3HO1A 1TVRA 3CFOA 3JYTA 4N56A 4CHPA 3EL2A 3OJSA 5J2NA 4DFJA 1ITGA 3FFKB 3U4LA 3OYMA 1YHQN 1C6VA 2NLXA 1RILA 4NCAA 4DG1A 5M1FA 1SQKA 2UUCK 1WSEA 3V1QA 4CJPA 4CF1A 3IUCA 4J2BA 4DSLA 1OH5A 3MN6A 4Z4GA 5C0YA 2RF2A 2D0OA 4YOWA 4FLWA 1BI4B 1LAVA 4B8CA 1SKRA 4WYBA 5AFUA 3SBGA 1XUPO 3CMEN 2D0AA 4DV0K 1L3UA 3NF7A 4DR3K 3HTVA 2XRIA 1XHZA 1NGFA 4WE1A 3C7NA 5B8HA 3SQ1A 3DLKA 3VEZA 1LV5A 3FZHA 2D5RA 1KVCA 5HBMA 2ZF5O 5EU7A 4FJXA 3KD1E 5AQOA 1VQMN 1U2VA 4DTUA 4MDAA 3R8EA 1NJZA 2UXDK 1IJJA 1G15A 3O08A 4CZKA 3NAEA 1XI1A 3TAQA 3P5JA 3LALA 2XY6A 2GX9A 3F5TA 1H1VA 1X1PA 2HHVA 1NK7A 1N33K 3PX0A 1IG9A 2ZJRL 3HPOA 1X9WA 1JLEA 3QETA 4GMJB 2OYQA 1WBBA 4HWIA 3LDQA 2XY7A 1O13A 1RTIA 4YY3K 4GNIA 3ZSWA 5CE3A 4FLYA 4CZJA 2QWOA 2GWKA 3GDQA 4A57A 3R6MA 3VQQA 2DTUA 3B6OA 4JK7A 3D2FA 2RKIA 1RT6A 2BE2A 2Q0RA 4CBWA 2E2OA 3QMLA 5C24A 2QKBA 4IOAL 1E3MA 3AO4A 3AA2A 2FBTA 2Z1IA 4HCBA 3JS6A 4E7JA 3D0PA 1CXUA 1BCMA 3O9QA 4I6MA 2Q36A 4CBUA 1UA0A 3O4WA 3WT0A 4CJUA 4E1JA 4CZEA 1NKBA 5KQDA 1C0MA 2DPNA 3KKRA 1UWBA 4GVEA 4CVNE 2O4GA 3CCQN 1TYQB 4DFMA 3OYGA 3Q7CA 1RDBA 4E1MA 4CF2A 4I9LA 4F2SA 3LDNA 3ZEUB 3KK1A 3FZMA 4B9MA 2D0CA 4CHOA 2G8FA 1JCFA 3C7NB 4B3OA 1K8KA 4DS5A 4PKGA 1SUQA 3O1BA 2O8CB 2HNZA 4X66K 5GAGP 2O8CA 3EZ5A 5FRNA 1Z05A 4DR6K 1EETA 1U6ZA 2WC9A 5F1XA 3VESA 1ATRA 4FO0A 3L2WA 1BCOA 1HNVA 3P1GA 3E66A 4WF9L 4F3OA 1MU2A 4CFBA 3MWPA 3O8MA 3TTFA 4JKDA 5AQYA 3ZETB 4F9OA 2UUBK 5MLCQ 3P38A 4RW7A 4TSXA 4AF1A 3FFIA 5BRFA 4H0VB 3SK3A 5KI6A 1VSEA 3CJCA 2HBKA 1WAFA 2JLEA 3MEEA 4B1WB 3B8AX 3OJUA 1IKYA 2ASPA 3LDOA 4CZFA 3M3ZA 2A40A 2GEMA 3EEQA 4FWSA 5GIOA 1KD1O 4NXNK 4BE2A 3THXA 3N4QA 4BRQA 1KLNA 3Q7BA 3SI6A 1O1WA 1ESVA 2QWMA 4EIAA 1IBMK 3CJAA 3EN9A 1YTAA 4BC4A 3VQ7A 4H5RA 2E20A 1WSHA 3BZKA 4NCBA 5I42A 1JLBA 4DHYA 1TK8A 2E6MA 4CK3A 4Z4EA 3THVA 4Z4HA 2FBVA 4JK8A 4B9QA 3ITHA 2IDOA 3WXIA 4JKFA 5AJ3K 4F8RA 1QSLA 4FVMA 1GLCG 3VTHA 2HW3A 3U3GA 1WBDA 2OA8A 4JI8K 1K6YA 1VSMA 1W97L 1SAZA 3EKSA 3DLRA 3MMVA 4HUGA 1RT7A 1W0HA 3VN5A 1Q7YO 4CJQA 4IG3A 4B9UA 3T69A 3IG1A 3NDKA 3BUZB 1CLQA 3AA3A 4YDUA 3IFRA 4WFAL 3L3VA 3DOKA 4PHTX 1YITN 2O8FA 5JVGL 2GTDA 1NGJA 4KI6A 3TARA 5J2MA 2HVHA 3NFAA 1D8YA 4RG8A 1HKGA 3QFUA 1LOTB 5ADXH 1HKCA 1MWKA 2O8EA 2FSKA 1SZ2A 2YKMA 1XHXA 3H6EA 4DQSA 1MWMA 4CD1A 2E88A 1NK9A 3SPYA 4OVLA 1GLLO 4JEPA 2VG6A 5GIPA 3D2EB 4GY2B 3SUPA 2OANA 3VF6A 2IS3A 4CJTA 1VHXA 2NRXA 4KB1A 1BHLA 2CH6A 4C8MA 1JXEA 4ID1A 3M5RA 3TAPA 1S1WA 5HP1A 2KFNA 2HF3A 1HKBA 4QS9A 4IXCA 3PX6A 1JLCA 3MDQA 4BVOA 4BRAA 3CC2N 4XEIA 3GBTA 3MN7A 4DV4K 2IVPA 5K14A 4Q5VA 3ULDA 4JHDB 1NK4A 2ZM6K 3LWLA 5M1NA 3TU5A 1C0TA 4AHCA 4WFNL 4RW4A 3P83D 3RWUA 3VQ9A 1J5OA 2FSNA 4N47A 4F3TA 3LZJA 4B3TK 5EVZA 2G8WA 1RT3A 4JNEA 5SWMA 1BO5O 5EXWA 4JV5K 1BU6O 3AVLA 4CEFA 1NK8A 3UB5A 3U3YA 5JVHL 2CGJA 4A59A 4IFVA 4PKHA 4OKKA 5CHIA 4FM0A 1ATNA 5EOYA 3DXMA 4KAZA 3H08A 2A41A 3SUQA 3AARA 4CFAA 3VPZA 4HHTA 3D2FB 3NE6A 2HBMA 3QIPA 3OYKA 1VQLN 1BA1A 1ILYA 5HRPA 3LAKA 5CY4A 1J6ZA 3CJBA 1Q8IA 4DKWA 3QEVA 4CJ5A 3KK7A 4OO1J 3VA3A 4QCLA 3I8BA 5C15A 2AP1A 3CCJN 4DQRA 4JI0K 3UKRB 5JLFA 4A2AA 3VQPA 2I7NA 3ZX0A 3IDHA 4FLXA 4FWQA 1BIUA 2FBYA 3KLEA 3HK2A 3SQ2A 2DFFA 3G10A 2OPRA 4B9NA 5CR4A 4FL9A 3QERA 2OTLN 3BY5A 3MWTA 1JL1A 2YJFA 3K5OA 2P5OA 3U9ZA 1KAXA 3BZCA 4M42A 1JCGA 1RCHA 3QEIA 2FXUA 1DLOA 2P5GA 1TUYA 1VK0A 4N76A 3MECA 2A1SA 3K57A 3W3DA 3C6UA 1HYSA 5LJVA 2E5LK 1JJ2M 1YTUA 4F2RA 1NMNA 1Q81O 4FJ9A 3CD6N 3L8BA 4Z4FA 5AQHA 5TKYA 3OY9A 5LY3A 4K42A 3OS0A 3LDPA 1HNXK 1FJGK 2D4WA 4B9LA 2Z1GA 1ZXOA 1BIZA 3FLCO 4FJGA 4IO9L 4CGGA 4CZGA 4OPJA 1B92A 3FR0A 4PQUA 3RRGA 3AAQA 4X65K 3VENA 4JYAK 1CZAN 3DXKB 3ZSXA 4ELUA 4DSIA 4LF5K 4Q0BA 5IWAK 2YNHA 4DUZK 3DM2A 5M1QA 4BDYA 3ZT4A 1QQCA 4DTJA 1QSYA 3CQXA 4IJNA 2NRHA 5CYQA 3H45C 3QLHA 2WBNA 3AO5A 3S3OA 1BA0A 2W6LA 1DKGD 4CEZA 4E7IA 4IDHA 5C25A 2HHSA 3L0QA 3P39A 1SL2A 4FLVA 4CJWA 1WB9A 4CEEA 3MCPA 4CGDA 3EY1A 4EHUA 1SV5A 4CE9A 1TK5A 2G8KA 1VQ6N 1C0UA 1E4GT 4JKGB 1KVBA 4BRLA 3IMXA 4FK4A 4K8ZA 4DSEA 1NM1A 1QQOA 3AVKA 1T6CA 1OVQA 4RWTA 2NRZA 2VGNA 4DQPA 3DRPA 4FPBA 4PY5A 3OW2M 4JRQA 3EO3A 4H5VA 2DFEA 1QS4A 2ETJA 3EE9A 1WN7A 3E9LA 3AGKA 4JI5K 3WQUA 4M3UA 3HXMA 4BE0A 4KHWA 1RBVA 3PY8A 4FZZA 1NGIA 5KRTA 4W5TA 3U9DA 1NKEA 1J54A 3BF1A 4O5BA 3V4IA 1W7AA 4DSFA 1W9HA 2YHYA 3THXB 5BN9A 4UY8O 2EWSA 1RT2A 3C6TA 3MAQA 4ILGB 5SZTA 2UU9K 1YIJN 5C2DA 1IH7A 4B1ZA 3MK6A 3RSEA 3D7EO 3KKSA 2A42A 4FWLA 4E7KA 3VQ8A 2G8IA 1RDAA 3F73A 1U47A 1MDUB 2YNGA 2P9SB 3IRXA 4OGCA 5HRSA 5GAEP 3VQDA 1KQSM 3L3UA 4M3YA 1JLFA 2YHXA 3FGUA 4YORA 3UKUB 3MXJA 2O8EB 3HZ6A 3QICA 3GOIA 4W5RA 3TTCA 3AVFA 3WQTA 5CYMA 1RBRA 4M3XA 4UQGA 2D0PA 3CCEN 1L3TA 3LL3A 4DV3K 5TKWA 3KK2A 3HT3A 4M3TA 3DWLA 4CCHA 4CHZA 1VSDA 3THYB 1N6QA 3JSMA 3I8DA 4PL7A 1NJXA 4IOXA 3OYFA 3THWA 4BDPA 1SL0A 4PA1A 3ISNC 3T3FA 3OVNA 3L2UA 3F2KA 2DFHA 3KWIA 4OPHA 1RT5A 4CJRA 4NO7A 3M8PA 3DLBA 1TKDA 1RGIA 2ZQBA 1U4BA 4KFBA 4DTOA 3LP3A 3EE8A 3SAHA 1KLMA 2B5JA 4LY7A 3CMAN 3K9KA 3TPQA 1SKWA 3AVJA 3O4NA 3VMFB 1GLEG 4HTUA 1JL2A 3C0BA 3RVCA 5J1EA 3LPUA 3VGMA 1JCEA 1VSLA 4NYFA 3RMAA 1JLGA 5EY4A 5AR0A 4PKIA 3J7ZO 4R5PA 3D2EA 4H0TB 1YI2N 1TAUA 3PSFA 4B1YB 2H3GX 3VF2A 2QWLA 5GAHP 1HPMA 3VOVA 3QINA 2BH1A 5AQXA 4CF0A 3HPGA 3A2FA 5A2QO 5J2QA 5M1OA 1NOYA 2LSNA 4EHTA 4BRDA 4DSKA 5AQJA 1QVFM 1FW6A 5C12A 4IZ9A 1VQPN 4BQZA 3V9XA 1GOBA 4BRGA 3CM6A 5BPNA 1FKPA 2VWKA 5F2RA 2G8UA 2RHKA 1GLAG 2BANA 2VYPA 4FLUA 1M1KO 3QBXA 4DTRA 1LAWA 2JGUA 1T8EA 1NGAA 3CCLN 4Z4IA 2AA4A 4BR2A 1T03A 3VQ6A 3ZSYA 1GOAA 4CIFA 4CJVA 4ID5A 4K0KK 3HVTA 1I94K 4XH4A 4CFCA 4CHQA 3AVCA 3QIOA 3OS2A 3ZEUA 5AQRA 2Q31A 2Q97A 2BDPA 4LF6K 2OZMA 4JKHA 4EP4A 1VQ5N 4JKAA 4DTXA 1KCFA 3VEWA 3AY9A 3K0SA 3DOLA 3KJVA 3VQ5A 3KZBA 1RT4A 3HYFA 3VETA 3WNFA 2HF4A 5HRRA 2F8TA 4NLBA 4YOTA 1NBWA 4CHYA 4FM2A 3WXMB 4KHSA 5JMVA 4HUEA 5LL6Z 1BOTO 1WSFA 2V7YA 4KV8A 5BRDA 4CZMA 3OYEA 3R9PA 3ZSQA 2YV0X 3G25A 3VQAA 4FLTA 1GLJO 4CJSA 4B1VA 3UIQA 3LPTA 3OYAA 3K59A 3HOTA 2QW9A 4JS5A 4KH5A 1WSJA 5DM7L 4A62A 3TI0A 3M6GA 4FWOA 5FDLA 2QA4N 4IKFA 1SKSA 3NGYA 3WXKA 4A5BA 4C1NK 2FC0A 4BRKA 3CCSN 1WLJA
chains in the Genus database with same CATH topology
5BPMA 2HMPA 2Q0UA 2CH6A 3CI5A 5AQGA 4WQ5C 5E84A 1IG8A 4NB4A 4JD2A 2E2NA 3M5RA 1RDWX 1K8KB 3VEXA 1DGKN 2I7PA 2HF3A 1HKBA 3JXUA 4QS9A 4IXCA 1KAZA 5KPRA 3SLCA 3CJ1A 4FOEA 4BC3A 5I9EB 3MDQA 4K43A 2E2QA 1NGGA 2VWBA 4ISEA 5F0XA 1HX1A 3HRGA 4JKEA 4BVOA 4YOYA 4BRAA 5AQVA 3OHRA 3CC2N 4XEIA 3GBTA 3MN7A 4MO4A 1KAYA 1QQMA 2IVPA 4BR0A 4BR4A 1RDUA 5FPDA 3O1WA 1U2VB 2NZTA 4JHDB 4C23A 1VQNN 3ID6A 2KKZA 5M1NA 3TU5A 4WFNL 2YHWA 2CH5A 4KH6A 4DB3A 4JAXA 4JKCA 1MA9B 5AQQA 2FSNA 3W0LA 2E1ZA 2HBJA 1C0FA 3E9PA 4BREA 4FWKA 2QXLA 3AAPA 5EVZA 5AQMA 1XQSC 4JNEA 3ZETA 1BO5O 5EXWA 1BU6O 5M1KA 4WQ4A 3DXKA 2OTJN 3UB5A 5JVHL 1NJIO 2CGJA 4A59A 3HBTA 4PKHA 5FPNA 3CCMN 3ZYYX 4A5AA 5CHIA 3QBWA 1ATNA 5EOYA 3DXMA 5JLHA 2A41A 5AZIA 3PIPL 2QI2A 2E1YA 4JKBA 3AARA 5AQZA 3VPZA 1NMDA 3CHWA 5H1SQ 3D2FB 1BG3A 1NGCA 5ELZA 4XH5A 2HBMA 4QS8A 3FZKA 3SMSA 4BRPA 1YJ9N 3OA9A 1DEJA 3DLLL 1VQLN 1NGBA 1BA1A 3ULEB 2P9KB 3A8YA 1DT9A 2NRTA 3L4QA 4BRFA 1VAZA 2VCPA 1ILYA 3ULEA 3RSEB 5C2FA 1J6ZA 3CJBA 3VF4A 1HLUA 4IFEA 4DKWA 4MO5A 3KWGA 1OKJA 4UY8O 2GWJA 2PBDA 3KK7A 4NLCA 5BR9A 4OO1J 4H5WA 4M7YA 3I8BA 4CZHA 2AP1A 5C15A 3CCJN 3CETA 3C6HA 2NRRA 5AQIA 4LC9B 3UKRB 2HSTA 5JLFA 4A2AA 5AQLA 3UKRA 2I7NA 3ZX0A 3NVKA 4ILJA 3IDHA 4FWQA 2Q2RA 3LM9A 3M1FA 3CXCM 4ISFA 3FZLA 3O5BA 2VGMA 4BRNA 1NGDA 2YJEA 4FPAA 5CR4A 3GE1A 4BRMA 3E9OA 4FL9A 1GLBG 5AQNA 1KC8O 2OTLN 4ILHA 2A3ZA 4BRHA 1X3MA 3MWTA 2NRWA 4M7XA 3HSCA 3VGLA 2ASOA 2YJFA 5KPZA 1Z6RA 3U9ZA 2ZGZA 4YDUC 2HOEA 1KAXA 1C0GA 3HM8A 2W41A 3QDKA 5FPEA 4O8UA 1JCGA 4RTFD 4BRCA 4KBOA 3ATVA 2FXUA 4GV6A 1WOQA 1TUYA 3G6EN 3R1XA 3P4IA 3ZX3A 2P9IB 3W3DA 3H3NO 1S72N 1HUXA 1BUPA 3ENOA 3QB0A 5BPLA 5LJVA 5JICA 2YI1A 1JJ2M 3WUHA 4IJAA 2HBLA 3A5NC 1GLDG 2FF6A 3VERA 2J4RA 1Q81O 3CD6N 1BWFO 1YXQA 5AQHA 1NGEA 5TKYA 4H0OA 4K42A 5LY3A 2ITMA 4KH4A 3T7ZA 3CQYA 2ZJQL 3LDPA 3DAWA 2D4WA 3K9JA 3SAFA 3FLCO 1ZXOA 4L3QA 2ZGYA 4BC2A 4BR5A 1X3NA 4IO9L 3EL2A 3TSPA 3R3LA 4CZGA 2QWQA 3FFKB 1G99A 5AZJB 3U4LA 1YHQN 3VEOA 2NLXA 1T44A 4YOUA 3CERA 5M1FA 1SQKA 2UYTA 3FR0A 2QTDA 4HTLA 3AAQA 1S3XA 4FWRA 3MX5A 3L4IA 3VENA 4MLHA 5BRHA 3UKUA 3IKMA 3IUCA 1CZAN 3DXKB 1D4XA 3MN6A 5C0YA 4EAHD 1T3VA 5M1QA 2D0OA 4YOWA 3CF5L 1VQ7N 4EFHA 3DXMB 4BVPA 5HOOA 2GELA 3CQXA 4Z94A 4IJNA 2NRHA 3CPEA 4J8FA 2V51B 4WYBA 3BEXA 3GL1A 3H45C 3E1YA 2WBNA 5AFUA 3LM2A 3DJCA 1P8ZA 3SBGA 1W2BM 1YAGA 1K73O 1XUPO 3CCUN 1N8RO 4FWMA 1BDGA 3CMEN 1BA0A 3HTVA 2P9LB 1DKGD 2P9KA 4IDHA 2P9UA 1NGFA 2P9LA 3L0QA 3P39A 3C7NA 5B8HA 5AQFA 4JN4A 3VEZA 3S41A 3FZHA 3MN9A 2YCHA 3H3OB 3I33A 3MCPA 5AQPA 3SAGA 3OBYA 2ZF5O 4EHUA 5AQOA 4JKGA 1VQMN 1VQ6N 1V4SA 1U2VA 4JHDA 1E4GT 4JKGB 4MDAA 3EZWA 4GV3A 4BRLA 3IMXA 2BUPA 3R8EA 4WCEL 2GUPA 1IJJA 3O08A 1NM1A 4CZLA 4CZKA 1QQOA 1T6CA 4RWTA 2D1KA 2NRZA 2VGNA 4FPBA 2GX9A 3EKUA 3F5TA 1H1VA 2QM1A 5ADXA 3OW2M 5KPTA 3EO3A 2QWPA 3FZFA 4H5VA 2A6AA 2IIRA 2ZJRL 2P9NA 4YOVA 3EE9A 1VQON 2CGKA 4HWIA 4BRIA 3E9LA 3AGKA 4FOIA 3WQUA 1LCUA 3LDQA 3O9SA 1NGIA 1O13A 4WQ4C 5LJWA 3U9DA 2PAVA 4GNIA 1R59O 5CE3A 4CZJA 2QWOA 2GWKA 3A5OC 3BF1A 5AZIB 1OVYA 3GDQA 1WUAA 4A57A 3R6MA 3J8AA 3O80A 4JK7A 3A5MC 3D2FA 2YHYA 2Q0RA 3BF3A 5BN9A 2EWSA 4B1UB 4CBWA 2E2OA 2KHOA 2PFUA 3ENHA 4IWVA 5KQ8A 3HOSA 3CCVN 2JWLA 4ILGB 3TSUA 3QMLA 1Q82O 1YIJN 5C2DA 4B1ZA 3MK6A 3RSEA 4IOAL 2BTFA 3D7EO 2A42A 1KXPA 4FWLA 1VQKN 3KVGA 3O9TA 3JS6A 2YX6A 1MDUB 4M63C 2P9SB 3WXLA 4R79A 3CPWM 5GAEP 4YOXA 1HJOA 1KQSM 3O9QA 4I6MA 4RCHA 2Q36A 3KHYA 4CBUA 3O4WA 2YHXA 1NWKA 3FGUA 4YORA 3WT0A 2W40A 4H5NA 4E1JA 2KLAA 1QHAA 4CZEA 4DQ8A 2DPNA 3TSQA 3CJ7A 5KQDA 3UKUB 4FWNA 4H0XB 1Q18A 1T6DA 4GVEA 5FPMA 3P31A 2NNWA 3HZ6A 1E4FT 3CCQN 3QICA 3GOIA 1TYQB 3ATUA 4H0PA 3C6AA 3TTCA 1QQNA 2JWKA 2Q1NA 3Q7CA 2P9PB 4BG9A 3A5LC 3WQTA 3WXJA 5E26A 1YJNN 3H1QA 2D0PA 3A0IX 3CCEN 3LL3A 2F9WA 5TKWA 3LDNA 3DWLA 3AGRA 5C10A 3VEYA 4AM6A 3ZEUB 1TUUA 4QS7A 4H0YB 3FZMA 2P9IA 3MN5A 1EQYA 2P9UB 4PL7A 1VQ9N 1JCFA 4MLEA 5BREA 3C7NB 4IOXA 3G4SN 1K8KA 3GG4A 4BGBA 4PKGA 2QWNA 3O1BA 4G9ZA 3F2KA 3KWIA 4OPHA 4C1NI 5GAGP 5AQSA 4NO7A 4PL8A 3SJHA 2RE2A 4CD3A 4O8KA 1Z05A 5GADP 1VQ4N 4MDBA 1U6ZA 2WC9A 3C65A 5F1XA 4BC5A 4Y0WA 4H5TA 3NMUA 4K41A 1ATRA 1RGIA 3VESA 4FO0A 2A5XA 5AZJA 5AQKA 3EE8A 3SAHA 3E66A 4WF9L 1RFQA 3CMAN 3CC4N 2FLOA 3K9KA 3MWPA 3O8MA 3TPQA 4JKDA 5AQYA 3TTFA 3ZETB 5HL7L 4WFBL 3VMFB 1GLEG 2P9NB 4FSVA 2FSJA 4AM7A 4F9OA 5MLCQ 3C0BA 3P38A 4AF1A 5BRFA 3RVCA 1Q86O 3VGMA 4H0VB 3SK3A 4IOCL 1JCEA 4K25A 3CJCA 5AQTA 2HBKA 3PLAA 1VQ8N 5EY4A 1S22A 5AR0A 2F7TA 2WFBA 4B1WB 4PKIA 3B8AX 3J7ZO 3NVMA 3L6QA 5BN8A 3D2EA 2ASPA 5M1PA 4H0TB 3LDOA 2FF3B 3VGKA 4CZFA 1YI2N 1K8AO 3M3ZA 2GEMA 2A40A 2H3GX 1GLFO 4FWSA 3VF2A 4B1YB 5GIOA 1KD1O 1K9MO 3N4QA 1Y64A 2QWLA 3QFPA 4BG8A 4BRQA 5GAHP 1HPMA 3VOVA 3TTDA 3H46O 2BH1A 5AQXA 4JD2B 3I56N 5EX5A 3CC7N 5GINA 5M1OA 3Q7BA 1ESVA 2QWMA 4EIAA 1X9JA 4EHTA 5AQUA 4BRDA 3CJAA 3EN9A 5AQJA 4U7BA 4BC4A 4IEIA 4H5RA 4DCHA 2E20A 4BY9C 1QVFM 2IVNA 5C12A 4O5FA 4XH1A 4BR7A 4IZ9A 3PIOL 4OPAA 1VQPN 3CCRN 4BQZA 4DHYA 3U8XA 4BRGA 1YVNA 5BPNA 2QEXN 3I55N 4JK8A 4B9QA 5F2RA 3WXIA 4JKFA 2RHKA 1GLAG 2VYPA 1P90A 1M1KO 3QBXA 4FWPA 4WQ5A 2CGLA 3SMPA 4BR9A 1XC3A 3MCAB 1NGAA 1GLCG 3VTHA 3CCLN 2WUSA 3F9MA 4BGAA 3O9UA 4ISGA 4IEEA 3N4PA 1W97L 1SAZA 3EKSA 2AA4A 3MX2A 4GV9A 4U67L 3MMVA 4BR2A 3FE1A 4CI6A 1ATSA 2V52B 4XH4A 3VEVA 1Q7YO 3ZEUA 5AQRA 4A2BA 1V4TA 2Q31A 1NLVA 2Q97A 2E8AA 2ZJPL 4CJ7A 1YUWA 3LDLA 4JKHA 3T69A 1VQ5N 4JKAA 3VEWA 3AY9A 3ZX2A 3BUZB 4CBXA 2ASMA 2F9TA 3D6RA 2V7ZA 3G71N 3O9RA 4YDUA 1QZ5A 3KZBA 3IFRA 5AQWA 3VETA 4WFAL 2HF4A 4CZIA 1YF5L 4NLBA 1QZ6A 3ENBA 4YOTA 1M90O 1NBWA 4PHTX 2NRVA 2ZWHA 1YITN 1ZC6A 5JVGL 4IO8A 3WXMB 2GTDA 1NGJA 4FVUA 5JMVA 2QWRA 1EO1A 5AFUH 1BOTO 1NGHA 2P9SA 2V7YA 4H03B 3CJ9A 4I6MB 1YJWN 5BRDA 4BROA 4CZMA 3UE5A 1HKGA 3R9PA 3QFUA 1LOTB 3WEEA 3SBTA 5ADXH 3G25A 1HKCA 1MWKA 3OBWA 2FSKA 3WEEB 1SZ2A 1GLJO 3CIPA 1QVGM 3O6WA 3BP8A 3H6EA 4B1VA 2P9PA 4BQLA 3VTIA 4A61A 1MWMA 3HOTA 2QW9A 4CD1A 2E88A 4KH5A 1TYQA 1SS6A 4B1XB 4A62A 5DM7L 1ZBSA 3M6GA 3HI0A 4FWOA 1GLLO 4JEPA 3ID8A 2QA4N 5GIPA 3D2EB 2IVOA 4GY2B 3WXKA 2E2PA 2OANA 3VF6A 4A5BA 4C1NK 5DM6L 4BRKA 3CCSN 4JK9A 3H1VX 2NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPM A;  2HMP A;  2Q0U A;  2CH6 A;  3CI5 A;  5AQG A;  4WQ5 C;  5E84 A;  1IG8 A;  4NB4 A;  4JD2 A;  2E2N A;  1RDW X;  1K8K B;  3VEX A;  1DGK N;  2I7P A;  2HF3 A;  1HKB A;  3JXU A;  4QS9 A;  4IXC A;  1KAZ A;  5KPR A;  3SLC A;  3CJ1 A;  4FOE A;  4BC3 A;  5I9E B;  3MDQ A;  4K43 A;  2E2Q A;  1NGG A;  2VWB A;  4ISE A;  5F0X A;  1HX1 A;  4BVO A;  4BRA A;  5AQV A;  3OHR A;  4XEI A;  3GBT A;  3MN7 A;  4MO4 A;  1KAY A;  1QQM A;  2IVP A;  4BR0 A;  4BR4 A;  5FPD A;  3O1W A;  1U2V B;  2NZT A;  4JHD B;  4C23 A;  3TU5 A;  2YHW A;  2CH5 A;  4DB3 A;  4JAX A;  1MA9 B;  5AQQ A;  2FSN A;  3W0L A;  2E1Z A;  1C0F A;  4BRE A;  4FWK A;  2QXL A;  3AAP A;  5EVZ A;  5AQM A;  1XQS C;  4JNE A;  3ZET A;  1BO5 O;  5EXW A;  1BU6 O;  4WQ4 A;  3DXK A;  3UB5 A;  2CGJ A;  3HBT A;  4PKH A;  5FPN A;  3QBW A;  1ATN A;  5EOY A;  3DXM A;  5JLH A;  2A41 A;  5AZI A;  2E1Y A;  3AAR A;  5AQZ A;  3VPZ A;  1NMD A;  3CHW A;  3D2F B;  1BG3 A;  1NGC A;  5ELZ A;  4XH5 A;  4QS8 A;  3FZK A;  3SMS A;  4BRP A;  1DEJ A;  1NGB A;  1BA1 A;  3ULE B;  2P9K B;  3A8Y A;  4BRF A;  2VCP A;  3ULE A;  3RSE B;  1J6Z A;  3CJB A;  3VF4 A;  1HLU A;  4MO5 A;  1OKJ A;  2GWJ A;  2PBD A;  5BR9 A;  4H5W A;  4M7Y A;  3I8B A;  4CZH A;  2AP1 A;  3CET A;  5AQI A;  4LC9 B;  3UKR B;  5JLF A;  4A2A A;  5AQL A;  3UKR A;  2I7N A;  3ZX0 A;  3IDH A;  4FWQ A;  2Q2R A;  3LM9 A;  3M1F A;  4ISF A;  3FZL A;  3O5B A;  4BRN A;  1NGD A;  2YJE A;  4FPA A;  3GE1 A;  4BRM A;  4FL9 A;  5AQN A;  1GLB G;  2A3Z A;  4BRH A;  1X3M A;  4M7X A;  3HSC A;  3VGL A;  2ASO A;  2YJF A;  5KPZ A;  1Z6R A;  3U9Z A;  2ZGZ A;  4YDU C;  2HOE A;  1KAX A;  1C0G A;  3HM8 A;  2W41 A;  3QDK A;  5FPE A;  1JCG A;  4RTF D;  4BRC A;  4KBO A;  3ATV A;  2FXU A;  1WOQ A;  1TUY A;  3P4I A;  3ZX3 A;  2P9I B;  3W3D A;  3H3N O;  1HUX A;  1BUP A;  3ENO A;  3QB0 A;  5BPL A;  5LJV A;  5JIC A;  2YI1 A;  3WUH A;  4IJA A;  3A5N C;  1GLD G;  2FF6 A;  3VER A;  2J4R A;  1BWF O;  1YXQ A;  5AQH A;  1NGE A;  5TKY A;  4H0O A;  4K42 A;  5LY3 A;  2ITM A;  3CQY A;  3LDP A;  3DAW A;  2D4W A;  3FLC O;  1ZXO A;  4L3Q A;  2ZGY A;  4BC2 A;  4BR5 A;  1X3N A;  3EL2 A;  4CZG A;  2QWQ A;  3FFK B;  1G99 A;  5AZJ B;  3U4L A;  3VEO A;  2NLX A;  1T44 A;  3CER A;  1SQK A;  2UYT A;  3FR0 A;  4HTL A;  3AAQ A;  1S3X A;  4FWR A;  3L4I A;  3VEN A;  4MLH A;  5BRH A;  3UKU A;  3IUC A;  1CZA N;  3DXK B;  1D4X A;  3MN6 A;  4EAH D;  2D0O A;  4EFH A;  3DXM B;  4BVP A;  2GEL A;  3CQX A;  4Z94 A;  4IJN A;  2NRH A;  4J8F A;  2V51 B;  4WYB A;  3BEX A;  3GL1 A;  3H45 C;  5AFU A;  3LM2 A;  3DJC A;  1P8Z A;  1YAG A;  1XUP O;  4FWM A;  1BDG A;  1BA0 A;  3HTV A;  2P9L B;  1DKG D;  2P9K A;  2P9U A;  1NGF A;  2P9L A;  3L0Q A;  3C7N A;  5B8H A;  5AQF A;  4JN4 A;  3VEZ A;  3S41 A;  3FZH A;  3MN9 A;  2YCH A;  3H3O B;  3I33 A;  3MCP A;  5AQP A;  2ZF5 O;  4EHU A;  5AQO A;  1V4S A;  1U2V A;  4JHD A;  1E4G T;  3EZW A;  4BRL A;  3IMX A;  2BUP A;  3R8E A;  2GUP A;  1IJJ A;  3O08 A;  1NM1 A;  4CZL A;  4CZK A;  1QQO A;  1T6C A;  4RWT A;  2D1K A;  4FPB A;  3EKU A;  1H1V A;  2QM1 A;  5ADX A;  5KPT A;  3EO3 A;  2QWP A;  3FZF A;  4H5V A;  2A6A A;  2IIR A;  2P9N A;  2CGK A;  4HWI A;  4BRI A;  4FOI A;  3WQU A;  1LCU A;  3LDQ A;  1NGI A;  4WQ4 C;  5LJW A;  3U9D A;  2PAV A;  4GNI A;  1R59 O;  5CE3 A;  4CZJ A;  2QWO A;  2GWK A;  3A5O C;  3BF1 A;  5AZI B;  3GDQ A;  1WUA A;  3R6M A;  3J8A A;  3O80 A;  3A5M C;  3D2F A;  2YHY A;  2Q0R A;  3BF3 A;  5BN9 A;  2EWS A;  4B1U B;  4CBW A;  2E2O A;  2KHO A;  4IWV A;  3ENH A;  5KQ8 A;  3QML A;  4B1Z A;  3MK6 A;  3RSE A;  2BTF A;  3D7E O;  2A42 A;  1KXP A;  4FWL A;  3KVG A;  3JS6 A;  1MDU B;  4M63 C;  2P9S B;  3WXL A;  1HJO A;  4I6M A;  4RCH A;  2Q36 A;  3KHY A;  4CBU A;  3O4W A;  2YHX A;  1NWK A;  3FGU A;  3WT0 A;  2W40 A;  4H5N A;  4E1J A;  4CZE A;  1QHA A;  4DQ8 A;  5KQD A;  2DPN A;  3CJ7 A;  3UKU B;  4FWN A;  4H0X B;  1Q18 A;  1T6D A;  5FPM A;  3HZ6 A;  1E4F T;  3QIC A;  3GOI A;  1TYQ B;  3ATU A;  4H0P A;  1QQN A;  2Q1N A;  4BG9 A;  2P9P B;  3A5L C;  3WQT A;  3WXJ A;  5E26 A;  3H1Q A;  2D0P A;  3A0I X;  3LL3 A;  2F9W A;  3LDN A;  3DWL A;  3VEY A;  4AM6 A;  3ZEU B;  1TUU A;  4QS7 A;  4H0Y B;  3FZM A;  2P9I A;  3MN5 A;  1EQY A;  2P9U B;  4PL7 A;  1JCF A;  4MLE A;  5BRE A;  3C7N B;  1K8K A;  3GG4 A;  4BGB A;  4PKG A;  2QWN A;  3O1B A;  5AQS A;  4NO7 A;  4PL8 A;  3SJH A;  4CD3 A;  4O8K A;  1Z05 A;  1U6Z A;  5F1X A;  4BC5 A;  4Y0W A;  4H5T A;  4K41 A;  1ATR A;  1RGI A;  3VES A;  4FO0 A;  2A5X A;  5AZJ A;  5AQK A;  1RFQ A;  2FLO A;  3O8M A;  3TPQ A;  5AQY A;  3ZET B;  1GLE G;  2P9N B;  4FSV A;  2FSJ A;  4AM7 A;  4F9O A;  3C0B A;  5BRF A;  3VGM A;  4H0V B;  3SK3 A;  1JCE A;  4K25 A;  3CJC A;  5AQT A;  5EY4 A;  1S22 A;  5AR0 A;  4B1W B;  4PKI A;  3B8A X;  3L6Q A;  5BN8 A;  3D2E A;  2ASP A;  4H0T B;  3LDO A;  2FF3 B;  3VGK A;  4CZF A;  3M3Z A;  2GEM A;  2A40 A;  2H3G X;  1GLF O;  4FWS A;  3VF2 A;  4B1Y B;  1Y64 A;  2QWL A;  3QFP A;  4BG8 A;  4BRQ A;  1HPM A;  3VOV A;  3H46 O;  5AQX A;  4JD2 B;  5EX5 A;  1ESV A;  2QWM A;  4EIA A;  1X9J A;  4EHT A;  5AQU A;  4BRD A;  3CJA A;  3EN9 A;  5AQJ A;  4BC4 A;  4H5R A;  4DCH A;  2E20 A;  2IVN A;  4O5F A;  4XH1 A;  4BR7 A;  4IZ9 A;  4BQZ A;  4DHY A;  3U8X A;  4BRG A;  1YVN A;  5BPN A;  4B9Q A;  5F2R A;  3WXI A;  1GLA G;  2VYP A;  3QBX A;  4FWP A;  4WQ5 A;  2CGL A;  3SMP A;  4BR9 A;  1XC3 A;  1NGA A;  1GLC G;  2WUS A;  3F9M A;  4BGA A;  4ISG A;  1SAZ A;  3EKS A;  2AA4 A;  3MMV A;  4BR2 A;  3FE1 A;  4CI6 A;  1ATS A;  2V52 B;  4XH4 A;  3VEV A;  3ZEU A;  5AQR A;  4A2B A;  1V4T A;  2Q31 A;  1NLV A;  2Q97 A;  2E8A A;  4CJ7 A;  1YUW A;  3LDL A;  3VEW A;  3AY9 A;  3ZX2 A;  3BUZ B;  4CBX A;  2ASM A;  2F9T A;  2V7Z A;  4YDU A;  1QZ5 A;  3KZB A;  3IFR A;  5AQW A;  3VET A;  2HF4 A;  4CZI A;  1QZ6 A;  1NBW A;  2ZWH A;  1ZC6 A;  4IO8 A;  2GTD A;  1NGJ A;  5JMV A;  2QWR A;  5AFU H;  1BOT O;  1NGH A;  2P9S A;  2V7Y A;  4H03 B;  3CJ9 A;  4I6M B;  5BRD A;  4BRO A;  4CZM A;  3UE5 A;  1HKG A;  3R9P A;  3QFU A;  1LOT B;  3WEE A;  5ADX H;  3G25 A;  1HKC A;  1MWK A;  2FSK A;  3WEE B;  1SZ2 A;  1GLJ O;  3CIP A;  3O6W A;  3BP8 A;  3H6E A;  4B1V A;  2P9P A;  4BQL A;  4A61 A;  1MWM A;  2QW9 A;  4CD1 A;  2E88 A;  4B1X B;  1TYQ A;  4A62 A;  1ZBS A;  3M6G A;  3HI0 A;  4FWO A;  1GLL O;  3ID8 A;  3D2E B;  2IVO A;  4GY2 B;  3WXK A;  2E2P A;  2OAN A;  3VF6 A;  4BRK A;  3H1V X; 
#chains in the Genus database with same CATH topology
 2HMP A;  5AQG A;  4WQ5 C;  5E84 A;  1IG8 A;  4CGI A;  1K8K B;  3VEX A;  2QXF A;  4CJ4 A;  1CXQ A;  3I0R A;  1KAZ A;  4FOE A;  4CF9 A;  4N41 A;  3OHR A;  1D9D A;  4CJK A;  4BR0 A;  4BR4 A;  3F9K A;  2NZT A;  4C23 A;  3ID6 A;  4E7L A;  4GW6 A;  3DI6 A;  5HRO A;  4DB3 A;  4CEQ A;  4CF8 A;  2PY5 A;  1MA9 B;  5KTQ A;  3NF8 A;  4BDZ A;  4E89 A;  1CZB A;  4BAC A;  3E9P A;  4DR2 K;  3LZI A;  5AQM A;  2B6A A;  1WSG A;  3L2V A;  2OTJ N;  4OJR A;  1RBU A;  4JI1 K;  4E19 A;  3QBW A;  2F8S A;  2E1Y A;  1S9G A;  4JKB A;  5T7B A;  3CHW A;  4OGE A;  5H1S Q;  1TKT A;  1BG3 A;  2RN2 A;  1NGC A;  4QAG A;  4OPK A;  4QS8 A;  3SUN A;  1S5J A;  4BRF A;  3L4Q A;  4FK0 A;  2EHG A;  3ULE A;  5C2F A;  3MXI A;  1HLU A;  5I3U A;  3LWM A;  1RTD A;  1OKJ A;  2PBD A;  4NLC A;  4ZHR A;  3T1H K;  3CET A;  3NGI A;  5AQI A;  3NF9 A;  3K58 A;  2HMI A;  5AQL A;  4ILJ A;  1ASV A;  4KTW A;  1U48 A;  5JS1 A;  3CXC M;  3TAF A;  1S6Q A;  2HHT A;  3FZL A;  3IS9 A;  3O5B A;  1RDC A;  2VG7 A;  4FPA A;  2PYL A;  3WNH A;  4DQQ A;  1KC8 O;  4ILH A;  2A3Z A;  4BRH A;  1X3M A;  1NOZ A;  2NRW A;  3VGL A;  1S1T A;  5KPZ A;  1Z6R A;  4YDU C;  4HUF A;  1C0G A;  3RMB A;  3QDK A;  4O8U A;  3AO2 A;  3J7Y P;  3PV8 A;  3DLE A;  4O0J A;  4FJK A;  2XY8 A;  1EP4 A;  2QK9 A;  4OX9 K;  1WOQ A;  4GV6 A;  1IKX A;  3R1X A;  3AA4 A;  4LF8 K;  1QE1 A;  3ZX3 A;  2P9I B;  4CGF A;  1S72 N;  3ZT2 A;  4EZ9 A;  3AVG A;  5JIC A;  1L3S A;  1HMV A;  2HBL A;  3RTV A;  3SZ2 A;  1NGE A;  4ICL A;  4H0O A;  4W5O A;  4KH4 A;  4RW9 A;  4AH9 A;  2ZJQ L;  4KRE A;  3DAW A;  4Z4C A;  4L3Q A;  4BC2 A;  2ZGY A;  1X3N A;  4CEB A;  3V9U A;  1Y97 A;  1JLQ A;  3R3L A;  3QNO A;  3M8R A;  3ZSR A;  4GKJ K;  3O4Q A;  1G99 A;  5AZJ B;  3MXM A;  3VEO A;  3T19 A;  3CER A;  2O8B B;  2Y1I A;  1A5X A;  2UYT A;  4LF4 K;  2QTD A;  4HTL A;  1S3X A;  4FWR A;  3MX5 A;  3L4I A;  5BRH A;  3UKU A;  1LWC A;  1KSP A;  2UXC K;  4DFP A;  4FJ5 A;  2E4L A;  1HQE A;  3K5L A;  4EAH D;  4Y1C A;  4AHV A;  3CF5 L;  1VQ7 N;  4EFH A;  1S1U A;  5CZ2 A;  1ASW A;  1HPZ A;  4BVP A;  5HOO A;  4Z94 A;  4J8F A;  1GOC A;  3HVR A;  1LW0 A;  3DJC A;  1P8Z A;  1W2B M;  5C42 A;  1YAG A;  3CCU N;  4FWM A;  3WNE A;  3M8S A;  2P9K A;  2I5J A;  2P9U A;  4CJL A;  2P9L A;  4DR7 K;  2UUA K;  5AQF A;  3S41 A;  3MN9 A;  3H3O B;  3I33 A;  4W5N A;  1REV A;  1BGX T;  1B9D A;  4JKG A;  1V4S A;  3D45 A;  3SQ4 A;  5HLF A;  3EZW A;  2VQF K;  4GV3 A;  1FXX A;  4WCE L;  2GUP A;  4M3W A;  1VRU A;  2KTQ A;  2D1K A;  1ASU A;  2QWP A;  2HND A;  3TAE A;  3SUO A;  2HB5 A;  4GKK K;  2P9N A;  4YOV A;  3AVA A;  2OPS A;  4BRI A;  1ZBF A;  3SV4 A;  3O9S A;  1VSF A;  4WQ4 C;  3VQB A;  5LJW A;  4YFU A;  3DRR A;  1R59 O;  1UA1 A;  5AZI B;  3V9S A;  3J8A A;  3A5M C;  1NK5 A;  1S9E A;  3BF3 A;  4B1U B;  5KQ8 A;  2KHO A;  2PFU A;  3ENH A;  4I2P A;  4IWV A;  3HOS A;  3CCV N;  2JWL A;  3NF6 A;  1HYZ A;  1ZBH A;  3TSU A;  1NK0 A;  4N5S A;  1A5W A;  4LSN A;  4BE1 A;  3KVG A;  3O9T A;  1J5E K;  4JI6 K;  2YX6 A;  4M63 C;  1IO2 A;  3CPW M;  3PSI A;  4YOX A;  3LDS A;  3KHY A;  1Q9X A;  1NWK A;  3OYC A;  2W40 A;  3AVM A;  2KLA A;  1QHA A;  4DQ8 A;  1NU0 A;  1WNS A;  4H0X B;  1Q18 A;  4DFK A;  5FPM A;  1A5V A;  4G1Q A;  4CEA A;  2NNW A;  3NCI A;  1DTQ A;  3C6A A;  1QQN A;  4BG9 A;  1N5Y A;  3WXJ A;  1U04 A;  5E26 A;  4DV5 K;  4H4O A;  3KLH A;  3A0I X;  4CFD A;  3BDP A;  2VWJ A;  3AVH A;  3BGR A;  3AGR A;  5C10 A;  3VEY A;  4FLZ A;  4H0Y B;  3ZT3 A;  4CIE A;  3ZCM A;  2P9I A;  4FJ8 A;  3MN5 A;  3J81 O;  4DV1 K;  1BIS A;  3V9Z A;  2P51 A;  4DLE A;  1BQM A;  3GG4 A;  4BGB A;  3ZSO A;  3RRH A;  4KI4 A;  4MQ3 A;  2QWN A;  2FBX A;  3SV3 A;  1CZ9 A;  1JLA A;  4G9Z A;  4LD0 A;  4C1N I;  4LF7 K;  5AQS A;  4PL8 A;  3SJH A;  2RE2 A;  4CD3 A;  4O8K A;  1VQ4 N;  1HYV A;  4MDB A;  4DV2 K;  4Y0W A;  3TAG A;  1NKC A;  3NMU A;  4K41 A;  3MEG A;  5AZJ A;  1NJW A;  4HCC A;  3HM9 A;  4DTM A;  1I39 A;  4L8R B;  2Z1J A;  3CC4 N;  2FLO A;  1LWF A;  5HL7 L;  3OYH A;  4FSV A;  4AM7 A;  3T1A A;  4PUO A;  1EKE A;  3ZLJ A;  4IOC L;  4KTZ A;  4CJ3 A;  5JS2 A;  4K25 A;  2HHH K;  5AQT A;  1TL1 A;  1RT1 A;  1VQ8 N;  3RMD A;  1S22 A;  2WFB A;  4BWM A;  4AHU A;  1OH7 A;  5BN8 A;  3VQ4 A;  5M1P A;  2WTU A;  1K8A O;  4M3R A;  1K9M O;  1GLF O;  1RBS A;  3V6D A;  2F96 A;  3QFP A;  1L5U A;  3TTD A;  4JD2 B;  3I56 N;  1D5A A;  5EX5 A;  5GIN A;  4OKE A;  1HR0 K;  5AQU A;  1VSK A;  1YVU A;  4U7B A;  4FW1 A;  4BY9 C;  3OYI A;  4O5F A;  3PIO L;  3S9H A;  4OPA A;  2HVI A;  4LFB K;  3CCR N;  3AO1 A;  1YVN A;  3M8Q A;  1F21 A;  2QEX N;  2D0B A;  3RR7 A;  4FYD A;  2WOM A;  4QOZ B;  4W5Q A;  3VQC A;  1P90 A;  3AV9 A;  4LH5 A;  4CJE A;  4KPY A;  4DR4 K;  4WQ5 A;  3SMP A;  3MCA B;  4FJH A;  2Y1J A;  2WUS A;  3F9M A;  3SQ0 A;  4IG0 A;  3N4P A;  2XHB A;  3C94 A;  3MX2 A;  4KO0 A;  4CJF A;  4GV9 A;  4U67 L;  4RW6 A;  1LW2 A;  3T1Y K;  1IV0 A;  3K2P A;  1ATS A;  3VEV A;  1HRH A;  1OH6 A;  4A2B A;  5KGX A;  2ZJP L;  1YUW A;  1J9A A;  3NH2 A;  4JRP A;  3ZX2 A;  4CBX A;  2ASM A;  3D6R A;  3G71 N;  2V7Z A;  3V1R A;  3O9R A;  1FKO A;  5AQW A;  3TR8 A;  1YF5 L;  3TAN A;  2X6S A;  3PO5 A;  2HHW A;  4LFA K;  3ENB A;  3KK3 A;  1M90 O;  2NRV A;  4XIU A;  1DTT A;  1ZC6 A;  4FVU A;  1XNQ K;  1TAQ A;  2ITG A;  2QWR A;  1NGH A;  2P9S A;  4O44 A;  4EZ6 A;  1HNI A;  3AVB A;  4H03 B;  4I6M B;  4ZTJ A;  4GVM A;  3HL8 A;  3SBT A;  3SPZ A;  1L3V A;  3WEE B;  3OYN A;  3CIP A;  3LAN A;  3O6W A;  3CYM A;  4BQL A;  3VTI A;  3DYA A;  4B1X B;  1TYQ A;  3HI0 A;  3LP0 A;  4OLB A;  3ID8 A;  1HNW K;  4DR5 K;  1YT3 A;  2PYJ A;  4I2Q A;  3I0S A;  5DM6 L;  3THY A;  2OPQ A;  4FJ7 A;  4F4K A;  3S3M A;  2Q0U A;  3KLI A;  4NB4 A;  2X6N A;  3HPH A;  2E2N A;  4JD2 A;  4EP5 A;  3JXU A;  2VG5 A;  3CQ8 A;  1HJR A;  3SLC A;  4BC3 A;  3THW B;  4K43 A;  2E2Q A;  1NGG A;  1HX1 A;  3JAM O;  4H8K A;  4YOY A;  4O0I A;  4DLG A;  4PWD A;  4DMN A;  4MO4 A;  4CEC A;  1WSI A;  2DY4 A;  3O1W A;  2EX3 A;  2KKZ A;  4B8A B;  3DMJ A;  2CH5 A;  4KH6 A;  4JAX A;  4JKC A;  2O4I A;  5AQQ A;  1IKW A;  3PO4 A;  2E1Z A;  4FJJ A;  1C1A A;  4BRE A;  2QXL A;  3AAP A;  1IBL K;  4CW7 B;  1T7P A;  1XQS C;  4AHS A;  2XO7 A;  4B3M K;  4WQ4 A;  4IDK A;  1C1B A;  2ATQ A;  3CFR A;  3HBT A;  5FPN A;  3CCM N;  3ZYY X;  4A5A A;  5JLH A;  3PIP L;  2QI2 A;  4DF8 A;  5AQZ A;  2BGG A;  5FLX O;  1NMD A;  5ELZ A;  5CZ1 A;  3TAM A;  4B9T A;  4XH5 A;  3FZK A;  3L2R A;  1YJ9 N;  3DLL L;  1NGB A;  2P9K B;  3A8Y A;  1DT9 A;  2NRT A;  3HJF A;  1VAZ A;  2VCP A;  3NHG A;  3VF4 A;  3L2Q A;  3O3G A;  4I7F A;  5BR9 A;  4M7Y A;  4CZH A;  4CIG A;  2NRR A;  4LC9 B;  2HST A;  4CEO A;  4CED A;  3QES A;  2NUB A;  1ZBL A;  2B4J A;  3M1F A;  4B9S A;  3CG7 A;  3NBP A;  1NGD A;  3SCX A;  3GE1 A;  4B08 A;  2HHX A;  1GLB G;  3HSC A;  1VSJ A;  2ZGZ A;  2HOE A;  1J53 A;  3HM8 A;  4RTF D;  4NXM K;  4BRC A;  2O8D A;  3QNN A;  3G6E N;  3H3N O;  1BUP A;  3ENO A;  3QB0 A;  5BR8 K;  2YI1 A;  3WUH A;  4IJA A;  2G8H A;  1GLD G;  2FF6 A;  3VER A;  4DV6 K;  1BWF O;  1YXQ A;  5D3G A;  2ITM A;  3ALY A;  1TKZ A;  3T7Z A;  3CQY A;  3OYB A;  4HVJ A;  3K9J A;  3SAF A;  3SNN A;  4BR5 A;  4DR1 K;  3OYJ A;  4JI2 K;  3TSP A;  5LMN K;  3NH1 A;  3DRS A;  4AIL C;  2QWQ A;  2YNI A;  3LP1 A;  4AHT A;  1T44 A;  4YOU A;  3WNG A;  1JKH A;  4E1N A;  4NYN A;  4DU1 A;  4MLH A;  3IKM A;  1D4X A;  3SJJ A;  3PUF A;  1OH8 A;  4DV7 K;  1T3V A;  3K5M A;  3DXM B;  5FRO A;  2GEL A;  4DTS A;  3KLF A;  1QHT A;  3CPE A;  1XC9 A;  2V51 B;  3BEX A;  3GL1 A;  4E3S A;  3E1Y A;  4LSL A;  3LM2 A;  3KD5 E;  1K73 O;  3O3H A;  4AQY K;  1N8R O;  4DWI A;  1BDG A;  3AVN A;  4FW2 A;  4LFC K;  2P9L B;  4JN4 A;  3AO3 A;  2YCH A;  3B6P A;  1NNE A;  5AQP A;  3SAG A;  3OBY A;  4C8O A;  1VSH A;  4JHD A;  2BUP A;  1BQN A;  4CZL A;  2ZD1 A;  1LWE A;  3EKU A;  1VRT A;  2QM1 A;  3OYL A;  5ADX A;  1KTQ A;  5KPT A;  3FZF A;  4FJL A;  2A6A A;  2IIR A;  4KKO A;  1Z26 A;  1KFD A;  4OLA A;  5KGW A;  4V19 S;  1VQO N;  2X78 A;  2IC3 A;  3TWH A;  2CGK A;  3SYZ A;  4C8K A;  4FOI A;  3DLG A;  4DS4 A;  1LCU A;  1S6P A;  5HRN A;  4FCY A;  1ZBU A;  2PAV A;  3HST B;  4FK2 A;  4OKJ A;  5LMU K;  4FZY A;  3A5O C;  1OVY A;  1WUA A;  3O80 A;  2W6K A;  4NCG A;  5FRM A;  1UOC A;  4KHN A;  4AHR A;  2OPP A;  3ZSZ A;  1Q82 O;  4CER A;  2BTF A;  1NK6 A;  1KXP A;  2O8F B;  1VQK N;  4B3S K;  1VSI A;  1N32 K;  3WXL A;  4R79 A;  1HJO A;  2PZS A;  4RCH A;  3ZSV A;  1WAJ A;  3ZT1 A;  4H5N A;  3J7A P;  3TSQ A;  3CJ7 A;  2G8V A;  4FWN A;  1RBT A;  1EWR A;  1T6D A;  1UAX A;  3TAB A;  3P31 A;  3ASM A;  1T05 A;  1E4F T;  3ATU A;  4H0P A;  2JWK A;  2Q1N A;  4FJM A;  2P9P B;  3A5L C;  3NGZ A;  1XMO K;  1YJN N;  3H1Q A;  4CGH A;  2F9W A;  1KFS A;  2KZZ A;  4AM6 A;  1TUU A;  2KQ2 A;  4QS7 A;  5DK5 A;  2QKK A;  4LF9 K;  2YHB A;  3VA0 A;  1Q9Y A;  1EQY A;  2P9U B;  1VQ9 N;  4MLE A;  5BRE A;  4FZX C;  3G4S N;  3LAM A;  3IAY A;  1BL3 A;  5DMR A;  4CK1 A;  4J2A A;  4IFY A;  1S1X A;  4H4M A;  1NJY A;  1TK0 A;  5GAD P;  5J2P A;  3C65 A;  4BC5 A;  1EWQ A;  4H5T A;  1D9F A;  2A5X A;  4B3R K;  3ZT0 A;  5AQK A;  2YKN A;  4M45 A;  1TGO A;  3V9W A;  3OYD A;  3OS1 A;  1RFQ A;  2O8B A;  5KRS A;  1QTM A;  1KRP A;  4WFB L;  4CHN A;  2P9N B;  4B9V A;  2FSJ A;  1KVA A;  1Q86 O;  1U45 A;  4Y1D A;  4DTP A;  1HNZ K;  4BWJ A;  3U6F A;  3PLA A;  3S3N A;  2GBZ A;  2F7T A;  1XWL A;  3NVM A;  3L6Q A;  3OTO K;  4DF4 A;  3VGK A;  2FF3 B;  3RR8 A;  4I9Q A;  1XMQ K;  1Y64 A;  4BG8 A;  4K8X A;  4JLH A;  3H46 O;  3KIO A;  3CC7 N;  2RPI A;  2R7Y A;  2OCE A;  3V1O A;  1X9J A;  4CES A;  5E41 A;  4DUY K;  4IEI A;  4DCH A;  4C8N A;  2E6L A;  2IVN A;  4FM1 A;  4XH1 A;  4BR7 A;  2GUI A;  2GV9 A;  3U8X A;  1RNH A;  4DTN A;  3I55 N;  4E7H A;  3O3F A;  1C1C A;  4FWP A;  3CM5 A;  2CGL A;  4BR9 A;  4KTQ A;  1XC3 A;  1SL1 A;  1TKX A;  1N36 K;  3PX4 A;  4BGA A;  3O9U A;  4ISG A;  4IEE A;  3QO9 A;  4FJI A;  3KLG A;  3E01 A;  3FE1 A;  2IGI A;  4CI6 A;  1IKV A;  2V52 B;  4O4G A;  1Z25 A;  2IAJ A;  1IBK K;  4DSJ A;  1V4T A;  1NLV A;  2O8D B;  2E8A A;  1R0A A;  4CJ7 A;  1U49 A;  3LDL A;  3QEX A;  2X74 A;  2OZS A;  4KRF A;  2HHU A;  2XY5 A;  2F9T A;  1QZ5 A;  3VQE A;  4CZI A;  1QZ6 A;  2HHQ A;  2ZWH A;  4IO8 A;  4X62 K;  4J2E A;  1EO1 A;  5AFU H;  4DQI A;  2YNF A;  3CJ9 A;  1YJW N;  4BRO A;  4KHY A;  3UE5 A;  4YNQ A;  4RW8 A;  3QEW A;  3DLH A;  2ZE2 A;  3WEE A;  3OBW A;  2W42 A;  1QVG M;  2Z1H A;  3BP8 A;  4X64 K;  2P9P A;  4A61 A;  1TL3 A;  3KTQ A;  1SS6 A;  1N34 K;  1ZBS A;  2AJQ A;  1TV6 A;  3HP9 A;  3V81 A;  2IVO A;  1BI4 A;  3EYZ A;  2E2P A;  4JK9 A;  3H1V X;  4JI4 K;  2WON A;  5BPM A;  4JS4 A;  4DU4 A;  3CI5 A;  3NH0 A;  4M41 A;  4DU3 A;  1ZYQ A;  1RDW X;  4KB0 A;  1DGK N;  2I7P A;  5KPR A;  3CJ1 A;  3J80 O;  4LH4 A;  5I9E B;  5F0X A;  2VWB A;  4ISE A;  1NG9 A;  4JKE A;  3HRG A;  5AQV A;  1KAY A;  1QQM A;  3K5N A;  1RDU A;  5FPD A;  1U2V B;  1VQN N;  2HNY A;  2YHW A;  1HQU A;  4C8L A;  3W0L A;  1ZBI A;  1B9F A;  2HBJ A;  1C0F A;  2UXB K;  4FWK A;  4Z0U A;  3ZET A;  4ZTF A;  3G0Z A;  5M1K A;  3DXK A;  2Q3S A;  1NJI O;  4YHH K;  3MED A;  1I3A A;  4MFB A;  5AZI A;  4J2D A;  2IOC A;  3SMS A;  4BRP A;  3OA9 A;  1DEJ A;  4KHQ A;  3AVI A;  3ULE B;  3RSE B;  1EX4 A;  1RTH A;  2A1R A;  2KW4 A;  4IFE A;  2F4V K;  1EXQ A;  1S1V A;  1RDD A;  4MO5 A;  3KWG A;  3CFP A;  4JI3 K;  2GWJ A;  1FK9 A;  1X9S A;  4H5W A;  4ELV A;  4CK2 A;  4KHU A;  3C6H A;  1JXB A;  3UKR A;  3NVK A;  3LP2 A;  2Q2R A;  3LM9 A;  1XNR K;  4ISF A;  4FJN A;  2VQE K;  1RTJ A;  2VGM A;  4BRN A;  4ELT A;  2YJE A;  4KHP K;  4IBN A;  4BRM A;  2P1J A;  3E9O A;  5AQN A;  1X9M A;  4E0D A;  4M7X A;  2ASO A;  4O55 A;  4CGJ A;  2W41 A;  3C95 A;  5FPE A;  3RMC A;  3AA5 X;  4KBO A;  2KFZ A;  3ATV A;  4FXD A;  2KZM A;  2YHA A;  3P4I A;  4M3Z A;  1HUX A;  5IT9 O;  5BPL A;  3QEP A;  4JI7 K;  3A5N C;  3HP6 A;  1QSS A;  2J4R A;  3HO1 A;  1TVR A;  3CFO A;  3JYT A;  4N56 A;  4CHP A;  3EL2 A;  3OJS A;  5J2N A;  4DFJ A;  1ITG A;  3FFK B;  3U4L A;  3OYM A;  1YHQ N;  1C6V A;  2NLX A;  1RIL A;  4NCA A;  4DG1 A;  5M1F A;  1SQK A;  2UUC K;  1WSE A;  3V1Q A;  4CJP A;  4CF1 A;  3IUC A;  4J2B A;  4DSL A;  1OH5 A;  3MN6 A;  4Z4G A;  5C0Y A;  2RF2 A;  2D0O A;  4YOW A;  4FLW A;  1BI4 B;  1LAV A;  4B8C A;  1SKR A;  4WYB A;  5AFU A;  3SBG A;  1XUP O;  3CME N;  2D0A A;  4DV0 K;  1L3U A;  3NF7 A;  4DR3 K;  3HTV A;  2XRI A;  1XHZ A;  1NGF A;  4WE1 A;  3C7N A;  5B8H A;  3SQ1 A;  3DLK A;  3VEZ A;  1LV5 A;  3FZH A;  2D5R A;  1KVC A;  5HBM A;  2ZF5 O;  5EU7 A;  4FJX A;  3KD1 E;  5AQO A;  1VQM N;  1U2V A;  4DTU A;  4MDA A;  3R8E A;  1NJZ A;  2UXD K;  1IJJ A;  1G15 A;  3O08 A;  4CZK A;  3NAE A;  1XI1 A;  3TAQ A;  3P5J A;  3LAL A;  2XY6 A;  2GX9 A;  3F5T A;  1H1V A;  1X1P A;  2HHV A;  1NK7 A;  1N33 K;  3PX0 A;  1IG9 A;  2ZJR L;  3HPO A;  1X9W A;  1JLE A;  3QET A;  4GMJ B;  2OYQ A;  1WBB A;  4HWI A;  3LDQ A;  2XY7 A;  1O13 A;  1RTI A;  4YY3 K;  4GNI A;  3ZSW A;  5CE3 A;  4FLY A;  4CZJ A;  2QWO A;  2GWK A;  3GDQ A;  4A57 A;  3R6M A;  3VQQ A;  2DTU A;  3B6O A;  4JK7 A;  3D2F A;  2RKI A;  1RT6 A;  2BE2 A;  2Q0R A;  4CBW A;  2E2O A;  3QML A;  5C24 A;  2QKB A;  4IOA L;  1E3M A;  3AO4 A;  3AA2 A;  2FBT A;  2Z1I A;  4HCB A;  3JS6 A;  4E7J A;  3D0P A;  1CXU A;  1BCM A;  3O9Q A;  4I6M A;  2Q36 A;  4CBU A;  1UA0 A;  3O4W A;  3WT0 A;  4CJU A;  4E1J A;  4CZE A;  1NKB A;  5KQD A;  1C0M A;  2DPN A;  3KKR A;  1UWB A;  4GVE A;  4CVN E;  2O4G A;  3CCQ N;  1TYQ B;  4DFM A;  3OYG A;  3Q7C A;  1RDB A;  4E1M A;  4CF2 A;  4I9L A;  4F2S A;  3LDN A;  3ZEU B;  3KK1 A;  3FZM A;  4B9M A;  2D0C A;  4CHO A;  2G8F A;  1JCF A;  3C7N B;  4B3O A;  1K8K A;  4DS5 A;  4PKG A;  1SUQ A;  3O1B A;  2O8C B;  2HNZ A;  4X66 K;  5GAG P;  2O8C A;  3EZ5 A;  5FRN A;  1Z05 A;  4DR6 K;  1EET A;  1U6Z A;  2WC9 A;  5F1X A;  3VES A;  1ATR A;  4FO0 A;  3L2W A;  1BCO A;  1HNV A;  3P1G A;  3E66 A;  4WF9 L;  4F3O A;  1MU2 A;  4CFB A;  3MWP A;  3O8M A;  3TTF A;  4JKD A;  5AQY A;  3ZET B;  4F9O A;  2UUB K;  5MLC Q;  3P38 A;  4RW7 A;  4TSX A;  4AF1 A;  3FFI A;  5BRF A;  4H0V B;  3SK3 A;  5KI6 A;  1VSE A;  3CJC A;  2HBK A;  1WAF A;  2JLE A;  3MEE A;  4B1W B;  3B8A X;  3OJU A;  1IKY A;  2ASP A;  3LDO A;  4CZF A;  3M3Z A;  2A40 A;  2GEM A;  3EEQ A;  4FWS A;  5GIO A;  1KD1 O;  4NXN K;  4BE2 A;  3THX A;  3N4Q A;  4BRQ A;  1KLN A;  3Q7B A;  3SI6 A;  1O1W A;  1ESV A;  2QWM A;  4EIA A;  1IBM K;  3CJA A;  3EN9 A;  1YTA A;  4BC4 A;  3VQ7 A;  4H5R A;  2E20 A;  1WSH A;  3BZK A;  4NCB A;  5I42 A;  1JLB A;  4DHY A;  1TK8 A;  2E6M A;  4CK3 A;  4Z4E A;  3THV A;  4Z4H A;  2FBV A;  4JK8 A;  4B9Q A;  3ITH A;  2IDO A;  3WXI A;  4JKF A;  5AJ3 K;  4F8R A;  1QSL A;  4FVM A;  1GLC G;  3VTH A;  2HW3 A;  3U3G A;  1WBD A;  2OA8 A;  4JI8 K;  1K6Y A;  1VSM A;  1W97 L;  1SAZ A;  3EKS A;  3DLR A;  3MMV A;  4HUG A;  1RT7 A;  1W0H A;  3VN5 A;  1Q7Y O;  4CJQ A;  4IG3 A;  4B9U A;  3T69 A;  3IG1 A;  3NDK A;  3BUZ B;  1CLQ A;  3AA3 A;  4YDU A;  3IFR A;  4WFA L;  3L3V A;  3DOK A;  4PHT X;  1YIT N;  2O8F A;  5JVG L;  2GTD A;  1NGJ A;  4KI6 A;  3TAR A;  5J2M A;  2HVH A;  3NFA A;  1D8Y A;  4RG8 A;  1HKG A;  3QFU A;  1LOT B;  5ADX H;  1HKC A;  1MWK A;  2O8E A;  2FSK A;  1SZ2 A;  2YKM A;  1XHX A;  3H6E A;  4DQS A;  1MWM A;  4CD1 A;  2E88 A;  1NK9 A;  3SPY A;  4OVL A;  1GLL O;  4JEP A;  2VG6 A;  5GIP A;  3D2E B;  4GY2 B;  3SUP A;  2OAN A;  3VF6 A;  2IS3 A;  4CJT A;  1VHX A;  2NRX A;  4KB1 A;  1BHL A;  2CH6 A;  4C8M A;  1JXE A;  4ID1 A;  3M5R A;  3TAP A;  1S1W A;  5HP1 A;  2KFN A;  2HF3 A;  1HKB A;  4QS9 A;  4IXC A;  3PX6 A;  1JLC A;  3MDQ A;  4BVO A;  4BRA A;  3CC2 N;  4XEI A;  3GBT A;  3MN7 A;  4DV4 K;  2IVP A;  5K14 A;  4Q5V A;  3ULD A;  4JHD B;  1NK4 A;  2ZM6 K;  3LWL A;  5M1N A;  3TU5 A;  1C0T A;  4AHC A;  4WFN L;  4RW4 A;  3P83 D;  3RWU A;  3VQ9 A;  1J5O A;  2FSN A;  4N47 A;  4F3T A;  3LZJ A;  4B3T K;  5EVZ A;  2G8W A;  1RT3 A;  4JNE A;  5SWM A;  1BO5 O;  5EXW A;  4JV5 K;  1BU6 O;  3AVL A;  4CEF A;  1NK8 A;  3UB5 A;  3U3Y A;  5JVH L;  2CGJ A;  4A59 A;  4IFV A;  4PKH A;  4OKK A;  5CHI A;  4FM0 A;  1ATN A;  5EOY A;  3DXM A;  4KAZ A;  3H08 A;  2A41 A;  3SUQ A;  3AAR A;  4CFA A;  3VPZ A;  4HHT A;  3D2F B;  3NE6 A;  2HBM A;  3QIP A;  3OYK A;  1VQL N;  1BA1 A;  1ILY A;  5HRP A;  3LAK A;  5CY4 A;  1J6Z A;  3CJB A;  1Q8I A;  4DKW A;  3QEV A;  4CJ5 A;  3KK7 A;  4OO1 J;  3VA3 A;  4QCL A;  3I8B A;  5C15 A;  2AP1 A;  3CCJ N;  4DQR A;  4JI0 K;  3UKR B;  5JLF A;  4A2A A;  3VQP A;  2I7N A;  3ZX0 A;  3IDH A;  4FLX A;  4FWQ A;  1BIU A;  2FBY A;  3KLE A;  3HK2 A;  3SQ2 A;  2DFF A;  3G10 A;  2OPR A;  4B9N A;  5CR4 A;  4FL9 A;  3QER A;  2OTL N;  3BY5 A;  3MWT A;  1JL1 A;  2YJF A;  3K5O A;  2P5O A;  3U9Z A;  1KAX A;  3BZC A;  4M42 A;  1JCG A;  1RCH A;  3QEI A;  2FXU A;  1DLO A;  2P5G A;  1TUY A;  1VK0 A;  4N76 A;  3MEC A;  2A1S A;  3K57 A;  3W3D A;  3C6U A;  1HYS A;  5LJV A;  2E5L K;  1JJ2 M;  1YTU A;  4F2R A;  1NMN A;  1Q81 O;  4FJ9 A;  3CD6 N;  3L8B A;  4Z4F A;  5AQH A;  5TKY A;  3OY9 A;  5LY3 A;  4K42 A;  3OS0 A;  3LDP A;  1HNX K;  1FJG K;  2D4W A;  4B9L A;  2Z1G A;  1ZXO A;  1BIZ A;  3FLC O;  4FJG A;  4IO9 L;  4CGG A;  4CZG A;  4OPJ A;  1B92 A;  3FR0 A;  4PQU A;  3RRG A;  3AAQ A;  4X65 K;  3VEN A;  4JYA K;  1CZA N;  3DXK B;  3ZSX A;  4ELU A;  4DSI A;  4LF5 K;  4Q0B A;  5IWA K;  2YNH A;  4DUZ K;  3DM2 A;  5M1Q A;  4BDY A;  3ZT4 A;  1QQC A;  4DTJ A;  1QSY A;  3CQX A;  4IJN A;  2NRH A;  5CYQ A;  3H45 C;  3QLH A;  2WBN A;  3AO5 A;  3S3O A;  1BA0 A;  2W6L A;  1DKG D;  4CEZ A;  4E7I A;  4IDH A;  5C25 A;  2HHS A;  3L0Q A;  3P39 A;  1SL2 A;  4FLV A;  4CJW A;  1WB9 A;  4CEE A;  3MCP A;  4CGD A;  3EY1 A;  4EHU A;  1SV5 A;  4CE9 A;  1TK5 A;  2G8K A;  1VQ6 N;  1C0U A;  1E4G T;  4JKG B;  1KVB A;  4BRL A;  3IMX A;  4FK4 A;  4K8Z A;  4DSE A;  1NM1 A;  1QQO A;  3AVK A;  1T6C A;  1OVQ A;  4RWT A;  2NRZ A;  2VGN A;  4DQP A;  3DRP A;  4FPB A;  4PY5 A;  3OW2 M;  4JRQ A;  3EO3 A;  4H5V A;  2DFE A;  1QS4 A;  2ETJ A;  3EE9 A;  1WN7 A;  3E9L A;  3AGK A;  4JI5 K;  3WQU A;  4M3U A;  3HXM A;  4BE0 A;  4KHW A;  1RBV A;  3PY8 A;  4FZZ A;  1NGI A;  5KRT A;  4W5T A;  3U9D A;  1NKE A;  1J54 A;  3BF1 A;  4O5B A;  3V4I A;  1W7A A;  4DSF A;  1W9H A;  2YHY A;  3THX B;  5BN9 A;  4UY8 O;  2EWS A;  1RT2 A;  3C6T A;  3MAQ A;  4ILG B;  5SZT A;  2UU9 K;  1YIJ N;  5C2D A;  1IH7 A;  4B1Z A;  3MK6 A;  3RSE A;  3D7E O;  3KKS A;  2A42 A;  4FWL A;  4E7K A;  3VQ8 A;  2G8I A;  1RDA A;  3F73 A;  1U47 A;  1MDU B;  2YNG A;  2P9S B;  3IRX A;  4OGC A;  5HRS A;  5GAE P;  3VQD A;  1KQS M;  3L3U A;  4M3Y A;  1JLF A;  2YHX A;  3FGU A;  4YOR A;  3UKU B;  3MXJ A;  2O8E B;  3HZ6 A;  3QIC A;  3GOI A;  4W5R A;  3TTC A;  3AVF A;  3WQT A;  5CYM A;  1RBR A;  4M3X A;  4UQG A;  2D0P A;  3CCE N;  1L3T A;  3LL3 A;  4DV3 K;  5TKW A;  3KK2 A;  3HT3 A;  4M3T A;  3DWL A;  4CCH A;  4CHZ A;  1VSD A;  3THY B;  1N6Q A;  3JSM A;  3I8D A;  4PL7 A;  1NJX A;  4IOX A;  3OYF A;  3THW A;  4BDP A;  1SL0 A;  4PA1 A;  3ISN C;  3T3F A;  3OVN A;  3L2U A;  3F2K A;  2DFH A;  3KWI A;  4OPH A;  1RT5 A;  4CJR A;  4NO7 A;  3M8P A;  3DLB A;  1TKD A;  1RGI A;  2ZQB A;  1U4B A;  4KFB A;  4DTO A;  3LP3 A;  3EE8 A;  3SAH A;  1KLM A;  2B5J A;  4LY7 A;  3CMA N;  3K9K A;  3TPQ A;  1SKW A;  3AVJ A;  3O4N A;  3VMF B;  1GLE G;  4HTU A;  1JL2 A;  3C0B A;  3RVC A;  5J1E A;  3LPU A;  3VGM A;  1JCE A;  1VSL A;  4NYF A;  3RMA A;  1JLG A;  5EY4 A;  5AR0 A;  4PKI A;  3J7Z O;  4R5P A;  3D2E A;  4H0T B;  1YI2 N;  1TAU A;  3PSF A;  4B1Y B;  2H3G X;  3VF2 A;  2QWL A;  5GAH P;  1HPM A;  3VOV A;  3QIN A;  2BH1 A;  5AQX A;  4CF0 A;  3HPG A;  3A2F A;  5A2Q O;  5J2Q A;  5M1O A;  1NOY A;  2LSN A;  4EHT A;  4BRD A;  4DSK A;  5AQJ A;  1QVF M;  1FW6 A;  5C12 A;  4IZ9 A;  1VQP N;  4BQZ A;  3V9X A;  1GOB A;  4BRG A;  3CM6 A;  5BPN A;  1FKP A;  2VWK A;  5F2R A;  2G8U A;  2RHK A;  1GLA G;  2BAN A;  2VYP A;  4FLU A;  1M1K O;  3QBX A;  4DTR A;  1LAW A;  2JGU A;  1T8E A;  1NGA A;  3CCL N;  4Z4I A;  2AA4 A;  4BR2 A;  1T03 A;  3VQ6 A;  3ZSY A;  1GOA A;  4CIF A;  4CJV A;  4ID5 A;  4K0K K;  3HVT A;  1I94 K;  4XH4 A;  4CFC A;  4CHQ A;  3AVC A;  3QIO A;  3OS2 A;  3ZEU A;  5AQR A;  2Q31 A;  2Q97 A;  2BDP A;  4LF6 K;  2OZM A;  4JKH A;  4EP4 A;  1VQ5 N;  4JKA A;  4DTX A;  1KCF A;  3VEW A;  3AY9 A;  3K0S A;  3DOL A;  3KJV A;  3VQ5 A;  3KZB A;  1RT4 A;  3HYF A;  3VET A;  3WNF A;  2HF4 A;  5HRR A;  2F8T A;  4NLB A;  4YOT A;  1NBW A;  4CHY A;  4FM2 A;  3WXM B;  4KHS A;  5JMV A;  4HUE A;  5LL6 Z;  1BOT O;  1WSF A;  2V7Y A;  4KV8 A;  5BRD A;  4CZM A;  3OYE A;  3R9P A;  3ZSQ A;  2YV0 X;  3G25 A;  3VQA A;  4FLT A;  1GLJ O;  4CJS A;  4B1V A;  3UIQ A;  3LPT A;  3OYA A;  3K59 A;  3HOT A;  2QW9 A;  4JS5 A;  4KH5 A;  1WSJ A;  5DM7 L;  4A62 A;  3TI0 A;  3M6G A;  4FWO A;  5FDL A;  2QA4 N;  4IKF A;  1SKS A;  3NGY A;  3WXK A;  4A5B A;  4C1N K;  2FC0 A;  4BRK A;  3CCS N;  1WLJ A; 
#chains in the Genus database with same CATH homology
 5BPM A;  2HMP A;  2Q0U A;  2CH6 A;  3CI5 A;  5AQG A;  4WQ5 C;  5E84 A;  1IG8 A;  4NB4 A;  4JD2 A;  2E2N A;  3M5R A;  1RDW X;  1K8K B;  3VEX A;  1DGK N;  2I7P A;  2HF3 A;  1HKB A;  3JXU A;  4QS9 A;  4IXC A;  1KAZ A;  5KPR A;  3SLC A;  3CJ1 A;  4FOE A;  4BC3 A;  5I9E B;  3MDQ A;  4K43 A;  2E2Q A;  1NGG A;  2VWB A;  4ISE A;  5F0X A;  1HX1 A;  3HRG A;  4JKE A;  4BVO A;  4YOY A;  4BRA A;  5AQV A;  3OHR A;  3CC2 N;  4XEI A;  3GBT A;  3MN7 A;  4MO4 A;  1KAY A;  1QQM A;  2IVP A;  4BR0 A;  4BR4 A;  1RDU A;  5FPD A;  3O1W A;  1U2V B;  2NZT A;  4JHD B;  4C23 A;  1VQN N;  3ID6 A;  2KKZ A;  5M1N A;  3TU5 A;  4WFN L;  2YHW A;  2CH5 A;  4KH6 A;  4DB3 A;  4JAX A;  4JKC A;  1MA9 B;  5AQQ A;  2FSN A;  3W0L A;  2E1Z A;  2HBJ A;  1C0F A;  3E9P A;  4BRE A;  4FWK A;  2QXL A;  3AAP A;  5EVZ A;  5AQM A;  1XQS C;  4JNE A;  3ZET A;  1BO5 O;  5EXW A;  1BU6 O;  5M1K A;  4WQ4 A;  3DXK A;  2OTJ N;  3UB5 A;  5JVH L;  1NJI O;  2CGJ A;  4A59 A;  3HBT A;  4PKH A;  5FPN A;  3CCM N;  3ZYY X;  4A5A A;  5CHI A;  3QBW A;  1ATN A;  5EOY A;  3DXM A;  5JLH A;  2A41 A;  5AZI A;  3PIP L;  2QI2 A;  2E1Y A;  4JKB A;  3AAR A;  5AQZ A;  3VPZ A;  1NMD A;  3CHW A;  5H1S Q;  3D2F B;  1BG3 A;  1NGC A;  5ELZ A;  4XH5 A;  2HBM A;  4QS8 A;  3FZK A;  3SMS A;  4BRP A;  1YJ9 N;  3OA9 A;  1DEJ A;  3DLL L;  1VQL N;  1NGB A;  1BA1 A;  3ULE B;  2P9K B;  3A8Y A;  1DT9 A;  2NRT A;  3L4Q A;  4BRF A;  1VAZ A;  2VCP A;  1ILY A;  3ULE A;  3RSE B;  5C2F A;  1J6Z A;  3CJB A;  3VF4 A;  1HLU A;  4IFE A;  4DKW A;  4MO5 A;  3KWG A;  1OKJ A;  4UY8 O;  2GWJ A;  2PBD A;  3KK7 A;  4NLC A;  5BR9 A;  4OO1 J;  4H5W A;  4M7Y A;  3I8B A;  4CZH A;  2AP1 A;  5C15 A;  3CCJ N;  3CET A;  3C6H A;  2NRR A;  5AQI A;  4LC9 B;  3UKR B;  2HST A;  5JLF A;  4A2A A;  5AQL A;  3UKR A;  2I7N A;  3ZX0 A;  3NVK A;  4ILJ A;  3IDH A;  4FWQ A;  2Q2R A;  3LM9 A;  3M1F A;  3CXC M;  4ISF A;  3FZL A;  3O5B A;  2VGM A;  4BRN A;  1NGD A;  2YJE A;  4FPA A;  5CR4 A;  3GE1 A;  4BRM A;  3E9O A;  4FL9 A;  1GLB G;  5AQN A;  1KC8 O;  2OTL N;  4ILH A;  2A3Z A;  4BRH A;  1X3M A;  3MWT A;  2NRW A;  4M7X A;  3HSC A;  3VGL A;  2ASO A;  2YJF A;  5KPZ A;  1Z6R A;  3U9Z A;  2ZGZ A;  4YDU C;  2HOE A;  1KAX A;  1C0G A;  3HM8 A;  2W41 A;  3QDK A;  5FPE A;  4O8U A;  1JCG A;  4RTF D;  4BRC A;  4KBO A;  3ATV A;  2FXU A;  4GV6 A;  1WOQ A;  1TUY A;  3G6E N;  3R1X A;  3P4I A;  3ZX3 A;  2P9I B;  3W3D A;  3H3N O;  1S72 N;  1HUX A;  1BUP A;  3ENO A;  3QB0 A;  5BPL A;  5LJV A;  5JIC A;  2YI1 A;  1JJ2 M;  3WUH A;  4IJA A;  2HBL A;  3A5N C;  1GLD G;  2FF6 A;  3VER A;  2J4R A;  1Q81 O;  3CD6 N;  1BWF O;  1YXQ A;  5AQH A;  1NGE A;  5TKY A;  4H0O A;  4K42 A;  5LY3 A;  2ITM A;  4KH4 A;  3T7Z A;  3CQY A;  2ZJQ L;  3LDP A;  3DAW A;  2D4W A;  3K9J A;  3SAF A;  3FLC O;  1ZXO A;  4L3Q A;  2ZGY A;  4BC2 A;  4BR5 A;  1X3N A;  4IO9 L;  3EL2 A;  3TSP A;  3R3L A;  4CZG A;  2QWQ A;  3FFK B;  1G99 A;  5AZJ B;  3U4L A;  1YHQ N;  3VEO A;  2NLX A;  1T44 A;  4YOU A;  3CER A;  5M1F A;  1SQK A;  2UYT A;  3FR0 A;  2QTD A;  4HTL A;  3AAQ A;  1S3X A;  4FWR A;  3MX5 A;  3L4I A;  3VEN A;  4MLH A;  5BRH A;  3UKU A;  3IKM A;  3IUC A;  1CZA N;  3DXK B;  1D4X A;  3MN6 A;  5C0Y A;  4EAH D;  1T3V A;  5M1Q A;  2D0O A;  4YOW A;  3CF5 L;  1VQ7 N;  4EFH A;  3DXM B;  4BVP A;  5HOO A;  2GEL A;  3CQX A;  4Z94 A;  4IJN A;  2NRH A;  3CPE A;  4J8F A;  2V51 B;  4WYB A;  3BEX A;  3GL1 A;  3H45 C;  3E1Y A;  2WBN A;  5AFU A;  3LM2 A;  3DJC A;  1P8Z A;  3SBG A;  1W2B M;  1YAG A;  1K73 O;  1XUP O;  3CCU N;  1N8R O;  4FWM A;  1BDG A;  3CME N;  1BA0 A;  3HTV A;  2P9L B;  1DKG D;  2P9K A;  4IDH A;  2P9U A;  1NGF A;  2P9L A;  3L0Q A;  3P39 A;  3C7N A;  5B8H A;  5AQF A;  4JN4 A;  3VEZ A;  3S41 A;  3FZH A;  3MN9 A;  2YCH A;  3H3O B;  3I33 A;  3MCP A;  5AQP A;  3SAG A;  3OBY A;  2ZF5 O;  4EHU A;  5AQO A;  4JKG A;  1VQM N;  1VQ6 N;  1V4S A;  1U2V A;  4JHD A;  1E4G T;  4JKG B;  4MDA A;  3EZW A;  4GV3 A;  4BRL A;  3IMX A;  2BUP A;  3R8E A;  4WCE L;  2GUP A;  1IJJ A;  3O08 A;  1NM1 A;  4CZL A;  4CZK A;  1QQO A;  1T6C A;  4RWT A;  2D1K A;  2NRZ A;  2VGN A;  4FPB A;  2GX9 A;  3EKU A;  3F5T A;  1H1V A;  2QM1 A;  5ADX A;  3OW2 M;  5KPT A;  3EO3 A;  2QWP A;  3FZF A;  4H5V A;  2A6A A;  2IIR A;  2ZJR L;  2P9N A;  4YOV A;  3EE9 A;  1VQO N;  2CGK A;  4HWI A;  4BRI A;  3E9L A;  3AGK A;  4FOI A;  3WQU A;  1LCU A;  3LDQ A;  3O9S A;  1NGI A;  1O13 A;  4WQ4 C;  5LJW A;  3U9D A;  2PAV A;  4GNI A;  1R59 O;  5CE3 A;  4CZJ A;  2QWO A;  2GWK A;  3A5O C;  3BF1 A;  5AZI B;  1OVY A;  3GDQ A;  1WUA A;  4A57 A;  3R6M A;  3J8A A;  3O80 A;  4JK7 A;  3A5M C;  3D2F A;  2YHY A;  2Q0R A;  3BF3 A;  5BN9 A;  2EWS A;  4B1U B;  4CBW A;  2E2O A;  2KHO A;  2PFU A;  3ENH A;  4IWV A;  5KQ8 A;  3HOS A;  3CCV N;  2JWL A;  4ILG B;  3TSU A;  3QML A;  1Q82 O;  1YIJ N;  5C2D A;  4B1Z A;  3MK6 A;  3RSE A;  4IOA L;  2BTF A;  3D7E O;  2A42 A;  1KXP A;  4FWL A;  1VQK N;  3KVG A;  3O9T A;  3JS6 A;  2YX6 A;  1MDU B;  4M63 C;  2P9S B;  3WXL A;  4R79 A;  3CPW M;  5GAE P;  4YOX A;  1HJO A;  1KQS M;  3O9Q A;  4I6M A;  4RCH A;  2Q36 A;  3KHY A;  4CBU A;  3O4W A;  2YHX A;  1NWK A;  3FGU A;  4YOR A;  3WT0 A;  2W40 A;  4H5N A;  4E1J A;  2KLA A;  1QHA A;  4CZE A;  4DQ8 A;  2DPN A;  3TSQ A;  3CJ7 A;  5KQD A;  3UKU B;  4FWN A;  4H0X B;  1Q18 A;  1T6D A;  4GVE A;  5FPM A;  3P31 A;  2NNW A;  3HZ6 A;  1E4F T;  3CCQ N;  3QIC A;  3GOI A;  1TYQ B;  3ATU A;  4H0P A;  3C6A A;  3TTC A;  1QQN A;  2JWK A;  2Q1N A;  3Q7C A;  2P9P B;  4BG9 A;  3A5L C;  3WQT A;  3WXJ A;  5E26 A;  1YJN N;  3H1Q A;  2D0P A;  3A0I X;  3CCE N;  3LL3 A;  2F9W A;  5TKW A;  3LDN A;  3DWL A;  3AGR A;  5C10 A;  3VEY A;  4AM6 A;  3ZEU B;  1TUU A;  4QS7 A;  4H0Y B;  3FZM A;  2P9I A;  3MN5 A;  1EQY A;  2P9U B;  4PL7 A;  1VQ9 N;  1JCF A;  4MLE A;  5BRE A;  3C7N B;  4IOX A;  3G4S N;  1K8K A;  3GG4 A;  4BGB A;  4PKG A;  2QWN A;  3O1B A;  4G9Z A;  3F2K A;  3KWI A;  4OPH A;  4C1N I;  5GAG P;  5AQS A;  4NO7 A;  4PL8 A;  3SJH A;  2RE2 A;  4CD3 A;  4O8K A;  1Z05 A;  5GAD P;  1VQ4 N;  4MDB A;  1U6Z A;  2WC9 A;  3C65 A;  5F1X A;  4BC5 A;  4Y0W A;  4H5T A;  3NMU A;  4K41 A;  1ATR A;  1RGI A;  3VES A;  4FO0 A;  2A5X A;  5AZJ A;  5AQK A;  3EE8 A;  3SAH A;  3E66 A;  4WF9 L;  1RFQ A;  3CMA N;  3CC4 N;  2FLO A;  3K9K A;  3MWP A;  3O8M A;  3TPQ A;  4JKD A;  5AQY A;  3TTF A;  3ZET B;  5HL7 L;  4WFB L;  3VMF B;  1GLE G;  2P9N B;  4FSV A;  2FSJ A;  4AM7 A;  4F9O A;  5MLC Q;  3C0B A;  3P38 A;  4AF1 A;  5BRF A;  3RVC A;  1Q86 O;  3VGM A;  4H0V B;  3SK3 A;  4IOC L;  1JCE A;  4K25 A;  3CJC A;  5AQT A;  2HBK A;  3PLA A;  1VQ8 N;  5EY4 A;  1S22 A;  5AR0 A;  2F7T A;  2WFB A;  4B1W B;  4PKI A;  3B8A X;  3J7Z O;  3NVM A;  3L6Q A;  5BN8 A;  3D2E A;  2ASP A;  5M1P A;  4H0T B;  3LDO A;  2FF3 B;  3VGK A;  4CZF A;  1YI2 N;  1K8A O;  3M3Z A;  2GEM A;  2A40 A;  2H3G X;  1GLF O;  4FWS A;  3VF2 A;  4B1Y B;  5GIO A;  1KD1 O;  1K9M O;  3N4Q A;  1Y64 A;  2QWL A;  3QFP A;  4BG8 A;  4BRQ A;  5GAH P;  1HPM A;  3VOV A;  3TTD A;  3H46 O;  2BH1 A;  5AQX A;  4JD2 B;  3I56 N;  5EX5 A;  3CC7 N;  5GIN A;  5M1O A;  3Q7B A;  1ESV A;  2QWM A;  4EIA A;  1X9J A;  4EHT A;  5AQU A;  4BRD A;  3CJA A;  3EN9 A;  5AQJ A;  4U7B A;  4BC4 A;  4IEI A;  4H5R A;  4DCH A;  2E20 A;  4BY9 C;  1QVF M;  2IVN A;  5C12 A;  4O5F A;  4XH1 A;  4BR7 A;  4IZ9 A;  3PIO L;  4OPA A;  1VQP N;  3CCR N;  4BQZ A;  4DHY A;  3U8X A;  4BRG A;  1YVN A;  5BPN A;  2QEX N;  3I55 N;  4JK8 A;  4B9Q A;  5F2R A;  3WXI A;  4JKF A;  2RHK A;  1GLA G;  2VYP A;  1P90 A;  1M1K O;  3QBX A;  4FWP A;  4WQ5 A;  2CGL A;  3SMP A;  4BR9 A;  1XC3 A;  3MCA B;  1NGA A;  1GLC G;  3VTH A;  3CCL N;  2WUS A;  3F9M A;  4BGA A;  3O9U A;  4ISG A;  4IEE A;  3N4P A;  1W97 L;  1SAZ A;  3EKS A;  2AA4 A;  3MX2 A;  4GV9 A;  4U67 L;  3MMV A;  4BR2 A;  3FE1 A;  4CI6 A;  1ATS A;  2V52 B;  4XH4 A;  3VEV A;  1Q7Y O;  3ZEU A;  5AQR A;  4A2B A;  1V4T A;  2Q31 A;  1NLV A;  2Q97 A;  2E8A A;  2ZJP L;  4CJ7 A;  1YUW A;  3LDL A;  4JKH A;  3T69 A;  1VQ5 N;  4JKA A;  3VEW A;  3AY9 A;  3ZX2 A;  3BUZ B;  4CBX A;  2ASM A;  2F9T A;  3D6R A;  2V7Z A;  3G71 N;  3O9R A;  4YDU A;  1QZ5 A;  3KZB A;  3IFR A;  5AQW A;  3VET A;  4WFA L;  2HF4 A;  4CZI A;  1YF5 L;  4NLB A;  1QZ6 A;  3ENB A;  4YOT A;  1M90 O;  1NBW A;  4PHT X;  2NRV A;  2ZWH A;  1YIT N;  1ZC6 A;  5JVG L;  4IO8 A;  3WXM B;  2GTD A;  1NGJ A;  4FVU A;  5JMV A;  2QWR A;  1EO1 A;  5AFU H;  1BOT O;  1NGH A;  2P9S A;  2V7Y A;  4H03 B;  3CJ9 A;  4I6M B;  1YJW N;  5BRD A;  4BRO A;  4CZM A;  3UE5 A;  1HKG A;  3R9P A;  3QFU A;  1LOT B;  3WEE A;  3SBT A;  5ADX H;  3G25 A;  1HKC A;  1MWK A;  3OBW A;  2FSK A;  3WEE B;  1SZ2 A;  1GLJ O;  3CIP A;  1QVG M;  3O6W A;  3BP8 A;  3H6E A;  4B1V A;  2P9P A;  4BQL A;  3VTI A;  4A61 A;  1MWM A;  3HOT A;  2QW9 A;  4CD1 A;  2E88 A;  4KH5 A;  1TYQ A;  1SS6 A;  4B1X B;  4A62 A;  5DM7 L;  1ZBS A;  3M6G A;  3HI0 A;  4FWO A;  1GLL O;  4JEP A;  3ID8 A;  2QA4 N;  5GIP A;  3D2E B;  2IVO A;  4GY2 B;  3WXK A;  2E2P A;  2OAN A;  3VF6 A;  4A5B A;  4C1N K;  5DM6 L;  4BRK A;  3CCS N;  4JK9 A;  3H1V X;  2NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...