3IFRA

The crystal structure of xylulose kinase from rhodospirillum rubrum
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
492
structure length
488
Chain Sequence
RQVIGLDIGTTSTIAILVRLPDTVVAVASRPTTLSSPHPGWAEEDPAQWWDNARAVLAELKTTAGESDWRPGGICVTGMLPAVVLLDDRGAVLRPSIQQSDGRCGDEVAELRAEVDSEAFLARTGNGVTQQLVTAKLRWIERHEPAVFGAIATVCGSYDYINMLLTGERVVDRNWALEGGFIDLASGTVEADLVALAHIPPSAVPPAHPTHRVLGAVTAEAAALTGLPTGLPVYGGAADHIASALAAGITRPGDVLLKFGGAGDIIVASATAKSDPRLYLDYHLVPGLYAPNGCMAATGSALNWLAKLLAPEAGEAAHAQLDALAAEVPAGADGLVCLPYFLGEKDPFASGTFTGLSLSHTRGHLWRALLEAVALAFRHHVAVLDDIGHAPQRFFASDGGTRSRVWMGIMADVLQRPVQLLANPLGSAVGAAWVAAIGGGDDLGWDDVTALVRTGEKITPDPAKAEVYDRLYRDFSALYATLHPFFHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Carbohydrate kinase, FGGY
publication title The crystal structure of xylulose kinase from Rhodospirillum rubrum
rcsb
source organism Rhodospirillum rubrum
total genus 144
structure length 488
sequence length 492
chains with identical sequence B
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA02
3AY9A 2H3GX 1LCUA 4FWLA 4B1WB 4H5NA 1RGIA 4BGAA 2P9KB 4IJNA 4B1ZA 3BEXA 1KAXA 2CH5A 3M1FA 1C0GA 1DKGD 3I33A 2Q1NA 3WEEA 5AQHA 5AQMA 3DJCA 2IIRA 4I6MB 5EX5A 2W41A 3A8YA 1TYQB 4DHYA 3ULEA 3AAPA 4CD3A 3LM9A 1GLJO 5AQPA 4EFHA 4RTFD 3SLCA 1BWFO 3HI0A 3FGUA 1MDUB 3S41A 3WXKA 5EOYA 3CJ7A 4FWQA 4QS7A 1GLCG 1RDWX 5AR0A 2EWSA 3U4LA 3R9PA 4BVPA 3O1WA 3WT0A 1QZ6A 3ZX2A 3MN5A 3SMPA 2GEMA 3MN9A 2D0OA 5AZJB 2QWRA 4BQZA 3W3DA 3H1QA 3IDHA 5F1XA 2A3ZA 1ESVA 2QWLA 4CZIA 5JICA 2P9LA 4A62A 1C0FA 4CZEA 4NO7A 3A5MC 2ZGYA 2AP1A 2FSNA 3MN7A 2QW9A 3FZFA 1Z05A 3FE1A 1HLUA 4BROA 2FSKA 3WXLA 4CBUA 1GLBG 4H0OA 1JCFA 2E1YA 1BA0A 5FPDA 5AQYA 1MA9B 3RSEB 1XQSC 3HZ6A 2AA4A 3UKUB 3M3ZA 1NGEA 5AFUA 3U9DA 5AQSA 1KAZA 1HUXA 3KHYA 3VEXA 3DXMB 3GDQA 3WXIA 5AQXA 4M7YA 1XC3A 3G25A 3ID8A 4IO8A 3HTVA 1SZ2A 1U2VB 1T6CA 3EO3A 4DCHA 5LY3A 3ZEUB 3O8MA 3QMLA 3VEYA 2P9NA 2YHXA 1X9JA 1HJOA 3DXKA 4YDUA 3C0BA 3VGMA 5KPRA 1ATNA 1BDGA 1GLFO 1S22A 4FPBA 1YXQA 2P9UB 4BQLA 3EN9A 4FWRA 1ATRA 3UB5A 4K41A 3CIPA 2DPNA 2OANA 3J8AA 5AQUA 4XH5A 2GWJA 2ASPA 3ZETB 4A2AA 5I9EB 5ADXA 4JD2A 1E4FT 1EQYA 4CZHA 2E1ZA 3FR0A 2KHOA 4BRKA 2FXUA 4AM7A 4BRGA 1HKGA 3C7NB 1IG8A 2P9PA 4XH4A 4BR5A 3CHWA 3LDNA 3ZX0A 5KQ8A 3H3OB 3MMVA 2E8AA 2IVPA 2QWNA 4K43A 2YJEA 1NM1A 2D1KA 5AQQA 5E84A 5AQLA 3VGLA 3ATVA 2QM1A 3CETA 1NGCA 4MO4A 2P9IB 2CH6A 4EAHD 5KPTA 4PKHA 5AQRA 4JHDA 4FWPA 3BF3A 2QWQA 1RFQA 4FOIA 4M63C 3VF2A 4BRNA 4EHTA 4IWVA 2F9TA 4FL9A 3UKRA 5EVZA 3IUCA 3CI5A 3FLCO 3VEOA 1JCGA 1JCEA 3GBTA 4CZJA 2Q97A 1SAZA 1QQOA 1DGKN 1S3XA 4FOEA 2ASMA 2P9SA 2Q2RA 5E26A 2CGJA 5FPMA 1E4GT 3CERA 4WQ5C 4H03B 4H0VB 5ELZA 3L4IA 4BR0A 1BU6O 4FWOA 2E2PA 3D2FB 3AAQA 1TUYA 1NGDA 1Z6RA 1NGHA 3H46O 5AQJA 5AQFA 3D2EB 3O5BA 3W0LA 4BGBA 3WUHA 5BPMA 2YHWA 4PL7A 1KAYA 3VENA 2E20A 3UE5A 1GLDG 2HOEA 3OHRA 4GY2B 1KXPA 3A5NC 4WQ4A 2QWMA 4Z94A 1X3NA 5BN8A 3EKSA 1K8KB 3EKUA 3MDQA 2I7PA 4FWSA 5FPEA 4FPAA 3H6EA 4MLHA 3VEWA 5JLFA 2YI1A 4B1XB 2PAVA 4RWTA 2W40A 1BUPA 4IXCA 3VESA 3MCPA 4CI6A 5AZIB 5JMVA 2FF6A 3MN6A 3O08A 1QQNA 4BRIA 2GTDA 4PKIA 1NLVA 4H0YB 3VPZA 3WQTA 5AQTA 4MO5A 3SMSA 5AFUH 1NGBA 5EY4A 2FF3B 2P9KA 1MWMA 2HF3A 2A6AA 1CZAN 1QQMA 3CQXA 1TUUA 2QWOA 3LL3A 4BREA 4O5FA 4K42A 2UYTA 1XUPO 3IFRA 4JNEA 4BG8A 1NGFA 3AARA 2BTFA 3IMXA 2E2OA 3M6GA 4GNIA 4I6MA 3SJHA 4F9OA 5JLHA 1TYQA 3QFUA 5TKYA 1R59O 3WEEB 5BPNA 4BC2A 3EL2A 3FZKA 4WYBA 1X3MA 4CJ7A 4DQ8A 5BREA 2V7ZA 5FPNA 4EIAA 1LOTB 1V4TA 3ULEB 1P8ZA 4IZ9A 1QHAA 4BVOA 2QXLA 2F9WA 3L0QA 3CQYA 1YAGA 4BR7A 3I8BA 1BA1A 4WQ4C 3QBWA 1HX1A 4RCHA 2ZF5O 1ZXOA 5AQIA 3VF4A 1WUAA 2D0PA 2E88A 3WQUA 3VERA 3R6MA 1NGAA 1HKCA 4E1JA 1HKBA 5EXWA 4H5RA 5LJWA 2V7YA 3A0IX 3L6QA 5BN9A 2VYPA 4FWMA 4B1UB 5ADXH 4CZFA 2BUPA 4BRPA 1H1VA 4H5WA 3B8AX 4JN4A 2Q31A 3KZBA 2P9LB 3O1BA 5BRFA 2HMPA 3RSEA 4CZMA 4BRAA 1D4XA 3UKUA 2CGLA 4BRMA 4PL8A 4LC9B 2VCPA 1V4SA 4PKGA 3VF6A 5AQKA 3DXMA 4YDUC 4BR9A 2VWBA 5LJVA 3O6WA 1HPMA 1U2VA 4BR4A 1DEJA 2YCHA 2ZWHA 3A5LC 3SK3A 4C23A 1Y64A 3ZEUA 1J6ZA 3JXUA 3O80A 2ASOA 1IJJA 4IJAA 2A42A 5AQWA 4BRLA 1MWKA 5CE3A 4A61A 2IVOA 2GWKA 3D7EO 2D4WA 3JS6A 3HM8A 2Q36A 1NWKA 2P9NB 2P9UA 3LDQA 1OKJA 3ZX3A 4BRCA 3A5OC 3DXKB 4Y0WA 1ZC6A 3LDLA 5BR9A 3TPQA 3ATUA 3ENOA 5KPZA 5BRHA 4FWNA 4H5TA 3FZMA 3GL1A 3DWLA 3ZETA 4J8FA 3VGKA 4B1YB 4BC5A 3EZWA 1ZBSA 2FLOA 4O8KA 4HTLA 2GUPA 4BC4A 1BG3A 5F0XA 5BRDA 3KVGA 4KBOA 1ATSA 4BRFA 3WXJA 3FZHA 4CZLA 1SQKA 3C7NA 3QB0A 3HBTA 4QS9A 1QZ5A 1BOTO 4JD2B 1NGIA 4BR2A 5BPLA 2E2QA 3CJAA 5AQVA 3R8EA 2Q0UA 4QS8A 2P9PB 4H0TB 4ISEA 4NB4A 5AQNA 3VOVA 2V51B 4CZGA 4FO0A 2P9IA 4CBXA 3QICA 3CJCA 4K25A 3HSCA 4B9QA 2J4RA 1G99A 2V52B 3TU5A 4EHUA 2GELA 2IVNA 4FWKA 3GOIA 2WUSA 4BC3A 3LDOA 4DB3A 4CBWA 1BO5O 4XH1A 3H3NO 5KQDA 4JHDB 3GE1A 1GLLO 3QFPA 3ENHA 3CJBA 3QDKA 2CGKA 2FSJA 4CD1A 3FZLA 3UKRB 3U8XA 2QWPA 2A40A 3FFKB 4BRDA 1WOQA 3GG4A 2YHYA 3CJ9A 3VETA 4BG9A 1NGGA 1GLAG 4BRHA 3VEVA 2E2NA 4H0PA 2A5XA 3MK6A 2P9SB 4ISFA 3D2FA 1YVNA 5AQZA 1Q18A 2ITMA 2A41A 3O4WA 2ZGZA 2NLXA 3D2EA 5B8HA 4XEIA 5AZJA 1NGJA 5AQOA 2HF4A 4AM6A 4L3QA 1T44A 3DAWA 3LDPA 3LM2A 3U9ZA 2NRHA 1GLEG 3P4IA 4FSVA 2Q0RA 3CJ1A 3H1VX 3H45C 3QBXA 3BUZB 4H5VA 4M7XA 4WQ5A 4A2BA 1T6DA 3F9MA 1K8KA 4JAXA 4B1VA 1NBWA 2PBDA 2NZTA 4HWIA 4CZKA 3VEZA 5AZIA 3BF1A 1YUWA 4H0XB 5AQGA 4MLEA 1NMDA 2I7NA 4BRQA 5F2RA 2YJFA 4ISGA 3BP8A 1U6ZA
chains in the Genus database with same CATH superfamily
2D0CA 2H3GX 3DOKA 3OY9A 2XO7A 4B1WB 3ASMA 4K8XA 2HMIA 4H5NA 5KGXA 3PSFA 4BGAA 4FLXA 3K57A 2CH5A 4DFPA 4CHNA 4CGJA 3CM6A 1WAFA 3EYZA 3DJCA 2IIRA 4I6MB 2W41A 1TYQB 2NUBA 4DHYA 2VG5A 3ULEA 4J2EA 5FROA 3AA2A 1UWBA 4CD3A 1D9FA 1GLJO 3VMFB 2HB5A 2KW4A 3G10A 3FGUA 3CC2N 3CJ7A 3R3LA 4QS7A 3OYGA 2YKMA 1ILYA 2NRTA 1NG9A 3E01A 3KK1A 4FM2A 4XIUA 4KHSA 1Q82O 3TI0A 3MX5A 1X9SA 2GEMA 3IKMA 1VSHA 3TAFA 5F1XA 4CZIA 3OYLA 1XMQK 3K5NA 1C0FA 1NK9A 3A5MC 2AP1A 3U6FA 4IEIA 1QSYA 3KD1E 4L8RB 1WSIA 3FZFA 4CBUA 1UAXA 1VQ7N 2E1YA 3QEWA 1YJ9N 3RSEB 4B3OA 4N56A 4OGCA 2FBVA 1RCHA 3I56N 5AQSA 2Y1IA 1GOBA 1DTQA 3VEXA 3GDQA 5AQXA 4IO8A 1TK0A 4DV4K 1SZ2A 4HVJA 3TAPA 2P5GA 3EO3A 4DSEA 2VG7A 5LY3A 3NF9A 2NRVA 2QEXN 1BI4B 2OPRA 4JS4A 5M1FA 4J2DA 2YHXA 3KTQA 4FK0A 4FJ7A 1HJOA 2HHSA 1TKXA 3NGIA 1ATNA 4OO1J 1S22A 1J5OA 3J7YP 4DF4A 3I0RA 2DY4A 3EN9A 1ATRA 1I39A 3CIPA 4XH5A 4DG1A 5JS1A 3F9KA 3AVNA 4A2AA 4M3XA 4DTOA 5ADXA 1XI1A 1RT6A 2F96A 1X9WA 3NF7A 4Z4HA 3HOTA 4BE2A 2KHOA 4BRKA 4BRGA 3VQBA 4JEPA 3CHWA 4KKOA 3EE9A 3MMVA 1XC9A 2QWNA 1WLJA 2NRRA 1Q9XA 5E84A 4OPKA 3VGLA 4DV3K 3WNGA 2QM1A 1VQ6N 4M3TA 1JLCA 4C8NA 1VRTA 4RW6A 4DUYK 3DYAA 2HVHA 5AQRA 3J81O 4M42A 4DV2K 1NKBA 2OZSA 1RFQA 4M63C 4EHTA 5C10A 4M45A 4FJLA 2F9TA 2YV0X 2XHBA 3IUCA 3QEXA 3FLCO 2W6KA 4JI6K 3ITHA 2Q97A 1SAZA 3DRRA 1E3MA 4FJHA 4M3RA 4GVEA 2Q2RA 5E26A 4W5QA 4OVLA 4LH4A 3SI6A 4FJ8A 4CJUA 4FW1A 1BU6O 2E4LA 3VQ7A 3AAQA 1NGDA 4KAZA 5AQJA 3D2EB 4E89A 4CF9A 5HRPA 5GAHP 3NF8A 3SNNA 3CCLN 2F8TA 1FXXA 5HBMA 2E20A 3PO4A 4PHTX 3OHRA 1TGOA 1YF5L 1KXPA 2X6SA 3PO5A 1C1CA 3EKSA 1HYSA 4FPAA 3H6EA 4MLHA 1GOCA 4YOVA 4DQPA 4FW2A 2PAVA 2W40A 3HP6A 4YHHK 4PWDA 2DTUA 3MN6A 3QESA 4ZTJA 4PA1A 4PKIA 1VSLA 3JYTA 5AQTA 1S1XA 4KTQA 1NGBA 3ZSWA 2P9KA 2HVIA 2HF3A 1JXBA 1CZAN 3SV4A 2QWOA 3VA0A 2W6LA 1BQMA 4KHQA 1NGFA 1VSFA 3D0PA 1UA1A 4OPAA 5JLHA 4GKJK 3VQQA 4K0KK 3MWPA 3SUPA 3M5RA 3OYAA 3K9KA 2IDOA 1LOTB 1V4TA 3ULEB 2EX3A 1P8ZA 5HL7L 1BQNA 1WBDA 4GW6A 4IG3A 4WFAL 3HOSA 3CCVN 4BDZA 1UOCA 3QETA 4BR7A 3I8BA 1BA1A 1VSEA 4DQRA 3TTDA 1SL0A 4KFBA 3VQ9A 5AQIA 3AV9A 3LZIA 2NRZA 1RBRA 2E88A 2OPPA 1BCOA 4JI1K 1OVYA 4DF8A 4JYAK 3OYBA 1IKYA 1I94K 4E1JA 4LFBK 5LJWA 1QSSA 4B1UB 4FWMA 5ADXH 3G71N 4CZFA 2BUPA 4BRPA 4DSIA 3H08A 3NHGA 1BIUA 2HMPA 4JI8K 4MDBA 4DKWA 3ZLJA 1BISA 2Z1HA 1D4XA 4BRMA 1HYVA 4PL8A 4CEEA 4GMJB 4BDPA 1KD1O 1V4SA 4PKGA 3WXMB 5AQKA 4YDUC 4BR9A 5LJVA 2NRXA 3O6WA 3SQ4A 4CEAA 1U2VA 1W9HA 1YHQN 2UU9K 2HHXA 3DLBA 2F8SA 2GV9A 4CJVA 4E3SA 3ZEUA 1A5VA 4B3TK 3O80A 4JK9A 2ASOA 1IJJA 5M1PA 2A42A 3TTCA 5CE3A 2IVOA 2GWKA 3LP3A 3K5OA 3VQ6A 2Q36A 2QK9A 5C0YA 1NWKA 3LDQA 2FBXA 2A1RA 4E7IA 3ZX3A 1Z26A 2Z1JA 1XNQK 3A5OC 3RR7A 3RRGA 2YNFA 3AO5A 2RPIA 4HCBA 4FK2A 3VN5A 5BRHA 2W42A 4DU3A 5KI6A 4CIGA 1Z25A 3FZMA 3OVNA 4YFUA 4FJXA 3ZETA 1ZBFA 1ZBSA 2O8EA 2GUPA 2WOMA 4QCLA 4DR2K 3J7AP 5BRDA 3MXJA 1ATSA 3ZCMA 3C7NA 3CCQN 3QB0A 3PLAA 4KHPK 4BR2A 4FJMA 3V1OA 1J53A 3CJAA 4DSLA 5AQVA 3ZT1A 3LPUA 1K73O 4CHZA 4QS8A 4H0TB 4ISEA 3CFOA 1UA0A 4JKDA 4NB4A 4OLBA 4CZGA 3V6DA 4HUFA 4B9QA 1ASUA 2J4RA 4V19S 2V52B 3QLHA 4EHUA 2IVNA 4FWKA 3HK2A 3LDOA 4DB3A 1QTMA 5SWMA 1VSIA 5SZTA 3ENHA 4CGDA 3CJBA 1HMVA 5DK5A 3QDKA 4CD1A 3DLKA 3U8XA 3U3GA 2QWPA 4KTZA 4NCBA 2A40A 3FFKB 3NFAA 1W97L 3I55N 3CJ9A 4BRHA 1NGGA 4PY5A 4JI2K 1C1BA 1TL3A 2E2NA 1JLQA 2A5XA 4E1MA 4DFMA 1N33K 3NAEA 4LF9K 4DV1K 3KK3A 1SL1A 4XEIA 3L2UA 4KHWA 2YNIA 3DAWA 3ZSOA 2ZD1A 2HHWA 4FSVA 2Q0RA 3QBXA 4H5VA 1T6DA 3DI6A 3C6AA 1WSEA 1S1VA 2F7TA 1TKZA 2NZTA 5AJ3K 1YITN 1JLEA 1QS4A 4NYNA 2O4GA 5AZIA 3QEIA 1DTTA 3AVKA 1EO1A 4DV7K 2G8IA 1BHLA 1LW2A 5DM6L 3LWLA 4WF9L 4JI3K 3ISNC 3AY9A 4JKAA 1EP4A 2P9KB 4IJNA 4BY9C 1KAXA 4KI4A 4OJRA 1DKGD 3E9OA 4AQYK 5HRRA 5AQHA 1T05A 3A8YA 5JS2A 2B6AA 3QERA 5LMNK 2Y1JA 4RTFD 3SLCA 4DTXA 4O55A 3KLHA 5TKWA 3S41A 3ZSXA 4YNQA 3THVA 1KSPA 1GLCG 1RDAA 1EX4A 5FRNA 3CG7A 3SQ1A 3AVCA 3U4LA 3R9PA 3PX6A 3LALA 3O1WA 2BDPA 4UY8O 3WT0A 1QZ6A 3O3FA 2DFHA 2YNGA 4Y1CA 2D0OA 3W3DA 2VQFK 3H1QA 3IDHA 4LF6K 2QWLA 4QAGA 3L2QA 5JICA 4KH4A 4CZEA 3VTHA 1FKPA 2QW9A 1Z05A 4BROA 1CLQA 1L3UA 2G8FA 2FSKA 3N4QA 1BA0A 5FPDA 2YKNA 2AA4A 4IDKA 2VG6A 3M3ZA 1VQON 4FLUA 1RDDA 3QIOA 1HUXA 4AHVA 3PV8A 4KHYA 1RNHA 3WXIA 3ID8A 3SAGA 1GOAA 4C1NK 4HUEA 1U2VB 4O0JA 3RTVA 1RTDA 4DTRA 4U7BA 3AO4A 1HPZA 3ZEUB 4IG0A 4CECA 3QMLA 1Y97A 1ZBUA 4LF8K 2HNZA 3VGMA 2FBYA 5KPRA 3MEEA 4HHTA 4CJKA 4FPBA 4KH5A 4BQLA 1L3SA 2OANA 3J8AA 2GWJA 4DQIA 3VQAA 3ZETB 3UIQA 5I9EB 2B4JA 2O8EB 1S6PA 3ZSVA 1VK0A 4GKKK 4YOUA 4CZHA 4KHUA 4ID1A 4W5NA 2FXUA 3SBTA 4AM7A 3V9SA 3C7NB 1IG8A 2P9PA 1QSLA 2O8DA 5KQ8A 1TK5A 4C8LA 4RW4A 4K43A 1JL2A 2YJEA 2D1KA 5AQQA 5AQLA 1RDBA 3ATVA 1NGCA 2FBTA 4CK1A 2X6NA 3VQ4A 1U4BA 4CERA 1RT4A 4JHDA 1C0TA 4FWPA 5CZ2A 3C94A 4CIFA 4FOIA 3IRXA 4DR1K 4BRNA 3JAMO 4IWVA 3HL8A 3UKRA 3VQEA 1F21A 2XY5A 4BWJA 1JCGA 1LWEA 4X65K 2P5OA 1XMOK 3VQ5A 3GBTA 3JSMA 4FLYA 3HXMA 4HCCA 1DGKN 3KK2A 1S3XA 3ZSZA 4FOEA 2KFNA 4LH5A 3SAHA 1E4GT 3OA9A 4WQ5C 4LF5K 3QNOA 1C1AA 3VTIA 3L4IA 4BR0A 1TUYA 1Z6RA 4IOCL 1NGHA 4CGIA 4WFBL 4CGFA 1NOZA 4DU1A 3W0LA 2O8FA 1DLOA 3NGYA 4YY3K 3WUHA 1FK9A 1SKSA 5BPMA 4PL7A 1TVRA 3VENA 3UE5A 2KZZA 4DV5K 4CGHA 1YTUA 3A5NC 3V9XA 4Z94A 4IFYA 1S1UA 4AH9A 5BN8A 4CEZA 3EKUA 3MDQA 4CFBA 4FWSA 3VEWA 4RWTA 2YI1A 1NJZA 3VESA 1WSFA 4O5BA 2NNWA 5AZIB 2FF6A 4BRIA 3O08A 1QQNA 4ILHA 1C0UA 1IBKK 4MO5A 4DTUA 1QE1A 1D8YA 1IBMK 1MWMA 2IS3A 4OPJA 4Z4GA 4BREA 4IBNA 4CW7B 1LV5A 4NCAA 4Z0UA 3S3MA 1XUPO 3IFRA 3V1RA 4HUGA 3HPGA 1Q86O 3IMXA 3SJHA 2HW3A 4F9OA 1NK8A 3O9QA 3QFUA 4FLVA 3V81A 2VGMA 3DLLL 5TKYA 5FLXO 3NVMA 4BC2A 2QA4N 4BDYA 4EZ9A 3TSUA 2Q3SA 2KLAA 1LAVA 5FPNA 5C25A 4DR5K 1JLGA 4Y1DA 5DM7L 1Q81O 1VSKA 1QHAA 1J54A 3ZSYA 1T3VA 3VF4A 2D0PA 4JRPA 3AA5X 3CCEN 3WQUA 3E9LA 3KWGA 3TAQA 2QKBA 4AHRA 2UUAK 4H5RA 2V7YA 3A0IX 5BN9A 2VYPA 1NNEA 4F2SA 4AILC 1H1VA 3PSIA 4R79A 2VWJA 4H5WA 1XHZA 3B8AX 3AVIA 3KZBA 5BRFA 3L3VA 3CYMA 3TWHA 3UKUA 1RBVA 5JVGL 2ZQBA 3P5JA 5CR4A 3VF6A 1SUQA 4H4MA 3QIPA 4BR4A 4AHTA 1DEJA 2YCHA 3A5LC 4C23A 3ZYYX 4DFJA 4F4KA 1J6ZA 1SS6A 1SL2A 3M8QA 2D5RA 4IJAA 5AQWA 4B8AB 4BRLA 1B9FA 3AO2A 4JI5K 2IC3A 1OKJA 1VQ4N 4Y0WA 4CJPA 1JLBA 1ZC6A 3TPQA 3ENOA 3OS1A 4QOZB 5KPZA 5M1KA 2F4VK 4JKHA 3DWLA 1ZBIA 3K5LA 4CJTA 3SPZA 3C65A 2FLOA 4HTLA 3U3YA 3TAMA 1BG3A 2WC9A 2HHTA 3KVGA 4KBOA 3WXJA 4CZLA 4LF4K 3M8PA 1N8RO 1QQCA 3P1GA 4B9UA 3L8BA 2D0BA 4PUOA 2IGIA 2WBNA 2P9PB 4DTSA 2O8DB 4CF0A 4CBXA 2HHQA 1YJWN 5HP1A 1CZBA 3KKSA 4CIEA 2GELA 5C12A 5A2QO 1HNVA 1DT9A 5HOOA 3CMEN 2OYQA 1BO5O 3H3NO 4JHDB 3GE1A 1IBLK 1GLLO 5CYQA 4LD0A 3KLEA 4CJEA 4B9NA 2FSJA 3UKRB 5MLCQ 4DLGA 3C6UA 1MU2A 2YHYA 1VQ9N 4DQQA 1NJWA 4BG9A 4H0PA 3MK6A 3RWUA 1YVNA 4ILGB 2ZGZA 4N47A 4OX9K 2RF2A 1XNRK 5HRNA 3SAFA 1WNSA 2HBLA 4OKKA 1T03A 4IKFA 4FJ9A 3AA3A 3LM2A 3U9ZA 4NXMK 1GLEG 2O8FB 3P4IA 3WNFA 3DRPA 1RBTA 3H1VX 3HJFA 3F9MA 3O3GA 1K8KA 4DU4A 4JAXA 4B1VA 3RMAA 2O8CB 2PBDA 4A5AA 2OA8A 1KFDA 5I3UA 3BGRA 3L3UA 3RMDA 2YNHA 5AQGA 3C6TA 5IT9O 3QEPA 1C6VA 5CY4A 2I7NA 1JJ2M 4BRQA 3OYJA 3NMUA 2VGNA 4ISGA 1BGXT 1U6ZA 4F2RA 4YORA 4FWLA 4CVNE 3MX2A 5E41A 1L3TA 5HRSA 1RTIA 1RGIA 4JI7K 4B1ZA 3BEXA 3HRGA 4DV0K 2G8WA 3AGRA 4DSJA 4YOWA 3M1FA 1C0GA 3I33A 2Q1NA 4CJRA 1EWRA 1SKWA 1TAUA 4MQ3A 4DUZK 1CZ9A 3OYCA 3AVBA 3LM9A 1LWCA 4EFHA 3CFRA 3HI0A 3K5MA 1R0AA 1MDUB 2HNYA 4FLTA 5EOYA 3HVTA 4JKGA 4FWQA 1S1TA 4JKEA 1VSJA 4WE1A 4BVPA 4FM1A 4I9QA 3E1YA 4CF8A 4FZZA 4G9ZA 2O8BA 5AZJB 3AVGA 2QWRA 4BQZA 3LAMA 1K8AO 2A3ZA 1ESVA 3PIOL 4JI4K 2P9LA 1LAWA 4LF7K 2ZGYA 1WSHA 2FSNA 4E1NA 2BH1A 3WXLA 4N76A 3L2WA 1GLBG 1M1KO 4W5OA 2JWLA 2UXCK 1XQSC 1U48A 4FZXC 3CCMN 3UKUB 5C24A 5FDLA 5AFUA 4LY7A 3B6PA 4CK3A 5CZ1A 1KAZA 3KHYA 4CEBA 1OH5A 1S9GA 3OBYA 4M7YA 1XC3A 1T6CA 3S9HA 3OJUA 1N36K 3KJVA 1VQMN 4NLCA 1D5AA 4Q5VA 4Q0BA 1TK8A 2OTLN 3O8MA 4I2PA 2OTJN 2QTDA 3AA4A 1G15A 3RMBA 2JLEA 3MCAB 3DXKA 2VQEK 3C0BA 3J7ZO 1BDGA 1HYZA 1GLFO 4JLHA 1QHTA 5H1SQ 4W5TA 3TAGA 1VQKN 4FWRA 3UB5A 1KFSA 3EE8A 3LP1A 1KLMA 3HSTB 3SUOA 2ASPA 4CJWA 3RVCA 4YOYA 3AO3A 1S5JA 2E1ZA 3FR0A 1HNIA 4CJFA 1ZYQA 4ICLA 3E66A 4O0IA 1HKGA 3LDNA 2AJQA 2E8AA 3AGKA 2IVPA 2G8HA 3BZCA 2UUCK 3TAEA 1SV5A 2ZJPL 4C8OA 2FC0A 4CHYA 3L2VA 4MO4A 4Z4IA 5KPTA 4CJLA 4JV5K 4DTNA 4PKHA 3IS9A 5BR8K 3V9WA 2NRWA 4F8RA 2QWQA 3VF2A 4C8KA 1W0HA 4TSXA 2RHKA 3CPWM 4R5PA 1KVBA 5EVZA 4FLWA 3BY5A 3THYA 3IAYA 1JKHA 1WB9A 4GVMA 4CJ4A 1VSMA 3OYNA 3T1YK 3K59A 2G8KA 1WN7A 4AHCA 3OYHA 3F5TA 4H0VB 5ELZA 4IFEA 3P83D 4FWOA 2E2PA 4OPHA 1HJRA 4LSNA 4DQSA 3K9JA 3O5BA 5AQFA 2HHHK 4BGBA 4DV6K 3J80O 5M1OA 1YIJN 4B8CA 1K9MO 1KAYA 4CK2A 5I42A 1HNXK 2OZMA 1GLDG 2HOEA 4WQ4A 2QWMA 4JS5A 1K8KB 3I0SA 2I7PA 5D3GA 1IV0A 2ZE2A 1VQPN 4FYDA 5JLFA 2IAJA 1NJIO 4B1XB 3TR8A 3AVJA 4E7LA 1O13A 4UQGA 4M3YA 1N5YA 3KLGA 1NLVA 4H0YB 4CEFA 1IKVA 4A59A 5AFUH 4KV8A 5EY4A 5GADP 4JKBA 2FF3B 1NKEA 2OCEA 2O4IA 3MEGA 5KTQA 1U49A 1IH7A 4CEQA 2YX6A 1TUUA 3HP9A 4O5FA 1TV6A 1VQ5N 2UYTA 2HHUA 4CE9A 5C42A 4CEOA 4JNEA 3NF6A 4BG8A 3AARA 1VQ8N 3LDSA 4GNIA 5K14A 3LP2A 5GAEP 3SQ0A 5M1NA 1RT5A 4E0DA 4U67L 1R59O 2P1JA 3TABA 3EL2A 3FZKA 3TTFA 1X3MA 4BE1A 1CXQA 2V7ZA 1YT3A 3WNHA 3OW2M 1IG9A 3KLFA 3CXCM 3V4IA 2QXLA 3I8DA 2F9WA 3L0QA 3CD6N 3CQYA 1YAGA 1IKXA 4WQ4C 3QBWA 1HX1A 2ZF5O 4JKGB 2PY5A 3V9UA 4GV9A 4CHOA 3VA3A 3VERA 3R6MA 3K0SA 1NGAA 4FXDA 3O9RA 1RTHA 3HPOA 1HKBA 3THWA 3L6QA 3QINA 1S72N 2O8BB 3DOLA 4JN4A 3P38A 2P9LB 3T1HK 2R7YA 1KVCA 3O1BA 1FKOA 1J9AA 1QVFM 4EP4A 3NDKA 3V1QA 4LFCK 2CGLA 1T7PA 4DFKA 1ASVA 1S9EA 2E6MA 4CFAA 4LC9B 1NK4A 1XWLA 4F3OA 2VCPA 1VHXA 4FJ5A 2Z1IA 3DXMA 3OYMA 4LFAK 1HPMA 4AHUA 1NK6A 2ZWHA 4J2BA 2XY6A 1Y64A 3EEQA 1RT1A 1RILA 1KVAA 2QKKA 4CESA 3VQ8A 4MDAA 1MWKA 4OGEA 4A61A 3JS6A 1W2BM 4IO9L 3CC4N 5J1EA 3AVLA 2P9UA 4BRCA 1KC8O 3DXKB 4JI0K 3S3OA 4F3TA 3LDLA 5BR9A 5J2NA 4H4OA 3QEVA 4KREA 4H5TA 3OTOK 3MECA 3GL1A 1IKWA 3VGKA 1N34K 4B1YB 4OLAA 4BC5A 4W5RA 3EZWA 2O8CA 4O8KA 3S3NA 1TKDA 3FZHA 1Q9YA 4Z4EA 1WBBA 3HBTA 4QS9A 1OH8A 1Q7YO 2E2QA 3SUNA 3R8EA 1OH6A 4CHQA 1KCFA 5EU7A 3OS0A 3K2PA 5AQNA 3VOVA 4FO0A 2P9IA 1X9MA 3CJCA 3HSCA 4CJQA 4YOTA 3P31A 1HRHA 3NH0A 1FJGK 4WCEL 4FJIA 4CBWA 3B6OA 2ITGA 3D6RA 5KQDA 1KLNA 3SQ2A 3QFPA 3A2FA 3KK7A 4JK7A 3HPHA 1OH7A 2CGKA 2QI2A 3FZLA 1KQSM 4KO0A 3DM2A 3THYB 3GG4A 1XHXA 3M8RA 3VETA 3TANA 4X64K 2HHVA 3AVFA 3PY8A 3D2FA 2ZM6K 1W7AA 5AQZA 1Q18A 2ITMA 3P39A 3THXA 2BE2A 4FCYA 4KPYA 3DLRA 5B8HA 3EY1A 1U47A 4WFNL 5AZJA 4O4GA 1NGJA 4Z4FA 3Q7CA 3O9SA 4FVMA 4AM6A 3NVKA 4E7KA 1T44A 4KHNA 3LDPA 1L3VA 3SYZA 4B9TA 2EHGA 3H45C 4A2BA 5LMUK 2GX9A 4EZ6A 1NBWA 3RR8A 4HWIA 3NH2A 5GAGP 4CZKA 4DSKA 3KKRA 4FJJA 3OYFA 1YUWA 5J2PA 4DR4K 3LANA 2YJFA 2E6LA 4FVUA 4B3RK 2XY8A 1EXQA 3L4QA 2KQ2A 1LCUA 4M41A 4CEDA 1U45A 1KTQA 4I9LA 3M8SA 3ZT3A 1HNZK 3PIPL 3ULDA 5JVHL 3CFPA 3MEDA 3WEEA 1T8EA 2OPSA 5AQMA 5EX5A 4LSLA 5GIPA 3AAPA 3BDPA 4IEEA 5AQPA 2ETJA 4RW9A 4CJSA 1TAQA 3CQ8A 1BWFO 3CCRN 4GV6A 3WXKA 2Z1GA 1VRUA 4M3ZA 2KZMA 1RDWX 5AR0A 2PFUA 2EWSA 4NXNK 2RN2A 4CHPA 1YI2N 3C95A 3ZX2A 4B08A 2LSNA 3AVAA 3MN5A 3SMPA 3MN9A 4CGGA 2HBKA 3KLIA 4OKEA 3VQCA 3THWB 4A62A 4NO7A 2KFZA 3AVMA 3MN7A 5C2DA 3FE1A 1HLUA 5C2FA 1NU0A 3NBPA 4H0OA 1JCFA 4M3WA 3T69A 5AQYA 4KB0A 1MA9B 1VQLN 3G0ZA 4Z4CA 3HZ6A 1EETA 1WAJA 4JRQA 5HLFA 3CCUN 4G1QA 3T19A 1NGEA 5CHIA 3U9DA 5KGWA 1BIZA 3O4QA 3DXMB 1NJYA 1IO2A 3G25A 1QVGM 3KWIA 3HTVA 1A5WA 4DCHA 3OYKA 4DR3K 4FM0A 1B92A 3VEYA 3ZT2A 2P9NA 4A5BA 4HTUA 2YHAA 2WFBA 3T3FA 1X9JA 4YDUA 3G4SN 1HR0K 1YXQA 2P9UB 1HQUA 4C8MA 5T7BA 4CJ5A 4FJKA 4K41A 4MFBA 2DPNA 3PX0A 5AQUA 3K58A 1U04A 1NJXA 2I5JA 1VAZA 4RW8A 2QXFA 4E7HA 1P90A 1EWQA 4JD2A 1E4FT 1EQYA 2WTUA 4B9SA 4KB1A 4N5SA 2HSTA 4I2QA 4KI6A 3FFIA 4CF1A 1Q8IA 5GIOA 1REVA 4XH4A 4BR5A 3ZX0A 4DS5A 3H3OB 3HT3A 3MXMA 2XY7A 4IFVA 4KRFA 1NM1A 3LP0A 3CETA 3SBGA 2VWKA 3CMAN 2P9IB 2CH6A 4EAHD 4FJNA 3ID6A 1ZBLA 1K6YA 3KD5E 2UXDK 3BF3A 1M90O 3HVRA 3R1XA 1WSJA 4FL9A 2PYLA 3CI5A 3VEOA 2E5LK 1JCEA 1N6QA 3SJJA 4CZJA 3SZ2A 3AO1A 1JLFA 5DMRA 1EKEA 1QQOA 1NOYA 2X78A 1L5UA 2ASMA 2P9SA 2CGJA 5FPMA 3CERA 4DR7K 3QNNA 4H03B 4FLZA 3DLEA 3SPYA 5M1QA 5C15A 3D2FB 4I7FA 3LZJA 4O8UA 3SUQA 3HYFA 3THXB 3OJSA 1X1PA 2G8UA 3H46O 2WONA 4RG8A 3TSQA 3OYDA 4JKFA 1NK0A 1RBUA 2YHWA 4B9MA 1I3AA 4GY2B 1ASWA 4KH6A 3NGZA 1J5EK 3NE6A 1X3NA 3RRHA 3AVHA 4BWMA 2ZJQL 3DLHA 5FPEA 4B3MK 1BUPA 4IXCA 3MCPA 1VSDA 3ENBA 4CI6A 1WSGA 1LWFA 5JMVA 3CCSN 2GTDA 3F73A 1NK7A 4O44A 3DMJA 3VPZA 3WQTA 2GBZA 3SMSA 3EZ5A 2IOCA 3TSPA 3CCJN 1S6QA 3OS2A 3QO9A 4X62K 3LAKA 2A6AA 4DTJA 1QQMA 3CQXA 3LL3A 2OPQA 4K42A 3SCXA 3LWMA 2BTFA 5J2MA 4JKCA 4ELTA 4I6MA 2E2OA 3M6GA 4H8KA 1TYQA 3WEEB 5BPNA 1YTAA 1KRPA 4FZYA 2PYJA 4WYBA 4CJ7A 4DQ8A 5BREA 4DWIA 4EIAA 3F2KA 4B9VA 4IZ9A 4BVOA 4ELUA 2RKIA 3IG1A 4JK8A 3NCIA 1S1WA 3G6EN 4RCHA 4CFDA 1ZXOA 3ALYA 4DR6K 1WUAA 4CF2A 4CCHA 2G8VA 1RDCA 1HQEA 1RDUA 1NK5A 3KIOA 1HKCA 4BE0A 5EXWA 3MWTA 3MXIA 3VQPA 4EP5A 3CC7N 2Q31A 3ZSRA 3PUFA 1D9DA 2UXBK 1CXUA 5GINA 2BANA 3O9TA 3RSEA 3OYEA 4DTMA 4CZMA 4BRAA 2DFFA 1BL3A 1TKTA 1NKCA 1JLAA 3O4NA 4YOXA 2VWBA 4FK4A 2KKZA 4PQUA 2B5JA 4X66K 3SK3A 1HNWK 4M3UA 3ZT0A 3CF5L 3CPEA 4E19A 1BI4A 3JXUA 4RW7A 5J2QA 4A57A 4CFCA 1O1WA 3D7EO 2D4WA 4DMNA 2P51A 3HM8A 3T1AA 2P9NB 4AHSA 3D45A 4IOXA 4ILJA 1FW6A 5CYMA 3LPTA 1YVUA 3CM5A 3ATUA 1RTJA 4IDHA 4DSFA 4FWNA 4NLBA 1B9DA 4NYFA 2KTQA 4OKJA 2ZJRL 1A5XA 2A1SA 4J8FA 3SV3A 3Q7BA 1JXEA 1N32K 4BC4A 1RT7A 5F0XA 4BRFA 4K8ZA 2DFEA 2RE2A 5KRTA 1SQKA 3ZSQA 1QZ5A 1BCMA 1BOTO 1NGIA 4JD2B 5BPLA 5KRSA 4J2AA 2HBMA 3HM9A 4B3SK 3OYIA 2Q0UA 2D0AA 3E9PA 1TL1A 2V51B 3QICA 4K25A 4ID5A 1G99A 2BGGA 3TU5A 3GOIA 2WUSA 4CJ3A 4BC3A 2YHBA 3ZT4A 1NMNA 2UUBK 1ZBHA 4XH1A 2HBJA 3O3HA 2HNDA 4ELVA 4IOAL 5IWAK 3VQDA 4DTPA 1OVQA 3DLGA 2JGUA 4KTWA 4BRDA 1WOQA 3MAQA 4BACA 2JWKA 3L2RA 2X74A 1YJNN 4AF1A 1GLAG 1RT2A 3VEVA 4GV3A 4N41A 4NCGA 3NH1A 2ATQA 2PZSA 4FJGA 4ZHRA 1LW0A 1RT3A 2P9SB 3OBWA 4ISFA 3PX4A 4DS4A 4B9LA 4ZTFA 5FRMA 2A41A 3O4WA 4DLEA 2XRIA 2NLXA 1C0MA 3O9UA 3D2EA 4C1NI 1ITGA 3V9ZA 5AQOA 2HF4A 3HO1A 4L3QA 2NRHA 3CJ1A 4M7XA 3BUZB 4WQ5A 3BZKA 3DRSA 3WNEA 5HROA 1SKRA 3T7ZA 3C6HA 3TARA 1JL1A 2GUIA 3VEZA 3BF1A 3RMCA 4H0XB 4E7JA 4MLEA 1NMDA 5LL6Z 1RBSA 5F2RA 1VQNN 3N4PA 3BP8A
chains in the Genus database with same CATH topology
4WF9L 4YORA 3L4QA 3AY9A 2H3GX 1LCUA 4FWLA 4B1WB 3MX2A 4H5NA 4JKAA 1RGIA 4BGAA 2P9KB 4IJNA 4B1ZA 3BEXA 3HRGA 4BY9C 3PIPL 1KAXA 3AGRA 2CH5A 4YOWA 3M1FA 5JVHL 1C0GA 1DKGD 3I33A 2Q1NA 3WEEA 3E9OA 5AQHA 5AQMA 3DJCA 2IIRA 4I6MB 5EX5A 2W41A 3A8YA 1TYQB 4DHYA 5GIPA 3ULEA 3AAPA 4CD3A 3LM9A 4IEEA 1GLJO 5AQPA 3VMFB 4EFHA 4RTFD 3SLCA 1BWFO 3HI0A 3CCRN 3FGUA 1MDUB 3CC2N 5TKWA 3S41A 4GV6A 3WXKA 5EOYA 4JKGA 3CJ7A 4FWQA 3R3LA 4QS7A 1GLCG 1RDWX 2NRTA 2PFUA 2EWSA 4JKEA 5AR0A 1ILYA 3U4LA 3R9PA 4BVPA 3O1WA 4UY8O 3WT0A 1YI2N 3E1YA 1QZ6A 3ZX2A 1Q82O 3MN5A 3MX5A 3SMPA 2GEMA 3MN9A 2D0OA 4G9ZA 3IKMA 2HBKA 5AZJB 2QWRA 4BQZA 3W3DA 3H1QA 3IDHA 5F1XA 1K8AO 2A3ZA 1ESVA 3PIOL 2QWLA 4CZIA 5JICA 2P9LA 4A62A 1C0FA 4KH4A 4NO7A 3A5MC 3VTHA 2ZGYA 2AP1A 4CZEA 4IEIA 2FSNA 3MN7A 2QW9A 3FZFA 5C2DA 1Z05A 3FE1A 1HLUA 4BROA 2BH1A 5C2FA 2FSKA 3WXLA 4CBUA 3N4QA 1GLBG 4H0OA 1VQ7N 1JCFA 2E1YA 1BA0A 5FPDA 3T69A 1M1KO 5AQYA 1MA9B 2JWLA 3RSEB 1YJ9N 1XQSC 1VQLN 3HZ6A 2AA4A 3CCMN 3UKUB 3M3ZA 3CCUN 1VQON 1NJIO 1NGEA 5AFUA 5CHIA 3I56N 3U9DA 5AQSA 1KAZA 1HUXA 3KHYA 3VEXA 3DXMB 3GDQA 3WXIA 5AQXA 3OBYA 4M7YA 1XC3A 3G25A 3ID8A 3SAGA 4IO8A 1QVGM 3KWIA 4C1NK 3HTVA 1SZ2A 1U2VB 1T6CA 3EO3A 4DCHA 5LY3A 2NRVA 4U7BA 4NLCA 1VQMN 2QEXN 3ZEUB 2OTLN 3O8MA 3QMLA 3VEYA 2P9NA 2QTDA 4A5BA 2OTJN 5M1FA 2WFBA 2YHXA 3MCAB 1X9JA 1HJOA 3DXKA 4YDUA 3C0BA 3VGMA 5KPRA 3J7ZO 1ATNA 1BDGA 4OO1J 1GLFO 3G4SN 1S22A 4FPBA 1YXQA 2P9UB 4KH5A 3EN9A 4BQLA 5H1SQ 1VQKN 4FWRA 1ATRA 3UB5A 3EE8A 4K41A 3CIPA 2DPNA 2OANA 3J8AA 5AQUA 4XH5A 2GWJA 2ASPA 1VAZA 3RVCA 3ZETB 4A2AA 5I9EB 1P90A 4YOUA 4YOYA 5ADXA 4JD2A 1E4FT 1EQYA 4CZHA 2E1ZA 3FR0A 3HOTA 2KHOA 4BRKA 2HSTA 2FXUA 3SBTA 3E66A 4AM7A 4BRGA 1HKGA 3C7NB 1IG8A 2P9PA 4XH4A 4BR5A 5GIOA 4JEPA 3CHWA 3LDNA 3ZX0A 5KQ8A 3EE9A 3H3OB 3MMVA 2E8AA 3AGKA 2IVPA 2QWNA 4K43A 2YJEA 1NM1A 2D1KA 5AQQA 2ZJPL 2NRRA 5E84A 5AQLA 3VGLA 3ATVA 1VQ6N 2QM1A 3CETA 1NGCA 3SBGA 4MO4A 3CMAN 2P9IB 2CH6A 4EAHD 5KPTA 4PKHA 3ID6A 5AQRA 4JHDA 2NRWA 4FWPA 3BF3A 1M90O 2QWQA 1RFQA 4FOIA 4M63C 3VF2A 4BRNA 4EHTA 5C10A 2RHKA 3CPWM 4IWVA 3R1XA 2F9TA 4FL9A 3UKRA 5EVZA 3IUCA 3CI5A 3FLCO 3VEOA 1JCGA 1JCEA 3GBTA 4CZJA 2Q97A 1SAZA 1QQOA 1DGKN 1S3XA 4FOEA 4GVEA 2ASMA 2P9SA 2Q2RA 5E26A 2CGJA 5FPMA 1E4GT 3OA9A 3CERA 3F5TA 4WQ5C 4H03B 3SAHA 4H0VB 5ELZA 4IFEA 5M1QA 3VTIA 3L4IA 4BR0A 5C15A 1BU6O 4FWOA 2E2PA 3D2FB 4OPHA 3AAQA 1TUYA 1NGDA 1Z6RA 4IOCL 1NGHA 4O8UA 3H46O 5AQJA 3K9JA 3D2EB 3O5BA 5AQFA 4WFBL 3W0LA 4BGBA 3TSQA 5M1OA 5GAHP 3WUHA 4JKFA 1YIJN 5BPMA 3CCLN 2YHWA 4PL7A 1KAYA 3VENA 2E20A 1K9MO 3UE5A 1GLDG 4PHTX 2HOEA 3OHRA 4GY2B 4KH6A 1YF5L 1KXPA 3A5NC 4WQ4A 2QWMA 4Z94A 1X3NA 5BN8A 3EKSA 1K8KB 3EKUA 3MDQA 2I7PA 2ZJQL 4FWSA 5FPEA 1VQPN 4FPAA 3H6EA 4MLHA 3VEWA 5JLFA 2YI1A 4B1XB 2PAVA 4RWTA 2W40A 4YOVA 1BUPA 4IXCA 3VESA 3MCPA 3ENBA 4CI6A 1O13A 2NNWA 5AZIB 5JMVA 2FF6A 3MN6A 3O08A 1QQNA 4BRIA 3CCSN 2GTDA 4PKIA 4ILHA 1NLVA 4H0YB 3VPZA 3WQTA 5AQTA 4MO5A 3SMSA 4A59A 3TSPA 5AFUH 3CCJN 1NGBA 5EY4A 5GADP 4JKBA 2FF3B 2P9KA 1MWMA 2HF3A 2A6AA 1CZAN 1QQMA 2YX6A 1TUUA 2QWOA 3CQXA 3LL3A 4O5FA 4BREA 4K42A 1VQ5N 2UYTA 1XUPO 3IFRA 4JNEA 4BG8A 1NGFA 3AARA 1VQ8N 2BTFA 4OPAA 4JKCA 1Q86O 3IMXA 2E2OA 3M6GA 4GNIA 4I6MA 3SJHA 5GAEP 3O9QA 1TYQA 3QFUA 4F9OA 5JLHA 5M1NA 2VGMA 3DLLL 3MWPA 5TKYA 4U67L 1R59O 3WEEB 5BPNA 3NVMA 4BC2A 2QA4N 3EL2A 3FZKA 3TTFA 3M5RA 3TSUA 2KLAA 4WYBA 1X3MA 4CJ7A 4DQ8A 3K9KA 5BREA 2V7ZA 5FPNA 4EIAA 1LOTB 1V4TA 3F2KA 3ULEB 1P8ZA 5HL7L 5DM7L 4IZ9A 3CXCM 3OW2M 1Q81O 1QHAA 4BVOA 2QXLA 4WFAL 3HOSA 3CCVN 2F9WA 3L0QA 3CD6N 3CQYA 1YAGA 4JK8A 4BR7A 3I8BA 1BA1A 4WQ4C 3G6EN 3QBWA 1HX1A 4RCHA 3TTDA 2ZF5O 1ZXOA 4JKGB 1T3VA 5AQIA 3VF4A 2NRZA 1WUAA 2D0PA 2E88A 4GV9A 3CCEN 1OVYA 1RDUA 3WQUA 3VERA 3R6MA 1NGAA 3O9RA 3E9LA 1HKCA 3KWGA 4E1JA 1HKBA 5EXWA 4H5RA 5LJWA 2V7YA 3A0IX 3L6QA 5BN9A 2VYPA 4FWMA 4B1UB 5ADXH 3G71N 4CZFA 3MWTA 1S72N 2BUPA 4BRPA 1H1VA 4R79A 4H5WA 3B8AX 3CC7N 4JN4A 2Q31A 3P38A 3KZBA 2P9LB 3O1BA 5BRFA 2HMPA 5GINA 3O9TA 4MDBA 1QVFM 3RSEA 4DKWA 4CZMA 4BRAA 1D4XA 3UKUA 2CGLA 4BRMA 4PL8A 5JVGL 4LC9B 1KD1O 2VCPA 1V4SA 4PKGA 5CR4A 3VF6A 5AQKA 3WXMB 3DXMA 4YDUC 4BR9A 4YOXA 2VWBA 5LJVA 2NRXA 2KKZA 3O6WA 1HPMA 1U2VA 4BR4A 1YHQN 1DEJA 2YCHA 2ZWHA 3A5LC 3SK3A 4C23A 1Y64A 3ZYYX 3ZEUA 1J6ZA 1SS6A 3CF5L 3CPEA 3JXUA 3O80A 4JK9A 2ASOA 1IJJA 4IJAA 2A42A 5M1PA 4MDAA 5AQWA 1MWKA 3TTCA 4A57A 4BRLA 5CE3A 4A61A 2IVOA 2GWKA 3D7EO 2D4WA 3JS6A 1W2BM 4IO9L 3HM8A 3CC4N 2Q36A 5C0YA 1NWKA 2P9NB 2P9UA 3LDQA 1OKJA 3ZX3A 4IOXA 4BRCA 4ILJA 1KC8O 1VQ4N 3A5OC 3DXKB 4Y0WA 1ZC6A 3LDLA 5BR9A 3TPQA 3ATUA 3ENOA 4IDHA 5KPZA 5BRHA 4FWNA 5M1KA 4NLBA 4JKHA 4H5TA 2ZJRL 3FZMA 3GL1A 3DWLA 3ZETA 4J8FA 3VGKA 3Q7BA 4B1YB 4BC5A 3C65A 3EZWA 1ZBSA 2FLOA 4O8KA 4HTLA 2GUPA 4BC4A 1BG3A 2WC9A 5F0XA 5BRDA 3KVGA 4KBOA 1ATSA 4BRFA 3WXJA 2RE2A 3FZHA 4CZLA 1N8RO 1SQKA 3C7NA 3CCQN 3QB0A 3PLAA 3HBTA 4QS9A 1QZ5A 1BOTO 4JD2B 1NGIA 4BR2A 1Q7YO 5BPLA 2E2QA 2WBNA 2HBMA 3CJAA 5AQVA 3R8EA 1K73O 2Q0UA 4QS8A 2P9PB 4H0TB 4ISEA 3E9PA 4JKDA 4NB4A 5AQNA 3VOVA 2V51B 4CZGA 4FO0A 2P9IA 4CBXA 3QICA 3CJCA 4K25A 1YJWN 3HSCA 4B9QA 2J4RA 1G99A 2V52B 3TU5A 4YOTA 4EHUA 3P31A 2GELA 2IVNA 5C12A 4FWKA 3GOIA 2WUSA 4BC3A 3LDOA 4DB3A 4WCEL 1DT9A 5HOOA 4CBWA 3CMEN 1BO5O 4XH1A 3H3NO 3D6RA 2HBJA 5KQDA 4JHDB 3GE1A 1GLLO 3QFPA 4IOAL 3ENHA 3KK7A 4JK7A 3CJBA 3QDKA 2CGKA 2FSJA 4CD1A 2QI2A 3FZLA 1KQSM 3UKRB 5MLCQ 3U8XA 2QWPA 2A40A 3FFKB 4BRDA 1WOQA 3GG4A 1W97L 2JWKA 2YHYA 3I55N 1VQ9N 1YJNN 3CJ9A 4AF1A 3VETA 4BG9A 1NGGA 1GLAG 4BRHA 3VEVA 4GV3A 2E2NA 4H0PA 2A5XA 3MK6A 2P9SB 3OBWA 4ISFA 3D2FA 1YVNA 5AQZA 1Q18A 2ITMA 2A41A 3P39A 3O4WA 4ILGB 2ZGZA 2NLXA 3O9UA 3D2EA 5B8HA 4C1NI 4WFNL 4XEIA 5AZJA 3SAFA 1NGJA 2HBLA 3Q7CA 3O9SA 2HF4A 5AQOA 4AM6A 3NVKA 4L3QA 1T44A 3DAWA 3LDPA 3LM2A 3U9ZA 2NRHA 1GLEG 3P4IA 4FSVA 2Q0RA 3CJ1A 3H1VX 3H45C 3QBXA 3BUZB 4H5VA 4M7XA 2GX9A 4WQ5A 4A2BA 1T6DA 3F9MA 3C6AA 1K8KA 4JAXA 4B1VA 1NBWA 2F7TA 4FVUA 2PBDA 2NZTA 4HWIA 4A5AA 5GAGP 3T7ZA 1YITN 4CZKA 3C6HA 3VEZA 5AZIA 3BF1A 1YUWA 1EO1A 4H0XB 5AQGA 4MLEA 1NMDA 2I7NA 1JJ2M 4BRQA 3NMUA 2VGNA 5F2RA 2YJFA 1VQNN 3N4PA 4ISGA 3BP8A 5DM6L 1U6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AY9 A;  2H3G X;  1LCU A;  4FWL A;  4B1W B;  4H5N A;  1RGI A;  4BGA A;  2P9K B;  4IJN A;  4B1Z A;  3BEX A;  1KAX A;  2CH5 A;  3M1F A;  1C0G A;  1DKG D;  3I33 A;  2Q1N A;  3WEE A;  5AQH A;  5AQM A;  3DJC A;  2IIR A;  4I6M B;  5EX5 A;  2W41 A;  3A8Y A;  1TYQ B;  4DHY A;  3ULE A;  3AAP A;  4CD3 A;  3LM9 A;  1GLJ O;  5AQP A;  4EFH A;  4RTF D;  3SLC A;  1BWF O;  3HI0 A;  3FGU A;  1MDU B;  3S41 A;  3WXK A;  5EOY A;  3CJ7 A;  4FWQ A;  4QS7 A;  1GLC G;  1RDW X;  5AR0 A;  2EWS A;  3U4L A;  3R9P A;  4BVP A;  3O1W A;  3WT0 A;  1QZ6 A;  3ZX2 A;  3MN5 A;  3SMP A;  2GEM A;  3MN9 A;  2D0O A;  5AZJ B;  2QWR A;  4BQZ A;  3W3D A;  3H1Q A;  3IDH A;  5F1X A;  2A3Z A;  1ESV A;  2QWL A;  4CZI A;  5JIC A;  2P9L A;  4A62 A;  1C0F A;  4CZE A;  4NO7 A;  3A5M C;  2ZGY A;  2AP1 A;  2FSN A;  3MN7 A;  2QW9 A;  3FZF A;  1Z05 A;  3FE1 A;  1HLU A;  4BRO A;  2FSK A;  3WXL A;  4CBU A;  1GLB G;  4H0O A;  1JCF A;  2E1Y A;  1BA0 A;  5FPD A;  5AQY A;  1MA9 B;  3RSE B;  1XQS C;  3HZ6 A;  2AA4 A;  3UKU B;  3M3Z A;  1NGE A;  5AFU A;  3U9D A;  5AQS A;  1KAZ A;  1HUX A;  3KHY A;  3VEX A;  3DXM B;  3GDQ A;  3WXI A;  5AQX A;  4M7Y A;  1XC3 A;  3G25 A;  3ID8 A;  4IO8 A;  3HTV A;  1SZ2 A;  1U2V B;  1T6C A;  3EO3 A;  4DCH A;  5LY3 A;  3ZEU B;  3O8M A;  3QML A;  3VEY A;  2P9N A;  2YHX A;  1X9J A;  1HJO A;  3DXK A;  4YDU A;  3C0B A;  3VGM A;  5KPR A;  1ATN A;  1BDG A;  1GLF O;  1S22 A;  4FPB A;  1YXQ A;  2P9U B;  4BQL A;  3EN9 A;  4FWR A;  1ATR A;  3UB5 A;  4K41 A;  3CIP A;  2DPN A;  2OAN A;  3J8A A;  5AQU A;  4XH5 A;  2GWJ A;  2ASP A;  3ZET B;  4A2A A;  5I9E B;  5ADX A;  4JD2 A;  1E4F T;  1EQY A;  4CZH A;  2E1Z A;  3FR0 A;  2KHO A;  4BRK A;  2FXU A;  4AM7 A;  4BRG A;  1HKG A;  3C7N B;  1IG8 A;  2P9P A;  4XH4 A;  4BR5 A;  3CHW A;  3LDN A;  3ZX0 A;  5KQ8 A;  3H3O B;  3MMV A;  2E8A A;  2IVP A;  2QWN A;  4K43 A;  2YJE A;  1NM1 A;  2D1K A;  5AQQ A;  5E84 A;  5AQL A;  3VGL A;  3ATV A;  2QM1 A;  3CET A;  1NGC A;  4MO4 A;  2P9I B;  2CH6 A;  4EAH D;  5KPT A;  4PKH A;  5AQR A;  4JHD A;  4FWP A;  3BF3 A;  2QWQ A;  1RFQ A;  4FOI A;  4M63 C;  3VF2 A;  4BRN A;  4EHT A;  4IWV A;  2F9T A;  4FL9 A;  3UKR A;  5EVZ A;  3IUC A;  3CI5 A;  3FLC O;  3VEO A;  1JCG A;  1JCE A;  3GBT A;  4CZJ A;  2Q97 A;  1SAZ A;  1QQO A;  1DGK N;  1S3X A;  4FOE A;  2ASM A;  2P9S A;  2Q2R A;  5E26 A;  2CGJ A;  5FPM A;  1E4G T;  3CER A;  4WQ5 C;  4H03 B;  4H0V B;  5ELZ A;  3L4I A;  4BR0 A;  1BU6 O;  4FWO A;  2E2P A;  3D2F B;  3AAQ A;  1TUY A;  1NGD A;  1Z6R A;  1NGH A;  3H46 O;  5AQJ A;  5AQF A;  3D2E B;  3O5B A;  3W0L A;  4BGB A;  3WUH A;  5BPM A;  2YHW A;  4PL7 A;  1KAY A;  3VEN A;  2E20 A;  3UE5 A;  1GLD G;  2HOE A;  3OHR A;  4GY2 B;  1KXP A;  3A5N C;  4WQ4 A;  2QWM A;  4Z94 A;  1X3N A;  5BN8 A;  3EKS A;  1K8K B;  3EKU A;  3MDQ A;  2I7P A;  4FWS A;  5FPE A;  4FPA A;  3H6E A;  4MLH A;  3VEW A;  5JLF A;  2YI1 A;  4B1X B;  2PAV A;  4RWT A;  2W40 A;  1BUP A;  4IXC A;  3VES A;  3MCP A;  4CI6 A;  5AZI B;  5JMV A;  2FF6 A;  3MN6 A;  3O08 A;  1QQN A;  4BRI A;  2GTD A;  4PKI A;  1NLV A;  4H0Y B;  3VPZ A;  3WQT A;  5AQT A;  4MO5 A;  3SMS A;  5AFU H;  1NGB A;  5EY4 A;  2FF3 B;  2P9K A;  1MWM A;  2HF3 A;  2A6A A;  1CZA N;  1QQM A;  3CQX A;  1TUU A;  2QWO A;  3LL3 A;  4BRE A;  4O5F A;  4K42 A;  2UYT A;  1XUP O;  3IFR A;  4JNE A;  4BG8 A;  1NGF A;  3AAR A;  2BTF A;  3IMX A;  2E2O A;  3M6G A;  4GNI A;  4I6M A;  3SJH A;  4F9O A;  5JLH A;  1TYQ A;  3QFU A;  5TKY A;  1R59 O;  3WEE B;  5BPN A;  4BC2 A;  3EL2 A;  3FZK A;  4WYB A;  1X3M A;  4CJ7 A;  4DQ8 A;  5BRE A;  2V7Z A;  5FPN A;  4EIA A;  1LOT B;  1V4T A;  3ULE B;  1P8Z A;  4IZ9 A;  1QHA A;  4BVO A;  2QXL A;  2F9W A;  3L0Q A;  3CQY A;  1YAG A;  4BR7 A;  3I8B A;  1BA1 A;  4WQ4 C;  3QBW A;  1HX1 A;  4RCH A;  2ZF5 O;  1ZXO A;  5AQI A;  3VF4 A;  1WUA A;  2D0P A;  2E88 A;  3WQU A;  3VER A;  3R6M A;  1NGA A;  1HKC A;  4E1J A;  1HKB A;  5EXW A;  4H5R A;  5LJW A;  2V7Y A;  3A0I X;  3L6Q A;  5BN9 A;  2VYP A;  4FWM A;  4B1U B;  5ADX H;  4CZF A;  2BUP A;  4BRP A;  1H1V A;  4H5W A;  3B8A X;  4JN4 A;  2Q31 A;  3KZB A;  2P9L B;  3O1B A;  5BRF A;  2HMP A;  3RSE A;  4CZM A;  4BRA A;  1D4X A;  3UKU A;  2CGL A;  4BRM A;  4PL8 A;  4LC9 B;  2VCP A;  1V4S A;  4PKG A;  3VF6 A;  5AQK A;  3DXM A;  4YDU C;  4BR9 A;  2VWB A;  5LJV A;  3O6W A;  1HPM A;  1U2V A;  4BR4 A;  1DEJ A;  2YCH A;  2ZWH A;  3A5L C;  3SK3 A;  4C23 A;  1Y64 A;  3ZEU A;  1J6Z A;  3JXU A;  3O80 A;  2ASO A;  1IJJ A;  4IJA A;  2A42 A;  5AQW A;  4BRL A;  1MWK A;  5CE3 A;  4A61 A;  2IVO A;  2GWK A;  3D7E O;  2D4W A;  3JS6 A;  3HM8 A;  2Q36 A;  1NWK A;  2P9N B;  2P9U A;  3LDQ A;  1OKJ A;  3ZX3 A;  4BRC A;  3A5O C;  3DXK B;  4Y0W A;  1ZC6 A;  3LDL A;  5BR9 A;  3TPQ A;  3ATU A;  3ENO A;  5KPZ A;  5BRH A;  4FWN A;  4H5T A;  3FZM A;  3GL1 A;  3DWL A;  3ZET A;  4J8F A;  3VGK A;  4B1Y B;  4BC5 A;  3EZW A;  1ZBS A;  2FLO A;  4O8K A;  4HTL A;  2GUP A;  4BC4 A;  1BG3 A;  5F0X A;  5BRD A;  3KVG A;  4KBO A;  1ATS A;  4BRF A;  3WXJ A;  3FZH A;  4CZL A;  1SQK A;  3C7N A;  3QB0 A;  3HBT A;  4QS9 A;  1QZ5 A;  1BOT O;  4JD2 B;  1NGI A;  4BR2 A;  5BPL A;  2E2Q A;  3CJA A;  5AQV A;  3R8E A;  2Q0U A;  4QS8 A;  2P9P B;  4H0T B;  4ISE A;  4NB4 A;  5AQN A;  3VOV A;  2V51 B;  4CZG A;  4FO0 A;  2P9I A;  4CBX A;  3QIC A;  3CJC A;  4K25 A;  3HSC A;  4B9Q A;  2J4R A;  1G99 A;  2V52 B;  3TU5 A;  4EHU A;  2GEL A;  2IVN A;  4FWK A;  3GOI A;  2WUS A;  4BC3 A;  3LDO A;  4DB3 A;  4CBW A;  1BO5 O;  4XH1 A;  3H3N O;  5KQD A;  4JHD B;  3GE1 A;  1GLL O;  3QFP A;  3ENH A;  3CJB A;  3QDK A;  2CGK A;  2FSJ A;  4CD1 A;  3FZL A;  3UKR B;  3U8X A;  2QWP A;  2A40 A;  3FFK B;  4BRD A;  1WOQ A;  3GG4 A;  2YHY A;  3CJ9 A;  3VET A;  4BG9 A;  1NGG A;  1GLA G;  4BRH A;  3VEV A;  2E2N A;  4H0P A;  2A5X A;  3MK6 A;  2P9S B;  4ISF A;  3D2F A;  1YVN A;  5AQZ A;  1Q18 A;  2ITM A;  2A41 A;  3O4W A;  2ZGZ A;  2NLX A;  3D2E A;  5B8H A;  4XEI A;  5AZJ A;  1NGJ A;  5AQO A;  2HF4 A;  4AM6 A;  4L3Q A;  1T44 A;  3DAW A;  3LDP A;  3LM2 A;  3U9Z A;  2NRH A;  1GLE G;  3P4I A;  4FSV A;  2Q0R A;  3CJ1 A;  3H1V X;  3H45 C;  3QBX A;  3BUZ B;  4H5V A;  4M7X A;  4WQ5 A;  4A2B A;  1T6D A;  3F9M A;  1K8K A;  4JAX A;  4B1V A;  1NBW A;  2PBD A;  2NZT A;  4HWI A;  4CZK A;  3VEZ A;  5AZI A;  3BF1 A;  1YUW A;  4H0X B;  5AQG A;  4MLE A;  1NMD A;  2I7N A;  4BRQ A;  5F2R A;  2YJF A;  4ISG A;  3BP8 A;  1U6Z A; 
#chains in the Genus database with same CATH topology
 2D0C A;  2H3G X;  3DOK A;  3OY9 A;  2XO7 A;  4B1W B;  3ASM A;  4K8X A;  2HMI A;  4H5N A;  5KGX A;  3PSF A;  4BGA A;  4FLX A;  3K57 A;  2CH5 A;  4DFP A;  4CHN A;  4CGJ A;  3CM6 A;  1WAF A;  3EYZ A;  3DJC A;  2IIR A;  4I6M B;  2W41 A;  1TYQ B;  2NUB A;  4DHY A;  2VG5 A;  3ULE A;  4J2E A;  5FRO A;  3AA2 A;  1UWB A;  4CD3 A;  1D9F A;  1GLJ O;  3VMF B;  2HB5 A;  2KW4 A;  3G10 A;  3FGU A;  3CC2 N;  3CJ7 A;  3R3L A;  4QS7 A;  3OYG A;  2YKM A;  1ILY A;  2NRT A;  1NG9 A;  3E01 A;  3KK1 A;  4FM2 A;  4XIU A;  4KHS A;  1Q82 O;  3TI0 A;  3MX5 A;  1X9S A;  2GEM A;  3IKM A;  1VSH A;  3TAF A;  5F1X A;  4CZI A;  3OYL A;  1XMQ K;  3K5N A;  1C0F A;  1NK9 A;  3A5M C;  2AP1 A;  3U6F A;  4IEI A;  1QSY A;  3KD1 E;  4L8R B;  1WSI A;  3FZF A;  4CBU A;  1UAX A;  1VQ7 N;  2E1Y A;  3QEW A;  1YJ9 N;  3RSE B;  4B3O A;  4N56 A;  4OGC A;  2FBV A;  1RCH A;  3I56 N;  5AQS A;  2Y1I A;  1GOB A;  1DTQ A;  3VEX A;  3GDQ A;  5AQX A;  4IO8 A;  1TK0 A;  4DV4 K;  1SZ2 A;  4HVJ A;  3TAP A;  2P5G A;  3EO3 A;  4DSE A;  2VG7 A;  5LY3 A;  3NF9 A;  2NRV A;  2QEX N;  1BI4 B;  2OPR A;  4JS4 A;  5M1F A;  4J2D A;  2YHX A;  3KTQ A;  4FK0 A;  4FJ7 A;  1HJO A;  2HHS A;  1TKX A;  3NGI A;  1ATN A;  4OO1 J;  1S22 A;  1J5O A;  3J7Y P;  4DF4 A;  3I0R A;  2DY4 A;  3EN9 A;  1ATR A;  1I39 A;  3CIP A;  4XH5 A;  4DG1 A;  5JS1 A;  3F9K A;  3AVN A;  4A2A A;  4M3X A;  4DTO A;  5ADX A;  1XI1 A;  1RT6 A;  2F96 A;  1X9W A;  3NF7 A;  4Z4H A;  3HOT A;  4BE2 A;  2KHO A;  4BRK A;  4BRG A;  3VQB A;  4JEP A;  3CHW A;  4KKO A;  3EE9 A;  3MMV A;  1XC9 A;  2QWN A;  1WLJ A;  2NRR A;  1Q9X A;  5E84 A;  4OPK A;  3VGL A;  4DV3 K;  3WNG A;  2QM1 A;  1VQ6 N;  4M3T A;  1JLC A;  4C8N A;  1VRT A;  4RW6 A;  4DUY K;  3DYA A;  2HVH A;  5AQR A;  3J81 O;  4M42 A;  4DV2 K;  1NKB A;  2OZS A;  1RFQ A;  4M63 C;  4EHT A;  5C10 A;  4M45 A;  4FJL A;  2F9T A;  2YV0 X;  2XHB A;  3IUC A;  3QEX A;  3FLC O;  2W6K A;  4JI6 K;  3ITH A;  2Q97 A;  1SAZ A;  3DRR A;  1E3M A;  4FJH A;  4M3R A;  4GVE A;  2Q2R A;  5E26 A;  4W5Q A;  4OVL A;  4LH4 A;  3SI6 A;  4FJ8 A;  4CJU A;  4FW1 A;  1BU6 O;  2E4L A;  3VQ7 A;  3AAQ A;  1NGD A;  4KAZ A;  5AQJ A;  3D2E B;  4E89 A;  4CF9 A;  5HRP A;  5GAH P;  3NF8 A;  3SNN A;  3CCL N;  2F8T A;  1FXX A;  5HBM A;  2E20 A;  3PO4 A;  4PHT X;  3OHR A;  1TGO A;  1YF5 L;  1KXP A;  2X6S A;  3PO5 A;  1C1C A;  3EKS A;  1HYS A;  4FPA A;  3H6E A;  4MLH A;  1GOC A;  4YOV A;  4DQP A;  4FW2 A;  2PAV A;  2W40 A;  3HP6 A;  4YHH K;  4PWD A;  2DTU A;  3MN6 A;  3QES A;  4ZTJ A;  4PA1 A;  4PKI A;  1VSL A;  3JYT A;  5AQT A;  1S1X A;  4KTQ A;  1NGB A;  3ZSW A;  2P9K A;  2HVI A;  2HF3 A;  1JXB A;  1CZA N;  3SV4 A;  2QWO A;  3VA0 A;  2W6L A;  1BQM A;  4KHQ A;  1NGF A;  1VSF A;  3D0P A;  1UA1 A;  4OPA A;  5JLH A;  4GKJ K;  3VQQ A;  4K0K K;  3MWP A;  3SUP A;  3M5R A;  3OYA A;  3K9K A;  2IDO A;  1LOT B;  1V4T A;  3ULE B;  2EX3 A;  1P8Z A;  5HL7 L;  1BQN A;  1WBD A;  4GW6 A;  4IG3 A;  4WFA L;  3HOS A;  3CCV N;  4BDZ A;  1UOC A;  3QET A;  4BR7 A;  3I8B A;  1BA1 A;  1VSE A;  4DQR A;  3TTD A;  1SL0 A;  4KFB A;  3VQ9 A;  5AQI A;  3AV9 A;  3LZI A;  2NRZ A;  1RBR A;  2E88 A;  2OPP A;  1BCO A;  4JI1 K;  1OVY A;  4DF8 A;  4JYA K;  3OYB A;  1IKY A;  1I94 K;  4E1J A;  4LFB K;  5LJW A;  1QSS A;  4B1U B;  4FWM A;  5ADX H;  3G71 N;  4CZF A;  2BUP A;  4BRP A;  4DSI A;  3H08 A;  3NHG A;  1BIU A;  2HMP A;  4JI8 K;  4MDB A;  4DKW A;  3ZLJ A;  1BIS A;  2Z1H A;  1D4X A;  4BRM A;  1HYV A;  4PL8 A;  4CEE A;  4GMJ B;  4BDP A;  1KD1 O;  1V4S A;  4PKG A;  3WXM B;  5AQK A;  4YDU C;  4BR9 A;  5LJV A;  2NRX A;  3O6W A;  3SQ4 A;  4CEA A;  1U2V A;  1W9H A;  1YHQ N;  2UU9 K;  2HHX A;  3DLB A;  2F8S A;  2GV9 A;  4CJV A;  4E3S A;  3ZEU A;  1A5V A;  4B3T K;  3O80 A;  4JK9 A;  2ASO A;  1IJJ A;  5M1P A;  2A42 A;  3TTC A;  5CE3 A;  2IVO A;  2GWK A;  3LP3 A;  3K5O A;  3VQ6 A;  2Q36 A;  2QK9 A;  5C0Y A;  1NWK A;  3LDQ A;  2FBX A;  2A1R A;  4E7I A;  3ZX3 A;  1Z26 A;  2Z1J A;  1XNQ K;  3A5O C;  3RR7 A;  3RRG A;  2YNF A;  3AO5 A;  2RPI A;  4HCB A;  4FK2 A;  3VN5 A;  5BRH A;  2W42 A;  4DU3 A;  5KI6 A;  4CIG A;  1Z25 A;  3FZM A;  3OVN A;  4YFU A;  4FJX A;  3ZET A;  1ZBF A;  1ZBS A;  2O8E A;  2GUP A;  2WOM A;  4QCL A;  4DR2 K;  3J7A P;  5BRD A;  3MXJ A;  1ATS A;  3ZCM A;  3C7N A;  3CCQ N;  3QB0 A;  3PLA A;  4KHP K;  4BR2 A;  4FJM A;  3V1O A;  1J53 A;  3CJA A;  4DSL A;  5AQV A;  3ZT1 A;  3LPU A;  1K73 O;  4CHZ A;  4QS8 A;  4H0T B;  4ISE A;  3CFO A;  1UA0 A;  4JKD A;  4NB4 A;  4OLB A;  4CZG A;  3V6D A;  4HUF A;  4B9Q A;  1ASU A;  2J4R A;  4V19 S;  2V52 B;  3QLH A;  4EHU A;  2IVN A;  4FWK A;  3HK2 A;  3LDO A;  4DB3 A;  1QTM A;  5SWM A;  1VSI A;  5SZT A;  3ENH A;  4CGD A;  3CJB A;  1HMV A;  5DK5 A;  3QDK A;  4CD1 A;  3DLK A;  3U8X A;  3U3G A;  2QWP A;  4KTZ A;  4NCB A;  2A40 A;  3FFK B;  3NFA A;  1W97 L;  3I55 N;  3CJ9 A;  4BRH A;  1NGG A;  4PY5 A;  4JI2 K;  1C1B A;  1TL3 A;  2E2N A;  1JLQ A;  2A5X A;  4E1M A;  4DFM A;  1N33 K;  3NAE A;  4LF9 K;  4DV1 K;  3KK3 A;  1SL1 A;  4XEI A;  3L2U A;  4KHW A;  2YNI A;  3DAW A;  3ZSO A;  2ZD1 A;  2HHW A;  4FSV A;  2Q0R A;  3QBX A;  4H5V A;  1T6D A;  3DI6 A;  3C6A A;  1WSE A;  1S1V A;  2F7T A;  1TKZ A;  2NZT A;  5AJ3 K;  1YIT N;  1JLE A;  1QS4 A;  4NYN A;  2O4G A;  5AZI A;  3QEI A;  1DTT A;  3AVK A;  1EO1 A;  4DV7 K;  2G8I A;  1BHL A;  1LW2 A;  5DM6 L;  3LWL A;  4WF9 L;  4JI3 K;  3ISN C;  3AY9 A;  4JKA A;  1EP4 A;  2P9K B;  4IJN A;  4BY9 C;  1KAX A;  4KI4 A;  4OJR A;  1DKG D;  3E9O A;  4AQY K;  5HRR A;  5AQH A;  1T05 A;  3A8Y A;  5JS2 A;  2B6A A;  3QER A;  5LMN K;  2Y1J A;  4RTF D;  3SLC A;  4DTX A;  4O55 A;  3KLH A;  5TKW A;  3S41 A;  3ZSX A;  4YNQ A;  3THV A;  1KSP A;  1GLC G;  1RDA A;  1EX4 A;  5FRN A;  3CG7 A;  3SQ1 A;  3AVC A;  3U4L A;  3R9P A;  3PX6 A;  3LAL A;  3O1W A;  2BDP A;  4UY8 O;  3WT0 A;  1QZ6 A;  3O3F A;  2DFH A;  2YNG A;  4Y1C A;  2D0O A;  3W3D A;  2VQF K;  3H1Q A;  3IDH A;  4LF6 K;  2QWL A;  4QAG A;  3L2Q A;  5JIC A;  4KH4 A;  4CZE A;  3VTH A;  1FKP A;  2QW9 A;  1Z05 A;  4BRO A;  1CLQ A;  1L3U A;  2G8F A;  2FSK A;  3N4Q A;  1BA0 A;  5FPD A;  2YKN A;  2AA4 A;  4IDK A;  2VG6 A;  3M3Z A;  1VQO N;  4FLU A;  1RDD A;  3QIO A;  1HUX A;  4AHV A;  3PV8 A;  4KHY A;  1RNH A;  3WXI A;  3ID8 A;  3SAG A;  1GOA A;  4C1N K;  4HUE A;  1U2V B;  4O0J A;  3RTV A;  1RTD A;  4DTR A;  4U7B A;  3AO4 A;  1HPZ A;  3ZEU B;  4IG0 A;  4CEC A;  3QML A;  1Y97 A;  1ZBU A;  4LF8 K;  2HNZ A;  3VGM A;  2FBY A;  5KPR A;  3MEE A;  4HHT A;  4CJK A;  4FPB A;  4KH5 A;  4BQL A;  1L3S A;  2OAN A;  3J8A A;  2GWJ A;  4DQI A;  3VQA A;  3ZET B;  3UIQ A;  5I9E B;  2B4J A;  2O8E B;  1S6P A;  3ZSV A;  1VK0 A;  4GKK K;  4YOU A;  4CZH A;  4KHU A;  4ID1 A;  4W5N A;  2FXU A;  3SBT A;  4AM7 A;  3V9S A;  3C7N B;  1IG8 A;  2P9P A;  1QSL A;  2O8D A;  5KQ8 A;  1TK5 A;  4C8L A;  4RW4 A;  4K43 A;  1JL2 A;  2YJE A;  2D1K A;  5AQQ A;  5AQL A;  1RDB A;  3ATV A;  1NGC A;  2FBT A;  4CK1 A;  2X6N A;  3VQ4 A;  1U4B A;  4CER A;  1RT4 A;  4JHD A;  1C0T A;  4FWP A;  5CZ2 A;  3C94 A;  4CIF A;  4FOI A;  3IRX A;  4DR1 K;  4BRN A;  3JAM O;  4IWV A;  3HL8 A;  3UKR A;  3VQE A;  1F21 A;  2XY5 A;  4BWJ A;  1JCG A;  1LWE A;  4X65 K;  2P5O A;  1XMO K;  3VQ5 A;  3GBT A;  3JSM A;  4FLY A;  3HXM A;  4HCC A;  1DGK N;  3KK2 A;  1S3X A;  3ZSZ A;  4FOE A;  2KFN A;  4LH5 A;  3SAH A;  1E4G T;  3OA9 A;  4WQ5 C;  4LF5 K;  3QNO A;  1C1A A;  3VTI A;  3L4I A;  4BR0 A;  1TUY A;  1Z6R A;  4IOC L;  1NGH A;  4CGI A;  4WFB L;  4CGF A;  1NOZ A;  4DU1 A;  3W0L A;  2O8F A;  1DLO A;  3NGY A;  4YY3 K;  3WUH A;  1FK9 A;  1SKS A;  5BPM A;  4PL7 A;  1TVR A;  3VEN A;  3UE5 A;  2KZZ A;  4DV5 K;  4CGH A;  1YTU A;  3A5N C;  3V9X A;  4Z94 A;  4IFY A;  1S1U A;  4AH9 A;  5BN8 A;  4CEZ A;  3EKU A;  3MDQ A;  4CFB A;  4FWS A;  3VEW A;  4RWT A;  2YI1 A;  1NJZ A;  3VES A;  1WSF A;  4O5B A;  2NNW A;  5AZI B;  2FF6 A;  4BRI A;  3O08 A;  1QQN A;  4ILH A;  1C0U A;  1IBK K;  4MO5 A;  4DTU A;  1QE1 A;  1D8Y A;  1IBM K;  1MWM A;  2IS3 A;  4OPJ A;  4Z4G A;  4BRE A;  4IBN A;  4CW7 B;  1LV5 A;  4NCA A;  4Z0U A;  3S3M A;  1XUP O;  3IFR A;  3V1R A;  4HUG A;  3HPG A;  1Q86 O;  3IMX A;  3SJH A;  2HW3 A;  4F9O A;  1NK8 A;  3O9Q A;  3QFU A;  4FLV A;  3V81 A;  2VGM A;  3DLL L;  5TKY A;  5FLX O;  3NVM A;  4BC2 A;  2QA4 N;  4BDY A;  4EZ9 A;  3TSU A;  2Q3S A;  2KLA A;  1LAV A;  5FPN A;  5C25 A;  4DR5 K;  1JLG A;  4Y1D A;  5DM7 L;  1Q81 O;  1VSK A;  1QHA A;  1J54 A;  3ZSY A;  1T3V A;  3VF4 A;  2D0P A;  4JRP A;  3AA5 X;  3CCE N;  3WQU A;  3E9L A;  3KWG A;  3TAQ A;  2QKB A;  4AHR A;  2UUA K;  4H5R A;  2V7Y A;  3A0I X;  5BN9 A;  2VYP A;  1NNE A;  4F2S A;  4AIL C;  1H1V A;  3PSI A;  4R79 A;  2VWJ A;  4H5W A;  1XHZ A;  3B8A X;  3AVI A;  3KZB A;  5BRF A;  3L3V A;  3CYM A;  3TWH A;  3UKU A;  1RBV A;  5JVG L;  2ZQB A;  3P5J A;  5CR4 A;  3VF6 A;  1SUQ A;  4H4M A;  3QIP A;  4BR4 A;  4AHT A;  1DEJ A;  2YCH A;  3A5L C;  4C23 A;  3ZYY X;  4DFJ A;  4F4K A;  1J6Z A;  1SS6 A;  1SL2 A;  3M8Q A;  2D5R A;  4IJA A;  5AQW A;  4B8A B;  4BRL A;  1B9F A;  3AO2 A;  4JI5 K;  2IC3 A;  1OKJ A;  1VQ4 N;  4Y0W A;  4CJP A;  1JLB A;  1ZC6 A;  3TPQ A;  3ENO A;  3OS1 A;  4QOZ B;  5KPZ A;  5M1K A;  2F4V K;  4JKH A;  3DWL A;  1ZBI A;  3K5L A;  4CJT A;  3SPZ A;  3C65 A;  2FLO A;  4HTL A;  3U3Y A;  3TAM A;  1BG3 A;  2WC9 A;  2HHT A;  3KVG A;  4KBO A;  3WXJ A;  4CZL A;  4LF4 K;  3M8P A;  1N8R O;  1QQC A;  3P1G A;  4B9U A;  3L8B A;  2D0B A;  4PUO A;  2IGI A;  2WBN A;  2P9P B;  4DTS A;  2O8D B;  4CF0 A;  4CBX A;  2HHQ A;  1YJW N;  5HP1 A;  1CZB A;  3KKS A;  4CIE A;  2GEL A;  5C12 A;  5A2Q O;  1HNV A;  1DT9 A;  5HOO A;  3CME N;  2OYQ A;  1BO5 O;  3H3N O;  4JHD B;  3GE1 A;  1IBL K;  1GLL O;  5CYQ A;  4LD0 A;  3KLE A;  4CJE A;  4B9N A;  2FSJ A;  3UKR B;  5MLC Q;  4DLG A;  3C6U A;  1MU2 A;  2YHY A;  1VQ9 N;  4DQQ A;  1NJW A;  4BG9 A;  4H0P A;  3MK6 A;  3RWU A;  1YVN A;  4ILG B;  2ZGZ A;  4N47 A;  4OX9 K;  2RF2 A;  1XNR K;  5HRN A;  3SAF A;  1WNS A;  2HBL A;  4OKK A;  1T03 A;  4IKF A;  4FJ9 A;  3AA3 A;  3LM2 A;  3U9Z A;  4NXM K;  1GLE G;  2O8F B;  3P4I A;  3WNF A;  3DRP A;  1RBT A;  3H1V X;  3HJF A;  3F9M A;  3O3G A;  1K8K A;  4DU4 A;  4JAX A;  4B1V A;  3RMA A;  2O8C B;  2PBD A;  4A5A A;  2OA8 A;  1KFD A;  5I3U A;  3BGR A;  3L3U A;  3RMD A;  2YNH A;  5AQG A;  3C6T A;  5IT9 O;  3QEP A;  1C6V A;  5CY4 A;  2I7N A;  1JJ2 M;  4BRQ A;  3OYJ A;  3NMU A;  2VGN A;  4ISG A;  1BGX T;  1U6Z A;  4F2R A;  4YOR A;  4FWL A;  4CVN E;  3MX2 A;  5E41 A;  1L3T A;  5HRS A;  1RTI A;  1RGI A;  4JI7 K;  4B1Z A;  3BEX A;  3HRG A;  4DV0 K;  2G8W A;  3AGR A;  4DSJ A;  4YOW A;  3M1F A;  1C0G A;  3I33 A;  2Q1N A;  4CJR A;  1EWR A;  1SKW A;  1TAU A;  4MQ3 A;  4DUZ K;  1CZ9 A;  3OYC A;  3AVB A;  3LM9 A;  1LWC A;  4EFH A;  3CFR A;  3HI0 A;  3K5M A;  1R0A A;  1MDU B;  2HNY A;  4FLT A;  5EOY A;  3HVT A;  4JKG A;  4FWQ A;  1S1T A;  4JKE A;  1VSJ A;  4WE1 A;  4BVP A;  4FM1 A;  4I9Q A;  3E1Y A;  4CF8 A;  4FZZ A;  4G9Z A;  2O8B A;  5AZJ B;  3AVG A;  2QWR A;  4BQZ A;  3LAM A;  1K8A O;  2A3Z A;  1ESV A;  3PIO L;  4JI4 K;  2P9L A;  1LAW A;  4LF7 K;  2ZGY A;  1WSH A;  2FSN A;  4E1N A;  2BH1 A;  3WXL A;  4N76 A;  3L2W A;  1GLB G;  1M1K O;  4W5O A;  2JWL A;  2UXC K;  1XQS C;  1U48 A;  4FZX C;  3CCM N;  3UKU B;  5C24 A;  5FDL A;  5AFU A;  4LY7 A;  3B6P A;  4CK3 A;  5CZ1 A;  1KAZ A;  3KHY A;  4CEB A;  1OH5 A;  1S9G A;  3OBY A;  4M7Y A;  1XC3 A;  1T6C A;  3S9H A;  3OJU A;  1N36 K;  3KJV A;  1VQM N;  4NLC A;  1D5A A;  4Q5V A;  4Q0B A;  1TK8 A;  2OTL N;  3O8M A;  4I2P A;  2OTJ N;  2QTD A;  3AA4 A;  1G15 A;  3RMB A;  2JLE A;  3MCA B;  3DXK A;  2VQE K;  3C0B A;  3J7Z O;  1BDG A;  1HYZ A;  1GLF O;  4JLH A;  1QHT A;  5H1S Q;  4W5T A;  3TAG A;  1VQK N;  4FWR A;  3UB5 A;  1KFS A;  3EE8 A;  3LP1 A;  1KLM A;  3HST B;  3SUO A;  2ASP A;  4CJW A;  3RVC A;  4YOY A;  3AO3 A;  1S5J A;  2E1Z A;  3FR0 A;  1HNI A;  4CJF A;  1ZYQ A;  4ICL A;  3E66 A;  4O0I A;  1HKG A;  3LDN A;  2AJQ A;  2E8A A;  3AGK A;  2IVP A;  2G8H A;  3BZC A;  2UUC K;  3TAE A;  1SV5 A;  2ZJP L;  4C8O A;  2FC0 A;  4CHY A;  3L2V A;  4MO4 A;  4Z4I A;  5KPT A;  4CJL A;  4JV5 K;  4DTN A;  4PKH A;  3IS9 A;  5BR8 K;  3V9W A;  2NRW A;  4F8R A;  2QWQ A;  3VF2 A;  4C8K A;  1W0H A;  4TSX A;  2RHK A;  3CPW M;  4R5P A;  1KVB A;  5EVZ A;  4FLW A;  3BY5 A;  3THY A;  3IAY A;  1JKH A;  1WB9 A;  4GVM A;  4CJ4 A;  1VSM A;  3OYN A;  3T1Y K;  3K59 A;  2G8K A;  1WN7 A;  4AHC A;  3OYH A;  3F5T A;  4H0V B;  5ELZ A;  4IFE A;  3P83 D;  4FWO A;  2E2P A;  4OPH A;  1HJR A;  4LSN A;  4DQS A;  3K9J A;  3O5B A;  5AQF A;  2HHH K;  4BGB A;  4DV6 K;  3J80 O;  5M1O A;  1YIJ N;  4B8C A;  1K9M O;  1KAY A;  4CK2 A;  5I42 A;  1HNX K;  2OZM A;  1GLD G;  2HOE A;  4WQ4 A;  2QWM A;  4JS5 A;  1K8K B;  3I0S A;  2I7P A;  5D3G A;  1IV0 A;  2ZE2 A;  1VQP N;  4FYD A;  5JLF A;  2IAJ A;  1NJI O;  4B1X B;  3TR8 A;  3AVJ A;  4E7L A;  1O13 A;  4UQG A;  4M3Y A;  1N5Y A;  3KLG A;  1NLV A;  4H0Y B;  4CEF A;  1IKV A;  4A59 A;  5AFU H;  4KV8 A;  5EY4 A;  5GAD P;  4JKB A;  2FF3 B;  1NKE A;  2OCE A;  2O4I A;  3MEG A;  5KTQ A;  1U49 A;  1IH7 A;  4CEQ A;  2YX6 A;  1TUU A;  3HP9 A;  4O5F A;  1TV6 A;  1VQ5 N;  2UYT A;  2HHU A;  4CE9 A;  5C42 A;  4CEO A;  4JNE A;  3NF6 A;  4BG8 A;  3AAR A;  1VQ8 N;  3LDS A;  4GNI A;  5K14 A;  3LP2 A;  5GAE P;  3SQ0 A;  5M1N A;  1RT5 A;  4E0D A;  4U67 L;  1R59 O;  2P1J A;  3TAB A;  3EL2 A;  3FZK A;  3TTF A;  1X3M A;  4BE1 A;  1CXQ A;  2V7Z A;  1YT3 A;  3WNH A;  3OW2 M;  1IG9 A;  3KLF A;  3CXC M;  3V4I A;  2QXL A;  3I8D A;  2F9W A;  3L0Q A;  3CD6 N;  3CQY A;  1YAG A;  1IKX A;  4WQ4 C;  3QBW A;  1HX1 A;  2ZF5 O;  4JKG B;  2PY5 A;  3V9U A;  4GV9 A;  4CHO A;  3VA3 A;  3VER A;  3R6M A;  3K0S A;  1NGA A;  4FXD A;  3O9R A;  1RTH A;  3HPO A;  1HKB A;  3THW A;  3L6Q A;  3QIN A;  1S72 N;  2O8B B;  3DOL A;  4JN4 A;  3P38 A;  2P9L B;  3T1H K;  2R7Y A;  1KVC A;  3O1B A;  1FKO A;  1J9A A;  1QVF M;  4EP4 A;  3NDK A;  3V1Q A;  4LFC K;  2CGL A;  1T7P A;  4DFK A;  1ASV A;  1S9E A;  2E6M A;  4CFA A;  4LC9 B;  1NK4 A;  1XWL A;  4F3O A;  2VCP A;  1VHX A;  4FJ5 A;  2Z1I A;  3DXM A;  3OYM A;  4LFA K;  1HPM A;  4AHU A;  1NK6 A;  2ZWH A;  4J2B A;  2XY6 A;  1Y64 A;  3EEQ A;  1RT1 A;  1RIL A;  1KVA A;  2QKK A;  4CES A;  3VQ8 A;  4MDA A;  1MWK A;  4OGE A;  4A61 A;  3JS6 A;  1W2B M;  4IO9 L;  3CC4 N;  5J1E A;  3AVL A;  2P9U A;  4BRC A;  1KC8 O;  3DXK B;  4JI0 K;  3S3O A;  4F3T A;  3LDL A;  5BR9 A;  5J2N A;  4H4O A;  3QEV A;  4KRE A;  4H5T A;  3OTO K;  3MEC A;  3GL1 A;  1IKW A;  3VGK A;  1N34 K;  4B1Y B;  4OLA A;  4BC5 A;  4W5R A;  3EZW A;  2O8C A;  4O8K A;  3S3N A;  1TKD A;  3FZH A;  1Q9Y A;  4Z4E A;  1WBB A;  3HBT A;  4QS9 A;  1OH8 A;  1Q7Y O;  2E2Q A;  3SUN A;  3R8E A;  1OH6 A;  4CHQ A;  1KCF A;  5EU7 A;  3OS0 A;  3K2P A;  5AQN A;  3VOV A;  4FO0 A;  2P9I A;  1X9M A;  3CJC A;  3HSC A;  4CJQ A;  4YOT A;  3P31 A;  1HRH A;  3NH0 A;  1FJG K;  4WCE L;  4FJI A;  4CBW A;  3B6O A;  2ITG A;  3D6R A;  5KQD A;  1KLN A;  3SQ2 A;  3QFP A;  3A2F A;  3KK7 A;  4JK7 A;  3HPH A;  1OH7 A;  2CGK A;  2QI2 A;  3FZL A;  1KQS M;  4KO0 A;  3DM2 A;  3THY B;  3GG4 A;  1XHX A;  3M8R A;  3VET A;  3TAN A;  4X64 K;  2HHV A;  3AVF A;  3PY8 A;  3D2F A;  2ZM6 K;  1W7A A;  5AQZ A;  1Q18 A;  2ITM A;  3P39 A;  3THX A;  2BE2 A;  4FCY A;  4KPY A;  3DLR A;  5B8H A;  3EY1 A;  1U47 A;  4WFN L;  5AZJ A;  4O4G A;  1NGJ A;  4Z4F A;  3Q7C A;  3O9S A;  4FVM A;  4AM6 A;  3NVK A;  4E7K A;  1T44 A;  4KHN A;  3LDP A;  1L3V A;  3SYZ A;  4B9T A;  2EHG A;  3H45 C;  4A2B A;  5LMU K;  2GX9 A;  4EZ6 A;  1NBW A;  3RR8 A;  4HWI A;  3NH2 A;  5GAG P;  4CZK A;  4DSK A;  3KKR A;  4FJJ A;  3OYF A;  1YUW A;  5J2P A;  4DR4 K;  3LAN A;  2YJF A;  2E6L A;  4FVU A;  4B3R K;  2XY8 A;  1EXQ A;  3L4Q A;  2KQ2 A;  1LCU A;  4M41 A;  4CED A;  1U45 A;  1KTQ A;  4I9L A;  3M8S A;  3ZT3 A;  1HNZ K;  3PIP L;  3ULD A;  5JVH L;  3CFP A;  3MED A;  3WEE A;  1T8E A;  2OPS A;  5AQM A;  5EX5 A;  4LSL A;  5GIP A;  3AAP A;  3BDP A;  4IEE A;  5AQP A;  2ETJ A;  4RW9 A;  4CJS A;  1TAQ A;  3CQ8 A;  1BWF O;  3CCR N;  4GV6 A;  3WXK A;  2Z1G A;  1VRU A;  4M3Z A;  2KZM A;  1RDW X;  5AR0 A;  2PFU A;  2EWS A;  4NXN K;  2RN2 A;  4CHP A;  1YI2 N;  3C95 A;  3ZX2 A;  4B08 A;  2LSN A;  3AVA A;  3MN5 A;  3SMP A;  3MN9 A;  4CGG A;  2HBK A;  3KLI A;  4OKE A;  3VQC A;  3THW B;  4A62 A;  4NO7 A;  2KFZ A;  3AVM A;  3MN7 A;  5C2D A;  3FE1 A;  1HLU A;  5C2F A;  1NU0 A;  3NBP A;  4H0O A;  1JCF A;  4M3W A;  3T69 A;  5AQY A;  4KB0 A;  1MA9 B;  1VQL N;  3G0Z A;  4Z4C A;  3HZ6 A;  1EET A;  1WAJ A;  4JRQ A;  5HLF A;  3CCU N;  4G1Q A;  3T19 A;  1NGE A;  5CHI A;  3U9D A;  5KGW A;  1BIZ A;  3O4Q A;  3DXM B;  1NJY A;  1IO2 A;  3G25 A;  1QVG M;  3KWI A;  3HTV A;  1A5W A;  4DCH A;  3OYK A;  4DR3 K;  4FM0 A;  1B92 A;  3VEY A;  3ZT2 A;  2P9N A;  4A5B A;  4HTU A;  2YHA A;  2WFB A;  3T3F A;  1X9J A;  4YDU A;  3G4S N;  1HR0 K;  1YXQ A;  2P9U B;  1HQU A;  4C8M A;  5T7B A;  4CJ5 A;  4FJK A;  4K41 A;  4MFB A;  2DPN A;  3PX0 A;  5AQU A;  3K58 A;  1U04 A;  1NJX A;  2I5J A;  1VAZ A;  4RW8 A;  2QXF A;  4E7H A;  1P90 A;  1EWQ A;  4JD2 A;  1E4F T;  1EQY A;  2WTU A;  4B9S A;  4KB1 A;  4N5S A;  2HST A;  4I2Q A;  4KI6 A;  3FFI A;  4CF1 A;  1Q8I A;  5GIO A;  1REV A;  4XH4 A;  4BR5 A;  3ZX0 A;  4DS5 A;  3H3O B;  3HT3 A;  3MXM A;  2XY7 A;  4IFV A;  4KRF A;  1NM1 A;  3LP0 A;  3CET A;  3SBG A;  2VWK A;  3CMA N;  2P9I B;  2CH6 A;  4EAH D;  4FJN A;  3ID6 A;  1ZBL A;  1K6Y A;  3KD5 E;  2UXD K;  3BF3 A;  1M90 O;  3HVR A;  3R1X A;  1WSJ A;  4FL9 A;  2PYL A;  3CI5 A;  3VEO A;  2E5L K;  1JCE A;  1N6Q A;  3SJJ A;  4CZJ A;  3SZ2 A;  3AO1 A;  1JLF A;  5DMR A;  1EKE A;  1QQO A;  1NOY A;  2X78 A;  1L5U A;  2ASM A;  2P9S A;  2CGJ A;  5FPM A;  3CER A;  4DR7 K;  3QNN A;  4H03 B;  4FLZ A;  3DLE A;  3SPY A;  5M1Q A;  5C15 A;  3D2F B;  4I7F A;  3LZJ A;  4O8U A;  3SUQ A;  3HYF A;  3THX B;  3OJS A;  1X1P A;  2G8U A;  3H46 O;  2WON A;  4RG8 A;  3TSQ A;  3OYD A;  4JKF A;  1NK0 A;  1RBU A;  2YHW A;  4B9M A;  1I3A A;  4GY2 B;  1ASW A;  4KH6 A;  3NGZ A;  1J5E K;  3NE6 A;  1X3N A;  3RRH A;  3AVH A;  4BWM A;  2ZJQ L;  3DLH A;  5FPE A;  4B3M K;  1BUP A;  4IXC A;  3MCP A;  1VSD A;  3ENB A;  4CI6 A;  1WSG A;  1LWF A;  5JMV A;  3CCS N;  2GTD A;  3F73 A;  1NK7 A;  4O44 A;  3DMJ A;  3VPZ A;  3WQT A;  2GBZ A;  3SMS A;  3EZ5 A;  2IOC A;  3TSP A;  3CCJ N;  1S6Q A;  3OS2 A;  3QO9 A;  4X62 K;  3LAK A;  2A6A A;  4DTJ A;  1QQM A;  3CQX A;  3LL3 A;  2OPQ A;  4K42 A;  3SCX A;  3LWM A;  2BTF A;  5J2M A;  4JKC A;  4ELT A;  4I6M A;  2E2O A;  3M6G A;  4H8K A;  1TYQ A;  3WEE B;  5BPN A;  1YTA A;  1KRP A;  4FZY A;  2PYJ A;  4WYB A;  4CJ7 A;  4DQ8 A;  5BRE A;  4DWI A;  4EIA A;  3F2K A;  4B9V A;  4IZ9 A;  4BVO A;  4ELU A;  2RKI A;  3IG1 A;  4JK8 A;  3NCI A;  1S1W A;  3G6E N;  4RCH A;  4CFD A;  1ZXO A;  3ALY A;  4DR6 K;  1WUA A;  4CF2 A;  4CCH A;  2G8V A;  1RDC A;  1HQE A;  1RDU A;  1NK5 A;  3KIO A;  1HKC A;  4BE0 A;  5EXW A;  3MWT A;  3MXI A;  3VQP A;  4EP5 A;  3CC7 N;  2Q31 A;  3ZSR A;  3PUF A;  1D9D A;  2UXB K;  1CXU A;  5GIN A;  2BAN A;  3O9T A;  3RSE A;  3OYE A;  4DTM A;  4CZM A;  4BRA A;  2DFF A;  1BL3 A;  1TKT A;  1NKC A;  1JLA A;  3O4N A;  4YOX A;  2VWB A;  4FK4 A;  2KKZ A;  4PQU A;  2B5J A;  4X66 K;  3SK3 A;  1HNW K;  4M3U A;  3ZT0 A;  3CF5 L;  3CPE A;  4E19 A;  1BI4 A;  3JXU A;  4RW7 A;  5J2Q A;  4A57 A;  4CFC A;  1O1W A;  3D7E O;  2D4W A;  4DMN A;  2P51 A;  3HM8 A;  3T1A A;  2P9N B;  4AHS A;  3D45 A;  4IOX A;  4ILJ A;  1FW6 A;  5CYM A;  3LPT A;  1YVU A;  3CM5 A;  3ATU A;  1RTJ A;  4IDH A;  4DSF A;  4FWN A;  4NLB A;  1B9D A;  4NYF A;  2KTQ A;  4OKJ A;  2ZJR L;  1A5X A;  2A1S A;  4J8F A;  3SV3 A;  3Q7B A;  1JXE A;  1N32 K;  4BC4 A;  1RT7 A;  5F0X A;  4BRF A;  4K8Z A;  2DFE A;  2RE2 A;  5KRT A;  1SQK A;  3ZSQ A;  1QZ5 A;  1BCM A;  1BOT O;  1NGI A;  4JD2 B;  5BPL A;  5KRS A;  4J2A A;  2HBM A;  3HM9 A;  4B3S K;  3OYI A;  2Q0U A;  2D0A A;  3E9P A;  1TL1 A;  2V51 B;  3QIC A;  4K25 A;  4ID5 A;  1G99 A;  2BGG A;  3TU5 A;  3GOI A;  2WUS A;  4CJ3 A;  4BC3 A;  2YHB A;  3ZT4 A;  1NMN A;  2UUB K;  1ZBH A;  4XH1 A;  2HBJ A;  3O3H A;  2HND A;  4ELV A;  4IOA L;  5IWA K;  3VQD A;  4DTP A;  1OVQ A;  3DLG A;  2JGU A;  4KTW A;  4BRD A;  1WOQ A;  3MAQ A;  4BAC A;  2JWK A;  3L2R A;  2X74 A;  1YJN N;  4AF1 A;  1GLA G;  1RT2 A;  3VEV A;  4GV3 A;  4N41 A;  4NCG A;  3NH1 A;  2ATQ A;  2PZS A;  4FJG A;  4ZHR A;  1LW0 A;  1RT3 A;  2P9S B;  3OBW A;  4ISF A;  3PX4 A;  4DS4 A;  4B9L A;  4ZTF A;  5FRM A;  2A41 A;  3O4W A;  4DLE A;  2XRI A;  2NLX A;  1C0M A;  3O9U A;  3D2E A;  4C1N I;  1ITG A;  3V9Z A;  5AQO A;  2HF4 A;  3HO1 A;  4L3Q A;  2NRH A;  3CJ1 A;  4M7X A;  3BUZ B;  4WQ5 A;  3BZK A;  3DRS A;  3WNE A;  5HRO A;  1SKR A;  3T7Z A;  3C6H A;  3TAR A;  1JL1 A;  2GUI A;  3VEZ A;  3BF1 A;  3RMC A;  4H0X B;  4E7J A;  4MLE A;  1NMD A;  5LL6 Z;  1RBS A;  5F2R A;  1VQN N;  3N4P A;  3BP8 A; 
#chains in the Genus database with same CATH homology
 4WF9 L;  4YOR A;  3L4Q A;  3AY9 A;  2H3G X;  1LCU A;  4FWL A;  4B1W B;  3MX2 A;  4H5N A;  4JKA A;  1RGI A;  4BGA A;  2P9K B;  4IJN A;  4B1Z A;  3BEX A;  3HRG A;  4BY9 C;  3PIP L;  1KAX A;  3AGR A;  2CH5 A;  4YOW A;  3M1F A;  5JVH L;  1C0G A;  1DKG D;  3I33 A;  2Q1N A;  3WEE A;  3E9O A;  5AQH A;  5AQM A;  3DJC A;  2IIR A;  4I6M B;  5EX5 A;  2W41 A;  3A8Y A;  1TYQ B;  4DHY A;  5GIP A;  3ULE A;  3AAP A;  4CD3 A;  3LM9 A;  4IEE A;  1GLJ O;  5AQP A;  3VMF B;  4EFH A;  4RTF D;  3SLC A;  1BWF O;  3HI0 A;  3CCR N;  3FGU A;  1MDU B;  3CC2 N;  5TKW A;  3S41 A;  4GV6 A;  3WXK A;  5EOY A;  4JKG A;  3CJ7 A;  4FWQ A;  3R3L A;  4QS7 A;  1GLC G;  1RDW X;  2NRT A;  2PFU A;  2EWS A;  4JKE A;  5AR0 A;  1ILY A;  3U4L A;  3R9P A;  4BVP A;  3O1W A;  4UY8 O;  3WT0 A;  1YI2 N;  3E1Y A;  1QZ6 A;  3ZX2 A;  1Q82 O;  3MN5 A;  3MX5 A;  3SMP A;  2GEM A;  3MN9 A;  2D0O A;  4G9Z A;  3IKM A;  2HBK A;  5AZJ B;  2QWR A;  4BQZ A;  3W3D A;  3H1Q A;  3IDH A;  5F1X A;  1K8A O;  2A3Z A;  1ESV A;  3PIO L;  2QWL A;  4CZI A;  5JIC A;  2P9L A;  4A62 A;  1C0F A;  4KH4 A;  4NO7 A;  3A5M C;  3VTH A;  2ZGY A;  2AP1 A;  4CZE A;  4IEI A;  2FSN A;  3MN7 A;  2QW9 A;  3FZF A;  5C2D A;  1Z05 A;  3FE1 A;  1HLU A;  4BRO A;  2BH1 A;  5C2F A;  2FSK A;  3WXL A;  4CBU A;  3N4Q A;  1GLB G;  4H0O A;  1VQ7 N;  1JCF A;  2E1Y A;  1BA0 A;  5FPD A;  3T69 A;  1M1K O;  5AQY A;  1MA9 B;  2JWL A;  3RSE B;  1YJ9 N;  1XQS C;  1VQL N;  3HZ6 A;  2AA4 A;  3CCM N;  3UKU B;  3M3Z A;  3CCU N;  1VQO N;  1NJI O;  1NGE A;  5AFU A;  5CHI A;  3I56 N;  3U9D A;  5AQS A;  1KAZ A;  1HUX A;  3KHY A;  3VEX A;  3DXM B;  3GDQ A;  3WXI A;  5AQX A;  3OBY A;  4M7Y A;  1XC3 A;  3G25 A;  3ID8 A;  3SAG A;  4IO8 A;  1QVG M;  3KWI A;  4C1N K;  3HTV A;  1SZ2 A;  1U2V B;  1T6C A;  3EO3 A;  4DCH A;  5LY3 A;  2NRV A;  4U7B A;  4NLC A;  1VQM N;  2QEX N;  3ZEU B;  2OTL N;  3O8M A;  3QML A;  3VEY A;  2P9N A;  2QTD A;  4A5B A;  2OTJ N;  5M1F A;  2WFB A;  2YHX A;  3MCA B;  1X9J A;  1HJO A;  3DXK A;  4YDU A;  3C0B A;  3VGM A;  5KPR A;  3J7Z O;  1ATN A;  1BDG A;  4OO1 J;  1GLF O;  3G4S N;  1S22 A;  4FPB A;  1YXQ A;  2P9U B;  4KH5 A;  3EN9 A;  4BQL A;  5H1S Q;  1VQK N;  4FWR A;  1ATR A;  3UB5 A;  3EE8 A;  4K41 A;  3CIP A;  2DPN A;  2OAN A;  3J8A A;  5AQU A;  4XH5 A;  2GWJ A;  2ASP A;  1VAZ A;  3RVC A;  3ZET B;  4A2A A;  5I9E B;  1P90 A;  4YOU A;  4YOY A;  5ADX A;  4JD2 A;  1E4F T;  1EQY A;  4CZH A;  2E1Z A;  3FR0 A;  3HOT A;  2KHO A;  4BRK A;  2HST A;  2FXU A;  3SBT A;  3E66 A;  4AM7 A;  4BRG A;  1HKG A;  3C7N B;  1IG8 A;  2P9P A;  4XH4 A;  4BR5 A;  5GIO A;  4JEP A;  3CHW A;  3LDN A;  3ZX0 A;  5KQ8 A;  3EE9 A;  3H3O B;  3MMV A;  2E8A A;  3AGK A;  2IVP A;  2QWN A;  4K43 A;  2YJE A;  1NM1 A;  2D1K A;  5AQQ A;  2ZJP L;  2NRR A;  5E84 A;  5AQL A;  3VGL A;  3ATV A;  1VQ6 N;  2QM1 A;  3CET A;  1NGC A;  3SBG A;  4MO4 A;  3CMA N;  2P9I B;  2CH6 A;  4EAH D;  5KPT A;  4PKH A;  3ID6 A;  5AQR A;  4JHD A;  2NRW A;  4FWP A;  3BF3 A;  1M90 O;  2QWQ A;  1RFQ A;  4FOI A;  4M63 C;  3VF2 A;  4BRN A;  4EHT A;  5C10 A;  2RHK A;  3CPW M;  4IWV A;  3R1X A;  2F9T A;  4FL9 A;  3UKR A;  5EVZ A;  3IUC A;  3CI5 A;  3FLC O;  3VEO A;  1JCG A;  1JCE A;  3GBT A;  4CZJ A;  2Q97 A;  1SAZ A;  1QQO A;  1DGK N;  1S3X A;  4FOE A;  4GVE A;  2ASM A;  2P9S A;  2Q2R A;  5E26 A;  2CGJ A;  5FPM A;  1E4G T;  3OA9 A;  3CER A;  3F5T A;  4WQ5 C;  4H03 B;  3SAH A;  4H0V B;  5ELZ A;  4IFE A;  5M1Q A;  3VTI A;  3L4I A;  4BR0 A;  5C15 A;  1BU6 O;  4FWO A;  2E2P A;  3D2F B;  4OPH A;  3AAQ A;  1TUY A;  1NGD A;  1Z6R A;  4IOC L;  1NGH A;  4O8U A;  3H46 O;  5AQJ A;  3K9J A;  3D2E B;  3O5B A;  5AQF A;  4WFB L;  3W0L A;  4BGB A;  3TSQ A;  5M1O A;  5GAH P;  3WUH A;  4JKF A;  1YIJ N;  5BPM A;  3CCL N;  2YHW A;  4PL7 A;  1KAY A;  3VEN A;  2E20 A;  1K9M O;  3UE5 A;  1GLD G;  4PHT X;  2HOE A;  3OHR A;  4GY2 B;  4KH6 A;  1YF5 L;  1KXP A;  3A5N C;  4WQ4 A;  2QWM A;  4Z94 A;  1X3N A;  5BN8 A;  3EKS A;  1K8K B;  3EKU A;  3MDQ A;  2I7P A;  2ZJQ L;  4FWS A;  5FPE A;  1VQP N;  4FPA A;  3H6E A;  4MLH A;  3VEW A;  5JLF A;  2YI1 A;  4B1X B;  2PAV A;  4RWT A;  2W40 A;  4YOV A;  1BUP A;  4IXC A;  3VES A;  3MCP A;  3ENB A;  4CI6 A;  1O13 A;  2NNW A;  5AZI B;  5JMV A;  2FF6 A;  3MN6 A;  3O08 A;  1QQN A;  4BRI A;  3CCS N;  2GTD A;  4PKI A;  4ILH A;  1NLV A;  4H0Y B;  3VPZ A;  3WQT A;  5AQT A;  4MO5 A;  3SMS A;  4A59 A;  3TSP A;  5AFU H;  3CCJ N;  1NGB A;  5EY4 A;  5GAD P;  4JKB A;  2FF3 B;  2P9K A;  1MWM A;  2HF3 A;  2A6A A;  1CZA N;  1QQM A;  2YX6 A;  1TUU A;  2QWO A;  3CQX A;  3LL3 A;  4O5F A;  4BRE A;  4K42 A;  1VQ5 N;  2UYT A;  1XUP O;  3IFR A;  4JNE A;  4BG8 A;  1NGF A;  3AAR A;  1VQ8 N;  2BTF A;  4OPA A;  4JKC A;  1Q86 O;  3IMX A;  2E2O A;  3M6G A;  4GNI A;  4I6M A;  3SJH A;  5GAE P;  3O9Q A;  1TYQ A;  3QFU A;  4F9O A;  5JLH A;  5M1N A;  2VGM A;  3DLL L;  3MWP A;  5TKY A;  4U67 L;  1R59 O;  3WEE B;  5BPN A;  3NVM A;  4BC2 A;  2QA4 N;  3EL2 A;  3FZK A;  3TTF A;  3M5R A;  3TSU A;  2KLA A;  4WYB A;  1X3M A;  4CJ7 A;  4DQ8 A;  3K9K A;  5BRE A;  2V7Z A;  5FPN A;  4EIA A;  1LOT B;  1V4T A;  3F2K A;  3ULE B;  1P8Z A;  5HL7 L;  5DM7 L;  4IZ9 A;  3CXC M;  3OW2 M;  1Q81 O;  1QHA A;  4BVO A;  2QXL A;  4WFA L;  3HOS A;  3CCV N;  2F9W A;  3L0Q A;  3CD6 N;  3CQY A;  1YAG A;  4JK8 A;  4BR7 A;  3I8B A;  1BA1 A;  4WQ4 C;  3G6E N;  3QBW A;  1HX1 A;  4RCH A;  3TTD A;  2ZF5 O;  1ZXO A;  4JKG B;  1T3V A;  5AQI A;  3VF4 A;  2NRZ A;  1WUA A;  2D0P A;  2E88 A;  4GV9 A;  3CCE N;  1OVY A;  1RDU A;  3WQU A;  3VER A;  3R6M A;  1NGA A;  3O9R A;  3E9L A;  1HKC A;  3KWG A;  4E1J A;  1HKB A;  5EXW A;  4H5R A;  5LJW A;  2V7Y A;  3A0I X;  3L6Q A;  5BN9 A;  2VYP A;  4FWM A;  4B1U B;  5ADX H;  3G71 N;  4CZF A;  3MWT A;  1S72 N;  2BUP A;  4BRP A;  1H1V A;  4R79 A;  4H5W A;  3B8A X;  3CC7 N;  4JN4 A;  2Q31 A;  3P38 A;  3KZB A;  2P9L B;  3O1B A;  5BRF A;  2HMP A;  5GIN A;  3O9T A;  4MDB A;  1QVF M;  3RSE A;  4DKW A;  4CZM A;  4BRA A;  1D4X A;  3UKU A;  2CGL A;  4BRM A;  4PL8 A;  5JVG L;  4LC9 B;  1KD1 O;  2VCP A;  1V4S A;  4PKG A;  5CR4 A;  3VF6 A;  5AQK A;  3WXM B;  3DXM A;  4YDU C;  4BR9 A;  4YOX A;  2VWB A;  5LJV A;  2NRX A;  2KKZ A;  3O6W A;  1HPM A;  1U2V A;  4BR4 A;  1YHQ N;  1DEJ A;  2YCH A;  2ZWH A;  3A5L C;  3SK3 A;  4C23 A;  1Y64 A;  3ZYY X;  3ZEU A;  1J6Z A;  1SS6 A;  3CF5 L;  3CPE A;  3JXU A;  3O80 A;  4JK9 A;  2ASO A;  1IJJ A;  4IJA A;  2A42 A;  5M1P A;  4MDA A;  5AQW A;  1MWK A;  3TTC A;  4A57 A;  4BRL A;  5CE3 A;  4A61 A;  2IVO A;  2GWK A;  3D7E O;  2D4W A;  3JS6 A;  1W2B M;  4IO9 L;  3HM8 A;  3CC4 N;  2Q36 A;  5C0Y A;  1NWK A;  2P9N B;  2P9U A;  3LDQ A;  1OKJ A;  3ZX3 A;  4IOX A;  4BRC A;  4ILJ A;  1KC8 O;  1VQ4 N;  3A5O C;  3DXK B;  4Y0W A;  1ZC6 A;  3LDL A;  5BR9 A;  3TPQ A;  3ATU A;  3ENO A;  4IDH A;  5KPZ A;  5BRH A;  4FWN A;  5M1K A;  4NLB A;  4JKH A;  4H5T A;  2ZJR L;  3FZM A;  3GL1 A;  3DWL A;  3ZET A;  4J8F A;  3VGK A;  3Q7B A;  4B1Y B;  4BC5 A;  3C65 A;  3EZW A;  1ZBS A;  2FLO A;  4O8K A;  4HTL A;  2GUP A;  4BC4 A;  1BG3 A;  2WC9 A;  5F0X A;  5BRD A;  3KVG A;  4KBO A;  1ATS A;  4BRF A;  3WXJ A;  2RE2 A;  3FZH A;  4CZL A;  1N8R O;  1SQK A;  3C7N A;  3CCQ N;  3QB0 A;  3PLA A;  3HBT A;  4QS9 A;  1QZ5 A;  1BOT O;  4JD2 B;  1NGI A;  4BR2 A;  1Q7Y O;  5BPL A;  2E2Q A;  2WBN A;  2HBM A;  3CJA A;  5AQV A;  3R8E A;  1K73 O;  2Q0U A;  4QS8 A;  2P9P B;  4H0T B;  4ISE A;  3E9P A;  4JKD A;  4NB4 A;  5AQN A;  3VOV A;  2V51 B;  4CZG A;  4FO0 A;  2P9I A;  4CBX A;  3QIC A;  3CJC A;  4K25 A;  1YJW N;  3HSC A;  4B9Q A;  2J4R A;  1G99 A;  2V52 B;  3TU5 A;  4YOT A;  4EHU A;  3P31 A;  2GEL A;  2IVN A;  5C12 A;  4FWK A;  3GOI A;  2WUS A;  4BC3 A;  3LDO A;  4DB3 A;  4WCE L;  1DT9 A;  5HOO A;  4CBW A;  3CME N;  1BO5 O;  4XH1 A;  3H3N O;  3D6R A;  2HBJ A;  5KQD A;  4JHD B;  3GE1 A;  1GLL O;  3QFP A;  4IOA L;  3ENH A;  3KK7 A;  4JK7 A;  3CJB A;  3QDK A;  2CGK A;  2FSJ A;  4CD1 A;  2QI2 A;  3FZL A;  1KQS M;  3UKR B;  5MLC Q;  3U8X A;  2QWP A;  2A40 A;  3FFK B;  4BRD A;  1WOQ A;  3GG4 A;  1W97 L;  2JWK A;  2YHY A;  3I55 N;  1VQ9 N;  1YJN N;  3CJ9 A;  4AF1 A;  3VET A;  4BG9 A;  1NGG A;  1GLA G;  4BRH A;  3VEV A;  4GV3 A;  2E2N A;  4H0P A;  2A5X A;  3MK6 A;  2P9S B;  3OBW A;  4ISF A;  3D2F A;  1YVN A;  5AQZ A;  1Q18 A;  2ITM A;  2A41 A;  3P39 A;  3O4W A;  4ILG B;  2ZGZ A;  2NLX A;  3O9U A;  3D2E A;  5B8H A;  4C1N I;  4WFN L;  4XEI A;  5AZJ A;  3SAF A;  1NGJ A;  2HBL A;  3Q7C A;  3O9S A;  2HF4 A;  5AQO A;  4AM6 A;  3NVK A;  4L3Q A;  1T44 A;  3DAW A;  3LDP A;  3LM2 A;  3U9Z A;  2NRH A;  1GLE G;  3P4I A;  4FSV A;  2Q0R A;  3CJ1 A;  3H1V X;  3H45 C;  3QBX A;  3BUZ B;  4H5V A;  4M7X A;  2GX9 A;  4WQ5 A;  4A2B A;  1T6D A;  3F9M A;  3C6A A;  1K8K A;  4JAX A;  4B1V A;  1NBW A;  2F7T A;  4FVU A;  2PBD A;  2NZT A;  4HWI A;  4A5A A;  5GAG P;  3T7Z A;  1YIT N;  4CZK A;  3C6H A;  3VEZ A;  5AZI A;  3BF1 A;  1YUW A;  1EO1 A;  4H0X B;  5AQG A;  4MLE A;  1NMD A;  2I7N A;  1JJ2 M;  4BRQ A;  3NMU A;  2VGN A;  5F2R A;  2YJF A;  1VQN N;  3N4P A;  4ISG A;  3BP8 A;  5DM6 L;  1U6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...