3IFRA

The crystal structure of xylulose kinase from rhodospirillum rubrum
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
492
structure length
488
Chain Sequence
RQVIGLDIGTTSTIAILVRLPDTVVAVASRPTTLSSPHPGWAEEDPAQWWDNARAVLAELKTTAGESDWRPGGICVTGMLPAVVLLDDRGAVLRPSIQQSDGRCGDEVAELRAEVDSEAFLARTGNGVTQQLVTAKLRWIERHEPAVFGAIATVCGSYDYINMLLTGERVVDRNWALEGGFIDLASGTVEADLVALAHIPPSAVPPAHPTHRVLGAVTAEAAALTGLPTGLPVYGGAADHIASALAAGITRPGDVLLKFGGAGDIIVASATAKSDPRLYLDYHLVPGLYAPNGCMAATGSALNWLAKLLAPEAGEAAHAQLDALAAEVPAGADGLVCLPYFLGEKDPFASGTFTGLSLSHTRGHLWRALLEAVALAFRHHVAVLDDIGHAPQRFFASDGGTRSRVWMGIMADVLQRPVQLLANPLGSAVGAAWVAAIGGGDDLGWDDVTALVRTGEKITPDPAKAEVYDRLYRDFSALYATLHPFFHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of xylulose kinase from Rhodospirillum rubrum
rcsb
source organism Rhodospirillum rubrum
molecule tags Transferase
molecule keywords Carbohydrate kinase, FGGY
total genus 144
structure length 488
sequence length 492
chains with identical sequence B
ec nomenclature ec 2.7.1.17: Xylulokinase.
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain
A PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ifrA02
1IJJA 1QQMA 4B1XB 3ENHA 3GOIA 2D1KA 1ZC6A 3LDPA 2Q0RA 3IMXA 4FWNA 4A62A 3R6MA 1BUPA 1QZ6A 1QQNA 3D2FA 4EAHD 3J8AA 4XH5A 2Q0UA 3CQXA 4GNIA 1IG8A 3DXMA 1U6ZA 5EOYA 4WQ5A 2CH5A 3H3OB 4JD2A 1HPMA 4L3QA 2CH6A 3ZX0A 4XH4A 1GLLO 3WXLA 1NGIA 5KPTA 1GLCG 4M7YA 3C7NB 2PAVA 4K43A 1C0FA 5ELZA 3AARA 2YJFA 4PKHA 4DB3A 5AZIA 2YCHA 1BWFO 3UKRB 4FWKA 4CZLA 3BEXA 1YXQA 2J4RA 4MLHA 3H6EA 1KAXA 1Y64A 2Q2RA 4B1WB 1CZAN 1NGCA 1GLBG 2H3GX 4A2BA 5BREA 1BU6O 1Q18A 3F9MA 3LDLA 2ZGZA 3HSCA 5AQOA 2UYTA 4BQZA 2Q97A 1KXPA 4FWRA 2QXLA 2A3ZA 4MO5A 4XEIA 1JCFA 2CGJA 5AZJA 3M6GA 3CHWA 1XC3A 4H0XB 1RGIA 2ASOA 2FF6A 4A2AA 3WEEA 5AQUA 2DPNA 4DCHA 4CZMA 5BPNA 3QFUA 3FZHA 5JMVA 4Z94A 5LJVA 1LOTB 5AQTA 3O80A 2ZGYA 4BRIA 4RCHA 2GELA 2BTFA 5AQXA 4DHYA 3SJHA 5EVZA 4IWVA 1V4TA 3VGMA 2QWMA 3HM8A 4BRLA 4K41A 3EKUA 1X9JA 3CJCA 4WQ4A 3MN6A 3BUZB 1X3MA 3IDHA 1NGFA 1S3XA 5AQQA 4ISGA 3WQTA 4CZFA 3UE5A 4CZJA 3IFRA 4FWLA 5FPNA 2EWSA 2NRHA 3MCPA 3A5LC 4JHDB 4H5VA 3VF6A 2HF3A 2IIRA 3DXKA 5BPLA 2QWPA 4CBXA 3LL3A 3ZEUA 3AAPA 2P9PA 1U2VB 3BF1A 4BRNA 4FWQA 3ID8A 1XUPO 4KBOA 4FPBA 1GLFO 3QFPA 4BRFA 2IVNA 1K8KB 3A0IX 4PKIA 4ISEA 5EX5A 3D7EO 2YHWA 2A6AA 1SAZA 2HF4A 5FPDA 3D2EA 5ADXH 5AQRA 3CIPA 3MN7A 2W40A 3EO3A 3CQYA 1GLEG 3GE1A 4K42A 5AQVA 4EIAA 1MDUB 3FZMA 3FZKA 4XH1A 1ESVA 3W3DA 2D0PA 3VGLA 5I9EB 4JN4A 3BP8A 4J8FA 4IXCA 3U8XA 1K8KA 2IVPA 4YDUC 1C0GA 1JCEA 1QZ5A 3W0LA 1P8ZA 2ASMA 4M63C 4BROA 4H5RA 2HOEA 2AP1A 2GEMA 3GL1A 5BPMA 3ZX2A 1WUAA 3FFKB 3D2EB 4HTLA 1E4FT 5JICA 2P9IB 2P9IA 3VEWA 5BRHA 1QHAA 3DJCA 3HZ6A 3A5MC 4K25A 3TPQA 5F0XA 1MWMA 2QW9A 2A42A 2E2QA 3QMLA 3ENOA 1HLUA 3SK3A 4BQLA 3L6QA 3O4WA 5AQPA 3MDQA 1QQOA 1ATNA 3QICA 3OHRA 3FR0A 3DXKB 4BRMA 4JHDA 2IVOA 2ASPA 3G25A 3H45C 4BC5A 1EQYA 3M1FA 5AQLA 1NGJA 2ITMA 1ATRA 4HWIA 2E1ZA 3IUCA 4WQ4C 3I8BA 3M3ZA 2FF3B 4BC4A 1BA0A 2FSKA 5AQFA 4B1VA 4CZGA 4BR4A 2CGKA 3MN5A 1U2VA 2E20A 2QWLA 4PL7A 1MWKA 3CJ1A 3H3NO 5AQKA 3C7NA 3S41A 5KPRA 5E84A 1KAZA 4BR9A 1ZBSA 4H0YB 2AA4A 3QBXA 3VOVA 1HKBA 3WQUA 5AQWA 1DEJA 1HUXA 1HX1A 2FSNA 4MO4A 3DXMB 4B9QA 3A5NC 2A41A 3MMVA 4IO8A 4FL9A 3CETA 1OKJA 4FWMA 5BN8A 3FZFA 4H5WA 3CJ7A 3O08A 3QB0A 2Q1NA 3MK6A 5AR0A 3FGUA 4Y0WA 5KPZA 1TUYA 3H46O 3HI0A 3CJ9A 2YJEA 1D4XA 4EHUA 2E8AA 5FPEA 4AM7A 3UKRA 3VESA 1S22A 2QWRA 5BRFA 2ZF5O 2QWQA 1MA9B 3O6WA 3VENA 4M7XA 4BVOA 4CD1A 1Z05A 3WT0A 3WXJA 1ATSA 5AQJA 1SQKA 3WEEB 5AQMA 1RDWX 4CD3A 3LDNA 5AQZA 4BRAA 1V4SA 4CI6A 3LDQA 4O5FA 4ISFA 4AM6A 4BRCA 2P9PB 2ZWHA 1YVNA 1H1VA 3ZEUB 4C23A 1X3NA 3VERA 3SMPA 2VWBA 4F9OA 1T44A 1NGDA 4E1JA 4H0OA 3O1WA 3R9PA 4BRHA 3A8YA 1E4GT 2QWOA 4FSVA 3LM9A 2GTDA 3EN9A 4FPAA 3EL2A 4I6MB 2E88A 3DAWA 1NGBA 2NLXA 4H03B 3GDQA 3UKUB 2W41A 1G99A 3P4IA 4BGBA 5BR9A 5AQNA 3CI5A 4RWTA 3VEVA 3VPZA 2QM1A 3AY9A 5EY4A 4CJ7A 3EKSA 2P9UB 4H0TB 1NGHA 3VF2A 4BRKA 2KHOA 1GLJO 3JXUA 1SZ2A 4BR2A 3O1BA 5LJWA 3AAQA 1NGGA 3VGKA 4EHTA 4IJAA 3KHYA 3FE1A 2P9KA 5BRDA 4B1ZA 3L0QA 1HKCA 1R59O 3FLCO 1ZXOA 5B8HA 4EFHA 4GY2B 2V52B 2P9LA 3U9DA 2NZTA 3MN9A 1J6ZA 2FLOA 5AZJB 5AFUH 2E2OA 3CJAA 3HBTA 2D0OA 3QDKA 1NGAA 4LC9B 4BC2A 5EXWA 2V51B 2Q31A 2GWJA 3H1VX 3U9ZA 2YHYA 2E2NA 4CBWA 2I7PA 1HJOA 2I7NA 5BN9A 3I33A 1NBWA 5F2RA 3RSEA 3KZBA 4DQ8A 3ATVA 5AQHA 4BRPA 3VEZA 4BRDA 2F9TA 1LCUA 4BGAA 2A40A 5KQ8A 1XQSC 1RFQA 5AZIB 2QWNA 2V7ZA 4CZEA 5AFUA 1WOQA 1NMDA 1BA1A 2HMPA 4NB4A 1TUUA 1NM1A 2YI1A 3VEXA 3L4IA 1T6DA 4I6MA 4JD2B 4B1UB 2GUPA 5AQYA 2VCPA 2PBDA 1NWKA 4JAXA 3U4LA 1T6CA 5JLHA 4IZ9A 4CBUA 4CZKA 4BG9A 3CERA 2P9KB 4WYBA 4BR0A 3DWLA 3A5OC 4PL8A 3LDOA 1YAGA 1DKGD 2P9SB 4FWSA 4YDUA 3C0BA 1JCGA 3EZWA 1NLVA 4WQ5C 3VETA 3H1QA 4BC3A 2E2PA 4JNEA 2CGLA 3KVGA 4QS9A 2GWKA 4BREA 5F1XA 4H0PA 2Q36A 3LM2A 3B8AX 2A5XA 4QS8A 4BVPA 3WXKA 1KAYA 4NO7A 4IJNA 2P9SA 2D4WA 3CJBA 4FOEA 3WXIA 4H0VB 3ULEA 2FSJA 5AQSA 3UKUA 1NGEA 2P9NB 1TYQB 3SLCA 1GLAG 3O5BA 1BDGA 3GBTA 5KQDA 5FPMA 4CZHA 1GLDG 3D2FB 4BRGA 1BOTO 2WUSA 3HTVA 2FXUA 3VEOA 4BR7A 3ZETA 5AQGA 2YHXA 3ATUA 3ZETB 3TU5A 2BUPA 5E26A 1DGKN 4FWPA 4BRQA 4H5NA 4O8KA 3GG4A 4QS7A 3BF3A 2F9WA 5ADXA 2P9UA 3UB5A 4BR5A 1Z6RA 5JLFA 2P9LB 5CE3A 1BO5O 1TYQA 1HKGA 2P9NA 2V7YA 3ULEB 2OANA 2E1YA 5LY3A 4CZIA 4H5TA 5AQIA 3SMSA 4MLEA 4FWOA 3R8EA 4FO0A 4RTFD 4BG8A 1YUWA 4PKGA 1BG3A 5TKYA 2VYPA 3FZLA 4FOIA 3VF4A 4B1YB 3O8MA 3RSEB 3ZX3A 3QBWA 4A61A 3VEYA 3JS6A 3WUHA
chains in the Genus database with same CATH superfamily
1IJJA 3GOIA 4ILGB 2YKNA 3N4QA 2Q0RA 2QA4N 3C6TA 4B3RK 3CM5A 4DTSA 3R6MA 1BUPA 3F9KA 3D2FA 3L8BA 1BL3A 4XH5A 3CQXA 4GNIA 1U6ZA 2YX6A 5GIOA 1HPMA 4L3QA 2CH6A 2VG6A 4DR5K 1YJ9N 1CLQA 5JVGL 1GLLO 5KPTA 4M7YA 1XHZA 2PAVA 1C0FA 2BDPA 4KFBA 2YJFA 4PKHA 1T03A 4DB3A 3VQ8A 1EWRA 1BWFO 3IG1A 2XY7A 2NNWA 2G8FA 3K9KA 4MLHA 4FJ7A 1YJNN 3KLGA 3MAQA 1B9FA 1RDCA 4CW7B 2KW4A 3P39A 1X1PA 1IBKK 4BWMA 3KIOA 1SL2A 3ZLJA 1BIUA 2RHKA 1J53A 4AF1A 2A3ZA 1IKYA 4MO5A 2CGJA 4X65K 3K5LA 3CCRN 3CHWA 1XC3A 2ASOA 1BCOA 4B9VA 3OA9A 3AVKA 3SUNA 1D8YA 4AHTA 2VG7A 1WAJA 5BPNA 2OPRA 3NGIA 4QCLA 2BANA 4F2RA 4KHQA 4B8CA 2X78A 2ZGYA 4BRIA 5AQXA 1EKEA 3CG7A 3M8RA 5HP1A 3VGMA 3TSUA 3C6HA 3RVCA 3OYAA 4O55A 4WFBL 3VMFB 5HRPA 4WQ4A 4HCCA 4IDHA 1X3MA 1VQKN 3L3UA 5M1OA 4KKOA 1QS4A 3UE5A 3QEXA 1Q86O 3A5LC 4H5VA 2HF3A 1W2BM 4DG1A 2W6LA 5BPLA 3HVRA 5TKWA 2HB5A 1EX4A 3AAPA 3DI6A 4AILC 1U2VB 4OX9K 1FK9A 1HYZA 4BRNA 3OYMA 4FPBA 1GLFO 4C8OA 2IVNA 1D9DA 4PKIA 3AVHA 1TL1A 3HYFA 1WSIA 3A2FA 2IAJA 4PHTX 4B9LA 3LPTA 1VHXA 5AQRA 3CIPA 3MN7A 1JJ2M 4O44A 3EO3A 4CHZA 5AQVA 4EIAA 4DLEA 3FZMA 2O8DB 3CCMN 2O8CA 3DLEA 2O4IA 3VGLA 3CCLN 3CCUN 1NMNA 3C6AA 1NK8A 4J8FA 3PUFA 2IS3A 4J2EA 2IVPA 2YNFA 1LWFA 4YDUC 1C0GA 1JCEA 4B9UA 1S1UA 4BROA 1HR0K 3DLHA 4YNQA 4B08A 1YJWN 5HL7L 3ZX2A 3DRSA 4KH4A 3CCVN 4AHRA 1L5UA 2P9IB 1SS6A 3EY1A 3EZ5A 1QHAA 1NK5A 3VQDA 3HO1A 3QMLA 4YOUA 3KD1E 4DUZK 1ZBFA 3SK3A 4BQLA 3OY9A 3L6QA 3O4WA 1ATNA 3OHRA 3DXKB 3D0PA 4LSLA 3TWHA 3G25A 4BC5A 1EQYA 1TK8A 4BE0A 1RT3A 3AVIA 1ATRA 4YOYA 1E3MA 4CJ4A 2UUCK 4B9SA 2IOCA 3M3ZA 1IKVA 4CHYA 4B1VA 2F8TA 2E20A 2QWLA 2HBJA 3VQCA 1BI4A 3CJ1A 3T3FA 1YIJN 4LFCK 3H3NO 3S41A 1EWQA 1NJWA 2WOMA 2AA4A 3VOVA 1HKBA 4Q0BA 1BI4B 4NLCA 3P5JA 5AQWA 1UA1A 4CEOA 3V9SA 3NMUA 3A5NC 4IFEA 5GAGP 5M1NA 4IO8A 2LSNA 1K9MO 4O4GA 5AJ3K 4LF6K 2FC0A 3O08A 3MK6A 2PFUA 1TUYA 1K8AO 1VQON 3CMAN 1D4XA 5A2QO 2XY6A 2E8AA 1NJZA 1S22A 2QWRA 1ASWA 3OYFA 5J2MA 2QWQA 5M1KA 3O6WA 4DF4A 4I2PA 1U45A 2HHWA 1N6QA 5BR8K 2YHBA 3WXJA 4OVLA 4CD3A 4DFPA 1UAXA 3LDNA 2DY4A 5AQZA 4KPYA 2A1RA 3E1YA 3LPUA 4FVMA 4M45A 4AM6A 1S9GA 2JGUA 2ZWHA 4JKGB 1HNIA 3J7ZO 4GV6A 1NK6A 3Q7BA 1XNQK 4FJNA 3VQPA 4CVNE 1NKBA 3U3YA 4E7LA 4E89A 3O1WA 3R9PA 2XY5A 2QWOA 4YHHK 3EN9A 1WSFA 2E88A 2KKZA 4LF4K 3UKUB 1G99A 2ITGA 4JV5K 3KLIA 4M3YA 4BGBA 3V4IA 1HRHA 4CEEA 4H0TB 3HOSA 4BRKA 4JI5K 1GLJO 4FJHA 3DLBA 5C2FA 3C95A 4ICLA 5CZ2A 2G8UA 1HJRA 3O1BA 3K0SA 1LW0A 4DV1K 1XMOK 4IJAA 1EETA 2YNHA 5J2PA 4CJPA 4KH5A 3L0QA 4J2DA 4C8LA 3L2VA 1NKEA 2P9LA 4DTJA 3U9DA 3MN9A 1J6ZA 4DR4K 2FLOA 3P31A 3CJAA 1KFDA 3AA3A 3QDKA 1NGAA 1JLCA 2I7PA 1HJOA 3KK3A 4ID1A 4AHUA 2HHSA 2PYLA 4JI6K 4CJSA 4CJLA 1TGOA 3DOKA 4FLVA 5CR4A 1O13A 3KZBA 5DK5A 4NXMK 1OH5A 3ATVA 4HUGA 1NKCA 3VEZA 1K6YA 3SQ4A 2QKBA 5KQ8A 1ASVA 4CJ3A 1BISA 5E41A 2HMPA 1NM1A 3SI6A 1QE1A 1RDDA 1T6DA 4I6MA 4JD2B 4DV3K 2ZE2A 2P5GA 4M3TA 2WC9A 5DM7L 1TKZA 4JLHA 2RN2A 4JAXA 5JLHA 1T6CA 1F21A 4IZ9A 3LP0A 4CBUA 5HBMA 3ZSQA 3CERA 1HYSA 2E6LA 2P9KB 1WAFA 3HSTB 4WYBA 4DTNA 1RT1A 5IT9O 3QEVA 2O8FB 1B9DA 4CFBA 1YAGA 1DKGD 4FZYA 3C0BA 3T69A 4CJKA 3NE6A 3VETA 4KHNA 2P1JA 1Z26A 1KC8O 2HSTA 4AQYK 5F1XA 5M1PA 2A5XA 4DR6K 4FOEA 5FRMA 3B6PA 1S72N 5KTQA 2W42A 2G8WA 3LANA 4YFUA 1P90A 4CHPA 3M8PA 1U04A 2UXDK 1BDGA 3G10A 3SNNA 4DU1A 2F96A 2UUAK 5KQDA 5FPMA 2YKMA 1GLDG 3D2FB 4BRGA 3THVA 3HTVA 4BR7A 1SL0A 3RRHA 4N76A 3I55N 2YHXA 3ATUA 1C0TA 2W6KA 4AH9A 1TVRA 5E26A 2GUIA 4H5NA 4O8KA 3L2QA 4M3RA 3ZT3A 3CF5L 2P9UA 3UB5A 4BR5A 1VQ5N 1Z6RA 4FW1A 5JLFA 4FJ8A 4CGFA 1X9WA 1TYQA 2V7YA 3G0ZA 5MLCQ 3E9LA 4CZIA 5AQIA 1VSJA 3SMSA 4FWOA 4CGDA 1YUWA 2Z1GA 4GW6A 2VYPA 3OW2M 4JKDA 2HHQA 4FOIA 3DLGA 1KVCA 3O8MA 3OYGA 3QBWA 1TAUA 1W97L 5SWMA 1RCHA 4JI0K 4GVMA 2O8FA 1QQMA 3ENHA 1T8EA 2Z1HA 5JS2A 4OLAA 4Z4CA 1ZC6A 1RDUA 3IMXA 3O9QA 3THXA 4GV9A 3J8AA 3RMBA 1C0UA 1IV0A 4WQ5A 2DTUA 2CH5A 2HHUA 1CXQA 4ELUA 1XNRK 1GLCG 3J81O 4JI1K 3TANA 5CY4A 5KGWA 1HNWK 3G71N 2IC3A 5M1FA 1GOCA 5AZIA 3NF9A 5C42A 3JSMA 3CFPA 1T7PA 3UKRB 3TAPA 2HNYA 2G8KA 4DSJA 4DWIA 3V81A 4KHWA 3H6EA 2Q2RA 1QSYA 1CZAN 3F2KA 1J5EK 1J5OA 1NGCA 2H3GX 4A2BA 5BREA 1BU6O 1Q18A 5KRSA 3LDLA 2ZGZA 1RBTA 1YF5L 2UYTA 3OS1A 1N34K 4DR3K 4U67L 2ATQA 1RILA 4GVEA 4FWRA 4XEIA 1JCFA 1ZBUA 4H0XB 2FF6A 2DFEA 4A2AA 5J2NA 2XO7A 5CZ1A 2QI2A 1LOTB 2OZSA 4DQIA 4CIGA 5DM6L 3MX5A 3VQ7A 4CK2A 3ZT0A 4FZXC 1B92A 1Q9XA 2GELA 3KWIA 3ZSXA 4DMNA 2JWKA 3SJHA 3ZSWA 4DHYA 4YOXA 4IWVA 3LWMA 1N32K 1JL1A 2NRVA 3KLHA 4LD0A 1X9JA 3G4SN 5HLFA 1ZBLA 3OYNA 1J9AA 4CF9A 1NK0A 3MN6A 2HBKA 3E66A 4YOVA 2D0BA 3IDHA 1L3TA 3VN5A 1NGFA 2HW3A 4CEAA 3IFRA 4FWLA 4X64K 5FPNA 2EWSA 3MCPA 4JKBA 4JHDB 3RMCA 2IIRA 3CCQN 3DXKA 3ZSYA 2QWPA 5C15A 4CBXA 3LL3A 3ZEUA 3MXIA 4OO1J 2P9PA 4C1NK 3BF1A 4OLBA 3ID8A 4MDAA 4FYDA 1XUPO 4KBOA 4KAZA 3QFPA 4BRFA 3DRPA 1K8KB 3A0IX 3QIOA 3THWA 5EX5A 3D7EO 3CC7N 2A6AA 3AO1A 1JLQA 3N4PA 3OS2A 3AVMA 4NYNA 4C8KA 3L4QA 4OGEA 3SQ1A 2W40A 1HNVA 4DSEA 3TABA 4NCBA 3WNHA 1SUQA 3FZKA 2WTUA 4CJVA 4DR7K 5K14A 3HM9A 2D0PA 3E01A 3MXJA 3LZIA 3EEQA 4DS5A 3PLAA 1VSIA 2O8BA 4ID5A 4QAGA 1VRUA 2HMIA 1QZ5A 3P1GA 4B9TA 2KFNA 3OYLA 3CPWM 3CFOA 4H5RA 2AP1A 3TAQA 3LP3A 4CFAA 4FJXA 4F3TA 3CCJN 3AA5X 3VEWA 4FZZA 3I8DA 1FJGK 4K25A 3HZ6A 1BIZA 5F0XA 3OYDA 1MWMA 3OBYA 4ELTA 3SAGA 4NCGA 4DTXA 4O5BA 3MDQA 4KRFA 1QQOA 3FR0A 3RMAA 4BRMA 1T05A 4PWDA 4W5RA 2ASPA 1YI2N 3VTHA 1NOYA 2NUBA 3R1XA 4LFBK 3IKMA 2O4GA 4A5AA 3IUCA 4FLUA 4HUFA 1Q82O 1Q9YA 1Q8IA 3AO5A 2ZJRL 4BR4A 3D45A 4PUOA 1U2VA 3ULDA 2EX3A 1IKWA 5AQKA 4KTZA 4DV5K 4KB1A 5E84A 3DLKA 4KREA 4H0YB 1S6QA 3QBXA 3VQBA 1ILYA 4KO0A 1HX1A 4MO4A 3DXMB 3NBPA 4B9QA 3ID6A 4CK3A 4FL9A 3CETA 2FBXA 1O1WA 4FWMA 3EE9A 2FBYA 3VQ4A 5AR0A 2Q1NA 4IEIA 2YHAA 3NF8A 3TI0A 4K8ZA 1T3VA 2G8HA 1M90O 3CJ9A 2YJEA 2KQ2A 4AM7A 2HNDA 3THYA 4LFAK 1VSLA 3V6DA 1S5JA 3VENA 3OYHA 2D0AA 4W5NA 4JKEA 4BVOA 3NVKA 1Z05A 4I2QA 4PY5A 3WEEB 1XHXA 1K73O 2O8EA 5FLXO 1V4SA 4O5FA 4HVJA 2YNGA 3R3LA 3AVLA 4LF9K 3THXB 4BY9C 4C23A 1YVNA 2ZQBA 4CF2A 4YOWA 4DTOA 3VERA 3SMPA 3TAFA 3IS9A 3SAHA 2VWBA 4DV2K 1T44A 3HP6A 1KCFA 2KTQA 3KLEA 3LM9A 3SPYA 1NGBA 4OPKA 1TV6A 3OTOK 1BGXT 5BR9A 4JK8A 2B6AA 4IDKA 4BE1A 4KTQA 5EY4A 1NGHA 4HUEA 2KHOA 3CCSN 3JXUA 1SZ2A 3NH2A 4FM2A 1WBBA 3UIQA 4BR2A 1JLEA 1ZBHA 4Y1CA 3AAQA 1NGGA 4EHTA 5C2DA 3FE1A 1OH6A 1HKCA 1R59O 3CCEN 5B8HA 3DLRA 4GY2B 2V52B 4EFHA 5C0YA 2NZTA 3L3VA 5AFUH 5AZJB 4A5BA 4CE9A 1HMVA 3C94A 4NLBA 4ILJA 4YOTA 3KKRA 3Q7CA 3U9ZA 4WF9L 4DLGA 3SQ2A 1NBWA 5F2RA 4WFAL 3O9SA 1G15A 2BE2A 1VQ6N 3VQ5A 3CPEA 4BRPA 4BRDA 2NRTA 1RFQA 2V7ZA 4CK1A 1D9FA 5AFUA 1WOQA 3KWGA 4CF8A 1NMDA 4JK7A 4JKHA 3SUQA 4LH4A 5AQYA 1C1AA 3DLLL 5KRTA 3SJJA 3WNFA 4I9LA 4CZKA 2B5JA 3T1HK 3IRXA 4FLYA 3VQ6A 1VQ9N 4E0DA 2UXCK 4BR0A 3RTVA 3A5OC 1EO1A 5CYMA 2P9SB 1VQ8N 4EP5A 4AHSA 1JCGA 3EZWA 2VQFK 4BC3A 3O9UA 3SYZA 4QS9A 4H0PA 3CD6N 3PSFA 3V1RA 3WXKA 1KAYA 4NO7A 3CJBA 4DV6K 3J80O 4H0VB 2RPIA 3ULEA 1S6PA 2ZM6K 1QTMA 4G1QA 2FSJA 5AQSA 2I5JA 1VQPN 1A5VA 4CEFA 3KK1A 1GLAG 3VQ9A 3O5BA 3OJUA 3GBTA 4Y1DA 1L3SA 4QOZB 3ITHA 4CGGA 4WFNL 1C0MA 4M3UA 3O4QA 4M41A 4BRQA 1VAZA 4DFMA 4QS7A 1L3VA 4K0KK 2JLEA 2F9WA 4DR1K 4FJIA 2O8EB 2NRRA 3NAEA 1BO5O 1KVAA 1HKGA 2P9NA 3PX0A 1LWCA 1S1TA 1NK9A 4BDYA 4W5TA 2OANA 2E1YA 4MLEA 4CEZA 3T7ZA 1IKXA 4BG8A 4E3SA 2G8VA 3RR7A 4WE1A 3SV4A 3P38A 4B1YB 4DSLA 2QK9A 3JS6A 1VK0A 3ZCMA 1ZYQA 2FBTA 2KZMA 1QHTA 2D1KA 3LDPA 2WONA 3AA2A 4DQSA 4FJGA 1QZ6A 1QQNA 3ZT1A 1Y97A 4WCEL 4M42A 3D6RA 4E7HA 3DXMA 3NHGA 5EOYA 2QXFA 3AA4A 3K9JA 1IBMK 3K57A 3SUOA 5ELZA 4RW6A 4H8KA 5GIPA 3OYKA 1IO2A 3NFAA 4J2BA 1RTDA 3BEXA 3HRGA 1YXQA 4O0IA 3OYIA 1FW6A 1Y64A 1GLBG 4DU3A 2IGIA 5AQOA 1QSSA 4BQZA 4UQGA 4DTPA 2Q97A 1REVA 3MEEA 5HRRA 4H4MA 2QXLA 2OPPA 5AZJA 3QNNA 1JXBA 3S3NA 4MDBA 3O3HA 3WEEA 4DS4A 5AQUA 2Z1JA 1R0AA 2DPNA 4DCHA 4CZMA 5HRNA 3QFUA 3FZHA 5JMVA 3AGKA 3NF6A 4FJ9A 3VQQA 1SKRA 3S3MA 2BTFA 3WNGA 3HL8A 5FRNA 1S1XA 1V4TA 4E7IA 3NH1A 5JVHL 4M3XA 2D5RA 3AVJA 3OYEA 4CEBA 3T1AA 1NOZA 4IOCL 4K41A 3EKUA 4KB0A 1NK4A 3CJCA 4DQRA 4FK0A 1HPZA 4JI4K 4CJQA 1DLOA 4ISGA 3WQTA 4CZFA 2YV0X 3HVTA 1KD1O 3ZSOA 2NRHA 2B4JA 3JAMO 4DTRA 4RG8A 2VQEK 3THWB 4CHQA 1XWLA 3V9XA 4FWQA 5KGXA 3PO4A 4B3MK 2VG5A 2YHWA 5JS1A 4I7FA 1JL2A 3V9ZA 1KSPA 1Q7YO 5ADXH 1N36K 1KLMA 1WBDA 3CQYA 1GLEG 3GE1A 3DMJA 4CIFA 3KD5E 3C65A 4XH1A 4LH5A 3MEDA 3PIPL 1S9EA 1WLJA 4Z4IA 1J54A 4C8NA 1SKSA 4CIEA 3O9TA 4YORA 3AV9A 2KZZA 1N8RO 3AVBA 5BPMA 4MQ3A 3D2EB 2E6MA 3MXMA 5LMUK 5JICA 2P9IA 3TAEA 1TAQA 5BRHA 5HROA 2UXBK 1EXQA 3CM6A 3TPQA 3SZ2A 1SL1A 1EP4A 2A42A 2E2QA 3ENOA 4JKAA 4JS4A 4GKJK 3ASMA 3QICA 3TR8A 1VQ4N 3HOTA 2X6SA 3QINA 4IO9L 3ALYA 4JHDA 2IVOA 3M1FA 1XC9A 1NGJA 3IAYA 2O8CB 3NVMA 4HWIA 2E1ZA 4WQ4C 3I56N 3G6EN 2DFFA 4DFKA 3K5NA 1YHQN 2OTJN 4CGIA 2FF3B 4BC4A 5AQFA 4CZGA 3K5OA 4A57A 3TTFA 3C7NA 3TAGA 4E1NA 1ZBSA 2PY5A 1DEJA 2FSNA 4G9ZA 4GMJB 1C1CA 1W0HA 1RTHA 1VQNN 3PIOL 1RT2A 3M8QA 1RT7A 1OKJA 5BN8A 3CJ7A 2VWJA 3T19A 3QB0A 4K8XA 3FGUA 4Y0WA 5KPZA 3H46O 3HI0A 3L2RA 4EHUA 4B9MA 4BDZA 2XRIA 3LP2A 4X66K 3KJVA 4DKWA 2F4VK 1Q81O 3WT0A 3E9PA 4B3TK 4JEPA 4FLXA 1S1VA 3QNOA 3SV3A 4CI6A 4ISFA 4DQQA 1RBUA 1ITGA 2P9PB 3QIPA 5EU7A 1H1VA 3ZEUB 4Z4FA 3MCAB 1RBVA 5LMNK 3ZT4A 4EZ6A 1TK5A 4Z4EA 4F9OA 1QQCA 3DRRA 3I0SA 4E1JA 4DU4A 1S1WA 2XHBA 4BRHA 3A8YA 2O8DA 4DFJA 1FKOA 2GTDA 4FPAA 4IG3A 3DAWA 4H03B 2NLXA 3EE8A 3GDQA 2ZJQL 2W41A 4DV0K 1YT3A 3P4IA 3QESA 3BDPA 4CCHA 1VSDA 3VPZA 2QM1A 3V9WA 1QVFM 3V9UA 3EKSA 3VF2A 3OYJA 3LP1A 3PV8A 1KRPA 3J7YP 4DV7K 2OCEA 3BZKA 3ZYYX 5D3GA 5LJWA 4KHYA 2BGGA 3VGKA 1RBSA 3RWUA 3KHYA 2P9KA 5BRDA 1RDBA 1ZXOA 4N56A 2OTLN 4CJEA 4CHNA 4FJMA 3WXMB 5FROA 2P51A 3AO2A 4BC2A 4KV8A 1CZ9A 1WSGA 3NH0A 2GWJA 4CJ5A 4W5OA 2YHYA 2E2NA 2I7NA 4Q5VA 4FLWA 5GAEP 3K59A 3QO9A 5GAHP 3AO3A 2OPQA 4N5SA 4IEEA 4JS5A 4E7JA 4DQ8A 5AQHA 3ISNC 1LCUA 4BGAA 2A40A 5GADP 1RNHA 1XQSC 5AZIB 3EYZA 1KLNA 3K2PA 4CFDA 1BA1A 4NB4A 3L4IA 1LW2A 4CF1A 4C1NI 2GUPA 4RW8A 3AVGA 3M8SA 1NWKA 3SBGA 3F73A 3CFRA 4HHTA 4O8UA 4C8MA 1TKDA 3DWLA 1Z25A 4PL8A 4EP4A 1VSMA 4LF7K 4DSFA 4FWSA 3O9RA 3VA3A 4FJJA 2F8SA 4ILHA 4WQ5C 2OZMA 2E2PA 3KVGA 1OVQA 4BREA 2FBVA 2Q36A 3KK7A 5CHIA 1MU2A 2KLAA 4RW7A 1WNSA 1OH7A 4KI6A 5J2QA 3E9OA 3V1QA 3SAFA 3UKUA 1TL3A 1NGEA 2X6NA 1TYQB 3THYB 1ASUA 3U3GA 4IOXA 3KK2A 3LWLA 4CZHA 3F5TA 4RW4A 3NGZA 4OPHA 2FXUA 3ZETA 4FLZA 1NNEA 5AQGA 3TTCA 1YTUA 3ZETB 1BHLA 3TU5A 2BUPA 4CJUA 4JKFA 3T1YK 3BF3A 3O3GA 2E4LA 2ZD1A 1YTAA 2P9LB 3NDKA 3HPOA 4CEQA 4E19A 4CF0A 1SKWA 1CZBA 4KHPK 4H5TA 1WB9A 3R8EA 4RTFD 1M1KO 4ZTJA 1I94K 1VSKA 1L3UA 1GOBA 3FZLA 4IG0A 5C24A 1VSHA 5HOOA 3RRGA 3RSEB 3ZX3A 3PX6A 5J1EA 3OS0A 3WUHA 1D5AA 4FM1A 4B1XB 5T7BA 2XY8A 3S9HA 4JI3K 4BE2A 3SQ0A 4FWNA 3OJSA 4A62A 4EAHD 4KTWA 2Q0UA 1IG8A 3H3OB 4JD2A 4CESA 3ZX0A 4XH4A 3WXLA 1NGIA 3C7NB 2HVHA 4CGJA 4K43A 4F8RA 3AARA 4Z4HA 3I0RA 2X74A 2OA8A 2YCHA 1OVYA 5KI6A 3LALA 1TK0A 4FWKA 4CZLA 4CJRA 4IFYA 3OVNA 3WNEA 4V19S 5C25A 2J4RA 2RF2A 1KAXA 4BWJA 4B1WB 3L2WA 1VQMN 4KHSA 1RT6A 1DTTA 1VQLN 2GBZA 3F9MA 4OPAA 3HSCA 1OH8A 2HHXA 2F7TA 1KXPA 3MECA 4Z4GA 3M6GA 2GV9A 1U4BA 2Z1IA 2A1SA 1RGIA 2NRXA 3TSQA 1VRTA 1NJYA 4DQPA 4GV3A 2KFZA 4ZTFA 3DYAA 4OKKA 5LJVA 4Z94A 4F2SA 4PA1A 5AQTA 4JRQA 3O80A 4B9NA 5C12A 2NRWA 4RCHA 2JWLA 3RR8A 1U48A 4FJLA 3DOLA 2OYQA 3HP9A 3PSIA 5EVZA 3SPZA 4HCBA 2QWMA 3HM8A 4BRLA 1CXUA 3PY8A 4CGHA 3V1OA 1KVBA 4NCAA 3SBTA 3CC2N 2Y1JA 3TARA 3BUZB 1U49A 3H08A 4KH6A 3NF7A 4FJKA 1S3XA 1YVUA 5AQQA 2P5OA 4J2AA 4CZJA 3CXCM 1WN7A 3VF6A 1JXEA 4BDPA 2HNZA 2Q3SA 3C6UA 3ZSRA 4O0JA 3QEIA 1W7AA 2HHVA 1C6VA 4JKGA 4W5QA 3J7AP 1RDAA 3O3FA 3BZCA 2VGNA 3HXMA 1FKPA 1HQUA 1NJXA 1X9SA 3LAKA 4ISEA 2PYJA 3CQ8A 3TTDA 1SAZA 2HF4A 4JK9A 5FPDA 4JKCA 3D2EA 4KI4A 1BCMA 4JI8K 3P83D 4K42A 1MDUB 1RTJA 1LAVA 3AVCA 3QEWA 3AVFA 3KKSA 1ESVA 4NXNK 3W3DA 4DV4K 1WSJA 4A59A 5LL6Z 4N41A 5I9EB 4JN4A 3BP8A 4F3OA 5C10A 3BGRA 3U8XA 4IXCA 2YNIA 1K8KA 4EZ9A 4DSKA 4DUYK 3PX4A 3W0LA 3VA0A 1P8ZA 2ASMA 4M63C 1QSLA 2HOEA 2GEMA 3GL1A 1IBLK 1WUAA 3FFKB 4BACA 3DM2A 3QLHA 4HTLA 2QTDA 1E4FT 2VWKA 3DJCA 1NJIO 3A5MC 3K58A 3MWPA 2QW9A 2HHHK 1HLUA 4OPJA 1I39A 3SUPA 5AQPA 2GX9A 4OKEA 2HBLA 3OYBA 4IKFA 1U47A 4E1MA 2QKKA 4CEDA 4DR2K 3H45C 5DMRA 5AQLA 2ITMA 4IOAL 3I8BA 2HBMA 3KLFA 1BQNA 4OGCA 1BA0A 2FSKA 1LWEA 2R7YA 2VGMA 3ZSVA 2CGKA 3MN5A 4PL7A 1MWKA 1TKXA 1W9HA 3ENBA 1KQSM 5KPRA 1KAZA 1VSFA 4DF8A 4BR9A 4FLTA 1UWBA 2ETJA 3WQUA 1HUXA 3MX2A 1ZBIA 2WBNA 2A41A 3OBWA 4JYAK 3MMVA 3KTQA 2EHGA 3FZFA 4H5WA 3HT3A 4ELVA 4JI7K 4KHUA 3VQAA 4OKJA 1HNZK 2G8IA 1JLAA 4JI2K 3AVAA 4OJRA 5FPEA 5H1SQ 3UKRA 3VESA 4X62K 5BRFA 3LDSA 1NK7A 2ZF5O 1A5XA 1MA9B 1SV5A 3O4NA 4M7XA 4CD1A 1UOCA 1ATSA 1JLFA 5AQJA 1SQKA 1WSHA 5AQMA 1RDWX 5GINA 4BRAA 3LZJA 3OYCA 3LDQA 4AHCA 3TAMA 4YY3K 4BRCA 4MFBA 4DTMA 4ZHRA 4LF5K 4AHVA 4CFCA 1X3NA 2QEXN 2O8BB 1JKHA 4IBNA 1I3AA 4FK4A 1LV5A 3S3OA 1NGDA 4XIUA 4H0OA 2E5LK 1LAWA 4M3WA 1E4GT 4FSVA 4PQUA 5I3UA 3MEGA 1RTIA 3EL2A 4I6MB 3M5RA 1RBRA 4DTUA 1TKTA 4E7KA 1C1BA 1DTQA 5AQNA 3CI5A 3LAMA 5I42A 4RWTA 3VEVA 3AY9A 2Y1IA 5CYQA 4CJ7A 3PO5A 4FXDA 3VQEA 2P9UB 4DSIA 3CYMA 4M3ZA 1WSEA 4U7BA 3HJFA 2RKIA 1XMQK 2IDOA 2PZSA 3AVNA 1RT5A 1A5WA 4B1ZA 3FLCO 4Z0UA 2E2OA 3QEPA 3HBTA 2HVIA 2D0OA 4LC9B 1XI1A 1N5YA 5EXWA 2V51B 2ZJPL 2Q31A 4I9QA 3H1VX 1JLGA 4CBWA 1KFSA 5FDLA 4LF8K 2OPSA 5BN9A 3I33A 3JYTA 3NCIA 4NYFA 3RSEA 4LSNA 1JLBA 1FXXA 1N33K 4CHOA 3ZT2A 2F9TA 3K5MA 2QWNA 4CZEA 4UY8O 3NGYA 1TUUA 2YI1A 3VEXA 4FM0A 3AO4A 4B1UB 4CECA 2VCPA 2PBDA 2AJQA 3U4LA 5HRSA 1X9MA 4R5PA 4BG9A 1VQ7N 4B3SK 1HNXK 3MWTA 1IH7A 3HPGA 3LDOA 3CC4N 4YDUA 4CERA 1NLVA 3HPHA 4CJWA 4RW9A 3H1QA 4TSXA 1IG9A 4JNEA 2CGLA 2GWKA 4JRPA 1HQEA 4F4KA 4L8RB 3LM2A 3B8AX 4QS8A 2WFBA 4B8AB 4BVPA 4IJNA 2P9SA 4FJ5A 2D4WA 3WXIA 1NU0A 3BY5A 2P9NB 3B6OA 4CJTA 3SLCA 1YITN 4FK2A 2HHTA 3L2UA 1VSEA 1KTQA 1NG9A 4B3OA 3VTIA 4LY7A 3CMEN 1BOTO 2WUSA 4H4OA 3VEOA 4R79A 5M1QA 3SCXA 1DGKN 4FWPA 5IWAK 3GG4A 3FFIA 4FCYA 2RE2A 5ADXA 3QERA 2D0CA 1GOAA 1BQMA 1HYVA 5CE3A 2UU9K 4N47A 4IFVA 2UUBK 3ULEB 5LY3A 2BH1A 2NRZA 4FVUA 4FO0A 3TSPA 4FW2A 1QVGM 4PKGA 3RMDA 1BG3A 5TKYA 4CJFA 3ZSZA 3VF4A 2DFHA 4HTUA 3U6FA 3QETA 1UA0A 1DT9A 4A61A 3VEYA 3HK2A 4GKKK 5SZTA 1RT4A 3AGRA
chains in the Genus database with same CATH topology
1IJJA 1QQMA 4B1XB 3ENHA 3GOIA 2D1KA 4ILGB 1ZC6A 3N4QA 3LDPA 1RDUA 2Q0RA 3IMXA 4FWNA 2QA4N 3O9QA 4A62A 3R6MA 1BUPA 1QZ6A 1QQNA 3D2FA 4EAHD 4WCEL 3J8AA 4GV9A 4XH5A 3D6RA 2Q0UA 3CQXA 4GNIA 1IG8A 3DXMA 1U6ZA 2YX6A 4WQ5A 5EOYA 3K9JA 5GIOA 2CH5A 3H3OB 4JD2A 1HPMA 4L3QA 2CH6A 1YJ9N 5JVGL 3ZX0A 4XH4A 1GLLO 3WXLA 1NGIA 5KPTA 1GLCG 4M7YA 3C7NB 2PAVA 4K43A 1C0FA 5ELZA 3AARA 2YJFA 5GIPA 3G71N 4PKHA 4DB3A 5M1FA 5AZIA 2YCHA 1BWFO 1OVYA 2NNWA 3UKRB 4FWKA 4CZLA 3BEXA 3K9KA 3HRGA 1YXQA 2J4RA 4MLHA 3H6EA 1KAXA 1YJNN 1Y64A 2Q2RA 4B1WB 1CZAN 3F2KA 1VQMN 1NGCA 1GLBG 2H3GX 1VQLN 4A2BA 5BREA 1BU6O 1Q18A 3P39A 3F9MA 4OPAA 3LDLA 2ZGZA 3HSCA 5AQOA 1YF5L 2UYTA 4BQZA 4U67L 2F7TA 2Q97A 1KXPA 4GVEA 2RHKA 4AF1A 4FWRA 2QXLA 2A3ZA 4MO5A 4XEIA 1JCFA 2CGJA 3CCRN 5AZJA 3M6GA 3CHWA 1XC3A 4H0XB 4MDBA 1RGIA 2ASOA 2FF6A 2NRXA 3OA9A 3TSQA 5AQUA 3WEEA 4A2AA 4GV3A 2DPNA 4DCHA 4CZMA 5BPNA 3QFUA 3FZHA 5JMVA 4Z94A 5LJVA 3AGKA 2QI2A 1LOTB 5AQTA 3O80A 5DM6L 3MX5A 2ZGYA 4BRIA 2NRWA 5C12A 4RCHA 2JWLA 2GELA 2BTFA 3KWIA 5AQXA 2JWKA 3SJHA 4DHYA 5EVZA 4YOXA 4IWVA 1V4TA 5JVHL 3VGMA 2NRVA 2QWMA 3HM8A 3TSUA 3C6HA 3RVCA 4BRLA 4K41A 4IOCL 3EKUA 1X9JA 3CJCA 4WFBL 3G4SN 3VMFB 3SBTA 3CC2N 4WQ4A 3MN6A 4IDHA 2HBKA 3BUZB 3E66A 4KH6A 1X3MA 3IDHA 4YOVA 1VQKN 1NGFA 1S3XA 5AQQA 4ISGA 5M1OA 3WQTA 4CZFA 3UE5A 4CZJA 3CXCM 3IFRA 4FWLA 1Q86O 5FPNA 2EWSA 2NRHA 3MCPA 3A5LC 4JKBA 4JHDB 4H5VA 3VF6A 2HF3A 2IIRA 3CCQN 1W2BM 3DXKA 5BPLA 2QWPA 5TKWA 5C15A 4CBXA 3LL3A 4JKGA 3ZEUA 4OO1J 3AAPA 2P9PA 4C1NK 1U2VB 3BF1A 4BRNA 4FWQA 3ID8A 4MDAA 1XUPO 4KBOA 4FPBA 1GLFO 2VGNA 3QFPA 4BRFA 2IVNA 1K8KB 3A0IX 4PKIA 4ISEA 5EX5A 3TTDA 3D7EO 2YHWA 3CC7N 2A6AA 1SAZA 2HF4A 4JK9A 5FPDA 3N4PA 3D2EA 4JKCA 4PHTX 1Q7YO 5ADXH 3L4QA 5AQRA 3CIPA 3MN7A 2W40A 1JJ2M 3EO3A 3CQYA 1GLEG 3GE1A 4K42A 5AQVA 4EIAA 1MDUB 3FZMA 3C65A 3CCMN 3FZKA 4XH1A 1ESVA 3W3DA 3PIPL 2D0PA 3VGLA 4A59A 3CCLN 5I9EB 4JN4A 3CCUN 3C6AA 3BP8A 3PLAA 5C10A 3O9TA 4IXCA 4J8FA 3U8XA 1K8KA 4YORA 2IVPA 4YDUC 1C0GA 1JCEA 1QZ5A 3W0LA 1P8ZA 2ASMA 3CPWM 4M63C 4BROA 4H5RA 2HOEA 1YJWN 2AP1A 2GEMA 3GL1A 5BPMA 5HL7L 1N8RO 3ZX2A 1WUAA 3FFKB 3D2EB 4HTLA 4KH4A 3CCVN 2QTDA 1E4FT 5JICA 2P9IB 3CCJN 1SS6A 2P9IA 3VEWA 5BRHA 3CCEN 1QHAA 3DJCA 3HZ6A 3A5MC 4K25A 3TPQA 5F0XA 1NJIO 1MWMA 3OBYA 3MWPA 2QW9A 3SAGA 2A42A 2E2QA 3QMLA 4YOUA 3ENOA 1HLUA 4JKAA 3SK3A 4BQLA 3L6QA 3O4WA 5AQPA 3MDQA 1QQOA 1ATNA 3QICA 2GX9A 3OHRA 3FR0A 3DXKB 4BRMA 2HBLA 1VQ4N 3HOTA 4IO9L 4JHDA 2IVOA 2ASPA 3G25A 3H45C 3VTHA 1EQYA 3M1FA 3R1XA 4BC5A 1YI2N 3IKMA 5AQLA 1NGJA 2ITMA 1ATRA 3NVMA 4IOAL 4A5AA 4HWIA 2E1ZA 3IUCA 4WQ4C 4YOYA 3I56N 3I8BA 2HBMA 1Q82O 3G6EN 1YHQN 2OTJN 2ZJRL 3M3ZA 2FF3B 4BC4A 1BA0A 2FSKA 5AQFA 2VGMA 4B1VA 4BR4A 2CGKA 3MN5A 4CZGA 1U2VA 2E20A 2HBJA 2QWLA 4PL7A 1MWKA 3CJ1A 4A57A 3ENBA 3TTFA 1YIJN 1KQSM 3H3NO 5AQKA 3C7NA 3S41A 5KPRA 5E84A 1KAZA 4BR9A 1ZBSA 4H0YB 2AA4A 3QBXA 3VOVA 1HKBA 1ILYA 3WQUA 4NLCA 1DEJA 1HUXA 1HX1A 2FSNA 4MO4A 3DXMB 3MX2A 5AQWA 4G9ZA 3NMUA 3ID6A 3A5NC 2WBNA 2A41A 4IFEA 3OBWA 4B9QA 3MMVA 5GAGP 5M1NA 1VQNN 4IO8A 3PIOL 4FL9A 3CETA 1OKJA 4FWMA 1K9MO 5BN8A 3EE9A 3FZFA 4H5WA 3CJ7A 3O08A 3QB0A 2Q1NA 2PFUA 3MK6A 5AR0A 4IEIA 3FGUA 4Y0WA 1T3VA 5KPZA 1TUYA 1K8AO 3H46O 3HI0A 1VQON 1M90O 3CJ9A 2YJEA 3CMAN 1D4XA 4EHUA 2E8AA 5FPEA 5H1SQ 4AM7A 3UKRA 3VESA 1S22A 2QWRA 5BRFA 2ZF5O 2QWQA 1MA9B 3O6WA 5M1KA 3VENA 1KD1O 4JKEA 4M7XA 4BVOA 4DKWA 4CD1A 3NVKA 1Z05A 1Q81O 3WT0A 3E9PA 3WXJA 1ATSA 5AQJA 1SQKA 3WEEB 4JEPA 1RDWX 5AQMA 4CD3A 5GINA 3LDNA 1K73O 5AQZA 4BRAA 1V4SA 3E1YA 4CI6A 3LDQA 4O5FA 3R3LA 4ISFA 4AM6A 4BRCA 2P9PB 3CD6N 4BY9C 2ZWHA 1YVNA 1H1VA 4JKGB 3ZEUB 1X3NA 4C23A 4YOWA 3VERA 3SMPA 3MCAB 3J7ZO 2QEXN 4GV6A 3Q7BA 3SAHA 2VWBA 4F9OA 1T44A 1NGDA 4E1JA 4H0OA 3O1WA 3R9PA 4BRHA 3A8YA 1E4GT 2QWOA 4FSVA 3LM9A 2GTDA 3EN9A 4FPAA 3EL2A 4I6MB 2E88A 3DAWA 1NGBA 2KKZA 2NLXA 3EE8A 3GDQA 2W41A 3M5RA 4H03B 3UKUB 2ZJQL 1G99A 3P4IA 4BGBA 5BR9A 4JK8A 5AQNA 3CI5A 4RWTA 3VEVA 3VPZA 2QM1A 3AY9A 5EY4A 1QVFM 4CJ7A 3EKSA 2P9UB 4H0TB 3HOSA 1NGHA 3VF2A 4BRKA 2KHOA 1GLJO 3CCSN 3JXUA 1SZ2A 5C2FA 3ZYYX 4U7BA 4BR2A 3O1BA 5LJWA 3AAQA 1NGGA 3VGKA 4EHTA 4IJAA 5C2DA 3KHYA 3FE1A 2P9KA 4KH5A 5BRDA 4B1ZA 1HKCA 1R59O 1ZXOA 3FLCO 3L0QA 5B8HA 4EFHA 4GY2B 2V52B 2OTLN 2P9LA 5C0YA 3U9DA 2NZTA 3MN9A 1J6ZA 2FLOA 5AZJB 5AFUH 4A5BA 2E2OA 3P31A 3CJAA 3WXMB 4NLBA 3HBTA 2D0OA 3QDKA 1NGAA 4ILJA 4LC9B 4YOTA 4BC2A 5EXWA 2V51B 2ZJPL 2Q31A 3Q7CA 2GWJA 3H1VX 3U9ZA 2YHYA 2E2NA 4CBWA 2I7PA 1HJOA 2I7NA 4WF9L 5GAEP 5GAHP 5BN9A 3I33A 1NBWA 4IEEA 5F2RA 4WFAL 3O9SA 3RSEA 5CR4A 1O13A 1VQ6N 3KZBA 3CPEA 4DQ8A 3ATVA 5AQHA 4BRPA 3VEZA 4BRDA 2F9TA 1LCUA 4BGAA 2A40A 5GADP 5KQ8A 1XQSC 2NRTA 1RFQA 5AZIB 2QWNA 2V7ZA 4CZEA 4UY8O 5AFUA 1WOQA 3KWGA 1NMDA 1BA1A 2HMPA 4NB4A 4JK7A 4JKHA 1TUUA 1NM1A 2YI1A 3VEXA 3L4IA 1T6DA 4I6MA 4JD2B 4B1UB 2GUPA 5AQYA 4C1NI 3DLLL 2VCPA 2WC9A 2PBDA 5DM7L 1NWKA 4JAXA 3SBGA 1T6CA 3U4LA 5JLHA 4IZ9A 4CBUA 4CZKA 4BG9A 1VQ7N 3CERA 1VQ9N 4O8UA 2P9KB 4WYBA 4BR0A 3MWTA 3DWLA 3A5OC 4PL8A 3LDOA 3CC4N 1EO1A 1YAGA 1DKGD 2P9SB 3O9RA 4FWSA 1VQ8N 4YDUA 3C0BA 1JCGA 3EZWA 3T69A 1NLVA 4ILHA 4WQ5C 3VETA 3H1QA 4BC3A 2E2PA 4JNEA 3O9UA 2CGLA 3KVGA 1KC8O 2HSTA 4QS9A 2GWKA 4BREA 5F1XA 4H0PA 2Q36A 3KK7A 3B8AX 2A5XA 2WFBA 3LM2A 2KLAA 4QS8A 5M1PA 4BVPA 5CHIA 3WXKA 1KAYA 4NO7A 4IJNA 2P9SA 2D4WA 3CJBA 4FOEA 3WXIA 1S72N 4H0VB 3E9OA 3ULEA 3SAFA 2FSJA 5AQSA 3UKUA 1NGEA 2P9NB 1TYQB 3SLCA 1YITN 1VQPN 1P90A 1GLAG 3O5BA 1BDGA 4IOXA 3GBTA 5KQDA 5FPMA 3VTIA 4CZHA 1GLDG 3D2FB 3CMEN 3F5TA 4BRGA 1BOTO 2WUSA 3HTVA 4OPHA 4WFNL 2FXUA 3VEOA 4BR7A 3ZETA 3I55N 4R79A 5AQGA 2YHXA 3TTCA 3ATUA 3ZETB 5M1QA 3TU5A 2BUPA 5E26A 1DGKN 4FWPA 4JKFA 4BRQA 4H5NA 4O8KA 1VAZA 3GG4A 4QS7A 3CF5L 3BF3A 2RE2A 2F9WA 5ADXA 2P9UA 3UB5A 4BR5A 1VQ5N 1Z6RA 2NRRA 5JLFA 2P9LB 5CE3A 1BO5O 1TYQA 1HKGA 2P9NA 2V7YA 3ULEB 2OANA 2E1YA 5LY3A 3E9LA 4CZIA 5MLCQ 2BH1A 2NRZA 4H5TA 5AQIA 3SMSA 4FVUA 4MLEA 4FWOA 3R8EA 4FO0A 4RTFD 3T7ZA 3TSPA 1YUWA 4BG8A 1M1KO 1QVGM 4PKGA 1BG3A 5TKYA 2VYPA 3OW2M 4JKDA 3P38A 3FZLA 4FOIA 3VF4A 4B1YB 5HOOA 3O8MA 3RSEB 3ZX3A 1DT9A 3QBWA 4A61A 3VEYA 1W97L 3JS6A 3AGRA 3WUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJJ A;  1QQM A;  4B1X B;  3ENH A;  3GOI A;  2D1K A;  1ZC6 A;  3LDP A;  2Q0R A;  3IMX A;  4FWN A;  4A62 A;  3R6M A;  1BUP A;  1QZ6 A;  1QQN A;  3D2F A;  4EAH D;  3J8A A;  4XH5 A;  2Q0U A;  3CQX A;  4GNI A;  1IG8 A;  3DXM A;  1U6Z A;  5EOY A;  4WQ5 A;  2CH5 A;  3H3O B;  4JD2 A;  1HPM A;  4L3Q A;  2CH6 A;  3ZX0 A;  4XH4 A;  1GLL O;  3WXL A;  1NGI A;  5KPT A;  1GLC G;  4M7Y A;  3C7N B;  2PAV A;  4K43 A;  1C0F A;  5ELZ A;  3AAR A;  2YJF A;  4PKH A;  4DB3 A;  5AZI A;  2YCH A;  1BWF O;  3UKR B;  4FWK A;  4CZL A;  3BEX A;  1YXQ A;  2J4R A;  4MLH A;  3H6E A;  1KAX A;  1Y64 A;  2Q2R A;  4B1W B;  1CZA N;  1NGC A;  1GLB G;  2H3G X;  4A2B A;  5BRE A;  1BU6 O;  1Q18 A;  3F9M A;  3LDL A;  2ZGZ A;  3HSC A;  5AQO A;  2UYT A;  4BQZ A;  2Q97 A;  1KXP A;  4FWR A;  2QXL A;  2A3Z A;  4MO5 A;  4XEI A;  1JCF A;  2CGJ A;  5AZJ A;  3M6G A;  3CHW A;  1XC3 A;  4H0X B;  1RGI A;  2ASO A;  2FF6 A;  4A2A A;  3WEE A;  5AQU A;  2DPN A;  4DCH A;  4CZM A;  5BPN A;  3QFU A;  3FZH A;  5JMV A;  4Z94 A;  5LJV A;  1LOT B;  5AQT A;  3O80 A;  2ZGY A;  4BRI A;  4RCH A;  2GEL A;  2BTF A;  5AQX A;  4DHY A;  3SJH A;  5EVZ A;  4IWV A;  1V4T A;  3VGM A;  2QWM A;  3HM8 A;  4BRL A;  4K41 A;  3EKU A;  1X9J A;  3CJC A;  4WQ4 A;  3MN6 A;  3BUZ B;  1X3M A;  3IDH A;  1NGF A;  1S3X A;  5AQQ A;  4ISG A;  3WQT A;  4CZF A;  3UE5 A;  4CZJ A;  3IFR A;  4FWL A;  5FPN A;  2EWS A;  2NRH A;  3MCP A;  3A5L C;  4JHD B;  4H5V A;  3VF6 A;  2HF3 A;  2IIR A;  3DXK A;  5BPL A;  2QWP A;  4CBX A;  3LL3 A;  3ZEU A;  3AAP A;  2P9P A;  1U2V B;  3BF1 A;  4BRN A;  4FWQ A;  3ID8 A;  1XUP O;  4KBO A;  4FPB A;  1GLF O;  3QFP A;  4BRF A;  2IVN A;  1K8K B;  3A0I X;  4PKI A;  4ISE A;  5EX5 A;  3D7E O;  2YHW A;  2A6A A;  1SAZ A;  2HF4 A;  5FPD A;  3D2E A;  5ADX H;  5AQR A;  3CIP A;  3MN7 A;  2W40 A;  3EO3 A;  3CQY A;  1GLE G;  3GE1 A;  4K42 A;  5AQV A;  4EIA A;  1MDU B;  3FZM A;  3FZK A;  4XH1 A;  1ESV A;  3W3D A;  2D0P A;  3VGL A;  5I9E B;  4JN4 A;  3BP8 A;  4J8F A;  4IXC A;  3U8X A;  1K8K A;  2IVP A;  4YDU C;  1C0G A;  1JCE A;  1QZ5 A;  3W0L A;  1P8Z A;  2ASM A;  4M63 C;  4BRO A;  4H5R A;  2HOE A;  2AP1 A;  2GEM A;  3GL1 A;  5BPM A;  3ZX2 A;  1WUA A;  3FFK B;  3D2E B;  4HTL A;  1E4F T;  5JIC A;  2P9I B;  2P9I A;  3VEW A;  5BRH A;  1QHA A;  3DJC A;  3HZ6 A;  3A5M C;  4K25 A;  3TPQ A;  5F0X A;  1MWM A;  2QW9 A;  2A42 A;  2E2Q A;  3QML A;  3ENO A;  1HLU A;  3SK3 A;  4BQL A;  3L6Q A;  3O4W A;  5AQP A;  3MDQ A;  1QQO A;  1ATN A;  3QIC A;  3OHR A;  3FR0 A;  3DXK B;  4BRM A;  4JHD A;  2IVO A;  2ASP A;  3G25 A;  3H45 C;  4BC5 A;  1EQY A;  3M1F A;  5AQL A;  1NGJ A;  2ITM A;  1ATR A;  4HWI A;  2E1Z A;  3IUC A;  4WQ4 C;  3I8B A;  3M3Z A;  2FF3 B;  4BC4 A;  1BA0 A;  2FSK A;  5AQF A;  4B1V A;  4CZG A;  4BR4 A;  2CGK A;  3MN5 A;  1U2V A;  2E20 A;  2QWL A;  4PL7 A;  1MWK A;  3CJ1 A;  3H3N O;  5AQK A;  3C7N A;  3S41 A;  5KPR A;  5E84 A;  1KAZ A;  4BR9 A;  1ZBS A;  4H0Y B;  2AA4 A;  3QBX A;  3VOV A;  1HKB A;  3WQU A;  5AQW A;  1DEJ A;  1HUX A;  1HX1 A;  2FSN A;  4MO4 A;  3DXM B;  4B9Q A;  3A5N C;  2A41 A;  3MMV A;  4IO8 A;  4FL9 A;  3CET A;  1OKJ A;  4FWM A;  5BN8 A;  3FZF A;  4H5W A;  3CJ7 A;  3O08 A;  3QB0 A;  2Q1N A;  3MK6 A;  5AR0 A;  3FGU A;  4Y0W A;  5KPZ A;  1TUY A;  3H46 O;  3HI0 A;  3CJ9 A;  2YJE A;  1D4X A;  4EHU A;  2E8A A;  5FPE A;  4AM7 A;  3UKR A;  3VES A;  1S22 A;  2QWR A;  5BRF A;  2ZF5 O;  2QWQ A;  1MA9 B;  3O6W A;  3VEN A;  4M7X A;  4BVO A;  4CD1 A;  1Z05 A;  3WT0 A;  3WXJ A;  1ATS A;  5AQJ A;  1SQK A;  3WEE B;  5AQM A;  1RDW X;  4CD3 A;  3LDN A;  5AQZ A;  4BRA A;  1V4S A;  4CI6 A;  3LDQ A;  4O5F A;  4ISF A;  4AM6 A;  4BRC A;  2P9P B;  2ZWH A;  1YVN A;  1H1V A;  3ZEU B;  4C23 A;  1X3N A;  3VER A;  3SMP A;  2VWB A;  4F9O A;  1T44 A;  1NGD A;  4E1J A;  4H0O A;  3O1W A;  3R9P A;  4BRH A;  3A8Y A;  1E4G T;  2QWO A;  4FSV A;  3LM9 A;  2GTD A;  3EN9 A;  4FPA A;  3EL2 A;  4I6M B;  2E88 A;  3DAW A;  1NGB A;  2NLX A;  4H03 B;  3GDQ A;  3UKU B;  2W41 A;  1G99 A;  3P4I A;  4BGB A;  5BR9 A;  5AQN A;  3CI5 A;  4RWT A;  3VEV A;  3VPZ A;  2QM1 A;  3AY9 A;  5EY4 A;  4CJ7 A;  3EKS A;  2P9U B;  4H0T B;  1NGH A;  3VF2 A;  4BRK A;  2KHO A;  1GLJ O;  3JXU A;  1SZ2 A;  4BR2 A;  3O1B A;  5LJW A;  3AAQ A;  1NGG A;  3VGK A;  4EHT A;  4IJA A;  3KHY A;  3FE1 A;  2P9K A;  5BRD A;  4B1Z A;  3L0Q A;  1HKC A;  1R59 O;  3FLC O;  1ZXO A;  5B8H A;  4EFH A;  4GY2 B;  2V52 B;  2P9L A;  3U9D A;  2NZT A;  3MN9 A;  1J6Z A;  2FLO A;  5AZJ B;  5AFU H;  2E2O A;  3CJA A;  3HBT A;  2D0O A;  3QDK A;  1NGA A;  4LC9 B;  4BC2 A;  5EXW A;  2V51 B;  2Q31 A;  2GWJ A;  3H1V X;  3U9Z A;  2YHY A;  2E2N A;  4CBW A;  2I7P A;  1HJO A;  2I7N A;  5BN9 A;  3I33 A;  1NBW A;  5F2R A;  3RSE A;  3KZB A;  4DQ8 A;  3ATV A;  5AQH A;  4BRP A;  3VEZ A;  4BRD A;  2F9T A;  1LCU A;  4BGA A;  2A40 A;  5KQ8 A;  1XQS C;  1RFQ A;  5AZI B;  2QWN A;  2V7Z A;  4CZE A;  5AFU A;  1WOQ A;  1NMD A;  1BA1 A;  2HMP A;  4NB4 A;  1TUU A;  1NM1 A;  2YI1 A;  3VEX A;  3L4I A;  1T6D A;  4I6M A;  4JD2 B;  4B1U B;  2GUP A;  5AQY A;  2VCP A;  2PBD A;  1NWK A;  4JAX A;  3U4L A;  1T6C A;  5JLH A;  4IZ9 A;  4CBU A;  4CZK A;  4BG9 A;  3CER A;  2P9K B;  4WYB A;  4BR0 A;  3DWL A;  3A5O C;  4PL8 A;  3LDO A;  1YAG A;  1DKG D;  2P9S B;  4FWS A;  4YDU A;  3C0B A;  1JCG A;  3EZW A;  1NLV A;  4WQ5 C;  3VET A;  3H1Q A;  4BC3 A;  2E2P A;  4JNE A;  2CGL A;  3KVG A;  4QS9 A;  2GWK A;  4BRE A;  5F1X A;  4H0P A;  2Q36 A;  3LM2 A;  3B8A X;  2A5X A;  4QS8 A;  4BVP A;  3WXK A;  1KAY A;  4NO7 A;  4IJN A;  2P9S A;  2D4W A;  3CJB A;  4FOE A;  3WXI A;  4H0V B;  3ULE A;  2FSJ A;  5AQS A;  3UKU A;  1NGE A;  2P9N B;  1TYQ B;  3SLC A;  1GLA G;  3O5B A;  1BDG A;  3GBT A;  5KQD A;  5FPM A;  4CZH A;  1GLD G;  3D2F B;  4BRG A;  1BOT O;  2WUS A;  3HTV A;  2FXU A;  3VEO A;  4BR7 A;  3ZET A;  5AQG A;  2YHX A;  3ATU A;  3ZET B;  3TU5 A;  2BUP A;  5E26 A;  1DGK N;  4FWP A;  4BRQ A;  4H5N A;  4O8K A;  3GG4 A;  4QS7 A;  3BF3 A;  2F9W A;  5ADX A;  2P9U A;  3UB5 A;  4BR5 A;  1Z6R A;  5JLF A;  2P9L B;  5CE3 A;  1BO5 O;  1TYQ A;  1HKG A;  2P9N A;  2V7Y A;  3ULE B;  2OAN A;  2E1Y A;  5LY3 A;  4CZI A;  4H5T A;  5AQI A;  3SMS A;  4MLE A;  4FWO A;  3R8E A;  4FO0 A;  4RTF D;  4BG8 A;  1YUW A;  4PKG A;  1BG3 A;  5TKY A;  2VYP A;  3FZL A;  4FOI A;  3VF4 A;  4B1Y B;  3O8M A;  3RSE B;  3ZX3 A;  3QBW A;  4A61 A;  3VEY A;  3JS6 A;  3WUH A; 
#chains in the Genus database with same CATH topology
 1IJJ A;  3GOI A;  4ILG B;  2YKN A;  3N4Q A;  2Q0R A;  2QA4 N;  3C6T A;  4B3R K;  3CM5 A;  4DTS A;  3R6M A;  1BUP A;  3F9K A;  3D2F A;  3L8B A;  1BL3 A;  4XH5 A;  3CQX A;  4GNI A;  1U6Z A;  2YX6 A;  5GIO A;  1HPM A;  4L3Q A;  2CH6 A;  2VG6 A;  4DR5 K;  1YJ9 N;  1CLQ A;  5JVG L;  1GLL O;  5KPT A;  4M7Y A;  1XHZ A;  2PAV A;  1C0F A;  2BDP A;  4KFB A;  2YJF A;  4PKH A;  1T03 A;  4DB3 A;  3VQ8 A;  1EWR A;  1BWF O;  3IG1 A;  2XY7 A;  2NNW A;  2G8F A;  3K9K A;  4MLH A;  4FJ7 A;  1YJN N;  3KLG A;  3MAQ A;  1B9F A;  1RDC A;  4CW7 B;  2KW4 A;  3P39 A;  1X1P A;  1IBK K;  4BWM A;  3KIO A;  1SL2 A;  3ZLJ A;  1BIU A;  2RHK A;  1J53 A;  4AF1 A;  2A3Z A;  1IKY A;  4MO5 A;  2CGJ A;  4X65 K;  3K5L A;  3CCR N;  3CHW A;  1XC3 A;  2ASO A;  1BCO A;  4B9V A;  3OA9 A;  3AVK A;  3SUN A;  1D8Y A;  4AHT A;  2VG7 A;  1WAJ A;  5BPN A;  2OPR A;  3NGI A;  4QCL A;  2BAN A;  4F2R A;  4KHQ A;  4B8C A;  2X78 A;  2ZGY A;  4BRI A;  5AQX A;  1EKE A;  3CG7 A;  3M8R A;  5HP1 A;  3VGM A;  3TSU A;  3C6H A;  3RVC A;  3OYA A;  4O55 A;  4WFB L;  3VMF B;  5HRP A;  4WQ4 A;  4HCC A;  4IDH A;  1X3M A;  1VQK N;  3L3U A;  5M1O A;  4KKO A;  1QS4 A;  3UE5 A;  3QEX A;  1Q86 O;  3A5L C;  4H5V A;  2HF3 A;  1W2B M;  4DG1 A;  2W6L A;  5BPL A;  3HVR A;  5TKW A;  2HB5 A;  1EX4 A;  3AAP A;  3DI6 A;  4AIL C;  1U2V B;  4OX9 K;  1FK9 A;  1HYZ A;  4BRN A;  3OYM A;  4FPB A;  1GLF O;  4C8O A;  2IVN A;  1D9D A;  4PKI A;  3AVH A;  1TL1 A;  3HYF A;  1WSI A;  3A2F A;  2IAJ A;  4PHT X;  4B9L A;  3LPT A;  1VHX A;  5AQR A;  3CIP A;  3MN7 A;  1JJ2 M;  4O44 A;  3EO3 A;  4CHZ A;  5AQV A;  4EIA A;  4DLE A;  3FZM A;  2O8D B;  3CCM N;  2O8C A;  3DLE A;  2O4I A;  3VGL A;  3CCL N;  3CCU N;  1NMN A;  3C6A A;  1NK8 A;  4J8F A;  3PUF A;  2IS3 A;  4J2E A;  2IVP A;  2YNF A;  1LWF A;  4YDU C;  1C0G A;  1JCE A;  4B9U A;  1S1U A;  4BRO A;  1HR0 K;  3DLH A;  4YNQ A;  4B08 A;  1YJW N;  5HL7 L;  3ZX2 A;  3DRS A;  4KH4 A;  3CCV N;  4AHR A;  1L5U A;  2P9I B;  1SS6 A;  3EY1 A;  3EZ5 A;  1QHA A;  1NK5 A;  3VQD A;  3HO1 A;  3QML A;  4YOU A;  3KD1 E;  4DUZ K;  1ZBF A;  3SK3 A;  4BQL A;  3OY9 A;  3L6Q A;  3O4W A;  1ATN A;  3OHR A;  3DXK B;  3D0P A;  4LSL A;  3TWH A;  3G25 A;  4BC5 A;  1EQY A;  1TK8 A;  4BE0 A;  1RT3 A;  3AVI A;  1ATR A;  4YOY A;  1E3M A;  4CJ4 A;  2UUC K;  4B9S A;  2IOC A;  3M3Z A;  1IKV A;  4CHY A;  4B1V A;  2F8T A;  2E20 A;  2QWL A;  2HBJ A;  3VQC A;  1BI4 A;  3CJ1 A;  3T3F A;  1YIJ N;  4LFC K;  3H3N O;  3S41 A;  1EWQ A;  1NJW A;  2WOM A;  2AA4 A;  3VOV A;  1HKB A;  4Q0B A;  1BI4 B;  4NLC A;  3P5J A;  5AQW A;  1UA1 A;  4CEO A;  3V9S A;  3NMU A;  3A5N C;  4IFE A;  5GAG P;  5M1N A;  4IO8 A;  2LSN A;  1K9M O;  4O4G A;  5AJ3 K;  4LF6 K;  2FC0 A;  3O08 A;  3MK6 A;  2PFU A;  1TUY A;  1K8A O;  1VQO N;  3CMA N;  1D4X A;  5A2Q O;  2XY6 A;  2E8A A;  1NJZ A;  1S22 A;  2QWR A;  1ASW A;  3OYF A;  5J2M A;  2QWQ A;  5M1K A;  3O6W A;  4DF4 A;  4I2P A;  1U45 A;  2HHW A;  1N6Q A;  5BR8 K;  2YHB A;  3WXJ A;  4OVL A;  4CD3 A;  4DFP A;  1UAX A;  3LDN A;  2DY4 A;  5AQZ A;  4KPY A;  2A1R A;  3E1Y A;  3LPU A;  4FVM A;  4M45 A;  4AM6 A;  1S9G A;  2JGU A;  2ZWH A;  4JKG B;  1HNI A;  3J7Z O;  4GV6 A;  1NK6 A;  3Q7B A;  1XNQ K;  4FJN A;  3VQP A;  4CVN E;  1NKB A;  3U3Y A;  4E7L A;  4E89 A;  3O1W A;  3R9P A;  2XY5 A;  2QWO A;  4YHH K;  3EN9 A;  1WSF A;  2E88 A;  2KKZ A;  4LF4 K;  3UKU B;  1G99 A;  2ITG A;  4JV5 K;  3KLI A;  4M3Y A;  4BGB A;  3V4I A;  1HRH A;  4CEE A;  4H0T B;  3HOS A;  4BRK A;  4JI5 K;  1GLJ O;  4FJH A;  3DLB A;  5C2F A;  3C95 A;  4ICL A;  5CZ2 A;  2G8U A;  1HJR A;  3O1B A;  3K0S A;  1LW0 A;  4DV1 K;  1XMO K;  4IJA A;  1EET A;  2YNH A;  5J2P A;  4CJP A;  4KH5 A;  3L0Q A;  4J2D A;  4C8L A;  3L2V A;  1NKE A;  2P9L A;  4DTJ A;  3U9D A;  3MN9 A;  1J6Z A;  4DR4 K;  2FLO A;  3P31 A;  3CJA A;  1KFD A;  3AA3 A;  3QDK A;  1NGA A;  1JLC A;  2I7P A;  1HJO A;  3KK3 A;  4ID1 A;  4AHU A;  2HHS A;  2PYL A;  4JI6 K;  4CJS A;  4CJL A;  1TGO A;  3DOK A;  4FLV A;  5CR4 A;  1O13 A;  3KZB A;  5DK5 A;  4NXM K;  1OH5 A;  3ATV A;  4HUG A;  1NKC A;  3VEZ A;  1K6Y A;  3SQ4 A;  2QKB A;  5KQ8 A;  1ASV A;  4CJ3 A;  1BIS A;  5E41 A;  2HMP A;  1NM1 A;  3SI6 A;  1QE1 A;  1RDD A;  1T6D A;  4I6M A;  4JD2 B;  4DV3 K;  2ZE2 A;  2P5G A;  4M3T A;  2WC9 A;  5DM7 L;  1TKZ A;  4JLH A;  2RN2 A;  4JAX A;  5JLH A;  1T6C A;  1F21 A;  4IZ9 A;  3LP0 A;  4CBU A;  5HBM A;  3ZSQ A;  3CER A;  1HYS A;  2E6L A;  2P9K B;  1WAF A;  3HST B;  4WYB A;  4DTN A;  1RT1 A;  5IT9 O;  3QEV A;  2O8F B;  1B9D A;  4CFB A;  1YAG A;  1DKG D;  4FZY A;  3C0B A;  3T69 A;  4CJK A;  3NE6 A;  3VET A;  4KHN A;  2P1J A;  1Z26 A;  1KC8 O;  2HST A;  4AQY K;  5F1X A;  5M1P A;  2A5X A;  4DR6 K;  4FOE A;  5FRM A;  3B6P A;  1S72 N;  5KTQ A;  2W42 A;  2G8W A;  3LAN A;  4YFU A;  1P90 A;  4CHP A;  3M8P A;  1U04 A;  2UXD K;  1BDG A;  3G10 A;  3SNN A;  4DU1 A;  2F96 A;  2UUA K;  5KQD A;  5FPM A;  2YKM A;  1GLD G;  3D2F B;  4BRG A;  3THV A;  3HTV A;  4BR7 A;  1SL0 A;  3RRH A;  4N76 A;  3I55 N;  2YHX A;  3ATU A;  1C0T A;  2W6K A;  4AH9 A;  1TVR A;  5E26 A;  2GUI A;  4H5N A;  4O8K A;  3L2Q A;  4M3R A;  3ZT3 A;  3CF5 L;  2P9U A;  3UB5 A;  4BR5 A;  1VQ5 N;  1Z6R A;  4FW1 A;  5JLF A;  4FJ8 A;  4CGF A;  1X9W A;  1TYQ A;  2V7Y A;  3G0Z A;  5MLC Q;  3E9L A;  4CZI A;  5AQI A;  1VSJ A;  3SMS A;  4FWO A;  4CGD A;  1YUW A;  2Z1G A;  4GW6 A;  2VYP A;  3OW2 M;  4JKD A;  2HHQ A;  4FOI A;  3DLG A;  1KVC A;  3O8M A;  3OYG A;  3QBW A;  1TAU A;  1W97 L;  5SWM A;  1RCH A;  4JI0 K;  4GVM A;  2O8F A;  1QQM A;  3ENH A;  1T8E A;  2Z1H A;  5JS2 A;  4OLA A;  4Z4C A;  1ZC6 A;  1RDU A;  3IMX A;  3O9Q A;  3THX A;  4GV9 A;  3J8A A;  3RMB A;  1C0U A;  1IV0 A;  4WQ5 A;  2DTU A;  2CH5 A;  2HHU A;  1CXQ A;  4ELU A;  1XNR K;  1GLC G;  3J81 O;  4JI1 K;  3TAN A;  5CY4 A;  5KGW A;  1HNW K;  3G71 N;  2IC3 A;  5M1F A;  1GOC A;  5AZI A;  3NF9 A;  5C42 A;  3JSM A;  3CFP A;  1T7P A;  3UKR B;  3TAP A;  2HNY A;  2G8K A;  4DSJ A;  4DWI A;  3V81 A;  4KHW A;  3H6E A;  2Q2R A;  1QSY A;  1CZA N;  3F2K A;  1J5E K;  1J5O A;  1NGC A;  2H3G X;  4A2B A;  5BRE A;  1BU6 O;  1Q18 A;  5KRS A;  3LDL A;  2ZGZ A;  1RBT A;  1YF5 L;  2UYT A;  3OS1 A;  1N34 K;  4DR3 K;  4U67 L;  2ATQ A;  1RIL A;  4GVE A;  4FWR A;  4XEI A;  1JCF A;  1ZBU A;  4H0X B;  2FF6 A;  2DFE A;  4A2A A;  5J2N A;  2XO7 A;  5CZ1 A;  2QI2 A;  1LOT B;  2OZS A;  4DQI A;  4CIG A;  5DM6 L;  3MX5 A;  3VQ7 A;  4CK2 A;  3ZT0 A;  4FZX C;  1B92 A;  1Q9X A;  2GEL A;  3KWI A;  3ZSX A;  4DMN A;  2JWK A;  3SJH A;  3ZSW A;  4DHY A;  4YOX A;  4IWV A;  3LWM A;  1N32 K;  1JL1 A;  2NRV A;  3KLH A;  4LD0 A;  1X9J A;  3G4S N;  5HLF A;  1ZBL A;  3OYN A;  1J9A A;  4CF9 A;  1NK0 A;  3MN6 A;  2HBK A;  3E66 A;  4YOV A;  2D0B A;  3IDH A;  1L3T A;  3VN5 A;  1NGF A;  2HW3 A;  4CEA A;  3IFR A;  4FWL A;  4X64 K;  5FPN A;  2EWS A;  3MCP A;  4JKB A;  4JHD B;  3RMC A;  2IIR A;  3CCQ N;  3DXK A;  3ZSY A;  2QWP A;  5C15 A;  4CBX A;  3LL3 A;  3ZEU A;  3MXI A;  4OO1 J;  2P9P A;  4C1N K;  3BF1 A;  4OLB A;  3ID8 A;  4MDA A;  4FYD A;  1XUP O;  4KBO A;  4KAZ A;  3QFP A;  4BRF A;  3DRP A;  1K8K B;  3A0I X;  3QIO A;  3THW A;  5EX5 A;  3D7E O;  3CC7 N;  2A6A A;  3AO1 A;  1JLQ A;  3N4P A;  3OS2 A;  3AVM A;  4NYN A;  4C8K A;  3L4Q A;  4OGE A;  3SQ1 A;  2W40 A;  1HNV A;  4DSE A;  3TAB A;  4NCB A;  3WNH A;  1SUQ A;  3FZK A;  2WTU A;  4CJV A;  4DR7 K;  5K14 A;  3HM9 A;  2D0P A;  3E01 A;  3MXJ A;  3LZI A;  3EEQ A;  4DS5 A;  3PLA A;  1VSI A;  2O8B A;  4ID5 A;  4QAG A;  1VRU A;  2HMI A;  1QZ5 A;  3P1G A;  4B9T A;  2KFN A;  3OYL A;  3CPW M;  3CFO A;  4H5R A;  2AP1 A;  3TAQ A;  3LP3 A;  4CFA A;  4FJX A;  4F3T A;  3CCJ N;  3AA5 X;  3VEW A;  4FZZ A;  3I8D A;  1FJG K;  4K25 A;  3HZ6 A;  1BIZ A;  5F0X A;  3OYD A;  1MWM A;  3OBY A;  4ELT A;  3SAG A;  4NCG A;  4DTX A;  4O5B A;  3MDQ A;  4KRF A;  1QQO A;  3FR0 A;  3RMA A;  4BRM A;  1T05 A;  4PWD A;  4W5R A;  2ASP A;  1YI2 N;  3VTH A;  1NOY A;  2NUB A;  3R1X A;  4LFB K;  3IKM A;  2O4G A;  4A5A A;  3IUC A;  4FLU A;  4HUF A;  1Q82 O;  1Q9Y A;  1Q8I A;  3AO5 A;  2ZJR L;  4BR4 A;  3D45 A;  4PUO A;  1U2V A;  3ULD A;  2EX3 A;  1IKW A;  5AQK A;  4KTZ A;  4DV5 K;  4KB1 A;  5E84 A;  3DLK A;  4KRE A;  4H0Y B;  1S6Q A;  3QBX A;  3VQB A;  1ILY A;  4KO0 A;  1HX1 A;  4MO4 A;  3DXM B;  3NBP A;  4B9Q A;  3ID6 A;  4CK3 A;  4FL9 A;  3CET A;  2FBX A;  1O1W A;  4FWM A;  3EE9 A;  2FBY A;  3VQ4 A;  5AR0 A;  2Q1N A;  4IEI A;  2YHA A;  3NF8 A;  3TI0 A;  4K8Z A;  1T3V A;  2G8H A;  1M90 O;  3CJ9 A;  2YJE A;  2KQ2 A;  4AM7 A;  2HND A;  3THY A;  4LFA K;  1VSL A;  3V6D A;  1S5J A;  3VEN A;  3OYH A;  2D0A A;  4W5N A;  4JKE A;  4BVO A;  3NVK A;  1Z05 A;  4I2Q A;  4PY5 A;  3WEE B;  1XHX A;  1K73 O;  2O8E A;  5FLX O;  1V4S A;  4O5F A;  4HVJ A;  2YNG A;  3R3L A;  3AVL A;  4LF9 K;  3THX B;  4BY9 C;  4C23 A;  1YVN A;  2ZQB A;  4CF2 A;  4YOW A;  4DTO A;  3VER A;  3SMP A;  3TAF A;  3IS9 A;  3SAH A;  2VWB A;  4DV2 K;  1T44 A;  3HP6 A;  1KCF A;  2KTQ A;  3KLE A;  3LM9 A;  3SPY A;  1NGB A;  4OPK A;  1TV6 A;  3OTO K;  1BGX T;  5BR9 A;  4JK8 A;  2B6A A;  4IDK A;  4BE1 A;  4KTQ A;  5EY4 A;  1NGH A;  4HUE A;  2KHO A;  3CCS N;  3JXU A;  1SZ2 A;  3NH2 A;  4FM2 A;  1WBB A;  3UIQ A;  4BR2 A;  1JLE A;  1ZBH A;  4Y1C A;  3AAQ A;  1NGG A;  4EHT A;  5C2D A;  3FE1 A;  1OH6 A;  1HKC A;  1R59 O;  3CCE N;  5B8H A;  3DLR A;  4GY2 B;  2V52 B;  4EFH A;  5C0Y A;  2NZT A;  3L3V A;  5AFU H;  5AZJ B;  4A5B A;  4CE9 A;  1HMV A;  3C94 A;  4NLB A;  4ILJ A;  4YOT A;  3KKR A;  3Q7C A;  3U9Z A;  4WF9 L;  4DLG A;  3SQ2 A;  1NBW A;  5F2R A;  4WFA L;  3O9S A;  1G15 A;  2BE2 A;  1VQ6 N;  3VQ5 A;  3CPE A;  4BRP A;  4BRD A;  2NRT A;  1RFQ A;  2V7Z A;  4CK1 A;  1D9F A;  5AFU A;  1WOQ A;  3KWG A;  4CF8 A;  1NMD A;  4JK7 A;  4JKH A;  3SUQ A;  4LH4 A;  5AQY A;  1C1A A;  3DLL L;  5KRT A;  3SJJ A;  3WNF A;  4I9L A;  4CZK A;  2B5J A;  3T1H K;  3IRX A;  4FLY A;  3VQ6 A;  1VQ9 N;  4E0D A;  2UXC K;  4BR0 A;  3RTV A;  3A5O C;  1EO1 A;  5CYM A;  2P9S B;  1VQ8 N;  4EP5 A;  4AHS A;  1JCG A;  3EZW A;  2VQF K;  4BC3 A;  3O9U A;  3SYZ A;  4QS9 A;  4H0P A;  3CD6 N;  3PSF A;  3V1R A;  3WXK A;  1KAY A;  4NO7 A;  3CJB A;  4DV6 K;  3J80 O;  4H0V B;  2RPI A;  3ULE A;  1S6P A;  2ZM6 K;  1QTM A;  4G1Q A;  2FSJ A;  5AQS A;  2I5J A;  1VQP N;  1A5V A;  4CEF A;  3KK1 A;  1GLA G;  3VQ9 A;  3O5B A;  3OJU A;  3GBT A;  4Y1D A;  1L3S A;  4QOZ B;  3ITH A;  4CGG A;  4WFN L;  1C0M A;  4M3U A;  3O4Q A;  4M41 A;  4BRQ A;  1VAZ A;  4DFM A;  4QS7 A;  1L3V A;  4K0K K;  2JLE A;  2F9W A;  4DR1 K;  4FJI A;  2O8E B;  2NRR A;  3NAE A;  1BO5 O;  1KVA A;  1HKG A;  2P9N A;  3PX0 A;  1LWC A;  1S1T A;  1NK9 A;  4BDY A;  4W5T A;  2OAN A;  2E1Y A;  4MLE A;  4CEZ A;  3T7Z A;  1IKX A;  4BG8 A;  4E3S A;  2G8V A;  3RR7 A;  4WE1 A;  3SV4 A;  3P38 A;  4B1Y B;  4DSL A;  2QK9 A;  3JS6 A;  1VK0 A;  3ZCM A;  1ZYQ A;  2FBT A;  2KZM A;  1QHT A;  2D1K A;  3LDP A;  2WON A;  3AA2 A;  4DQS A;  4FJG A;  1QZ6 A;  1QQN A;  3ZT1 A;  1Y97 A;  4WCE L;  4M42 A;  3D6R A;  4E7H A;  3DXM A;  3NHG A;  5EOY A;  2QXF A;  3AA4 A;  3K9J A;  1IBM K;  3K57 A;  3SUO A;  5ELZ A;  4RW6 A;  4H8K A;  5GIP A;  3OYK A;  1IO2 A;  3NFA A;  4J2B A;  1RTD A;  3BEX A;  3HRG A;  1YXQ A;  4O0I A;  3OYI A;  1FW6 A;  1Y64 A;  1GLB G;  4DU3 A;  2IGI A;  5AQO A;  1QSS A;  4BQZ A;  4UQG A;  4DTP A;  2Q97 A;  1REV A;  3MEE A;  5HRR A;  4H4M A;  2QXL A;  2OPP A;  5AZJ A;  3QNN A;  1JXB A;  3S3N A;  4MDB A;  3O3H A;  3WEE A;  4DS4 A;  5AQU A;  2Z1J A;  1R0A A;  2DPN A;  4DCH A;  4CZM A;  5HRN A;  3QFU A;  3FZH A;  5JMV A;  3AGK A;  3NF6 A;  4FJ9 A;  3VQQ A;  1SKR A;  3S3M A;  2BTF A;  3WNG A;  3HL8 A;  5FRN A;  1S1X A;  1V4T A;  4E7I A;  3NH1 A;  5JVH L;  4M3X A;  2D5R A;  3AVJ A;  3OYE A;  4CEB A;  3T1A A;  1NOZ A;  4IOC L;  4K41 A;  3EKU A;  4KB0 A;  1NK4 A;  3CJC A;  4DQR A;  4FK0 A;  1HPZ A;  4JI4 K;  4CJQ A;  1DLO A;  4ISG A;  3WQT A;  4CZF A;  2YV0 X;  3HVT A;  1KD1 O;  3ZSO A;  2NRH A;  2B4J A;  3JAM O;  4DTR A;  4RG8 A;  2VQE K;  3THW B;  4CHQ A;  1XWL A;  3V9X A;  4FWQ A;  5KGX A;  3PO4 A;  4B3M K;  2VG5 A;  2YHW A;  5JS1 A;  4I7F A;  1JL2 A;  3V9Z A;  1KSP A;  1Q7Y O;  5ADX H;  1N36 K;  1KLM A;  1WBD A;  3CQY A;  1GLE G;  3GE1 A;  3DMJ A;  4CIF A;  3KD5 E;  3C65 A;  4XH1 A;  4LH5 A;  3MED A;  3PIP L;  1S9E A;  1WLJ A;  4Z4I A;  1J54 A;  4C8N A;  1SKS A;  4CIE A;  3O9T A;  4YOR A;  3AV9 A;  2KZZ A;  1N8R O;  3AVB A;  5BPM A;  4MQ3 A;  3D2E B;  2E6M A;  3MXM A;  5LMU K;  5JIC A;  2P9I A;  3TAE A;  1TAQ A;  5BRH A;  5HRO A;  2UXB K;  1EXQ A;  3CM6 A;  3TPQ A;  3SZ2 A;  1SL1 A;  1EP4 A;  2A42 A;  2E2Q A;  3ENO A;  4JKA A;  4JS4 A;  4GKJ K;  3ASM A;  3QIC A;  3TR8 A;  1VQ4 N;  3HOT A;  2X6S A;  3QIN A;  4IO9 L;  3ALY A;  4JHD A;  2IVO A;  3M1F A;  1XC9 A;  1NGJ A;  3IAY A;  2O8C B;  3NVM A;  4HWI A;  2E1Z A;  4WQ4 C;  3I56 N;  3G6E N;  2DFF A;  4DFK A;  3K5N A;  1YHQ N;  2OTJ N;  4CGI A;  2FF3 B;  4BC4 A;  5AQF A;  4CZG A;  3K5O A;  4A57 A;  3TTF A;  3C7N A;  3TAG A;  4E1N A;  1ZBS A;  2PY5 A;  1DEJ A;  2FSN A;  4G9Z A;  4GMJ B;  1C1C A;  1W0H A;  1RTH A;  1VQN N;  3PIO L;  1RT2 A;  3M8Q A;  1RT7 A;  1OKJ A;  5BN8 A;  3CJ7 A;  2VWJ A;  3T19 A;  3QB0 A;  4K8X A;  3FGU A;  4Y0W A;  5KPZ A;  3H46 O;  3HI0 A;  3L2R A;  4EHU A;  4B9M A;  4BDZ A;  2XRI A;  3LP2 A;  4X66 K;  3KJV A;  4DKW A;  2F4V K;  1Q81 O;  3WT0 A;  3E9P A;  4B3T K;  4JEP A;  4FLX A;  1S1V A;  3QNO A;  3SV3 A;  4CI6 A;  4ISF A;  4DQQ A;  1RBU A;  1ITG A;  2P9P B;  3QIP A;  5EU7 A;  1H1V A;  3ZEU B;  4Z4F A;  3MCA B;  1RBV A;  5LMN K;  3ZT4 A;  4EZ6 A;  1TK5 A;  4Z4E A;  4F9O A;  1QQC A;  3DRR A;  3I0S A;  4E1J A;  4DU4 A;  1S1W A;  2XHB A;  4BRH A;  3A8Y A;  2O8D A;  4DFJ A;  1FKO A;  2GTD A;  4FPA A;  4IG3 A;  3DAW A;  4H03 B;  2NLX A;  3EE8 A;  3GDQ A;  2ZJQ L;  2W41 A;  4DV0 K;  1YT3 A;  3P4I A;  3QES A;  3BDP A;  4CCH A;  1VSD A;  3VPZ A;  2QM1 A;  3V9W A;  1QVF M;  3V9U A;  3EKS A;  3VF2 A;  3OYJ A;  3LP1 A;  3PV8 A;  1KRP A;  3J7Y P;  4DV7 K;  2OCE A;  3BZK A;  3ZYY X;  5D3G A;  5LJW A;  4KHY A;  2BGG A;  3VGK A;  1RBS A;  3RWU A;  3KHY A;  2P9K A;  5BRD A;  1RDB A;  1ZXO A;  4N56 A;  2OTL N;  4CJE A;  4CHN A;  4FJM A;  3WXM B;  5FRO A;  2P51 A;  3AO2 A;  4BC2 A;  4KV8 A;  1CZ9 A;  1WSG A;  3NH0 A;  2GWJ A;  4CJ5 A;  4W5O A;  2YHY A;  2E2N A;  2I7N A;  4Q5V A;  4FLW A;  5GAE P;  3K59 A;  3QO9 A;  5GAH P;  3AO3 A;  2OPQ A;  4N5S A;  4IEE A;  4JS5 A;  4E7J A;  4DQ8 A;  5AQH A;  3ISN C;  1LCU A;  4BGA A;  2A40 A;  5GAD P;  1RNH A;  1XQS C;  5AZI B;  3EYZ A;  1KLN A;  3K2P A;  4CFD A;  1BA1 A;  4NB4 A;  3L4I A;  1LW2 A;  4CF1 A;  4C1N I;  2GUP A;  4RW8 A;  3AVG A;  3M8S A;  1NWK A;  3SBG A;  3F73 A;  3CFR A;  4HHT A;  4O8U A;  4C8M A;  1TKD A;  3DWL A;  1Z25 A;  4PL8 A;  4EP4 A;  1VSM A;  4LF7 K;  4DSF A;  4FWS A;  3O9R A;  3VA3 A;  4FJJ A;  2F8S A;  4ILH A;  4WQ5 C;  2OZM A;  2E2P A;  3KVG A;  1OVQ A;  4BRE A;  2FBV A;  2Q36 A;  3KK7 A;  5CHI A;  1MU2 A;  2KLA A;  4RW7 A;  1WNS A;  1OH7 A;  4KI6 A;  5J2Q A;  3E9O A;  3V1Q A;  3SAF A;  3UKU A;  1TL3 A;  1NGE A;  2X6N A;  1TYQ B;  3THY B;  1ASU A;  3U3G A;  4IOX A;  3KK2 A;  3LWL A;  4CZH A;  3F5T A;  4RW4 A;  3NGZ A;  4OPH A;  2FXU A;  3ZET A;  4FLZ A;  1NNE A;  5AQG A;  3TTC A;  1YTU A;  3ZET B;  1BHL A;  3TU5 A;  2BUP A;  4CJU A;  4JKF A;  3T1Y K;  3BF3 A;  3O3G A;  2E4L A;  2ZD1 A;  1YTA A;  2P9L B;  3NDK A;  3HPO A;  4CEQ A;  4E19 A;  4CF0 A;  1SKW A;  1CZB A;  4KHP K;  4H5T A;  1WB9 A;  3R8E A;  4RTF D;  1M1K O;  4ZTJ A;  1I94 K;  1VSK A;  1L3U A;  1GOB A;  3FZL A;  4IG0 A;  5C24 A;  1VSH A;  5HOO A;  3RRG A;  3RSE B;  3ZX3 A;  3PX6 A;  5J1E A;  3OS0 A;  3WUH A;  1D5A A;  4FM1 A;  4B1X B;  5T7B A;  2XY8 A;  3S9H A;  4JI3 K;  4BE2 A;  3SQ0 A;  4FWN A;  3OJS A;  4A62 A;  4EAH D;  4KTW A;  2Q0U A;  1IG8 A;  3H3O B;  4JD2 A;  4CES A;  3ZX0 A;  4XH4 A;  3WXL A;  1NGI A;  3C7N B;  2HVH A;  4CGJ A;  4K43 A;  4F8R A;  3AAR A;  4Z4H A;  3I0R A;  2X74 A;  2OA8 A;  2YCH A;  1OVY A;  5KI6 A;  3LAL A;  1TK0 A;  4FWK A;  4CZL A;  4CJR A;  4IFY A;  3OVN A;  3WNE A;  4V19 S;  5C25 A;  2J4R A;  2RF2 A;  1KAX A;  4BWJ A;  4B1W B;  3L2W A;  1VQM N;  4KHS A;  1RT6 A;  1DTT A;  1VQL N;  2GBZ A;  3F9M A;  4OPA A;  3HSC A;  1OH8 A;  2HHX A;  2F7T A;  1KXP A;  3MEC A;  4Z4G A;  3M6G A;  2GV9 A;  1U4B A;  2Z1I A;  2A1S A;  1RGI A;  2NRX A;  3TSQ A;  1VRT A;  1NJY A;  4DQP A;  4GV3 A;  2KFZ A;  4ZTF A;  3DYA A;  4OKK A;  5LJV A;  4Z94 A;  4F2S A;  4PA1 A;  5AQT A;  4JRQ A;  3O80 A;  4B9N A;  5C12 A;  2NRW A;  4RCH A;  2JWL A;  3RR8 A;  1U48 A;  4FJL A;  3DOL A;  2OYQ A;  3HP9 A;  3PSI A;  5EVZ A;  3SPZ A;  4HCB A;  2QWM A;  3HM8 A;  4BRL A;  1CXU A;  3PY8 A;  4CGH A;  3V1O A;  1KVB A;  4NCA A;  3SBT A;  3CC2 N;  2Y1J A;  3TAR A;  3BUZ B;  1U49 A;  3H08 A;  4KH6 A;  3NF7 A;  4FJK A;  1S3X A;  1YVU A;  5AQQ A;  2P5O A;  4J2A A;  4CZJ A;  3CXC M;  1WN7 A;  3VF6 A;  1JXE A;  4BDP A;  2HNZ A;  2Q3S A;  3C6U A;  3ZSR A;  4O0J A;  3QEI A;  1W7A A;  2HHV A;  1C6V A;  4JKG A;  4W5Q A;  3J7A P;  1RDA A;  3O3F A;  3BZC A;  2VGN A;  3HXM A;  1FKP A;  1HQU A;  1NJX A;  1X9S A;  3LAK A;  4ISE A;  2PYJ A;  3CQ8 A;  3TTD A;  1SAZ A;  2HF4 A;  4JK9 A;  5FPD A;  4JKC A;  3D2E A;  4KI4 A;  1BCM A;  4JI8 K;  3P83 D;  4K42 A;  1MDU B;  1RTJ A;  1LAV A;  3AVC A;  3QEW A;  3AVF A;  3KKS A;  1ESV A;  4NXN K;  3W3D A;  4DV4 K;  1WSJ A;  4A59 A;  5LL6 Z;  4N41 A;  5I9E B;  4JN4 A;  3BP8 A;  4F3O A;  5C10 A;  3BGR A;  3U8X A;  4IXC A;  2YNI A;  1K8K A;  4EZ9 A;  4DSK A;  4DUY K;  3PX4 A;  3W0L A;  3VA0 A;  1P8Z A;  2ASM A;  4M63 C;  1QSL A;  2HOE A;  2GEM A;  3GL1 A;  1IBL K;  1WUA A;  3FFK B;  4BAC A;  3DM2 A;  3QLH A;  4HTL A;  2QTD A;  1E4F T;  2VWK A;  3DJC A;  1NJI O;  3A5M C;  3K58 A;  3MWP A;  2QW9 A;  2HHH K;  1HLU A;  4OPJ A;  1I39 A;  3SUP A;  5AQP A;  2GX9 A;  4OKE A;  2HBL A;  3OYB A;  4IKF A;  1U47 A;  4E1M A;  2QKK A;  4CED A;  4DR2 K;  3H45 C;  5DMR A;  5AQL A;  2ITM A;  4IOA L;  3I8B A;  2HBM A;  3KLF A;  1BQN A;  4OGC A;  1BA0 A;  2FSK A;  1LWE A;  2R7Y A;  2VGM A;  3ZSV A;  2CGK A;  3MN5 A;  4PL7 A;  1MWK A;  1TKX A;  1W9H A;  3ENB A;  1KQS M;  5KPR A;  1KAZ A;  1VSF A;  4DF8 A;  4BR9 A;  4FLT A;  1UWB A;  2ETJ A;  3WQU A;  1HUX A;  3MX2 A;  1ZBI A;  2WBN A;  2A41 A;  3OBW A;  4JYA K;  3MMV A;  3KTQ A;  2EHG A;  3FZF A;  4H5W A;  3HT3 A;  4ELV A;  4JI7 K;  4KHU A;  3VQA A;  4OKJ A;  1HNZ K;  2G8I A;  1JLA A;  4JI2 K;  3AVA A;  4OJR A;  5FPE A;  5H1S Q;  3UKR A;  3VES A;  4X62 K;  5BRF A;  3LDS A;  1NK7 A;  2ZF5 O;  1A5X A;  1MA9 B;  1SV5 A;  3O4N A;  4M7X A;  4CD1 A;  1UOC A;  1ATS A;  1JLF A;  5AQJ A;  1SQK A;  1WSH A;  5AQM A;  1RDW X;  5GIN A;  4BRA A;  3LZJ A;  3OYC A;  3LDQ A;  4AHC A;  3TAM A;  4YY3 K;  4BRC A;  4MFB A;  4DTM A;  4ZHR A;  4LF5 K;  4AHV A;  4CFC A;  1X3N A;  2QEX N;  2O8B B;  1JKH A;  4IBN A;  1I3A A;  4FK4 A;  1LV5 A;  3S3O A;  1NGD A;  4XIU A;  4H0O A;  2E5L K;  1LAW A;  4M3W A;  1E4G T;  4FSV A;  4PQU A;  5I3U A;  3MEG A;  1RTI A;  3EL2 A;  4I6M B;  3M5R A;  1RBR A;  4DTU A;  1TKT A;  4E7K A;  1C1B A;  1DTQ A;  5AQN A;  3CI5 A;  3LAM A;  5I42 A;  4RWT A;  3VEV A;  3AY9 A;  2Y1I A;  5CYQ A;  4CJ7 A;  3PO5 A;  4FXD A;  3VQE A;  2P9U B;  4DSI A;  3CYM A;  4M3Z A;  1WSE A;  4U7B A;  3HJF A;  2RKI A;  1XMQ K;  2IDO A;  2PZS A;  3AVN A;  1RT5 A;  1A5W A;  4B1Z A;  3FLC O;  4Z0U A;  2E2O A;  3QEP A;  3HBT A;  2HVI A;  2D0O A;  4LC9 B;  1XI1 A;  1N5Y A;  5EXW A;  2V51 B;  2ZJP L;  2Q31 A;  4I9Q A;  3H1V X;  1JLG A;  4CBW A;  1KFS A;  5FDL A;  4LF8 K;  2OPS A;  5BN9 A;  3I33 A;  3JYT A;  3NCI A;  4NYF A;  3RSE A;  4LSN A;  1JLB A;  1FXX A;  1N33 K;  4CHO A;  3ZT2 A;  2F9T A;  3K5M A;  2QWN A;  4CZE A;  4UY8 O;  3NGY A;  1TUU A;  2YI1 A;  3VEX A;  4FM0 A;  3AO4 A;  4B1U B;  4CEC A;  2VCP A;  2PBD A;  2AJQ A;  3U4L A;  5HRS A;  1X9M A;  4R5P A;  4BG9 A;  1VQ7 N;  4B3S K;  1HNX K;  3MWT A;  1IH7 A;  3HPG A;  3LDO A;  3CC4 N;  4YDU A;  4CER A;  1NLV A;  3HPH A;  4CJW A;  4RW9 A;  3H1Q A;  4TSX A;  1IG9 A;  4JNE A;  2CGL A;  2GWK A;  4JRP A;  1HQE A;  4F4K A;  4L8R B;  3LM2 A;  3B8A X;  4QS8 A;  2WFB A;  4B8A B;  4BVP A;  4IJN A;  2P9S A;  4FJ5 A;  2D4W A;  3WXI A;  1NU0 A;  3BY5 A;  2P9N B;  3B6O A;  4CJT A;  3SLC A;  1YIT N;  4FK2 A;  2HHT A;  3L2U A;  1VSE A;  1KTQ A;  1NG9 A;  4B3O A;  3VTI A;  4LY7 A;  3CME N;  1BOT O;  2WUS A;  4H4O A;  3VEO A;  4R79 A;  5M1Q A;  3SCX A;  1DGK N;  4FWP A;  5IWA K;  3GG4 A;  3FFI A;  4FCY A;  2RE2 A;  5ADX A;  3QER A;  2D0C A;  1GOA A;  1BQM A;  1HYV A;  5CE3 A;  2UU9 K;  4N47 A;  4IFV A;  2UUB K;  3ULE B;  5LY3 A;  2BH1 A;  2NRZ A;  4FVU A;  4FO0 A;  3TSP A;  4FW2 A;  1QVG M;  4PKG A;  3RMD A;  1BG3 A;  5TKY A;  4CJF A;  3ZSZ A;  3VF4 A;  2DFH A;  4HTU A;  3U6F A;  3QET A;  1UA0 A;  1DT9 A;  4A61 A;  3VEY A;  3HK2 A;  4GKK K;  5SZT A;  1RT4 A;  3AGR A; 
#chains in the Genus database with same CATH homology
 1IJJ A;  1QQM A;  4B1X B;  3ENH A;  3GOI A;  2D1K A;  4ILG B;  1ZC6 A;  3N4Q A;  3LDP A;  1RDU A;  2Q0R A;  3IMX A;  4FWN A;  2QA4 N;  3O9Q A;  4A62 A;  3R6M A;  1BUP A;  1QZ6 A;  1QQN A;  3D2F A;  4EAH D;  4WCE L;  3J8A A;  4GV9 A;  4XH5 A;  3D6R A;  2Q0U A;  3CQX A;  4GNI A;  1IG8 A;  3DXM A;  1U6Z A;  2YX6 A;  4WQ5 A;  5EOY A;  3K9J A;  5GIO A;  2CH5 A;  3H3O B;  4JD2 A;  1HPM A;  4L3Q A;  2CH6 A;  1YJ9 N;  5JVG L;  3ZX0 A;  4XH4 A;  1GLL O;  3WXL A;  1NGI A;  5KPT A;  1GLC G;  4M7Y A;  3C7N B;  2PAV A;  4K43 A;  1C0F A;  5ELZ A;  3AAR A;  2YJF A;  5GIP A;  3G71 N;  4PKH A;  4DB3 A;  5M1F A;  5AZI A;  2YCH A;  1BWF O;  1OVY A;  2NNW A;  3UKR B;  4FWK A;  4CZL A;  3BEX A;  3K9K A;  3HRG A;  1YXQ A;  2J4R A;  4MLH A;  3H6E A;  1KAX A;  1YJN N;  1Y64 A;  2Q2R A;  4B1W B;  1CZA N;  3F2K A;  1VQM N;  1NGC A;  1GLB G;  2H3G X;  1VQL N;  4A2B A;  5BRE A;  1BU6 O;  1Q18 A;  3P39 A;  3F9M A;  4OPA A;  3LDL A;  2ZGZ A;  3HSC A;  5AQO A;  1YF5 L;  2UYT A;  4BQZ A;  4U67 L;  2F7T A;  2Q97 A;  1KXP A;  4GVE A;  2RHK A;  4AF1 A;  4FWR A;  2QXL A;  2A3Z A;  4MO5 A;  4XEI A;  1JCF A;  2CGJ A;  3CCR N;  5AZJ A;  3M6G A;  3CHW A;  1XC3 A;  4H0X B;  4MDB A;  1RGI A;  2ASO A;  2FF6 A;  2NRX A;  3OA9 A;  3TSQ A;  5AQU A;  3WEE A;  4A2A A;  4GV3 A;  2DPN A;  4DCH A;  4CZM A;  5BPN A;  3QFU A;  3FZH A;  5JMV A;  4Z94 A;  5LJV A;  3AGK A;  2QI2 A;  1LOT B;  5AQT A;  3O80 A;  5DM6 L;  3MX5 A;  2ZGY A;  4BRI A;  2NRW A;  5C12 A;  4RCH A;  2JWL A;  2GEL A;  2BTF A;  3KWI A;  5AQX A;  2JWK A;  3SJH A;  4DHY A;  5EVZ A;  4YOX A;  4IWV A;  1V4T A;  5JVH L;  3VGM A;  2NRV A;  2QWM A;  3HM8 A;  3TSU A;  3C6H A;  3RVC A;  4BRL A;  4K41 A;  4IOC L;  3EKU A;  1X9J A;  3CJC A;  4WFB L;  3G4S N;  3VMF B;  3SBT A;  3CC2 N;  4WQ4 A;  3MN6 A;  4IDH A;  2HBK A;  3BUZ B;  3E66 A;  4KH6 A;  1X3M A;  3IDH A;  4YOV A;  1VQK N;  1NGF A;  1S3X A;  5AQQ A;  4ISG A;  5M1O A;  3WQT A;  4CZF A;  3UE5 A;  4CZJ A;  3CXC M;  3IFR A;  4FWL A;  1Q86 O;  5FPN A;  2EWS A;  2NRH A;  3MCP A;  3A5L C;  4JKB A;  4JHD B;  4H5V A;  3VF6 A;  2HF3 A;  2IIR A;  3CCQ N;  1W2B M;  3DXK A;  5BPL A;  2QWP A;  5TKW A;  5C15 A;  4CBX A;  3LL3 A;  4JKG A;  3ZEU A;  4OO1 J;  3AAP A;  2P9P A;  4C1N K;  1U2V B;  3BF1 A;  4BRN A;  4FWQ A;  3ID8 A;  4MDA A;  1XUP O;  4KBO A;  4FPB A;  1GLF O;  2VGN A;  3QFP A;  4BRF A;  2IVN A;  1K8K B;  3A0I X;  4PKI A;  4ISE A;  5EX5 A;  3TTD A;  3D7E O;  2YHW A;  3CC7 N;  2A6A A;  1SAZ A;  2HF4 A;  4JK9 A;  5FPD A;  3N4P A;  3D2E A;  4JKC A;  4PHT X;  1Q7Y O;  5ADX H;  3L4Q A;  5AQR A;  3CIP A;  3MN7 A;  2W40 A;  1JJ2 M;  3EO3 A;  3CQY A;  1GLE G;  3GE1 A;  4K42 A;  5AQV A;  4EIA A;  1MDU B;  3FZM A;  3C65 A;  3CCM N;  3FZK A;  4XH1 A;  1ESV A;  3W3D A;  3PIP L;  2D0P A;  3VGL A;  4A59 A;  3CCL N;  5I9E B;  4JN4 A;  3CCU N;  3C6A A;  3BP8 A;  3PLA A;  5C10 A;  3O9T A;  4IXC A;  4J8F A;  3U8X A;  1K8K A;  4YOR A;  2IVP A;  4YDU C;  1C0G A;  1JCE A;  1QZ5 A;  3W0L A;  1P8Z A;  2ASM A;  3CPW M;  4M63 C;  4BRO A;  4H5R A;  2HOE A;  1YJW N;  2AP1 A;  2GEM A;  3GL1 A;  5BPM A;  5HL7 L;  1N8R O;  3ZX2 A;  1WUA A;  3FFK B;  3D2E B;  4HTL A;  4KH4 A;  3CCV N;  2QTD A;  1E4F T;  5JIC A;  2P9I B;  3CCJ N;  1SS6 A;  2P9I A;  3VEW A;  5BRH A;  3CCE N;  1QHA A;  3DJC A;  3HZ6 A;  3A5M C;  4K25 A;  3TPQ A;  5F0X A;  1NJI O;  1MWM A;  3OBY A;  3MWP A;  2QW9 A;  3SAG A;  2A42 A;  2E2Q A;  3QML A;  4YOU A;  3ENO A;  1HLU A;  4JKA A;  3SK3 A;  4BQL A;  3L6Q A;  3O4W A;  5AQP A;  3MDQ A;  1QQO A;  1ATN A;  3QIC A;  2GX9 A;  3OHR A;  3FR0 A;  3DXK B;  4BRM A;  2HBL A;  1VQ4 N;  3HOT A;  4IO9 L;  4JHD A;  2IVO A;  2ASP A;  3G25 A;  3H45 C;  3VTH A;  1EQY A;  3M1F A;  3R1X A;  4BC5 A;  1YI2 N;  3IKM A;  5AQL A;  1NGJ A;  2ITM A;  1ATR A;  3NVM A;  4IOA L;  4A5A A;  4HWI A;  2E1Z A;  3IUC A;  4WQ4 C;  4YOY A;  3I56 N;  3I8B A;  2HBM A;  1Q82 O;  3G6E N;  1YHQ N;  2OTJ N;  2ZJR L;  3M3Z A;  2FF3 B;  4BC4 A;  1BA0 A;  2FSK A;  5AQF A;  2VGM A;  4B1V A;  4BR4 A;  2CGK A;  3MN5 A;  4CZG A;  1U2V A;  2E20 A;  2HBJ A;  2QWL A;  4PL7 A;  1MWK A;  3CJ1 A;  4A57 A;  3ENB A;  3TTF A;  1YIJ N;  1KQS M;  3H3N O;  5AQK A;  3C7N A;  3S41 A;  5KPR A;  5E84 A;  1KAZ A;  4BR9 A;  1ZBS A;  4H0Y B;  2AA4 A;  3QBX A;  3VOV A;  1HKB A;  1ILY A;  3WQU A;  4NLC A;  1DEJ A;  1HUX A;  1HX1 A;  2FSN A;  4MO4 A;  3DXM B;  3MX2 A;  5AQW A;  4G9Z A;  3NMU A;  3ID6 A;  3A5N C;  2WBN A;  2A41 A;  4IFE A;  3OBW A;  4B9Q A;  3MMV A;  5GAG P;  5M1N A;  1VQN N;  4IO8 A;  3PIO L;  4FL9 A;  3CET A;  1OKJ A;  4FWM A;  1K9M O;  5BN8 A;  3EE9 A;  3FZF A;  4H5W A;  3CJ7 A;  3O08 A;  3QB0 A;  2Q1N A;  2PFU A;  3MK6 A;  5AR0 A;  4IEI A;  3FGU A;  4Y0W A;  1T3V A;  5KPZ A;  1TUY A;  1K8A O;  3H46 O;  3HI0 A;  1VQO N;  1M90 O;  3CJ9 A;  2YJE A;  3CMA N;  1D4X A;  4EHU A;  2E8A A;  5FPE A;  5H1S Q;  4AM7 A;  3UKR A;  3VES A;  1S22 A;  2QWR A;  5BRF A;  2ZF5 O;  2QWQ A;  1MA9 B;  3O6W A;  5M1K A;  3VEN A;  1KD1 O;  4JKE A;  4M7X A;  4BVO A;  4DKW A;  4CD1 A;  3NVK A;  1Z05 A;  1Q81 O;  3WT0 A;  3E9P A;  3WXJ A;  1ATS A;  5AQJ A;  1SQK A;  3WEE B;  4JEP A;  1RDW X;  5AQM A;  4CD3 A;  5GIN A;  3LDN A;  1K73 O;  5AQZ A;  4BRA A;  1V4S A;  3E1Y A;  4CI6 A;  3LDQ A;  4O5F A;  3R3L A;  4ISF A;  4AM6 A;  4BRC A;  2P9P B;  3CD6 N;  4BY9 C;  2ZWH A;  1YVN A;  1H1V A;  4JKG B;  3ZEU B;  1X3N A;  4C23 A;  4YOW A;  3VER A;  3SMP A;  3MCA B;  3J7Z O;  2QEX N;  4GV6 A;  3Q7B A;  3SAH A;  2VWB A;  4F9O A;  1T44 A;  1NGD A;  4E1J A;  4H0O A;  3O1W A;  3R9P A;  4BRH A;  3A8Y A;  1E4G T;  2QWO A;  4FSV A;  3LM9 A;  2GTD A;  3EN9 A;  4FPA A;  3EL2 A;  4I6M B;  2E88 A;  3DAW A;  1NGB A;  2KKZ A;  2NLX A;  3EE8 A;  3GDQ A;  2W41 A;  3M5R A;  4H03 B;  3UKU B;  2ZJQ L;  1G99 A;  3P4I A;  4BGB A;  5BR9 A;  4JK8 A;  5AQN A;  3CI5 A;  4RWT A;  3VEV A;  3VPZ A;  2QM1 A;  3AY9 A;  5EY4 A;  1QVF M;  4CJ7 A;  3EKS A;  2P9U B;  4H0T B;  3HOS A;  1NGH A;  3VF2 A;  4BRK A;  2KHO A;  1GLJ O;  3CCS N;  3JXU A;  1SZ2 A;  5C2F A;  3ZYY X;  4U7B A;  4BR2 A;  3O1B A;  5LJW A;  3AAQ A;  1NGG A;  3VGK A;  4EHT A;  4IJA A;  5C2D A;  3KHY A;  3FE1 A;  2P9K A;  4KH5 A;  5BRD A;  4B1Z A;  1HKC A;  1R59 O;  1ZXO A;  3FLC O;  3L0Q A;  5B8H A;  4EFH A;  4GY2 B;  2V52 B;  2OTL N;  2P9L A;  5C0Y A;  3U9D A;  2NZT A;  3MN9 A;  1J6Z A;  2FLO A;  5AZJ B;  5AFU H;  4A5B A;  2E2O A;  3P31 A;  3CJA A;  3WXM B;  4NLB A;  3HBT A;  2D0O A;  3QDK A;  1NGA A;  4ILJ A;  4LC9 B;  4YOT A;  4BC2 A;  5EXW A;  2V51 B;  2ZJP L;  2Q31 A;  3Q7C A;  2GWJ A;  3H1V X;  3U9Z A;  2YHY A;  2E2N A;  4CBW A;  2I7P A;  1HJO A;  2I7N A;  4WF9 L;  5GAE P;  5GAH P;  5BN9 A;  3I33 A;  1NBW A;  4IEE A;  5F2R A;  4WFA L;  3O9S A;  3RSE A;  5CR4 A;  1O13 A;  1VQ6 N;  3KZB A;  3CPE A;  4DQ8 A;  3ATV A;  5AQH A;  4BRP A;  3VEZ A;  4BRD A;  2F9T A;  1LCU A;  4BGA A;  2A40 A;  5GAD P;  5KQ8 A;  1XQS C;  2NRT A;  1RFQ A;  5AZI B;  2QWN A;  2V7Z A;  4CZE A;  4UY8 O;  5AFU A;  1WOQ A;  3KWG A;  1NMD A;  1BA1 A;  2HMP A;  4NB4 A;  4JK7 A;  4JKH A;  1TUU A;  1NM1 A;  2YI1 A;  3VEX A;  3L4I A;  1T6D A;  4I6M A;  4JD2 B;  4B1U B;  2GUP A;  5AQY A;  4C1N I;  3DLL L;  2VCP A;  2WC9 A;  2PBD A;  5DM7 L;  1NWK A;  4JAX A;  3SBG A;  1T6C A;  3U4L A;  5JLH A;  4IZ9 A;  4CBU A;  4CZK A;  4BG9 A;  1VQ7 N;  3CER A;  1VQ9 N;  4O8U A;  2P9K B;  4WYB A;  4BR0 A;  3MWT A;  3DWL A;  3A5O C;  4PL8 A;  3LDO A;  3CC4 N;  1EO1 A;  1YAG A;  1DKG D;  2P9S B;  3O9R A;  4FWS A;  1VQ8 N;  4YDU A;  3C0B A;  1JCG A;  3EZW A;  3T69 A;  1NLV A;  4ILH A;  4WQ5 C;  3VET A;  3H1Q A;  4BC3 A;  2E2P A;  4JNE A;  3O9U A;  2CGL A;  3KVG A;  1KC8 O;  2HST A;  4QS9 A;  2GWK A;  4BRE A;  5F1X A;  4H0P A;  2Q36 A;  3KK7 A;  3B8A X;  2A5X A;  2WFB A;  3LM2 A;  2KLA A;  4QS8 A;  5M1P A;  4BVP A;  5CHI A;  3WXK A;  1KAY A;  4NO7 A;  4IJN A;  2P9S A;  2D4W A;  3CJB A;  4FOE A;  3WXI A;  1S72 N;  4H0V B;  3E9O A;  3ULE A;  3SAF A;  2FSJ A;  5AQS A;  3UKU A;  1NGE A;  2P9N B;  1TYQ B;  3SLC A;  1YIT N;  1VQP N;  1P90 A;  1GLA G;  3O5B A;  1BDG A;  4IOX A;  3GBT A;  5KQD A;  5FPM A;  3VTI A;  4CZH A;  1GLD G;  3D2F B;  3CME N;  3F5T A;  4BRG A;  1BOT O;  2WUS A;  3HTV A;  4OPH A;  4WFN L;  2FXU A;  3VEO A;  4BR7 A;  3ZET A;  3I55 N;  4R79 A;  5AQG A;  2YHX A;  3TTC A;  3ATU A;  3ZET B;  5M1Q A;  3TU5 A;  2BUP A;  5E26 A;  1DGK N;  4FWP A;  4JKF A;  4BRQ A;  4H5N A;  4O8K A;  1VAZ A;  3GG4 A;  4QS7 A;  3CF5 L;  3BF3 A;  2RE2 A;  2F9W A;  5ADX A;  2P9U A;  3UB5 A;  4BR5 A;  1VQ5 N;  1Z6R A;  2NRR A;  5JLF A;  2P9L B;  5CE3 A;  1BO5 O;  1TYQ A;  1HKG A;  2P9N A;  2V7Y A;  3ULE B;  2OAN A;  2E1Y A;  5LY3 A;  3E9L A;  4CZI A;  5MLC Q;  2BH1 A;  2NRZ A;  4H5T A;  5AQI A;  3SMS A;  4FVU A;  4MLE A;  4FWO A;  3R8E A;  4FO0 A;  4RTF D;  3T7Z A;  3TSP A;  1YUW A;  4BG8 A;  1M1K O;  1QVG M;  4PKG A;  1BG3 A;  5TKY A;  2VYP A;  3OW2 M;  4JKD A;  3P38 A;  3FZL A;  4FOI A;  3VF4 A;  4B1Y B;  5HOO A;  3O8M A;  3RSE B;  3ZX3 A;  1DT9 A;  3QBW A;  4A61 A;  3VEY A;  1W97 L;  3JS6 A;  3AGR A;  3WUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...