1TKZA

Crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 142
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkzA05
2D0CA 3TAFA 4ZVFA 3L3UA 2IC3B 5CYMA 4PWDB 3KLHA 1GX5A 3AVKA 3M9NB 5HP1B 2BDPA 4RU9A 2J6SA 5I42A 3QZ8A 1TKZA 3WNGA 3ZSWA 4NLGA 1S0OA 4RNHA 5L1JA 4NYFA 1JLFA 1TV6A 1XHZA 3NCIA 4URSA 4DG1A 2E9RX 3DRSA 3OL8A 4EEYA 3M8SA 4HUGA 1JLGB 1VSDA 4KV8B 2BQRA 1KFDA 2O5DA 3I0SA 3OSPA 1IKXB 2X74A 4O0JA 3M8PB 3KK1B 1FKPA 2A1SA 2G8WA 4M42A 3SUOA 1SKWA 3VQ9A 1BGXT 3L8BA 3QEXA 1HPZB 1WN7A 2VWKA 1SKRA 1DTQB 1TL3B 1J5OB 1T7PA 2V9WA 4IRDA 3DLEB 3UDLA 3PVXA 1S6PB 3T5JA 2W8KA 4TY8A 1IKYA 1JLCA 1UA0A 4QWDA 1BL3A 1QS4A 4G3IA 3VQ6A 3ALYA 2E9TA 4K4VA 5CYQA 5KFYA 3F73A 2IM2A 2DPJA 1Q8IA 3CDEA 4Q43A 3M8QB 2OPSB 5KRSA 4Y2CA 2GC8A 5DG9A 4CECA 2D7SA 4E19A 1TL1A 2WK4A 3RB6A 4CHNA 2HW3A 2IMWP 4E7JA 3NH0A 4O4GA 1QAJA 4RW7B 3KK3A 2QKBA 4ZP7A 5I3UB 3AO3A 3PW5A 2JC0A 3HJFA 3ICLA 2DTUA 4FM0A 1RDRA 2KZZA 4KBIA 2X6SA 3CQ8A 4FM2A 1UAXA 3T5LA 1TKTB 1GX6A 1HYVA 3LANA 2R8JA 1BQMB 3I0RA 1T03A 3PW4A 4Z4HA 1Z25A 5J1EB 1JLBB 3VA3A 3ITHB 1N56A 4BE2A 1KVBA 2RF2B 4K4TA 1D8YA 3OS1A 4B9TA 4EBEA 4W5TA 3QEWA 1NOYA 4MK8A 5J2NA 5KTQA 4DSEA 3BREA 3KTQA 4OGEA 4HCBA 4ECQA 3THVA 2RN2A 1NK5A 3SUNA 3HO1A 3BGRA 4HHTA 4M41A 4LQ9A 4KO0B 5CZ1A 1B9FA 4EYHB 4ZPBA 1NK0A 4O3PA 5K14A 1CXUA 2FC0A 5KT3A 4J2BA 1JLAA 4KRFA 3CYMA 4CGGA 5C5JA 1S1VA 3KNAA 1RT5B 3ZSZA 3VN5A 5KFFA 2ETJA 2VG5A 4DFKA 4H4OB 5EWFA 4RW4B 1WLJA 4FLZA 2WOMA 4F4XA 1RYSA 4DTRA 4CJSA 4LSLB 4CEFA 3D28A 2YV0X 3DRPB 5FDLA 1S1UB 3KLEA 3KJVA 4LQ3A 5KG7A 1HQUA 5L9XA 4ZP9A 4CF2A 2V0NA 5F8GA 4KHRA 3KMSA 3HVAA 4BDPA 4NLTA 1JX4A 5KFDA 3ISNC 1HJRA 4DL7A 4MIAA 3GIJA 2RDJA 1RT4A 1C1CB 3ZT4A 5KG3A 4E1MA 1B92A 1O1WA 3OYLA 3OJSA 4F8RA 3PX0A 2R2UA 1RTDA 1GOCA 3KLVA 5KG6A 4J9RA 4CHQA 3FSIA 4GVMA 1YTUA 1HMVA 5KG2A 2DY4A 3C6TB 4O4RA 4CIEA 3VA0A 1JIHA 3OYHA 4ECYA 3SV4A 4CJUA 4KHQA 3RBEA 4IOBA 4B9SA 1S1TA 3K59A 4HCCA 2W7PA 2R8GA 4BDYA 2O4IA 1SL0A 2I5JB 4W5RA 3H5XA 2X78A 5KFCA 2Q3SA 1NK6A 4YMEA 3CG7A 2QKKA 3HVRA 4C8MA 4OGCA 1NKBA 1RDBA 2W9CB 4I2QA 4WFZA 1ASWA 4O44A 4C8OA 2XWYA 4MKBA 2OA8A 4CIFA 3G6YA 4F2RA 5DGBA 2OYQA 4Q8FA 1C0UB 1RT6A 3TWHA 4G1QA 5D3GA 4Q45A 4ID5B 1IM4A 3AA4A 3AVHA 3VQ5A 3OS2A 3OL7A 4NCAA 1S9FA 4Y34A 4WXOA 3KHHA 3LP1A 3CWJA 3OYGA 4BDZA 3DOKA 1ZTTA 4RUAA 4ZPDA 4ZHRA 3G6XA 2IS3A 1LW2B 1BQNB 1MMLA 3QEVA 2ALZA 4LY7A 3PO5A 4IH6A 3BQ1A 1VK0A 1C0TB 1VRUB 5KFRA 3G86A 1YVFA 3DRRB 3KKSA 3NGZA 4ECRA 3K2PA 3MEDB 4E7KA 5EU7A 4CEAA 1WSHA 4K4SA 1KSPA 4RW9A 4ZMMA 4JUZA 4IG0A 3MR3A 2FLPA 4CFDA 4KHUA 4DSJA 4O3SA 4CFCA 5KT6A 3C94A 4TN2A 1XR6A 2XI2A 3HHKA 2OZSA 1Y97A 4M3YA 4FLYA 1SV5A 1BI4B 1RBVA 3VQ8A 3CFOA 1JLQB 1ZTWA 1SL2A 3SQ2A 3SZ2A 2YNGA 4NYNA 2W9AA 4Z4EA 3BDPA 3OVNA 4RG8A 3DLHA 1D1UA 1N4LA 4R5PA 1VRTB 4CJ3A 4DF4A 3T5HA 1NJYA 2JGUA 4JS5A 2X6NA 2QE5A 4MFBA 4FM1A 1VSKA 2UVWA 1RBTA 2VG7B 1W0HA 1LWEA 4I2PA 1LWCA 4DFJA 4HUFA 2D3ZA 4ECXA 4DLEA 1NK7A 1Z26A 1QE1B 4B9MA 4FJIA 5J2QB 4ID1A 1LW0A 4CK2A 3JSMB 4Q0BA 1KHWA 4OKEA 4DS4A 3OJUA 2HHUA 3B6OA 4JRPA 1S0NA 3ZSYA 2V4QA 1RDAA 4HVJA 3Q8QB 2UVRA 4ECUA 3QO9A 4FW2A 2XO7A 4H4MB 1W25A 2Z1HA 3O3GA 1C2PA 3NMAA 5HROB 3QEPA 4CJEA 4NLDA 4CERA 5C24A 1WNEA 3LAMA 1G15A 5KFVA 1NJWA 2HVIA 4I7FA 4PQUA 4J2DA 3PR5B 3L2VA 4CK3A 4J9QA 3QGIA 1D9DA 4F4WA 4DQSA 4E7HA 3NL0A 4NLSA 3NE6A 2RKIA 4NLOA 4FBUA 4NRUA 3K5LA 1YTAA 2C2EA 3RR8A 1R0AA 2YNHB 2HWIA 3MECA 3FDSA 4RW8A 1HYSB 3IGVA 4CF9A 4RW6A 3NF8A 2F8TA 1I6JA 2YNIA 4FS2A 2KZMA 3L2RA 3LALA 3V9XA 3UR0A 5J2PB 3T3FA 2B5JB 3BSCA 3ZT2A 2BQUA 4FJJA 2W8LA 2HVHA 1EETA 3VQCA 3RTVA 4KSEB 3GQCA 3FRZA 3HK2A 1U04A 4DTNA 2Y1IA 4AHUA 2GIRA 1WAFA 4NZ0A 3AO4A 4QOZB 4K4XA 1FXXA 3EPIA 3DLGB 5L1LA 2IA6A 3DMJB 1TK8A 2G8UA 3D45A 2OPPB 4MK7A 4EBDA 4BACA 2OZMA 3CJ4A 4NCGB 3V6KA 3PX6A 4HKQA 4KTZA 5KGXA 3IRXB 1KFSA 1EP4A 3OSNA 4FZXC 3WNFA 1TVRB 3KMQA 4DQIA 2IJNA 3NDKA 4ECWA 5DG8A 1NK9A 3AA5X 1HQEA 1W9HA 4NLUA 1TP7A 4M3WA 2IC3A 4PWDA 3KLFB 4FZYA 1RT7A 1WSFA 4H8KA 3MEGB 4CCHA 3AVLA 1RT3B 4ZP8A 3CVKA 4B9VA 1C1BB 1XR5A 5F8LA 4FLVA 2W42A 2JC1A 1RTJB 2IJFA 2B4JA 2R2SA 1ITGA 4R0EA 4FZZA 1JKHA 3RRHA 4WE1B 3KK2A 1X1PA 2IAJA 4IFVB 4K4UA 3L2WA 4FJHA 1IKXA 2ZD1B 4ED7A 4O3RA 4N56A 3DLRA 2HNYB 4NYZA 3LPUA 3T19A 1GOAA 5KFAA 3IG1B 4F3TA 1UWBA 2PZSA 4CEDA 5HRRA 5DLFA 1DTQA 1J5OA 5KFJA 3DLEA 2CKWA 1JXBA 1KVAA 2OPQB 2HNDA 2FJXA 4K4ZA 3EZUA 2A1RA 4NLPA 1VSLA 3DDKA 1SUQA 3QETA 4RNNA 4EO8A 3LP0B 3ZT0A 5KFOA 2YKNB 2XGQA 2I1RA 3NF6A 3M8RA 1HYZA 2OPSA 1NK8A 3V6DB 4E7LA 2ASJA 2B6AB 2YKMB 3GV7B 4ED3A 4ECZA 1UA1A 3CM6A 2DFEA 4WFXA 5C25A 5DMRA 5I3UA 1D0EA 4DFMA 3N6LA 4F3OA 3HPHA 5CY4A 5E41A 3GIKA 4LSNB 1TK5A 3MAQA 4DSKA 1SKSA 3PZPA 2ZE2A 3MTKA 3CFRA 2G8HA 1S9EB 1S4FA 2BANB 3ITHA 2AQ4A 4U7CA 1LWFA 3RMDA 4DL4A 2AGQA 2RF2A 4KREA 4KI6A 4CF0A 3SFUA 4J9PA 4O55A 3TAEA 3AA3A 5HRSA 3KLHB 1BCMA 1IH7A 5I42B 1TKZB 3O3HA 4CHOA 2VWJA 3H08A 3SCXA 1WSGA 4ZVEA 3CJ0A 1TV6B 1FKOB 1N48A 2R2TA 3DRSB 4CGHA 3MFIA 3NAEA 4CFBA 4HYKA 3RB0A 2JLEA 1VSIA 1C1AA 3AV9A 2HMIB 4N76A 3G6VA 3L2UA 1EKEA 3BJYA 4DU1A 1FKPB 3JYTA 4M3RA 4DTMA 1QUVA 1IO2A 3PUFA 4TQRA 3BSOA 3V4IB 1TAQA 4IQXA 3KLIA 3V1QA 1U48A 5L1KA 3S3OA 1RYRA 3AVIA 4PUOA 4IR9A 4AH9A 1CLQA 2NUBA 4FS1A 2W9BB 3CM5A 4TY8B 1IKYB 1JLCB 2B43A 3U3YA 2KFZA 4AHRA 4IDKA 2IM0A 4IR1A 4FBTA 5JS2A 3SUPA 2OH2A 4LH5A 5KFXA 2JEIA 5CYQB 1C1CA 4ZVHA 5KFNA 3OYIA 4GMJB 1L3VA 4OLBA 1TK0A 5HRPA 3RAXA 4CEOA 3QIPB 4J2EA 4ELVA 4FJKA 1KVCA 4H54A 5KFSA 3LPTA 4DSFA 3NAHA 2QXFA 3IS9B 5KFBA 4CGDA 3RRGA 4WZMA 1TL1B 3HKWA 3V9SA 2F8SA 1J54A 3C6TA 1BIZA 1NHUA 2D3UA 1A5WA 2KQ2A 4FK0A 4MIBA 3TAGA 2YNFA 5HLFA 3L2QA 4ELUA 1T05B 1RTHA 2WONB 2I5JA 2AGPA 3K5OA 3I0RB 1T03B 4BWJA 1RTIB 3FQLA 5L1IA 1KTQA 1NKEA 2W9CA 2FJWA 4FJNA 5EDWA 3E01A 3FQKA 1NNDA 1FK9B 5F9NA 4J9OA 3DM2A 4J9MA 5KFQA 4DMNA 1C0UA 4WXWA 5KG1A 3OYAA 4EZ6A 4DTOA 4ID5A 1T8EA 1Q9YA 5KGWA 4DQPA 4CJ5A 2IDOA 1C0MA 1LW2A 2XCAA 4QAGA 1ZBLA 1WSIA 1CZBA 1NKCA 4OL8A 5K14B 1X9MA 4EO6A 2C28A 3PW2A 1CXQA 3ULDA 1C0TA 1S9GB 3V1OA 3GYNA 4FXDA 1IKVA 1S1VB 3QERA 4RNMA 1LAVA 3SQ4A 1I3AA 1L3UA 3DLKB 1RA6A 2VG5B 3QNOA 2D0BA 2E6MA 4TY9A 2WOMB 4MKAA 3SI6A 3QIOA 5DG7A 2ILYA 2UVVA 1WNSA 5FDLB 3QEIA 3SPZA 3DYAA 4CHYA 3QYYA 2E9ZA 3SQ1A 3SUQA 3OL9A 4KTQA 1JLQA 3TANA 3LDSA 3CO9A 3ZT1A 3P1GA 3CIZA 1RT4B 1S97A 4FCYA 4KB7A 3O4NA 5CZ2A 3OYBA 4ZTFA 1ZYQA 1ZBFA 5C42B 2GV9A 1XC9A 4L8RB 3OLBA 4ZTJA 1CSJA 1RTDB 3V6JA 2FJVA 1NJXA 2Y1JA 2VG7A 1RCHA 1HMVB 4WYLA 1QE1A 2UVUA 3RMAA 1HNVB 4KTWA 4C8LA 4KHWA 3C6UA 3PHEA 5J2QA 2FBYA 2F96A 1RT1B 4KFBA 1JL2A 3C95A 5EWGA 4F4KA 2IM1A 1DTTA 3RWUA 1L5UA 3OYKA 3UQSA 4FK2A 2UUTA 3T5KA 3OYJA 3V81A 3P5JA 4ECSA 1NOZA 4LD0A 5HBMA 4JRQA 4YR0A 4AHVA 1S1WA 4O44B 3FFIA 2F8EX 3TVKA 1KRPA 2ASDA 2KFNA 5JUMA 1RT6B 4CGJA 2HHQA 5D3GB 2HNZA 4Z4IA 1A5XA 4DS5A 4DTUA 4CHZA 1CZ9A 1U4BA 2XY8A 3KOAA 3V9WA 3DOKB 5J2MB 4I9LA 4B3OA 4M3UA 3HVTA 1RT2A 3ASMA 5JS1A 4N47A 1TKXA 3DI6A 3AVMA 3M9OB 4GW6A 3SV3A 5FRMA 1N6QB 5KFMA 3IGNA 4Z4CA 3UIQA 5KFEA 2RPIA 2BE2A 5JXSA 2OPRB 3V6HA 2AJQA 4RW9B 4DEZA 1RNHA 5J2PA 2W7OA 3V9ZA 3NKYA 2ATQA 2B5JA 3MEEA 4FJ9A 2QK9A 3NGDA 1N5YA 1SV5B 5F8IA 3AO1A 3OHAA 3ZSQA 1S1XB 2YNGB 1QTMA 3VQSA 4FW1A 4FJ5A 3HP6A 3DLGA 1JLEB 3AVFA 4MQ3A 4R5PB 4CEZA 4Z0UA 3TAMB 4XO0A 4YFUA 4NCGA 3PY8A 2JEFA 4CF8A 3H5SA 4F50A 4MFBB 3VQBA 4KAIA 4NLRA 4I2PB 2ITGA 1LWCB 1A5VA 3Q8PB 1ASUA 4KKOB 2HWHA 4E89A 3KLGA 4QCLA 4HUEA 1RILA 5F8NA 4FJGA 4YQWA 4R8UA 2G8VA 3PW0A 3HYFA 3NBPB 4B8AB 4DTPA 3KHRA 1IKWB 3Q8RB 5FRNA 4QW9A 3TABA 4GC6A 3KD5E 2RDIA 1HNIB 1MU2A 2IOCA 4ED2A 3HVWA 4KPYA 5F8JA 2FVSA 3MEGA 1RTJA 4K50A 2C2DA 4N41A 4ECVA 4F4YA 1S49A 4Q5VA 4WE1A 1QQCA 5SZTA 4B9NA 3SQ0A 1HARA 4B8CA 5C24B 3A2FA 3DOLB 4I7FB 2XY7A 4PQUB 3LP2A 3NH1A 1S6QB 4AHTA 2VG6A 4ICLB 1REVB 1S48A 1XWLA 3UPFA 4K8ZA 2D0AA 1RBSA 4U6PA 2RKIB 3LWLA 4CJLA 4TYBA 4IRKA 4PA1A 4DTSA 4QWAA 1KLMB 2FBXA 4FJMA 3K5MA 1RBRA 3Q8SB 1R0AB 2Z1IA 3VQDA 1QSLA 3MECB 5HP1A 3WNEA 4RW6B 3VQ4A 3QLHB 2YNIB 1VSMA 4FJXA 4J9KA 3CDUA 4ZP6A 4XPEA 3BR9A 3NFAA 2HB5A 3H5YA 4JS4A 2YKNA 4M3TA 3SI8A 1TKDA 1QAIA 2WTFA 3V1RA 1JLGA 4CIGA 1TGOA 4KV8A 4ED1A 3TAQA 4IKAA 5KT7A 1TAUA 2D41A 3M8PA 3KK1A 4DQQA 1L3SA 2CJQA 3MR5A 3OYEA 2D5RA 1QSYA 3I5CA 3O4QA 1HPZA 2EC0A 4LH4A 4IH5A 3U3GA 2P51A 4KB0A 1B9DA 3MR6A 3S9HA 3T1AA 1TL3A 3D0PA 4NRTA 4WFYA 5KG0A 4CFAA 3HPOA 1S10A 4IKFA 4CJ4A 4FLWA 1EP4B 3QIDA 1S6PA 3K58A 4M95A 4FYDA 4B08A 4IG3B 4DL5A 2PY5A 3AVCA 2AX1A 1DLOB 3PR4A 4JV2A 1Q9XA 1S9EA 2BRLA 2J6TA 2XHBA 4Y1DA 4BE1A 1HQEB 3IAYA 4IFYB 3EPGA 3KKRA 3M8QA 3OL6A 1K6YA 4TXSA 4IRCA 3P83D 4F2SA 4QWCA 1RT7B 2P5OA 3GIMA 4DSLA 3KIOA 1LAWA 3DLBA 3TQ1A 1VSEA 4RW7A 1FKOA 2FVQA 3HM9A 1YT3A 1QHTA 4DFPA 1JKHB 4Q8EA 2GUIA 4K4WA 2ZKUA 3KK2B 2IAJB 1SH0A 3NHGA 2HMIA 1TKTA 1JL1A 2ZQBA 2R8KA 1BQMA 3D5MA 4URGA 4O3QA 4FLTA 4CK1A 4ED0A 5J1EA 3V4IA 2G8IA 4NCBA 2JEGA 1JLBA 1UWBB 1J53A 3ZSRA 2GBZA 2HHXA 1D5AA 3EZ5A 4Y3CA 3N6NA 4AHCA 4DL2A 1JXLA 2W9BA 3OLAA 5CYMB 2HNDB 3HPGA 4CEEA 5KFLA 4OKKA 3NF9A 3PJXA 2BRKA 3LP3A 3I8DA 3TARA 3NGYA 5DQHA 1LV5A 1RDCA 2HAIA 2IM3A 4URQU 3ZSXA 1SUQB 2BGGA 1JLFB 4DG1B 4RNOA 5T14A 3QINA 3QIPA 4KO0A 1Z4UA 5DK5A 2XCPA 4OLAA 4K4YA 2O4GA 3IS9A 5KFZA 1TQLA 2E6LA 4YR2A 3I0SB 1D9FA 4J9LA 1RT5A 4Y1CA 1T3NA 4CJFA 2R7YA 5C25B 4H4OA 4QPXA 4M45A 4RW4A 4O3NA 2VA3A 3AO5A 4JV1A 4CJPA 4NLYA 3ZSOA 4LSLA 3MXJA 4DU4A 4NLXA 3DRPA 4NLVA 1S1UA 3ZCMA 1T05A 4C8NA 2WONA 3GV8B 4J9SA 1YVUA 1XHXA 4KAZA 4ECTA 4BE0A 3TAPA 1RTIA 2C22A 2ZE2B 3KD1E 3H5UA 3MFHA 1KHVA 1LWFB 1UOCA 4QW8A 5KI6A 5F8HA 3HXMA 4AHSA 2WB4A 2FBTA 1FK9A 3PX4A 4K8XA 4Z4FA 2FVCA 4RUCA 4EP5A 4EP4A 3NH2A 5KFGA 5KT2A 3VQAA 2KTQA 4O4GB 4Z4GA 3KK3B 3QGGA 3I5BA 4DU3A 2IGIA 5T7BA 5FROA 4ZPAA 1S9GA 1BHLA 4GC7A 2EX3A 4OPKA 4DL6A 1K1QA 3AO2A 3WNHA 3JYTB 3DLKA 3ISND 3OS0A 3H40A 1ZBHA 4DL3A 4OJRA 4KI4A 3KLIB 2E4LA 2GIQA 4RZRA 4PUOB 3PW7A 2HHTA 1BCOA 1U45A 4M3XA 4ZVGA 5J2NB 2BQ3A 4IDKB 4Y2AA 2HHSA 1BISA 5KFKA 1HRHA 4EBCA 2DPIA 4M3ZA 4WZQA 3VQQA 3BGRB 2JEJA 4CEBA 2IBKA 1BQNA 3M9MB 5C42A 4UQGA 1ZBUA 4IBNA 4XPCA 4IH7A 4FK4A 3H98A 3NF7A 1S0MA 3MXMA 5DQIA 1JLAB 4J2AA 3CDWA 1VRUA 2EHGA 4RNFA 3DRRA 1EX4A 4TYAA 3AA2A 3HSTB 3K5NA 5KT4A 1RDDA 3MR2A 3MEDA 1HNVA 4I9QA 4J9NA 5KG5A 4FLXA 3OYMA 1RT1A 2YNFB 5HLFB 3KJVB 3KLEB 2R8HA 4DWIA 3VQPA 2XY5A 1L3TA 4W5NA 4CJWA 3QZ7A 1HQUB 1RTHB 4DTJA 2XC9A 4OVLA 1EXQA 3TR8A 3O3FA 1BI4A 4KHSA 3AVNA 3E01B 1SL1A 3RAQA 3H4DA 1VRTA 4W5QA 4CE9A 4ELTA 3DM2B 3PJWA 1BIUA 4F4ZA 2HHWA 5DQGA 3LZIA 2R8IA 3OYCA 3S3MA 4KB1A 1U47A 4YR3A 3RR7A 4N5SA 1ASVA 5J2MA 3ZSVA 4TSXA 1QSSA 3JSMA 1XI1A 1S1TB 2FVRA 3VQEA 3CFPA 4TLRA 1N6QA 3OYDA 1JXEA 1IKVB 3SFGA 3OY9A 3MF5A 3CJ5A 2VA2A 3RB4A 4E7IA 5KFWA 3EYZA 2OPRA 4H4MA 4CJKA 3B6PA 4QWEA 4I2QB 2ILZA 1U49A 1XR7A 1I39A 4CGIA 2KW4A 5HROA 2HHVA 4CJVA 4B9UA 3DYAB 2FBVA 3SYZA 3AVAA 3I5AA 3QESA 4O3OA 4G1QB 4FJLA 5EWEA 1S1XA 2FLNA 1JLEA 3LP1B 4CESA 2YHAA 3RBDA 3QNNA 1WSJA 4ZHRB 3TAMA 3K57A 2G8FA 3CJ3A 3BSNA 1K1SA 4KHYA 3PO4A 2WHOA 2YNHA 1HYSA 4DLGA 4KHMA 3PV8A 2Z1JA 4KKOA 1T94A 3C6UB 3KHGA 5F8MA 5HRNA 1J9AA 3IN5A 4YP3A 4IG0B 1WAJA 4KFBB 5DLGA 3NBPA 1NJZA 4Q44A 3NGIA 4C8KA 4DSIA 1IKWA 5KFHA 1DTTB 1HNIA 4FVMA 1NHVA 2LSNA 2R2RA 4O5BA 2PYJA 4M94A 5KFPA 1OS5A 2WRMA 2DFHA 2FLLA 3V81B 3HT3A 5KFUA 4PY5A 5HBMB 3SPYA 1S1WB 3DMJA 3FFIB 3LZJA 2OPPA 5DGAA 4WYWA 2V4RA 1S5JA 1U09A 3IRXA 3DOLA 3U6FA 2HNZB 3MXIA 3EY1A 1C6VA 1LWEB 1S6QA 1X9SA 4ICLA 3S3NA 1REVA 2ASLA 4E0DA 1TVRA 4DQRA 3H4BA 3RMCA 4KE5A 2J6UA 4B3OB 3HVTB 1LW0B 1RT2B 4B9LA 4Q0BB 1TKXB 3DI6B 1KLMA 3L3VA 3NAIA 3KLFA 4X2BA 4AILC 2BE2B 3RMBA 3F9KA 1GOBA 4CEQA 1RT3A 3QO9B 3QLHA 4YNQA 1C1BA 4ED6A 4FLUA 4FJ8A 1KCFA 2G8KA 3G0ZA 1WSEA 4DTXA 3AVGA 1VSHA 4XIUA 3RB3A 4HTUA 1SH3A 2AU0A 3MEEB 2P5GA 4EZ9A 1ZETA 3E51A 3LAKA 4IFVA 4FJ7A 1N5YB 3GIIA 1KLNA 3BQ0A 3GILA 5SWMA 2ZD1A 3SJJA 2HNYA 3CJ2A 1NK4A 4CGFA 4MH8A 1IG9A 5KRTA 2P1JA 3IG1A 2WCXA 4EYIB 4E1NA 3OYNA 4ED8A 2QV6A 2OPQA 3G10A 5EUHA 4RW8B 5KFTA 3BQ2A 4IG3A 4BWMA 3SNNA 1DLOA 4OPJA 4CJRA 1SH2A 2BR0A 3KLGB 4KHNA 4JLHA 1ZBIA 5KG4A 4O0IA 4R8UB 3LP0A 2Z1GA 3TI0A 3V9UA 4IFYA 2XRIA 1EETB 5F9LA 2C2RA 2UUWA 3V6DA 2AWZA 2PYLA 4E3SA 1MU2B 2YHBA 4CHPA 2B6AA 2YKMA 2FVPA 3VQ7A 3KHLA 3H59A 1RA7A 4CJTA 3QGHA 3AVJA 3OHBA 3HP9A 3ZT3A 1X9WA 2XI3A 4ZPCA 4W5OA 3AVBA 4CJQA 3OYFA 4CF1A 4TQSA 4NLQA 2DFFA 2AGOA 4OKJA 2XGPA 4DF8A 2ATLA 4LSNA 1RAJA 3LP2B 5KT5A 4JV0A 1F21A 4MK9A 2VG6B 3GV5B 1VSFA 3LWMA 3N6MA 3HL8A 2BANA 3BSAA 3H2LA 2AX0A 4QWBA 2XY6A 5KFIA 4NLWA 1VSJA 1RBUA
chains in the Genus database with same CATH superfamily
1YGYA 1FFWB 2D0CA 1CQNA 5CYMA 4PWDB 5HP1B 2BDPA 4JI4F 5C2DA 4CD3A 5GIPA 1MMNA 3NGUA 3QICA 5AXMA 4OJHA 5L1JA 3M2UB 2FJDB 3NCIA 3J7A1 3F56A 1WELA 3OL8A 3M8SA 3BF4A 2FTRA 2BQRA 2O5DA 3ZTQA 3OSPA 4O0JA 3A12A 2ROGA 2A1SA 1MROA 2VWBA 3L8BA 5LXRA 5HMZA 1TL7A 2VWKA 1FJGK 2VQEK 1DTQB 1J5OB 2DNKA 2DEJA 2HVDA 3PVXA 3T5JA 2ZWPA 3QJJA 3ALYA 4K4VA 5CYQA 1GLFO 5F1XA 3F73A 4R25A 1HKBA 1WG1A 4FWRA 4CO5A 2VFRA 3CDEA 4BRCA 1V9OA 4LR9A 4Y2CA 2CNOB 3THTA 3EKUA 3M6WA 1HWUA 2HW3A 4CHNA 1DRZA 3KZBA 4O4GA 1QHAA 1VQ6S 3AO3A 3HJFA 3ICLA 2YX6A 1FRHA 1RDRA 2KZZA 3ZZOA 2X6SA 1LQ9A 4NEYA 4B1XB 4NYPA 1UAXA 3T5LA 2WZ1A 2O8FA 3TWZA 2E7XA 2R8JA 1CQMA 3AODA 1PO6A 2DGOA 1TR0A 4Z4HA 4CLWA 4BR9A 1H74A 2VPXB 5J1EB 1J27A 5IWAJ 2MLZA 1N56A 3CB4A 4BE2A 1JJ2M 3LF0A 3CCES 4CLTA 2CQ3A 4K4TA 2L41A 1D8YA 4B9TA 2QTWA 4EBEA 5IS2A 2DGSA 2H1YA 4OYWA 4MK8A 5J2NA 1FEHA 1VQMN 1VGYA 5LMUK 3ZYYX 4HCBA 3LPEA 1JQGA 3QRPA 1NK5A 2GGPB 1KBRA 2FSNA 2HHHK 3BGRA 1SXLA 1GT8A 1DBDA 4KO0B 3NNAA 5CZ1A 1YRUA 5KT3A 4J2BA 2IIHA 4CRJA 5C5JA 1S1VA 3KNAA 1RT5B 1TL5A 3VN5A 1BWEA 4QIVA 1WLJA 4FLZA 1YZ7A 4F4XA 1RYSA 4DTRA 4LSLB 4CZJA 3D28A 2VPYB 4A8XA 2FF6A 1B7FA 2CNNB 5KG7A 2ZM6J 2ZH5A 1QVFR 2LU1A 4ZP9A 5FLXU 4CF2A 3CCSS 1N36J 3PDNA 1IXKA 2V0NA 3BKFA 1PSDA 3BY5A 4KHRA 2LXUA 2RJZA 1SIWB 5D0EA 3L7OA 1SC3B 2E2PA 1N5TA 2QA1A 2LQBA 4E1MA 1B92A 1ATNA 5BN8A 3MM5B 2R2UA 3L4IA 1OWXA 4ZJOA 3CMEN 5KG6A 2EG2A 2MZJA 5AE2A 3I96A 5KG2A 2MHNA 2C42A 4CJUA 4KHQA 1X4BA 1WG4A 2CQGA 4NZ7A 2HMPA 4B9SA 1S1TA 3HJVA 3K59A 2IYIA 3BS9A 1T9TA 2W7PA 1SL0A 2XEXA 5L9NA 5C10A 3H5XA 1FD2A 1NK6A 1UMJA 4C8MA 3PHTA 1RDBA 2W9CB 2E88A 4NO7A 1SCJB 4ZCKA 3ZXWA 4MKYA 4MKBA 4CIFA 3G6YA 4OI4A 2ZBIA 4ISFA 3IBCB 4B3MK 4JD2A 3DDIA 3MK6A 4IOAQ 2CNKB 4NXNJ 1S9FA 1Y4ZB 4WXOA 4OYIA 3KHHA 4FWLA 4CLPA 2F4VF 4X84A 3UE2A 3FEXB 4ZHRA 3G6XA 2I7PA 5AQXA 1WBDA 3JB9k 3H46O 1YRTA 3OBYA 1VQPN 1IBKJ 1VK0A 5CABA 5THWA 5CXTA 3EICA 3G86A 2VGMA 1YVFA 2QLBB 2PFFB 4ECRA 2NREA 3MX5A 1WSHA 4K4SA 4RW9A 4JUZA 3MN9A 3Q86A 4CFDA 2FLPA 1ZS6A 4KHUA 1WTFA 3HOSA 5IOLA 5KT6A 2E8AA 3C94A 2XI2A 1QAYA 3IO1A 3Q7BA 2G9OA 4HI2A 2QWLA 1ZTWA 3SQ2A 3QRRA 4ZLJA 2YNGA 2W9AA 4GY2B 5A8RA 3THWB 3DLHA 2KJWA 3SCKE 2EPIA 1U1OA 4FM1A 1VSKA 1RBTA 1R6VA 2XHWA 1X0FA 4I2PA 1N34F 2W2NP 2D3ZA 4DLEA 2GQCA 4PCQA 2MKKA 4ZVSB 4B9MA 1N54B 1T11A 1WI8A 1T02A 3FRYA 1AB8A 2UV8A 1U1QA 3OJUA 2FC8A 3B6OA 2QWRA 2V4QA 2F65A 4DXLA 1IBMJ 2L9DA 2XO7A 4H4MB 1RAGB 1W25A 3B8AX 5AQOA 2MLYA 1U1NA 4PKHA 2DR8A 1C2PA 3MWBA 3ULHA 4NA2A 1NJIT 1OVYA 1H2UX 1WNEA 2XB2D 1G15A 4FWNA 3HCXA 4OZNA 3HMJG 2KB2A 4J9QA 2CPEA 1D9DA 5H9FK 1VK8A 4IZ9A 3K89A 5G4DA 3NE6A 2RKIA 4DV3J 3S1TA 1X3NA 2FHKA 3X1LB 3ONQA 4A46A 2ZZNA 3P5BP 1O5JA 2YNHB 2HWIA 5D77A 5AT1B 1HYSB 4DCHA 2ZJRL 5F0WA 4RCHA 2HFZA 2ALYB 3ENQA 2VGNA 1I6JA 2YNIA 4HL9A 1LFWA 1P6TA 2Q1LA 1TMJA 2DO4A 2M5YA 4FL9A 2BQUA 4FJJA 2DGTA 2G0JA 1EETA 3ZZUA 3VQCA 3J81O 3T1YJ 3RTVA 4JKGA 2ASOA 2DH7A 3R1LA 3GQCA 3SLCA 2JFDA 4NE9C 2ZHAA 1FXXA 3DLGB 1W2IA 5L1LA 2IA6A 3KFWX 1TK8A 4JV5F 3D45A 1IWGA 1U7LA 1VIOA 4KTZA 5KGXA 1DGKN 1KFSA 4UY8O 1EP4A 3DN9A 2AYEA 4JI3J 4BC2A 1R43A 3DC2A 2EKNA 1TVRB 4LRBA 2P9PA 3NDKA 4IO1A 4ECWA 4QYZK 3CJ9A 5DG8A 4CDIA 3HHLB 3K7RA 1W9HA 4NLUA 2IC3A 3M2RB 4L6V3 4FZYA 3TQEA 4ZOSA 5ETLA 2VBZA 3RW7A 1RT7A 3HHDA 1RT3B 3CVKA 3I9V9 1CULA 2BJDA 3SBTA 1RWVB 4JI1F 5D15A 1UVIA 5BN9A 4FZZA 4FJHA 1IKXA 4ED7A 1WSVA 4N56A 2JWLA 3CXCR 5B0DA 4EGLA 5KFAA 4X4SA 5HRRA 3R2CJ 2KVIA 3U9ZA 2RS8A 1U2VB 1VQ9S 4V1Ak 4MAKA 1X5TA 3R9PA 1KVAA 5BPLA 5L38A 5IQ6A 2JHEA 3G71N 3CMAS 4IJAA 4GO5X 4LF9F 2BTFA 3MCAB 1SUQA 4EO8A 3CCJS 3HLUA 4WWSA 4C3MA 3VGLA 5KFOA 2XGQA 4PXDA 2D1KA 1OJ4A 4B1VA 9RUBA 2OPSA 3V6DB 4X65K 3FZ2A 1TYQB 1F3FA 4LFBJ 2B6AB 4ED3A 1FJEB 2DFEA 5C25A 4LRAA 3CF5Q 3CULA 3U7JA 4WU2A 4KYZA 4DFMA 4F3OA 3HPHA 2DT9A 5ETPA 2D1CA 2RUSA 4K0KF 1VQ8S 2E66A 4JI6F 2CQIA 3FZBA 3OVSA 1SKSA 3PZPA 1ZAXA 3MTKA 1YJ7A 3CFRA 1S4FA 3DOMA 5DZ6A 1KP6A 2FC9A 4PG5A 4DL4A 2DR6A 2LQ9A 2ZH7A 2RF2A 2AGQA 4KI6A 3SFUA 3NGTA 1D8ZA 4J9PA 3L0QA 4RKUC 3TAEA 1XMOF 4CH7A 3AA3A 5HRSA 4DPWA 2PFUA 3OV7A 4H5WA 3NGRA 3K8VA 2VWJA 4ZVEA 4GKKF 1UEUA 4BR0A 4CI0B 4OYPA 1FKOB 1NGEA 3NOCA 2A6MA 4WYBA 2ASMA 3GCXP 2N7YA 1RDUA 4H0YB 4CFBA 5ETRA 1XEZA 1C1AA 2HMIB 3IFRA 3G6VA 2EXUA 3HDSA 1FTCA 2QEXN 1M1GA 5CCMA 3A1YG 4CBWA 5IFMA 1QUVA 1HI1A 5I3PA 3V4IB 3BSOA 3KKFA 1HW8A 2NYHA 1TFYA 3KLIA 1MN7A 2OTLS 4FYXB 3VAKA 3AVIA 5H9EJ 2GHWA 3A5OC 2VD3A 1CLQA 2NUBA 3VAFA 4LF7J 4KPCA 4JNEA 3EZWA 2B43A 4DL0C 1HIYA 3L09A 5T7LB 3IDHA 4BGBA 3TP2A 5K9FA 1WOSA 5KFXA 5HO4A 2JEIA 5CYQB 2NXCA 1C1CA 5KFNA 3T9NA 3U02A 2OAUA 4J2EA 4FJKA 3U27A 1Q86O 3JXOA 3WXIA 2YH1A 2MHEA 5IWAK 3HSGA 5AQPA 1OH6A 4WZMA 3S01A 1QVGM 4LIRA 3D68A 3W9HA 4MIBA 3VGKA 2CWXA 4B3RF 3L2QA 1S59A 1T05B 3KG4A 5F3TA 1RTHA 2O8FB 1PC5A 3HT0A 1HNZJ 5L1IA 3T69A 3JAMU 2EWSA 2KO1A 4KHPJ 1U6ZA 4ZK7M 5EDWA 1UVJA 3UKUA 2VC1A 5B8HA 3FQKA 1IR2A 1RGIA 2WVBA 5BPNA 4NPOA 4M5HA 3UNYA 2YH0A 5JLFA 1K0TA 3D2WA 4DQPA 1YQHA 3K5PA 3BBBA 3OBIA 3Q8VA 1C0MA 4C23A 3ULEA 2J0WA 3O08A 1ZBLA 1WSIA 4OHYA 5M1KA 3D66A 4EO6A 3ULDA 2XHCA 3V1OA 3BGFA 1IKVA 1S1VB 3QERA 5HOOA 3OUYA 4U7BA 2E6MA 4TY9A 4JI2F 2IBOA 4MKAA 1FTRA 2ILYA 2MLXA 3N28A 4FPRA 2HVEA 3SPZA 4BRGA 4CHYA 3SUQA 2OGUA 1VIXA 4KTQA 1JLQA 3LDSA 4GVBB 1QQNA 3CO9A 3CD7A 4X64K 2DGVA 3ZT1A 4A8SA 2YKPA 4KB7A 3O4NA 4FVUA 5CZ2A 3PRDA 4X4RA 3CCUN 3M1FA 2NRZA 2HBYB 4L8RB 3OLBA 2R7UA 1CSJA 5C15A 3KDNA 5GAGU 2R7SA 4UUXA 1HQ2A 4DJBA 3QT5A 1RCHA 4ZN1A 4JHDB 1WC0A 2V2VA 5A8WA 1HNVB 1S79A 5IC4B 1O8BA 2VZ9A 3C6UA 5J2QA 3KG1A 4J5OA 2EKYA 4KFBA 2Q2RA 2YX7A 4F4KA 2GELA 3L4QA 2FQQB 3RWUA 2UU9J 5AQSA 3H7HB 4LF6F 3UVJA 2DVIA 3ID6A 3T5KA 4ILRA 1IBKK 2PT0A 2UXDF 3H3OB 2BBEA 2PFDA 1KRPA 5JUMA 3K17A 3MMBA 2HHQA 3MN6A 1YX2A 2HNZA 4JD2B 1RBAA 2HWTA 4A57A 4ID8A 3KOAA 4X4PA 1M5KC 2QG9B 3TX0A 3CPEA 2G13A 3P31A 3ASMA 2FUG9 3SDEB 3M9OB 5FRMA 1P9YA 3IBWA 3BF3A 4Z4CA 1IJJA 2RPIA 3ZX3A 2VPWB 2OPRB 2DHXA 2BMBA 4L76A 1UFLA 2AJQA 1KOOA 4RW9B 1T95A 3WT0A 2ATQA 2B5JA 3M1VA 2PEBA 3H3NO 2QK9A 2VBYA 3OW2R 4LR8A 4IEIA 1RKIA 4HACA 2MSSA 4Y00A 3KWIA 2DPNA 1S1XB 1BXNA 2YNGB 2I38A 3J7YP 2NXUA 1QTMA 4JKDA 4FW1A 5A8RB 4FJ5A 4CEZA 1ATRA 4UQTA 3TAMB 1CEZA 4YFUA 4NCGA 4BRLA 2A3ZA 3WC0A 1IBMK 1YHQS 4WFNL 3H5SA 3PIOL 2DNPA 1ZAVA 4KAIA 3CI5A 4I2PB 2Z8QA 3V4MA 1A5VA 4YS2A 3Q8PB 3O4WA 4KKOB 2HS0A 3W63A 1QD1A 1UW4A 4FYYB 2HWHA 1KD1O 4QCLA 4HUEA 1MWZA 4FJGA 2RRBA 3M05A 5HJXA 3NS5A 3PW0A 3HYFA 3NBPB 2PSZA 2HQCA 3KHRA 4TVAB 5FPDA 2RDIA 1MU2A 3J7Z5 5LMNJ 3R6LB 3MD3A 2KHDA 4JI0F 1PAUB 4K50A 2F7VA 4TNOA 2FHJD 4M5DA 5SZTA 3N5FA 1NSKL 4DR3F 4B8CA 3A2FA 1EARA 2ZWOA 5DRKA 4ES2A 4AHTA 1S48A 3UPFA 3T1YK 2BJEA 3WQTA 3IUCA 5H1SQ 3GE1A 4DR7F 3TRGA 1RUSA 6FDRA 3LWLA 1FFGB 2RKIB 1MWQA 2G0IA 3LH2S 4TYBA 4QWAA 2HZCA 1KLMB 4UOHA 2FBXA 4BR4A 4FJMA 4ZVOB 5HMWA 5K8OA 4ZVPB 1BOTO 3VQDA 4ED4A 4NMXA 2HGMA 5B7WA 3HTVA 1CBKA 4PL7A 4OHVA 2YNIB 1Y5LB 3W5XA 2JLGA 3E8OA 2HB5A 5K8PA 3TPQA 2UZAA 2YKNA 4B3TF 4JS4A 3D4JA 2DO0A 4IUFA 4JKGB 2OKQA 4IKAA 1KN6A 1EQYA 2XZDB 2D5RA 2I8EA 1HKCA 1U2RA 3CTRA 4CJ7A 1EO1A 1HPZA 2EC0A 3UCGA 1S6OA 1B9DA 3MR6A 3NNHA 3T1AA 3NS6A 1TL3A 4JKHA 1YAGA 1NH8A 5C2GA 3CO0P 4NRTA 4RTFD 3VGVA 2CGKA 3L95X 1WG5A 1EP4B 1S6PA 2A42A 3K58A 2PY5A 4FNHA 2AX1A 4PKGA 2P9PB 1Q9XA 2XHBA 5LJWA 1YUWA 1MWKA 3EPGA 2WBMA 4MO5A 1RWMB 3KKRA 4MDBA 1HHTP 4QR0A 1RT7B 3KIOA 2WC9A 1CULB 3DLBA 1VSEA 3QNWB 2QX0A 2FVQA 2CPFA 2E1AA 3ZX2A 3MXHP 4BVPA 1YT3A 4DV6F 4XDCA 1HNXJ 4LF4J 4YHHJ 4DFPA 3VENA 3WXKA 4K4WA 1FDDA 3NHGA 3O9UA 1TKTA 5AZIA 2KU7A 3D5MA 3O5BA 4IQMA 4ED0A 4C6AA 1SC4B 1JLBA 5AQNA 1YTYA 1S6UA 4ILJA 4LFBK 2Q6BA 3ZSRA 5HL7Q 1D5AA 2YPYA 3EZ5A 4Y3CA 2ROPA 2VFTA 2W9BA 3OLAA 3FMWA 1BG3A 1M1KO 3M2VB 5KFLA 2J0QD 4OKKA 2VQFK 3NGYA 2MSTA 3GSDA 1LV5A 1QVFM 4URQU 1SUQB 2BGGA 1JLFB 4DG1B 4RNOA 2XULA 3QIPA 3ATVA 4WFAL 4JK9A 2M88A 4C48A 4ILLA 3EO3A 3O6WA 4K4YA 5LJ5Y 5KFZA 4W98A 2E6LA 4J9LA 3T1HJ 4N7TA 4Y1CA 1T3OA 2R7YA 4W92B 3D6FB 5C25B 1ZH5A 3W60A 4CJPA 4NLYA 5KAKA 3MXJA 2N4DA 3E3XA 4NLXA 3F2KA 3WC2A 1FHTA 4UUWA 3ZCMA 3R5AA 2ZGZA 3Q8YA 4C8NA 2WONA 4J9SA 1YVUA 4DR6K 2VICA 1E4GT 4BE0A 1TTHB 2Z2YB 2I7NA 1OH7A 2LLZA 1RTIA 3J80U 2DR9A 4XH5A 3MWTA 2Y0SD 3DOMB 1UAWA 3NCRA 1WF0A 3MFHA 2EVZA 2GIFA 1RGVA 4QW8A 2IRUA 4GV3A 4UOGA 4BG9A 3VZIA 4K8XA 4Z4FA 2XNQA 3RZAA 5IT9O 4EP4A 3NH2A 2J9DE 4BC9A 5H9EK 4DV7F 1ICEB 3OXGA 1BMQB 3KK3B 1VQKN 4LF7K 3NVMA 3I5BA 5GAEP 4YB7A 4DU8A 1HPMA 3PRVA 1UEVA 4E1JA 1GLAG 5T7BA 5HVHA 4ZPAA 2LQ5A 4GC7A 2P9LA 1K1QA 4ZLPA 2IA0A 3AO2A 4B1WB 4KH4A 1ZBHA 4C4WA 1HR0J 4OJRA 3KLIB 2MKHA 4RZRA 2ACMA 3TEGA 1BCOA 2GX9A 4PABA 1BC6A 1VBXA 1F5CA 5K8MA 4AQYJ 2HHSA 2KFYA 1HRHA 1Q7YT 2NRWA 3A5MC 4WZQA 1EB0A 3BO2A 3VQQA 1HNZK 4CEBA 3O1LA 2IBKA 2VDHA 2OSQA 3OTCA 4UQGA 4IBNA 4IH7A 4YB5A 1B3TA 4KJIA 1PIEA 1S0MA 1UW9A 1CS4A 3R7NB 4KHPK 5DQIA 4J2AA 2HQDA 2YQ0A 4RNFA 3DRRA 1EX4A 3H20A 4F9OA 3MEDA 1QAXA 1LXNA 1HI0P 3CJKA 3CJAA 3M30B 4V19S 1RT1A 1WOPA 4RBTA 2XY5A 4H4KC 1VQ7S 3QZ7A 1RTHB 3G6ES 2XC9A 2ZGYA 2XS7A 1BI4A 4KHSA 3AVNA 1J2VA 4OZJA 1U26A 3OTOF 1NBEB 1U2FA 4I69A 2HHPA 3I31A 4DCJB 4GO7X 1H6KX 3UKUB 4RWTA 4W5QA 2AZ1A 2B7BB 4GKJF 5DQGA 3AY9A 2RHKA 2I9SA 4C11A 4TKTA 2UUAF 2ZF5O 2NQPA 3RR7A 1I94F 4EK2A 4N5SA 4DX6A 1DURA 4OJ3A 2YKAA 1FO1A 2JNJA 1QSSA 4BRIA 5E33A 1XI1A 1VBKA 2CA9A 1RCXB 4WK3A 4DR5J 2CH5A 3KK7A 1IKVB 2QWPA 2O8BA 3THXB 3MF5A 2VA2A 2ITMA 5M1FA 1VJWA 3MPUB 3EYZA 3OUYB 1HUXA 2B3TB 3SBGA 4CJKA 3B6PA 2PD1A 3BF1A 5BRHA 1I39A 2ASYA 2MQ8A 2P6SA 2H3EB 5KQDA 5DZ7A 1WEXA 3U1LA 4USTA 1F9FA 4BC7A 5EWEA 5ETOA 4EWTA 5I9EB 3CCMN 2AJ4A 2R4FA 4A4JA 4WTYA 4TU9A 1JLEA 4CESA 2UU9K 2HBQB 1K1SA 4KHYA 1ZA2B 2QMXA 3DHXA 5CHIA 5ELZA 4ANEA 3GONA 4DLGA 4KHMA 3R3LA 2E1YA 2CQPA 2CGLA 3C6UB 1VQ5N 1Y64A 1J9AA 1LFPA 3IN5A 2Z4PA 2ABYA 2BACA 4KFBB 2IIRA 3NGIA 3KUHA 2HG4A 1IKWA 1UVNA 1CJUA 2MKIA 2J0SD 5EOYA 1CZAN 3P38A 2R2RA 2PYJA 4ZLNA 4M94A 2RVJA 1AUDA 3H6EA 1X4EA 3R97A 4FWOA 4CZEA 2EWHA 4LFAK 4PWUA 5KFUA 2E7WA 4PY5A 3BGOP 1NPRA 3CQXA 5GAHP 2QN6B 3LZJA 3O8WA 5DGAA 2UV8G 2BM1A 1S5JA 1KTVA 3MMBB 2D0PA 2HNZB 3O9SA 4H0XB 4ICLA 2Q6CA 2ASLA 4K25A 3GE9A 3UDEA 4TU7A 2J6UA 1H7XA 3FVYA 1OY6A 1RU1A 3CXCM 2C2KB 3QQCD 3L3VA 4I6YA 1IM6A 4Z94A 2AA4A 3IBFB 4J37A 3KLFA 4DV4F 4AILC 1MMDA 4RBVA 3W62A 3L9ZA 4C3KA 4HTIA 2UXCK 1C1BA 4FLUA 2Z2ZA 3SCIE 4FPIA 1KCFA 3G0ZA 4ANCA 2CQBA 3C65A 4GMKA 4XIUA 4HTUA 2YWHA 2QO3A 4EZ9A 2ZDPA 1WKLA 1XQSC 3E51A 4I4BA 4FJ7A 4HACB 5A76A 3GYGA 3BQ0A 3GILA 3AT1B 2LYVA 1NK4A 3ENVA 2PAVA 2WCXA 1XNQK 1NDKA 5MLCQ 2CQ1A 2F7TA 4W4MA 5CE3A 2QL9B 4EYIB 4E1NA 2W4CA 1VQMS 5A2QU 1GEHA 1NPPA 3OBWA 1URRA 4ED8A 1X5SA 2E44A 2DHGA 2OPQA 4RW8B 3BQ2A 2IVMA 2F8HA 3TTDA 4OPJA 2HS3A 1SI9A 5DDRC 1G4CA 4KHNA 2AEFA 2V69A 4JLHA 2GO8A 1ZBIA 3LP0A 5AJ3K 5U47A 2BH1A 4ZN3A 4IFYA 4A8MP 2C2RA 2UUWA 2AWZA 2PYLA 4E3SA 2DNZA 1MU2B 2E1ZA 3GJTB 2YHBA 2BVZA 2CADA 2J5AA 2FVPA 3H59A 2KT2A 4JI8J 4CJTA 3QGHA 3GZ7A 5DDQC 3AVJA 2YWKA 2XI3A 2X1BA 4ZPCA 4W5OA 3N0VA 3AVBA 4M5DB 1B0TA 2DFFA 1XMQK 2NRTA 1BD6A 2Q79A 1RKJA 1VQON 1VQNN 3N79A 2MEWA 4JV0A 3M32A 1VSFA 4WJBA 3LWMA 1GQEA 4CYUA 3ZZ0A 1O51A 2AX0A 3CMES 2MZQA 4QWBA 1FJ7A 2XY6A 5KFIA 4NLWA 1UJ4A 1S99A 3TAFA 3MDFA 4OPHA 3J7AN 2J6SA 3QZ8A 3WNGA 4EHTA 2DHSA 1IBLK 2DB1A 4FSVA 2MKYA 4URSA 4JI5F 4U67L 4EEYA 4HUGA 3DRYA 2CPZA 3I0SA 2C3YA 4KH6A 4M8LA 2X74A 3J81j 3DLJA 4XDDA 3WX4A 3WZ0A 1SKWA 1BGXT 1HPZB 1ZM4A 1C0FA 1SKRA 1TL3B 2A1BA 2OFHX 4PQAA 1T7PA 2V9WA 4IRDA 3DLEB 1S6PB 4AT1B 1JLCA 2B8QA 3Q89A 1HNXK 2HEKA 4YHHK 2R9LA 3BH7B 4G3IA 3W5ZA 3VQ6A 1QQOA 3MUTP 5KFYA 1MA9B 5F41A 2LDIA 1K73T 4CZHA 2E1MC 2ZH9A 1M90T 4Q43A 3ZZYA 2UYTA 1X4DA 2IVNA 2UUBF 3MMCB 2IMWP 3DKDA 2QKBA 4DUZF 5I3UB 2CDQA 2AJ2A 3UB5A 2GVZA 4FM2A 1QZ5A 2LU2A 1TKTB 1W2BR 5AZIB 1GX6A 5DETA 4OI0A 3LANA 2YTCA 1N8RO 3NWGA 1MLAA 1T03A 2ZJPQ 3PW4A 1TUYA 1Z25A 2J7WA 2Y8WA 4AXJA 1R27B 2XMKA 4OV6A 3QFPA 1JLBB 3ITHB 1FJGF 2VQEF 3FKBA 1KVBA 3TJ9A 1GXUA 4MDAA 4PAAA 3NLCA 3RBXA 2RE1A 4W5TA 2X3GA 3DFEA 2QLFB 3V2UC 4PG7A 3BREA 3KTQA 4C2MA 1QQMA 4ECQA 2RN2A 3U4LA 3ZTOA 4DV5F 1SAZA 1P1LA 4ZPBA 1WC5A 2RMLA 3AGKA 1JLAA 1SJ1A 4CGGA 3BYRA 1OSDA 3W65A 3A0IX 4KR0B 4EFHA 4DFKA 2C2NA 3QPIA 5EWFA 4CD1A 4WF9Q 4CEFA 4JYAK 2R7QA 3KJVA 3KLEA 4LQ3A 2HYIB 1I3OB 4NMLA 4B1UB 3MM8B 2NYIA 2KT5A 4NLTA 1JX4A 1WKKA 3AD9C 4DL7A 2IJRA 5EGYA 2N3LA 2F3JA 2IY5B 1O1WA 2PC6A 3KJNB 3PX0A 2DNNA 4D3HA 3A5NC 4CHQA 1HR0K 2B56A 4GVMA 5LMUF 1HMVA 1OO0B 1VI7A 1ZZFA 2DY4A 2P9KB 3C6TB 1YVNA 2HHHF 1Q8BA 1K8AO 3SV4A 5HQLA 2FZKB 2OEMA 2YHWA 3RBEA 3JQJA 4IOBA 2CGJA 2QI2A 4LT6A 4AQYK 4ZLLA 4PWWA 2R8GA 1GLJO 3C16A 4S0MA 4DCOB 3J81Y 2RILA 2P9LB 1SJFA 1NGCA 3JTPA 4W5RA 5AFUA 5KFCA 1JJ2R 4I0WA 4YMEA 4CH0S 3O8MA 3HVRA 3VGTA 2VFUA 2K8GA 3W1YC 3ZEUB 2BKOA 3HD2A 3NOGA 3P96A 1J5EJ 4I2QA 4QBUA 2L3MA 4LF2A 2OA8A 2PEHA 2QRRA 2GHVC 1KONA 1C0UB 3AFGA 4BGAA 1WF2A 3S41A 4G1QA 5G0RB 1Y3JA 5D3GA 3AVHA 4ID5B 3TA2A 5K5MA 2MQMA 3OW2M 4F0KA 3OYGA 3CJ7A 1ZTTA 5TKYA 4RUAA 4ZCIA 2QWQA 1FDAA 3HF5A 3PO5A 4Z2XA 1HBUA 1KQKA 1CS4B 3UWTA 1WEZA 1C0TB 4PXCA 2AYGA 2HFVA 1ATSA 1ZOTA 5KFRA 2QA2A 3DRRB 4DR2K 2YQ1A 1Q81O 5K20B 5D4OA 2PI4A 4OQJA 3MEDB 1VOMA 2XMMA 4IG0A 2B9YA 3MR3A 5M1QA 1YJWS 3F5TA 1XR6A 3QB0A 3WXMB 3KYLA 1UKUA 5IQQA 1BI4B 1RBVA 1NH7A 3VQ8A 1RAOA 3CFOA 2H4YB 5D4LA 1SL2A 5AQKA 2ZBQA 4DR5K 3CMQA 4NYNA 1S5ZA 2F5GA 1D1UA 1N4LA 2HQFA 2E2QA 4CJ3A 3ETMA 4DF4A 3G71S 1NJYA 1VMBA 1NSPA 2ZJRQ 4C11B 4MFBA 3SSSA 1U02A 4CP5A 2CQ2A 1LWCA 4DFJA 4ECXA 1Z26A 1QE1B 3TZZA 4FZVA 3PXGa 4BS2A 4BLGA 4G1IA 4ID1A 1LW0A 4NXMJ 4PXEA 4Q0BA 3F0NA 4NLCA 4UT4A 4OKEA 3EM1A 3E9LA 1GMVA 2O8BB 1RDAA 1WHVA 1R8BA 3Q8QB 2E5LF 1IG8A 3N9UC 1HD1A 2GTDA 3LOUA 1OQ3A 4O0NA 2K06A 1YJNS 3H2VE 4HVZA 1TUWA 4A2BA 3NMAA 4CERA 3IWLA 2HOEA 5C24A 4IXCA 1NJWA 1WF1A 2ZH3A 4L72B 4PYDA 1JCFA 5I4MA 1FT8A 3QBCA 3LTOA 4CK3A 1YITN 3VWSA 4F4WA 4E7HA 2FB0A 3NL0A 4K5RA 4X4NA 3R5BA 1Y0HA 1GFWB 4FBUA 3K5LA 1HA1A 1YTAA 4ZIWA 3UE5A 2C2EA 4B9QA 3RR8A 1ZM3A 1VCTA 2KRBA 3MECA 3FDSA 1CC7A 4RW6A 2WW8A 1ELOA 3NF8A 1YIJN 1D3WA 2F8TA 2BJ8A 4FS2A 3L2RA 3LALA 1H73A 3CGIA 5CZVA 5C0YA 5J2PB 2G1HA 4KGZB 1VC6A 1ZM9A 3ZT2A 5LSLA 2QEXS 2HVHA 1CJUB 2GAGC 3QSIA 1SQEA 1EJ7L 3EDQB 3HK2A 2B51A 4IJNA 2Y1IA 2G2YA 4YN3B 3SJHA 4F3QA 4NZ0A 4IYQA 3TOQA 4QOZB 4K4XA 3EPIA 1Q5YA 2Q0UA 3DLLQ 1HW9A 4OYZA 2G8UA 4EBDA 2MPUA 3PX6A 3KVGA 1HLUA 4HKQA 2VOOA 3D6TB 2QW9A 1RHKB 3OSNA 2HQIA 5B0BA 4JI4K 4FZXC 3KMQA 5A0YA 2IJNA 3W8GA 1T9UA 2V7ZA 4F0MA 3Q2TC 4K8RA 4OYXA 4M3WA 2B9XA 2U1AA 3PKYA 4PWDA 1EQMA 3KLFB 4HTJA 2XSJB 4CCHA 3VEVA 2XLJA 1C1BB 3IR5B 5AQGA 2IJFA 3SIPB 2R2SA 4GVLA 3FZKA 1NU0A 2OO4A 2O3DA 4WE1B 3SQOP 2M0GB 2ACYA 3SMPA 3GJSB 2FLOA 3GL1A 1MSWD 4PHTX 1WC1A 4M7XA 3PIPL 1DTQA 1PYOB 1J5OA 1F5AA 1JXBA 2W4PA 2Z57B 1OSCA 5EXWA 2OPQB 3G4SN 2KI2A 4K4ZA 3EZUA 1WUUA 3KG0A 5B0CA 3LP0B 2R7RA 3QRQA 2DNHA 2K2PA 3TW0A 3MPWA 4ZA1A 2W7AA 2DJWA 2FY8A 1SJ4P 4CWBA 2UXBJ 4ZCMA 1AA1B 2XLIA 4ECZA 1ROFA 1RWXB 1UA1A 3CM6A 1I1GA 4C97A 3N6LA 3EZOA 2YBVA 4CI6A 5CY4A 1X4CA 3IKMA 2DNYA 3NCPA 1I51B 4WCEQ 3W9IA 3CCUS 1CJKA 1S9EB 1WJ9A 3E66A 3RMDA 2W6KA 1H1VA 4AL7A 3C15B 5GADU 2HGNA 4CF0A 2EBGA 3BR8A 4UZCA 3TJAA 4FWPA 3SCXA 3RGIA 4P73A 5C2CA 2IDEA 2W2QP 2R2TA 4FWSA 3NAEA 8RUCA 4X65F 1ZPWX 3RB0A 1VSIA 4WQ4C 2W25A 3AV9A 4N76A 1BUPA 4EIAA 2K1RA 4Z7CA 4DU1A 3JYTA 4DTMA 2VJUA 4TQRA 2CJBA 3DXMA 3MMAA 1U48A 2P9UA 1EIYB 1Q53A 1S4EA 3CCLS 4FS1A 4BRKA 1JLCB 3PYFA 1RU2A 2NXNA 2IM0A 4PXBA 4FBTA 2A2CA 4LH5A 2XMTA 2XYGB 4ZVHA 4NI2A 1L3VA 2DH9A 4YY3J 5HRPA 1M0SA 5C2FA 3QBWA 2DY9A 1VQ4N 5KFSA 4DSFA 3NAHA 3T6JA 1HKAA 4DPTA 4WTOB 2OTJN 3V9SA 1J54A 4CO3A 1BIZA 3BN4A 1IVZA 3DWLA 4X4VA 4L73A 3I4HX 1V5VA 2D3UA 4B17A 2GVZB 2YNFA 4HDHA 5HLFA 3MHYA 4M5LA 2MB0B 2J8AA 3W61A 5BR8J 2DTJA 6FD1A 1T03B 3BYPA 1KTQA 3H90A 4TU8A 2W9CA 1SC1B 3BV8A 3BZQA 2J7KA 1LEOA 3ZZZA 5F9NA 5DM7Q 3B82A 4C1NK 2BYCA 3OYAA 2DRAA 4V19J 1BA0A 5GAHI 5JVGQ 4ILMA 5TKWA 3NP5A 4X62F 2CJ9A 2E5HA 1OPZA 2KL8A 3VVTA 3MZIA 2XCAA 1S77D 4OL8A 5IWAF 1A9NB 1S9GB 1UZHA 3GYNA 3NMRA 4C0HA 4CVNE 4CIOA 4RNMA 1LAVA 3SQ4A 3DLKB 1OYEA 2LVWA 3SCJE 4K41A 4WBFA 3UDCA 1VQLN 3SI6A 5DG7A 2UVVA 2VC0A 3K9JA 3MR7A 1WUAA 5IC6B 3QYYA 1NMNA 2E9ZA 1UVMA 2XM3A 2ATCB 2C3OA 2QFJA 1QDUB 3THWA 3AD7C 2HFUA 3ZTPA 3WIUA 4L3NA 1VFJA 5C42B 2GV9A 2DRDA 1OH5A 3V6JA 3AJDA 4USJC 1J5EK 4BRNA 4F67A 2FJBB 1HMVB 3L7UA 1N5VA 1EAYC 2ZM6F 3M3ZA 5IM0A 4KTWA 1N36F 3PHEA 2BZ2A 2F96A 4JB8B 1YI2S 3C95A 3C16B 1NM2A 1YRXA 2F1FA 1DTTA 1L5UA 3OYKA 3UQSA 3HRGA 2RHSB 4NOHA 4E2FB 3V81A 1NOZA 2QL7B 4DV2F 4YR0A 4AM6A 2RE2A 2ASDA 1U1RA 4DMZA 5D3GB 5CA5A 2VIHA 2CZ9A 3DXBA 4G6VB 1U4BA 2V52B 3V9WA 1Y3KA 5J2MB 4I9LA 4M3UA 1RT2A 4IOAL 1NDCA 3FK4A 5JS1A 2OD4A 3AVMA 1HBUB 1N6QB 2RDDA 4OZLA 5D6GA 3BBCA 1U1PA 1GLEG 3IGNA 2VL1A 3D0HE 3PG9A 2ERRA 3N4PA 3FC9A 2MQPA 3ET6A 2EG1A 2LMIA 1RNHA 2W7OA 4AXIA 4NXNF 3DDNA 4FJ9A 2C3UA 2OMLA 3MAHA 5F2RA 3Q24A 4NLBA 5LY3A 4NXMK 2QIFA 3OHAA 2QA4S 3ZSQA 1IBKF 3IWXA 3O44A 4P10A 3DLGA 3FR0A 3B4DA 4MQ3A 3QFWA 1A7GE 4CF8A 5LSRA 2DXEA 4MFBB 4PZVA 3MWPA 2IPOB 1LWCB 1QM9A 2DITA 1ASUA 2MJUA 2H9ZA 5L39A 2NR0A 4WK1A 4E89A 2WAQD 2J9EA 2OIHA 3S7RA 3IM8A 2ZBRA 4JI1K 1YG0A 4H5TA 4DTPA 3D2FA 2V67A 3EKSA 4YORA 3M2RA 3KD5E 3D2EB 2P8IA 3W2WA 1WOQA 2GJFA 3HVWA 2GMLA 4LREA 5CZXA 3CD6N 2EK1A 2C2DA 2OANA 1NGBA 3FGUA 4KH1B 2BE9B 3SQ0A 1HBMA 3KJFB 1HARA 5C24B 2P6TA 3LA0A 3DOLB 2C1EB 1RWNB 1QTNB 2VG6A 4UZBA 2KDOA 2QLXA 1XWLA 4P52A 2D0AA 1UPMB 1RBSA 3VTHA 4U6PA 1IBMF 4OX8A 1Q16B 4J7CA 3Q8SB 5ADXA 1VQKS 3MECB 5AQZA 2Z56B 3FBBA 3WNEA 2ZC4A 4RW6B 1ILYA 3VQ4A 2GEMA 2K3IA 1FD8A 2RRAA 2XS2A 2F63A 3QLHB 1R3NA 2DK2A 2KT3A 1AXQA 4J9KA 3UO0A 3CDUA 4ZP6A 1KR4A 4KGMA 2W24A 3BR9A 3H5YA 3VEZA 3IWNC 1TKDA 1NB7A 3FGVA 3TSQA 3TA1A 1NB2A 1JLGA 1TYQA 4KV8A 4ED1A 3AY0A 4K0KK 4DV3F 2HQ3A 4UOFA 3R9LA 4JI6K 2D41A 3UCZP 3M8PA 3KK1A 4DQQA 3OTDA 2Z30B 1YK9A 2KM8B 1QSYA 1PILA 3I5CA 2MGZB 3VPZA 4LH4A 4IH5A 3U3GA 2VJVA 3BO3A 1N0VC 4WFYA 5KG0A 4CFAA 4IKFA 1S10A 4FLWA 3QIDA 2UUCF 1XMOK 4A8QA 4FYDA 2YJFA 4B08A 4DL5A 1R0BG 3AVCA 1DLOB 3T1YF 3PM9A 4LVNP 3PR4A 2FSKA 4JKAA 1YBAA 2BRLA 4WFAQ 1BWVA 1B0VA 2MQOA 1PGZA 2J6TA 1RHUB 1IR1A 2VCPA 4QIFA 2JSXA 3GR0A 4FWKA 3M8QA 1K6YA 2ZOFA 4TXSA 3P83D 4F2SA 4QWCA 3GIMA 1LAWA 2QZ8A 4CLZA 2XMVA 3UFCX 1FKOA 4JI3F 3HM9A 2CNLB 1QHTA 2HBMA 3LM9A 4CBXA 2LEAA 4Q8EA 4FO0A 2M4MA 2ZKUA 4KGVB 1QLNA 2NRXA 2HMIA 4IWVA 1VLYA 1S22A 2ZQBA 2R8KA 3OHRA 1BQMA 2ZOMA 3J7AP 4FLTA 3CIPA 2CQ4A 2FPHX 3V4IA 2G8IA 2MY7A 3O1BA 3CCTA 2UXBK 1NGHA 2GBZA 1RK8A 2Y1RI 2NZ4A 4LBIA 1R8AA 4AHCA 4DL2A 1FRLA 2DIUA 4C3LA 3HPGA 1IJFB 4CEEA 3NF9A 3PJXA 5T7LA 3LP3A 3TARA 2IM3A 2ZVIA 2JOQA 5T14A 1Z4UA 1FEEA 2AT1B 2D9PA 3O2IA 2O4GA 1U1KA 3ENWA 4YR2A 4F36A 2D3O1 5GADI 4DUYJ 2RQ4A 4CJFA 1VQSA 4H4OA 4M45A 3P4UB 3ZSOA 3CHWA 4DU4A 1S1UA 1T05A 3CCMS 1YZ6A 1S0VA 1K0VA 1XHXA 3NEKA 5IT9U 4KAZA 3TAPA 3AARA 2C22A 4KRWA 1CJKB 2A6AA 3H5UA 3JSYA 4LFBF 1KHVA 3WEEB 1U1MA 5KI6A 1JJHA 3HXMA 2WB4A 2GCFA 4K43A 4ETXA 4XAKA 5IZHA 1VQ5S 4EP5A 4A61A 2WVEA 1WTBA 5KFGA 3VQAA 5AQQA 1KQSM 4Z4GA 2RQMA 4FPAA 2XSFA 4JKBA 2QYCA 3T7ZA 4U9RA 1GLLO 3TSPA 2K1RB 2EX3A 4YB1P 4YY3K 3E2EA 2R7WA 4DB3A 3WNHA 3JYTB 5B0AA 3ISND 1V4SA 3CJTA 3H40A 3CIMA 3ETOA 2RS2A 3DXMB 3MMAB 2P9UB 2Q66A 3H1QA 1BY9A 4M1KA 2MMYA 4K59A 1N0UA 3VCDA 1WD6A 4GVBA 1BISA 5KFKA 1IQTA 3WQUA 3FFKB 3HBTA 3JAMO 4M3ZA 4NI2B 4OZ1A 3D0IE 2JEJA 4P2FA 5BR8K 3CMAN 2ZH8A 3ZTSA 4RLEA 1HL6A 3R1HA 2MKCA 3CDWA 4G65A 1VRUA 1SKUB 1QJHA 2EHGA 4JHDA 4P71A 3AA2A 3HSTB 3PLAA 1F2GA 4LF7F 2QGFB 1HNVA 2CZVC 1HKGA 4I9QA 1FFSB 3BH6B 2FD2A 2KVQE 3BKUA 3OYMA 2YNFB 5HLFB 2R8HA 4X64J 4W5NA 4CJWA 1HQUB 4RUHA 2BOPA 1WHWA 4OX7A 3O3FA 2VDIA 1VQYA 2CDRB 4GV6A 4B3SJ 4QR2A 3TUZC 1IR0A 3OXFA 1SL1A 3CJ1A 3OD2A 2FDNA 4UW2A 4CE9A 3UR3C 4HT5A 4ELTA 1NO8A 3ILOA 5CQGA 3PJWA 1BIUA 4F4ZA 4I64A 2R8IA 2H5JB 4NEZA 3OYCA 3S3MA 4KB1A 3O9TA 3O9RA 3FCWA 2FHJA 1RLDA 1ZBTA 2AW0A 4NZ6A 2V2ZA 3QFUA 1KAZA 2QSWA 2OJ3A 3VF6A 1F2HA 4A2AA 1Q82O 3SDEA 2AJFE 3VQEA 4PKDB 4CLLA 2BJ9A 4KHPF 5AQLA 3OYDA 1WC6A 2WVFA 2QYGA 3MN7A 3BZKA 4X4TA 3I82A 2OPRA 1AZSB 3C8YA 5AQHA 1WORA 4QWEA 1HD0A 3P39A 4CGIA 2NRHA 3LDPA 3A8IA 3AVAA 1RWOB 3V5RA 2AYMA 3QESA 2DCUB 3RAMA 1RZMA 1S1XA 3I9ZA 1NGAA 1Y7PA 1X31C 3GDQA 3LP1B 1Y5IB 4P74A 3VF2A 2CPXA 5KPRA 3QNNA 3TAMA 2VONA 3BSNA 3PRBA 3CW2C 3PO4A 3D6MB 4X4UA 2VYPA 3VQTA 4DOZA 4FXWA 4CZIA 2PI5A 1FNMA 4KKOA 2RUGA 5IM0B 2RRNA 3KHGA 3VZHA 3LGNA 2JFKA 3D7SB 1WAJA 1Z1ZA 1RABB 3NBPA 1NJZA 4QQBA 4YB6A 1Q18A 1DTTB 3QMLA 4GV9A 4A62A 1NHVA 2H5EA 4OMFG 5KFPA 2ZITA 3G87A 1TL4A 4LBHA 3V81B 1FNOA 3LO3A 4EFAC 4RR5A 3DMJA 2CWKA 4DR7K 4M63C 4WYWA 2BKPA 2AD9A 1RBLA 1SJ3P 1GK8A 1NGDA 2DGQA 1MN9A 1X9SA 1LWEB 4E0DA 1PG5B 3H4BA 3R27A 2UU9F 2YQ3A 1RT2B 2Z58B 1KLMA 3R8EA 4JI7J 2MZ1A 3PYGA 3NAIA 1GTHA 1UWAA 2NZCA 4U7UK 2CJXB 4LF8F 1GOBA 3ET6B 2GWJA 3QO9B 1NGJA 4FJ8A 2G8KA 4MT1A 4ZJQA 2VHGA 2XYPB 5F0UA 1SH3A 5L46A 2AU0A 3MI7X 1Y10A 3LAKA 4IFVA 1AUSL 3IMQJ 1KOHA 1K44A 2JWNA 2ZD1A 3SJJA 4JI5J 2HNYA 1NEEA 4CGFA 1FX4A 2BKNA 4BQZA 2P1JA 4ILGB 4M5MA 4AL5A 1OVQA 3RU0A 2Z2LA 3OT9A 5EUHA 5KFTA 3SNNA 4LSZB 3W7BA 2BJ3A 2Q31A 4DI6A 2LA6A 4KGXB 3KUEA 3LQVA 4O0IA 1JCEA 2M3DA 3TI0A 3QAUA 3D2FB 4E98A 5F9LA 1ZBSA 3GIRA 2HBLA 1AW0A 1X4FA 2ZNYA 3G9CA 3W2WB 4CHPA 3GFZA 2YKMA 2BX6A 5DM6L 3DRXA 2J9DA 1NAQA 4X66J 2M52A 3OHBA 3MM6A 1NGFA 2VFSA 4OLOA 4H5RA 4CJQA 2UUBJ 1HBMB 1WBBA 4NLQA 1WKJA 4DF8A 4BRHA 2H54B 4DUZJ 5KT5A 4MK9A 2VG6B 4LRFA 4LFCF 1Y11A 3CQYA 3H2LA 2GFFA 5LMNF 2H48B 2VKRA 3EGZA 5BXIA 1UVKA 2V8HA 1VHXA 1GX5A 3KLHA 3AVKA 3M9NB 3M2VA 4RU9A 4L3QA 1TKZA 1S0OA 1JLFA 3IAS9 1XHZA 4DG1A 2B0GA 3J8AA 2E9RX 1PBUA 3CC7S 1FRMA 5D4PA 2P9EA 3LDLA 1PCAA 3D1QA 1JLGB 1VSDA 1YDLA 4KV8B 1KFDA 3RYLA 3NWRA 2X51A 1YJVA 3DGPB 3G2XA 3M8PB 3KK1B 5A8KA 4DV5J 1FKPA 2G8WA 4M42A 3UD3P 2I6WA 2IFXA 2VUGA 3SUOA 4OV1A 1NSAA 4IO8A 2R42A 2VQFJ 2PBDA 1WN7A 1V5IB 2V94A 1X5OA 1S3XA 4QJVA 4H5NA 1M5SA 4LF1A 4FWQA 4LF5J 2LQJA 2W8KA 4JN4A 2IRYA 4TY8A 1UA0A 1SVDA 1QS4A 4XH1A 3VEOA 3AQOA 4BBYA 2RNEA 4DBQA 1F9EB 2IM2A 2BXJA 1NGGA 3VETA 1UFKA 3IRWP 4HHJA 4WKYA 1Q8IA 3M8QB 2L9NA 4DN0A 2GC8A 5D78A 2NLXA 4CECA 4F02A 2WK4A 5HQMA 4U8VA 4E7JA 2FF3B 3NH0A 1MG7A 1QAJA 3KK3A 3R5CA 1OKJA 3GLJA 3BZCA 5HVGA 4DR6J 4KBOA 3DU5A 2JC0A 2DTUA 3UD5A 4KBIA 3GWCA 2E2OA 4KC5A 3CQ8A 4YOWA 4Y2KA 2LCWA 4OHXA 2Q3PA 3HI9A 1JK9B 3ZFVA 1SZ2A 4I1TA 4PEOA 1BQMB 2HS4A 3I0RA 1WI6A 1UEKA 3P6YC 4FYVB 1Q8KA 4CM2A 3VA3A 4E8UA 4DV1J 3QMQA 3WQPA 3C6AA 4DUYK 3PACA 4NL5A 1ZA1B 4DDFA 2MXYA 1VBYA 2CPHA 2E7VA 1HNXF 4EHUA 3QEWA 4LF4F 4YHHF 1NOYA 4W90B 5KTQA 4DSEA 2KKHA 2MY8A 2BE7D 3THVA 3MCOA 2BUNA 1VR6A 1H2VZ 2AF6A 4CZKA 4LQ9A 2YX1A 3BM7A 4J9VA 4EYHB 3SQGA 1NK0A 2AZ3A 4O3PA 2PE8A 5K14A 1CXUA 4YOUA 2NLWA 1NLKL 4KRFA 3D7EO 5FPNA 1A0OB 3UN2A 3OFFA 2LEBA 5KFFA 2ETJA 3ZZPA 2VG5A 4MMOA 4H4OB 1MWMA 3M30A 3OTOK 4CJSA 5IXUA 1BLUA 1KQGB 5FDLA 1S1UB 2CPYA 1YITS 4OI6A 2NS1B 5F8GA 2HSTA 3MD1A 2GA7A 2UUAK 3KMSA 1DEJA 4BDPA 2R7XA 3GB0A 1HJRA 1I94K 3NVKA 4MIAA 3AOBA 3T1HF 1M5HA 3OYLA 4F8RA 5HMXA 3CCQN 3GG4A 1YIJS 1RTDA 5BPMA 1GOCA 3KLVA 4J9RA 2KYZA 3FEZA 3TUPA 3RSEA 3VA0A 1JIHA 1Z2ZA 2YCHA 3OYHA 4ECYA 1S72S 3RBZA 5DJBA 4DU7A 4FF1A 2CPDA 3PYEA 3QSYB 2O4IA 2BEFA 2QA4G 3MCNA 3AA8A 4JK8A 2I5JB 4P75A 3THXA 1D09B 2X78A 2Q3SA 4B1YB 2N7CA 2LXIA 4D3GA 2QKKA 1RXOB 1NKBA 4OGCA 1RAAB 5KOWA 3GBTA 4C8OA 2XWYA 3EUNA 2E5LJ 1YWXA 2PMWA 3GCWP 1KEKA 5DGBA 2FGCA 4Q8FA 1RT6A 1IUJA 3TWHA 1VC5A 3AA4A 4M5KA 3OL7A 3OR2B 4CLSA 4Y34A 1NBWA 2RU3A 4YEAA 3DOKA 2WSEC 2IS3A 1LW2B 3Q0AA 3QEVA 2ALZA 2KXHA 3UNGC 4B3SK 1HR0F 2XS5A 1VRUB 4C0OC 2O8DB 5ETSA 3C7NA 4ZIVA 2JRSA 2XO6A 2OCEA 3NGZA 1RWUA 4DPYA 4QS7A 4FNIA 4P7TA 5BREA 2PMZD 2OD6A 4CEAA 3TVYA 4N8NA 1HWLA 1KSPA 2MDAA 3CCRN 1OY8A 4L3KA 4DSJA 4CFCA 4OPAA 3NGKA 1ZZNA 1E3MA 2E1CA 4TN2A 1V4TA 1Y5NB 4F7VA 4OZ0A 2IHR1 1Y97A 3W66A 4FLYA 1SV5A 2Y9HA 3CT9A 3SZ2A 1HNWJ 2LFVA 4A8FA 4F04B 2BW7A 1T0TV 3G4SS 4R5PA 3T5HA 5AXKA 3LUYA 2JGUA 1BE4A 2QE5A 2UVWA 2VG7B 3AXKA 1K73O 1M90O 2YX4A 5B0FA 3ZO7A 1NK7A 1KXPA 4RU2A 1H0HB 4CK2A 4BRFA 1KVKA 4LFAJ 4BY9C 3JQMA 2WBRA 4DS4A 1BUXA 2HHUA 3O5TB 4JRPA 3ZSYA 4ETZA 3BKTA 2HSEB 1XNRF 4HVJA 2UVRA 4JEPA 4FW2A 3HD1A 4A47A 1VLOA 1HBNA 3O3GA 3MCMA 1H2TZ 3AB4B 2XWXA 3FBCA 3IP0A 2J0XA 1T6DA 4CJEA 4NLDA 4ANDA 2XNRA 3DCAA 3FNNA 4OYAA 5JJBA 3FEYB 1NHKL 2HVIA 4PQUA 4J2DA 3PR5B 3L2VA 1FX2A 1IBCB 4DV0J 4DR5F 1U6BA 3PTWA 1B4SA 2R3VA 1APSA 4HLBA 1XC3A 1FF2A 3X3UA 4PG4A 2RAQA 2QL5B 4NLOA 3JSBA 4NRUA 2UXCJ 2GV1A 3J7ZT 3EE8A 2M70A 1FERA 2IVPA 4RW8A 4DZDA 3IGVA 4CF9A 4OFZA 4P2SA 4DHVA 1YBUA 3V9XA 4Y28C 3T3FA 3BSCA 4ZITA 2W8LA 3LGMA 2B9EA 1XNQJ 3FRZA 1FKAF 3TEHB 4DTNA 4AHUA 1VHFA 1HLWA 5J1NA 1VYAA 3HULA 1VQ7N 4JI7K 2YI1A 3G6EN 4RX6A 3PIPQ 3AOCA 1X4GA 5ETQA 3DMJB 1RI7A 2DCLA 4K42A 4MK7A 2OZMA 3V6KA 1LK7A 2GS8A 3TTCA 1VBZA 4U95A 3TUIC 5AJ3J 1MDUB 3VERA 1LOUA 2NXEA 1O6XA 4FN5A 2MQNA 4YDUC 4DQIA 1PJ7A 1KC8O 1RBOB 1C4CA 2MQQA 1ZM2A 3CETA 4JI5K 3R7SB 1HQEA 1U0HA 1TP7A 2F9DA 5A2QO 4WFBQ 3QATA 5BYQA 3MEGB 2NNWA 3AVLA 4B9VA 4FLVA 1XMQJ 5HANA 2JC1A 1RTJB 4IOCL 1ITGA 2RQKA 3EEQA 1R31A 3L7PA 1JKHA 3EX7B 3PSFA 3O6QA 2VBXA 4IFVB 3JS6A 3HX9A 1H72C 1YJ9S 2EFVA 3JQKA 2DNRA 2ZD1B 3DLRA 2HNYB 4NYZA 3LPUA 4CZGA 2VASA 1GOAA 2DRBA 4F3TA 1UWBA 5DLFA 4ZPVR 1IBLJ 4LRDA 2E29A 4X4QA 2Q97A 4P2MA 1HWIA 5KFJA 3DLEA 4H0PA 2Q0RA 3R5DA 4X66K 2HNDA 2WVCA 3R6GB 3LDNA 1ACMB 5FLXY 2UUBK 3AQPA 4NLPA 4Y2MA 4QIWD 1Q1KA 2AMCB 4ATNA 4B1ZA 1VSLA 4Z37A 1UFWA 4DR4J 5AR0A 3QETA 4ZDNA 2O8EA 3ZT0A 4DUZK 2H5IB 1HYZA 3EMTA 1CJVA 4E7LA 2ASJA 4OYMA 1Q81T 4K7QA 1VQLS 3BN7A 3M4XA 2YKMB 2MTLA 3MMCA 2HBZB 3GV7B 2P9NA 2NSCA 3MM6B 3MGJA 2GUPA 5I3UA 2D69A 1D0EA 2DKOB 4NASA 2NPFA 3L3CA 2APOA 2CIMA 5E41A 4C8YA 1B7YB 2E1RA 1TK5A 3M8WA 3TA0A 2IMOA 4DSKA 3HHLC 3OFGA 2LDYA 3TNVA 4H4KA 2ZJQL 2ZEJA 3OTBA 2DHHA 3ITHA 3EL2A 1IN0A 3CSKA 4JOUA 4KREA 3MMJA 4DV5K 4JI8F 4O55A 1LWXA 2VODA 3KLHB 1BCMA 1IH7A 4IO9L 1U8WA 2NUHA 1TKZB 4ZJLA 2BA9A 4NX9A 3B8HA 3O3HA 1WSGA 2KXNB 3CD0A 4RL1A 1SJRA 4BR7A 1N48A 4LF5K 4CGHA 1PC4A 3MFIA 3QWUA 3I8BA 2JLEA 3AD8C 2Y1LB 4X62J 4OX9F 1X60A 3ENHA 5GINA 5A8KB 1FKPB 3M5RA 4QR1A 1IO2A 3CC2N 1XUPO 3PUFA 4PPZA 1WDDA 4UF4A 1DKGD 1TAQA 4IQXA 3V1QA 1NU4A 3IAM9 3S3OA 2B4UA 3H45C 2YWGA 1F60B 3HHEA 2DISA 5ADZA 1G99A 2WTUA 3FBFA 3CM5A 2FGOA 4TY8B 2KFZA 4AHRA 3MM8A 4IDKA 4IR1A 4MYUA 5JS2A 4OI1A 3G25A 3OYIA 4GMJB 4OLBA 1TK0A 1HWJA 3RAXA 4CEOA 4JBCA 4ELVA 3FCHA 4H54A 3HFVA 2QXFA 3IS9B 4JYAJ 4DV1K 3C46A 4CGDA 3ENBA 3RRGA 3MMVA 3HKWA 1U0SA 2F8SA 2P9KA 3CJQA 3C6TA 3TU5A 2MZRA 5ETMA 3BEGB 1NHUA 3KNGA 1A5WA 3P8BB 1N33J 1S12A 1ZAWA 2P9GA 4USVA 2XZWA 2Y8YA 5FPEA 3MPDA 2E1PA 5D0HA 4HTLA 3NMUA 3I0RB 5DO2A 3FQLA 4KT0C 2E20A 5AQUA 3ZEUA 2ZJPL 1NKEA 3EXYA 1VDHA 3J7YU 2D0OA 1Q79A 4OX6A 1NNDA 1FK9B 2EFGA 3DXKB 3C0BA 4CNYA 5KFQA 4DMNA 1C0UA 4WXWA 4M5GA 5KG1A 4H0OA 5G0RA 4DPXA 2QMWA 4EZ6A 4O8UA 4ID5A 4DV2J 1T8EA 1Q9YA 5KGWA 2GWKA 5AQFA 1RAEB 1RAFB 2CJKA 4OI3A 4CJ5A 4R79A 3DNCA 1SB6A 2IDOA 1CG2A 3S6EA 1X3MA 3SQGB 3G82A 1RWWB 4ZVTB 5K14B 2C28A 3NXZA 3PW2A 1GMWD 1C0TA 3CD6S 4FXDA 3W3SA 2BV3A 3POTB 1K9MT 1L3UA 2VG5B 2D0BA 3QIOA 3W3DA 4FF2A 2ZHBA 5FDLB 2HBJA 4WF9L 4L74A 3GU0A 4AD6A 3TANA 1N52B 3P1GA 1RISA 3CIZA 1YF5L 3U9DA 4DR2J 5E2QA 3NNCA 3OYBA 4ZTFA 4HHHA 5D4NA 3EE3A 1XC9A 1RTDB 1WOOA 4C1NI 2FJVA 1NJXA 2Y1JA 2C2MB 2LP4A 3TZWA 4WYLA 2CAJA 2E5LK 3RSEB 1QE1A 4ES3A 2V5HG 1JNZB 2CZ4A 4KHWA 3OFHA 2FBYA 1RQ0A 3UD4P 1DY3A 3A8YA 1TUVA 1JL2A 2DGWA 1UPPA 2IM1A 4FP9A 4DR1J 3I55N 1KVJA 2O1PA 3OPKA 2EC2A 5FJ4A 5D0RA 2UUTA 5LSOA 5E84A 5HATA 2ZBPA 3P5JA 4ECSA 3CE8A 4JRQA 6AT1B 2VOPA 1B99A 2NCKL 3FFIA 2A5XA 3I56S 2F8EX 1RSCA 2KFNA 4H0TB 4A48A 2EFNA 1RT6B 2W4DA 4CGJA 2K7JA 2BM0A 1DZ5A 4H5VA 5CR4A 1A5XA 3AAQA 4DS5A 1CZ9A 2JL9A 1NCLA 1N32J 1HBOA 2CYYA 3A8JA 2WUSA 2V6AA 4ZCLA 3DOKB 4B3OA 3RW6A