1TKZA

Crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 142
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkzA05
1S9FA 1BHLA 4OGCA 4WFZA 3MR5A 4ELVA 4RUCA 1XI1A 2JGUA 1CSJA 4Q8EA 1XWLA 4KFBB 5KT7A 3KLGB 3RAQA 1JLBB 2R2UA 4FM1A 3NF9A 4YP3A 2RDIA 4E89A 2AQ4A 1BIUA 4LY7A 4CK1A 3MXMA 3ZT3A 4I9QA 4KKOB 1SL2A 2PY5A 3RTVA 4Q44A 4BE2A 1SUQB 2ZE2B 4CJRA 2C2EA 1HYSB 1LWEA 4CJWA 1K1SA 3RRGA 1UWBA 2ATQA 1ITGA 2WONB 3GIJA 4HVJA 1X9WA 4H4MB 1JLFB 1LAWA 5EWFA 4FBUA 1VSDA 2OH2A 4ED1A 2VWKA 3AO5A 5I42B 2AJQA 1EP4B 1WSGA 4IRDA 1TKDA 1IKWA 4KO0B 3HPOA 1RA7A 2G8IA 4NLGA 4GC6A 3I0SA 3BSCA 1B9FA 4B9VA 4CFBA 4W5OA 5KG5A 4ED6A 4RNMA 4O0JA 3EPIA 5DK5A 3OYKA 4Q43A 3OYCA 4LH5A 1VSLA 4ZHRA 4CESA 3DLHA 4TLRA 2XY8A 2OPQB 2HMIB 3I5AA 1VSIA 3QZ8A 5F8JA 2D0CA 4B9LA 3O4QA 4BDYA 5DGAA 4TY8B 4ECVA 2ASLA 3QERA 4B8AB 1HQEA 4AHRA 4FJGA 1NHUA 2KQ2A 3MEGA 2HNDB 4CEBA 1S5JA 3FFIB 4ZVHA 3KTQA 4OKKA 4ED8A 1B92A 3WNFA 4W5QA 3OSPA 3VQCA 1I3AA 2ASDA 4NRUA 1EETB 4DU4A 4NYFA 4CJQA 2RN2A 4E7KA 1U49A 3GIKA 3VQBA 3RB3A 2XY7A 2F8SA 1FKOA 4CERA 2V4QA 2DFFA 3SPYA 4RW8A 1T94A 1LW0A 5KT4A 1YVUA 2FVSA 4WFXA 1TKXB 3VQ6A 3KLHA 5FRNA 4FXDA 3TQ1A 2IAJB 4C8KA 3SFUA 1RAJA 5DG7A 1UOCA 4QWCA 1U09A 3OJSA 2E9RX 5EWEA 4FJIA 2Z1IA 1NK0A 4HUGA 1Z25A 3V9XA 3PW0A 4DMNA 3KOAA 3N6LA 1YTUA 5HBMA 5KT2A 4J2DA 3VQ4A 4E3SA 2HNDA 1TL3A 3ZCMA 2QV6A 1S6PB 3MEDB 1RYRA 1J5OA 2EHGA 2Q3SA 3OHBA 2J6UA 3QLHA 4IG3B 5KRSA 1NK5A 2E6LA 4CIGA 3DM2B 1HNVB 4KI4A 3F73A 3ZT1A 2B5JA 2G8VA 5EU7A 3RAXA 4CEQA 3L2UA 3LZIA 4CJPA 2P1JA 3RMBA 1SH2A 4NLUA 2W7PA 3DOLA 1RDDA 3TAMA 3V4IB 1UA0A 1FKPB 3VN5A 3DOKB 1NJXA 4DS4A 4EEYA 5C25B 3UR0A 4BACA 3LP1B 1CLQA 3D28A 5DG9A 2KTQA 4C8OA 2XGQA 5KFIA 4FM2A 5KFVA 2WK4A 4CHZA 1SKRA 2G8UA 3EZUA 3LP0A 3ZT0A 4U7CA 3JSMB 4RW7A 5DLFA 1NNDA 3OYFA 2W9CB 4DQPA 4DTSA 3ZSVA 4K4UA 4OLBA 2RKIA 3VA3A 1QQCA 1UWBB 4GW6A 4B9NA 3QESA 4QWEA 3MEGB 4Z4IA 1S9GB 1HYSA 1RBVA 1RT2B 3PW2A 2YNHA 4J9RA 4ID5B 2P5OA 4ECZA 4ZVEA 4F4KA 4QW8A 4EO6A 4KTWA 3DM2A 3FQKA 4FK2A 1TKTA 5DQGA 4CGGA 4BE1A 1HPZB 1KLMB 5JXSA 4OLAA 2WOMA 3M8QA 3BREA 1LWCA 1RTHA 1FKPA 4Y1CA 4DLEA 3I8DA 4NLPA 3SQ4A 4NLVA 1JLCB 3BGRA 2O5DA 1F21A 2HAIA 4RG8A 5C24B 1BL3A 1VRUA 4JV0A 4QOZB 3F9KA 3QGHA 3NMAA 1VSMA 2OPQA 4H54A 3KNAA 1KTQA 4TN2A 3A2FA 4KTQA 2FVRA 3D45A 1C2PA 2ALZA 4XIUA 4TYAA 5L1LA 1S4FA 3RMDA 3PJXA 4WZMA 3KLFA 4X2BA 3NCIA 2FJVA 5J2QB 4F3OA 2X6SA 4IH6A 4CF8A 1T8EA 1FK9B 4TSXA 1U45A 3SCXA 2JC1A 4FJJA 3V6KA 4ECXA 4CK3A 4J9OA 3B6OA 5KFZA 4EP4A 1JXLA 1L3TA 3ISNC 1UAXA 5HRPA 3BDPA 1ZBIA 3ITHB 1JLCA 3MTKA 4B9SA 1QSYA 4ECTA 3HJFA 1CZ9A 5HLFB 2AX1A 2V0NA 3NL0A 3Q8PB 3BSAA 4J9MA 4CJ3A 4ZPCA 3M8PA 4RNHA 4CE9A 3EYZA 3BQ2A 1S1WB 2RF2B 2OPSB 1SUQA 4WZQA 4M45A 3KHGA 3SZ2A 1MU2B 1RT2A 4FZZA 4KPYA 2CKWA 4OKEA 4IG3A 1S1UB 1HMVB 3DMJB 2JEGA 3RB6A 2O4GA 3TAQA 3QEIA 3KLVA 4GVMA 2WOMB 3H40A 4MIBA 3CM6A 4IBNA 3IS9B 3N6NA 4N41A 4Y2CA 4F4WA 2YNFA 3ZSYA 4DF4A 1WNSA 4WYLA 3AVGA 3GYNA 1EXQA 1RT1A 2R8IA 4KFBA 3LZJA 3L2VA 2F8EX 2A1SA 4KHYA 1TQLA 3IN5A 1XR7A 3OYAA 3M8PB 5JUMA 2ZD1B 3OL9A 3HP6A 4FM0A 3D0PA 3GIIA 2DFHA 4DFPA 1LWEB 3QO9B 4Q8FA 4JV2A 4PWDB 4FZXC 3KK1B 4AHVA 3KK2A 1VSKA 3ZT4A 4RW4A 4C8NA 3H2LA 3G0ZA 3QNNA 4ZP7A 1T03B 1G15A 2J6TA 3VQPA 3PR5B 4M94A 4ZMMA 1TK8A 1VSHA 1U47A 2G8FA 3Q8RB 1TKTB 3HVTA 3VQ7A 4Q0BB 1IKYB 3VQ9A 5CYMA 3OYIA 3KLIB 5J1EA 2AGPA 1C0TB 4QW9A 4I2QA 2HHSA 3QINA 2Z1GA 4IFVA 1RT1B 4RNFA 1RDCA 1JLBA 2HNYA 2YNGA 1S97A 4ZVGA 3QGGA 1IKXA 1LAVA 3TR8A 3NGZA 5KG6A 3V9ZA 1JLEA 4UQGA 4E7LA 1L3SA 4K4YA 4W5RA 4O4GB 4FYDA 4Y3CA 1QE1A 4B08A 4HUEA 3AVIA 1Y97A 2AGOA 4CF2A 3K2PA 5FRMA 4IRCA 5KFKA 2E9TA 4FLTA 2R8GA 3MXIA 3E01B 1S1UA 1S1VB 3CG7A 4ZP9A 1X9MA 2XY6A 2A1RA 2KZZA 2FBVA 2HHWA 2R8HA 2VG6B 4FJLA 4LQ9A 4PUOA 2ILYA 5KFRA 5DLGA 3L3VA 1DLOA 4GC7A 1J53A 2D0BA 5CZ2A 3IG1A 5J2MB 3JYTA 5KFHA 4K4XA 4C8LA 1EP4A 5FDLB 2OA8A 5HP1A 2WRMA 3H4DA 4NCAA 3NFAA 1IG9A 5J1EB 5J2PA 3QIPB 2FJWA 2HNZB 3NKYA 2P5GA 1KRPA 1NK9A 4OPKA 4CGHA 4IFVB 3DLKB 5KFYA 3HK2A 4ECSA 1RDBA 3MFHA 3H5YA 4CF0A 2V9WA 5KFOA 5KT3A 1KVBA 3IGNA 5JS2A 5HLFA 4RUAA 1QAIA 2YKMA 2ASJA 1CZBA 1S0MA 5D3GB 5KG7A 1JLAA 1S6QB 3AA3A 4M41A 3KHLA 1QE1B 2GIQA 3OYNA 2YNIB 3NBPB 4EZ6A 2FVCA 3AVJA 2IMWP 3SPZA 5K14B 5HROB 1QHTA 4ZVFA 4CEOA 1BQMB 1RCHA 5CY4A 4NLDA 3QLHB 4PA1A 1S1TA 4DTXA 3QZ7A 4AHTA 1N5YB 5SWMA 3NGIA 4Z0UA 1BQNA 3BR9A 1SH3A 5KG2A 5KTQA 3RR7A 1ZBLA 5KT6A 4DL5A 4F4YA 3DLRA 5F8MA 4CIEA 4DS5A 3MR2A 5F9LA 1C1BA 4J9LA 3I5CA 4I9LA 4CHYA 3SQ2A 1WLJA 3AVKA 4LH4A 4DSLA 1W0HA 3AA4A 2FVQA 3DRRB 4QWDA 2DTUA 5KGXA 4PWDA 4K4ZA 3BSOA 4TQSA 5T14A 5FROA 3K5MA 2BE2B 1C0MA 2I5JA 4NZ0A 1XR6A 1B9DA 1KHWA 3V1RA 4CFDA 4PUOB 1RT7B 3EY1A 2IM0A 1GX6A 3DRSB 4O3SA 1JL2A 1HNVA 1JLQA 4ICLB 1ZYQA 2ATLA 3PX4A 3VQSA 3ZT2A 1KLMA 2QKKA 4DL7A 4K4SA 4IOBA 2UUTA 1RTHB 3MF5A 2IM2A 1S1XB 1RYSA 1LW0B 3CDUA 1IH7A 3H08A 3C6TA 3IRXA 2IJNA 5T7BA 4G1QB 3UDLA 3OYEA 3TAGA 1VRUB 4URGA 5DG8A 2IA6A 2R7YA 4FJXA 3KJVA 3DRRA 2ILZA 4CEEA 1RBSA 2XI3A 4NRTA 2D0AA 3KLFB 2R2SA 4LSNB 4O3NA 4F8RA 2F8TA 1RT5B 3DI6B 3RBDA 1RTDA 1WSEA 3C95A 1NK8A 3ALYA 4ED0A 1S1VA 5KG3A 3ZSXA 2Y1IA 3T19A 1NKBA 1JLFA 2YKNA 2DPJA 3SQ1A 3OS0A 5EDWA 5KFWA 5I42A 1QTMA 2VA3A 1XHXA 3NH1A 4KBIA 3M8QB 3UPFA 4XO0A 1TKZA 1ASWA 1HPZA 4HYKA 1NKEA 3QEVA 3BGRB 3H5UA 3C94A 2HNZA 4Z4CA 2UVWA 1K1QA 2Y1JA 4BE0A 3C6UA 4IKAA 1S1XA 1KVAA 2CJQA 2BRLA 4DL4A 3O4NA 3SI6A 4K4TA 5C42B 4F2SA 4F2RA 1NK4A 3KIOA 2RPIA 4O3RA 4BWJA 3FRZA 4CCHA 3SV3A 1S6QA 4CJKA 3LDSA 3PVXA 4KHNA 4TY8A 3HKWA 3OSNA 1BIZA 1RT6B 4IFYB 2LSNA 2D41A 4FLYA 4C8MA 3OY9A 1CXQA 1TGOA 1TV6A 1C6VA 4J2BA 3FFIA 1BQMA 4AHSA 3Q8SB 4DU3A 4CFAA 4DTNA 4NCGA 3PUFA 5KFCA 4CHQA 2R8JA 3HXMA 1IKVA 5F9NA 4DU1A 2G8WA 2XO7A 3S3OA 1U48A 1N5YA 3CQ8A 3T5KA 3HVTB 4FLWA 4MKAA 3NF8A 3OYMA 4F4ZA 4JRQA 3K59A 1T05A 3SUNA 3QGIA 4EYHB 5KT5A 4TY9A 2XCPA 3LWMA 3AO4A 4OKJA 1X9SA 4ELUA 3GQCA 4ELTA 3AVCA 1S9EA 1HNIA 4MK9A 1WSHA 5JS1A 3CVKA 4O55A 4CF1A 2WB4A 4MQ3A 3BJYA 3L2RA 1S6PA 3KK1A 3VA0A 1FXXA 1HQEB 4FLVA 4HTUA 4KI6A 1KCFA 1D5AA 2YKNB 1YVFA 2C22A 4RW4B 3LPUA 3HPGA 3FQLA 3DRSA 3U3YA 4NLOA 4DSFA 3G6YA 5KFBA 3V1QA 4R8UB 3RR8A 3SUPA 1VRTA 1ZBHA 1D0EA 1NKCA 1JLGB 2B43A 5KFPA 1BCMA 4KAZA 2W7OA 1ZTWA 4O0IA 4URSA 4CGJA 1D9FA 2IGIA 4CJ4A 4FJNA 3QIOA 1SKSA 1JL1A 1RTJA 3AVHA 3WNGA 3V9WA 1NK7A 4M3ZA 3B6PA 4ED2A 3CM5A 3T3FA 4HCBA 5KG1A 3NF7A 1QAJA 3V6DA 2UVVA 4TYBA 4CJLA 4ECQA 4HUFA 4KSEB 4B9TA 4DFKA 4KHQA 1RT6A 4DQIA 4NYNA 4IFYA 3KHHA 1TL3B 2IJFA 5KFAA 1D9DA 2QE5A 5L9XA 3NAIA 3M9OB 4RW9B 4DL3A 2VG7A 4M42A 4MFBB 3IGVA 1JXBA 3OYBA 3SQ0A 4DQSA 1MMLA 3MEEA 4YR2A 3OS1A 4DQRA 3OVNA 4ZTJA 3SV4A 4EBEA 2GV9A 4KHRA 4ZPDA 3DOLB 2D3UA 4M3RA 1EETA 5FDLA 3VQAA 2VG5B 2IS3A 4CEAA 4JUZA 4KB0A 4GMJB 3TWHA 2HB5A 4ECYA 2XGPA 3THVA 4CGFA 3GV5B 2E9ZA 1C0TA 2BR0A 2BGGA 3CJ0A 1Z26A 1RTIA 4TXSA 4J9KA 4FLZA 1RBUA 5D3GA 3TAEA 2DPIA 2HHVA 5KFFA 1HJRA 2FC0A 3H5XA 3K5NA 2JEIA 4Z4GA 2IOCA 4E1MA 1JLEB 3KLEB 1Q9YA 4ED3A 2AWZA 2FLLA 1S9GA 3T5LA 3OYGA 3FSIA 2NUBA 3PV8A 4RW9A 4I2PB 3G10A 3DLEA 2VWJA 4DTJA 1Q8IA 2P51A 3RBEA 1DLOB 1XC9A 5HRSA 3MR3A 3QETA 1HRHA 1S1TB 4IKFA 4PQUA 3NAEA 1KHVA 4DTOA 4ICLA 4L8RB 2W8KA 4RW6B 3O3FA 4FJKA 1SL1A 4LD0A 3CFPA 2EX3A 3M8RA 4IDKA 3TAFA 3ASMA 1L3UA 1XHZA 3ITHA 4ECUA 4JRPA 1JX4A 5J2PB 3SYZA 4WE1B 3V6HA 5KGWA 1SH0A 3V9UA 3V1OA 2OPRA 2IM1A 3CDEA 2UVUA 4XPEA 4NLQA 2OPSA 5KG4A 2HHTA 4I7FB 5KFLA 2X6NA 1ZTTA 4RNOA 4ID5A 3AA5X 3KKSA 4CGDA 2VG6A 1FK9A 1NHVA 3OLBA 4ECWA 1IKWB 1SV5B 5F8LA 5J2NA 4CECA 1W9HA 2F96A 4XPCA 3NE6A 4LSLB 3I0RA 5KFQA 1JLGA 3HVWA 4K8XA 4CEZA 3HO1A 2XC9A 3PW5A 1LWCB 1U4BA 5L1KA 3L2WA 5KI6A 3FDSA 1N48A 3T5HA 1N4LA 2WTFA 4CJSA 4JS5A 4DL2A 4DG1B 1S49A 1QSSA 4WE1A 2C2RA 1A5VA 4FJ8A 1WAFA 1WAJA 2ZD1A 1JXEA 2OPPA 5DGBA 3OJUA 1DTQB 4O3PA 1L5UA 4N5SA 3OL8A 3RRHA 5KFNA 4YR0A 4NLYA 3VQEA 3LPTA 3CYMA 4B3OB 4HKQA 3BQ1A 4NLWA 3OYLA 1HMVA 2D7SA 2EC0A 3NDKA 1RA6A 4KHSA 4I2PA 5DQHA 4E7JA 4DEZA 4FJ7A 4OL8A 4FZYA 4G3IA 4EBCA 1WN7A 1NK6A 4MH8A 4B8CA 1Z4UA 2GUIA 2ETJA 4IDKB 1VK0A 3TAMB 1RDRA 2HHXA 2FLPA 2HNYB 1BI4A 3KK3B 3GV7B 3I0SB 4DTMA 3HP9A 4MK8A 2JEFA 1D1UA 4Y2AA 1HYZA 3C6UB 4BDZA 4K4WA 4E1NA 4N56A 4EYIB 2OPRB 2BQUA 3G6VA 4F50A 1DTTA 2IAJA 1Q9XA 1KLNA 4FJ5A 4R5PB 4O44B 2JC0A 4MK7A 1TL1B 4WXOA 1ASVA 3ZSOA 2UVRA 2IC3B 5CYQA 4ZPBA 3KD5E 2QXFA 4O5BA 5KFXA 1J5OB 3KMQA 4N76A 4U6PA 1HYVA 3QNOA 3T1AA 1TV6B 5SZTA 3PHEA 4CJFA 4J2AA 3NH0A 3CWJA 2YHAA 2R8KA 3HVAA 3MECB 5HRRA 4FLXA 3RB4A 1I39A 5KFGA 1LWFA 4CHPA 2YNFB 2PYJA 4ZPAA 4FVMA 3KK3A 3Q8QB 3TANA 3M8SA 3KLHB 4M3UA 3CFOA 1SKWA 3KKRA 1IKXB 5KFJA 4G1QA 4Q5VA 3GIMA 1UA1A 3GILA 3P5JA 1JLAB 4ECRA 2OPPB 4IR1A 4FJ9A 3DYAA 1S10A 2AU0A 3EPGA 3MAQA 3UIQA 3JSMA 2J6SA 4O4GA 1GOAA 4YFUA 4O4RA 3L2QA 3OS2A 3ICLA 1HQUB 3QIDA 2XWYA 3ZSRA 2YNIA 3M9NB 4O3OA 2HVHA 3MEDA 1J9AA 1RT4A 3LP3A 3NHGA 4M3XA 4E7HA 4KV8B 4EP5A 3LALA 3V81B 5I3UA 4B3OA 1OS5A 2E6MA 4ZP6A 2AGQA 1S0NA 5HBMB 1RTDB 1KSPA 3QEPA 1LV5A 2YHBA 2OZMA 2XHBA 1TVRA 3GV8B 4FLUA 3HT3A 4FJHA 4NLXA 2W42A 1SV5A 5HRNA 2BANA 3IG1B 3JYTB 5J2MA 3CJ2A 5KFMA 5C25A 3QIPA 2IDOA 1LWFB 2XRIA 1T05B 3OYHA 3DLKA 1BI4B 5KFTA 2FLNA 4DFMA 3RMAA 3LP2B 3E51A 2KZMA 1RTIB 4J9PA 2YNGB 5KFDA 4JLHA 4IG0B 1HNIB 2GC8A 3OLAA 3H4BA 4W5NA 4ZHRB 2O4IA 3PR4A 4B9UA 4KHWA 5DMRA 3SJJA 2W9BA 2OYQA 4O44A 4ID1A 4DTRA 3PZPA 4KKOA 4Y1DA 2BE2A 3DLGA 3H98A 3ZSQA 2VG7B 4PY5A 2IC3A 5CYQB 2BRKA 1RT3B 2W8LA 4CHNA 3S3MA 5K14A 4ZTFA 5F8GA 5F8HA 3PW4A 4FK0A 5I3UB 3V81A 1D8YA 2QKBA 2FBTA 4M3YA 2V4RA 1GOCA 4M95A 4NCBA 4EBDA 3UQSA 4H8KA 1KFSA 3DMJA 3G86A 2YNHB 5KG0A 2QK9A 4F4XA 1LW2B 2FVPA 4PQUB 4RZRA 2VG5A 5HP1B 1EKEA 1WSIA 3P1GA 5F8IA 2AX0A 4NLRA 4IH5A 5KFEA 2PZSA 3SI8A 4RNNA 1BCOA 1SL0A 3DRPB 1JIHA 4Y34A 4QWAA 1VSJA 4CK2A 4QCLA 3V6DB 1S9EB 3DYAB 4KTZA 1DTTB 4M3WA 1S1WA 4KE5A 1O1WA 3K58A 3PO4A 1IO2A 4EZ9A 2C2DA 3TABA 3HSTB 4JS4A 1KVCA 1GOBA 3OL7A 4F3TA 3EZ5A 3V6JA 4YMEA 1A5WA 1WSFA 3AV9A 3MEEB 1RT5A 3DI6A 3RB0A 3DLEB 2WONA 4FW2A 4HCCA 1W25A 4WFYA 1REVB 3AVNA 3MR6A 3CDWA 2B5JB 1JLQB 1TKZB 4W5TA 4CIFA 4KHUA 4MIAA 3I0RB 4CEDA 4KHMA 3PJWA 2ZKUA 1VSFA 4WXWA 3LWLA 1C0UA 2FBYA 4CGIA 1HARA 4CHOA 1ZETA 4E0DA 2WCXA 1C1BB 5C42A 3DRPA 5CZ1A 3KHRA 4AHUA 4QPXA 1RTJB 1C1CB 2X74A 1TKXA 2HWHA 2HMIA 2YV0X 1DTQA 4OVLA 1RDAA 3H5SA 3I5BA 5L1JA 2ZE2A 1HQUA 1QS4A 3LANA 1MU2A 3KJVB 2RKIB 3CFRA 3KLEA 3QEXA 3DLGB 3PY8A 1WSJA 4R0EA 3SNNA 4CJ5A 3U6FA 3HYFA 2GBZA 2Z1HA 4TQRA 4LSNA 1K6YA 3TI0A 3KD1E 1IKVB 2ITGA 5J2NB 1T3NA 3V9SA 3RWUA 4OGEA 4DLGA 3LAMA 1ASUA 3HPHA 3QEWA 3AO1A 3V4IA 3TVKA 4RW6A 4KO0A 4Q0BA 4H4OA 3P83D 4CFCA 4AILC 2BANB 3IS9A 3LP1A 4LSLA 2KFNA 4OPJA 2GIRA 4AH9A 4Z4HA 4IR9A 3PX0A 3PW7A 3T5JA 5L1IA 1BGXT 4NLSA 3G6XA 1FKOB 3KLIA 3DLBA 1NOYA 3NGYA 1VSEA 3M9MB 1C1AA 3IRXB 2HHQA 3LP0B 4CJVA 2B4JA 2XI2A 2DFEA 1TAUA 1RNHA 3SFGA 1C1CA 4RW7B 2RDJA 2W9BB 4R5PA 4IRKA 2FBXA 4IQXA 3ISND 2HWIA 3NF6A 1TL1A 4FJMA 2W9CA 3HM9A 4BWMA 4DQQA 1RT3A 3CJ4A 1A5XA 3VQDA 2KW4A 1U04A 3ULDA 3MFIA 4O3QA 4DWIA 4ZP8A 3BQ0A 4KREA 4QAGA 5E41A 5HROA 4FBTA 1REVA 1S0OA 4OJRA 3BSNA 3KMSA 4FCYA 1YT3A 1T03A 2C28A 3AVBA 1BQNB 3AVFA 2JEJA 1VRTB 3MECA 2E4LA 3SUQA 5EWGA 3O3GA 3O3HA 2BQ3A 3CO9A 1C0UB 5CYMB 2R2RA 4FW1A 1BISA 1RBTA 1TAQA 4BDPA 2FJXA 4K4VA 4NYZA 5KFSA 3OYDA 4I2QB 3KLGA 3HVRA 1NJZA 1JKHA 1R0AA 4DG1A 1WNEA 4CJEA 3L8BA 3QYYA 3S9HA 3LAKA 3AA2A 2YKMB 3WNEA 2IM3A 3D5MA 2W9AA 3NBPA 1KFDA 3VQ5A 1TP7A 1N6QA 4I7FA 1ZBFA 2HHUA 3E01A 2G8HA 2R2TA 1NJWA 5C5JA 4YQWA 1XR5A 4FK4A 2B6AB 1N56A 4NCGB 2Z1JA 3RMCA 4H4MA 4E7IA 3TAPA 3VQ8A 4Z4EA 2WHOA 4URQU 4N47A 1TK0A 4B9MA 4M3TA 1X1PA 2VA2A 2KFZA 4R8UA 3OHAA 3IAYA 3L3UA 4FS2A 3K5LA 3CIZA 3WNHA 3LP2A 4CJUA 4K8ZA 4DSEA 2PYLA 2I1RA 1QSLA 5KFUA 3TARA 4Q45A 3K5OA 3HHKA 1ZBUA 4WYWA 2XY5A 1GX5A 3QO9A 4RU9A 3HL8A 1RBRA 1N6QB 3AO2A 4DTPA 3H59A 4DSJA 4DFJA 3DDKA 4J9NA 4MFBA 4HHTA 3S3NA 3OYJA 2DY4A 1RT7A 3VQQA 3N6MA 4DSIA 4FS1A 2D5RA 1J54A 2I5JB 1RILA 3AVMA 3NGDA 1S48A 2BDPA 1TVRB 1T7PA 5DQIA 5J2QA 3CJ5A 4DSKA 4DL6A 4KRFA 2G8KA 4H4OB 4JV1A 3AVAA 1I6JA 3CJ3A 3AO3A 2D3ZA 4Z4FA 1CXUA 1TK5A 3MXJA 4RW8B 5F8NA 1IKYA 3OL6A 3ZSWA 3K57A 2XCAA 4CF9A 2IBKA 4IH7A 4CEFA 3NH2A 3PX6A 2JLEA 5C24A 5KRTA 4NLTA 1EX4A 2OZSA 4MKBA 3ZSZA 3PO5A 4E19A 4J9SA 3U3GA 3C6TB 4AHCA 2BQRA 4IG0A 1IM4A 1JKHB 1R0AB 4LQ3A 1L3VA 2ZQBA 2X78A 4EO8A 5EUHA 4YR3A 4CJTA 2RF2A 1NJYA 4K50A 1RT4B 1YTAA 3SUOA 3AVLA 3NAHA 4DF8A 4DTUA 3KK2B 4KB7A 4KV8A 4KB1A 4YNQA 4J2EA 4J9QA 2B6AA 1LW2A 4ED7A 2HW3A 1QUVA 4KAIA 2UUWA 1NOZA 4QWBA 2HVIA 3DOKA
chains in the Genus database with same CATH superfamily
4ZVOB 2MY8A 1BHLA 1IBMK 4OJHA 3MR5A 2P9GA 1HHTP 3SCIE 3T1YK 4KFBB 5KT7A 2H1YA 1GMVA 3VGUA 4FM1A 2XNQA 3NF9A 4YEAA 4YP3A 5BXIA 2RDIA 2ZWPA 1QZ6A 3C0BA 5E3QA 3JSBA 1SL2A 4CYUA 1SAZA 1U26A 4Q44A 3JAMU 2XMWA 1RHMB 3J7AN 2IRUA 4CJWA 4C2MA 1NGIA 2ATQA 4IJNA 2H51B 4YHHJ 3GIJA 4MT1A 4PQAA 5EY4A 4H4MB 1GMWD 3SJHA 4P2MA 2VWKA 3CCVN 3AO5A 3I87A 2JVRA 3NGTA 1TKDA 4B1XB 3CEDA 2MPUA 2G8IA 1WHVA 4NLGA 4GC6A 4AQYK 4DR5J 1IBMJ 1B9FA 4G1IA 1JQGA 1LFWA 1EQ0A 2PO4A 5AJ3J 1F0XA 4OO1J 2OEMA 3UN3A 4ZHRA 1GXLA 1NM2A 4DR3K 1X7VA 5F8JA 5LMNK 2O8EA 2UUCK 4LT6A 4B9LA 4BDYA 5DGAA 3PLAA 2J8AA 3QERA 4DR1F 2H54B 2QL7B 2VBZA 1JMTA 1V5IB 2JLGA 4JK8A 1S5JA 3CPWM 2NLXA 2P6TA 3KTQA 4OMFG 1FRXA 1WBBA 2XNRA 1B92A 3HOSA 3G6EN 3VQCA 1I3AA 1RWXB 3ZFVA 3ZZUA 4OQJA 5FPEA 1PJ7A 1S4EA 1EETB 2IMOA 5U47A 2UXCF 4JHDA 1FRJA 3CCLN 4E7KA 2DKOB 2F8SA 2G2YA 3CB4A 3LM2A 2DGQA 2DFFA 1G6BA 3SPYA 4RBUA 1FNXH 1VQOS 2IPOB 3CJ1A 4RW8A 5AZIA 2ASYA 1T94A 1GLBG 1LW0A 2RNEA 1MROB 4FXDA 3G4SN 6FDRA 2J7KA 1RAJA 5C0YA 2JWNA 3KJNB 4C9DA 1XQSC 1U09A 4LFBJ 2E9RX 4FJIA 2QYGA 1NK0A 3BZCA 1VQNN 2WFBA 2NSBA 3M6UA 2LXFA 3MM6A 3TQEA 4DUZK 3P6YC 4NA3A 3ZCMA 4F0KA 4LVOP 5HMZA 1J5OA 4BRDA 3DDIA 2EG2A 3QLHA 4IG3B 3IDHA 3DM2B 3ZT1A 1K8AT 3FR0A 5K8OA 3LZIA 2V67A 3CCTA 3IKMA 3IXQA 1CULB 4F67A 4ZPVR 1RDDA 3O9QA 3J80O 1RGVA 3W65A 2A10A 4RTFD 4YOXA 3UD4P 4BACA 1K0TA 1CLQA 1X60A 3QRQA 2IA0A 5DG9A 1U02A 5KFIA 2L9NA 3QSYB 1SKRA 4Y2MA 2NUUG 1R0CB 3EZUA 2DR5A 3BPSP 1NSQA 5DLFA 3OYFA 3FVYA 4OLBA 3CMEN 4A8SA 1QQCA 1UWBB 4GW6A 4B9NA 3MZIA 2DTJA 3QESA 3MEGB 1YBUA 4Z4IA 1S57A 3PW2A 5IQ6A 2P5OA 5MAOA 1SBRA 3A12A 4QW8A 4F4KA 1OH7A 4MLEA 1S6UA 3FQKA 4JHDB 5DQGA 4DUYJ 1FF2A 4BE1A 3BKTA 1HPZB 3WXLA 1ESVA 2E20A 5JXSA 1YHQS 2WOMA 2LXIA 3RYLA 1LWCA 4Y1CA 1H73A 3HBTA 2FUG9 1PILA 3I8DA 4NLPA 3FNNA 3MMBA 2O5DA 1M0SA 4OI2A 1Z1ZA 4K2JA 3VEVA 2DNZA 3FBCA 4LF6F 1VRUA 4CO2A 3FZMA 2CG4A 3UDVA 3CCLS 1HNWK 1WDTA 4NEYA 1W2IA 3QGHA 3F9KA 3U9DA 2GJIA 2UV8A 3D0GE 2AJ1A 1RACB 3AXKA 1VSMA 2BXJA 2HMPA 3CCQS 1YBAA 4ZIVA 3D45A 4CBUA 4XIUA 2QG9B 3D3BJ 1S4FA 3T1YF 2CGJA 1XBWA 1UZHA 1VC5A 4CF8A 4CDIA 3B82A 3W63A 2P9IB 5B08A 4ZS6A 4ZA1A 4CIOA 3MTJA 1YTYA 1WUAA 2ZJPL 2HQGA 4EP4A 2MY7A 3TZWA 3ISNC 1RCOB 3BDPA 1NGBA 2V51B 1ZBIA 3MTKA 1CZ9A 4A8XA 2UV8G 2HQFA 2AX1A 1Q78A 2V0NA 3WZ0A 2YWKA 4Q2MA 2LQ8A 4H5TA 4JKGA 3UB5A 4ZK7M 4CJ3A 3M8PA 4RNHA 3ZTQA 4H0VB 3LA0A 3CCEN 2OSQA 3BQ2A 4H4KA 4NXNF 4PWWA 3VF4A 2RF2B 1T9TA 1CJTB 2OPSB 2WW8A 4KHPF 1MU2B 2ZFHA 1HBNB 2B0GA 3ET6B 2CG8A 3CGIA 1IBCB 2POKA 3RB6A 1BDGA 2H3GX 4FWMA 3KLVA 4A59A 1CZAN 2WOMB 3UD5A 2ZF5O 2D1CA 2V69A 2ZM6K 4ZVSB 3IS9B 4N41A 3FLCO 2A1BA 4F4WA 2YNFA 4UY8T 4DF4A 3B78A 1RT1A 1F2HA 4FKXA 1VRQC 2R8IA 3QJLA 2E7XA 3F41A 1U6FA 2F8EX 5C2DA 4OYXA 4AUKA 1YI2N 5JUMA 1MN7A 4IUFA 3D0PA 1R31A 4QYZK 1LWEB 5HQMA 4Q8FA 1DKGD 4Y0WA 4NMXA 1TELA 4D3GA 1XMQK 1ZM9A 2I7PA 3IP0A 4XH5A 5H9FJ 3D7EO 2P9KA 3H2LA 3G0ZA 3QNNA 2MKSA 2MKIA 1X0PA 1G15A 1XNQF 2WBMA 3PYGA 2ZJPQ 2G0CA 2VZ9A 3O8WA 1VSHA 4AE5A 2WVDA 1P8ZA 2AJFE 2GAGC 4UQTA 5FPNA 3D1OA 3HVTA 1IKYB 4J7CA 1X3NA 5J1EA 5AQMA 4DR2F 1VC0A 3OFFA 4EI2A 2Z1GA 4IFVA 3ZTPA 2QTDA 2CQ1A 2KHDA 2DGVA 4HEA9 3KWIA 1S97A 1VQYA 1VQ4N 1LAVA 3TR8A 4N8NA 3EDQB 1N33F 4RO0A 6AT1B 4UQGA 1YSJA 1BUPA 1DQAA 1QE1A 2A5XA 1WF2A 3KNGA 3NS6A 4FN5A 4GKJK 1N5TA 2AGOA 3DGPA 1SC3B 2YQ1A 4CT8A 3MXIA 2LDYA 3QSIA 1NH8A 1M1KO 1NB7A 3AGKA 2F9TA 2K8GA 3ONQA 5DLGA 1DLOA 2V63A 4GC7A 3HTVA 4HLBA 4DQ8A 5CZ2A 3JYTA 5KFHA 1VR6A 3BO3A 2OA8A 1T02A 5M1OA 5HP1A 4NCAA 1IG9A 3OR1B 1XNQJ 5KPTA 1F5BA 3EGNA 1NK9A 4KGVB 5CCLA 4CGHA 5AQFA 3DLKB 5L46A 1UJ4A 1ZZNA 2BOAA 2MEWA 3HK2A 1Q79A 4CF0A 2ZC4A 3IUCA 3I55N 3ENOA 2J4RA 1QAIA 3QBCA 5M1QA 2AZ1A 4C8YA 3KHLA 1FESA 4FOEA 2E1AA 3VEZA 4JN4A 3AA8A 3CPWR 4A8KA 1YZ6A 4ATNA 3AVJA 4UOGA 3ISZA 1VIXA 2YX1A 3IMQJ 2YKAA 5CY4A 5IXUA 4K5SA 5CD4H 4AHTA 4H0YB 1BQNA 2Q2RA 4FPAA 1OO0B 4M63C 4M5DA 4CLPA 4DUTA 5KT6A 4DL5A 2CZ9A 1MWQA 1H2UX 3UD3P 1J2VA 4BGBA 4WTYA 5HQ8A 3Q2TC 4HI2A 5CYJA 3FZKA 4B3RK 1Q5VA 2YJFA 3AVKA 1HNWF 4LH4A 2WTUA 4DSLA 5IV3A 3GB0A 3T69A 3ZEUA 1QDUB 5T14A 4DV0K 4O23A 2I5JA 3I96A 2A6OA 1KHWA 1RCXB 1GLJO 2BH1A 2RS2A 4DR5F 3WQUA 1NB2A 2QLWA 2VPWB 4O3SA 4ICLB 2KXFA 1WACA 3VQSA 3ZT2A 1KLMA 1WWHA 4LF5J 2QKKA 3LF0A 1RTHB 3R6MA 1SC4B 5EGYA 3VEOA 4JEPA 1VK3A 2HPUA 5T7BA 1WKLA 3OYEA 3TAGA 1HBUA 4FKYA 5DG8A 2QX0A 3R7BB 1FERA 2ZHOA 3KWMA 2DK2A 5I3QA 4X4UA 5GAHP 5AFUA 4CEEA 2XI3A 4JKAA 2D0AA 2R2SA 3SSRA 3RBDA 1FEHA 3OR2A 3ZSXA 1Q7YT 1JLFA 4M1KA 3GFXA 3Q89A 3IBCB 2HBKA 3DXSX 5I42A 1CJVB 2VA3A 2F4VF 1SC6A 3M8QB 4CH7A 1TKZA 2I9SA 4LBIA 4NASA 4J37A 2ZEJA 2LEAA 1S0VA 2CNKB 3HD1A 4PCQA 3C6UA 4IKAA 1S1XA 2CJQA 3SSSA 2M7SA 4CNYA 3O4NA 4K4TA 4LMZA 3FRZA 4CCHA 4B17A 4FPRA 3SV3A 4OHWA 4ZJQA 2P9LA 1RWUA 2AEFA 3C8YA 4P73A 3PVXA 4KHNA 2P6SA 3QRPA 3NCRA 4YHHK 3LH2S 2WSCC 2QWRA 1K9MO 3MUMP 4XH4A 4LIWA 2X1FA 2VQEF 1TGOA 1TV6A 1HWUA 4U95A 3FFIA 1TL4A 4DU3A 1ZAXA 3NOGA 4OI1A 1NWKA 1VAZA 2NRHA 2XO7A 2G0IA 1KC8T 3T5KA 3H45C 4YOUA 3HVTB 1HR0J 4GO7X 2MLXA 2KHOA 2RQKA 1H72C 4MKAA 3NF8A 3M8YA 4PXDA 1H1VA 4KQZA 5FPMA 1T05A 3SUNA 5DM7L 2XCPA 2GUPA 3NVMA 4OKJA 3EKUA 1TTHB 2CQHA 2CNOB 4IO9Q 2KVQE 2EFNA 2RQMA 3AVCA 1TUYA 5HK4A 1WSHA 2WB4A 1YAGA 2GVZA 3THYB 2I7NA 3BJYA 1V3ZA 1S6PA 3DRXA 3KK1A 1Y0HA 1BO5O 4DPWA 1HQEB 4HTUA 2D9OA 3SBGA 3O2IA 5GMDA 1KCFA 1U2CA 3W62A 3LPUA 1P6TA 4OZ5A 1Z6RA 1OIAA 4DSFA 1E6VB 3V1QA 5K5MA 1W7AA 1FT8A 2PSZA 2EXUA 1VRTA 1A6LA 2XMTA 1BCMA 5B0GA 4KAZA 2KHCA 2YI1A 1SJRA 2DY9A 3CJ7A 2LU1A 4URSA 1MROA 4BRQA 4CGJA 1TFYA 2IGIA 1ZAVA 1PBAA 2VD3A 1RTZA 1SKSA 3AVHA 4YOWA 3WNGA 2QMWA 3Q2SC 3EE8A 4M3ZA 1CEZA 5IS2A 3CM5A 4M5IA 5KG1A 3NF7A 1N34J 4TYBA 1VQPS 2BV3A 4DV2J 3LL3A 4H5WA 4KHQA 4NA1A 4P72A 5A8KA 3JTOA 3KHHA 4USUA 2PFFB 1NU4A 1T9YA 1ILYA 4DR7K 4M42A 3IGVA 1JXBA 2F4VJ 3F9MA 3OYBA 4AM7A 4YR2A 4DQRA 3OVNA 4IO1A 3SV4A 4I1TA 4KHRA 3CSKA 1YJ7A 1F9EB 4YHHF 3UVJB 4JUZA 3V5RA 5JMVA 4DX7A 2DPNA 2CDRB 4DL0C 2P9NA 1DBDA 4FO0A 3IA0A 2QLFB 3GV5B 3M6VA 2BR0A 5KOWA 3EN9A 4J9KA 3K9JA 2QL5B 3KG4A 5F0WA 5KFFA 3FCVA 1FJGK 5AZJA 2FC0A 3SQOP 3QMLA 2LA6A 4Z4GA 4I6AA 2Y0SD 3BM7A 3E9PA 1J5EJ 2HQIA 3Q23A 5IT9U 1OH5A 3VETA 4ZVRB 4RW9A 3K9KA 5DJBA 1J27A 1UAWA 4U9RA 4MIWA 4DTJA 2EFVA 4EU0A 1EQMA 5HRSA 1PG5B 3MR3A 3QETA 3B8AX 2KYZA 1HRHA 1S1TB 4X62F 3MCMA 2E1PA 3NAEA 3JSYA 1WHWA 4RWTA 4ICLA 4UOFA 3DHWC 4CLYA 1HBOA 1VHFA 4LD0A 4BVOA 5J1PA 3M8RA 2MDAA 1WI8A 1Y00A 5LSRA 4ECUA 3AH6A 4DUZF 2RHSB 3SYZA 4V19X 4PXEA 2M2BA 4NMLA 3V9UA 3TVYA 2DRDA 1YJWS 2RUGA 2DGOA 2R7QA 5E7OB 4XPEA 1FTRA 2HG4A 5CXTA 3B4DA 4BR0A 3O1LA 2FLOA 4I6YA 3QATA 1UP1A 4QIWD 2COLA 5KG4A 1ZH5A 5IM0A 2Y1RI 3N9UC 4C6AA 2R9LA 3O9RA 4JI3K 2X6NA 1ZTTA 2ZH6A 1TMMA 4FWRA 2VG6A 1NHVA 3CDBA 4WIQA 5DZ7A 2A3ZA 3BUZB 2KG1A 4CECA 1W9HA 3NE6A 3HO1A 4CEZA 2QFJA 3PW5A 5L1KA 1X4BA 4YY3K 4B1UB 3PYDA 2RAQA 5C15A 4IYQA 1U1KA 2BJ3A 4F7VA 3N4PA 4JKGB 4CJSA 4OYIA 4C0HA 5EOYA 2WAQD 1S49A 1WAJA 2ZITA 1L5UA 1GFWB 1C4AA 4BRLA 2GO9A 3RRHA 5KFNA 2KO1A 4DR3J 4DV1J 4FXWA 4NLYA 4KH0B 4PKHA 4G1PA 3VEWA 2MMYA 4ID8A 2EC0A 1RA6A 5L9NA 2VQEK 3JSRA 5DQHA 2E5JA 4E7JA 4DEZA 2C3OA 4FZYA 4EBCA 3I9ZA 2DO0A 3ZZPA 2HHXA 2FLPA 3Q24A 5F41A 5H9EJ 3GV7B 2XSJA 2V34A 3HP9A 2GGPB 2JEFA 4FP9A 4BDZA 1PAEX 2DNLA 5CHIA 3M32B 2BQUA 4FNIA 3G6VA 4F50A 4X62K 2NPFA 1FD8A 1U0HA 1KLNA 3G71N 4R5PB 2CQPA 1C0FA 4FJ5A 2PA8D 4HTJA 4MK7A 4ETZA 2DXDA 2DJWA 5IM0B 2IC3B 1VGYA 3BV8A 3A8YA 2MLYA 4N76A 4U6PA 3TRGA 3KK7A 3WXMB 4W92B 5SZTA 2VUGA 4B1WB 3NH0A 1U24A 1Q8LA 2YHAA 3SLCA 2HQCA 2O1PA 2IVMA 2NZ4A 1LWFA 2F8MA 2ZNZA 4CHPA 2PYJA 3AOBA 1WJ9A 1NGAA 4ZPAA 2E5HA 3GJSB 5BJRA 1UZDA 4M3UA 3OXGA 1SKWA 4X64J 2LU2A 5IZHA 2FHJA 4PL7A 1JLAB 4JD2A 4DV5K 4DR7F 2XSFA 5LJ3Y 1KWMA 2C1EB 7FDRA 2DXFA 3IR6B 1WOSA 4DPXA 1Q7LB 3C15B 3MAQA 1HLWA 3UIQA 4YFUA 1BC6A 2XWYA 1E4FT 3EX7B 2HVHA 2CA9A 2LCWA 3KWGA 4KV8B 3V81B 4B3OA 2E6MA 4JI0K 5HBMB 4OI3A 3ZETA 1RTDB 2NPIA 1LV5A 3PG9A 3R5DA 2YHBA 2OZMA 3N4QA 2N7CA 3GYXB 3GV8B 1S7HA 3HT3A 3UFCX 1EHWA 3HSDA 3LW5C 2XLIA 3FBBA 1XNQK 1MNEA 2OAUA 3IG1B 5J2MA 3DXKA 1N52B 4I67A 2DGUA 3DLKA 4P71A 1BI4B 3RMAA 4DFMA 4OX7A 1N36J 3E51A 1NGCA 4JLHA 4IG0B 1HNIB 1AFIA 2KKZA 3PR4A 2Q36A 3IM8A 1DGKN 1ZS6A 4M8LA 2XMMA 2DRAA 4R0JA 4DTRA 4Y1DA 3OTBA 2VG7B 2BRKA 4Z7CA 2M5YA 2VQFJ 3VAIA 1T9UA 3HT0A 2A2CA 3BO2A 4TU8A 1YJ9N 4P6QA 4EBDA 4ZN3A 3G86A 2Z2MA 5KG0A 2FGOA 5D0HA 1IV0A 4F4XA 3U9ZA 2FVPA 3OA9A 4KR0B 3AJ2A 1WSIA 4NOHA 4CH0S 2VPXB 1QVGR 2AX0A 2OLWA 4PG8A 5KFEA 3CCUN 1KS2A 4JI8J 2CYYA 2MZ1A 3SI8A 5CZVA 1BCOA 2E1ZA 3W8PA 1X9JA 2MSSA 4C1NI 3V6DB 4KTZA 2ZOGA 4LBHA 4LF1A 2P2CB 3CJBA 4BR5A 3K58A 4NXMK 3VGLA 4IDHA 4EZ9A 3IWNC 4FYWB 1UVIA 1O5JA 4LRBA 4P52A 5IT9Y 3Q7BA 3LDNA 5AQZA 4LSZB 1CVJA 3V6JA 3AV9A 4JI1J 5C2CA 3MEEB 1RT5A 4K8RA 2WONA 4FW2A 3L09A 3SSQA 1W25A 4WFYA 5L8RC 3BEGB 5HVGA 2B5JB 4H0PA 7FD1A 1VJQA 4DV4J 3FZHA 2ZKUA 3QFUA 1U0SA 3LUYA 2DNMA 1Y3JA 1ZETA 5C42A 3E3XA 4F9OA 5HJYA 3SQGB 1IBKK 2HWHA 2HMIA 2DO4A 4U67Q 2YV0X 4UOCA 1YK9A 3CIMA 4QR1A 5AT1B 1R7IA 3HKZD 3I5BA 2ZE2A 2QO3A 2VBYA 2CJKA 2YWFA 1QS4A 1MU2A 4U67L 3CULA 2V8PA 4PRFA 1SJFA 3QEXA 3DLGB 3L9ZA 2A42A 3R7SB 3T9NA 1WSJA 4R0EA 5T7LB 2BE9B 2OMOA 3U6FA 2GBZA 2ZUAA 2JFDA 3TI0A 1IKVB 1RBAA 5KQDA 2KM8C 5J2NB 3FC9A 3R9LA 1T3NA 3V9SA 3RWUA 3CHWA 3HPHA 3AO1A 3H25A 5BR8J 2DVIA 4AILC 2AJ4A 4DR5K 3IS9A 1CULA 3LP1A 4LSLA 1HNXJ 4JOUA 2OTJS 4NLSA 3J7YP 2HS3A 1FKOB 3G6XA 3KLIA 5JJBA 3DLBA 3TJ8A 3R3LA 2GGPA 4DV0F 2KU7A 3IRXB 4U7UK 1HI1A 1X5SA 1RNHA 2GVDB 1C1CA 2VFRA 3EJMA 2W9BB 4R5PA 4DV7F 5ETVA 1IBKJ 2ABYA 4IRKA 2CQ4A 3ISND 1MA9B 5F0XA 2HWIA 3B4MA 2SXLA 3MCNA 2RQ4A 4DQQA 3GJRB 1U04A 3MFIA 4O3QA 2B3TB 1S0OA 1C0GA 4CM0A 2MQNA 2C2NA 1T03A 2H5IB 3LDQA 2C28A 4KGMA 3ATUA 2O8CB 1BQNB 3LPEA 4XK8C 4DV5F 4HTIA 1QUPA 5EWGA 2GTDA 2BQ3A 4ZCLA 2HYIB 4F26A 4DXLA 5EXWA 4FW1A 1HR0K 4EGLA 4NYZA 2C3MA 5IT9O 1BG3A 3KLGA 2AD9A 1VS3A 4CJEA 1P90A 3QYYA 5LL6Z 2LFVA 3THYA 2YKMB 2PI4A 3T7ZA 2IM3A 3NBPA 2R7WA 1TP7A 2FF3B 5AQQA 4I7FA 1QVFR 4EHTA 1FCAA 5C5JA 4YQWA 1KAZA 1XR5A 1T9XA 2B6AB 2O8DA 5DRKA 1WHXA 1HW8A 1U7LA 2E5IA 2HZAA 4W98A 5ETKA 3OHAA 3L3UA 3WNHA 4DCJB 5JVHQ 4CZIA 1Q16B 4K8ZA 4B3SF 1H6KX 2PYLA 2I1RA 1QSLA 5AE1A 5KFUA 1NZ8A 3MUVP 2RE2A 4WYWA 4WBFA 4B3TF 4RLEA 5JLFA 2OIHA 1N6QB 3H59A 2XB2D 4K43A 4B1ZA 2YCHA 2PMHA 1RT7A 3W2WB 2BJ1A 2H3EB 3JQKA 1RHJB 2QWLA 2MJUA 1A7GE 3U8XA 1NBWA 1W2BM 1S48A 2HBJA 4RPFA 5J2QA 4CM2A 3AVAA 4M5NA 4RWWA 4AYBD 3AO3A 2OFGX 2D3ZA 5F8NA 2CQ0A 3OL6A 2ADCA 5ETPA 3CCVS 3ZSWA 4YOVA 4DV6F 2XCAA 2OGUA 4CF9A 3TX0A 2OELA 2V94A 3NH2A 2NSCA 3PX6A 3RW6A 5C24A 1EX4A 3MK6A 4E19A 3C2PA 1S72N 4AHCA 4JBCA 1HI8A 2BQRA 4CLSA 4OHVA 1RBOB 2IFXA 4LQ3A 2EFGA 1Q4RA 2R3VA 1NDKA 4CLKA 5GAGP 1RT4B 3GU0A 1KR4A 1OSDA 1T95A 2J9DE 1N8RT 4DTUA 3NGKA 2J9EA 3TTCA 1X8DA 1DAXA 4KB7A 4KB1A 1MWMA 2BYCA 5KAKA 1LW2A 3DU6A 2EK1A 4KAIA 3OUYB 1NOZA 4WQ5A 2RU9A 3DOKA 4LR9A 4C3MA 2GX9A 4DMZA 2CZ4A 4RUCA 3OFGA 3CCUS 2CAJA 2JGUA 1CSJA 1XWLA 4M7XA 1IJEB 4C23A 4GKKF 2ZWOA 3HM8A 3L0QA 1RHQB 2V6AA 2R2UA 2AP1A 3GE1A 2Y8WA 1BIUA 4F4AA 3I31A 4CK1A 3MEKA 2RS8A 3QJPA 4KKOB 3WX8A 5IWAF 3RTVA 2QL9B 4H4KC 1SUQB 2ZE2B 3FZFA 1HYSB 2I8EA 2XWXA 1K1SA 3MWTA 3IFRA 3VF0B 5AQKA 3C16A 2BZ2A 1JLFB 1LAWA 5EWFA 4FBUA 4ED1A 1H38A 1SJ1A 5I42B 2AJQA 3P5BP 4LIRA 1EP4B 5DDPC 3N4WA 1E6VA 1SB6A 1WSGA 4W4MA 5IT0A 1FJGF 3HPOA 1RA7A 4TU7A 4QIVA 2MZRA 4CFBA 3EPIA 4XTTA 2M70A 3OYCA 4M5LA 1XN9A 3CJQA 2K3KA 1XC3A 4CESA 2CQCA 1VQLN 2QW9A 2QA1A 3BH7B 1VSIA 3I5AA 2J0SD 4F25A 2D0CA 3O4QA 4DCOB 2IVOA 3WXKA 1CQNA 2R7XA 1P27B 4AHRA 3ZZTA 2KQ2A 5E3AA 2B4PA 3P49B 2A18A 2OSRA 3FFIB 1YJTA 3TYTA 3WNFA 4ED8A 2B8QA 2ASDA 1KOHA 3D9BA 2DEJA 2CJ9A 4DU4A 2DIVA 4NYFA 4CJQA 5EHHA 5F1XA 2ZDPA 4C98A 3VQBA 3RB3A 1U2VA 5ETQA 2OEJA 2OUGA 4KRWA 5KT4A 2FVSA 1TKXB 5FRNA 3SIPB 3PCOB 4ZLNA 4CZMA 3TQ1A 1U0HB 3UNYA 3BN7A 2E2PA 4YB6A 3F2KA 4Z94A 2LKZA 4QWCA 1HHSA 5EWEA 5LMNJ 4HUGA 1Z25A 2BMBA 3KOAA 3N6LA 1YTUA 3H7HB 5KT2A 3VQ4A 4E3SA 2HNDA 4R25A 2EK6A 3RG6A 2E8AA 4A5AA 3MEDB 1I3OB 3UDCA 4ED5A 4BC3A 3CCSS 1NK5A 3J81O 4CIGA 1HNVB 5AQYA 3F73A 1XEZA 4CLLA 2VBXA 4CEQA 3QMQA 1SH2A 3TAMA 3JAMY 2XG8A 4JI2F 3DOKB 1NJXA 1BD6A 4CT9A 2VBWA 3D28A 4F02A 4LF4F 3ZTOA 3LDLA 2ZVIA 3JQMA 3PRDA 1CJUB 3TA2A 2WK4A 4OPHA 1Q7YO 4CHZA 3LP0A 2WVBA 4U7CA 1U1PA 4RW7A 2ZJQL 2E1MC 3ZSVA 4I6WA 1U1RA 1ZBSA 2V8GA 1HYSA 4K0KJ 1KVKA 1N5QA 2YNHA 1NJIT 4ECZA 4LF9J 2BKNA 4EO6A 4KTWA 1K73T 5HL7Q 4K7QA 4RU2A 5ETRA 1FX2A 2XM3A 3J81Y 3M8QA 3BREA 2EVZA 3LOUA 2QXLA 5A2QO 1CG2A 4ZLPA 2CJYB 3VOVA 5C24B 3OXFA 4RG8A 3B6BA 4I56A 1GMWA 4QOZB 2K06A 4XEIA 2MQ8A 5B0AA 3M1VA 4OYBA 2VONA 3ZO7A 3HJVA 1SJ4P 1CJTA 3VVTA 1FX4A 1OMSA 3CE8A 3AY0A 3DJCA 4KTQA 3MGJA 2FVRA 2VDHA 1VCTA 1FWLA 2ALZA 3M2RA 4WZMA 4OYWA 5K8PA 4X2BA 3HCXA 2FJVA 1JJ2R 3AJDA 4F3OA 4E8UA 2X6SA 2VIHA 2HRYA 1U45A 4GKKK 2JC1A 4FJJA 2FHKA 4ECXA 2FDNA 1N54B 4J9OA 3B6OA 5KFZA 2C3UA 1JXLA 1L3TA 3VQTA 1UAXA 1NG9A 3VVUA 2QT7A 1URNA 3M2VA 4B9SA 3DXBA 3NY0A 2F7VA 1KEKA 3NL0A 2KLAA 1OPIA 5E33A 4JI6K 3NEKA 4C0OC 2Z56B 5J1NA 1OKJA 1S1WB 1XMOF 3FFKB 5FJ4A 1MWKA 3DWLA 2FSNA 1SUQA 1ATNA 1ATSA 2YHYA 2DNPA 4OZ3A 3UW1A 2YWGA 4CTAA 2CKWA 4QPTA 3M6GA 3BB5A 1EO1A 1R6YA 3DMJB 1QD1A 4A48A 2RDDA 4NX9A 3RUBL 4WTOB 2W7AA 4GVMA 4JI8F 1B64A 4LF4K 4MIBA 4IBNA 3AD7C 1FTCA 3RU0A 4Y2CA 3ENQA 1WNSA 3H2UB 3TSUA 3GFHA 3GYNA 5MLCQ 2AP6A 2HBQB 2HSTA 1IQZA 1GT8A 3KDOA 3CC7S 2A1SA 1WEXA 1TQLA 4K0KF 4LFCK 4LRFA 4A57A 1JJHA 4WCEL 1WEZA 4WP9A 4E98A 4NXMF 5D0RA 3DOMA 4WFNL 5D4OA 1VSKA 4MO4A 4RW4A 4C8NA 1CS4A 2DR9A 3CCWA 4CO0A 2XYHB 3PR5B 2ZM6F 1XNRJ 3Q8VA 3W3DA 1NPPA 3Q8RB 8AT1B 3C46A 5G0RA 3VQ7A 3K8VA 5CYMA 3OYIA 3KLIB 1C0TB 3BGUA 2MQMA 2VJVA 3EM1A 2HHSA 4RNFA 1JLBA 1LWXA 2V4JA 1UPMB 1HNXK 1RABB 2ZNYA 1Z2ZA 4LF6K 3QGGA 1IKXA 5AFUH 3R97A 4L73A 1JLEA 5B0CA 1L3SA 4W5RA 4FYDA 2HFSA 2XO6A 1U1LA 2LXUA 3AVIA 3R3TA 1Y97A 4ED4A 3NGRA 3EVMA 5DS7A 2I2YA 1S1VB 3CG7A 1NEEA 1FRIA 2JDJA 2KZZA 1N0UA 2HHWA 2MGZB 2QWNA 3FZ2A 4FJLA 4DCHA 2YX4A 5KFRA 3L3VA 3R6LB 2UP1A 2Y1LB 2O8CA 1RWOB 2D0BA 2LQBA 3MCAB 1E3MA 3GPAA 5FDLB 3S41A 2WRMA 2QWPA 2MXYA 2ZH7A 3NFAA 3GSDA 5AQLA 4DU7A 4F36A 1HLUA 3U1MA 1KRPA 2BEFA 3WHIA 4DPTA 3D6HB 2DNKA 1EX8A 4ECSA 1YDLA 3MM8B 1RDBA 3EXYA 3MFHA 3WDOA 2V9WA 5HMXA 5KFOA 1KVBA 3IGNA 5JS2A 1RWWB 2YKMA 1CZBA 1EARA 1S6QB 4WFNQ 2ZUGA 5C7PA 3MM6B 2VU5A 3OYNA 1X4HA 3VZHA 1AUDA 3CJKB 2BVZA 2NCKL 3ZETB 1IR1A 1SI9A 3E9OA 5K14B 5HROB 3HHDA 1QHTA 4ZVFA 4CEOA 1BQMB 4WJBA 1RCHA 1IWAA 4DV2F 3MPYA 3J80Y 2H48B 4CH1A 1QQOA 4DTXA 4YOYA 3I4PA 3SDEB 5SWMA 1A9NB 4U8YA 3US5A 3PIOQ 4C1NK 5KG2A 1RGIA 5KTQA 3Q86A 2NRVA 2U1AA 1ZBLA 1OVQA 2YKOA 3DLRA 5CAAA 5CD4A 3J81U 2W4CA 1F9FA 3W2VB 5AQPA 4Y6IA 4DDFA 2BX6A 3VR1A 3I5CA 2GEMA 4I9LA 1AZSA 4CHYA 4AQYF 3SQ2A 2QN6B 2Q1NA 5C10A 4GY2B 1W0HA 3AA4A 4LC9B 4UUWA 2DTUA 1RLDA 5KGXA 4PWDA 3BSOA 4CI6A 4TQSA 2RHKA 1IG8A 3K5MA 2BE2B 1HW9A 1C0MA 3DN9A 1NDLA 4NZ0A 5EX0A 3W9JA 1B9DA 3RBZA 4IEIA 3CI5A 1S12A 3NG8A 2RD5C 3U02A 3V1RA 3DKDA 3EY1A 3UI3A 3WIVA 4KH5A 4DR1K 3PEJA 5LJVA 2IIHA 4MAKA 1B0PA 2ATLA 4YOEA 5BN9A 3NWGA 1GXTA 1M5KC 3HZGA 3VHQA 2UUTA 1XMOK 2ATCB 1S1XB 1TL5A 1YF5L 1FRHA 3IRXA 2IJNA 4G1QB 3UDLA 1CJKA 2GVDA 4NZ6A 5EN1A 5B0EA 5HJXA 2LVWA 2XS5A 3EO3A 2Q31A 2R7YA 4FJXA 3KJVA 1KKHA 3OHRA 1RBSA 4OIXA 2FJAB 3MM5A 4O3NA 2F8TA 4F8RA 4PEOA 1RT5B 4WF9Q 3GG4A 5KG3A 1S1VA 4FF3A 2YKNA 2DPJA 3ZNUA 3TSQA 3GL1A 5KFWA 1QTMA 3EMTA 3PDNA 1XHXA 4JNEA 3M2UA 4KBIA 4XO0A 2V68A 1GQEA 1HPZA 4HYKA 2YHXA 3QJJA 1LFPA 3BGRB 4Z4CA 3C94A 2HNZA 2Y1JA 5B8HA 1UJ5A 2KXHA 1X0FA 2EG1A 1I94J 3SAFA 4DL4A 2OTLS 2YTCA 4HACB 4F2RA 3KIOA 3MM9A 4MO5A 4HDHA 4KC5A 3EXCX 3Q8YA 1M1HA 4CJKA 2BKPA 3TEGA 3I82A 3HKWA 2VHGA 3OSNA 4OX6A 4PPZA 2D41A 4C8MA 3MAHA 3OY9A 3X1LB 4J2BA 5LL6d 3Q7CA 1VQSA 4U8VA 3H0PA 3M05A 2JWLA 4CHQA 4C3KA 2IYGA 3H1VX 2R8JA 3HXMA 1U1NA 3ENAA 3KG1A 5F9NA 3JTPA 1FJ7A 3S3OA 4I69A 3CQ8A 5G0RB 5H9EK 3W61A 4AM6A 2M0GB 4JRQA 2ZVSA 4ERDA 3QGIA 3T1HJ 2RIJA 2N3OA 2MKYA 3KXDA 3D7SB 2UUCJ 4ELTA 1RISA 4H0TB 3H20A 1B3TA 2DNGA 1HNIA 4UT4A 5IQQA 4YDUC 1JWWA 2W40A 3CVKA 4O55A 4CF1A 1MN9A 3L2RA 3P8BB 3VA0A 3EWGA 4FLVA 1KP6A 4LRCA 4F3MA 3MCPA 3MWBA 2OD6A 3FJ2A 2YKNB 2XMAA 5JMNA 3D2EB 3HSGA 3DRSA 3U3YA 4KJIA 4R8UB 1IQTA 3RR8A 2MZQA 1R8AA 1D0EA 1NKCA 3NNCA 3MM7A 1U2VB 5IWAK 2Q43A 4L74A 2IIRA 1WC0A 3FZBA 3Q8UA 1D9FA 4JYAK 3M1FA 3T3FA 2IYIA 3V6DA 3BGOP 3PRBA 1CJKB 5FIIA 3TEHB 3F44A 5LXYA 1MWYA 1AYEA 3AT1B 4HWIA 4RW9B 4QIEA 2X3DA 4MFBB 4JKHA 2HFUA 4DQSA 3MEEA 3BP8A 4ZTJA 4FDFA 2XZWA 2D3UA 4NYPA 3TP2A 3DFEA 3I4HX 2VG5B 2IS3A 2F1FA 2MB0B 4JV5K 3WEEB 2HWTA 1U6BA 4GMJB 2Q6CA 3S6EA 4K2XA 1SQGA 1X31C 3G4SS 2OMLA 4A8MP 3O1BA 1RI7A 4CGFA 2ZH5A 2E9ZA 2BGGA 2JJ4D 4TXSA 4DUYF 3G71S 2EFQA 4WCEQ 2JLFA 3TAEA 1ZA1B 1AXQA 1N32J 1HJRA 5A0YA 1LK5A 4B3RJ 3E1YA 2DGXA 2IOCA 4E1MA 4Z37A 4CZFA 1M5VC 1IR0A 3KJFB 2RUSA 1WD6A 3LGNA 2B4UA 3H3OB 3FSIA 2DITA 2FB0A 3C16B 2FYXA 3DLEA 2VWJA 1Q86O 4WU2A 4QIFA 2P51A 3RBEA 1V5VA 1GXUA 2HVDA 1X4DA 4OZJA 2JZ5A 1NSPA 5AQGA 2AKWB 2C2OB 4IKFA 2UUBJ 3CCZA 1ULRA 1WI6A 2EX3A 1DARA 2L41A 1JCFA 3VPZA 1T11A 1XHZA 3ITHA 4JRPA 5LY3A 3OR1A 2CPZA 3MDFA 1TR0A 3V6HA 1CPZA 5KGWA 3ENBA 1SH0A 2BM1A 3CDEA 4DPUA 2C42A 1Y4ZB 3TUZC 1OJ4A 2EWHA 2CFXA 2QTWA 2YWEA 4FWLA 3ILJA 5KFLA 2R7OA 2ZDOA 3B54A 3OBYA 4RNOA 1UMJA 1Y7PA 4CGDA 3DCAA 1TYQA 2O8BA 3OLBA 4DV4K 1SV5B 4XPCA 3KG0A 1JLGA 2XC9A 1U4BA 1R0BG 1KNZA 2HRTA 4FL9A 1D9AA 2DR8A 1N48A 4WIIA 3R27A 3CD0A 4KHPK 4JS5A 2HIQA 2R7RA 4DG1B 3KFWX 1QSSA 4JI4F 3U4LA 3QFPA 4FJ8A 2ZD1A 1JXEA 3C6AA 3G8TA 5DGBA 5C2FA 5A8RA 1DTQB 2ZHAA 1Q86T 3P5TL 4O3PA 3OL8A 3BR8A 1WC3A 2GQQA 4GMKA 3HRGA 1URRA 3PSFA 4GRSA 5AQXA 1Q82O 3QT5A 3GR1A 1VMBA 3VQEA 3LPTA 3ZEUB 4NLWA 3NGSA 3OYLA 3CD7A 3KUEA 1ICEB 3MPUB 1LKZA 4G3IA 3JQJA 1UFLA 3SCKE 4MH8A 4B8CA 1SKUB 2GUIA 2KI2A 4P74A 4OI6A 3TAMB 4USJC 5K20B 2HNYB 3G9CA 4PG6A 1VQPN 2JRSA 4DTMA 1VQKN 5FLXU 1D4XA 1CJUA 4N56A 3VGVA 4ZLJA 3QT7A 3CQXA 1N5SA 2F7TA 1G3OA 1FW6A 1DTTA 1FDBA 2HQ3A 4QR2A 3BZKA 1REGX 4O44B 2ZHBA 1TL1B 2UVRA 3PYFA 1RU2A 4ZPBA 3KD5E 4DX6A 2YQ3A 3HFKA 1CQMA 4O5BA 5KFXA 1J5OB 1OPZA 4P2SA 4XDCA 3QNOA 3T1AA 4M5JA 2M3DA 3PHEA 4EAHD 4HHUA 3KUGA 3R5JB 1H0HB 3A8EA 1N33K 5HRRA 3JS9A 2W2OP 3RB4A 5A2QU 5KFGA 2P5VA 5D4PA 4ILRA 3KK3A 3Q8QB 3M8SA 1GLDG 3MX2A 1IKXB 4H0OA 1RFQA 4Q5VA 3GIMA 1K8AO 3GILA 1OY8A 1T3OA 2DCLA 3T1HF 4ECRA 2CJXB 4IR1A 4FJ9A 1LCUA 1MLAA 2V8VA 3EPGA 5LT5A 3D6FB 3QAEA 3CQYA 1M5PC 3ULEA 4K0KK 4O4GA 2K1RA 1GOAA 1RAHB 4O4RA 4GV6A 3L2QA 2YNIA 3M9NB 3MEDA 1RT4A 3IC1A 4M3XA 3LALA 4ZP6A 2AGQA 1U2RA 2JOQA 3NS7B 5GADP 3QEPA 3AAWB 4OYMA 1YRXA 2XHBA 1TVRA 3BKUA 3HFZB 4KBOA 4FLUA 4NB4A 4WKYA 4FJHA 1SV5A 5HRNA 2BANA 4OX9K 1O0PA 3CJ2A 1HFEL 5TKYA 2XRIA 1WORA 3DNCA 2ZBCA 3R9PA 1HWJA 1KC8O 3O9TA 5KFTA 2FLNA 1PC5A 4DV1F 5DO2A 2YNGB 5KFDA 1O8BA 1Y3KA 2GC8A 3OTOJ 4W5NA 4ZHRB 4B9UA 3IBFB 2F65A 1R43A 2DCUB 2ALYB 4NEZA 2HQDA 1TFWA 1U6ZA 4ID1A 3SK3A 3CTRA 2V9KA 3PHTA 1RWNB 4KKOA 1DFDA 2GWJA 2IC3A 1AB8A 2OEKA 1RT3B 5F3TA 2AJ0A 4CHNA 3S3MA 3R8EA 5K14A 1BQXA 4C11B 1DQ8A 4BHQA 3PW4A 4FK0A 5K8NA 1D8YA 2QA2A 1YUWA 4M3YA 2V4RA 1GOCA 4M95A 3SEOA 3HI9A 3UQSA 4H8KA 3DMJA 2W2NP 3G96A 2QK9A 4CZCA 2QIFA 1M90O 1RWMB 3P1GA 2X1GA 4IH5A 1WG4A 1DEJA 2J0XA 1HJOA 3LDOA 3QT8A 4RNNA 5H1SQ 2Z57B 4FXVA 4PXBA 1S5ZA 1H74A 4CK2A 3BS9A 1S9EB 3JB9k 4KE5A 2V52B 2RE1A 3CCMN 3HDSA 1IO2A 4JD2B 1YGYA 4ZJOA 4TLQA 4DV0J 1R3NA 4BQZA 5FLXO 5GADU 3OL7A 4F3TA 2N4DA 1YITN 3MMAA 4YMEA 1WSFA 4DR1J 2MJNA 3FUYA 3DI6A 3MOJB 2DNRA 3CMAN 2QJ3A 4HCCA 1HHQA 3MR6A 3T9ZA 2DNNA 4V1Ak 4W5TA 4AD6A 4MIAA 1XIQA 1RAGB 3PJWA 5AQTA 1JB0C 1Y9OA 4WXWA 3D1QA 3LWLA 2KM8B 3LGMA 3MPWA 2DGTA 3M30B 1ZXOA 2KRBA 3PKYA 4E0DA 2WCXA 2FY8A 1X5OA 4UTGA 3DRPA 2CGKA 4X65K 1RTJB 1XMOJ 4H03B 1MMDA 4B1VA 1C1CB 1TKXA 2ACMA 3HHNB 1DTQA 3VALA 1RDAA 5G4DA 1VQNS 5BRDA 4RR5A 4HTLA 1HQUA 3CFRA 1B0VA 3Q22A 3SNNA 2DXEA 3HYFA 1XMQJ 3ET6A 4LSNA 2ITGA 2CPYA 1N5VA 1UETA 1ZPWX 2HK3A 3OFHA 4DLGA 4OGEA 1ASUA 1Q53A 2M52A 4A8WA 3V4IA 3TVKA 2AMCB 1RAAB 3OW2R 2PEBA 3PJ9A 2GIRA 4AH9A 2DGSA 4Z4HA 3VAFA 2WBNA 1PO6A 3W3SA 3PX0A 3GG1A 3PW7A 5FLXY 1NMDA 3N5BA 1HX1A 2P9PA 3TVZA 3GCWP 3NGYA 3M9MB 4OHYA 1B70B 2DFEA 2XI2A 3EGZA 1X5PA 1HBMB 4BR2A 4A4JA 5CZXA 4BRAA 1VDHA 3KKFA 4CZEA 4IQXA 4JAXA 3NF6A 1TL1A 3NOCA 1P9YA 2MQPA 2KW4A 2H9ZA 5C12A 2K3IA 4A8OA 2OFHX 2O8DB 1K8KB 4ALZA 5HROA 1K73O 4WK1A 2V7YA 2BTFA 4FCYA 1BWEA 1BOTO 3AVFA 2VB6A 2E4LA 1F9HA 3T1HK 3SUQA 3MAAB 1U1OA 1SIZA 2BOPA 4ISEA 4ZDNA 4CP5A 4UZCA 2AYGA 2VFSA 1BISA 1RBTA 1TAQA 5AXLA 4BDPA 2FJXA 4X4NA 4K4VA 3QDKA 5KFSA 3OYDA 1Y5IB 4M5GA 3HVRA 1HIYA 2J0QD 3UKUB 1AZSB 4L76A 4ZJLA 1WNEA 1F5CA 2QFIA 3CXCM 4LFBK 4YB5A 1N36F 3ZNJ1 2W9AA 1N6QA 5LSLA 2HHUA 5EX3A 1NJWA 1ZZFA 4X4PA 4OX9F 4PZVA 1NGHA 4NCGB 2Z1JA 3RMCA 4H4MA 4RL1A 2CWKA 4B3MJ 3PKMA 2VPYB 3NCPA 3T6BA 2V2ZA 4USMA 1TUVA 4URQU 2VA2A 1VQON 2EFOA 5DDRC 1PCAA 4X65F 1WDDA 1S3XA 1R8BA 5GMKa 1S99A 3WQTA 5GAEU 3CIZA 3HHLB 4B3TJ 2XZDB 3TWZA 4Y00A 1VQLS 4NL5A 2XSJB 4CJUA 2NXJA 2MKHA 3M6WA 2CPXA 2HKEA 4C4WA 4NPOA 1FVSA 4OHZA 2HBRB 3HHKA 2XY5A 3SMPA 1O13A 4X4TA 3GMGA 3ILLA 1YZ7A 2E5LF 1YVNA 1RBRA 3AO2A 3TW0A 4MFBA 5M1KA 3GOIA 3H46O 3FRYA 3RRKA 1GLFO 3NVKA 2BDPA 1HL6A 5L39A 5DQIA 3CJ5A 5LOQA 2PBDA 4H4OB 5B09A 1JXVA 2AV5A 4Z4FA 1TK5A 3MXJA 3QQCD 4QBUA 3CO0P 1IKYA 3IFEA 4WPAA 3K57A 3DLLL 2IBKA 4IH7A 2ZOMA 2JLEA 2OZSA 4JI8K 4MKBA 2VGNA 3PO5A 1MWZA 2YH0A 3C6TB 5C2GA 3K8WA 3C65A 2ZGZA 3IM9A 4JYAF 1L3VA 2ZQBA 2X78A 2CADA 4EO8A 2XS2A 1Z2LA 5EUHA 2J7UA 4CJTA 4K50A 5K8MA 1X4AA 4ZIWA 1YTAA 3AVLA 4CJ7A 4DF8A 3J7YI 4IOCQ 2Z2YB 1RK8A 1BA0A 2MQLA 3ENWA 2O3DA 3QRRA 4H5RA 4KV8A 1CS4B 4YNQA 2Q0UA 1Q81T 1NLKL 2B6AA 4DPYA 3NMRA 2G4BA 3DHXA 2UUWA 1W2BR 1TMJA 1YHQN 1FDNA 1PJ6A 4HL9A 2HVIA 1S9FA 4ELVA 2BM0A 2FY1A 1XI1A 2XBPA 2Y9HA 1Q82T 4Q8EA 2VPZB 3E8OA 1X5TA 2VKZG 2RSQA 2CH6A 2VOPA 3R7NB 1JLBB 4X4VA 3ZLJA 2AQ4A 2IBOA 2VCPA 4JI7K 3FCWA 3MXMA 3ZT3A 4B3MF 2Z2LA 4K42A 2PY5A 4AL7A 4CJRA 2C2EA 4PKIA 2O67A 3ETMA 1UWBA 1OY6A 3THXA 3BO4A 1P1TA 4ZVTB 2WONB 3SXLA 2CPDA 4HVJA 1X9WA 1JJCB 1E6YB 1UTAA 2QMXA 1VSDA 3MURP 1KBRA 1Q18A 2P9UB 3TX8A 2GHPA 1IKWA 2W24A 3A5NC 2UUCF 4PR6A 4Q7AA 2HIYA 3I0SA 4I64A 3VAMA 3VTIA 4W5OA 5KG5A 4ED6A 5AQJA 5DK5A 5DM7Q 1U2FA 3OYKA 4Q43A 2OHDA 4LH5A 1FFSB 4KHPJ 2ZZNA 3DLHA 4TLRA 2XY8A 2OPQB 2VFUA 5LJWA 4NO7A 4ZOSA 2OP5A 1VQKS 3K89A 1RE1B 2HBMA 4GNIA 4DUZJ 1YX2A 1HQEA 2E7WA 1NHUA 4BROA 2HNDB 4CEBA 2UXDJ 1AA1B 4BCAA 4ZVHA 1VBZA 4OKKA 4W5QA 3H6EA 3K2YA 4MMOA 4NRUA 1U49A 3GIKA 5F2RA 2RRBA 3C3LA 1FKOA 4CERA 2V4QA 3AA9A 2ZWHA 1NDCA 1QHAA 1QM9A 4KGKA 4WFXA 4CI0B 4CZJA 4DN9A 2N82B 4C8KA 3M5RA 3PM9A 4BQLA 3CJTA 3R1XA 3EE9A 5DG7A 5B0FA 1UOCA 2Z1IA 1B99A 3T6JA 4BRPA 3V9XA 2CIMA 3PXGa 4J2DA 5D15A 2QV6A 1S6PB 4Z2XA 1RYRA 1G1XA 1NHKL 1JJ2M 1U8WA 4DB3A 2E6LA 4CZKA 2W2PP 1NU0A 4KI4A 3VTHA 3VGKA 5LMUK 5EU7A 3RAXA 2N3LA 2P1JA 3RMBA 4NLUA 2W7PA 4DR2J 4G9ZA 4LF8F 4HT7A 1KD1T 1PC4A 3CERA 1I94F 4DS4A 5C25B 3UR0A 3LP1B 2APOA 2BJ7A 4FF1A 3R5AA 4C8OA 3AB4B 2XGQA 2DR6A 1HNWJ 5IV4A 1HNZJ 4BY9C 2W6KA 2W9CB 4C48A 3C14A 4DQPA 4DTSA 4RWXA 2RKIA 1YJNN 3E9LA 1XNRF 3CCMS 2WSFC 2RU3A 1RBVA 1E4GT 4WWSA 4OPAA 2GHVC 4ZVEA 2UUBK 4KH4A 2BUNA 2Z0GA 1FFGB 5GIPA 4JI0J 4OZ1A 2K7JA 1SQKA 1TKTA 4FK2A 1DJ0A 4A8FA 1KLMB 2VL1A 1RTHA 1FKPA 3LO3A 3M2VB 2B9EA 3BGRA 3IWLA 4OFZA 4JI6J 2W6LA 2HAIA 1F21A 1B4SA 1BL3A 1HBUB 4JV0A 3CW2C 4OHXA 3R2CJ 3SMSA 3NMAA 2OPQA 3GIRA 4WP8A 3KNAA 3WT0A 1KTQA 4TN2A 2E2NA 1C2PA 4E2FB 5L1LA 3UCZP 2ZH2A 3RMDA 2P9CA 3PJXA 1FJEB 3KLFA 3NCIA 5J2QB 2HLUA 1FK9B 4TSXA 2NRTA 4QYRA 3SCXA 2VASA 4U96A 3V6KA 2B56A 4OJ1A 4DX5A 1SQFA 2ZH8A 5HRPA 3W9HA 3ITHB 4DV3J 1JLCA 1U1QA 1UKUA 3HJFA 1ZC6A 4X4OA 3BSAA 4L72B 4J9MA 4DV1K 2R7UA 3KHYA 4M5HA 5A2QY 2WZ1A 2DR7A 2X3GA 3TPQA 2X1AA 4M45A 1F1BB 2DYAA 4OYPA 4H0XB 1FKAF 4KPYA 4OKEA 4IG3A 3A4TA 5A76A 1RWKB 3BYPA 1HMVB 2JEGA 4BG8A 2O4GA 1CC8A 3QEIA 3D2EA 1UL3A 4NXNK 2Q3PA 2LEBA 4YB1P 2UUAK 2B9XA 3CDAA 4JK7A 3H40A 4P75A 2KG0A 1OQ3A 3EGWB 3R6GB 3FSXA 1RDUA 4WYLA 3AVGA 2P9NB 1N34F 1YIJS 3AD8C 3CC4S 4LUBA 2UUBF 4KFBA 2YXLA 4DV3K 3LZJA 4KHYA 3I9V9 3IN5A 1XR7A 3OL9A 3WQPA 4XH1A 4JB8B 2AEJA 4FM0A 3KZBA 1SXLA 2ZJQQ 4DFPA 2CZVC 3QO9B 1J6ZA 3QBXA 2WW4A 2C2MB 2C3PA 2FD2A 1RLCL 4JV2A 4FYVB 5A8WB 1NCLA 4FZXC 4AHVA 3KK2A 2QRRA 3ZT4A 1HPMA 4ZP7A 2RH3A 2MGZA 2NYHA 3VQPA 5E2QA 4FWQA 1Q95G 4R79A 1TK8A 3DXMB 3W0LA 1U47A 2G8FA 4GVBA 1M5HA 1TKTB 4Q0BB 3VQ9A 2IVYA 2AGPA 4QW9A 3W5ZA 2DEIA 4DV7J 4I2QA 3QINA 1V3SA 4LFCF 2ZH4A 1RDCA 4C3LA 2YNGA 1NPRA 3PTWA 3NGZA 5KG6A 2CQ3A 1T9VA 3P31A 4E7LA 4K4YA 1ATRA 4LFCJ 4B08A 1NUEA 1Q8BA 4QYZJ 4MTPA 4YDDB 2E9TA 5KFKA 2RILA 2R8GA 1UFKA 4A8QA 2ZKTA 1Y5LB 2A1RA 1WC1A 2IDEA 1HR0F 3PNIA 2VG6B 3AB2B 1VQ9S 2P9IA 4LQ9A 1J53A 1AUSL 3SMZA 3IG1A 5J2MB 1PIEA 3DXKB 1EP4A 4EK2A 3PYEA 5J2PA 4LF7F 2P5GA 2FJWA 4PXCA 3MCOA 5KFYA 4RBVA 2E2QA 4PKGA 1FXDA 2LMIA 4OYOA 1ZPVA 5KT3A 2FZGB 1CBKA 4OZLA 2DH9A 2ASJA 1P8GA 2AW0A 1S0MA 5D3GB 5KG7A 1JLAA 1FEEA 3IO1A 1VBYA 4FVUA 2YBVA 3C14B 2C3YA 4NLCA 2YNIB 1QQMA 2F4FA 1R89A 1EWQA 4EZ6A 5M1FA 2IMWP 3SPZA 3ZZ0A 2Q79A 4NLDA 3FZLA 3QLHB 4PHTX 4PA1A 3AD9C 1S1TA 3QZ7A 1N5YB 1FA0A 3IMXA 3NGIA 1PYOB 4Z0UA 4NI2B 3BR9A 3DRYA 3D6MB 4WU3A 3TJAA 2QSFA 4B3TK 4ZVPB 3GFZA 5F8MA 4DS5A 3MR2A 3M30A 2GQ2A 5CH7B 2NXEA 3B8HA 4F04B 2NXNA 4ETXA 3ETOA 2Z58B 3FMWA 1Q81O 4MYUA 3CPEA 4TVAB 2FVQA 1TUWA 3BPDA 2QEXS 4X4SA 3QAUA 1WG5A 5FROA 1XR6A 2VH7A 3C7NB 3NRBA 1LEOA 4B3RF 4JI1K 3O9UA 1UVJA 3LM9A 1UPPA 3TR5A 1HNVA 3BZQA 1JLQA 3BF1A 1ZYQA 2ZBIA 1TZ0A 4DL7A 4K4SA 4IOBA 2EBGA 3MF5A 2IM2A 2IDLA 1BMQB 5THWA 1QJHA 1LW0B 1ELOA 3SQGA 4YUDA 5BPNA 1WOQA 3C6TA 2P9PB 2H65B 1NSAA 1HNXF 1VRUB 1JCGA 5B0BA 4URGA 2ASMA 2C2ZB 4CYUB 4Z7YA 4PG7A 3ZXWA 5BRFA 5GMEA 3UN5A 1SZ2A 3DRRA 2ILZA 2A2DA 2CDQA 3FEXB 2ASPA 2NNWA 3H3NO 2HGMA 4NRTA 1LXJA 3WC2A 3DI6B 2XZTB 1RTDA 1WSEA 5CA5A 1D3WA 3CCRS 3ALYA 4ED0A 2Q66A 2MHNA 4P2FA 3SQ1A 2VQFF 2NLWA 3OS0A 1G4CA 5E26A 3T1YJ 2H4WB 1ASWA 1VQMS 3HSJA 3FGVA 1VQ8S 4BE0A 3QNWB 1KVAA 2F40A 4NZ7A 2BRLA 4YDUA 2PDAA 2DT9A 4JI7J 1U1MA 3SI6A 5C42B 1MMNA 1NK4A 2A0FB 3DU5A 4BWJA 4PAAA 1T9WA 4EIAA 3BBBA 3KUHA 4BVPA 4LRDA 4TY8A 1CC7A 3J7A1 4LR8A 3GJQB 2DHGA 1BIZA 1HWIA 5A8WA 4IFYB 4FLYA 4L3NA 2DBBA 4P9SA 1CXQA 3WC0A 3MX5A 4AHSA 2PIIA 3Q8SB 3HZEA 3S1TA 4CFAA 4NCGA 3PUFA 5KFCA 1YITS 2YX6A 4P2XA 4KGXB 1UVMA 1IKVA 4DZDA 2ZH9A 3DGVA 1N5YA 4WQ5C 3R8YA 3F0NA 3K59A 1VQ7S 1NZAA 2UXBF 3NCQA 4EYHB 1RUSA 5KT5A 4TY9A 3LWMA 4ELUA 1VOMA 2BJDA 2OTJN 2PMWA 3WIUA 2AYEA 2F63A 5E3CA 5CE3A 4WFBQ 1ACMB 2FHOB 1T44A 5JS1A 1FVQA 3HOTA 4MQ3A 4L3KA 4LBPA 2X7IA 3I56S 3GBTA 1GLEG 1YJWN 4B3MK 4KI6A 3EDRB 1PAUB 1YJ9S 1D5AA 4OI4A 4BRCA 3A0IX 2D0PA 1YVFA 2P9KB 3HPGA 2GCFA 1S72S 4NLOA 2AYBA 3G6YA 2ZZTA 5KFBA 4IOCL 1KOOA 3E66A 3O80A 3SUPA 1ZBHA 1LK7A 4B02A 3BH6B 1IBLJ 1MSWD 3ID8A 1WSRA 4XAKA 2W7OA 4N8OA 1ZTWA 4O0IA 3D68A 5E0OA 4G6VB 5AE3A 4FJNA 1S79A 1Q8KA 3V9WA 3VAGA 1FJGJ 3N5FA 3B6PA 4ED2A 2QYCA 2DRBA 1QAJA 4CJLA 3VEYA 2ERRA 2WVFA 1HKCA 1HKGA 2PC6A 5F3ZA 1J5EK 4B9TA 4DFKA 4DQIA 4IFYA 2B7BB 1UFWA 2IJFA 4QS9A 4YB7A 2E7VA 4JI2K 1D9DA 5L9XA 4Q2LA 3S01A 3M9OB 1HD1A 3HHLC 2GJFA 4I0WA 1IVZA 3D0IE 2IRXA 3OS1A 1FRLA 4BBYA 4ZPDA 3TZYA 4FOIA 3O9SA 4M3RA 2QC3A 5FDLA 5HI7A 2CPIA 3VQAA 4DR6F 2A6AA 4CEAA 3BKFA 4KB0A 3X3UA 1JJ4A 3M8ZA 3HSZA 2GHWA 5E5NA 2HB5A 3VV2B 1VISA 2XGPA 3THVA 2G1HA 1C0TA 3CJ0A 4EMDA 4FLZA 2E1RA 1MG7A 1RBUA 3OW2M 2IHR1 4X66J 2XMKA 2XYGB 2RRNA 3RZAA 1KN6A 2DPIA 2HHVA 1WSVA 3JTNA 1PJ5A 1F3VA 4UY85 1HA1A 5ITHA 2NS1B 1JLEB 3KLEB 2WSEC 3MN6A 3OV7A 2ROEA 3A3PB 2G1DA 2VGMA 1NXIA 2ADBA 3PV8A 4I2PB 3G10A 2LA4A 3L6QA 3C66A 4ILLA 4JKBA 3C7NA 1Q8IA 2KN4A 5KPRA 2KDOA 4ZPTR 4FWNA 3VF6A 2B8PA 2BBEA 5CR4A 3PEHA 4QQBA 4DTOA 4LF9K 3CNQP 2W8KA 3O3FA 4FJKA 4UW2A 3CFPA 2ROPA 3TZXA 3D4JA 1KVIA 4HT5A 4DUYK 4IDKA 3KJQB 3ASMA 1L3UA 1GMUA