1TKZA

Crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 142
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkzA05
2OPSB 1J9AA 4FJXA 1NK8A 3C6TB 1YVUA 1VSDA 1ITGA 1TL3A 2W7PA 4OKKA 2OPRA 3KLIA 4ECUA 3NBPB 3KK1A 1RT7B 1KVAA 1WSFA 1WLJA 3KD1E 5J2PB 3OYHA 4CJWA 4ZTFA 1O1WA 4Q45A 5L1JA 1HNVB 5KG1A 1IKYB 3LP1B 4KTQA 1A5XA 4EYIB 2GV9A 4RNOA 1NK7A 5FRNA 4KB0A 3EPGA 1JLQB 5F8HA 3JSMB 3HM9A 4IRKA 3ZSQA 3DLEB 2HHTA 4JV0A 4FJ5A 2W9BB 1X1PA 4KHYA 4CJFA 4DFMA 1SUQB 2O5DA 1IG9A 1BGXT 3S9HA 4RW6B 3SPYA 1RT6A 3T19A 3MEEB 3ISND 1YVFA 3CDUA 4ZTJA 4KHNA 2UVRA 4KHWA 5D3GA 5CYMA 1JXEA 4JV1A 4CHQA 1LV5A 3WNGA 3EZUA 3GV5B 2XI2A 4IQXA 4C8KA 3AA5X 4CFBA 3CDEA 3KLVA 2IDOA 4OL8A 2JEGA 3BGRB 3FRZA 4MKBA 2ASDA 4KB7A 2ZD1A 3KLGA 2CJQA 5KFJA 1T03B 3AO2A 2XGQA 3BSNA 2UUTA 4CEEA 5DGBA 3HP9A 4RW9A 1RYRA 4YMEA 5HROB 1QHTA 2ASJA 1W9HA 3CFPA 3I0SA 2IJFA 4R8UA 3D0PA 2FJXA 3MTKA 3CJ0A 3OLAA 4K4TA 2KQ2A 3OYGA 2XGPA 2BQRA 4O3NA 4CF2A 4PY5A 3KLIB 1ZBFA 5JS1A 3KK1B 1RBUA 4HUEA 2FBYA 4FLWA 3IAYA 4YR3A 1SL2A 3V1QA 1D9DA 5EU7A 3OYLA 4MFBA 2E9TA 4DU1A 2UVWA 3MFIA 3GYNA 3VQCA 5F8MA 1TV6B 4NLOA 5KFXA 1RTIB 3O4QA 1X9MA 5KFBA 3EY1A 1DTQA 4OKEA 4I9LA 2A1RA 3IRXA 2WHOA 1VRTA 5J2MA 4TN2A 4CJPA 3OYEA 1Y97A 1HYSB 1TL1A 5K14A 3N6NA 5KFOA 3QLHA 4KSEB 4BDZA 4DLGA 1QE1A 4LSNB 4O3PA 4WXOA 4FM2A 3P83D 5D3GB 3RMCA 4KFBA 2ILYA 4Y34A 4Q44A 2FC0A 4DTXA 3QO9A 2IM0A 1KCFA 1TK8A 4HCCA 1REVA 2AU0A 3CJ4A 3Q8RB 1K1SA 4J9OA 3OLBA 2D0CA 2QK9A 4M42A 4M45A 4E7HA 3V9XA 2FBXA 4C8MA 4NYFA 4FCYA 2VG7A 3PW0A 3PZPA 4B9MA 3NGYA 4R8UB 1S1UA 3KK2A 1WSHA 4J2EA 5FROA 3ZSOA 4KI6A 1Q8IA 3KD5E 4H54A 3VQ6A 3ZSZA 4KPYA 4Q5VA 4PQUA 3DOKA 3V9SA 4ED6A 4E19A 4WFXA 1KVCA 1QSSA 3PUFA 3RB6A 3K58A 3V1RA 4HHTA 1RTDB 2C2RA 3VQDA 3LP0A 4FS1A 1N56A 3F9KA 1CZ9A 4CIFA 2FBVA 3KLEB 3D5MA 1S1VA 4O3QA 3CJ5A 3ZSYA 1VRTB 3QERA 5J2MB 1JLCA 2OZMA 2IMWP 3NAHA 1TL1B 4ZVFA 3AA2A 1GOAA 3QLHB 1FK9A 3PR4A 3C6UB 2FVSA 1QE1B 4R5PA 2XY7A 4Y3CA 1S0MA 4CK1A 1VSFA 1QQCA 3OS2A 3BJYA 1Q9YA 4WE1B 1JLAA 4TQSA 1S49A 1RBTA 3QEIA 2JEFA 3BR9A 3KTQA 3VQSA 3HP6A 4KHSA 3OYMA 2LSNA 4CHZA 3B6OA 4E0DA 2ATQA 2VG7B 4IKAA 4IRDA 4M3UA 4IH5A 2FVPA 3O4NA 1LWEA 2ILZA 1I6JA 2RDJA 2HHWA 1QAJA 4DG1A 1TP7A 2YNFB 4E7IA 2G8IA 2Y1IA 1NKCA 3AA4A 4ELVA 2FJVA 1XC9A 4DF8A 1Z4UA 4TSXA 4GC7A 1NJWA 4LSLA 2R8IA 4CFCA 3RBEA 5SZTA 2IM2A 1L3VA 4BACA 5KFIA 3MR5A 4GC6A 1HQEA 1C1AA 1S9EA 3LP0B 1S6QB 1B9FA 4DQQA 1NJXA 3GV7B 2HMIB 3EZ5A 4CERA 1RT3A 4WYLA 2R8HA 4B3OB 4LY7A 5F8IA 4AHRA 2F8EX 5C42B 3TR8A 1FK9B 3NGIA 4J2DA 3PW4A 1A5VA 4JS4A 4IDKB 5FDLA 3VQ7A 4DS5A 4M3TA 2WONA 3V6DA 1SV5A 4ED2A 3NGDA 4O4GA 1JLAB 4NLVA 1S0NA 3NH0A 1VSIA 5KFAA 3GV8B 3HVAA 1T7PA 4M3WA 4I2PB 4K4VA 1R0AB 1S9GB 1RDAA 3TARA 4N76A 3IG1A 4FJ8A 1DTTB 1ZBLA 4ECWA 4ICLA 1J5OB 3T5LA 3RB3A 3MAQA 4RZRA 3K5MA 3IS9A 2BANA 1T05A 3H5SA 3T5HA 3MXMA 5CZ2A 5J2NB 4KAIA 1ASUA 5T7BA 4OGCA 4Y1DA 1LW2A 4KB1A 4DSLA 3DM2A 3DYAB 1L5UA 1TKZB 3FQKA 4NLPA 5HRSA 4K4WA 3F73A 2YNIB 1XWLA 4DQPA 4KHUA 1A5WA 3SQ1A 1WSIA 4E1MA 2HVHA 1C2PA 4CJ3A 3OS0A 1S9EB 3BSAA 4Q43A 2PYJA 3KHLA 4RW8A 4F3OA 2J6TA 1C0MA 1RT3B 2FVQA 4EYHB 3CM5A 2AGPA 3SFUA 4CGGA 1NHVA 4TQRA 3L2RA 4JS5A 1UA0A 1N5YA 4DL3A 3V6DB 2FBTA 3TI0A 3ZT1A 2YKMB 4CE9A 1Z26A 3I5BA 3AVCA 3OJUA 3OSNA 5KGWA 4NCAA 1LW0A 4NLGA 1Z25A 4Z4IA 5KFCA 3DLRA 3CFRA 4URQU 4HUFA 1C1CB 4Z0UA 2RN2A 1KTQA 3VQPA 1SKWA 1EETA 3CQ8A 4X2BA 3PHEA 4IOBA 3NH2A 4H4OA 4IG0A 3MFHA 4CGJA 2AQ4A 2HAIA 3N6LA 3VQ4A 4ICLB 1JLBA 2IM1A 3IS9B 1BIZA 1WSGA 4M3XA 4CEFA 3HHKA 2FJWA 3L2VA 3RWUA 4LQ9A 2VG6A 3QGHA 1CXQA 3SCXA 3LAKA 3DM2B 4BDYA 3FFIB 1JLFA 3KK3B 3RTVA 3ASMA 5KG7A 2NUBA 2P51A 3CJ3A 4DTRA 3D28A 4ECYA 1CXUA 4I7FA 3PJXA 2IAJA 3L2WA 2HNDB 5KG2A 2C2EA 4HUGA 4BDPA 3PX4A 4KBIA 4B9SA 4DFKA 3QGGA 4FLXA 5HRPA 3BREA 4ZVHA 3DLGB 2IM3A 3LPTA 4LH4A 1WSJA 3TAMA 2QXFA 4O3SA 2B43A 1ZBIA 3M8PB 4Z4FA 2IS3A 2IC3A 1S9FA 3ZT2A 4ECZA 4EBDA 5I42A 3L3VA 2FLPA 2VWJA 3SQ4A 4J9QA 4ID5A 3K5NA 1N5YB 5KFNA 4FK2A 2VG5B 5DG9A 4FYDA 3UR0A 2ZQBA 4DTPA 1UAXA 4KHQA 4DSEA 3MECA 1RT5B 1S1WA 2W9AA 1LAVA 3EPIA 3LDSA 3SUQA 4DFPA 3CO9A 4QW8A 3I5AA 1QSLA 5KFYA 4OGEA 4DEZA 2W7OA 4DTJA 1SL0A 4ZHRA 4IR1A 1EETB 3DRSB 3VQBA 5HBMB 4FLTA 4M41A 5C25B 1U49A 5J2QB 4CF8A 1QAIA 4O0JA 4Y2CA 4FJHA 4HVJA 4R0EA 4EBEA 3BSOA 5F9LA 4O3OA 4RUCA 3LPUA 2VG6B 3D45A 2J6SA 3I0RA 2C2DA 3DOLA 1NHUA 4CJ5A 5KFKA 3NCIA 3GIKA 2OPPB 3V1OA 1VSHA 5HRNA 2WTFA 1TKXB 3HYFA 2RF2B 4I7FB 2IAJB 3UDLA 1N4LA 1UOCA 4F3TA 2C22A 1KHWA 4ZPAA 4O5BA 3CIZA 4DL6A 4E7JA 5C24A 2WRMA 4B8CA 3VQ5A 1NJZA 4ECVA 3DLKA 3TAMB 2HVIA 3MEDA 5KFDA 2G8HA 2HHSA 1Q9XA 4URSA 3NF9A 5KG4A 3AA3A 1VSEA 4NYZA 4FLYA 3KHHA 4ID5B 3H98A 3FSIA 2G8UA 4LD0A 4NLQA 1LWCB 5KG5A 3DRRB 3MECB 2RPIA 3NFAA 5KG3A 1S1WB 4IG3A 4DSJA 3T5JA 1KSPA 4Y2AA 4JRPA 4B9NA 4F4XA 3RMDA 2EC0A 1B92A 3HPOA 1IO2A 1EP4B 4DF4A 3THVA 5HLFB 1IKXB 5KFZA 4HTUA 1W25A 1NOYA 4JUZA 2V0NA 5L1LA 2WK4A 4DL4A 2DFEA 4G3IA 1IH7A 5KFUA 4DMNA 1TL3B 1NK5A 2OPRB 3ALYA 2E6LA 2UVUA 1I39A 4PA1A 2ATLA 3HKWA 1JL2A 2F8TA 4ED0A 3PO5A 4URGA 1NNDA 1KRPA 3QGIA 2F8SA 2G8KA 3PJWA 4ID1A 2KZZA 3DOLB 1WN7A 4H4MA 3PV8A 4ZP6A 5KRSA 3ZSXA 3V6JA 4F8RA 3SNNA 1S6PA 2HB5A 4FJNA 1JLEA 3PX6A 5KT3A 5KT4A 3DMJA 4QWEA 4W5TA 4CEAA 5C24B 1JXBA 4ZP9A 2R8GA 2ASLA 3DLKB 1C0TA 4PUOA 1RT6B 2BE2A 2R2SA 4CJEA 1VSKA 4B9UA 2BDPA 2DPIA 4OKJA 5CYMB 3V6KA 2PZSA 1U09A 1U47A 4Y1CA 3MEGA 5DQHA 4JV2A 5KFTA 4K4UA 4J9LA 2W8LA 3I8DA 2ZD1B 2YHAA 3NF6A 4IG3B 3KLGB 3KJVA 3OHAA 4M3ZA 4RW9B 3TAQA 3I0SB 4JLHA 4F2RA 2YKNA 4CJRA 3IGNA 4NYNA 4MIAA 4BWMA 5L1KA 4CJLA 3AVKA 3TQ1A 4TY8A 3GIJA 1RDBA 3AVLA 3HVRA 1XR5A 4H8KA 1X9WA 1ZYQA 4KTZA 4MFBB 4YR2A 1NKEA 4QWDA 4H4MB 4K4ZA 2EHGA 3LWLA 1QUVA 2D7SA 5KTQA 3OYAA 4DU4A 4RW4A 3SV4A 4NRTA 1S6PB 2HHQA 5JXSA 4ED7A 1DTQB 1TK5A 2P1JA 3IRXB 5KG0A 4NLRA 4WZQA 4CJVA 1SL1A 4CGDA 5EWFA 3WNFA 4AHTA 3QEVA 4FM1A 1RILA 4NRUA 2WOMA 2AWZA 5K14B 1RTHA 3KKRA 1DLOA 2RDIA 4FLUA 1ZTWA 4PUOB 4K50A 2BE2B 3A2FA 4FBUA 2F96A 2VA2A 3OYDA 4KFBB 3RRHA 4I2QA 1JKHA 3QO9B 1UWBA 4FJ9A 1REVB 3TAFA 4FZXC 4HKQA 4EEYA 3PY8A 1GX5A 1B9DA 5DG7A 4MK8A 4MH8A 4FJ7A 3T1AA 3HSTB 3ZCMA 1WNSA 2B5JA 4RNHA 3K59A 3MXIA 3G6YA 4OPKA 3ZSRA 1KFDA 4TYBA 4OLBA 2Y1JA 4Z4HA 4OPJA 3KOAA 3NGZA 1S1UB 3KK2B 3M8SA 3RAQA 2I5JA 2YKNB 1HQUA 4DL5A 5CZ1A 3BQ0A 4EBCA 3DI6A 3NKYA 4XPCA 4PQUB 3DOKB 1BI4A 3KMQA 3NHGA 4RNMA 4K8ZA 4RUAA 2G8VA 3HK2A 2XI3A 1VRUA 2HWHA 2GBZA 2AJQA 3AO3A 4C8LA 2HNZA 3C94A 4CHOA 3Q8PB 2D41A 4LQ3A 2WB4A 4RW4B 1HPZA 3OSPA 4F4YA 4NLWA 3HT3A 5KFWA 4WXWA 4E89A 1S1VB 4E7LA 1XHZA 1ZETA 1C6VA 2JC0A 4BWJA 5KFQA 1T94A 2PY5A 1JLCB 1VSJA 3G6VA 4QPXA 4L8RB 4IFYA 2WOMB 4MK7A 1KFSA 3MF5A 4B08A 4MQ3A 4Q8FA 3TABA 1BIUA 3SPZA 2FVCA 4R5PB 2JGUA 4QWAA 2KFZA 4N56A 4I2QB 1TGOA 1WAJA 3LP2A 3L3UA 3H40A 3OJSA 2E6MA 2JLEA 4KHMA 3S3NA 1SH3A 4E1NA 4K4YA 3OS1A 1C1BA 1NK9A 5KFRA 5DQGA 1S10A 3JYTA 4NLUA 4IR9A 3BQ2A 2RKIA 1S48A 3CFOA 4PWDA 1RCHA 2HW3A 3NE6A 3RB4A 4CJUA 5KFEA 2GIQA 4ZP7A 1K6YA 1TK0A 1CSJA 2EX3A 4FLZA 1LWEB 3ICLA 1S1XA 1FKPA 1KLNA 1HQUB 5F8NA 3KLHA 3H5XA 1JLGA 4NLDA 4F4WA 1N48A 3SUOA 4DG1B 3IN5A 1TAUA 3DDKA 5T14A 4KTWA 1HRHA 5KT7A 4TYAA 4LSLB 1NJYA 3OL6A 1VRUB 3V4IA 4CIGA 2HNZB 2XCAA 1HQEB 3WNEA 5C5JA 3NH1A 4FZYA 4CJQA 3QZ7A 4M94A 2QKBA 4KO0A 2HWIA 4MIBA 1IKWA 1F21A 5CY4A 1BL3A 4ECTA 3ITHA 4ED8A 3HO1A 3TAGA 5FDLB 3ZSVA 4CEQA 2PYLA 2WONB 4LH5A 3NL0A 3M9OB 3VN5A 1EX4A 3OYIA 1SV5B 4C8OA 5DGAA 4O4GB 3PX0A 2BRKA 3LWMA 4W5NA 2ETJA 3AVIA 2Z1HA 1NK0A 3IG1B 2KFNA 3VA3A 3UIQA 3DRPA 5EUHA 1RT1A 1I3AA 2Z1IA 3FDSA 2FLLA 1FKPB 2OPQA 2BANB 4QWCA 1T05B 4RW7A 3KLHB 1JLGB 1BQNA 2AGOA 4ZPCA 3L2UA 2JEJA 1TAQA 2D3ZA 1LW2B 1RDCA 3UPFA 3U3YA 3SFGA 3KMSA 3C6TA 1S1TA 4CHYA 4GMJB 1VK0A 1BQMA 3NBPA 5DLGA 3EYZA 1CZBA 2E9RX 2P5GA 2D0AA 2G8FA 5J2PA 4ED3A 2QE5A 4DTUA 4KO0B 4CESA 4DL7A 3SI8A 4CJSA 1IKYA 4RW8B 3U3GA 1X9SA 3AVAA 1RT2A 3JSMA 4HCBA 4XIUA 4M95A 2IJNA 4ECSA 2HHVA 2DPJA 4NLTA 1WSEA 3MR6A 5J1EA 2W9BA 4CJTA 4FJJA 4ZMMA 1XR7A 4NCGA 3HPGA 2B6AA 3KHGA 2ALZA 3O3FA 4J9SA 4FXDA 3S3OA 3H5UA 1LW0B 1UA1A 3TVKA 2ZKUA 4J9KA 4CJ4A 4AHUA 3KLFA 3H08A 2BR0A 3QIDA 2B4JA 1HJRA 2BQ3A 3AO1A 3PW7A 3KHRA 3VQEA 4H4OB 4IG0B 1BHLA 3RAXA 3OL9A 3DRPB 1T03A 1RT1B 4EZ6A 1JLBB 3CDWA 1CLQA 1U04A 3V9ZA 3RMBA 2OPQB 4CECA 3CJ2A 3H2LA 5HROA 4AH9A 1BQNB 4FZZA 2HHXA 3HPHA 4KAZA 1JLFB 3LANA 3HVWA 1S1TB 4RNFA 3PW2A 4CFDA 1BQMB 4K8XA 2BRLA 3AO4A 3MXJA 4K4SA 4EP5A 4W5OA 5FRMA 4EO6A 3RRGA 4B9LA 3M8QA 3OL8A 3MR2A 2X78A 5KT6A 3CVKA 3HXMA 3VQAA 1RT2B 4BE2A 1L3TA 1G15A 1TV6A 1RTIA 4CGIA 2IC3B 2D0BA 3QNOA 1TKTA 3QYYA 3TAPA 1SKSA 5I42B 3MR3A 3AVMA 5J1EB 3O3GA 1HYSA 1RA6A 1NK4A 3V9WA 1GOCA 1W0HA 3QINA 4NCGB 5JS2A 3PO4A 2B6AB 3K5OA 1QS4A 4TY9A 4LSNA 1HNIA 3OY9A 4AILC 3GIIA 3FQLA 3KLFB 5KFGA 3HVTA 3TAEA 2G8WA 4ZHRB 2R8JA 1BCOA 1RA7A 4WFZA 3T3FA 1RT4A 2R2RA 4Z4CA 2XWYA 3UQSA 1U4BA 1YTUA 2YNGA 2C28A 3OYNA 1RAJA 5DQIA 5EWGA 4FK4A 4CF1A 4FLVA 2QV6A 5KT5A 1JX4A 2D3UA 2VA3A 4DU3A 1RDRA 3H4BA 3I0RB 4RU9A 4FVMA 2AX0A 3HJFA 1KLMA 3QZ8A 3WNHA 4ECRA 4XPEA 3G10A 4CGHA 4FJLA 2JC1A 2R2UA 4NZ0A 2Q3SA 3M8RA 4QW9A 2AGQA 3GILA 5EWEA 5E41A 2XHBA 3M8QB 1RTDA 5DK5A 2GC8A 2IBKA 2X74A 3MEDB 1GX6A 3G0ZA 1JXLA 3OYFA 3IGVA 3LP3A 4CIEA 1WNEA 5L9XA 3KLEA 4OVLA 3PR5B 1TKTB 4J9PA 1HMVA 1S0OA 4WZMA 5I3UA 4O55A 2J6UA 4YP3A 4C8NA 1C0UA 1FXXA 2W42A 1ZBUA 3M9NB 2IGIA 4AHVA 3C6UA 5DG8A 4KE5A 1L3UA 4O3RA 3SYZA 3PW5A 4J9RA 1HNIB 3QIPA 3GIMA 3RBDA 3LZJA 2BQUA 2XY5A 3AVGA 3H5YA 5F9NA 3HVTB 4N5SA 3VA0A 4QOZB 4WE1A 3VQ9A 2XY8A 4U6PA 3ZT3A 1RT4B 2I1RA 3V81A 2YNGB 4J9MA 4ZVGA 4RG8A 1RDDA 5KFPA 5KI6A 5L1IA 3HL8A 5F8GA 2R8KA 4KHRA 2V9WA 3RR8A 2O4GA 1HYZA 3SV3A 4FM0A 2DY4A 4O44A 4IH6A 2IA6A 4CFAA 1FKOA 1KLMB 1NOZA 4F4ZA 1J53A 4IBNA 2D5RA 4B9VA 4YFUA 4KRFA 3LZIA 4NCBA 2YNFA 3ZT4A 4Q0BA 1JLEB 1N6QA 3ZSWA 3DMJB 2HNYA 1S5JA 2P5OA 4ELTA 4F2SA 3QEXA 4IKFA 3RR7A 1C0TB 3OYJA 4M3YA 4I9QA 4YQWA 1S6QA 2KW4A 4KI4A 2YHBA 1QSYA 2HMIA 4FJIA 3AVFA 4DTMA 2BGGA 1HMVB 2HHUA 3KIOA 4DTNA 4B3OA 5I3UB 4IFVA 3MEGB 5C42A 4EZ9A 1C0UB 2GUIA 2ZE2A 4FW2A 4TLRA 2OA8A 3BSCA 3BQ1A 4GW6A 3VQQA 3SI6A 4IDKA 3CWJA 3QIPB 3KJVB 2XCPA 5SWMA 4NLYA 1K1QA 4WFYA 4RNNA 1XI1A 1GOBA 1IKVA 2IOCA 3AVBA 3SZ2A 1KHVA 4W5QA 3GQCA 3V81B 5HP1A 4EO8A 4CCHA 3Q8QB 4BE0A 3Q8SB 4BE1A 3AVJA 5KGXA 1IM4A 4TY8B 3NAIA 4I2PA 3M9MB 1ZTTA 1R0AA 4NLSA 2V4RA 1HYVA 1S9GA 1S4FA 2OH2A 1DTTA 3SUNA 2Z1GA 3SQ2A 4O44B 1J5OA 2QKKA 5CYQA 4Q8EA 3O3HA 2UVVA 1D5AA 1FKOB 5J2NA 3G6XA 2YV0X 2OYQA 3AO5A 4CK3A 3E51A 2DFHA 3SUPA 5EDWA 4DFJA 3U6FA 1TVRA 2E9ZA 3DYAA 5F8LA 4Q0BB 1TKZA 1N6QB 2W8KA 2HNYB 2YNIA 4YNQA 4B8AB 3QESA 4DSKA 2VWKA 1RTHB 1DLOB 4MKAA 2R7YA 4FJMA 3DLHA 3L2QA 3ISNC 1MU2A 1U45A 3KKSA 1JKHB 4DTSA 3LALA 3L8BA 1RTJA 1UWBB 1NKBA 1SH2A 4KV8A 1ZBHA 4IFVB 5KFVA 3QNNA 2UUWA 4O4RA 2ZE2B 4CGFA 3KNAA 5KFSA 3VQ8A 2B5JB 1EKEA 3RMAA 1LAWA 4OLAA 4ZPBA 4ED1A 2JEIA 2YKMA 1IKVB 1NK6A 5KG6A 1JL1A 4AHCA 3ULDA 5F8JA 3H59A 4XO0A 3OL7A 4JRQA 3BDPA 2I5JB 5HP1B 3SJJA 4UQGA 3TANA 1C1CA 4Z4EA 4OJRA 4TXSA 4W5RA 1U48A 3DI6B 1BISA 1BI4B 4ELUA 4CHPA 3DLBA 4DWIA 4O0IA 2R2TA 1VSLA 1J54A 1VSMA 5CYQB 1OS5A 2CKWA 4NLXA 4DS4A 2Z1JA 3NF7A 1HPZB 4G1QA 2GIRA 4DLEA 3SQ0A 1TVRB 4QAGA 2V4QA 3FFIA 3CG7A 4FK0A 2A1SA 4DSFA 3KK3A 3CM6A 1TKDA 2E4LA 4IFYB 4KKOA 2HNDA 2DFFA 4QWBA 3OHBA 4DQSA 1EXQA 5JUMA 4E3SA 2W9CA 3OYCA 1D9FA 5KFFA 1ASVA 4CF9A 1D0EA 1MU2B 3N6MA 1MMLA 1KVBA 2X6SA 3B6PA 3K57A 3DLGA 5HRRA 3LP2B 1RTJB 4KV8B 3K5LA 5DLFA 3C95A 4FJKA 3M8PA 4FS2A 5KRTA 4Z4GA 4DTOA 4CEZA 1C1BB 4B9TA 4F50A 1LWFA 4GVMA 3JYTB 3E01A 3NMAA 2RKIB 2VG5A 1YTAA 4PWDB 5KFMA 5KT2A 2KZMA 4ECXA 2OZSA 4N47A 1RT5A 3V9UA 1SKRA 4CJKA 3NAEA 3OYBA 1S1XB 2XC9A 1XR6A 1WAFA 2XO7A 3QEWA 3P1GA 3OYKA 2YNHA 3V6HA 4MK9A 3TWHA 1S97A 3AVHA 3DRSA 4M3RA 5HBMA 2OPSA 1TQLA 5C25A 4J9NA 5J2QA 4FJGA 2KTQA 4IH7A 1L3SA 1RBRA 3ZT0A 3AVNA 3V4IB 4HYKA 4J2AA 1RT7A 3H4DA 4J2BA 4IRCA 4G1QB 2FVRA 2AX1A 1IKWB 3PVXA 1XHXA 1HNVA 3LP1A 2ITGA 4CF0A 4CEDA 2FLNA 2OPPA 3ITHB 3P5JA 4DL2A 4F4KA 1ASWA 4CEBA 1TKXA 1T3NA 2RF2A 1JLQA 1RYSA 4KKOB 4CEOA 3QETA 4N41A 4FW1A 2W9CB 3DLEA 1BCMA 1QTMA 1SH0A 4KREA 2XY6A 4DQIA 1SUQA 4E7KA 4ZPDA 1T8EA 2X6NA 1RNHA 4RW6A 5KFLA 4YR0A 3MEEA 2DTUA 3QEPA 4WYWA 5KFHA 1D8YA 4U7CA 3G86A 1LWFB 1D1UA 3T5KA 3RB0A 1RBSA 4QCLA 4DSIA 4EP4A 3E01B 1YT3A 3LAMA 3CYMA 3OVNA 2WCXA 1LWCA 3QIOA 3AV9A 1HARA 3DRRA 1JIHA 4ZVEA 3BGRA 4DQRA 4AHSA 3K2PA 3I5CA 1RBVA 2XRIA 4ECQA 3NDKA 4RW7B 4ZP8A 3S3MA 4K4XA 2O4IA 1EP4A 2YNHB 4CK2A 4CHNA 3NF8A 5HLFA 1IKXA 5DMRA 4FBTA
chains in the Genus database with same CATH superfamily
1R59O 3ZTQA 1QZ6A 4CLYA 3C6TB 2N4DA 4WIIA 2W7PA 4FSVA 1TR0A 4OKKA 2DXEA 1WF2A 3WQTA 1JMTA 2EVZA 3RSEB 5J2PB 3M6VA 3M7VA 1HI1A 4WPAA 3M6XA 4Q45A 4KTQA 2OELA 4EYIB 2HS0A 3EPGA 3VF4A 2QTDA 1JLQB 1NPKA 4IRKA 1IN0A 3VTIA 3TJ9A 4B3SJ 2XG8A 3DLEB 5GMEA 4N77A 4JV0A 1NBEB 3UD5A 3G25A 2O5DA 4OJ1A 3O5TB 2NUHA 1N34K 2UVRA 1J27A 5CYMA 2HBJA 4DR5F 3H7HB 2AEJA 1LV5A 4ZJLA 4C8KA 1NHKL 1YJUA 3AA5X 4Z7YA 3TA0A 4CWBA 4E98A 3TZZA 4OL8A 4FWKA 3BGRB 3VGTA 3KLGA 1LCUA 2CJQA 5KFJA 2UUTA 3DU6A 4CEEA 1ROFA 4CZEA 2DRBA 3L7UA 2QWPA 3CFPA 1PYOB 4R8UA 4U7UD 2L9DA 3CJ0A 4OYXA 2OEMA 1BDGA 1UAWA 4B17A 1XNQJ 4PY5A 1F9EB 4DR6J 3NNCA 2YX1A 3IAS9 2BM0A 2FBYA 4YR3A 4DV1K 4LVOP 1HNWJ 4LF5F 2E9TA 1CJTB 4IO1A 5F8MA 1TV6B 3O4QA 1MN7A 5E3AA 4N7TA 1KS2A 4TN2A 3AFGA 1QDUB 1TL1A 1I94J 2AD9A 4BDZA 3GG0A 3NVKA 2POKA 5GAHP 3BYRA 5AXNA 4LUBA 2HMPA 4WXOA 4FM2A 5SUHA 2NXUA 3RMCA 4Q44A 2EFOA 1N33J 4WKYA 1TK8A 2FQQB 3HHEA 4K42A 3CJ4A 3SMZA 3UD4P 1K1SA 5IV4A 1Q8BA 2XQCA 1HLUA 3H25A 4MT1A 4M42A 4A2BA 3G4SN 1W2IA 3V4MA 3EE9A 2HHPA 2M88A 4DV2J 2C3PA 3BN7A 1SAZA 2YKOA 3WQPA 4R8UB 3I55N 2XTJP 3D6FB 4G1IA 4FKXA 2B56A 2IRXA 1NGIA 4WTYA 2A0FB 1FEEA 5AT1B 3DOKA 4K0KF 3ISZA 3HOSA 4NI2A 4AL7A 2EFGA 4RWTA 3PTWA 4Q2LA 2EBGA 1YXQA 3DGPA 3AODA 5IT4A 3WXLA 4HH1A 1K9MO 2BOAA 3F9KA 3NS6A 3P31A 3SMPA 2JX2A 4CIFA 3D5MA 4MLEA 4O8KA 3G2XA 2VQFF 4ZDNA 3B8HA 1HBOA 1TL1B 2QA1A 4R0JA 5HMWA 1G6BA 3FEXB 3PR4A 1E6YA 2ZH3A 4J5OA 3THYB 8ATCB 1S0MA 1QQCA 3THWA 2XMKA 3GCWP 3OS2A 4Z2XA 1Q9YA 3N01A 1S49A 3LOUA 2HBLA 3HP6A 1NH8A 2HIYA 4U95A 3OYMA 3W65A 1JCEA 2NRHA 1VYAA 1KQSR 3B6OA 1U8SA 4LF7F 2Q3PA 5B0AA 3BDEA 2V51B 2FVPA 1HX1A 3G87A 2OI2A 4WIQA 2OTJN 1CS4A 1IJEB 2PD1A 3M2RB 1TP7A 2YNFB 2G8IA 2Y1IA 3AA4A 3OBYA 1VC5A 4GC7A 4LSLA 4DPWA 4KBOA 2VYPA 2IM2A 1L3VA 4BACA 2XHWA 3DGPB 3JSRA 4KH1B 2CYYA 1S6QB 4DQQA 3GV7B 4OHZA 4JI0F 3EZ5A 3FK4A 2E1CA 1EAYC 4CERA 1RT3A 2R8HA 4B3OB 4NX9A 4UQTA 5LMNJ 3TR8A 2O8FB 1T9UA 3CULA 3TYTA 1XN9A 4JS4A 5CCLA 4PXDA 2KVIA 1NO8A 2WONA 4BRDA 2EFQA 1RAOA 3THWB 2HFUA 3MPVA 1SV5A 3OXFA 4ED2A 2DNGA 4W90B 4CLKA 2HVZA 1IR1A 3A8IA 1X0PA 5KFAA 2FJBB 5AFUA 4K4VA 2WFBA 3WX8A 3TARA 1NU0A 1WG5A 2H5IB 5ETLA 4F36A 2Q43A 1DTTB 3T5LA 1R8BA 4RZRA 1MW7A 2Q6BA 3MXMA 1CS4B 4KAIA 5T7BA 1XJWB 2OD4A 3T1HF 1RI7A 3W2WA 1L5UA 5IT0A 1TKZB 1VQON 2OP5A 3ZZOA 1XWLA 3QSYB 4KHUA 3SQ1A 4K41A 3I96A 1NSQA 2HVHA 4CJ3A 2NNWA 4G65A 3HMJG 3BSAA 3NNHA 1BG3A 2J6TA 1RT3B 1VJQA 1GLEG 4P75A 3CM5A 3BBFA 4X66J 3CJRA 2VGNA 3R3TA 3L2RA 2XULA 3A3NB 4JS5A 1UA0A 3JS6A 1WHXA 3W8PA 4BC3A 2MLZA 3F2KA 3FMWA 4A46A 4O8UA 1Y7PA 1WJ9A 4CQ1A 1T11A 2ZHOA 5KGWA 3OXGA 1Z25A 4Z4IA 3DLRA 2KYZA 3SQOP 3AAQA 3C65A 4Z0UA 1X4BA 1G1XA 1R31A 3M30B 3NGSA 3R2DJ 2I6WA 3CQ8A 2QYGA 2EK6A 4DV0J 1F3FA 2C3YA 3N6LA 3MUVP 1JLBA 5D8HB 2BBEA 4JEPA 3C15A 4NYPA 1S5ZA 2AJ1A 2E1RA 3FRYA 1WC6A 2FJWA 2BJ3A 2VG6A 4JKCA 3PIPQ 3SCXA 3W2WB 5CZVA 3FFIB 1JLFA 3RTVA 3BEGB 3FEZA 4OYIA 5KG7A 2P51A 4P74A 3CJ3A 1Q4RA 3PJXA 3E9OA 1FRJA 5EX3A 2UV8A 4A61A 1HLWA 2K3IA 4K5RA 4X64J 4B9SA 4ENOA 2HBZB 4DFKA 2Y3YA 2NZTA 5A2QO 5HRPA 2ZJPL 5EX5A 2K06A 2DYAA 2F5GA 4HT7A 4DQ8A 5JVGQ 1GLFO 1ZBIA 1Y10A 2A6OA 2AT1B 4KC5A 3ZT2A 1RWXB 4OJHA 3PYGA 4ZIVA 4ECZA 5FPDA 2CQHA 3TRGA 2VWJA 5KFNA 5DG9A 1YIJS 2ZQBA 4DTPA 4DSEA 2DO0A 3VTHA 4FWLA 4ZITA 1B70B 3JTPA 3D3BJ 1B0VA 1V9OA 3EPIA 3LPYA 4BRQA 3VZIA 4M1KA 3VGKA 3I5AA 2KRBA 3EDRB 2DR8A 4DUYK 4M41A 5C25B 1U49A 1NDCA 5J2QB 4H5NA 2A6MA 4O0JA 3D66A 3CCES 4EBEA 4PPDA 1OPIA 5KOXA 3BSOA 2Q6CA 1KVIA 2VG6B 3BY5A 1K47A 1Y5IB 3DOLA 1T3OA 3NCIA 4FP9A 2O1PA 2FLOA 2JNJA 2W2QP 1UOCA 3PSFA 1QTNB 5B7WA 4E7JA 3MM6B 2WVCA 2WVFA 4B8CA 1M0SA 5JVHQ 2GWKA 2CQ2A 4ECVA 3C14B 3AD8C 4M5JA 4OX8A 2DH9A 3ADAC 2HHHF 4CH1A 2HZCA 5KFDA 5MAOA 2JVOA 1Q9XA 4B9QA 2DK2A 2E1MC 3G71N 4GVLA 5LT5A 4FLYA 1RWNB 3H98A 4ID8A 2DCUB 1Y5LB 2G8UA 3U1MA 3UE5A 3K7RA 2QT7A 2EBEA 3LDNA 2MMYA 3ZTSA 2AYMA 4JRPA 4F4XA 3PYDA 2DNOA 4DF4A 2PA8D 4ZCIA 1C4CA 3THVA 1IKXB 4HTUA 4JUZA 1FHTA 3MZIA 1HNXF 2WK4A 2DT9A 2DFEA 4A5BA 3VEVA 5C2FA 3GL1A 1M90O 4P2FA 1NK5A 2OPRB 5DS7A 2LMIA 4IJNA 2ATLA 2J5AA 4X4PA 2JFKA 3PO5A 4URGA 2RU9A 1PJ6A 2F8SA 3LPEA 3PJWA 4OI6A 3DOLB 4USVA 3MUMP 2OD6A 3V6JA 3Q23A 1BO5O 4WF9Q 4FJNA 1J5EJ 3MK6A 2VFTA 4FPIA 5KT4A 1F5AA 2Y1LB 2QWRA 2IHR1 2AKWB 4CEAA 5JVGL 4ZP9A 4L72B 2KB2A 3QNWB 4DR3J 3HSCA 2R2SA 1YJ7A 3BF1A 4B9UA 4CZMA 3J81O 2PZSA 1U09A 1U47A 1EZZB 1SKUB 3IBWA 3QFWA 1OMSA 3TX8A 3LA0A 3S8SA 2MQOA 2NZ4A 3KJVA 3OHAA 5IQ6A 4M3ZA 1ACMB 1IQZA 5HVFA 4DCJB 1KAYA 1V4TA 3I0SB 8RUCA 2VU5A 2QZ8A 1W2BR 3C6HA 1WOSA 4F2RA 2YKNA 2JWKA 4CJRA 3E8OA 3IGNA 2BV3A 4NYNA 4MIAA 4BWMA 5L1KA 3R8EA 2N3OA 5C12A 3MCOA 4TY8A 1HR0K 2ADBA 2Z58B 1YKWA 2RRBA 5IWAF 4OHWA 3CJCA 4B3RJ 3HCXA 3L0QA 2PAVA 4MFBB 3VWSA 4I0WA 2YH1A 4QWDA 3SLCA 3I9V9 2D7SA 2NXEA 5KTQA 4DU4A 1NU4A 4LRCA 2IIHA 1BLUA 2P2CB 4C9DA 2B51A 3P8BB 5JXSA 3WIUA 5JVHL 3FR0A 4O5FA 1DTQB 4QOTA 4OI2A 1TK5A 2UUAF 3IRXB 4BCAA 1SL1A 1FD8A 4A59A 1HHQA 3OVBA 3WNFA 2Q31A 4NRUA 1VR6A 2AWZA 5K14B 4LF5J 3ULEA 1URRA 4FLUA 4R25A 3V5RA 5E33A 4L3QA 1UVMA 3EVWA 1FVSA 2NPFA 3SXLA 3MMJA 5BRHA 4LBHA 3ZLJA 2OSQA 3TZXA 3M1FA 5FJ4A 4FJ9A 3WDOA 1F5BA 4DCOB 5DG7A 4V1Ak 3TUJC 3HHNB 4XTTA 3W7BA 2R7QA 5AR0A 3K59A 2PC6A 4Z4HA 1S1UB 3KK2B 2CNKB 2YKNB 1M1GA 2ZM6K 3A8EA 1V5VA 3BQ0A 4EBCA 5LXYA 4XPCA 3VF0B 3Q8UA 4FN5A 2KJVA 3C6AA 3VEOA 4DPUA 4RNMA 1U2VB 3R5BA 2UUBF 4RUAA 3FBEA 2XI3A 3CCRS 2HWHA 2GBZA 4YOWA 1M5VC 3HSDA 1UEUA 4WF9L 3DCAA 3WC0A 4DX5A 4CHOA 3Q8PB 5GINA 5HN0A 2D41A 1X5PA 2RB7A 4NXNF 2GW8A 4EFAC 3OSPA 2QA4N 3HFZB 1S1VB 4K0KJ 1XHZA 3CD6N 1XTZA 1JCFA 2D4WA 2B4PA 1S76D 3T1YF 1VQNN 4MK7A 4B08A 3OT9A 2CAJA 2O8BA 4HTLA 5M2PA 2RHSB 3JAMY 2HZVA 1J2VA 2FVCA 4R5PB 2KFZA 2LQ8A 2O67A 1TGOA 1WAJA 4USUA 5M1KA 2GV1A 3QJLA 3L3UA 3S3NA 4BRFA 2PGCA 2VQFJ 2NUUG 2NLXA 3A5MC 2QMXA 2VPZB 3BO4A 5KFRA 5GIOA 5DJBA 4P52A 4IEIA 1S48A 3CFOA 4PWDA 1RCHA 4FWOA 5DETA 1X4GA 2OIHA 1N54B 4CJUA 2XNRA 1UP1A 3TVYA 1VQKS 5KFEA 2GIQA 4OIXA 3H20A 1RU1A 1QJHA 2DHSA 4RWWA 1JLGA 3SUOA 1AZSA 4DU7A 2OTLS 2CH6A 2K1RA 1HRHA 5KT7A 2ZDPA 1S0VA 3OL6A 3JSBA 2PMZD 4QQBA 3QRPA 1HQEB 5C5JA 2RSQA 1Q86T 3NH1A 1NPRA 4BR7A 1YJNN 2QKBA 4KO0A 2HWIA 4MIBA 1BL3A 4FPBA 3IM9A 5HI7A 3W9JA 2G9OA 4CM2A 3ENBA 3FGVA 5E5NA 2MPUA 4H0PA 3IA0A 3GPAA 1Y0HA 3ZSVA 1NGJA 5K8OA 4CZFA 4JI0J 2H5JB 1JB0C 2LDIA 4MO4A 1B64A 4GKKK 4O4GB 3SAGA 2KT3A 1UW4A 2AJFE 4EU0A 1QVGR 1XQSC 2BRKA 2Z30B 2ITMA 3AVIA 4ZLNA 2KFNA 3UKUA 1I3AA 1IBLK 2BANB 1FKAF 4X65F 3PIOQ 1JLGB 4AXIA 2HF4A 3H2VE 3I33A 2EXUA 3P96A 4YDUC 2KXFA 1F1BB 2D3ZA 1LW2B 2K1RB 3RUBL 1RDCA 3SFGA 3RU0A 4WP8A 3HHDA 2MKCA 3FCWA 4LF9K 4GMJB 4AL5A 4PEOA 1U6BA 3GLJA 3NBPA 3EYZA 5IZHA 3CCMS 2P5GA 1NGDA 2G8FA 3DRXA 2BJEA 3HT0A 4KO0B 4DL7A 1KC8T 4JV5J 3SI8A 4CJSA 2UZAA 3T1HJ 1IKYA 5IM0A 4RW8B 1FD2A 1PBUA 2RQ4A 2H3GX 4KH0B 3H2UB 3JSMA 4HCBA 4XIUA 4M95A 2H51B 4DXLA 2HHVA 5IC6B 3MR6A 2B7BB 2DR7A 4CJTA 5F41A 1HHTP 5ETNA 4ZMMA 2GWJA 3HHLD 4NCGA 1BHNA 3UN3A 2D0OA 3V2UC 3E2EA 2B6AA 3ENWA 3W60A 4B1VA 1UKUA 5AZJA 4B1ZA 4ZLPA 1HWLA 3TVKA 4J9KA 2IVNA 1RJJA 1IJFB 2HG4A 4JYAF 2A3ZA 1N36F 2P9IB 3TWZA 1HJRA 3PW7A 4H4OB 2GAHC 1VBKA 4IG0B 2CZ9A 3RAXA 4ISGA 3JXOA 1T0TV 3QBWA 3RMBA 4AF1A 1BY9A 4L73A 1REGX 1I1GA 1FW6A 3I9ZA 3CJ2A 4FZZA 1EARA 4DR1K 2I0XA 3HPHA 3B4MA 1NB7A 3CCUS 3W0LA 4NMLA 4YHHF 2LDYA 2B0GA 3MX2A 3P49B 2DNHA 3GG1A 1NLKL 3MXJA 3LUYA 5FRMA 2QC3A 3GJTB 4DB3A 1F6TA 2WVBA 5KT6A 2MTLA 4LF4F 5AQUA 1SC3B 4CGIA 5F3TA 2IC3B 2D0BA 3QNOA 3TAPA 4MO5A 3AD9C 5I42B 3AVMA 5BR8F 2V9KA 1H74A 5C2CA 2KN4A 1RA6A 4AYBD 5GADI 1W0HA 4NCGB 3NGUA 2MDAA 2B6AB 4JI6J 5AZJB 4TU9A 4AILC 2V8VA 4JKAA 3RRKA 2EFPA 3FQLA 1X5TA 3HVTA 3TAEA 3ZETA 2G8WA 3EKUA 2RJZA 3BZKA 1IWGA 1NPPA 2R2RA 2KT2A 2E5JA 1U4BA 1YTUA 4CBXA 3PIOL 2YNGA 2HFNA 4LF6J 5DQIA 2ZOFA 3UVJB 3W5XA 3P45B 3C7NA 2HBMA 3ZZPA 5D4PA 1X4CA 5J1NA 2OANA 4ES1A 2IRUA 4RU9A 4X4QA 4C7QA 1R43A 2KU7A 1KLMA 3QZ8A 1HBMB 4XPEA 3G10A 2JC1A 3SSSA 4QW9A 3GILA 3UNYA 1WC4A 3W9IA 2F4VK 1HI0P 2VB6A 1FRKA 5JJBA 2GC8A 4AUKA 1GX6A 2VPYB 4DN9A 3OYFA 4CIEA 1WNEA 2PO4A 3IR6B 1RGIA 4CI0B 2CPJA 4WZMA 4YDDB 3WXMB 4F0KA 4C97A 1U6ZA 2R7OA 4DV7F 2XWXA 2KYXA 2HBQB 2W42A 5I4MA 3M9NB 2IGIA 4AHVA 4DR7F 4W4MA 3O1LA 2HHHJ 3PW5A 1RBOB 3H5YA 3H42A 2C2NA 3HVTB 3ZETB 3VA0A 2XS5A 3CC2S 4RBUA 4WE1A 4KGZB 4NA1A 5AQMA 3V81A 2YNGB 1ULRA 2X1BA 3P3DA 4LRBA 4QR0A 2D69A 4RG8A 4GMKA 4CO0A 5KI6A 5A0YB 2V9WA 3RR8A 3DOMA 3QMLA 2MZRA 4O44A 2OKQA 2XB2D 2HK3A 3Q7BA 1HNXJ 1FKOA 3C2PA 1KLMB 2C3UA 2D5RA 4KRFA 2FYXA 4YORA 1WF1A 3ZT4A 3R7SB 3MHYA 2NRRA 3NLCA 1N6QA 4QPTA 2P5OA 1NMEB 3PYEA 3KDOA 1MMDA 4IKFA 1S77D 1C0TB 4M3YA 4B3SK 5LJ5Y 2YHBA 1QSYA 2HMIA 2QFJA 3MCPA 1XMOF 1NZ8A 3KIOA 1KEKA 1BC6A 3ZO7A 3O1WA 3MEGB 2OJ3A 2GUIA 2ZE2A 2VOOA 4TLRA 1RGVA 1JK9B 3VQQA 1H72C 3CC7N 3CWJA 2X7IA 1Q5YA 2XCPA 3OR2A 3Q22A 1K1QA 1ZA1B 4WFYA 2GIFA 2X1FA 2SXLA 3AVBA 1VAZA 4CT8A 3SZ2A 3PCOB 2F7VA 3KUHA 2AHOB 1NWKA 3V81B 5HP1A 4NZ6A 5IQQA 4CCHA 3WBZA 4BE0A 3AVJA 5KGXA 2HS3A 2OUGA 1HWUA 1WI8A 3EGNA 3DXSX 1R0AA 1UJ6A 1ZA2B 3DOMB 4CLFA 1NGHA 5HVHA 4QIGA 1XNQK 3K0JA 1U1QA 4O44B 3H8YA 2FJDB 3JXUA 2D3OR 4DR6K 2AJ2A 1APSA 1FKOB 5J2NA 3W3SA 1WC5A 1RAHB 3SUPA 5EDWA 4DFJA 3U6FA 2V34A 1TVRA 4KGVB 2E9ZA 5F8LA 1N0UA 1HW8A 1N6QB 1HNWK 3WC2A 5IWAJ 4LF8F 3CCJN 5AJ3J 2YNIA 4ILMA 3ELHA 5A76A 3VETA 2BA9A 3MMVA 3QESA 3PACA 1VBXA 1NMNA 4KGKA 2OO4A 3D0IE 4GNIA 1FX2A 2DNYA 5E2QA 1JKHB 4DTSA 2NRTA 1I94K 2LA4A 3BKFA 2UUAJ 1UWBB 5AE2A 1SH2A 4KV8A 3TTFA 2BE7D 3OQ2A 4LR7A 1GFWB 2GO9A 4DN0A 2ZE2B 3CCVS 1KKHA 5KFSA 3VQ8A 3E3XA 2J9DE 1EKEA 1N33K 1RBLA 3QAUA 2QLJB 2UU9F 3MMAB 4AHCA 2I9SA 3ULDA 3H59A 1KQSM 3OL7A 2I38A 5HP1B 2U1AA 2BUPA 3SJJA 1C1CA 1LWXA 4OJRA 4PYDA 2O8CA 3OR1A 4DV2K 4W5RA 4BRHA 3DI6B 3QT6A 1BISA 4WCEQ 3MWTA 3DLBA 4DWIA 1J54A 1OS5A 2MJNA 1H2VZ 5IT9Y 1XMBA 2J7WA 2Q0UA 1WC1A 3NNAA 4WQ5A 4U96A 4CLUA 2CNNB 3NF7A 2GIRA 4G1QA 1TVRB 4QAGA 1E3MA 2V4QA 5DDOC 3CCLN 4NOHA 5JLFA 1TYQA 3KK3A 2PMHA 2ERRA 2W1BA 2E4LA 2A2DA 1U7LA 4QWBA 2MLYA 2W9CA 4A8FA 1S72S 1SXLA 4NXNJ 5EHHA 5MLCQ 4XH4A 3K57A 1HBNA 4UOCA 3LP2B 4KV8B 2Q2RA 5DDRC 2CH5A 4FJKA 1FJCA 3SBMA 1C1BB 2QX0A 1LWFA 5I9EB 5K8PA 2E2OA 3JYTB 4GVMA 2BXJA 1K73T 2ZNZA 1N34J 2R7TA 2VJVA 4RUBA 3QAEA 5KFMA 1VQLS 4OV1A 2WUSA 4ZN3A 3HD1A 3SSRA 2Q66A 5ADZA 4TNOA 2YY3A 4MYTA 4KHPF 3VVUA 1P27B 2IFXA 2QSWA 1OYEA 1S97A 4FZVA 3DRSA 5HBMA 2OPSA 4JI8F 1TQLA 2QEXS 3CD7A 1RBRA 3CCQN 3ZT0A 1Q7YO 5E3QA 4MLHA 4A2AA 3V4IB 1NB2A 1RT7A 2CJ9A 2XZDB 3SSQA 4A8SA 2MKYA 4CZJA 2NCKL 1OH5A 1WTBA 4G1QB 1G3OA 2LYVA 1TYQB 3C16A 4F4KA 4CEBA 1TKXA 1T3NA 2D9OA 1RYSA 4PWUA 5K8MA 3QETA 2JH3A 2W9CB 2PFUA 1HJOA 1BCMA 2M5YA 1SH0A 4A8YA 5LMNK 1VISA 3ZZYA 4RW6A 1DHMA 1Z2ZA 4YR0A 1VGYA 3L6QA 3QEPA 1KOHA 1LWFB 1TL5A 4WFBQ 4QCLA 2EKYA 2YH0A 3EO3A 3M8YA 4DSIA 4EAHD 3T9NA 1YT3A 3NCQA 2RE2A 3CYMA 5BR9A 1U1OA 1UL3A 1LWCA 3NCRA 1FXLA 3QBCA 3K2PA 2XRIA 4WCEL 4RW7B 5AQKA 4K4XA 1EP4A 4JD2B 3NF8A 3CF5Q 5HLFA 2YHYA 2XBPA 3OTEA 3MN6A 2PE8A 2OPSB 3UR3C 4FJXA 1VSDA 2PA3A 1MSWD 1TL3A 3J7A1 1RT7B 1KVAA 3UO0A 1WSFA 2XS2A 2HFZA 4X65J 3OYHA 4OHXA 4ZTFA 3MM8B 4CLLA 1A5XA 2KM8C 3C16B 4DJBA 1NK7A 2GV9A 3HM9A 2XMVA 3ZZTA 3ZSQA 2ROPA 2GJIA 2HHTA 5E84A 2YKAA 4DFMA 4CJFA 2GNKA 4ER8A 4X66K 1W7AA 1BGXT 2ACMA 4RW6B 1K8AT 1RT6A 3T19A 3ISND 1U2CA 1YVFA 1EJ7L 2V67A 3ID8A 5BYRA 2AP1A 3GV5B 4IQXA 4EWTA 2ZVSA 3HJVA 4CFBA 5HANA 3CDEA 2NRWA 1MA9B 3O6QA 2QWLA 2HF3A 4CTAA 3AO2A 3QT5A 1GXLA 2JRSA 4H0VB 3HP9A 4LBPA 4RW9A 2Q1LA 1RYRA 1VHXA 4C8ZA 4DV0K 3WIVA 1W9HA 3A3OB 1N36J 1VHFA 2FJXA 5CQGA 4UZCA 2CPIA 4BROA 4RL1A 2XGPA 4PL7A 4BRIA 4X4UA 3FMBA 2P8IA 3K9JA 4PG5A 4NL5A 1ZBFA 5JS1A 4HUEA 2KG0A 4NE9C 4CZGA 4WBFA 4DPTA 1D9DA 3THPA 4J9UE 1FWPA 3LQVA 3GYNA 5CH7B 3VQCA 5KFXA 4YHHJ 5KFBA 4UF4A 4X64K 3EY1A 2M4MA 2WHOA 4GV6A 5J2MA 1BA0A 3SCJE 2ZH5A 1HYSB 3CCTA 5KFOA 4KSEB 4WFBL 3L4BC 2NRVA 3P83D 5C2DA 1SJFA 1IBMF 2O8EA 1RP5A 3TTCA 2HURA 2FC0A 4DTXA 1ZH5A 3QO9A 1EWRA 2IM0A 4HH0A 1KCFA 4HCCA 3M8ZA 1REVA 1S7HA 2AU0A 2QTWA 2G0JA 5M2RA 2UXDK 4BRGA 3MPUB 2DNQA 1WHWA 3KXDA 4J9OA 3OLBA 1Q53A 1PSDA 3CF5L 2V7YA 4M45A 4E7HA 3CJKA 4NYFA 4FCYA 3H3NO 2VG7A 2WBMA 3PW0A 5F3ZA 3PZPA 2ZH7A 2N4CA 1WSHA 4J2EA 3R1HA 4QZVB 2XO6A 3WT0A 3ZSOA 3U1NA 1Q8IA 3VQ6A 2P9KA 3V9SA 4ED6A 3A5NC 3J80Y 1YGYA 1QSSA 4WWSA 1KR4A 4W92B 3GSDA 4BR5A 2GO8A 3N4QA 4OZJA 1RTDB 1CQMA 2C2RA 3UCGA 3BP8A 2O66A 1GT8A 1CZ9A 2FBVA 1Q0NA 1YITS 5J2MB 2V8GA 2RQCA 1Z05A 4JI5F 2OZMA 2IMWP 3IWLA 2BW7A 1GOAA 2ZZMA 1VQMN 1NGEA 3C6UB 2FVSA 3GDQA 2XY7A 2MQLA 5BRFA 4A8QA 2V4JB 4QU7A 2O8EB 4CK1A 1ZBSA 2GAGC 2FTRA 1ZPVA 3FBFA 4BC9A 5E0OA 4DV7J 2JEFA 2K2PA 4MMOA 4BR9A 4DR7J 4CBUA 1VK3A 4CYUA 1X7VA 4CHZA 3CJKB 4ILJA 4E0DA 3TA1A 5D78A 2ATQA 2VG7B 3CDBA 1W2BM 4IKAA 4IRDA 4CZKA 4M3UA 5I3PA 1NJIO 3ET6A 3O4NA 1LWEA 2ILZA 2CQGA 3W61A 4I6WA 3MMBA 2QFIA 2IYIA 2F3JA 3QT8A 3DJCA 3RVCA 3K2YA 3GB0A 4JB8B 4DG1A 4DX6A 5F0XA 1M5SA 2E1AA 2CVIA 4ELVA 2MKIA 1UEKA 1Z4UA 4JI1K 4JI3J 4YB1P 5CAAA 3GJQB 3RBEA 4CFCA 3MR5A 2Y0BB 4GKJF 4GC6A 3DXBA 1JJHA 4A8KA 2EK1A 1NJXA 1B9FA 5GMKa 1GMVA 1TTHB 2OLWA 3HHLA 1KAZA 2F9TA 3ZC4A 1CVJA 4C0OC 4WYLA 4OZ5A 4DR3K 4LY7A 2HQ3A 3Q8YA 4AHRA 1R0CB 2OMOA 2RVJA 5D0HA 4DV5F 2DEJA 3VALA 4DS5A 5AZIA 1DT9A 1KVKA 4I67A 2RUGA 3H45C 2HKEA 4YY3J 4NLVA 4IOXA 3NH0A 1NM2A 2RQKA 4DR5K 4M3WA 4I2PB 2Z0GA 4YN3B 3N79A 1S9GB 2GHWA 1RHKB 3IG1A 4X4RA 4J9VA 2X3DA 4A5AA 4FJ8A 2AZ3A 4ECWA 4ICLA 2CPEA 1J5OB 4L3NA 3MDQA 1T05A 3H5SA 3T5HA 3QBXA 3MMBB 1VQ9N 3ENAA 4OGCA 3IAM9 3ZTOA 3TSUA 3TUIC 3SBTA 4H5TA 2DH7A 2CNOB 1VK8A 4DUZF 5L38A 4MYUA 5HRSA 2A42A 4YB7A 4K4WA 1KTVA 3F73A 2R7WA 1VDHA 4DQPA 1K8KA 1A5WA 1VC0A 1C2PA 3CXCR 4LRFA 2I8EA 4OYBA 2CQ3A 3A8JA 5GMDA 2PYJA 3FC9A 5BRDA 4OO1J 4F3OA 2GJFA 2FB0A 1C0MA 1XC3A 4LF5K 4LF8J 1UTAA 2AGPA 3PFEA 1CC8A 1UEVA 2YJFA 2L08A 2HEKA 1EIYB 3R6MA 4DL3A 3FSYA 2VH7A 2FBTA 5AZIB 1QY7A 3ZT1A 2G2OA 4ZPWR 4CE9A 2HSEB 4BR0A 4NCAA 2MSSA 1LW0A 5KFCA 3W8GA 1OJ4A 3EX7B 3CJBA 2BYCA 4YEAA 3MGJA 3PHEA 3NH2A 3UDCA 2MQ8A 2ASMA 2UU9J 2OFGX 3MFHA 4CGJA 3M2VA 3WX4A 3VQ4A 4ICLB 5LXRA 1WSGA 4JI7F 4ZPVR 3BKTA 1F5CA 3L2VA 1U1KA 3L4IA 3O9SA 2ZC3A 3R1LA 4BDYA 1NG9A 3ASMA 2R7SA 2HNDB 4OPHA 4K0KK 3PX4A 5T7LA 1RACB 4FDFA 3QGGA 1R8AA 3BF4A 5LMUF 2IM3A 3WQUA 4LH4A 4NASA 1WSJA 3TAMA 4DV6F 2QXFA 2E1PA 2B43A 4LR8A 2YX6A 4EBDA 3L3VA 2FLPA 2MJUA 4FPRA 4CRJA 2VQFK 3UR0A 2NQPA 4F7VA 3MECA 1RT5B 2CJAA 4JOUA 1YSJA 1QVGM 2P6TA 3GSIA 4DFPA 3J80U 4NWBA 5HJXA 4FF4A 4DEZA 5AQRA 1PJ7A 3AY0A 2C2OB 3VGVA 1G99A 5K9FA 3VQBA 4FLTA 4PABA 2R7UA 5F0WA 1QAIA 5IXUA 1AYEA 4FJHA 1U6FA 2CGJA 4R0EA 2AIRB 4KHPJ 3M8WA 2ZBQA 4M7XA 2APOA 4RUCA 3D45A 4ZVRB 3GWCA 2C2DA 1H3DA 3BPDA 4JI8J 5KFKA 5ADXH 1F9FA 3V1OA 1VSHA 1FFGB 3HYFA 2H4WB 1Q78A 3I55S 4B1WB 3ZEUA 2QL7B 1RAAB 2R7VA 4F3TA 2KT5A 2Q97A 1LK7A 3HX9A 2B8PA 5T7LB 4BBYA 3G6ES 1F2HA 3AGKA 2V63A 2FD2A 3EZOA 3TAMB 3MEDA 2HHSA 3NF9A 5C10A 2QJ3A 4Y65A 5KG4A 4NYZA 4JI4F 4JI0K 3JAMO 3QICA 4WU3A 4LD0A 4NLQA 5KG5A 4JK8A 3MECB 2RPIA 5DM6Q 4DSJA 1KSPA 1FA0A 3RMDA 1B92A 3OHRA 3MCAB 1IO2A 3QRRA 5GADP 2CJBA 5KFZA 1S59A 1W25A 1YRXA 3R6GB 4Y2IA 5L1LA 4G3IA 3CQYA 5KFUA 1AB8A 2VUGA 7AT1B 2HLTA 1X3NA 4JHDA 3ALYA 1RABB 2UVUA 1JL2A 2F8TA 2DXDA 1NNDA 1WKJA 1PAEX 2PBDA 1WN7A 3PV8A 4CI6A 4ZP6A 5KRSA 3PEJA 4O0NA 4F8RA 4H5VA 1S6PA 5A8WB 2OTJS 3PSIA 5GADU 2HFOA 3DDIA 4K25A 3PX6A 3T1HK 4QU6A 4QWEA 3G82A 1MDUB 1T9XA 1JXBA 4FNIA 1NGCA 4CJ7A 1AXQA 3HTVA 2R8GA 2C3OA 1VQPN 5AQYA 5AE3A 2DJWA 1VSKA 2N7YA 4ZVQB 2BDPA 3V6KA 3UDEA 1OIAA 5TKWA 4Y1CA 1V3RA 1OSCA 5C2GA 4K4UA 4M5MA 3J7ZT 3MPWA 2W8LA 4Y6IA 4UOGA 2ZD1B 3D2FA 1CJVA 1URNA 4KPCA 2AZ1A 1NSPA 1UJ4A 4ILHA 2VFRA 4EIAA 4NXMF 4AQYF 2MQNA 4BR2A 3D6HB 4BS2A 1H0HB 4IEEA 4CJLA 4DR2F 2Q79A 2QM1A 1RUSA 4JHDB 4G9ZA 5HVGA 1RDBA 2QWOA 3JB9k 4V19J 1X9WA 1RTZA 4A8OA 1ZM2A 2OGUA 2OAUA 1RHUB 3MX5A 4KGMA 4YR2A 2DHHA 3OYAA 2IDEA 3SV4A 1S6PB 3P39A 4ED7A 2HLUA 7FD1A 1ZOTA 3FBBA 3W3DA 2P1JA 4NLRA 4CJVA 1XERA 3G82B 3OTOF 1GMUA 4AHTA 1OVYA 3QEVA 1VQ6N 1RILA 2J0XA 4FWQA 3S7RA 4DKWA 5H1SV 3SDEA 1VQOS 2F96A 4BVOA 4KFBB 4M5LA 5DM6L 3X1LB 3PY8A 1B9DA 4MK8A 2CDQA 2E2QA 1WNSA 2B5JA 1R3NA 2AJ0A 4RNHA 3R9LA 3KK7A 3EL2A 2I2YA 2W4PA 4BC4A 4OLBA 1QD1A 3M8SA 4HHJA 3J7YP 5CZ1A 2BM1A 5FPEA 1VQ5N 2L41A 4KYZA 4ZLLA 1ZXOA 4PQUB 1BI4A 2HPUA 1UMJA 4HTIA 4CD1A 4K8ZA 3ZX2A 2EKNA 1ZM4A 1HD0A 1JNZB 3D1HA 4V19S 1YJWN 5AQSA 2WB4A 1HPZA 5LJ3Y 5KFWA 4E89A 4YOUA 3IWXA 1MG7A 3KG1A 1ZETA 2JC0A 2R42A 4YOVA 1SZ2A 2CQPA 2MKHA 2G13A 4LFCF 5B0FA 2PY5A 1JLCB 1VSJA 3PDNA 4QPXA 3QGPA 3J7YU 4L8RB 2D9PA 2ZBPA 4Q8FA 2B9WA 2VOPA 3NRBA 4NA2A 1KP6A 1E4GT 3VF2A 2P9LB 1UVLA 3OJSA 2JLEA 5L9NA 2VKZG 4QIVA 3CJ9A 2HHHK 4K4YA 2DBBA 1U1PA 4JI5J 3G8TA 1NDLA 3CJTA 3MM5A 1KD1T 5CABA 3QFUA 3LGMA 2RKIA 1TMMA 4FF1A 2DPNA 4H0YB 1TK0A 1CSJA 4HEA9 5CHIA 2EX3A 4FLZA 3ICLA 4DPOA 1FKPA 5KOWA 5EX0A 2YCHA 1T02A 3KLHA 3H5XA 1FDDA 4NLDA 1PIEA 2M3DA 4DHVA 4GV9A 2VZ9A 4DR1J 1HNXK 1YI2N 5LL6Z 4TKTA 1SJQA 3J7Z5 4ILGB 2CQ1A 5AQIA 1XBWA 4C98A 2XCAA 1O5JA 2E7VA 4M5NA 1SVDA 2E44A 3QZ7A 2ROGA 4M94A 3P5BP 2AF6A 3EVOA 2EI5A 1TUGB 1F21A 1RWMB 4FOIA 4ED8A 2NRZA 2CVEA 2V50A 4GRSA 1BQXA 3EGWB 2PI5A 4JK9A 2E5LF 2Y1RI 2DGOA 3TAGA 3TOQA 3NEKA 5FDLB 2B9XA 2VFSA 5HATA 4LH5A 3NL0A 3M9OB 1YJTA 3VN5A 1GEHA 5KPTA 1HNZF 1EX4A 4DOZA 5DGAA 5AXKA 3EMTA 1Q81T 3A1YG 3MM5B 5AE1A 3PX0A 3PYFA 4OI4A 4DV5J 2MY7A 1R8CA 2ETJA 4U7BA 2Z1HA 1NK0A 3G71S 4I68A 5EUHA 2V94A 1Q7LB 2FLLA 1FKPB 2WSFC 3KLHB 3CMAS 1N5SA 5RUBA 5KQ8A 4ZPCA 3SAHA 3C8YA 3UPFA 2V8DA 3C6TA 4CHYA 2XLKA 4JI2F 3JTNA 4YDXA 3UB5A 4WYBA 1GNKA 4BRAA 1BQMA 3P4UB 1RKIA 2E9RX 2XHCA 2FSJA 2D0AA 2GQQA 5J2PA 5IWAK 1IVZA 2ZC4A 2F8HA 2F4VJ 1VFJA 1Q82O 2HVEA 2ADCA 2IJNA 5DRKA 2DPJA 1F3VA 3FZ2A 5J1EA 4KH5A 2UUAK 3SQGB 3FGUA 4OX6A 1YAGA 3O6WA 1FEHA 2IMOA 3G96A 2FZGB 3ETMA 2D3O1 1VLOA 2HGNA 3H5UA 2PEBA 3VAKA 2NR0A 1IUJA 3JTOA 4AHUA 4M63A 3MN9A 4CT9A 2B4JA 4IWVA 4DV4F 3O9UA 4OLOA 3GFYA 3D6RA 2J7UA 4WTOB 5T41A 4OI1A 2M52A 4PXCA 4I4BA 2MHEA 1CLQA 1NCLA 4H5RA 2HQDA 4AH9A 5IV3A 3KG4A 4UOHA 1HWIA 2GGPB 2BH1A 1N32F 4KAZA 3LANA 1LXJA 2A2CA 4RNFA 3M2UB 3IKMA 4USJC 1BQMB 2V52B 1IR2A 3UWTA 4JI7J 4EP5A 3D54A 3BS9A 4W5OA 3C19A 4NB4A 4FWSA 2UUBK 5GAEU 3MR2A 3CVKA 1CJTA 1L3TA 2LP4A 1G15A 1TV6A 4DZ6A 4FVUA 4NXNK 3QYYA 1SKSA 3EWGA 1FJGF 5J1EB 1JCGA 4PQAA 1GOCA 3T1YK 5M1QA 3CB4A 3K5OA 1QS4A 1HPMA 4DV6J 2DIUA 3T9ZA 4C8YA 3OY9A 4Y28C 3I4PA 3POTB 5KFGA 3OA9A 2ZOMA 4ZHRB 1RA7A 2NLWA 2EWHA 1TUUA 4EI2A 3UQSA 4XEIA 1FESA 4TVAB 2C28A 2KFYA 1RAJA 3IP0A 5EWGA 4DUTA 5CR4A 5KT5A 2MGZB 4F67A 3O80A 2VA3A 4DU3A 2QSFA 1RDRA 3KVGA 4B1YB 1ELOA 4P6QA 3D68A 3I0RB 4FVMA 5AQXA 1E6VB 2PDAA 4ZPTR 3LDOA 3VGUA 1QUPA 2LXUA 1U1LA 3CHWA 2ZBIA 5IT9O 2GMJA 3R5AA 3D9BA 4OJGA 3QQCD 4B3TF 4K2JA 5EWEA 2DGSA 5E41A 4ZOSA 2ZNYA 2BJ8A 2IBKA 1YVNA 4U7UK 3QDKA 3G0ZA 1JXLA 1XQIA 3IGVA 3LP3A 5L9XA 4J9PA 3L7PA 3AY9A 1S0OA 1TELA 1K44A 4O55A 2J6UA 4QIEA 2IYGA 3B82A 4YP3A 1S12A 2VONA 4AT1B 1FXXA 4KY3A 2QA4S 3WXIA 3SYZA 2KG1A 1HKAA 2BEFA 3THYA 3QIPA 1BMQB 2DB1A 1B4SA 4JN4A 2XY5A 1VQNS 3AVGA 2PN6A 4PG7A 4P7VA 2O3DA 1WWHA 4QOZB 2DR9A 3SAFA 5D4OA 3VQ9A 2XY8A 3WEEB 5B0GA 2BVZA 2R8KA 4GVEA 2O4GA 2RRAA 3SV3A 4FM0A 3QT7A 3DAWA 2FJEB 5ETPA 1J53A 2FPHX 4IBNA 4B9VA 3CIMA 3M2RA 4X65K 3M6GA 2YNFA 4V19X 2CADA 1KDNA 5A2QY 2P9SB 1UFLA 4Q0BA 1JLEB 2W40A 3WZ0A 1M1KO 2B7CB 2FZKB 3DMJB 1G7CB 4C23A 2G0IA 4LVNP 5D0GA 2A18A 3RR7A 3OYJA 2FF6A 5BN8A 1S6QA 1AUDA 1ZAXA 1VQ4N 1NBWA 3O8WA 1EB0A 1VIXA 2GVDB 1VRQC 2BGGA 1U0HA 1H7XA 1UVJA 1PAUB 3VR1A 4B3OA 1QQOA 4UY8T 3BZQA 3SBGA 2H3EB 3SCKE 3J7AP 1YJNS 4ZJOA 1KXPA 2O8FA 4P10A 1VQ7S 4OZLA 3MR7A 3BQ1A 3GOIA 3VGMA 3SI6A 3QIPB 1U02A 4LSZB 2KLAA 3BGOP 2DNMA 2PI4A 4CIOA 2F9DA 4M8LA 4LRDA 1IKVA 2IOCA 4JKFA 1WOQA 2V2ZA 4BG9A 1V4SA 4W5QA 3CMQA 2F8MA 3TX0A 1BU6O 4BRNA 2JLFA 3Q8SB 1YZ6A 1IM4A 2V5HG 1ZTTA 5IOLA 1N36K 3Q0AA 1HYVA 1S4FA 2AYBA 1DTTA 1FFSB 1JNRB 5CA5A 1RZMA 2YPYA 1B0PA 1OPZA 4AQYJ 5AQTA 2OYQA 3AO5A 4CK3A 2BZ2A 2DFHA 5EN1A 1N5VA 4DR2J 1IXKA 4Q0BB 1TKZA 2COLA 2IY5B 8AT1B 2YHXA 2K3KA 5FIIA 4EHUA 4P2MA 1WDDA 4YHHK 2VWKA 1RTHB 3ZXWA 1DLOB 2R7YA 3GYGA 2ZZTA 3KKSA 4QYZJ 1U0HB 3WXJA 3T41A 4X62F 1NKBA 2FC8A 5KFVA 3OTOJ 3WUHA 2P9CA 4O4RA 4LF4K 5LSRA 4CGFA 2QO3A 3HKZD 2RS8A 1Q1KA 3NWGA 1J6ZA 2YKQA 3SK3A 3VERA 5BR8K 2VIHA 2JEIA 1BD6A 1IKVB 5KG6A 1JL1A 4JAXA 5F8JA 1MWYA 4XO0A 4JRQA 3R97A 4ISEA 1O51A 1YJRA 3BDPA 2V2KA 2I5JB 2XMAA 1VQ8N 3TANA 4Z4EA 4ZJQA 1U48A 2CPYA 3M30A 4IQMA 2VBZA 3D2EA 4CHPA 2R2TA 1VSLA 3CMEN 5A6WA 1WEYA 1WHYA 1QLNA 2KVQE 3FZMA 2Z1JA 2DXFA 4KIAA 4Z7CA 1S22A 3FFIA 1N52B 4DSFA 3CM6A 2V69A 1TKDA 4HHHA 2G2YA 1YX2A 4IFYB 2DFFA 4ATNA 3QWUA 3OHBA 1EXQA 5M1FA 1FDBA 1ASVA 1D0EA 3N6MA 4FL9A 1ZAVA 2X6SA 2HOEA 1ILYA 3K5LA 4LFCJ 4FS2A 3TEGA 4JKEA 1YDLA 4DTOA 4Z4GA 3TPQA 2ZH8A 1RAFB 1TU0B 1X60A 4PXEA 2KZMA 2NSBA 2OZSA 4DV7K 1SKRA 1CJUB 1ZM9A 4DR7K 1S1XB 2NS1B 3DN9A 3OFFA 4RO0A 3P1GA 3FFKB 3BGLA 1FRHA 3V6HA 1G2EA 2AEFA 3AVHA 2JJ4D 2XYHB 4M3RA 3FZHA 4UY85 5C25A 1N8RO 5J2QA 3D2EB 1MN9A 3R6LB 2QWNA 2BUNA 1EX8A 4WKRA 3AVNA 3VESA 3KHYA 4KH6A 3R9PA 1IQTA 2GMLA 3JQKA 1FNMA 4IRCA 4JI3K 1IKWB 1HNVA 2ITGA 3CXCM 4FF2A 1X31C 2D74B 1RWWB 3ITHB 3J8AA 4DL2A 2L3MA 2NZCA 1ASWA 1P8ZA 2FSKA 1KAXA 4C1NI 1AW0A 5F2RA 2FDNA 2VICA 4FW1A 1A9NB 2V7ZA 1QTMA 2D0PA 3MM6A 4WK3A 2E2PA 2JWLA 4DQIA 3BEXA 1SUQA 4E7KA 4ZPDA 3C14A 2X6NA 3CCSN 2G2ZA 4F02A 5KFLA 3Q7CA 3NMUA 3AOCA 4WYWA 1D8YA 4U7CA 5D4LA 2BKNA 1FERA 1IBKF 4EP4A 3CJAA 1ZAWA 5M2UA 4YY3K 3OVNA 4ZVEA 5B08A 4DBQA 1HNZJ 4AHSA 2UXDJ 2JWNA 5A2QU 3MAAA 4LFAF 2E1ZA 2EFVA 1GXTA 4ZP8A 4CHNA 1Z6RA 2HQGA 1IKXA 3UW1A 1HFEL 5HQ8A 4FBTA 4OQJA 2OFHX 4ZLJA 1NK8A 2HFVA 3RG6A 1ITGA 4OYPA 3QJJA 2VWBA 2OPRA 3KLIA 4ECUA 2RILA 3KK1A 3PFOA 5HQLA 1WLJA 2CQIA 3IFEA 5DM7Q 3LL3A 4DV3F 2HYIB 3NGKA 5AQLA 4CJWA 1K9MT 1HNVB 1EHWA 1LQ9A 2BX6A 4RWXA 4KB0A 2YWWA 3TNVA 1PC4A 1JJ2R 2FC9A 3E1YA 1WACA 1R6VA 5CD4A 1YJ9N 3SCLE 4FJ5A 2W9BB 2FGOA 4KHYA 4LF8K 2FXUA 1SUQB 1U2FA 4OX9J 1IG9A 1X4AA 3CDUA 5AQZA 4ZTJA 1YG0A 5D3GA 3X3UA 2QEXN 4IOAQ 3WNGA 1F9HA 4NA3A 1WB9A 3NGTA 2J9EA 4I6YA 1X9JA 1WKLA 3FRZA 4MKBA 4KB7A 2WBRA 1T03B 2VASA 3BSNA 3MAAB 5DGBA 4YMEA 2X1AA 1ZS6A 5HROB 2UU9K 3CC7S 3I0SA 4Z94A 3MTKA 3OLAA 1RCOB 3DU5A 4O3NA 4CF2A 3EN9A 3KLIB 2KH9A 3PIPL 3KK1B 1RBUA 1V3SA 4CLPA 2IRYA 3NXZA 3LO3A 3V1QA 1KQKA 4UUXA 4JI1J 5EU7A 4MFBA 2MY8A 3MCNA 3VGSA 1RHJB 3OYLA 4DU1A 2UVWA 1N32J 3UCZP 2YTCA 4NLOA 1X9MA 1RTIB 3KZBA 3CEDA 1DTQA 4WK1A 4I9LA 4OKEA 3HSGA 3IRXA 1VRTA 4HDHA 4NZ7A 4C0BA 4CJPA 3GE1A 1Y97A 5K14A 3N6NA 1N88A 3QLHA 4DLGA 2MB0B 1UZHA 1WC3A 4KGXB 3CCJS 2LU2A 4LSNB 3IO1A 4O3PA 2ZBRA 5D3GB 2Q0RA 4QJVA 2HVDA 5AXLA 3R1XA 2GMHA 1YWXA 2IBOA 1EQYA 3Q8RB 1TZ0A 2D0CA 3S01A 4ZVOB 3F0NA 4C8MA 4OPAA 3TSQA 4GY2B 3VENA 5THWA 4DR5J 4B9MA 2M7SA 1OYDA 4L74A 1S1UA 3KK2A 3J81U 2HAFA 1NRKA 4DI6A 3KD5E 4KHPK 2X51A 5DM7L 3FE1A 4H54A 2VBYA 3ZSZA 2KM8B 4E19A 1U2VA 1SJRA 3FZFA 2J9DA 4JI8K 1KVCA 2KXHA 3R7NB 1IV0A 3V1RA 5M1PA 3MI7X 1U1NA 1M5HA 3KLEB 1S1VA 3CJ5A 3ZSYA 1VRTB 4OJ3A 3QERA 2C2ZB 4HTJA 4BC7A 4B3TJ 3FKBA 3NAHA 4ZVFA 3AA2A 3QLHB 1QM9A 1FK9A 3CCLS 2ZF5O 4NYOA 4IOAL 4MAKA 5BXIA 4BY9C 1Y3KA 4R5PA 4Y3CA 1LKZA 1RAIB 1VSFA 4X84A 4UUWA 2G1HA 4ZKAA 3BJYA 4HVZA 2HS4A 4TQSA 2P9UB 2YVSA 3IC1A 1RBTA 3PRVA 3QB0A 3KTQA 2RAQA 3VQSA 1DGKN 2GUPA 4KQZA 4CLZA 4ZCLA 4IH5A 1WC0A 2P9EA 2O8DA 2RE1A 4ZK7M 1I6JA 2C1EB 1BA1A 3RZAA 2RDJA 2E7WA 3PHTA 2HHWA 2YWFA 4CBWA 1CULB 4YUDA 3NWRA 4E7IA 2P9NB 2FJVA 1XC9A 4PXBA 2J7KA 1NJWA 3NS5A 3GFHA 1GLAG 4WQ5C 3THTA 4J91A 2YKPA 4PKGA 1HQEA 1HBUA 4XH5A 1C1AA 3H46O 1UVNA 1S9EA 3CCQS 1R6YA 1SC1B 3I56N 1S57A 2W2PP 1AUSL 4QBUA 1T6DA 1WTFA 1Y64A 3CJ8A 5F8IA 1FRMA 5C42B 1W26A 4DCPB 2HK2A 1M5PC 1FK9B 3NGIA 1A5VA 4IDKB 3VQ7A 4M3TA 3V6DA 2QLBB 5AQGA 4YOEA 5ELZA 4RBTA 3FEYB 3US5A 3NGDA 1RDUA 3CTRA 4O4GA 1S0NA 3Q8VA 1VSIA 1JJ4A 4QR1A 5AQVA 3GV8B 3C46A 4PKIA 1GMWA 2DGQA 5HMYA 3NOGA 1WOPA 1ZBLA 1WOOA 2O8DB 2CPFA 3RB3A 3MAQA 3VAJA 2YXLA 3IS9A 2BANA 2QLFB 3IR7B 3CDAA 3KNGA 4Y1DA 1LW2A 4RKUC 4D3HA 4LF7J 4KB1A 3DYAB 7FDRA 3R5JB 3FQKA 1XNRF 1RLCL 4NLPA 2HGLA 2IA0A 4EFHA 2UXCF 2ZWHA 1WSIA 1UPPA 1CPZA 1HBUB 4Y0WA 1FF2A 1S9EB 2OHDA 4ED4A 3KUGA 3KHLA 3W63A 3GBTA 3DKDA 4RW8A 3T7ZA 4EYHB 3FZBA 2OEJA 1Q18A 1TUVA 4WU2A 3SFUA 9ATCB 3T6JA 4KT0C 1NHVA 3AJ1A 4HL9A 3O3LA 1V3ZA 1B3TA 3V6DB 2ZJRQ 3TI0A 3OUYA 2YKMB 4MIWA 3I5BA 3OJUA 4X62J 3AVCA 4USIA 2OCEA 3RYLA 1FFWB 4NLGA 5LJVA 1IBMK 1OKJA 1S6OA 4ZCMA 3DXMA 2P9IA 1KTQA 4JNEA 3VQPA 1B7YB 1HW9A 1WUUA 1M90T 3RW7A 3CQXA 4IOBA 4H4OA 4IG0A 2HAIA 3C66A 4K7QA 4GVBB 4LMZA 2IM1A 3IS9B 2BKOA 3OW2R 2LEBA 3RWUA 4LQ9A 1FWLA 3QGHA 2FY8A 3N4PA 4FYWB 4I1TA 2W24A 4DTRA 3RAMA 4I7FA 2IAJA 2DO4A 1RHRB 1B7FA 5BYQA 4HUGA 3R5CA 1H7WA 5C0YA 1P8GA 4MDAA 2DISA 4FLXA 5H9FK 2UV8G 4ILLA 3BREA 4ZVHA 3DLGB 3LPTA 4A4JA 5HQMA 1T9TA 2L48A 4O3SA 1YK9A 3M8PB 3TO8A 2IS3A 2IC3A 2MZSA 4P2XA 3KKFA 2HFSA 5I42A 4ID5A 2VG5B 9RUBA 1UAXA 4JI5K 1NAQA 3OUYB 2W9AA 4BGAA 4JP8A 4LFBF 4QW8A 1QSLA 2W01A 2M8HA 4QS9A 2C2KB 4CNZA 4OX7A 3DXMB 4FWMA 4LREA 2MSTA 1UW9A 3O44A 4CF8A 3LM9A 1PYSB 3S1TA 4Y2CA 3UVJA 4RJVA 1NXIA 1J5EF 4MKYA 2GQCA 2YX4A 1OY6A 1CG2A 2A3JA 3EE3A 4O3OA 3LPUA 2RUSA 5HOOA 2J6SA 5L39A 4BREA 1BE4A 3DLJA 4DR3F 4CJ5A 1NHUA 2MQMA 4ZIWA 2OPPB 5HRNA 2WTFA 1HBMA 1Q79A 2J9CA 3BH6B 2RF2B 4I7FB 1RLDA 2P9GA 2IAJB 3UDLA 3RBXA 1VIOA 2C22A 3H1QA 4O5BA 3CIZA 4DL6A 1DY3A 5C24A 1HA1A 2O01C 4CO3A 3VQ5A 3MM9B 2U2FA 3DLKA 5GAGP 1O13A 1B99A 2HVIA 4GKJK 2XLIA 3CGIA 3D3CJ 3M05A 2ZJRL 1BWFO 3MWBA 3MUTP 1U25A 4I6MA 3KHHA 1FNOA 4ID5B 5EGYA 3FSIA 3W9HA 2UP1A 1X8DA 3DRRB 3NFAA 3N5BA 3T5JA 1EQ0A 4Y2AA 3CD5A 4DV5K 1TL4A 1TFYA 2EC0A 4KR0B 3HPOA 4A62A 1VQMS 2R7RA 4B3RF 3MOZA 1IBKJ 3U9DA 3MMCA 3ENHA 5LJWA 5FLXO 3OPKA 5GAGU 3N28A 4DL4A 1DEJA 1IH7A 3AAPA 4KJIA 1RWKB 5A0YA 2E6LA 4LFAJ 3B6BA 3HKWA 3NY0A 4ED0A 2DNNA 1PJ5A 1LOUA 2G8KA 4ID1A 1SC6A 3ILIA 4IO9Q 1NZAA 4IXCA 3L09A 4H4MA 3U7JA 5FLXU 3SNNA 1P1TA 4PCQA 2CDRB 2DR5A 3ILLA 3THXA 5KT3A 3K8VA 5C24B 4DV3J 4DUZK 2PFDA 2KDOA 2MQPA 3DXKA 2ASLA 3DLKB 1C0TA 2A10A 5K5MA 4PUOA 1MWKA 2BE2A 1EQMA 2PFFB 2FHOB 2DPIA 1FRLA 1HUXA 4OKJA 5CYMB 4I6MB 4H03B 3MEGA 3PKYA 3NG8A 2YWEA 4JV2A 2M0GB 4J9LA 3VGLA 3I8DA 2YHAA 3NF6A 3KLGB 2WW8A 2DNLA 4H4KA 1RWUA 5LM7E 4PYAA 2W4CA 3D67A 3TAQA 3MMCB 2LLZA 4JLHA 5JMNA 1RWOB 1NM1A 5GAHU 3QATA 1YHQN 3TQ1A 4C3LA 4ZS6A 2BW2A 3G6EN 1BXNA 2HBYB 3HVRA 1DBDA 3KWIA 1XR5A 3EZWA 1YZ7A 1ATNA 1ZYQA 2RS2A 1D9AA 3IBCB 4I69A 2N3LA 4OYOA 2ROEA 4H4MB 2EHGA 1GQEA 4OHVA 4JI7K 4RW4A 2UXBF 3UKRA 3HI9A 2PMWA 4KH4A 2J0WA 3THXB 5KG0A 2J8SA 1VQ9S 5K20B 1WSRA 3HFVA 1PYTA 3DXKB 1CZAN 2JVRA 3HHLC 4PUOB 2DRAA 4K50A 2BE2B 4FBUA 4Q7AA 2GZOA 3RRHA 1JKHA 2BJ9A 3F9MA 3UN2A 2E5IA 3TU5A 3ZX3A 1UWBA 1FDAA 3BZCA 5LMUK 3PRDA 1K0VA 1GX5A 4DV6K 3T1AA 3HSTB 1JWWA 3ZCMA 3WHIA 3PJ9A 3JS9A 2Z4PA 5KAKA 3R5GA 3J7YI 3MXIA 4PHTX 4RX6A 1KFDA 4TYBA 4BRLA 3MMAA 2Y1JA 2QYCA 4OPJA 3NGZA 2CGLA 5JLHA 3KJFB 3DI6A 4F0MA 3SCIE 4ZVTB 2H65B 3DOKB 2F1FA 4IO9L 4NI2B 3NHGA 3L7OA 2G8VA 4HLBA 2CWXA 2CJYB 1IR0A 5BJRA 2AJQA 1WKKA 4AD6A 4CVNE 1VCTA 1JQGA 4LQ3A 4RW4B 3CERA 3UKRB 4RR5A 4NLWA 3HT3A 1H1VA 2ACYA 1C6VA 2OEKA 2DY1A 1T94A 1SJ1A 1HBOB 1Y11A 3G6VA 3CUNA 1KFSA 2ZJPQ 4ISFA 2H48B 3TABA 1BIUA 1E6YB 3QSIA 3SPZA 2C2MB 5DDPC 1ICEB 2DGTA 2J8AA 4N56A 3VMFB 3LP2A 3H40A 2E6MA 4KHMA 4E1NA 2A40A 3CJQA 3OS1A 1C1BA 1LFPA 1NK9A 1S10A 4C3KA 3JYTA 3D6MB 4NLUA 4JI4K 3CPEA 4CLSA 2HW3A 3NE6A 1FT8A 1T9WA 5BPMA 1VBZA 1LK5A 1K6YA 4DR4F 3A3PB 3BH7B 1LFWA 4HR2A 1D3WA 1C0GA 1KLNA 5F8NA 2EPIA 4F4WA 1N48A 1Z2LA 4H0OA 1TAUA 2WC9A 1RE1B 3DDKA 4I64A 4JV5F 4DPYA 5C7PA 1HHSA 4PL8A 5CYJA 1H6KX 4LSLB 5M1NA 3V4IA 3WNEA 5D77A 2B8QA 4CJQA 4BC2A 3LGNA 4WJBA 1RFQA 4BG8A 3EM1A 3CIPA 3ATVA 1NGBA 1NLVA 2UUBJ 1BUXA 2F65A 1U0SA 3PLAA 1MWQA 4F9OA 1S4EA 1WUAA 3OTBA 4CEQA 3U1LA 1S7IA 2WONB 2H4YB 2H54B 3R27A 4X4NA