1TKZA

Crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 142
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkzA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tkzA05
2GC8A 1RDDA 3C6TA 1B9FA 5DMRA 1LWFA 1JXEA 1S0MA 2DTUA 3RRGA 3OL8A 4E19A 4F2SA 4CJTA 4EP4A 1D5AA 4DSEA 1RCHA 3DDKA 2BQ3A 1QSYA 4FW1A 2V9WA 3Q8QB 1S5JA 3RR8A 2OYQA 5FDLA 3DOLA 2E9TA 4CERA 3OL7A 4FS2A 2YNFB 3VQ7A 4CIEA 3KK1A 4M45A 5CYQA 1XHXA 5KFCA 5DQHA 3KLVA 5J2MB 5KG7A 4AHVA 3DMJB 4FBUA 3LWMA 1XI1A 3HVWA 3OS0A 3D45A 3PZPA 4BWMA 3OSPA 5KT6A 4ECXA 4NLWA 1UWBB 2J6UA 4J9RA 2FC0A 4Z4FA 2UVVA 1BL3A 3OYEA 5L9XA 3ZSVA 3EYZA 4NCBA 3UDLA 2XCAA 4M95A 5KFBA 1RDCA 4KTZA 4KBIA 3LWLA 2AGQA 1KVBA 3TABA 4HUGA 2FJXA 5F8HA 2ZE2A 4ED2A 2WTFA 3TR8A 2R2RA 3PW5A 4QWCA 4E7KA 4AHSA 2JEFA 4YNQA 2NUBA 2R8HA 1JXLA 1B9DA 4Z4EA 4BDZA 1KLMA 3T1AA 1WSJA 4CJVA 2KTQA 1S1XB 2OPRA 3Q8SB 4O44A 2OPQA 4GMJB 3QO9B 4EYHB 4KB1A 1RT1B 3EPGA 4J9KA 1VSDA 2Z1IA 4KHUA 3AVMA 4O3PA 3QEVA 5EDWA 4CEQA 1ZBFA 4FJNA 3BQ0A 4ECUA 1NJZA 4H4MB 2YNFA 1S6QA 3VQ4A 1RNHA 4K50A 4YFUA 5C24A 3BQ1A 4IBNA 4ZPCA 1X1PA 4CEZA 5J2MA 5EWEA 3CJ3A 5DG9A 2R8KA 3QLHA 5F8MA 2UUTA 3LZIA 4IQXA 3NF8A 1BISA 5J2QA 3JYTB 3H2LA 3ZSOA 5K14A 1TL1A 3LPTA 3CYMA 3L2WA 4M3XA 2VA3A 4Y1CA 3TAPA 2O4IA 2V0NA 4HYKA 3AVHA 4J9NA 4O0IA 2OPSB 1S9GA 3THVA 2DFHA 1WN7A 4WE1B 4NYNA 3F9KA 4DTXA 1HMVB 5F9LA 4Q43A 4FK2A 4ICLA 1NHVA 3U6FA 3C6UA 3GYNA 4CHYA 4FLYA 3RB0A 2OPQB 4ICLB 4B8CA 4QAGA 3OYGA 1ZBHA 4CGDA 3CDUA 4KO0A 4Y1DA 1C1CB 5KT7A 4FZYA 5KT4A 4O0JA 4C8KA 1NK5A 4CF0A 3GIKA 1UA1A 2F8TA 4J2EA 1RYRA 4KB0A 2B6AA 1S10A 4OGEA 2D0AA 1UOCA 5HRPA 4DF4A 4RNFA 3OL9A 4QW9A 3K5NA 4ZTJA 2FBXA 2OPPA 1VSEA 1ZTTA 3SI6A 2C22A 3RB3A 4CJPA 4DS5A 5KFEA 3TANA 4CJFA 3PX4A 4IG0A 4RW8A 3MECA 4HCCA 1TL1B 1LWCA 4BWJA 2D0BA 4CFBA 4N76A 1LAVA 5L1LA 2XO7A 4DG1B 3ZT3A 1IKWB 2ITGA 3SQ4A 2OH2A 3CDWA 2D5RA 2R7YA 3CDEA 4DF8A 2QKKA 3I8DA 3S3MA 3AO4A 4F4WA 3M8RA 1QQCA 3A2FA 1JLBB 1S1VA 4IG3A 2EC0A 3KHRA 1LV5A 2Z1HA 4DQPA 2FBVA 4KTWA 4URQU 1NKBA 2GBZA 4EZ6A 4WFXA 4K4VA 4W5QA 1CZBA 3LP1A 3HP9A 4OVLA 1KFSA 1CZ9A 2E9ZA 1SUQA 3VQQA 1RT3B 2BRLA 5KI6A 4ECRA 4I2QA 3NGIA 4KHRA 4BE0A 2HHTA 1U49A 3M9MB 1JLAA 2Y1JA 4CF8A 2FJWA 1BIZA 2AJQA 2O5DA 2WHOA 4MKBA 2G8HA 5KG5A 4Z4GA 3MEEA 5J2PA 4K8ZA 3MR6A 1T03A 1LW0B 1TKZB 4RNNA 4ED0A 1RA6A 5KFLA 1C0UA 3HJFA 1B92A 2HHWA 4JV0A 4ED7A 4FLUA 1NKEA 5HROA 4CJ4A 4RW4A 1UAXA 4KRFA 4FLZA 4C8NA 3TWHA 3ZT4A 1O1WA 5KFTA 3NF6A 2X6NA 4KHNA 4B08A 1JLBA 5J2NA 5CYMB 3WNGA 4UQGA 1VSMA 1U04A 4DU3A 1A5XA 5J2NB 2E6MA 3KLIA 2W8LA 4KHYA 4O55A 1TKDA 4FJHA 4CHZA 1HRHA 3SFUA 2ASDA 3KK3A 2B5JB 1EP4A 1RILA 1SL0A 2QKBA 4LSNA 1HPZA 2WOMA 2W42A 4RW7B 4FJ7A 1XC9A 3KK3B 3V9XA 3KHHA 4LSNB 1RBRA 3OLAA 2AX1A 4I2QB 2WOMB 2Z1GA 3BDPA 2P5OA 4IR1A 1TK8A 3HPGA 2YKNA 3D0PA 2EHGA 3CO9A 3I0RB 1ASUA 1CXUA 4NCAA 5KRTA 1J9AA 5CZ2A 2IOCA 3MR5A 1TKXA 4XIUA 5KFWA 1K6YA 1IKXB 3ZT0A 1S0NA 4J9QA 3IAYA 3BSCA 3KHLA 2VG7B 2XY5A 4H4OB 4MIBA 4HKQA 2DPIA 4KAZA 1WLJA 2XY8A 3ZSWA 4M41A 4O4GA 4ZHRB 2E6LA 3QESA 2XI2A 2KW4A 3HKWA 1FKPB 4JRPA 2XY7A 1U09A 2G8KA 1ZBIA 3SFGA 1NJYA 5J1EB 2XC9A 4LD0A 4CEOA 1RAJA 3I5CA 4NLYA 4F3OA 1C0MA 1EP4B 2B4JA 4TQRA 3WNHA 4LSLA 4XPEA 2I5JA 3BJYA 4DL4A 4OL8A 2D3UA 1Q8IA 4NLGA 4AH9A 4CCHA 1T3NA 1NHUA 4OPJA 1DLOB 2W9CB 1N5YA 2AQ4A 4LQ9A 3DLEA 2HNDB 4BACA 3QEPA 2UVUA 5L1JA 2BE2A 3P83D 1N5YB 4EZ9A 4KKOA 4DL3A 3TAGA 3V1RA 4ECWA 2HMIA 1HNIB 4ECVA 3OYMA 4PQUA 2RKIA 5HBMB 3G86A 3SV4A 4NLPA 5SZTA 1JKHB 4CK3A 1HNIA 2B43A 1HQUA 1WNSA 1C0TA 4ZP6A 1S9FA 1Z4UA 3NH1A 3DOKB 4R5PB 1NJXA 3H4DA 4N5SA 2R2SA 4QWEA 4FJXA 4O5BA 1BQMA 3I0SB 4KSEB 4R5PA 3VQ8A 1KSPA 4FYDA 1IH7A 3T5JA 3P5JA 3V6JA 1JL1A 5CYQB 4JV1A 4CFAA 4R0EA 4CJQA 4FLTA 4LH5A 5KT5A 3B6PA 4PUOB 4QCLA 1ASWA 4FM2A 5KFPA 1YTUA 4JS4A 3TAMB 4EBCA 4FK4A 1REVB 2Q3SA 3ZCMA 1FXXA 5KFFA 2ZD1B 1TAQA 5J2QB 3EZUA 3IGVA 2IM2A 4MH8A 3PX6A 5E41A 2JEGA 4K4UA 1VK0A 1YT3A 3HP6A 3NDKA 1D9DA 4CJSA 1EKEA 3CJ5A 4DFKA 3NAHA 4B3OA 3BGRB 2XWYA 3KLFA 4DTUA 1Q9YA 2LSNA 4KHWA 4DS4A 1NJWA 3KOAA 1BCOA 3F73A 1S1TA 4KPYA 2Z1JA 5F8NA 3PHEA 4DFJA 4DSIA 1RDBA 3NE6A 4I7FB 5HP1A 3HT3A 4KO0B 1MMLA 3QO9A 3VQCA 3QINA 5KFMA 4CF1A 2J6SA 3PR5B 3KD1E 4TYBA 2JEIA 2BANB 3FQLA 2F96A 4NRUA 3NGZA 4TYAA 2B6AB 4NLQA 4B9UA 5KFJA 2O4GA 4HHTA 4RZRA 4IFYA 3QGGA 2R2UA 4DQSA 2D0CA 4IFYB 4CIFA 3OS2A 3ULDA 3QLHB 2XI3A 4HTUA 4IG0B 3FDSA 3K5MA 3QETA 4N47A 4G1QB 3JYTA 4Y2AA 3HM9A 2HWIA 2ASJA 4R8UA 4G1QA 4NZ0A 3T5LA 2JGUA 3QNNA 3LANA 3AV9A 1VSKA 4M3RA 4I2PB 4TN2A 3RB4A 4O44B 5I42B 1S1UB 1C1CA 2PYJA 3IGNA 1RT5B 3CFOA 1X9MA 2FLLA 2HHSA 2KFNA 3LALA 3AA5X 1KCFA 4RG8A 3CQ8A 4CF2A 5D3GA 2AX0A 2WK4A 2YHAA 3VQPA 4AILC 1SUQB 2HAIA 4O4RA 1NOZA 3ALYA 3KLGB 2J6TA 5C25B 3DLHA 3V4IB 4M3YA 4EBEA 1LAWA 2XY6A 4M3UA 4F8RA 3CJ4A 4ECQA 3KKRA 1NOYA 2D7SA 2V4RA 3Q8RB 4Q0BA 1JLFB 1NK6A 2VWKA 4NLXA 3H98A 4PWDA 5KG6A 1N48A 3OYCA 4WFZA 4K4YA 4KFBA 1JLCB 2YNHB 1RT2A 5DG8A 3OYIA 4CIGA 1DTTA 1VRUB 1JLCA 2YNHA 5F8JA 2CJQA 4CGHA 3RBEA 2IA6A 1RBTA 3PJXA 2IM0A 4W5NA 3NAIA 3P1GA 3PW7A 1TK0A 2G8FA 3T5HA 3VQBA 1RDAA 3NGYA 2HVHA 3QEIA 3OYBA 1RT5A 1FKOA 3OVNA 3T3FA 2BDPA 4IG3B 3QIOA 4ED8A 1HQEB 1W25A 4GW6A 3RBDA 1FKOB 4ZP8A 3NBPB 1EX4A 4FJIA 4GC7A 3AVNA 3M8PA 3O4NA 2DFEA 4KREA 2A1SA 5FRMA 5KFGA 3G6YA 4O3NA 3KLGA 3HYFA 4IR9A 4Q5VA 1LW2B 4EYIB 3NF9A 1WAJA 4DTSA 3S9HA 4ELTA 1T03B 3RMAA 4YR0A 4XPCA 1S97A 2HVIA 1TKXB 2R8IA 3LAKA 1NNDA 1QAJA 5HROB 3ZT2A 3CIZA 3IS9B 2DPJA 4JLHA 1L3UA 4CJLA 4Z4IA 3CFRA 4F2RA 3VQ5A 4FM0A 5FROA 4CJWA 3LP0B 5CYMA 1KLNA 4J2BA 3LP0A 4MK7A 3RB6A 2HHUA 3L2RA 1KTQA 3SUNA 5C5JA 3M8QB 4CEBA 1UA0A 1HQEA 3KJVA 4Y2CA 4Q8FA 4MFBB 4CHOA 3KLIB 3CM5A 2VG6A 2HHXA 4I9LA 3V9UA 4AHCA 3ZT1A 2RPIA 3ISND 4KV8B 3UQSA 4CGGA 4RW6B 3KLHA 1D8YA 1QE1A 1TVRB 3C95A 1DLOA 1TAUA 1JLAB 4YQWA 3QZ8A 1QE1B 2OA8A 1TVRA 3K2PA 4EO8A 4DQQA 5C42A 3TI0A 3MF5A 4KKOB 2FVPA 3K58A 5KFVA 2F8EX 3DM2B 3MAQA 2IAJB 3TQ1A 2YKMB 2ILZA 1BQNB 3SJJA 2BGGA 4B9NA 1JKHA 4O4GB 4ZHRA 1S9EA 1ZBLA 5KG0A 3DLGB 1BQNA 3DOKA 3DLKB 1N6QB 1DTQA 3IN5A 3RAXA 4J9OA 4DL5A 2AWZA 2ATLA 3TAQA 3O3GA 2XRIA 1N6QA 1TL3B 4URSA 3SV3A 1EXQA 2R2TA 2UVRA 4M94A 4ZVHA 1A5VA 4WZMA 4TSXA 2GIRA 1VSIA 1QHTA 3JSMB 1A5WA 1RTDB 4TY8B 4MK8A 4Q8EA 1T05A 4DTNA 2XCPA 3H5YA 3SUPA 3UR0A 3LP3A 4DU4A 2WRMA 3TAMA 4AHRA 4KHSA 1Z25A 4ZPDA 4CJ5A 2ZD1A 4PY5A 4IFVB 4BDYA 4B8AB 1XR5A 3CM6A 3H5UA 4MQ3A 2BE2B 4KE5A 1S1WB 4K4TA 3E01A 3N6MA 2RKIB 5HBMA 3QEWA 4YMEA 3ITHB 1R0AB 4HCBA 4J9PA 1T7PA 3KLFB 5T14A 3BSNA 3PR4A 3AO2A 4J2AA 2P1JA 2HB5A 4E89A 1NK4A 3KLEB 2WONB 1BGXT 3EY1A 3V81A 3AA3A 5KFRA 4HUFA 4CGIA 3EPIA 3NL0A 4Z0UA 4F4XA 1RT4B 1RBVA 4OPKA 1IKYA 4TQSA 1TL3A 4ZMMA 1FKPA 3PW2A 2FVSA 3DI6B 3RR7A 1I3AA 4FLXA 2BANA 2IC3A 5KFKA 1U47A 3MFHA 2IDOA 3RRHA 3N6LA 5C24B 4B9MA 2HNYA 3MEDB 4CEFA 5L1IA 1Q9XA 4HVJA 1REVA 4OKEA 2RF2A 3ISNC 2G8IA 2W7OA 3H40A 3V1QA 4WYLA 4FLVA 3MEGA 5KFQA 4ED3A 2UUWA 3SI8A 2RN2A 4YR2A 1RTIA 3TARA 3E01B 3BGRA 3RMCA 2D3ZA 2ZKUA 1R0AA 4DSKA 1QTMA 4CEDA 2OPSA 4NYFA 3V9WA 4CFDA 3V9SA 4TY9A 3WNEA 1EETB 1QS4A 2WONA 3OYDA 2PY5A 3V81B 4CK1A 5I3UA 2KFZA 2QE5A 3LP2A 2IMWP 1TKTA 4Q44A 1RT4A 1Y97A 3I0SA 4M3TA 3G6XA 3HVRA 1KVCA 2YNIB 1GOCA 2XGPA 2V4QA 4DL7A 4DEZA 1YVUA 3VQDA 1J54A 4FJMA 4K4SA 4AHTA 4IRKA 1QAIA 3ZSXA 1RA7A 3H59A 4RUCA 4ED1A 4KHQA 2JEJA 4LQ3A 4E7IA 1KFDA 5JS2A 4NRTA 3AVFA 2E4LA 2RF2B 3KIOA 3UIQA 2R8GA 5K14B 1JL2A 2X74A 4EP5A 3TAEA 2JC0A 3SYZA 3DRRA 4C8MA 4DSFA 1BCMA 3IG1A 3ZSQA 4FJLA 3G10A 1IM4A 4IRDA 5KFSA 1N56A 3O4QA 1S9GB 3IG1B 4ECSA 4ED6A 4Z4HA 3OYFA 1RT2B 2VWJA 2ZE2B 3C6UB 2D41A 3AVGA 4GC6A 5KFZA 5HRNA 4QOZB 4Y34A 1KLMB 1ASVA 4IKFA 1KRPA 3SQ2A 3OJSA 4AHUA 3OYAA 4I2PA 4JS5A 1TV6B 1TKTB 2HNZA 1RDRA 3SPZA 4TXSA 5D3GB 3U3YA 5FRNA 5HP1B 1D1UA 3DYAB 1JIHA 1VRTA 4NYZA 3M9NB 1SH0A 2YNIA 4ZPBA 4CHQA 4ZVFA 1S6QB 3TAFA 3KMQA 4ELVA 3AVKA 1NKCA 4E7LA 3IRXB 4MK9A 2IM3A 5KFDA 3AVLA 4WYWA 3CG7A 4DL6A 3H5SA 2BRKA 3H4BA 2HHQA 3HXMA 4C8LA 1LWCB 4DL2A 1LW0A 4U7CA 1TKZA 1JXBA 3NHGA 3KMSA 3GILA 4NCGB 1VSFA 4G3IA 3IS9A 5HRSA 5KT3A 1BI4B 1VRUA 4CGFA 4E0DA 2ATQA 1NK9A 1SKWA 3K5OA 3OSNA 1RTHA 1U45A 3NMAA 1BI4A 4DG1A 3AA2A 2X6SA 3PUFA 1YTAA 4XO0A 2GUIA 4JV2A 3NKYA 1C2PA 2R8JA 5I42A 3RWUA 1TV6A 2HNZB 1K1SA 3RTVA 1NK7A 1X9WA 4YP3A 5CZ1A 1S1VB 1JX4A 3CVKA 2P51A 2ALZA 3VQ9A 1VRTB 1ZTWA 4N41A 5KT2A 5KG2A 1BHLA 3AO1A 2VG6B 2CKWA 4CECA 4IOBA 3QNOA 2YHBA 4M3WA 3NH0A 3AVCA 5DLFA 3MXIA 5DGAA 2FVRA 2JC1A 4Q0BB 3SQ0A 4OKKA 2W9AA 4RNOA 3KK2B 3CFPA 3NH2A 4CF9A 4KHMA 2IAJA 4J9SA 2YKMA 2KZMA 3T5KA 4O3SA 1C0UB 4MKAA 3L2QA 3QIDA 2WB4A 3K5LA 1DTTB 2F8SA 1DTQB 4RW4B 3OLBA 4B9TA 4K4WA 3SZ2A 4GVMA 3K57A 3V6KA 1SKRA 3HL8A 4DTJA 1TQLA 3G0ZA 1I39A 3ZSRA 4HUEA 5EU7A 2HWHA 2ILYA 4RNHA 3ASMA 3QERA 4WFYA 3AO5A 2RDJA 2HW3A 4OGCA 4DMNA 2C2RA 3HVTA 1VSJA 4TY8A 5KFOA 3KJVB 3LDSA 4DSLA 1HNVA 4RW6A 1X9SA 4B9VA 4IDKA 3HPOA 1LW2A 1KVAA 2FBYA 3CJ0A 1U48A 1HYSB 2C2DA 4O3QA 3FFIB 3KLHB 1RTJA 1BIUA 2KQ2A 3DLEB 3DM2A 5DQIA 3B6OA 4OKJA 3K59A 3OJUA 4M3ZA 3QEXA 4NLTA 4PQUB 4JUZA 5C42B 1SL1A 5EUHA 1IKVA 4QWDA 5KFUA 3KLEA 2QXFA 2VG7A 2FVCA 5DG7A 4EO6A 5KFNA 5KFIA 1SV5A 4J9LA 3DLGA 3QIPA 3PY8A 4FW2A 2W8KA 3GV5B 1BQMB 3DLKA 4BE1A 1IKYB 4OJRA 2WCXA 2BQRA 1S49A 4DQIA 3GIMA 3LAMA 3DRPA 4EBDA 4WZQA 1RYSA 3LZJA 1N4LA 3FRZA 3M8SA 3WNFA 3MEDA 4MFBA 3PX0A 5J1EA 4FZXC 5F9NA 4X2BA 3MR3A 3BR9A 4FZZA 4DFMA 3RMDA 2IJNA 1KHWA 1IG9A 1T05B 3SPYA 2ETJA 3VA3A 5KTQA 1S1WA 2YKNB 3GV7B 3U3GA 4FJ8A 3AVIA 3AA4A 1RTJB 5F8GA 1U4BA 1WSEA 2BQUA 1TP7A 4RW9B 1HQUB 1GX5A 1ZETA 4LY7A 4H4OA 3HK2A 3ZSZA 1HARA 1LWFB 3V6HA 5KG1A 3KD5E 4FJ9A 1SV5B 5KGXA 3QIPB 1XWLA 5EWGA 1CLQA 1YVFA 1GX6A 1CXQA 3KK1B 2C28A 4FBTA 5FDLB 3N6NA 1S48A 3DOLB 3DI6A 4FS1A 2IM1A 4DU1A 3KNAA 2IC3B 4YR3A 3AVAA 4W5OA 4IH7A 1TK5A 1RTDA 1ZYQA 4W5TA 4IKAA 2G8UA 3PW4A 2W9BA 4PUOA 3S3NA 5SWMA 2PZSA 1WAFA 4K4ZA 2W9BB 1Z26A 4CJ3A 4B9LA 4QPXA 4CJRA 4NLVA 1QSLA 3DRRB 1XR6A 4TLRA 1IO2A 3TVKA 1SL2A 2QV6A 3FSIA 3QGIA 2RDIA 3NGDA 4B3OB 3H08A 3CJ2A 4PA1A 1NK0A 1RTIB 1S6PA 2A1RA 2FLPA 2HMIB 4NLSA 1G15A 4DLGA 4JRQA 3C6TB 3O3FA 1S1TB 1S6PB 1KHVA 4ZVEA 4NLOA 3T19A 2DFFA 4WXOA 3M9OB 4MIAA 3MTKA 1S0OA 2BR0A 3E51A 1K1QA 1HYVA 1S1XA 2OPRB 4K8XA 4DTOA 1W0HA 1C1AA 4CJEA 3D28A 4FXDA 3LP2B 4ID1A 4I7FA 3PW0A 4E7JA 1J5OB 4LH4A 3HSTB 3I5BA 3V1OA 3AO3A 3BQ2A 1WSHA 3UPFA 3IRXA 1L3SA 1GOAA 3DMJA 4F4YA 1GOBA 5C25A 4I9QA 3V4IA 2QK9A 2G8WA 3AVJA 4FCYA 2EX3A 4FJGA 3SQ1A 4F50A 2IBKA 3H5XA 3PJWA 1JLEB 2AU0A 5F8IA 3L3UA 3L3VA 3KHGA 4J2DA 2W7PA 3OYNA 4EEYA 1JLEA 3MFIA 1IKWA 3L2VA 1HMVA 4E3SA 4URGA 3S3OA 3EZ5A 4R8UB 4FJJA 3GIJA 4J9MA 4CFCA 3HPHA 1EETA 4N56A 1S1UA 1W9HA 3RMBA 2HHVA 3OY9A 5KFAA 2AGOA 3GV8B 3HVAA 4BDPA 5I3UB 4F4ZA 3OHBA 2Y1IA 1RT1A 4ZPAA 3NCIA 1JLGB 3VQ6A 1HYZA 3FQKA 1HJRA 4NLDA 4OLAA 4ZVGA 4BE2A 3L8BA 4H4MA 4KI4A 1JLGA 1SH2A 1J5OA 4FLWA 4H8KA 5EWFA 4U6PA 5JUMA 1TGOA 1SH3A 1WSFA 4ECYA 1VSHA 4QWAA 4DSJA 2OPPB 4DWIA 4ID5A 1VSLA 4CEEA 3HHKA 2GIQA 5F8LA 2UVWA 1JLFA 4H54A 4IRCA 5DQGA 1MU2B 4F3TA 2IS3A 3MECB 2VA2A 1WSIA 3AVBA 4CJUA 3BREA 1MU2A 3OHAA 4FJ5A 5KG3A 5KRSA 3KKSA 1D9FA 3OS1A 2C2EA 4IH6A 1JLQA 3SUQA 5JS1A 1RTHB 5HRRA 4B9SA 3BSAA 3O3HA 4E1MA 4RNMA 1JLQB 4NCGA 3QZ7A 2X78A 3SUOA 3OYLA 2OZMA 4KFBB 4WE1A 4KTQA 4QW8A 4DTPA 4RUAA 4CEAA 2YNGA 1T94A 3OL6A 1WSGA 4NLRA 4Y3CA 2ZQBA 3DYAA 2G8VA 1ZBUA 3M8QA 3RAQA 3M8PB 1XHZA 4DLEA 3SCXA 4ECTA 4WXWA 4DTMA 4C8OA 1J53A 1RT6B 4CHNA 3VQSA 1SKSA 3VN5A 3PVXA 3NBPA 4FVMA 3LP1B 1RT6A 1ITGA 4IDKB 4Q45A 1C6VA 4CHPA 4ID5B 4KV8A 3PO5A 2FVQA 4L8RB 3MEEB 2OZSA 4CE9A 3BSOA 1CSJA 3KK2A 2FLNA 2FJVA 5KFHA 4RW8B 1RBSA 5KGWA 2P5GA 5JXSA 1FK9B 1OS5A 5J2PB 3LPUA 4PWDB 1FK9A 4ZP7A 4OLBA 1WNEA 1D0EA 4E7HA 1L3TA 4ZTFA 1NK8A 3ICLA 1QSSA 4CK2A 1QUVA 2YNGB 4DQRA 1L3VA 1XR7A 3VQEA 5HLFB 2IJFA 4ZP9A 3MXMA 3CWJA 4Z4CA 3DLRA 4NLUA 3HVTB 2XHBA 2B5JA 5T7BA 3DRSB 2PYLA 1HPZB 4RU9A 3Q8PB 4F4KA 3SNNA 5CY4A 2I5JB 1LWEB 2VG5A 1RT3A 3KTQA 5KG4A 3G6VA 3NFAA 3OYHA 5DGBA 3GIIA 4K4XA 4E1NA 4RW7A 4CESA 3NAEA 4IFVA 2W9CA 4FM1A 2E9RX 1IKXA 3FFIA 3DLBA 3ITHA 3MXJA 4QWBA 4W5RA 2XGQA 2I1RA 1RT7B 4DTRA 4KAIA 3HO1A 1C0TB 3VQAA 1IKVB 4O3OA 3QGHA 1RT7A 1S4FA 4M42A 3V6DA 1S9EB 3C94A 1C1BB 2FBTA 5L1KA 3V6DB 3ZSYA 4KB7A 1C1BA 3PV8A 3MR2A 2AGPA 5HLFA 3D5MA 1T8EA 3VA0A 2KZZA 3I5AA 4FJKA 3V9ZA 4CJKA 4KI6A 1I6JA 3DRSA 3DRPB 2DY4A 2ASLA 2HNYB 2JLEA 3L2UA 3OYKA 3OYJA 1LWEA 2VG5B 1HNVB 5KFXA 5KFYA 4ECZA 5DK5A 1F21A 3JSMA 4O3RA 4LSLB 3GQCA 1UWBA 2HNDA 4FK0A 4ELUA 4CGJA 1HYSA 3MEGB 3I0RA 2IGIA 5DLGA 4DFPA 1L5UA 1RBUA 4RW9A 3NF7A 4IH5A 2GV9A 2YV0X 3QYYA 3PO4A
chains in the Genus database with same CATH superfamily
1P9QC 2AIRB 3NLCA 1HL6A 4HTLA 5JVHL 1S0MA 4F2SA 4UOCA 2UXBK 4LF1A 3GB0A 2OMOA 3E3XA 2J7UA 1LQ9A 1RCHA 3DDKA 3THXA 2V9WA 1AB8A 3AH6A 5GAEI 2FHMA 3TX0A 3H2VE 4DV3J 5K8PA 4CIEA 4OYIA 4C11B 4OHVA 2GTDA 1P1LA 2BE9B 1Q7YT 5J2MB 4AHVA 5A6WA 1Z2LA 1S99A 4PKHA 3OS0A 4UOHA 1YSJA 1O6XA 1LK7A 3C16A 2XMWA 2DXDA 3MM8B 3OYEA 2DHGA 2FZCB 2MGZA 3EYZA 1Q7YO 2XCAA 5KFBA 4KTZA 2AGQA 3TABA 2U1AA 2EG2A 2WTFA 2R2RA 4E7KA 1RP5A 3CCZA 4G1PA 4YNQA 3H3NO 4C4WA 3T1AA 2KTQA 2OPRA 3Q89A 2OPQA 3UKUA 3QO9B 3FZKA 3QAUA 2V63A 1RT1B 3P6YC 2Z1IA 3RSEA 1N0UA 2Q43A 5EDWA 4CT9A 3G4SN 3U1LA 2L41A 4ECUA 3UW1A 3BO4A 1S6QA 4FVUA 2XMJA 2ZGZA 4DV1K 3R1XA 4IBNA 5J2MA 3DAWA 2VODA 4RL1A 3CJ3A 5J1NA 1HUXA 4OX7A 3HHNB 2I7NA 4IQXA 3VERA 2ZBQA 2EWSA 4ZOSA 5AQXA 3CYMA 2VA3A 1W7AA 3WQPA 4C0HA 1HWJA 4HYKA 4A8QA 4J9NA 2OPSB 2CQIA 3CCJS 3UVJA 4WE1B 1EIYB 3KUGA 3GYNA 3OTEA 1N32J 5A8WA 2MKHA 4FWKA 2OPQB 3UKUB 3HMJG 4CGDA 4KO0A 1C1CB 3W61A 2F4VF 1NK5A 4CBWA 3GIKA 3UCUP 3CC2S 2CQHA 3JXUA 4OIXA 2B6AA 3IM9A 4OLPA 4IO9L 4RNFA 2M7SA 1GLBG 4M63A 3OL9A 4QW9A 2A41A 2GFFA 5CXTA 4OQJA 3BUZB 2QW9A 2OPPA 3SI6A 1Y5IB 3DHWC 1NBEB 3PYFA 2VYPA 4IG0A 2DYAA 5ETSA 4RCHA 1UVMA 4A48A 4U7UD 4BWJA 4K0KK 2F4VJ 4M7YA 1SVDA 3IDHA 3MR7A 2XO7A 4DG1B 3ZT3A 1IKWB 2IHR1 3MCSA 3ENHA 4KH4A 3MAAB 1YJRA 2RT3A 4DF8A 4CZEA 4OZLA 3J8AA 3S3MA 3R5GA 4ISFA 4DR4K 2VQFJ 1QQCA 3A2FA 1JLBB 2EPIA 3G9CA 1BWFO 4YB7A 2BXJA 2MKJA 3QRQA 3R3TA 1NKBA 4EZ6A 4WFXA 1Q0NA 4K4VA 4USVA 1LOUA 4MMOA 2E1ZA 2X1FA 2UV8A 3F2KA 3VQQA 1RT3B 1VOMA 5ETPA 2BRLA 2DR6A 1WDDA 3NGIA 2XZDB 4C1NK 4CO3A 4BE0A 2HHTA 2DGSA 2VQFF 2G8HA 5KG5A 1S76D 3MEEA 4P10A 3CC7N 3MR6A 1T03A 5F2RA 3UD3P 3WT0A 3A5LC 1ZC6A 5A8KA 4B3TF 3ETOA 4AXJA 2GEMA 2CPHA 4CJ4A 4ZLLA 2ZZNA 3T1YJ 1UVKA 3TWHA 3WIVA 1NB7A 2CADA 3I6PA 4B08A 2L9DA 1KKHA 4DV2F 4O23A 4OX9F 3HKZD 1A5XA 2W8LA 4BRIA 1ITPA 1TKDA 4FJHA 3TJAA 1HRHA 1K9MO 4DPOA 2C2OB 4LSNA 1HPZA 3SQGB 3OR1A 2BV3A 3LF0A 3KK3B 3KHHA 4LSNB 4LF4F 2WOMB 2BJEA 3K2YA 4IR1A 1TK8A 2I7PA 2YKNA 3D0PA 2E7WA 3CO9A 3I0RB 4G1IA 1CXUA 1J9AA 5CZ2A 2B4PA 5D4NA 5KOWA 1K9MT 1TKXA 3U4LA 1S0NA 3IAYA 4MYTA 3KHLA 2OEJA 5IT9U 1QUPA 2Z2ZA 3FZLA 4KAZA 4DOZA 1YGYA 4DPYA 2XI2A 5FPNA 5K8OA 2KW4A 4F3MA 3J7YI 1FKPB 3OTOJ 4JRPA 2IDLA 5FLXU 1DY3A 2KFYA 3Q8VA 4C0OC 2GJ2A 4WK3A 5D0EA 3GYGA 2YJEA 2B4JA 3MN5A 3QJJA 3QQCD 2J7KA 4NLGA 1P8GA 3TSQA 4DHVA 1NHUA 3P4IA 4CLUA 4ZJLA 2FLOA 3UKRA 1BWVA 2QA2A 3QBCA 5JLHA 1Y00A 4B3RJ 1RAGB 1X5TA 4EZ9A 2QLWA 4YOTA 1ATRA 1I5OB 1NXIA 4ECVA 1V5VA 4X66J 2E5HA 3GSDA 4NLPA 4PG8A 3GE9A 1C0TA 3BBBA 4R5PB 3AT1B 4A2AA 3W62A 3MPWA 4R79A 4N5SA 4QWEA 4M5MA 3TEGA 2H65B 3L3CA 3CCLS 4KSEB 4R5PA 2QA4G 3KG1A 1IH7A 3DCAA 1WHVA 2UXDF 4ETZA 3V6JA 1RE1B 5CYQB 2QLXA 4KR0B 2FSKA 3MM9B 1RI7A 3PACA 1IJFB 2N3LA 4CP5A 5C10A 4PUOB 3ZEUA 1AYEA 4EWTA 2AJ1A 2YHXA 2DR7A 2LFVA 4I0WA 3DU6A 4JS4A 3H42A 3TAMB 3ZCMA 1RWKB 1EAYC 3BH6B 3CCVS 2HBYB 4JV5J 3ZX2A 2IM2A 5E41A 3VTHA 4K4UA 3HP6A 1D9DA 2UXBF 3QT7A 1EKEA 1VBKA 2CNLB 1GQEA 3IRWP 2ZH5A 1YJ7A 2W6LA 4DTUA 3HZGA 4DS4A 1FF2A 1TFWA 1VQNN 5F8NA 2AHOB 1NB2A 3PHEA 1EB0A 4DFJA 2VQFK 3THWB 2K7KA 4EGLA 5EY4A 2F1FA 3BV8A 4NXNF 2V52B 3HT3A 1MMLA 2K3KA 3T6BA 3VQCA 1ZAWA 2HRTA 5KFMA 4X65K 2EK1A 4ZVOB 4JI4J 2CAJA 4QR2A 3KD1E 2MSTA 2F96A 4NRUA 5EX0A 3BGUA 2B6AB 1NU4A 4B17A 1QAYA 2NYIA 2KT2A 4HHTA 3LPYA 4RZRA 4RBVA 2VFUA 5AR0A 1KTVA 4DQSA 1KDNA 3FCVA 2RAQA 4F7VA 1O8BA 2DNRA 1VQKS 2XI3A 4L6V3 4HTUA 3VEXA 5E0OA 4GKKF 3ULEA 4PL7A 4N47A 4NXNJ 3JYTA 3WQUA 2HWIA 1VQSA 2ZM6F 1OH7A 2HIQA 1IBKJ 3T5LA 1G99A 1NGFA 3HD1A 4ZN3A 1VSKA 4U7UK 3R9LA 4K7QA 4LF8J 2XZWA 5I42B 2QZ8A 1NWKA 1RT5B 1RBAA 1X9MA 2FLLA 2KFNA 3HZ6A 4RG8A 1GT8A 3MCOA 2FJEB 1SQGA 1OWXA 2HAIA 3NOGA 2COLA 2AJ2A 7FD1A 2EK6A 1U2FA 1Q5YA 2ZM6J 3KLGB 5G0RA 2IRXA 3ID8A 3JQJA 3VF4A 2GA7A 4QS9A 4FWQA 3SSSA 3CJ4A 4ECQA 3KKRA 1X31C 4HT7A 1WUAA 3QWPA 4YY3J 4PEOA 4NLXA 4I69A 3V4MA 3K9KA 1T9UA 1RHKB 4JI0F 5KG6A 3OYCA 4K4YA 2MEWA 1R8PA 2YNHB 4CIGA 1KAXA 1RAAB 3WHIA 3RBEA 2IA6A 3MAAA 2C3OA 3PW7A 2CPYA 2G8FA 5FIIA 5AQLA 1RDAA 1MMNA 2K1RB 3D7EO 4A4JA 3QEIA 2YWFA 2EC2A 3OVNA 2BDPA 3L09A 4IG3B 4LFCJ 3MHYA 1IBLF 4BRFA 1HQEB 4GW6A 3RBDA 3ENQA 5LMNJ 1EX4A 4FJIA 4FYVB 1YJNN 4DX6A 4Y0WA 3O4NA 5D0RA 4MO4A 4DR2J 1WG4A 2QLFB 4NMLA 5FRMA 3G6YA 1VHFA 2MYFA 3QGPA 1K8AT 3HYFA 3NOCA 2PT0A 3P49B 4EYIB 3BP8A 4DR1F 3ILJA 3RMAA 5JVHQ 1RHUB 2R8IA 1WTBA 5LY3A 3WXJA 1HBUB 2J76E 1SC6A 3IS9B 3DRXA 1FRIA 5CABA 3NGRA 2YH0A 1XBWA 3CFRA 4F2RA 1R59O 2CFXA 4CJWA 3LP0B 5A2QU 1TUVA 2HQFA 2AEMA 4CIOA 4LRAA 1TYQB 4AL5A 5HK4A 4AM7A 3M8QB 1NSPA 1GK8A 2FHJA 1UA0A 3C0BA 3Q86A 2MLYA 2A10A 4Y28C 4Q8FA 2ACYA 4FZVA 3M2VB 3MDFA 5LM7E 3MWBA 4ZPVR 5ADXA 5I3QA 3ZLJA 3PFOA 3JTPA 4X4NA 1HNZF 3C95A 1JLAB 1RTZA 2VHGA 4NXMF 5HN0A 2WVBA 1TVRA 4JI5K 4M1KA 4DQQA 3KDNA 1JNZB 3MF5A 2FVPA 2JVRA 3FVYA 2IAJB 1Y64A 3TQ1A 1B64A 2QL5B 2Y1RI 3GMGA 4XTTA 3UDCA 4BR2A 3DLKB 1AW0A 4FL9A 1N6QB 4LF8K 1DTQA 3M6UA 3FGUA 3RAXA 2ZVIA 3O3GA 2XRIA 2X7IA 5CH7B 2O8FA 3SV3A 3VTIA 4MLEA 2R2TA 3AB2B 4M94A 4ZIWA 1RWPB 4OFZA 4RPFA 4OX9J 1VSIA 2VOOA 4M5JA 3SDEA 4HTIA 1DURA 2GX8A 3OT9A 2YWKA 3DOMA 4MK8A 1T05A 4DTNA 2OSRA 1NPKA 4MTPA 3FZFA 1QQOA 3H5YA 2CPIA 1IQTA 3UR0A 3LP3A 1JWWA 2CPZA 1EKRA 2F8HA 3TAMA 2X51A 5D8HB 5BPLA 2VOPA 4BDYA 4NA3A 3OFFA 2BE2B 3O6QA 5AQZA 1S1WB 4WQ4C 4JOUA 5IM0A 1KQSR 3JQKA 2GVZA 4YMEA 3CTRA 1ZA2B 5E3PA 5CCMA 1UMJA 3NS6A 2J9CA 4J2AA 3JAMY 2DGUA 3KLEB 1BGXT 3AA3A 4DR6K 3NL0A 5M1PA 4F4XA 3CD6N 1RT4B 3HFZB 1RBVA 3EVOA 1TL3A 3SCJE 1GMWD 3RR7A 2LXIA 2IC3A 3A5OC 3OW2M 4B1VA 5U47A 1KVIA 4HDHA 4B1XB 4RBUA 2RB7A 1HR0J 2B9YA 4NYPA 1WG5A 2VDIA 1QZ5A 2IVFB 2QMUB 2DGOA 4UQTA 3HBTA 1FX4A 3ELHA 3SI8A 1PAEX 2CWKA 3E01B 1PILA 2VPWB 3RMCA 1UFLA 2YJFA 1R0AA 4F67A 2C42A 2DR8A 1N5TA 4CEDA 3BN4A 1Y10A 3D0HE 4Z2XA 1RHJB 4AYBD 5EGYA 3AAWB 2KFZA 1X4AA 3KDOA 2MJUA 2ITMA 3D54A 3I0SA 3HT0A 3G6XA 3MZIA 2XG8A 3JQMA 2XGPA 2V4QA 4DL7A 2HGNA 1WOQA 1SC1B 3TA2A 1YRXA 1RKIA 4FJMA 2NRWA 3MM9A 2ZUAA 2OCEA 3ZSXA 2B51A 4KHQA 4OI2A 4LQ3A 4JV5F 3JS6A 4E7IA 3J7Z5 5JS2A 1CQNA 1N33J 2IVYA 2E4LA 3IBWA 4B3SJ 5L38A 3UIQA 3LUYA 5K14B 1JL2A 4LBIA 1F2HA 3ZSQA 2RRNA 1QZ6A 1NH8A 5KFSA 3IWNC 4HHUA 3IG1B 3TZZA 3CCRN 2MKKA 4BC2A 2UXBJ 1YDLA 1U26A 4P2MA 5GAHI 1RT2B 2D41A 5ELZA 1SAZA 4GC6A 3NXZA 4AT1B 1VQ5S 1RBOB 3A1YG 4IKFA 2JWKA 4HACB 3DC2A 3OYAA 1TV6B 1RDRA 4K2JA 4TXSA 3U3YA 5HP1B 1D1UA 3I56S 3O9SA 1VRTA 5D15A 3G6ES 4ZVFA 1W7WA 3HLUA 5AQNA 3VEZA 1EARA 4AF1A 2MZJA 4JI3K 3TUPA 2FSNA 2Y9HA 1RWUA 4KHPK 1OH6A 3CCQN 4CH7A 1RWWB 2O8BA 4X84A 4DL6A 3IFEA 2HHQA 4A59A 1IBMJ 3W8PA 1SBRA 3OVBA 3D3CJ 4LFAF 4DL2A 3AA9A 1GLEG 4DXLA 2GWJA 3IS9A 5KT3A 1RWMB 1NK9A 4BC3A 3OSNA 4DU7A 4XH4A 4UOGA 1SQKA 3RAMA 2DEJA 5BPNA 3G8QA 1G1XA 4PL8A 2O8DB 4XO0A 2GUIA 4JV2A 4KJIA 1ZZNA 1C2PA 2W01A 2ZDOA 4ILRA 4TKTA 3M6GA 4YN3B 1NK7A 3TNVA 1X9WA 2RVJA 5BYRA 1JX4A 2PFDA 4JBCA 4OYMA 1M5VC 1S0VA 3FMBA 3CQXA 3O44A 1Y0HA 1UFKA 2NQPA 4DV5J 4CM2A 4DPXA 2YH1A 1UL3A 2Y3YA 2CKWA 2YHBA 1FNOA 5DLFA 5DGAA 2FSJA 2JC1A 1O51A 2WFBA 2ASMA 4GKJK 1Q86O 3SQ0A 3CFPA 2J8AA 4CF9A 1FRHA 2XSJB 3SMPA 2HURA 3SBTA 1QM9A 3K5LA 1K44A 3IM8A 3UDVA 2F8SA 1LCUA 3J7ZT 4RW4B 1YF5L 1IR2A 3OLBA 1UEUA 4K4WA 3EICA 4ER8A 2ZBRA 1SKRA 5FLXO 1X60A 4E8UA 3HL8A 4PWWA 1VQLS 1PAUB 3JTOA 5EU7A 4RNHA 3ASMA 1PIEA 3QERA 5C2FA 1CJVB 2JJ4D 2XMAA 4LF6F 4ZVPB 3R6LB 3SBMA 1V3RA 5B0BA 5IS2A 1VSJA 5KFOA 4DSLA 3LDSA 1V9OA 3BF1A 3CPWM 4X4RA 4B9VA 1MROA 3FRYA 4CZFA 1P90A 2M52A 4JI3J 2FBYA 1RAEB 1IR0A 1Z2ZA 1RTJA 1BIUA 3AAQA 1NM2A 4OKJA 3BKUA 1W2IA 3OJUA 3QEXA 3KUHA 3OTOK 2KYXA 2N3OA 2XHWA 2KH9A 1SL1A 2GELA 1FX2A 1IKVA 5A8KB 3CD6S 3KLEA 3OTOF 2FVCA 5DG7A 1VQ6N 2ZGYA 5KFNA 3W64A 4JI1K 5KFIA 1FJCA 1SV5A 4FP9A 3GV5B 4OI3A 1S49A 2UUCF 4DQIA 3MCPA 3GIMA 4Z7CA 1Q7LB 1BUPA 3DRPA 1XNQJ 3HDSA 2HMPA 4O5FA 3LZJA 1N4LA 1VIXA 1FE4A 5LSOA 1WORA 4P2FA 4X2BA 3IMXA 4FZZA 4HHHA 3MOJB 4CO2A 2IJNA 4DR6J 1IG9A 1RXOB 3LDPA 4JI2K 2NSBA 3MMBB 3MTJA 2EFPA 2W2QP 3O1BA 3U3GA 3ZZPA 3DNCA 4X66F 3AA4A 1VQ8N 5HO4A 2Z2LA 3O1WA 4A8MP 2XMUA 5IM0B 1TP7A 2UP1A 4RW9B 3C14B 5CYJA 4TNOA 3KZBA 4BR9A 1LWFB 4ANCA 4WFNL 3BKTA 3EVWA 3N28A 4NLBA 3QIPB 2V2QA 1XWLA 4X62K 1U2CA 2BJ8A 3FCWA 1H73A 2DCUB 5H9FK 3KFWX 2C28A 4ZJQA 7FDRA 2Z2MA 2CYYA 3H8YA 1OY9A 4U8VA 1VC5A 3Q22A 2IM1A 4DU1A 2MTLA 3AVAA 1ZYQA 2VF3A 4X4OA 1RU1A 1SI9A 4PUOA 5SWMA 2D9PA 2DT9A 3W5YA 2PZSA 2NRTA 1Z26A 4CJ3A 3K17A 3TRGA 4CJRA 3I55N 1QSLA 2KJVA 1NJIT 2F4FA 2HKEA 2RDIA 3L9ZA 2PI5A 2G9OA 2A1RA 3M32A 4NLSA 3LO3A 3C14A 4ZVEA 3THWA 2E2NA 3M9OB 4DCHA 4MIAA 3MAHA 4JI4F 5GAEP 1G4CA 4DUYJ 4K8XA 1KP6A 1W0HA 1CJUA 2FJAB 1C1AA 4I7FA 3D0IE 3QSYB 2NREA 1ZM3A 3MOZA 4JYAF 2ASYA 2AD9A 2QL7B 3V1OA 3AO3A 3PEJA 4TVAB 5AE2A 1XERA 1BC6A 1L3SA 3S7RA 3V4IA 2NLWA 2QK9A 2MXYA 5DM6Q 2ZJRL 2R7UA 1V6HA 1WC4A 4YOVA 4IOXA 2GHPA 4DR7F 2B9XA 4FJGA 4BR7A 3MWTA 1TL5A 3L6QA 3QMQA 5JVGQ 3L3UA 2VB6A 3MFIA 1IKWA 3SCKE 4BR0A 1VI7A 4JYAJ 4E3SA 4RWXA 2LQBA 3CCTA 4CLPA 1VK8A 1X3MA 3GIJA 1EETA 3RMBA 3D2EA 3OY9A 2QWOA 5K5MA 2AGOA 2GW8A 2ZNYA 2CG4A 1KXPA 3CF5Q 4ZPAA 4FKYA 3E9OA 3NCIA 1JLGB 3VQ6A 4DR7J 1V4TA 1HYZA 1HJRA 2P9NB 1HPMA 5ETKA 4LF6K 2Y0SD 4H4MA 1JLGA 1SH2A 4FLWA 2PSZA 2AJFE 2IMOA 2KKHA 1NEEA 4U6PA 3CULA 4ECYA 4BC7A 4DSJA 4DV6F 4AQYK 2GAGC 3HHKA 1YITN 1JLFA 2BW7A 4DV4F 5EX3A 3EX7B 3MECB 3CCEN 2VA2A 1VRQC 3AVBA 2BKNA 3BREA 1MU2A 4W92B 1FWPA 3GONA 4GVEA 3OS1A 2C2EA 1WTFA 2P9LB 1JLQA 4GV6A 5JS1A 1RTHB 4B9SA 4NEZA 4E1MA 3FC9A 4C8ZA 1WC6A 1QLNA 3QZ7A 2X78A 4DN0A 4WE1A 1VQLN 3FZBA 4RUAA 4CEAA 1SZ2A 1T94A 4USMA 2KI2A 3DYAA 1N32F 2FB0A 1ZBUA 3W7BA 1J2VA 3RAQA 1HKBA 1XHZA 1UVNA 4ECTA 4N8NA 1T11A 2E5GA 4J9VA 5CHCB 1OH8A 4CHNA 3VQSA 4IOCL 2E5LK 3VN5A 3OR1B 2QRRA 1HLUA 4JK7A 4EHTA 3CT9A 2LDIA 1RT6A 2NSCA 4CHPA 1PKUA 2Q36A 3A13A 2J7WA 1ZAXA 4UY8T 5D4OA 1VDHA 2DIUA 3C8YA 3BSOA 3KK2A 3L7OA 2FLNA 1WHYA 3W5ZA 4RW8B 3HHDA 4C9DA 5KGWA 2P5GA 3BPSP 5JXSA 4LFCK 3N0VA 4GNIA 1IWAA 4GRSA 4IO8A 3DLLL 1AFIA 3E8OA 4OLBA 2D1CA 2XWXA 1B0PA 2AJ0A 2V8VA 3WXMB 1D0EA 5TKYA 2G2OA 2ZVSA 4E7HA 1L3TA 4OYAA 3VEOA 1QSSA 4CK2A 3LH2S 2JLGA 1HHTP 2UUBK 2AP1A 1LXJA 1XR7A 3ZFVA 3IKMA 3CW2C 4KRWA 2NYHA 3K0JA 4Z4CA 4AQYF 4QOTA 2PYLA 1HPZB 3I8BA 3RYLA 1PGZA 2F9TA 4MJKA 4WFAQ 5LJ3Y 3DXKB 3MM6B 2I5JB 2VG5A 2CPJA 3W3SA 2YHYA 2V7ZA 2IRUA 4J91A 2HQDA 1YJNS 1IBCB 1VQ8S 4E1NA 2FC9A 4CESA 4IFVA 1H7WA 2I2YA 3F0NA 1IKXA 4GKKJ 1SIZA 3ITHA 3LW5C 4W5RA 2MLXA 1UEKA 2I1RA 1JMTA 3AD8C 1NGEA 1EWQA 4DTRA 1VJWA 3R27A 1XMQK 3MK6A 1IKVB 2QYCA 1Q18A 4M42A 1S4FA 3V6DA 1WHXA 2KT5A 1PJ6A 3E1YA 2QA4N 2QLJB 2OTLN 4KB7A 1C1BA 3MR2A 1FD8A 5HLFA 3D5MA 2F3JA 4OO1J 4CZIA 4CDIA 4FJKA 3CJRA 1X5PA 1H6KX 2AYMA 3CMES 3PHTA 4CJKA 4KI6A 4C11A 3DRPB 1UJ5A 5H9EK 2DY4A 1FJ7A 2HNYB 1UZDA 3WIUA 3OYKA 2CZ9A 3BZQA 3MPDA 2DH9A 4RUBA 1AXQA 4H5WA 3JSMA 1NH7A 3ZTSA 3QJLA 2BKOA 4IJNA 2HNDA 4C7QA 3KKFA 5B09A 1KEKA 1U7LA 1DQ8A 2GHWA 4IH5A 3QYYA 1B9FA 1RJJA 1LWFA 1JXEA 5AT1B 2ZJQQ 2QWLA 4YDUA 1XJWB 1YIJN 2BKPA 4EP4A 4ZLPA 1T9TA 1RFQA 1D5AA 3IUCA 4DSEA 1QSYA 2O67A 3TZWA 4MKVA 4CI0B 3Q8QB 1S5JA 2XLJA 4P7VA 2E9TA 3MPVA 4FS2A 2CJAA 4M5DA 3S01A 2ZZTA 1S59A 2DR9A 4KH5A 4M45A 3UFCX 2MQOA 3LM9A 1XHXA 3DRYA 4UUXA 4M5DB 2HVDA 3A4TA 1CEZA 4LF5F 4V1Ak 4X65F 1RISA 4FBUA 3LWMA 1WG1A 1XI1A 1RHMB 3HVWA 3PZPA 3K0SA 1N32K 4NLWA 1UWBB 2UUAJ 2J6UA 3GFYA 3H46O 3Q8UA 4H0VB 1CG2A 1J5EJ 3CJCA 1YJVA 3M32B 4NCBA 3UDLA 3D2WA 2EKNA 1E6VA 3LWLA 1TUYA 5F8HA 3PW5A 3I31A 4AHSA 2JEFA 4ILGB 1R89A 1F5AA 2R8HA 2IVNA 4Z4EA 4KY3A 4BDZA 1KLMA 1WSJA 1C0FA 1KBRA 3IA0A 4O44A 4L73A 4EYHB 4KB1A 4LF7F 5FPEA 4G6VB 4KYZA 4CLKA 4J9KA 3GL1A 3GFXA 1HNXJ 3AVMA 2ROGA 2DCLA 4DV1J 3HFKA 4OJ3A 1ZBFA 1FNMA 3PSIA 4H4MB 1RNHA 1TZ0A 2W2NP 5C24A 4DCOB 3A3PB 5EWEA 4NL5A 5G0RB 3GLJA 2A18A 5DG9A 3IAM9 2ZOGA 3QLHA 5HVFA 2D3O1 1H1VA 4LRFA 3THPA 1R8HA 2PFFB 2CWXA 5J2QA 4QYRA 2QSFA 5ETMA 2LXFA 3SCIE 3PJ9A 1UCNA 2O4IA 3W63A 3UVJB 2B4OA 3AJ1A 4O0IA 3FJ2A 1S9GA 1NPPA 3WUHA 1T44A 2WVDA 3F9KA 4DTXA 1LFPA 5F9LA 1NHVA 3U6FA 4CYUB 4DI6A 1NLVA 4CHYA 3ZZOA 3ONQA 5ITHA 4FLYA 4ICLB 3D67A 4QAGA 2V7YA 2Q2RA 3CDUA 3FSXA 4C8KA 2ZC3A 1PC5A 1HBNB 1RK8A 4KB0A 2DNNA 3FSYA 3M8ZA 2D0AA 1HD0A 2DITA 4C2MA 3OR2A 5IFMA 4F0KA 4ZTJA 4U67Q 2FBXA 3RB3A 2KM8B 1FVQA 3MECA 3AOAA 2DNGA 4FYWB 2D0BA 1HBUA 3JB9k 2BYCA 2R7RA 1LAVA 1MMDA 3GJRB 2RQCA 2OH2A 4ZCMA 5F41A 2K7JA 3CCRS 3ZX0A 4V19J 4LFBK 3T1YK 4TU8A 1WF0A 1TL4A 1WEZA 5CD4H 3EDQB 2A6OA 3KHRA 1LV5A 4KH6A 2BUPA 4DV0J 1GAOA 2VWBA 4URQU 4LF8F 1S57A 5D78A 4LF2A 3PYDA 3ENAA 1CZBA 3DXKA 2E9ZA 1H38A 4K8RA 2AA4A 2HIYA 2M4MA 3HF5A 4ECRA 4TLQA 3GR1A 5LMUJ 3BR8A 1HNXK 3B54A 1GXLA 1KD1O 2RU3A 3VGLA 1HBOB 4CF8A 4L3KA 2O5DA 2VQEF 4Z4GA 4Z94A 4JI7J 2ZZMA 2AYBA 3O8WA 8AT1B 1FNXH 5KFLA 1C0UA 4GVLA 3SSRA 1I1GA 1EQ0A 2C2KB 4ED7A 1HNWK 2A6AA 1NKEA 2DGQA 5T41A 1KD1T 4ILLA 4KRFA 3FR0A 3PIPQ 4FLZA 3LM2A 4C8NA 4V19S 2E2OA 2CZVC 1HI8A 3AD9C 2B7BB 1DJ0A 5D77A 2JZ5A 1O1WA 5KFTA 1N52B 4LF6J 3P39A 4ETXA 2W4CA 4UQGA 4BC5A 4DU3A 4ANEA 2JOQA 2XMKA 2HFNA 3KLIA 3R5BA 3SDEB 3M2VA 3MM5A 1IUJA 3KK3A 1LWXA 1EP4A 4WQ5A 2B0GA 7AT1B 4O8KA 1WEYA 3Q24A 2W42A 2CPEA 4RW7B 2MKIA 3A8KA 2ZH4A 4FJ7A 1I3OB 1RBRA 3OLAA 4I2QB 3GJSB 2Z1GA 2P5OA 1FWKA 1FRXA 2ZOFA 5IOLA 4H5RA 2RE1A 1ZBSA 4NCAA 3LDLA 1H2TZ 5EOYA 2IOCA 3KWGA 1K6YA 3FBBA 3NGSA 2WB1D 2MY7A 2PA3A 3AOBA 3C7NA 2ASOA 4H4OB 5C15A 4MIBA 4HKQA 2GMHA 2OGUA 5GIPA 5E3CA 3R7BB 3TU5A 1WLJA 3ZSWA 3ILIA 4M41A 3AARA 4O4GA 2MKCA 5ADXH 1B7FA 2KU7A 3R7NB 1U09A 2G8KA 2VC0A 2A40A 3PM9A 3OV7A 2RUGA 3SFGA 2DRBA 4BS2A 3OXGA 3I5CA 2WAQD 3L4QA 3W65A 2HZVA 4F3OA 3RVCA 1C0MA 3WNHA 4LSLA 4XPEA 3UO0A 4FKXA 1WC1A 3GJTB 5A0YB 3UNYA 4Q2MA 4IFEA 4PXEA 1DLOB 4FPBA 1N5YA 2AQ4A 3DLEA 2HNDB 2K06A 4BACA 3QEPA 2UVUA 1NZAA 2E66A 2BE2A 1N5YB 4DV6K 3TAGA 4IQMA 3V1RA 2XNQA 3G6EN 1DEJA 3OYMA 4PZVA 2P9EA 2ZEJA 3IBFB 5DDPC 2BJ3A 1DAXA 2A1BA 3AODA 1HNIA 2LECA 4TU9A 1WNSA 5DDRC 1L3KA 1Z4UA 2V51B 1SC3B 3CJ1A 1KC8O 4CO1A 4OHXA 2LQ9A 1AROP 4WKRA 2R2SA 5C2DA 4O5BA 2EKYA 1KSPA 3L0QA 2AEFA 1NDKA 2CDQA 1UJ4A 3HHLD 4JV1A 3G71S 1VHXA 4M5LA 4FVCA 4R0EA 5E84A 2E7XA 4PKGA 5KT5A 4DV7F 4PKIA 1Z6RA 2HQ3A 2QIFA 4FM2A 3DOMB 5K8MA 1I94F 5HSPA 4A8FA 1ZM9A 5FLXY 5T7LA 4EBCA 1REVB 4NXMK 3KJQB 2ZD1B 5KFFA 5D0HA 1F3VA 3IGVA 3PX6A 1D09B 1HFEL 2BX6A 1Q16B 1YT3A 4CJSA 4OLOA 4DFKA 2D3OR 3ISZA 4B3OA 4NI2B 2LVWA 2WSEC 1K0VA 4UY8O 2LDYA 2DHXA 4KHWA 3KYLA 1BLUA 3KOAA 1S1TA 4K5SA 2Z1JA 4P9SA 3ENVA 2G0JA 1K8KA 4X65J 4WTOB 3CJSA 2XMVA 2P9NA 4CF1A 1S6OA 1RHQB 4GV3A 3BGOP 4I67A 4TYBA 4P74A 4DCPB 2NPFA 4USHA 4OZ1A 2R7TA 4B3RF 4L3NA 2Z57B 4LVOP 1BWEA 1FFSB 3NCQA 1T3VA 4ZCKA 4IFYA 2E1MC 4GMKA 2M8HA 2R2UA 1PBUA 3OS2A 3U1NA 4ENOA 2QA4S 1A6LA 3ENOA 3LDQA 3QETA 5C7PA 3HJVA 5ETLA 1RQ0A 1S3XA 1TTHB 4NZ0A 4UY85 3HHLA 2A3JA 4LIRA 4OYOA 4I2PB 2WUSA 1WUUA 4BREA 2B3TB 1S1UB 2C1EB 3IGNA 5AQGA 2HHSA 3LALA 1BE4A 2MQQA 3AA5X 4JI0K 2LQJA 5TKWA 1FDDA 1NGBA 2WW8A 2RDDA 4FOEA 2YHAA 1FJGF 1RWNB 1ROFA 4C3KA 4AILC 3CCMS 1GNKA 2HZCA 5BN9A 1HNZK 4F0HA 3VHQA 4M3YA 3JTNA 3GCXP 2GO9A 4AD6A 1U2VA 4F8RA 5F0WA 3FNNA 2D7SA 3F44A 1YJ9N 3Q8RB 4Q0BA 1JLFB 2XSJA 3Q83A 4KFBA 4OJGA 4F0MA 3D4JA 4I64A 1PC4A 2BTFA 3OYIA 1DTTA 5F8JA 2YNHA 4J37A 2ZJPL 3D6FB 4CGHA 5THWA 1RBTA 3PJXA 2VASA 3NAIA 1TK0A 3WX4A 3A5NC 3NGYA 3VQBA 1KOHA 3EUNA 1FKOA 1DQ9A 3TOQA 3QIOA 1W25A 4IOAQ 1FKOB 3P8BB 4ZP8A 4WBFA 3NBPB 1FE0A 1HBNA 1BDGA 2AV5A 3BH7B 2DFEA 2HS4A 4KREA 5E26A 1T02A 4DR3F 2BJ9A 1E4FT 4O3NA 4Q5VA 2RUSA 4IR9A 1LW2B 3E2EA 1B4SA 2UXCJ 4OV6A 4DTSA 2ZUGA 2H48B 1X0FA 3M6VA 2P9IA 3GZ7A 1VYAA 3F56A 2P9IB 1U1NA 1NNDA 5C2CA 4Q2LA 3CEDA 3PXGa 2P9LA 3CD5A 1U0HA 2OJ3A 4LFAJ 4JLHA 1MWMA 1PSDA 4OPHA 2E5IA 2WTUA 1EZZB 3ADAC 4Z4IA 1QY7A 3VQ5A 1Q86T 5CYMA 4J2BA 2XB2D 1GH8A 2HFZA 1BA1A 1R6VA 3RB6A 2HHUA 2LEAA 4Q7AA 1FDNA 1KTQA 2DNMA 3A3OB 5C5JA 3VPZA 2QWNA 3JSBA 1F9FA 4CHOA 3J7ZO 5GADI 2NZ4A 3RG6A 5AJ3K 2YKOA 3UQSA 3AXKA 4RW6B 3KLHA 1VQ7N 2V68A 1AT1B 2WSFC 3BGFA 3MN6A 1TAUA 1DLOA 5ETNA 5L46A 1QE1B 2YWEA 3QBXA 4EO8A 5C42A 3TI0A 1AUDA 2W2MP 3CD0A 4JI8J 2CQ0A 4DX5A 2YKMB 3TQEA 2ILZA 3N4PA 3SJJA 1MWQA 4QIEA 3D6MB 5LOQA 3WC2A 4RTFD 1BQNA 3O5BA 3FUYA 2BOAA 3H7HB 3IN5A 1X7VA 3RU0A 3PCOB 2VH7A 2HBQB 1N34F 4YOXA 1EXQA 1GLCG 4WIIA 2Q31A 3I4PA 4B3MF 4GY2B 4ZVHA 4OPAA 4U8YA 4WZMA 4V19X 2GIRA 2H1YA 2J4RA 4IEIA 4X4UA 4NB4A 1QHTA 4LFAK 3PIOL 4CLSA 4KHPJ 4CW7B 1O5JA 3SUPA 2EFGA 4DU4A 2WRMA 4YORA 2HBKA 3MX2A 4KHSA 2P6SA 4CJ5A 2B56A 2ZD1A 1GMWA 2KVQE 2V4JB 3OD2A 4ISEA 3CM6A 1FI4A 4GVBB 4ZPTR 3E01A 1VLOA 1ZM2A 1GMVA 3ITHB 4KGZB 4A47A 3V2UC 4BHQA 5AQKA 3PR4A 3AO2A 4FDFA 1CVJA 2HB5A 3VESA 4E89A 1B70B 3MPYA 3EY1A 3V81A 1GLFO 4HUFA 2MHEA 2M0GB 3QRRA 3NNCA 2FY1A 4OPKA 4ZMMA 3C66A 1LK5A 3DI6B 5GAGI 4MAKA 1I3AA 3MFHA 3RRHA 1PYTA 1XNQF 4CEFA 1GLDG 1Q9XA 4HVJA 4Y2MA 3B8HA 4FXVA 2FUG9 1JJ4A 4U7BA 2CQGA 1FW6A 2W7OA 3V1QA 2KLAA 3KK7A 5KFQA 2J9EA 2UUWA 4GVBA 4YR2A 1HHSA 5GAHP 3NWRA 3AA8A 4IZ9A 2NUHA 3DFEA 1FA0A 4FSVA 1QVGM 4DSKA 1K8AO 2VBZA 2ZOMA 4DV2K 2OPSA 3CC4N 1VQPN 3EEQA 4TU7A 1FD2A 3AJDA 1X5OA 2KXNB 1QS4A 3SLCA 4PHTX 2PY5A 2G13A 2IVPA 4CK1A 3B4MA 4LF9K 3KJNB 4OX9K 5I3UA 2FF3B 4CO5A 2QE5A 3CJKA 2IMWP 1YHQN 4JD2B 3R97A 1I94J 3HVRA 1I94K 1GOCA 4DEZA 1YVUA 3ZZTA 3QICA 1NGIA 4AHTA 2H54B 3ZTOA 3SMZA 2JEJA 2C3PA 3CF5L 3VAKA 4ZA1A 3LDNA 3AVFA 3W2WA 2UU9K 3TUZC 3AGKA 2FHOB 1T6CA 1NMDA 2R8GA 3ULEB 3VAGA 2X74A 3TAEA 3SYZA 4C8MA 1XMOK 4FWNA 3IG1A 4NZ6A 3G10A 1IM4A 4IRDA 4DR4J 3O4QA 4ECSA 4ED6A 3Q7BA 3M8WA 2K8GA 3G8TA 2BEFA 1R7IA 2HF4A 2W2OP 1BY9A 5HRNA 4QOZB 2P9PA 2UXCK 5A76A 3SPZA 4LRDA 5FRNA 1HKGA 3M9NB 5AQWA 1SH0A 4BLGA 3GP9A 3QRPA 2MZQA 1S6QB 4KPCA 3I9V9 5AE3A 3W9HA 3TAFA 1Y5LB 1E6YB 2HF3A 1NKCA 3ZZRA 2R7QA 4MK9A 2YPYA 2IM3A 5KFDA 3O4WA 3EM1A 3CG7A 2BRKA 3H4BA 4DUZF 2DNOA 4C8LA 5EVZA 2IPOB 3CPWR 1RB0A 3KMSA 4C0BA 3WX8A 1NAQA 1RWVB 4G3IA 5HRSA 2PC6A 3UD4P 1SKWA 1OMSA 5HL7L 2QSWA 1YJ9S 1BI4A 4DG1A 1YQHA 3PUFA 1YTAA 4FWOA 2DB1A 1MLAA 3NKYA 3PEHA 4I6WA 4UTGA 1TV6A 2LCWA 3RTVA 1KWMA 5B7WA 2NXEA 2I9SA 3TVZA 1CJVA 2APOA 2ALZA 1VRTB 5CD4A 2CDRB 1PBAA 2I6WA 3EZOA 1M90T 1BHLA 3BY5A 2DJWA 2LQ5A 1I51B 1VQ9N 2BMBA 1XNRJ 2QXLA 2E1CA 3TSUA 4R0JA 3DXBA 1OSDA 3N5FA 3D2FB 2LLZA 5L9NA 3AVCA 4LF7J 3TTDA 1OPIA 1N36F 5A8RB 2IYGA 3US5A 1SC4B 4RUHA 3TPQA 4Q0BB 1HBOA 2W9AA 4PXBA 3KK2B 2DXEA 2E1AA 4ZVUB 4OZ2A 2IAJA 2N82B 3HSDA 3T5KA 4O3SA 1ZM4A 1QTNB 1IQZA 2WB4A 3IBCB 5AQIA 4B9TA 3SZ2A 4GVMA 4LRBA 3V6KA 4DX7A 1YZ6A 2YX7A 5AQTA 2DGWA 3TZXA 2ILYA 2IY5B 2P2CB 3M4XA 1FJEB 2MHNA 3AO5A 2HW3A 4OGCA 4DMNA 3HVTA 2AYEA 4FF1A 5LSLA 4TY8A 2ZFHA 3KJVB 1F6TA 2QLBB 2IJRA 2EEYA 1X9SA 1X8DA 5IT0A 4IDKA 3VGMA 3HPOA 5GAEU 1NGCA 2C2DA 1ZOTA 4JAXA 4O3QA 3BYPA 1M5OC 2E8AA 4CTAA 4ZCIA 4OZNA 5DQIA 3B6OA 3D66A 3QAEA 3K59A 3A12A 2W24A 3UE2A 2Q0UA 1VQ7S 2HYIB 4NLTA 2F9WA 4JUZA 1TR0A 3NEKA 3AHPA 1VQ4S 2F4VK 5EUHA 1KAYA 3UB5A 2XS2A 1NNEA 2CXEA 1KAZA 2P5VA 2DHSA 2W6KA 1F3FA 4FW2A 4H5NA 1BQMB 2Q66A 4OJRA 2BQRA 2NLXA 3LAMA 2LMIA 4EBDA 1RYSA 1GMUA 2W4DA 3FRZA 2CVEA 1VQMN 4CO0A 2AKWB 5F9NA 3BR9A 1UKUA 1CS4A 2PI4A 3N4WA 2FDNA 4A62A 2BM0A 3VA3A 5KTQA 1S1WA 2E5JA 4W4MA 1TFYA 4XH5A 1SJ4P 5LMUK 1RTJB 1U4BA 3IAS9 1Q1KA 1FTCA 3ETMA 1F9EB 4NX9A 4DDFA 5KAKA 1ZETA 4LY7A 2DK2A 3D0GE 2P9CA 4FYYB 3Q2TC 1HARA 1M1KO 4HH1A 1HKCA 4BRHA 3O3LA 4CD1A 4FJ9A 5KGXA 4HTJA 1BMQB 4NO7A 1P9YA 4X62J 4BVPA 1R8AA 5EWGA 1RSCA 4MKYA 2F7TA 1UAWA 1YVFA 1GX6A 4PCQA 3VETA 4JI3F 3VAHA 2EBEA 2FQQB 1S48A 3DI6A 5HJYA 3NMUA 4FS1A 4H4KA 2UXDJ 2P9UA 4YR3A 1RTDA 4C23A 4IKAA 2HHHJ 3QFPA 4XH1A 1KVKA 1IVZA 1WAFA 3NGUA 4WU3A 4K4ZA 3L7PA 4WFBL 4TLRA 1IO2A 3TVKA 1SL2A 2QV6A 3NGDA 2HLUA 3QB0A 3CJ2A 4PA1A 1S6PA 2NXJA 1IJJA 4JRQA 1KHVA 3O1LA 3T19A 2DFFA 1G3OA 3R6GB 3DXMA 4WF9Q 3R8YA 5B0CA 2O8EA 2PMWA 2B7CB 3CC4S 3L4BC 4PPDA 4DTOA 4JI1J 3D28A 3CJKB 2KHOA 4ID1A 2ZH1A 2Y8WA 1G7CB 1J5OB 4FO0A 3G8SA 3I96A 3BQ2A 4I6MB 2NS1B 3UPFA 6AT1B 3DMJA 4F4YA 1GOBA 3BBCA 3PIPL 4RWWA 4DPTA 3MI7X 1FRLA 2EX3A 4ZLNA 1HWUA 2QX0A 2W1BA 2AU0A 2UUAF 5F8IA 4DR5F 3R5AA 3KHGA 4J2DA 3QFUA 3I82A 4EEYA 2VGMA 4URGA 2GMJA 3M3ZA 3VAIA 3EZ5A 4BR4A 3VAMA 3ID6A 4LMZA 4J9MA 1Z1ZA 1S1UA 1ELOA 3H25A 5KFAA 4DL0C 2ZJPQ 1E3MA 3HVAA 5E2QA 5I3UB 1LFWA 4N8OA 4ZVRB 5D6GA 1N0VC 3H1QA 1CJUB 1RKJA 4XDDA 2ZHOA 3W8GA 4B1WB 3R9PA 5LT5A 1ZAVA 5DO2A 2VPXB 2KXHA 4DV0K 2DY1A 2V34A 4PAAA 2U2FA 4DWIA 4ID5A 4MDAA 2YHWA 5AFUH 2JH3A 4CEEA 3POTB 8ATCB 1CPZA 1WSIA 2E20A 2GAHC 4XEIA 3T1HF 1VC0A 2CPFA 3OHAA 3T9NA 5E7OB 4LF9F 4FJ5A 5KG3A 1A9NB 5KRSA 3CSKA 2O1PA 4IH6A 4HI2A 3SUQA 2KRRA 3EJMA 3DHXA 3BSAA 3KWMA 4RNMA 4NCGA 2KM8C 3BEGB 1CULB 2HLTA 4CLZA 1WELA 1Q8KA 3SJHA 4HACA 4NLRA 3T1YF 1VQOS 4DR1K 2EFQA 3M8QA 3RBZA 4DLEA 1HJOA 4WXWA 2QTDA 4DTMA 2RQKA 4M5IA 4DUZJ 1J53A 1J5EK 3CNQP 4PYAA 3LP1B 1ITGA 5CQGA 4Q45A 4ID5B 4KV8A 2UUAK 2PGCA 3MUVP 2FVQA 1MSWD 3J7AP 2JSXA 1LXNA 4M5NA 3CCMN 3D9BA 2OZSA 4CE9A 3I9ZA 4DUZK 5KQ8A 5KFHA 1OKJA 4ZKAA 1JCFA 2EG1A 3G71N 1AUSL 4ES1A 1FDBA 3HI0A 3A8IA 1FXLA 4DHYA 4PWDB 1FK9A 4ZP7A 4WK1A 2XSFA 1WNEA 2FXUA 1WOPA 4W98A 5H1SQ 2VJVA 4ZTFA 1NK8A 1WB9A 4A2BA 4DQRA 1L3VA 4PG5A 1T9VA 1S12A 3UD5A 2K1RA 5HLFB 2AEJA 3UNGC 3CWJA 2Q3PA 2CJYB 4DV4J 2HK3A 2PN6A 4RU9A 2AMCB 4DV0F 3Q8PB 2DGTA 4F4KA 1SIWB 5K8NA 5IV3A 3T1HK 2FHKA 5KG4A 1Q78A 1Y3KA 5GAGU 4RW7A 3NAEA 2W9CA 2HQCA 5IXUA 2N7CA 2H3EB 5MLCV 4OX6A 3MMAA 2GGPB 4FPIA 1YBTA 2DIVA 2VQEJ 2XGQA 4JI7F 4BRMA 4KAIA 3VQAA 4O3OA 2CH6A 1R8BA 1C1BB 4PWUA 2FBTA 3DN9A 2J9DA 1T8EA 2KZZA 4JI6K 1TYQA 1HKAA 2M8DB 5AJ3F 3DRSA 3GIRA 4EI2A 2K2PA 3N79A 3VOVA 1LWEA 1U1MA 5KFYA 2R3VA 3OUYB 5DK5A 1F21A 2KXFA 3MPUB 5ADZA 1UWBA 2CQBA 4ELUA 1HD1A 1NZ8A 4DFPA 2R9LA 2AZ1A 4RW9A 5HATA 3W1YC 3TZYA 2GV9A 1TELA 1E6VB 3RW6A 2YV0X 1X4GA 3PO4A 1HHQA 1RDDA 3C6TA 2HBRB 4JI2J 5HMXA 2ALYB 2DTUA 3RRGA 3OL8A 2OANA 2BQ3A 4H0XB 4FW1A 5M1OA 4DV3K 5CAAA 3MD3A 3GPAA 4E1JA 3DOLA 2HZAA 4CERA 3OL7A 1H72C 2ACMA 3X1LB 3VWSA 5BYSA 5CYQA 6FDRA 1KC8T 5DQHA 2QA1A 3KLVA 2RRBA 3CIPA 4U96A 3DMJB 1JJ2M 2ZC4A 4I6YA 2ZH9A 3OSPA 2UXDK 1OY6A 3OHRA 2ZBIA 5T7LB 1M90O 3TJ8A 4CLWA 1EX8A 2YVSA 2DNZA 5L9XA 4M95A 1RDCA 4KBIA 1WBDA 4OHZA 2MGZB 2NUUG 3OW2R 1MN9A 3X3UA 2ZE2A 3DXMB 4USJC 1S22A 2NUBA 2LEBA 3M2UA 1Y3JA 2FPHX 4DR7K 1JXLA 3PG9A 2P9PB 3Q8SB 2B8QA 3PKMA 4GMJB 3SSQA 3EPGA 3KG0A 1VSDA 4KHUA 2HRUA 3R8EA 4O3PA 1YRUA 4YEAA 2J0SD 3BQ0A 2IVOA 2B4UA 1TL7A 2YNFA 2CG8A 2RH3A 4EU0A 2M88A 4CEZA 4ZPCA 3IFRA 4ILHA 2VKRA 2R8KA 1VISA 4AL7A 2FZGB 2YKQA 3POTA 4OYXA 5AQMA 5F8MA 5B8HA 2HGMA 3DLLQ 4O8UA 3LZIA 4X4PA 2DISA 1BISA 3JYTB 3H2LA 3ZSOA 3RBXA 3HI9A 4FXWA 1URRA 3LPTA 3L2WA 4M3XA 4Y1CA 2JL9A 4JI8F 2OI2A 2V0NA 4F4AA 1WI8A 4IUFA 4AFFA 2DFHA 3DGPB 1WN7A 4NYNA 1HMVB 4Q43A 4FK2A 4ICLA 3C6UA 1HI1A 4FWRA 4B1ZA 4DUYK 3ULHA 3NCRA 4LF5J 1ZBHA 4B8CA 2LEPA 1RGIA 5JMNA 4B3MJ 1PYOB 4WYBA 4FZYA 4O0JA 4A57A 4CF0A 1UA1A 1YHQS 2SXLA 1UOCA 1UETA 4JKFA 2UUBF 4EMDA 3OTCA 3K5NA 4WWSA 4DR5J 3LPEA 5AQOA 3BF3A 1V4SA 3DU5A 1ZTTA 4LF4K 4CJPA 2J8SA 4RW8A 4LBPA 4JV5K 1TL1B 2DR5A 4L75A 2CQ4A 2DHHA 4F9OA 3J7A1 1DZ5A 3UWTA 1ZPVA 5L1LA 3Q23A 2EI5A 3SQ4A 2W40A 2ROEA 4QR1A 2D5RA 2QKKA 5AQFA 4FF3A 1N54B 5FJ4A 3I8DA 1LNQA 3AO4A 4F4WA 3M8RA 2A2CA 5CHIA 2O8CB 3R1HA 2YWGA 4YHHK 4IG3A 1ILYA 2Z1HA 3L4IA 4D3HA 3BB5A 4KTWA 4EUVA 1M1GA 4FPAA 3W9IA 3CGIA 2UZAA 4W5QA 2Z30B 3LP1A 3HP9A 4OVLA 2RS2A 3PRBA 1CZ9A 1SUQA 3FLCO 2F7VA 3CXCR 2ZH8A 2CNNB 1U49A 2HVEA 4ZITA 3HCXA 2DO0A 4YOYA 5A8RA 4K8ZA 1OO0B 2Z2YB 3HTVA 2WSCC 2JX2A 2ZM6K 1QVFM 1RA6A 1B92A 1JNRB 2CH5A 2CGKA 2I8EA 1ZPWX 3MX5A 1UAXA 2AF6A 3FEYB 1N33K 3MMVA 3HHEA 2KL8A 5M1QA 4CZHA 4A8WA 4UW2A 4ES2A 3G96A 5CYMB 4C3LA 1VSMA 1U04A 2D4WA 1VAZA 2E6MA 1Q8LA 2HFSA 1FJGK 2ZBCA 4O55A 3ENWA 1BA0A 3SFUA 2ASDA 2X1BA 2Z0GA 4NWBA 2QKBA 1C4CA 1XC9A 4CLFA 2AX1A 2YY3A 3DGVA 2P6TA 5EHHA 1D4XA 1YXQA 3PTWA 5BR8F 3NMRA 2DH8A 2EHGA 5KRTA 4F25A 3QJPA 2UXCF 4DKWA 3JXOA 4XIUA 3Q7CA 3J80U 3EMTA 1MW7A 5KFWA 3ZETA 1IKXB 3ZT0A 2WZ1A 1OPZA 1R31A 2IVMA 4J9QA 2VG7B 2OP5A 2XY5A 1RUSA 1XNQK 2DBBA 4DUTA 1OH5A 3HSGA 2DPIA 3LL3A 4L76A 4W90B 5MAOA 4ZHRB 2ZWHA 3ZNUA 2E6LA 5HI7A 3VGVA 3O9TA 4OYWA 2XY7A 5I9EB 3VALA 3D1QA 1ZBIA 1NM1A 5C2GA 2DGVA 1NJYA 5J1EB 4CEOA 5LMNK 3PDNA 4OHYA 3MCAB 1Q81O 4TQRA 2CA9A 5KPRA 4DL4A 4OL8A 4XAKA 1DKGD 3FBCA 1WACA 4GKJJ 4CCHA 1YVNA 1WI6A 3TUIC 2UUCK 4HR2A 1ZA1B 2XBPA 2FF6A 4NA1A 2W9CB 1AFJA 4LQ9A 5L1JA 1W2BM 2GQCA 4KKOA 2Q1LA 4ECWA 4DV7K 2RKIA 5SZTA 1GXUA 1VBYA 1VQ9S 1JKHB 5D4PA 2KN4A 2RILA 4ZP6A 5FPDA 5AQQA 3DOKB 1UW4A 4P75A 1VFJA 1WHWA 3H4DA 3AGRA 5F1XA 4BVOA 4R25A 5BR8K 4FJXA 1BQMA 1R6YA 5IQQA 2MB0B 2J0XA 3T5JA 1JL1A 3D68A 4CNYA 3VF6A 3NS7B 4CFAA 1PG5B 2PE8A 4CJQA 2HK2A 4FLTA 4LH5A 2LA6A 2J0WA 3GCWP 3O9UA 1WF1A 4QCLA 4CZMA 2OHDA 3C3LA 1ASWA 4I6MA 3N9UC 4RKUC 1YTUA 4FK4A 4I6AA 1BOTO 1FXXA 5J2QB 4DZ6A 3EZUA 2CGJA 3QFHA 2Q0RA 3VAFA 2OTJN 2QWRA 3MM8A 1WSVA 3KNGA 3CJ5A 1NMNA 2YI1A 3QT5A 4OYZA 1H2UX 3BGRB 2XWYA 3KLFA 2MJNA 4LUBA 3NNHA 1Q9YA 2LSNA 2WC9A 1BCOA 4KPYA 4YDXA 2VICA 4DSIA 3M2UB 1HA1A 3NE6A 3ZO7A 4I7FB 5HP1A 5BREA 3O9QA 3LTOA 3SAGA 4JD2A 2J6SA 3PR5B 4A5AA 1T6DA 3HSJA 3EE3A 3FQLA 1R0CB 3NGZA 2ADCA 1OQ3A 3UN5A 4FF2A 3OQ2A 4NLQA 4B9UA 2N4CA 2PMHA 4CZKA 5B0EA 2O4GA 3G4SS 2VZ9A 3QGGA 4YUDA 4WFAL 4OHWA 4NA2A 4J8FA 2D0CA 4IFYB 2D0OA 3QLHB 4IG0B 3FDSA 4NYOA 1J6ZA 4ZVSB 4IOCQ 1RABB 4FWLA 4G1QB 3CJTA 1CJTA 3ZNJ1 2ASJA 4R8UA 4BC9A 1IBMF 3H20A 2JGUA 3AV9A 2G1HA 2YQ1A 4M3RA 2BBEA 3HHLB 1EHWA 3C2PA 1GFWB 4TN2A 1XMOF 5BRHA 1VQYA 4O44B 1C1CA 2PYJA 3ZC4A 3M05A 1NPRA 3G82A 3CQ8A 1H3DA 4DV5K 3HM8A 1V3ZA 1QHAA 4UZCA 4ZCLA 1SUQB 5LMUF 3J7AN 2RJZA 1NOZA 2PEHA 1F0XA 1U2VB 5C25B 3DLHA 4WU2A 4P72A 4EBEA 5GIOA 2MQ8A 3J80Y 1NOYA 2ADBA 2PO4A 1HR0K 2RHKA 2V4RA 4FWPA 2YXLA 2VWKA 3CERA 1FERA 3ZX3A 3H98A 3TWZA 1YITS 1N48A 1VQMS 4WFZA 3IR5B 2VQEK 1JLCB 2QC3A 1KQKA 2KYZA 3A8JA 2XYGB 3MM7B 1FVSA 5DG8A 1YTYA 1VRUB 3J81U 4XDCA 3MN7A 2CJQA 1VIOA 2W2PP 3U8XA 3P1GA 1NGDA 3QMLA 2MQMA 4X62F 3T5HA 2ABYA 2HVHA 5AZJB 1YBUA 4LR8A 3OYBA 3T3FA 5BN8A 1KNZA 4ED8A 1REGX 3W0LA 1BO5O 1YI2N 2A2DA 2FZKB 1S7IA 4CZLA 1S6UA 4GC7A 2CJKA 5HMWA 4USWA 1CLFA 2P9SB 5IWAF 1MA9B 5KFGA 2R7OA 2XYPB 2DD8S 4PKDB 1OYDA 2FTRA 4F3QA 2MQPA 3RGIA 3NF9A 1WAJA 5LL6d 3B4DA 4RJVA 1WJ9A 3VQTA 4YR0A 4XPCA 1S97A 2E5LJ 4K43A 3LAKA 1QAJA 2CVIA 5HROB 3DXSX 2J5AA 3ZT2A 1OVYA 1NGAA 2XLIA 1L3UA 2NXCA 3TUJC 4NASA 5AXKA 1CULA 4LR9A 2KB2A 2OAUA 2VBXA 1H98A 4JI6J 4M5GA 3IMQJ 4CLLA 2MKYA 1NRKA 3LP0A 4MK7A 3L2RA 1U1LA 4JI4K 3SUNA 1HQEA 4Y2CA 4RBTA 4MFBB 5LJ5Y 3CM5A 2VG6A 2HHXA 2W7AA 1CS4B 2EFNA 3V9UA 2FD2A 4AHCA 3ZT1A 4JI5J 3ISND 4KV8B 3BDEA 3WZ0A 1QE1A 4JKBA 3EXYA 2PEBA 5BR9A 2YTCA 4CWBA 2RNEA 2OA8A 3K2PA 5KFVA 4QYZK 2F8EX 3DM2B 4DJBA 3MAQA 4H5TA 5FPMA 2BGGA 1JKHA 2HEKA 4ZHRA 1S9EA 5ETVA 3DLGB 3TA1A 4BRLA 2WVCA 3DOKA 4L3QA 4N7TA 2V50A 1YZ7A 4DR3J 4O0NA 2R7SA 3TAQA 1TL3B 1X4FA 4I1TA 1K0TA 2UVRA 1A5VA 5ETRA 1U1PA 3A0IX 4TSXA 3NGKA 1NSKL 3KHYA 2QO3A 4IXCA 1A5WA 1RTDB 1YKWA 1Q5VA 1M5PC 2AYGA 4FNIA 2Y1LB 2XCPA 2OUGA 1Z25A 4I68A 1EQYA 5M1FA 2OEKA 3H5UA 3T1HJ 4MQ3A 5BPMA 4I4BA 3W60A 2IRYA 1RCOB 3E9LA 4JI2F 3N6MA 1Q79A 2KO1A 1VK3A 5HBMA 4FPRA 1IM6A 4NZ7A 3WEEA 3QEWA 2HBLA 1R0AB 4IDHA 3H90A 2VUGA 4BCAA 1XN9A 4J9PA 1S72S 2JFKA 2P1JA 2HQGA 2WONB 3GTYX 1UVJA 3N4QA 4CGIA 3EZWA 1TMMA 4HWIA 2O8EB 2VL1A 3THTA 1RWOB 4CBUA 4DR4F 4TQSA 3OBYA 2CQPA 2FVSA 1FRKA 2QG9B 4JK9A 3SMSA 2YKPA 5LJVA 3OFGA 2V69A 2EFVA 4FLXA 2BANA 2IA0A 5KFKA 2DNLA 2IDOA 2ZH2A 4B9MA 2VV5A 2V2KA 2ZKTA 3MEDB 1NGJA 4IWVA 2BACA 1RDUA 1REVA 1R43A 3ISNC 1OQ6A 2EFOA 3O5TB 3MEGA 3P4UB 4DR2K 2RN2A 3TARA 4KQZA 1RTIA 2VFVA 1C0GA 1RLCL 1OIAA 1N34J 2ZKUA 1CQMA 3AY0A 4WF9L 2DNPA 1MG7A 4U9RA 2DNHA 1V5IB 3M8YA 1ZZFA 2VPYB 1RHRB 1TU0B 3V9SA 4TY9A 1EETB 2WONA 4LR7A 3T41A 3V81B 1XC3A 2NZTA 1P8ZA 1PJ5A 5FD1A 4KH0B 3AY9A 1Y97A 2LQ8A 4M3TA 4WFBQ 3THYB 2YNIB 4NE9C 3CJ7A 1CC8A 4DN9A 5BYQA 5GMDA 4K4SA 5ETTA 1XMQJ 4RUCA 2MZRA 1KFDA 5CE3A 4NRTA 3OR2B 5DS7A