1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
3BR9A 1SUQA 3KK3B 4CEZA 4DTJA 4PUOA 5DGBA 4ZP6A 3MXJA 1TV6B 4K50A 2GV9A 2R8HA 1TAQA 3V6DB 4ECTA 4O4RA 2OZSA 3KMQA 2HMIA 1IKXA 4YR2A 3PW7A 2ATQA 4FBUA 2IS3A 3QO9B 1S4FA 4ICLB 1K6YA 4PWDA 3ISNC 3DLBA 4WFYA 4JLHA 4F3OA 1C0UB 1NHVA 3I0SB 3DRRA 1TGOA 3D5MA 3MEGA 3QINA 4FLZA 1HMVB 4CJLA 2R2UA 5JS2A 1JXLA 3OSPA 4O3SA 3SYZA 1S10A 1TAUA 3DLEA 3VQEA 1YVUA 4M3YA 4NRUA 3KK2A 4TQSA 1A5WA 3P1GA 2OPQA 3EZ5A 1GX6A 3WNFA 2KFNA 4DMNA 5T7BA 4NLSA 4ECVA 4CIEA 3MXMA 4ZPBA 1QE1B 4CK2A 3VQCA 1T94A 3FRZA 5KFVA 5KFLA 4IG0B 4CJPA 3DM2B 4J9LA 5KFGA 4Q45A 3HVTB 4O3QA 1D1UA 5KFOA 4MIAA 5I42B 3GV7B 4DL5A 2E9RX 4HCBA 3ZT3A 3K5NA 1RTHB 4KE5A 2IOCA 3JSMA 4I2QB 3K57A 4RW9B 2IJFA 3GYNA 1VSIA 4NYFA 5KFHA 1YTUA 4CJSA 2ASDA 3AV9A 1LW2A 5J2QA 4FJHA 2FVCA 4DL7A 4UQGA 3MEDB 2F8TA 1N5YB 2IMWP 3S9HA 1C2PA 3BSNA 4NLXA 3AO2A 2D0CA 2YNFB 3RRHA 4ZVFA 2VA2A 1C0TA 3BDPA 3TI0A 2GIQA 1MU2A 5EWFA 1ASWA 3IAYA 1NK5A 3DLHA 3QIPA 4MK8A 5EUHA 1U4BA 3HP9A 4GVMA 2QKKA 4MIBA 3GIMA 3MTKA 3ZSRA 2ZE2A 3HPGA 1G15A 3LPTA 4TQRA 1JL1A 4CJEA 1T03A 1HNIB 4B9TA 3S3MA 3EY1A 5HBMA 3FFIB 4ZVEA 3LANA 4JV1A 4DG1B 4F50A 4KTQA 4DQSA 4TSXA 3QZ7A 1B9FA 4OVLA 4KI6A 1I3AA 2KZMA 4Z4FA 4IG3B 3OL7A 1SV5B 2CJQA 4E19A 3OY9A 5HRSA 2GIRA 1HQUA 2ZKUA 3OSNA 4H4OA 2I5JB 1BHLA 3LALA 4FJ5A 4M3ZA 3PVXA 3OYLA 3V6HA 3HM9A 5FDLB 4O5BA 2ILZA 3CO9A 2HWIA 1KVAA 4X2BA 2BANA 3JYTB 4BE2A 1IKYA 4K4XA 4N47A 1N48A 3KKSA 4DL2A 1REVA 1VSEA 1VSMA 5HP1A 4CHZA 2V9WA 3K5MA 4R0EA 3HJFA 4MH8A 3V9ZA 5SWMA 3CIZA 2UVVA 3T5LA 2YKNA 1UAXA 3SV4A 2BRKA 5DQGA 3ZSVA 1L3VA 3G6YA 3E01A 4RW7B 3WNEA 1Z4UA 3QIOA 3BQ2A 3DLGA 3EPGA 3SUNA 5F8HA 2JEFA 1JLEA 1U47A 4DQRA 3PZPA 3UQSA 5DQHA 3DRPA 3PHEA 5F8LA 2UVRA 5KFFA 3KHHA 3RMDA 3V9SA 4Z4EA 2X74A 3H2LA 4B8AB 2F96A 4ZTJA 1BQMB 3DDKA 5C42B 2YKMB 3BGRB 4BE0A 2G8FA 4ID5A 3SFUA 1K1QA 5L1JA 1A5XA 3QLHA 1JLFA 2BQRA 1FKOB 2R8KA 3CM6A 4NLOA 1S0OA 2WRMA 2GUIA 1L3SA 2Q3SA 2BE2A 2AU0A 4F4KA 2WONB 4OLAA 4Q0BB 1QHTA 1TL3A 3PW4A 3M8SA 4GC6A 4DFJA 3CJ5A 5FRNA 1RBVA 4WE1B 4DU4A 2ZQBA 2J6UA 1SKWA 2OYQA 4KO0A 5L1KA 3ULDA 3OYAA 4CF0A 1A5VA 4B3OB 1RTIB 3MAQA 1SL0A 3D28A 4DU3A 4RW4A 4IH6A 2FVQA 3H4BA 3AA4A 4DTUA 4M3RA 2NUBA 4PA1A 5HROB 2W9CA 4C8MA 4CEBA 1RDAA 4AILC 2HNYA 2LSNA 1I6JA 3KLHA 3OS2A 4FLXA 2W9BA 1S1XA 3DLKB 3KLIB 5E41A 4E3SA 2W7OA 1I39A 4WYLA 1L3TA 3AVLA 1KVBA 3KJVA 2XY8A 1WSFA 4FJMA 1NJXA 4QOZB 4LQ9A 4GMJB 1BGXT 1S1VA 2AX0A 3SCXA 1RTDA 4KSEB 2HWHA 2EX3A 3PR5B 3OYKA 3DLRA 4KHNA 4FW2A 3AA3A 1RBTA 2WCXA 1DTTB 1KRPA 3VA3A 4QW8A 2HHUA 1RYSA 4LSLA 4WFZA 3TAEA 2E9TA 4LSNB 4O4GA 3SQ2A 4NLWA 4KHYA 1S49A 1N4LA 4OJRA 1HNVA 4CERA 2C2RA 5KG0A 2IC3B 3NGIA 4WXOA 4MKAA 1EP4A 1JLBB 4PUOB 2V0NA 4IBNA 3DYAB 2ETJA 1KLNA 2DFEA 1CZBA 4CJKA 3RB3A 4NCAA 2FJXA 4CEQA 3V1QA 5D3GB 3IS9B 1HQEA 4NYNA 3LAKA 1K1SA 5HLFA 1RT4A 1IKXB 5KFBA 3VQ6A 2F8EX 4DTXA 3DI6A 1TKXA 4ELVA 3AVIA 4J9OA 3GIJA 1R0AA 4ED2A 1TL1A 2D5RA 1L3UA 4HKQA 4FJ9A 3NBPA 2X78A 2V4QA 4J9QA 1TVRB 4TYBA 1L5UA 3KHGA 4M42A 3SPYA 3DRRB 3LP0A 4I2PB 4ECRA 3IGVA 3H5YA 3RR8A 4IFVB 4KV8A 3ZT4A 1T8EA 4FYDA 1YT3A 3RMAA 1KLMA 3KKRA 5DMRA 1LW0B 3H98A 1NKBA 3DOLA 3SFGA 4PQUB 1ZYQA 4FW1A 4RNNA 3CQ8A 4J2BA 1NJYA 4TY8A 1NJWA 4EEYA 4M3XA 4Y1DA 4QW9A 3OYFA 2YV0X 4F8RA 1EXQA 2XCAA 5KT6A 1EETA 4N41A 2PZSA 3OYNA 1T7PA 4ZP9A 3TQ1A 1ZBIA 2HNZA 4NCGB 3N6MA 2ATLA 1QQCA 2R8JA 3KLGA 3I5CA 1C6VA 3O3HA 1WSEA 2B43A 2ASJA 4ELTA 5KFDA 3LAMA 1C1BA 2XWYA 1RDCA 3OL8A 4LH4A 1FK9B 2AWZA 3I0RA 3SI6A 4IDKA 4FJGA 2BQ3A 3T5KA 1NK9A 5KG3A 3C6UA 4KHSA 2FVRA 4M94A 3TABA 1RCHA 4CHYA 4RU9A 1SL1A 3FDSA 1S0MA 3VQBA 1RA6A 2VWKA 5KFXA 2VG6A 1JLAB 5J2QB 4RW8A 4EBDA 3RMCA 2BRLA 5J1EB 4OLBA 5DLFA 1ITGA 4Z4IA 4RUAA 2EHGA 5KRSA 4H8KA 2QK9A 1VRUB 3WNGA 3AVNA 1HPZB 5KFRA 3TAMA 1O1WA 1MU2B 2R2SA 2C28A 5I3UB 3N6NA 1RT3A 3G86A 4O55A 3HYFA 4FVMA 3PJXA 1NK8A 4KTWA 3NGZA 3NF6A 2XGPA 4MK7A 2FBTA 4IRKA 4NLDA 5J2NB 1RNHA 4FM1A 3SUPA 4JV0A 4ZHRB 5J2PA 3AVBA 1CXUA 4DQPA 5J2MB 4WZQA 3EZUA 4JRQA 5HBMB 3D45A 3TAPA 4M3TA 5KFEA 4I7FA 3GV5B 4DL3A 1RBSA 3KLVA 3P5JA 4KPYA 1SH3A 4B9UA 1ZETA 4CHPA 3GILA 1S1WA 4OPJA 2E9ZA 2QXFA 4M3WA 3SQ4A 1WLJA 3NDKA 2XRIA 1HRHA 1EX4A 1N6QB 2ZD1A 3QEPA 3ZSZA 3NKYA 4TY9A 2OPRA 2YNGA 2AX1A 4NLRA 4FZXC 3ZSOA 2PY5A 2JC1A 3M9NB 2I1RA 1KCFA 2G8UA 4IR9A 3U6FA 3TARA 1VK0A 1WSJA 3GV8B 4AHCA 2BANB 1DLOB 3IRXA 3ICLA 1C1CA 5KGXA 3DMJB 1IKYB 2JEGA 3RTVA 2E6LA 3TANA 2D0BA 4QWEA 4K4ZA 2IBKA 2IA6A 5DG8A 5C25A 4EO6A 3G10A 4CESA 4DSJA 2P5GA 4TLRA 3SZ2A 3QESA 2J6SA 3PR4A 3MF5A 1RDRA 4B9MA 4ED0A 3GIIA 1HYSB 3LP1B 4EZ9A 2FLNA 4M41A 4FK2A 5KG4A 3HPOA 2W42A 4KI4A 1BQNA 3NH2A 3Q8SB 3RRGA 3QEWA 3OYBA 1BL3A 4J9KA 1TKZA 2EC0A 2RPIA 4O44B 5F9NA 4BWMA 4IFYA 4W5NA 1RT5A 3N6LA 3PX6A 4CEFA 1JKHA 4FLUA 1NK0A 4KHWA 3OYGA 2HHVA 1LWCA 4Q8EA 3QGIA 2BDPA 1JXEA 1IKVA 3ZT2A 3M8QA 1JXBA 4E7LA 4J9SA 3KIOA 4LD0A 3T1AA 3NAHA 5CYMA 1JLCB 1RT2B 3D0PA 4ECZA 4ECSA 3HSTB 4NLPA 1J9AA 4E89A 3RAXA 2OPSB 4KB1A 2G8WA 2YNIA 2W9AA 3V1RA 4RW6B 4CIGA 3OS0A 3O4QA 2O4IA 3FQKA 3KMSA 3OL9A 4OGEA 4BDZA 1NOYA 4XO0A 1LWFA 3MFIA 2PYLA 4F3TA 4L8RB 1JLQA 5JS1A 1NOZA 1VRTA 3SI8A 5KFCA 1LAVA 4NLVA 1Q8IA 4DTMA 3LZIA 4B9LA 1HYZA 4CEEA 2VG5A 3ALYA 4GW6A 2W9CB 1LWEB 2RKIA 3KLHB 1FXXA 3DOKA 2AJQA 4OPKA 5DK5A 1S9GA 5EWEA 2JLEA 2D0AA 4K8ZA 3OYIA 1S9EA 1NK7A 3PW5A 2OPPB 1XI1A 3NF7A 5F8JA 3DRSB 3AO3A 1NHUA 3C95A 3V1OA 1FKPA 5KT2A 4CGJA 3AO5A 3QIDA 3U3YA 1T3NA 3SV3A 4DFPA 2FJVA 4E0DA 1RT7B 3OYEA 1IM4A 3FSIA 4DQIA 4DS5A 5CY4A 2HVIA 3KK3A 2FJWA 4OKEA 4KB7A 4NLGA 4KBIA 1C0MA 4CFDA 1TV6A 5SZTA 4O3PA 2E6MA 1S6QA 3V81B 3NL0A 4B9NA 4KHUA 2QKBA 3OYDA 2Z1HA 3V6DA 4DL4A 1ZTWA 5KFMA 4FJKA 4ZPDA 2KW4A 4F4YA 3IN5A 3CG7A 3QO9A 3H5XA 3ZT1A 4KRFA 4DF8A 5HLFB 1RT4B 1NK6A 2W7PA 4ICLA 3PO5A 1TKXB 4E7KA 5C24B 4ECYA 5K14A 1VSHA 3THVA 2FBVA 4MKBA 1NK4A 4OKKA 3NBPB 3I0SA 1QSYA 3LPUA 4URGA 3TR8A 2FVPA 3LZJA 1HMVA 3HPHA 4C8KA 1BI4B 3BSAA 3H4DA 3OHBA 2R2TA 3ZSXA 4O3OA 2YNHB 2P1JA 1VSFA 4OL8A 3OS1A 3QYYA 1Q9XA 4J9RA 4FM0A 1WNEA 1KLMB 2KZZA 3C6TA 5KFPA 3DOLB 3V4IA 2HNDA 2ALZA 3KLFB 4FZYA 1VSDA 4JS4A 4FJIA 4FK4A 2XI2A 4WXWA 4B08A 1QE1A 4NCBA 2HVHA 4DL6A 3DM2A 4YP3A 4KKOB 2X6NA 1S48A 2XY7A 3HVTA 3TAGA 1U09A 2JEJA 2IM3A 4RZRA 1QTMA 1VSJA 1S5JA 5I42A 4CF8A 3ITHA 3BREA 1XHXA 3QETA 3QEVA 2HNZB 3UDLA 3QNNA 4CGGA 3H08A 4FS2A 2IM2A 4IH7A 1C1BB 1S6PB 4I2QA 2B4JA 4ECUA 4RW9A 4IRDA 4CJQA 3NFAA 4AH9A 3SUOA 4RNMA 4W5QA 5L1IA 4EYIB 4O0IA 1T05B 2C2DA 4MFBB 3PO4A 4WZMA 4CFBA 3VQPA 2F8SA 3MEDA 4RUCA 2HHQA 1N5YA 1B9DA 1CXQA 2VG6B 3MXIA 2WK4A 3MECA 1UA1A 4RW8B 2YNFA 3PX0A 4CIFA 5F8GA 2P51A 1JLGB 4Y3CA 3AVKA 4CFCA 3QEIA 1TKDA 5EU7A 1D5AA 1DTQB 3KD1E 1J5OB 4CJRA 4NRTA 3MR5A 3AO4A 1F21A 4N76A 2Z1GA 2IM1A 1RT3B 2OH2A 3S3OA 5CZ2A 3L2RA 5KG5A 3L2QA 3NF8A 4CF9A 3HP6A 4J9NA 5KT7A 1D9FA 4CGFA 1HNIA 1S1TB 3Q8RB 4KB0A 5KFSA 3HVWA 5F8NA 2JEIA 1UWBB 3LP3A 4DG1A 3ZCMA 1JIHA 1RTJB 5KRTA 4KHRA 4KFBA 3LP2A 4Q43A 4IG3A 4K4WA 4CGDA 3BJYA 1SUQB 4EO8A 4ECXA 3I5BA 4DF4A 3CFOA 1RDBA 3M8RA 2D7SA 2I5JA 4GC7A 4DSIA 2O4GA 5FDLA 2RDIA 5JXSA 2BGGA 5CYQA 1TK5A 1S97A 3JYTA 3TVKA 2YHAA 2KFZA 3MR3A 4TN2A 3M8PA 2G8HA 2AQ4A 1KSPA 2HMIB 1TP7A 3B6PA 3MEEA 4F4WA 4B8CA 4G3IA 1WSHA 1SH2A 1S0NA 3MR6A 3KLEA 3GIKA 4ED1A 4CEOA 4DTPA 4PWDB 2FLPA 4FZZA 4DQQA 5FRMA 5L9XA 3PV8A 2AGQA 4KHMA 5F9LA 1WAJA 4RW7A 3MEGB 2IGIA 2FBXA 3CJ3A 4NLYA 1BISA 3SQ1A 4FJ8A 2IAJA 3WNHA 4K4VA 3DLEB 4Q5VA 3AA2A 3KK2B 1RAJA 4H54A 1RT1A 5KI6A 1KHWA 1IKWA 1TKZB 4Z4CA 2OPQB 3FQLA 4DTRA 5F8MA 3PW0A 4JRPA 1UA0A 1BQMA 2G8KA 4CK1A 4CHQA 4MK9A 3OVNA 2YKMA 1JKHB 4Y1CA 3BGRA 1QUVA 4IRCA 4W5TA 4I9LA 3G6XA 4CK3A 5HRPA 3KHLA 4CJUA 3BSOA 1IKVB 4CF2A 4DWIA 2XY5A 1ZBHA 4HYKA 2WB4A 3UIQA 2KTQA 4Z4GA 4FLWA 4EBEA 4IH5A 1XR5A 3JSMB 4ZVHA 5HRRA 2WHOA 3ISND 5DLGA 4AHTA 3VQ7A 1WSIA 1B92A 4WE1A 4YNQA 1LW2B 4NLQA 3CFPA 3VQ5A 3V9UA 3VA0A 4YFUA 3T19A 2FBYA 5KTQA 3NGDA 2CKWA 3H59A 3U3GA 2JC0A 4ED8A 1C0TB 3KNAA 4KAZA 3KK1A 2B5JA 1VRTB 1KHVA 1NJZA 1KFSA 5HROA 3QIPB 4YR0A 4DSEA 3HT3A 1CZ9A 4R8UA 3VQ8A 1Q9YA 3DLKA 3KLIA 5KFIA 2ZE2B 1EKEA 3T5HA 4OGCA 3DOKB 5KFYA 1T03B 5KG7A 2Y1IA 3RR7A 4AHVA 1YVFA 4Y34A 2UUWA 2UVUA 1TKTA 4CJTA 3L3VA 1LAWA 2PYJA 4ZPCA 4BDYA 4DSKA 2WOMA 3TAQA 4R5PA 3OLAA 4CJ5A 3AVAA 1HQUB 4CGHA 4H4OB 4LSNA 1JL2A 4B9SA 2KQ2A 3UR0A 4C8LA 4NLUA 4J9MA 4DSFA 5EWGA 2IC3A 4XIUA 4KHQA 4QWCA 1ZBFA 1JLBA 3DYAA 3AVCA 2Z1JA 5JUMA 4U6PA 1J53A 1S6QB 1ZBUA 4G1QA 4HVJA 1NNDA 2W8LA 1D0EA 1QAJA 3NAIA 1REVB 2B6AA 3OLBA 5D3GA 4IKFA 3TAFA 3L8BA 1S1UA 5HP1B 3IS9A 3PW2A 4FK0A 5KFAA 2YHBA 2VG7A 2R2RA 3MFHA 4JV2A 3L2UA 3OYCA 4FLYA 2J6TA 3SNNA 4IKAA 2YKNB 4FJNA 4J9PA 3Q8QB 4WYWA 4NLTA 3QEXA 1D9DA 3E01B 5K14B 1TVRA 3DLGB 4HCCA 1SKSA 4O3RA 4HUEA 5KFTA 1JLEB 1J54A 4I2PA 4ED7A 3K59A 3V9WA 2RF2A 4IFVA 3F9KA 4Z0UA 1TQLA 3DRPB 3OYHA 1XC9A 1LW0A 4OKJA 5KFJA 3AVJA 5KGWA 1RYRA 4NZ0A 3VN5A 4DFKA 4PQUA 3VQQA 4ZMMA 4F4ZA 1XHZA 1Y97A 1RT6A 3C6TB 3V4IB 2HNDB 4ID5B 1WNSA 3AVFA 1VSKA 3CJ4A 4RNHA 1W9HA 1NKEA 3QLHB 4EP4A 1JLFB 2IDOA 4QWDA 2AGPA 1KTQA 5KFZA 4ZP7A 4I9QA 3LWMA 1ZTTA 4ZPAA 2BE2B 2XC9A 4NCGA 2HHXA 4CJWA 2HHTA 4F4XA 5KG1A 1TL3B 4RG8A 3ITHB 1RA7A 1W25A 4LH5A 5C5JA 1WN7A 4AHRA 1HJRA 1FK9A 3GQCA 3NE6A 1JX4A 3HL8A 4CJ3A 2Y1JA 4W5OA 4KO0B 3CDWA 4NYZA 4DTSA 4C8NA 4N5SA 3OYJA 1JLAA 4AHUA 4DTOA 4DLGA 1NKCA 1U49A 4RW4B 4CJ4A 5J1EA 3V6KA 3ZT0A 2ILYA 5DGAA 3CWJA 3MECB 1VSLA 2FVSA 2DPJA 1VRUA 4M95A 2AGOA 2HNYB 1HPZA 3QERA 4H4MA 3L2WA 2QV6A 2W9BB 1S1XB 5I3UA 1HYVA 4DS4A 3KJVB 3C94A 3IG1A 3M9OB 4DLEA 5DQIA 5F8IA 5J2NA 1LV5A 1S1VB 4BACA 4CJVA 4ZHRA 4U7CA 3OJUA 4KAIA 5J2MA 3PUFA 2HHSA 1RTDB 2VWJA 3E51A 1QS4A 3RBEA 3K5LA 3KHRA 5KG2A 3ZSYA 4FJ7A 3NF9A 2FLLA 4KTZA 1Z26A 4Z4HA 1CLQA 5KFUA 4QWBA 4C8OA 4KFBB 4LSLB 3RWUA 1TK0A 2P5OA 3LP2B 4O4GB 4YR3A 4QAGA 4FLTA 1N6QA 1WSGA 1HNVB 2IJNA 1BIZA 4B9VA 4YMEA 1EP4B 5HRNA 1BCOA 3CDEA 3SJJA 3M9MB 2HW3A 4DU1A 4CCHA 5CYQB 2V4RA 3RB0A 4CHNA 1HQEB 1DLOA 5DG9A 3OJSA 3M8PB 1X9WA 3DMJA 4W5RA 1IH7A 3MEEB 1S9FA 3DI6B 1U04A 4MQ3A 3VQAA 3KLEB 4K4UA 1R0AB 3L2VA 1TL1B 3HXMA 1C0UA 2A1RA 3ZSWA 2XO7A 3VQSA 4O3NA 1BCMA 4YQWA 3T3FA 1Z25A 4ED6A 3SPZA 1RILA 1HYSA 1XWLA 3LP0B 4EYHB 3LP1A 4EZ6A 2GBZA 4DSLA 4RNOA 3RMBA 4E7IA 2W8KA 3AVMA 4KV8B 1OS5A 1RDDA 3Q8PB 2IAJB 2XCPA 3OL6A 4EBCA 1X9SA 3NAEA 2GC8A 4O44A 1RT1B 1IKWB 3UPFA 1UOCA 4TY8B 2XHBA 4IG0A 1GOAA 3I5AA 2D41A 3HK2A 1D8YA 4Y2CA 3NCIA 3SQ0A 1ASVA 3CFRA 1EETB 4FJXA 2DFHA 5KT5A 3H5UA 5KG6A 4AHSA 3OYMA 1RTHA 4ECWA 4ECQA 3KLGB 4Y2AA 1XR6A 3F73A 4ED3A 2RN2A 5KFWA 3NH1A 1JLCA 1RT2A 2R8IA 4CECA 1HARA 5T14A 5EDWA 3PJWA 3CJ0A 1BIUA 3KD5E 3I0RB 4IDKB 2G8IA 3MR2A 3C6UB 2OPSA 4EP5A 3EPIA 1GOCA 2VA3A 3SUQA 1QSLA 2QE5A 4FS1A 4RNFA 4RW6A 5FROA 4CEAA 4CJFA 4XPCA 3AVGA 3CVKA 3BQ1A 1U48A 2HAIA 3IGNA 4XPEA 4Q44A 3CM5A 2JGUA 4CF1A 3TAMB 3KK1B 3I8DA 3AA5X 2B5JB 3QNOA 1CSJA 2UVWA 3HVAA 1LWEA 2DTUA 1QAIA 2E4LA 4JS5A 3VQ4A 4R8UB 3CDUA 3T5JA 3FFIA 4CEDA 5J2PB 2R7YA 3O4NA 4J2DA 2OPPA 5L1LA 1IG9A 1RBUA 3HKWA 3DRSA 3G0ZA 3S3NA 3G6VA 4I7FB 4J2EA 2HB5A 4FJLA 1TKTB 4HUGA 3AVHA 1S1WB 1SV5A 2WTFA 3KOAA 3AO1A 2G8VA 2X6SA 1U45A 2WOMB 4E1NA 3H5SA 4DEZA 2Z1IA 2ZD1B 4R5PB 2BQUA 2DFFA 1RT7A 4ZP8A 2OPRB 4K8XA 2YNGB 3QGHA 2BR0A 4O0JA 4QCLA 4ID1A 3RB4A 4DFMA 3O3FA 2IM0A 2C22A 3P83D 3V81A 4FJJA 3NGYA 4WFXA 1ASUA 5KT3A 4J2AA 3IRXB 4HTUA 1C1CB 3PY8A 4ZVGA 4FLVA 4M45A 4FCYA 4G1QB 1RBRA 3V9XA 2B6AB 4URQU 2ASLA 2DY4A 2OZMA 1S1UB 3QZ8A 2FC0A 3KTQA 5C25B 4BWJA 3OHAA 2VG7B 2ITGA 3K58A 1SL2A 4QPXA 3L3UA 5KFQA 5C24A 4HHTA 4M3UA 4DTNA 1XR7A 4K4TA 3A2FA 1BQNB 2HHWA 2RDJA 3HHKA 4CHOA 4K4SA 1BI4A 4CE9A 1KVCA 2YNHA 4BE1A 3H40A 1WAFA 2RF2B 4BDPA 1GOBA 4FBTA 2XI3A 4K4YA 4FM2A 4E1MA 5CZ1A 4IFYB 1RT5B 5DG7A 4IR1A 5C42A 3KLFA 3K5OA 2R8GA 1LWCB 4TXSA 4LQ3A 1RT6B 1W0HA 3LWLA 3M8QB 1IO2A 4N56A 4KKOA 1FKOA 4TYAA 3EYZA 4E7JA 3CJ2A 2WONA 2O5DA 5CYMB 4Q0BA 3NHGA 5KT4A 4Q8FA 1GX5A 2C2EA 4URSA 1KFDA 4LY7A 2A1SA 2YNIB 4KREA 4F2SA 1S6PA 3PX4A 5KFNA 3LDSA 1X9MA 4F2RA 3QGGA 1N56A 1T05A 3NMAA 4MFBA 1LWFB 3RAQA 4B3OA 1SKRA 1RTIA 3HO1A 1MMLA 4HUFA 3HVRA 1JLQB 3BQ0A 1ZBLA 4PY5A 4IOBA 1JLGA 3O3GA 3ZSQA 2OA8A 3BSCA 2VG5B 4E7HA 2D3ZA 1SH0A 2UUTA 1DTQA 2RKIB 1J5OA 4H4MB 2XGQA 1S9GB 4IQXA 3K2PA 1TK8A 1X1PA 4CGIA 1QSSA 3V6JA 3ASMA 1S9EB 4JUZA 3IG1B 4FXDA 5KFKA 2D3UA 1S1TA 4CFAA 2XY6A 4QWAA 3RBDA 1YTAA 3B6OA 1UWBA 1FKPB 1DTTA 1RTJA 3TWHA 3NH0A 1C1AA 4ELUA 3VQ9A 3RB6A 2DPIA 3CYMA 4ZTFA 3VQDA
chains in the Genus database with same CATH superfamily
3BR9A 1SUQA 3KK3B 1WACA 5DGBA 2K3IA 1X4GA 1H1VA 2GV9A 1PIEA 2W6KA 1ZM2A 1OO0B 4ECTA 1VQOS 5AQWA 4M5NA 1OH8A 2MY8A 2VIHA 3GL1A 3PSFA 1NGBA 1YJNN 4U96A 2HFUA 2OSQA 3MPWA 3ZFVA 4FBUA 1CJUA 1XBWA 1S4FA 2Y3YA 2BACA 2NXEA 3N79A 3OA9A 4PWDA 3TX0A 4K8RA 5GAHP 2LA6A 4U8YA 3GE9A 3KUGA 1C0UB 2ROPA 4DX7A 3A8YA 3KKFA 4M5MA 3VF2A 3MEGA 5GAHI 2OO4A 4PWUA 2E2PA 3BP8A 1IV0A 1YXQA 5JS2A 4FO0A 4F9OA 2DHSA 4DUYF 2FHMA 1TAUA 2B0GA 2MQ8A 1YITN 4M3YA 1FJEB 3SCKE 1CQNA 4C0HA 1GX6A 2KFNA 4CZLA 3EVMA 2V9KA 2J4RA 3MXMA 1T9VA 2DY1A 1KDNA 2RRNA 4NXNF 1S99A 4CK2A 3VQCA 4QOTA 3O44A 3FRZA 5KFVA 4IG0B 4CJPA 3DM2B 4J9LA 5KFGA 4O3QA 4JI0F 1D1UA 2AV5A 3GV7B 4DL5A 2E9RX 3SDEB 2VC1A 3K89A 3R6GB 4F0MA 3L7PA 3HLUA 2HZVA 4X65F 4U7UK 3JSMA 3K57A 3QFPA 2IJFA 1VSIA 2P5VA 5C12A 3U27A 4CJSA 3AV9A 5G0RA 4FJHA 2E5JA 2QL9B 2OANA 2J8AA 4BRCA 2F8TA 2IMWP 3S9HA 3BO3A 3BSNA 1Q53A 3AO2A 2VA2A 1Y7PA 4AL5A 3JAMY 1NLVA 3O5TB 5EWFA 3R2CJ 3NMUA 1VS3A 3QIPA 3HHLD 5EUHA 1U4BA 3HP9A 2QKKA 4NI2A 5AJ3F 3VZHA 2MKJA 4WYBA 3PIPQ 2ZE2A 1YRTA 4TQRA 3THWB 2E2QA 3S3MA 1J6ZA 5RUBA 1JQGA 4JV1A 4F50A 2GQCA 1ZAWA 3K17A 4OVLA 4QU6A 4KI6A 1F5CA 1Y11A 1I3AA 4Z4FA 2CPXA 2HHHK 3OL7A 2YH1A 1BOTO 4U7BA 2GHWA 4H4OA 2I5JB 3CCMN 2ZVIA 2YVSA 5FDLB 4BE2A 1IQTA 2QA4N 1N48A 1HR0K 3R2DJ 3I4PA 3FC9A 1VSEA 5HP1A 2V9WA 3CCLS 1WC6A 4DR7J 1MN7A 1U1PA 3W60A 2HK2A 4DV6K 3UN2A 1U0HA 3M6XA 1V3SA 5EGYA 4ZPTR 2YKNA 1UAXA 2ZZMA 3SV4A 2HRTA 3ZC4A 5IM0B 5DQGA 3G6YA 1TYQA 1Z4UA 3QIOA 1UW9A 4DV5F 3HKZD 2FHJD 4F02A 4EK2A 4O8KA 4DQRA 2N3OA 5KFFA 2LP4A 3RMDA 4Y2MA 4Z4EA 5C15A 3H2VE 3N5BA 2F96A 3ZX2A 4J91A 3BB5A 4YOXA 3K2YA 2DNMA 3FZLA 2O8CA 3KG1A 1XJWB 1RQ0A 5K8OA 1M1HA 2OD4A 2CWXA 5K20B 2QLXA 1HW9A 4WU2A 4NLOA 2Q3SA 3A4TA 3D2EA 2WONB 4WFAQ 4OLAA 1LOTB 3DNCA 4JI8F 5CA5A 2KYXA 3PW4A 3AJ2A 4DFJA 4GC6A 1HBOA 2X1FA 4OZLA 1NSPA 3MN9A 5FRNA 3MMAB 1SKWA 2V8PA 3NWGA 2XSFA 4USHA 4YOEA 1U26A 1A5VA 2EXUA 3ETOA 4LF4F 1RTIB 2NXUA 3D28A 1Q16B 3D3CJ 3CMAS 4M3RA 4K59A 4C8MA 5HROB 4CEBA 4AILC 1I6JA 5JJBA 5JVGL 5CR4A 4DUYJ 2Y0SD 2D0OA 4OYIA 2DGVA 5E41A 4E3SA 2W7OA 4AM7A 1QVGR 1NGDA 5CHIA 2XY8A 2O3DA 4FJMA 2OHDA 1MWZA 2DNNA 2HBLA 2CDRB 4ERDA 3IMXA 3V5RA 4NXNJ 1VQNN 1N32F 1S0VA 1S1VA 2AJFE 1KP6A 1NDKA 3WIUA 2FPHX 2P9GA 3SCXA 1U6FA 3D2FA 4G65A 1SBRA 3PYGA 1RWKB 4BG9A 4JI0J 2I7PA 3OYKA 1NDCA 3L9ZA 3DLRA 4KHNA 4RWWA 5AQFA 1JJHA 7FD1A 2NCKL 3AA3A 2BM1A 1RAAB 3O5BA 1KRPA 3VA3A 4NLWA 2A18A 2HZAA 3FUYA 4OJRA 1HNVA 1VQ6S 4CERA 2C2RA 3NGIA 4EWTA 4WXOA 2W2OP 3J8AA 1EP4A 1Q82O 4LF5K 1BXNA 3O3LA 3ZTSA 1KLNA 3KDOA 3EE3A 3RB3A 4KC5A 5A2QO 3J80O 1K1SA 2CQ3A 3MCPA 2J0QD 3TJAA 2HBKA 2F8EX 4ZA1A 1TKXA 3A3OB 5B0GA 1CJUB 3TYTA 4DCHA 3GIJA 1TL1A 1DJ0A 4HKQA 4IO9Q 3NBPA 3C7NA 1H74A 5AJ3J 2AYGA 3KHGA 2QFJA 1S59A 2HBMA 4ECRA 2JWLA 4PG6A 3ZT4A 1T8EA 4FYDA 4ILHA 5DMRA 1NGIA 1NSQA 3K9JA 1XMQK 2DRAA 2EPIA 4K0KF 2C3YA 4X4OA 3SFGA 2YJFA 1FX4A 3CMQA 1GLEG 2VF3A 4RNNA 3MM9A 2DR8A 4M3XA 3HTVA 2KDOA 2YV0X 3OYFA 1PBAA 2PZSA 2Q1NA 1NZAA 2DNHA 1XQSC 3MN6A 3CJBA 4ILLA 1O8BA 5BR8K 3HSGA 2B43A 2ASJA 4ELTA 2QW9A 3LAMA 3FZMA 4LH4A 1FK9B 1HI0P 1NK9A 2YQ3A 2LCWA 5LJWA 2X3GA 3T1HF 2FVRA 2IVOA 2PBDA 2SXLA 4ZN3A 5BR9A 4DV1F 4I6MB 2XMMA 1S0MA 2VG6A 4EBDA 2YCHA 1WC1A 4ZIWA 3DLLL 1J2VA 2V8VA 4DV5J 4Z4IA 1R8PA 1UEVA 4H8KA 1VRUB 2HGNA 1HPZB 3O6QA 1O13A 3VGMA 3GLJA 3G86A 3M05A 2MJNA 1FFWB 2DNZA 4EU0A 2VICA 2JFDA 1UFWA 2XGPA 4MK7A 4NI2B 2FBTA 4FYYB 4IRKA 1RNHA 1PYTA 5J2PA 1QTNB 2V8GA 3GB0A 2WVBA 4WZQA 2BJDA 5ETTA 5B0AA 2RQ4A 2VKRA 1F0XA 3BGFA 1IUJA 2CQ0A 3TAPA 2UUAK 4I7FA 6FD1A 4KPYA 1BUPA 3IWLA 3RYLA 4L3KA 3GILA 5CYJA 1CJKA 4DCOB 3JTNA 3SQ4A 3QWUA 1HRHA 3CTRA 1EX4A 4JI8J 4JI4K 3TA0A 3UDCA 3HI0A 3QT8A 5K8NA 2OPRA 2V8DA 2HGMA 3D6TB 2I1RA 5C10A 4IR9A 3CEDA 3CJKB 1WSJA 1DLOB 1NRKA 1NUEA 3IRXA 3ICLA 4Y28C 5KGXA 3C65A 2FYXA 2Q43A 4LF4J 4CLFA 1N88A 4XH4A 4M63A 3NRBA 3D67A 3G10A 2HRYA 4ZKAA 4C8ZA 2ZBPA 5HATA 2BV3A 4BR9A 2WBMA 1QVGM 3CHWA 3QESA 1YJ7A 3D2WA 2Q6BA 4EZ9A 2ZHBA 1AFIA 1TYQB 3OV7A 4HVZA 4M41A 3O8MA 5KG4A 1WDDA 1YBUA 1JJ2R 3NH2A 4KGXB 3WQTA 2ZWOA 1N32J 3MMBA 2DIVA 3G8SA 4GKJF 4ITSA 2RPIA 1N5SA 3HZ6A 2FXUA 3Q2TC 1R89A 4W5NA 1S7HA 1JKHA 4KHWA 1NK0A 4DR1F 2QA4G 2W4PA 3VPZA 2EBGA 3RRKA 1H2TZ 3HHEA 3BZQA 3MPYA 4J9SA 1NJIT 1RHKB 2VPYB 3T1AA 4IQMA 1RT2B 4ECZA 4I67A 4E89A 1WF0A 2AP6A 2DTJA 4DX5A 3D2EB 1WUUA 3D1OA 2G8WA 4ZITA 2I6WA 1RWMB 4PR6A 3TVZA 2O8EB 4RW6B 3O4QA 3C8YA 2O4IA 3L7OA 3FQKA 3KMSA 2CPIA 3CCQS 1D4XA 4BDZA 3W5YA 4NX9A 3GJSB 4XO0A 2E1MC 4DPXA 1E6VB 3IO1A 4FYXB 1JLQA 3SLCA 4LUBA 3MM6A 4JEPA 4LBHA 5KFCA 4FSVA 4IEEA 2XZWA 2PI4A 4YB1P 4NLVA 3NOCA 4B9LA 3CI5A 2RRAA 2ZH4A 2O8DA 1KQFB 2O8BB 1RJJA 5BJRA 4K0KJ 2AJQA 2IBOA 1OQ3A 3AGKA 1Y4ZB 4U9RA 4K8ZA 1VDHA 3RSEB 1NHKL 3PW5A 3PYFA 5F8JA 3QFHA 4C0BA 2DK2A 3BGLA 4WTYA 1P27B 1VQ4S 2CJYB 1SJ3P 5KPRA 3KUHA 4ETXA 4NA2A 2FJVA 1RT7B 3FSIA 1GMVA 2HVIA 4OKEA 4PXEA 5B0DA 1YJNS 2NPIA 1C0MA 4CFDA 1TV6A 3SQGB 5SZTA 3T1HJ 1NMNA 1E6YA 3V81B 5DDOC 2AZ1A 1YX2A 1TELA 5GINA 3MM8B 4H4KA 5C2GA 4DV1J 2Z1HA 3V6DA 1H73A 3ZETA 1Q8KA 2QLBB 1ZTWA 3WQPA 1Y3JA 2E1PA 3PJ9A 2KW4A 4F4YA 2YQ1A 4P7TA 3IN5A 1FCAA 2VCPA 3THYA 3ZT1A 4K41A 1O0PA 4OYOA 1FNMA 5D8HB 3J7AN 2BJ9A 4ICLA 1PYOB 2EI5A 3AGRA 1TKXB 5K14A 3GFXA 3THVA 4RBVA 5D0HA 4FVCA 1SVDA 3SEOA 2QLWA 5IOLA 1P9QC 3NBPB 3I0SA 1QSYA 1FJ7A 1YITS 5EHHA 1Z6RA 3TR8A 2X1BA 1GTEA 3IFEA 3PIOQ 2LU1A 1BI4B 3BSAA 1YSJA 4DU7A 2QX0A 3OHBA 2R2TA 2MZRA 4FYWB 1JWWA 4N7TA 2P9SA 4J9RA 2V4JB 1HI1A 4FM0A 1WNEA 3HHLC 3NS5A 3ID6A 4DUYK 2HNDA 5E3PA 1KAZA 2XI2A 4HI1A 3VGSA 4WXWA 1QE1A 3NVKA 3MM9B 2HVHA 3NEKA 1N54B 1FNOA 2PN6A 3HVTA 1V3RA 4OX9F 2HKEA 4RZRA 1QTMA 3VEWA 2FLOA 5JLHA 4BGBA 3U9ZA 1YJVA 2CAJA 1X4BA 1SQEA 4WPAA 1XHXA 3QETA 4JI0K 4F0KA 1RHUB 3WZ0A 3QEVA 1CQMA 2CZVC 3BKUA 3W2VB 3H08A 1WB9A 3CCEN 5GAGU 1S6PB 2B4JA 2HAFA 1K0TA 3MWPA 4HL9A 5DDQC 3ZEUB 4QIGA 2JH3A 3VQPA 5AQYA 1CXQA 2ACYA 2JOQA 2VG6B 1HNXF 1UA1A 1IJFB 2YNFA 3PX0A 4CIFA 3K0SA 5F8GA 2P51A 2P9KA 4MYTA 2F63A 1D5AA 3KD1E 1J5OB 4CJRA 1KEKA 4GKJJ 2DHAA 3G2XA 3UCZP 4CZKA 1FD2A 3S3OA 2LA4A 2CG4A 3L2RA 4P2MA 4U67Q 3BGOP 4LFAK 2KXNB 2DH7A 4J9NA 4DR1J 1D9FA 3I6PA 1YDLA 2D9OA 1UWBB 1GXUA 2M9KA 4KHRA 3CCMS 5A8WA 2RS2A 1ESVA 4KFBA 2BJEA 3WBZA 3CJSA 3CCUN 4IG3A 2RIJA 1CJKB 2G2YA 2CVEA 4EO8A 5ETSA 4DPWA 2QA4S 3WEEA 4NOHA 2NYHA 1U2VA 4B1ZA 3O1BA 5AR0A 3TNVA 3L4QA 3GYGA 3TVKA 2KFZA 1EIYB 2MPUA 2G8HA 1HNZF 5FJ4A 3I96A 2GJ2A 4G3IA 1WSHA 5D4PA 3MR6A 5AQGA 4DPYA 4DTPA 4C9DA 3R8EA 2VFVA 1FXDA 3CQXA 5L9NA 3D0GE 3U8XA 3MGJA 2GEMA 2AGQA 5JVHL 3VAFA 1NBEB 1V9OA 1G6BA 3CQYA 4RW7A 3EXYA 4DHVA 1JJCB 3G82A 3BYRA 3E8OA 2VC0A 1KNZA 3NWRA 1SQFA 2WVDA 2DNKA 3L6QA 3WNHA 4K4VA 2VGNA 5HN0A 1RT1A 3HFZB 3C15A 1IKWA 4Z4CA 2OPQB 3SSQA 3W7BA 4DX6A 4DV3F 3PW0A 3E2EA 2NREA 4JRPA 2YH0A 1SIWB 2MXYA 3MPDA 1JKHB 1D8ZA 5ELZA 3PRDA 4BVOA 4JKCA 2YXLA 2N7CA 3BSOA 3O9TA 4DR3F 3TUZC 4PL7A 3LGHA 4J9UE 4DWIA 4OJHA 4A48A 2WBRA 4FLWA 3POTB 4EBEA 4DDFA 5MLCV 4ZVHA 5HRRA 2WHOA 3NGTA 2JWKA 3AB2B 3DCAA 3VQ7A 3ENHA 4JI8K 5HL7L 2QL7B 3OW2R 4WE1A 4YNQA 2DNGA 1QZ5A 3WC2A 3W2WA 5BREA 3VA0A 2RS8A 3T19A 4X84A 3NGDA 2XLIA 2B4OA 3H3OB 3PDNA 2CPEA 3KNAA 5GIPA 3MWBA 3KK1A 2FHKA 4OYAA 4JI2K 4R0JA 1VISA 1KHVA 4LF4K 4PG7A 4YR0A 4H0XB 2JVRA 3PNIA 1CZ9A 1VQNS 1KC8T 5AZIA 4PPDA 1AFJA 3ENQA 3Q86A 2ZH1A 4UY8T 2BE7D 3QQCD 4LF8F 3IKMA 4CZMA 2UUWA 1TKTA 1N32K 4OX9J 3L3VA 2GVDA 4W92B 4BRKA 4ZK7M 4BDYA 2WOMA 3TAQA 2Q0RA 3MUTP 1OKJA 4CJ5A 1Y00A 3AVAA 1HQUB 4CGHA 1DT9A 1JL2A 4W4MA 5GIOA 2IC3A 4XIUA 4QWCA 3MDQA 5D15A 1WBDA 2ZJRL 5AQTA 4G1QA 3NGUA 1D0EA 3J7ZT 1QAJA 4OZ0A 3OLBA 4E1JA 4IKFA 1S1UA 3ZETB 2LQJA 1HNXJ 5KFAA 2XS7A 3SK3A 4JV2A 2AF6A 4FLYA 3LO3A 3SNNA 3M32B 4WWSA 2E1RA 2ZNZA 3C19A 2HS3A 3Q8QB 3PEHA 2V94A 2Z2MA 3BZCA 4FPRA 5K14B 3GE1A 1TVRA 3CIPA 3CCJN 3DLGB 4HCCA 4JKFA 4HUEA 3O9QA 2VZ9A 1TZ0A 1JLEB 3SCLE 4OHZA 2QZ8A 5B0CA 2HOEA 2PMZD 4I2PA 3F9KA 4Z0UA 1GFWB 1GLJO 5F3ZA 5KFJA 4PQAA 1YIJN 1DRZA 3QGPA 2P9SB 4NZ0A 2MLZA 4V19S 4NO7A 5DM7Q 4JAXA 3C14A 2HNDB 4ANEA 1VSKA 2P9IB 1E3MA 1XNQK 3ZTOA 1NKEA 3ZZTA 3QLHB 4EP4A 1JLFB 2IDOA 5HQLA 1MWKA 1KTQA 4CIOA 5KFZA 2UXCF 2D69A 4ZPAA 3T6BA 1RWWB 5JICA 2UXBJ 4CJWA 4NMLA 5LL6d 2VQFK 1TL3B 1HNZJ 4RG8A 2GWJA 5C5JA 1WN7A 1HJRA 1KAYA 4AM6A 4P9SA 1V6HA 2WSFC 5AFUH 2BJ8A 1I94K 3BV8A 3QNWB 4KO0B 2H9ZA 2PT0A 3DLJA 2DR7A 1FF2A 4NYZA 1K8AT 4WIQA 3KJNB 1QAXA 1JLAA 2W2QP 2PI5A 4DV1K 3KDNA 5ETNA 1IG8A 2VB6A 3CCWA 3ZT0A 4WBFA 2ILYA 2E5LF 1VQKN 5CD4H 2AGOA 1SJQA 1H3DA 4EUVA 3QERA 2P9KB 3U4LA 1WDTA 2W9BB 2MKCA 3R1LA 1S1XB 4K2XA 3OT9A 4OZ1A 2MKKA 3G96A 4UOGA 4DV3J 2OEJA 3LDOA 3M9OB 4DLEA 1IBCB 5F8IA 5KOXA 4BACA 1MWMA 4CD3A 4U7CA 3OJUA 4KAIA 2ZH8A 3PUFA 2HHSA 4RWXA 3AXMA 3SMZA 3RBEA 3K5LA 5KG2A 4DR3J 3ILOA 4KTZA 2UUCJ 1WI6A 5KFUA 4USUA 2ZJPL 5A8WB 4KFBB 3VESA 4LSLB 3RWUA 1NMEB 4O4GB 4KH1B 5HK4A 1WSGA 1BIZA 3OW2M 1RWPB 4YMEA 4CRJA 2P6TA 5L46A 4DV0K 3WXJA 1RLDA 2AKWB 3SJJA 4CCHA 4WP8A 4KH0B 2JNJA 4L3NA 1HQEB 1X9WA 5IC4B 4HI2A 3DMJA 4W5RA 4ISGA 5D6GA 3DI6B 1JCFA 3TO8A 1U04A 5H1SV 2H4YB 5M2RA 3L2VA 4JD2A 1R8CA 2A1RA 4OHYA 2XO7A 4LFBF 4YQWA 3KG0A 3T3FA 3LDLA 4MT1A 2ZDPA 3A8KA 5JLFA 3R9PA 5KAKA 1HYSA 1XWLA 3LP0B 2GBZA 3VAKA 4RNOA 2EKNA 2W8KA 4KV8B 3D7SB 4WP3A 2VYPA 4LF8J 1RDDA 1LXJA 3Q8PB 3I56N 3IM9A 2XCPA 3ZZOA 4EBCA 1TU0B 1K8KA 2GC8A 4O44A 1RT1B 4P2XA 2KH9A 3FK4A 4GKJK 1IKWB 3GJQB 1UOCA 2UYTA 4N77A 3JTPA 2YX6A 3T69A 4Y2CA 5EVZA 3OFGA 1ASVA 3SQ0A 4BLGA 1EETB 3WDOA 4IYQA 4M5DB 4I68A 1YBTA 5KG6A 3OYMA 2NYIA 2L48A 1QD1A 4P7VA 4OHWA 4WF9L 5D4OA 4LR8A 1JLCA 1HARA 1CULB 3KD5E 4IDKB 2VV5A 3C6UB 1GOCA 2IYGA 3SUQA 1QSLA 1RZMA 2QE5A 4FS1A 1TFYA 2F7VA 1VJWA 4MTPA 2HS0A 3W2WB 3QATA 1KONA 1RISA 1APSA 3A8IA 5HJYA 3HD1A 2W25A 1NAQA 1TL4A 4RJVA 3CJCA 3TAMB 3KK1B 3UKRB 3LW5C 3R1XA 4FWRA 3LDNA 2J9DA 2UXDK 2HS4A 4WQ4A 3SAGA 3O4NA 5L1LA 4C6AA 3DRSA 3G0ZA 3S3NA 5LT5A 2WC9A 3AQPA 3RW7A 4FJLA 1TKTB 2PA3A 1F2GA 3EKUA 3L0QA 4HUGA 2UXCJ 3KOAA 2GVDB 3QJPA 2JZ5A 1UZHA 1EAYC 2X6SA 2ZH6A 1U45A 2WOMB 5K8PA 1KXPA 1K44A 2V69A 2VD3A 2XHWA 2GMHA 4K8XA 2YNGB 4NA1A 4QCLA 4ID1A 1HD0A 1Y5IB 5ETKA 3M2RB 3P83D 1U25A 3F44A 1ASUA 4J2AA 3C16A 2DR6A 1T44A 4FCYA 4G1QB 1RBRA 2NSBA 3AAPA 1SCJB 2DY4A 2DITA 1S1UB 2E5LJ 3OHAA 3A0IX 2AA4A 2ITGA 4J9VA 3D6MB 4HHTA 1EX8A 5G4DA 1XERA 4L75A 2GZOA 4DTNA 4DBQA 1S22A 4K4TA 2ASOA 4GVLA 4RUHA 1WF2A 2NNWA 3HHKA 4LF6F 3TP2A 3ID8A 4CHOA 2YNHA 2PSZA 5KQDA 4FBTA 1N36K 1VQ5N 1M5PC 5AQQA 5C42A 1RSCA 2EWSA 4A46A 1I51B 1T9YA 2FDNA 1BMQB 3J81U 3C14B 3M8QB 4ISFA 3WUHA 2R7QA 3CCES 4TYAA 4E7JA 1SJFA 5EX0A 2Z8QA 2O5DA 2G1DA 4Q0BA 3NHGA 3W3SA 1GAOA 2B9EA 5KT4A 1KFDA 3X3UA 4DPTA 4KREA 2PEBA 4F2SA 5KPZA 2JVOA 4DQ8A 5KFNA 3LDSA 5GAEP 4P74A 4ZVUB 2M70A 3GP9A 1TR0A 4B3SK 1SKRA 3RAQA 5T7LB 2C2OB 2K06A 4LFBJ 2E8AA 4L6V3 3BQ0A 5GAEI 4PY5A 5MAOA 2GVZA 3BF3A 3P3DA 3RG6A 1JLGA 3O3GA 4FKYA 2D0PA 3A8JA 1HD1A 2BBEA 1SH0A 1N5QA 1C4AA 2CDQA 3IM8A 2RKIB 3GDQA 3R5JB 1RI7A 2EFPA 4LF1A 2IIRA 3EICA 4YOUA 4IQXA 3OBWA 2V6AA 1X1PA 3V6JA 3BBCA 3LM9A 1SQKA 1S9EB 3U1MA 4CLWA 3RBXA 2KM8C 3R9LA 5FLXU 1S1TA 1ZPWX 3CCUS 2ITMA 4WU3A 2R7UA 1YTAA 1DTTA 1RTJA 1HPMA 1KVKA 3S6EA 3BPDA 1C1AA 3RB6A 1QZ6A 1RXOB 1GXLA 4ZTFA 3T7ZA 1NU0A 2Y0BB 3VETA 1YJ9N 3VF0B 4PUOA 2GX8A 3MXJA 1U1RA 2APOA 4CWBA 3W5XA 5LSOA 2MKIA 3MM5B 4LBPA 3IDHA 4AD6A 3QFUA 2N7YA 4BC4A 4WQ5A 3UR3C 3BEXA 2B8PA 3BM7A 2UXBK 1RAHB 2IS3A 4B3RF 1HNZK 4RPFA 3L95X 4K43A 4AT1B 5B7WA 4DV2F 3DLBA 3ATUA 1VBXA 3SMPA 4K5SA 4F3OA 1FHTA 3RW6A 1BA1A 4JD2B 1NHVA 4NPOA 2MQNA 2VFRA 2F9JA 3DRRA 2P9EA 1TGOA 3QINA 1UVIA 4B3MF 1HMVB 1G1XA 5ITHA 4UOHA 5FPMA 4C23A 3BDEA 2BOPA 4O3SA 4IFEA 2QMXA 3VQEA 4JKGA 4NRUA 3KK2A 3BBFA 3X1LB 3VEYA 1SC3B 1PC4A 3DOMB 4DV3K 5C2FA 2HBRB 5HSPA 1HKAA 3PCOB 1ATNA 1YJWN 3GONA 2V7ZA 3ZT3A 2KU7A 3IBCB 4BR2A 4PG5A 4KE5A 2UUCK 2IOCA 3BO4A 1RAEB 2CGJA 4I2QB 2CPDA 4RW9B 2HFSA 1IXKA 3MUVP 4PKDB 4M7YA 1UFLA 4CTAB 1LW2A 1AROP 5J2QA 4DB3A 2IRUA 3EEQA 3MEDB 1N5YB 3IXQA 2QN6B 4CT8A 3M1VB 2D0CA 2RQCA 1Q81O 1C0TA 4NYPA 3BDPA 3TI0A 2RE2A 1MU2A 4LF6J 3N0VA 3W3DA 4DV7F 4CNYA 3CMEN 3OTDA 3QFWA 1VOMA 2HBYB 2FUG9 3MTKA 4PABA 1EB0A 3W62A 2QWOA 1G15A 3LPTA 2FJBB 4WP9A 1JL1A 4CJEA 4LR9A 2AYBA 1T03A 1HNIB 4B9TA 3EY1A 3ZZYA 3HZGA 1FA0A 4DG1B 4XEIA 1B0PA 5HI7A 1DY3A 2A40A 4TSXA 3I33A 3M2VA 1B9FA 4OMFG 4YDXA 1NO8A 2CJQA 4E19A 1S4EA 3MOZA 1O6XA 3LALA 2H51B 1URRA 4M3ZA 5H9FJ 3V6HA 2EVZA 3Q22A 1NM2A 2IPOB 4X2BA 4XDDA 2OUGA 3KJFB 3CUNA 1XEZA 4DR6F 4LREA 1REVA 3F5TA 4OYMA 1VSMA 4CHZA 3C16B 5AZJA 2K3KA 2H1YA 1EHWA 3K5MA 2OTJN 3CCJS 3AAWB 3CIZA 4AQYK 2UVVA 4ZDNA 3T5LA 5IQQA 3DJCA 3W66A 4NYOA 1L3VA 3E01A 5HVHA 2B51A 2HLTA 2NZCA 1SQGA 3TEGA 3SUNA 1YIJS 1FXLA 1A6LA 2MKSA 4OYZA 1IWGA 4OYBA 2W1BA 2XM3A 1NPRA 2XNQA 4ZVPB 5LXRA 3O9UA 1GLCG 3OUYA 1FJGF 3H2LA 1IR2A 4B8AB 3NLCA 3QT6A 4S0MA 5C42B 2YKMB 3BGRB 4BE0A 2G8FA 3R7SB 3G9CA 2BZ2A 1K1QA 5F0WA 1HWJA 1NGEA 2BQRA 5F0UA 4XAKA 2R8KA 3EZWA 1S0OA 2GUIA 2E5IA 2DISA 1G7CB 2AU0A 1FTCA 4F4KA 1FD8A 3FSXA 4Q0BB 4I6AA 3CJ5A 1U7LA 2VBZA 4B3RJ 5DZ6A 3NG8A 4DU4A 1VC5A 2ZQBA 3HZEA 2OYQA 4DV2J 2CYYA 1VQKS 3OYAA 4Z7YA 1U6BA 1X9JA 4CF0A 4BRNA 2WFBA 2QL5B 4DU3A 4RW4A 4IH6A 5DO2A 4B3MJ 2I7NA 3GCWP 1CC7A 2GVZB 2K2PA 2D3O1 4PA1A 1FEEA 2HNYA 2LSNA 4CLZA 4F4AA 4OO1J 3DLKB 3KLIB 3QWPA 1I39A 1L3TA 1KVBA 1U6ZA 1WSFA 3BPSP 1Y10A 3RAMA 2VBWA 4GMJB 1HKBA 2LDIA 1FWLA 3ENAA 5JVGQ 3W1YC 2HWHA 2BKOA 3PR5B 1QVFR 4KQZA 1EWQA 1DTTB 3IBWA 1QAYA 4WFZA 2MQMA 1YTYA 4LSNB 2Q97A 4E98A 3ENBA 2K8GA 5KG0A 3OQ2A 4MKAA 4PUOB 2JWNA 5CAAA 4A5AA 4IZ9A 2ETJA 2DFEA 4NCAA 1F5BA 1EQYA 3IS9B 3LAKA 5KFBA 2KLAA 1BO5O 3AVIA 4UOFA 4J9OA 4ED2A 2D5RA 4DV7J 3FEXB 2HQCA 2O01C 4BQZA 2X78A 2HQDA 2CQ1A 1SS6A 1L5UA 1M1KT 3D68A 3I56S 3R5GA 4LFBK 3DRRB 2F8MA 1GLLO 3IGVA 4IFVB 1J27A 3VEOA 2O8FB 3DXMB 1LW0B 5J1NA 8RUCA 3H98A 3CJ8A 2KRRA 1NKBA 1XMOF 1DARA 3VEZA 4PRFA 3A5MC 2HG4A 1NJWA 2ZBIA 1VYAA 7AT1B 4BHQA 1X5SA 2N4CA 4QW9A 4B02A 4A8OA 3OFHA 2A0FB 3OYNA 1KWMA 1R0CB 1T7PA 1AXQA 2FSKA 3DGPB 4ZP9A 5SUHA 1EKRA 1ZBIA 4NCGB 2O1PA 3N6MA 5B0EA 2ATLA 1QQCA 1Y64A 3KLGA 2KRBA 3O3HA 4DR6J 2HIQA 1RDCA 3OL8A 1CS4A 2AWZA 4TU9A 3I0RA 3SI6A 2XG8A 3HT0A 3PHTA 1V5IB 1VBKA 1ZM3A 4TNOA 2P9NA 4JN4A 3OVAA 4FVUA 4LSZB 4M94A 1S57A 3TABA 4LRDA 2AP1A 4QPTA 1SL1A 4ZLNA 5KFXA 1CBKA 2H3GX 5J2QB 1WOQA 2CQBA 5J1EB 3R5BA 3W8PA 5DLFA 1ITGA 3VCDA 2LFVA 2EHGA 3PFOA 2QK9A 3WNGA 5AFUA 3FRYA 3AVNA 3QB0A 4QIFA 1MU2B 5I3UB 5E7OB 2XBPA 4O55A 2F9TA 5LSRA 4ATNA 4KTWA 5B09A 2V8HA 2H48B 2KXFA 3NF6A 1FJGJ 2QG9B 1SC1B 5J2NB 4FM1A 1NZ8A 1FI4A 4ZHRB 2AHOB 2D1CA 1UTAA 3EZUA 4BRMA 3NS7B 4JRQA 1ZA1B 3D45A 3GV5B 4DL3A 3KLVA 3P5JA 4B9UA 3MM7A 4M7XA 2CGLA 5A8KB 1RAOA 1DHMA 3CC7N 2QXFA 4M3WA 5AXMA 1WLJA 3IC1A 1KQKA 1N6QB 5GADU 3HSDA 2W40A 2ZD1A 3E9OA 1JCGA 1S79A 4YDUC 4NLRA 2PY5A 1BU6O 4CJ7A 2G8UA 4CZGA 4DR4K 1VK0A 3GV8B 1HR0F 3K9KA 5TKWA 4AHCA 4Z37A 4YB5A 3UNGC 3IA0A 3TANA 3RJMB 1UVJA 2D0BA 3T9NA 2J9CA 4DV6F 2RHSB 2KFYA 1BG3A 3IRWP 2IBKA 5AZJB 6AT1B 3BKTA 4YOVA 4OX6A 5AE1A 2RSQA 4AF1A 4TLRA 3PR4A 5HVFA 4K5RA 4B9MA 4ED0A 3F41A 3GIIA 4QR0A 3GG1A 3LP1B 2FLNA 4V19J 3N4PA 1VQ5S 4KI4A 1UWAA 1BQNA 3WHIA 3BN7A 1BE4A 2HBJA 2COLA 1FESA 5LMUF 2HVZA 1BL3A 5GAHU 1NU4A 1RE1B 3QRQA 3OFEA 4LF6K 1Q18A 3GMGA 3CPEA 5F9NA 3N6LA 4CEFA 3C66A 3W0LA 4A8KA 1RKIA 2HHVA 2XZTB 4PCQA 2BDPA 1JXEA 3ZT2A 3O9SA 3PG9A 2GELA 3M2UA 1IWAA 2J0WA 3TTCA 1PJ6A 3UWTA 2FSJA 1KR4A 3J81Y 5LMNK 3NAHA 4DR5K 4D3HA 4ECSA 2QYCA 1J9AA 1AYEA 3RAXA 2OPSB 2H54B 2ZHOA 4KB1A 1VQPN 1S5ZA 3MR7A 4KHPK 4CIGA 4FWSA 1TUGB 3OPKA 3HFKA 4E2FB 4OX8A 4CZFA 3D1QA 2RHKA 1B4SA 4C3MA 1LWFA 4F3TA 4BRHA 2BKPA 2X51A 2H5IB 3OHRA 3UD3P 2G4BA 2M8HA 2CPHA 1QQOA 4CEEA 4DCJB 3ALYA 2XWXA 2GHPA 2ZNYA 4UY8O 1XMOJ 1FXXA 3TVYA 4OPKA 2E5HA 3FMWA 1T9TA 3U1LA 1AUSL 5EWEA 4YY3K 2JLEA 1R0BG 2BJ1A 5T41A 1XI1A 3AO3A 1W97L 1NHUA 1SC6A 3C95A 1YJ9S 3V1OA 4BRPA 1HHTP 1FKPA 3US5A 1L3KA 1D3WA 3QIDA 2CH6A 5FLXY 4KH4A 4BGAA 5A2QU 3J80U 3QJJA 1IM4A 3OBYA 2L9WA 4DS5A 3KK3A 2FJWA 3NNAA 1SJ1A 1VQYA 4LF5F 5H9EK 2E6MA 4LBIA 4KHUA 3OYDA 4XDCA 1T9XA 1KOHA 1F3FA 3GCXP 4DUZF 2PDAA 4KRFA 3PO5A 1VQ8N 4E7KA 5C24B 2XZDB 4ECYA 2FBVA 2RD5C 2XLJA 4MKBA 1FRXA 4DV2K 3LPUA 2Z57B 2FVPA 2CXEA 3LZJA 4C8KA 2DO4A 3HPHA 2B7BB 3KG4A 2QTWA 2DBBA 2R3VA 2P1JA 3OS1A 4OL8A 4EHUA 1O51A 4YB7A 1XMQF 3N4WA 1FDBA 1IBKF 3ULEA 2KZZA 2MB0B 4WFAL 3IFRA 2ALZA 3KLFB 1YJWS 4FZYA 4USWA 4FJIA 4FK4A 5GAGP 4LF7F 4B08A 4LMZA 2X3DA 2QMUB 3DM2A 2DR5A 1S48A 3CGIA 3I8BA 5GAGI 1YG0A 4NEZA 3EGNA 3ZXWA 5BR8F 3BREA 3I31A 3SDEA 4IO8A 1HR0J 4RKUC 4CGGA 2Z2ZA 4HH0A 4BCAA 4IH7A 1K8AO 1FT8A 3LM2A 4BROA 5AT1B 4DV6J 3AOCA 3SUOA 1T05B 3O6WA 3PO4A 4WZMA 3G87A 4RR5A 2F8SA 4IJAA 3MDFA 3CMES 3VVTA 3MXIA 2IJRA 3PACA 1RADB 1ZA2B 3B4DA 1TKDA 3VMFB 5LMUJ 1DTQB 2ZKTA 4I56A 5AQRA 1M5KC 5AXKA 2J76E 1I1GA 4N76A 2VFSA 5CZ2A 1P9YA 5KG5A 2HK3A 1VHXA 3IBFB 2YWGA 2KYZA 2IY5B 3THWA 4PYAA 5E26A 3SBTA 4ZJOA 4P71A 4HT5A 3HVWA 2JEIA 2UUAF 4L73A 1PILA 4HHHA 2A2DA 3VAIA 4Q7AA 3LP2A 3MM7B 4CGDA 2CFXA 3BJYA 4LRBA 4JI4F 4ECXA 2W6LA 3I5BA 1HBUB 3M8RA 2I5JA 3S1TA 4DSIA 1X4AA 5FDLA 4IO9L 4A4JA 2BW7A 2OTJS 2H5EA 2X1GA 2HMIB 3ZZUA 4F4WA 4B8CA 1BWEA 2IFXA 1S0NA 4UZBA 4GY2B 2FLPA 3CCTA 1EQMA 1BWVA 1I3OB 3L4BC 1XNRF 4C11B 2HMPA 4QU7A 1QQNA 1N34K 3VOVA 2FBXA 4IWVA 2OAUA 4NLYA 3EZOA 4P73A 4OI4A 2QSWA 3HHLB 1BISA 3PFEA 4CLLA 3M3ZA 4FJ8A 3DLEB 4OYXA 1DAXA 2EG2A 1KHWA 5JVHQ 4ETZA 1WC5A 1C0GA 1HQ2A 2B7CB 4QBUA 1RHRB 5E3QA 4H0YB 2CJKA 4IRCA 5AQHA 2V52B 2QTDA 4CK3A 2PD1A 4CJUA 4OX7A 9RUBA 3Q24A 2OMOA 4LF5J 1ZC6A 4CF2A 2XO6A 5AE3A 2WB4A 4KIAA 3NCQA 3UIQA 1F2HA 2V7YA 4IH5A 3F9MA 3CXCM 3A5LC 2DB1A 4DUZJ 4F25A 4H0VB 4AHTA 2VBYA 4QS9A 4HTLA 1HL6A 1OSDA 2FZKB 2VASA 3LTOA 5ADXH 4FZVA 5L39A 4JKEA 4YFUA 4PAAA 3FKBA 2D74B 2JC0A 1PGZA 5HQMA 2RVJA 1XIQA 4KAZA 2B5JA 5HL7Q 1NJZA 2FGOA 3ISZA 4CM2A 5HVGA 2Q2RA 2PFUA 5HROA 4ZVQB 1XMQJ 3A1YG 2DXDA 2IMOA 1IBKJ 3WC0A 5KFIA 1IR0A 4OGCA 1PO6A 4ZCKA 4JKAA 4HEA9 1M5SA 5KFYA 1SIZA 1SC4B 4LF7J 2NLWA 3IMQJ 2P9PB 3A5NC 3CJRA 3S7RA 3E66A 2PYJA 3G71N 4DI6A 1PC5A 5BR8J 3QSYB 4U8VA 2ZH9A 4HACB 4B9SA 4C8LA 2PMWA 2KQ2A 4NLUA 3EWGA 4D3GA 5EWGA 3EE9A 3AVCA 2CQIA 1ZBUA 2MZ1A 4HVJA 3UN5A 4USJC 2ZM6F 2B6AA 3OTCA 4MAKA 2AEMA 2QM1A 5AQOA 4KR0B 3D4JA 4NB4A 4YDDB 2GJFA 3D6HB 4A8QA 1NB2A 3A12A 1D9DA 2DVIA 4X4NA 2YBVA 2KHOA 4FKXA 5D77A 4O3RA 2VPXB 2R7SA 5KFTA 1CG2A 1N33F 4ED7A 3K59A 3V9WA 1QHAA 3VTIA 2RF2A 1TQLA 1ZAXA 3L7UA 1JK9B 3DRPB 3OYHA 4OKJA 2UUAJ 5KGWA 2F1FA 3VN5A 4EFHA 2NUHA 2HWTA 1IBMF 1YRXA 3G4SN 3ULEB 2V5HG 1XMOK 3HI9A 4CH1A 5BN8A 2UUBJ 4ID5B 3RUBL 4V1Ak 3CJ4A 4JI4J 1W9HA 4PL8A 1NSAA 1S3XA 4QWDA 3EKSA 4V19X 3LWMA 2XMAA 1R8BA 1ZTTA 4RBUA 2BE2B 2LXFA 2QGFB 2HHXA 4F4XA 5C2DA 4B1YB 3U9DA 4O5FA 4P52A 2R7TA 2L41A 3ZO7A 4LH5A 1BDGA 1FK9A 2RH3A 2Y1RI 2RU9A 3NOGA 2P9CA 4CJ3A 2CPFA 1EO1A 3A3NB 2DY9A 4W5OA 1XNRJ 3PKMA 4I6MA 1ROFA 1YZ6A 4DTSA 1LEOA 4JI6K 1VHFA 2E1AA 4C8NA 4N5SA 4FDFA 4E8UA 3THXB 5A6WA 5ETPA 1NKCA 4NXMK 3C2PA 4DX8H 4IXCA 1PG5B 1VSLA 1VRUA 1HPZA 3V4MA 2AZ3A 2QV6A 4AL6A 3FCVA 2MTLA 5HAOA 1YZ7A 3KJVB 3NNCA 4LFAF 4WIIA 1F6TA 3IG1A 2ZZNA 3LL3A 2U2FA 4X4SA 3CC7S 2LDYA 1RTDB 2VWJA 2PFFB 5AQSA 1QS4A 4BS2A 4CO2A 1FJCA 1OSCA 3TUJC 4FJ7A 2CQGA 4BRLA 1Z26A 2HBZB 1UPMB 1CLQA 1VQ9N 3NNHA 2IRYA 2VFUA 4MLEA 1RBLA 1GH8A 2P5OA 2XYGB 3LP2B 4FLTA 2W2MP 1KTVA 2HQIA 4C1NK 5HRNA 2XS5A 1BCOA 3CDEA 3TOQA 3M9MB 5M1QA 5HOOA 3CJKA 2IIHA 3H0PA 1GMUA 1DLOA 5DG9A 3OJSA 3PIOL 4PWWA 2A6OA 2E66A 2BH1A 3W61A 3VQAA 1R0AB 3HXMA 3VQSA 3TA1A 2HFZA 2MEWA 1SKUB 3OR2B 4M63C 4ED6A 4OLOA 4M1KA 3LPYA 4EYHB 3FZFA 4DSLA 3IWNC 4E7IA 3SQOP 1WOPA 2NQPA 4A57A 3OL6A 5LMUK 2E7VA 3MN7A 2B8QA 3W64A 3VGTA 1BHNA 4TY8B 1G3OA 2YWKA 3I5AA 1OYEA 1VJQA 2D41A 2OI2A 3MEKA 2NPFA 2A3ZA 3NCIA 1TMMA 3CC4N 2DFHA 3VR1A 2FZCB 2ATCB 4OZ3A 1ATSA 4BRAA 3VF6A 1RTHA 1QM9A 4M5GA 4Y0FA 1VQPS 1T6DA 3VF4A 3F73A 2A5XA 1Q86O 2CPJA 5GMDA 1RT2A 2R8IA 3NH1A 3VWSA 3PJWA 2ZM6J 3MZIA 3K8VA 1WHVA 4HHJA 2IVFB 4CP5A 2IDLA 1WEYA 1FNXH 2O8EA 2VA3A 5EX3A 1XQIA 4RW6A 3HSZA 3UB5A 4U67L 5IV4A 3DC2A 1WD6A 3SIPB 4ES1A 2B4PA 3AVGA 1Q95G 3TTDA 1E6VA 3CVKA 3BQ1A 5HANA 3ZZZA 1U48A 2HAIA 3IGNA 5BRFA 5IWAK 4JI2F 4AL7A 1N33J 4CF1A 1WKKA 3I8DA 2B5JB 3VQTA 2O8BA 3ZZPA 4YORA 3P5TL 5E3RA 4P6QA 4NZ7A 1IBMJ 3CDUA 2F4VK 1DQAA 1R7IA 4BRGA 4CEDA 2R7YA 3RSEA 3RVCA 2C2MB 3JSBA 3ZTRA 4FF3A 2V2KA 1X3MA 1LKZA 4XH5A 3AVHA 1S1WB 4X4QA 5IT4A 3TWZA 4IJNA 1ZS6A 2QJ3A 4FWMA 1ICEB 2UU9K 3UI3A 2JFKA 4QR2A 5CZVA 4OV6A 1RT7A 5C7PA 3S41A 3O3FA 3SQGA 2PC6A 2CQDA 5A2QY 3ET6A 2ZOGA 3V81A 3J80Y 4H5VA 4FJJA 5KT3A 2WBNA 3MM8A 1C1CB 4ZVGA 2VQEK 2BUPA 4FLVA 1VQ8S 4M45A 1WKLA 3V9XA 2B6AB 4H4KC 1SJRA 2VKZG 5EY4A 5C25B 4BWJA 3K58A 4DUZK 4QPXA 3R5DA 3ZX0A 1QLNA 1OH7A 2MHNA 3T1YK 4M3UA 5FPDA 2B9YA 4ID8A 2BXJA 3SBMA 4LFAJ 3A2FA 3GPAA 4OHXA 1RWXB 3OBIA 4K4SA 2KT5A 1BI4A 4CE9A 5B0FA 2GFFA 3D6FB 1ZH5A 4BE1A 1NNEA 2RF2B 4G1PA 2V4JA 2R7WA 2DNRA 3KWIA 5CZ1A 4E1MA 4IFYB 5M1OA 1RT5B 5DG7A 4IR1A 1CVJA 2BE9B 3Q23A 3K5OA 4DZDA 1IBKK 1LWCB 1DKGD 4QIEA 1XNQF 3D9BA 1IO2A 4N56A 2G0JA 4LF7K 4EAHD 3UD5A 3EYZA 1U1LA 4IDHA 3UKUB 4HDHA 4CI0B 3H6EA 4IOCL 5CYMB 2VQFF 4F3QA 2PFDA 3B82A 1MA9B 1GX5A 2C2EA 5LOQA 3W2VA 1MLAA 2A1SA 2YNIB 3P39A 2VJUA 1S6PA 1I94F 4FPBA 3C46A 1YF5L 1X9MA 1N56A 2FY1A 3ZEUA 4OZNA 3CPWR 4B3OA 2FSNA 4J90A 3HO1A 1MMLA 4HUFA 3HVRA 4JI3K 4UTGA 1CC8A 1TL7A 2XMWA 3L3CA 2C2KB 2CJ9A 4IOBA 2BKNA 2OA8A 1F9HA 2VG5B 4LC9B 2C1EB 2DPNA 3CF5Q 1J5OA 1Q81T 1Z2LA 2NRWA 5AQNA 1HA1A 1S9GB 3ASMA 4JUZA 3IG1B 4FXDA 1HFEL 4CFAA 3D0IE 2XY6A 3QBWA 4F0HA 1X4DA 1UWBA 2DO0A 3BF4A 1Y5LB 4DPUA 5IZHA 3VQ9A 1VMBA 3MUMP 1RDUA 4FXVA 2LXUA 4O8UA 2H4WB 1RFQA 4CEZA 2UUBK 3WT0A 2KVQE 4DV0F 4K50A 1IN0A 1CJTA 4FOEA 2HGLA 2R8HA 1DQ8A 2C3OA 3VALA 3DRYA 1OY8A 3WXKA 5JMNA 2OZSA 3KMQA 4YR2A 1YJTA 3PW7A 2ATQA 4OLPA 2MLXA 3QO9B 2NXCA 1BUXA 3HFVA 2ZH7A 3RZAA 1B99A 4JI2J 3HHDA 2QA2A 4HH1A 4MO5A 1S12A 1K6YA 2PGCA 2FIUA 4ZCMA 4CD1A 2A1BA 1M1KO 3FZHA 3R6MA 3P49B 5LL6Z 1CJVB 1Q0NA 1RUSA 2L9NA 4JLHA 5DM7L 1XNRK 4CBUA 3D5MA 1B3TA 2R2UA 1P1LA 2J7KA 4HLBA 1JXLA 3J7YU 2RNEA 1HBNB 5IT9O 1DZ5A 2BYCA 3R7BB 3B78A 4TQSA 3AXKA 1A5WA 2I2YA 2OPQA 1ZM4A 3WNFA 5T7BA 3UN3A 2G0IA 2P9LB 3L4IA 4CIEA 4PEOA 1UVMA 1LNQA 2DGSA 4H0OA 2GNKA 5LY3A 5IXUA 2V50A 4Y0WA 4YB6A 3LH2S 2AMCB 1VBYA 4WFNL 5KFOA 3MPVA 5I42B 3CIMA 3K5NA 1RTHB 3VV2B 3UFCX 2M8DB 3POTA 1K0VA 5CCMA 4FYVB 5I3QA 4LRFA 1YTUA 1MSWD 3HULA 5FPNA 4A8XA 2FVCA 1JB0C 1RKJA 2FY8A 1RBAA 1U1NA 2KHDA 5F3TA 2CQ4A 3W9HA 2FF6A 4C1NI 4ZVFA 4LR7A 4GV3A 4C3LA 3GR1A 5BN9A 2F4FA 2GIQA 3W5ZA 3MCMA 1ASWA 3DLHA 4YN3B 1U1OA 2WSCC 4GVMA 2KM8B 3KWGA 3GIMA 4Y2KA 3GSIA 4J8FA 3ZSRA 2UXDF 2FGCA 2Z30B 3G71S 2IDEA 5HMYA 5AQUA 1XNQJ 1GNKA 4DUTA 5J1PA 1M5OC 4EIAA 2D4WA 2EFVA 4RLEA 4DQSA 1K73O 3E1YA 2KZMA 2ZZTA 2VQFJ 2JLGA 3OY9A 5HRSA 2GIRA 3AOAA 1HQUA 2ZKUA 3OSNA 1UPPA 1ITPA 4KGVB 3PKYA 3PVXA 3HM9A 4UY85 4O5BA 4WFBL 2XSJB 1H38A 1I94J 2ILZA 2ZWPA 3CO9A 4OFZA 3CPWM 3THTA 2BANA 3JYTB 1TTHB 3OVBA 1NG9A 1IKYA 4K4XA 3KKSA 3ET6B 2DYAA 3MXHP 2NRTA 4R0EA 4KGKA 3HJFA 2ZM6K 4MH8A 3V9ZA 1HI8A 4DPOA 3H46O 3M32A 2OJ3A 2XTJP 4USIA 3H1VX 3WQUA 4CDIA 1RHMB 2KJWA 2HFVA 3TJ9A 1DQ9A 5E5NA 1PAEX 3DLGA 3PEJA 5AQVA 3J7Z5 4EMDA 1JLEA 2OIHA 4CLYA 4KYZA 2QWQA 1NSKL 3G4SS 3GFHA 2N3LA 3PZPA 1R3NA 1N33K 5F8LA 2UVRA 2P2CB 1N36F 4C48A 1OPIA 2HQGA 3KHHA 3V9SA 2LXIA 2QWPA 1V4TA 1BQMB 3DDKA 5FD1A 1B70B 2NLXA 1IBMK 4FPIA 1Q7YT 3SFUA 2P9IA 4QZVB 4X62K 1ELOA 3QLHA 1JLFA 4DV0J 4LRCA 3ZTQA 4TU8A 1HWIA 3FGUA 2F3JA 3R27A 3BH7B 1BC6A 1TL3A 4XK8C 1FRJA 2A10A 2B9WA 5AQJA 1RBVA 1U02A 2FZGB 3DGVA 5CH7B 3MWTA 3H45C 1T9WA 2FQQB 2VBXA 4BRDA 4KO0A 1N52B 1OJ4A 1WSVA 5L1KA 2AJ2A 4B3SF 4JK9A 3ULDA 1Y0HA 2WVFA 2ZITA 4G1IA 3IAS9 2VDIA 4IOAL 4KY3A 2B56A 4B3OB 3LPEA 3UNYA 3MAQA 2FVQA 4F7VA 3H4BA 3AA4A 2MDAA 1TL7B 5A0YB 2NUBA 1U8SA 2AYMA 1RDAA 3DHWC 2CA9A 4JYAF 1BY9A 1ULRA 3OS2A 2W9BA 3DU5A 1S1XA 3H3NO 4PKHA 2R7RA 3AD7C 4WYLA 3CD7A 2OEMA 1NJXA 1VCTA 4QOZB 2ADCA 1WI8A 1NDLA 1VQ9S 1BGXT 1RCXB 3MTJA 1S6OA 3CCZA 2OFHX 2MKHA 2AX0A 1ACMB 2VGMA 4KSEB 1NLKL 4YDUA 3EXCX 1RBTA 1MW7A 2WCXA 3GWCA 2ZH3A 2HHUA 2OCEA 1RYSA 3DXKB 4LSLA 4CZJA 4O4GA 3EN9A 2IRXA 2MY7A 4EFAC 1S49A 1N4LA 1BD6A 1JLBB 4ZJQA 2DH9A 4IBNA 3DYAB 4KPCA 1CJTB 3CJQA 3P4UB 4CJKA 3CETA 2FJXA 3G8QA 5D3GB 2DD8S 1HQEA 2UXBF 4YHHJ 2FJAB 1WG4A 1WSRA 4H5NA 1RT4A 4DTXA 3DI6A 5THWA 1XN9A 1P6TA 2J0XA 4K25A 1UJ4A 6FDRA 5B08A 4OJ1A 4YUDA 4J9QA 2C3MA 4TYBA 1ATRA 1SI9A 1WHXA 2UXDJ 3LP0A 2OEKA 2CH5A 3CERA 4KV8A 1YT3A 3KKRA 4DU8A 3KHYA 3AY9A 4PQUB 3EMTA 3CC4S 4FW1A 4ZLPA 2QMWA 4A47A 4K42A 1NWKA 2J8SA 3CQ8A 2ROEA 4J2BA 2NRXA 3QMLA 4Y1DA 3AODA 3MMCB 4AYBD 4U7UD 1EXQA 2XCAA 1ZZNA 5KT6A 1EETA 4N41A 1W2BR 4C2MA 4C0OC 4M5DA 1LFWA 3ADAC 3CCVN 3HX9A 4ILGB 3R3LA 4Y6IA 2HNZA 1EJ7L 3R8YA 2R8JA 3I5CA 1HKGA 1WSEA 4DL0C 2UUCF 3D3BJ 2XWYA 1CULA 4IDKA 2MZQA 4FJGA 2BQ3A 3T5KA 5KG3A 4PG4A 3C6UA 2VODA 2Q0UA 4KHSA 3UW1A 2OFGX 1RCHA 4CHYA 2VWKA 4BC9A 4RW8A 2DGTA 4JNEA 4C97A 4X4UA 4OLBA 4OPHA 1PJ5A 4KRWA 4RUAA 4X4TA 5L8RC 2CQCA 5GAEU 3TAMA 3UKRA 2R2SA 2C28A 3N6NA 4CNZA 4DMZA 3HYFA 1NK8A 1N36J 4HWIA 3VVUA 1K9MO 4OI1A 3NGZA 2GAHC 1R59O 5GADP 3QT5A 4GV9A 4NLDA 3SUPA 5J2MB 4QS8A 5GADI 3OR1B 4M3TA 5KFEA 4WQ4C 4WK1A 1RBSA 4CYUA 1SH3A 5A76A 3JQJA 4CHPA 5K8MA 4FWPA 4TU7A 3EGWB 4EI2A 1MWYA 2XRIA 3AQOA 3QEPA 2PIIA 1VK8A 1WBBA 2O67A 1GLDG 2YNGA 3CD6N 4FZXC 3QMQA 2RQMA 4CH0S 3CDAA 3M2RA 4O23A 5HMZA 3U6FA 1YHQN 4B3SJ 2BANB 2ZVSA 1IKYB 2JEGA 4G6VB 1YJRA 3RTVA 2E6LA 3I55N 2AYEA 1LXNA 4K4ZA 3Q7CA 4EO6A 4AQYF 1F60B 2P5GA 3QJLA 3SZ2A 4JYAJ 2J6SA 3MF5A 3TA2A 1A0OB 2GAGC 2QLFB 4C8YA 1OMSA 4JK7A 4FK2A 3HPOA 2W42A 1TUVA 1WHYA 3RRGA 2ZH5A 3QEWA 4I69A 3CCSN 1ZPVA 1RGIA 2GA7A 3O2IA 1WOOA 2V34A 3NVMA 1OQ6A 3E9PA 2R9LA 3OYGA 1X4CA 5GMKa 2QYGA 2WUSA 1Q79A 3D54A 1IKVA 3HF5A 3M8QA 5LM7E 1JXBA 4E7LA 3K0JA 4LD0A 2XB2D 3MCOA 4FL9A 3VGKA 1NBWA 5A8RA 3AA9A 2OTLN 1HW8A 2VH7A 3WXLA 2H3EB 2RT3A 2W9AA 3V1RA 2CADA 3OS0A 1NGGA 4OI0A 5K9FA 2DCUB 4OGEA 1FKAF 2EFGA 1WC3A 2YQ0A 5T7LA 3MFIA 4GKKF 2PYLA 4IUFA 3OVSA 1EQ0A 5JS1A 3ZNUA 1NOZA 1YKWA 1VRTA 3SI8A 1F3VA 2EBEA 2CPYA 1HYZA 4GRSA 3M8WA 5D78A 1LWEB 4FWLA 3JAMO 2RKIA 2ZJQQ 3DOKA 3GYXB 2DNPA 2EKYA 2D0AA 3OYIA 1S9EA 1W2BM 1NK7A 1CEZA 2OPPB 2ZUAA 2C2NA 3CJ1A 4OZJA 5E3CA 1JXVA 2EFQA 4CBXA 1NM1A 1IR1A 3IP0A 5KT2A 3AD8C 5M2UA 3AO5A 1T3NA 3H2UB 2F9WA 1WG1A 2ASYA 4DR2F 1R6YA 4IO1A 2DH8A 4E0DA 4YOTA 3OYEA 3CJTA 3K7RA 3T41A 5CY4A 4JI5K 3H8YA 2CUYA 4JV5K 3B4MA 3LOUA 3C3LA 3CDBA 4KB7A 1S6QA 1FDAA 1N5TA 4B9NA 1GLBG 3MM5A 4UUXA 2QKBA 2WVEA 4WKYA 4DV4J 5KFMA 4FJKA 2LQBA 2V68A 4WCEQ 1LFPA 4AXIA 5CXTA 3CG7A 4CW7B 2LQ8A 4WQ5C 1RT4B 4LIWA 4QR1A 3BBBA 2YPYA 1ZZFA 2KXHA 1PCAA 1NK4A 4EGLA 3FBBA 1RWUA 4URGA 3ZNJ1 1HMVA 2KT3A 2MSTA 3H4DA 5BPMA 4RWTA 4O3OA 1DURA 2E7WA 3ILIA 1Q9XA 1N8RO 1LCUA 4QYZK 3EGZA 3C6TA 1LK5A 5KFPA 4MIWA 1JMTA 2KJVA 2M2BA 4WJBA 2GUPA 2EWHA 3TTFA 2CVIA 3DOMA 1XTZA 4A61A 4KKOB 2NS1B 5LJ3Y 2X6NA 4MKVA 4QS7A 2XY7A 3IR5B 2IM3A 2Z2LA 4DOZA 4FWNA 4JK8A 2BJ7A 1YJUA 1VSJA 2XQCA 1S5JA 4CF8A 2MSSA 4AXJA 2HNZB 3FGVA 9ATCB 1YI2N 3GG4A 4FS2A 5DM6L 3VAHA 4RO0A 3Q7BA 1T9UA 4I2QA 4CO5A 4ECUA 4RW9A 3NFAA 2IVMA 4O0IA 4AQYJ 4CTAA 4MFBB 1PYSB 4CFBA 3TU5A 3MEDA 2C3UA 1N5YA 1B9DA 3MX5A 3M1VA 1FRMA 1XK8A 4LRAA 3MECA 4RW8B 3VGLA 1KVIA 1NGCA 2YWFA 2E7XA 4Y3CA 4YHHK 3Q2SC 4GNIA 2O66A 1AT1B 2KG0A 2RQKA 3AA8A 4ED5A 4NRTA 3MR5A 2I0XA 2BEFA 3EM1A 1F21A 2FJDB 3EL2A 2Z1GA 4PHTX 2CGKA 2OH2A 3I82A 3L2QA 3NF8A 4CF9A 3HP6A 3GG0A 5AQMA 3UDVA 3K5PA 4CGFA 4Y65A 1HNIA 3Q8RB 4KB0A 3MHYA 5KFSA 1U1QA 1DBDA 3LP3A 4DG1A 1JIHA 1AW0A 1OPZA 3DDNA 3DKDA 2NZTA 1X4HA 4CYUB 1RAGB 5D0EA 4X65J 2CIMA 1T0TV 1YAGA 2GGPB 1SUQB 3CFOA 5K5MA 1RDBA 3F56A 2D7SA 1VI7A 1H7XA 5EXWA 3M1FA 5CYQA 4DR4F 1TK5A 1S97A 5EN1A 2EK6A 2YHAA 1B0VA 1T11A 4TN2A 3M8PA 2Q79A 1KSPA 4BC3A 4Z94A 4GKKJ 3B6PA 3B8AX