1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
4RW7B 1G15A 4HUFA 3C6UB 3MXMA 3MEDA 4FJ8A 4O5BA 4RW9A 1HNIA 4DF4A 4ZVHA 3M8PB 5T7BA 4PA1A 3OSNA 5KFIA 2ALZA 1C6VA 3MF5A 1JXLA 3L3VA 3V9XA 2GBZA 3M8QA 1TQLA 3QGGA 4H4OB 3SUPA 3RMCA 1LW0A 3GIKA 1D8YA 3VA0A 3AO5A 4E0DA 4ED2A 3THVA 5KT2A 3I0RA 3QO9B 1N48A 3KLVA 2VG6A 4E7KA 2UVRA 3LP1B 1LAWA 3CWJA 3KIOA 2RF2B 1FKOA 4NLPA 3DLKA 3MECA 4WYLA 1J9AA 2XGPA 4ECXA 2UUWA 3AA5X 2BDPA 4I2QB 3VQ9A 1TKDA 2HHSA 1TL3A 5J2QB 3L2VA 5JXSA 1IG9A 4ELTA 4OLBA 1YTUA 3FSIA 4MKBA 5KFUA 3RAQA 3DLEA 3QEXA 2D41A 3HPOA 1TL1B 4G1QA 1HPZB 1EX4A 4ZVEA 4CGIA 4NLRA 3QGHA 1KLNA 3CO9A 3KK2B 4YP3A 1SKWA 2C2EA 4I9QA 2OZMA 4E7LA 2YNIA 3M8RA 2YNIB 3LALA 3NF7A 3PY8A 4Y2AA 4ZHRA 3NF9A 3V9WA 4DFPA 2IBKA 4DTUA 4JS4A 2E6LA 4GC6A 3K57A 2PYJA 3KK3B 5F8LA 3MEEA 4KHSA 1WAJA 4KI6A 3SI6A 3AVNA 1ZYQA 1N6QB 2P51A 1JXEA 3IAYA 5F8NA 1NK4A 4BE1A 3EZUA 3QIPB 3A2FA 4ID1A 3NFAA 4KHQA 1RT7A 3NHGA 2W9BB 1VSIA 4CHZA 2RF2A 3I5CA 2QE5A 2ITGA 5KFGA 1WSEA 2ZE2A 4QCLA 1NK7A 3DLHA 4LQ3A 3UIQA 1QSYA 4CEZA 5L1LA 3QNNA 2KW4A 4CJQA 4N41A 2FC0A 2HAIA 4NLGA 2KFNA 4TQSA 4O3PA 4CFCA 4UQGA 3MXIA 3TWHA 2JEJA 3Q8SB 3IRXA 4CF8A 4IDKA 1RT1A 1CZBA 4ZVGA 3LP0B 2AQ4A 4E7JA 4Q44A 1HQEB 1A5XA 2B6AA 4DTJA 1SKSA 3M8PA 5CYMA 3QNOA 1FK9A 3KK1A 4PWDB 4ELUA 4Z4CA 5KT6A 1WLJA 4DU4A 2IMWP 4DTNA 1NK0A 1RT4B 1NHUA 2J6SA 1IKWB 4YR3A 3RR8A 3OYGA 4QWCA 5J2QA 1VRTB 4DTRA 3K59A 4ZPBA 4IRKA 3P5JA 2RKIA 3PUFA 1KLMA 2ILYA 4KKOB 3BSAA 2VG7B 3OL6A 3CJ5A 3PW7A 2IS3A 1LWFB 1HQUA 2J6TA 1LW2A 4CFAA 3B6PA 1X9MA 1NJZA 2Z1GA 2Q3SA 1RTHA 4RU9A 2G8WA 4TY8B 3H59A 3HXMA 4F50A 4EYHB 4CF9A 2XO7A 1KLMB 4HKQA 4M3YA 3JYTB 3K58A 4TLRA 4RW4B 3KMQA 3GILA 2HNDA 1R0AB 3BJYA 4O4GA 4KPYA 3UDLA 4J9RA 3SFUA 2BQUA 1S1XB 4Q5VA 4CJRA 3L8BA 1VSMA 3CQ8A 3QLHB 2IAJB 3CG7A 4U6PA 3T5JA 2F96A 4CF1A 1C1CA 3LDSA 1JLQA 3V9UA 1RYSA 4RNFA 2XGQA 2Z1IA 2OYQA 2RKIB 4B9LA 4EYIB 4KB0A 5DG9A 1HRHA 4ECUA 4XO0A 3LP2B 3TR8A 2YNFA 5DG8A 4C8NA 3QEWA 3ZT3A 1OS5A 4CE9A 4K4ZA 4K4VA 4NYFA 4CHYA 4NLUA 1ZTTA 1UWBA 2ATLA 3D28A 1NKCA 4IH5A 4EP5A 1RT5A 1SL2A 1TP7A 4O55A 4DS5A 4M3TA 1HNVB 5KFQA 4CERA 5KFCA 3PX4A 4B8AB 1FKPA 1X9WA 4H4MA 2FVQA 2XY6A 1RBVA 4L8RB 2GUIA 4C8KA 4BACA 3RWUA 4J9MA 4CGFA 1C2PA 3SCXA 2DTUA 4B3OB 1S6PB 5FRNA 3T5HA 4EZ6A 3ZT4A 1S1UA 4K8ZA 4FJNA 4F4WA 1SKRA 1JLGB 4N56A 5I42A 3MECB 3BREA 5FROA 4FK0A 4E89A 3QO9A 3PW5A 4N5SA 4CGJA 1RDDA 4B8CA 3DLGB 4KV8A 4JV2A 4WE1A 3H4DA 4GC7A 3LP2A 3VQDA 3DRSB 5KRTA 4C8MA 3ITHB 3MR2A 1NHVA 3FQKA 1S4FA 1VRUB 4CJ4A 4CEAA 4CFDA 4DU3A 4HUEA 2KZZA 4FLVA 2IA6A 3MEDB 3H4BA 2KZMA 1HPZA 4ZP8A 3Q8PB 4FJHA 1RT2B 2HNZB 3EYZA 2VG5A 4DG1B 4IG0A 4PUOA 2JLEA 4IFVA 2ZKUA 5C42A 4R5PB 3H5XA 1U47A 1NK6A 4TN2A 2FBXA 3F9KA 3KLHB 4K4SA 1DTTB 5EWEA 1J53A 5KFLA 4HUGA 4J2BA 1WNSA 2G8KA 2YHAA 4KAZA 4ZPAA 3VQSA 4X2BA 3LAMA 3CM6A 3RRHA 2W7OA 4LH5A 4H54A 1RDRA 4CJUA 4Y2CA 3O3FA 4CFBA 3RMDA 1EETB 3Q8RB 4DQQA 5SWMA 3HP6A 2DFEA 2OPRB 4LH4A 3S3OA 3AVFA 3JSMA 2HMIA 3OLAA 1TKXA 4ZPDA 2JC0A 4IG0B 2D0BA 1B92A 3PVXA 1UOCA 4CJKA 4IRCA 3NE6A 1JLCA 4PWDA 2JEGA 4CIEA 3FFIA 2RN2A 1C0UB 3EZ5A 4RW6A 3VQAA 3VQQA 2EC0A 3PV8A 3AVAA 3IGNA 4KKOA 1ASUA 4FJIA 3CYMA 1S1WA 4DU1A 4URSA 4DSFA 2GIQA 4Y1DA 1N5YA 2EHGA 4KI4A 2FVPA 2C22A 4JRPA 3SYZA 4FLYA 3Q8QB 3ALYA 1CSJA 1S5JA 4NCBA 4CF2A 3DDKA 2HHVA 2W9BA 4WZQA 5DQHA 4B08A 4IDKB 5JS1A 3V4IA 4M45A 1FK9B 4MQ3A 4FLTA 1EP4B 2FLLA 4O0JA 2CKWA 4FLXA 4ED0A 1JLGA 5J2PA 4AHUA 5J1EA 4CJLA 1SH2A 5KI6A 2WTFA 2F8TA 2YKNB 1MU2A 4MK7A 3H5SA 4CEEA 3KLIB 4IQXA 2J6UA 4JUZA 4Q8FA 2P5OA 5KFTA 1KHWA 3H2LA 1HMVB 5HROA 4Z4IA 3DRRA 1RTJB 4HYKA 4RUCA 2WONB 4DQIA 1GOAA 3T3FA 4KFBB 4JLHA 1NK9A 3KD5E 3T1AA 5KG1A 5EDWA 4W5TA 3ISND 4DEZA 3L3UA 4MKAA 4CECA 3MR5A 1FXXA 4J2AA 4N76A 4Z4EA 5KFOA 4CGHA 5EU7A 5K14B 4DTOA 1RTIA 1S9EA 4NRUA 4F2RA 1RT2A 5J1EB 3AO1A 3I0SB 2YNFB 2G8HA 1C1BB 4OPKA 3MXJA 4K50A 3KKRA 3WNFA 5KFAA 1BQMA 1FKPB 5KTQA 3KNAA 3V1OA 3V1QA 3ZSOA 3DM2B 1RTJA 3DRRB 3TI0A 1JLQB 3NL0A 4M42A 3TANA 2F8EX 1L3TA 3MEGA 4KTWA 4DQSA 1BI4A 3FDSA 2OPSA 3DLGA 4KV8B 3VQ4A 3AA3A 4ID5A 2FLNA 1SUQA 5DMRA 3L2UA 2Y1JA 1U45A 2ZQBA 1DLOB 3KHHA 2GV9A 3JSMB 4PQUB 4FJGA 1XR5A 1HYVA 1T7PA 3GQCA 4FJMA 4YQWA 4LD0A 3EPIA 1WSHA 2EX3A 2HHWA 1K6YA 1Z25A 1XHXA 1HARA 4HVJA 1JL2A 4DFKA 5L1KA 3IS9A 2ILZA 2B5JB 4FS1A 3DLRA 5C25A 4I7FA 2R8KA 3HVAA 3BQ2A 2GIRA 4CF0A 2XY5A 1EP4A 3OYBA 1YVUA 4EP4A 3JYTA 4NLYA 2BGGA 4FS2A 1VRTA 4NLDA 2JGUA 1SH3A 4IRDA 4ZTFA 2KQ2A 4E1MA 1ZBLA 3AO4A 3NAIA 4YFUA 3CFRA 1D9DA 3K5MA 2F8SA 4G3IA 3KLGA 3S3NA 1T05B 3U6FA 2HWIA 3C6UA 3V81B 2BE2A 3UPFA 1K1QA 3OL8A 2YHBA 4DQPA 1X1PA 3M9NB 1Z4UA 4J9QA 3VQBA 2FJVA 3BGRA 1BCMA 4TYAA 1BQNA 1RT6B 1KFDA 4CIGA 4C8OA 2IJFA 3V9ZA 1TKTA 2B5JA 4IFVB 3HP9A 1JLBB 1RNHA 1Q8IA 3AVJA 3LWMA 2BANB 1JLAB 5KG2A 4KSEB 4DTMA 5FRMA 2QXFA 5F9NA 3P83D 3DI6B 4E7IA 4I7FB 3I5BA 4KTQA 5EUHA 3OS0A 2P5GA 4RNOA 3CDUA 3KK3A 2YV0X 1S1UB 4Q0BB 1JXBA 2OPQB 1U09A 1BI4B 5C42B 1L3SA 1RT3A 1LWCB 4CEOA 1RBUA 3DRPA 3CJ3A 5T14A 1KTQA 3HKWA 3T5KA 4EO8A 1WSIA 3SV4A 3DM2A 2YNHB 3HM9A 4DF8A 2UVWA 4FK2A 4FM2A 5F9LA 3D0PA 2V4QA 2I5JA 4RW8B 1BIZA 4ZP6A 3SFGA 3HYFA 5KFBA 4AHRA 3BSOA 1O1WA 3QEPA 1T94A 2BANA 3UR0A 3KLFA 3CIZA 1S49A 2BQRA 1Q9XA 4MFBA 3V6DA 4IR1A 5L9XA 3H08A 3ULDA 4KB7A 4NRTA 4FVMA 4R0EA 2OPPB 4HTUA 2V0NA 1KVCA 1N5YB 4IFYA 5CZ1A 3NAHA 1FKOB 3CDWA 4Y1CA 4M3RA 4GW6A 1SL1A 1L3VA 1GOCA 2X74A 2HHQA 3NKYA 1I3AA 4IBNA 4OVLA 5KFDA 4EZ9A 1REVB 3IRXB 3E51A 4O3QA 1CXUA 2WOMA 1JLFB 4BE2A 5SZTA 3SUOA 4ED3A 3NGIA 4HCBA 1T03A 3K5LA 2OPPA 3MAQA 3DLEB 1TVRB 5KGWA 3KHGA 4Q0BA 1VSLA 4MIAA 3HVRA 4NLSA 3RMBA 5HRPA 4KHNA 5HLFA 4J2EA 1JIHA 1QQCA 1N4LA 4JS5A 3MR3A 1GX6A 1TV6B 4WFXA 4MFBB 1BL3A 3HSTB 4PY5A 1S1TB 4FJ7A 4OGEA 4CHQA 4CEBA 1S9GA 4K4WA 1S9FA 4ED7A 2ASLA 2BRLA 4OKJA 1JLBA 3EPGA 5I3UB 3OSPA 1VSEA 1TKTB 3ZSWA 1LWFA 3DRPB 4W5QA 4FM0A 1IH7A 4K4XA 3NMAA 1SL0A 4H4OA 4RZRA 4J9LA 5KFMA 2OPSB 4TY9A 3ZSRA 3QERA 1NJYA 1U4BA 1QSLA 1NKEA 3DOKB 2X78A 1RT4A 5L1IA 3QETA 3RTVA 2VG5B 3K2PA 1JLEB 1RDBA 3QEVA 4LSLA 4XIUA 2G8VA 1KVBA 3QLHA 3QZ8A 2FBYA 4NLWA 4F4ZA 2WB4A 1RYRA 3TAPA 5KT3A 3HHKA 4FLUA 4TYBA 2E6MA 3K5NA 5F8MA 5FDLB 2AGOA 4URQU 4BWJA 4OKEA 5F8GA 4BDZA 5KFHA 4FW2A 1WSGA 3V6JA 4Z0UA 2AGQA 4TY8A 2XY7A 5KT5A 2R7YA 1VSHA 2V4RA 2HNZA 2R8JA 4FBUA 2XI2A 4LSLB 3B6OA 5DLGA 4R8UB 1HQUB 4H8KA 1S9GB 1BGXT 4IH6A 2B43A 5KGXA 3DOKA 1JKHB 1LW0B 2KFZA 1RT1B 4CJVA 5KRSA 2HMIB 5J2NA 3DLBA 4ICLB 3WNGA 2IM2A 2D3UA 3MFHA 4XPCA 5DK5A 1N56A 4KHYA 4CK1A 4ZP9A 1HNIB 4ECSA 4M3WA 2IGIA 1LW2B 1RBRA 3HVWA 5KG4A 3KMSA 2WOMB 1NNDA 4FLZA 4IKFA 3SV3A 4EBEA 4QW8A 3V6KA 3PO5A 1W25A 2PZSA 4ZPCA 2HNYB 1XR6A 4KHUA 2W7PA 4YR0A 2R2TA 2QV6A 5K14A 5CY4A 3HO1A 3IN5A 3U3GA 4O44B 3OYCA 2R8HA 4KE5A 4NYZA 4QW9A 1TKZA 3FRZA 2DFHA 5HP1A 2GC8A 2Z1HA 5CYMB 2OH2A 3GIMA 3F73A 2XC9A 3CFPA 4CIFA 4IH7A 1HNVA 2D0AA 3RMAA 3ITHA 3ISNC 4IOBA 3OJSA 4DWIA 3OYMA 1XR7A 4G1QB 2DPJA 2R8GA 4I9LA 3GIJA 1A5VA 4K4UA 3M8SA 4AHSA 1S9EB 1ZBHA 3NAEA 5I3UA 3SUQA 4NLXA 1SH0A 4ZP7A 3HK2A 4M95A 4IG3B 4LSNB 2RDJA 2HNDB 2D0CA 3D5MA 5D3GB 3OYHA 1Q9YA 4MK9A 3V4IB 4CHOA 3C95A 3LPUA 2WK4A 2AJQA 5EWGA 5JS2A 3KK2A 4M94A 1CZ9A 4DTPA 4ECTA 3L2QA 2HW3A 3V9SA 2HVIA 3TQ1A 4NCGA 1J54A 4F8RA 1TL1A 1S1XA 2XWYA 4OPJA 2RPIA 4DSLA 4Q43A 3HT3A 3QGIA 3CM5A 3ICLA 4AHCA 1QTMA 3V6HA 1R0AA 4Z4FA 1ASVA 2D5RA 1REVA 5J2PB 3V81A 5KFPA 4CJSA 2FLPA 3DLKB 4KHRA 4RW6B 5HP1B 1JX4A 4R8UA 4K4YA 2IAJA 1JLAA 5DQIA 3RB0A 3NF8A 1RTDA 3OL9A 3AVGA 4KB1A 3N6NA 4DLEA 4U7CA 2PYLA 5C25B 3KLFB 4QWAA 2NUBA 4GVMA 1BQNB 1RT6A 1XC9A 4M3ZA 4ECWA 3HJFA 5KFKA 2FVSA 1KRPA 4F4YA 1D0EA 1I39A 1ZBIA 5DGAA 4YNQA 4QWDA 1S0MA 3BR9A 3TAGA 2YNHA 4RW9B 3P1GA 4W5OA 2FBVA 4DMNA 4O3OA 1T05A 2CJQA 4O0IA 3KK1B 4YR2A 1C0TA 5KG6A 3NH1A 1A5WA 1RT3B 4URGA 5HRSA 1RT7B 2DY4A 3S3MA 5F8IA 3M9OB 4PQUA 4EO6A 5KG5A 2D3ZA 4C8LA 2OPRA 3LWLA 1ZETA 4O3RA 3E01B 5FDLA 4Q45A 3MR6A 3WNEA 4FZZA 1D1UA 1WN7A 3L2RA 3CJ0A 4CJ3A 5HRNA 4B9NA 2JC1A 3OLBA 1VSFA 1B9FA 1NOYA 4JRQA 2W8LA 4DL3A 3IGVA 1ZBUA 2ZD1A 3H5UA 1ZTWA 3MFIA 3G86A 3I0SA 3HL8A 5KFSA 4FJXA 3CVKA 1Y97A 4QWBA 2G8IA 4QWEA 4LSNA 3BGRB 3KOAA 4IFYB 1F21A 5HRRA 4BDPA 5HLFB 4WE1B 2W9CA 3L2WA 3AO2A 3MEGB 1EXQA 2FBTA 1TL3B 5KT7A 3NH2A 2FJWA 1BQMB 5KFNA 1NOZA 2LSNA 3RB6A 4E7HA 5D3GA 4KTZA 4DFJA 2E9ZA 3MEEB 3BDPA 5KFEA 1TVRA 5DGBA 1RILA 5KFXA 3HVTB 1LWCA 4DTXA 4E19A 4Q8EA 1LWEA 4CJFA 4EBCA 2I1RA 3V6DB 2YKNA 4EEYA 3OVNA 4ICLA 1QE1A 3PR5B 5CYQB 4KAIA 3AVCA 1RA6A 4WZMA 4CJWA 2X6NA 1MMLA 1S6QA 2PY5A 3TVKA 3LP1A 3AA2A 5DLFA 2ATQA 3I8DA 1S10A 1C1AA 3OYIA 4Y34A 3NCIA 2W9CB 4TQRA 4HHTA 3KLIA 4ED1A 5KFZA 3VQEA 3DYAB 4FK4A 3NGYA 5J2NB 3GIIA 2HNYA 1RDAA 1RAJA 3ZSVA 4DS4A 3CFOA 4RNMA 4BE0A 3RB4A 3SQ1A 1S1WB 3LZIA 4CCHA 3VA3A 1C1BA 4W5NA 2E4LA 4ED8A 2G8FA 4OLAA 4KO0B 1XWLA 3BQ0A 2AU0A 4E1NA 3U3YA 4DSEA 1C0UA 4RNNA 4LY7A 4AHTA 2HB5A 1J5OA 3N6MA 4DL6A 4FJKA 1GX5A 2B4JA 1HQEA 3SUNA 1L3UA 1JL1A 4DLGA 4NLOA 4B9VA 2WRMA 4WXWA 1TAUA 1YTAA 4CHPA 4ELVA 4ECZA 3SPZA 3VN5A 3G10A 2AX1A 3KD1E 1S48A 1ITGA 4Z4HA 2R8IA 4MIBA 3PW4A 4CJTA 5JUMA 3TARA 3VQ7A 3SZ2A 3PX6A 3OYEA 4RW7A 1NJXA 1VSJA 1DTQB 5C5JA 4M41A 3VQ8A 3PW2A 1IO2A 2WCXA 3PHEA 4MH8A 5C24A 3ZT0A 4RUAA 3RAXA 2UUTA 1QAIA 1TV6A 4R5PA 1JKHA 4IR9A 1D5AA 4CK2A 3OYLA 1XHZA 1J5OB 4B9SA 3GV5B 4WYWA 4FZYA 3OS1A 3UQSA 1T03B 5CZ2A 3FQLA 3CJ4A 2QK9A 2FJXA 4FZXC 2OA8A 2B6AB 2IM1A 2D7SA 1GOBA 3OS2A 1NK8A 3H5YA 4KRFA 3OYJA 4FLWA 3OYNA 4DL7A 3G6VA 2HWHA 3VQ6A 2BR0A 3SQ4A 3KLHA 4I2PB 1RTDB 4AH9A 4CGGA 4O44A 1WAFA 3OL7A 3DYAA 4EBDA 5HBMB 3C94A 1UA0A 5F8HA 1JLEA 1BCOA 4OJRA 3O4QA 1RBTA 4O3NA 1VSDA 4B9MA 1IKVB 3NH0A 1S6QB 3H98A 3ZT2A 5EWFA 1KFSA 2Y1IA 1IKYA 1JLCB 3OHAA 1NK5A 3O3GA 3DMJA 3NDKA 3KLEA 3HPGA 4FXDA 4FM1A 4JV0A 3NF6A 4K4TA 5KFYA 4M3UA 3SPYA 5CYQA 3QIDA 3ZSXA 1I6JA 5HROB 3AVBA 1NJWA 4MK8A 3DOLB 5KG3A 4H4MB 3IG1B 1VSKA 1RDCA 4QAGA 4NCGB 2XY8A 3K5OA 3NGDA 5E41A 3OYAA 3SQ2A 4E3SA 3GV7B 4FCYA 2C28A 3DMJB 2ASJA 3QYYA 1UWBB 3ZSQA 2WONA 4CK3A 2O5DA 4N47A 1W9HA 2QKKA 4B3OA 2Z1JA 2YNGB 1RBSA 1ZBFA 1TAQA 3ZT1A 1U49A 4I2QA 2YKMA 5KG0A 3SJJA 3WNHA 2HVHA 3VQ5A 4B9TA 4J9SA 3DI6A 2IM0A 1U48A 3AA4A 1SV5B 3AV9A 1TK5A 3V1RA 3KLEB 3LPTA 1C1CB 1UA1A 4FJ5A 1RCHA 2VG6B 4CJEA 1HJRA 4FJLA 3GYNA 1BHLA 1KCFA 2A1RA 3QIOA 4BDYA 3NGZA 1RTIB 1S97A 3RR7A 3DOLA 2E9RX 3ZSYA 4J2DA 4FYDA 3PJXA 4NCAA 4ECQA 3BSCA 1IM4A 3PR4A 3LP3A 2XRIA 1QSSA 4CESA 2OZSA 4DL2A 1S0NA 4KFBA 3D45A 2R2RA 5C24B 4CGDA 4NYNA 1S1VB 5J2MB 3PJWA 2JEFA 1T8EA 2IJNA 1D9FA 1QE1B 3FFIB 4ED6A 1HMVA 1BIUA 3H40A 1LWEB 1S6PA 3RBEA 1B9DA 1EKEA 1QUVA 3AO3A 4ECVA 3QINA 3KJVB 2BQ3A 3OYFA 4I2PA 3O4NA 4O3SA 3N6LA 5KFFA 4Z4GA 4FJ9A 2HHUA 4F3OA 4GMJB 4OGCA 1IKYB 2O4GA 3T5LA 2DFFA 4HCCA 1TK8A 4CJPA 4XPEA 4FW1A 2HHTA 4J9PA 2UVUA 2WHOA 3LP0A 4DQRA 4NZ0A 3AVHA 1IKXA 4ZMMA 4J9KA 4W5RA 2VG7A 1VRUA 3OYKA 4K8XA 3KKSA 4F2SA 3KHRA 3C6TA 4O4RA 3O3HA 4NLTA 4WXOA 3AVKA 4KHMA 4ECYA 1IKWA 3VQCA 3OHBA 4F4XA 1TK0A 1HYSA 2HHXA 1C0MA 1L5UA 2VA3A 1S1VA 5J2MA 3KTQA 4RW8A 3OY9A 1CXQA 4J9OA 1Z26A 4TXSA 4AILC 4ZTJA 1DLOA 5KFVA 4ECRA 4O4GB 1ASWA 4KHWA 3BQ1A 2YKMB 3AVIA 4RW4A 2DPIA 3G6XA 4IG3A 2AX0A 3TAMA 4CEFA 1U04A 2P1JA 3TAMB 2JEIA 1LAVA 1W0HA 1DTQA 1C0TB 2VWJA 1HYZA 2XCPA 3ASMA 2ZE2B 2XI3A 4CJ5A 3TAQA 3CJ2A 1KHVA 1S1TA 3HPHA 4DSIA 5DG7A 3TAFA 1SUQB 3MTKA 3SI8A 3LZJA 1T3NA 4DSKA 2AWZA 1YVFA 3G6YA 1TKZB 1QAJA 1WNEA 3QIPA 2C2RA 3PO4A 1WSFA 3OJUA 3LAKA 2IM3A 3PW0A 5KT4A 3PX0A 3CDEA 5F8JA 5HBMA 4PUOB 5KFJA 1JLFA 4QPXA 4CEDA 2RDIA 3G0ZA 3QZ7A 2XHBA 2QKBA 4KO0A 1VK0A 1QHTA 1NKBA 2IC3A 2IDOA 4CHNA 4DFMA 3S9HA 2IC3B 2ASDA 4RNHA 4ZHRB 4RG8A 4FJJA 5I42B 4QOZB 2R2SA 4BWMA 1IKVA 2AGPA 1RT5B 4TSXA 3QESA 2O4IA 3I0RB 3TAEA 4OL8A 4Y3CA 3RBDA 1MU2B 4WFYA 4M3XA 2OPQA 4B9UA 4JV1A 3TABA 2C2DA 2A1SA 3T19A 3E01A 2I5JB 1YT3A 3M8QB 4LQ9A 5L1JA 3BSNA 3KJVA 4AHVA 4NLVA 2FVRA 3VQPA 1LV5A 2W42A 1CLQA 1RA7A 1EETA 3KHLA 3IG1A 2XCAA 1N6QA 3RB3A 1TGOA 3QEIA 2ETJA 3HVTA 4F4KA 3AVMA 4NLQA 3C6TB 5DQGA 4ID5B 3OYDA 1XI1A 3SQ0A 1TKXB 2FVCA 3PZPA 1KVAA 3ZCMA 4DTSA 2E9TA 1DTTA 2BRKA 3NBPB 1K1SA 3ZSZA 4YMEA 4J9NA 3AVLA 4FBTA 1S0OA 1BISA 1KSPA 2R2UA 5KG7A 4IKAA 5KFWA 3KLGB 3EY1A 1QS4A 2UVVA 2ZD1B 4DG1A 1RTHB 2X6SA 4ZVFA 3I5AA 1WSJA 4OKKA 1HYSB 4DL5A 1X9SA 3SNNA 3RRGA 2W8KA 4KREA 1SV5A 4WFZA 4F3TA 2G8UA 2VA2A 1IKXB 2VWKA 4KBIA 3M9MB 4DL4A 4CEQA 3NBPA 2IOCA 2BE2B 3DRSA 3GV8B 2V9WA 1UAXA 2YNGA 3IS9B 2KTQA 3LANA 4DSJA 5KFRA 2W9AA
chains in the Genus database with same CATH superfamily
3NS5A 1G15A 3SBMA 1B3TA 2CRLA 3MXMA 3JS9A 3ZX2A 4DF4A 2GV1A 4WP9A 4JNEA 3A5LC 5BREA 3CIPA 3FGVA 1HFEL 5KFIA 2ALZA 5AR0A 3OFEA 1M1GA 3M8QA 4CNYA 3SUPA 3MCOA 2ROPA 2DRAA 5AQIA 2DRBA 1D8YA 3OR2B 3THVA 3I56N 3QO9B 3D1QA 4GVEA 4NMXA 2VG6A 4E7KA 4CWBA 1N33F 2PD1A 1LEOA 1DZ5A 3C0BA 4CO4A 1J9AA 1NLVA 3MCNA 2XGPA 3GTYX 1HWJA 3AA5X 3VQ9A 1TL3A 1V9OA 4MMOA 3PYEA 3JAMU 4ELTA 3VVUA 4HHUA 2D41A 1TL1B 3C65A 4LF4F 3QGHA 3CO9A 3WXIA 1R89A 4YP3A 2ZBQA 1SKWA 2B7CB 2ZJPL 4E7LA 3PY8A 3RSEA 5IWAF 1GTEA 2WZ1A 5E3AA 4EGLA 1Q82T 4ZJOA 1S76D 4I6MB 2LKZA 2W2NP 3N28A 2CPEA 5JVHL 2LXIA 3M05A 2E6LA 4DU8A 4N7TA 4IDHA 1XNRF 2PFFB 3UCZP 4I6YA 5DETA 4LBPA 1H74A 1WAJA 2P51A 3THTA 3IAYA 3T9ZA 3EZUA 3QIPB 1F0XA 3SCLE 4ID1A 3NFAA 3ZZOA 3Q83A 2W9BB 2KVIA 2XMMA 4OI6A 2RF2A 5IFMA 2QE5A 2RRAA 5FLXO 4LVOP 5KFGA 2JWNA 2BACA 5LJ5Y 1GXUA 3DGPA 3PIOL 4Z94A 3DLHA 4LQ3A 4DV5F 2OFGX 3MXHP 4M8LA 4N41A 4MJKA 2MGZA 2W4DA 1I94J 4NLGA 2KFNA 1GLAG 1A7GE 4X65K 2E66A 3Q8SB 2G0JA 1A6LA 2DHSA 1RT1A 1AB8A 1WDTA 4OZ3A 1U1PA 4DTJA 4YEAA 5CYMA 2D3O1 1FK9A 3KK1A 2ADBA 3D3CJ 4MIWA 4JI7K 2QO3A 2ZDPA 4ELUA 2G4BA 2CNOB 1AFJA 4A48A 4Z4CA 3SSRA 2VUGA 2XS5A 3ENHA 4DU4A 3TPQA 2IVYA 2C3MA 1RT4B 2J6SA 2KXFA 4CH7A 4E8UA 3HHLA 1K0VA 1SC1B 2HQDA 1B70B 3BZCA 4JI2F 3RVCA 1IWGA 2QWRA 3T9NA 1Y10A 3TZZA 2P9SB 3VF0B 1HBOA 5LMNF 2ILYA 3A4TA 3BSAA 3OL6A 5BXIA 4DUYJ 3IDHA 3W3DA 4WPAA 5DRKA 4JP8A 4CFAA 4A8XA 3B6PA 1X9MA 2Z1GA 2UXBF 3OFFA 2G8WA 5BJRA 3H59A 2AKWB 1KLMB 4M3YA 1CBKA 3GCXP 5G0RA 2VOPA 3D1OA 3PYDA 2IRUA 2IDLA 4CLKA 4OO1J 4Q5VA 1CPZA 4CJRA 2F9DA 1VSMA 3CQ8A 3CG7A 4C0OC 4U6PA 2F96A 3LDSA 3M30A 3Q24A 4RNFA 1R59O 3AY0A 2GO9A 4ES2A 3OA9A 2RKIB 3VGTA 4XO0A 2YNFA 5DG8A 3J80U 2NRHA 4G9ZA 4FYWB 4NXMK 3T1YF 3ZTOA 1U02A 3IO1A 1T3VA 2DY1A 1Q8LA 1YIJN 3A5MC 2QWQA 2PAVA 1V5VA 3D28A 1L3KA 4EP5A 2RQMA 3K5PA 4NLBA 3PX4A 4B8AB 2YVSA 2Z2MA 3GP9A 4H4MA 1JJ4A 2O3DA 4KY3A 2OCEA 4QIEA 4K2XA 4L8RB 1RBLA 3QT5A 3CMEN 4JHDB 3RWUA 1C2PA 2YKOA 1IJEB 1B7FA 1S7IA 2XQCA 2EFGA 2ZBIA 3I4PA 5GADP 3EGZA 3ZT4A 2A6AA 4GV9A 1HR0J 4N56A 5I42A 4XDCA 1VBKA 5FROA 3UVJA 1KBRA 4JB8B 2B4UA 1WC1A 1ZM9A 3UN5A 3IC1A 2DNHA 3EDQB 4DPUA 3GONA 5ITHA 3CCUS 2B4PA 4GC7A 5KRTA 2NS1B 1M5PC 3ITHB 3MR2A 3P49B 4IEEA 5AQQA 2LQ5A 4U67Q 3M6WA 4X4NA 3MUTP 2BKOA 2JJ4D 1YG0A 4ZPWR 2UU9K 4FWSA 2PA8D 4UUXA 4HUEA 2KZZA 4WTOB 1KQSR 4ILJA 3FRYA 2E88A 4ZP8A 4DR1K 3MM8A 4FJHA 1RT2B 2E2NA 1YJWN 1QAXA 3WIUA 2CQGA 2MZRA 2HZAA 2UV8A 1Y3JA 4PKIA 2HBZB 2XWXA 3O1WA 4JI6K 3H46O 2ZKUA 1F5AA 4R5PB 3MOZA 4HWIA 1UL3A 5EWEA 4LR7A 2HSTA 4J2BA 1WNSA 2CQ1A 4MKYA 2P9NA 2VBYA 3VQSA 2HK2A 3CM6A 1X5SA 2VDHA 4H54A 1RDRA 4CJUA 4C7QA 3IRWP 4ZVPB 4DQQA 2DKOB 4QZVB 1GLLO 4QIVA 3VR1A 4IWVA 5BR8K 1TKXA 5E0OA 4OI1A 1IQTA 1PKUA 3I82A 4G1IA 4JI4J 3PVXA 3NCQA 4IXCA 4IRCA 2DK2A 1XNQK 2DEIA 3O1LA 3MDFA 4CIEA 2RN2A 3W2VA 1C0UB 2QYGA 4PRFA 5DZ7A 3AVAA 4ZVOB 1HNWF 2GUPA 1MN9A 3CYMA 4P71A 1S1WA 4GV6A 1U1RA 4DSFA 2EHGA 3QFUA 1VQYA 2FVPA 3HOTA 1VLYA 3CCVN 1H1VA 3D67A 3I8BA 1QTNB 4CO3A 7AT1B 3ALYA 1QDUB 1NH8A 4B08A 3CCWA 2C3YA 4IOCQ 3IBWA 5D0HA 5L8RC 4FLXA 2PDAA 2BOPA 2GJIA 4AHUA 5J1EA 4A59A 4K0KF 4YB1P 2WTFA 3DXMB 1JXVA 3MD3A 3H5SA 3HSGA 2P5OA 1VQLS 2ZHBA 1HMVB 1BE4A 4Z4IA 3FGUA 2WONB 4DQIA 1T9UA 1FDBA 3MMBB 3EKSA 3T1AA 5KG1A 5EDWA 4W5TA 4QR1A 4FXVA 5IM0B 3MR5A 3FBEA 4U95A 1YITS 3QB0A 4HTLA 3BKFA 1GT8A 1NUEA 4J2AA 4N76A 2KG1A 1HNXF 2WUSA 3ATUA 4Z4EA 5K14B 3SBTA 4DTOA 1S9EA 2QWOA 4EFHA 3VGKA 3AO1A 3I0SB 2YNFB 1YBUA 3CJ7A 4OPKA 2DEJA 3MXJA 4K50A 3KKRA 4A2BA 2ZZNA 3AODA 3ZSOA 3ZZYA 3CJ9A 1RTJA 3TI0A 2NRRA 4NXNK 2CH6A 1L3TA 5LT5A 4WP3A 4DQSA 3B78A 3EN9A 2VCPA 4KH4A 3NCPA 3HSZA 5BPLA 1VQ9N 4X66K 1F3FA 3A5NC 1RFQA 5K8OA 1SUQA 4DHVA 1DLOB 3EICA 5ETSA 4BRGA 3SCIE 1XR5A 2ZVSA 4P2SA 1T7PA 2OKQA 2P9IB 5IV4A 1T9YA 3EPIA 1WSHA 3CC4N 1Z25A 4P10A 2GWJA 2GAGC 3M7VA 4F25A 3R7NB 1QY7A 5L1KA 3SMZA 2B5JB 4DX7A 2WC9A 1IN0A 2EKNA 3FCWA 3K7RA 3Q2TC 3VTIA 4X64K 1CQNA 3OYBA 1YVUA 4EP4A 2DR5A 1SH3A 4ZLPA 1ZBLA 3AO4A 1P8GA 2GGPA 4CIOA 1SCJB 1RISA 3K5MA 2ASPA 4JAXA 2F8SA 3KLGA 1RE1B 3WZ0A 4WWSA 3UPFA 4AUKA 2M7SA 4QYRA 4M5GA 1K1QA 3M8WA 4JI0F 4NXNF 2HLUA 4J9QA 2FJVA 3BGRA 3L7PA 3T1HK 2N3OA 4TYAA 4CIGA 1UAWA 1XNQF 1TKTA 2B5JA 1JJCB 2MZQA 1Q8IA 4PL7A 3FNNA 3LWMA 5K8NA 3C14B 3ZZZA 4JK8A 1SC6A 5HMZA 3RZAA 5D0RA 1VHXA 5TKYA 2IBOA 4LF6J 4KSEB 2L48A 5KAKA 4DR2K 2C2OB 4M63C 5E3QA 4I7FB 2FQQB 4YS2A 1K44A 1NXIA 3TEHB 4H5WA 3OS0A 3U8XA 2P5GA 3UN2A 5AQWA 2YV0X 1JXBA 2OPQB 1UVKA 3FJ2A 4ZS6A 1RT3A 2RU3A 3KFWX 3ILLA 4CLTA 4FKXA 3T5KA 1B0TA 4EO8A 3Q86A 3OTOF 5ETQA 3ZETA 3S6EA 5F9LA 2V4QA 4KIAA 3IMQJ 4K0KK 5KFBA 3D3BJ 2EBEA 2VDIA 2BQRA 4A8WA 1Q9XA 3I4HX 3V6DA 5L9XA 4U7UD 2ZF5O 4LC9B 4DX8H 2IMOA 4FVMA 3O5BA 3EMTA 2OJ3A 2AZ3A 2OPPB 3CCZA 1W7WA 4HTUA 4PPDA 4IFYA 3CD6N 3UNYA 4BRLA 4CLFA 4BRPA 4GW6A 2ZUGA 3OXLA 4G65A 2G1DA 1I3AA 5HMXA 1CXUA 1JLFB 9ATCB 4BE2A 2DBBA 2NPIA 2A3ZA 3SUOA 1FWKA 1PC5A 3JTNA 3NOGA 5C2FA 2OEKA 3W9JA 1JIHA 1VRQC 1VC5A 4DOZA 1GX6A 2V69A 1VQMN 2XYPB 3E2EA 4FJ7A 1BUXA 2DY9A 2XMWA 4CEBA 4Q2MA 2W25A 2MKJA 4K4WA 4OYXA 2HQ3A 1D8ZA 4DJBA 3HX9A 4U8YA 3I31A 1KVJA 3LH2S 2BTFA 4DKWA 2ZGYA 1HHSA 2HFUA 4W5QA 4FM0A 1S5ZA 2UYTA 1RACB 2OTJN 1IH7A 1S6UA 1NDLA 1KAYA 4LF7J 4RZRA 5KFMA 2EEYA 3DFEA 3DXSX 4TVAB 2V8PA 1U4BA 1QSLA 1KD1T 1U6BA 1VQMS 3QETA 2ABYA 3RTVA 3MM7B 3R6LB 1RDBA 1T0TV 1TYQA 1P6TA 4IQMA 3MN5A 1KVBA 1YSJA 3QZ8A 3VF4A 5GAEU 1H3DA 4TYBA 4YB7A 4BQLA 4BWJA 3FZLA 3GJSB 1CJUB 5KPZA 1H0HB 1WOPA 4FW2A 2AW0A 3BEGB 5CA5A 2WVCA 3FBCA 2R7YA 1YRUA 2HNZA 1EKRA 2CDQA 4LSLB 4LT6A 2XSFA 2FY8A 1BGXT 4ZCIA 1LW0B 3LGNA 3FBBA 4X62F 4CJVA 2V8DA 3DLBA 3WNGA 1IBMK 2Z2LA 2FJAB 2HBJA 5DK5A 4KHYA 2FHOB 4CK1A 4M5LA 4ZP9A 4PYDA 2CNNB 2OD6A 4ETZA 5KG4A 3NXZA 4JI2K 3P45B 3KMSA 2FHJA 2LDIA 3UB5A 2Z2YB 3V6KA 4B3TJ 2PZSA 4ZPCA 2JLGA 2HNYB 1XR6A 4YR0A 4CI0B 2QEXS 2QV6A 5CY4A 5EHHA 3IN5A 2CJ9A 1KDNA 2O8BA 5LL6d 5J1PA 2OUGA 3DXKA 4NYZA 4WF9L 2RUGA 3D66A 5IXUA 1U2VB 3I56S 5HP1A 2Z1HA 4BR2A 4OJ3A 4Y2IA 2I38A 3H7HB 3KJFB 3I87A 3A3OB 5BPMA 2CG8A 3CCRN 2KU7A 2DR8A 2DPNA 5KPTA 5HK4A 4JK7A 3SBGA 3OYMA 2H4WB 3S1TA 4MAKA 2HS3A 1WG5A 1SIZA 4IUFA 3SUQA 1HWIA 2HNDB 2MB0B 2HFSA 1HNZF 3ZC4A 1K8KB 1WWHA 4CHOA 3C95A 1RABB 3IR7B 4AE5A 3ZZRA 1NO8A 5EWGA 3EZOA 2KKZA 1CZ9A 1KQGB 5DDOC 3V9SA 3TQ1A 1MDUB 2QG9B 1U26A 4B3SK 1J54A 4OPJA 2W2MP 4Q43A 3ZZ0A 3CM5A 1HBMB 1NAQA 3CJ1A 3R5DA 4WK3A 1P9YA 4ZIVA 3AD9C 4CO5A 1UVMA 3DLKB 3HHEA 3RW6A 2NXCA 4K4YA 3A8JA 2IVFB 1XN9A 1VQ6S 3CMES 2BJ3A 4LR8A 4WU2A 1RTDA 4HDHA 3BF1A 4KB1A 1VQSA 4DLEA 4UOCA 1FRHA 3AQOA 3WQUA 4QWAA 1XC9A 4GKJF 1DBDA 1RT6A 2NUBA 1H72C 2XSJB 5KFKA 2ZITA 3HRGA 2FVSA 1KRPA 4F4YA 1I39A 4PKHA 1ZBIA 3PHTA 3LQVA 4YNQA 5B0DA 5FPEA 1EO1A 3CF5Q 4PKGA 1T05A 4DHYA 2KKHA 1GQEA 2W41A 1A5WA 2F4VK 1RT3B 3CMQA 2X1GA 4URGA 3KG0A 1RT7B 3GL1A 2L9WA 1HD1A 3C3LA 3M9OB 4UF4A 2D3ZA 2HRYA 2HBYB 1ZETA 4H5NA 2B3TB 2IDEA 1U2RA 3L2RA 3PRBA 3CJ0A 2GCFA 3A1YG 5EVZA 5IT0A 1NH7A 5KQ8A 5ETTA 2FY1A 4DL3A 1ZBUA 2HQIA 3RBXA 2A41A 3UCUP 1X4EA 3CCSS 3ONQA 4F9OA 2QWLA 4X4RA 4L6V3 1R43A 1B99A 4RWTA 1Y97A 5GMEA 4LSNA 1H73A 3BGRB 3K8VA 4IFYB 1F21A 2IIRA 5ETMA 3CJAA 1RKIA 5BRFA 2PMWA 3BGLA 4YDDB 4F3MA 1OH8A 1OYEA 3MUMP 3MEGB 2JDJA 1EXQA 4U8VA 1EWQA 2WSEC 4Y28C 2FZCB 3TUJC 3NH2A 3CPWM 3KJNB 4A5BA 3CCQN 5F0WA 4CNZA 3GFXA 4E7HA 3ULEB 4DV0K 2EXUA 1UJ4A 3N79A 2MZ1A 5IQ6A 1SB6A 2R7WA 4C0BA 1TVRA 2D74B 2F8HA 1RILA 1NCLA 5AXLA 2FDNA 2UUCJ 1LWEA 1N36F 3V6DB 4CZFA 4ICLA 1QE1A 2Q0UA 3SMSA 1RA6A 3IAS9 4WIIA 4CJWA 5U47A 4CLSA 4JV5J 3VGMA 1RHQB 1Q82O 2PY5A 4BC7A 3LP1A 3ZETB 4FPBA 3TVZA 1C1AA 4LFCJ 3O08A 1JQGA 3R5CA 3R7BB 3UFCX 3BH7B 3UDVA 1J2VA 4J90A 1WF1A 2YQ0A 3KLIA 2FUG9 1SC4B 4FK4A 4P2FA 4DV6F 3C46A 1RAHB 5A2QU 1HX1A 4MDBA 3RB4A 4FWMA 3VA3A 2K06A 4W5NA 4ED8A 3O9RA 3CJSA 2CIMA 2LP4A 3U3YA 2Q0RA 2MDAA 2JVRA 4I64A 3TYTA 1J5OA 3OTDA 3N6MA 2E5HA 2P9KA 2RQ4A 3PNIA 3SUNA 2F40A 1X4BA 4BGBA 4X62K 2ZJRL 1Q53A 1BC6A 5LSOA 2E5GA 1URNA 2QL5B 4WP8A 3IMXA 1S48A 2HS4A 2R8IA 1YRTA 4CJTA 4DUYK 1HLWA 1CLFA 3PX6A 3E9PA 1SI9A 1WUAA 4LF8F 5C5JA 3VQ8A 4G6VB 2EG1A 4MH8A 3ZT0A 4IJAA 4H0TB 3RAXA 2UUTA 4ZKAA 3WHIA 2MQNA 4DUTA 1JKHA 5IWAK 3NNHA 1CC8A 3E8OA 1E6YA 5D78A 3VENA 3KDNA 4ANCA 5CZ2A 4O5FA 4AL7A 1URRA 2B6AB 2IM1A 2I7PA 2DGOA 1NK8A 2MQOA 3CTRA 1V4SA 3MCSA 2LEAA 4N8OA 4DPXA 3Q8UA 1V3RA 2LQ8A 1J5EJ 3PIPQ 1NDKA 4AH9A 4EUVA 4MO5A 2RQKA 5F8HA 3CCMS 1JLEA 2IIHA 3GLJA 1NGEA 5A6WA 3O4QA 1RBTA 1VSDA 4NYOA 1LFPA 3NH0A 4WK1A 1S6QB 3H98A 2AYEA 1NJIO 2Y1IA 1IKYA 6AT1B 2QSWA 3OHAA 3O3GA 2BM1A 3TTCA 4L73A 4DUZJ 2HRUA 4FXDA 2CGLA 4V1Ak 1WC6A 2VFTA 3NF6A 3GE1A 2YTCA 3SPYA 4PR6A 3ZSXA 1I6JA 3MWPA 3AVBA 4MK8A 2M88A 4NXMJ 3THPA 2EWSA 1RDCA 2ZZMA 5E41A 2LEPA 3OYAA 3SQ2A 4GO5X 3GV7B 4FCYA 2PO4A 2C28A 4B1VA 2G2OA 3DMJB 4B9QA 1U2VA 3ZSQA 2WONA 3DXBA 4CK3A 2UUAJ 4OYPA 2R9LA 4JI3K 4N47A 1W9HA 4NEYA 2DH7A 3P3DA 1OQ6A 2GMJA 3OTEA 2E7XA 2MTLA 4ID8A 2QKKA 3AJDA 1RBSA 2JSXA 1FRKA 4QYZK 4I2QA 3DNCA 1QZ6A 5KG0A 4J9SA 3DI6A 3AA4A 1SV5B 3GOIA 4TU9A 1C1CB 3CJ8A 5K8PA 1UA1A 4LF9J 3CCVS 3MURP 3ELHA 4CJEA 2DR7A 3GYNA 3NG8A 5AXMA 2DTJA 5LJVA 4YY3J 2Z0GA 2GZOA 1Y5NB 4FYDA 3QRQA 5CD4A 3SJHA 3VAIA 3PR4A 3LP3A 2XRIA 3UVJB 2ZEJA 1SJ4P 4B3SJ 3CXCR 1N52B 3PJWA 1APSA 4YDUA 4ED6A 3B6BA 2RH3A 3NVKA 4ZN3A 2O8DB 3TOQA 4LJMA 4ECVA 2P9NB 5MLCV 3CD5A 4H0XB 5KFFA 2NNWA 1KP6A 2BVZA 3G25A 4F3OA 2N4DA 1IKYB 4C3MA 3TU5A 2VHGA 3T5LA 1GEHA 4PXBA 2GAHC 1FRJA 1FVQA 5AFUH 4CJPA 3CMAN 2YWHA 4F0KA 1OIAA 4L75A 2H5IB 4DDFA 3SQGB 3WC0A 1VQPN 1IKXA 4KHPK 3G82A 4BROA 2DGTA 3FMWA 4WJBA 3AJ1A 2GJFA 1TMJA 3O3HA 2AJ1A 2V2VA 3AFGA 1TK0A 2ZDOA 2KH9A 3WC2A 3OT9A 1BDGA 1AYEA 3TA2A 4NZ7A 4UY8T 3THWA 5BRHA 1NGJA 3HI9A 4K41A 3SAHA 4J9OA 4AILC 5KFVA 1YGYA 3PYFA 2DR9A 4BG8A 1ESVA 1BLUA 2QT7A 3BQ1A 1NGGA 2V8VA 1X0FA 2YH1A 4IG3A 1FT8A 5D0EA 2QGFB 3ETMA 2P1JA 1IBMJ 4OZ1A 2W2PP 3OW2R 4G1PA 1M5VC 2O8CA 1HYZA 2ZE2B 2BJ9A 5GADI 1KEKA 3QJJA 4B02A 4A8OA 3I55N 3TVYA 1T3NA 3ZXWA 5RUBA 5CCMA 3PO4A 1GLFO 4DV1J 1VQ5N 4KHPF 3WEEB 4F02A 4L3NA 4IEIA 1Z05A 5F8JA 4JD2A 5KFJA 2RHSB 1HHQA 1H2TZ 2M0GB 3QZ7A 2XHBA 1NB2A 5B0EA 1ZA2B 2VGMA 3M6GA 4JBCA 5H9FK 3HZEA 3FKBA 3PG9A 2IC3A 2IDOA 1N88A 4DFMA 3S9HA 2ASDA 5B0BA 3AGRA 4FJJA 3ZEUA 4DR4K 5LOQA 4W92B 4BREA 4YOVA 3THYB 1NPPA 1RDUA 1T02A 3QESA 3I0RB 5D77A 4JKAA 4Y3CA 3RBDA 3BEXA 4M3XA 2OPQA 4JV1A 2BMBA 2Y3YA 4DB3A 1M1KT 1FESA 2NYIA 1YJNN 1VYAA 1IR2A 4C3LA 1K73O 5L1JA 3KJVA 4LR9A 3NY0A 3VQPA 1FE0A 5AZJA 3LGHA 4EFAC 3KHLA 2EFPA 4NO7A 4CYUA 2KT5A 1HA1A 2GVZA 1BWEA 2M4MA 2DNZA 4FWRA 4ETXA 3C6TB 2MXYA 1K9MT 1KVKA 2R7VA 5DQGA 2OAUA 2VBWA 1XI1A 3CPEA 3SQ0A 3VF6A 1KVAA 5A2QY 3ULEA 3W0LA 2KHCA 2EFNA 1Q7YO 1O13A 1WF2A 3EY1A 3KLGB 3D7SB 3DKDA 1YI2S 5D4LA 1FXLA 4OKKA 4ZVRB 1P90A 1I3OB 1PBUA 3EXCX 3A13A 3RRGA 2G9OA 2VQEF 5FIIA 2VA2A 2VWKA 3NBPA 2BE2B 8AT1B 1F3VA 3GJRB 2YNGA 1RHMB 3OR1B 4DPYA 1KFSA 2DHXA 1RAIB 2W7AA 3C66A 4C98A 4DZDA 2E44A 3NGSA 2OTLN 4ZVHA 5HATA 3FZMA 4BRCA 3HF5A 2C3OA 1C6VA 1G7CB 3J7AN 2QRRA 2J9EA 3V9XA 3OV7A 1TQLA 3QGGA 2XS2A 3RMCA 2EWHA 2EVZA 4GMKA 3BO3A 1V3ZA 2UVRA 3LP1B 2O8FA 3KIOA 2RF2B 4KH5A 1FKOA 4NLPA 4LF6K 2WB1D 4IOCL 3DLKA 3W64A 4WYLA 2XSJA 2IY5B 2UUWA 3CB4A 1TKDA 2HIQA 5JXSA 1IG9A 1M0SA 4OLBA 1YTUA 2JRSA 4KHPJ 5KFUA 3RAQA 3DLEA 3HHLC 2OTJS 1HPZB 1EX4A 4ZVEA 3VEVA 2BABA 1KLNA 1R8PA 4F26A 2G2ZA 1V5IB 4LFCK 3IM9A 1F6TA 1EB0A 1S59A 1ZM2A 3SIPB 1MWYA 3NF9A 4JS4A 2OGUA 3BF3A 3PCOB 1B0VA 3DXMA 1V3SA 3QPIA 3HFZB 3CERA 4KI6A 3SI6A 3UKRA 4EAHD 1N6QB 1YZ6A 2P2CB 5F8NA 3CMAS 1RT7A 3I9V9 3F9MA 3VERA 2P9CA 2L41A 3I33A 1UJ5A 3FE1A 4YOYA 3I5CA 2ZE2A 1NK7A 1WC0A 4X65J 3UIQA 1QSYA 1HI1A 5L1LA 4JKCA 1Q78A 1FHTA 3F0NA 1GH8A 4USMA 2HAIA 4CFCA 4O3PA 3MXIA 4X4VA 3IRXA 4CF8A 3QAEA 1ICEB 1VQ8N 2IRXA 2MKSA 1CZBA 4UTGA 2AQ4A 1HKAA 2DO0A 4E7JA 3TA1A 4CTAB 3EVOA 4RL1A 3QNOA 2NRVA 5AE2A 3P96A 4CM0A 5A8KA 4CRJA 3VAMA 2ZH5A 1NHUA 1XNRK 4LVNP 4YR3A 2CJAA 4QWCA 5J2QA 5LJWA 5LXRA 1PAEX 4CZCA 4LF5F 3PUFA 2GJ2A 4L3QA 2WAQD 5HSPA 4C11B 4Y2KA 1NHKL 2HG4A 2WBNA 2RB7A 2JWLA 3SK3A 1HNWJ 2U2FA 2J6TA 3SSSA 2D1KA 1WC5A 1NJZA 4RU9A 1R8AA 4TU7A 4LF7K 4CF9A 2N4CA 2ZVIA 3BM7A 3MMAA 4HKQA 3D0IE 4TLRA 3KG1A 3VETA 2HNDA 2LDYA 1CZAN 3SFUA 2ZWPA 3L8BA 5IQQA 2L9NA 2ZKTA 2IAJB 4OX8A 4EIAA 1SJ3P 1C1CA 2JWKA 2RU9A 1T9XA 2HGLA 4C11A 2GQCA 4BCAA 4NMLA 2E1CA 2Z1IA 2OYQA 2J5AA 4EYIB 1IUJA 2V34A 5DG9A 1OSCA 3TR8A 2LXUA 1RWVB 1YDLA 1SQKA 3S01A 3ZT3A 4CE9A 4NYFA 3B4DA 4BR0A 4CHYA 4DV6K 1BUPA 5AFUA 1ZTTA 2ATLA 3T41A 1Q86O 1TP7A 4DS5A 4DPWA 1VS3A 5M2PA 2BH1A 5B0GA 1FKPA 2ACYA 1MMNA 3CCSN 2FVQA 3O44A 2H5EA 3G8QA 1RBVA 2ZOMA 2DNYA 2KT2A 4ZK7M 4NXMF 4ZPTR 4C8KA 4BACA 3I6PA 3TZXA 2M9KA 3WT0A 3SCXA 5FRNA 5EX0A 4DL0C 2I9SA 3EKUA 2I2YA 3QBWA 3KK7A 3P31A 1JLGB 3MECB 2MLYA 2XULA 3VAJA 3HMJG 3P5BP 4F67A 3NGUA 4N5SA 2QL9B 1WOSA 3DLGB 4JV2A 4WE1A 3H4DA 2F9JA 4HDGA 3J7ZT 4YUDA 2P9EA 1RWXB 3DRSB 3FZKA 1NGDA 1PG5B 2DHAA 4LF7F 4KGMA 5F1XA 1S4FA 1VRUB 4CJ4A 1N33K 4CFDA 1UTAA 3LM9A 2MSTA 3MEDB 3BBFA 4Z2XA 1F1BB 1SQEA 3H4BA 1EX8A 1HPZA 3Q8PB 1VR6A 1TYQB 1TELA 2HNZB 4NL5A 3A0IX 4IG0A 4ZJLA 5KOXA 2MKHA 1MROA 4JK9A 4FF3A 4DV2K 3H5XA 1DAXA 3AD8C 3JSYA 4P2XA 4TN2A 3F9KA 3H3NO 3LUYA 4C8YA 2JFDA 1OH6A 1J5EF 2F4FA 2HS0A 4RUBA 2WSCC 2BXJA 4E98A 1IG8A 3O6WA 3OUYB 4JV5K 4HL9A 2YQ1A 1GMWA 4JI8K 4DR4J 2MHNA 1T95A 1UFLA 4CFBA 1LOTB 3RMDA 1EETB 3Q8RB 2EBGA 1BG3A 2OO4A 3HP6A 2OP5A 1HHTP 3NCRA 5E5NA 3JSMA 2HMIA 2BE7D 3OLAA 1YJ7A 3JXOA 4ZPDA 2D0BA 1KS2A 1B92A 4I0WA 4CJKA 2AD9A 2QA4G 3NE6A 5LM7E 3TX8A 4DV4F 2HRTA 2HVEA 4UOFA 2O1PA 4RW6A 5F3TA 3OR1A 3PV8A 2M8HA 1TUUA 1FO1A 4KKOA 1WBDA 2DB1A 1CS4A 2LECA 2DRDA 2KHDA 1VBZA 4URSA 1YXQA 1VC0A 4PHTX 2CH5A 4JKFA 5AQHA 4JRPA 3BO4A 4R25A 1HUXA 1N36K 3VEOA 4NI2B 1CSJA 2A18A 3MM5A 5C2DA 2HHVA 3DDKA 2NRTA 2W9BA 2B7BB 5BRDA 3IA0A 1HD0A 4IDKB 4UW2A 4M45A 1FK9B 4FLTA 1Q86T 4O0JA 1O51A 1PAUB 5J2PA 4QU6A 2RE1A 5KI6A 5I9EB 3P39A 2LLZA 1GXLA 2XMJA 3MPVA 2PGCA 2F8TA 1XNRJ 4ZCLA 2YKNB 2XMUA 2IVMA 3KLIB 3VGLA 4Q8FA 4V19S 1KHWA 5CAAA 5CD4H 3A12A 2QFIA 1RTJB 4RBVA 4HYKA 3Q7CA 4OYZA 3MGJA 4TU8A 1UFWA 2P9IA 1OH5A 1GOAA 3FEXB 2C1EB 2OMOA 3KNGA 4Q2LA 4KFBB 1SQGA 3WX8A 2MPUA 3R8EA 2QA4S 3KD5E 3T7ZA 3L3UA 4MKAA 2XZTB 5M1FA 2R7TA 1OQ3A 1FXXA 3MAAA 3RYLA 1T44A 1RTIA 4NRUA 1YJWS 2XTJP 2QW9A 4F2RA 4CZEA 2CFXA 2KI2A 4RU2A 2NYHA 1Y0HA 3MZIA 4RBTA 4WU3A 2DNLA 5KFAA 1WF0A 3RSEB 3HD1A 3QJPA 1C0FA 3L7OA 3CUNA 1WTFA 1QHAA 3C14A 1JLQB 3IFEA 3NL0A 4FWOA 2HFVA 1GTHA 2FLOA 1S0VA 2F8EX 3MEGA 4F0HA 1FRMA 4C8ZA 2OPSA 1M5OC 3DLGA 2KDOA 3B8AX 3QWPA 5DDRC 5ADZA 2ZJPQ 2MQQA 1ZM3A 1CS4B 4PQUB 4FJGA 3FC9A 1HYVA 4GV3A 3TEGA 4LD0A 5EGYA 2O8CB 5JVHQ 2HHWA 2CQHA 3GR0A 4OHYA 4HLBA 4QIGA 1GNKA 1MMDA 1JL2A 4CZLA 4DFKA 4FS1A 3VESA 1PC4A 5A6PA 5THWA 4BRIA 4ZLJA 1FJGF 5IC6B 2LEBA 2R8KA 4XDDA 2VOOA 2XY5A 4CF0A 2Z30B 2J8SA 3T1HJ 4QS7A 4NLDA 3EVWA 2KQ2A 3TUZC 1HWLA 5IT9U 4YFUA 3BF4A 1XUPO 4LF8K 4P7TA 1T05B 3S3NA 2CZVC 2N3LA 1C4AA 3CCMN 3NVMA 1WKJA 3OL8A 1HNWK 4DQPA 1X1PA 3WXKA 4PXCA 4FKYA 4JI6J 3KVGA 1HBMA 1BCMA 4GKJJ 1PIEA 1RT6B 2G2YA 2IJFA 4PCQA 4GKKJ 2FC9A 3HP9A 4BG9A 5HVFA 1N8RO 3VEWA 4RTFD 3LDPA 2DGXA 2QLWA 4AYBD 5TKWA 5I3PA 5KG2A 4NYPA 1BA1A 2P9LB 4RNOA 1PYTA 3KK3A 1GK8A 1KKHA 1NGHA 1S1UB 4P7VA 4CEOA 1Q0NA 4FWNA 3CJ3A 5T14A 2DNNA 4AXJA 2F9WA 4P73A 1WSIA 3SV4A 3H90A 2YNHB 4NPOA 4DF8A 2UVWA 3KUGA 2Z58B 1T94A 2BANA 1SAZA 2WVDA 4RLEA 4IR1A 3VQTA 2QIFA 4KB7A 2UUBF 3AAQA 2VPWB 2RRBA 3GYGA 3CE8A 4B3SF 5CZ1A 2UXCJ 2R7UA 2XZDB 2CJKA 1L3VA 1GOCA 1Q16B 5BR9A 2P9GA 3NKYA 3L4IA 3ZLJA 4OVLA 1REVB 3IRXB 3O4WA 5SZTA 4ED3A 4AM6A 3NGIA 1T03A 3K5LA 3VGUA 1IBKF 3CC4S 3F2KA 1NDPA 1YJ9S 4MIAA 3HVRA 4NLSA 5HRPA 4KHNA 5HLFA 5CQGA 4JS5A 4X62J 2N7CA 3OVBA 4WFXA 2DNRA 4MFBB 1BL3A 3HSTB 5F3ZA 1S1TB 1FEEA 2K2PA 2H48B 3MEKA 2EG2A 2BW7A 4AM7A 2A40A 3UR3C 1RCOB 1S9GA 3TZYA 1S9FA 4ED7A 2P6TA 1W2BM 2BRLA 4ALZA 3EPGA 1VSEA 5I3UB 3PKYA 3OSPA 1VQ7S 3P5TL 3F41A 1Q7LB 3ZSWA 1RWMB 3H45C 1FRLA 1LWFA 4H4KC 3DRPB 4HVZA 3W5ZA 4K4XA 1VQOS 1SL0A 4AQYK 2P5VA 4H4OA 4FF1A 4TKTA 1KQFB 2GNKA 3KYLA 2K3KA 3ZSRA 1VOMA 1NJYA 3VAKA 1NKEA 2DIVA 1VC6A 3MM7A 4AT1B 2Q79A 4H4KA 1JLEB 4LSLA 3Q0AA 3CJBA 1O8BA 4NLWA 2WB4A 3CJQA 3HHKA 1HNXK 2ZH4A 3K5NA 2E6MA 4URQU 1HR0F 4A62A 3FFKB 3PACA 2YI1A 2ZJQL 4BDZA 1X60A 4I4BA 5AQUA 5C12A 5T7LA 1UEKA 3FZBA 4EI2A 2K7JA 1FXDA 1VSHA 3V4MA 2R8JA 3OHRA 5GAHI 4NA1A 4H5RA 3B6OA 1H2UX 5DLGA 5CXTA 3GG0A 1S9GB 1VI7A 4IH6A 1OSDA 4OZ5A 5KGXA 1JKHB 3ZTSA 4FNIA 2Y0BB 2Q43A 3HFVA 1Q18A 2PBDA 4CJ7A 5H9EJ 3MFHA 2PI4A 5I4MA 4A2AA 4I69A 3GBTA 2RVJA 2X3GA 4M3WA 3J80Y 3M1VB 2PSZA 3HVWA 1VQ6N 1F60B 3ULHA 4CO1A 4IKFA 2B8QA 4IFEA 4EBEA 1K47A 2O66A 3PO5A 1W25A 4XK8C 5M2UA 5GVQA 4KHUA 2UU9J 5F2RA 4A8MP 3HO1A 3WQTA 3PRVA 4NWBA 3U3GA 3GCWP 2ITMA 2R8HA 3T6JA 4KE5A 3MPYA 3JAMY 3AOCA 4FPRA 4EHTA 3SDEB 1M5KC 2CZ4A 2DFHA 3HI0A 5CYMB 2OH2A 3GIMA 5B08A 2LQJA 4OLOA 1RAFB 3CFPA 2MJUA 4GNIA 2HF3A 3THXA 1OVYA 4USUA 4IH7A 5BN9A 4BGAA 2K3IA 4S0MA 3RMAA 2AJ4A 3ISNC 2DGQA 1SC3B 3OJSA 5CR4A 4KPCA 2GW8A 2KXHA 4J91A 2BJ7A 2DCUB 3BPDA 3M8SA 4K4UA 2VF3A 5H9FJ 4AHSA 1E6YB 1ZC6A 4J8FA 4YOEA 3NAEA 1XC3A 2AYMA 2DNOA 4M95A 1FCAA 3D5MA 3H42A 4MK9A 3LPUA 2WK4A 1ATRA 4M94A 4DTPA 2VKZG 4ECTA 4ITSA 4PXEA 4OX6A 1D09B 4CLWA 4NCGA 1REGX 4F8RA 1TL1A 4X66J 1NGAA 1B0PA 1TL4A 3HT3A 4LFCF 4YN3B 4DX6A 5C2CA 5AQTA 4Z4FA 5AQNA 1H7XA 4NXNJ 2QZ8A 2EFOA 2HZVA 3ADAC 5KFPA 2FLPA 3CCQS 4RW6B 4DV5J 1U1QA 1JX4A 4MLEA 4R8UA 5E3CA 1RDWX 3TUIC 3NF8A 5IT4A 4AD6A 2VGNA 2GELA 2HHHJ 3FLCO 3E3XA 3J7ZO 2QXLA 3KLFB 2B9YA 4M3ZA 1KONA 1Z2LA 1WC4A 4DUZK 1D0EA 2J9CA 2NRWA 2IPOB 1VQ7N 4QWDA 5EY4A 2BJDA 3P1GA 1RSCA 4ZIWA 2FBVA 4DMNA 1ZH5A 2CJQA 3OUYA 3KK1B 2E8AA 2I0XA 1LXNA 1VDHA 2B9XA 3QJLA 2NXUA 4BR5A 2C42A 3CC2N 1DGKN 2DY4A 5H9EK 3S3MA 3W66A 5F8IA 2F1FA 4PQUA 4EO6A 1S77D 4JOUA 4O3RA 3E01B 5FDLA 4OHVA 3N5BA 3ENOA 1RK8A 1D1UA 3BUZB 3VOVA 4CJ3A 4B9NA 5HRNA 4DR7J 1KC8T 3OLBA 2FB0A 3J81O 2W8LA 2M3DA 3BBCA 4C48A 5GIPA 3U9ZA 2YJFA 3IKMA 3G86A 3I0SA 4FWLA 2RNEA 4JI7J 2CVEA 2E1PA 1KOOA 5ETNA 4QWBA 2R7RA 5ADXA 5CE3A 5LSLA 1X4AA 1RKJA 1RBOB 2E5LK 1HNXJ 4WE1B 3AO2A 1RCXB 2CQBA 4FF2A 2Q31A 1TL3B 4I6MA 3GFYA 4UY8O 2FJWA 4LRFA 4YY3K 5JICA 2X1AA 3CHWA 4YB6A 1RU1A 3NS6A 5AQLA 4ENOA 1S7HA 4KTZA 2I8EA 4K5SA 4LF9K 3V2UC 4DFJA 3MEEB 3MDQA 4JKDA 1LWCA 1WB9A 3G71S 1TFYA 3DDIA 4E19A 4Q8EA 4EBCA 2WTUA 4DCOB 2YKNA 2NXJA 3GPAA 2XNRA 3OVNA 4DR3K 5CYQB 1UKUA 3AXMA 4HT5A 1E3MA 4LRDA 1MMLA 3O9SA 2ASOA 2WBMA 3CJKA 3A8EA 1Y5IB 4H0OA 3I8DA 2JLFA 5GMDA 1BXNA 3D0GE 3EL2A 3V5RA 2RHKA 3DYAB 1RDAA 1LQ9A 2HNYA 1XQIA 3ZSVA 1LXJA 4AQYF 4USTA 1HBNA 4UOGA 1KC8O 2J8AA 1C1BA 4OLAA 2D1CA 3K9KA 4KO0B 1XWLA 1HLUA 4K5RA 3O9TA 4E1NA 3W8GA 4DSEA 4AXIA 4LY7A 2OEJA 2HB5A 3LF0A 4DL6A 3R2CJ 1GX5A 2B4JA 5FPNA 3G8TA 4OYOA 3DCAA 1L3UA 4DLGA 3U9DA 3B8HA 4OFZA 2WRMA 3CJTA 2OLWA 1TAUA 1YTAA 4USVA 4F04B 1NPKA 1MG7A 3U4LA 1J5EK 3G10A 1ITGA 1J6ZA 4MIBA 1SXLA 3BKTA 4ES3A 1DTQB 4M41A 1IO2A 2RILA 3DRYA 5C24A 5DO2A 1TU0B 3H2UB 1TV6A 1XMOK 4R5PA 1EAYC 4IR9A 1D5AA 4ILMA 3OYLA 2CXEA 4PPZA 3AY9A 1RAGB 4FZYA 2R3VA 4WFNQ 3J81U 2ZGZA 1LFWA 3FQLA 2HLTA 3CJ4A 5GINA 1PSDA 2QK9A 5AJ3K 4FZXC 1ZPWX 4O8KA 2D7SA 3OS2A 5CYJA 2YX7A 4GKKK 4KRFA 1NB7A 4K43A 2ROEA 4IJNA 4FLWA 3OYNA 2HWHA 3PEHA 4YHHJ 4FPIA 2BR0A 2N7YA 3SQ4A 3CNQP 4GVBB 2F4VJ 1OVQA 2QYCA 1F9HA 2DNPA 4O3NA 4B9MA 1IKVB 1JNRB 3NRBA 2XYHB 2E1MC 1JLCB 1NK5A 4NE9C 1FWLA 4U67L 3LM2A 3SQOP 4GKKF 3RJMB 3KZBA 4QS9A 3NDKA 1CJTB 3HPGA 4FM1A 3C8YA 2WW8A 2P9PA 3QIDA 1MLAA 2LU1A 1RBAA 5HROB 2QL7B 4DR5J 1G99A 3M6UA 5KG3A 4OPHA 4H4MB 2CQ3A 1VSKA 4QAGA 3ZO7A 2XY8A 3K5OA 4IO9L 5B0FA 2GMHA 3MMVA 3BY5A 2OSQA 4C3KA 1QVFM 2ASJA 2J0WA 1UWAA 5DM6L 4X4TA 3HTVA 3PM9A 5K9FA 3MMCB 4QOTA 1ZAVA 3ZT1A 4YOUA 4JHDA 4B17A 3CF5L 2R4FA 2IM0A 3TSUA 3QT6A 1TK5A 1DHMA 1OKJA 3CC7S 1AROP 1Q1KA 2ZWOA 4KT0C 3HULA 2PI5A 1TUVA 2MZSA 1NDCA 1RTIB 4IOAL 3ZTQA 4EMDA 1K9MO 1QVGM 5IZHA 1YIJS 3M1FA 3PJXA 4USJC 4ECQA 1UCNA 1IM4A 1YHQN 3M2RA 4X4QA 1QSSA 3O8MA 2HFOA 4CESA 4OI4A 4KFBA 3D45A 1F2HA 2CGKA 5C24B 2MQMA 1S1VB 4NYNA 1T8EA 6FD1A 4CZHA 2IJNA 1D9FA 1QE1B 2DISA 1NU0A 1LWEB 5HQ8A 1S6PA 3AO3A 2BQ3A 4RPFA 4DPOA 3QFHA 3OYFA 2MY7A 2VONA 1R8CA 2EFVA 3N4QA 1UPPA 4ZVTB 1J27A 4IO8A 1RWOB 2OD4A 1X7VA 4DR2F 1ILYA 2GIFA 1D4XA 4DR1F 1ZBSA 3MD1A 3WIVA 4NI2A 3WDOA 4JKGA 4ISFA 1P9QC 2UVUA 3OBYA 2WHOA 2VD3A 3A3PB 4O23A 3HJVA 4W5RA 2Y8YA 3KHRA 4BLGA 1HI8A 2CNKB 3C6TA 2P9SA 4PG4A 3BS9A 2LVWA 4FXWA 2CNLB 1EKSA 2VQEJ 3VQCA 2QLXA 5D6GA 1C0MA 4BRHA 2C2MB 3R97A 5J2MA 3KTQA 3FZHA 3ZZPA 3CJKB 1T11A 1CXQA 3OTCA 4TXSA 3QBXA 1XTZA 1DLOA 3VV2B 1JNZB 2HAFA 4ECRA 4KHWA 3QRRA 5B0AA 3JS6A 2YQ3A 5IS2A 3LDQA 1YX2A 3TAMA 4QJVA 1U04A 4B3MJ 2VWJA 4JI8J 2XCPA 3CCJN 3O1BA 5AQRA 3C7NB 3HPHA 2KM8B 4JI7F 5DG7A 3DAWA 1SUQB 3SI8A 3LO3A 1QAJA 2DGSA 3QIPA 2MQPA 2C2RA 5BR8F 1WSFA 3CCUN 1U0SA 5CZVA 1XQSC 4DR5K 2RDIA 3ZFVA 5BR8J 2QKBA 3L7UA 4PG6A 5HQLA 1VK0A 1NKBA 2MHEA 4OI2A 1X8DA 2IC3B 4RNHA 1N33J 2V7ZA 1EIYB 2C3PA 2VIHA 3OR2A 4PXDA 4JI8F 4LF4J 1A9NB 2O8FB 2X7IA 4JD2B 2O4IA 1RU2A 1WDDA 3TAEA 2MJNA 1EQYA 4WFYA 3L9ZA 2Z8QA 3TABA 2C2DA 1S57A 3E01A 3OPKA 2CUYA 2I5JB 3M3ZA 5JVGL 1X4CA 3BSNA 4A8QA 2K1RB 4X4OA 3PYGA 1RA7A 7FD1A 3PKMA 4ANDA 2VV5A 2M52A 4ISEA 1JWWA 5CZXA 4LSZB 3ZTRA 3L4QA 3TO8A 4K42A 3D54A 3PZPA 1DTTA 2BRKA 3NBPB 1GMUA 1K1SA 3ZSZA 2APOA 4J9NA 1S0OA 3THWB 1BISA 4YOTA 2MQLA 2R2UA 1FWPA 3BH6B 1RLCL 2ZD1B 3WQPA 4DG1A 1RTHB 2X6SA 2E1RA 1T9VA 3I5AA 4QIWD 3PLAA 1YHQS 3M32B 4B1ZA 1X9SA 3SNNA 1HR0K 2W8KA 1JCEA 4KREA 1OPIA 4F3TA 2G8UA 3MM6B 1RJJA 2L08A 1FD8A 1IKXB 1Y5LB 2J4RA 2VPYB 2ERRA 5HAOA 1UAXA 1YZ7A 3LANA 1R31A 3DJCA 3QAUA 2W9AA 4E1JA 4RW7B 3D2EB 5LJ3Y 4LIWA 3C6UB 5IT9O 2KXNB 3MEDA 4FJ8A 1GXTA 4O5BA 4RW9A 3M8PB 5K5MA 5T7BA 1YVNA 2AP1A 4IZ9A 5A0YB 3Q22A 5GAGP 1UETA 3L3VA 4ES1A 4F3QA 1G1XA 2GBZA 4DN9A 2AP6A 1RQ0A 2XLJA 3EM1A 1U24A 1LW0A 4OZ0A 3EE9A 2ZOGA 4XH1A 3AO5A 4ED2A 3MM8B 1NJIT 5KT2A 3I0RA 4DV5K 2VFUA 1N48A 2UU9F 1LAWA 3CWJA 3LPEA 2IHR1 2YKAA 3MECA 4ECXA 2LCWA 5DM7Q 2BDPA 4I2QB 4WYBA 1XMBA 5J2QB 2MKYA 3AA9A 1RP5A 2H5JB 4KH1B 4MKBA 4DV7K 3NS7B 4RCHA 4CGIA 4NLRA 2F63A 2FF6A 1HBNB 4JYAJ 3C16B 4CD1A 3KK2B 4BC3A 3MAHA 4FWQA 1IWAA 2YNIB 3LALA 1M90O 2VZ9A 1RAOA 3CC2S 4Y2AA 4ZHRA 1X3MA 1NWKA 4ED4A 4DFPA 2IBKA 4GC6A 3K57A 2V9KA 4J9VA 4ILHA 2PYJA 3KK3B 2BKNA 1Y9OA 3IBFB 1ZYQA 3D4JA 1RHRB 2GQ2A 2UUAF 2RUSA 5AQSA 3O8WA 2ZM6F 1HWKA 3VAGA 2DNGA 1TUGB 5F0UA 2HPUA 3A8IA 4CEZA 3QNNA 2F4VF 5LMUJ 2KW4A 4WFBQ 4FYYB 1GFWB 2FC0A 4KGKA 1AXQA 4UQGA 3TWHA 2JEJA 1U0HA 3OTBA 3IWLA 4ZVGA 2P9PB 3D6RA 1ZZFA 1MWZA 3O5TB 1HQEB 4IYQA 2B6AA 2JHEA 4DUZF 5LMUF 2V2ZA 3M30B 3QT8A 5DM6Q 2F7VA 4PWDB 4FVCA 1VBYA 1CVJA 2DNQA 1FNXH 5M1PA 1EHWA 4CH0S 5KT6A 1WLJA 2E1ZA 2IMWP 2FD2A 1IKWB 2KYXA 2W24A 1QVGR 2CQPA 1VRTB 4RKUC 3K59A 3KUEA 4ZCMA 4DCJB 2RKIA 1LK5A 3BBBA 5ETVA 1KLMA 1RI7A 4JI6F 3HSCA 3MCAB 1SS6A 3CJ5A 2W4CA 3PW7A 2JZ5A 1N32J 2IS3A 1LWFB 4J37A 5B8HA 2O8DA 2QM1A 4Y6IA 5FPMA 2VBXA 2KHOA 1GLBG 5M1OA 3CD7A 2HGMA 3JSRA 4CTAA 3J7AP 3HXMA 2BKPA 3MWTA 3JYTB 3K58A 4RW4B 2CZ9A 2AHOB 1YUWA 3GILA 1FJGJ 1R0AB 3PFEA 4ANEA 2Q36A 4O4GA 4KPYA 3EDRB 4J9RA 3HOSA 2BQUA 5L9NA 2EC2A 1DFDA 4CZMA 2F3JA 1RYSA 1OYDA 3QFWA 4KYZA 3L95X 7FDRA 1E6VB 4CLLA 4B9LA 4AQYJ 4ECUA 3ID8A 4DV7J 2VYPA 3QEWA 5GMKa 1OS5A 4JKBA 3AARA 2GS8A 4DU7A 3MTJA 4NLUA 2G1HA 2V52B 1NKCA 4IH5A 1RT5A 1LWXA 3ET6A 5KFQA 1WJ9A 4ILGB 2UP1A 5KFCA 1X9WA 1NGFA 1WSRA 3VGVA 4PG8A 1KTVA 2GHWA 2BJ8A 1CJKB 2GUIA 2HHHF 2XEXA 1NG9A 3AJ2A 2QMWA 2B4VA 4CGFA 1EQ0A 2DJWA 4FSVA 4B3OB 2GQQA 3O3LA 3T5HA 4EZ6A 1S1UA 5L38A 4K8ZA 2ZH6A 1SKRA 4WBFA 3BREA 3EGWB 1NM1A 3H6EA 4M5NA 4FK0A 4E89A 4Q7AA 3PW5A 1RDDA 4B8CA 1H2VZ 2J0XA 1P1TA 1Z1ZA 1RAAB 3CCTA 3LP2A 4DI6A 3K0JA 3VQDA 2H51B 1N5VA 2QWMA 4WFNL 3GWCA 3FQKA 3W2WB 1MSWD 2P9UB 3NMRA 4CEAA 3MK6A 4DU3A 2FSKA 4LFAK 1R8HA 1RWKB 4HR2A 2YWGA 2IA6A 4BC2A 2A10A 1PILA 4JI1F 3QWUA 4LFBF 5AT1B 2VG5A 1DURA 1EJ7L 1U1KA 4DG1B 2VU5A 5LMNK 4L74A 1XK8A 5C42A 1U47A 2DNMA 3HD2A 2FBXA 2KL8A 3KLHB 5B0CA 3M2VB 1DTTB 2CQ2A 1ZZNA 4K2JA 5IWAJ 4HUGA 3M6VA 3BB5A 2G8KA 2W1BA 4M1KA 2YHAA 1E4GT 1T3OA 4KAZA 1K0TA 4ZPAA 3W61A 3BV8A 2VQFF 1PO6A 2UZAA 4X2BA 3LAMA 3O2IA 2ZOFA 1HJOA 2J0QD 3D6TB 1KAXA 2DR6A 5SWMA 3H1VX 2XNQA 3R1HA 4QBUA 3UD5A 1CJVB 2HZCA 3S3OA 3AVFA 2GA7A 1N5SA 2FJEB 4FWKA 1UP1A 4BS2A 4IG0B 4WKYA 4LFBJ 4FF4A 5J1NA 2KT3A 3FFIA 4W90B 1N32K 3VQAA 3VQQA 3E66A 2EC0A 3IGNA 2BYCA 4LIRA 1ASUA 4DR6F 4OHZA 4FJIA 2NQPA 4DV2F 4Y0FA 3R1LA 3CCJS 3QRPA 1XBWA 4DU1A 4XH5A 2GIQA 4Y1DA 1N5YA 4KI4A 3W62A 3WX4A 4WQ4A 4U96A 4B3MF 1MA9B 3SYZA 4ZVSB 4FLYA 5L39A 3Q8QB 4JI3F 1VGYA 4D3GA 1V4TA 2QSFA 2QMXA 4MLHA 4CF2A 3F56A 3F5TA 4LF5K 4WZQA 2UUBK 4L3KA 2GFFA 2NXEA 4MQ3A 2W2QP 4EK2A 1WI8A 4OV1A 2YWEA 4ED0A 1VJQA 1SH2A 2BE9B 4F0MA 3POTA 1XMQJ 1IR1A 2CWXA 1R27B 1MU2A 2UUCK 4CEEA 4IQXA 1S99A 2J6UA 1MWQA 3H2LA 4BRMA 3ENVA 4B3RJ 2YX1A 5M1QA 2FXUA 3TX0A 4I6AA 2XMTA 3T3FA 2EKYA 2I7NA 4M5HA 1LNQA 3L6QA 5A8WA 1NK9A 3MX5A 4GVLA 2B51A 3ISND 4CECA 3VVTA 1I94K 4DV4J 3H1QA 5E26A 4W98A 1CQMA 4CGHA 3B82A 3K0SA 2DXFA 3J8AA 2ZH1A 3W5YA 3CJRA 4Y2MA 1T9WA 1RT2A 5J1EB 2E7VA 1Y4ZB 1EQMA 3WNFA 1BQMA 3KNAA 3V1OA 3DM2B 1YJTA 1FDNA 1FFSB 1X9JA 2V51B 3DRRB 3UCGA 1R6YA 4DCHA 1IBKJ 3LDLA 2VASA 2PT0A 3CD0A 2LFVA 1BI4A 3CD6S 2E1YA 4ZPVR 2W4PA 3HKZD 4P6QA 2RS2A 3IR6B 1SPBP 3P6YC 4K8RA 4LF9F 3JSMB 4B3TF 1G6BA 1TTHB 4FJMA 3AB2B 4YQWA 1VQNN 2GO8A 1K6YA 4B1XB 2QA1A 1XHXA 1HARA 2J76E 3IS9A 2ILZA 3M4XA 3DLRA 1B64A 1QQOA 4ZA1A 1JCGA 1LK7A 3TUPA 3D0HE 3D2WA 4RR5A 3BQ2A 2GIRA 1EP4A 4A8SA 2HBMA 1H38A 3JYTA 1BWFO 4NLYA 1R0BG 4FS2A 1VRTA 4ZTFA 4E1MA 3SXLA 2V63A 3CEDA 3HHLD 5AE1A 1U1OA 4G3IA 2Z56B 3EGVA 3U6FA 4BRKA 2BOAA 2HFZA 1UVNA 3V81B 4P74A 1R3NA 2YHBA 5D15A 4WQ4C 1X5OA 3VQBA 1U7LA 2DGVA 2HBLA 1BQNA 1DY3A 3C15A 2XG8A 3V9ZA 4DQ8A 1LKZA 3B4MA 2ZWHA 1RNHA 3SAGA 2Q66A 3O9QA 2R7QA 4CP5A 1QAYA 2XMAA 2R7XA 1JLAB 2KYZA 4A4JA 5C15A 1SJQA 4DTMA 5FRMA 1HQ2A 3G8SA 2AEMA 4TLQA 5F9NA 3DI6B 5EUHA 4DR3F 3A3NB 3CDUA 2KLAA 1O0PA 3N0VA 3UKUA 1KXPA 1BI4B 1N34J 1L3SA 4FNHA 3UD4P 1VQ9S 3DRPA 3UW1A 3HKWA 5A2QO 3MR7A 3HCXA 2B4OA 5AQPA 1VQ8S 2K1RA 1UEUA 3DM2A 1VQ4S 4FK2A 3D0PA 5E2QA 1RWNB 2DYAA 2I5JA 1BIZA 3R2DJ 4AHRA 3QEPA 3BSOA 2O01C 5A76A 3CIZA 4MFBA 3HHLB 1X5TA 4LFAF 3QATA 2V0NA 2D3OR 1KVCA 1YLXA 3NAHA 1FKOB 1I5OB 3NGKA 1Z2ZA 1VQKN 3FUYA 4F36A 1SL1A 5GAGU 2HF4A 2HHQA 4IBNA 3E51A 2V8GA 1DRZA 1SVDA 1VQ5S 3ZTPA 2CJYB 5KGWA 3VTHA 3RMBA 1Q81O 4CQ1A 3H20A 4ZLNA 1N4LA 1TV6B 2VFRA 2V7YA 3CCLN 4XAKA 1X5PA 4OGEA 4CHQA 4P72A 5KOWA 4WFAL 1NMDA 1WKLA 1FD2A 2DGUA 4DV6J 2ASLA 2ZH8A 2CAJA 1HWUA 3H8YA 1TKTB 3JQMA 2R7SA 4J9LA 3NOCA 2CPJA 4DV0J 1NU4A 2VQFK 1VIOA 3CCLS 4HH0A 1ROFA 2ZBPA 2X78A 5L1IA 3K2PA 1TR0A 2G8VA 3G2XA 3QLHA 2VJUA 2FBYA 4F4ZA 3VMFB 5KT3A 2MEWA 2FHKA 1WTBA 1SJFA 1R8BA 5FDLB 2AGOA 4OKEA 3EEQA 4A61A 1I51B 5JVGQ 1Y3KA 3V6JA 2P9KB 4Z0UA 3SAFA 3BO2A 4TY8A 2XY7A 1H6KX 3RW7A 4HTJA 1NMEB 2FHJD 3VPZA 3O9UA 3SSQA 2C2KB 2XI2A 4I1TA 2OIHA 3UO0A 1HQUB 4H8KA 3KDOA 1VHFA 4KH6A 1OWXA 2B43A 3DOKA 1RUSA 2ZH3A 3C6HA 2MLZA 2KFZA 1RT1B 4EU0A 5KRSA 2HMIB 2POKA 2LMIA 2ZC4A 4HHJA 2MKIA 1C0GA 4XPCA 3NNCA 4L72B 2X3DA 1N56A 2J7WA 2E5LF 1HKGA 1IVZA 4HI1A 3E1YA 5H1SQ 2RRNA 1PJ7A 4GO7X 4ECSA 2ZHAA 2CPYA 2IGIA 1LW2B 1WSVA 1NBEB 2EPIA 4OZJA 1GMVA 3N01A 4P2MA 1NNDA 4FLZA 2JH3A 1RHKB 2E2OA 3EE8A 4M5DB 2MKKA 3D68A 2W7PA 3MI7X 2A2DA 2V4JA 2R2TA 4FL9A 5K14A 1IM6A 2V8HA 1AZSA 2QMUB 1VAZA 4DR4F 2E5LJ 4QW9A 1M5HA 2GTDA 4GY2B 2FYXA 2GC8A 3F73A 4A8KA 1UVJA 3GJQB 4CIFA 1HNVA 3RAMA 4YOWA 1U1LA 2YPZA 1XR7A 3IR5B 2Y9HA 2FHMA 3GR1A 2R8GA 1FNOA 2D9OA 2C2ZB 3K8WA 1NSPA 1ZBHA 5IM0A 5T41A 2NCKL 1CJKA 2UXDK 4NLXA 1SH0A 2D0CA 4LSNB 2RDJA 3CQXA 2ZHOA 2ZBCA 2C2NA 3MMJA 1WG4A 3BN4A 5JS2A 3CXCM 3W7BA 3L4BC 2HVIA 3SDEA 2KN4A 2PMZD 4U7BA 1RHJB 1S1XA 2NRZA 3QGIA 4AHCA 1QTMA 1ASVA