1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
3CM5A 3LAKA 3WNHA 4CE9A 3IS9A 5FDLA 2J6TA 4BE0A 5KFOA 3N6LA 4LH4A 4CHNA 3UQSA 1NJZA 3DLGA 3L2UA 2VG6A 1S6QA 4TY8A 4F4XA 3RWUA 2BE2B 4QAGA 1Q9YA 2OPSA 3KK1A 4HUGA 1KHWA 5HBMA 4YFUA 2FJVA 4NCGA 3DLHA 1VRTA 1KRPA 1QTMA 3V9SA 3RR7A 4NCBA 3LP0A 3CJ0A 1ASUA 1SKWA 4Q44A 3MFIA 3CO9A 1T8EA 4K4WA 1O1WA 4C8KA 4W5NA 4IFYB 1SL1A 5C42B 2OH2A 2HHWA 3EZUA 5SZTA 3NF8A 1XR7A 1TKTB 2BQUA 4RUCA 3LZJA 2FC0A 5KG0A 4KBIA 3TAMA 3SYZA 2HHVA 3QNNA 4TN2A 3ZCMA 1JLFB 3OYEA 2HMIB 3L2VA 4DQPA 3OLAA 3RMBA 2PYJA 4DU1A 3KMQA 4LY7A 3QEXA 1NNDA 3LAMA 4CIGA 1TKXB 3OYKA 4IKFA 5KT5A 4M3ZA 3VA3A 3QYYA 4DSKA 2WONA 4DLEA 1KLNA 3FQKA 3D5MA 2LSNA 1ZTTA 2W8KA 2GUIA 4GW6A 4ICLB 4F4KA 3KK3B 3ALYA 4ECRA 4G3IA 3V9ZA 3C6UA 3EZ5A 5KFYA 1W9HA 3RTVA 3NFAA 3O4QA 4FJXA 3NH1A 2BE2A 3QERA 1VRUA 5F9LA 4TY9A 4NLOA 3HXMA 5JS2A 3V6KA 3IRXB 4FM2A 5F8MA 2OZMA 2E6LA 3OYBA 3RMDA 4ECWA 5I3UB 2KZMA 4CIFA 4FXDA 1LW0B 4DSFA 5KFSA 1WN7A 2XC9A 3DRRB 1Z4UA 3RRGA 4IFYA 4FZZA 2PZSA 3QIPB 3OHAA 3PX0A 4ELVA 3IG1A 5KRSA 1TKTA 4CJTA 5EWFA 2VA2A 4AH9A 2FLLA 4FZXC 1WAJA 2R7YA 1JLFA 2HMIA 4F50A 3NAIA 5DQHA 2W7OA 3T3FA 4RNNA 1JLGB 4CJVA 3TR8A 4Y2AA 3SNNA 5KFQA 1JXBA 5D3GA 2B5JA 3GIIA 1KCFA 1RT6B 1S1UA 1X1PA 2HB5A 3VQPA 1NK8A 3CG7A 1LV5A 3KLHA 1ASVA 5HP1A 2G8VA 4EZ9A 3OL8A 4KFBB 2IM3A 3QESA 1U4BA 4ICLA 1OS5A 1T03B 4B9MA 3TARA 4RG8A 3KK3A 1IH7A 4CERA 2CJQA 2ITGA 2CKWA 4BDYA 3DMJB 5J2MB 1RYSA 5DQGA 2HVIA 2OPPB 3ZSYA 2G8HA 4FJ7A 3MEDB 1T05B 4F4YA 1B92A 4TLRA 1TP7A 2R8GA 1NOYA 2FBYA 4PA1A 4UQGA 3OS2A 4Q8EA 4GVMA 5I3UA 1BCMA 3QGHA 3PW5A 3RMCA 1KFDA 2R2UA 4C8NA 2AGOA 1LW0A 1XI1A 5L1LA 4CK1A 4JV1A 3DRRA 4CHZA 1CZ9A 4O5BA 1UA1A 2WHOA 2ASLA 4CGFA 1RTHB 3LP2B 4EYHB 3OYNA 3DLEB 1C2PA 4RNMA 5K14B 4NLWA 4U7CA 3FQLA 1KVAA 3DI6A 3ULDA 3BGRB 3Q8PB 5CZ1A 3CDWA 4Z4CA 1C0TB 3H4DA 2E9ZA 3RB3A 2F8SA 1JLGA 4MFBA 2JLEA 4WXWA 4FJKA 2XY5A 4O3PA 3AO4A 1RBTA 5KT7A 2J6UA 5F8LA 1SKSA 1IKVA 3FFIB 2WK4A 4N76A 1KLMB 2EHGA 4E7JA 2YNIB 4M3XA 2F8EX 4KFBA 2BDPA 5L1KA 1T03A 3C6TA 3CJ2A 3NL0A 5C25B 3K5NA 4IR1A 1J54A 3MXMA 1RT4A 2FVQA 2VWJA 4N5SA 4TXSA 5CY4A 2IDOA 4CJ3A 5J2MA 4MK7A 3BR9A 3H2LA 2OPPA 5F9NA 3SUQA 3ZT1A 3MEDA 1T05A 1QAIA 4W5QA 2KTQA 2Z1JA 5KT3A 1XWLA 1TKDA 1RT3B 4CEOA 3SUNA 3H5XA 4HTUA 2XY6A 4YR3A 3D28A 4QW9A 1BI4A 4KAZA 3IGVA 3BDPA 1W0HA 1Y97A 2AGPA 2XWYA 5DLGA 4ECQA 1RTHA 3LP2A 3G6VA 3PVXA 3H98A 2HNYB 3DLEA 2DPIA 1C6VA 2WB4A 3NGZA 4FVMA 2IM2A 5K14A 2KFNA 4CEFA 4OL8A 5F8JA 3QINA 3BGRA 3MTKA 3QIDA 4KTWA 1C0TA 2Y1IA 3GV5B 2IAJB 3NH2A 1I6JA 4M42A 5FRMA 2P1JA 2ZKUA 1JLEB 4EP4A 1NJWA 5L1JA 4W5OA 3V9WA 4CEBA 5CYQB 3FFIA 3MECB 4KREA 4YMEA 1HMVB 5CYMB 1KLMA 1U04A 3BJYA 1WSHA 3PHEA 3S3MA 1XR6A 5I42B 2YNIA 2WCXA 4AHSA 2X78A 1WSFA 5C25A 4CHYA 2R8JA 3HYFA 3HPHA 3AVHA 4ZPAA 3HVWA 4CFAA 5F8HA 3T5KA 1EKEA 4BDZA 4DL4A 1HQEB 2W9AA 3Q8SB 4XO0A 4LD0A 2YV0X 2IGIA 3ICLA 4B08A 1ZBFA 3G10A 3KHGA 3C95A 3NAEA 2ZD1A 1RT3A 4ZHRB 3VQBA 3M8PA 4E7HA 4QW8A 2DTUA 4Q0BB 1IKYB 1NK4A 1W25A 2VWKA 3HM9A 4DFJA 1A5WA 2VG5B 4MK8A 4CJKA 4EYIB 1RT7A 4MIAA 3AVKA 1WAFA 3BREA 4ZPDA 3CJ4A 4CJPA 3I5AA 2D0BA 1SH2A 3V9UA 2HNYA 1GX6A 1TL3A 4DSJA 2Z1HA 2FBXA 4CEQA 4F3TA 4KHYA 1KHVA 5KG4A 2UVWA 3SQ2A 3CQ8A 2I5JB 4NLGA 1D9DA 2IAJA 3TAGA 1JLEA 3HJFA 4M3UA 4R5PB 4ECVA 2HW3A 1KFSA 3G86A 1YVUA 5KFGA 3MECA 1HRHA 1HMVA 5CYMA 4FJJA 1X9MA 4TYAA 2V4QA 2YNFB 2DFEA 4XPEA 1GOAA 5I42A 1TQLA 3CVKA 1XC9A 3KJVA 1ZTWA 2HNZA 2YNHB 4LH5A 2C28A 3HSTB 4DTXA 4O3NA 1RT2B 3HO1A 5KFVA 1JL1A 1QS4A 4R0EA 3PW7A 1WLJA 1NK7A 1DLOB 1S1VA 4IBNA 4OPJA 3UR0A 2FBTA 1HQEA 1HNIB 2IBKA 4L8RB 4NLUA 2Q3SA 2BQRA 1R0AB 4FJ8A 3PX4A 1RCHA 1ITGA 1JLQB 5DLFA 1D0EA 1S1XB 3TQ1A 3QEWA 3ZSOA 3QGGA 3SV3A 3AA4A 3NBPB 3ITHB 2XCPA 4J9NA 5HROB 4F2RA 4N47A 5KFJA 3DRSB 2VG5A 4CJFA 4TQSA 5KFAA 4F3OA 3ISND 3K57A 1F21A 2R2TA 2W42A 4KHWA 1TAUA 3K5OA 1U09A 4B9TA 1C1CA 3RB6A 1CSJA 4CK2A 4E0DA 3DOKB 1TV6B 4KB7A 1QUVA 4Q45A 2XO7A 2HHXA 3M9NB 2GBZA 4MIBA 3I0SA 4R5PA 2DPJA 4NYNA 4U6PA 3QGIA 4URGA 4E19A 1UWBB 5DK5A 2HHTA 1JXLA 4EBDA 4B9VA 4ZMMA 1KSPA 3VQCA 4BACA 4EEYA 1RT5A 1S9EB 5EUHA 1S0MA 4M45A 2V9WA 3CFRA 5F8IA 4DSEA 1RT2A 4FLTA 1HYZA 1DLOA 3G0ZA 4ECUA 1HNIA 3LALA 1VSIA 1U47A 1EETB 2B6AA 4O3SA 3KD1E 1Q8IA 4PWDA 2P5GA 1R0AA 3OS1A 4GC6A 4KAIA 3DLKB 2XCAA 4F8RA 1JLQA 2G8IA 4DFPA 1G15A 4E1NA 5KT6A 3KOAA 3O3HA 4FLUA 3QEPA 4RW8B 1QE1A 3NBPA 3SPYA 3ITHA 2JEFA 4ECYA 2AX1A 3DRSA 1D5AA 2IM0A 4LQ9A 3Q8QB 4IOBA 4OKEA 4LSNA 4C8OA 4HHTA 2E6MA 4FJ5A 4I9LA 4ZTFA 3KMSA 1ZBIA 2UVRA 3GV7B 3OYHA 4CGJA 3G6YA 4CEZA 4EO8A 3NH0A 3GYNA 4KPYA 2RF2A 1C1BB 3B6PA 4M95A 2OYQA 4JS4A 3K2PA 3NGYA 2C2RA 3TI0A 1TV6A 4CJQA 4FZYA 4JV0A 3L2WA 3PR5B 3T5JA 5C5JA 3DDKA 3MXIA 2UVVA 4JV2A 3AO1A 2JEGA 1UWBA 5KFHA 1S0OA 2AX0A 2UUWA 3O4NA 4MQ3A 1RTDB 3MR2A 3H5UA 4ELTA 1HNVA 3DRPB 4QWBA 5HRRA 1TK5A 4FJ9A 1S9EA 4XPCA 3OYAA 4J9SA 5KFIA 3VQSA 2BANA 3KK2B 4F4WA 3QLHB 4X2BA 4CJRA 2AGQA 4PUOB 3MXJA 4Z4IA 5T14A 2IC3B 2XI2A 3I5BA 3DLKA 2W9CB 2G8FA 2DY4A 3OJUA 3CM6A 2E9RX 1N4LA 4O0IA 1BQNB 1FXXA 4FK0A 4FM1A 4HUEA 1S6PB 4YQWA 2JEIA 4TSXA 2FVSA 4J9KA 3K58A 1KVCA 4NLYA 4CESA 1L3UA 3U3GA 4FJHA 4DSLA 1DTQB 3M8QB 2XY8A 2AU0A 1RBSA 4GMJB 3EPGA 4AHRA 2F8TA 1RDBA 4M3WA 5JUMA 5DG8A 2W9BB 2DFHA 2PYLA 2FJXA 3DLRA 1BIUA 4K4UA 4NRUA 4RNFA 4M41A 1EX4A 4J9OA 1C1BA 4DF4A 4DTUA 3SI8A 4CJWA 4RNHA 3OS0A 4E89A 1VSLA 2V4RA 3I8DA 3OLBA 3HVTB 4MH8A 2JGUA 5C42A 2D41A 3D45A 2ZQBA 4WXOA 1RTDA 4CJ4A 4J2EA 5KFKA 4ELUA 3PO4A 2KQ2A 4WFXA 3DRPA 1T7PA 4RUAA 3PJXA 2FBVA 4CJEA 1QHTA 4Q8FA 4KHSA 3DM2B 1TKXA 4FBTA 5FROA 3KK2A 3QLHA 3VQ7A 3SFGA 3Q8RB 1DTTB 4PUOA 4CEAA 4URQU 4K50A 2HWIA 1NHUA 1S48A 1TL1B 4G1QB 4FW2A 3U3YA 2W9CA 1T3NA 2OPQB 4KE5A 4FK4A 3E01B 5J1EB 3V6DB 4FJNA 1BQNA 3ASMA 4B8AB 3E51A 4HCCA 4DTMA 4EP5A 1S6PA 4OKJA 3AA2A 4KB0A 2A1SA 4I2QB 4ZP6A 2KFZA 1CZBA 4E7IA 3M8QA 4KKOB 3IRXA 4URSA 3NF6A 2C2EA 4BDPA 1RILA 1GX5A 2W9BA 4CF0A 4KI6A 1A5XA 3G6XA 4Y1DA 4B9SA 3LDSA 4H4MB 1JLBB 5KFUA 5DGAA 3KLFB 3HL8A 3S3NA 3QIPA 1YVFA 3AVIA 3I0RB 1UOCA 5SWMA 3MEEB 3PUFA 2IJFA 4W5RA 3VQ4A 1N6QB 4BWMA 4J2BA 3TANA 3RBDA 1WNEA 2ILZA 3GQCA 4IKAA 4NYZA 4KTZA 4K4TA 1REVB 3SUOA 1U49A 4AHCA 1RT6A 1DTTA 5J2PB 4O3OA 1TL1A 1IKWB 2OPQA 1MU2B 1BCOA 3HP6A 5DGBA 3NGIA 2UUTA 5J1EA 3V6DA 1NOZA 4OVLA 3LP3A 3ZSQA 4WYLA 4J9MA 4B9LA 1C1AA 3MR3A 3DMJA 3NF9A 1EXQA 2FVRA 1Z26A 1IM4A 1LWFB 1BISA 4E7LA 4RZRA 2ATQA 2WTFA 5KT2A 3H5YA 2C2DA 1N48A 4DFMA 4JRPA 4NCAA 4N56A 4IH7A 5KRTA 4AILC 2F96A 4FBUA 3LP1B 4H4MA 3V1OA 2VA3A 1JLBA 1B9DA 1S0NA 1VK0A 3VQ9A 1CXQA 1WSJA 1RNHA 3VQ5A 5J2NB 2EC0A 5KG1A 5EWGA 5JS1A 2J6SA 3MEEA 1N56A 4N41A 2E9TA 3U6FA 3RRHA 5HLFB 3AO5A 1N6QA 3OYGA 1X9SA 3AVMA 4F2SA 3NGDA 3AVGA 2YKMB 2PY5A 2OA8A 4IG3B 4MK9A 3VQDA 4ZPCA 1REVA 3SFUA 1MMLA 4JUZA 4CFBA 2QKKA 1WSGA 2IS3A 1WSIA 2BQ3A 1VSDA 3HHKA 3H40A 4IR9A 4CJUA 1IKWA 1MU2A 3QNOA 3SQ4A 2XGPA 1CXUA 3AVBA 3GIJA 1C0MA 2OPRB 1HQUB 3FDSA 4O44B 2Z1GA 3TABA 3L3UA 3S9HA 4B8CA 1TK8A 5KFTA 1LWFA 3QETA 4K4XA 4NLRA 4JS5A 1UAXA 4IFVB 4CJSA 5KG2A 3ZSWA 3BSAA 2B43A 5KFXA 1BHLA 4FW1A 4Q5VA 4DL2A 4CIEA 3LP1A 3N6NA 4J9LA 1BL3A 4KHQA 3KNAA 4FJGA 2XHBA 3RMAA 1K1QA 5FRNA 3TAQA 1RDDA 3K59A 2B4JA 3KLEB 4MKAA 2YNGB 2X74A 4CGHA 3RAXA 5HLFA 3AA3A 5KG5A 4TYBA 3TAEA 5J2QB 1RDAA 3P1GA 2YKMA 3H59A 3OL9A 4Y1CA 4J9PA 1RBRA 4LQ3A 1RTJB 5KFLA 5CYQA 4Y34A 1NK5A 1JKHB 2ZE2B 3PZPA 3ISNC 1HYSB 4M3RA 3V4IB 3OSPA 2AJQA 4WFYA 3HT3A 2OPRA 1HQUA 4CGIA 3AV9A 1QAJA 3LPUA 4CF9A 1HARA 1FK9B 1S1WB 1J53A 3UDLA 3VA0A 2BRKA 3L3VA 1Z25A 4QWDA 3KKRA 4YNQA 4IFVA 1RAJA 2V0NA 2YHAA 1TAQA 4ZHRA 4DQIA 4B3OB 4E7KA 4WE1B 3OYJA 5KFZA 4Q0BA 1IKYA 3TWHA 2HHUA 4RW4B 3AA5X 3QZ7A 1XR5A 1ZETA 4R8UB 1X9WA 4O4RA 4KB1A 4DTSA 3GIMA 1TGOA 1TVRB 2D5RA 2QXFA 4KHUA 5FDLB 3OSNA 1I39A 4QCLA 3KLEA 2IA6A 4K4VA 1S97A 2YNGA 2RKIB 4EBCA 2FLNA 1FKPB 2VG6B 5KG6A 3O3GA 2I5JA 2ALZA 5J2QA 4DL7A 5KFFA 3BSNA 4DTPA 2JC0A 1RBUA 4AHTA 3KLGB 2BRLA 1RBVA 3IGNA 1S9GB 1RTJA 4EBEA 1L3TA 2AQ4A 4IRCA 1N5YB 1JKHA 2YNFA 2ZE2A 3V4IA 2G8WA 4E1MA 1QSLA 2YNHA 3D0PA 3NAHA 4BWJA 2P5OA 5L9XA 4RU9A 1FK9A 2A1RA 4ID1A 4NLVA 4KI4A 1U45A 4HUFA 2O5DA 3OJSA 2XRIA 1GOBA 1S1XA 3M9MB 1K6YA 1NK9A 4WE1A 3PW4A 3QIOA 3A2FA 3AVCA 4QOZB 5F8GA 3F9KA 4RW4A 3RB0A 2D3UA 5EWEA 5HROA 4R8UA 1TKZB 4J9RA 3PO5A 1TVRA 4ECTA 1XHXA 5KTQA 3RB4A 1JX4A 1VSHA 3C6UB 4I9QA 4GC7A 3T5HA 2RKIA 3PW2A 1WNSA 1YTAA 3T19A 1FKPA 4QWEA 4OJRA 2BGGA 2AWZA 1VRUB 4ZPBA 5JXSA 3DOKA 4FK2A 3PY8A 1RA6A 1A5VA 3OVNA 3KLGA 4IG0B 3VQ6A 3KLIB 3KKSA 4CJLA 5HRSA 1ZBHA 1S9GA 3IN5A 1ZBUA 3EPIA 1N5YA 4EZ6A 1Q9XA 4FJMA 4ZP8A 3SPZA 4DS5A 3IG1B 1LW2B 2HNDB 3OYFA 3MR6A 3RBEA 4FLWA 1EETA 4YR2A 3T1AA 2D7SA 3M8RA 1S49A 4J2AA 1J5OB 1ASWA 1NJXA 3FRZA 4KSEB 3AO2A 1NKBA 2G8UA 5D3GB 2B5JB 4LSLB 3ZSVA 4RW8A 3RAQA 1S1UB 3H4BA 2W8LA 4NYFA 3KLHB 3MF5A 3KTQA 5HP1B 1TKZA 4JRQA 3AVJA 2R8HA 2BR0A 3WNGA 4KHRA 2JEJA 4OLBA 4NLXA 3CWJA 3MEGB 1SV5B 1JXEA 2O4IA 5F8NA 1EP4B 4O4GB 4DU3A 4Q43A 4CF1A 2XGQA 3CFPA 3LZIA 1HPZB 4H8KA 4KTQA 3PW0A 4ECSA 3QEVA 2QKBA 4AHVA 3OYCA 4IG0A 3KLIA 4Z0UA 3BQ0A 4FJLA 4MKBA 4FS1A 1VSMA 2FLPA 4ZVHA 2OZSA 3CJ3A 3NHGA 4H54A 1NK0A 4ED3A 4DL6A 3SQ1A 5KG7A 4K4YA 4Z4GA 5KFDA 1LW2A 4DL3A 4DU4A 3DOLB 3ZT3A 2HNDA 5DG7A 3HP9A 1RA7A 3F73A 3NMAA 4CCHA 4KO0B 4FLYA 3DI6B 4Z4FA 2IC3A 3HK2A 4OKKA 2G8KA 1SUQB 2HHSA 1QQCA 4DTNA 1J5OA 4YP3A 4MFBB 1HYVA 4DSIA 1VSFA 4K4SA 4CEDA 5E41A 3HVAA 2YHBA 2IMWP 4LSLA 3PX6A 5HRNA 4WFZA 1IKVB 1S9FA 4CGDA 2FVCA 3VQEA 4F4ZA 4IH6A 4PQUB 4I2PB 3ZT4A 3VQ8A 1DTQA 4DTRA 4M3TA 3C6TB 5KGWA 5KFMA 4CHPA 3P83D 1RT4B 3P5JA 2GIQA 3MEGA 1SV5A 5CZ2A 1JLAB 1EP4A 3ZSRA 2D3ZA 4KHMA 4J2DA 2RDIA 4O4GA 4RW6B 1BIZA 4O3QA 1VSJA 2QV6A 1C0UB 3K5MA 3HVTA 3OL7A 1HPZA 4CHQA 2I1RA 1LWEB 3OHBA 3OL6A 4DFKA 2QK9A 3SV4A 4KHNA 4C8LA 1K1SA 2ASJA 1BI4B 1I3AA 4BE1A 4K8ZA 4CFCA 3BSOA 3KHHA 2D0AA 3FSIA 3AVLA 4DEZA 4WZMA 3VN5A 3DM2A 4CHOA 4QWAA 3QZ8A 3DOLA 3TVKA 4HVJA 3M8SA 5T7BA 2NUBA 3N6MA 2IOCA 1YT3A 4E3SA 2XY7A 4KO0A 3PJWA 4M3YA 3BQ2A 4NZ0A 1KVBA 2O4GA 1BQMB 1SUQA 4G1QA 2HHQA 3T5LA 1SL0A 4KRFA 3H08A 3KD5E 5KFRA 4O55A 3E01A 4DQQA 2Z1IA 2KZZA 3V6JA 4DTJA 1NK6A 4ED7A 4NLQA 2X6SA 2ATLA 3HVRA 4I2QA 1RT1B 4TQRA 1QSSA 4PQUA 4I2PA 4RNOA 3SZ2A 3ZSXA 4RW7B 4ED8A 4KKOA 4M94A 1T94A 3VQAA 4DS4A 4HKQA 1SKRA 3SJJA 5KT4A 3LPTA 4JLHA 3OYLA 1JLAA 3VQQA 2X6NA 4CK3A 4OGCA 4J9QA 4RW6A 3OY9A 5KG3A 4FM0A 1C0UA 3KLFA 4NRTA 2JC1A 4IRKA 4ZVEA 3AO3A 4AHUA 1LWEA 3I0RA 2ZD1B 2R2RA 3ZT0A 3M8PB 3S3OA 3M9OB 2QE5A 2R8IA 4ECXA 1CLQA 3L2QA 4OPKA 3SI6A 3DYAB 5KFWA 3V9XA 3EYZA 5C24B 1IKXB 1IO2A 4HCBA 3TAPA 2Y1JA 2GIRA 4FYDA 1S4FA 4ZTJA 1RT7B 4CEEA 3KHRA 4Z4HA 4DQRA 1IG9A 3QO9B 3GV8B 3MFHA 2RPIA 5KI6A 3SUPA 3UIQA 3B6OA 1D8YA 1TL3B 4Z4EA 3QEIA 2YKNB 3JSMB 4ID5B 3GIKA 1RYRA 5J2PA 3EY1A 4Y3CA 4CGGA 1BQMA 1KTQA 4BE2A 3PV8A 3KLVA 4DL5A 3LWMA 3V81B 1HJRA 5KFBA 1NJYA 3CJ5A 2R8KA 4NLSA 3PR4A 3JYTB 4RW9B 1RT1A 1RDCA 1SH0A 2WOMB 4ED6A 5KFNA 3KJVB 4B9NA 4RW7A 4PY5A 1WSEA 4IH5A 2IM1A 2HNZB 2HVHA 4WZQA 3OYDA 4ZVFA 1S1VB 4DG1B 3BQ1A 3IAYA 2WRMA 4NLDA 4ED0A 4DWIA 4XIUA 3L2RA 4B9UA 4I7FB 3NKYA 2IJNA 1ZBLA 4CJ5A 3ZSZA 4NLPA 5J2NA 4CECA 1NHVA 2DFFA 3CFOA 3WNFA 3DYAA 2XI3A 4FLVA 3HPGA 1NKEA 5C24A 1IKXA 3L8BA 5KGXA 4ZP9A 2C22A 3ZT2A 3NF7A 1ZYQA 3QO9A 4CFDA 4DLGA 4IG3A 4O3RA 4H4OB 1LWCB 3KIOA 4ECZA 3HKWA 1LAWA 3BSCA 2YKNA 4KV8B 3JSMA 3HPOA 4DQSA 4ID5A 4DF8A 1JLCB 3GILA 3WNEA 1C1CB 4ED1A 1L3VA 1XHZA 5DMRA 3OYIA 2W7PA 3V1RA 3DLBA 4IDKB 3V81A 3I0SB 1FKOB 3O3FA 2FJWA 4OGEA 1D9FA 4O44A 4FLZA 1RTIB 3LWLA 3JYTA 4YR0A 4RW9A 2VG7B 2WOMA 1RT5B 4FS2A 1L5UA 5HRPA 4K8XA 1YTUA 4CF2A 3TAFA 4EO6A 4FCYA 4DG1A 4W5TA 1U48A 1UA0A 3C94A 1S1TB 4FJIA 5KFPA 2B6AB 4PWDB 1J9AA 2ETJA 1JL2A 2KW4A 4I7FA 3KHLA 4DTOA 3UPFA 1S5JA 2R2SA 3NCIA 3IS9B 1GOCA 2HAIA 4HYKA 3NE6A 4OLAA 4FLXA 4CF8A 1QE1B 3AVAA 1B9FA 4IQXA 1NKCA 4C8MA 3DLGB 1RDRA 2D0CA 3CYMA 1S6QB 4TY8B 2ASDA 2RN2A 1D1UA 1VSKA 3CDEA 3MAQA 4LSNB 5L1IA 2OPSB 3KK1B 2GV9A 4H4OA 5HBMB 1LWCA 4NCGB 2HWHA 2P51A 1VRTB 1L3SA 1QSYA 4KV8A 4ZVGA 2RF2B 3LP0B 2RDJA 3AVFA 3RR8A 1JLCA 5DQIA 2E4LA 5KFEA 1LAVA 1SL2A 1HYSA 4DMNA 3I5CA 4IDKA 2UVUA 3K5LA 1FKOA 5EDWA 1TK0A 3H5SA 1RTIA 3TAMB 4IRDA 2EX3A 5DG9A 3NDKA 1S1WA 2VG7A 2GC8A 1VSEA 4NLTA 1S10A 5EU7A 1HNVB 4QWCA 2FVPA 3CIZA 4Y2CA 4QPXA 4ZP7A 4ED2A 3V6HA 3SQ0A 3MR5A 4K4ZA 4B3OA 5KFCA 1SH3A 2BANB 2ILYA 4O0JA 3SCXA 3OYMA 3CDUA 2WONB 1JIHA 1S1TA 1BGXT 3AVNA 3THVA 3LANA 3V1QA 4WYWA
chains in the Genus database with same CATH superfamily
3CM5A 3LAKA 3WNHA 1SIZA 2ZOMA 3CCLN 3MPVA 3RBXA 1YXQA 3CCMS 2UXBJ 2XHWA 3L4BC 1VQ5S 3TA2A 3ATVA 4CHNA 3UQSA 4XAKA 1Q78A 1RACB 1FRMA 2HQGA 3NY0A 1OVYA 4F4XA 2JFDA 3EDQB 5J1NA 4ZLPA 4QAGA 5ADXA 5B0BA 2OPSA 2P9SA 5HBMA 4C11A 2V2KA 5BYSA 3J80U 1QTMA 4E1JA 3LP0A 3CJ0A 4Q44A 1T8EA 3BGUA 4K4WA 1ATNA 5CHCB 2FDNA 1O1WA 1X3MA 2H3GX 1MW7A 1XR7A 2CPYA 1TKTB 2ADBA 2FC0A 2CG4A 1FRKA 4DV3F 1AFJA 3SYZA 2L08A 3N01A 3L2VA 1ZH5A 1GH8A 4GKKK 1HR0K 4DQPA 3RMBA 4DU1A 4LY7A 2KYXA 1NNDA 1KD1T 3OYKA 4KRWA 1YTYA 3H46O 2HBRB 3QYYA 2WONA 4DLEA 2XYHB 4ZVTB 2W8KA 1IQZA 2LDIA 5AQMA 2GUIA 4PYAA 5AJ3F 4F4KA 2LA4A 3O6WA 2MQQA 3MUVP 4OYPA 4G3IA 3V9ZA 4KH6A 3SMSA 3IXQA 5A8WA 1K8AT 5AQIA 3MMAA 2LKZA 3O4QA 3M2UB 2UV8A 4NLOA 5JS2A 4FM2A 2OZMA 2NXJA 3BKUA 3P5TL 5I3UB 2W2QP 5E3AA 4CIFA 1NGHA 3RJMB 2I0XA 1NGGA 2F8MA 1Z4UA 4B1XB 4FZZA 1YIJS 3QIPB 1IJJA 2ACMA 1EHWA 4CJTA 5EWFA 3W5ZA 1Q95G 4FN5A 4AH9A 1U1NA 2UXCF 2CGKA 2R7YA 1B64A 3HHLA 4MT1A 1X5PA 3NAIA 4YB5A 1S6UA 1JLGB 4CJVA 3RVCA 4Y2AA 5KFQA 2MKKA 4HEA9 1JXBA 5D3GA 1U26A 4F36A 2J76E 1AUDA 2POKA 4Q2MA 1R8CA 1RT6B 3VQPA 4ES1A 2G8VA 4V19S 1SQFA 3F9MA 1KQSR 2BVZA 1VOMA 4ICLA 1OS5A 1Y11A 1T03B 1SXLA 4LMZA 3KK3A 1IH7A 5AXLA 4OZLA 1RHRB 4OZNA 1F2GA 5M1FA 3O4WA 2ATCB 3DMJB 1VFJA 2XMUA 1F60B 2HVIA 4A62A 2G8HA 3Q8YA 3DU6A 4FJ7A 4PG5A 3MEDB 1T05B 4F4YA 4TLRA 1TP7A 2JDJA 3K8WA 1OQ6A 4UQGA 3OS2A 4DZ6A 3T9NA 2IVOA 1BWEA 5CQGA 2YY3A 4YN3B 1FVSA 3C0BA 4Y0WA 1E3MA 1XI1A 3PKYA 5U47A 1EWQA 1PC5A 2OIHA 5D15A 5EXWA 1MN9A 3QBCA 2ZH5A 4CZHA 2HMPA 3SCLE 3DLEB 3CC2S 1C2PA 1F6TA 1KVAA 2H9ZA 3W9HA 5KAKA 4LFBF 3ULDA 3H4DA 4GV9A 1VQOS 4CBUA 3UKUB 3PLAA 2BYCA 2F1FA 3ENWA 5AQKA 1CZAN 4ILHA 3SDEA 5C15A 1IKVA 3THPA 4WIIA 2QA4G 2BJ9A 4U8YA 2F8EX 1CS4A 2D9PA 2XYGB 3CJ2A 3K5NA 2UU9F 3AAQA 1U0SA 5ITHA 4F3MA 3NCRA 2DNNA 2HHPA 1UETA 2HAFA 5CY4A 2IDOA 5J2MA 2QJ3A 5HMYA 2OPPA 1EAYC 5CZVA 5F2RA 3CCUS 1RWWB 2DR9A 2MKYA 4N7TA 5AQTA 3MD3A 3MM9B 5ADXH 1BI4A 3ZEUA 1HBNB 5G4DA 3IGVA 3BDPA 3K5PA 3J7ZO 2G0CA 3MGJA 3IKMA 2J9EA 3LP2A 4IEEA 3SCJE 1HNXF 2HNYB 1KWMA 2IDEA 3ULEB 2DNMA 4NZ6A 3IFEA 4KR0B 2HZAA 2Y1IA 2HKEA 1GEHA 4DPYA 3H1VX 3AD8C 4EP4A 1NJWA 1PSDA 3BF3A 4W5OA 1WF1A 1O13A 5CYQB 3OVSA 2JLFA 2C3UA 3FFIA 4KREA 3ZNUA 4YMEA 1KLMA 1HFEL 5D4PA 3PHEA 4NA1A 3OBYA 4RBTA 3RU0A 3OR2A 4AHSA 2QWPA 2LQJA 5C25A 2A41A 2IJRA 2NREA 3DWLA 1ICEB 2ZJRL 4BDZA 2V63A 5C2CA 2NYHA 1HQEB 4BC3A 3PDNA 2W9AA 5HJXA 2N4CA 1WKLA 1KBRA 4MKYA 1UVJA 2ZH6A 4GKJK 2AYGA 3MCAB 1Q1KA 3NAEA 2ZD1A 1VQYA 1I94K 4KHPF 3P3DA 1WWHA 4M1KA 4QW8A 3DXKB 1P6TA 4FOIA 2QSWA 2P8IA 3PTWA 3H2UB 2M3DA 3R7NB 3WEEB 2DEJA 1UCNA 2R7OA 5GADI 3FZBA 2VG5B 3BREA 4UZCA 3I5AA 2XLJA 3ENAA 2BKNA 1FW6A 1GX6A 2Z1HA 1XNRJ 4CDIA 2DCLA 4CEQA 3U27A 3WDOA 3WQTA 2P9UA 1O0PA 5KG4A 3SQ2A 1GLFO 4H0TB 5LY3A 4NB4A 1U1QA 1JLEA 1S7HA 4R5PB 5ETQA 2HW3A 3QWUA 2VODA 3PRVA 4DZDA 4OHVA 1ELOA 1H72C 3CEDA 3K9JA 3CE8A 2W01A 1GOAA 1FVQA 2I6WA 2V8GA 4DCOB 4JI8J 4M5HA 3EE3A 3PW7A 1NPPA 2FBTA 4F7VA 4X65F 1R0AB 4J8FA 4BROA 3EZOA 3US5A 3P8BB 3HZGA 1UVIA 1Q86T 3FZFA 1G99A 4HVZA 5ETVA 3EVWA 4LBPA 5E84A 1D0EA 3TQ1A 2V52B 1FERA 2QIFA 4DN9A 1FFWB 3SV3A 3AA4A 4JD2B 3NBPB 2C1EB 4DUZK 1JNRB 4F2RA 4N47A 3O6QA 4CJFA 4TQSA 3NGRA 3P5BP 1UWAA 3ISND 4DXLA 4KGVB 1H73A 3H25A 1DQ8A 3ISZA 1U25A 2R2TA 2V2QA 2W42A 2YBVA 4ZVQB 2XHCA 4JKGA 3VV2B 2UUBK 1C1CA 2W24A 1V4SA 1CSJA 3AQPA 4E0DA 4KB7A 4Q45A 3ZX3A 2HHXA 4DR3K 2JHEA 4WIQA 2BEFA 4MIBA 4NYNA 3IBCB 2KN4A 4E19A 1UWBB 4DV7J 2YJEA 1GMUA 1KSPA 1RTZA 1SC6A 1S0MA 4M45A 3DHWC 4DSEA 1RT2A 4DV4K 2IFXA 3DGPA 3G0ZA 3CC7N 3A13A 2PDAA 3QGPA 3LALA 1U47A 1EETB 3KD1E 6FD1A 1P9QC 1Q8IA 1QHAA 4PWDA 1HW8A 2P5GA 3C19A 2IVMA 2XCAA 5CZXA 1HKGA 3W0LA 2ASMA 1D09B 4DFPA 1G15A 1Q82T 3KOAA 1YITS 3O3HA 2AMCB 5LOQA 2NPIA 2RQ4A 3CT9A 1Y64A 2JEFA 2Z2YB 4ED4A 3THXB 4LQ9A 4OKEA 4TLQA 3MM6B 2UVRA 3GV7B 3CPWR 1XN9A 4YB7A 2Z8QA 1LXNA 1T6CA 2MQLA 2W1BA 1XNQJ 2E1MC 4IOCQ 3J7YP 2OYQA 4DMZA 3K2PA 3NS6A 1TV6A 4CJQA 4WTYA 3BGLA 1VS3A 1FX4A 1N32K 2JSXA 2ZDPA 1JJCB 4CW7B 1Q0NA 4Y65A 3AO1A 2HEKA 2E88A 2XQCA 2VICA 4MQ3A 1YWXA 4OYMA 4ELTA 3FCVA 2MY7A 3CJ7A 2YWGA 2GX9A 4QWBA 4AL7A 1S9EA 3ILLA 4A2BA 3ENVA 1AW0A 1DGKN 4X2BA 4DV7K 2AGQA 3R8YA 5B09A 1B99A 2G2OA 2IRYA 4AE5A 2E9RX 4IEIA 2OAUA 3DNCA 1SJ1A 1IBKF 5M1OA 4FM1A 4YQWA 4TSXA 3K58A 4J9KA 1BC6A 3CJSA 2DHSA 2UXDJ 4I69A 1VQPS 3FZHA 3WC0A 1NXIA 2EBGA 2DFHA 4I6MB 1BIUA 5GAEU 1DFDA 4DF4A 4H4KC 4A8WA 4DTUA 3BS9A 4RNHA 2A3JA 3CJ1A 2CADA 2E2NA 3OTCA 2JGUA 1UJ6A 2DHGA 3VCDA 4DR1F 4RTFD 3ENBA 4FWQA 3ID6A 2A6AA 2ZQBA 1M0SA 2BW2A 2J7KA 3VGMA 2VOPA 5MLCV 1RTDA 1ZS6A 4ELUA 2KQ2A 3IWLA 4WFXA 3DRPA 3SXLA 1SBRA 5M1PA 3L9ZA 3J81O 4KHSA 3DM2B 1RISA 4J91A 3QLHA 4OPHA 3NGKA 3Q8RB 3VF2A 4CEAA 4URQU 4DPOA 4K50A 1TL1B 4G1QB 3U3YA 1U0HA 3W61A 3EMTA 3CCSN 4X84A 5M1NA 3E01B 5J1EB 1PYOB 1UJ5A 2MQMA 1BQNA 3M2RA 4UTGA 4BC5A 3TX0A 1KNZA 4OKJA 3VTHA 2WFBA 2A1SA 3THYB 4I2QB 3BF1A 1BU6O 1ZAVA 3JS6A 1JB0C 1KEKA 1CZBA 3VEYA 1EQMA 4WKRA 2QYCA 4URSA 3I55S 2QLFB 3LUYA 1GX5A 4KI6A 1XJWB 1A5XA 3TZXA 4JI0J 4YS2A 2QZ8A 3ZZTA 3R7BB 4H4MB 1V3SA 1W7WA 3L4QA 2A5XA 5KFUA 4DV0F 1YVFA 1ZOTA 3AVIA 3C7NB 5SWMA 1T9VA 3KWMA 2QA4S 1FD2A 3L09A 2Z2ZA 3TP2A 2IRUA 4C23A 1RAEB 3HI0A 1FI4A 2QWOA 2C2NA 1WHWA 4GV6A 2O8BB 4L72B 4NYZA 3IAM9 4EHUA 3Q24A 2BJ1A 5J2PB 1VDHA 1L3KA 1HKCA 5HATA 1RGIA 4PR6A 3LP3A 1CBKA 4B1WB 1VBXA 2VQEF 3UNGC 4CT9A 5ETKA 1IJEB 2FC9A 4IJNA 2W4PA 1RCXB 1Z26A 1IM4A 4E7LA 4BRDA 1FWLA 3H5YA 4RKUC 2C2DA 1N48A 3AHPA 4DI6A 4JRPA 2ZF5O 3SK3A 3P4IA 1I5OB 4IH7A 3GPAA 2VCPA 1RHJB 2O8FA 2DKOB 4AILC 2RUGA 4FBUA 2VA3A 3Q7BA 3QT7A 1B9DA 1Z6RA 1S0NA 2YKOA 1VK0A 1MWZA 4A57A 2JVOA 3VQ5A 2OTLN 2K1RB 3T1HF 5EX3A 5JS1A 1N56A 4N41A 1LOTB 4WF9Q 3BEXA 3OYGA 2ASOA 1EO1A 3AVMA 1PJ6A 5EVZA 2O66A 4IG3B 1YX2A 5IT9U 4MK9A 2Q0UA 1UAWA 4OX9J 4JYAJ 2Q0RA 2J7UA 2B3TB 4CFBA 4C0HA 2RIJA 2VF3A 2BQ3A 4RWTA 3HHKA 2AEJA 4FWPA 1FD8A 3SQ4A 4MDBA 1XMOJ 5LJ3Y 1QZ6A 2ZJQL 3SCIE 3S9HA 4Y28C 1LWFA 4NWBA 4ZVRB 2RHSB 4NLRA 3E8OA 1TMJA 3ZSWA 1HR0F 3WXMB 4HI2A 3CJ9A 5I3PA 2QMUB 3J7AN 2GMLA 3LP1A 4J9LA 5G0RB 4H0XB 1D9AA 4X4OA 2XHBA 3VEOA 3RMAA 3F2KA 3C6HA 1NGAA 3GJSB 3O3LA 1DKGD 4MKAA 2X74A 1H74A 5HLFA 1UKUA 2V7ZA 2A40A 1GT8A 1RDAA 4CNYA 3OL9A 3R3LA 4J9PA 2GVZA 2QFIA 4NXNK 1H2VZ 4FF3A 2ZH9A 1NGJA 4NO7A 2A6MA 3DGVA 3Q0AA 1FX2A 2PMZD 1S0VA 5HOOA 3V4IB 3OSPA 1RCOB 2AJQA 2DHXA 4WFYA 1OYEA 4CGIA 3HSDA 1QAJA 5B0FA 2CH5A 1HARA 1J53A 3UDLA 2G13A 2VV5A 1VI7A 4JI2J 4ZJQA 2YHAA 2U2FA 4B3OB 1M5HA 1JJ2R 4DR4K 1ZZNA 2BOPA 4RW4B 3OXLA 3AA5X 5T7LA 1ZETA 4KB1A 1WG4A 2XSJA 1YRXA 2VL1A 5AQFA 2PC6A 3MR7A 1TGOA 4F67A 3L7OA 1NHKL 2R3VA 3J7ZT 2RKIB 2FLNA 2Y0BB 2IMOA 1Y5IB 5KG6A 1CJTA 2JL9A 3QDKA 1WEXA 2FHJD 4NA2A 1VK3A 3MCPA 2WSFC 2JC0A 4AHTA 1UVNA 1GLDG 3IGNA 2K8GA 2AQ4A 2PA3A 4K25A 2AEMA 4HTIA 5A2QU 2CQGA 2O8EA 4BR4A 3NAHA 1N33J 5GAHP 1BDGA 4WQ5C 5D77A 4BC4A 2A1RA 2MJNA 2HGMA 2HFUA 3E3XA 1X5OA 2EFQA 5LL6Z 3GFXA 2XWXA 3D1OA 4K7QA 4X64J 2E2PA 3OJSA 3Q86A 1GOBA 1S1XA 3R5JB 2RS2A 4JI5K 3AVCA 2VB6A 5F8GA 3F9KA 3EL2A 2D3UA 5EWEA 2HRTA 1IR0A 1RBAA 3AFGA 1WKJA 3HKZD 1UZHA 3M1VB 1TVRA 1YI2S 5E0OA 2J9DE 4WFNQ 1B0VA 2GMJA 3FZLA 4ILGB 3T5HA 1N34K 4QWEA 1FKPA 4OJRA 3QBXA 4P6QA 2AWZA 5K8MA 4QR0A 4ZPBA 2HVDA 3NWGA 4FF1A 5HMWA 3JXUA 1EQ0A 4KQZA 2DRBA 1HNZJ 2G2YA 4CJLA 3KLIB 2V69A 1S9GA 4M7YA 1EZZB 4EZ6A 1Q9XA 4HACA 4FJMA 3N4QA 3SBTA 3SPZA 2AYBA 3KZBA 2ZGYA 4IWVA 1LW2B 1XMQK 3AXKA 1YJ7A 2XZDB 2KXHA 5ETLA 4YR2A 3T1AA 2D7SA 3BB5A 3M8RA 3CNQP 1N36J 4IUFA 4CH0S 3FRZA 3AO2A 2F4FA 2F9TA 5D3GB 2J5AA 2GV1A 2AEFA 3RAQA 2ZH3A 5C0YA 2QM1A 4DV6K 3KTQA 1K9MT 4JRQA 4LF5J 3BM7A 3E1YA 1G1XA 3WNGA 3WUHA 4OLBA 4NLXA 1JXEA 1VQ7S 2OANA 1JNZB 1X4CA 4CJ7A 3UVJB 4KTQA 3PW0A 3HHEA 3LGHA 2QKBA 4AHVA 2CPIA 4GKJF 4Z0UA 3O1WA 2FLPA 2Z56B 1I94F 2OZSA 1TL7A 2ZZTA 2YXLA 2YHWA 3SQ1A 2E1CA 2DPNA 1GLBG 4DL3A 5KPRA 1J5EK 4ZS6A 5DO2A 2EWSA 4B3MJ 1N54B 1RA7A 2QLJB 4FLYA 2JH3A 2IC3A 5A0YA 3PSFA 4A48A 5LJ5Y 2PFFB 5A8KB 1HYVA 4FPIA 3HVAA 3JS9A 2IMWP 5HRNA 1APSA 4GO5X 2ZUAA 1IKVB 5DDQC 4IH6A 3QRPA 1ZM2A 5JJBA 3ZT4A 3ZYYX 1WC0A 1CS4B 4DTRA 1M90O 1N36K 4LRAA 4CHPA 3JQMA 2GIQA 5HAOA 2NRRA 4KHMA 5MAOA 2RDIA 4PPDA 4NXMJ 2FSKA 3K5MA 1KS2A 2E7XA 2HQ3A 1FFSB 3OHBA 1IG8A 2F9JA 3SAFA 1R27B 3T41A 4KHNA 1K1SA 2ASJA 1BI4B 5AQRA 3ZEUB 4DPWA 4CLZA 3KHHA 3QSYB 1U6BA 4DEZA 3UKRB 4WZMA 5A6WA 2MGZB 2M4MA 1WC6A 4ID8A 4DUZF 2AP6A 4FP9A 3TJAA 3DXMA 3TVKA 1HI8A 3N6MA 1Q8KA 2FF6A 4KO0A 4C4WA 2F4VJ 3BQ2A 1KVBA 4WFBQ 2RE2A 1OIAA 3T1YK 2HHQA 3CTRA 3VAMA 1R0CB 2UUBF 3KD5E 5KFRA 1N8RO 4DQQA 2KZZA 3V6JA 1NK6A 4B1ZA 3D9BA 1ILYA 1PBAA 2DEIA 2Z4PA 5HVFA 4DR3F 1QUPA 2RNEA 3OW2R 4CNZA 2QGFB 1VQ6N 4TU8A 4TQRA 2LFVA 3SSQA 1NZAA 4PQUA 3EO3A 4ED8A 4M94A 4HKQA 4B3TJ 3SJJA 4BRPA 3LPTA 1M1KO 1RP5A 2HS3A 4CK3A 1B3TA 5L39A 4FVUA 4DV4F 2IRXA 5KG3A 2E1PA 2GUPA 4ZK7M 1GLJO 2OEKA 1TL5A 1C0UA 3KLFA 3FCHA 5M2PA 2W2NP 2BE9B 2FJDB 2ZD1B 3ZT0A 3VWSA 3M9OB 1CLQA 2P9LA 1BA0A 3OA9A 5KFWA 2R7TA 1EIYB 1S22A 3WZ0A 4J5OA 4CH1A 3HHDA 4M63A 4FYDA 3FNNA 4ZTJA 1LNQA 4DQRA 1ITPA 3QO9B 3MFHA 3BPSP 3HHLC 3GIKA 1RYRA 2D3OR 1IBLJ 1PIEA 3PHTA 2VJVA 4C98A 1RDWX 4DR7J 4DX8H 2EBEA 5BXIA 1HJRA 1SQKA 2MKIA 1NJYA 2QWMA 1N32F 3H45C 2R8KA 5E3QA 2B51A 1QQMA 4RW9B 2FC8A 1SH0A 2G4BA 2WVFA 4ED6A 2YPZA 3QSIA 4RW7A 4PY5A 4ANEA 2HVHA 4WZQA 3CCWA 2E2QA 3V4MA 3IAYA 4ED0A 4UY8O 4CLYA 4DWIA 4XIUA 2B4VA 4JI7K 2IHR1 4DV7F 1ZBLA 2E29A 3ZSZA 1RU1A 1U1OA 5J2NA 1WOPA 1NHVA 1U1MA 3CFOA 1NDCA 1FJCA 2AZ3A 4UOCA 4KGZB 2KXNB 1BO5O 1NKEA 1K0TA 5KGXA 2AYMA 1ZXOA 1NDPA 4CO3A 3NF7A 1ZYQA 2WW4A 4OX6A 2C3OA 3H2VE 3JSMA 4JKGB 2OMOA 2FY1A 3GILA 1C1CB 2DNZA 1Y9OA 2GA7A 3UN2A 5K8NA 5GAGP 2I9SA 1D9FA 4FLZA 3BBFA 1OPIA 2V34A 2W25A 4L6V3 1HA1A 4QYRA 3IM8A 1NGBA 4KH4A 2IYIA 3B6BA 4FS2A 2MZ1A 5IC6B 3TAFA 2R7UA 4FCYA 5CXTA 4YEAA 4UOFA 1S1TB 2YH1A 5KFPA 4PWDB 1J27A 4ZVPB 3A5NC 2WZ1A 4DTOA 5HN0A 2YWEA 1U8WA 1GOCA 3MURP 5IS2A 4HYKA 3J7YU 2AIRB 4K2JA 4DX7A 4CF8A 5C12A 1NKCA 2OTJS 2J9CA 4IQXA 3DLGB 3CYMA 1S6QB 3KNGA 1KR4A 2PGCA 4OZ1A 1D1UA 3CCMN 5D0RA 1VSKA 4NYPA 3KK1B 1VQ5N 2NLWA 2OKQA 1VRTB 3VEXA 4KV8A 4ZVGA 4UQTA 1IVZA 1XUPO 2E4LA 1I51B 1LAVA 4NI2A 1NU0A 4XEIA 3CMQA 5GMKa 4C1NK 3M1FA 4N77A 2XB2D 1A0OB 4CLTA 2EI5A 2VG7A 4U8VA 2GC8A 1WF2A 3OTBA 3ZZRA 1R89A 4ZP7A 2BABA 2QX0A 5CABA 3NXZA 3KUGA 1W26A 4LFCJ 1RWPB 2O8DB 1YBTA 4O0JA 3TUZC 3OYMA 1OQ3A 1NB2A 3TOQA 3JQKA 3FE1A 2D4WA 2BM0A 2UUAK 5FDLA 2DR6A 1VC0A 3I4PA 3C6AA 3HZ6A 2C3MA 4WWSA 4EUVA 4JI3J 1NM1A 3MCMA 2CA9A 1HI0P 4YOVA 1R6YA 1HBUB 2BE2B 2WBNA 9ATCB 4TNOA 5ETPA 4CLWA 1Q9YA 3EKUA 4YFUA 4NCGA 2LEAA 3DLHA 1VQKS 1KRPA 3RR7A 2KJWA 1SKWA 1HHTP 2V8VA 3MFIA 3CO9A 4LBHA 1RLDA 1VISA 4W5NA 2OH2A 2HHWA 3EZUA 4RR5A 4Y00A 3KJNB 2J8SA 3LZJA 1N52B 5KG0A 4KBIA 2HHVA 2YI1A 3ZCMA 3RAMA 4DX6A 2HMIB 1YIJN 3OLAA 1JK9B 4K5SA 2PYJA 3P45B 3KMQA 3FBEA 3QEXA 1WUAA 3T7ZA 4CIGA 3O9UA 5A8RB 1GXLA 3M2VA 4OZ0A 1VLYA 3PEHA 3VA3A 4JI1J 1CC8A 3D5MA 3O9QA 3OQ2A 1FXRA 2JWKA 3ONQA 2FZKB 3O9SA 4GW6A 3T6BA 1WG1A 1TR0A 2LYVA 1IQTA 3BGFA 3D0HE 1M1GA 3T6JA 2D3O1 1U24A 1KXPA 5D8HB 3EZ5A 2XYPB 4X4QA 5KFYA 2HHHK 1X4GA 1VRUA 3EKSA 5F9LA 2E6LA 1DURA 1GLEG 1FDDA 1T9UA 2KZMA 2W2OP 5KFSA 1PYTA 2KL8A 2XC9A 2ZKTA 3Q8VA 1GLCG 1Y5NB 2DXFA 1FJEB 1T9YA 3NP5A 2E5IA 2PMHA 1RAFB 3PX0A 3O5BA 1QVGM 5KRSA 1TKTA 2VA2A 3SBGA 1WAJA 4RWWA 1S79A 2N82B 2LEPA 2DO4A 3AQOA 3CC2N 5K8OA 2B5JA 3BEGB 4UW2A 3FUYA 4OQJA 5EOYA 1NK8A 1UZDA 3CG7A 1LV5A 3BH6B 4NXNF 1VQON 4EZ9A 2W6KA 4OHYA 3PIPQ 3OL8A 2I8EA 4B9MA 3TARA 1NSAA 5FLXO 2HGLA 4CERA 2XS5A 2ITGA 1S6OA 1NJIO 2BZ2A 3Q7CA 3TTCA 1NRKA 4XDCA 1MWKA 5DQGA 4JYAF 2VBZA 3X1LB 4B3RK 2CIMA 2C2OB 3M2UA 2V8PA 2CPJA 1EB0A 4GVMA 5I3UA 2KXFA 1J6ZA 2ZBCA 1KFDA 4C8NA 4A47A 2OHDA 1KKHA 3CCUN 4GVBB 4DKWA 4CHZA 3GTYX 1FRXA 1CZ9A 4O5BA 1UA1A 2WHOA 5CHIA 4PRFA 1RADB 4BR0A 1P8ZA 5AXMA 2PO4A 3A8YA 3DI6A 2EW9A 3JTNA 5BJRA 3BGRB 2ZVIA 1C0TB 1X5SA 2DNRA 2E9ZA 4ZCMA 2MXYA 1JLGA 1R43A 4QS7A 2JLEA 2CVIA 4C48A 2LEBA 3MX2A 3NGSA 4I4BA 1NG9A 3N0VA 1UEKA 4P2XA 3AO4A 1RBTA 5KT7A 2J6UA 3W8PA 2CZVC 4N76A 2CNNB 1JJ2M 1SC4B 2Q6CA 4M3XA 4H5VA 5L1KA 4IDHA 1T03A 2VIHA 3MXMA 1J54A 1RT4A 1RB0A 2FVQA 2MMYA 4TXSA 5A2QO 1XC3A 4CJ3A 2BH1A 4MK7A 3BR9A 3TR5A 4LF8K 3MEDA 1T05A 2P9PA 3G2XA 2Z1JA 3EX7B 5B8HA 2UXCJ 2E1RA 1RT3B 3SUNA 5HQLA 1NMNA 4YR3A 2DB1A 4LF7J 4KAZA 4ZJLA 4JI5F 4OZ3A 2XWYA 3G4SS 3OUYA 1GK8A 1N5SA 3UO0A 2NXEA 4DHYA 1EKSA 3H98A 1C6VA 3DLEA 3MK6A 1F3FA 2IM2A 3MWBA 3POTB 1WHVA 3DC2A 3W66A 4HT7A 5F8JA 1RJJA 3TO8A 3DDIA 1HBMB 3QIDA 3P31A 2ROPA 2E1AA 1I6JA 2ACYA 1YHQN 5FRMA 3UKUA 4K2XA 3R5CA 4U7BA 2A18A 5L1JA 3WXIA 4MO4A 4Y2MA 3MN7A 4DR6J 1HMVB 5CYMB 3W9IA 3I31A 5B7WA 2WCXA 1CQNA 1WSFA 4CHYA 2GJFA 4ZPAA 4CFAA 3MN6A 2DGSA 1M90T 4OPAA 3AB4B 3CJCA 1XMQF 3CD7A 2CQIA 3M8WA 2F9WA 2IGIA 3ICLA 4B08A 4I68A 2B0GA 2Q36A 3M8YA 1WEZA 3M8PA 1N33F 5IXUA 5LMNK 4LFBJ 2DTUA 3GG1A 2MLYA 1HBNA 1W25A 4XH5A 3DN9A 1RI7A 3HM9A 1TFWA 3R5GA 4DV6F 3GB0A 5ETOA 1P1LA 1Q18A 2D0BA 2HNYA 3NMRA 2XS7A 4IQMA 3ULEA 2FBXA 4OHZA 4EIAA 4F3TA 3A8IA 2UVWA 2B7BB 3DFEA 1CJTB 5E33A 3R8EA 2H3EB 2UU9J 4RBUA 3TAGA 5GAHU 5AQPA 4WFAQ 2BJ8A 4M3UA 2FUG9 4ECVA 1KFSA 1SVDA 2OGUA 1YVUA 3J8AA 5H9EJ 4TYAA 4P2MA 2JLGA 1N8RT 1QVFR 1TQLA 2J8AA 3CVKA 3KJVA 1ZTWA 2GWJA 4FWMA 8RUCA 1X4DA 4DTXA 2C28A 4O3NA 1VQ9N 4B1VA 1WLJA 1NK7A 1DLOB 1S1VA 2G1HA 4DR5J 1AFIA 2PFUA 4IBNA 4OPJA 1BWVA 1HQEA 4DR6K 3I4HX 3JQJA 2ZBRA 2YX7A 2BQRA 2Q3SA 4FJ8A 1HNXJ 1M1KT 1HJOA 4IZ9A 1S1XB 3QEWA 3DXKA 3ZSOA 1WI6A 3TTFA 2M9KA 3A0IX 3ITHB 3WEEA 3S6EA 1RFQA 2I7PA 2FY8A 3B54A 2VG5A 5KFAA 4RUBA 2NPFA 1Q53A 1KC8O 3K57A 1F21A 1N36F 4KHWA 5LXYA 3ID8A 4OI4A 4XTTA 1QUVA 3M9NB 2DYAA 3FR0A 2GBZA 4R25A 4R5PA 1ZBTA 4M8LA 4U6PA 3OTOK 1BD6A 2HPUA 2HHTA 4HACB 4B9VA 2QLBB 2C2MB 3K8VA 1RT5A 4QR2A 2CQ4A 4LF4K 5LSOA 2NNWA 3G8SA 3NGUA 4FL9A 5DZ6A 4O3SA 2B6AA 1F9EB 1R0AA 4PCQA 3OS1A 4GC6A 2E5GA 5E5NA 4F8RA 1YJNS 5KT6A 2JNJA 2R7RA 4M5MA 4UY8T 3THTA 3T1YF 3BPDA 1WTBA 3QEPA 2FXUA 2RHQB 3SQOP 4JD2A 3NBPA 4ECYA 5GAEI 4C8OA 4IOBA 4I9LA 2CQ0A 2XLKA 4CEZA 4EO8A 3NH0A 3CSKA 3GYNA 2RF2A 3SIPB 3J81Y 1C1BB 3LL3A 3B6PA 1ZAWA 4JS4A 3J81j 1VQPN 3NGYA 2C2RA 3CW2C 4FZYA 4JV0A 1VHIA 3HMJG 4FWKA 2YQ1A 5C5JA 2MYFA 1LK7A 4RX6A 2UVVA 1FO1A 1HWLA 2DK2A 5KFHA 1UWBA 2DO0A 3ZETB 2AX0A 2UUWA 2XLIA 4KGMA 3TVZA 1HNVA 3W2WA 4FJ9A 1G6BA 3OYAA 3BKFA 3UFCX 1GMVA 2CVEA 2VU5A 4CZMA 2BANA 3AD9C 2F63A 4PUOB 5AXNA 4Z4IA 3CETA 2IC3B 3TUJC 4FNHA 2R42A 5BR9A 2VUGA 4Y2KA 3GFZA 3DHXA 4X4RA 4NLYA 4ZVUB 4CESA 1WC5A 1RWMB 3THXA 2N7CA 3W3DA 3CIPA 3MM6A 4AHRA 5AE1A 5JUMA 5DG8A 2W9BB 3HFVA 3H42A 2FJXA 5LT5A 1BA1A 4M41A 1EX4A 4XDDA 4J9OA 2OP5A 1R6VA 4UOHA 3SI8A 3OS0A 1PAUB 5CYJA 3EICA 3I55N 3AODA 2V4RA 4LFAJ 3QAEA 2UV8G 5C42A 4OYBA 2D41A 4JI7F 3IAS9 1QM9A 4CBWA 2P9KA 5AQYA 4L74A 5K9FA 3PO4A 3TQEA 2VGMA 1D4XA 4RL1A 1T7PA 2QA4N 2LQ9A 1QHTA 4Q8FA 2L3MA 3OT9A 1TKXA 1LWXA 1UMJA 3SFGA 1DTTB 1WHXA 2WSCC 1Y00A 2BE7D 2HWIA 1H1VA 1S48A 1WC1A 3PYDA 1LXJA 2OPQB 2ZH8A 3V6DB 2BW7A 1IV0A 3ASMA 4ITSA 3CCRN 4HCCA 3D7SB 3LGMA 4EP5A 2CQDA 1CJVB 4ZP6A 1B7FA 1X7VA 2K7JA 3GBTA 2P2CB 3IRXA 3K0JA 1HHQA 1HNWJ 2E5LK 4CF0A 2NQPA 3NS7B 3G6XA 1TYQA 3CJBA 5M1KA 3IWXA 2NRXA 4Y1DA 2FHMA 3HFZB 3W5XA 4PG8A 5DGAA 3KLFB 3S3NA 1OY6A 2XZWA 2ZOGA 7AT1B 1UOCA 3R5BA 1V5IB 3R97A 2XM3A 2MKJA 3R5DA 3J80Y 3PUFA 2BOAA 2B8PA 1MMNA 2BJEA 2RRNA 3CCZA 3VQ4A 2WW8A 3KG1A 1N6QB 2X1BA 4LFAK 3ULHA 2E5JA 3RBDA 2ABYA 2B56A 1WNEA 1E4FT 4YHHK 4BRNA 2ILZA 5HANA 3TWZA 4KTZA 1REVB 1U49A 3O80A 4BC9A 4ZLJA 4O3OA 3GL1A 2ZBIA 4EK2A 3CHWA 1TL1A 4FYYB 1ATSA 1IKWB 3A3PB 1MU2B 3HZEA 5J1EA 4OVLA 3C2PA 3BF4A 3PJ9A 3MR3A 1WEYA 4C3MA 2FJBB 4C8ZA 4WKYA 2V6AA 3THYA 1Q16B 1Y0HA 2W2MP 2KKZA 4DFMA 5BN9A 3C46A 4JAXA 1R31A 1YSJA 1SQEA 3P96A 5KRTA 1K73O 2ZJRQ 3ILOA 5LXRA 4H4MA 3V1OA 3FZ2A 3VQ9A 4USHA 1CXQA 1WSJA 1HNWK 1RKIA 3W62A 5J2NB 2HBMA 3FMBA 1RAOA 4IO8A 1FKAF 3QJPA 4OFZA 4JV5K 3VEZA 5GAGU 1X9SA 1T6DA 4F2SA 5L8RC 2M70A 3FEYB 3IP0A 2YKMB 2PY5A 2M7SA 1CG2A 2OA8A 2YX1A 3M6WA 4NMLA 3GOIA 2R7QA 4ZPCA 3JXOA 1RAGB 3T9ZA 4FNIA 2UZAA 4JUZA 1SPBP 4DUYJ 2X3GA 4YY3J 1HBOA 4C8YA 3D7EO 1WSIA 1VSDA 3EGWB 4CJUA 4OZ5A 3C16A 5RUBA 1CXUA 4OV1A 2OI2A 2OPRB 4A8KA 1HQUB 2A10A 4W98A 1NH8A 4M5DA 3TABA 3L3UA 2NUHA 2DIUA 4WQ5A 2L9DA 4WCEL 4IOXA 4DV0J 2OCEA 3CIMA 2GW8A 4AFFA 3GP9A 3U1NA 2CH6A 1NJIT 5ELZA 4K4XA 2Q3PA 4IFVB 3CMEN 4NYOA 4CJSA 5KG2A 4DR2K 1SI9A 2Y3YA 2B43A 5KFXA 1BHLA 4CIEA 5JVHL 4PZVA 3UD3P 3HHLD 3N6NA 3RBZA 1Z05A 3FZMA 3A8EA 4JEPA 3KNAA 4FJGA 1Q4RA 2AV5A 3R5AA 5FRNA 2K1RA 4CYUA 3M8ZA 3K59A 2FZGB 1RDDA 1WI8A 3ADAC 5CA5A 1KVIA 4JI4K 3KLEB 4LF9K 2YNGB 3GR0A 4CGHA 4CM2A 3RAXA 4Z7CA 1F3VA 1HWUA 1QLNA 5H9FK 3AGRA 5J2QB 4A46A 2YCHA 5HVHA 4Y1CA 2MHEA 1FTCA 2LU2A 2VQEJ 1FE4A 3PKMA 1RBRA 3A8KA 5IT0A 1U1PA 2LXUA 4LQ3A 1RTJB 1O51A 1M5SA 2NLXA 1JKHB 2ZE2B 4JI3F 1WACA 4NI2B 2HRYA 4GVEA 4HTLA 1RUSA 3MMCA 2JZ5A 3G71S 3AV9A 1CJUB 2QTDA 3SQGA 4DUYK 2XNRA 2GMHA 3TSQA 3VA0A 2BRKA 3L3VA 4DL0C 3C65A 3T1HJ 1KONA 1VJQA 4YNQA 1RAJA 4ZHRA 4DQIA 2DCUB 2KRRA 5D4LA 1MROB 1MA9B 1YRTA 3HD1A 2CQPA 3OYJA 3ZTSA 4ZCKA 4FDFA 4Q0BA 3MAAB 2HHUA 4NLCA 3QZ7A 1X9WA 4R8UB 4DTSA 3SJHA 3HLUA 1VQLS 2QXFA 5FDLB 3OSNA 4QCLA 2WBMA 3VAGA 2YJFA 4EBCA 5F3TA 3DKDA 3E9OA 4JI1F 1X9JA 1YI2N 2I5JA 4H5TA 3P6YC 2R7SA 1FJGK 4B3RF 4DTPA 3U9ZA 1N5YB 2KG0A 3CULA 2O67A 1DARA 3V4IA 1HR0J 4GKKJ 1QSLA 3D0PA 4OZJA 4X4VA 2ZH4A 2M8DB 3CQYA 2X51A 5SUHA 1C0GA 2WVEA 2QL5B 5LJVA 4ID1A 2ZWHA 4O8UA 3CCQN 2O1PA 3N5FA 2W41A 4HUFA 5HO4A 2O5DA 5CAAA 2XRIA 1D3WA 4WTOB 3M9MB 3QBWA 1NK9A 4FWNA 1BMQB 3PW4A 3PYFA 1D8ZA 4QOZB 1BUPA 4RW4A 3RB0A 1T02A 5IT4A 5ETTA 1F9HA 2CJBA 3H7HB 1VIOA 1JX4A 3QPIA 4GC7A 1CJKA 2D74B 2RKIA 3PW2A 3T19A 4V19X 5C2FA 2KT3A 1B0PA 1VRUB 5JXSA 3DOKA 4FK2A 3MM8B 3PY8A 1VJWA 4LF8F 2ZC4A 3H3OB 3DLLL 1VQ7N 4IG0B 3VQ6A 3KKSA 3ETOA 4CI6A 3IN5A 4FWLA 1ZBUA 4M5NA 2NXUA 3R3TA 3ZC4A 3MN9A 1V9OA 4X62K 3PYGA 3HDSA 1HKBA 1FFGB 3BN4A 3ZX0A 2CPZA 3O8WA 2OJ3A 1X31C 3KKFA 3MX5A 4FLWA 4KBOA 3SLCA 2FHKA 5AQSA 1S49A 1QJHA 1NJXA 1RBLA 1ASWA 4KSEB 4DV1K 3N79A 4RU2A 2B5JB 3ZSVA 3VALA 1Q8LA 2W8LA 3G96A 1WDTA 3MF5A 1U6ZA 2EG1A 2Y0SD 2PEBA 5D4NA 2EFOA 3M1VA 2HSEB 1YJVA 4KHRA 5IC4B 4A2AA 3CWJA 3MEGB 4CTAA 1SV5B 4DDFA 1EP4B 1F5BA 1RWKB 3BKTA 1WOSA 2A2CA 1KC8T 4DU3A 2QWQA 4Q43A 4J7CA 4CF1A 2XGQA 2M2BA 3RSEB 3F56A 2HURA 2R7XA 2MSTA 3BO4A 2EFGA 4ECSA 3QEVA 3KLIA 4FJLA 4FS1A 3M4XA 3SAGA 1MWMA 3NHGA 4H54A 4PPZA 3JSRA 4I67A 4IO1A 4K4YA 1YBUA 1LW2A 3U7JA 3DOLB 5KOXA 3HP9A 3LQVA 1M5KC 3BZKA 4CCHA 3DI6B 5L46A 4HI1A 4LF7F 4YOXA 2M52A 4OHXA 5TKYA 3NCQA 4CLFA 4C0BA 1NO8A 5EN1A 3PFEA 1DBDA 2WBRA 3ZZ0A 3SCKE 2GWKA 2DR8A 4F4ZA 3FLCO 3QJJA 1Y3JA 1DTQA 1TUYA 4M3TA 2PT0A 4ZOSA 5HVGA 1RT4B 1F9FA 5LL6d 1JLAB 4DV5J 1YK9A 4NE9C 4DU8A 1Z2LA 4ILLA 2OEJA 1IWAA 4ILMA 2HZVA 4DR6F 2P9PB 3HVTA 3UVJA 1N5VA 3OL7A 3LPYA 4MMOA 3TTDA 4GRSA 1CVJA 4IO9L 3CERA 5LJWA 3WQPA 4C8LA 4CLUA 3E2EA 2YHXA 4BE1A 1H2UX 4L3NA 2KHOA 1Y10A 3FSIA 2VFTA 5CD4H 1SJRA 3CDAA 3OUYB 3NNAA 2FQQB 3HCXA 3C14B 3M6VA 3QZ8A 3NOCA 3HULA 4TVAB 4HVJA 5CE3A 1QVFM 2KH9A 2ZH7A 4E3SA 2HBJA 2CQBA 4A4JA 3WIVA 3VVUA 1WSRA 4BGBA 4M3YA 4NZ0A 1SC1B 4KRFA 5A8KA 3ZLJA 4DTJA 2VPXB 3K0SA 2KKHA 1DRZA 2RD5C 3WQUA 1RT1B 1QSSA 2A42A 4FYVB 2P9IA 3AXMA 5H1SV 3VQAA 4GKJJ 4DS4A 1SKRA 2DNPA 2GAGC 1I94J 2KDOA 1MSWD 5A6PA 4LF4F 4G65A 3VQQA 3U8XA 4J9QA 3OY9A 4MDAA 2ZJQQ 5BYRA 2CPXA 5IQ6A 2FLOA 1FRLA 4AHUA 4DV3K 3I0RA 2CPHA 4QS8A 4DV5K 1LFPA 3M8PB 3S3OA 4LIRA 3ZFVA 1OSDA 4ECXA 4WFBL 3L2QA 3LDPA 3SI6A 3VOVA 4DR5F 3V9XA 1DEJA 4KC5A 2PSZA 2ZC3A 1IKXB 2QEXN 1IO2A 2GIRA 3UKRA 1UEVA 2D1CA 2MGZA 4CEEA 2RQKA 1U8SA 3SUPA 3UIQA 2GO8A 3M7VA 5AJ3K 3DXSX 1M1HA 1S77D 3Q2SC 1GFWB 2V8DA 4UUXA 3UDVA 1E6VB 3GLJA 5KFBA 1WC4A 4I0WA 1CC7A 4P71A 2RE1A 3PR4A 1RDCA 3BO3A 1OH7A 4OMFG 2V8HA 5IOLA 3TUPA 3KJVB 1RHUB 2D9OA 2KFYA 4B9NA 2P6TA 3N9UC 4IH5A 3F0NA 1VC6A 2RRAA 4ZVFA 1S1VB 4DG1B 4MTPA 1BHNA 4NLDA 3J7YI 3TA0A 4MKVA 2F5GA 3CF5L 4USIA 4B9UA 3L2RA 2BJ7A 4DUZJ 2Q1NA 3K89A 4BVPA 2ZM6K 2JVRA 4PQAA 4WPAA 1TL4A 4BBYA 3OXGA 5JICA 5F41A 2MY8A 2HFZA 4EHTA 2DJWA 3CQXA 2KT5A 2UUBJ 3L8BA 2Q43A 4BRAA 3QO9A 1BQXA 4DR3J 1YHQS 3PM9A 4YOUA 5FPEA 2OTJN 2W2PP 4OX7A 4A61A 4ECZA 3HKWA 3BSCA 4DQSA 4DF8A 3R2DJ 3SEOA 4ZCIA 1JLCB 3ZX2A 1XHZA 3OYIA 4BGAA 3SMPA 4IDKB 2HFSA 2XMTA 4HDHA 3O3FA 2FJWA 4OGEA 4DV4J 1Y7PA 3LWLA 4R79A 4RW9A 4WU2A 3N28A 4DV2J 3LDNA 1RT5B 4OI1A 3VGUA 3WX4A 5HRPA 3LOUA 3D0GE 3D2FA 1YTUA 1H2TZ 3MPWA 1G2EA 1IBMK 3C94A 3I56S 2B6AB 1J9AA 2ETJA 2KW4A 4OIXA 3CCEN 3U02A 2CWXA 3UPFA 5JVGL 1K73T 2LQ5A 3IS9B 1WELA 1K9MO 2ZH1A 1K47A 4DPUA 5AZJB 3AVAA 4C8MA 2D0CA 2VPZB 2AJ1A 4DQ8A 4TY8B 2ASDA 4JP8A 3FBCA 2RN2A 3OD2A 1K44A 1RHKB 3FZKA 1VAZA 1RKJA 4YOWA 1N32J 2NZTA 3V5RA 1L3SA 2P51A 1QSYA 1GMWA 2RF2B 1LQ9A 3AVFA 2ERRA 2E5LF 1KVJA 3KG4A 3AT1B 4A59A 3CJAA 2HF3A 2A1BA 1VQKN 2WVBA 2M88A 3EJMA 5IT9Y 3M32B 1KAZA 1VQ9S 3JAMU 3TAMB 2JFKA 1S1WA 2Y8YA 3L6QA 3ATUA 1QQOA 1HNVB 4LSZB 3CIZA 4Y2CA 3W2WB 1M5VC 3SQ0A 1TUVA 1T9TA 1HWKA 3MR5A 4LFAF 4K4ZA 1SH3A 2BANB 4YHHF 2ILYA 3CDUA 3EGNA 1S1TA 1YJWS 2AT1B 3H3NO 3LW5C 3QMQA 1FESA 4CO0A 3THVA 3HSZA 3LANA 4DV2K 3V1QA 4WYWA 1VBZA 3GDQA 4FXWA 2QMWA 1VBKA 1DY3A 1RSCA 4BE0A 4LH4A 4DUTA 2YWFA 3FBBA 2GEMA 4LIWA 4HHJA 3DLGA 4ANCA 1S6QA 1F1BB 4J9VA 3RWUA 4DCHA 5IWAK 3KK1A 4HUGA 1KHWA 4WP3A 4J37A 1VRTA 1W2BR 3QICA 3V9SA 2GHVC 3GCXP 3M05A 4NCBA 1ASUA 4LF6K 3UE5A 3AD7C 2F7VA 3D2WA 4IFYB 1SL1A 3J7Z5 1G4CA 5C42B 3NF8A 2BQUA 4RUCA 1T9XA 1CEZA 1VLOA 2MEWA 3GE1A 1HNWF 3FJ2A 4FO0A 2P9KB 4TN2A 1JLFB 3OYEA 4L73A 4KHPK 3BUZB 4JV5F 2FHOB 3LAMA 3D6TB 1ROFA 1TKXB 4IKFA 2JOQA 3QFUA 1QD1A 5BRDA 5BPNA 1IN0A 2D1KA 2O8DA 2BJDA 1KLNA 2MZQA 4ZIWA 2LECA 3MWPA 3G9CA 2FIUA 3ALYA 3E9LA 3L4IA 3C6UA 3QQCD 3U1MA 3MMBA 1V5VA 4LUBA 4Y0FA 1MWQA 1HBUA 3NFAA 2DH8A 1CULB 2BE2A 2X7IA 4NMXA 4JKCA 4TY9A 3HXMA 3IRXB 1TYQB 4FXDA 1LW0B 4DSFA 4DR2F 1WN7A 3DRRB 3RRGA 1T44A 3EE9A 4YOTA 2PZSA 2ZDOA 3FK4A 4ELVA 3NMUA 4X66K 2M0GB 2ZZNA 4X65K 2UYTA 4CZCA 2FLLA 4FZXC 1ZPVA 2BUNA 2HMIA 4JI4F 5DQHA 4ISFA 5L9NA 2HVEA 4BQZA 2P9CA 1GQEA 1NDKA 3T3FA 1T11A 5A2QY 3MCSA 1FHTA 3TR8A 3TSPA 2RB7A 4BR5A 1R8BA 5KQ8A 5A8RA 4A8FA 5LMUK 1X1PA 4P2FA 4S0MA 2EWHA 3AGKA 2DR7A 1ASVA 5HP1A 4DN0A 4KFBB 4E2FB 2V5HG 1LKZA 3UDCA 4NEYA 5HQMA 2NRWA 2A2DA 2K3IA 2CKWA 2ZOFA 5KPTA 4BDYA 3NGTA 1X8DA 1M5OC 3ZSYA 1OMSA 1EQYA 1NSQA 1RWNB 4DUYF 1HWJA 3QWPA 2R8GA 4YY3F 3BDEA 4PA1A 4Q8EA 3MPDA 3QGHA 4E98A 3PW5A 1XBWA 2R2UA 2YTCA 2AGOA 4PKHA 2MKHA 4C9DA 4U67Q 5GAEP 3AJDA 1NNEA 2ASLA 1X4EA 1RTHB 3Q23A 3OYNA 1ZA1B 4RNMA 5K14B 1PO6A 4NLWA 4U7CA 3FQLA 3G4SN 3LGNA 2DHHA 3Q8PB 3CDWA 2E20A 2F8SA 1S3XA 1ZM3A 1DJ0A 4JOUA 2P9NA 4FPAA 1FJGF 1A7GE 3CCRS 1HBOB 2IBOA 3FMWA 3GR1A 2YNIB 3UN3A 2BDPA 4BG9A 1RAAB 1ZPWX 3KUEA 3NL0A 3C16B 4M5IA 4IR1A 1N5QA 1YQHA 2VWJA 4M5DB 4PXEA 2AJFE 4FSVA 2DGQA 2CNOB 2HIYA 5HJYA 1UL3A 5F9NA 3ZT1A 2J9DA 4USUA 3E66A 3WXKA 3SSSA 4W4MA 4PABA 1N88A 1XWLA 1TKDA 4CEOA 3PEJA 3H5XA 2HVZA 3D28A 2I38A 5GMEA 3TYTA 3GG0A 2CRLA 4GVBA 4B3SJ 4QIWD 5IQQA 4ER8A 4Y6IA 4X4NA 4H5RA 1E6YB 2DNYA 3PVXA 5GAHI 3DCAA 4CYUB 2Q1LA 3MCOA 2WB4A 4FVMA 4NXNJ 2MB0B 4OL8A 1U2VB 2PFDA 3OFHA 4U7UK 4QZVB 3IDHA 3BGRA 3MTKA 4KTWA 2EVZA 1C0TA 4BRKA 2IAJB 1IBKK 4M42A 2YQ3A 2ZHOA 2P1JA 4H5NA 2ZKUA 2ZHAA 4WK1A 2HWTA 3MECB 4PYDA 5BR8K 1U04A 4XH4A 1WSHA 4O0NA 1XR6A 5I42B 2AZ1A 5A76A 4BC2A 3PSIA 2H5EA 2X78A 4JI6K 3KXDA 3MMCB 4X62F 4ZCLA 2R8JA 3AVHA 4EFAC 3HVWA 5F8HA 1EKEA 2FF3B 4K59A 4ES3A 1Z2ZA 2HF4A 3SQGB 4DR4J 2XEXA 2L41A 4F3QA 5AFUA 4DR1K 4XO0A 4LD0A 3G10A 3C95A 4BS2A 3CD0A 4OZ2A 4GKKF 1RT3A 4ZHRB 4G6VB 3VQBA 4E7HA 1CQMA 3GJRB 4DV1F 4Q0BB 4OI2A 4OJHA 4AUKA 2QFJA 1NK4A 3N4WA 4DHVA 2VWKA 4ES2A 2NZCA 4DFJA 4PAAA 4BRFA 4MIAA 3L95X 3AVKA 1WAFA 2AP1A 2GVDA 3CJ4A 1Q5YA 3O2IA 2H4WB 1TL3A 3JTPA 4ZN3A 4DSJA 3POTA 4B3SK 4X4PA 4ZVOB 2G2ZA 3AA8A 3M6GA 3RUBL 3CQ8A 2X3DA 1HBMA 3MUMP 2I5JB 1D9DA 3VAKA 1A6LA 5T41A 3HJFA 4CP5A 3I96A 3G86A 3G8QA 4KIAA 5FLXU 2NXCA 1HMVA 5CYMA 2LDYA 3R27A 2V4QA 2DFEA 4XPEA 1OY8A 2DGUA 2V50A 2HNZA 4HH1A 4LH5A 3HSTB 1F5CA 4MYUA 3HO1A 4R0EA 5DRKA 3CMES 2CFXA 4BR7A 4CZJA 3RW6A 2VPWB 2MKSA 3UR0A 1WSVA 4JI5J 4CH7A 1HNIB 2AW0A 2IBKA 4FF4A 4L8RB 4NLUA 3Q83A 1LK5A 3K2YA 4P75A 3PX4A 1JLQB 3NWRA 1R7IA 1U2FA 4C3KA 3QGGA 2HFVA 2IVPA 1N34J 3VAJA 1UTAA 2ADCA 3LA0A 5KFJA 1YJNN 4UF4A 3DRSB 3H8YA 4H0YB 4F3OA 2RDDA 1BY9A 3R1LA 2Z2MA 3Q2TC 4ERDA 1HLWA 2P9GA 5FPMA 5HI7A 4O8KA 1CJKB 5BRFA 1TAUA 3UI3A 3K5OA 1U09A 3QJLA 4I64A 4JB8B 3JSYA 4CK2A 3DOKB 1KTVA 2AJ2A 2XO7A 1WB9A 2QSFA 4USWA 3I0SA 5HL7L 4ZITA 2P6SA 3OTDA 3K9KA 4URGA 1XMQJ 3K7RA 5DK5A 1JXLA 3ZO7A 1K8KA 4BACA 5EUHA 5F8IA 4WBFA 2KVQE 3HFKA 3MOZA 1F0XA 2V4JA 4FLTA 1HYZA 1DLOA 1KQSM 2X1GA 5I3QA 2E1ZA 3DRYA 2KHDA 4LRCA 1VSIA 1ZZFA 2H54B 2CNKB 3UCGA 3R6LB 3RYLA 4DV6J 4I1TA 1HI1A 3NOGA 4KAIA 3DLKB 3FBFA 2RUSA 5EHHA 2VQFK 4KYZA 3A1YG 2G8IA 1HKAA 2PEHA 2LMIA 4FLUA 3SMZA 4ZLNA 1QE1A 5FD1A 3SPYA 3ITHA 4CRJA 1EKRA 3M6XA 2AX1A 4EGLA 5DM6L 1D5AA 2IM0A 2ZBQA 4LSNA 4HHTA 3KMSA 4USVA 4CTAB 3G6YA 4CGJA 3O8MA 4KPYA 2N4DA 3EE8A 1KN6A 3P39A 9RUBA 1BXNA 3HHNB 4QIGA 2CPEA 4XH1A 3IBFB 2ROEA 3Q89A 4BCAA 3VGKA 3ILIA 3MD1A 3TI0A 1FNXH 3L2WA 3G87A 3PR5B 4JK7A 3T5JA 2YKAA 3DDKA 2ITMA 1MNEA 4CLKA 1J5EJ 2JEGA 4C6AA 1S0OA 3O4NA 3NG8A 4LR8A 4DV5F 3MR2A 3D1QA 2FZCB 1TK5A 2CPFA 3CCQS 4XPCA 1XMBA 4M5KA 4ETZA 3VQSA 4N8NA 3KK2B 4F4WA 4F26A 1OH5A 4K41A 4C1NI 3MXJA 2FJAB 2XI2A 5C10A 2CQ2A 3VF6A 2W9CB 2G8FA 1K0VA 3OJUA 3CM6A 3QT6A 2BJ3A 4O0IA 1ZM4A 5AFUH 1FXXA 4FK0A 3IUCA 5E3PA 4B1YB 2DIVA 3O44A 1S6PB 3ENOA 2FVSA 1KVCA 1L3UA 3U3GA 3OTEA 2YWHA 4TKTA 2MZSA 1DTQB 3M8QB 5HK4A 2XY8A 2UXBK 4YDUA 3EPGA 1RDBA 2DY1A 3WIUA 4M3WA 4EU0A 2IIHA 2PYLA 3UN5A 4B02A 4ATNA 3DLRA 2M5YA 2PA8D 4NRUA 4RNFA 3R7SB 1C1BA 4CJWA 1NBEB 4E89A 1NPRA 1VSLA 3OLBA 3HVTB 4EAHD 5AE3A 4OYWA 4MH8A 2R7VA 2ZM6F 4WXOA 1VIXA 3ZETA 4CJ4A 1VQSA 2RMLA 1C4CA 2AKWB 4CJEA 3T1YJ 1PAEX 4LRFA 2CAJA 3A12A 4YB6A 4P10A 1U7LA 4G1IA 3VQ7A 1VQ4S 1ZBSA 4PUOA 1QY7A 1RK8A 1WUUA 1T0TV 4JKAA 3VF4A 2DGTA 3O1LA 3DJCA 2DTJA 1ESVA 4MO5A 4WQ4A 5F0WA 3EUNA 3L3CA 4AQYJ 5JMVA 4B8AB 2X1FA 2HQCA 5I9EB 2NRTA 4KB0A 2B4OA 2KFZA 4V19J 1XQIA 4OJ1A 2P9IB 4KT0C 4MJKA 2C2EA 4BDPA 4AL5A 2W9BA 1NEEA 2VONA 5C7PA 3LDSA 3T69A 3MDFA 1JLBB 4PG7A 1IBMF 3HL8A 2GGPB 2GQ2A 1NGIA 2Y8WA 3WHIA 5GAGI 3MAHA 2DGXA 3I0RB 4C0OC 3IO1A 2RVJA 3R9LA 2Z30B 4D3HA 3MEEB 3QNWB 2IJFA 3AAPA 5GMDA 2MZJA 4BWMA 4J2BA 3TANA 2VDHA 4AXJA 3VTIA 4ENOA 3GQCA 1H6KX 4Z94A 4LBIA 2FPHX 3D66A 4X4TA 3SUOA 4AHCA 2QTWA 1DTTA 1YJ9S 4BR9A 3W2VB 2ZJPL 3CPEA 3CJKB 2DBBA 1TELA 2OPQA 3HP6A 1BCOA 3S41A 3NGIA 3V6DA 3GJTB 4WYLA 4CM0A 1C1AA 4NX9A 3R6GB 1EXQA 1CJVA 3U9DA 2HRUA 2LQBA 2ATQA 2WTFA 1H38A 4JI7J 4LR9A 3JAMO 2QI2A 3FC9A 2ZNYA 3WXJA 2C3PA 5AQZA 3MI7X 4AQYK 4CVNE 4J9UE 5DS7A 2CQCA 5K5MA 1LFWA 5KOWA 1WD6A 1QQNA 3D3CJ 2PMWA 3EGZA 1V3RA 1XTZA 4DV2F 3BN7A 2Q2RA 2N7YA 2EC0A 1SIWB 1FA0A 3F44A 5EWGA 4BRLA 3NRBA 1RWOB 3U1LA 3AO5A 1N6QA 5GVQA 3NGDA 3AVGA 4G1PA 3J7AP 3MWTA 4CD1A 4L3KA 2VOOA 3UD5A 2GCFA 1YAGA 1REVA 3SFUA 5IWAF 3VAIA 3FCWA 3D1HA 2IS3A 3HM8A 3H40A 4LF6F 1IKWA 2DXEA 1MU2A 1YBAA 2F9DA 3QNOA 2XGPA 3AVBA 5B0EA 3GIJA 1C0MA 1W97L 1WOOA 3BZCA 2QO3A 2Z1GA 4FPBA 3HX9A 3CCJS 1TK8A 4B8CA 4L3QA 2BBEA 4YDDB 3VESA 3WT0A 2IVFB 2HQIA 2IIRA 3QETA 4JS5A 3G71N 1UAXA 5DETA 3D2FB 2NUUG 1ZAXA 3BSAA 3ZZPA 2G9OA 4FW1A 1H7XA 4Q5VA 5M2UA 4PKGA 3A5LC 4BRHA 3CD5A 4F04B 4KHQA 5C2GA 3CPWM 1W2BM 3BGOP 1NGCA 3MM7B 2DNQA 2QEXS 2O8CB 1NWKA 3TAQA 2B4JA 2ZUGA 2DNLA 3KWGA 1VQLN 2F40A 3AA3A 3P1GA 2YKMA 2GO9A 2C2KB 3H59A 4QU6A 3R6MA 3TJ8A 5IM0B 1QDUB 1XIQA 3G6ES 1B70B 1M5PC 2BX6A 1RE1B 1NK5A 2UP1A 2EG2A 3EGVA 3PXGa 1SKUB 1T9WA 3PIOQ 1X60A 2OPRA 5TKWA 1HQUA 3LPUA 1FK9B 3DOMB 4X66F 3IRWP 1S1WB 2OFGX 1MG7A 2DISA 2MZRA 2PE8A 1Z25A 4QWDA 3KKRA 4IFVA 1TAQA 2GQQA 2LCWA 2MKCA 2UUAJ