1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
4CEQA 1JLFB 1ZTTA 2YNFA 4HTUA 5DG9A 4Q8FA 4ELTA 1HMVA 4IG0A 2OZMA 1NK6A 3C95A 4CFAA 3Q8QB 3O4QA 1TK5A 1S48A 2VG6B 4KHWA 3KKRA 1GX6A 1U49A 3LWMA 3HO1A 1LWEA 4NLRA 1LAWA 4DL3A 3DRRB 1D8YA 3DM2B 2XGPA 5KFWA 1BIZA 1RILA 4OLAA 1YVUA 4DWIA 3QGIA 2BQ3A 2HW3A 2C2EA 5L1IA 1RT5B 1TL3A 1RA6A 1RT1A 2HNDA 2UUTA 4IFYB 5KFRA 5HP1A 3TAMB 4Q5VA 2W8LA 2W9BA 3EPIA 4DFKA 4FYDA 4WFYA 2W42A 1HJRA 4ZPBA 5KG2A 5K14A 2BRKA 3NAEA 4TQSA 4J2BA 1HQEB 3NAIA 3OYJA 2Y1IA 4CHNA 1C0UA 2C2RA 3VQBA 3T3FA 1JXLA 3NFAA 3QGHA 2YNHA 4MH8A 4AHSA 4B9MA 2VG7A 5KFHA 5JUMA 1UA1A 3I5AA 4WYLA 3FQLA 4O3NA 4IFVA 3U6FA 1RBVA 5KT5A 3PUFA 4QWBA 2C22A 2B4JA 3KHLA 4ED1A 1ASVA 4KB0A 4FLWA 1X9WA 3QO9B 4LH5A 2YNGA 3HYFA 4GVMA 4CIEA 3BSNA 4AHUA 1QAJA 4EO6A 4NRTA 1KLMB 2FBTA 3H4BA 1IKXA 1JLQB 4J9SA 4LD0A 4ECSA 1JLAA 1FKPA 3V9WA 1DLOB 1UWBA 3OS0A 2R8IA 2LSNA 4K4TA 4TYAA 2OPPA 3MR6A 4IKAA 4E19A 2GIQA 4OGEA 2OPQB 4K8XA 1K1SA 3QGGA 4KHSA 2R8GA 4KFBB 4PQUA 1T7PA 4EEYA 3DLEB 4CEAA 4XPCA 4RZRA 2A1SA 4J9RA 3K5LA 4C8LA 2JLEA 2W7PA 4TY8A 4MQ3A 3M8PB 3M8RA 3NH1A 1IKWA 2IC3B 4K4WA 4PUOB 1S6PA 3KMQA 2AGPA 3OJUA 1EETA 4KO0A 4KHMA 4HCBA 1SL2A 5EUHA 2NUBA 3IAYA 4XIUA 1QE1A 4CJRA 4O4GB 4W5NA 5C42B 3C6UA 4DQRA 4IR1A 2FVQA 1ZETA 3ZSYA 1KSPA 1S1XA 4Y34A 3KIOA 2XRIA 5FROA 2G8FA 1RTDA 1CZBA 2IA6A 3RBEA 3DRSA 4ID5B 2ASDA 5EWEA 1KFDA 2G8WA 4NCAA 2V0NA 3C6TA 4ZVHA 4HUGA 3HHKA 3NGYA 2Q3SA 4B8CA 3QYYA 1RTIB 2HNYA 1HNVA 3KK3B 4FLVA 3SNNA 4FK2A 1KVCA 3OL8A 2YKMB 4TN2A 1LW2A 3RB4A 4HHTA 3SCXA 4ECYA 3CIZA 4CJLA 3QLHB 5KFQA 5L1LA 1SH0A 1U09A 3OYIA 4E1NA 4ZVFA 4K4XA 5DLFA 4F4WA 3IS9A 4DL2A 4ECVA 4KHQA 1BGXT 1W9HA 2ILYA 4CJ4A 2DPJA 1RAJA 2XO7A 3OS2A 3LZIA 4BDPA 3BR9A 4NYNA 3SPYA 1FXXA 1RT2B 4RW8A 1QSLA 1BQMB 4ZP9A 4FS2A 3LPTA 5C25B 3HVTA 5F8GA 4J9MA 4QAGA 1RNHA 1IKYB 1VSEA 4OKJA 2HVHA 1TKXB 4ED6A 1RTHB 3KLHA 1VSFA 1JKHA 3OJSA 4EYHB 1X9SA 1D5AA 3MFHA 4E7JA 2J6TA 3HM9A 3RR8A 2R8KA 1QUVA 1VRTB 1KVAA 3RRHA 3RMDA 1WSIA 1TL1A 2ALZA 4CJPA 5KG5A 3SQ0A 4N5SA 4GMJB 3KK2B 4NLOA 2HAIA 4FJGA 3VQDA 3IRXA 4M3UA 3S3NA 1HYZA 4I2PA 3KLGB 3IGNA 4JV2A 3LP0A 3QIOA 4CJVA 1IH7A 4FJHA 3H40A 4LQ3A 1S49A 2UVWA 4FJJA 1T05B 4MKBA 2R8HA 2XY8A 1W25A 3F9KA 1LW0A 4HCCA 3QEVA 3ZT2A 4FZZA 1BQNA 1TV6A 4JV0A 4ECZA 3K5MA 3PR5B 2IM2A 5F8JA 4IBNA 4F3TA 2HNZA 3PV8A 4J9QA 4NCGA 2FVSA 2D7SA 4AHCA 2D0CA 5KFAA 3ZSWA 4B9LA 1S97A 2KZZA 2VWJA 1JXEA 3MECB 1GOCA 4KKOA 4KHUA 5KFLA 3DOLA 4GC6A 2XHBA 1D0EA 5DGAA 3T5JA 3AA4A 5KFNA 5J2MA 4URGA 2P5GA 1T03A 5KFMA 1D9FA 4BE1A 3NAHA 1MU2B 3VN5A 2ZE2B 4ZTFA 3I0SB 5HRNA 4NLYA 5HRPA 1CXQA 3DYAA 3IGVA 2BRLA 3LPUA 3ITHB 5L9XA 4FZXC 5KFIA 3HXMA 1TKZB 1RCHA 1S1UA 3HP9A 4KPYA 2HB5A 4WFZA 4K4ZA 3VA3A 4KSEB 2YHAA 2IDOA 4G1QA 1EX4A 1VSMA 4KTWA 3VQSA 5KFVA 1BCMA 3AVNA 4OKKA 1HARA 2HHWA 2FBYA 5J2NA 3G0ZA 3H5YA 4I7FA 2ETJA 1RDCA 2P51A 3E01A 3PJXA 4ZPCA 4DL6A 2PYJA 3MEDA 4O3RA 3GIKA 1CXUA 4HYKA 1JLEA 3H98A 4F4YA 4CEEA 1S9GB 3OYAA 4E7KA 1JLCB 4B9UA 4ED8A 3OL9A 4WE1A 2R2SA 3HJFA 4OVLA 3V1OA 1WNSA 1KHWA 2X6NA 1C0TB 3KHRA 4CGIA 4FW1A 1XC9A 3Q8RB 3KNAA 3M8QA 5DQHA 4RNMA 4GW6A 3EY1A 4DTUA 4KV8B 3V1QA 3OYLA 2BE2B 3V4IB 4O55A 5CZ2A 4NLPA 5FDLA 1RT4B 4KTZA 1U47A 2WOMA 3L3UA 4PWDA 3K59A 4JS4A 1Y97A 2B43A 3K57A 1DTTA 1S0NA 1SUQB 4DU1A 4DF8A 3BSAA 2WONB 3KHGA 1A5WA 4MFBA 2OPRA 1VK0A 3ISNC 3QERA 4LH4A 2D0AA 4YP3A 2CKWA 3V6DB 2KZMA 3M9MB 1J5OB 4DTOA 1I6JA 4NLSA 1D1UA 1RT7B 1FKOB 1TKTA 5KFFA 3O3GA 2BGGA 3O3FA 3GQCA 5DQGA 3C94A 4DFPA 4M3YA 4HUEA 1NJXA 3KJVB 4RW7A 3DI6B 4DSKA 4CEDA 3BSCA 4ZVEA 5T14A 3BJYA 2OPSB 1JL2A 4NLDA 3P5JA 4C8MA 4JRPA 1RBUA 2YNFB 4HUFA 3HPOA 3AVMA 3B6PA 1F21A 5CYQB 2FJVA 1TK0A 5E41A 1B9FA 2EHGA 4FJMA 4QW8A 3ZSVA 4DU4A 2ZD1A 3PO4A 3OYDA 1S1TB 1TVRB 2IAJA 1VSDA 2IM1A 4KAIA 5F9LA 4CF1A 1LWEB 1YVFA 3L3VA 3V6JA 2RF2A 4O3OA 3H2LA 1NNDA 3S9HA 4IG3A 3E51A 5KT3A 3QETA 5J2QA 4J2EA 4N47A 5F8NA 2FC0A 4LQ9A 4ZVGA 1TL3B 4JRQA 3HVRA 4OGCA 2UVUA 4M3TA 4IRDA 5KFZA 3JSMB 1S0OA 4NRUA 4KBIA 2KW4A 3OYGA 2B5JA 4EBDA 4RW9B 5K14B 1S6QA 1FK9A 1J54A 4DS5A 3LAMA 4AILC 3NMAA 1C0UB 4RNHA 2X6SA 4FJ9A 1S1VA 2O4IA 4BE0A 3VQ6A 4FBTA 2RKIA 4O3PA 2YNHB 5KRTA 1UA0A 2F8SA 3PZPA 2VG7B 1L3TA 3TABA 4HKQA 1N6QA 4NLXA 4IFVB 1RYRA 4CJWA 1IKVA 1HYSA 4DLGA 3SV4A 2RN2A 1KTQA 2Z1IA 1NJWA 3H5SA 1NOYA 3VQQA 2YNGB 4TSXA 3LP2B 4E3SA 3SFGA 4YQWA 3N6MA 1JLBB 1IKXB 4WZMA 4CHPA 5DG8A 3NBPA 1JLAB 1KCFA 4NLTA 1FKPB 4EO8A 3CJ0A 1UWBB 4IH7A 5L1KA 2W9CA 4IOBA 1J9AA 5HRSA 1S1WB 3KLFA 1N56A 2BQUA 4DTSA 2FBXA 1WAFA 3V6KA 1XI1A 5SWMA 2E9RX 3QIPA 4ED2A 3OLBA 1VRUB 3QIDA 1CZ9A 4Q0BA 5I3UA 1JX4A 2JEIA 4R5PA 4O3QA 2KTQA 5HLFB 2XCPA 3N6LA 3HPGA 3PX4A 4UQGA 2FJWA 4RNNA 4RNOA 5DMRA 3RR7A 4ZTJA 3VQ9A 2D3UA 1S6PB 4KB1A 1HPZB 2D5RA 2BANB 1ASWA 4U6PA 3K5OA 4KTQA 5EWGA 1QE1B 3DRPB 2FLNA 3PO5A 4CHZA 3KLIA 3P83D 3I0RA 4XO0A 2C28A 4AHVA 1LWFA 1JL1A 1IO2A 3TARA 2WRMA 4M3ZA 2IGIA 2E9ZA 2XC9A 1HQUA 1S1XB 3GIJA 4OJRA 1SV5A 1ZYQA 2KFZA 1U04A 4CK3A 2PYLA 4H4OA 2OZSA 1L3UA 3V9SA 1LAVA 5I42A 3DRSB 4ECXA 1Z26A 3RWUA 4NZ0A 4B3OA 1T3NA 1C1AA 4DTRA 3C6TB 1ASUA 2R2TA 4J9NA 3K5NA 4CJFA 1XWLA 4I2QB 2HNYB 3OYCA 2IOCA 1OS5A 1NK5A 2GUIA 4ZPAA 1RYSA 3VQ5A 4F4KA 1LW2B 1R0AA 4CJUA 4ICLA 1IG9A 3RBDA 3CFOA 1RBSA 3SZ2A 2I5JB 3IS9B 4DSIA 4ZMMA 3QEPA 5C5JA 4F3OA 2HMIA 4RW8B 1WSJA 1SH2A 1ZBFA 2DPIA 3HVTB 4EP4A 1S5JA 3AVGA 3KLHB 2W9AA 3AVJA 4Z4HA 2FLPA 2B6AB 1L3VA 5F8HA 3ULDA 4R0EA 1Z25A 5JS2A 3L2VA 2IMWP 4TYBA 4IRCA 3SPZA 1RA7A 5KI6A 5DK5A 2XWYA 1SKRA 2DTUA 4TXSA 2AJQA 4EZ9A 3IRXB 5C24A 5KFOA 3PW4A 3FSIA 3NCIA 1S4FA 4I2PB 3LP0B 3DLGB 4FLTA 1KHVA 3KD1E 1WSGA 2YHBA 3AVIA 3HL8A 4CEBA 2AWZA 3D5MA 4RW4A 1WAJA 1LW0B 1HNIA 3ZCMA 4Z4GA 1TV6B 4CEOA 3OHAA 3OYBA 4M3XA 2F8TA 4H4MA 4G3IA 1RBTA 4RW6B 2HNZB 4NCGB 3HVWA 4DG1B 2BR0A 4FJLA 2WK4A 2DFEA 3MXMA 3NF8A 1BHLA 3TWHA 1EP4A 3LP1B 3DMJA 3OYEA 4ED7A 1SKWA 4BE2A 4KKOB 4LSNB 1WSHA 4URSA 2ZQBA 1S9EA 3RB0A 2HHXA 4QPXA 3V9UA 3H59A 5J2MB 5FRNA 5F8LA 2OPQA 4F2SA 2ASLA 4FLXA 5HBMA 4I9QA 2JGUA 3H08A 4DQSA 3KK1B 4RU9A 3DYAB 3PVXA 5J1EA 2WHOA 3QZ8A 2D41A 2YNIA 1S1UB 3FQKA 3OY9A 4CJQA 2IC3A 3ZT3A 4ZP8A 3VA0A 3QINA 2XI2A 2E6LA 4ZP6A 2VWKA 4N56A 5KFUA 3JYTB 4CGGA 4I7FB 3V81B 4FM1A 5DQIA 4FLUA 3AVCA 2W8KA 3MEDB 2G8HA 2IBKA 1IM4A 5J2PA 3FFIA 1C1CB 4CGFA 1JLEB 4URQU 1WSFA 5D3GA 4WE1B 3O3HA 4W5OA 2P1JA 3VQ4A 3M8QB 3DLHA 5FRMA 3OVNA 4PY5A 3SUOA 4QOZB 3Q8SB 4DTXA 1SKSA 3NL0A 4EBCA 3CDUA 3KK3A 5FDLB 4N41A 4BDYA 1C6VA 4PWDB 1RTJA 2YKMA 1B9DA 2OA8A 4O44A 1CLQA 2O4GA 4OPJA 3ISND 2Z1GA 3QLHA 3IG1A 2OPRB 4FM0A 2ILZA 2OYQA 4Z0UA 1MMLA 3FDSA 4B9SA 3BQ0A 4J9PA 3AO4A 5KFYA 3WNEA 3M8SA 2IM3A 3SQ2A 2J6UA 2PZSA 4IDKB 1TKTB 3H5XA 3CQ8A 5C25A 3T5HA 4W5RA 4ZHRB 5EWFA 4NYFA 3CG7A 5KFTA 5JXSA 3PW0A 1RT3B 4RW7B 3VQ7A 5KFPA 4ECUA 2QXFA 1WSEA 3MAQA 1QQCA 1VSLA 4ED3A 4CFDA 1VRTA 2JC0A 4CK2A 3CJ5A 4CFBA 3TAEA 4AH9A 3L2UA 2AGOA 1S0MA 5KG0A 1O1WA 2XY7A 1EXQA 3HT3A 2DY4A 1ZBHA 1QS4A 2IJFA 2D3ZA 1S9FA 2YKNA 3IN5A 2ZD1B 3KLGA 4IKFA 3NGZA 3UR0A 2FVPA 5KGWA 2RF2B 3BGRA 3O4NA 1ZBUA 4IG3B 4O0JA 4O5BA 1NKEA 5J2QB 1T05A 4CFCA 2P5OA 4DSFA 3SUQA 4FJNA 3AVLA 3QEXA 5HROA 4PA1A 4EP5A 4FXDA 2GIRA 1QHTA 3K2PA 2BQRA 2QKKA 3KHHA 3PW2A 3D45A 1N5YA 1RDBA 3S3MA 4FZYA 2HHSA 3OYKA 2B5JB 1ITGA 4KE5A 3ZSOA 1FK9B 3CJ3A 4MIBA 4QWCA 1X1PA 4J2DA 3ZT1A 5F9NA 4AHTA 1DTQA 3MECA 4TY9A 4U7CA 5F8IA 1J53A 3ALYA 5KT4A 1C1BB 4EZ6A 4DSEA 1N6QB 1HYVA 3PW7A 2QK9A 3AVKA 1IKVB 2R8JA 4DSLA 4Y3CA 4QWAA 3KMSA 3OL7A 3LAKA 3I0SA 4YNQA 4H54A 3AVHA 1QSYA 3CJ4A 4O3SA 4LY7A 2OH2A 1TKZA 3EZUA 4BWMA 3GILA 1HMVB 4IG0B 4KB7A 4CJSA 3QZ7A 2Y1JA 5KFSA 3NKYA 2A1RA 3SQ1A 4LSLA 3NBPB 4C8OA 4OLBA 3DLBA 3NH0A 2UVRA 3D28A 5HRRA 2W9CB 4DTJA 1BCOA 3TAQA 2CJQA 3OSPA 4B9NA 2RDJA 3BREA 3SFUA 4FJ7A 4O4RA 4WYWA 4DL5A 1I39A 4CGHA 4CK1A 1KRPA 1LWCA 5KG4A 4Q0BB 5I3UB 1RT1B 4R5PB 3V9ZA 1RT6A 1XR7A 2HNDB 1ZBIA 3RAXA 3ASMA 4DS4A 5HP1B 2W9BB 3AO3A 4CF2A 3H5UA 4YR3A 1VSKA 3ZSZA 4B9TA 4B08A 3V4IA 4DQPA 2HHUA 1Q9YA 1ZBLA 1RT4A 1WLJA 4C8NA 1L3SA 3OYFA 4F2RA 4Z4FA 3THVA 2J6SA 3EZ5A 3U3GA 4CJ3A 1SH3A 3KLIB 2HWIA 5EDWA 5KFGA 2XY6A 2EX3A 1LWFB 3DLKA 1NK7A 3GIMA 4NLGA 3TI0A 1HQUB 4M3WA 1SV5B 3UPFA 4H4OB 3BDPA 3ICLA 4QWEA 5CYMA 3QEWA 5I42B 3EYZA 4DFJA 2JEGA 3BQ1A 1FKOA 4B3OB 1JLGA 2UVVA 4AHRA 3L2QA 3V9XA 3NF9A 3AVAA 1TK8A 4NLUA 4ECTA 4ECQA 4QWDA 2VG5A 1S10A 1VSHA 4Y1DA 3I5CA 3KLEA 4GC7A 3DOKA 4FVMA 4M42A 3SUNA 2HHQA 3LZJA 3RMAA 4JS5A 3ZSRA 4ICLB 1BI4A 2OPPB 1U4BA 4KREA 3M9OB 4IRKA 3MEGA 3N6NA 4KHNA 3SYZA 4DLEA 2G8UA 5CYQA 2R2UA 4PQUB 5L1JA 3HKWA 1REVA 3MEEA 1T8EA 1S1TA 1TVRA 1NKBA 2HMIB 1BIUA 4TY8B 4TQRA 4HVJA 1IKWB 1A5XA 3CDEA 1LV5A 4E7LA 2HHTA 4F4XA 4KAZA 4DQQA 4DMNA 2F96A 1EETB 4KO0B 3HP6A 1D9DA 2IM0A 2W7OA 2AQ4A 4MKAA 3JSMA 3F73A 4EBEA 1N48A 4YR0A 3OHBA 4RW9A 3C6UB 4J9KA 3AO2A 4TLRA 3CM6A 2PY5A 3L2RA 3RB6A 4ECRA 2GC8A 4KHRA 5C24B 4ID1A 4Q45A 1TGOA 4N76A 4DFMA 1RTDB 1NHUA 4QCLA 1NHVA 4K4YA 2O5DA 5KG7A 1KVBA 2JEFA 5KFXA 3RMBA 1UAXA 4RW4B 4OKEA 1HNIB 1HNVB 3CDWA 2JEJA 4RG8A 5KG1A 4KHYA 4OPKA 4XPEA 4F8RA 4H4MB 2ASJA 2X74A 1WNEA 4CGJA 3MTKA 3OYNA 3CFPA 4R8UA 4WXOA 3MR3A 3LP2A 1JLFA 2IS3A 1NK4A 4I9LA 3G10A 1JLBA 4MK8A 4CJEA 3V6HA 3MFIA 1RDRA 2G8VA 1EP4B 3DMJB 3AVFA 3VQPA 2ITGA 2VG6A 4JUZA 4W5QA 3TQ1A 2QE5A 3V1RA 1BL3A 1S9EB 1C2PA 1S1WA 3DRRA 3DM2A 2GV9A 1SL0A 2HWHA 1NOZA 2GBZA 4OL8A 1U45A 4BDZA 1Q9XA 5HBMB 2X78A 1VRUA 3QESA 3TANA 1JKHB 1KLNA 5JS1A 1RBRA 1RT5A 4FS1A 4NLWA 4ZP7A 4M94A 3KKSA 5J1EB 5HLFA 1NKCA 4IFYA 3TAMA 2V4RA 2YNIB 1TL1B 4DTNA 3QEIA 3RRGA 4EYIB 1HQEA 4ECWA 2V9WA 4FM2A 1HPZA 4WXWA 2BANA 4Y1CA 1QSSA 3GV8B 3NF6A 4DL7A 1Z4UA 3DRPA 3KOAA 4RUCA 3VQ8A 3P1GA 4FJXA 4WFXA 4CHQA 4ED0A 3MXIA 1XHZA 1GOBA 1NJZA 3G6XA 5J2PB 3FFIB 3D0PA 2G8KA 1BQNB 3L2WA 3OYMA 2AU0A 3LWLA 3AA3A 2F8EX 5D3GB 5T7BA 3T19A 3QO9A 3BSOA 4RNFA 1B92A 3PR4A 5KGXA 4IH5A 3PW5A 4IH6A 1TAQA 1KLMA 3CJ2A 4WZQA 4I2QA 1TP7A 4CIFA 3GV5B 1JLQA 3HVAA 3T1AA 1HRHA 4CGDA 1K1QA 1XR5A 4X2BA 1RTJB 4YR2A 1DLOA 3OYHA 4O44B 3DOLB 3BQ2A 2I5JA 1T03B 1VSJA 3ZT4A 3SUPA 3IG1B 4E89A 2XGQA 1QAIA 2DFFA 5KRSA 4KFBA 3L8BA 4FLZA 1SL1A 3DLEA 1TKDA 2XCAA 3OS1A 3WNHA 3M8PA 3WNGA 1NK9A 5KG3A 4K8ZA 3PX6A 1Q8IA 4PUOA 4J2AA 1XR6A 3GV7B 4H8KA 4E7HA 4M45A 4G1QB 3VQAA 2B6AA 2HHVA 3LALA 3MR5A 4FJIA 4FK4A 2ATLA 5J2NB 1EKEA 4Z4IA 2RDIA 4K50A 2KFNA 4MIAA 3RTVA 4MK9A 5KT2A 3E01B 4O4GA 1UOCA 5C42A 2ATQA 4ELUA 4L8RB 3AO5A 4NLVA 3TVKA 4CCHA 2RPIA 4DL4A 2YKNB 3CM5A 2R7YA 3NGIA 2FVCA 1G15A 3ZT0A 5KFKA 4CIGA 5KFDA 3DLGA 4IR9A 4ID5A 3G6YA 1BISA 3BGRB 4ZPDA 4Q8EA 3CWJA 4MK7A 4DQIA 5DLGA 3HK2A 4CJ5A 1RTIA 2AX0A 5HROB 3SJJA 2WOMB 1YTAA 2ZKUA 3OLAA 5KT7A 4CEZA 4CJTA 3RB3A 1N5YB 4RW6A 3I5BA 2IJNA 4DG1A 1DTTB 3NDKA 3QNNA 4MFBB 4J9LA 2HVIA 4CERA 1TQLA 1T94A 4CF9A 3LP1A 4Z4EA 2R2RA 3M9NB 1DTQB 5KG6A 4LSNA 2E6MA 1A5VA 1RT2A 3KTQA 1BQMA 1NJYA 4QW9A 1QTMA 4CHOA 3WNFA 4DSJA 1IKYA 2EC0A 1TKXA 4DF4A 3AV9A 1RTHA 3U3YA 1N4LA 5EU7A 2D0BA 4CHYA 1VSIA 3DDKA 3TR8A 1X9MA 3KK1A 2FLLA 2YV0X 5KFBA 3MXJA 4NCBA 3LANA 4BACA 5KFCA 4Y2CA 5SZTA 3S3OA 4FK0A 3HSTB 3KK2A 2Z1HA 3GIIA 1NK0A 2AX1A 4LSLB 4E1MA 1U48A 1CSJA 2IAJB 4E0DA 4M41A 4Z4CA 3JYTA 4B8AB 4F50A 3V81A 4KRFA 4CJKA 2Z1JA 4O0IA 3TAFA 3DLRA 3MF5A 1YT3A 3TAPA 2VA2A 3K58A 4FBUA 3NF7A 1LWCB 1C1CA 3NE6A 2WCXA 2V4QA 4FJ8A 1RT6B 3NGDA 3CVKA 4F4ZA 2E9TA 2QKBA 4BWJA 3GYNA 3UQSA 3OSNA 1GOAA 3TAGA 1S6QB 3G86A 4FJ5A 3EPGA 5DG7A 1ZTWA 4K4VA 4Q43A 3CFRA 1S1VB 2RKIB 4JV1A 3PHEA 4YMEA 1WN7A 4W5TA 4K4SA 4M3RA 3VQEA 5KT6A 4CF8A 3DLKB 1KFSA 1HYSB 2WTFA 3ZSXA 3CYMA 4FLYA 4ELVA 1MU2A 2UUWA 2ZE2A 2FJXA 4CEFA 4Q44A 3PJWA 2JC1A 4IQXA 1NK8A 5CYMB 3ITHA 4K4UA 4IDKA 3MR2A 1JLGB 4ZHRA 2E4LA 2KQ2A 2C2DA 4RUAA 2FBVA 3SQ4A 4KI4A 1TAUA 3SI6A 3OL6A 2VG5B 1XHXA 1RT3A 3KLEB 2XI3A 3DOKB 3I8DA 3UIQA 3Q8PB 3AVBA 4FCYA 2FVRA 3QNOA 3PY8A 3RAQA 5KTQA 3LDSA 3NHGA 3T5KA 1BI4B 4CECA 3KLFB 3MEGB 2WB4A 4B9VA 4FW2A 3T5LA 5F8MA 3AA2A 3AO1A 4NLQA 3QIPB 3G6VA 3RMCA 4DTMA 1JIHA 2I1RA 1REVB 3FRZA 1S9GA 3KLVA 3MEEB 1JXBA 1JLCA 3KD5E 1C0MA 1C0TA 3B6OA 3PX0A 5KFEA 3ZSQA 4KV8A 5KFJA 2BE2A 5CY4A 2AGQA 1YTUA 4M95A 5CZ1A 3HPHA 2BDPA 1RDDA 4Y2AA 3LP3A 4NYZA 4C8KA 2XY5A 4KI6A 4E7IA 3H4DA 5DGBA 3I0RB 4DTPA 1SUQA 2WONA 1GX5A 2VA3A 4CF0A 1W0HA 3V6DA 1I3AA 3VQCA 1J5OA 3UDLA 4CESA 1C1BA 1K6YA 2G8IA 1RT7A 3CO9A 4JLHA 2QV6A 1L5UA 1RDAA 3SI8A 3NH2A 4YFUA 3AA5X 4DU3A 4DEZA 4CE9A 3KJVA 3DI6A 3A2FA 3SV3A 2OPSA 4FJKA 4R8UB 2DFHA 1R0AB 4J9OA
chains in the Genus database with same CATH superfamily
1NRKA 1ZTTA 3TA1A 3CD5A 4GKKK 5DG9A 4ELTA 1HMVA 2OZMA 2DNRA 1NK6A 1F2HA 4KHPF 3JXUA 1TK5A 3WC0A 2VG6B 4KHWA 2GHPA 4P71A 3LWMA 1NDLA 1A9NB 2MZ1A 4DL3A 1QM9A 5AQMA 4QU7A 3DRRB 1D8YA 3PRDA 4DR5K 1H0HB 3VZHA 4OLAA 2CJYB 3QGIA 1NG9A 5IM0B 3HX9A 1RA6A 2DGWA 4AL7A 1NPPA 2HNDA 5BPLA 4DZDA 4IFYB 2GVDA 3N28A 5K14A 3NAEA 3SLCA 1HQEB 4CT9A 2OSQA 4Q2MA 3OR1A 5E2QA 2CIMA 1JXLA 2E2PA 1YWXA 3NFAA 5LMUF 3VAJA 2HLTA 3NOGA 1WI8A 5KFHA 2GWKA 3DXKA 3W3DA 2LEAA 2CNLB 3UR3C 4B3MF 2R7SA 4M63C 1RBVA 4EK2A 5B0AA 5KT5A 4QWBA 2B4JA 4DV2J 1X9WA 2LQ8A 3M30B 2J8AA 2F4VJ 2UP1A 3D2EB 2YNGA 1IUJA 4A62A 2E7VA 2L08A 3Q8YA 2O8BA 4AHUA 1QAJA 4EO6A 4OHWA 3JTNA 5DO2A 4U7UK 3OPKA 4OZNA 4JI3J 4XTTA 4J9SA 3QWPA 1FKPA 2O8CA 5L46A 1WD6A 4CLPA 3I33A 2B9XA 2MGZA 4LF7K 1XNRK 2OPPA 5GAGU 2Y3YA 5AZJA 2FHJD 4OGEA 4K8XA 3EGNA 2KRBA 4OJ1A 2A5XA 2EG2A 5FD1A 3U9ZA 4EEYA 4XPCA 2X1GA 2A1SA 2E1ZA 1X4HA 1QQOA 3F9MA 2KJVA 2A0FB 3M2UA 4K41A 3C66A 1VHXA 1IKWA 3QSIA 3D7SB 5A2QU 3CCZA 4PUOB 1RABB 5AQUA 2AGPA 1WSRA 1SL2A 3MHYA 2NUBA 4XIUA 1MROA 4FF2A 2P6TA 1QE1A 2UYTA 4BRPA 4DR2J 3GG4A 5GVQA 1MN9A 2UXBF 4TLQA 2XTJP 3WEEA 1JJCB 3R6GB 2FVQA 4BC9A 2NS1B 4FNHA 3ZSYA 3FC9A 2MQPA 1PGZA 4DR1F 5FROA 4I0WA 1RTDA 3RBEA 4MO4A 2ASDA 5EWEA 3GL1A 3HHKA 4E2FB 4B8CA 3QYYA 5D8HB 1HNVA 3KK3B 1NGHA 2OEMA 3IUCA 2DT9A 1Y00A 4GO5X 4HT5A 1VGYA 5CE3A 4HHTA 3L9ZA 1NDPA 3SCXA 4BG8A 3NG8A 5L1LA 1U09A 3NCRA 1U0HA 2K1RA 3A13A 4DL2A 4JI6K 1P9YA 3ZXWA 1BGXT 2ILYA 3FLCO 4O5FA 1RAJA 3OS2A 3SPYA 2MZJA 1BQMB 4FS2A 4B3RK 2F40A 3NGRA 4QAGA 5G4DA 3M32B 2F4FA 1U25A 2UV8A 3KLHA 1JKHA 3OJSA 4UUWA 1X9SA 1FJCA 4P72A 5M2PA 2R8KA 4USMA 2DXDA 1QUVA 3RMDA 2P9GA 2H54B 1Q86T 4FXWA 4GMJB 2DRDA 2CDRB 2C2NA 1HBMB 3UN5A 2X7IA 3PIOL 2VUGA 2N7CA 2VBYA 3QIOA 4CJVA 1IH7A 3NWGA 2ZH2A 1I1GA 3D54A 2XY8A 1LW0A 4XDDA 2VICA 1BHNA 4FZZA 5LJ5Y 4ECZA 4J37A 4JV0A 4BC4A 1BY9A 2P5VA 1UPMB 4FF1A 5F8JA 4ILLA 2UXDF 3NWRA 4J9QA 1FXDA 1V3SA 2FVSA 4AHCA 2JRSA 2NNWA 1J5EJ 3H25A 2J7KA 4F3QA 2BUPA 1YXQA 2VWJA 1QLNA 1RLCL 4DPWA 4DV4K 4KKOA 4KHUA 3KFWX 3PG9A 3QMLA 1VC0A 2MKJA 5AQTA 3H20A 5DGAA 5EOYA 1TL7A 4XEIA 3TVYA 2XULA 1MU2B 1PG5B 1R6VA 4NLYA 1MNEA 1UZDA 3G4SN 1WB9A 3RUBL 2HHHJ 3LPUA 4FZXC 3LOUA 1QTNB 1IR2A 1S1UA 4YOVA 1YBUA 3RJMB 2FTRA 2MSTA 1K9MT 4KPYA 1NUEA 1HR0K 2IDLA 3VQSA 1BCMA 4WP3A 3MX5A 3J80O 5LOQA 3H5YA 2P51A 3E01A 2BJ9A 4G9ZA 1E6VA 5KQ8A 2L3MA 3WX4A 4F4YA 4CEEA 1S9GB 4ED8A 2BVZA 2LQJA 3QPIA 4OVLA 3V1OA 2OO4A 1WNSA 1HWLA 3SDEB 3UO0A 3VZIA 4C0OC 4CGIA 1HI8A 3KNAA 3OYLA 2A6OA 4NLPA 5AQWA 1TL4A 1PJ6A 2ZZNA 1S7IA 1RU2A 2C3OA 4JS4A 3MX2A 2B43A 4X66J 1SJFA 2DIUA 1IWAA 4DU1A 3M2RA 2U1AA 3OW2R 4MFBA 1HW8A 3HZGA 4YP3A 3IFEA 3H6EA 2UUBF 1Q86O 1VBZA 3V6DB 2X3GA 2KZMA 2F9DA 1RT7B 5M1KA 1V9OA 2BGGA 1C4CA 2PMHA 2CJXB 2IVYA 2Q36A 3RYLA 3HMJG 2VWBA 3KJVB 2MTLA 3BSCA 2OPSB 1NPRA 4H0OA 1JL2A 2F7VA 1RISA 3P5JA 4C8MA 5J1PA 4M5NA 1DY3A 4A2AA 5E41A 1W7WA 3W9JA 2EFOA 2EHGA 1ZAVA 4QW8A 2E29A 4P9SA 3OYDA 4KAIA 2HK3A 1BA1A 4CF1A 4OMFG 1LWEB 3L3VA 3B82A 3CXCR 3VV2B 3H2LA 1NNDA 2HQ3A 3GZ7A 2MKKA 3D4JA 4N47A 1RKIA 5F8NA 4LQ9A 1M5OC 3HOSA 1TUUA 3A8YA 5JJBA 4M3TA 5KFZA 3JSMB 4Q7AA 3EKUA 2D69A 3OYGA 3FEXB 4JKAA 1XMBA 3W8GA 4YOUA 1IN0A 1SBRA 1FK9A 2BM1A 3LAMA 4AILC 1JJ2R 4RNHA 2RSQA 4BR4A 1K9MO 1S1VA 3V2UC 4FBTA 1PBAA 4I4BA 2CH5A 2YNHB 1UA0A 4QS7A 3PZPA 1HA1A 2HMPA 4HKQA 4L3QA 4CO4A 4FPRA 4CJWA 3L4QA 4ALZA 3SV4A 2RN2A 4M7XA 3SQGA 3ILJA 4ED5A 1F6TA 2Z1IA 2M8HA 2NLWA 4BRLA 3IAM9 3MUMP 1Z2LA 4WU3A 3DHWC 4ZS6A 4TSXA 3LP2B 4E3SA 3SFGA 4YQWA 3BYRA 3MMVA 4LF2A 1GXTA 4CHPA 5JVGQ 2YX1A 1WUAA 3W60A 3CCRS 3W5YA 2QC3A 4JKEA 3GE9A 1RAAB 3G25A 1UWBB 5L1KA 4FWKA 2W9CA 3B8HA 3LGMA 1S1WB 3KLFA 4KR0B 3AY0A 2FBXA 3V6KA 2QEXN 1WSVA 2VQEK 3QIDA 4L3NA 4FNIA 5I3UA 2RILA 1YJ9S 4R5PA 4O3QA 2RQ4A 3ELHA 2KTQA 4ZOSA 3TVZA 2YXLA 1FKAF 3PX4A 2FJWA 3QBCA 5BREA 2FDNA 1NMEB 1S6PB 1HPZB 4X4SA 2Z2LA 5D77A 2BANB 5H9EJ 1DRZA 3MDQA 3K5OA 4V19S 1GMWA 5LM7E 3TRGA 2VJUA 4CHZA 3TU5A 3EGVA 3P83D 4OYPA 5ETSA 3S41A 4LFBJ 2Y8WA 1T9WA 1JL1A 1CJTB 2Y1LB 1N33K 2IGIA 4P75A 1CJVB 2XC9A 3GIJA 1S1XB 4OJRA 5B0EA 1ZYQA 3AJ1A 1BG3A 4CIOA 5AR0A 1LAVA 5C7PA 4DX6A 4DTRA 5BYRA 4L3KA 3C6TB 3BS9A 1OQ6A 1AW0A 2R2TA 4NYPA 5GAEI 3K5NA 4BVOA 4CJFA 1NJIT 4I2QB 1SJ3P 2ZZTA 2ITMA 1SJQA 4HWIA 3CCUS 3CJKB 2FGOA 3R6LB 1NU4A 4CTAB 4H03B 2NREA 1LW2B 3SSRA 1RADB 4ICLA 2ZNYA 3RBDA 2MLXA 3Q7BA 2JH3A 2D0OA 4JI4K 5AQVA 4DSIA 4V1Ak 2CPYA 3R8EA 1LQ9A 3J7ZO 2MYFA 3WBZA 1SH2A 1I5OB 2V2ZA 4LF6J 2H9ZA 3UI3A 1RBAA 5HJXA 1FRMA 4EP4A 3AVGA 3VF0B 4UOCA 3GJTB 4LF1A 2W9AA 3AVJA 2FLPA 3UKUA 1IJJA 5F8HA 3TSUA 1HNWJ 3BV8A 3SPZA 1RA7A 3BDEA 2CPFA 3P5TL 3IRXB 5C24A 1RAFB 5KFOA 3NCIA 1S4FA 4I2PB 2CQ4A 2YHWA 2AYEA 2XMWA 1EKRA 4FLTA 3F0NA 1RFQA 3KD1E 3TZZA 3TJ8A 3D2FA 4ZIVA 1T3VA 4RW4A 1WAJA 2E5JA 2K7JA 2F65A 2ZOGA 4WK3A 1HNXJ 1K8KB 2VDIA 3OYBA 4NI2A 4UZBA 2VGMA 4F02A 2DHAA 4H4MA 2XLJA 1RBTA 1AB8A 3HVWA 5LXRA 4GMKA 4BGBA 3SMPA 1JCGA 4JI3F 4PL7A 1BWFO 2DFEA 4BC2A 1DAXA 2Z2YB 3TWHA 4YHHJ 4DV1F 4JI2K 1EP4A 4ED7A 4G1IA 2CNOB 3DOMB 4ETZA 3O4WA 2NRWA 2ZQBA 4KC5A 4QPXA 2V94A 2XMMA 5J2MB 5FRNA 5F8LA 2YKQA 4LIWA 2ASLA 4WCEL 3TJAA 2HZVA 1F1BB 4I9QA 3CCJN 5K8MA 1BD6A 4PWWA 5J1EA 2I2YA 2KKZA 2F8MA 2E5IA 2IVMA 5KAKA 3FQKA 3I4HX 4RPFA 3ZT3A 4ZP8A 2UU9J 2QN6B 1WTFA 3QINA 4YDUC 3NVMA 2XI2A 2E6LA 1NJIO 2B3TB 5GIOA 1HKBA 4I7FB 4QR1A 4FM1A 4ZJLA 2GQCA 4PKHA 4Y0WA 4NL5A 4FLUA 3NGSA 1NGIA 2ZH5A 4MIWA 2IVPA 3DGPA 2CQGA 4KIAA 1B7YB 1JLEB 5GAHU 4URQU 3DU5A 3UVJB 5IV4A 4OV6A 5D3GA 2XSJA 2W7AA 2Z2ZA 3VQ4A 3BGOP 4KY3A 1U2VA 4YOTA 3LDOA 3ZZ0A 4QOZB 4QQBA 3ET6B 1VQKS 5FDLB 4DR4J 3LO3A 1C6VA 1B9DA 4NO7A 1U02A 2KXHA 4O44A 2O4GA 3CGIA 3ISND 3MURP 2Z1GA 3VPZA 2IHR1 2D9OA 1BOTO 2FSJA 1V4TA 2OYQA 4Z0UA 2B0GA 5KFYA 1RQ0A 4OI6A 1R3NA 1EJ7L 4JKGA 1TKTB 4DX5A 5C25A 2DRAA 4NYFA 3TEGA 1WKKA 4Y65A 1IVZA 5KFTA 1D9AA 2MKCA 4NMLA 1SIZA 2QXFA 4Y28C 4G1PA 1WTBA 3CJ5A 3MPDA 5H1SQ 3CMQA 1S0MA 5KG0A 3R5JB 2EKNA 3R2DJ 3LH2S 2DY4A 1ZBHA 2IJFA 2XHCA 3PKYA 1MSWD 2YKNA 2E1AA 4OI3A 3BF3A 3UR0A 5KGWA 1PCAA 2LQ5A 2UV8G 1HD0A 1ZA1B 4F9OA 4O0JA 2MJNA 4CFCA 4FJNA 3C46A 4PA1A 4C23A 4LF4F 3Q2SC 4XH1A 4HTJA 2QKKA 5B09A 3D45A 2A6MA 2R7RA 1N32J 1RDBA 4FZYA 1E4GT 2F9WA 4C4WA 1YTYA 3ZSOA 2GFFA 4NZ7A 2Q1LA 3G82A 3JAMO 2M7SA 2HFSA 2QFJA 3PIOQ 2UXCK 5D4OA 4AHTA 3AD8C 3KUGA 1DQ8A 3MECA 2YY3A 2K7KA 4WWSA 5F8IA 3LM9A 3BH6B 2ZBIA 1U6FA 1C1BB 4EZ6A 1N6QB 4W92B 4C6AA 2V8PA 2PT0A 1DJ0A 2QK9A 1YGYA 4DSLA 1GEHA 3KMSA 2HHHF 1WOQA 3OL7A 3LAKA 3I0SA 2J7WA 4H54A 5B8HA 5ETOA 2CXEA 3ZTRA 3BH7B 4O3SA 4CLKA 5IT9Y 4X65K 4I6MB 5ETKA 4OX9F 3GILA 5T7LA 1GH8A 5CZVA 4LSLA 3NBPB 5FIIA 4OLBA 1X5TA 3B6BA 5ADXH 4P2MA 2GGPB 4DTJA 3O80A 3OXLA 4USTA 2RDJA 2XO6A 1VDHA 4J8FA 4O4RA 4NOHA 5KG4A 4Q0BB 3JXOA 3POTB 5A0YA 4LF8K 4BRAA 3RAXA 2AT1B 4DS4A 4PKIA 5HP1B 4QYZJ 1XC3A 2HG4A 3AO3A 1HKGA 4M5MA 3MN6A 2G2OA 3AOCA 1W2BM 4P7TA 4AUKA 1KVIA 1ZBLA 4UUXA 4A2BA 1RT4A 4IEIA 4C8NA 2VOPA 4X66F 3M1FA 4Y6IA 2X3DA 4LFAJ 4YS2A 3KLIB 5EDWA 4CP5A 4MLEA 2FY1A 1FW6A 1LWFB 4CZGA 2P9IA 3WDOA 3UE5A 4NLGA 4OZJA 4KH0B 3D0HE 2BE7D 5IWAJ 3FVYA 3ICLA 2VFTA 3QEWA 2CPIA 3BQ1A 1FKOA 4B3OB 2W6KA 3AXKA 4AHRA 1G2EA 5I3PA 4OYWA 2X51A 4HT7A 1S10A 1URNA 1IQTA 3CC7N 3KLEA 4GC7A 4M42A 1Q4RA 2YQ1A 1LFPA 1U1PA 1X9JA 2W2QP 4DV3J 2YX7A 1BI4A 4LREA 4IRKA 1LCUA 3MD3A 3N6NA 2E1RA 3WIVA 4KHNA 5CYQA 1SPBP 2LP4A 3ZZOA 1T8EA 4QIEA 3TNVA 2NRRA 2HFOA 3HHEA 1V3RA 3TSQA 4Q2LA 2YH1A 4TY8B 3CJ1A 2N4CA 3OD2A 3P45B 5A8KA 4O8KA 4AD6A 4DQQA 2E2QA 1FTRA 5A8WB 5AQKA 3FE1A 5AQJA 4DV5K 3HP6A 1AZSA 2QG9B 4ZN3A 1FD8A 5F0WA 1DT9A 4I64A 4HHUA 4F67A 2W4CA 4NE9C 4ISGA 3A3OB 3BUZB 3AARA 3AB2B 4KHRA 4ID1A 1TGOA 2CGLA 5AQOA 1NHUA 3MM7A 4CI6A 3UKRA 3H7HB 1PC4A 2GJIA 4H4KA 1NXIA 3MM5A 3OTCA 1KVBA 3RMBA 2CG4A 1UAXA 1NB2A 2JEJA 1A6LA 4RWXA 4OQJA 5KG1A 3HCXA 4OPKA 1KP6A 3C6HA 4CGJA 3MTKA 1UEKA 3EZOA 3GR1A 4WXOA 1HNZJ 5LT5A 3GJQB 2IS3A 2IIHA 4ERDA 4I9LA 3G10A 3MAAB 4ZVSB 3CC2S 4CJEA 2FGCA 2KT2A 2ITGA 3NMUA 2VG6A 4JUZA 3TQ1A 4EHTA 5BRDA 3GBTA 3UNGC 4CLFA 4JNEA 3MWBA 2FZCB 3O2IA 1S9EB 2HIQA 3LTOA 3DRRA 2GV9A 2NRTA 3CCVS 1NSKL 4OL8A 1U45A 4BDZA 3KYLA 1Q9XA 2NXUA 5HBMB 3TANA 5JS1A 4M94A 4IXCA 3RW6A 5HLFA 4IFYA 5CR4A 2V4RA 3QEIA 6AT1B 1HQEA 4ECWA 3CCSS 2NXNA 4NXNJ 5C15A 2E2NA 2ABYA 3KOAA 4DU8A 4GKKJ 1X5OA 2EPIA 4M8LA 2QTDA 3KZBA 3ZX0A 1P1LA 3FMBA 1CJKB 4USWA 2G8KA 1BQNB 4U7UD 2I0XA 2AU0A 3R7SB 1X4EA 5T7BA 3T19A 3K0SA 3M30A 4U95A 4DR5J 1B92A 3D2EA 1WG4A 3PR4A 5KGXA 1NB7A 4TU9A 4P2FA 2BOAA 4IH6A 3CJ2A 1VQ9S 1HRHA 4Y2IA 4CGDA 2KG0A 2DR5A 4BR9A 3MMJA 3JTOA 2I5JA 1T03B 3SUPA 3IG1B 4CBXA 1DKGD 4WP8A 1QAIA 5KRSA 2BJ7A 3TX0A 2HRUA 4RBTA 1CPZA 3OS1A 4EAHD 4IFEA 3WNGA 4FWMA 4K8ZA 3FZFA 5DM6L 2EFQA 4GKJF 4PUOA 1UP1A 1OY8A 2NZ4A 3W3SA 4G1QB 3VQAA 3Q0AA 2FSKA 2HHVA 4OFZA 3MR5A 4DDFA 2QMUB 1RHUB 2CQPA 1FJGF 4LF9K 1RWVB 2KFNA 4MIAA 4MK9A 4LJMA 3SBTA 2NZCA 1YX2A 4ELUA 4NLVA 1HI0P 2V5HG 3CM5A 3NGIA 2FVCA 1XJWB 1XNRJ 1BISA 3C6AA 1RGVA 1HNXF 3CWJA 1TMJA 2AX0A 2QMXA 5HK4A 3OLAA 5KT7A 2ZBPA 2XZTB 4B3TK 3ENBA 2ASOA 1R0CB 3MR7A 4RW6A 3I5BA 2ZGZA 2IJNA 1KOOA 1DTTB 2N82B 3QNNA 4YHHF 1U1OA 4LUBA 4K25A 3T1HK 2ZKTA 4L72B 4PG7A 3ZTQA 1MDUB 1TQLA 3LP1A 2LDYA 1DQ9A 2E6MA 1M1HA 4DPTA 3KTQA 1BQMA 1R8BA 2X1FA 3J81j 1FVQA 2QRRA 3ZEUA 3M32A 2AKWB 2EC0A 2W2OP 3RSEB 3PEJA 4OHXA 1OY9A 4CHYA 1VSIA 1X9MA 3KK1A 5MLCV 2QWOA 5AZIA 3MXJA 3R3LA 3LANA 2G1DA 1IBKK 1Q1KA 3H1QA 1WI6A 2AX1A 1DFDA 1CSJA 4M41A 3HJVA 3W61A 4C8ZA 4WCEQ 3W2VA 3W62A 2Y0BB 1SC4B 3MF5A 4JI6J 3K58A 4FBUA 4FWNA 1P27B 1RT6B 3BN7A 1Y7PA 2FHJA 1RHJB 4B3RJ 4J90A 2IPOB 1WBBA 5LL6Z 4DR4F 1U8SA 3UQSA 5CZXA 3TAGA 1S6QB 3G86A 3PTWA 3M2VB 4X64K 5DG7A 4YOEA 2C2OB 5D0RA 2LEPA 4Q43A 3HZ6A 3CFRA 2RKIB 1AFIA 5GADI 3NP5A 3PHEA 1QQNA 1DGKN 4YMEA 5GMKa 1YJ9N 4WPAA 4W5TA 3VEZA 4M3RA 2VL1A 2HRTA 1HYSB 4JHDA 2BV3A 3J80U 1MU2A 2FD2A 4LRAA 4FWPA 3N4PA 1NLKL 3W2WB 4CEFA 1FD2A 5DDOC 3PJWA 2JC1A 1RTZA 4IQXA 3J81U 1NK8A 1RZMA 5IZHA 5CYMB 5HVGA 4IDKA 2KT5A 1FA0A 2ZVIA 2CQ1A 3SQ4A 1YIJS 3OL6A 1RT3A 3AVBA 1SAZA 4M7YA 4ILMA 3RAQA 4DV7K 2QWPA 2CVEA 3ILLA 1S57A 3MEGB 2JFKA 2RRNA 4BY9C 2B9EA 3PYFA 3FMWA 3AA2A 3AO1A 5JLHA 3QIPB 4L75A 3DAWA 4DTMA 1O13A 4DV4J 1REVB 3FRZA 3VGVA 1S9GA 1UL3A 4RCHA 2EFVA 4G6VB 3VEWA 1QY7A 1U1KA 3CCUN 3B6OA 2N4DA 3SAFA 1AXQA 2Z56B 5CZ1A 1HBNB 5HN0A 1RDDA 2RHSB 3J80Y 4NYZA 3G71S 3M6GA 3EVMA 3J81Y 2QA4G 1OQ3A 3I0RB 3T1YF 4BGAA 1G4CA 3A5LC 4DPUA 1HR0J 1KBRA 5DDRC 1GX5A 5DDQC 2VA3A 2KVIA 3V6DA 4U96A 3UDLA 4CESA 1GAOA 2PD1A 1NZ8A 1RT7A 4JLHA 1RDAA 4UY8T 4DU3A 4DEZA 4CE9A 5BR9A 3KJVA 4C3KA 1OH5A 4JI5J 2ZF5O 3A2FA 2OPSA 4J9OA 4NLBA 2GELA 1CZAN 1VISA 4HTUA 1FDBA 4IG0A 4A8KA 3CE8A 4B9QA 4FOIA 3C95A 4ZKAA 4WKYA 4CFAA 2VASA 4AQYK 3HLUA 4B1ZA 5HQLA 1KQFB 4DCJB 3KKRA 1LWEA 4LRDA 5B0CA 3MK6A 3DJCA 3DM2B 2XGPA 2P9LB 1RILA 2Z0GA 1T9VA 3G2XA 4U7BA 4DWIA 2CQ3A 1IJEB 2HW3A 1RT1A 2MKHA 1QUPA 4WK1A 2HQCA 1BUPA 3CC4N 4Q5VA 3H3NO 2W9BA 3EPIA 3N5BA 4WFYA 3IMQJ 4HTIA 2BRKA 4TQSA 3NAIA 2Y1IA 4CHNA 1X5PA 3T3FA 4LFAF 5K20B 4RUBA 4F7VA 4GV3A 3MUTP 2YNHA 1RLDA 4AHSA 2DXEA 4DMZA 2VOOA 4AF1A 3GB0A 2CQCA 2DH9A 5IWAF 3I8BA 4P7VA 4FXVA 3PUFA 2GV1A 3KHLA 4C7QA 2DNPA 3QO9B 1Q81T 2RNEA 1Q5VA 4DPYA 4CIEA 4R0JA 5LSRA 2UUAK 1OY6A 1NSQA 5TKWA 2VQFK 2BW2A 4LD0A 3MCMA 3U8XA 3HM8A 2ZUAA 1UWBA 3OS0A 2R8IA 4TYAA 4IKAA 1N0VC 2OPQB 1M5VC 4KHSA 1J2VA 3PSFA 2R8GA 4KFBB 4M5HA 1FESA 1T7PA 3DLEB 1VQKN 1G7CB 7FDRA 2DGTA 4MQ3A 2COLA 3NH1A 3IWLA 2Q3PA 4Y00A 1YUWA 1S6PA 2VPXB 2NRHA 5E26A 1Q95G 4UY8O 5HANA 5BYSA 3IC1A 2VFSA 4YDDB 1TZ0A 1UPPA 4O4GB 1N0UA 5C42B 4DQRA 2BA9A 1HHTP 2EFNA 1ZETA 2PC6A 1S1XA 2P9KA 3KIOA 3A0IX 2G8FA 1U1QA 5JVHL 4HH1A 2G8WA 4NCAA 1HQ2A 2M70A 3C6TA 2VQEJ 4HUGA 3D66A 4FPIA 3MZIA 1RTIB 2HQIA 3QT6A 1WOSA 1HNZF 2A40A 1KVCA 3CJKA 4I6YA 3OL8A 4CTAA 2DHXA 2GO9A 1LW2A 1D8ZA 4N77A 4CLWA 4H5TA 1DEJA 2ZJPL 4CJLA 5KFQA 4BCAA 3LDLA 1YJUA 1KQGB 2GWJA 3OYIA 4ZVFA 4OPHA 5IT4A 5AJ3K 3SMSA 3CCLS 4NASA 2CNKB 3HHLD 4LFCK 3HHNB 3LZIA 1OH6A 4NYNA 1RT2B 1QSLA 3LPTA 1N33J 1W26A 1IKYB 1VSEA 4OKJA 4QIFA 4ED6A 1Y10A 3P3DA 4DCHA 4EYHB 1UAWA 4OHVA 3AT1B 2VFRA 3SCLE 4OJ3A 4IDHA 1X3NA 3DXSX 1H6KX 5M1FA 5JICA 1UJ5A 2O8FA 3ETOA 3RG6A 4NXNF 4NYOA 1VRTB 3RRHA 1W2BR 1KVAA 2P9EA 1S5ZA 3SQ0A 4N5SA 1Q81O 5I4MA 1I94F 3CJ7A 5LMNF 4NLOA 4W90B 3VQDA 3IRXA 2WBRA 4KYZA 3S3NA 4GKKF 4I2PA 3KLGB 3IGNA 4JI4J 1UJ4A 4RU2A 4DR3K 1T6DA 2OP5A 4MYUA 2D0PA 4FJJA 3ZT2A 1K8KA 4DR5F 3IRWP 4FF4A 2VPWB 4IBNA 2VPYB 5GAGI 4F3TA 3PV8A 2FB0A 3WQUA 2D7SA 1TYQB 4ZVOB 3QFWA 5ADXA 4BC7A 4RLEA 1JJ4A 4DR7K 3ZSWA 2DGUA 2DY9A 1ZBSA 4LF5K 3AXMA 3DOMA 3WXLA 3DOLA 2RJZA 4ILRA 4GC6A 2XHBA 3AA4A 3T5JA 5J2MA 1HUXA 1JB0C 3VEYA 4JAXA 1RWKB 2MHEA 5HRPA 3J7Z5 5KFIA 1TKZB 3THWB 4XH4A 4WFZA 5LMUK 5GADP 2R4FA 2YHAA 2IDOA 4F04B 3JQJA 1JCEA 3G0ZA 4I7FA 3MPWA 2VYPA 3D1OA 4WQ4A 4DL6A 3LPYA 4JI2J 3EXCX 1FEHA 3GIKA 4OI1A 1HBOB 3IWNC 2QLWA 4HYKA 5AQXA 1JLEA 3KJFB 2JLFA 4K5SA 3OYAA 3D9BA 2R2SA 2DIVA 4F25A 3KVGA 3OXFA 1KHWA 4CYUB 2X6NA 4DUZF 3K2YA 1XC9A 3Q8RB 5DQHA 3VMFB 4B1WB 4KV8B 4O55A 4BRMA 4JI0F 5CZ2A 3HHLB 1FO1A 5FDLA 4KTZA 1U47A 3L3UA 2HWTA 2I8EA 1HX1A 4RBVA 3K59A 4XDCA 1X60A 5AQPA 3A5MC 4CZEA 3ADAC 5CD4H 2KN4A 1S0NA 2MDAA 4F36A 5HO4A 3KHGA 2CQ0A 1VK0A 2D0AA 4CH1A 4DTOA 3VVUA 3LDQA 1TKTA 2CA9A 1U26A 2AEFA 3O3GA 3MPVA 3O3FA 3GQCA 1N5QA 4DFPA 3C94A 4M3YA 3GOIA 4E1JA 2BKOA 1RUSA 1YJWS 4DSKA 2UXBK 5D0GA 4CEDA 2I6WA 2M52A 3BJYA 3GFHA 5DETA 3D2WA 3IBFB 1BMQB 1VI7A 3CD7A 4CO3A 2YNFB 4HUFA 1E6YA 1F21A 4FVUA 3LPEA 4HR2A 1EO1A 4RJVA 2GEMA 1NBWA 1TVRB 2IAJA 2IM1A 3BM7A 3J7YP 3OXGA 3JAMU 1W2IA 3IA0A 4DUTA 1X4FA 2V67A 3QETA 2OD4A 1DBDA 4LRFA 4J2EA 1A7GE 2FC0A 1KAYA 1UFKA 2HYIB 3FGVA 1UJ6A 3G8SA 2FXUA 2CZ4A 1TL3B 1KKHA 3CC2N 2HQDA 3ENAA 1OPIA 3CJRA 4IUFA 2UVUA 2EWSA 1KONA 4KBIA 4Y2MA 3ZLJA 2XNQA 2CJKA 5A8RB 2VBWA 3E8OA 2WZ1A 3E9OA 2XMKA 3CCVN 2IDEA 2VG7B 1UFWA 1L3TA 1N6QA 4NLXA 2ROPA 2W1BA 4IFVB 4PYDA 4CT8A 1TFYA 2QW9A 1KTQA 2P9PB 3EGZA 2MSSA 3DLLL 3CCSN 4Y2KA 3H5SA 2ZDPA 1R7IA 1KOHA 1NOYA 3IM8A 4RX6A 3P38A 1XIQA 3JAMY 5IFMA 3TUZC 3HFVA 3ZX3A 4I6MA 1JLBB 3VTIA 2KM8B 3NBPA 2F1FA 1JLAB 3IR7B 4UOFA 4EO8A 4DCOB 3M4XA 2YJEA 2FZKB 2GGPA 1J9AA 1H2VZ 2BQUA 2XM3A 2IVNA 4DV4F 3OTOK 2Z2MA 3FZ2A 2UXCJ 2QI2A 1EZZB 4ED2A 1VRUB 1CZ9A 4FPAA 2UXDK 4Q0BA 3V4MA 1JX4A 3POTA 2I9SA 4H0PA 4JEPA 1VQ9N 1GLCG 1F60B 2C42A 2DH8A 3N6LA 4QS9A 4BR2A 1LK5A 4RNOA 5DMRA 3H42A 3FSXA 3KKFA 4FF3A 1VJQA 1W7AA 1WC1A 3M5RA 1VAZA 3D7EO 2ZBCA 3T9ZA 1HWUA 2HKEA 3MCPA 3Q86A 4X65J 4KTQA 2DCUB 1HR0F 4IO9L 4X4QA 3KLIA 2GQ2A 5BR8F 3AH6A 1RWXB 2C28A 2DPNA 3O1BA 1LWFA 3TARA 1IO2A 3TOQA 2HS0A 3VGMA 2WRMA 1F5BA 1HPMA 2CQ2A 4FWOA 5K9FA 1HIYA 1R0BG 1UVKA 3W8PA 1U04A 4CK3A 4WFAL 1F5CA 2IIRA 3DRSB 1Z26A 3RWUA 1C1AA 4B3OA 5M2RA 3FZMA 1S6OA 2AZ1A 3PACA 4JI5F 2HNYB 4LF8J 1RSCA 2GS8A 3HSDA 1NK5A 2CAJA 2RHQB 4AE5A 3D1QA 3VQ5A 5B7WA 4HDHA 1R0AA 2Z4PA 3IBCB 2BW7A 2VC0A 1IG9A 3CFOA 5KPTA 3SZ2A 4PKGA 3OUYB 3IS9B 5C2FA 3PYEA 4HDGA 4KBOA 5C5JA 3PHTA 1KC8O 1W97L 4RW8B 2B4OA 1WSJA 3SCKE 4C0HA 4CZLA 3CJSA 2DGVA 4OZ2A 1S5JA 2FLOA 3DKDA 5A8WA 1QAYA 2L9DA 2WAQD 4R79A 3J7AN 5JS2A 4PG5A 3L2VA 4K43A 1YKWA 3Q8UA 2V6AA 3C3LA 2EBGA 4TYBA 1WEZA 3ENWA 2DTUA 2A41A 3U1NA 1H98A 3QJPA 1ILYA 3EE8A 3EN9A 3ENQA 2YWHA 3DLGB 1S22A 1Y4ZB 2YHBA 1VC5A 3AVIA 4O23A 3HL8A 3HT0A 4CEBA 2RUSA 4JI1K 3ZCMA 2RRBA 1TV6B 2DR7A 4CEOA 4M3XA 2E7WA 2DO0A 4G3IA 1ZXOA 2CQHA 3FCHA 4NCGB 4DG1B 1OSCA 4W98A 2AEMA 2JX2A 2W2PP 4NLCA 4X4VA 3MAAA 3MXMA 4DV5J 4M5GA 2EK6A 2V4JB 1SKWA 1ULRA 3RBZA 2MKIA 1WSHA 3ZTSA 1S9EA 3UDEA 5AQYA 2FJAB 3D3CJ 1QHAA 5LJVA 4FLXA 2HBZB 3H90A 5HBMA 2FF3B 3AY9A 5JLFA 4DQSA 4TNOA 4OI0A 1R8PA 4KT0C 2WHOA 2NRVA 3AD9C 2M88A 3SSSA 2YWGA 2AEJA 1WUUA 1NEEA 3OV7A 2IC3A 4A47A 3VA0A 3P5BP 3CJAA 4ZP6A 4N56A 3Q8VA 5KFUA 3OVAA 1M1KT 4CGGA 4WF9L 3RAMA 3AVCA 3MEDB 2WB1D 2IBKA 1CJKA 1C1CB 4FVCA 4PCQA 3U1MA 1YIJN 4WE1B 2VQEF 1PO6A 3TUJC 3SJHA 2BBEA 1VQ7S 3M8QB 3DLHA 5FRMA 2FHOB 3J8AA 2MJUA 4N7TA 3PFOA 3CDUA 1N36K 2YPZA 1VQNS 1N88A 4BDYA 2E5LK 2C1EB 3MCAB 4OI4A 1XMOF 5D0HA 2YKMA 3ULEB 2OA8A 3EE3A 1SIWB 1GNKA 5BN8A 3QLHA 5IT9O 3IG1A 2U2FA 5DJBA 2HFVA 2ILZA 3CCES 3FDSA 2CNNB 1VQ6S 3UD3P 3TO8A 3AO4A 4A4JA 3WNEA 3C15B 2IM3A 3SQ2A 1UZHA 2PZSA 2H5EA 1CVJA 3H5XA 2Z57B 1IWGA 3G71N 4WTYA 2LXFA 4A8MP 5JXSA 3KDOA 2HGMA 5AFUH 1Z05A 1NBEB 3VQ7A 3EL2A 2ZJPQ 5KFPA 3UD4P 5BXIA 4ECUA 1WSEA 1QQCA 2ZJRQ 4ED3A 2ZM6K 1SQEA 3TAEA 2AGOA 1U1RA 2JSXA 1O1WA 4HI2A 2D3ZA 2R7XA 3ZZTA 4JK7A 3IN5A 2ZD1B 2Q0RA 4IKFA 3NGZA 2EC2A 2IRUA 2Q1NA 2F3JA 3L4BC 3MN7A 4IG3B 3RW7A 1N5SA 1WHWA 1T05A 3SUQA 1MWYA 4WQ5C 4FXDA 2VFUA 2BQRA 2G2ZA 4AXIA 3PW2A 4ZVUB 1BXNA 2HHSA 1HW9A 1N52B 4QYRA 2B5JB 1M0SA 2H3GX 4X62K 4E98A 4KE5A 4IJNA 4CZKA 1IV0A 4J2DA 3ZT1A 4LF9J 4TY9A 4U7CA 3DRXA 2HURA 5JVGL 3ALYA 4QJVA 5KT4A 4FO0A 2ZOFA 3AOAA 1HKAA 3R9LA 4EGLA 3PW7A 4DPOA 3CJBA 2HGNA 1IKVB 1M1KO 3R7BB 4Y3CA 3FZBA 4QWAA 2R7TA 4H5VA 2NQPA 1YI2S 4A57A 4YNQA 2ZHAA 3FJ2A 1K8AO 3ZZYA 3AVHA 3CJ4A 2YI1A 5DRKA 3EZUA 2HAFA 3HHDA 4IOAQ 3I96A 4JK8A 1HMVB 5GAHI 3QZ7A 5KFSA 4PWUA 4B3TJ 3NKYA 3IO1A 1Q7LB 1IM6A 3GLJA 2P9CA 5HSPA 3A4TA 2DGQA 3T1HJ 3DXMA 2IBOA 4CQ1A 3SFUA 4FJ7A 4DL5A 1TELA 3M05A 1KRPA 3OA9A 4KH6A 2VHGA 1K0TA 1O6XA 1RT6A 1RACB 2HNDB 3WQPA 2HSEB 3H8YA 1RCOB 2CQIA 3E3XA 3GFZA 1N5VA 2GVDB 1YBAA 4DV1K 3V4IA 1FFSB 4ISFA 1T9TA 2GVZB 3M2VA 4IO1A 4FYYB 2NLXA 3OYFA 2EG1A 3THVA 2JOQA 3LM2A 4BRGA 2PI4A 4NXMK 3DXKB 2ZBRA 2HWIA 1T02A 4HLBA 5KFGA 4CNZA 1IBKJ 1RHQB 2MKSA 1RWUA 3M7VA 1YLXA 2NYHA 3EVWA 1NK7A 3BZCA 4OO1J 3GIMA 1HQUB 1DZ5A 1SV5B 2HS4A 3W2WA 1NGJA 3T69A 3CPWR 4H4OB 4QWEA 5CYMA 3EYZA 2VDHA 3UCUP 4YOWA 3MMCB 5T41A 2JEGA 1AUSL 1RDWX 3NF9A 1VQOS 5DM7Q 1TK8A 2WW4A 4ECTA 4ECQA 3R1HA 4QWDA 1T95A 4K42A 2DGSA 4DN9A 4Y1DA 2OFHX 2DHGA 2HHQA 3AGRA 2XMAA 1XNQF 2RQKA 3QAUA 2OPPB 1RAIB 4KREA 3MEGA 4X64J 5AZJB 3O9QA 2PA3A 2BACA 2R2UA 5BPNA 5HMYA 1REVA 3QB0A 3AJDA 3CQXA 1S1TA 2JWLA 1BIUA 3JTPA 2HGLA 3GDQA 1VQSA 1IKWB 4HACB 3CDEA 4E7LA 4F4XA 4HI1A 3C14B 2P8IA 1HBNA 1RCXB 2GCFA 1D9DA 1MWQA 5GIPA 2W7OA 3CCLN 1MROB 1AFJA 3VEOA 4MKAA 4WFNQ 2R7QA 3P8BB 1FHTA 3W9IA 1FT8A 3OQ2A 4BLGA 1GLEG 4RW9A 2QA2A 3WEEB 3CCWA 3JSBA 4J9KA 2N7YA 4BR5A 1FNOA 3L2RA 3RB6A 4A8SA 4B1VA 4ECRA 4ILGB 4DV7J 4Q45A 5D4LA 4N76A 1RTDB 2C3MA 2XHWA 2O5DA 3T9NA 5KG7A 3VGKA 3CDWA 1HNVB 4DV6K 1B70B 3O44A 3DC2A 3O6QA 3R1LA 2DNKA 3ILOA 2ASJA 1O8BA 1WF2A 4PL8A 3QT7A 3AQOA 1B7FA 4QIVA 2QA4N 5IS2A 2K3KA 1CC8A 3MR3A 4YUDA 3CB4A 4TKTA 2KLAA 2HBKA 2WC9A 4MK8A 4ZCLA 3V6HA 3MFIA 1RDRA 3DMJB 4H0VB 3BEGB 3VCDA 3VQPA 3A5NC 1QJHA 3DLJA 4I6AA 1NNEA 1X31C 1U6BA 3V1RA 1BL3A 3NCQA 3DM2A 1WC4A 4LF4K 2HWHA 3DLLQ 4K0KF 4A59A 2JNJA 1L3KA 1JKHB 1KLNA 4FS1A 4ZP7A 4LIRA 2O8EB 4ZK7M 1P8GA 2YNIB 3TWZA 4DTNA 1ZC6A 4EYIB 4FM2A 2EBEA 4X65F 1FRHA 4WXWA 2JVOA 5AQFA 4Y1CA 3NF6A 2G4BA 2K8GA 3DRPA 2KI2A 3VQ8A 4ZDNA 3P1GA 4FJXA 3QMQA 4DCPB 2NRXA 3OFFA 4WFXA 3UWTA 3O6WA 4CHQA 4ED0A 3CCMS 1XHZA 2YKAA 4AQYJ 1GOBA 2XYPB 4QIGA 4B17A 1NJZA 2E5GA 3FFIB 4PPDA 3L2WA 3SCIE 4MJKA 4CVNE 3PIPQ 3AD7C 3QO9A 4OX9K 5C12A 4K7QA 3O5BA 4WFBL 2CGKA 3EEQA 1TAQA 4WZQA 4HH0A 4CIFA 3GV5B 3ZETB 3CTRA 4IO9Q 3AOBA 1RTJB 2KH9A 2ZH6A 3OYHA 4ANDA 3BY5A 1VSJA 5K8PA 4WFAQ 1S99A 2I7NA 1GMUA 3NCPA 2C3YA 4KFBA 1E3MA 3DLEA 4J5OA 1UVIA 2XCAA 4CRJA 3QRQA 1B0VA 2RB7A 2F5GA 1IBLK 4X66K 5CD4A 1WHVA 4J2AA 5A6WA 2NYIA 3GV7B 4H8KA 2B6AA 3KDNA 4FJIA 4FK4A 2R3VA 2ATLA 1EKEA 3L0QA 1XK8A 2RDIA 2CWKA 2UUAJ 3E01B 4O4GA 4DOZA 5C42A 4O8UA 1G1XA 1E6VB 3TVKA 1FRXA 1U24A 4DL4A 5IC4B 5IC6B 3M1VB 4DHYA 2QWLA 4C98A 2P9UA 1YJWN 2LKZA 3G6YA 3BGRB 4ZPDA 1YF5L 4Q8EA 4DQIA 3HK2A 1E4FT 3GMGA 1RTIA 4Z2XA 1RHKB 3SJJA 3MAHA 1UEVA 2W41A 2ZEJA 3J7A1 2PDAA 1HD1A 4CM2A 4CJTA 1N5YB 3KXDA 1QZ6A 4DV5F 3MXHP 3NDKA 1PILA 1SJ1A 3M2RB 2JFDA 3NS5A 2ADCA 4MFBB 2MXYA 4J9LA 4MDAA 2DNOA 1VMBA 4LSNA 2K06A 1RT2A 4JV5F 3KG0A 2CZ9A 3THXB 1GMWD 8AT1B 3CDBA 1QTMA 1T9XA 1IKYA 2E1MC 4DF4A 3OFHA 2FLLA 1CEZA 2AYBA 1HLWA 3TEHB 3O8WA 1RJJA 3RRKA 4YB6A 4Y2CA 3ZZPA 5H9FJ 1JCFA 3TPQA 1V5IB 2L9NA 3JYTA 3BKFA 2MLZA 4UY85 4F50A 3V81A 3TAFA 3MWPA 4MAKA 2HBLA 3UDCA 5IV3A 3J81O 3M3ZA 1YT3A 3B8AX 3JSRA 2ZH4A 5M1OA 1BLUA 1NGGA 1LWCB 2Y1RI 2BKPA 4I56A 3NE6A 2CQBA 4ZLLA 3CVKA 3W66A 4F4ZA 3O3LA 2LU2A 1R89A 3IDHA 1TYQA 3D68A 1ATNA 5GAHP 1V4SA 3ID8A 2QFIA 3A8KA 2W4DA 4FJ5A 5F0XA 5THWA 3BKTA 2HFNA 1K73T 4WF9Q 1S1VB 2RHKA 4M5KA 3VWSA 3VERA 4BBYA 4K4SA 4YB7A 4CF8A 3ZSXA 3KG4A 3GJRB 4ELVA 2FJXA 1N5TA 5HQ8A 4Q44A 1Z1ZA 5BRHA 4DR3J 4KGMA 4K4UA 3MR2A 1H73A 1ZH5A 4ZHRA 3THWA 3HTVA 2BM0A 4RUAA 4CM0A 3SI6A 3R97A 4HHJA 2XI3A 3DOKB 3QNOA 4DV0J 3PY8A 2OSRA 2VKRA 5KTQA 1NGDA 4JI7K 3KLFB 2R9LA 2WB4A 4DR7J 3NS7B 4FW2A 3BF4A 2EI5A 4LF5J 4NLQA 2GHWA 3G6VA 5AQQA 3RMCA 1HBOA 2AJ4A 1Q8KA 4ZCIA 1JXBA 4BRIA 5EGYA 4QIWD 4CYUA 5F41A 5B0FA 3UE2A 4KV8A 1SC6A 3A8JA 1NMNA 3HHLA 5ETQA 3HPHA 1K44A 4Y2AA 2J76E 2LECA 2VIHA 1R8HA 2DKOB 3MN9A 2XY5A 3DU6A 2PSZA 1EWQA 3CO0P 1EQMA 1FE4A 3MM9A 3QRRA 1VRQC 5FPMA 4LF9F 1FFWB 1GK8A 1IR0A 2OHDA 1AT1B 3J7ZT 3I56S 4I68A 3FEZA 5B0DA 2RS8A 3VQCA 3JSYA 5I9EB 3IR6B 4GKJK 4YY3F 1XMQK 2QIFA 4AXJA 2FZGB 3I55S 3KJNB 1L5UA 4ISEA 4X84A 4YFUA 3EJMA 3AA5X 1GTHA 1FJGK 2ZH8A 3FZHA 1B64A 5LSOA 3KNGA 1RAEB 2YX4A 2DFHA 5AQLA 3LGHA 1JLFB 4XK8C 2YNFA 2QLFB 3R5GA 2W01A 4Q8FA 4DPXA 3Q8QB 4JB8B 4JYAK 1FFGB 3EKSA 2AJFE 5AQIA 3SCJE 3T1HF 1HNXK 5CQGA 1U49A 1K73O 4NLRA 1LAWA 1SB6A 2ZH7A 4OZLA 5KFWA 2QL9B 3S6EA 1PBUA 4K2XA 2XS7A 1RT5B 1TL3A 4CNYA 3CF5L 1XTZA 2ZBQA 1DHMA 2W8LA 1YDLA 2V8VA 4FYDA 5DZ7A 4DX7A 1IBMF 4CI0B 2C2RA 2UXBJ 1HHSA 2VB6A 5H1SV 2G13A 2DISA 4C9DA 3E2EA 3QGHA 4MH8A 4B9MA 2VG7A 2MY7A 5JUMA 3FQLA 4X4TA 4O3NA 4IFVA 4DN0A 2BEFA 4FYWB 1LKZA 3D2FB 3TZXA 2PAVA 1FXLA 1XUPO 2P9PA 2WSEC 4FLWA 3AAPA 3OBWA 4LH5A 2NRZA 1H3DA 2BTFA 4ZPVR 3MUVP 4X4UA 1NWKA 4DUYK 3ZO7A 4I6WA 3HYFA 3OBIA 4GVMA 2ZDOA 3HFZB 4CDIA 1GLFO 2BJ1A 4NRTA 4L6V3 2FBTA 1JLQB 4A8WA 2ROEA 1Q18A 4ENOA 4ECSA 3GYXB 2UUCK 1JLAA 3V9WA 3MM8B 4CO0A 2LSNA 3LF0A 2V50A 2OEJA 3CD6S 3ZX2A 1TUYA 1VQ7N 4PQUA 2BJ8A 2AP1A 4CEAA 4HHHA 4RZRA 1Q79A 1VQNN 4OV1A 2JLEA 2CPJA 1S76D 3M8PB 3D3BJ 5AQSA 3NOCA 4Z94A 2ZVSA 2M9KA 2PN6A 4C1NI 2OAUA 3GONA 2W40A 1EETA 4KO0A 4HCBA 5CHCB 5EUHA 4KRWA 1RAGB 3CCEN 3WX8A 4NWBA 2NR0A 5L38A 3C6UA 1VR6A 1BU6O 1DARA 2FF6A 2RAQA 4OJHA 3N79A 4PPZA 2XRIA 3TTCA 4X4RA 2MQOA 1F2GA 5AFUA 1GXLA 2IA6A 1CZBA 4YORA 3DRSA 4ID5B 3OTOJ 2G0JA 3THTA 3HI0A 3PRBA 3N0VA 4KQZA 2QWMA 3NNAA 2Q3SA 4DV2F 5ETTA 2HNYA 1VLYA 3SNNA 4FK2A 2GAGC 2F4VF 2KHDA 5AE1A 3BB5A 2ZWHA 1H7XA 2A3ZA 4TN2A 3RB4A 1JNRB 4CO2A 5I3QA 4ECYA 3CIZA 4FWQA 4W4MA 1LXNA 3DHXA 1ICEB 4E1NA 5DLFA 2B4VA 3OUYA 4F4WA 1FJ7A 3RBXA 3IS9A 2C2KB 1F5AA 4ECVA 3M8ZA 4KHQA 1W9HA 4OYOA 4CLYA 3O08A 4CJ4A 3FCVA 4RW8A 1P6TA 4JKGB 4LSZB 5C25B 4USHA 4J9MA 1TKXB 2AJ1A 2LDIA 2ZNZA 3F41A 2BKNA 1HJOA 1ZOTA 3T1YK 1D5AA 3MFHA 4M63A 2J6TA 2DNYA 2R7VA 3OTEA 4ZCKA 2XNRA 5EXWA 1EX8A 1TL1A 1NH7A 5KG5A 1GLLO 4B3SK 3VF4A 4CD3A 4DR2F 4Z7CA 3PSIA 1SJRA 2HAIA 5L8RC 4WP9A 4M3UA 2DNHA 1G99A 1HYZA 4Z7YA 3M8YA 2J0SD 1Q16B 2XS5A 4JV2A 2VFVA 2C2MB 4FJHA 3CDAA 1SQGA 4MKBA 2R8HA 3F9KA 7AT1B 4HCCA 3R8YA 1TV6A 3TTDA 2IM2A 4ZLPA 1MWMA 2CH6A 1QAXA 1NSPA 1FRLA 3QT8A 4NCGA 4CJ7A 5EY4A 2J9CA 2D0CA 5KOWA 1MMDA 5HI7A 3H2UB 5KFAA 3QFHA 4CZHA 2QLXA 1XEZA 2V4JA 4PR6A 1JXEA 2HRYA 3LUYA 3MECB 1RI7A 1GOCA 1QVGM 5KFLA 2YCHA 1D0EA 7FD1A 5KFNA 1WEYA 4URGA 4QYZK 2R7UA 5KFMA 1D3WA 1D9FA 5IOLA 3NAHA 2ZE2B 3W64A 3I0SB 5ADZA 1ROFA 4A8OA 4WFBQ 3ITHB 1F9FA 2ATCB 2P9SA 1RCHA 4PQAA 1G3OA 4JI1J 2OCEA 2HB5A 3J7YU 2O1PA 2V8HA 5T7LB 4KSEB 3HI9A 6FD1A 3PLAA 1YQHA 3ULHA 2QO3A 3QSYB 1VSMA 2A6AA 4KTWA 5KFVA 3AVNA 2ZC3A 1KAXA 5J2NA 3FBCA 1VIXA 1RDCA 4ZPCA 2CJ9A 5E3AA 3N4QA 2YTCA 3MEDA 5LSLA 4O3RA 3U9DA 1FX2A 1CXUA 1NO8A 2BE9B 1VQON 3HOTA 1C0GA 4F3MA 5A0YB 5IT9U 5FJ4A 2BABA 2PMZD 4WE1A 3AJ2A 1TTHB 3CI5A 4JN4A 3M8QA 2BE2B 2VZ9A 3AQPA 1RT4B 2F63A 2NXJA 2WOMA 4AT1B 3D6RA 4EWTA 3GIRA 5K5MA 2PO4A 1J5EF 1Y97A 2EEYA 2DR6A 2X1AA 2PFDA 1SUQB 3BSAA 1Y5LB 2WONB 1A5WA 5D4NA 1HFEL 4LH4A 3C7NB 3LA0A 2P9NB 2J8SA 4RKUC 4DR6K 4I1TA 3ETMA 2CKWA 4HVZA 4LT6A 4BRKA 3C15A 4CWBA 1RK8A 3ZZZA 3FK4A 2DCLA 1J5OB 3M9MB 4NLSA 1EIYB 1OJ4A 1FKOB 2QX0A 3SK3A 5DQGA 3QRPA 2EFGA 3CMAS 2XBPA 1CLFA 3PNIA 1PSDA 1KD1T 4YB1P 4DQ8A 3CCQS 5T14A 1TUGB 5KQDA 3TR5A 2QM1A 1YRTA 4C48A 1N36J 2ADBA 2E5LJ 3HPOA 1OVQA 3AVMA 3HSCA 3B6PA 3R6MA 1U2FA 5CYQB 2MQNA 1TK0A 1LOTB 2XZDB 4FJMA 4DU4A 2FPHX 4ILJA 2ZD1A 3PO4A 5F9LA 2WUSA 3S9HA 4IG3A 3A8IA 3H0PA 3ATUA 2GUPA 5AQRA 3VF6A 9RUBA 5E3CA 4ZVGA 2V2QA 4JRQA 4OGCA 2VC1A 4IRDA 1PJ7A 1Y0HA 2XMUA 1S0OA 3CUNA 4NRUA 2KW4A 2B5JA 3HF5A 4YDXA 3K0JA 3WHIA 2YWKA 1SJ4P 4DS5A 1J54A 1BQXA 1C0UB 4WYBA 2X6SA 5GMDA 3D6HB 3VQ6A 4O3PA 2JZ5A 2ZM6J 2F8SA 2D3OR 5K8OA 4CZIA 1RYRA 1IKVA 2QSWA 3MI7X 4DLGA 2GMLA 3HSZA 3BPSP 4DR3F 5ETLA 1CJUB 4UTGA 9ATCB 1EARA 4NXNK 2ASMA 4FWRA 2YKPA 4ZVPB 4DKWA 1I94K 5LMNK 1MW7A 1Y64A 2VD3A 3GFYA 1WDDA 3IWXA 2GTDA 2V7YA 3HD1A 1S12A 3I9V9 1IKXB 4WZMA 4DV0F 3CCMN 4PXCA 1M90T 3R1XA 2AZ3A 1KCFA 4DR7F 3CJ0A 4X62J 4LF5F 1VBXA 2BZ2A 1NLVA 1ELOA 1N56A 1WEXA 2V9KA 1WAFA 1XI1A 4PZVA 5SWMA 2E9RX 1FE0A 5HJYA 5C10A 1RWMB 2PA8D 5CXTA 2JEIA 4X4OA 3O9UA 5HLFB 5GAEP 2OELA 2XCPA 2J5AA 1X0PA 5ETPA 3HPGA 5ITHA 4UQGA 4RNNA 3ZC4A 3NLCA 3RR7A 1NH8A 2DR9A 2GVZA 3MCNA 2D5RA 3K89A 4IOCQ 1REGX 4TU7A 3OTDA 1ASWA 1FWKA 3M6XA 5KOXA 2J0QD 1PAEX 5EWGA 2FLNA 3PO5A 5IQ6A 6FDRA 1EWRA 1KD1O 1XBWA 2VBXA 1WC5A 2Q0UA 2DNLA 1HQUA 2KFZA 1SV5A 4ZCMA 4H4OA 3EE9A 2OZSA 4ZA1A 3V9SA 4IZ9A 4ECXA 3MMCA 4BQLA 4NZ0A 4QU6A 1ASUA 5EX5A 5BYQA 1XWLA 5HVHA 1WELA 3IM9A 4FSVA 1RBLA 4ZPWR 2IOCA 2KYXA 1CG2A 2WBMA 4F4KA 4DV1J 4CJUA 5K8NA 5JMVA 3TA0A 2MZRA 1RBSA 4BR0A 3PJ9A 2XWXA 2I5JB 2L41A 3TUIC 2V52B 2IY5B 1HKCA 3K9JA 4ZMMA 4DUZK 5C2CA 2V51B 4NXMJ 5A6PA 3R27A 2RVJA 4JI0K 1WHYA 3C19A 1ZBFA 2KO1A 2RMLA 4DL0C 5HOOA 3FBEA 3NRBA 4HACA 3HVTB 2DPIA 4BREA 4CH0S 1RDUA 3QJLA 3C14A 3QJJA 2DGOA 2L48A 5IM0A 3ENVA 1L3VA 3D67A 4KH1B 1Z25A 2BJEA 5CABA 2VU5A 5AQGA 2IMWP 1Y3KA 3NGKA 1QDUB 2GMJA 3J7AP 5KI6A 4NX9A 3CC7S 2OGUA 2R7OA 2HVZA 2XWYA 3P39A 4TXSA 4EZ9A 1YJNS 4FKYA 2O8DB 2WBNA 1YRXA 3PW4A 2M2BA 3Q2TC 4LFBF 3A3PB 1X7VA 3LP0B 4D3GA 1M90O 1KHVA 2A1BA 5CCMA 3NMRA 4FKXA 1V6HA 3CF5Q 4ETXA 2AWZA 5EHHA 3VTHA 3OR2B 3OHAA 3MOJB 3DRYA 2F8TA 3MEKA 3X1LB 1Y3JA 4RW6B 2HNZB 1VQ4S 3DNCA 4H0TB 3R5BA 1EQ0A 2WK4A 1BUXA 1VQYA 5A2QY 1IG8A 1LEOA 3LP1B 3DMJA 1RXOB 4BE2A 1KAZA 4URSA 1OPZA 3THPA 3V9UA 2DNNA 2CG8A 2Z58B 2Q31A 3H59A 3ZEUB 4F2SA 4GV6A 2NXEA 3EUNA 3O8MA 4LR9A 3H08A 4LF6F 3KK1B 3U27A 4CD1A 4RU9A 3DYAB 3PVXA 2O8EA 2RD5C 4OZ0A 5AZIB 3QZ8A 2E5HA 2YNIA 4DV6J 3FR0A 4PAAA 3K17A 1HNWF 1YRUA 2VWKA 5BRFA 3P49B 1MLAA 2LMIA 5DQIA 3W2VB 4F0HA 1PYOB 5AQNA 2G8HA 4ATNA 1GLAG 3FFIA 1RAHB 4CGFA 3OTOF 3FZLA 4NMXA 1WSFA 4E8UA 4LF7J 3TJ9A 3WXKA 4A48A 4AL6A 3BZKA 4W5OA 5EVZA 2YPYA 4LF4J 3K5PA 2P1JA 3OVNA 4PY5A 4PEOA 3SUOA 1YG0A 3VOVA 4EBCA 3KK3A 4B1UB 3ZETA 4N41A 2KL8A 1FWLA 3M6WA 4PWDB 1F9EB 3OFGA 1RTJA 4J91A 2D1CA 1CLQA 1ZM2A 1FCAA 2P6SA 3EDQB 5IXUA 3EMTA 3L7PA 2OPRB 4JHDB 2DB1A 5D6GA 2FYXA 3BQ0A 4J9PA 2M5YA 2IVOA 1NM2A 4LBPA 3DN9A 2VV5A 2J6UA 4IDKB 2XMVA 2YQ3A 1RWOB 5FPDA 2B7CB 4FYVB 3TX8A 3OVSA 3PW0A 3WXJA 3T7ZA 2JLGA 1RT3B 4RW7B 5BR8K 5CA5A 3TP2A 4OX9J 3I56N 5DDPC 3K8WA 2UU9F 1YVNA 2JC0A 4CFBA 3T6JA 4AH9A 4YEAA 4USVA 2IYGA 3JS9A 1EXQA 2AA4A 1T0TV 3I55N 2B9WA 1BWVA 5DS7A 1OYDA 2DNGA 1AYEA 1HBMA 3M1VA 2HBYB 4WKRA 3RGIA 2RF2B 4GO7X 4JI5K 3BGRA 4MMOA 1CS4B 3TQEA 1AA1B 1T3OA 1ZBUA 3NXZA 2W4PA 5GINA 5J2QB 4DSFA 2CQDA 2GX8A 3RZAA 3AVLA 4EP5A 1LNQA 2GIRA 4P2XA 5U47A 5FPEA 1N5YA 1RHRB 1IBLJ 3OYKA 1NGBA 3CCRN 4BG9A 3D6TB 4MIBA 3MN5A 2HLUA 2XLKA 2B4PA 2PFUA 4LMZA 3FZKA 5F9NA 3VAIA 3UD5A 1J53A 2ZH1A 4YDUA 1UCNA 4DSEA 1XERA 2UZAA 3THXA 3QNWB 1HYVA 3AGKA 2KXFA 2RIJA 4JKBA 3AVKA 2XB2D 3WUHA 4DU7A