1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
4FW1A 3BSOA 4K50A 3GYNA 3QEWA 5F8MA 4J9LA 4FJJA 3H5YA 1K1QA 3G6YA 4TYBA 4ZPDA 1ZBIA 4F4KA 4NCBA 1I39A 4HYKA 4CF2A 4ECRA 3NAIA 2DY4A 5KFAA 2OPPB 1S1TA 4B9VA 5KG0A 1HQUB 4O3SA 4HTUA 4WYLA 1TVRA 3LAKA 3KLFB 5D3GA 4MKAA 4NLVA 2E4LA 1A5XA 5HLFA 3E01A 1WAJA 4OLBA 2VG7B 5KFFA 1HJRA 4FLYA 2FJWA 4E1NA 3KK2B 3AO3A 1L3VA 3NKYA 4I9LA 2HHVA 1WN7A 1BIUA 1VRTB 1RBVA 3IGVA 1S1XB 2IOCA 1TL1B 4CHOA 5KRSA 4JUZA 5KFUA 4B3OB 1S1XA 3VQAA 1U09A 4CEQA 4DLEA 4ZVFA 1VSIA 1VSMA 2ETJA 4W5OA 3L2VA 4DEZA 2KZZA 4U6PA 4M3WA 1FK9B 2ASJA 4FJIA 3PHEA 1LWEA 3UR0A 2KZMA 4F50A 2HW3A 3RBEA 2HNDA 4M3TA 2VG5B 1RDAA 1RBTA 3H5UA 1T03B 5KFGA 2DPIA 4MIBA 3D0PA 5K14B 2AJQA 4FVMA 3KD1E 3NHGA 1BCMA 3SUQA 4Y2AA 4CJVA 1QAJA 3DYAA 4O4GA 4CJTA 3PR4A 2P5OA 1SKSA 4CEFA 4B9NA 3I5CA 3HHKA 3HVWA 4DF4A 2V0NA 4IDKB 1CZ9A 2FBYA 3PJWA 4QWCA 2RKIA 3BQ2A 5KFIA 3S3MA 2YNIA 3KMQA 2VA2A 2NUBA 1C0TB 3C6UA 5F8IA 3KD5E 1IKXB 4Q43A 4LY7A 3RAQA 5C25A 4H4MB 4XO0A 2DTUA 2ATLA 1JXBA 4KE5A 4CJRA 4O3PA 5KFPA 3KNAA 3V4IB 4OKJA 2OYQA 4CK1A 1XHZA 1ASUA 2Z1JA 2HHUA 5FRMA 1YTAA 3L8BA 5DG9A 1JLCB 1RT4B 3KLGA 2OPQB 3VN5A 1S6PA 1UA1A 3QGHA 2C28A 2Q3SA 4TXSA 4KAZA 2C22A 4KV8A 4RU9A 4ECUA 4O0JA 3QLHA 1BI4A 4KBIA 1S97A 1VSFA 3SUNA 2G8UA 1RTHB 1BISA 2OZSA 4FJ7A 5J2QB 2YHBA 1QAIA 4C8OA 4YR2A 4N76A 4B08A 3T3FA 4IR1A 3ITHB 4B9TA 3RR8A 3DLBA 3K59A 1S6PB 1JLBA 5KT6A 1D1UA 1EXQA 3V9WA 3V1QA 3OYHA 4CEDA 3BSCA 3AA3A 3OYCA 3M8PA 3O4QA 1TV6B 4DL4A 4F2RA 4YP3A 2ZD1A 3V6KA 3ZT3A 4FJNA 3PY8A 1LWEB 2BDPA 3KMSA 2XCAA 2P5GA 3DRRB 4KFBB 2YKMB 4C8NA 4M3XA 4RNHA 3MECB 5SWMA 1BQMB 2E9TA 1TL1A 3CDEA 4CHZA 4Z4CA 3OYBA 2OZMA 4WE1B 3MXMA 1VSLA 5DQGA 1NNDA 2RF2A 2XHBA 1HPZB 2WTFA 5DGBA 3OYJA 4M95A 1NHVA 1RILA 2VG7A 2BR0A 4CJEA 3HPGA 4DFJA 2IJFA 1KHWA 4IBNA 4CK2A 1DLOA 4FM2A 4Q0BA 3PW7A 1B9DA 1RT5A 4O5BA 2D0BA 3HSTB 3DLGB 3CFRA 1NKEA 4M42A 4FK0A 2R8IA 4DSJA 3LZJA 4ECQA 3GIJA 3KK2A 3KHLA 4FLXA 4CIEA 3O3GA 4K4WA 4M3UA 1RYSA 5I42B 5J2MB 4MKBA 3DMJB 2OPPA 4B8CA 5KG6A 2JC1A 1JX4A 1RT6A 5KFOA 1S1VA 1SL0A 4W5RA 4MFBB 4O44A 4O3QA 4CJPA 3JYTB 4IFVA 4M3YA 4EYHB 2UUTA 1CXUA 3WNGA 2V4QA 3JYTA 1TL3A 4YQWA 3LPUA 3QNOA 1QTMA 3T5LA 4FLWA 4IG0B 2R8HA 1J54A 4PWDA 3SQ2A 3DRSB 1RDBA 3N6NA 3RR7A 2R8GA 1VSHA 4KTWA 1BHLA 2F8SA 2OPQA 1RCHA 2I1RA 4ZP8A 3M9MB 2YNIB 4FXDA 4EZ6A 1QUVA 3EPIA 1RYRA 4ED2A 2AGOA 2UVRA 3SPZA 1IKWA 5JS2A 3LP3A 4DSIA 1VSKA 5KG5A 3V6DA 2XY7A 1BGXT 4DSKA 2YNFA 3VQDA 3V9XA 4CE9A 1LWCA 3FFIA 4Q8FA 1XWLA 3G6VA 3DMJA 4OKKA 4F4WA 2R7YA 3F9KA 2D41A 5I42A 2JEGA 2Y1JA 5KFRA 3TVKA 3V9SA 2HWHA 3A2FA 2DFFA 3AVGA 3NAHA 3OYGA 5DQIA 2W7OA 4CF1A 4XPEA 5F8JA 4IQXA 1ZBUA 4PA1A 3OSNA 4JLHA 2BANA 1TKTA 1T3NA 1EETA 1ZTTA 3WNEA 3DYAB 1RBUA 2BRLA 3CJ4A 4NYFA 1FKOB 5HLFB 1BL3A 4C8MA 3M8SA 3SPYA 4CJ5A 1NJZA 1LAWA 3HM9A 1TK0A 4Q8EA 3FSIA 2XGPA 4QCLA 1S1TB 2B4JA 3H5SA 2ZE2A 2D0AA 2QKKA 1D0EA 1RTIB 4H4OB 1C6VA 2YKNB 3C94A 2ZD1B 5FRNA 4GC6A 4FZXC 2IJNA 2W8KA 4Q45A 1RTJA 3PUFA 1TP7A 1TKXB 4QW9A 3I5AA 3LP1A 3AVHA 4H54A 3SUOA 4OPKA 2CKWA 3TARA 3NDKA 2FLLA 3ZSQA 2XCPA 4NLDA 3SFGA 4EEYA 4BWMA 3QIPA 3GIIA 1N48A 3IS9A 3OHBA 3OS1A 3QYYA 1TKTB 4ECWA 4FJLA 3Q8RB 4NRUA 4ZP6A 3ZSXA 3E01B 1RTHA 3OY9A 1RDRA 4ZVEA 3DLEA 4FJMA 1HNIB 3VQEA 1LW0A 1QSLA 3HVRA 4ZPAA 3AVCA 3NMAA 3OS2A 1K1SA 5F9LA 2X6SA 4GW6A 3K5OA 4URGA 2VG6B 1U45A 4DQRA 3RB0A 4QWAA 1LWFA 4FCYA 1JLGB 4IOBA 4MK8A 2GUIA 1JLGA 1RAJA 5CZ2A 1ZBFA 2R8JA 4NCGA 3L2UA 4YMEA 4PUOB 1JKHB 1DTTB 4DQSA 4B9LA 3KOAA 1BIZA 1C0TA 3M9OB 3SYZA 4ZPBA 4Q0BB 3HT3A 1TGOA 4FS1A 5HRRA 4RG8A 4LSNA 2OA8A 3O3FA 5J2PB 3U3GA 2W42A 3V4IA 4H4OA 1C0MA 1RA7A 5F9NA 1GOBA 4KHRA 1KTQA 3VA0A 2F96A 4DQQA 2KTQA 1JXEA 2XY6A 1LW0B 1IKYA 2AWZA 4J9PA 3H40A 2R2UA 4KI4A 3KK3A 4IKFA 4KTQA 1EP4B 4BE1A 1IO2A 3TR8A 5CYQB 1Y97A 2B6AB 3AVAA 4WZQA 4AHTA 3PVXA 1VSDA 2HHWA 3M8QA 4J2AA 4FJGA 4CF9A 3N6MA 2IM3A 3PJXA 2ZKUA 3MEEB 5KFDA 1X9MA 5KFHA 4FK2A 1JLBB 2R2RA 3DLRA 3QINA 5KFBA 4RW4B 4WZMA 4NLRA 3M8RA 4TYAA 5L1KA 4Y2CA 2ZE2B 2FJXA 3RB4A 4EO8A 4F4YA 1S6QB 2XGQA 3LPTA 3HVAA 1QE1B 3ICLA 4TQSA 1NK0A 4M41A 3AVJA 2X74A 1VSJA 3T5KA 2HAIA 3MEEA 5CY4A 2QKBA 4PQUB 4R8UB 5J1EB 2YKMA 3VQ9A 1UWBB 1D5AA 4O55A 2HHXA 3NAEA 3RB6A 4FBTA 4CJFA 2G8IA 4PWDB 4EP4A 1JLCA 1RT4A 1RA6A 2GIRA 2RPIA 2B6AA 2BANB 1D9FA 4NCAA 4X2BA 4Z4IA 5J2PA 5F8LA 3LDSA 3V6JA 4CJUA 4FLUA 4KKOA 3AO4A 4FJXA 1JLQA 3ZSYA 4BWJA 1UOCA 2RN2A 4K8XA 2JC0A 1TQLA 3MEGA 4FM1A 1KSPA 4DLGA 1WSGA 3CDWA 4KHMA 4CJWA 3QERA 3LP2B 3K2PA 2AQ4A 3LZIA 4FJ5A 3HL8A 4WXOA 2FBVA 4O0IA 2X78A 5KFTA 3HK2A 2G8KA 3QGGA 4TLRA 3BSNA 3NBPB 1NOZA 3S9HA 3GIMA 3WNFA 4DFKA 1NJXA 2AGPA 5KT4A 2QK9A 4FM0A 1TAUA 4DS5A 1UWBA 1RDDA 2KFZA 4NLOA 3KLGB 3AVBA 3MEGB 2KQ2A 3OYAA 1KFSA 3SQ4A 4IG0A 4MK9A 4NZ0A 2HVHA 1REVB 2J6TA 3OLAA 4IFYA 3N6LA 1U48A 5KFYA 5KFQA 3MR6A 4FW2A 4KB1A 4ELUA 1ASWA 4WFXA 4O44B 4ZVGA 3MR5A 5C24A 3CJ5A 2FLNA 1KLMB 4E7HA 3HXMA 2IAJA 1S1UB 3FQLA 3NH2A 1NK9A 4J2EA 4K4TA 3T5JA 1N56A 3I0SB 1RTDA 1JLEA 4CJQA 3ZSVA 4PQUA 4R8UA 3MECA 4JRQA 1RTDB 2ILYA 3SV4A 1WNEA 4NRTA 1A5WA 3DI6A 3B6OA 3O3HA 3DM2A 2IDOA 3TAQA 3HKWA 2Y1IA 3VA3A 4DTJA 5C42B 1TV6A 4NLUA 4CHQA 4K4UA 3ZSZA 4MQ3A 3BR9A 1DTQB 2IC3A 5KG2A 2PYLA 1QHTA 1SUQB 4E7KA 3RMDA 2D3UA 4W5NA 2VG5A 2HHTA 4YR3A 2YV0X 2PY5A 3DRPA 4NYNA 4WFYA 2XI3A 4Y1DA 4CJKA 1FK9A 3CM6A 1SL2A 3BGRA 4NYZA 4DTPA 5J2QA 5HP1B 2RDIA 1S0MA 1LWFB 3SCXA 1JLFB 1B92A 1JLAB 5KT5A 3MTKA 2W8LA 1NK7A 5EDWA 3OYLA 4FZYA 4CJ3A 3L2QA 4QWBA 1LWCB 1DTTA 1C0UB 4RUAA 3PZPA 1RT2B 4J2DA 2D3ZA 3AVIA 2W9BB 3U6FA 2UUWA 4FJKA 3C6TA 2DFEA 3ZT2A 3KJVA 5KT3A 4IFVB 4CHYA 4MFBA 2D0CA 3RB3A 4JV0A 4NLGA 3ASMA 3OS0A 3KKSA 4ECXA 1K6YA 4KHWA 3G10A 1C2PA 4Q44A 3V1RA 3FFIB 3I0RB 4URSA 3AVMA 3NF7A 3CJ2A 3OYDA 2FVSA 2XWYA 3OYNA 5KFEA 1NJYA 3OL8A 1JL1A 3RMBA 3KTQA 4DSFA 4E7JA 4G1QA 5DK5A 2WHOA 3EZUA 4DTSA 3MEDA 4E7IA 3VQ7A 2HWIA 1SUQA 1DTQA 2IC3B 5KG7A 2BQUA 1DLOB 3G86A 1SKRA 4IRDA 5KFNA 5DLGA 4Q5VA 1J5OB 5J2NA 3D45A 1WAFA 5EU7A 2V4RA 1W0HA 3TI0A 4R5PA 1T8EA 3CIZA 3GV5B 4O4GB 2IM1A 3P1GA 4HUGA 3CJ3A 2HB5A 5JUMA 3OHAA 3MXJA 3TAFA 1HNVB 1JLAA 4DTOA 1JLEB 2P1JA 2JGUA 4JRPA 3IRXB 1RT1A 3CDUA 3DDKA 2FVPA 5EWFA 5KG3A 4BDPA 1KLNA 4ID1A 4IG3A 4K8ZA 4CF0A 3LWMA 3D5MA 3NF9A 4J9RA 4DMNA 3AO1A 3U3YA 1YTUA 4LSLA 4J9SA 5EWEA 2B43A 4KPYA 2OPSA 1NK8A 1KFDA 4IR9A 4N56A 3TAPA 3TWHA 3LAMA 4OVLA 2HHSA 3GIKA 3QZ8A 1L5UA 2HNDB 4ZHRB 4DL2A 1NKCA 3VQPA 1ZYQA 1EX4A 4MK7A 1N4LA 5CYQA 4OJRA 1KVBA 3M8PB 4M94A 4LSNB 4XPCA 4Z4EA 3F73A 4BDZA 1S4FA 2KFNA 3KLFA 5D3GB 3K5NA 2IMWP 2R2SA 4N5SA 3VQSA 4HUFA 3EY1A 3M9NB 2O5DA 3OL6A 3IGNA 3I0RA 1RBRA 4ZTFA 2VA3A 3OL7A 5KFZA 5J2MA 4CEBA 3HVTB 3DLHA 2AX0A 3TAMA 3QIDA 4F4XA 1NOYA 3KLEB 1G15A 3ZSOA 2KW4A 1A5VA 2UVVA 1IKWB 4CGGA 3K58A 3C6TB 3SI8A 4I7FA 4CJSA 1J9AA 4M3ZA 2R2TA 2HNZB 3CG7A 5SZTA 3LWLA 4HHTA 5HRPA 4WYWA 1HQEB 4FJ9A 2IGIA 3OYIA 3NGZA 3PW2A 4J2BA 1JKHA 1YT3A 3IAYA 4OL8A 3HYFA 4RZRA 1T05B 3OJUA 4W5QA 3BGRB 4TY9A 2FBTA 1SH2A 5KT7A 3V9ZA 4F8RA 1N6QB 1SL1A 2UVWA 2GV9A 1TK8A 4F3TA 3ZSRA 3QETA 4I9QA 4CGDA 4Z4GA 2RF2B 1Z4UA 2AGQA 1NJWA 4TSXA 2HNZA 3LALA 3PR5B 2J6UA 4DF8A 4ICLB 4J9NA 5JS1A 2DPJA 4B9MA 3VQ8A 4IRCA 4CK3A 3DRRA 2B5JA 3GV8B 5KTQA 4Y1CA 4ZP9A 4O4RA 1X1PA 2A1SA 5L1JA 1HRHA 3FRZA 3TABA 2WB4A 1T94A 3ISNC 2E6MA 5KFLA 1LAVA 2BE2A 3RTVA 5I3UB 3ISND 3RMAA 4ICLA 4CGJA 3ZCMA 2RKIB 4IH6A 1VRTA 4KFBA 1MU2B 1LW2A 1S9GA 4CEZA 4ECZA 2IBKA 1T7PA 1VRUB 1B9FA 4DG1A 1X9SA 4CFCA 3K57A 1WSHA 3OJSA 1S49A 3HPOA 3DI6B 2Z1IA 3G0ZA 3OYMA 5KFVA 3FDSA 5KG4A 1VK0A 1GOAA 4AHCA 3I0SA 4GMJB 4CCHA 1UA0A 1CZBA 1Z26A 1C1CB 4ZPCA 2RDJA 1KCFA 5DLFA 2HNYB 3DRSA 3UDLA 2XO7A 1WSEA 3PW4A 4DU4A 4DTRA 4CJLA 3SQ1A 3UQSA 3NGYA 3MAQA 1BI4B 1S0OA 5KGWA 4TQRA 2G8WA 4IRKA 3OYEA 4DU1A 4CECA 4XIUA 4QW8A 3ZT0A 2W9CA 1JIHA 3ULDA 4RNNA 2EX3A 4PY5A 1OS5A 1U47A 4FYDA 3BSAA 2X6NA 2WONA 1BCOA 1FXXA 4Z0UA 4KSEB 1S1WA 1NK4A 4TY8A 3QIOA 1XR6A 4AILC 3RBDA 1S1VB 4YNQA 4DS4A 4K4VA 5C25B 4CF8A 4LQ3A 5CYMA 3T19A 2E6LA 4HUEA 3PW0A 4EZ9A 4AH9A 1C1CA 1GX6A 3PV8A 4DL6A 3CWJA 2R8KA 5FROA 4LH5A 4IDKA 1WSFA 4CHNA 1WLJA 1TKXA 4DSEA 4BE2A 3QNNA 1T03A 4TY8B 3C95A 4KREA 5KRTA 2FVQA 3SI6A 4ZMMA 3KKRA 4NLYA 5F8HA 1HPZA 4H4MA 4J9MA 4MH8A 1HARA 3TAGA 1RT3B 2W9CB 2FC0A 3CFOA 4CGIA 1S9EB 1I3AA 3CYMA 4QOZB 4EBEA 4URQU 5J1EA 1HNVA 1NKBA 2YNHB 3L2WA 4RW9A 4QAGA 3P83D 4ECTA 2F8TA 3S3OA 4L8RB 3RMCA 1D8YA 4B9UA 1U4BA 4WE1A 4ECYA 5KFKA 3JSMB 4I2PA 4ID5A 1TVRB 4KRFA 2BE2B 2WK4A 3QEXA 1KHVA 4CEAA 4OGCA 3FQKA 2WRMA 1YVFA 4ED6A 2ITGA 5JXSA 2C2EA 4RW8B 3BQ0A 3DRPB 4FJ8A 5C5JA 1CXQA 1QSSA 4NLQA 5J2NB 2IA6A 4G1QB 2UVUA 3CQ8A 3MF5A 4DTMA 4KHUA 3VQ4A 4HKQA 2I5JA 3ZT1A 5KT2A 2G8HA 2O4GA 4C8LA 1HQUA 3BREA 3CVKA 4B8AB 1ASVA 4CFAA 3SNNA 4FK4A 1FKOA 1HQEA 2FVCA 2A1RA 5L1LA 4HCBA 3CO9A 4PUOA 4EYIB 3G6XA 3V81A 3BJYA 4HCCA 3NE6A 5KFJA 4RNOA 3KJVB 4OGEA 3KLEA 4EP5A 4E1MA 3V9UA 2J6SA 4DL5A 4N41A 5KFXA 3NGIA 4EO6A 1RT6B 1S9EA 5KFCA 3DOLA 4E7LA 3T1AA 1KVCA 2YNGA 4M45A 4OPJA 3LP0A 4F4ZA 2IAJB 2FVRA 3NCIA 2QXFA 3AVKA 2VWKA 2G8VA 1TKZA 2HMIB 3L3VA 5HROA 2WCXA 3KIOA 3UPFA 4JS4A 1RNHA 1JXLA 4CJ4A 3QLHB 3OYKA 5L9XA 1S0NA 1QQCA 1MMLA 3QIPB 4KI6A 1Z25A 3PX0A 4KB0A 1RDCA 3V6HA 1N5YA 5CYMB 3UIQA 4CIGA 3NH0A 1WSJA 1TAQA 4F3OA 3VQBA 1RBSA 4CIFA 3Q8SB 3P5JA 4DQIA 5KFWA 3TAMB 4JV2A 5EWGA 3EYZA 1U49A 3SJJA 4KHNA 4DTXA 4K4XA 1HYVA 4CFBA 4WXWA 1JL2A 3DM2B 3KLVA 3IG1A 4AHSA 4KHYA 3QZ7A 4JS5A 3OSPA 3OVNA 5EUHA 3QESA 5T14A 3QEVA 4BACA 3V81B 1ZBHA 4CGHA 1LW2B 4R5PB 1RT1B 4EBDA 3TQ1A 3HO1A 3NGDA 4CEEA 4RW7A 1GX5A 1VSEA 2E9RX 3AA5X 4B3OA 1IH7A 1FKPB 3I5BA 4QWDA 4ED7A 3CFPA 2AX1A 5HBMA 3PO4A 4M3RA 1S5JA 1ZTWA 3H2LA 3MR3A 2D7SA 1D9DA 1X9WA 4JV1A 2XY8A 1XHXA 4UQGA 1HYSA 5L1IA 4NLWA 4BDYA 4FLTA 4CHPA 4OLAA 5F8GA 3AV9A 2EHGA 4R0EA 1S48A 5HRNA 1S9FA 3KK3B 4DL7A 3EZ5A 4E3SA 3MR2A 2IM2A 3VQ6A 3L2RA 4EBCA 4DFMA 2GBZA 3SQ0A 2HHQA 4RNFA 3AA2A 3IG1B 2BRKA 4GVMA 1S1UA 5E41A 3M8QB 4O3OA 4OKEA 2EC0A 5FDLB 4O3RA 2F8EX 1BQNA 1O1WA 4FLZA 4K4YA 1EP4A 2DFHA 3Q8PB 4E19A 2VG6A 4ECVA 1SV5A 4IKAA 3E51A 2JEFA 3QO9B 3LP0B 1RT3A 1IKXA 1IG9A 3KLHA 1HNIA 3HP6A 1L3UA 3HJFA 1NHUA 3ITHA 2XY5A 3GV7B 4AHVA 4DSLA 2XRIA 1Q8IA 1R0AA 4AHRA 4WFZA 3KHHA 5KG1A 4CFDA 4Z4HA 2PYJA 4B9SA 1REVA 3PX4A 3HP9A 3NFAA 2W9BA 2YHAA 1HMVA 1C1BB 3IN5A 1KVAA 4DU3A 2ASDA 2OPRA 1QSYA 3QEIA 1YVUA 4I7FB 3LP1B 5DGAA 1JLQB 1I6JA 5DG7A 5HRSA 2BQRA 4ZP7A 2AU0A 1ZETA 3AVLA 3H4DA 3AO5A 1TKZB 4DG1B 2HMIA 4IG3B 4CEOA 3PW5A 4E0DA 1RT2A 4FJHA 4NLXA 3H98A 3C6UB 2CJQA 4QWEA 3I8DA 4NLPA 4DL3A 2JEIA 4Y3CA 3KK1B 4RUCA 3NH1A 4CERA 4NLSA 1JLFA 3H5XA 3QGIA 1CSJA 3TAEA 4FBUA 3T5HA 3V1OA 1SKWA 3O4NA 4E89A 3LANA 2B5JB 3MFHA 4HVJA 3K5MA 2ZQBA 1J5OA 1U04A 4W5TA 3DLGA 4ED3A 4NLTA 3DLKB 5HBMB 1QS4A 4K4ZA 3OLBA 1C1AA 1FKPA 2P51A 3WNHA 1S6QA 3VQQA 3SV3A 3AO2A 4YFUA 2WOMB 4J9KA 1TK5A 1Q9YA 1VRUA 1IKVA 2C2RA 5F8NA 4RW9B 4ELTA 1TKDA 3ZSWA 5KI6A 2D5RA 2OPRB 4KHSA 3EPGA 1RT7B 2OH2A 2IS3A 3BDPA 3KLHB 4RW7B 1ITGA 4RW6B 3H08A 2GC8A 5DMRA 4NCGB 3DLEB 1W9HA 3OL9A 4GC7A 3KLIA 1S1WB 4IFYB 1SH3A 2Z1HA 2QE5A 3CM5A 3HVTA 1IKYB 4CGFA 4O3NA 2G8FA 4LQ9A 3PO5A 1HYZA 5KGXA 2E9ZA 2HVIA 4RW6A 3QO9A 1J53A 4FZZA 4KO0A 1RT7A 1LV5A 2Z1GA 1N6QA 3HPHA 3V6DB 3ZT4A 4KKOB 3NBPA 3NF8A 4ED8A 1XR7A 2FJVA 3KLIB 4I2QA 1S10A 3BQ1A 2ASLA 2W7PA 4I2QB 1R0AB 3GQCA 4QPXA 3AVNA 3H4BA 1C0UA 4J9QA 2PZSA 3GILA 4LD0A 1L3TA 4C8KA 3CJ0A 4K4SA 1NK6A 3DOLB 2ALZA 1SV5B 3SZ2A 2I5JB 3L3UA 2OPSB 1WSIA 1RTJB 1IM4A 4LSLB 2GIQA 2JEJA 1IKVB 3AA4A 3TANA 1UAXA 1XI1A 2WONB 3SFUA 1KRPA 4IH7A 4KTZA 4IH5A 4BE0A 2JLEA 4CESA 4DWIA 4KHQA 3THVA 4H8KA 3QEPA 3S3NA 1RT5B 2IM0A 3MFIA 3MXIA 1XC9A 4ID5B 4TN2A 3JSMA 3KK1A 3VQ5A 5T7BA 2ATQA 5C42A 5HP1A 1QE1A 4AHUA 4DTNA 1L3SA 4FS2A 3DOKB 3OYFA 3RAXA 2WOMA 4RW8A 5KFMA 1HYSB 2W9AA 2BQ3A 3AVFA 4ZHRA 2HNYA 2YNHA 4RW4A 1S9GB 4ZTJA 3H59A 4KAIA 1XR5A 3Q8QB 2XC9A 2FLPA 1Q9XA 5K14A 1NK5A 1CLQA 4KB7A 4MIAA 3RRHA 3DLKA 4I2PB 5I3UA 1N5YB 4G3IA 3RRGA 5DG8A 5DQHA 4F2SA 2ILZA 2YKNA 3B6PA 1RTIA 2BGGA 4Z4FA 3DOKA 3K5LA 4DTUA 4DFPA 2O4IA 2VWJA 5CZ1A 1F21A 3NF6A 1MU2A 4ED0A 3IRXA 3KHRA 1GOCA 1T05A 2XI2A 5KFSA 1BQMA 4ZVHA 4Y34A 4ECSA 1ZBLA 4KO0B 2QV6A 3D28A 4N47A 1HMVB 4ED1A 2YNGB 1WNSA 3SUPA 1EETB 4RNMA 1KLMA 1EKEA 5C24B 3ALYA 1W25A 2YNFB 2V9WA 1TL3B 3VQCA 1BQNB 2C2DA 5HROB 3LP2A 2LSNA 5FDLA 2FBXA 4J9OA 3RWUA 3KHGA 4YR0A 4LH4A 3IS9B 4FLVA 4KV8B 3NL0A 1SH0A 3PX6A 4DQPA 4ELVA 1C1BA 4U7CA 3MEDB
chains in the Genus database with same CATH superfamily
4WU2A 4FW1A 4Y0FA 4OI0A 4FJJA 5C2GA 1K1QA 4RJVA 1SQEA 2RU9A 3TEHB 3OTDA 2GNKA 3TX8A 1S1TA 1KVIA 5KG0A 2UU9K 2B8QA 3D2FB 3DAWA 5IM0A 2QO3A 3QFHA 3W60A 1A5XA 1WAJA 2VG7B 1HJRA 4FLYA 4WK1A 2CQ2A 1L3VA 3NKYA 2YWGA 3IFEA 2HHVA 1WN7A 1HBMA 2RU3A 2RQMA 4AM6A 5CH7B 1BIUA 3QDKA 3LDOA 1VLOA 2MKKA 1RBVA 4H0TB 5KRSA 2VZ9A 5GINA 1J2VA 1U09A 3I4PA 2B9XA 1VSIA 2ETJA 1KS2A 1YHQS 2DEJA 2KZZA 4P73A 3J80Y 2VONA 3UR0A 3U1LA 2KZMA 1M5KC 3O9UA 3RBEA 1SPBP 2QX0A 1FWPA 3TSQA 1RBTA 2OCEA 2QLFB 4OLPA 5KFGA 1IWGA 2LLZA 4MMOA 4MIBA 2DPIA 3D0PA 5C0YA 3C15A 5ETSA 2DH8A 1WTBA 1YRUA 4O8KA 5MLCV 4BR7A 3GJSB 3PR4A 3PIOQ 3HX9A 2JOQA 2CQIA 3HHKA 3A5NC 2FZKB 5D0EA 1CZ9A 3PJWA 2RKIA 2M4MA 3HF5A 2UUBJ 4WK3A 5ETLA 1HI0P 4GVBB 2X1FA 3W3SA 3C6UA 5F8IA 3KD5E 4LY7A 5C25A 1ILYA 3B4MA 1JXBA 4RU2A 4CJRA 5KFPA 3KNAA 3L7OA 4DV5K 4OKJA 1F9HA 2PMHA 3R9PA 2AMCB 2HHUA 1ASUA 5GAHP 5FRMA 2BEFA 3ZZYA 4HVZA 1YTAA 3M5RA 3BKUA 3GONA 3L8BA 2DYAA 4LFCF 2W2QP 1NJIO 5HMYA 2GMLA 4TXSA 5AE3A 2C22A 2C3PA 4RU9A 3C15B 1VSFA 3OVBA 1BI4A 3D3CJ 1H1VA 1Q53A 4CLTA 1BISA 2OZSA 4FJ7A 4FP9A 4B08A 4DV5F 4IR1A 3ZYYX 4DR4F 5ETRA 3RR8A 5AJ3J 4BRMA 3CMES 1S6PB 3SSRA 3GSDA 1JLBA 3ZFVA 3M3ZA 1D1UA 1EXQA 3VENA 4R25A 1O6XA 4UUWA 1K8AO 1Q1KA 5T7LA 2N4DA 4CEDA 3AA3A 2NZTA 5FPNA 4JI3K 4YHHF 3M8PA 3V6KA 3ZT3A 1MA9B 4LF1A 3FKBA 3DRRB 4P6QA 1NDCA 1KAYA 4M3XA 1U6BA 3MECB 3MM9A 3CDEA 2DR6A 3CJTA 1NSKL 1GFWB 1I1GA 3DKDA 1VSLA 1SZ2A 1TZ0A 1WSRA 3U8XA 2WTFA 3HOSA 1NHVA 1KQGB 4CJEA 3CJ9A 2IJFA 4CLFA 3IAS9 3PW7A 3OTEA 2R8IA 2OHDA 4B3MJ 4JI4K 3QT5A 3GIJA 3KK2A 4YHHJ 2Z8QA 5AQSA 3TZXA 2IVOA 3CCRN 4M3UA 2BZ2A 1U2VA 3PYFA 5J2MB 3MMBB 4MKBA 2VASA 4R0JA 1WD6A 5KFOA 2EW9A 4O44A 4G65A 2ZGZA 3JYTB 5M2PA 3WNGA 2ZH9A 1VQ9N 2G0JA 4DHYA 1E6YB 3MCNA 4PWDA 2GW8A 2H3EB 2VBZA 2CYYA 2HHPA 4FVCA 3M9MB 1AROP 4DZ6A 4NOHA 1VQ6S 3A5OC 5CZVA 2AGOA 2UVRA 4ANCA 2LQJA 3J7YP 2ZOFA 2V63A 2XMVA 1U0SA 2XS5A 1VSKA 2CUYA 3D6RA 2XY7A 4DSKA 4WJBA 5F0WA 2I7PA 4NYPA 1Y7PA 2QC3A 3AJ2A 4CE9A 4Q8FA 2ZZNA 2KRBA 3GZ7A 3JTNA 2B0GA 2L3MA 2MQNA 2Y1JA 1F2HA 1UAWA 5KFRA 5AJ3K 3V9SA 3AVGA 3NAHA 4PXBA 3AB4B 2QYCA 5I3QA 4XPEA 1C4AA 2YX4A 4WU3A 2M52A 2Y8YA 1ZBUA 3CCLN 3WX8A 1KQKA 3T9ZA 1O5JA 4IDHA 4X62K 1EETA 1ZTTA 3HZ6A 3DYAB 2DGXA 1RBUA 2NR0A 1FKOB 1D9AA 3QWPA 3HLUA 1M5PC 3P5BP 3P96A 3SPYA 2HBLA 1WACA 5EY4A 5CR4A 3M2UA 1S1TB 4BY9C 3LH2S 4PG6A 4P9SA 4X4TA 1D0EA 2XYPB 4X66F 4H4OB 5FRNA 5CCMA 1NEEA 2MTLA 5L9NA 1UFKA 4PL8A 3PUFA 2AJ0A 2CVIA 2HFVA 3I5AA 3UB5A 4DUZK 1H7XA 4OPKA 3TARA 1P1TA 2QG9B 2FZCB 2FLLA 1FA0A 2GO9A 5CHIA 4I67A 4EEYA 1JJ2R 5DM6Q 3QIPA 3AAWB 5AJ3F 3QYYA 1TKTB 4ECWA 2LEAA 3VV2B 4NRUA 5JVHQ 3EGZA 4C6AA 3ET6A 4ZVTB 3CGIA 3SAGA 3PSIA 2HMPA 2XSFA 2QEXN 4ZPAA 2HQCA 3AVCA 3ULHA 4NZ6A 1K1SA 2X6SA 4B17A 4KPCA 3K5OA 2FLOA 1B99A 4FWPA 2K06A 2M8DB 4B3TJ 1F5AA 1LWFA 1JLGB 3ET6B 2IIRA 4MK8A 4CLSA 1RAJA 5IT9O 2R8JA 3HOTA 4NCGA 1SBRA 1JKHB 1TELA 4DQSA 5IC6B 4CI0B 1NGHA 3KOAA 1BIZA 4HI2A 2KI2A 4DN9A 1RAAB 2CGJA 4Q0BB 4YN3B 5KOXA 3SBGA 1FWLA 5B0EA 3MM5A 5BRFA 1YAGA 2CQGA 5LY3A 4U96A 4H4OA 4LF4F 2P5VA 1RA7A 1U0HA 1VQ4S 5BPLA 3B78A 3GYXB 5A6WA 3VA0A 4DQQA 5HMWA 1PKUA 2HVZA 3EJMA 3O5TB 1LW0B 4FF3A 1GLFO 4J9PA 3H40A 4BROA 4Y2KA 1EP4B 3A1YG 4YB6A 1V5VA 2E1PA 2U2FA 2XEXA 3Q83A 1EIYB 3NS5A 1VC6A 2XSJB 3M8QA 2DNLA 3ULEB 1CJUB 3BN4A 3F2KA 3CMQA 4CF9A 3SDEB 2AJ4A 1JCFA 4F36A 3PJXA 3OBWA 4WQ5C 1X9MA 4FK2A 4J8FA 2CQBA 3QINA 4DN0A 4YDUC 2AHOB 1V4TA 3OQ2A 2POKA 3I8BA 4Y2CA 2ZE2B 3RB4A 2EVZA 4EO8A 3HVAA 1QE1B 2B51A 3CTRA 3VF4A 2X74A 1VSJA 2HAIA 3HFZB 5CY4A 5J1EB 1T3VA 2XULA 2GO8A 4O55A 2F7VA 4EP4A 1JLCA 1RT4A 7AT1B 4LFAK 4YOEA 3TU5A 3AODA 2ZVIA 3HHLA 4KT0C 4WCEL 5LMNK 3E9OA 3W5ZA 2RD5C 3AO4A 2JVOA 3Q8YA 3L7UA 4EUVA 4B1UB 2CDRB 2ZKTA 1KSPA 2RB7A 2D4WA 3JXOA 3FVYA 4CZMA 4OZ2A 3D1HA 4KHMA 4OZJA 4CJWA 3THTA 3TO8A 4M5IA 4BC7A 2K7JA 4WXOA 3PHTA 3UCZP 3QJJA 2G8KA 1LK5A 4JAXA 1NOZA 4DFKA 2F8HA 2H54B 1JB0C 3H3NO 4OHWA 4IYQA 1UWBA 1BOTO 3WXKA 3AVBA 4DR6J 1KFSA 2KB2A 4MK9A 4NZ0A 1NJIT 1WF2A 3GJTB 2Z30B 2CJ9A 4FPRA 3D6FB 3OLAA 4IFYA 3M1VB 1FRKA 3N6LA 3MR6A 5KFQA 4KB1A 3CDAA 4ELUA 3QFPA 1URNA 1X0PA 3GJQB 4ZLJA 3MR5A 3CJ5A 1G4CA 2VD3A 1T6CA 4E7HA 2BJ3A 1NK9A 2HHHK 2A6AA 3T5JA 4ES3A 3TTCA 3I0SB 3MECA 1R8AA 1RTDB 2ILYA 2CWXA 1P9YA 2VU5A 4M5JA 4HHHA 4NRTA 3DM2A 1FKAF 2XTJP 4B3RF 3CCEN 2Y1IA 5C42B 1KR4A 1LKZA 4CHQA 5IQ6A 2C42A 2PYLA 1NGAA 4O0NA 3RMDA 1Q0NA 2W6KA 1KWMA 4L75A 4FWRA 4LF6K 1JJHA 2XS2A 4LR9A 2XI3A 2E2PA 4Y1DA 4CJKA 1FK9A 3W64A 4NYZA 4NL5A 2NRXA 5HP1B 4V19S 1ZM4A 3SAFA 2RAQA 1N8RO 1E4FT 1CS4B 1JLAB 5KT5A 2UXDJ 1RHMB 2HHHF 4CZLA 3GR0A 4RUAA 3PZPA 5HJYA 1RT2B 4J2DA 2UUWA 4FJKA 3VAKA 2RVJA 3B54A 4PXDA 1V6HA 4DR5K 2D0CA 2Q0UA 1X5PA 3C16A 4TNOA 3VVUA 4Q44A 3I0RB 5LMNJ 2XB2D 3A8KA 1ITPA 1RDWX 2AP1A 1NJYA 1CJVA 2DH7A 2RH3A 4LF5K 3ENHA 2CQ1A 2FSKA 1MN9A 4ENOA 2YKPA 4E7IA 2EG2A 3K9JA 2OEMA 3POTA 2E1ZA 5I3PA 3UD3P 4WQ4A 3PJ9A 4CZCA 4RWXA 4EHUA 2BQUA 1SKRA 1B0PA 4IRDA 1VDHA 5DLGA 4HT7A 1HNZF 4UOGA 3AOAA 2KT3A 2W7AA 2V4RA 4R5PA 1X4DA 1T8EA 5AQJA 1S72N 3AOBA 3C65A 2HB5A 3UKUA 2JHEA 5JUMA 2BJ9A 4CBUA 3SEOA 3RW6A 4P52A 1JLAA 2DR7A 4DTOA 2HBQB 5C2DA 2GEMA 4B1WB 4F3QA 5K20B 3I32A 2CA9A 1Y0HA 4UOFA 2ZITA 5EWFA 2R42A 3CCWA 4WFAL 4ID1A 4IG3A 4YDUA 4K8ZA 4CF0A 5LSOA 2DVIA 4JI6J 4PL7A 2CJXB 3U3YA 1YTUA 4DCOB 5BRDA 2B43A 4KPYA 2A5XA 2OPSA 3DRYA 1X3NA 5M1FA 4IR9A 2X3GA 2P9SB 3F0NA 3LAMA 1X3MA 4RTFD 2HHSA 2QLJB 3GIKA 1QZ5A 2QWQA 3JSRA 3QZ8A 3M6XA 2HBRB 1L5UA 2A10A 4DL2A 1NKCA 2CIMA 4JI1F 5CYQA 4OJRA 3MDQA 3M8PB 4M94A 1S4FA 2KFNA 4N5SA 4BC9A 2ZEJA 4HUFA 5IV4A 4BRCA 3EY1A 5HVFA 2LCWA 3BB5A 3IGNA 2V4JB 3OL7A 2UXDK 2N7YA 4CEBA 1VHFA 2X1GA 2RSQA 3TAMA 4WKYA 3ZSOA 2KW4A 2UVVA 4CGGA 3K58A 5A8WB 1ZBSA 1V3SA 4DR7J 4NO7A 4I7FA 3NY0A 3RSEA 4MKYA 4M3ZA 2R2TA 2HNZB 5SZTA 2HGLA 1HQEB 4FJ9A 1NWKA 3OYIA 2OD6A 2E2OA 1YT3A 4RZRA 4J7CA 1T05B 1NU4A 3CQXA 4A8WA 4CO2A 3M32A 3BGRB 2FBTA 3ZTPA 1VBXA 3A13A 4F8RA 1N6QB 1SL1A 3QETA 4I9QA 2RF2B 1FRJA 4TU7A 4TSXA 1NSQA 2HPUA 4ZCIA 2O8EB 5H9EJ 5ETQA 5HJXA 1FTRA 3C7NA 4CK3A 3CJ1A 4CM2A 2B5JA 4Y1CA 1WDDA 4ZP9A 4O4RA 1HRHA 1SQGA 4C23A 2NXCA 2ZBRA 1PJ7A 4OZNA 1BWEA 3H20A 4OZ0A 2WVCA 2BE2A 2HQ3A 4ICLA 1N33J 1WOQA 4CGJA 3ZCMA 1ULRA 1LOTB 5HO4A 5AQXA 4TU9A 1MU2B 4A59A 4MT1A 4P72A 3THPA 2XMJA 4HH1A 1X9SA 3WXIA 4GO5X 3OJSA 1YITS 1L3KA 3DI6B 3G0ZA 5KFVA 3FDSA 2MB0B 1GOAA 1UVKA 3W8PA 3GIRA 4BRPA 2ZOMA 1UA0A 1Z26A 1C1CB 4JYAK 1TMJA 4USJC 1UEVA 1WUUA 3DRSA 4DU7A 2ZNYA 2Q1NA 2BMBA 2BOAA 2F4VF 3R9LA 3HFVA 2FGCA 1OQ3A 1HWJA 3TW0A 3MM7B 3D66A 4PKHA 3MAQA 1HNWK 1S0OA 2Z0GA 4DR3J 3D2FA 2C2ZB 4Q2LA 2W40A 4CECA 3BN7A 4QW8A 3B6BA 4PY5A 2G13A 3QRPA 3AFGA 1N33F 3C14B 3GCXP 2X6NA 2WONA 1BCOA 5AQFA 3NXZA 4DV2K 3ENOA 4DPOA 1XR6A 4AILC 4YNQA 1I94J 4OYPA 3DFEA 2J7UA 3CCUN 3T19A 4CQ1A 3HKZD 4AH9A 3H6EA 3RUBL 5BR8J 4DR7K 2R7UA 3LM9A 3TJ8A 2ADCA 2H5EA 2R8KA 3J81Y 2RRNA 1M5HA 4AQYJ 1WSFA 1WLJA 3MM7A 4RX6A 2B4OA 3PDNA 4LIWA 3FCWA 4JHDB 4H03B 2N4CA 3SI6A 1OWXA 1FHTA 1HIYA 4MKVA 1B70B 3TAGA 3B8AX 1RT3B 3PTWA 3CFOA 4A48A 1TL5A 4QOZB 4URQU 5HQ8A 1WEZA 1QQOA 2CZ4A 4ZDNA 2X1AA 2YNHB 2E1AA 1OYDA 4JKGA 4YOUA 5DJBA 3NMRA 3ILJA 4L8RB 3RMCA 2VQFK 4ISFA 4GVEA 3VAGA 1U4BA 2KVQE 3GLJA 3JSMB 4Y2MA 4HR2A 3HHDA 3MWPA 3ZZ0A 1FDAA 3SBTA 3WC2A 2BACA 4OX8A 4OGCA 4DMZA 1YVFA 4B3SJ 3I87A 4ZS6A 5C5JA 3X3UA 4LFCK 5DDOC 1HLUA 2KM8B 4ALZA 5A8KB 3CQ8A 4KHUA 4DBQA 4BR0A 2FQQB 4H4KC 2BE7D 4C8LA 3OFFA 3CVKA 1UVMA 2ZDOA 3MCMA 4M5LA 2DO4A 2EK1A 4I6AA 3SNNA 4FK4A 2A1RA 4NI2B 2W2MP 5L1LA 2R7RA 3FBFA 4PUOA 3G6XA 3BJYA 2QSFA 2PFFB 3W2VA 5IWAK 4B02A 4E1MA 3VZIA 4DL5A 4N41A 3MX5A 1K8KA 1HBUB 3T1AA 5SUHA 4F4ZA 1N5SA 2O3DA 2UUBK 3AVKA 4NASA 2IRUA 2G8VA 1TKZA 3T1YJ 3UPFA 4QR0A 3H2UB 5LMUJ 4JS4A 2HZAA 4ZJQA 1K8AT 3QLHB 3OYKA 2GQ2A 1X4GA 1QQCA 5AXLA 2IMOA 1GH8A 5CYMB 2BBEA 4C3LA 4CIGA 2C2OB 4USVA 3BV8A 1YJRA 2B3TB 1TAQA 4K2XA 3L6QA 2FHMA 1DFDA 1RBSA 3MCOA 3Q8SB 3P5JA 4DQIA 2OSRA 1RGVA 3EYZA 1U49A 2JJ4D 3ZTQA 3SJJA 4DTXA 3DDNA 3VAJA 4CFBA 2AYGA 3DM2B 4BRFA 1R31A 5D0GA 5D15A 3VAHA 1RLCL 2E7XA 4LF7F 3QESA 5T14A 2RHSB 3CJ8A 1LW2B 5CZXA 3TQ1A 3NGDA 1GX5A 2RDDA 3BPSP 2DR9A 3BGLA 3M8ZA 2DNHA 4B3OA 1FKPB 2CWKA 3BKFA 4QWDA 3ZX2A 2AX1A 2VQFJ 2CDQA 1AUDA 3H2LA 3MR3A 3UKUB 3FZMA 1Q82O 1T9VA 2ZJPQ 1HBOA 2AZ3A 4LF6F 4DL0C 1VISA 3VQTA 2CGLA 3DRXA 3HD2A 5BXIA 2W1BA 4CHPA 4UY8T 2EHGA 5HRNA 1RWPB 2HRYA 3KK3B 3EZ5A 1Q18A 1HNZJ 4U8YA 4B3SK 1IR2A 2GBZA 1FRMA 3SQ0A 1SC3B 1FJGJ 1FXRA 2BRKA 2PN6A 3G8TA 4O3RA 2JWKA 5GMDA 4K4YA 2UXBF 4IWVA 1KC8T 2QT7A 3Q8PB 4B3MK 2ZZMA 1NGCA 4JI4J 4IKAA 4YHHK 5IWAJ 5EHHA 1YUWA 2HF4A 3C16B 4KRWA 5DM7L 3TA0A 1X0FA 1Q8IA 1PSDA 3KHHA 3BZQA 4Z4HA 2I8EA 2PYJA 1REVA 3HP9A 1TUVA 2YHAA 3ILLA 5M2UA 3UKRA 1HMVA 1C1BB 2YQ1A 2G4BA 4B1YB 2AF6A 3R5DA 5HSPA 2OPRA 1N52B 1YVUA 3I82A 2ZJRQ 4OJ1A 3T9NA 1FX2A 3AT1B 1MN7A 1I6JA 2G0CA 1PIEA 3IKMA 4C11B 2F4VK 1UVLA 3QGPA 4JI7J 1GXTA 1TKZB 3MCAB 2KO1A 1ZBTA 4WKRA 4JI8F 1NGFA 3B8HA 2OMOA 4NLXA 5JICA 4PPZA 5AZIA 2CJQA 4QWEA 4DL3A 1S12A 4Y3CA 4ZLNA 3KK1B 4CERA 1JLFA 3ENAA 3H5XA 2UUAK 5DM6L 1ZA1B 2F40A 3RBZA 1B7FA 1HBMB 5A76A 1B7YB 3VWSA 3V1OA 1OH6A 1KD1O 3DGVA 2Q97A 5ETVA 4HVJA 2KFYA 3R1HA 3C7NB 1J5OA 4QBUA 4ED3A 3DHXA 4NLTA 3CJ7A 1F0XA 4XTTA 2HQIA 4Y0WA 5HBMB 4ZOSA 2I7NA 1QS4A 3OLBA 3NGKA 4NXNJ 3P8BB 3UNGC 4DR1J 2WB1D 3QBWA 1ROFA 2I38A 2ZH3A 3AO2A 1LFPA 4J9KA 1TK5A 2OD4A 4C98A 3CCJN 1C0FA 2CADA 3UO0A 4KHSA 1RT7B 5C12A 2OFGX 2CRLA 2XYGB 3K5PA 3VALA 2GC8A 4KGKA 4QIFA 1J5EK 4KY3A 1IR1A 5F3TA 4BBYA 2DNKA 4PCQA 3KLIA 3R6MA 2JLFA 4FWOA 1SH3A 2Z1HA 3CM5A 1RWOB 5KGXA 2HVIA 2PSZA 4ZK7M 1RZMA 4Z7CA 3WX4A 3PIPQ 1MMDA 3JTPA 3N5BA 4KHPF 2OJ3A 4NXNF 4ZIVA 3NF8A 4HEA9 4RUHA 1XR7A 2L9DA 3FZLA 1PJ6A 2BJ1A 1VIOA 3FBBA 2ZNZA 4I2QB 1DEJA 1ATRA 3M1FA 1R0AB 3NG8A 3QJPA 3I33A 3MAAB 4J9QA 4YUDA 1SC4B 5DS7A 4C8KA 4CW7B 4I64A 4NYOA 2N3OA 3SZ2A 4ISEA 1IM4A 2GIQA 4DUYK 3AA4A 2P9LA 1UAXA 1XI1A 4WQ5A 4IH7A 4KTZA 3UVJB 1N0UA 2F4FA 3LL3A 5BR9A 4BLGA 2JLEA 4QZVB 2W4CA 4KHQA 2XMUA 1G3OA 1XC9A 3WXLA 3GFZA 3KK1A 4ANEA 1U1LA 3OFGA 3CHWA 5T7BA 2FSJA 4OPAA 2VQEF 4AD6A 4DTNA 4CIOA 4FS2A 3DOKB 3BF3A 4LJMA 1HYSB 2W9AA 3CERA 4RUBA 1RI7A 1NBWA 3ZZZA 3H59A 2QL7B 3Q8QB 2XC9A 2DGWA 5K14A 2QXLA 5BREA 1RK8A 4C7QA 3OV7A 5DQHA 1G6BA 2E7VA 4DHVA 4F2SA 1QVFM 1RTIA 3DOKA 3K5LA 4NXNK 1YRXA 2O4IA 2VWJA 1N5TA 1MU2A 1U26A 3KWMA 5IT9U 1GOCA 4WF9Q 4AQYF 5KFSA 2VICA 3DNCA 4Q2MA 4ZVHA 1VQ9S 4ECSA 2OI2A 1C4CA 3VMFB 4IOCL 3DOMB 4ED1A 2YNGB 1WNSA 3SUPA 3J7YI 2EBGA 1KLMA 2IRYA 3KWGA 3BR8A 1Q79A 4ZIWA 1FE4A 1J5EJ 2GTDA 1IBCB 4USWA 3G2XA 5GIOA 4J9OA 3KHGA 4LH4A 1VQKN 3IS9B 2JH3A 4AF1A 1QHAA 3GU0A 3LA0A 2ZGYA 1H2VZ 4DQPA 4U7CA 1QLNA 2CG8A 5F8MA 4LF7K 4J9LA 3MGJA 3LPEA 2J7WA 3H5YA 3CEDA 2R3VA 2LEBA 3THYA 4TYBA 1HA1A 3WZ0A 2UXBK 1SQFA 3Q24A 4JI5F 3A8JA 1I39A 1WC6A 5BN9A 4CF2A 3BZKA 3G71S 3NAIA 3P3DA 4I4BA 4B1XB 4ZVUB 2BJ7A 1HQUB 1FI4A 4O3SA 2GX8A 3L95X 5E3PA 3C3LA 5HATA 1MROB 2ZH8A 4NLVA 2B4PA 2JFKA 4M5GA 4A2BA 3E01A 1EHWA 5GAHI 2EFQA 1YIJN 4E1NA 3KK2B 3CQYA 3GPAA 2ZH4A 2VFTA 2C1EB 4PR6A 5K8PA 3IGVA 1S1XB 3MM8A 4CHOA 4OFZA 3TEGA 3VQAA 4IUFA 5AQLA 2HRTA 5ETMA 2JDJA 3L2VA 4U6PA 4M3WA 1LEOA 1RABB 2R7WA 4O23A 4FJIA 3PHEA 1LWEA 2V7ZA 3A8YA 3PEJA 2HW3A 1FJEB 5GAGP 2VFUA 3AAQA 4CZFA 1YZ6A 3H5UA 3VAFA 3KZBA 4M7XA 2FHOB 3KUHA 4YOTA 2RHKA 1KC8O 2AJQA 4QIGA 2CJYB 5CABA 3FBCA 4YS2A 2QMXA 2AA4A 4B1VA 1QAJA 3DYAA 2E5GA 3QATA 1H2UX 4CJTA 4IEIA 3RU0A 3GDQA 1UZHA 2ACMA 4DF4A 4WFBL 2V0NA 1S76D 1CULB 2FBYA 3AH6A 3CCVN 3KMQA 2NUBA 3N4PA 2E29A 4UY8O 1C0TB 4GKJK 2ZHBA 4NXMJ 2DHAA 3X1LB 3VEWA 1IKXB 4Q43A 1MLAA 4H4MB 4PG7A 5FPMA 1OSDA 1WG4A 2W2OP 1IQZA 2ATLA 4O3PA 2VPYB 1SIWB 3V4IB 3PG9A 2OYQA 2NQPA 3BUZB 4K5SA 2MY8A 2BM0A 5A6PA 2KM8C 3JB9k 2C28A 2Q3SA 4KAZA 1WHVA 4DR5F 2P9NB 3ZXWA 2ADBA 4LFAF 1K8KB 4IJAA 2H4YB 3E1YA 4O0JA 2AJ2A 1S97A 5HK4A 2KLAA 2G8UA 1RTHB 3IM9A 1QAIA 2B9YA 4C8OA 5FLXY 5DO2A 4BRKA 1NH7A 2XLJA 3D0HE 3WXMB 4LF5J 2HRUA 3JQJA 1UWAA 3NOCA 2XYHB 3GJRB 5KT6A 1IBLJ 3C2PA 3V1QA 1X5SA 3CO0P 3OYHA 1CLFA 1P1LA 3BSCA 4IO9L 2ERRA 1MWMA 3O4QA 4DL4A 4F2RA 4YP3A 1HKAA 3P31A 4FJNA 4Z37A 1LWEB 1VFJA 3KMSA 2XG8A 4YB7A 4NI2A 4KFBB 3R27A 2E1RA 2YKMB 4C8NA 4RNHA 4UOHA 1OVQA 1BQMB 3MM8B 1YIJS 4CHZA 1SVDA 4K0KF 4WE1B 2E5JA 3QMQA 2QWOA 2A3ZA 4M95A 3T1HJ 2VG7A 2BR0A 1WB9A 3HPGA 4DFJA 1R59O 3EKSA 4JD2A 3W62A 1FESA 1NO8A 3BBFA 4CK2A 1GQEA 4IOAL 1HR0F 4UUXA 1NDLA 4Q0BA 2A41A 5D78A 2MHEA 2D0BA 1BDGA 5GAGI 3AD8C 4CLYA 3LZJA 3SCKE 4B3TF 4DXLA 1ZOTA 2CPFA 3KDOA 2IDLA 2LFVA 3O3GA 4K4WA 1WORA 1VQ8S 1H98A 1PAEX 1CJKA 5K8NA 4EHTA 2D0PA 3IR7B 3PNIA 1RT6A 4JI2J 5F3ZA 4MFBB 1F9EB 3NCPA 3MMVA 4CJPA 4IFVA 4D3GA 4E2FB 2V4QA 1TL3A 1R8HA 3QT6A 2QW9A 3T5LA 4FLWA 2X1BA 1F9FA 4DR1F 1GLBG 1SJQA 3DRSB 1NPKA 5GAEI 3RR7A 1M1KT 2R8GA 1DZ5A 2I1RA 4ZP8A 2YNIB 3NS7B 4FXDA 4EZ6A 3SBMA 1OY6A 2DY1A 3N9UC 3NRBA 2RNEA 2D1CA 4C2MA 1RYRA 3SPZA 5JS2A 2DR5A 2LEPA 4KC5A 2QWPA 4ZKAA 4ANDA 3VQDA 2UUAF 3FFIA 2CPEA 1XWLA 3DMJA 4F4WA 2R7YA 1R7IA 2E88A 2NZCA 2DFFA 4FF1A 5DQIA 3PFOA 4CF1A 3KG1A 3ZETB 2P2CB 1NGJA 5DDRC 4WFNQ 3OSNA 2E1CA 3HMJG 4JI1J 1RKIA 3GG1A 1T3NA 2OP5A 4L3KA 1WKKA 2ASOA 5HLFB 1BL3A 4TKTA 1YI2S 4JI5K 2QGFB 1LAWA 4DCPB 1LNQA 5U47A 2V2ZA 3SSSA 2B4JA 3QB0A 2ZE2A 2H51B 4XH4A 1IBMJ 1X4EA 1RTIB 2YKNB 5AE2A 2ZD1B 5AQZA 5E33A 3WHIA 2W8KA 1YBUA 2GAGC 4QW9A 3H2VE 3SUOA 4LFAJ 1YX2A 4CVNE 4X84A 4K7QA 5AQIA 3NDKA 1I51B 3UD5A 3ZSQA 1FVQA 4NLDA 4DCJB 2CZ9A 2VFVA 3OVSA 2H1YA 2QLBB 3DN9A 1IJFB 1F3VA 5K5MA 4ZP6A 3ZSXA 3FEZA 4CO1A 4YOWA 3DLEA 2EG1A 2LQBA 2BABA 3UI3A 3PKYA 2ZWOA 3NMAA 3NMUA 3R7SB 4PKGA 8RUCA 1HD1A 3M6WA 4OYZA 2VG6B 4OX7A 1U45A 1K73O 5D4NA 1I3OB 3RB0A 2KKZA 1QTNB 2V8DA 3SMZA 4IOBA 1YTYA 3CIMA 1JLGA 5CZ2A 1ZBFA 4DR6K 2MXYA 2PAVA 4DV2J 1VRQC 2R7XA 2XZDB 3M9OB 1EX8A 1I94K 2CQDA 2WUSA 1HLWA 5ETPA 3L3CA 4LSNA 3M30B 2WW8A 1WG5A 3KG4A 1MDUB 3O3FA 4O5FA 4RWWA 2W42A 1T95A 2BOPA 4DKWA 2M2BA 5F9NA 1GOBA 4KHRA 4FWQA 1KTQA 2WW4A 3LW5C 4FO0A 4ED5A 1JXEA 2NPFA 3ZTOA 2LXFA 4CDIA 4KI4A 3KK3A 4IKFA 4BE1A 1IO2A 1RCOB 3BF4A 2LQ5A 3WQTA 1Y97A 2JWNA 3AVAA 4AHTA 4PABA 3PVXA 2HHWA 3H0PA 1R0CB 1NCLA 2K1RB 4RWTA 3N6MA 2IM3A 5CCLA 2MEWA 2ZKUA 2CFXA 1XNQF 3CC7N 1WEYA 2D9PA 4X4SA 1RE1B 3J8AA 2GJ2A 3N28A 4WZMA 4QIVA 2DR8A 4XK8C 1FRLA 1R8BA 1HWIA 3RRKA 4F4YA 3BF1A 1S6QB 5EXWA 1FFWB 1FEHA 3ICLA 4TQSA 4M41A 2DNPA 4DR4K 2HGMA 3MEEA 1GLJO 2GA7A 4PQUB 4ILHA 2E5LF 2YKMA 3VQ9A 1D5AA 3NAEA 5AQTA 3RB6A 4FBTA 1WTFA 5DDPC 4CJFA 2G8IA 4PWDB 1RA6A 1VMBA 2GIRA 1XNQK 4IFEA 2B6AA 2WZ1A 4LUBA 1ZAVA 5J2PA 2CJBA 2K2PA 3LM2A 4FLUA 4FJXA 1H74A 3ZSYA 2NSBA 4I6YA 1UOCA 2RN2A 1Q4RA 4A2AA 3I56S 3EICA 2E66A 1U1QA 3J81O 4ER8A 2VPXB 3QERA 2NXUA 1FNOA 3LP2B 3K2PA 2AQ4A 4OX9F 2YX7A 1FW6A 1N5QA 3HK2A 3NBPB 3EN9A 3S9HA 3IA0A 3WNFA 2P9PB 4P7VA 1TAUA 2D69A 3LGNA 3QAEA 2KFZA 4NLOA 3KLGB 3MEGB 3MAHA 4BC4A 1UZDA 3SQ4A 2FYXA 1RUSA 1REVB 2J6TA 5A8WA 4EWTA 4N77A 4FW2A 3BY5A 3FMWA 5L46A 1ASWA 3H42A 4H5RA 5C24A 2FLNA 1D8ZA 3MN6A 3NEKA 1S1UB 3IP0A 3D2WA 3KNGA 1NMNA 1GTHA 4NEZA 1N56A 1RTDA 4DU8A 4CJQA 3M2VB 2DNNA 3K8VA 4PQUA 1MNEA 3FGVA 7FDRA 4JI6K 1OH7A 4YORA 2GGPA 2V50A 1VJWA 2RE1A 2WSEC 4PRFA 3SAHA 4CZHA 1KOOA 3MMJA 1FD8A 1RHJB 3PIOL 2F63A 1QHTA 1SUQB 2PC6A 2J76E 4LRFA 4W5NA 2VG5A 2HHTA 5ADXA 4OYXA 3OR1B 1VYAA 2UU9F 4NYNA 4JK7A 4M5HA 4JN4A 2ATCB 1S0MA 1Q82T 1LWFB 3SCXA 3Q8VA 4GRSA 1ACMB 3MTKA 3M2VA 1NK7A 2PI4A 3CETA 4CJ3A 1CC7A 4QWBA 1HI8A 1DTTA 1C0UB 3OW2R 1HNZK 1YHQN 2HLTA 2D3ZA 1NLKL 5HI7A 3AOCA 3SCIE 4DR2K 3C6TA 3ZT2A 4CZJA 1GLCG 3RB3A 4JV0A 5JLHA 1X7VA 3EXCX 3TRGA 4KHWA 3HDSA 4ZVQB 1VQSA 1ZXOA 1GMUA 3L0QA 2WFBA 1KAZA 2BW2A 2MPUA 5AQOA 1NMDA 1VBKA 4MO4A 3CJ2A 3OYDA 2XWYA 1QM9A 3IXQA 3ZX0A 4A8MP 2AW0A 3ZNJ1 2ZH2A 5D4PA 3KTQA 3RMBA 4DSFA 4ISGA 5J1PA 3MUVP 3PSFA 3EZUA 4DTSA 3MEDA 4FPBA 2ZC3A 2Y0SD 2P8IA 4Z94A 5EX0A 3W1YC 3A5MC 3W0LA 3Q7BA 1HKGA 1DTQA 2IC3B 5KG7A 1DLOB 3G86A 3TOQA 3GBTA 2ZH6A 1DQ9A 3PYDA 5KFNA 3QMLA 4Q5VA 3BBCA 5M1QA 3P45B 5J2NA 2GHWA 1W0HA 4BVPA 2KKHA 3FRYA 5IV3A 1TUYA 3CIZA 1YJ9N 3AJDA 1DRZA 3V5RA 1QDUB 3RW7A 4Y6IA 5ADXH 4QYZJ 3OT9A 4MAKA 3GP9A 2FZGB 1JLEB 2P1JA 2JGUA 2BJEA 5GAGU 3MURP 3MCSA 1RT1A 3CDUA 1R0BG 5KG3A 1SJRA 3H90A 2CAJA 3UWTA 5B0DA 1CJTA 4N7TA 3R8YA 3ZETA 3D5MA 4J9RA 3AQOA 2W41A 3NGSA 3AO1A 4J9SA 2XQCA 2C2NA 2CQ0A 2B7CB 4ETZA 2K3KA 2O66A 1G1XA 2D9OA 4QS9A 2JSXA 3KXDA 2M9KA 5HQMA 1HNWJ 3MAAA 3R3TA 4DV3J 1RBLA 2DJWA 3VQPA 5IXUA 1PO6A 4MK7A 2P9CA 3W65A 4RL1A 1KVBA 2WBMA 4LSNB 4XPCA 5B09A 3M7VA 4YOYA 4Z4EA 4HTJA 1GEHA 3VQSA 1X4BA 3A3OB 3EZOA 3OVAA 1N34K 4DV4J 4Z2XA 2ZH7A 2DISA 2W2NP 2VA3A 1OO0B 3RG6A 2ZZTA 5G0RA 3WEEB 2MDAA 3QIDA 1B0VA 4OI4A 5E3AA 4CTAB 3W61A 1NRKA 3CW2C 1E6VA 3HCXA 4PQAA 4BC3A 3C8YA 3T1YF 2YHWA 2QM1A 4OL8A 2WSCC 4AL7A 4W5QA 3D1OA 5KT7A 1N88A 2YY3A 2HS4A 4M63A 3ZSRA 2GX9A 4Z4GA 1E6VB 3O8MA 2AGQA 5LMNF 2DY9A 2KHCA 1OKJA 1WC0A 2P9IA 2DPJA 4B9MA 3DRRA 2MYFA 1YJTA 2Y1RI 1T0TV 1XNRJ 1FWKA 1X1PA 3EEQA 3FRZA 3TABA 4OX9K 2WB4A 3C46A 5DDQC 1T94A 1Q16B 2E6MA 1RADB 1RACB 5KFLA 1U2CA 1LAVA 3RTVA 3GG4A 3ISND 2ASYA 2RKIB 4JKHA 2P9UA 4AM7A 3M6UA 4WWSA 1VRTA 4QYZK 1S5ZA 1S9GA 3CF5Q 4ECZA 1T7PA 4LF8K 4CFCA 4C1NK 3GE9A 2KDOA 3GCWP 2C3MA 2O8BB 2E5IA 2DHHA 5JMNA 2NXNA 5KG4A 3IAM9 2KJVA 5LJVA 4ILGB 1KCFA 3KUGA 2HNYB 4A5BA 3W8GA 2J9DE 1CPZA 3PW4A 2DRBA 4DU4A 4CJLA 1PC4A 3UQSA 4X4UA 3SQ1A 2L48A 2EPIA 3CF5L 2V2QA 4TQRA 1NDKA 4DU1A 1PG5B 4P2MA 4XIUA 3T1YK 1JIHA 2W4PA 1FX4A 1U47A 3HZEA 2MKYA 1OSCA 4FPIA 4DR3F 3FSYA 3TVYA 4KSEB 1S1WA 1NK4A 5AR0A 4TY8A 1VBYA 3FEXB 3RBDA 2E6LA 3HTVA 5H1SV 1JWWA 4HDGA 1Q8BA 1GNKA 2IPOB 2ZJQQ 1CULA 4CHNA 1TKXA 4BE2A 2EC2A 4BCAA 2R7QA 4IJNA 2VFSA 4ZLLA 4ZMMA 3KKRA 3OR1A 4NLYA 4H4MA 4J9MA 3Q86A 2RUGA 2LQ8A 3KFWX 1W2IA 3LDQA 3EE9A 3RSEB 3WIVA 3Q8UA 4CGIA 1HNVA 1NKBA 3OUYA 2N7CA 2HZVA 3GOIA 2UU9J 2MKCA 2MQLA 1NPRA 4LREA 5AQPA 2VQEJ 1D8YA 2J9EA 2Q6CA 1VQMS 4WE1A 1YJ9S 3CCUS 1P6TA 3L4BC 2VKZG 4ID5A 2EEYA 5C2CA 4LVNP 3O1WA 3CCQN 3LDNA 4JD2B 4H0YB 2OKQA 3FQKA 4ED6A 1Y64A 1U1KA 4RW8B 2HFSA 2I2YA 3DRPB 3QPIA 4NLQA 4LIRA 1EQMA 4G1QB 3HSCA 1R6VA 1S99A 4DTMA 4LF8J 3M2UB 2QZ8A 4X64K 3ZT1A 2G8HA 5LXRA 3TJ9A 3BREA 3AY0A 1F6TA 1FKOA 2FVCA 2GMHA 3IBCB 2DK2A 4HCBA 2IFXA 2J0XA 4PWWA 2A6OA 3NE6A 4HDHA 5E3QA 4CD1A 3KJVB 3KLEA 3GYGA 4PXCA 3V9UA 4NB4A 2HEKA 4TVAB 4EO6A 1UVJA 3ZEUA 5KFCA 4EU0A 3DOLA 2YNGA 4M45A 4X4VA 5L8RC 2A2DA 3QRQA 2IAJB 1FNXH 2QXFA 4CM0A 2P9PA 3KYLA 2HMIB 3L3VA 4CO4A 5HROA 1BY9A 4NXMK 3KIOA 2MZQA 2IA0A 2YWFA 1DGKN 4ZPTR 1SJFA 5L9XA 2AV5A 3M6VA 4KI6A 2CH6A 4KB0A 3CCLS 3NNAA 4WQ4C 4DI6A 1Q5VA 3UIQA 4JKAA 4CZEA 3W7BA 2ZM6J 4JI7K 1AT1B 4CIFA 4KH4A 2YQ0A 2WAQD 5EX3A 4Y65A 5FIIA 2C2KB 4K4XA 1HYVA 1ELOA 3LF0A 2J9CA 3D3BJ 4AHSA 4KHYA 3ZEUB 3QZ7A 4WFAQ 4JS5A 3OSPA 3OVNA 5GAHU 2FGOA 1KVKA 5EUHA 3MMCA 4RKUC 3R1LA 3QEVA 2KRRA 3RVCA 2EFVA 1HNXF 4CGHA 3AHPA 3MPUB 4AXIA 5IOLA 4NMXA 4X64F 4USKA 1M90T 5IM0B 3AA5X 2XMMA 2VQEK 1S5JA 2D7SA 2AT1B 1D9DA 1JNRB 4CBXA 3CJCA 2M7SA 1XHXA 4UQGA 3PM9A 4C1NI 1HYSA 5L1IA 4NLWA 3AV9A 4DL7A 4E3SA 2CNKB 3MR2A 3ZC4A 3L2RA 2NS1B 1WHWA 3WQPA 3IG1B 2C3YA 1WOPA 4PZVA 4QIWD 2XMAA 3R3LA 1X60A 5IT0A 4P71A 1U1OA 3CDBA 3VOVA 3UVJA 4QQBA 5AZJA 4FLZA 3R5CA 3T6JA 2BE9B 4FWKA 3SK3A 2DFHA 3M30A 3QT7A 3H1VX 4USTA 4E19A 2VG6A 2CQ3A 1SV5A 3OXGA 2LYVA 3E51A 3LP0B 2BVZA 1RT3A 3OW2M 1IG9A 3ITHA 4NEYA 3GE1A 5AQYA 4AHVA 1KKHA 3PACA 2XRIA 3O9QA 3W2WA 1R0AA 1YVNA 5KG1A 4CFDA 4M5DA 3PX4A 3NFAA 5JJBA 1XMQJ 3WEEA 2ZJPL 2W9BA 1GXLA 2Q6BA 3PKMA 4DU3A 3PFEA 2JNJA 4DUYJ 4TLQA 4HT5A 3QEIA 2J0QD 3DGPB 1YQHA 2H3GX 4CD3A 4H5WA 4RPFA 1VLYA 5DG7A 2BQRA 3J7YU 1ZETA 2J8SA 2J4RA 3AVLA 4NMLA 3H4DA 4WIQA 4DG1B 2CJAA 1E3MA 1CJTB 4CEOA 2FJAB 3PW5A 2H5IB 1YBAA 2QA4N 3ETOA 3H98A 3UW1A 5B0CA 3C6UB 3I8DA 1XMOJ 2JEIA 5IS2A 3F5TA 5HAOA 2VIHA 3HJVA 1RWKB 2N82B 1UPPA 1CSJA 1YZ7A 4ZITA 3MMAA 3CJSA 5HMXA 1SKWA 2F9DA 3O4NA 4IO9Q 2B5JB 3MFHA 2YJEA 1MG7A 3DLGA 3R97A 1ZS6A 1VQ5S 3VGLA 4JI1K 5DETA 3DLKB 2AEFA 4FYVB 2XNQA 1IUJA 3WNHA 3QSIA 3G4SS 1S6QA 4F04B 4BVOA 2XBPA 2E5LJ 1OJ4A 1IKVA 2C2RA 4ELTA 3JSBA 1XBWA 1D4XA 2QJ3A 3O44A 3OPKA 2MQOA 5KI6A 1IBMK 5EN1A 4X65F 3THXB 2QA4G 2DNMA 2MJNA 3DXSX 2IS3A 1AA1B 1AFJA 4RW7B 1ITGA 1OYEA 3H08A 1HNXJ 4OI6A 1Q95G 2HFUA 5DMRA 2PFDA 3G25A 1FJ7A 1SJ3P 1W7WA 4NCGB 3R2DJ 4BRAA 1W9HA 4GC7A 3AXKA 2UXDF 3CNQP 2DPNA 1W2BR 1NUEA 1QUPA 1WOOA 3S7RA 2NXJA 4O3NA 1HFEL 1BWVA 1HYZA 4K41A 5JLFA 3MHYA 4RW6A 5C2FA 5JMVA 4FZZA 3DDIA 4LBHA 4R79A 1JMTA 4KH5A 3D4JA 3V6DB 3ZT4A 3R5GA 2HSEB 2UXCJ 3C6AA 2Q43A 4ED8A 2QLXA 3EX7B 4DB3A 2MLYA 3KLIB 4I2QA 3FCHA 3O6WA 5MAOA 4OI2A 3AVNA 1U1MA 4M5KA 4AE5A 2PE8A 1VCTA 3GILA 3A3NB 4FWSA 3CJ0A 5GADU 1XMQK 4BREA 4KH6A 1JJCB 1Y00A 3DOLB 4UQTA 1SV5B 4K42A 2OPSB 3DXKB 1RTJB 1NNEA 4LSLB 5D0RA 3MCPA 4F0HA 5GMEA 3TANA 2FJEB 2WONB 2LU2A 3SFUA 3N0VA 2F9TA 4IH5A 2DGQA 3N4QA 5LJ3Y 1F3FA 2VPWB 3FSXA 5K9FA 4BE0A 3CD6S 2GGPB 4MTPA 4WBFA 1ZAWA 4OZLA 1QJHA 2RQCA 1NGEA 3THVA 3RJMB 3MFIA 3MXIA 1H2TZ 4ID5B 2EK6A 3VQ5A 2ATQA 1FCAA 3F9MA 1L3SA 3VCDA 3OYFA 3RAXA 2WOMA 4RW8A 5KFMA 1HBOB 2BQ3A 3AVFA 2DNZA 1PILA 2CPZA 2O8DB 4RW4A 4MLHA 4CLPA 3D6MB 1OMSA 1WKLA 4DPWA 3J7ZT 5T41A 3J7ZO 2ZOGA 1CLQA 4OYOA 3RRHA 1XIQA 1G7CB 2V67A 4XDCA 4I2PB 5I3UA 4QR2A 1IWAA 3H45C 1N5YB 3RRGA 4G3IA 2HIQA 2V8GA 1QVFR 2YKNA 3CIPA 3B6PA 1BD6A 4OYWA 5CE3A 4C4WA 4DTUA 3EO3A 1UCNA 5GVQA 3KHRA 2XI2A 2E5LK 1BQMA 2W01A 1W97L 1K73T 5L39A 4DR4J 5M1KA 3R1XA 1HMVB 2NLWA 2C3OA 1EETB 2X7IA 4RNMA 1RGIA 3UN5A 2V9WA 3HFKA 3HI9A 4KGVB 2CNOB 3MOZA 1BQNB 2C2DA 3F44A 5HROB 3LP2A 2LSNA 2VJVA 2FBXA 3RWUA 2Z2YB 2APOA 2NLXA 1KOHA 3UE2A 3CD7A 3DOMA 1T9XA 2O8FA 1HBUA 2E1YA 4F0MA 1C1BA 1VQ6N 2FUG9 1VC0A 1YBTA 3MEDB 5I4MA 2V8PA 4CH0S 3BSOA 2YBVA 1HBNA 2ZWHA 3QEWA 2ZHAA 1VS3A 4FNIA 4P2SA 3G9CA 1H0HB 1JXVA 3ENBA 1ZBIA 3G82A 2WTUA 3BGFA 4F4KA 3VTIA 5B0FA 2ZBCA 2DY4A 5KFAA 2HOEA 1VQ4N 2OPPB 4B9VA 1SJ4P 1YJVA 4GVBA 4K0KJ 4WYLA 1TVRA 2H65B 2MZTA 3LAKA 3KLFB 5D3GA 3TVZA 1RAHB 2V2VA 3OXFA 4OLBA 1RDUA 3AO3A 1U2FA 2VPZB 2ZBIA 3NLCA 4ETXA 5C15A 2QMUB 5GADI 1M0SA 1OH5A 5KFUA 5A0YA 4B3OB 1S1XA 2F3JA 2FTRA 4ZVFA 1SCJB 1VSMA 2FJBB 1BU6O 1VQYA 4W5OA 5CAAA 4FXWA 4K43A 1ZM2A 3MN7A 1O51A 1FK9B 5GIPA 1K47A 3ZLJA 4F50A 3QBCA 1KD1T 5E2QA 2HNDA 2VG5B 1RDAA 1T03B 2G2OA 4D3HA 2PA3A 4BC5A 3LO3A 1N0VC 4OJGA 2CPXA 3NHGA 3SUQA 4CJVA 3FCVA 4O4GA 4CT8A 1ZA2B 2P5OA 1WBBA 3W63A 1SKSA 3IDHA 3HVWA 2NPIA 3MUTP 1E4GT 2CPIA 3PIPL 3MOJB 4QWCA 3S8SA 3N01A 3S3MA 5AFUH 4BHQA 4JI2K 2HIYA 2HQDA 2NRRA 1QQMA 4HACA 2GAHC 3RAQA 2DTUA 3WT0A 4C0BA 1R8PA 2J7KA 1EO1A 1XHZA 2JL9A 2ROPA 2XO6A 2Z1JA 3UD4P 2PT0A 2YCHA 2DITA 3JS6A 3J7Z5 4OIXA 2XHCA 4OYMA 4DX7A 1VQLN 2OMLA 3RBXA 1U8WA 2XM3A 1JLCB 1RT4B 3KLGA 2OPQB 4JI0K 1S6PA 4OJHA 4HH0A 3QGHA 1RLDA 3P38A 3THXA 1PYTA 4ECUA 3QLHA 3CSKA 2GIFA 1K9MO 4KBIA 3SUNA 3D67A 4FKYA 1CBKA 5J2QB 1HBNB 2YHBA 4JK8A 3ZTRA 4YR2A 2VC1A 3T3FA 2VL1A 5AQRA 3O5BA 1MW7A 4B9TA 1V4SA 1UKUA 1WBDA 5LT5A 3ID6A 5EOYA 3DLBA 2H48B 1HI1A 3C0BA 1GMVA 4X65K 4A8SA 3IBWA 1UJ6A 2ALYB 4DV7F 4M8LA 4DUTA 3HULA 3QT8A 2EWSA 3OYCA 1TV6B 5E3RA 2ZD1A 1YJNS 3PY8A 5B0AA 2MQ8A 5HOOA 2P5GA 3Q89A 3VVTA 2E9TA 1X31C 1IM6A 3CJKB 4Z4CA 3OYBA 1SC6A 2F9WA 3W5YA 1VQPN 2XHBA 2RF2A 1HPZB 4W92B 5DGBA 3OYJA 1XMBA 4A47A 1RILA 3W9JA 3CJQA 1HWUA 4P2FA 1WWHA 4QJVA 4IBNA 3H25A 1DURA 2P9UB 1DLOA 1OPZA 4FM2A 1QD1A 4C3KA 1FNMA 3HSTB 3DLGB 3CFRA 4M42A 2AKWB 1Z1ZA 4DSJA 4ECQA 1EB0A 3NWRA 2IVPA 3BGOP 2Y9HA 3KHLA 2V2KA 4CIEA 2P6SA 1PJ5A 2J9DA 2UUCJ 1VQNS 1RYSA 3OFEA 5I42B 2FDNA 1NBEB 1EWRA 4B8CA 3FZFA 5KG6A 2JC1A 6FD1A 3H3OB 1S1VA 2CPDA 3G96A 1WJ9A 5IT4A 2CQHA 5D4LA 3U9DA 4EYHB 2UUTA 1CXUA 4YQWA 3LPUA 5LL6Z 2HYIB 3LQVA 2GVZA 4C8YA 3R7BB 4LT6A 1J54A 1CJKB 3HT0A 1RDBA 4KTWA 1BHLA 2F8SA 3CCRS 5LMUF 4P10A 2AJFE 1NXIA 2VWBA 4KBOA 1QUVA 1UVIA 2DTJA 2A40A 2AEJA 3CMAN 2ZF5O 2PI5A 3AA9A 4DX6A 4DSIA 5KG5A 3CE8A 3V6DA 4RBUA 2KJWA 1H38A 3EVMA 2KT5A 3A8IA 1LWCA 2DHXA 3RAMA 4OKKA 1RSCA 3F9KA 2D41A 5I42A 2JEGA 3VF2A 5F1XA 3TVKA 2HWHA 1BO5O 3FZBA 2DGUA 2W7OA 4H4KA 3R5BA 4IQXA 2M3DA 2GJFA 1K44A 2BANA 4M63C 1S22A 1TKTA 3TNVA 5H9EK 5BYSA 1R8CA 3WNEA 4M1KA 1VC5A 3CJ4A 4FOIA 5H9FK 4WTOB 1VQOS 3M8SA 1NJZA 3HM9A 1TK0A 4OYIA 2XGPA 1DQ8A 3ZZTA 1GMWA 3H5SA 2QKKA 3SMSA 3OHRA 1C6VA 4FZXC 5AQUA 1YJUA 8ATCB 4Q45A 3TQEA 1TP7A 5K8OA 3IFRA 2KH9A 4H54A 2QFIA 2KG0A 2CKWA 1RU2A 2MKSA 2BM1A 2XCPA 2OFHX 1FTCA 4BWMA 1AW0A 3GFYA 4G1PA 3GIIA 1N48A 3NGUA 3OHBA 3WXJA 3F56A 4NX9A 3Q8RB 4B3SF 3EE3A 1RTHA 3OY9A 2B4VA 4A8OA 1Z2ZA 4FJMA 1IR0A 1LW0A 3HVRA 3TYTA 3I31A 1T02A 1NH8A 3OS2A 5F9LA 4DR3K 4GW6A 3P5TL 4H0VB 1CZAN 2WBRA 2LDYA 1EZZB 1NM2A 4QWAA 4JI4F 3RGIA 3P49B 4FCYA 5AQMA 1B3TA 4BG9A 3WUHA 2QWNA 2HAFA 3T7ZA 4ILLA 1YJWN 4ERDA 4U7UK 4X66J 3CCJS 3L2UA 4YMEA 1WHXA 4PUOB 1DTTB 1U02A 2ASMA 4AFFA 4UY85 2VGMA 1C0TA 4ZPBA 3UKRB 3HT3A 1TGOA 4FS1A 4BRHA 5HRRA 3E9LA 4RG8A 4PKDB 2MQMA 5A8KA 1KP6A 4K5RA 5BPMA 3T6BA 1RHRB 1S7HA 3U3GA 2AYEA 1B64A 1RCXB 5FPDA 2HQGA 3RZAA 4LF9K 1U1NA 3ETMA 1IG8A 2COLA 2A2CA 1D09B 3E8OA 2Q66A 2MQQA 5KQ8A 2R2UA 3W3DA 2E2QA 2PMWA 2WVBA 4G1IA 1EKRA 3HRGA 5AQVA 5CYQB 2HG4A 4I0WA 4WZQA 4LC9B 1A7GE 4PEOA 4J2AA 5E84A 2QMWA 3V4MA 2G1DA 2I9SA 5KFDA 1NG9A 3TUJC 3LDLA 1DKGD 2NUUG 1JLBB 5H9FJ 2XWXA 3CPWR 1I94F 2EBEA 4NLRA 1FXDA 4A8KA 3M8RA 4TYAA 5L1KA 5CD4A 1WOSA 3LPTA 4JKDA 1NK0A 2ROGA 4A4JA 1HQ2A 3T5KA 2QKBA 1LCUA 3MD1A 4LFCJ 4P75A 4WFNL 1UWBB 2HHXA 3A3PB 1DQAA 2LA6A 1ZZNA 2WVDA 2DNQA 2ZJRL 2RPIA 4TU8A 1O8BA 2VBYA 4NCAA 4X2BA 4Z4IA 2VYPA 4DDFA 3LDSA 4CJUA 3HHNB 4KKOA 4CYUB 4H5NA 1WKJA 4CH1A 4K8XA 1VQ5N 3SQOP 3BO2A 3C14A 1FO1A 2JC0A 1TQLA 3MEGA 4ATNA 2DBBA 3AGRA 1WSGA 4MDAA 3CDWA 1CQNA 4F26A 3HHLD 2IVFB 5IC4B 3HBTA 3CCQS 1TL7A 6FDRA 5DM7Q 1P90A 4CT9A 2FBVA 4USHA 4O0IA 5HL7Q 4GMKA 3QGGA 9ATCB 2IVYA 3BSNA 3GIMA 1VQ8N 2DXDA 1NJXA 5KT4A 2J0SD 2CG4A 5D8HB 5JVHL 1WHYA 3OD2A 3U02A 3CPEA 1JCEA 1H72C 1BUXA 1U48A 2R7SA 2W24A 2RE2A 9RUBA 4WFXA 4O44B 4ZVGA 5D6GA 2ZM6K 3O1LA 2KT2A 4CLZA 1KLMB 2E1MC 3HXMA 2IAJA 4BRIA 1VAZA 2NRVA 3MMCB 2WSFC 4K4TA 1SI9A 3T69A 1ZZFA 4CZKA 1AZSA 1FXLA 3NVMA 3MPYA 3SV4A 2EFOA 3DI6A 3B6OA 3O3HA 2IDOA 2JZ5A 2XSJA 3TA1A 4W98A 3VA3A 4DTJA 2ZC4A 4LRBA 1TV6A 3I4HX 3ZNUA 4MQ3A 3CI5A 2P9IB 4JKCA 4EI2A 5KG2A 4HLBA 2Y0BB 4E7KA 2M5YA 1RAOA 2D3UA 2AYMA 1RFQA 4YR3A 2PY5A 1H73A 3DRPA 1YGYA 4ZA1A 2H5JB 4LF2A 2VV5A 1HHQA 1X4HA 1S72S 1SL2A 4DTPA 5J2QA 3IRWP 4DV4K 2RDIA 3L7PA 4A8QA 4X4OA 3LGMA 4AUKA 2XNRA 4XEIA 1RQ0A 3FR0A 5EDWA 5LL6d 1JCGA 4FZYA 3VAIA 4WTYA 1LWCB 3SQGA 4RR5A 1YDLA 2QWMA 1FJGK 4JHDA 1RJJA 2DFEA 3VGVA 3QFUA 3R5JB 5KT3A 4IFVB 3DXKA 2QA4S 1UPMB 4NLGA 3OS0A 3DU5A 3SSQA 1K6YA 1C2PA 3V1RA 2V5HG 3ENVA 2V4JA 3EGNA 1F1BB 4YB1P 5D0HA 2FVSA 3OYNA 3OL8A 1JL1A 4E7JA 2VQFF 2WHOA 2ROEA 1QQNA 3VQ7A 2HWIA 3G8QA 2P9KB 1XK8A 3EWGA 4JI3J 1T11A 1PCAA 3AA8A 4CNZA 2ZWPA 1UW4A 1ZAXA 4OX9J 1UVNA 4OJ3A 1G2EA 3FFKB 1J5OB 2LXIA 5EU7A 3TI0A 4DPXA 2YJFA 5IWAF 1HX1A 3Q22A 2VODA 3GV5B 3EGVA 4MLEA 2IM1A 1WG1A 3LUYA 4HUGA 3CJ3A 2F4VJ 3OHAA 1KAXA 3MXJA 3TAFA 3FMBA 2FHJD 1KNZA 2FY8A 1HNVB 3S41A 3VGKA 4JRPA 2Z58B 1PYSB 3NCRA 5AE1A 1RHUB 3DDKA 4YOVA 2FVPA 2HF3A 4BDPA 1KLNA 2B9WA 3SCLE 1OVYA 4FYYB 2UUAJ 1AUSL 4XAKA 3NF9A 3MDFA 1UETA 3FZKA 2E7WA 1NK8A 3OBYA 4S0MA 2ZHOA 4N56A 3TWHA 3OXLA 4OVLA 4L76A 5KPTA 3SDEA 5E0OA 2YHYA 2V68A 3PYGA 4ZHRB 3E66A 1LFWA 1TTHB 3A12A 2RJZA 5KQDA 4CI6A 1ZYQA 3NS6A 1N4LA 1U25A 3I96A 5AQKA 3E9PA 1IJJA 1W2BM 4BDZA 2HBYB 3KLFA 5D3GB 3K5NA 2IMWP 4DR6F 3M9NB 4FKXA 2O5DA 3CB4A 3OL6A 3I0RA 3GMGA 4DUYF 1NGIA 3U7JA 5J2MA 1IBMF 3VF0B 3HVTB 3DLHA 1LOUA 2AX0A 2B8PA 1SC1B 4F4XA 1NOYA 3KLEB 1RWXB 3O2IA 3DWLA 3C6TB 3SI8A 2VBXA 3J80U 1TFYA 4CJSA 2BTFA 2M0GB 4CBWA 3CG7A 5HRPA 4OX6A 3D2EA 4YY3F 1DHMA 4L6V3 2DIUA 3MMBA 3PW2A 4YDXA 1JKHA 1BWFO 3ZZRA 5LM7E 3Q0AA 4ILRA 1Y5LB 5BJRA 2QI2A 2FB0A 3F41A 1IXKA 1EJ7L 2QYGA 4G9ZA 2UXCK 3PXGa 5EGYA 2UVWA 2GV9A