1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
1NNDA 2BDPA 3MEDB 4G1QB 4R8UA 3H40A 4B9MA 1C1AA 4O44B 4DFJA 3KK2B 1VSDA 1S1UB 1VRUA 3S3MA 4FJ7A 3BSCA 1BL3A 3QIPB 1VRTA 1NK6A 4W5QA 4I2PB 5E41A 3HP9A 4N41A 2BE2B 3CDUA 4IRDA 1ZTWA 1JLAA 5DLGA 2XY8A 5J2NB 4CF2A 2WHOA 4FJXA 1TGOA 3M8QB 5FDLA 1JKHB 5KFNA 1JXEA 2DPJA 3D5MA 3T5HA 3PR4A 4DQPA 1Q8IA 2ALZA 4Y1DA 1KRPA 4GMJB 1S9EA 3C6UA 3UR0A 3OL7A 4J9RA 3RMDA 5JS1A 3Q8RB 4TLRA 3AVLA 1RAJA 3NE6A 1W25A 4K4UA 3OYGA 4PY5A 3ASMA 3ZT1A 4RZRA 3ZT2A 3RB0A 1HARA 3Q8PB 4RW4B 2I5JA 2IM3A 1VSEA 4B9UA 2IGIA 3LPTA 4DF8A 2OA8A 1NOZA 2R8GA 1L3VA 2YKNB 5CYMA 2IMWP 3AVCA 2HVHA 4AH9A 4K4TA 1TKXA 3O4NA 2ZKUA 5KFUA 2WCXA 4AHTA 5FRMA 1XHXA 2XI3A 2D0BA 4F4KA 4FK2A 4PWDA 4DG1B 3HPHA 1NJXA 4NLQA 1RTDA 3GV8B 1UAXA 3IS9A 4NLXA 2IC3A 4H8KA 4J2EA 3HVAA 4BDPA 3GIJA 1QS4A 4DS5A 1YTAA 1RA7A 5EWEA 2HB5A 3DDKA 4CJWA 3DMJA 2G8WA 1JLFB 4IKFA 4ZP8A 4WZMA 3DM2B 4J9OA 1C1CA 3GQCA 2HNYB 3NKYA 3OSPA 1B9FA 4DTUA 4RW9A 4YQWA 4MK8A 4CFAA 3HYFA 3KLIA 1BQNA 4HHTA 2VG6A 3IGVA 3N6MA 4B9SA 4JV2A 2GUIA 4ECQA 2XY7A 2WTFA 2QKKA 5F8JA 3LP0B 1Z25A 5KFJA 1TQLA 3VQDA 4BDYA 2WOMB 1W9HA 3TR8A 4Q45A 3L2UA 1Q9YA 2FVQA 5KRSA 3UDLA 4ECYA 1HNIB 2IAJA 4NLTA 5L1IA 5KFPA 5L1LA 3KK3A 4CEZA 5DGAA 2OPPA 4TY8B 1IKYA 1UOCA 4B9TA 3AO2A 5J2PA 2FJVA 3SV4A 3MXMA 2XI2A 4QWBA 2HHQA 5I3UA 1S48A 3NAIA 5JS2A 1C6VA 3ALYA 3SQ1A 2HHVA 4OVLA 2UUTA 1RBUA 3OYCA 3QGIA 3QIDA 1RDBA 1N56A 3WNGA 2C2RA 3TARA 4NLWA 1RT4A 2D0AA 4ZPBA 1TL3B 3FFIA 4ZVHA 3M9OB 3LP1A 3AO5A 2FJXA 2HNDB 3RMAA 3NL0A 4H4OA 4HUGA 4JUZA 3HPOA 1FKOA 2XY5A 3RMBA 3RRGA 4NLSA 3TAQA 1QAJA 2D41A 1SL0A 1RT3B 2YKMB 4DFPA 4HCBA 3CWJA 4ECUA 4CIEA 3O3FA 3GIKA 4OPKA 4Q5VA 2KQ2A 2OPRB 2F8SA 2XGPA 5DQGA 1L3SA 4DSLA 4FJ9A 1KLMB 4C8OA 3LZJA 1VRUB 1IM4A 4OLAA 3N6NA 4H4MB 3QNOA 3SI8A 4IFVA 3QERA 4EP5A 3LALA 5L9XA 3ZSVA 2W9BA 3O4QA 4KFBA 3DYAA 4URGA 2UVVA 1JLAB 4O5BA 2X74A 3T5JA 5HP1B 4FBTA 3V1RA 3KLFA 3HK2A 2HW3A 4CEQA 1NK5A 3SPYA 1HQUB 4DSEA 4IG3A 1WNEA 4OJRA 3OY9A 1S1VB 3IN5A 4DTPA 3BSNA 1S9GB 5HRRA 1MMLA 2B5JA 1T7PA 2BANB 3OL8A 3C95A 4DL5A 2AX0A 3NFAA 1JLBB 4M3XA 3QIOA 5FRNA 5C25A 5F8LA 1GOBA 5F8NA 2Y1IA 1C0UB 4ID1A 3H4BA 5C24B 3ZSYA 4CHYA 1RT5B 3HO1A 1NJZA 3AVAA 3CM6A 2ZQBA 3PO5A 2W8LA 4BWJA 4HUFA 4RW7B 5CYMB 3EZUA 4CEEA 3GILA 2VG5B 1ZETA 3AVIA 1EETB 3EY1A 2YNIB 1TKTA 4PWDB 4ZMMA 4MFBA 3KIOA 3IS9B 3OLBA 4N47A 1TVRA 3SYZA 3EZ5A 5HBMB 4FM1A 2D0CA 1S6QA 4W5TA 2G8IA 3NGIA 4N56A 2J6TA 3OYJA 5JUMA 4CIGA 3KD1E 2D3UA 3I8DA 3OL9A 5HRNA 1J53A 3MEDA 4FJHA 4G1QA 3TWHA 3CFRA 4NLPA 3U3GA 4F4XA 3C94A 4O44A 3KK2A 2JLEA 4ELUA 4KTZA 1N5YB 3QIPA 1D5AA 4CE9A 4I2PA 1BQNB 2RDIA 4DTMA 3MR6A 3V9XA 3CJ3A 1QE1A 1KTQA 1DLOB 4B3OB 2RF2B 3NAHA 1MU2A 5J2NA 2JEIA 1BISA 1JLEB 4ICLB 3KKRA 3M8QA 4U6PA 1JKHA 3FQKA 1TK5A 3SUOA 2WB4A 3PX6A 2Y1JA 3GIMA 4K4VA 4LH5A 2YNHB 4MIAA 1ZYQA 4TN2A 5EWFA 4K50A 2JC0A 3SZ2A 1S0MA 2XCAA 4RNOA 4DL7A 1JLGB 2HAIA 1U49A 1BCMA 2OPPB 1NKBA 4ID5B 3OS1A 1EXQA 4NRTA 4RW4A 1IKYB 1B92A 2HNZB 4CJ3A 4CJTA 4EYHB 4I2QB 2YKNA 2R2UA 4BE0A 4JLHA 4WZQA 1BQMB 3SCXA 1NK8A 3OYDA 4CF9A 5F8IA 1RA6A 1WSEA 5SWMA 2OPQB 1NHVA 4EO6A 2IS3A 3NMAA 4AILC 4M3UA 2KZZA 1JXLA 4C8KA 1N4LA 3EYZA 4ED6A 3U6FA 4NRUA 3BSOA 4IFYB 3NHGA 1TK8A 4Z4GA 3KD5E 3JSMB 1S6PB 3LP3A 1RT1B 4DFMA 3FFIB 5KT6A 4ZTFA 1RT2B 2XCPA 1JLFA 4ZP6A 5DQHA 4J9PA 2GV9A 2R2SA 3OL6A 3DM2A 1HQEB 4IRCA 3IAYA 3IGNA 4WYWA 1QSSA 5KFDA 3ITHB 2Z1JA 4FJIA 1R0AB 1HRHA 3DOLB 3L2VA 1CLQA 2GIQA 3PX4A 4YMEA 4CF1A 3OYHA 1WLJA 3V81A 5KT2A 3LP0A 2PYJA 3L3UA 1TKDA 4CFCA 1X9SA 3PHEA 1U4BA 3OS2A 4DL4A 3L2RA 1RNHA 3KJVA 2W9BB 3AVKA 2HHSA 4OKJA 1RCHA 3NH1A 1S1WB 4PQUB 4O4GB 2FVSA 3SQ0A 1YVUA 5KG2A 5KFMA 1NK7A 4DLEA 1DTTB 4CJKA 2F8EX 3KLEB 2OPSB 4XIUA 4TY8A 3M9MB 4KSEB 3WNHA 3NF6A 3HVTA 1NK0A 4KHSA 2EX3A 3QESA 1SH3A 4EO8A 4CF0A 3I0SB 4ED2A 4IR1A 4J9LA 4U7CA 3RR7A 3AA3A 4AHUA 4IH6A 4W5RA 1L3TA 2YHBA 1RDCA 4HVJA 3V6KA 4OL8A 4J2BA 2KFZA 2DFEA 4CERA 4NYZA 2GIRA 4IH5A 2D7SA 5T14A 4ELVA 4GW6A 4NZ0A 1ASWA 4DTNA 4ZPDA 2EHGA 3K59A 1TL3A 3DLKB 4TSXA 3RBEA 5KFVA 2VA2A 3L8BA 4FXDA 4CESA 3TABA 4BE1A 4FJJA 1TVRB 4CGFA 3OYBA 3MAQA 1S97A 1S6QB 3V9WA 3TAEA 3VQ5A 1CSJA 4WE1B 4MKAA 3CDWA 3PW2A 1J9AA 1SH2A 3AVGA 2X6SA 4M45A 5KG0A 3AVMA 5C42A 3ZSQA 1KLMA 1SKSA 1JL2A 4OLBA 4E7KA 1KVBA 3V9SA 3ZSXA 2XY6A 3OVNA 4H4MA 1LW0B 3VQCA 3N6LA 1BGXT 5KT3A 4FCYA 3M8PB 1QE1B 1N48A 3AA2A 2VWKA 3K58A 4RW8B 4QWAA 4DU4A 3NBPB 1MU2B 5HP1A 4W5OA 4Q44A 1HQUA 4RUCA 2B6AB 1S1VA 3TAMB 2KW4A 4CEBA 4ECXA 3VQBA 1S9GA 5KG1A 1I3AA 4IR9A 2BANA 1FXXA 3RBDA 2AWZA 2E9ZA 4I7FA 1ZBIA 1JLBA 1K6YA 1QSLA 4DFKA 2X78A 4O55A 1C0UA 1TL1B 3LZIA 3VA3A 5C24A 1TAQA 4AHCA 1RT5A 3V6DB 2FBYA 3QINA 4RUAA 4FLZA 3VQQA 3CVKA 3NGDA 4RW7A 2WK4A 3ZCMA 2VG5A 1EETA 2YNIA 1S0OA 3V1QA 3OYNA 4BACA 3RB3A 3NF7A 3QZ8A 5HBMA 3AA4A 4GC7A 4ZP9A 4TQSA 1C2PA 4Y3CA 2W9CB 1WSIA 3HSTB 3TAFA 1LWFA 2PYLA 3LWMA 3KHLA 4Q0BB 5KTQA 2AGQA 2E9TA 3CO9A 5CZ1A 3VA0A 1NHUA 4Z4HA 1C1BB 2DY4A 1LAVA 3M8RA 1O1WA 3OHBA 4R0EA 1N5YA 2E4LA 3SJJA 1Z4UA 3ISNC 4LD0A 3OHAA 1SH0A 3MF5A 1DLOA 2J6UA 5KI6A 4B3OA 2RF2A 1ZTTA 3NDKA 3V81B 2W7PA 4B08A 4CJVA 4OKKA 5CYQB 1SKRA 4ZVFA 1JLEA 4ICLA 3MEGB 1BIUA 2OZMA 2OYQA 2G8VA 2J6SA 4O3QA 3KJVB 4C8MA 4FW1A 4QWDA 2ITGA 4DS4A 3AA5X 2IM1A 4TYBA 4CJUA 2YNHA 3BGRB 3H5XA 3PZPA 1TP7A 3HJFA 1JLGA 5KT4A 4O0IA 1VSJA 4ID5A 4Z4EA 3HVTB 3RB6A 2HNZA 4O3PA 4B9VA 4ECRA 4I2QA 4CEOA 1FK9A 4Y1CA 1BQMA 1RTIB 1T05A 1VSHA 4ED1A 2ETJA 2UUWA 4OGEA 4K8ZA 2OPQA 4O3SA 4IQXA 3DLGB 4F2SA 1X9MA 4TYAA 1SV5B 5DGBA 1VSKA 2E6MA 3IRXA 2AQ4A 1XR5A 1OS5A 2P51A 4LSLB 1ZBFA 3G6YA 4GVMA 3BQ0A 4AHVA 4DSKA 3TVKA 4W5NA 4IFYA 1GX6A 1RYSA 3BDPA 5J2MB 3JSMA 1S6PA 1IG9A 4FZZA 4M41A 1RT1A 1FKPB 2A1SA 5L1JA 1WSFA 4QWCA 5F8MA 3PR5B 3PX0A 1LWCA 1RT2A 2QK9A 2OZSA 4IH7A 3MR5A 1RDRA 4M94A 5T7BA 4J9KA 4I9QA 1HQEA 2XGQA 5KFZA 3CJ0A 4EP4A 4HUEA 1K1QA 4WYLA 3ITHA 4J9QA 1RT6B 2V4QA 3UIQA 1R0AA 4E1NA 4F3OA 3DOLA 3S3NA 5C42B 5KFEA 3WNEA 4Y2CA 4ED3A 4FK4A 2PY5A 4YP3A 3H4DA 4ECSA 5EWGA 3KKSA 4KB0A 3NCIA 3MTKA 4WFXA 1WNSA 4FLTA 5KFBA 1XI1A 4MH8A 3ZT4A 4ZPCA 1GOAA 5KG3A 3ULDA 4E3SA 1S1WA 4PQUA 4O4GA 5K14B 3RAQA 3KLGA 2IOCA 3ZSWA 1DTTA 3KLEA 2V0NA 2OPSA 2ZD1A 4FLYA 4KAZA 4DSFA 4DL3A 4FJ5A 4HKQA 2V9WA 2DPIA 3I0SA 3LWLA 4CGGA 2UVRA 2XWYA 3AVNA 4I7FB 2BGGA 2HVIA 2W8KA 2QE5A 4F4ZA 3NGYA 4KTWA 3ZSZA 4ECVA 4DQRA 3S9HA 1UWBA 3KLHA 1EP4B 4FJNA 4IG0B 1QSYA 5KFTA 4DL2A 3K5OA 4KHUA 3KHRA 3S3OA 5HROB 2G8FA 4M95A 4WFZA 3THVA 2ZE2B 1HYZA 3DLKA 4F8RA 2O5DA 5KFSA 5HLFB 3K5NA 3VQPA 2F96A 3QO9B 3G0ZA 3O3HA 3CFOA 1N6QB 3VQ7A 3DOKB 4Q8FA 2XRIA 2GC8A 3TANA 2FLNA 3SFUA 2E6LA 1KFSA 5KG7A 3NGZA 3CJ4A 3T5KA 4WE1A 4CHZA 4FLWA 1RDDA 3V1OA 3F73A 1LWFB 2HHXA 4ZHRB 3CDEA 3RWUA 4AHRA 3SFGA 3B6OA 3K5LA 4PA1A 1SL1A 1X9WA 4DU3A 1Q9XA 3H08A 1C0MA 1ZBUA 3C6TB 3IG1B 4N76A 3MECB 1LW0A 4DSJA 3KNAA 3E01B 4F50A 5EDWA 3M8PA 1ASUA 2O4GA 4J2AA 3G10A 4RW8A 4MK7A 2AGPA 2XO7A 3NBPA 4FYDA 1SUQB 1HYSB 3OYLA 4FZXC 4FVMA 4CK2A 3HM9A 3SV3A 2B6AA 3TAMA 4YR2A 3I5CA 4NCAA 2KTQA 2QXFA 1S1TB 2C22A 3TAGA 2ILYA 3FQLA 4B8AB 4E7IA 2FBTA 2VA3A 1HPZB 4E0DA 3OSNA 4CEFA 4Z0UA 2A1RA 2YNGB 4C8NA 4CJQA 2VG7B 4ZVGA 1NJWA 2ASDA 3Q8QB 2C2EA 5JXSA 1TL1A 2R2RA 4JRQA 1CXQA 3LP2B 3V6DA 1S0NA 5DG8A 1FK9B 1TAUA 1T05B 3RMCA 3SNNA 2F8TA 4LY7A 3V6HA 3O3GA 3BQ1A 4DQSA 4K4WA 4M42A 4FS2A 3QEWA 4F4YA 3MXJA 4CJ5A 4G3IA 4MKBA 3AVHA 3LAMA 4O4RA 3VQSA 3IRXB 3AVFA 5F8GA 2R8HA 3VQ8A 3WNFA 3A2FA 1NJYA 4R5PB 3PW4A 2GBZA 5DG7A 4E7HA 3TAPA 4FBUA 2W9CA 4WXWA 2KZMA 3NAEA 1LWCB 4CJLA 4CEAA 4CF8A 4Q0BA 1WSHA 1S10A 3VQAA 4Q43A 4WFYA 4CHQA 5F9LA 4E1MA 1C1BA 4KI4A 3DLHA 1BCOA 4ED0A 3K57A 3AVBA 2ASLA 3JYTB 4RU9A 2HWIA 3FSIA 4CGIA 2IM2A 5DG9A 2Z1GA 2D3ZA 4M3WA 1LW2B 4KV8B 4TXSA 2AJQA 2IM0A 2YHAA 3MEEB 1WSGA 4XPCA 2KFNA 5KFRA 5CYQA 3L2WA 1JLCA 3MEGA 4M3YA 4B9LA 3OLAA 3BSAA 3PUFA 3HXMA 3HL8A 2JGUA 4CEDA 1DTQB 2W42A 1CZ9A 4CJ4A 1Z26A 3BGRA 3GV7B 5SZTA 3KHHA 3Q8SB 4CIFA 1WAFA 5KGXA 3KLGB 2FVPA 4O3NA 2ZD1B 1RILA 1S49A 3BR9A 3QETA 4CJSA 4CGHA 3BQ2A 1HJRA 4H54A 3PJXA 1QUVA 1RTIA 2C2DA 2FLLA 1W0HA 1UWBB 3DLGA 3B6PA 3TI0A 3KLHB 1SV5A 3DLEB 4Q8EA 5KRTA 2FBVA 1U45A 3K5MA 4LSLA 4K8XA 2E9RX 3HP6A 3F9KA 5J2MA 4IBNA 1FKPA 3MFIA 4LSNB 4AHSA 3T1AA 3QEIA 2WONA 3GIIA 4DMNA 4FJ8A 4IDKA 4ZVEA 1KFDA 1S1XB 1UA0A 1J5OB 3QNNA 3AVJA 2Z1IA 4EZ6A 2W9AA 3LAKA 1KHVA 2FJWA 3P83D 4OGCA 4LH4A 2AX1A 4RW6B 1RBVA 1RT6A 3HHKA 1CZBA 2Z1HA 5KG4A 4QW9A 4PUOB 3L3VA 5CY4A 3QEXA 4M3TA 3V6JA 4CHNA 3ISND 4KTQA 4CHOA 2YV0X 4CGDA 3ZT0A 4NLUA 4DEZA 4DSIA 3I5AA 5DLFA 4JRPA 4FS1A 5J2QB 5KFWA 1U09A 1QQCA 3H98A 4FM2A 4I9LA 1RTJB 3ZT3A 2IDOA 4KHYA 1A5XA 4FM0A 1REVA 5K14A 4DTRA 1KVAA 3BJYA 3AO4A 3VN5A 4Y34A 2RPIA 4FJGA 4CCHA 3M8SA 4KHWA 1YTUA 1IKWB 4DU1A 2R8IA 4KKOB 3RAXA 4FLXA 3NF8A 4ZPAA 4MK9A 1BI4A 4KB7A 5KFAA 4DQQA 4E7LA 2P5OA 3KOAA 2HMIB 3V4IB 2CKWA 4BWMA 2JEGA 3I0RB 1A5WA 4JS4A 4KPYA 4RNNA 3G6VA 1EP4A 3K2PA 1K1SA 1NKEA 1CXUA 4Z4FA 4IG0A 3DI6B 4J9MA 5F8HA 2R8JA 5D3GB 1HMVB 4NLDA 3RRHA 5HROA 5CZ2A 2ATQA 3UPFA 1JXBA 2ZE2A 4CJPA 1KLNA 5HLFA 2LSNA 4ECZA 2D5RA 3QO9A 5KFXA 2UVWA 4ZTJA 2RKIA 1N6QA 3MR3A 4KHNA 3DOKA 3FRZA 4N5SA 3NH2A 1BHLA 2IJNA 4LQ3A 3OJUA 3P5JA 1VSLA 3QLHB 1J54A 4FK0A 4B8CA 5DK5A 1QTMA 4DL6A 2C28A 1RT7B 3QGGA 4DTOA 1RDAA 4ZHRA 4EYIB 2JC1A 4O3RA 2YNFA 3UQSA 3T19A 4GC6A 4E19A 4NCGA 3C6TA 3IG1A 4QAGA 4IOBA 4URSA 1ZBHA 3MECA 1UA1A 3BREA 4K4XA 1I39A 4ECWA 2G8UA 4ED7A 3E01A 3D28A 4YFUA 1IKVB 4FLVA 3PW7A 1IKXB 1JLQB 1C0TB 3DRRB 5KFIA 1SUQA 1HYSA 3H5UA 1JLCB 3HVRA 1TKZB 4UQGA 5KGWA 1HNVB 4NLVA 1S1TA 4RG8A 2ILZA 4DLGA 1HPZA 2R8KA 2YNGA 2VG7A 2HHWA 2W7OA 3QEPA 4XPEA 1WAJA 1VSIA 3LP2A 3DRPB 5I42B 2AU0A 5HRPA 3CQ8A 1A5VA 4NLYA 1JX4A 3RTVA 1RBSA 1GOCA 3VQ9A 1SKWA 3QYYA 3OYMA 4R5PA 2IA6A 2WRMA 4WXOA 4QWEA 5J1EB 3KK1B 4EBCA 1T8EA 1S9FA 1JIHA 4ZP7A 5KT7A 3V9UA 2WONB 1D0EA 4HYKA 3LDSA 4IDKB 5KFQA 1EKEA 4L8RB 3U3YA 4LQ9A 4FJLA 3CJ5A 3QEVA 2AGOA 3JYTA 2FBXA 1XWLA 2RDJA 2G8KA 3TQ1A 4F4WA 1LW2A 4KV8A 3EPIA 4CJEA 2CJQA 1VK0A 3MEEA 4E7JA 3KMQA 3DRSB 2DFHA 4DTXA 1RTHB 3KTQA 4QCLA 3OYAA 4FJMA 4KHRA 2JEFA 5EU7A 4M3RA 4BDZA 3G86A 1DTQA 5FROA 3MFHA 2EC0A 2HWHA 2QV6A 1REVB 3PW0A 1QHTA 4R8UB 5DMRA 2ATLA 1VSFA 5KFHA 1F21A 1ITGA 1VRTB 4DTJA 1LWEA 4KBIA 1BI4B 2VWJA 1IO2A 2I1RA 2QKBA 1T94A 3E51A 1TV6A 3RB4A 3RR8A 4KAIA 4YR0A 4XO0A 3HPGA 3LANA 4EBDA 1Y97A 5FDLB 1KSPA 3DLEA 4QW8A 4J2DA 3OYKA 2UVUA 4QPXA 2P1JA 5KFFA 1U47A 1S9EB 3C6UB 3CG7A 3V9ZA 1RBRA 2DFFA 4LSNA 1D9DA 2JEJA 2RN2A 4Y2AA 1LV5A 2RKIB 3ZSOA 1S1XA 2I5JB 1J5OA 5KT5A 3OYIA 3HVWA 3SUQA 1U04A 3NH0A 4CGJA 1TKXB 4ELTA 4RW6A 3ZSRA 3DLBA 1RTDB 4PUOA 5HRSA 4MIBA 4KHMA 2R7YA 4DF4A 4OPJA 5KFLA 2V4RA 2IC3B 2YNFB 1GX5A 2O4IA 5KFKA 3SQ2A 4FJKA 2IBKA 4KO0A 4NCGB 3AO3A 4CHPA 1YT3A 4CFBA 3CYMA 4O0JA 3QGHA 1LAWA 5J2QA 4IKAA 1ZBLA 4NLOA 3SUPA 3DMJB 1D8YA 1RTJA 3SI6A 1T03A 3T3FA 4KE5A 4KI6A 1C1CB 4C8LA 3PVXA 3KLVA 2FC0A 4ED8A 2B43A 3QZ7A 3LPUA 3MXIA 4J9NA 2OH2A 1S1UA 4RW9B 2BQUA 1U48A 4RNHA 4K4ZA 1IKWA 4JS5A 3GV5B 3MR2A 4KKOA 3DLRA 3KLIB 4IRKA 2XHBA 1XR6A 4TQRA 1KVCA 3L2QA 2VG6B 4RNFA 5KFOA 2BE2A 2FLPA 1KCFA 1IH7A 2HMIA 3V4IA 5C5JA 2PZSA 1JL1A 4URQU 3PY8A 3I0RA 1XHZA 1XR7A 3DI6A 4CFDA 3D45A 1G15A 5D3GA 1HMVA 4CK1A 3HT3A 2IAJB 2ASJA 4JV1A 3KK3B 3PV8A 1KHWA 4K4YA 4NCBA 4F2RA 1NK4A 3FDSA 2G8HA 5J2PB 1HYVA 4YR3A 3M9NB 3QLHA 3AV9A 5I3UB 4CJFA 5KFGA 2NUBA 1RT7A 5KG6A 4DG1A 4CECA 3H59A 4FZYA 2XC9A 1BIZA 3VQ6A 5EUHA 4M3ZA 3CFPA 4X2BA 1X1PA 2DTUA 1RT4B 4KRFA 3KHGA 2BQRA 2BRKA 3LP1B 4EZ9A 2BRLA 4NYNA 1IKVA 3VQ4A 3KMSA 1IKXA 1JLQA 4H4OB 1YVFA 1C0TA 1FKOB 4OKEA 3DRRA 1VSMA 2HNYA 4CJRA 4MQ3A 1TKZA 4Z4IA 4NLRA 1HNVA 1RBTA 2BQ3A 1NOYA 2R2TA 3I5BA 1L3UA 5KFYA 2P5GA 1B9DA 4DWIA 1T3NA 4KREA 4FW2A 5KFCA 4BE2A 1QAIA 1ASVA 4JV0A 4EEYA 1XC9A 3OYFA 4K4SA 3VQEA 1NK9A 4KB1A 4IFVB 3DRPA 2WOMA 5I42A 2HHTA 1LWEB 3H5SA 3HKWA 2IJFA 1S5JA 4CK3A 3OJSA 3GYNA 4E89A 4HTUA 1HNIA 4KFBB 1TV6B 3P1GA 3DYAB 1EX4A 4O3OA 3OS0A 4NYFA 3KLFB 5L1KA 1TK0A 3PO4A 4IG3B 2Q3SA 3CIZA 3EPGA 2HHUA 5F9NA 2B5JB 1SL2A 1NKCA 5J1EA 2X6NA 3KK1A 4Z4CA 4DQIA 1D1UA 1WN7A 4F3TA 4NLGA 4KHQA 5DQIA 5C25B 3D0PA 4YNQA 3SUNA 4RNMA 1RYRA 3CJ2A 4EBEA 3PW5A 4J9SA 3CM5A 3SPZA 3G6XA 3H2LA 1TKTB 4FLUA 3SQ4A 4MFBB 2FVRA 2HNDA 4HCCA 1S4FA 2FVCA 4ECTA 3AO1A 1WSJA 5KG5A 3H5YA 1L5UA 3T5LA 3DRSA 4KO0B 1RTHA 3ICLA 3NF9A 4DTSA 2B4JA 4TY9A 3PJWA 4QOZB 1RT3A 2YKMA 4B9NA 1D9FA 1I6JA 2BR0A 3OYEA 2OPRA 1T03B
chains in the Genus database with same CATH superfamily
1NG9A 1C0FA 2BDPA 4G1QB 4DV0K 1C1AA 4O44B 2JLFA 4CVNE 1VSDA 3E9PA 2H4YB 3S3MA 2EWHA 2Q79A 1RCXB 3BSCA 4CBXA 3QIPB 2JLGA 3EKUA 1VMBA 2VL1A 1M90T 3HP9A 1B0TA 4N41A 3MK6A 3CDUA 4IRDA 2XMUA 1KBRA 4X65K 2QL5B 2BTFA 1XERA 5DLGA 2XY8A 2A3ZA 2NRTA 3O1BA 1G6BA 1TGOA 3HKZD 3DGVA 5B09A 1JXEA 5FIIA 2GMHA 1HKGA 2G0JA 3PR4A 2DNGA 4LFBJ 4P7TA 3TW0A 3OL7A 4I56A 3UR0A 1ULRA 2WBRA 2UUAJ 3NE6A 1T6DA 1HIYA 3DKDA 3GFYA 3OYGA 3ASMA 3ZT2A 4BC9A 1NHKL 1WKJA 2I5JA 1VSEA 1Y11A 1G3OA 4A5BA 2OA8A 2XSJA 2R8GA 2OD4A 4RBTA 4K4TA 2WCXA 5FRMA 4R25A 1NM2A 1XHXA 2XI3A 4DG1B 3BDEA 3HPHA 1RKIA 1HNWK 3UE2A 1UAXA 4DPXA 3DXBA 2FHOB 2DXEA 1QS4A 1VHIA 1RA7A 2DYAA 1X31C 1AXQA 3DDKA 3HFVA 1JLFB 4IKFA 1TL7B 4W90B 3DM2B 1RHJB 3CMAS 3OVBA 4I69A 3GJTB 3R2CJ 2VC0A 3W63A 2FJDB 3N0VA 1I3OB 1S59A 3B54A 1XNQF 4OZNA 3N6MA 4JV2A 1AB8A 4OHXA 3QT7A 1JCGA 3K89A 3VAKA 1IUJA 1UVNA 4WK3A 1HNZF 4LF9K 1QHAA 3I32A 3WBZA 1AUDA 5KFJA 1FRJA 1TQLA 2AYBA 4C1NI 2WOMB 4N8NA 4WJBA 4X84A 4Q45A 1Q9YA 4UOHA 4FKXA 4YDXA 3GWCA 2A6MA 1K73O 3GU0A 1W2BM 4A61A 4JI1K 1XQIA 1NSPA 4UOGA 4WFAQ 5LMUK 3SV4A 2LDYA 2EEYA 5ETVA 2HHQA 5I3UA 4OV6A 3NAIA 2X3DA 4IWVA 4IQMA 5A2QY 4DCJB 1RBUA 2HS0A 2HOEA 3IM8A 1RDBA 3TSPA 4FF4A 3TARA 3DJCA 1RUSA 3CIMA 4ISGA 1R27B 5JVGQ 1TL3B 3FFIA 5AQRA 1RQ0A 1LKZA 2GNKA 2UV8A 4HLBA 1ESVA 2P9IB 3D6RA 2WVDA 1FKOA 3HPOA 3Q86A 1JJCB 3EDQB 4E2FB 4EMDA 2D41A 4DFPA 4YN3B 4CIEA 3MURP 4Q5VA 2XGPA 3S8SA 1TYQA 1KLMB 1NXIA 4C8OA 2WW8A 4OLAA 3WXLA 3IM9A 2ZBRA 4H4MB 1TUWA 5L9XA 4BC2A 5CCLA 1FA0A 4B3MK 2CPXA 1YDLA 3DYAA 3T5JA 3V1RA 3HK2A 4CEQA 3SPYA 2XMAA 3CCRN 3OY9A 2DR8A 4MKVA 4DU7A 1DEJA 4RLEA 2NSBA 1FTCA 5K8PA 2AZ3A 2ZC3A 4DPOA 3MPUB 2CNNB 2BANB 2OTJN 1P8GA 3TU5A 2GS8A 1OSCA 2RSQA 4DL5A 2MMYA 3QIOA 3M2RA 4ED5A 3C16B 2W2OP 1GOBA 1HX1A 3GONA 1SBRA 2F9TA 3A12A 3U9DA 2CWXA 3M6WA 2JOQA 3CM6A 2W8LA 3CMQA 4U8YA 1ZOTA 3RU0A 3AVIA 1EETB 2YNIB 3JTPA 1FVQA 2AZ1A 3IS9B 2QXLA 1I1GA 3HCXA 2CRLA 3VF4A 4JI4F 5HBMB 4CH1A 1FRXA 1S6QA 4LVNP 5C2CA 3NGIA 2HG4A 2QM1A 3EKSA 4FZVA 4IUFA 3ETOA 4USUA 2NR0A 1I94F 2CNLB 3M3ZA 3R2DJ 2XMWA 2KM8B 2JLEA 4ELUA 4MLEA 4KTZA 4QU6A 4P73A 1O5JA 1W7AA 4DTMA 2B4UA 4DV0J 4A62A 1QE1A 4ZOSA 1Y4ZB 1UJ4A 1DARA 2EFPA 4B3OB 2AMCB 1RWVB 2QL9B 3MM8B 2J0SD 3VAJA 1L3KA 4U6PA 2V7YA 1BA1A 3UD3P 1WACA 1ILYA 3JXOA 1QQOA 5M1KA 3G82B 4X65J 4DR2F 4IFEA 3A0IX 2X7IA 4TN2A 4DR4F 4K50A 2JC0A 1H1VA 1S0MA 1ATSA 1EAYC 2OPPB 2XQCA 1NKBA 3OS1A 3M2VA 3OXFA 1IKYB 1B92A 3W2VB 4WYBA 4CJ3A 3FFKB 3CCZA 2YKNA 3EE8A 3GPAA 3I31A 3SCXA 1AZSA 3S6EA 2KZZA 1C4CA 1JXLA 2HQFA 2K7KA 2Y3YA 1N4LA 2V8DA 2WC9A 4NRUA 3BSOA 3R1XA 2I9SA 2EWSA 3J7Z5 1YBUA 4Z4GA 4JI2F 2HLTA 3KD5E 4NX9A 1S6PB 1HNWJ 1RT1B 4DFMA 1AYEA 5D6GA 2XCPA 4ZP6A 4DR3F 3OL6A 3IAYA 4LFBF 5A8KB 1YITS 2E5JA 3OPKA 2UUAF 2I7PA 4F02A 5FJ4A 3MN9A 1OVYA 5AR0A 2FF3B 3DOLB 2FPHX 1CLQA 1FD8A 4EFHA 2GIQA 4YMEA 3OYHA 5KT2A 1NGEA 4NLBA 3ZTRA 1TKDA 3QFWA 3TPQA 3PXGa 3KJVA 3CDAA 2HHSA 5A0YB 1SKUB 4V19S 4LF9J 3W0LA 5KG2A 3I33A 3ID8A 1RK8A 1IXKA 3KLEB 3PKYA 3VGUA 3KG4A 2HQIA 4KHSA 4OJ3A 4J91A 2VIHA 4EO8A 2XNRA 4L73A 4U7CA 3RR7A 2CWKA 4HT7A 3HSJA 4IH6A 4JI1J 4UUWA 1L3TA 1RHQB 2HKEA 5LMUJ 2KFZA 4FYXB 4OX8A 4D3GA 4CERA 2HSEB 4NYZA 2D7SA 5HMYA 2M52A 1ASWA 3FMBA 3MMBA 3CC2S 4CZLA 1HW8A 1RAGB 4CESA 2RDDA 4FJJA 2IFXA 2DHSA 3RSEA 3MAQA 2BA9A 4PKDB 5JVGL 3PW2A 1SXLA 2X6SA 1O0PA 2XLJA 1YJNS 2ZVSA 3AVMA 5C42A 2PEBA 3O5BA 3UVJA 2I7NA 4KQZA 3EGWB 3FZLA 2OCEA 4LRFA 2XY6A 2G4BA 1V3SA 4B3TK 1LW0B 3VQCA 2DY1A 2QG9B 3DHXA 5KT3A 1FI4A 1GLEG 2E5LF 2XMJA 2G1DA 3VTHA 3K58A 4DU4A 5KPZA 2ZBIA 5FLXU 2ZJQQ 4H4KA 3QT8A 1MMDA 3Q89A 2QIFA 5U47A 1HQUA 3JQKA 4B3MJ 1S1VA 4CEBA 4BRFA 1S9GA 3M8YA 2DGOA 3D1HA 4CO5A 5ETLA 3CCSN 3CJ8A 2KJWA 1NM1A 1F60B 1NJIT 4I7FA 1SAZA 1K6YA 1U1MA 1QSLA 4DFKA 3VA3A 3LZIA 2J8AA 4LRCA 2IRYA 4RUAA 4RW7A 3ZCMA 4YS2A 3O1LA 4P2MA 2VG5A 4BG9A 3S7RA 2O1PA 5BJRA 2IVNA 3OYNA 1U2RA 4BACA 3HOTA 5FLXY 5CZXA 3AA4A 1HHQA 1LNQA 1CJUB 3ILJA 4Y3CA 2Q66A 5EOYA 1WSIA 2IRXA 1UAWA 1FXRA 3TAFA 2DRAA 2EG2A 3LWMA 3BY5A 2VGMA 1LCUA 3CO9A 3WQPA 5L38A 3VA0A 3H7HB 2DGQA 4FPIA 3CXCM 3OHBA 4Y6IA 3D1OA 2XHWA 4CTAA 2GWJA 4OZ2A 2LXIA 4IOAQ 3CQXA 2J5AA 3AAPA 5D15A 2CNOB 2VHGA 1FWLA 5GAHP 1NDLA 3V81B 1SKRA 5CYQB 4ZVFA 3MEGB 2OZMA 2OYQA 4O3QA 2MKCA 5FLXO 2ITGA 4DS4A 3MPYA 3DC2A 3FKBA 4NO7A 4TYBA 2FZCB 1S4EA 2CPZA 1UEUA 1Q81T 1V6HA 3C3LA 3POTA 2FYXA 4ID5A 1WG5A 3RAMA 5LSOA 3HVTB 3RB6A 4X66K 4DUZK 4B9VA 4ECRA 4GV9A 4CEOA 4JHDA 4F9OA 3JS9A 2UUWA 1Q4RA 2OPQA 4O3SA 4ILJA 4IQXA 3SCIE 3DLGB 4TYAA 5DGBA 1HHTP 2AQ4A 2E29A 2P51A 2PDAA 1ZBFA 3G6YA 4GVMA 1XQSC 4DV0F 3QGPA 3BKTA 5G0RB 2LCWA 5J2MB 3BDPA 3JSMA 1GH8A 4FZZA 4M41A 4JI7J 1WSFA 2A1SA 2WSEC 5F8MA 2WBNA 1RT2A 3TYTA 5LXRA 3TZWA 2KHOA 1KQFB 5T7BA 4J9KA 2DNHA 1KXPA 2VKZG 1H72C 4EP4A 4C3KA 3NS7B 3DRXA 1K1QA 1UVMA 4XEIA 2CJ9A 2W4CA 2RMLA 1R0AA 4E1NA 4W4MA 3MM5B 3S3NA 3NCRA 2P9KA 7AT1B 1FJGJ 4JI3J 1FX4A 1NDPA 5EWGA 3KKSA 3CJTA 5D77A 2VICA 1X4CA 4QYRA 1B4SA 2GZOA 2C2NA 4ZPCA 5KG3A 2RJZA 4QIVA 1S1WA 3C15B 4O4GA 4I1TA 3ZX2A 1OH6A 2IOCA 3DXKB 1QY7A 2GW8A 1DTTA 5D0RA 1VQOS 2RHSB 2OPSA 1HNWF 4GMKA 4W98A 4FJ5A 1KC8T 2V9WA 2DPIA 3QRRA 3IKMA 1PJ6A 2HVIA 1FWKA 3S9HA 4ECVA 1HD1A 1GK8A 3QSIA 3CCUS 3A1YG 1DZ5A 4K5RA 3S3OA 4M5JA 2PN6A 2KT3A 3ULEB 3T1HK 2L3MA 4YDDB 3OTCA 3THVA 1U7LA 2L41A 2JHEA 4L75A 1GLFO 3VGMA 2F96A 5AQVA 3O3HA 3CFOA 3SK3A 1N6QB 5FPNA 4BRNA 2XRIA 2GC8A 3TANA 5M1NA 3NWRA 2NYIA 3NP5A 5F3ZA 2MLZA 2HQDA 1FXLA 1KFSA 5KG7A 3NGZA 2YTCA 3T5KA 4CHZA 4OYWA 2FQQB 1F9FA 2VKRA 4K7QA 4LF9F 4CZEA 2WVBA 3F73A 2QEXN 3WQUA 3J7A1 2HHXA 2CA9A 4ZHRB 1VQNN 2XZWA 4AHRA 4P74A 3MD3A 4H0TB 3IFEA 1ZAVA 3R6GB 4FYVB 4X4SA 3H08A 3UR3C 3VGTA 2BM1A 5AQUA 1NBWA 2E20A 4JI1F 3MWBA 2J9DA 1NB2A 4LFAJ 4JBCA 4USJC 5E3PA 3E8OA 5EX0A 5LMUF 5EDWA 3M8PA 2O4GA 3VVUA 2BXJA 2KB2A 3ZEUA 2MSTA 3CJBA 2JRSA 4B3TJ 1SUQB 1HYSB 1EKSA 4CK2A 5BXIA 1S72S 2GEMA 4NCAA 4HDHA 1S1TB 2C22A 1T02A 3FQLA 3D3CJ 4B8AB 3QQCD 3OSNA 1HNXK 4C8NA 4ZVGA 1NJWA 2R2RA 3O8MA 2XMVA 3MMCA 4PRFA 3LP2B 1R8CA 4CO0A 3V6DA 2ZHBA 3P5BP 5AFUA 5DG8A 5BR9A 1FK9B 2VV5A 4GRSA 5FPDA 4LY7A 5BYRA 3BQ1A 4AFFA 1CS4A 4FS2A 5GAGP 3T6JA 4CJ5A 3SAHA 1HKBA 3F9MA 1MWYA 4C0BA 1YJ7A 3AVFA 4J90A 2UP1A 4JKEA 4R5PB 1UWAA 3M7VA 1LQ9A 3PW4A 2P9PB 4E7HA 3TAPA 1FHTA 4FBUA 2W9CA 1IWGA 4KH1B 3PDNA 4GNIA 1EARA 2HHHJ 1WSHA 4B3MF 4WFYA 3BV8A 2CQHA 4S0MA 3JSBA 1F0XA 3ZZTA 1BCOA 2PE8A 2M70A 3R5JB 3H1QA 5B08A 2HSTA 2MPUA 2H5EA 4O23A 2Z1GA 2D3ZA 1GXUA 2O01C 2ZOMA 3EJMA 2AJQA 4NL5A 1WSGA 1KOHA 1T3OA 5KFRA 5AQJA 3B6BA 1KN6A 4IOAL 4NE9C 1QZ6A 3OLAA 3BSAA 3I56S 1U6ZA 3BZQA 3HL8A 1X5PA 4CEDA 2W42A 3OVAA 3EL2A 2D4WA 2GO8A 3I55N 3BGRA 3GV7B 1R8BA 3Q8SB 5GIPA 4LC9B 1NCLA 1WAFA 5KGXA 3KLGB 4HL9A 4O3NA 3RVCA 2ZD1B 3HOSA 3F44A 4H54A 4FWMA 5AQMA 1RTIA 1SQGA 3TUPA 4L76A 4OYPA 2FLLA 4DUZJ 2BJ1A 4X66J 1W0HA 1IVZA 2P9LA 3CTRA 2DVIA 3CMEN 2EVZA 2XZDB 4Q8EA 1U2VA 5DDPC 4LSLA 1GLLO 2FJEB 3FBCA 4A5AA 3CB4A 4IBNA 4CT9A 1F3VA 2WONA 4CO3A 5CD4H 3GIIA 4C3MA 5IQQA 1U0HA 4FJ8A 4IDKA 3O80A 2JL9A 4HEA9 2BBEA 2GIFA 3QNNA 4EZ6A 2W9AA 1KHVA 3P83D 4OGCA 1N52B 4RW6B 1RBVA 2Z1HA 2LQ9A 5KG4A 1U8WA 3CCVN 2GGPA 1NGCA 1HBNB 4NLUA 4EUVA 2A2CA 4DSIA 2E2PA 5IXUA 3MMAB 3KWMA 3VESA 1EO1A 4QQBA 3H98A 3THYA 3OTDA 3X1LB 3ZT3A 4KHYA 2H3GX 5K14A 1S57A 2UYTA 3BJYA 2KU7A 2GA7A 1NZAA 4CCHA 4OI3A 3M8SA 1IKWB 3W9JA 2FC9A 5JMVA 3UO0A 2FHKA 1Q7YO 4ISFA 2VQFK 3QAEA 4M63C 2MZTA 4KB7A 5KFAA 4DQQA 2HMIB 2LEBA 3V4IB 2ZBPA 4KGMA 2MZRA 4CLPA 2CGKA 2Y0BB 2B8PA 3I0RB 2XS5A 1VK8A 1OO0B 2J76E 4W92B 1GLBG 3BGLA 3M1VB 2R8JA 5D3GB 4QJVA 5HROA 5CZ2A 9RUBA 3ZX3A 1BDGA 1JXBA 3BUZB 2ZE2A 1R59O 2GVDA 5HLFA 1EHWA 1XJWB 1VI7A 1DY3A 3FZHA 4JN4A 4L3KA 1HBMB 5KFXA 3M5RA 4ZTJA 2RKIA 4N5SA 3OVSA 2WSFC 3T1HJ 2HZCA 3R7SB 5T7LB 3OJUA 1VSLA 3QLHB 2YKPA 4FK0A 2MQPA 3K0SA 3CJKB 4JYAK 3RGIA 4CLSA 4LSZB 2C28A 5AQWA 2ADBA 4U8VA 4DR1K 3EVOA 4FOEA 4FDFA 2JC1A 3I82A 2F4VK 3T19A 1VJQA 4E19A 2F63A 2KG1A 3OBWA 1DFDA 1OH7A 4RU2A 1U2CA 3AA8A 2OP5A 3E01A 3T9NA 1R8AA 2I8EA 3LH2S 4FLVA 1VQMN 2QLJB 4C6AA 5RUBA 1JLQB 2ZZNA 3AJ2A 1HBUA 4WQ5C 5IC6B 3VAHA 2GJIA 1JLCB 4YOUA 2FD2A 3W3SA 1WJ9A 1RAFB 4NLVA 2MKJA 1NMDA 3T41A 1MWQA 3TA1A 2HHWA 1VISA 1HLWA 4PQAA 2W7OA 1VSIA 3VEVA 4AQYJ 5I42B 2XBPA 1HNXJ 4NLYA 2PFDA 2YQ3A 1JX4A 2GHWA 3AOCA 4YOVA 2H1YA 3RJMB 2P9UB 4YDUC 3SSSA 3OYMA 5IM0B 4XH1A 4KGKA 3UW1A 2COLA 5J1EB 4MYUA 4EBCA 1T8EA 1S9FA 2V94A 2QJ3A 3D6HB 5KT7A 4B3TF 1D0EA 2Q6BA 1EKEA 3U3YA 4LQ9A 2AJ0A 4FJLA 5JICA 3GDQA 2LP4A 3FEXB 3R9LA 4B3SK 2L9DA 4NOHA 3QEVA 1WHXA 3F56A 2RDJA 4M1KA 4OHWA 3DGPA 1JJ2M 3CJ9A 2CJQA 1NGDA 2IIRA 1FFGB 3P96A 3DXMB 3RW6A 1P90A 3CCMN 4ZPTR 5EU7A 4BVPA 4YUDA 1YJWN 1OPIA 2VFTA 3HFKA 2YQ0A 3R5CA 5AQKA 1REVB 4OZJA 1B64A 5DMRA 4DQ8A 1VSFA 5KFHA 1M5SA 4BHQA 4LF2A 3QBCA 2XTJP 5BN8A 1SB6A 1BI4B 2QKBA 1T94A 3E51A 3RB4A 1WG1A 4C4WA 2VPWB 2PO4A 1YIJS 3IAS9 3LANA 1QTNB 1KTVA 1SS6A 2P9NA 2NXUA 4OZ0A 2QN6B 3DLEA 3GJRB 1M1GA 2UVUA 3I9ZA 5GMKa 5FPMA 1RAEB 1UVLA 4ZN3A 3V9ZA 1GFWB 1RBRA 2IY5B 3PIOQ 2VODA 1MROB 4ZVPB 2AF6A 1LV5A 2NCKL 2RVJA 4ZCIA 2I5JB 1J5OA 2XSJB 3SUQA 2VPXB 1DAXA 3GG4A 2ADCA 3QFPA 2ATCB 2DCUB 2AJ4A 3ZSRA 3DLBA 2AHOB 1Q82T 3R9PA 3DHWC 4PUOA 2M5YA 2KXNB 5HRSA 3TEHB 1W2IA 4CZMA 3TA2A 3VPZA 3CIPA 3CHWA 2ZITA 5HAOA 4CFBA 3I4HX 3QMQA 1ZBLA 4DUZF 4X66F 3SUPA 1D8YA 2E1AA 2GQCA 3GG0A 3SI6A 3CULA 2FC0A 4ED8A 1P27B 3QZ7A 2ZH8A 2OH2A 4JS5A 1JJHA 3GV5B 4KKOA 3DLRA 3IMQJ 3L2QA 4K5SA 2G0IA 1VQLN 1IH7A 3GBTA 1VJWA 1KVIA 4Y2MA 4A57A 2VQFJ 1XR7A 1N5QA 1LOTB 1FERA 6AT1B 1YJRA 3TSQA 1M90O 1XK8A 3B4MA 3TEGA 1SZ2A 3IBWA 2R7RA 2CPDA 4CBUA 3NMUA 2GX8A 2MHNA 5BRHA 4YR3A 5K9FA 2GO9A 5I3UB 4CJFA 3UNGC 5KFGA 2RUGA 2NQPA 4DG1A 3JTOA 1ICEB 4PG4A 2KM8C 3VTIA 4CECA 1LEOA 2PT0A 2CQDA 3KUGA 3CCEN 4JYAJ 1N34K 4YDUA 2ZH2A 4B3RK 2J9EA 4DR1J 4QOTA 2HFZA 3OBYA 4KH6A 1GMWD 5ETOA 3BM7A 1FKOB 4OKEA 5M1FA 5SUHA 3HSDA 3K0JA 1UZHA 1TKZA 2FDNA 3CJCA 2VFUA 3I5BA 4OFZA 1TYQB 1B9DA 2J4RA 3T1HF 2DXDA 2B56A 3PHTA 1DQAA 4JV0A 3OFGA 2YX4A 3A8KA 3DRPA 2WOMA 1LWEB 3H5SA 4CK3A 2IJFA 1VOMA 2XMTA 2Z2LA 4HTUA 3DYAB 2V8HA 1EX4A 3OS0A 4AYBD 1U1KA 4ZLJA 3EWGA 2DGXA 1U1NA 3GFHA 1FRKA 4GVBA 4CNYA 5IWAK 1NKCA 3N4PA 3VAIA 2V50A 4PG8A 4Z4CA 3M2RB 1D1UA 3DRYA 4K2JA 4NLGA 1WN7A 3D0PA 3RYLA 3CJ2A 4V1Ak 4EBEA 3M8ZA 1NO8A 1PYTA 1KVJA 5LMNK 4J9SA 3CM5A 3G6XA 3TUIC 3Q83A 1SQFA 4HCCA 1S4FA 1M0SA 2FVCA 3DAWA 1RWMB 3KVGA 4B3SJ 5C2GA 4C98A 1Z2ZA 1HNXF 5CR4A 4F04B 1RTHA 2R42A 2A1BA 2DH9A 4QOZB 3N79A 2F8HA 1WDTA 1XIQA 3OYEA 2ZKTA 4LF7J 5BR8K 1EX8A 4R8UA 4B9MA 2D3OR 1S1UB 4X4OA 1R8HA 1T11A 2U1AA 1VRTA 1NK6A 2E8AA 3TNVA 1VBYA 1NH8A 5E41A 3UDVA 5B0FA 2W24A 3O8WA 2NSCA 2DO4A 1VQ5N 4KBOA 4BRLA 4CF2A 3OTBA 5IOLA 2Z58B 1S3XA 4JKAA 4FJXA 1P1TA 5KFNA 1YHQS 3TX8A 3D5MA 3W5XA 4DCOB 4DQPA 3TTDA 4GMJB 3C6UA 4J9RA 4L74A 2GFFA 3RMDA 1V9OA 1Q8KA 2KKZA 2P6TA 5HQMA 3QNWB 4RZRA 3RB0A 3MOZA 3SQOP 1HARA 3ELHA 3M2VB 3LPTA 4DF8A 3H3OB 3A8IA 2YKNB 3AVCA 2IMWP 2HVHA 3PIOL 4AH9A 2KT2A 2BJ3A 3O4NA 5JJBA 4RO0A 4H5WA 2QMXA 4FK2A 4G1IA 2J7UA 4NLQA 3IS9A 4DR6K 2NYHA 1S6OA 3UD4P 4OYAA 1N54B 2EI5A 1BU6O 4UW2A 3JS6A 2W7AA 2YWWA 2HB5A 1JJ4A 2G8WA 1PYOB 4ZP8A 3M32B 1HQ2A 2BVZA 3ZNUA 2B7BB 2FC8A 4YQWA 5T41A 2N7CA 2FGOA 3KLIA 3AA9A 2YPYA 1HD0A 5M1QA 5GMEA 1ATNA 2GUIA 3IRWP 3D54A 3BO3A 2A41A 3QDKA 4ECQA 3ZZPA 3D3BJ 4UUXA 1TU0B 4DV2K 4E1JA 1EQYA 3D6FB 4C0OC 2DITA 3W5ZA 1F5CA 3P8BB 2RB7A 2NREA 3N28A 3TR8A 3E9LA 4Q2LA 3MZIA 5HQLA 1EQMA 5GINA 3UDLA 1O13A 2ZZTA 4NLTA 4OYZA 1WBDA 5C15A 1NGHA 3V4MA 1WF0A 1X60A 3CD7A 2QFIA 4KIAA 1VQ9S 5DGAA 3MTJA 2OPPA 3TVYA 2MJNA 4RUBA 1IKYA 1FTRA 3KG0A 5J2PA 4ERDA 1EZZB 4OLOA 5JS2A 2LECA 3ALYA 3SQ1A 2UUTA 3L7PA 3DNCA 4QYZK 2LXUA 1YITN 2MHEA 1YRTA 4OI0A 1OY6A 2OO4A 3MMBB 3D0HE 2FJAB 4XDCA 5F41A 2HNDB 4A47A 1ZPVA 2VQFF 1N34J 3RSEB 4B3RJ 5A8WA 5A8KA 2XY5A 1X8DA 4NLSA 3TAQA 1SL0A 3KHYA 5M2PA 4HCBA 2XMKA 4ECUA 1URNA 3O3FA 4OPKA 4Z7CA 2KQ2A 3CUNA 4PXDA 2F8SA 3P49B 3FC9A 2YPZA 2MKYA 1G7CB 4ZCLA 1IBMK 1ZBTA 4XDDA 3UVJB 2SXLA 4C11B 1VRUB 1IM4A 3QNOA 3QERA 3LALA 5GAHI 1VQ6N 4HHUA 4EHTA 4WFNQ 2Z2MA 4X64K 2WAQD 3ATUA 4KFBA 1RHRB 3LPEA 2UVVA 1JLAB 4QBUA 1FDAA 3TZXA 1N32J 4JYAF 4FO0A 3UKRA 3KLFA 1GMWA 1NU0A 4HWIA 1MN7A 2I0XA 1HQUB 5D78A 4DSEA 4OJRA 1S1VB 3F41A 3IN5A 4DR1F 3W9HA 4JOUA 2HBJA 1S9GB 2F4VF 3S01A 3OL8A 3PTWA 3C95A 2HLUA 2AX0A 1BUPA 4M3XA 4USVA 5FRNA 2V4JB 2OTLN 3BPSP 4ID1A 2JJ4D 3AARA 3TJ9A 2OMLA 1Q0NA 1NJZA 4DV3K 1NGGA 3DU5A 2ZQBA 4BWJA 4RW7B 3JQJA 4ZN1A 3CJRA 2EKYA 2VG5B 1NSAA 1ZETA 4NASA 2CG4A 2JWLA 3P45B 1TKTA 4ZMMA 2Q1NA 2PGCA 3VV2B 3BP8A 3CNQP 3HT0A 3WC2A 1JCEA 1ZS6A 3SYZA 2JNJA 4LF5J 1KQGB 2ZWPA 2R7WA 4N56A 5LXYA 1Z6RA 2J6TA 3OYJA 5JUMA 2D3UA 3I8DA 1J53A 1ZBSA 4FJHA 3TWHA 3U3GA 1VQ7N 2HRYA 4WU2A 4CTAB 2XNQA 1RAOA 1XMOK 1Q7LB 5BR8J 4CI6A 4UTGA 4WQ4A 3MWTA 4LF8K 3CJ3A 2IRUA 2ZH6A 1XEZA 2ZM6K 2JEIA 2BKPA 2YJFA 4CD1A 1OKJA 3QRQA 3KKRA 2YH1A 1VBKA 3D6TB 1JKHA 4JKDA 3FQKA 1TK5A 3MM9B 2IVFB 5C7PA 2AKWB 5HL7Q 3SUOA 3BF1A 3UB5A 2Y1JA 4DJBA 3R5AA 4LH5A 4MIAA 4B3SF 5EWFA 5CAAA 3SZ2A 4K25A 2GV1A 3POTB 4ID5B 1SJFA 4RW4A 5AE1A 1R7IA 2R2UA 2AT1B 4ILHA 2DRBA 3ZYYX 3OYDA 1ZM2A 5SWMA 2OPQB 1NJIO 5HQ8A 2IS3A 3RBZA 2BKNA 2ZFHA 4ED6A 3THWA 1FE4A 2GVZA 4ZS6A 2ZJPQ 4BR4A 4QR0A 1H2VZ 1TK8A 3JSMB 1U2FA 3FEZA 2H4WB 3NVMA 5KT6A 5CABA 4DR6J 4ZTFA 1RT2B 2ROEA 1N36K 4EU0A 2GV9A 2XZTB 3HHDA 2QA1A 1WC5A 3H3NO 5KPRA 1VCTA 3DDIA 5KFDA 2Z1JA 3MMJA 1R0AB 3OQ2A 5ADXH 1HI1A 4X4RA 4JK8A 3PX4A 2P9KB 4CF1A 4NI2A 3V81A 3L3UA 3GE9A 5EGYA 4DI6A 1X9SA 3PHEA 2G1HA 5H1SV 2CNKB 4DL4A 1Q86T 1YVNA 4DV2J 1WD6A 1JNRB 2W9BB 3BS9A 2R7XA 4OKJA 4QIWD 1RCHA 5BRFA 2PFUA 1S1WB 4O4GB 3SQ0A 2EFOA 4PG7A 3CDBA 4DBQA 1NK7A 5CE3A 1PCAA 1DTTB 2HBQB 2OPSB 4XIUA 2QO3A 5DZ7A 4KSEB 3WNHA 3HVTA 1NK0A 3AT1B 2EX3A 4ANCA 5EX5A 3MUMP 1ZXOA 2B9XA 3AA3A 2CADA 4PXEA 3WIVA 2FTRA 4W5RA 1IBLJ 2YHBA 2O8DA 4HVJA 1XN9A 1Q81O 2WZ1A 4J2BA 1UJ6A 2HFSA 5DJBA 4J7CA 1HA1A 5T14A 4NZ0A 4BRAA 5GAGI 4DTNA 4ZPDA 1RTZA 4WP3A 3RBEA 1RU2A 2NXNA 2YH0A 3L8BA 1WOPA 4BE1A 1RU1A 3CCJS 3L3CA 2GMJA 4CGFA 1PJ7A 3V9WA 1RAIB 2AP1A 1CSJA 1HBOA 4MKAA 3CDWA 3UCZP 3AVGA 4M45A 3ET6A 3GYXB 4OI1A 4EWTA 2F7TA 3P39A 1VK3A 2RIJA 2PAVA 3K7RA 3ZSQA 2QA4N 2Q36A 4WTYA 4E7KA 3V9SA 4RL1A 2BH1A 5ETQA 3SMSA 4LBIA 3EICA 4USWA 4Y2KA 1IBMJ 4FCYA 1HWKA 2Y1RI 1NDKA 3M8PB 3C15A 1TUYA 3ZEUB 3DXKA 2R7QA 2X1BA 1BWEA 3ENQA 4B1YB 2KW4A 1SQEA 3K8VA 2HF3A 4ZPWR 3P4IA 5KG1A 4ZLLA 4ISEA 4GKKK 1N34F 3AD9C 1UKUA 3AH6A 1FNOA 4B3RF 3VEOA 4CLWA 3DOMB 1C0UA 3EGZA 3MMCB 4AHCA 5C10A 1RT5A 3V6DB 2A3JA 3QINA 3AB2B 1KC8O 1CPZA 2EXUA 1C4AA 1V5IB 2YWKA 2FSNA 2HZAA 2QSFA 2BYCA 1S0OA 3A5LC 3V1QA 1U1OA 4DV3J 3NCQA 4UY85 1REGX 4QIFA 3QZ8A 4F25A 3NGRA 4DUTA 1KAXA 4TQSA 2W9CB 2QWOA 1DT9A 2CDRB 1J6ZA 2PYLA 5BPLA 2AGQA 3VOVA 5CZ1A 1KD1T 4Z4HA 3VF6A 2VDIA 4P2XA 3M8RA 1V3ZA 4ZJOA 3SJJA 1Z4UA 3ISNC 1VQKS 4LD0A 5IWAF 1H7WA 1ZAWA 4OYBA 4JKGA 1TUVA 1CZAN 3MF5A 5K5MA 1DLOA 4BRIA 2J6UA 2RF2A 1ZTTA 1QAXA 2LVWA 4B08A 1Y9OA 3AJDA 2WVEA 1GXTA 4AUKA 2QWPA 4OKKA 4CJVA 1BIUA 4LF8J 3Q2SC 2DGVA 4C8MA 5HJYA 2ZM6J 1FRMA 3NWGA 1IJJA 2YNHA 3BGRB 4A59A 5LMNF 4H0OA 1QVGM 1JLGA 1RB0A 4DDFA 1OSDA 2FSKA 2HNZA 1OQ3A 2KXHA 2HBKA 4OZ3A 1M5VC 1FK9A 1RTIB 3QWUA 1WC6A 2ZOFA 4ED1A 1Y3KA 1KR4A 4K8ZA 4XTTA 4N8OA 2P9LB 4F2SA 3MAHA 2E6MA 2RRAA 1U2VB 1N88A 1XR5A 4BRKA 4LSLB 2QMWA 5BR8F 4IFYA 1GX6A 3NRBA 1RYSA 2BV3A 5AQPA 3J81U 2UV8G 4XK8C 3PX0A 2D9OA 1U0HB 2QK9A 4ZVSB 4MO5A 2OZSA 2XLKA 5IC4B 2ZJPL 3MM6B 1HQEA 2XGQA 5KFZA 3G96A 3CJ0A 5F3TA 4LR8A 1IJEB 4A48A 1G99A 4HUEA 2MKHA 1N36J 3I56N 4WYLA 2IHR1 3SCLE 2V4QA 3HHLD 5F2RA 3PKMA 2GGPB 3F0NA 3VENA 4Y2CA 3A8EA 4ED3A 2DGSA 1RXOB 4JAXA 2GCFA 2C2MB 4ZJQA 1W7WA 3CC7N 3TSUA 3HFZB 1EB0A 1EJ7L 3THYB 5J1NA 4MH8A 4OJHA 4PQUA 5K14B 2A40A 4FVCA 2KHCA 3KLGA 3G87A 1ZPWX 2ZD1A 4KAZA 2GUPA 4DSFA 4DL3A 5HJXA 4DR6F 1WG4A 3TR5A 1LFWA 3I0SA 1UVJA 5AQXA 3QT6A 3O9SA 4C48A 2F3JA 4RJVA 4TNOA 1TFYA 5A8RA 4WKRA 5KFTA 4DL2A 2ZUAA 2QTDA 2IVOA 4JKFA 1FXDA 3K5OA 3KHRA 2W6KA 5ETSA 5HROB 5GAEU 4TKTA 2NRVA 2NZ4A 2ZE2B 5KFSA 2GQQA 2GVDB 5AZJA 5HLFB 3Q24A 4EFAC 1M5OC 1OIAA 2XYPB 2QWNA 2J7KA 1OY9A 3J81O 4WF9L 3SFUA 4DV2F 2E6LA 4CZFA 3BEXA 1R89A 4FLWA 4L72B 1RDDA 2H48B 3FE1A 3IR6B 1CJVA 3V1OA 2IDEA 5E3AA 1FDBA 1LWFB 3CDEA 3TWZA 4LF4K 1K44A 4KR0B 4RKUC 2E5IA 4PA1A 1HBNA 4N76A 2XHCA 3HSGA 1VAZA 4DSJA 3KNAA 3E01B 4F50A 4PG5A 1ASUA 1WSRA 4MIWA 1BWVA 3L4IA 4J2AA 2IVPA 2ZH4A 4MJKA 1HBUB 4FWOA 4IEEA 5LJWA 4JI5K 3NBPA 4FYDA 2MQNA 3WHIA 1N5VA 4FVMA 1IM6A 3SV3A 2NRHA 2MQOA 1HL6A 2QXFA 2VA3A 1HKAA 3HF5A 2Y1LB 2YXLA 4CJQA 2GELA 3M6UA 4LJMA 2K3KA 4NMLA 4OLPA 3MXHP 3Q0AA 1TL1A 2VDHA 5M1OA 4CO2A 1YJ9N 1KQKA 2GAGC 2BUPA 4YB7A 1T05B 2F8TA 4H5RA 3TZYA 3VGVA 3V6HA 3GL1A 4DQSA 5IQ6A 4K4WA 4M42A 3A13A 1HBMA 3H0PA 1M5HA 4I68A 3VQ8A 3WNFA 3FBFA 1IBMF 3ETMA 2PA8D 4A8XA 1FJ7A 5E84A 3CJKA 2KZMA 4PWUA 3NAEA 3KWIA 1LWCB 4CJLA 1XNRK 2O8CA 1TZ0A 4CF8A 4Q0BA 1SJQA 3SMPA 2QW9A 4X64F 4Y2IA 5F9LA 4E1MA 5FPEA 4KI4A 2LXFA 5BPNA 4NLCA 1N33J 4JI8K 1Z2LA 2IM2A 5DG9A 4OHVA 1IR0A 2E88A 4M3WA 4AL6A 3DGPB 2JWKA 4H0YB 3VGKA 2QWLA 4WTOB 4XPCA 3SDEA 3OD2A 5IZHA 4YB1P 1JLCA 4E8UA 4M3YA 3RZAA 5HVGA 4BY9C 3PUFA 3G71N 3NEKA 4DV3F 4OX9K 4CJ4A 5ETMA 1Z26A 6FD1A 2A42A 4QIEA 1VQ8N 2HBZB 1NGAA 4WP8A 3BR9A 3QETA 2RHKA 2V6AA 2EPIA 4NWBA 1UWBB 2P9NB 3KLHB 3AGKA 3DLEB 3N5BA 2ASOA 1U45A 4AM6A 3K5MA 2HBYB 4QIGA 4GY2B 3CCRS 3H2VE 5GADP 5K8OA 4IOCQ 3F9KA 4OPAA 1FKPA 1SJ3P 2OTJS 4FP9A 3M4XA 3QEIA 4G1PA 1XMOF 1GAOA 3UE5A 2RS2A 1KFDA 1KAYA 1UA0A 4LF8F 1J5OB 2ASYA 1WB9A 2Z1IA 1IR2A 2ZM6F 1UFWA 1J2VA 2NRRA 2HQ3A 3NGTA 1RT6A 1CZBA 1ZAXA 1VC6A 2XO6A 1LXJA 4PUOB 4M3TA 3V6JA 4CHNA 1K8AT 4CGDA 5MLCQ 4DB3A 4DEZA 3NNAA 4WIQA 5DLFA 4FS1A 2O8EA 3FGVA 2N7YA 1Y5LB 3U7JA 1UETA 4U7UD 2F4FA 3FRYA 3IP0A 1A5XA 3MCNA 1REVA 3HHNB 3MR7A 1KVAA 3PSIA 4CBWA 4U7UK 4KHWA 1FEEA 4DU1A 4DV7K 4KKOB 3HHEA 3NF8A 2CQ0A 4ZPAA 2BE9B 1BI4A 3HHLA 3ZTOA 2B0GA 4E7LA 5AQHA 4DV5K 4CDIA 4KRWA 2MEWA 2A5XA 1B0PA 2K06A 3FBEA 2JEGA 4DR7F 1N36F 4RNNA 3G6VA 2DHGA 1EP4A 1K1SA 4Z4FA 2WBMA 1EKRA 1Q5VA 4CM0A 4NLDA 3MM7A 1N5SA 2VB6A 3VAMA 1MROA 1KLNA 1HI8A 2LSNA 2D5RA 5IV4A 2UVWA 4KHNA 3WXKA 4U67Q 3W7BA 4LQ3A 2KKHA 3NMRA 2ACMA 1SIZA 4B8CA 1FNXH 2D9PA 5F0WA 3MPWA 1EWQA 4DTOA 1RDAA 1YJTA 1ZA2B 3BKFA 5L9NA 4YHHK 2NPIA 1IR1A 4X4VA 2ACYA 1U1PA 1X5SA 4O3RA 1HWIA 2GAHC 1OY8A 2F65A 3IG1A 1ZBHA 4LF4J 2Q97A 3BREA 4CI0B 4PYAA 4OZ5A 1I39A 2VFVA 4YFUA 1T9XA 1Q82O 3ZZYA 5AQLA 3H5UA 2RILA 1TKZB 3K2YA 2Q1LA 2J9CA 1PAUB 1RSCA 1QQMA 4JI5J 2ILZA 4I67A 1HPZA 2ZVIA 4Z7YA 3DDNA 2ZDPA 2C3UA 2JVOA 3MD1A 3VEZA 1WAJA 4ATNA 2AU0A 3DRPB 2FSJA 3UD5A 1UEVA 1A5VA 3IBFB 4OHYA 1O6XA 3NOGA 2QTWA 3RTVA 1GOCA 4JNEA 2CYYA 1TMJA 2VJVA 4GVBB 1Z05A 3MCAB 1ACMB 1KQSR 2XYGB 2CDQA 1CC8A 1ATRA 1G1XA 3C0BA 2Z8QA 4MYTA 2V2QA 2WW4A 3V9UA 3H8YA 3U1MA 4TVAB 4HYKA 4PXCA 3K9KA 1F2GA 4M5IA 2EW9A 2DHHA 4L8RB 2UXDK 4FWNA 4ID8A 2G13A 2ASPA 5A6PA 4LRDA 1XNRJ 3JYTA 3Q2TC 4ES2A 2WSCC 2G8KA 4AXIA 2VOPA 2R7SA 4PZVA 1LW2A 4KV8A 3EPIA 4GKKF 4CJEA 2P9GA 1VK0A 1K9MT 3KMQA 3A5NC 3PG9A 2CGJA 2R7OA 4JI8J 2ZH3A 1RTHB 3KTQA 4QCLA 1IQZA 3OYAA 4KHRA 2AIRB 3MI7X 2ZH5A 4BDZA 1PC4A 3G2XA 2EC0A 1BHNA 3VCDA 5AQIA 1H2TZ 3QSYB 3O2IA 4BR9A 2CZ4A 4RPFA 2ZGZA 4R8UB 3ZZ0A 5D0EA 2ATLA 1RCOB 4TU8A 1KS2A 2VF3A 4CLZA 3BYPA 4OX9J 1VRTB 4QR2A 3G8QA 4CZKA 1CJKA 1FFSB 1BG3A 3AY9A 3J8AA 1LWEA 4WU3A 4KBIA 1SJRA 1IO2A 2I1RA 3VAFA 1TTHB 3D6MB 3RR8A 1VIOA 2B3TB 4KAIA 1W2BR 3CJ1A 4XO0A 3HPGA 2B9WA 4EBDA 2UUBJ 2LU2A 4DCPB 1YWXA 1QD1A 2CH6A 2CFXA 4QPXA 2P1JA 1GNKA 5KFFA 2F7VA 3C6UB 3JAMU 4BGAA 1RHKB 3CCSS 1BQXA 3TOQA 4OYIA 4LSNA 2JEJA 3T1YK 3BH6B 3ZSOA 1S1XA 1OPZA 3BO4A 1PBUA 4IOCL 3OYIA 1VHXA 3HVWA 2QYCA 4CGJA 2OI2A 4QPTA 4ELTA 3I8BA 2YCHA 1R31A 2BW7A 3LGHA 4RWWA 1RADB 4MIBA 2DJWA 2VFRA 3OW2M 4A8KA 1OVQA 2RQMA 5KFKA 3HTVA 3SQ2A 4FJKA 2IBKA 4B1XB 2D74B 3C7NA 4CHPA 1YT3A 3CYMA 3QGHA 5J2QA 4IKAA 4NLOA 4H4KC 2CQIA 2W2NP 1HWJA 3JAMY 3T3FA 4KE5A 2ZNZA 3L95X 4KI6A 1NLKL 1MLAA 2VC1A 3MXIA 2E7WA 1S1UA 1U48A 4K4ZA 2O3DA 3KLIB 5H9EK 1XR6A 4DKWA 4LMZA 3ZTQA 5DDOC 2FLPA 4ETZA 2X1GA 2XSFA 4DV7J 1JL1A 2UXBK 4URQU 4CZJA 3TP2A 5DZ6A 1A6LA 2NLWA 1XHZA 4NYPA 3GFXA 1FKAF 2Z56B 3S1TA 4DV5J 2A2DA 3M1FA 1GLDG 2ASJA 3PV8A 4OX7A 4JI0J 4NCBA 3JAMO 1EWRA 5J2PB 4GKJJ 2E1ZA 1FF2A 2EFGA 2BW2A 1U1QA 2EG1A 3CERA 1RT7A 2BOAA 5KG6A 4JP8A 4JI7K 4U67L 1NSKL 4OV1A 3WEEA 3K5PA 2EFQA 3VQ6A 2Z2YB 3CFPA 4YHHJ 3QJJA 4OI2A 4KRFA 2MZ1A 3KHGA 3ZZRA 3M30A 2BRLA 4KT0C 3M32A 1IKVA 3I96A 5AXLA 1IKXA 2WUSA 1YVFA 2DNPA 1DBDA 3A5MC 1C0TA 5A8WB 1VQPN 3A4TA 5AQOA 3DRRA 1FJGK 4JI3K 3LM2A 4Z4IA 1VLOA 2DD8S 2VWBA 1RBTA 2BMBA 1NOYA 1WC0A 1B0VA 3N5FA 1L3UA 5KFYA 2MQLA 1WC1A 1KEKA 5H1SQ 1T3NA 3KYLA 1QAIA 1FT8A 2IA0A 1C0GA 1NMEB 1WOSA 4EEYA 3J7ZT 3PRDA 3HKWA 1S5JA 2OD6A 2Q2RA 1NZ8A 3HSCA 2Z0GA 4USIA 4FF1A 2NZTA 4KFBB 1TV6B 1JK9B 5AXKA 1WOOA 3MDFA 1SIWB 1OH8A 3UKRB 3KLFB 2YKQA 3ISZA 1K8KA 5AQFA 5I4MA 3NS5A 4LF4F 3EPGA 2HHUA 5AFUH 4BRMA 3M2UA 1TL5A 2AJ2A 3I4PA 1HLUA 3ILIA 4RBUA 1NGIA 2YWEA 5E3CA 2DNYA 2DHXA 2AYEA 1QM9A 4JI5F 4ALZA 1KP6A 2C3MA 3P4UB 2HHPA 4CZIA 2KH9A 1MSWD 2HFOA 3SPZA 3SQ4A 1TKTB 2UXDJ 2KRRA 2HNDA 2B4OA 3ENOA 1OYDA 2OUGA 4DR5K 2LEAA 3CC4N 2BZ2A 2YHXA 4KO0B 3NGSA 3C65A 2YKAA 4JI6J 3VZIA 3G9CA 4DTSA 2NUHA 4K0KK 1PJ5A 2C42A 4M5DA 2QEXS 4H03B 2RUSA 1T03B 4LFAK 1NNDA 1VQNS 3H40A 1ZH5A 2BOPA 1P8ZA 4C11A 1VRUA 2K1RB 2ZC4A 1BL3A 2V67A 4A2AA 2RS8A 1ELOA 2ZWHA 5EXWA 5HMWA 2BE2B 1JLAA 4LRBA 2EKNA 2HQGA 3EZWA 1XNRF 4JK9A 1JKHB 3T5HA 1Q8IA 2ALZA 4Y1DA 2QFJA 4P75A 5JS1A 1W25A 2V4JA 4JI8F 4FNIA 3ZT1A 1W97L 2CJXB 3FZ2A 1XUPO 3Q8PB 4RW4B 2IM3A 4B9UA 2VQEJ 5E2QA 1NOZA 5B0BA 1YJUA 3U02A 3T1YJ 2ZKUA 5KOXA 4C9DA 2D0BA 4F4KA 3TUZC 3J7AN 2AEJA 3NVKA 1NJXA 4KH4A 4OX9F 3ZZUA 2N3OA 2IVMA 3THWB 3UDCA 2HHHK 2GVZB 1RZMA 3CJ7A 1OQ6A 3HVAA 4BDPA 3SSRA 3GIJA 1UMJA 1NPKA 4F4AA 1YTAA 5C0YA 1TUGB 5EWEA 1UZDA 1VQ4N 4CLTA 5EVZA 4CJWA 3DMJA 2HGNA 4WZMA 2OFGX 3HJVA 1UW4A 3ZFVA 4CZCA 3GQCA 2HNYB 3NKYA 3OSPA 1B9FA 4FL9A 4DTUA 3EO3A 4CFAA 4PL8A 3HYFA 2ROGA 5IFMA 3JSYA 3J80U 4HHTA 3IGVA 2CXEA 2XY7A 5F0UA 5E5NA 3UN5A 4NI2B 1PGZA 5H9EJ 5B8HA 3MM9A 4BDYA 5AQYA 3HDSA 3L2UA 2UXBJ 2FVQA 5KRSA 2MYFA 2AD9A 1NB7A 5L1IA 3C6AA 1BD6A 2YX6A 4QU7A 3H25A 1B7FA 2A6AA 1WBBA 3AXMA 1UOCA 1MWKA 3Q22A 2QYGA 4LR7A 3MXMA 4QWBA 3IWNC 1PILA 4LF6K 3W66A 1S48A 4ILRA 4C0HA 1X3NA 2HHVA 2O8DB 3J80Y 3IFRA 2H65B 3OYCA 3QGIA 5KAKA 3QIDA 2K2PA 1BOTO 2DXFA 2Y8YA 1YXQA 3CMES 3IUCA 3W5YA 4MDAA 1ZC6A 1RT4A 2D0AA 1KVKA 4DV7F 5AJ3K 4ZVHA 3LP1A 3W2WB 3AO5A 2FJXA 4F36A 2QLWA 1S5ZA 2L9WA 3NL0A 1IQTA 2PD1A 4DV5F 3CXCR 1DKGD 4X65F 3HULA 3RRGA 2BABA 2DISA 4NYOA 1KOOA 1HBOB 1U25A 3WXMB 1QAJA 2YKMB 5DDRC 3ET6B 1VC5A 2E2NA 4DSLA 1L3SA 4FJ9A 3CCVS 4AF1A 3BGUA 3LZJA 3J80O 1NPRA 2HK2A 4IFVA 1U02A 1U8SA 2W9BA 2VUGA 3IXQA 2G2YA 2CQPA 2ZEJA 2G9OA 4O5BA 2KRBA 1NK5A 2X1FA 4YHHF 4IG3A 5KOWA 4M8LA 4RBVA 4DTPA 3BSNA 3GSIA 2B5JA 1RBLA 1T7PA 1Q86O 2C2KB 2W2PP 1HFEL 1OJ4A 2QA2A 5C25A 5F8LA 5F8NA 2Y1IA 1C0UB 4U96A 4ZIWA 1S79A 3PYGA 4CHYA 1RT5B 3P38A 2Q6CA 3HO1A 3AVAA 3PO5A 3OHRA 4HUFA 5CYMB 3CCQN 3EZUA 4CEEA 2W1BA 3R6MA 1RWWB 4PWDB 4DMZA 4N47A 4LIWA 5HK4A 3EZ5A 3G4SN 2D0CA 4F3QA 5B0GA 4W5TA 4V19J 3EUNA 3R97A 4DR5J 2FF6A 4I6AA 4FVUA 1J27A 4PWWA 1SC4B 5AQQA 3KD1E 2VCPA 2XYHB 3BZKA 5HRNA 3LW5C 1M1HA 3MEDA 4OI6A 3CFRA 2C1EB 4F4XA 3C94A 1WELA 3KK2A 5M2RA 2E66A 2BEFA 4MTPA 4K0KJ 1VHFA 3DFEA 4DHVA 1YF5L 2G0CA 2C2ZB 1HWLA 3KJQB 1YBTA 2NS1B 4M5LA 1D5AA 4O0NA 4I2PA 1BQNB 2AJFE 2H5JB 2RDIA 2VJUA 3MR6A 4JKGB 2ZUGA 2E44A 1KTQA 4AL7A 3NGKA 1DLOB 2P9SA 3CPWM 2MY8A 2RF2B 3NAHA 2DNMA 5J2NA 1VQMS 4P2FA 3M8QA 1BY9A 1MNEA 2UXDF 4V19X 4ENOA 2W4DA 3PX6A 2V51B 3GYGA 3GIMA 4K4VA 4AQYK 2YNHB 2VBWA 1LOUA 1ZYQA 2NNWA 2RNEA 1CVJA 1ZZNA 1JLGB 2HAIA 3DOMA 1U49A 1RP5A 1BCMA 4A8OA 4Y0FA 3EGVA 4NRTA 2M7SA 4OJGA 4A4JA 1EXQA 1HPMA 2HNZB 1Z1ZA 4CJTA 2V8GA 4Q7AA 2E5LK 3G6EN 4JLHA 4JV5K 1NK8A 3WDOA 4FSVA 2LA6A 4EO6A 1H0HB 5GADU 3NMAA 3A8YA 2OEMA 4OPHA 1SI9A 4ZJLA 2DKOB 4IFYB 3NHGA 3PFEA 3MN6A 3LP3A 4I6MA 3E3XA 1NBEB 5D0GA 4DPYA 3LM9A 4J9PA 2R2SA 3OTOK 3PFOA 1HQEB 2IPOB 1GLCG 2HVDA 3MCOA 4WFBQ 4DL0C 5D4PA 1RWNB 4FJIA 3HX9A 1F5BA 1LWXA 2XULA 4PPDA 3KG1A 1WLJA 3U1NA 1S22A 3LP0A 2GX9A 1KD1O 2PYJA 3T1YF 3CEDA 3OFHA 1U4BA 3LO3A 5KPTA 3PLAA 2QSWA 4ZVUB 1UCNA 3CCMS 8RUCA 3ZO7A 2D3O1 2QWMA 1PBAA 4PQUB 4PG6A 2FVSA 1YVUA 5KFMA 4DLEA 4CJKA 2F8EX 3UCUP 4TY8A 3M9MB 3NF6A 2X1AA 1SH3A 3I0SB 4ED2A 3T6BA 4P10A 4P52A 2ITMA 3EVWA 4U7BA 3TQEA 4OL8A 4PAAA 1T0TV 5A8RB 1YBAA 4IH5A 4LF6J 3WXJA 3TUJC 4HT5A 4RX6A 2EHGA 3L0QA 3K59A 1FE0A 2DB1A 5AZJB 1A9NB 5KFVA 4FXDA 2VYPA 3MM6A 2GJFA 4DV1K 1TVRB 3OYBA 2NLXA 4BC7A 5AJ3J 2UXBF 4RCHA 3TAEA 2ERRA 3D2FA 1CJVB 5CZVA 1J9AA 3FJ2A 3D4JA 3EX7B 3ONQA 1X4EA 3HLUA 4FPAA 2RU9A 1JL2A 4MAKA 5I3PA 1GEHA 1IWAA 2E1MC 3C14A 3BH7B 2YQ1A 1I51B 3OVNA 1UFLA 3N6LA 2OMOA 1BGXT 2AP6A 4JI2J 1WKKA 1N48A 1FCAA 2PSZA 3NBPB 1MU2B 5HP1A 1WKLA 4USTA 3MMVA 4Q44A 3MUVP 1UVKA 1AROP 3TVZA 4PR6A 4JI7F 4DR3J 1GMUA 1LXNA 3VQBA 4IR9A 1FXXA 3RBDA 4BS2A 2P9EA 3A8JA 3TZZA 4N7TA 2E9ZA 3HZ6A 1JLBA 1S12A 1DJ0A 4L3QA 1VQLS 2V9KA 2X78A 1TL1B 2LQ5A 5C24A 3B8AX 1TAQA 1E4GT 2FGCA 2FBYA 4H5VA 5LSRA 4FLZA 3CVKA 3NGDA 2WK4A 1KQSM 2L08A 1FJGF 4JI3F 1U1LA 2RQKA 4KPCA 3ZZZA 2HVZA 4BR0A 3UI3A 5GADI 2F40A 2HURA 4ZP9A 4RWTA 3AXKA 3BO2A 4NEZA 3MOJB 1HWUA 3PSFA 1HKCA 1E6VA 3J7AP 3HSTB 5TKYA 1URRA 1LWFA 2R7UA 3KHLA 2O8CB 3VALA 4Q0BB 5KTQA 2IJRA 1SC3B 2QLFB 3H46O 1NHUA 4JD2A 1LAVA 5AQGA 3O5TB 3HI0A 3CCES 1U24A 2ZWOA 1N5YA 2WVCA 4P6QA 3O9UA 1MA9B 1FRLA 3VHQA 5A2QU 1NH7A 3OHAA 1SH0A 1GQEA 4IYQA 4Y65A 4FOIA 3SDEB 3NDKA 2W7PA 2XEXA 1JLEA 2ZNYA 4ICLA 5CHCB 2G8VA 4N77A 2J6SA 3T69A 4QWDA 1XC3A 1GLJO 5BREA 3H5XA 2P2CB 1E6YA 1TP7A 2P6SA 5BYQA 4O0IA 2RE1A 4Z4EA 4DR5F 2Z57B 4O3PA 3OR1A 4CNZA 2VH7A 4YORA 3FSYA 4I2QA 2PMHA 4Y1CA 3IWLA 2XWXA 4KGZB 1BQMA 1T05A 4WCEQ 4OGEA 3QATA 1X4DA 3NNHA 4K0KF 4CO1A 1PC5A 2LDIA 2HRUA 2E5LJ 1IV0A 4JV5J 4J37A 4LFAF 5JVHQ 3BQ0A 4AHVA 4W5NA 1K47A 3EE9A 2MQ8A 2MGZA 1FKPB 3W65A 2JZ5A 1LWCA 3HBTA 4JKBA 1WC4A 4M94A 4I9QA 3WQTA 5DDQC 3FZMA 1S6UA 2DRDA 3ITHA 4F7VA 3Q23A 4J9QA 1RT6B 3OTOJ 4YOTA 1IBKK 3CCLN 4F3OA 1Q8LA 3KWGA 2HZVA 4CP5A 3M6VA 2B51A 3D0GE 3WNEA 4WFBL 4B02A 4Z2XA 2BJ8A 4FK4A 3MN7A 2PY5A 1FD2A 4YP3A 3KFWX 4O8KA 4LF7K 3R8EA 3NCIA 3MTKA 5A2QO 1WNSA 3BYRA 1RAHB 3WUHA 2O8EB 1YK9A 2FZGB 2HK3A 3CD6N 1XI1A 4M5KA 1GOAA 3SBTA 4HI2A 4E3SA 2CQCA 4Z94A 1BC6A 1FVSA 3ZSWA 4FWPA 2V0NA 2P5VA 3QBWA 3IO1A 4ZVTB 2YKOA 3VMFB 3NG8A 3HHLB 2O67A 2HHHF 2JSXA 1CULB 3LWLA 2XWYA 4R79A 2W8KA 1QJHA 2DIVA 2QE5A 1AFJA 2GTDA 3W62A 1VQ5S 4KTWA 4DQRA 1TUUA 2O8FA 1UWBA 3DCAA 3KLHA 1EP4B 4FJNA 1QSYA 1X7VA 2W4PA 1QDUB 4KHUA 5LT5A 5DM6Q 3MM7B 4F3MA 1IJFB 2FZKB 4USMA 3UWTA 2CQBA 1HYZA 3DLKA 2O5DA 3IWXA 4YEAA 3VQPA 2N3LA 3CCTA 3G0ZA 4DN9A 3VQ7A 2QL7B 4Q8FA 1CQNA 2KXFA 3GJSB 3CJ4A 4WE1A 1VFJA 3EXCX 2D69A 1JJ2R 1YZ7A 4DV1J 1F1BB 4B1ZA 3RWUA 5AXMA 1ZA1B 1N8RT 2AYGA 3J7YP 3GZ7A 5LOQA 3N9UC 4PPZA 1Q9XA 2F1FA 1C0MA 3IG1B 3GCWP 4PXBA 4LT6A 2HVEA 3B78A 4BCAA 4Z37A 3FGUA 2DHAA 2NRZA 3CD5A 3G10A 4RW8A 1O8BA 4LF6F 4MK7A 2AGPA 2XO7A 1H2UX 4DZDA 4F26A 4NA3A 1SJ4P 1K8AO 1W26A 4FZXC 3HM9A 2B6AA 3TAMA 1Q78A 1ZM9A 3TAGA 2ILYA 4UT4A 2FBTA 2I38A 2E1CA 1HPZB 4E0DA 2A1RA 3KDOA 1T44A 3MDQA 4OJ1A 2ASDA 5AJ3F 4HACB 1F9EB 4JRQA 4I6YA 2YWFA 4GO5X 3I6PA 2CVEA 3SQGA 4H0PA 2CJYB 3C66A 1TAUA 2MJUA 3RMCA 3O3GA 1TR0A 2H5IB 1P9QC 4PKGA 3MXJA 2LFVA 4G3IA 4MKBA 3LAMA 1QVFR 3VQSA 3IRXB 2BACA 4BLGA 5F8GA 4BC3A 2R8HA 3A2FA 3LPYA 1KAZA 5DG7A 1RGVA 3OR2A 4ZVQB 2N82B 2M2BA 3GLJA 1BXNA 4I4BA 3CMAN 4CEAA 3H45C 2M8DB 3VF0B 4ILMA 4Q43A 1ZM3A 3ADAC 3NNCA 1C1BA 2V2ZA 5AQTA 3DLHA 2R9LA 3S41A 3BKUA 2M9KA 5CXTA 2ASLA 3JYTB 4GVEA 4RU9A 3FSIA 2PMZD 4TU7A 2X3GA 1YUWA 1FJCA 3R3LA 1LW2B 4KV8B 4TXSA 1PG5B