1C1BA

Crystal structure of hiv-1 reverse transcriptase in complex with gca-186
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
543
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of MKC-442 (emivirine) analogues with improved activity against drug-resistant HIV mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 140
structure length 536
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c1bA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c1bA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c1bA05
5KFMA 4KAZA 3RMDA 4C8NA 4AHSA 3VQQA 4YR2A 3PW4A 1TGOA 2O4IA 2HHVA 2FLLA 1HYZA 5J2PA 5HROB 2AWZA 2HVIA 1WAJA 4QW8A 2IBKA 2I1RA 3RB3A 3IN5A 4PQUA 3JSMB 2B43A 1S9GA 4KTQA 3LP3A 4B9NA 4DQPA 2IMWP 2YNFB 2QK9A 1KFDA 1KLMA 1DTQA 3OYJA 3TAEA 1Y97A 3CJ0A 4AHUA 4O44A 1VSIA 4BDPA 4GC6A 4Q0BB 4KTWA 4I9QA 3LP2B 1S1TA 4IH5A 2WTFA 4KPYA 2WHOA 3OYKA 1GX6A 4EBDA 3KD1E 3DM2A 3HHKA 1GOBA 3H5YA 2GBZA 4ZP9A 1S1VB 2QXFA 2KFNA 4WFZA 4MK9A 4DEZA 1GOAA 4QAGA 4DFJA 2QE5A 3BR9A 4NYFA 4OLAA 5DGBA 2ZQBA 3OSNA 4FCYA 2W7PA 1WSHA 1RTHB 1WSJA 3L2VA 3HPGA 3V4IB 3TABA 3QNOA 2YNGB 3CIZA 4TN2A 2O4GA 3NH2A 4CJEA 4Z4CA 4G1QB 4WE1A 1U48A 4EO8A 4RW4A 3SUPA 4KV8B 4J9SA 3SZ2A 4I2PB 5KFYA 1JLAA 2D0BA 2OPRB 4J9KA 3V1RA 3NHGA 4O5BA 4DL5A 4FS2A 4URGA 2HHXA 4Z4FA 4L8RB 3NBPA 3LP0A 5KG4A 1Q9YA 4Y1DA 2RKIB 3H5UA 4O3RA 2XGPA 1S6QA 1QTMA 2YNFA 2W9BB 1J5OA 3DYAA 4EBEA 4DTJA 1C0TB 1VRUA 1JIHA 5KFTA 3VQ5A 1RT5B 4EYIB 4R0EA 4IBNA 3PZPA 1RT1A 5L1JA 3M8QB 3VQPA 1I6JA 4HYKA 4FJNA 3QGGA 3PX0A 1YT3A 2IJFA 1KLNA 2BQUA 3NF8A 3I5BA 1LW0A 2EHGA 4FLVA 3DRRA 2HWIA 4KE5A 1UAXA 2I5JA 1T05A 4DWIA 1WN7A 3MR3A 4MK7A 4XO0A 1QE1A 1TL3A 1D0EA 4Z4HA 3QEPA 3ZSWA 1A5XA 2IAJB 2HNYA 4CHPA 3AVMA 1JLAB 3MR6A 2W9CB 4IR9A 5HP1B 5DG9A 4FK4A 2VG5B 3THVA 2OPQA 1JLFB 2HNDB 4E7KA 3NAHA 4ZPBA 2GIRA 5KFOA 1IKWA 1KVBA 5J1EA 4ECZA 4CJPA 2HWHA 3O3FA 3L3UA 3KK1A 4DTNA 1FK9B 3M8SA 4FYDA 1VSFA 2IOCA 5KFKA 4B9SA 2R2SA 3B6PA 4NLYA 3C6TB 1JLBB 1C6VA 4IG3A 5KFIA 1LWEB 3EZ5A 4FK0A 1YVFA 1LV5A 1W0HA 1BCOA 1S4FA 1XC9A 2AX1A 1N4LA 1LW2A 1TKTA 4DQSA 3H5SA 5EWGA 3SQ1A 3KK2B 4OVLA 2XY7A 2HNYB 3OYHA 4M3ZA 2XO7A 1U47A 1NHUA 2R8HA 3CG7A 3AVNA 4K4XA 2QV6A 2BE2B 5F8HA 5KG1A 4ECRA 5J2PB 1HARA 3RBDA 2VG7A 4JRQA 4DU3A 4WFXA 2BRKA 2PY5A 1VSDA 1C1CA 2PYLA 3KD5E 4EP4A 4RW6B 2DFFA 3OYMA 1JL2A 4KHYA 3IRXA 4O4GA 2IGIA 2FC0A 5FDLB 3K58A 1RA6A 1J54A 5DGAA 3DDKA 4CJKA 2P1JA 2B4JA 5KGXA 4DQRA 4FW1A 4CE9A 4CEQA 4M94A 3OS0A 4TY8B 3I0RA 3SFGA 1RAJA 3OL9A 2YHBA 3PX4A 4E19A 1U04A 2IM0A 1J9AA 3PO4A 4YQWA 3CDWA 4DTMA 4K4VA 3KLGB 3QZ8A 2Z1HA 1SKSA 1UA0A 4RNOA 3K2PA 4CEBA 4HUGA 3ITHA 5CZ1A 1ZYQA 3QEWA 3V1OA 4OKEA 1C1BA 4ED3A 1S9FA 4DL3A 5EWFA 1TKDA 4FZXC 3CM6A 3DRRB 3HVTB 1N6QB 3OYEA 4WE1B 2D7SA 2ETJA 4WZQA 1ITGA 1S5JA 5L1IA 4QCLA 4CEEA 2GIQA 4GW6A 1NK8A 5C5JA 4ECQA 4O3QA 3TAFA 1REVA 4F50A 1JLQB 1TAQA 2HVHA 4B9LA 4KI6A 2ATQA 4Y1CA 4KRFA 3WNGA 1HMVA 5CZ2A 2AGPA 1T7PA 5KFHA 1EXQA 1QSLA 1RBRA 5C25A 2FBXA 1KLMB 5L1KA 1QAJA 2FBVA 3TARA 2VWJA 4RW8A 3E51A 3NFAA 4WYLA 1S1TB 3MFIA 5HRNA 2O5DA 3T1AA 4FJKA 5KT7A 2KZMA 3M8PB 1S97A 3GYNA 2C2EA 4ED1A 3AVKA 2KZZA 4E0DA 2QKKA 2UVVA 1OS5A 3TVKA 4ELVA 4ELTA 2IS3A 4KHRA 1FKPA 1REVB 4CJ5A 2DFHA 1X9SA 1HPZA 1TKZB 1U45A 2XCPA 3SFUA 2D3UA 3H40A 2JLEA 3T3FA 3KK2A 4ID5B 1SL1A 2DPIA 4BE2A 4M3UA 4MKAA 3V9XA 1ZBIA 4XIUA 4EP5A 2GV9A 4IFVA 3HK2A 2HMIB 4ZTFA 2FJWA 3GIKA 2W7OA 4OLBA 1C0TA 1VRUB 1JKHB 3Q8SB 3KJVB 3BQ0A 4RW8B 4TSXA 3QESA 3P1GA 3KHLA 4ZHRA 4TYAA 4W5NA 4DTXA 4HKQA 3SI6A 1JLEA 3LAKA 2D3ZA 3AVIA 3NF9A 2XCAA 1RCHA 1EKEA 2Z1JA 2JEGA 2E6MA 3BSOA 4JS4A 3EPIA 2XI2A 4FM0A 1S6QB 5KT5A 4G3IA 3OYDA 4KI4A 4I2QB 4PUOA 1Q8IA 5HRPA 5HROA 4F2RA 3DRPB 4KHNA 1L3UA 3ALYA 1JXLA 1IKXA 3KLEB 4YR0A 3HT3A 4ID5A 3CWJA 4K50A 1JXBA 1XHXA 4ZP7A 4C8MA 2P5GA 1YTUA 4M41A 4J2BA 1LW0B 4TY9A 4CHOA 3RRGA 4FJIA 1T05B 1BISA 2AJQA 3MR5A 4AILC 4CGHA 4O0JA 4CFDA 5KRSA 4OL8A 4LSNA 1HNVA 1O1WA 3VQ6A 3CFRA 4W5RA 1NNDA 4F4ZA 1RDCA 3VQDA 4FXDA 4TY8A 1LAWA 1NKEA 3P83D 3OJUA 4NLUA 2YKMB 1CLQA 3KKRA 3HVAA 3DOKA 4RG8A 4F8RA 4KBIA 4J2EA 4OKKA 4J9OA 3H08A 4KHWA 1RNHA 3PX6A 4JUZA 2DPJA 3VA3A 3K5NA 4TLRA 4MIBA 3SCXA 1ZETA 5FRMA 4CJ3A 2ILZA 1C1AA 2IC3A 3TAMA 2WRMA 3BQ1A 1JLFA 2HNDA 3ISNC 5F8GA 4J2AA 4CEOA 2I5JB 4C8OA 3HP9A 4NYNA 3DLRA 1ZBHA 1IKWB 1WSIA 5KFJA 4ICLA 3IGVA 2AU0A 2AGOA 3OYFA 1MU2B 1SV5A 4QWDA 4QPXA 5KFCA 4ZMMA 3G86A 3UR0A 3AO4A 4CFCA 3IRXB 2BQRA 3PHEA 3HYFA 5E41A 1KFSA 1IKVA 2KQ2A 5KT3A 3NCIA 3MEEA 5CY4A 4DTRA 2AGQA 2C22A 4RNNA 2RF2A 4CGDA 2YNHB 4DTUA 3MEGB 3SQ2A 5CYMB 3VN5A 4IQXA 2CJQA 5KFNA 4CJLA 4E7LA 2JC1A 4KKOB 1IO2A 4MQ3A 1S49A 3QGIA 2P51A 4I9LA 4DL4A 2GUIA 4OPKA 4B9VA 3DLKB 3QGHA 3SPYA 4OKJA 2ASJA 4JV0A 2Z1IA 2IC3B 3TAMB 1JLCB 1SH0A 3NKYA 2R2UA 3OJSA 3BSCA 3HP6A 4FK2A 4CESA 3PR5B 3BGRB 1KVCA 2EX3A 4ID1A 1DTTA 2J6TA 3KMQA 3K59A 1HQUB 1VSLA 1K6YA 1KHVA 1CXUA 2RDIA 2ALZA 4M3XA 3KK1B 1J5OB 2HNZA 2UUWA 4R8UA 1C0MA 4NCAA 5KFQA 4NRTA 5K14B 1G15A 1R0AB 5KFEA 1ZBFA 3MEGA 1SH3A 3L2WA 2VA3A 4CJFA 1RYSA 4BDYA 1DLOA 1RTHA 1NKBA 2B5JA 1RDRA 3MEEB 1LW2B 4MKBA 3ZSOA 3QIPA 3FFIB 1LWCB 3O3GA 2BR0A 3GV5B 4I2QA 3RR7A 1BI4B 2E6LA 2XWYA 3ZSYA 1K1QA 5EDWA 3ZSQA 1DTTB 2YKMA 4O3OA 4NLOA 3CJ4A 4O0IA 3PW7A 4E89A 5KGWA 4K4SA 1WSGA 4CCHA 1VSEA 4OGCA 4B8AB 3SV4A 1F21A 3SQ4A 3LP1A 1S0MA 1JLBA 1GX5A 4Y2AA 3KTQA 2OPRA 3FQKA 1CZ9A 3ASMA 3VQCA 4R5PB 4I2PA 2UVUA 4CF9A 3K5OA 4IG0B 4FLYA 4YMEA 2J6UA 4NCGA 3KKSA 3N6NA 5L1LA 3DLKA 1C0UA 3OYBA 5D3GA 4GMJB 4NLVA 5DMRA 1T03B 2OPPB 4F3TA 1VRTB 1KCFA 1HNVB 1HMVB 4FJ5A 3PW2A 4ZPDA 3DI6A 3CVKA 4MFBB 4XPCA 5JS1A 3AVAA 2FJVA 1YTAA 1ZTTA 1N48A 4PWDA 3OYCA 4NLPA 3ZT0A 1TKXB 1SV5B 5KFBA 2OPSB 5DG7A 5F9LA 2D0AA 1D5AA 2OZSA 3MR2A 3ZSZA 3AO2A 3IGNA 2WONB 3AO1A 5SWMA 4HCBA 1R0AA 3V6JA 1CZBA 2C2DA 3AA2A 1T8EA 4Y2CA 1RT5A 1RBVA 1GOCA 1L3VA 4M3TA 5DG8A 1NK7A 1JKHA 2Y1JA 1X9MA 1LWFA 2ILYA 3CO9A 1K1SA 2V9WA 4AHTA 2WK4A 2G8UA 2E9ZA 4F4KA 1J53A 2OZMA 2XY8A 3VQAA 3LDSA 3CJ3A 1WSEA 3S3NA 4OPJA 3M9NB 1BIUA 4CIEA 4CEFA 1A5WA 1HPZB 4AH9A 3KMSA 3IS9B 4ED0A 4QOZB 1HYVA 3IG1B 4FBUA 1BQNB 3LWLA 2OYQA 1IKXB 4DSIA 5I42A 4E1MA 3D0PA 1D9DA 5F9NA 2BE2A 1HYSA 4FBTA 4NLDA 5KFLA 4WXOA 4CJ4A 1S48A 2G8IA 3AVLA 1QQCA 1JX4A 2R7YA 3V6DA 1DLOB 4MH8A 4BDZA 3CDUA 1LWFB 3CYMA 3AVHA 3V9WA 4B9TA 4M3RA 1NKCA 1IM4A 4CERA 1S0OA 2HHSA 1TV6B 5KT2A 4K8XA 2VG6B 1RDBA 3RAQA 3BJYA 2G8VA 1XR6A 2BDPA 3E01A 5HRSA 4GVMA 3I0SB 4CHYA 2VWKA 1ZTWA 4R5PA 5KTQA 5HRRA 3QO9B 3BSAA 4O4GB 2KFZA 3L8BA 3RMCA 4QW9A 4KV8A 2G8FA 4EZ9A 5T7BA 4DQQA 3I5AA 4FZYA 4QWBA 3IAYA 4KHUA 3T19A 4YR3A 1NJZA 3TWHA 1SUQB 1VSJA 4LH4A 4B9UA 4URQU 4IRDA 2F8EX 4LSLB 1IKYB 3JYTB 1ZBLA 2X6NA 2WOMA 4FLZA 1IH7A 2OPPA 4RUAA 4HVJA 1RYRA 3RB4A 2E9TA 3T5HA 1VSKA 2XRIA 4J2DA 3G0ZA 5KFWA 5HBMA 2UUTA 2AQ4A 1ASVA 4RNMA 1KVAA 2E4LA 3OHAA 2EC0A 3LAMA 3NGYA 3BQ2A 1MU2A 3QLHB 2VG6A 1SH2A 3HPOA 5I3UA 4CGJA 1QS4A 3RMBA 1NJYA 2IM2A 2KW4A 4ECWA 1QSYA 4KHQA 3DLBA 4CEDA 4FJ9A 2A1SA 3LPUA 2XHBA 4DFKA 4NLQA 4J9MA 3RMAA 2HB5A 3OSPA 3I0SA 5KFFA 3HPHA 3KLHA 4OJRA 3BGRA 4CJRA 4CEAA 3GQCA 3O4QA 1RTIB 2WOMB 3G6VA 3V1QA 3EZUA 2ZKUA 3JYTA 1S10A 1JLCA 4TYBA 3OL8A 2IA6A 5J2MA 1QHTA 4KB0A 4LY7A 4IH7A 4ECVA 5KI6A 4U6PA 3TAPA 4LQ3A 4IDKA 2OA8A 1X9WA 4FJJA 3UDLA 3DOLA 3UIQA 1JLGB 1VSMA 3OY9A 2ZD1A 3HKWA 4FJGA 4FJ8A 4Q45A 3FQLA 3V6HA 4DU4A 4QWCA 1N56A 1NK0A 4RZRA 5K14A 1RTJB 2QKBA 4NLRA 1RT7B 4FM1A 1Z26A 1NOYA 4CF8A 2HNZB 3DLEB 2FVRA 4DF8A 4O55A 2W9BA 3NAIA 3LWMA 3G6YA 3EYZA 1L5UA 4CGGA 1NJWA 3M8PA 5CYQA 3H5XA 1W9HA 3GIJA 1TVRB 3KK3A 1WNEA 4EZ6A 4BE1A 1S6PA 1TAUA 3NE6A 1T3NA 4HTUA 3F9KA 1B9DA 4CF2A 4DF4A 1NK9A 3UQSA 2PYJA 1CSJA 1BI4A 3AA4A 3DOKB 2VA2A 2X6SA 4M95A 1S1XB 3SI8A 3MAQA 1HYSB 1NOZA 3VQ4A 1WLJA 3LP0B 4ED7A 4F4XA 2ZD1B 2BRLA 3TANA 2P5OA 2J6SA 4KAIA 1S9EA 4FS1A 2WONA 2R8JA 3MFHA 2B6AA 3CDEA 4PQUB 1RT6A 4E1NA 1JLGA 3WNEA 4ED8A 3OLAA 3V9SA 3QYYA 4PWDB 2W8LA 3MXJA 2FLNA 4FW2A 2E9RX 4URSA 5F8NA 3SPZA 4F3OA 3G10A 5EUHA 4FM2A 3HVTA 1N6QA 3UPFA 4EEYA 5FROA 3KLIA 1T03A 3TQ1A 1KRPA 3CM5A 3S9HA 5C42B 4F4YA 4QWEA 4DSKA 3O3HA 1S1XA 5CYQB 1RT3A 3OYIA 4CEZA 3GV7B 3S3OA 4IH6A 2R2RA 4C8KA 1FK9A 2RDJA 4ZVEA 4U7CA 1TVRA 3KK3B 1RT7A 5KG7A 2G8KA 3B6OA 4B9MA 3M9OB 2IM3A 3FSIA 4ECSA 2WCXA 3HM9A 1EX4A 5SZTA 4K4YA 4CFAA 3OYNA 4RW4B 1BGXT 3NBPB 1Z25A 3FDSA 1B9FA 3DLGA 3ZT3A 4DFPA 4HHTA 3AVBA 3RTVA 4RW6A 3N6MA 5KFAA 3TAQA 1TP7A 1RT1B 4KHMA 4ZVHA 5I42B 3OL6A 2OH2A 1RT6B 2VG7B 4LD0A 1FKPB 1S1WB 5DQGA 2FVCA 1C1BB 3DYAB 3IS9A 4ZP6A 2R2TA 4DL7A 3OS1A 4O3SA 3QIOA 3S3MA 3U3GA 1TQLA 3M9MB 3GIIA 3CFOA 5C42A 4J9QA 3ZT4A 3BDPA 3OYAA 2PZSA 4IRCA 5J2QB 3KLIB 3CJ5A 1WSFA 1UA1A 1BHLA 2C28A 1TV6A 3WNFA 4LQ9A 2D5RA 4WZMA 4CJVA 5F8MA 4AHCA 4Z0UA 3QEVA 2XI3A 1XHZA 4Y3CA 3LPTA 2RF2B 2WB4A 4CHZA 2ATLA 3VA0A 1S0NA 5CYMA 4EO6A 3QINA 3OYLA 3NGDA 4HUEA 3DLHA 3E01B 3RR8A 4DSFA 5EWEA 4K4UA 4DMNA 3SJJA 3M8RA 4OGEA 4RU9A 4ICLB 2C2RA 5KG0A 4YFUA 2ZE2B 2FBTA 3LANA 4CGIA 3QNNA 4LH5A 4DFMA 1XWLA 3P5JA 4E7HA 4M3WA 1FKOA 1TKTB 4KSEB 1SL0A 2OPSA 3O4NA 3V9UA 2IDOA 3SUOA 2UVWA 4E7JA 3DI6B 2JGUA 4WFYA 4PA1A 2B6AB 4UQGA 4FJ7A 4JV1A 4HUFA 1EP4B 4N41A 3QZ7A 5KFSA 1TL1B 3PY8A 3H2LA 4K4WA 4H4MB 3H4BA 1BCMA 2IJNA 3PO5A 2D41A 5KG3A 4CGFA 4YP3A 3L3VA 3GV8B 1S1UA 5FRNA 5HBMB 4ECUA 3CFPA 2D0CA 4NZ0A 3SYZA 5J2QA 4ECYA 3OHBA 4IG3B 3V81A 3LP1B 4DSJA 3K5LA 4FJLA 5J2NB 3OVNA 3AA5X 3Q8QB 1U09A 5DLGA 3ZCMA 4LSLA 2XY6A 3KHHA 3RAXA 4FVMA 3PVXA 4CECA 2YNGA 2YV0X 5F8IA 4W5QA 4NCBA 4RUCA 3MTKA 5KFDA 3I5CA 4E3SA 4O3PA 4DTSA 2G8WA 1RT2B 1VSHA 3HVRA 1TKZA 3AO5A 3QETA 4NCGB 3MECB 2JEJA 1U4BA 4CF0A 3QO9A 1RT4B 5D3GB 2YNIB 4XPEA 5J2MB 4ED6A 4CK1A 3KLVA 1TL1A 3ZSRA 4KTZA 4KO0A 3HL8A 4X2BA 1QAIA 1EP4A 3AVJA 4EBCA 2HW3A 1JLQA 3T5KA 1NJXA 1RTJA 4PY5A 3OL7A 3KLGA 2BGGA 3A2FA 3ZSXA 3AVGA 3NH0A 3RWUA 1UWBA 2VG5A 4K4TA 3DRSB 4AHRA 5KT6A 3PJWA 3BREA 3DLGB 3PR4A 4N47A 1RBUA 4FJMA 3U3YA 1CXQA 5DK5A 2GC8A 2XGQA 4BWJA 1U49A 2AX0A 4KKOA 3C95A 3KLEA 3MXIA 4I7FA 3C94A 1RA7A 3D45A 1ZBUA 3HXMA 1NHVA 1S1WA 2YHAA 5J2NA 1LWEA 1HNIA 3KHGA 1L3TA 3PW5A 4NYZA 3KOAA 4TQSA 4Q5VA 3N6LA 3Q8RB 4H8KA 5C25B 3TI0A 3LALA 3NGIA 1S9EB 3I0RB 4J9LA 2FVQA 3IG1A 1N5YB 2DY4A 1KTQA 1BL3A 2RPIA 3SUQA 4B3OA 1KSPA 5I3UB 1A5VA 4W5TA 3VQ9A 1RTDA 4Q44A 4N76A 4J9PA 1UOCA 2R8KA 4K8ZA 4H54A 3KLFB 3I8DA 4N5SA 3ZSVA 1EETA 2XC9A 2F8SA 2HMIA 2V4RA 4JS5A 1DTQB 1C1CB 4M45A 4J9NA 2A1RA 4RW7B 3LZJA 1C2PA 3NL0A 1D8YA 5DQHA 4KREA 2B5JB 4ZTJA 1FKOB 1XI1A 2NUBA 3QIPB 1RT3B 3HVWA 1RDAA 2HHTA 5KRTA 2DTUA 2BANA 3AVCA 3PW0A 1XR5A 3RB0A 3L2UA 3HO1A 1I39A 4F4WA 5DLFA 3WNHA 4NLWA 2OPQB 3NF6A 3V6DB 1BQNA 4IFYB 5C24A 4DS5A 1HJRA 3D28A 4DLEA 4Y34A 1TKXA 4DG1A 4FLTA 1NK5A 1SKRA 1HQUA 4JV2A 2F8TA 1C0UB 2YKNB 1RBSA 4IOBA 5KG5A 4BE0A 1EETB 1D9FA 4CIFA 3QIDA 3VQ7A 3ULDA 4CJUA 3EY1A 3MEDA 4PUOB 3K57A 4AHVA 4RW7A 4IRKA 4J9RA 1RTDB 4JRPA 1BQMB 2IM1A 2W42A 5JS2A 3U6FA 3ICLA 1KHWA 3TAGA 3PJXA 4M42A 2Y1IA 3V81B 1S6PB 5KFZA 4CK2A 3NMAA 3DLEA 1JL1A 5KFPA 3PUFA 3D5MA 4CHQA 4BACA 4W5OA 1LWCA 1VK0A 2HHQA 1LAVA 4C8LA 4KHSA 1N5YA 1RT2A 3FRZA 3F73A 4IFYA 2FJXA 3V4IA 5JXSA 5KG2A 4DG1B 4MIAA 3RBEA 4WYWA 3KNAA 3NDKA 4G1QA 5KFUA 2X74A 4ELUA 2CKWA 4KB1A 3CQ8A 3MF5A 2YKNA 5FDLA 4ZVGA 4DL2A 4R8UB 4DTOA 4H4OA 4LSNB 1I3AA 1RILA 4TXSA 4CJTA 3SUNA 3V9ZA 3ZT1A 2HHWA 5C24B 3OS2A 3C6TA 4FJXA 1MMLA 4CIGA 4ED2A 1QSSA 3OLBA 4NLXA 4YNQA 3SV3A 1W25A 1L3SA 4QWAA 3KLHB 4FLUA 4F2SA 4DL6A 4NLSA 4Z4GA 1BQMA 5KFXA 2KTQA 3AVFA 4IG0A 5KFRA 4Q8EA 3MEDB 1XR7A 3KJVA 5F8JA 4CJSA 2HHUA 3H59A 1SKWA 4RNFA 4CF1A 4IFVB 1NK4A 1Z4UA 2IAJA 1B92A 1FXXA 3DMJA 4B08A 1Q9XA 4Z4EA 4ZPCA 3BSNA 1JLEB 4IKFA 4H4MA 4IKAA 4O44B 2XY5A 2LSNA 1TK5A 3OYGA 3L2RA 2JEFA 4MFBA 4WXWA 5KFVA 4I7FB 3HJFA 1QE1B 1TL3B 3ZT2A 3V6KA 4DS4A 1YVUA 3Q8PB 3CJ2A 3SQ0A 1VRTA 3DRPA 1HNIB 3GIMA 2W9CA 4CHNA 3GILA 1HQEB 4FLXA 1S1VA 3T5JA 2BANB 3SNNA 1T94A 4B8CA 4KB7A 3QEIA 3DOLB 4ZPAA 1SUQA 4DTPA 1BIZA 2RN2A 2F96A 1TK0A 3NGZA 4TQRA 1IKYA 3LP2A 3QEXA 5DQIA 2JEIA 4BWMA 3G6XA 3VQBA 4Z4IA 3ISND 3PV8A 2ASDA 4MK8A 3QLHA 3AA3A 4Q8FA 1RDDA 2BQ3A 1WAFA 3VQEA 3AV9A 2G8HA 3H98A 5KFGA 1UWBB 2FVSA 4CFBA 5HLFB 4KFBA 4RW9A 3RB6A 4DSEA 4KO0B 4JLHA 2FBYA 1SL2A 4RNHA 3C6UA 4O3NA 4EYHB 4GC7A 2W9AA 1X1PA 2R8GA 4O4RA 3MECA 5F8LA 1TK8A 2JC0A 3T5LA 4CJWA 3VQSA 1HQEA 2YNIA 2FVPA 2HAIA 4HCCA 1IKVB 4FLWA 1IG9A 3JSMA 5T14A 3HSTB 3FFIA 1JXEA 3RRHA 5EU7A 5JUMA 4K4ZA 1RTIA 2YNHA 2V4QA 4ECXA 3KIOA 4ZVFA 3LZIA 3MXMA 3H4DA 3NH1A 4Q43A 3VQ8A 3L2QA 2UVRA 3DMJB 1D1UA 5L9XA 3AO3A 4IDKB 3DRSA 2V0NA 3NF7A 2ZE2A 2X78A 4E7IA 1ASWA 4NLGA 5KT4A 1WNSA 1NK6A 3ITHB 4M3YA 3KHRA 4ZHRB 4DSLA 5KG6A 2RKIA 4KFBB 4RW9B 3EPGA 4DLGA 3M8QA 4Q0BA 4DQIA 4NLTA 1S9GB 4FJHA 4CK3A 1HRHA 1S1UB 3DM2B 4DU1A 2ASLA 2W8KA 2ITGA 4NRUA 1RBTA 3QERA 2R8IA 3KLFA 2Z1GA 1RT4A 4N56A 1QUVA 3K5MA 4ZP8A 3C6UB 5J1EB 4IR1A 4FZZA 4CJQA 2Q3SA 2FLPA 4B3OB 3TR8A 3NAEA 2DFEA 1ASUA 5HLFA 4ECTA 4H4OB 5HP1A
chains in the Genus database with same CATH superfamily
4XH1A 2WVDA 2YPYA 2ZVIA 1WHWA 1TGOA 2O4IA 2HHVA 3QT5A 2K7JA 3JAMY 2HVIA 4QW8A 4LVNP 3OTDA 4W98A 2I1RA 3SK3A 3RB3A 3R5DA 1PC5A 4ANCA 2LP4A 1X5SA 4X4QA 3MZIA 3W3SA 3NP5A 2QA4S 2ZJPL 1SXLA 1EQMA 4O44A 2M8HA 4PQAA 4WIIA 1FD2A 4Q0BB 4WFBQ 4I9QA 2KI2A 2WTFA 1KTVA 3OYKA 2E44A 3G71N 1YWXA 3R9PA 3HHKA 5AZIB 4K7QA 5DM7Q 4ZP9A 4J90A 2EK6A 3IP0A 2DR9A 1T9VA 2ABYA 3D0IE 2KFNA 5E84A 4MK9A 1GOAA 2KXNB 2Y0SD 1YLXA 3Q83A 3CIMA 2YWGA 2CWKA 2XB2D 2NYHA 4M5DA 1N52B 4L75A 3RG6A 2MQOA 1NGAA 2ZGZA 3NH2A 4CJEA 4OI4A 2A2CA 3FRYA 5LSOA 1U48A 4JI3F 3CCZA 1VHXA 3MTJA 2NRTA 4RW4A 4KV8B 3KG0A 4LFAJ 2OTLN 3O3LA 4V19X 3SMPA 4J9KA 3V1RA 3MMAA 1EJ7L 5C15A 2LEPA 4URGA 4X62J 5M1PA 5KG4A 3R6LB 2JHEA 2OTLS 3H5UA 2XGPA 1KNZA 4KH1B 2UU9K 3Q86A 3ENAA 2IIRA 3DYAA 3M1FA 5KFTA 1TUUA 4X66J 1X4HA 2F4VJ 1PYOB 4DPWA 3VQPA 4OJGA 2XMUA 4HYKA 4FJNA 3J7A1 3MCPA 1S7IA 1DKGD 4WQ4A 2IJFA 4NE9C 2PO4A 1B99A 1H98A 3I5BA 1LW0A 3BBFA 4BC4A 4F7VA 3MMAB 3HOSA 4KE5A 2ZHAA 2QTWA 3NGRA 2LKZA 2I5JA 4DWIA 4FKXA 1TL3A 3AD7C 4Z4HA 1X4AA 2IAJB 2VASA 2KU7A 2HNYA 2L08A 4IR9A 3OHRA 2P9SA 5HP1B 2VG5B 2OPQA 4USKA 4E7KA 3NAHA 3I32A 3POTA 3O3FA 1FK9B 3M8SA 4DR6J 4CQ1A 1WHVA 4RWXA 5D0HA 2G4BA 2YWEA 1PYTA 5KOXA 3FC9A 4IOXA 3C6TB 3ZEUA 2ASPA 2KKHA 3EZ5A 4FK0A 1YVFA 1LV5A 2NQPA 1W0HA 3AT1B 5CYJA 3A3OB 2AX1A 4JKGB 2VJVA 4BRQA 2BTFA 1WEYA 2GAHC 5EWGA 3SQ1A 1SJ4P 3KK2B 1DEJA 4NX9A 3VTIA 2XO7A 2MTLA 2R8HA 2LU1A 2RHSB 4JNEA 5FPMA 2D0PA 2BE2B 5ELZA 1PJ7A 3EXCX 1V3SA 3PEJA 3KDOA 2LMIA 3OTOF 1WB9A 2HBRB 3KD5E 2H48B 4Y0FA 1VS3A 3AD9C 5T7LB 2IGIA 4NXMF 2FC0A 3QJLA 4ZOSA 2GJFA 1J54A 4YB5A 3WX4A 4OHZA 4CE9A 4CEQA 3AQOA 1FRMA 4QZVB 4W92B 2POKA 4DR1F 3SFGA 1NRKA 3HSZA 5JLFA 2IM0A 2E1AA 1VHFA 2P9IA 4W90B 4NI2B 4DPOA 1GTEA 4ZPWR 1RSCA 3MK6A 5G4DA 3TUPA 1UA0A 4RUBA 4USMA 2WBRA 4NXNF 8RUCA 1DGKN 2H1YA 1CLFA 4CLSA 4HUGA 3FR0A 3MM6B 3QEWA 4OKEA 4B3MF 2OUGA 3VGTA 5B7WA 2K3IA 1YI2N 2K7KA 3T9ZA 2Z2LA 4GRSA 5EWFA 2VCPA 2D74B 2ETJA 3WXIA 2E1YA 2OHDA 2Q3PA 4CEEA 2BX6A 3EUNA 4AL5A 2GIQA 5M1FA 5M1KA 4RUHA 3IXQA 5C5JA 3CIPA 4ECQA 1A7GE 3CGIA 5KAKA 1T0TV 2EI5A 2RT3A 2HVHA 2CDRB 3CD6S 4M5IA 1N5TA 2I0XA 2ATQA 2UV8A 4HTLA 3R1XA 1Q79A 1TUGB 3J80O 4XK8C 3CMAS 1HMVA 1URNA 1T7PA 3TRGA 4LSZB 1GMWA 5LJVA 1WG1A 2EBGA 4C2MA 1RBRA 2LQJA 1RP5A 2FBXA 3FZHA 3UWTA 1KLMB 1VC6A 2OFHX 1S1TB 5HRNA 2OGUA 4HTIA 5KT7A 1DARA 3MPUB 2FHOB 3FBFA 4OYPA 2J0SD 1TR0A 2G13A 4TNOA 7AT1B 1U24A 5D0GA 2LXUA 1Z05A 4Z94A 1YRUA 4CJ5A 4KGKA 2HMPA 1X9SA 1HPZA 3ILOA 4I6WA 4LBHA 4ZJOA 4BC2A 4AXIA 4CLZA 2DNGA 3HLUA 2O8DB 4MKAA 5DM7L 3V9XA 2PE8A 3LDLA 4CTAA 1Y64A 1HD0A 4JYAJ 4I69A 1Y00A 2R7VA 2P9GA 4JKHA 3H2VE 1VRUB 3CCQN 1JKHB 5ADXH 3KJVB 5HL7L 4KH4A 4ZHRA 4OZJA 3W65A 3CTRA 4BR9A 4W5NA 4QJVA 4WP9A 4IOCL 4JK7A 1JLEA 2XCAA 4C11B 4LF5K 2JEGA 3BSOA 3DXKA 3FZ2A 3EPIA 3UDEA 5IV3A 5KT5A 5DJBA 4FXWA 4I2QB 9ATCB 5AQZA 1B3TA 5HRPA 5HROA 3UD4P 2HBZB 4F2RA 4WBFA 3J81Y 3VEXA 3H7HB 3ALYA 1Y10A 3SSRA 2BKNA 5HI7A 2GQQA 2HBMA 1JXBA 4XTTA 2P5GA 2NZ4A 4YHHF 3AY0A 4OX9J 3RRGA 3UD3P 1T05B 3AOAA 2AJQA 3OTEA 2EK1A 1HBUB 1SZ2A 4O0JA 5GADI 4CFDA 2ZBQA 1HBMA 3MD3A 4OL8A 1GMUA 2QX0A 2D3O1 4DV1K 1NNDA 2IDEA 3ZEUB 3N4PA 3OJUA 4OYAA 3C0BA 1CLQA 3ENVA 3D3CJ 3QATA 5A8WA 3VALA 1YJWN 2H54B 4J9OA 1U1KA 1FRLA 5JVGL 3BGFA 4QIEA 2P9KA 2M88A 5HO4A 1QZ5A 2WVEA 3IC1A 3SCXA 5CD4H 3MUMP 1S72N 1ZETA 4CJ3A 4YORA 5LM7E 2ILZA 1XERA 1QAYA 1LK7A 5H1SV 2MJUA 3H2UB 2I5JB 2ZWPA 1Q7YT 3HP9A 3BY5A 1K8AO 1K47A 2GVZB 1IBKJ 1YUWA 4C3LA 3NVKA 4QWDA 1SV5A 5KFCA 3CW2C 4ZMMA 3AO4A 5E41A 2DNKA 3HYFA 2AJFE 1UFLA 2W6KA 1R8HA 5M2RA 3MMCB 2FHJA 4M63C 3FK4A 3NCIA 3PFEA 1QUPA 4DDFA 1Y5NB 2C22A 1RDWX 2RF2A 3TOQA 3I56N 3AAPA 1K44A 2NXNA 3I4PA 3FBBA 2JC1A 4NYOA 5AE3A 1BUPA 2DEIA 4I9LA 2LCWA 4YHHK 4LC9B 1VGYA 1NB7A 4B9VA 1TYQB 3D2FB 1Y7PA 4OKJA 4JV0A 3TAMB 3PYGA 1SH0A 4PKHA 4B3SF 2R2UA 1JJ2M 2F9WA 3BSCA 2NLWA 4OHYA 3BGRB 3Q0AA 2Z4PA 3K59A 1K6YA 5ETMA 3BH6B 1J5OB 2ZF5O 3RYLA 4KHPK 3AD8C 3LA0A 4ES1A 1EKSA 4X4PA 1G15A 1G6BA 4ZN1A 4IDHA 1ZBTA 3MEGA 1SH3A 2G2YA 2VONA 4JI0K 3FGVA 1SJRA 3LTOA 1RYSA 4BDYA 1DLOA 4KHPJ 1YBUA 1O6XA 2HQFA 2B5JA 3MEEB 3ZSOA 2H65B 1KDNA 2X1BA 4I6MA 5F0WA 3WC2A 3RR7A 4BY9C 2B8PA 5B09A 2CJAA 1E6YA 3CCRN 5FPNA 1KC8T 1NGJA 3D2FA 3T1YF 3M3ZA 3UKRB 4K4SA 1K0VA 2QO3A 4CCHA 1VSEA 2MLXA 4H0VB 3ZO7A 2CQGA 2OPRA 4OYZA 3VF6A 3UDVA 5G0RA 4LJMA 4P2XA 1YX2A 1KVJA 3VAIA 2J6UA 3KKSA 4LF8F 1VC0A 1TYQA 1T03B 3MMBA 1VQ6N 1HNVB 2H4WB 1NLVA 3FZLA 1MWKA 1HKBA 4MFBB 3QJPA 4XPCA 1B7FA 1SAZA 3JAMO 5HAOA 4A8KA 4V19J 3IDHA 2ZWHA 1SV5B 5KFBA 2I2YA 1WG4A 1RU2A 2UU9F 4AQYK 1SJ1A 3O4WA 3VEYA 2HSEB 1X7VA 4O8KA 3ZX3A 2CJXB 2QWPA 4USJC 3PCOB 4IJNA 2C2DA 3AA2A 2UZAA 1UVKA 4DR6F 2WSCC 4A8XA 3DLLL 1XMQK 1VBZA 1T3VA 4DZDA 2BBEA 1JKHA 3T1HF 2PFDA 1JQGA 3P39A 1GQEA 1K1SA 4I6AA 2V9WA 4ISFA 2BOPA 4LFAK 3MCSA 2DH7A 4B9QA 2BW2A 2PA8D 3M9NB 1BIUA 2KN4A 4J37A 4K8RA 4CIEA 1R31A 4B3SJ 4YOTA 1HPZB 2B7BB 3KMSA 2AV5A 1J6ZA 5BR8F 4C0HA 1BQNB 5BXIA 5GMDA 2W25A 6FDRA 1CC7A 4DSIA 2CVIA 2CPZA 2AZ3A 3D0PA 3M32B 1Q81T 4X66K 5F9NA 3HZEA 2HHHJ 4FBTA 4NLDA 4CJ4A 2W1BA 2ITMA 5F0XA 3GCXP 3F41A 1QQCA 3IKMA 4CT8A 1WD6A 3JSBA 3CYMA 3CCTA 4PG8A 3AVHA 2HHHK 2KFYA 1S72S 4K0KJ 3BN7A 4PPZA 2V8GA 2KJWA 4EHUA 2Q66A 2JRSA 2G8VA 1U6ZA 4FWSA 3IBCB 4USIA 2QSWA 2F7VA 4G65A 2QWLA 2DCUB 3CJKA 4CHYA 1OH8A 4OI2A 3O9RA 1ZTWA 5HRRA 1UL3A 4FF2A 3QO9B 1VQ9N 2BH1A 3RMCA 2BJEA 4A8MP 4P72A 4ETZA 1OO0B 4DQQA 1Q78A 2NZTA 1Z2LA 4ZCMA 3CDAA 2Z58B 1IKYB 3FKBA 2X6NA 1GXLA 2OPPA 4LRFA 2A0FB 3GG0A 5KPRA 2PIIA 3G87A 2NXJA 3RB4A 2XRIA 1ZZFA 2A42A 2QSFA 2QA4G 4YB1P 5HBMA 1M5HA 4I64A 4EUVA 4ZIVA 3UO0A 4GVBA 4DPUA 3BQ2A 4M7YA 1SH2A 3HPOA 4FXVA 3RMBA 2H5IB 3W66A 4FYYB 4ECWA 1CJTA 3DU6A 4FJ9A 1XTZA 4NLQA 5DDOC 3AARA 3EL2A 4LF9J 1WKKA 2KM8C 3OSPA 2VDIA 5IXUA 5KFFA 2N4DA 1FDBA 3PHTA 1RKIA 4DV5F 4JI1J 4B3TJ 2VOPA 1OMSA 2W4DA 3G6VA 1FI4A 1RJJA 3UN5A 2HFNA 4KB0A 1F6TA 4IH7A 1UVNA 4FWPA 1CS4A 4NLCA 3A12A 1LKZA 5KI6A 1YZ6A 4IDKA 5H9FJ 1X9WA 1V9OA 3UDLA 3DOLA 3HHDA 4JI2J 1TFWA 2DGWA 3UIQA 2ZD1A 3HKWA 1VQMN 1LXJA 1GH8A 1V4TA 4GMKA 4Q45A 2W24A 2IVMA 4DU4A 1X5TA 4RZRA 1RTJB 1D8ZA 1NOYA 4DR1K 2HNZB 3DLEB 2FVRA 4O55A 2QWMA 1IUJA 3NAIA 4YS2A 4ZITA 3ZYYX 1MMDA 1WC4A 1TVRB 3KK3A 2DGOA 3K0JA 3R6MA 4BE1A 1KP6A 5IM0A 1TAUA 3JS9A 2NUHA 3TO8A 1VIXA 4OYBA 1CSJA 2JNJA 3MDQA 1JMTA 2VA2A 4X4RA 3MAQA 1RACB 1RAAB 4K2JA 1WLJA 2QLWA 2AYEA 4AQYF 5BRDA 5A2QU 4R79A 4KAIA 4FS1A 2CPFA 2ZOFA 4DX7A 3ZZTA 1JLGA 2ASYA 1FTRA 3QYYA 5TKYA 2W8LA 4FW2A 4M5NA 2YCHA 3SPZA 2UUCJ 3W0LA 4FM2A 4GV3A 4C98A 4LF2A 1AT1B 1KWMA 4KHPF 2DNLA 3CM5A 3WQUA 1K73O 3ELHA 4JI2F 2BUPA 4IH6A 1HA1A 4NXNJ 1FK9A 2R42A 4U7CA 3AXKA 2P9LB 1VMBA 1RT7A 5KG7A 5HSPA 4B9MA 2CPXA 2FD2A 3TPQA 5CZXA 4CRJA 2IM3A 4JI1F 2YQ0A 4ECSA 3E2EA 1UCNA 4FL9A 4K4YA 3OYNA 3GG1A 1JB0C 2B9WA 3CMEN 2NXCA 3NBPB 5LMNK 3M2VB 3FDSA 4NB4A 4ZCIA 4AL7A 4DFPA 2R7XA 3C3LA 1SIZA 4M5KA 1DQ8A 3N6MA 2V7YA 2RE2A 2ZZNA 1TP7A 3UN3A 3A3PB 1NSPA 2AHOB 3W9IA 4LF7J 4LD0A 2C2KB 1R3NA 1L3KA 4YDUC 1XMOJ 2CQHA 4PXBA 3DYAB 1Z2ZA 3IS9A 4DL7A 3CCMS 2F9TA 4Y65A 4CI0B 5BR9A 2G1DA 3U3GA 2VQEF 5BPNA 4NEZA 3BDPA 2XBPA 4LIRA 4CNZA 1UA1A 4BVOA 1TV6A 5AQPA 1CJUA 1RLCL 1OQ3A 4DUZF 3CHWA 1XHZA 2RF2B 5F41A 4PWUA 2WB4A 2P9UA 5CYMA 3A1YG 2IVPA 2QMXA 4L76A 3DLHA 4HUEA 3E01B 5LT5A 3RR8A 5BRFA 4K4UA 5M2UA 2FXUA 1CJKA 3M8RA 2YY3A 2E7VA 4BRNA 2HQIA 2BKOA 3ZZYA 5KG0A 5M1OA 2FBTA 5GIPA 3QNNA 3P5JA 5E3QA 4M3WA 4UT4A 4BC5A 2ZBRA 2DVIA 4A5AA 4G9ZA 3F44A 2IDOA 1WG5A 4OHWA 2JGUA 2B6AB 2WSEC 5IT9U 1IBKK 1QVFR 5IWAK 1RU1A 4N41A 2CPHA 2KB2A 1X0FA 4QQBA 3G8QA 3BM7A 1S57A 1TL1B 4CD3A 4K4WA 2RIJA 5C0YA 2LQ9A 4JI5F 4L74A 1TL7B 2O1PA 4DV0K 3C46A 4CGFA 4FPAA 2UUAK 3MM9B 1CJUB 3L3VA 3GBTA 4OYOA 3CFPA 4ECUA 1F2HA 3SYZA 4X66F 2Y8WA 1WOPA 1X8DA 4YN3B 4CM2A 3UE5A 4HH1A 3K5LA 3MMVA 3GFXA 3OVNA 1X4FA 1U09A 2XY6A 4IQMA 5H1SQ 2YNGA 3C19A 1NMEB 2MHEA 4NCBA 3W63A 2Z2MA 4YEAA 1UMJA 4JHDB 3OBWA 3C7NA 1VSHA 4BQZA 4C4WA 3QETA 2M7SA 4LF6F 2JEJA 1U4BA 4GKKK 1OPZA 3OUYA 4KH6A 4CK1A 2QL5B 4KO0A 1GLFO 1QAIA 2VPWB 3O6WA 3RGIA 5KPZA 3PYDA 4OJ1A 2QFJA 3C14B 3GE1A 2E5LK 2HOEA 1NJXA 2V2VA 1RTJA 4KIAA 5AJ3J 2YWFA 2BGGA 3ZSXA 4ZLNA 3Q24A 3AJ1A 4BQLA 3W5YA 1VQNS 3DLGB 3AODA 3D2EA 4CZFA 4FJMA 3ZZRA 3ISZA 3QQCD 1CXQA 4UY8O 5DETA 2XGQA 4BWJA 2RU3A 1WI8A 4NO7A 6FD1A 1MWZA 3IWXA 2GO9A 4YY3F 4H5VA 2YHAA 3VEVA 1LWEA 1HNIA 1R7IA 3PW5A 2MQQA 3UW1A 3KUGA 5D4NA 3KOAA 3Q8RB 3I0RB 3BR8A 4YDDB 1N5YB 2DY4A 1BL3A 3CD5A 2YKAA 3UE2A 2VBWA 2MGZB 3OTBA 3MCNA 3I6PA 1X4GA 4HHJA 2R8KA 4HTJA 1FVSA 4M5JA 3ZLJA 3ZSVA 5LJ5Y 2ZEJA 1DTQB 4J9NA 3R8YA 3LZJA 1C2PA 4WCEL 1WC6A 2JVOA 3F5TA 4ILLA 4ZTJA 2LYVA 2OMLA 4P74A 3QIPB 2J8SA 2JSXA 1XMQJ 4UY8T 2HAFA 3AVCA 3TX8A 1XR5A 3RB0A 3H20A 4F4WA 3WNHA 2CNNB 2HK2A 3P5BP 4PYDA 2R7SA 3HULA 3MUTP 3BP8A 2E7WA 2ZDPA 5D6GA 1MW7A 1NXIA 4JV2A 4X64J 1RBSA 1BQXA 1HWLA 2XZTB 3D68A 3T6JA 1YTYA 3N5FA 3OR2B 4IO8A 3M6XA 4AFFA 3ATVA 1K9MO 4RL1A 3E9PA 4DR3J 3GB0A 3VQ7A 1Q86T 3ZETB 4AHVA 2G2ZA 2V50A 1BQMB 3RUBL 1IVZA 5JS2A 4ZPVR 4YOVA 2VDHA 5H9EK 3TAGA 2Y1IA 3VGVA 1S6PB 4CHQA 2L9NA 4JI5J 4BC9A 2FSKA 2HHQA 2PMWA 4NMXA 1LAVA 2BJ8A 4N77A 4C8LA 1N5YA 4ILJA 5ITHA 1RT2A 4IFYA 3L0QA 2FJXA 4DR7F 3V4IA 4TKTA 5KG2A 2Y1LB 4MIAA 1Y0HA 3RBEA 2MQNA 4UW2A 1KQSR 4G1QA 2UUBF 5GMEA 4ELUA 4ATNA 3MF5A 1P8GA 4DL2A 2LLZA 4R8UB 2VQEK 4H4OA 4LSNB 4DN9A 1RILA 1IWAA 2GNKA 2P9NA 5CH7B 4CJTA 3V9ZA 1UJ6A 5GMKa 4JKFA 5F3ZA 3ZFVA 3VGLA 3C6TA 4QYZJ 4FJXA 2JL9A 4JI4J 1TL4A 3A13A 1RAHB 1W25A 3GFYA 2VZ9A 3QAUA 4CZHA 3F56A 3KLHB 4F2SA 4CD1A 4KGVB 3BPSP 4IG0A 1ZPWX 2Y0BB 3THXB 3MEDB 1VQ4S 1GLBG 4WP8A 5F8JA 4ILHA 3D6RA 4IFVB 2IAJA 3DMJA 4HACA 4ZPCA 3CCSS 3TSUA 4LT6A 2GZOA 3NCRA 2ZJPQ 4RBTA 3H46O 2LSNA 4TLQA 4JI0F 2JEFA 4MFBA 4PPDA 3DXMB 2C2MB 5D78A 3HJFA 3ENHA 4W4MA 1R27B 3OVAA 3GZ7A 3CJ2A 2O8CB 1HNIB 4MO4A 3GIMA 2W9CA 3VF0B 4ISGA 4CHNA 4U67Q 4JN4A 4CH7A 2E7XA 3MWBA 5A8RA 2E29A 4FPRA 5AXKA 5LSRA 3NGZA 5B0EA 1IKYA 1ZXOA 2QIFA 4PYAA 4Z37A 3FZKA 4MK8A 3QLHA 3AV9A 2G8HA 4K0KF 3H98A 2LEBA 2FVSA 1OKJA 3UCZP 4DSEA 2D9OA 1IQTA 4A57A 2PA3A 4KO0B 1RWVB 1IJJA 4DV4J 1N34F 1GLEG 4RNHA 1JXVA 5JJBA 2OP5A 1H74A 2KO1A 3TZYA 2FB0A 2M4MA 2R8GA 4XDCA 3B4MA 5GAEU 2L9DA 2ZFHA 4B1ZA 1VBXA 3D0GE 1UW9A 2ALYB 3AAQA 1BU6O 3FE1A 2CQ4A 3VQSA 4DR5J 1X4DA 1G7CB 4HCCA 4FLWA 3JSMA 5T14A 1XJWB 4BRGA 3M2RB 1RTIA 2V4QA 4ECXA 3T1HK 1KN6A 4BR2A 3TSPA 2OMOA 3L2QA 2UVRA 5AQHA 4QYRA 1D1UA 1RHQB 2K3KA 7FD1A 4C0BA 4FNIA 4R25A 1ASWA 4J9UE 2F40A 1NK6A 2Q0UA 3ITHB 4M3YA 2W2NP 1WC0A 5KG6A 2O67A 4LF5F 1X9JA 1FXLA 4WTYA 2GMLA 1VQPN 4CK3A 1U1PA 5AQIA 3DM2B 2UU9J 2W8KA 2I7PA 2Z1GA 4N56A 1BA0A 1QUVA 2X3GA 4ED4A 3K5MA 4FZZA 1MG7A 4X4UA 1FWPA 1N34J 4B3OB 1PGZA 3QSYB 4UOGA 5B8HA 4FPBA 1NUEA 1N5VA 1FXDA 2GMHA 2GAGC 4H4KA 5LSLA 1S77D 5KFMA 5DZ7A 3RMDA 4RWTA 4C8NA 4AHSA 1IR2A 2Q2RA 1N34K 1CULA 3VQQA 2D9PA 3PW4A 2EEYA 1Q5VA 3LDOA 2LEAA 4F04B 2FLLA 1HYZA 3J80Y 4P7TA 1WAJA 3IN5A 5GADU 3JSMB 2B43A 2P9KB 3D7EO 4B9NA 2VQFF 2QK9A 2X1AA 4JKCA 3EE9A 3OTOJ 3OYJA 4DR4J 2M9KA 4AHUA 4GC6A 3HMJG 1ATRA 2J9CA 1IBLK 1RBLA 2A41A 4KPCA 4EBDA 3KD1E 1RAFB 3DM2A 5EX5A 1HBMB 2CXEA 2GBZA 4WK3A 4K2XA 4HR2A 5GAHI 5DDRC 2QXFA 4WFZA 3Q8UA 4LREA 1RWXB 2QE5A 4NYFA 2HFZA 3M30B 3VESA 1RTHB 3CCLS 1WSJA 4XEIA 3KHYA 1BWEA 3V4IB 1RXOB 3QNOA 2YI1A 1LOUA 1F3FA 2VFRA 3HI9A 2F7TA 1AROP 3ILJA 1OJ4A 3EEQA 3SZ2A 4I2PB 5KFYA 2D0BA 4O5BA 3GJTB 3J7YP 2Q0RA 1PJ5A 1UFKA 4OX8A 1SBRA 2HHXA 5LMUK 3NBPA 4A8QA 1BDGA 1RBAA 4CBUA 5A2QY 1Q9YA 2PC6A 5IC6B 4Y1DA 2W2MP 4FWNA 1U0HB 3GLJA 5LMUJ 4JK9A 1H38A 4C3KA 2YNFA 1J5OA 1ZBSA 3L4BC 1YJNS 1VRUA 1JIHA 4DI6A 4B3MK 4RCHA 4R0EA 1FJEB 2YX1A 4IBNA 3VVTA 1N8RO 2FLOA 3M8QB 2VPXB 3QICA 1QD1A 2GGPA 4YOWA 2E5GA 3N5BA 3KUHA 3BKTA 4LF8K 3PX0A 1YT3A 1KLNA 3Q7CA 3NF8A 1M1KO 3JTNA 2EHGA 4EFAC 2HIQA 2A3JA 1T05A 1N5QA 4BRPA 3MR3A 5ETNA 1D0EA 3I8BA 1A5XA 3GU0A 1DY3A 4HI1A 2W9CB 2GQCA 1NZAA 4FK4A 3WIVA 4X62F 1JLFB 4P2MA 4ZPBA 2N7CA 3US5A 5KFOA 1KVBA 2QLJB 2J0QD 4ECZA 3PSFA 1DHMA 3KK1A 3O5TB 3L3UA 4DTNA 1XNRK 2J8AA 3KWMA 2XNQA 1XMQF 1VSFA 2AYBA 1BWVA 1SJFA 5KFKA 3I55S 4B9SA 1FJ7A 2UXDK 1JLBB 1WKJA 1C6VA 4ILGB 4CYUB 1LWEB 2IVNA 5IT9Y 1S4FA 4C97A 1HPMA 4PG4A 1LW2A 1LFPA 1P8ZA 4DR3F 1U6BA 2UXDJ 4DV2K 3H5SA 3CD0A 4BROA 1WJ9A 3OYHA 4M3ZA 3IM8A 4C0OC 1IR0A 1U47A 5E26A 1M1HA 1NHUA 5FPEA 2ZDOA 3O44A 4BVPA 2B4OA 3LPEA 4K4XA 4FYVB 5D4LA 5F8HA 5KG1A 4ECRA 4CW7B 2VG7A 1HR0K 2BABA 3M1VA 3H3OB 3CCRS 2HRTA 1VSDA 3FSXA 4RBUA 4EP4A 3EDQB 1PO6A 4RW6B 1JL2A 4WYBA 2D3OR 2XQCA 4KHYA 2UXBK 4OI0A 3K58A 5DGAA 4CJKA 2HYIB 1H6KX 1YJTA 2F4FA 2B4JA 3U9ZA 2RNEA 3QBCA 2L3MA 2KL8A 2IMOA 1UZHA 3S41A 4TY8B 1FRKA 3I0RA 1RAJA 3MHYA 1NM2A 3GSIA 4YQWA 4DTMA 3IMXA 3GJQB 2MDAA 1IBMK 5BREA 3ZNUA 3NWRA 3VQTA 4IXCA 4ED3A 1S9FA 4DL3A 3TYTA 1N6QB 3OYEA 4WE1B 1ZM3A 2D7SA 4MLEA 3GJSB 1KONA 3L7PA 1S5JA 4QCLA 5AE2A 5AQOA 1NK8A 1OSDA 1D9AA 4L3QA 5C10A 3TAFA 1REVA 1C0FA 1TAQA 1VFJA 4HH0A 3FLCO 5IC4B 4B9LA 4MDAA 4OYWA 4KJIA 2P9IB 1KC8O 3VEOA 3IA0A 4BG9A 1ZAXA 2KJVA 4USWA 2EWHA 3NVMA 4DR7K 1QSLA 3AXMA 3ZTPA 2HS4A 3MMJA 1YXQA 1YIJS 2NRVA 2FBVA 3BPDA 1XQIA 1NGCA 4NPOA 2ASOA 1X3MA 3N4QA 4CYUA 4QS9A 3SMZA 1N0VC 4WYLA 2C3MA 1WOQA 3MFIA 1NB2A 4CLKA 3T1AA 3C6HA 4FJKA 1HWUA 3M8PB 5THWA 4FN5A 5FJ4A 3R5BA 4GVEA 2VD3A 3GYNA 1B0TA 4ED1A 2F65A 3HSGA 4X62K 3RZAA 3TVKA 4ELVA 4LF6J 1NM1A 4LFBJ 4JHDA 2DFHA 3VAGA 5H9EJ 5AFUH 3H40A 1GMVA 2JLEA 1Y4ZB 2NUUG 3KK2A 4Y0WA 4NMLA 2JFDA 4A8FA 4ID5B 2DNHA 2BJDA 3FSYA 4EP5A 2NNWA 2GV9A 3CC7N 2Q31A 1HBNB 5AFUA 2C42A 3MOJB 2F4VK 3M6GA 2ZBCA 3GIKA 2VODA 4XDDA 3QESA 3P1GA 3D67A 4CLYA 3C14A 1JCGA 4DTXA 1K9MT 4HKQA 3NCPA 3LAKA 3AB2B 1EKEA 2XEXA 2E6MA 4O0NA 1Q8BA 3OYDA 2YJEA 3ULEB 3P4IA 1R43A 1M1GA 3ETOA 1Q8IA 5AQKA 5GAEI 2FY8A 5E3AA 4ZCLA 3DRPB 1RUSA 4ZDNA 1H1VA 3RVCA 3O9UA 4X4SA 3VCDA 4E8UA 1IKXA 2GQ2A 4K50A 1RBOB 4ZP7A 3MM8B 1HI8A 2HG4A 4M41A 4FO0A 3I87A 4J2BA 1LW0B 4TY9A 2BMBA 5ETVA 2R3VA 1XMOF 2HZVA 4ZLJA 4M8LA 1IBKF 1Q8LA 2J4RA 2ZJRQ 4OYMA 1U8SA 2I8EA 3GCWP 1HNVA 1O1WA 3CFRA 4W5RA 1B70B 4DV6J 2JFKA 2MZJA 1RDCA 4FXDA 5LJWA 4ID8A 1ESVA 4BR7A 3VEZA 2HFSA 2RS8A 5HQMA 4HT7A 4BHQA 3OFFA 3DOKA 2VFVA 1W97L 4RG8A 4F8RA 4OKKA 2ZITA 3OVSA 4DV6K 1S59A 1T3OA 3CCES 4BCAA 2HQ3A 4DHYA 4TLRA 4MIBA 1GXTA 1HBNA 3I4HX 1T6CA 3TAMA 2V63A 3O6QA 4ZVQB 1NGGA 1O8BA 4A5BA 5F8GA 3F2KA 4J2AA 2B7CB 2I38A 3SAHA 1ZBHA 3C65A 1IKWB 2QL9B 1WSIA 5JVHL 2Z57B 3IGVA 3OYFA 1MU2B 3OR1B 2NS1B 1U2FA 3IRXB 3MD1A 4DV4K 4FKYA 4V19S 3MEEA 2FPHX 1G4CA 4DCHA 4MYUA 4DV7J 2MZRA 2YJFA 2DHGA 3MEGB 5CYMB 2DNMA 5KFNA 1I51B 5A0YA 4X65K 5CHCB 1IO2A 5EY4A 1S49A 4NA2A 5M1QA 2M52A 4RU2A 4IEIA 5C2DA 1JNZB 2GUIA 4OPKA 3QGHA 3SPYA 2ASJA 1JLCB 1BMQB 3NKYA 1Z6RA 3T1HJ 2NSBA 4FK2A 4CESA 3MUVP 1JJ2R 2P9LA 3CMQA 5IQQA 2HQGA 1WACA 3BUZB 1F5BA 3IWLA 3QDKA 2KM8B 3O1BA 3R1HA 1KHVA 4OPHA 1CXUA 3GWCA 2ALZA 2ZJRL 1NGDA 4OZNA 2F63A 1DURA 1CS4B 4R8UA 3CETA 4NCAA 1B4SA 4NRTA 3CJQA 1R0AB 1WBDA 3L2WA 3VR1A 4CJFA 3OW2R 1UVJA 4MKBA 4PABA 2KT3A 1VQ8N 2E8AA 2BR0A 2WFBA 3VPZA 3CJBA 2AW0A 4I2QA 2R4FA 3OXFA 3M2VA 5HATA 2YQ3A 1KVKA 3JQJA 3ZSYA 2YKMA 2Y3YA 1WUAA 4O0IA 3PW7A 5U47A 3QFUA 3QWUA 1WSGA 4OGCA 4B8AB 3SV4A 1F21A 4BRLA 2P6TA 2OD4A 1S0MA 3FUYA 3KKFA 3GDQA 3KTQA 1CZ9A 1YJRA 3A3NB 2UVUA 4CF9A 4IG0B 2G0JA 4YMEA 5ETPA 2Z2ZA 1FXRA 4DN0A 5L38A 2VF3A 1C0UA 2YHWA 5D3GA 4GMJB 2D1KA 3THYB 5HQLA 4WJBA 3HDSA 1VRTB 4BLGA 1KCFA 1EQ0A 4FJ5A 3PW2A 1KQKA 4ZPDA 3DI6A 1BOTO 1PKUA 1U2RA 1HNWJ 5JS1A 2ROPA 2PBDA 1ZTTA 2PDAA 4WKRA 1TKXB 2VGNA 5EGYA 2MMYA 3AO2A 1R8AA 3AO1A 4HCBA 1PJ6A 2A40A 5E3RA 4CH1A 4DX8H 2ROGA 1RT5A 1L3VA 4MIWA 5EX0A 1IJFB 5DG8A 2EW9A 3SXLA 2CQIA 4PCQA 2W2OP 2GX9A 3J7ZT 2G8UA 5C12A 1V6HA 1J53A 3GL1A 1HUXA 3CJ3A 4NXMJ 3ULHA 3D1OA 4ZPTR 3CJTA 2ZKTA 1MA9B 5L39A 1YQHA 4LF9K 1A5WA 4HVZA 4QOZB 4FBUA 1FE0A 2C2NA 3WHIA 1YVNA 1UVIA 3CUNA 3MX5A 4B02A 3J8AA 3CF5Q 1U1OA 1D9DA 1HHTP 2ZNYA 4FF4A 3QMQA 4FOEA 1MROA 1VQOS 4BDZA 1S7HA 1RI7A 2JDJA 3V9WA 2XSFA 3EGWB 2G0IA 2ZH3A 5K8OA 3TSQA 3EGZA 4K8XA 2VG6B 1RDBA 3RAQA 2IRUA 3D6HB 4DUYJ 5HRSA 1CJTB 4GVMA 1LFWA 4R5PA 1Q7YO 4EFHA 1TUYA 3R8EA 3L8BA 3JTPA 3OT9A 1LEOA 3CDBA 5CA5A 3THWB 4LR9A 3UVJA 1VQ7S 2LVWA 3L9ZA 1OH5A 1B7YB 1Q1KA 1FX2A 2YHYA 3T19A 1SUQB 4IRDA 3JYTB 3QRRA 1ZBLA 4WTOB 2J76E 4RUAA 4HVJA 3GFHA 1RYRA 3CCVN 1WI6A 3A5NC 3MM5A 2D1CA 3P3DA 2YQ1A 3M1VB 5KFWA 2AQ4A 1Q7LB 1C0GA 1UETA 2N3OA 3MWTA 1KVAA 3VTHA 4DR4F 2B9XA 3IMQJ 2UUCK 2J0WA 3F0NA 3PRVA 3DJCA 2P5VA 3M4XA 2XHBA 1FWLA 4PHTX 3JAMU 4EAHD 3CCJS 1VQYA 2COLA 4LFCK 3IAS9 2I7NA 4F0KA 3V1QA 2WOMB 1RHKB 2ZKUA 3OPKA 3OL8A 2NPFA 2C3PA 4H0OA 1TUWA 4LFCJ 3QT6A 3PIOL 1NH8A 4RJVA 2OA8A 4C1NK 3M30A 3JB9k 4QS7A 3N9UC 3S7RA 3H90A 4KC5A 4FJGA 1WORA 3ENWA 1YITS 4FJ8A 1PC4A 2FJBB 1PBAA 4K5RA 1N88A 3V6HA 2Z0GA 1N56A 4Y2KA 2N82B 1NO8A 2GO8A 4NLRA 1OWXA 4CNYA 4LF7K 4CF8A 5AQLA 3LGHA 2IVFB 1GLLO 3KXDA 4FWLA 1AFIA 3L3CA 3LWMA 1FRIA 1L5UA 1NJWA 3DXBA 3DOMB 2DR7A 5CYQA 1FFWB 4QPTA 3NGKA 2NSCA 2XSJB 2DXDA 4F0HA 1OVYA 4HTUA 1MWQA 1HBOB 4CF2A 2CZ4A 1NK9A 5A0YB 2XS2A 3AA4A 1Z1ZA 3DOKB 2X6SA 1EZZB 4M95A 1TU0B 1S1XB 3CPWM 4KBOA 2ADCA 2F8HA 4FYXB 4ED7A 1APSA 1UW4A 1F9FA 3TANA 4BR0A 4FOIA 2VL1A 3Q8YA 4WFAL 2J6SA 2RDDA 1VI7A 2YWHA 1J5EJ 2B6AA 4J91A 3T1YJ 2DHSA 4YOUA 5A8KB 9RUBA 3TW0A 2E5JA 3K7RA 4URSA 5EOYA 3G10A 2ZOMA 3NCQA 5LXRA 2XLJA 1XNRF 1T03A 3QT8A 1OSCA 4N8OA 1HI1A 1IBLF 1VAZA 1ITPA 5IT4A 4DSKA 1S1XA 4NWBA 2AP1A 5CYQB 3OYIA 1NU4A 2VB6A 3S3OA 3W7BA 3P4UB 3UI3A 3ID6A 4DCOB 2QLFB 4DV1F 1N5SA 3R2CJ 2G8KA 1U26A 2FZKB 2DHXA 4H0TB 1RHUB 1RB0A 4CLTA 5SZTA 4ES2A 4RW4B 5ADZA 2GELA 2RHQB 3CERA 4IZ9A 1B9FA 1RWPB 1FJGF 3AVBA 3TU5A 2QWOA 4IEEA 5KFAA 4F36A 1RT1B 3JS6A 5I42B 4M1KA 4NASA 1NEEA 3HD2A 4HT5A 4AXJA 3TWZA 1JCEA 1T6DA 1LK5A 1RCOB 2FVCA 1FD8A 1C1BB 4ZP6A 3IRWP 4RKUC 4JAXA 3OS1A 1CPZA 3BV8A 1W2BR 3QIOA 3DXSX 4J9QA 3O5BA 2PZSA 2UXDF 2DGXA 3KJQB 4IJAA 1TZ0A 3WNFA 4CJVA 2DIUA 4LR8A 5F8MA 4Z0UA 3QEVA 1S79A 4Y3CA 3LPTA 2ASMA 2DGVA 1TUVA 4CHZA 2ATLA 1NG9A 1FERA 3QINA 2GVDA 2MKKA 3NGDA 2QRRA 2DHHA 3GPAA 4DMNA 3VZIA 1OYDA 1S5ZA 3MI7X 2PD1A 4GKJK 4ICLB 3KG1A 2C2RA 4DQ8A 2XM3A 2MKJA 5JICA 4CGIA 4LH5A 1ZC6A 1BXNA 1XWLA 4E7HA 1TKTB 3PRDA 4KSEB 4CWBA 2OPSA 3V9UA 3HKZD 5ADXA 1FT8A 3AQPA 1G2EA 5LJ3Y 4WF9Q 4WFYA 3ENBA 4PA1A 3NWGA 4FJ7A 1H7XA 2DH8A 2XHWA 4Q2LA 3H45C 2IVYA 1EP4B 1ILYA 4P73A 3EX7B 5KFSA 1FNMA 1F9HA 4WU2A 1BCMA 4GVBB 3VGKA 2D41A 1EWRA 4AL6A 4YOEA 5HBMB 4NZ0A 1VOMA 5J2QA 4ECYA 2FQQB 4IG3B 3H6EA 3V81A 4F4AA 2OEJA 4Z2XA 2GJ2A 5J2NB 1MWMA 5SUHA 1R8CA 5AT1B 2GV1A 2ACMA 3KHHA 3CO0P 3RAXA 2OJ3A 2YKOA 3PVXA 4CECA 2YV0X 4JV5F 3ENQA 3DRXA 5F8IA 4W5QA 4KY3A 3NRBA 1BA1A 1EAYC 5ETSA 1U7LA 3K0SA 4RUCA 2RQCA 2FSJA 2FIUA 5KFDA 1U2VA 3RSEA 2CPJA 4O3PA 2YBVA 1R8PA 1RT2B 3K8WA 5DS7A 1U1QA 4NCGB 1Q81O 1HR0F 3MECB 2CNKB 1VIOA 2DRAA 4JI6J 2YNIB 2CIMA 4A62A 1XK8A 3ZSRA 1VQ5N 4PZVA 1EP4A 2E1MC 2PSZA 4EBCA 2HW3A 1VK8A 4MJKA 5AQQA 4DR2F 2FSNA 4PY5A 3V4MA 4DMZA 4K4TA 3E8OA 3R3LA 3DRSB 3I55N 4AHRA 5KT6A 3IBFB 4WKYA 5AXLA 3BREA 5GINA 5GAGI 3OR2A 3T9NA 4H5TA 3U3YA 2AX0A 3THYA 3C95A 3CJ1A 3KLEA 1FESA 3TUZC 3J7YU 4DPTA 3MXIA 4ZVTB 3D1HA 3G96A 2ZH6A 1S76D 5J2NA 5BYQA 4NL5A 2GWJA 5AZJA 2BM0A 4JP8A 1TTHB 5EXWA 4NYZA 5FD1A 4TQSA 4BS2A 3N6LA 4PR6A 1S9EB 2FVQA 3CJSA 4L72B 3TEGA 1KSPA 5I3UB 3VEWA 4W5TA 3G82B 1RTDA 4N76A 4H54A 1EETA 2AMCB 2HMIA 1MLAA 2V4RA 3CCUS 2LQBA 2QA2A 4JS5A 4M45A 2V8HA 3DNCA 4J9VA 5CABA 4E98A 4KREA 5DQHA 1YGYA 5I3QA 1TMJA 2NUBA 3N01A 1BE4A 4KGZB 4Y6IA 1RT3B 2XZDB 1RDAA 3RRKA 5KRTA 3L2UA 3FMWA 5DLFA 3CCWA 4RWWA 4IOAQ 1BQNA 3CULA 4DS5A 4OZ3A 2FGOA 3D28A 1YF5L 3HT0A 1TKXA 5K8MA 3L7UA 3M6VA 2LQ8A 1C0UB 3W3DA 3HOTA 3FMBA 1O51A 1S6UA 4CLUA 1YBAA 1YSJA 1S99A 1YZ7A 2HF3A 3SCKE 1TL7A 4CJUA 3EY1A 4PUOB 3HHEA 3VF4A 1WC5A 1T95A 2H5EA 5A76A 5AR0A 3RBZA 1T9WA 1KHWA 2RQKA 4M42A 4LMZA 3OUYB 3V81B 3WEEB 3QFWA 1JL1A 3PUFA 4PKIA 3D5MA 2ZUGA 3GOIA 3CCQS 5LOQA 2R9LA 3UFCX 3CJKB 4UQTA 2CQ3A 4BRMA 1NGIA 2DNPA 2P9SB 1Q53A 5JXSA 1BY9A 2MQ8A 4M5DB 2CZVC 1S3XA 4DG1B 4HDHA 3HZGA 2CKWA 1FE4A 1PG5B 1FNOA 1VQSA 4QR1A 4TXSA 3FZFA 2HHWA 3UDCA 3W2WA 3TTCA 5C24B 3CMES 4IFEA 1NDKA 2IFXA 1MMLA 1QSSA 3IFEA 2E66A 1LNQA 4QWAA 2XMKA 4DL6A 4Z4GA 1E6YB 2KTQA 3K8VA 2MKIA 3G4SN 2IDLA 4L73A 3H59A 3S8SA 4GY2B 2EFVA 4RNFA 1I94K 4CF1A 3J81j 2MKYA 2VYPA 1HNXK 5ETRA 1B92A 4JI7K 1UEKA 1SC1B 3R7BB 1Q9XA 2QXLA 4IKFA 4KYZA 2ZOGA 3L2RA 2RRBA 4WXWA 1T44A 5KFVA 4I7FB 2R7UA 2HLUA 3QAEA 1TL3B 3R1LA 3PIPL 1UEVA 2U2FA 3SQ0A 1FHTA 3CQXA 3L6QA 3DRPA 4CO4A 1NGFA 4DV5K 4FLXA 2BANB 2BEFA 3EGVA 3NY0A 3QEIA 1NNEA 2AT1B 3VERA 1UPMB 4YDXA 4CZCA 3C7NB 4C6AA 3U8XA 1TK0A 5AJ3K 2EKYA 1Q5YA 2XSJA 3QEXA 3VQBA 3PFOA 3G6XA 2YTCA 3PV8A 2ASDA 4Q8FA 1WAFA 2BQ3A 3VQEA 2ZBPA 4GKKF 3G6EN 3RB6A 3HM8A 3ULEA 2H5JB 4AT1B 1RHMB 3P8BB 1H2TZ 1PCAA 3LGMA 4M5LA 5GVQA 4GC7A 4OZ0A 2L41A 4PAAA 4ITSA 1IBLJ 2ZHBA 5F8LA 5IV4A 2SXLA 1P1TA 2P6SA 5J1NA 5BN8A 2HAIA 4PG6A 4CO3A 4DUTA 3SEOA 4GO7X 4FZVA 1NSKL 3FFIA 2HPUA 4IYQA 1MN9A 2UV8G 3I31A 4AQYJ 5JUMA 1XBWA 3DXMA 4P2FA 4CZLA 2GVZA 2DCLA 3LZIA 3W2WB 3VQ8A 3DMJB 1N32F 2MLZA 2D0OA 3AO3A 1WWHA 4PG7A 2A6MA 2K1RA 1WNSA 1QQMA 1N36F 5LY3A 2WB1D 4ZHRB 1J5EK 2RKIA 2EVZA 4PL7A 1EKRA 4Q0BA 1QVGR 4DQIA 1S9GB 3OXGA 5I4MA 1HRHA 1S1UB 2OLWA 1V3ZA 4DU1A 1FA0A 1RISA 1TMMA 2R8IA 3KLFA 1RT4A 3VGSA 1FF2A 2VBXA 3N0VA 3TVYA 2VBYA 4ZP8A 4WWSA 5J1EB 3BGOP 4A2AA 1HNWF 4IR1A 1N36J 4CJQA 2Q3SA 4B3MJ 1SI9A 4ZJQA 5D8HB 4KH5A 4H4OB 4DR3K 4OV6A 1N36K 4FYWB 2LFVA 3SQGA 3KUEA 1VHIA 1CBKA 5J2PA 5HROB 2AWZA 1YIJN 2IBKA 2GW8A 1RFQA 4U8YA 1SS6A 2V4JB 2DNRA 1N32J 3LP3A 4DQPA 4FWKA 2A6AA 4CVNE 1F0XA 2IMWP 3OVBA 3LM2A 1YRXA 1KFDA 1CEZA 2KRBA 3TAEA 1Y97A 3VGMA 5D4PA 4BRFA 4KTWA 3LDNA 1DJ0A 4KPYA 3QWPA 2WHOA 3G8TA 4KGXB 3H5YA 4WFBL 4GKKJ 4FSVA 4S0MA 4GV9A 2G2OA 4LUBA 4WQ5C 3A8IA 3P31A 4QAGA 4DFJA 3VGUA 3BKFA 2DO0A 5A8WB 1HNZK 3OSNA 2EKNA 3E9OA 3CD7A 1K8KA 2ZWOA 2W7PA 3BDEA 3L2VA 2VFSA 2JWKA 2E5LJ 3TABA 3EZWA 4JI8K 3M8YA 1VLYA 1MROB 3CIZA 2O4GA 4LBPA 3DLLQ 4OI3A 2FZCB 2NRXA 4Z4CA 4G1QB 4WE1A 2A10A 3R3TA 4EO8A 2W40A 3SUPA 4J9SA 4O8UA 3TA2A 1JLAA 4JD2B 4JI8J 3NHGA 1WOSA 4FS2A 3IUCA 3LP0A 3BB5A 2WVCA 2GUPA 3P96A 1KD1O 1S6QA 5HK4A 2C3UA 4HWIA 1LXNA 4U7BA 5E0OA 5K8PA 1WKLA 1C0TB 2G9OA 3NOGA 4B1YB 1TFYA 1RT5B 2KDOA 1XIQA 3GFZA 3CCVS 3QT7A 5L1JA 1I6JA 2DGSA 1ZA1B 3QJJA 2HGLA 3OW2M 4FLVA 1AUSL 2HWIA 5L9NA 1UAXA 4C23A 2RB7A 5DDQC 1N54B 5BR8J 4MK7A 1K8KB 4XO0A 3TJ8A 1NDCA 2MQMA 3ZSWA 3QEPA 2CJBA 2ROEA 3EVMA 4CHPA 1JLAB 2PT0A 3MR6A 3FNNA 1VJWA 2CG8A 2LU2A 2HNDB 4PL8A 2GIRA 2DHAA 1IN0A 2B3TB 1GLCG 2BACA 5J1EA 4A4JA 4CJPA 3EN9A 1KR4A 4JI8F 4WFAQ 1A6LA 1N0UA 4H5WA 1AA1B 4FYDA 4QIGA 3AHPA 2HVEA 4EK2A 2DGUA 2PFFB 2HS3A 3HFKA 3B6PA 1VISA 2ZBIA 4IG3A 2HVZA 1QVGM 4B3RF 4EWTA 1XC9A 1TKTA 4DQSA 4Z7YA 1Q82O 2E2NA 1Q18A 3O9TA 3SQGB 2DNNA 3MPVA 2QV6A 5J2PB 4JI5K 3J7AP 4U95A 4JRQA 4WFXA 2WAQD 2PY5A 1RADB 3ZTSA 1OH7A 2PYLA 3CF5L 1HJOA 1QTNB 1H72C 2AJ2A 3OYMA 3MXHP 5FDLB 3BYRA 1RA6A 2GVDB 3DDKA 3ZZPA 5KGXA 3JSYA 1CVJA 4FW1A 1T02A 1FEHA 3CCUN 3MN7A 3OS0A 3BKUA 5F3TA 1U25A 2FGCA 3PX4A 4JKGA 2IVOA 1AXQA 1U04A 5HMXA 1J9AA 1XEZA 3PO4A 1NDLA 3A5LC 5BYRA 3CDWA 1WEXA 4K4VA 4QYZK 3TP2A 3TUJC 1SKSA 2Z1HA 5HOOA 4JI4K 3CPWR 1VQ8S 2DR5A 3K2PA 2ADBA 2QWRA 1ZYQA 1C1BA 3D2WA 1K8AT 4WFNL 2O01C 2V68A 4XH4A 1TKDA 4FZXC 3HVTB 3RAMA 4DR6K 1X4EA 4WZQA 3OTOK 4LF4J 4LF5J 2B0GA 2V52B 3O9SA 3J7Z5 2PI5A 3BS9A 4GW6A 2CDQA 1Y5LB 2DY1A 2WW8A 5ETKA 2QZ8A 3NGUA 3H25A 4LF4K 2V94A 3EZOA 4CBXA 4CI6A 4HI2A 2CWXA 4KRFA 4BR4A 3WNGA 1KOHA 2Z8QA 4WFNQ 5CZ2A 2AGPA 3DRYA 1X3NA 3DLJA 1K0TA 1F2GA 2NRHA 3SCIE 5C25A 4ZS6A 5AQMA 3PACA 5L1KA 5G0RB 1SJ3P 3TARA 1KD1T 4RW8A 1GK8A 3NFAA 3BN4A 3R27A 2JX2A 1M5PC 2KZMA 2HURA 3AJ2A 5J1PA 1S97A 3TJ9A 3JSRA 2L9WA 1F9EB 3LGNA 2VBZA 2KZZA 3VETA 3ENOA 2V69A 2QKKA 2UVVA 1WF2A 2QN6B 4USVA 4X84A 4ELTA 2BW7A 1UZDA 1TKZB 2D3UA 2F1FA 3T3FA 4DV0F 4M3UA 2FUG9 2DPIA 4JI6F 1KVIA 4BE2A 1FJGK 3TA0A 4OLOA 2ERRA 3THTA 3HK2A 3DWLA 4ZTFA 2W7OA 4OLBA 4TU9A 4BRAA 4TSXA 4RW8B 1U0SA 4KH0B 3KHLA 5K8NA 5I3PA 4TYAA 1MMNA 5GAGU 1HFEL 2DR8A 4AM7A 4JKAA 2D3ZA 5IWAJ 2DIVA 1ZAVA 4FM0A 1KAXA 4YB6A 1G99A 4H5NA 4PUOA 2HS0A 2VOOA 2CJYB 3GYGA 2KHDA 2PMZD 1SJQA 1EIYB 2UUAJ 1UAWA 3CE8A 4YHHJ 4ID5A 3CWJA 3DHXA 4A2BA 2CYYA 2QYCA 2AKWB 3AH6A 3NNHA 1PILA 2AZ1A 2QMWA 3RW7A 4PKDB 1BISA 2C2OB 4CLFA 4J8FA 3B78A 3MR5A 5HQ8A 2A1BA 3RU0A 5KRSA 3TX0A 3SBTA 3VQ6A 4C11A 4F4ZA 4TY8A 4P7VA 4X65F 3P83D 3HVAA 5B08A 2AEJA 4J2EA 1W7WA 4CZEA 2EG2A 1RNHA 4JUZA 1IWGA 5ETOA 2DPJA 3VA3A 3HF5A 4IO9Q 3W9JA 5AZIA 1CJVA 5FRMA 2IC3A 2WRMA 2CQ2A 4DKWA 2HNDA 3ISNC 4CEOA 3G4SS 5B0FA 4QU7A 3ZZUA 4C8OA 3OD2A 4NYNA 1VJQA 2AU0A 4QPXA 3G86A 3C8YA 1HBUA 1VYAA 3NXZA 2B9EA 5DM6L 1VQ4N 1KFSA 5KT3A 3A4TA 2F5GA 5D0RA 2X51A 2HRYA 5CY4A 2CRLA 4DTRA 4ILRA 2F8MA 1RAIB 2AGQA 2DNOA 2KHCA 4RNNA 4CGDA 2YNHB 3SQ2A 3HFVA 3NEKA 3VN5A 3ZZZA 2CJQA 3D6FB 4CJLA 1U1RA 4KKOB 4MQ3A 3QGIA 2XYPB 2W4PA 3ZTQA 2VKZG 1U8WA 4DL4A 4AD6A 3DLKB 4P6QA 4ALZA 2O66A 4JI3K 1ZA2B 3OJSA 3HP6A 3CC7S 2YXLA 1KVCA 2EX3A 1DTTA 2J6TA 2O8FB 3KMQA 1VSLA 2RDIA 2VPZB 3CJCA 2O8DA 3BH7B 4DV1J 2HNZA 2AIRB 1C0MA 3J80U 1N8RT 2NRRA 4FF1A 2E2OA 5KFEA 2DGTA 1ZBFA 5IZHA 1UPPA 2RQ4A 1C4CA 1NKBA 3S1TA 1WOOA 2GJIA 1LQ9A 1RDRA 1LW2B 2OTJN 1F5AA 3QIPA 3C15A 1JNRB 2IA0A 3TTDA 2YKPA 3VENA 1BI4B 2E6LA 2XWYA 2RMLA 3LO3A 3ZSQA 1DTTB 4NLOA 3N4WA 3CJ4A 5KGWA 2K06A 1HNZF 3P45B 1QZ6A 2O3DA 3SQ4A 3LP1A 3O80A 1JLBA 2DYAA 4Y2AA 3VQCA 4R5PB 4I2PA 3K5OA 2YWWA 4JKDA 4NCGA 1N32K 1V5IB 3N6NA 5L1LA 3DLKA 4NLVA 5DMRA 1U1NA 1D09B 2OPPB 1AW0A 3M32A 1HMVB 1VQON 1YITN 3KVGA 4WU3A 3B6BA 5CD4A 3A5OC 1ZOTA 3CVKA 4CO0A 3AVAA 2FJVA 4MKVA 4G6VB 3OYCA 3MN5A 2UXCJ 4NLPA 3MPDA 1RLDA 5F9LA 3NS6A 1D5AA 4UUXA 3W2VA 1IJEB 3IGNA 5SWMA 2KVQE 4H4KC 2WVFA 2ZC3A 3V6JA 2BJ1A 1CZBA 3AGKA 3CI5A 4Y2CA 1GOCA 3BEGB 4F02A 3SIPB 3R5GA 3CO9A 1UJ5A 1CJVB 1NCLA 3DCAA 3M6UA 2UXBJ 1VQ6S 2OZMA 1Y11A 2XY8A 3VQAA 2E1PA 1WSEA 3CMAN 3S3NA 4JKEA 3BO2A 3FBEA 2GMJA 3W62A 5A6WA 3WXLA 4AH9A 5FLXU 4OZ5A 3OFEA 1HYVA 1VQ5S 1GEHA 5TKWA 4I68A 1X60A 5B0BA 2OELA 2CGJA 4CDIA 4C9DA 1QJHA 1NJIO 3LWLA 5B0CA 2IRXA 5I42A 4E1MA 1N33F 4O23A 5K9FA 2BE2A 1HYSA 5KFLA 2MY8A 4CZGA 3CCLN 1VCTA 5HJYA 4H5RA 1HD1A 4ZJLA 1S48A 2DEJA 3VAHA 3AVLA 1FFSB 3GMGA 2R7YA 3V6DA 3QRQA 4MH8A 3CDUA 1H2UX 1LWFB 4B9TA 4M3RA 2CQCA 1YAGA 2CFXA 4X4TA 2XTJP 1S0OA 2DKOB 2R7RA 3KK7A 4F25A 5HMWA 3T69A 1XR6A 2BDPA 1FO1A 2GX8A 1FX4A 4DR2K 4X4OA 2VWKA 3BBBA 2C3OA 5KTQA 2Q1NA 4DUYF 3K9JA 4DV6F 4O4GB 2BM1A 1DFDA 2W41A 4K43A 4QW9A 4KV8A 2G8FA 4EZ9A 2X3DA 5T7BA 5F0UA 3BZKA 3I5AA 3DDNA 4PXCA 1CULB 2K1RB 4DR7J 5AE1A 2AJ4A 3K17A 4PKGA 1IXKA 1BD6A 4QWBA 3IAYA 2JH3A 4V1Ak 4YR3A 3TWHA 1KAYA 1VSJA 4B9UA 1Q0NA 2CUYA 4URQU 2F8EX 3G8SA 3PKYA 1IH7A 5LL6d 1PYSB 3SMSA 3T5HA 1F60B 1VSKA 3LUYA 1RWMB 3G0ZA 3X1LB 2DNYA 4RNMA 4U96A 1WHXA 1VQPS 1WTBA 2E4LA 2EC0A 3LAMA 4LF7F 1MU2A 3OR1A 4CM0A 2DD8S 3QLHB 1J2VA 5F2RA 2KT5A 1QS4A 1NPKA 3MMBB 4UY85 2MY7A 4CEDA 1I94F 3O1WA 2CJKA 3M8WA 3C2PA 4HLBA 3LPUA 4DFKA 3VF2A 4J9MA 2M5YA 4FWOA 1P1LA 2ZHOA 3RMAA 3DGVA 3I0SA 3BO3A 4F3MA 1U1MA 3ILIA 1FW6A 4OJRA 2VQFJ 3WXKA 3WZ0A 1P6TA 4CEAA 2GHWA 3GQCA 1RTIB 3A8EA 1S10A 1JLCA 4TYBA 2HBLA 5B0DA 1RWKB 1XN9A 1QHTA 3AY9A 3PEHA 4DCPB 1QQNA 5K20B 2B4UA 5E7OB 5E33A 3TAPA 1P9YA 2GWKA 1C4AA 3BEXA 4HACB 4NXNK 5ETTA 3AJDA 4DBQA 3OY9A 3EKSA 4RPFA 4OPAA 3IWNC 3MN6A 2GEMA 3FQLA 3VAJA 2HZAA 3MN9A 1RT7B 4FM1A 1Z26A 3CXCM 3L7OA 4DF8A 4IUFA 2W9BA 1JCFA 3G6YA 4P9SA 4CGGA 2ZH2A 3B8HA 1W9HA 3GIJA 1WNEA 3WEEA 3NE6A 1T3NA 1J5EF 1B9DA 1FNXH 1U2CA 4YB7A 2JWLA 4DR4K 1MSWD 3SI8A 3FFKB 3C66A 1HYSB 2VU5A 3LDQA 1NOZA 3NGTA 2R7QA 2PGCA 1CC8A 1WELA 3Q2SC 3ZX0A 2V51B 2BRLA 3ZTOA 5HANA 1HNXF 1ATSA 3R5AA 2RRNA 1YDLA 2XYGB 3HHLA 2WONA 3CDEA 4F0MA 3WNEA 5A6PA 3V9SA 4PWDB 3H42A 2XZWA 5F8NA 2RS2A 1H0HB 4F3OA 3VAMA 3MAHA