3KWGA

X-ray structure of ns1 effector domain w187a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEANDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 35
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwgA00
3OA9A 3EE9A 3O9QA 2RHKA 3D6RA 2KKZA 3RVCA 3P39A 3M5RA 3O9UA 3P31A 3F5TA 3KWGA 4OPAA 3L4QA 3O9RA 3O9TA 3EE8A 3O9SA 4OPHA 2GX9A 3P38A 3KWIA
chains in the Genus database with same CATH superfamily
4FVMA 4DSLA 3GBTA 3M8RA 3CQYA 3AO1A 3AVKA 1NGJA 3CJ1A 3AV9A 1C1CA 4DTMA 4GVMA 2YNHA 4E7HA 4M41A 4CJRA 4JAXA 1DGKN 4AHSA 3NDKA 1VHXA 2HB5A 4JKGA 4I2QA 5KI6A 4X66K 1N8RO 1LWCA 2NUBA 3ENBA 2FF3B 4FZZA 3ZEUA 1X9JA 3THXA 4EP5A 2IVOA 4F3OA 4IEIA 1NJWA 4H0TB 4LFCK 5F1XA 3V9XA 4A2BA 3QETA 2UYTA 4FK4A 1N32K 3M5RA 3ZCMA 3VTIA 2D0PA 3SZ2A 4XH4A 4FZXC 2P9IB 1NGFA 4EP4A 2Q97A 3THYA 4AHVA 1D9FA 1HJOA 4O8UA 3TAGA 3QEIA 3HYFA 3JAMO 3UKUB 3BY5A 3HSCA 5M1KA 3LALA 1ZBFA 3O3FA 3QEPA 5AQZA 1X9SA 2YNGA 3U3GA 5JS1A 4PL8A 1GLCG 5FDLA 3EE8A 1T6DA 4OPHA 3M6GA 4CFCA 1S1VA 2AA4A 3SCXA 3ZT4A 3CCQN 1BUPA 1XUPO 2UUCK 5AQMA 2E20A 3CD6N 1BGXT 1VQ7N 2O8CB 4JKHA 4B9QA 4KTZA 1WSFA 5C24A 4PA1A 4IFEA 2OZMA 3DOKA 3AGRA 4YOXA 1P8ZA 1S22A 3VESA 1MWMA 1TL3A 4KFBA 4BRHA 2YX6A 2OPRA 4YNQA 1RDUA 3ZSZA 2I7NA 5AQLA 5F0XA 4B9NA 3CIPA 1RDBA 1TKZA 4CGGA 3A5LC 1J5EK 3CFPA 3F5TA 5AZJB 2HHXA 3UKRB 4DWIA 1IBLK 1RDAA 1ASVA 2HHQA 2D1KA 3VEXA 1BA0A 3HRGA 2IDOA 4O0IA 1YXQA 1NJIO 2YKNA 4I2PA 5AQSA 3FZFA 1QSLA 2D4WA 4CFDA 1KRPA 4MO4A 4R79A 3MCAB 4PKGA 2YHXA 3I56N 2BE2A 1JLBA 4E7JA 1TK0A 1JL2A 2HNZA 3HPGA 4FJ9A 4H0VB 4DS4A 1BI4B 2Y1IA 5JS2A 4FJNA 3BDPA 1TKTA 1RT5A 1ATRA 3QESA 1RBVA 2HBLA 3K9JA 3VEWA 3KWGA 4JI1K 2A3ZA 4YOUA 3P83D 1C0UA 2HF4A 1R59O 1RTDA 4G9ZA 1XHXA 1KXPA 4E7LA 1X3MA 1HMVA 4NYFA 5LJWA 2CGKA 5HRSA 1Q18A 4W5OA 2P51A 5FLXO 4DQRA 3K5LA 5EY4A 4M63C 4OX9K 3EYZA 4DV3K 3L8BA 4YHHK 3D6RA 2HHWA 5SWMA 3M8SA 5FROA 5GIOA 4HTUA 2G8IA 2ZJPL 5DK5A 5FPDA 2OPSA 4FJXA 2KZZA 1I39A 3N4QA 1QQCA 3OYKA 2E2QA 2Q0RA 1QHAA 3VENA 3D2EB 3KTQA 3J7AP 4HCCA 2IC3A 3N4PA 4FOIA 2QXLA 4CEOA 2PY5A 1FK9A 4HWIA 3TR8A 2P9LA 5HRPA 3ZLJA 4DSKA 4YOVA 1ESVA 4H0PA 2HOEA 3K5OA 2UXDK 4BRKA 4CZEA 2A1RA 1VQ4N 2Z1IA 1XHZA 1Q86O 3LWMA 4FJJA 1VQKN 1QS4A 1WUAA 3AY9A 1Z26A 3NH0A 1Y97A 4H03B 1VRUA 1D4XA 2HHVA 3V81A 4CESA 1FKPA 4E0DA 2ITGA 1S9EA 4C8KA 3HOSA 3O6WA 1RCHA 5C0YA 4CFAA 4YDUA 3G10A 3RSEA 3K58A 4ILHA 4MLEA 3SI6A 5KQ8A 4BRAA 4CHQA 4BR5A 4LF6K 2A40A 1SUQA 4CEQA 5C42A 4WFBL 2WOMA 1KFDA 1NK5A 4OLBA 3VEOA 3LM9A 4IG0A 4CGDA 3OS0A 5FRMA 3ZSRA 3NE6A 2D0OA 3QFUA 2HHUA 1NGAA 4IOAL 4CJTA 4BRGA 3CCSN 3WNHA 4AHCA 4FJMA 4IJNA 2Y1JA 3HXMA 3K0SA 2CGLA 4BRCA 4DTUA 3TSPA 2HBJA 2OZSA 1UWBA 1QQMA 1ZBLA 1VSKA 4F9OA 4CBXA 1NJZA 2OTJN 2O8DA 3O4WA 3CM6A 4B9TA 1OVQA 4JHDB 3THXB 3SJHA 2P9SA 4X62K 4K8ZA 4AM7A 1TAQA 3J8AA 4DQSA 2EWSA 5M1QA 2PYJA 1WSIA 3UE5A 2QWPA 2QW9A 3LPTA 1TV6A 1SKWA 4E7IA 2GBZA 1HR0K 5E84A 2W6LA 1KC8O 3THYB 4YY3K 1DTTA 1V4TA 2V7YA 4BR0A 1LV5A 4PUOA 3ENHA 4CF0A 1HYSA 4I9QA 2E6LA 4FJIA 3T3FA 5TKWA 2XY7A 1B9DA 4B9VA 4CEAA 3T69A 3T1HK 4Z4IA 1WOQA 4CZIA 3UKUA 3CJ9A 4JK9A 5AQGA 4XH5A 2QA4N 5AQFA 4KHUA 5AQVA 1NU0A 4GMJB 4JNEA 4ISFA 5C12A 1KLNA 4FLYA 2VGMA 3V9WA 2HW3A 4N76A 4J2EA 3DXKA 4DV6K 4BWJA 2G8UA 4NCGA 3W0LA 4CERA 3L2VA 4BRMA 4N41A 1W9HA 3AAQA 3QEWA 3HM8A 2Z1JA 3V6DA 4Q0BA 2O8CA 2KTQA 3HJFA 4YOTA 4OPKA 3K57A 1NJXA 4CF8A 3VGMA 1DLOA 2VQEK 4FWLA 4B9SA 5DMRA 3H3NO 2UXBK 2ZGYA 3C95A 3PX0A 3GG4A 3VA3A 1RILA 3J7YP 1U6ZA 4BDPA 3BP8A 3THWA 4H0XB 3L3VA 4WF9L 4WFAL 1E4FT 1RBTA 1HNZK 2Q36A 3VQAA 3P5JA 3C7NB 3I55N 1WN7A 3V9UA 4M3XA 2PYLA 3MWTA 1YVNA 2QWNA 4MDAA 1LWEA 2F4VK 3DLKA 4CZFA 4GVEA 3OYIA 2X78A 1OH8A 4FXDA 4IOXA 3R1XA 3JYTA 3CXCM 1QQNA 2QKKA 1XNRK 4LFAK 3NAEA 2HMIA 3R9PA 4CZGA 3OYMA 1GOBA 1YHQN 2VWBA 1VQ5N 3AAPA 4BQZA 5KGXA 1Q9YA 4FLVA 3D7EO 3LP2A 1EWQA 1BQMA 3FFKB 1YJWN 5BPMA 3L4IA 1C0GA 3CFOA 3U6FA 1N33K 1BI4A 4E19A 3UIQA 4LF9K 4M3TA 2XY5A 3F2KA 1GLDG 4DR2K 2WC9A 4IWVA 4RW6A 1JLCA 3RRGA 4FL9A 4PQUA 3CHWA 3KD5E 3SQ4A 3L2WA 3ZETA 4ZTFA 4Y1DA 4BDYA 1IV0A 2V51B 3FZKA 4CZKA 4HUEA 3DI6A 2O8FB 3AVIA 1RBRA 2X6NA 2NZTA 1RTIA 4B1WB 4CEDA 3EL2A 3FZHA 4A5BA 4AHUA 4O44A 2AP1A 2BH1A 3D45A 4JI7K 4J2BA 4BR2A 4E1MA 1LWFA 3B6PA 4DB3A 1WB9A 3LAMA 1KAZA 5AQUA 3KJVA 1HPMA 2R7YA 1TKXA 2KZMA 1JLGA 3VEYA 3E9LA 1NGDA 2X74A 4H0YB 4F2SA 4IXCA 5BPLA 4B9UA 4M3WA 3AA4A 2WTUA 2D5RA 1EO1A 1MA9B 2F7TA 3U9DA 4BVOA 1SS6A 4C1NI 1BDGA 2P9PA 1HKCA 5GADP 4QS9A 3O3GA 1QVGM 1LAWA 1T6CA 3RRHA 4KI6A 4CK3A 1QZ5A 2F9TA 3HI0A 4FWSA 4CF2A 1OVYA 3L3UA 2NRZA 4CHNA 4OKJA 4GV3A 4H0OA 4JRQA 3WT0A 3EZ5A 3T7ZA 3TU5A 3LDLA 4X64K 1VQMN 4FJ7A 1T3VA 2E8AA 2BDPA 2KW4A 2WFBA 3QICA 3QIPA 3WNEA 4LC9B 1FW6A 3IFRA 3RSEB 4RW9A 4HVJA 3ZT3A 1IG8A 5GIPA 2IGIA 3MEEA 4NLCA 2W42A 4FZYA 3HOTA 3VQ7A 4CK2A 2B4JA 3KHYA 1C6VA 4DCHA 5SZTA 1YT3A 1IBKK 1NGEA 4B9MA 1EP4A 3R8EA 1NGGA 1QZ6A 4LF8K 3BGRA 5LMUK 1VSFA 1LW2A 4DF8A 5AQQA 4U7BA 1N34K 1TUUA 2KFNA 3J80O 3BEXA 2DPNA 1BA1A 2Z1HA 1XMQK 4O5FA 3VQPA 4HHTA 4NCAA 5AQNA 2O8DB 4X65K 1RT6A 1Z6RA 1B92A 3HVTA 4CE9A 4BRQA 4C8NA 3TABA 4DQPA 2P9SB 4DR7K 2VCPA 4M3ZA 3ENOA 1TYQB 1RT7A 3KD1E 1NOYA 5FPNA 2JWLA 1BWFO 4JHDA 3OYEA 3WNGA 3H6EA 4JI5K 4E3SA 4OPJA 3VTHA 2LSNA 5C25A 4CZJA 4WFNL 3TARA 4K0KK 4IO8A 5CHIA 1S6PA 3O5BA 4DFJA 1MDUB 2IOCA 3VMFB 2QM1A 3IAYA 4KAZA 4I9LA 4Z0UA 1RT1A 3CPWM 4FJLA 3IKMA 1GOCA 4H5NA 2HNDA 2P9KB 2PBDA 1LCUA 4O0JA 1KQSM 3ULEB 2YHWA 3H3OB 4JS4A 1BHLA 4MQ3A 2GUIA 4O55A 2P1JA 1RDCA 4BRPA 3OTOK 3CF5L 5GAGP 2F8SA 3QERA 4CGHA 3VPZA 5GINA 3A8YA 3DXKB 3MXJA 4DQQA 3CC2N 4J8FA 4KHNA 4OO1J 4PL7A 4KH6A 2J4RA 4DU4A 1I3AA 3FE1A 1KAYA 4H5VA 4GKJK 4KRFA 4OPAA 3U8XA 5BRDA 2GV9A 4KO0A 3TAFA 4KTWA 3CG7A 3OYLA 3WXKA 5HRNA 3CM5A 4C23A 4CECA 3THWB 4BR7A 1NM1A 3NVKA 3AVHA 1JXEA 4JI6K 4BE0A 1L3VA 3LP0A 2F9WA 1VK0A 4R5PA 4KTQA 5KPTA 4BC5A 4FJGA 4GKKK 4JYAK 2D0BA 2XY6A 1W0HA 3RWUA 2AJQA 3AVCA 4A2AA 1K9MO 1EX4A 4DS5A 5JLHA 3WQUA 3LZJA 4GNIA 3C7NA 1BIZA 4QOZB 3T19A 1T05A 3LDSA 1ASWA 3ZX0A 5KPZA 3NFAA 5LMNK 4BRNA 3SLCA 2JLEA 3SQ1A 3E9OA 1N36K 3O9UA 3VQQA 1F21A 3S3NA 1RFQA 3LP3A 1RTJA 1U2VA 4H4MA 2QWLA 1CZBA 3O9TA 2ATQA 1TKDA 3RMCA 1HX1A 4ZTJA 1HUXA 2G8HA 4BRFA 3ZT1A 4BROA 4FM1A 2XRIA 3PLAA 5HL7L 1J6ZA 1BCMA 4CJQA 3NF7A 2QXFA 3LDPA 3I8DA 3Q7BA 1DT9A 4RWTA 3AA3A 4IFVA 3QB0A 3ZETB 3IMXA 4L8RB 3OY9A 3AVLA 3VQ8A 3UB5A 1TK5A 5D3GA 2UUAK 4WQ5A 3HPOA 1QE1A 3U4LA 2O8FA 4AHTA 4LF7K 4PWDA 3B8AX 2OTLN 5TKYA 4A5AA 4E1JA 4CGJA 1WSEA 5I9EB 3BZKA 3PIPL 4DTSA 3SMSA 5ADXH 4N5SA 3ATUA 4Z4FA 4XEIA 3M3ZA 3VQ9A 1EQYA 3KWIA 3WXJA 2P9PB 4OLAA 1VSEA 4G1QA 1REVA 3SAFA 3NMUA 3ZX3A 3ZSXA 2FSJA 1QVFM 3WEEB 3MECA 3KVGA 4KKOA 5LY3A 3VGKA 1IG9A 4FYDA 4FJKA 5AQYA 3MK6A 2YKMA 3K9KA 1WAFA 5AJ3K 3MXMA 3AVMA 4KBOA 1NKBA 2GX9A 3CERA 3G71N 3PY8A 1VQ6N 3FGUA 4ICLA 1XC3A 3C6TA 3ZT0A 1SQKA 4EIAA 4B3SK 1NBWA 2RHKA 2W6KA 3CCRN 1X3NA 2FLOA 3QIOA 1FXXA 3FFIA 4Z94A 4CHPA 2E5LK 1SAZA 1H1VA 4NCBA 1ITGA 1CZAN 3C65A 4W5NA 1EWRA 1QHTA 4H5WA 3OYGA 3JXUA 2UUBK 3F73A 3OJSA 3QDKA 4RW4A 4F8RA 1NOZA 4JK8A 1IKXA 4DUZK 3WXIA 1C0TA 2F8TA 4JV5K 4O8KA 4C1NK 2ZM6K 1SL2A 3P39A 3MCPA 5B8HA 1MU2A 4CD1A 3VETA 3OS1A 1SL1A 1FJGK 5DM7L 1UOCA 4K43A 4WE1A 3SQ2A 5M1PA 1JKHA 1RT2A 4B1VA 1KD1O 2YHBA 1M90O 3SPZA 4DLEA 5BN9A 1JXBA 3OJUA 4CK1A 4BG9A 3EKSA 3ITHA 3HVRA 4UQGA 4DSJA 5AQTA 1NGIA 1MWKA 3S3OA 3CQ8A 2G8WA 4CJ7A 4E89A 1VQ9N 2PAVA 1U45A 4DR4K 1TYQA 3PO5A 3CCUN 3CI5A 5ELZA 3DLLL 1S1WA 1KTQA 2P5GA 2VYPA 2FBXA 2RKIA 1S1UA 4CVNE 4FWMA 3VQ4A 3V1QA 2YHYA 1RBUA 4K25A 1S9GA 4IFYA 3NH2A 2HSTA 1TVRA 3CCEN 5MLCQ 3VQ5A 2QTDA 2NRXA 4FJ8A 4M3UA 3BF3A 1IKVA 3AO2A 2NRWA 3CC4N 4BVPA 1KLMA 1JCGA 4QS8A 4KB1A 3ZSOA 2P9KA 1NJYA 4H8KA 4FWQA 3P38A 4JKCA 4MDBA 3ULEA 4B1UB 1XMOK 4ZHRA 4Z4GA 1U47A 1XI1A 5CYMA 4YOWA 4B3TK 3CJAA 3F9MA 1L3SA 4ISGA 1XQSC 3MN7A 4BC2A 1VSJA 2ZE2A 2QI2A 3KIOA 3J7ZO 4DTJA 3MN9A 2W41A 2DFFA 5KTQA 3ZSYA 3U9ZA 1JJ2M 4A61A 5M1FA 2G8KA 2A41A 4M7YA 4KV8A 4LF5K 3ZSQA 5BREA 2DTUA 2XO7A 4F3TA 3DXMA 3KK2A 2CH5A 1J9AA 4CJWA 5H1SQ 5HROA 4F4KA 5AFUA 2A5XA 1BU6O 4DV7K 1VSIA 3SUQA 3E66A 4EHTA 5T7BA 1W97L 1D9DA 4FJ5A 3KLEA 1NLVA 5AQHA 3V9ZA 1YTAA 4RG8A 5CE3A 3DLEA 5IT9O 2P9NA 3HP9A 1NMDA 3ZT2A 1YJNN 2NRHA 2IVPA 2NRTA 4FM2A 1CXUA 3L6QA 4FWKA 4KHSA 4DU1A 4IO9L 3THVA 2YHAA 4DV0K 5C10A 3TAPA 1E3MA 2HHTA 3MXIA 4YORA 3DLHA 4FWPA 5AQOA 5AQKA 4FVUA 3LAKA 4FK2A 1BG3A 5I42A 2IS3A 1KCFA 4BGAA 2YV0X 2W40A 4CF9A 3O3HA 3FLCO 1GLAG 1U2VB 1OH6A 4OJRA 4EZ6A 2Q0UA 2VQFK 5M1NA 3S3MA 4IBNA 1BL3A 1FKOA 3E9PA 5C2DA 4B3MK 1HNWK 3LZIA 4Z4HA 2GTDA 2NRRA 3R6MA 3PSIA 2EHGA 3LDQA 3NCIA 3TI0A 1NK9A 4FLZA 3P1GA 1T44A 3O80A 4A59A 4CZHA 1IJJA 4RW8A 2BGGA 1NK8A 4FLUA 3LDOA 2HHSA 4CD3A 3TSUA 3D0PA 1DTQA 2RE2A 4FSVA 3LM2A 2A1SA 1J53A 4H4OA 3CETA 1ZXOA 3LANA 2ZJRL 2FBVA 3OYFA 1RT3A 3LWLA 2YJEA 4DFMA 1ZBHA 3K59A 1U49A 2O4IA 1RGIA 4WQ5C 3OA9A 5CYQA 2QK9A 1IH7A 4B3RK 3KLGA 3MAQA 1S6QA 1BOTO 1D5AA 3CJCA 2A6AA 1Q7YO 1L3TA 4ILJA 2WBNA 1O1WA 3BF1A 4HUFA 3KKSA 4ID1A 3EN9A 3O9RA 3R3LA 4WQ4C 1Z25A 3J81O 4N56A 1U04A 2DFEA 2FBTA 4HUGA 3S9HA 4NXNK 3L0QA 2CGJA 3CCJN 5M1OA 2F96A 3MN5A 1BCOA 3GE1A 3IDHA 2JWKA 3M8QA 3E01A 1E4GT 3A0IX 1RDWX 3HTVA 3TPQA 3WEEA 4B1YB 4ILGB 3K2PA 1RBSA 1WLJA 5JICA 3RMAA 1JLEA 4CBUA 3KLFA 1GLEG 4Z4CA 3ID8A 1YF5L 3H45C 4DUYK 1SV5A 4F2RA 3VQCA 2QKBA 3SQ0A 1SZ2A 1SKSA 4K8XA 4DR3K 3VN5A 4JD2A 5HP1A 1VQNN 4RW7A 1U4BA 1J54A 4AH9A 5AQRA 4Y1CA 1NKEA 4NLBA 2HF3A 1Q9XA 4XH1A 4U67L 4KREA 3SV4A 4DU3A 1YITN 3O1BA 3AO3A 4AM6A 4QS7A 3MWPA 3QFPA 4BRIA 2YNFA 4J2DA 2FC0A 3BUZB 4KHQA 3ZSWA 1K8AO 2E2PA 4NYNA 1A5XA 2QWMA 4H5TA 4CJKA 3OW2M 3QBWA 4BE2A 1X9MA 3CPEA 3IUCA 5C2FA 4BR9A 5JMVA 2Q1NA 2BUPA 4IJAA 4DG1A 3RVCA 4IOCL 3CJBA 3Q7CA 1BISA 1VQLN 4LD0A 4B3OA 5EU7A 3S41A 1KFSA 3EO3A 4DV4K 3VQEA 3ZYYX 1X9WA 3O9SA 3KLIA 1TGOA 3L2RA 3VQDA 3O4NA 4CJ4A 5J2PA 3AVNA 1SL0A 3WUHA 2DY4A 3MN6A 3IG1A 2ZD1A 4Q5VA 4C8MA 4DTNA 4FWOA 3AVAA 2KKZA 3VF6A 1BO5O 2ASPA 3SAGA 4JI0K 4KHPK 4JRPA 1NK0A 1YI2N 5AQXA 5EVZA 3LDNA 4GV9A 4KI4A 2G8VA 2O8BB 3VQ6A 4EAHD 3GOIA 4CBWA 2FXUA 2IVNA 5IWAK 4L3QA 1OH7A 3OYBA 3DLBA 3WNFA 1N5YA 2XHBA 1T8EA 1HNXK 3SAHA 4UY8O 3RMDA 4BG8A 2H3GX 3PUFA 4JLHA 5AZIA 4BC4A 1VQ8N 2A42A 4QAGA 2HMPA 3QINA 1KVCA 5C15A 3T1AA 4CJUA 1KVAA 2YJFA 1C0MA 3I8BA 1WBDA 4ELVA 3NGYA 1JLFA 1RDDA 3OYDA 1CZ9A 1B9FA 1CXQA 4FOEA 5CY4A 4W5QA 3NH1A 5J2QA 1NMNA 5KQDA 5FRNA 2E4LA 2VWKA 3DRRA 3OYHA 3DM2A 5HOOA 3TAEA 3AVJA 1HRHA 4RTFD 1LW0A 3DXMB 2FSKA 3DOLA 3CCLN 3TTDA 4JK7A 3HZ6A 1KVBA 1HKGA 4OKKA 3KK1A 3QNNA 1KSPA 3AARA 1TK8A 4ID5A 5KPRA 3OS2A 1C1AA 3DLGA 2OPPA 4MFBA 2V7ZA 2P9UB 4BE1A 4AQYK 3O9QA 4AILC 4BREA 4EFHA 2P9NB 4FJHA 5AFUH 2G8FA 4BRDA 4CEFA 3MX5A 3DYAA 3FR0A 1K8KA 3KK7A 3L4QA 3MX2A 4HTLA 3TAMA 3A5MC 1HJRA 2XY8A 1HNVA 3I33A 4Z4EA 1TL1A 4AF1A 3FZLA 3TTFA 4PKIA 3EE9A 3QEVA 1NNEA 2E6MA 3P4IA 1V4SA 2ZF5O 2DFHA 4FO0A 4KPYA 2Q2RA 3MEGA 2PFUA 4I6MB 3PSFA 1OKJA 2YI1A 3SNNA 1P90A 3KK3A 4CIEA 4QCLA 4YFUA 4M3YA 1BQNA 4BY9C 4CJ3A 3M1FA 3TANA 4FWRA 1L5UA 3VEVA 3V1RA 1S3XA 1NGHA 3HP6A 1DEJA 4DFPA 3KZBA 4OGEA 4JKBA 4CZMA 4DQIA 2NNWA 1HYVA 3O4QA 3G6EN 4CFBA 3TAQA 3ID6A 5JLFA 4FLWA 4A57A 4CJPA 1OH5A 1QTMA 4CW7B 1T7PA 1JLQA 3EEQA 2GUPA 2QWRA 3KLHA 4RCHA 3DRPA 2NRVA 4DSIA 3G0ZA 3VA0A 1ZBSA 3AO5A 4JEPA 4CIGA 3SUNA 4CJFA 3CMAN 1HLUA 2FBYA 1L3UA 2V52B 2VWJA 4LSLA 3RR8A 4WQ4A 3D2FA 3CJ7A 1S1XA 5BRHA 3LP1A 1Z05A 3OBWA 2OYQA 5HBMA 4LF4K 4JKEA 4BGBA 4OKEA 3T1YK 1HKBA 3QMLA 4LFBK 3MMVA 3ATVA 3QO9A 4LSNA 4CGFA 3HT3A 1EETA 1XNQK 3BZCA 3RMBA 2KQ2A 4CI6A 2FSNA 2I7PA 2ITMA 2HBKA 3WQTA 1NK4A 2X6SA 1YAGA 3AVGA 4B1ZA 4FM0A 1WBBA 3RTVA 3OYNA 1GLBG 3PIOL 4DSEA 2RF2A 2PZSA 2IIRA 1JCEA 3K5NA 3O1WA 4E7KA 4JI3K 3HBTA 4GW6A 3SMPA 3VGLA 4JD2B 5HLFA 2OPQA 3A5OC 3O08A 2HNYA 1GLFO 4DTPA 1NG9A 5A2QO 1ASUA 1G99A 2VG5A 4CJ5A 3H1QA 4BR4A 4O4GA 4AHRA 3G4SN 1ZC6A 3HM9A 4JKFA 4MO5A 3SBGA 3DJCA 3E1YA 2I5JA 3NF8A 2GELA 5KRTA 3ZSVA 1WNSA 2OA8A 4DR5K 4J2AA 1YJ9N 3VF2A 5J1EA 1Y64A 4JKAA 5GAHP 4PHTX 1UAXA 1HQEA 3L2QA 4E1NA 3HK2A 3VQBA 1N6QA 3O8MA 2O8EB 2KHOA 3VF4A 2OANA 4DV5K 2HBMA 3NHGA 3WXMB 3I0SA 2GEMA 3OHRA 3H46O 1JCFA 3AGKA 1VQPN 1NWKA 4JN4A 4O5BA 4FPBA 2E2NA 4B8AB 3SV3A 1SKRA 3AVFA 4V19S 2YNIA 5BRFA 1RT4A 4CEEA 1JLAA 1NK6A 4LH4A 4FLTA 3F9KA 4DF4A 4M45A 2UXCK 1BIUA 4A62A 4WCEL 1C1BA 5CZ2A 3PX6A 2P5OA 2ETJA 4JKGB 3TTCA 4KH5A 1WSJA 3JSMA 5E26A 4CJVA 3GDQA 3ZEUB 4C8OA 4Y0WA 4OVLA 3VEZA 3ULDA 4KB0A 2O8BA 4IZ9A 4FPAA 4DFKA 5AZIB 3M8PA 4KHYA 1VSLA 4DV2K 1UA0A 4DTOA 4B1XB 1RNHA 1VAZA 3QBXA 2QWOA 2Q31A 5J2NA 3A2FA 1VQON 1YUWA 5K14A 5AQWA 3NF9A 2P9IA 4I7FA 3DLRA 5J2MA 4CZLA 3CFRA 1QSYA 4M42A 4JKDA 2WONA 3ASMA 1X1PA 5EOYA 4NB4A 1JL1A 1VRTA 1A5VA 5KGWA 3SUPA 1IO2A 1EXQA 2D0AA 1ATNA 4PY5A 5CZ1A 3MDQA 5CR4A 4FK0A 3AA5X 1ZBUA 1QSSA 1S5JA 3OBYA 4B08A 4BC3A 4DSFA 5E41A 4XIUA 1S72N 2EX3A 4MLHA 3TWHA 3SUOA 1J5OA 5BR8K 3CCMN 4DR6K 1ATSA 4CJSA 2BTFA 5FPEA 3NGIA 2YCHA 1GOAA 4CGIA 2QEXN 4DHYA 3OVNA 1K8KB 2Z1GA 2P9UA 4EHUA 3JS6A 2D0CA 4K42A 4OGCA 1K73O 4W5RA 1W2BM 3NGZA 2NLXA 1WAJA 4CF1A 4CEBA 4IKFA 3AO4A 4CCHA 4CHOA 4FW2A 5AQIA 3TSQA 1UA1A 2B6AA 3V9SA 4EZ9A 1EKEA 3CQXA 4ELTA 4DTRA 3I0RA 1Q81O 1IBMK 3L2UA 4BWMA 3DAWA 4CEZA 3RR7A 3PO4A 5EXWA 1NKCA 1KAXA 5EX5A 5FPMA 2KFZA 3G25A 1HPZA 4NO7A 4B8CA 3C0BA 3IS9A 4I6MA 5AZJA 1GLLO 2ZGZA 5DM6L 4FCYA 1ILYA 3UKRA 3KKRA 4GY2B 1S1TA 3SK3A 1VSMA 1IKWA 3OYAA 1LAVA 1YIJN 4HCBA 1TUYA 3HL8A 1I94K 5JVGL 4DTXA 3EKUA 4LY7A 1DKGD 3C94A 3SPYA 1C0FA 3ISNC 3GL1A 1O13A 3NF6A 4IDHA 2HVIA 2ZWHA 3ALYA 2E1ZA 5BPNA 3VERA 5BN8A 4M7XA 4C8LA 1YTUA 4ISEA 5I3UA 4BRLA 2Q3SA 1WSGA 2E88A 3PV8A 1WSHA 3P31A 2B5JA 1XWLA 1NGCA 4IG3A 2CH6A 4DQ8A 4K41A 3V1OA 3EY1A 4GV6A 2KLAA 5JVHL 1TAUA 2GWKA 4BACA 2RN2A 2HHHK 1VSHA 3DRSA 4DV1K 4KHWA 3D2FB 5LJVA 3OYJA 1QQOA 1HNIA 2VG7A 4CJLA 1M1KO 3CC7N 4FWNA 3MEDA 4IDKA 3AVBA 1G15A 4PKHA 4W5TA 4BDZA 1A5WA 4FLXA 3NBPA 1IKYA 2GWJA 2O4GA 3LPUA 3CYMA 3QEXA 2UU9K 3OYCA 4CHZA 5ADXA 4CIFA 2E2OA 3IRXA 4LH5A 1VSDA 5AQJA 3A5NC 4NXMK 2RPIA 4JI4K 1LOTB 3SBTA 2WUSA 1U48A 2OCEA 1W7AA 3AA2A 1T03A 5F2RA 4DMNA 5LL6Z 1XC9A 1ZYQA 3D2EA 2FF6A 2ZJQL 3SJJA 1HQUA 2P9LB 1K6YA 4WYBA 3EZWA 4DKWA 1D8YA 3K5MA 1NK7A 3CMEN 3LL3A 3C6UA 3H1VX 3QLHA 3HSTB 3C6HA 3DMJA 3WXLA 4JI2K 4B9LA 5KRSA 4N47A 1NGBA 1RTHA 2ZQBA 4FW1A 3SYZA 4CHYA 4IEEA 4JI8K 3NVMA 4JS5A 1YVUA 5BR9A 3V4IA 3QNOA 2VG6A 3PX4A 3ZX2A 1Q8IA 4H5RA 3FZMA 2VGNA 2QWQA 2HVHA 4M3RA 1GLJO 5HRRA 3H08A 3W3DA 4ELUA 2E1YA 5GAEP 4YOYA 3VOVA 3HO1A 2O8EA 2ASMA 4KH4A 1HYZA 2IAJA 3DWLA 5AQPA 1R0AA 3HPHA 4BQLA 1CLQA 2JGUA 2BANA 4TSXA 4DLGA 4YDUC 3U3YA 3C6AA 3CCVN 3B6OA 2ASOA 4DR1K 4CJEA 1Q82O 5AR0A 1ZBIA
chains in the Genus database with same CATH topology
3M1FA 3R9PA 4CZGA 3GBTA 1KD1O 1M90O 3CQYA 4FWRA 5BN9A 1NGJA 4BG9A 3EKSA 1YHQN 2VWBA 3VEVA 5AQTA 3CJ1A 1NGIA 1MWKA 1S3XA 1NGHA 1VQ5N 1DEJA 3KZBA 3AAPA 4BQZA 4JKBA 4CZMA 4CJ7A 2NNWA 3D7EO 4JAXA 1VQ9N 2PAVA 1DGKN 3G6EN 3ID6A 1TYQA 5JLFA 3FFKB 3CCUN 3CI5A 1YJWN 4JKGA 4A57A 5BPMA 3L4IA 1C0GA 5ELZA 1N8RO 3DLLL 2GUPA 2QWRA 2VYPA 3ENBA 3F2KA 2FF3B 4FWMA 3ZEUA 1X9JA 4RCHA 1GLDG 2WC9A 2NRVA 2YHYA 2IVOA 4K25A 1ZBSA 4IWVA 4IEIA 4JEPA 4H0TB 4FL9A 3CHWA 5F1XA 2HSTA 3ZETA 4A2BA 3CCEN 3CMAN 1HLUA 2UYTA 2V51B 3FZKA 4CZKA 3M5RA 5MLCQ 2NZTA 4B1WB 2QTDA 3VTIA 2D0PA 2NRXA 2V52B 3EL2A 4XH4A 3BF3A 4WQ4A 2NRWA 3CC4N 3D2FA 4BVPA 3CJ7A 3FZHA 4A5BA 1JCGA 5BRHA 4QS8A 2AP1A 2BH1A 2P9IB 1Z05A 2P9KA 3OBWA 1NGFA 4FWQA 3P38A 4JKCA 4MDBA 3ULEA 4B1UB 4BR2A 2Q97A 4DB3A 4JKEA 4BGBA 1HJOA 1HKBA 3QMLA 4O8UA 1KAZA 5AQUA 4YOWA 3CJAA 1HPMA 3ATVA 3MMVA 3F9MA 4ISGA 1XQSC 3UKUB 3HSCA 4CI6A 5M1KA 3VEYA 3E9LA 2FSNA 1NGDA 2I7PA 2HBKA 3MN7A 2ITMA 3WQTA 4BC2A 1YAGA 4H0YB 4IXCA 5BPLA 4B1ZA 2QI2A 5AQZA 1EO1A 3J7ZO 1MA9B 2F7TA 3MN9A 3U9DA 4BVOA 2W41A 4PL8A 1SS6A 1GLCG 1GLBG 3PIOL 3EE8A 1T6DA 4C1NI 1BDGA 2IIRA 1JCEA 2P9PA 3M6GA 3O1WA 4OPHA 1HKCA 3U9ZA 4A61A 5GADP 3HBTA 4QS9A 1QVGM 1JJ2M 3SMPA 5M1FA 1T6CA 2A41A 3VGLA 2AA4A 4M7YA 4JD2B 3CCQN 1QZ5A 1BUPA 1XUPO 2F9TA 5AQMA 2E20A 3HI0A 5BREA 3CD6N 1VQ7N 4FWSA 3A5OC 3DXMA 3O08A 4JKHA 4B9QA 1GLFO 2CH5A 1OVYA 5H1SQ 5AFUA 2A5XA 1BU6O 1G99A 2NRZA 4IFEA 3E66A 4EHTA 3H1QA 1W97L 3AGRA 4BR4A 4GV3A 3G4SN 1ZC6A 1NLVA 5AQHA 4H0OA 3WT0A 4YOXA 1P8ZA 1S22A 4JKFA 4MO5A 3SBGA 3T7ZA 3DJCA 3TU5A 3LDLA 3VESA 1VQMN 5CE3A 1MWMA 1T3VA 3E1YA 2E8AA 2WFBA 3QICA 2P9NA 4BRHA 2GELA 4LC9B 1NMDA 2YX6A 1YJNN 3IFRA 3RSEB 2NRHA 2IVPA 1YJ9N 3VF2A 2NRTA 1Y64A 4JKAA 1RDUA 3L6QA 5GAHP 2I7NA 4FWKA 5AQLA 4PHTX 5F0XA 1IG8A 5GIPA 4IO9L 3CIPA 5C10A 4NLCA 3A5LC 3HOTA 4YORA 3F5TA 3KHYA 4FWPA 3O8MA 5AQOA 2KHOA 5AQKA 2OANA 5AZJB 3VF4A 4DCHA 4FVUA 2HBMA 1NGEA 1BG3A 3UKRB 3WXMB 2GEMA 3OHRA 4BGAA 2D1KA 3H46O 3R8EA 1JCFA 2W40A 3AGKA 1NGGA 3FLCO 1GLAG 1U2VB 3VEXA 1BA0A 1QZ6A 3HRGA 1VQPN 1YXQA 1NJIO 2Q0UA 5M1NA 1NWKA 5AQQA 4JN4A 4U7BA 5AQSA 1TUUA 4FPBA 3E9PA 2E2NA 5C2DA 3FZFA 3BEXA 2D4WA 1BA1A 2DPNA 5BRFA 2GTDA 2NRRA 3R6MA 4MO4A 4O5FA 4R79A 3MCAB 3LDQA 4PKGA 2YHXA 5AQNA 3I56N 1Z6RA 4A62A 1T44A 3O80A 4A59A 4BRQA 4CZHA 1IJJA 4WCEL 2P9SB 2VCPA 3ENOA 3LDOA 1TYQB 4JKGB 3TTCA 4CD3A 4KH5A 3TSUA 5FPNA 4H0VB 4FSVA 2RE2A 2JWLA 3LM2A 1BWFO 4JHDA 3CETA 3H6EA 5E26A 3GDQA 3ZEUB 1ZXOA 3VTHA 4Y0WA 1ATRA 2ZJRL 4CZJA 4WFNL 2HBLA 3K9JA 4IO8A 3VEZA 5CHIA 3VEWA 2YJEA 3KWGA 2A3ZA 3O5BA 4YOUA 4IZ9A 4FPAA 1MDUB 2HF4A 5AZIB 1R59O 4G9ZA 3VMFB 1KXPA 2QM1A 1X3MA 5LJWA 2CGKA 3CPWM 1Q18A 1RGIA 4B1XB 3IKMA 1VAZA 4H5NA 3OA9A 4WQ5C 2P9KB 2PBDA 1LCUA 1KQSM 3ULEB 2YHWA 3H3OB 5EY4A 3QBXA 2QWOA 2Q31A 4M63C 1VQON 1YUWA 1BOTO 4BRPA 3D6RA 3CJCA 2A6AA 5AQWA 1Q7YO 3CF5L 5GAGP 4ILJA 2WBNA 3BF1A 2P9IA 4CZLA 5GIOA 4JKDA 2ZJPL 3EN9A 5EOYA 5FPDA 3O9RA 3R3LA 4NB4A 4WQ4C 3VPZA 5GINA 3A8YA 3DXKB 3N4QA 2E2QA 2Q0RA 1QHAA 3L0QA 3VENA 2CGJA 3D2EB 3CCJN 5M1OA 3MN5A 3GE1A 3IDHA 2JWKA 3CC2N 1ATNA 4J8FA 4OO1J 1E4GT 3A0IX 1RDWX 3HTVA 3TPQA 3WEEA 3MDQA 4KH6A 4B1YB 4PL7A 2J4RA 5CR4A 3N4PA 4FOIA 4ILGB 2QXLA 5JICA 4HWIA 3FE1A 3OBYA 4BC3A 4CBUA 1KAYA 4H5VA 1GLEG 2P9LA 1S72N 3ID8A 4MLHA 1YF5L 3H45C 4OPAA 3U8XA 5BRDA 3CCMN 1SZ2A 4YOVA 1ESVA 4H0PA 2HOEA 1ATSA 5FPEA 2BTFA 4JD2A 4BRKA 4CZEA 2YCHA 1VQ4N 1VQNN 2QEXN 4DHYA 1Q86O 3WXKA 1K8KB 5AQRA 2P9UA 4EHUA 3JS6A 4K42A 1VQKN 4C23A 1WUAA 1K73O 3AY9A 1W2BM 4NLBA 2NLXA 2HF3A 4BR7A 1NM1A 3NVKA 4XH1A 4U67L 4H03B 1YITN 1D4XA 3O1BA 2F9WA 5AQIA 4AM6A 4QS7A 3MWPA 3TSQA 5KPTA 3QFPA 4BRIA 4BC5A 3HOSA 3O6WA 5C0YA 3BUZB 4YDUA 3RSEA 3CQXA 4A2AA 4ILHA 1K9MO 5JLHA 3WQUA 2E2PA 4MLEA 1K8AO 5KQ8A 4GNIA 4BRAA 3C7NA 1Q81O 3DAWA 4BR5A 2QWMA 4H5TA 3OW2M 2A40A 3QBWA 5EXWA 1KAXA 5EX5A 4WFBL 3CPEA 3IUCA 5FPMA 5C2FA 4BR9A 3ZX0A 5JMVA 3G25A 5KPZA 4NO7A 2Q1NA 2BUPA 3C0BA 4I6MA 5AZJA 1GLLO 2ZGZA 4IJAA 3SLCA 3VEOA 3LM9A 4BRNA 5DM6L 1ILYA 3RVCA 3UKRA 3E9OA 4IOCL 2D0OA 3QFUA 1NGAA 3CJBA 3O9UA 3Q7CA 4GY2B 3SK3A 4IOAL 1RFQA 4BRGA 3CCSN 1VQLN 1YIJN 1U2VA 3S41A 1TUYA 2QWLA 5JVGL 3EO3A 3EKUA 3O9TA 4IJNA 3ZYYX 3O9SA 1HX1A 1DKGD 1HUXA 2CGLA 1C0FA 4BRCA 3TSPA 3GL1A 2HBJA 1O13A 4BRFA 4IDHA 1QQMA 4BROA 2ZWHA 3PLAA 3WUHA 2E1ZA 3MN6A 4F9OA 5BPNA 5HL7L 1J6ZA 4CBXA 3VERA 5BN8A 4M7XA 4FWOA 2OTJN 3LDPA 4ISEA 2KKZA 3VF6A 1BO5O 4BRLA 2ASPA 3O4WA 3Q7BA 3SAGA 2E88A 1DT9A 4JHDB 3SJHA 2P9SA 3P31A 4AM7A 5AQXA 4RWTA 1YI2N 3QB0A 1NGCA 4DQ8A 2CH6A 5EVZA 3J8AA 3ZETB 3LDNA 3IMXA 4K41A 4GV9A 4GV6A 2EWSA 2KLAA 5JVHL 5M1QA 3UB5A 2GWKA 3UE5A 2QWPA 3GOIA 4EAHD 4CBWA 2FXUA 2QW9A 4WQ5A 2IVNA 3D2FB 4L3QA 5LJVA 1QQOA 3U4LA 3SAHA 4UY8O 1M1KO 5E84A 1KC8O 3CC7N 4BG8A 2H3GX 4FWNA 3B8AX 5AZIA 1V4TA 4BC4A 1VQ8N 2V7YA 4BR0A 2A42A 4PKHA 2OTLN 5TKYA 3ENHA 4A5AA 2HMPA 4E1JA 2GWJA 5I9EB 5TKWA 5C15A 3PIPL 3SMSA 5ADXH 5ADXA 3ATUA 2E2OA 4XEIA 2YJFA 3M3ZA 3T69A 3I8BA 1WOQA 4CZIA 1EQYA 3KWIA 3UKUA 3CJ9A 4JK9A 5AQJA 5AQGA 3A5NC 4FOEA 3WXJA 2P9PB 4XH5A 2QA4N 1LOTB 5AQFA 5AQVA 3SBTA 2WUSA 4JNEA 4ISFA 5C12A 3SAFA 3ZX3A 3NMUA 5KQDA 2FSJA 1QVFM 3WEEB 2VGMA 3KVGA 5LY3A 3DXKA 3VGKA 5HOOA 5F2RA 5AQYA 3MK6A 4RTFD 3DXMB 2FSKA 3D2EA 3W0LA 2FF6A 3CCLN 3K9KA 3TTDA 4JK7A 4BRMA 2ZJQL 4KBOA 2P9LB 4WYBA 3HZ6A 1HKGA 3EZWA 3AAQA 4DKWA 2GX9A 3CERA 3HM8A 3G71N 3AARA 1VQ6N 3CMEN 3LL3A 5KPRA 3H1VX 3FGUA 1XC3A 3C6HA 3WXLA 1SQKA 4YOTA 1NGBA 2V7ZA 2P9UB 4EIAA 3VGMA 3O9QA 4BREA 4EFHA 2P9NB 4FWLA 1NBWA 2RHKA 4IEEA 3CCRN 3H3NO 5AFUH 1X3NA 4BRDA 2ZGYA 2FLOA 3MX5A 3NVMA 4Z94A 3FR0A 3GG4A 1K8KA 3KK7A 3L4QA 3MX2A 1U6ZA 4HTLA 5BR9A 1SAZA 1H1VA 3A5MC 1CZAN 3BP8A 3C65A 3I33A 4H0XB 4AF1A 3FZLA 3TTFA 4WF9L 3ZX2A 4WFAL 1E4FT 4H5WA 3JXUA 3FZMA 4H5RA 2VGNA 3QDKA 2Q36A 2QWQA 4PKIA 3EE9A 4JK8A 3C7NB 3I55N 1GLJO 3WXIA 3W3DA 2E1YA 3MWTA 1YVNA 5GAEP 4O8KA 3P4IA 3VOVA 4YOYA 2ASMA 2QWNA 4KH4A 4MDAA 4C1NK 1V4SA 2ZF5O 3P39A 3MCPA 4FO0A 2Q2RA 3DWLA 5AQPA 5B8HA 4CZFA 4BQLA 2PFUA 4I6MB 4CD1A 1OKJA 2YI1A 4GVEA 3VETA 1P90A 4IOXA 3R1XA 4YDUC 3CXCM 5DM7L 1QQNA 3C6AA 4K43A 3CCVN 2ASOA 5M1PA 4B1VA 1Q82O 5AR0A 4BY9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA9 A;  3EE9 A;  3O9Q A;  2RHK A;  3D6R A;  2KKZ A;  3RVC A;  3P39 A;  3M5R A;  3O9U A;  3P31 A;  3F5T A;  3KWG A;  4OPA A;  3L4Q A;  3O9R A;  3O9T A;  3EE8 A;  3O9S A;  4OPH A;  2GX9 A;  3P38 A;  3KWI A; 
#chains in the Genus database with same CATH topology
 4FVM A;  4DSL A;  3GBT A;  3M8R A;  3CQY A;  3AO1 A;  3AVK A;  1NGJ A;  3CJ1 A;  3AV9 A;  1C1C A;  4DTM A;  4GVM A;  2YNH A;  4E7H A;  4M41 A;  4CJR A;  4JAX A;  1DGK N;  4AHS A;  3NDK A;  1VHX A;  2HB5 A;  4JKG A;  4I2Q A;  5KI6 A;  4X66 K;  1N8R O;  1LWC A;  2NUB A;  3ENB A;  2FF3 B;  4FZZ A;  3ZEU A;  1X9J A;  3THX A;  4EP5 A;  2IVO A;  4F3O A;  4IEI A;  1NJW A;  4H0T B;  4LFC K;  5F1X A;  3V9X A;  4A2B A;  3QET A;  2UYT A;  4FK4 A;  1N32 K;  3M5R A;  3ZCM A;  3VTI A;  2D0P A;  3SZ2 A;  4XH4 A;  4FZX C;  2P9I B;  1NGF A;  4EP4 A;  2Q97 A;  3THY A;  4AHV A;  1D9F A;  1HJO A;  4O8U A;  3TAG A;  3QEI A;  3HYF A;  3JAM O;  3UKU B;  3BY5 A;  3HSC A;  5M1K A;  3LAL A;  1ZBF A;  3O3F A;  3QEP A;  5AQZ A;  1X9S A;  2YNG A;  3U3G A;  5JS1 A;  4PL8 A;  1GLC G;  5FDL A;  3EE8 A;  1T6D A;  4OPH A;  3M6G A;  4CFC A;  1S1V A;  2AA4 A;  3SCX A;  3ZT4 A;  3CCQ N;  1BUP A;  1XUP O;  2UUC K;  5AQM A;  2E20 A;  3CD6 N;  1BGX T;  1VQ7 N;  2O8C B;  4JKH A;  4B9Q A;  4KTZ A;  1WSF A;  5C24 A;  4PA1 A;  4IFE A;  2OZM A;  3DOK A;  3AGR A;  4YOX A;  1P8Z A;  1S22 A;  3VES A;  1MWM A;  1TL3 A;  4KFB A;  4BRH A;  2YX6 A;  2OPR A;  4YNQ A;  1RDU A;  3ZSZ A;  2I7N A;  5AQL A;  5F0X A;  4B9N A;  3CIP A;  1RDB A;  1TKZ A;  4CGG A;  3A5L C;  1J5E K;  3CFP A;  3F5T A;  5AZJ B;  2HHX A;  3UKR B;  4DWI A;  1IBL K;  1RDA A;  1ASV A;  2HHQ A;  2D1K A;  3VEX A;  1BA0 A;  3HRG A;  2IDO A;  4O0I A;  1YXQ A;  1NJI O;  2YKN A;  4I2P A;  5AQS A;  3FZF A;  1QSL A;  2D4W A;  4CFD A;  1KRP A;  4MO4 A;  4R79 A;  3MCA B;  4PKG A;  2YHX A;  3I56 N;  2BE2 A;  1JLB A;  4E7J A;  1TK0 A;  1JL2 A;  2HNZ A;  3HPG A;  4FJ9 A;  4H0V B;  4DS4 A;  1BI4 B;  2Y1I A;  5JS2 A;  4FJN A;  3BDP A;  1TKT A;  1RT5 A;  1ATR A;  3QES A;  1RBV A;  2HBL A;  3K9J A;  3VEW A;  3KWG A;  4JI1 K;  2A3Z A;  4YOU A;  3P83 D;  1C0U A;  2HF4 A;  1R59 O;  1RTD A;  4G9Z A;  1XHX A;  1KXP A;  4E7L A;  1X3M A;  1HMV A;  4NYF A;  5LJW A;  2CGK A;  5HRS A;  1Q18 A;  4W5O A;  2P51 A;  5FLX O;  4DQR A;  3K5L A;  5EY4 A;  4M63 C;  4OX9 K;  3EYZ A;  4DV3 K;  3L8B A;  4YHH K;  3D6R A;  2HHW A;  5SWM A;  3M8S A;  5FRO A;  5GIO A;  4HTU A;  2G8I A;  2ZJP L;  5DK5 A;  5FPD A;  2OPS A;  4FJX A;  2KZZ A;  1I39 A;  3N4Q A;  1QQC A;  3OYK A;  2E2Q A;  2Q0R A;  1QHA A;  3VEN A;  3D2E B;  3KTQ A;  3J7A P;  4HCC A;  2IC3 A;  3N4P A;  4FOI A;  2QXL A;  4CEO A;  2PY5 A;  1FK9 A;  4HWI A;  3TR8 A;  2P9L A;  5HRP A;  3ZLJ A;  4DSK A;  4YOV A;  1ESV A;  4H0P A;  2HOE A;  3K5O A;  2UXD K;  4BRK A;  4CZE A;  2A1R A;  1VQ4 N;  2Z1I A;  1XHZ A;  1Q86 O;  3LWM A;  4FJJ A;  1VQK N;  1QS4 A;  1WUA A;  3AY9 A;  1Z26 A;  3NH0 A;  1Y97 A;  4H03 B;  1VRU A;  1D4X A;  2HHV A;  3V81 A;  4CES A;  1FKP A;  4E0D A;  2ITG A;  1S9E A;  4C8K A;  3HOS A;  3O6W A;  1RCH A;  5C0Y A;  4CFA A;  4YDU A;  3G10 A;  3RSE A;  3K58 A;  4ILH A;  4MLE A;  3SI6 A;  5KQ8 A;  4BRA A;  4CHQ A;  4BR5 A;  4LF6 K;  2A40 A;  1SUQ A;  4CEQ A;  5C42 A;  4WFB L;  2WOM A;  1KFD A;  1NK5 A;  4OLB A;  3VEO A;  3LM9 A;  4IG0 A;  4CGD A;  3OS0 A;  5FRM A;  3ZSR A;  3NE6 A;  2D0O A;  3QFU A;  2HHU A;  1NGA A;  4IOA L;  4CJT A;  4BRG A;  3CCS N;  3WNH A;  4AHC A;  4FJM A;  4IJN A;  2Y1J A;  3HXM A;  3K0S A;  2CGL A;  4BRC A;  4DTU A;  3TSP A;  2HBJ A;  2OZS A;  1UWB A;  1QQM A;  1ZBL A;  1VSK A;  4F9O A;  4CBX A;  1NJZ A;  2OTJ N;  2O8D A;  3O4W A;  3CM6 A;  4B9T A;  1OVQ A;  4JHD B;  3THX B;  3SJH A;  2P9S A;  4X62 K;  4K8Z A;  4AM7 A;  1TAQ A;  3J8A A;  4DQS A;  2EWS A;  5M1Q A;  2PYJ A;  1WSI A;  3UE5 A;  2QWP A;  2QW9 A;  3LPT A;  1TV6 A;  1SKW A;  4E7I A;  2GBZ A;  1HR0 K;  5E84 A;  2W6L A;  1KC8 O;  3THY B;  4YY3 K;  1DTT A;  1V4T A;  2V7Y A;  4BR0 A;  1LV5 A;  4PUO A;  3ENH A;  4CF0 A;  1HYS A;  4I9Q A;  2E6L A;  4FJI A;  3T3F A;  5TKW A;  2XY7 A;  1B9D A;  4B9V A;  4CEA A;  3T69 A;  3T1H K;  4Z4I A;  1WOQ A;  4CZI A;  3UKU A;  3CJ9 A;  4JK9 A;  5AQG A;  4XH5 A;  2QA4 N;  5AQF A;  4KHU A;  5AQV A;  1NU0 A;  4GMJ B;  4JNE A;  4ISF A;  5C12 A;  1KLN A;  4FLY A;  2VGM A;  3V9W A;  2HW3 A;  4N76 A;  4J2E A;  3DXK A;  4DV6 K;  4BWJ A;  2G8U A;  4NCG A;  3W0L A;  4CER A;  3L2V A;  4BRM A;  4N41 A;  1W9H A;  3AAQ A;  3QEW A;  3HM8 A;  2Z1J A;  3V6D A;  4Q0B A;  2O8C A;  2KTQ A;  3HJF A;  4YOT A;  4OPK A;  3K57 A;  1NJX A;  4CF8 A;  3VGM A;  1DLO A;  2VQE K;  4FWL A;  4B9S A;  5DMR A;  3H3N O;  2UXB K;  2ZGY A;  3C95 A;  3PX0 A;  3GG4 A;  3VA3 A;  1RIL A;  3J7Y P;  1U6Z A;  4BDP A;  3BP8 A;  3THW A;  4H0X B;  3L3V A;  4WF9 L;  4WFA L;  1E4F T;  1RBT A;  1HNZ K;  2Q36 A;  3VQA A;  3P5J A;  3C7N B;  3I55 N;  1WN7 A;  3V9U A;  4M3X A;  2PYL A;  3MWT A;  1YVN A;  2QWN A;  4MDA A;  1LWE A;  2F4V K;  3DLK A;  4CZF A;  4GVE A;  3OYI A;  2X78 A;  1OH8 A;  4FXD A;  4IOX A;  3R1X A;  3JYT A;  3CXC M;  1QQN A;  2QKK A;  1XNR K;  4LFA K;  3NAE A;  2HMI A;  3R9P A;  4CZG A;  3OYM A;  1GOB A;  1YHQ N;  2VWB A;  1VQ5 N;  3AAP A;  4BQZ A;  5KGX A;  1Q9Y A;  4FLV A;  3D7E O;  3LP2 A;  1EWQ A;  1BQM A;  3FFK B;  1YJW N;  5BPM A;  3L4I A;  1C0G A;  3CFO A;  3U6F A;  1N33 K;  1BI4 A;  4E19 A;  3UIQ A;  4LF9 K;  4M3T A;  2XY5 A;  3F2K A;  1GLD G;  4DR2 K;  2WC9 A;  4IWV A;  4RW6 A;  1JLC A;  3RRG A;  4FL9 A;  4PQU A;  3CHW A;  3KD5 E;  3SQ4 A;  3L2W A;  3ZET A;  4ZTF A;  4Y1D A;  4BDY A;  1IV0 A;  2V51 B;  3FZK A;  4CZK A;  4HUE A;  3DI6 A;  2O8F B;  3AVI A;  1RBR A;  2X6N A;  2NZT A;  1RTI A;  4B1W B;  4CED A;  3EL2 A;  3FZH A;  4A5B A;  4AHU A;  4O44 A;  2AP1 A;  2BH1 A;  3D45 A;  4JI7 K;  4J2B A;  4BR2 A;  4E1M A;  1LWF A;  3B6P A;  4DB3 A;  1WB9 A;  3LAM A;  1KAZ A;  5AQU A;  3KJV A;  1HPM A;  2R7Y A;  1TKX A;  2KZM A;  1JLG A;  3VEY A;  3E9L A;  1NGD A;  2X74 A;  4H0Y B;  4F2S A;  4IXC A;  5BPL A;  4B9U A;  4M3W A;  3AA4 A;  2WTU A;  2D5R A;  1EO1 A;  1MA9 B;  2F7T A;  3U9D A;  4BVO A;  1SS6 A;  4C1N I;  1BDG A;  2P9P A;  1HKC A;  5GAD P;  4QS9 A;  3O3G A;  1QVG M;  1LAW A;  1T6C A;  3RRH A;  4KI6 A;  4CK3 A;  1QZ5 A;  2F9T A;  3HI0 A;  4FWS A;  4CF2 A;  1OVY A;  3L3U A;  2NRZ A;  4CHN A;  4OKJ A;  4GV3 A;  4H0O A;  4JRQ A;  3WT0 A;  3EZ5 A;  3T7Z A;  3TU5 A;  3LDL A;  4X64 K;  1VQM N;  4FJ7 A;  1T3V A;  2E8A A;  2BDP A;  2KW4 A;  2WFB A;  3QIC A;  3QIP A;  3WNE A;  4LC9 B;  1FW6 A;  3IFR A;  3RSE B;  4RW9 A;  4HVJ A;  3ZT3 A;  1IG8 A;  5GIP A;  2IGI A;  3MEE A;  4NLC A;  2W42 A;  4FZY A;  3HOT A;  3VQ7 A;  4CK2 A;  2B4J A;  3KHY A;  1C6V A;  4DCH A;  5SZT A;  1YT3 A;  1IBK K;  1NGE A;  4B9M A;  1EP4 A;  3R8E A;  1NGG A;  1QZ6 A;  4LF8 K;  3BGR A;  5LMU K;  1VSF A;  1LW2 A;  4DF8 A;  5AQQ A;  4U7B A;  1N34 K;  1TUU A;  2KFN A;  3J80 O;  3BEX A;  2DPN A;  1BA1 A;  2Z1H A;  1XMQ K;  4O5F A;  3VQP A;  4HHT A;  4NCA A;  5AQN A;  2O8D B;  4X65 K;  1RT6 A;  1Z6R A;  1B92 A;  3HVT A;  4CE9 A;  4BRQ A;  4C8N A;  3TAB A;  4DQP A;  2P9S B;  4DR7 K;  2VCP A;  4M3Z A;  3ENO A;  1TYQ B;  1RT7 A;  3KD1 E;  1NOY A;  5FPN A;  2JWL A;  1BWF O;  4JHD A;  3OYE A;  3WNG A;  3H6E A;  4JI5 K;  4E3S A;  4OPJ A;  3VTH A;  2LSN A;  5C25 A;  4CZJ A;  4WFN L;  3TAR A;  4K0K K;  4IO8 A;  5CHI A;  1S6P A;  3O5B A;  4DFJ A;  1MDU B;  2IOC A;  3VMF B;  2QM1 A;  3IAY A;  4KAZ A;  4I9L A;  4Z0U A;  1RT1 A;  3CPW M;  4FJL A;  3IKM A;  1GOC A;  4H5N A;  2HND A;  2P9K B;  2PBD A;  1LCU A;  4O0J A;  1KQS M;  3ULE B;  2YHW A;  3H3O B;  4JS4 A;  1BHL A;  4MQ3 A;  2GUI A;  4O55 A;  2P1J A;  1RDC A;  4BRP A;  3OTO K;  3CF5 L;  5GAG P;  2F8S A;  3QER A;  4CGH A;  3VPZ A;  5GIN A;  3A8Y A;  3DXK B;  3MXJ A;  4DQQ A;  3CC2 N;  4J8F A;  4KHN A;  4OO1 J;  4PL7 A;  4KH6 A;  2J4R A;  4DU4 A;  1I3A A;  3FE1 A;  1KAY A;  4H5V A;  4GKJ K;  4KRF A;  4OPA A;  3U8X A;  5BRD A;  2GV9 A;  4KO0 A;  3TAF A;  4KTW A;  3CG7 A;  3OYL A;  3WXK A;  5HRN A;  3CM5 A;  4C23 A;  4CEC A;  3THW B;  4BR7 A;  1NM1 A;  3NVK A;  3AVH A;  1JXE A;  4JI6 K;  4BE0 A;  1L3V A;  3LP0 A;  2F9W A;  1VK0 A;  4R5P A;  4KTQ A;  5KPT A;  4BC5 A;  4FJG A;  4GKK K;  4JYA K;  2D0B A;  2XY6 A;  1W0H A;  3RWU A;  2AJQ A;  3AVC A;  4A2A A;  1K9M O;  1EX4 A;  4DS5 A;  5JLH A;  3WQU A;  3LZJ A;  4GNI A;  3C7N A;  1BIZ A;  4QOZ B;  3T19 A;  1T05 A;  3LDS A;  1ASW A;  3ZX0 A;  5KPZ A;  3NFA A;  5LMN K;  4BRN A;  3SLC A;  2JLE A;  3SQ1 A;  3E9O A;  1N36 K;  3O9U A;  3VQQ A;  1F21 A;  3S3N A;  1RFQ A;  3LP3 A;  1RTJ A;  1U2V A;  4H4M A;  2QWL A;  1CZB A;  3O9T A;  2ATQ A;  1TKD A;  3RMC A;  1HX1 A;  4ZTJ A;  1HUX A;  2G8H A;  4BRF A;  3ZT1 A;  4BRO A;  4FM1 A;  2XRI A;  3PLA A;  5HL7 L;  1J6Z A;  1BCM A;  4CJQ A;  3NF7 A;  2QXF A;  3LDP A;  3I8D A;  3Q7B A;  1DT9 A;  4RWT A;  3AA3 A;  4IFV A;  3QB0 A;  3ZET B;  3IMX A;  4L8R B;  3OY9 A;  3AVL A;  3VQ8 A;  3UB5 A;  1TK5 A;  5D3G A;  2UUA K;  4WQ5 A;  3HPO A;  1QE1 A;  3U4L A;  2O8F A;  4AHT A;  4LF7 K;  4PWD A;  3B8A X;  2OTL N;  5TKY A;  4A5A A;  4E1J A;  4CGJ A;  1WSE A;  5I9E B;  3BZK A;  3PIP L;  4DTS A;  3SMS A;  5ADX H;  4N5S A;  3ATU A;  4Z4F A;  4XEI A;  3M3Z A;  3VQ9 A;  1EQY A;  3KWI A;  3WXJ A;  2P9P B;  4OLA A;  1VSE A;  4G1Q A;  1REV A;  3SAF A;  3NMU A;  3ZX3 A;  3ZSX A;  2FSJ A;  1QVF M;  3WEE B;  3MEC A;  3KVG A;  4KKO A;  5LY3 A;  3VGK A;  1IG9 A;  4FYD A;  4FJK A;  5AQY A;  3MK6 A;  2YKM A;  3K9K A;  1WAF A;  5AJ3 K;  3MXM A;  3AVM A;  4KBO A;  1NKB A;  2GX9 A;  3CER A;  3G71 N;  3PY8 A;  1VQ6 N;  3FGU A;  4ICL A;  1XC3 A;  3C6T A;  3ZT0 A;  1SQK A;  4EIA A;  4B3S K;  1NBW A;  2RHK A;  2W6K A;  3CCR N;  1X3N A;  2FLO A;  3QIO A;  1FXX A;  3FFI A;  4Z94 A;  4CHP A;  2E5L K;  1SAZ A;  1H1V A;  4NCB A;  1ITG A;  1CZA N;  3C65 A;  4W5N A;  1EWR A;  1QHT A;  4H5W A;  3OYG A;  3JXU A;  2UUB K;  3F73 A;  3OJS A;  3QDK A;  4RW4 A;  4F8R A;  1NOZ A;  4JK8 A;  1IKX A;  4DUZ K;  3WXI A;  1C0T A;  2F8T A;  4JV5 K;  4O8K A;  4C1N K;  2ZM6 K;  1SL2 A;  3P39 A;  3MCP A;  5B8H A;  1MU2 A;  4CD1 A;  3VET A;  3OS1 A;  1SL1 A;  1FJG K;  5DM7 L;  1UOC A;  4K43 A;  4WE1 A;  3SQ2 A;  5M1P A;  1JKH A;  1RT2 A;  4B1V A;  1KD1 O;  2YHB A;  1M90 O;  3SPZ A;  4DLE A;  5BN9 A;  1JXB A;  3OJU A;  4CK1 A;  4BG9 A;  3EKS A;  3ITH A;  3HVR A;  4UQG A;  4DSJ A;  5AQT A;  1NGI A;  1MWK A;  3S3O A;  3CQ8 A;  2G8W A;  4CJ7 A;  4E89 A;  1VQ9 N;  2PAV A;  1U45 A;  4DR4 K;  1TYQ A;  3PO5 A;  3CCU N;  3CI5 A;  5ELZ A;  3DLL L;  1S1W A;  1KTQ A;  2P5G A;  2VYP A;  2FBX A;  2RKI A;  1S1U A;  4CVN E;  4FWM A;  3VQ4 A;  3V1Q A;  2YHY A;  1RBU A;  4K25 A;  1S9G A;  4IFY A;  3NH2 A;  2HST A;  1TVR A;  3CCE N;  5MLC Q;  3VQ5 A;  2QTD A;  2NRX A;  4FJ8 A;  4M3U A;  3BF3 A;  1IKV A;  3AO2 A;  2NRW A;  3CC4 N;  4BVP A;  1KLM A;  1JCG A;  4QS8 A;  4KB1 A;  3ZSO A;  2P9K A;  1NJY A;  4H8K A;  4FWQ A;  3P38 A;  4JKC A;  4MDB A;  3ULE A;  4B1U B;  1XMO K;  4ZHR A;  4Z4G A;  1U47 A;  1XI1 A;  5CYM A;  4YOW A;  4B3T K;  3CJA A;  3F9M A;  1L3S A;  4ISG A;  1XQS C;  3MN7 A;  4BC2 A;  1VSJ A;  2ZE2 A;  2QI2 A;  3KIO A;  3J7Z O;  4DTJ A;  3MN9 A;  2W41 A;  2DFF A;  5KTQ A;  3ZSY A;  3U9Z A;  1JJ2 M;  4A61 A;  5M1F A;  2G8K A;  2A41 A;  4M7Y A;  4KV8 A;  4LF5 K;  3ZSQ A;  5BRE A;  2DTU A;  2XO7 A;  4F3T A;  3DXM A;  3KK2 A;  2CH5 A;  1J9A A;  4CJW A;  5H1S Q;  5HRO A;  4F4K A;  5AFU A;  2A5X A;  1BU6 O;  4DV7 K;  1VSI A;  3SUQ A;  3E66 A;  4EHT A;  5T7B A;  1W97 L;  1D9D A;  4FJ5 A;  3KLE A;  1NLV A;  5AQH A;  3V9Z A;  1YTA A;  4RG8 A;  5CE3 A;  3DLE A;  5IT9 O;  2P9N A;  3HP9 A;  1NMD A;  3ZT2 A;  1YJN N;  2NRH A;  2IVP A;  2NRT A;  4FM2 A;  1CXU A;  3L6Q A;  4FWK A;  4KHS A;  4DU1 A;  4IO9 L;  3THV A;  2YHA A;  4DV0 K;  5C10 A;  3TAP A;  1E3M A;  2HHT A;  3MXI A;  4YOR A;  3DLH A;  4FWP A;  5AQO A;  5AQK A;  4FVU A;  3LAK A;  4FK2 A;  1BG3 A;  5I42 A;  2IS3 A;  1KCF A;  4BGA A;  2YV0 X;  2W40 A;  4CF9 A;  3O3H A;  3FLC O;  1GLA G;  1U2V B;  1OH6 A;  4OJR A;  4EZ6 A;  2Q0U A;  2VQF K;  5M1N A;  3S3M A;  4IBN A;  1BL3 A;  1FKO A;  3E9P A;  5C2D A;  4B3M K;  1HNW K;  3LZI A;  4Z4H A;  2GTD A;  2NRR A;  3R6M A;  3PSI A;  2EHG A;  3LDQ A;  3NCI A;  3TI0 A;  1NK9 A;  4FLZ A;  3P1G A;  1T44 A;  3O80 A;  4A59 A;  4CZH A;  1IJJ A;  4RW8 A;  2BGG A;  1NK8 A;  4FLU A;  3LDO A;  2HHS A;  4CD3 A;  3TSU A;  3D0P A;  1DTQ A;  2RE2 A;  4FSV A;  3LM2 A;  2A1S A;  1J53 A;  4H4O A;  3CET A;  1ZXO A;  3LAN A;  2ZJR L;  2FBV A;  3OYF A;  1RT3 A;  3LWL A;  2YJE A;  4DFM A;  1ZBH A;  3K59 A;  1U49 A;  2O4I A;  1RGI A;  4WQ5 C;  3OA9 A;  5CYQ A;  2QK9 A;  1IH7 A;  4B3R K;  3KLG A;  3MAQ A;  1S6Q A;  1BOT O;  1D5A A;  3CJC A;  2A6A A;  1Q7Y O;  1L3T A;  4ILJ A;  2WBN A;  1O1W A;  3BF1 A;  4HUF A;  3KKS A;  4ID1 A;  3EN9 A;  3O9R A;  3R3L A;  4WQ4 C;  1Z25 A;  3J81 O;  4N56 A;  1U04 A;  2DFE A;  2FBT A;  4HUG A;  3S9H A;  4NXN K;  3L0Q A;  2CGJ A;  3CCJ N;  5M1O A;  2F96 A;  3MN5 A;  1BCO A;  3GE1 A;  3IDH A;  2JWK A;  3M8Q A;  3E01 A;  1E4G T;  3A0I X;  1RDW X;  3HTV A;  3TPQ A;  3WEE A;  4B1Y B;  4ILG B;  3K2P A;  1RBS A;  1WLJ A;  5JIC A;  3RMA A;  1JLE A;  4CBU A;  3KLF A;  1GLE G;  4Z4C A;  3ID8 A;  1YF5 L;  3H45 C;  4DUY K;  1SV5 A;  4F2R A;  3VQC A;  2QKB A;  3SQ0 A;  1SZ2 A;  1SKS A;  4K8X A;  4DR3 K;  3VN5 A;  4JD2 A;  5HP1 A;  1VQN N;  4RW7 A;  1U4B A;  1J54 A;  4AH9 A;  5AQR A;  4Y1C A;  1NKE A;  4NLB A;  2HF3 A;  1Q9X A;  4XH1 A;  4U67 L;  4KRE A;  3SV4 A;  4DU3 A;  1YIT N;  3O1B A;  3AO3 A;  4AM6 A;  4QS7 A;  3MWP A;  3QFP A;  4BRI A;  2YNF A;  4J2D A;  2FC0 A;  3BUZ B;  4KHQ A;  3ZSW A;  1K8A O;  2E2P A;  4NYN A;  1A5X A;  2QWM A;  4H5T A;  4CJK A;  3OW2 M;  3QBW A;  4BE2 A;  1X9M A;  3CPE A;  3IUC A;  5C2F A;  4BR9 A;  5JMV A;  2Q1N A;  2BUP A;  4IJA A;  4DG1 A;  3RVC A;  4IOC L;  3CJB A;  3Q7C A;  1BIS A;  1VQL N;  4LD0 A;  4B3O A;  5EU7 A;  3S41 A;  1KFS A;  3EO3 A;  4DV4 K;  3VQE A;  3ZYY X;  1X9W A;  3O9S A;  3KLI A;  1TGO A;  3L2R A;  3VQD A;  3O4N A;  4CJ4 A;  5J2P A;  3AVN A;  1SL0 A;  3WUH A;  2DY4 A;  3MN6 A;  3IG1 A;  2ZD1 A;  4Q5V A;  4C8M A;  4DTN A;  4FWO A;  3AVA A;  2KKZ A;  3VF6 A;  1BO5 O;  2ASP A;  3SAG A;  4JI0 K;  4KHP K;  4JRP A;  1NK0 A;  1YI2 N;  5AQX A;  5EVZ A;  3LDN A;  4GV9 A;  4KI4 A;  2G8V A;  2O8B B;  3VQ6 A;  4EAH D;  3GOI A;  4CBW A;  2FXU A;  2IVN A;  5IWA K;  4L3Q A;  1OH7 A;  3OYB A;  3DLB A;  3WNF A;  1N5Y A;  2XHB A;  1T8E A;  1HNX K;  3SAH A;  4UY8 O;  3RMD A;  4BG8 A;  2H3G X;  3PUF A;  4JLH A;  5AZI A;  4BC4 A;  1VQ8 N;  2A42 A;  4QAG A;  2HMP A;  3QIN A;  1KVC A;  5C15 A;  3T1A A;  4CJU A;  1KVA A;  2YJF A;  1C0M A;  3I8B A;  1WBD A;  4ELV A;  3NGY A;  1JLF A;  1RDD A;  3OYD A;  1CZ9 A;  1B9F A;  1CXQ A;  4FOE A;  5CY4 A;  4W5Q A;  3NH1 A;  5J2Q A;  1NMN A;  5KQD A;  5FRN A;  2E4L A;  2VWK A;  3DRR A;  3OYH A;  3DM2 A;  5HOO A;  3TAE A;  3AVJ A;  1HRH A;  4RTF D;  1LW0 A;  3DXM B;  2FSK A;  3DOL A;  3CCL N;  3TTD A;  4JK7 A;  3HZ6 A;  1KVB A;  1HKG A;  4OKK A;  3KK1 A;  3QNN A;  1KSP A;  3AAR A;  1TK8 A;  4ID5 A;  5KPR A;  3OS2 A;  1C1A A;  3DLG A;  2OPP A;  4MFB A;  2V7Z A;  2P9U B;  4BE1 A;  4AQY K;  3O9Q A;  4AIL C;  4BRE A;  4EFH A;  2P9N B;  4FJH A;  5AFU H;  2G8F A;  4BRD A;  4CEF A;  3MX5 A;  3DYA A;  3FR0 A;  1K8K A;  3KK7 A;  3L4Q A;  3MX2 A;  4HTL A;  3TAM A;  3A5M C;  1HJR A;  2XY8 A;  1HNV A;  3I33 A;  4Z4E A;  1TL1 A;  4AF1 A;  3FZL A;  3TTF A;  4PKI A;  3EE9 A;  3QEV A;  1NNE A;  2E6M A;  3P4I A;  1V4S A;  2ZF5 O;  2DFH A;  4FO0 A;  4KPY A;  2Q2R A;  3MEG A;  2PFU A;  4I6M B;  3PSF A;  1OKJ A;  2YI1 A;  3SNN A;  1P90 A;  3KK3 A;  4CIE A;  4QCL A;  4YFU A;  4M3Y A;  1BQN A;  4BY9 C;  4CJ3 A;  3M1F A;  3TAN A;  4FWR A;  1L5U A;  3VEV A;  3V1R A;  1S3X A;  1NGH A;  3HP6 A;  1DEJ A;  4DFP A;  3KZB A;  4OGE A;  4JKB A;  4CZM A;  4DQI A;  2NNW A;  1HYV A;  3O4Q A;  3G6E N;  4CFB A;  3TAQ A;  3ID6 A;  5JLF A;  4FLW A;  4A57 A;  4CJP A;  1OH5 A;  1QTM A;  4CW7 B;  1T7P A;  1JLQ A;  3EEQ A;  2GUP A;  2QWR A;  3KLH A;  4RCH A;  3DRP A;  2NRV A;  4DSI A;  3G0Z A;  3VA0 A;  1ZBS A;  3AO5 A;  4JEP A;  4CIG A;  3SUN A;  4CJF A;  3CMA N;  1HLU A;  2FBY A;  1L3U A;  2V52 B;  2VWJ A;  4LSL A;  3RR8 A;  4WQ4 A;  3D2F A;  3CJ7 A;  1S1X A;  5BRH A;  3LP1 A;  1Z05 A;  3OBW A;  2OYQ A;  5HBM A;  4LF4 K;  4JKE A;  4BGB A;  4OKE A;  3T1Y K;  1HKB A;  3QML A;  4LFB K;  3MMV A;  3ATV A;  3QO9 A;  4LSN A;  4CGF A;  3HT3 A;  1EET A;  1XNQ K;  3BZC A;  3RMB A;  2KQ2 A;  4CI6 A;  2FSN A;  2I7P A;  2ITM A;  2HBK A;  3WQT A;  1NK4 A;  2X6S A;  1YAG A;  3AVG A;  4B1Z A;  4FM0 A;  1WBB A;  3RTV A;  3OYN A;  1GLB G;  3PIO L;  4DSE A;  2RF2 A;  2PZS A;  2IIR A;  1JCE A;  3K5N A;  3O1W A;  4E7K A;  4JI3 K;  3HBT A;  4GW6 A;  3SMP A;  3VGL A;  4JD2 B;  5HLF A;  2OPQ A;  3A5O C;  3O08 A;  2HNY A;  1GLF O;  4DTP A;  1NG9 A;  5A2Q O;  1ASU A;  1G99 A;  2VG5 A;  4CJ5 A;  3H1Q A;  4BR4 A;  4O4G A;  4AHR A;  3G4S N;  1ZC6 A;  3HM9 A;  4JKF A;  4MO5 A;  3SBG A;  3DJC A;  3E1Y A;  2I5J A;  3NF8 A;  2GEL A;  5KRT A;  3ZSV A;  1WNS A;  2OA8 A;  4DR5 K;  4J2A A;  1YJ9 N;  3VF2 A;  5J1E A;  1Y64 A;  4JKA A;  5GAH P;  4PHT X;  1UAX A;  1HQE A;  3L2Q A;  4E1N A;  3HK2 A;  3VQB A;  1N6Q A;  3O8M A;  2O8E B;  2KHO A;  3VF4 A;  2OAN A;  4DV5 K;  2HBM A;  3NHG A;  3WXM B;  3I0S A;  2GEM A;  3OHR A;  3H46 O;  1JCF A;  3AGK A;  1VQP N;  1NWK A;  4JN4 A;  4O5B A;  4FPB A;  2E2N A;  4B8A B;  3SV3 A;  1SKR A;  3AVF A;  4V19 S;  2YNI A;  5BRF A;  1RT4 A;  4CEE A;  1JLA A;  1NK6 A;  4LH4 A;  4FLT A;  3F9K A;  4DF4 A;  4M45 A;  2UXC K;  1BIU A;  4A62 A;  4WCE L;  1C1B A;  5CZ2 A;  3PX6 A;  2P5O A;  2ETJ A;  4JKG B;  3TTC A;  4KH5 A;  1WSJ A;  3JSM A;  5E26 A;  4CJV A;  3GDQ A;  3ZEU B;  4C8O A;  4Y0W A;  4OVL A;  3VEZ A;  3ULD A;  4KB0 A;  2O8B A;  4IZ9 A;  4FPA A;  4DFK A;  5AZI B;  3M8P A;  4KHY A;  1VSL A;  4DV2 K;  1UA0 A;  4DTO A;  4B1X B;  1RNH A;  1VAZ A;  3QBX A;  2QWO A;  2Q31 A;  5J2N A;  3A2F A;  1VQO N;  1YUW A;  5K14 A;  5AQW A;  3NF9 A;  2P9I A;  4I7F A;  3DLR A;  5J2M A;  4CZL A;  3CFR A;  1QSY A;  4M42 A;  4JKD A;  2WON A;  3ASM A;  1X1P A;  5EOY A;  4NB4 A;  1JL1 A;  1VRT A;  1A5V A;  5KGW A;  3SUP A;  1IO2 A;  1EXQ A;  2D0A A;  1ATN A;  4PY5 A;  5CZ1 A;  3MDQ A;  5CR4 A;  4FK0 A;  3AA5 X;  1ZBU A;  1QSS A;  1S5J A;  3OBY A;  4B08 A;  4BC3 A;  4DSF A;  5E41 A;  4XIU A;  1S72 N;  2EX3 A;  4MLH A;  3TWH A;  3SUO A;  1J5O A;  5BR8 K;  3CCM N;  4DR6 K;  1ATS A;  4CJS A;  2BTF A;  5FPE A;  3NGI A;  2YCH A;  1GOA A;  4CGI A;  2QEX N;  4DHY A;  3OVN A;  1K8K B;  2Z1G A;  2P9U A;  4EHU A;  3JS6 A;  2D0C A;  4K42 A;  4OGC A;  1K73 O;  4W5R A;  1W2B M;  3NGZ A;  2NLX A;  1WAJ A;  4CF1 A;  4CEB A;  4IKF A;  3AO4 A;  4CCH A;  4CHO A;  4FW2 A;  5AQI A;  3TSQ A;  1UA1 A;  2B6A A;  3V9S A;  4EZ9 A;  1EKE A;  3CQX A;  4ELT A;  4DTR A;  3I0R A;  1Q81 O;  1IBM K;  3L2U A;  4BWM A;  3DAW A;  4CEZ A;  3RR7 A;  3PO4 A;  5EXW A;  1NKC A;  1KAX A;  5EX5 A;  5FPM A;  2KFZ A;  3G25 A;  1HPZ A;  4NO7 A;  4B8C A;  3C0B A;  3IS9 A;  4I6M A;  5AZJ A;  1GLL O;  2ZGZ A;  5DM6 L;  4FCY A;  1ILY A;  3UKR A;  3KKR A;  4GY2 B;  1S1T A;  3SK3 A;  1VSM A;  1IKW A;  3OYA A;  1LAV A;  1YIJ N;  4HCB A;  1TUY A;  3HL8 A;  1I94 K;  5JVG L;  4DTX A;  3EKU A;  4LY7 A;  1DKG D;  3C94 A;  3SPY A;  1C0F A;  3ISN C;  3GL1 A;  1O13 A;  3NF6 A;  4IDH A;  2HVI A;  2ZWH A;  3ALY A;  2E1Z A;  5BPN A;  3VER A;  5BN8 A;  4M7X A;  4C8L A;  1YTU A;  4ISE A;  5I3U A;  4BRL A;  2Q3S A;  1WSG A;  2E88 A;  3PV8 A;  1WSH A;  3P31 A;  2B5J A;  1XWL A;  1NGC A;  4IG3 A;  2CH6 A;  4DQ8 A;  4K41 A;  3V1O A;  3EY1 A;  4GV6 A;  2KLA A;  5JVH L;  1TAU A;  2GWK A;  4BAC A;  2RN2 A;  2HHH K;  1VSH A;  3DRS A;  4DV1 K;  4KHW A;  3D2F B;  5LJV A;  3OYJ A;  1QQO A;  1HNI A;  2VG7 A;  4CJL A;  1M1K O;  3CC7 N;  4FWN A;  3MED A;  4IDK A;  3AVB A;  1G15 A;  4PKH A;  4W5T A;  4BDZ A;  1A5W A;  4FLX A;  3NBP A;  1IKY A;  2GWJ A;  2O4G A;  3LPU A;  3CYM A;  3QEX A;  2UU9 K;  3OYC A;  4CHZ A;  5ADX A;  4CIF A;  2E2O A;  3IRX A;  4LH5 A;  1VSD A;  5AQJ A;  3A5N C;  4NXM K;  2RPI A;  4JI4 K;  1LOT B;  3SBT A;  2WUS A;  1U48 A;  2OCE A;  1W7A A;  3AA2 A;  1T03 A;  5F2R A;  4DMN A;  5LL6 Z;  1XC9 A;  1ZYQ A;  3D2E A;  2FF6 A;  2ZJQ L;  3SJJ A;  1HQU A;  2P9L B;  1K6Y A;  4WYB A;  3EZW A;  4DKW A;  1D8Y A;  3K5M A;  1NK7 A;  3CME N;  3LL3 A;  3C6U A;  3H1V X;  3QLH A;  3HST B;  3C6H A;  3DMJ A;  3WXL A;  4JI2 K;  4B9L A;  5KRS A;  4N47 A;  1NGB A;  1RTH A;  2ZQB A;  4FW1 A;  3SYZ A;  4CHY A;  4IEE A;  4JI8 K;  3NVM A;  4JS5 A;  1YVU A;  5BR9 A;  3V4I A;  3QNO A;  2VG6 A;  3PX4 A;  3ZX2 A;  1Q8I A;  4H5R A;  3FZM A;  2VGN A;  2QWQ A;  2HVH A;  4M3R A;  1GLJ O;  5HRR A;  3H08 A;  3W3D A;  4ELU A;  2E1Y A;  5GAE P;  4YOY A;  3VOV A;  3HO1 A;  2O8E A;  2ASM A;  4KH4 A;  1HYZ A;  2IAJ A;  3DWL A;  5AQP A;  1R0A A;  3HPH A;  4BQL A;  1CLQ A;  2JGU A;  2BAN A;  4TSX A;  4DLG A;  4YDU C;  3U3Y A;  3C6A A;  3CCV N;  3B6O A;  2ASO A;  4DR1 K;  4CJE A;  1Q82 O;  5AR0 A;  1ZBI A; 
#chains in the Genus database with same CATH homology
 3M1F A;  3R9P A;  4CZG A;  3GBT A;  1KD1 O;  1M90 O;  3CQY A;  4FWR A;  5BN9 A;  1NGJ A;  4BG9 A;  3EKS A;  1YHQ N;  2VWB A;  3VEV A;  5AQT A;  3CJ1 A;  1NGI A;  1MWK A;  1S3X A;  1NGH A;  1VQ5 N;  1DEJ A;  3KZB A;  3AAP A;  4BQZ A;  4JKB A;  4CZM A;  4CJ7 A;  2NNW A;  3D7E O;  4JAX A;  1VQ9 N;  2PAV A;  1DGK N;  3G6E N;  3ID6 A;  1TYQ A;  5JLF A;  3FFK B;  3CCU N;  3CI5 A;  1YJW N;  4JKG A;  4A57 A;  5BPM A;  3L4I A;  1C0G A;  5ELZ A;  1N8R O;  3DLL L;  2GUP A;  2QWR A;  2VYP A;  3ENB A;  3F2K A;  2FF3 B;  4FWM A;  3ZEU A;  1X9J A;  4RCH A;  1GLD G;  2WC9 A;  2NRV A;  2YHY A;  2IVO A;  4K25 A;  1ZBS A;  4IWV A;  4IEI A;  4JEP A;  4H0T B;  4FL9 A;  3CHW A;  5F1X A;  2HST A;  3ZET A;  4A2B A;  3CCE N;  3CMA N;  1HLU A;  2UYT A;  2V51 B;  3FZK A;  4CZK A;  3M5R A;  5MLC Q;  2NZT A;  4B1W B;  2QTD A;  3VTI A;  2D0P A;  2NRX A;  2V52 B;  3EL2 A;  4XH4 A;  3BF3 A;  4WQ4 A;  2NRW A;  3CC4 N;  3D2F A;  4BVP A;  3CJ7 A;  3FZH A;  4A5B A;  1JCG A;  5BRH A;  4QS8 A;  2AP1 A;  2BH1 A;  2P9I B;  1Z05 A;  2P9K A;  3OBW A;  1NGF A;  4FWQ A;  3P38 A;  4JKC A;  4MDB A;  3ULE A;  4B1U B;  4BR2 A;  2Q97 A;  4DB3 A;  4JKE A;  4BGB A;  1HJO A;  1HKB A;  3QML A;  4O8U A;  1KAZ A;  5AQU A;  4YOW A;  3CJA A;  1HPM A;  3ATV A;  3MMV A;  3F9M A;  4ISG A;  1XQS C;  3UKU B;  3HSC A;  4CI6 A;  5M1K A;  3VEY A;  3E9L A;  2FSN A;  1NGD A;  2I7P A;  2HBK A;  3MN7 A;  2ITM A;  3WQT A;  4BC2 A;  1YAG A;  4H0Y B;  4IXC A;  5BPL A;  4B1Z A;  2QI2 A;  5AQZ A;  1EO1 A;  3J7Z O;  1MA9 B;  2F7T A;  3MN9 A;  3U9D A;  4BVO A;  2W41 A;  4PL8 A;  1SS6 A;  1GLC G;  1GLB G;  3PIO L;  3EE8 A;  1T6D A;  4C1N I;  1BDG A;  2IIR A;  1JCE A;  2P9P A;  3M6G A;  3O1W A;  4OPH A;  1HKC A;  3U9Z A;  4A61 A;  5GAD P;  3HBT A;  4QS9 A;  1QVG M;  1JJ2 M;  3SMP A;  5M1F A;  1T6C A;  2A41 A;  3VGL A;  2AA4 A;  4M7Y A;  4JD2 B;  3CCQ N;  1QZ5 A;  1BUP A;  1XUP O;  2F9T A;  5AQM A;  2E20 A;  3HI0 A;  5BRE A;  3CD6 N;  1VQ7 N;  4FWS A;  3A5O C;  3DXM A;  3O08 A;  4JKH A;  4B9Q A;  1GLF O;  2CH5 A;  1OVY A;  5H1S Q;  5AFU A;  2A5X A;  1BU6 O;  1G99 A;  2NRZ A;  4IFE A;  3E66 A;  4EHT A;  3H1Q A;  1W97 L;  3AGR A;  4BR4 A;  4GV3 A;  3G4S N;  1ZC6 A;  1NLV A;  5AQH A;  4H0O A;  3WT0 A;  4YOX A;  1P8Z A;  1S22 A;  4JKF A;  4MO5 A;  3SBG A;  3T7Z A;  3DJC A;  3TU5 A;  3LDL A;  3VES A;  1VQM N;  5CE3 A;  1MWM A;  1T3V A;  3E1Y A;  2E8A A;  2WFB A;  3QIC A;  2P9N A;  4BRH A;  2GEL A;  4LC9 B;  1NMD A;  2YX6 A;  1YJN N;  3IFR A;  3RSE B;  2NRH A;  2IVP A;  1YJ9 N;  3VF2 A;  2NRT A;  1Y64 A;  4JKA A;  1RDU A;  3L6Q A;  5GAH P;  2I7N A;  4FWK A;  5AQL A;  4PHT X;  5F0X A;  1IG8 A;  5GIP A;  4IO9 L;  3CIP A;  5C10 A;  4NLC A;  3A5L C;  3HOT A;  4YOR A;  3F5T A;  3KHY A;  4FWP A;  3O8M A;  5AQO A;  2KHO A;  5AQK A;  2OAN A;  5AZJ B;  3VF4 A;  4DCH A;  4FVU A;  2HBM A;  1NGE A;  1BG3 A;  3UKR B;  3WXM B;  2GEM A;  3OHR A;  4BGA A;  2D1K A;  3H46 O;  3R8E A;  1JCF A;  2W40 A;  3AGK A;  1NGG A;  3FLC O;  1GLA G;  1U2V B;  3VEX A;  1BA0 A;  1QZ6 A;  3HRG A;  1VQP N;  1YXQ A;  1NJI O;  2Q0U A;  5M1N A;  1NWK A;  5AQQ A;  4JN4 A;  4U7B A;  5AQS A;  1TUU A;  4FPB A;  3E9P A;  2E2N A;  5C2D A;  3FZF A;  3BEX A;  2D4W A;  1BA1 A;  2DPN A;  5BRF A;  2GTD A;  2NRR A;  3R6M A;  4MO4 A;  4O5F A;  4R79 A;  3MCA B;  3LDQ A;  4PKG A;  2YHX A;  5AQN A;  3I56 N;  1Z6R A;  4A62 A;  1T44 A;  3O80 A;  4A59 A;  4BRQ A;  4CZH A;  1IJJ A;  4WCE L;  2P9S B;  2VCP A;  3ENO A;  3LDO A;  1TYQ B;  4JKG B;  3TTC A;  4CD3 A;  4KH5 A;  3TSU A;  5FPN A;  4H0V B;  4FSV A;  2RE2 A;  2JWL A;  3LM2 A;  1BWF O;  4JHD A;  3CET A;  3H6E A;  5E26 A;  3GDQ A;  3ZEU B;  1ZXO A;  3VTH A;  4Y0W A;  1ATR A;  2ZJR L;  4CZJ A;  4WFN L;  2HBL A;  3K9J A;  4IO8 A;  3VEZ A;  5CHI A;  3VEW A;  2YJE A;  3KWG A;  2A3Z A;  3O5B A;  4YOU A;  4IZ9 A;  4FPA A;  1MDU B;  2HF4 A;  5AZI B;  1R59 O;  4G9Z A;  3VMF B;  1KXP A;  2QM1 A;  1X3M A;  5LJW A;  2CGK A;  3CPW M;  1Q18 A;  1RGI A;  4B1X B;  3IKM A;  1VAZ A;  4H5N A;  3OA9 A;  4WQ5 C;  2P9K B;  2PBD A;  1LCU A;  1KQS M;  3ULE B;  2YHW A;  3H3O B;  5EY4 A;  3QBX A;  2QWO A;  2Q31 A;  4M63 C;  1VQO N;  1YUW A;  1BOT O;  4BRP A;  3D6R A;  3CJC A;  2A6A A;  5AQW A;  1Q7Y O;  3CF5 L;  5GAG P;  4ILJ A;  2WBN A;  3BF1 A;  2P9I A;  4CZL A;  5GIO A;  4JKD A;  2ZJP L;  3EN9 A;  5EOY A;  5FPD A;  3O9R A;  3R3L A;  4NB4 A;  4WQ4 C;  3VPZ A;  5GIN A;  3A8Y A;  3DXK B;  3N4Q A;  2E2Q A;  2Q0R A;  1QHA A;  3L0Q A;  3VEN A;  2CGJ A;  3D2E B;  3CCJ N;  5M1O A;  3MN5 A;  3GE1 A;  3IDH A;  2JWK A;  3CC2 N;  1ATN A;  4J8F A;  4OO1 J;  1E4G T;  3A0I X;  1RDW X;  3HTV A;  3TPQ A;  3WEE A;  3MDQ A;  4KH6 A;  4B1Y B;  4PL7 A;  2J4R A;  5CR4 A;  3N4P A;  4FOI A;  4ILG B;  2QXL A;  5JIC A;  4HWI A;  3FE1 A;  3OBY A;  4BC3 A;  4CBU A;  1KAY A;  4H5V A;  1GLE G;  2P9L A;  1S72 N;  3ID8 A;  4MLH A;  1YF5 L;  3H45 C;  4OPA A;  3U8X A;  5BRD A;  3CCM N;  1SZ2 A;  4YOV A;  1ESV A;  4H0P A;  2HOE A;  1ATS A;  5FPE A;  2BTF A;  4JD2 A;  4BRK A;  4CZE A;  2YCH A;  1VQ4 N;  1VQN N;  2QEX N;  4DHY A;  1Q86 O;  3WXK A;  1K8K B;  5AQR A;  2P9U A;  4EHU A;  3JS6 A;  4K42 A;  1VQK N;  4C23 A;  1WUA A;  1K73 O;  3AY9 A;  1W2B M;  4NLB A;  2NLX A;  2HF3 A;  4BR7 A;  1NM1 A;  3NVK A;  4XH1 A;  4U67 L;  4H03 B;  1YIT N;  1D4X A;  3O1B A;  2F9W A;  5AQI A;  4AM6 A;  4QS7 A;  3MWP A;  3TSQ A;  5KPT A;  3QFP A;  4BRI A;  4BC5 A;  3HOS A;  3O6W A;  5C0Y A;  3BUZ B;  4YDU A;  3RSE A;  3CQX A;  4A2A A;  4ILH A;  1K9M O;  5JLH A;  3WQU A;  2E2P A;  4MLE A;  1K8A O;  5KQ8 A;  4GNI A;  4BRA A;  3C7N A;  1Q81 O;  3DAW A;  4BR5 A;  2QWM A;  4H5T A;  3OW2 M;  2A40 A;  3QBW A;  5EXW A;  1KAX A;  5EX5 A;  4WFB L;  3CPE A;  3IUC A;  5FPM A;  5C2F A;  4BR9 A;  3ZX0 A;  5JMV A;  3G25 A;  5KPZ A;  4NO7 A;  2Q1N A;  2BUP A;  3C0B A;  4I6M A;  5AZJ A;  1GLL O;  2ZGZ A;  4IJA A;  3SLC A;  3VEO A;  3LM9 A;  4BRN A;  5DM6 L;  1ILY A;  3RVC A;  3UKR A;  3E9O A;  4IOC L;  2D0O A;  3QFU A;  1NGA A;  3CJB A;  3O9U A;  3Q7C A;  4GY2 B;  3SK3 A;  4IOA L;  1RFQ A;  4BRG A;  3CCS N;  1VQL N;  1YIJ N;  1U2V A;  3S41 A;  1TUY A;  2QWL A;  5JVG L;  3EO3 A;  3EKU A;  3O9T A;  4IJN A;  3ZYY X;  3O9S A;  1HX1 A;  1DKG D;  1HUX A;  2CGL A;  1C0F A;  4BRC A;  3TSP A;  3GL1 A;  2HBJ A;  1O13 A;  4BRF A;  4IDH A;  1QQM A;  4BRO A;  2ZWH A;  3PLA A;  3WUH A;  2E1Z A;  3MN6 A;  4F9O A;  5BPN A;  5HL7 L;  1J6Z A;  4CBX A;  3VER A;  5BN8 A;  4M7X A;  4FWO A;  2OTJ N;  3LDP A;  4ISE A;  2KKZ A;  3VF6 A;  1BO5 O;  4BRL A;  2ASP A;  3O4W A;  3Q7B A;  3SAG A;  2E88 A;  1DT9 A;  4JHD B;  3SJH A;  2P9S A;  3P31 A;  4AM7 A;  5AQX A;  4RWT A;  1YI2 N;  3QB0 A;  1NGC A;  4DQ8 A;  2CH6 A;  5EVZ A;  3J8A A;  3ZET B;  3LDN A;  3IMX A;  4K41 A;  4GV9 A;  4GV6 A;  2EWS A;  2KLA A;  5JVH L;  5M1Q A;  3UB5 A;  2GWK A;  3UE5 A;  2QWP A;  3GOI A;  4EAH D;  4CBW A;  2FXU A;  2QW9 A;  4WQ5 A;  2IVN A;  3D2F B;  4L3Q A;  5LJV A;  1QQO A;  3U4L A;  3SAH A;  4UY8 O;  1M1K O;  5E84 A;  1KC8 O;  3CC7 N;  4BG8 A;  2H3G X;  4FWN A;  3B8A X;  5AZI A;  1V4T A;  4BC4 A;  1VQ8 N;  2V7Y A;  4BR0 A;  2A42 A;  4PKH A;  2OTL N;  5TKY A;  3ENH A;  4A5A A;  2HMP A;  4E1J A;  2GWJ A;  5I9E B;  5TKW A;  5C15 A;  3PIP L;  3SMS A;  5ADX H;  5ADX A;  3ATU A;  2E2O A;  4XEI A;  2YJF A;  3M3Z A;  3T69 A;  3I8B A;  1WOQ A;  4CZI A;  1EQY A;  3KWI A;  3UKU A;  3CJ9 A;  4JK9 A;  5AQJ A;  5AQG A;  3A5N C;  4FOE A;  3WXJ A;  2P9P B;  4XH5 A;  2QA4 N;  1LOT B;  5AQF A;  5AQV A;  3SBT A;  2WUS A;  4JNE A;  4ISF A;  5C12 A;  3SAF A;  3ZX3 A;  3NMU A;  5KQD A;  2FSJ A;  1QVF M;  3WEE B;  2VGM A;  3KVG A;  5LY3 A;  3DXK A;  3VGK A;  5HOO A;  5F2R A;  5AQY A;  3MK6 A;  4RTF D;  3DXM B;  2FSK A;  3D2E A;  3W0L A;  2FF6 A;  3CCL N;  3K9K A;  3TTD A;  4JK7 A;  4BRM A;  2ZJQ L;  4KBO A;  2P9L B;  4WYB A;  3HZ6 A;  1HKG A;  3EZW A;  3AAQ A;  4DKW A;  2GX9 A;  3CER A;  3HM8 A;  3G71 N;  3AAR A;  1VQ6 N;  3CME N;  3LL3 A;  5KPR A;  3H1V X;  3FGU A;  1XC3 A;  3C6H A;  3WXL A;  1SQK A;  4YOT A;  1NGB A;  2V7Z A;  2P9U B;  4EIA A;  3VGM A;  3O9Q A;  4BRE A;  4EFH A;  2P9N B;  4FWL A;  1NBW A;  2RHK A;  4IEE A;  3CCR N;  3H3N O;  5AFU H;  1X3N A;  4BRD A;  2ZGY A;  2FLO A;  3MX5 A;  3NVM A;  4Z94 A;  3FR0 A;  3GG4 A;  1K8K A;  3KK7 A;  3L4Q A;  3MX2 A;  1U6Z A;  4HTL A;  5BR9 A;  1SAZ A;  1H1V A;  3A5M C;  1CZA N;  3BP8 A;  3C65 A;  3I33 A;  4H0X B;  4AF1 A;  3FZL A;  3TTF A;  4WF9 L;  3ZX2 A;  4WFA L;  1E4F T;  4H5W A;  3JXU A;  3FZM A;  4H5R A;  2VGN A;  3QDK A;  2Q36 A;  2QWQ A;  4PKI A;  3EE9 A;  4JK8 A;  3C7N B;  3I55 N;  1GLJ O;  3WXI A;  3W3D A;  2E1Y A;  3MWT A;  1YVN A;  5GAE P;  4O8K A;  3P4I A;  3VOV A;  4YOY A;  2ASM A;  2QWN A;  4KH4 A;  4MDA A;  4C1N K;  1V4S A;  2ZF5 O;  3P39 A;  3MCP A;  4FO0 A;  2Q2R A;  3DWL A;  5AQP A;  5B8H A;  4CZF A;  4BQL A;  2PFU A;  4I6M B;  4CD1 A;  1OKJ A;  2YI1 A;  4GVE A;  3VET A;  1P90 A;  4IOX A;  3R1X A;  4YDU C;  3CXC M;  5DM7 L;  1QQN A;  3C6A A;  4K43 A;  3CCV N;  2ASO A;  5M1P A;  4B1V A;  1Q82 O;  5AR0 A;  4BY9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...