3KWGA

X-ray structure of ns1 effector domain w187a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEANDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 35
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwgA00
3KWGA 3OA9A 3M5RA 3RVCA 3P39A 3P38A 3O9TA 3KWIA 3O9UA 2KKZA 3D6RA 3P31A 4OPAA 2GX9A 3O9SA 4OPHA 3F5TA 2RHKA 3O9RA 3EE8A 3L4QA 3O9QA 3EE9A
chains in the Genus database with same CATH superfamily
1RGIA 2CGKA 2P9SA 3MEDA 3LAMA 5BRHA 2GWJA 3CFPA 3P38A 3SV4A 1VQ8N 2E5LK 2YKNA 4YOYA 3VTHA 1RT6A 4KHNA 3ZETA 2FF6A 5AJ3K 4CHZA 2YJFA 4CIEA 1HNXK 1BG3A 1WSIA 4EZ9A 2D4WA 1N36K 4KPYA 2IVPA 2WBNA 3QBWA 3CCQN 3SUPA 4JN4A 4WYBA 2ASOA 4DSKA 2HMPA 4JKBA 4I2PA 2P9NA 3IAYA 4N76A 1BCOA 4WQ5A 3HPGA 2R7YA 4FZXC 3UB5A 1TAQA 3E9OA 1XNRK 5M1FA 1IJJA 4IBNA 3T19A 2UUAK 1EWQA 2Q0UA 3U3GA 5KQDA 3V9SA 4JYAK 1NK6A 5T7BA 4C8NA 3AV9A 4C1NI 1ILYA 3GBTA 4IKFA 1UAXA 2W40A 3ZSQA 3HBTA 2Z1JA 2G8UA 3HXMA 3HP6A 4M42A 5BPNA 2BUPA 3AA4A 1UWBA 3L4IA 1W9HA 3PV8A 1SUQA 4B9LA 4BGBA 5KRSA 4DTPA 2IVOA 3KIOA 1GLLO 1QSLA 3K5LA 4F4KA 3SUNA 3KLHA 3IG1A 5C10A 1NGGA 1EX4A 1QVGM 3VF2A 4J2EA 2WC9A 3KLGA 3ZT0A 4B3RK 3QEIA 4ICLA 3OJSA 1G15A 4X66K 1RCHA 1BA0A 3ULEA 5FRMA 1ASVA 4CEDA 1E4GT 4EP5A 4DQRA 4CEAA 2RHKA 4BC4A 3AVHA 2YHYA 2PFUA 4FJNA 4O8KA 4OVLA 4CEBA 3O3HA 1TL1A 3IRXA 2OTLN 4KH4A 3RMDA 4F3TA 2WOMA 3A8YA 3I0RA 3FE1A 4K8XA 4X62K 3ID6A 1L3UA 4NCAA 5EY4A 1CZAN 4HCBA 2E88A 4NXNK 5SZTA 4HTLA 5GAEP 1A5XA 1UA1A 1L3SA 4E7JA 5FRNA 1NGBA 1NK5A 5BR8K 2Z1HA 3C94A 2ZJPL 3DRSA 2QWLA 1I94K 1NMNA 2PY5A 5EXWA 3H45C 4RW8A 3V9UA 3OTOK 3MXMA 3PO5A 3KWIA 4CFCA 4W5OA 3A5MC 1U6ZA 5JLHA 3U8XA 4OPKA 4CZHA 5AQXA 4NXMK 5CHIA 3QEVA 3A5OC 1D5AA 1Q82O 3AA3A 3ENHA 2ITMA 1E4FT 4KI4A 3J80O 3O6WA 2NZTA 4J2AA 1U04A 1VSFA 3FGUA 5BRFA 4FJ8A 3KK1A 1RTDA 4B1WB 4DSEA 1IKWA 3LDSA 3SYZA 3M8SA 4AH9A 2W41A 3OYEA 3V9XA 5DM6L 3V1RA 4C8KA 4CHNA 3I55N 4R79A 3VF6A 3RR8A 2HOEA 5M1NA 4NYFA 5AQRA 1NNEA 4B9UA 2J4RA 3TPQA 3V9ZA 5AQFA 5FPMA 1NM1A 5I9EB 3WXLA 4NLBA 5I3UA 4FWMA 1NG9A 4B9MA 3VEOA 3QIOA 4BQZA 4OO1J 3B6OA 4DTNA 5J2QA 1VQ6N 3TSQA 2HNYA 3GL1A 4KV8A 2G8KA 4BC2A 1U45A 2A40A 4JKCA 3HM8A 2G8WA 3MK6A 4B9QA 1RDDA 4H4MA 3THWA 5KGXA 1BQMA 4JK9A 3V6DA 5FPNA 3EY1A 4H5NA 1WAFA 3P4IA 1RT4A 3KK7A 4YFUA 3QESA 1HPZA 2BDPA 5GIOA 4FWQA 2XY6A 1W2BM 3OYMA 4K0KK 1TAUA 1LWCA 4YOTA 3PX4A 2JGUA 4FW2A 4FWRA 1VQLN 4FK2A 4G9ZA 4DV5K 3DLLL 1R59O 4BE2A 1JLBA 3AVCA 3SV3A 2XY5A 3THXA 3H1VX 4MLEA 2O8DB 1Z25A 4K43A 1O13A 3FZKA 1Z05A 4QS9A 3W3DA 3PY8A 3AY9A 4DR7K 3NF8A 4FLVA 2P9PA 3G6EN 4A62A 4AHVA 4B3SK 4M63C 4DTXA 1X9SA 4B1VA 4DV7K 1VSLA 4KHYA 4GMJB 1S9GA 1VRUA 3HYFA 2HF4A 4FM0A 1VHXA 3HSTB 1D9DA 2QM1A 4KTZA 4FWNA 1EKEA 4PA1A 5CZ1A 1VSEA 4YOVA 3LWMA 3S3NA 3DLEA 3K5NA 2GWKA 3Q7BA 3A0IX 2HHWA 5B8HA 3KWGA 1ASWA 4WFBL 2NLXA 5AZIA 4F3OA 5FROA 1WUAA 4M45A 1IV0A 4Z4GA 2LSNA 4JKGB 2I7NA 2UUCK 3AVJA 3RRHA 3SAHA 3NE6A 5HBMA 1SV5A 4L8RB 3EE8A 1C0GA 5HL7L 3TANA 3ALYA 4PY5A 4DUZK 3VESA 2VCPA 2IOCA 4YDUC 1U48A 4H0TB 3QEPA 3L3UA 4FPBA 1JCGA 2YX6A 2QW9A 5KPZA 3IDHA 4CJTA 1U2VB 1X9WA 4BRNA 3S9HA 4B08A 4FWOA 3C7NA 4HWIA 3VQCA 2EHGA 2O4IA 2HBKA 4CJ7A 1J5OA 4CGHA 4FJHA 4FJMA 1N33K 3TWHA 4WFAL 4DSJA 2QXLA 3T69A 2UXBK 4IG0A 2B6AA 4FJGA 1ASUA 1KVAA 4WQ4C 4YDUA 1EO1A 3DXKA 4YOWA 4AHCA 4KREA 4C8LA 4EHTA 4IEIA 3D2FA 4Y0WA 2XHBA 3QNNA 1ZBSA 4CEEA 4BC5A 3VQDA 3VEYA 1C1AA 4ZHRA 3IKMA 1VK0A 3VA0A 2QWNA 3AVMA 5KQ8A 4IG3A 1NGJA 4JS5A 1BIZA 3KD1E 2HHSA 5KPRA 4OPAA 4RCHA 3GDQA 4WQ4A 3UKUA 4CZFA 3O9RA 3BZCA 5CYMA 4CFDA 4FSVA 4CECA 5TKWA 4PKHA 4RW4A 4RG8A 3O1BA 5EVZA 4LSNA 4ELVA 2V7YA 4CHOA 4ZTFA 1NLVA 3O4QA 5HRSA 1B92A 3PUFA 2GBZA 3QFPA 4CF0A 3CI5A 4PWDA 4CVNE 3N4PA 3FZMA 1NGFA 3K59A 4QAGA 4E7LA 2P9LA 3D2EB 2O8BB 1Y64A 1RT2A 5F1XA 1K6YA 3E9LA 3OY9A 3NMUA 4BRKA 4FZYA 2GUPA 3L0QA 1KTQA 4DSLA 3CPEA 4DSIA 1S3XA 1NKEA 4GV6A 3ULDA 2XO7A 2YNIA 5C12A 4E0DA 1DGKN 4CK1A 4DTRA 2G8IA 1BI4A 4M7YA 4NCGA 3ATVA 3RMAA 1OH6A 1IBMK 4BR5A 4CF2A 2UUBK 4OJRA 5AQLA 3SJJA 4FLWA 1D9FA 5E26A 4DWIA 2HBLA 3VQ9A 1TK8A 4FJ7A 1FKPA 4BR9A 3DLKA 3NGYA 2WONA 5KI6A 4GVEA 5F0XA 2JLEA 3DRPA 2ZD1A 2D0PA 4KTWA 1CLQA 2A42A 1VQ7N 4B3OA 2FBYA 4F2SA 4LFAK 5CE3A 4DR4K 3MEEA 4IOXA 3AVAA 3ATUA 1HJOA 1B9FA 1YT3A 1FW6A 1WSEA 1BOTO 2HBMA 1SKRA 2QKKA 4R5PA 1SL1A 4NCBA 2FSKA 3OYBA 5BRDA 3MWPA 1TGOA 2QWRA 4GV3A 4DTMA 1TYQB 1KFDA 4J2DA 1KD1O 3DXMA 3L4QA 1S1WA 3D7EO 3LM2A 1MDUB 1TVRA 4ISFA 1CXQA 2P51A 2P9IA 3MX2A 1ESVA 2D0AA 4BRAA 2YCHA 4HVJA 2CGLA 2X78A 4M3YA 4JEPA 4BC3A 5AQWA 1YJNN 4BY9C 1QHTA 3WXIA 4CGJA 1QTMA 4DV1K 4DLGA 3NAEA 1Q18A 3SUQA 3ZSVA 3NCIA 2YHWA 4CZIA 4CJLA 3VEZA 5CYQA 3N4QA 3V1QA 3ZX0A 3NDKA 3UE5A 3IS9A 2WUSA 4BRCA 3A2FA 2HHVA 3H3OB 4RW6A 1K8KA 3IFRA 1X9JA 3DLGA 3K58A 1HYVA 1NGCA 1VQPN 2NRHA 1MU2A 4CI6A 2UU9K 2HVIA 1RT1A 3M8RA 4RW9A 3SQ2A 4DCHA 3LWLA 3HOSA 1QZ5A 3BP8A 3RSEB 3U9ZA 1S22A 4BWMA 3P5JA 1HNZK 1C0MA 1S5JA 2IC3A 2ZWHA 4BRPA 4DFJA 1T7PA 4B1UB 1NK9A 5BPLA 3VQEA 4CBWA 4O4GA 3AO5A 1MWKA 5AR0A 1QE1A 3A5LC 3DOLA 2DY4A 3ZSRA 4CZKA 2Y1JA 2OA8A 3AGRA 2O4GA 5MLCQ 3KLIA 5M1QA 1IO2A 2ITGA 3WNGA 1VSKA 3EE9A 3TTCA 4FLXA 1LAVA 4FJXA 5CZ2A 2GX9A 4C8OA 3VQ8A 3UKRB 4CERA 4ELUA 1GLDG 4AHUA 2YNHA 3TTFA 4MO4A 3HOTA 4F8RA 1TKXA 4CEFA 3HPHA 1SS6A 3VQBA 3ZX3A 3EZ5A 3HTVA 3L2VA 3WQUA 3G71N 3FR0A 3MN6A 3HVRA 4ILHA 3V9WA 3W0LA 4CZGA 1HJRA 2E6LA 4WE1A 1RILA 3QB0A 4BRQA 1W7AA 2JWKA 2P5GA 2P9KA 3MMVA 4JD2A 5M1PA 3TSPA 3MAQA 1KSPA 4BDYA 3KTQA 5H1SQ 5JS1A 4FPAA 1V4TA 2BH1A 4O0JA 2OPPA 4H0YB 1HQUA 1YUWA 4PKGA 5AQKA 1KXPA 2D0BA 3VN5A 1YJWN 3O80A 4M3TA 3SAGA 1V4SA 3I8BA 4J2BA 4LH5A 2OPQA 3QEWA 2IS3A 2KFZA 3T1YK 3KLEA 3JYTA 4AQYK 5GAHP 5BPMA 5C2DA 1BCMA 3IUCA 3BF1A 5AQMA 2OANA 4LF4K 3I0SA 1ZBLA 4JV5K 3VPZA 3VMFB 4EFHA 3LDLA 3O9TA 4BRLA 4HUFA 4FL9A 3HM9A 3SLCA 3I56N 2Q97A 4CJQA 4W5TA 3A5NC 3VEVA 2D5RA 2NRZA 3AVNA 4IOCL 1S1UA 3CM5A 4I6MB 3KKRA 3TU5A 5AQPA 3F9KA 5AZJB 3OYIA 4DF8A 2GTDA 1HKBA 4PHTX 1J5EK 1NKCA 1YAGA 3WUHA 5C0YA 4DFKA 1KAXA 3AARA 2ZGYA 3BGRA 1WAJA 4E7IA 4M3RA 4JNEA 1VQ5N 4Z4IA 3J7AP 3QFUA 4PL7A 4GW6A 3E9PA 4KHUA 1JLQA 1NOZA 2IAJA 1GLCG 4AM7A 1IKYA 1QQNA 3OBWA 4TSXA 3WEEB 4CEZA 3CPWM 5JVGL 1KQSM 4KRFA 5D3GA 1HLUA 1T05A 2AJQA 4KHSA 3HRGA 1JXBA 3MEGA 4F9OA 3ZSWA 5DK5A 3THWB 4QS8A 3R8EA 3ZEUB 2GELA 1VQNN 2OPSA 3D45A 4CBXA 1J53A 2UXCK 3OJUA 5AQIA 2VWJA 4V19S 4BDPA 3JAMO 1BWFO 2F4VK 1HKGA 4CF1A 3M8QA 1KC8O 3JS6A 4LD0A 1K8AO 4JKFA 4OLAA 1QQMA 2E8AA 4CJVA 4HCCA 4CZLA 4MLHA 1VQKN 1S9EA 3THXB 1WB9A 4E1JA 3CJ9A 4FM1A 1K73O 4ILGB 1NJXA 4DG1A 4I9QA 4XH5A 3RTVA 3WNFA 4YOUA 3L3VA 4FXDA 2P1JA 2YV0X 4U67L 4OPHA 4BRGA 5BR9A 4W5NA 1REVA 5AQGA 3SMSA 3C6AA 3B6PA 3NF6A 3VQ6A 3VGKA 4PUOA 3G25A 4Z4HA 1LWFA 1T3VA 4B1YB 3PIOL 5AQYA 4DR1K 1M1KO 3TABA 4JAXA 4UY8O 4FWKA 3NHGA 3SK3A 4W5QA 4A57A 3THVA 2O8CB 1GLAG 1ATNA 1QHAA 4CZEA 4CHPA 3F73A 3LDPA 5BREA 4CJPA 2UYTA 4M3WA 1E3MA 3V4IA 2FBVA 4OGCA 4K8ZA 3SUOA 3BY5A 1YVNA 4MDAA 4FM2A 4XH1A 5LJVA 4N41A 1WBDA 4XEIA 1KVBA 3LPTA 4GKJK 2A6AA 4WFNL 5J2MA 5LL6Z 3TSUA 2P9UB 3AO3A 2KW4A 1KVCA 4O0IA 4H0PA 1X3NA 4FLZA 2IDOA 1U4BA 2OYQA 4FK0A 4DF4A 4XIUA 1EXQA 3MN5A 5CY4A 3VQ7A 2YJEA 1JLAA 4B9TA 4B9SA 4DS5A 2QWMA 1VQ4N 3EL2A 5CR4A 1T03A 3VF4A 2G8VA 4DTOA 4DQ8A 1NGHA 3F5TA 4K42A 4X65K 4JKEA 4HTUA 2G8HA 4KO0A 4CFAA 2AP1A 3O9QA 4EIAA 5HRPA 4MO5A 3S41A 1VSHA 3HSCA 5C42A 1SQKA 2G8FA 1T6DA 1R0AA 4DQQA 1ATRA 4NLCA 3QERA 2QTDA 4E1MA 2KKZA 4LFCK 1QZ6A 2GEMA 3P31A 3ZCMA 5C15A 3WNEA 3O9SA 1FJGK 3UKUB 5AQTA 1DTQA 3C0BA 4PKIA 2CH5A 1XC9A 1RDCA 1WSJA 1SL0A 1RBSA 2YNFA 2O8DA 1T8EA 1VSDA 2HHQA 1G99A 3OYGA 3TAPA 4CJKA 2YNGA 4ISGA 3KZBA 3C6TA 2ZM6K 4Y1CA 2WFBA 4IWVA 3CMAN 1TKDA 2KQ2A 4H5VA 2P5OA 4K25A 4A5BA 3OS1A 3J7ZO 4FJKA 4JKHA 3H08A 1FKOA 1ZXOA 2NRVA 3LZIA 4QCLA 1Z26A 4KHPK 3AVBA 4JHDB 4DQIA 4WF9L 1KFSA 1XMQK 4C1NK 1VRTA 1SKSA 3P39A 2HHHK 3CCSN 3TI0A 2O8FA 2QI2A 1B9DA 4JKGA 4BVOA 3PIPL 3K2PA 2YHBA 5DM7L 5JS2A 4FJJA 2NUBA 4CFBA 3E66A 5M1OA 2KTQA 4DFMA 5HRRA 1HNWK 4YOXA 1OKJA 1T6CA 3SPZA 2OTJN 3FFKB 4Z4FA 1EETA 1JCEA 1NJYA 1NWKA 1OH5A 2RF2A 3VQ5A 4BGAA 2V7ZA 4IEEA 4BRHA 5JMVA 4U7BA 1DKGD 4C23A 4AM6A 3THYB 4DS4A 2W6KA 3NVMA 4O5BA 3Q7CA 3OVNA 3MDQA 5ADXH 3CXCM 1RTJA 2QWQA 3OYFA 3TAGA 1S6QA 4A59A 4RW7A 4DU4A 4IFYA 2CH6A 3PSFA 1TUYA 1A5VA 3OYLA 3M1FA 1Q9XA 2YHXA 4DTJA 2IIRA 3KHYA 5EX5A 1YXQA 1QVFM 1BQNA 2X6SA 4BACA 3E01A 1LCUA 4EZ6A 3CERA 3CFRA 1S6PA 2VQEK 5AQQA 3AO2A 3GG4A 1C1CA 2VYPA 3WT0A 4BR7A 4JI0K 3B8AX 4DV4K 1Y97A 3LALA 1JLGA 3LP1A 3T1AA 3DI6A 1OH7A 5HP1A 4NB4A 3ZSYA 4KB1A 3RVCA 4LF9K 1TK5A 3K5MA 2FSNA 3EKUA 2FXUA 4IXCA 2HSTA 4IOAL 1GOAA 4IFEA 4IZ9A 1MA9B 1QSYA 2PYJA 4CEQA 4JI3K 4CD1A 4DR6K 4LY7A 4FWPA 4ID5A 4CJSA 4AHTA 3T3FA 3H6EA 2HVHA 4GVMA 4A61A 3EYZA 3ZSXA 4KB0A 2EWSA 1TL3A 3CM6A 5F2RA 1NGEA 1XC3A 1NOYA 1L3VA 3CJCA 1HKCA 2NRRA 3D2EA 2O8BA 2DPNA 2W6LA 1YHQN 2D0OA 2ZJRL 3VETA 4GY2B 2RPIA 1IG8A 3CG7A 1F21A 5FPEA 4FJLA 2VWKA 4DUYK 5C2FA 3CJBA 1RTIA 1ZYQA 1LOTB 4B8AB 3CC7N 1WOQA 2O8EB 3MCAB 5A2QO 4Z4EA 4DQSA 5EU7A 3AGKA 4FOIA 2HW3A 1IBKK 2Q31A 3VERA 1BIUA 4KKOA 3DWLA 1ZBIA 4GNIA 3ZX2A 4KHWA 5AQUA 3DJCA 3M5RA 2P9SB 3OYNA 1NGDA 4ISEA 4MDBA 3LAKA 3KLFA 3VGMA 3ZSOA 2HB5A 2QK9A 3ZETB 3K9KA 3MWTA 3TARA 3QEXA 2QKBA 1HMVA 1S72N 2ZJQL 4LF8K 2F9WA 4JI4K 2OZSA 1S1XA 2HNZA 2P9NB 4CE9A 1NK7A 2X6NA 4DHYA 2I7PA 3HZ6A 1NK8A 2BANA 3L2QA 1RDWX 4CESA 3L8BA 1HNIA 3O3GA 4O8UA 4C8MA 1WNSA 3T1HK 4GKKK 3CCLN 3T7ZA 1W0HA 1C1BA 3O4NA 4BG8A 2HBJA 1ZBFA 4OKEA 5LMNK 3LL3A 1QSSA 1ZC6A 1HR0K 3EO3A 1DLOA 1XHZA 1YJ9N 4YORA 3NVKA 1GOBA 2F8SA 1C6VA 3I33A 5LY3A 1ZBHA 4JKDA 3DYAA 4CHYA 4BVPA 4OLBA 2A1RA 4JI7K 3H46O 1Q86O 1HPMA 4UQGA 1C0TA 3KJVA 4PL8A 3CETA 3OA9A 3IMXA 5AQJA 3CC4N 3D6RA 3WNHA 3ULEB 3F2KA 3VEXA 2A41A 3AA2A 5KPTA 4DQPA 2ZE2A 4CJFA 1FXXA 1BDGA 2FSJA 3M8PA 3OYAA 1CZ9A 2HHTA 4HUEA 3EKSA 3UIQA 1L5UA 4I2QA 1OVYA 1S1TA 1XMOK 1KAYA 3DLRA 3RSEA 3SI6A 5J1EA 2KZZA 1BGXT 4DV0K 3TAEA 4EHUA 4H0XB 3K5OA 3DM2A 3GE1A 4CEOA 1DT9A 5GIPA 1IKXA 1RTHA 3FZFA 1CXUA 4M7XA 1HX1A 4KBOA 3SPYA 1Q81O 3GOIA 5E84A 2BE2A 1NGIA 1SZ2A 5TKYA 1RDBA 4BRIA 4CGGA 3L2UA 1IKVA 4BQLA 3CCMN 3VEWA 3CMEN 2XRIA 3ZT2A 4KH6A 2FF3B 3SAFA 4DFPA 4CJEA 4QS7A 2VGMA 4ELTA 3VA3A 3H1QA 3CCVN 2AA4A 3P1GA 3QDKA 2QEXN 3MECA 1GOCA 4KI6A 3SQ4A 3EEQA 3UKRA 1O1WA 2YI1A 4DR3K 4I9LA 2GV9A 4BRMA 1TKTA 2YKMA 4FOEA 3RR7A 3DLBA 3HJFA 3QNOA 5JLFA 1N6QA 2KZMA 2NRTA 4IDKA 4CIGA 2ATQA 4DLEA 3CQXA 4N47A 3WXJA 1NKBA 4JS4A 2V52B 1YF5L 3LANA 1GLJO 4H5TA 3O3FA 1JL2A 2Q2RA 3AVKA 4XH4A 2IGIA 2B4JA 1I39A 3BZKA 3SQ1A 1VSIA 4NYNA 3EN9A 1JKHA 3H3NO 1NJIO 2F7TA 1BHLA 3SZ2A 4RTFD 4QOZB 2VWBA 4IDHA 5JICA 2JWLA 1ITGA 3QICA 4A5AA 3S3MA 3SQ0A 4BRDA 4HUGA 1JXEA 1YVUA 3E1YA 4CJUA 1RDAA 3WXKA 5GADP 1N5YA 1JJ2M 5AFUA 4F2RA 4JLHA 3FFIA 1L3TA 3CJ1A 3SBGA 5IT9O 4L3QA 1WSFA 1Q9YA 4FLTA 4BWJA 3G10A 1LWEA 1YITN 3BDPA 1KLMA 3FZLA 4RWTA 2VGNA 3DLHA 2FLOA 3O1WA 4CW7B 4CGDA 1QQCA 2IVNA 3NH2A 1U49A 4CCHA 3HP9A 3WQTA 3K57A 1BUPA 3D0PA 4JKAA 4AHRA 5GINA 4W5RA 4FLUA 4KHQA 1X9MA 1J6ZA 4FJIA 2BGGA 2HHXA 3R9PA 2E4LA 3C6HA 3LDNA 4CF9A 3LP2A 4I6MA 1N34K 2P9PB 3OYDA 4DB3A 5AZJA 1TK0A 4E19A 1NU0A 5ADXA 3CQYA 3ZT3A 3TR8A 2XY8A 3VGLA 1JLEA 4FLYA 2VG5A 1YI2N 1BA1A 3CIPA 3HI0A 5HRNA 1ZBUA 2VG6A 3DRRA 3G0ZA 5LMUK 4A2BA 5IWAK 4CJ3A 2UXDK 1BL3A 4EP4A 3CYMA 3HK2A 1X1PA 4B1XB 2QA4N 4Z0UA 4CHQA 4OGEA 4M3UA 3LZJA 5AQOA 1J9AA 5AZIB 3PX0A 3WEEA 2KHOA 4J8FA 4Y1DA 3AO4A 3SCXA 3NH1A 1D8YA 4Z94A 4DV3K 3OYHA 1GLBG 1SKWA 4Q5VA 2D1KA 5FDLA 3PX6A 1NJWA 1WSGA 1KCFA 3O08A 3ZEUA 2XY7A 3C95A 2NNWA 4OKJA 2ZF5O 5M1KA 3J8AA 3TAFA 3KD5E 5AQZA 3KK2A 4KH5A 1XNQK 3QO9A 3PLAA 2H3GX 2RN2A 3RRGA 4DU3A 4LF7K 3OS2A 3C7NB 5AQSA 4CD3A 3U3YA 3BF3A 3ZYYX 1RBVA 4BRFA 3QIPA 2DTUA 3K0SA 2QXFA 1S1VA 2A3ZA 3ZT4A 5BN8A 3ISNC 2F96A 3OBYA 4E7KA 4B3TK 1P8ZA 1RBUA 4EAHD 4KTQA 1C0UA 1RT5A 3DXKB 3VOVA 3VQ4A 4B8CA 4DV2K 1LV5A 4Q0BA 4ID1A 3CD6N 3ITHA 5EOYA 1IG9A 4E89A 3D2FB 1JLFA 3ENBA 3AVGA 4K41A 1NK0A 1LAWA 1VQON 1HRHA 4MQ3A 4CJWA 1U47A 1RNHA 3JSMA 4OPJA 3MCPA 3O5BA 3CJAA 4WCEL 1VQ9N 4CBUA 2A1SA 2FC0A 3P83D 1SAZA 3JXUA 1VQMN 3MXJA 2O8FB 2V51B 4CK2A 3OS0A 2ZGZA 1ATSA 4BR4A 1I3AA 2HF3A 2O8CA 1TUUA 1KLNA 4FJ9A 4AHSA 3LPUA 2PZSA 5HLFA 1NMDA 1A5WA 4DSFA 4CK3A 1RFQA 2Q1NA 2F8TA 3CFOA 3V1OA 3AVFA 1GLEG 1N8RO 3L2RA 3FZHA 4LF6K 1Z6RA 1BU6O 2W42A 2OCEA 1KAZA 2E20A 2HNDA 4AILC 2P9LB 1RDUA 2P9UA 3TTDA 4BR0A 4JI6K 5KRTA 3CCRN 4IJNA 2DFEA 5AQVA 4DKWA 3ZSZA 3HT3A 4M3XA 5AFUH 4M3ZA 4LSLA 2I5JA 1XUPO 1HYSA 2QWOA 1MWMA 1K9MO 2PAVA 5C24A 3U4LA 1WN7A 3KKSA 3AVLA 2FBTA 1JL1A 1WSHA 4CJ4A 4AF1A 3L2WA 3CCEN 2DFFA 4H0OA 1GLFO 1BI4B 3LP3A 2GUIA 1UA0A 4HHTA 3LM9A 4N5SA 1NBWA 4G1QA 3KVGA 4B1ZA 4FVMA 3AAQA 2Q3SA 1LW2A 3MXIA 3BEXA 2VQFK 4CZJA 3CCJN 4BREA 1WLJA 2WTUA 4DR5K 3QINA 4CJ5A 3DMJA 4NO7A 4BE0A 1BISA 2B5JA 1VAZA 1RBRA 4FYDA 2PYLA 2OPRA 4JI8K 1U2VA 3ENOA 4LC9B 2A5XA 4FW1A 1NGAA 3SNNA 1DEJA 1W97L 4H0VB 3V81A 1JLCA 2F9TA 4E1NA 5AQNA 3CF5L 4O44A 5AQHA 4CZMA 4FZZA 1UOCA 4LF5K 4H5WA 3RMBA 4BDZA 2Z1GA 4MFBA 1LW0A 3OYJA 3C6UA 1J54A 4FK4A 2E6MA 3LDOA 2FBXA 3NFAA 3SBTA 4B3MK 1Q8IA 3LDQA 1VSJA 4DTSA 3J7YP 4H8KA 3AVIA 2RE2A 4CJRA 3DXMB 4O5FA 3NH0A 4ILJA 2KLAA 3ASMA 2ASPA 4JRQA 4DV6K 5ELZA 2P9IB 4JK8A 4FCYA 1C0FA 1TKZA 3QETA 1TV6A 4JHDA 1VSMA 3HL8A 4IO8A 3OW2M 1RBTA 1CZBA 4M41A 2D0CA 3DAWA 3NBPA 4Z4CA 2Q0RA 3F9MA 4H03B 3PO4A 4DTUA 3R1XA 2HHUA 3K9JA 1SL2A 2QWPA 4H5RA 2NRWA 4IJAA 3U9DA 5E41A 2Q36A 1QQOA 5J2NA 3RMCA 4PQUA 5BN9A 3QMLA 3TAQA 1EQYA 4JK7A 4FVUA 4O55A 5KGWA 4YNQA 2E2QA 3VQPA 3CHWA 2NRXA 4JI5K 1K8KB 1QS4A 1IBLK 3HO1A 3THYA 2KFNA 3HPOA 4BR2A 3I8DA 5JVHL 5HROA 2YHAA 1RT3A 4H4OA 4BG9A 1YIJN 2CGJA 2ASMA 3QBXA 3OYCA 2X74A 3OYKA 2E2OA 3J81O 5C25A 1YTAA 4JRPA 3R6MA 1XQSC 3MN9A 4CGIA 2PBDA 4GV9A 3NGIA 1XI1A 1X3MA 4LH4A 4CGFA 2ETJA 1HYZA 1JCFA 4YY3K 3O8MA 4OKKA 3R3LA 3VTIA 5K14A 1WBBA 2E1ZA 5SWMA 4X64K 1NJZA 1FK9A 3PSIA 2DFHA 2EX3A 3NF9A 1HQEA 4N56A 3S3OA 1NK4A 3WXMB 4B9VA 4FWSA 2E2PA 3MX5A 3ZLJA 3NGZA 1T44A 3M3ZA 3SMPA 5HOOA 4B9NA 5FPDA 2BTFA 3L6QA 3FLCO 1OH8A 2E1YA 4JI1K 1YTUA 3DOKA 1RT7A 3CC2N 2Z1IA 4JI2K 3ZT1A 3CJ7A 3VQAA 1XHXA 4A2AA 2HMIA 1DTTA 3HVTA 2OZMA 5DMRA 3SJHA 3C65A 1HUXA 3MN7A 4I7FA 1KRPA 4CIFA 4IFVA 4LFBK 3BUZB 1N32K 3VENA 3TAMA 1Q7YO 1OVQA 3AAPA 4KFBA 4BE1A 1HNVA 4YHHK 3O9UA 4BROA 5LJWA 2Y1IA 1EP4A 3AO1A 4E7HA 2P9KB 1TYQA 4JD2B 5KTQA 1M90O 1EWRA 4KAZA 2VG7A 3M6GA 1BO5O 3ID8A 3RWUA 1P90A 3G4SN 3AA5X 3O4WA 4OX9K 1IH7A 5J2PA 3U6FA 4DMNA 2ZQBA 5GAGP 3VQQA 2O8EA 2RKIA 4FWLA 1D4XA 1H1VA 4DU1A 3KK3A 3QLHA 1XWLA 4E3SA 3CCUN 3NF7A 4FJ5A 4CF8A 3CQ8A 4WQ5C 5FLXO 4IO9L 3EZWA 3OHRA 5I42A 4FO0A 2E2NA 4ZTJA 3LP0A 4DR2K
chains in the Genus database with same CATH topology
4NLCA 2VGNA 1RGIA 2FLOA 2CGKA 2P9SA 4GVEA 3O1WA 5BRHA 5F0XA 2QTDA 2GWJA 3P38A 1VQ8N 2KKZA 2D0PA 4YOYA 2IVNA 1QZ6A 2GEMA 3P31A 3VTHA 3ZETA 5C15A 2A42A 2FF6A 3O9SA 1VQ7N 3WQTA 3UKUB 2YJFA 5AQTA 3C0BA 1BUPA 4PKIA 1BG3A 5CE3A 2CH5A 4JKAA 5GINA 2D4WA 2IVPA 1J6ZA 2WBNA 3QBWA 3CCQN 4IOXA 4JN4A 4WYBA 2ASOA 2HMPA 3ATUA 4JKBA 3R9PA 3C6HA 1G99A 2P9NA 1HJOA 3LDNA 4WQ5A 4I6MA 4ISGA 2HBMA 1BOTO 3KZBA 2P9PB 3UB5A 4DB3A 3E9OA 5AZJA 2WFBA 5M1FA 4IWVA 3CMAN 1IJJA 5ADXA 3CQYA 4H5VA 2FSKA 5BRDA 3MWPA 4K25A 2Q0UA 3VGLA 4A5BA 2QWRA 5KQDA 4GV3A 1TYQB 3J7ZO 4JKHA 1YI2N 1BA1A 1KD1O 3DXMA 4C1NI 3L4QA 1ZXOA 3CIPA 3GBTA 3HI0A 3D7EO 1ILYA 2NRVA 3LM2A 1MDUB 4A2BA 4ISFA 3MX2A 2P9IA 1ESVA 4BRAA 2YCHA 2CGLA 4JHDB 2W40A 4WF9L 4B1XB 2QA4N 3HBTA 4JEPA 4BC3A 4C1NK 5AQOA 5AQWA 1YJNN 4BY9C 5BPNA 5AZIB 2BUPA 3WXIA 3P39A 3WEEA 3CCSN 2KHOA 4J8FA 3L4IA 2QI2A 4JKGA 4BVOA 3PIPL 4Z94A 5DM7L 4BGBA 1Q18A 2IVOA 1GLBG 3E66A 5M1OA 2D1KA 1GLLO 2YHWA 4YOXA 1OKJA 5C10A 1NGGA 3O08A 4CZIA 1T6CA 3ZEUA 2OTJN 3FFKB 1QVGM 3VF2A 2NNWA 1JCEA 3VEZA 1NWKA 2ZF5O 5M1KA 4BGAA 2WC9A 3J8AA 2V7ZA 3N4QA 3ZX0A 4IEEA 5AQZA 4KH5A 4BRHA 3UE5A 2WUSA 4BRCA 3PLAA 2H3GX 3H3OB 5JMVA 1K8KA 4U7BA 3IFRA 4UY8O 1X9JA 1BA0A 1DKGD 3C7NB 1NGCA 5AQSA 3ULEA 4AM6A 2NRHA 4C23A 3NVMA 1VQPN 3Q7CA 3BF3A 1E4GT 4CI6A 3ZYYX 2RHKA 3MDQA 5ADXH 4BRFA 3CXCM 4BC4A 2QWQA 2A3ZA 4DCHA 2YHYA 2PFUA 3HOSA 4O8KA 5BN8A 1QZ5A 3BP8A 3RSEB 4A59A 3U9ZA 1S22A 3OBYA 2OTLN 2CH6A 4KH4A 1P8ZA 4EAHD 1TUYA 4BRPA 2ZWHA 3M1FA 2YHXA 2IIRA 3A8YA 3DXKB 3KHYA 4B1UB 3FE1A 4BR0A 5BPLA 5EX5A 1YXQA 1QVFM 3VOVA 4CBWA 3ID6A 3CD6N 5EOYA 1LCUA 1MWKA 3D2FB 1CZAN 3ENBA 3A5LC 4K41A 5AR0A 5EY4A 2E88A 3CERA 4R79A 4HTLA 5GAEP 4CZKA 1VQON 5AQQA 3GG4A 1NGBA 3AGRA 2VYPA 3WT0A 4BR7A 5MLCQ 5M1QA 3MCPA 3O5BA 2ZJPL 3B8AX 3CJAA 4WCEL 2QWLA 1VQ9N 3EE9A 4CBUA 3TTCA 5EXWA 3H45C 4NB4A 3RVCA 1SAZA 3JXUA 1VQMN 3KWIA 2V51B 2FSNA 3A5MC 3EKUA 2GX9A 1U6ZA 2FXUA 2ZGZA 1ATSA 4IXCA 3U8XA 4BR4A 4CZHA 5JLHA 3UKRB 2HF3A 5AQXA 5CHIA 1TUUA 2HSTA 1GLDG 3A5OC 1Q82O 4IOAL 4IFEA 3ENHA 2ITMA 1E4FT 4MO4A 3TTFA 3HOTA 4IZ9A 1MA9B 1NMDA 3O6WA 4CD1A 2NZTA 1SS6A 3ZX3A 1RFQA 3HTVA 2Q1NA 3FGUA 4FWPA 5BRFA 3WQUA 3G71N 3FR0A 3H6EA 4A61A 3MN6A 1GLEG 4B1WB 4ILHA 3W0LA 1N8RO 3FZHA 1Z6RA 1BU6O 2EWSA 2W41A 4CZGA 5DM6L 5F2RA 1KAZA 1NGEA 1XC3A 3QB0A 2E20A 4BRQA 2P9LB 3I55N 1RDUA 2JWKA 1HKCA 2NRRA 2P9UA 3CJCA 3D2EA 3TTDA 3VF6A 2DPNA 2P9KA 2HOEA 3MMVA 4JD2A 5M1PA 3TSPA 5AQRA 5M1NA 3CCRN 1YHQN 2D0OA 2ZJRL 3VETA 4IJNA 4GY2B 4DKWA 2J4RA 5AQVA 5H1SQ 1IG8A 3TPQA 5FPEA 5AFUH 4FPAA 5AQFA 5FPMA 1XUPO 2QWOA 1MWMA 1NM1A 5C2FA 5I9EB 2PAVA 1K9MO 3U4LA 3CJBA 3WXLA 1V4TA 4NLBA 4FWMA 2BH1A 4H0YB 3VEOA 1YUWA 4PKGA 1LOTB 5AQKA 1KXPA 3CC7N 4BQZA 4AF1A 1WOQA 3CCEN 4OO1J 4H0OA 1GLFO 1YJWN 3O80A 3MCAB 1VQ6N 3TSQA 3GL1A 3SAGA 1V4SA 3LM9A 1NBWA 3I8BA 4BC2A 2A40A 3KVGA 4B1ZA 4JKCA 3AGKA 3AAQA 3HM8A 3BEXA 4FOIA 3MK6A 4CZJA 3CCJN 4B9QA 4BREA 2Q31A 3VERA 3DWLA 5GAHP 5BPMA 5C2DA 4JK9A 4GNIA 5FPNA 3ZX2A 3IUCA 4NO7A 4H5NA 3BF1A 3P4IA 5AQMA 2OANA 3KK7A 3DJCA 3M5RA 5AQUA 2P9SB 1VAZA 1NGDA 4ISEA 4MDBA 3VPZA 3VMFB 4EFHA 3LDLA 5GIOA 3O9TA 4FWQA 3VGMA 1U2VA 4BRLA 3ENOA 1W2BM 4FL9A 3ZETB 4LC9B 3K9KA 2A5XA 3MWTA 3SLCA 1NGAA 1DEJA 1W97L 4H0VB 4YOTA 3I56N 2F9TA 2Q97A 4FWRA 1VQLN 5AQNA 3CF5L 1S72N 4CZMA 5AQHA 3A5NC 3VEVA 2ZJQL 4G9ZA 3DLLL 1R59O 4H5WA 2F9WA 2NRZA 3H1VX 4MLEA 4K43A 4IOCL 1O13A 3FZKA 1Z05A 2P9NB 4QS9A 3W3DA 4DHYA 2I7PA 3AY9A 3HZ6A 4I6MB 5AQPA 3TU5A 2P9PA 3G6EN 4A62A 1RDWX 4M63C 5AZJB 2GTDA 4B1VA 3LDOA 3SBTA 1HKBA 4O8UA 2HF4A 3LDQA 4PHTX 1YAGA 3WUHA 5C0YA 1KAXA 3AARA 3T7ZA 3CCLN 2ZGYA 2RE2A 2QM1A 4JNEA 4FWNA 3DXMB 1VQ5N 4O5FA 4ILJA 2KLAA 2ASPA 4BG8A 2HBJA 5ELZA 4YOVA 2P9IB 4JK8A 1C0FA 3QFUA 4PL7A 4JHDA 3E9PA 3LL3A 2GWKA 3Q7BA 3A0IX 5B8HA 3KWGA 1ZC6A 1GLCG 4AM7A 4IO8A 4WFBL 2NLXA 3EO3A 3OW2M 5AZIA 1QQNA 3OBWA 3WEEB 5JVGL 1WUAA 3CPWM 1KQSM 1YJ9N 4YORA 3NVKA 4JKGB 2I7NA 3DAWA 3I33A 5LY3A 2Q0RA 3F9MA 4H03B 4JKDA 3R1XA 3SAHA 3K9JA 1HLUA 2QWPA 4BVPA 3EE8A 2NRWA 1C0GA 4H5RA 4IJAA 3U9DA 5HL7L 3HRGA 2Q36A 4F9OA 1QQOA 3VESA 2VCPA 3H46O 5BN9A 1HPMA 1Q86O 4QS8A 3QMLA 4YDUC 2GELA 3R8EA 3ZEUB 1VQNN 1EQYA 4H0TB 4JK7A 4FPBA 4CBXA 4FVUA 4PL8A 1JCGA 3CETA 3OA9A 2YX6A 5AQIA 2QW9A 3IMXA 5KPZA 1BWFO 2E2QA 5AQJA 1HKGA 3IDHA 1KC8O 1U2VB 3JS6A 3CHWA 2NRXA 3CC4N 1K8KB 3D6RA 4JKFA 4BRNA 1K8AO 4FWOA 3C7NA 1QQMA 4HWIA 3ULEB 2E8AA 3F2KA 3VEXA 2A41A 4BR2A 5JVHL 5KPTA 4BG9A 1YIJN 2HBKA 4CZLA 2CGJA 1BDGA 4MLHA 2ASMA 2FSJA 3QBXA 4CJ7A 1VQKN 3EKSA 2E2OA 1OVYA 4WFAL 1KAYA 3RSEA 4E1JA 2QXLA 3CJ9A 3R6MA 3T69A 4ILGB 1K73O 1XQSC 3MN9A 4XH5A 4EHUA 2PBDA 4H0XB 4WQ4C 4YDUA 4YOUA 4GV9A 3GE1A 1EO1A 1DT9A 5GIPA 3DXKA 4CD3A 4YOWA 1X3MA 4U67L 3FZFA 4M7XA 4EHTA 4IEIA 1HX1A 4OPHA 4KBOA 1Q81O 4BRGA 1JCFA 3D2FA 3GOIA 4Y0WA 5E84A 5BR9A 1NGIA 3O8MA 3R3LA 3VTIA 1ZBSA 1SZ2A 5AQGA 2E1ZA 5TKYA 4BC5A 3VEYA 4BRIA 3SMSA 3C6AA 3IKMA 4BQLA 3WXMB 3CCMN 4FWSA 3VEWA 3CMEN 3VGKA 2QWNA 5KQ8A 4KH6A 2E2PA 2FF3B 3G25A 3SAFA 4QS7A 1NGJA 2VGMA 1T3VA 3MX5A 4B1YB 3PIOL 5AQYA 3H1QA 1T44A 3CCVN 3M3ZA 2AA4A 3SMPA 5HOOA 1M1KO 3QDKA 4JAXA 5KPRA 4FWKA 5FPDA 2BTFA 3L6QA 4OPAA 3FLCO 3SK3A 2QEXN 2E1YA 4A57A 4RCHA 3UKRA 3GDQA 2YI1A 1GLAG 1ATNA 1QHAA 4WQ4A 3UKUA 4CZEA 3CC2N 4CZFA 3LDPA 3CJ7A 5BREA 3O9RA 4A2AA 4BRMA 4FSVA 2UYTA 4FOEA 5TKWA 3C65A 3SJHA 1HUXA 4PKHA 5JLFA 3MN7A 2NRTA 3O1BA 5EVZA 1YVNA 2V7YA 3BUZB 3CQXA 1NLVA 4MDAA 3WXJA 3VENA 4XH1A 5LJVA 2V52B 1Q7YO 3AAPA 1YF5L 4XEIA 1GLJO 3QFPA 4H5TA 3CI5A 3O9UA 4BROA 3N4PA 5LJWA 2Q2RA 3FZMA 1NGFA 2A6AA 4WFNL 4XH4A 2P9LA 3TSUA 2P9UB 3D2EB 1Y64A 2P9KB 1TYQA 4JD2B 5F1XA 4H0PA 1X3NA 3EN9A 3H3NO 1M90O 3E9LA 1NJIO 3NMUA 2F7TA 4BRKA 3M6GA 1BO5O 2GUPA 3ID8A 4RTFD 1P90A 3L0QA 2VWBA 3MN5A 3CPEA 3G4SN 1S3XA 4IDHA 3O4WA 5JICA 2YJEA 2JWLA 4GV6A 3QICA 4A5AA 2QWMA 1VQ4N 4BRDA 5C12A 5GAGP 1DGKN 3E1YA 4FWLA 3EL2A 1D4XA 3WXKA 1H1VA 5CR4A 4M7YA 5GADP 3ATVA 3VF4A 4DQ8A 1NGHA 1JJ2M 5AFUA 3F5TA 4BR5A 3CCUN 4K42A 5AQLA 4JKEA 5E26A 3CJ1A 2HBLA 3SBGA 2AP1A 4WQ5C 4IO9L 3EZWA 3O9QA 4L3QA 3OHRA 4MO5A 4EIAA 4FO0A 4BR9A 3S41A 2E2NA 3HSCA 1YITN 1SQKA 1T6DA 1ATRA 3FZLA 4RWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWG A;  3OA9 A;  3M5R A;  3RVC A;  3P39 A;  3P38 A;  3O9T A;  3KWI A;  3O9U A;  2KKZ A;  3D6R A;  3P31 A;  4OPA A;  2GX9 A;  3O9S A;  4OPH A;  3F5T A;  2RHK A;  3O9R A;  3EE8 A;  3L4Q A;  3O9Q A;  3EE9 A; 
#chains in the Genus database with same CATH topology
 1RGI A;  2CGK A;  2P9S A;  3MED A;  3LAM A;  5BRH A;  2GWJ A;  3CFP A;  3P38 A;  3SV4 A;  1VQ8 N;  2E5L K;  2YKN A;  4YOY A;  3VTH A;  1RT6 A;  4KHN A;  3ZET A;  2FF6 A;  5AJ3 K;  4CHZ A;  2YJF A;  4CIE A;  1HNX K;  1BG3 A;  1WSI A;  4EZ9 A;  2D4W A;  1N36 K;  4KPY A;  2IVP A;  2WBN A;  3QBW A;  3CCQ N;  3SUP A;  4JN4 A;  4WYB A;  2ASO A;  4DSK A;  2HMP A;  4JKB A;  4I2P A;  2P9N A;  3IAY A;  4N76 A;  1BCO A;  4WQ5 A;  3HPG A;  2R7Y A;  4FZX C;  3UB5 A;  1TAQ A;  3E9O A;  1XNR K;  5M1F A;  1IJJ A;  4IBN A;  3T19 A;  2UUA K;  1EWQ A;  2Q0U A;  3U3G A;  5KQD A;  3V9S A;  4JYA K;  1NK6 A;  5T7B A;  4C8N A;  3AV9 A;  4C1N I;  1ILY A;  3GBT A;  4IKF A;  1UAX A;  2W40 A;  3ZSQ A;  3HBT A;  2Z1J A;  2G8U A;  3HXM A;  3HP6 A;  4M42 A;  5BPN A;  2BUP A;  3AA4 A;  1UWB A;  3L4I A;  1W9H A;  3PV8 A;  1SUQ A;  4B9L A;  4BGB A;  5KRS A;  4DTP A;  2IVO A;  3KIO A;  1GLL O;  1QSL A;  3K5L A;  4F4K A;  3SUN A;  3KLH A;  3IG1 A;  5C10 A;  1NGG A;  1EX4 A;  1QVG M;  3VF2 A;  4J2E A;  2WC9 A;  3KLG A;  3ZT0 A;  4B3R K;  3QEI A;  4ICL A;  3OJS A;  1G15 A;  4X66 K;  1RCH A;  1BA0 A;  3ULE A;  5FRM A;  1ASV A;  4CED A;  1E4G T;  4EP5 A;  4DQR A;  4CEA A;  2RHK A;  4BC4 A;  3AVH A;  2YHY A;  2PFU A;  4FJN A;  4O8K A;  4OVL A;  4CEB A;  3O3H A;  1TL1 A;  3IRX A;  2OTL N;  4KH4 A;  3RMD A;  4F3T A;  2WOM A;  3A8Y A;  3I0R A;  3FE1 A;  4K8X A;  4X62 K;  3ID6 A;  1L3U A;  4NCA A;  5EY4 A;  1CZA N;  4HCB A;  2E88 A;  4NXN K;  5SZT A;  4HTL A;  5GAE P;  1A5X A;  1UA1 A;  1L3S A;  4E7J A;  5FRN A;  1NGB A;  1NK5 A;  5BR8 K;  2Z1H A;  3C94 A;  2ZJP L;  3DRS A;  2QWL A;  1I94 K;  1NMN A;  2PY5 A;  5EXW A;  3H45 C;  4RW8 A;  3V9U A;  3OTO K;  3MXM A;  3PO5 A;  3KWI A;  4CFC A;  4W5O A;  3A5M C;  1U6Z A;  5JLH A;  3U8X A;  4OPK A;  4CZH A;  5AQX A;  4NXM K;  5CHI A;  3QEV A;  3A5O C;  1D5A A;  1Q82 O;  3AA3 A;  3ENH A;  2ITM A;  1E4F T;  4KI4 A;  3J80 O;  3O6W A;  2NZT A;  4J2A A;  1U04 A;  1VSF A;  3FGU A;  5BRF A;  4FJ8 A;  3KK1 A;  1RTD A;  4B1W B;  4DSE A;  1IKW A;  3LDS A;  3SYZ A;  3M8S A;  4AH9 A;  2W41 A;  3OYE A;  3V9X A;  5DM6 L;  3V1R A;  4C8K A;  4CHN A;  3I55 N;  4R79 A;  3VF6 A;  3RR8 A;  2HOE A;  5M1N A;  4NYF A;  5AQR A;  1NNE A;  4B9U A;  2J4R A;  3TPQ A;  3V9Z A;  5AQF A;  5FPM A;  1NM1 A;  5I9E B;  3WXL A;  4NLB A;  5I3U A;  4FWM A;  1NG9 A;  4B9M A;  3VEO A;  3QIO A;  4BQZ A;  4OO1 J;  3B6O A;  4DTN A;  5J2Q A;  1VQ6 N;  3TSQ A;  2HNY A;  3GL1 A;  4KV8 A;  2G8K A;  4BC2 A;  1U45 A;  2A40 A;  4JKC A;  3HM8 A;  2G8W A;  3MK6 A;  4B9Q A;  1RDD A;  4H4M A;  3THW A;  5KGX A;  1BQM A;  4JK9 A;  3V6D A;  5FPN A;  3EY1 A;  4H5N A;  1WAF A;  3P4I A;  1RT4 A;  3KK7 A;  4YFU A;  3QES A;  1HPZ A;  2BDP A;  5GIO A;  4FWQ A;  2XY6 A;  1W2B M;  3OYM A;  4K0K K;  1TAU A;  1LWC A;  4YOT A;  3PX4 A;  2JGU A;  4FW2 A;  4FWR A;  1VQL N;  4FK2 A;  4G9Z A;  4DV5 K;  3DLL L;  1R59 O;  4BE2 A;  1JLB A;  3AVC A;  3SV3 A;  2XY5 A;  3THX A;  3H1V X;  4MLE A;  2O8D B;  1Z25 A;  4K43 A;  1O13 A;  3FZK A;  1Z05 A;  4QS9 A;  3W3D A;  3PY8 A;  3AY9 A;  4DR7 K;  3NF8 A;  4FLV A;  2P9P A;  3G6E N;  4A62 A;  4AHV A;  4B3S K;  4M63 C;  4DTX A;  1X9S A;  4B1V A;  4DV7 K;  1VSL A;  4KHY A;  4GMJ B;  1S9G A;  1VRU A;  3HYF A;  2HF4 A;  4FM0 A;  1VHX A;  3HST B;  1D9D A;  2QM1 A;  4KTZ A;  4FWN A;  1EKE A;  4PA1 A;  5CZ1 A;  1VSE A;  4YOV A;  3LWM A;  3S3N A;  3DLE A;  3K5N A;  2GWK A;  3Q7B A;  3A0I X;  2HHW A;  5B8H A;  3KWG A;  1ASW A;  4WFB L;  2NLX A;  5AZI A;  4F3O A;  5FRO A;  1WUA A;  4M45 A;  1IV0 A;  4Z4G A;  2LSN A;  4JKG B;  2I7N A;  2UUC K;  3AVJ A;  3RRH A;  3SAH A;  3NE6 A;  5HBM A;  1SV5 A;  4L8R B;  3EE8 A;  1C0G A;  5HL7 L;  3TAN A;  3ALY A;  4PY5 A;  4DUZ K;  3VES A;  2VCP A;  2IOC A;  4YDU C;  1U48 A;  4H0T B;  3QEP A;  3L3U A;  4FPB A;  1JCG A;  2YX6 A;  2QW9 A;  5KPZ A;  3IDH A;  4CJT A;  1U2V B;  1X9W A;  4BRN A;  3S9H A;  4B08 A;  4FWO A;  3C7N A;  4HWI A;  3VQC A;  2EHG A;  2O4I A;  2HBK A;  4CJ7 A;  1J5O A;  4CGH A;  4FJH A;  4FJM A;  1N33 K;  3TWH A;  4WFA L;  4DSJ A;  2QXL A;  3T69 A;  2UXB K;  4IG0 A;  2B6A A;  4FJG A;  1ASU A;  1KVA A;  4WQ4 C;  4YDU A;  1EO1 A;  3DXK A;  4YOW A;  4AHC A;  4KRE A;  4C8L A;  4EHT A;  4IEI A;  3D2F A;  4Y0W A;  2XHB A;  3QNN A;  1ZBS A;  4CEE A;  4BC5 A;  3VQD A;  3VEY A;  1C1A A;  4ZHR A;  3IKM A;  1VK0 A;  3VA0 A;  2QWN A;  3AVM A;  5KQ8 A;  4IG3 A;  1NGJ A;  4JS5 A;  1BIZ A;  3KD1 E;  2HHS A;  5KPR A;  4OPA A;  4RCH A;  3GDQ A;  4WQ4 A;  3UKU A;  4CZF A;  3O9R A;  3BZC A;  5CYM A;  4CFD A;  4FSV A;  4CEC A;  5TKW A;  4PKH A;  4RW4 A;  4RG8 A;  3O1B A;  5EVZ A;  4LSN A;  4ELV A;  2V7Y A;  4CHO A;  4ZTF A;  1NLV A;  3O4Q A;  5HRS A;  1B92 A;  3PUF A;  2GBZ A;  3QFP A;  4CF0 A;  3CI5 A;  4PWD A;  4CVN E;  3N4P A;  3FZM A;  1NGF A;  3K59 A;  4QAG A;  4E7L A;  2P9L A;  3D2E B;  2O8B B;  1Y64 A;  1RT2 A;  5F1X A;  1K6Y A;  3E9L A;  3OY9 A;  3NMU A;  4BRK A;  4FZY A;  2GUP A;  3L0Q A;  1KTQ A;  4DSL A;  3CPE A;  4DSI A;  1S3X A;  1NKE A;  4GV6 A;  3ULD A;  2XO7 A;  2YNI A;  5C12 A;  4E0D A;  1DGK N;  4CK1 A;  4DTR A;  2G8I A;  1BI4 A;  4M7Y A;  4NCG A;  3ATV A;  3RMA A;  1OH6 A;  1IBM K;  4BR5 A;  4CF2 A;  2UUB K;  4OJR A;  5AQL A;  3SJJ A;  4FLW A;  1D9F A;  5E26 A;  4DWI A;  2HBL A;  3VQ9 A;  1TK8 A;  4FJ7 A;  1FKP A;  4BR9 A;  3DLK A;  3NGY A;  2WON A;  5KI6 A;  4GVE A;  5F0X A;  2JLE A;  3DRP A;  2ZD1 A;  2D0P A;  4KTW A;  1CLQ A;  2A42 A;  1VQ7 N;  4B3O A;  2FBY A;  4F2S A;  4LFA K;  5CE3 A;  4DR4 K;  3MEE A;  4IOX A;  3AVA A;  3ATU A;  1HJO A;  1B9F A;  1YT3 A;  1FW6 A;  1WSE A;  1BOT O;  2HBM A;  1SKR A;  2QKK A;  4R5P A;  1SL1 A;  4NCB A;  2FSK A;  3OYB A;  5BRD A;  3MWP A;  1TGO A;  2QWR A;  4GV3 A;  4DTM A;  1TYQ B;  1KFD A;  4J2D A;  1KD1 O;  3DXM A;  3L4Q A;  1S1W A;  3D7E O;  3LM2 A;  1MDU B;  1TVR A;  4ISF A;  1CXQ A;  2P51 A;  2P9I A;  3MX2 A;  1ESV A;  2D0A A;  4BRA A;  2YCH A;  4HVJ A;  2CGL A;  2X78 A;  4M3Y A;  4JEP A;  4BC3 A;  5AQW A;  1YJN N;  4BY9 C;  1QHT A;  3WXI A;  4CGJ A;  1QTM A;  4DV1 K;  4DLG A;  3NAE A;  1Q18 A;  3SUQ A;  3ZSV A;  3NCI A;  2YHW A;  4CZI A;  4CJL A;  3VEZ A;  5CYQ A;  3N4Q A;  3V1Q A;  3ZX0 A;  3NDK A;  3UE5 A;  3IS9 A;  2WUS A;  4BRC A;  3A2F A;  2HHV A;  3H3O B;  4RW6 A;  1K8K A;  3IFR A;  1X9J A;  3DLG A;  3K58 A;  1HYV A;  1NGC A;  1VQP N;  2NRH A;  1MU2 A;  4CI6 A;  2UU9 K;  2HVI A;  1RT1 A;  3M8R A;  4RW9 A;  3SQ2 A;  4DCH A;  3LWL A;  3HOS A;  1QZ5 A;  3BP8 A;  3RSE B;  3U9Z A;  1S22 A;  4BWM A;  3P5J A;  1HNZ K;  1C0M A;  1S5J A;  2IC3 A;  2ZWH A;  4BRP A;  4DFJ A;  1T7P A;  4B1U B;  1NK9 A;  5BPL A;  3VQE A;  4CBW A;  4O4G A;  3AO5 A;  1MWK A;  5AR0 A;  1QE1 A;  3A5L C;  3DOL A;  2DY4 A;  3ZSR A;  4CZK A;  2Y1J A;  2OA8 A;  3AGR A;  2O4G A;  5MLC Q;  3KLI A;  5M1Q A;  1IO2 A;  2ITG A;  3WNG A;  1VSK A;  3EE9 A;  3TTC A;  4FLX A;  1LAV A;  4FJX A;  5CZ2 A;  2GX9 A;  4C8O A;  3VQ8 A;  3UKR B;  4CER A;  4ELU A;  1GLD G;  4AHU A;  2YNH A;  3TTF A;  4MO4 A;  3HOT A;  4F8R A;  1TKX A;  4CEF A;  3HPH A;  1SS6 A;  3VQB A;  3ZX3 A;  3EZ5 A;  3HTV A;  3L2V A;  3WQU A;  3G71 N;  3FR0 A;  3MN6 A;  3HVR A;  4ILH A;  3V9W A;  3W0L A;  4CZG A;  1HJR A;  2E6L A;  4WE1 A;  1RIL A;  3QB0 A;  4BRQ A;  1W7A A;  2JWK A;  2P5G A;  2P9K A;  3MMV A;  4JD2 A;  5M1P A;  3TSP A;  3MAQ A;  1KSP A;  4BDY A;  3KTQ A;  5H1S Q;  5JS1 A;  4FPA A;  1V4T A;  2BH1 A;  4O0J A;  2OPP A;  4H0Y B;  1HQU A;  1YUW A;  4PKG A;  5AQK A;  1KXP A;  2D0B A;  3VN5 A;  1YJW N;  3O80 A;  4M3T A;  3SAG A;  1V4S A;  3I8B A;  4J2B A;  4LH5 A;  2OPQ A;  3QEW A;  2IS3 A;  2KFZ A;  3T1Y K;  3KLE A;  3JYT A;  4AQY K;  5GAH P;  5BPM A;  5C2D A;  1BCM A;  3IUC A;  3BF1 A;  5AQM A;  2OAN A;  4LF4 K;  3I0S A;  1ZBL A;  4JV5 K;  3VPZ A;  3VMF B;  4EFH A;  3LDL A;  3O9T A;  4BRL A;  4HUF A;  4FL9 A;  3HM9 A;  3SLC A;  3I56 N;  2Q97 A;  4CJQ A;  4W5T A;  3A5N C;  3VEV A;  2D5R A;  2NRZ A;  3AVN A;  4IOC L;  1S1U A;  3CM5 A;  4I6M B;  3KKR A;  3TU5 A;  5AQP A;  3F9K A;  5AZJ B;  3OYI A;  4DF8 A;  2GTD A;  1HKB A;  4PHT X;  1J5E K;  1NKC A;  1YAG A;  3WUH A;  5C0Y A;  4DFK A;  1KAX A;  3AAR A;  2ZGY A;  3BGR A;  1WAJ A;  4E7I A;  4M3R A;  4JNE A;  1VQ5 N;  4Z4I A;  3J7A P;  3QFU A;  4PL7 A;  4GW6 A;  3E9P A;  4KHU A;  1JLQ A;  1NOZ A;  2IAJ A;  1GLC G;  4AM7 A;  1IKY A;  1QQN A;  3OBW A;  4TSX A;  3WEE B;  4CEZ A;  3CPW M;  5JVG L;  1KQS M;  4KRF A;  5D3G A;  1HLU A;  1T05 A;  2AJQ A;  4KHS A;  3HRG A;  1JXB A;  3MEG A;  4F9O A;  3ZSW A;  5DK5 A;  3THW B;  4QS8 A;  3R8E A;  3ZEU B;  2GEL A;  1VQN N;  2OPS A;  3D45 A;  4CBX A;  1J53 A;  2UXC K;  3OJU A;  5AQI A;  2VWJ A;  4V19 S;  4BDP A;  3JAM O;  1BWF O;  2F4V K;  1HKG A;  4CF1 A;  3M8Q A;  1KC8 O;  3JS6 A;  4LD0 A;  1K8A O;  4JKF A;  4OLA A;  1QQM A;  2E8A A;  4CJV A;  4HCC A;  4CZL A;  4MLH A;  1VQK N;  1S9E A;  3THX B;  1WB9 A;  4E1J A;  3CJ9 A;  4FM1 A;  1K73 O;  4ILG B;  1NJX A;  4DG1 A;  4I9Q A;  4XH5 A;  3RTV A;  3WNF A;  4YOU A;  3L3V A;  4FXD A;  2P1J A;  2YV0 X;  4U67 L;  4OPH A;  4BRG A;  5BR9 A;  4W5N A;  1REV A;  5AQG A;  3SMS A;  3C6A A;  3B6P A;  3NF6 A;  3VQ6 A;  3VGK A;  4PUO A;  3G25 A;  4Z4H A;  1LWF A;  1T3V A;  4B1Y B;  3PIO L;  5AQY A;  4DR1 K;  1M1K O;  3TAB A;  4JAX A;  4UY8 O;  4FWK A;  3NHG A;  3SK3 A;  4W5Q A;  4A57 A;  3THV A;  2O8C B;  1GLA G;  1ATN A;  1QHA A;  4CZE A;  4CHP A;  3F73 A;  3LDP A;  5BRE A;  4CJP A;  2UYT A;  4M3W A;  1E3M A;  3V4I A;  2FBV A;  4OGC A;  4K8Z A;  3SUO A;  3BY5 A;  1YVN A;  4MDA A;  4FM2 A;  4XH1 A;  5LJV A;  4N41 A;  1WBD A;  4XEI A;  1KVB A;  3LPT A;  4GKJ K;  2A6A A;  4WFN L;  5J2M A;  5LL6 Z;  3TSU A;  2P9U B;  3AO3 A;  2KW4 A;  1KVC A;  4O0I A;  4H0P A;  1X3N A;  4FLZ A;  2IDO A;  1U4B A;  2OYQ A;  4FK0 A;  4DF4 A;  4XIU A;  1EXQ A;  3MN5 A;  5CY4 A;  3VQ7 A;  2YJE A;  1JLA A;  4B9T A;  4B9S A;  4DS5 A;  2QWM A;  1VQ4 N;  3EL2 A;  5CR4 A;  1T03 A;  3VF4 A;  2G8V A;  4DTO A;  4DQ8 A;  1NGH A;  3F5T A;  4K42 A;  4X65 K;  4JKE A;  4HTU A;  2G8H A;  4KO0 A;  4CFA A;  2AP1 A;  3O9Q A;  4EIA A;  5HRP A;  4MO5 A;  3S41 A;  1VSH A;  3HSC A;  5C42 A;  1SQK A;  2G8F A;  1T6D A;  1R0A A;  4DQQ A;  1ATR A;  4NLC A;  3QER A;  2QTD A;  4E1M A;  2KKZ A;  4LFC K;  1QZ6 A;  2GEM A;  3P31 A;  3ZCM A;  5C15 A;  3WNE A;  3O9S A;  1FJG K;  3UKU B;  5AQT A;  1DTQ A;  3C0B A;  4PKI A;  2CH5 A;  1XC9 A;  1RDC A;  1WSJ A;  1SL0 A;  1RBS A;  2YNF A;  2O8D A;  1T8E A;  1VSD A;  2HHQ A;  1G99 A;  3OYG A;  3TAP A;  4CJK A;  2YNG A;  4ISG A;  3KZB A;  3C6T A;  2ZM6 K;  4Y1C A;  2WFB A;  4IWV A;  3CMA N;  1TKD A;  2KQ2 A;  4H5V A;  2P5O A;  4K25 A;  4A5B A;  3OS1 A;  3J7Z O;  4FJK A;  4JKH A;  3H08 A;  1FKO A;  1ZXO A;  2NRV A;  3LZI A;  4QCL A;  1Z26 A;  4KHP K;  3AVB A;  4JHD B;  4DQI A;  4WF9 L;  1KFS A;  1XMQ K;  4C1N K;  1VRT A;  1SKS A;  3P39 A;  2HHH K;  3CCS N;  3TI0 A;  2O8F A;  2QI2 A;  1B9D A;  4JKG A;  4BVO A;  3PIP L;  3K2P A;  2YHB A;  5DM7 L;  5JS2 A;  4FJJ A;  2NUB A;  4CFB A;  3E66 A;  5M1O A;  2KTQ A;  4DFM A;  5HRR A;  1HNW K;  4YOX A;  1OKJ A;  1T6C A;  3SPZ A;  2OTJ N;  3FFK B;  4Z4F A;  1EET A;  1JCE A;  1NJY A;  1NWK A;  1OH5 A;  2RF2 A;  3VQ5 A;  4BGA A;  2V7Z A;  4IEE A;  4BRH A;  5JMV A;  4U7B A;  1DKG D;  4C23 A;  4AM6 A;  3THY B;  4DS4 A;  2W6K A;  3NVM A;  4O5B A;  3Q7C A;  3OVN A;  3MDQ A;  5ADX H;  3CXC M;  1RTJ A;  2QWQ A;  3OYF A;  3TAG A;  1S6Q A;  4A59 A;  4RW7 A;  4DU4 A;  4IFY A;  2CH6 A;  3PSF A;  1TUY A;  1A5V A;  3OYL A;  3M1F A;  1Q9X A;  2YHX A;  4DTJ A;  2IIR A;  3KHY A;  5EX5 A;  1YXQ A;  1QVF M;  1BQN A;  2X6S A;  4BAC A;  3E01 A;  1LCU A;  4EZ6 A;  3CER A;  3CFR A;  1S6P A;  2VQE K;  5AQQ A;  3AO2 A;  3GG4 A;  1C1C A;  2VYP A;  3WT0 A;  4BR7 A;  4JI0 K;  3B8A X;  4DV4 K;  1Y97 A;  3LAL A;  1JLG A;  3LP1 A;  3T1A A;  3DI6 A;  1OH7 A;  5HP1 A;  4NB4 A;  3ZSY A;  4KB1 A;  3RVC A;  4LF9 K;  1TK5 A;  3K5M A;  2FSN A;  3EKU A;  2FXU A;  4IXC A;  2HST A;  4IOA L;  1GOA A;  4IFE A;  4IZ9 A;  1MA9 B;  1QSY A;  2PYJ A;  4CEQ A;  4JI3 K;  4CD1 A;  4DR6 K;  4LY7 A;  4FWP A;  4ID5 A;  4CJS A;  4AHT A;  3T3F A;  3H6E A;  2HVH A;  4GVM A;  4A61 A;  3EYZ A;  3ZSX A;  4KB0 A;  2EWS A;  1TL3 A;  3CM6 A;  5F2R A;  1NGE A;  1XC3 A;  1NOY A;  1L3V A;  3CJC A;  1HKC A;  2NRR A;  3D2E A;  2O8B A;  2DPN A;  2W6L A;  1YHQ N;  2D0O A;  2ZJR L;  3VET A;  4GY2 B;  2RPI A;  1IG8 A;  3CG7 A;  1F21 A;  5FPE A;  4FJL A;  2VWK A;  4DUY K;  5C2F A;  3CJB A;  1RTI A;  1ZYQ A;  1LOT B;  4B8A B;  3CC7 N;  1WOQ A;  2O8E B;  3MCA B;  5A2Q O;  4Z4E A;  4DQS A;  5EU7 A;  3AGK A;  4FOI A;  2HW3 A;  1IBK K;  2Q31 A;  3VER A;  1BIU A;  4KKO A;  3DWL A;  1ZBI A;  4GNI A;  3ZX2 A;  4KHW A;  5AQU A;  3DJC A;  3M5R A;  2P9S B;  3OYN A;  1NGD A;  4ISE A;  4MDB A;  3LAK A;  3KLF A;  3VGM A;  3ZSO A;  2HB5 A;  2QK9 A;  3ZET B;  3K9K A;  3MWT A;  3TAR A;  3QEX A;  2QKB A;  1HMV A;  1S72 N;  2ZJQ L;  4LF8 K;  2F9W A;  4JI4 K;  2OZS A;  1S1X A;  2HNZ A;  2P9N B;  4CE9 A;  1NK7 A;  2X6N A;  4DHY A;  2I7P A;  3HZ6 A;  1NK8 A;  2BAN A;  3L2Q A;  1RDW X;  4CES A;  3L8B A;  1HNI A;  3O3G A;  4O8U A;  4C8M A;  1WNS A;  3T1H K;  4GKK K;  3CCL N;  3T7Z A;  1W0H A;  1C1B A;  3O4N A;  4BG8 A;  2HBJ A;  1ZBF A;  4OKE A;  5LMN K;  3LL3 A;  1QSS A;  1ZC6 A;  1HR0 K;  3EO3 A;  1DLO A;  1XHZ A;  1YJ9 N;  4YOR A;  3NVK A;  1GOB A;  2F8S A;  1C6V A;  3I33 A;  5LY3 A;  1ZBH A;  4JKD A;  3DYA A;  4CHY A;  4BVP A;  4OLB A;  2A1R A;  4JI7 K;  3H46 O;  1Q86 O;  1HPM A;  4UQG A;  1C0T A;  3KJV A;  4PL8 A;  3CET A;  3OA9 A;  3IMX A;  5AQJ A;  3CC4 N;  3D6R A;  3WNH A;  3ULE B;  3F2K A;  3VEX A;  2A41 A;  3AA2 A;  5KPT A;  4DQP A;  2ZE2 A;  4CJF A;  1FXX A;  1BDG A;  2FSJ A;  3M8P A;  3OYA A;  1CZ9 A;  2HHT A;  4HUE A;  3EKS A;  3UIQ A;  1L5U A;  4I2Q A;  1OVY A;  1S1T A;  1XMO K;  1KAY A;  3DLR A;  3RSE A;  3SI6 A;  5J1E A;  2KZZ A;  1BGX T;  4DV0 K;  3TAE A;  4EHU A;  4H0X B;  3K5O A;  3DM2 A;  3GE1 A;  4CEO A;  1DT9 A;  5GIP A;  1IKX A;  1RTH A;  3FZF A;  1CXU A;  4M7X A;  1HX1 A;  4KBO A;  3SPY A;  1Q81 O;  3GOI A;  5E84 A;  2BE2 A;  1NGI A;  1SZ2 A;  5TKY A;  1RDB A;  4BRI A;  4CGG A;  3L2U A;  1IKV A;  4BQL A;  3CCM N;  3VEW A;  3CME N;  2XRI A;  3ZT2 A;  4KH6 A;  2FF3 B;  3SAF A;  4DFP A;  4CJE A;  4QS7 A;  2VGM A;  4ELT A;  3VA3 A;  3H1Q A;  3CCV N;  2AA4 A;  3P1G A;  3QDK A;  2QEX N;  3MEC A;  1GOC A;  4KI6 A;  3SQ4 A;  3EEQ A;  3UKR A;  1O1W A;  2YI1 A;  4DR3 K;  4I9L A;  2GV9 A;  4BRM A;  1TKT A;  2YKM A;  4FOE A;  3RR7 A;  3DLB A;  3HJF A;  3QNO A;  5JLF A;  1N6Q A;  2KZM A;  2NRT A;  4IDK A;  4CIG A;  2ATQ A;  4DLE A;  3CQX A;  4N47 A;  3WXJ A;  1NKB A;  4JS4 A;  2V52 B;  1YF5 L;  3LAN A;  1GLJ O;  4H5T A;  3O3F A;  1JL2 A;  2Q2R A;  3AVK A;  4XH4 A;  2IGI A;  2B4J A;  1I39 A;  3BZK A;  3SQ1 A;  1VSI A;  4NYN A;  3EN9 A;  1JKH A;  3H3N O;  1NJI O;  2F7T A;  1BHL A;  3SZ2 A;  4RTF D;  4QOZ B;  2VWB A;  4IDH A;  5JIC A;  2JWL A;  1ITG A;  3QIC A;  4A5A A;  3S3M A;  3SQ0 A;  4BRD A;  4HUG A;  1JXE A;  1YVU A;  3E1Y A;  4CJU A;  1RDA A;  3WXK A;  5GAD P;  1N5Y A;  1JJ2 M;  5AFU A;  4F2R A;  4JLH A;  3FFI A;  1L3T A;  3CJ1 A;  3SBG A;  5IT9 O;  4L3Q A;  1WSF A;  1Q9Y A;  4FLT A;  4BWJ A;  3G10 A;  1LWE A;  1YIT N;  3BDP A;  1KLM A;  3FZL A;  4RWT A;  2VGN A;  3DLH A;  2FLO A;  3O1W A;  4CW7 B;  4CGD A;  1QQC A;  2IVN A;  3NH2 A;  1U49 A;  4CCH A;  3HP9 A;  3WQT A;  3K57 A;  1BUP A;  3D0P A;  4JKA A;  4AHR A;  5GIN A;  4W5R A;  4FLU A;  4KHQ A;  1X9M A;  1J6Z A;  4FJI A;  2BGG A;  2HHX A;  3R9P A;  2E4L A;  3C6H A;  3LDN A;  4CF9 A;  3LP2 A;  4I6M A;  1N34 K;  2P9P B;  3OYD A;  4DB3 A;  5AZJ A;  1TK0 A;  4E19 A;  1NU0 A;  5ADX A;  3CQY A;  3ZT3 A;  3TR8 A;  2XY8 A;  3VGL A;  1JLE A;  4FLY A;  2VG5 A;  1YI2 N;  1BA1 A;  3CIP A;  3HI0 A;  5HRN A;  1ZBU A;  2VG6 A;  3DRR A;  3G0Z A;  5LMU K;  4A2B A;  5IWA K;  4CJ3 A;  2UXD K;  1BL3 A;  4EP4 A;  3CYM A;  3HK2 A;  1X1P A;  4B1X B;  2QA4 N;  4Z0U A;  4CHQ A;  4OGE A;  4M3U A;  3LZJ A;  5AQO A;  1J9A A;  5AZI B;  3PX0 A;  3WEE A;  2KHO A;  4J8F A;  4Y1D A;  3AO4 A;  3SCX A;  3NH1 A;  1D8Y A;  4Z94 A;  4DV3 K;  3OYH A;  1GLB G;  1SKW A;  4Q5V A;  2D1K A;  5FDL A;  3PX6 A;  1NJW A;  1WSG A;  1KCF A;  3O08 A;  3ZEU A;  2XY7 A;  3C95 A;  2NNW A;  4OKJ A;  2ZF5 O;  5M1K A;  3J8A A;  3TAF A;  3KD5 E;  5AQZ A;  3KK2 A;  4KH5 A;  1XNQ K;  3QO9 A;  3PLA A;  2H3G X;  2RN2 A;  3RRG A;  4DU3 A;  4LF7 K;  3OS2 A;  3C7N B;  5AQS A;  4CD3 A;  3U3Y A;  3BF3 A;  3ZYY X;  1RBV A;  4BRF A;  3QIP A;  2DTU A;  3K0S A;  2QXF A;  1S1V A;  2A3Z A;  3ZT4 A;  5BN8 A;  3ISN C;  2F96 A;  3OBY A;  4E7K A;  4B3T K;  1P8Z A;  1RBU A;  4EAH D;  4KTQ A;  1C0U A;  1RT5 A;  3DXK B;  3VOV A;  3VQ4 A;  4B8C A;  4DV2 K;  1LV5 A;  4Q0B A;  4ID1 A;  3CD6 N;  3ITH A;  5EOY A;  1IG9 A;  4E89 A;  3D2F B;  1JLF A;  3ENB A;  3AVG A;  4K41 A;  1NK0 A;  1LAW A;  1VQO N;  1HRH A;  4MQ3 A;  4CJW A;  1U47 A;  1RNH A;  3JSM A;  4OPJ A;  3MCP A;  3O5B A;  3CJA A;  4WCE L;  1VQ9 N;  4CBU A;  2A1S A;  2FC0 A;  3P83 D;  1SAZ A;  3JXU A;  1VQM N;  3MXJ A;  2O8F B;  2V51 B;  4CK2 A;  3OS0 A;  2ZGZ A;  1ATS A;  4BR4 A;  1I3A A;  2HF3 A;  2O8C A;  1TUU A;  1KLN A;  4FJ9 A;  4AHS A;  3LPU A;  2PZS A;  5HLF A;  1NMD A;  1A5W A;  4DSF A;  4CK3 A;  1RFQ A;  2Q1N A;  2F8T A;  3CFO A;  3V1O A;  3AVF A;  1GLE G;  1N8R O;  3L2R A;  3FZH A;  4LF6 K;  1Z6R A;  1BU6 O;  2W42 A;  2OCE A;  1KAZ A;  2E20 A;  2HND A;  4AIL C;  2P9L B;  1RDU A;  2P9U A;  3TTD A;  4BR0 A;  4JI6 K;  5KRT A;  3CCR N;  4IJN A;  2DFE A;  5AQV A;  4DKW A;  3ZSZ A;  3HT3 A;  4M3X A;  5AFU H;  4M3Z A;  4LSL A;  2I5J A;  1XUP O;  1HYS A;  2QWO A;  1MWM A;  1K9M O;  2PAV A;  5C24 A;  3U4L A;  1WN7 A;  3KKS A;  3AVL A;  2FBT A;  1JL1 A;  1WSH A;  4CJ4 A;  4AF1 A;  3L2W A;  3CCE N;  2DFF A;  4H0O A;  1GLF O;  1BI4 B;  3LP3 A;  2GUI A;  1UA0 A;  4HHT A;  3LM9 A;  4N5S A;  1NBW A;  4G1Q A;  3KVG A;  4B1Z A;  4FVM A;  3AAQ A;  2Q3S A;  1LW2 A;  3MXI A;  3BEX A;  2VQF K;  4CZJ A;  3CCJ N;  4BRE A;  1WLJ A;  2WTU A;  4DR5 K;  3QIN A;  4CJ5 A;  3DMJ A;  4NO7 A;  4BE0 A;  1BIS A;  2B5J A;  1VAZ A;  1RBR A;  4FYD A;  2PYL A;  2OPR A;  4JI8 K;  1U2V A;  3ENO A;  4LC9 B;  2A5X A;  4FW1 A;  1NGA A;  3SNN A;  1DEJ A;  1W97 L;  4H0V B;  3V81 A;  1JLC A;  2F9T A;  4E1N A;  5AQN A;  3CF5 L;  4O44 A;  5AQH A;  4CZM A;  4FZZ A;  1UOC A;  4LF5 K;  4H5W A;  3RMB A;  4BDZ A;  2Z1G A;  4MFB A;  1LW0 A;  3OYJ A;  3C6U A;  1J54 A;  4FK4 A;  2E6M A;  3LDO A;  2FBX A;  3NFA A;  3SBT A;  4B3M K;  1Q8I A;  3LDQ A;  1VSJ A;  4DTS A;  3J7Y P;  4H8K A;  3AVI A;  2RE2 A;  4CJR A;  3DXM B;  4O5F A;  3NH0 A;  4ILJ A;  2KLA A;  3ASM A;  2ASP A;  4JRQ A;  4DV6 K;  5ELZ A;  2P9I B;  4JK8 A;  4FCY A;  1C0F A;  1TKZ A;  3QET A;  1TV6 A;  4JHD A;  1VSM A;  3HL8 A;  4IO8 A;  3OW2 M;  1RBT A;  1CZB A;  4M41 A;  2D0C A;  3DAW A;  3NBP A;  4Z4C A;  2Q0R A;  3F9M A;  4H03 B;  3PO4 A;  4DTU A;  3R1X A;  2HHU A;  3K9J A;  1SL2 A;  2QWP A;  4H5R A;  2NRW A;  4IJA A;  3U9D A;  5E41 A;  2Q36 A;  1QQO A;  5J2N A;  3RMC A;  4PQU A;  5BN9 A;  3QML A;  3TAQ A;  1EQY A;  4JK7 A;  4FVU A;  4O55 A;  5KGW A;  4YNQ A;  2E2Q A;  3VQP A;  3CHW A;  2NRX A;  4JI5 K;  1K8K B;  1QS4 A;  1IBL K;  3HO1 A;  3THY A;  2KFN A;  3HPO A;  4BR2 A;  3I8D A;  5JVH L;  5HRO A;  2YHA A;  1RT3 A;  4H4O A;  4BG9 A;  1YIJ N;  2CGJ A;  2ASM A;  3QBX A;  3OYC A;  2X74 A;  3OYK A;  2E2O A;  3J81 O;  5C25 A;  1YTA A;  4JRP A;  3R6M A;  1XQS C;  3MN9 A;  4CGI A;  2PBD A;  4GV9 A;  3NGI A;  1XI1 A;  1X3M A;  4LH4 A;  4CGF A;  2ETJ A;  1HYZ A;  1JCF A;  4YY3 K;  3O8M A;  4OKK A;  3R3L A;  3VTI A;  5K14 A;  1WBB A;  2E1Z A;  5SWM A;  4X64 K;  1NJZ A;  1FK9 A;  3PSI A;  2DFH A;  2EX3 A;  3NF9 A;  1HQE A;  4N56 A;  3S3O A;  1NK4 A;  3WXM B;  4B9V A;  4FWS A;  2E2P A;  3MX5 A;  3ZLJ A;  3NGZ A;  1T44 A;  3M3Z A;  3SMP A;  5HOO A;  4B9N A;  5FPD A;  2BTF A;  3L6Q A;  3FLC O;  1OH8 A;  2E1Y A;  4JI1 K;  1YTU A;  3DOK A;  1RT7 A;  3CC2 N;  2Z1I A;  4JI2 K;  3ZT1 A;  3CJ7 A;  3VQA A;  1XHX A;  4A2A A;  2HMI A;  1DTT A;  3HVT A;  2OZM A;  5DMR A;  3SJH A;  3C65 A;  1HUX A;  3MN7 A;  4I7F A;  1KRP A;  4CIF A;  4IFV A;  4LFB K;  3BUZ B;  1N32 K;  3VEN A;  3TAM A;  1Q7Y O;  1OVQ A;  3AAP A;  4KFB A;  4BE1 A;  1HNV A;  4YHH K;  3O9U A;  4BRO A;  5LJW A;  2Y1I A;  1EP4 A;  3AO1 A;  4E7H A;  2P9K B;  1TYQ A;  4JD2 B;  5KTQ A;  1M90 O;  1EWR A;  4KAZ A;  2VG7 A;  3M6G A;  1BO5 O;  3ID8 A;  3RWU A;  1P90 A;  3G4S N;  3AA5 X;  3O4W A;  4OX9 K;  1IH7 A;  5J2P A;  3U6F A;  4DMN A;  2ZQB A;  5GAG P;  3VQQ A;  2O8E A;  2RKI A;  4FWL A;  1D4X A;  1H1V A;  4DU1 A;  3KK3 A;  3QLH A;  1XWL A;  4E3S A;  3CCU N;  3NF7 A;  4FJ5 A;  4CF8 A;  3CQ8 A;  4WQ5 C;  5FLX O;  4IO9 L;  3EZW A;  3OHR A;  5I42 A;  4FO0 A;  2E2N A;  4ZTJ A;  3LP0 A;  4DR2 K; 
#chains in the Genus database with same CATH homology
 4NLC A;  2VGN A;  1RGI A;  2FLO A;  2CGK A;  2P9S A;  4GVE A;  3O1W A;  5BRH A;  5F0X A;  2QTD A;  2GWJ A;  3P38 A;  1VQ8 N;  2KKZ A;  2D0P A;  4YOY A;  2IVN A;  1QZ6 A;  2GEM A;  3P31 A;  3VTH A;  3ZET A;  5C15 A;  2A42 A;  2FF6 A;  3O9S A;  1VQ7 N;  3WQT A;  3UKU B;  2YJF A;  5AQT A;  3C0B A;  1BUP A;  4PKI A;  1BG3 A;  5CE3 A;  2CH5 A;  4JKA A;  5GIN A;  2D4W A;  2IVP A;  1J6Z A;  2WBN A;  3QBW A;  3CCQ N;  4IOX A;  4JN4 A;  4WYB A;  2ASO A;  2HMP A;  3ATU A;  4JKB A;  3R9P A;  3C6H A;  1G99 A;  2P9N A;  1HJO A;  3LDN A;  4WQ5 A;  4I6M A;  4ISG A;  2HBM A;  1BOT O;  3KZB A;  2P9P B;  3UB5 A;  4DB3 A;  3E9O A;  5AZJ A;  2WFB A;  5M1F A;  4IWV A;  3CMA N;  1IJJ A;  5ADX A;  3CQY A;  4H5V A;  2FSK A;  5BRD A;  3MWP A;  4K25 A;  2Q0U A;  3VGL A;  4A5B A;  2QWR A;  5KQD A;  4GV3 A;  1TYQ B;  3J7Z O;  4JKH A;  1YI2 N;  1BA1 A;  1KD1 O;  3DXM A;  4C1N I;  3L4Q A;  1ZXO A;  3CIP A;  3GBT A;  3HI0 A;  3D7E O;  1ILY A;  2NRV A;  3LM2 A;  1MDU B;  4A2B A;  4ISF A;  3MX2 A;  2P9I A;  1ESV A;  4BRA A;  2YCH A;  2CGL A;  4JHD B;  2W40 A;  4WF9 L;  4B1X B;  2QA4 N;  3HBT A;  4JEP A;  4BC3 A;  4C1N K;  5AQO A;  5AQW A;  1YJN N;  4BY9 C;  5BPN A;  5AZI B;  2BUP A;  3WXI A;  3P39 A;  3WEE A;  3CCS N;  2KHO A;  4J8F A;  3L4I A;  2QI2 A;  4JKG A;  4BVO A;  3PIP L;  4Z94 A;  5DM7 L;  4BGB A;  1Q18 A;  2IVO A;  1GLB G;  3E66 A;  5M1O A;  2D1K A;  1GLL O;  2YHW A;  4YOX A;  1OKJ A;  5C10 A;  1NGG A;  3O08 A;  4CZI A;  1T6C A;  3ZEU A;  2OTJ N;  3FFK B;  1QVG M;  3VF2 A;  2NNW A;  1JCE A;  3VEZ A;  1NWK A;  2ZF5 O;  5M1K A;  4BGA A;  2WC9 A;  3J8A A;  2V7Z A;  3N4Q A;  3ZX0 A;  4IEE A;  5AQZ A;  4KH5 A;  4BRH A;  3UE5 A;  2WUS A;  4BRC A;  3PLA A;  2H3G X;  3H3O B;  5JMV A;  1K8K A;  4U7B A;  3IFR A;  4UY8 O;  1X9J A;  1BA0 A;  1DKG D;  3C7N B;  1NGC A;  5AQS A;  3ULE A;  4AM6 A;  2NRH A;  4C23 A;  3NVM A;  1VQP N;  3Q7C A;  3BF3 A;  1E4G T;  4CI6 A;  3ZYY X;  2RHK A;  3MDQ A;  5ADX H;  4BRF A;  3CXC M;  4BC4 A;  2QWQ A;  2A3Z A;  4DCH A;  2YHY A;  2PFU A;  3HOS A;  4O8K A;  5BN8 A;  1QZ5 A;  3BP8 A;  3RSE B;  4A59 A;  3U9Z A;  1S22 A;  3OBY A;  2OTL N;  2CH6 A;  4KH4 A;  1P8Z A;  4EAH D;  1TUY A;  4BRP A;  2ZWH A;  3M1F A;  2YHX A;  2IIR A;  3A8Y A;  3DXK B;  3KHY A;  4B1U B;  3FE1 A;  4BR0 A;  5BPL A;  5EX5 A;  1YXQ A;  1QVF M;  3VOV A;  4CBW A;  3ID6 A;  3CD6 N;  5EOY A;  1LCU A;  1MWK A;  3D2F B;  1CZA N;  3ENB A;  3A5L C;  4K41 A;  5AR0 A;  5EY4 A;  2E88 A;  3CER A;  4R79 A;  4HTL A;  5GAE P;  4CZK A;  1VQO N;  5AQQ A;  3GG4 A;  1NGB A;  3AGR A;  2VYP A;  3WT0 A;  4BR7 A;  5MLC Q;  5M1Q A;  3MCP A;  3O5B A;  2ZJP L;  3B8A X;  3CJA A;  4WCE L;  2QWL A;  1VQ9 N;  3EE9 A;  4CBU A;  3TTC A;  5EXW A;  3H45 C;  4NB4 A;  3RVC A;  1SAZ A;  3JXU A;  1VQM N;  3KWI A;  2V51 B;  2FSN A;  3A5M C;  3EKU A;  2GX9 A;  1U6Z A;  2FXU A;  2ZGZ A;  1ATS A;  4IXC A;  3U8X A;  4BR4 A;  4CZH A;  5JLH A;  3UKR B;  2HF3 A;  5AQX A;  5CHI A;  1TUU A;  2HST A;  1GLD G;  3A5O C;  1Q82 O;  4IOA L;  4IFE A;  3ENH A;  2ITM A;  1E4F T;  4MO4 A;  3TTF A;  3HOT A;  4IZ9 A;  1MA9 B;  1NMD A;  3O6W A;  4CD1 A;  2NZT A;  1SS6 A;  3ZX3 A;  1RFQ A;  3HTV A;  2Q1N A;  3FGU A;  4FWP A;  5BRF A;  3WQU A;  3G71 N;  3FR0 A;  3H6E A;  4A61 A;  3MN6 A;  1GLE G;  4B1W B;  4ILH A;  3W0L A;  1N8R O;  3FZH A;  1Z6R A;  1BU6 O;  2EWS A;  2W41 A;  4CZG A;  5DM6 L;  5F2R A;  1KAZ A;  1NGE A;  1XC3 A;  3QB0 A;  2E20 A;  4BRQ A;  2P9L B;  3I55 N;  1RDU A;  2JWK A;  1HKC A;  2NRR A;  2P9U A;  3CJC A;  3D2E A;  3TTD A;  3VF6 A;  2DPN A;  2P9K A;  2HOE A;  3MMV A;  4JD2 A;  5M1P A;  3TSP A;  5AQR A;  5M1N A;  3CCR N;  1YHQ N;  2D0O A;  2ZJR L;  3VET A;  4IJN A;  4GY2 B;  4DKW A;  2J4R A;  5AQV A;  5H1S Q;  1IG8 A;  3TPQ A;  5FPE A;  5AFU H;  4FPA A;  5AQF A;  5FPM A;  1XUP O;  2QWO A;  1MWM A;  1NM1 A;  5C2F A;  5I9E B;  2PAV A;  1K9M O;  3U4L A;  3CJB A;  3WXL A;  1V4T A;  4NLB A;  4FWM A;  2BH1 A;  4H0Y B;  3VEO A;  1YUW A;  4PKG A;  1LOT B;  5AQK A;  1KXP A;  3CC7 N;  4BQZ A;  4AF1 A;  1WOQ A;  3CCE N;  4OO1 J;  4H0O A;  1GLF O;  1YJW N;  3O80 A;  3MCA B;  1VQ6 N;  3TSQ A;  3GL1 A;  3SAG A;  1V4S A;  3LM9 A;  1NBW A;  3I8B A;  4BC2 A;  2A40 A;  3KVG A;  4B1Z A;  4JKC A;  3AGK A;  3AAQ A;  3HM8 A;  3BEX A;  4FOI A;  3MK6 A;  4CZJ A;  3CCJ N;  4B9Q A;  4BRE A;  2Q31 A;  3VER A;  3DWL A;  5GAH P;  5BPM A;  5C2D A;  4JK9 A;  4GNI A;  5FPN A;  3ZX2 A;  3IUC A;  4NO7 A;  4H5N A;  3BF1 A;  3P4I A;  5AQM A;  2OAN A;  3KK7 A;  3DJC A;  3M5R A;  5AQU A;  2P9S B;  1VAZ A;  1NGD A;  4ISE A;  4MDB A;  3VPZ A;  3VMF B;  4EFH A;  3LDL A;  5GIO A;  3O9T A;  4FWQ A;  3VGM A;  1U2V A;  4BRL A;  3ENO A;  1W2B M;  4FL9 A;  3ZET B;  4LC9 B;  3K9K A;  2A5X A;  3MWT A;  3SLC A;  1NGA A;  1DEJ A;  1W97 L;  4H0V B;  4YOT A;  3I56 N;  2F9T A;  2Q97 A;  4FWR A;  1VQL N;  5AQN A;  3CF5 L;  1S72 N;  4CZM A;  5AQH A;  3A5N C;  3VEV A;  2ZJQ L;  4G9Z A;  3DLL L;  1R59 O;  4H5W A;  2F9W A;  2NRZ A;  3H1V X;  4MLE A;  4K43 A;  4IOC L;  1O13 A;  3FZK A;  1Z05 A;  2P9N B;  4QS9 A;  3W3D A;  4DHY A;  2I7P A;  3AY9 A;  3HZ6 A;  4I6M B;  5AQP A;  3TU5 A;  2P9P A;  3G6E N;  4A62 A;  1RDW X;  4M63 C;  5AZJ B;  2GTD A;  4B1V A;  3LDO A;  3SBT A;  1HKB A;  4O8U A;  2HF4 A;  3LDQ A;  4PHT X;  1YAG A;  3WUH A;  5C0Y A;  1KAX A;  3AAR A;  3T7Z A;  3CCL N;  2ZGY A;  2RE2 A;  2QM1 A;  4JNE A;  4FWN A;  3DXM B;  1VQ5 N;  4O5F A;  4ILJ A;  2KLA A;  2ASP A;  4BG8 A;  2HBJ A;  5ELZ A;  4YOV A;  2P9I B;  4JK8 A;  1C0F A;  3QFU A;  4PL7 A;  4JHD A;  3E9P A;  3LL3 A;  2GWK A;  3Q7B A;  3A0I X;  5B8H A;  3KWG A;  1ZC6 A;  1GLC G;  4AM7 A;  4IO8 A;  4WFB L;  2NLX A;  3EO3 A;  3OW2 M;  5AZI A;  1QQN A;  3OBW A;  3WEE B;  5JVG L;  1WUA A;  3CPW M;  1KQS M;  1YJ9 N;  4YOR A;  3NVK A;  4JKG B;  2I7N A;  3DAW A;  3I33 A;  5LY3 A;  2Q0R A;  3F9M A;  4H03 B;  4JKD A;  3R1X A;  3SAH A;  3K9J A;  1HLU A;  2QWP A;  4BVP A;  3EE8 A;  2NRW A;  1C0G A;  4H5R A;  4IJA A;  3U9D A;  5HL7 L;  3HRG A;  2Q36 A;  4F9O A;  1QQO A;  3VES A;  2VCP A;  3H46 O;  5BN9 A;  1HPM A;  1Q86 O;  4QS8 A;  3QML A;  4YDU C;  2GEL A;  3R8E A;  3ZEU B;  1VQN N;  1EQY A;  4H0T B;  4JK7 A;  4FPB A;  4CBX A;  4FVU A;  4PL8 A;  1JCG A;  3CET A;  3OA9 A;  2YX6 A;  5AQI A;  2QW9 A;  3IMX A;  5KPZ A;  1BWF O;  2E2Q A;  5AQJ A;  1HKG A;  3IDH A;  1KC8 O;  1U2V B;  3JS6 A;  3CHW A;  2NRX A;  3CC4 N;  1K8K B;  3D6R A;  4JKF A;  4BRN A;  1K8A O;  4FWO A;  3C7N A;  1QQM A;  4HWI A;  3ULE B;  2E8A A;  3F2K A;  3VEX A;  2A41 A;  4BR2 A;  5JVH L;  5KPT A;  4BG9 A;  1YIJ N;  2HBK A;  4CZL A;  2CGJ A;  1BDG A;  4MLH A;  2ASM A;  2FSJ A;  3QBX A;  4CJ7 A;  1VQK N;  3EKS A;  2E2O A;  1OVY A;  4WFA L;  1KAY A;  3RSE A;  4E1J A;  2QXL A;  3CJ9 A;  3R6M A;  3T69 A;  4ILG B;  1K73 O;  1XQS C;  3MN9 A;  4XH5 A;  4EHU A;  2PBD A;  4H0X B;  4WQ4 C;  4YDU A;  4YOU A;  4GV9 A;  3GE1 A;  1EO1 A;  1DT9 A;  5GIP A;  3DXK A;  4CD3 A;  4YOW A;  1X3M A;  4U67 L;  3FZF A;  4M7X A;  4EHT A;  4IEI A;  1HX1 A;  4OPH A;  4KBO A;  1Q81 O;  4BRG A;  1JCF A;  3D2F A;  3GOI A;  4Y0W A;  5E84 A;  5BR9 A;  1NGI A;  3O8M A;  3R3L A;  3VTI A;  1ZBS A;  1SZ2 A;  5AQG A;  2E1Z A;  5TKY A;  4BC5 A;  3VEY A;  4BRI A;  3SMS A;  3C6A A;  3IKM A;  4BQL A;  3WXM B;  3CCM N;  4FWS A;  3VEW A;  3CME N;  3VGK A;  2QWN A;  5KQ8 A;  4KH6 A;  2E2P A;  2FF3 B;  3G25 A;  3SAF A;  4QS7 A;  1NGJ A;  2VGM A;  1T3V A;  3MX5 A;  4B1Y B;  3PIO L;  5AQY A;  3H1Q A;  1T44 A;  3CCV N;  3M3Z A;  2AA4 A;  3SMP A;  5HOO A;  1M1K O;  3QDK A;  4JAX A;  5KPR A;  4FWK A;  5FPD A;  2BTF A;  3L6Q A;  4OPA A;  3FLC O;  3SK3 A;  2QEX N;  2E1Y A;  4A57 A;  4RCH A;  3UKR A;  3GDQ A;  2YI1 A;  1GLA G;  1ATN A;  1QHA A;  4WQ4 A;  3UKU A;  4CZE A;  3CC2 N;  4CZF A;  3LDP A;  3CJ7 A;  5BRE A;  3O9R A;  4A2A A;  4BRM A;  4FSV A;  2UYT A;  4FOE A;  5TKW A;  3C65 A;  3SJH A;  1HUX A;  4PKH A;  5JLF A;  3MN7 A;  2NRT A;  3O1B A;  5EVZ A;  1YVN A;  2V7Y A;  3BUZ B;  3CQX A;  1NLV A;  4MDA A;  3WXJ A;  3VEN A;  4XH1 A;  5LJV A;  2V52 B;  1Q7Y O;  3AAP A;  1YF5 L;  4XEI A;  1GLJ O;  3QFP A;  4H5T A;  3CI5 A;  3O9U A;  4BRO A;  3N4P A;  5LJW A;  2Q2R A;  3FZM A;  1NGF A;  2A6A A;  4WFN L;  4XH4 A;  2P9L A;  3TSU A;  2P9U B;  3D2E B;  1Y64 A;  2P9K B;  1TYQ A;  4JD2 B;  5F1X A;  4H0P A;  1X3N A;  3EN9 A;  3H3N O;  1M90 O;  3E9L A;  1NJI O;  3NMU A;  2F7T A;  4BRK A;  3M6G A;  1BO5 O;  2GUP A;  3ID8 A;  4RTF D;  1P90 A;  3L0Q A;  2VWB A;  3MN5 A;  3CPE A;  3G4S N;  1S3X A;  4IDH A;  3O4W A;  5JIC A;  2YJE A;  2JWL A;  4GV6 A;  3QIC A;  4A5A A;  2QWM A;  1VQ4 N;  4BRD A;  5C12 A;  5GAG P;  1DGK N;  3E1Y A;  4FWL A;  3EL2 A;  1D4X A;  3WXK A;  1H1V A;  5CR4 A;  4M7Y A;  5GAD P;  3ATV A;  3VF4 A;  4DQ8 A;  1NGH A;  1JJ2 M;  5AFU A;  3F5T A;  4BR5 A;  3CCU N;  4K42 A;  5AQL A;  4JKE A;  5E26 A;  3CJ1 A;  2HBL A;  3SBG A;  2AP1 A;  4WQ5 C;  4IO9 L;  3EZW A;  3O9Q A;  4L3Q A;  3OHR A;  4MO5 A;  4EIA A;  4FO0 A;  4BR9 A;  3S41 A;  2E2N A;  3HSC A;  1YIT N;  1SQK A;  1T6D A;  1ATR A;  3FZL A;  4RWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...