3KWGA

X-ray structure of ns1 effector domain w187a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
b'TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEANDNTVRVSKTLQRFAWGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 35
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwgA00
3L4QA 3KWGA 3OA9A 3P31A 3O9SA 3O9UA 3RVCA 3O9RA 3M5RA 3F5TA 3EE8A 3O9TA 4OPAA 3D6RA 3EE9A 3KWIA 2GX9A 2KKZA 3O9QA 4OPHA 3P39A 3P38A 2RHKA
chains in the Genus database with same CATH superfamily
2NRXA 1NJIO 3C7NB 4JI4K 4DTUA 4YHHK 1Y97A 4FW1A 2W41A 1OVQA 1BIUA 3C6TA 3CI5A 2HHVA 4W5TA 3LWLA 4DR2K 5IWAK 3CJBA 2GUPA 2QWLA 1WLJA 1T44A 2HBKA 5KPTA 2A5XA 1NK5A 1QQCA 3C7NA 4J2DA 5AQPA 4CHYA 5TKYA 2O4IA 4KH6A 2BANA 4OGEA 1RT6A 4CEEA 4EIAA 2BTFA 3KJVA 3R1XA 3O9RA 1RBTA 3QINA 3E01A 3F2KA 3CCSN 3TU5A 1D5AA 1VSDA 1HNWK 3SAFA 1KAZA 5AQFA 2QKBA 3L3UA 3CJAA 3NF6A 3I0RA 2O4GA 1EXQA 5BREA 3WQTA 3LALA 4ZTFA 1A5VA 2OZMA 1QQNA 4F4KA 2IVNA 2FBXA 3QIPA 2F9WA 4A61A 3OS0A 2WOMA 4KTWA 2WC9A 1ATSA 3KKRA 1Q18A 4H5WA 1NJZA 5C15A 4KI6A 3O1WA 3AGKA 3D2EB 2D0CA 3QLHA 1IBMK 3WNGA 5AZIB 1GLLO 1SL2A 4GNIA 3O9SA 4FK4A 3CFOA 3QEWA 3VQ8A 2E2NA 4PKHA 3KLHA 4PL7A 1XHZA 3K9KA 1MDUB 2FBTA 1A5XA 4JRQA 2YJFA 3AARA 2KFNA 4CBWA 3D2EA 4I2PA 4MDBA 1RTJA 4FJ5A 5AZIA 1NGFA 4YFUA 3CCVN 3K5LA 5KGWA 3MAQA 4WFBL 1QVGM 1HYZA 3BZCA 3DJCA 1UA1A 3E1YA 2GV9A 2A6AA 1BHLA 2RE2A 2HMIA 2E1ZA 1ASWA 3NH2A 1WAJA 3ZSZA 4DTXA 1UWBA 3V6DA 3CMAN 1WUAA 5FLXO 5E84A 4MO5A 3UIQA 1JKHA 3ZX3A 3PY8A 1L3SA 3DLEA 4CF9A 3V9WA 2Z1IA 2HF3A 3E9PA 5T7BA 2WUSA 1C0FA 3CCUN 2V7YA 5FPNA 1ZBHA 2KTQA 1UOCA 2UXCK 4DR5K 4DR1K 5AQKA 4NCGA 3GL1A 4CJQA 3K58A 4JKCA 4WFAL 3LWMA 2XY7A 3VA0A 1NOZA 3KLEA 4CJLA 2ZJQL 4CJKA 4YOWA 4CJVA 4DFKA 2AJQA 4HTUA 2QKKA 3FE1A 3AO2A 4TSXA 5JVHL 4HUFA 1W0HA 4DV7K 5I3UA 5HRNA 4YOVA 2YNIA 4BRCA 5FPDA 4KKOA 2O8EB 4FM2A 5BRDA 3VQCA 2B6AA 1Z25A 3AVAA 3A5NC 5JMVA 4QCLA 4AQYK 5M1KA 2VG6A 4CGDA 2NLXA 4QS7A 3OYEA 4WF9L 3WXKA 3KLGA 4PWDA 4CGHA 1GLJO 1VSKA 2GELA 2X74A 4GY2B 5B8HA 4KV8A 2RHKA 1TUYA 2XY8A 2A1RA 1MA9B 1NMDA 3KWGA 4YOTA 5KI6A 4DTJA 3AVFA 3LP3A 4KO0A 4DCHA 2KZZA 1C0UA 4CZKA 4BR9A 2O8EA 4JKBA 3TAQA 3C95A 4XH4A 3C6HA 3IAYA 2ZF5O 3E66A 4OKKA 4E7HA 1SAZA 2UUAK 1L3VA 1S9EA 4FZZA 1RNHA 3GBTA 3WQUA 1GLEG 2YHAA 3CJCA 1XC9A 3AAPA 4CGIA 4KHUA 4K41A 3H3NO 4RTFD 3L2VA 2E8AA 3OYHA 4H0VB 4I7FA 4C23A 1J5EK 4FPAA 2ZM6K 5AQWA 5MLCQ 2Q97A 2JWLA 3OJUA 4OLBA 4CEAA 2BUPA 4CERA 2P9SB 3OYFA 1BO5O 5A2QO 4JEPA 3M8PA 1HX1A 4EHTA 1BG3A 2QWRA 3U9ZA 4CK1A 3R9PA 3B8AX 5AQGA 1VSHA 2G8HA 4F2SA 4LSLA 4CJUA 2F9TA 4CESA 2Z1HA 3CJ7A 1NK7A 4NB4A 4BDPA 3M8QA 1TL3A 5AQIA 1Q7YO 2W6KA 4NO7A 5KQDA 2P9SA 1X9WA 1XNRK 4BE1A 3QEIA 4O8KA 2UU9K 4L3QA 2HF4A 3FZKA 4FWKA 2PY5A 4FJMA 2QK9A 3AVHA 5ADXA 2H3GX 3G71N 4PA1A 2G8VA 3CMEN 4MQ3A 3VQQA 4DQSA 4FLVA 2PAVA 4B3TK 3PIOL 3DYAA 1JLQA 4DV0K 5M1NA 3IS9A 3L4QA 3C6AA 1G99A 3ZX2A 4FWLA 3NE6A 2I7PA 3K5NA 4CFCA 1G15A 1VSMA 1T8EA 2GUIA 2R7YA 2OA8A 3O5BA 4RW6A 3BF3A 3I55N 4JI7K 4O55A 4B3MK 1S3XA 5C42A 4CFAA 1TKTA 1JLBA 2HBMA 3EL2A 1VQ6N 3KLIA 4KRFA 1U45A 3SLCA 1LCUA 4KB0A 1NM1A 5HP1A 3LZJA 3J81O 1SKSA 2YV0X 2E2PA 1T3VA 4UQGA 3J7YP 3RR7A 4CJWA 2GTDA 5HBMA 1XC3A 1GLBG 3SPYA 5DK5A 4ISEA 2F8SA 2CH6A 4C8OA 3ENBA 3F73A 2QXLA 3LP1A 3VQ4A 5D3GA 1VHXA 5HLFA 4C8LA 4KPYA 2P5GA 1X3MA 1GLCG 4CJFA 3UKRA 4CHZA 4WE1A 3QERA 3OYKA 4H5RA 3CC2N 3ZSOA 4OO1J 4DQ8A 1IO2A 4B9MA 3E9LA 4A57A 4WYBA 4Z94A 4KHYA 2FF6A 5AJ3K 3VF4A 5ADXH 1SL0A 2OPQA 4FL9A 4CD3A 3SV3A 1L3TA 3ULEB 1Q9YA 4CCHA 3AVIA 4IDHA 3AVMA 3L3VA 1KVCA 4IBNA 3JS6A 3ZETB 4FWOA 1YTUA 3VGKA 4O5FA 4OKJA 1NJXA 4HUEA 3J7AP 3K9JA 1SKRA 2QW9A 1YF5L 4K43A 1FJGK 4LF8K 3LM2A 5JICA 3J80O 4LF9K 4KH4A 1GOAA 4CJEA 3K5MA 3SQ0A 5AQVA 2IAJA 3SBGA 1IG9A 4IEIA 3FZMA 4NXNK 1BOTO 4AHUA 1RBSA 3FZLA 3GDQA 3SUPA 1YI2N 3T3FA 2VGMA 2IC3A 3V81A 3CCRN 2B5JA 3QNOA 1X9SA 1BCMA 4CZFA 1N34K 1T6DA 3C0BA 2IGIA 4QAGA 4FJHA 1OH5A 1EWRA 2ZJPL 1JCEA 1T7PA 4B9LA 1DTTA 1NOYA 3SUOA 2VWBA 4QS9A 3OS2A 4H4MA 3A8YA 3ZLJA 4WQ5C 1TK0A 3SQ2A 5EU7A 1IKXA 4DS4A 2BGGA 5CY4A 4DQQA 4B3OA 4DR4K 3NF8A 1BA1A 4JYAK 3L2RA 4YDUA 1VQPN 2Q0UA 1S9GA 2KKZA 2W6LA 1W97L 4CECA 4KB1A 4JKGB 4CJ4A 3MXJA 1QQMA 4E1MA 3ALYA 3IDHA 2FBYA 4KHQA 3JAMO 2EX3A 3HVTA 3PO4A 1HMVA 1S1TA 1JLCA 3RR8A 2O8FB 4BRAA 1VQ8N 3HSTB 3LDPA 1HQEA 4FCYA 4FJLA 2VG7A 4JK9A 2KHOA 3TAMA 1ATNA 4JKGA 3SMSA 1HNXK 1VQ9N 2QWOA 3L2WA 1NJYA 4B9TA 4Z4CA 3SQ4A 5ELZA 3ATUA 4CK2A 2O8FA 3CQXA 4DB3A 4BDZA 3MK6A 3SV4A 5IT9O 3P1GA 5AQOA 4BRQA 4IEEA 3MWTA 3KIOA 2YKNA 4CEFA 1VSEA 4H0OA 4LF6K 1JCGA 1EX4A 1LOTB 4JLHA 3FR0A 2Y1JA 3DI6A 4AHTA 4LFAK 1D9DA 2OYQA 3TR8A 1GOCA 1WSEA 3HOTA 1ITGA 4OPAA 3MN7A 1HYSA 3ZSVA 3EY1A 3FGUA 2UXBK 3ZSQA 2ZD1A 1TAUA 2P9KB 3C94A 1YAGA 3MECA 3VQ6A 1A5WA 4M41A 4BVPA 1NK4A 1C1BA 4CEBA 1NMNA 2JWKA 3RWUA 4K8ZA 3H45C 1Z05A 3ID8A 4BWJA 2NUBA 1C0MA 4CZGA 3C65A 3NVMA 5LJVA 1ZBIA 3AVLA 2YX6A 2F4VK 4LH4A 4H5NA 4FZXC 4LH5A 5BPMA 5JLFA 1S72N 4DKWA 4GKJK 1QSSA 5C24A 3HYFA 3QO9A 4BC2A 1JLAA 5AQQA 4DQPA 4Q0BA 1C0TA 4JKAA 2HSTA 1YXQA 4CJSA 3MEGA 3TAFA 4YORA 1X9MA 1K8AO 3AAQA 3AA3A 3SYZA 1TV6A 3KWIA 2A1SA 4BY9C 3D0PA 4DTSA 4FLXA 5M1PA 1QZ6A 1HRHA 4FLYA 3I56N 3F9KA 4RG8A 1ZC6A 4GVMA 2VG5A 3O8MA 1WBBA 3KD5E 5AQZA 1CZAN 3H1VX 1NGCA 4DF8A 2D1KA 3OYIA 1RILA 2UYTA 3TSUA 1TGOA 4FXDA 2E6MA 4O44A 3OVNA 4GVEA 4E7KA 5EX5A 4B1ZA 3HPHA 3C6UA 3D6RA 4E7IA 4HUGA 3VERA 1U04A 1W2BM 1GLDG 2Q0RA 3JXUA 1KLNA 4V19S 4NLBA 5BN8A 4GMJB 3AVCA 4EAHD 4H8KA 1JXEA 3LAMA 4Q5VA 1S1XA 1VRUA 2CGKA 4CZLA 3CQ8A 3CCLN 1MWKA 5HRRA 1RTHA 4BE0A 2HNYA 1P8ZA 1VSLA 4JKDA 2DPNA 1OH6A 1TAQA 1ZXOA 4FJ9A 3N4QA 3OHRA 3V1RA 2FXUA 3EEQA 2FF3B 3ASMA 1V4TA 4J2AA 3F9MA 3G6EN 3O9UA 1EQYA 4F8RA 2E88A 4OPJA 3ZSWA 1X9JA 3DM2A 3AA4A 4QS8A 3L2QA 3MDQA 5BRFA 4CVNE 1BWFO 1VK0A 4PKGA 3ZSRA 3TSQA 4A62A 4BR7A 2ITGA 3CCJN 3TABA 4OX9K 3THXB 1J54A 3KK1A 3WNHA 1SV5A 3OTOK 1XQSC 1QS4A 2IVPA 1FKPA 4CJPA 2OTJN 1L3UA 4GV3A 4IZ9A 4RW9A 4G9ZA 1SS6A 1NU0A 3ZT4A 3SAHA 2QTDA 1XWLA 4AHCA 2QM1A 3ZCMA 1WSJA 2FLOA 4BR5A 5GIOA 1HJOA 3THXA 1ASVA 4M3WA 5BR8K 4FJXA 2A3ZA 4FK0A 4BRLA 1VQNN 3P39A 2DY4A 4WCEL 4CIFA 3MMVA 3CM5A 3AO5A 4DLEA 1TYQB 5C2FA 3CFPA 4HCCA 3VF2A 2D0BA 1D9FA 2O8BB 2LSNA 4JI1K 3GG4A 2KLAA 4IJAA 4KTQA 1RDAA 2RKIA 3THYB 4Z4HA 1X1PA 3LAKA 1R0AA 1WN7A 2D0OA 1KRPA 4CEOA 4GV6A 1NKCA 2JLEA 4J2BA 2QA4N 1D4XA 1MU2A 1RFQA 1TYQA 4CZHA 5DMRA 3O4QA 1NGHA 2O8BA 3THVA 4U67L 4ELUA 4HCBA 4L8RB 3VMFB 5H1SQ 4CIGA 1RDDA 4JS5A 3THYA 5BRHA 3DOKA 3VQEA 2GBZA 3I8DA 3EKSA 4OKEA 1NNEA 5GADP 2YKMA 5EOYA 4H0PA 2HOEA 4FW2A 1K8KB 3MCPA 1NJWA 3E9OA 1NGGA 5CE3A 3G0ZA 4ID5A 4E7JA 1KTQA 3RMDA 4DR3K 3EE8A 4F3OA 1TKXA 4M63C 3BZKA 4B8AB 1S22A 3BUZB 2W42A 1EO1A 4Z4EA 2IDOA 2HHHK 2W40A 3PX0A 1B9DA 1WB9A 1WSFA 4M3YA 2HHXA 4DQIA 1K8KA 3FZHA 1FXXA 3K57A 1TL1A 3VQ5A 2NRZA 4H5VA 1RDBA 5C12A 3V4IA 3QFPA 4NXMK 2GWKA 4CGFA 3CFRA 1ZBUA 5F2RA 2D5RA 2OPPA 4OGCA 3VQ7A 4DFPA 1S6QA 4M42A 3ZT2A 1RGIA 4NCBA 2P9NB 4CF1A 1TVRA 3K5OA 4JK8A 4W5RA 3O4NA 1NGBA 1BIZA 1VSJA 1XMOK 1BU6O 5AQNA 4DTNA 3K2PA 2EWSA 1P90A 2XRIA 4IDKA 4JKHA 1RT5A 3VGMA 1DLOA 3EYZA 2J4RA 3KZBA 4WQ4C 1K73O 4F3TA 1YHQN 1CLQA 2P9NA 4WFNL 4JI8K 1IH7A 4BVOA 1REVA 4CBXA 3IMXA 1I3AA 3MCAB 2HNDA 3BEXA 4M7YA 3R3LA 3NF9A 4CBUA 2Q31A 1NGDA 4B9QA 2QI2A 4DSIA 5KGXA 4DSJA 3A5OC 1DT9A 1SL1A 3RMBA 4ICLA 4N5SA 3PSIA 4DFMA 3H6EA 3HP9A 4DTMA 1N8RO 4B8CA 2OPRA 4DG1A 3RMCA 1NBWA 1S5JA 3HSCA 3AY9A 3QEVA 5J2NA 5J2PA 5LL6Z 1FK9A 1XUPO 4CHOA 3WNFA 4ILHA 1BQMA 4BWMA 4N76A 3EN9A 1IJJA 3DLBA 4B1VA 3AO4A 4H0XB 5KQ8A 4DR6K 3OYCA 3ZT0A 3OJSA 3MXIA 1VSIA 3JSMA 1I39A 3KVGA 3UKUB 3MEDA 1KFSA 1C1AA 2B4JA 4KBOA 4JHDB 4FWSA 3PUFA 5BPLA 5C25A 2DFEA 4DTRA 1JLGA 1RT2A 1IBKK 1RTDA 1RBUA 4HVJA 3A2FA 1NG9A 3OBYA 4H5TA 4DV6K 2O8DB 1DEJA 2PBDA 4CJ3A 1KSPA 4J2EA 1BUPA 1IG8A 3UKUA 2F8TA 1WOQA 2HVHA 4JHDA 2UUCK 1QQOA 3VETA 3ZT3A 3P5JA 3D7EO 4IOAL 4LSNA 2ASPA 2EHGA 2ZWHA 5GAEP 4AM7A 2P9LB 5AQMA 3HO1A 3UE5A 4QOZB 3V9SA 3QB0A 4HHTA 2HW3A 3L6QA 2O8DA 4BRHA 1E4GT 1JL2A 3TAPA 3LZIA 4LD0A 1RCHA 3VEYA 4DSEA 1B92A 1YJ9N 4FLTA 3V1QA 3CC4N 1Q81O 1U6ZA 1SQKA 3ZYYX 2IVOA 3LP0A 3BGRA 3CERA 2O8CB 3LDOA 4B9NA 2HMPA 4YOXA 1KC8O 3ULEA 2YNHA 1RBRA 1EWQA 1T05A 3CG7A 1OKJA 5AQJA 4O4GA 1N32K 1O1WA 3NF7A 3ZETA 3V1OA 1WSGA 2HB5A 4KREA 3NDKA 1S6PA 3KHYA 1HNVA 2V52B 2O8CA 3SQ1A 3EE9A 4W5OA 2FC0A 3IG1A 3I8BA 3KKSA 3FZFA 5KPZA 1YITN 3L0QA 1HKGA 1LW2A 3OYLA 5M1QA 1C6VA 2YCHA 2P9PB 2P9UB 3NHGA 5LY3A 2ZE2A 3AVNA 3M8SA 3LM9A 3NCIA 5AQLA 3WXMB 1J5OA 3HP6A 1ZBFA 3AVJA 3DMJA 3O9TA 1VQ5N 4BR4A 3S3OA 3SK3A 2WTUA 3A5MC 4CEQA 2PYLA 1HKBA 3OY9A 2FBVA 5F0XA 3WXJA 4X64K 4DUZK 2ZQBA 5JLHA 3BY5A 1QHTA 2P9PA 2P9UA 4XIUA 4BDYA 3S3MA 4ELVA 4EZ9A 1J53A 3NFAA 2IIRA 4FLWA 3PO5A 4H0YB 4GW6A 3O3FA 3TWHA 4X62K 1QSYA 4CEDA 2XHBA 3CETA 4Y1CA 4EZ6A 3DOLA 1QTMA 2Q2RA 4BC5A 2YNGA 4KTZA 1KVBA 3SZ2A 2KW4A 5CYQA 4CHNA 3QNNA 1JCFA 3OYMA 1Z26A 4IFYA 4FJ8A 2QWMA 4JV5K 2HHTA 1YUWA 2FSNA 3VF6A 4I9LA 3U3GA 4CZEA 4B9SA 1VRTA 4K0KK 1VQ7N 1BDGA 4FOEA 4MLEA 3U9DA 4M45A 3CPWM 4JI2K 3TTFA 4IG0A 1TKDA 3SMPA 3TPQA 4JI3K 4KHWA 2UXDK 3WT0A 1HKCA 2VQEK 2YHYA 3QIOA 3VOVA 4H03B 1Q9XA 2ASMA 3G25A 4FM0A 4CZIA 4IO9L 1J9AA 3NH0A 5I9EB 3O1BA 5FPMA 3U6FA 3FFIA 4BE2A 4DU4A 3NGYA 1TK8A 3J7ZO 1VSFA 3L2UA 4BC3A 3LP2A 3CCMN 2BH1A 1NGEA 5HOOA 1NK0A 1NGJA 3JYTA 4DUYK 1CXQA 3GOIA 4BR0A 4CJ5A 1V4SA 5KTQA 3HJFA 1WAFA 4M3RA 3THWB 4BGBA 1LAWA 2VCPA 1RT3A 3VESA 1SKWA 1KAYA 3RVCA 4LF7K 4BRDA 4E1JA 4RW8A 3VQDA 5GAHP 1D8YA 3DLKA 2G8FA 1TUUA 2BDPA 3H3OB 5AQUA 4GKKK 2PYJA 3FLCO 3HL8A 2P9KA 4E1NA 4KH5A 1HNIA 3LDLA 2G8IA 4JNEA 3ATVA 3OYBA 4CFDA 2ETJA 2ZGZA 5AFUH 1BISA 5JVGL 3HM9A 2Q36A 3Q7CA 1JLEA 3M6GA 3CJ1A 3MN5A 3VEOA 1K9MO 4A5AA 4Z0UA 3MN6A 4AHVA 3G4SN 1XI1A 4ZTJA 4DR7K 2KFZA 3LDQA 4KHPK 4BRKA 4FJKA 2E1YA 1N5YA 3RRHA 4ZHRA 1BL3A 5F1XA 2VQFK 2QXFA 2YHXA 5KRTA 3U8XA 4RWTA 3NMUA 4LFCK 1KCFA 1HQUA 1KFDA 3VN5A 5C0YA 5LMUK 2NRRA 3VEWA 3OYGA 1U2VB 3M5RA 3QBXA 3EKUA 3CCQN 3A0IX 3K59A 2X6NA 4PHTX 2DFFA 4RW4A 5HL7L 1HLUA 4FWMA 2OZSA 4DSLA 2XO7A 3AVBA 2D0PA 2HNZA 1HJRA 4O8UA 4FK2A 1EKEA 2WONA 4K42A 5CHIA 4BROA 2GWJA 4BG8A 4DSFA 1RT7A 3O6WA 1FW6A 4FJIA 2JGUA 1U2VA 1VQON 4R79A 3SPZA 5FRMA 4B1XB 5EY4A 4ILJA 4HWIA 3DLLL 3CHWA 4FSVA 3CXCM 4CGGA 3DRRA 1OVYA 3CPEA 2KQ2A 2P51A 4DU3A 3AVKA 3QDKA 4ID1A 1KD1O 2HHUA 2P5OA 4EP4A 1VQ4N 4LFBK 1CZ9A 2XY5A 4CEZA 2HHQA 1ZBLA 2PZSA 1OH8A 2FSKA 4B3RK 4BQZA 3F5TA 4C8MA 4K25A 4B9UA 3ZT1A 4WQ5A 3HK2A 5AQHA 2G8WA 4FPBA 4LF5K 4BRIA 1H1VA 3VENA 2NRWA 2D4WA 4Y0WA 2P1JA 3LANA 2I7NA 5C10A 1E4FT 2DTUA 3RTVA 4M3ZA 2X6SA 5DM6L 4FWPA 5HRSA 2YHWA 3ZSYA 4H0TB 4FJNA 1B9FA 4IKFA 4N47A 1Z6RA 4M7XA 4LY7A 5I42A 1N6QA 3HVRA 3ZEUB 2OANA 5AQYA 4DMNA 4FJJA 4JK7A 1JLFA 4E0DA 2XY6A 1IKWA 2VGNA 3VEZA 1XHXA 3VTIA 1RDWX 4FLZA 1NLVA 2CGLA 3S3NA 5C2DA 1RDUA 3QMLA 4FOIA 5GINA 1YT3A 4UY8O 4OJRA 4CF0A 3G10A 3H1QA 1WNSA 4KFBA 3A5LC 5FROA 3ZEUA 1HUXA 3LL3A 1HPMA 1BCOA 1RT1A 1S1UA 4YY3K 4DF4A 3CCEN 4PY5A 3DLRA 4ISFA 3QFUA 1U47A 1LW0A 2IS3A 1JJ2M 1KLMA 2E6LA 5JS1A 1BQNA 4C8NA 2GEMA 4AHRA 4C1NI 1GLFO 2Q1NA 4CJRA 5SZTA 3K0SA 4FJ7A 2VWKA 3ZSXA 2F7TA 3KD1E 1KXPA 4BR2A 5SWMA 1ILYA 3DLGA 2BE2A 4I6MB 2E2QA 3T7ZA 3OW2M 3QEPA 3AO1A 5CZ2A 1WSHA 3R6MA 3NH1A 4FWNA 4RCHA 5DM7L 4CJTA 4DFJA 1HNZK 1KVAA 5K14A 4IOCL 1HYVA 1EETA 4Z4FA 5CR4A 4FZYA 3DWLA 3MWPA 1X3NA 3FFKB 2YNFA 1LWCA 4FVMA 4I6MA 4M3UA 3IRXA 3QEXA 2ZJRL 1IKYA 5TKWA 5J2QA 2UUBK 3SJJA 1S1VA 4IFEA 4FWRA 3MX5A 3HOSA 3NBPA 3WUHA 4U7BA 4CZJA 1C0GA 4CIEA 1DGKN 2Q3SA 5J2MA 1Q8IA 1GOBA 3PV8A 3DLHA 3ITHA 3TI0A 5HROA 3CC7N 5KRSA 4FWQA 4EFHA 1QVFM 3OYAA 4JKEA 4BRNA 4XH5A 3O9QA 3QICA 4PL8A 3AVGA 3T1AA 2A41A 4YDUC 4DV2K 1XNQK 3NGZA 2AP1A 3OS1A 4MLHA 3ISNC 3KK2A 4IOXA 3L4IA 3TSPA 2P9IB 1LV5A 4DSKA 3KLFA 3KK3A 5FPEA 3BDPA 2WBNA 4DWIA 2VYPA 5AZJB 1LAVA 2Z1GA 3RMAA 2OCEA 3R8EA 5J1EA 4FVUA 3IKMA 4JRPA 3VQ9A 4B1UB 4O5BA 4B08A 4I2QA 4A2BA 2P9IA 1IV0A 3CQYA 4DU1A 4O0IA 3V9UA 3V9ZA 1TK5A 1NGIA 3O3GA 4JAXA 1S1WA 3OYJA 1KAXA 5AZJA 3PX4A 5BR9A 1HR0K 4N41A 4B1WB 4CF8A 3M3ZA 5BN9A 3TTCA 3Q7BA 3SAGA 1JL1A 3VQPA 2CGJA 3QETA 2HBLA 4MFBA 3KTQA 3ENOA 4ELTA 3HXMA 1RT4A 3B6PA 1VQMN 2QEXN 3OA9A 3I33A 4BRMA 2PFUA 1RTIA 3HZ6A 1T03A 1WSIA 1R59O 3VQAA 4AM6A 1Q82O 2G8UA 3NAEA 4M3XA 1KQSM 4ILGB 5CYMA 2FSJA 1IBLK 2X78A 4NYFA 4FM1A 4PQUA 2RPIA 1RBVA 4W5QA 3LDNA 4A2AA 2RF2A 4G1QA 4O0JA 3OYDA 3WEEB 3T19A 1M1KO 2E20A 3ZX0A 4JD2B 1YTAA 4CF2A 1O13A 3TARA 4JS4A 3T69A 4PUOA 2E4LA 4F2RA 4A5BA 1ATRA 1SUQA 3LPUA 4DV1K 3U4LA 4CI6A 4YOYA 5AQRA 3LDSA 4JN4A 4ISGA 1NKBA 4EHUA 4IXCA 2A40A 3CD6N 5M1FA 4E7LA 5GIPA 3ULDA 3WEEA 3HBTA 1F21A 5KPRA 3UKRB 4JD2A 1BI4B 3EO3A 1WBDA 1VQLN 4LF4K 3TTDA 3AV9A 1NK8A 4M3TA 3HTVA 3CF5L 3WNEA 2CH5A 4Z4GA 4XEIA 3WXLA 3SUNA 1BGXT 4JI5K 3SCXA 5E41A 4MO4A 4DV4K 4LC9B 1QHAA 2GX9A 1N33K 5EXWA 1NK6A 3DXMB 3GE1A 4CZMA 2ASOA 4J8FA 1K6YA 1BI4A 4DTPA 2AA4A 3ENHA 3TAGA 4JKFA 3VGLA 4KHSA 2D0AA 1BA0A 3D45A 1IKVA 2Y1IA 4I9QA 2WFBA 3S41A 4HTLA 3W0LA 1YVUA 3TAEA 4AILC 3CJ9A 3HI0A 5CZ1A 4CHQA 3SUQA 5E26A 4AF1A 3DXMA 4DV3K 5AQXA 4AHSA 5LMNK 2P9LA 4DS5A 3DRPA 4JI0K 1UAXA 4BRGA 3DAWA 4OLAA 3B6OA 2QWPA 3W3DA 4B3SK 1JXBA 3PX6A 4X66K 4C1NK 3U3YA 3IFRA 2I5JA 4BGAA 4BACA 3VTHA 1U48A 4CFBA 4DHYA 1J6ZA 3CM6A 3EZWA 3S9HA 2IOCA 3PLAA 4NLCA 5M1OA 3LPTA 4R5PA 2YJEA 3O08A 4N56A 1I94K 4OPKA 4YNQA 1U49A 1NKEA 4EP5A 3VA3A 3H46O 1QSLA 4Y1DA 1LWEA 2V51B 3MN9A 2V7ZA 3NGIA 1GLAG 1TKZA 1T6CA 3RSEB 4NYNA 3SJHA 4BRFA 4BREA 1YJWN 5GAGP 1YJNN 4B1YB 3SI6A 3TANA 2E2OA 2HBJA 4XH1A 5FDLA 4W5NA 1M90O 3AA2A 4DQRA 4CHPA 2QWNA 3D2FB 4PKIA 1XMQK 3V9XA 3M8RA 4AH9A 4IFVA 3BF1A 3CIPA 4FLUA 3T1HK 1OH7A 1NGAA 4KAZA 2ZGYA 1Q86O 5EVZA 3RSEA 4FO0A 3RRGA 1QE1A 4DV5K 3H08A 4IO8A 3DRSA 5HRPA 4GV9A 1W9HA 5AFUA 3UB5A 2NZTA 3O3HA 4NCAA 3D2FA 1CXUA 3P31A 3P83D 4YOUA 3SBTA 4E89A 2F96A 1ZYQA 4IJNA 3HPOA 3P4IA 4X65K 1SZ2A 4WQ4A 4BC4A 2OTLN 3J8AA 2NNWA 2RN2A 4DLGA 4IWVA 2ITMA 3HRGA 1YIJN 4RW7A 1YVNA 3M1FA 1ZBSA 3L8BA 4CE9A 2DFHA 2E5LK 3I0SA 3QBWA 4OPHA 1DKGD 4MDAA 4A59A 4K8XA 1ASUA 3VPZA 1L5UA 3WXIA 2YI1A 4FJGA 1FKOA 3MX2A 4BG9A 1VQKN 1MWMA 3OBWA 3DXKB 3AA5X 5BPNA 4H4OA 1NK9A 1CZBA 3O4WA 1RDCA 2HHSA 5JS2A 4BQLA 4CK3A 4CW7B 3PSFA 3KK7A 2KZMA 3P38A 5LJWA 3T1YK 3BP8A 2VWJA 4E19A 4KHNA 3ID6A 4F9OA 3CYMA 1UA0A 4C8KA 3HPGA 5AR0A 3VQBA 1VAZA 3O80A 3VEXA 1NWKA 3DXKA 3SNNA 2QWQA 2HHWA 1E3MA 5AQTA 4CJ7A 1QZ5A 4BRPA 1W7AA 3NVKA 2YHBA 1N36K 1Y64A 4E3SA 3MEEA 3N4PA 4FYDA 3AO3A 4Z4IA 3OYNA 1LWFA 3VEVA 3AGRA 3IUCA 1EP4A 4IG3A 3PIPL 3THWA 2HVIA 3EZ5A 2NRTA 3HT3A 4JI6K 1HPZA 2NRVA 2A42A 4OVLA 3MXMA 4B9VA 2Z1JA 5FRNA 2OPSA 2ATQA 4CGJA 4KI4A 3QESA 3HM8A 2G8KA 1U4BA 4CD1A 1ESVA 4DTOA 2NRHA 5AQSA 1DTQA 1C1CA
chains in the Genus database with same CATH topology
2VWBA 4QS9A 2NRXA 1NJIO 3C7NB 3A8YA 3H6EA 4WQ5C 3CCEN 4ISFA 3QFUA 1JJ2M 1N8RO 2GEMA 2W41A 4C1NI 3CI5A 1GLFO 2Q1NA 1NBWA 3HSCA 1BA1A 3AY9A 4YDUA 3CJBA 2F7TA 1KXPA 2GUPA 4BR2A 1VQPN 2Q0UA 2QWLA 2KKZA 1ILYA 1W97L 1XUPO 4I6MB 1T44A 2E2QA 3T7ZA 3OW2M 4JKGB 2HBKA 5KPTA 2A5XA 4ILHA 3EN9A 1IJJA 4B1VA 1QQMA 3C7NA 3R6MA 3IDHA 4FWNA 5AQPA 4H0XB 5TKYA 4RCHA 5DM7L 5KQ8A 4KH6A 4EIAA 2BTFA 3KVGA 3R1XA 3O9RA 3UKUB 4IOCL 4KBOA 4BRAA 1VQ8N 3LDPA 4JHDB 4FWSA 5CR4A 3F2KA 3DWLA 3CCSN 4JK9A 3TU5A 3MWPA 2KHOA 1X3NA 3FFKB 1KAZA 5BPLA 3SAFA 5AQFA 1ATNA 4I6MA 4JKGA 3CJAA 2ZJRL 3SMSA 5TKWA 3OBYA 4IFEA 1VQ9N 5BREA 4FWRA 2QWOA 4H5TA 3WQTA 3MX5A 3HOSA 3WUHA 1DEJA 1QQNA 4U7BA 2PBDA 2IVNA 4CZJA 2F9WA 1C0GA 4A61A 1BUPA 1IG8A 3UKUA 1DGKN 1WOQA 5ELZA 2WC9A 3ATUA 1ATSA 3CQXA 4DB3A 1Q18A 4H5WA 4JHDA 1QQOA 3VETA 3MK6A 5C15A 3D7EO 4IOAL 5AQOA 3O1WA 4BRQA 4IEEA 3AGKA 3D2EB 3CC7N 3MWTA 4FWQA 4EFHA 2ASPA 1QVFM 5AZIB 4JKEA 1GLLO 4BRNA 2ZWHA 3O9QA 4XH5A 5GAEP 4AM7A 3QICA 2P9LB 4PL8A 5AQMA 2A41A 3UE5A 4YDUC 4H0OA 3QB0A 1JCGA 1LOTB 4GNIA 3L6QA 2AP1A 4MLHA 1E4GT 3O9SA 4BRHA 4IOXA 3L4IA 3TSPA 2P9IB 3FR0A 2E2NA 4PKHA 3VEYA 4PL7A 1YJ9N 3K9KA 3CC4N 1MDUB 1Q81O 1U6ZA 5FPEA 1SQKA 2YJFA 2WBNA 3AARA 2IVOA 2VYPA 3ZYYX 5AZJB 4CBWA 3HOTA 4OPAA 3CERA 3D2EA 3MN7A 3LDOA 4MDBA 3FGUA 5AZIA 1NGFA 3R8EA 2HMPA 3CCVN 4YOXA 4FVUA 2P9KB 1KC8O 3ULEA 3IKMA 1YAGA 4WFBL 1QVGM 4B1UB 1OKJA 5AQJA 3DJCA 4BVPA 4A2BA 2P9IA 3E1YA 3ZETA 3CQYA 2A6AA 2JWKA 2RE2A 3H45C 1Z05A 3ID8A 1NGIA 2E1ZA 4JAXA 4CZGA 3KHYA 1KAXA 5AZJA 5BR9A 2V52B 3C65A 3NVMA 4B1WB 3CMAN 1WUAA 3M3ZA 5BN9A 3TTCA 3EE9A 5E84A 5LJVA 4MO5A 3Q7BA 3SAGA 3ZX3A 2YX6A 3I8BA 2CGJA 4H5NA 2HBLA 5JLFA 5BPMA 1S72N 3FZFA 3ENOA 5KPZA 4DKWA 2HF3A 3E9PA 1YITN 3L0QA 1HKGA 2QEXN 1VQMN 3OA9A 4BC2A 2WUSA 5M1QA 3I33A 5AQQA 4BRMA 2PFUA 3HZ6A 2YCHA 1C0FA 2P9PB 2P9UB 3CCUN 1R59O 4JKAA 2HSTA 5LY3A 4AM6A 1YXQA 1Q82O 2V7YA 5FPNA 3LM9A 5AQLA 4YORA 3WXMB 1KQSM 1K8AO 4ILGB 3AAQA 5AQKA 2FSJA 3O9TA 3GL1A 1VQ5N 3KWIA 4JKCA 4BR4A 4WFAL 4BY9C 3SK3A 5M1PA 3A5MC 1QZ6A 3LDNA 4A2AA 2ZJQL 3I56N 1HKBA 5F0XA 3WXJA 4YOWA 1ZC6A 3WEEB 5JLHA 3FE1A 2P9PA 2P9UA 3O8MA 2E20A 1M1KO 5AQZA 3ZX0A 1CZAN 3H1VX 4JD2B 1NGCA 5JVHL 2D1KA 2UYTA 3TSUA 2IIRA 4H0YB 4YOVA 1O13A 4BRCA 5FPDA 3T69A 4GVEA 5BRDA 5EX5A 4B1ZA 3CETA 4A5BA 1ATRA 3A5NC 5JMVA 3U4LA 4CI6A 5M1KA 3D6RA 5AQRA 4YOYA 3VERA 2NLXA 4JN4A 4QS7A 4ISGA 4WF9L 3WXKA 2Q2RA 4EHUA 4BC5A 1W2BM 1GLJO 1GLDG 2A40A 4IXCA 2Q0RA 5M1FA 3JXUA 2GELA 3CD6N 4GY2B 5B8HA 5GIPA 1JCFA 4NLBA 5BN8A 2RHKA 1TUYA 3WEEA 3HBTA 1MA9B 1NMDA 3KWGA 4YOTA 4EAHD 4EHTA 5KPRA 3UKRB 4JD2A 2QWMA 4DCHA 3EO3A 1YUWA 1VQLN 3TTDA 4CZKA 4BR9A 2CGKA 2FSNA 4CZLA 3HTVA 3VF6A 3CCLN 3CF5L 2CH5A 4CZEA 1MWKA 4XEIA 4JKBA 3WXLA 4XH4A 3C6HA 1VQ7N 1BDGA 4FOEA 1P8ZA 2ZF5O 4MLEA 3U9DA 3E66A 4JKDA 4MO4A 2DPNA 3CPWM 1ZXOA 3N4QA 1QHAA 2GX9A 4LC9B 3OHRA 3TTFA 3SMPA 3TPQA 3WT0A 1HKCA 1SAZA 2YHYA 5EXWA 3VOVA 3DXMB 3GE1A 2FXUA 4CZMA 2FF3B 4H03B 1V4TA 3GBTA 2ASMA 2ASOA 4J8FA 3G25A 3WQUA 4CZIA 4IO9L 1GLEG 2AA4A 3ENHA 3F9MA 3G6EN 3O9UA 4JKFA 3VGLA 1EQYA 1BA0A 5I9EB 2E88A 3O1BA 1X9JA 5FPMA 3CJCA 3AAPA 4QS8A 4K41A 3H3NO 2WFBA 4RTFD 3S41A 3MDQA 2E8AA 4HTLA 5BRFA 3W0LA 1BWFO 3J7ZO 4H0VB 3CJ9A 3HI0A 4BC3A 4C23A 4PKGA 4A62A 3TSQA 4BR7A 4FPAA 3CCJN 3CCMN 2BH1A 5E26A 1NGEA 5AQWA 4AF1A 2Q97A 5MLCQ 2JWLA 5HOOA 3DXMA 1NGJA 5AQXA 2P9LA 3GOIA 1XQSC 2IVPA 4BR0A 2OTJN 2BUPA 4BRGA 1V4SA 3DAWA 4GV3A 4IZ9A 2QWPA 3W3DA 4G9ZA 4BGBA 2P9SB 2VCPA 3VESA 1BO5O 1SS6A 4JEPA 4C1NK 1HX1A 1KAYA 1BG3A 2QWRA 3IFRA 3LL3A 3U9ZA 3RVCA 3R9PA 3B8AX 4BGAA 3SAHA 3VTHA 2QTDA 4DHYA 1J6ZA 4BRDA 5AQGA 4E1JA 2QM1A 5GAHP 1TUUA 3H3OB 3EZWA 5AQUA 2FLOA 3PLAA 4NLCA 2F9TA 4BR5A 5M1OA 3FLCO 5GIOA 1HJOA 3CJ7A 2P9KA 2YJEA 3O08A 4KH5A 2A3ZA 4NB4A 4BRLA 1VQNN 3P39A 5AQIA 3LDLA 4JNEA 1Q7YO 4WCEL 3ATVA 3MMVA 3H46O 4NO7A 5KQDA 2P9SA 1TYQB 2ZGZA 5AFUH 5C2FA 5JVGL 3VF2A 4O8KA 2V51B 3MN9A 2Q36A 3Q7CA 4L3QA 2V7ZA 2HF4A 3M6GA 3CJ1A 3FZKA 4FWKA 1GLAG 3MN5A 3VEOA 1T6CA 1K9MO 5ADXA 3RSEB 4A5AA 3MN6A 3G4SN 3GG4A 2KLAA 2H3GX 4IJAA 3SJHA 4BRFA 4BREA 3G71N 1YJWN 3LDQA 3CMEN 4BRKA 2D0OA 2E1YA 5GAGP 1YJNN 4B1YB 2PAVA 4GV6A 2E2OA 2HBJA 3PIOL 4XH1A 5F1XA 1M90O 2QA4N 2QWNA 2YHXA 5M1NA 1D4XA 3U8XA 4RWTA 3L4QA 1RFQA 1TYQA 3C6AA 3D2FB 4PKIA 4CZHA 3NMUA 1G99A 3BF1A 3ZX2A 3CIPA 1NGHA 4FWLA 5C0YA 2I7PA 1NGAA 2ZGYA 1Q86O 5EVZA 4U67L 2NRRA 3RSEA 4FO0A 3O5BA 3VEWA 1U2VB 3VMFB 3M5RA 3QBXA 5H1SQ 3BF3A 3EKUA 3CCQN 3I55N 3A0IX 5BRHA 4IO8A 4PHTX 5HL7L 1HLUA 1S3XA 4FWMA 4GV9A 2D0PA 2HBMA 5AFUA 3UB5A 3EL2A 1VQ6N 3EKSA 2NZTA 4O8UA 5GADP 4K42A 3D2FA 3SLCA 4YOUA 1LCUA 3P31A 3SBTA 5CHIA 4BROA 1NM1A 2GWJA 4H0PA 5EOYA 2HOEA 4BG8A 4IJNA 3O6WA 1K8KB 3MCPA 3E9OA 3P4IA 1NGGA 5CE3A 2E2PA 1T3VA 1SZ2A 4WQ4A 1U2VA 1VQON 4BC4A 4R79A 2OTLN 3J8AA 2GTDA 4B1XB 1XC3A 2NNWA 1GLBG 3EE8A 4ILJA 4HWIA 5EY4A 3DLLL 4ISEA 3CHWA 4FSVA 2CH6A 4IWVA 2ITMA 4M63C 3CXCM 1OVYA 3CPEA 3HRGA 1YIJN 1S22A 1YVNA 3ENBA 3M1FA 1ZBSA 2QXLA 3BUZB 1EO1A 3QDKA 3QBWA 4OPHA 1DKGD 4MDAA 1KD1O 2W40A 4A59A 1X3MA 1GLCG 3VPZA 3UKRA 1VQ4N 1K8KA 3FZHA 3WXIA 2YI1A 4H5RA 3CC2N 3MX2A 4BG9A 2NRZA 1VQKN 4OO1J 1MWMA 4DQ8A 2FSKA 4H5VA 3OBWA 3DXKB 3E9LA 3F5TA 4BQZA 5BPNA 4A57A 5C12A 4WYBA 4Z94A 4K25A 2FF6A 3QFPA 4WQ5A 3O4WA 5AQHA 3VF4A 5ADXH 4FPBA 2GWKA 4FL9A 4BQLA 4CD3A 4BRIA 5F2RA 3ULEB 3KK7A 3P38A 5LJWA 3BP8A 1H1VA 3VENA 2NRWA 4IDHA 1RGIA 2D4WA 3ID6A 4Y0WA 4F9OA 2P9NB 3JS6A 4JK8A 2I7NA 3ZETB 5C10A 4FWOA 1E4FT 5AR0A 1VAZA 1NGBA 3O80A 3VEXA 3VGKA 1NWKA 3DXKA 1BU6O 2QWQA 5AQNA 5DM6L 4FWPA 4O5FA 2EWSA 1P90A 2YHWA 4H0TB 4JKHA 3K9JA 5AQTA 4CJ7A 1QZ5A 4BRPA 2QW9A 1YF5L 4K43A 3VGMA 3NVKA 1Y64A 2J4RA 3KZBA 3LM2A 4WQ4C 1Z6RA 5JICA 3N4PA 1K73O 4KH4A 4M7XA 5AQVA 3ZEUB 2OANA 5AQYA 1YHQN 3SBGA 3VEVA 2P9NA 4WFNL 3AGRA 3IUCA 3PIPL 4JK7A 4IEIA 3FZMA 2NRTA 1BOTO 4BVOA 2VGNA 3VEZA 2NRVA 2A42A 3VTIA 1RDWX 1NLVA 2CGLA 5C2DA 3FZLA 1RDUA 3GDQA 3IMXA 4CBXA 1YI2N 3MCAB 2VGMA 3QMLA 4FOIA 3BEXA 5GINA 3CCRN 3HM8A 4M7YA 3R3LA 4CBUA 4UY8O 4CZFA 4CD1A 1ESVA 2Q31A 1NGDA 3H1QA 2QI2A 2NRHA 4B9QA 1T6DA 3C0BA 3A5OC 2ZJPL 5AQSA 1JCEA 1DT9A 3A5LC 3ZEUA 1HUXA 1HPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4Q A;  3KWG A;  3OA9 A;  3P31 A;  3O9S A;  3O9U A;  3RVC A;  3O9R A;  3M5R A;  3F5T A;  3EE8 A;  3O9T A;  4OPA A;  3D6R A;  3EE9 A;  3KWI A;  2GX9 A;  2KKZ A;  3O9Q A;  4OPH A;  3P39 A;  3P38 A;  2RHK A; 
#chains in the Genus database with same CATH topology
 2NRX A;  1NJI O;  3C7N B;  4JI4 K;  4DTU A;  4YHH K;  1Y97 A;  4FW1 A;  2W41 A;  1OVQ A;  1BIU A;  3C6T A;  3CI5 A;  2HHV A;  4W5T A;  3LWL A;  4DR2 K;  5IWA K;  3CJB A;  2GUP A;  2QWL A;  1WLJ A;  1T44 A;  2HBK A;  5KPT A;  2A5X A;  1NK5 A;  1QQC A;  3C7N A;  4J2D A;  5AQP A;  4CHY A;  5TKY A;  2O4I A;  4KH6 A;  2BAN A;  4OGE A;  1RT6 A;  4CEE A;  4EIA A;  2BTF A;  3KJV A;  3R1X A;  3O9R A;  1RBT A;  3QIN A;  3E01 A;  3F2K A;  3CCS N;  3TU5 A;  1D5A A;  1VSD A;  1HNW K;  3SAF A;  1KAZ A;  5AQF A;  2QKB A;  3L3U A;  3CJA A;  3NF6 A;  3I0R A;  2O4G A;  1EXQ A;  5BRE A;  3WQT A;  3LAL A;  4ZTF A;  1A5V A;  2OZM A;  1QQN A;  4F4K A;  2IVN A;  2FBX A;  3QIP A;  2F9W A;  4A61 A;  3OS0 A;  2WOM A;  4KTW A;  2WC9 A;  1ATS A;  3KKR A;  1Q18 A;  4H5W A;  1NJZ A;  5C15 A;  4KI6 A;  3O1W A;  3AGK A;  3D2E B;  2D0C A;  3QLH A;  1IBM K;  3WNG A;  5AZI B;  1GLL O;  1SL2 A;  4GNI A;  3O9S A;  4FK4 A;  3CFO A;  3QEW A;  3VQ8 A;  2E2N A;  4PKH A;  3KLH A;  4PL7 A;  1XHZ A;  3K9K A;  1MDU B;  2FBT A;  1A5X A;  4JRQ A;  2YJF A;  3AAR A;  2KFN A;  4CBW A;  3D2E A;  4I2P A;  4MDB A;  1RTJ A;  4FJ5 A;  5AZI A;  1NGF A;  4YFU A;  3CCV N;  3K5L A;  5KGW A;  3MAQ A;  4WFB L;  1QVG M;  1HYZ A;  3BZC A;  3DJC A;  1UA1 A;  3E1Y A;  2GV9 A;  2A6A A;  1BHL A;  2RE2 A;  2HMI A;  2E1Z A;  1ASW A;  3NH2 A;  1WAJ A;  3ZSZ A;  4DTX A;  1UWB A;  3V6D A;  3CMA N;  1WUA A;  5FLX O;  5E84 A;  4MO5 A;  3UIQ A;  1JKH A;  3ZX3 A;  3PY8 A;  1L3S A;  3DLE A;  4CF9 A;  3V9W A;  2Z1I A;  2HF3 A;  3E9P A;  5T7B A;  2WUS A;  1C0F A;  3CCU N;  2V7Y A;  5FPN A;  1ZBH A;  2KTQ A;  1UOC A;  2UXC K;  4DR5 K;  4DR1 K;  5AQK A;  4NCG A;  3GL1 A;  4CJQ A;  3K58 A;  4JKC A;  4WFA L;  3LWM A;  2XY7 A;  3VA0 A;  1NOZ A;  3KLE A;  4CJL A;  2ZJQ L;  4CJK A;  4YOW A;  4CJV A;  4DFK A;  2AJQ A;  4HTU A;  2QKK A;  3FE1 A;  3AO2 A;  4TSX A;  5JVH L;  4HUF A;  1W0H A;  4DV7 K;  5I3U A;  5HRN A;  4YOV A;  2YNI A;  4BRC A;  5FPD A;  4KKO A;  2O8E B;  4FM2 A;  5BRD A;  3VQC A;  2B6A A;  1Z25 A;  3AVA A;  3A5N C;  5JMV A;  4QCL A;  4AQY K;  5M1K A;  2VG6 A;  4CGD A;  2NLX A;  4QS7 A;  3OYE A;  4WF9 L;  3WXK A;  3KLG A;  4PWD A;  4CGH A;  1GLJ O;  1VSK A;  2GEL A;  2X74 A;  4GY2 B;  5B8H A;  4KV8 A;  2RHK A;  1TUY A;  2XY8 A;  2A1R A;  1MA9 B;  1NMD A;  3KWG A;  4YOT A;  5KI6 A;  4DTJ A;  3AVF A;  3LP3 A;  4KO0 A;  4DCH A;  2KZZ A;  1C0U A;  4CZK A;  4BR9 A;  2O8E A;  4JKB A;  3TAQ A;  3C95 A;  4XH4 A;  3C6H A;  3IAY A;  2ZF5 O;  3E66 A;  4OKK A;  4E7H A;  1SAZ A;  2UUA K;  1L3V A;  1S9E A;  4FZZ A;  1RNH A;  3GBT A;  3WQU A;  1GLE G;  2YHA A;  3CJC A;  1XC9 A;  3AAP A;  4CGI A;  4KHU A;  4K41 A;  3H3N O;  4RTF D;  3L2V A;  2E8A A;  3OYH A;  4H0V B;  4I7F A;  4C23 A;  1J5E K;  4FPA A;  2ZM6 K;  5AQW A;  5MLC Q;  2Q97 A;  2JWL A;  3OJU A;  4OLB A;  4CEA A;  2BUP A;  4CER A;  2P9S B;  3OYF A;  1BO5 O;  5A2Q O;  4JEP A;  3M8P A;  1HX1 A;  4EHT A;  1BG3 A;  2QWR A;  3U9Z A;  4CK1 A;  3R9P A;  3B8A X;  5AQG A;  1VSH A;  2G8H A;  4F2S A;  4LSL A;  4CJU A;  2F9T A;  4CES A;  2Z1H A;  3CJ7 A;  1NK7 A;  4NB4 A;  4BDP A;  3M8Q A;  1TL3 A;  5AQI A;  1Q7Y O;  2W6K A;  4NO7 A;  5KQD A;  2P9S A;  1X9W A;  1XNR K;  4BE1 A;  3QEI A;  4O8K A;  2UU9 K;  4L3Q A;  2HF4 A;  3FZK A;  4FWK A;  2PY5 A;  4FJM A;  2QK9 A;  3AVH A;  5ADX A;  2H3G X;  3G71 N;  4PA1 A;  2G8V A;  3CME N;  4MQ3 A;  3VQQ A;  4DQS A;  4FLV A;  2PAV A;  4B3T K;  3PIO L;  3DYA A;  1JLQ A;  4DV0 K;  5M1N A;  3IS9 A;  3L4Q A;  3C6A A;  1G99 A;  3ZX2 A;  4FWL A;  3NE6 A;  2I7P A;  3K5N A;  4CFC A;  1G15 A;  1VSM A;  1T8E A;  2GUI A;  2R7Y A;  2OA8 A;  3O5B A;  4RW6 A;  3BF3 A;  3I55 N;  4JI7 K;  4O55 A;  4B3M K;  1S3X A;  5C42 A;  4CFA A;  1TKT A;  1JLB A;  2HBM A;  3EL2 A;  1VQ6 N;  3KLI A;  4KRF A;  1U45 A;  3SLC A;  1LCU A;  4KB0 A;  1NM1 A;  5HP1 A;  3LZJ A;  3J81 O;  1SKS A;  2YV0 X;  2E2P A;  1T3V A;  4UQG A;  3J7Y P;  3RR7 A;  4CJW A;  2GTD A;  5HBM A;  1XC3 A;  1GLB G;  3SPY A;  5DK5 A;  4ISE A;  2F8S A;  2CH6 A;  4C8O A;  3ENB A;  3F73 A;  2QXL A;  3LP1 A;  3VQ4 A;  5D3G A;  1VHX A;  5HLF A;  4C8L A;  4KPY A;  2P5G A;  1X3M A;  1GLC G;  4CJF A;  3UKR A;  4CHZ A;  4WE1 A;  3QER A;  3OYK A;  4H5R A;  3CC2 N;  3ZSO A;  4OO1 J;  4DQ8 A;  1IO2 A;  4B9M A;  3E9L A;  4A57 A;  4WYB A;  4Z94 A;  4KHY A;  2FF6 A;  5AJ3 K;  3VF4 A;  5ADX H;  1SL0 A;  2OPQ A;  4FL9 A;  4CD3 A;  3SV3 A;  1L3T A;  3ULE B;  1Q9Y A;  4CCH A;  3AVI A;  4IDH A;  3AVM A;  3L3V A;  1KVC A;  4IBN A;  3JS6 A;  3ZET B;  4FWO A;  1YTU A;  3VGK A;  4O5F A;  4OKJ A;  1NJX A;  4HUE A;  3J7A P;  3K9J A;  1SKR A;  2QW9 A;  1YF5 L;  4K43 A;  1FJG K;  4LF8 K;  3LM2 A;  5JIC A;  3J80 O;  4LF9 K;  4KH4 A;  1GOA A;  4CJE A;  3K5M A;  3SQ0 A;  5AQV A;  2IAJ A;  3SBG A;  1IG9 A;  4IEI A;  3FZM A;  4NXN K;  1BOT O;  4AHU A;  1RBS A;  3FZL A;  3GDQ A;  3SUP A;  1YI2 N;  3T3F A;  2VGM A;  2IC3 A;  3V81 A;  3CCR N;  2B5J A;  3QNO A;  1X9S A;  1BCM A;  4CZF A;  1N34 K;  1T6D A;  3C0B A;  2IGI A;  4QAG A;  4FJH A;  1OH5 A;  1EWR A;  2ZJP L;  1JCE A;  1T7P A;  4B9L A;  1DTT A;  1NOY A;  3SUO A;  2VWB A;  4QS9 A;  3OS2 A;  4H4M A;  3A8Y A;  3ZLJ A;  4WQ5 C;  1TK0 A;  3SQ2 A;  5EU7 A;  1IKX A;  4DS4 A;  2BGG A;  5CY4 A;  4DQQ A;  4B3O A;  4DR4 K;  3NF8 A;  1BA1 A;  4JYA K;  3L2R A;  4YDU A;  1VQP N;  2Q0U A;  1S9G A;  2KKZ A;  2W6L A;  1W97 L;  4CEC A;  4KB1 A;  4JKG B;  4CJ4 A;  3MXJ A;  1QQM A;  4E1M A;  3ALY A;  3IDH A;  2FBY A;  4KHQ A;  3JAM O;  2EX3 A;  3HVT A;  3PO4 A;  1HMV A;  1S1T A;  1JLC A;  3RR8 A;  2O8F B;  4BRA A;  1VQ8 N;  3HST B;  3LDP A;  1HQE A;  4FCY A;  4FJL A;  2VG7 A;  4JK9 A;  2KHO A;  3TAM A;  1ATN A;  4JKG A;  3SMS A;  1HNX K;  1VQ9 N;  2QWO A;  3L2W A;  1NJY A;  4B9T A;  4Z4C A;  3SQ4 A;  5ELZ A;  3ATU A;  4CK2 A;  2O8F A;  3CQX A;  4DB3 A;  4BDZ A;  3MK6 A;  3SV4 A;  5IT9 O;  3P1G A;  5AQO A;  4BRQ A;  4IEE A;  3MWT A;  3KIO A;  2YKN A;  4CEF A;  1VSE A;  4H0O A;  4LF6 K;  1JCG A;  1EX4 A;  1LOT B;  4JLH A;  3FR0 A;  2Y1J A;  3DI6 A;  4AHT A;  4LFA K;  1D9D A;  2OYQ A;  3TR8 A;  1GOC A;  1WSE A;  3HOT A;  1ITG A;  4OPA A;  3MN7 A;  1HYS A;  3ZSV A;  3EY1 A;  3FGU A;  2UXB K;  3ZSQ A;  2ZD1 A;  1TAU A;  2P9K B;  3C94 A;  1YAG A;  3MEC A;  3VQ6 A;  1A5W A;  4M41 A;  4BVP A;  1NK4 A;  1C1B A;  4CEB A;  1NMN A;  2JWK A;  3RWU A;  4K8Z A;  3H45 C;  1Z05 A;  3ID8 A;  4BWJ A;  2NUB A;  1C0M A;  4CZG A;  3C65 A;  3NVM A;  5LJV A;  1ZBI A;  3AVL A;  2YX6 A;  2F4V K;  4LH4 A;  4H5N A;  4FZX C;  4LH5 A;  5BPM A;  5JLF A;  1S72 N;  4DKW A;  4GKJ K;  1QSS A;  5C24 A;  3HYF A;  3QO9 A;  4BC2 A;  1JLA A;  5AQQ A;  4DQP A;  4Q0B A;  1C0T A;  4JKA A;  2HST A;  1YXQ A;  4CJS A;  3MEG A;  3TAF A;  4YOR A;  1X9M A;  1K8A O;  3AAQ A;  3AA3 A;  3SYZ A;  1TV6 A;  3KWI A;  2A1S A;  4BY9 C;  3D0P A;  4DTS A;  4FLX A;  5M1P A;  1QZ6 A;  1HRH A;  4FLY A;  3I56 N;  3F9K A;  4RG8 A;  1ZC6 A;  4GVM A;  2VG5 A;  3O8M A;  1WBB A;  3KD5 E;  5AQZ A;  1CZA N;  3H1V X;  1NGC A;  4DF8 A;  2D1K A;  3OYI A;  1RIL A;  2UYT A;  3TSU A;  1TGO A;  4FXD A;  2E6M A;  4O44 A;  3OVN A;  4GVE A;  4E7K A;  5EX5 A;  4B1Z A;  3HPH A;  3C6U A;  3D6R A;  4E7I A;  4HUG A;  3VER A;  1U04 A;  1W2B M;  1GLD G;  2Q0R A;  3JXU A;  1KLN A;  4V19 S;  4NLB A;  5BN8 A;  4GMJ B;  3AVC A;  4EAH D;  4H8K A;  1JXE A;  3LAM A;  4Q5V A;  1S1X A;  1VRU A;  2CGK A;  4CZL A;  3CQ8 A;  3CCL N;  1MWK A;  5HRR A;  1RTH A;  4BE0 A;  2HNY A;  1P8Z A;  1VSL A;  4JKD A;  2DPN A;  1OH6 A;  1TAQ A;  1ZXO A;  4FJ9 A;  3N4Q A;  3OHR A;  3V1R A;  2FXU A;  3EEQ A;  2FF3 B;  3ASM A;  1V4T A;  4J2A A;  3F9M A;  3G6E N;  3O9U A;  1EQY A;  4F8R A;  2E88 A;  4OPJ A;  3ZSW A;  1X9J A;  3DM2 A;  3AA4 A;  4QS8 A;  3L2Q A;  3MDQ A;  5BRF A;  4CVN E;  1BWF O;  1VK0 A;  4PKG A;  3ZSR A;  3TSQ A;  4A62 A;  4BR7 A;  2ITG A;  3CCJ N;  3TAB A;  4OX9 K;  3THX B;  1J54 A;  3KK1 A;  3WNH A;  1SV5 A;  3OTO K;  1XQS C;  1QS4 A;  2IVP A;  1FKP A;  4CJP A;  2OTJ N;  1L3U A;  4GV3 A;  4IZ9 A;  4RW9 A;  4G9Z A;  1SS6 A;  1NU0 A;  3ZT4 A;  3SAH A;  2QTD A;  1XWL A;  4AHC A;  2QM1 A;  3ZCM A;  1WSJ A;  2FLO A;  4BR5 A;  5GIO A;  1HJO A;  3THX A;  1ASV A;  4M3W A;  5BR8 K;  4FJX A;  2A3Z A;  4FK0 A;  4BRL A;  1VQN N;  3P39 A;  2DY4 A;  4WCE L;  4CIF A;  3MMV A;  3CM5 A;  3AO5 A;  4DLE A;  1TYQ B;  5C2F A;  3CFP A;  4HCC A;  3VF2 A;  2D0B A;  1D9F A;  2O8B B;  2LSN A;  4JI1 K;  3GG4 A;  2KLA A;  4IJA A;  4KTQ A;  1RDA A;  2RKI A;  3THY B;  4Z4H A;  1X1P A;  3LAK A;  1R0A A;  1WN7 A;  2D0O A;  1KRP A;  4CEO A;  4GV6 A;  1NKC A;  2JLE A;  4J2B A;  2QA4 N;  1D4X A;  1MU2 A;  1RFQ A;  1TYQ A;  4CZH A;  5DMR A;  3O4Q A;  1NGH A;  2O8B A;  3THV A;  4U67 L;  4ELU A;  4HCB A;  4L8R B;  3VMF B;  5H1S Q;  4CIG A;  1RDD A;  4JS5 A;  3THY A;  5BRH A;  3DOK A;  3VQE A;  2GBZ A;  3I8D A;  3EKS A;  4OKE A;  1NNE A;  5GAD P;  2YKM A;  5EOY A;  4H0P A;  2HOE A;  4FW2 A;  1K8K B;  3MCP A;  1NJW A;  3E9O A;  1NGG A;  5CE3 A;  3G0Z A;  4ID5 A;  4E7J A;  1KTQ A;  3RMD A;  4DR3 K;  3EE8 A;  4F3O A;  1TKX A;  4M63 C;  3BZK A;  4B8A B;  1S22 A;  3BUZ B;  2W42 A;  1EO1 A;  4Z4E A;  2IDO A;  2HHH K;  2W40 A;  3PX0 A;  1B9D A;  1WB9 A;  1WSF A;  4M3Y A;  2HHX A;  4DQI A;  1K8K A;  3FZH A;  1FXX A;  3K57 A;  1TL1 A;  3VQ5 A;  2NRZ A;  4H5V A;  1RDB A;  5C12 A;  3V4I A;  3QFP A;  4NXM K;  2GWK A;  4CGF A;  3CFR A;  1ZBU A;  5F2R A;  2D5R A;  2OPP A;  4OGC A;  3VQ7 A;  4DFP A;  1S6Q A;  4M42 A;  3ZT2 A;  1RGI A;  4NCB A;  2P9N B;  4CF1 A;  1TVR A;  3K5O A;  4JK8 A;  4W5R A;  3O4N A;  1NGB A;  1BIZ A;  1VSJ A;  1XMO K;  1BU6 O;  5AQN A;  4DTN A;  3K2P A;  2EWS A;  1P90 A;  2XRI A;  4IDK A;  4JKH A;  1RT5 A;  3VGM A;  1DLO A;  3EYZ A;  2J4R A;  3KZB A;  4WQ4 C;  1K73 O;  4F3T A;  1YHQ N;  1CLQ A;  2P9N A;  4WFN L;  4JI8 K;  1IH7 A;  4BVO A;  1REV A;  4CBX A;  3IMX A;  1I3A A;  3MCA B;  2HND A;  3BEX A;  4M7Y A;  3R3L A;  3NF9 A;  4CBU A;  2Q31 A;  1NGD A;  4B9Q A;  2QI2 A;  4DSI A;  5KGX A;  4DSJ A;  3A5O C;  1DT9 A;  1SL1 A;  3RMB A;  4ICL A;  4N5S A;  3PSI A;  4DFM A;  3H6E A;  3HP9 A;  4DTM A;  1N8R O;  4B8C A;  2OPR A;  4DG1 A;  3RMC A;  1NBW A;  1S5J A;  3HSC A;  3AY9 A;  3QEV A;  5J2N A;  5J2P A;  5LL6 Z;  1FK9 A;  1XUP O;  4CHO A;  3WNF A;  4ILH A;  1BQM A;  4BWM A;  4N76 A;  3EN9 A;  1IJJ A;  3DLB A;  4B1V A;  3AO4 A;  4H0X B;  5KQ8 A;  4DR6 K;  3OYC A;  3ZT0 A;  3OJS A;  3MXI A;  1VSI A;  3JSM A;  1I39 A;  3KVG A;  3UKU B;  3MED A;  1KFS A;  1C1A A;  2B4J A;  4KBO A;  4JHD B;  4FWS A;  3PUF A;  5BPL A;  5C25 A;  2DFE A;  4DTR A;  1JLG A;  1RT2 A;  1IBK K;  1RTD A;  1RBU A;  4HVJ A;  3A2F A;  1NG9 A;  3OBY A;  4H5T A;  4DV6 K;  2O8D B;  1DEJ A;  2PBD A;  4CJ3 A;  1KSP A;  4J2E A;  1BUP A;  1IG8 A;  3UKU A;  2F8T A;  1WOQ A;  2HVH A;  4JHD A;  2UUC K;  1QQO A;  3VET A;  3ZT3 A;  3P5J A;  3D7E O;  4IOA L;  4LSN A;  2ASP A;  2EHG A;  2ZWH A;  5GAE P;  4AM7 A;  2P9L B;  5AQM A;  3HO1 A;  3UE5 A;  4QOZ B;  3V9S A;  3QB0 A;  4HHT A;  2HW3 A;  3L6Q A;  2O8D A;  4BRH A;  1E4G T;  1JL2 A;  3TAP A;  3LZI A;  4LD0 A;  1RCH A;  3VEY A;  4DSE A;  1B92 A;  1YJ9 N;  4FLT A;  3V1Q A;  3CC4 N;  1Q81 O;  1U6Z A;  1SQK A;  3ZYY X;  2IVO A;  3LP0 A;  3BGR A;  3CER A;  2O8C B;  3LDO A;  4B9N A;  2HMP A;  4YOX A;  1KC8 O;  3ULE A;  2YNH A;  1RBR A;  1EWQ A;  1T05 A;  3CG7 A;  1OKJ A;  5AQJ A;  4O4G A;  1N32 K;  1O1W A;  3NF7 A;  3ZET A;  3V1O A;  1WSG A;  2HB5 A;  4KRE A;  3NDK A;  1S6P A;  3KHY A;  1HNV A;  2V52 B;  2O8C A;  3SQ1 A;  3EE9 A;  4W5O A;  2FC0 A;  3IG1 A;  3I8B A;  3KKS A;  3FZF A;  5KPZ A;  1YIT N;  3L0Q A;  1HKG A;  1LW2 A;  3OYL A;  5M1Q A;  1C6V A;  2YCH A;  2P9P B;  2P9U B;  3NHG A;  5LY3 A;  2ZE2 A;  3AVN A;  3M8S A;  3LM9 A;  3NCI A;  5AQL A;  3WXM B;  1J5O A;  3HP6 A;  1ZBF A;  3AVJ A;  3DMJ A;  3O9T A;  1VQ5 N;  4BR4 A;  3S3O A;  3SK3 A;  2WTU A;  3A5M C;  4CEQ A;  2PYL A;  1HKB A;  3OY9 A;  2FBV A;  5F0X A;  3WXJ A;  4X64 K;  4DUZ K;  2ZQB A;  5JLH A;  3BY5 A;  1QHT A;  2P9P A;  2P9U A;  4XIU A;  4BDY A;  3S3M A;  4ELV A;  4EZ9 A;  1J53 A;  3NFA A;  2IIR A;  4FLW A;  3PO5 A;  4H0Y B;  4GW6 A;  3O3F A;  3TWH A;  4X62 K;  1QSY A;  4CED A;  2XHB A;  3CET A;  4Y1C A;  4EZ6 A;  3DOL A;  1QTM A;  2Q2R A;  4BC5 A;  2YNG A;  4KTZ A;  1KVB A;  3SZ2 A;  2KW4 A;  5CYQ A;  4CHN A;  3QNN A;  1JCF A;  3OYM A;  1Z26 A;  4IFY A;  4FJ8 A;  2QWM A;  4JV5 K;  2HHT A;  1YUW A;  2FSN A;  3VF6 A;  4I9L A;  3U3G A;  4CZE A;  4B9S A;  1VRT A;  4K0K K;  1VQ7 N;  1BDG A;  4FOE A;  4MLE A;  3U9D A;  4M45 A;  3CPW M;  4JI2 K;  3TTF A;  4IG0 A;  1TKD A;  3SMP A;  3TPQ A;  4JI3 K;  4KHW A;  2UXD K;  3WT0 A;  1HKC A;  2VQE K;  2YHY A;  3QIO A;  3VOV A;  4H03 B;  1Q9X A;  2ASM A;  3G25 A;  4FM0 A;  4CZI A;  4IO9 L;  1J9A A;  3NH0 A;  5I9E B;  3O1B A;  5FPM A;  3U6F A;  3FFI A;  4BE2 A;  4DU4 A;  3NGY A;  1TK8 A;  3J7Z O;  1VSF A;  3L2U A;  4BC3 A;  3LP2 A;  3CCM N;  2BH1 A;  1NGE A;  5HOO A;  1NK0 A;  1NGJ A;  3JYT A;  4DUY K;  1CXQ A;  3GOI A;  4BR0 A;  4CJ5 A;  1V4S A;  5KTQ A;  3HJF A;  1WAF A;  4M3R A;  3THW B;  4BGB A;  1LAW A;  2VCP A;  1RT3 A;  3VES A;  1SKW A;  1KAY A;  3RVC A;  4LF7 K;  4BRD A;  4E1J A;  4RW8 A;  3VQD A;  5GAH P;  1D8Y A;  3DLK A;  2G8F A;  1TUU A;  2BDP A;  3H3O B;  5AQU A;  4GKK K;  2PYJ A;  3FLC O;  3HL8 A;  2P9K A;  4E1N A;  4KH5 A;  1HNI A;  3LDL A;  2G8I A;  4JNE A;  3ATV A;  3OYB A;  4CFD A;  2ETJ A;  2ZGZ A;  5AFU H;  1BIS A;  5JVG L;  3HM9 A;  2Q36 A;  3Q7C A;  1JLE A;  3M6G A;  3CJ1 A;  3MN5 A;  3VEO A;  1K9M O;  4A5A A;  4Z0U A;  3MN6 A;  4AHV A;  3G4S N;  1XI1 A;  4ZTJ A;  4DR7 K;  2KFZ A;  3LDQ A;  4KHP K;  4BRK A;  4FJK A;  2E1Y A;  1N5Y A;  3RRH A;  4ZHR A;  1BL3 A;  5F1X A;  2VQF K;  2QXF A;  2YHX A;  5KRT A;  3U8X A;  4RWT A;  3NMU A;  4LFC K;  1KCF A;  1HQU A;  1KFD A;  3VN5 A;  5C0Y A;  5LMU K;  2NRR A;  3VEW A;  3OYG A;  1U2V B;  3M5R A;  3QBX A;  3EKU A;  3CCQ N;  3A0I X;  3K59 A;  2X6N A;  4PHT X;  2DFF A;  4RW4 A;  5HL7 L;  1HLU A;  4FWM A;  2OZS A;  4DSL A;  2XO7 A;  3AVB A;  2D0P A;  2HNZ A;  1HJR A;  4O8U A;  4FK2 A;  1EKE A;  2WON A;  4K42 A;  5CHI A;  4BRO A;  2GWJ A;  4BG8 A;  4DSF A;  1RT7 A;  3O6W A;  1FW6 A;  4FJI A;  2JGU A;  1U2V A;  1VQO N;  4R79 A;  3SPZ A;  5FRM A;  4B1X B;  5EY4 A;  4ILJ A;  4HWI A;  3DLL L;  3CHW A;  4FSV A;  3CXC M;  4CGG A;  3DRR A;  1OVY A;  3CPE A;  2KQ2 A;  2P51 A;  4DU3 A;  3AVK A;  3QDK A;  4ID1 A;  1KD1 O;  2HHU A;  2P5O A;  4EP4 A;  1VQ4 N;  4LFB K;  1CZ9 A;  2XY5 A;  4CEZ A;  2HHQ A;  1ZBL A;  2PZS A;  1OH8 A;  2FSK A;  4B3R K;  4BQZ A;  3F5T A;  4C8M A;  4K25 A;  4B9U A;  3ZT1 A;  4WQ5 A;  3HK2 A;  5AQH A;  2G8W A;  4FPB A;  4LF5 K;  4BRI A;  1H1V A;  3VEN A;  2NRW A;  2D4W A;  4Y0W A;  2P1J A;  3LAN A;  2I7N A;  5C10 A;  1E4F T;  2DTU A;  3RTV A;  4M3Z A;  2X6S A;  5DM6 L;  4FWP A;  5HRS A;  2YHW A;  3ZSY A;  4H0T B;  4FJN A;  1B9F A;  4IKF A;  4N47 A;  1Z6R A;  4M7X A;  4LY7 A;  5I42 A;  1N6Q A;  3HVR A;  3ZEU B;  2OAN A;  5AQY A;  4DMN A;  4FJJ A;  4JK7 A;  1JLF A;  4E0D A;  2XY6 A;  1IKW A;  2VGN A;  3VEZ A;  1XHX A;  3VTI A;  1RDW X;  4FLZ A;  1NLV A;  2CGL A;  3S3N A;  5C2D A;  1RDU A;  3QML A;  4FOI A;  5GIN A;  1YT3 A;  4UY8 O;  4OJR A;  4CF0 A;  3G10 A;  3H1Q A;  1WNS A;  4KFB A;  3A5L C;  5FRO A;  3ZEU A;  1HUX A;  3LL3 A;  1HPM A;  1BCO A;  1RT1 A;  1S1U A;  4YY3 K;  4DF4 A;  3CCE N;  4PY5 A;  3DLR A;  4ISF A;  3QFU A;  1U47 A;  1LW0 A;  2IS3 A;  1JJ2 M;  1KLM A;  2E6L A;  5JS1 A;  1BQN A;  4C8N A;  2GEM A;  4AHR A;  4C1N I;  1GLF O;  2Q1N A;  4CJR A;  5SZT A;  3K0S A;  4FJ7 A;  2VWK A;  3ZSX A;  2F7T A;  3KD1 E;  1KXP A;  4BR2 A;  5SWM A;  1ILY A;  3DLG A;  2BE2 A;  4I6M B;  2E2Q A;  3T7Z A;  3OW2 M;  3QEP A;  3AO1 A;  5CZ2 A;  1WSH A;  3R6M A;  3NH1 A;  4FWN A;  4RCH A;  5DM7 L;  4CJT A;  4DFJ A;  1HNZ K;  1KVA A;  5K14 A;  4IOC L;  1HYV A;  1EET A;  4Z4F A;  5CR4 A;  4FZY A;  3DWL A;  3MWP A;  1X3N A;  3FFK B;  2YNF A;  1LWC A;  4FVM A;  4I6M A;  4M3U A;  3IRX A;  3QEX A;  2ZJR L;  1IKY A;  5TKW A;  5J2Q A;  2UUB K;  3SJJ A;  1S1V A;  4IFE A;  4FWR A;  3MX5 A;  3HOS A;  3NBP A;  3WUH A;  4U7B A;  4CZJ A;  1C0G A;  4CIE A;  1DGK N;  2Q3S A;  5J2M A;  1Q8I A;  1GOB A;  3PV8 A;  3DLH A;  3ITH A;  3TI0 A;  5HRO A;  3CC7 N;  5KRS A;  4FWQ A;  4EFH A;  1QVF M;  3OYA A;  4JKE A;  4BRN A;  4XH5 A;  3O9Q A;  3QIC A;  4PL8 A;  3AVG A;  3T1A A;  2A41 A;  4YDU C;  4DV2 K;  1XNQ K;  3NGZ A;  2AP1 A;  3OS1 A;  4MLH A;  3ISN C;  3KK2 A;  4IOX A;  3L4I A;  3TSP A;  2P9I B;  1LV5 A;  4DSK A;  3KLF A;  3KK3 A;  5FPE A;  3BDP A;  2WBN A;  4DWI A;  2VYP A;  5AZJ B;  1LAV A;  2Z1G A;  3RMA A;  2OCE A;  3R8E A;  5J1E A;  4FVU A;  3IKM A;  4JRP A;  3VQ9 A;  4B1U B;  4O5B A;  4B08 A;  4I2Q A;  4A2B A;  2P9I A;  1IV0 A;  3CQY A;  4DU1 A;  4O0I A;  3V9U A;  3V9Z A;  1TK5 A;  1NGI A;  3O3G A;  4JAX A;  1S1W A;  3OYJ A;  1KAX A;  5AZJ A;  3PX4 A;  5BR9 A;  1HR0 K;  4N41 A;  4B1W B;  4CF8 A;  3M3Z A;  5BN9 A;  3TTC A;  3Q7B A;  3SAG A;  1JL1 A;  3VQP A;  2CGJ A;  3QET A;  2HBL A;  4MFB A;  3KTQ A;  3ENO A;  4ELT A;  3HXM A;  1RT4 A;  3B6P A;  1VQM N;  2QEX N;  3OA9 A;  3I33 A;  4BRM A;  2PFU A;  1RTI A;  3HZ6 A;  1T03 A;  1WSI A;  1R59 O;  3VQA A;  4AM6 A;  1Q82 O;  2G8U A;  3NAE A;  4M3X A;  1KQS M;  4ILG B;  5CYM A;  2FSJ A;  1IBL K;  2X78 A;  4NYF A;  4FM1 A;  4PQU A;  2RPI A;  1RBV A;  4W5Q A;  3LDN A;  4A2A A;  2RF2 A;  4G1Q A;  4O0J A;  3OYD A;  3WEE B;  3T19 A;  1M1K O;  2E20 A;  3ZX0 A;  4JD2 B;  1YTA A;  4CF2 A;  1O13 A;  3TAR A;  4JS4 A;  3T69 A;  4PUO A;  2E4L A;  4F2R A;  4A5B A;  1ATR A;  1SUQ A;  3LPU A;  4DV1 K;  3U4L A;  4CI6 A;  4YOY A;  5AQR A;  3LDS A;  4JN4 A;  4ISG A;  1NKB A;  4EHU A;  4IXC A;  2A40 A;  3CD6 N;  5M1F A;  4E7L A;  5GIP A;  3ULD A;  3WEE A;  3HBT A;  1F21 A;  5KPR A;  3UKR B;  4JD2 A;  1BI4 B;  3EO3 A;  1WBD A;  1VQL N;  4LF4 K;  3TTD A;  3AV9 A;  1NK8 A;  4M3T A;  3HTV A;  3CF5 L;  3WNE A;  2CH5 A;  4Z4G A;  4XEI A;  3WXL A;  3SUN A;  1BGX T;  4JI5 K;  3SCX A;  5E41 A;  4MO4 A;  4DV4 K;  4LC9 B;  1QHA A;  2GX9 A;  1N33 K;  5EXW A;  1NK6 A;  3DXM B;  3GE1 A;  4CZM A;  2ASO A;  4J8F A;  1K6Y A;  1BI4 A;  4DTP A;  2AA4 A;  3ENH A;  3TAG A;  4JKF A;  3VGL A;  4KHS A;  2D0A A;  1BA0 A;  3D45 A;  1IKV A;  2Y1I A;  4I9Q A;  2WFB A;  3S41 A;  4HTL A;  3W0L A;  1YVU A;  3TAE A;  4AIL C;  3CJ9 A;  3HI0 A;  5CZ1 A;  4CHQ A;  3SUQ A;  5E26 A;  4AF1 A;  3DXM A;  4DV3 K;  5AQX A;  4AHS A;  5LMN K;  2P9L A;  4DS5 A;  3DRP A;  4JI0 K;  1UAX A;  4BRG A;  3DAW A;  4OLA A;  3B6O A;  2QWP A;  3W3D A;  4B3S K;  1JXB A;  3PX6 A;  4X66 K;  4C1N K;  3U3Y A;  3IFR A;  2I5J A;  4BGA A;  4BAC A;  3VTH A;  1U48 A;  4CFB A;  4DHY A;  1J6Z A;  3CM6 A;  3EZW A;  3S9H A;  2IOC A;  3PLA A;  4NLC A;  5M1O A;  3LPT A;  4R5P A;  2YJE A;  3O08 A;  4N56 A;  1I94 K;  4OPK A;  4YNQ A;  1U49 A;  1NKE A;  4EP5 A;  3VA3 A;  3H46 O;  1QSL A;  4Y1D A;  1LWE A;  2V51 B;  3MN9 A;  2V7Z A;  3NGI A;  1GLA G;  1TKZ A;  1T6C A;  3RSE B;  4NYN A;  3SJH A;  4BRF A;  4BRE A;  1YJW N;  5GAG P;  1YJN N;  4B1Y B;  3SI6 A;  3TAN A;  2E2O A;  2HBJ A;  4XH1 A;  5FDL A;  4W5N A;  1M90 O;  3AA2 A;  4DQR A;  4CHP A;  2QWN A;  3D2F B;  4PKI A;  1XMQ K;  3V9X A;  3M8R A;  4AH9 A;  4IFV A;  3BF1 A;  3CIP A;  4FLU A;  3T1H K;  1OH7 A;  1NGA A;  4KAZ A;  2ZGY A;  1Q86 O;  5EVZ A;  3RSE A;  4FO0 A;  3RRG A;  1QE1 A;  4DV5 K;  3H08 A;  4IO8 A;  3DRS A;  5HRP A;  4GV9 A;  1W9H A;  5AFU A;  3UB5 A;  2NZT A;  3O3H A;  4NCA A;  3D2F A;  1CXU A;  3P31 A;  3P83 D;  4YOU A;  3SBT A;  4E89 A;  2F96 A;  1ZYQ A;  4IJN A;  3HPO A;  3P4I A;  4X65 K;  1SZ2 A;  4WQ4 A;  4BC4 A;  2OTL N;  3J8A A;  2NNW A;  2RN2 A;  4DLG A;  4IWV A;  2ITM A;  3HRG A;  1YIJ N;  4RW7 A;  1YVN A;  3M1F A;  1ZBS A;  3L8B A;  4CE9 A;  2DFH A;  2E5L K;  3I0S A;  3QBW A;  4OPH A;  1DKG D;  4MDA A;  4A59 A;  4K8X A;  1ASU A;  3VPZ A;  1L5U A;  3WXI A;  2YI1 A;  4FJG A;  1FKO A;  3MX2 A;  4BG9 A;  1VQK N;  1MWM A;  3OBW A;  3DXK B;  3AA5 X;  5BPN A;  4H4O A;  1NK9 A;  1CZB A;  3O4W A;  1RDC A;  2HHS A;  5JS2 A;  4BQL A;  4CK3 A;  4CW7 B;  3PSF A;  3KK7 A;  2KZM A;  3P38 A;  5LJW A;  3T1Y K;  3BP8 A;  2VWJ A;  4E19 A;  4KHN A;  3ID6 A;  4F9O A;  3CYM A;  1UA0 A;  4C8K A;  3HPG A;  5AR0 A;  3VQB A;  1VAZ A;  3O80 A;  3VEX A;  1NWK A;  3DXK A;  3SNN A;  2QWQ A;  2HHW A;  1E3M A;  5AQT A;  4CJ7 A;  1QZ5 A;  4BRP A;  1W7A A;  3NVK A;  2YHB A;  1N36 K;  1Y64 A;  4E3S A;  3MEE A;  3N4P A;  4FYD A;  3AO3 A;  4Z4I A;  3OYN A;  1LWF A;  3VEV A;  3AGR A;  3IUC A;  1EP4 A;  4IG3 A;  3PIP L;  3THW A;  2HVI A;  3EZ5 A;  2NRT A;  3HT3 A;  4JI6 K;  1HPZ A;  2NRV A;  2A42 A;  4OVL A;  3MXM A;  4B9V A;  2Z1J A;  5FRN A;  2OPS A;  2ATQ A;  4CGJ A;  4KI4 A;  3QES A;  3HM8 A;  2G8K A;  1U4B A;  4CD1 A;  1ESV A;  4DTO A;  2NRH A;  5AQS A;  1DTQ A;  1C1C A; 
#chains in the Genus database with same CATH homology
 2VWB A;  4QS9 A;  2NRX A;  1NJI O;  3C7N B;  3A8Y A;  3H6E A;  4WQ5 C;  3CCE N;  4ISF A;  3QFU A;  1JJ2 M;  1N8R O;  2GEM A;  2W41 A;  4C1N I;  3CI5 A;  1GLF O;  2Q1N A;  1NBW A;  3HSC A;  1BA1 A;  3AY9 A;  4YDU A;  3CJB A;  2F7T A;  1KXP A;  2GUP A;  4BR2 A;  1VQP N;  2Q0U A;  2QWL A;  2KKZ A;  1ILY A;  1W97 L;  1XUP O;  4I6M B;  1T44 A;  2E2Q A;  3T7Z A;  3OW2 M;  4JKG B;  2HBK A;  5KPT A;  2A5X A;  4ILH A;  3EN9 A;  1IJJ A;  4B1V A;  1QQM A;  3C7N A;  3R6M A;  3IDH A;  4FWN A;  5AQP A;  4H0X B;  5TKY A;  4RCH A;  5DM7 L;  5KQ8 A;  4KH6 A;  4EIA A;  2BTF A;  3KVG A;  3R1X A;  3O9R A;  3UKU B;  4IOC L;  4KBO A;  4BRA A;  1VQ8 N;  3LDP A;  4JHD B;  4FWS A;  5CR4 A;  3F2K A;  3DWL A;  3CCS N;  4JK9 A;  3TU5 A;  3MWP A;  2KHO A;  1X3N A;  3FFK B;  1KAZ A;  5BPL A;  3SAF A;  5AQF A;  1ATN A;  4I6M A;  4JKG A;  3CJA A;  2ZJR L;  3SMS A;  5TKW A;  3OBY A;  4IFE A;  1VQ9 N;  5BRE A;  4FWR A;  2QWO A;  4H5T A;  3WQT A;  3MX5 A;  3HOS A;  3WUH A;  1DEJ A;  1QQN A;  4U7B A;  2PBD A;  2IVN A;  4CZJ A;  2F9W A;  1C0G A;  4A61 A;  1BUP A;  1IG8 A;  3UKU A;  1DGK N;  1WOQ A;  5ELZ A;  2WC9 A;  3ATU A;  1ATS A;  3CQX A;  4DB3 A;  1Q18 A;  4H5W A;  4JHD A;  1QQO A;  3VET A;  3MK6 A;  5C15 A;  3D7E O;  4IOA L;  5AQO A;  3O1W A;  4BRQ A;  4IEE A;  3AGK A;  3D2E B;  3CC7 N;  3MWT A;  4FWQ A;  4EFH A;  2ASP A;  1QVF M;  5AZI B;  4JKE A;  1GLL O;  4BRN A;  2ZWH A;  3O9Q A;  4XH5 A;  5GAE P;  4AM7 A;  3QIC A;  2P9L B;  4PL8 A;  5AQM A;  2A41 A;  3UE5 A;  4YDU C;  4H0O A;  3QB0 A;  1JCG A;  1LOT B;  4GNI A;  3L6Q A;  2AP1 A;  4MLH A;  1E4G T;  3O9S A;  4BRH A;  4IOX A;  3L4I A;  3TSP A;  2P9I B;  3FR0 A;  2E2N A;  4PKH A;  3VEY A;  4PL7 A;  1YJ9 N;  3K9K A;  3CC4 N;  1MDU B;  1Q81 O;  1U6Z A;  5FPE A;  1SQK A;  2YJF A;  2WBN A;  3AAR A;  2IVO A;  2VYP A;  3ZYY X;  5AZJ B;  4CBW A;  3HOT A;  4OPA A;  3CER A;  3D2E A;  3MN7 A;  3LDO A;  4MDB A;  3FGU A;  5AZI A;  1NGF A;  3R8E A;  2HMP A;  3CCV N;  4YOX A;  4FVU A;  2P9K B;  1KC8 O;  3ULE A;  3IKM A;  1YAG A;  4WFB L;  1QVG M;  4B1U B;  1OKJ A;  5AQJ A;  3DJC A;  4BVP A;  4A2B A;  2P9I A;  3E1Y A;  3ZET A;  3CQY A;  2A6A A;  2JWK A;  2RE2 A;  3H45 C;  1Z05 A;  3ID8 A;  1NGI A;  2E1Z A;  4JAX A;  4CZG A;  3KHY A;  1KAX A;  5AZJ A;  5BR9 A;  2V52 B;  3C65 A;  3NVM A;  4B1W B;  3CMA N;  1WUA A;  3M3Z A;  5BN9 A;  3TTC A;  3EE9 A;  5E84 A;  5LJV A;  4MO5 A;  3Q7B A;  3SAG A;  3ZX3 A;  2YX6 A;  3I8B A;  2CGJ A;  4H5N A;  2HBL A;  5JLF A;  5BPM A;  1S72 N;  3FZF A;  3ENO A;  5KPZ A;  4DKW A;  2HF3 A;  3E9P A;  1YIT N;  3L0Q A;  1HKG A;  2QEX N;  1VQM N;  3OA9 A;  4BC2 A;  2WUS A;  5M1Q A;  3I33 A;  5AQQ A;  4BRM A;  2PFU A;  3HZ6 A;  2YCH A;  1C0F A;  2P9P B;  2P9U B;  3CCU N;  1R59 O;  4JKA A;  2HST A;  5LY3 A;  4AM6 A;  1YXQ A;  1Q82 O;  2V7Y A;  5FPN A;  3LM9 A;  5AQL A;  4YOR A;  3WXM B;  1KQS M;  1K8A O;  4ILG B;  3AAQ A;  5AQK A;  2FSJ A;  3O9T A;  3GL1 A;  1VQ5 N;  3KWI A;  4JKC A;  4BR4 A;  4WFA L;  4BY9 C;  3SK3 A;  5M1P A;  3A5M C;  1QZ6 A;  3LDN A;  4A2A A;  2ZJQ L;  3I56 N;  1HKB A;  5F0X A;  3WXJ A;  4YOW A;  1ZC6 A;  3WEE B;  5JLH A;  3FE1 A;  2P9P A;  2P9U A;  3O8M A;  2E20 A;  1M1K O;  5AQZ A;  3ZX0 A;  1CZA N;  3H1V X;  4JD2 B;  1NGC A;  5JVH L;  2D1K A;  2UYT A;  3TSU A;  2IIR A;  4H0Y B;  4YOV A;  1O13 A;  4BRC A;  5FPD A;  3T69 A;  4GVE A;  5BRD A;  5EX5 A;  4B1Z A;  3CET A;  4A5B A;  1ATR A;  3A5N C;  5JMV A;  3U4L A;  4CI6 A;  5M1K A;  3D6R A;  5AQR A;  4YOY A;  3VER A;  2NLX A;  4JN4 A;  4QS7 A;  4ISG A;  4WF9 L;  3WXK A;  2Q2R A;  4EHU A;  4BC5 A;  1W2B M;  1GLJ O;  1GLD G;  2A40 A;  4IXC A;  2Q0R A;  5M1F A;  3JXU A;  2GEL A;  3CD6 N;  4GY2 B;  5B8H A;  5GIP A;  1JCF A;  4NLB A;  5BN8 A;  2RHK A;  1TUY A;  3WEE A;  3HBT A;  1MA9 B;  1NMD A;  3KWG A;  4YOT A;  4EAH D;  4EHT A;  5KPR A;  3UKR B;  4JD2 A;  2QWM A;  4DCH A;  3EO3 A;  1YUW A;  1VQL N;  3TTD A;  4CZK A;  4BR9 A;  2CGK A;  2FSN A;  4CZL A;  3HTV A;  3VF6 A;  3CCL N;  3CF5 L;  2CH5 A;  4CZE A;  1MWK A;  4XEI A;  4JKB A;  3WXL A;  4XH4 A;  3C6H A;  1VQ7 N;  1BDG A;  4FOE A;  1P8Z A;  2ZF5 O;  4MLE A;  3U9D A;  3E66 A;  4JKD A;  4MO4 A;  2DPN A;  3CPW M;  1ZXO A;  3N4Q A;  1QHA A;  2GX9 A;  4LC9 B;  3OHR A;  3TTF A;  3SMP A;  3TPQ A;  3WT0 A;  1HKC A;  1SAZ A;  2YHY A;  5EXW A;  3VOV A;  3DXM B;  3GE1 A;  2FXU A;  4CZM A;  2FF3 B;  4H03 B;  1V4T A;  3GBT A;  2ASM A;  2ASO A;  4J8F A;  3G25 A;  3WQU A;  4CZI A;  4IO9 L;  1GLE G;  2AA4 A;  3ENH A;  3F9M A;  3G6E N;  3O9U A;  4JKF A;  3VGL A;  1EQY A;  1BA0 A;  5I9E B;  2E88 A;  3O1B A;  1X9J A;  5FPM A;  3CJC A;  3AAP A;  4QS8 A;  4K41 A;  3H3N O;  2WFB A;  4RTF D;  3S41 A;  3MDQ A;  2E8A A;  4HTL A;  5BRF A;  3W0L A;  1BWF O;  3J7Z O;  4H0V B;  3CJ9 A;  3HI0 A;  4BC3 A;  4C23 A;  4PKG A;  4A62 A;  3TSQ A;  4BR7 A;  4FPA A;  3CCJ N;  3CCM N;  2BH1 A;  5E26 A;  1NGE A;  5AQW A;  4AF1 A;  2Q97 A;  5MLC Q;  2JWL A;  5HOO A;  3DXM A;  1NGJ A;  5AQX A;  2P9L A;  3GOI A;  1XQS C;  2IVP A;  4BR0 A;  2OTJ N;  2BUP A;  4BRG A;  1V4S A;  3DAW A;  4GV3 A;  4IZ9 A;  2QWP A;  3W3D A;  4G9Z A;  4BGB A;  2P9S B;  2VCP A;  3VES A;  1BO5 O;  1SS6 A;  4JEP A;  4C1N K;  1HX1 A;  1KAY A;  1BG3 A;  2QWR A;  3IFR A;  3LL3 A;  3U9Z A;  3RVC A;  3R9P A;  3B8A X;  4BGA A;  3SAH A;  3VTH A;  2QTD A;  4DHY A;  1J6Z A;  4BRD A;  5AQG A;  4E1J A;  2QM1 A;  5GAH P;  1TUU A;  3H3O B;  3EZW A;  5AQU A;  2FLO A;  3PLA A;  4NLC A;  2F9T A;  4BR5 A;  5M1O A;  3FLC O;  5GIO A;  1HJO A;  3CJ7 A;  2P9K A;  2YJE A;  3O08 A;  4KH5 A;  2A3Z A;  4NB4 A;  4BRL A;  1VQN N;  3P39 A;  5AQI A;  3LDL A;  4JNE A;  1Q7Y O;  4WCE L;  3ATV A;  3MMV A;  3H46 O;  4NO7 A;  5KQD A;  2P9S A;  1TYQ B;  2ZGZ A;  5AFU H;  5C2F A;  5JVG L;  3VF2 A;  4O8K A;  2V51 B;  3MN9 A;  2Q36 A;  3Q7C A;  4L3Q A;  2V7Z A;  2HF4 A;  3M6G A;  3CJ1 A;  3FZK A;  4FWK A;  1GLA G;  3MN5 A;  3VEO A;  1T6C A;  1K9M O;  5ADX A;  3RSE B;  4A5A A;  3MN6 A;  3G4S N;  3GG4 A;  2KLA A;  2H3G X;  4IJA A;  3SJH A;  4BRF A;  4BRE A;  3G71 N;  1YJW N;  3LDQ A;  3CME N;  4BRK A;  2D0O A;  2E1Y A;  5GAG P;  1YJN N;  4B1Y B;  2PAV A;  4GV6 A;  2E2O A;  2HBJ A;  3PIO L;  4XH1 A;  5F1X A;  1M90 O;  2QA4 N;  2QWN A;  2YHX A;  5M1N A;  1D4X A;  3U8X A;  4RWT A;  3L4Q A;  1RFQ A;  1TYQ A;  3C6A A;  3D2F B;  4PKI A;  4CZH A;  3NMU A;  1G99 A;  3BF1 A;  3ZX2 A;  3CIP A;  1NGH A;  4FWL A;  5C0Y A;  2I7P A;  1NGA A;  2ZGY A;  1Q86 O;  5EVZ A;  4U67 L;  2NRR A;  3RSE A;  4FO0 A;  3O5B A;  3VEW A;  1U2V B;  3VMF B;  3M5R A;  3QBX A;  5H1S Q;  3BF3 A;  3EKU A;  3CCQ N;  3I55 N;  3A0I X;  5BRH A;  4IO8 A;  4PHT X;  5HL7 L;  1HLU A;  1S3X A;  4FWM A;  4GV9 A;  2D0P A;  2HBM A;  5AFU A;  3UB5 A;  3EL2 A;  1VQ6 N;  3EKS A;  2NZT A;  4O8U A;  5GAD P;  4K42 A;  3D2F A;  3SLC A;  4YOU A;  1LCU A;  3P31 A;  3SBT A;  5CHI A;  4BRO A;  1NM1 A;  2GWJ A;  4H0P A;  5EOY A;  2HOE A;  4BG8 A;  4IJN A;  3O6W A;  1K8K B;  3MCP A;  3E9O A;  3P4I A;  1NGG A;  5CE3 A;  2E2P A;  1T3V A;  1SZ2 A;  4WQ4 A;  1U2V A;  1VQO N;  4BC4 A;  4R79 A;  2OTL N;  3J8A A;  2GTD A;  4B1X B;  1XC3 A;  2NNW A;  1GLB G;  3EE8 A;  4ILJ A;  4HWI A;  5EY4 A;  3DLL L;  4ISE A;  3CHW A;  4FSV A;  2CH6 A;  4IWV A;  2ITM A;  4M63 C;  3CXC M;  1OVY A;  3CPE A;  3HRG A;  1YIJ N;  1S22 A;  1YVN A;  3ENB A;  3M1F A;  1ZBS A;  2QXL A;  3BUZ B;  1EO1 A;  3QDK A;  3QBW A;  4OPH A;  1DKG D;  4MDA A;  1KD1 O;  2W40 A;  4A59 A;  1X3M A;  1GLC G;  3VPZ A;  3UKR A;  1VQ4 N;  1K8K A;  3FZH A;  3WXI A;  2YI1 A;  4H5R A;  3CC2 N;  3MX2 A;  4BG9 A;  2NRZ A;  1VQK N;  4OO1 J;  1MWM A;  4DQ8 A;  2FSK A;  4H5V A;  3OBW A;  3DXK B;  3E9L A;  3F5T A;  4BQZ A;  5BPN A;  4A57 A;  5C12 A;  4WYB A;  4Z94 A;  4K25 A;  2FF6 A;  3QFP A;  4WQ5 A;  3O4W A;  5AQH A;  3VF4 A;  5ADX H;  4FPB A;  2GWK A;  4FL9 A;  4BQL A;  4CD3 A;  4BRI A;  5F2R A;  3ULE B;  3KK7 A;  3P38 A;  5LJW A;  3BP8 A;  1H1V A;  3VEN A;  2NRW A;  4IDH A;  1RGI A;  2D4W A;  3ID6 A;  4Y0W A;  4F9O A;  2P9N B;  3JS6 A;  4JK8 A;  2I7N A;  3ZET B;  5C10 A;  4FWO A;  1E4F T;  5AR0 A;  1VAZ A;  1NGB A;  3O80 A;  3VEX A;  3VGK A;  1NWK A;  3DXK A;  1BU6 O;  2QWQ A;  5AQN A;  5DM6 L;  4FWP A;  4O5F A;  2EWS A;  1P90 A;  2YHW A;  4H0T B;  4JKH A;  3K9J A;  5AQT A;  4CJ7 A;  1QZ5 A;  4BRP A;  2QW9 A;  1YF5 L;  4K43 A;  3VGM A;  3NVK A;  1Y64 A;  2J4R A;  3KZB A;  3LM2 A;  4WQ4 C;  1Z6R A;  5JIC A;  3N4P A;  1K73 O;  4KH4 A;  4M7X A;  5AQV A;  3ZEU B;  2OAN A;  5AQY A;  1YHQ N;  3SBG A;  3VEV A;  2P9N A;  4WFN L;  3AGR A;  3IUC A;  3PIP L;  4JK7 A;  4IEI A;  3FZM A;  2NRT A;  1BOT O;  4BVO A;  2VGN A;  3VEZ A;  2NRV A;  2A42 A;  3VTI A;  1RDW X;  1NLV A;  2CGL A;  5C2D A;  3FZL A;  1RDU A;  3GDQ A;  3IMX A;  4CBX A;  1YI2 N;  3MCA B;  2VGM A;  3QML A;  4FOI A;  3BEX A;  5GIN A;  3CCR N;  3HM8 A;  4M7Y A;  3R3L A;  4CBU A;  4UY8 O;  4CZF A;  4CD1 A;  1ESV A;  2Q31 A;  1NGD A;  3H1Q A;  2QI2 A;  2NRH A;  4B9Q A;  1T6D A;  3C0B A;  3A5O C;  2ZJP L;  5AQS A;  1JCE A;  1DT9 A;  3A5L C;  3ZEU A;  1HUX A;  1HPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...