3KWGA

X-ray structure of ns1 effector domain w187a mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEANDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 1
publication title X-ray structures of NS1 effector domain mutants.
pubmed doi rcsb
source organism Influenza a virus
total genus 35
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3kwgA00
3O9RA 3KWGA 3L4QA 3KWIA 2GX9A 3EE9A 3RVCA 3O9SA 2KKZA 3M5RA 2RHKA 3OA9A 3P39A 3O9QA 3O9UA 3F5TA 4OPHA 3P31A 3D6RA 4OPAA 3O9TA 3EE8A 3P38A
chains in the Genus database with same CATH superfamily
4CK3A 2ZGYA 3M6GA 4FLYA 4AQYK 5C25A 1U4BA 2P9UA 3HVTA 4LH5A 3HTVA 4FWKA 3M3ZA 4JAXA 4WQ5A 5AQPA 2KTQA 5AQSA 3T1HK 1NJIO 3NH1A 1QQMA 3RTVA 4JI8K 4FPBA 4AHSA 3IS9A 4YOTA 2HNZA 5BN8A 3AAQA 2P9LA 2YHBA 1WOQA 3TPQA 2VG7A 3KJVA 5GADP 4NLCA 3HPOA 5CY4A 3HYFA 4CJEA 3MXMA 4KHNA 3HOSA 4E19A 2AA4A 2I7PA 2QK9A 4IO9L 4H0PA 2HHWA 2PY5A 4BG8A 3NCIA 4DS5A 2CGJA 3V1RA 4BWMA 5KPRA 3HSTB 3C0BA 4W5NA 3VGKA 3KD5E 1KXPA 1BUPA 3P1GA 3O1WA 3TARA 1Y64A 3G10A 2E4LA 3H3OB 4DMNA 3MN6A 5JVHL 3O08A 3VOVA 3O6WA 3AO5A 3KZBA 2JWKA 4OPAA 4CF0A 3GG4A 4YOXA 3O9RA 1TK8A 3L4IA 3NE6A 1BCOA 4EIAA 3H6EA 4QAGA 2HMIA 1RT4A 3P5JA 1K9MO 2YKMA 3QEPA 4DSLA 1QVGM 5HBMA 1IH7A 2VWJA 1BU6O 2VG5A 4CGGA 2ITMA 4M3WA 3L3UA 2HHVA 2VYPA 4BRCA 3I56N 4PKHA 1IKXA 1XMQK 3CCEN 3SUQA 2JWLA 4E7JA 4BE2A 4CFBA 2DFEA 2ZGZA 3O8MA 5EU7A 1NGFA 3MWPA 4XH5A 3PIOL 5M1FA 5C10A 4DCHA 5GINA 2RN2A 5BRFA 1C1BA 2Q36A 2QI2A 3WEEB 1LOTB 4MLEA 3CFRA 4IKFA 1RDBA 3TAMA 2QA4N 2GTDA 4I9QA 3T69A 4Q5VA 2GV9A 1ZBFA 1TK0A 2RKIA 2DFFA 2P9UB 4RW8A 1SL1A 3CPWM 1BISA 4Y0WA 1NGHA 3LP0A 4FCYA 4HUFA 1JJ2M 1LWCA 2YJFA 3THXB 4B1WB 4HCBA 4FWMA 3H46O 3C65A 3NH2A 3BGRA 1KVBA 4FJGA 2P9LB 5IWAK 1WBBA 2E5LK 4BY9C 2PAVA 3HBTA 4BR9A 4WCEL 1B92A 3MK6A 4JI4K 3KK2A 3PX0A 3H1VX 4FJNA 4JI6K 4OKKA 1VQ8N 4CZEA 2Y1JA 4CW7B 4FLXA 3KK1A 4CD3A 2EHGA 3B6OA 1OKJA 4JHDA 4LF6K 3NGYA 4CGIA 2X6SA 2VGNA 3JAMO 4JKGA 2Q31A 2BH1A 3SYZA 2HHSA 3ULDA 3K0SA 2P5GA 4EFHA 4AHVA 4WFBL 4B1XB 1N34K 1U6ZA 4LFBK 3VTHA 1X9WA 3HL8A 1HLUA 4FWRA 4CEAA 3TWHA 3CJCA 2YNIA 2QXLA 4CJPA 3FGUA 5KGXA 4CJTA 3NF9A 1EXQA 4BVOA 1MWMA 2A40A 4DUYK 1VAZA 3A5NC 3TTDA 1VSKA 5BPMA 1SZ2A 1XWLA 4DB3A 1XHZA 3FZLA 1WSFA 5FLXO 4DWIA 3O3GA 3T7ZA 4H4MA 4DSEA 4DTMA 4RWTA 3K59A 3QIPA 2VQFK 1Z26A 4BR7A 1U47A 3AO3A 5AQYA 4F2SA 3DYAA 4H5WA 1RNHA 4BE1A 1KRPA 4DTRA 4BREA 4F4KA 3HJFA 4BRFA 2OPRA 3IFRA 4B3RK 3JSMA 4HTUA 4IFYA 2X6NA 4CJSA 4BROA 4O8UA 5CYMA 4AM6A 3K5LA 4OLAA 4CF1A 3U9ZA 2KKZA 1CXUA 4FJ7A 5BRDA 2RPIA 3PSIA 3NVKA 2BE2A 3MMVA 3WQUA 2NRVA 4WQ4C 4FM2A 2AP1A 4K42A 2EX3A 3EL2A 3ZCMA 4FK0A 3FZMA 2NUBA 1C1CA 1NK5A 1RCHA 1FXXA 2PFUA 4ELTA 2UXBK 1X9JA 2YKNA 4FPAA 1JCEA 4CEFA 2A1RA 4FW1A 2QWQA 4CJVA 3CCMN 2YJEA 1WSJA 3VQ6A 3BUZB 4AM7A 1HNXK 4BRQA 3NHGA 2Z1GA 3VEZA 3BP8A 4FLUA 1SV5A 2A5XA 2WTUA 2D0CA 3OYEA 4H5NA 4I6MA 2P9IA 2P9KB 5AQFA 1BOTO 2NRHA 2QXFA 3THYA 4C8OA 1NK8A 3D2FA 4C8LA 4K43A 3J80O 4CESA 5AQGA 2W42A 4DG1A 4LSNA 4KAZA 4AILC 4NCBA 3T19A 4CZKA 1Q8IA 5AQQA 4JHDB 4M3UA 2RF2A 1ATRA 3MCPA 3OVNA 4JKGB 1L3VA 3IMXA 5A2QO 4CJUA 3OYCA 4C1NK 3H3NO 4KHUA 1VQ4N 2D5RA 1FKOA 1U48A 3QESA 4JI5K 1LW0A 2FC0A 1EX4A 2XRIA 4B9NA 1ZC6A 2UXCK 4FJ5A 3HRGA 5E41A 4M42A 1FW6A 3LAMA 1HPZA 2YNGA 4CBUA 1DEJA 4BR4A 1Q81O 4CEDA 1YVNA 3RRHA 2B6AA 3MEEA 3QEWA 4CEOA 3RMDA 4GKJK 3DLLL 3ATUA 4FK4A 4XH1A 2IGIA 4AF1A 5B8HA 5AQNA 1ILYA 4CZHA 2F4VK 4E0DA 1W7AA 3NH0A 1DKGD 3LZIA 3LDQA 3AO4A 4U67L 3A2FA 3SAFA 1LW2A 3KWIA 3I8BA 4E1NA 1L3SA 3T1YK 3QNOA 4CJ5A 4DTOA 4YORA 2E2QA 1D9FA 5FPMA 5AZJA 1VRUA 1W0HA 3BZCA 1ZBHA 2E2PA 4BRKA 1XC9A 4KHWA 4IEIA 2IDOA 3QFUA 4HUEA 4KTZA 5BR9A 4WFNL 4B8CA 2AJQA 3TSPA 1NJYA 1JCFA 3G25A 4GVMA 2PBDA 4B1ZA 4LY7A 3OJUA 3HVRA 2F9WA 4A59A 3SPZA 1QE1A 4CIGA 1W2BM 4A61A 2O8BA 3SBTA 1ATNA 4KO0A 2OZSA 5BREA 1KD1O 2Q0UA 3PO5A 1BI4A 4IJAA 4IDKA 4AHUA 4H0VB 2FBXA 2QEXN 4CIFA 1VQ5N 5AFUH 4B3MK 3TAGA 5HRSA 2D0PA 3HK2A 4CEQA 3P83D 3QETA 3AVGA 2GEMA 1IBKK 3SAGA 3KLHA 3OYBA 2G8UA 2OYQA 1S22A 1HR0K 5SZTA 4PL8A 3SV4A 1H1VA 4DR2K 3BDPA 3VQQA 4JKBA 4I6MB 4NB4A 2DPNA 2P9IB 3D6RA 4FWQA 4DFMA 1TKDA 4G9ZA 3THYB 3D2FB 3SPYA 1S1VA 4JKCA 3C6UA 3F2KA 3VQ7A 2OTLN 4B3OA 4DV0K 5J2MA 4E7LA 4O5FA 1RT6A 3G4SN 3VA3A 3D7EO 5DM7L 1TAQA 5HL7L 2FBVA 1QQNA 2RHKA 5AQWA 3OA9A 4H0OA 1O13A 1P90A 1UAXA 3CYMA 4CHPA 4H5RA 5FROA 4GY2B 1CZAN 4KRFA 3ASMA 3DAWA 1DLOA 2GWJA 2OTJN 4YOWA 2X74A 2EWSA 4FWLA 1TVRA 5AR0A 2HBMA 4PKIA 1NGEA 3BY5A 5E26A 5AQUA 2A1SA 3AVIA 4CVNE 1OH7A 4C23A 4CHNA 2ZE2A 3WT0A 2NLXA 4A5AA 1RBUA 4JKAA 5C24A 2QTDA 2Q2RA 4FWSA 3I55N 2B4JA 1N5YA 1T03A 4HVJA 2QW9A 4WQ4A 1J6ZA 3U8XA 1DTTA 5AZJB 4GW6A 1YI2N 4LF4K 3CI5A 1IG9A 1R59O 5M1OA 4FLTA 2E1ZA 2F9TA 3AVLA 1RT1A 3CCRN 2O8FB 4JK7A 4JEPA 2BUPA 4ILJA 1HMVA 1SAZA 5I42A 2HW3A 3L4QA 4Z4IA 1BL3A 4AHTA 2PZSA 1NM1A 3KLIA 3ISNC 1TUYA 1WAJA 3CF5L 5C15A 4Z4GA 1YJ9N 2O8BB 2DFHA 2HF3A 3LL3A 4ELUA 3OS0A 1Q7YO 3K2PA 1N36K 4J2DA 2D0OA 2YCHA 4NCAA 3WNHA 3LPUA 3Q7CA 3WXJA 4PL7A 3P31A 1OH8A 1ZBLA 3O4NA 2X78A 4CZGA 5JS2A 3CCQN 3I0RA 2ZJQL 1T6DA 3SCXA 3IAYA 1M90O 4MFBA 3OYAA 4K25A 1C1AA 1Q18A 3V9UA 1YF5L 3WEEA 4X65K 3L2WA 1RT2A 2YHWA 1HQUA 1JLQA 3ENOA 3P38A 3E9OA 3NGZA 2BTFA 2UXDK 3CQYA 4CJRA 3FZFA 4IOXA 3TI0A 3PUFA 2VQEK 5DMRA 4ELVA 3ZX2A 1QSLA 4GV9A 2F8TA 3R3LA 4BRDA 1EWRA 1HKCA 3EO3A 4DQSA 3NF8A 2WC9A 4Y1CA 4DTPA 1S1XA 3ENHA 3THXA 1V4SA 1K6YA 4BRLA 3FZHA 3AVFA 1EETA 1QSSA 1VQPN 3LM2A 3WNGA 1S6PA 5FPDA 1LAWA 3LP2A 4KI4A 3N4PA 4B1UB 4ZTFA 2XY6A 4OJRA 3DI6A 2HOEA 4K8ZA 4PY5A 4QS9A 4IO8A 4N47A 3ZX3A 4BC3A 4CHOA 4IFVA 2ZJRL 4LFCK 3TAEA 2HB5A 3NFAA 4HWIA 3THWA 2A42A 1E4FT 3F73A 3MAQA 4A2BA 1HQEA 3VF4A 1BIUA 3KK3A 3VA0A 5M1KA 1KAZA 4BQZA 5J2QA 1HYSA 3L3VA 3ZSWA 4IXCA 4JD2A 5FPEA 4CJKA 3SI6A 1Q82O 1NMNA 1IJJA 3AGKA 3SUOA 4DV7K 1JLCA 3HM9A 3V1QA 1KFDA 3OYNA 1WSIA 3V6DA 4JKFA 5ADXA 1S5JA 1VSEA 3V4IA 4W5QA 1SUQA 2W41A 1FJGK 3TANA 1C0MA 2O8DA 3LWLA 1X1PA 1YUWA 3M8QA 4U7BA 4H0XB 3L2VA 5JLHA 3O80A 2H3GX 1J9AA 1N8RO 4OX9K 4KFBA 5HRRA 1W9HA 3R1XA 4GV3A 1EO1A 5DM6L 1NK4A 4DV2K 1E4GT 3RSEA 5M1PA 2IC3A 4O5BA 5HLFA 1NGBA 5HOOA 2P9NA 4JYAK 3ID8A 4KBOA 1J5OA 2O4IA 3RR8A 5D3GA 1IKWA 4E1MA 4FJIA 3QICA 3SQ0A 1S1TA 5C0YA 4DFKA 5J2PA 1E3MA 1NK7A 3MEDA 4OVLA 5FDLA 5MLCQ 5CZ2A 4CCHA 1CZ9A 3QBXA 4E89A 4FYDA 5DK5A 1SQKA 1TGOA 3OYLA 4EHTA 4NYNA 4OPHA 3VESA 1KCFA 3O9TA 5K14A 3AA3A 2OPPA 4DU1A 5JS1A 4R5PA 3HT3A 2G8HA 4OPKA 4CBXA 1Z05A 1QVFM 4ISGA 1NKCA 1JLGA 4GV6A 1MDUB 4OGEA 4JI1K 3CETA 2NZTA 3TR8A 1QQOA 3FZKA 4FWPA 4PA1A 1TUUA 3AY9A 4H0TB 2QKKA 3LAKA 3CPEA 4DKWA 2HHHK 3SNNA 3C6TA 1BO5O 2E1YA 1ASUA 2E20A 3MN9A 4CE9A 4ICLA 2P9KA 4KHSA 1DTQA 3PIPL 3T1AA 1BG3A 4N56A 5TKYA 3AVJA 5KPZA 1VQ9N 4M3XA 3ZEUA 2G8FA 1S6QA 1J5EK 1ASVA 1NJZA 3E9PA 3ZT0A 4JI3K 2GELA 3QNNA 1YT3A 3VEYA 1TL3A 4Z4EA 3DOKA 3THWB 3DXMA 5KI6A 3CXCM 3TAQA 1K8AO 4B3SK 4RW9A 2Q0RA 3D2EA 1LCUA 3RRGA 2BGGA 3AAPA 1BGXT 2HF4A 4JD2B 2GUIA 4I7FA 4I9LA 1Z6RA 2NRTA 2E6LA 1HJOA 3OTOK 5EY4A 4M3YA 4RTFD 3SUPA 4KI6A 2HBJA 3BEXA 1LWFA 3HPGA 4EP4A 4B1YB 3I8DA 4CHQA 4M3TA 3DXKA 2Q3SA 3VQBA 3OS1A 4KB1A 1L3UA 1BQMA 2O8DB 3SQ2A 4AH9A 1U45A 4YDUC 2Z1IA 3ZT2A 4DFJA 4B9VA 3CD6N 3LDOA 2RE2A 5LMUK 3NDKA 2YHXA 1XNRK 3HP6A 1HNIA 2HHQA 3MXJA 3LDSA 1JXEA 4NXMK 3EN9A 3PO4A 4KHYA 1KC8O 2ASPA 2WFBA 4YFUA 3PX4A 4B9UA 3RSEB 1EQYA 1EKEA 4K8XA 5C2FA 5T7BA 2JLEA 1NGIA 2P9NB 3CCLN 1IO2A 4IDHA 1WN7A 4YOUA 5AQVA 3ZT3A 4DTNA 1NOYA 3ZX0A 3FR0A 1ZBUA 2E2OA 4I2PA 3QERA 1JKHA 4E3SA 4CGDA 1T6CA 3NBPA 3VQCA 4BVPA 3C7NB 3M1FA 3OYHA 2P9SB 2KLAA 3PLAA 1QZ5A 3R8EA 4GVEA 2P5OA 3H1QA 3BF3A 1VSFA 4DV1K 4N41A 2NRZA 3V9ZA 2KQ2A 4DU4A 4DR7K 3TABA 1J54A 5LMNK 5AQOA 1UA0A 5F1XA 3RMBA 1RTIA 4EHUA 1YTAA 1RDCA 2HSTA 4DV5K 4IFEA 1RGIA 4M7XA 3PX6A 3ITHA 3C95A 3ZSOA 4DHYA 3ULEA 3FLCO 3EEQA 3L2QA 1KFSA 3O9UA 2XO7A 1RILA 1TYQB 2WBNA 3GL1A 5BPNA 3LZJA 4KREA 2HHUA 4DR6K 3L2UA 1YJWN 1I3AA 1DT9A 1C0TA 3EKUA 4J8FA 5JMVA 3A5MC 3DLHA 1NJXA 3J7YP 1VSLA 2B5JA 3CM6A 5BN9A 4QS8A 4CZLA 5HROA 3EKSA 3ZEUB 4JLHA 1T05A 4N5SA 3K57A 1EWQA 4CGJA 4CEZA 3FFKB 3NVMA 2P1JA 1RBTA 3G6EN 3MEGA 2W40A 3F9KA 3KLFA 4E7IA 4CBWA 1S72N 3DXMB 1ATSA 5KRSA 3CMEN 1GOBA 4BR0A 2FF3B 3D2EB 3AVAA 3CJAA 1Z25A 2VWBA 3K9KA 1SKWA 2VGMA 3ZSRA 1P8ZA 4CF8A 3VEOA 1MA9B 4CF2A 4OGCA 4DR5K 3DXKB 2YHAA 3GE1A 4IBNA 3UKUA 1GLDG 4FWOA 1HX1A 4NLBA 2OPSA 3O3FA 4OKJA 3WUHA 4FZYA 4WE1A 4IOAL 4A57A 4DS4A 4X62K 3CCSN 3AV9A 4L3QA 4LC9B 3IDHA 4KH4A 4FWNA 4G1QA 2O8FA 2NRRA 3SZ2A 5GIPA 1HUXA 5LJWA 3MECA 4K0KK 1GOAA 2KZZA 4YY3K 4Z94A 1ITGA 4CERA 4B9LA 1UWBA 5CZ1A 2PYJA 3MN5A 4H0YB 1S3XA 3W3DA 3KIOA 1I94K 4FM0A 3PSFA 3OYKA 4KPYA 4E7HA 4YOYA 3IUCA 3VQPA 1VSIA 1NOZA 1OVYA 4B9QA 5I3UA 1JLEA 1LAVA 3VQAA 3VF6A 2D0BA 4JRPA 3QEIA 3DLBA 2ASMA 4CIEA 1YJNN 1XC3A 4H03B 5KGWA 5FPNA 1J53A 1ZXOA 3CMAN 1VQLN 3V1OA 3SMPA 3ULEB 2IOCA 2OCEA 1YAGA 1D8YA 1C0GA 4FM1A 4OO1J 3JS6A 1EP4A 1VSMA 5AFUA 5GAGP 1ZBIA 1T44A 5AQRA 3CC7N 2G8KA 4KH6A 4FW2A 4DTSA 1ZBSA 3LALA 3O9SA 4JI2K 1TKZA 3SJHA 4FLWA 4LFAK 3P4IA 4NCGA 1U49A 4UY8O 1NBWA 1GLJO 1K8KA 5C12A 1BWFO 1JLAA 3NGIA 5KPTA 1BA0A 1WBDA 4YDUA 4IEEA 3B8AX 3NMUA 4DLEA 3VQEA 5I9EB 1KLMA 3DLEA 1JCGA 3LWMA 3CIPA 4KB0A 4CJQA 1Q86O 3G71N 4FL9A 3HI0A 3QBWA 1NMDA 1WSHA 3AO1A 4BR2A 3S3NA 2VWKA 3E01A 2KW4A 4KH5A 1WLJA 1IV0A 5AQTA 1NGCA 5M1NA 1TKXA 1S1UA 3OJSA 4PUOA 3UKUB 3OYFA 3CJ1A 4IJNA 2HBLA 3MN7A 2ZM6K 3CQ8A 3O1BA 3U3GA 4LF9K 3KWGA 1MWKA 1L3TA 3HZ6A 2F8SA 3CC4N 4CHYA 3OHRA 3PY8A 5IT9O 3SV3A 4HCCA 1BQNA 4CJ4A 3VENA 3J7AP 3C94A 5F0XA 1TK5A 4FJMA 1SKRA 2UUAK 4Y1DA 3NAEA 3ZETB 1ESVA 4JKDA 4MO4A 1CZBA 4B9SA 4CJFA 3KHYA 2D0AA 3C6HA 4ILGB 3VGLA 3RVCA 1VQMN 4O4GA 3VGMA 5LY3A 1VQ7N 3K9JA 4CJ3A 4DSFA 1U2VA 4CJLA 4A2AA 2HHTA 5SWMA 3CJ9A 5LJVA 1C0FA 3GDQA 5J2NA 2FXUA 1RDUA 3LP1A 3I0SA 4JKHA 3VQ4A 3IRXA 5EX5A 4FOIA 1TAUA 5AQZA 3FE1A 2JGUA 2D1KA 1RDDA 2QWRA 3K5NA 1NU0A 1HJRA 2P9PA 4ZHRA 3KVGA 2QWPA 2D4WA 1S1WA 3LANA 5GIOA 3TTFA 4NO7A 4BRHA 4FXDA 4H5TA 1REVA 3CERA 4FK2A 4W5TA 4HTLA 1QHAA 1OH6A 2IVPA 3HM8A 3VQ9A 4BGBA 3DJCA 1BDGA 4XIUA 1U04A 1VK0A 4XH4A 4LF5K 1X3MA 1K8KB 3ATVA 4CZJA 3OY9A 3K58A 4N76A 3OYGA 3E1YA 4FLZA 2WONA 3AA2A 1UA1A 3WNEA 3VEWA 5FRNA 3CM5A 4M63C 3HP9A 1GLEG 1JLFA 1VQNN 3ID6A 3SQ1A 4JKEA 4FOEA 3G0ZA 4BRMA 2BDPA 3OYDA 3CCVN 5KRTA 4F9OA 1D5AA 3EZWA 3V9XA 4LH4A 4DF8A 5AQKA 1WAFA 4PKGA 1SL0A 3QIOA 4DR3K 1KTQA 2E2NA 5FRMA 1BCMA 5EXWA 4BC2A 2KZMA 2YX6A 3N4QA 3HO1A 4CFCA 5HRNA 1M1KO 3AO2A 4Q0BA 4DQIA 1NJWA 1JL2A 4CZMA 4CI6A 1YXQA 1B9FA 1GLAG 5ADXH 3VN5A 1A5VA 3SBGA 2QWOA 1DGKN 4DSKA 1T3VA 1XHXA 4W5OA 4J2BA 3AVMA 1U2VB 2FF6A 1YHQN 4DQQA 2A41A 1GLLO 2NNWA 1R0AA 3DLRA 3VQ8A 3KLGA 2WUSA 4DU3A 1WSGA 3SLCA 1UOCA 2NRWA 2VG6A 5TKWA 5AJ3K 4EAHD 4X66K 2XY8A 4FVMA 4ISEA 4LF7K 3ALYA 1HYVA 3HSCA 3TU5A 4FJKA 3EY1A 1T8EA 1KVAA 2V7ZA 1IBMK 1N32K 4BG9A 2R7YA 1NGAA 4ILHA 1XI1A 3C7NA 2YHYA 1RTDA 2P9SA 1ZYQA 2P9PB 3IKMA 2F96A 4A5BA 2IVNA 1WUAA 4CEEA 1QTMA 3BZKA 4B9MA 3C6AA 1L5UA 1XNQK 1O1WA 1NK6A 5AQMA 3MDQA 4W5RA 3AVCA 3D0PA 3DWLA 2HVIA 4DQ8A 4OPJA 4F2RA 3VPZA 2O8CB 1HYZA 5J1EA 1VSDA 1VSJA 4BQLA 3OS2A 4JS5A 2A6AA 4OKEA 3DLGA 2KHOA 2ATQA 2FLOA 4E7KA 4L8RB 4HHTA 4FJ9A 1GLCG 5HRPA 4C8NA 1RT7A 1F21A 3CCUN 1TL1A 1TYQA 4BRAA 3DM2A 3GBTA 4MO5A 3M8SA 1RBVA 3GOIA 5CE3A 1V4TA 2OANA 4QOZB 2NRXA 1NNEA 2G8IA 4RW6A 4O55A 3DMJA 4KKOA 5H1SQ 4FJ8A 3WXLA 3KKRA 2VCPA 3FFIA 3E9LA 3HPHA 4R79A 1N6QA 1VQKN 3MXIA 1RTHA 4EZ6A 4V19S 2QM1A 3AVKA 4ID1A 3V9WA 3CFPA 4JI7K 3KLEA 3QDKA 2XY5A 4DR4K 3AA4A 4UQGA 4K41A 3NF7A 4WFAL 1NK0A 2V7YA 1VQON 1SL2A 3CCJN 4MQ3A 4FJXA 5BPLA 4BACA 4BRIA 4DFPA 4BE0A 4BDPA 4FJJA 4CJWA 5AQJA 3UIQA 1K73O 3SQ4A 3QO9A 1HKBA 1NKBA 1XQSC 4O0IA 3J8AA 4JN4A 1CXQA 3E66A 2UUCK 3CFOA 3F9MA 4DQRA 1FK9A 1JXBA 2E88A 4B1VA 3LDNA 5JLFA 3CQXA 3WXKA 5M1QA 5JVGL 5C42A 4MDBA 2YNFA 4WYBA 5AQHA 3M8RA 2P51A 1X3NA 2ZF5O 1S9EA 1SS6A 4JV5K 2E8AA 3K5MA 1OH5A 2ZJPL 3U9DA 3U3YA 1XUPO 3CJ7A 3OW2M 2J4RA 1G15A 4FJLA 5CYQA 4FSVA 3DRSA 4B3TK 4LSLA 4A62A 2QKBA 4GMJB 1LWEA 2CGKA 4AHRA 3OYMA 3RMAA 3RWUA 5EVZA 2OPQA 1QZ6A 2QWMA 3SUNA 3DRPA 1NGDA 4BDZA 4NXNK 2YV0X 3O9QA 4HUGA 1TKTA 3F5TA 2G8WA 1QQCA 2O4GA 3S3MA 1GOCA 4DSIA 3EE8A 5AZIA 2GBZA 4C8KA 1NK9A 5GAHP 4X64K 5ELZA 4O44A 2HBKA 4JI0K 4M3ZA 3D45A 4J2AA 4FZZA 3AGRA 1OVQA 4CEBA 2G8VA 2OA8A 3LPTA 5AQIA 4DTXA 4O8KA 5EOYA 1QS4A 5KQDA 3HOTA 3QINA 4BR5A 4B8AB 4YOVA 3O4WA 1RDAA 1IKYA 4JRQA 4PWDA 4GNIA 3U4LA 3LDLA 2E6MA 5C2DA 3VEVA 2QWNA 5KTQA 4I2QA 3ZSYA 5LL6Z 3TTCA 4CZIA 3QMLA 4KTQA 3QEXA 3LM9A 5JICA 3HXMA 1HPMA 2HVHA 2QWLA 1BA1A 4FO0A 3BF1A 2A3ZA 5CHIA 1A5WA 1RT5A 2DTUA 4BWJA 2HHXA 3VETA 4IOCL 3V9SA 3UE5A 2Q97A 3I33A 3U6FA 1VSHA 2FBYA 3OYIA 1W97L 2ZD1A 3KD1E 1VHXA 1A5XA 3L0QA 4CD1A 4CZFA 4DTJA 3QEVA 4IZ9A 3CJBA 4BC4A 2FSNA 3TSUA 2PYLA 2UU9K 3ZSQA 3UKRA 4B08A 1NGJA 4JS4A 4DV4K 2CH6A 4BRPA 3ZLJA 4KHQA 1B9DA 2GWKA 2IS3A 3W0LA 3EZ5A 3ZYYX 3RMCA 1D4XA 3VF2A 3TAFA 3O3HA 3VEXA 3SAHA 4RW4A 1NGGA 3V81A 1QHTA 4FJHA 2IIRA 3AVNA 4H5VA 1YVUA 2ETJA 3OBYA 4H4OA 2GUPA 3AARA 3ENBA 3A8YA 4WQ5C 3B6PA 4E1JA 2Q1NA 1NKEA 3JXUA 3ZETA 1WNSA 2XHBA 4JK8A 3R9PA 4RG8A 1KVCA 4DUZK 5E84A 4DQPA 2V52B 4FVUA 3EE9A 2KFNA 4F3TA 1VQ6N 4BGAA 3H45C 4ISFA 1KAYA 4CFAA 3SMSA 1LV5A 1NG9A 3A5LC 4DLGA 2ITGA 1IG8A 1T7PA 4FZXC 1G99A 2Z1HA 3OYJA 3P39A 3AVBA 4O0JA 1JLBA 2CGLA 2IVOA 3K5OA 5AQXA 1Q9YA 3MX2A 1I39A 5AZIB 2OZMA 1JL1A 5KQ8A 5AQLA 1NWKA 4C8MA 2V51B 4CF9A 3L2RA 1C0UA 3RR7A 2I7NA 4LD0A 1WB9A 2I5JA 4RCHA 2O8EA 3TSQA 5BR8K 3VQDA 4QS7A 4Z4CA 1BIZA 3CHWA 4YNQA 4NYFA 2HNYA 1HNZK 4OLBA 2GX9A 4Z4FA 4BC5A 3WNFA 5GAEP 2FSJA 1HRHA 1X9MA 3M8PA 1RBRA 4M3RA 4DR1K 4M45A 3QFPA 2BANA 3KKSA 3AA5X 1ASWA 1QSYA 3S41A 3ZT4A 4F8RA 2DY4A 1WSEA 1YTUA 3MCAB 4F3OA 4MLHA 2F7TA 3CG7A 2ZWHA 2IAJA 1HKGA 4DSJA 2YNHA 2ZQBA 4Z4HA 1XMOK 1RT3A 3UKRB 4EP5A 1TV6A 4CGFA 1YITN 3O5BA 4CK2A 3R6MA 2LSNA 4CJ7A 3O4QA 1RFQA 3ZSZA 3WXIA 4CGHA 1RBSA 3DLKA 4MDAA 5HP1A 4IG3A 3OBWA 3L6QA 2UUBK 4H8KA 3WXMB 1YIJN 2KFZA 4C1NI 4TSXA 3A5OC 3LP3A 3J7ZO 2W6KA 4JNEA 4GKKK 1Y97A 4DV3K 3VQ5A 4PQUA 1Q9XA 1GLBG 4M7YA 4PHTX 2Y1IA 3Q7BA 1C6VA 3SJJA 3IG1A 4ID5A 3MX5A 3VMFB 3QB0A 4CFDA 4QCLA 4IG0A 1KLNA 3KK7A 2W6LA 1MU2A 1RTJA 3NF6A 4RW7A 3M5RA 4DF4A 4M41A 4CECA 4B9TA 4KHPK 2Z1JA 4AHCA 3VTIA 4DTUA 4FLVA 1SKSA 4J2EA 1KQSM 1IBLK 3CC2N 1IKVA 4KV8A 5CR4A 3J81O 3UB5A 4CK1A 4CHZA 3VERA 4EZ9A 1NLVA 4LF8K 3AVHA 3ZSXA 4WF9L 3EYZA 3ZT1A 1GLFO 4Z0UA 5F2RA 1KAXA 2FSKA 2CH5A 3DRRA 3S9HA 3SK3A 3A0IX 1N33K 2WOMA 1HNVA 1RDWX 3THVA 1BI4B 2YI1A 3JYTA 2O8EB 3L8BA 1KSPA 1HNWK 3KTQA 4BDYA 3QLHA 1CLQA 3PV8A 4DV6K 3MWTA 4XEIA 4BRGA 4IWVA 2XY7A 4ZTJA 2ASOA 1D9DA 3T3FA 2O8CA 3H08A 1VRTA 3WQTA 1X9SA 3LDPA 2HNDA 4BRNA 4KTWA 4YHHK 2FBTA 4JK9A 1FKPA 1BHLA 1S9GA 2UYTA 3DOLA 3TAPA 2HMPA 3ZSVA 3S3OA 5BRHA
chains in the Genus database with same CATH topology
1YJWN 4J8FA 1DT9A 2ZGYA 3EKUA 3M6GA 3D2FB 5JMVA 3A5MC 4JKCA 3F2KA 2P9UA 2OTLN 3HTVA 5H1SQ 4FWKA 3M3ZA 4JAXA 4O5FA 3EKSA 4QS8A 4WQ5A 5AQPA 5BN9A 3WXLA 3ZEUB 3G4SN 2VCPA 3D7EO 3E9LA 5AQSA 4R79A 5DM7L 1VQKN 5HL7L 1QQNA 4CZLA 2RHKA 5AQWA 3FFKB 3OA9A 3NVMA 4H0OA 1NJIO 1O13A 1QQMA 2QM1A 1P90A 3G6EN 2W40A 4FPBA 4H5RA 4GY2B 4YOTA 1CZAN 5BN8A 3AAQA 3QDKA 1S72N 2P9LA 4CBWA 3DAWA 3DXMB 1ATSA 1WOQA 2GWJA 4K41A 3TPQA 3CMEN 4BR0A 4WFAL 2FF3B 2V7YA 4YOWA 2OTJN 1VQON 3D2EB 5GADP 4NLCA 2EWSA 3CCJN 3CJAA 5BPLA 4FWLA 5AR0A 4BRIA 2HBMA 2VWBA 4PKIA 1NGEA 3HOSA 3K9KA 5E26A 5AQJA 5AQUA 2VGMA 2AA4A 2I7PA 1P8ZA 1K73O 4IO9L 3VEOA 1HKBA 4H0PA 1MA9B 1XQSC 3J8AA 4JN4A 4C23A 3DXKB 4BG8A 3E66A 3GE1A 3WT0A 3F9MA 2CGJA 2NLXA 3UKUA 4A5AA 1GLDG 2E88A 4FWOA 3LDNA 4B1VA 3CQXA 5JLFA 1HX1A 5KPRA 4JKAA 3WXKA 5M1QA 2QTDA 5JVGL 2Q2RA 4NLBA 3C0BA 4MDBA 4FWSA 3I55N 5AQHA 4WYBA 3WUHA 3VGKA 2QW9A 1KXPA 4IOAL 1BUPA 4WQ4A 4A57A 1X3NA 2ZF5O 3O1WA 1J6ZA 3U8XA 5AZJB 1SS6A 1YI2N 1Y64A 3CI5A 2E8AA 1R59O 3CCSN 3H3OB 5M1OA 2ZJPL 3MN6A 5JVHL 3U9DA 1XUPO 2E1ZA 3CJ7A 2F9TA 3O08A 4L3QA 4LC9B 3OW2M 2J4RA 3IDHA 4KH4A 3CCRN 3VOVA 3O6WA 4FWNA 4JK7A 4JEPA 2BUPA 3KZBA 2JWKA 4OPAA 2NRRA 3GG4A 4ILJA 5GIPA 1HUXA 4YOXA 5LJWA 3O9RA 4FSVA 3L4IA 1SAZA 3L4QA 4A62A 4EIAA 3H6EA 4Z94A 1NM1A 2CGKA 1TUYA 1K9MO 3CF5L 5C15A 5EVZA 1QZ6A 2QWMA 3MN5A 1QVGM 4H0YB 1YJ9N 1NGDA 1S3XA 3W3DA 2HF3A 3LL3A 1Q7YO 1BU6O 2ITMA 3O9QA 2D0OA 2VYPA 2YCHA 4BRCA 3F5TA 3Q7CA 3WXJA 3I56N 4YOYA 3IUCA 4PL7A 4PKHA 3P31A 3CCEN 2JWLA 3EE8A 1OVYA 5AZIA 4B9QA 2ZGZA 3VF6A 3O8MA 4CZGA 1NGFA 2ASMA 5GAHP 3MWPA 3CCQN 5ELZA 2HBKA 4XH5A 5M1FA 5C10A 3PIOL 1YJNN 1XC3A 2ZJQL 1T6DA 4H03B 5FPNA 4DCHA 1ZXOA 5GINA 3CMAN 1VQLN 3AGRA 5BRFA 1M90O 4K25A 2Q36A 3SMPA 2QI2A 3ULEB 5AQIA 1Q18A 3WEEB 1YAGA 4O8KA 5EOYA 1C0GA 1YF5L 3WEEA 1LOTB 3HOTA 5KQDA 4MLEA 4BR5A 4YOVA 2YHWA 3O4WA 4OO1J 2QA4N 2GTDA 3JS6A 3T69A 5AFUA 5GAGP 1T44A 4GNIA 5AQRA 3U4LA 3ENOA 3P38A 3CC7N 3LDLA 3E9OA 5C2DA 2BTFA 4KH6A 3CQYA 3VEVA 3FZFA 4IOXA 2QWNA 1ZBSA 2P9UB 3ZX2A 3TTCA 4CZIA 3CPWM 3O9SA 4GV9A 4Y0WA 1NGHA 3QMLA 3SJHA 3R3LA 4BRDA 3P4IA 3LM9A 5JICA 1JJ2M 1HPMA 1HKCA 4UY8O 3EO3A 1NBWA 2QWLA 2YJFA 1BA1A 1GLJO 1K8KA 4FO0A 5C12A 2WC9A 3BF1A 1BWFO 2A3ZA 5CHIA 3ENHA 5KPTA 4B1WB 3VETA 4IOCL 1BA0A 1V4SA 4YDUA 3UE5A 4FWMA 3H46O 3C65A 4BRLA 3FZHA 2P9LB 4BY9C 2Q97A 2PAVA 3HBTA 3I33A 4BR9A 4IEEA 4WCEL 3B8AX 3NMUA 1W97L 3MK6A 1VQPN 3LM2A 3H1VX 1VQ8N 4CZEA 5I9EB 5FPDA 1JCGA 3CIPA 3L0QA 4CD1A 4CZFA 1Q86O 3G71N 4IZ9A 3CJBA 4BC4A 3N4PA 4FL9A 2FSNA 3HI0A 3TSUA 4CD3A 3QBWA 4B1UB 1NMDA 1OKJA 4JHDA 2HOEA 4BR2A 3UKRA 4QS9A 2VGNA 4KH5A 4JKGA 5AQTA 1NGCA 2Q31A 5M1NA 1NGJA 4IO8A 3ZX3A 2BH1A 4BC3A 3UKUB 2ZJRL 3CJ1A 2CH6A 4BRPA 4IJNA 2HBLA 3MN7A 4HWIA 4EFHA 2A42A 2GWKA 3O1BA 3W0LA 1E4FT 3KWGA 1MWKA 4A2BA 3ZYYX 3VF4A 4B1XB 4WFBL 3HZ6A 3CC4N 1D4XA 1KAZA 1U6ZA 4BQZA 5M1KA 3VF2A 3OHRA 3VTHA 4IXCA 1HLUA 4JD2A 5FPEA 1Q82O 3VEXA 3SAHA 3AGKA 1IJJA 1NGGA 4FWRA 3CJCA 3VENA 2IIRA 4H5VA 5F0XA 2QXLA 3FGUA 3OBYA 2GUPA 3AARA 3ENBA 4JKFA 1MWMA 2A40A 3A8YA 4WQ5C 4BVOA 5ADXA 4E1JA 2Q1NA 1VAZA 3JXUA 3A5NC 3TTDA 3ZETB 5BPMA 1ESVA 1SZ2A 2W41A 4JKDA 3ZETA 4MO4A 4DB3A 4JK8A 3R9PA 1YUWA 3FZLA 4U7BA 4H0XB 5E84A 3KHYA 2V52B 3T7ZA 3C6HA 4ILGB 3O80A 2H3GX 3EE9A 3VGLA 3RVCA 5JLHA 4RWTA 1VQMN 1VQ6N 4BGAA 4FVUA 3VGMA 4BR7A 5LY3A 1VQ7N 1N8RO 3K9JA 1U2VA 3H45C 4ISFA 1KAYA 5AQYA 3SMSA 3R1XA 4A2AA 4H5WA 3A5LC 1IG8A 3CJ9A 4GV3A 1EO1A 4BREA 1G99A 5LJVA 5DM6L 1C0FA 1E4GT 3GDQA 3P39A 3RSEA 5M1PA 4BRFA 1NGBA 2CGLA 2FXUA 2IVOA 5HOOA 2P9NA 5AQXA 1RDUA 3IFRA 3MX2A 3ID8A 4KBOA 4JKHA 4BROA 5AZIB 4O8UA 4AM6A 5EX5A 4FOIA 5KQ8A 5AQZA 3FE1A 1NWKA 5AQLA 2V51B 3QICA 2D1KA 2KKZA 3U9ZA 5C0YA 5BRDA 2I7NA 3NVKA 3MMVA 3WQUA 2QWRA 5MLCQ 2NRVA 4RCHA 2P9PA 4WQ4C 3KVGA 2QWPA 3QBXA 2D4WA 2AP1A 1SQKA 4EHTA 4OPHA 3TSQA 4K42A 3VESA 3EL2A 4QS7A 5GIOA 3FZMA 3O9TA 3CHWA 3TTFA 4NO7A 4BRHA 4H5TA 3CERA 2PFUA 1X9JA 1QHAA 2GX9A 4HTLA 2IVPA 4FPAA 4BC5A 3HM8A 4CBXA 1Z05A 1QVFM 4ISGA 1JCEA 5GAEP 4BGBA 3DJCA 4GV6A 1MDUB 1BDGA 2QWQA 3CCMN 2FSJA 3CETA 2YJEA 4XH4A 2NZTA 1X3MA 3BUZB 4AM7A 1K8KB 1QQOA 3ATVA 4BRQA 4CZJA 3QFPA 3BP8A 3FZKA 3VEZA 4FWPA 1TUUA 3AY9A 4H0TB 3CPEA 2A5XA 3E1YA 4DKWA 3S41A 4H5NA 4I6MA 2P9IA 3VEWA 1BO5O 2P9KB 2E1YA 5AQFA 1BOTO 2NRHA 2E20A 3MN9A 3MCAB 4M63C 2P9KA 1GLEG 4MLHA 3D2FA 3ID6A 3PIPL 1VQNN 4K43A 1BG3A 4JKEA 2F7TA 4FOEA 5TKYA 4BRMA 2ZWHA 5AQGA 5KPZA 1VQ9N 3CCVN 3ZEUA 1HKGA 4F9OA 4CZKA 3EZWA 5AQQA 4JHDB 1ATRA 3UKRB 3MCPA 5AQKA 4JKGB 4PKGA 3IMXA 3E9PA 1YITN 3O5BA 2GELA 3H3NO 4C1NK 3R6MA 1VQ4N 4CJ7A 3VEYA 1RFQA 3DXMA 2E2NA 3CXCM 1K8AO 5EXWA 4BC2A 2Q0RA 3D2EA 3WXIA 1LCUA 1ZC6A 2YX6A 3N4QA 3HRGA 4MDAA 3AAPA 1M1KO 2HF4A 4JD2B 4CBUA 1Z6RA 1DEJA 2NRTA 3L6QA 3OBWA 1HJOA 4BR4A 3WXMB 1YIJN 1YVNA 1Q81O 5EY4A 4CZMA 4CI6A 4RTFD 4C1NI 1YXQA 3A5OC 2HBJA 3BEXA 3DLLL 3ATUA 1GLAG 5ADXH 4B1YB 3J7ZO 3DXKA 4XH1A 4JNEA 4AF1A 5B8HA 5AQNA 1ILYA 4CZHA 1GLBG 1DKGD 4M7YA 4PHTX 3SBGA 3LDQA 2QWOA 1DGKN 4U67L 3SAFA 4YDUC 1T3VA 3KWIA 3Q7BA 3I8BA 3CD6N 3LDOA 2RE2A 4YORA 2E2QA 3MX5A 1U2VB 3QB0A 2FF6A 5FPMA 3VMFB 5AZJA 2YHXA 3KK7A 1YHQN 2A41A 2E2PA 4BRKA 1GLLO 2NNWA 3M5RA 4IEIA 3EN9A 1KC8O 2ASPA 2WUSA 2WFBA 3QFUA 3RSEB 1EQYA 5BR9A 3VTIA 3SLCA 2NRWA 5TKWA 5C2FA 4WFNL 4EAHD 1NGIA 2P9NB 1KQSM 3CC2N 3TSPA 4ISEA 5CR4A 3CCLN 1JCFA 4IDHA 4YOUA 3HSCA 5AQVA 3TU5A 3UB5A 3G25A 2PBDA 3VERA 4B1ZA 1NLVA 3ZX0A 3FR0A 2F9WA 2E2OA 4A59A 2V7ZA 4WF9L 4BG9A 1T6CA 1GLFO 1NGAA 4ILHA 4BVPA 3C7NB 1KAXA 3M1FA 5F2RA 1W2BM 2FSKA 3C7NA 2P9SB 2YHYA 2CH5A 2KLAA 2P9SA 3SK3A 4A61A 1QZ5A 3A0IX 3PLAA 3R8EA 4GVEA 3H1QA 1ATNA 2P9PB 3IKMA 3SBTA 3BF3A 4A5BA 2IVNA 1RDWX 1WUAA 5BREA 2YI1A 2NRZA 2Q0UA 1KD1O 4IJAA 3C6AA 4H0VB 2QEXN 5AQMA 3MDQA 1VQ5N 5AFUH 3MWTA 3DWLA 4XEIA 4IWVA 4BRGA 5AQOA 5F1XA 4DQ8A 2D0PA 2ASOA 4EHUA 3VPZA 2HSTA 4IFEA 1RGIA 4M7XA 4BQLA 3WQTA 2A6AA 2GEMA 2KHOA 3LDPA 4DHYA 3SAGA 2FLOA 4BRNA 3ULEA 3FLCO 1GLCG 1S22A 4JK9A 3O9UA 4PL8A 1TYQB 5BRHA 3CCUN 2WBNA 1H1VA 3GL1A 2UYTA 1TYQA 4JKBA 4I6MB 4NB4A 2DPNA 2P9IB 3GBTA 4MO5A 4BRAA 5BPNA 3D6RA 3GOIA 5CE3A 2HMPA 4FWQA 4G9ZA 1V4TA 2OANA 2NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9R A;  3KWG A;  3L4Q A;  3KWI A;  2GX9 A;  3EE9 A;  3RVC A;  3O9S A;  2KKZ A;  3M5R A;  2RHK A;  3OA9 A;  3P39 A;  3O9Q A;  3O9U A;  3F5T A;  4OPH A;  3P31 A;  3D6R A;  4OPA A;  3O9T A;  3EE8 A;  3P38 A; 
#chains in the Genus database with same CATH topology
 4CK3 A;  2ZGY A;  3M6G A;  4FLY A;  4AQY K;  5C25 A;  1U4B A;  2P9U A;  3HVT A;  4LH5 A;  3HTV A;  4FWK A;  3M3Z A;  4JAX A;  4WQ5 A;  5AQP A;  2KTQ A;  5AQS A;  3T1H K;  1NJI O;  3NH1 A;  1QQM A;  3RTV A;  4JI8 K;  4FPB A;  4AHS A;  3IS9 A;  4YOT A;  2HNZ A;  5BN8 A;  3AAQ A;  2P9L A;  2YHB A;  1WOQ A;  3TPQ A;  2VG7 A;  3KJV A;  5GAD P;  4NLC A;  3HPO A;  5CY4 A;  3HYF A;  4CJE A;  3MXM A;  4KHN A;  3HOS A;  4E19 A;  2AA4 A;  2I7P A;  2QK9 A;  4IO9 L;  4H0P A;  2HHW A;  2PY5 A;  4BG8 A;  3NCI A;  4DS5 A;  2CGJ A;  3V1R A;  4BWM A;  5KPR A;  3HST B;  3C0B A;  4W5N A;  3VGK A;  3KD5 E;  1KXP A;  1BUP A;  3P1G A;  3O1W A;  3TAR A;  1Y64 A;  3G10 A;  2E4L A;  3H3O B;  4DMN A;  3MN6 A;  5JVH L;  3O08 A;  3VOV A;  3O6W A;  3AO5 A;  3KZB A;  2JWK A;  4OPA A;  4CF0 A;  3GG4 A;  4YOX A;  3O9R A;  1TK8 A;  3L4I A;  3NE6 A;  1BCO A;  4EIA A;  3H6E A;  4QAG A;  2HMI A;  1RT4 A;  3P5J A;  1K9M O;  2YKM A;  3QEP A;  4DSL A;  1QVG M;  5HBM A;  1IH7 A;  2VWJ A;  1BU6 O;  2VG5 A;  4CGG A;  2ITM A;  4M3W A;  3L3U A;  2HHV A;  2VYP A;  4BRC A;  3I56 N;  4PKH A;  1IKX A;  1XMQ K;  3CCE N;  3SUQ A;  2JWL A;  4E7J A;  4BE2 A;  4CFB A;  2DFE A;  2ZGZ A;  3O8M A;  5EU7 A;  1NGF A;  3MWP A;  4XH5 A;  3PIO L;  5M1F A;  5C10 A;  4DCH A;  5GIN A;  2RN2 A;  5BRF A;  1C1B A;  2Q36 A;  2QI2 A;  3WEE B;  1LOT B;  4MLE A;  3CFR A;  4IKF A;  1RDB A;  3TAM A;  2QA4 N;  2GTD A;  4I9Q A;  3T69 A;  4Q5V A;  2GV9 A;  1ZBF A;  1TK0 A;  2RKI A;  2DFF A;  2P9U B;  4RW8 A;  1SL1 A;  3CPW M;  1BIS A;  4Y0W A;  1NGH A;  3LP0 A;  4FCY A;  4HUF A;  1JJ2 M;  1LWC A;  2YJF A;  3THX B;  4B1W B;  4HCB A;  4FWM A;  3H46 O;  3C65 A;  3NH2 A;  3BGR A;  1KVB A;  4FJG A;  2P9L B;  5IWA K;  1WBB A;  2E5L K;  4BY9 C;  2PAV A;  3HBT A;  4BR9 A;  4WCE L;  1B92 A;  3MK6 A;  4JI4 K;  3KK2 A;  3PX0 A;  3H1V X;  4FJN A;  4JI6 K;  4OKK A;  1VQ8 N;  4CZE A;  2Y1J A;  4CW7 B;  4FLX A;  3KK1 A;  4CD3 A;  2EHG A;  3B6O A;  1OKJ A;  4JHD A;  4LF6 K;  3NGY A;  4CGI A;  2X6S A;  2VGN A;  3JAM O;  4JKG A;  2Q31 A;  2BH1 A;  3SYZ A;  2HHS A;  3ULD A;  3K0S A;  2P5G A;  4EFH A;  4AHV A;  4WFB L;  4B1X B;  1N34 K;  1U6Z A;  4LFB K;  3VTH A;  1X9W A;  3HL8 A;  1HLU A;  4FWR A;  4CEA A;  3TWH A;  3CJC A;  2YNI A;  2QXL A;  4CJP A;  3FGU A;  5KGX A;  4CJT A;  3NF9 A;  1EXQ A;  4BVO A;  1MWM A;  2A40 A;  4DUY K;  1VAZ A;  3A5N C;  3TTD A;  1VSK A;  5BPM A;  1SZ2 A;  1XWL A;  4DB3 A;  1XHZ A;  3FZL A;  1WSF A;  5FLX O;  4DWI A;  3O3G A;  3T7Z A;  4H4M A;  4DSE A;  4DTM A;  4RWT A;  3K59 A;  3QIP A;  2VQF K;  1Z26 A;  4BR7 A;  1U47 A;  3AO3 A;  5AQY A;  4F2S A;  3DYA A;  4H5W A;  1RNH A;  4BE1 A;  1KRP A;  4DTR A;  4BRE A;  4F4K A;  3HJF A;  4BRF A;  2OPR A;  3IFR A;  4B3R K;  3JSM A;  4HTU A;  4IFY A;  2X6N A;  4CJS A;  4BRO A;  4O8U A;  5CYM A;  4AM6 A;  3K5L A;  4OLA A;  4CF1 A;  3U9Z A;  2KKZ A;  1CXU A;  4FJ7 A;  5BRD A;  2RPI A;  3PSI A;  3NVK A;  2BE2 A;  3MMV A;  3WQU A;  2NRV A;  4WQ4 C;  4FM2 A;  2AP1 A;  4K42 A;  2EX3 A;  3EL2 A;  3ZCM A;  4FK0 A;  3FZM A;  2NUB A;  1C1C A;  1NK5 A;  1RCH A;  1FXX A;  2PFU A;  4ELT A;  2UXB K;  1X9J A;  2YKN A;  4FPA A;  1JCE A;  4CEF A;  2A1R A;  4FW1 A;  2QWQ A;  4CJV A;  3CCM N;  2YJE A;  1WSJ A;  3VQ6 A;  3BUZ B;  4AM7 A;  1HNX K;  4BRQ A;  3NHG A;  2Z1G A;  3VEZ A;  3BP8 A;  4FLU A;  1SV5 A;  2A5X A;  2WTU A;  2D0C A;  3OYE A;  4H5N A;  4I6M A;  2P9I A;  2P9K B;  5AQF A;  1BOT O;  2NRH A;  2QXF A;  3THY A;  4C8O A;  1NK8 A;  3D2F A;  4C8L A;  4K43 A;  3J80 O;  4CES A;  5AQG A;  2W42 A;  4DG1 A;  4LSN A;  4KAZ A;  4AIL C;  4NCB A;  3T19 A;  4CZK A;  1Q8I A;  5AQQ A;  4JHD B;  4M3U A;  2RF2 A;  1ATR A;  3MCP A;  3OVN A;  4JKG B;  1L3V A;  3IMX A;  5A2Q O;  4CJU A;  3OYC A;  4C1N K;  3H3N O;  4KHU A;  1VQ4 N;  2D5R A;  1FKO A;  1U48 A;  3QES A;  4JI5 K;  1LW0 A;  2FC0 A;  1EX4 A;  2XRI A;  4B9N A;  1ZC6 A;  2UXC K;  4FJ5 A;  3HRG A;  5E41 A;  4M42 A;  1FW6 A;  3LAM A;  1HPZ A;  2YNG A;  4CBU A;  1DEJ A;  4BR4 A;  1Q81 O;  4CED A;  1YVN A;  3RRH A;  2B6A A;  3MEE A;  3QEW A;  4CEO A;  3RMD A;  4GKJ K;  3DLL L;  3ATU A;  4FK4 A;  4XH1 A;  2IGI A;  4AF1 A;  5B8H A;  5AQN A;  1ILY A;  4CZH A;  2F4V K;  4E0D A;  1W7A A;  3NH0 A;  1DKG D;  3LZI A;  3LDQ A;  3AO4 A;  4U67 L;  3A2F A;  3SAF A;  1LW2 A;  3KWI A;  3I8B A;  4E1N A;  1L3S A;  3T1Y K;  3QNO A;  4CJ5 A;  4DTO A;  4YOR A;  2E2Q A;  1D9F A;  5FPM A;  5AZJ A;  1VRU A;  1W0H A;  3BZC A;  1ZBH A;  2E2P A;  4BRK A;  1XC9 A;  4KHW A;  4IEI A;  2IDO A;  3QFU A;  4HUE A;  4KTZ A;  5BR9 A;  4WFN L;  4B8C A;  2AJQ A;  3TSP A;  1NJY A;  1JCF A;  3G25 A;  4GVM A;  2PBD A;  4B1Z A;  4LY7 A;  3OJU A;  3HVR A;  2F9W A;  4A59 A;  3SPZ A;  1QE1 A;  4CIG A;  1W2B M;  4A61 A;  2O8B A;  3SBT A;  1ATN A;  4KO0 A;  2OZS A;  5BRE A;  1KD1 O;  2Q0U A;  3PO5 A;  1BI4 A;  4IJA A;  4IDK A;  4AHU A;  4H0V B;  2FBX A;  2QEX N;  4CIF A;  1VQ5 N;  5AFU H;  4B3M K;  3TAG A;  5HRS A;  2D0P A;  3HK2 A;  4CEQ A;  3P83 D;  3QET A;  3AVG A;  2GEM A;  1IBK K;  3SAG A;  3KLH A;  3OYB A;  2G8U A;  2OYQ A;  1S22 A;  1HR0 K;  5SZT A;  4PL8 A;  3SV4 A;  1H1V A;  4DR2 K;  3BDP A;  3VQQ A;  4JKB A;  4I6M B;  4NB4 A;  2DPN A;  2P9I B;  3D6R A;  4FWQ A;  4DFM A;  1TKD A;  4G9Z A;  3THY B;  3D2F B;  3SPY A;  1S1V A;  4JKC A;  3C6U A;  3F2K A;  3VQ7 A;  2OTL N;  4B3O A;  4DV0 K;  5J2M A;  4E7L A;  4O5F A;  1RT6 A;  3G4S N;  3VA3 A;  3D7E O;  5DM7 L;  1TAQ A;  5HL7 L;  2FBV A;  1QQN A;  2RHK A;  5AQW A;  3OA9 A;  4H0O A;  1O13 A;  1P90 A;  1UAX A;  3CYM A;  4CHP A;  4H5R A;  5FRO A;  4GY2 B;  1CZA N;  4KRF A;  3ASM A;  3DAW A;  1DLO A;  2GWJ A;  2OTJ N;  4YOW A;  2X74 A;  2EWS A;  4FWL A;  1TVR A;  5AR0 A;  2HBM A;  4PKI A;  1NGE A;  3BY5 A;  5E26 A;  5AQU A;  2A1S A;  3AVI A;  4CVN E;  1OH7 A;  4C23 A;  4CHN A;  2ZE2 A;  3WT0 A;  2NLX A;  4A5A A;  1RBU A;  4JKA A;  5C24 A;  2QTD A;  2Q2R A;  4FWS A;  3I55 N;  2B4J A;  1N5Y A;  1T03 A;  4HVJ A;  2QW9 A;  4WQ4 A;  1J6Z A;  3U8X A;  1DTT A;  5AZJ B;  4GW6 A;  1YI2 N;  4LF4 K;  3CI5 A;  1IG9 A;  1R59 O;  5M1O A;  4FLT A;  2E1Z A;  2F9T A;  3AVL A;  1RT1 A;  3CCR N;  2O8F B;  4JK7 A;  4JEP A;  2BUP A;  4ILJ A;  1HMV A;  1SAZ A;  5I42 A;  2HW3 A;  3L4Q A;  4Z4I A;  1BL3 A;  4AHT A;  2PZS A;  1NM1 A;  3KLI A;  3ISN C;  1TUY A;  1WAJ A;  3CF5 L;  5C15 A;  4Z4G A;  1YJ9 N;  2O8B B;  2DFH A;  2HF3 A;  3LL3 A;  4ELU A;  3OS0 A;  1Q7Y O;  3K2P A;  1N36 K;  4J2D A;  2D0O A;  2YCH A;  4NCA A;  3WNH A;  3LPU A;  3Q7C A;  3WXJ A;  4PL7 A;  3P31 A;  1OH8 A;  1ZBL A;  3O4N A;  2X78 A;  4CZG A;  5JS2 A;  3CCQ N;  3I0R A;  2ZJQ L;  1T6D A;  3SCX A;  3IAY A;  1M90 O;  4MFB A;  3OYA A;  4K25 A;  1C1A A;  1Q18 A;  3V9U A;  1YF5 L;  3WEE A;  4X65 K;  3L2W A;  1RT2 A;  2YHW A;  1HQU A;  1JLQ A;  3ENO A;  3P38 A;  3E9O A;  3NGZ A;  2BTF A;  2UXD K;  3CQY A;  4CJR A;  3FZF A;  4IOX A;  3TI0 A;  3PUF A;  2VQE K;  5DMR A;  4ELV A;  3ZX2 A;  1QSL A;  4GV9 A;  2F8T A;  3R3L A;  4BRD A;  1EWR A;  1HKC A;  3EO3 A;  4DQS A;  3NF8 A;  2WC9 A;  4Y1C A;  4DTP A;  1S1X A;  3ENH A;  3THX A;  1V4S A;  1K6Y A;  4BRL A;  3FZH A;  3AVF A;  1EET A;  1QSS A;  1VQP N;  3LM2 A;  3WNG A;  1S6P A;  5FPD A;  1LAW A;  3LP2 A;  4KI4 A;  3N4P A;  4B1U B;  4ZTF A;  2XY6 A;  4OJR A;  3DI6 A;  2HOE A;  4K8Z A;  4PY5 A;  4QS9 A;  4IO8 A;  4N47 A;  3ZX3 A;  4BC3 A;  4CHO A;  4IFV A;  2ZJR L;  4LFC K;  3TAE A;  2HB5 A;  3NFA A;  4HWI A;  3THW A;  2A42 A;  1E4F T;  3F73 A;  3MAQ A;  4A2B A;  1HQE A;  3VF4 A;  1BIU A;  3KK3 A;  3VA0 A;  5M1K A;  1KAZ A;  4BQZ A;  5J2Q A;  1HYS A;  3L3V A;  3ZSW A;  4IXC A;  4JD2 A;  5FPE A;  4CJK A;  3SI6 A;  1Q82 O;  1NMN A;  1IJJ A;  3AGK A;  3SUO A;  4DV7 K;  1JLC A;  3HM9 A;  3V1Q A;  1KFD A;  3OYN A;  1WSI A;  3V6D A;  4JKF A;  5ADX A;  1S5J A;  1VSE A;  3V4I A;  4W5Q A;  1SUQ A;  2W41 A;  1FJG K;  3TAN A;  1C0M A;  2O8D A;  3LWL A;  1X1P A;  1YUW A;  3M8Q A;  4U7B A;  4H0X B;  3L2V A;  5JLH A;  3O80 A;  2H3G X;  1J9A A;  1N8R O;  4OX9 K;  4KFB A;  5HRR A;  1W9H A;  3R1X A;  4GV3 A;  1EO1 A;  5DM6 L;  1NK4 A;  4DV2 K;  1E4G T;  3RSE A;  5M1P A;  2IC3 A;  4O5B A;  5HLF A;  1NGB A;  5HOO A;  2P9N A;  4JYA K;  3ID8 A;  4KBO A;  1J5O A;  2O4I A;  3RR8 A;  5D3G A;  1IKW A;  4E1M A;  4FJI A;  3QIC A;  3SQ0 A;  1S1T A;  5C0Y A;  4DFK A;  5J2P A;  1E3M A;  1NK7 A;  3MED A;  4OVL A;  5FDL A;  5MLC Q;  5CZ2 A;  4CCH A;  1CZ9 A;  3QBX A;  4E89 A;  4FYD A;  5DK5 A;  1SQK A;  1TGO A;  3OYL A;  4EHT A;  4NYN A;  4OPH A;  3VES A;  1KCF A;  3O9T A;  5K14 A;  3AA3 A;  2OPP A;  4DU1 A;  5JS1 A;  4R5P A;  3HT3 A;  2G8H A;  4OPK A;  4CBX A;  1Z05 A;  1QVF M;  4ISG A;  1NKC A;  1JLG A;  4GV6 A;  1MDU B;  4OGE A;  4JI1 K;  3CET A;  2NZT A;  3TR8 A;  1QQO A;  3FZK A;  4FWP A;  4PA1 A;  1TUU A;  3AY9 A;  4H0T B;  2QKK A;  3LAK A;  3CPE A;  4DKW A;  2HHH K;  3SNN A;  3C6T A;  1BO5 O;  2E1Y A;  1ASU A;  2E20 A;  3MN9 A;  4CE9 A;  4ICL A;  2P9K A;  4KHS A;  1DTQ A;  3PIP L;  3T1A A;  1BG3 A;  4N56 A;  5TKY A;  3AVJ A;  5KPZ A;  1VQ9 N;  4M3X A;  3ZEU A;  2G8F A;  1S6Q A;  1J5E K;  1ASV A;  1NJZ A;  3E9P A;  3ZT0 A;  4JI3 K;  2GEL A;  3QNN A;  1YT3 A;  3VEY A;  1TL3 A;  4Z4E A;  3DOK A;  3THW B;  3DXM A;  5KI6 A;  3CXC M;  3TAQ A;  1K8A O;  4B3S K;  4RW9 A;  2Q0R A;  3D2E A;  1LCU A;  3RRG A;  2BGG A;  3AAP A;  1BGX T;  2HF4 A;  4JD2 B;  2GUI A;  4I7F A;  4I9L A;  1Z6R A;  2NRT A;  2E6L A;  1HJO A;  3OTO K;  5EY4 A;  4M3Y A;  4RTF D;  3SUP A;  4KI6 A;  2HBJ A;  3BEX A;  1LWF A;  3HPG A;  4EP4 A;  4B1Y B;  3I8D A;  4CHQ A;  4M3T A;  3DXK A;  2Q3S A;  3VQB A;  3OS1 A;  4KB1 A;  1L3U A;  1BQM A;  2O8D B;  3SQ2 A;  4AH9 A;  1U45 A;  4YDU C;  2Z1I A;  3ZT2 A;  4DFJ A;  4B9V A;  3CD6 N;  3LDO A;  2RE2 A;  5LMU K;  3NDK A;  2YHX A;  1XNR K;  3HP6 A;  1HNI A;  2HHQ A;  3MXJ A;  3LDS A;  1JXE A;  4NXM K;  3EN9 A;  3PO4 A;  4KHY A;  1KC8 O;  2ASP A;  2WFB A;  4YFU A;  3PX4 A;  4B9U A;  3RSE B;  1EQY A;  1EKE A;  4K8X A;  5C2F A;  5T7B A;  2JLE A;  1NGI A;  2P9N B;  3CCL N;  1IO2 A;  4IDH A;  1WN7 A;  4YOU A;  5AQV A;  3ZT3 A;  4DTN A;  1NOY A;  3ZX0 A;  3FR0 A;  1ZBU A;  2E2O A;  4I2P A;  3QER A;  1JKH A;  4E3S A;  4CGD A;  1T6C A;  3NBP A;  3VQC A;  4BVP A;  3C7N B;  3M1F A;  3OYH A;  2P9S B;  2KLA A;  3PLA A;  1QZ5 A;  3R8E A;  4GVE A;  2P5O A;  3H1Q A;  3BF3 A;  1VSF A;  4DV1 K;  4N41 A;  2NRZ A;  3V9Z A;  2KQ2 A;  4DU4 A;  4DR7 K;  3TAB A;  1J54 A;  5LMN K;  5AQO A;  1UA0 A;  5F1X A;  3RMB A;  1RTI A;  4EHU A;  1YTA A;  1RDC A;  2HST A;  4DV5 K;  4IFE A;  1RGI A;  4M7X A;  3PX6 A;  3ITH A;  3C95 A;  3ZSO A;  4DHY A;  3ULE A;  3FLC O;  3EEQ A;  3L2Q A;  1KFS A;  3O9U A;  2XO7 A;  1RIL A;  1TYQ B;  2WBN A;  3GL1 A;  5BPN A;  3LZJ A;  4KRE A;  2HHU A;  4DR6 K;  3L2U A;  1YJW N;  1I3A A;  1DT9 A;  1C0T A;  3EKU A;  4J8F A;  5JMV A;  3A5M C;  3DLH A;  1NJX A;  3J7Y P;  1VSL A;  2B5J A;  3CM6 A;  5BN9 A;  4QS8 A;  4CZL A;  5HRO A;  3EKS A;  3ZEU B;  4JLH A;  1T05 A;  4N5S A;  3K57 A;  1EWQ A;  4CGJ A;  4CEZ A;  3FFK B;  3NVM A;  2P1J A;  1RBT A;  3G6E N;  3MEG A;  2W40 A;  3F9K A;  3KLF A;  4E7I A;  4CBW A;  1S72 N;  3DXM B;  1ATS A;  5KRS A;  3CME N;  1GOB A;  4BR0 A;  2FF3 B;  3D2E B;  3AVA A;  3CJA A;  1Z25 A;  2VWB A;  3K9K A;  1SKW A;  2VGM A;  3ZSR A;  1P8Z A;  4CF8 A;  3VEO A;  1MA9 B;  4CF2 A;  4OGC A;  4DR5 K;  3DXK B;  2YHA A;  3GE1 A;  4IBN A;  3UKU A;  1GLD G;  4FWO A;  1HX1 A;  4NLB A;  2OPS A;  3O3F A;  4OKJ A;  3WUH A;  4FZY A;  4WE1 A;  4IOA L;  4A57 A;  4DS4 A;  4X62 K;  3CCS N;  3AV9 A;  4L3Q A;  4LC9 B;  3IDH A;  4KH4 A;  4FWN A;  4G1Q A;  2O8F A;  2NRR A;  3SZ2 A;  5GIP A;  1HUX A;  5LJW A;  3MEC A;  4K0K K;  1GOA A;  2KZZ A;  4YY3 K;  4Z94 A;  1ITG A;  4CER A;  4B9L A;  1UWB A;  5CZ1 A;  2PYJ A;  3MN5 A;  4H0Y B;  1S3X A;  3W3D A;  3KIO A;  1I94 K;  4FM0 A;  3PSF A;  3OYK A;  4KPY A;  4E7H A;  4YOY A;  3IUC A;  3VQP A;  1VSI A;  1NOZ A;  1OVY A;  4B9Q A;  5I3U A;  1JLE A;  1LAV A;  3VQA A;  3VF6 A;  2D0B A;  4JRP A;  3QEI A;  3DLB A;  2ASM A;  4CIE A;  1YJN N;  1XC3 A;  4H03 B;  5KGW A;  5FPN A;  1J53 A;  1ZXO A;  3CMA N;  1VQL N;  3V1O A;  3SMP A;  3ULE B;  2IOC A;  2OCE A;  1YAG A;  1D8Y A;  1C0G A;  4FM1 A;  4OO1 J;  3JS6 A;  1EP4 A;  1VSM A;  5AFU A;  5GAG P;  1ZBI A;  1T44 A;  5AQR A;  3CC7 N;  2G8K A;  4KH6 A;  4FW2 A;  4DTS A;  1ZBS A;  3LAL A;  3O9S A;  4JI2 K;  1TKZ A;  3SJH A;  4FLW A;  4LFA K;  3P4I A;  4NCG A;  1U49 A;  4UY8 O;  1NBW A;  1GLJ O;  1K8K A;  5C12 A;  1BWF O;  1JLA A;  3NGI A;  5KPT A;  1BA0 A;  1WBD A;  4YDU A;  4IEE A;  3B8A X;  3NMU A;  4DLE A;  3VQE A;  5I9E B;  1KLM A;  3DLE A;  1JCG A;  3LWM A;  3CIP A;  4KB0 A;  4CJQ A;  1Q86 O;  3G71 N;  4FL9 A;  3HI0 A;  3QBW A;  1NMD A;  1WSH A;  3AO1 A;  4BR2 A;  3S3N A;  2VWK A;  3E01 A;  2KW4 A;  4KH5 A;  1WLJ A;  1IV0 A;  5AQT A;  1NGC A;  5M1N A;  1TKX A;  1S1U A;  3OJS A;  4PUO A;  3UKU B;  3OYF A;  3CJ1 A;  4IJN A;  2HBL A;  3MN7 A;  2ZM6 K;  3CQ8 A;  3O1B A;  3U3G A;  4LF9 K;  3KWG A;  1MWK A;  1L3T A;  3HZ6 A;  2F8S A;  3CC4 N;  4CHY A;  3OHR A;  3PY8 A;  5IT9 O;  3SV3 A;  4HCC A;  1BQN A;  4CJ4 A;  3VEN A;  3J7A P;  3C94 A;  5F0X A;  1TK5 A;  4FJM A;  1SKR A;  2UUA K;  4Y1D A;  3NAE A;  3ZET B;  1ESV A;  4JKD A;  4MO4 A;  1CZB A;  4B9S A;  4CJF A;  3KHY A;  2D0A A;  3C6H A;  4ILG B;  3VGL A;  3RVC A;  1VQM N;  4O4G A;  3VGM A;  5LY3 A;  1VQ7 N;  3K9J A;  4CJ3 A;  4DSF A;  1U2V A;  4CJL A;  4A2A A;  2HHT A;  5SWM A;  3CJ9 A;  5LJV A;  1C0F A;  3GDQ A;  5J2N A;  2FXU A;  1RDU A;  3LP1 A;  3I0S A;  4JKH A;  3VQ4 A;  3IRX A;  5EX5 A;  4FOI A;  1TAU A;  5AQZ A;  3FE1 A;  2JGU A;  2D1K A;  1RDD A;  2QWR A;  3K5N A;  1NU0 A;  1HJR A;  2P9P A;  4ZHR A;  3KVG A;  2QWP A;  2D4W A;  1S1W A;  3LAN A;  5GIO A;  3TTF A;  4NO7 A;  4BRH A;  4FXD A;  4H5T A;  1REV A;  3CER A;  4FK2 A;  4W5T A;  4HTL A;  1QHA A;  1OH6 A;  2IVP A;  3HM8 A;  3VQ9 A;  4BGB A;  3DJC A;  1BDG A;  4XIU A;  1U04 A;  1VK0 A;  4XH4 A;  4LF5 K;  1X3M A;  1K8K B;  3ATV A;  4CZJ A;  3OY9 A;  3K58 A;  4N76 A;  3OYG A;  3E1Y A;  4FLZ A;  2WON A;  3AA2 A;  1UA1 A;  3WNE A;  3VEW A;  5FRN A;  3CM5 A;  4M63 C;  3HP9 A;  1GLE G;  1JLF A;  1VQN N;  3ID6 A;  3SQ1 A;  4JKE A;  4FOE A;  3G0Z A;  4BRM A;  2BDP A;  3OYD A;  3CCV N;  5KRT A;  4F9O A;  1D5A A;  3EZW A;  3V9X A;  4LH4 A;  4DF8 A;  5AQK A;  1WAF A;  4PKG A;  1SL0 A;  3QIO A;  4DR3 K;  1KTQ A;  2E2N A;  5FRM A;  1BCM A;  5EXW A;  4BC2 A;  2KZM A;  2YX6 A;  3N4Q A;  3HO1 A;  4CFC A;  5HRN A;  1M1K O;  3AO2 A;  4Q0B A;  4DQI A;  1NJW A;  1JL2 A;  4CZM A;  4CI6 A;  1YXQ A;  1B9F A;  1GLA G;  5ADX H;  3VN5 A;  1A5V A;  3SBG A;  2QWO A;  1DGK N;  4DSK A;  1T3V A;  1XHX A;  4W5O A;  4J2B A;  3AVM A;  1U2V B;  2FF6 A;  1YHQ N;  4DQQ A;  2A41 A;  1GLL O;  2NNW A;  1R0A A;  3DLR A;  3VQ8 A;  3KLG A;  2WUS A;  4DU3 A;  1WSG A;  3SLC A;  1UOC A;  2NRW A;  2VG6 A;  5TKW A;  5AJ3 K;  4EAH D;  4X66 K;  2XY8 A;  4FVM A;  4ISE A;  4LF7 K;  3ALY A;  1HYV A;  3HSC A;  3TU5 A;  4FJK A;  3EY1 A;  1T8E A;  1KVA A;  2V7Z A;  1IBM K;  1N32 K;  4BG9 A;  2R7Y A;  1NGA A;  4ILH A;  1XI1 A;  3C7N A;  2YHY A;  1RTD A;  2P9S A;  1ZYQ A;  2P9P B;  3IKM A;  2F96 A;  4A5B A;  2IVN A;  1WUA A;  4CEE A;  1QTM A;  3BZK A;  4B9M A;  3C6A A;  1L5U A;  1XNQ K;  1O1W A;  1NK6 A;  5AQM A;  3MDQ A;  4W5R A;  3AVC A;  3D0P A;  3DWL A;  2HVI A;  4DQ8 A;  4OPJ A;  4F2R A;  3VPZ A;  2O8C B;  1HYZ A;  5J1E A;  1VSD A;  1VSJ A;  4BQL A;  3OS2 A;  4JS5 A;  2A6A A;  4OKE A;  3DLG A;  2KHO A;  2ATQ A;  2FLO A;  4E7K A;  4L8R B;  4HHT A;  4FJ9 A;  1GLC G;  5HRP A;  4C8N A;  1RT7 A;  1F21 A;  3CCU N;  1TL1 A;  1TYQ A;  4BRA A;  3DM2 A;  3GBT A;  4MO5 A;  3M8S A;  1RBV A;  3GOI A;  5CE3 A;  1V4T A;  2OAN A;  4QOZ B;  2NRX A;  1NNE A;  2G8I A;  4RW6 A;  4O55 A;  3DMJ A;  4KKO A;  5H1S Q;  4FJ8 A;  3WXL A;  3KKR A;  2VCP A;  3FFI A;  3E9L A;  3HPH A;  4R79 A;  1N6Q A;  1VQK N;  3MXI A;  1RTH A;  4EZ6 A;  4V19 S;  2QM1 A;  3AVK A;  4ID1 A;  3V9W A;  3CFP A;  4JI7 K;  3KLE A;  3QDK A;  2XY5 A;  4DR4 K;  3AA4 A;  4UQG A;  4K41 A;  3NF7 A;  4WFA L;  1NK0 A;  2V7Y A;  1VQO N;  1SL2 A;  3CCJ N;  4MQ3 A;  4FJX A;  5BPL A;  4BAC A;  4BRI A;  4DFP A;  4BE0 A;  4BDP A;  4FJJ A;  4CJW A;  5AQJ A;  3UIQ A;  1K73 O;  3SQ4 A;  3QO9 A;  1HKB A;  1NKB A;  1XQS C;  4O0I A;  3J8A A;  4JN4 A;  1CXQ A;  3E66 A;  2UUC K;  3CFO A;  3F9M A;  4DQR A;  1FK9 A;  1JXB A;  2E88 A;  4B1V A;  3LDN A;  5JLF A;  3CQX A;  3WXK A;  5M1Q A;  5JVG L;  5C42 A;  4MDB A;  2YNF A;  4WYB A;  5AQH A;  3M8R A;  2P51 A;  1X3N A;  2ZF5 O;  1S9E A;  1SS6 A;  4JV5 K;  2E8A A;  3K5M A;  1OH5 A;  2ZJP L;  3U9D A;  3U3Y A;  1XUP O;  3CJ7 A;  3OW2 M;  2J4R A;  1G15 A;  4FJL A;  5CYQ A;  4FSV A;  3DRS A;  4B3T K;  4LSL A;  4A62 A;  2QKB A;  4GMJ B;  1LWE A;  2CGK A;  4AHR A;  3OYM A;  3RMA A;  3RWU A;  5EVZ A;  2OPQ A;  1QZ6 A;  2QWM A;  3SUN A;  3DRP A;  1NGD A;  4BDZ A;  4NXN K;  2YV0 X;  3O9Q A;  4HUG A;  1TKT A;  3F5T A;  2G8W A;  1QQC A;  2O4G A;  3S3M A;  1GOC A;  4DSI A;  3EE8 A;  5AZI A;  2GBZ A;  4C8K A;  1NK9 A;  5GAH P;  4X64 K;  5ELZ A;  4O44 A;  2HBK A;  4JI0 K;  4M3Z A;  3D45 A;  4J2A A;  4FZZ A;  3AGR A;  1OVQ A;  4CEB A;  2G8V A;  2OA8 A;  3LPT A;  5AQI A;  4DTX A;  4O8K A;  5EOY A;  1QS4 A;  5KQD A;  3HOT A;  3QIN A;  4BR5 A;  4B8A B;  4YOV A;  3O4W A;  1RDA A;  1IKY A;  4JRQ A;  4PWD A;  4GNI A;  3U4L A;  3LDL A;  2E6M A;  5C2D A;  3VEV A;  2QWN A;  5KTQ A;  4I2Q A;  3ZSY A;  5LL6 Z;  3TTC A;  4CZI A;  3QML A;  4KTQ A;  3QEX A;  3LM9 A;  5JIC A;  3HXM A;  1HPM A;  2HVH A;  2QWL A;  1BA1 A;  4FO0 A;  3BF1 A;  2A3Z A;  5CHI A;  1A5W A;  1RT5 A;  2DTU A;  4BWJ A;  2HHX A;  3VET A;  4IOC L;  3V9S A;  3UE5 A;  2Q97 A;  3I33 A;  3U6F A;  1VSH A;  2FBY A;  3OYI A;  1W97 L;  2ZD1 A;  3KD1 E;  1VHX A;  1A5X A;  3L0Q A;  4CD1 A;  4CZF A;  4DTJ A;  3QEV A;  4IZ9 A;  3CJB A;  4BC4 A;  2FSN A;  3TSU A;  2PYL A;  2UU9 K;  3ZSQ A;  3UKR A;  4B08 A;  1NGJ A;  4JS4 A;  4DV4 K;  2CH6 A;  4BRP A;  3ZLJ A;  4KHQ A;  1B9D A;  2GWK A;  2IS3 A;  3W0L A;  3EZ5 A;  3ZYY X;  3RMC A;  1D4X A;  3VF2 A;  3TAF A;  3O3H A;  3VEX A;  3SAH A;  4RW4 A;  1NGG A;  3V81 A;  1QHT A;  4FJH A;  2IIR A;  3AVN A;  4H5V A;  1YVU A;  2ETJ A;  3OBY A;  4H4O A;  2GUP A;  3AAR A;  3ENB A;  3A8Y A;  4WQ5 C;  3B6P A;  4E1J A;  2Q1N A;  1NKE A;  3JXU A;  3ZET A;  1WNS A;  2XHB A;  4JK8 A;  3R9P A;  4RG8 A;  1KVC A;  4DUZ K;  5E84 A;  4DQP A;  2V52 B;  4FVU A;  3EE9 A;  2KFN A;  4F3T A;  1VQ6 N;  4BGA A;  3H45 C;  4ISF A;  1KAY A;  4CFA A;  3SMS A;  1LV5 A;  1NG9 A;  3A5L C;  4DLG A;  2ITG A;  1IG8 A;  1T7P A;  4FZX C;  1G99 A;  2Z1H A;  3OYJ A;  3P39 A;  3AVB A;  4O0J A;  1JLB A;  2CGL A;  2IVO A;  3K5O A;  5AQX A;  1Q9Y A;  3MX2 A;  1I39 A;  5AZI B;  2OZM A;  1JL1 A;  5KQ8 A;  5AQL A;  1NWK A;  4C8M A;  2V51 B;  4CF9 A;  3L2R A;  1C0U A;  3RR7 A;  2I7N A;  4LD0 A;  1WB9 A;  2I5J A;  4RCH A;  2O8E A;  3TSQ A;  5BR8 K;  3VQD A;  4QS7 A;  4Z4C A;  1BIZ A;  3CHW A;  4YNQ A;  4NYF A;  2HNY A;  1HNZ K;  4OLB A;  2GX9 A;  4Z4F A;  4BC5 A;  3WNF A;  5GAE P;  2FSJ A;  1HRH A;  1X9M A;  3M8P A;  1RBR A;  4M3R A;  4DR1 K;  4M45 A;  3QFP A;  2BAN A;  3KKS A;  3AA5 X;  1ASW A;  1QSY A;  3S41 A;  3ZT4 A;  4F8R A;  2DY4 A;  1WSE A;  1YTU A;  3MCA B;  4F3O A;  4MLH A;  2F7T A;  3CG7 A;  2ZWH A;  2IAJ A;  1HKG A;  4DSJ A;  2YNH A;  2ZQB A;  4Z4H A;  1XMO K;  1RT3 A;  3UKR B;  4EP5 A;  1TV6 A;  4CGF A;  1YIT N;  3O5B A;  4CK2 A;  3R6M A;  2LSN A;  4CJ7 A;  3O4Q A;  1RFQ A;  3ZSZ A;  3WXI A;  4CGH A;  1RBS A;  3DLK A;  4MDA A;  5HP1 A;  4IG3 A;  3OBW A;  3L6Q A;  2UUB K;  4H8K A;  3WXM B;  1YIJ N;  2KFZ A;  4C1N I;  4TSX A;  3A5O C;  3LP3 A;  3J7Z O;  2W6K A;  4JNE A;  4GKK K;  1Y97 A;  4DV3 K;  3VQ5 A;  4PQU A;  1Q9X A;  1GLB G;  4M7Y A;  4PHT X;  2Y1I A;  3Q7B A;  1C6V A;  3SJJ A;  3IG1 A;  4ID5 A;  3MX5 A;  3VMF B;  3QB0 A;  4CFD A;  4QCL A;  4IG0 A;  1KLN A;  3KK7 A;  2W6L A;  1MU2 A;  1RTJ A;  3NF6 A;  4RW7 A;  3M5R A;  4DF4 A;  4M41 A;  4CEC A;  4B9T A;  4KHP K;  2Z1J A;  4AHC A;  3VTI A;  4DTU A;  4FLV A;  1SKS A;  4J2E A;  1KQS M;  1IBL K;  3CC2 N;  1IKV A;  4KV8 A;  5CR4 A;  3J81 O;  3UB5 A;  4CK1 A;  4CHZ A;  3VER A;  4EZ9 A;  1NLV A;  4LF8 K;  3AVH A;  3ZSX A;  4WF9 L;  3EYZ A;  3ZT1 A;  1GLF O;  4Z0U A;  5F2R A;  1KAX A;  2FSK A;  2CH5 A;  3DRR A;  3S9H A;  3SK3 A;  3A0I X;  1N33 K;  2WOM A;  1HNV A;  1RDW X;  3THV A;  1BI4 B;  2YI1 A;  3JYT A;  2O8E B;  3L8B A;  1KSP A;  1HNW K;  3KTQ A;  4BDY A;  3QLH A;  1CLQ A;  3PV8 A;  4DV6 K;  3MWT A;  4XEI A;  4BRG A;  4IWV A;  2XY7 A;  4ZTJ A;  2ASO A;  1D9D A;  3T3F A;  2O8C A;  3H08 A;  1VRT A;  3WQT A;  1X9S A;  3LDP A;  2HND A;  4BRN A;  4KTW A;  4YHH K;  2FBT A;  4JK9 A;  1FKP A;  1BHL A;  1S9G A;  2UYT A;  3DOL A;  3TAP A;  2HMP A;  3ZSV A;  3S3O A;  5BRH A; 
#chains in the Genus database with same CATH homology
 1YJW N;  4J8F A;  1DT9 A;  2ZGY A;  3EKU A;  3M6G A;  3D2F B;  5JMV A;  3A5M C;  4JKC A;  3F2K A;  2P9U A;  2OTL N;  3HTV A;  5H1S Q;  4FWK A;  3M3Z A;  4JAX A;  4O5F A;  3EKS A;  4QS8 A;  4WQ5 A;  5AQP A;  5BN9 A;  3WXL A;  3ZEU B;  3G4S N;  2VCP A;  3D7E O;  3E9L A;  5AQS A;  4R79 A;  5DM7 L;  1VQK N;  5HL7 L;  1QQN A;  4CZL A;  2RHK A;  5AQW A;  3FFK B;  3OA9 A;  3NVM A;  4H0O A;  1NJI O;  1O13 A;  1QQM A;  2QM1 A;  1P90 A;  3G6E N;  2W40 A;  4FPB A;  4H5R A;  4GY2 B;  4YOT A;  1CZA N;  5BN8 A;  3AAQ A;  3QDK A;  1S72 N;  2P9L A;  4CBW A;  3DAW A;  3DXM B;  1ATS A;  1WOQ A;  2GWJ A;  4K41 A;  3TPQ A;  3CME N;  4BR0 A;  4WFA L;  2FF3 B;  2V7Y A;  4YOW A;  2OTJ N;  1VQO N;  3D2E B;  5GAD P;  4NLC A;  2EWS A;  3CCJ N;  3CJA A;  5BPL A;  4FWL A;  5AR0 A;  4BRI A;  2HBM A;  2VWB A;  4PKI A;  1NGE A;  3HOS A;  3K9K A;  5E26 A;  5AQJ A;  5AQU A;  2VGM A;  2AA4 A;  2I7P A;  1P8Z A;  1K73 O;  4IO9 L;  3VEO A;  1HKB A;  4H0P A;  1MA9 B;  1XQS C;  3J8A A;  4JN4 A;  4C23 A;  3DXK B;  4BG8 A;  3E66 A;  3GE1 A;  3WT0 A;  3F9M A;  2CGJ A;  2NLX A;  3UKU A;  4A5A A;  1GLD G;  2E88 A;  4FWO A;  3LDN A;  4B1V A;  3CQX A;  5JLF A;  1HX1 A;  5KPR A;  4JKA A;  3WXK A;  5M1Q A;  2QTD A;  5JVG L;  2Q2R A;  4NLB A;  3C0B A;  4MDB A;  4FWS A;  3I55 N;  5AQH A;  4WYB A;  3WUH A;  3VGK A;  2QW9 A;  1KXP A;  4IOA L;  1BUP A;  4WQ4 A;  4A57 A;  1X3N A;  2ZF5 O;  3O1W A;  1J6Z A;  3U8X A;  5AZJ B;  1SS6 A;  1YI2 N;  1Y64 A;  3CI5 A;  2E8A A;  1R59 O;  3CCS N;  3H3O B;  5M1O A;  2ZJP L;  3MN6 A;  5JVH L;  3U9D A;  1XUP O;  2E1Z A;  3CJ7 A;  2F9T A;  3O08 A;  4L3Q A;  4LC9 B;  3OW2 M;  2J4R A;  3IDH A;  4KH4 A;  3CCR N;  3VOV A;  3O6W A;  4FWN A;  4JK7 A;  4JEP A;  2BUP A;  3KZB A;  2JWK A;  4OPA A;  2NRR A;  3GG4 A;  4ILJ A;  5GIP A;  1HUX A;  4YOX A;  5LJW A;  3O9R A;  4FSV A;  3L4I A;  1SAZ A;  3L4Q A;  4A62 A;  4EIA A;  3H6E A;  4Z94 A;  1NM1 A;  2CGK A;  1TUY A;  1K9M O;  3CF5 L;  5C15 A;  5EVZ A;  1QZ6 A;  2QWM A;  3MN5 A;  1QVG M;  4H0Y B;  1YJ9 N;  1NGD A;  1S3X A;  3W3D A;  2HF3 A;  3LL3 A;  1Q7Y O;  1BU6 O;  2ITM A;  3O9Q A;  2D0O A;  2VYP A;  2YCH A;  4BRC A;  3F5T A;  3Q7C A;  3WXJ A;  3I56 N;  4YOY A;  3IUC A;  4PL7 A;  4PKH A;  3P31 A;  3CCE N;  2JWL A;  3EE8 A;  1OVY A;  5AZI A;  4B9Q A;  2ZGZ A;  3VF6 A;  3O8M A;  4CZG A;  1NGF A;  2ASM A;  5GAH P;  3MWP A;  3CCQ N;  5ELZ A;  2HBK A;  4XH5 A;  5M1F A;  5C10 A;  3PIO L;  1YJN N;  1XC3 A;  2ZJQ L;  1T6D A;  4H03 B;  5FPN A;  4DCH A;  1ZXO A;  5GIN A;  3CMA N;  1VQL N;  3AGR A;  5BRF A;  1M90 O;  4K25 A;  2Q36 A;  3SMP A;  2QI2 A;  3ULE B;  5AQI A;  1Q18 A;  3WEE B;  1YAG A;  4O8K A;  5EOY A;  1C0G A;  1YF5 L;  3WEE A;  1LOT B;  3HOT A;  5KQD A;  4MLE A;  4BR5 A;  4YOV A;  2YHW A;  3O4W A;  4OO1 J;  2QA4 N;  2GTD A;  3JS6 A;  3T69 A;  5AFU A;  5GAG P;  1T44 A;  4GNI A;  5AQR A;  3U4L A;  3ENO A;  3P38 A;  3CC7 N;  3LDL A;  3E9O A;  5C2D A;  2BTF A;  4KH6 A;  3CQY A;  3VEV A;  3FZF A;  4IOX A;  2QWN A;  1ZBS A;  2P9U B;  3ZX2 A;  3TTC A;  4CZI A;  3CPW M;  3O9S A;  4GV9 A;  4Y0W A;  1NGH A;  3QML A;  3SJH A;  3R3L A;  4BRD A;  3P4I A;  3LM9 A;  5JIC A;  1JJ2 M;  1HPM A;  1HKC A;  4UY8 O;  3EO3 A;  1NBW A;  2QWL A;  2YJF A;  1BA1 A;  1GLJ O;  1K8K A;  4FO0 A;  5C12 A;  2WC9 A;  3BF1 A;  1BWF O;  2A3Z A;  5CHI A;  3ENH A;  5KPT A;  4B1W B;  3VET A;  4IOC L;  1BA0 A;  1V4S A;  4YDU A;  3UE5 A;  4FWM A;  3H46 O;  3C65 A;  4BRL A;  3FZH A;  2P9L B;  4BY9 C;  2Q97 A;  2PAV A;  3HBT A;  3I33 A;  4BR9 A;  4IEE A;  4WCE L;  3B8A X;  3NMU A;  1W97 L;  3MK6 A;  1VQP N;  3LM2 A;  3H1V X;  1VQ8 N;  4CZE A;  5I9E B;  5FPD A;  1JCG A;  3CIP A;  3L0Q A;  4CD1 A;  4CZF A;  1Q86 O;  3G71 N;  4IZ9 A;  3CJB A;  4BC4 A;  3N4P A;  4FL9 A;  2FSN A;  3HI0 A;  3TSU A;  4CD3 A;  3QBW A;  4B1U B;  1NMD A;  1OKJ A;  4JHD A;  2HOE A;  4BR2 A;  3UKR A;  4QS9 A;  2VGN A;  4KH5 A;  4JKG A;  5AQT A;  1NGC A;  2Q31 A;  5M1N A;  1NGJ A;  4IO8 A;  3ZX3 A;  2BH1 A;  4BC3 A;  3UKU B;  2ZJR L;  3CJ1 A;  2CH6 A;  4BRP A;  4IJN A;  2HBL A;  3MN7 A;  4HWI A;  4EFH A;  2A42 A;  2GWK A;  3O1B A;  3W0L A;  1E4F T;  3KWG A;  1MWK A;  4A2B A;  3ZYY X;  3VF4 A;  4B1X B;  4WFB L;  3HZ6 A;  3CC4 N;  1D4X A;  1KAZ A;  1U6Z A;  4BQZ A;  5M1K A;  3VF2 A;  3OHR A;  3VTH A;  4IXC A;  1HLU A;  4JD2 A;  5FPE A;  1Q82 O;  3VEX A;  3SAH A;  3AGK A;  1IJJ A;  1NGG A;  4FWR A;  3CJC A;  3VEN A;  2IIR A;  4H5V A;  5F0X A;  2QXL A;  3FGU A;  3OBY A;  2GUP A;  3AAR A;  3ENB A;  4JKF A;  1MWM A;  2A40 A;  3A8Y A;  4WQ5 C;  4BVO A;  5ADX A;  4E1J A;  2Q1N A;  1VAZ A;  3JXU A;  3A5N C;  3TTD A;  3ZET B;  5BPM A;  1ESV A;  1SZ2 A;  2W41 A;  4JKD A;  3ZET A;  4MO4 A;  4DB3 A;  4JK8 A;  3R9P A;  1YUW A;  3FZL A;  4U7B A;  4H0X B;  5E84 A;  3KHY A;  2V52 B;  3T7Z A;  3C6H A;  4ILG B;  3O80 A;  2H3G X;  3EE9 A;  3VGL A;  3RVC A;  5JLH A;  4RWT A;  1VQM N;  1VQ6 N;  4BGA A;  4FVU A;  3VGM A;  4BR7 A;  5LY3 A;  1VQ7 N;  1N8R O;  3K9J A;  1U2V A;  3H45 C;  4ISF A;  1KAY A;  5AQY A;  3SMS A;  3R1X A;  4A2A A;  4H5W A;  3A5L C;  1IG8 A;  3CJ9 A;  4GV3 A;  1EO1 A;  4BRE A;  1G99 A;  5LJV A;  5DM6 L;  1C0F A;  1E4G T;  3GDQ A;  3P39 A;  3RSE A;  5M1P A;  4BRF A;  1NGB A;  2CGL A;  2FXU A;  2IVO A;  5HOO A;  2P9N A;  5AQX A;  1RDU A;  3IFR A;  3MX2 A;  3ID8 A;  4KBO A;  4JKH A;  4BRO A;  5AZI B;  4O8U A;  4AM6 A;  5EX5 A;  4FOI A;  5KQ8 A;  5AQZ A;  3FE1 A;  1NWK A;  5AQL A;  2V51 B;  3QIC A;  2D1K A;  2KKZ A;  3U9Z A;  5C0Y A;  5BRD A;  2I7N A;  3NVK A;  3MMV A;  3WQU A;  2QWR A;  5MLC Q;  2NRV A;  4RCH A;  2P9P A;  4WQ4 C;  3KVG A;  2QWP A;  3QBX A;  2D4W A;  2AP1 A;  1SQK A;  4EHT A;  4OPH A;  3TSQ A;  4K42 A;  3VES A;  3EL2 A;  4QS7 A;  5GIO A;  3FZM A;  3O9T A;  3CHW A;  3TTF A;  4NO7 A;  4BRH A;  4H5T A;  3CER A;  2PFU A;  1X9J A;  1QHA A;  2GX9 A;  4HTL A;  2IVP A;  4FPA A;  4BC5 A;  3HM8 A;  4CBX A;  1Z05 A;  1QVF M;  4ISG A;  1JCE A;  5GAE P;  4BGB A;  3DJC A;  4GV6 A;  1MDU B;  1BDG A;  2QWQ A;  3CCM N;  2FSJ A;  3CET A;  2YJE A;  4XH4 A;  2NZT A;  1X3M A;  3BUZ B;  4AM7 A;  1K8K B;  1QQO A;  3ATV A;  4BRQ A;  4CZJ A;  3QFP A;  3BP8 A;  3FZK A;  3VEZ A;  4FWP A;  1TUU A;  3AY9 A;  4H0T B;  3CPE A;  2A5X A;  3E1Y A;  4DKW A;  3S41 A;  4H5N A;  4I6M A;  2P9I A;  3VEW A;  1BO5 O;  2P9K B;  2E1Y A;  5AQF A;  1BOT O;  2NRH A;  2E20 A;  3MN9 A;  3MCA B;  4M63 C;  2P9K A;  1GLE G;  4MLH A;  3D2F A;  3ID6 A;  3PIP L;  1VQN N;  4K43 A;  1BG3 A;  4JKE A;  2F7T A;  4FOE A;  5TKY A;  4BRM A;  2ZWH A;  5AQG A;  5KPZ A;  1VQ9 N;  3CCV N;  3ZEU A;  1HKG A;  4F9O A;  4CZK A;  3EZW A;  5AQQ A;  4JHD B;  1ATR A;  3UKR B;  3MCP A;  5AQK A;  4JKG B;  4PKG A;  3IMX A;  3E9P A;  1YIT N;  3O5B A;  2GEL A;  3H3N O;  4C1N K;  3R6M A;  1VQ4 N;  4CJ7 A;  3VEY A;  1RFQ A;  3DXM A;  2E2N A;  3CXC M;  1K8A O;  5EXW A;  4BC2 A;  2Q0R A;  3D2E A;  3WXI A;  1LCU A;  1ZC6 A;  2YX6 A;  3N4Q A;  3HRG A;  4MDA A;  3AAP A;  1M1K O;  2HF4 A;  4JD2 B;  4CBU A;  1Z6R A;  1DEJ A;  2NRT A;  3L6Q A;  3OBW A;  1HJO A;  4BR4 A;  3WXM B;  1YIJ N;  1YVN A;  1Q81 O;  5EY4 A;  4CZM A;  4CI6 A;  4RTF D;  4C1N I;  1YXQ A;  3A5O C;  2HBJ A;  3BEX A;  3DLL L;  3ATU A;  1GLA G;  5ADX H;  4B1Y B;  3J7Z O;  3DXK A;  4XH1 A;  4JNE A;  4AF1 A;  5B8H A;  5AQN A;  1ILY A;  4CZH A;  1GLB G;  1DKG D;  4M7Y A;  4PHT X;  3SBG A;  3LDQ A;  2QWO A;  1DGK N;  4U67 L;  3SAF A;  4YDU C;  1T3V A;  3KWI A;  3Q7B A;  3I8B A;  3CD6 N;  3LDO A;  2RE2 A;  4YOR A;  2E2Q A;  3MX5 A;  1U2V B;  3QB0 A;  2FF6 A;  5FPM A;  3VMF B;  5AZJ A;  2YHX A;  3KK7 A;  1YHQ N;  2A41 A;  2E2P A;  4BRK A;  1GLL O;  2NNW A;  3M5R A;  4IEI A;  3EN9 A;  1KC8 O;  2ASP A;  2WUS A;  2WFB A;  3QFU A;  3RSE B;  1EQY A;  5BR9 A;  3VTI A;  3SLC A;  2NRW A;  5TKW A;  5C2F A;  4WFN L;  4EAH D;  1NGI A;  2P9N B;  1KQS M;  3CC2 N;  3TSP A;  4ISE A;  5CR4 A;  3CCL N;  1JCF A;  4IDH A;  4YOU A;  3HSC A;  5AQV A;  3TU5 A;  3UB5 A;  3G25 A;  2PBD A;  3VER A;  4B1Z A;  1NLV A;  3ZX0 A;  3FR0 A;  2F9W A;  2E2O A;  4A59 A;  2V7Z A;  4WF9 L;  4BG9 A;  1T6C A;  1GLF O;  1NGA A;  4ILH A;  4BVP A;  3C7N B;  1KAX A;  3M1F A;  5F2R A;  1W2B M;  2FSK A;  3C7N A;  2P9S B;  2YHY A;  2CH5 A;  2KLA A;  2P9S A;  3SK3 A;  4A61 A;  1QZ5 A;  3A0I X;  3PLA A;  3R8E A;  4GVE A;  3H1Q A;  1ATN A;  2P9P B;  3IKM A;  3SBT A;  3BF3 A;  4A5B A;  2IVN A;  1RDW X;  1WUA A;  5BRE A;  2YI1 A;  2NRZ A;  2Q0U A;  1KD1 O;  4IJA A;  3C6A A;  4H0V B;  2QEX N;  5AQM A;  3MDQ A;  1VQ5 N;  5AFU H;  3MWT A;  3DWL A;  4XEI A;  4IWV A;  4BRG A;  5AQO A;  5F1X A;  4DQ8 A;  2D0P A;  2ASO A;  4EHU A;  3VPZ A;  2HST A;  4IFE A;  1RGI A;  4M7X A;  4BQL A;  3WQT A;  2A6A A;  2GEM A;  2KHO A;  3LDP A;  4DHY A;  3SAG A;  2FLO A;  4BRN A;  3ULE A;  3FLC O;  1GLC G;  1S22 A;  4JK9 A;  3O9U A;  4PL8 A;  1TYQ B;  5BRH A;  3CCU N;  2WBN A;  1H1V A;  3GL1 A;  2UYT A;  1TYQ A;  4JKB A;  4I6M B;  4NB4 A;  2DPN A;  2P9I B;  3GBT A;  4MO5 A;  4BRA A;  5BPN A;  3D6R A;  3GOI A;  5CE3 A;  2HMP A;  4FWQ A;  4G9Z A;  1V4T A;  2OAN A;  2NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...