4DMNA

Hiv-1 integrase catalytical core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
145
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multimode, cooperative mechanism of action of allosteric HIV-1 integrase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
molecule keywords HIV-1 Integrase
total genus 49
structure length 145
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dmnA00
3MAQA 2XY7A 1B92A 2VG6A 3S9HA 2YHAA 4QOZB 1KVCA 3OYCA 2OPQA 1JKHA 3H08A 1RBTA 4MFBA 3ZT1A 3ZSVA 4CGDA 3AA3A 3ZCMA 4ID5A 2X6NA 4CEOA 1T7PA 2B6AA 3T1AA 4KHYA 3AVJA 4AHCA 3KKRA 2G8UA 3U3YA 4B3OA 1HQUA 5J1EA 1QE1A 2A1RA 4LY7A 3LPUA 3SUOA 3ZSQA 1WN7A 4CEZA 3KD5E 1TKXA 3O3FA 3QEIA 1Z25A 4B9VA 1L3SA 1SKWA 3RMDA 3VQBA 3QNNA 4F2SA 3PY8A 2KFZA 1BISA 4KKOA 1NJYA 3CFPA 4NCGA 1SL2A 5FRMA 4OKEA 3NGYA 1EETA 4CJ3A 4HVJA 1BL3A 4L8RB 1LWCA 4KTWA 2PYLA 1NKEA 1SV5A 3L2UA 2KZMA 1VSEA 3VQEA 2JLEA 3NGZA 2QKKA 4DFMA 1LV5A 5HRRA 1IG9A 3HO1A 3SV4A 2XY5A 3VQAA 1D5AA 4CF8A 2D5RA 1WSGA 4CF0A 4FJKA 4M3RA 5KGXA 4Y1CA 3EY1A 1W0HA 3KLFA 4DFJA 4M3ZA 3MEEA 2VWJA 4E3SA 4M3UA 4WE1A 3LWMA 4B9TA 4KPYA 4CFBA 2HHXA 2FC0A 3K5MA 1ZBLA 4OLBA 3AV9A 4CGFA 3WNEA 1S1UA 4I9LA 1KVBA 3DRRA 3RRHA 4OLAA 4E89A 2BGGA 3F9KA 1FKOA 1WSHA 4KB1A 1MU2A 1HMVA 3TAMA 4HCBA 2IOCA 2LSNA 2QKBA 3AVFA 1RTHA 3HPGA 1LW0A 2FBVA 3KJVA 1D8YA 1VRUA 4OVLA 4CJSA 4O0IA 4HUGA 4DTJA 2KW4A 3HPHA 4CK1A 3OY9A 2BE2A 1TAQA 3V1RA 5CYQA 3ZSYA 4DMNA 3G0ZA 3ZT4A 4DTNA 3S3OA 5KTQA 4M3WA 4I2PA 1I3AA 2Z1IA 3SQ0A 1Q9YA 2DY4A 1YTUA 3B6PA 3CQ8A 1VSDA 4PUOA 2OA8A 4LH5A 1XHXA 1BQNA 1S9EA 1IKYA 3OYJA 3RR8A 3NBPA 3NF6A 4R5PA 4F3TA 2JGUA 2XY6A 3VQPA 2X74A 4FLWA 3SQ1A 4J2EA 4IKFA 4KI6A 4CECA 2G8HA 2FBXA 3EZ5A 1RT3A 3NDKA 2G8FA 3MEGA 1JXBA 1S1WA 2IC3A 4FLUA 3HVTA 5CYMA 1RTDA 1Q8IA 3VQ9A 1C0UA 1X1PA 1TKZA 3ZT3A 4M3XA 1XWLA 3LAKA 5DMRA 3KK3A 3K59A 4MQ3A 3LPTA 1RBRA 4KO0A 2B5JA 4FJIA 1FK9A 3EYZA 4KHUA 2HNZA 4E19A 2DFFA 4B8AB 4PA1A 4B9UA 3DMJA 1JLCA 3SV3A 3VQCA 4BWJA 2Z1JA 4CGIA 4OPJA 1S1VA 1VSFA 4FJXA 1EP4A 1RBSA 3AO1A 4CK2A 1HNIA 1WAJA 3S3NA 2HVIA 4DSLA 4BE1A 3AVHA 4RW9A 1Z26A 4Z0UA 3KLHA 3I8DA 1JLGA 3VQQA 3HM9A 3C6UA 1JXEA 3HL8A 4OGEA 4CEDA 3NH1A 4NCAA 3L2QA 4F3OA 4B08A 1JLAA 1RDBA 2ITGA 1KCFA 3QETA 3AA2A 4NYNA 2O4GA 1B9FA 3KK2A 2GBZA 2RKIA 1EX4A 1NJXA 4IFVA 1CZBA 1JLBA 3DRPA 4CEQA 3O4NA 1JLFA 4H4MA 4H4OA 3WNFA 3HXMA 3RMBA 3ISNC 1ZYQA 4KHNA 4FK2A 1U48A 4FZZA 1KRPA 4DQQA 1TL3A 1VSHA 5C25A 1YT3A 2VG5A 4CEFA 5SZTA 2X6SA 3AVKA 1RT1A 4DSEA 4W5OA 3OJUA 2ZD1A 3LP2A 1RNHA 1SKSA 2ZQBA 1BHLA 4DTSA 3D0PA 4AHRA 4FJGA 3HJFA 3O3HA 3AA5X 2PZSA 1A5VA 1U47A 1L3UA 1QSYA 3MXIA 4EZ6A 3MXMA 1T8EA 4KI4A 3HT3A 4J2BA 3L8BA 3V81A 4ELTA 3V9WA 2DFEA 3TAQA 3QNOA 4G1QA 4BE0A 4K8XA 3ITHA 2AJQA 1BGXT 2D0BA 3TAEA 4DQRA 4CHNA 4CF1A 1RBVA 3OS0A 4OKKA 1CXQA 3QEVA 3CYMA 3KTQA 1HYZA 3AVNA 2XY8A 4CJQA 4O0JA 4FJ8A 3VQDA 3AO3A 4F4KA 3OVNA 1NK8A 2YHBA 5KGWA 3VQ5A 1KFSA 3I0SA 2YNFA 1YVUA 4CJ5A 4KREA 1J54A 4AHVA 3T19A 2FBYA 3L3UA 2OPSA 2IAJA 2YKMA 4HUEA 4FLZA 1RCHA 4CHZA 2R7YA 2YV0X 4DSJA 3BGRA 3O3GA 2G8KA 3OYKA 4CE9A 1XHZA 1Q9XA 3DLRA 2YNGA 4CEBA 1UOCA 4O44A 3TAFA 4RG8A 3LALA 2HNYA 4JRPA 4E7LA 1A5WA 2F8SA 4CJEA 4UQGA 3AVAA 3SPZA 1R0AA 4E0DA 4PWDA 3OYLA 3DLKA 5HBMA 1F21A 3G10A 3CM5A 1J9AA 3AO2A 4JLHA 3V9SA 4EP4A 3KLGA 4E7HA 3PX6A 3B6OA 4HHTA 1RT6A 2ZE2A 3KK1A 3V9UA 1D9FA 3CM6A 4CK3A 4BDPA 4DLEA 4M41A 1WAFA 3BDPA 3AVMA 3K5NA 4FJMA 3MEDA 3U3GA 4CIFA 3NE6A 3NGIA 4Z4GA 3LZJA 1VRTA 3AVLA 3QEWA 4CIEA 3L2WA 5C42A 3QESA 1WSIA 2OZSA 1RTIA 3OYEA 3OYGA 3C94A 4ICLA 4ZTFA 4CGGA 1FKPA 4W5QA 4E7IA 4Q0BA 3SCXA 3VQ6A 4XIUA 4FZXC 1BIUA 4ZTJA 4DTXA 4ELVA 3CG7A 3D45A 4CIGA 1SL1A 4DQIA 1SKRA 3QEXA 2X78A 1HJRA 4DS5A 4KFBA 5HRSA 4Z4IA 1RBUA 1NKCA 2DFHA 2RPIA 2A1SA 3HSTB 3NF9A 4RW8A 1S9GA 2XO7A 4KHWA 4CEAA 3PO5A 2FBTA 5CZ2A 4BDZA 4FCYA 1WLJA 4NYFA 1LAWA 3DYAA 3LAMA 4DF8A 4Z4HA 4DLGA 4DSFA 1NK6A 1NKBA 2HVHA 3SUNA 4QAGA 1NK4A 3V1QA 1TL1A 3M8PA 1RTJA 2BANA 3HP6A 1KLNA 1QSLA 5HROA 3E01A 4C8MA 1HRHA 1U04A 1FXXA 4AHSA 2XHBA 2G8VA 3KLEA 3HP9A 3NH2A 3JYTA 4FLTA 3TANA 3QO9A 1BI4B 2F8TA 4IG3A 3L2VA 3DLEA 3ASMA 3P83D 4ZHRA 3VQ8A 4FW2A 1U45A 5T7BA 2OZMA 3NH0A 4F8RA 5EU7A 3NCIA 4CFCA 2DTUA 3TAPA 1LAVA 1VSIA 4N56A 1T05A 1IKWA 2QK9A 1WSJA 3PO4A 3QLHA 3OYFA 4CFAA 4AH9A 3SI6A 3TARA 1XI1A 5E41A 3ULDA 5I3UA 4N47A 3RR7A 2B4JA 2E6MA 4E1MA 4CCHA 4DTUA 1QTMA 3KLIA 4E7KA 1GOBA 3RRGA 1NOZA 3RWUA 3IS9A 1LWFA 3FFIA 3KKSA 2W42A 1CLQA 4PY5A 2EHGA 3SUPA 4ID1A 4B9NA 3DM2A 3LZIA 2P5OA 4GVMA 4LH4A 1C1AA 2Y1IA 4NCBA 1RT7A 2XRIA 1HPZA 3M8SA 3LANA 4JS5A 4FM2A 1WSEA 5KRTA 3OJSA 3ALYA 4FLYA 4FJ5A 4FW1A 4FK4A 4N41A 4GMJB 5SWMA 1ITGA 4DTRA 5HLFA 2G8IA 3TABA 4DFKA 4Z4FA 5KRSA 3WNHA 1QHTA 1S5JA 1QSSA 3IAYA 4FZYA 1RT4A 4K8ZA 3HVRA 4YNQA 3OYNA 4N5SA 1N5YA 2VWKA 4CFDA 4OPKA 1GOAA 2VG7A 1T03A 1L5UA 1W9HA 1IO2A 3ZSZA 3S3MA 3PV8A 4DFPA 4KHSA 4AHTA 1JL1A 1QS4A 3M8QA 3PUFA 3TI0A 3ZT0A 3DLBA 1ZBFA 4C8LA 2Q3SA 4CHOA 4B9LA 2E6LA 5DK5A 3SNNA 3NHGA 4RW6A 4EP5A 5CZ1A 4LD0A 1QQCA 1TGOA 3DLGA 4OKJA 1JL2A 3V9ZA 4DU4A 3PX4A 4CERA 1ASWA 1A5XA 1VSMA 3K5OA 5HRNA 2PYJA 1VSLA 3AA4A 3DOKA 1EXQA 4EZ9A 1JLQA 5C24A 1O1WA 4BE2A 5J2NA 2HHSA 3F73A 2HHTA 2OPRA 4DTMA 4CHYA 1C0TA 1EKEA 1C1BA 3OYAA 1BIZA 1S6PA 3DOLA 2QXFA 4RW4A 2NUBA 5K14A 1C0MA 3NF8A 3V1OA 3QERA 4N76A 2O4IA 4AHUA 2KZZA 4IDKA 1GOCA 1S1TA 3A2FA 2HHQA 1HYSA 4J2DA 3SUQA 3DLHA 4I7FA 4KAZA 4CGJA 4CJRA 1IKXA 1YTAA 4E7JA 4FJ7A 2HHVA 3LWLA 4HTUA 4KHQA 3U6FA 4CJFA 3LP0A 4ELUA 5HRPA 4HUFA 4KB0A 4FK0A 2HMIA 4O5BA 3QEPA 3OS1A 3THVA 3ZSRA 3AVIA 1B9DA 4CEEA 4CJLA 4CJUA 1BQMA 3SJJA 1UA1A 2HW3A 5JS1A 1HQEA 3KIOA 2RF2A 1VSJA 1ZBHA 4CESA 1LW2A 3NF7A 3VQ7A 1L3VA 1RDAA 4IFYA 3M8RA 3RMCA 4FXDA 1VSKA 3LP3A 3V4IA 1I39A 3CFRA 3OS2A 4W5RA 3SPYA 3PX0A 4C8NA 4CJ4A 4LSNA 2WONA 3VA3A 3AVBA 2Y1JA 3TWHA 4DF4A 4E1NA 3ZSXA 4AILC 3ZSWA 3K2PA 4Y1DA 2E4LA 1NK7A 1IH7A 3QIPA 2WOMA 3V6DA 4DSIA 3T3FA 1UWBA 1RILA 1ASUA 1TKTA 1J53A 4IG0A 4CF2A 5I42A 4Z4EA 4CJKA 1TAUA 2KFNA 1HYVA 4FVMA 3ZT2A 3DI6A 2P51A 3MECA 1WSFA 1RT2A 2YNIA 4BACA 3SQ4A 3TR8A 5J2MA 5D3GA 4CJWA 3RMAA 4CJTA 5J2PA 4FJJA 1BCMA 2IDOA 3OYIA 3VN5A 2HHUA 1TVRA 1VK0A 1U4BA 4TSXA 4FJNA 1SUQA 4QCLA 1L3TA 4OGCA 2Z1GA 2OYQA 5HP1A 1REVA 2D0CA 4F2RA 1RT5A 4M3TA 1CXUA 4DS4A 4W5TA 1J5OA 1C1CA 5CY4A 2EX3A 1DLOA 2HNDA 4DU3A 3NAEA 1KVAA 1U49A 4KTZA 3OYHA 4C8OA 4JRQA 3O4QA 1KTQA 1UA0A 4I9QA 1S1XA 4CGHA 1NK9A 3QINA 4DTOA 4BDYA 1X9SA 4Q5VA 1C6VA 3L2RA 4M3YA 4YFUA 4BWMA 2IGIA 4Z4CA 2D0AA 1CZ9A 2YNHA 3WNGA 3MXJA 3C95A 4RW7A 5FDLA 4I2QA 1D9DA 3TAGA 3AVGA 5FROA 3LDSA 1KLMA 1BCOA 1K6YA 1ASVA 2P1JA 4FM0A 4DQPA 1ZBIA 2OPPA 3IRXA 4J2AA 1WNSA 3OYBA 1TV6A 1Y97A 2P5GA 1DTTA 4DWIA 4OJRA 4LSLA 3VA0A 3C6TA 1RDDA 4DTPA 1G15A 3AVCA 3L3VA 2IS3A 1X9WA 1ZBUA 4HCCA 1DTQA 3AO5A 3QIOA 2HHWA 2GV9A 1S6QA 4PQUA 1NK5A 4CJVA 1TK5A 1BI4A 4JS4A 1TK8A 1RDCA 4DSKA 2YKNA 3JSMA 3K58A 2GUIA 3SYZA 4M42A 4CHPA 2ATQA 4FM1A 1LWEA 1NJZA 4DQSA 4IBNA 1HNVA 1SL0A 2G8WA 1UAXA 3I0RA 4CHQA 4FLVA 4B8CA 2PY5A 4KRFA 3LP1A 4W5NA 1TKDA 1NOYA 4M45A 2ETJA 3AO4A 1KFDA 4CF9A 2RN2A 3HYFA 2BDPA 5JS2A 4C8KA 4FJ9A 3P5JA 4FJLA 3K5LA 1XC9A 3HK2A 3VQ4A 1JLEA 1NJWA 2KQ2A 2Z1HA 3OYMA 1N6QA 3DRSA 3SQ2A 1X9MA 3NFAA 3RTVA 3K57A 3V9XA 4B9MA 5FRNA 5KI6A 3IG1A 4O4GA 4GW6A 3OYDA 2I5JA 1NK0A 4KV8A 3ZSOA 4H8KA 4CJPA 3CFOA 2F96A 3HPOA 4FLXA 1TK0A 3UIQA 4DU1A 3P1GA 2HB5A 5J2QA 4KTQA 4FYDA 4FJHA 1IKVA 1KSPA 3SZ2A 4O55A 4B9SA 2KTQA 3KD1E 4DG1A
chains in the Genus database with same CATH superfamily
1KVCA 4JAXA 3OYCA 3I56N 3VOVA 1RBTA 1NLVA 3ZCMA 4ID5A 1T7PA 2A1RA 4LY7A 3ZSQA 2YJEA 3KD5E 4B9VA 3LDQA 1NJYA 4BRHA 5FRMA 4OKEA 4YY3K 3W3DA 1BL3A 3VF2A 4L8RB 3PLAA 2DPNA 4MDAA 2JLEA 3NGZA 4AQYK 5M1NA 2XY5A 3VQAA 4CF8A 3TTFA 1RDWX 3KLFA 2QWMA 4JKGA 4DFJA 3VGLA 4B9TA 2HHXA 3CMEN 1ZBLA 3WNEA 3RSEB 1ATSA 3GG4A 3RRHA 1FKOA 1HMVA 2LSNA 3AY9A 2FBVA 1D8YA 1JJ2M 1VRUA 1M1KO 4O0IA 3M5RA 4HUGA 3OY9A 5JLFA 3H1QA 3V1RA 4BROA 3CI5A 4DMNA 3G0ZA 1V4SA 4B1XB 5AQSA 1Q9YA 3N4PA 5MLCQ 3B6PA 2F7TA 3CQ8A 3H1VX 1VSDA 2J4RA 1XHXA 3C7NA 3OBWA 3QICA 3VQPA 4KI6A 2ASOA 4CECA 3H3OB 3EZ5A 1RT3A 1NGFA 3QMLA 5JICA 2IC3A 3C0BA 1QZ6A 3HVTA 2HBJA 3D2FA 2Q0UA 2A42A 4ISFA 3LPTA 1KXPA 3HTVA 5H1SQ 3OHRA 1EP4A 4A62A 5TKWA 4IJNA 4WQ4A 3M3ZA 1BA1A 3HM9A 3VQQA 3C6UA 3HL8A 4OGEA 4NCAA 3CCRN 3ENHA 5EVZA 4O8UA 3AA2A 2O4GA 1B9FA 1SQKA 3RSEA 4BR0A 1NJXA 3DRPA 1JLBA 3O4NA 4H4OA 3VEZA 3RMBA 2O8BA 1JCGA 4DQQA 1VSHA 1RT1A 1MDUB 3O80A 3ULEB 3O4WA 2ZQBA 3D0PA 4FJGA 3O3HA 2PZSA 3SAHA 2W41A 3SLCA 2P9IB 3FGUA 4DV2K 2IVPA 3L8BA 3V81A 3N4QA 4QS9A 4ELTA 3QNOA 2KKZA 4CVNE 3OS0A 3WXMB 3R6MA 1HYZA 3AVNA 2XY8A 3F9MA 4FOIA 3J81O 3VQDA 4IOAL 3AO3A 4F4KA 2GTDA 1NK8A 2YHBA 1C0GA 4K42A 3I0SA 1J54A 4EIAA 3VF4A 1KC8O 1RFQA 1GLJO 4LF4K 3NMUA 2YKMA 3CC2N 4MLHA 4FLZA 2R7YA 2YV0X 4CE9A 1Q9XA 2YNGA 5DM6L 2HF4A 4O44A 4RG8A 2HNYA 3FZHA 4H5NA 4CJEA 3SPZA 2F8SA 1NGDA 3OYLA 5HBMA 3G10A 1J9AA 2E2NA 3AO2A 4EP4A 3BZCA 3KLGA 5M1OA 4C1NI 4HHTA 5AR0A 2ZWHA 2P9IA 3O5BA 3DXKB 3MEDA 5AQTA 3NE6A 4DV6K 3SJHA 5GAGP 3J7ZO 1O13A 4CIEA 3L2WA 3BEXA 1WSIA 1V4TA 3ID6A 3OYGA 2GWKA 4FSVA 4W5QA 3SCXA 2H3GX 2VWBA 4CZMA 3D45A 4IWVA 3QEXA 5AQQA 3DWLA 1NKCA 1VQ6N 2DFHA 3NF9A 4IOXA 4RW8A 1IBKK 4BR2A 5CZ2A 3BUZB 2HVHA 4Z4HA 4DSFA 1NK6A 4QAGA 1NK4A 3HP6A 3M8PA 1QSLA 4H03B 2OTJN 4AHSA 3VESA 3HP9A 3NH2A 1QVGM 3OBYA 4FLTA 3SAFA 1ZC6A 5KPRA 1BI4B 3DLEA 4ZHRA 1N8RO 1KAXA 3NH0A 3BZKA 3WUHA 2D0PA 3O9RA 2QK9A 3FR0A 1YXQA 3PIOL 4CFAA 3TARA 1MA9B 3DXKA 3VGMA 3RR7A 2B4JA 4E1MA 4X65K 3IS9A 3FFIA 3KKSA 4PY5A 2ASMA 2PAVA 5E84A 2P5OA 4NCBA 2Y1IA 5LJWA 4JS5A 1WSEA 3OJSA 3NVMA 3ALYA 4FW1A 4GMJB 5SWMA 1ITGA 5HLFA 4DFKA 4IJAA 3OYNA 1N5YA 1DKGD 4CFDA 4BVOA 3AARA 3PV8A 4AHTA 1QS4A 3M8QA 3ZT0A 1ZBFA 1K8KB 5BRHA 2E6LA 4EP5A 1XC3A 3K0SA 4OKJA 1JL2A 4CZLA 3V9ZA 3ULEA 3PX4A 3K5OA 3AA4A 4H0XB 3SBTA 4EZ9A 4IXCA 4CHYA 3QFUA 1EKEA 1C1BA 3VETA 4JI2K 3LL3A 4B1UB 5C15A 5C12A 2O8EA 3NF8A 3QERA 5AQGA 3LDPA 1S1TA 1S22A 4CZJA 1HYSA 5GADP 1IKXA 3G25A 2HHVA 1R59O 3CQYA 1P90A 3CJBA 4FOEA 4CJFA 4ELUA 5HRPA 4O5BA 3OS1A 3ZSRA 3AVIA 2HW3A 1BQMA 3C6HA 3BF3A 2RF2A 3MX2A 4CESA 2PBDA 3M8RA 1VSKA 3AGRA 1BA0A 3OS2A 4CJ4A 1N34K 3D2FB 4PKHA 3AVBA 3TWHA 3HZ6A 3EO3A 1GLLO 3A8YA 2V51B 4DB3A 2QXLA 1RILA 5I42A 2OCEA 4CJKA 1W97L 1RT2A 3MN9A 3TR8A 4KBOA 1BCMA 3CPEA 3VN5A 4DV1K 1U4BA 1SUQA 4QCLA 1L3TA 2P9NB 3GL1A 2Z1GA 4OGCA 5C0YA 5HP1A 2D0CA 4CZEA 3CIPA 4W5TA 1ILYA 3CC7N 1T6DA 3OYHA 4C8OA 3O4QA 1UA0A 4B3TK 1I94K 4NB4A 1X9SA 4LC9B 3H3NO 4BRNA 1YJNN 2IGIA 3WNGA 2YNHA 1BOTO 2V52B 4I2QA 4ISEA 2JWLA 1KQSM 2W40A 1ASVA 4RCHA 2OPPA 4JKDA 1WNSA 4PL7A 1TV6A 3VPZA 1SZ2A 4DTPA 4PQUA 2V7YA 4CJVA 4JK9A 3E66A 3K58A 4CHPA 4GKJK 2JWKA 1LWEA 1NJZA 4DQSA 4IBNA 4JKFA 5BRFA 1CZAN 4IDHA 3AO4A 3HK2A 3P5JA 1N6QA 3RTVA 2QWPA 2VYPA 5BN9A 4MLEA 3K57A 5KI6A 3IG1A 4GW6A 3W0LA 3RR8A 3ZSOA 3AAPA 2GWJA 4CJPA 3P1GA 2P9KB 4ILJA 4HTLA 1QQMA 4B9SA 1HJOA 4DG1A 2QEXN 3HOSA 2XY7A 4QOZB 4LF8K 4CGDA 3ZSVA 3AA3A 3EKSA 2X6NA 1XNQK 1X9JA 3U3YA 4DKWA 5J1EA 3SUOA 5B8HA 4ILGB 3QEIA 4WQ4C 3A5LC 3RMDA 4F2SA 3MN5A 3PIPL 1HNZK 1NU0A 4CJ3A 4KTWA 3KWGA 1XNRK 1NKEA 3PSFA 1E4GT 3HO1A 4H5WA 3R9PA 5F0XA 1D5AA 3UB5A 2D5RA 3D7EO 4CF0A 4M3RA 2CGKA 4E3SA 4M3UA 3LWMA 1U2VA 2P9SB 4BG9A 4CGFA 2YI1A 4I9LA 3I33A 4OLAA 4E89A 2BGGA 3F9KA 4MDBA 2NRRA 4HCBA 2IOCA 1RTHA 1LW0A 3L0QA 3R1XA 4DTJA 2KW4A 3HPHA 3L6QA 2P9LA 1Q18A 5CYQA 3ZSYA 1YJWN 3I8BA 1I3AA 3SQ0A 2FLOA 1YTUA 4JHDB 4IO9L 2OA8A 4LH5A 3CC4N 3NBPA 3NF6A 4R5PA 4F3TA 1DEJA 4A59A 2JGUA 2FF3B 4IKFA 3A5MC 3ZLJA 2E1YA 3NDKA 3EKUA 1JXBA 1S1WA 4FLUA 1RTDA 3FZFA 4B3MK 1VQ5N 1OVYA 4DUYK 3S3NA 4KB1A 5DMRA 3CCMN 1RBRA 4BR9A 4CBWA 1FK9A 4E19A 2DFFA 4PA1A 4DV7K 1JLCA 3BF1A 2Z1JA 3VTIA 4FJXA 2CGJA 3CCVN 3P31A 1RBSA 4CK2A 1WAJA 3AVHA 3TTDA 4CEDA 4F3OA 4B08A 4BRFA 4EHTA 2ITGA 3QETA 4DR3K 4JI1K 3KK2A 1EX4A 5GAHP 4CEQA 1ZYQA 1JLFA 2Q31A 4FZZA 2FSJA 3J80O 3K9JA 2QWLA 1Z05A 1YT3A 2X6SA 4A5AA 3AVKA 1D4XA 4YOWA 3OJUA 2GEMA 3DXMA 1E3MA 3AA5X 1A5VA 4K43A 4EZ6A 3MXMA 4H0YB 3MCPA 3CHWA 4KI4A 4YORA 4CD1A 2DFEA 3TAQA 5IWAK 3ITHA 1BGXT 3CJCA 3OA9A 4DQRA 4CHNA 4CF1A 1U2VB 2P9SA 3QEVA 4FJ8A 4CJQA 3VQ5A 4YOXA 4BC3A 5BRDA 4KREA 4AM6A 3CMAN 4GV9A 1WB9A 1NGHA 2IAJA 5AZJB 3TSUA 4CHZA 3CETA 5ELZA 3IDHA 3BGRA 4OPAA 3OYKA 3DLRA 5AQKA 4CEBA 3LALA 1XMOK 2OANA 1NJIO 4H0VB 3DLLL 1A5WA 1R0AA 3AVAA 1QQNA 2WC9A 3MK6A 3PX6A 2FSNA 4E7HA 2NRZA 3B6OA 1QQOA 3KWIA 1SS6A 3V9UA 1D9FA 4XH1A 5JLHA 3P38A 4BDPA 3BDPA 3AVMA 4FJMA 3DJCA 1HKBA 1YHQN 3LZJA 3FZKA 3QEWA 3EN9A 2O8EB 4XEIA 3OYEA 2CH6A 4E7IA 3QFPA 1NGGA 2HF3A 3ID8A 1NGEA 4KFBA 2A1SA 3HSTB 4KHWA 1S9GA 4KH5A 2ASPA 5AQLA 4BRAA 4CEAA 2FBTA 3VEWA 3GDQA 3LAMA 1NKBA 1N36K 1XUPO 3SUNA 2UXDK 1RGIA 2YX6A 2VQEK 2YCHA 1LOTB 3F2KA 2HBLA 1YITN 3JYTA 3GOIA 2F8TA 4IG3A 3L2VA 3P83D 1U45A 1HKGA 4WYBA 4CFCA 3UKRB 1HNXK 4IO8A 4N56A 1Q81O 3QLHA 3OYFA 4A61A 3ULDA 4N47A 4DR6K 4CCHA 5CR4A 5TKYA 3RWUA 1LWFA 4CZFA 2NLXA 2W6LA 4B9NA 3LZIA 4GVMA 4LH4A 3KZBA 4X62K 3THXB 3LANA 4FJ5A 4FLYA 4UY8O 5EXWA 1U6ZA 3CF5L 2E20A 1VHXA 2G8IA 4Z4FA 3IAYA 5BN8A 5AQXA 1T03A 4BRGA 1IO2A 4IEIA 4V19S 4M63C 4KHSA 3DLBA 3PUFA 4CZKA 3TI0A 2Q3SA 4CHOA 3UKUB 5AQIA 5DK5A 4RW6A 4B1ZA 4DU4A 3I55N 3UKRA 1A5XA 4BC5A 4H5VA 4C1NK 1JLQA 1O1WA 2QW9A 4JK8A 1BDGA 2P9UA 2QXFA 4LF9K 5K14A 3V1OA 4MO4A 1KD1O 2KZZA 4IDKA 3A2FA 2HHQA 4J2DA 3SUQA 3DLHA 4I7FA 5M1QA 4CGJA 4E7JA 4FJ7A 2D1KA 3LWLA 4E1JA 4KHQA 5AQPA 4IEEA 1OH5A 3QEPA 4X66K 4JD2A 2NZTA 4CEEA 4CJLA 3CCEN 1L3VA 4WFNL 3RMCA 5AQVA 4FXDA 1IG8A 3LP3A 1I39A 3CFRA 3CJ7A 2O8FB 5AQJA 3Q7BA 3VA3A 2NRXA 4E1NA 1T44A 4FWQA 3ZSWA 3K2PA 2E4LA 1NK7A 1IH7A 3QIPA 3T3FA 4GVEA 1TKTA 1J53A 2E2QA 4IG0A 2KFNA 3ZT2A 3DI6A 2OTLN 2VGNA 2YJFA 3O1WA 2P51A 4YOTA 3ZETB 1WSFA 3SQ4A 3JS6A 4CJTA 4A2AA 3MWTA 3ZX0A 5FLXO 1N32K 4DS4A 1J5OA 4JNEA 5CY4A 5AZJA 3LDOA 1KVAA 1U49A 4KTZA 4LFBK 4FPBA 1KTQA 4CGHA 3CJ9A 4IFEA 4Q5VA 1C6VA 4BRIA 2HBMA 1NNEA 4C23A 2ZGZA 3WQTA 4BVPA 5C10A 4GKKK 2F9TA 5C2DA 5M1FA 4RW7A 3SBGA 1D9DA 1ATRA 5FROA 2UUBK 1BCOA 3O6WA 4FM0A 1VQPN 1ZBIA 4JD2B 3HI0A 3IRXA 3OYBA 4JHDA 5AFUA 3ZEUA 3C6TA 1RDDA 1G15A 3AVCA 2IS3A 1ZBUA 2D4WA 3FZMA 2GV9A 1S6QA 4YDUC 1TK5A 1BI4A 3KHYA 4JS4A 3QBXA 2ITMA 1TK8A 2YKNA 3E9OA 3D2EB 4FWNA 5I9EB 5JVGL 3J7AP 1SL0A 3I0RA 4B8CA 4W5NA 4CF9A 3WEEA 2RN2A 3SK3A 1HKCA 4FJ9A 3T1YK 4FJLA 3K5LA 1HPMA 2KQ2A 1X9MA 3NFAA 5FRNA 4X64K 1VQMN 1VQLN 1NK0A 3HPOA 4ISGA 2HB5A 5J2QA 5AQFA 1IKVA 5BR8K 4DV0K 3KD1E 4BY9C 3CPWM 2YHAA 1JKHA 4MFBA 2I7NA 4HWIA 2V7ZA 2B6AA 2KLAA 3T1AA 3A5OC 4KHYA 4AHCA 4B3OA 1HQUA 1NGCA 4DR5K 1TKXA 5AQUA 3O3FA 1Z25A 1L3SA 2AP1A 2KFZA 4BRMA 3HBTA 4KKOA 4NCGA 3ZETA 3NGYA 3ZEUB 1FJGK 1LWCA 2QI2A 3OTOK 2VQFK 1SV5A 2O8DB 3ATUA 3CXCM 4AF1A 2UXBK 3TPQA 2QKKA 4DFMA 5AQZA 5HRRA 1LV5A 1WSGA 2WFBA 4Y1CA 3EY1A 1W0HA 1ZXOA 4KPYA 2QWQA 4CFBA 2FC0A 3WXJA 3K5MA 3MCAB 1S1UA 1VQ8N 1GLFO 2E2PA 3P4IA 1MU2A 2P9UB 3O9SA 4CBXA 2E88A 4OVLA 4YOVA 1HNWK 4CK1A 2BE2A 1TAQA 5KQDA 4WQ5C 4RTFD 3S3OA 1K9MO 1S9EA 3FZLA 1IKYA 3OYJA 2WTUA 3VEVA 2GUPA 4JI0K 2XY6A 2X74A 4BRPA 3QDKA 3THYA 1NMNA 1Q8IA 3VQ9A 1C0UA 1X1PA 1TKZA 3ZT3A 4M3XA 4DR7K 2YHYA 3K59A 4M3WA 3KK3A 4FJIA 4KO0A 2B5JA 2HNZA 3G6EN 4B8AB 2UUCK 4M7YA 4NLBA 4B9UA 1QVFM 3DMJA 3SV3A 3VQCA 4BWJA 4CGIA 1S1VA 1VSFA 3AO1A 4K41A 1HNIA 4DSLA 4DR2K 1Z26A 3M6GA 1JLGA 1JXEA 4BC2A 2QWNA 4LFCK 2Q2RA 1NGIA 1JLAA 1T6CA 4EAHD 4B9QA 1KCFA 3O9TA 3QBWA 1EWRA 2RKIA 4IFVA 3HXMA 4HTUA 4H4MA 4FK2A 4M3ZA 3WNFA 5KQ8A 4KHNA 1U48A 1KRPA 3MDQA 2VG5A 3QB0A 4DSEA 4W5OA 3LP2A 1RNHA 4FL9A 1SKSA 4F9OA 2O8CA 4DTSA 4AHRA 1YI2N 2EWSA 2PFUA 1L3UA 4LFAK 5M1KA 1T8EA 2NRWA 5GIOA 3HT3A 2AJQA 4EHUA 4K8XA 4OKKA 4BG8A 4O0JA 4BQLA 5KGWA 1IV0A 5BPNA 1KFSA 2KHOA 2YNFA 4CJ5A 1BO5O 3T19A 2FBYA 3L3UA 3CCQN 2P9PA 3U4LA 1YIJN 1RCHA 1S3XA 4DSJA 3E9LA 2P9NA 4XH5A 5AQOA 4JKHA 2A5XA 2BTFA 1TYQA 4FO0A 4E7LA 1VAZA 4O8KA 4R79A 4E0DA 5HOOA 4FWOA 4PWDA 1F21A 4JLHA 1RDUA 4CK3A 3EL2A 2VGMA 3U9DA 5LJVA 4DLEA 4M41A 1WAFA 5HL7L 1Q7YO 3CCLN 4CIFA 3NGIA 4Z4GA 3VEOA 1TYQB 1VRTA 3AVLA 3R8EA 2P9KA 5C42A 2OZSA 2AA4A 1RTIA 1XMQK 3C94A 4CGGA 3A5NC 3TSQA 4Q0BA 3VQ6A 4XIUA 4DTXA 4CIGA 4DCHA 4DQIA 2P9PB 2X78A 5HRSA 4Z4IA 4H5RA 1E4FT 2RPIA 4JK7A 4DR1K 4PHTX 4FCYA 4BDZA 1WLJA 4NYFA 3V1QA 2BANA 1KLNA 3R3LA 4WCEL 1FXXA 2XHBA 2ZGYA 3KLEA 4DV3K 3EE9A 3QO9A 3DXMB 3ASMA 4F8RA 5M1PA 4FW2A 3VQ8A 5T7BA 1IKWA 1WSJA 3PO4A 5E26A 3K9KA 1XI1A 4A57A 4DTUA 4E7KA 1GOBA 3RRGA 1W7AA 2W42A 1CLQA 2EHGA 4DQ8A 3CJ1A 3DM2A 1RT7A 2XRIA 1ESVA 3LM9A 4MO5A 4FK4A 1NBWA 1VQ9N 5KPTA 4PKIA 2FF6A 4I6MA 5KRSA 2A41A 3WNHA 1NWKA 1QHTA 1QHAA 1QSSA 4K8ZA 3HVRA 4N5SA 4OX9K 2E2OA 1VQ4N 4OPKA 2VG7A 5EOYA 2NRVA 3THXA 1L5UA 3S3MA 3T7ZA 4DFPA 1JL1A 3PSIA 4O5FA 4C8LA 1DT9A 3H6EA 3WT0A 2ZJQL 5JMVA 5CZ1A 1ASWA 5BPMA 3S41A 2PYJA 1VSLA 1YUWA 1EXQA 4BE2A 5C24A 2HHHK 2HHTA 3SMPA 4DTMA 3DOLA 1C0MA 2O4IA 4N76A 2O8DA 4CW7B 1GOCA 4CBUA 4KAZA 4CJRA 1YTAA 3ZX3A 3U6FA 3LP0A 4HUFA 2HMIA 4K0KK 3THVA 3Q7CA 4FWSA 3SJJA 3HSCA 5AQMA 1ZBHA 1VSJA 1LW2A 3VQ7A 2CH5A 1EQYA 5AFUH 1H1VA 5GAEP 4W5RA 4C8NA 4CJ7A 1VQNN 3VEYA 3D6RA 2VCPA 1IBMK 5FPEA 2WOMA 1HLUA 1TAUA 4BRDA 4FVMA 3LM2A 5AQWA 2A3ZA 3CQXA 3O9UA 4DHYA 3MECA 5D3GA 4BACA 4CJWA 2UYTA 2IDOA 5A2QO 2HHUA 3O8MA 1TVRA 1VK0A 4TSXA 3WXLA 3BY5A 4FJNA 2OYQA 1REVA 4F2RA 4M3TA 1RT5A 1C1CA 4QS7A 2QM1A 1DLOA 2I7PA 3MWPA 3G4SN 3EEQA 1S1XA 1NK9A 3JAMO 3U8XA 4BDYA 2O8CB 3TTCA 1GLAG 4G9ZA 3L2RA 4M3YA 3ZYYX 4YFUA 4WFAL 2D0AA 1CZ9A 3UKUA 4BREA 3H45C 3MXJA 4FWRA 1HR0K 4KH6A 4GV6A 4BGBA 5LY3A 2E5LK 2Q36A 4H0OA 1Y97A 3MX5A 3THWA 1DTTA 4OPHA 1S72N 4LSLA 2NRTA 3VA0A 1OH8A 3L3VA 3SMSA 5CE3A 2YHXA 1GLBG 1DTQA 3QIOA 4BGAA 2ZJRL 1NK5A 4J8FA 4CD3A 5LL6Z 1RDCA 2A6AA 4NXMK 3JSMA 3SYZA 2GUIA 3VF6A 4FM1A 1HNVA 3VERA 4NXNK 5AZIB 4KRFA 2PY5A 1KAZA 3J7YP 4JKGB 1QZ5A 1TUYA 2ETJA 1KFDA 4L3QA 1HUXA 1Y64A 1XC9A 3VQ4A 3MN6A 2GX9A 1JLEA 4NLCA 3IMXA 3DRSA 3JXUA 2YHWA 2Q1NA 3V9XA 4B9MA 5AJ3K 3TSPA 2I5JA 4KV8A 4H8KA 3CFOA 2F96A 4GNIA 1G99A 4FJHA 1KSPA 3SZ2A 2KTQA 4BR5A 3MAQA 1B92A 2VG6A 1YAGA 3S9HA 2IVOA 2UU9K 4JI6K 2O8BB 2OPQA 5IT9O 4YOUA 3H08A 3ZT1A 2ZM6K 4IOCL 4CEOA 3AVJA 3KKRA 2G8UA 5F2RA 1QE1A 1W2BM 3LPUA 2E8AA 1WN7A 2WUSA 4CEZA 1M90O 1SKWA 3VQBA 3QNNA 3PY8A 3ENOA 1BISA 1GLDG 4I6MB 3CFPA 1SL2A 3L4IA 1EETA 4HVJA 2HMPA 3O08A 2PYLA 3L2UA 2KZMA 1VSEA 1OKJA 3VQEA 5JVHL 1IG9A 1Z6RA 3SV4A 3CJAA 4PKGA 3KVGA 5LMNK 4FJKA 5KGXA 4B1VA 3MEEA 2VWJA 4U7BA 4WE1A 4IZ9A 3U9ZA 4OLBA 3AV9A 1BWFO 3A0IX 3B8AX 1KVBA 3DRRA 1WSHA 3TAMA 4WQ5A 2QKBA 3GBTA 3ATVA 3AVFA 3HPGA 3KJVA 1WOQA 1YF5L 4CJSA 4JV5K 1MWKA 3ENBA 3VTHA 5CHIA 3VGKA 3ZT4A 4FWMA 4DTNA 5KTQA 4I2PA 3L4QA 2Z1IA 4FWKA 2DY4A 5AQYA 3GE1A 4PUOA 1BU6O 1BQNA 1Q86O 4FLWA 4J2EA 3SQ1A 1GLEG 3H46O 2FBXA 1K73O 2W6KA 3CCJN 4JKBA 4U67L 2G8FA 3MEGA 1OH6A 2E1ZA 4Z94A 2F9WA 2ZF5O 5CYMA 5AZIA 2HOEA 3EE8A 1YVNA 3WXKA 4CZHA 1XWLA 3LAKA 1MWMA 2G8HA 4MQ3A 4OO1J 3EYZA 4KHUA 2QWRA 3RVCA 3T1HK 5AQHA 1X3MA 4OPJA 2HVIA 4BE1A 4RW9A 4Z0UA 3KLHA 3I8DA 1KAYA 2QTDA 1WBDA 3NH1A 3L2QA 1SAZA 1RDBA 1VQ7N 4NYNA 4QS8A 5FPNA 2GBZA 1CZBA 3ISNC 3VENA 1TL3A 5C25A 4PL8A 3CCUN 5SZTA 4CEFA 2FXUA 1OH7A 4B1YB 3J8AA 2ZD1A 2QA4N 3FLCO 3WQUA 1BHLA 4JI4K 4BRCA 3O1BA 3HJFA 4DV5K 5BPLA 1U47A 1QSYA 3MXIA 1LCUA 4J2BA 3V9WA 4G1QA 4BE0A 2D0BA 3TAEA 4JKCA 1RBVA 3WEEB 1CXQA 3KTQA 3CYMA 1GLCG 3MN7A 3OVNA 1EO1A 4WFBL 4B3RK 1YVUA 4AHVA 3EZWA 1EWQA 1NGBA 2OPSA 4HUEA 4H0PA 3O3GA 2G8KA 1XHZA 2UUAK 2ZJPL 4DUZK 1UOCA 3TAFA 3NVKA 4WF9L 4NO7A 4JRPA 2O8FA 4EFHA 3WXIA 4UQGA 1P8ZA 3DLKA 1K8KA 3CM5A 1NG9A 4YHHK 3V9SA 5KPZA 1J6ZA 5AQRA 1RT6A 2ZE2A 3KK1A 4A5BA 3FE1A 2WBNA 3VEXA 3CM6A 3LDNA 3K5NA 3U3GA 4BC4A 4BR4A 3OW2M 3T69A 4JEPA 1YJ9N 1VQKN 3VMFB 4H5TA 3QESA 3AGKA 2HBKA 4ICLA 4ZTFA 1FKPA 3C6AA 4FZXC 5GINA 1BIUA 4ZTJA 4JKAA 4ELVA 3CG7A 1SL1A 1SKRA 4RWTA 1HJRA 4DS5A 1RBUA 3HOTA 2XO7A 3PO5A 5ADXA 1LAWA 2A40A 3DYAA 1NGAA 4DF8A 4DLGA 1TL1A 4GV3A 1RTJA 4FPAA 5ADXH 1Q82O 5HROA 3E01A 4C8MA 3CCSN 1HRHA 1U04A 3LDLA 1BUPA 2G8VA 4LF6K 2BH1A 3TANA 4FWPA 3IKMA 4CI6A 2IVNA 2OZMA 1JCFA 5EU7A 3NCIA 2DTUA 3TAPA 1LAVA 1VSIA 1T05A 3AAQA 4AH9A 3SI6A 5E41A 3IFRA 5I3UA 2E6MA 1QTMA 1IBLK 4H0TB 3KLIA 2GELA 2NRHA 1NOZA 5EY4A 3HM8A 5DM7L 3SUPA 4ID1A 4YOYA 1C1AA 1HPZA 3M8SA 4FM2A 5KRTA 4N41A 3E9PA 1WBBA 4DTRA 4JI7K 4BRKA 1VQON 4CZGA 1ZBSA 3TABA 5F1XA 4XH4A 4BR7A 1S5JA 4B1WB 4FZYA 1RT4A 4YNQA 2VWKA 4KHPK 3THWB 1GOAA 1W9HA 3MMVA 3TU5A 3ZSZA 3C7NB 2BUPA 4K25A 4B9LA 3SNNA 3NHGA 4LD0A 1QQCA 2F4VK 1TGOA 3DLGA 4CERA 1VSMA 5HRNA 3DOKA 1K8AO 4LF5K 2Q97A 5J2NA 5BREA 2HHSA 5EX5A 3F73A 2OPRA 3SAGA 1C0TA 3OYAA 1BIZA 1S6PA 4RW4A 2NUBA 4FWLA 4AHUA 1XQSC 3CERA 1TUUA 1HX1A 3C65A 2NNWA 5BR9A 4KB0A 4FK0A 4BQZA 3G71N 1B9DA 4CJUA 5FPMA 1UA1A 5JS1A 1HQEA 3KIOA 4JKEA 3IUCA 1NMDA 2QWOA 3NF7A 1RDAA 4IFYA 3UE5A 4YDUA 3V4IA 3HRGA 3SPYA 3PX0A 4JN4A 4LSNA 2CGLA 2WONA 2Y1JA 3F5TA 4DF4A 3ZSXA 4AILC 1T3VA 4Y1DA 1C0FA 3V6DA 4DSIA 1UWBA 2FSKA 3ZX2A 1ASUA 4CF2A 3FFKB 4Z4EA 1HYVA 2Q0RA 4AM7A 2YNIA 5J2MA 3RMAA 5J2PA 3E1YA 4FJJA 3OYIA 1NM1A 5LMUK 2P9LB 1DGKN 2RHKA 1CXUA 4DV4K 2EX3A 3P39A 2D0OA 2HNDA 3BP8A 4M7XA 4BRLA 3NAEA 4DU3A 4FVUA 4JYAK 4B3SK 4JRQA 4I9QA 4JI3K 3QINA 4DTOA 4DR4K 2IIRA 1IJJA 2HSTA 2RE2A 1J5EK 4BWMA 1OVQA 3THYB 3KK7A 4Z4CA 1FW6A 1BG3A 3C95A 5FDLA 3TAGA 3AVGA 3LDSA 1N33K 1KLMA 1K6YA 4KH4A 2P1JA 4DQPA 4J2AA 4JI5K 2P5GA 4DWIA 4OJRA 4CZIA 1WUAA 1X9WA 4HCCA 3O9QA 4Y0WA 3AO5A 2HHWA 4BRQA 1ATNA 4DSKA 4M42A 3DAWA 2ATQA 2G8WA 1UAXA 4CHQA 4FLVA 3CD6N 3LP1A 1TKDA 5C2FA 1NOYA 1JCEA 4LF7K 2UXCK 4JI8K 4M45A 5AQNA 2BDPA 3HYFA 5JS2A 4C8KA 3M1FA 5FPDA 1NJWA 2Z1HA 3OYMA 3SQ2A 1NGJA 3D2EA 4O4GA 3OYDA 4GY2B 5GIPA 4FLXA 1TK0A 3UIQA 4DU1A 4KTQA 4FYDA 1X3NA 4O55A 4ILHA 4A2BA
chains in the Genus database with same CATH topology
3MAQA 2XY7A 1B92A 2VG6A 3S9HA 2YHAA 4QOZB 1KVCA 3OYCA 2OPQA 1JKHA 3H08A 1RBTA 4MFBA 3ZT1A 3ZSVA 4CGDA 3AA3A 3ZCMA 4ID5A 2X6NA 4CEOA 1T7PA 2B6AA 3T1AA 4KHYA 3AVJA 4AHCA 3KKRA 2G8UA 3U3YA 4B3OA 1HQUA 5J1EA 1QE1A 2A1RA 4LY7A 3LPUA 3SUOA 3ZSQA 1WN7A 4CEZA 3KD5E 1TKXA 3O3FA 3QEIA 1Z25A 4B9VA 1L3SA 1SKWA 3RMDA 3VQBA 3QNNA 4F2SA 3PY8A 2KFZA 1BISA 4KKOA 1NJYA 3CFPA 4NCGA 1SL2A 5FRMA 4OKEA 3NGYA 1EETA 4CJ3A 4HVJA 1BL3A 4L8RB 1LWCA 4KTWA 2PYLA 1NKEA 1SV5A 3L2UA 2KZMA 1VSEA 3VQEA 2JLEA 3NGZA 2QKKA 4DFMA 1LV5A 5HRRA 1IG9A 3HO1A 3SV4A 2XY5A 3VQAA 1D5AA 4CF8A 2D5RA 1WSGA 4CF0A 4FJKA 4M3RA 5KGXA 4Y1CA 3EY1A 1W0HA 3KLFA 4DFJA 4M3ZA 3MEEA 2VWJA 4E3SA 4M3UA 4WE1A 3LWMA 4B9TA 4KPYA 4CFBA 2HHXA 2FC0A 3K5MA 1ZBLA 4OLBA 3AV9A 4CGFA 3WNEA 1S1UA 4I9LA 1KVBA 3DRRA 3RRHA 4OLAA 4E89A 2BGGA 3F9KA 1FKOA 1WSHA 4KB1A 1MU2A 1HMVA 3TAMA 4HCBA 2IOCA 2LSNA 2QKBA 3AVFA 1RTHA 3HPGA 1LW0A 2FBVA 3KJVA 1D8YA 1VRUA 4OVLA 4CJSA 4O0IA 4HUGA 4DTJA 2KW4A 3HPHA 4CK1A 3OY9A 2BE2A 1TAQA 3V1RA 5CYQA 3ZSYA 4DMNA 3G0ZA 3ZT4A 4DTNA 3S3OA 5KTQA 4M3WA 4I2PA 1I3AA 2Z1IA 3SQ0A 1Q9YA 2DY4A 1YTUA 3B6PA 3CQ8A 1VSDA 4PUOA 2OA8A 4LH5A 1XHXA 1BQNA 1S9EA 1IKYA 3OYJA 3RR8A 3NBPA 3NF6A 4R5PA 4F3TA 2JGUA 2XY6A 3VQPA 2X74A 4FLWA 3SQ1A 4J2EA 4IKFA 4KI6A 4CECA 2G8HA 2FBXA 3EZ5A 1RT3A 3NDKA 2G8FA 3MEGA 1JXBA 1S1WA 2IC3A 4FLUA 3HVTA 5CYMA 1RTDA 1Q8IA 3VQ9A 1C0UA 1X1PA 1TKZA 3ZT3A 4M3XA 1XWLA 3LAKA 5DMRA 3KK3A 3K59A 4MQ3A 3LPTA 1RBRA 4KO0A 2B5JA 4FJIA 1FK9A 3EYZA 4KHUA 2HNZA 4E19A 2DFFA 4B8AB 4PA1A 4B9UA 3DMJA 1JLCA 3SV3A 3VQCA 4BWJA 2Z1JA 4CGIA 4OPJA 1S1VA 1VSFA 4FJXA 1EP4A 1RBSA 3AO1A 4CK2A 1HNIA 1WAJA 3S3NA 2HVIA 4DSLA 4BE1A 3AVHA 4RW9A 1Z26A 4Z0UA 3KLHA 3I8DA 1JLGA 3VQQA 3HM9A 3C6UA 1JXEA 3HL8A 4OGEA 4CEDA 3NH1A 4NCAA 3L2QA 4F3OA 4B08A 1JLAA 1RDBA 2ITGA 1KCFA 3QETA 3AA2A 4NYNA 2O4GA 1B9FA 3KK2A 2GBZA 2RKIA 1EX4A 1NJXA 4IFVA 1CZBA 1JLBA 3DRPA 4CEQA 3O4NA 1JLFA 4H4MA 4H4OA 3WNFA 3HXMA 3RMBA 3ISNC 1ZYQA 4KHNA 4FK2A 1U48A 4FZZA 1KRPA 4DQQA 1TL3A 1VSHA 5C25A 1YT3A 2VG5A 4CEFA 5SZTA 2X6SA 3AVKA 1RT1A 4DSEA 4W5OA 3OJUA 2ZD1A 3LP2A 1RNHA 1SKSA 2ZQBA 1BHLA 4DTSA 3D0PA 4AHRA 4FJGA 3HJFA 3O3HA 3AA5X 2PZSA 1A5VA 1U47A 1L3UA 1QSYA 3MXIA 4EZ6A 3MXMA 1T8EA 4KI4A 3HT3A 4J2BA 3L8BA 3V81A 4ELTA 3V9WA 2DFEA 3TAQA 3QNOA 4G1QA 4BE0A 4K8XA 3ITHA 2AJQA 1BGXT 2D0BA 3TAEA 4DQRA 4CHNA 4CF1A 1RBVA 3OS0A 4OKKA 1CXQA 3QEVA 3CYMA 3KTQA 1HYZA 3AVNA 2XY8A 4CJQA 4O0JA 4FJ8A 3VQDA 3AO3A 4F4KA 3OVNA 1NK8A 2YHBA 5KGWA 3VQ5A 1KFSA 3I0SA 2YNFA 1YVUA 4CJ5A 4KREA 1J54A 4AHVA 3T19A 2FBYA 3L3UA 2OPSA 2IAJA 2YKMA 4HUEA 4FLZA 1RCHA 4CHZA 2R7YA 2YV0X 4DSJA 3BGRA 3O3GA 2G8KA 3OYKA 4CE9A 1XHZA 1Q9XA 3DLRA 2YNGA 4CEBA 1UOCA 4O44A 3TAFA 4RG8A 3LALA 2HNYA 4JRPA 4E7LA 1A5WA 2F8SA 4CJEA 4UQGA 3AVAA 3SPZA 1R0AA 4E0DA 4PWDA 3OYLA 3DLKA 5HBMA 1F21A 3G10A 3CM5A 1J9AA 3AO2A 4JLHA 3V9SA 4EP4A 3KLGA 4E7HA 3PX6A 3B6OA 4HHTA 1RT6A 2ZE2A 3KK1A 3V9UA 1D9FA 3CM6A 4CK3A 4BDPA 4DLEA 4M41A 1WAFA 3BDPA 3AVMA 3K5NA 4FJMA 3MEDA 3U3GA 4CIFA 3NE6A 3NGIA 4Z4GA 3LZJA 1VRTA 3AVLA 3QEWA 4CIEA 3L2WA 5C42A 3QESA 1WSIA 2OZSA 1RTIA 3OYEA 3OYGA 3C94A 4ICLA 4ZTFA 4CGGA 1FKPA 4W5QA 4E7IA 4Q0BA 3SCXA 3VQ6A 4XIUA 4FZXC 1BIUA 4ZTJA 4DTXA 4ELVA 3CG7A 3D45A 4CIGA 1SL1A 4DQIA 1SKRA 3QEXA 2X78A 1HJRA 4DS5A 4KFBA 5HRSA 4Z4IA 1RBUA 1NKCA 2DFHA 2RPIA 2A1SA 3HSTB 3NF9A 4RW8A 1S9GA 2XO7A 4KHWA 4CEAA 3PO5A 2FBTA 5CZ2A 4BDZA 4FCYA 1WLJA 4NYFA 1LAWA 3DYAA 3LAMA 4DF8A 4Z4HA 4DLGA 4DSFA 1NK6A 1NKBA 2HVHA 3SUNA 4QAGA 1NK4A 3V1QA 1TL1A 3M8PA 1RTJA 2BANA 3HP6A 1KLNA 1QSLA 5HROA 3E01A 4C8MA 1HRHA 1U04A 1FXXA 4AHSA 2XHBA 2G8VA 3KLEA 3HP9A 3NH2A 3JYTA 4FLTA 3TANA 3QO9A 1BI4B 2F8TA 4IG3A 3L2VA 3DLEA 3ASMA 3P83D 4ZHRA 3VQ8A 4FW2A 1U45A 5T7BA 2OZMA 3NH0A 4F8RA 5EU7A 3NCIA 4CFCA 2DTUA 3TAPA 1LAVA 1VSIA 4N56A 1T05A 1IKWA 2QK9A 1WSJA 3PO4A 3QLHA 3OYFA 4CFAA 4AH9A 3SI6A 3TARA 1XI1A 5E41A 3ULDA 5I3UA 4N47A 3RR7A 2B4JA 2E6MA 4E1MA 4CCHA 4DTUA 1QTMA 3KLIA 4E7KA 1GOBA 3RRGA 1NOZA 3RWUA 3IS9A 1LWFA 3FFIA 3KKSA 2W42A 1CLQA 4PY5A 2EHGA 3SUPA 4ID1A 4B9NA 3DM2A 3LZIA 2P5OA 4GVMA 4LH4A 1C1AA 2Y1IA 4NCBA 1RT7A 2XRIA 1HPZA 3M8SA 3LANA 4JS5A 4FM2A 1WSEA 5KRTA 3OJSA 3ALYA 4FLYA 4FJ5A 4FW1A 4FK4A 4N41A 4GMJB 5SWMA 1ITGA 4DTRA 5HLFA 2G8IA 3TABA 4DFKA 4Z4FA 5KRSA 3WNHA 1QHTA 1S5JA 1QSSA 3IAYA 4FZYA 1RT4A 4K8ZA 3HVRA 4YNQA 3OYNA 4N5SA 1N5YA 2VWKA 4CFDA 4OPKA 1GOAA 2VG7A 1T03A 1L5UA 1W9HA 1IO2A 3ZSZA 3S3MA 3PV8A 4DFPA 4KHSA 4AHTA 1JL1A 1QS4A 3M8QA 3PUFA 3TI0A 3ZT0A 3DLBA 1ZBFA 4C8LA 2Q3SA 4CHOA 4B9LA 2E6LA 5DK5A 3SNNA 3NHGA 4RW6A 4EP5A 5CZ1A 4LD0A 1QQCA 1TGOA 3DLGA 4OKJA 1JL2A 3V9ZA 4DU4A 3PX4A 4CERA 1ASWA 1A5XA 1VSMA 3K5OA 5HRNA 2PYJA 1VSLA 3AA4A 3DOKA 1EXQA 4EZ9A 1JLQA 5C24A 1O1WA 4BE2A 5J2NA 2HHSA 3F73A 2HHTA 2OPRA 4DTMA 4CHYA 1C0TA 1EKEA 1C1BA 3OYAA 1BIZA 1S6PA 3DOLA 2QXFA 4RW4A 2NUBA 5K14A 1C0MA 3NF8A 3V1OA 3QERA 4N76A 2O4IA 4AHUA 2KZZA 4IDKA 1GOCA 1S1TA 3A2FA 2HHQA 1HYSA 4J2DA 3SUQA 3DLHA 4I7FA 4KAZA 4CGJA 4CJRA 1IKXA 1YTAA 4E7JA 4FJ7A 2HHVA 3LWLA 4HTUA 4KHQA 3U6FA 4CJFA 3LP0A 4ELUA 5HRPA 4HUFA 4KB0A 4FK0A 2HMIA 4O5BA 3QEPA 3OS1A 3THVA 3ZSRA 3AVIA 1B9DA 4CEEA 4CJLA 4CJUA 1BQMA 3SJJA 1UA1A 2HW3A 5JS1A 1HQEA 3KIOA 2RF2A 1VSJA 1ZBHA 4CESA 1LW2A 3NF7A 3VQ7A 1L3VA 1RDAA 4IFYA 3M8RA 3RMCA 4FXDA 1VSKA 3LP3A 3V4IA 1I39A 3CFRA 3OS2A 4W5RA 3SPYA 3PX0A 4C8NA 4CJ4A 4LSNA 2WONA 3VA3A 3AVBA 2Y1JA 3TWHA 4DF4A 4E1NA 3ZSXA 4AILC 3ZSWA 3K2PA 4Y1DA 2E4LA 1NK7A 1IH7A 3QIPA 2WOMA 3V6DA 4DSIA 3T3FA 1UWBA 1RILA 1ASUA 1TKTA 1J53A 4IG0A 4CF2A 5I42A 4Z4EA 4CJKA 1TAUA 2KFNA 1HYVA 4FVMA 3ZT2A 3DI6A 2P51A 3MECA 1WSFA 1RT2A 2YNIA 4BACA 3SQ4A 3TR8A 5J2MA 5D3GA 4CJWA 3RMAA 4CJTA 5J2PA 4FJJA 1BCMA 2IDOA 3OYIA 3VN5A 2HHUA 1TVRA 1VK0A 1U4BA 4TSXA 4FJNA 1SUQA 4QCLA 1L3TA 4OGCA 2Z1GA 2OYQA 5HP1A 1REVA 2D0CA 4F2RA 1RT5A 4M3TA 1CXUA 4DS4A 4W5TA 1J5OA 1C1CA 5CY4A 2EX3A 1DLOA 2HNDA 4DU3A 3NAEA 1KVAA 1U49A 4KTZA 3OYHA 4C8OA 4JRQA 3O4QA 1KTQA 1UA0A 4I9QA 1S1XA 4CGHA 1NK9A 3QINA 4DTOA 4BDYA 1X9SA 4Q5VA 1C6VA 3L2RA 4M3YA 4YFUA 4BWMA 2IGIA 4Z4CA 2D0AA 1CZ9A 2YNHA 3WNGA 3MXJA 3C95A 4RW7A 5FDLA 4I2QA 1D9DA 3TAGA 3AVGA 5FROA 3LDSA 1KLMA 1BCOA 1K6YA 1ASVA 2P1JA 4FM0A 4DQPA 1ZBIA 2OPPA 3IRXA 4J2AA 1WNSA 3OYBA 1TV6A 1Y97A 2P5GA 1DTTA 4DWIA 4OJRA 4LSLA 3VA0A 3C6TA 1RDDA 4DTPA 1G15A 3AVCA 3L3VA 2IS3A 1X9WA 1ZBUA 4HCCA 1DTQA 3AO5A 3QIOA 2HHWA 2GV9A 1S6QA 4PQUA 1NK5A 4CJVA 1TK5A 1BI4A 4JS4A 1TK8A 1RDCA 4DSKA 2YKNA 3JSMA 3K58A 2GUIA 3SYZA 4M42A 4CHPA 2ATQA 4FM1A 1LWEA 1NJZA 4DQSA 4IBNA 1HNVA 1SL0A 2G8WA 1UAXA 3I0RA 4CHQA 4FLVA 4B8CA 2PY5A 4KRFA 3LP1A 4W5NA 1TKDA 1NOYA 4M45A 2ETJA 3AO4A 1KFDA 4CF9A 2RN2A 3HYFA 2BDPA 5JS2A 4C8KA 4FJ9A 3P5JA 4FJLA 3K5LA 1XC9A 3HK2A 3VQ4A 1JLEA 1NJWA 2KQ2A 2Z1HA 3OYMA 1N6QA 3DRSA 3SQ2A 1X9MA 3NFAA 3RTVA 3K57A 3V9XA 4B9MA 5FRNA 5KI6A 3IG1A 4O4GA 4GW6A 3OYDA 2I5JA 1NK0A 4KV8A 3ZSOA 4H8KA 4CJPA 3CFOA 2F96A 3HPOA 4FLXA 1TK0A 3UIQA 4DU1A 3P1GA 2HB5A 5J2QA 4KTQA 4FYDA 4FJHA 1IKVA 1KSPA 3SZ2A 4O55A 4B9SA 2KTQA 3KD1E 4DG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAQ A;  2XY7 A;  1B92 A;  2VG6 A;  3S9H A;  2YHA A;  4QOZ B;  1KVC A;  3OYC A;  2OPQ A;  1JKH A;  3H08 A;  1RBT A;  4MFB A;  3ZT1 A;  3ZSV A;  4CGD A;  3AA3 A;  3ZCM A;  4ID5 A;  2X6N A;  4CEO A;  1T7P A;  2B6A A;  3T1A A;  4KHY A;  3AVJ A;  4AHC A;  3KKR A;  2G8U A;  3U3Y A;  4B3O A;  1HQU A;  5J1E A;  1QE1 A;  2A1R A;  4LY7 A;  3LPU A;  3SUO A;  3ZSQ A;  1WN7 A;  4CEZ A;  3KD5 E;  1TKX A;  3O3F A;  3QEI A;  1Z25 A;  4B9V A;  1L3S A;  1SKW A;  3RMD A;  3VQB A;  3QNN A;  4F2S A;  3PY8 A;  2KFZ A;  1BIS A;  4KKO A;  1NJY A;  3CFP A;  4NCG A;  1SL2 A;  5FRM A;  4OKE A;  3NGY A;  1EET A;  4CJ3 A;  4HVJ A;  1BL3 A;  4L8R B;  1LWC A;  4KTW A;  2PYL A;  1NKE A;  1SV5 A;  3L2U A;  2KZM A;  1VSE A;  3VQE A;  2JLE A;  3NGZ A;  2QKK A;  4DFM A;  1LV5 A;  5HRR A;  1IG9 A;  3HO1 A;  3SV4 A;  2XY5 A;  3VQA A;  1D5A A;  4CF8 A;  2D5R A;  1WSG A;  4CF0 A;  4FJK A;  4M3R A;  5KGX A;  4Y1C A;  3EY1 A;  1W0H A;  3KLF A;  4DFJ A;  4M3Z A;  3MEE A;  2VWJ A;  4E3S A;  4M3U A;  4WE1 A;  3LWM A;  4B9T A;  4KPY A;  4CFB A;  2HHX A;  2FC0 A;  3K5M A;  1ZBL A;  4OLB A;  3AV9 A;  4CGF A;  3WNE A;  1S1U A;  4I9L A;  1KVB A;  3DRR A;  3RRH A;  4OLA A;  4E89 A;  2BGG A;  3F9K A;  1FKO A;  1WSH A;  4KB1 A;  1MU2 A;  1HMV A;  3TAM A;  4HCB A;  2IOC A;  2LSN A;  2QKB A;  3AVF A;  1RTH A;  3HPG A;  1LW0 A;  2FBV A;  3KJV A;  1D8Y A;  1VRU A;  4OVL A;  4CJS A;  4O0I A;  4HUG A;  4DTJ A;  2KW4 A;  3HPH A;  4CK1 A;  3OY9 A;  2BE2 A;  1TAQ A;  3V1R A;  5CYQ A;  3ZSY A;  4DMN A;  3G0Z A;  3ZT4 A;  4DTN A;  3S3O A;  5KTQ A;  4M3W A;  4I2P A;  1I3A A;  2Z1I A;  3SQ0 A;  1Q9Y A;  2DY4 A;  1YTU A;  3B6P A;  3CQ8 A;  1VSD A;  4PUO A;  2OA8 A;  4LH5 A;  1XHX A;  1BQN A;  1S9E A;  1IKY A;  3OYJ A;  3RR8 A;  3NBP A;  3NF6 A;  4R5P A;  4F3T A;  2JGU A;  2XY6 A;  3VQP A;  2X74 A;  4FLW A;  3SQ1 A;  4J2E A;  4IKF A;  4KI6 A;  4CEC A;  2G8H A;  2FBX A;  3EZ5 A;  1RT3 A;  3NDK A;  2G8F A;  3MEG A;  1JXB A;  1S1W A;  2IC3 A;  4FLU A;  3HVT A;  5CYM A;  1RTD A;  1Q8I A;  3VQ9 A;  1C0U A;  1X1P A;  1TKZ A;  3ZT3 A;  4M3X A;  1XWL A;  3LAK A;  5DMR A;  3KK3 A;  3K59 A;  4MQ3 A;  3LPT A;  1RBR A;  4KO0 A;  2B5J A;  4FJI A;  1FK9 A;  3EYZ A;  4KHU A;  2HNZ A;  4E19 A;  2DFF A;  4B8A B;  4PA1 A;  4B9U A;  3DMJ A;  1JLC A;  3SV3 A;  3VQC A;  4BWJ A;  2Z1J A;  4CGI A;  4OPJ A;  1S1V A;  1VSF A;  4FJX A;  1EP4 A;  1RBS A;  3AO1 A;  4CK2 A;  1HNI A;  1WAJ A;  3S3N A;  2HVI A;  4DSL A;  4BE1 A;  3AVH A;  4RW9 A;  1Z26 A;  4Z0U A;  3KLH A;  3I8D A;  1JLG A;  3VQQ A;  3HM9 A;  3C6U A;  1JXE A;  3HL8 A;  4OGE A;  4CED A;  3NH1 A;  4NCA A;  3L2Q A;  4F3O A;  4B08 A;  1JLA A;  1RDB A;  2ITG A;  1KCF A;  3QET A;  3AA2 A;  4NYN A;  2O4G A;  1B9F A;  3KK2 A;  2GBZ A;  2RKI A;  1EX4 A;  1NJX A;  4IFV A;  1CZB A;  1JLB A;  3DRP A;  4CEQ A;  3O4N A;  1JLF A;  4H4M A;  4H4O A;  3WNF A;  3HXM A;  3RMB A;  3ISN C;  1ZYQ A;  4KHN A;  4FK2 A;  1U48 A;  4FZZ A;  1KRP A;  4DQQ A;  1TL3 A;  1VSH A;  5C25 A;  1YT3 A;  2VG5 A;  4CEF A;  5SZT A;  2X6S A;  3AVK A;  1RT1 A;  4DSE A;  4W5O A;  3OJU A;  2ZD1 A;  3LP2 A;  1RNH A;  1SKS A;  2ZQB A;  1BHL A;  4DTS A;  3D0P A;  4AHR A;  4FJG A;  3HJF A;  3O3H A;  3AA5 X;  2PZS A;  1A5V A;  1U47 A;  1L3U A;  1QSY A;  3MXI A;  4EZ6 A;  3MXM A;  1T8E A;  4KI4 A;  3HT3 A;  4J2B A;  3L8B A;  3V81 A;  4ELT A;  3V9W A;  2DFE A;  3TAQ A;  3QNO A;  4G1Q A;  4BE0 A;  4K8X A;  3ITH A;  2AJQ A;  1BGX T;  2D0B A;  3TAE A;  4DQR A;  4CHN A;  4CF1 A;  1RBV A;  3OS0 A;  4OKK A;  1CXQ A;  3QEV A;  3CYM A;  3KTQ A;  1HYZ A;  3AVN A;  2XY8 A;  4CJQ A;  4O0J A;  4FJ8 A;  3VQD A;  3AO3 A;  4F4K A;  3OVN A;  1NK8 A;  2YHB A;  5KGW A;  3VQ5 A;  1KFS A;  3I0S A;  2YNF A;  1YVU A;  4CJ5 A;  4KRE A;  1J54 A;  4AHV A;  3T19 A;  2FBY A;  3L3U A;  2OPS A;  2IAJ A;  2YKM A;  4HUE A;  4FLZ A;  1RCH A;  4CHZ A;  2R7Y A;  2YV0 X;  4DSJ A;  3BGR A;  3O3G A;  2G8K A;  3OYK A;  4CE9 A;  1XHZ A;  1Q9X A;  3DLR A;  2YNG A;  4CEB A;  1UOC A;  4O44 A;  3TAF A;  4RG8 A;  3LAL A;  2HNY A;  4JRP A;  4E7L A;  1A5W A;  2F8S A;  4CJE A;  4UQG A;  3AVA A;  3SPZ A;  1R0A A;  4E0D A;  4PWD A;  3OYL A;  3DLK A;  5HBM A;  1F21 A;  3G10 A;  3CM5 A;  1J9A A;  3AO2 A;  4JLH A;  3V9S A;  4EP4 A;  3KLG A;  4E7H A;  3PX6 A;  3B6O A;  4HHT A;  1RT6 A;  2ZE2 A;  3KK1 A;  3V9U A;  1D9F A;  3CM6 A;  4CK3 A;  4BDP A;  4DLE A;  4M41 A;  1WAF A;  3BDP A;  3AVM A;  3K5N A;  4FJM A;  3MED A;  3U3G A;  4CIF A;  3NE6 A;  3NGI A;  4Z4G A;  3LZJ A;  1VRT A;  3AVL A;  3QEW A;  4CIE A;  3L2W A;  5C42 A;  3QES A;  1WSI A;  2OZS A;  1RTI A;  3OYE A;  3OYG A;  3C94 A;  4ICL A;  4ZTF A;  4CGG A;  1FKP A;  4W5Q A;  4E7I A;  4Q0B A;  3SCX A;  3VQ6 A;  4XIU A;  4FZX C;  1BIU A;  4ZTJ A;  4DTX A;  4ELV A;  3CG7 A;  3D45 A;  4CIG A;  1SL1 A;  4DQI A;  1SKR A;  3QEX A;  2X78 A;  1HJR A;  4DS5 A;  4KFB A;  5HRS A;  4Z4I A;  1RBU A;  1NKC A;  2DFH A;  2RPI A;  2A1S A;  3HST B;  3NF9 A;  4RW8 A;  1S9G A;  2XO7 A;  4KHW A;  4CEA A;  3PO5 A;  2FBT A;  5CZ2 A;  4BDZ A;  4FCY A;  1WLJ A;  4NYF A;  1LAW A;  3DYA A;  3LAM A;  4DF8 A;  4Z4H A;  4DLG A;  4DSF A;  1NK6 A;  1NKB A;  2HVH A;  3SUN A;  4QAG A;  1NK4 A;  3V1Q A;  1TL1 A;  3M8P A;  1RTJ A;  2BAN A;  3HP6 A;  1KLN A;  1QSL A;  5HRO A;  3E01 A;  4C8M A;  1HRH A;  1U04 A;  1FXX A;  4AHS A;  2XHB A;  2G8V A;  3KLE A;  3HP9 A;  3NH2 A;  3JYT A;  4FLT A;  3TAN A;  3QO9 A;  1BI4 B;  2F8T A;  4IG3 A;  3L2V A;  3DLE A;  3ASM A;  3P83 D;  4ZHR A;  3VQ8 A;  4FW2 A;  1U45 A;  5T7B A;  2OZM A;  3NH0 A;  4F8R A;  5EU7 A;  3NCI A;  4CFC A;  2DTU A;  3TAP A;  1LAV A;  1VSI A;  4N56 A;  1T05 A;  1IKW A;  2QK9 A;  1WSJ A;  3PO4 A;  3QLH A;  3OYF A;  4CFA A;  4AH9 A;  3SI6 A;  3TAR A;  1XI1 A;  5E41 A;  3ULD A;  5I3U A;  4N47 A;  3RR7 A;  2B4J A;  2E6M A;  4E1M A;  4CCH A;  4DTU A;  1QTM A;  3KLI A;  4E7K A;  1GOB A;  3RRG A;  1NOZ A;  3RWU A;  3IS9 A;  1LWF A;  3FFI A;  3KKS A;  2W42 A;  1CLQ A;  4PY5 A;  2EHG A;  3SUP A;  4ID1 A;  4B9N A;  3DM2 A;  3LZI A;  2P5O A;  4GVM A;  4LH4 A;  1C1A A;  2Y1I A;  4NCB A;  1RT7 A;  2XRI A;  1HPZ A;  3M8S A;  3LAN A;  4JS5 A;  4FM2 A;  1WSE A;  5KRT A;  3OJS A;  3ALY A;  4FLY A;  4FJ5 A;  4FW1 A;  4FK4 A;  4N41 A;  4GMJ B;  5SWM A;  1ITG A;  4DTR A;  5HLF A;  2G8I A;  3TAB A;  4DFK A;  4Z4F A;  5KRS A;  3WNH A;  1QHT A;  1S5J A;  1QSS A;  3IAY A;  4FZY A;  1RT4 A;  4K8Z A;  3HVR A;  4YNQ A;  3OYN A;  4N5S A;  1N5Y A;  2VWK A;  4CFD A;  4OPK A;  1GOA A;  2VG7 A;  1T03 A;  1L5U A;  1W9H A;  1IO2 A;  3ZSZ A;  3S3M A;  3PV8 A;  4DFP A;  4KHS A;  4AHT A;  1JL1 A;  1QS4 A;  3M8Q A;  3PUF A;  3TI0 A;  3ZT0 A;  3DLB A;  1ZBF A;  4C8L A;  2Q3S A;  4CHO A;  4B9L A;  2E6L A;  5DK5 A;  3SNN A;  3NHG A;  4RW6 A;  4EP5 A;  5CZ1 A;  4LD0 A;  1QQC A;  1TGO A;  3DLG A;  4OKJ A;  1JL2 A;  3V9Z A;  4DU4 A;  3PX4 A;  4CER A;  1ASW A;  1A5X A;  1VSM A;  3K5O A;  5HRN A;  2PYJ A;  1VSL A;  3AA4 A;  3DOK A;  1EXQ A;  4EZ9 A;  1JLQ A;  5C24 A;  1O1W A;  4BE2 A;  5J2N A;  2HHS A;  3F73 A;  2HHT A;  2OPR A;  4DTM A;  4CHY A;  1C0T A;  1EKE A;  1C1B A;  3OYA A;  1BIZ A;  1S6P A;  3DOL A;  2QXF A;  4RW4 A;  2NUB A;  5K14 A;  1C0M A;  3NF8 A;  3V1O A;  3QER A;  4N76 A;  2O4I A;  4AHU A;  2KZZ A;  4IDK A;  1GOC A;  1S1T A;  3A2F A;  2HHQ A;  1HYS A;  4J2D A;  3SUQ A;  3DLH A;  4I7F A;  4KAZ A;  4CGJ A;  4CJR A;  1IKX A;  1YTA A;  4E7J A;  4FJ7 A;  2HHV A;  3LWL A;  4HTU A;  4KHQ A;  3U6F A;  4CJF A;  3LP0 A;  4ELU A;  5HRP A;  4HUF A;  4KB0 A;  4FK0 A;  2HMI A;  4O5B A;  3QEP A;  3OS1 A;  3THV A;  3ZSR A;  3AVI A;  1B9D A;  4CEE A;  4CJL A;  4CJU A;  1BQM A;  3SJJ A;  1UA1 A;  2HW3 A;  5JS1 A;  1HQE A;  3KIO A;  2RF2 A;  1VSJ A;  1ZBH A;  4CES A;  1LW2 A;  3NF7 A;  3VQ7 A;  1L3V A;  1RDA A;  4IFY A;  3M8R A;  3RMC A;  4FXD A;  1VSK A;  3LP3 A;  3V4I A;  1I39 A;  3CFR A;  3OS2 A;  4W5R A;  3SPY A;  3PX0 A;  4C8N A;  4CJ4 A;  4LSN A;  2WON A;  3VA3 A;  3AVB A;  2Y1J A;  3TWH A;  4DF4 A;  4E1N A;  3ZSX A;  4AIL C;  3ZSW A;  3K2P A;  4Y1D A;  2E4L A;  1NK7 A;  1IH7 A;  3QIP A;  2WOM A;  3V6D A;  4DSI A;  3T3F A;  1UWB A;  1RIL A;  1ASU A;  1TKT A;  1J53 A;  4IG0 A;  4CF2 A;  5I42 A;  4Z4E A;  4CJK A;  1TAU A;  2KFN A;  1HYV A;  4FVM A;  3ZT2 A;  3DI6 A;  2P51 A;  3MEC A;  1WSF A;  1RT2 A;  2YNI A;  4BAC A;  3SQ4 A;  3TR8 A;  5J2M A;  5D3G A;  4CJW A;  3RMA A;  4CJT A;  5J2P A;  4FJJ A;  1BCM A;  2IDO A;  3OYI A;  3VN5 A;  2HHU A;  1TVR A;  1VK0 A;  1U4B A;  4TSX A;  4FJN A;  1SUQ A;  4QCL A;  1L3T A;  4OGC A;  2Z1G A;  2OYQ A;  5HP1 A;  1REV A;  2D0C A;  4F2R A;  1RT5 A;  4M3T A;  1CXU A;  4DS4 A;  4W5T A;  1J5O A;  1C1C A;  5CY4 A;  2EX3 A;  1DLO A;  2HND A;  4DU3 A;  3NAE A;  1KVA A;  1U49 A;  4KTZ A;  3OYH A;  4C8O A;  4JRQ A;  3O4Q A;  1KTQ A;  1UA0 A;  4I9Q A;  1S1X A;  4CGH A;  1NK9 A;  3QIN A;  4DTO A;  4BDY A;  1X9S A;  4Q5V A;  1C6V A;  3L2R A;  4M3Y A;  4YFU A;  4BWM A;  2IGI A;  4Z4C A;  2D0A A;  1CZ9 A;  2YNH A;  3WNG A;  3MXJ A;  3C95 A;  4RW7 A;  5FDL A;  4I2Q A;  1D9D A;  3TAG A;  3AVG A;  5FRO A;  3LDS A;  1KLM A;  1BCO A;  1K6Y A;  1ASV A;  2P1J A;  4FM0 A;  4DQP A;  1ZBI A;  2OPP A;  3IRX A;  4J2A A;  1WNS A;  3OYB A;  1TV6 A;  1Y97 A;  2P5G A;  1DTT A;  4DWI A;  4OJR A;  4LSL A;  3VA0 A;  3C6T A;  1RDD A;  4DTP A;  1G15 A;  3AVC A;  3L3V A;  2IS3 A;  1X9W A;  1ZBU A;  4HCC A;  1DTQ A;  3AO5 A;  3QIO A;  2HHW A;  2GV9 A;  1S6Q A;  4PQU A;  1NK5 A;  4CJV A;  1TK5 A;  1BI4 A;  4JS4 A;  1TK8 A;  1RDC A;  4DSK A;  2YKN A;  3JSM A;  3K58 A;  2GUI A;  3SYZ A;  4M42 A;  4CHP A;  2ATQ A;  4FM1 A;  1LWE A;  1NJZ A;  4DQS A;  4IBN A;  1HNV A;  1SL0 A;  2G8W A;  1UAX A;  3I0R A;  4CHQ A;  4FLV A;  4B8C A;  2PY5 A;  4KRF A;  3LP1 A;  4W5N A;  1TKD A;  1NOY A;  4M45 A;  2ETJ A;  3AO4 A;  1KFD A;  4CF9 A;  2RN2 A;  3HYF A;  2BDP A;  5JS2 A;  4C8K A;  4FJ9 A;  3P5J A;  4FJL A;  3K5L A;  1XC9 A;  3HK2 A;  3VQ4 A;  1JLE A;  1NJW A;  2KQ2 A;  2Z1H A;  3OYM A;  1N6Q A;  3DRS A;  3SQ2 A;  1X9M A;  3NFA A;  3RTV A;  3K57 A;  3V9X A;  4B9M A;  5FRN A;  5KI6 A;  3IG1 A;  4O4G A;  4GW6 A;  3OYD A;  2I5J A;  1NK0 A;  4KV8 A;  3ZSO A;  4H8K A;  4CJP A;  3CFO A;  2F96 A;  3HPO A;  4FLX A;  1TK0 A;  3UIQ A;  4DU1 A;  3P1G A;  2HB5 A;  5J2Q A;  4KTQ A;  4FYD A;  4FJH A;  1IKV A;  1KSP A;  3SZ2 A;  4O55 A;  4B9S A;  2KTQ A;  3KD1 E;  4DG1 A; 
#chains in the Genus database with same CATH topology
 1KVC A;  4JAX A;  3OYC A;  3I56 N;  3VOV A;  1RBT A;  1NLV A;  3ZCM A;  4ID5 A;  1T7P A;  2A1R A;  4LY7 A;  3ZSQ A;  2YJE A;  3KD5 E;  4B9V A;  3LDQ A;  1NJY A;  4BRH A;  5FRM A;  4OKE A;  4YY3 K;  3W3D A;  1BL3 A;  3VF2 A;  4L8R B;  3PLA A;  2DPN A;  4MDA A;  2JLE A;  3NGZ A;  4AQY K;  5M1N A;  2XY5 A;  3VQA A;  4CF8 A;  3TTF A;  1RDW X;  3KLF A;  2QWM A;  4JKG A;  4DFJ A;  3VGL A;  4B9T A;  2HHX A;  3CME N;  1ZBL A;  3WNE A;  3RSE B;  1ATS A;  3GG4 A;  3RRH A;  1FKO A;  1HMV A;  2LSN A;  3AY9 A;  2FBV A;  1D8Y A;  1JJ2 M;  1VRU A;  1M1K O;  4O0I A;  3M5R A;  4HUG A;  3OY9 A;  5JLF A;  3H1Q A;  3V1R A;  4BRO A;  3CI5 A;  4DMN A;  3G0Z A;  1V4S A;  4B1X B;  5AQS A;  1Q9Y A;  3N4P A;  5MLC Q;  3B6P A;  2F7T A;  3CQ8 A;  3H1V X;  1VSD A;  2J4R A;  1XHX A;  3C7N A;  3OBW A;  3QIC A;  3VQP A;  4KI6 A;  2ASO A;  4CEC A;  3H3O B;  3EZ5 A;  1RT3 A;  1NGF A;  3QML A;  5JIC A;  2IC3 A;  3C0B A;  1QZ6 A;  3HVT A;  2HBJ A;  3D2F A;  2Q0U A;  2A42 A;  4ISF A;  3LPT A;  1KXP A;  3HTV A;  5H1S Q;  3OHR A;  1EP4 A;  4A62 A;  5TKW A;  4IJN A;  4WQ4 A;  3M3Z A;  1BA1 A;  3HM9 A;  3VQQ A;  3C6U A;  3HL8 A;  4OGE A;  4NCA A;  3CCR N;  3ENH A;  5EVZ A;  4O8U A;  3AA2 A;  2O4G A;  1B9F A;  1SQK A;  3RSE A;  4BR0 A;  1NJX A;  3DRP A;  1JLB A;  3O4N A;  4H4O A;  3VEZ A;  3RMB A;  2O8B A;  1JCG A;  4DQQ A;  1VSH A;  1RT1 A;  1MDU B;  3O80 A;  3ULE B;  3O4W A;  2ZQB A;  3D0P A;  4FJG A;  3O3H A;  2PZS A;  3SAH A;  2W41 A;  3SLC A;  2P9I B;  3FGU A;  4DV2 K;  2IVP A;  3L8B A;  3V81 A;  3N4Q A;  4QS9 A;  4ELT A;  3QNO A;  2KKZ A;  4CVN E;  3OS0 A;  3WXM B;  3R6M A;  1HYZ A;  3AVN A;  2XY8 A;  3F9M A;  4FOI A;  3J81 O;  3VQD A;  4IOA L;  3AO3 A;  4F4K A;  2GTD A;  1NK8 A;  2YHB A;  1C0G A;  4K42 A;  3I0S A;  1J54 A;  4EIA A;  3VF4 A;  1KC8 O;  1RFQ A;  1GLJ O;  4LF4 K;  3NMU A;  2YKM A;  3CC2 N;  4MLH A;  4FLZ A;  2R7Y A;  2YV0 X;  4CE9 A;  1Q9X A;  2YNG A;  5DM6 L;  2HF4 A;  4O44 A;  4RG8 A;  2HNY A;  3FZH A;  4H5N A;  4CJE A;  3SPZ A;  2F8S A;  1NGD A;  3OYL A;  5HBM A;  3G10 A;  1J9A A;  2E2N A;  3AO2 A;  4EP4 A;  3BZC A;  3KLG A;  5M1O A;  4C1N I;  4HHT A;  5AR0 A;  2ZWH A;  2P9I A;  3O5B A;  3DXK B;  3MED A;  5AQT A;  3NE6 A;  4DV6 K;  3SJH A;  5GAG P;  3J7Z O;  1O13 A;  4CIE A;  3L2W A;  3BEX A;  1WSI A;  1V4T A;  3ID6 A;  3OYG A;  2GWK A;  4FSV A;  4W5Q A;  3SCX A;  2H3G X;  2VWB A;  4CZM A;  3D45 A;  4IWV A;  3QEX A;  5AQQ A;  3DWL A;  1NKC A;  1VQ6 N;  2DFH A;  3NF9 A;  4IOX A;  4RW8 A;  1IBK K;  4BR2 A;  5CZ2 A;  3BUZ B;  2HVH A;  4Z4H A;  4DSF A;  1NK6 A;  4QAG A;  1NK4 A;  3HP6 A;  3M8P A;  1QSL A;  4H03 B;  2OTJ N;  4AHS A;  3VES A;  3HP9 A;  3NH2 A;  1QVG M;  3OBY A;  4FLT A;  3SAF A;  1ZC6 A;  5KPR A;  1BI4 B;  3DLE A;  4ZHR A;  1N8R O;  1KAX A;  3NH0 A;  3BZK A;  3WUH A;  2D0P A;  3O9R A;  2QK9 A;  3FR0 A;  1YXQ A;  3PIO L;  4CFA A;  3TAR A;  1MA9 B;  3DXK A;  3VGM A;  3RR7 A;  2B4J A;  4E1M A;  4X65 K;  3IS9 A;  3FFI A;  3KKS A;  4PY5 A;  2ASM A;  2PAV A;  5E84 A;  2P5O A;  4NCB A;  2Y1I A;  5LJW A;  4JS5 A;  1WSE A;  3OJS A;  3NVM A;  3ALY A;  4FW1 A;  4GMJ B;  5SWM A;  1ITG A;  5HLF A;  4DFK A;  4IJA A;  3OYN A;  1N5Y A;  1DKG D;  4CFD A;  4BVO A;  3AAR A;  3PV8 A;  4AHT A;  1QS4 A;  3M8Q A;  3ZT0 A;  1ZBF A;  1K8K B;  5BRH A;  2E6L A;  4EP5 A;  1XC3 A;  3K0S A;  4OKJ A;  1JL2 A;  4CZL A;  3V9Z A;  3ULE A;  3PX4 A;  3K5O A;  3AA4 A;  4H0X B;  3SBT A;  4EZ9 A;  4IXC A;  4CHY A;  3QFU A;  1EKE A;  1C1B A;  3VET A;  4JI2 K;  3LL3 A;  4B1U B;  5C15 A;  5C12 A;  2O8E A;  3NF8 A;  3QER A;  5AQG A;  3LDP A;  1S1T A;  1S22 A;  4CZJ A;  1HYS A;  5GAD P;  1IKX A;  3G25 A;  2HHV A;  1R59 O;  3CQY A;  1P90 A;  3CJB A;  4FOE A;  4CJF A;  4ELU A;  5HRP A;  4O5B A;  3OS1 A;  3ZSR A;  3AVI A;  2HW3 A;  1BQM A;  3C6H A;  3BF3 A;  2RF2 A;  3MX2 A;  4CES A;  2PBD A;  3M8R A;  1VSK A;  3AGR A;  1BA0 A;  3OS2 A;  4CJ4 A;  1N34 K;  3D2F B;  4PKH A;  3AVB A;  3TWH A;  3HZ6 A;  3EO3 A;  1GLL O;  3A8Y A;  2V51 B;  4DB3 A;  2QXL A;  1RIL A;  5I42 A;  2OCE A;  4CJK A;  1W97 L;  1RT2 A;  3MN9 A;  3TR8 A;  4KBO A;  1BCM A;  3CPE A;  3VN5 A;  4DV1 K;  1U4B A;  1SUQ A;  4QCL A;  1L3T A;  2P9N B;  3GL1 A;  2Z1G A;  4OGC A;  5C0Y A;  5HP1 A;  2D0C A;  4CZE A;  3CIP A;  4W5T A;  1ILY A;  3CC7 N;  1T6D A;  3OYH A;  4C8O A;  3O4Q A;  1UA0 A;  4B3T K;  1I94 K;  4NB4 A;  1X9S A;  4LC9 B;  3H3N O;  4BRN A;  1YJN N;  2IGI A;  3WNG A;  2YNH A;  1BOT O;  2V52 B;  4I2Q A;  4ISE A;  2JWL A;  1KQS M;  2W40 A;  1ASV A;  4RCH A;  2OPP A;  4JKD A;  1WNS A;  4PL7 A;  1TV6 A;  3VPZ A;  1SZ2 A;  4DTP A;  4PQU A;  2V7Y A;  4CJV A;  4JK9 A;  3E66 A;  3K58 A;  4CHP A;  4GKJ K;  2JWK A;  1LWE A;  1NJZ A;  4DQS A;  4IBN A;  4JKF A;  5BRF A;  1CZA N;  4IDH A;  3AO4 A;  3HK2 A;  3P5J A;  1N6Q A;  3RTV A;  2QWP A;  2VYP A;  5BN9 A;  4MLE A;  3K57 A;  5KI6 A;  3IG1 A;  4GW6 A;  3W0L A;  3RR8 A;  3ZSO A;  3AAP A;  2GWJ A;  4CJP A;  3P1G A;  2P9K B;  4ILJ A;  4HTL A;  1QQM A;  4B9S A;  1HJO A;  4DG1 A;  2QEX N;  3HOS A;  2XY7 A;  4QOZ B;  4LF8 K;  4CGD A;  3ZSV A;  3AA3 A;  3EKS A;  2X6N A;  1XNQ K;  1X9J A;  3U3Y A;  4DKW A;  5J1E A;  3SUO A;  5B8H A;  4ILG B;  3QEI A;  4WQ4 C;  3A5L C;  3RMD A;  4F2S A;  3MN5 A;  3PIP L;  1HNZ K;  1NU0 A;  4CJ3 A;  4KTW A;  3KWG A;  1XNR K;  1NKE A;  3PSF A;  1E4G T;  3HO1 A;  4H5W A;  3R9P A;  5F0X A;  1D5A A;  3UB5 A;  2D5R A;  3D7E O;  4CF0 A;  4M3R A;  2CGK A;  4E3S A;  4M3U A;  3LWM A;  1U2V A;  2P9S B;  4BG9 A;  4CGF A;  2YI1 A;  4I9L A;  3I33 A;  4OLA A;  4E89 A;  2BGG A;  3F9K A;  4MDB A;  2NRR A;  4HCB A;  2IOC A;  1RTH A;  1LW0 A;  3L0Q A;  3R1X A;  4DTJ A;  2KW4 A;  3HPH A;  3L6Q A;  2P9L A;  1Q18 A;  5CYQ A;  3ZSY A;  1YJW N;  3I8B A;  1I3A A;  3SQ0 A;  2FLO A;  1YTU A;  4JHD B;  4IO9 L;  2OA8 A;  4LH5 A;  3CC4 N;  3NBP A;  3NF6 A;  4R5P A;  4F3T A;  1DEJ A;  4A59 A;  2JGU A;  2FF3 B;  4IKF A;  3A5M C;  3ZLJ A;  2E1Y A;  3NDK A;  3EKU A;  1JXB A;  1S1W A;  4FLU A;  1RTD A;  3FZF A;  4B3M K;  1VQ5 N;  1OVY A;  4DUY K;  3S3N A;  4KB1 A;  5DMR A;  3CCM N;  1RBR A;  4BR9 A;  4CBW A;  1FK9 A;  4E19 A;  2DFF A;  4PA1 A;  4DV7 K;  1JLC A;  3BF1 A;  2Z1J A;  3VTI A;  4FJX A;  2CGJ A;  3CCV N;  3P31 A;  1RBS A;  4CK2 A;  1WAJ A;  3AVH A;  3TTD A;  4CED A;  4F3O A;  4B08 A;  4BRF A;  4EHT A;  2ITG A;  3QET A;  4DR3 K;  4JI1 K;  3KK2 A;  1EX4 A;  5GAH P;  4CEQ A;  1ZYQ A;  1JLF A;  2Q31 A;  4FZZ A;  2FSJ A;  3J80 O;  3K9J A;  2QWL A;  1Z05 A;  1YT3 A;  2X6S A;  4A5A A;  3AVK A;  1D4X A;  4YOW A;  3OJU A;  2GEM A;  3DXM A;  1E3M A;  3AA5 X;  1A5V A;  4K43 A;  4EZ6 A;  3MXM A;  4H0Y B;  3MCP A;  3CHW A;  4KI4 A;  4YOR A;  4CD1 A;  2DFE A;  3TAQ A;  5IWA K;  3ITH A;  1BGX T;  3CJC A;  3OA9 A;  4DQR A;  4CHN A;  4CF1 A;  1U2V B;  2P9S A;  3QEV A;  4FJ8 A;  4CJQ A;  3VQ5 A;  4YOX A;  4BC3 A;  5BRD A;  4KRE A;  4AM6 A;  3CMA N;  4GV9 A;  1WB9 A;  1NGH A;  2IAJ A;  5AZJ B;  3TSU A;  4CHZ A;  3CET A;  5ELZ A;  3IDH A;  3BGR A;  4OPA A;  3OYK A;  3DLR A;  5AQK A;  4CEB A;  3LAL A;  1XMO K;  2OAN A;  1NJI O;  4H0V B;  3DLL L;  1A5W A;  1R0A A;  3AVA A;  1QQN A;  2WC9 A;  3MK6 A;  3PX6 A;  2FSN A;  4E7H A;  2NRZ A;  3B6O A;  1QQO A;  3KWI A;  1SS6 A;  3V9U A;  1D9F A;  4XH1 A;  5JLH A;  3P38 A;  4BDP A;  3BDP A;  3AVM A;  4FJM A;  3DJC A;  1HKB A;  1YHQ N;  3LZJ A;  3FZK A;  3QEW A;  3EN9 A;  2O8E B;  4XEI A;  3OYE A;  2CH6 A;  4E7I A;  3QFP A;  1NGG A;  2HF3 A;  3ID8 A;  1NGE A;  4KFB A;  2A1S A;  3HST B;  4KHW A;  1S9G A;  4KH5 A;  2ASP A;  5AQL A;  4BRA A;  4CEA A;  2FBT A;  3VEW A;  3GDQ A;  3LAM A;  1NKB A;  1N36 K;  1XUP O;  3SUN A;  2UXD K;  1RGI A;  2YX6 A;  2VQE K;  2YCH A;  1LOT B;  3F2K A;  2HBL A;  1YIT N;  3JYT A;  3GOI A;  2F8T A;  4IG3 A;  3L2V A;  3P83 D;  1U45 A;  1HKG A;  4WYB A;  4CFC A;  3UKR B;  1HNX K;  4IO8 A;  4N56 A;  1Q81 O;  3QLH A;  3OYF A;  4A61 A;  3ULD A;  4N47 A;  4DR6 K;  4CCH A;  5CR4 A;  5TKY A;  3RWU A;  1LWF A;  4CZF A;  2NLX A;  2W6L A;  4B9N A;  3LZI A;  4GVM A;  4LH4 A;  3KZB A;  4X62 K;  3THX B;  3LAN A;  4FJ5 A;  4FLY A;  4UY8 O;  5EXW A;  1U6Z A;  3CF5 L;  2E20 A;  1VHX A;  2G8I A;  4Z4F A;  3IAY A;  5BN8 A;  5AQX A;  1T03 A;  4BRG A;  1IO2 A;  4IEI A;  4V19 S;  4M63 C;  4KHS A;  3DLB A;  3PUF A;  4CZK A;  3TI0 A;  2Q3S A;  4CHO A;  3UKU B;  5AQI A;  5DK5 A;  4RW6 A;  4B1Z A;  4DU4 A;  3I55 N;  3UKR A;  1A5X A;  4BC5 A;  4H5V A;  4C1N K;  1JLQ A;  1O1W A;  2QW9 A;  4JK8 A;  1BDG A;  2P9U A;  2QXF A;  4LF9 K;  5K14 A;  3V1O A;  4MO4 A;  1KD1 O;  2KZZ A;  4IDK A;  3A2F A;  2HHQ A;  4J2D A;  3SUQ A;  3DLH A;  4I7F A;  5M1Q A;  4CGJ A;  4E7J A;  4FJ7 A;  2D1K A;  3LWL A;  4E1J A;  4KHQ A;  5AQP A;  4IEE A;  1OH5 A;  3QEP A;  4X66 K;  4JD2 A;  2NZT A;  4CEE A;  4CJL A;  3CCE N;  1L3V A;  4WFN L;  3RMC A;  5AQV A;  4FXD A;  1IG8 A;  3LP3 A;  1I39 A;  3CFR A;  3CJ7 A;  2O8F B;  5AQJ A;  3Q7B A;  3VA3 A;  2NRX A;  4E1N A;  1T44 A;  4FWQ A;  3ZSW A;  3K2P A;  2E4L A;  1NK7 A;  1IH7 A;  3QIP A;  3T3F A;  4GVE A;  1TKT A;  1J53 A;  2E2Q A;  4IG0 A;  2KFN A;  3ZT2 A;  3DI6 A;  2OTL N;  2VGN A;  2YJF A;  3O1W A;  2P51 A;  4YOT A;  3ZET B;  1WSF A;  3SQ4 A;  3JS6 A;  4CJT A;  4A2A A;  3MWT A;  3ZX0 A;  5FLX O;  1N32 K;  4DS4 A;  1J5O A;  4JNE A;  5CY4 A;  5AZJ A;  3LDO A;  1KVA A;  1U49 A;  4KTZ A;  4LFB K;  4FPB A;  1KTQ A;  4CGH A;  3CJ9 A;  4IFE A;  4Q5V A;  1C6V A;  4BRI A;  2HBM A;  1NNE A;  4C23 A;  2ZGZ A;  3WQT A;  4BVP A;  5C10 A;  4GKK K;  2F9T A;  5C2D A;  5M1F A;  4RW7 A;  3SBG A;  1D9D A;  1ATR A;  5FRO A;  2UUB K;  1BCO A;  3O6W A;  4FM0 A;  1VQP N;  1ZBI A;  4JD2 B;  3HI0 A;  3IRX A;  3OYB A;  4JHD A;  5AFU A;  3ZEU A;  3C6T A;  1RDD A;  1G15 A;  3AVC A;  2IS3 A;  1ZBU A;  2D4W A;  3FZM A;  2GV9 A;  1S6Q A;  4YDU C;  1TK5 A;  1BI4 A;  3KHY A;  4JS4 A;  3QBX A;  2ITM A;  1TK8 A;  2YKN A;  3E9O A;  3D2E B;  4FWN A;  5I9E B;  5JVG L;  3J7A P;  1SL0 A;  3I0R A;  4B8C A;  4W5N A;  4CF9 A;  3WEE A;  2RN2 A;  3SK3 A;  1HKC A;  4FJ9 A;  3T1Y K;  4FJL A;  3K5L A;  1HPM A;  2KQ2 A;  1X9M A;  3NFA A;  5FRN A;  4X64 K;  1VQM N;  1VQL N;  1NK0 A;  3HPO A;  4ISG A;  2HB5 A;  5J2Q A;  5AQF A;  1IKV A;  5BR8 K;  4DV0 K;  3KD1 E;  4BY9 C;  3CPW M;  2YHA A;  1JKH A;  4MFB A;  2I7N A;  4HWI A;  2V7Z A;  2B6A A;  2KLA A;  3T1A A;  3A5O C;  4KHY A;  4AHC A;  4B3O A;  1HQU A;  1NGC A;  4DR5 K;  1TKX A;  5AQU A;  3O3F A;  1Z25 A;  1L3S A;  2AP1 A;  2KFZ A;  4BRM A;  3HBT A;  4KKO A;  4NCG A;  3ZET A;  3NGY A;  3ZEU B;  1FJG K;  1LWC A;  2QI2 A;  3OTO K;  2VQF K;  1SV5 A;  2O8D B;  3ATU A;  3CXC M;  4AF1 A;  2UXB K;  3TPQ A;  2QKK A;  4DFM A;  5AQZ A;  5HRR A;  1LV5 A;  1WSG A;  2WFB A;  4Y1C A;  3EY1 A;  1W0H A;  1ZXO A;  4KPY A;  2QWQ A;  4CFB A;  2FC0 A;  3WXJ A;  3K5M A;  3MCA B;  1S1U A;  1VQ8 N;  1GLF O;  2E2P A;  3P4I A;  1MU2 A;  2P9U B;  3O9S A;  4CBX A;  2E88 A;  4OVL A;  4YOV A;  1HNW K;  4CK1 A;  2BE2 A;  1TAQ A;  5KQD A;  4WQ5 C;  4RTF D;  3S3O A;  1K9M O;  1S9E A;  3FZL A;  1IKY A;  3OYJ A;  2WTU A;  3VEV A;  2GUP A;  4JI0 K;  2XY6 A;  2X74 A;  4BRP A;  3QDK A;  3THY A;  1NMN A;  1Q8I A;  3VQ9 A;  1C0U A;  1X1P A;  1TKZ A;  3ZT3 A;  4M3X A;  4DR7 K;  2YHY A;  3K59 A;  4M3W A;  3KK3 A;  4FJI A;  4KO0 A;  2B5J A;  2HNZ A;  3G6E N;  4B8A B;  2UUC K;  4M7Y A;  4NLB A;  4B9U A;  1QVF M;  3DMJ A;  3SV3 A;  3VQC A;  4BWJ A;  4CGI A;  1S1V A;  1VSF A;  3AO1 A;  4K41 A;  1HNI A;  4DSL A;  4DR2 K;  1Z26 A;  3M6G A;  1JLG A;  1JXE A;  4BC2 A;  2QWN A;  4LFC K;  2Q2R A;  1NGI A;  1JLA A;  1T6C A;  4EAH D;  4B9Q A;  1KCF A;  3O9T A;  3QBW A;  1EWR A;  2RKI A;  4IFV A;  3HXM A;  4HTU A;  4H4M A;  4FK2 A;  4M3Z A;  3WNF A;  5KQ8 A;  4KHN A;  1U48 A;  1KRP A;  3MDQ A;  2VG5 A;  3QB0 A;  4DSE A;  4W5O A;  3LP2 A;  1RNH A;  4FL9 A;  1SKS A;  4F9O A;  2O8C A;  4DTS A;  4AHR A;  1YI2 N;  2EWS A;  2PFU A;  1L3U A;  4LFA K;  5M1K A;  1T8E A;  2NRW A;  5GIO A;  3HT3 A;  2AJQ A;  4EHU A;  4K8X A;  4OKK A;  4BG8 A;  4O0J A;  4BQL A;  5KGW A;  1IV0 A;  5BPN A;  1KFS A;  2KHO A;  2YNF A;  4CJ5 A;  1BO5 O;  3T19 A;  2FBY A;  3L3U A;  3CCQ N;  2P9P A;  3U4L A;  1YIJ N;  1RCH A;  1S3X A;  4DSJ A;  3E9L A;  2P9N A;  4XH5 A;  5AQO A;  4JKH A;  2A5X A;  2BTF A;  1TYQ A;  4FO0 A;  4E7L A;  1VAZ A;  4O8K A;  4R79 A;  4E0D A;  5HOO A;  4FWO A;  4PWD A;  1F21 A;  4JLH A;  1RDU A;  4CK3 A;  3EL2 A;  2VGM A;  3U9D A;  5LJV A;  4DLE A;  4M41 A;  1WAF A;  5HL7 L;  1Q7Y O;  3CCL N;  4CIF A;  3NGI A;  4Z4G A;  3VEO A;  1TYQ B;  1VRT A;  3AVL A;  3R8E A;  2P9K A;  5C42 A;  2OZS A;  2AA4 A;  1RTI A;  1XMQ K;  3C94 A;  4CGG A;  3A5N C;  3TSQ A;  4Q0B A;  3VQ6 A;  4XIU A;  4DTX A;  4CIG A;  4DCH A;  4DQI A;  2P9P B;  2X78 A;  5HRS A;  4Z4I A;  4H5R A;  1E4F T;  2RPI A;  4JK7 A;  4DR1 K;  4PHT X;  4FCY A;  4BDZ A;  1WLJ A;  4NYF A;  3V1Q A;  2BAN A;  1KLN A;  3R3L A;  4WCE L;  1FXX A;  2XHB A;  2ZGY A;  3KLE A;  4DV3 K;  3EE9 A;  3QO9 A;  3DXM B;  3ASM A;  4F8R A;  5M1P A;  4FW2 A;  3VQ8 A;  5T7B A;  1IKW A;  1WSJ A;  3PO4 A;  5E26 A;  3K9K A;  1XI1 A;  4A57 A;  4DTU A;  4E7K A;  1GOB A;  3RRG A;  1W7A A;  2W42 A;  1CLQ A;  2EHG A;  4DQ8 A;  3CJ1 A;  3DM2 A;  1RT7 A;  2XRI A;  1ESV A;  3LM9 A;  4MO5 A;  4FK4 A;  1NBW A;  1VQ9 N;  5KPT A;  4PKI A;  2FF6 A;  4I6M A;  5KRS A;  2A41 A;  3WNH A;  1NWK A;  1QHT A;  1QHA A;  1QSS A;  4K8Z A;  3HVR A;  4N5S A;  4OX9 K;  2E2O A;  1VQ4 N;  4OPK A;  2VG7 A;  5EOY A;  2NRV A;  3THX A;  1L5U A;  3S3M A;  3T7Z A;  4DFP A;  1JL1 A;  3PSI A;  4O5F A;  4C8L A;  1DT9 A;  3H6E A;  3WT0 A;  2ZJQ L;  5JMV A;  5CZ1 A;  1ASW A;  5BPM A;  3S41 A;  2PYJ A;  1VSL A;  1YUW A;  1EXQ A;  4BE2 A;  5C24 A;  2HHH K;  2HHT A;  3SMP A;  4DTM A;  3DOL A;  1C0M A;  2O4I A;  4N76 A;  2O8D A;  4CW7 B;  1GOC A;  4CBU A;  4KAZ A;  4CJR A;  1YTA A;  3ZX3 A;  3U6F A;  3LP0 A;  4HUF A;  2HMI A;  4K0K K;  3THV A;  3Q7C A;  4FWS A;  3SJJ A;  3HSC A;  5AQM A;  1ZBH A;  1VSJ A;  1LW2 A;  3VQ7 A;  2CH5 A;  1EQY A;  5AFU H;  1H1V A;  5GAE P;  4W5R A;  4C8N A;  4CJ7 A;  1VQN N;  3VEY A;  3D6R A;  2VCP A;  1IBM K;  5FPE A;  2WOM A;  1HLU A;  1TAU A;  4BRD A;  4FVM A;  3LM2 A;  5AQW A;  2A3Z A;  3CQX A;  3O9U A;  4DHY A;  3MEC A;  5D3G A;  4BAC A;  4CJW A;  2UYT A;  2IDO A;  5A2Q O;  2HHU A;  3O8M A;  1TVR A;  1VK0 A;  4TSX A;  3WXL A;  3BY5 A;  4FJN A;  2OYQ A;  1REV A;  4F2R A;  4M3T A;  1RT5 A;  1C1C A;  4QS7 A;  2QM1 A;  1DLO A;  2I7P A;  3MWP A;  3G4S N;  3EEQ A;  1S1X A;  1NK9 A;  3JAM O;  3U8X A;  4BDY A;  2O8C B;  3TTC A;  1GLA G;  4G9Z A;  3L2R A;  4M3Y A;  3ZYY X;  4YFU A;  4WFA L;  2D0A A;  1CZ9 A;  3UKU A;  4BRE A;  3H45 C;  3MXJ A;  4FWR A;  1HR0 K;  4KH6 A;  4GV6 A;  4BGB A;  5LY3 A;  2E5L K;  2Q36 A;  4H0O A;  1Y97 A;  3MX5 A;  3THW A;  1DTT A;  4OPH A;  1S72 N;  4LSL A;  2NRT A;  3VA0 A;  1OH8 A;  3L3V A;  3SMS A;  5CE3 A;  2YHX A;  1GLB G;  1DTQ A;  3QIO A;  4BGA A;  2ZJR L;  1NK5 A;  4J8F A;  4CD3 A;  5LL6 Z;  1RDC A;  2A6A A;  4NXM K;  3JSM A;  3SYZ A;  2GUI A;  3VF6 A;  4FM1 A;  1HNV A;  3VER A;  4NXN K;  5AZI B;  4KRF A;  2PY5 A;  1KAZ A;  3J7Y P;  4JKG B;  1QZ5 A;  1TUY A;  2ETJ A;  1KFD A;  4L3Q A;  1HUX A;  1Y64 A;  1XC9 A;  3VQ4 A;  3MN6 A;  2GX9 A;  1JLE A;  4NLC A;  3IMX A;  3DRS A;  3JXU A;  2YHW A;  2Q1N A;  3V9X A;  4B9M A;  5AJ3 K;  3TSP A;  2I5J A;  4KV8 A;  4H8K A;  3CFO A;  2F96 A;  4GNI A;  1G99 A;  4FJH A;  1KSP A;  3SZ2 A;  2KTQ A;  4BR5 A;  3MAQ A;  1B92 A;  2VG6 A;  1YAG A;  3S9H A;  2IVO A;  2UU9 K;  4JI6 K;  2O8B B;  2OPQ A;  5IT9 O;  4YOU A;  3H08 A;  3ZT1 A;  2ZM6 K;  4IOC L;  4CEO A;  3AVJ A;  3KKR A;  2G8U A;  5F2R A;  1QE1 A;  1W2B M;  3LPU A;  2E8A A;  1WN7 A;  2WUS A;  4CEZ A;  1M90 O;  1SKW A;  3VQB A;  3QNN A;  3PY8 A;  3ENO A;  1BIS A;  1GLD G;  4I6M B;  3CFP A;  1SL2 A;  3L4I A;  1EET A;  4HVJ A;  2HMP A;  3O08 A;  2PYL A;  3L2U A;  2KZM A;  1VSE A;  1OKJ A;  3VQE A;  5JVH L;  1IG9 A;  1Z6R A;  3SV4 A;  3CJA A;  4PKG A;  3KVG A;  5LMN K;  4FJK A;  5KGX A;  4B1V A;  3MEE A;  2VWJ A;  4U7B A;  4WE1 A;  4IZ9 A;  3U9Z A;  4OLB A;  3AV9 A;  1BWF O;  3A0I X;  3B8A X;  1KVB A;  3DRR A;  1WSH A;  3TAM A;  4WQ5 A;  2QKB A;  3GBT A;  3ATV A;  3AVF A;  3HPG A;  3KJV A;  1WOQ A;  1YF5 L;  4CJS A;  4JV5 K;  1MWK A;  3ENB A;  3VTH A;  5CHI A;  3VGK A;  3ZT4 A;  4FWM A;  4DTN A;  5KTQ A;  4I2P A;  3L4Q A;  2Z1I A;  4FWK A;  2DY4 A;  5AQY A;  3GE1 A;  4PUO A;  1BU6 O;  1BQN A;  1Q86 O;  4FLW A;  4J2E A;  3SQ1 A;  1GLE G;  3H46 O;  2FBX A;  1K73 O;  2W6K A;  3CCJ N;  4JKB A;  4U67 L;  2G8F A;  3MEG A;  1OH6 A;  2E1Z A;  4Z94 A;  2F9W A;  2ZF5 O;  5CYM A;  5AZI A;  2HOE A;  3EE8 A;  1YVN A;  3WXK A;  4CZH A;  1XWL A;  3LAK A;  1MWM A;  2G8H A;  4MQ3 A;  4OO1 J;  3EYZ A;  4KHU A;  2QWR A;  3RVC A;  3T1H K;  5AQH A;  1X3M A;  4OPJ A;  2HVI A;  4BE1 A;  4RW9 A;  4Z0U A;  3KLH A;  3I8D A;  1KAY A;  2QTD A;  1WBD A;  3NH1 A;  3L2Q A;  1SAZ A;  1RDB A;  1VQ7 N;  4NYN A;  4QS8 A;  5FPN A;  2GBZ A;  1CZB A;  3ISN C;  3VEN A;  1TL3 A;  5C25 A;  4PL8 A;  3CCU N;  5SZT A;  4CEF A;  2FXU A;  1OH7 A;  4B1Y B;  3J8A A;  2ZD1 A;  2QA4 N;  3FLC O;  3WQU A;  1BHL A;  4JI4 K;  4BRC A;  3O1B A;  3HJF A;  4DV5 K;  5BPL A;  1U47 A;  1QSY A;  3MXI A;  1LCU A;  4J2B A;  3V9W A;  4G1Q A;  4BE0 A;  2D0B A;  3TAE A;  4JKC A;  1RBV A;  3WEE B;  1CXQ A;  3KTQ A;  3CYM A;  1GLC G;  3MN7 A;  3OVN A;  1EO1 A;  4WFB L;  4B3R K;  1YVU A;  4AHV A;  3EZW A;  1EWQ A;  1NGB A;  2OPS A;  4HUE A;  4H0P A;  3O3G A;  2G8K A;  1XHZ A;  2UUA K;  2ZJP L;  4DUZ K;  1UOC A;  3TAF A;  3NVK A;  4WF9 L;  4NO7 A;  4JRP A;  2O8F A;  4EFH A;  3WXI A;  4UQG A;  1P8Z A;  3DLK A;  1K8K A;  3CM5 A;  1NG9 A;  4YHH K;  3V9S A;  5KPZ A;  1J6Z A;  5AQR A;  1RT6 A;  2ZE2 A;  3KK1 A;  4A5B A;  3FE1 A;  2WBN A;  3VEX A;  3CM6 A;  3LDN A;  3K5N A;  3U3G A;  4BC4 A;  4BR4 A;  3OW2 M;  3T69 A;  4JEP A;  1YJ9 N;  1VQK N;  3VMF B;  4H5T A;  3QES A;  3AGK A;  2HBK A;  4ICL A;  4ZTF A;  1FKP A;  3C6A A;  4FZX C;  5GIN A;  1BIU A;  4ZTJ A;  4JKA A;  4ELV A;  3CG7 A;  1SL1 A;  1SKR A;  4RWT A;  1HJR A;  4DS5 A;  1RBU A;  3HOT A;  2XO7 A;  3PO5 A;  5ADX A;  1LAW A;  2A40 A;  3DYA A;  1NGA A;  4DF8 A;  4DLG A;  1TL1 A;  4GV3 A;  1RTJ A;  4FPA A;  5ADX H;  1Q82 O;  5HRO A;  3E01 A;  4C8M A;  3CCS N;  1HRH A;  1U04 A;  3LDL A;  1BUP A;  2G8V A;  4LF6 K;  2BH1 A;  3TAN A;  4FWP A;  3IKM A;  4CI6 A;  2IVN A;  2OZM A;  1JCF A;  5EU7 A;  3NCI A;  2DTU A;  3TAP A;  1LAV A;  1VSI A;  1T05 A;  3AAQ A;  4AH9 A;  3SI6 A;  5E41 A;  3IFR A;  5I3U A;  2E6M A;  1QTM A;  1IBL K;  4H0T B;  3KLI A;  2GEL A;  2NRH A;  1NOZ A;  5EY4 A;  3HM8 A;  5DM7 L;  3SUP A;  4ID1 A;  4YOY A;  1C1A A;  1HPZ A;  3M8S A;  4FM2 A;  5KRT A;  4N41 A;  3E9P A;  1WBB A;  4DTR A;  4JI7 K;  4BRK A;  1VQO N;  4CZG A;  1ZBS A;  3TAB A;  5F1X A;  4XH4 A;  4BR7 A;  1S5J A;  4B1W B;  4FZY A;  1RT4 A;  4YNQ A;  2VWK A;  4KHP K;  3THW B;  1GOA A;  1W9H A;  3MMV A;  3TU5 A;  3ZSZ A;  3C7N B;  2BUP A;  4K25 A;  4B9L A;  3SNN A;  3NHG A;  4LD0 A;  1QQC A;  2F4V K;  1TGO A;  3DLG A;  4CER A;  1VSM A;  5HRN A;  3DOK A;  1K8A O;  4LF5 K;  2Q97 A;  5J2N A;  5BRE A;  2HHS A;  5EX5 A;  3F73 A;  2OPR A;  3SAG A;  1C0T A;  3OYA A;  1BIZ A;  1S6P A;  4RW4 A;  2NUB A;  4FWL A;  4AHU A;  1XQS C;  3CER A;  1TUU A;  1HX1 A;  3C65 A;  2NNW A;  5BR9 A;  4KB0 A;  4FK0 A;  4BQZ A;  3G71 N;  1B9D A;  4CJU A;  5FPM A;  1UA1 A;  5JS1 A;  1HQE A;  3KIO A;  4JKE A;  3IUC A;  1NMD A;  2QWO A;  3NF7 A;  1RDA A;  4IFY A;  3UE5 A;  4YDU A;  3V4I A;  3HRG A;  3SPY A;  3PX0 A;  4JN4 A;  4LSN A;  2CGL A;  2WON A;  2Y1J A;  3F5T A;  4DF4 A;  3ZSX A;  4AIL C;  1T3V A;  4Y1D A;  1C0F A;  3V6D A;  4DSI A;  1UWB A;  2FSK A;  3ZX2 A;  1ASU A;  4CF2 A;  3FFK B;  4Z4E A;  1HYV A;  2Q0R A;  4AM7 A;  2YNI A;  5J2M A;  3RMA A;  5J2P A;  3E1Y A;  4FJJ A;  3OYI A;  1NM1 A;  5LMU K;  2P9L B;  1DGK N;  2RHK A;  1CXU A;  4DV4 K;  2EX3 A;  3P39 A;  2D0O A;  2HND A;  3BP8 A;  4M7X A;  4BRL A;  3NAE A;  4DU3 A;  4FVU A;  4JYA K;  4B3S K;  4JRQ A;  4I9Q A;  4JI3 K;  3QIN A;  4DTO A;  4DR4 K;  2IIR A;  1IJJ A;  2HST A;  2RE2 A;  1J5E K;  4BWM A;  1OVQ A;  3THY B;  3KK7 A;  4Z4C A;  1FW6 A;  1BG3 A;  3C95 A;  5FDL A;  3TAG A;  3AVG A;  3LDS A;  1N33 K;  1KLM A;  1K6Y A;  4KH4 A;  2P1J A;  4DQP A;  4J2A A;  4JI5 K;  2P5G A;  4DWI A;  4OJR A;  4CZI A;  1WUA A;  1X9W A;  4HCC A;  3O9Q A;  4Y0W A;  3AO5 A;  2HHW A;  4BRQ A;  1ATN A;  4DSK A;  4M42 A;  3DAW A;  2ATQ A;  2G8W A;  1UAX A;  4CHQ A;  4FLV A;  3CD6 N;  3LP1 A;  1TKD A;  5C2F A;  1NOY A;  1JCE A;  4LF7 K;  2UXC K;  4JI8 K;  4M45 A;  5AQN A;  2BDP A;  3HYF A;  5JS2 A;  4C8K A;  3M1F A;  5FPD A;  1NJW A;  2Z1H A;  3OYM A;  3SQ2 A;  1NGJ A;  3D2E A;  4O4G A;  3OYD A;  4GY2 B;  5GIP A;  4FLX A;  1TK0 A;  3UIQ A;  4DU1 A;  4KTQ A;  4FYD A;  1X3N A;  4O55 A;  4ILH A;  4A2B A; 
#chains in the Genus database with same CATH homology
 3MAQ A;  2XY7 A;  1B92 A;  2VG6 A;  3S9H A;  2YHA A;  4QOZ B;  1KVC A;  3OYC A;  2OPQ A;  1JKH A;  3H08 A;  1RBT A;  4MFB A;  3ZT1 A;  3ZSV A;  4CGD A;  3AA3 A;  3ZCM A;  4ID5 A;  2X6N A;  4CEO A;  1T7P A;  2B6A A;  3T1A A;  4KHY A;  3AVJ A;  4AHC A;  3KKR A;  2G8U A;  3U3Y A;  4B3O A;  1HQU A;  5J1E A;  1QE1 A;  2A1R A;  4LY7 A;  3LPU A;  3SUO A;  3ZSQ A;  1WN7 A;  4CEZ A;  3KD5 E;  1TKX A;  3O3F A;  3QEI A;  1Z25 A;  4B9V A;  1L3S A;  1SKW A;  3RMD A;  3VQB A;  3QNN A;  4F2S A;  3PY8 A;  2KFZ A;  1BIS A;  4KKO A;  1NJY A;  3CFP A;  4NCG A;  1SL2 A;  5FRM A;  4OKE A;  3NGY A;  1EET A;  4CJ3 A;  4HVJ A;  1BL3 A;  4L8R B;  1LWC A;  4KTW A;  2PYL A;  1NKE A;  1SV5 A;  3L2U A;  2KZM A;  1VSE A;  3VQE A;  2JLE A;  3NGZ A;  2QKK A;  4DFM A;  1LV5 A;  5HRR A;  1IG9 A;  3HO1 A;  3SV4 A;  2XY5 A;  3VQA A;  1D5A A;  4CF8 A;  2D5R A;  1WSG A;  4CF0 A;  4FJK A;  4M3R A;  5KGX A;  4Y1C A;  3EY1 A;  1W0H A;  3KLF A;  4DFJ A;  4M3Z A;  3MEE A;  2VWJ A;  4E3S A;  4M3U A;  4WE1 A;  3LWM A;  4B9T A;  4KPY A;  4CFB A;  2HHX A;  2FC0 A;  3K5M A;  1ZBL A;  4OLB A;  3AV9 A;  4CGF A;  3WNE A;  1S1U A;  4I9L A;  1KVB A;  3DRR A;  3RRH A;  4OLA A;  4E89 A;  2BGG A;  3F9K A;  1FKO A;  1WSH A;  4KB1 A;  1MU2 A;  1HMV A;  3TAM A;  4HCB A;  2IOC A;  2LSN A;  2QKB A;  3AVF A;  1RTH A;  3HPG A;  1LW0 A;  2FBV A;  3KJV A;  1D8Y A;  1VRU A;  4OVL A;  4CJS A;  4O0I A;  4HUG A;  4DTJ A;  2KW4 A;  3HPH A;  4CK1 A;  3OY9 A;  2BE2 A;  1TAQ A;  3V1R A;  5CYQ A;  3ZSY A;  4DMN A;  3G0Z A;  3ZT4 A;  4DTN A;  3S3O A;  5KTQ A;  4M3W A;  4I2P A;  1I3A A;  2Z1I A;  3SQ0 A;  1Q9Y A;  2DY4 A;  1YTU A;  3B6P A;  3CQ8 A;  1VSD A;  4PUO A;  2OA8 A;  4LH5 A;  1XHX A;  1BQN A;  1S9E A;  1IKY A;  3OYJ A;  3RR8 A;  3NBP A;  3NF6 A;  4R5P A;  4F3T A;  2JGU A;  2XY6 A;  3VQP A;  2X74 A;  4FLW A;  3SQ1 A;  4J2E A;  4IKF A;  4KI6 A;  4CEC A;  2G8H A;  2FBX A;  3EZ5 A;  1RT3 A;  3NDK A;  2G8F A;  3MEG A;  1JXB A;  1S1W A;  2IC3 A;  4FLU A;  3HVT A;  5CYM A;  1RTD A;  1Q8I A;  3VQ9 A;  1C0U A;  1X1P A;  1TKZ A;  3ZT3 A;  4M3X A;  1XWL A;  3LAK A;  5DMR A;  3KK3 A;  3K59 A;  4MQ3 A;  3LPT A;  1RBR A;  4KO0 A;  2B5J A;  4FJI A;  1FK9 A;  3EYZ A;  4KHU A;  2HNZ A;  4E19 A;  2DFF A;  4B8A B;  4PA1 A;  4B9U A;  3DMJ A;  1JLC A;  3SV3 A;  3VQC A;  4BWJ A;  2Z1J A;  4CGI A;  4OPJ A;  1S1V A;  1VSF A;  4FJX A;  1EP4 A;  1RBS A;  3AO1 A;  4CK2 A;  1HNI A;  1WAJ A;  3S3N A;  2HVI A;  4DSL A;  4BE1 A;  3AVH A;  4RW9 A;  1Z26 A;  4Z0U A;  3KLH A;  3I8D A;  1JLG A;  3VQQ A;  3HM9 A;  3C6U A;  1JXE A;  3HL8 A;  4OGE A;  4CED A;  3NH1 A;  4NCA A;  3L2Q A;  4F3O A;  4B08 A;  1JLA A;  1RDB A;  2ITG A;  1KCF A;  3QET A;  3AA2 A;  4NYN A;  2O4G A;  1B9F A;  3KK2 A;  2GBZ A;  2RKI A;  1EX4 A;  1NJX A;  4IFV A;  1CZB A;  1JLB A;  3DRP A;  4CEQ A;  3O4N A;  1JLF A;  4H4M A;  4H4O A;  3WNF A;  3HXM A;  3RMB A;  3ISN C;  1ZYQ A;  4KHN A;  4FK2 A;  1U48 A;  4FZZ A;  1KRP A;  4DQQ A;  1TL3 A;  1VSH A;  5C25 A;  1YT3 A;  2VG5 A;  4CEF A;  5SZT A;  2X6S A;  3AVK A;  1RT1 A;  4DSE A;  4W5O A;  3OJU A;  2ZD1 A;  3LP2 A;  1RNH A;  1SKS A;  2ZQB A;  1BHL A;  4DTS A;  3D0P A;  4AHR A;  4FJG A;  3HJF A;  3O3H A;  3AA5 X;  2PZS A;  1A5V A;  1U47 A;  1L3U A;  1QSY A;  3MXI A;  4EZ6 A;  3MXM A;  1T8E A;  4KI4 A;  3HT3 A;  4J2B A;  3L8B A;  3V81 A;  4ELT A;  3V9W A;  2DFE A;  3TAQ A;  3QNO A;  4G1Q A;  4BE0 A;  4K8X A;  3ITH A;  2AJQ A;  1BGX T;  2D0B A;  3TAE A;  4DQR A;  4CHN A;  4CF1 A;  1RBV A;  3OS0 A;  4OKK A;  1CXQ A;  3QEV A;  3CYM A;  3KTQ A;  1HYZ A;  3AVN A;  2XY8 A;  4CJQ A;  4O0J A;  4FJ8 A;  3VQD A;  3AO3 A;  4F4K A;  3OVN A;  1NK8 A;  2YHB A;  5KGW A;  3VQ5 A;  1KFS A;  3I0S A;  2YNF A;  1YVU A;  4CJ5 A;  4KRE A;  1J54 A;  4AHV A;  3T19 A;  2FBY A;  3L3U A;  2OPS A;  2IAJ A;  2YKM A;  4HUE A;  4FLZ A;  1RCH A;  4CHZ A;  2R7Y A;  2YV0 X;  4DSJ A;  3BGR A;  3O3G A;  2G8K A;  3OYK A;  4CE9 A;  1XHZ A;  1Q9X A;  3DLR A;  2YNG A;  4CEB A;  1UOC A;  4O44 A;  3TAF A;  4RG8 A;  3LAL A;  2HNY A;  4JRP A;  4E7L A;  1A5W A;  2F8S A;  4CJE A;  4UQG A;  3AVA A;  3SPZ A;  1R0A A;  4E0D A;  4PWD A;  3OYL A;  3DLK A;  5HBM A;  1F21 A;  3G10 A;  3CM5 A;  1J9A A;  3AO2 A;  4JLH A;  3V9S A;  4EP4 A;  3KLG A;  4E7H A;  3PX6 A;  3B6O A;  4HHT A;  1RT6 A;  2ZE2 A;  3KK1 A;  3V9U A;  1D9F A;  3CM6 A;  4CK3 A;  4BDP A;  4DLE A;  4M41 A;  1WAF A;  3BDP A;  3AVM A;  3K5N A;  4FJM A;  3MED A;  3U3G A;  4CIF A;  3NE6 A;  3NGI A;  4Z4G A;  3LZJ A;  1VRT A;  3AVL A;  3QEW A;  4CIE A;  3L2W A;  5C42 A;  3QES A;  1WSI A;  2OZS A;  1RTI A;  3OYE A;  3OYG A;  3C94 A;  4ICL A;  4ZTF A;  4CGG A;  1FKP A;  4W5Q A;  4E7I A;  4Q0B A;  3SCX A;  3VQ6 A;  4XIU A;  4FZX C;  1BIU A;  4ZTJ A;  4DTX A;  4ELV A;  3CG7 A;  3D45 A;  4CIG A;  1SL1 A;  4DQI A;  1SKR A;  3QEX A;  2X78 A;  1HJR A;  4DS5 A;  4KFB A;  5HRS A;  4Z4I A;  1RBU A;  1NKC A;  2DFH A;  2RPI A;  2A1S A;  3HST B;  3NF9 A;  4RW8 A;  1S9G A;  2XO7 A;  4KHW A;  4CEA A;  3PO5 A;  2FBT A;  5CZ2 A;  4BDZ A;  4FCY A;  1WLJ A;  4NYF A;  1LAW A;  3DYA A;  3LAM A;  4DF8 A;  4Z4H A;  4DLG A;  4DSF A;  1NK6 A;  1NKB A;  2HVH A;  3SUN A;  4QAG A;  1NK4 A;  3V1Q A;  1TL1 A;  3M8P A;  1RTJ A;  2BAN A;  3HP6 A;  1KLN A;  1QSL A;  5HRO A;  3E01 A;  4C8M A;  1HRH A;  1U04 A;  1FXX A;  4AHS A;  2XHB A;  2G8V A;  3KLE A;  3HP9 A;  3NH2 A;  3JYT A;  4FLT A;  3TAN A;  3QO9 A;  1BI4 B;  2F8T A;  4IG3 A;  3L2V A;  3DLE A;  3ASM A;  3P83 D;  4ZHR A;  3VQ8 A;  4FW2 A;  1U45 A;  5T7B A;  2OZM A;  3NH0 A;  4F8R A;  5EU7 A;  3NCI A;  4CFC A;  2DTU A;  3TAP A;  1LAV A;  1VSI A;  4N56 A;  1T05 A;  1IKW A;  2QK9 A;  1WSJ A;  3PO4 A;  3QLH A;  3OYF A;  4CFA A;  4AH9 A;  3SI6 A;  3TAR A;  1XI1 A;  5E41 A;  3ULD A;  5I3U A;  4N47 A;  3RR7 A;  2B4J A;  2E6M A;  4E1M A;  4CCH A;  4DTU A;  1QTM A;  3KLI A;  4E7K A;  1GOB A;  3RRG A;  1NOZ A;  3RWU A;  3IS9 A;  1LWF A;  3FFI A;  3KKS A;  2W42 A;  1CLQ A;  4PY5 A;  2EHG A;  3SUP A;  4ID1 A;  4B9N A;  3DM2 A;  3LZI A;  2P5O A;  4GVM A;  4LH4 A;  1C1A A;  2Y1I A;  4NCB A;  1RT7 A;  2XRI A;  1HPZ A;  3M8S A;  3LAN A;  4JS5 A;  4FM2 A;  1WSE A;  5KRT A;  3OJS A;  3ALY A;  4FLY A;  4FJ5 A;  4FW1 A;  4FK4 A;  4N41 A;  4GMJ B;  5SWM A;  1ITG A;  4DTR A;  5HLF A;  2G8I A;  3TAB A;  4DFK A;  4Z4F A;  5KRS A;  3WNH A;  1QHT A;  1S5J A;  1QSS A;  3IAY A;  4FZY A;  1RT4 A;  4K8Z A;  3HVR A;  4YNQ A;  3OYN A;  4N5S A;  1N5Y A;  2VWK A;  4CFD A;  4OPK A;  1GOA A;  2VG7 A;  1T03 A;  1L5U A;  1W9H A;  1IO2 A;  3ZSZ A;  3S3M A;  3PV8 A;  4DFP A;  4KHS A;  4AHT A;  1JL1 A;  1QS4 A;  3M8Q A;  3PUF A;  3TI0 A;  3ZT0 A;  3DLB A;  1ZBF A;  4C8L A;  2Q3S A;  4CHO A;  4B9L A;  2E6L A;  5DK5 A;  3SNN A;  3NHG A;  4RW6 A;  4EP5 A;  5CZ1 A;  4LD0 A;  1QQC A;  1TGO A;  3DLG A;  4OKJ A;  1JL2 A;  3V9Z A;  4DU4 A;  3PX4 A;  4CER A;  1ASW A;  1A5X A;  1VSM A;  3K5O A;  5HRN A;  2PYJ A;  1VSL A;  3AA4 A;  3DOK A;  1EXQ A;  4EZ9 A;  1JLQ A;  5C24 A;  1O1W A;  4BE2 A;  5J2N A;  2HHS A;  3F73 A;  2HHT A;  2OPR A;  4DTM A;  4CHY A;  1C0T A;  1EKE A;  1C1B A;  3OYA A;  1BIZ A;  1S6P A;  3DOL A;  2QXF A;  4RW4 A;  2NUB A;  5K14 A;  1C0M A;  3NF8 A;  3V1O A;  3QER A;  4N76 A;  2O4I A;  4AHU A;  2KZZ A;  4IDK A;  1GOC A;  1S1T A;  3A2F A;  2HHQ A;  1HYS A;  4J2D A;  3SUQ A;  3DLH A;  4I7F A;  4KAZ A;  4CGJ A;  4CJR A;  1IKX A;  1YTA A;  4E7J A;  4FJ7 A;  2HHV A;  3LWL A;  4HTU A;  4KHQ A;  3U6F A;  4CJF A;  3LP0 A;  4ELU A;  5HRP A;  4HUF A;  4KB0 A;  4FK0 A;  2HMI A;  4O5B A;  3QEP A;  3OS1 A;  3THV A;  3ZSR A;  3AVI A;  1B9D A;  4CEE A;  4CJL A;  4CJU A;  1BQM A;  3SJJ A;  1UA1 A;  2HW3 A;  5JS1 A;  1HQE A;  3KIO A;  2RF2 A;  1VSJ A;  1ZBH A;  4CES A;  1LW2 A;  3NF7 A;  3VQ7 A;  1L3V A;  1RDA A;  4IFY A;  3M8R A;  3RMC A;  4FXD A;  1VSK A;  3LP3 A;  3V4I A;  1I39 A;  3CFR A;  3OS2 A;  4W5R A;  3SPY A;  3PX0 A;  4C8N A;  4CJ4 A;  4LSN A;  2WON A;  3VA3 A;  3AVB A;  2Y1J A;  3TWH A;  4DF4 A;  4E1N A;  3ZSX A;  4AIL C;  3ZSW A;  3K2P A;  4Y1D A;  2E4L A;  1NK7 A;  1IH7 A;  3QIP A;  2WOM A;  3V6D A;  4DSI A;  3T3F A;  1UWB A;  1RIL A;  1ASU A;  1TKT A;  1J53 A;  4IG0 A;  4CF2 A;  5I42 A;  4Z4E A;  4CJK A;  1TAU A;  2KFN A;  1HYV A;  4FVM A;  3ZT2 A;  3DI6 A;  2P51 A;  3MEC A;  1WSF A;  1RT2 A;  2YNI A;  4BAC A;  3SQ4 A;  3TR8 A;  5J2M A;  5D3G A;  4CJW A;  3RMA A;  4CJT A;  5J2P A;  4FJJ A;  1BCM A;  2IDO A;  3OYI A;  3VN5 A;  2HHU A;  1TVR A;  1VK0 A;  1U4B A;  4TSX A;  4FJN A;  1SUQ A;  4QCL A;  1L3T A;  4OGC A;  2Z1G A;  2OYQ A;  5HP1 A;  1REV A;  2D0C A;  4F2R A;  1RT5 A;  4M3T A;  1CXU A;  4DS4 A;  4W5T A;  1J5O A;  1C1C A;  5CY4 A;  2EX3 A;  1DLO A;  2HND A;  4DU3 A;  3NAE A;  1KVA A;  1U49 A;  4KTZ A;  3OYH A;  4C8O A;  4JRQ A;  3O4Q A;  1KTQ A;  1UA0 A;  4I9Q A;  1S1X A;  4CGH A;  1NK9 A;  3QIN A;  4DTO A;  4BDY A;  1X9S A;  4Q5V A;  1C6V A;  3L2R A;  4M3Y A;  4YFU A;  4BWM A;  2IGI A;  4Z4C A;  2D0A A;  1CZ9 A;  2YNH A;  3WNG A;  3MXJ A;  3C95 A;  4RW7 A;  5FDL A;  4I2Q A;  1D9D A;  3TAG A;  3AVG A;  5FRO A;  3LDS A;  1KLM A;  1BCO A;  1K6Y A;  1ASV A;  2P1J A;  4FM0 A;  4DQP A;  1ZBI A;  2OPP A;  3IRX A;  4J2A A;  1WNS A;  3OYB A;  1TV6 A;  1Y97 A;  2P5G A;  1DTT A;  4DWI A;  4OJR A;  4LSL A;  3VA0 A;  3C6T A;  1RDD A;  4DTP A;  1G15 A;  3AVC A;  3L3V A;  2IS3 A;  1X9W A;  1ZBU A;  4HCC A;  1DTQ A;  3AO5 A;  3QIO A;  2HHW A;  2GV9 A;  1S6Q A;  4PQU A;  1NK5 A;  4CJV A;  1TK5 A;  1BI4 A;  4JS4 A;  1TK8 A;  1RDC A;  4DSK A;  2YKN A;  3JSM A;  3K58 A;  2GUI A;  3SYZ A;  4M42 A;  4CHP A;  2ATQ A;  4FM1 A;  1LWE A;  1NJZ A;  4DQS A;  4IBN A;  1HNV A;  1SL0 A;  2G8W A;  1UAX A;  3I0R A;  4CHQ A;  4FLV A;  4B8C A;  2PY5 A;  4KRF A;  3LP1 A;  4W5N A;  1TKD A;  1NOY A;  4M45 A;  2ETJ A;  3AO4 A;  1KFD A;  4CF9 A;  2RN2 A;  3HYF A;  2BDP A;  5JS2 A;  4C8K A;  4FJ9 A;  3P5J A;  4FJL A;  3K5L A;  1XC9 A;  3HK2 A;  3VQ4 A;  1JLE A;  1NJW A;  2KQ2 A;  2Z1H A;  3OYM A;  1N6Q A;  3DRS A;  3SQ2 A;  1X9M A;  3NFA A;  3RTV A;  3K57 A;  3V9X A;  4B9M A;  5FRN A;  5KI6 A;  3IG1 A;  4O4G A;  4GW6 A;  3OYD A;  2I5J A;  1NK0 A;  4KV8 A;  3ZSO A;  4H8K A;  4CJP A;  3CFO A;  2F96 A;  3HPO A;  4FLX A;  1TK0 A;  3UIQ A;  4DU1 A;  3P1G A;  2HB5 A;  5J2Q A;  4KTQ A;  4FYD A;  4FJH A;  1IKV A;  1KSP A;  3SZ2 A;  4O55 A;  4B9S A;  2KTQ A;  3KD1 E;  4DG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...