4DMNA

Hiv-1 integrase catalytical core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
145
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase
publication title Multimode, cooperative mechanism of action of allosteric HIV-1 integrase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 49
structure length 145
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dmnA00
2PYLA 3V9XA 3KD5E 1TKTA 1W9HA 2DFEA 4CJSA 2HHWA 4FJMA 1RT6A 3DLGA 4KV8A 4HCCA 3AO4A 1VSIA 3HPHA 3HM9A 2EX3A 4RW8A 3O3HA 1RDCA 1RT1A 2IGIA 3CFPA 1KVCA 3AVKA 3QO9A 4DSFA 1X1PA 4AILC 1C0TA 3ZSXA 3SI6A 2HNDA 4RW6A 1RBTA 3OYBA 3OYDA 2ZE2A 2FBTA 3I0RA 4KKOA 4FCYA 4CHYA 1WAJA 1LV5A 1JKHA 1CXQA 1KVBA 1HJRA 1TL1A 1XC9A 4FXDA 2Y1JA 1VSEA 1ASWA 3CM5A 1QS4A 3NF8A 3B6OA 4AHRA 3V9ZA 2I5JA 4FLVA 4KB0A 3DRSA 2WOMA 1J53A 4OGEA 1SKRA 3PY8A 4WE1A 3V1RA 4DTXA 2YNGA 4I2QA 4PQUA 3SUQA 4CEZA 3LDSA 1WSGA 4DSIA 4FJ5A 2E6LA 4DU3A 4J2DA 4CFBA 3DLHA 4ZHRA 2B6AA 1R0AA 3SV4A 3G0ZA 5HBMA 4KHYA 1C0MA 3S3NA 1BISA 1NKCA 3OYFA 1NOYA 4PUOA 4M3RA 1ZBIA 2YV0X 4C8KA 4NCBA 3OYIA 1TK0A 1WN7A 3NE6A 1ASVA 3CM6A 4I9LA 3LAKA 2VWJA 4E7HA 3LP2A 3SYZA 4DTOA 1X9SA 1NKBA 4M3XA 2IDOA 5J2NA 1CLQA 3V9UA 1XWLA 3K57A 2BE2A 3ZT2A 3SQ4A 1T03A 3VQEA 3U6FA 4M42A 1BI4B 3HPGA 3ITHA 4Z4CA 3KLGA 4Z4GA 3V9WA 3VQ7A 4QCLA 2XY8A 1VRTA 4N47A 3TANA 4J2BA 2YHAA 3DRRA 3VA3A 3QNNA 4FK0A 4CJ3A 4OPKA 1ZBUA 4CJLA 4ID5A 4DTRA 4OKJA 4CERA 2OA8A 4L8RB 3ALYA 4KHQA 2JLEA 3M8RA 2PZSA 4CEQA 1TGOA 2GUIA 1WAFA 4N5SA 4E3SA 1ZBHA 4CCHA 1UA1A 1U48A 3O4QA 1RT2A 1JLCA 4AHVA 1QQCA 4BWJA 3T3FA 3AA2A 1WSFA 4FYDA 3O3GA 2RKIA 1B9DA 4CESA 4BWMA 3QEVA 3HVTA 4DLEA 1IG9A 3T1AA 3ZSZA 1Y97A 3OYGA 4O4GA 4O5BA 1BCOA 1TVRA 4O0JA 1HMVA 1RT5A 1J5OA 4CEBA 1ZBFA 3AVNA 4ICLA 3RMAA 4AHSA 4LY7A 2RPIA 1HPZA 4CEDA 4RG8A 1L5UA 2Z1GA 3QIOA 3NAEA 5KRSA 1L3VA 4RW9A 2P51A 2D0CA 3MEGA 3F73A 4CJ5A 1JLEA 4O0IA 4LSNA 4CIEA 3LAMA 5I3UA 2P1JA 4EP5A 2O4GA 4CJPA 4CFDA 4NCGA 2XO7A 3K5LA 4KTQA 4JRPA 1TKZA 4RW4A 1DTTA 1RBVA 3V1QA 3HXMA 4F4KA 5EU7A 2BDPA 2E6MA 3L3UA 4DFKA 3QERA 3TAQA 1WSHA 2G8UA 3TR8A 4KO0A 4N56A 1B9FA 4M3TA 3MXJA 3NH0A 1EETA 5C25A 4DQSA 4DTUA 2G8FA 3NBPA 3KIOA 4AH9A 4OLAA 3DRPA 4CJKA 1DLOA 1U45A 1D9DA 2XHBA 4KTZA 3TABA 2Z1HA 3UIQA 1KLMA 3I0SA 1IKXA 1JLAA 3MEDA 3EZ5A 1RILA 3OYCA 1GOAA 2XY5A 4QOZB 1Q8IA 4CGFA 1NJYA 3U3YA 4FJXA 3AVLA 2YNIA 2D0BA 3AA4A 2HMIA 4IG3A 5CZ2A 4Z4FA 1HYSA 1KVAA 4ELVA 1RDAA 3CFOA 1G15A 4CF9A 4CHOA 3OS2A 1LAVA 1D8YA 1S9GA 3WNGA 3ZSOA 1VSLA 1QTMA 4KPYA 1J54A 1WSIA 4KHWA 3QIPA 2DY4A 4DMNA 3K5OA 4PY5A 4HCBA 5CYQA 3OVNA 4FW1A 1S6PA 3L8BA 4C8LA 4J2AA 2YKNA 4CK2A 4MFBA 5D3GA 1LWFA 3QNOA 1YTAA 2XRIA 4JS5A 4HUGA 4CGIA 4G1QA 1BIZA 3SPZA 3RMDA 5K14A 3KLHA 1RBRA 3K2PA 3CYMA 1LWCA 5E41A 3CG7A 3LWMA 1KFSA 4MQ3A 1MU2A 4DU1A 1IKWA 2FC0A 3RRHA 2IOCA 4JS4A 1RTIA 2FBVA 1NK6A 2YNFA 1I39A 4HTUA 1UAXA 3C94A 4JLHA 5J1EA 1RNHA 1NK0A 4FJIA 4LSLA 1HRHA 3K5NA 3NDKA 3PV8A 1C6VA 1BIUA 3T19A 3VQ5A 4FK4A 3LZIA 4EZ6A 1SKSA 4W5QA 3OS0A 3OYHA 4CGGA 1KTQA 5J2MA 3RRGA 2OZMA 4KREA 1VSDA 1L3SA 3VQCA 4CEAA 3P83D 3ZSYA 4FJLA 1REVA 4KHNA 3IRXA 4CF0A 1XI1A 5SWMA 1JL1A 4E7IA 1FKOA 2IC3A 3OJSA 3K5MA 4JRQA 3NGIA 4CJUA 4BDYA 3AVBA 5J2QA 4CIFA 2G8VA 4ELUA 2YHBA 4NYFA 3VA0A 4O44A 4CE9A 3AO1A 4B8CA 2F8TA 3PX6A 1RTDA 4CHNA 1KCFA 4LH5A 4QAGA 4FZXC 3SJJA 3SNNA 1D9FA 1ITGA 3RMBA 1QSSA 4CGJA 1HNIA 3LP0A 2QK9A 1QSYA 2W42A 3ZT1A 3OJUA 1WSJA 3AO2A 3AO5A 4BE0A 3C6TA 4CF2A 2NUBA 1NK9A 4DS4A 3KKRA 4EP4A 3OYJA 2OZSA 5JS1A 1DTQA 1BGXT 3OYAA 3DMJA 4F2SA 1T05A 2Z1JA 1C1CA 3DLRA 2R7YA 5SZTA 3ZT0A 1GOBA 3CFRA 3AVHA 1NK5A 3NF9A 3O3FA 3ZSRA 1UOCA 4W5TA 1ZBLA 4N76A 3ZSWA 1FKPA 2F8SA 1VK0A 3OYLA 3TAEA 1TK8A 3OS1A 4B9TA 3MEEA 2ZQBA 3AV9A 1KFDA 3NCIA 5CZ1A 3AVJA 3DLEA 2OPRA 2F96A 3VQ4A 3AVIA 4PA1A 4UQGA 1LWEA 4DQIA 4B08A 3H08A 3ZSVA 3MECA 1QHTA 2IAJA 4Q5VA 4M45A 2OYQA 1CXUA 1X9MA 4OVLA 2HHUA 3QEPA 3DLKA 4OKEA 4DF4A 1N5YA 1VSJA 3L3VA 4DTMA 4DTJA 3E01A 4B9VA 1NJZA 3U3GA 4M3UA 3HK2A 2KZMA 4KI6A 2BGGA 4FLXA 4E89A 1TL3A 2VG6A 2HNYA 3TAGA 4DF8A 3SUNA 1Q9XA 4DSLA 3VQBA 4Z4HA 4ZTFA 1JLQA 4I9QA 3DOKA 3QETA 1UA0A 3ZSQA 3DYAA 4CJTA 3L2QA 4W5RA 2KFNA 2KFZA 1WNSA 3C6UA 1VSMA 2FBXA 3LWLA 4ZTJA 4CGHA 3NH1A 2G8IA 2KQ2A 5CYMA 1VRUA 5T7BA 4FLYA 1VSHA 4CJEA 1TKXA 4E1MA 3SV3A 1SL2A 1K6YA 4HHTA 3L2VA 3WNHA 3HPOA 2PYJA 3QEIA 2KTQA 2HW3A 3QEWA 4E0DA 1T7PA 4CJRA 4CECA 3NH2A 3NFAA 4FJJA 1FXXA 1NK4A 1C1AA 4XIUA 1IH7A 1IO2A 1LW2A 1SKWA 4CJWA 4DFMA 3AVCA 1N6QA 3KK2A 4CF8A 3V81A 2P5GA 1WSEA 1NJXA 4AHUA 1TKDA 1NKEA 2Z1IA 3AO3A 3MAQA 3QESA 5HRRA 4FJNA 4DTPA 3PUFA 1LAWA 1TV6A 3BDPA 3G10A 4I2PA 4IDKA 1ASUA 1SL1A 1S1WA 1RCHA 1S5JA 3D45A 3VQQA 3DM2A 3ULDA 4FZYA 4W5NA 4FLUA 4B9SA 5CY4A 3KK3A 3K59A 4FM1A 2QXFA 2OPPA 1L3UA 2RN2A 4IFVA 1HYVA 3IG1A 4RW7A 1EX4A 1RT4A 2GV9A 5HROA 3LP1A 3L2RA 4KRFA 3BGRA 3VQDA 2X6NA 4KTWA 3PX0A 1BQMA 4LD0A 4F3TA 1S9EA 4CEFA 2GBZA 1VSFA 3M8PA 3LALA 3TAFA 4F2RA 4CK3A 1SL0A 3KK1A 4K8XA 2RF2A 3NF7A 3PX4A 3LPUA 4DQQA 4B9NA 4M41A 1XHXA 1SV5A 4DQPA 4GMJB 1YVUA 3TARA 1YT3A 4GW6A 4NCAA 2P5OA 4E7KA 1GOCA 2OPSA 2DTUA 4DQRA 1BQNA 4Y1CA 4F3OA 3HT3A 5C24A 4BDPA 3MXMA 1HYZA 3L2UA 3AVAA 1U47A 1XHZA 3V9SA 4BE1A 3THVA 2EHGA 3SUPA 4H8KA 3HL8A 1NJWA 2XY6A 2G8HA 3RR8A 1U04A 4KAZA 3M8QA 2D5RA 2HHVA 1UWBA 1QE1A 4FVMA 4FJ7A 3B6PA 3VN5A 4DWIA 3HSTB 3S9HA 4CIGA 4BACA 4B8AB 4Z4IA 1ZYQA 4N41A 2X6SA 2ATQA 1L3TA 4Z4EA 4FJ8A 4M3WA 4AHTA 5DK5A 1U4BA 1YTUA 2VG5A 3HP9A 4KFBA 3HO1A 1S1XA 3NGYA 4DTNA 2QKBA 5FRMA 2ITGA 1W0HA 3L2WA 1BI4A 2D0AA 3PO4A 4C8OA 1JLGA 3SUOA 1RBUA 4AHCA 1BCMA 1LW0A 1NK8A 2KZZA 1CZ9A 5FROA 3SZ2A 2O4IA 2AJQA 1HNVA 3KLEA 2IS3A 3KJVA 3TAMA 4B9LA 4HVJA 3EY1A 3D0PA 3IAYA 4FK2A 2Y1IA 2HHSA 1HQEA 1A5VA 4FM0A 2B5JA 3C95A 3KTQA 3ASMA 2DFFA 3SCXA 4CHQA 3QLHA 2LSNA 3OY9A 3LP3A 1A5WA 3VQAA 3OYEA 4O55A 3ISNC 1BL3A 3QINA 5FDLA 4DSJA 3NF6A 4FW2A 2VG7A 3O4NA 3VQPA 3HP6A 3ZCMA 4CJVA 3HVRA 1S6QA 1Z25A 1BHLA 4E7JA 3NHGA 4DFJA 4KI4A 4CHPA 4I7FA 3AVMA 5KGXA 3CQ8A 2X78A 3F9KA 4HUEA 3V4IA 4E1NA 4DS5A 3V6DA 5FRNA 4DU4A 1WLJA 3P5JA 4ID1A 4CF1A 2G8KA 3AVGA 4CEEA 4CHZA 4M3YA 4IBNA 2Q3SA 3AVFA 2XY7A 1C0UA 4FM2A 1HQUA 4KB1A 1S1TA 3MXIA 1B92A 3LPTA 2FBYA 2WONA 3S3MA 2B4JA 4DSEA 4YNQA 4DSKA 1SUQA 4LH4A 2A1RA 1EP4A 1TAUA 2HHQA 3NGZA 5DMRA 3TWHA 4KHSA 3EYZA 1NK7A 1EKEA 2HHXA 4GVMA 4B9UA 1KLNA 3RR7A 1S1UA 2A1SA 2OPQA 4J2EA 2X74A 3WNFA 1JLFA 1QSLA 4CJ4A 4ELTA 1NOZA 1TAQA 4FLWA 4PWDA 3JSMA 2HNZA 1KSPA 4FZZA 2E4LA 3AA5X 3VQ8A 3TAPA 4FJHA 3TI0A 3IS9A 3RTVA 1A5XA 3P1GA 1VSKA 3SQ1A 5HLFA 2HB5A 4DLGA 3I8DA 1KRPA 4OGCA 3OYKA 4OPJA 1EXQA 4FLZA 1RDDA 4OKKA 5KI6A 1S1VA 5HRNA 1FK9A 3KD1E 3JYTA 3AA3A 4M3ZA 3OYNA 2JGUA 1T8EA 3QEXA 1IKVA 1JXBA 4YFUA 1JXEA 3LZJA 3FFIA 4CGDA 3SQ0A 1IKYA 3DI6A 2HVHA 3A2FA 1J9AA 4H4MA 4E19A 5KGWA 1RT3A 2HVIA 2PY5A 3WNEA 4Z0UA 4CK1A 4FJ9A 4C8MA 2HHTA 4HUFA 3KLIA 1JLBA 1Q9YA 4B9MA 4EZ9A 3KLFA 4DG1A 4BE2A 5I42A 4CFCA 2ZD1A 5KTQA 3LANA 3HJFA 3V1OA 2DFHA 4FLTA 3K58A 1X9WA 2YKMA 4FJGA 4DTSA 4W5OA 3PO5A 3HYFA 2QKKA 1RT7A 4C8NA 5C42A 1O1WA 1RBSA 3VQ6A 4OJRA 3S3OA 5JS2A 3DLBA 4Q0BA 4NYNA 3M8SA 2KW4A 4IKFA 4TSXA 1I3AA 2ETJA 4IFYA 5J2PA 3ZT3A 3RMCA 4B3OA 1CZBA 1D5AA 5KRTA 3SQ2A 2VWKA 4CJFA 4KHUA 1Z26A 2YNHA 4CFAA 3KKSA 4CJQA 5HRSA 4E7LA 1F21A 4H4OA 1RDBA 3SPYA 1U49A 1TK5A 4DFPA 5HRPA 4K8ZA 3RWUA 3OYMA 4OLBA 3ZT4A 4F8RA 5HP1A 1RTJA 4BDZA 3VQ9A 4R5PA 4FJKA 2BANA 1C1BA 1RTHA 2G8WA 1JL2A 4CEOA 4IG0A 3DOLA 4Y1DA
chains in the Genus database with same CATH superfamily
2PYLA 2E88A 1W9HA 2DFEA 2P9SB 3UKUB 4FJMA 3CIPA 4HCCA 1SAZA 3ZX0A 5EVZA 2UU9K 3HM9A 1XUPO 3L4QA 4AILC 3ZSXA 3M5RA 1RBTA 3Q7BA 3BEXA 4CHYA 4BRCA 1JKHA 4FWPA 3PSIA 1TL1A 4JKAA 4FXDA 1KC8O 2YJFA 1QS4A 4WQ5A 4AHRA 3V9ZA 4BRPA 4FLVA 4KB0A 3HZ6A 3K9KA 1N32K 4GV6A 2WOMA 4DR4K 3O8MA 4WE1A 4DTXA 2YNGA 4I2QA 1HUXA 4K42A 2E6LA 4J2DA 4IXCA 4IO8A 3G0ZA 3H1QA 1C0MA 3S3NA 4PUOA 1ZBIA 3OYFA 1NOYA 4BRGA 4A57A 5BREA 3CM6A 4I9LA 1VQKN 3SYZA 3NVKA 5AQHA 3OBYA 1K8KB 4DKWA 3ITHA 4Z4CA 3V9WA 3VQ7A 4QCLA 1VRTA 3TANA 1ZBSA 2IVPA 3VA3A 3QNNA 3MCPA 3VGKA 4BQLA 3CJ9A 4N5SA 1WAFA 4E3SA 5AQZA 3O9TA 3VPZA 5LY3A 4CD1A 5BR8K 3O4QA 5M1QA 2RHKA 4AHVA 1QQCA 2CGLA 3MK6A 3T3FA 4DV7K 1IG9A 3T1AA 1Y97A 4O4GA 3FLCO 4DR3K 4H0YB 4PKHA 3AVNA 4H5WA 1OVYA 4AHSA 4LY7A 3ZEUA 3NAEA 3VTIA 3TSQA 4BQZA 4LSNA 4CIEA 2O4GA 2QTDA 4CFDA 1TKZA 4JKDA 3HXMA 3ZYYX 1JJ2M 3QERA 5AZIA 3TR8A 3H6EA 3NH0A 4DQSA 5C25A 3HOTA 1NGHA 2KLAA 3EKSA 2XHBA 3UIQA 4JKCA 4BRHA 2E1YA 3MEDA 3MDQA 5M1KA 3OYCA 4X64K 1KAZA 3SJHA 1Q8IA 2F7TA 1NGFA 1HJOA 4RTFD 4WQ4C 4FJXA 4FSVA 1HYSA 3AA4A 4IG3A 4A62A 4RCHA 1G15A 1D8YA 1LAVA 1S9GA 1ATRA 3THYB 3ZSOA 1QZ5A 3WXIA 1J54A 3MX5A 3GE1A 2ZWHA 3OVNA 1S6PA 1K9MO 5C15A 4C8LA 2YKNA 4CK2A 4WFAL 3KWGA 4NLCA 5D3GA 4IWVA 1N36K 4HUGA 2Q97A 4O8UA 3KLHA 1RBRA 3K2PA 1LWCA 3CG7A 1MU2A 4LF4K 2IVNA 1HX1A 3SBTA 2YNFA 3AY9A 3D7EO 3C94A 5J1EA 1OVQA 1O13A 4FK4A 4BROA 3LZIA 3OS0A 2QXLA 3OYHA 2NRRA 1VSDA 3H46O 3O9UA 1L3SA 1KD1O 4PHTX 4H0TB 2QI2A 3OTOK 3OJSA 4CVNE 3ENHA 5J2QA 4ELUA 2OTJN 4B8CA 2I7PA 1RTDA 3G71N 4JKEA 1D9FA 4CGJA 1HNIA 1N33K 2P9IA 3T69A 2P9PA 4CF2A 5JS1A 3KKRA 4B1XB 3C65A 1DTQA 3DMJA 2D4WA 2O8DA 1C1CA 1TYQA 2HF3A 2R7YA 3ZT0A 1NGEA 1NK5A 2GEMA 3CETA 3CXCM 3QB0A 2BUPA 4LC9B 4B9TA 3THXA 3MWPA 4DV3K 3AVJA 3C6HA 3AAQA 3AVIA 2ITMA 3ZSVA 1QHTA 4M45A 1CXUA 3QEPA 3DLKA 4DF4A 3C7NB 1BG3A 4JKHA 1BWFO 1OH7A 4MO4A 2VG6A 3O9QA 3TAGA 3SUNA 5AQKA 3VQBA 4Z4HA 3QETA 2Q31A 3UKRB 3DXKB 1Y64A 1WNSA 3SMPA 3R6MA 1BOTO 2O8CB 4FLYA 3SV3A 1XMQK 5BR9A 1DGKN 1SL2A 3J80O 5C2DA 3L2VA 4CECA 2ASMA 4FJJA 1FXXA 3CJ7A 4BY9C 3BUZB 2F9WA 4DFMA 3AVCA 1N6QA 1QQMA 1TKDA 1VQ4N 3AO3A 3QESA 4YDUA 4B9QA 3E9PA 4DTPA 2O8BB 4BR4A 4IDKA 3VQQA 4WCEL 2QWMA 3ULDA 4W5NA 3A5OC 3FZLA 1VQPN 5CY4A 1C0GA 1GLCG 4DHYA 1ATNA 2PBDA 3WXMB 4RW7A 3KHYA 3ATUA 3BGRA 3PX0A 4F3TA 1NGBA 3M8PA 3IKMA 3G4SN 4K8XA 4DR7K 3NF7A 4DQQA 4DQPA 3BY5A 1SV5A 4GMJB 1IG8A 1YT3A 5TKYA 3E9LA 2QWQA 4DQRA 1NJIO 1VHXA 4H5TA 4U7BA 4BE1A 5M1NA 1NJWA 3DXMA 1U04A 2HHVA 1UWBA 3D2EA 3F9MA 1FJGK 4CIGA 4B8AB 4Z4IA 2W6KA 4MLEA 2X6SA 1L3TA 4Z4EA 3ZX2A 3HP9A 3HO1A 3L2WA 2KKZA 1CZ9A 2AJQA 1HNVA 2IS3A 3TAMA 3IAYA 2Y1IA 3BZCA 1A5VA 3H45C 3KTQA 2DFFA 4CHQA 3A5MC 2LSNA 3VQAA 4O55A 3ZETB 5FDLA 5BRFA 2ASOA 4DFJA 1S6QA 3VF6A 4E7JA 2YHYA 1K8AO 3V4IA 4LF9K 5FRNA 4DU4A 3QMLA 4CF1A 5JICA 4M3YA 4IBNA 3NVMA 1VQON 5AQJA 4KB1A 3SK3A 4DUZK 4BR7A 4DSEA 5M1FA 4DSKA 1XMOK 1QZ6A 3NGZA 3ZX3A 3EYZA 2D0PA 4H0OA 3IUCA 5FPEA 1X3MA 1KLNA 4J2EA 4PWDA 4IEIA 2YX6A 3DJCA 3KZBA 4BRQA 4DR2K 4FLWA 3TAPA 3TI0A 3SQ1A 3P1GA 5HLFA 4FLZA 1EXQA 4C1NI 1RDDA 4A59A 5HRNA 1S1VA 5AQWA 1RGIA 1IKVA 1JXEA 4FWKA 1HNWK 1JLBA 1Q9YA 4EZ9A 4BRDA 3KLFA 3D2FA 2HHHK 4E1JA 3MMVA 4H0PA 2P9UB 3PO5A 5AQVA 3B8AX 4I6MA 3WEEA 3TTCA 5JS2A 4Q0BA 4BC2A 3P4IA 2UXDK 2ETJA 2Q36A 4Y0WA 4YDUC 2JWKA 3OHRA 3RMCA 2GWKA 2J4RA 4CJFA 3KKSA 4E7LA 3EE9A 3SPYA 3FFKB 4HWIA 3CPWM 4DFPA 1U49A 5HP1A 4IFEA 4FWSA 1RTHA 4B3SK 4Y1DA 4BGBA 3K9JA 3KD5E 3PSFA 3ENBA 1NG9A 1LCUA 3AO4A 3ENOA 2ZM6K 1VSIA 2NRTA 2P9LA 3VGMA 4JHDB 2IGIA 4DSFA 3AVKA 3SI6A 4RW6A 4KKOA 3I0RA 4JV5K 3VESA 3UB5A 2Y1JA 1VSEA 1ASWA 3CM5A 2I5JA 3VF4A 3V1RA 4PQUA 2VWBA 4DCHA 4CEZA 3LDSA 3C6AA 1WB9A 4CFBA 4YOTA 3SV4A 1ESVA 3HBTA 5HBMA 1BISA 2YV0X 1WN7A 4JKGB 4DTOA 1NKBA 1BA1A 1EWQA 3LP2A 4M3XA 2IDOA 1CLQA 4PL7A 4B3MK 1XWLA 2BE2A 3SQ4A 1QVFM 4Z4GA 4C23A 4GV3A 1BUPA 4N47A 2I7NA 4FK0A 4PKIA 2V52B 4CERA 4L8RB 1NWKA 3ALYA 1N8RO 3M3ZA 3ID6A 1U48A 2O8FB 1JLCA 3O4WA 4BWJA 4FYDA 3O3GA 4FWOA 1B9DA 2V51B 3WUHA 5DM6L 2V7YA 1TVRA 4O0JA 1HMVA 1QVGM 4CEBA 2QWLA 4ICLA 1MWKA 1HPZA 3E66A 3H1VX 3O08A 2Z1GA 3QIOA 5KRSA 4X62K 3LAMA 4EP5A 2XO7A 4RW4A 1U2VB 3E9OA 3R9PA 2BDPA 2VCPA 3CJAA 1IBKK 5BRHA 4KO0A 1B9FA 3MXJA 4YOWA 4DTUA 4OLAA 2G8FA 3NBPA 4AH9A 1D9DA 1U45A 2OTLN 4KTZA 2FXUA 3LDPA 4BC5A 3I0SA 3MN5A 1IKXA 5FPNA 1MDUB 3EZ5A 3LDNA 1RILA 2OANA 1GOAA 2XY5A 4QOZB 3MN7A 3W3DA 2OCEA 2YNIA 2D0BA 2HMIA 5CZ2A 1KVAA 4XH4A 3SBGA 4ELVA 4BC3A 4CF9A 3OS2A 5AQMA 5FLXO 3WNGA 1HKBA 1MA9B 4K41A 1QTMA 4KHWA 5KQDA 3K5OA 1NNEA 3W0LA 3BF3A 4FW1A 1V4SA 4J2AA 3VETA 1VAZA 5M1OA 3VMFB 5FPMA 3QNOA 1YTAA 4CGIA 3MX2A 3SPZA 5LL6Z 5E41A 1KFSA 4MQ3A 3QDKA 4JI1K 4LF8K 3FZKA 2HSTA 4ILJA 1RTIA 2FBVA 5AQFA 4HTUA 1UAXA 1ZXOA 3J7YP 5AFUA 1NK0A 3VEYA 3PV8A 1C6VA 3VQ5A 4EZ6A 4W5QA 4CGGA 2OZMA 3RRGA 2WFBA 3VQCA 4KHNA 1REVA 4BRIA 3CQYA 3RSEA 5SWMA 4E7IA 4JRQA 1CZAN 4NYFA 3LDQA 3TSUA 4CE9A 3PX6A 4BG8A 4B3TK 3SNNA 3RMBA 3LP0A 2W42A 3AO2A 2NUBA 2YCHA 3OYJA 2OZSA 1H1VA 4GNIA 4O5FA 1BGXT 2O8EA 2VGNA 3DLRA 3CFRA 3AVHA 3NF9A 3L0QA 4U67L 2E2PA 5HOOA 1ZBLA 1S3XA 3OYLA 3TAEA 1TK8A 2ZQBA 3G25A 4A5BA 3FZMA 3L6QA 2P9NA 3VEXA 4PA1A 4UQGA 4Z94A 3MECA 4YOUA 1C0FA 2IAJA 4Q5VA 2OYQA 2P9PB 4OVLA 1YI2N 1V4TA 3BF1A 3L3VA 4BR5A 4DTMA 4B9VA 1NJZA 4KI6A 4E89A 1TUYA 2HNYA 3VEWA 4I9QA 5JVGL 1JLQA 3DOKA 1UA0A 3ZSQA 3DYAA 3CCSN 1E4GT 3BZKA 5CE3A 1VSMA 3FE1A 3NH1A 3J7AP 2KQ2A 3O80A 5CYMA 5GAEP 4YHHK 1NGJA 2E2QA 1K6YA 1E4FT 1NGGA 3WNHA 2PYJA 4BRNA 1GLBG 2UYTA 3QEWA 4CZGA 1T7PA 5AQIA 5BN9A 1NK4A 1C1AA 2HF4A 4XIUA 1IO2A 1SKWA 1E3MA 4NXNK 3KK2A 3V81A 2P5GA 3N4PA 4JD2B 3MAQA 3MWTA 3CMAN 3PUFA 1LAWA 1TV6A 4I2PA 4JK7A 1NMDA 3CJCA 1GLLO 3HM8A 4MDAA 3D45A 3LDOA 5KPTA 1BA0A 1XQSC 4FZYA 4FLUA 4B9SA 1K73O 2P9SA 3LL3A 2QXFA 5MLCQ 2RN2A 3IG1A 2A3ZA 1X3NA 3L2RA 4BVOA 4KRFA 4GVEA 4CEFA 3R8EA 2GBZA 3T1HK 5C10A 1SL0A 1NLVA 2RF2A 3PX4A 1BDGA 1XHXA 4NCAA 2DTUA 3CCMN 3VGLA 4Y1CA 3HT3A 4BDPA 4V19S 1Z6RA 3C0BA 1HYZA 3L2UA 3AVAA 1XHZA 3V9SA 5AFUH 2H3GX 3SUPA 4H8KA 3HL8A 1YAGA 4KH6A 2HMPA 4FOIA 2G8HA 4NLBA 3M8QA 4FVMA 5IWAK 1N34K 3B6PA 5KPRA 4BACA 4YOVA 4WQ5C 1ZYQA 4IOAL 2NRZA 4JKFA 4FJ8A 4AHTA 3AARA 4JI4K 4DTNA 2QKBA 4C8OA 2KZZA 1JLGA 4AHCA 1BCMA 1LW0A 1NK8A 1WBDA 3SZ2A 3KJVA 4B9LA 3EY1A 3D0PA 2A41A 3CF5L 4M63C 3ASMA 3DXMB 3QLHA 3OY9A 3OYEA 3D2EB 3HP6A 4OPHA 4JI7K 4CJVA 1Z25A 1BHLA 4KI4A 4I7FA 3CQ8A 4CW7B 2X78A 2UXBK 4DS5A 5AZJA 1P90A 3AVFA 2XY7A 3R1XA 1C0UA 4ISEA 1HQUA 1S1TA 2WBNA 3U8XA 1B92A 1YJNN 2WONA 1XNRK 3CCUN 1TAUA 2HHQA 3TWHA 3OW2M 1EKEA 4A2BA 5GIOA 1HPMA 2E5LK 2D1KA 2X74A 1QSLA 1EQYA 4CJ4A 1XC3A 3TTDA 5GADP 2HNZA 1KSPA 2E4LA 2FF3B 1OH6A 1RDUA 4QS7A 5LMUK 2NRWA 4NXMK 4ISFA 2A6AA 2WC9A 2F9TA 1KRPA 4JEPA 5KI6A 2VGMA 1FK9A 4M3ZA 3JYTA 5CHIA 2JGUA 4LF7K 3LZJA 1U6ZA 4CGDA 3N4QA 2A40A 3DI6A 3IFRA 3A2FA 4H4MA 3ULEA 1RT3A 3WNEA 4Z0UA 4CK1A 3KLIA 4DG1A 4BE2A 5I42A 4CFCA 1DEJA 4FLTA 3CQXA 3GG4A 3LM9A 3HYFA 3CERA 3AGKA 5EOYA 4C8NA 1EO1A 3OBWA 2KW4A 1I3AA 5J2PA 1HLUA 1D5AA 5KRTA 2VWKA 4CJQA 1RDBA 4CBWA 5A2QO 4JI2K 3O9SA 3D2FB 4F8RA 4IOCL 4BDZA 4IO9L 3CMEN 4R5PA 4FJKA 2BANA 1C1BA 2G8WA 5ADXA 3V9XA 3J81O 4WF9L 4I6MB 2HHWA 1RT6A 4KV8A 5BN8A 5BPLA 4DV2K 2EX3A 3A0IX 3GDQA 4RW8A 3O3HA 1RDCA 1RT1A 5GINA 3CFPA 3QO9A 1X1PA 3OYDA 2IVOA 3JS6A 4FCYA 3U4LA 1LV5A 2HBMA 1KVBA 2QW9A 3CC4N 3M1FA 3B6OA 1YF5L 3VOVA 3DRSA 4FWNA 4DV6K 4AF1A 4OGEA 3I55N 1SKRA 1VQ8N 4DSIA 3CJBA 4FJ5A 1GLDG 1QQNA 2NZTA 1T6CA 4ZHRA 5JLHA 1D4XA 2B6AA 4KHYA 4BRMA 2ASPA 4K0KK 3OYIA 4DR6K 1TK0A 3NE6A 1ASVA 1X9SA 3LAKA 2VWJA 4E7HA 5C12A 5J2NA 2HBLA 2NRHA 4RWTA 5DM7L 1T03A 3ZT2A 3VQEA 1BI4B 5M1PA 3KLGA 5AQTA 1JCGA 4CBUA 4CJ3A 4OPKA 2IIRA 4OKJA 2OA8A 4KHQA 2JLEA 3M8RA 2PZSA 4CEQA 1TGOA 2GUIA 3LM2A 1UA1A 4CZMA 2QWNA 2FLOA 3AA2A 3UKRA 1S72N 2RKIA 3ID8A 4CESA 4BWMA 4DLEA 3ZSZA 3OYGA 3P39A 4O5BA 1ATSA 4YOXA 3WXKA 4BRFA 3RMAA 3CJ1A 4CEDA 2DPNA 4RG8A 4G9ZA 1L5UA 3U9DA 4RW9A 2D0CA 3MEGA 4BGAA 4O0IA 3CD6N 5I3UA 4HTLA 1SQKA 4CJPA 2ZF5O 4NCGA 3K5LA 4KTQA 4JRPA 4LFCK 3V1QA 3THWB 3CI5A 2E6MA 3TAQA 1WSHA 3QICA 4M3TA 4KH5A 4CJ7A 3DRPA 4CJKA 1DLOA 2QWRA 2Z1HA 1KLMA 3SMSA 3EE8A 3KK7A 3TU5A 4CGFA 1NBWA 4B3RK 1NGAA 4FWLA 3AVLA 4FO0A 1RDAA 3CFOA 1VQ7N 1M1KO 4CHOA 3TPQA 3CCRN 3PLAA 4LF5K 1WSIA 3QIPA 2NNWA 4DMNA 5CYQA 3L8BA 2W6LA 4MFBA 5ADXH 4KH4A 1LWFA 4EFHA 4G1QA 5K14A 1Q18A 3CCLN 3LWMA 4DU1A 1VQ6N 5AQSA 2IOCA 3I56N 5AQNA 1I39A 1ILYA 3AGRA 3UE5A 2A5XA 4FJIA 1HRHA 4NO7A 1WUAA 3K5NA 3VEZA 3NDKA 2NLXA 1IBLK 5HL7L 1SKSA 1KTQA 4CZJA 3P83D 3SAHA 4FJLA 1VQMN 4CF0A 1XI1A 2WTUA 1FKOA 3NGIA 4CJUA 3MN6A 3WXLA 4BDYA 4CIFA 4O44A 4JN4A 3O5BA 4CHNA 2Q0UA 4QAGA 2BTFA 4FWQA 2QK9A 1QSYA 3ZT1A 3OJUA 1WSJA 4H0XB 3AO5A 2YHXA 4BE0A 3S41A 4BC4A 1RDWX 1T6DA 3ZLJA 3OYAA 4CZLA 5SZTA 1GOBA 4CBXA 3K0SA 3EZWA 3ZSRA 4W5TA 3AAPA 4MO5A 4N76A 1KAYA 3OS1A 3AV9A 1KFDA 3NCIA 5CZ1A 2OPRA 4R79A 4DQIA 3QFUA 4B08A 4CZHA 3H08A 1IJJA 4CZFA 1DT9A 1X9MA 1SS6A 2HHUA 1N5YA 1VSJA 2KZMA 2D0OA 3EO3A 3U3GA 3PIOL 2BGGA 5AQLA 4FLXA 5F1XA 4DF8A 1Q9XA 3CPEA 2FF6A 4CJTA 4JKBA 2KFZA 3C6UA 2FBXA 3LWLA 4ZTJA 4CGHA 5T7BA 1VRUA 2P9NB 4CJEA 1GLAG 3FGUA 4HHTA 4EIAA 2KTQA 2E2NA 1G99A 4IEEA 4CJRA 3ZEUB 3NH2A 2VQFK 2ZJPL 1LW2A 2P9KA 3I33A 1Q81O 4QS9A 3QBWA 4AHUA 4H5NA 2Z1IA 1NKEA 1OKJA 1YJ9N 5HRRA 4WQ4A 4JK8A 3CCQN 1ASUA 5AZIB 2BH1A 1S1WA 4IDHA 2A42A 3KK3A 3K59A 2OPPA 5FPDA 4BREA 2HBJA 4IFVA 4DV0K 1HYVA 1LOTB 1SZ2A 3WQUA 4JHDA 5HROA 3LP1A 1HNXK 3FZHA 3QBXA 4LD0A 2NRVA 1S9EA 1VSFA 3HI0A 3LALA 3TAFA 4WYBA 4QS8A 4A61A 4CK3A 1VQNN 3KK1A 1YVUA 3TARA 4E7KA 2OPSA 4YY3K 1YXQA 3ATVA 3WQTA 2V7ZA 1NGIA 3A5LC 2XY6A 1QE1A 4BRKA 2W40A 3HSTB 3S9HA 4FPAA 4JI0K 4JKGA 4N41A 2ATQA 4M3WA 1JCEA 4DV4K 5DK5A 1U4BA 2VG5A 1YVNA 3NGYA 5FRMA 1W0HA 2D0AA 3PO4A 3HTVA 3SUOA 1T44A 4OPAA 5FROA 2O4IA 3O1BA 4CI6A 1KQSM 4FK2A 2QWOA 1HQEA 5LJVA 3C95A 2O8FA 2JWLA 3LP3A 3ISNC 4FW2A 3SLCA 3ZCMA 4GY2B 4CHPA 5KGXA 3AVMA 4BR2A 4E1NA 1ZC6A 3AVGA 4CEEA 4DUYK 2P9IB 3MXIA 3LPTA 5GAHP 2FBYA 2B4JA 2UUCK 4YNQA 3TSPA 2Q0RA 2O8DB 4PL8A 1TYQB 1U2VA 4KHSA 2HBKA 1NK7A 4GVMA 4MDBA 4FWMA 4B9UA 2A1SA 2OPQA 2GUPA 3THXB 1TAQA 3O6WA 4FZZA 5AQYA 5AQPA 3O1WA 2UUAK 4FJHA 5AZJB 3J8AA 3RTVA 3CHWA 3OYKA 4OPJA 3KD1E 4OKKA 2E2OA 3MCAB 3QEXA 1OH5A 2FSJA 3FFIA 2HVHA 1J9AA 5KGWA 4A2AA 2RE2A 2PY5A 4B9MA 4B1ZA 5JVHL 3HJFA 5AQQA 3V1OA 2CGJA 3H3NO 3K58A 2EWSA 5F0XA 4DTSA 4W5OA 3VTHA 1RT7A 3UKUA 1RBSA 3WT0A 3DLBA 3NMUA 4IFYA 3ZT3A 2Q1NA 4B3OA 1CZBA 3SQ2A 4KHUA 1Z26A 4IZ9A 3ULEB 3D6RA 2E20A 3RWUA 3OYMA 4OLBA 1RTJA 1HKCA 3VQ9A 4CEOA 1J6ZA 5CR4A 1TKTA 1VQLN 5E84A 4CJSA 4WFNL 3DLGA 1YIJN 3P31A 4FWRA 4H5RA 3HPHA 2VYPA 1RFQA 3DWLA 1KVCA 3IMXA 2AP1A 1C0TA 2HNDA 3OYBA 2ZE2A 2FBTA 4XH1A 1WAJA 3T7ZA 1CXQA 2QM1A 2F4VK 1HJRA 1XC9A 2PAVA 3VF2A 3BP8A 1K8KA 3NF8A 4YORA 1Z05A 3CCJN 1IBMK 2YHWA 1J53A 3VEVA 3PY8A 3SUQA 4JNEA 1WSGA 3M6GA 2E8AA 5EXWA 4DU3A 3DLHA 1GLFO 1R0AA 1YITN 1NKCA 4M3RA 4C8KA 4F9OA 4NCBA 3EN9A 2QA4N 3V9UA 3K57A 4M42A 3U6FA 3HPGA 4CD3A 5AQRA 2XY8A 4J2BA 2GTDA 3E1YA 2YHAA 3DRRA 4LF6K 4OO1J 1T3VA 2CH5A 1ZBUA 4CJLA 4ID5A 4DTRA 2ZGYA 1ZBHA 4CCHA 4JYAK 3O9RA 3T1YK 1RT2A 5JMVA 1VQ9N 4LFAK 1WOQA 1WSFA 3A8YA 3EEQA 3QEVA 3HVTA 1HNZK 1Q7YO 1BCOA 1S22A 1BO5O 1RT5A 2Q2RA 3CC2N 3LDLA 1J5OA 1ZBFA 2FSKA 2RPIA 1L3VA 2P51A 3KWIA 2YJEA 3F73A 4CJ5A 1JLEA 3R3LA 2P1JA 3WXJA 4JD2A 3A5NC 1NGDA 1DTTA 1RBVA 5KPZA 5C0YA 4F4KA 5EU7A 2GELA 3L3UA 4DFKA 2VQEK 4DV5K 2G8UA 4N56A 3THYA 1EETA 5AQGA 3KIOA 3U9ZA 1NU0A 1VQ5N 3TABA 2GWJA 4B1WB 1JLAA 5F2RA 1NJYA 3U3YA 1P8ZA 4J8FA 3DLLL 1WBBA 4JI3K 4Z4FA 3SAFA 4CZKA 5GIPA 1R59O 1VSLA 4KPYA 4C1NK 1NGCA 2DY4A 4PY5A 4HCBA 4NB4A 3WEEB 5GAGP 2XRIA 4JS5A 1BIZA 3JAMO 3RMDA 4FOEA 3CYMA 4KBOA 4EHUA 1IKWA 2FC0A 3RRHA 4B1YB 4JS4A 1NK6A 4BR9A 1GLJO 4JLHA 4L3QA 1RNHA 2UXCK 1KXPA 4LSLA 1QQOA 2GX9A 3T19A 1BIUA 1KAXA 5J2MA 4KREA 3VEOA 4AM6A 4CEAA 2P9LB 3ZSYA 3IRXA 4ISGA 1JL1A 2IC3A 3K5MA 3AVBA 2G8VA 2YHBA 3VA0A 3AO1A 2F8TA 4OX9K 3EL2A 1KCFA 4LH5A 4FZXC 3SJJA 3FR0A 1ITGA 1QSSA 3VERA 1NMNA 5AQOA 3C6TA 4YOYA 1NK9A 4DS4A 4EP4A 4FL9A 3C7NA 3VENA 4F2SA 1T05A 2Z1JA 2FSNA 4GV9A 3O3FA 1UOCA 2F8SA 2CH6A 4MLHA 1FKPA 4IOXA 3ZSWA 1VK0A 4EHTA 4XH5A 3MEEA 3DXKA 4IJAA 3P38A 3DLEA 2O8CA 2F96A 3VQ4A 1BU6O 1LWEA 1M90O 4DR5K 4WFBL 4PKGA 2CGKA 4AQYK 4OKEA 4DTJA 3E01A 4M3UA 3HK2A 5BRDA 4H5VA 5C2FA 4CZEA 4GKKK 1TL3A 1W2BM 4DB3A 4DSLA 4ZTFA 1QHAA 1MWMA 3L2QA 4B1UB 5LJWA 4W5RA 1YHQN 2O8BA 2KFNA 5JLFA 4LFBK 2G8IA 4M7YA 4B1VA 5AQUA 1VSHA 4E1MA 1TKXA 3EKUA 4K25A 3HPOA 2HW3A 3QEIA 5I9EB 4E0DA 4BRAA 3NFAA 2NRXA 1IH7A 5ELZA 3RVCA 4JAXA 4XEIA 4CJWA 4CF8A 1WSEA 1NJXA 4FJNA 1Q82O 2KHOA 3BDPA 3G10A 3DAWA 3HOSA 4K43A 3FZFA 3SAGA 1SL1A 1RCHA 1S5JA 2ZJRL 3DM2A 5AQXA 4FM1A 4H03B 1L3UA 4DV1K 4M7XA 3F2KA 4ILHA 1EX4A 1RT4A 2P9KB 2GV9A 4FPBA 1NM1A 3VQDA 2X6NA 4KTWA 1BQMA 5EY4A 4AM7A 1J5EK 4F2RA 1HKGA 1X9JA 1HR0K 3LPUA 4B9NA 4M41A 3KVGA 1W7AA 4GW6A 4JI5K 2P5OA 1GOCA 5B8HA 1BQNA 4ILGB 4F3OA 2QWPA 5AR0A 5C24A 3MXMA 1U47A 4DQ8A 1XNQK 3THVA 1W97L 2EHGA 2W41A 3OA9A 3CCVN 3RR8A 4KAZA 2D5RA 5KQ8A 4FJ7A 3VN5A 3QFPA 1FW6A 3ZETA 4DWIA 4JI8K 3GBTA 3GL1A 1YTUA 4FVUA 4KFBA 1S1XA 1TUUA 5EX5A 1GLEG 2ITGA 1BI4A 4JI6K 1RBUA 1YJWN 4KHPK 1IV0A 1YUWA 3KLEA 4HVJA 2HHSA 4FM0A 2B5JA 4CZIA 5BPNA 3SCXA 5AJ3K 1Q86O 4H0VB 3RSEB 1A5WA 4DSJA 1BL3A 2E1ZA 3QINA 3NF6A 3VQPA 2VG7A 3HSCA 3O4NA 3HVRA 3L4IA 3NHGA 3GOIA 3H3OB 3F9KA 4HUEA 3V6DA 1WLJA 3P5JA 4ID1A 2G8KA 3IDHA 2WUSA 4CHZA 4EAHD 4X66K 2ZGZA 2Q3SA 3J7ZO 1JCFA 4FM2A 5LMNK 4JK9A 3S3MA 2O8EB 1SUQA 1DKGD 4LH4A 2A1RA 1EP4A 5DMRA 3THWA 5TKWA 4X65K 2HHXA 3I8BA 3TTFA 1S1UA 3RR7A 3WNFA 1JLFA 4ELTA 1NOZA 3JSMA 2ZJQL 2PFUA 3VQ8A 3AA5X 3F5TA 2P9UA 3IS9A 1A5XA 1VSKA 2HB5A 4DLGA 3I8DA 1OH8A 4OGCA 3MN9A 3CC7N 3AA3A 3PIPL 3OYNA 1T8EA 3Q7CA 1JXBA 4YFUA 3SQ0A 2YI1A 4IJNA 1IKYA 3JXUA 4BR0A 4E19A 2HVIA 4FJ9A 4C8MA 2HHTA 4HUFA 4DR1K 4BVPA 4GKJK 2ZD1A 5KTQA 3LANA 4O8KA 2DFHA 1I94K 4FJGA 1X9WA 2YKMA 3G6EN 4A5AA 2QKKA 4BG9A 5C42A 1O1WA 3S3OA 3VQ6A 4OJRA 3HRGA 4NYNA 3M8SA 4IKFA 4TSXA 5BPMA 5IT9O 2UUBK 2YNHA 4CFAA 5HRSA 4BRLA 2AA4A 1F21A 1EWRA 2HOEA 4H4OA 1TK5A 5HRPA 4K8ZA 3ZT4A 4UY8O 2QEXN 5E26A 5H1SQ 1JL2A 3CCEN 4IG0A 3DOLA
chains in the Genus database with same CATH topology
2PYLA 3V9XA 3KD5E 1TKTA 1W9HA 2DFEA 4CJSA 2HHWA 4FJMA 1RT6A 3DLGA 4KV8A 4HCCA 3AO4A 1VSIA 3HPHA 3HM9A 2EX3A 4RW8A 3O3HA 1RDCA 1RT1A 2IGIA 3CFPA 1KVCA 3AVKA 3QO9A 4DSFA 1X1PA 4AILC 1C0TA 3ZSXA 3SI6A 2HNDA 4RW6A 1RBTA 3OYBA 3OYDA 2ZE2A 2FBTA 3I0RA 4KKOA 4FCYA 4CHYA 1WAJA 1LV5A 1JKHA 1CXQA 1KVBA 1HJRA 1TL1A 1XC9A 4FXDA 2Y1JA 1VSEA 1ASWA 3CM5A 1QS4A 3NF8A 3B6OA 4AHRA 3V9ZA 2I5JA 4FLVA 4KB0A 3DRSA 2WOMA 1J53A 4OGEA 1SKRA 3PY8A 4WE1A 3V1RA 4DTXA 2YNGA 4I2QA 4PQUA 3SUQA 4CEZA 3LDSA 1WSGA 4DSIA 4FJ5A 2E6LA 4DU3A 4J2DA 4CFBA 3DLHA 4ZHRA 2B6AA 1R0AA 3SV4A 3G0ZA 5HBMA 4KHYA 1C0MA 3S3NA 1BISA 1NKCA 3OYFA 1NOYA 4PUOA 4M3RA 1ZBIA 2YV0X 4C8KA 4NCBA 3OYIA 1TK0A 1WN7A 3NE6A 1ASVA 3CM6A 4I9LA 3LAKA 2VWJA 4E7HA 3LP2A 3SYZA 4DTOA 1X9SA 1NKBA 4M3XA 2IDOA 5J2NA 1CLQA 3V9UA 1XWLA 3K57A 2BE2A 3ZT2A 3SQ4A 1T03A 3VQEA 3U6FA 4M42A 1BI4B 3HPGA 3ITHA 4Z4CA 3KLGA 4Z4GA 3V9WA 3VQ7A 4QCLA 2XY8A 1VRTA 4N47A 3TANA 4J2BA 2YHAA 3DRRA 3VA3A 3QNNA 4FK0A 4CJ3A 4OPKA 1ZBUA 4CJLA 4ID5A 4DTRA 4OKJA 4CERA 2OA8A 4L8RB 3ALYA 4KHQA 2JLEA 3M8RA 2PZSA 4CEQA 1TGOA 2GUIA 1WAFA 4N5SA 4E3SA 1ZBHA 4CCHA 1UA1A 1U48A 3O4QA 1RT2A 1JLCA 4AHVA 1QQCA 4BWJA 3T3FA 3AA2A 1WSFA 4FYDA 3O3GA 2RKIA 1B9DA 4CESA 4BWMA 3QEVA 3HVTA 4DLEA 1IG9A 3T1AA 3ZSZA 1Y97A 3OYGA 4O4GA 4O5BA 1BCOA 1TVRA 4O0JA 1HMVA 1RT5A 1J5OA 4CEBA 1ZBFA 3AVNA 4ICLA 3RMAA 4AHSA 4LY7A 2RPIA 1HPZA 4CEDA 4RG8A 1L5UA 2Z1GA 3QIOA 3NAEA 5KRSA 1L3VA 4RW9A 2P51A 2D0CA 3MEGA 3F73A 4CJ5A 1JLEA 4O0IA 4LSNA 4CIEA 3LAMA 5I3UA 2P1JA 4EP5A 2O4GA 4CJPA 4CFDA 4NCGA 2XO7A 3K5LA 4KTQA 4JRPA 1TKZA 4RW4A 1DTTA 1RBVA 3V1QA 3HXMA 4F4KA 5EU7A 2BDPA 2E6MA 3L3UA 4DFKA 3QERA 3TAQA 1WSHA 2G8UA 3TR8A 4KO0A 4N56A 1B9FA 4M3TA 3MXJA 3NH0A 1EETA 5C25A 4DQSA 4DTUA 2G8FA 3NBPA 3KIOA 4AH9A 4OLAA 3DRPA 4CJKA 1DLOA 1U45A 1D9DA 2XHBA 4KTZA 3TABA 2Z1HA 3UIQA 1KLMA 3I0SA 1IKXA 1JLAA 3MEDA 3EZ5A 1RILA 3OYCA 1GOAA 2XY5A 4QOZB 1Q8IA 4CGFA 1NJYA 3U3YA 4FJXA 3AVLA 2YNIA 2D0BA 3AA4A 2HMIA 4IG3A 5CZ2A 4Z4FA 1HYSA 1KVAA 4ELVA 1RDAA 3CFOA 1G15A 4CF9A 4CHOA 3OS2A 1LAVA 1D8YA 1S9GA 3WNGA 3ZSOA 1VSLA 1QTMA 4KPYA 1J54A 1WSIA 4KHWA 3QIPA 2DY4A 4DMNA 3K5OA 4PY5A 4HCBA 5CYQA 3OVNA 4FW1A 1S6PA 3L8BA 4C8LA 4J2AA 2YKNA 4CK2A 4MFBA 5D3GA 1LWFA 3QNOA 1YTAA 2XRIA 4JS5A 4HUGA 4CGIA 4G1QA 1BIZA 3SPZA 3RMDA 5K14A 3KLHA 1RBRA 3K2PA 3CYMA 1LWCA 5E41A 3CG7A 3LWMA 1KFSA 4MQ3A 1MU2A 4DU1A 1IKWA 2FC0A 3RRHA 2IOCA 4JS4A 1RTIA 2FBVA 1NK6A 2YNFA 1I39A 4HTUA 1UAXA 3C94A 4JLHA 5J1EA 1RNHA 1NK0A 4FJIA 4LSLA 1HRHA 3K5NA 3NDKA 3PV8A 1C6VA 1BIUA 3T19A 3VQ5A 4FK4A 3LZIA 4EZ6A 1SKSA 4W5QA 3OS0A 3OYHA 4CGGA 1KTQA 5J2MA 3RRGA 2OZMA 4KREA 1VSDA 1L3SA 3VQCA 4CEAA 3P83D 3ZSYA 4FJLA 1REVA 4KHNA 3IRXA 4CF0A 1XI1A 5SWMA 1JL1A 4E7IA 1FKOA 2IC3A 3OJSA 3K5MA 4JRQA 3NGIA 4CJUA 4BDYA 3AVBA 5J2QA 4CIFA 2G8VA 4ELUA 2YHBA 4NYFA 3VA0A 4O44A 4CE9A 3AO1A 4B8CA 2F8TA 3PX6A 1RTDA 4CHNA 1KCFA 4LH5A 4QAGA 4FZXC 3SJJA 3SNNA 1D9FA 1ITGA 3RMBA 1QSSA 4CGJA 1HNIA 3LP0A 2QK9A 1QSYA 2W42A 3ZT1A 3OJUA 1WSJA 3AO2A 3AO5A 4BE0A 3C6TA 4CF2A 2NUBA 1NK9A 4DS4A 3KKRA 4EP4A 3OYJA 2OZSA 5JS1A 1DTQA 1BGXT 3OYAA 3DMJA 4F2SA 1T05A 2Z1JA 1C1CA 3DLRA 2R7YA 5SZTA 3ZT0A 1GOBA 3CFRA 3AVHA 1NK5A 3NF9A 3O3FA 3ZSRA 1UOCA 4W5TA 1ZBLA 4N76A 3ZSWA 1FKPA 2F8SA 1VK0A 3OYLA 3TAEA 1TK8A 3OS1A 4B9TA 3MEEA 2ZQBA 3AV9A 1KFDA 3NCIA 5CZ1A 3AVJA 3DLEA 2OPRA 2F96A 3VQ4A 3AVIA 4PA1A 4UQGA 1LWEA 4DQIA 4B08A 3H08A 3ZSVA 3MECA 1QHTA 2IAJA 4Q5VA 4M45A 2OYQA 1CXUA 1X9MA 4OVLA 2HHUA 3QEPA 3DLKA 4OKEA 4DF4A 1N5YA 1VSJA 3L3VA 4DTMA 4DTJA 3E01A 4B9VA 1NJZA 3U3GA 4M3UA 3HK2A 2KZMA 4KI6A 2BGGA 4FLXA 4E89A 1TL3A 2VG6A 2HNYA 3TAGA 4DF8A 3SUNA 1Q9XA 4DSLA 3VQBA 4Z4HA 4ZTFA 1JLQA 4I9QA 3DOKA 3QETA 1UA0A 3ZSQA 3DYAA 4CJTA 3L2QA 4W5RA 2KFNA 2KFZA 1WNSA 3C6UA 1VSMA 2FBXA 3LWLA 4ZTJA 4CGHA 3NH1A 2G8IA 2KQ2A 5CYMA 1VRUA 5T7BA 4FLYA 1VSHA 4CJEA 1TKXA 4E1MA 3SV3A 1SL2A 1K6YA 4HHTA 3L2VA 3WNHA 3HPOA 2PYJA 3QEIA 2KTQA 2HW3A 3QEWA 4E0DA 1T7PA 4CJRA 4CECA 3NH2A 3NFAA 4FJJA 1FXXA 1NK4A 1C1AA 4XIUA 1IH7A 1IO2A 1LW2A 1SKWA 4CJWA 4DFMA 3AVCA 1N6QA 3KK2A 4CF8A 3V81A 2P5GA 1WSEA 1NJXA 4AHUA 1TKDA 1NKEA 2Z1IA 3AO3A 3MAQA 3QESA 5HRRA 4FJNA 4DTPA 3PUFA 1LAWA 1TV6A 3BDPA 3G10A 4I2PA 4IDKA 1ASUA 1SL1A 1S1WA 1RCHA 1S5JA 3D45A 3VQQA 3DM2A 3ULDA 4FZYA 4W5NA 4FLUA 4B9SA 5CY4A 3KK3A 3K59A 4FM1A 2QXFA 2OPPA 1L3UA 2RN2A 4IFVA 1HYVA 3IG1A 4RW7A 1EX4A 1RT4A 2GV9A 5HROA 3LP1A 3L2RA 4KRFA 3BGRA 3VQDA 2X6NA 4KTWA 3PX0A 1BQMA 4LD0A 4F3TA 1S9EA 4CEFA 2GBZA 1VSFA 3M8PA 3LALA 3TAFA 4F2RA 4CK3A 1SL0A 3KK1A 4K8XA 2RF2A 3NF7A 3PX4A 3LPUA 4DQQA 4B9NA 4M41A 1XHXA 1SV5A 4DQPA 4GMJB 1YVUA 3TARA 1YT3A 4GW6A 4NCAA 2P5OA 4E7KA 1GOCA 2OPSA 2DTUA 4DQRA 1BQNA 4Y1CA 4F3OA 3HT3A 5C24A 4BDPA 3MXMA 1HYZA 3L2UA 3AVAA 1U47A 1XHZA 3V9SA 4BE1A 3THVA 2EHGA 3SUPA 4H8KA 3HL8A 1NJWA 2XY6A 2G8HA 3RR8A 1U04A 4KAZA 3M8QA 2D5RA 2HHVA 1UWBA 1QE1A 4FVMA 4FJ7A 3B6PA 3VN5A 4DWIA 3HSTB 3S9HA 4CIGA 4BACA 4B8AB 4Z4IA 1ZYQA 4N41A 2X6SA 2ATQA 1L3TA 4Z4EA 4FJ8A 4M3WA 4AHTA 5DK5A 1U4BA 1YTUA 2VG5A 3HP9A 4KFBA 3HO1A 1S1XA 3NGYA 4DTNA 2QKBA 5FRMA 2ITGA 1W0HA 3L2WA 1BI4A 2D0AA 3PO4A 4C8OA 1JLGA 3SUOA 1RBUA 4AHCA 1BCMA 1LW0A 1NK8A 2KZZA 1CZ9A 5FROA 3SZ2A 2O4IA 2AJQA 1HNVA 3KLEA 2IS3A 3KJVA 3TAMA 4B9LA 4HVJA 3EY1A 3D0PA 3IAYA 4FK2A 2Y1IA 2HHSA 1HQEA 1A5VA 4FM0A 2B5JA 3C95A 3KTQA 3ASMA 2DFFA 3SCXA 4CHQA 3QLHA 2LSNA 3OY9A 3LP3A 1A5WA 3VQAA 3OYEA 4O55A 3ISNC 1BL3A 3QINA 5FDLA 4DSJA 3NF6A 4FW2A 2VG7A 3O4NA 3VQPA 3HP6A 3ZCMA 4CJVA 3HVRA 1S6QA 1Z25A 1BHLA 4E7JA 3NHGA 4DFJA 4KI4A 4CHPA 4I7FA 3AVMA 5KGXA 3CQ8A 2X78A 3F9KA 4HUEA 3V4IA 4E1NA 4DS5A 3V6DA 5FRNA 4DU4A 1WLJA 3P5JA 4ID1A 4CF1A 2G8KA 3AVGA 4CEEA 4CHZA 4M3YA 4IBNA 2Q3SA 3AVFA 2XY7A 1C0UA 4FM2A 1HQUA 4KB1A 1S1TA 3MXIA 1B92A 3LPTA 2FBYA 2WONA 3S3MA 2B4JA 4DSEA 4YNQA 4DSKA 1SUQA 4LH4A 2A1RA 1EP4A 1TAUA 2HHQA 3NGZA 5DMRA 3TWHA 4KHSA 3EYZA 1NK7A 1EKEA 2HHXA 4GVMA 4B9UA 1KLNA 3RR7A 1S1UA 2A1SA 2OPQA 4J2EA 2X74A 3WNFA 1JLFA 1QSLA 4CJ4A 4ELTA 1NOZA 1TAQA 4FLWA 4PWDA 3JSMA 2HNZA 1KSPA 4FZZA 2E4LA 3AA5X 3VQ8A 3TAPA 4FJHA 3TI0A 3IS9A 3RTVA 1A5XA 3P1GA 1VSKA 3SQ1A 5HLFA 2HB5A 4DLGA 3I8DA 1KRPA 4OGCA 3OYKA 4OPJA 1EXQA 4FLZA 1RDDA 4OKKA 5KI6A 1S1VA 5HRNA 1FK9A 3KD1E 3JYTA 3AA3A 4M3ZA 3OYNA 2JGUA 1T8EA 3QEXA 1IKVA 1JXBA 4YFUA 1JXEA 3LZJA 3FFIA 4CGDA 3SQ0A 1IKYA 3DI6A 2HVHA 3A2FA 1J9AA 4H4MA 4E19A 5KGWA 1RT3A 2HVIA 2PY5A 3WNEA 4Z0UA 4CK1A 4FJ9A 4C8MA 2HHTA 4HUFA 3KLIA 1JLBA 1Q9YA 4B9MA 4EZ9A 3KLFA 4DG1A 4BE2A 5I42A 4CFCA 2ZD1A 5KTQA 3LANA 3HJFA 3V1OA 2DFHA 4FLTA 3K58A 1X9WA 2YKMA 4FJGA 4DTSA 4W5OA 3PO5A 3HYFA 2QKKA 1RT7A 4C8NA 5C42A 1O1WA 1RBSA 3VQ6A 4OJRA 3S3OA 5JS2A 3DLBA 4Q0BA 4NYNA 3M8SA 2KW4A 4IKFA 4TSXA 1I3AA 2ETJA 4IFYA 5J2PA 3ZT3A 3RMCA 4B3OA 1CZBA 1D5AA 5KRTA 3SQ2A 2VWKA 4CJFA 4KHUA 1Z26A 2YNHA 4CFAA 3KKSA 4CJQA 5HRSA 4E7LA 1F21A 4H4OA 1RDBA 3SPYA 1U49A 1TK5A 4DFPA 5HRPA 4K8ZA 3RWUA 3OYMA 4OLBA 3ZT4A 4F8RA 5HP1A 1RTJA 4BDZA 3VQ9A 4R5PA 4FJKA 2BANA 1C1BA 1RTHA 2G8WA 1JL2A 4CEOA 4IG0A 3DOLA 4Y1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYL A;  3V9X A;  3KD5 E;  1TKT A;  1W9H A;  2DFE A;  4CJS A;  2HHW A;  4FJM A;  1RT6 A;  3DLG A;  4KV8 A;  4HCC A;  3AO4 A;  1VSI A;  3HPH A;  3HM9 A;  2EX3 A;  4RW8 A;  3O3H A;  1RDC A;  1RT1 A;  2IGI A;  3CFP A;  1KVC A;  3AVK A;  3QO9 A;  4DSF A;  1X1P A;  4AIL C;  1C0T A;  3ZSX A;  3SI6 A;  2HND A;  4RW6 A;  1RBT A;  3OYB A;  3OYD A;  2ZE2 A;  2FBT A;  3I0R A;  4KKO A;  4FCY A;  4CHY A;  1WAJ A;  1LV5 A;  1JKH A;  1CXQ A;  1KVB A;  1HJR A;  1TL1 A;  1XC9 A;  4FXD A;  2Y1J A;  1VSE A;  1ASW A;  3CM5 A;  1QS4 A;  3NF8 A;  3B6O A;  4AHR A;  3V9Z A;  2I5J A;  4FLV A;  4KB0 A;  3DRS A;  2WOM A;  1J53 A;  4OGE A;  1SKR A;  3PY8 A;  4WE1 A;  3V1R A;  4DTX A;  2YNG A;  4I2Q A;  4PQU A;  3SUQ A;  4CEZ A;  3LDS A;  1WSG A;  4DSI A;  4FJ5 A;  2E6L A;  4DU3 A;  4J2D A;  4CFB A;  3DLH A;  4ZHR A;  2B6A A;  1R0A A;  3SV4 A;  3G0Z A;  5HBM A;  4KHY A;  1C0M A;  3S3N A;  1BIS A;  1NKC A;  3OYF A;  1NOY A;  4PUO A;  4M3R A;  1ZBI A;  2YV0 X;  4C8K A;  4NCB A;  3OYI A;  1TK0 A;  1WN7 A;  3NE6 A;  1ASV A;  3CM6 A;  4I9L A;  3LAK A;  2VWJ A;  4E7H A;  3LP2 A;  3SYZ A;  4DTO A;  1X9S A;  1NKB A;  4M3X A;  2IDO A;  5J2N A;  1CLQ A;  3V9U A;  1XWL A;  3K57 A;  2BE2 A;  3ZT2 A;  3SQ4 A;  1T03 A;  3VQE A;  3U6F A;  4M42 A;  1BI4 B;  3HPG A;  3ITH A;  4Z4C A;  3KLG A;  4Z4G A;  3V9W A;  3VQ7 A;  4QCL A;  2XY8 A;  1VRT A;  4N47 A;  3TAN A;  4J2B A;  2YHA A;  3DRR A;  3VA3 A;  3QNN A;  4FK0 A;  4CJ3 A;  4OPK A;  1ZBU A;  4CJL A;  4ID5 A;  4DTR A;  4OKJ A;  4CER A;  2OA8 A;  4L8R B;  3ALY A;  4KHQ A;  2JLE A;  3M8R A;  2PZS A;  4CEQ A;  1TGO A;  2GUI A;  1WAF A;  4N5S A;  4E3S A;  1ZBH A;  4CCH A;  1UA1 A;  1U48 A;  3O4Q A;  1RT2 A;  1JLC A;  4AHV A;  1QQC A;  4BWJ A;  3T3F A;  3AA2 A;  1WSF A;  4FYD A;  3O3G A;  2RKI A;  1B9D A;  4CES A;  4BWM A;  3QEV A;  3HVT A;  4DLE A;  1IG9 A;  3T1A A;  3ZSZ A;  1Y97 A;  3OYG A;  4O4G A;  4O5B A;  1BCO A;  1TVR A;  4O0J A;  1HMV A;  1RT5 A;  1J5O A;  4CEB A;  1ZBF A;  3AVN A;  4ICL A;  3RMA A;  4AHS A;  4LY7 A;  2RPI A;  1HPZ A;  4CED A;  4RG8 A;  1L5U A;  2Z1G A;  3QIO A;  3NAE A;  5KRS A;  1L3V A;  4RW9 A;  2P51 A;  2D0C A;  3MEG A;  3F73 A;  4CJ5 A;  1JLE A;  4O0I A;  4LSN A;  4CIE A;  3LAM A;  5I3U A;  2P1J A;  4EP5 A;  2O4G A;  4CJP A;  4CFD A;  4NCG A;  2XO7 A;  3K5L A;  4KTQ A;  4JRP A;  1TKZ A;  4RW4 A;  1DTT A;  1RBV A;  3V1Q A;  3HXM A;  4F4K A;  5EU7 A;  2BDP A;  2E6M A;  3L3U A;  4DFK A;  3QER A;  3TAQ A;  1WSH A;  2G8U A;  3TR8 A;  4KO0 A;  4N56 A;  1B9F A;  4M3T A;  3MXJ A;  3NH0 A;  1EET A;  5C25 A;  4DQS A;  4DTU A;  2G8F A;  3NBP A;  3KIO A;  4AH9 A;  4OLA A;  3DRP A;  4CJK A;  1DLO A;  1U45 A;  1D9D A;  2XHB A;  4KTZ A;  3TAB A;  2Z1H A;  3UIQ A;  1KLM A;  3I0S A;  1IKX A;  1JLA A;  3MED A;  3EZ5 A;  1RIL A;  3OYC A;  1GOA A;  2XY5 A;  4QOZ B;  1Q8I A;  4CGF A;  1NJY A;  3U3Y A;  4FJX A;  3AVL A;  2YNI A;  2D0B A;  3AA4 A;  2HMI A;  4IG3 A;  5CZ2 A;  4Z4F A;  1HYS A;  1KVA A;  4ELV A;  1RDA A;  3CFO A;  1G15 A;  4CF9 A;  4CHO A;  3OS2 A;  1LAV A;  1D8Y A;  1S9G A;  3WNG A;  3ZSO A;  1VSL A;  1QTM A;  4KPY A;  1J54 A;  1WSI A;  4KHW A;  3QIP A;  2DY4 A;  4DMN A;  3K5O A;  4PY5 A;  4HCB A;  5CYQ A;  3OVN A;  4FW1 A;  1S6P A;  3L8B A;  4C8L A;  4J2A A;  2YKN A;  4CK2 A;  4MFB A;  5D3G A;  1LWF A;  3QNO A;  1YTA A;  2XRI A;  4JS5 A;  4HUG A;  4CGI A;  4G1Q A;  1BIZ A;  3SPZ A;  3RMD A;  5K14 A;  3KLH A;  1RBR A;  3K2P A;  3CYM A;  1LWC A;  5E41 A;  3CG7 A;  3LWM A;  1KFS A;  4MQ3 A;  1MU2 A;  4DU1 A;  1IKW A;  2FC0 A;  3RRH A;  2IOC A;  4JS4 A;  1RTI A;  2FBV A;  1NK6 A;  2YNF A;  1I39 A;  4HTU A;  1UAX A;  3C94 A;  4JLH A;  5J1E A;  1RNH A;  1NK0 A;  4FJI A;  4LSL A;  1HRH A;  3K5N A;  3NDK A;  3PV8 A;  1C6V A;  1BIU A;  3T19 A;  3VQ5 A;  4FK4 A;  3LZI A;  4EZ6 A;  1SKS A;  4W5Q A;  3OS0 A;  3OYH A;  4CGG A;  1KTQ A;  5J2M A;  3RRG A;  2OZM A;  4KRE A;  1VSD A;  1L3S A;  3VQC A;  4CEA A;  3P83 D;  3ZSY A;  4FJL A;  1REV A;  4KHN A;  3IRX A;  4CF0 A;  1XI1 A;  5SWM A;  1JL1 A;  4E7I A;  1FKO A;  2IC3 A;  3OJS A;  3K5M A;  4JRQ A;  3NGI A;  4CJU A;  4BDY A;  3AVB A;  5J2Q A;  4CIF A;  2G8V A;  4ELU A;  2YHB A;  4NYF A;  3VA0 A;  4O44 A;  4CE9 A;  3AO1 A;  4B8C A;  2F8T A;  3PX6 A;  1RTD A;  4CHN A;  1KCF A;  4LH5 A;  4QAG A;  4FZX C;  3SJJ A;  3SNN A;  1D9F A;  1ITG A;  3RMB A;  1QSS A;  4CGJ A;  1HNI A;  3LP0 A;  2QK9 A;  1QSY A;  2W42 A;  3ZT1 A;  3OJU A;  1WSJ A;  3AO2 A;  3AO5 A;  4BE0 A;  3C6T A;  4CF2 A;  2NUB A;  1NK9 A;  4DS4 A;  3KKR A;  4EP4 A;  3OYJ A;  2OZS A;  5JS1 A;  1DTQ A;  1BGX T;  3OYA A;  3DMJ A;  4F2S A;  1T05 A;  2Z1J A;  1C1C A;  3DLR A;  2R7Y A;  5SZT A;  3ZT0 A;  1GOB A;  3CFR A;  3AVH A;  1NK5 A;  3NF9 A;  3O3F A;  3ZSR A;  1UOC A;  4W5T A;  1ZBL A;  4N76 A;  3ZSW A;  1FKP A;  2F8S A;  1VK0 A;  3OYL A;  3TAE A;  1TK8 A;  3OS1 A;  4B9T A;  3MEE A;  2ZQB A;  3AV9 A;  1KFD A;  3NCI A;  5CZ1 A;  3AVJ A;  3DLE A;  2OPR A;  2F96 A;  3VQ4 A;  3AVI A;  4PA1 A;  4UQG A;  1LWE A;  4DQI A;  4B08 A;  3H08 A;  3ZSV A;  3MEC A;  1QHT A;  2IAJ A;  4Q5V A;  4M45 A;  2OYQ A;  1CXU A;  1X9M A;  4OVL A;  2HHU A;  3QEP A;  3DLK A;  4OKE A;  4DF4 A;  1N5Y A;  1VSJ A;  3L3V A;  4DTM A;  4DTJ A;  3E01 A;  4B9V A;  1NJZ A;  3U3G A;  4M3U A;  3HK2 A;  2KZM A;  4KI6 A;  2BGG A;  4FLX A;  4E89 A;  1TL3 A;  2VG6 A;  2HNY A;  3TAG A;  4DF8 A;  3SUN A;  1Q9X A;  4DSL A;  3VQB A;  4Z4H A;  4ZTF A;  1JLQ A;  4I9Q A;  3DOK A;  3QET A;  1UA0 A;  3ZSQ A;  3DYA A;  4CJT A;  3L2Q A;  4W5R A;  2KFN A;  2KFZ A;  1WNS A;  3C6U A;  1VSM A;  2FBX A;  3LWL A;  4ZTJ A;  4CGH A;  3NH1 A;  2G8I A;  2KQ2 A;  5CYM A;  1VRU A;  5T7B A;  4FLY A;  1VSH A;  4CJE A;  1TKX A;  4E1M A;  3SV3 A;  1SL2 A;  1K6Y A;  4HHT A;  3L2V A;  3WNH A;  3HPO A;  2PYJ A;  3QEI A;  2KTQ A;  2HW3 A;  3QEW A;  4E0D A;  1T7P A;  4CJR A;  4CEC A;  3NH2 A;  3NFA A;  4FJJ A;  1FXX A;  1NK4 A;  1C1A A;  4XIU A;  1IH7 A;  1IO2 A;  1LW2 A;  1SKW A;  4CJW A;  4DFM A;  3AVC A;  1N6Q A;  3KK2 A;  4CF8 A;  3V81 A;  2P5G A;  1WSE A;  1NJX A;  4AHU A;  1TKD A;  1NKE A;  2Z1I A;  3AO3 A;  3MAQ A;  3QES A;  5HRR A;  4FJN A;  4DTP A;  3PUF A;  1LAW A;  1TV6 A;  3BDP A;  3G10 A;  4I2P A;  4IDK A;  1ASU A;  1SL1 A;  1S1W A;  1RCH A;  1S5J A;  3D45 A;  3VQQ A;  3DM2 A;  3ULD A;  4FZY A;  4W5N A;  4FLU A;  4B9S A;  5CY4 A;  3KK3 A;  3K59 A;  4FM1 A;  2QXF A;  2OPP A;  1L3U A;  2RN2 A;  4IFV A;  1HYV A;  3IG1 A;  4RW7 A;  1EX4 A;  1RT4 A;  2GV9 A;  5HRO A;  3LP1 A;  3L2R A;  4KRF A;  3BGR A;  3VQD A;  2X6N A;  4KTW A;  3PX0 A;  1BQM A;  4LD0 A;  4F3T A;  1S9E A;  4CEF A;  2GBZ A;  1VSF A;  3M8P A;  3LAL A;  3TAF A;  4F2R A;  4CK3 A;  1SL0 A;  3KK1 A;  4K8X A;  2RF2 A;  3NF7 A;  3PX4 A;  3LPU A;  4DQQ A;  4B9N A;  4M41 A;  1XHX A;  1SV5 A;  4DQP A;  4GMJ B;  1YVU A;  3TAR A;  1YT3 A;  4GW6 A;  4NCA A;  2P5O A;  4E7K A;  1GOC A;  2OPS A;  2DTU A;  4DQR A;  1BQN A;  4Y1C A;  4F3O A;  3HT3 A;  5C24 A;  4BDP A;  3MXM A;  1HYZ A;  3L2U A;  3AVA A;  1U47 A;  1XHZ A;  3V9S A;  4BE1 A;  3THV A;  2EHG A;  3SUP A;  4H8K A;  3HL8 A;  1NJW A;  2XY6 A;  2G8H A;  3RR8 A;  1U04 A;  4KAZ A;  3M8Q A;  2D5R A;  2HHV A;  1UWB A;  1QE1 A;  4FVM A;  4FJ7 A;  3B6P A;  3VN5 A;  4DWI A;  3HST B;  3S9H A;  4CIG A;  4BAC A;  4B8A B;  4Z4I A;  1ZYQ A;  4N41 A;  2X6S A;  2ATQ A;  1L3T A;  4Z4E A;  4FJ8 A;  4M3W A;  4AHT A;  5DK5 A;  1U4B A;  1YTU A;  2VG5 A;  3HP9 A;  4KFB A;  3HO1 A;  1S1X A;  3NGY A;  4DTN A;  2QKB A;  5FRM A;  2ITG A;  1W0H A;  3L2W A;  1BI4 A;  2D0A A;  3PO4 A;  4C8O A;  1JLG A;  3SUO A;  1RBU A;  4AHC A;  1BCM A;  1LW0 A;  1NK8 A;  2KZZ A;  1CZ9 A;  5FRO A;  3SZ2 A;  2O4I A;  2AJQ A;  1HNV A;  3KLE A;  2IS3 A;  3KJV A;  3TAM A;  4B9L A;  4HVJ A;  3EY1 A;  3D0P A;  3IAY A;  4FK2 A;  2Y1I A;  2HHS A;  1HQE A;  1A5V A;  4FM0 A;  2B5J A;  3C95 A;  3KTQ A;  3ASM A;  2DFF A;  3SCX A;  4CHQ A;  3QLH A;  2LSN A;  3OY9 A;  3LP3 A;  1A5W A;  3VQA A;  3OYE A;  4O55 A;  3ISN C;  1BL3 A;  3QIN A;  5FDL A;  4DSJ A;  3NF6 A;  4FW2 A;  2VG7 A;  3O4N A;  3VQP A;  3HP6 A;  3ZCM A;  4CJV A;  3HVR A;  1S6Q A;  1Z25 A;  1BHL A;  4E7J A;  3NHG A;  4DFJ A;  4KI4 A;  4CHP A;  4I7F A;  3AVM A;  5KGX A;  3CQ8 A;  2X78 A;  3F9K A;  4HUE A;  3V4I A;  4E1N A;  4DS5 A;  3V6D A;  5FRN A;  4DU4 A;  1WLJ A;  3P5J A;  4ID1 A;  4CF1 A;  2G8K A;  3AVG A;  4CEE A;  4CHZ A;  4M3Y A;  4IBN A;  2Q3S A;  3AVF A;  2XY7 A;  1C0U A;  4FM2 A;  1HQU A;  4KB1 A;  1S1T A;  3MXI A;  1B92 A;  3LPT A;  2FBY A;  2WON A;  3S3M A;  2B4J A;  4DSE A;  4YNQ A;  4DSK A;  1SUQ A;  4LH4 A;  2A1R A;  1EP4 A;  1TAU A;  2HHQ A;  3NGZ A;  5DMR A;  3TWH A;  4KHS A;  3EYZ A;  1NK7 A;  1EKE A;  2HHX A;  4GVM A;  4B9U A;  1KLN A;  3RR7 A;  1S1U A;  2A1S A;  2OPQ A;  4J2E A;  2X74 A;  3WNF A;  1JLF A;  1QSL A;  4CJ4 A;  4ELT A;  1NOZ A;  1TAQ A;  4FLW A;  4PWD A;  3JSM A;  2HNZ A;  1KSP A;  4FZZ A;  2E4L A;  3AA5 X;  3VQ8 A;  3TAP A;  4FJH A;  3TI0 A;  3IS9 A;  3RTV A;  1A5X A;  3P1G A;  1VSK A;  3SQ1 A;  5HLF A;  2HB5 A;  4DLG A;  3I8D A;  1KRP A;  4OGC A;  3OYK A;  4OPJ A;  1EXQ A;  4FLZ A;  1RDD A;  4OKK A;  5KI6 A;  1S1V A;  5HRN A;  1FK9 A;  3KD1 E;  3JYT A;  3AA3 A;  4M3Z A;  3OYN A;  2JGU A;  1T8E A;  3QEX A;  1IKV A;  1JXB A;  4YFU A;  1JXE A;  3LZJ A;  3FFI A;  4CGD A;  3SQ0 A;  1IKY A;  3DI6 A;  2HVH A;  3A2F A;  1J9A A;  4H4M A;  4E19 A;  5KGW A;  1RT3 A;  2HVI A;  2PY5 A;  3WNE A;  4Z0U A;  4CK1 A;  4FJ9 A;  4C8M A;  2HHT A;  4HUF A;  3KLI A;  1JLB A;  1Q9Y A;  4B9M A;  4EZ9 A;  3KLF A;  4DG1 A;  4BE2 A;  5I42 A;  4CFC A;  2ZD1 A;  5KTQ A;  3LAN A;  3HJF A;  3V1O A;  2DFH A;  4FLT A;  3K58 A;  1X9W A;  2YKM A;  4FJG A;  4DTS A;  4W5O A;  3PO5 A;  3HYF A;  2QKK A;  1RT7 A;  4C8N A;  5C42 A;  1O1W A;  1RBS A;  3VQ6 A;  4OJR A;  3S3O A;  5JS2 A;  3DLB A;  4Q0B A;  4NYN A;  3M8S A;  2KW4 A;  4IKF A;  4TSX A;  1I3A A;  2ETJ A;  4IFY A;  5J2P A;  3ZT3 A;  3RMC A;  4B3O A;  1CZB A;  1D5A A;  5KRT A;  3SQ2 A;  2VWK A;  4CJF A;  4KHU A;  1Z26 A;  2YNH A;  4CFA A;  3KKS A;  4CJQ A;  5HRS A;  4E7L A;  1F21 A;  4H4O A;  1RDB A;  3SPY A;  1U49 A;  1TK5 A;  4DFP A;  5HRP A;  4K8Z A;  3RWU A;  3OYM A;  4OLB A;  3ZT4 A;  4F8R A;  5HP1 A;  1RTJ A;  4BDZ A;  3VQ9 A;  4R5P A;  4FJK A;  2BAN A;  1C1B A;  1RTH A;  2G8W A;  1JL2 A;  4CEO A;  4IG0 A;  3DOL A;  4Y1D A; 
#chains in the Genus database with same CATH topology
 2PYL A;  2E88 A;  1W9H A;  2DFE A;  2P9S B;  3UKU B;  4FJM A;  3CIP A;  4HCC A;  1SAZ A;  3ZX0 A;  5EVZ A;  2UU9 K;  3HM9 A;  1XUP O;  3L4Q A;  4AIL C;  3ZSX A;  3M5R A;  1RBT A;  3Q7B A;  3BEX A;  4CHY A;  4BRC A;  1JKH A;  4FWP A;  3PSI A;  1TL1 A;  4JKA A;  4FXD A;  1KC8 O;  2YJF A;  1QS4 A;  4WQ5 A;  4AHR A;  3V9Z A;  4BRP A;  4FLV A;  4KB0 A;  3HZ6 A;  3K9K A;  1N32 K;  4GV6 A;  2WOM A;  4DR4 K;  3O8M A;  4WE1 A;  4DTX A;  2YNG A;  4I2Q A;  1HUX A;  4K42 A;  2E6L A;  4J2D A;  4IXC A;  4IO8 A;  3G0Z A;  3H1Q A;  1C0M A;  3S3N A;  4PUO A;  1ZBI A;  3OYF A;  1NOY A;  4BRG A;  4A57 A;  5BRE A;  3CM6 A;  4I9L A;  1VQK N;  3SYZ A;  3NVK A;  5AQH A;  3OBY A;  1K8K B;  4DKW A;  3ITH A;  4Z4C A;  3V9W A;  3VQ7 A;  4QCL A;  1VRT A;  3TAN A;  1ZBS A;  2IVP A;  3VA3 A;  3QNN A;  3MCP A;  3VGK A;  4BQL A;  3CJ9 A;  4N5S A;  1WAF A;  4E3S A;  5AQZ A;  3O9T A;  3VPZ A;  5LY3 A;  4CD1 A;  5BR8 K;  3O4Q A;  5M1Q A;  2RHK A;  4AHV A;  1QQC A;  2CGL A;  3MK6 A;  3T3F A;  4DV7 K;  1IG9 A;  3T1A A;  1Y97 A;  4O4G A;  3FLC O;  4DR3 K;  4H0Y B;  4PKH A;  3AVN A;  4H5W A;  1OVY A;  4AHS A;  4LY7 A;  3ZEU A;  3NAE A;  3VTI A;  3TSQ A;  4BQZ A;  4LSN A;  4CIE A;  2O4G A;  2QTD A;  4CFD A;  1TKZ A;  4JKD A;  3HXM A;  3ZYY X;  1JJ2 M;  3QER A;  5AZI A;  3TR8 A;  3H6E A;  3NH0 A;  4DQS A;  5C25 A;  3HOT A;  1NGH A;  2KLA A;  3EKS A;  2XHB A;  3UIQ A;  4JKC A;  4BRH A;  2E1Y A;  3MED A;  3MDQ A;  5M1K A;  3OYC A;  4X64 K;  1KAZ A;  3SJH A;  1Q8I A;  2F7T A;  1NGF A;  1HJO A;  4RTF D;  4WQ4 C;  4FJX A;  4FSV A;  1HYS A;  3AA4 A;  4IG3 A;  4A62 A;  4RCH A;  1G15 A;  1D8Y A;  1LAV A;  1S9G A;  1ATR A;  3THY B;  3ZSO A;  1QZ5 A;  3WXI A;  1J54 A;  3MX5 A;  3GE1 A;  2ZWH A;  3OVN A;  1S6P A;  1K9M O;  5C15 A;  4C8L A;  2YKN A;  4CK2 A;  4WFA L;  3KWG A;  4NLC A;  5D3G A;  4IWV A;  1N36 K;  4HUG A;  2Q97 A;  4O8U A;  3KLH A;  1RBR A;  3K2P A;  1LWC A;  3CG7 A;  1MU2 A;  4LF4 K;  2IVN A;  1HX1 A;  3SBT A;  2YNF A;  3AY9 A;  3D7E O;  3C94 A;  5J1E A;  1OVQ A;  1O13 A;  4FK4 A;  4BRO A;  3LZI A;  3OS0 A;  2QXL A;  3OYH A;  2NRR A;  1VSD A;  3H46 O;  3O9U A;  1L3S A;  1KD1 O;  4PHT X;  4H0T B;  2QI2 A;  3OTO K;  3OJS A;  4CVN E;  3ENH A;  5J2Q A;  4ELU A;  2OTJ N;  4B8C A;  2I7P A;  1RTD A;  3G71 N;  4JKE A;  1D9F A;  4CGJ A;  1HNI A;  1N33 K;  2P9I A;  3T69 A;  2P9P A;  4CF2 A;  5JS1 A;  3KKR A;  4B1X B;  3C65 A;  1DTQ A;  3DMJ A;  2D4W A;  2O8D A;  1C1C A;  1TYQ A;  2HF3 A;  2R7Y A;  3ZT0 A;  1NGE A;  1NK5 A;  2GEM A;  3CET A;  3CXC M;  3QB0 A;  2BUP A;  4LC9 B;  4B9T A;  3THX A;  3MWP A;  4DV3 K;  3AVJ A;  3C6H A;  3AAQ A;  3AVI A;  2ITM A;  3ZSV A;  1QHT A;  4M45 A;  1CXU A;  3QEP A;  3DLK A;  4DF4 A;  3C7N B;  1BG3 A;  4JKH A;  1BWF O;  1OH7 A;  4MO4 A;  2VG6 A;  3O9Q A;  3TAG A;  3SUN A;  5AQK A;  3VQB A;  4Z4H A;  3QET A;  2Q31 A;  3UKR B;  3DXK B;  1Y64 A;  1WNS A;  3SMP A;  3R6M A;  1BOT O;  2O8C B;  4FLY A;  3SV3 A;  1XMQ K;  5BR9 A;  1DGK N;  1SL2 A;  3J80 O;  5C2D A;  3L2V A;  4CEC A;  2ASM A;  4FJJ A;  1FXX A;  3CJ7 A;  4BY9 C;  3BUZ B;  2F9W A;  4DFM A;  3AVC A;  1N6Q A;  1QQM A;  1TKD A;  1VQ4 N;  3AO3 A;  3QES A;  4YDU A;  4B9Q A;  3E9P A;  4DTP A;  2O8B B;  4BR4 A;  4IDK A;  3VQQ A;  4WCE L;  2QWM A;  3ULD A;  4W5N A;  3A5O C;  3FZL A;  1VQP N;  5CY4 A;  1C0G A;  1GLC G;  4DHY A;  1ATN A;  2PBD A;  3WXM B;  4RW7 A;  3KHY A;  3ATU A;  3BGR A;  3PX0 A;  4F3T A;  1NGB A;  3M8P A;  3IKM A;  3G4S N;  4K8X A;  4DR7 K;  3NF7 A;  4DQQ A;  4DQP A;  3BY5 A;  1SV5 A;  4GMJ B;  1IG8 A;  1YT3 A;  5TKY A;  3E9L A;  2QWQ A;  4DQR A;  1NJI O;  1VHX A;  4H5T A;  4U7B A;  4BE1 A;  5M1N A;  1NJW A;  3DXM A;  1U04 A;  2HHV A;  1UWB A;  3D2E A;  3F9M A;  1FJG K;  4CIG A;  4B8A B;  4Z4I A;  2W6K A;  4MLE A;  2X6S A;  1L3T A;  4Z4E A;  3ZX2 A;  3HP9 A;  3HO1 A;  3L2W A;  2KKZ A;  1CZ9 A;  2AJQ A;  1HNV A;  2IS3 A;  3TAM A;  3IAY A;  2Y1I A;  3BZC A;  1A5V A;  3H45 C;  3KTQ A;  2DFF A;  4CHQ A;  3A5M C;  2LSN A;  3VQA A;  4O55 A;  3ZET B;  5FDL A;  5BRF A;  2ASO A;  4DFJ A;  1S6Q A;  3VF6 A;  4E7J A;  2YHY A;  1K8A O;  3V4I A;  4LF9 K;  5FRN A;  4DU4 A;  3QML A;  4CF1 A;  5JIC A;  4M3Y A;  4IBN A;  3NVM A;  1VQO N;  5AQJ A;  4KB1 A;  3SK3 A;  4DUZ K;  4BR7 A;  4DSE A;  5M1F A;  4DSK A;  1XMO K;  1QZ6 A;  3NGZ A;  3ZX3 A;  3EYZ A;  2D0P A;  4H0O A;  3IUC A;  5FPE A;  1X3M A;  1KLN A;  4J2E A;  4PWD A;  4IEI A;  2YX6 A;  3DJC A;  3KZB A;  4BRQ A;  4DR2 K;  4FLW A;  3TAP A;  3TI0 A;  3SQ1 A;  3P1G A;  5HLF A;  4FLZ A;  1EXQ A;  4C1N I;  1RDD A;  4A59 A;  5HRN A;  1S1V A;  5AQW A;  1RGI A;  1IKV A;  1JXE A;  4FWK A;  1HNW K;  1JLB A;  1Q9Y A;  4EZ9 A;  4BRD A;  3KLF A;  3D2F A;  2HHH K;  4E1J A;  3MMV A;  4H0P A;  2P9U B;  3PO5 A;  5AQV A;  3B8A X;  4I6M A;  3WEE A;  3TTC A;  5JS2 A;  4Q0B A;  4BC2 A;  3P4I A;  2UXD K;  2ETJ A;  2Q36 A;  4Y0W A;  4YDU C;  2JWK A;  3OHR A;  3RMC A;  2GWK A;  2J4R A;  4CJF A;  3KKS A;  4E7L A;  3EE9 A;  3SPY A;  3FFK B;  4HWI A;  3CPW M;  4DFP A;  1U49 A;  5HP1 A;  4IFE A;  4FWS A;  1RTH A;  4B3S K;  4Y1D A;  4BGB A;  3K9J A;  3KD5 E;  3PSF A;  3ENB A;  1NG9 A;  1LCU A;  3AO4 A;  3ENO A;  2ZM6 K;  1VSI A;  2NRT A;  2P9L A;  3VGM A;  4JHD B;  2IGI A;  4DSF A;  3AVK A;  3SI6 A;  4RW6 A;  4KKO A;  3I0R A;  4JV5 K;  3VES A;  3UB5 A;  2Y1J A;  1VSE A;  1ASW A;  3CM5 A;  2I5J A;  3VF4 A;  3V1R A;  4PQU A;  2VWB A;  4DCH A;  4CEZ A;  3LDS A;  3C6A A;  1WB9 A;  4CFB A;  4YOT A;  3SV4 A;  1ESV A;  3HBT A;  5HBM A;  1BIS A;  2YV0 X;  1WN7 A;  4JKG B;  4DTO A;  1NKB A;  1BA1 A;  1EWQ A;  3LP2 A;  4M3X A;  2IDO A;  1CLQ A;  4PL7 A;  4B3M K;  1XWL A;  2BE2 A;  3SQ4 A;  1QVF M;  4Z4G A;  4C23 A;  4GV3 A;  1BUP A;  4N47 A;  2I7N A;  4FK0 A;  4PKI A;  2V52 B;  4CER A;  4L8R B;  1NWK A;  3ALY A;  1N8R O;  3M3Z A;  3ID6 A;  1U48 A;  2O8F B;  1JLC A;  3O4W A;  4BWJ A;  4FYD A;  3O3G A;  4FWO A;  1B9D A;  2V51 B;  3WUH A;  5DM6 L;  2V7Y A;  1TVR A;  4O0J A;  1HMV A;  1QVG M;  4CEB A;  2QWL A;  4ICL A;  1MWK A;  1HPZ A;  3E66 A;  3H1V X;  3O08 A;  2Z1G A;  3QIO A;  5KRS A;  4X62 K;  3LAM A;  4EP5 A;  2XO7 A;  4RW4 A;  1U2V B;  3E9O A;  3R9P A;  2BDP A;  2VCP A;  3CJA A;  1IBK K;  5BRH A;  4KO0 A;  1B9F A;  3MXJ A;  4YOW A;  4DTU A;  4OLA A;  2G8F A;  3NBP A;  4AH9 A;  1D9D A;  1U45 A;  2OTL N;  4KTZ A;  2FXU A;  3LDP A;  4BC5 A;  3I0S A;  3MN5 A;  1IKX A;  5FPN A;  1MDU B;  3EZ5 A;  3LDN A;  1RIL A;  2OAN A;  1GOA A;  2XY5 A;  4QOZ B;  3MN7 A;  3W3D A;  2OCE A;  2YNI A;  2D0B A;  2HMI A;  5CZ2 A;  1KVA A;  4XH4 A;  3SBG A;  4ELV A;  4BC3 A;  4CF9 A;  3OS2 A;  5AQM A;  5FLX O;  3WNG A;  1HKB A;  1MA9 B;  4K41 A;  1QTM A;  4KHW A;  5KQD A;  3K5O A;  1NNE A;  3W0L A;  3BF3 A;  4FW1 A;  1V4S A;  4J2A A;  3VET A;  1VAZ A;  5M1O A;  3VMF B;  5FPM A;  3QNO A;  1YTA A;  4CGI A;  3MX2 A;  3SPZ A;  5LL6 Z;  5E41 A;  1KFS A;  4MQ3 A;  3QDK A;  4JI1 K;  4LF8 K;  3FZK A;  2HST A;  4ILJ A;  1RTI A;  2FBV A;  5AQF A;  4HTU A;  1UAX A;  1ZXO A;  3J7Y P;  5AFU A;  1NK0 A;  3VEY A;  3PV8 A;  1C6V A;  3VQ5 A;  4EZ6 A;  4W5Q A;  4CGG A;  2OZM A;  3RRG A;  2WFB A;  3VQC A;  4KHN A;  1REV A;  4BRI A;  3CQY A;  3RSE A;  5SWM A;  4E7I A;  4JRQ A;  1CZA N;  4NYF A;  3LDQ A;  3TSU A;  4CE9 A;  3PX6 A;  4BG8 A;  4B3T K;  3SNN A;  3RMB A;  3LP0 A;  2W42 A;  3AO2 A;  2NUB A;  2YCH A;  3OYJ A;  2OZS A;  1H1V A;  4GNI A;  4O5F A;  1BGX T;  2O8E A;  2VGN A;  3DLR A;  3CFR A;  3AVH A;  3NF9 A;  3L0Q A;  4U67 L;  2E2P A;  5HOO A;  1ZBL A;  1S3X A;  3OYL A;  3TAE A;  1TK8 A;  2ZQB A;  3G25 A;  4A5B A;  3FZM A;  3L6Q A;  2P9N A;  3VEX A;  4PA1 A;  4UQG A;  4Z94 A;  3MEC A;  4YOU A;  1C0F A;  2IAJ A;  4Q5V A;  2OYQ A;  2P9P B;  4OVL A;  1YI2 N;  1V4T A;  3BF1 A;  3L3V A;  4BR5 A;  4DTM A;  4B9V A;  1NJZ A;  4KI6 A;  4E89 A;  1TUY A;  2HNY A;  3VEW A;  4I9Q A;  5JVG L;  1JLQ A;  3DOK A;  1UA0 A;  3ZSQ A;  3DYA A;  3CCS N;  1E4G T;  3BZK A;  5CE3 A;  1VSM A;  3FE1 A;  3NH1 A;  3J7A P;  2KQ2 A;  3O80 A;  5CYM A;  5GAE P;  4YHH K;  1NGJ A;  2E2Q A;  1K6Y A;  1E4F T;  1NGG A;  3WNH A;  2PYJ A;  4BRN A;  1GLB G;  2UYT A;  3QEW A;  4CZG A;  1T7P A;  5AQI A;  5BN9 A;  1NK4 A;  1C1A A;  2HF4 A;  4XIU A;  1IO2 A;  1SKW A;  1E3M A;  4NXN K;  3KK2 A;  3V81 A;  2P5G A;  3N4P A;  4JD2 B;  3MAQ A;  3MWT A;  3CMA N;  3PUF A;  1LAW A;  1TV6 A;  4I2P A;  4JK7 A;  1NMD A;  3CJC A;  1GLL O;  3HM8 A;  4MDA A;  3D45 A;  3LDO A;  5KPT A;  1BA0 A;  1XQS C;  4FZY A;  4FLU A;  4B9S A;  1K73 O;  2P9S A;  3LL3 A;  2QXF A;  5MLC Q;  2RN2 A;  3IG1 A;  2A3Z A;  1X3N A;  3L2R A;  4BVO A;  4KRF A;  4GVE A;  4CEF A;  3R8E A;  2GBZ A;  3T1H K;  5C10 A;  1SL0 A;  1NLV A;  2RF2 A;  3PX4 A;  1BDG A;  1XHX A;  4NCA A;  2DTU A;  3CCM N;  3VGL A;  4Y1C A;  3HT3 A;  4BDP A;  4V19 S;  1Z6R A;  3C0B A;  1HYZ A;  3L2U A;  3AVA A;  1XHZ A;  3V9S A;  5AFU H;  2H3G X;  3SUP A;  4H8K A;  3HL8 A;  1YAG A;  4KH6 A;  2HMP A;  4FOI A;  2G8H A;  4NLB A;  3M8Q A;  4FVM A;  5IWA K;  1N34 K;  3B6P A;  5KPR A;  4BAC A;  4YOV A;  4WQ5 C;  1ZYQ A;  4IOA L;  2NRZ A;  4JKF A;  4FJ8 A;  4AHT A;  3AAR A;  4JI4 K;  4DTN A;  2QKB A;  4C8O A;  2KZZ A;  1JLG A;  4AHC A;  1BCM A;  1LW0 A;  1NK8 A;  1WBD A;  3SZ2 A;  3KJV A;  4B9L A;  3EY1 A;  3D0P A;  2A41 A;  3CF5 L;  4M63 C;  3ASM A;  3DXM B;  3QLH A;  3OY9 A;  3OYE A;  3D2E B;  3HP6 A;  4OPH A;  4JI7 K;  4CJV A;  1Z25 A;  1BHL A;  4KI4 A;  4I7F A;  3CQ8 A;  4CW7 B;  2X78 A;  2UXB K;  4DS5 A;  5AZJ A;  1P90 A;  3AVF A;  2XY7 A;  3R1X A;  1C0U A;  4ISE A;  1HQU A;  1S1T A;  2WBN A;  3U8X A;  1B92 A;  1YJN N;  2WON A;  1XNR K;  3CCU N;  1TAU A;  2HHQ A;  3TWH A;  3OW2 M;  1EKE A;  4A2B A;  5GIO A;  1HPM A;  2E5L K;  2D1K A;  2X74 A;  1QSL A;  1EQY A;  4CJ4 A;  1XC3 A;  3TTD A;  5GAD P;  2HNZ A;  1KSP A;  2E4L A;  2FF3 B;  1OH6 A;  1RDU A;  4QS7 A;  5LMU K;  2NRW A;  4NXM K;  4ISF A;  2A6A A;  2WC9 A;  2F9T A;  1KRP A;  4JEP A;  5KI6 A;  2VGM A;  1FK9 A;  4M3Z A;  3JYT A;  5CHI A;  2JGU A;  4LF7 K;  3LZJ A;  1U6Z A;  4CGD A;  3N4Q A;  2A40 A;  3DI6 A;  3IFR A;  3A2F A;  4H4M A;  3ULE A;  1RT3 A;  3WNE A;  4Z0U A;  4CK1 A;  3KLI A;  4DG1 A;  4BE2 A;  5I42 A;  4CFC A;  1DEJ A;  4FLT A;  3CQX A;  3GG4 A;  3LM9 A;  3HYF A;  3CER A;  3AGK A;  5EOY A;  4C8N A;  1EO1 A;  3OBW A;  2KW4 A;  1I3A A;  5J2P A;  1HLU A;  1D5A A;  5KRT A;  2VWK A;  4CJQ A;  1RDB A;  4CBW A;  5A2Q O;  4JI2 K;  3O9S A;  3D2F B;  4F8R A;  4IOC L;  4BDZ A;  4IO9 L;  3CME N;  4R5P A;  4FJK A;  2BAN A;  1C1B A;  2G8W A;  5ADX A;  3V9X A;  3J81 O;  4WF9 L;  4I6M B;  2HHW A;  1RT6 A;  4KV8 A;  5BN8 A;  5BPL A;  4DV2 K;  2EX3 A;  3A0I X;  3GDQ A;  4RW8 A;  3O3H A;  1RDC A;  1RT1 A;  5GIN A;  3CFP A;  3QO9 A;  1X1P A;  3OYD A;  2IVO A;  3JS6 A;  4FCY A;  3U4L A;  1LV5 A;  2HBM A;  1KVB A;  2QW9 A;  3CC4 N;  3M1F A;  3B6O A;  1YF5 L;  3VOV A;  3DRS A;  4FWN A;  4DV6 K;  4AF1 A;  4OGE A;  3I55 N;  1SKR A;  1VQ8 N;  4DSI A;  3CJB A;  4FJ5 A;  1GLD G;  1QQN A;  2NZT A;  1T6C A;  4ZHR A;  5JLH A;  1D4X A;  2B6A A;  4KHY A;  4BRM A;  2ASP A;  4K0K K;  3OYI A;  4DR6 K;  1TK0 A;  3NE6 A;  1ASV A;  1X9S A;  3LAK A;  2VWJ A;  4E7H A;  5C12 A;  5J2N A;  2HBL A;  2NRH A;  4RWT A;  5DM7 L;  1T03 A;  3ZT2 A;  3VQE A;  1BI4 B;  5M1P A;  3KLG A;  5AQT A;  1JCG A;  4CBU A;  4CJ3 A;  4OPK A;  2IIR A;  4OKJ A;  2OA8 A;  4KHQ A;  2JLE A;  3M8R A;  2PZS A;  4CEQ A;  1TGO A;  2GUI A;  3LM2 A;  1UA1 A;  4CZM A;  2QWN A;  2FLO A;  3AA2 A;  3UKR A;  1S72 N;  2RKI A;  3ID8 A;  4CES A;  4BWM A;  4DLE A;  3ZSZ A;  3OYG A;  3P39 A;  4O5B A;  1ATS A;  4YOX A;  3WXK A;  4BRF A;  3RMA A;  3CJ1 A;  4CED A;  2DPN A;  4RG8 A;  4G9Z A;  1L5U A;  3U9D A;  4RW9 A;  2D0C A;  3MEG A;  4BGA A;  4O0I A;  3CD6 N;  5I3U A;  4HTL A;  1SQK A;  4CJP A;  2ZF5 O;  4NCG A;  3K5L A;  4KTQ A;  4JRP A;  4LFC K;  3V1Q A;  3THW B;  3CI5 A;  2E6M A;  3TAQ A;  1WSH A;  3QIC A;  4M3T A;  4KH5 A;  4CJ7 A;  3DRP A;  4CJK A;  1DLO A;  2QWR A;  2Z1H A;  1KLM A;  3SMS A;  3EE8 A;  3KK7 A;  3TU5 A;  4CGF A;  1NBW A;  4B3R K;  1NGA A;  4FWL A;  3AVL A;  4FO0 A;  1RDA A;  3CFO A;  1VQ7 N;  1M1K O;  4CHO A;  3TPQ A;  3CCR N;  3PLA A;  4LF5 K;  1WSI A;  3QIP A;  2NNW A;  4DMN A;  5CYQ A;  3L8B A;  2W6L A;  4MFB A;  5ADX H;  4KH4 A;  1LWF A;  4EFH A;  4G1Q A;  5K14 A;  1Q18 A;  3CCL N;  3LWM A;  4DU1 A;  1VQ6 N;  5AQS A;  2IOC A;  3I56 N;  5AQN A;  1I39 A;  1ILY A;  3AGR A;  3UE5 A;  2A5X A;  4FJI A;  1HRH A;  4NO7 A;  1WUA A;  3K5N A;  3VEZ A;  3NDK A;  2NLX A;  1IBL K;  5HL7 L;  1SKS A;  1KTQ A;  4CZJ A;  3P83 D;  3SAH A;  4FJL A;  1VQM N;  4CF0 A;  1XI1 A;  2WTU A;  1FKO A;  3NGI A;  4CJU A;  3MN6 A;  3WXL A;  4BDY A;  4CIF A;  4O44 A;  4JN4 A;  3O5B A;  4CHN A;  2Q0U A;  4QAG A;  2BTF A;  4FWQ A;  2QK9 A;  1QSY A;  3ZT1 A;  3OJU A;  1WSJ A;  4H0X B;  3AO5 A;  2YHX A;  4BE0 A;  3S41 A;  4BC4 A;  1RDW X;  1T6D A;  3ZLJ A;  3OYA A;  4CZL A;  5SZT A;  1GOB A;  4CBX A;  3K0S A;  3EZW A;  3ZSR A;  4W5T A;  3AAP A;  4MO5 A;  4N76 A;  1KAY A;  3OS1 A;  3AV9 A;  1KFD A;  3NCI A;  5CZ1 A;  2OPR A;  4R79 A;  4DQI A;  3QFU A;  4B08 A;  4CZH A;  3H08 A;  1IJJ A;  4CZF A;  1DT9 A;  1X9M A;  1SS6 A;  2HHU A;  1N5Y A;  1VSJ A;  2KZM A;  2D0O A;  3EO3 A;  3U3G A;  3PIO L;  2BGG A;  5AQL A;  4FLX A;  5F1X A;  4DF8 A;  1Q9X A;  3CPE A;  2FF6 A;  4CJT A;  4JKB A;  2KFZ A;  3C6U A;  2FBX A;  3LWL A;  4ZTJ A;  4CGH A;  5T7B A;  1VRU A;  2P9N B;  4CJE A;  1GLA G;  3FGU A;  4HHT A;  4EIA A;  2KTQ A;  2E2N A;  1G99 A;  4IEE A;  4CJR A;  3ZEU B;  3NH2 A;  2VQF K;  2ZJP L;  1LW2 A;  2P9K A;  3I33 A;  1Q81 O;  4QS9 A;  3QBW A;  4AHU A;  4H5N A;  2Z1I A;  1NKE A;  1OKJ A;  1YJ9 N;  5HRR A;  4WQ4 A;  4JK8 A;  3CCQ N;  1ASU A;  5AZI B;  2BH1 A;  1S1W A;  4IDH A;  2A42 A;  3KK3 A;  3K59 A;  2OPP A;  5FPD A;  4BRE A;  2HBJ A;  4IFV A;  4DV0 K;  1HYV A;  1LOT B;  1SZ2 A;  3WQU A;  4JHD A;  5HRO A;  3LP1 A;  1HNX K;  3FZH A;  3QBX A;  4LD0 A;  2NRV A;  1S9E A;  1VSF A;  3HI0 A;  3LAL A;  3TAF A;  4WYB A;  4QS8 A;  4A61 A;  4CK3 A;  1VQN N;  3KK1 A;  1YVU A;  3TAR A;  4E7K A;  2OPS A;  4YY3 K;  1YXQ A;  3ATV A;  3WQT A;  2V7Z A;  1NGI A;  3A5L C;  2XY6 A;  1QE1 A;  4BRK A;  2W40 A;  3HST B;  3S9H A;  4FPA A;  4JI0 K;  4JKG A;  4N41 A;  2ATQ A;  4M3W A;  1JCE A;  4DV4 K;  5DK5 A;  1U4B A;  2VG5 A;  1YVN A;  3NGY A;  5FRM A;  1W0H A;  2D0A A;  3PO4 A;  3HTV A;  3SUO A;  1T44 A;  4OPA A;  5FRO A;  2O4I A;  3O1B A;  4CI6 A;  1KQS M;  4FK2 A;  2QWO A;  1HQE A;  5LJV A;  3C95 A;  2O8F A;  2JWL A;  3LP3 A;  3ISN C;  4FW2 A;  3SLC A;  3ZCM A;  4GY2 B;  4CHP A;  5KGX A;  3AVM A;  4BR2 A;  4E1N A;  1ZC6 A;  3AVG A;  4CEE A;  4DUY K;  2P9I B;  3MXI A;  3LPT A;  5GAH P;  2FBY A;  2B4J A;  2UUC K;  4YNQ A;  3TSP A;  2Q0R A;  2O8D B;  4PL8 A;  1TYQ B;  1U2V A;  4KHS A;  2HBK A;  1NK7 A;  4GVM A;  4MDB A;  4FWM A;  4B9U A;  2A1S A;  2OPQ A;  2GUP A;  3THX B;  1TAQ A;  3O6W A;  4FZZ A;  5AQY A;  5AQP A;  3O1W A;  2UUA K;  4FJH A;  5AZJ B;  3J8A A;  3RTV A;  3CHW A;  3OYK A;  4OPJ A;  3KD1 E;  4OKK A;  2E2O A;  3MCA B;  3QEX A;  1OH5 A;  2FSJ A;  3FFI A;  2HVH A;  1J9A A;  5KGW A;  4A2A A;  2RE2 A;  2PY5 A;  4B9M A;  4B1Z A;  5JVH L;  3HJF A;  5AQQ A;  3V1O A;  2CGJ A;  3H3N O;  3K58 A;  2EWS A;  5F0X A;  4DTS A;  4W5O A;  3VTH A;  1RT7 A;  3UKU A;  1RBS A;  3WT0 A;  3DLB A;  3NMU A;  4IFY A;  3ZT3 A;  2Q1N A;  4B3O A;  1CZB A;  3SQ2 A;  4KHU A;  1Z26 A;  4IZ9 A;  3ULE B;  3D6R A;  2E20 A;  3RWU A;  3OYM A;  4OLB A;  1RTJ A;  1HKC A;  3VQ9 A;  4CEO A;  1J6Z A;  5CR4 A;  1TKT A;  1VQL N;  5E84 A;  4CJS A;  4WFN L;  3DLG A;  1YIJ N;  3P31 A;  4FWR A;  4H5R A;  3HPH A;  2VYP A;  1RFQ A;  3DWL A;  1KVC A;  3IMX A;  2AP1 A;  1C0T A;  2HND A;  3OYB A;  2ZE2 A;  2FBT A;  4XH1 A;  1WAJ A;  3T7Z A;  1CXQ A;  2QM1 A;  2F4V K;  1HJR A;  1XC9 A;  2PAV A;  3VF2 A;  3BP8 A;  1K8K A;  3NF8 A;  4YOR A;  1Z05 A;  3CCJ N;  1IBM K;  2YHW A;  1J53 A;  3VEV A;  3PY8 A;  3SUQ A;  4JNE A;  1WSG A;  3M6G A;  2E8A A;  5EXW A;  4DU3 A;  3DLH A;  1GLF O;  1R0A A;  1YIT N;  1NKC A;  4M3R A;  4C8K A;  4F9O A;  4NCB A;  3EN9 A;  2QA4 N;  3V9U A;  3K57 A;  4M42 A;  3U6F A;  3HPG A;  4CD3 A;  5AQR A;  2XY8 A;  4J2B A;  2GTD A;  3E1Y A;  2YHA A;  3DRR A;  4LF6 K;  4OO1 J;  1T3V A;  2CH5 A;  1ZBU A;  4CJL A;  4ID5 A;  4DTR A;  2ZGY A;  1ZBH A;  4CCH A;  4JYA K;  3O9R A;  3T1Y K;  1RT2 A;  5JMV A;  1VQ9 N;  4LFA K;  1WOQ A;  1WSF A;  3A8Y A;  3EEQ A;  3QEV A;  3HVT A;  1HNZ K;  1Q7Y O;  1BCO A;  1S22 A;  1BO5 O;  1RT5 A;  2Q2R A;  3CC2 N;  3LDL A;  1J5O A;  1ZBF A;  2FSK A;  2RPI A;  1L3V A;  2P51 A;  3KWI A;  2YJE A;  3F73 A;  4CJ5 A;  1JLE A;  3R3L A;  2P1J A;  3WXJ A;  4JD2 A;  3A5N C;  1NGD A;  1DTT A;  1RBV A;  5KPZ A;  5C0Y A;  4F4K A;  5EU7 A;  2GEL A;  3L3U A;  4DFK A;  2VQE K;  4DV5 K;  2G8U A;  4N56 A;  3THY A;  1EET A;  5AQG A;  3KIO A;  3U9Z A;  1NU0 A;  1VQ5 N;  3TAB A;  2GWJ A;  4B1W B;  1JLA A;  5F2R A;  1NJY A;  3U3Y A;  1P8Z A;  4J8F A;  3DLL L;  1WBB A;  4JI3 K;  4Z4F A;  3SAF A;  4CZK A;  5GIP A;  1R59 O;  1VSL A;  4KPY A;  4C1N K;  1NGC A;  2DY4 A;  4PY5 A;  4HCB A;  4NB4 A;  3WEE B;  5GAG P;  2XRI A;  4JS5 A;  1BIZ A;  3JAM O;  3RMD A;  4FOE A;  3CYM A;  4KBO A;  4EHU A;  1IKW A;  2FC0 A;  3RRH A;  4B1Y B;  4JS4 A;  1NK6 A;  4BR9 A;  1GLJ O;  4JLH A;  4L3Q A;  1RNH A;  2UXC K;  1KXP A;  4LSL A;  1QQO A;  2GX9 A;  3T19 A;  1BIU A;  1KAX A;  5J2M A;  4KRE A;  3VEO A;  4AM6 A;  4CEA A;  2P9L B;  3ZSY A;  3IRX A;  4ISG A;  1JL1 A;  2IC3 A;  3K5M A;  3AVB A;  2G8V A;  2YHB A;  3VA0 A;  3AO1 A;  2F8T A;  4OX9 K;  3EL2 A;  1KCF A;  4LH5 A;  4FZX C;  3SJJ A;  3FR0 A;  1ITG A;  1QSS A;  3VER A;  1NMN A;  5AQO A;  3C6T A;  4YOY A;  1NK9 A;  4DS4 A;  4EP4 A;  4FL9 A;  3C7N A;  3VEN A;  4F2S A;  1T05 A;  2Z1J A;  2FSN A;  4GV9 A;  3O3F A;  1UOC A;  2F8S A;  2CH6 A;  4MLH A;  1FKP A;  4IOX A;  3ZSW A;  1VK0 A;  4EHT A;  4XH5 A;  3MEE A;  3DXK A;  4IJA A;  3P38 A;  3DLE A;  2O8C A;  2F96 A;  3VQ4 A;  1BU6 O;  1LWE A;  1M90 O;  4DR5 K;  4WFB L;  4PKG A;  2CGK A;  4AQY K;  4OKE A;  4DTJ A;  3E01 A;  4M3U A;  3HK2 A;  5BRD A;  4H5V A;  5C2F A;  4CZE A;  4GKK K;  1TL3 A;  1W2B M;  4DB3 A;  4DSL A;  4ZTF A;  1QHA A;  1MWM A;  3L2Q A;  4B1U B;  5LJW A;  4W5R A;  1YHQ N;  2O8B A;  2KFN A;  5JLF A;  4LFB K;  2G8I A;  4M7Y A;  4B1V A;  5AQU A;  1VSH A;  4E1M A;  1TKX A;  3EKU A;  4K25 A;  3HPO A;  2HW3 A;  3QEI A;  5I9E B;  4E0D A;  4BRA A;  3NFA A;  2NRX A;  1IH7 A;  5ELZ A;  3RVC A;  4JAX A;  4XEI A;  4CJW A;  4CF8 A;  1WSE A;  1NJX A;  4FJN A;  1Q82 O;  2KHO A;  3BDP A;  3G10 A;  3DAW A;  3HOS A;  4K43 A;  3FZF A;  3SAG A;  1SL1 A;  1RCH A;  1S5J A;  2ZJR L;  3DM2 A;  5AQX A;  4FM1 A;  4H03 B;  1L3U A;  4DV1 K;  4M7X A;  3F2K A;  4ILH A;  1EX4 A;  1RT4 A;  2P9K B;  2GV9 A;  4FPB A;  1NM1 A;  3VQD A;  2X6N A;  4KTW A;  1BQM A;  5EY4 A;  4AM7 A;  1J5E K;  4F2R A;  1HKG A;  1X9J A;  1HR0 K;  3LPU A;  4B9N A;  4M41 A;  3KVG A;  1W7A A;  4GW6 A;  4JI5 K;  2P5O A;  1GOC A;  5B8H A;  1BQN A;  4ILG B;  4F3O A;  2QWP A;  5AR0 A;  5C24 A;  3MXM A;  1U47 A;  4DQ8 A;  1XNQ K;  3THV A;  1W97 L;  2EHG A;  2W41 A;  3OA9 A;  3CCV N;  3RR8 A;  4KAZ A;  2D5R A;  5KQ8 A;  4FJ7 A;  3VN5 A;  3QFP A;  1FW6 A;  3ZET A;  4DWI A;  4JI8 K;  3GBT A;  3GL1 A;  1YTU A;  4FVU A;  4KFB A;  1S1X A;  1TUU A;  5EX5 A;  1GLE G;  2ITG A;  1BI4 A;  4JI6 K;  1RBU A;  1YJW N;  4KHP K;  1IV0 A;  1YUW A;  3KLE A;  4HVJ A;  2HHS A;  4FM0 A;  2B5J A;  4CZI A;  5BPN A;  3SCX A;  5AJ3 K;  1Q86 O;  4H0V B;  3RSE B;  1A5W A;  4DSJ A;  1BL3 A;  2E1Z A;  3QIN A;  3NF6 A;  3VQP A;  2VG7 A;  3HSC A;  3O4N A;  3HVR A;  3L4I A;  3NHG A;  3GOI A;  3H3O B;  3F9K A;  4HUE A;  3V6D A;  1WLJ A;  3P5J A;  4ID1 A;  2G8K A;  3IDH A;  2WUS A;  4CHZ A;  4EAH D;  4X66 K;  2ZGZ A;  2Q3S A;  3J7Z O;  1JCF A;  4FM2 A;  5LMN K;  4JK9 A;  3S3M A;  2O8E B;  1SUQ A;  1DKG D;  4LH4 A;  2A1R A;  1EP4 A;  5DMR A;  3THW A;  5TKW A;  4X65 K;  2HHX A;  3I8B A;  3TTF A;  1S1U A;  3RR7 A;  3WNF A;  1JLF A;  4ELT A;  1NOZ A;  3JSM A;  2ZJQ L;  2PFU A;  3VQ8 A;  3AA5 X;  3F5T A;  2P9U A;  3IS9 A;  1A5X A;  1VSK A;  2HB5 A;  4DLG A;  3I8D A;  1OH8 A;  4OGC A;  3MN9 A;  3CC7 N;  3AA3 A;  3PIP L;  3OYN A;  1T8E A;  3Q7C A;  1JXB A;  4YFU A;  3SQ0 A;  2YI1 A;  4IJN A;  1IKY A;  3JXU A;  4BR0 A;  4E19 A;  2HVI A;  4FJ9 A;  4C8M A;  2HHT A;  4HUF A;  4DR1 K;  4BVP A;  4GKJ K;  2ZD1 A;  5KTQ A;  3LAN A;  4O8K A;  2DFH A;  1I94 K;  4FJG A;  1X9W A;  2YKM A;  3G6E N;  4A5A A;  2QKK A;  4BG9 A;  5C42 A;  1O1W A;  3S3O A;  3VQ6 A;  4OJR A;  3HRG A;  4NYN A;  3M8S A;  4IKF A;  4TSX A;  5BPM A;  5IT9 O;  2UUB K;  2YNH A;  4CFA A;  5HRS A;  4BRL A;  2AA4 A;  1F21 A;  1EWR A;  2HOE A;  4H4O A;  1TK5 A;  5HRP A;  4K8Z A;  3ZT4 A;  4UY8 O;  2QEX N;  5E26 A;  5H1S Q;  1JL2 A;  3CCE N;  4IG0 A;  3DOL A; 
#chains in the Genus database with same CATH homology
 2PYL A;  3V9X A;  3KD5 E;  1TKT A;  1W9H A;  2DFE A;  4CJS A;  2HHW A;  4FJM A;  1RT6 A;  3DLG A;  4KV8 A;  4HCC A;  3AO4 A;  1VSI A;  3HPH A;  3HM9 A;  2EX3 A;  4RW8 A;  3O3H A;  1RDC A;  1RT1 A;  2IGI A;  3CFP A;  1KVC A;  3AVK A;  3QO9 A;  4DSF A;  1X1P A;  4AIL C;  1C0T A;  3ZSX A;  3SI6 A;  2HND A;  4RW6 A;  1RBT A;  3OYB A;  3OYD A;  2ZE2 A;  2FBT A;  3I0R A;  4KKO A;  4FCY A;  4CHY A;  1WAJ A;  1LV5 A;  1JKH A;  1CXQ A;  1KVB A;  1HJR A;  1TL1 A;  1XC9 A;  4FXD A;  2Y1J A;  1VSE A;  1ASW A;  3CM5 A;  1QS4 A;  3NF8 A;  3B6O A;  4AHR A;  3V9Z A;  2I5J A;  4FLV A;  4KB0 A;  3DRS A;  2WOM A;  1J53 A;  4OGE A;  1SKR A;  3PY8 A;  4WE1 A;  3V1R A;  4DTX A;  2YNG A;  4I2Q A;  4PQU A;  3SUQ A;  4CEZ A;  3LDS A;  1WSG A;  4DSI A;  4FJ5 A;  2E6L A;  4DU3 A;  4J2D A;  4CFB A;  3DLH A;  4ZHR A;  2B6A A;  1R0A A;  3SV4 A;  3G0Z A;  5HBM A;  4KHY A;  1C0M A;  3S3N A;  1BIS A;  1NKC A;  3OYF A;  1NOY A;  4PUO A;  4M3R A;  1ZBI A;  2YV0 X;  4C8K A;  4NCB A;  3OYI A;  1TK0 A;  1WN7 A;  3NE6 A;  1ASV A;  3CM6 A;  4I9L A;  3LAK A;  2VWJ A;  4E7H A;  3LP2 A;  3SYZ A;  4DTO A;  1X9S A;  1NKB A;  4M3X A;  2IDO A;  5J2N A;  1CLQ A;  3V9U A;  1XWL A;  3K57 A;  2BE2 A;  3ZT2 A;  3SQ4 A;  1T03 A;  3VQE A;  3U6F A;  4M42 A;  1BI4 B;  3HPG A;  3ITH A;  4Z4C A;  3KLG A;  4Z4G A;  3V9W A;  3VQ7 A;  4QCL A;  2XY8 A;  1VRT A;  4N47 A;  3TAN A;  4J2B A;  2YHA A;  3DRR A;  3VA3 A;  3QNN A;  4FK0 A;  4CJ3 A;  4OPK A;  1ZBU A;  4CJL A;  4ID5 A;  4DTR A;  4OKJ A;  4CER A;  2OA8 A;  4L8R B;  3ALY A;  4KHQ A;  2JLE A;  3M8R A;  2PZS A;  4CEQ A;  1TGO A;  2GUI A;  1WAF A;  4N5S A;  4E3S A;  1ZBH A;  4CCH A;  1UA1 A;  1U48 A;  3O4Q A;  1RT2 A;  1JLC A;  4AHV A;  1QQC A;  4BWJ A;  3T3F A;  3AA2 A;  1WSF A;  4FYD A;  3O3G A;  2RKI A;  1B9D A;  4CES A;  4BWM A;  3QEV A;  3HVT A;  4DLE A;  1IG9 A;  3T1A A;  3ZSZ A;  1Y97 A;  3OYG A;  4O4G A;  4O5B A;  1BCO A;  1TVR A;  4O0J A;  1HMV A;  1RT5 A;  1J5O A;  4CEB A;  1ZBF A;  3AVN A;  4ICL A;  3RMA A;  4AHS A;  4LY7 A;  2RPI A;  1HPZ A;  4CED A;  4RG8 A;  1L5U A;  2Z1G A;  3QIO A;  3NAE A;  5KRS A;  1L3V A;  4RW9 A;  2P51 A;  2D0C A;  3MEG A;  3F73 A;  4CJ5 A;  1JLE A;  4O0I A;  4LSN A;  4CIE A;  3LAM A;  5I3U A;  2P1J A;  4EP5 A;  2O4G A;  4CJP A;  4CFD A;  4NCG A;  2XO7 A;  3K5L A;  4KTQ A;  4JRP A;  1TKZ A;  4RW4 A;  1DTT A;  1RBV A;  3V1Q A;  3HXM A;  4F4K A;  5EU7 A;  2BDP A;  2E6M A;  3L3U A;  4DFK A;  3QER A;  3TAQ A;  1WSH A;  2G8U A;  3TR8 A;  4KO0 A;  4N56 A;  1B9F A;  4M3T A;  3MXJ A;  3NH0 A;  1EET A;  5C25 A;  4DQS A;  4DTU A;  2G8F A;  3NBP A;  3KIO A;  4AH9 A;  4OLA A;  3DRP A;  4CJK A;  1DLO A;  1U45 A;  1D9D A;  2XHB A;  4KTZ A;  3TAB A;  2Z1H A;  3UIQ A;  1KLM A;  3I0S A;  1IKX A;  1JLA A;  3MED A;  3EZ5 A;  1RIL A;  3OYC A;  1GOA A;  2XY5 A;  4QOZ B;  1Q8I A;  4CGF A;  1NJY A;  3U3Y A;  4FJX A;  3AVL A;  2YNI A;  2D0B A;  3AA4 A;  2HMI A;  4IG3 A;  5CZ2 A;  4Z4F A;  1HYS A;  1KVA A;  4ELV A;  1RDA A;  3CFO A;  1G15 A;  4CF9 A;  4CHO A;  3OS2 A;  1LAV A;  1D8Y A;  1S9G A;  3WNG A;  3ZSO A;  1VSL A;  1QTM A;  4KPY A;  1J54 A;  1WSI A;  4KHW A;  3QIP A;  2DY4 A;  4DMN A;  3K5O A;  4PY5 A;  4HCB A;  5CYQ A;  3OVN A;  4FW1 A;  1S6P A;  3L8B A;  4C8L A;  4J2A A;  2YKN A;  4CK2 A;  4MFB A;  5D3G A;  1LWF A;  3QNO A;  1YTA A;  2XRI A;  4JS5 A;  4HUG A;  4CGI A;  4G1Q A;  1BIZ A;  3SPZ A;  3RMD A;  5K14 A;  3KLH A;  1RBR A;  3K2P A;  3CYM A;  1LWC A;  5E41 A;  3CG7 A;  3LWM A;  1KFS A;  4MQ3 A;  1MU2 A;  4DU1 A;  1IKW A;  2FC0 A;  3RRH A;  2IOC A;  4JS4 A;  1RTI A;  2FBV A;  1NK6 A;  2YNF A;  1I39 A;  4HTU A;  1UAX A;  3C94 A;  4JLH A;  5J1E A;  1RNH A;  1NK0 A;  4FJI A;  4LSL A;  1HRH A;  3K5N A;  3NDK A;  3PV8 A;  1C6V A;  1BIU A;  3T19 A;  3VQ5 A;  4FK4 A;  3LZI A;  4EZ6 A;  1SKS A;  4W5Q A;  3OS0 A;  3OYH A;  4CGG A;  1KTQ A;  5J2M A;  3RRG A;  2OZM A;  4KRE A;  1VSD A;  1L3S A;  3VQC A;  4CEA A;  3P83 D;  3ZSY A;  4FJL A;  1REV A;  4KHN A;  3IRX A;  4CF0 A;  1XI1 A;  5SWM A;  1JL1 A;  4E7I A;  1FKO A;  2IC3 A;  3OJS A;  3K5M A;  4JRQ A;  3NGI A;  4CJU A;  4BDY A;  3AVB A;  5J2Q A;  4CIF A;  2G8V A;  4ELU A;  2YHB A;  4NYF A;  3VA0 A;  4O44 A;  4CE9 A;  3AO1 A;  4B8C A;  2F8T A;  3PX6 A;  1RTD A;  4CHN A;  1KCF A;  4LH5 A;  4QAG A;  4FZX C;  3SJJ A;  3SNN A;  1D9F A;  1ITG A;  3RMB A;  1QSS A;  4CGJ A;  1HNI A;  3LP0 A;  2QK9 A;  1QSY A;  2W42 A;  3ZT1 A;  3OJU A;  1WSJ A;  3AO2 A;  3AO5 A;  4BE0 A;  3C6T A;  4CF2 A;  2NUB A;  1NK9 A;  4DS4 A;  3KKR A;  4EP4 A;  3OYJ A;  2OZS A;  5JS1 A;  1DTQ A;  1BGX T;  3OYA A;  3DMJ A;  4F2S A;  1T05 A;  2Z1J A;  1C1C A;  3DLR A;  2R7Y A;  5SZT A;  3ZT0 A;  1GOB A;  3CFR A;  3AVH A;  1NK5 A;  3NF9 A;  3O3F A;  3ZSR A;  1UOC A;  4W5T A;  1ZBL A;  4N76 A;  3ZSW A;  1FKP A;  2F8S A;  1VK0 A;  3OYL A;  3TAE A;  1TK8 A;  3OS1 A;  4B9T A;  3MEE A;  2ZQB A;  3AV9 A;  1KFD A;  3NCI A;  5CZ1 A;  3AVJ A;  3DLE A;  2OPR A;  2F96 A;  3VQ4 A;  3AVI A;  4PA1 A;  4UQG A;  1LWE A;  4DQI A;  4B08 A;  3H08 A;  3ZSV A;  3MEC A;  1QHT A;  2IAJ A;  4Q5V A;  4M45 A;  2OYQ A;  1CXU A;  1X9M A;  4OVL A;  2HHU A;  3QEP A;  3DLK A;  4OKE A;  4DF4 A;  1N5Y A;  1VSJ A;  3L3V A;  4DTM A;  4DTJ A;  3E01 A;  4B9V A;  1NJZ A;  3U3G A;  4M3U A;  3HK2 A;  2KZM A;  4KI6 A;  2BGG A;  4FLX A;  4E89 A;  1TL3 A;  2VG6 A;  2HNY A;  3TAG A;  4DF8 A;  3SUN A;  1Q9X A;  4DSL A;  3VQB A;  4Z4H A;  4ZTF A;  1JLQ A;  4I9Q A;  3DOK A;  3QET A;  1UA0 A;  3ZSQ A;  3DYA A;  4CJT A;  3L2Q A;  4W5R A;  2KFN A;  2KFZ A;  1WNS A;  3C6U A;  1VSM A;  2FBX A;  3LWL A;  4ZTJ A;  4CGH A;  3NH1 A;  2G8I A;  2KQ2 A;  5CYM A;  1VRU A;  5T7B A;  4FLY A;  1VSH A;  4CJE A;  1TKX A;  4E1M A;  3SV3 A;  1SL2 A;  1K6Y A;  4HHT A;  3L2V A;  3WNH A;  3HPO A;  2PYJ A;  3QEI A;  2KTQ A;  2HW3 A;  3QEW A;  4E0D A;  1T7P A;  4CJR A;  4CEC A;  3NH2 A;  3NFA A;  4FJJ A;  1FXX A;  1NK4 A;  1C1A A;  4XIU A;  1IH7 A;  1IO2 A;  1LW2 A;  1SKW A;  4CJW A;  4DFM A;  3AVC A;  1N6Q A;  3KK2 A;  4CF8 A;  3V81 A;  2P5G A;  1WSE A;  1NJX A;  4AHU A;  1TKD A;  1NKE A;  2Z1I A;  3AO3 A;  3MAQ A;  3QES A;  5HRR A;  4FJN A;  4DTP A;  3PUF A;  1LAW A;  1TV6 A;  3BDP A;  3G10 A;  4I2P A;  4IDK A;  1ASU A;  1SL1 A;  1S1W A;  1RCH A;  1S5J A;  3D45 A;  3VQQ A;  3DM2 A;  3ULD A;  4FZY A;  4W5N A;  4FLU A;  4B9S A;  5CY4 A;  3KK3 A;  3K59 A;  4FM1 A;  2QXF A;  2OPP A;  1L3U A;  2RN2 A;  4IFV A;  1HYV A;  3IG1 A;  4RW7 A;  1EX4 A;  1RT4 A;  2GV9 A;  5HRO A;  3LP1 A;  3L2R A;  4KRF A;  3BGR A;  3VQD A;  2X6N A;  4KTW A;  3PX0 A;  1BQM A;  4LD0 A;  4F3T A;  1S9E A;  4CEF A;  2GBZ A;  1VSF A;  3M8P A;  3LAL A;  3TAF A;  4F2R A;  4CK3 A;  1SL0 A;  3KK1 A;  4K8X A;  2RF2 A;  3NF7 A;  3PX4 A;  3LPU A;  4DQQ A;  4B9N A;  4M41 A;  1XHX A;  1SV5 A;  4DQP A;  4GMJ B;  1YVU A;  3TAR A;  1YT3 A;  4GW6 A;  4NCA A;  2P5O A;  4E7K A;  1GOC A;  2OPS A;  2DTU A;  4DQR A;  1BQN A;  4Y1C A;  4F3O A;  3HT3 A;  5C24 A;  4BDP A;  3MXM A;  1HYZ A;  3L2U A;  3AVA A;  1U47 A;  1XHZ A;  3V9S A;  4BE1 A;  3THV A;  2EHG A;  3SUP A;  4H8K A;  3HL8 A;  1NJW A;  2XY6 A;  2G8H A;  3RR8 A;  1U04 A;  4KAZ A;  3M8Q A;  2D5R A;  2HHV A;  1UWB A;  1QE1 A;  4FVM A;  4FJ7 A;  3B6P A;  3VN5 A;  4DWI A;  3HST B;  3S9H A;  4CIG A;  4BAC A;  4B8A B;  4Z4I A;  1ZYQ A;  4N41 A;  2X6S A;  2ATQ A;  1L3T A;  4Z4E A;  4FJ8 A;  4M3W A;  4AHT A;  5DK5 A;  1U4B A;  1YTU A;  2VG5 A;  3HP9 A;  4KFB A;  3HO1 A;  1S1X A;  3NGY A;  4DTN A;  2QKB A;  5FRM A;  2ITG A;  1W0H A;  3L2W A;  1BI4 A;  2D0A A;  3PO4 A;  4C8O A;  1JLG A;  3SUO A;  1RBU A;  4AHC A;  1BCM A;  1LW0 A;  1NK8 A;  2KZZ A;  1CZ9 A;  5FRO A;  3SZ2 A;  2O4I A;  2AJQ A;  1HNV A;  3KLE A;  2IS3 A;  3KJV A;  3TAM A;  4B9L A;  4HVJ A;  3EY1 A;  3D0P A;  3IAY A;  4FK2 A;  2Y1I A;  2HHS A;  1HQE A;  1A5V A;  4FM0 A;  2B5J A;  3C95 A;  3KTQ A;  3ASM A;  2DFF A;  3SCX A;  4CHQ A;  3QLH A;  2LSN A;  3OY9 A;  3LP3 A;  1A5W A;  3VQA A;  3OYE A;  4O55 A;  3ISN C;  1BL3 A;  3QIN A;  5FDL A;  4DSJ A;  3NF6 A;  4FW2 A;  2VG7 A;  3O4N A;  3VQP A;  3HP6 A;  3ZCM A;  4CJV A;  3HVR A;  1S6Q A;  1Z25 A;  1BHL A;  4E7J A;  3NHG A;  4DFJ A;  4KI4 A;  4CHP A;  4I7F A;  3AVM A;  5KGX A;  3CQ8 A;  2X78 A;  3F9K A;  4HUE A;  3V4I A;  4E1N A;  4DS5 A;  3V6D A;  5FRN A;  4DU4 A;  1WLJ A;  3P5J A;  4ID1 A;  4CF1 A;  2G8K A;  3AVG A;  4CEE A;  4CHZ A;  4M3Y A;  4IBN A;  2Q3S A;  3AVF A;  2XY7 A;  1C0U A;  4FM2 A;  1HQU A;  4KB1 A;  1S1T A;  3MXI A;  1B92 A;  3LPT A;  2FBY A;  2WON A;  3S3M A;  2B4J A;  4DSE A;  4YNQ A;  4DSK A;  1SUQ A;  4LH4 A;  2A1R A;  1EP4 A;  1TAU A;  2HHQ A;  3NGZ A;  5DMR A;  3TWH A;  4KHS A;  3EYZ A;  1NK7 A;  1EKE A;  2HHX A;  4GVM A;  4B9U A;  1KLN A;  3RR7 A;  1S1U A;  2A1S A;  2OPQ A;  4J2E A;  2X74 A;  3WNF A;  1JLF A;  1QSL A;  4CJ4 A;  4ELT A;  1NOZ A;  1TAQ A;  4FLW A;  4PWD A;  3JSM A;  2HNZ A;  1KSP A;  4FZZ A;  2E4L A;  3AA5 X;  3VQ8 A;  3TAP A;  4FJH A;  3TI0 A;  3IS9 A;  3RTV A;  1A5X A;  3P1G A;  1VSK A;  3SQ1 A;  5HLF A;  2HB5 A;  4DLG A;  3I8D A;  1KRP A;  4OGC A;  3OYK A;  4OPJ A;  1EXQ A;  4FLZ A;  1RDD A;  4OKK A;  5KI6 A;  1S1V A;  5HRN A;  1FK9 A;  3KD1 E;  3JYT A;  3AA3 A;  4M3Z A;  3OYN A;  2JGU A;  1T8E A;  3QEX A;  1IKV A;  1JXB A;  4YFU A;  1JXE A;  3LZJ A;  3FFI A;  4CGD A;  3SQ0 A;  1IKY A;  3DI6 A;  2HVH A;  3A2F A;  1J9A A;  4H4M A;  4E19 A;  5KGW A;  1RT3 A;  2HVI A;  2PY5 A;  3WNE A;  4Z0U A;  4CK1 A;  4FJ9 A;  4C8M A;  2HHT A;  4HUF A;  3KLI A;  1JLB A;  1Q9Y A;  4B9M A;  4EZ9 A;  3KLF A;  4DG1 A;  4BE2 A;  5I42 A;  4CFC A;  2ZD1 A;  5KTQ A;  3LAN A;  3HJF A;  3V1O A;  2DFH A;  4FLT A;  3K58 A;  1X9W A;  2YKM A;  4FJG A;  4DTS A;  4W5O A;  3PO5 A;  3HYF A;  2QKK A;  1RT7 A;  4C8N A;  5C42 A;  1O1W A;  1RBS A;  3VQ6 A;  4OJR A;  3S3O A;  5JS2 A;  3DLB A;  4Q0B A;  4NYN A;  3M8S A;  2KW4 A;  4IKF A;  4TSX A;  1I3A A;  2ETJ A;  4IFY A;  5J2P A;  3ZT3 A;  3RMC A;  4B3O A;  1CZB A;  1D5A A;  5KRT A;  3SQ2 A;  2VWK A;  4CJF A;  4KHU A;  1Z26 A;  2YNH A;  4CFA A;  3KKS A;  4CJQ A;  5HRS A;  4E7L A;  1F21 A;  4H4O A;  1RDB A;  3SPY A;  1U49 A;  1TK5 A;  4DFP A;  5HRP A;  4K8Z A;  3RWU A;  3OYM A;  4OLB A;  3ZT4 A;  4F8R A;  5HP1 A;  1RTJ A;  4BDZ A;  3VQ9 A;  4R5P A;  4FJK A;  2BAN A;  1C1B A;  1RTH A;  2G8W A;  1JL2 A;  4CEO A;  4IG0 A;  3DOL A;  4Y1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...