4DMNA

Hiv-1 integrase catalytical core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
145
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Integrase
publication title Multimode, cooperative mechanism of action of allosteric HIV-1 integrase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/inhibitor
total genus 49
structure length 145
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dmnA00
2IGIA 4OKKA 4DF8A 2EX3A 3NGIA 3TANA 3BDPA 4M3XA 2Z1JA 1RDDA 1CXQA 2DFEA 3AA3A 4CFCA 3TAGA 1I39A 2YNHA 4W5TA 4PY5A 1BQNA 4F3OA 1NKCA 4M3UA 3QEVA 2IOCA 5C42A 5J2QA 4IFYA 1RDBA 3KK2A 4KPYA 4CHZA 2BE2A 3LWMA 3VQDA 4KB1A 4FLXA 4CJ4A 1BIUA 1CXUA 1IKVA 1EP4A 4O0IA 3VQEA 3DM2A 4ZHRA 3KLHA 1DTTA 4E1NA 2WOMA 4KO0A 4CJ5A 3AV9A 1HQUA 1ITGA 4RW6A 4KRFA 3HPGA 3LP2A 1HYZA 4J2EA 4E7JA 4KHWA 3QIPA 4DTXA 4OKEA 3MXIA 3LANA 4ZTFA 1ZYQA 3SJJA 4KAZA 4ZTJA 1NOYA 1HYSA 1A5XA 2HHQA 1WN7A 5J2PA 1TKZA 4CECA 4NCGA 4DTSA 3S3NA 3AVKA 1L3VA 2PZSA 4NCAA 3V9XA 4OPKA 3NCIA 2NUBA 1HYVA 4DTOA 3CM5A 1TKTA 3L2WA 1BI4A 1EETA 1HNVA 4DWIA 4OGEA 3NE6A 4CGJA 3ZT4A 2OZMA 1VSHA 1BCMA 1U04A 1HPZA 1W9HA 2OPPA 3B6PA 3NH0A 4N41A 4N76A 4RW8A 4BE0A 3SCXA 2BDPA 2EHGA 5KGXA 4O55A 2BGGA 4Y1CA 4C8MA 4FXDA 4DTMA 1NKBA 2X74A 4EP4A 3DLRA 4DS5A 3DRSA 3HVTA 3VQPA 1IKYA 2Y1IA 1QE1A 4M3RA 3ZT0A 3RMBA 2PYLA 1BCOA 4CF8A 3A2FA 1MU2A 1C6VA 1D5AA 3G0ZA 3JYTA 3CFRA 1T05A 3SQ0A 3AO5A 3BGRA 3TARA 3RMCA 4AHTA 4OLAA 1REVA 4CK1A 4J2BA 3P5JA 2Z1HA 3V9WA 3THVA 2GUIA 4Q5VA 3VQCA 4AHCA 4DG1A 4CEBA 1JLEA 3PUFA 4IG3A 3ZT1A 2ZQBA 4FJLA 2YNGA 3QEXA 4CE9A 2FBVA 5FRMA 5C24A 2P5OA 4CHNA 4FZXC 1RT2A 3QO9A 4E19A 1RBTA 2XY5A 1KRPA 3P83D 4PQUA 1TK8A 3K58A 1JXEA 1TK5A 2ZD1A 1VSDA 3NF8A 1N6QA 4IBNA 1TKDA 4J2DA 4FZZA 1JL2A 2JGUA 5I42A 1S5JA 3MXJA 1QSLA 1S6QA 2Q3SA 3CYMA 3VQBA 3OY9A 5HRSA 1T03A 1IH7A 1X1PA 2G8KA 1KFSA 4EZ9A 3ISNC 4O0JA 2A1RA 3QESA 4JLHA 3HO1A 3SPYA 4L8RB 3RMAA 2FBYA 1WSEA 3ASMA 3KKRA 2R7YA 3SPZA 1X9WA 3HP6A 2DFHA 5CY4A 4CEDA 4DSKA 3RR7A 1KLNA 1JKHA 4Z4IA 3HL8A 3NF7A 4KREA 1JL1A 3M8PA 4O4GA 3HPOA 2YHBA 3DLKA 3OYFA 4DQRA 3ZSRA 1L3UA 4FM0A 1VSKA 2HHWA 1UAXA 3QNNA 1BHLA 1IKWA 1QS4A 3LP1A 3G10A 1HNIA 4EZ6A 3VQ6A 3AVAA 5HBMA 3LDSA 3KTQA 1NK6A 2G8IA 1BL3A 1JLGA 1IKXA 2HHVA 3VQ7A 1TAQA 3OVNA 3OS2A 1RT6A 1U4BA 3LP0A 4CEFA 2DTUA 1WAJA 3M8RA 4DFKA 2XY6A 1XHZA 2KFZA 5HRNA 3TABA 4RW7A 1FXXA 3U3GA 4E7IA 1QQCA 2FC0A 3SYZA 4ID1A 1KFDA 4I9LA 4DQSA 1ZBFA 4CJVA 1WLJA 4CJ3A 4FM1A 2OZSA 1RILA 3ULDA 3U6FA 4FW1A 2PYJA 4CERA 2HHSA 1L5UA 3OYKA 1SKWA 4CK3A 3WNHA 4B9LA 4CHQA 2YV0X 2RKIA 1RT1A 2LSNA 4RG8A 4FLUA 4KHYA 4MQ3A 3OYAA 2HHTA 1YVUA 5JS1A 3SQ2A 1CZBA 3CQ8A 4CGHA 3DLHA 5CZ1A 4LY7A 3HXMA 2Y1JA 3S9HA 5HP1A 4DQPA 3L8BA 1NK7A 2HVIA 2KTQA 4Y1DA 2BANA 2P5GA 1CZ9A 4CK2A 4F2SA 1LAWA 2QKBA 1S1WA 4E7HA 1ZBLA 1VSLA 1CLQA 4C8NA 3S3MA 2RPIA 1DTQA 1WAFA 1ASUA 4PA1A 4W5QA 3HT3A 3VA0A 4KI6A 3NDKA 4YNQA 4HHTA 1LWCA 1ASWA 1YT3A 3CG7A 3AO3A 1SKSA 1NKEA 4CGFA 3QINA 3I8DA 3VQ5A 3ZCMA 1JLBA 1S9GA 4W5OA 4KHSA 2AJQA 1LWFA 1NJZA 1KVBA 1SV5A 5DK5A 1WNSA 4HTUA 1U45A 5D3GA 1X9SA 2A1SA 1RTIA 1RBUA 3AA2A 1YTAA 1ZBUA 5KRSA 4CIEA 4BWJA 4M3YA 1KLMA 4AH9A 2Z1IA 4DSLA 4AILC 4B3OA 1VRUA 3V1RA 3NHGA 4BE1A 3OYJA 4B9SA 4KHQA 4HUEA 2G8UA 4ICLA 4DSJA 4JS4A 1A5VA 2E6LA 1JLAA 5HRRA 3RRHA 4KHNA 2ETJA 5HROA 1D9DA 1C0UA 4CJWA 2VG7A 1VSMA 3AVMA 4BACA 1S1UA 3L3UA 3V1QA 4FYDA 4DSIA 3LZIA 3OYIA 1J53A 1C0TA 3AVJA 4IFVA 4DTNA 3QIOA 4CJUA 4BWMA 4FCYA 4K8XA 4IDKA 3LWLA 2HHXA 1G15A 1VSFA 2OPSA 4Z0UA 4YFUA 3O3FA 4EP5A 3KLGA 2KW4A 1WSHA 3V9UA 4Z4EA 5JS2A 4I9QA 4N47A 1TGOA 4ELTA 4FW2A 4NCBA 3QEPA 4DTPA 3OS0A 2E6MA 3VQ8A 3SZ2A 4TSXA 4OKJA 1HRHA 4LSLA 4FLVA 4JRQA 4DU1A 1B92A 1B9FA 4I7FA 3HK2A 4OPJA 3TWHA 2D5RA 3HM9A 3QERA 1TKXA 1LW2A 1J5OA 1RNHA 2O4IA 2HNDA 4E89A 5FDLA 1KVCA 3OYEA 2XHBA 4DLGA 1SL0A 3NF6A 4FJNA 3M8QA 3VA3A 1RT7A 4E7KA 4KTQA 2I5JA 4B9NA 4M42A 4RW4A 3QETA 1LAVA 3MEGA 5J1EA 3KK1A 1UA0A 2ATQA 5FRNA 3OYDA 3QEWA 4QAGA 1UA1A 4W5RA 1W0HA 1WSJA 3L2UA 1JLFA 3DLEA 4H4MA 4B08A 1FKPA 3D0PA 3L3VA 4AHVA 4DFPA 4FJMA 3O3HA 1WSFA 4KTWA 4DFMA 1TK0A 4HCBA 3VN5A 4HUGA 2G8VA 4GVMA 3C94A 1WSGA 3OYHA 1JXBA 3AVFA 1GOBA 3DOLA 4OJRA 4B8CA 3KK3A 3TAPA 3AO2A 3F9KA 1XC9A 1Q9YA 1Q9XA 1T7PA 4JS5A 4CEZA 3SUPA 4F2RA 5KI6A 4FJ9A 3V9ZA 3PX6A 1C1BA 2OA8A 2E4LA 1GOAA 4CF0A 1VSJA 5SWMA 1JLQA 2B5JA 3WNEA 3O3GA 3SV3A 4O44A 4RW9A 5CYQA 2D0AA 2DY4A 1HQEA 4DU4A 1RT3A 1L3TA 3ITHA 5HLFA 4DS4A 3TAFA 3V4IA 1QTMA 3VQ4A 4M3TA 1XWLA 1FK9A 2IDOA 3AVNA 3K57A 2D0BA 2VG5A 4DSFA 4ELVA 4N56A 1O1WA 4QCLA 4B8AB 2ZE2A 4CGIA 4CFBA 3EYZA 1HJRA 2DFFA 3SQ1A 3SI6A 4FJIA 3T3FA 1X9MA 4CJPA 4CEAA 3AA4A 5C25A 3ZSYA 4CHOA 1U49A 3PY8A 4CF1A 3AVLA 2PY5A 1D9FA 4W5NA 4DTRA 4FJKA 4I2PA 2B6AA 4CFAA 3LAMA 4Z4CA 1KVAA 2HNZA 2JLEA 3LP3A 3WNGA 3L2VA 3LZJA 1RBVA 3OYBA 1NK4A 3OYMA 3H08A 1NJYA 4KHUA 4Z4FA 4DQQA 1LW0A 3NFAA 3NGYA 4DMNA 4J2AA 5FROA 2HB5A 2YNIA 3MEEA 2YKNA 4LH4A 3CFOA 3ZT3A 3MAQA 1Z26A 3DOKA 3SUNA 4FK4A 3DRPA 3VQQA 3O4NA 2YHAA 3NGZA 4BDYA 3UIQA 3D45A 3KD5E 4E1MA 4M41A 4DF4A 1TAUA 1IO2A 1BGXT 3OJSA 1BI4B 3C95A 2W42A 3LALA 4DFJA 3QEIA 2VG6A 4FLTA 4LSNA 4CJFA 1GOCA 2HMIA 2RF2A 2RN2A 3WNFA 1DLOA 3OYGA 4DTJA 4DU3A 1NJXA 1SL1A 2OYQA 4PUOA 3ZSXA 3SUQA 2OPRA 3OYLA 4FJ7A 2FBTA 2X6SA 3NBPA 1JLCA 3SV4A 3AVGA 1BIZA 1YTUA 3DLBA 2KFNA 1NOZA 1U48A 4Z4HA 4CGGA 3CFPA 2XO7A 4FJ5A 4G1QA 3TR8A 3V1OA 4B9VA 3QLHA 3M8SA 4FLZA 1XI1A 3V9SA 4PWDA 3AVHA 4ELUA 3NAEA 1EXQA 1HMVA 1T8EA 1ZBHA 3T19A 4LH5A 1RCHA 3HPHA 2X78A 3O4QA 2XY7A 3KKSA 4CFDA 3HVRA 2G8HA 5K14A 3PX0A 4CHYA 4E3SA 1KSPA 2GBZA 5HRPA 1S9EA 2KZMA 4B9TA 1S6PA 2D0CA 5DMRA 3RR8A 3ZT2A 1B9DA 3RWUA 4FJ8A 5SZTA 4CJSA 3ZSWA 1D8YA 2KQ2A 3HP9A 1SUQA 5KRTA 2FBXA 5KTQA 3SQ4A 1Y97A 3K5MA 2KZZA 4FK2A 1FKOA 3K2PA 4OLBA 2YKMA 4DTUA 3EZ5A 4CIGA 5KGWA 3KD1E 4CJQA 1N5YA 3KLIA 1S1VA 2HHUA 4MFBA 3AO1A 4C8OA 4CESA 5J2MA 4CF9A 4XIUA 1KCFA 3DYAA 2F8TA 1S1XA 2G8WA 4FZYA 4HCCA 1LV5A 2XY8A 4KFBA 3ALYA 3T1AA 4CJLA 2O4GA 1QHTA 4FLYA 1RDCA 4CEOA 1F21A 3OYNA 4O5BA 3U3YA 4DLEA 3HJFA 4F3TA 5T7BA 3E01A 3AVIA 3RMDA 1RDAA 3KLFA 4CCHA 4AHSA 4NYFA 3C6TA 3FFIA 3P1GA 2XRIA 4GW6A 4HVJA 3SNNA 2G8FA 3MECA 3KIOA 4ID5A 3IAYA 3L2QA 3L2RA 4IKFA 1R0AA 1K6YA 1VSEA 3DLGA 3IG1A 4BDPA 1TL3A 4I2QA 3B6OA 3AVBA 3HYFA 3K5NA 1VSIA 3TAEA 1BISA 1S1TA 1ASVA 3F73A 4AHRA 3S3OA 1XHXA 3AO4A 1RTDA 1NK0A 2ITGA 1TL1A 4FJGA 3HSTB 4IG0A 3DMJA 1U47A 1VRTA 4K8ZA 4DQIA 1EX4A 1RT5A 4QOZB 3CM6A 4CJTA 5EU7A 3OYCA 3IS9A 4CJKA 4WE1A 2Z1GA 2B4JA 4Z4GA 3PO4A 1A5WA 4FK0A 1C1CA 4FM2A 3PX4A 3QNOA 4M45A 3DRRA 4LD0A 1EKEA 3V6DA 1NK9A 4NYNA 2IC3A 3NH2A 2IS3A 3JSMA 4N5SA 2QXFA 4KB0A 1KTQA 1VK0A 1RBRA 3SUOA 4HUFA 3ZSVA 4C8KA 4OGCA 3NH1A 4Q0BA 3IRXA 3RTVA 2X6NA 4BDZA 3TAQA 3EY1A 3ZSZA 4FJHA 1SKRA 4C8LA 3LAKA 1BQMA 5CZ2A 3PV8A 3DI6A 2F8SA 1Z25A 4CHPA 4CJRA 4JRPA 3LPUA 1C0MA 1LWEA 2YNFA 3LPTA 4CF2A 2IAJA 3AVCA 4H8KA 3KLEA 3NF9A 4F4KA 2WONA 4FJXA 2P51A 1SL2A 4BE2A 2QK9A 4B9UA 1WSIA 2HW3A 2HVHA 1RTJA 3MXMA 4DSEA 1RT4A 3MEDA 2HNYA 2VWJA 2QKKA 3TI0A 4KI4A 1I3AA 1J9AA 4KKOA 4KTZA 3I0SA 3TAMA 1RTHA 4CGDA 4FLWA 1Q8IA 4B9MA 5E41A 4CEEA 1NJWA 3K5OA 5CYMA 1TV6A 1UOCA 2OPQA 1UWBA 4R5PA 3C6UA 5J2NA 3AA5X 4CIFA 4M3WA 2F96A 3KJVA 3K59A 1IG9A 3VQ9A 1QSSA 1QSYA 4F8RA 4H4OA 3ZSOA 3V81A 1C1AA 3OJUA 5I3UA 4OVLA 4E7LA 2P1JA 2VWKA 3OS1A 1L3SA 1ZBIA 1J54A 4FVMA 4FJJA 4CEQA 3VQAA 3RRGA 3I0RA 1NK5A 1RBSA 4GMJB 3ZSQA 3K5LA 4E0DA 4CJEA 1TVRA 4M3ZA 1NK8A 4AHUA 4KV8A 4UQGA 3PO5A 2GV9A
chains in the Genus database with same CATH superfamily
5M1OA 3TANA 4DR3K 4EIAA 1CXQA 4YOWA 5GAEP 5C0YA 5J2QA 4KPYA 4CHZA 3LWMA 4KB1A 1BIUA 1IKVA 1EP4A 3VQEA 3DM2A 4ZHRA 3KLHA 4CJ5A 1ITGA 4KRFA 4J2EA 4E7JA 4ZTFA 1ZYQA 3UE5A 4ZTJA 1HYSA 3I33A 4BY9C 3SAGA 5GINA 3DWLA 4H5RA 5AQQA 1QQNA 5J2PA 2O8DB 4CECA 1CZAN 4NCAA 4BC3A 2OTJN 4OPKA 3NCIA 1HYVA 3RSEA 4H0VB 5TKYA 1IBMK 3Q7BA 3ID6A 4BE0A 3THYA 5BPNA 2BGGA 3FZKA 4DTMA 1NKBA 1T6DA 2X74A 3DRSA 4FWOA 3ZT0A 3RMBA 1Z6RA 4CF8A 1T05A 4YOVA 2ZM6K 3BGRA 1DGKN 1OH5A 1NGHA 4JK8A 3J7AP 3THVA 4DV2K 5KPRA 4Q5VA 5DM6L 3THXB 3VQCA 3D2EA 4DG1A 1JLEA 3PUFA 1NGDA 2NNWA 2P5OA 4FZXC 3MK6A 1KRPA 2E2NA 3K58A 2ZD1A 4J2DA 1JL2A 5I42A 3MXJA 1VQ4N 1QSLA 2O8EA 3OY9A 4JAXA 4O0JA 3QESA 3CI5A 2FBYA 2R7YA 3SPZA 4BR0A 2DFHA 4NB4A 4BRPA 2W6KA 5JICA 4O4GA 4AQYK 3P31A 4JI2K 4DQRA 5HOOA 1UAXA 2ZJPL 1BHLA 4NXNK 1V4SA 2UXBK 4H5NA 2G8IA 3R1XA 1JLGA 3VQ7A 4H5WA 4CEFA 4KH5A 4DFKA 2EWSA 5HRNA 4DR1K 3CJCA 2O8CA 3SYZA 1RGIA 3VERA 3EL2A 1ZBFA 4CJ3A 2PYJA 1VQLN 4CK3A 1XUPO 1ATSA 4KHYA 1YVUA 2D4WA 3SQ2A 1CZBA 3CQ8A 3HXMA 4JKEA 1TUUA 4Y1DA 2BANA 3TTDA 3RSEB 2CH5A 2YHXA 1CLQA 1X3MA 4C8NA 4W5QA 3VA0A 4CBXA 3THYB 3H3NO 2VQFK 4W5OA 1S9GA 1LWFA 1KVBA 2PFUA 5DK5A 3T7ZA 4HTUA 2A1SA 5KRSA 1ZBUA 2Q0RA 3AA2A 1YI2N 1J5EK 1KLMA 4AH9A 1QVGM 4B9SA 4KHQA 4BE1A 4HUEA 2ITMA 3VF2A 5LMUK 4MO5A 4B9QA 1A5VA 3RRHA 4A2BA 3V1QA 3L3UA 3ZLJA 1VQ7N 5BN8A 1C0TA 3AVJA 5C10A 3QIOA 4FPBA 5AQTA 4FCYA 4Z0UA 4B3SK 3O3FA 2W41A 3ENOA 3VGKA 4Z4EA 4N47A 1U2VB 1JCGA 2UU9K 3K9JA 4LSLA 5AFUA 1KQSM 4I7FA 3TWHA 3HM9A 1VQON 4WFNL 1RNHA 2O4IA 2HNDA 3CCVN 2XHBA 3KVGA 4O5FA 3CHWA 2I5JA 3QETA 1LAVA 2ATQA 3OYDA 3G6EN 4UY8O 3E9OA 4FJMA 1KC8O 2O8CB 5M1KA 3AVFA 5GIPA 3DOLA 4OJRA 1XC9A 1Q9XA 4CEZA 4LF8K 5KI6A 3V9ZA 1C1BA 1EWRA 3CCRN 3WNEA 3O3GA 1N32K 1GLCG 2GX9A 3SV3A 5CYQA 1RT3A 5CR4A 5HLFA 4DS4A 1K8AO 4PKIA 1XWLA 2D0PA 3I55N 2D0BA 2VG5A 3HOTA 4N56A 4MDBA 4QCLA 5MLCQ 1BWFO 2ZE2A 4CGIA 3N4QA 1X9MA 2NZTA 1YJWN 5C25A 5M1PA 4CF1A 3MN5A 4IEIA 4RWTA 4W5NA 2B6AA 4Z4CA 2HNZA 4JYAK 3LZJA 1RBVA 1NGBA 1NJYA 3HSCA 2A5XA 4YDUA 3NFAA 2QM1A 5FROA 4CD1A 3SUNA 3DRPA 5HL7L 3VQQA 1Y64A 4BDYA 3KD5E 2IVNA 4DF4A 1IO2A 1BI4B 3C95A 2W42A 3QEIA 4BR7A 1XMOK 3FZMA 2YX6A 3CIPA 3OYGA 4PUOA 3SUQA 2X6SA 1FJGK 1BIZA 3DLBA 4I6MA 4QS7A 5AQJA 3V1OA 3QLHA 1XI1A 2FSJA 3MN9A 4BRFA 2QW9A 1HMVA 3WXIA 3T19A 3HPHA 4GKKK 5FLXO 3O4QA 3KKSA 2ASMA 4A2AA 3PX0A 5GAGP 1GLLO 3CMEN 2FXUA 5A2QO 3VGLA 3ZETB 1B9DA 3GG4A 4FJ8A 1QVFM 5KRTA 2FBXA 3AY9A 4BG8A 5KTQA 1Y97A 3K5MA 3K2PA 4K0KK 4XH4A 2HHUA 1N5YA 3KLIA 3AO1A 5J2MA 4B1VA 1KCFA 4ILHA 2BH1A 1GLBG 2HOEA 4BQLA 1RDCA 4CEOA 4O5BA 3HJFA 1IBKK 3MX5A 4AHSA 3FFIA 3OW2M 3L2QA 1R0AA 2VQEK 3DLGA 4BDPA 2E20A 3HYFA 1VSIA 3MWTA 3ATVA 3PSFA 3J81O 3VGMA 1Q7YO 1XHXA 3OA9A 3AO4A 1RTDA 1TL1A 2QEXN 3HSTB 4AM7A 1U47A 4YY3K 2QTDA 4G9ZA 1JJ2M 3IS9A 4WE1A 2Z1GA 4Z4GA 3C7NA 1C1CA 4LF4K 3G71N 2HBKA 4FOEA 3J7ZO 3ZSVA 4JD2A 4C8KA 3NH1A 3IRXA 4C23A 5ADXA 2A3ZA 3HRGA 4NO7A 5AQRA 4DSKA 3EEQA 4CF2A 4F4KA 4H8KA 2WONA 2ZJRL 4BE2A 3O1WA 1WSIA 4I6MB 1HR0K 2HW3A 1RTJA 3M5RA 5TKWA 4KI4A 4FLWA 4JKGA 1RTHA 3SAFA 1K8KA 1YAGA 1Q8IA 4B9MA 2P9NA 3C6UA 2JWLA 3KJVA 3K59A 1BDGA 3LM9A 3VQ9A 1QSSA 1QSYA 2E5LK 2P1JA 3OS1A 3QFUA 4DV0K 1GLAG 3D7EO 1M90O 2E8AA 2V51B 4H5TA 4KV8A 2GV9A 4BREA 4X62K 4BR2A 4OKKA 4M3XA 4JHDA 2DFEA 2ZWHA 3AA3A 3F2KA 1NU0A 2HSTA 1I39A 2YNHA 4W5TA 4A61A 1BQNA 1NKCA 3VEYA 4M3UA 1SZ2A 5C42A 1RDBA 5AR0A 3VQDA 4FLXA 1CXUA 5LL6Z 5AJ3K 3KWGA 4C1NI 3O9QA 4E1NA 5AQMA 3HPGA 3O1BA 1VQNN 3LDQA 3LP2A 2QWQA 4DTXA 4OKEA 3J8AA 1QHAA 1A5XA 1KAXA 4IXCA 4KH6A 1TKZA 3VMFB 4NCGA 4DTSA 2QWNA 3V9XA 2NUBA 4V19S 3L2WA 4GNIA 3D6RA 3CC2N 3WQTA 5LY3A 4B1UB 3ZT4A 2OZMA 1BCMA 1U04A 1HPZA 3B6PA 3NH0A 2GWJA 2P9KB 3I8BA 5LJWA 1HKBA 2ZJQL 5FPMA 4C8MA 2VCPA 2WBNA 3ZEUA 3BY5A 4DS5A 4JKHA 3HVTA 2PYLA 4JD2B 3G0ZA 4IO9L 4GY2B 3U9ZA 2O8BA 4J8FA 4EHTA 3TARA 3WT0A 3V9WA 2GUIA 4CEBA 4JI6K 2ZQBA 4CE9A 5FRMA 4JKGB 5C24A 1K8KB 4IOAL 3QO9A 4E19A 1RBTA 4YOUA 3CCJN 2P9NB 3CD6N 1JXEA 1TK5A 1HNWK 4IBNA 5BPMA 3CC7N 3BZCA 2Q3SA 3CYMA 4EZ9A 1KFSA 1X1PA 2QWOA 2PAVA 3SPYA 4L8RB 4CEDA 3FLCO 1JKHA 3CJ9A 4KREA 3CC4N 3HPOA 1EQYA 2GUPA 1W2BM 1L3UA 1IKWA 3G10A 4JHDB 4EZ6A 5CE3A 3LDSA 3KTQA 1BL3A 4GV6A 2HHVA 1DEJA 4JI8K 5AQOA 2DTUA 3VF4A 3M8RA 4BGAA 4RW7A 1FXXA 4E7IA 1QQCA 4GV9A 4ID1A 4BGBA 1DKGD 1ZBSA 5CHIA 3WNHA 1NMNA 4CHQA 2HBLA 2RKIA 4M7XA 1RT1A 4FLUA 4BC5A 4WQ4A 4CGHA 5FPNA 3DXKA 4LY7A 2WUSA 5HP1A 3L8BA 1NK7A 3CCQN 1LAWA 4IOXA 2RPIA 1NM1A 3HT3A 4KI6A 3NDKA 5AQFA 4HHTA 1LWCA 1ASWA 1YT3A 2V7YA 1SKSA 4CGFA 3QINA 3I8DA 3ZCMA 1JLBA 3HOSA 1SV5A 2F9WA 1H1VA 2HHHK 3L6QA 4M3YA 2O8BB 4DSLA 3CCLN 3V1RA 3NHGA 5GAHP 2G8UA 4ICLA 3PSIA 4JS4A 2E6LA 1JLAA 3M6GA 5HROA 5AZJB 4CJWA 1VSMA 3AVMA 4FYDA 3G4SN 1HKCA 4IFVA 2HHXA 4EP5A 3CPWM 3V9UA 4JI1K 4LF9K 5JS2A 2W6LA 1TGOA 5BR9A 4TSXA 1E3MA 4ISFA 4CJ7A 1YHQN 1IBLK 3HK2A 3QERA 5FDLA 4DLGA 3VA3A 1RT7A 1XQSC 3C65A 4KTQA 4B9NA 3MEGA 1UA0A 5C2DA 3QEWA 4QAGA 3S41A 1W0HA 1W97L 3L3VA 4CZLA 4O8UA 4AHVA 2CH6A 3VTIA 4KTWA 4HUGA 3UKUB 2P9UA 2A40A 3LM2A 1WB9A 3OYHA 1GOBA 3LL3A 3EN9A 3F9KA 2A41A 3QDKA 5KPZA 1KAZA 4L3QA 3ATUA 3VEZA 1BOTO 1L3TA 4A59A 3AVNA 4DSFA 1I94K 3CJBA 2E2QA 3LDNA 4R79A 3SI6A 3SQ1A 4CEAA 3PY8A 2Q1NA 3H3OB 3AVLA 5AQWA 1N34K 4CI6A 1P90A 4I2PA 4YOYA 3L2VA 1YJ9N 2JLEA 3OYBA 1NMDA 2D0OA 1NK4A 3H08A 3D2FA 3OHRA 3NGYA 2F4VK 4QS9A 2YNIA 4LH4A 2YKNA 3CFOA 4CZIA 4YDUC 4FK4A 3EKUA 3O4WA 4BRQA 4PHTX 3D45A 2Q2RA 3CJ7A 2QI2A 2UYTA 3R3LA 3LALA 4KHPK 2VG6A 4A5AA 5H1SQ 1NGIA 4GV3A 1NLVA 3OBWA 2RF2A 2RN2A 4DR2K 4DTJA 3VEOA 1BO5O 3ZSXA 3P39A 3AVGA 4CD3A 3VESA 5AQVA 4DQ8A 2YCHA 1WOQA 4CGGA 3V9SA 3AVHA 5BR8K 4ELUA 1RCHA 3QB0A 4BRHA 2X78A 4CFDA 1ZC6A 2G8HA 5K14A 4GKJK 4CHYA 4E3SA 3D2EB 4B9TA 1LOTB 1S6PA 3FR0A 3RR8A 3ZT2A 3RWUA 4WCEL 5SZTA 1HX1A 1J6ZA 2KQ2A 1SUQA 2O8EB 1FKOA 1Z05A 4ILJA 4BVOA 4OLBA 1V4TA 2P9UB 5KGWA 4CIGA 1S1VA 4MFBA 4CESA 4DR5K 4CF9A 5JLHA 3ZX2A 3EE9A 1LV5A 2XY8A 4KFBA 3T1AA 4FLYA 2O4GA 4ISEA 4DLEA 3WUHA 5T7BA 3E01A 2F9TA 2NRTA 2AP1A 1RDAA 3AVIA 4CCHA 3C6TA 3P1GA 3L4QA 4JK9A 3MECA 2GEMA 3IAYA 5AQPA 3AVBA 1SS6A 1HKGA 1GLJO 4AHRA 3F73A 4PL8A 3CCMN 4Y0WA 1YIJN 4FJGA 4IG0A 1E4FT 4YOXA 1VRTA 5I9EB 4DQIA 3O5BA 2Q97A 3D2FB 3E9PA 4CJTA 1YXQA 2IIRA 5BN9A 4CJKA 3NMUA 1A5WA 3PX4A 2I7PA 3QNOA 3RVCA 3V6DA 4NYNA 3JSMA 2Q31A 4N5SA 4KB0A 1KTQA 1VK0A 2FLOA 3BF1A 4LF7K 4M7YA 4BR4A 1VHXA 3T69A 3H6EA 4BR9A 3DI6A 1Z25A 2OCEA 4CHPA 4CJRA 4JRPA 4CBUA 4WYBA 3KLEA 3LPTA 4FJXA 3F9MA 3SLCA 1SL2A 4Z94A 4ILGB 2HVHA 3F5TA 4AM6A 5BREA 3VENA 2QKKA 3TI0A 1I3AA 2NRWA 4KTZA 4CGDA 3TAMA 3I0SA 4WQ5A 1YUWA 3MDQA 4X64K 3G25A 3M1FA 4DV7K 3GDQA 3VPZA 2F96A 2KHOA 1XNQK 4MLEA 4H4OA 3ZSOA 2VWKA 3MN6A 1QZ6A 4BC4A 4CEQA 2NRZA 1BA0A 3RRGA 1NK5A 3EKSA 3ZSQA 2HBMA 2QWRA 4UQGA 4O44A 4GVEA 2YHWA 4DF8A 1K73O 2EX3A 2Z1JA 3U4LA 4WFAL 4CFCA 3TAGA 4JV5K 3C0BA 2WTUA 4WF9L 4PKGA 3QEVA 1NJIO 4IFYA 1GLEG 4CJ4A 3AV9A 1HQUA 4RW6A 1G99A 5BRFA 4KHWA 3QIPA 3O80A 5JMVA 3MXIA 4BRIA 1T6CA 4HWIA 3NVKA 3DLLL 1WN7A 5AQGA 3S3NA 3AVKA 1L3VA 3C6AA 2PZSA 3CM5A 2A42A 3CXCM 4H0XB 3A8YA 4NLCA 3U9DA 1HNVA 4DWIA 4OGEA 3NE6A 1RDWX 1VQ9N 5C12A 2OPPA 4N41A 1TYQA 4N76A 1EWQA 2BDPA 1HPMA 2Q36A 5KGXA 4O55A 3PLAA 4Y1CA 5BRHA 5AQSA 4EP4A 1IKYA 4FWLA 1RDUA 4RCHA 1HNZK 1MU2A 5BRDA 3JYTA 2QWLA 3CFRA 3CF5L 2P9PA 1OH8A 1KD1O 3SQ0A 3AO5A 2O8FA 4CZFA 4OLAA 1REVA 4J2BA 3P5JA 5LJVA 4JK7A 1YVNA 4AHCA 3Q7CA 4CVNE 1WUAA 4IG3A 3QEXA 2FBVA 3CCEN 1VQKN 5EOYA 3CETA 4PQUA 3FE1A 1N6QA 4FZZA 3NF8A 1TKDA 2JGUA 3KZBA 2QXLA 1T03A 1IH7A 2G8KA 2A1RA 2E2PA 3RMAA 3MCPA 1WSEA 3ASMA 3KKRA 1ATRA 3CERA 3VEXA 1X9WA 5CY4A 3IFRA 3RR7A 2NRXA 4Z4IA 3HL8A 2ASOA 3NF7A 1BUPA 3OYFA 3DJCA 3EE8A 4FM0A 2HHWA 2E1ZA 3QNNA 3LP1A 2NRHA 3VQ6A 4CZKA 5HBMA 1NK6A 3E1YA 2UUAK 1IKXA 1TAQA 3N4PA 3OVNA 3OS2A 3SJHA 2XY6A 1XHZA 1SAZA 2PBDA 2VWBA 2FC0A 4A57A 1KFDA 4I9LA 1VQMN 4DQSA 4CJVA 3IUCA 1RILA 2YI1A 5B8HA 1Q82O 4CERA 2HHSA 2YV0X 3MMVA 2QA4N 3IKMA 3TPQA 3OBYA 3OYAA 2HHTA 5JS1A 1E4GT 5LMNK 3H45C 3DLHA 5CZ1A 2Y1JA 3S9HA 4DQPA 2KTQA 4WQ4C 1CZ9A 2W40A 2QKBA 1S1WA 3P4IA 1VSLA 1ZBLA 1DTQA 1WAFA 1ASUA 4PA1A 1JCFA 3FGUA 3VEVA 3AO3A 3GE1A 3MX2A 4OO1J 1JCEA 5JLFA 3HI0A 3PIPL 2AJQA 1WNSA 1U45A 3A5NC 5D3GA 2VGMA 4H0YB 1X9SA 1S22A 1RTIA 5BPLA 2P9PB 4BWJA 2O8FB 1VRUA 3P38A 4X65K 3QBWA 5FPDA 5AQHA 4DSJA 1S3XA 5HRRA 3AAQA 4OX9K 1NGGA 1BA1A 4MO4A 3SK3A 4DSIA 1IG8A 4K8XA 2ZF5O 4BWMA 3C7NB 3LWLA 2FSKA 3H46O 1G15A 1VSFA 2P9SA 2OPSA 2D1KA 2KW4A 1WSHA 3PIOL 4I9QA 4ELTA 4NCBA 3QEPA 1O13A 4DTPA 3SZ2A 3GL1A 3O08A 1HRHA 1T44A 4FLVA 4DU1A 1B9FA 4OPJA 3R9PA 4LC9B 4FJNA 4U7BA 3NF6A 3M8QA 3HTVA 5M1QA 3E66A 5EY4A 3ZX0A 2QWPA 1QQOA 1UA1A 4W5RA 1JLFA 5AFUH 3O3HA 1WSFA 4DFMA 1TK0A 4HCBA 3VN5A 5AQZA 3H1VX 3FZFA 1WSGA 3FFKB 1JXBA 3TAPA 4JI7K 1Q9YA 1T7PA 3KK7A 4B1ZA 4DR4K 4X66K 4F2RA 4JS5A 4YORA 1MA9B 4H03B 4JI3K 2OA8A 2E4LA 3EZWA 1KXPA 4H0OA 5SWMA 1JLQA 4CZJA 2ZGZA 2DY4A 2HBJA 1U6ZA 3L4IA 4WFBL 1QTMA 3V4IA 4M3TA 3VQ4A 4B3MK 1NBWA 1RFQA 3THWA 4B8AB 3TSQA 4CFBA 4FJIA 3T3FA 4B1WB 4CJPA 3T1HK 4CHOA 1U49A 3WXKA 2DPNA 2PY5A 1D9FA 2A6AA 4DTRA 4XH5A 4H0PA 3JS6A 4OPAA 4FJKA 1KVAA 3L0QA 3LP3A 3WNGA 3OYMA 4KHUA 4LFBK 2RE2A 1LW0A 4BQZA 4CW7B 4DMNA 2OANA 3ZT3A 1OVQA 5C15A 4YOTA 3NGZA 4JI5K 2FF6A 4E1MA 4M41A 1BGXT 1NNEA 2YJEA 3BP8A 4FSVA 4DFJA 1MDUB 4DHYA 2VYPA 4LSNA 4CJFA 3O9SA 4NXMK 2HMIA 1NJXA 4DU3A 1SL1A 2OPRA 3OYLA 2WFBA 2FBTA 2V52B 3NBPA 1JLCA 3SV4A 3ZEUB 1NOZA 3U8XA 2HF4A 5KQDA 1C0GA 4JKDA 4YHHK 2XO7A 3CFPA 4G1QA 4JN4A 3M8SA 4FLZA 5IT9O 1C0FA 1T8EA 3O9UA 4LH5A 2OTLN 3HVRA 2GBZA 1S9EA 1X3NA 2KZMA 4BROA 4EAHD 2D0CA 4E1JA 4FVUA 3ID8A 5DMRA 3KWIA 3HP9A 3SQ4A 5F2RA 2YKMA 4DTUA 1EO1A 3KD1E 5DM7L 2F8TA 4CZEA 1S1XA 4FZYA 4HCCA 4CJLA 2HF3A 5AQYA 3HM8A 1TUYA 4F3TA 3RMDA 1N8RO 3KLFA 4HVJA 3M3ZA 2UUCK 3KIOA 1K9MO 4FWMA 3THWB 4I2QA 4HTLA 1MWMA 3W3DA 4JI0K 4DR7K 1ASVA 3A5MC 3UKRA 3LDLA 5EVZA 2ITGA 1D4XA 1XC3A 4H5VA 3ZX3A 3DMJA 1EX4A 4C1NK 1W7AA 4FWRA 4QOZB 4IZ9A 3IMXA 5EU7A 5KQ8A 4FWQA 4IJNA 5AQNA 4FK0A 3A0IX 3CCSN 4FM2A 3O6WA 1NK9A 1VQ8N 3NH2A 3DXKB 4DV5K 2QXFA 3DAWA 3SUOA 4HUFA 4IWVA 4OGCA 4A62A 3RTVA 1U2VA 2X6NA 4BDZA 3TAQA 3EY1A 3ZSZA 1M1KO 4BC2A 4C8LA 3LAKA 1NGEA 4FWNA 3AAPA 2GWKA 4BRLA 4CZMA 4FOIA 5JVHL 4K43A 3LPUA 2YNFA 2IAJA 2QK9A 3NF9A 2P51A 3O9TA 4B9UA 4BVPA 3TTCA 4DSEA 1RT4A 2VWJA 2ASPA 4K25A 4NLBA 1J9AA 5ADXH 1NJWA 3K5OA 2IVOA 1TV6A 2OPQA 4WQ5C 3E9LA 4B3RK 1VQPN 4M3WA 1NGAA 1IG9A 3HZ6A 4F8RA 4FWPA 3WXMB 4FVMA 3MCAB 3BF3A 4IFEA 4CJEA 3TSUA 1HJOA 5KPTA 1TVRA 1NG9A 2NRVA 2IGIA 3NGIA 5M1NA 3BDPA 1RDDA 5AQKA 3KHYA 1HNXK 2IVPA 3WXJA 4BR5A 4CBWA 4PY5A 4F3OA 2HMPA 2IOCA 3KK2A 2BE2A 4DV3K 3TU5A 4O0IA 1DTTA 2WOMA 4KO0A 1HYZA 4JI4K 2BTFA 3BEXA 5F1XA 3LANA 3SJJA 3QICA 4EFHA 4KAZA 1NOYA 2NRRA 3I56N 1OH6A 4KH4A 1ILYA 3JAMO 5EXWA 4B1XB 4DCHA 3UKRB 2JWKA 4DTOA 1TKTA 2YHYA 4FWSA 1BI4A 1EETA 2P9LA 2AA4A 4BRMA 3SAHA 4CGJA 1VSHA 1W9HA 4QS8A 4RW8A 3SCXA 3CPEA 2EHGA 3UB5A 4B1YB 4FXDA 3K0SA 3A5OC 3DLRA 2Y1IA 3VQPA 1QE1A 4M3RA 1S72N 1BCOA 4MLHA 3A2FA 1C6VA 1D5AA 3VOVA 3AGRA 3J7YP 3T1YK 2ZGYA 4XEIA 2CGKA 1YITN 3RMCA 4AHTA 4CK1A 2Z1HA 4JKCA 3ZT1A 4BRKA 4FJLA 2YNGA 2NLXA 5AQLA 4JEPA 3CJAA 3ZETA 4CHNA 1RT2A 2XY5A 3P83D 1TK8A 5E26A 2QWMA 1VSDA 1S5JA 1S6QA 3VQBA 5HRSA 3SBGA 3EO3A 3MN7A 4ISGA 3ISNC 4JLHA 3LDPA 3HO1A 2E88A 3HP6A 1VQ5N 3DXMA 4XH1A 1KLNA 3CQYA 1JL1A 3M8PA 3WEEA 2YHBA 3DLKA 3GOIA 3ZSRA 3VEWA 1VSKA 1IJJA 1QS4A 1HNIA 4LF6K 3AVAA 1NWKA 4H0TB 1HLUA 5ELZA 1U4BA 1RT6A 5IWAK 3LP0A 1ATNA 1WAJA 2GELA 4IJAA 4BRCA 2KFZA 3TABA 1BU6O 3U3GA 5AQUA 3SMPA 2GTDA 1WLJA 4FM1A 2OZSA 4KBOA 3ULDA 3U6FA 4FW1A 1N33K 1L5UA 3OYKA 1SKWA 4B9LA 2LSNA 1OH7A 4RG8A 4K42A 4MQ3A 4DB3A 1WBDA 1NGJA 2HVIA 2P5GA 4CK2A 4F2SA 2P9LB 4E7HA 3BUZB 3S3MA 1ESVA 3CMAN 3CJ1A 4YNQA 1NKEA 2UUBK 3CG7A 4JKFA 4BRAA 2FF3B 5F0XA 3VQ5A 3VF6A 4KHSA 1NJZA 1Q18A 1RBUA 1YTAA 2UXCK 4PL7A 4CIEA 2Z1IA 4AILC 5AQXA 4B3OA 3OYJA 4KHNA 2ETJA 4OPHA 1D9DA 1C0UA 5AQIA 1DT9A 2VG7A 4BACA 1S1UA 4M63C 5AZIA 4O8KA 3LZIA 3OYIA 1J53A 4DTNA 1VAZA 4CJUA 4IDKA 5C2FA 4YFUA 3KLGA 1NGCA 4EHUA 1SQKA 4FW2A 3OS0A 2E6MA 3VQ8A 4OKJA 3DXMB 4JRQA 1B92A 3K9KA 2D5RA 3WEEB 1TKXA 1LW2A 2YJFA 1J5OA 4E89A 4CZHA 1KVCA 3OYEA 1SL0A 2KKZA 4E7KA 4B3TK 1T3VA 3A5LC 3VETA 4RW4A 4M42A 5J1EA 3KK1A 5FRNA 1HUXA 1WSJA 3L2UA 3H1QA 3DLEA 4H4MA 4B08A 1FKPA 3D0PA 3TTFA 3AARA 4DFPA 3B8AX 3FZLA 4GVMA 2G8VA 1IV0A 3C94A 2UXDK 3TSPA 4B8CA 3W0LA 3KK3A 3AO2A 3SUPA 3FZHA 4FJ9A 3PX6A 4IOCL 1GOAA 1BG3A 4CF0A 2P9IA 1Q86O 1VSJA 3ENHA 2B5JA 2P9KA 4JKAA 4DV1K 4RW9A 1VQ6N 3IDHA 4FPAA 2D0AA 3ULEA 1HQEA 4DU4A 2V7ZA 3ITHA 3TAFA 2F7TA 1FK9A 2IDOA 3HBTA 3K57A 1YJNN 4ELVA 5FPEA 1O1WA 4DKWA 3EYZA 3OTOK 1HJRA 2H3GX 2E2OA 2DFFA 4U67L 3AA4A 3ZSYA 4DV6K 4IDHA 4DV4K 4CFAA 3LAMA 2VGNA 4Z4FA 4JNEA 4DQQA 4J2AA 1GLFO 2HB5A 3MEEA 3MAQA 3WXLA 1Z26A 3DOKA 2FSNA 3O4NA 1NGFA 1OVYA 2YHAA 3O8MA 3UIQA 1TAUA 3BZKA 3OJSA 2I7NA 4PKHA 3NVMA 3QMLA 3SMSA 5AZIB 3ZYYX 4FLTA 5M1FA 1GOCA 1TYQB 3WNFA 1DLOA 5E84A 2OYQA 3O9RA 4FJ7A 2RHKA 1LCUA 1YTUA 2KFNA 2KLAA 1U48A 4Z4HA 4FJ5A 3TR8A 4B9VA 4PWDA 3VTHA 4BRGA 1EXQA 2Q0UA 3NAEA 1ZBHA 1N36K 5EX5A 4K41A 1X9JA 2BUPA 4IO8A 2XY7A 2E1YA 4CZGA 3JXUA 1KSPA 2WC9A 5HRPA 4JKBA 3QBXA 1QQMA 4CJSA 4F9OA 3ZSWA 3AGKA 1D8YA 4RTFD 4FO0A 2KZZA 4FK2A 3EZ5A 4CJQA 4C8OA 4XIUA 3DYAA 4IEEA 2G8WA 3ALYA 1XMQK 1QHTA 2P9IB 4BG9A 1F21A 3OYNA 3U3YA 3R8EA 4DR6K 3ULEB 4NYFA 4GW6A 2XRIA 3SNNA 2G8FA 1OKJA 1QZ5A 1MWKA 4ID5A 3L2RA 4IKFA 1K6YA 4FWKA 1XNRK 1VSEA 3IG1A 4FL9A 1TL3A 4DUYK 4DUZK 4LF5K 5JVGL 1FW6A 3B6OA 3K5NA 3TAEA 1BISA 2O8DA 1S1TA 5GIOA 3S3OA 3R6MA 1NK0A 4BRNA 5AZJA 4K8ZA 1RT5A 4A5BA 1WBBA 3CM6A 1KAYA 3OYCA 2B4JA 3PO4A 3GBTA 4M45A 3WQUA 3DRRA 3CQXA 1EKEA 4LD0A 2IC3A 2IS3A 1RBRA 3J80O 4Q0BA 4BRDA 4FJHA 1SKRA 1ZXOA 4LFAK 1BQMA 2J4RA 5CZ2A 3PV8A 4LFCK 1R59O 2F8SA 2HHQA 1C0MA 1LWEA 4AF1A 3AVCA 3THXA 1Q81O 3ENBA 2CGJA 3MXMA 3MEDA 2HNYA 1GLDG 2CGLA 4KKOA 5E41A 4CEEA 5CYMA 1UOCA 1UWBA 5GADP 3LDOA 4R5PA 5J2NA 3AA5X 4CIFA 3SBTA 1YF5L 1P8ZA 3UKUA 4MDAA 3V81A 1L3SA 1C1AA 3OJUA 5I3UA 4OVLA 4E7LA 1ZBIA 1J54A 4FJJA 3VQAA 3I0RA 1RBSA 3MWPA 4GMJB 3CCUN 2P9SB 3K5LA 4E0DA 4M3ZA 1NK8A 3C6HA 4AHUA 3QFPA 3PO5A
chains in the Genus database with same CATH topology
2IGIA 4OKKA 4DF8A 2EX3A 3NGIA 3TANA 3BDPA 4M3XA 2Z1JA 1RDDA 1CXQA 2DFEA 3AA3A 4CFCA 3TAGA 1I39A 2YNHA 4W5TA 4PY5A 1BQNA 4F3OA 1NKCA 4M3UA 3QEVA 2IOCA 5C42A 5J2QA 4IFYA 1RDBA 3KK2A 4KPYA 4CHZA 2BE2A 3LWMA 3VQDA 4KB1A 4FLXA 4CJ4A 1BIUA 1CXUA 1IKVA 1EP4A 4O0IA 3VQEA 3DM2A 4ZHRA 3KLHA 1DTTA 4E1NA 2WOMA 4KO0A 4CJ5A 3AV9A 1HQUA 1ITGA 4RW6A 4KRFA 3HPGA 3LP2A 1HYZA 4J2EA 4E7JA 4KHWA 3QIPA 4DTXA 4OKEA 3MXIA 3LANA 4ZTFA 1ZYQA 3SJJA 4KAZA 4ZTJA 1NOYA 1HYSA 1A5XA 2HHQA 1WN7A 5J2PA 1TKZA 4CECA 4NCGA 4DTSA 3S3NA 3AVKA 1L3VA 2PZSA 4NCAA 3V9XA 4OPKA 3NCIA 2NUBA 1HYVA 4DTOA 3CM5A 1TKTA 3L2WA 1BI4A 1EETA 1HNVA 4DWIA 4OGEA 3NE6A 4CGJA 3ZT4A 2OZMA 1VSHA 1BCMA 1U04A 1HPZA 1W9HA 2OPPA 3B6PA 3NH0A 4N41A 4N76A 4RW8A 4BE0A 3SCXA 2BDPA 2EHGA 5KGXA 4O55A 2BGGA 4Y1CA 4C8MA 4FXDA 4DTMA 1NKBA 2X74A 4EP4A 3DLRA 4DS5A 3DRSA 3HVTA 3VQPA 1IKYA 2Y1IA 1QE1A 4M3RA 3ZT0A 3RMBA 2PYLA 1BCOA 4CF8A 3A2FA 1MU2A 1C6VA 1D5AA 3G0ZA 3JYTA 3CFRA 1T05A 3SQ0A 3AO5A 3BGRA 3TARA 3RMCA 4AHTA 4OLAA 1REVA 4CK1A 4J2BA 3P5JA 2Z1HA 3V9WA 3THVA 2GUIA 4Q5VA 3VQCA 4AHCA 4DG1A 4CEBA 1JLEA 3PUFA 4IG3A 3ZT1A 2ZQBA 4FJLA 2YNGA 3QEXA 4CE9A 2FBVA 5FRMA 5C24A 2P5OA 4CHNA 4FZXC 1RT2A 3QO9A 4E19A 1RBTA 2XY5A 1KRPA 3P83D 4PQUA 1TK8A 3K58A 1JXEA 1TK5A 2ZD1A 1VSDA 3NF8A 1N6QA 4IBNA 1TKDA 4J2DA 4FZZA 1JL2A 2JGUA 5I42A 1S5JA 3MXJA 1QSLA 1S6QA 2Q3SA 3CYMA 3VQBA 3OY9A 5HRSA 1T03A 1IH7A 1X1PA 2G8KA 1KFSA 4EZ9A 3ISNC 4O0JA 2A1RA 3QESA 4JLHA 3HO1A 3SPYA 4L8RB 3RMAA 2FBYA 1WSEA 3ASMA 3KKRA 2R7YA 3SPZA 1X9WA 3HP6A 2DFHA 5CY4A 4CEDA 4DSKA 3RR7A 1KLNA 1JKHA 4Z4IA 3HL8A 3NF7A 4KREA 1JL1A 3M8PA 4O4GA 3HPOA 2YHBA 3DLKA 3OYFA 4DQRA 3ZSRA 1L3UA 4FM0A 1VSKA 2HHWA 1UAXA 3QNNA 1BHLA 1IKWA 1QS4A 3LP1A 3G10A 1HNIA 4EZ6A 3VQ6A 3AVAA 5HBMA 3LDSA 3KTQA 1NK6A 2G8IA 1BL3A 1JLGA 1IKXA 2HHVA 3VQ7A 1TAQA 3OVNA 3OS2A 1RT6A 1U4BA 3LP0A 4CEFA 2DTUA 1WAJA 3M8RA 4DFKA 2XY6A 1XHZA 2KFZA 5HRNA 3TABA 4RW7A 1FXXA 3U3GA 4E7IA 1QQCA 2FC0A 3SYZA 4ID1A 1KFDA 4I9LA 4DQSA 1ZBFA 4CJVA 1WLJA 4CJ3A 4FM1A 2OZSA 1RILA 3ULDA 3U6FA 4FW1A 2PYJA 4CERA 2HHSA 1L5UA 3OYKA 1SKWA 4CK3A 3WNHA 4B9LA 4CHQA 2YV0X 2RKIA 1RT1A 2LSNA 4RG8A 4FLUA 4KHYA 4MQ3A 3OYAA 2HHTA 1YVUA 5JS1A 3SQ2A 1CZBA 3CQ8A 4CGHA 3DLHA 5CZ1A 4LY7A 3HXMA 2Y1JA 3S9HA 5HP1A 4DQPA 3L8BA 1NK7A 2HVIA 2KTQA 4Y1DA 2BANA 2P5GA 1CZ9A 4CK2A 4F2SA 1LAWA 2QKBA 1S1WA 4E7HA 1ZBLA 1VSLA 1CLQA 4C8NA 3S3MA 2RPIA 1DTQA 1WAFA 1ASUA 4PA1A 4W5QA 3HT3A 3VA0A 4KI6A 3NDKA 4YNQA 4HHTA 1LWCA 1ASWA 1YT3A 3CG7A 3AO3A 1SKSA 1NKEA 4CGFA 3QINA 3I8DA 3VQ5A 3ZCMA 1JLBA 1S9GA 4W5OA 4KHSA 2AJQA 1LWFA 1NJZA 1KVBA 1SV5A 5DK5A 1WNSA 4HTUA 1U45A 5D3GA 1X9SA 2A1SA 1RTIA 1RBUA 3AA2A 1YTAA 1ZBUA 5KRSA 4CIEA 4BWJA 4M3YA 1KLMA 4AH9A 2Z1IA 4DSLA 4AILC 4B3OA 1VRUA 3V1RA 3NHGA 4BE1A 3OYJA 4B9SA 4KHQA 4HUEA 2G8UA 4ICLA 4DSJA 4JS4A 1A5VA 2E6LA 1JLAA 5HRRA 3RRHA 4KHNA 2ETJA 5HROA 1D9DA 1C0UA 4CJWA 2VG7A 1VSMA 3AVMA 4BACA 1S1UA 3L3UA 3V1QA 4FYDA 4DSIA 3LZIA 3OYIA 1J53A 1C0TA 3AVJA 4IFVA 4DTNA 3QIOA 4CJUA 4BWMA 4FCYA 4K8XA 4IDKA 3LWLA 2HHXA 1G15A 1VSFA 2OPSA 4Z0UA 4YFUA 3O3FA 4EP5A 3KLGA 2KW4A 1WSHA 3V9UA 4Z4EA 5JS2A 4I9QA 4N47A 1TGOA 4ELTA 4FW2A 4NCBA 3QEPA 4DTPA 3OS0A 2E6MA 3VQ8A 3SZ2A 4TSXA 4OKJA 1HRHA 4LSLA 4FLVA 4JRQA 4DU1A 1B92A 1B9FA 4I7FA 3HK2A 4OPJA 3TWHA 2D5RA 3HM9A 3QERA 1TKXA 1LW2A 1J5OA 1RNHA 2O4IA 2HNDA 4E89A 5FDLA 1KVCA 3OYEA 2XHBA 4DLGA 1SL0A 3NF6A 4FJNA 3M8QA 3VA3A 1RT7A 4E7KA 4KTQA 2I5JA 4B9NA 4M42A 4RW4A 3QETA 1LAVA 3MEGA 5J1EA 3KK1A 1UA0A 2ATQA 5FRNA 3OYDA 3QEWA 4QAGA 1UA1A 4W5RA 1W0HA 1WSJA 3L2UA 1JLFA 3DLEA 4H4MA 4B08A 1FKPA 3D0PA 3L3VA 4AHVA 4DFPA 4FJMA 3O3HA 1WSFA 4KTWA 4DFMA 1TK0A 4HCBA 3VN5A 4HUGA 2G8VA 4GVMA 3C94A 1WSGA 3OYHA 1JXBA 3AVFA 1GOBA 3DOLA 4OJRA 4B8CA 3KK3A 3TAPA 3AO2A 3F9KA 1XC9A 1Q9YA 1Q9XA 1T7PA 4JS5A 4CEZA 3SUPA 4F2RA 5KI6A 4FJ9A 3V9ZA 3PX6A 1C1BA 2OA8A 2E4LA 1GOAA 4CF0A 1VSJA 5SWMA 1JLQA 2B5JA 3WNEA 3O3GA 3SV3A 4O44A 4RW9A 5CYQA 2D0AA 2DY4A 1HQEA 4DU4A 1RT3A 1L3TA 3ITHA 5HLFA 4DS4A 3TAFA 3V4IA 1QTMA 3VQ4A 4M3TA 1XWLA 1FK9A 2IDOA 3AVNA 3K57A 2D0BA 2VG5A 4DSFA 4ELVA 4N56A 1O1WA 4QCLA 4B8AB 2ZE2A 4CGIA 4CFBA 3EYZA 1HJRA 2DFFA 3SQ1A 3SI6A 4FJIA 3T3FA 1X9MA 4CJPA 4CEAA 3AA4A 5C25A 3ZSYA 4CHOA 1U49A 3PY8A 4CF1A 3AVLA 2PY5A 1D9FA 4W5NA 4DTRA 4FJKA 4I2PA 2B6AA 4CFAA 3LAMA 4Z4CA 1KVAA 2HNZA 2JLEA 3LP3A 3WNGA 3L2VA 3LZJA 1RBVA 3OYBA 1NK4A 3OYMA 3H08A 1NJYA 4KHUA 4Z4FA 4DQQA 1LW0A 3NFAA 3NGYA 4DMNA 4J2AA 5FROA 2HB5A 2YNIA 3MEEA 2YKNA 4LH4A 3CFOA 3ZT3A 3MAQA 1Z26A 3DOKA 3SUNA 4FK4A 3DRPA 3VQQA 3O4NA 2YHAA 3NGZA 4BDYA 3UIQA 3D45A 3KD5E 4E1MA 4M41A 4DF4A 1TAUA 1IO2A 1BGXT 3OJSA 1BI4B 3C95A 2W42A 3LALA 4DFJA 3QEIA 2VG6A 4FLTA 4LSNA 4CJFA 1GOCA 2HMIA 2RF2A 2RN2A 3WNFA 1DLOA 3OYGA 4DTJA 4DU3A 1NJXA 1SL1A 2OYQA 4PUOA 3ZSXA 3SUQA 2OPRA 3OYLA 4FJ7A 2FBTA 2X6SA 3NBPA 1JLCA 3SV4A 3AVGA 1BIZA 1YTUA 3DLBA 2KFNA 1NOZA 1U48A 4Z4HA 4CGGA 3CFPA 2XO7A 4FJ5A 4G1QA 3TR8A 3V1OA 4B9VA 3QLHA 3M8SA 4FLZA 1XI1A 3V9SA 4PWDA 3AVHA 4ELUA 3NAEA 1EXQA 1HMVA 1T8EA 1ZBHA 3T19A 4LH5A 1RCHA 3HPHA 2X78A 3O4QA 2XY7A 3KKSA 4CFDA 3HVRA 2G8HA 5K14A 3PX0A 4CHYA 4E3SA 1KSPA 2GBZA 5HRPA 1S9EA 2KZMA 4B9TA 1S6PA 2D0CA 5DMRA 3RR8A 3ZT2A 1B9DA 3RWUA 4FJ8A 5SZTA 4CJSA 3ZSWA 1D8YA 2KQ2A 3HP9A 1SUQA 5KRTA 2FBXA 5KTQA 3SQ4A 1Y97A 3K5MA 2KZZA 4FK2A 1FKOA 3K2PA 4OLBA 2YKMA 4DTUA 3EZ5A 4CIGA 5KGWA 3KD1E 4CJQA 1N5YA 3KLIA 1S1VA 2HHUA 4MFBA 3AO1A 4C8OA 4CESA 5J2MA 4CF9A 4XIUA 1KCFA 3DYAA 2F8TA 1S1XA 2G8WA 4FZYA 4HCCA 1LV5A 2XY8A 4KFBA 3ALYA 3T1AA 4CJLA 2O4GA 1QHTA 4FLYA 1RDCA 4CEOA 1F21A 3OYNA 4O5BA 3U3YA 4DLEA 3HJFA 4F3TA 5T7BA 3E01A 3AVIA 3RMDA 1RDAA 3KLFA 4CCHA 4AHSA 4NYFA 3C6TA 3FFIA 3P1GA 2XRIA 4GW6A 4HVJA 3SNNA 2G8FA 3MECA 3KIOA 4ID5A 3IAYA 3L2QA 3L2RA 4IKFA 1R0AA 1K6YA 1VSEA 3DLGA 3IG1A 4BDPA 1TL3A 4I2QA 3B6OA 3AVBA 3HYFA 3K5NA 1VSIA 3TAEA 1BISA 1S1TA 1ASVA 3F73A 4AHRA 3S3OA 1XHXA 3AO4A 1RTDA 1NK0A 2ITGA 1TL1A 4FJGA 3HSTB 4IG0A 3DMJA 1U47A 1VRTA 4K8ZA 4DQIA 1EX4A 1RT5A 4QOZB 3CM6A 4CJTA 5EU7A 3OYCA 3IS9A 4CJKA 4WE1A 2Z1GA 2B4JA 4Z4GA 3PO4A 1A5WA 4FK0A 1C1CA 4FM2A 3PX4A 3QNOA 4M45A 3DRRA 4LD0A 1EKEA 3V6DA 1NK9A 4NYNA 2IC3A 3NH2A 2IS3A 3JSMA 4N5SA 2QXFA 4KB0A 1KTQA 1VK0A 1RBRA 3SUOA 4HUFA 3ZSVA 4C8KA 4OGCA 3NH1A 4Q0BA 3IRXA 3RTVA 2X6NA 4BDZA 3TAQA 3EY1A 3ZSZA 4FJHA 1SKRA 4C8LA 3LAKA 1BQMA 5CZ2A 3PV8A 3DI6A 2F8SA 1Z25A 4CHPA 4CJRA 4JRPA 3LPUA 1C0MA 1LWEA 2YNFA 3LPTA 4CF2A 2IAJA 3AVCA 4H8KA 3KLEA 3NF9A 4F4KA 2WONA 4FJXA 2P51A 1SL2A 4BE2A 2QK9A 4B9UA 1WSIA 2HW3A 2HVHA 1RTJA 3MXMA 4DSEA 1RT4A 3MEDA 2HNYA 2VWJA 2QKKA 3TI0A 4KI4A 1I3AA 1J9AA 4KKOA 4KTZA 3I0SA 3TAMA 1RTHA 4CGDA 4FLWA 1Q8IA 4B9MA 5E41A 4CEEA 1NJWA 3K5OA 5CYMA 1TV6A 1UOCA 2OPQA 1UWBA 4R5PA 3C6UA 5J2NA 3AA5X 4CIFA 4M3WA 2F96A 3KJVA 3K59A 1IG9A 3VQ9A 1QSSA 1QSYA 4F8RA 4H4OA 3ZSOA 3V81A 1C1AA 3OJUA 5I3UA 4OVLA 4E7LA 2P1JA 2VWKA 3OS1A 1L3SA 1ZBIA 1J54A 4FVMA 4FJJA 4CEQA 3VQAA 3RRGA 3I0RA 1NK5A 1RBSA 4GMJB 3ZSQA 3K5LA 4E0DA 4CJEA 1TVRA 4M3ZA 1NK8A 4AHUA 4KV8A 4UQGA 3PO5A 2GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGI A;  4OKK A;  4DF8 A;  2EX3 A;  3NGI A;  3TAN A;  3BDP A;  4M3X A;  2Z1J A;  1RDD A;  1CXQ A;  2DFE A;  3AA3 A;  4CFC A;  3TAG A;  1I39 A;  2YNH A;  4W5T A;  4PY5 A;  1BQN A;  4F3O A;  1NKC A;  4M3U A;  3QEV A;  2IOC A;  5C42 A;  5J2Q A;  4IFY A;  1RDB A;  3KK2 A;  4KPY A;  4CHZ A;  2BE2 A;  3LWM A;  3VQD A;  4KB1 A;  4FLX A;  4CJ4 A;  1BIU A;  1CXU A;  1IKV A;  1EP4 A;  4O0I A;  3VQE A;  3DM2 A;  4ZHR A;  3KLH A;  1DTT A;  4E1N A;  2WOM A;  4KO0 A;  4CJ5 A;  3AV9 A;  1HQU A;  1ITG A;  4RW6 A;  4KRF A;  3HPG A;  3LP2 A;  1HYZ A;  4J2E A;  4E7J A;  4KHW A;  3QIP A;  4DTX A;  4OKE A;  3MXI A;  3LAN A;  4ZTF A;  1ZYQ A;  3SJJ A;  4KAZ A;  4ZTJ A;  1NOY A;  1HYS A;  1A5X A;  2HHQ A;  1WN7 A;  5J2P A;  1TKZ A;  4CEC A;  4NCG A;  4DTS A;  3S3N A;  3AVK A;  1L3V A;  2PZS A;  4NCA A;  3V9X A;  4OPK A;  3NCI A;  2NUB A;  1HYV A;  4DTO A;  3CM5 A;  1TKT A;  3L2W A;  1BI4 A;  1EET A;  1HNV A;  4DWI A;  4OGE A;  3NE6 A;  4CGJ A;  3ZT4 A;  2OZM A;  1VSH A;  1BCM A;  1U04 A;  1HPZ A;  1W9H A;  2OPP A;  3B6P A;  3NH0 A;  4N41 A;  4N76 A;  4RW8 A;  4BE0 A;  3SCX A;  2BDP A;  2EHG A;  5KGX A;  4O55 A;  2BGG A;  4Y1C A;  4C8M A;  4FXD A;  4DTM A;  1NKB A;  2X74 A;  4EP4 A;  3DLR A;  4DS5 A;  3DRS A;  3HVT A;  3VQP A;  1IKY A;  2Y1I A;  1QE1 A;  4M3R A;  3ZT0 A;  3RMB A;  2PYL A;  1BCO A;  4CF8 A;  3A2F A;  1MU2 A;  1C6V A;  1D5A A;  3G0Z A;  3JYT A;  3CFR A;  1T05 A;  3SQ0 A;  3AO5 A;  3BGR A;  3TAR A;  3RMC A;  4AHT A;  4OLA A;  1REV A;  4CK1 A;  4J2B A;  3P5J A;  2Z1H A;  3V9W A;  3THV A;  2GUI A;  4Q5V A;  3VQC A;  4AHC A;  4DG1 A;  4CEB A;  1JLE A;  3PUF A;  4IG3 A;  3ZT1 A;  2ZQB A;  4FJL A;  2YNG A;  3QEX A;  4CE9 A;  2FBV A;  5FRM A;  5C24 A;  2P5O A;  4CHN A;  4FZX C;  1RT2 A;  3QO9 A;  4E19 A;  1RBT A;  2XY5 A;  1KRP A;  3P83 D;  4PQU A;  1TK8 A;  3K58 A;  1JXE A;  1TK5 A;  2ZD1 A;  1VSD A;  3NF8 A;  1N6Q A;  4IBN A;  1TKD A;  4J2D A;  4FZZ A;  1JL2 A;  2JGU A;  5I42 A;  1S5J A;  3MXJ A;  1QSL A;  1S6Q A;  2Q3S A;  3CYM A;  3VQB A;  3OY9 A;  5HRS A;  1T03 A;  1IH7 A;  1X1P A;  2G8K A;  1KFS A;  4EZ9 A;  3ISN C;  4O0J A;  2A1R A;  3QES A;  4JLH A;  3HO1 A;  3SPY A;  4L8R B;  3RMA A;  2FBY A;  1WSE A;  3ASM A;  3KKR A;  2R7Y A;  3SPZ A;  1X9W A;  3HP6 A;  2DFH A;  5CY4 A;  4CED A;  4DSK A;  3RR7 A;  1KLN A;  1JKH A;  4Z4I A;  3HL8 A;  3NF7 A;  4KRE A;  1JL1 A;  3M8P A;  4O4G A;  3HPO A;  2YHB A;  3DLK A;  3OYF A;  4DQR A;  3ZSR A;  1L3U A;  4FM0 A;  1VSK A;  2HHW A;  1UAX A;  3QNN A;  1BHL A;  1IKW A;  1QS4 A;  3LP1 A;  3G10 A;  1HNI A;  4EZ6 A;  3VQ6 A;  3AVA A;  5HBM A;  3LDS A;  3KTQ A;  1NK6 A;  2G8I A;  1BL3 A;  1JLG A;  1IKX A;  2HHV A;  3VQ7 A;  1TAQ A;  3OVN A;  3OS2 A;  1RT6 A;  1U4B A;  3LP0 A;  4CEF A;  2DTU A;  1WAJ A;  3M8R A;  4DFK A;  2XY6 A;  1XHZ A;  2KFZ A;  5HRN A;  3TAB A;  4RW7 A;  1FXX A;  3U3G A;  4E7I A;  1QQC A;  2FC0 A;  3SYZ A;  4ID1 A;  1KFD A;  4I9L A;  4DQS A;  1ZBF A;  4CJV A;  1WLJ A;  4CJ3 A;  4FM1 A;  2OZS A;  1RIL A;  3ULD A;  3U6F A;  4FW1 A;  2PYJ A;  4CER A;  2HHS A;  1L5U A;  3OYK A;  1SKW A;  4CK3 A;  3WNH A;  4B9L A;  4CHQ A;  2YV0 X;  2RKI A;  1RT1 A;  2LSN A;  4RG8 A;  4FLU A;  4KHY A;  4MQ3 A;  3OYA A;  2HHT A;  1YVU A;  5JS1 A;  3SQ2 A;  1CZB A;  3CQ8 A;  4CGH A;  3DLH A;  5CZ1 A;  4LY7 A;  3HXM A;  2Y1J A;  3S9H A;  5HP1 A;  4DQP A;  3L8B A;  1NK7 A;  2HVI A;  2KTQ A;  4Y1D A;  2BAN A;  2P5G A;  1CZ9 A;  4CK2 A;  4F2S A;  1LAW A;  2QKB A;  1S1W A;  4E7H A;  1ZBL A;  1VSL A;  1CLQ A;  4C8N A;  3S3M A;  2RPI A;  1DTQ A;  1WAF A;  1ASU A;  4PA1 A;  4W5Q A;  3HT3 A;  3VA0 A;  4KI6 A;  3NDK A;  4YNQ A;  4HHT A;  1LWC A;  1ASW A;  1YT3 A;  3CG7 A;  3AO3 A;  1SKS A;  1NKE A;  4CGF A;  3QIN A;  3I8D A;  3VQ5 A;  3ZCM A;  1JLB A;  1S9G A;  4W5O A;  4KHS A;  2AJQ A;  1LWF A;  1NJZ A;  1KVB A;  1SV5 A;  5DK5 A;  1WNS A;  4HTU A;  1U45 A;  5D3G A;  1X9S A;  2A1S A;  1RTI A;  1RBU A;  3AA2 A;  1YTA A;  1ZBU A;  5KRS A;  4CIE A;  4BWJ A;  4M3Y A;  1KLM A;  4AH9 A;  2Z1I A;  4DSL A;  4AIL C;  4B3O A;  1VRU A;  3V1R A;  3NHG A;  4BE1 A;  3OYJ A;  4B9S A;  4KHQ A;  4HUE A;  2G8U A;  4ICL A;  4DSJ A;  4JS4 A;  1A5V A;  2E6L A;  1JLA A;  5HRR A;  3RRH A;  4KHN A;  2ETJ A;  5HRO A;  1D9D A;  1C0U A;  4CJW A;  2VG7 A;  1VSM A;  3AVM A;  4BAC A;  1S1U A;  3L3U A;  3V1Q A;  4FYD A;  4DSI A;  3LZI A;  3OYI A;  1J53 A;  1C0T A;  3AVJ A;  4IFV A;  4DTN A;  3QIO A;  4CJU A;  4BWM A;  4FCY A;  4K8X A;  4IDK A;  3LWL A;  2HHX A;  1G15 A;  1VSF A;  2OPS A;  4Z0U A;  4YFU A;  3O3F A;  4EP5 A;  3KLG A;  2KW4 A;  1WSH A;  3V9U A;  4Z4E A;  5JS2 A;  4I9Q A;  4N47 A;  1TGO A;  4ELT A;  4FW2 A;  4NCB A;  3QEP A;  4DTP A;  3OS0 A;  2E6M A;  3VQ8 A;  3SZ2 A;  4TSX A;  4OKJ A;  1HRH A;  4LSL A;  4FLV A;  4JRQ A;  4DU1 A;  1B92 A;  1B9F A;  4I7F A;  3HK2 A;  4OPJ A;  3TWH A;  2D5R A;  3HM9 A;  3QER A;  1TKX A;  1LW2 A;  1J5O A;  1RNH A;  2O4I A;  2HND A;  4E89 A;  5FDL A;  1KVC A;  3OYE A;  2XHB A;  4DLG A;  1SL0 A;  3NF6 A;  4FJN A;  3M8Q A;  3VA3 A;  1RT7 A;  4E7K A;  4KTQ A;  2I5J A;  4B9N A;  4M42 A;  4RW4 A;  3QET A;  1LAV A;  3MEG A;  5J1E A;  3KK1 A;  1UA0 A;  2ATQ A;  5FRN A;  3OYD A;  3QEW A;  4QAG A;  1UA1 A;  4W5R A;  1W0H A;  1WSJ A;  3L2U A;  1JLF A;  3DLE A;  4H4M A;  4B08 A;  1FKP A;  3D0P A;  3L3V A;  4AHV A;  4DFP A;  4FJM A;  3O3H A;  1WSF A;  4KTW A;  4DFM A;  1TK0 A;  4HCB A;  3VN5 A;  4HUG A;  2G8V A;  4GVM A;  3C94 A;  1WSG A;  3OYH A;  1JXB A;  3AVF A;  1GOB A;  3DOL A;  4OJR A;  4B8C A;  3KK3 A;  3TAP A;  3AO2 A;  3F9K A;  1XC9 A;  1Q9Y A;  1Q9X A;  1T7P A;  4JS5 A;  4CEZ A;  3SUP A;  4F2R A;  5KI6 A;  4FJ9 A;  3V9Z A;  3PX6 A;  1C1B A;  2OA8 A;  2E4L A;  1GOA A;  4CF0 A;  1VSJ A;  5SWM A;  1JLQ A;  2B5J A;  3WNE A;  3O3G A;  3SV3 A;  4O44 A;  4RW9 A;  5CYQ A;  2D0A A;  2DY4 A;  1HQE A;  4DU4 A;  1RT3 A;  1L3T A;  3ITH A;  5HLF A;  4DS4 A;  3TAF A;  3V4I A;  1QTM A;  3VQ4 A;  4M3T A;  1XWL A;  1FK9 A;  2IDO A;  3AVN A;  3K57 A;  2D0B A;  2VG5 A;  4DSF A;  4ELV A;  4N56 A;  1O1W A;  4QCL A;  4B8A B;  2ZE2 A;  4CGI A;  4CFB A;  3EYZ A;  1HJR A;  2DFF A;  3SQ1 A;  3SI6 A;  4FJI A;  3T3F A;  1X9M A;  4CJP A;  4CEA A;  3AA4 A;  5C25 A;  3ZSY A;  4CHO A;  1U49 A;  3PY8 A;  4CF1 A;  3AVL A;  2PY5 A;  1D9F A;  4W5N A;  4DTR A;  4FJK A;  4I2P A;  2B6A A;  4CFA A;  3LAM A;  4Z4C A;  1KVA A;  2HNZ A;  2JLE A;  3LP3 A;  3WNG A;  3L2V A;  3LZJ A;  1RBV A;  3OYB A;  1NK4 A;  3OYM A;  3H08 A;  1NJY A;  4KHU A;  4Z4F A;  4DQQ A;  1LW0 A;  3NFA A;  3NGY A;  4DMN A;  4J2A A;  5FRO A;  2HB5 A;  2YNI A;  3MEE A;  2YKN A;  4LH4 A;  3CFO A;  3ZT3 A;  3MAQ A;  1Z26 A;  3DOK A;  3SUN A;  4FK4 A;  3DRP A;  3VQQ A;  3O4N A;  2YHA A;  3NGZ A;  4BDY A;  3UIQ A;  3D45 A;  3KD5 E;  4E1M A;  4M41 A;  4DF4 A;  1TAU A;  1IO2 A;  1BGX T;  3OJS A;  1BI4 B;  3C95 A;  2W42 A;  3LAL A;  4DFJ A;  3QEI A;  2VG6 A;  4FLT A;  4LSN A;  4CJF A;  1GOC A;  2HMI A;  2RF2 A;  2RN2 A;  3WNF A;  1DLO A;  3OYG A;  4DTJ A;  4DU3 A;  1NJX A;  1SL1 A;  2OYQ A;  4PUO A;  3ZSX A;  3SUQ A;  2OPR A;  3OYL A;  4FJ7 A;  2FBT A;  2X6S A;  3NBP A;  1JLC A;  3SV4 A;  3AVG A;  1BIZ A;  1YTU A;  3DLB A;  2KFN A;  1NOZ A;  1U48 A;  4Z4H A;  4CGG A;  3CFP A;  2XO7 A;  4FJ5 A;  4G1Q A;  3TR8 A;  3V1O A;  4B9V A;  3QLH A;  3M8S A;  4FLZ A;  1XI1 A;  3V9S A;  4PWD A;  3AVH A;  4ELU A;  3NAE A;  1EXQ A;  1HMV A;  1T8E A;  1ZBH A;  3T19 A;  4LH5 A;  1RCH A;  3HPH A;  2X78 A;  3O4Q A;  2XY7 A;  3KKS A;  4CFD A;  3HVR A;  2G8H A;  5K14 A;  3PX0 A;  4CHY A;  4E3S A;  1KSP A;  2GBZ A;  5HRP A;  1S9E A;  2KZM A;  4B9T A;  1S6P A;  2D0C A;  5DMR A;  3RR8 A;  3ZT2 A;  1B9D A;  3RWU A;  4FJ8 A;  5SZT A;  4CJS A;  3ZSW A;  1D8Y A;  2KQ2 A;  3HP9 A;  1SUQ A;  5KRT A;  2FBX A;  5KTQ A;  3SQ4 A;  1Y97 A;  3K5M A;  2KZZ A;  4FK2 A;  1FKO A;  3K2P A;  4OLB A;  2YKM A;  4DTU A;  3EZ5 A;  4CIG A;  5KGW A;  3KD1 E;  4CJQ A;  1N5Y A;  3KLI A;  1S1V A;  2HHU A;  4MFB A;  3AO1 A;  4C8O A;  4CES A;  5J2M A;  4CF9 A;  4XIU A;  1KCF A;  3DYA A;  2F8T A;  1S1X A;  2G8W A;  4FZY A;  4HCC A;  1LV5 A;  2XY8 A;  4KFB A;  3ALY A;  3T1A A;  4CJL A;  2O4G A;  1QHT A;  4FLY A;  1RDC A;  4CEO A;  1F21 A;  3OYN A;  4O5B A;  3U3Y A;  4DLE A;  3HJF A;  4F3T A;  5T7B A;  3E01 A;  3AVI A;  3RMD A;  1RDA A;  3KLF A;  4CCH A;  4AHS A;  4NYF A;  3C6T A;  3FFI A;  3P1G A;  2XRI A;  4GW6 A;  4HVJ A;  3SNN A;  2G8F A;  3MEC A;  3KIO A;  4ID5 A;  3IAY A;  3L2Q A;  3L2R A;  4IKF A;  1R0A A;  1K6Y A;  1VSE A;  3DLG A;  3IG1 A;  4BDP A;  1TL3 A;  4I2Q A;  3B6O A;  3AVB A;  3HYF A;  3K5N A;  1VSI A;  3TAE A;  1BIS A;  1S1T A;  1ASV A;  3F73 A;  4AHR A;  3S3O A;  1XHX A;  3AO4 A;  1RTD A;  1NK0 A;  2ITG A;  1TL1 A;  4FJG A;  3HST B;  4IG0 A;  3DMJ A;  1U47 A;  1VRT A;  4K8Z A;  4DQI A;  1EX4 A;  1RT5 A;  4QOZ B;  3CM6 A;  4CJT A;  5EU7 A;  3OYC A;  3IS9 A;  4CJK A;  4WE1 A;  2Z1G A;  2B4J A;  4Z4G A;  3PO4 A;  1A5W A;  4FK0 A;  1C1C A;  4FM2 A;  3PX4 A;  3QNO A;  4M45 A;  3DRR A;  4LD0 A;  1EKE A;  3V6D A;  1NK9 A;  4NYN A;  2IC3 A;  3NH2 A;  2IS3 A;  3JSM A;  4N5S A;  2QXF A;  4KB0 A;  1KTQ A;  1VK0 A;  1RBR A;  3SUO A;  4HUF A;  3ZSV A;  4C8K A;  4OGC A;  3NH1 A;  4Q0B A;  3IRX A;  3RTV A;  2X6N A;  4BDZ A;  3TAQ A;  3EY1 A;  3ZSZ A;  4FJH A;  1SKR A;  4C8L A;  3LAK A;  1BQM A;  5CZ2 A;  3PV8 A;  3DI6 A;  2F8S A;  1Z25 A;  4CHP A;  4CJR A;  4JRP A;  3LPU A;  1C0M A;  1LWE A;  2YNF A;  3LPT A;  4CF2 A;  2IAJ A;  3AVC A;  4H8K A;  3KLE A;  3NF9 A;  4F4K A;  2WON A;  4FJX A;  2P51 A;  1SL2 A;  4BE2 A;  2QK9 A;  4B9U A;  1WSI A;  2HW3 A;  2HVH A;  1RTJ A;  3MXM A;  4DSE A;  1RT4 A;  3MED A;  2HNY A;  2VWJ A;  2QKK A;  3TI0 A;  4KI4 A;  1I3A A;  1J9A A;  4KKO A;  4KTZ A;  3I0S A;  3TAM A;  1RTH A;  4CGD A;  4FLW A;  1Q8I A;  4B9M A;  5E41 A;  4CEE A;  1NJW A;  3K5O A;  5CYM A;  1TV6 A;  1UOC A;  2OPQ A;  1UWB A;  4R5P A;  3C6U A;  5J2N A;  3AA5 X;  4CIF A;  4M3W A;  2F96 A;  3KJV A;  3K59 A;  1IG9 A;  3VQ9 A;  1QSS A;  1QSY A;  4F8R A;  4H4O A;  3ZSO A;  3V81 A;  1C1A A;  3OJU A;  5I3U A;  4OVL A;  4E7L A;  2P1J A;  2VWK A;  3OS1 A;  1L3S A;  1ZBI A;  1J54 A;  4FVM A;  4FJJ A;  4CEQ A;  3VQA A;  3RRG A;  3I0R A;  1NK5 A;  1RBS A;  4GMJ B;  3ZSQ A;  3K5L A;  4E0D A;  4CJE A;  1TVR A;  4M3Z A;  1NK8 A;  4AHU A;  4KV8 A;  4UQG A;  3PO5 A;  2GV9 A; 
#chains in the Genus database with same CATH topology
 5M1O A;  3TAN A;  4DR3 K;  4EIA A;  1CXQ A;  4YOW A;  5GAE P;  5C0Y A;  5J2Q A;  4KPY A;  4CHZ A;  3LWM A;  4KB1 A;  1BIU A;  1IKV A;  1EP4 A;  3VQE A;  3DM2 A;  4ZHR A;  3KLH A;  4CJ5 A;  1ITG A;  4KRF A;  4J2E A;  4E7J A;  4ZTF A;  1ZYQ A;  3UE5 A;  4ZTJ A;  1HYS A;  3I33 A;  4BY9 C;  3SAG A;  5GIN A;  3DWL A;  4H5R A;  5AQQ A;  1QQN A;  5J2P A;  2O8D B;  4CEC A;  1CZA N;  4NCA A;  4BC3 A;  2OTJ N;  4OPK A;  3NCI A;  1HYV A;  3RSE A;  4H0V B;  5TKY A;  1IBM K;  3Q7B A;  3ID6 A;  4BE0 A;  3THY A;  5BPN A;  2BGG A;  3FZK A;  4DTM A;  1NKB A;  1T6D A;  2X74 A;  3DRS A;  4FWO A;  3ZT0 A;  3RMB A;  1Z6R A;  4CF8 A;  1T05 A;  4YOV A;  2ZM6 K;  3BGR A;  1DGK N;  1OH5 A;  1NGH A;  4JK8 A;  3J7A P;  3THV A;  4DV2 K;  5KPR A;  4Q5V A;  5DM6 L;  3THX B;  3VQC A;  3D2E A;  4DG1 A;  1JLE A;  3PUF A;  1NGD A;  2NNW A;  2P5O A;  4FZX C;  3MK6 A;  1KRP A;  2E2N A;  3K58 A;  2ZD1 A;  4J2D A;  1JL2 A;  5I42 A;  3MXJ A;  1VQ4 N;  1QSL A;  2O8E A;  3OY9 A;  4JAX A;  4O0J A;  3QES A;  3CI5 A;  2FBY A;  2R7Y A;  3SPZ A;  4BR0 A;  2DFH A;  4NB4 A;  4BRP A;  2W6K A;  5JIC A;  4O4G A;  4AQY K;  3P31 A;  4JI2 K;  4DQR A;  5HOO A;  1UAX A;  2ZJP L;  1BHL A;  4NXN K;  1V4S A;  2UXB K;  4H5N A;  2G8I A;  3R1X A;  1JLG A;  3VQ7 A;  4H5W A;  4CEF A;  4KH5 A;  4DFK A;  2EWS A;  5HRN A;  4DR1 K;  3CJC A;  2O8C A;  3SYZ A;  1RGI A;  3VER A;  3EL2 A;  1ZBF A;  4CJ3 A;  2PYJ A;  1VQL N;  4CK3 A;  1XUP O;  1ATS A;  4KHY A;  1YVU A;  2D4W A;  3SQ2 A;  1CZB A;  3CQ8 A;  3HXM A;  4JKE A;  1TUU A;  4Y1D A;  2BAN A;  3TTD A;  3RSE B;  2CH5 A;  2YHX A;  1CLQ A;  1X3M A;  4C8N A;  4W5Q A;  3VA0 A;  4CBX A;  3THY B;  3H3N O;  2VQF K;  4W5O A;  1S9G A;  1LWF A;  1KVB A;  2PFU A;  5DK5 A;  3T7Z A;  4HTU A;  2A1S A;  5KRS A;  1ZBU A;  2Q0R A;  3AA2 A;  1YI2 N;  1J5E K;  1KLM A;  4AH9 A;  1QVG M;  4B9S A;  4KHQ A;  4BE1 A;  4HUE A;  2ITM A;  3VF2 A;  5LMU K;  4MO5 A;  4B9Q A;  1A5V A;  3RRH A;  4A2B A;  3V1Q A;  3L3U A;  3ZLJ A;  1VQ7 N;  5BN8 A;  1C0T A;  3AVJ A;  5C10 A;  3QIO A;  4FPB A;  5AQT A;  4FCY A;  4Z0U A;  4B3S K;  3O3F A;  2W41 A;  3ENO A;  3VGK A;  4Z4E A;  4N47 A;  1U2V B;  1JCG A;  2UU9 K;  3K9J A;  4LSL A;  5AFU A;  1KQS M;  4I7F A;  3TWH A;  3HM9 A;  1VQO N;  4WFN L;  1RNH A;  2O4I A;  2HND A;  3CCV N;  2XHB A;  3KVG A;  4O5F A;  3CHW A;  2I5J A;  3QET A;  1LAV A;  2ATQ A;  3OYD A;  3G6E N;  4UY8 O;  3E9O A;  4FJM A;  1KC8 O;  2O8C B;  5M1K A;  3AVF A;  5GIP A;  3DOL A;  4OJR A;  1XC9 A;  1Q9X A;  4CEZ A;  4LF8 K;  5KI6 A;  3V9Z A;  1C1B A;  1EWR A;  3CCR N;  3WNE A;  3O3G A;  1N32 K;  1GLC G;  2GX9 A;  3SV3 A;  5CYQ A;  1RT3 A;  5CR4 A;  5HLF A;  4DS4 A;  1K8A O;  4PKI A;  1XWL A;  2D0P A;  3I55 N;  2D0B A;  2VG5 A;  3HOT A;  4N56 A;  4MDB A;  4QCL A;  5MLC Q;  1BWF O;  2ZE2 A;  4CGI A;  3N4Q A;  1X9M A;  2NZT A;  1YJW N;  5C25 A;  5M1P A;  4CF1 A;  3MN5 A;  4IEI A;  4RWT A;  4W5N A;  2B6A A;  4Z4C A;  2HNZ A;  4JYA K;  3LZJ A;  1RBV A;  1NGB A;  1NJY A;  3HSC A;  2A5X A;  4YDU A;  3NFA A;  2QM1 A;  5FRO A;  4CD1 A;  3SUN A;  3DRP A;  5HL7 L;  3VQQ A;  1Y64 A;  4BDY A;  3KD5 E;  2IVN A;  4DF4 A;  1IO2 A;  1BI4 B;  3C95 A;  2W42 A;  3QEI A;  4BR7 A;  1XMO K;  3FZM A;  2YX6 A;  3CIP A;  3OYG A;  4PUO A;  3SUQ A;  2X6S A;  1FJG K;  1BIZ A;  3DLB A;  4I6M A;  4QS7 A;  5AQJ A;  3V1O A;  3QLH A;  1XI1 A;  2FSJ A;  3MN9 A;  4BRF A;  2QW9 A;  1HMV A;  3WXI A;  3T19 A;  3HPH A;  4GKK K;  5FLX O;  3O4Q A;  3KKS A;  2ASM A;  4A2A A;  3PX0 A;  5GAG P;  1GLL O;  3CME N;  2FXU A;  5A2Q O;  3VGL A;  3ZET B;  1B9D A;  3GG4 A;  4FJ8 A;  1QVF M;  5KRT A;  2FBX A;  3AY9 A;  4BG8 A;  5KTQ A;  1Y97 A;  3K5M A;  3K2P A;  4K0K K;  4XH4 A;  2HHU A;  1N5Y A;  3KLI A;  3AO1 A;  5J2M A;  4B1V A;  1KCF A;  4ILH A;  2BH1 A;  1GLB G;  2HOE A;  4BQL A;  1RDC A;  4CEO A;  4O5B A;  3HJF A;  1IBK K;  3MX5 A;  4AHS A;  3FFI A;  3OW2 M;  3L2Q A;  1R0A A;  2VQE K;  3DLG A;  4BDP A;  2E20 A;  3HYF A;  1VSI A;  3MWT A;  3ATV A;  3PSF A;  3J81 O;  3VGM A;  1Q7Y O;  1XHX A;  3OA9 A;  3AO4 A;  1RTD A;  1TL1 A;  2QEX N;  3HST B;  4AM7 A;  1U47 A;  4YY3 K;  2QTD A;  4G9Z A;  1JJ2 M;  3IS9 A;  4WE1 A;  2Z1G A;  4Z4G A;  3C7N A;  1C1C A;  4LF4 K;  3G71 N;  2HBK A;  4FOE A;  3J7Z O;  3ZSV A;  4JD2 A;  4C8K A;  3NH1 A;  3IRX A;  4C23 A;  5ADX A;  2A3Z A;  3HRG A;  4NO7 A;  5AQR A;  4DSK A;  3EEQ A;  4CF2 A;  4F4K A;  4H8K A;  2WON A;  2ZJR L;  4BE2 A;  3O1W A;  1WSI A;  4I6M B;  1HR0 K;  2HW3 A;  1RTJ A;  3M5R A;  5TKW A;  4KI4 A;  4FLW A;  4JKG A;  1RTH A;  3SAF A;  1K8K A;  1YAG A;  1Q8I A;  4B9M A;  2P9N A;  3C6U A;  2JWL A;  3KJV A;  3K59 A;  1BDG A;  3LM9 A;  3VQ9 A;  1QSS A;  1QSY A;  2E5L K;  2P1J A;  3OS1 A;  3QFU A;  4DV0 K;  1GLA G;  3D7E O;  1M90 O;  2E8A A;  2V51 B;  4H5T A;  4KV8 A;  2GV9 A;  4BRE A;  4X62 K;  4BR2 A;  4OKK A;  4M3X A;  4JHD A;  2DFE A;  2ZWH A;  3AA3 A;  3F2K A;  1NU0 A;  2HST A;  1I39 A;  2YNH A;  4W5T A;  4A61 A;  1BQN A;  1NKC A;  3VEY A;  4M3U A;  1SZ2 A;  5C42 A;  1RDB A;  5AR0 A;  3VQD A;  4FLX A;  1CXU A;  5LL6 Z;  5AJ3 K;  3KWG A;  4C1N I;  3O9Q A;  4E1N A;  5AQM A;  3HPG A;  3O1B A;  1VQN N;  3LDQ A;  3LP2 A;  2QWQ A;  4DTX A;  4OKE A;  3J8A A;  1QHA A;  1A5X A;  1KAX A;  4IXC A;  4KH6 A;  1TKZ A;  3VMF B;  4NCG A;  4DTS A;  2QWN A;  3V9X A;  2NUB A;  4V19 S;  3L2W A;  4GNI A;  3D6R A;  3CC2 N;  3WQT A;  5LY3 A;  4B1U B;  3ZT4 A;  2OZM A;  1BCM A;  1U04 A;  1HPZ A;  3B6P A;  3NH0 A;  2GWJ A;  2P9K B;  3I8B A;  5LJW A;  1HKB A;  2ZJQ L;  5FPM A;  4C8M A;  2VCP A;  2WBN A;  3ZEU A;  3BY5 A;  4DS5 A;  4JKH A;  3HVT A;  2PYL A;  4JD2 B;  3G0Z A;  4IO9 L;  4GY2 B;  3U9Z A;  2O8B A;  4J8F A;  4EHT A;  3TAR A;  3WT0 A;  3V9W A;  2GUI A;  4CEB A;  4JI6 K;  2ZQB A;  4CE9 A;  5FRM A;  4JKG B;  5C24 A;  1K8K B;  4IOA L;  3QO9 A;  4E19 A;  1RBT A;  4YOU A;  3CCJ N;  2P9N B;  3CD6 N;  1JXE A;  1TK5 A;  1HNW K;  4IBN A;  5BPM A;  3CC7 N;  3BZC A;  2Q3S A;  3CYM A;  4EZ9 A;  1KFS A;  1X1P A;  2QWO A;  2PAV A;  3SPY A;  4L8R B;  4CED A;  3FLC O;  1JKH A;  3CJ9 A;  4KRE A;  3CC4 N;  3HPO A;  1EQY A;  2GUP A;  1W2B M;  1L3U A;  1IKW A;  3G10 A;  4JHD B;  4EZ6 A;  5CE3 A;  3LDS A;  3KTQ A;  1BL3 A;  4GV6 A;  2HHV A;  1DEJ A;  4JI8 K;  5AQO A;  2DTU A;  3VF4 A;  3M8R A;  4BGA A;  4RW7 A;  1FXX A;  4E7I A;  1QQC A;  4GV9 A;  4ID1 A;  4BGB A;  1DKG D;  1ZBS A;  5CHI A;  3WNH A;  1NMN A;  4CHQ A;  2HBL A;  2RKI A;  4M7X A;  1RT1 A;  4FLU A;  4BC5 A;  4WQ4 A;  4CGH A;  5FPN A;  3DXK A;  4LY7 A;  2WUS A;  5HP1 A;  3L8B A;  1NK7 A;  3CCQ N;  1LAW A;  4IOX A;  2RPI A;  1NM1 A;  3HT3 A;  4KI6 A;  3NDK A;  5AQF A;  4HHT A;  1LWC A;  1ASW A;  1YT3 A;  2V7Y A;  1SKS A;  4CGF A;  3QIN A;  3I8D A;  3ZCM A;  1JLB A;  3HOS A;  1SV5 A;  2F9W A;  1H1V A;  2HHH K;  3L6Q A;  4M3Y A;  2O8B B;  4DSL A;  3CCL N;  3V1R A;  3NHG A;  5GAH P;  2G8U A;  4ICL A;  3PSI A;  4JS4 A;  2E6L A;  1JLA A;  3M6G A;  5HRO A;  5AZJ B;  4CJW A;  1VSM A;  3AVM A;  4FYD A;  3G4S N;  1HKC A;  4IFV A;  2HHX A;  4EP5 A;  3CPW M;  3V9U A;  4JI1 K;  4LF9 K;  5JS2 A;  2W6L A;  1TGO A;  5BR9 A;  4TSX A;  1E3M A;  4ISF A;  4CJ7 A;  1YHQ N;  1IBL K;  3HK2 A;  3QER A;  5FDL A;  4DLG A;  3VA3 A;  1RT7 A;  1XQS C;  3C65 A;  4KTQ A;  4B9N A;  3MEG A;  1UA0 A;  5C2D A;  3QEW A;  4QAG A;  3S41 A;  1W0H A;  1W97 L;  3L3V A;  4CZL A;  4O8U A;  4AHV A;  2CH6 A;  3VTI A;  4KTW A;  4HUG A;  3UKU B;  2P9U A;  2A40 A;  3LM2 A;  1WB9 A;  3OYH A;  1GOB A;  3LL3 A;  3EN9 A;  3F9K A;  2A41 A;  3QDK A;  5KPZ A;  1KAZ A;  4L3Q A;  3ATU A;  3VEZ A;  1BOT O;  1L3T A;  4A59 A;  3AVN A;  4DSF A;  1I94 K;  3CJB A;  2E2Q A;  3LDN A;  4R79 A;  3SI6 A;  3SQ1 A;  4CEA A;  3PY8 A;  2Q1N A;  3H3O B;  3AVL A;  5AQW A;  1N34 K;  4CI6 A;  1P90 A;  4I2P A;  4YOY A;  3L2V A;  1YJ9 N;  2JLE A;  3OYB A;  1NMD A;  2D0O A;  1NK4 A;  3H08 A;  3D2F A;  3OHR A;  3NGY A;  2F4V K;  4QS9 A;  2YNI A;  4LH4 A;  2YKN A;  3CFO A;  4CZI A;  4YDU C;  4FK4 A;  3EKU A;  3O4W A;  4BRQ A;  4PHT X;  3D45 A;  2Q2R A;  3CJ7 A;  2QI2 A;  2UYT A;  3R3L A;  3LAL A;  4KHP K;  2VG6 A;  4A5A A;  5H1S Q;  1NGI A;  4GV3 A;  1NLV A;  3OBW A;  2RF2 A;  2RN2 A;  4DR2 K;  4DTJ A;  3VEO A;  1BO5 O;  3ZSX A;  3P39 A;  3AVG A;  4CD3 A;  3VES A;  5AQV A;  4DQ8 A;  2YCH A;  1WOQ A;  4CGG A;  3V9S A;  3AVH A;  5BR8 K;  4ELU A;  1RCH A;  3QB0 A;  4BRH A;  2X78 A;  4CFD A;  1ZC6 A;  2G8H A;  5K14 A;  4GKJ K;  4CHY A;  4E3S A;  3D2E B;  4B9T A;  1LOT B;  1S6P A;  3FR0 A;  3RR8 A;  3ZT2 A;  3RWU A;  4WCE L;  5SZT A;  1HX1 A;  1J6Z A;  2KQ2 A;  1SUQ A;  2O8E B;  1FKO A;  1Z05 A;  4ILJ A;  4BVO A;  4OLB A;  1V4T A;  2P9U B;  5KGW A;  4CIG A;  1S1V A;  4MFB A;  4CES A;  4DR5 K;  4CF9 A;  5JLH A;  3ZX2 A;  3EE9 A;  1LV5 A;  2XY8 A;  4KFB A;  3T1A A;  4FLY A;  2O4G A;  4ISE A;  4DLE A;  3WUH A;  5T7B A;  3E01 A;  2F9T A;  2NRT A;  2AP1 A;  1RDA A;  3AVI A;  4CCH A;  3C6T A;  3P1G A;  3L4Q A;  4JK9 A;  3MEC A;  2GEM A;  3IAY A;  5AQP A;  3AVB A;  1SS6 A;  1HKG A;  1GLJ O;  4AHR A;  3F73 A;  4PL8 A;  3CCM N;  4Y0W A;  1YIJ N;  4FJG A;  4IG0 A;  1E4F T;  4YOX A;  1VRT A;  5I9E B;  4DQI A;  3O5B A;  2Q97 A;  3D2F B;  3E9P A;  4CJT A;  1YXQ A;  2IIR A;  5BN9 A;  4CJK A;  3NMU A;  1A5W A;  3PX4 A;  2I7P A;  3QNO A;  3RVC A;  3V6D A;  4NYN A;  3JSM A;  2Q31 A;  4N5S A;  4KB0 A;  1KTQ A;  1VK0 A;  2FLO A;  3BF1 A;  4LF7 K;  4M7Y A;  4BR4 A;  1VHX A;  3T69 A;  3H6E A;  4BR9 A;  3DI6 A;  1Z25 A;  2OCE A;  4CHP A;  4CJR A;  4JRP A;  4CBU A;  4WYB A;  3KLE A;  3LPT A;  4FJX A;  3F9M A;  3SLC A;  1SL2 A;  4Z94 A;  4ILG B;  2HVH A;  3F5T A;  4AM6 A;  5BRE A;  3VEN A;  2QKK A;  3TI0 A;  1I3A A;  2NRW A;  4KTZ A;  4CGD A;  3TAM A;  3I0S A;  4WQ5 A;  1YUW A;  3MDQ A;  4X64 K;  3G25 A;  3M1F A;  4DV7 K;  3GDQ A;  3VPZ A;  2F96 A;  2KHO A;  1XNQ K;  4MLE A;  4H4O A;  3ZSO A;  2VWK A;  3MN6 A;  1QZ6 A;  4BC4 A;  4CEQ A;  2NRZ A;  1BA0 A;  3RRG A;  1NK5 A;  3EKS A;  3ZSQ A;  2HBM A;  2QWR A;  4UQG A;  4O44 A;  4GVE A;  2YHW A;  4DF8 A;  1K73 O;  2EX3 A;  2Z1J A;  3U4L A;  4WFA L;  4CFC A;  3TAG A;  4JV5 K;  3C0B A;  2WTU A;  4WF9 L;  4PKG A;  3QEV A;  1NJI O;  4IFY A;  1GLE G;  4CJ4 A;  3AV9 A;  1HQU A;  4RW6 A;  1G99 A;  5BRF A;  4KHW A;  3QIP A;  3O80 A;  5JMV A;  3MXI A;  4BRI A;  1T6C A;  4HWI A;  3NVK A;  3DLL L;  1WN7 A;  5AQG A;  3S3N A;  3AVK A;  1L3V A;  3C6A A;  2PZS A;  3CM5 A;  2A42 A;  3CXC M;  4H0X B;  3A8Y A;  4NLC A;  3U9D A;  1HNV A;  4DWI A;  4OGE A;  3NE6 A;  1RDW X;  1VQ9 N;  5C12 A;  2OPP A;  4N41 A;  1TYQ A;  4N76 A;  1EWQ A;  2BDP A;  1HPM A;  2Q36 A;  5KGX A;  4O55 A;  3PLA A;  4Y1C A;  5BRH A;  5AQS A;  4EP4 A;  1IKY A;  4FWL A;  1RDU A;  4RCH A;  1HNZ K;  1MU2 A;  5BRD A;  3JYT A;  2QWL A;  3CFR A;  3CF5 L;  2P9P A;  1OH8 A;  1KD1 O;  3SQ0 A;  3AO5 A;  2O8F A;  4CZF A;  4OLA A;  1REV A;  4J2B A;  3P5J A;  5LJV A;  4JK7 A;  1YVN A;  4AHC A;  3Q7C A;  4CVN E;  1WUA A;  4IG3 A;  3QEX A;  2FBV A;  3CCE N;  1VQK N;  5EOY A;  3CET A;  4PQU A;  3FE1 A;  1N6Q A;  4FZZ A;  3NF8 A;  1TKD A;  2JGU A;  3KZB A;  2QXL A;  1T03 A;  1IH7 A;  2G8K A;  2A1R A;  2E2P A;  3RMA A;  3MCP A;  1WSE A;  3ASM A;  3KKR A;  1ATR A;  3CER A;  3VEX A;  1X9W A;  5CY4 A;  3IFR A;  3RR7 A;  2NRX A;  4Z4I A;  3HL8 A;  2ASO A;  3NF7 A;  1BUP A;  3OYF A;  3DJC A;  3EE8 A;  4FM0 A;  2HHW A;  2E1Z A;  3QNN A;  3LP1 A;  2NRH A;  3VQ6 A;  4CZK A;  5HBM A;  1NK6 A;  3E1Y A;  2UUA K;  1IKX A;  1TAQ A;  3N4P A;  3OVN A;  3OS2 A;  3SJH A;  2XY6 A;  1XHZ A;  1SAZ A;  2PBD A;  2VWB A;  2FC0 A;  4A57 A;  1KFD A;  4I9L A;  1VQM N;  4DQS A;  4CJV A;  3IUC A;  1RIL A;  2YI1 A;  5B8H A;  1Q82 O;  4CER A;  2HHS A;  2YV0 X;  3MMV A;  2QA4 N;  3IKM A;  3TPQ A;  3OBY A;  3OYA A;  2HHT A;  5JS1 A;  1E4G T;  5LMN K;  3H45 C;  3DLH A;  5CZ1 A;  2Y1J A;  3S9H A;  4DQP A;  2KTQ A;  4WQ4 C;  1CZ9 A;  2W40 A;  2QKB A;  1S1W A;  3P4I A;  1VSL A;  1ZBL A;  1DTQ A;  1WAF A;  1ASU A;  4PA1 A;  1JCF A;  3FGU A;  3VEV A;  3AO3 A;  3GE1 A;  3MX2 A;  4OO1 J;  1JCE A;  5JLF A;  3HI0 A;  3PIP L;  2AJQ A;  1WNS A;  1U45 A;  3A5N C;  5D3G A;  2VGM A;  4H0Y B;  1X9S A;  1S22 A;  1RTI A;  5BPL A;  2P9P B;  4BWJ A;  2O8F B;  1VRU A;  3P38 A;  4X65 K;  3QBW A;  5FPD A;  5AQH A;  4DSJ A;  1S3X A;  5HRR A;  3AAQ A;  4OX9 K;  1NGG A;  1BA1 A;  4MO4 A;  3SK3 A;  4DSI A;  1IG8 A;  4K8X A;  2ZF5 O;  4BWM A;  3C7N B;  3LWL A;  2FSK A;  3H46 O;  1G15 A;  1VSF A;  2P9S A;  2OPS A;  2D1K A;  2KW4 A;  1WSH A;  3PIO L;  4I9Q A;  4ELT A;  4NCB A;  3QEP A;  1O13 A;  4DTP A;  3SZ2 A;  3GL1 A;  3O08 A;  1HRH A;  1T44 A;  4FLV A;  4DU1 A;  1B9F A;  4OPJ A;  3R9P A;  4LC9 B;  4FJN A;  4U7B A;  3NF6 A;  3M8Q A;  3HTV A;  5M1Q A;  3E66 A;  5EY4 A;  3ZX0 A;  2QWP A;  1QQO A;  1UA1 A;  4W5R A;  1JLF A;  5AFU H;  3O3H A;  1WSF A;  4DFM A;  1TK0 A;  4HCB A;  3VN5 A;  5AQZ A;  3H1V X;  3FZF A;  1WSG A;  3FFK B;  1JXB A;  3TAP A;  4JI7 K;  1Q9Y A;  1T7P A;  3KK7 A;  4B1Z A;  4DR4 K;  4X66 K;  4F2R A;  4JS5 A;  4YOR A;  1MA9 B;  4H03 B;  4JI3 K;  2OA8 A;  2E4L A;  3EZW A;  1KXP A;  4H0O A;  5SWM A;  1JLQ A;  4CZJ A;  2ZGZ A;  2DY4 A;  2HBJ A;  1U6Z A;  3L4I A;  4WFB L;  1QTM A;  3V4I A;  4M3T A;  3VQ4 A;  4B3M K;  1NBW A;  1RFQ A;  3THW A;  4B8A B;  3TSQ A;  4CFB A;  4FJI A;  3T3F A;  4B1W B;  4CJP A;  3T1H K;  4CHO A;  1U49 A;  3WXK A;  2DPN A;  2PY5 A;  1D9F A;  2A6A A;  4DTR A;  4XH5 A;  4H0P A;  3JS6 A;  4OPA A;  4FJK A;  1KVA A;  3L0Q A;  3LP3 A;  3WNG A;  3OYM A;  4KHU A;  4LFB K;  2RE2 A;  1LW0 A;  4BQZ A;  4CW7 B;  4DMN A;  2OAN A;  3ZT3 A;  1OVQ A;  5C15 A;  4YOT A;  3NGZ A;  4JI5 K;  2FF6 A;  4E1M A;  4M41 A;  1BGX T;  1NNE A;  2YJE A;  3BP8 A;  4FSV A;  4DFJ A;  1MDU B;  4DHY A;  2VYP A;  4LSN A;  4CJF A;  3O9S A;  4NXM K;  2HMI A;  1NJX A;  4DU3 A;  1SL1 A;  2OPR A;  3OYL A;  2WFB A;  2FBT A;  2V52 B;  3NBP A;  1JLC A;  3SV4 A;  3ZEU B;  1NOZ A;  3U8X A;  2HF4 A;  5KQD A;  1C0G A;  4JKD A;  4YHH K;  2XO7 A;  3CFP A;  4G1Q A;  4JN4 A;  3M8S A;  4FLZ A;  5IT9 O;  1C0F A;  1T8E A;  3O9U A;  4LH5 A;  2OTL N;  3HVR A;  2GBZ A;  1S9E A;  1X3N A;  2KZM A;  4BRO A;  4EAH D;  2D0C A;  4E1J A;  4FVU A;  3ID8 A;  5DMR A;  3KWI A;  3HP9 A;  3SQ4 A;  5F2R A;  2YKM A;  4DTU A;  1EO1 A;  3KD1 E;  5DM7 L;  2F8T A;  4CZE A;  1S1X A;  4FZY A;  4HCC A;  4CJL A;  2HF3 A;  5AQY A;  3HM8 A;  1TUY A;  4F3T A;  3RMD A;  1N8R O;  3KLF A;  4HVJ A;  3M3Z A;  2UUC K;  3KIO A;  1K9M O;  4FWM A;  3THW B;  4I2Q A;  4HTL A;  1MWM A;  3W3D A;  4JI0 K;  4DR7 K;  1ASV A;  3A5M C;  3UKR A;  3LDL A;  5EVZ A;  2ITG A;  1D4X A;  1XC3 A;  4H5V A;  3ZX3 A;  3DMJ A;  1EX4 A;  4C1N K;  1W7A A;  4FWR A;  4QOZ B;  4IZ9 A;  3IMX A;  5EU7 A;  5KQ8 A;  4FWQ A;  4IJN A;  5AQN A;  4FK0 A;  3A0I X;  3CCS N;  4FM2 A;  3O6W A;  1NK9 A;  1VQ8 N;  3NH2 A;  3DXK B;  4DV5 K;  2QXF A;  3DAW A;  3SUO A;  4HUF A;  4IWV A;  4OGC A;  4A62 A;  3RTV A;  1U2V A;  2X6N A;  4BDZ A;  3TAQ A;  3EY1 A;  3ZSZ A;  1M1K O;  4BC2 A;  4C8L A;  3LAK A;  1NGE A;  4FWN A;  3AAP A;  2GWK A;  4BRL A;  4CZM A;  4FOI A;  5JVH L;  4K43 A;  3LPU A;  2YNF A;  2IAJ A;  2QK9 A;  3NF9 A;  2P51 A;  3O9T A;  4B9U A;  4BVP A;  3TTC A;  4DSE A;  1RT4 A;  2VWJ A;  2ASP A;  4K25 A;  4NLB A;  1J9A A;  5ADX H;  1NJW A;  3K5O A;  2IVO A;  1TV6 A;  2OPQ A;  4WQ5 C;  3E9L A;  4B3R K;  1VQP N;  4M3W A;  1NGA A;  1IG9 A;  3HZ6 A;  4F8R A;  4FWP A;  3WXM B;  4FVM A;  3MCA B;  3BF3 A;  4IFE A;  4CJE A;  3TSU A;  1HJO A;  5KPT A;  1TVR A;  1NG9 A;  2NRV A;  2IGI A;  3NGI A;  5M1N A;  3BDP A;  1RDD A;  5AQK A;  3KHY A;  1HNX K;  2IVP A;  3WXJ A;  4BR5 A;  4CBW A;  4PY5 A;  4F3O A;  2HMP A;  2IOC A;  3KK2 A;  2BE2 A;  4DV3 K;  3TU5 A;  4O0I A;  1DTT A;  2WOM A;  4KO0 A;  1HYZ A;  4JI4 K;  2BTF A;  3BEX A;  5F1X A;  3LAN A;  3SJJ A;  3QIC A;  4EFH A;  4KAZ A;  1NOY A;  2NRR A;  3I56 N;  1OH6 A;  4KH4 A;  1ILY A;  3JAM O;  5EXW A;  4B1X B;  4DCH A;  3UKR B;  2JWK A;  4DTO A;  1TKT A;  2YHY A;  4FWS A;  1BI4 A;  1EET A;  2P9L A;  2AA4 A;  4BRM A;  3SAH A;  4CGJ A;  1VSH A;  1W9H A;  4QS8 A;  4RW8 A;  3SCX A;  3CPE A;  2EHG A;  3UB5 A;  4B1Y B;  4FXD A;  3K0S A;  3A5O C;  3DLR A;  2Y1I A;  3VQP A;  1QE1 A;  4M3R A;  1S72 N;  1BCO A;  4MLH A;  3A2F A;  1C6V A;  1D5A A;  3VOV A;  3AGR A;  3J7Y P;  3T1Y K;  2ZGY A;  4XEI A;  2CGK A;  1YIT N;  3RMC A;  4AHT A;  4CK1 A;  2Z1H A;  4JKC A;  3ZT1 A;  4BRK A;  4FJL A;  2YNG A;  2NLX A;  5AQL A;  4JEP A;  3CJA A;  3ZET A;  4CHN A;  1RT2 A;  2XY5 A;  3P83 D;  1TK8 A;  5E26 A;  2QWM A;  1VSD A;  1S5J A;  1S6Q A;  3VQB A;  5HRS A;  3SBG A;  3EO3 A;  3MN7 A;  4ISG A;  3ISN C;  4JLH A;  3LDP A;  3HO1 A;  2E88 A;  3HP6 A;  1VQ5 N;  3DXM A;  4XH1 A;  1KLN A;  3CQY A;  1JL1 A;  3M8P A;  3WEE A;  2YHB A;  3DLK A;  3GOI A;  3ZSR A;  3VEW A;  1VSK A;  1IJJ A;  1QS4 A;  1HNI A;  4LF6 K;  3AVA A;  1NWK A;  4H0T B;  1HLU A;  5ELZ A;  1U4B A;  1RT6 A;  5IWA K;  3LP0 A;  1ATN A;  1WAJ A;  2GEL A;  4IJA A;  4BRC A;  2KFZ A;  3TAB A;  1BU6 O;  3U3G A;  5AQU A;  3SMP A;  2GTD A;  1WLJ A;  4FM1 A;  2OZS A;  4KBO A;  3ULD A;  3U6F A;  4FW1 A;  1N33 K;  1L5U A;  3OYK A;  1SKW A;  4B9L A;  2LSN A;  1OH7 A;  4RG8 A;  4K42 A;  4MQ3 A;  4DB3 A;  1WBD A;  1NGJ A;  2HVI A;  2P5G A;  4CK2 A;  4F2S A;  2P9L B;  4E7H A;  3BUZ B;  3S3M A;  1ESV A;  3CMA N;  3CJ1 A;  4YNQ A;  1NKE A;  2UUB K;  3CG7 A;  4JKF A;  4BRA A;  2FF3 B;  5F0X A;  3VQ5 A;  3VF6 A;  4KHS A;  1NJZ A;  1Q18 A;  1RBU A;  1YTA A;  2UXC K;  4PL7 A;  4CIE A;  2Z1I A;  4AIL C;  5AQX A;  4B3O A;  3OYJ A;  4KHN A;  2ETJ A;  4OPH A;  1D9D A;  1C0U A;  5AQI A;  1DT9 A;  2VG7 A;  4BAC A;  1S1U A;  4M63 C;  5AZI A;  4O8K A;  3LZI A;  3OYI A;  1J53 A;  4DTN A;  1VAZ A;  4CJU A;  4IDK A;  5C2F A;  4YFU A;  3KLG A;  1NGC A;  4EHU A;  1SQK A;  4FW2 A;  3OS0 A;  2E6M A;  3VQ8 A;  4OKJ A;  3DXM B;  4JRQ A;  1B92 A;  3K9K A;  2D5R A;  3WEE B;  1TKX A;  1LW2 A;  2YJF A;  1J5O A;  4E89 A;  4CZH A;  1KVC A;  3OYE A;  1SL0 A;  2KKZ A;  4E7K A;  4B3T K;  1T3V A;  3A5L C;  3VET A;  4RW4 A;  4M42 A;  5J1E A;  3KK1 A;  5FRN A;  1HUX A;  1WSJ A;  3L2U A;  3H1Q A;  3DLE A;  4H4M A;  4B08 A;  1FKP A;  3D0P A;  3TTF A;  3AAR A;  4DFP A;  3B8A X;  3FZL A;  4GVM A;  2G8V A;  1IV0 A;  3C94 A;  2UXD K;  3TSP A;  4B8C A;  3W0L A;  3KK3 A;  3AO2 A;  3SUP A;  3FZH A;  4FJ9 A;  3PX6 A;  4IOC L;  1GOA A;  1BG3 A;  4CF0 A;  2P9I A;  1Q86 O;  1VSJ A;  3ENH A;  2B5J A;  2P9K A;  4JKA A;  4DV1 K;  4RW9 A;  1VQ6 N;  3IDH A;  4FPA A;  2D0A A;  3ULE A;  1HQE A;  4DU4 A;  2V7Z A;  3ITH A;  3TAF A;  2F7T A;  1FK9 A;  2IDO A;  3HBT A;  3K57 A;  1YJN N;  4ELV A;  5FPE A;  1O1W A;  4DKW A;  3EYZ A;  3OTO K;  1HJR A;  2H3G X;  2E2O A;  2DFF A;  4U67 L;  3AA4 A;  3ZSY A;  4DV6 K;  4IDH A;  4DV4 K;  4CFA A;  3LAM A;  2VGN A;  4Z4F A;  4JNE A;  4DQQ A;  4J2A A;  1GLF O;  2HB5 A;  3MEE A;  3MAQ A;  3WXL A;  1Z26 A;  3DOK A;  2FSN A;  3O4N A;  1NGF A;  1OVY A;  2YHA A;  3O8M A;  3UIQ A;  1TAU A;  3BZK A;  3OJS A;  2I7N A;  4PKH A;  3NVM A;  3QML A;  3SMS A;  5AZI B;  3ZYY X;  4FLT A;  5M1F A;  1GOC A;  1TYQ B;  3WNF A;  1DLO A;  5E84 A;  2OYQ A;  3O9R A;  4FJ7 A;  2RHK A;  1LCU A;  1YTU A;  2KFN A;  2KLA A;  1U48 A;  4Z4H A;  4FJ5 A;  3TR8 A;  4B9V A;  4PWD A;  3VTH A;  4BRG A;  1EXQ A;  2Q0U A;  3NAE A;  1ZBH A;  1N36 K;  5EX5 A;  4K41 A;  1X9J A;  2BUP A;  4IO8 A;  2XY7 A;  2E1Y A;  4CZG A;  3JXU A;  1KSP A;  2WC9 A;  5HRP A;  4JKB A;  3QBX A;  1QQM A;  4CJS A;  4F9O A;  3ZSW A;  3AGK A;  1D8Y A;  4RTF D;  4FO0 A;  2KZZ A;  4FK2 A;  3EZ5 A;  4CJQ A;  4C8O A;  4XIU A;  3DYA A;  4IEE A;  2G8W A;  3ALY A;  1XMQ K;  1QHT A;  2P9I B;  4BG9 A;  1F21 A;  3OYN A;  3U3Y A;  3R8E A;  4DR6 K;  3ULE B;  4NYF A;  4GW6 A;  2XRI A;  3SNN A;  2G8F A;  1OKJ A;  1QZ5 A;  1MWK A;  4ID5 A;  3L2R A;  4IKF A;  1K6Y A;  4FWK A;  1XNR K;  1VSE A;  3IG1 A;  4FL9 A;  1TL3 A;  4DUY K;  4DUZ K;  4LF5 K;  5JVG L;  1FW6 A;  3B6O A;  3K5N A;  3TAE A;  1BIS A;  2O8D A;  1S1T A;  5GIO A;  3S3O A;  3R6M A;  1NK0 A;  4BRN A;  5AZJ A;  4K8Z A;  1RT5 A;  4A5B A;  1WBB A;  3CM6 A;  1KAY A;  3OYC A;  2B4J A;  3PO4 A;  3GBT A;  4M45 A;  3WQU A;  3DRR A;  3CQX A;  1EKE A;  4LD0 A;  2IC3 A;  2IS3 A;  1RBR A;  3J80 O;  4Q0B A;  4BRD A;  4FJH A;  1SKR A;  1ZXO A;  4LFA K;  1BQM A;  2J4R A;  5CZ2 A;  3PV8 A;  4LFC K;  1R59 O;  2F8S A;  2HHQ A;  1C0M A;  1LWE A;  4AF1 A;  3AVC A;  3THX A;  1Q81 O;  3ENB A;  2CGJ A;  3MXM A;  3MED A;  2HNY A;  1GLD G;  2CGL A;  4KKO A;  5E41 A;  4CEE A;  5CYM A;  1UOC A;  1UWB A;  5GAD P;  3LDO A;  4R5P A;  5J2N A;  3AA5 X;  4CIF A;  3SBT A;  1YF5 L;  1P8Z A;  3UKU A;  4MDA A;  3V81 A;  1L3S A;  1C1A A;  3OJU A;  5I3U A;  4OVL A;  4E7L A;  1ZBI A;  1J54 A;  4FJJ A;  3VQA A;  3I0R A;  1RBS A;  3MWP A;  4GMJ B;  3CCU N;  2P9S B;  3K5L A;  4E0D A;  4M3Z A;  1NK8 A;  3C6H A;  4AHU A;  3QFP A;  3PO5 A; 
#chains in the Genus database with same CATH homology
 2IGI A;  4OKK A;  4DF8 A;  2EX3 A;  3NGI A;  3TAN A;  3BDP A;  4M3X A;  2Z1J A;  1RDD A;  1CXQ A;  2DFE A;  3AA3 A;  4CFC A;  3TAG A;  1I39 A;  2YNH A;  4W5T A;  4PY5 A;  1BQN A;  4F3O A;  1NKC A;  4M3U A;  3QEV A;  2IOC A;  5C42 A;  5J2Q A;  4IFY A;  1RDB A;  3KK2 A;  4KPY A;  4CHZ A;  2BE2 A;  3LWM A;  3VQD A;  4KB1 A;  4FLX A;  4CJ4 A;  1BIU A;  1CXU A;  1IKV A;  1EP4 A;  4O0I A;  3VQE A;  3DM2 A;  4ZHR A;  3KLH A;  1DTT A;  4E1N A;  2WOM A;  4KO0 A;  4CJ5 A;  3AV9 A;  1HQU A;  1ITG A;  4RW6 A;  4KRF A;  3HPG A;  3LP2 A;  1HYZ A;  4J2E A;  4E7J A;  4KHW A;  3QIP A;  4DTX A;  4OKE A;  3MXI A;  3LAN A;  4ZTF A;  1ZYQ A;  3SJJ A;  4KAZ A;  4ZTJ A;  1NOY A;  1HYS A;  1A5X A;  2HHQ A;  1WN7 A;  5J2P A;  1TKZ A;  4CEC A;  4NCG A;  4DTS A;  3S3N A;  3AVK A;  1L3V A;  2PZS A;  4NCA A;  3V9X A;  4OPK A;  3NCI A;  2NUB A;  1HYV A;  4DTO A;  3CM5 A;  1TKT A;  3L2W A;  1BI4 A;  1EET A;  1HNV A;  4DWI A;  4OGE A;  3NE6 A;  4CGJ A;  3ZT4 A;  2OZM A;  1VSH A;  1BCM A;  1U04 A;  1HPZ A;  1W9H A;  2OPP A;  3B6P A;  3NH0 A;  4N41 A;  4N76 A;  4RW8 A;  4BE0 A;  3SCX A;  2BDP A;  2EHG A;  5KGX A;  4O55 A;  2BGG A;  4Y1C A;  4C8M A;  4FXD A;  4DTM A;  1NKB A;  2X74 A;  4EP4 A;  3DLR A;  4DS5 A;  3DRS A;  3HVT A;  3VQP A;  1IKY A;  2Y1I A;  1QE1 A;  4M3R A;  3ZT0 A;  3RMB A;  2PYL A;  1BCO A;  4CF8 A;  3A2F A;  1MU2 A;  1C6V A;  1D5A A;  3G0Z A;  3JYT A;  3CFR A;  1T05 A;  3SQ0 A;  3AO5 A;  3BGR A;  3TAR A;  3RMC A;  4AHT A;  4OLA A;  1REV A;  4CK1 A;  4J2B A;  3P5J A;  2Z1H A;  3V9W A;  3THV A;  2GUI A;  4Q5V A;  3VQC A;  4AHC A;  4DG1 A;  4CEB A;  1JLE A;  3PUF A;  4IG3 A;  3ZT1 A;  2ZQB A;  4FJL A;  2YNG A;  3QEX A;  4CE9 A;  2FBV A;  5FRM A;  5C24 A;  2P5O A;  4CHN A;  4FZX C;  1RT2 A;  3QO9 A;  4E19 A;  1RBT A;  2XY5 A;  1KRP A;  3P83 D;  4PQU A;  1TK8 A;  3K58 A;  1JXE A;  1TK5 A;  2ZD1 A;  1VSD A;  3NF8 A;  1N6Q A;  4IBN A;  1TKD A;  4J2D A;  4FZZ A;  1JL2 A;  2JGU A;  5I42 A;  1S5J A;  3MXJ A;  1QSL A;  1S6Q A;  2Q3S A;  3CYM A;  3VQB A;  3OY9 A;  5HRS A;  1T03 A;  1IH7 A;  1X1P A;  2G8K A;  1KFS A;  4EZ9 A;  3ISN C;  4O0J A;  2A1R A;  3QES A;  4JLH A;  3HO1 A;  3SPY A;  4L8R B;  3RMA A;  2FBY A;  1WSE A;  3ASM A;  3KKR A;  2R7Y A;  3SPZ A;  1X9W A;  3HP6 A;  2DFH A;  5CY4 A;  4CED A;  4DSK A;  3RR7 A;  1KLN A;  1JKH A;  4Z4I A;  3HL8 A;  3NF7 A;  4KRE A;  1JL1 A;  3M8P A;  4O4G A;  3HPO A;  2YHB A;  3DLK A;  3OYF A;  4DQR A;  3ZSR A;  1L3U A;  4FM0 A;  1VSK A;  2HHW A;  1UAX A;  3QNN A;  1BHL A;  1IKW A;  1QS4 A;  3LP1 A;  3G10 A;  1HNI A;  4EZ6 A;  3VQ6 A;  3AVA A;  5HBM A;  3LDS A;  3KTQ A;  1NK6 A;  2G8I A;  1BL3 A;  1JLG A;  1IKX A;  2HHV A;  3VQ7 A;  1TAQ A;  3OVN A;  3OS2 A;  1RT6 A;  1U4B A;  3LP0 A;  4CEF A;  2DTU A;  1WAJ A;  3M8R A;  4DFK A;  2XY6 A;  1XHZ A;  2KFZ A;  5HRN A;  3TAB A;  4RW7 A;  1FXX A;  3U3G A;  4E7I A;  1QQC A;  2FC0 A;  3SYZ A;  4ID1 A;  1KFD A;  4I9L A;  4DQS A;  1ZBF A;  4CJV A;  1WLJ A;  4CJ3 A;  4FM1 A;  2OZS A;  1RIL A;  3ULD A;  3U6F A;  4FW1 A;  2PYJ A;  4CER A;  2HHS A;  1L5U A;  3OYK A;  1SKW A;  4CK3 A;  3WNH A;  4B9L A;  4CHQ A;  2YV0 X;  2RKI A;  1RT1 A;  2LSN A;  4RG8 A;  4FLU A;  4KHY A;  4MQ3 A;  3OYA A;  2HHT A;  1YVU A;  5JS1 A;  3SQ2 A;  1CZB A;  3CQ8 A;  4CGH A;  3DLH A;  5CZ1 A;  4LY7 A;  3HXM A;  2Y1J A;  3S9H A;  5HP1 A;  4DQP A;  3L8B A;  1NK7 A;  2HVI A;  2KTQ A;  4Y1D A;  2BAN A;  2P5G A;  1CZ9 A;  4CK2 A;  4F2S A;  1LAW A;  2QKB A;  1S1W A;  4E7H A;  1ZBL A;  1VSL A;  1CLQ A;  4C8N A;  3S3M A;  2RPI A;  1DTQ A;  1WAF A;  1ASU A;  4PA1 A;  4W5Q A;  3HT3 A;  3VA0 A;  4KI6 A;  3NDK A;  4YNQ A;  4HHT A;  1LWC A;  1ASW A;  1YT3 A;  3CG7 A;  3AO3 A;  1SKS A;  1NKE A;  4CGF A;  3QIN A;  3I8D A;  3VQ5 A;  3ZCM A;  1JLB A;  1S9G A;  4W5O A;  4KHS A;  2AJQ A;  1LWF A;  1NJZ A;  1KVB A;  1SV5 A;  5DK5 A;  1WNS A;  4HTU A;  1U45 A;  5D3G A;  1X9S A;  2A1S A;  1RTI A;  1RBU A;  3AA2 A;  1YTA A;  1ZBU A;  5KRS A;  4CIE A;  4BWJ A;  4M3Y A;  1KLM A;  4AH9 A;  2Z1I A;  4DSL A;  4AIL C;  4B3O A;  1VRU A;  3V1R A;  3NHG A;  4BE1 A;  3OYJ A;  4B9S A;  4KHQ A;  4HUE A;  2G8U A;  4ICL A;  4DSJ A;  4JS4 A;  1A5V A;  2E6L A;  1JLA A;  5HRR A;  3RRH A;  4KHN A;  2ETJ A;  5HRO A;  1D9D A;  1C0U A;  4CJW A;  2VG7 A;  1VSM A;  3AVM A;  4BAC A;  1S1U A;  3L3U A;  3V1Q A;  4FYD A;  4DSI A;  3LZI A;  3OYI A;  1J53 A;  1C0T A;  3AVJ A;  4IFV A;  4DTN A;  3QIO A;  4CJU A;  4BWM A;  4FCY A;  4K8X A;  4IDK A;  3LWL A;  2HHX A;  1G15 A;  1VSF A;  2OPS A;  4Z0U A;  4YFU A;  3O3F A;  4EP5 A;  3KLG A;  2KW4 A;  1WSH A;  3V9U A;  4Z4E A;  5JS2 A;  4I9Q A;  4N47 A;  1TGO A;  4ELT A;  4FW2 A;  4NCB A;  3QEP A;  4DTP A;  3OS0 A;  2E6M A;  3VQ8 A;  3SZ2 A;  4TSX A;  4OKJ A;  1HRH A;  4LSL A;  4FLV A;  4JRQ A;  4DU1 A;  1B92 A;  1B9F A;  4I7F A;  3HK2 A;  4OPJ A;  3TWH A;  2D5R A;  3HM9 A;  3QER A;  1TKX A;  1LW2 A;  1J5O A;  1RNH A;  2O4I A;  2HND A;  4E89 A;  5FDL A;  1KVC A;  3OYE A;  2XHB A;  4DLG A;  1SL0 A;  3NF6 A;  4FJN A;  3M8Q A;  3VA3 A;  1RT7 A;  4E7K A;  4KTQ A;  2I5J A;  4B9N A;  4M42 A;  4RW4 A;  3QET A;  1LAV A;  3MEG A;  5J1E A;  3KK1 A;  1UA0 A;  2ATQ A;  5FRN A;  3OYD A;  3QEW A;  4QAG A;  1UA1 A;  4W5R A;  1W0H A;  1WSJ A;  3L2U A;  1JLF A;  3DLE A;  4H4M A;  4B08 A;  1FKP A;  3D0P A;  3L3V A;  4AHV A;  4DFP A;  4FJM A;  3O3H A;  1WSF A;  4KTW A;  4DFM A;  1TK0 A;  4HCB A;  3VN5 A;  4HUG A;  2G8V A;  4GVM A;  3C94 A;  1WSG A;  3OYH A;  1JXB A;  3AVF A;  1GOB A;  3DOL A;  4OJR A;  4B8C A;  3KK3 A;  3TAP A;  3AO2 A;  3F9K A;  1XC9 A;  1Q9Y A;  1Q9X A;  1T7P A;  4JS5 A;  4CEZ A;  3SUP A;  4F2R A;  5KI6 A;  4FJ9 A;  3V9Z A;  3PX6 A;  1C1B A;  2OA8 A;  2E4L A;  1GOA A;  4CF0 A;  1VSJ A;  5SWM A;  1JLQ A;  2B5J A;  3WNE A;  3O3G A;  3SV3 A;  4O44 A;  4RW9 A;  5CYQ A;  2D0A A;  2DY4 A;  1HQE A;  4DU4 A;  1RT3 A;  1L3T A;  3ITH A;  5HLF A;  4DS4 A;  3TAF A;  3V4I A;  1QTM A;  3VQ4 A;  4M3T A;  1XWL A;  1FK9 A;  2IDO A;  3AVN A;  3K57 A;  2D0B A;  2VG5 A;  4DSF A;  4ELV A;  4N56 A;  1O1W A;  4QCL A;  4B8A B;  2ZE2 A;  4CGI A;  4CFB A;  3EYZ A;  1HJR A;  2DFF A;  3SQ1 A;  3SI6 A;  4FJI A;  3T3F A;  1X9M A;  4CJP A;  4CEA A;  3AA4 A;  5C25 A;  3ZSY A;  4CHO A;  1U49 A;  3PY8 A;  4CF1 A;  3AVL A;  2PY5 A;  1D9F A;  4W5N A;  4DTR A;  4FJK A;  4I2P A;  2B6A A;  4CFA A;  3LAM A;  4Z4C A;  1KVA A;  2HNZ A;  2JLE A;  3LP3 A;  3WNG A;  3L2V A;  3LZJ A;  1RBV A;  3OYB A;  1NK4 A;  3OYM A;  3H08 A;  1NJY A;  4KHU A;  4Z4F A;  4DQQ A;  1LW0 A;  3NFA A;  3NGY A;  4DMN A;  4J2A A;  5FRO A;  2HB5 A;  2YNI A;  3MEE A;  2YKN A;  4LH4 A;  3CFO A;  3ZT3 A;  3MAQ A;  1Z26 A;  3DOK A;  3SUN A;  4FK4 A;  3DRP A;  3VQQ A;  3O4N A;  2YHA A;  3NGZ A;  4BDY A;  3UIQ A;  3D45 A;  3KD5 E;  4E1M A;  4M41 A;  4DF4 A;  1TAU A;  1IO2 A;  1BGX T;  3OJS A;  1BI4 B;  3C95 A;  2W42 A;  3LAL A;  4DFJ A;  3QEI A;  2VG6 A;  4FLT A;  4LSN A;  4CJF A;  1GOC A;  2HMI A;  2RF2 A;  2RN2 A;  3WNF A;  1DLO A;  3OYG A;  4DTJ A;  4DU3 A;  1NJX A;  1SL1 A;  2OYQ A;  4PUO A;  3ZSX A;  3SUQ A;  2OPR A;  3OYL A;  4FJ7 A;  2FBT A;  2X6S A;  3NBP A;  1JLC A;  3SV4 A;  3AVG A;  1BIZ A;  1YTU A;  3DLB A;  2KFN A;  1NOZ A;  1U48 A;  4Z4H A;  4CGG A;  3CFP A;  2XO7 A;  4FJ5 A;  4G1Q A;  3TR8 A;  3V1O A;  4B9V A;  3QLH A;  3M8S A;  4FLZ A;  1XI1 A;  3V9S A;  4PWD A;  3AVH A;  4ELU A;  3NAE A;  1EXQ A;  1HMV A;  1T8E A;  1ZBH A;  3T19 A;  4LH5 A;  1RCH A;  3HPH A;  2X78 A;  3O4Q A;  2XY7 A;  3KKS A;  4CFD A;  3HVR A;  2G8H A;  5K14 A;  3PX0 A;  4CHY A;  4E3S A;  1KSP A;  2GBZ A;  5HRP A;  1S9E A;  2KZM A;  4B9T A;  1S6P A;  2D0C A;  5DMR A;  3RR8 A;  3ZT2 A;  1B9D A;  3RWU A;  4FJ8 A;  5SZT A;  4CJS A;  3ZSW A;  1D8Y A;  2KQ2 A;  3HP9 A;  1SUQ A;  5KRT A;  2FBX A;  5KTQ A;  3SQ4 A;  1Y97 A;  3K5M A;  2KZZ A;  4FK2 A;  1FKO A;  3K2P A;  4OLB A;  2YKM A;  4DTU A;  3EZ5 A;  4CIG A;  5KGW A;  3KD1 E;  4CJQ A;  1N5Y A;  3KLI A;  1S1V A;  2HHU A;  4MFB A;  3AO1 A;  4C8O A;  4CES A;  5J2M A;  4CF9 A;  4XIU A;  1KCF A;  3DYA A;  2F8T A;  1S1X A;  2G8W A;  4FZY A;  4HCC A;  1LV5 A;  2XY8 A;  4KFB A;  3ALY A;  3T1A A;  4CJL A;  2O4G A;  1QHT A;  4FLY A;  1RDC A;  4CEO A;  1F21 A;  3OYN A;  4O5B A;  3U3Y A;  4DLE A;  3HJF A;  4F3T A;  5T7B A;  3E01 A;  3AVI A;  3RMD A;  1RDA A;  3KLF A;  4CCH A;  4AHS A;  4NYF A;  3C6T A;  3FFI A;  3P1G A;  2XRI A;  4GW6 A;  4HVJ A;  3SNN A;  2G8F A;  3MEC A;  3KIO A;  4ID5 A;  3IAY A;  3L2Q A;  3L2R A;  4IKF A;  1R0A A;  1K6Y A;  1VSE A;  3DLG A;  3IG1 A;  4BDP A;  1TL3 A;  4I2Q A;  3B6O A;  3AVB A;  3HYF A;  3K5N A;  1VSI A;  3TAE A;  1BIS A;  1S1T A;  1ASV A;  3F73 A;  4AHR A;  3S3O A;  1XHX A;  3AO4 A;  1RTD A;  1NK0 A;  2ITG A;  1TL1 A;  4FJG A;  3HST B;  4IG0 A;  3DMJ A;  1U47 A;  1VRT A;  4K8Z A;  4DQI A;  1EX4 A;  1RT5 A;  4QOZ B;  3CM6 A;  4CJT A;  5EU7 A;  3OYC A;  3IS9 A;  4CJK A;  4WE1 A;  2Z1G A;  2B4J A;  4Z4G A;  3PO4 A;  1A5W A;  4FK0 A;  1C1C A;  4FM2 A;  3PX4 A;  3QNO A;  4M45 A;  3DRR A;  4LD0 A;  1EKE A;  3V6D A;  1NK9 A;  4NYN A;  2IC3 A;  3NH2 A;  2IS3 A;  3JSM A;  4N5S A;  2QXF A;  4KB0 A;  1KTQ A;  1VK0 A;  1RBR A;  3SUO A;  4HUF A;  3ZSV A;  4C8K A;  4OGC A;  3NH1 A;  4Q0B A;  3IRX A;  3RTV A;  2X6N A;  4BDZ A;  3TAQ A;  3EY1 A;  3ZSZ A;  4FJH A;  1SKR A;  4C8L A;  3LAK A;  1BQM A;  5CZ2 A;  3PV8 A;  3DI6 A;  2F8S A;  1Z25 A;  4CHP A;  4CJR A;  4JRP A;  3LPU A;  1C0M A;  1LWE A;  2YNF A;  3LPT A;  4CF2 A;  2IAJ A;  3AVC A;  4H8K A;  3KLE A;  3NF9 A;  4F4K A;  2WON A;  4FJX A;  2P51 A;  1SL2 A;  4BE2 A;  2QK9 A;  4B9U A;  1WSI A;  2HW3 A;  2HVH A;  1RTJ A;  3MXM A;  4DSE A;  1RT4 A;  3MED A;  2HNY A;  2VWJ A;  2QKK A;  3TI0 A;  4KI4 A;  1I3A A;  1J9A A;  4KKO A;  4KTZ A;  3I0S A;  3TAM A;  1RTH A;  4CGD A;  4FLW A;  1Q8I A;  4B9M A;  5E41 A;  4CEE A;  1NJW A;  3K5O A;  5CYM A;  1TV6 A;  1UOC A;  2OPQ A;  1UWB A;  4R5P A;  3C6U A;  5J2N A;  3AA5 X;  4CIF A;  4M3W A;  2F96 A;  3KJV A;  3K59 A;  1IG9 A;  3VQ9 A;  1QSS A;  1QSY A;  4F8R A;  4H4O A;  3ZSO A;  3V81 A;  1C1A A;  3OJU A;  5I3U A;  4OVL A;  4E7L A;  2P1J A;  2VWK A;  3OS1 A;  1L3S A;  1ZBI A;  1J54 A;  4FVM A;  4FJJ A;  4CEQ A;  3VQA A;  3RRG A;  3I0R A;  1NK5 A;  1RBS A;  4GMJ B;  3ZSQ A;  3K5L A;  4E0D A;  4CJE A;  1TVR A;  4M3Z A;  1NK8 A;  4AHU A;  4KV8 A;  4UQG A;  3PO5 A;  2GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...