4GV3A

Structures of lassa and tacaribe viral nucleoproteins with or without 5 triphosphate dsrna substrate reveal a unique 3 -5 exoribonuclease mechanism to suppress type i interferon production
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
207
Chain Sequence
GAMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*(GTP)P*GP*GP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
total genus 58
structure length 207
sequence length 214
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gv3A01
4GV3A 4GVEA 3Q7BA 3MX2A 4GV6A 3MX5A 3Q7CA 3MWTA 3R3LA 4FVUA 3MWPA 4GV9A 4G9ZA
chains in the Genus database with same CATH superfamily
3V9XA 3HK2A 3R8EA 3UKRA 1LWEA 3AVAA 2A1SA 2VG7A 2IVPA 4ILHA 3V4IA 4AHRA 2CH5A 3L4IA 2G8IA 1QQCA 3FR0A 3LALA 4WFBL 4QS7A 4JD2B 4MDAA 4YOWA 4FLYA 3KD1E 1J5EK 4YOUA 3MN5A 3VQ7A 2NRWA 3AO5A 2QK9A 4KAZA 1RGIA 3O5BA 3R3LA 4M3RA 3AA3A 1DT9A 3VEZA 4PY5A 2HHSA 4O5BA 2G8KA 3J7AP 1VSMA 1HMVA 3PSFA 1OH6A 3E9LA 3JS6A 4CIGA 3DLLL 2YHWA 5BR9A 4KHNA 3MK6A 1S5JA 4CJPA 1NOYA 2P9SB 5C2FA 2P9PA 5BPMA 2G8HA 2P9IA 4OPJA 3HM8A 4RTFD 3PV8A 2AJQA 1OVYA 1WOQA 1QSLA 2KFZA 2F4VK 3LDLA 2QTDA 3I0SA 2NRTA 3VPZA 3AO1A 2O8FB 2NUBA 3RMCA 4NLCA 1OKJA 3AVIA 4A59A 3P1GA 4OPAA 3NGIA 3O3GA 4JI0K 2HBKA 1RDBA 4L3QA 1ZC6A 4BRNA 4E7LA 4CW7B 4DUZK 4W5QA 1Q18A 3THWA 1VSJA 4KI6A 1HRHA 3R6MA 1XC9A 4HHTA 1W0HA 5HOOA 2WTUA 4BRQA 5AQQA 3H46O 3K57A 1N36K 1Q7YO 3LWMA 4FSVA 2XY8A 4LF4K 4A61A 3AVKA 5CZ1A 1HQUA 4CF2A 3VEXA 2HNZA 4WQ4C 1U2VA 3CCQN 4B1XB 4QAGA 2IVNA 2G8WA 1C0FA 3MCPA 3B8AX 4Q5VA 4DR6K 5SWMA 3CD6N 4PA1A 1GLDG 5BN9A 5FPMA 4IWVA 4B9TA 1S6QA 2KFNA 1CLQA 2VWKA 2FSKA 1RBRA 1ZXOA 3ZEUB 1NGFA 1HLUA 2FF3B 2GV9A 5BREA 1SAZA 3C6TA 3A5MC 1A5VA 4DV4K 1KD1O 3OYKA 1NKBA 4LH5A 2WC9A 4WE1A 4BVPA 3NE6A 4BG9A 3QBWA 2ZJRL 3VGLA 3BP8A 2DFHA 3KK1A 3J7YP 4DSJA 4DR7K 1RBVA 1RT6A 4PQUA 4ID5A 4M3WA 3PO5A 3QEVA 4OLAA 3CJCA 1S9EA 3WXIA 3KLGA 1B92A 3CCMN 2D0PA 5JMVA 4GVMA 4CEBA 2ASOA 3CC2N 2E2NA 4LFAK 4E1NA 2GELA 3P39A 3NVKA 1KVAA 5F1XA 1Q82O 1GLAG 3AGRA 4X62K 3ZX2A 3CM6A 4IFEA 1GLBG 3P31A 4IJAA 5E84A 3O4WA 5J2NA 4QS8A 3FZFA 4M3YA 4F2RA 1Q9YA 4FZXC 4NYFA 3CJ1A 4LF7K 5K14A 4AHVA 5AZIA 5KQDA 1D5AA 1VQKN 2BDPA 4IEEA 1S1TA 1WSIA 4CHPA 5F0XA 1KSPA 4X65K 1RNHA 1NLVA 1JKHA 3KKSA 1C0TA 4DV6K 4DV0K 4AHTA 2P9KA 3HO1A 4DUYK 4B9LA 4H4OA 3ZYYX 5CYMA 5AQJA 4DMNA 3FZLA 2HMPA 4KHUA 4JRPA 4BRHA 1LOTB 5CY4A 4EP5A 3D7EO 2OPRA 4B3MK 3HTVA 3DLGA 4EAHD 3CXCM 4W5NA 3CERA 1VSHA 4DV3K 4XIUA 2Q3SA 2QWQA 1RILA 4H0PA 4DSIA 5GIOA 3L2UA 3OJUA 4CJ3A 2WONA 5M1QA 2YHXA 3HSCA 1TKTA 2KQ2A 3CF5L 4KREA 4DKWA 1RT3A 3UB5A 3SV4A 4BRGA 2P9LA 4FXDA 4FJNA 4JLHA 3PX4A 3HPGA 4OO1J 3O1WA 3V9UA 4J8FA 3WNEA 1EKEA 4BR9A 1X9MA 3PUFA 1MU2A 1NK0A 3HZ6A 4ISGA 3ENHA 3VTHA 3RWUA 2BH1A 4CGHA 4FM1A 5KPRA 1REVA 3DAWA 4E7JA 4FK2A 5KGXA 4XEIA 4UQGA 5T7BA 4JRQA 2PY5A 4WQ5C 3K58A 3I55N 2Q0UA 1NK6A 2D0CA 5EXWA 1JXBA 3NCIA 3DLRA 3W0LA 3DMJA 2D5RA 2NRHA 4H0YB 3AAQA 3CMEN 3ENBA 1U6ZA 3ULEB 4MO5A 4DTSA 3EZ5A 4CJWA 3MX5A 3T1YK 3HL8A 4PL7A 5SZTA 1RBSA 1EETA 2YCHA 3FFKB 4JI5K 4DR2K 2NNWA 1MA9B 3ID8A 4PL8A 3VQQA 4A62A 3FGUA 3WNGA 4B9SA 1MWMA 3I33A 4YNQA 4CZHA 5BN8A 2QM1A 5HRRA 2OZMA 5FRNA 4CEZA 5C0YA 3NBPA 3P38A 2OTLN 2ZWHA 2W6LA 1BIUA 4CJ7A 4PHTX 2GTDA 1EX4A 1Q81O 5GINA 1QE1A 1YVNA 1GOAA 3PX6A 4Z4FA 3NF9A 4HVJA 3HVRA 2ZF5O 1WAJA 4FJJA 3OS1A 3NH0A 4FW1A 4CJEA 4JI8K 1SKSA 4E7KA 4A2BA 3AVHA 3O80A 3NH1A 4KHYA 1YTAA 4FZZA 3RSEB 3ZCMA 5DK5A 1VQ9N 1XMQK 2BUPA 2Z1HA 3DLKA 1BHLA 1DTQA 5C2DA 4K8ZA 3T1HK 1XHXA 3U4LA 1X9SA 1GLLO 4IBNA 3VA0A 3V9ZA 4B8CA 3CQ8A 3P83D 3CFPA 3CCVN 4JKAA 4M63C 3ULDA 1NBWA 3C0BA 4BQZA 3DRPA 2HVIA 3L3UA 4CE9A 5KRSA 4DQPA 4FJMA 2ZGZA 1QVFM 1QQNA 4KV8A 1BGXT 1VSIA 3A5NC 4X64K 4IG0A 1EWRA 4CJTA 3ZETB 1CXUA 3ZT3A 4W5OA 3RRHA 3OVNA 4EIAA 4DQRA 3A0IX 3LANA 2DTUA 4A57A 3WXJA 3BUZB 1BUPA 5EVZA 4BC3A 3IAYA 5AQYA 4K42A 1IKYA 2FSNA 2RHKA 1C1CA 4CF8A 3CFRA 3ZSZA 1V4SA 1IV0A 1LW0A 3NGYA 4HTLA 1HNXK 3T7ZA 1WLJA 3VQDA 4IOCL 3IMXA 5CZ2A 2YX6A 5EX5A 1C0MA 1Y97A 3LM9A 3LAKA 3OS2A 5AQPA 3AVBA 4IDKA 3M8RA 5AQIA 1DGKN 5HRSA 3OS0A 4YOTA 2Q31A 3C94A 3EE9A 4OJRA 3ASMA 1T6CA 1JCGA 1YAGA 3TSQA 1U49A 4DSKA 4RW7A 2FF6A 4MFBA 3DOKA 3OY9A 4IO8A 2OZSA 1VSLA 3ZX0A 3PX0A 4CJUA 1NJZA 1TK5A 4MLHA 4Y0WA 2NLXA 4F3OA 2X78A 4ILGB 4CESA 1BDGA 1ASVA 3OHRA 1TL3A 1E3MA 3SI6A 3VQ8A 4I9QA 3QESA 2PAVA 2RF2A 1NKEA 1YJWN 1BCMA 3KLIA 1IJJA 5GIPA 3SMSA 3THYB 1WSEA 5ADXH 5AJ3K 2GWJA 2CGJA 1K9MO 3O9UA 1E4GT 2QA4N 3AA2A 1NK8A 2D0AA 5FROA 1GLEG 3A2FA 4M7XA 3MWPA 5DM6L 2NRXA 2YNFA 3D2EB 4IG3A 1S3XA 4RW8A 1YJ9N 3MXMA 3CCEN 3WUHA 4JKGB 2VWJA 1MWKA 4H0OA 5M1NA 4GMJB 4JI3K 1RT2A 3ISNC 1K73O 4FLUA 3MECA 3DRRA 2BTFA 4CZLA 3KWGA 1UOCA 2BE2A 1SL2A 4B3SK 1X9JA 3U8XA 1QQOA 1JLBA 3G0ZA 3O8MA 3T1AA 1BO5O 4O8UA 4CHNA 3G6EN 4BRDA 1H1VA 1WBBA 5M1OA 1T05A 1ILYA 2QKBA 3TU5A 1K8KB 4BRKA 3ZLJA 3ATVA 4DSLA 2VG6A 3QO9A 1M1KO 3OTOK 3A5OC 3CJAA 1T03A 4B9VA 3UKRB 4BR7A 1KAXA 4YDUC 4DF4A 4FWQA 3SAFA 2XY5A 1Z26A 1NU0A 1E4FT 4DQQA 4H03B 4FOIA 3WXKA 4J2BA 3MX2A 3VEWA 2D0OA 3NH2A 4CJRA 3TAPA 2YNIA 1IO2A 2IDOA 1SV5A 1A5XA 3MEDA 1RDCA 3TTCA 4DV7K 5C10A 3EL2A 3LWLA 5GAGP 2WBNA 3WT0A 1IBKK 1RBUA 3GDQA 3K5MA 1RFQA 3CYMA 3MDQA 4DTUA 1EXQA 1FJGK 5I9EB 4CJSA 3AVMA 4YOYA 5AQUA 3TAQA 4CGDA 3SQ1A 4BROA 3MN7A 1ZBLA 2P9PB 2P9IB 2P9NA 3S3OA 4CEDA 2V51B 4ZTJA 4LFBK 4ISEA 2XY6A 1BA1A 1S22A 4C8OA 4JKCA 3LP3A 4DV1K 3WEEA 1RT7A 5BRDA 4CBUA 4Y1DA 2HSTA 4IJNA 1KVCA 3MCAB 3QBXA 4ID1A 1QQMA 4DFPA 1C6VA 2Y1JA 3M8SA 3EE8A 2UYTA 1X3NA 5DM7L 1NKCA 3L2WA 3S9HA 3WXMB 4FW2A 2KZMA 4OKEA 4B08A 1L5UA 3QERA 3CCSN 3QDKA 4Z4EA 3UKUA 1N34K 3GE1A 4KI4A 2WFBA 2PYLA 5A2QO 1QHAA 2HHWA 1RDAA 5HL7L 2DFEA 5AZJA 1LWCA 1FXXA 3VQBA 2HNYA 3L8BA 2BGGA 1BL3A 3TANA 1QZ5A 1FKPA 3NMUA 1U2VB 3EY1A 4GV3A 3L2VA 3AVGA 2F9TA 2Z1JA 3P5JA 3VETA 4CEQA 3IUCA 3KKRA 1W97L 4GY2B 2W40A 2F8SA 2P51A 3T3FA 4NB4A 3PY8A 3OBYA 2FBYA 5M1PA 1NGDA 5FPNA 3T69A 1VHXA 3VMFB 1TL1A 4BDZA 2NRVA 3V9SA 1NJYA 2ZD1A 1BWFO 1XHZA 2HW3A 1DKGD 3AVJA 4C8KA 3O6WA 3ZX3A 1P90A 3THXA 4BR2A 2AA4A 2HHQA 2OANA 4FWPA 1HJRA 3C6AA 1K6YA 4CFCA 1BIZA 3QEXA 4BC5A 4FWLA 3FFIA 1JLFA 3G4SN 4OLBA 1W7AA 4M3ZA 3HOTA 4BE0A 3K59A 1WB9A 2O8DA 2HHXA 3LM2A 4JKDA 3K9KA 2NRRA 2O8EA 1T3VA 4OKJA 5C15A 4KHPK 2XRIA 2GUIA 4J2AA 2YI1A 1YI2N 4W5RA 1LV5A 2QXLA 4JS5A 3VESA 3O3HA 3NDKA 3RMAA 3NF8A 3VEOA 4JYAK 4FWKA 3RR7A 2HB5A 3AV9A 4F4KA 4BDYA 2YHAA 1IH7A 4CHOA 1C1AA 3EZWA 3JXUA 3VEVA 1TVRA 3RR8A 5JVHL 5AZIB 4JK9A 3KK3A 5I3UA 4OPHA 2B4JA 1Z05A 4DWIA 5E26A 3HT3A 2KW4A 3TAGA 4CVNE 1HUXA 3VERA 2YHBA 2P9KB 4BC4A 4I6MA 3U6FA 1N33K 4CK2A 4Z4IA 1BI4A 4CFBA 4AHUA 5LMNK 2HHUA 4E3SA 2IC3A 5KPTA 1BCOA 4DF8A 1R0AA 4E0DA 3QLHA 4NCAA 4GVEA 1NGGA 3ZSWA 5AQKA 1NK4A 3GL1A 4NYNA 2E6MA 1S1WA 1N32K 3PIOL 4YHHK 2A42A 4EFHA 2HHVA 3EKUA 4AHCA 4DR4K 1JL1A 4WQ5A 3DOLA 3V81A 3TSUA 4DTMA 4J2EA 4C1NK 2P9LB 4CGIA 4LC9B 3LP1A 1BG3A 3SJHA 4FWNA 3OYBA 4BRMA 3LZJA 4UY8O 1HNZK 4KPYA 1HKBA 3D0PA 3FZKA 1G15A 1J53A 4B3TK 4CGFA 2ITGA 4M42A 4FJ8A 4A5AA 1GLFO 1NOZA 1TYQA 1ZBIA 1NNEA 3F9MA 4OKKA 4BR4A 1EP4A 2F8TA 3H08A 1HKGA 4KRFA 3I56N 3KTQA 5BR8K 3WNHA 3SAGA 3CG7A 3O9SA 3D6RA 1SQKA 1A5WA 3KJVA 3GG4A 3M1FA 3I8BA 1OH8A 3LP2A 5EY4A 3QMLA 1WBDA 3CMAN 3SLCA 4AM7A 4OGCA 5C25A 3VENA 5EU7A 2QWOA 4KB0A 4K0KK 4H4MA 2IVOA 2XY7A 2B5JA 3BF1A 2VCPA 1U45A 2X74A 3AO2A 1MDUB 4LSNA 4DSFA 1NGAA 4CF9A 4DTNA 3OA9A 3IDHA 1C0UA 3TR8A 4B9MA 1SKWA 2QWRA 1T8EA 3HP6A 3SPZA 3QEWA 4DS4A 3O9RA 4DTJA 2OA8A 3L2QA 3K5OA 4G9ZA 4MLEA 4JI6K 3CPEA 4I2QA 3R9PA 3LPUA 5BRHA 3SMPA 2D1KA 5LJVA 2P9UA 3HVTA 1SKRA 2A6AA 4MQ3A 4FVUA 1GLJO 4YOXA 4DTXA 1NGIA 4B1WB 1HYVA 3V1QA 3BZCA 3HP9A 4CGJA 4KHSA 4O5FA 4CBXA 3HOSA 1BU6O 4DTOA 3E01A 4E19A 3BDPA 4QOZB 2QWLA 2YHYA 3E9OA 3SUOA 4LF6K 5HROA 4N5SA 3U9DA 4XH4A 4I9LA 3C7NA 3CJ7A 1YTUA 4BRCA 1KLMA 3BEXA 5KI6A 1SL1A 1HYSA 2Q97A 4OVLA 4JNEA 3V6DA 1QSSA 4B3RK 4FVMA 4B1UB 4FPBA 1JCFA 1KRPA 4V19S 4FJ5A 5CYQA 1NM1A 1ATSA 3O9TA 4K8XA 3CPWM 4K43A 4JKHA 4Z4GA 4CBWA 3ZT2A 3CC4N 1BQMA 4A2AA 4B1VA 3CCUN 4NXNK 1IKXA 3AAPA 5F2RA 3MEEA 4BRLA 5AQHA 2YNHA 4EHUA 1CZ9A 1RTIA 1CXQA 1RBTA 3C6HA 3SNNA 3TI0A 4FOEA 4O8KA 4JKEA 4CF1A 4CGGA 1TKDA 2E2OA 2P5OA 5JVGL 3T19A 1NGHA 3TAFA 3RTVA 3IG1A 1NK7A 1VQNN 3KLEA 5AFUH 4CZIA 4FCYA 1KTQA 5J2MA 3H6EA 3M3ZA 2X6SA 1X9WA 2WOMA 4F9OA 3MXIA 4FK4A 1JL2A 3KK2A 1WUAA 4JHDA 1IBLK 4LF9K 4CF0A 3OYCA 3QEPA 3PLAA 1VQ5N 3VTIA 1LAWA 4CK1A 4PKHA 3M6GA 5AQTA 3J7ZO 4H8KA 2KLAA 1HJOA 4CHQA 3H3OB 2KTQA 1KQSM 3H1QA 5J2QA 4E7HA 1T6DA 3KIOA 3SUNA 3J8AA 3LDNA 4M3UA 3LDPA 2W41A 4FWOA 5C12A 1R59O 1TGOA 5AFUA 2IGIA 1ZYQA 1TK8A 1M90O 1NMNA 2E2QA 2HF4A 3MAQA 1VSDA 2HVHA 4RW4A 5HBMA 4IXCA 2OPPA 3VQ9A 4CJFA 3VGMA 3E66A 4RW6A 4Z4CA 3P4IA 3DXKA 4FJLA 4BRPA 4CEOA 3QETA 3R1XA 2UUBK 4OX9K 3CIPA 1D4XA 1VSEA 1UA0A 4YDUA 1U48A 3G71N 3OYDA 2WUSA 3IFRA 1VQ8N 3D2FA 1UWBA 4DLEA 1UAXA 4O0JA 3KHYA 2XO7A 3NF7A 1XNRK 1TKZA 3VQPA 4DU3A 1WNSA 3NAEA 4YORA 5AQLA 4KBOA 2JLEA 1ATRA 2UXCK 3HI0A 4EZ6A 3DLEA 4NLBA 1VQ7N 5I42A 2A1RA 3I0RA 3L6QA 3SK3A 1JXEA 3SQ0A 3K2PA 4DU4A 3QNNA 5MLCQ 1TUYA 3L2RA 4PWDA 5M1KA 2IAJA 2IIRA 1O1WA 4FL9A 4U67L 5LMUK 5TKYA 3CI5A 2O4GA 2H3GX 1J6ZA 1V4TA 1WN7A 1HPZA 5FRMA 1J5OA 1FKOA 4ILJA 5AQFA 3ZSVA 1LWFA 2QWPA 4X66K 1L3TA 4HTUA 2DY4A 3DRSA 4DQ8A 1RT1A 4CIFA 3HBTA 4DQSA 5TKWA 4RCHA 3AA5X 1I3AA 3M8PA 2JWKA 4H5VA 2E2PA 2I7PA 3TTFA 5BPNA 3OW2M 1HNVA 4BRFA 1VQ6N 1ASUA 3CQXA 2P9NB 5LY3A 3DJCA 1RCHA 3HRGA 4H5WA 4JS4A 4FWSA 4C8MA 1SL0A 4BREA 3WEEB 1S9GA 4CFDA 1VQMN 4E1JA 2OYQA 5D3GA 1NMDA 2KKZA 4KFBA 4CZKA 4YFUA 5IWAK 1IKWA 1X1PA 5AQZA 4E1MA 3LDSA 4GKKK 4H0TB 2BANA 4IZ9A 4IEIA 1JLAA 4JK8A 1KXPA 3DXMA 4CHZA 4AM6A 3EEQA 4AH9A 2FLOA 3UKUB 4YOVA 3ZT1A 2J4RA 2NZTA 3M5RA 3OYMA 3TAEA 5M1FA 4IFVA 4JKBA 4CZFA 2ZGYA 4FLTA 1VSFA 3ZT0A 3OYJA 3EYZA 5AZJB 4B9QA 4Z4HA 2UXDK 1QS4A 1IBMK 4CJ4A 2YV0X 2Q0RA 4DS5A 3IRXA 4I7FA 1NGBA 4H5NA 3E1YA 3OYEA 4ZHRA 4DLGA 2YNGA 1K8AO 3C65A 2O8BA 3SCXA 2RPIA 3THVA 4WQ4A 3WXLA 2Q1NA 3ITHA 1YT3A 4LF8K 4M41A 3NGZA 1RDWX 3THWB 1TUUA 1BOTO 3VF6A 1HR0K 1YXQA 4HUFA 5ELZA 4FO0A 2D4WA 5C24A 3THXB 4DHYA 4Z94A 2R7YA 4CD1A 1CZAN 1Z25A 1XNQK 3EKSA 4IDHA 2O8CA 1KAZA 4XH1A 4NCBA 2VGMA 1IG8A 1RTJA 4FK0A 3PSIA 1XUPO 4O4GA 2JGUA 3KWIA 4G1QA 3DYAA 3U3GA 1L3SA 4AQYK 2O8DB 1VRUA 2QXFA 3LAMA 4JKFA 3OYNA 4FLVA 4QCLA 3IS9A 2O8EB 3DLHA 4KO0A 3KLHA 3SUQA 4IOAL 1UA1A 3AARA 3NFAA 2E5LK 3CJ9A 2PZSA 5AQXA 3U3YA 1YVUA 4KTZA 1GLCG 3MEGA 1XQSC 4DQIA 4JD2A 3L0QA 3DM2A 3TAMA 2EX3A 3NVMA 3Q7CA 5C42A 3AVFA 3TPQA 4FM0A 4JAXA 1IG9A 2E20A 3UIQA 3LL3A 2DPNA 2P5GA 2V52B 1W2BM 1SUQA 2Y1IA 1KAYA 1KVBA 1OVQA 1SZ2A 3G10A 2KHOA 4O55A 4FJGA 1NJIO 2RN2A 2P9SA 4A5BA 3ATUA 2GUPA 1NGEA 4I6MB 1HPMA 1BI4B 1HKCA 3LDOA 4AILC 1XWLA 1S1VA 3F5TA 3H3NO 1RTHA 5AR0A 1RDUA 4JI2K 4XH5A 2HBLA 1ITGA 3PIPL 4WCEL 3QFUA 3QNOA 3MN9A 4DSEA 2O8FA 1B9FA 2E4LA 4KH5A 4RG8A 4CJQA 2UXBK 4ELTA 4EHTA 4M3TA 3JYTA 1ASWA 5EOYA 3DWLA 4ISFA 2VQFK 4I2PA 4GW6A 3SBTA 3WNFA 4FLWA 2IOCA 5HRPA 4BGBA 2FXUA 3WQUA 4AF1A 4DTRA 1S1XA 1I39A 3EN9A 4BRIA 3K5NA 4WF9L 3G25A 1YF5L 1VQLN 3OJSA 3AO4A 4FYDA 4MO4A 1NK5A 4K41A 4KTQA 3QINA 1OH7A 1KC8O 1WSGA 4H0VB 4JI1K 4CJVA 1WSHA 2V7YA 2DFFA 2UUCK 4DU1A 3NHGA 3F9KA 3J81O 4O0IA 3VOVA 4Z0UA 2HHTA 1TYQB 2A3ZA 5JICA 3SUPA 1WAFA 5JLHA 3B6PA 5HRNA 2GWKA 3OYFA 3BZKA 4C8LA 2Q36A 5FPDA 3K0SA 3VQAA 3GOIA 1VAZA 1QZ6A 1SS6A 3HJFA 1RT5A 1HYZA 1Q9XA 3B6OA 4K25A 3GBTA 1T7PA 3L3VA 4CZGA 4KH6A 3QIPA 3ZEUA 4L8RB 5AQGA 3BF3A 4OPKA 1QHTA 4BDPA 3LPTA 5J1EA 4ELVA 3C95A 3SAHA 3CCRN 1NK9A 2OPSA 1JLCA 2VQEK 2B6AA 4FJ9A 4CI6A 3SBGA 5AQNA 3WQTA 2E6LA 3VQCA 2E88A 1QTMA 4MDBA 3QIOA 4M7YA 4DFJA 4ICLA 1S6PA 3K9JA 1TK0A 5BRFA 1C1BA 2P9UB 1S72N 2FBVA 2KZZA 2A5XA 3JSMA 3MXJA 5CR4A 2UUAK 4GV6A 5CHIA 4KHWA 5E41A 3D45A 1ZBUA 1JLEA 2Z1GA 3O4QA 3VF2A 1BQNA 1D8YA 4FJ7A 3F2KA 2ZQBA 5H1SQ 2AP1A 4CK3A 1L3VA 4HCCA 3RVCA 1KFSA 3QB0A 1TV6A 3HXMA 4GNIA 2E1YA 5DMRA 3K5LA 1XC3A 3C7NB 4CEEA 2G8UA 4DV2K 4DR1K 2RKIA 4U7BA 1QVGM 1YJNN 1J9AA 4LSLA 4BQLA 4CEAA 1YITN 4AHSA 3DLBA 2EHGA 1NG9A 2ETJA 4E89A 1T44A 2P1JA 4LFCK 3PO4A 4JEPA 1FW6A 2E8AA 3CQYA 1D9FA 4BY9C 2HBMA 4FWMA 4JI7K 4YY3K 1U04A 4NO7A 2A40A 4W5TA 3SZ2A 5AQRA 4C23A 2FSJA 5KTQA 4LH4A 1XI1A 2LSNA 4B9NA 4CFAA 2JWLA 3CM5A 3CCJN 5JS1A 2D0BA 3AY9A 3VF4A 2ZJQL 1S1UA 2I7NA 2Z1IA 5LL6Z 4EP4A 4CJKA 3CJBA 3J80O 3ZSQA 3TTDA 1JJ2M 3HSTB 3VQEA 3F73A 3ALYA 2HMIA 2UU9K 1W9HA 1TAUA 5IT9O 3AVNA 3MWTA 3ZSOA 1GOCA 3L4QA 1ESVA 4HUEA 4CEFA 2GBZA 4OGEA 5AQWA 2A41A 2HBJA 3OYIA 2QKKA 4Q0BA 5JS2A 3VQ6A 1KFDA 3V9WA 4DFMA 4WFNL 2YKNA 5J2PA 4JI4K 4KTWA 3BY5A 1NGJA 5FDLA 2W42A 4FPAA 1FK9A 1XMOK 3SYZA 4JHDB 4B1YB 4BE2A 3O1BA 3S3MA 1VQPN 4DTPA 5GADP 3ZSYA 3LZIA 3O4NA 2W6KA 3AO3A 3S41A 3ULEA 3U9ZA 4DG1A 5GAHP 4R79A 3SQ2A 1VQ4N 2IS3A 4KKOA 4FJIA 3HPHA 3Q7BA 3HPOA 1VSKA 3ZT4A 1BISA 4CJ5A 3M8QA 1DEJA 2VYPA 5GAEP 3V1RA 3VN5A 4PKIA 4CZMA 4F8RA 1OH5A 1L3UA 3VGKA 4QS9A 4BWJA 3IKMA 5AQVA 3O3FA 1NJXA 1EWQA 4IKFA 1NWKA 4FJKA 4HUGA 4CZJA 2YKMA 1JLQA 2I5JA 4DB3A 3QEIA 4BE1A 3KVGA 2HF3A 2VG5A 1O13A 4CIEA 1EQYA 4DCHA 1Q86O 1YUWA 4KB1A 4Y1CA 4RW9A 3SV3A 4J2DA 1RTDA 3OYLA 2YJEA 4CCHA 3VEYA 3A8YA 2GX9A 1G99A 1ZBHA 5B8HA 2OPQA 3AVLA 3DXKB 5CE3A 3I8DA 3O08A 4H0XB 4B9UA 1BA0A 3RSEA 2YJFA 2CH6A 1U47A 3A5LC 3OYGA 1HNIA 1TKXA 3MN6A 3AA4A 3D2FB 4R5PA 2HOEA 2VGNA 4CZEA 3OYAA 4FJXA 3OBWA 2F96A 3RMDA 2RE2A 3CHWA 4HCBA 1U4BA 3H1VX 5KQ8A 4NXMK 3H45C 3AGKA 2FBTA 3SPYA 1YIJN 1B9DA 5AQOA 4CJLA 4C1NI 4DR5K 3TSPA 1KCFA 1N6QA 4HWIA 2OTJN 4CD3A 4DR3K 2CGLA 2GEMA 2Q2RA 3ZETA 2ASPA 5FPEA 5KGWA 3FZMA 1J54A 3TARA 3SQ4A 4KHQA 5AQMA 2QWMA 4GV9A 1RDDA 3BGRA 2EWSA 5HP1A 4LF5K 4BR0A 1LW2A 3CCLN 4ZTFA 4CERA 3N4QA 3LDQA 4EZ9A 4H5RA 5LJWA 2PBDA 3O9QA 3QFPA 4FWRA 1NGCA 4KH4A 3W3DA 1IKVA 4CHYA 5FLXO 4FLXA 2V7ZA 1GOBA 2QEXN 3KD5E 4WYBA 2ZE2A 3ID6A 1C0GA 1HQEA 1P8ZA 1WSJA 1QSYA 4TSXA 3E9PA 1ZBFA 4N76A 5HLFA 3VQ5A 3HM9A 4ELUA 2FC0A 4H5TA 4M45A 3JAMO 4IFYA 3FZHA 5KRTA 2ZJPL 3FE1A 4PKGA 4FZYA 3N4PA 4BRAA 2X6NA 2CGKA 1D9DA 1CZBA 4BWMA 3CFOA 2ZM6K 5BPLA 1VK0A 1X3MA 4LY7A 4N47A 2HNDA 1N5YA 3KK7A 3EO3A 4LD0A 4FM2A 1KLNA 4BGAA 3VA3A 1LAVA 1DLOA 5AQSA 3TWHA 4BVOA 1DTTA 4B1ZA 3MMVA 4RWTA 3CETA 4O44A 4BC2A 1WSFA 3DXMB 2G8FA 3HYFA 3UE5A 3AVCA 4WFAL 5KPZA 1ATNA 4BR5A 3THYA 1I94K 3RMBA 4E7IA 3CC7N 4CECA 2G8VA 4B8AB 1JCEA 5ADXA 4M3XA 1EO1A 2VWBA 4IO9L 4BACA 4DFKA 3RRGA 3D2EA 3NF6A 4FLZA 3ZSXA 1HX1A 1VRTA 2ATQA 2O8BB 4JKGA 4GKJK 4C8NA 2OCEA 4N41A 2HHHK 3FLCO 1RT4A 1TAQA 2QW9A 4FJHA 2NRZA 2QI2A 2O4IA 3C6UA 3QICA 2QWNA 1LCUA 1YHQN 3S3NA 2XHBA 1N8RO 3KZBA 4JV5K 1Y64A 4DV5K 1NJWA 4JN4A 3ENOA 3ZSRA 1JLGA 3DI6A 2PYJA 1Z6RA 4IOXA 5JLFA 3OYHA 3SJJA 4BG8A 4NCGA 3TABA 2PFUA 1F21A 3VQ4A 4PUOA 1ZBSA 2FBXA 2O8CB 2ITMA 1K8KA 3V1OA 4JK7A 2E1ZA 2F7TA 4F3TA 2ASMA 1HNWK 4B3OA 4F2SA 3LP0A 4N56A 3KLFA 1VQON 1Q8IA 2F9WA
chains in the Genus database with same CATH topology
2FF6A 3R8EA 3UKRA 2QWLA 2YHYA 3E9OA 4IO8A 2IVPA 4ILHA 3ZX0A 2CH5A 3L4IA 3U9DA 3VOVA 4XH4A 3FR0A 3C7NA 3CJ7A 4MLHA 4Y0WA 2NLXA 4BRCA 1TYQB 3BEXA 4ILGB 2A3ZA 5JICA 1BDGA 4WFBL 5JLHA 3OHRA 2GWKA 2Q97A 4QS7A 2PAVA 4JD2B 4MDAA 4YOWA 4JNEA 1YJWN 4YOUA 1IJJA 3MN5A 2Q36A 5GIPA 3SMSA 2NRWA 5FPDA 3GOIA 4B1UB 1RGIA 1VAZA 3O5BA 1JCFA 1QZ6A 3R3LA 4FPBA 5ADXH 1SS6A 2GWJA 2CGJA 1K9MO 1DT9A 3O9UA 4K25A 3VEZA 1E4GT 2QA4N 1NM1A 3GBTA 1ATSA 3O9TA 1GLEG 4CZGA 4M7XA 3E9LA 3JS6A 3MWPA 4K43A 5DM6L 4KH6A 2NRXA 4JKHA 3CPWM 3ZEUA 4CBWA 3DLLL 2YHWA 5BR9A 5AQGA 3CC4N 3BF3A 3D2EB 1S3XA 1YJ9N 3MK6A 4A2AA 4B1VA 3CCUN 3AAPA 3CCEN 5F2RA 4BRLA 3WUHA 5AQHA 2P9SB 4JKGB 4EHUA 5C2FA 2P9PA 5BPMA 1MWKA 2P9IA 3SAHA 3CCRN 4H0OA 5M1NA 3HM8A 4RTFD 3C6HA 1OVYA 1WOQA 4FOEA 4CI6A 3SBGA 5AQNA 3LDLA 4O8KA 4JKEA 3WQTA 2QTDA 1K73O 2NRTA 2E88A 3VPZA 2E2OA 2BTFA 5JVGL 4CZLA 3KWGA 1NGHA 4MDBA 4NLCA 1OKJA 4A59A 4OPAA 2HBKA 4M7YA 4L3QA 1VQNN 1X9JA 3U8XA 1ZC6A 4BRNA 1QQOA 5AFUH 3O8MA 4CZIA 3K9JA 1BO5O 4O8UA 5BRFA 3G6EN 4BRDA 1H1VA 2P9UB 1S72N 5M1OA 2A5XA 3H6EA 1ILYA 5CR4A 4GV6A 1Q18A 3M3ZA 5CHIA 3R6MA 3TU5A 1K8KB 4BRKA 4F9OA 3VF2A 3ATVA 5HOOA 3F2KA 4BRQA 5AQQA 1WUAA 3H46O 4JHDA 1M1KO 5H1SQ 3A5OC 2AP1A 1Q7YO 3CJAA 3PLAA 3RVCA 4FSVA 3QB0A 3UKRB 4BR7A 3VTIA 1VQ5N 1KAXA 4YDUC 4A61A 4FWQA 3SAFA 4GNIA 2E1YA 4PKHA 1E4FT 3M6GA 5AQTA 3J7ZO 1XC3A 3C7NB 2KLAA 4H03B 4FOIA 1HJOA 3VEXA 3MX2A 4WQ4C 3WXKA 1U2VA 3VEWA 2D0OA 4U7BA 1QVGM 1YJNN 3H3OB 3CCQN 4B1XB 4BQLA 1YITN 1KQSM 2IVNA 3H1QA 1T6DA 1C0FA 3TTCA 3MCPA 1T44A 3B8AX 3J8AA 5C10A 3EL2A 3LDNA 4JEPA 2E8AA 1GLDG 3CQYA 5GAGP 3LDPA 3CD6N 5BN9A 2WBNA 2W41A 4FWOA 4IWVA 5FPMA 3WT0A 5C12A 4BY9C 1R59O 2HBMA 4FWMA 1VQKN 5AFUA 1M90O 2E2QA 2HF4A 3GDQA 1RFQA 2FSKA 1ZXOA 3ZEUB 1NGFA 1HLUA 2FF3B 3MDQA 5BREA 5I9EB 1SAZA 4NO7A 3A5MC 2A40A 4YOYA 1KD1O 5AQUA 2WC9A 4BVPA 4IXCA 4BG9A 3QBWA 5AQRA 4BROA 4C23A 3MN7A 2ZJRL 2FSJA 3VGLA 2P9PB 3VGMA 2P9IB 3BP8A 2JWLA 2P9NA 2V51B 3CCJN 4ISEA 3E66A 3AY9A 3VF4A 2ZJQL 2I7NA 1BA1A 1S22A 4JKCA 3P4IA 3CJCA 3DXKA 3WXIA 3CJBA 3WEEA 3TTDA 4BRPA 1JJ2M 3R1XA 5BRDA 3CCMN 4CBUA 2D0PA 3CIPA 5JMVA 1D4XA 3MWTA 2ASOA 4YDUA 2E2NA 3CC2N 2HSTA 3G71N 3L4QA 4IJNA 2WUSA 2GELA 3IFRA 1ESVA 3MCAB 3D2FA 3P39A 1QQMA 3QBXA 1VQ8N 3NVKA 5F1XA 1Q82O 1GLAG 3KHYA 3AGRA 3EE8A 5AQWA 2UYTA 2A41A 3ZX2A 2HBJA 4YORA 1X3NA 4IFEA 5DM7L 1GLBG 3P31A 5AQLA 4IJAA 5E84A 3WXMB 3O4WA 4KBOA 4WFNL 1ATRA 1NGJA 3CCSN 3HI0A 3QDKA 4QS8A 3UKUA 3FZFA 4FPAA 4NLBA 1VQ7N 3GE1A 3CJ1A 2WFBA 4JHDB 4B1YB 3O1BA 3L6QA 1VQPN 5GADP 3SK3A 5AZIA 1QHAA 3S41A 3U9ZA 3ULEA 5KQDA 4IEEA 1TUYA 4R79A 5MLCQ 5GAHP 1VQ4N 5HL7L 5AZJA 5F0XA 3Q7BA 5M1KA 1NLVA 2IIRA 4U67L 4FL9A 5TKYA 1QZ5A 3NMUA 1U2VB 3CI5A 4GV3A 2H3GX 1J6ZA 1V4TA 1DEJA 2F9TA 2P9KA 3VETA 2VYPA 5GAEP 3IUCA 3ZYYX 1W97L 4GY2B 5AQJA 4PKIA 3FZLA 2HMPA 2W40A 4CZMA 3VGKA 4NB4A 4ILJA 5AQFA 4QS9A 3IKMA 5AQVA 3OBYA 2QWPA 1NWKA 4BRHA 1LOTB 5M1PA 1NGDA 5FPNA 3T69A 3VMFB 4CZJA 4DB3A 2NRVA 4DQ8A 3KVGA 1BWFO 3D7EO 1DKGD 2HF3A 3PIPL 3HTVA 4EAHD 1O13A 3O6WA 1EQYA 3HBTA 4DCHA 3CXCM 1Q86O 3ZX3A 1YUWA 3CERA 5TKWA 4RCHA 1P90A 2QWQA 4BR2A 2AA4A 2JWKA 4H0PA 2E2PA 2I7PA 2YJEA 4H5VA 3TTFA 5BPNA 5GIOA 4BRFA 3OW2M 2OANA 3VEYA 1VQ6N 3CQXA 4FWPA 3A8YA 2GX9A 2P9NB 5M1QA 3C6AA 5LY3A 1G99A 3DJCA 2YHXA 3HSCA 3HRGA 4H5WA 4FWLA 4BC5A 5B8HA 3CF5L 4DKWA 3DXKB 3UB5A 4FWSA 4BRGA 2P9LA 3O08A 5CE3A 3G4SN 4BREA 4OO1J 4H0XB 3WEEB 3O1WA 1BA0A 3HOTA 3RSEA 2YJFA 1VQMN 2CH6A 4E1JA 4J8FA 3LM2A 1NMDA 4JKDA 4BR9A 3K9KA 3A5LC 2KKZA 2NRRA 1T3VA 3HZ6A 3MN6A 4ISGA 3D2FB 4CZKA 5C15A 2HOEA 2VGNA 3ENHA 3VTHA 4CZEA 3OBWA 5AQZA 2BH1A 2YI1A 1YI2N 4H0TB 5KPRA 3DAWA 2RE2A 2QXLA 3CHWA 4IZ9A 3H1VX 5KQ8A 4IEIA 3H45C 3AGKA 4JK8A 3VESA 4XEIA 1KXPA 3DXMA 4WQ5C 3I55N 1YIJN 5AQOA 4AM6A 3VEOA 2Q0UA 4FWKA 2FLOA 3UKUB 5EXWA 4YOVA 4C1NI 3W0LA 2NRHA 2J4RA 2NZTA 3M5RA 4H0YB 3TSPA 5M1FA 4HWIA 2OTJN 3EZWA 3JXUA 3AAQA 4JKBA 3ENBA 3VEVA 2ZGYA 4CZFA 1U6ZA 3CMEN 5JVHL 4CD3A 5AZIB 2CGLA 3ULEB 4JK9A 2GEMA 4MO5A 2Q2RA 5AZJB 3ZETA 4B9QA 2ASPA 4OPHA 5FPEA 3FZMA 1Z05A 2Q0RA 5E26A 1NGBA 4H5NA 3E1YA 3MX5A 5AQMA 1HUXA 2QWMA 3VERA 4PL7A 4GV9A 2YCHA 3C65A 3FFKB 1K8AO 2P9KB 4BC4A 4I6MA 2NNWA 1MA9B 2EWSA 3ID8A 4PL8A 4A62A 4BR0A 3FGUA 4WQ4A 3CCLN 3N4QA 3LDQA 2Q1NA 3WXLA 1MWMA 3I33A 4H5RA 5KPTA 5LJWA 2PBDA 4CZHA 2QM1A 5BN8A 3O9QA 5C0YA 3QFPA 1RDWX 4GVEA 1NGGA 1NGCA 1TUUA 3P38A 1BOTO 4FWRA 4KH4A 5AQKA 3W3DA 3GL1A 3VF6A 1YXQA 5ELZA 4FO0A 2OTLN 2D4WA 2V7ZA 2ZWHA 3PIOL 2QEXN 4CJ7A 4PHTX 4WYBA 2A42A 3ID6A 1C0GA 4EFHA 1P8ZA 2GTDA 1Q81O 5GINA 4DHYA 3EKUA 1YVNA 3E9PA 4Z94A 4WQ5A 4CD1A 1CZAN 2ZF5O 3TSUA 4H5TA 3EKSA 4IDHA 3FZHA 1KAZA 2ZJPL 3FE1A 4PKGA 4XH1A 3N4PA 2VGMA 1IG8A 4BRAA 4C1NK 2P9LB 4A2BA 1XUPO 2CGKA 4LC9B 3KWIA 3O80A 3RSEB 1VQ9N 1BG3A 2BUPA 3SJHA 4FWNA 4JKFA 5C2DA 4BRMA 5BPLA 4UY8O 1X3MA 1HKBA 3KK7A 3EO3A 3FZKA 4IOAL 3U4LA 3AARA 1GLLO 4BGAA 4A5AA 1GLFO 3CJ9A 5AQXA 5AQSA 4BVOA 1TYQA 4B1ZA 3MMVA 4RWTA 3F9MA 3CETA 3CCVN 4BC2A 4BR4A 4JKAA 1GLCG 1XQSC 3DXMB 4M63C 3UE5A 4WFAL 4JD2A 5KPZA 1HKGA 1ATNA 1NBWA 3C0BA 3L0QA 4BR5A 3I56N 4BQZA 3NVMA 3Q7CA 3SAGA 3TPQA 2ZGZA 3O9SA 3D6RA 1QQNA 1SQKA 4JAXA 3CC7N 1QVFM 3GG4A 3M1FA 3A5NC 2E20A 3I8BA 3LL3A 2DPNA 1JCEA 2V52B 3ZETB 5ADXA 1W2BM 1EO1A 2VWBA 5EY4A 3QMLA 3CMAN 4IO9L 3SLCA 1KAYA 1SZ2A 3D2EA 4AM7A 2KHOA 4EIAA 3VENA 2QWOA 1HX1A 3A0IX 1NJIO 3TSQA 2P9SA 4JKGA 2IVOA 4A5BA 3ATUA 2GUPA 1NGEA 4I6MB 1HPMA 3BF1A 4A57A 2VCPA 1HKCA 3LDOA 3WXJA 1MDUB 3BUZB 1BUPA 3F5TA 3FLCO 5EVZA 1NGAA 4BC3A 3H3NO 5AR0A 1RDUA 2HBLA 4XH5A 3OA9A 2QW9A 3IDHA 4K42A 5AQYA 4WCEL 2FSNA 2RHKA 2QWRA 3QFUA 2NRZA 2QI2A 3MN9A 3QICA 4KH5A 1V4SA 2QWNA 1LCUA 1YHQN 1N8RO 4HTLA 3O9RA 3KZBA 3T7ZA 4EHTA 1Y64A 4IOCL 3IMXA 4G9ZA 2YX6A 5EX5A 5EOYA 4MLEA 4JN4A 3DWLA 3CPEA 4ISFA 3ENOA 3R9PA 5BRHA 1Z6RA 4IOXA 5JLFA 3LM9A 3SMPA 4BG8A 2D1KA 3SBTA 5LJVA 2P9UA 5AQPA 2PFUA 4BGBA 2A6AA 2FXUA 3WQUA 4AF1A 3EN9A 1DGKN 5AQIA 4BRIA 1ZBSA 4FVUA 4WF9L 3G25A 1YF5L 1K8KA 2ITMA 1VQLN 1GLJO 4JK7A 4YOXA 2E1ZA 1NGIA 2F7TA 4B1WB 4MO4A 4YOTA 4K41A 2ASMA 2Q31A 3EE9A 1KC8O 4O5FA 1T6CA 4H0VB 4CBXA 1JCGA 1BU6O 1YAGA 3HOSA 1VQON 2V7YA 2F9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV3 A;  4GVE A;  3Q7B A;  3MX2 A;  4GV6 A;  3MX5 A;  3Q7C A;  3MWT A;  3R3L A;  4FVU A;  3MWP A;  4GV9 A;  4G9Z A; 
#chains in the Genus database with same CATH topology
 3V9X A;  3HK2 A;  3R8E A;  3UKR A;  1LWE A;  3AVA A;  2A1S A;  2VG7 A;  2IVP A;  4ILH A;  3V4I A;  4AHR A;  2CH5 A;  3L4I A;  2G8I A;  1QQC A;  3FR0 A;  3LAL A;  4WFB L;  4QS7 A;  4JD2 B;  4MDA A;  4YOW A;  4FLY A;  3KD1 E;  1J5E K;  4YOU A;  3MN5 A;  3VQ7 A;  2NRW A;  3AO5 A;  2QK9 A;  4KAZ A;  1RGI A;  3O5B A;  3R3L A;  4M3R A;  3AA3 A;  1DT9 A;  3VEZ A;  4PY5 A;  2HHS A;  4O5B A;  2G8K A;  3J7A P;  1VSM A;  1HMV A;  3PSF A;  1OH6 A;  3E9L A;  3JS6 A;  4CIG A;  3DLL L;  2YHW A;  5BR9 A;  4KHN A;  3MK6 A;  1S5J A;  4CJP A;  1NOY A;  2P9S B;  5C2F A;  2P9P A;  5BPM A;  2G8H A;  2P9I A;  4OPJ A;  3HM8 A;  4RTF D;  3PV8 A;  2AJQ A;  1OVY A;  1WOQ A;  1QSL A;  2KFZ A;  2F4V K;  3LDL A;  2QTD A;  3I0S A;  2NRT A;  3VPZ A;  3AO1 A;  2O8F B;  2NUB A;  3RMC A;  4NLC A;  1OKJ A;  3AVI A;  4A59 A;  3P1G A;  4OPA A;  3NGI A;  3O3G A;  4JI0 K;  2HBK A;  1RDB A;  4L3Q A;  1ZC6 A;  4BRN A;  4E7L A;  4CW7 B;  4DUZ K;  4W5Q A;  1Q18 A;  3THW A;  1VSJ A;  4KI6 A;  1HRH A;  3R6M A;  1XC9 A;  4HHT A;  1W0H A;  5HOO A;  2WTU A;  4BRQ A;  5AQQ A;  3H46 O;  3K57 A;  1N36 K;  1Q7Y O;  3LWM A;  4FSV A;  2XY8 A;  4LF4 K;  4A61 A;  3AVK A;  5CZ1 A;  1HQU A;  4CF2 A;  3VEX A;  2HNZ A;  4WQ4 C;  1U2V A;  3CCQ N;  4B1X B;  4QAG A;  2IVN A;  2G8W A;  1C0F A;  3MCP A;  3B8A X;  4Q5V A;  4DR6 K;  5SWM A;  3CD6 N;  4PA1 A;  1GLD G;  5BN9 A;  5FPM A;  4IWV A;  4B9T A;  1S6Q A;  2KFN A;  1CLQ A;  2VWK A;  2FSK A;  1RBR A;  1ZXO A;  3ZEU B;  1NGF A;  1HLU A;  2FF3 B;  2GV9 A;  5BRE A;  1SAZ A;  3C6T A;  3A5M C;  1A5V A;  4DV4 K;  1KD1 O;  3OYK A;  1NKB A;  4LH5 A;  2WC9 A;  4WE1 A;  4BVP A;  3NE6 A;  4BG9 A;  3QBW A;  2ZJR L;  3VGL A;  3BP8 A;  2DFH A;  3KK1 A;  3J7Y P;  4DSJ A;  4DR7 K;  1RBV A;  1RT6 A;  4PQU A;  4ID5 A;  4M3W A;  3PO5 A;  3QEV A;  4OLA A;  3CJC A;  1S9E A;  3WXI A;  3KLG A;  1B92 A;  3CCM N;  2D0P A;  5JMV A;  4GVM A;  4CEB A;  2ASO A;  3CC2 N;  2E2N A;  4LFA K;  4E1N A;  2GEL A;  3P39 A;  3NVK A;  1KVA A;  5F1X A;  1Q82 O;  1GLA G;  3AGR A;  4X62 K;  3ZX2 A;  3CM6 A;  4IFE A;  1GLB G;  3P31 A;  4IJA A;  5E84 A;  3O4W A;  5J2N A;  4QS8 A;  3FZF A;  4M3Y A;  4F2R A;  1Q9Y A;  4FZX C;  4NYF A;  3CJ1 A;  4LF7 K;  5K14 A;  4AHV A;  5AZI A;  5KQD A;  1D5A A;  1VQK N;  2BDP A;  4IEE A;  1S1T A;  1WSI A;  4CHP A;  5F0X A;  1KSP A;  4X65 K;  1RNH A;  1NLV A;  1JKH A;  3KKS A;  1C0T A;  4DV6 K;  4DV0 K;  4AHT A;  2P9K A;  3HO1 A;  4DUY K;  4B9L A;  4H4O A;  3ZYY X;  5CYM A;  5AQJ A;  4DMN A;  3FZL A;  2HMP A;  4KHU A;  4JRP A;  4BRH A;  1LOT B;  5CY4 A;  4EP5 A;  3D7E O;  2OPR A;  4B3M K;  3HTV A;  3DLG A;  4EAH D;  3CXC M;  4W5N A;  3CER A;  1VSH A;  4DV3 K;  4XIU A;  2Q3S A;  2QWQ A;  1RIL A;  4H0P A;  4DSI A;  5GIO A;  3L2U A;  3OJU A;  4CJ3 A;  2WON A;  5M1Q A;  2YHX A;  3HSC A;  1TKT A;  2KQ2 A;  3CF5 L;  4KRE A;  4DKW A;  1RT3 A;  3UB5 A;  3SV4 A;  4BRG A;  2P9L A;  4FXD A;  4FJN A;  4JLH A;  3PX4 A;  3HPG A;  4OO1 J;  3O1W A;  3V9U A;  4J8F A;  3WNE A;  1EKE A;  4BR9 A;  1X9M A;  3PUF A;  1MU2 A;  1NK0 A;  3HZ6 A;  4ISG A;  3ENH A;  3VTH A;  3RWU A;  2BH1 A;  4CGH A;  4FM1 A;  5KPR A;  1REV A;  3DAW A;  4E7J A;  4FK2 A;  5KGX A;  4XEI A;  4UQG A;  5T7B A;  4JRQ A;  2PY5 A;  4WQ5 C;  3K58 A;  3I55 N;  2Q0U A;  1NK6 A;  2D0C A;  5EXW A;  1JXB A;  3NCI A;  3DLR A;  3W0L A;  3DMJ A;  2D5R A;  2NRH A;  4H0Y B;  3AAQ A;  3CME N;  3ENB A;  1U6Z A;  3ULE B;  4MO5 A;  4DTS A;  3EZ5 A;  4CJW A;  3MX5 A;  3T1Y K;  3HL8 A;  4PL7 A;  5SZT A;  1RBS A;  1EET A;  2YCH A;  3FFK B;  4JI5 K;  4DR2 K;  2NNW A;  1MA9 B;  3ID8 A;  4PL8 A;  3VQQ A;  4A62 A;  3FGU A;  3WNG A;  4B9S A;  1MWM A;  3I33 A;  4YNQ A;  4CZH A;  5BN8 A;  2QM1 A;  5HRR A;  2OZM A;  5FRN A;  4CEZ A;  5C0Y A;  3NBP A;  3P38 A;  2OTL N;  2ZWH A;  2W6L A;  1BIU A;  4CJ7 A;  4PHT X;  2GTD A;  1EX4 A;  1Q81 O;  5GIN A;  1QE1 A;  1YVN A;  1GOA A;  3PX6 A;  4Z4F A;  3NF9 A;  4HVJ A;  3HVR A;  2ZF5 O;  1WAJ A;  4FJJ A;  3OS1 A;  3NH0 A;  4FW1 A;  4CJE A;  4JI8 K;  1SKS A;  4E7K A;  4A2B A;  3AVH A;  3O80 A;  3NH1 A;  4KHY A;  1YTA A;  4FZZ A;  3RSE B;  3ZCM A;  5DK5 A;  1VQ9 N;  1XMQ K;  2BUP A;  2Z1H A;  3DLK A;  1BHL A;  1DTQ A;  5C2D A;  4K8Z A;  3T1H K;  1XHX A;  3U4L A;  1X9S A;  1GLL O;  4IBN A;  3VA0 A;  3V9Z A;  4B8C A;  3CQ8 A;  3P83 D;  3CFP A;  3CCV N;  4JKA A;  4M63 C;  3ULD A;  1NBW A;  3C0B A;  4BQZ A;  3DRP A;  2HVI A;  3L3U A;  4CE9 A;  5KRS A;  4DQP A;  4FJM A;  2ZGZ A;  1QVF M;  1QQN A;  4KV8 A;  1BGX T;  1VSI A;  3A5N C;  4X64 K;  4IG0 A;  1EWR A;  4CJT A;  3ZET B;  1CXU A;  3ZT3 A;  4W5O A;  3RRH A;  3OVN A;  4EIA A;  4DQR A;  3A0I X;  3LAN A;  2DTU A;  4A57 A;  3WXJ A;  3BUZ B;  1BUP A;  5EVZ A;  4BC3 A;  3IAY A;  5AQY A;  4K42 A;  1IKY A;  2FSN A;  2RHK A;  1C1C A;  4CF8 A;  3CFR A;  3ZSZ A;  1V4S A;  1IV0 A;  1LW0 A;  3NGY A;  4HTL A;  1HNX K;  3T7Z A;  1WLJ A;  3VQD A;  4IOC L;  3IMX A;  5CZ2 A;  2YX6 A;  5EX5 A;  1C0M A;  1Y97 A;  3LM9 A;  3LAK A;  3OS2 A;  5AQP A;  3AVB A;  4IDK A;  3M8R A;  5AQI A;  1DGK N;  5HRS A;  3OS0 A;  4YOT A;  2Q31 A;  3C94 A;  3EE9 A;  4OJR A;  3ASM A;  1T6C A;  1JCG A;  1YAG A;  3TSQ A;  1U49 A;  4DSK A;  4RW7 A;  2FF6 A;  4MFB A;  3DOK A;  3OY9 A;  4IO8 A;  2OZS A;  1VSL A;  3ZX0 A;  3PX0 A;  4CJU A;  1NJZ A;  1TK5 A;  4MLH A;  4Y0W A;  2NLX A;  4F3O A;  2X78 A;  4ILG B;  4CES A;  1BDG A;  1ASV A;  3OHR A;  1TL3 A;  1E3M A;  3SI6 A;  3VQ8 A;  4I9Q A;  3QES A;  2PAV A;  2RF2 A;  1NKE A;  1YJW N;  1BCM A;  3KLI A;  1IJJ A;  5GIP A;  3SMS A;  3THY B;  1WSE A;  5ADX H;  5AJ3 K;  2GWJ A;  2CGJ A;  1K9M O;  3O9U A;  1E4G T;  2QA4 N;  3AA2 A;  1NK8 A;  2D0A A;  5FRO A;  1GLE G;  3A2F A;  4M7X A;  3MWP A;  5DM6 L;  2NRX A;  2YNF A;  3D2E B;  4IG3 A;  1S3X A;  4RW8 A;  1YJ9 N;  3MXM A;  3CCE N;  3WUH A;  4JKG B;  2VWJ A;  1MWK A;  4H0O A;  5M1N A;  4GMJ B;  4JI3 K;  1RT2 A;  3ISN C;  1K73 O;  4FLU A;  3MEC A;  3DRR A;  2BTF A;  4CZL A;  3KWG A;  1UOC A;  2BE2 A;  1SL2 A;  4B3S K;  1X9J A;  3U8X A;  1QQO A;  1JLB A;  3G0Z A;  3O8M A;  3T1A A;  1BO5 O;  4O8U A;  4CHN A;  3G6E N;  4BRD A;  1H1V A;  1WBB A;  5M1O A;  1T05 A;  1ILY A;  2QKB A;  3TU5 A;  1K8K B;  4BRK A;  3ZLJ A;  3ATV A;  4DSL A;  2VG6 A;  3QO9 A;  1M1K O;  3OTO K;  3A5O C;  3CJA A;  1T03 A;  4B9V A;  3UKR B;  4BR7 A;  1KAX A;  4YDU C;  4DF4 A;  4FWQ A;  3SAF A;  2XY5 A;  1Z26 A;  1NU0 A;  1E4F T;  4DQQ A;  4H03 B;  4FOI A;  3WXK A;  4J2B A;  3MX2 A;  3VEW A;  2D0O A;  3NH2 A;  4CJR A;  3TAP A;  2YNI A;  1IO2 A;  2IDO A;  1SV5 A;  1A5X A;  3MED A;  1RDC A;  3TTC A;  4DV7 K;  5C10 A;  3EL2 A;  3LWL A;  5GAG P;  2WBN A;  3WT0 A;  1IBK K;  1RBU A;  3GDQ A;  3K5M A;  1RFQ A;  3CYM A;  3MDQ A;  4DTU A;  1EXQ A;  1FJG K;  5I9E B;  4CJS A;  3AVM A;  4YOY A;  5AQU A;  3TAQ A;  4CGD A;  3SQ1 A;  4BRO A;  3MN7 A;  1ZBL A;  2P9P B;  2P9I B;  2P9N A;  3S3O A;  4CED A;  2V51 B;  4ZTJ A;  4LFB K;  4ISE A;  2XY6 A;  1BA1 A;  1S22 A;  4C8O A;  4JKC A;  3LP3 A;  4DV1 K;  3WEE A;  1RT7 A;  5BRD A;  4CBU A;  4Y1D A;  2HST A;  4IJN A;  1KVC A;  3MCA B;  3QBX A;  4ID1 A;  1QQM A;  4DFP A;  1C6V A;  2Y1J A;  3M8S A;  3EE8 A;  2UYT A;  1X3N A;  5DM7 L;  1NKC A;  3L2W A;  3S9H A;  3WXM B;  4FW2 A;  2KZM A;  4OKE A;  4B08 A;  1L5U A;  3QER A;  3CCS N;  3QDK A;  4Z4E A;  3UKU A;  1N34 K;  3GE1 A;  4KI4 A;  2WFB A;  2PYL A;  5A2Q O;  1QHA A;  2HHW A;  1RDA A;  5HL7 L;  2DFE A;  5AZJ A;  1LWC A;  1FXX A;  3VQB A;  2HNY A;  3L8B A;  2BGG A;  1BL3 A;  3TAN A;  1QZ5 A;  1FKP A;  3NMU A;  1U2V B;  3EY1 A;  4GV3 A;  3L2V A;  3AVG A;  2F9T A;  2Z1J A;  3P5J A;  3VET A;  4CEQ A;  3IUC A;  3KKR A;  1W97 L;  4GY2 B;  2W40 A;  2F8S A;  2P51 A;  3T3F A;  4NB4 A;  3PY8 A;  3OBY A;  2FBY A;  5M1P A;  1NGD A;  5FPN A;  3T69 A;  1VHX A;  3VMF B;  1TL1 A;  4BDZ A;  2NRV A;  3V9S A;  1NJY A;  2ZD1 A;  1BWF O;  1XHZ A;  2HW3 A;  1DKG D;  3AVJ A;  4C8K A;  3O6W A;  3ZX3 A;  1P90 A;  3THX A;  4BR2 A;  2AA4 A;  2HHQ A;  2OAN A;  4FWP A;  1HJR A;  3C6A A;  1K6Y A;  4CFC A;  1BIZ A;  3QEX A;  4BC5 A;  4FWL A;  3FFI A;  1JLF A;  3G4S N;  4OLB A;  1W7A A;  4M3Z A;  3HOT A;  4BE0 A;  3K59 A;  1WB9 A;  2O8D A;  2HHX A;  3LM2 A;  4JKD A;  3K9K A;  2NRR A;  2O8E A;  1T3V A;  4OKJ A;  5C15 A;  4KHP K;  2XRI A;  2GUI A;  4J2A A;  2YI1 A;  1YI2 N;  4W5R A;  1LV5 A;  2QXL A;  4JS5 A;  3VES A;  3O3H A;  3NDK A;  3RMA A;  3NF8 A;  3VEO A;  4JYA K;  4FWK A;  3RR7 A;  2HB5 A;  3AV9 A;  4F4K A;  4BDY A;  2YHA A;  1IH7 A;  4CHO A;  1C1A A;  3EZW A;  3JXU A;  3VEV A;  1TVR A;  3RR8 A;  5JVH L;  5AZI B;  4JK9 A;  3KK3 A;  5I3U A;  4OPH A;  2B4J A;  1Z05 A;  4DWI A;  5E26 A;  3HT3 A;  2KW4 A;  3TAG A;  4CVN E;  1HUX A;  3VER A;  2YHB A;  2P9K B;  4BC4 A;  4I6M A;  3U6F A;  1N33 K;  4CK2 A;  4Z4I A;  1BI4 A;  4CFB A;  4AHU A;  5LMN K;  2HHU A;  4E3S A;  2IC3 A;  5KPT A;  1BCO A;  4DF8 A;  1R0A A;  4E0D A;  3QLH A;  4NCA A;  4GVE A;  1NGG A;  3ZSW A;  5AQK A;  1NK4 A;  3GL1 A;  4NYN A;  2E6M A;  1S1W A;  1N32 K;  3PIO L;  4YHH K;  2A42 A;  4EFH A;  2HHV A;  3EKU A;  4AHC A;  4DR4 K;  1JL1 A;  4WQ5 A;  3DOL A;  3V81 A;  3TSU A;  4DTM A;  4J2E A;  4C1N K;  2P9L B;  4CGI A;  4LC9 B;  3LP1 A;  1BG3 A;  3SJH A;  4FWN A;  3OYB A;  4BRM A;  3LZJ A;  4UY8 O;  1HNZ K;  4KPY A;  1HKB A;  3D0P A;  3FZK A;  1G15 A;  1J53 A;  4B3T K;  4CGF A;  2ITG A;  4M42 A;  4FJ8 A;  4A5A A;  1GLF O;  1NOZ A;  1TYQ A;  1ZBI A;  1NNE A;  3F9M A;  4OKK A;  4BR4 A;  1EP4 A;  2F8T A;  3H08 A;  1HKG A;  4KRF A;  3I56 N;  3KTQ A;  5BR8 K;  3WNH A;  3SAG A;  3CG7 A;  3O9S A;  3D6R A;  1SQK A;  1A5W A;  3KJV A;  3GG4 A;  3M1F A;  3I8B A;  1OH8 A;  3LP2 A;  5EY4 A;  3QML A;  1WBD A;  3CMA N;  3SLC A;  4AM7 A;  4OGC A;  5C25 A;  3VEN A;  5EU7 A;  2QWO A;  4KB0 A;  4K0K K;  4H4M A;  2IVO A;  2XY7 A;  2B5J A;  3BF1 A;  2VCP A;  1U45 A;  2X74 A;  3AO2 A;  1MDU B;  4LSN A;  4DSF A;  1NGA A;  4CF9 A;  4DTN A;  3OA9 A;  3IDH A;  1C0U A;  3TR8 A;  4B9M A;  1SKW A;  2QWR A;  1T8E A;  3HP6 A;  3SPZ A;  3QEW A;  4DS4 A;  3O9R A;  4DTJ A;  2OA8 A;  3L2Q A;  3K5O A;  4G9Z A;  4MLE A;  4JI6 K;  3CPE A;  4I2Q A;  3R9P A;  3LPU A;  5BRH A;  3SMP A;  2D1K A;  5LJV A;  2P9U A;  3HVT A;  1SKR A;  2A6A A;  4MQ3 A;  4FVU A;  1GLJ O;  4YOX A;  4DTX A;  1NGI A;  4B1W B;  1HYV A;  3V1Q A;  3BZC A;  3HP9 A;  4CGJ A;  4KHS A;  4O5F A;  4CBX A;  3HOS A;  1BU6 O;  4DTO A;  3E01 A;  4E19 A;  3BDP A;  4QOZ B;  2QWL A;  2YHY A;  3E9O A;  3SUO A;  4LF6 K;  5HRO A;  4N5S A;  3U9D A;  4XH4 A;  4I9L A;  3C7N A;  3CJ7 A;  1YTU A;  4BRC A;  1KLM A;  3BEX A;  5KI6 A;  1SL1 A;  1HYS A;  2Q97 A;  4OVL A;  4JNE A;  3V6D A;  1QSS A;  4B3R K;  4FVM A;  4B1U B;  4FPB A;  1JCF A;  1KRP A;  4V19 S;  4FJ5 A;  5CYQ A;  1NM1 A;  1ATS A;  3O9T A;  4K8X A;  3CPW M;  4K43 A;  4JKH A;  4Z4G A;  4CBW A;  3ZT2 A;  3CC4 N;  1BQM A;  4A2A A;  4B1V A;  3CCU N;  4NXN K;  1IKX A;  3AAP A;  5F2R A;  3MEE A;  4BRL A;  5AQH A;  2YNH A;  4EHU A;  1CZ9 A;  1RTI A;  1CXQ A;  1RBT A;  3C6H A;  3SNN A;  3TI0 A;  4FOE A;  4O8K A;  4JKE A;  4CF1 A;  4CGG A;  1TKD A;  2E2O A;  2P5O A;  5JVG L;  3T19 A;  1NGH A;  3TAF A;  3RTV A;  3IG1 A;  1NK7 A;  1VQN N;  3KLE A;  5AFU H;  4CZI A;  4FCY A;  1KTQ A;  5J2M A;  3H6E A;  3M3Z A;  2X6S A;  1X9W A;  2WOM A;  4F9O A;  3MXI A;  4FK4 A;  1JL2 A;  3KK2 A;  1WUA A;  4JHD A;  1IBL K;  4LF9 K;  4CF0 A;  3OYC A;  3QEP A;  3PLA A;  1VQ5 N;  3VTI A;  1LAW A;  4CK1 A;  4PKH A;  3M6G A;  5AQT A;  3J7Z O;  4H8K A;  2KLA A;  1HJO A;  4CHQ A;  3H3O B;  2KTQ A;  1KQS M;  3H1Q A;  5J2Q A;  4E7H A;  1T6D A;  3KIO A;  3SUN A;  3J8A A;  3LDN A;  4M3U A;  3LDP A;  2W41 A;  4FWO A;  5C12 A;  1R59 O;  1TGO A;  5AFU A;  2IGI A;  1ZYQ A;  1TK8 A;  1M90 O;  1NMN A;  2E2Q A;  2HF4 A;  3MAQ A;  1VSD A;  2HVH A;  4RW4 A;  5HBM A;  4IXC A;  2OPP A;  3VQ9 A;  4CJF A;  3VGM A;  3E66 A;  4RW6 A;  4Z4C A;  3P4I A;  3DXK A;  4FJL A;  4BRP A;  4CEO A;  3QET A;  3R1X A;  2UUB K;  4OX9 K;  3CIP A;  1D4X A;  1VSE A;  1UA0 A;  4YDU A;  1U48 A;  3G71 N;  3OYD A;  2WUS A;  3IFR A;  1VQ8 N;  3D2F A;  1UWB A;  4DLE A;  1UAX A;  4O0J A;  3KHY A;  2XO7 A;  3NF7 A;  1XNR K;  1TKZ A;  3VQP A;  4DU3 A;  1WNS A;  3NAE A;  4YOR A;  5AQL A;  4KBO A;  2JLE A;  1ATR A;  2UXC K;  3HI0 A;  4EZ6 A;  3DLE A;  4NLB A;  1VQ7 N;  5I42 A;  2A1R A;  3I0R A;  3L6Q A;  3SK3 A;  1JXE A;  3SQ0 A;  3K2P A;  4DU4 A;  3QNN A;  5MLC Q;  1TUY A;  3L2R A;  4PWD A;  5M1K A;  2IAJ A;  2IIR A;  1O1W A;  4FL9 A;  4U67 L;  5LMU K;  5TKY A;  3CI5 A;  2O4G A;  2H3G X;  1J6Z A;  1V4T A;  1WN7 A;  1HPZ A;  5FRM A;  1J5O A;  1FKO A;  4ILJ A;  5AQF A;  3ZSV A;  1LWF A;  2QWP A;  4X66 K;  1L3T A;  4HTU A;  2DY4 A;  3DRS A;  4DQ8 A;  1RT1 A;  4CIF A;  3HBT A;  4DQS A;  5TKW A;  4RCH A;  3AA5 X;  1I3A A;  3M8P A;  2JWK A;  4H5V A;  2E2P A;  2I7P A;  3TTF A;  5BPN A;  3OW2 M;  1HNV A;  4BRF A;  1VQ6 N;  1ASU A;  3CQX A;  2P9N B;  5LY3 A;  3DJC A;  1RCH A;  3HRG A;  4H5W A;  4JS4 A;  4FWS A;  4C8M A;  1SL0 A;  4BRE A;  3WEE B;  1S9G A;  4CFD A;  1VQM N;  4E1J A;  2OYQ A;  5D3G A;  1NMD A;  2KKZ A;  4KFB A;  4CZK A;  4YFU A;  5IWA K;  1IKW A;  1X1P A;  5AQZ A;  4E1M A;  3LDS A;  4GKK K;  4H0T B;  2BAN A;  4IZ9 A;  4IEI A;  1JLA A;  4JK8 A;  1KXP A;  3DXM A;  4CHZ A;  4AM6 A;  3EEQ A;  4AH9 A;  2FLO A;  3UKU B;  4YOV A;  3ZT1 A;  2J4R A;  2NZT A;  3M5R A;  3OYM A;  3TAE A;  5M1F A;  4IFV A;  4JKB A;  4CZF A;  2ZGY A;  4FLT A;  1VSF A;  3ZT0 A;  3OYJ A;  3EYZ A;  5AZJ B;  4B9Q A;  4Z4H A;  2UXD K;  1QS4 A;  1IBM K;  4CJ4 A;  2YV0 X;  2Q0R A;  4DS5 A;  3IRX A;  4I7F A;  1NGB A;  4H5N A;  3E1Y A;  3OYE A;  4ZHR A;  4DLG A;  2YNG A;  1K8A O;  3C65 A;  2O8B A;  3SCX A;  2RPI A;  3THV A;  4WQ4 A;  3WXL A;  2Q1N A;  3ITH A;  1YT3 A;  4LF8 K;  4M41 A;  3NGZ A;  1RDW X;  3THW B;  1TUU A;  1BOT O;  3VF6 A;  1HR0 K;  1YXQ A;  4HUF A;  5ELZ A;  4FO0 A;  2D4W A;  5C24 A;  3THX B;  4DHY A;  4Z94 A;  2R7Y A;  4CD1 A;  1CZA N;  1Z25 A;  1XNQ K;  3EKS A;  4IDH A;  2O8C A;  1KAZ A;  4XH1 A;  4NCB A;  2VGM A;  1IG8 A;  1RTJ A;  4FK0 A;  3PSI A;  1XUP O;  4O4G A;  2JGU A;  3KWI A;  4G1Q A;  3DYA A;  3U3G A;  1L3S A;  4AQY K;  2O8D B;  1VRU A;  2QXF A;  3LAM A;  4JKF A;  3OYN A;  4FLV A;  4QCL A;  3IS9 A;  2O8E B;  3DLH A;  4KO0 A;  3KLH A;  3SUQ A;  4IOA L;  1UA1 A;  3AAR A;  3NFA A;  2E5L K;  3CJ9 A;  2PZS A;  5AQX A;  3U3Y A;  1YVU A;  4KTZ A;  1GLC G;  3MEG A;  1XQS C;  4DQI A;  4JD2 A;  3L0Q A;  3DM2 A;  3TAM A;  2EX3 A;  3NVM A;  3Q7C A;  5C42 A;  3AVF A;  3TPQ A;  4FM0 A;  4JAX A;  1IG9 A;  2E20 A;  3UIQ A;  3LL3 A;  2DPN A;  2P5G A;  2V52 B;  1W2B M;  1SUQ A;  2Y1I A;  1KAY A;  1KVB A;  1OVQ A;  1SZ2 A;  3G10 A;  2KHO A;  4O55 A;  4FJG A;  1NJI O;  2RN2 A;  2P9S A;  4A5B A;  3ATU A;  2GUP A;  1NGE A;  4I6M B;  1HPM A;  1BI4 B;  1HKC A;  3LDO A;  4AIL C;  1XWL A;  1S1V A;  3F5T A;  3H3N O;  1RTH A;  5AR0 A;  1RDU A;  4JI2 K;  4XH5 A;  2HBL A;  1ITG A;  3PIP L;  4WCE L;  3QFU A;  3QNO A;  3MN9 A;  4DSE A;  2O8F A;  1B9F A;  2E4L A;  4KH5 A;  4RG8 A;  4CJQ A;  2UXB K;  4ELT A;  4EHT A;  4M3T A;  3JYT A;  1ASW A;  5EOY A;  3DWL A;  4ISF A;  2VQF K;  4I2P A;  4GW6 A;  3SBT A;  3WNF A;  4FLW A;  2IOC A;  5HRP A;  4BGB A;  2FXU A;  3WQU A;  4AF1 A;  4DTR A;  1S1X A;  1I39 A;  3EN9 A;  4BRI A;  3K5N A;  4WF9 L;  3G25 A;  1YF5 L;  1VQL N;  3OJS A;  3AO4 A;  4FYD A;  4MO4 A;  1NK5 A;  4K41 A;  4KTQ A;  3QIN A;  1OH7 A;  1KC8 O;  1WSG A;  4H0V B;  4JI1 K;  4CJV A;  1WSH A;  2V7Y A;  2DFF A;  2UUC K;  4DU1 A;  3NHG A;  3F9K A;  3J81 O;  4O0I A;  3VOV A;  4Z0U A;  2HHT A;  1TYQ B;  2A3Z A;  5JIC A;  3SUP A;  1WAF A;  5JLH A;  3B6P A;  5HRN A;  2GWK A;  3OYF A;  3BZK A;  4C8L A;  2Q36 A;  5FPD A;  3K0S A;  3VQA A;  3GOI A;  1VAZ A;  1QZ6 A;  1SS6 A;  3HJF A;  1RT5 A;  1HYZ A;  1Q9X A;  3B6O A;  4K25 A;  3GBT A;  1T7P A;  3L3V A;  4CZG A;  4KH6 A;  3QIP A;  3ZEU A;  4L8R B;  5AQG A;  3BF3 A;  4OPK A;  1QHT A;  4BDP A;  3LPT A;  5J1E A;  4ELV A;  3C95 A;  3SAH A;  3CCR N;  1NK9 A;  2OPS A;  1JLC A;  2VQE K;  2B6A A;  4FJ9 A;  4CI6 A;  3SBG A;  5AQN A;  3WQT A;  2E6L A;  3VQC A;  2E88 A;  1QTM A;  4MDB A;  3QIO A;  4M7Y A;  4DFJ A;  4ICL A;  1S6P A;  3K9J A;  1TK0 A;  5BRF A;  1C1B A;  2P9U B;  1S72 N;  2FBV A;  2KZZ A;  2A5X A;  3JSM A;  3MXJ A;  5CR4 A;  2UUA K;  4GV6 A;  5CHI A;  4KHW A;  5E41 A;  3D45 A;  1ZBU A;  1JLE A;  2Z1G A;  3O4Q A;  3VF2 A;  1BQN A;  1D8Y A;  4FJ7 A;  3F2K A;  2ZQB A;  5H1S Q;  2AP1 A;  4CK3 A;  1L3V A;  4HCC A;  3RVC A;  1KFS A;  3QB0 A;  1TV6 A;  3HXM A;  4GNI A;  2E1Y A;  5DMR A;  3K5L A;  1XC3 A;  3C7N B;  4CEE A;  2G8U A;  4DV2 K;  4DR1 K;  2RKI A;  4U7B A;  1QVG M;  1YJN N;  1J9A A;  4LSL A;  4BQL A;  4CEA A;  1YIT N;  4AHS A;  3DLB A;  2EHG A;  1NG9 A;  2ETJ A;  4E89 A;  1T44 A;  2P1J A;  4LFC K;  3PO4 A;  4JEP A;  1FW6 A;  2E8A A;  3CQY A;  1D9F A;  4BY9 C;  2HBM A;  4FWM A;  4JI7 K;  4YY3 K;  1U04 A;  4NO7 A;  2A40 A;  4W5T A;  3SZ2 A;  5AQR A;  4C23 A;  2FSJ A;  5KTQ A;  4LH4 A;  1XI1 A;  2LSN A;  4B9N A;  4CFA A;  2JWL A;  3CM5 A;  3CCJ N;  5JS1 A;  2D0B A;  3AY9 A;  3VF4 A;  2ZJQ L;  1S1U A;  2I7N A;  2Z1I A;  5LL6 Z;  4EP4 A;  4CJK A;  3CJB A;  3J80 O;  3ZSQ A;  3TTD A;  1JJ2 M;  3HST B;  3VQE A;  3F73 A;  3ALY A;  2HMI A;  2UU9 K;  1W9H A;  1TAU A;  5IT9 O;  3AVN A;  3MWT A;  3ZSO A;  1GOC A;  3L4Q A;  1ESV A;  4HUE A;  4CEF A;  2GBZ A;  4OGE A;  5AQW A;  2A41 A;  2HBJ A;  3OYI A;  2QKK A;  4Q0B A;  5JS2 A;  3VQ6 A;  1KFD A;  3V9W A;  4DFM A;  4WFN L;  2YKN A;  5J2P A;  4JI4 K;  4KTW A;  3BY5 A;  1NGJ A;  5FDL A;  2W42 A;  4FPA A;  1FK9 A;  1XMO K;  3SYZ A;  4JHD B;  4B1Y B;  4BE2 A;  3O1B A;  3S3M A;  1VQP N;  4DTP A;  5GAD P;  3ZSY A;  3LZI A;  3O4N A;  2W6K A;  3AO3 A;  3S41 A;  3ULE A;  3U9Z A;  4DG1 A;  5GAH P;  4R79 A;  3SQ2 A;  1VQ4 N;  2IS3 A;  4KKO A;  4FJI A;  3HPH A;  3Q7B A;  3HPO A;  1VSK A;  3ZT4 A;  1BIS A;  4CJ5 A;  3M8Q A;  1DEJ A;  2VYP A;  5GAE P;  3V1R A;  3VN5 A;  4PKI A;  4CZM A;  4F8R A;  1OH5 A;  1L3U A;  3VGK A;  4QS9 A;  4BWJ A;  3IKM A;  5AQV A;  3O3F A;  1NJX A;  1EWQ A;  4IKF A;  1NWK A;  4FJK A;  4HUG A;  4CZJ A;  2YKM A;  1JLQ A;  2I5J A;  4DB3 A;  3QEI A;  4BE1 A;  3KVG A;  2HF3 A;  2VG5 A;  1O13 A;  4CIE A;  1EQY A;  4DCH A;  1Q86 O;  1YUW A;  4KB1 A;  4Y1C A;  4RW9 A;  3SV3 A;  4J2D A;  1RTD A;  3OYL A;  2YJE A;  4CCH A;  3VEY A;  3A8Y A;  2GX9 A;  1G99 A;  1ZBH A;  5B8H A;  2OPQ A;  3AVL A;  3DXK B;  5CE3 A;  3I8D A;  3O08 A;  4H0X B;  4B9U A;  1BA0 A;  3RSE A;  2YJF A;  2CH6 A;  1U47 A;  3A5L C;  3OYG A;  1HNI A;  1TKX A;  3MN6 A;  3AA4 A;  3D2F B;  4R5P A;  2HOE A;  2VGN A;  4CZE A;  3OYA A;  4FJX A;  3OBW A;  2F96 A;  3RMD A;  2RE2 A;  3CHW A;  4HCB A;  1U4B A;  3H1V X;  5KQ8 A;  4NXM K;  3H45 C;  3AGK A;  2FBT A;  3SPY A;  1YIJ N;  1B9D A;  5AQO A;  4CJL A;  4C1N I;  4DR5 K;  3TSP A;  1KCF A;  1N6Q A;  4HWI A;  2OTJ N;  4CD3 A;  4DR3 K;  2CGL A;  2GEM A;  2Q2R A;  3ZET A;  2ASP A;  5FPE A;  5KGW A;  3FZM A;  1J54 A;  3TAR A;  3SQ4 A;  4KHQ A;  5AQM A;  2QWM A;  4GV9 A;  1RDD A;  3BGR A;  2EWS A;  5HP1 A;  4LF5 K;  4BR0 A;  1LW2 A;  3CCL N;  4ZTF A;  4CER A;  3N4Q A;  3LDQ A;  4EZ9 A;  4H5R A;  5LJW A;  2PBD A;  3O9Q A;  3QFP A;  4FWR A;  1NGC A;  4KH4 A;  3W3D A;  1IKV A;  4CHY A;  5FLX O;  4FLX A;  2V7Z A;  1GOB A;  2QEX N;  3KD5 E;  4WYB A;  2ZE2 A;  3ID6 A;  1C0G A;  1HQE A;  1P8Z A;  1WSJ A;  1QSY A;  4TSX A;  3E9P A;  1ZBF A;  4N76 A;  5HLF A;  3VQ5 A;  3HM9 A;  4ELU A;  2FC0 A;  4H5T A;  4M45 A;  3JAM O;  4IFY A;  3FZH A;  5KRT A;  2ZJP L;  3FE1 A;  4PKG A;  4FZY A;  3N4P A;  4BRA A;  2X6N A;  2CGK A;  1D9D A;  1CZB A;  4BWM A;  3CFO A;  2ZM6 K;  5BPL A;  1VK0 A;  1X3M A;  4LY7 A;  4N47 A;  2HND A;  1N5Y A;  3KK7 A;  3EO3 A;  4LD0 A;  4FM2 A;  1KLN A;  4BGA A;  3VA3 A;  1LAV A;  1DLO A;  5AQS A;  3TWH A;  4BVO A;  1DTT A;  4B1Z A;  3MMV A;  4RWT A;  3CET A;  4O44 A;  4BC2 A;  1WSF A;  3DXM B;  2G8F A;  3HYF A;  3UE5 A;  3AVC A;  4WFA L;  5KPZ A;  1ATN A;  4BR5 A;  3THY A;  1I94 K;  3RMB A;  4E7I A;  3CC7 N;  4CEC A;  2G8V A;  4B8A B;  1JCE A;  5ADX A;  4M3X A;  1EO1 A;  2VWB A;  4IO9 L;  4BAC A;  4DFK A;  3RRG A;  3D2E A;  3NF6 A;  4FLZ A;  3ZSX A;  1HX1 A;  1VRT A;  2ATQ A;  2O8B B;  4JKG A;  4GKJ K;  4C8N A;  2OCE A;  4N41 A;  2HHH K;  3FLC O;  1RT4 A;  1TAQ A;  2QW9 A;  4FJH A;  2NRZ A;  2QI2 A;  2O4I A;  3C6U A;  3QIC A;  2QWN A;  1LCU A;  1YHQ N;  3S3N A;  2XHB A;  1N8R O;  3KZB A;  4JV5 K;  1Y64 A;  4DV5 K;  1NJW A;  4JN4 A;  3ENO A;  3ZSR A;  1JLG A;  3DI6 A;  2PYJ A;  1Z6R A;  4IOX A;  5JLF A;  3OYH A;  3SJJ A;  4BG8 A;  4NCG A;  3TAB A;  2PFU A;  1F21 A;  3VQ4 A;  4PUO A;  1ZBS A;  2FBX A;  2O8C B;  2ITM A;  1K8K A;  3V1O A;  4JK7 A;  2E1Z A;  2F7T A;  4F3T A;  2ASM A;  1HNW K;  4B3O A;  4F2S A;  3LP0 A;  4N56 A;  3KLF A;  1VQO N;  1Q8I A;  2F9W A; 
#chains in the Genus database with same CATH homology
 2FF6 A;  3R8E A;  3UKR A;  2QWL A;  2YHY A;  3E9O A;  4IO8 A;  2IVP A;  4ILH A;  3ZX0 A;  2CH5 A;  3L4I A;  3U9D A;  3VOV A;  4XH4 A;  3FR0 A;  3C7N A;  3CJ7 A;  4MLH A;  4Y0W A;  2NLX A;  4BRC A;  1TYQ B;  3BEX A;  4ILG B;  2A3Z A;  5JIC A;  1BDG A;  4WFB L;  5JLH A;  3OHR A;  2GWK A;  2Q97 A;  4QS7 A;  2PAV A;  4JD2 B;  4MDA A;  4YOW A;  4JNE A;  1YJW N;  4YOU A;  1IJJ A;  3MN5 A;  2Q36 A;  5GIP A;  3SMS A;  2NRW A;  5FPD A;  3GOI A;  4B1U B;  1RGI A;  1VAZ A;  3O5B A;  1JCF A;  1QZ6 A;  3R3L A;  4FPB A;  5ADX H;  1SS6 A;  2GWJ A;  2CGJ A;  1K9M O;  1DT9 A;  3O9U A;  4K25 A;  3VEZ A;  1E4G T;  2QA4 N;  1NM1 A;  3GBT A;  1ATS A;  3O9T A;  1GLE G;  4CZG A;  4M7X A;  3E9L A;  3JS6 A;  3MWP A;  4K43 A;  5DM6 L;  4KH6 A;  2NRX A;  4JKH A;  3CPW M;  3ZEU A;  4CBW A;  3DLL L;  2YHW A;  5BR9 A;  5AQG A;  3CC4 N;  3BF3 A;  3D2E B;  1S3X A;  1YJ9 N;  3MK6 A;  4A2A A;  4B1V A;  3CCU N;  3AAP A;  3CCE N;  5F2R A;  4BRL A;  3WUH A;  5AQH A;  2P9S B;  4JKG B;  4EHU A;  5C2F A;  2P9P A;  5BPM A;  1MWK A;  2P9I A;  3SAH A;  3CCR N;  4H0O A;  5M1N A;  3HM8 A;  4RTF D;  3C6H A;  1OVY A;  1WOQ A;  4FOE A;  4CI6 A;  3SBG A;  5AQN A;  3LDL A;  4O8K A;  4JKE A;  3WQT A;  2QTD A;  1K73 O;  2NRT A;  2E88 A;  3VPZ A;  2E2O A;  2BTF A;  5JVG L;  4CZL A;  3KWG A;  1NGH A;  4MDB A;  4NLC A;  1OKJ A;  4A59 A;  4OPA A;  2HBK A;  4M7Y A;  4L3Q A;  1VQN N;  1X9J A;  3U8X A;  1ZC6 A;  4BRN A;  1QQO A;  5AFU H;  3O8M A;  4CZI A;  3K9J A;  1BO5 O;  4O8U A;  5BRF A;  3G6E N;  4BRD A;  1H1V A;  2P9U B;  1S72 N;  5M1O A;  2A5X A;  3H6E A;  1ILY A;  5CR4 A;  4GV6 A;  1Q18 A;  3M3Z A;  5CHI A;  3R6M A;  3TU5 A;  1K8K B;  4BRK A;  4F9O A;  3VF2 A;  3ATV A;  5HOO A;  3F2K A;  4BRQ A;  5AQQ A;  1WUA A;  3H46 O;  4JHD A;  1M1K O;  5H1S Q;  3A5O C;  2AP1 A;  1Q7Y O;  3CJA A;  3PLA A;  3RVC A;  4FSV A;  3QB0 A;  3UKR B;  4BR7 A;  3VTI A;  1VQ5 N;  1KAX A;  4YDU C;  4A61 A;  4FWQ A;  3SAF A;  4GNI A;  2E1Y A;  4PKH A;  1E4F T;  3M6G A;  5AQT A;  3J7Z O;  1XC3 A;  3C7N B;  2KLA A;  4H03 B;  4FOI A;  1HJO A;  3VEX A;  3MX2 A;  4WQ4 C;  3WXK A;  1U2V A;  3VEW A;  2D0O A;  4U7B A;  1QVG M;  1YJN N;  3H3O B;  3CCQ N;  4B1X B;  4BQL A;  1YIT N;  1KQS M;  2IVN A;  3H1Q A;  1T6D A;  1C0F A;  3TTC A;  3MCP A;  1T44 A;  3B8A X;  3J8A A;  5C10 A;  3EL2 A;  3LDN A;  4JEP A;  2E8A A;  1GLD G;  3CQY A;  5GAG P;  3LDP A;  3CD6 N;  5BN9 A;  2WBN A;  2W41 A;  4FWO A;  4IWV A;  5FPM A;  3WT0 A;  5C12 A;  4BY9 C;  1R59 O;  2HBM A;  4FWM A;  1VQK N;  5AFU A;  1M90 O;  2E2Q A;  2HF4 A;  3GDQ A;  1RFQ A;  2FSK A;  1ZXO A;  3ZEU B;  1NGF A;  1HLU A;  2FF3 B;  3MDQ A;  5BRE A;  5I9E B;  1SAZ A;  4NO7 A;  3A5M C;  2A40 A;  4YOY A;  1KD1 O;  5AQU A;  2WC9 A;  4BVP A;  4IXC A;  4BG9 A;  3QBW A;  5AQR A;  4BRO A;  4C23 A;  3MN7 A;  2ZJR L;  2FSJ A;  3VGL A;  2P9P B;  3VGM A;  2P9I B;  3BP8 A;  2JWL A;  2P9N A;  2V51 B;  3CCJ N;  4ISE A;  3E66 A;  3AY9 A;  3VF4 A;  2ZJQ L;  2I7N A;  1BA1 A;  1S22 A;  4JKC A;  3P4I A;  3CJC A;  3DXK A;  3WXI A;  3CJB A;  3WEE A;  3TTD A;  4BRP A;  1JJ2 M;  3R1X A;  5BRD A;  3CCM N;  4CBU A;  2D0P A;  3CIP A;  5JMV A;  1D4X A;  3MWT A;  2ASO A;  4YDU A;  2E2N A;  3CC2 N;  2HST A;  3G71 N;  3L4Q A;  4IJN A;  2WUS A;  2GEL A;  3IFR A;  1ESV A;  3MCA B;  3D2F A;  3P39 A;  1QQM A;  3QBX A;  1VQ8 N;  3NVK A;  5F1X A;  1Q82 O;  1GLA G;  3KHY A;  3AGR A;  3EE8 A;  5AQW A;  2UYT A;  2A41 A;  3ZX2 A;  2HBJ A;  4YOR A;  1X3N A;  4IFE A;  5DM7 L;  1GLB G;  3P31 A;  5AQL A;  4IJA A;  5E84 A;  3WXM B;  3O4W A;  4KBO A;  4WFN L;  1ATR A;  1NGJ A;  3CCS N;  3HI0 A;  3QDK A;  4QS8 A;  3UKU A;  3FZF A;  4FPA A;  4NLB A;  1VQ7 N;  3GE1 A;  3CJ1 A;  2WFB A;  4JHD B;  4B1Y B;  3O1B A;  3L6Q A;  1VQP N;  5GAD P;  3SK3 A;  5AZI A;  1QHA A;  3S41 A;  3U9Z A;  3ULE A;  5KQD A;  4IEE A;  1TUY A;  4R79 A;  5MLC Q;  5GAH P;  1VQ4 N;  5HL7 L;  5AZJ A;  5F0X A;  3Q7B A;  5M1K A;  1NLV A;  2IIR A;  4U67 L;  4FL9 A;  5TKY A;  1QZ5 A;  3NMU A;  1U2V B;  3CI5 A;  4GV3 A;  2H3G X;  1J6Z A;  1V4T A;  1DEJ A;  2F9T A;  2P9K A;  3VET A;  2VYP A;  5GAE P;  3IUC A;  3ZYY X;  1W97 L;  4GY2 B;  5AQJ A;  4PKI A;  3FZL A;  2HMP A;  2W40 A;  4CZM A;  3VGK A;  4NB4 A;  4ILJ A;  5AQF A;  4QS9 A;  3IKM A;  5AQV A;  3OBY A;  2QWP A;  1NWK A;  4BRH A;  1LOT B;  5M1P A;  1NGD A;  5FPN A;  3T69 A;  3VMF B;  4CZJ A;  4DB3 A;  2NRV A;  4DQ8 A;  3KVG A;  1BWF O;  3D7E O;  1DKG D;  2HF3 A;  3PIP L;  3HTV A;  4EAH D;  1O13 A;  3O6W A;  1EQY A;  3HBT A;  4DCH A;  3CXC M;  1Q86 O;  3ZX3 A;  1YUW A;  3CER A;  5TKW A;  4RCH A;  1P90 A;  2QWQ A;  4BR2 A;  2AA4 A;  2JWK A;  4H0P A;  2E2P A;  2I7P A;  2YJE A;  4H5V A;  3TTF A;  5BPN A;  5GIO A;  4BRF A;  3OW2 M;  2OAN A;  3VEY A;  1VQ6 N;  3CQX A;  4FWP A;  3A8Y A;  2GX9 A;  2P9N B;  5M1Q A;  3C6A A;  5LY3 A;  1G99 A;  3DJC A;  2YHX A;  3HSC A;  3HRG A;  4H5W A;  4FWL A;  4BC5 A;  5B8H A;  3CF5 L;  4DKW A;  3DXK B;  3UB5 A;  4FWS A;  4BRG A;  2P9L A;  3O08 A;  5CE3 A;  3G4S N;  4BRE A;  4OO1 J;  4H0X B;  3WEE B;  3O1W A;  1BA0 A;  3HOT A;  3RSE A;  2YJF A;  1VQM N;  2CH6 A;  4E1J A;  4J8F A;  3LM2 A;  1NMD A;  4JKD A;  4BR9 A;  3K9K A;  3A5L C;  2KKZ A;  2NRR A;  1T3V A;  3HZ6 A;  3MN6 A;  4ISG A;  3D2F B;  4CZK A;  5C15 A;  2HOE A;  2VGN A;  3ENH A;  3VTH A;  4CZE A;  3OBW A;  5AQZ A;  2BH1 A;  2YI1 A;  1YI2 N;  4H0T B;  5KPR A;  3DAW A;  2RE2 A;  2QXL A;  3CHW A;  4IZ9 A;  3H1V X;  5KQ8 A;  4IEI A;  3H45 C;  3AGK A;  4JK8 A;  3VES A;  4XEI A;  1KXP A;  3DXM A;  4WQ5 C;  3I55 N;  1YIJ N;  5AQO A;  4AM6 A;  3VEO A;  2Q0U A;  4FWK A;  2FLO A;  3UKU B;  5EXW A;  4YOV A;  4C1N I;  3W0L A;  2NRH A;  2J4R A;  2NZT A;  3M5R A;  4H0Y B;  3TSP A;  5M1F A;  4HWI A;  2OTJ N;  3EZW A;  3JXU A;  3AAQ A;  4JKB A;  3ENB A;  3VEV A;  2ZGY A;  4CZF A;  1U6Z A;  3CME N;  5JVH L;  4CD3 A;  5AZI B;  2CGL A;  3ULE B;  4JK9 A;  2GEM A;  4MO5 A;  2Q2R A;  5AZJ B;  3ZET A;  4B9Q A;  2ASP A;  4OPH A;  5FPE A;  3FZM A;  1Z05 A;  2Q0R A;  5E26 A;  1NGB A;  4H5N A;  3E1Y A;  3MX5 A;  5AQM A;  1HUX A;  2QWM A;  3VER A;  4PL7 A;  4GV9 A;  2YCH A;  3C65 A;  3FFK B;  1K8A O;  2P9K B;  4BC4 A;  4I6M A;  2NNW A;  1MA9 B;  2EWS A;  3ID8 A;  4PL8 A;  4A62 A;  4BR0 A;  3FGU A;  4WQ4 A;  3CCL N;  3N4Q A;  3LDQ A;  2Q1N A;  3WXL A;  1MWM A;  3I33 A;  4H5R A;  5KPT A;  5LJW A;  2PBD A;  4CZH A;  2QM1 A;  5BN8 A;  3O9Q A;  5C0Y A;  3QFP A;  1RDW X;  4GVE A;  1NGG A;  1NGC A;  1TUU A;  3P38 A;  1BOT O;  4FWR A;  4KH4 A;  5AQK A;  3W3D A;  3GL1 A;  3VF6 A;  1YXQ A;  5ELZ A;  4FO0 A;  2OTL N;  2D4W A;  2V7Z A;  2ZWH A;  3PIO L;  2QEX N;  4CJ7 A;  4PHT X;  4WYB A;  2A42 A;  3ID6 A;  1C0G A;  4EFH A;  1P8Z A;  2GTD A;  1Q81 O;  5GIN A;  4DHY A;  3EKU A;  1YVN A;  3E9P A;  4Z94 A;  4WQ5 A;  4CD1 A;  1CZA N;  2ZF5 O;  3TSU A;  4H5T A;  3EKS A;  4IDH A;  3FZH A;  1KAZ A;  2ZJP L;  3FE1 A;  4PKG A;  4XH1 A;  3N4P A;  2VGM A;  1IG8 A;  4BRA A;  4C1N K;  2P9L B;  4A2B A;  1XUP O;  2CGK A;  4LC9 B;  3KWI A;  3O80 A;  3RSE B;  1VQ9 N;  1BG3 A;  2BUP A;  3SJH A;  4FWN A;  4JKF A;  5C2D A;  4BRM A;  5BPL A;  4UY8 O;  1X3M A;  1HKB A;  3KK7 A;  3EO3 A;  3FZK A;  4IOA L;  3U4L A;  3AAR A;  1GLL O;  4BGA A;  4A5A A;  1GLF O;  3CJ9 A;  5AQX A;  5AQS A;  4BVO A;  1TYQ A;  4B1Z A;  3MMV A;  4RWT A;  3F9M A;  3CET A;  3CCV N;  4BC2 A;  4BR4 A;  4JKA A;  1GLC G;  1XQS C;  3DXM B;  4M63 C;  3UE5 A;  4WFA L;  4JD2 A;  5KPZ A;  1HKG A;  1ATN A;  1NBW A;  3C0B A;  3L0Q A;  4BR5 A;  3I56 N;  4BQZ A;  3NVM A;  3Q7C A;  3SAG A;  3TPQ A;  2ZGZ A;  3O9S A;  3D6R A;  1QQN A;  1SQK A;  4JAX A;  3CC7 N;  1QVF M;  3GG4 A;  3M1F A;  3A5N C;  2E20 A;  3I8B A;  3LL3 A;  2DPN A;  1JCE A;  2V52 B;  3ZET B;  5ADX A;  1W2B M;  1EO1 A;  2VWB A;  5EY4 A;  3QML A;  3CMA N;  4IO9 L;  3SLC A;  1KAY A;  1SZ2 A;  3D2E A;  4AM7 A;  2KHO A;  4EIA A;  3VEN A;  2QWO A;  1HX1 A;  3A0I X;  1NJI O;  3TSQ A;  2P9S A;  4JKG A;  2IVO A;  4A5B A;  3ATU A;  2GUP A;  1NGE A;  4I6M B;  1HPM A;  3BF1 A;  4A57 A;  2VCP A;  1HKC A;  3LDO A;  3WXJ A;  1MDU B;  3BUZ B;  1BUP A;  3F5T A;  3FLC O;  5EVZ A;  1NGA A;  4BC3 A;  3H3N O;  5AR0 A;  1RDU A;  2HBL A;  4XH5 A;  3OA9 A;  2QW9 A;  3IDH A;  4K42 A;  5AQY A;  4WCE L;  2FSN A;  2RHK A;  2QWR A;  3QFU A;  2NRZ A;  2QI2 A;  3MN9 A;  3QIC A;  4KH5 A;  1V4S A;  2QWN A;  1LCU A;  1YHQ N;  1N8R O;  4HTL A;  3O9R A;  3KZB A;  3T7Z A;  4EHT A;  1Y64 A;  4IOC L;  3IMX A;  4G9Z A;  2YX6 A;  5EX5 A;  5EOY A;  4MLE A;  4JN4 A;  3DWL A;  3CPE A;  4ISF A;  3ENO A;  3R9P A;  5BRH A;  1Z6R A;  4IOX A;  5JLF A;  3LM9 A;  3SMP A;  4BG8 A;  2D1K A;  3SBT A;  5LJV A;  2P9U A;  5AQP A;  2PFU A;  4BGB A;  2A6A A;  2FXU A;  3WQU A;  4AF1 A;  3EN9 A;  1DGK N;  5AQI A;  4BRI A;  1ZBS A;  4FVU A;  4WF9 L;  3G25 A;  1YF5 L;  1K8K A;  2ITM A;  1VQL N;  1GLJ O;  4JK7 A;  4YOX A;  2E1Z A;  1NGI A;  2F7T A;  4B1W B;  4MO4 A;  4YOT A;  4K41 A;  2ASM A;  2Q31 A;  3EE9 A;  1KC8 O;  4O5F A;  1T6C A;  4H0V B;  4CBX A;  1JCG A;  1BU6 O;  1YAG A;  3HOS A;  1VQO N;  2V7Y A;  2F9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...