4GV3A

Structures of lassa and tacaribe viral nucleoproteins with or without 5 triphosphate dsrna substrate reveal a unique 3 -5 exoribonuclease mechanism to suppress type i interferon production
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
207
Chain Sequence
GAMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*(GTP)P*GP*GP*C)-3')
total genus 58
structure length 207
sequence length 214
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gv3A01
3MWTA 3MX2A 3Q7BA 4GV9A 4GV6A 3MWPA 4G9ZA 3R3LA 4GV3A 3MX5A 4GVEA 4FVUA 3Q7CA
chains in the Genus database with same CATH superfamily
1IKXA 4JKGA 3AVFA 3QEPA 5JS1A 1NGFA 3L8BA 1NKBA 2KFZA 2O8DA 5AZJA 4PHTX 4MLEA 1NNEA 4H0YB 5KRSA 2GUIA 4E0DA 4FVUA 1YUWA 3K59A 1T6CA 1F21A 4BACA 3CPEA 2UYTA 5AQXA 2NZTA 2E2QA 3M8PA 4CJUA 2HW3A 5BREA 1QQMA 3W3DA 1NGJA 5EU7A 3SQ2A 1VQMN 4JEPA 1SS6A 1HPMA 3U9DA 1YTAA 4IFVA 4G1QA 1N8RO 1K6YA 5LL6Z 3QEIA 1RBUA 2P9KB 3TI0A 1NGAA 2HNDA 3O3GA 3SCXA 1VQ7N 4KPYA 4BR7A 3DLGA 3V9SA 1CLQA 3NF6A 1VQ4N 1TKXA 1M90O 4FCYA 1IBLK 4PWDA 1VQNN 2IIRA 3CM6A 2O4IA 1YAGA 1TK5A 3I56N 5C2DA 4JAXA 3J7AP 3VQ4A 4IDKA 3VGMA 4FWSA 1BO5O 3CXCM 1P8ZA 3AO5A 3QNOA 1FW6A 4CE9A 5M1NA 3WXLA 4CJWA 4DLGA 1N6QA 3CCRN 2ATQA 4XH4A 5AZIA 3J8AA 1L5UA 4HTLA 3T3FA 1QZ5A 3HVRA 4WFNL 5HL7L 3SYZA 1D9DA 2F7TA 1JCGA 2KLAA 2YJFA 4CIEA 2HMPA 1KQSM 4EZ6A 1JLCA 2QWOA 1JXEA 2G8UA 3JSMA 4QS8A 4C1NK 1DT9A 1P90A 2QWNA 5AQGA 1OVYA 3SPZA 1U4BA 1N32K 2NRXA 3JAMO 2IVOA 4CFBA 4BDZA 4DUZK 4JHDA 4Y1DA 4DWIA 4CZLA 4H5RA 4ICLA 4JLHA 4B8CA 3KLFA 4FJJA 2V51B 5FPMA 3RMAA 3E9LA 2X6SA 4RTFD 3TSUA 1HQEA 2G8VA 4B9NA 3CG7A 4W5TA 1BOTO 3IFRA 4HCBA 4DSFA 4CBWA 4DSEA 1NMNA 2FLOA 1NGHA 4DV2K 5CYMA 4IOXA 1QQCA 1KVBA 3QIPA 4DU3A 1LAWA 1L3VA 2FSNA 3QO9A 1XC3A 4F3TA 1RCHA 3PV8A 3V9UA 1RBVA 5F2RA 4RW4A 1RDCA 2NRVA 3OYMA 3SQ4A 4W5NA 3U3YA 4GKKK 4LFAK 3BGRA 4OPKA 5DK5A 3QERA 4QAGA 4CJFA 4LSLA 2FBXA 3KWGA 5F0XA 3FZMA 2A40A 2GBZA 2GWJA 1NK8A 3O08A 4KH6A 3OYEA 3KLEA 2HSTA 5C42A 4KAZA 1TAQA 3CCEN 2QWMA 5AQIA 1BCOA 4YORA 3CPWM 4F2RA 5BRFA 2A41A 4O8UA 5C12A 4DTSA 4CF9A 4W5RA 4H5TA 1KFSA 1RTDA 1I39A 3RRHA 4DR7K 2YHYA 4BREA 2ETJA 3M3ZA 4FPBA 4FJKA 4M3WA 2YKMA 1WSJA 4V19S 4OGEA 3WXJA 5SWMA 3VEYA 2P51A 4KKOA 3EKSA 1HQUA 1DTQA 1KTQA 4Z4HA 4DLEA 3EY1A 3HXMA 1NK5A 2VYPA 3K5MA 1BQMA 4CBXA 3L2WA 3DAWA 5TKYA 3E01A 4B1UB 3LP0A 3AVKA 1CZ9A 2IAJA 5AQKA 3FFIA 3M6GA 3L2RA 4DU4A 2E4LA 4FJIA 1VSEA 1O1WA 3V9WA 1EO1A 3AGRA 3EZ5A 2CGLA 5BPNA 4CJ7A 2B4JA 1TYQB 2KQ2A 1WUAA 3ALYA 2WONA 3DRRA 5AQSA 3IS9A 4LF9K 1RT3A 3A5MC 3FLCO 4JKHA 3O9RA 2Q36A 4DQSA 3DXKB 4FSVA 3TTDA 1TK0A 1KCFA 1N33K 2VGMA 1FK9A 1RDUA 2HHWA 2P9NA 4F2SA 3O6WA 1RTHA 3THWB 3OYAA 4A2AA 3ENHA 1OH8A 4FWNA 3HPOA 4DS5A 4C8MA 1Y97A 4H5NA 1KLNA 4KB1A 1KAXA 1D5AA 1J5EK 5AZJB 1RTJA 2P9NB 2OYQA 4CK3A 1JJ2M 3V9ZA 4B9MA 3JYTA 2I5JA 3R6MA 4KRFA 3A8YA 3HL8A 5I9EB 2RKIA 1S22A 3SAFA 3T1HK 1U47A 1WSGA 1S1WA 4CIGA 2E88A 5C0YA 1ATNA 3QLHA 2D0AA 3V1OA 4BR9A 2P9IB 3M5RA 3C6AA 1REVA 2HVHA 4Z4FA 4M7YA 3ZT1A 4DV6K 3L2QA 3AO3A 1KAZA 2UXCK 4YOYA 3AA2A 4M7XA 3TAGA 2F8SA 2Y1JA 3H08A 3MK6A 4IFYA 3UKRA 4FM0A 1EETA 1Q81O 4C8LA 3MEEA 5AFUH 2AP1A 3CQYA 2O4GA 4E19A 3KLGA 4CGJA 2VG7A 4DFPA 4ELVA 3GDQA 3DLRA 3VERA 4LSNA 2UXBK 3NF9A 4IFEA 4DTOA 2DY4A 3GG4A 1BCMA 4HHTA 1RT6A 4ZHRA 2RF2A 1RDDA 4DR4K 3MN9A 3CFPA 3S3MA 1HUXA 2O8EB 1JCEA 1ZXOA 4OO1J 4C8KA 1C1BA 4QOZB 3D2FA 3V9XA 3SLCA 4OKKA 1WSIA 5JVGL 1SV5A 4IKFA 4M41A 3TSQA 4CIFA 1HLUA 4DV5K 2HBKA 4CK2A 3D2FB 5J1EA 5AQWA 3H45C 3AVMA 1UAXA 2YV0X 2IDOA 5IWAK 3OYFA 4C1NI 1H1VA 3VETA 1JLFA 5HRRA 3HOTA 1GOBA 4FLXA 1VRUA 4F4KA 1C1CA 3L3UA 4FWOA 4OKJA 1RBTA 1U2VB 4LY7A 4DQQA 1HRHA 4MQ3A 3A5OC 2YX6A 3DXKA 4C23A 4CZEA 3P31A 1ZBHA 3FR0A 2P9PA 2Q2RA 1EKEA 4EIAA 4BRIA 3VEOA 4U7BA 2KFNA 2E5LK 4NYFA 4FLVA 3LPTA 4JI6K 4DSIA 2P5GA 2HHTA 5JLHA 5C15A 2NLXA 4KH4A 3TARA 2NNWA 2E1ZA 1GLEG 4ELUA 1BU6O 2O8DB 2W42A 1WSFA 3TR8A 4CGHA 4HTUA 3DM2A 4BGAA 2G8WA 3MCPA 1J9AA 2PYJA 1NLVA 1XWLA 1NGEA 3KKSA 4KREA 4WFAL 2BGGA 4ZTFA 1D9FA 4FYDA 4H4OA 3FZHA 3QICA 2BE2A 2ASOA 1UOCA 1LV5A 1NJWA 1EWQA 3DYAA 3VESA 3TAEA 3DJCA 3H6EA 4DV0K 5FPEA 2HNZA 1WBDA 4KBOA 3KZBA 4CESA 3V6DA 5AQOA 1NOZA 3VMFB 4CF8A 1GLCG 3L2VA 3LAKA 1A5XA 1ZBFA 1S1UA 4BRGA 4MO5A 1SL0A 2RE2A 4BRAA 1YT3A 1M1KO 4K8ZA 3HTVA 4M3TA 4BRCA 1KLMA 1RT2A 4BR4A 3QEWA 4KTZA 1VRTA 3C6TA 3TSPA 4OVLA 5I42A 4UY8O 1NJYA 1JXBA 2QXFA 3I55N 2XY6A 2GUPA 1YHQN 3PSFA 3KJVA 2XY7A 4IJAA 5ADXH 4FZXC 5GINA 1IH7A 3R8EA 3HSTB 3P38A 5AQMA 4GNIA 3LDSA 2JLEA 4GMJB 3CJ9A 3VOVA 4E1JA 4CJ5A 3SBTA 1VQ9N 4HUFA 2VG5A 4B9UA 4ISFA 5T7BA 2E1YA 1KXPA 1WLJA 4F3OA 3WNHA 5GAEP 4B9TA 3LANA 1VQPN 2G8FA 3R3LA 1W0HA 4CGDA 3OBYA 3CCJN 4AM7A 5DMRA 3SQ1A 4JKDA 4IOCL 3TAPA 2JGUA 3QIOA 1D4XA 3DLEA 3LPUA 4JK7A 2P9PB 1C0GA 4H0TB 2WTUA 3ZT0A 5EXWA 4R5PA 4AILC 5J2PA 3P39A 3K58A 3PIPL 4CJTA 4FJMA 3FE1A 4A62A 4N41A 2BUPA 4YDUA 3ATVA 3S41A 4YOVA 2NRTA 4CZGA 4KTQA 5C2FA 3LWLA 2WUSA 4OPJA 5LMNK 4DU1A 3DRSA 4J2EA 1ESVA 4OLAA 3HOSA 1BIUA 3L2UA 5CZ1A 4HUEA 2Q3SA 3CJ7A 3WQTA 3SAHA 2IGIA 5FROA 1UA1A 1HJOA 2KKZA 3DI6A 3RVCA 1NGBA 3VQ8A 4BWMA 4H5WA 2A5XA 4IO9L 1IKWA 1VAZA 2YI1A 3WNFA 5BRHA 3O5BA 3VQEA 5BR8K 4IDHA 1G15A 1V4TA 1YF5L 1U45A 4CJLA 5B8HA 4WCEL 1IG9A 5J2MA 4CJRA 3K5NA 2HBLA 2Q97A 3SV3A 3RMCA 5GIPA 1W97L 4DQIA 1WN7A 3P83D 5IT9O 4BVPA 2P9LA 4WQ4A 2O8CB 1B92A 4Z4CA 2P9KA 3A5LC 2OANA 1NJIO 1DTTA 4JK9A 3BUZB 1IO2A 3HT3A 4DSJA 4K25A 4CHZA 3NGIA 2QM1A 5AQFA 1KRPA 1S3XA 5AQVA 3WEEB 2QWPA 4GVEA 3OYLA 1NKCA 1XNRK 3AARA 4QS7A 3C65A 1Z6RA 4NCGA 3VPZA 4M3RA 1S1VA 2DTUA 4LF8K 5KPTA 3S3NA 3SZ2A 4WQ5C 4YOUA 3SJHA 1XQSC 4R79A 5GAHP 1SKRA 5JLFA 1KAYA 3VA0A 4G9ZA 1RTIA 3KLIA 1YJWN 4WYBA 5DM6L 5BR9A 3AO1A 4RW8A 4FWRA 1FXXA 3K2PA 3MEGA 5E26A 3CERA 4CEAA 3LDPA 3ZEUB 2OTLN 4CD1A 4KHUA 5AQNA 4M3YA 3GE1A 2Z1JA 1CXUA 3AVCA 4I9LA 4DV7K 2OA8A 4HCCA 1JKHA 3O3HA 1WBBA 3E1YA 4DTUA 1LOTB 1SL1A 3FZFA 3EO3A 3VEXA 2KZZA 1C0TA 3SUPA 3BZKA 3VQCA 3QNNA 1RILA 3D6RA 3OS1A 3CC2N 2GV9A 2D0CA 1GOAA 4RW6A 1T44A 3GL1A 5AR0A 4DR6K 3B8AX 1WNSA 5KGXA 2V7YA 1ZYQA 5JICA 2ZWHA 4I7FA 1BWFO 4FM2A 1VSIA 2QKKA 4X65K 5AQTA 1FKOA 4E89A 3IUCA 4CJPA 2YHBA 3QFPA 5HRSA 3C0BA 5LMUK 2BH1A 1QZ6A 2YHAA 4NCBA 1HKBA 2QWQA 4M63C 2NRWA 4WQ5A 3K9JA 3WUHA 4E7JA 1S1XA 2F8TA 4DS4A 3ZT4A 1X9SA 5AQYA 3J7ZO 1VSJA 4KV8A 3PSIA 4DSKA 5M1KA 4ISEA 4XEIA 3ZSVA 4FK4A 1JLQA 5KPZA 1IG8A 3ENOA 1LW2A 3C94A 4I2PA 2H3GX 4N5SA 4H8KA 4BDPA 3WT0A 3DLKA 3QEVA 2QA4N 4A2BA 1LWCA 1JL2A 5HOOA 1X3MA 1HNVA 1VSKA 5KQDA 1BGXT 3DXMA 1L3TA 1EP4A 1X1PA 3AAPA 4YNQA 2FXUA 1HX1A 4JI2K 1L3UA 4DF4A 2EWSA 2HHHK 2XO7A 3SAGA 1D8YA 5AZIB 4MO4A 4OJRA 4B1WB 3K5LA 4FK0A 1WAFA 4JYAK 3NH0A 1T03A 3MCAB 3VQ7A 2P5OA 4DTJA 3JXUA 4JKBA 2Q31A 4IBNA 4HUGA 3Q7BA 4FOEA 2NRRA 4KI6A 3I33A 1VQLN 4A59A 3CFOA 3ZEUA 3CQXA 3LP3A 3H46O 3HBTA 3ZETA 1SKSA 1XI1A 4H0PA 3DMJA 2KW4A 4KO0A 3PY8A 3OVNA 4IG3A 3EYZA 3MXMA 4DTNA 5HRNA 5BN8A 3BY5A 2A6AA 1JLAA 4OPAA 4KTWA 2HMIA 4ELTA 4DR3K 5M1PA 3HK2A 3D0PA 2VWKA 4H5VA 3MN7A 4B1ZA 4GKJK 4B08A 2PZSA 5LY3A 3OYCA 1E3MA 2PYLA 1U04A 3O80A 3HI0A 4CFCA 4I9QA 4Z4EA 2E2OA 4KB0A 4EHTA 3OA9A 2IVNA 4FLWA 1IBMK 2PAVA 4BRPA 4H0VB 4C8NA 4CVNE 1Q86O 3L3VA 4NCAA 3AVNA 2HBJA 3NF8A 1HKGA 3Q7CA 4YHHK 3HSCA 4K42A 1LCUA 3CJ1A 1GLDG 4DFMA 5JVHL 1QSLA 4GV6A 4RWTA 4AQYK 4JNEA 1QVGM 3PX4A 1CZAN 3P5JA 1EXQA 2ZE2A 1YJ9N 4JV5K 5HRPA 3I8BA 4AH9A 4A5AA 4GV3A 3O4NA 1TVRA 4JI4K 4X64K 1HYSA 3T69A 1GLFO 1KSPA 4FLTA 4A5BA 4M42A 4O5FA 3OTOK 3KK7A 3KVGA 1NKEA 4JI5K 4DV4K 1CZBA 1XNQK 3ZYYX 4C8OA 3UKRB 3ZT3A 4PL8A 4DTPA 1VQ6N 3C6HA 4DTXA 3THYB 3NVKA 4BGBA 3ID8A 3HP9A 4FLZA 3E66A 5E84A 1YIJN 3NVMA 3SPYA 1A5VA 4OKEA 3CI5A 4NB4A 3THYA 5F1XA 1C0MA 4I6MB 2OPSA 1GOCA 3EE8A 2D5RA 1X9JA 2P9SA 4CJKA 3MEDA 5AQPA 4EZ9A 4DV1K 3WXKA 4FVMA 2HNYA 4NXNK 3VGKA 4JI1K 2F96A 2WOMA 2HBMA 1MU2A 3R1XA 4LD0A 2BDPA 4A61A 1XMQK 3FZLA 1I3AA 1TYQA 3AAQA 3LM9A 2CGJA 1HJRA 3THVA 4DFJA 4JN4A 4E7LA 3OS2A 4LFCK 3AVBA 3O1WA 3VENA 4BVOA 2YHWA 4Y0WA 3S3OA 4EAHD 3D45A 4WE1A 3F73A 3PUFA 2A1RA 2FF6A 1BA0A 3VF6A 4N47A 4I2QA 1IV0A 3LWMA 3SUOA 1FJGK 3LAMA 5FRMA 3KK2A 2GEMA 4Z4GA 2NRZA 3G0ZA 3VQQA 3IDHA 1U48A 2YHXA 2ZQBA 4AF1A 1QHAA 3VF4A 4B8AB 3D7EO 5JS2A 4DR5K 3K5OA 5AFUA 1NK9A 4LC9B 2UUAK 4FJLA 5HROA 1RT4A 4O0JA 1VQ8N 1GLJO 5M1OA 1YVNA 4CHYA 3SV4A 1ASUA 1S6PA 1TUYA 4IWVA 4DQRA 1S5JA 3RMDA 1SL2A 1N36K 2G8IA 1Q9XA 4JI8K 4BWJA 3AGKA 5EOYA 2B5JA 4FK2A 3CJCA 2E6LA 4HWIA 3VF2A 1YI2N 5EVZA 1FKPA 3VQBA 3ZX3A 4FJNA 3QEXA 2A3ZA 1I94K 2D0OA 3DWLA 1JCFA 5FDLA 1EQYA 1BL3A 3ENBA 1O13A 4FWLA 4CZMA 4LF4K 2KZMA 4MFBA 4CZJA 3OYIA 3W0LA 5LJWA 1HNIA 4E7IA 4YY3K 4FW2A 1TKDA 3VEVA 3VA3A 3SMSA 1NGIA 4M3UA 1NU0A 3U9ZA 2P9LB 1RDWX 4OPHA 4J2DA 3LDQA 2WFBA 2HVIA 1C0UA 4FLYA 3B6OA 3BP8A 4B3TK 4F9OA 4CEDA 4WF9L 2D0BA 3CC4N 3LL3A 1LAVA 3AA3A 3NAEA 3KTQA 4LH5A 4KH5A 2YKNA 3THXB 4E1NA 5ADXA 1WSEA 4BRQA 5I3UA 1QSYA 3IAYA 3VEWA 4B1XB 1Y64A 1C1AA 3OS0A 3OYKA 3CMAN 3NH2A 3WXIA 3TANA 1HR0K 2AJQA 2WC9A 5KQ8A 1NK7A 3GBTA 4XH1A 1OH6A 4KFBA 1W7AA 2E2NA 2BTFA 1T7PA 1C6VA 1RT1A 5FRNA 3WQUA 3A5NC 4B3RK 2P1JA 2ZGZA 2EHGA 3SUQA 3DOKA 3A0IX 3NF7A 3K9KA 5E41A 3MAQA 2HHUA 4BRHA 2NRHA 3VGLA 3VQPA 1S6QA 1IJJA 4J2BA 1MWMA 4FJXA 3V1QA 1VQKN 1RNHA 2HHVA 3I0SA 4CERA 3O8MA 1JL1A 1NK6A 2ZF5O 3H3NO 4L8RB 2OZSA 4CGIA 1OVQA 5MLCQ 2V52B 4O5BA 4FM1A 3C7NB 5H1SQ 3AA4A 1TKTA 2DFHA 5HBMA 3NCIA 4CEBA 4JS4A 1ASVA 3DRPA 3J7YP 2YCHA 3K0SA 1KC8O 2VWBA 2RN2A 4W5OA 3BEXA 3TTFA 2VG6A 3QESA 4KHSA 3HP6A 1QE1A 1VQON 1VSHA 3VQ5A 1NGGA 4W5QA 4MLHA 4CJ3A 3ZSRA 1QQOA 2YNIA 3DLHA 4BRFA 4H0XB 3ZSQA 4CEEA 3I8DA 4B9QA 4FPAA 4ILGB 1QHTA 4X62K 1WSHA 3ZX0A 1ITGA 1BI4A 3QETA 2OPRA 2P9UA 1Q82O 3OBWA 4NLCA 3SJJA 4IEIA 3M8RA 3SUNA 3CHWA 2X74A 3H1QA 3E9PA 3CJAA 1NJZA 1SKWA 2D4WA 4TSXA 3O9SA 1TAUA 4BQLA 2NUBA 3RRGA 3SK3A 2AA4A 4B1VA 4B9LA 2ZJQL 4IOAL 4L3QA 4FWKA 4BRDA 2FF3B 3CQ8A 1S9EA 4OGCA 3OHRA 2QK9A 2PY5A 5GAGP 1XC9A 3PIOL 2ITGA 4BY9C 1TL1A 1C0FA 2O8FA 2PFUA 4FL9A 3MX5A 1NOYA 2UU9K 4JK8A 2XY8A 1XHXA 3NE6A 1VSMA 3HPGA 3P1GA 3UKUA 4AHTA 5AJ3K 2O8FB 1VQ5N 2J4RA 3ZT2A 3QDKA 4MDAA 1NBWA 4JRQA 2UUCK 2VWJA 3LZJA 4MDBA 4U67L 3VQ6A 1WOQA 2YNFA 3IMXA 4DF8A 2ASPA 4PQUA 4BE0A 1JLGA 2HHXA 3PLAA 5EY4A 3C6UA 4B3SK 4K8XA 1XUPO 1YXQA 2X6NA 3O9QA 3WNEA 4FWMA 3OYDA 3T19A 3SQ0A 2BANA 3ASMA 3ID6A 4KHNA 4NO7A 1SUQA 1BA1A 2Z1IA 3SBGA 1NWKA 3O3FA 4BQZA 1YJNN 2LSNA 1DEJA 3UIQA 1RBRA 3WXMB 2W6KA 1U2VA 3O9TA 3L4IA 3KWIA 3KLHA 1QSSA 4GV9A 3P4IA 4DSLA 3VQAA 1VK0A 2F9TA 4DQPA 1RGIA 1RT5A 3BZCA 3ZSYA 4CJQA 3CCSN 3EEQA 1WB9A 4CGGA 1Z25A 4F8RA 4PY5A 3NH1A 2I7PA 5J2NA 5LJVA 1BISA 3VQ9A 2PBDA 2R7YA 2GWKA 1QQNA 3CIPA 4BRMA 4FO0A 1XMOK 4YOWA 4FXDA 2CH6A 4QCLA 4CJEA 2P9UB 3QINA 1NK0A 1OKJA 5AQZA 3ZSOA 3KD1E 3L4QA 2ZJPL 4JKAA 1DGKN 3U8XA 4DTMA 3S9HA 5KTQA 3VEZA 3RR7A 4KI4A 5FLXO 4KHQA 2UXDK 3UB5A 4CD3A 2VQFK 4PL7A 3TTCA 4AHSA 1TK8A 2IS3A 3OJSA 2FC0A 1E4FT 3LDLA 1YITN 4RW9A 2KTQA 4CF2A 2DFFA 1NG9A 1ZC6A 4JKEA 4AM6A 1KVAA 2FBVA 2O8CA 3AA5X 4BR5A 1TL3A 5JMVA 4BC3A 3OY9A 1T6DA 1HNZK 4X66K 1CXQA 2B6AA 4FJ5A 1BHLA 3UKUB 2YNGA 3U3GA 5HP1A 3DXMB 4JRPA 2F9WA 2HF3A 1OH5A 1Q18A 2FBYA 4CEZA 4BC5A 3FGUA 3FFKB 2VCPA 4CEFA 3VTIA 3RMBA 4ISGA 5BRDA 3G6EN 3QB0A 3G10A 1ZBUA 3HZ6A 3M1FA 3V4IA 4AHUA 2OTJN 4RCHA 5BPLA 4JI3K 2DPNA 4CGFA 3HM9A 4B3OA 2V7ZA 1T05A 1ASWA 4I6MA 3EN9A 4DB3A 3NBPA 2RHKA 1YTUA 1W2BM 4DKWA 1S72N 3TAFA 3EZWA 1B9DA 4FJ9A 3CD6N 4B3MK 4DUYK 2HHQA 4EP4A 2QXLA 3O1BA 4LH4A 3CCLN 4H0OA 5HLFA 4BRKA 3PO4A 2GX9A 1J53A 2QW9A 3SI6A 1DLOA 4YOTA 1HPZA 3F9MA 4BR0A 3QFUA 2ZM6K 3ZX2A 4E7KA 1BG3A 4O4GA 4M3ZA 2IVPA 3HM8A 3LDOA 4CBUA 4PKIA 1HNXK 1Q8IA 2E8AA 3ZSXA 4CZFA 4HVJA 4CCHA 1SZ2A 3OYJA 2QTDA 3EL2A 3ZSWA 4RG8A 1SAZA 2W6LA 4E7HA 1Q7YO 4CEOA 4JKGB 4JHDB 3LZIA 5CR4A 2Z1GA 1HKCA 4BE1A 3RTVA 2G8KA 3MXJA 2X78A 2IC3A 2Q1NA 1U6ZA 3JS6A 4CHPA 2HHSA 1HNWK 4AHVA 1HMVA 5KGWA 1L3SA 4CZIA 4DHYA 3VN5A 4EHUA 1ATRA 3AVGA 2Y1IA 3QBXA 5KI6A 3ZCMA 3NMUA 1QS4A 2ASMA 3M8QA 1NJXA 3N4QA 4CI6A 4H03B 1DKGD 1RFQA 4BG9A 3CFRA 5BPMA 3IKMA 3SNNA 2YJEA 4PKGA 4CFAA 1W9HA 1VSFA 4JD2A 4CZHA 3O4QA 2GELA 4K41A 2ZJRL 4CJVA 3MDQA 1LW0A 1N34K 5K14A 3J81O 1GLBG 1A5WA 2G8HA 3KKRA 3QMLA 4JS5A 4FJHA 4OLBA 2W40A 3AVIA 4DR2K 2IOCA 5AQRA 3ULEB 4IEEA 3MECA 3QBWA 3TWHA 4BDYA 2W41A 4O8KA 3G25A 1X9WA 3EE9A 4PKHA 2FBTA 1XHZA 3ISNC 4BE2A 2P9SB 2OPPA 3U4LA 3TAQA 4AHCA 3MMVA 3T7ZA 4Z4IA 5AQQA 4UQGA 4FWQA 3MXIA 4CJ4A 4JI0K 4XH5A 3CM5A 4FJ7A 2O8EA 1JLEA 3CETA 3ATUA 4B1YB 4CEQA 3KK3A 4ID5A 5ELZA 4FOIA 4IZ9A 1QVFM 3OYNA 2CH5A 5AQUA 5KRTA 3M8SA 3PX6A 1ILYA 1BUPA 1NK4A 4LFBK 3IG1A 3BDPA 5CE3A 3VQDA 4ILHA 2QWLA 2QWRA 4J2AA 3KD5E 1TV6A 3R9PA 4KHPK 4DQ8A 4Y1CA 3DLBA 2QKBA 1NMDA 3KHYA 4NLBA 4B9SA 3AV9A 1RDAA 3CC7N 4H4MA 5M1QA 4IJNA 3DOLA 3CMEN 3OJUA 3PX0A 4CFDA 4IG0A 3CJBA 3HO1A 4CECA 1NGCA 1MA9B 2F4VK 2XHBA 1VSDA 2Q0UA 3HRGA 1TGOA 4IXCA 1J5OA 1K8KA 5C10A 5KPRA 3V81A 4ILJA 2CGKA 3THWA 1V4SA 2YNHA 1Q9YA 2HB5A 1IKYA 3LALA 1RBSA 1K8KB 2D0PA 3HJFA 4PA1A 2UUBK 3IRXA 1KFDA 3O4WA 3TABA 4FZYA 4Q0BA 3FZKA 1S9GA 1QTMA 4JD2B 5SZTA 3NHGA 1BDGA 1T3VA 1G99A 3G71N 5A2QO 2FSKA 5AQLA 5AQHA 1RT7A 1VSLA 3MWPA 2KHOA 5M1FA 4BR2A 1IBKK 3ULEA 1EWRA 4B9VA 2RPIA 1K8AO 4PUOA 2OPQA 4E3SA 2ZGYA 4BRLA 3MN5A 3U6FA 4CHOA 1IKVA 3T1YK 3OYHA 4BG8A 3ZSZA 5TKWA 1TUUA 3UE5A 2I7NA 3J80O 3PO5A 1ZBSA 2XY5A 3NGYA 4WFBL 4LF7K 2A42A 5FPDA 1UA0A 1Z05A 4CF1A 4FZZA 3THXA 3WEEA 4CHNA 1N5YA 1HYZA 3NGZA 4DG1A 4IO8A 2GTDA 2O8BA 1GLLO 3EKUA 3CYMA 4M45A 2D1KA 2E2PA 3L0QA 4RW7A 3E9OA 4NYNA 3SMPA 3F9KA 1WAJA 2O8BB 2VGNA 1R59O 3OYGA 1HYVA 2QI2A 3RSEB 3K57A 3OW2M 4N76A 1ATSA 4DTRA 1X9MA 4QS9A 3F2KA 4BC4A 4E1MA 4YFUA 2FSJA 5CYQA 3CCMN 3RWUA 4DR1K 4GW6A 3RSEA 5GADP 2DFEA 3O9UA 2JWLA 1MDUB 4LF5K 1J6ZA 1Z26A 2Z1HA 3H3OB 4XIUA 2QEXN 2OZMA 1E4GT 1RDBA 5CHIA 2A1SA 1K73O 3WNGA 5C25A 4KHWA 1BI4B 4CHQA 3HVTA 5CZ2A 3AVHA 3MN6A 4BRNA 2HF4A 5J2QA 4WQ4C 5C24A 2OCEA 1YVUA 4CZKA 3LP1A 3V1RA 1J54A 4O0IA 4OX9K 4EP5A 3N4PA 3AVJA 3AO2A 3TAMA 5D3GA 2P9IA 3A2FA 3TPQA 3NDKA 1R0AA 3AVLA 4ID1A 3T1AA 3CCVN 1NM1A 5BN9A 2ITMA 3OYBA 1TKZA 2JWKA 1MWKA 2HOEA 5EX5A 5DM7L 4FW1A 3CCQN 4CF0A 4JI7K 3LM2A 4CK1A 4YOXA 3CCUN 3CF5L 2Q0RA 4LF6K 3H1VX 3D2EA 4GY2B 4FLUA 4A57A 3BF3A 4BROA 5FPNA 3HPHA 4KHYA 5CY4A 4DFKA 1ZBIA 2E20A 4K0KK 1LWEA 3D2EB 4N56A 3ZLJA 1KD1O 4Z94A 1SQKA 3KIOA 1UWBA 3F5TA 4EFHA 1T8EA 3VTHA 4CW7B 1OH7A 3C95A 3GOIA 4YDUC 2VQEK 1ZBLA 4M3XA 1EX4A 1GLAG 3AO4A 5AQJA 4O44A 5GIOA 3NFAA 3AVAA 2EX3A 1X3NA 2E6MA 2XRIA 3BF1A 3ITHA 3HYFA 3ULDA 4FJ8A 4CJSA 4GVMA 1NGDA 1U49A 1S1TA 3LP2A 4J8FA 3MX2A 3AY9A 1K9MO 4O55A 3C7NA 4FJGA 4JKFA 4DCHA 1JLBA 4NXMK 4AHRA 4ZTJA 3ZETB 1B9FA 1LWFA 4K43A 4Z0UA 4Q5VA 3RR8A 1VHXA 4DMNA 2WBNA 3L6QA 3TU5A 3MWTA 1KVCA 3LDNA 3DLLL 3KK1A 3I0RA 2ZD1A 4BC2A 4JKCA 4DV3K 1BIZA 1BQNA 3B6PA 3G4SN 4FWPA
chains in the Genus database with same CATH topology
4JKGA 3NVKA 4BGBA 3ID8A 1NGFA 2QXLA 3O1BA 3VESA 3E66A 3DJCA 3H6EA 5AZJA 5E84A 4MLEA 4PHTX 4H0YB 3CCLN 4H0OA 1YIJN 5FPEA 3NVMA 4BRKA 2GX9A 3CI5A 2QW9A 4NB4A 4KBOA 3KZBA 4YOTA 5F1XA 3F9MA 1YUWA 4FVUA 5AQOA 4BR0A 3QFUA 3ZX2A 4I6MB 3VMFB 1BG3A 3EE8A 1GLCG 1X9JA 2P9SA 1T6CA 2IVPA 3HM8A 3LDOA 4PKIA 4CBUA 5AQPA 4BRGA 2E8AA 4MO5A 4CZFA 3CPEA 2RE2A 1SZ2A 3WXKA 2QTDA 3EL2A 4BRAA 2UYTA 5AQXA 2NZTA 3VGKA 1M1KO 1SAZA 3HTVA 4BRCA 2HBMA 4BR4A 2E2QA 3R1XA 1Q7YO 4A61A 4JKGB 4JHDB 3FZLA 5CR4A 1TYQA 3AAQA 3TSPA 3LM9A 1HKCA 4UY8O 2CGJA 5BREA 1QQMA 3W3DA 1NGJA 1VQMN 4JEPA 3I55N 2GUPA 2Q1NA 1U6ZA 4JN4A 1YHQN 1SS6A 1HPMA 3JS6A 4IJAA 5ADXH 3U9DA 3O1WA 3VENA 5GINA 4BVOA 2YHWA 4Y0WA 3R8EA 4CZIA 4DHYA 1N8RO 3P38A 1ATRA 5AQMA 4EAHD 4EHUA 4GNIA 2P9KB 3QBXA 1NGAA 3CJ9A 1VQ7N 2FF6A 3VOVA 4E1JA 3SBTA 1BA0A 1VQ9N 3VF6A 3NMUA 4BR7A 2ASMA 3N4QA 4CI6A 4H03B 1DKGD 1RFQA 4ISFA 2E1YA 4BG9A 1VQ4N 1KXPA 5BPMA 5GAEP 3IKMA 1M90O 2GEMA 2YJEA 4PKGA 2NRZA 3IDHA 1VQPN 2YHXA 3R3LA 4JD2A 4CZHA 1VQNN 4AF1A 1QHAA 2IIRA 1YAGA 2GELA 3OBYA 4K41A 3I56N 2ZJRL 3VF4A 4AM7A 3CCJN 5C2DA 3D7EO 3MDQA 4JAXA 4JKDA 4IOCL 5AFUA 1D4XA 4JK7A 4LC9B 3VGMA 4FWSA 1BO5O 3CXCM 1P8ZA 2P9PB 1VQ8N 1GLBG 1GLJO 1C0GA 4H0TB 5M1OA 5M1NA 1YVNA 3QMLA 3WXLA 5EXWA 3CCRN 3P39A 1TUYA 4IWVA 4XH4A 2W40A 3PIPL 5AZIA 3J8AA 5AQRA 3ULEB 3FE1A 4IEEA 4A62A 4HTLA 2BUPA 3QBWA 3AGKA 1QZ5A 5EOYA 4WFNL 5HL7L 3CJCA 4YDUA 2F7TA 2W41A 3ATVA 4HWIA 3G25A 4O8KA 1JCGA 3S41A 3VF2A 4YOVA 3EE9A 2KLAA 4PKHA 5EVZA 1YI2N 2NRTA 2YJFA 4CZGA 5C2FA 2HMPA 3ZX3A 2WUSA 2P9SB 1KQSM 2A3ZA 2QWOA 3U4LA 3MMVA 2D0OA 3DWLA 1JCFA 1EQYA 4QS8A 3ENBA 3T7ZA 1DT9A 1P90A 2QWNA 5AQGA 4C1NK 1OVYA 5AQQA 1ESVA 4FWQA 2NRXA 1O13A 4FWLA 4CZMA 3HOSA 2IVOA 4CZJA 4XH5A 4JHDA 3W0LA 3CJ7A 5LJWA 3WQTA 4CZLA 3SAHA 4H5RA 3VEVA 1HJOA 3CETA 2KKZA 3SMSA 3ATUA 1NGIA 3RVCA 1NGBA 2V51B 4B1YB 5FPMA 5ELZA 3E9LA 3U9ZA 2P9LB 1RDWX 4OPHA 4H5WA 3LDQA 2WFBA 4FOIA 4IZ9A 2A5XA 4IO9L 1QVFM 3BP8A 2CH5A 1VAZA 4RTFD 3TSUA 4F9OA 5AQUA 2YI1A 4WF9L 1ILYA 1BOTO 1BUPA 3LL3A 3IFRA 3CC4N 4CBWA 4KH5A 2FLOA 5BRHA 1NGHA 3O5BA 5CE3A 5ADXA 4BRQA 4IDHA 4IOXA 4ILHA 1V4TA 2QWLA 2QWRA 1YF5L 2FSNA 3VEWA 4B1XB 1Y64A 5B8HA 3R9PA 4WCEL 1XC3A 3CMAN 3WXIA 2HBLA 2Q97A 5F2RA 4DQ8A 2NRVA 5GIPA 1W97L 2WC9A 5KQ8A 3GBTA 4XH1A 1NMDA 3KHYA 4NLBA 2E2NA 3CC7N 2BTFA 4BVPA 5M1QA 4IJNA 2P9LA 3WQUA 3CMEN 3A5NC 4WQ4A 2ZGZA 2P9KA 3CJBA 3A0IX 3K9KA 3A5LC 2OANA 4BRHA 5F0XA 1NJIO 1NGCA 2NRHA 3VGLA 1MA9B 3FZMA 2A40A 2GWJA 1IJJA 4JK9A 2Q0UA 3HRGA 1MWMA 3O08A 4IXCA 4KH6A 1VQKN 3BUZB 1K8KA 5C10A 5KPRA 2HSTA 4K25A 3O8MA 2CGKA 4ILJA 3CCEN 2QWMA 2QM1A 1V4SA 2ZF5O 3H3NO 5AQIA 5AQFA 4YORA 1S3XA 5AQVA 3WEEB 3CPWM 2QWPA 5BRFA 4GVEA 2A41A 4O8UA 5C12A 1K8KB 5MLCQ 2V52B 3AARA 3C65A 4QS7A 3C7NB 1Z6RA 2D0PA 4H5TA 5H1SQ 3VPZA 1KC8O 2YCHA 2VWBA 5KPTA 2YHYA 3BEXA 3TTFA 4BREA 3M3ZA 3O4WA 4WQ5C 4FPBA 4YOUA 3SJHA 1XQSC 3FZKA 4R79A 5GAHP 5JLFA 1KAYA 4JD2B 4G9ZA 1VQON 1BDGA 1T3VA 1G99A 3G71N 3WXJA 1NGGA 1YJWN 4MLHA 2FSKA 1QQOA 4WYBA 5AQLA 5DM6L 5BR9A 5AQHA 4BRFA 4H0XB 4FWRA 3VEYA 4B9QA 3EKSA 5E26A 3CERA 4FPAA 3LDPA 4ILGB 3MWPA 3ZEUB 2KHOA 2OTLN 4CD1A 3ZX0A 5M1FA 2VYPA 4FWPA 5AQNA 4BR2A 3GE1A 3ULEA 4CBXA 3DAWA 5TKYA 2P9UA 1K8AO 4B1UB 1Q82O 3OBWA 4NLCA 4IEIA 2ZGYA 4BRLA 3MN5A 3E1YA 5AQKA 3M6GA 3CHWA 1LOTB 4BG8A 3FZFA 3H1QA 3EO3A 5TKWA 3E9PA 1TUUA 3CJAA 3UE5A 2I7NA 1EO1A 3VEXA 2D4WA 3AGRA 3O9SA 2CGLA 4BQLA 3SK3A 5BPNA 2AA4A 4B1VA 1ZBSA 4CJ7A 2ZJQL 4IOAL 1TYQB 4L3QA 4WFBL 3D6RA 4FWKA 1WUAA 2A42A 3CC2N 5FPDA 4BRDA 2FF3B 5AQSA 1Z05A 3OHRA 3A5MC 3FLCO 4JKHA 3WEEA 1T44A 3GL1A 5AR0A 5GAGP 3PIOL 4BY9C 3O9RA 1C0FA 2Q36A 2PFUA 3B8AX 4FL9A 2V7YA 3DXKB 3MX5A 4JK8A 4IO8A 2GTDA 5JICA 4FSVA 3TTDA 1GLLO 2ZWHA 2VGMA 3EKUA 1RDUA 1BWFO 3UKUA 2P9NA 3O6WA 2D1KA 2E2PA 3L0QA 3E9OA 3SMPA 4A2AA 2J4RA 3ENHA 5AQTA 1VQ5N 3IUCA 4FWNA 3QDKA 4H5NA 4MDAA 1KAXA 1NBWA 3QFPA 5AZJB 3C0BA 2VGNA 1R59O 2P9NB 4MDBA 2BH1A 1QZ6A 1JJ2M 1HKBA 2QWQA 4U67L 4M63C 2NRWA 2QI2A 3K9JA 1WOQA 4WQ5A 3WUHA 3IMXA 3R6MA 3RSEB 3OW2M 2ASPA 1ATSA 3A8YA 5AQYA 3J7ZO 4QS9A 3PLAA 3F2KA 5EY4A 4BC4A 2FSJA 5I9EB 3CCMN 5M1KA 1XUPO 1YXQA 3O9QA 1S22A 4FWMA 3RSEA 5GADP 3SAFA 3O9UA 2JWLA 3ID6A 4ISEA 1MDUB 4XEIA 4NO7A 1J6ZA 5KPZA 1IG8A 3H3OB 2QEXN 1BA1A 3ENOA 1E4GT 2E88A 3SBGA 5C0YA 1ATNA 1NWKA 2H3GX 4BR9A 5CHIA 1K73O 4BQZA 1YJNN 3WT0A 2P9IB 3M5RA 3C6AA 2QA4N 1DEJA 4A2BA 5HOOA 1X3MA 4M7YA 5KQDA 3DXMA 3AAPA 3WXMB 3MN6A 2FXUA 2HF4A 1HX1A 1U2VA 4BRNA 3O9TA 1KAZA 3L4IA 2EWSA 3KWIA 4YOYA 4M7XA 4GV9A 3SAGA 3P4IA 4WQ4C 5AZIB 3MK6A 2F9TA 3UKRA 4MO4A 4CZKA 1Q81O 1RGIA 4B1WB 5AFUH 2AP1A 3CQYA 3MCAB 3CCSN 3GDQA 3N4PA 3VERA 2I7PA 4IFEA 3JXUA 4JKBA 2P9IA 2Q31A 3GG4A 5LJVA 3TPQA 3Q7BA 4FOEA 2NRRA 2PBDA 3I33A 2GWKA 1VQLN 3CCVN 1NM1A 3MN9A 5BN9A 2ITMA 1QQNA 4A59A 2JWKA 3ZEUA 1MWKA 2HOEA 3CIPA 4BRMA 3CQXA 4FO0A 3H46O 5EX5A 3HBTA 1HUXA 2CH6A 5DM7L 4YOWA 3CCQN 1JCEA 3LM2A 3ZETA 1ZXOA 4YOXA 3CCUN 3CF5L 4H0PA 2P9UB 4OO1J 2Q0RA 1OKJA 5AQZA 3H1VX 3L4QA 2ZJPL 4JKAA 1DGKN 3D2EA 3D2FA 3SLCA 3U8XA 3VEZA 4GY2B 5JVGL 4A57A 3CD6N 3BF3A 4BROA 5BN8A 2A6AA 4OPAA 5FPNA 3TSQA 1HLUA 3UB5A 2HBKA 4CD3A 5M1PA 4PL7A 2E20A 3D2EB 3D2FB 3TTCA 4H5VA 5AQWA 3H45C 1KD1O 3MN7A 4Z94A 4B1ZA 1SQKA 1E4FT 5LY3A 4C1NI 1H1VA 3F5TA 3VETA 4EFHA 3LDLA 3O80A 3HI0A 3HOTA 3VTHA 2E2OA 1YITN 4EHTA 3GOIA 3OA9A 4FWOA 4YDUC 2IVNA 1U2VB 1ZC6A 1GLAG 2PAVA 4JKEA 3A5OC 2YX6A 4AM6A 4BRPA 5AQJA 3DXKA 4H0VB 4C23A 4CZEA 4BR5A 3P31A 5JMVA 4BC3A 1T6DA 5GIOA 3FR0A 2P9PA 2Q2RA 3UKUB 1Q86O 4EIAA 2HBJA 3VEOA 4BRIA 1HKGA 4U7BA 1X3NA 3Q7CA 3DXMB 3BF1A 2F9WA 2HF3A 1Q18A 4BC5A 3FGUA 3HSCA 5JLHA 4K42A 3FFKB 1LCUA 3CJ1A 5C15A 2NLXA 2VCPA 1GLDG 5JVHL 3VTIA 4GV6A 4ISGA 4KH4A 5BRDA 1NGDA 4RWTA 3G6EN 3QB0A 4JNEA 1QVGM 2NNWA 1CZAN 2E1ZA 3HZ6A 3M1FA 4J8FA 1YJ9N 3MX2A 1GLEG 3AY9A 1K9MO 3I8BA 1BU6O 3C7NA 4A5AA 4GV3A 2OTJN 4JKFA 4DCHA 4RCHA 5BPLA 3ZETB 4K43A 2DPNA 4BGAA 3T69A 3MCPA 2WBNA 1GLFO 2V7ZA 4I6MA 3EN9A 1NLVA 3L6QA 1NGEA 3MWTA 3TU5A 4A5BA 3LDNA 4DB3A 2RHKA 4O5FA 3KK7A 3KVGA 3DLLL 4WFAL 1W2BM 4DKWA 1S72N 3ZYYX 4BC2A 4JKCA 3UKRB 3EZWA 4PL8A 3FZHA 1VQ6N 3C6HA 3QICA 3G4SN 2ASOA 3KWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWT A;  3MX2 A;  3Q7B A;  4GV9 A;  4GV6 A;  3MWP A;  4G9Z A;  3R3L A;  4GV3 A;  3MX5 A;  4GVE A;  4FVU A;  3Q7C A; 
#chains in the Genus database with same CATH topology
 1IKX A;  4JKG A;  3AVF A;  3QEP A;  5JS1 A;  1NGF A;  3L8B A;  1NKB A;  2KFZ A;  2O8D A;  5AZJ A;  4PHT X;  4MLE A;  1NNE A;  4H0Y B;  5KRS A;  2GUI A;  4E0D A;  4FVU A;  1YUW A;  3K59 A;  1T6C A;  1F21 A;  4BAC A;  3CPE A;  2UYT A;  5AQX A;  2NZT A;  2E2Q A;  3M8P A;  4CJU A;  2HW3 A;  5BRE A;  1QQM A;  3W3D A;  1NGJ A;  5EU7 A;  3SQ2 A;  1VQM N;  4JEP A;  1SS6 A;  1HPM A;  3U9D A;  1YTA A;  4IFV A;  4G1Q A;  1N8R O;  1K6Y A;  5LL6 Z;  3QEI A;  1RBU A;  2P9K B;  3TI0 A;  1NGA A;  2HND A;  3O3G A;  3SCX A;  1VQ7 N;  4KPY A;  4BR7 A;  3DLG A;  3V9S A;  1CLQ A;  3NF6 A;  1VQ4 N;  1TKX A;  1M90 O;  4FCY A;  1IBL K;  4PWD A;  1VQN N;  2IIR A;  3CM6 A;  2O4I A;  1YAG A;  1TK5 A;  3I56 N;  5C2D A;  4JAX A;  3J7A P;  3VQ4 A;  4IDK A;  3VGM A;  4FWS A;  1BO5 O;  3CXC M;  1P8Z A;  3AO5 A;  3QNO A;  1FW6 A;  4CE9 A;  5M1N A;  3WXL A;  4CJW A;  4DLG A;  1N6Q A;  3CCR N;  2ATQ A;  4XH4 A;  5AZI A;  3J8A A;  1L5U A;  4HTL A;  3T3F A;  1QZ5 A;  3HVR A;  4WFN L;  5HL7 L;  3SYZ A;  1D9D A;  2F7T A;  1JCG A;  2KLA A;  2YJF A;  4CIE A;  2HMP A;  1KQS M;  4EZ6 A;  1JLC A;  2QWO A;  1JXE A;  2G8U A;  3JSM A;  4QS8 A;  4C1N K;  1DT9 A;  1P90 A;  2QWN A;  5AQG A;  1OVY A;  3SPZ A;  1U4B A;  1N32 K;  2NRX A;  3JAM O;  2IVO A;  4CFB A;  4BDZ A;  4DUZ K;  4JHD A;  4Y1D A;  4DWI A;  4CZL A;  4H5R A;  4ICL A;  4JLH A;  4B8C A;  3KLF A;  4FJJ A;  2V51 B;  5FPM A;  3RMA A;  3E9L A;  2X6S A;  4RTF D;  3TSU A;  1HQE A;  2G8V A;  4B9N A;  3CG7 A;  4W5T A;  1BOT O;  3IFR A;  4HCB A;  4DSF A;  4CBW A;  4DSE A;  1NMN A;  2FLO A;  1NGH A;  4DV2 K;  5CYM A;  4IOX A;  1QQC A;  1KVB A;  3QIP A;  4DU3 A;  1LAW A;  1L3V A;  2FSN A;  3QO9 A;  1XC3 A;  4F3T A;  1RCH A;  3PV8 A;  3V9U A;  1RBV A;  5F2R A;  4RW4 A;  1RDC A;  2NRV A;  3OYM A;  3SQ4 A;  4W5N A;  3U3Y A;  4GKK K;  4LFA K;  3BGR A;  4OPK A;  5DK5 A;  3QER A;  4QAG A;  4CJF A;  4LSL A;  2FBX A;  3KWG A;  5F0X A;  3FZM A;  2A40 A;  2GBZ A;  2GWJ A;  1NK8 A;  3O08 A;  4KH6 A;  3OYE A;  3KLE A;  2HST A;  5C42 A;  4KAZ A;  1TAQ A;  3CCE N;  2QWM A;  5AQI A;  1BCO A;  4YOR A;  3CPW M;  4F2R A;  5BRF A;  2A41 A;  4O8U A;  5C12 A;  4DTS A;  4CF9 A;  4W5R A;  4H5T A;  1KFS A;  1RTD A;  1I39 A;  3RRH A;  4DR7 K;  2YHY A;  4BRE A;  2ETJ A;  3M3Z A;  4FPB A;  4FJK A;  4M3W A;  2YKM A;  1WSJ A;  4V19 S;  4OGE A;  3WXJ A;  5SWM A;  3VEY A;  2P51 A;  4KKO A;  3EKS A;  1HQU A;  1DTQ A;  1KTQ A;  4Z4H A;  4DLE A;  3EY1 A;  3HXM A;  1NK5 A;  2VYP A;  3K5M A;  1BQM A;  4CBX A;  3L2W A;  3DAW A;  5TKY A;  3E01 A;  4B1U B;  3LP0 A;  3AVK A;  1CZ9 A;  2IAJ A;  5AQK A;  3FFI A;  3M6G A;  3L2R A;  4DU4 A;  2E4L A;  4FJI A;  1VSE A;  1O1W A;  3V9W A;  1EO1 A;  3AGR A;  3EZ5 A;  2CGL A;  5BPN A;  4CJ7 A;  2B4J A;  1TYQ B;  2KQ2 A;  1WUA A;  3ALY A;  2WON A;  3DRR A;  5AQS A;  3IS9 A;  4LF9 K;  1RT3 A;  3A5M C;  3FLC O;  4JKH A;  3O9R A;  2Q36 A;  4DQS A;  3DXK B;  4FSV A;  3TTD A;  1TK0 A;  1KCF A;  1N33 K;  2VGM A;  1FK9 A;  1RDU A;  2HHW A;  2P9N A;  4F2S A;  3O6W A;  1RTH A;  3THW B;  3OYA A;  4A2A A;  3ENH A;  1OH8 A;  4FWN A;  3HPO A;  4DS5 A;  4C8M A;  1Y97 A;  4H5N A;  1KLN A;  4KB1 A;  1KAX A;  1D5A A;  1J5E K;  5AZJ B;  1RTJ A;  2P9N B;  2OYQ A;  4CK3 A;  1JJ2 M;  3V9Z A;  4B9M A;  3JYT A;  2I5J A;  3R6M A;  4KRF A;  3A8Y A;  3HL8 A;  5I9E B;  2RKI A;  1S22 A;  3SAF A;  3T1H K;  1U47 A;  1WSG A;  1S1W A;  4CIG A;  2E88 A;  5C0Y A;  1ATN A;  3QLH A;  2D0A A;  3V1O A;  4BR9 A;  2P9I B;  3M5R A;  3C6A A;  1REV A;  2HVH A;  4Z4F A;  4M7Y A;  3ZT1 A;  4DV6 K;  3L2Q A;  3AO3 A;  1KAZ A;  2UXC K;  4YOY A;  3AA2 A;  4M7X A;  3TAG A;  2F8S A;  2Y1J A;  3H08 A;  3MK6 A;  4IFY A;  3UKR A;  4FM0 A;  1EET A;  1Q81 O;  4C8L A;  3MEE A;  5AFU H;  2AP1 A;  3CQY A;  2O4G A;  4E19 A;  3KLG A;  4CGJ A;  2VG7 A;  4DFP A;  4ELV A;  3GDQ A;  3DLR A;  3VER A;  4LSN A;  2UXB K;  3NF9 A;  4IFE A;  4DTO A;  2DY4 A;  3GG4 A;  1BCM A;  4HHT A;  1RT6 A;  4ZHR A;  2RF2 A;  1RDD A;  4DR4 K;  3MN9 A;  3CFP A;  3S3M A;  1HUX A;  2O8E B;  1JCE A;  1ZXO A;  4OO1 J;  4C8K A;  1C1B A;  4QOZ B;  3D2F A;  3V9X A;  3SLC A;  4OKK A;  1WSI A;  5JVG L;  1SV5 A;  4IKF A;  4M41 A;  3TSQ A;  4CIF A;  1HLU A;  4DV5 K;  2HBK A;  4CK2 A;  3D2F B;  5J1E A;  5AQW A;  3H45 C;  3AVM A;  1UAX A;  2YV0 X;  2IDO A;  5IWA K;  3OYF A;  4C1N I;  1H1V A;  3VET A;  1JLF A;  5HRR A;  3HOT A;  1GOB A;  4FLX A;  1VRU A;  4F4K A;  1C1C A;  3L3U A;  4FWO A;  4OKJ A;  1RBT A;  1U2V B;  4LY7 A;  4DQQ A;  1HRH A;  4MQ3 A;  3A5O C;  2YX6 A;  3DXK A;  4C23 A;  4CZE A;  3P31 A;  1ZBH A;  3FR0 A;  2P9P A;  2Q2R A;  1EKE A;  4EIA A;  4BRI A;  3VEO A;  4U7B A;  2KFN A;  2E5L K;  4NYF A;  4FLV A;  3LPT A;  4JI6 K;  4DSI A;  2P5G A;  2HHT A;  5JLH A;  5C15 A;  2NLX A;  4KH4 A;  3TAR A;  2NNW A;  2E1Z A;  1GLE G;  4ELU A;  1BU6 O;  2O8D B;  2W42 A;  1WSF A;  3TR8 A;  4CGH A;  4HTU A;  3DM2 A;  4BGA A;  2G8W A;  3MCP A;  1J9A A;  2PYJ A;  1NLV A;  1XWL A;  1NGE A;  3KKS A;  4KRE A;  4WFA L;  2BGG A;  4ZTF A;  1D9F A;  4FYD A;  4H4O A;  3FZH A;  3QIC A;  2BE2 A;  2ASO A;  1UOC A;  1LV5 A;  1NJW A;  1EWQ A;  3DYA A;  3VES A;  3TAE A;  3DJC A;  3H6E A;  4DV0 K;  5FPE A;  2HNZ A;  1WBD A;  4KBO A;  3KZB A;  4CES A;  3V6D A;  5AQO A;  1NOZ A;  3VMF B;  4CF8 A;  1GLC G;  3L2V A;  3LAK A;  1A5X A;  1ZBF A;  1S1U A;  4BRG A;  4MO5 A;  1SL0 A;  2RE2 A;  4BRA A;  1YT3 A;  1M1K O;  4K8Z A;  3HTV A;  4M3T A;  4BRC A;  1KLM A;  1RT2 A;  4BR4 A;  3QEW A;  4KTZ A;  1VRT A;  3C6T A;  3TSP A;  4OVL A;  5I42 A;  4UY8 O;  1NJY A;  1JXB A;  2QXF A;  3I55 N;  2XY6 A;  2GUP A;  1YHQ N;  3PSF A;  3KJV A;  2XY7 A;  4IJA A;  5ADX H;  4FZX C;  5GIN A;  1IH7 A;  3R8E A;  3HST B;  3P38 A;  5AQM A;  4GNI A;  3LDS A;  2JLE A;  4GMJ B;  3CJ9 A;  3VOV A;  4E1J A;  4CJ5 A;  3SBT A;  1VQ9 N;  4HUF A;  2VG5 A;  4B9U A;  4ISF A;  5T7B A;  2E1Y A;  1KXP A;  1WLJ A;  4F3O A;  3WNH A;  5GAE P;  4B9T A;  3LAN A;  1VQP N;  2G8F A;  3R3L A;  1W0H A;  4CGD A;  3OBY A;  3CCJ N;  4AM7 A;  5DMR A;  3SQ1 A;  4JKD A;  4IOC L;  3TAP A;  2JGU A;  3QIO A;  1D4X A;  3DLE A;  3LPU A;  4JK7 A;  2P9P B;  1C0G A;  4H0T B;  2WTU A;  3ZT0 A;  5EXW A;  4R5P A;  4AIL C;  5J2P A;  3P39 A;  3K58 A;  3PIP L;  4CJT A;  4FJM A;  3FE1 A;  4A62 A;  4N41 A;  2BUP A;  4YDU A;  3ATV A;  3S41 A;  4YOV A;  2NRT A;  4CZG A;  4KTQ A;  5C2F A;  3LWL A;  2WUS A;  4OPJ A;  5LMN K;  4DU1 A;  3DRS A;  4J2E A;  1ESV A;  4OLA A;  3HOS A;  1BIU A;  3L2U A;  5CZ1 A;  4HUE A;  2Q3S A;  3CJ7 A;  3WQT A;  3SAH A;  2IGI A;  5FRO A;  1UA1 A;  1HJO A;  2KKZ A;  3DI6 A;  3RVC A;  1NGB A;  3VQ8 A;  4BWM A;  4H5W A;  2A5X A;  4IO9 L;  1IKW A;  1VAZ A;  2YI1 A;  3WNF A;  5BRH A;  3O5B A;  3VQE A;  5BR8 K;  4IDH A;  1G15 A;  1V4T A;  1YF5 L;  1U45 A;  4CJL A;  5B8H A;  4WCE L;  1IG9 A;  5J2M A;  4CJR A;  3K5N A;  2HBL A;  2Q97 A;  3SV3 A;  3RMC A;  5GIP A;  1W97 L;  4DQI A;  1WN7 A;  3P83 D;  5IT9 O;  4BVP A;  2P9L A;  4WQ4 A;  2O8C B;  1B92 A;  4Z4C A;  2P9K A;  3A5L C;  2OAN A;  1NJI O;  1DTT A;  4JK9 A;  3BUZ B;  1IO2 A;  3HT3 A;  4DSJ A;  4K25 A;  4CHZ A;  3NGI A;  2QM1 A;  5AQF A;  1KRP A;  1S3X A;  5AQV A;  3WEE B;  2QWP A;  4GVE A;  3OYL A;  1NKC A;  1XNR K;  3AAR A;  4QS7 A;  3C65 A;  1Z6R A;  4NCG A;  3VPZ A;  4M3R A;  1S1V A;  2DTU A;  4LF8 K;  5KPT A;  3S3N A;  3SZ2 A;  4WQ5 C;  4YOU A;  3SJH A;  1XQS C;  4R79 A;  5GAH P;  1SKR A;  5JLF A;  1KAY A;  3VA0 A;  4G9Z A;  1RTI A;  3KLI A;  1YJW N;  4WYB A;  5DM6 L;  5BR9 A;  3AO1 A;  4RW8 A;  4FWR A;  1FXX A;  3K2P A;  3MEG A;  5E26 A;  3CER A;  4CEA A;  3LDP A;  3ZEU B;  2OTL N;  4CD1 A;  4KHU A;  5AQN A;  4M3Y A;  3GE1 A;  2Z1J A;  1CXU A;  3AVC A;  4I9L A;  4DV7 K;  2OA8 A;  4HCC A;  1JKH A;  3O3H A;  1WBB A;  3E1Y A;  4DTU A;  1LOT B;  1SL1 A;  3FZF A;  3EO3 A;  3VEX A;  2KZZ A;  1C0T A;  3SUP A;  3BZK A;  3VQC A;  3QNN A;  1RIL A;  3D6R A;  3OS1 A;  3CC2 N;  2GV9 A;  2D0C A;  1GOA A;  4RW6 A;  1T44 A;  3GL1 A;  5AR0 A;  4DR6 K;  3B8A X;  1WNS A;  5KGX A;  2V7Y A;  1ZYQ A;  5JIC A;  2ZWH A;  4I7F A;  1BWF O;  4FM2 A;  1VSI A;  2QKK A;  4X65 K;  5AQT A;  1FKO A;  4E89 A;  3IUC A;  4CJP A;  2YHB A;  3QFP A;  5HRS A;  3C0B A;  5LMU K;  2BH1 A;  1QZ6 A;  2YHA A;  4NCB A;  1HKB A;  2QWQ A;  4M63 C;  2NRW A;  4WQ5 A;  3K9J A;  3WUH A;  4E7J A;  1S1X A;  2F8T A;  4DS4 A;  3ZT4 A;  1X9S A;  5AQY A;  3J7Z O;  1VSJ A;  4KV8 A;  3PSI A;  4DSK A;  5M1K A;  4ISE A;  4XEI A;  3ZSV A;  4FK4 A;  1JLQ A;  5KPZ A;  1IG8 A;  3ENO A;  1LW2 A;  3C94 A;  4I2P A;  2H3G X;  4N5S A;  4H8K A;  4BDP A;  3WT0 A;  3DLK A;  3QEV A;  2QA4 N;  4A2B A;  1LWC A;  1JL2 A;  5HOO A;  1X3M A;  1HNV A;  1VSK A;  5KQD A;  1BGX T;  3DXM A;  1L3T A;  1EP4 A;  1X1P A;  3AAP A;  4YNQ A;  2FXU A;  1HX1 A;  4JI2 K;  1L3U A;  4DF4 A;  2EWS A;  2HHH K;  2XO7 A;  3SAG A;  1D8Y A;  5AZI B;  4MO4 A;  4OJR A;  4B1W B;  3K5L A;  4FK0 A;  1WAF A;  4JYA K;  3NH0 A;  1T03 A;  3MCA B;  3VQ7 A;  2P5O A;  4DTJ A;  3JXU A;  4JKB A;  2Q31 A;  4IBN A;  4HUG A;  3Q7B A;  4FOE A;  2NRR A;  4KI6 A;  3I33 A;  1VQL N;  4A59 A;  3CFO A;  3ZEU A;  3CQX A;  3LP3 A;  3H46 O;  3HBT A;  3ZET A;  1SKS A;  1XI1 A;  4H0P A;  3DMJ A;  2KW4 A;  4KO0 A;  3PY8 A;  3OVN A;  4IG3 A;  3EYZ A;  3MXM A;  4DTN A;  5HRN A;  5BN8 A;  3BY5 A;  2A6A A;  1JLA A;  4OPA A;  4KTW A;  2HMI A;  4ELT A;  4DR3 K;  5M1P A;  3HK2 A;  3D0P A;  2VWK A;  4H5V A;  3MN7 A;  4B1Z A;  4GKJ K;  4B08 A;  2PZS A;  5LY3 A;  3OYC A;  1E3M A;  2PYL A;  1U04 A;  3O80 A;  3HI0 A;  4CFC A;  4I9Q A;  4Z4E A;  2E2O A;  4KB0 A;  4EHT A;  3OA9 A;  2IVN A;  4FLW A;  1IBM K;  2PAV A;  4BRP A;  4H0V B;  4C8N A;  4CVN E;  1Q86 O;  3L3V A;  4NCA A;  3AVN A;  2HBJ A;  3NF8 A;  1HKG A;  3Q7C A;  4YHH K;  3HSC A;  4K42 A;  1LCU A;  3CJ1 A;  1GLD G;  4DFM A;  5JVH L;  1QSL A;  4GV6 A;  4RWT A;  4AQY K;  4JNE A;  1QVG M;  3PX4 A;  1CZA N;  3P5J A;  1EXQ A;  2ZE2 A;  1YJ9 N;  4JV5 K;  5HRP A;  3I8B A;  4AH9 A;  4A5A A;  4GV3 A;  3O4N A;  1TVR A;  4JI4 K;  4X64 K;  1HYS A;  3T69 A;  1GLF O;  1KSP A;  4FLT A;  4A5B A;  4M42 A;  4O5F A;  3OTO K;  3KK7 A;  3KVG A;  1NKE A;  4JI5 K;  4DV4 K;  1CZB A;  1XNQ K;  3ZYY X;  4C8O A;  3UKR B;  3ZT3 A;  4PL8 A;  4DTP A;  1VQ6 N;  3C6H A;  4DTX A;  3THY B;  3NVK A;  4BGB A;  3ID8 A;  3HP9 A;  4FLZ A;  3E66 A;  5E84 A;  1YIJ N;  3NVM A;  3SPY A;  1A5V A;  4OKE A;  3CI5 A;  4NB4 A;  3THY A;  5F1X A;  1C0M A;  4I6M B;  2OPS A;  1GOC A;  3EE8 A;  2D5R A;  1X9J A;  2P9S A;  4CJK A;  3MED A;  5AQP A;  4EZ9 A;  4DV1 K;  3WXK A;  4FVM A;  2HNY A;  4NXN K;  3VGK A;  4JI1 K;  2F96 A;  2WOM A;  2HBM A;  1MU2 A;  3R1X A;  4LD0 A;  2BDP A;  4A61 A;  1XMQ K;  3FZL A;  1I3A A;  1TYQ A;  3AAQ A;  3LM9 A;  2CGJ A;  1HJR A;  3THV A;  4DFJ A;  4JN4 A;  4E7L A;  3OS2 A;  4LFC K;  3AVB A;  3O1W A;  3VEN A;  4BVO A;  2YHW A;  4Y0W A;  3S3O A;  4EAH D;  3D45 A;  4WE1 A;  3F73 A;  3PUF A;  2A1R A;  2FF6 A;  1BA0 A;  3VF6 A;  4N47 A;  4I2Q A;  1IV0 A;  3LWM A;  3SUO A;  1FJG K;  3LAM A;  5FRM A;  3KK2 A;  2GEM A;  4Z4G A;  2NRZ A;  3G0Z A;  3VQQ A;  3IDH A;  1U48 A;  2YHX A;  2ZQB A;  4AF1 A;  1QHA A;  3VF4 A;  4B8A B;  3D7E O;  5JS2 A;  4DR5 K;  3K5O A;  5AFU A;  1NK9 A;  4LC9 B;  2UUA K;  4FJL A;  5HRO A;  1RT4 A;  4O0J A;  1VQ8 N;  1GLJ O;  5M1O A;  1YVN A;  4CHY A;  3SV4 A;  1ASU A;  1S6P A;  1TUY A;  4IWV A;  4DQR A;  1S5J A;  3RMD A;  1SL2 A;  1N36 K;  2G8I A;  1Q9X A;  4JI8 K;  4BWJ A;  3AGK A;  5EOY A;  2B5J A;  4FK2 A;  3CJC A;  2E6L A;  4HWI A;  3VF2 A;  1YI2 N;  5EVZ A;  1FKP A;  3VQB A;  3ZX3 A;  4FJN A;  3QEX A;  2A3Z A;  1I94 K;  2D0O A;  3DWL A;  1JCF A;  5FDL A;  1EQY A;  1BL3 A;  3ENB A;  1O13 A;  4FWL A;  4CZM A;  4LF4 K;  2KZM A;  4MFB A;  4CZJ A;  3OYI A;  3W0L A;  5LJW A;  1HNI A;  4E7I A;  4YY3 K;  4FW2 A;  1TKD A;  3VEV A;  3VA3 A;  3SMS A;  1NGI A;  4M3U A;  1NU0 A;  3U9Z A;  2P9L B;  1RDW X;  4OPH A;  4J2D A;  3LDQ A;  2WFB A;  2HVI A;  1C0U A;  4FLY A;  3B6O A;  3BP8 A;  4B3T K;  4F9O A;  4CED A;  4WF9 L;  2D0B A;  3CC4 N;  3LL3 A;  1LAV A;  3AA3 A;  3NAE A;  3KTQ A;  4LH5 A;  4KH5 A;  2YKN A;  3THX B;  4E1N A;  5ADX A;  1WSE A;  4BRQ A;  5I3U A;  1QSY A;  3IAY A;  3VEW A;  4B1X B;  1Y64 A;  1C1A A;  3OS0 A;  3OYK A;  3CMA N;  3NH2 A;  3WXI A;  3TAN A;  1HR0 K;  2AJQ A;  2WC9 A;  5KQ8 A;  1NK7 A;  3GBT A;  4XH1 A;  1OH6 A;  4KFB A;  1W7A A;  2E2N A;  2BTF A;  1T7P A;  1C6V A;  1RT1 A;  5FRN A;  3WQU A;  3A5N C;  4B3R K;  2P1J A;  2ZGZ A;  2EHG A;  3SUQ A;  3DOK A;  3A0I X;  3NF7 A;  3K9K A;  5E41 A;  3MAQ A;  2HHU A;  4BRH A;  2NRH A;  3VGL A;  3VQP A;  1S6Q A;  1IJJ A;  4J2B A;  1MWM A;  4FJX A;  3V1Q A;  1VQK N;  1RNH A;  2HHV A;  3I0S A;  4CER A;  3O8M A;  1JL1 A;  1NK6 A;  2ZF5 O;  3H3N O;  4L8R B;  2OZS A;  4CGI A;  1OVQ A;  5MLC Q;  2V52 B;  4O5B A;  4FM1 A;  3C7N B;  5H1S Q;  3AA4 A;  1TKT A;  2DFH A;  5HBM A;  3NCI A;  4CEB A;  4JS4 A;  1ASV A;  3DRP A;  3J7Y P;  2YCH A;  3K0S A;  1KC8 O;  2VWB A;  2RN2 A;  4W5O A;  3BEX A;  3TTF A;  2VG6 A;  3QES A;  4KHS A;  3HP6 A;  1QE1 A;  1VQO N;  1VSH A;  3VQ5 A;  1NGG A;  4W5Q A;  4MLH A;  4CJ3 A;  3ZSR A;  1QQO A;  2YNI A;  3DLH A;  4BRF A;  4H0X B;  3ZSQ A;  4CEE A;  3I8D A;  4B9Q A;  4FPA A;  4ILG B;  1QHT A;  4X62 K;  1WSH A;  3ZX0 A;  1ITG A;  1BI4 A;  3QET A;  2OPR A;  2P9U A;  1Q82 O;  3OBW A;  4NLC A;  3SJJ A;  4IEI A;  3M8R A;  3SUN A;  3CHW A;  2X74 A;  3H1Q A;  3E9P A;  3CJA A;  1NJZ A;  1SKW A;  2D4W A;  4TSX A;  3O9S A;  1TAU A;  4BQL A;  2NUB A;  3RRG A;  3SK3 A;  2AA4 A;  4B1V A;  4B9L A;  2ZJQ L;  4IOA L;  4L3Q A;  4FWK A;  4BRD A;  2FF3 B;  3CQ8 A;  1S9E A;  4OGC A;  3OHR A;  2QK9 A;  2PY5 A;  5GAG P;  1XC9 A;  3PIO L;  2ITG A;  4BY9 C;  1TL1 A;  1C0F A;  2O8F A;  2PFU A;  4FL9 A;  3MX5 A;  1NOY A;  2UU9 K;  4JK8 A;  2XY8 A;  1XHX A;  3NE6 A;  1VSM A;  3HPG A;  3P1G A;  3UKU A;  4AHT A;  5AJ3 K;  2O8F B;  1VQ5 N;  2J4R A;  3ZT2 A;  3QDK A;  4MDA A;  1NBW A;  4JRQ A;  2UUC K;  2VWJ A;  3LZJ A;  4MDB A;  4U67 L;  3VQ6 A;  1WOQ A;  2YNF A;  3IMX A;  4DF8 A;  2ASP A;  4PQU A;  4BE0 A;  1JLG A;  2HHX A;  3PLA A;  5EY4 A;  3C6U A;  4B3S K;  4K8X A;  1XUP O;  1YXQ A;  2X6N A;  3O9Q A;  3WNE A;  4FWM A;  3OYD A;  3T19 A;  3SQ0 A;  2BAN A;  3ASM A;  3ID6 A;  4KHN A;  4NO7 A;  1SUQ A;  1BA1 A;  2Z1I A;  3SBG A;  1NWK A;  3O3F A;  4BQZ A;  1YJN N;  2LSN A;  1DEJ A;  3UIQ A;  1RBR A;  3WXM B;  2W6K A;  1U2V A;  3O9T A;  3L4I A;  3KWI A;  3KLH A;  1QSS A;  4GV9 A;  3P4I A;  4DSL A;  3VQA A;  1VK0 A;  2F9T A;  4DQP A;  1RGI A;  1RT5 A;  3BZC A;  3ZSY A;  4CJQ A;  3CCS N;  3EEQ A;  1WB9 A;  4CGG A;  1Z25 A;  4F8R A;  4PY5 A;  3NH1 A;  2I7P A;  5J2N A;  5LJV A;  1BIS A;  3VQ9 A;  2PBD A;  2R7Y A;  2GWK A;  1QQN A;  3CIP A;  4BRM A;  4FO0 A;  1XMO K;  4YOW A;  4FXD A;  2CH6 A;  4QCL A;  4CJE A;  2P9U B;  3QIN A;  1NK0 A;  1OKJ A;  5AQZ A;  3ZSO A;  3KD1 E;  3L4Q A;  2ZJP L;  4JKA A;  1DGK N;  3U8X A;  4DTM A;  3S9H A;  5KTQ A;  3VEZ A;  3RR7 A;  4KI4 A;  5FLX O;  4KHQ A;  2UXD K;  3UB5 A;  4CD3 A;  2VQF K;  4PL7 A;  3TTC A;  4AHS A;  1TK8 A;  2IS3 A;  3OJS A;  2FC0 A;  1E4F T;  3LDL A;  1YIT N;  4RW9 A;  2KTQ A;  4CF2 A;  2DFF A;  1NG9 A;  1ZC6 A;  4JKE A;  4AM6 A;  1KVA A;  2FBV A;  2O8C A;  3AA5 X;  4BR5 A;  1TL3 A;  5JMV A;  4BC3 A;  3OY9 A;  1T6D A;  1HNZ K;  4X66 K;  1CXQ A;  2B6A A;  4FJ5 A;  1BHL A;  3UKU B;  2YNG A;  3U3G A;  5HP1 A;  3DXM B;  4JRP A;  2F9W A;  2HF3 A;  1OH5 A;  1Q18 A;  2FBY A;  4CEZ A;  4BC5 A;  3FGU A;  3FFK B;  2VCP A;  4CEF A;  3VTI A;  3RMB A;  4ISG A;  5BRD A;  3G6E N;  3QB0 A;  3G10 A;  1ZBU A;  3HZ6 A;  3M1F A;  3V4I A;  4AHU A;  2OTJ N;  4RCH A;  5BPL A;  4JI3 K;  2DPN A;  4CGF A;  3HM9 A;  4B3O A;  2V7Z A;  1T05 A;  1ASW A;  4I6M A;  3EN9 A;  4DB3 A;  3NBP A;  2RHK A;  1YTU A;  1W2B M;  4DKW A;  1S72 N;  3TAF A;  3EZW A;  1B9D A;  4FJ9 A;  3CD6 N;  4B3M K;  4DUY K;  2HHQ A;  4EP4 A;  2QXL A;  3O1B A;  4LH4 A;  3CCL N;  4H0O A;  5HLF A;  4BRK A;  3PO4 A;  2GX9 A;  1J53 A;  2QW9 A;  3SI6 A;  1DLO A;  4YOT A;  1HPZ A;  3F9M A;  4BR0 A;  3QFU A;  2ZM6 K;  3ZX2 A;  4E7K A;  1BG3 A;  4O4G A;  4M3Z A;  2IVP A;  3HM8 A;  3LDO A;  4CBU A;  4PKI A;  1HNX K;  1Q8I A;  2E8A A;  3ZSX A;  4CZF A;  4HVJ A;  4CCH A;  1SZ2 A;  3OYJ A;  2QTD A;  3EL2 A;  3ZSW A;  4RG8 A;  1SAZ A;  2W6L A;  4E7H A;  1Q7Y O;  4CEO A;  4JKG B;  4JHD B;  3LZI A;  5CR4 A;  2Z1G A;  1HKC A;  4BE1 A;  3RTV A;  2G8K A;  3MXJ A;  2X78 A;  2IC3 A;  2Q1N A;  1U6Z A;  3JS6 A;  4CHP A;  2HHS A;  1HNW K;  4AHV A;  1HMV A;  5KGW A;  1L3S A;  4CZI A;  4DHY A;  3VN5 A;  4EHU A;  1ATR A;  3AVG A;  2Y1I A;  3QBX A;  5KI6 A;  3ZCM A;  3NMU A;  1QS4 A;  2ASM A;  3M8Q A;  1NJX A;  3N4Q A;  4CI6 A;  4H03 B;  1DKG D;  1RFQ A;  4BG9 A;  3CFR A;  5BPM A;  3IKM A;  3SNN A;  2YJE A;  4PKG A;  4CFA A;  1W9H A;  1VSF A;  4JD2 A;  4CZH A;  3O4Q A;  2GEL A;  4K41 A;  2ZJR L;  4CJV A;  3MDQ A;  1LW0 A;  1N34 K;  5K14 A;  3J81 O;  1GLB G;  1A5W A;  2G8H A;  3KKR A;  3QML A;  4JS5 A;  4FJH A;  4OLB A;  2W40 A;  3AVI A;  4DR2 K;  2IOC A;  5AQR A;  3ULE B;  4IEE A;  3MEC A;  3QBW A;  3TWH A;  4BDY A;  2W41 A;  4O8K A;  3G25 A;  1X9W A;  3EE9 A;  4PKH A;  2FBT A;  1XHZ A;  3ISN C;  4BE2 A;  2P9S B;  2OPP A;  3U4L A;  3TAQ A;  4AHC A;  3MMV A;  3T7Z A;  4Z4I A;  5AQQ A;  4UQG A;  4FWQ A;  3MXI A;  4CJ4 A;  4JI0 K;  4XH5 A;  3CM5 A;  4FJ7 A;  2O8E A;  1JLE A;  3CET A;  3ATU A;  4B1Y B;  4CEQ A;  3KK3 A;  4ID5 A;  5ELZ A;  4FOI A;  4IZ9 A;  1QVF M;  3OYN A;  2CH5 A;  5AQU A;  5KRT A;  3M8S A;  3PX6 A;  1ILY A;  1BUP A;  1NK4 A;  4LFB K;  3IG1 A;  3BDP A;  5CE3 A;  3VQD A;  4ILH A;  2QWL A;  2QWR A;  4J2A A;  3KD5 E;  1TV6 A;  3R9P A;  4KHP K;  4DQ8 A;  4Y1C A;  3DLB A;  2QKB A;  1NMD A;  3KHY A;  4NLB A;  4B9S A;  3AV9 A;  1RDA A;  3CC7 N;  4H4M A;  5M1Q A;  4IJN A;  3DOL A;  3CME N;  3OJU A;  3PX0 A;  4CFD A;  4IG0 A;  3CJB A;  3HO1 A;  4CEC A;  1NGC A;  1MA9 B;  2F4V K;  2XHB A;  1VSD A;  2Q0U A;  3HRG A;  1TGO A;  4IXC A;  1J5O A;  1K8K A;  5C10 A;  5KPR A;  3V81 A;  4ILJ A;  2CGK A;  3THW A;  1V4S A;  2YNH A;  1Q9Y A;  2HB5 A;  1IKY A;  3LAL A;  1RBS A;  1K8K B;  2D0P A;  3HJF A;  4PA1 A;  2UUB K;  3IRX A;  1KFD A;  3O4W A;  3TAB A;  4FZY A;  4Q0B A;  3FZK A;  1S9G A;  1QTM A;  4JD2 B;  5SZT A;  3NHG A;  1BDG A;  1T3V A;  1G99 A;  3G71 N;  5A2Q O;  2FSK A;  5AQL A;  5AQH A;  1RT7 A;  1VSL A;  3MWP A;  2KHO A;  5M1F A;  4BR2 A;  1IBK K;  3ULE A;  1EWR A;  4B9V A;  2RPI A;  1K8A O;  4PUO A;  2OPQ A;  4E3S A;  2ZGY A;  4BRL A;  3MN5 A;  3U6F A;  4CHO A;  1IKV A;  3T1Y K;  3OYH A;  4BG8 A;  3ZSZ A;  5TKW A;  1TUU A;  3UE5 A;  2I7N A;  3J80 O;  3PO5 A;  1ZBS A;  2XY5 A;  3NGY A;  4WFB L;  4LF7 K;  2A42 A;  5FPD A;  1UA0 A;  1Z05 A;  4CF1 A;  4FZZ A;  3THX A;  3WEE A;  4CHN A;  1N5Y A;  1HYZ A;  3NGZ A;  4DG1 A;  4IO8 A;  2GTD A;  2O8B A;  1GLL O;  3EKU A;  3CYM A;  4M45 A;  2D1K A;  2E2P A;  3L0Q A;  4RW7 A;  3E9O A;  4NYN A;  3SMP A;  3F9K A;  1WAJ A;  2O8B B;  2VGN A;  1R59 O;  3OYG A;  1HYV A;  2QI2 A;  3RSE B;  3K57 A;  3OW2 M;  4N76 A;  1ATS A;  4DTR A;  1X9M A;  4QS9 A;  3F2K A;  4BC4 A;  4E1M A;  4YFU A;  2FSJ A;  5CYQ A;  3CCM N;  3RWU A;  4DR1 K;  4GW6 A;  3RSE A;  5GAD P;  2DFE A;  3O9U A;  2JWL A;  1MDU B;  4LF5 K;  1J6Z A;  1Z26 A;  2Z1H A;  3H3O B;  4XIU A;  2QEX N;  2OZM A;  1E4G T;  1RDB A;  5CHI A;  2A1S A;  1K73 O;  3WNG A;  5C25 A;  4KHW A;  1BI4 B;  4CHQ A;  3HVT A;  5CZ2 A;  3AVH A;  3MN6 A;  4BRN A;  2HF4 A;  5J2Q A;  4WQ4 C;  5C24 A;  2OCE A;  1YVU A;  4CZK A;  3LP1 A;  3V1R A;  1J54 A;  4O0I A;  4OX9 K;  4EP5 A;  3N4P A;  3AVJ A;  3AO2 A;  3TAM A;  5D3G A;  2P9I A;  3A2F A;  3TPQ A;  3NDK A;  1R0A A;  3AVL A;  4ID1 A;  3T1A A;  3CCV N;  1NM1 A;  5BN9 A;  2ITM A;  3OYB A;  1TKZ A;  2JWK A;  1MWK A;  2HOE A;  5EX5 A;  5DM7 L;  4FW1 A;  3CCQ N;  4CF0 A;  4JI7 K;  3LM2 A;  4CK1 A;  4YOX A;  3CCU N;  3CF5 L;  2Q0R A;  4LF6 K;  3H1V X;  3D2E A;  4GY2 B;  4FLU A;  4A57 A;  3BF3 A;  4BRO A;  5FPN A;  3HPH A;  4KHY A;  5CY4 A;  4DFK A;  1ZBI A;  2E20 A;  4K0K K;  1LWE A;  3D2E B;  4N56 A;  3ZLJ A;  1KD1 O;  4Z94 A;  1SQK A;  3KIO A;  1UWB A;  3F5T A;  4EFH A;  1T8E A;  3VTH A;  4CW7 B;  1OH7 A;  3C95 A;  3GOI A;  4YDU C;  2VQE K;  1ZBL A;  4M3X A;  1EX4 A;  1GLA G;  3AO4 A;  5AQJ A;  4O44 A;  5GIO A;  3NFA A;  3AVA A;  2EX3 A;  1X3N A;  2E6M A;  2XRI A;  3BF1 A;  3ITH A;  3HYF A;  3ULD A;  4FJ8 A;  4CJS A;  4GVM A;  1NGD A;  1U49 A;  1S1T A;  3LP2 A;  4J8F A;  3MX2 A;  3AY9 A;  1K9M O;  4O55 A;  3C7N A;  4FJG A;  4JKF A;  4DCH A;  1JLB A;  4NXM K;  4AHR A;  4ZTJ A;  3ZET B;  1B9F A;  1LWF A;  4K43 A;  4Z0U A;  4Q5V A;  3RR8 A;  1VHX A;  4DMN A;  2WBN A;  3L6Q A;  3TU5 A;  3MWT A;  1KVC A;  3LDN A;  3DLL L;  3KK1 A;  3I0R A;  2ZD1 A;  4BC2 A;  4JKC A;  4DV3 K;  1BIZ A;  1BQN A;  3B6P A;  3G4S N;  4FWP A; 
#chains in the Genus database with same CATH homology
 4JKG A;  3NVK A;  4BGB A;  3ID8 A;  1NGF A;  2QXL A;  3O1B A;  3VES A;  3E66 A;  3DJC A;  3H6E A;  5AZJ A;  5E84 A;  4MLE A;  4PHT X;  4H0Y B;  3CCL N;  4H0O A;  1YIJ N;  5FPE A;  3NVM A;  4BRK A;  2GX9 A;  3CI5 A;  2QW9 A;  4NB4 A;  4KBO A;  3KZB A;  4YOT A;  5F1X A;  3F9M A;  1YUW A;  4FVU A;  5AQO A;  4BR0 A;  3QFU A;  3ZX2 A;  4I6M B;  3VMF B;  1BG3 A;  3EE8 A;  1GLC G;  1X9J A;  2P9S A;  1T6C A;  2IVP A;  3HM8 A;  3LDO A;  4PKI A;  4CBU A;  5AQP A;  4BRG A;  2E8A A;  4MO5 A;  4CZF A;  3CPE A;  2RE2 A;  1SZ2 A;  3WXK A;  2QTD A;  3EL2 A;  4BRA A;  2UYT A;  5AQX A;  2NZT A;  3VGK A;  1M1K O;  1SAZ A;  3HTV A;  4BRC A;  2HBM A;  4BR4 A;  2E2Q A;  3R1X A;  1Q7Y O;  4A61 A;  4JKG B;  4JHD B;  3FZL A;  5CR4 A;  1TYQ A;  3AAQ A;  3TSP A;  3LM9 A;  1HKC A;  4UY8 O;  2CGJ A;  5BRE A;  1QQM A;  3W3D A;  1NGJ A;  1VQM N;  4JEP A;  3I55 N;  2GUP A;  2Q1N A;  1U6Z A;  4JN4 A;  1YHQ N;  1SS6 A;  1HPM A;  3JS6 A;  4IJA A;  5ADX H;  3U9D A;  3O1W A;  3VEN A;  5GIN A;  4BVO A;  2YHW A;  4Y0W A;  3R8E A;  4CZI A;  4DHY A;  1N8R O;  3P38 A;  1ATR A;  5AQM A;  4EAH D;  4EHU A;  4GNI A;  2P9K B;  3QBX A;  1NGA A;  3CJ9 A;  1VQ7 N;  2FF6 A;  3VOV A;  4E1J A;  3SBT A;  1BA0 A;  1VQ9 N;  3VF6 A;  3NMU A;  4BR7 A;  2ASM A;  3N4Q A;  4CI6 A;  4H03 B;  1DKG D;  1RFQ A;  4ISF A;  2E1Y A;  4BG9 A;  1VQ4 N;  1KXP A;  5BPM A;  5GAE P;  3IKM A;  1M90 O;  2GEM A;  2YJE A;  4PKG A;  2NRZ A;  3IDH A;  1VQP N;  2YHX A;  3R3L A;  4JD2 A;  4CZH A;  1VQN N;  4AF1 A;  1QHA A;  2IIR A;  1YAG A;  2GEL A;  3OBY A;  4K41 A;  3I56 N;  2ZJR L;  3VF4 A;  4AM7 A;  3CCJ N;  5C2D A;  3D7E O;  3MDQ A;  4JAX A;  4JKD A;  4IOC L;  5AFU A;  1D4X A;  4JK7 A;  4LC9 B;  3VGM A;  4FWS A;  1BO5 O;  3CXC M;  1P8Z A;  2P9P B;  1VQ8 N;  1GLB G;  1GLJ O;  1C0G A;  4H0T B;  5M1O A;  5M1N A;  1YVN A;  3QML A;  3WXL A;  5EXW A;  3CCR N;  3P39 A;  1TUY A;  4IWV A;  4XH4 A;  2W40 A;  3PIP L;  5AZI A;  3J8A A;  5AQR A;  3ULE B;  3FE1 A;  4IEE A;  4A62 A;  4HTL A;  2BUP A;  3QBW A;  3AGK A;  1QZ5 A;  5EOY A;  4WFN L;  5HL7 L;  3CJC A;  4YDU A;  2F7T A;  2W41 A;  3ATV A;  4HWI A;  3G25 A;  4O8K A;  1JCG A;  3S41 A;  3VF2 A;  4YOV A;  3EE9 A;  2KLA A;  4PKH A;  5EVZ A;  1YI2 N;  2NRT A;  2YJF A;  4CZG A;  5C2F A;  2HMP A;  3ZX3 A;  2WUS A;  2P9S B;  1KQS M;  2A3Z A;  2QWO A;  3U4L A;  3MMV A;  2D0O A;  3DWL A;  1JCF A;  1EQY A;  4QS8 A;  3ENB A;  3T7Z A;  1DT9 A;  1P90 A;  2QWN A;  5AQG A;  4C1N K;  1OVY A;  5AQQ A;  1ESV A;  4FWQ A;  2NRX A;  1O13 A;  4FWL A;  4CZM A;  3HOS A;  2IVO A;  4CZJ A;  4XH5 A;  4JHD A;  3W0L A;  3CJ7 A;  5LJW A;  3WQT A;  4CZL A;  3SAH A;  4H5R A;  3VEV A;  1HJO A;  3CET A;  2KKZ A;  3SMS A;  3ATU A;  1NGI A;  3RVC A;  1NGB A;  2V51 B;  4B1Y B;  5FPM A;  5ELZ A;  3E9L A;  3U9Z A;  2P9L B;  1RDW X;  4OPH A;  4H5W A;  3LDQ A;  2WFB A;  4FOI A;  4IZ9 A;  2A5X A;  4IO9 L;  1QVF M;  3BP8 A;  2CH5 A;  1VAZ A;  4RTF D;  3TSU A;  4F9O A;  5AQU A;  2YI1 A;  4WF9 L;  1ILY A;  1BOT O;  1BUP A;  3LL3 A;  3IFR A;  3CC4 N;  4CBW A;  4KH5 A;  2FLO A;  5BRH A;  1NGH A;  3O5B A;  5CE3 A;  5ADX A;  4BRQ A;  4IDH A;  4IOX A;  4ILH A;  1V4T A;  2QWL A;  2QWR A;  1YF5 L;  2FSN A;  3VEW A;  4B1X B;  1Y64 A;  5B8H A;  3R9P A;  4WCE L;  1XC3 A;  3CMA N;  3WXI A;  2HBL A;  2Q97 A;  5F2R A;  4DQ8 A;  2NRV A;  5GIP A;  1W97 L;  2WC9 A;  5KQ8 A;  3GBT A;  4XH1 A;  1NMD A;  3KHY A;  4NLB A;  2E2N A;  3CC7 N;  2BTF A;  4BVP A;  5M1Q A;  4IJN A;  2P9L A;  3WQU A;  3CME N;  3A5N C;  4WQ4 A;  2ZGZ A;  2P9K A;  3CJB A;  3A0I X;  3K9K A;  3A5L C;  2OAN A;  4BRH A;  5F0X A;  1NJI O;  1NGC A;  2NRH A;  3VGL A;  1MA9 B;  3FZM A;  2A40 A;  2GWJ A;  1IJJ A;  4JK9 A;  2Q0U A;  3HRG A;  1MWM A;  3O08 A;  4IXC A;  4KH6 A;  1VQK N;  3BUZ B;  1K8K A;  5C10 A;  5KPR A;  2HST A;  4K25 A;  3O8M A;  2CGK A;  4ILJ A;  3CCE N;  2QWM A;  2QM1 A;  1V4S A;  2ZF5 O;  3H3N O;  5AQI A;  5AQF A;  4YOR A;  1S3X A;  5AQV A;  3WEE B;  3CPW M;  2QWP A;  5BRF A;  4GVE A;  2A41 A;  4O8U A;  5C12 A;  1K8K B;  5MLC Q;  2V52 B;  3AAR A;  3C65 A;  4QS7 A;  3C7N B;  1Z6R A;  2D0P A;  4H5T A;  5H1S Q;  3VPZ A;  1KC8 O;  2YCH A;  2VWB A;  5KPT A;  2YHY A;  3BEX A;  3TTF A;  4BRE A;  3M3Z A;  3O4W A;  4WQ5 C;  4FPB A;  4YOU A;  3SJH A;  1XQS C;  3FZK A;  4R79 A;  5GAH P;  5JLF A;  1KAY A;  4JD2 B;  4G9Z A;  1VQO N;  1BDG A;  1T3V A;  1G99 A;  3G71 N;  3WXJ A;  1NGG A;  1YJW N;  4MLH A;  2FSK A;  1QQO A;  4WYB A;  5AQL A;  5DM6 L;  5BR9 A;  5AQH A;  4BRF A;  4H0X B;  4FWR A;  3VEY A;  4B9Q A;  3EKS A;  5E26 A;  3CER A;  4FPA A;  3LDP A;  4ILG B;  3MWP A;  3ZEU B;  2KHO A;  2OTL N;  4CD1 A;  3ZX0 A;  5M1F A;  2VYP A;  4FWP A;  5AQN A;  4BR2 A;  3GE1 A;  3ULE A;  4CBX A;  3DAW A;  5TKY A;  2P9U A;  1K8A O;  4B1U B;  1Q82 O;  3OBW A;  4NLC A;  4IEI A;  2ZGY A;  4BRL A;  3MN5 A;  3E1Y A;  5AQK A;  3M6G A;  3CHW A;  1LOT B;  4BG8 A;  3FZF A;  3H1Q A;  3EO3 A;  5TKW A;  3E9P A;  1TUU A;  3CJA A;  3UE5 A;  2I7N A;  1EO1 A;  3VEX A;  2D4W A;  3AGR A;  3O9S A;  2CGL A;  4BQL A;  3SK3 A;  5BPN A;  2AA4 A;  4B1V A;  1ZBS A;  4CJ7 A;  2ZJQ L;  4IOA L;  1TYQ B;  4L3Q A;  4WFB L;  3D6R A;  4FWK A;  1WUA A;  2A42 A;  3CC2 N;  5FPD A;  4BRD A;  2FF3 B;  5AQS A;  1Z05 A;  3OHR A;  3A5M C;  3FLC O;  4JKH A;  3WEE A;  1T44 A;  3GL1 A;  5AR0 A;  5GAG P;  3PIO L;  4BY9 C;  3O9R A;  1C0F A;  2Q36 A;  2PFU A;  3B8A X;  4FL9 A;  2V7Y A;  3DXK B;  3MX5 A;  4JK8 A;  4IO8 A;  2GTD A;  5JIC A;  4FSV A;  3TTD A;  1GLL O;  2ZWH A;  2VGM A;  3EKU A;  1RDU A;  1BWF O;  3UKU A;  2P9N A;  3O6W A;  2D1K A;  2E2P A;  3L0Q A;  3E9O A;  3SMP A;  4A2A A;  2J4R A;  3ENH A;  5AQT A;  1VQ5 N;  3IUC A;  4FWN A;  3QDK A;  4H5N A;  4MDA A;  1KAX A;  1NBW A;  3QFP A;  5AZJ B;  3C0B A;  2VGN A;  1R59 O;  2P9N B;  4MDB A;  2BH1 A;  1QZ6 A;  1JJ2 M;  1HKB A;  2QWQ A;  4U67 L;  4M63 C;  2NRW A;  2QI2 A;  3K9J A;  1WOQ A;  4WQ5 A;  3WUH A;  3IMX A;  3R6M A;  3RSE B;  3OW2 M;  2ASP A;  1ATS A;  3A8Y A;  5AQY A;  3J7Z O;  4QS9 A;  3PLA A;  3F2K A;  5EY4 A;  4BC4 A;  2FSJ A;  5I9E B;  3CCM N;  5M1K A;  1XUP O;  1YXQ A;  3O9Q A;  1S22 A;  4FWM A;  3RSE A;  5GAD P;  3SAF A;  3O9U A;  2JWL A;  3ID6 A;  4ISE A;  1MDU B;  4XEI A;  4NO7 A;  1J6Z A;  5KPZ A;  1IG8 A;  3H3O B;  2QEX N;  1BA1 A;  3ENO A;  1E4G T;  2E88 A;  3SBG A;  5C0Y A;  1ATN A;  1NWK A;  2H3G X;  4BR9 A;  5CHI A;  1K73 O;  4BQZ A;  1YJN N;  3WT0 A;  2P9I B;  3M5R A;  3C6A A;  2QA4 N;  1DEJ A;  4A2B A;  5HOO A;  1X3M A;  4M7Y A;  5KQD A;  3DXM A;  3AAP A;  3WXM B;  3MN6 A;  2FXU A;  2HF4 A;  1HX1 A;  1U2V A;  4BRN A;  3O9T A;  1KAZ A;  3L4I A;  2EWS A;  3KWI A;  4YOY A;  4M7X A;  4GV9 A;  3SAG A;  3P4I A;  4WQ4 C;  5AZI B;  3MK6 A;  2F9T A;  3UKR A;  4MO4 A;  4CZK A;  1Q81 O;  1RGI A;  4B1W B;  5AFU H;  2AP1 A;  3CQY A;  3MCA B;  3CCS N;  3GDQ A;  3N4P A;  3VER A;  2I7P A;  4IFE A;  3JXU A;  4JKB A;  2P9I A;  2Q31 A;  3GG4 A;  5LJV A;  3TPQ A;  3Q7B A;  4FOE A;  2NRR A;  2PBD A;  3I33 A;  2GWK A;  1VQL N;  3CCV N;  1NM1 A;  3MN9 A;  5BN9 A;  2ITM A;  1QQN A;  4A59 A;  2JWK A;  3ZEU A;  1MWK A;  2HOE A;  3CIP A;  4BRM A;  3CQX A;  4FO0 A;  3H46 O;  5EX5 A;  3HBT A;  1HUX A;  2CH6 A;  5DM7 L;  4YOW A;  3CCQ N;  1JCE A;  3LM2 A;  3ZET A;  1ZXO A;  4YOX A;  3CCU N;  3CF5 L;  4H0P A;  2P9U B;  4OO1 J;  2Q0R A;  1OKJ A;  5AQZ A;  3H1V X;  3L4Q A;  2ZJP L;  4JKA A;  1DGK N;  3D2E A;  3D2F A;  3SLC A;  3U8X A;  3VEZ A;  4GY2 B;  5JVG L;  4A57 A;  3CD6 N;  3BF3 A;  4BRO A;  5BN8 A;  2A6A A;  4OPA A;  5FPN A;  3TSQ A;  1HLU A;  3UB5 A;  2HBK A;  4CD3 A;  5M1P A;  4PL7 A;  2E20 A;  3D2E B;  3D2F B;  3TTC A;  4H5V A;  5AQW A;  3H45 C;  1KD1 O;  3MN7 A;  4Z94 A;  4B1Z A;  1SQK A;  1E4F T;  5LY3 A;  4C1N I;  1H1V A;  3F5T A;  3VET A;  4EFH A;  3LDL A;  3O80 A;  3HI0 A;  3HOT A;  3VTH A;  2E2O A;  1YIT N;  4EHT A;  3GOI A;  3OA9 A;  4FWO A;  4YDU C;  2IVN A;  1U2V B;  1ZC6 A;  1GLA G;  2PAV A;  4JKE A;  3A5O C;  2YX6 A;  4AM6 A;  4BRP A;  5AQJ A;  3DXK A;  4H0V B;  4C23 A;  4CZE A;  4BR5 A;  3P31 A;  5JMV A;  4BC3 A;  1T6D A;  5GIO A;  3FR0 A;  2P9P A;  2Q2R A;  3UKU B;  1Q86 O;  4EIA A;  2HBJ A;  3VEO A;  4BRI A;  1HKG A;  4U7B A;  1X3N A;  3Q7C A;  3DXM B;  3BF1 A;  2F9W A;  2HF3 A;  1Q18 A;  4BC5 A;  3FGU A;  3HSC A;  5JLH A;  4K42 A;  3FFK B;  1LCU A;  3CJ1 A;  5C15 A;  2NLX A;  2VCP A;  1GLD G;  5JVH L;  3VTI A;  4GV6 A;  4ISG A;  4KH4 A;  5BRD A;  1NGD A;  4RWT A;  3G6E N;  3QB0 A;  4JNE A;  1QVG M;  2NNW A;  1CZA N;  2E1Z A;  3HZ6 A;  3M1F A;  4J8F A;  1YJ9 N;  3MX2 A;  1GLE G;  3AY9 A;  1K9M O;  3I8B A;  1BU6 O;  3C7N A;  4A5A A;  4GV3 A;  2OTJ N;  4JKF A;  4DCH A;  4RCH A;  5BPL A;  3ZET B;  4K43 A;  2DPN A;  4BGA A;  3T69 A;  3MCP A;  2WBN A;  1GLF O;  2V7Z A;  4I6M A;  3EN9 A;  1NLV A;  3L6Q A;  1NGE A;  3MWT A;  3TU5 A;  4A5B A;  3LDN A;  4DB3 A;  2RHK A;  4O5F A;  3KK7 A;  3KVG A;  3DLL L;  4WFA L;  1W2B M;  4DKW A;  1S72 N;  3ZYY X;  4BC2 A;  4JKC A;  3UKR B;  3EZW A;  4PL8 A;  3FZH A;  1VQ6 N;  3C6H A;  3QIC A;  3G4S N;  2ASO A;  3KWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...