4IFEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
448
structure length
434
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 2 protein
total genus 145
structure length 434
sequence length 448
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ifeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifeA01
5CITA 3PUWA 1LB1B 1NN1A 2DFNA 4KLNA 4ARZA 3CRQA 4BGDA 1ZC4A 2RB4A 1OHHD 4WZAE 5KNBA 5HKKD 5AJVB 3NG1A 5AJWA 3SJBA 2RGEA 1Z6TA 5CDFA 3OHMA 2P0EA 1Z29A 3K1JA 2J7PD 3SEAA 3IIMA 4GZLA 1N6PA 1G7RA 1LF0A 1IN5A 3KKNA 2C04A 3C6AA 3RABA 3PEYA 1L2TA 2PEZA 1FMJA 2V3CC 2XZLA 4F93B 2G1JA 4I99A 1DS6A 3L0OA 1KO5A 4P4UA 4HZIA 3R7WA 3RS3A 2WWHA 2GJAA 3E5HA 2DYKA 5KDLA 3VR1A 2VHTA 1SHKA 1XD8A 3ZVNA 1JJ7A 2OLJA 2D2EA 2CLDX 3DEFA 5FBWB 2GDJA 4HAVA 2ZRDA 1SULA 3SE0A 4B74A 1Z6XA 5AR1A 2MMGA 4FWIB 5JWHA 2R62A 1E1QA 3PEWA 3IDQA 1Q1BA 1GTVA 3B1ZA 3CRVA 1ZIOA 3W34A 3IIJA 1U81A 2Q9AA 2PZFA 4LBWA 4CGZA 3G5UA 4NYMQ 4D81A 2B21A 3LX5A 4QC2A 1VKJA 4TYYA 3NEJA 3FDIA 1NIJA 1OFHA 3T1TA 2EFCB 1KSHA 3MRSA 3IKJA 1XTIA 4IRUB 4XVRA 1G6OA 2CBZA 1WBBA 1DAFA 2J3EA 4KYUA 5KNCA 3MWYW 2BMJA 1ZRHA 4OL0A 2QA5A 4QM6A 2ZRPA 3BGWA 3BIFA 4YMVA 3ASYA 3ZS8A 1O87A 1P73A 4PXAA 2J5XA 3QXXA 4C0BA 4ZDJA 5JEEA 5EXXA 4EJSB 5TARA 4TTRA 4LJ7A 4CDGA 4K81B 2IYQA 2R9VA 3BH6A 3U7HB 1EWRA 3KJGA 1VYUA 5GVRA 1N0UA 1P61B 5CK5A 5KDDA 4NHOA 2XSZD 4XTRA 1S3GA 2J45A 4FINA 4DHEA 1A2KC 2AKAB 3EC2A 1XMSA 3T61A 1W44A 2JDID 2O8FB 3FWYA 4ZCMA 4PC1A 1N5IA 1XB2A 2REBA 2KB0A 1Z07A 1NG9A 2O0HA 2ORVA 3R9XA 1IONA 4O2LA 3RRMA 1FP7A 3HJNA 4DCVA 1MO5A 1SKYE 2QZ4A 5C4MA 4QHYA 4B47A 5GJWC 1ELOA 3U6KA 1SKQA 3TUIC 4ZPXA 4A2WA 4Z1MA 4ASUA 5EE0A 3W3ZB 4O0MA 3SU8A 1BKDR 3ASZA 2DFKB 3AVXA 3CNLA 2FPLA 2WKQA 2AWNA 4C0AC 2ZYWX 3U3OA 4IJMA 4PPNA 2XZPA 2CNWD 2JATA 3I72A 3TBKA 4US2R 3BFKA 5GADl 1KAOA 3GEIA 1QHYA 2GA8A 2ZPTX 5FR1A 3TGPA 2EFDB 4C0QC 2NG1A 4DT1A 3QY0A 5F98A 1M2OB 4A6XA 1IAQA 2EQBA 4LYJA 1QHIA 3I4LA 2YVUA 2ZITA 5EP4A 1DAEA 1G17A 4JLDA 3HPQA 3RC3A 3EIEA 1WBDA 2HF9A 2N46A 4LBYA 3ZZ0A 3N70A 3QF7A 4OKSA 2R6CA 4QBGB 1E9FA 2IYLD 4Q1EA 5J47A 4XVQA 5SZHB 1FX0A 4D80A 4JLOA 2EWWA 1EWQA 1DTSA 4S35A 4BZXA 1NN5A 5JHGB 2B8TA 1Z3IX 1IHUA 5JRZA 2FH5B 1TQDA 2ZE7A 2FFHA 2Q21A 2QMHA 3BXZA 2K5UA 4D0GA 1SVSA 5HKKA 3M4YA 5KDOA 3QEOA 2QP3A 4M1KA 1AS3A 1KO4A 3C5CA 3FHOA 2J9RA 4B32A 4D2IA 1XEXA 2CK3D 3G82C 3AKCA 3DKVA 3TJZA 2HUPA 2NGRA 5C46F 4M22A 2SHKA 2ZROA 2CHVA 3GJ0A 2OV2A 5FTMA 4WBSA 1OJLA 1G3RA 2IYVA 4V03A 5CYOA 4E5UA 1TMKA 1P4SA 3GJ3A 2ZI3A 4BZQA 4TLEA 4XWKA 1QHNA 3TUJC 1JJVA 3B2EA 3NDBB 1LY1A 2E9SA 4CEJA 2WAYA 3CPJB 1U98A 1VCIA 4EKDA 2EVWX 2O0JA 3PVSA 2FG5A 3N2IA 2DWOA 4MGYR 3WYFA 4DSTA 4GI7A 2R6FA 2WOJA 1OIWA 1E9EA 3KTAB 3LVRE 5LB4A 5GJBA 5FR2A 1Y3AA 4MGZR 2AWOA 1W49A 2IYZA 4EPVA 1R0WA 1YJ5A 4DCUA 8OHMA 1FL9A 5KOYA 2BC9A 3WMGA 3QXCA 1SZPA 4PHTA 5HCIA 1XZQA 1F2TA 1KJWA 4A8JC 3NBXX 3TQCA 4GSYA 2ERXA 3NHBA 4P4TA 1KI4A 2QPTA 5A0FA 2V1UA 2VP4A 3TR0A 1JEEA 2UVQA 1CR2A 3THWB 5H1YA 1R7RA 3EX7C 4BFSA 1XTSA 3L0SA 5J4VA 5KSOA 4DLZA 3ZLJA 3PV0A 2HLDA 1FUKA 3EIQA 4P4SA 1YQTA 1SQ5A 1C4OA 3U7EB 1U90A 4HB4A 5SZIA 2WWIA 1OXVA 4HSEA 1BO6A 2R44A 2ANCA 4G1UC 1OH8A 2HF8A 3ECCA 1AA9A 2ZYUX 3KXIA 4C0KA 2IXGA 3I92A 3GLGB 1YHNA 1KDOA 2I1QA 4CEJB 2WAXA 3WNCA 2A78A 1MABA 3PENA 2QMEA 1ZD9A 2A5FA 1XXHA 5DGXA 4MKHA 5FL7D 4PZZA 1I2MA 3GLIB 5FL7A 1OKKD 3NXSA 1NVWQ 3LDAA 3TAHA 821PA 3KTAA 3QPVA 1E2FA 4KLZA 4LGMA 4HDCA 3SQXA 2ONJA 1F48A 2QTVB 3UXMA 1OFIA 2AX4A 2RCNA 4JT4A 4P32A 4DZZA 2QAGC 3KDSE 1E4YA 3KKOA 5EXSA 3U6BA 2HLDD 4C0HA 1KO7A 3DMNA 3DZDA 1N2CE 4TQ9A 3LBNA 2PJRA 4B34A 1KI6A 3CRW1 3BK7A 4C7OB 2GKSA 1TTTA 2UKDA 4HDQB 3WY9A 1IY2A 2IYTA 2ZJOA 3IQXA 5FI1B 3FPAA 2ZJ8A 2X77A 1YZTA 4OI0A 1CEEA 5JBQA 4TMVA 4CF7A 3WP0A 3RSOA 3PJRA 1P2TA 3THWA 3K53A 1CR1A 1CBUA 1DPFA 1E0KA 3PQCA 1XP8A 1VDZA 2FFQA 4D26A 1E9BA 3K0SA 2GTPA 2D2FA 3CLVA 3R20A 4LYAA 4A4DA 4PTLA 4BFTA 1KOFA 1II9A 2JGNA 4FMCF 2CE7A 4ESVA 3BB3A 3AVPA 4NP6A 2YYZA 4NYIQ 3QQ5A 3LBIA 5E95A 3LX8A 4JJKA 5F3WB 3GLGA 4MRVA 4WA7A 3CX8A 2GVZC 2O8EB 3TW4A 4EPWA 1J7KA 1XXHB 2QTHA 2JLQA 4HDOB 4IKEA 4QJ3A 2TMKA 5M1NA 3GLIA 1NNEA 2XAUA 2O5VA 1CP2A 1PLJA 2JJ1D 3IILA 2ODWA 3VQTA 5K8UA 5BWMA 4RD4A 1Z28A 3CW2A 4RJLA 1UEJA 4LYFA 3RRNA 1CJTC 4KFUA 3FFAA 1VHLA 2JA1A 5B2ZA 1GITA 1Z5ZA 2ZSFA 4IDPA 4PX9A 3VMFA 2FWRA 3ZDQA 1A2BA 1OIVA 2G6BA 2G0TA 5IRCD 4RD6A 2D7DA 1KI6B 1JAIA 1X1RA 3TMKA 2YNMA 1KGDA 4E07A 3THXB 3GJ5A 2XEXA 1W1WA 3QF4B 3ZH9B 4YC7A 2VPPA 4B3XA 3K9GA 3AVTA 1PLLA 3TSOA 2J0UA 3K0FB 1SXJE 2ZSBA 4B75A 1HUQA 1OFTA 3U7FB 3ICEA 4XIGS 4HAUA 3Q8XB 3E1SA 3RWMB 3PCRB 3R9IA 1DO2A 2CMKA 1KSJA 4M1YA 4PSKA 2IWRA 5AUNB 4U00A 1ZYUA 5E7MA 2GCPA 2V7QA 3KFXA 1E2NA 4KV9A 2GZAA 2JCSA 5IK2D 2ZU6A 1F60A 2IUTA 3GLIE 2EWVA 4ON9A 4PHGA 4BEBA 1YKSA 2QUZA 5TMPA 2F1IA 4A92A 2ZJAA 3I8XA 3AB3A 3SNHA 2WVJA 2A5GA 1GOTA 2OLKA 3VHLB 3VX3A 1GKIA 4AKGA 5EE9A 1JXOA 2GEUA 5ANRB 3VTKA 1IY0A 4Q66C 3TRFA 2GJSA 2F9LA 4HATA 1YR7A 1P9NA 3UPUA 1E0JA 2IS2A 4PPGA 2GEVA 3P32A 1RC8A 3DO6A 2PCLA 5AUOB 5G3YA 2D3WA 521PA 4HLCA 2ZETA 1GRRA 3DMDA 4JVLA 5DI9A 1KZGB 3QBVA 4GOXA 1G41A 4A9AA 5J4LA 5C15A 1SVMA 2PCJA 1ZD1A 3K70B 1COWA 3B1XA 1NLYA 5FBLB 1D2EA 4QGFA 3C15C 4XSHA 2R6GA 4RZ3A 2AD1A 2C9OA 4U7DA 4DWJA 4BFXA 3P27A 2QTFA 4G3XA 1Z83A 4IHQA 2ZVQX 1IQPA 3FKSA 1EESA 4Q01A 1XCMA 3QF4A 4MUBA 3KQUA 1HE8B 3T35A 4QFMA 1XDBA 1OYYA 3I62A 2ZI9A 4TLDA 2J0UB 4MYTA 1ZM9A 4PSVA 1E98A 1GKUB 1NVUQ 2J59A 1NN0A 1J8MF 1FPMA 3KFVA 2GXAA 3BJIC 4L8GA 3UMSA 2ZM5A 2XOKD 4LSGA 4DBLC 3B6EA 4Q9HA 1UKZA 5CLLA 1MKYA 1YRAA 1HA3A 2FA9A 4TMKA 2HT1A 3L8YA 4R71A 3AF2A 4J0QA 4RCZA 2F43A 2ZRMA 2FGJA 3EZ9A 3IEVA 4FMCB 4EFLA 2FSIA 2BBSA 1R5NA 2XSZA 1V5WA 1E9AA 3I3SR 1U94A 4M53A 4EDHA 5HR5A 2KBEA 1KSGA 1XTQA 1ZINA 1N6RA 1GUAA 1E2IA 2JASA 4O2RA 5C2JB 4R9UC 5L3VA 3EWSA 2WBLC 5EUQB 1W47A 1VECA 5DSZA 4AG5A 1GL6A 1Z6AA 3QKRB 2XXAB 2GXSA 5TB5A 4Q7MB 1YRBA 3X1XA 3T5GA 2D06A 3LA6A 4GMXA 4BECA 1GM5A 2C03A 3O8DA 2IUUA 3AVOA 3IBGA 1GP2A 2J0VA 4PQYA 2VQSA 5FPHA 5M1FA 4JVMA 2AR7A 3ZIAD 3VNVA 4IEEA 4AURA 1EFRD 1PVOA 2QEQA 2YWEA 1GVNB 2J0QA 2ECKA 4DUGD 2O0KA 2PT7A 2YWGA 1TQ4A 3CZQA 1II0A 1NBMD 2F1HA 1R5BA 2JJ2A 3FB4A 2JLWA 3C4JA 4LZZA 3TW8B 1Q21A 2ORWA 5C2DA 2H5EA 1JQJC 5TV2A 1RRPA 4D0NA 2IWHA 1M74A 3OE7D 4DRZA 2VP0A 1NVXQ 2OAP1 1G3IA 2JAQA 1Z6GA 1E4VA 2YOFA 4RFSA 1QHGA 2ZI4A 1Q0UA 2KSQA 3BE4A 4LOAA 4Q48A 1VG1A 1G8PA 2VA8A 3LQQA 5H8WA 2O8DA 3GJ4A 2WMOB 1S3SA 3WMEA 3ZJYA 4TMZA 3CF0A 2ZJBA 1DG3A 4V0KA 4A6PA 2IK8A 1D2MA 1G21E 2WOOA 2AK3A 2ZEJA 4M9SA 3TE6A 1A5TA 4RD3A 4GOJA 3BH0A 4LJYA 3BRWD 1E2JA 3O8CA 4RD0A 3Q85A 4GNKA 2EFGA 1YZNA 4TTPA 4LPSA 2GAAA 1F2UB 2WPDD 3VR4A 5AUPB 4N0DA 4B3DA 4NMMA 3SHFA 3H4MA 1H8ED 1IOZA 1VTKA 1AGPA 2LWIA 3AKEA 1R0ZA 1UKEA 4DXAA 1KDPA 2PZGA 2OT3B 2WWFA 4URUR 5M1OA 2NO9A 4W5WA 4IVQA 2GJ9A 2IBMA 4AKHA 3LD9A 4MH0R 5FH9A 4NKRA 2W6JA 2OAQ1 1O3YA 4HI0E 1OV4A 1E79D 4PPFA 1IN7A 2P5TB 1ZMXA 3ND9A 4BQSA 4IOKA 2FV8A 4UXHA 4KODA 2ZRCA 4RFSB 3LLUA 1NIPA 3I73A 4QOSA 3SBDA 2IHBA 4Q9JA 4DT1B 1XBTA 3P1JA 4B48A 4JLPA 4HLDA 2O8DB 1ZM7A 2DPXA 4C4PA 4DLWA 2ZE8A 1JXMA 2J7KA 1XEFA 3PXGA 3U61B 4JYBA 4KU4A 2MSDB 1X1SA 3AH8A 3DVLA 3FVQA 2A5YB 2WJIA 3KQLA 2EFHB 1Z0JA 2V54A 1F2UA 4TL8A 1DAGA 4KBFA 3CNNA 4Q9IA 5TVKA 2BM1A 4BLOA 2DFLA 1GNPA 2JEOA 4Z8YA 1CR0A 1N6IA 1U0JA 1UADA 4AYXA 2ZSDA 3I61A 4Q4AA 3MJRA 2QN6A 5DISB 4KFSA 1VIYA 5EZ5A 2ZXUA 1GRQA 3AM1A 3ZGXA 3MWLA 4A15A 2H8KA 2WM9B 2ZR7A 3RS2A 1QVRA 1ZP6A 2BCJQ 1VCNA 4PC7A 1ZUHA 4OI4A 3PUYA 1D9ZA 2OFWA 3ZVRA 1UDWA 3CIOA 3QSYA 1K5DA 2V6JA 1DEKA 5H70A 1I2DA 2QROA 2WSSD 3THYA 4HZUA 1D5CA 1TF2A 3ND8A 1U8AA 3AP1A 1KAGA 4GOKA 1KYIA 5IHPA 1YZUA 3CZPA 4D4KA 3ADDA 4LJ6A 2NO1A 2OO7A 5DYIA 4TWZA 2QAGB 4UXJA 1P2SA 2JLXA 1GKYA 1EX6A 1QVAA 3BOSA 1GG2A 1NY6A 1XMIA 4Q1FA 5EE1A 1S0UA 2ZS8A 1FP6A 4B2LA 1KJYA 1VPLA 1UFQA 5CJPA 3DDCA 4KSBA 3NIBA 2XNDD 4BWYA 1HV8A 1VG8A 5FOVA 4URVR 1M7GA 2ZRGA 4BEJA 3OFND 1NN3A 4DKXA 1U2RA 1XZPA 4XVUA 1TEVA 2F7SA 3Q7QA 1GZSA 1E9SA 2Q3FA 4XTCS 2E1RA 1E0AA 1F2TB 4DCNA 5B57C 1NP6A 4UJ5A 1YZQA 3HP1A 4PZLA 2FEMA 4DUGA 4QG7A 1GAJA 2IA5A 3EXAA 1T4GA 1EFRA 1UBCA 3PUXA 2OFOA 3NH6A 2QP4A 3K70C 3GJ6A 4HLQB 3UMFA 5KNDA 4QHTA 4L16A 5FOWA 1ZUIA 4LJ9A 3AF1A 1G5PA 3X1DA 2O8BA 4MUAA 2ZRAA 1GL9B 1R4AA 3QXJA 4P4SB 2PL3A 5F2EA 4HB2A 1P9WA 2H17A 2VRWA 4QHSA 3VHXA 4NYMR 1G18A 5JI3E 4OHYA 1F6BA 3KB2A 4QBFA 4HAWA 2GJKA 4PO8A 2QAGA 1AS2A 1KI2A 2KBFA 4LCBA 1MABB 4G5GA 3WNBA 2VHJA 1US8A 1ZNZA 4W5HA 3UK6A 2Q0HA 3EW9A 3KQNA 1NSTA 2X2EA 2F1RA 4NBSA 1NLFA 2VYFA 1E2GA 1DO0A 4L15A 4TT3A 3NC1C 1PUJA 4TT3D 3A1VA 4DSOA 1ONBA 3QKSA 5B30A 4C30A 2XGJA 3TKLA 3O8BA 1HURA 1NBMA 1VYTA 3RSLA 4PSAA 421PA 4JMPA 5BN3A 4C7OA 1WQ1R 5A5GA 1Z6YA 5DLQC 2NMVA 3LLMA 3FTQA 4AG6A 2JLUA 2FNAA 4DVGA 3ZIAA 2ZJ2A 1G4AE 4M9XA 3X2SA 4M4SA 3IQWA 1PV4A 2CCKA 4XWAA 4G5OA 2GK7A 4UXIA 2ZRBA 5AJZA 2QPOA 4M1SA 3RVBA 2QL6A 4L9WA 3KB1A 1ESNA 3A1TA 3BB1A 2QPAA 1TU4A 3MGCA 4M9QA 3RS7A 1NG1A 2OILA 3C41J 2PLRA 1MH1A 5J40A 2ZUBA 1PUIA 1NY5A 3KKMA 2O8EA 1R0YA 1P3JA 1US8B 3SR0A 1W36D 3A6PC 3MD0A 3QUSA 4LBVA 4U02A 3NWJA 5BQ5A 2P6NA 3EPKA 4D25A 3B9PA 4CEIA 2LKCA 2F6RA 2RGBA 4LY6A 2GXUA 1NMZA 4PO1A 4DDWA 2XOKA 2Z0MA 5FI0B 5EP2A 1SVWA 5FUWA 4RD2A 2YC2C 2OM2A 3LW8A 2L0XA 4UNPA 4GDFA 4YDSA 3ADCA 4B76A 5J4KA 3SJCA 1R10A 2C9YA 1G8FA 3CX7A 4CVNA 1KNXA 3KZ1E 2ZRJA 3PIRA 4HLUA 5C1BA 4LPKA 2IS4A 2VP5A 4NCJA 4ESHA 2IHYA 1S9HA 3VKGA 3TIFA 4BLSA 4N3NA 1T0JB 4IVPA 4UNRA 3CPEA 1UKVY 3KXKA 4URYR 1YU9A 3K0FA 5M1QA 1ZM3A 2W2XA 3LQRA 5AJXA 2OESA 1W4BA 1ANKA 1M6NA 5DNYB 4EFNA 4PC3A 4LRWA 1AKYA 4FXPA 3TR5A 2QAJA 2IYRA 2Z83A 2FN4A 4PANA 4G01B 4PO9A 1FNMA 4Q18A 3KUCA 5AJYA 2QENA 1DAHA 3I5XA 1XXHE 1E9CA 1XTJA 4CEHB 4OK5A 1IBRA 3CONA 1D6JA 2RHDA 3T06B 4YMUA 4TQAA 1XPUA 1UKYA 3L43A 4JVNA 1T3LA 5SZKB 3SFVA 4ZIRB 5EZ6B 1BS1A 2EW1A 2VHQA 4HB3A 4AKEA 5KO2A 4ACBA 5HCNA 3H86A 4DLYA 1S2MA 3FMOB 4URZR 4I4LA 3G0HA 4ILEA 4WW0A 3T15A 3QKUA 3B60A 2Q9BA 4G0NA 1T5LA 3C7KA 3ZYCA 4JL8A 4K46A 4LHYA 2NZ8A 3BFVA 4FCVA 2BCGY 1AQUA 1KSFX 2JLZA 4PZYA 4YQFA 4Q03A 1N6LA 1K8RA 2W2VA 2YINC 1IJFA 1OW3B 3L0IB 4Q1BA 4W7SA 2FX3A 4L5BA 4MRNA 4LC0A 3VKHA 2KI5A 3C5HA 2A5DA 3C6HA 2GVDC 2IYUA 3NBZC 3WXMA 3OIWA 3LBHA 4XWOA 1OPXA 2BV3A 1IXSB 1TQ6A 1CKEA 4M8NE 5KU1A 4A0FA 4MYHA 4XJXA 2OUKA 1M1YE 3MMPA 1XPRA 2UZIR 3KXLA 3LRPA 1OXUA 3VR2A 4GL2A 3OE7A 3Q9LA 4QL3A 4Q47A 2VTKA 2QP9X 4M1MA 2F43B 4HLUC 1P6XA 4C0SA 1D8TA 2OEPA 4PR0A 1K5GA 5GVSA 1BMFA 3TVDA 1TEXA 4JSTA 4B6EA 1Z47A 4E03A 1OB2A 2QG6A 5DO9A 4ZDIA 3FGNA 2ZRKA 4TL9A 1K6MA 3CWQA 1QRAA 2X8AA 3QXSA 3T12A 5FTJA 2FOLA 2HXYA 2V7QD 5EE3A 3OIUA 4TYQA 3QKRA 1T6NA 1TF5A 2XXAA 1G6HA 2J41A 3CPHA 3FYHA 3S1AA 4LJ5A 3IHLA 5IDVA 1M8PA 4D4JA 2WJYA 2JJ8A 3LFUA 4KITB 4Z54A 3RC8A 2WJGA 2DBYA 1KY2A 1PLKA 4HEJA 1Z0KA 5LDDC 3QE0A 3CWZA 3SFZA 1JR3E 5FOTA 2N42A 3QEJA 2PBRA 2WJHA 2IYWA 4JKYA 4NTZA 1KI3A 3OEHD 5JMTA 1G1MA 3U3JA 4TL7A 4ZI3A 1LFDB 3EZ7A 3K09C 2XITA 5EP3A 3IUYA 3W6NA 3U44B 4Z51A 1ZVQA 3WMFA 4WZBE 2XX3A 1R6BX 1LV7A 4PC2A 3OZXA 1YE8A 1NL3A 4KBGA 3LY5A 4JLKA 2GJ8A 2BKEA 3F8TA 2Z4SA 3ZS9A 2QBYA 2W0MA 1S4QA 1N0VC 2RGGA 2OE2A 2W6ID 3CH5A 2A9KA 3UKDA 1XJQA 3NH9A 4A8JA 1ZC3A 2B8WA 1MO6A 2AHOA 4B3GA 1A1VA 5JWOA 1UBEA 2OBNA 2XB2A 3BC1A 3FHTA 4OQLA 3RNLA 5L3QB 3NVAA 4U5XA 2VL7A 2J46A 4O3MA 1T3HA 3X1ZA 4II7A 4V0OA 1E2QA 2QRZA 4UQOA 2WJJA 3UANA 4BLRA 5CIWA 2FZLA 2HJVA 1GRNA 4X8HA 1UPTA 3I1FA 1M7BA 2NOAA 5EXTA 5EP1A 3W6OA 1VCMA 1CTQA 2UZ3A 4IDQA 1YR8A 4NU0A 2CK3A 3REGA 2A2ZA 3EPLA 1IY1A 4LWZA 4WAUA 3LNCA 2PLFA 2R6AA 3HR8A 4ZV4A 1RRGA 1J99A 4Q02A 5EJEA 1I4DD 1Z0FA 2RGCA 1ZNXA 2C5LA 1NSFA 1P75A 4WIAA 3IEUA 2HCJB 5M04A 5KSPA 3VR3A 1P62B 1L7VC 2FSHA 2QBYB 4I1SA 2ODEA 4RVCA 4KO8A 2R65A 2RGXA 3W9YA 1Z08A 1CJMA 2CVFA 3RLFA 4JBXA 4UJ3A 1ZAKA 1TF7A 5LBIA 3VNUA 2CL0X 5FUXA 1NF3A 3R9WA 5L3QA 4XOIA 4DDTA 4KI0A 5KTYA 3A58B 4PQFA 4HYYA 2QM7A 3MWJA 5JJLA 1Z0DA 2C78A 3W8NA 4AD8A 4RZ2A 2ZQ5A 1D9XA 1E2KA 2ATVA 2IF0A 4DLXA 3DOFA 4QNRA 1CRQA 4A2PA 4MKFA 5DN6A 4Q4AB 2QSZA 2ZVPX 2FSGA 1XJ0A 5EXPA 3GLFB 5JS8A 1W5TA 2ORIA 1EFCA 1E6CA 4FD2A 3W5IA 3I32A 1KK2A 1MRSA 2CL6X 2PZEA 2BJVA 4JL6A 2G9NA 2FF7A 4BZPA 2FJUA 2DWQA 2BM0A 2KE5A 4URXR 1II8A 5J4YA 1RRCA 3BAFA 2FU5C 1AZTA 2OCYC 1T9HA 4HZUB 3THYB 3I5YA 2CVHA 1Z2CA 1GWNA 4OHVA 3A1WA 5LD2C 3A36A 1WXQA 4MA4A 4V0LA 4JLVA 2NO6A 4DCTA 3D3QA 3JVVA 5BYJA 1QBKC 4RY2A 1NMXA 621PA 1E99A 2QGZA 5DIFA 2G3YA 2FZ4A 5FOUA 2ZRLA 1KDTA 2BEKA 5M1KA 1AZSC 3UG7A 5JSZB 2ZE5A 3B1VA 4D4MA 1IN4A 4DLVA 1SKYB 3TUZC 2VIIA 1XX6A 4NH0A 4PHHA 4CW7A 3UG6A 3EIHA 1KKMA 3B8HA 2VF7A 2MMCA 1XTKA 4NE2A 3FMFA 2NO7A 5LD2B 1TU3A 1FQJA 1E2MA 2GXQA 3EZFA 2YWFA 2ZYVX 3BWDD 4P31A 4Z1MD 3EA0A 4Z8XA 3BORA 3GLHE 2A3RA 1W0KD 1XF9A 3GLFA 1IXZA 3EZ6A 1QG4A 5DN6D 1AN0A 1S96A 2AFIE 5FBVB 1E1RA 2FDCA 4KJZA 1C9KA 3A37A 5TDHA 4TL6A 4A0GA 4X8OA 2O8BB 4MKIA 1II8B 1NKSA 3KJEA 3T1OA 1QHXA 5G3ZA 4EPYA 2W0SA 2ZJZA 1TUEA 1P7CA 2CCJA 4MQBA 1RYFA 1RFLA 3H2YA 4YDHB 4PQRA 2OBMA 1WB9A 3Q5EA 1Z06A 4Q4HB 2CJWA 4BE7B 4Q9LA 3PFIA 1H8HD 3WBJA 3HWSA 3CH4B 2BKUA 1OE0A 2H16A 2V8OA 3HR7A 3AUXA 2Z5FA 5BYKA 2Y8EA 5ELXA 4DLUA 1ZU4A 4LDJA 2AD5A 2PX0A 3KKQA 3GLGE 4NCKA 4DSNA 3NBYC 1LTQA 2RGNC 4GRAA 3L2OB 3LW7A 3RS5A 1KIMA 5JSZA 1KMHA 2WMNB 5HZHA 4LHWA 2WIAA 721PA 5KSYA 3AVUA 2YJTD 4FW9A 5DE3A 1ZM2A 1RJ9B 2X19A 4HAYA 3AVYA 1OXSC 4RKEA 5DH9A 1WRBA 1SVKA 1AJEA 3HYRA 3QKSB 1AGRA 1Q1ZA 2IYXA 2J87A 4ITRC 3V9PA 5UKDA 4DJTA 3JVUA 1XD2A 3DZ8A 3VKWA 3AEZA 1U0HC 1DAMA 1E1RD 1WE2A 3JZAA 5CLQA 5KYKA 3ZVMA 1TPZA 3DHWC 4WVFA 1CULC 1HT1E 1NJGA 1U8ZA 2A7QA 3QG1A 5D3MB 4ASUD 2BEJA 3W6PA 1E1QD 2Q9CA 2YV5A 3T5DA 1W0KA 1LW7A 4IXNA 4F92B 3U60B 2GCOA 2O8CA 3RAPR 4AWXA 3AV0B 2CNWA 3QG5A 2D4HA 2JLRA 1ZNWA 4CYMA 1YR9A 2QM8A 3A4LA 4JJZA 1DG1G 2WHXA 2QMUA 4QXAA 3GJ8A 4LX0A 4I1OA 4JBWA 1OSNA 2O52A 4B43A 3SOPA 3KJHA 1CF4A 3BFXA 1Q3HA 2R8RA 1P2VA 2C8VA 3DOEA 1N5LA 2CJWB 3QPWA 4Q4HA 4QRHA 4AYWA 3HU3A 2Z4RA 2CCGA 4C3ZA 3U7GA 5FPSA 1B23P 5DHFA 1T91A 1W48A 4LHXA 3ZZTA 1E2PA 1XEWY 5FBQB 3FE2A 4MRRA 3ZQJA 2W83A 5TXGA 2ZRFA 4GMDA 2P2LA 3SJAA 1JR6A 1RPZA 4CEIB 2RKOA 1KMHB 3W8RA 2WJVA 1VG0B 3D7MA 3VU9B 4FMBB 2HDNB 4N0EA 2P67A 4NYJQ 4Q5IA 1XU4A 2AL7A 1DVRA 2GETA 4LJ8A 4Q1CA 3R8FA 2GWHA 4X8LA 3PEUA 4YMSA 1CJKC 5L8VA 3IPXA 3MLEA 4JT2A 5LPNA 4JS0A 4CT5A 4LV5B 2YKGA 2REXB 3B1YA 1X6VA 2QE7D 1X8JA 3PUVA 1Q1EA 1R2QA 2HEIA 3GCGA 4EUNA 3H84A 2HXSA 3UMRA 4WXRA 1DAKA 4Q4JA 4OHZA 3IO3A 2GCOB 4QBIA 2A5JA 3OIYA 3BBPA 2AXPA 2ZR0A 5BW8A 1AIPA 4JL5A 3B1WA 3CBQA 3JZMA 3K0CA 1S8FA 2CHQA 1CR4A 4Q7KA 5HE8A 5J5CA 5G53C 2IS6A 3ETLA 2H18A 3MAAC 4DEXA 1W7AA 5KHOC 3AQ4A 4FCTA 2REOA 5FOSA 4TLCA 2WWXA 4PPQA 1X8LA 1WP9A 2NQ2C 3L8ZA 3T34A 2PEYA 1JB1A 2ZYTX 4AC9A 1A82A 4LV6A 2QU8A 4CEHA 1E32A 1GDDA 2W6IA 3AF0A 5CDFE 2FPMA 2HV8A 4MGIR 4PAOA 4ZIRA 2ZAMA 4ZKEA 1ZD8A 2GBLA 1U9IC 3F3YA 3RRZA 2VHCA 3CB4A 2BBOA 3RDPA 3ZZUA 3X1YA 1TNDA 1IJEA 4MITA 1MRNA 1HEIA 5BN5A 3SI7A 2GILA 5E3HA 4C2TA 1KHTA 1HE1C 3GMTA 5FUVA 4NONA 2YC4C 4NDZA 2EFEB 4GFDA 5EQTA 3TLXA 2G1KA 1IN6A 3MSXA 2FPKA 4HAZA 3WP1B 1G5TA 1GIAA 5H68A 3AVWA 4Q7LA 3B82A 5DHAA 3PG5A 5IF9A 3V4FA 1Z8FA 5LB2A 2XJ4A 3EWAA 5JFGA 3QIAA 1VCOA 1G19A 4Q4JB 4A36A 2QE7A 1M7HA 3SC3A 4F38A 4F4JA 2BBWA 2HT6A 2XTZA 1VG9B 4ZDWA 2CDNA 4LHZA 2BHRA 3FMIA 1KK3A 1SXJC 1JPNA 1RZ3A 4JSYA 2FFAA 1XMJA 4B73A 1G7SA 1MT0A 2LCFA 1JNYA 1JAHA 1OFUX 3B5JA 3SDZA 2ZS7A 3EA5A 3RANA 4B35A 5F9HA 2WV9A 4M0LA 1E2EA 5EUMA 1Q22A 6Q21A 3B85A 2ZREA 1BMFD 2ZANA 5L3RA 1DOAA 1BYUA 3A4MA 1G9XA 4Q4LA 4P3YA 2WICA 5M1PA 3VFDA 2V1XA 4HUQB 1J70A 2PJZA 4KHZA 2RAPA 5FPKA 1BYIA 5FL3A 2WSMA 2XTMA 4A2QA 5KUTA 4KXFB 2ANBA 1MV5A 1YVDA 3BD9A 4RSGA 5GJVC 4FIDA 2HCBA 1GFIA 2RHMA 2RH5A 2QSYA 4L9SA 4EQ6B 3S1AB 2GF0A 4I81A 1NLZA 2GF9A 3QBTA 1OXXK 2QT1A 3CKLA 1E9DA 1UF9A 3CR8A 2W2TA 3Q7PA 3ZQ6A 5K8IA 3WRYC 1LF5A 3SYNA 2D7CA 4KSCA 1H65A 4TZ6A 3CF6R 3QNUA 4TTQA 3UATA 3OEHA 3UIEA 4BRWA 1MO3A 2FMXA 2ZJYA 1N6OA 1XMVA 4G5QA 3WNDA 4DIDA 4BLQA 1HYQA 3LH5A 4V0MA 3X1WA 3WHKA 2ZI5A 2QT0A 3A8TA 1UJ2A 4XH9B 1W46A 1DADA 3U44A 4A0RA 4K8OA 3DL0A 3GEHA 3LO5A 4GT1A 1BH2A 2VBCA 4C0LA 3ZD6A 1JPJA 4DDUA 2J7PA 1FTNA 1G3UA 2GESA 4M2LA 4A8JB 2XNSA 2FE4A 4CZ2A 2HYIC 4LI0A 4PC6A 1VIAA 2I1VB 4AI6A 3B78A 3LXRA 3AGPA 4IDNA 1XNJA 4HUQA 1TL7C 3ZD7A 1G8YA 4WXPA 2G83A 3KQKA 1KO1A 2CL7X 4RZXA 1C1YA 4B2PA 1N0WA 2GBLC 4IOMA 2NIPA 4G5RA 1Q3TA 2I4IA 1V43A 4RD1A 2XNDA 1ZJ6A 1Z2AA 2P5SA 1ZBDA 2ZSEA 2VH5R 4OJKA 3U4QA 3DM5A 1A7JA 2Q6TA 2AKYA 2OSBA 1CLUA 4H1UA 1JALA 1AM4D 2IF2A 3D31A 1IM2A 2Q3MA 4QJ5A 2FEOA 2VP9A 4A1FA 1X8KA 1VHTA 4YXWA 1W0JD 2Z6VA 1G64A 2OBLA 2ZI7A 1E94E 1AKEA 2ODNA 3P4XA 3P26A 3QKTA 5JEDA 3RRYA 2WWYA 3L0PA 5KPDA 3OF5A 4ZCLA 2RGDA 3SYLA 2JLYA 1JBKA 1I4LD 4ZO4A 5G40A 1SVOA 4I1UA 4D82A 3CRRA 4R2IA 4R7ZA 4MDFA 4YMTA 4JLNA 2IYSA 1G5RA 1P9RA 2QNRA 1J2JA 5HPYB 3OEED 3FOZA 1EXMA 4UNQA 3T1VA 3SQWA 2VSFA 4ZCIA 1W5SA 1PJRA 1OIXA 1W4AA 4F91B 2OG2A 1T8TA 2QI9C 2QQ0A 4OK3A 5G41A 1GILA 1R5OA 4UKDA 2P65A 4KVGA 1NRJB 1KK0A 4R98A 5HZKA 4JBYA 3NEYA 4BFZA 3LV8A 1SVLA 4DEYA 4ZKDA 1N6NA 2RGAA 2D62A 3CF2A 1J90A 3GEEA 2JLVA 4V0NA 2DFTA 3H1TA 2OXCA 1KI9A 1N6KA 3EC1A 2OCAA 3U3MA 4OQXA 1DELA 1OXTA 2DWPA 1WA5A 2XB4A 4FMDF 5CIQA 4OQMA 5JHHB 3NBFA 4M1OA 3QXHA 4HUTA 3C8UA 4AYTA 2ZRNA 4F7WA 4TN1A 1GL7A 1JECA 5C4GB 5CB6A 2BBTA 2GCNA 4OI2A 1Z63A 2VF8A 1AS0A 3F5FA 5FOXA 2I3BA 3GJ7A 3CUEF 3QENA 3PUZA 1T3SA 5HE9A 4LUCA 2J0SA 3KX2A 2VEDA 1UEIA 5K8TA 2GZHA 4GPTA 4M1WA 1QHHB 5GJCA 2CE2X 3Q72A 1NJFA 4D6PA 1E96A 3AF4A 4POAA 4KFTA 3CR7A 4TLBA 1CRPA 3RS4A 3W90A 1SXJA 2YHSA 4C2UA 4ACAA 4BFWA 4Y0AA 3QOFA 3SS8A 4Q21A 3C14C 1SHZA 3WRXC 1OH7A 4IFBA 3W3AA 2EYUA 1G8HA 1Z0IA 1LNZA 2H1LA 1FTSA 2WKRA 3MUFA 5CJ2A 5DI3B 5E7JA 2JLSA 1S9DA 2X2FA 5P21A 1ZW6A 1CU1A 2BOVA 2WPDA 2CLCX 2PX3A 4US0R 2VHUA 1YZGA 3K70D 1EG7A 1RKBA 1JR3A 2IL1A 2MSEB 3MWKA 4IDOA 4NPHA 1Z22A 1UM8A 2QY9A 2WKPA 2X1VA 4MDEA 4JLBA 2AN9A 2P6UA 5JCPA 3AP3A 2QGNA 2ZUDA 4B3CA 4OYHA 3A1UA 4W9MC 4ARZB 1OHHA 3AVQA 1HH4A 1XCGB 2VO1A 3UWOA 4EFMA 1KI1A 3LWNA 1DE0A 3FKQA 5TY0A 3TQFA 2YWHA 3PR1A 4WZ6A 1HTWA 4QGHA 3EG5A 3IO5A 1CS4C 3LAWA 4JYCA 1HT2E 3D8BA 4QJ4A 1XD9A 3GPLA 4C0JA 3WHLA 5AWFC 4Q1AA 4P33A 1FW6A 3CNOA 2C99A 5B58C 4RFVA 1XRJA 1KMQA 4ZI2A 1SXJB 4TQUS 3A4NA 3BH7A 4NYJR 4DSUA 4QBHA 2PH1A 3K9LA 5KPJA 2B6HA 3AKYA 4TSFA 3GFPA 3TH5A 4YONB 2GHIA 3BERA 4W5JA 2VP6A 5CM9C 3HU2A 3EZ2A 1HQYE 3V00A 3THOA 2OFXA 3GFTA 4FN5A 2C77A 2E87A 3FFBA 1G20E 1FMLA 2JIZD 5BXQC 1VYVA 3NDPA 1RJ9A 2VLIA 5J4HA 5AK0A 1L4UA 4UNSA 5IT5A 2F55A 3GP8A 1ZCAA 4RKFA 1Q44A 4URWR 1N5KA 1XD2B 3GLFE 4Q19A 1G291 2FGKA 4M9ZA 2F3RA 1KKLA 1AQYA 4ABYA 5D3MA 5L3SA 1JEDA 2WTUA 4CIDA 4KYIB 3HYTA 2PT5A 2NTYC 2CXXA 3DM9B 5JECA 2DHRA 2O8CB 2BDTA 3CO5A 4NCIA 4GP7A 3OAAA 1OYWA 2OCPA 4I1VA 1SGWA 1RRFA 2IEYA 2B92A 2WIBA 3IIKA 1DBSA 3E70C 5E7IA 4XSGA 3W5JA 4A82A 4EJSA 4QKQA 1KI8A 2BMFA 4LV8B 5HTKA 5CM8B 2W00A 3BB4A 5SZJA 1OH5A 1KO8A 2C2HA 3EPJA 1G8GA 4GBMA 2WWGA 4MYUA 4RCYA 1FNNA 1P60A 4HAXA 3REFA 2P6RA 2YOHA 3CM0A 1ZCBA 2IXFA 4DLRA 4DLTA 3P20A 4L4UA 1CIPA 1KDRA 1YZKA 3QI2A 2O8FA 5JRJA 4KFRA 4YLGA 2GAOA 3VU9A 3M6AA 1ETUA 2Q3HA 1QZXA 3WYAA 1R8QA 2ZRHA 1MOZA 1KNQA 4C9BA 1B0UA 5AUQA 3CRMA 2IX3A 4G5SA 2RMKA 3SYKA 1RE0A 3K0CC 2JJ2D 1EGAA 4IEIA 4Y0VA 1S1MA 1T5IA 3EARA 1Q20A 1F3OA 4M21A 1HQCA 1W4RA 1G4UR 2V9PA 3M1IA 4CT4B 3QVUA 5L3SB 1VMAA 2OXRA 1AK2A 1FOEB 2KWIA 4OJQA 3PEVA 4AK9A 1ZUNB 1N25A 2WSSA 1Y63A 1KY3A 2H7VA 3KKPA 1W2GA 3KJIA 3OAAD 2C95A 3I8SA 5C12A 3KQHA 2XZOA 3PITA 5JI2E 1UDXA 4ERNA 3K8YA 1DARA 3F0TA 4JIMA 3VAAA 2A30A 1F5NA 3B7GA 3OEEA 4EIWA 4TYWA 1D2NA 2ERYA 1P5ZB 4V02A 1SXJD 2NPIA 2B7BA 221PA 4PHFA 4XD7A 3SZRA 1G3MA 2QQEA 1G16A 1IXRC 3QJYA 2ASEA 3E2IA 3QPUA 3U3KA 2C9CA 3TAUA 2GZDA 4OI1A 2P3SA 1JQLB 5FTLA 3O47A 4IDHA 1EFHA 1FX0B 4H9GA 2RGNA 5FTNA 1WF3A 3GLHB 3AF3A 1QF9A 3OFNA 4IW3B 4TYNA 4AKIA 1E9RA 4JKIA 4YXWD 2DCUA 2NPFA 2JJ1A 1MR3F 2BIFA 4GZMA 1NBME 3B13B 2AXNA 4JLJA 4EPRA 1JI0A 3MFYA 3FKSD 3K0AB 2AFHE 3EPHA 2G0NA 4LJ4A 4CRWB 2YOGA 1XEXB 2ZUCA 3A1SA 5CB8A 1LS1A 1X3SA 3NKVA 5K8LA 2HYDA 1U0LA 5JLJA 4OQFA 3K9HA 4LJAA 3WYGA 1CJVC 2IUSA 2ZS9A 4LK2A 3K09A 1GNQA 3IPYA 4NCNA 1I4TD 3L82B 3KUDA 4N1AA 1FQKA 1NVVQ 1E79A 2Z43A 2G88A 5A4JA 4OBEA 3AGQA 3RYTC 2W6JD 4BASA 2G77B 4D0LB 2V4ZA 3NC0C 1TUIA 4JLMA 2NZJA 2R2AA 2WZQA 3OIVA 3GFOA 3MJHA 1WCV1 1YR6A 2LKDA 2F3TA 2WWWA 3ZVLA 3U3RA 4DB2A 4X8MA 2DB3A 3NHAA 2ZU0C 2F1JA 3EAQA 4PAQA 4TLAA 5CYPA 2CHGA 2ZSAA 1QDEA 2PMDA 5DYGA 4TMTA 1ZIPA 1ZM4A 5BN4A 3AVVA 4FMDB 1Q12A 1Q57A 5FUYA 3QVVA 4EPTA 3BS4A 1RW4A 3H0KA 4BFYA 4DC9A 1ZU5A 1W4CA 1FZQA 2ZR9A 4WOPA 2BJWA 2IW3A 4D4LA 3GLHA 4P0TA 3NTUA 4EQ6A 4TZ0A 4TYPA 1EFUA 1A4RA 1QG2A 1CXZA 1N3BA 3D6TB 3M0EA 4BUJA 1E0SA 2MSCB 4LBZA 5JS7A 3CX6A 2OZEA 4B3BA 2ZTSA 1ZNYA 3K0AA 2KJQA 4NCHA 4YMWA 1YZLA 5FFMA 3SN6A 4B44A 3RHFA 4BPBA 2EYQA 2IT1A 4NZYA 4EAQA 1TQ2A 2D74A 3IHWA 4QGGA 5EE5B 4EPXA 4TMWA 1WMSA 1T0HB 5FBRB 4TSFD 3P4YA 2ZE6A 2CLSA 5C18A 1RYHA 3AP2A 4QNMA 1E2HA 4RZUA 3HDTA 1OH6A 3GQBA 2BVNA 2F9MA 4AIIA 1U8YA 1W2HA 4FI3C 4B71A 1NVVR 1UBFA 3GJXC 3SHWA 4BFUA 3LXXA 1WDTA 3O8RA 1OT3A 2AK2A 2ZJ5A 1KK1A 3WBKA 1SVIA 1GNRA 4B33A 2IS1A 3U2QA 4XD7D 3HU1A 4NL4H 1ESMA 1TADA 5IK2A 1KJZA 1XEWX 4EJSC 1W36B 4MRSA 2VSOA 1OB5A 3IBYA 1M34E 2ZRIA 1XPOA 1PZNA 1N5JA 1XFAA 2J1LA 3VX4A 1HY3A 3C16C 2YZ2A 5FPTA 2R6DA 2IYYA 3N2EA 4JVSB 4Q7JB 5FTKA 4LYHA 3HPRA 1P2UA 1XCPA 2QORA 1T8UA 1G7TA 2JIZA 1XWIA 4HB0A 1TX4B 4E22A 4GP6A 3ADKA 3OESA 3U4QB 1LVGA 2PMKA 4US1R 1X86B 2FSFA 3AKDA 1QHSA 2XTNA 4S2EA 3TSZA 4BLPA 4JLAA 5B64A 3GD7A 3T1QA 1W36C 2XJ9A 2OHFA 2OCBA 1E3MA 4B3FX 4KCGA 4OK6A 1E2LA 4LC1A 1LS6A 1L8QA 1R0XA 1KI7A 3U5ZB 3V4RA 1EX7A 1NKTA 2QRNA 3IGFA 3SBEA 3TSWA 5JWRA 3Q3JB 1W0JA 3LVQE 2ATXA 3VR6A 2C96A 2V55B 3DKPA 2BMEA 4E09A 1XJCA 4IOLA 1G3QA 1RIFA 5C2FA 1BIFA 2IC5A 4BLTA 4OHXA 1EK0A 1KZ7B 1OKKA 4NYIR 3KL4A 1OF1A 4Q00A 2V6IA 1P72A 4QM7A 1L4YA 2ONKA 5E4FA 2IEZA 5JCZA 4DLSA 5JZVA 1R8SA 4IFEA 5D3QA 3SJZA 3RWOA 4F4IA 4OQNA 1ODFA 4MYCA 3RS0A 5C10A 1U99A 3TK1A 1H8EA 4H1VA 1NMYA 5CK4A 5F9FA 3ICQB 1FFHA 3K9NA 4JZKA 2DR3A 1GSIA 2B7CA 4ZDKA 1JR3D 2BWJA 3ADBA 1IN8A 2H92A 4A0HA 4F4CA 4IXMA 4KVAA 4Q1DA 5KSZA 2ZIAA 2VP2A 1FUUA 2BMDA 4M1TA 1NI3A 4FCWA 3THXA 5JJKA 3N5CA 2GNOA 4LHVA 2ZI6A 4DCSA 1KTVA 1H8HA 4B2IA 4MGKR 1BOFA 1DAIA 4BFVA 3R8CA 4B6FA 1MO4A 1Z0AA 2QMOA 1TAGA 3AUYA 2GRJA 3FHCB 2N1BA 3TNFA 1QHHA 4FWTA 3B9QA 1N6HA 4QGAA 1S1CA 4R2HA 3TVTA 2ODBA 1RVDA 2FFBA 1XTRA 2H57A 2DY1A 2GEDA 1G7CA 4OHWA 4MRPA 3R7WB 121PA 1UBGA 1U9IA 2GK6A 2W58A 2NO0A 4PFSA 4BRUA 2HJGA 1E2DA 3DPUA 4AY2A 3ONWA 2ZAOA 3J81k 4V0ME 5DI3A 1EFTA 4UNNA 4IOJA 2C98A 3EASA 3MG9A 4TMXA 1OLOA 5JJIA 1J8YF 3UWKA 2IXEA 1COWD 3FMPB 4MKGA 5FPYA 4O25A 3MCAA 2JDIA 1UAAA 3K0EA 1E69A 2EU8A 4DDVA 4DB4A 1CJUC 2CEAA 3Q5DA 4PAMA 4Q9KA 4DIEA 2VSXA 4KAXA 4IVRA 3VR5A 1Q1QA
chains in the Genus database with same CATH superfamily
2LPMA 1LB1B 1T4CA 3JWEA 5EJ9A 5AQMA 2Y1EA 3UJCA 4OJNA 4RK5A 3UN1A 3BSSA 4XYMA 4DDKA 2PE5A 1JDZA 3KYCA 2VNJA 1H93A 4AICA 4TOIA 3AV9A 1WUYA 3NG1A 3E7WA 1ZBLA 1WBJB 1RHRA 2PFKA 2EJBA 4YY3B 3T3EA 1JDBB 1A4XA 2FR8C 3OHMA 4IUDS 2P0EA 4KVZA 2MYNA 3V4VB 3LZCA 2J7PD 1GT91 1U65A 3EAFA 3OP1A 1J9ZA 3IIMA 4G0XA 3IVCA 1JQAA 4FK8A 4NBWA 2H1IA 3MJ4A 3KYDA 3RC9A 1G7RA 1LF0A 3DMYA 1R4MB 5CFPA 5HL7L 2EWMA 2C04A 2XRFA 3BRCA 4CV0A 4GE3A 4U7WA 3S2GA 1R0CA 4B40A 4PN3A 4JKFA 5AQWA 2VYNA 3JQBA 4G4IA 2G1JA 2VK8A 5ESRA 4PHTX 3H3FA 4F93B 1QZ6A 2YHYA 4ZODA 1CLEA 3TD2A 2VT3A 3TLGB 4CQMB 1HE2A 4NLBA 4OPKA 2V6FA 5COAA 1TFUA 1U3GA 2YS6A 3ECAA 5E2BA 5B6PA 5I4IA 1RXSA 2GJAA 2DHCA 1HO3A 3E5HA 5KHAA 1DX6A 4IIFA 1I80A 1QXSA 3RR2A 3IP9A 4DNPA 4FZVA 1R6XA 4J1QA 1XMQB 1FFCA 2D2EA 3GZNA 1EZZA 3RTCA 4ZVVA 4HAVA 1OWLA 3C95A 2Y1KA 3UHFA 1WPXA 3S7TA 1SULA 4IKFA 1CUXA 1K88A 2A7XA 2DY4A 3T95A 2VT6A 4CLXA 3HN7A 5IJ0A 5AR1A 2MMGA 2AZDA 1KYVA 5JWHA 2D5IA 3PEWA 4PIVA 2Q0UA 1GTVA 1DJMA 3CRVA 2AZXA 2YMLA 3AVBA 2EX4A 1VSJA 2L2QA 3AEQB 3N5KA 3IR7A 2PZFA 1P17A 2BTEA 3IALA 4ZQEA 4IO8A 5AQOA 1CY7A 3LT5A 3NEJA 3R6GA 3KQPA 4K5QA 4MB2A 4UHBA 3FNRA 5HBGA 3PL1A 1FJHA 2V97A 3AM5A 3MRSA 3LJKA 3AB7A 3ZY6A 3KG2A 2ZJ7A 3SS9X 4J2AA 1ESEA 1QUEA 4XVRA 5DEIA 2C8KA 1YFZA 1WBBA 2EF0A 4RELA 3F5QA 3HZZA 2J3EA 3OECA 3P9SA 4RW0A 2C7VA 1TCCA 1X1BA 2BMJA 2DFVA 3DOKA 2B1RA 1EHIA 2G76A 3FZQA 3QLVC 4IO1A 5F73A 3ZS8A 4H5NA 4C0BA 1TQ8A 4LF7B 5GINA 1FUIA 2JFQA 3EVEA 5F1PA 4MR8B 4JLSA 1JHUA 1QGDA 2FYTA 5DSXA 4CDGA 2IYQA 3OCUA 3BH6A 4UOQA 4U6NA 3A0UA 1N0UA 5EQFA 5EKDA 1JT2A 5LUAA 3C1OA 2O7RA 5LUBA 5LOVB 4LXIA 2GBIA 5BVHA 4FINA 1S1TA 2AKAB 4U7BA 1ASWA 3KM0A 3U4MA 3TANA 1YDHA 2X4LA 3LQKA 3T61A 2JCVA 4L0DA 3CJAA 2C4TA 3AUTA 3FWYA 3JD1A 4DQRA 5LKRA 5CB4F 1WMDA 1KWKA 4CJVA 4L8RB 2KB0A 3HVJA 1XTTA 1Z07A 4IIBA 4Z99A 5CB0A 5IM4F 1BSVA 2B4KA 3AY6A 2NV2B 1KS9A 1IONA 4OTZA 4Q7EA 4BLWA 5BR1A 7MDHA 4FMPA 4DCVA 4I4TB 4E32A 4XCQA 5KTQA 2D5CA 3FPFA 2P9BA 2HDWA 2QD3A 4MARA 1AO0A 3PNMA 4EYOA 1P44A 3ENNA 4AZTA 5HP4A 4JP1A 3VH3A 3ZUPA 4B47A 3I4CA 4M54A 5MHTA 5DM70 1SKQA 3TUIC 1ZCJA 4DLGA 3L6OO 3BDPA 2G8WA 2YJ6A 4G0MA 4CKWB 4A2WA 2IQ5A 1CY1A 1RJGA 3TI0A 1R5JA 4ND8A 5EE0A 5TNXA 4ASUA 5CLHA 3SU8A 1DX4A 4HEHA 1JFLA 5LN1A 3DZFA 1C1BA 1GUYA 2BUBA 2DFKB 3OZTA 5H9WA 1NZJA 1Q18A 1DKNA 4EG0A 2AWNA 2QXLA 3K96A 3WNZA 2FVXA 2DSTA 2CVPA 3MX2A 4ZVUA 4F3KA 1GRCA 4TTSA 3NMUF 1OROA 3PEFA 4LE2A 3ESXA 4ZOAA 3TAHA 2AEMA 5MDHA 1H5UA 4US2R 3WEEA 4K9PA 3Q11A 3LLVA 1Z82A 1QHYA 4E7HA 2E0IA 4DPLA 3IEXA 5FR1A 3TGPA 4ND1A 3SQMA 4PCUA 2H2HA 1Q74A 4DT1A 4QT0A 4LNUB 5DHRA 2W37A 1K7FB 3SK3A 1IAQA 5F9MA 4CHZA 1RYDA 2RK3A 3CH6A 3WOHA 3R4VA 2ZITA 4GEGA 4OYYA 4WH0A 1NU8A 1DAEA 3E35A 4JLDA 2XT9A 3SQOA 3VTZA 2CGLA 1JAZA 2Y76A 1MB0A 1S02A 4O08A 1DKOA 4QYIB 2N46A 4IV5A 3WWOA 4EQZA 4LBYA 3N70A 1W0HA 4ZMSA 2R6CA 5ALKA 3BTSA 4D97A 2HHXA 4PLTA 3WK6A 3ER9A 2QXUA 1XA3A 1PD1A 1IIRA 1VL1A 2GYWA 2YYAA 4IWXA 4R1PA 2AA4A 4BVGA 4DUZB 3E3MA 1XRSB 3FYDA 3SXPA 3G0OA 2J9YB 2XY8A 2R7AA 4IGIA 2B8TA 1Z3IX 1RI3A 1VJTA 3AHEA 4HDAA 4JUBA 1NJ2A 3L5KA 4BGEA 2FFHA 2W2KA 4GZ6A 1H2HA 3FZHA 2ZP1A 2VUTA 4KV7A 5TQ2A 4I50F 3VISA 5DCYA 1UWBA 3NQ41 3WRVA 4CLHA 4PWZA 3F7NA 2QP3A 2OCKA 4UEQA 1RMYA 4JI8B 4F6LA 3WUHA 4OMFG 5LYJB 5KX5A 3OU2A 2CYBA 4JELA 5F2RA 3DW1X 4QLAA 3OZEA 2P4UA 4X7MA 1RS0A 1IKXA 5IS2A 3ZJ5A 2HUPA 3HBMA 4IWVA 1TVMA 4OBWA 4WK6A 1IBCA 2SHKA 5F12A 4JU9A 5LIPA 5HW0A 1JQ3A 5AM0A 5KZMB 1EIWA 2PYDA 4XYEA 2OV2A 4XWYA 3WG9A 3WEEB 3AHCA 1OJLA 2IYVA 5E6RA 2ZJRL 2AW3A 3WLIA 4CLOB 1T5HX 3MILA 5CYOA 4J1TA 2UYYA 4QICA 4ENRA 2ZI3A 4XWKA 1RT6A 4RTMA 4LDZA 1QE5A 3M3HA 4QJBA 4GS5A 5EIWA 1HNZK 3IJRA 4MS1A 1U98A 1VCIA 2EVWX 2W4QA 2WFMA 3BEDA 3TJMA 3UGTA 3N2IA 2G8IA 4MGYR 2YZ7A 5LNK6 3COZA 2R6FA 3OT5A 3PHCA 4FJ7A 4ICIA 3LVRE 1RHQA 1BD4A 2JJQA 4OG2A 5LB4A 5TS3A 5JDIA 3EZYA 2AWOA 1V26A 3UT5A 5KJFA 5K0ZA 1ISFA 1YJ5A 2PMBA 4DCUA 5B4UA 1U0OC 1A9QA 4F5WA 1FL9A 2XVXA 4BQNA 5I8WA 1R6TA 1CUJA 4NWIA 2XUPA 1EXQA 5HCIA 2R1TA 2HHHB 1XZQA 2DGDA 5AVSA 3SAJA 1JQBA 1JR2A 5KTOA 2HMPA 5K7SA 1Q1AA 1SC4A 1PI3A 3EWIA 4UBIA 2A5LA 2ERXA 4AF7A 5BP7A 1BVRA 1VC2A 3IOMA 1U5AA 4HWSA 3C7TA 1JPUA 1C0PA 5A0FA 1A04A 3INRA 4NAVA 4C5CA 2IDKA 4LZPA 1JEEA 2JG3A 3BT7A 4PX3A 3BILA 2C83A 4MINA 2Z5VA 5DNVA 3WY9A 5K51A 4EA6A 4EUFA 1R7RA 2P9LB 4MW4A 1AA6A 3VGMA 3L0SA 5JRDS 2IKQA 2G25A 1FP4B 4FSVA 3CUVA 3VPGA 1ID8A 1ORDA 4M3UA 5ABPA 3DRSA 4GM0A 4CLOA 2WWIA 3A9VA 4Z9FA 5DYTA 3P9IA 4AIRA 1R64A 4G1UC 3ECCA 5CNMA 4AO8A 1YI8A 1JU3A 1MG0A 3AZQA 1BCRA 4TTIA 4DA0A 4EZEA 1MBZA 5JH7F 2BFOA 3GLGB 2QJFA 4AJPA 3MUOA 5LJIA 2QRMA 4CEJB 2O20A 2A78A 3EF3A 3NPMA 3PENA 3VA3A 1U9YA 1O0CA 1KFDA 5AQNA 2BP7B 3M1FA 1QVWA 2EERA 1I2MA 2WILA 2XBUA 1C8KA 4PZZA 4DV3K 1U7UA 1OKKD 3RTGA 2VH2A 2VXBA 1XQVA 2OV3A 3G49A 1CRZA 4EY5A 1QIFA 1HKHA 5G1OA 4A5BA 1SJ9A 3DMPA 3TX6A 3WGHA 4LGMA 5CURA 3OZAA 4HDCA 4PONA 4ZVLA 3SQXA 1EDDA 3QGMA 2QTVB 3L77A 2IY7A 3DOIA 2AX4A 4XWTA 3PWSA 4E12A 4O5FA 2QAGC 1DRWA 3Q8LA 4QFCA 2PRKA 3U49A 1VL2A 4IBNA 2IOYA 4FJXA 3VNAA 3NAEA 5C5EA 4MJ7A 3WB0A 5LWQA 4C0HA 3U6BA 1DP4A 3KEQA 3TDKA 2CBGA 2P69A 3ZJUA 4C7OB 1TTTA 2QTWB 2UKDA 4HDQB 3K35A 1NKVA 2A0UA 3AR9A 3FNIA 1AB5A 2ZJ8A 4LRQA 4GV6A 4IJ5A 1XCLA 4AF6A 4JCCA 4NI5A 4BJ5A 4NJOA 4CF7A 1UDBA 3L7CA 4YVFA 3RSOA 4MUEA 3VPSA 5F3RA 2XUOA 5DDIP 3DFUA 3AA4A 1BDMA 1CR1A 4BROA 2P9LA 1IOWA 1CBUA 2IZ7A 2ZJ6A 3K53A 4C8MA 3FAZA 3M4JA 4K87A 2H3GX 1K1EA 5D51S 4NJEB 3EKUA 3B6OA 4CUJA 3JQ6A 3ZCXA 1Y34E 4A4DA 4BVLA 3LHFA 5PNTA 1AB6A 3ILVA 3CPSA 1II9A 1VE7A 2JGNA 1SCAA 2MTBA 2GO1A 3OM9A 2G70A 2LD4A 4YJ2B 3RJMA 3NEPX 3UF0A 1TD9A 3AVPA 4NP6A 5KI6A 3RSSA 5CCXA 3LBIA 4E0DA 1ZR2A 4TKUB 1EE1A 4J2EA 4MDAA 2WUSA 2JK0A 5EXWA 3O8NA 3SG0A 1RAEA 3TW4A 3WQUA 4O5OA 4TWAA 4NZPA 3GLIA 3PO5A 4B80A 2EJTA 3EMVA 2O5VA 4G5HA 1CP2A 1PLJA 1ZGBA 3I9MA 1GPLA 3N58A 5HA5A 3RVJA 3VQTA 3T7RA 5BSVA 3WQRA 3CW2A 3L02A 4CVNE 2JLCA 2W4MA 4BDTA 3ZGVA 2BSXA 5K5EA 1VHLA 2BM8A 3AR5A 4YTEA 4U39A 3T3MB 3JTEA 4JJGA 3TW0A 3P0HA 3LI2A 1VPDA 3RUFA 1G8JA 4YUYA 2RGRA 3IYLW 1CZHA 1CUGA 4EB3A 1Q95A 4IDFA 1JDJA 2GKGA 1OIVA 1BKSB 2G6BA 1ZQ1A 1W85A 5EKSA 3FLEA 5A03A 5IRCD 4ITUA 1JAIA 1M6VB 1XROA 4FJGA 1REQA 4E1MA 2VF5X 4K9OA 2ZZMA 4R1NA 4FCCA 4KH0A 1DB3A 2XEXA 4RANA 5CGZA 5B12A 4CJUA 2WB4A 3X2EA 1ADYA 1T9AA 3NGMA 1RDFA 3QF4B 3VO8A 1AXEA 4EW2A 2YXNA 4B3XA 3K9GA 1T1IA 2EJVA 2XMCA 1L5VA 2J0UA 3PR2B 1HF3A 3S3MA 2XYVA 1GCAA 1AGYA 3K0FB 4JXKA 1FEZA 4Y6PA 1QWOA 2QTBA 4DV1B 1UK9A 3VAZA 3ZD8A 3U7FB 1K2WA 1C3LA 1PZFA 2PZKA 3Q8XB 2AN1A 2C58A 4XIGS 2FQXA 3RWMB 1IB0A 4BNZA 1SNYA 5B55A 1C1DB 2HMYB 1Z56C 3PGVA 1KR5A 2JKZA 3L1KA 3C65A 2X74A 2X1LA 4E3SA 5HIIA 5BO5A 5KTMA 3I0ZA 4JASB 5MN5A 4KR2A 2FEKA 3H6GA 2NACA 1E2NA 4N7RA 4P35A 2X8BA 5CU7A 4O4LF 4QPDA 5HVNA 2Z2IA 4Q3LA 3SEFA 2I29A 2AFIA 1Y6JA 4MQ5A 3KLPX 4RUKA 3FZKA 4FW2A 1QM5A 2QUZA 2NRRA 4BIIA 2F1IA 3MWTA 2FW7A 2AT1A 3GGGA 3O9MA 2WVJA 3VX3A 4A92A 4AZVA 1YQWA 3VHLB 4JI3B 1T5BA 1MX5A 1JFVA 2FDRA 2E2OA 3EXEB 3KVYA 1YJCA 5ANRB 5C7LO 2FZCA 1ZHFA 4X45A 4E08A 1IDN1 1P9NA 3NF7A 1T15A 2V7PA 3AHFA 4CTJA 1CSEE 2ASVA 5J2PA 1TA4A 1RC8A 1KETA 2PCLA 5EZSA 4LZJA 3WP0A 4BFYA 3WJ2A 1PDWA 3RYIB 3PJRA 4HLCA 4IY1A 4JVLA 2Z5GA 4A9AA 3QBVA 3UC5A 3HABA 4H3VA 1QMPA 5C15A 1P0IA 2VF4X 1SVMA 2WMDA 1JKJA 3PJFA 5KTNA 3JSAA 3L40A 1D2EA 2A9QA 4QGFA 4XSHA 5AVQA 2R6GA 3BGSA 3WTCA 3W2GA 3U6KA 3CERA 2QV7A 2BSQA 5I01A 2XUKA 2UXCB 1XZKA 3P27A 4G3XA 3EQ9A 4UU8A 3PE3A 2NNLD 1ZN7A 3L7LA 4MUBA 4QFMA 1X9HA 3AXSA 3DW3X 4TLDA 3LT1A 2VYND 5BVGB 4PSVA 4KPYA 3C6MA 3X2FA 4XI9A 2J59A 1WSIA 2HN9A 1JF8A 4IUBS 5C1DA 1J8MF 2BZ0A 5AH0A 2OYQA 1E1NA 5EHIA 2Q27A 2VRNA 3BJIC 4E1JA 2APJA 2ISQA 3TE7A 3UMSA 4OA5A 3ZHVA 4DBLC 3BBLA 5BRNA 3B6EA 3QEVA 3DEJA 1R4MA 3EZ5A 1UKZA 1MKYA 1HA3A 4DC0A 4FWNA 4M3TA 3VEZA 4LWPA 2HT1A 2J30A 3LGSA 4C8OA 5DK4A 2LXNA 5BRAA 4RY9A 2X0NA 1AGNA 4WERA 2QU7A 2OMKA 5H59A 3GBTA 1NJ8A 2B1GA 2FGJA 2C00A 2EKPA 3DTVD 3M6LA 5SY9A 4AMYA 3IEVA 3AI7A 4EFLA 3NP9A 2BBSA 4IH4A 4ZQFA 5FPDA 1AHHA 1E9AA 4LYDA 3WFJA 5LQCA 1X3NA 3H17A 3K4PA 1C0TA 2AG0A 1RBZA 2ZVDA 4N41A 3O4QA 1P5HA 1RWQA 4BO1A 4F71A 1KVAA 1MTOA 1ZINA 1GUAA 4O2RA 3LL3A 1YUBA 3A3YA 4C06A 3ELWA 2I3GA 1CX9B 2YY5A 2MYPA 2WYVA 4IJ6A 2ZUEA 4BIMA 4AG5A 3N8GA 1LI4A 4P4GA 5IJ0B 4QUBA 4LC9B 4ZA2A 2YHAA 4NV1A 4XJVA 3A4YA 1TKTA 4IDBA 4Q7MB 4RK0A 3SHWA 3WTBA 4BQIA 1GM5A 1YI1A 2IUUA 1Y6GA 1H4VB 1UJNA 2FLOA 4PL8A 3FW1A 3I2KA 5CJJA 1QIMA 5M1FA 1BU5A 2AR7A 3VNVA 2OD9A 4ZO7A 4YP7A 4AURA 5B7NA 2XE7A 3NIDB 4M46A 1K3UB 2NNWA 1TK5A 2PT7A 2YWGA 3AFNA 1TQ4A 1NBMD 3JXEA 3P0JA 2IPXA 4LZZA 3SY8A 1ZZEA 2JFYA 3CLKA 3ESAA 2H5EA 1QKIA 3P9RA 4YRDA 5BV2P 1WTCA 5A0VA 4FS8A 1R8YA 2NAPA 3V8PA 1VFPA 2H3HA 3R7FA 4MYSA 4DRZA 2JAOA 2OAP1 3FYUB 3QLTA 4U9UA 2ITGA 4WFBL 4NX2A 1J00A 1E4VA 3DGEC 5IVPA 3OKAA 4RFSA 1IMOA 1OD6A 1QHGA 2NPOA 3LNTA 4CDNA 1XRRA 5H3HA 2FWMX 5JVDA 2BH1A 4IIVA 7YASA 3TF5A 3H4VA 2YIDA 3KNZA 1QMGA 1WUJS 3WQHA 4ISBA 5C81A 4YQYA 2QZPA 1S3SA 5LZ5A 1SCUB 3VYTB 4LJLA 1J5EK 1WHTB 1PKEA 2CWDA 4BDZA 2ZJBA 2QI9F 2QL9A 3CF0A 4QDXA 1G21E 1XVUA 4GY2B 2RGYA 4V0KA 5LOVA 4H03B 4BMSA 2E5WA 4R41A 3TE6A 1A5TA 3VNRA 3M33A 3OMXA 4O02B 4QODA 5CFZA 4LNAA 4AQYK 1SC3A 1V1RA 3F71A 2QXTA 1HDRA 3GARA 1U9ZA 2I5PO 4L3OA 1YZNA 2UUPA 4GLBA 1JG4A 1B1AA 1AZLA 3UXHA 4UHHA 2WPDD 2J67A 4Y6RA 3RVSA 3NFYA 2XWBF 4E7OA 5L7TA 4N9QA 3AG5A 4R1LA 5AI5A 3SHFA 2QX6A 3SMSA 3PF9A 1IZZA 4P7GA 2W43A 2NV0A 1SUPA 2R7KA 3EGOA 3WL4A 2FMFA 1L4GA 1Z45A 1ATIA 3AKEA 1U1IA 3BD6A 3C8MA 1JG7A 4XEHA 3ZZ1A 4CM4A 3K2PA 4GBJA 4DXAA 3DYIA 4MVJM 4K0KB 4URUR 1IJKA 4EG6A 3GT7A 5HM8A 1GLJO 3AVLA 1C0EA 2AQ8A 3R5KA 4JQSA 4LMBA 4CFSA 5JANA 4HRAA 4MROA 4IIJB 4J6EA 2GJ9A 1K8ZB 5HFAA 4ZEOA 1MJFA 1T34A 4JY7A 5FH9A 5I3CA 1RWXA 3DLTA 1YT3A 2PZMA 4Q3EA 4HI0E 3IVXA 3ZSXA 1G2QA 3KAPA 3TAQA 2GYVA 2H00A 3VR6D 3KJVA 1N3LA 4BO8A 3LM9A 2FV8A 1RM3A 1VMDA 2HD4A 3GC6A 1TRKA 4JP8A 4KODA 2G1PA 4NEQA 2ZRCA 1Y3CE 2C5FA 2PVCA 1ZIDA 1HDYA 4N0PA 4K6HA 4U1RA 3V9AA 4DT1B 6REQB 2GEFA 3WV4A 1V6AA 4JLPA 2O8DB 4HLDA 4Q37A 4B48A 4B7UA 1YR3A 2DPXA 4QEZA 1FFGA 2F62A 3T3DA 2O2CA 4OUDB 4DLWA 4MW7A 2ZPUA 2ZE8A 2VDWA 4ILKA 2WABA 3GGPA 4D8WA 1GTMA 3CKMA 3RS0A 5JV5A 2XLBA 4ARSA 2BFNA 2BFFB 2CNKA 4DZTA 1Y5RA 3QZUA 1X1SA 2WVGA 5EGNA 2EP7A 1V7CA 3DVLA 3N7UA 2IY9A 2GAIA 2EFHB 4DMKA 3L0BA 2GEKA 1GG8A 3C7NB 1SQGA 1F2UA 4R5HA 5CBKA 4P86A 3REQB 3CNNA 3EXFA 1USGA 3IULA 4MOWA 2BE9A 4BLOA 1J0CA 1GNPA 3LP6A 2EKDA 3A2KA 2JEOA 2H4ZA 2AEJA 2AGVA 2Y93A 3HUEA 4EMBA 1U0JA 1MWMA 3K9KA 3PTZA 3ITEA 3PQ6A 4FB4A 1FK9A 4H7HA 4RVOA 5G4LA 1KZHA 3H8SA 4KFSA 1VIYA 4XX1A 5EFOA 1CZOA 5EZ5A 3WGMA 4FJMA 10MHA 3KOWA 4PQGA 5EQJB 2NVUA 4TS3A 5ILGA 4CJSA 2QLMA 4TPKA 4PC7A 1O6FA 2ACEA 5IC6A 1ZUHA 3DEKA 1SBQA 1NVBA 4OB8A 4R6WA 2IIQA 2AEEA 2CW5A 2UUBB 5EIAA 2FPXA 3ZVRA 4OHPA 1K5DA 2AG1A 3A10A 4J49A 5G4KB 1I2DA 1XTVA 2QROA 2WU1A 1G98A 3JQ7B 1D5CA 1TM7E 4FE3A 5A3QA 1JZSA 3AP1A 3O9SA 5J2UF 1CD5A 3P0FA 5IMSA 7GPBA 1WY7A 4OLBA 3CZPA 3N59A 5FF9A 4DV3B 2V3WA 4OU5A 1Y5MA 1A1SA 2G7ZA 2OO7A 4TWZA 1OOEA 3OSUA 5FHQA 1X77A 1EMDA 1SOMA 2ZYHA 3H1AA 1UA1A 3NTLA 5C51B 4MS1B 3D43A 1NY6A 2FUG6 3TCXB 1Y9ZA 3VMMA 3ZDFA 3TG8A 4EEXA 1S0UA 3QOXA 1VPLA 1UFQA 3TZLA 1E4OA 4LD0A 4DR6K 1OAKA 1PP4A 2C31A 2QR2A 3DDCA 3DZHA 3NIBA 4Y2VA 5L9AA 3C94A 5B36A 1ZW1A 2CKMA 4INOA 2PMEA 1YBFA 1NKEA 3IVAA 3W04A 4CW7B 4AJNA 5LQNA 1I7SB 1FK8A 1OBOA 1W581 2ZRGA 3B3AA 3C98A 5GOTA 4DKXA 1NN3A 3OYEA 3OZCA 3MF4A 1E60A 2HA0A 2XW6A 3VVBA 2R1TB 3DAFA 2F7SA 1BX0A 3IURA 3Q7QA 2OBXA 1O03A 2Q3FA 4X5OA 4XB6B 4XTCS 1R16A 4MVJI 4AZSA 1L7BA 2J4DA 3D81A 2GD1O 1QQCA 3KOOA 3SE7A 3SDBA 1NP6A 2QNBA 4UJ5A 2RAVA 1VSMA 4DR1K 3F9MA 1QB8A 1Y98A 2FEMA 2R00A 4LHSA 1NV9A 5EJ6A 3CGGA 4BNTA 1QKJA 1Z4MA 1M67A 1DJOA 3LLSA 3EXAA 4REOA 3K70C 4BE2A 2QP4A 4FJ5A 3GJ6A 4HLQB 5DYNA 4NBKA 3TIVA 3WNEA 3CMMA 5GPBA 1VMKA 4DR4B 2GBPA 1ZUIA 3QBWA 3AL3A 5FHRA 5C8XA 2PV0A 3H8WA 3GRFA 4M7WA 2GPTA 3W2TA 5DHSA 1BFKA 3W05A 1KA9H 2AXQA 4XGKA 4E88A 4P4SB 5LM3A 5L45A 2XKAA 1HDCA 3DV0B 3SF8A 3TZHA 4NU6A 1P9WA 2H17A 3VHXA 4F3NA 3NLLA 4OHYA 1S2NA 1F6BA 2AF3C 1CWUA 4H0CA 3PB3A 3KB2A 3HP6A 3D59A 2PH5A 1XDDA 1TIPA 3T69A 2GJKA 1IG0A 3ANXA 3G5LA 5ECYA 4ENSA 4LMPA 2QAGA 3QH4A 3CYFA 1ZOSA 1AS2A 1KI2A 3ZCMA 2KBFA 3AFGA 4LCBA 1L7XA 2HJWA 3MCTA 3SYRA 3I53A 2VHJA 5AMXA 3WNBA 3ZDRA 3DTVA 2ZQBA 1RPTA 3VVLA 1JA9A 3EW9A 3CVJA 4AM8A 4YV2A 1NSTA 1IHXA 2QY6A 3GF4A 4ND4A 4YP9A 1OFGA 2QHXA 3OHSX 3M6MD 4KUGA 3OJOA 1PR2A 2HHJA 3OYJA 3HNRA 4RHFA 5DZSA 2NT3A 2TMYA 2Y1LA 1E2GA 4KYVA 5SZTA 2Q99A 4GG1A 4DMUB 1K86A 5JCXA 4DNQA 3ZWAA 1MD9A 3K8OE 4FW8A 1X2EA 4G84A 2OORA 1PUJA 2GNAA 3W5VA 2QLBA 5M5BA 4KHWA 2HI0A 4FGLA 3CLHA 3NBMA 5CM2Z 2VPIA 1MH9A 1ODKA 3EGDB 3EVTA 1RXYA 1OTXA 4KE9A 4LGCA 3O8BA 1HURA 1YE5A 1YZFA 2OCLA 2PGAA 5K3SA 3WDMA 1WZ2A 1WNSA 1RMTA 1ULSA 3RSLA 1BS2A 1OFUA 5BN3A 2IHJA 1WQ1R 4C7OA 2UXDB 3QVXA 4D9KA 3RRGA 2Q50A 1NNUA 2FJ0A 2NMVA 2CLEB 2G71A 3Q6MA 1SC6A 2ZJ2A 1V35A 4NZNA 1NLMA 3DP7A 3R3WA 1VSEA 1BXRA 1SY7A 2ADOA 3G68A 4M4SA 3O80A 1NPYA 3KLBA 1O96A 1Z5VA 3IDZA 2PO7A 4AFNA 1VQ6N 2FBVA 1RTTA 3P39A 3MTJA 1T0BA 4RHXA 1HM5A 1G2OA 2FEXA 3D8SA 3K3PA 4LJKA 3OEYA 3LY9A 4OKEA 4M1SA 2VZ9A 5EWMB 1GGMA 5ERXA 4O8UA 1NW3A 2XCSB 3PA6A 4M9QA 2B5VA 2PL5A 3CR3C 3B7PA 3DKKA 1YQQA 5JMWA 5KEIA 1JL1A 3MSCA 5LQSA 2OILA 3DDOA 1RYNA 2PLRA 3C41J 3BTUA 4WASA 2ZUBA 3SEZA 3TLZA 2QLJA 2JBAA 1DL5A 3FYSA 5ALSA 2NRWA 5AYVA 5F4ZA 3WSWA 3ONNA 4ER7A 1NY5A 4KIUA 4F86A 1EQ2A 2R25B 1CF9A 4DFMA 1US8B 4N7JA 4REQB 4CKEB 3UM9A 4G4GA 1JFSA 1XHXA 5JYBA 3A6PC 2Z57A 3MD0A 3QUSA 4LBVA 3I6ZA 3EB9A 2EZTA 2FLVA 1ISPA 1C30A 3H2GA 4MQEA 2F6RA 3JARB 4R68A 4ZQGA 5KNLA 4LF9B 4IQFA 3V3KA 4CI6A 1W34A 3I8OA 2P9PB 1KEKA 1V4BA 1P6UA 3DO8A 4GH5A 4I3FA 3C6ZA 4O4JF 5JCJD 3PX4A 3PYXA 5E4YA 2M98A 3CSSA 2EG9A 3HB1A 3TSUA 4BNLA 1MC5A 2OM2A 2KW4A 3LW8A 1ONNA 1SL0A 1N2XA 2ENUA 3ZU5A 4LZOA 2HMWA 3HGQA 4D9BA 3SJCA 3WHIA 1H1LB 3CX7A 5EEHA 2CLIB 1YBHA 4ZWNA 1MT3A 3O91A 2OA0A 3RVLA 4GPAA 4TTTS 3RSGA 3ZBTA 5HRSA 2IHYA 3F1LA 4ESHA 3UMMA 4X85A 3S2YA 4MUMA 3DWLA 3HH8A 2WP0A 1IZ0A 4FWMA 4KXUA 4MI9A 1GVHA 2C9DA 3TIFA 4CGYA 1GXSA 2Q8NA 1QSLA 4C7MA 2BTOA 1UKVY 3KXKA 3LK6A 1ZM3A 3L07A 1PHPA 3I0MA 4ARCA 4PGFA 1RAHA 4PRLA 3P9CA 4S3MA 4GHWA 5ED4A 4P5DA 1NGIA 2HO4A 3EDMA 3FDZB 1M2HA 3JVDA 3DZIA 4EFNA 3TR5A 2F9FA 5G0VA 1UOQA 2VJPA 3T5TA 5KYYA 4KPUB 4R8MA 1V1MA 4G01B 3GLKA 1FNMA 2ZW9A 4BR2A 2E18A 4ISFA 4FFLA 1T1JA 2QENA 3QYAA 2VSQA 5F1XA 4F06A 5CTAA 3CVXA 5DTEA 4CU2A 3A6GA 2OHHA 2QTRA 4HQNA 4QXPA 4UNIA 2QF7A 1D6JA 1GAQA 3I6QA 3L43A 4PQUA 3KV1A 2GH1A 2H1WA 2W2MA 4K9NA 4TS9A 3PQ8A 5AKEA 4EX6A 3D0RA 3JARA 1KP9A 1U4NA 5EZ6B 4BEVA 4UFNA 2VHQA 4AKEA 5TLSA 3V1TC 2P9UB 2CB9A 2FMKA 2OQIA 5H9VA 1XF1A 4DG1A 2DLCX 3NV7A 3RK1A 4DLYA 3BIJA 4C6TA 3D6RA 1XJWA 2WSIA 4K03A 5AKGA 3W8DA 1GSHA 4ILEA 4WSOA 1Q84A 2XD9A 3QKUA 1QTNA 4I4NA 3B60A 3L8FA 4YRQA 2Q9BA 4DTNA 3V5NA 5DCUA 2JGKA 2VN8A 1U8FO 2BEWA 2CBXA 4FDTA 4JL8A 3WIOA 4FGZA 3V9ZA 1TA0A 2H07A 2O3RA 4FCVA 4P82A 4ROSA 4BO2A 1CHDA 1PFGA 3RIXA 5BW5A 4WY5A 1Y8QB 1M2JA 2EAUA 4PZYA 4JI6B 5EKXA 1OW3B 2E4WA 3L0IB 4Y1RA 1VGVA 1TGVA 4L5BA 4LC0A 2IGIA 1H2XA 2I99A 1CY2A 2PU5A 3E22B 5JZBA 5G1PA 2G8HA 2FXIA 3WXMA 5L51A 4DQIA 2E7ZA 1T2DA 2IYUA 2DX7A 3OIWA 1PE0A 4P8RA 3J80A 3JVIA 1DQPA 1TQ6A 1OC2A 1W5BA 3HXQA 5KU1A 4A0FA 4Y2JA 4XJXA 2RHOA 3COYA 4FOTA 2RD2A 1QTIA 2J4FA 1XPRA 4LFAK 3KXLA 5BSEA 1OXUA 4K8ZA 3LKDA 3OE7A 3CCVN 3T1NA 5CDUA 4M1MA 3T1AA 3PY8A 1QQ5A 3UW3A 1N0IA 1ULTA 1D8TA 4PR0A 1K5GA 2V7TA 1U7HA 3M2TA 1BMFA 4FLYA 5FULA 3IMKA 1PFVA 3HP7A 4JSTA 2DFHA 2VTVA 4B6EA 5LU9A 5LZ8A 5DYWA 3RFUA 4FLWA 3ABRB 2VWJA 2I03A 3CZ9A 3AO3A 4FWQA 3O2SB 1N8TA 3JR3A 3UV7A 3E1GA 5P8WA 5FTJA 2BH2A 2YVLA 2WAAA 4KLRA 4OJTA 3ZWDA 3OIUA 3L2UA 1QVGM 1R9NA 1UBMS 2B2NA 1G6HA 3PF8A 1PCXA 2BZ1A 3CPHA 1G63A 4CGHA 3EFBA 4MVWA 1X7YA 4LJ5A 4P2GA 1R6DA 3GE1A 4KI4A 3IHLA 3KYBA 3ABSB 5IDVA 3NP7A 1WLYA 2WIDA 4BLVA 1NNSA 1YU6A 1F7UA 3AHJA 4BWFB 1PZXA 2BGLA 2PX4A 4QD3A 4WHMA 3I0NA 4Z54A 1QQMA 1K66A 1KY2A 1NOIA 2Z3VA 3OG9A 4TTVA 3RU2A 1B43A 1Z0KA 3QE0A 3VHRA 1E3QA 2EARA 3EN9A 2DRIA 2JD2A 3Q0IA 1WLJA 2YJEA 5FPKA 2PBRA 2IYWA 4JI7B 1KI3A 3I01M 2IJGX 1SG9A 2R85A 1AMNA 1IBLK 3EZ7A 5KQGA 5C0YA 5L95A 3W6NA 3URMA 4UASA 1ZVQA 1YB1A 4HFNA 2P3OA 3ZSYA 4OXQA 1LV7A 1NZDA 5KYWB 4YRGA 1NL3A 3USCS 4DRXB 3NTXA 3VQ5A 1BA1A 1J0AA 2GJ8A 2PSEA 3PNVA 4A5OA 4EO7A 2JI7A 4KB1A 3LLCA 3ZS9A 4EUSA 2QBYA 2W0MA 4KTQA 4AX8A 1NP7A 3UKDA 3ZCTA 1XJQA 1KORA 3E7FA 5ERYA 3NH9A 2A35A 3OX1A 5CH5A 4A8JA 1ZC3A 2YQ4A 3FNFA 1L5YA 4KR7A 1HTTA 5L7WA 1MO6A 1U7ZA 2GUWA 2CKDA 4FTWA 1A1VA 3BZWA 4YJKA 4LQDA 1P7YA 2OBNA 5T67A 2IP2A 3BC1A 3OOSA 3FHTA 3WK7A 3NCTA 3ZWOA 4J4HA 1IWBB 3PC7A 4X1IA 3K2BA 5DGTA 3JS5A 4O3MA 2FN3A 3W8EA 1T3HA 3UANA 1ZUD1 2QRZA 4UQOA 5MLCQ 3OF3A 5CIWA 2OO5A 5JAQA 1GRNA 1NR7A 1YXQA 1X1EA 2O7NA 3IXLA 2D3TA 3WADA 1RZRA 1P1HA 5JO0A 1M7BA 4E89A 1Y82A 4MVJG 4YT2A 1U63A 2NOAA 4KQFA 5EXTA 1HQUA 3W6OA 1VCMA 4ZJPA 1QJ4A 3IP3A 4FC7A 4BWVA 5ES4B 4B3MK 2WSLA 2F96A 5D7NA 1VLJA 4RTLA 2HMTA 3KR2A 1RM4A 4JI0K 3LKVA 3PKJA 1CK4A 2IZ5A 2DTUA 4QLBA 1D04A 1K73O 3TEMA 2XUFA 2VQDA 1D2CA 2GPYA 1BC5A 1ZO8A 3L5OA 4ETIA 5KYUB 3MT7A 3R3JA 4RDIA 2PWYA 4UU1A 4ZV4A 1LWOA 2B0JA 4RDHA 5AW8A 1IIBA 1I3AA 1J99A 2NVBA 4Q3BA 4P3PA 4ID3A 1I4DD 4HXEB 4Q39A 4Z9YA 3H2SA 4YJGB 5EJEA 1ZNXA 4B09A 5IVHA 1JLKA 1NJZA 4WIAA 1LI7A 3I64A 5ECGC 3Q8KA 1NM5A 2HCJB 1UM9A 3W5DA 2PBDA 1XAJA 2NRZA 1RRVA 3SC4A 4F2RA 3T7EA 3VR3A 4JOQA 1LK5A 2ODEA 4AP9A 4DCPA 4BVJA 1XZNA 3VQ4A 2R65A 2RGXA 3W9YA 3V9SA 1QS4A 1IWPB 1N2HA 4HUJA 1RYBA 3PCTA 3FM9A 1C9JA 2WDPA 1D2AA 3IXMA 3VBEA 1BX1A 1OXBB 1TF7A 2PX5A 2CL0X 3ETCA 2ISSD 1NF3A 5C9ZA 1U0TA 3ITHA 2B5WA 1LV8A 4XOIA 3R7SA 5E0OA 1XTPA 2SKEA 4HX2A 5GP1A 4MI6A 2OPHA 1IG3A 4RC9A