4IFEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
448
structure length
434
Chain Sequence
b'INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 145
structure length 434
sequence length 448
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ifeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifeA01
4GP6A 1W0KA 1ZRHA 1P2SA 2RHDA 5L3QA 4Q1AA 3BJIC 2PT7A 1P7CA 4D80A 4MYCA 4M8NE 4OBEA 4JIMA 4BZXA 4QGFA 2QRNA 4TQ9A 5AJWA 2VBCA 1G41A 2BCGY 2FNAA 4JLDA 3AVWA 1EWQA 2RMKA 2RGNC 3TQFA 3EAQA 3Q5EA 4WOPA 3QEOA 4UNQA 4B74A 1SHZA 5EXTA 4YONB 2H17A 4V0ME 1Z83A 1G7TA 1LVGA 1NY6A 1FX0B 1WCV1 2KWIA 1VHTA 3LD9A 5C46F 1UEIA 3KJIA 2WMNB 2C78A 4PC7A 3UG6A 2JIZA 521PA 4ZI2A 2ZXUA 1CS4C 4KVAA 2F6RA 1Z63A 5J5CA 4DCVA 1RRCA 2ZRGA 2R8RA 4NE2A 4IKEA 4HLCA 4HAWA 4QRHA 2AHOA 4ILEA 3I62A 3A1WA 5FPKA 2XOKD 3WMGA 3U44B 5GJBA 3HP1A 1FNMA 4AYTA 4ZIRB 5IT5A 5KU1A 2H5EA 1P61B 4GT1A 1LF0A 1T8TA 4LYHA 2ANCA 4AI6A 3LBNA 2C2HA 1IXRC 1Q1QA 1EX6A 3W9YA 1GUAA 1XXHA 4RD0A 1RPZA 1GM5A 2Z43A 1A2BA 1A2KC 3B8HA 3HR7A 2DYKA 4D0LB 1NLYA 4TZ6A 2G3YA 2VP4A 4GDFA 1NBME 2WSMA 3KJEA 4A92A 4IDOA 1EGAA 1L4UA 3N2EA 4Z1MA 1RZ3A 4RFVA 2XAUA 3GQBA 5SZHB 4FWIB 5KYKA 4ASUA 3DKVA 4WVFA 5GJCA 1AS3A 4CT4B 1Z6XA 3R7WA 4K8OA 3RS2A 4B75A 1VCIA 4LYFA 3PUXA 4XWKA 4F91B 4PR0A 1DELA 2N42A 2JIZD 1SXJD 2ZJOA 2R2AA 1XX6A 2ZSDA 2GCNA 3WY9A 5KTYA 2IUUA 4Q4AA 1S3SA 2HLDD 2W2VA 3THXA 4PQFA 1R8SA 5DYIA 2O8CB 4NYJQ 2DCUA 1OIXA 4GZMA 1VTKA 3QG1A 2ZRJA 2G6BA 1XEFA 3KL4A 3L8YA 3U4QB 4CZ2A 1ZNYA 3N70A 4PSVA 2DB3A 1ZBDA 5DHFA 4L15A 1KI9A 5AWFC 5DNYB 2DWOA 5M1QA 3QVUA 4KLNA 5DISB 3LW8A 1W2HA 5B30A 5JI2E 2C5LA 4TN1A 4BFXA 2IS6A 3K9LA 1G5TA 2RGBA 3QF7A 4LRWA 1WE2A 5J4HA 4MRSA 2J5XA 3TR5A 1J90A 5J40A 3SJBA 1WBDA 4Z1MD 3GLGE 4ASUD 2CHQA 4HAZA 4M9QA 4XJXA 3TUZC 3EWAA 1RKBA 5JRJA 3SDZA 3GJ4A 2HJGA 3EWSA 2XJ9A 1L8QA 1IN4A 5KNCA 2O8DB 2WBLC 3CLVA 4Q9LA 4Q01A 1E9EA 1EG7A 1XD2A 4BUJA 1VECA 1HURA 4QBIA 4FCVA 2OXCA 3T5GA 4D0NA 1G16A 1T3SA 1XEXA 1OHHA 4LWZA 2BBOA 5G53C 2J41A 3AP3A 4BRUA 3QKSB 4JSYA 3QOFA 4QM6A 2H92A 2J0UA 2WJIA 4PC2A 1GDDA 2FMXA 2HT1A 4TLCA 2ZI4A 3FVQA 4C2UA 3CWZA 3GLIE 2V6IA 1T6NA 2YV5A 2FSHA 3B5JA 2GXAA 2XITA 4BZQA 4A4DA 4PO8A 2BJVA 2FDCA 1R5BA 4XTRA 5JZVA 3RAPR 5CDFE 4Q9KA 3NBZC 1RYFA 3RNLA 1CP2A 4PPFA 1IXZA 1E9SA 1Z0JA 4C0LA 3CKLA 2CVFA 3WRYC 3IBGA 1PUJA 5JWRA 2WVJA 5BYKA 4DCUA 5CLLA 1N5IA 4RD6A 2ZEJA 3K0EA 4OQXA 3X1ZA 3T1VA 3EZ6A 2GJKA 3LQRA 3RSLA 4N3NA 3RDPA 4JKYA 1OHHD 4PPNA 4NZYA 5DHAA 3U7EB 5KSPA 3ZYCA 1CEEA 2ECKA 2HF9A 3D8BA 4B43A 2Q3FA 1D2MA 1DADA 2OG2A 1MO3A 2J7PA 2OCYC 2Z4SA 1AIPA 2F9LA 2CE7A 5HR5A 3SHWA 1BMFA 2P6UA 2ZI3A 5L8VA 3NH9A 2F7SA 3TSOA 2QMUA 2FZ4A 1N0WA 2YC4C 3NVAA 3UPUA 3SQXA 5FFMA 4Q66C 3EPKA 5DI3B 2TMKA 1W49A 3L0IB 1XZPA 5G3YA 4HYYA 5FUXA 1P6XA 4A8JB 3ZD7A 3TJZA 2IW3A 1JPNA 1T3HA 2IWRA 4YQFA 2ZRFA 2CCGA 2GJ9A 3LFUA 1SULA 4TL8A 2GK6A 1SXJE 4X8LA 5M1NA 2HXSA 3KZ1E 2WHXA 1UDWA 3L8ZA 4HI0E 5J4LA 2XTMA 3NBFA 5LDDC 1WMSA 1OLOA 2B8WA 4RZ3A 1E2IA 4EPVA 4ON9A 1E3MA 3PV0A 5FL7A 2PJRA 1YJ5A 2IYLD 1YR6A 1N0UA 4IEEA 1MKYA 2WWGA 2PH1A 3TBKA 5J47A 2WWFA 1Z2CA 2J0QA 1MRNA 4LHWA 3ASZA 1XXHE 1ZCAA 4L9WA 1BMFD 4WZ6A 3TRFA 1E4YA 1XTRA 2J9RA 5J4VA 4EFMA 3AF4A 5DYGA 4TYQA 4QXAA 1R0XA 2CHGA 2AD5A 4KFUA 1W36B 2ZAMA 4AYWA 3W3ZB 2J87A 4JVNA 5C2DA 1XJCA 1E1RA 1TX4B 2RHMA 3GJ6A 3M4YA 5AR1A 3DOFA 3RS7A 2NIPA 4KU4A 5AK0A 5EP2A 1ESMA 2YJTD 4DLWA 2WV9A 2VIIA 3SEAA 3K8YA 1E2DA 1G21E 4FCWA 4HLQB 1VG8A 4NYJR 4QBHA 5TDHA 4DBLC 4B3GA 2QBYB 1UEJA 4AC9A 1RJ9B 4D0GA 5FBWB 1MO6A 4TMKA 2DR3A 3X2SA 5UKDA 2VRWA 3AF2A 1NMXA 4PFSA 3AKCA 3FHTA 5FL7D 3NG1A 4KBFA 1Z0KA 3AUYA 1AGRA 1PVOA 1S1CA 3LBIA 3P20A 4JLAA 3WP0A 4GMXA 2ONKA 1KI8A 4TMTA 2XB2A 2G1KA 4Q7MB 1T8UA 2F1HA 3KXIA 2CCKA 2BEKA 1T91A 1D5CA 1VIAA 4LJ7A 1BO6A 2PCLA 2WKQA 3RWMB 1R5NA 3LXXA 3K1JA 3KKQA 4I99A 2AKAB 5CJPA 2IWHA 2WWXA 4LPSA 1C1YA 3TGPA 1F2TA 1J99A 2JASA 1Q1BA 1LW7A 1CF4A 1P9RA 4H1VA 1E1RD 1K5GA 3BXZA 3CNOA 4A2PA 3BFKA 2CE2X 2YVUA 4F7WA 1KK2A 1W48A 3QUSA 4PHFA 1NLFA 4KHZA 3CX6A 3KKOA 2KB0A 2FA9A 3LLMA 5CB8A 2ZSAA 1II9A 3LQQA 1F5NA 3QKRA 2GVZC 3AEZA 2VP6A 4OJKA 1KJZA 1TQ2A 2BDTA 4ZDJA 3WMEA 1OW3B 1E2QA 1VCNA 4Q1BA 2JJ1A 1RYHA 2FEMA 2GKSA 4ZPXA 2P6RA 1SVMA 4O25A 3S1AA 3QENA 5CYOA 4EDHA 2A78A 2ZITA 1N6IA 1CKEA 1UDXA 5TVKA 4C0BA 5IRCD 4MGZR 3GJ0A 2GHIA 1J2JA 1G3IA 2QL6A 3LY5A 3P4XA 4HB3A 3VHXA 5FTLA 1UM8A 4QNRA 5KHOC 2C04A 1A7JA 3TUJC 2BM1A 3LVQE 3O8DA 4JBXA 2J0VA 4HEJA 2NMVA 5FTJA 1Z6GA 2WSSA 3E2IA 4LHYA 4WW0A 1N6HA 2R6AA 3KJGA 3VAAA 4DB4A 2E9SA 4LJYA 2CJWB 1G291 4F4CA 3BERA 1XZQA 5AJVB 2Y8EA 5C2FA 2X8AA 4IVPA 3MAAC 3AGQA 3LWNA 4LDJA 3WXMA 4JBWA 1Z07A 3VU9B 4M22A 4EPRA 3KQLA 3LA6A 1ANKA 3D3QA 3L43A 2XNSA 4UQOA 1DAHA 1VG0B 4KJZA 4FCTA 4ZCIA 1UFQA 2REXB 3IEVA 1H65A 2JJ1D 4XD7A 1FUUA 2GEUA 2CL6X 2P6NA 2R44A 3A4LA 1Z6YA 2O8FA 4C3ZA 5AJYA 3GLFB 5SZKB 5TB5A 4C0JA 1XJQA 1XTJA 3CF2A 2ZJ5A 4UXIA 3IIKA 5TARA 4Z8XA 3CNNA 5KDDA 4WZBE 1E0JA 3GLHA 4P31A 3W6PA 1W5TA 2OBLA 4NCHA 1G3MA 1JEDA 4Y0VA 2C99A 3THWA 2WSSD 5L3RA 3G0HA 4I1UA 1E2HA 4F4JA 3DM5A 3M6AA 1R8QA 4YMSA 4RVCA 2WJHA 4DKXA 2GJSA 1YZGA 4O2LA 4A9AA 4RFSA 4M9SA 3EARA 4MA4A 5IK2A 4KSCA 4B73A 4FMBB 4I4LA 4AKIA 4IOLA 1GAJA 4QBGB 1OKKA 1M2OB 2N46A 4S35A 1XCPA 4HAUA 3GEIA 4Q7KA 1M7GA 3F3YA 3ZQJA 4IDHA 1X6VA 4JYCA 3I73A 2I1QA 2QAJA 2WKPA 1AK2A 3U3RA 2O0KA 1RRGA 3IQWA 4XD7D 4Q5IA 2GXSA 1J70A 1N2CE 1JNYA 2CMKA 2F1RA 3MWKA 4AYXA 1KDRA 3AVQA 4IHQA 5JEEA 3AVUA 2BJWA 2HF8A 2EFCB 4V0MA 1TUEA 2GZAA 2FJUA 4M4SA 2WWHA 4C0AC 2IS1A 4B2PA 1US8B 2AFIE 4EPWA 3GJ7A 1W2GA 2O8BB 4OL0A 2NO9A 4LJ8A 4NCKA 3P4YA 1U8AA 2EVWX 2D3WA 1T9HA 2F43B 3VX3A 3WYFA 4DIEA 3BWDD 2FEOA 2QQEA 1MR3F 1P9WA 2QM7A 2ZJ2A 5HKKA 4PANA 1N5LA 3OFNA 2R6FA 1KSFX 3UXMA 1ZD8A 1S4QA 1Z0AA 1YZLA 4PZLA 4AKHA 5IK2D 2D62A 1CBUA 2DWQA 3QXCA 1UKZA 1OKKD 3L2OB 4II7A 4D4JA 1OFUX 4Q7JB 1YE8A 1U9IC 2D2EA 4YMVA 1G19A 1CU1A 5EE0A 2GCOB 4RD3A 2DWPA 2AX4A 3R20A 1Z8FA 1YR7A 1EX7A 3W8RA 4D2IA 4V0LA 5AUPB 2D4HA 3Q9LA 4QBFA 3EZFA 2ORIA 4BLQA 1BKDR 4MQBA 1TQDA 1XP8A 2QPAA 1VKJA 5FOVA 3ADBA 2BKUA 3SC3A 3CR7A 2Q21A 4LBZA 3AVXA 1GL6A 4NMMA 4ZDWA 4FD2A 1FNNA 4G01B 4BWYA 2FZLA 1QHHA 2OILA 3TSWA 1NN0A 2ZRCA 2ZRMA 3MG9A 2QPOA 4Q02A 2R6DA 4PQYA 1TU3A 1ZM7A 2IYZA 1YU9A 3TW4A 5C18A 2OO7A 2PZGA 3Q7QA 5HKKD 4XVQA 3LDAA 3EG5A 3VNVA 4G0NA 3OFND 5EZ6B 3LRPA 2BOVA 4C4PA 1SKQA 1IHUA 4RKFA 3QXXA 1AZTA 2QP3A 5DN6A 2W6IA 4FMCF 4W9MC 2AK2A 3MWJA 2BBTA 1CJMA 4A15A 1XJ0A 1D9XA 5F9HA 2ERXA 3ZD6A 3B1YA 2QEQA 2XGJA 4BASA 3I5YA 4MGIR 2Z5FA 3IPXA 2ZRAA 4PZYA 5FBRB 1CR4A 3CPEA 1GG2A 5IHPA 4URXR 1YZTA 1OF1A 2VYFA 2YOHA 4L9SA 2PMDA 4D25A 4JYBA 2X2EA 5C4MA 2GILA 1KZGB 2HCJB 2J3EA 3B13B 3REFA 3GP8A 1E9DA 3GCGA 3NXSA 4DDVA 2IYXA 2ZSBA 2VF7A 4DCTA 1U9IA 4P0TA 1DAMA 3BOSA 1RRFA 3V4RA 2NO1A 2ZI6A 1XF9A 3RYTC 4DHEA 2P65A 3AP2A 2ZSFA 5FBVB 1SKYE 5JSZA 2B6HA 2DBYA 1ZMXA 4IOKA 4Q18A 3ECCA 2DFKB 5DIFA 3PR1A 2X1VA 3SR0A 3K0FA 4ZDKA 3CX8A 4A2WA 4B3FX 3ADDA 2H18A 1G3QA 4ARZB 4TTQA 4Q4HA 5DN6D 5B57C 2W6ID 2QN6A 4CYMA 1KSJA 3AB3A 4DLUA 4X8OA 2WJYA 1OSNA 3A1SA 3NHBA 1W4BA 2QTHA 4J0QA 1KI6A 3GLIA 3GFTA 3CM0A 1YKSA 4BFTA 3ICEA 2ZR0A 5GJWC 1UBCA 2RGGA 5FH9A 4LV8B 1SXJC 1FMJA 3K0AA 3X1WA 5DGXA 3EIHA 3SJAA 5HPYB 121PA 4ZO4A 4HAXA 2ZANA 4B47A 4TLEA 4XIGS 3THYB 3BB4A 3AVOA 1R5OA 4Q1EA 1G18A 1XMVA 1IY2A 2EWWA 3U3JA 1TADA 1C4OA 2D06A 4CEJB 1T4GA 2ZJYA 2XSZA 3A6PC 4QGHA 4CDGA 2QP4A 3A58B 3K70B 1D8TA 3TMKA 1CIPA 2Z4RA 1G9XA 4MKGA 4V02A 4QM7A 3NHAA 821PA 3B9QA 4BFUA 4BZPA 2JLZA 3EC2A 5AUOB 4JLOA 3CWQA 2ZR9A 5BN4A 4TYPA 1D2NA 2XXAB 2FV8A 2RGXA 3BH7A 4FMCB 4BRWA 1I4DD 2OLKA 2PLFA 2ZYUX 2V9PA 1SZPA 1GTVA 3HU1A 1LS6A 1WRBA 1G8FA 3CIOA 3PIRA 3HR8A 4IOMA 4DT1B 4C7OB 3TNFA 1NG9A 2A5DA 3I8SA 2HV8A 4BLPA 4EPYA 4CEHB 2QROA 2WICA 2OXRA 4PHTA 4HSEA 1F2UB 3WNDA 3KB2A 1NN1A 1S96A 2JATA 4YMTA 4GOJA 3CZQA 2IXGA 2OSBA 2GK7A 2C9YA 3KQKA 5E7JA 1P73A 4OQMA 2YYZA 1Z47A 3BAFA 3FMPB 4AURA 1JEEA 2W0SA 1KI3A 1NLZA 2ODBA 1SVLA 2QORA 1KO4A 4R71A 2XSZD 3HJNA 1IJEA 2R62A 4OI1A 1W47A 2QUZA 1LV7A 2ZI9A 5FOSA 1K8RA 4JLPA 2V1XA 3C6HA 1SXJA 3RANA 3R9WA 2BHRA 1NMYA 2BVNA 4KV9A 5BYJA 1E2LA 1HT1E 1KMQA 3GEEA 2HLDA 1Q21A 2HYIC 4TLDA 4EIWA 2F1JA 3QPUA 2ODEA 1ZC4A 3LVRE 2VH5R 4DDUA 1SQ5A 4M1OA 3B1XA 3Q8XB 1TL7C 1UAAA 3HPQA 2ZSEA 1U98A 5C4GB 2W2XA 1MV5A 4YLGA 1CLUA 1CTQA 5KO2A 4G5GA 4HUQA 3LV8A 4QOSA 1NG1A 4JS0A 3GMTA 4EPXA 3QBVA 3U44A 1PV4A 4Q7LA 4L8GA 2JCSA 5KNDA 1GZSA 3Q5DA 5EJEA 1H8HA 1N5KA 2A5GA 2WAXA 1U0LA 2B7BA 1S2MA 3K09A 5LB4A 4B3CA 1BH2A 1OXVA 4KBGA 2B8TA 2H57A 4X8HA 2GNOA 2ZE7A 1PLJA 3P26A 2QA5A 3E1SA 1EWRA 2QE7A 2HJVA 4RZ2A 4JL6A 4Z51A 2EFDB 4NCJA 3ND8A 3PUZA 4JVLA 4LYAA 5FTKA 4B44A 2FFHA 3V4FA 4BLRA 3O47A 2V3CC 3CRRA 3R7WB 4Q4JA 2GVDC 4US0R 3RWOA 3B6EA 2HT6A 1FP7A 2Q0HA 3DVLA 3AVPA 4MUBA 1XB2A 1U2RA 5JJIA 4B6FA 2R6GA 3OZXA 1GSIA 2WJJA 2QG6A 2VA8A 2HDNB 1KI4A 4JLVA 3N2IA 2XZPA 1GL9B 2ZUCA 4HDCA 4XVRA 1DPFA 1FQKA 1VCMA 4MUAA 3SBDA 4QFMA 4URVR 5E7MA 1NKSA 1UBGA 2AXNA 2OCAA 1H8HD 1ZYUA 4RCYA 3FMIA 3ZIAA 3U4QA 3U7HB 1NL3A 4FMDF 4MYHA 2A5YB 3H0KA 3IO5A 4DWJA 4M0LA 3NBYC 1G7CA 3LO5A 4OKSA 4R2HA 5JHGB 1NIPA 4UKDA 2FG5A 4LGMA 4DEYA 2QE7D 2ZVPX 3B1WA 3SYKA 3PUYA 4QC2A 3F8TA 4ERNA 4RD2A 3BB1A 1G1MA 1HYQA 2QY9A 4DRZA 1JXOA 5K8IA 5LB2A 4TWZA 3DHWC 3OEEA 3HU2A 3C16C 2QAGA 2N1BA 4G5OA 4JKIA 4CVNA 1RIFA 1II0A 5JWOA 5FBQB 3WHKA 1LNZA 2H16A 3IIJA 3NDPA 1XD2B 5HZKA 4EJSC 1KY2A 2C03A 2GZHA 2DFNA 3AF1A 1ZM2A 2O8DA 4RKEA 1NJFA 1GRQA 3CRVA 4OI2A 1CJUC 1XEXB 5TY0A 5KPDA 5AUQA 1XEWX 4BFSA 4TL9A 2V8OA 2AWOA 1PJRA 2J0UB 1DOAA 1Q22A 1QG2A 5M1PA 1ZM3A 1JR6A 3RS0A 1EFRA 1CJKC 5CJ2A 3ZIAD 1QDEA 1NVVR 3FFAA 1HQCA 2IA5A 1NF3A 2WWYA 5HE8A 5D3MA 4KSBA 2VP2A 3PEVA 4PAOA 3WRXC 4NTZA 2FN4A 3BE4A 4H9GA 1FFHA 5EE3A 1M1YE 4DLTA 2HCBA 4CT5A 3BH0A 3TR0A 3WYGA 3BGWA 5F3WB 4P4SA 3W90A 1GL7A 1G64A 3VKGA 2PX3A 2WJVA 1G5PA 3V9PA 3RC3A 2NZ8A 2L0XA 1VMAA 3OEED 1VG9B 2XEXA 2WJGA 1KO8A 1TAGA 3ZVMA 2Q3MA 1XD9A 1F60A 3C7KA 2VP0A 1IY1A 4AY2A 3MLEA 2VHTA 1Z06A 1UPTA 5KDOA 2OCPA 2VO1A 1OYWA 5LBIA 4LBYA 1S8FA 2CCJA 1VIYA 3MJRA 1X1SA 1OXTA 3BB3A 2GDJA 4I81A 4Y0AA 4AK9A 1TEVA 1COWA 1SVOA 1IN5A 2G83A 2H8KA 4NBSA 1M7HA 4U00A 1YHNA 2IHYA 3KKMA 1BYUA 1I4TD 4XWAA 4FMDB 1EFRD 2BIFA 4EJSA 3EA5A 4UXHA 4XSHA 2FSFA 3TLXA 2RKOA 1FQJA 4HLUC 3L0SA 4URYR 1E2NA 4MITA 4ABYA 1R0ZA 1XPRA 1UKYA 4LV6A 4IOJA 3M0EA 4GNKA 1KI1A 2ZRDA 1KO1A 1QRAA 3IEUA 4C2TA 2QI9C 2IS2A 4C0QC 4EQ6A 5M1OA 1XBTA 1ESNA 2C98A 3FPAA 4Q9HA 3I92A 3OIYA 2XZLA 2BWJA 2CHVA 1P4SA 1PLLA 2EFEB 4NYIQ 1T5LA 1Z28A 1DVRA 1CJVC 1JAHA 2QT0A 1UADA 1GOTA 1Q3HA 2UZ3A 3EASA 5FUVA 1COWD 3OAAA 4RY2A 3ZVLA 2WIAA 1QHGA 2GEDA 2KBFA 5C10A 2NO0A 5KSZA 4HZUA 2GAOA 3B85A 4O3MA 3FWYA 2H1LA 2JA1A 3F5FA 1ZC3A 1HQYE 3QI2A 4MKIA 3G5UA 1XCMA 2XX3A 4Q9JA 4XOIA 4F38A 1TU4A 3ND9A 3UMFA 1O3YA 4DLXA 4ESHA 5B64A 4LV5B 1OB5A 4DEXA 4M1YA 1SVKA 1ZU5A 3FKSA 4DLVA 2RB4A 4LC1A 2FFAA 2ZS9A 3C5CA 2ZR7A 4YDSA 2IT1A 2FFBA 3KTAB 2C77A 3SJCA 1DBSA 2MSCB 1MO5A 3KUDA 5FPSA 4E03A 3IKJA 4PPQA 4V0OA 4HLUA 3X1DA 5P21A 2EFHB 4TL6A 1VG1A 2QPTA 4P32A 4EAQA 4P3YA 4PPGA 4B2IA 2BMDA 3O8RA 3AGPA 2OE2A 1H8EA 1P75A 4JL8A 1E0SA 1DG3A 3EZ7A 3GJ5A 3UG7A 1C9KA 1RJ9A 3VR1A 2QBYA 1Z3IX 1T0HB 2GBLA 3OAAD 4LBVA 1CULC 3CONA 1FL9A 1JQJC 1XEWY 3C41J 3HU3A 2LKCA 2YZ2A 2UZIR 1P3JA 1UF9A 1ZAKA 5K8UA 3PQCA 5EE9A 4DDTA 4UJ5A 1Z0FA 1HA3A 2ZVQX 1OFTA 1ZNWA 5H70A 1F6BA 2ATXA 1JPJA 2GTPA 3CNLA 2F3TA 2KBEA 3QPWA 4PC1A 3FKSD 4DJTA 4UNNA 1EK0A 1OB2A 1KIMA 4HB4A 3WBKA 3ZZUA 1W36D 1F2TB 2PBRA 3RRYA 3PXGA 3HDTA 1KAOA 1OH5A 2ZREA 3R9XA 3ZH9B 4FW9A 1XTQA 3GPLA 2C8VA 1E2EA 1P2TA 2VHJA 2ZYVX 3TAUA 5B2ZA 1NSFA 4EFLA 2FPKA 4IXMA 1D2EA 1H8ED 4GBMA 1JR3E 4BFYA 1E0KA 1K5DA 1S0UA 3D7MA 1IN8A 1IAQA 1ZD9A 3A8TA 1VPLA 1KMHA 2AFHE 4FWTA 3SHFA 1GKUB 1AJEA 4GRAA 1EFTA 1WQ1R 3C8UA 3I3SR 3A1VA 4MDFA 4CEIB 4U02A 3IHWA 2O0JA 4KFSA 4U5XA 1ZNZA 5JJLA 3UATA 4JMPA 1JAIA 3GJ3A 1KK0A 1E1QA 3ZVNA 2G88A 5J4YA 2E1RA 2BKEA 5EE5B 2JLYA 5C1BA 2OM2A 2V54A 2NZJA 3A36A 4JT2A 1VYVA 2BM0A 3P1JA 1R4AA 2P67A 1MT0A 1A1VA 5FUYA 4PAMA 1KK3A 3QF4B 4QHTA 1N6LA 4D4KA 4BFVA 1OH8A 5JJKA 4FINA 3MD0A 3SOPA 1J8YF 2QTFA 2KE5A 3TK1A 1P9NA 5BW8A 2FPMA 4QJ5A 3HWSA 3U6BA 1L7VC 3NIBA 1IBRA 5JWHA 2JJ8A 3QSYA 4G5QA 4M9ZA 1DAFA 1BIFA 3IQXA 4YDHB 621PA 1E4VA 3VFDA 1SVWA 3H1TA 4MDEA 2P5SA 5DO9A 2UVQA 1ZNXA 1FTNA 3NEYA 3K53A 5H68A 1JECA 1TEXA 2ZIAA 2ZRBA 2ZE8A 2O8FB 2JDIA 1XRJA 2G9NA 3OHMA 2WOJA 1E1QD 2LWIA 2ZI5A 3SFZA 3TUIC 4W7SA 4G5SA 4W5HA 5A4JA 3FMFA 2PZEA 1J7KA 1KJWA 3H4MA 3W3AA 2QTVB 2RH5A 3GLFA 1E6CA 4Q9IA 4S2EA 3GLHB 1ZD1A 2ZTSA 2QRZA 4UXJA 3B1ZA 5K8LA 1DG1G 3NC0C 1QHYA 2OFWA 1N25A 4HB2A 3THWB 2XB4A 3LNCA 3MGCA 4MKHA 3TQCA 4DLSA 2CVHA 4MYTA 2AN9A 4GZLA 2PT5A 2A5FA 1PUIA 1Q1EA 4RFSB 3KDSE 1KDOA 4D82A 5M1KA 2FGKA 3FHCB 1P2VA 3AP1A 3QKUA 2IYUA 3R8FA 1OPXA 2IUSA 3DL0A 6Q21A 1OE0A 2IF0A 2QU8A 2WTUA 4B3BA 2ASEA 1NSTA 1YVDA 2BCJQ 2X19A 2YOGA 4JZKA 1M6NA 3GD7A 3KFVA 1OIWA 3IILA 3WHLA 2JDID 1XFAA 3ASYA 4HB0A 2O8EB 1WP9A 4OI4A 3W8NA 3K9GA 3B1VA 4RZUA 3KXKA 3P27A 4TQAA 4LJ4A 4ITRC 4TQUS 4P4UA 3H2YA 2XJ4A 3B82A 2WMOB 2QNRA 5JS7A 2IYRA 1RC8A 3B7GA 3HPRA 4B2LA 1PZNA 3ZGXA 1XPUA 2J59A 4OK5A 1I2DA 221PA 1DEKA 5J4KA 4QKQA 3M1IA 4M1TA 5KNBA 3HYTA 3I8XA 2W00A 5EXSA 3NH6A 2JLQA 4JLKA 3RRMA 3L0OA 4GI7A 4RCZA 1T0JB 1TF7A 3QXHA 4BLTA 1ZIPA 2YC2C 4LHZA 2G0NA 3VMFA 4LCBA 1GRRA 3KQUA 1E0AA 3CBQA 3IIMA 4MH0R 1N0VC 2Q9CA 3W34A 4URWR 2PCJA 4YMUA 4ACAA 2V4ZA 3C4JA 2CBZA 1LFDB 2NO7A 3I32A 2IXEA 4KODA 1Z2AA 2FGJA 3A4MA 1EESA 2GRJA 1TPZA 2X2FA 2BEJA 1XCGB 3BS4A 1P2UA 4A0FA 4LBWA 1OIVA 1NY5A 1QHHB 2ZRPA 5EXXA 1FMLA 1T5IA 3JZAA 4GFDA 3Q72A 3OESA 4UNPA 5F98A 3LXRA 3NWJA 4V0NA 3VQTA 3P32A 4A36A 4R2IA 1XTKA 1E2FA 1W46A 3PEUA 4M53A 3QEJA 5JS8A 4A1FA 3C15C 3LLUA 1IJFA 3LX5A 3AM1A 4LHVA 1IN7A 2WIBA 3PUVA 4OHYA 4Q00A 2MMCA 2QM8A 2ZROA 5FOTA 2W83A 2ZUBA 3Q7PA 1FUKA 4HATA 3RSOA 2J1LA 1KKLA 5JCPA 2E87A 1UBEA 5ELXA 1ZU4A 1KK1A 3DZ8A 2K5UA 4PTLA 4JL5A 3U60B 2RGEA 1GP2A 4ZDIA 1IQPA 2A2ZA 3CH5A 4KAXA 1RW4A 2AXPA 5TXGA 5HZHA 2XZOA 4WZAE 1NJGA 1OT3A 1W4CA 2WM9B 3BD9A 2DPXA 2GF0A 4HAVA 1ZIOA 5EUMA 3LBHA 4JSTA 4IJMA 5FL3A 1Z6AA 3AV0B 4DUGA 2NPIA 2ZU0C 3GLGB 1ZW6A 2GWHA 4O0MA 4OHXA 1G3UA 1ZUNB 2IXFA 2WZQA 1U99A 3MSXA 3K9NA 4B35A 2I1VB 8OHMA 3FMOB 2JLWA 3LX8A 4KFTA 1HE8B 5JSZB 4A82A 1S3GA 2RCNA 1DAEA 1E98A 4KVGA 3VKWA 4UNRA 3FYHA 1AZSC 4NONA 4A6XA 1II8B 1Q0UA 3L82B 4BE7B 3CW2A 4LPKA 4M1MA 4LSGA 4HLDA 4C0SA 3PITA 1UBFA 1ZVQA 5SZIA 1E32A 4Q4HB 3T06B 3BRWD 2FSIA 3MCAA 5KSOA 3R9IA 3TAHA 421PA 4ARZA 5KPJA 3I4LA 5F2EA 4E09A 2AR7A 4NU0A 1IOZA 3RRNA 1VYUA 2WKRA 1F48A 1KDPA 1XMJA 1E9AA 2ZPTX 3GLIB 2OAQ1 4QJ3A 4EUNA 1MABB 2IYSA 3KQHA 4FN5A 4IFEA 2W2TA 4IW3B 2J7KA 1YZQA 3J81k 3KUCA 1JQLB 3QPVA 1M8PA 1FPMA 2VSXA 3NKVA 4NCIA 4P33A 4B34A 4DUGD 1NN3A 1B23P 1GWNA 1IXSB 3GLFE 3T5DA 1W44A 4Q19A 3U7FB 5CB6A 3THYA 2SHKA 4M2LA 1U0JA 4PX9A 1XWIA 1DO2A 1HV8A 4QHYA 1ELOA 3TE6A 2JLSA 4AKGA 5CYPA 1TF5A 2FPLA 2R6CA 2V1UA 1QF9A 3OIUA 2CNWA 3CB4A 1YZKA 2WPDA 3K09C 1U0HC 5BN5A 4E5UA 2IBMA 1Z0DA 2IHBA 2C9OA 2O52A 3E70C 4M1SA 1W4AA 2ZUDA 3REGA 1X8LA 1Q3TA 3T1TA 1CXZA 5HCNA 2XXAA 3BH6A 4QGGA 5L3SB 4KLZA 2QP9X 1R0YA 3EW9A 3QVVA 1KGDA 1AN0A 4MRVA 3U3OA 2ZRNA 2QSZA 4DT1A 4C7OA 4US2R 5L3QB 1E2KA 5KDLA 1R0WA 4AG5A 4M1KA 1E2JA 1G5RA 4CEHA 4A2QA 4KCGA 1Z22A 3QJYA 4JVMA 4V0KA 4DVGA 1Z6TA 5G40A 2LKDA 2FFQA 3QXSA 4NPHA 2QGZA 5CK5A 2MMGA 2ODWA 4UJ3A 3ADCA 1A5TA 2OUKA 4A0RA 4TYWA 3FTQA 4IVRA 4M9XA 3I72A 4ZV4A 2IYTA 1V43A 2Q6TA 1FX0A 3K0CC 3TVDA 4LHXA 4PC3A 4BLSA 1JB1A 1SXJB 1E9FA 5DE3A 1PLKA 1SVIA 2CNWD 3K70D 2V55B 2WPDD 4L5BA 4BPBA 2RGCA 3L0PA 3CH4B 4TSFA 4C0KA 5K8TA 1UKVY 3TVTA 4Q1FA 2D7CA 4C9BA 1TNDA 5HE9A 1VDZA 4ZIRA 4TTPA 2AK3A 3B78A 3Q3JB 4WBSA 1XXHB 4OHZA 3TSZA 4HUQB 5FUWA 2PX0A 2QAGC 5BN3A 3D31A 2XTNA 5FOXA 3MUFA 2X77A 1TTTA 3I1FA 1TF2A 1Q1ZA 2BMJA 2IS4A 1X8KA 4PSAA 2R9VA 4A0HA 4Q47A 4BFWA 3U3KA 4LX0A 2KI5A 1E94E 1W0KD 2CK3A 2ZYTX 2D7DA 2C95A 3CUEF 4YMWA 1AGPA 3MWYW 4IDNA 4RD4A 3W5IA 2REOA 3OEHA 4DSOA 1G17A 5GVRA 5HTKA 2HEIA 3ADKA 2AKYA 1TQ6A 1EFHA 3DEFA 3QQ5A 4E07A 3AH8A 1DAGA 4Q4JB 4M1WA 5JECA 4Q4AB 1N6KA 3AQ4A 1W1WA 5H1YA 3THXB 1OFHA 5FPYA 3VR4A 3LW7A 1Q20A 5JCZA 3NDBB 1VYTA 2GJAA 4OK6A 4LI0A 2PEYA 4TSFD 2O8CA 1ZJ6A 2VSFA 4E22A 1NVWQ 2RGNA 3K0CA 3MFYA 1ZUIA 4I1SA 4NKRA 3UANA 3UMRA 1G4UR 3MRSA 1QHXA 5GJVC 3UWKA 2GZDA 1G6HA 2O5VA 3SFVA 2A9KA 2Z83A 2F1IA 2OCBA 1LY1A 2CDNA 4EPTA 1GNRA 1HE1C 1JALA 1DE0A 5KSYA 4IXNA 5EXPA 4X8MA 2OT3B 3AKYA 2HUPA 4LUCA 1HEIA 2O0HA 1GKYA 3R8CA 4RD1A 4JJZA 2CK3D 4JBYA 4AD8A 2PEZA 4JJKA 3PEWA 2JJ2A 1MH1A 2C9CA 3T12A 3OEHD 4TLAA 3B60A 4JLBA 2ERYA 1XMIA 2KJQA 1NVXQ 1S1MA 2OESA 1SHKA 4L4UA 2ANBA 4URUR 4D4MA 1I2MA 3PG5A 1AA9A 1HY3A 4TLBA 2QAGB 5M1FA 4H1UA 1JR3A 4EKDA 4RSGA 1HT2E 3IGFA 4Q1DA 2UKDA 2Z6VA 4YXWA 1S9DA 3RS3A 2NOAA 2F3RA 3CF0A 3U5ZB 1AKYA 1CR1A 2VF8A 1KTVA 1ZINA 1QBKC 5CIQA 3SJZA 3OIWA 1X1RA 1WBBA 3QKSA 1QHNA 1GFIA 2ORWA 1X8JA 4NHOA 1OJLA 2JLXA 4MRNA 1KDTA 4AWXA 5F9FA 3GJ8A 1BOFA 1NVUQ 4US1R 2G1JA 5CM9C 3RVBA 2H7VA 4A8JC 4TT3A 3ZQ6A 3RHFA 2BC9A 1E9CA 4ZCMA 4LY6A 1TMKA 3EIEA 1Q57A 4JVSB 4G5RA 5D3MB 3CRQA 3BK7A 2GEVA 1KJYA 2XTZA 4LJ6A 4W5JA 4HZIA 3ZVRA 5IF9A 2JJ2D 3KQNA 2OHFA 2PL3A 4P4SB 1CR2A 2I4IA 1I4LD 2NGRA 2B92A 2ZS8A 4R98A 1E9BA 3AKDA 3O8BA 5GVSA 1FW6A 1GIAA 5L3VA 3IBYA 3DMDA 3HYRA 2FOLA 4ZKEA 1LTQA 2QENA 4A0GA 1WB9A 3FOZA 3IUYA 1JR3D 1S9HA 1KO5A 2CL7X 1P72A 1U8YA 4DDWA 2VLIA 3AVYA 1KI2A 4YXWD 4PAQA 2CL0X 3UIEA 1U94A 1KKMA 4QHSA 4Z8YA 3H84A 2Q3HA 3T1QA 4AKEA 1L2TA 1AS2A 3RRZA 2B21A 2FWRA 1GITA 2ZE5A 2ZE6A 1W36C 2F9MA 1DO0A 1JJ7A 4BFZA 3VR5A 2FX3A 4P4TA 4TT3D 3PFIA 3E5HA 2P0EA 3CO5A 4Q4LA 4B3DA 1FOEB 2IYVA 3CX7A 4KO8A 4NYMQ 4WAUA 4EJSB 5KUTA 3EPLA 2A7QA 4GOXA 5DI3A 4NDZA 1M34E 4IVQA 1R10A 4PO1A 3PCRB 1NRJB 4CGZA 4MRPA 2GBLC 2ZAOA 1KOFA 3W6NA 4A8JA 1XD8A 1KI7A 4F4IA 1U8ZA 1Y3AA 3JVVA 4BEJA 4D81A 4G3XA 2W6JA 2AL7A 1E79A 2GCPA 4EQ6B 5FOUA 1N6NA 3KXLA 4WXPA 3UK6A 4R7ZA 4W5WA 5EP4A 5FR2A 1YRAA 1L4YA 5EQTA 1LS1A 2Z0MA 1KNXA 3JVUA 1OXUA 3NC1C 4OQNA 3QBTA 3AVVA 1QG4A 4WIAA 1P60A 3DOEA 5SZJA 1DAKA 2CLSA 3W6OA 5A0FA 2YWHA 2I3BA 4DB2A 4PQRA 3UWOA 4TYYA 4HZUB 1WA5A 3H86A 3ZDQA 3SBEA 4GP7A 5E4FA 4TMWA 3KB1A 5FTMA 3CPJB 2J7PD 2PMKA 4WA7A 4OHWA 5G41A 1HTWA 1EFUA 3AF0A 2C96A 2OBMA 3CRMA 3DM9B 3SYLA 4FI3C 1U90A 4Q1CA 4ACBA 3U61B 1QHSA 1GILA 3DZDA 4PHGA 1N3BA 3U6KA 4B3XA 5CK4A 2G77B 3VR3A 2PZFA 2W6JD 1N6OA 4OHVA 4FIDA 4AIIA 1E79D 4M21A 4GPTA 1IM2A 1JJVA 1N6RA 2ZS7A 3QG5A 3KTAA 2A30A 3OIVA 3PJRA 3TIFA 4DLRA 1P5ZB 5AJXA 5DLQC 1RE0A 2EYQA 3AF3A 4IFBA 4CF7A 2JLRA 1E9RA 1OFIA 4IEIA 4DSTA 3ZZ0A 3T61A 1LF5A 4K81B 4BQSA 5AUNB 4XSGA 4QNMA 1R7RA 2PJZA 2VHQA 3QXJA 4XWOA 3NBXX 3SI7A 4PXAA 2BBSA 2IYQA 4TMVA 3SZRA 3A1UA 2NPFA 4TTRA 2W0MA 4JLJA 2VSOA 4BEBA 5A5GA 3SU8A 1W7AA 5DSZA 2RGDA 1XTSA 5C2JB 2YHSA 3ONWA 2ZJZA 5EUQB 2DFTA 2GXUA 3ZJYA 3EA0A 3VNUA 4B33A 5M04A 4RZXA 4K46A 3IPYA 1OV4A 1IY0A 1DARA 1Q12A 1JI0A 3AKEA 2FE4A 5EP1A 4XH9B 1FTSA 2HYDA 3TKLA 1XTIA 5ANRB 4ZI3A 3BORA 4LOAA 1RVDA 1R6BX 2J45A 4DC9A 3EXAA 1KYIA 1O87A 3VHLB 2ZU6A 2JAQA 4DLYA 3KKPA 3IHLA 2ODNA 4TMXA 3MJHA 4URZR 1JXMA 3BBPA 4NCNA 2YKGA 1G6OA 2DY1A 3FE2A 5EP3A 3MMPA 4TMZA 4R9UC 3QKRB 2ZRKA 2R65A 3PUWA 1E2PA 1KSGA 2IYYA 2ZYWX 2OFOA 3ZLJA 1WXQA 4LJAA 2GAAA 5JI3E 2CLCX 3SE0A 4OJQA 3QNUA 2VHCA 3THOA 1KMHB 2ZETA 4MKFA 3S1AB 1D6JA 4B32A 4LZZA 5IDVA 1Y63A 5CM8B 4GMDA 1V5WA 4TYNA 4OK3A 1R2QA 2KSQA 4CEIA 3LAWA 3T35A 4HUTA 3U2QA 4OQFA 4ESVA 4CRWB 2ZJ8A 1SKYB 3F0TA 4DZZA 1HUQA 3WNBA 4ZCLA 4Z54A 5FPTA 4EFNA 1G8YA 3JZMA 3AVTA 2QMOA 2CJWA 2EFGA 2GF9A 1Q44A 4KXFB 3DO6A 2OBNA 2DHRA 1TUIA 3QF4A 3T34A 3A37A 3D6TB 4G1UC 1NIJA 3GJXC 3UMSA 4DSUA 3VU9A 2OLJA 3B9PA 3BC1A 2IX3A 3KKNA 2GXQA 4QG7A 2EU8A 3X1YA 2FSGA 4I1VA 5FTNA 3SNHA 4TL7A 4NYMR 3RABA 5AJZA 3KJHA 4POAA 4D4LA 3A4NA 1Z08A 1G7SA 4BECA 2A5JA 2MSEB 5FOWA 4TZ0A 1ZP6A 3NEJA 1AS0A 3BFXA 3C5HA 4KI0A 2RAPA 2VP5A 2IUTA 1E69A 1FP6A 2FH5B 2CLDX 3EC1A 3GEHA 4JLNA 1ZCBA 1MOZA 5B58C 3CR8A 3N5CA 3RC8A 4NYIR 2V6JA 2B7CA 1CRQA 1IN6A 4NP6A 1RFLA 3EIQA 1OH7A 2YINC 1NN5A 4C30A 4V03A 2YWEA 4N0EA 4D26A 2GETA 2ORVA 4JLMA 3FFBA 3FB4A 5E7IA 2ZM5A 4OYHA 5FI0B 2ZRLA 3RS5A 1G8GA 4LJ9A 5CLQA 1XPOA 2MSDB 2J46A 1FZQA 1YZNA 4PSKA 4NL4H 3IO3A 1ONBA 2BMFA 3EX7C 3OE7A 2YWGA 3QKTA 3FHOA 2QGNA 1GRNA 3LH5A 1A82A 1YR9A 1A4RA 3PENA 2D74A 4IDPA 1AKEA 4L16A 3WMFA 4PC6A 3FDIA 3EPHA 4OQLA 4BLOA 5H8WA 1E99A 1GKIA 2G0TA 4PZZA 4LK2A 3I5XA 2QMHA 2REBA 3ICQB 1P62B 4QJ4A 3TW8B 3QIAA 3O8CA 1SVSA 1X86B 1US8A 2XNDA 2ZI7A 5FI1B 1XU4A 2O8EA 2BV3A 3PEYA 2O8BA 4LJ5A 1NNEA 1NMZA 2F43A 5D3QA 3IDQA 2ZJBA 4F92B 2VPPA 2A3RA 2P2LA 3EZ2A 3NTUA 1ETUA 3MWLA 2YNMA 4DLZA 5DI9A 1G8HA 1KO7A 2ZQ5A 4PHHA 1X3SA 2W58A 4IRUB 2PLRA 1NKTA 3SQWA 1NP6A 1E2GA 2IF2A 2QZ4A 1Z0IA 2EWVA 2GCOA 1W0JA 5EE1A 3WNCA 5JBQA 2AWNA 3OE7D 1OYYA 2VL7A 3DMNA 2OZEA 2JLUA 2F55A 2WWIA 4LYJA 3VKHA 1E96A 4HDOB 4C0HA 1YZUA 1LB1B 1QZXA 2OAP1 2VQSA 1M74A 1NBMA 1RRPA 4QL3A 1CRPA 2XNDD 3Q85A 2WWWA 3ZS9A 1IONA 1YR8A 1KSHA 4KYUA 4NH0A 5LD2C 1G7RA 3T15A 4DXAA 5JHHB 1N5JA 2WAYA 2BBWA 2NO6A 3WYAA 3KX2A 1G8PA 1VCOA 2ZJAA 3VX4A 5JLJA 2D2FA 3DDCA 4MGYR 2AD1A 3W5JA 1QHIA 3BIFA 2DFLA 2GJ8A 1EXMA 1KHTA 3ETLA 2QQ0A 5CIWA 3SS8A 3K0SA 5C15A 1ZUHA 5LPNA 2FF7A 4LC0A 4OI0A 2ZRHA 1W0JD 4N1AA 1J8MF 1KNQA 1KAGA 2ATVA 2P3SA 1GNQA 1UKEA 1YQTA 2IK8A 3EZ9A 4HAYA 4Q48A 2YOFA 4XVUA 3K70C 1B0UA 2NQ2C 1UJ2A 5JMTA 3V00A 2JEOA 5FBLB 1EFCA 4B76A 2IC5A 1DS6A 1QVRA 3A1TA 1NBMD 721PA 2OV2A 3DKPA 3DPUA 3K9HA 2VP9A 3EPJA 2ONJA 3AUXA 1D9ZA 4KYIB 2JLVA 3GLGA 1G20E 1WDTA 2V7QA 2IL1A 4MRRA 1BYIA 3K0FB 3UKDA 1E2MA 1CR0A 2ZRIA 2QT1A 5BWMA 4AG6A 3QY0A 1W4RA 2QMEA 2JGNA 3QE0A 4RJLA 4F93B 5BXQC 2Q9BA 4B48A 4DSNA 1GVNB 1G4AE 1M7BA 3FKQA 4B6EA 2EQBA 3ZZTA 1TQ4A 2VHUA 4BGDA 1F3OA 1BS1A 1Z29A 3X1XA 1II8A 1ODFA 3U3MA 4CW7A 4DIDA 1KI6B 3RS4A 3VR6A 2CEAA 5CITA 1XMSA 5G3ZA 4WXRA 5EZ5A 1SGWA 1W5SA 1AQUA 3GFPA 5E3HA 1QVAA 4XTCS 3C6AA 4O2RA 3VTKA 1JBKA 4A6PA 2QSYA 2CXXA 4GOKA 4KITB 5JFGA 3K0AB 4JT4A 2OEPA 4YC7A 5LD2B 1ZM9A 1ZM4A 1Z5ZA 5BQ5A 2EW1A 3T1OA 2VEDA 5KOYA 3CF6R 1YRBA 3WBJA 1OXXK 4ZKDA 4CIDA 4MGKR 2FU5C 4D6PA 2GESA 5JRZA 1MABA 3C14C 4N0DA 4DCSA 5TMPA 5GADl 1DAIA 2IEYA 2NG1A 2LCFA 4PO9A 4CEJA 1OXSC 2Q9AA 3SN6A 1GNPA 3BFVA 3I61A 5HCIA 5CDFA 2VTKA 1KZ7B 2NTYC 3PVSA 2P5TB 3U7GA 1T3LA 2IEZA 2V7QD 3CRW1 1MRSA 3GFOA 4GSYA 4HDQB 4KFRA 1NVVQ 4Q03A 1DTSA 4IDQA 5TV2A 4FXPA 1WF3A 5JEDA 1MO4A 4U7DA 5C12A 3VR2A 4QGAA 3GLHE 4Q21A 2YWFA 3SYNA 2EYUA 4MYUA 2J0SA 1XDBA 5E95A 1AM4D 3FGNA 2GA8A 2RGAA 1OH6A 1HH4A 3CZPA 1CJTC 1NI3A 2OFXA 1U81A 2WOOA 1K6MA 3RLFA 4I1OA 5FR1A 3G82C 1XNJA 4UNSA 4DCNA 5FPHA 4B71A 1AQYA 2XOKA 4GL2A 2IYWA 3TH5A 3B2EA 3OF5A 3WP1B 1N6PA 3ZS8A 1G3RA 5L3SA 1VHLA 3KFXA 2BMEA 1F2UA 5DH9A 3CPHA 2HXYA 1KY3A
chains in the Genus database with same CATH superfamily
1P2SA 4P38A 1P3DA 3EGIA 1KU6A 5H80A 3C65A 3EBOA 3ZSOA 2A1UB 2ATCA 1X1DA 2CLKB 5B58T 4UNQA 4UD6A 2C0CA 3DP7A 2DFVA 2KWIA 1G2PA 3EY9A 521PA 3SF0A 2F6RA 1Z5NA 4R05A 1AZWA 1R1DA 1TV6A 1AQJA 4KIUA 4OPKA 4J7XA 1ZMBA 1RHUA 5CY4A 1YVRA 1M8KA 1C3VA 2Q2NA 3C7AA 1A2BA 2EZ8A 1NLYA 1K89A 4ZI5A 3B8EA 1IWBB 2B4JA 3OKCA 5KYKA 2Z5GA 2FW8A 2MOKA 1ZXXA 4K8OA 3SAJA 5AKKA 1WZCA 1RYZA 3BJMA 3PUXA 4B17A 4XWKA 4PYNA 3NXKA 3KKLA 3KR0A 1K8KB 1QRSA 5A3VA 3FROA 3JPWA 3EEFA 1KI9A 4D9GA 2C5LA 2OUIA 4BFXA 4KR6A 3HBLA 3L9XA 5KYUB 1PSZA 3UCEA 1R50A 4RVDA 2CXPA 5T8KA 2B5VA 3KYBA 4YQYA 2AKEA 5KNCA 3I30X 1YFJA 1NLVA 1EG7A 2BGNA 4LX8A 4X3CA 5JZBA 3W2GA 4FCVA 5L95A 4IJQA 4DUZK 4GWLA 3K2QA 1H94A 3PUKA 3CWZA 1AKUA 4FJ7A 1RXVA 3MLBA 1E9SA 5KWSA 1WUIS 1Z0JA 2W6OA 1VIMA 4CHOA 3DWIA 5JWRA 1BFDA 4UU1A 1WPGA 3EDCA 5DT2A 2GJKA 2F17A 3G2NA 4WFNL 4AW9A 2G8VA 2BUBA 5BRJA 2HPVA 1D2MA 4H15A 3D6RA 2IVFA 2G7MC 1O6ZA 1MC5A 3AY3A 1XROA 2E49A 2RIRA 4E2ZA 4HF7A 3TJZA 3T1NA 4EW2A 2CCGA 3TB4A 2NRRA 3F3SA 1EUDA 2XTMA 5LA6A 1WMSA 1U3CA 5CB4B 4MQ6A 2PJRA 1CDZA 4NXMK 3I4CA 2ZIZA 5J47A 4LHWA 4U7FA 2QX9A 3FGUA 1PWYE 1E4YA 2EHJA 4YRQA 4C6TB 1BEEA 3UJ8A 4L7QA 1T1RA 4QT0A 3IB3A 5I7UA 4WX2B 4W5RA 1E2DA 4HLQB 5LMCA 5IABA 3WGZA 2K7FA 1M6VA 4KBFA 1NFQA 4QDZA 3R3JA 1C1BA 3S9HA 2WIFA 1T8UA 2Y9MB 2CCKA 1W88A 3IUJA 3B2NA 4M8SA 2AKAB 2ZYDA 4LPSA 2R1UA 1J99A 1P9RA 1K8ZB 4H1VA 4YRGA 1NVKA 3IFRA 3BFKA 4DR6K 4YJFB 3WC4A 3GNSA 2R7MA 3J7TA 1DTWA 4KPUA 3AEZA 2ACKA 5LOVA 1KJZA 1VCNA 1HE5A 4EDHA 2BZGA 5EJIA 4DV6K 4U4AA 1N6IA 3BK1A 3EC7A 4LG1A 4ZCQA 3P4XA 3T3NA 1A7JA 4FOLA 4LY0A 4HEJA 4FEAA 5C8ZA 1N6HA 5B3KA 3LUPA 2CXQA 3SZ2A 4C06A 5EJ4A 1YJCA 1GUBA 2Y8EA 3LWNA 3U4AA 2VOJA 3OCUA 2OPQA 3UJAA 3ZHYA 4E1MA 4AMUA 3UMMA 3B1JA 1PZMA 1G2OA 2PKRA 1OVYA 5H4HA 2VG6A 4B3MK 3BWXA 3K0BA 1Z7WA 1E2HA 7REQB 2R7AA 5TQJA 3JQAA 1N5DA 2E6UX 2CKMA 1Z2DA 1AUPA 1Y8RB 4Q34A 4KSCA 5JDCC 3HJTA 4TWBA 2PANA 4OKEA 5D86A 3EGXB 1N8TA 1N32K 5AOCA 4Z49A 1PFYA 1Q9YA 4GMKA 2GXSA 4DQDA 3OZSA 3UT6A 4EJFA 2C9ZA 2FRXA 1PT5A 3GDWA 4BX2A 3AVGA 4FSXA 1U8AA 4EKNB 2QVXX 4FFWA 5DTQA 1ABFA 2WJPA 2YMPA 2HMSA 4JI5K 4YMVA 2Q5OA 3PF8A 1Z68A 1BXKA 2B37A 2IRWA 4HDAA 4NMMA 1FKOA 3OJLA 4QXOA 2YS7A 4KHQA 3DULA 4U9UA 1NP7A 1WNSA 3ENHA 3LYLA 4D9JA 4S1WA 3O8MA 1Z74A 2AEJA 4YOVA 4MTCA 1KHHA 4R51A 3IP6A 2HA5A 2OXFA 3M6WA 3NZEA 3WQBA 4F5WA 4D25A 4JYBA 1YFLA 2P2NA 4BVFA 5LC1A 4CLXA 4QPJC 1XF9A 1UIRA 1CUYA 4P4GA 5A4MS 4Q3LA 5DIFA 1OGJA 2DUNA 1JAYA 3OX2A 2PHZA 4KHPK 4I50F 1KSJA 3M70A 5CGQB 4ZK2A 2VG5A 2WYUA 1ABEA 5BWBA 3UY4A 4X24A 3HP6A 4KP7A 4EP4A 5DGHA 5KWVA 4P35A 4XIGS 3R2JA 5JICA 3ZDCA 4QGHA 1JLHA 2WHRA 7YASA 3EGOA 4C7BA 1JKJB 2OVBA 4TMYA 3ILVA 3M89A 1GTVA 3ZWXA 4CLDA 3OKAA 4KI6A 1GFSA 2FLKA 2HV8A 4DILA 1RLIA 4MV7A 2GGSA 4EMSA 3NTOA 1TOAA 4FZZA 1UPBA 1SUAA 1VQON 1XA4A 2ZWIA 1QPZA 4UTOA 1UC8A 2X6QA 1D0VA 5FP0A 2HYIC 1Q11A 2ODEA 1NUUA 1QYXA 4FDTA 4KBYA 2P2CA 3RVNA 1LUAA 1PV4A 2JCSA 1GZSA 3I28A 2ZKIA 1Y7TA 3K09A 4C88A 3M8KA 2F3UA 4K9OA 1BNCA 3WK9A 3MCVA 3OHRA 2EFDB 4I9GA 4D44A 2V3CC 1G38A 1GYQA 3CMMA 1CUAA 4J1SA 3AVPA 5KQGA 3VMMA 3JQGA 2W40A 4B6PA 3HYFA 5CDTA 2FSSA 4QFMA 4OKKA 5JH7F 2AXNA 3TOXA 2C5BA 4IGIA 1IAVA 1W19A 1DJLA 3I1JA 3LHKA 1YXQA 4IO1A 4KVZA 2YHYA 3RGGA 1JHAA 3OEEA 3FFKB 1TVEA 1JG1A 2FPIA 1WNTA 1GCOA 1WB6A 3AF1A 1S6YA 1K63A 4LJSA 3D3NA 4AO8A 2IDZA 2EHGA 1EVQA 1QQ5A 3KOOA 2ICAA 3DRPA 2JFVA 1D9FA 3GARA 1FFHA 1QK3A 3ULEB 1ICEA 1B0AA 3OCWA 1EIZA 5BN8A 1E3QA 2QRQA 1YAHA 3QXGA 4F3CA 2HHJA 2JI6A 3LM9A 5E26A 2UXDB 1OC4A 1TEVA 4K43A 3INNA 3KKMA 4LF8B 1AKRA 3UAWA 1NMSA 3PHJA 1W2BM 2GB4A 3O4GA 1EFLA 2ID7A 4WNAB 4LV6A 3VUEA 1U2VA 4CI6A 4GNKA 4A1OA 3T19A 4R7GA 2BFBB 4UTZA 3OS2A 2XF2A 5H3LA 4EDFA 4FI3F 1YBFA 4PN3A 3JW8A 1JDZA 1SIOA 1EUDB 4S2UA 2IP4A 1DVRA 3UUWA 1CG6A 5BQOA 4XQ9A 1E20A 3C1TA 3LYHA 2H1LA 2JA1A 1RILA 1JHYA 2HQRA 1KSPA 1NJ5A 1RD4A 2WP0A 4DEXA 1SVKA 4N6NA 4K03A 1X3LA 3FFWA 3M7IA 1MO5A 1H2YA 2FMFA 3HVTA 3Q7BA 4PPGA 3LALA 4MQLA 5AQQA 1M6VB 1DG3A 5DKFA 1FXXA 2QU7A 4I2NA 3DOOA 1ODLA 4NDAA 4J2HA 4W4TA 1QFJA 4CFYA 1HA3A 1N8NA 2A7XA 1W88B 4X7RA 1Q6YA 1IE3A 1ECFA 5I7VA 2CXNA 1PNOA 5FAKA 3D1JA 4ZYXA 3ZSWA 3HHEA 1PSWA 2VQDA 3RUFA 4GX0A 1H8ED 3C3XA 1DTWB 1AHHA 4ZYVA 4G8JA 2HOEA 1VKOA 4KPUB 4KDRA 5LOVB 1TZKA 3UXHA 1EUQA 4JP1A 1THMA 3PDWA 2Q0RA 4R4JA 2R97A 4KFSA 3ROTA 4WUVA 3KCNA 1KAYA 2NSLA 1FFBA 2CFSA 5AKZA 4JT2A 3LDHA 1C7EA 2GCEA 3S1LA 4FINA 5CHEA 3UMJA 1P9NA 4I4TF 3OZTA 1AZLA 3NIBA 4KKOA 1YO6A 2JJ8A 3TPFA 4BN4A 1U8UA 3IQXA 1CF2O 1X7ZA 4NBKA 2QT9A 3GGGA 1DX4A 1LDEA 2XUJA 3NTVA 2JDIA 3ACCA 2LWIA 1KMMA 2QR2A 2M1ZA 1GY8A 4YAKA 1Y5IA 1RXUA 4FQ8A 3G5LA 2VDPB 3OG9A 4M37A 5ALGA 3VSAA 1MDFA 1YVNA 5B1IA 3IDZA 3AI2A 1KDOA 1RQ2A 4EFDA 2ZSJA 3FHCB 4Z4FA 1M2OA 2H4FA 2WAMA 4FFPA 1BDMA 2POQX 4OI4A 3VO1A 4CQJA 3UGJA 2PMBA 3WJAA 2QTRA 4IF4A 1C0PA 3AR5A 3THVA 1OPRA 2DSTA 1DEKA 4JLKA 5TT1A 4BY9E 4RCZA 4KPFC 3K9KA 4DUYK 4BLTA 3SQNA 4UZSA 1L0BA 4G9BA 4LCBA 2HTFA 1E0AA 3H05A 3O7WA 2HA2A 3QEXA 3C4JA 4DTXA 3A4MA 3CVWA 2IIBA 1NOZA 2PL9A 4X7PA 1IG0A 1V5GA 4DJJA 4C23A 3VYSB 4CCHA 1TC1A 1YC5A 4V0NA 3P32A 4C1NK 1NW4A 3LLUA 1QF7A 2KLHA 4JOQA 2X0EA 4LDPA 2A9FA 3BK2A 4BKRA 2E87A 3H2BA 1HT0A 3TKYA 2H11A 5EUMA 2NPIA 1JJIA 2DSNA 1Y6QA 3MSXA 2I1VB 2G6TA 5AQMA 4X1OA 1V1JA 3V9UA 1LV8A 1FTYA 2V97A 3T9EA 3GVPA 5KSOA 4AROA 2AR7A 3RRNA 2OAQ1 1X19A 1RBSA 5CA0A 4M83A 4IIDA 2KLBA 4BVOA 1YDGA 3KTDA 2I4OA 1YA8A 2VDKB 3TCNA 1UXHA 5K8VA 4CLRA 2HMTA 3HXOA 4BE4A 2YICA 1ELOA 4QIHA 2FPLA 4NMXB 2VRCD 2D4AA 2AS0A 4M1SA 1JHRA 1XI1A 3REGA 5MFPA 3D2AA 2XXAA 4FGSA 3TRIA 1YQEA 3LUJA 4MRVA 2KX7A 3ROKA 3U3OA 4LF9K 1UA0A 2Q6IA 5L3QB 2HWUA 4DVGA 2JPDA 5JAQA 3GRAA 2IX9A 1S1XA 3FTQA 4MNTA 3RSHA 4RIGA 5YASA 4L5BA 5ICMA 1WSWA 1FEZA 4M76B 3DM2A 4C0KA 2FP4A 4Q1FA 1EK6A 4ZIRA 4TTPA 1H5UA 3O1IC 3DHNA 2AEMA 2QTDA 5M2QA 3D31A 4EBBA 4BPRA 2FFJA 4LAFA 2L18A 3EDOA 3PNMA 2G1AA 1W0KD 4OY3A 5F77A 5AI9A 4F1KA 3W5IA 4RTKA 2IY7A 3HL0A 4KUEA 4GUDA 4A57A 4Y8VA 1RMYA 3JQGB 4MYRA 4WOJA 3MFYA 5K9ZA 3L02A 4RZHA 3B20A 2HV9A 2JFHA 2E4UA 3UK7A 3F67A 4XUDA 3EEBA 5KSYA 1BRTA 1U3VA 5LP1A 3REQB 4D4MA 3CCSN 4IO8A 3T7ZA 3IGFA 4KL8S 3P9YA 2PKQO 2BHLA 4HFRA 3DCIA 3WBBA 1JH9A 1RWMA 3FSRA 1X1RA 4AWXA 1HQUA 4US1R 4DA8A 4DV3K 5CM9C 2P51A 3QPBA 4LY6A 4PO3X 3CQ9A 4Q0MA 5MF6A 5IH3A 2PL3A 3OOEA 4R98A 5EU7A 3V1TC 2E5FA 4FJJA 4M54A 3DBRB 1DT3A 1NJ2A 3Q6MA 3FGPA 1QHEA 1FUIA 5JE8A 4NK4A 1J54A 1KDZA 3QOYA 3KL2A 4WWHA 5KWJA 4BY9C 4CQLB 2R1TA 5AW0A 1U2VB 5K4GA 3M3DA 1C8BA 3WGOA 4XLZA 4YFYA 4KXLA 4QPZA 4KO2S 3NAMA 2BUPA 1UKAA 2NO5A 2PRJA 3DDNA 1QG4A 3UC9A 1ZN7A 1YJBA 3TLZA 3WYEA 4ZAYA 1YUBA 1ZJ5A 3N0VA 5FTMA 3RIGA 1HWYA 3AF0A 5LR6A 1NGGA 4Q1CA 1GGVA 1W0HA 3L1KA 2RHBA 3O0DA 1HNWB 4AIIA 4FIDA 3NTQA 3BHMA 5T4BA 4MVXA 3RROA 1RWQA 1OFIA 4OIMA 4XWWA 2VHYA 5F21A 1FXSA 5DSZA 3KHUA 4ESOA 5KCZA 3ONWA 4GL4A 1SKRA 4RZXA 2AA3A 3CX4A 3I9MA 2ZF5O 5EP1A 4PY5A 1WXFA 2ODPA 4MB2A 1ZBFA 3R75A 2JAQA 1QVVA 5AW7A 2PUTA 3QESA 2DY1A 5CCBA 5EP3A 3GL9A 1T35A 4R9UC 2Z2KA 1XDWA 3D2LA 1BS2A 4JX8A 3NAZA 2QN7A 4NZZA 1WXQA 1T1GA 5BVGA 3NCTA 4MUEA 4DV7K 5GQSA 1V9CA 2HCTA 2W93A 4U7TB 1J0XO 2H31A 1KFJB 1RM4A 3TTFA 3I52A 2YBEA 3VQ5A 3O94A 2WMDA 2VUSA 2B1JA 2EKZA 4AUKA 2F62A 4ENSA 4L4YA 3HZOA 5F1PA 1JG7A 4BVBA 5BSEA 4BNYA 2OFPA 3UJBA 3CKKA 1FMFA 1Q50A 1PT9A 4HUJA 1X7ZB 3V6DA 1Z08A 5FOWA 2YNMC 2PGAA 3MJCA 3RJZA 2Z1NA 3U4LA 2FH5B 2CLDX 3U13A 4H60A 3MT8A 5B58C 2RE2A 4BEVA 2YX1A 1I4WA 3WQHA 1SL1A 6YASA 3ISJA 1S4MA 3B5IA 3P2YA 3I9OA 4DYHA 4BATA 1C8VB 2ZG6A 3TX2A 4BNVA 3H3JA 2O8BA 4FQ5A 4L76A 5K09A 3EZ2A 1VHDA 3E0QA 4TVKA 3AB8A 3K8QA 1YFKA 4JGGA 2VHVA 4Q15A 3WGGA 5EWLA 3FCCA 2VYNA 1M33A 2V9CA 2EWVA 1RP1A 4GM1A 1ISRA 4CQMB 4JR0A 5JADA 2OXIA 3WIOA 4AJ2A 3T94A 4C07A 1DNPA 3E9OA 4GGPA 3RUCA 1UK9A 4RPJA 2IGIA 4KYUA 5LD2C 5GGXA 3KOUA 5FO0A 1VA4A 3GLRA 1A9XB 3ADPA 3STYA 1PK7A 5FCDA 2WYWA 1PGNA 2GJ8A 2Y93A 1GQRA 1IIBA 1ZUD1 1UKEA 3I6ZA 2YOFA 5BRDA 2VR1A 2OGZA 3V00A 4OGGA 4IDBA 1EE9A 2H5IA 3I0MA 1TLTA 721PA 3K9HA 1L8XA 1D9ZA 4CJ3A 4KYIB 1CJBA 4I1IA 3D54D 1P0PA 3PPXA 2QT1A 4HX9A 2X5NA 1P2BA 4P36A 1KOLA 1I6LA 4RJLA 5BXQC 1IBMB 4DSNA 1WMAA 1UBLS 3A2MA 2QMQA 4YQEA 3OT5A 3RS4A 1XZNA 4L7VA 1HEUA 1U4NA 1BE6A 4A6PA 2YFKA 1I9GA 5CA0B 2EW1A 2HMPA 1BA2A 3G7NA 3TBHA 3OYMA 5AQRA 1SCIA 3G0BA 2K6GA 1QQOA 2QTGA 2WI8A 4CEJA 2PNFA 3C0BA 1ORDA 1DTSA 3C5VA 4QGAA 5J43A 1P4RA 4KQHA 2LP4Y 1ZFNA 3FPGA 5EHZA 5E95A 4EO7A 3VQDA 4FYMA 2ZJ7A 4I9UA 1NVBA 3HCAA 3IBCA 4EG7A 3LI2A 3KFXA 2JCYA 1URPA 1XTPA 3ZSRA 4RUKA 4FJGA 3CCQN 5IEBA 3WIUA 5A5DA 1MB3A 3DE3X 1FVXA 1GGHA 3VR2D 1NY6A 4RQBA 3WK4A 3B3GA 1V7ZA 3IAXA 4DG9A 2R8RA 5B1YA 2NVBA 1CY8A 4DSLA 2FP4B 1QQAA 3U44B 5ADHA 4ZIRB 3I0ZA 4F1JA 1ABBA 1IXRC 2QLNA 5EOVA 3LXMA 2I03A 3K0KA 3VO2A 4ZCSA 1DB3A 1NJ6A 1FK9A 4IDOA 3TAEA 2GPBA 1RZ3A 1UP6A 1W9MA 1UMDA 1ZL2A 4MV1A 3IBSA 4KFBA 1EETA 3S2EA 2DJ5A 4RABA 5TEWA 2HNDA 2W6ZA 3AUUA 4YREA 4NFSA 3RKUA 3DDUA 4G5FA 3ONNA 3ZT4A 4EY8A 2OCLA 5DM60 5EVJA 3KL4A 3L8YA 3FHLA 1MFZA 1Z05A 3CZ5A 2IH4A 5IDWA 4MRSA 2X0KA 5JAPA 1XWFA 4YAFA 3AI7A 5JRJA 1IEXA 1CPYA 1K4MA 4PSDA 5IAAA 1ONPA 1VLHA 4FFBA 4OXKA 3F49S 4NMWA 2XT9A 1M67A 3C6XA 5CTAA 4ZU1X 3TRHA 3VPBA 2AG5A 3OYKA 1NOJA 5KC9A 1K7YA 4D9CA 4IHAA 5BNTA 2ONCA 5GIPE 4FM1A 4ZAXA 1DMSA 2BJVA 3O7MA 5CNMA 5K6AA 3M6VA 3RAPR 3A70A 1RBYA 4KRXA 4B3OA 2CFTA 2OB2A 1C8KA 3QNWA 4FJ9A 2P9JA 4QREA 1Z4IA 3T41A 3PZRA 3U17A 4YDQA 4D8WA 3DZIA 3OJXA 3TAQA 4NZYA 5ALMA 2W70A 3ZHBA 3TS1A 4XIIA 4B43A 3BP8A 3EVCA 3LP6A 2OCYC 3TSOA 1N0WA 3KSZO 2Q2QA 4QUBA 3ZSQA 5JMOA 1ECBA 2R1TB 4FYDA 2ZT6A 1Q7GA 1GUZA 1QFSA 4ZD6A 3AU8A 2VHEA 1SXJE 4PYOA 4CFAA 1UDWA 2E4ZA 4RZ3A 2E5LK 4MW1A 3IH5A 3CCMN 1J5XA 4XYMA 3TBKA 1PQPA 5AVZA 5C1IA 3VQAA 1ZCAA 1BMFD 3U56A 2PR7A 2CFRA 2HQ1A 2C29D 5CUQA 4PA1A 3BAZA 1ITZA 1ZW1A 3VQQA 1R0LA 3N2ZB 3K8YA 1VG8A 5A5EA 3EUEA 1AXGA 4PKHA 1T5HX 3ETNA 2HU5A 2Q49A 5LBUA 2C2GA 2FEPA 2BEKA 1G5IA 1JN0A 4J7UA 3GGSA 2ZBPA 1WCXA 4KKVA 4LK3A 1YRYE 3KQQA 2QM3A 2LZ0A 4R79A 3K5NA 1WXWA 2P9FA 4F7WA 1PL8A 3L49A 1NLFA 3IKVA 1JHDA 1II9A 3S8MA 4HLNA 3I45A 4JJ4A 1FDOA 5CNJA 4EJ0A 4GUAA 1ZONA 4Q1BA 3TANA 1K8QA 3V2HA 4L51A 3G13A 1I0IA 3NM6B 3VHXA 4DTUA 1B0ZA 2C04A 3GLSA 2J0VA 3P0FA 3VGLA 4TOIA 3DF7A 4KGDA 4X97A 4OKJA 5LIRA 1QGAA 2X8AA 3NH1A 4DTPA 4RK7A 1W581 3WXMA 4GKVA 2MDTA 1YC2A 3OT1A 5HQTA 4C4YA 1T1IA 1Z8NA 4FCTA 5IBRA 4XD7A 3SCZA 2O0LA 1N34K 4ZAWA 4RH3A 1USGA 2QTVA 3FXAA 2BI7A 3PNQA 4FZ5A 4QS7A 4L8WB 1W5TA 2HHSA 5L3RA 4LXYA 4I1UA 4TKZA 1UBMS 5CM2Z 5MGNA 4O4HF 4OXNA 4M99A 5FV7A 3RKSA 5A3QA 4I4LA 5CFMA 4OEHA 1K8XB 5EUBA 3KTOA 4UUNA 4KIGA 1RVV1 1AH2A 3RFVA 1KU0A 4IMJB 3G02A 1ILWA 3OPVA 4F2WA 3L04A 2G08A 2P8SA 4D8XA 2EFCB 1XI2A 4M4SA 4DFPA 1MLDA 2QL9A 2O8BB 4HXYA 1ZR2A 3WYFA 3VX3A 4FYHA 3RJ9A 5CDUA 3EEYA 3OFNA 3CW9A 4NV3A 5EWLB 4II7A 4JY7A 4Q7JB 3QWHA 5BQFA 5MLCQ 1QH1B 4XAQA 4OHMA 2XVYA 1TQDA 1OXKB 2AC4A 1Z56C 1NUPA 4YPOA 3TSWA 4GY2B 3LL3A 3Q7QA 1DX9A 3VNVA 2BOVA 1U4SA 3KTFA 4E2FA 1F2DA 1RHJA 3MWJA 3CNEA 4RGVA 2DXIA 4HEA1 4GI2A 2XGJA 3GHHA 4DY4A 4YDUC 2ZDGA 4URXR 4CMEA 4J9VA 5JTTA 4OJRA 3OBIA 3QJGA 4ZT4A 2VWGA 4UMVA 3IT1A 4NICA 4UBKA 2XY7A 4NPAA 4M0FA 4Z0PA 1CQJA 5FBVB 4ZOQI 5JSZA 1V8DA 2QWQA 1WXGA 3MCAB 1S89A 4AHTA 1TW2A 3MJ4A 3K6RA 2RGYA 5HMMA 3QEMB 2GHRA 2EZ9A 4U1RA 2ZB2A 2DX7A 4KMOA 1SXJC 1QSLA 1XLTA 2VNHA 2W90A 1OKJA 2WYVA 1C4OA 4CEJB 4JUFA 2QP4A 3ME5A 3SZMA 2W2LD 3OFKA 4L0DA 3B9QA 3FVTA 1DC4A 4UFNA 4MW5A 2QJRA 4IOMA 4KWIA 4X92A 4ZAGA 1MX3A 4WSOA 1MFPA 1NGEA 2NUTB 1P73A 3EOZA 3IUMA 3KS9A 5CE3A 3ZDEA 1OZ0A 4WESA 1SBCA 3HJNA 2ISCA 1RWNA 4B4DA 4KV9A 2FEKA 1N7IA 4WV3A 3GWGA 4Z7QB 4DUZB 2XRFA 1U98A 5C4GB 4YLGA 3LV8A 3L3UA 3WIEA 1PL0A 2DPYA 2H9IA 4PRYA 3SIRA 4ZVKA 3SNNA 4Q3EA 2QE7A 3PGLA 1ZIDA 5F76A 1UJ4A 3B1KA 1MG0A 1FP7A 3F9CA 4Y2TA 4B6FA 4LRSB 1P33A 3OYBA 3MN1A 2ZUCA 3UAGA 5TE9A 1GPDG 3CISA 1ZYUA 3U7HB 1J39A 2GN2A 4NENB 2H1IA 5JNLA 4UHDA 3N8GA 3NVDA 4YA6A 2C97A 3MTDA 2FPRA 2QAGA 1JUDA 1W6RA 3G9UA 2P9YA 3C48A 1NGDA 2QDKA 4FFBB 1CJUC 4NXMB 1QZ3A 3M5PA 2HPAA 4N9WA 4FT4A 2O1WA 5AM0A 3IUNA 3MTJA 2WWYA 3WNVA 2PSHA 3IEXA 2G4CA 3FCUB 4R9VA 2HCBA 4P4LA 2PX3A 4GXNA 3W2TA 2OANA 4B9TA 3L0ZA 4AY2A 1RU3A 4P92A 1Z06A 3N8DA 3WOVA 4L9AA 1CRLA 1COWA 4V24A 1MOPA 1ZN9A 1OVMA 1ODSA 2VAPA 2DFFA 3QBEA 5D87A 1GTSA 3SQDA 1NK0A 4R5HA 2VQFB 2QI9C 3CXRA 4BB5A 1B00A 5I7WA 4YROA 1T5LA 5CR9A 3OPNA 4IQ0A 1Q3HA 4S24A 3SJUA 4NATA 5EVCA 1UFVA 1NKVA 3CUKA 2HWXA 5AFUH 1QFMA 1T3TA 3LRXA 4GQAA 4F38A 1TU4A 4WFBL 1K8AO 1O3YA 4YRKA 1Y6RA 4CL0A 3D7LA 2C5GA 4LC1A 3TLEA 3C5CA 2ZR7A 3HN6A 4O4GA 1GA1A 3DE4X 3KUDA 3UKRB 4DW8A 2R4UA 4CZIA 3OY7A 5L4LA 1ULAA 2IYOA 3IQZA 2Y92A 4PZDA 4CUJA 5ISMA 1YL7A 3BUZB 5KTMA 5DT9A 4CHPA 2ATXA 4BDPA 3WZLA 2HD4A 4DJTA 2DBZA 3WBKA 1QWOA 1H3EA 3LOPA 3SR3A 3OQHA 1SUIA 1E2EA 3TAUA 4YJFA 1S0UA 1GTL1 1IAQA 3O4VA 2AMYA 3KD5E 3FMVA 2ZFUA 1GOCA 1WQ1R 2CYBA 1G5HA 3KVRA 1O9HA 1D2HA 3IHWA 2O0JA 2K87A 3DFMA 3IAM6 3VI4B 3GJ3A 1XIVA 3VHXB 2OLEA 2BM0A 7ABPA 1WMBA 1N8RO 3MUOA 1BAPA 4D4KA 1JVBA 3ROQA 1O6FA 3AWDA 1X3MA 1ETHA 5HHTA 2Z6QA 2AN3A 2APJA 1LA2A 3B8AX 3M1LA 3WXMB 4JI5B 4L5YA 621PA 1UZLA 4QOZB 4MDYA 4DR7K 3U39A 4DJAA 1KQPA 2D5AA 3OHMA 3O8OA 3DTVD 4QICA 5A4JA 2QTVB 3NW9A 1I13A 3CLUC 1RS0A 1GQFA 1L7MA 3Q6IA 5A4KA 7REQA 1PUIA 5IU6A 1Q1EA 1GGEA 5DLEA 5IC6A 4YP1A 5IYZF 4E6EA 2IYUA 3UMBA 3LIPA 2BTOA 3TU5A 3NJRA 4BX8A 4TLLB 5F2OA 1SCDA 4RHYA 1Q83A 3VOSA 4JJEA 5JS7A 1P80A 1JHPA 1VJRA 1Z33A 5KNBA 5C52B 5C32A 1UODA 4TRRA 4NBWA 3ATVA 1F17A 4R1LA 1ZIPA 3MEQA 2GEMA 9GPBA 2OPRA 5HS4A 4HWSA 1ZD4A 3W34A 1YSCA 4L2IB 4LOKA 2NO7A 4C20A 3G9QA 1GKKA 5EZYA 1SCJA 1T5IA 3OESA 3VPSA 3A1EA 4ABTA 2DU8A 3T38A 4GNRA 2PZ8A 3MXJA 2MSLA 4LXTA 5I8WA 4FR2A 2WIBA 4MXDA 5DM1A 3ZHZA 1LCIA 1DO8A 3AR4A 2J1LA 2WF9A 3QE2A 1C81A 2K5UA 4BO6A 1RW4A 3I8BA 4Z9YA 4JSTA 3MBKA 2GWHA 3KWFA 1G3UA 3BM5A 4YY3B 2P6OA 5AM4A 1L5KA 1CQJB 5JSZB 4L72A 3NBUA 3LWDA 3CW2A 3OTHA 3O2NA 5LP6F 1TZCA 2FSIA 4CMJA 3ZHXA 3AVLA 4XIUA 4FN5A 2I7NA 3J81k 1NN3A 3T5DA 3HVRA 3CEJA 2SHKA 3KLOA 5G0UA 4QHYA 1DO2A 1ZZEA 4R84A 4RIIA 3FZKA 1DC6A 2XUDA 2HMAA 4IH9A 2C9OA 2ZUDA 1WW2A 4YAOA 1KZ9A 4KLZA 4F6LA 1AUXA 4AY6A 1OVQA 5DNEA 4M1KA 5DCYA 1O08A 4OTZA 2OZKA 3BTUA 3E9MA 3QXSA 2C5EA 4FD3A 4M9XA 4WESB 2P9GA 1FX0A 1PK8A 4LHXA 4EZBA 1DCFA 2WPDD 3MQ2A 4ED9A 1H23A 1OR8A 1ZK3A 1E77A 4RG8A 1RZUA 3BXPA 3AHIA 4A26A 4FWSA 1HDRA 3TSZA 3VYWA 4TPKA 4DF8A 4BC2A 2X77A 2BMJA 3GLKA 4Q47A 4BFWA 2KI5A 2ZYTX 1W5FA 1EAMA 2AZMA 5T4HA 3WA7A 1ZBSA 1C0GA 4MV6A 2HEIA 4YLEA 2VDUE 1SUSA 4ZT2A 4GR5A 1VYTA 3QYFA 1AQNA 4L3OA 4J0EA 1LX6A 1EKXA 4E12A 2MCFA 4NU5A 2F1IA 2OCBA 2X74A 4R8VA 1UQRA 4L95C 5B53A 3BIJA 5MN4A 4XFJA 3RK1A 3RSQA 1H4SA 4NY1A 3ITEA 4TLBA 2QAGB 3CCJN 1YMQA 2Z6VA 4YXWA 2F3RA 2PJUA 1O6CA 3QLVC 2GPYA 2PR2A 2ECOA 1J9ZA 3DFFA 4MRNA 5E3IA 5K0JA 3EIEA 4JVSB 1PQ4A 1EWYA 1RBRA 2X41A 4KQEA 3KQNA 3R44A 2O05A 2I4IA 3ULEA 1I4LD 1FW6A 4NJOA 1QRDA 3DR5A 2ZWPA 4DDWA 3FPLA 1GARA 3H84A 4HGYA 2NM0A 2FWRA 4OXXA 4UZFA 3NFAA 4BJ6A 1A69A 1GITA 1W36C 3PGA1 4RK4A 4MV3A 3JQBC 1JIXA 2DM6A 2YV3A 4EG3A 4FPBA 3ETDA 1VPVA 3AR6A 3EQ8A 1C30A 3EH2A 3HNOA 4WNAA 4MHTA 2P5YA 1XHFA 2I62A 1U7PA 4LE0A 3ZCMA 3CR3C 2BFBA 1QHFA 1A76A 3NC1C 1NXWA 3S2UA 2BR4A 2Z1DA 2BKAA 5D3KA 4DYVA 2QLBA 4NBRA 1WXIA 2BONA 4BQIA 1A8QA 3TOCA 4RW6A 4F3TA 1N3BA 2EF0A 2PZFA 2HSEA 4S3MA 4Z4EA 1LSUA 3JCZA 3S68A 4JYAB 1E9RA 5MN6A 4Z7OB 1OC2A 1BHLA 4BQSA 1A9YA 4E7IA 3NBXX 5FJJA 2VZ8A 1RR6A 3A1UA 4BNTA 4CEFA 3OFJA 3CMAN 1VA5A 1Q0SA 2G0AA 2QUAA 5DRTA 4IXWA 4N7JA 3OI7A 4FLZA 4BN0A 3VPCA 3R76A 1OTYA 2J45A 4DC9A 3VQEA 2ZU6A 4TMXA 2GT1A 3KLHA 2HI0A 5E2AA 4M3ZA 4IJ5A 4EW1A 1E2PA 4DFMA 2QRUA 1N1DA 1KR5A 2G06A 4RGYA 2Y6VA 1SK8A 3V1NA 3HPOA 4JI4K 3U2QA 4O8UA 1WBJB 1Y1QA 1NKEA 3LCRA 4PLTA 1FP1D 1OXMA 4G1UC 4H0TB 3UMSA 4DSUA 3RUPA 3AO4A 2YYYA 4DUYB 4JI1K 1P4HA 1QR2A 2F59A 2VNJA 4DV2B 3EHDA 1WV1A 3O8OB 2RKIA 3HXPA 3EZXA 4PZ0A 4EX6A 1E69A 2HOQA 3BBLA 1EU1A 1MOZA 2JEYA 2EGGA 4JK7A 2PS9A 3EIQA 3LJKA 1P77A 3BY5A 4D26A 1JA9A 3PGMA 3KHKA 1VL0A 3RFTA 4ER7A 1KAZA 2WKSA 4MWBA 6GPBA 5K0NA 4MRAA 1DKGD 1D1QA 2WQZA 3ICPA 1RQPA 3QIAA 1SVSA 1VB5A 3F4LA 1USWA 5AIAA 3ORYA 1A04A 4RW8A 1SBQA 2F8MA 1BN6A 1KO7A 3FUUA 1YASA 3K2PA 2PLRA 5EHXA 3SQWA 1A1SA 4R01A 3WNCA 1SJ9A 4I4IA 3T3EA 3L0QA 2CXUA 3PFHA 4HUGA 3SKXA 1ZRNA 2JZNA 1JLKA 2VQSA 4ALIA 4GMGA 4WQ4C 1K06A 5EZYB 1KSHA 2Q5FA 4NH0A 4FWLA 1TMGE 5JHHB 2OBXA 2BUAA 2YNMD 2X13A 3QPCA 4X90A 1U6KA 1KHTA 1IJKA 1WUJS 3FJ1A 4U2CA 4N1AA 1CY1A 1GNQA 4XVUA 4L8VA 3ZY6A 4JRQA 2NTNA 1N5OX 3S3TA 4WKGA 1AOXA 1K7EB 1NBMD 2UYQA 1SG0A 3LKBA 4DTNA 4JS4A 3P9QA 2SECE 3KU1A 4RTJA 3D59A 3K9WA 1F3OA 4YUAA 1ODFA 3FYUA 3FKJA 1ST3A 4PNPA 1U7HA 1QVAA 4IOXA 2OEPA 5DGTA 1M1YB 1NU0A 1TQ8A 3OP1A 2H9AA 4KITB 3ZHSA 5C12A 3QEIA 1XDBA 2GEJA 4M9UA 5M7EA 4ZVSA 3B2EA 3OF5A 3ZS8A 2NLOA 1EA7A 5L3QA 3BJIC 3B12A 5ENZA 4KTTE 2GHTA 1G41A 2BCGY 4OQPA 2Z57A 3G6EN 2DH5A 3OIFA 1FX0B 4JB8A 4KYTA 4G07A 2OY0A 4ZI2A 1CS4C 3QEPA 2DQZA 4ROSA 5BR8K 1MEEA 5KU1A 4O4JA 4GT1A 5JVDA 5E1DA 4DV3B 2WDZA 1Y37A 2Z3WA 2G8LA 4JENA 4E7PA 2WVAA 3BQNB 1EFPB 2ACEA 3ZCUA 3R7WA 5AI0A 4RTQA 1U28C 2QMYA 3W4IA 4UATA 2RHTA 2HHTA 1NNSA 2RJOA 3PFCA 2HHQA 1R8SA 5IZCC 4IJWA 1H3FA 3VO8A 2OB1A 4OHCA 4KDCA 4RORA 3LW8A 4C5CA 3TR5A 4TKLA 3I1IA 2MYNA 2FW1A 1NFRA 2XJ9A 4UUBA 1BROA 2YHBA 3REQA 1HUXA 5IPFA 4UUMA 2ENWA 4D0NA 3MT0A 5IJAA 4ZA2A 2HA4A 1ZVJA 4QM6A 1F0PA 3DFKA 2FZGA 1V5IA 4KX3A 3UMVA 3KZVA 3B5JA 3UAVA 2B1RA 3LPTA 1RYFA 2XH8A 1HLGA 1T26A 2I1WA 1PUJA 4DCUA 3DBRA 3N86A 3RYHB 1OHHD 2GN4A 4S1OA 3EVEA 5GPBA 4E0DA 2M6RA 1VSJA 4CJWA 2AFRA 2ZI3A 3I9NA 3DO8A 3P52A 1C30B 1KS2A 1P6XA 4CQLA 1DC5A 4E5MA 2BGTA 3R3YA 1Y3FE 1QGOA 1ZKMA 4JI3K 2AFVA 3L8ZA 1YDWA 1SPXA 1YRWA 4H1WA 4IEEA 1ZK2A 5TMEA 4BR9A 2XQKA 3LWZA 3ONEA 2WWFA 3CH7A 5AHRA 1XXHE