4IFEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
448
structure length
434
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 145
structure length 434
sequence length 448
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ifeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifeA01
3IUYA 1J99A 3GLIB 3A1WA 4DBLC 3R9IA 4TTPA 5G3YA 4QNRA 5C2FA 1TUIA 2EQBA 1GITA 1MO3A 1ZVQA 1KJWA 2ECKA 1NSFA 1RZ3A 1G1MA 1Z0JA 5C10A 4WW0A 3EIQA 4GMXA 4RKEA 4UJ3A 1BIFA 2V3CC 2ODBA 2XNSA 3PCRB 2H1LA 4LPKA 3KKOA 3LRPA 4DUGA 1K8RA 1SHZA 3B1ZA 1AK2A 1Z3IX 3D7MA 3K09A 2V6JA 1VDZA 3B5JA 3CW2A 2CK3D 3FKQA 3LW7A 1VMAA 1EFUA 4N0EA 5EXTA 1VYUA 1F60A 2VHUA 4M1YA 3WHLA 5K8IA 1AZSC 4KO8A 1KMHB 4BLOA 3FHTA 1G3RA 4Q02A 1F5NA 1ZJ6A 3TW4A 1FTSA 3ZZUA 2QL6A 4HZIA 4K8OA 2ZRAA 4CEHB 1MABA 4GOXA 2ZITA 1M2OB 4LI0A 3AVVA 2B6HA 3AVTA 4JJZA 3ICQB 1PZNA 4G01B 2GJKA 2ZAOA 4RZ3A 3MWJA 4XSGA 1XCGB 4DIEA 3FMPB 5M1QA 1G4AE 5DI9A 3PIRA 4DC9A 3VNUA 2ZRKA 4LOAA 2F55A 1FP7A 1T8TA 3GFTA 4FCWA 2ODEA 1Z29A 4D4MA 4WA7A 2DWOA 3TQCA 3BK7A 4M0LA 1NJFA 4KV9A 1X8JA 3AH8A 4L9WA 4MGZR 1H65A 3PUXA 3QE0A 2GEVA 2ZSDA 2FMXA 4LX0A 2PZEA 1GP2A 1QF9A 2ZANA 4JLPA 4DSTA 1SKQA 1FW6A 4OHZA 1HE1C 2FPKA 1Z06A 4Q9IA 4FMDB 5FBVB 3OIWA 4BEBA 1N5IA 5FPYA 6Q21A 3TAHA 1RRFA 2CE2X 4JZKA 1IM2A 4KHZA 5JHGB 3NEYA 4ACAA 4F4CA 1XDBA 4JSYA 4BFWA 4NYMQ 3REFA 2ZRHA 2REOA 3WXMA 1IJFA 4TT3D 5JFGA 1N6KA 1J90A 4XTCS 3JZAA 2RGDA 1SVKA 2XOKA 4GNKA 4C0LA 1I2MA 2QQEA 3L2OB 5FL7D 721PA 4AI6A 1C9KA 2B92A 2VO1A 1FFHA 1DEKA 1R5NA 2FGKA 3DOEA 4DWJA 1DS6A 5JS8A 1P75A 2V1UA 4DCNA 4LCBA 1T91A 2N1BA 4B75A 5JSZB 4ESVA 3QPUA 2P2LA 3WRXC 2ZI4A 2X19A 3ZGXA 2CNWD 1DAGA 2WPDD 2RGNC 2YV5A 4HB3A 3RRZA 2EYUA 2F7SA 1G6OA 4IEIA 5JBQA 2IX3A 3TSWA 1S9DA 2IYVA 4Q18A 1ZNZA 5F3WB 3U5ZB 2F9LA 5H1YA 2W6JA 3I32A 2PH1A 1OKKD 3ASZA 3SJBA 3AGQA 1GOTA 4V03A 2JAQA 1Z83A 2EFHB 2F1HA 4HATA 5IK2D 2OSBA 4OL0A 5DNYB 1Z28A 2QE7A 2SHKA 1ANKA 2H5EA 4HLDA 3O47A 1BMFD 2A3RA 4Q66C 1JAHA 4E5UA 2FE4A 2MSCB 2OLJA 5D3MA 2IWHA 1TU3A 4H1UA 3G82C 1JECA 5F2EA 3C4JA 1FMJA 1A7JA 1KYIA 3AF2A 3AVOA 2WJYA 3PEVA 4MKHA 4CYMA 4DHEA 5JEEA 3X1DA 4PHHA 3PQCA 4KLZA 4D81A 1TQDA 4A8JB 3RC3A 5J4VA 2OXCA 1OXTA 1TF5A 5M1NA 1CIPA 2QA5A 2HT6A 4KVAA 1K5GA 3M0EA 2DFNA 1P62B 5BN4A 1UFQA 2ERYA 2ZJ8A 4RD4A 1ZNWA 2ODNA 3SNHA 5FH9A 3UPUA 1W36B 4PHFA 3W6NA 2Q3MA 3GJXC 4FMCB 121PA 4PFSA 5BQ5A 1TEVA 2XB2A 3U61B 3AVWA 2NO9A 1CJMA 4XH9B 1U8ZA 1E69A 4NHOA 5A0FA 1QG2A 1W5SA 5JJLA 3CZPA 4Q9LA 4QRHA 4PQYA 1AJEA 3A1SA 3VQTA 4NH0A 5HTKA 2FPLA 5E7IA 3DHWC 4WXRA 1ZC4A 2XEXA 4GPTA 4DDTA 4Q5IA 4TSFA 3C16C 3GD7A 3TW8B 1E96A 4R9UC 4M9ZA 4F4IA 5TVKA 5B2ZA 1EFRD 2W2XA 3EIHA 4D4LA 4Q7JB 1KK3A 2J7PD 3KQUA 1W4BA 1DAFA 3LXXA 2ONJA 3X1XA 2VF7A 2XX3A 4G5GA 4IKEA 2DFLA 4CGZA 1F3OA 4RZXA 5FUVA 4W9MC 1G3MA 1F6BA 1AN0A 2WJJA 2Z5FA 3FYHA 3AF3A 1GFIA 2R65A 2R8RA 4DT1A 2DFTA 4ASUD 5EQTA 1OXVA 5CB8A 1P2SA 5JCZA 1CLUA 2CLCX 5AWFC 1G5TA 1LNZA 1V5WA 1J2JA 1QBKC 2WAYA 1Q57A 1II8B 2WMOB 5H68A 3BD9A 1NKSA 1ZM9A 3NVAA 3VX4A 5FUWA 3NBFA 1M1YE 1G7SA 4OQXA 4XD7A 1JR3E 4M4SA 2UKDA 4NE2A 3H2YA 1D2NA 3P4XA 4C0AC 2IYYA 2VHCA 1HURA 1II9A 4MYCA 5TB5A 1PLJA 3RRNA 1S3GA 3N2IA 2GJSA 1KAOA 3BRWD 2NGRA 5IHPA 2F3TA 4C4PA 1D6JA 4NYJQ 1E4YA 2XXAB 4C7OA 1S96A 4Z1MD 1KO4A 1ZU4A 4AD8A 3AVQA 3AM1A 4II7A 1G6HA 2O8DB 4NCNA 2ZJ5A 2IF0A 2IYTA 2R6GA 4MRNA 2GZAA 4LJ7A 1Q21A 3A6PC 1HEIA 2VQSA 5EP4A 2VH5R 4ILEA 5L3RA 1Z0AA 1D9ZA 1I4LD 4IFEA 2DWPA 3WMEA 1XPUA 1IOZA 4LHWA 1E2KA 2HJGA 1E6CA 1SGWA 3K9GA 3PUYA 3SI7A 3SEAA 4ACBA 4JS0A 1DE0A 3Q85A 4OHWA 4JVNA 4P4SA 4B2LA 2ZSEA 2C95A 4FD2A 3A8TA 1CR4A 5KDOA 5JEDA 3QXJA 2QU8A 4QBIA 1D2MA 5E7JA 1NN0A 2RKOA 2R6FA 4B48A 2WWWA 1KTVA 1P7CA 5EE0A 3W3AA 2HYDA 5SZHB 1GRRA 3SFZA 1RPZA 2Q0HA 1G8YA 2ATXA 2ZE6A 4BZPA 1OB5A 1E0AA 5K8LA 3WHKA 1AQUA 3MWLA 3M1IA 4URUR 2REXB 4LJ4A 3RS5A 4NONA 3CBQA 3NKVA 3I61A 1Z6AA 1WBBA 1N5LA 2YZ2A 4RD2A 1TPZA 5CYPA 2QN6A 1U94A 5KSOA 4DEYA 3VKHA 2J0UA 1XD2B 4AKHA 3CPEA 1XJCA 5IDVA 1G8PA 3S1AB 2F1RA 2YWGA 4UNRA 2ZROA 4Z8XA 1E1QD 4XIGS 3UWOA 3VFDA 2LKCA 3A4MA 1R5OA 3IBYA 3G5UA 2ZREA 3GLHB 1Q3TA 4GRAA 3K8YA 2QAGC 1F2UB 2AFHE 1QHHB 2HLDD 2XSZD 4DEXA 2H8KA 2QGZA 2R9VA 3PVSA 1XD9A 2AKYA 3VMFA 2A30A 1XCMA 3FMFA 2JJ2D 4OQNA 4NKRA 5E4FA 2O8CA 1NG1A 3U7FB 2NO6A 1BYIA 4B44A 1KNXA 2FX3A 5L3VA 1YZKA 5FBWB 4Q00A 4BFZA 2QTVB 1ZD1A 4RY2A 1PJRA 4PHTA 2BM1A 1MRSA 2YWFA 3IKJA 2VSOA 1II0A 1FX0B 3CO5A 2WJVA 3SN6A 3Q7PA 4TL8A 4UNPA 4ABYA 1P3JA 5DN6A 2ZSAA 1KOFA 4KJZA 4TZ6A 3EA5A 1QHNA 3QXXA 2PLRA 3WNBA 4AKIA 1GILA 1GL9B 1E79D 1VHTA 4DDUA 3W90A 1Q1BA 3KUCA 4DLRA 2OM2A 4RZUA 4DLWA 1SXJC 3T1VA 2DFKB 2UZIR 1RYHA 4QGFA 2AX4A 2E87A 2G83A 3KKQA 4TTQA 4HB4A 3WP1B 1RRGA 1UM8A 3P1JA 4FMDF 2ZRMA 1I4TD 1GG2A 1XB2A 2CCGA 4M1SA 4NZYA 4Q21A 2YKGA 2P6UA 2VYFA 4R71A 1DO2A 2ZYTX 3TBKA 3L8YA 3AQ4A 4N1AA 4MA4A 4ZO4A 2GHIA 5FPSA 1CJVC 4JVSB 5HZKA 3K0CA 4QGHA 2CK3A 4ZDIA 1HE8B 2AXNA 4AY2A 2Z0MA 1JAIA 4XOIA 3AEZA 1GRQA 3D6TB 3CF2A 5BN5A 1HQYE 3TKLA 3SJAA 1NVVR 1XEWY 4LUCA 4B2PA 1T0JB 4MRVA 1JB1A 2X8AA 4XVRA 1KSJA 2R2AA 3GJ4A 2QORA 3K9NA 4L4UA 4B35A 1N6HA 5AUOB 2GAAA 3AVXA 2IBMA 1XMSA 2C99A 5AJXA 3KTAA 3Q72A 3KQLA 2R6CA 1NL3A 4H1VA 1GKIA 1E0KA 1MABB 1H8ED 1EWQA 3ZVMA 1RRCA 4LJYA 5BWMA 2CHGA 3QSYA 5TMPA 3MMPA 2GDJA 1NRJB 4PXAA 1U0HC 1X3SA 2W0SA 3SYKA 3IQXA 4IW3B 2QT0A 4TWZA 4A0FA 5F9HA 2EFDB 5C2DA 2FV8A 5G3ZA 5DI3B 1FP6A 2C78A 3TUIC 2JLSA 4HAZA 4IOJA 4KLNA 1XU4A 4Q1DA 1NY5A 4FXPA 4DSUA 1S3SA 1KZ7B 2CLSA 1P2TA 2GTPA 3EASA 2B8WA 1Z63A 3R9XA 1A82A 3QQ5A 2C9YA 1ZW6A 4PC3A 2D2EA 3CF0A 3NIBA 4KFUA 3I4LA 3NC0C 1DADA 3BIFA 5FTJA 421PA 3K0AB 5M1OA 1YQTA 2BDTA 4OHXA 4TT3A 2IYXA 3CPHA 3QKTA 3U4QB 2CDNA 1A2KC 1ZMXA 2A5GA 3B2EA 4XJXA 2ZUDA 3IPYA 2G0NA 1W4AA 2NO7A 5FL7A 2KWIA 2ANBA 4WOPA 3TIFA 4YXWD 1MV5A 4QL3A 2WSMA 3I8XA 1E9AA 4DCUA 4FIDA 3BXZA 2VP5A 2BHRA 3L0SA 3TMKA 2XZLA 4Q7MB 4RFSB 2IYUA 4HZUB 3SOPA 3PEUA 2OZEA 1HT1E 3H84A 4FMCF 4JBXA 1E2FA 2ZUBA 5FFMA 1W0JD 2IHYA 2CNWA 2WPDA 3RC8A 2C77A 1QHXA 2HJVA 2EFCB 4NDZA 5C46F 3EG5A 3RYTC 1P73A 4D4JA 5SZJA 4OI1A 2A9KA 1M7GA 2FF7A 2RHMA 5GJVC 4DLYA 5ELXA 3IPXA 3NXSA 1JNYA 1OKKA 1T5IA 1U8YA 3RS4A 1W48A 1E2EA 1OV4A 3IIJA 2XGJA 5AK0A 5IK2A 2ZRNA 3OESA 3X1ZA 4C0HA 2OHFA 1DAIA 2VRWA 3TSZA 3GFPA 1W0KD 3LA6A 3GP8A 4V0KA 1BMFA 3CNOA 1OT3A 5DHFA 1RVDA 4Q4HA 2AN9A 4EFNA 3T34A 1ONBA 3CR8A 2ZI9A 5AUQA 3SQWA 2GJAA 1SZPA 4YQFA 4CIDA 4XWKA 2EVWX 1UEJA 3Q7QA 4CEJB 4D4KA 2I3BA 4P3YA 2A7QA 1RYFA 2BMDA 1ESMA 2DBYA 5IT5A 4IVPA 4GZLA 1NF3A 2IHBA 2QMEA 2D3WA 2GXUA 3KKPA 4HUQA 2D62A 1MKYA 3RVBA 1Z0DA 3CWQA 4IDPA 4L8GA 3AUXA 4PO9A 3SQXA 2IL1A 2VL7A 4ZDKA 3KXKA 2JGNA 1D5CA 3DZDA 2ZE8A 1W1WA 3NC1C 4RJLA 4C2TA 3AF1A 4RD0A 2ZRIA 3RS2A 1J8YF 2ORIA 2IXEA 3UMRA 2W2TA 4OHVA 2GRJA 2NZJA 1WF3A 4XTRA 5JJKA 3TNFA 4PAQA 3ASYA 4Z8YA 3LQQA 1CR2A 1KNQA 4JKYA 2AR7A 3GEHA 3QJYA 4A1FA 1ZCBA 1E3MA 1G18A 2OBLA 4OI4A 2NPFA 3CNNA 4LHVA 2JLZA 3LBIA 4ZIRB 1G8GA 4UNNA 4NMMA 4F4JA 4PANA 1QHSA 3GPLA 4YLGA 3DEFA 1EFRA 4P0TA 2WJIA 1GVNB 5EXPA 4HUTA 2V9PA 2VA8A 2J7PA 1SVIA 3SE0A 3EWAA 1KI8A 1WRBA 4MKIA 5FUXA 1ZUHA 2OG2A 2A2ZA 5A5GA 1RC8A 5C4GB 3EZ2A 1R4AA 4I99A 3GJ8A 4LY6A 1XTJA 3LFUA 5L3SB 5EP1A 4AYWA 3RRMA 1CU1A 4LV5B 3THXA 2QMHA 1TX4B 2FSFA 3RWMB 2IUSA 2FFBA 3OAAD 4AKEA 1XEXA 2ZXUA 4HB0A 4M1KA 4F7WA 2W83A 2OE2A 2JLUA 2PT5A 4ASUA 3AGPA 4QGAA 3ZQJA 3RANA 3TR0A 4TMKA 2MSEB 2DY1A 4WZ6A 1HYQA 1KDPA 4F91B 1KDTA 3PUWA 1KK1A 4A0GA 1SVLA 2DPXA 1FL9A 4JLBA 2RH5A 4ZDWA 1CR0A 1MH1A 1US8A 221PA 2H18A 4QM7A 2IT1A 1GKYA 1ZM4A 1YR8A 4NP6A 4LC0A 3BC1A 1YJ5A 3R8FA 1QDEA 3KFXA 4P31A 2IYLD 1QZXA 4C30A 4FN5A 5CK5A 2FFHA 1M7BA 3IO5A 1G7TA 2WKRA 4I1SA 4LBWA 1VCIA 2ORWA 2W0MA 1LF0A 4KXFB 2A5YB 4HDOB 4PZLA 3E2IA 4U7DA 5KSPA 4MRPA 2XTZA 3T35A 2H57A 3MD0A 2ZI5A 4O0MA 1UDXA 3SBEA 1U90A 2REBA 3THWA 3QY0A 4Z1MA 1W2HA 1IONA 2J41A 4O25A 5CITA 3K0EA 1EX7A 3E1SA 1DAKA 1G3QA 1R7RA 4I4LA 1I4DD 2JIZD 3A58B 1VIAA 2J7KA 3UMSA 2O8FB 3HU2A 4YMSA 4CEIB 5FTLA 5KPDA 2GVZC 2GETA 2PEYA 3H86A 3DVLA 2AXPA 4TLAA 1NMYA 5CJPA 4C7OB 5G41A 3CRMA 4FI3C 4HAXA 1NMXA 4A0RA 5KYKA 1Q1ZA 1BOFA 2X2EA 1W2GA 4JLAA 4EFMA 3CZQA 1P6XA 3ZS9A 1EFTA 2CJWB 4R98A 4DCVA 3BB1A 3KXLA 4AURA 4B6EA 1KKMA 2C5LA 3QF4B 4MUBA 4I1VA 2KE5A 1SHKA 2VHTA 3CRQA 2WICA 3QPVA 5FOTA 2J9RA 4Q1BA 1VG0B 3T1OA 1RIFA 3WYAA 1NN3A 2OFOA 2FZ4A 2OCAA 4M21A 1VECA 1YKSA 1LFDB 1OFHA 3TSOA 1SVMA 4M9QA 1N3BA 1NIPA 3OF5A 4HYYA 5FI1B 4WXPA 4RCZA 3I3SR 1UADA 2VTKA 4WZAE 2PMKA 4Q4AB 4UQOA 4P4TA 5KNDA 3JVUA 2YNMA 3MJHA 3R7WA 1Y63A 2O8BB 4ZV4A 3RHFA 4CT4B 1P72A 4EJSA 4ITRC 3K9LA 1XX6A 2BKUA 2BBTA 1W47A 3QPWA 4N0DA 4B73A 1E1QA 1JQJC 2QM7A 5JZVA 3C5CA 1LB1B 5GJBA 4TQAA 2I1VB 4HLUC 5CIWA 5BYJA 2DR3A 3KQHA 3MLEA 2JLYA 3WRYC 2XSZA 2HLDA 3Q5DA 4NU0A 3TJZA 4AG6A 1XWIA 4LV8B 4E22A 4Y0VA 1UDWA 2JJ2A 1AKYA 4P32A 1JEEA 1AKEA 3W6OA 4NYIQ 3JVVA 5JRZA 4ZKDA 2BBOA 4Q1CA 5FOWA 1IQPA 4B32A 1E2PA 5B30A 5KTYA 3IBGA 5EUQB 4RZ2A 5EZ5A 3VKWA 3KB2A 1YE8A 5LPNA 2LCFA 1R8SA 4TZ0A 1YRBA 4JLNA 2P67A 1Z6GA 2O8CB 1BS1A 1XXHA 1N2CE 3T15A 2BM0A 3UG6A 1U9IA 4PSAA 3F5FA 5J47A 3SHWA 1Z0FA 1P5ZB 1XTQA 2JJ8A 2H16A 1TEXA 2HCBA 2AFIE 1E0JA 2ZVQX 2GF0A 3DKVA 3B78A 1IN4A 1KDRA 1J70A 3QKSA 4B3BA 3ZZ0A 1E79A 4B3DA 2RB4A 2CVHA 3KFVA 4CT5A 3TRFA 1G20E 2NO0A 1KKLA 1MR3F 1KK2A 2WWFA 3WBJA 2BEJA 3T1QA 3L0OA 2QSYA 3VU9B 4BLTA 1DVRA 5JHHB 2JATA 3QKRA 2ZRBA 1XMJA 2CBZA 1E98A 1XEWX 2GJ9A 2OBMA 2UVQA 3C7KA 4LGMA 2DYKA 4RFVA 4BZQA 3B9QA 2BBWA 4LSGA 2P5SA 2Z4SA 2B8TA 5EZ6B 5FUYA 4MUAA 1IXZA 1WMSA 3GJ0A 4QC2A 1KSHA 3GCGA 1GZSA 1E9FA 2I4IA 3FMOB 1JBKA 3EZ9A 2Z43A 5DSZA 4UNSA 3CIOA 2WV9A 2GA8A 3BFXA 2PJZA 3HYRA 1R5BA 3IHWA 4URZR 3LWNA 2YWEA 5CDFA 1ZAKA 2CEAA 2BCJQ 5HPYB 5KHOC 1XZQA 4Q7LA 3DM9B 4CZ2A 4PC6A 2IS6A 1T3SA 4NCJA 1OIWA 4RVCA 3QOFA 1S8FA 2W00A 3GJ3A 4CVNA 3QENA 4TL7A 1HA3A 2QRZA 4LHYA 5KNCA 4IOKA 3DZ8A 2RGGA 1R0WA 1H8EA 1JPNA 3H0KA 3K53A 2QGNA 1QRAA 4DLZA 5JWOA 5E95A 5LD2B 3HU1A 2J45A 4IEEA 4JLMA 2XTMA 2XZOA 4ZPXA 2ONKA 4P33A 2A5JA 4PTLA 1RJ9B 4BECA 2BV3A 4GL2A 3CWZA 4MGYR 2VP0A 1SXJD 3U7EB 3B85A 1E2NA 3KKMA 1VCNA 3KJGA 3VX3A 1SQ5A 4Q01A 2WIAA 4A82A 1KSFX 4DCTA 3P4YA 4KFTA 3P32A 2J0VA 4GBMA 1ZD8A 3ZDQA 2CL0X 5UKDA 3T06B 3IEVA 2IS4A 1N0WA 3I62A 3REGA 5J4LA 1E94E 4I1OA 2CLDX 2O0KA 2Q6TA 4A8JC 1FOEB 4QOSA 2BCGY 5H8WA 3FMIA 2NTYC 4BZXA 1K5DA 4W5HA 2Q9BA 4A15A 1YR7A 1W36C 2WJGA 4YXWA 5J4YA 4BLQA 3BERA 1PV4A 5SZIA 2ZSFA 2MSDB 2FDCA 1KI7A 2C8VA 4Q4JA 4ARZA 4DDWA 3SS8A 4LK2A 3KKNA 2GCOB 2C98A 3QVVA 2O52A 1M34E 2IK8A 2V1XA 2AD5A 3H4MA 1DG1G 2BMJA 5LB4A 5LD2C 2D74A 5JI3E 1W0JA 5KSYA 1KO7A 4NYMR 1U99A 3OIUA 1M8PA 5EXXA 1NLFA 2L0XA 5C2JB 1GWNA 4M53A 3GLFA 1ZP6A 1ZIOA 3AKDA 3TR5A 4W5WA 2ZE5A 4G5RA 1NVXQ 2BKEA 3GLGA 4QXAA 2PLFA 2ZJ2A 1YZTA 1RFLA 4NYIR 4TMWA 4URVR 2ZRJA 2KBEA 4A2WA 3SFVA 4B47A 1G21E 4W5JA 4KI0A 3ND8A 2F3RA 4JT4A 4A4DA 4Q1FA 1E99A 2Q9CA 3VR4A 2CHQA 4URYR 3QUSA 1IJEA 3UG7A 2Q3HA 1G9XA 3V4FA 3FTQA 4B76A 4DDVA 4Q9KA 3R8CA 1JPJA 3IO3A 1ZM3A 4EPXA 1WXQA 4XVUA 2NOAA 2B7BA 2IYRA 3AKEA 1W0KA 2N46A 4D26A 3FHCB 3SR0A 5F9FA 3CRRA 3G0HA 3HR7A 5FR2A 3ONWA 3K70B 4OQMA 1Z22A 1L7VC 1S0UA 2ORVA 5CYOA 5J4HA 2IA5A 2ZJYA 5D3QA 1VTKA 1ESNA 1ZUNB 2EFEB 1WBDA 1Z0IA 3I5YA 4LJ5A 1Q3HA 4MQBA 3O8RA 1GL7A 4Q4HB 4PSVA 4A92A 1G8FA 4EUNA 1TQ6A 4MDFA 2RAPA 4DSOA 1YHNA 2ZRDA 1AZTA 5KPJA 3DPUA 3QG1A 5FOXA 4TLDA 3TE6A 2EWWA 5GADl 4MGIR 2WWIA 3SYNA 5JLJA 4EQ6A 2ZUCA 8OHMA 4OQLA 4TLBA 1E9BA 4A6XA 4FINA 3THYB 3RSLA 2RCNA 4OI2A 1LV7A 4KU4A 3LVRE 3BORA 3ZJYA 1OH8A 3OIYA 2RGNA 4ZKEA 2GILA 2D4HA 4RD1A 4AWXA 2ZS7A 1JR6A 2ZYWX 1QG4A 3D8BA 4GP7A 1E2QA 1HY3A 3B8HA 4G0NA 1BKDR 4B33A 2QMOA 2RGAA 4PSKA 2BJWA 2FWRA 4Q47A 3K70C 1EGAA 4IRUB 5FPHA 1UBFA 3FDIA 5KSZA 2GBLC 2K5UA 1TNDA 4HAUA 4I1UA 1WCV1 2QI9C 3EPLA 2EFGA 1G3IA 4NCKA 5FBRB 3SYLA 4KBGA 3OAAA 1N0UA 2QTHA 3QIAA 4LBVA 4S35A 3U6BA 1ZCAA 4PO8A 1Z6XA 2QPOA 5DHAA 5SZKB 4HAWA 3W8NA 2WWYA 3THXB 3VR5A 3F0TA 4J0QA 1YU9A 4KSBA 4QBHA 2HF8A 4AYXA 5CM8B 2UZ3A 1CULC 1LY1A 1XEXB 5CB6A 2YOFA 2BOVA 2KBFA 3BFKA 2IW3A 3L43A 4JLVA 4PO1A 3KX2A 3SU8A 3A37A 3BGWA 1T3LA 4OK5A 1CBUA 2A78A 4JMPA 4L9SA 1AS3A 1N5KA 2WM9B 2YINC 4B43A 1X1RA 1DOAA 1OSNA 4F38A 2GKSA 3OFND 4JVLA 3B9PA 2KJQA 1UKEA 2PMDA 2HYIC 3PITA 1JJ7A 3K1JA 1NY6A 4IXMA 5AJWA 2QQ0A 5CLLA 4TYNA 3C5HA 4DLXA 5DIFA 3EPJA 4URWR 4LBYA 5CK4A 1QHGA 2G77B 4D0GA 4HB2A 1COWD 2FH5B 4B3CA 1GNPA 1HTWA 2QEQA 3QXHA 4MGKR 1X1SA 1EFHA 4POAA 2FU5C 4ZI2A 3GEIA 2JIZA 1XXHE 3A36A 3U7GA 3X1YA 3EIEA 4YMUA 1MO4A 3O8BA 4GOJA 1ZNYA 1L8QA 2QUZA 1OJLA 1IXSB 1SKYE 2AL7A 1OHHD 2XZPA 5J40A 4CRWB 1CS4C 2Q3FA 2Z4RA 2F43A 4GFDA 3LAWA 3KZ1E 3W5IA 2ZPTX 2F1JA 1QHYA 2QPAA 3CRW1 2WWGA 5JMTA 4DIDA 4NYJR 3L0IB 2RMKA 4AC9A 5FPTA 3T61A 1OXUA 2ZYUX 4M1OA 4A36A 3VAAA 1C4OA 2Y8EA 4WAUA 4NTZA 2V55B 3NG1A 3QXCA 2TMKA 2PL3A 1KI2A 1DG3A 1Z2AA 5CIQA 1DAMA 4QBGB 2D06A 4BWYA 3D31A 4EPTA 3NHBA 3U60B 1N0VC 2PEZA 5HE9A 3SZRA 2FSIA 5DE3A 2WSSD 4KCGA 1P4SA 3WYFA 3M6AA 4O2RA 3E70C 5J5CA 4LJ8A 4Q4LA 1QVRA 4RD3A 4LRWA 1FTNA 3LBNA 1TQ4A 4B34A 1KHTA 3DO6A 3HDTA 3WP0A 4EPRA 3M4YA 5CDFE 1E9DA 1VCMA 1NBMD 2AWOA 3AP2A 2IUUA 2OAP1 4JT2A 5G53C 1Q1EA 4C0JA 1AQYA 2ASEA 3HYTA 3U3RA 2BVNA 4QNMA 3C15C 5DLQC 4WVFA 3R7WB 2AK3A 2VPPA 5TDHA 1U0JA 2X2FA 2QBYA 1VCOA 4C0QC 4CF7A 1GNRA 3K09C 1FQJA 1ZINA 2AK2A 4P4UA 1X86B 3MUFA 3VHXA 3QVUA 5FTKA 3QI2A 3TLXA 1XTKA 4WBSA 3SJZA 5TXGA 1YZLA 5AJYA 1N6IA 3ICEA 2QP4A 3OEHD 4JLOA 5LB2A 1R0XA 4C3ZA 4EFLA 4BGDA 4M8NE 1H8HD 1II8A 1ZC3A 4OKSA 5FBQB 2WOOA 3WMFA 3U44A 4CDGA 5GJWC 4LHZA 1P9RA 3ZVNA 1Z6YA 2QZ4A 1XP8A 2VP2A 3BB4A 3MGCA 3AVPA 4EDHA 1GNQA 3AP1A 3PEWA 3CLVA 1DAEA 4L5BA 1E4VA 1XBTA 4W7SA 1GL6A 4DLVA 4A0HA 4B2IA 1CRPA 4JJKA 2ZSBA 1XJ0A 4TL6A 2OEPA 2WOJA 2IYZA 1SKYB 1Z07A 4QFMA 3U6KA 4MH0R 1JJVA 4RCYA 4B74A 1O87A 4BRUA 4F93B 1MRNA 2W2VA 3WY9A 1BYUA 3VR1A 2ZS9A 2ZJAA 5KO2A 1B23P 1SVOA 3U2QA 4DLTA 4DJTA 1OPXA 3CONA 4TYQA 4G5OA 1G17A 4KSCA 4TLCA 5KNBA 1E32A 2JLWA 3EZFA 4C0BA 1R8QA 3GLFE 3Q9LA 5TV2A 2QAGA 4IVRA 3GLGE 1VG8A 5KU1A 5ANRB 5AUPB 4JYCA 1AIPA 2GCNA 4N3NA 4X8OA 5D3MB 5C15A 4JIMA 1SULA 2J0QA 1E2IA 1N6NA 1GKUB 2NZ8A 3IDQA 2D7DA 4AKGA 2VP9A 2DHRA 3T12A 2BJVA 4QHYA 2PBRA 4XSHA 3N2EA 2XNDD 5H70A 2BC9A 2GK7A 2IYQA 2C96A 3HR8A 2DWQA 4GDFA 1VYTA 3ZS8A 1NI3A 3FWYA 4X8LA 4KVGA 2IXGA 3V00A 3JZMA 4M1MA 4A6PA 2XJ4A 2VSFA 3PR1A 3WYGA 2FEOA 2IF2A 3ETLA 1YRAA 1IN5A 4UXHA 2CE7A 3T5GA 3RSOA 2AD1A 1X8LA 3SDZA 4JLKA 4DZZA 3LO5A 1NNEA 4E09A 1W4CA 3TUJC 3S1AA 1KI6A 3ZLJA 1SXJA 621PA 1UAAA 1U98A 3KXIA 3BB3A 3GLHA 3BFVA 4Z54A 1T6NA 1NVUQ 2HUPA 3N70A 1F2UA 1QHHA 1G291 3MWYW 4PPNA 3FE2A 1DBSA 2A5FA 3NDPA 1T9HA 4A9AA 1K6MA 4US1R 3C6HA 2YWHA 4ZCIA 1A5TA 2AWNA 1S1CA 3F3YA 2FOLA 1P2UA 3LY5A 3O8DA 3UIEA 2PX3A 1JALA 4KYIB 1WP9A 1XPRA 1YZQA 3J81k 1U8AA 1QHIA 2GJ8A 4QBFA 4Q9HA 2GXQA 5JI2E 1NKTA 4DT1B 4MYUA 1R2QA 3VR3A 3X2SA 1FX0A 1DPFA 2BEKA 1KO5A 2KSQA 1IN8A 4AYTA 1LVGA 1YVDA 3FOZA 1WA5A 4GT1A 4PQFA 4IDOA 3RRYA 2G3YA 4M22A 1NIJA 3LQRA 1OXXK 2AKAB 4QJ5A 4JKIA 4PAOA 1TTTA 5M1FA 4YMVA 1KJYA 4L15A 1E9RA 1T0HB 1RW4A 3A4LA 3UMFA 4I81A 4NCHA 4UJ5A 3TK1A 3LLMA 1KY2A 1B0UA 2ZJOA 4L16A 4QJ3A 1U2RA 2QPTA 2WZQA 3EW9A 1P2VA 4BFVA 1G5PA 3HPRA 3PFIA 3GLFB 3FVQA 3QBVA 4TYPA 4JBYA 2PZGA 3K0FA 4E07A 2LWIA 1CEEA 4X8HA 3QF7A 5C4MA 1OF1A 2J46A 2IC5A 3Q5EA 3B1VA 1E2JA 4TQUS 4A2QA 4HDCA 2A5DA 2GVDC 4OJQA 2F9MA 3A1TA 4NBSA 4DLUA 2FJUA 3RDPA 2GZHA 1N6RA 4B3FX 2IYSA 5FPKA 4JYBA 4U5XA 1HT2E 2MMGA 5GJCA 5B64A 2FSHA 2KI5A 4WZBE 1KI1A 1TUEA 3CX7A 3PENA 1T4GA 5FR1A 4F92B 4IDHA 4OBEA 1W36D 4BQSA 3CH4B 2EWVA 2ZS8A 1ZBDA 5AJVB 2NQ2C 4LDJA 2ZVPX 2QY9A 1UKZA 3NHAA 5P21A 4P4SB 5LBIA 3ZIAD 2GNOA 2JDID 3EAQA 1RKBA 3LLUA 1KDOA 1A2BA 4JL8A 1G3UA 2ZRGA 2V8OA 3BH6A 1YZNA 2WMNB 1VHLA 2QM8A 1NVWQ 1MO6A 3B1WA 1IN7A 4PHGA 1GM5A 4OI0A 4EQ6B 1Z6TA 3BWDD 3VR2A 5DI3A 2WWHA 2C04A 4C2UA 3V4RA 2JCSA 2QG6A 5JRJA 1FUKA 1TF7A 2IUTA 1L2TA 1Q44A 2FA9A 2V7QD 4FWIB 4JLJA 4KFRA 4QHSA 3I73A 4BFUA 2J0UB 1CP2A 2GWHA 1R10A 1NP6A 4XWAA 4RKFA 4B3XA 3AKYA 1DAHA 2ATVA 4MKFA 2ZEJA 5G40A 1UKYA 3LV8A 4LYJA 2FEMA 4DRZA 2XITA 3K0AA 4FMBB 2QP3A 2G1KA 2CCKA 1W44A 3EZ7A 4Q7KA 3N5CA 3DL0A 3LX8A 4BLPA 4YC7A 2O8EA 1UPTA 1CTQA 3U4QA 3CKLA 1CJUC 5EJEA 2PCLA 5DYGA 1UBGA 2JJ1D 1F2TA 2QSZA 4FCTA 5HCIA 3LH5A 2BMEA 1V43A 4BFTA 1F48A 1NMZA 1VYVA 4ZCMA 4PC1A 3P26A 1XEFA 4PC7A 4RFSA 3D3QA 2DCUA 1A1VA 4HZUA 2AHOA 1HH4A 3KJEA 2O0HA 3ADDA 1DARA 2RHDA 1S1MA 2ZE7A 4Q1EA 3L0PA 5FBLB 3I5XA 2N42A 4OK6A 4PX9A 2ZYVX 4URXR 5HKKD 2OESA 4TMVA 2W6ID 2NG1A 2QRNA 5KUTA 2J1LA 4KBFA 2ZJBA 4PAMA 1Z8FA 4D0NA 3B7GA 5JS7A 4QM6A 3RLFA 5E7MA 3OFNA 4LZZA 2Q21A 1N6LA 2CXXA 2G1JA 4C0KA 4Q1AA 1CR1A 4QG7A 1D8TA 5EUMA 4EAQA 1W4RA 1U81A 3EARA 1OH7A 3RNLA 1XTRA 4XWOA 4UKDA 1EX6A 1TL7C 3CX8A 4UNQA 4V02A 4AG5A 4E03A 3GQBA 1E1RD 4D82A 3WBKA 1COWA 3W9YA 1IY2A 1E2GA 4B3GA 2X77A 1UKVY 4DB2A 1TADA 1UBEA 1S4QA 3CF6R 2FN4A 3EPHA 2OUKA 1ZM7A 3CM0A 3TGPA 2ERXA 1OW3B 3GJ6A 5EP3A 3UANA 4HI0E 5M04A 2PT7A 1EWRA 3K70D 3U3JA 4LBZA 2OFWA 3MRSA 1OHHA 4QHTA 5JCPA 3OE7D 2HV8A 4CEJA 1AM4D 4HAVA 2XB4A 3QKUA 1UJ2A 1YR9A 4M9SA 3OHMA 3RAPR 2GXAA 1X6VA 5F98A 1PVOA 2R62A 4JLDA 5C12A 2B7CA 2C9OA 2OCBA 2V4ZA 1FQKA 2RGBA 3EA0A 3IGFA 4MITA 3CUEF 4HEJA 5FOUA 3HPQA 2F43B 4UXJA 2ZR7A 1TQ2A 4Q48A 1XPOA 4KODA 1KO8A 3AVUA 2EU8A 3AKCA 4V0OA 2WSSA 3KB1A 3W34A 4MYHA 3KTAB 4Y0AA 2HF9A 2OFXA 4LPSA 3TUZC 4LC1A 1KJZA 3EC2A 2P5TB 1XCPA 1E2DA 1EK0A 1FNNA 2JA1A 2R44A 3DMDA 1FZQA 2IEZA 2BMFA 4ZIRA 2ZRCA 2XJ9A 2WJHA 4NPHA 1NBMA 5KDLA 3TQFA 2GAOA 2J5XA 1IBRA 4DVGA 1SVSA 2FZLA 3BOSA 1DO0A 1JI0A 2FGJA 3PG5A 1PUJA 4M9XA 1VIYA 3PUVA 4R2IA 1Z08A 3C8UA 2J87A 1G19A 1JQLB 4YMWA 2OLKA 4C0SA 2OV2A 2VP6A 1T5LA 2ZJZA 1P60A 4IVQA 4PZZA 4TN1A 4US0R 2F1IA 2ANCA 5L3SA 2NMVA 2QTFA 3QXSA 2ZU0C 3K0CC 1OH6A 3R9WA 2OXRA 2IXFA 821PA 4MDEA 4BFYA 1JR3D 4GOKA 2BWJA 5L3QA 4DCSA 2ODWA 3RS3A 1P61B 2QBYB 3OEHA 1NG9A 2IS1A 5EE9A 5B58C 2PX0A 5HZHA 3LBHA 1H8HA 2RGCA 2P6RA 3UXMA 2CL7X 1P9WA 4ZCLA 2G9NA 3WNDA 2GXSA 1CJTC 3MFYA 4Q9JA 3I92A 1SXJE 3MAAC 4LJAA 5GVSA 1OH5A 1ZIPA 4HDQB 1XRJA 2WKPA 2CCJA 4EKDA 2J0SA 3FKSD 4HAYA 2OCPA 3GLHE 4PZYA 3VTKA 2P65A 3B13B 1GDDA 3B82A 4TYYA 5AUNB 4IDQA 1PLKA 3HWSA 3MSXA 3V9PA 5JWRA 5LDDC 1NJGA 1Q1QA 3GLIA 3PXGA 1XNJA 2C2HA 2QP9X 3P27A 4U00A 5HE8A 3U44B 5EE5B 2GK6A 1ZM2A 1W7AA 4GSYA 2JASA 4LHXA 2G88A 4LJ6A 1KO1A 4NL4H 3RS7A 5E3HA 1ZD9A 5JJIA 1KAGA 3VHLB 4HLQB 4TMTA 4D6PA 4HSEA 4KAXA 5C18A 1NVVQ 4OJKA 3KQNA 1JXOA 2FG5A 1UBCA 3Q8XB 5BW8A 4XVQA 2O8FA 3R20A 5EE1A 4CEIA 2VLIA 1PLLA 1KMHA 4HLUA 4US2R 1LS1A 1Z2CA 4DXAA 3P20A 4DUGD 3W8RA 3ADBA 1S9HA 1ZUIA 4CEHA 3EZ6A 3SC3A 2CJWA 4LYAA 1XFAA 1Z5ZA 2H17A 5A4JA 2OCYC 4Q03A 5AJZA 3NH6A 1S2MA 2FPMA 3QF4A 1Q22A 4LJ9A 3EPKA 2QAGB 3DM5A 3CRVA 1CJKC 3QG5A 2VBCA 3PV0A 1U0LA 1WDTA 2XNDA 4HUQB 3DDCA 2E9SA 2YOGA 2G6BA 3RABA 1E2MA 2FFAA 3PJRA 1G4UR 4UXIA 1OYWA 2WIBA 4Q4AA 2ZIAA 3RS0A 3PUZA 2NO1A 1BO6A 3MJRA 1T3HA 2V54A 4BE7B 2ZR9A 2GCPA 4JL6A 4BFSA 3C41J 2O8BA 2ZQ5A 2ZU6A 4FWTA 4DKXA 3LD9A 3T1TA 4X8MA 5TARA 3X1WA 1VG9B 1KI3A 4FCVA 2W58A 1HV8A 3HU3A 1MOZA 3GFOA 1NLYA 1OFIA 1XMVA 3QEJA 4ON9A 2GESA 2BBSA 2ZI6A 3L82B 4M1WA 3KJIA 4QJ4A 2VSXA 5BYKA 4AIIA 3VNVA 3OEEA 3NDBB 4V0MA 2H92A 5EE3A 3NBXX 3WNCA 4BPBA 1KI6B 3U3KA 5K8TA 1GAJA 1SXJB 4RD6A 4DB4A 4EIWA 1TU4A 3ADKA 4A2PA 1YZGA 4H9GA 1AGPA 3CNLA 3CX6A 3MWKA 3BAFA 3ECCA 1FNMA 5M1PA 1G16A 2LKDA 4IOLA 1KSGA 4BFXA 1ELOA 4G5SA 3UKDA 5JSZA 1D9XA 2XOKD 2G0TA 1RRPA 1EFCA 3NWJA 4D0LB 3IEUA 4GMDA 5HCNA 1LF5A 3BBPA 2I1QA 1A4RA 2J3EA 4JL5A 1CXZA 1N25A 2WHXA 2OBNA 3SHFA 521PA 3EXAA 1ETUA 4S2EA 1AS2A 1US8B 2NPIA 1TMKA 4G1UC 3AV0B 1FPMA 1PUIA 3BH7A 1N6OA 4MRRA 4R7ZA 4V0NA 2BIFA 2CMKA 3AF0A 4D25A 1J8MF 2O0JA 2H7VA 2RGEA 3FFBA 4M2LA 5C1BA 2P6NA 1JXMA 3QBTA 4IDNA 3UATA 1XD8A 3VU9A 1Q20A 5BXQC 3B1XA 3GJ7A 4V0LA 1OFUX 4QGGA 1EESA 2W6JD 2HEIA 2WTUA 3THWB 3AP3A 5FTNA 5AR1A 2JLRA 4OQFA 3NTUA 4BUJA 3PEYA 4MYTA 1L4UA 2WKQA 2JLXA 2YC2C 3K0FB 3RWOA 5KDDA 4TMZA 2QE7D 2D2FA 2V6IA 3K0SA 1OXSC 2ZTSA 4EPWA 3VKGA 5DGXA 2VEDA 1ZU5A 4FW9A 3F8TA 3NEJA 2RGXA 1CF4A 1T8UA 4A8JA 2PCJA 3VR6A 2OT3B 4IJMA 2NIPA 4O3MA 3DKPA 2CHVA 2E1RA 4TYWA 2OILA 2ZRLA 1WQ1R 1SVWA 1WE2A 5KOYA 3TAUA 2WVJA 5EP2A 1NLZA 3W5JA 2X1VA 1R0ZA 1VPLA 4BLRA 4D80A 4PQRA 2J59A 1Z0KA 2YJTD 3LW8A 1E9EA 3EWSA 4K81B 5DH9A 3ZIAA 1IXRC 2OAQ1 2OO7A 4QKQA 4CW7A 2JDIA 1TF2A 3SBDA 1WB9A 1OIVA 3I72A 4O2LA 1EXMA 2P0EA 4LWZA 2F6RA 4WIAA 5FOVA 3B1YA 2O5VA 3GMTA 3E5HA 1VG1A 2QAJA 2Z83A 2GF9A 1GSIA 5FL3A 1IAQA 3ZZTA 3ZH9B 4EPYA 1E0SA 4MKGA 1CKEA 2ZR0A 3LVQE 5TY0A 2ZRFA 2IS2A 1KI4A 1XF9A 3AF4A 2MMCA 1ODFA 1RJ9A 4G5QA 4JBWA 1KMQA 2QNRA 2YC4C 1KZGB 2V7QA 4BEJA 3OIVA 1EG7A 2IWRA 4LV6A 4EJSB 3ZYCA 4TSFD 2QENA 1E9SA 4KFSA 3EX7C 1AA9A 3UWKA 1IN6A 1RE0A 3CB4A 1GTVA 4OHYA 1IY0A 1P9NA 2JLVA 1G41A 4RSGA 1I2DA 3TVDA 1XZPA 2C9CA 3OZXA 3W6PA 3BJIC 4GZMA 1G7RA 1MT0A 1IY1A 2YHSA 4B6FA 1HQCA 4HLCA 1CRQA 2B21A 2JEOA 2JJ1A 4BLSA 1XMIA 4TLEA 4YDHB 1M74A 4R2HA 3UK6A 3HP1A 4K46A 3K9HA 3QNUA 1R6BX 4TL9A 1NBME 1W46A 3H1TA 3IQWA 5DYIA 2GCOA 2O8EB 5DISB 4C9BA 3CR7A 3FHOA 3LXRA 1F2TB 2HCJB 4B71A 5HKKA 2YVUA 1M6NA 2GEUA 1ZRHA 2W6IA 3GEEA 5B57C 3B60A 3IIMA 1XXHB 4IOMA 4LYHA 1GRNA 2D7CA 1KIMA 3WMGA 4PPGA 4XD7D 4KITB 3A1UA 4DLSA 1C1YA 1Q0UA 4PPFA 4DSNA 1KGDA 5L8VA 4AK9A 3NBZC 2C03A 3QKSB 1GIAA 3IILA 4BRWA 4LYFA 2XXAA 1MO5A 2VIIA 4EJSC 3LX5A 5FOSA 1E1RA 3I8SA 2O8DA 1DTSA 4ESHA 5CLQA 2PJRA 2QT1A 4GI7A 4BASA 3KJHA 5J4KA 3TH5A 1HUQA 2HXSA 1BH2A 3QKRB 3TVTA 2R6AA 1D2EA 4IHQA 3ZD6A 2WAXA 1E2HA 5M1KA 1GUAA 3BH0A 1J7KA 1XTIA 4NCIA 2GBLA 2JLQA 4TTRA 3ADCA 3C14C 3OE7A 2VHJA 1G5RA 1LTQA 2FNAA 3BE4A 1ZNXA 2DB3A 3CH5A 3GLIE 2Q9AA 1Y3AA 2EW1A 1W5TA 3ZQ6A 2FFQA 3EC1A 4PR0A 1Q12A 3MG9A 5IF9A 4JSTA 1IHUA 3U3OA 3HJNA 4PPQA 2GEDA 3FB4A 3O8CA 3NBYC 1FMLA 3KL4A 1JEDA 1LS6A 2WWXA 3KDSE 1N5JA 4Q19A 2FSGA 1U9IC 1AS0A 4IFBA 4OYHA 4YONB 2KB0A 1AGRA 3IHLA 1X8KA 1UF9A 3KUDA 3SJCA 3THYA 5CJ2A 2VHQA 1N6PA 3CPJB 1OE0A 3NH9A 3QEOA 3W3ZB 3ND9A 2ZI3A 2HT1A 1G8HA 1XD2A 2IYWA 1W49A 2YOHA 2HDNB 1Z47A 4TQ9A 4U02A 4JVMA 4Z51A 1OFTA 1QVAA 2GZDA 1L4YA 1YR6A 3THOA 1KY3A 2Z6VA 3MCAA 3C6AA 5FI0B 2QROA 1KK0A 1XTSA 2VP4A 3T5DA 5BN3A 3OEED 1NN5A 4PC2A 3AVYA 1YZUA 1M7HA 5JECA 1DELA 1NSTA 3FGNA 1O3YA 1UEIA 3AB3A 3U7HB 2XTNA 3I1FA 4KYUA 1G7CA 1JR3A 1OIXA 2P3SA 3Q3JB 2CVFA 5JWHA 4EPVA 5IRCD 3BS4A 1G64A 2WBLC 1KI9A 4MRSA 1XJQA 2ZAMA 2EYQA 3L8ZA 1FUUA 1ZYUA 3KQKA 1OYYA 1LW7A 4YMTA 2XAUA 3ZVLA 2YYZA 4OK3A 2ZI7A 5HR5A 5DO9A 1R0YA 4GP6A 3U3MA 5L3QB 4Q4JB 4ARZB 3DMNA 1OB2A 5CM9C 4M1TA 5FTMA 2ZM5A 4ZDJA 3A4NA 3FFAA 2CL6X 3FKSA 3GJ5A 3LDAA 2HXYA 5K8UA 3ZVRA 3ZD7A 1VKJA 1E9CA 2PZFA 4IXNA 3DOFA 4G3XA 5EXSA 4ERNA 2ZRPA 3B6EA 3AUYA 4V0ME 1NN1A 5GVRA 3LNCA 5DN6D 3IIKA 2VF8A 1OLOA 1E2LA 2R6DA 3A1VA 1TAGA 4D2IA 4TMXA 4YDSA 2IEYA 3FPAA 3GLGB 2QMUA 2ZETA 4ZI3A
chains in the Genus database with same CATH superfamily
4L8WB 3E9ZA 4L0QA 2PN1A 3UAVA 2BGKA 4JQCA 4DWVA 4KWTA 1EWYA 2WJAA 3JYPA 5LP6B 4OQQA 1WJGA 2O1SA 2O5EA 3CJ7A 1RZ3A 3SUOA 1RHRA 1BDJA 3PCRB 2RIRA 2C3UA 4Y30A 4KP7A 5DGTA 1VLHA 4KO8A 1WSEA 1G3RA 1MJFA 2WZDA 5EHXA 2ZITA 1JZSA 2B6HA 3CVYA 4UD6A 3SHOA 1C3OA 3S44A 4YR7A 5HIKA 5HIMA 5JZOA 1F51E 3H8JA 3U4AA 4AILC 4WOCA 2H63A 1VI2A 2ZANA 4JLPA 4MUKA 1DLIA 2DTEA 1MRZA 2PAFA 4V39A 4Q9IA 2PWAA 5AO9A 2JIMA 5E3IA 1A9RA 2Z1IA 1RRFA 4JSYA 4BFWA 3QFRA 4GE3A 4INPA 1PR5A 3GAZA 1J90A 2RHOA 2WTNA 4J94A 721PA 1PBTA 5KREA 4DNOA 1WSBA 2XB6A 3KQVA 1T91A 3INGA 1K9SA 1MU0A 1MDBA 2WPDD 5HF9A 5EL0A 4H3HB 4ZYYA 2BM9A 4F9FA 3L2RA 5FP0A 1JCGA 5EMNA 4NE9A 1NI4A 1Z6QA 2QE7A 2Y2UA 1T43A 1VYHA 4HLDA 2A3RA 3OEYA 1W85A 1YACA 3QHAA 4IUBS 3ZJ4A 4WCDA 5TRTA 3X1DA 3T5BA 3PQCA 3RC3A 3LM2A 5M1NA 5DCYA 1UZAA 3JD3A 4N3GA 2HBKA 5C7YA 4FOSA 2C5AA 4YREA 1FUEA 1U8ZA 4BRPA 4OHOA 1NXVA 1MP0A 2PS3A 5IYZF 2XEXA 4GPTA 3GD7A 4IFYA 1EVEA 1O58A 4UU7A 1CXQA 2NAPA 4ZCQA 2JPDA 4DFJA 2DECA 1XTBA 1ZHHA 3Q12A 1AN0A 3H99A 3CFYA 4K2AA 3OECA 1UWLA 3WOHA 1HDYA 1UJBA 3TTFA 1C3LA 3OF3A 5G0SA 4RHXA 2LGJA 2C4HA 1TA0A 3DR5A 3P4XA 5C53B 3JQQA 3EH1A 3CO0S 4MYCA 1J6UA 2O54A 5D3ZA 4Q3AA 4B7ZA 2Y2VA 4BVLA 2FW9A 4C7OA 1DUIA 1FYDA 3ACCA 2ZJ5A 1ZKMA 4B8CA 1RABA 1TLLA 4CZHA 1OILA 1Q21A 1J53A 4OEHA 5KYTA 3MA0A 3WMEA 4EB3A 1ZI9A 4JK9A 1DE0A 2NU8A 1XHEA 4FI3F 4H5NA 4XRRA 2HU2A 2QU8A 4ONEA 1O0SA 1CRLA 2OPBA 4WASA 3GCZA 1E0AA 1C7ZA 4H60A 4URUR 3RS5A 5FNVF 4ZV9A 1H4VB 5CYPA 5KSOA 4CMAA 5LQAA 3K94A 2FEPA 3S1AB 4HY3A 4JUBA 2DSNA 4K41A 5HF5A 1XCMA 1H9AA 4OXNA 1B0ZA 4N18A 4N5HX 2I7PA 2BM1A 1XQ6A 1U7DA 5LXTF 2Y1CA 1N2OA 3Q7PA 3S1SA 2J4RA 3LZ6A 1T5BA 3AOGA 5AQFA 3QDKA 2IQIA 1A2OA 3BA6A 1F7UA 1LU9A 2F3PA 2X5XA 4MI1A 4DQUA 2ZATA 3DTNA 1A8HA 4AHVA 3TBKA 4R40A 3MXTA 4YX9A 3FPKA 1M6WA 3EGVA 4BX8A 1RS0A 2P11A 2XNHA 4LXGA 2R2AA 3ANMA 4IIXA 2VDQB 4B35A 1WABA 4C29A 1NF8A 1TKRA 4G9EA 4F2SA 1EWQA 1C0MA 2QS9A 3M4XA 1IOWA 2D59A 4R7GA 3SYKA 2EFDB 2OZPA 1ETHA 4ATNA 1NY5A 5G0WA 1KZ7B 2B8WA 3MM4A 2XKBA 4Z4CA 3AEUB 1DADA 3BIFA 2VWJA 1NK5A 2IJGX 4JZYA 4OHXA 1D1SA 3V1OA 1ZMRA 4YXWD 1WXGA 3GPBA 4HPWA 4KN6A 2XNCA 3P39A 5AHWA 2UUOA 1GNVA 1M8JA 3SLKA 3UV7A 1Z36A 1QWSA 2V0NA 1YS4A 3LP2A 3AINA 2NRXA 1P73A 4D4JA 3FZQA 3GVPA 1KAQA 4WJLA 1LW0A 1ZBIA 1T5IA 2XDYA 3ROEA 3RS4A 2C7PA 5GZ1A 3NUGA 2B37A 4IMRA 2Q31A 3IHTA 4RBNA 1W0KD 3GP8A 4V0KA 3VA3A 5IM4F 2ZI9A 3OZFA 3M1FA 2EVWX 3WLKX 4LF7B 5AQPA 1NQAO 4MJLA 1TKAA 2AEFA 5KQRA 3ZHUA 1MKYA 3WMWA 1AH2A 3CWQA 3NC1C 5ESRA 5JJKA 2H85A 1JLRA 2EBWA 3GFRA 2GPBA 1ML4A 1ZH0A 3DFZA 3DEFA 4P0TA 1PAUA 4IS2A 1U8FO 4QWMA 5FUXA 1KI8A 3X1MA 1ISHA 4JD2A 5BT8A 2H1CA 2PKQO 3QKIA 3IEXA 3RRMA 3KWMA 4LV5B 4JCCA 4WQ4A 3EDYA 1RTHA 4M1KA 4KE9A 4F91B 1HF3A 1LWEA 1IEQA 3VF6A 2RH5A 4XDZA 221PA 3QX7A 3FF1A 3NKFA 4P31A 4XW2A 3T3HA 1U6JA 2O48X 5A2QA 2AJBA 3G5LA 2PX5A 1HQDA 1UDXA 3CLUC 2RGYA 4I4LA 3ZY3A 2J7KA 4MWBA 5FHQA 4CEIB 3NI2A 3K8QA 4FI3C 4C7BA 5ADUS 4E5SA 2FW7A 5BYBA 3JQBA 3PFNA 1P6XA 4DLKA 4BUCA 5GTDA 1SB9A 2AG6A 2QF7A 2VHTA 1A9YA 5EZYA 1FLVA 1P81A 3L77A 1PQUA 3ZIUA 1KAEA 1LFDB 5EJAA 2JVIA 4YRMA 3WGQA 1S2IA 2Z6AA 4PTZA 4H1WA 3KG2A 4N0MA 1H2AS 4X7PA 3L6OO 4B73A 1E1QA 1R9JA 3ATVA 3M6IA 3MEQA 4BQQA 2QZZA 3TLBA 2YHAA 3WRYC 2TMGA 4PNHA 1PTJA 2JJ2A 3T8YA 4BV3A 3DWFA 4EY5A 1ACMA 1IQPA 1E2PA 1EINA 4QEDA 3VKWA 1M6VA 3GPIA 2EZ4A 4GH5A 3R3HA 1QFJA 3BJZA 1TUYA 1M2HA 1X7YB 3IPAA 3JVIA 4GLOA 4UVEA 5EKUA 1KKLA 3I6YA 2XDQA 3OEWA 3T5MA 4DABA 4H6VA 4B1FA 1DC7A 3C7KA 2NZYA 4X63A 1NR7A 3ENBA 1FDOA 1FYFA 4E70A 2LZ0A 4PLZA 3WWEA 4M6WA 3K1YA 3CVJA 2GA8A 3L4BA 3WGKA 1Y8RB 4GBED 5IAKA 3SIRA 4KTZA 3QOFA 2W00A 2ZR8A 5LJWA 2ODTX 3UIQA 1DTEA 5A2GA 1PJ4A 3K96A 4L4RA 3HTVA 1PP4A 3E7WA 5EPUA 1A9XA 4BR9A 4LC9B 4BY9C 1KD1O 3PWSA 1EAMA 2H4JA 4RPGA 1SXJD 3U7EB 3GFFA 3EEOA 2GO7A 4ZALA 4WK0B 2Q3BA 3CETA 5ES3A 3ITDA 2Q6TA 3C1OA 1U63A 2VG6A 1RM4A 2DC1A 2VDNB 4A15A 3COYA 1OFVA 2JB9A 1Q7GA 4GBJA 4DDWA 3CISA 4LK2A 2QN1A 1O97D 2O52A 5B55A 1M34E 4KO1S 5LD2C 2GD6A 4BRHA 5C2JB 3BRQA 3E8XA 4ZRNA 4PLFA 4PYLA 1G21E 4A2BA 4TZTA 4ZVLA 3SJ7A 1Y7LA 3VR4A 3MN5A 2CHQA 1RI1A 1XKTA 5C7LO 3RS9A 4BVEA 3QEMB 2ADOA 1NHWA 4QUEA 3KV3O 3DWGA 1S0UA 4OUDB 1Y6JA 3W5AA 1ZUNB 3PF8A 5HXAA 4YQEA 4CKZA 3MUEA 4FJXA 4EUNA 1SELA 2GM3A 1AZTA 3QEWA 4GP9A 4R4JA 1XC9A 3QVOA 4MQLA 5HQ3B 2WWIA 1OA1A 4MGHA 3THYB 1R00A 1DWPA 4HDKB 1JR6A 3EGEA 4DFMA 1MC4A 1L5HA 1UK8A 4HAUA 4WKOA 2QA4N 4PXSA 3NPMA 4B9UA 3SDSA 2VZ0A 3I6QA 4Z0HO 2WWYA 1PEDA 1ZN7A 2UZ3A 4V1CB 4BO0A 1WSJA 4C14A 2MSLA 3BGWA 2BP7A 5H16A 3AA4A 1B6TA 5JNTA 2W6PA 1DOAA 1OSNA 2FWNA 4IXMA 4L27A 3C5HA 2NYVA 3U1BA 5C37A 3ZHRA 4BGBA 4HAOA 2P9NB 4UZEA 2W2QA 1A5VA 4YRJA 3WKEA 3VH1A 5J40A 1FYXA 3KYCA 5ENVA 4W5NA 1FSFA 2NU9A 3L0IB 1Q84A 3BIJA 4NTZA 1U28C 3F67A 1L5UA 1OGIA 3I6ZA 3PSFA 1JEYA 2DP4E 2HK6A 5A4IS 1UZMA 3EE8A 1SUDA 5TE9A 2UZAA 2KFNA 3M6AA 3UAYA 1UKBA 4K0RA 2ZBVA 4QPPA 1Q74A 4B34A 4EPRA 3TW8A 3AP2A 4P58A 4QNMA 1RDCA 2A58A 3NGYA 1HFJA 5EJ4A 4MMXB 2AK2A 2VTEA 2P9IB 4BIIA 3L8DA 4UFNA 2A1UA 2WB4A 4BGDA 1P8JA 4BX2A 2YVKA 3G5MA 2D1RA 1P9RA 3GZJA 4EDFA 2QRPA 1XP8A 2NSDA 2CL5A 3E9PA 5FLKA 4BRSA 1DAEA 1QGUA 3SF8A 1E4VA 3WAKA 3OA0A 4J8PA 5HBGA 4K26A 4RCYA 6GPBA 3ZX3A 3KXPA 4IFVA 4CHTA 1SOUA 1AHIA 2ZT5A 1YT5A 4DREA 3MPOA 4PLPA 2JGKA 2XGGA 5AJUA 1J42A 1IK6A 3VHRA 1KYTA 3HR8A 2DTUA 1QHTA 2V7TA 2HEGA 1PSDA 5AFUH 2B8NA 3M9WA 3EQ2A 1SBHA 3VPDA 2GHRA 3UKRB 4CM5A 5K0ZA 2A5XA 2E4XA 5C5CA 1T0PA 2GELA 1RT9A 3F3YA 1P2UA 2G08A 4OX9B 4CJRA 1L8AA 1PGQA 3OX2A 4YS6A 4INZA 3KYIB 1BDGA 4MOWA 3KIOA 4AYTA 4YQZA 3FOZA 4GT1A 4FZXC 1MFPA 3IQFA 1L5OA 1TTTA 2ZAYA 3KHSA 3TPFA 2IITA 3PNVA 4UJ5A 2I3ZA 1GTMA 4YORA 4EX7A 3PPXA 2LIPA 2GDZA 1JYFA 1CEEA 3QVGB 1OF1A 4FHZA 4KTWA 3GLUA 5AQXA 4DWIA 4UDYX 1U5AA 4V0RA 1E20A 5AI8A 1TUEA 4F92B 3D6UA 5AESA 5AJVB 4MI3A 1HSZA 1CZAN 1YD7A 1RDDA 1A2BA 4BN4A 2AG8A 2HU7A 3OYCA 3SMVA 3ZE6A 1Q44A 4CUJA 3I73A 3LPUA 4Y1RB 1IUNA 3ZLVA 2G1KA 2AP1A 1PNOA 5LBUA 5EJEA 4DR6K 3ZW7A 3GUCA 2PFKA 1VYVA 2ZUSA 1JJFA 2GD2A 1G66A 1Z6ZA 2IZ0A 4EFHA 2JAXA 5COAA 1MUUA 2N42A 1IKVA 1P0FA 2ZSKA 5JMWA 1Z8FA 2H1OA 3B38A 5E7MA 1MIHA 2CXXA 4O08A 4EAQA 3PWKA 3U4HA 2YW2A 3CX8A 4E03A 4ZVNA 2P7IA 3D43A 1YL6A 4EO7A 1UBEA 1WDWB 3TGPA 2ERXA 4PLCA 1YVNA 5M04A 5IS2A 4H18A 2PA3A 4YIHA 4EKNB 1ND6A 3OE7D 4HAVA 4OKEA 2KYRA 4O3FA 1X6VA 4JB8A 1BMQA 1RAEA 3Q98A 4FPXA 1Z7BA 5DEOA 2E2QA 2VOJA 2QTAA 4JP5A 5A9SA 4B6GA 1FFYA 2P5TB 1J07A 3NDJA 5F1XA 3AHIA 3DMDA 3TQFA 3G0IA 1WKVA 4DVGA 3TPCA 1KVRA 2WKWA 3PUVA 4G0OA 2AJLI 5L3SA 1OZGA 4G8CA 2QTFA 3R9WA 4HBGA 2HR1A 2GD1O 4M76B 3D7KA 1SIBE 3BTVA 3BG5A 5KRTA 4CKWB 3WIEA 1DINA 1T44A 4Z49A 1HDOA 4IIGA 1ZIPA 5DYNA 4BRDA 1U8XX 5HRAA 1QCDA 2YIJA 3DEIA 3DXYA 1GDDA 1QRUA 4MULA 1I01A 4U00A 2GK6A 2O2JA 1VB3A 2EXXA 4MVJA 1IXKA 4LJ6A 2Y71A 1C1DA 1M2EA 4D6PA 1X3LA 4V38A 1PLLA 1LS1A 1SCBA 2FZ5A 1VZ3A 4OQ4A 3DV2A 2H17A 2QK4A 4Q03A 2OZKA 4DJDC 1IBKB 2V6MA 1NR5A 1Z0UA 5B4VA 2EIHA 3C3WA 2BHTA 2QL9A 1QO7A 4WFJA 3GU3A 2F9WA 2ZR9A 3O3FA 1IE3A 5CXSA 3C6ZA 3WI7A 2ZIEA 3EL2A 3C3DA 4UHFA 1S3XA 4PBRA 5JAHA 4GQAA 3HU3A 1OFIA 2AI2A 2FVYA 5EKTA 1KEKA 1LI7A 4B9NA 2NLXA 3AY3A 3EE9A 3SPZA 1QDLB 4ITUA 5EINA 2HA4A 4RKYA 4G37A 4EGAA 3FHLA 1KSGA 2PS9A 2KLHA 2IPMA 4IDDA 1SHLA 3ZHTA 2WHXA 4JU9A 3D4NA 4Y9UA 3BH7A 4GGPA 5KINB 5JC1A 3UATA 3OQVA 1JMYA 3TYXA 3DC7A 4TM8A 1RFGE 4AJ4A 3DZBA 4IILA 1ZGHA 1NOJA 4ZOQI 1KQOA 4MYTA 4KIFA 1ZZGA 3GMIA 2M6LA 5IWAK 2GPNA 3DT8A 2WA2A 1BW9A 2E4UA 3E8SA 2O5CA 4CZFA 4TYWA 3OHPA 1WQ1R 1SV5A 3NWPA 5EP2A 5SWMA 4D80A 3A6LA 4CFZA 1MVLA 3BUSA 1IXRC 3I72A 1T8SA 1YB5A 4WIAA 3B1YA 4C07A 3E5HA 4BE9A 3R0QA 3AETB 4B85A 4MRAA 3HS3A 3SZ3A 1QKIA 1QYCA 2OV1A 4NS1A 2QUKA 5I9BA 1OMOA 3ZYCA 2QENA 4MP8A 5DWQA 4YAJA 5HFAA 1I2DA 2O8NA 1VSLA 1KZYC 1IBLB 4YDHB 5J5AA 1JYEA 1WNFA 3OC0A 4QXOA 3ZDXB 5KTTA 4C9BA 2HCJB 4DR5K 1UPBA 1M6NA 1LX6A 3HH8A 3GJZA 1Y1KE 3E3AA 4NEGA 5AQRA 4LYHA 1LPPA 5D5HA 4AK9A 1QSYA 4YJ3F 1EJ2A 1MO5A 4Q1VA 5KJFA 3E5RA 3LQYA 3KJHA 2IBTA 4KQWA 2XRYA 3R7DA 2VZ9A 1YAJA 3AEKA 3ZD6A 4XUGB 4UUQA 3R7LA 2AN5A 1USIA 4CETA 3LDGA 3A1CA 2NRRA 4XOUA 3GLIE 3NM6B 4FOLA 5IF9A 3NHKA 3KPJA 3CLSD 2P1JA 4KIJA 3SLGA 1ZOSA 1X8KA 3OU7A 2HWKA 2Z56A 1QVAA 3ZNNA 3THOA 4ECEA 2Z6VA 2XVMA 2AKEA 1KK0A 5BN3A 2DPLA 2XTNA 4G9BA 1JR3A 3OC6A 3O1HB 4FOPA 1NKEA 1HZJA 2ZAMA 1T6CA 4NYNA 1PWEA 1GPJA 5KZMB 3C65A 1HJOA 5L3QB 4CF0A 3OBBA 3DOFA 5EXSA 1L7DA 2AX3A 4DQKA 1CRWG 4PN3A 3DOKA 1OLOA 3NKLA 2DUMA 4TMXA 3QNOA 2ZETA 4E33A 4MPJA 2ZZMA 1T4MA 1YS1X 3GLIB 4TTTS 1J5EK 2P27A 4GKVA 5KJ6A 2VCHA 2WEKA 1U45A 1QTRA 4DDKA 1JLHA 3CW2A 2VTBB 1VMAA 2B98A 3PSAA 5C34B 4PCLA 1DZ3A 3TTWA 3MT7A 4MJXA 2D2VA 2CMFA 3FMPB 1UDBA 2F55A 4QEKA 1UZLA 2IC3A 1NA5A 4M0LA 1X8JA 4FNMA 1SKQA 2ESRA 1PHRA 4E1BA 3WWOA 2VQFB 1XNHA 1IM2A 2DTDA 3L1UA 3FZYA 2R8BA 4COKA 1V16A 1HXHA 1PD0A 4BMXA 2J31A 3FWZA 4MV0A 3EOAI 2VPQA 1DC4A 1R5NA 1P5HA 2A0YA 1FSPA 4HGPA 2WM3A 3MERA 3ZHSA 3I3OA 3PQ8A 2GEFA 1NOKA 3DDOA 1UK7A 2Z95A 2IPXA 4OFZA 1DJLA 1Y5LA 2W6MA 2F9LA 4KIGA 1Y8QA 2I2DA 1TAQA 2HNZA 3H46O 2SHKA 1ONSA 1U5BA 1PZHA 1UOCA 2OLJA 4JI7K 4K9SA 1VE1A 4CFAA 3C8ZA 1MD9A 4NZPA 2OXCA 1TF5A 1DRKA 2RC6A 1P62B 4BROA 1W2BM 1SCJA 2AZMA 2ERYA 4CIBA 1HNVA 4L5JA 3ZU6A 2YW9A 4G26A 4FJIA 4PQYA 2YWJA 4NH0A 5E6SB 4DDTA 4P08A 3IAEA 4XCXA 4JX8A 5K0SA 3FTFA 1YBFA 1Y6FA 4CG0A 1ORWA 4FFNA 2BKLA 1EBFA 1UUFA 1HZZC 3FNBA 4KK4A 4JN6B 2QJWA 4KPEC 3PB3A 3T3NA 4NE2A 1JDBB 2WYHA 3GOIA 1OX4A 2AC2A 4DCCA 2TYSB 1HK7A 3BMQB 5BURA 3A3NA 3LKDA 5KX5F 1G6HA 3FZMA 2QWLA 1WB5A 3UUFA 1K06A 1HYHA 2ETVA 2YIMA 5CVTA 3RJTA 5HLFA 2YIDA 3VDNB 1ZFNA 5JYEA 1TL3A 4EJMA 4PKHA 5AHKA 4QO8A 3Q85A 4C08A 3BCHA 1JG6A 3N8GA 5JS6A 5JEDA 3PLAE 2E2PA 1P7CA 3W3AA 1XIVA 5SZHB 4IEFB 4MUXA 2AR0A 1ZDMA 3WV5A 3IP5A 4C1NA 1KSPA 1LK7A 2O1XA 3RYIB 1TJPB 3KUXA 1DBPA 1TPZA 3HP9A 5C0OE 4ARBA 2PYDA 1B1CA 2YWGA 2VQEB 2DH6A 4CHQA 3JD0A 4MZXA 4FFBA 1R5OA 3HO6A 1QHHB 2P4UA 2H8KA 1T35A 3FMFA 1MU2A 5J23A 4YAKA 3HJRA 2XY4A 3LZJA 3OZIA 1P3JA 4AJIA 4WGFA 4LTDA 1T6BY 1CZKA 1PU2A 4AHSA 3EA5A 2Z5GA 5JC8A 3U9ZA 1RILA 1VHTA 4DDUA 1N5DA 3RVMA 3L18A 3MN1A 4ANFA 1TXGA 2E87A 4FYKA 2G83A 4KLRA 3BULA 1GG2A 1F9AA 2VYFA 3BMNB 4ELVA 1T8PA 3WGNA 3TCNA 1ISJA 1T0JB 3CZ5A 3IDFA 2RFLA 1Z7WA 2WAOA 1GQQA 4IJUA 1R8YA 3B1KA 3C94A 1J8VA 3IEKA 4XPZA 3RHSA 4P7FA 3PZRA 1RJGA 1NHGA 5BWMA 3MWDB 1NRJB 3C3MA 4R5PA 3IQXA 4A0FA 4M7YA 4V1CI 2OBXA 4EHUA 2AI3A 2CFOA 4ZQFA 4ES6A 4ENPA 5LKRA 1G8KA 5DXAA 2CLSA 1IUPA 2G8VA 1UJNA 3E1KA 2C9YA 4EJ6A 4DQIA 1RBVA 3F6PA 4V24A 2Q5OA 4CKCB 2ANBA 4AICA 4TKUA 3M70A 1QAOA 3DE0X 2Y1KA 2XZLA 3MB5A 5EJ2A 4RZIA 2B4KA 1K6YA 4D46A 1OKKA 3DOCA 1JYSA 3UT5A 4AL4A 5ALIA 1D4XA 1DAIA 2X4LA 1FP4A 1WCIA 1SUQA 1OT3A 4GMKA 4EI9A 4GR4A 1E60A 1L4BA 1CZUA 2DBYA 5IT5A 2O1EA 3INTA 2MDTA 1MW8X 1CVRA 1WNTA 2V8BA 1PR4A 5AQNA 2NSYA 5FLXA 4DV7B 4AZ3B 3MK6A 3TNFA 4BC5A 3FH0A 3SC6A 1H0SA 1JZQA 1CR2A 4DM4A 1KMCA 2NPFA 5I9NA 2J9FA 4F8JA 2DSTA 1KMIY 1OBVA 2FDRA 1EWTA 3SQNA 2R4TA 3EWAA 4Q6BA 3SWWA 1JBQA 4I99A 3H4TA 2G9VA 2KLBA 4R0NA 1JT2A 1T1GA 3NH0A 3TAGA 4QGAA 4CKBB 3OQ1A 4FZVA 1DX9A 3TMAA 2E4ZA 1TYDE 1US8A 2JI8A 1OT5A 4C30A 1GQ2A 4K87A 3NOQA 1LRJA 2RPIA 2G63A 4I1SA 3AO0B 4G4IA 4DPLA 2RI0A 2YHBA 4MRPA 2E21A 2PKYX 3NX4A 1OPRA 1NPDA 3VQAA 1JFRA 2O5RA 3KVRA 2Q0UA 4BAZA 3O90A 3FOWA 2O8FB 3UPDA 1DC6A 4M8KA 1X7ZA 2GUWA 1N2BA 1ACJA 3BDPA 2H1RA 3D7NA 4AURA 2C5LA 2HA5A 3PQDA 2Z9BA 3AF5A 3L05A 2ZYHA 3FFTA 4FGSA 1PZXA 4XR4A 3HADA 5AQYA 1GSHA 4WXPA 1SWVA 1S4MA 2HBYA 2I2CA 4BX9A 3F74A 2RHRA 2IZ7A 1DFHA 2PL5A 5TS2A 3AHHA 2JLYA 3ETEA 2IHZA 2XSZA 3HXOA 4LH5A 3DJFA 2PGOA 5F4BA 5ERYA 3GA7A 3HGMA 4MW0A 4XM1A 4DKJA 3V42A 2GZSA 1Z4NA 1TRHA 1DT3A 1BIUA 1J4AA 1KETA 3A9SA 4DS4A 3WYBA 2EP8A 3JYQA 3K57A 4TLLB 5LVAA 2VVTA 2FW8A 1MR3F 3OLWA 4BNZA 2GEMA 1DAPA 4RTJA 2P0YA 1YHQN 1RRMA 4XR9A 3GRAA 1UXIA 3HLKA 3P83D 4LSGA 3GJ0A 3QUBA 4N03A 2R7KA 1N1EA 5LQJA 4O0IA 2EJUA 4NU5A 3DM9B 2OP1A 2IS6A 4FWRA 4GI5A 4E21A 1YOVA 3NEAA 4HYQA 1HA3A 1V6AA 5KPZA 2RGGA 2JGAA 3A4YA 3BHJA 3T7DA 3CKYA 3IRVA 4AJPA 1RAIA 1W52X 5IU6A 1T6DA 1L5MA 2YS6A 1VCNA 4NU8X 1YHZA 1CQIB 3CEPB 1Y3HA 2O0KA 4JS5A 2I6FA 3CRZA 2IU6A 1FXUA 2NTYC 4MWSA 4P5DA 2OD7A 4DMRA 3GUUA 1NXQA 4Q4JA 4EG1A 5JE8A 3OPYA 4XDYA 2D74A 4XFJA 3QMWA 4FR5A 3H0CA 4RIHA 4G5RA 2CMDA 5JNRA 4DW8A 3ZGZA 5AVKA 1KYWA 4O5FA 1B8OA 4B47A 3QUCA 4BP8A 3WDKA 2F3RA 1E99A 1W4ZA 5JDCC 2PMFA 2P2GA 4B76A 4V3BA 4Q9KA 2Q29A 2YMQA 2VPTA 1M3SA 3Q7RA 3Q3GE 2XCLA 3P38A 4N65A 4LX8A 5ISMA 4A03A 1XAHA 1Z0IA 3I5YA 3D6FA 4ZTZB 1Q3HA 3R0VA 2G25A 1I7DA 1XQSC 3QKWA 3RVCA 3L8MA 4N6OA 1VFNA 3KK1A 3D2AA 4ENVA 4GP7A 1J9AA 3TZLA 2E4YA 1H4TA 3R5XA 5IZCA 5JXJA 1E3JA 2G5TA 4V19S 4RELA 5KSZA 2GBLC 4I1UA 1ECCA 3IA7A 5HRPA 5A0VA 3BTUA 5CXUA 3OAAA 3H7AA 1QG0A 2BCEA 4DQSA 2O0MA 2VP3A 1YU9A 5LOVB 1GQFA 1XEXB 5MN6A 1H2EA 2HLPA 4EUKA 5C1OA 1QC5A 3OZBA 1QORA 2A78A 2AUNA 4TXHA 1LI4A 2NSHA 5DHPA 3C74A 4KKVA 3W4IA 3R0ZA 5BWLA 5J2QA 3HDYA 3K1JA 3ITNA 5CLLA 1CLQA 2VTDA 3I05A 4QSMA 2JIZA 3A36A 1CUWA 3COZA 2WF8A 1R50A 1CY2A 4NLCA 4FGWA 6PFKA 4S3MA 4QOEA 2Q3FA 1Y9AA 3E22A 2CMHA 4YO7A 3MN6A 4TRJA 5FPTA 3T61A 4P83A 1Z2AA 4FJ8A 1Y0BA 4O1HA 2NX2A 2PEZA 3KHTA 4O2RA 3CJCA 1MDUB 3EZGA 2ZQZA 1T3TA 2CMGA 3DO6A 5LYJF 3SXPA 4EVQA 2ASEA 5JVDA 3R7WB 1RHUA 2VPPA 2X2FA 1ZINA 1QIMA 4P4UA 3VHXA 1NVAA 4ND8B 4JKEA 3AU8A 5K6AC 5KYWB 3DUWA 1QCYA 1B0AA 5L7TA 2FUEA 2D1FA 4F84A 3LYAA 1CUSA 1KS9A 2OYQA 1D07A 3PEWA 1NW8A 2AZXA 3V2IA 4W7SA 3L0DA 4CJTA 3LDHA 4AMGA 1QF7A 2HWUA 1U04A 4FCCA 2W2VA 4GW3A 3H2IA 1OPXA 1LLCA 2ZYIA 1AE1A 3B6JA 1JVNA 4N7MA 3TNDA 1V8PA 1DC3A 4BE2A 3IULA 3U7IA 1HTTA 5D3MB 4N3NA 1V47A 4NCBA 1C7EA 1SULA 1B8UA 2XNDD 4E7JA 4YGXB 2C96A 2E55A 4NOLA 5CUQA 4IG4A 1AX9A 3SDBA 4KVGA 2OV6A 2FEOA 5JMVA 1I0LA 3MJDA 4QATA 3FJOA 3WK4A 4FFOA 1W4CA 2EG9A 5IABA 621PA 1XA4A 1U98A 1Z37A 3BFVA 3F9KA 4PIMA 3AESB 2A5FA 1MZVA 1V9SA 3NDPA 3ER8A 3MBKA 1I32A 5AIBA 3KBOA 2GXQA 4W8OA 4KFBA 3L7YA 1YVDA 4IDOA 3DL7A 3JTEA 2OQ2A 4YRAA 5M1FA 4WEQA 4RGVA 2QWQA 1EP4A 1VLMA 2CT8A 1G5PA 4XIIA 4LNUB 4FLYA 2MIIA 4YUWA 1C0UA 1SA0B 2HF7A 3JWEA 4HDCA 2FJUA 3FR8A 2C83A 2XUOA 3HCBA 4GNRA 3QJGA 1P18A 3EVFA 1NUPA 4C4ZA 2OHHA 1QQCA 5GAEP 2EIXA 4QOJA 1EVQA 1VPEA 2QMYA 4R31A 4CL0A 2QTCA 1RADA 3RUFA 5A3RA 2V58A 1OUMA 2WD9A 3V8NA 5AQSA 2Y1DA 4W82A 1CTQA 3U4QA 1CJUC 3T7JA 4BMZA 3KJQA 2J85A 1NMZA 2XR1A 3VZDA 5A4AA 2HJRA 2DEUA 3H3NO 2RHDA 2D00A 4YT2A 3PNOA 5T6BA 3IP9A 5LJIA 4DU4A 4WACA 1U47A 4PAMA 3U4IA 3OFNA 4NMLA 1FFSA 4IPTA 1WHTA 4EB6B 3RNLA 4YFYA 1P74A 1COWA 5LR6A 4DB2A 3VSEA 4YHBA 2B7LA 4OTZA 1WV0A 3D8RA 3MTDA 5EJGA 3CM0A 4HI0E 5BOSA 1J56A 3EWIA 4EBFA 1PK8A 1MB2A 5FWDA 3EVEA 5GIPE 3RAPR 4JLDA 3A2MA 3FBGA 1AMUA 1KTQA 1P1IA 4PSCA 1I6KA 3HSCA 3SBGA 3EXIA 1PR1A 4BP9A 1KA9H 3LC1O 1U0BB 2R44A 3HXMA 2XJ9A 5KJCA 1X87A 4NPHA 2Q7DA 3BOSA 4K3VA 3ELDA 4KH0A 2ECOA 4R69A 4C0SA 3A0UA 3P9XA 4Y7CA 1VPTA 4WZZA 2YYAA 1GOAA 4JT9A 1H2YA 1JSRA 3BY5A 5AVWA 1MPTA 2ODWA 2MCFA 1GU0A 3H11A 4I9GA 2BI4A 5DGCA 2WLTA 4LGCA 3VF2A 2IGBA 5HKAA 1XNJA 3SNKA 1BXZA 1XR3A 3QIOA 5E3HA 1ZD9A 1H23A 3WKDA 2TMDA 2EKQA 2HH9A 2WHRA 4HSEA 4CQMA 1NVVQ 4OJKA 4FNAA 1KMHA 3VPXA 4G56A 3W8RA 4Z4GA 3I56N 1IPEA 5JY1A 1CVLA 4TSRA 5A4JA 4DM7A 3DTVB 1ZMTA 3RRBA 2VXCA 5T8KA 2M6SA 1Z3CA 1Y4ZA 1LWFA 2D8AA 3WSVA 3SAJA 5B2FA 1G4UR 2H4ZA 4CV0A 3PUZA 4B9TA 2P9YA 4AF1A 4NESA 2ID7A 3OI7A 2WWVD 3QX8A 1P9LA 4JQYA 4OO3A 4Y0NA 4FWSA 3U09A 1Z2OX 4U2GA 1E3IA 3ZU4A 1DG9A 1DB3A 5DGDA 4MQFA 4FLXA 2ZBUA 3ECCA 1Y42X 4GLJA 3L6BA 4I1YA 1RQXA 1BA2A 1GSOA 3GN2A 3IEUA 4JAVC 3MTIA 5EHQA 2VG5A 2PAAA 2O14A 2I65A 3AT1A 4MVJP 3DRRA 4MAMA 2XA2A 1U7XA 5BR9A 5JATA 1HNXK 3HXKA 3BDVA 1EESA 3P9CA 4N3AA 2PUVA 5BP7A 1GLGA 2WTUA 3IG1A 1Z5PA 5AR1A 3NT5A 2I5JA 1V71A 3CPSA 4RPKA 4A8JA 3BK1A 3W5JA 4NHEA 2UYCA 2Z1MA 1BHLA 4XGNA 1VG1A 2VJLA 4DV0B 1NRIA 1O4VA 1C81A 2QTWB 4B0PA 3ZGNA 1I3LA 2O4CA 1Y1SA 2H65A 2HSJA 3BRSA 2IWRA 1IG9A 2JFZA 3HM8A 2WW8A 4WA8A 5JAQA 4B6FA 4JKHA 1MQAA 1L7BA 1AQ6A 2JJ1A 5CB4A 2JGUA 3WDSA 4EG7A 3IH5A 3RVSA 1KBOA 3RYCA 1L0BA 3JPYA 4RF3A 1XZCA 3GEMA 5IG2A 3MIIA 4XD7D 4QS7A 3QELA 2WNIA 4BRNA 1CQXA 2A88A 3NBZC 4MKXA 3U0BA 1QP4A 2WUWE 5FRNA 3EFOA 2E20A 2HQOA 2AJ8A 2HXSA 4MEBA 3JXEA 2WLSA 1BU5A 4G8DA 5KOJA 3VYVA 2FEXA 1U0GA 4ZQEA 4LECA 3ZQ6A 1PKEA 2FFQA 4PYRA 3T5AA 2W43A 1J1IA 4I8IA 2ONCA 1PJLA 4YV7A 4IFBA 3LDPA 3OQPA 2EZTA 1QNFA 3KO8A 4DUZK 4L3WA 3ED5A 2JCXA 1A5SB 4RHTA 3JZDA 4ARVA 3ZCMA 4PXYA 3AVYA 3O4JA 5GIOE 1MB4A 4EZEA 3V8VA 4U1RA 1TJNA 3OKPA 4G07A 3ENKA 4WNCA 1PS9A 2X0JA 1VSMA 4B1VA 3D59A 5LQDA 5HR5A 1C4WA 2ZM5A 4I3FA 5TMDA 1RXVA 4O55A 3ZD7A 1E9CA 5KQPA 2RGUA 4KBYA 1G2QA 1ULZA 2YKMA 1J0CA 3SGLA 2V1UA 3KD2A 4B8WA 1LWNA 2FXUA 4BKMA 4H5VA 2EL9A 4GOMD 4WW0A 2O2EA 2H1LA 5D01A 4FGUA 1VDZA 2J5KA 2W6QA 3QPCA 4FS3A 4CFBA 5AT1A 1R6AA 4FE4A 1U3WA 4G01B 4DC9A 2ZRKA 1K8KA 4LMRA 1C1CA 4MGZR 1POXA 3DJCA 4QYTA 2O3TA 1O2DA 3COWA 1HRKA 1NVDA 3L4QA 1RWPA 3AERA 5D6OA 3EVGA 4S1PA 3IAHA 5GGXA 4YALA 3ENVA 3O4GA 4B4UA 4DCNA 3AR3A 1PJSA 2ZI4A 5B3JC 3EYAA 1LV8A 2DWCA 1KWGA 1GDHA 2YV5A 3UHOA 1GEGA 3SX4A 5I48A 2SKEA 4YDUC 5FAXA 3L7BA 5LZ4A 3KZMA 2UU9K 1YULA 1RTIA 5IJ9A 5HOQA 1XEAA 4MFBA 1IAVA 4DG5A 1E2UA 1BMFD 1IO2A 3FOEC 1MB3A 1JAHA 2Z04A 3OM0A 1Q82O 4MKHA 1UBOS 5A2QO 1WXHA 5FH9A 2Q3MA 2VHYA 1TEVA 2ONYA 3BZBA 1XNGA 1XA3A 2O7QA 5ILOA 2QTZA 2LXNA 4AKSA 2VJKA 4TSFA 3K5LA 2OQIA 5I47A 3ZPXA 3VNSA 5BPNA 2FW1A 1WY5A 5AHRA 2TS1A 3B3JA 3P94A 3TLYA 2P9ZA 4NWIA 4QYIB 1WUYA 1LSSA 2W6NA 1CS0B 1T4CA 3NBFA 3WISA 2XA1A 3VA7A 2ZJ0A 1GTRA 2VXBA 3G88A 4IX9A 5TQVA 2IYYA 4U6NA 1PL6A 4MV7A 1JHYA 3G13A 1WETA 4IX1A 2B2CA 3TQHA 4CV2A 4IZ6A 3DEJA 3V4OA 3OZRA 4IVNA 2CYBA 3A6PC 5D2CA 4YUXA 5DP2A 3IT1A 4CN9A 4QIHA 3VN5A 1FNSA 1KXZA 4BQZA 4JVNA 4AJJA 2OCEA 5E7JA 2HIMA 4OH1A 3OD5A 1MC8A 5FUMA 4BTEA 4NBTA 4CM4B <