4IFEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
448
structure length
434
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 145
structure length 434
sequence length 448
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ifeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifeA01
1MH1A 1YVDA 2JIZA 4DUGD 4MKHA 2PZGA 2ZSBA 2GESA 2XZOA 2V9PA 1YZTA 4KO8A 2Q3HA 3H4MA 4MRRA 3R9IA 3GEHA 3A8TA 5CLLA 3UXMA 5IK2D 2ZJ5A 3PUYA 3IQXA 1N0UA 3SC3A 5JEDA 4ZDKA 2GTPA 1ZM9A 3L2OB 3EAQA 2O0JA 4JYCA 5JCZA 1JR3E 1SVKA 3OZXA 1DADA 4Q9IA 5GADl 1ZAKA 3GLIB 1RVDA 4HLDA 4DKXA 4TYWA 3RLFA 2ANBA 1TUEA 3C5HA 4GP6A 1A4RA 1DEKA 2FFAA 1W5TA 3UWKA 4A2WA 3K0AB 1II8A 3HP1A 1EFUA 2CBZA 2V7QD 1X3SA 4Q1CA 3SJAA 4QJ5A 4V02A 2ZRKA 4PAOA 5GVSA 1E4VA 5DIFA 2ZETA 4TMXA 1F2UB 3ICQB 4LSGA 2YC2C 1T0HB 1JNYA 2H1LA 3QKRA 1YZKA 1W1WA 4GMXA 2A5JA 5B57C 3CH4B 2REXB 4CVNA 3B1YA 5AJXA 3W9YA 3BJIC 3SFVA 2JDID 5J4HA 3B13B 5LPNA 3JZAA 3Q7QA 1GNPA 3U4QA 5J4KA 3VR6A 3H2YA 3GFPA 3VKWA 2KBFA 5C18A 3FMFA 3PITA 3QF7A 4JL6A 5JSZB 5FUVA 2O0KA 2QPOA 1CR2A 2DY1A 2EFEB 4KFSA 2F7SA 4PHTA 5EP2A 4F91B 2X8AA 1IXZA 3PUZA 3NBFA 3REGA 2WWWA 2XJ9A 5J40A 3K9GA 3VR1A 1LF0A 1CR0A 1CRPA 3X1WA 4QBGB 4QM7A 4LJ8A 3QENA 3W34A 4A2PA 1R8QA 3MD0A 4URXR 1ZCAA 1OFIA 1G3MA 4A92A 1KDOA 2IW3A 2NQ2C 2Z43A 2WKRA 3A6PC 2BOVA 4OJQA 1SVWA 5E7JA 2BEJA 1T9HA 5IDVA 4IJMA 4ZCLA 3SJCA 1B23P 1AKYA 1US8B 2EFDB 3MFYA 2NTYC 1LNZA 5EE0A 3AKDA 3Q9LA 4OK3A 1DO0A 2GZHA 4XOIA 5KO2A 3VX3A 3I5YA 2G0NA 3NVAA 4QL3A 3P20A 1Z0KA 4X8MA 5DN6A 4CW7A 4GL2A 1JEDA 3FMPB 3KXLA 2EW1A 4B48A 3GFOA 4HUTA 3QVVA 4BZXA 1VG1A 5FOXA 1CLUA 4M9ZA 1H8EA 4HB0A 3BFVA 4BZPA 3Q72A 3O8BA 4B2PA 3S1AA 1LV7A 5L3QB 4IVPA 3KKNA 5AJYA 2QQEA 4F38A 2MMGA 4YLGA 2WOJA 5KPDA 1P2SA 1P9RA 1KI6A 2A5GA 3U3OA 4U7DA 3OEHD 2JLUA 2F9LA 3RRZA 2R8RA 5IF9A 1AIPA 5EUQB 2PH1A 3GQBA 4B76A 1R10A 3IHLA 4IXNA 1OV4A 3AVXA 1S3GA 2UKDA 4AC9A 3GP8A 2BCJQ 4ZDWA 2VP6A 5FH9A 3AV0B 1W0KD 1NVWQ 4QHYA 1A1VA 2QP9X 2IX3A 1ODFA 2NO1A 3FOZA 3KB2A 4MUBA 3T5DA 4TLEA 2E1RA 2ZYVX 4Z51A 3AGQA 4Z8YA 4G1UC 3B9PA 2ZE7A 1U8ZA 2B8TA 2YYZA 4PHFA 3SQXA 2O8BA 2CVHA 3U7HB 1L4UA 1FMLA 2OBMA 3B1ZA 4YONB 5TMPA 3ZD7A 1RKBA 4Q19A 1F2TB 4R7ZA 4DCNA 2IT1A 4OI1A 2GF0A 2YZ2A 3GEEA 5K8TA 1E9EA 5HTKA 3KQKA 1U9IA 3SQWA 1E9FA 4OKSA 4M4SA 1R4AA 2J7PA 1ESNA 2PT7A 3KUCA 3N70A 1A7JA 3RHFA 3AVPA 2CJWB 4QRHA 4OQLA 4L5BA 2AKYA 3ND9A 3BRWD 1G8PA 1KKLA 1J70A 1NI3A 1KI8A 4EJSB 1E2QA 3IIKA 2XTZA 1UJ2A 3ZVRA 1CR4A 1DOAA 3H84A 4Q4JB 3TR0A 1TF7A 1XXHA 2QTFA 2VYFA 2P6RA 2DB3A 4LBYA 3O8DA 1XMSA 2PBRA 3VAAA 3MLEA 1EFCA 5L3SA 2ZRFA 4LYFA 3KQUA 4JSTA 3U3JA 4EUNA 1OH7A 2WKQA 2V55B 5FI1B 3W5IA 1VYUA 4L15A 4W5HA 3NWJA 1F5NA 3GJ6A 1UAAA 4E22A 1XD9A 3C14C 3CRW1 4BRUA 1FOEB 2IYQA 5DN6D 5JWOA 4Y0AA 2GXSA 4L9WA 2QGNA 3VNUA 4TQAA 1RJ9B 4JBYA 4G5SA 2J0UA 2WPDA 2W0SA 3CZPA 2G83A 2VF8A 3BB4A 2J87A 4M1OA 1NY6A 2ORIA 3NHBA 3W6PA 2QY9A 3IEVA 5KSPA 3FFBA 4C3ZA 1ELOA 4MRNA 3RVBA 4PC1A 1NN0A 1NY5A 1I4TD 1KI4A 1NVXQ 2JCSA 4YMWA 4LWZA 3I72A 3HPRA 1KMHA 4CEJB 1AZTA 4FWIB 5CJPA 4OHYA 2P5SA 1IJFA 1YKSA 1Z2CA 3A4NA 2ZSFA 1G8YA 1IHUA 1KZGB 2IEYA 1XEWX 2WIBA 2ZRAA 4URZR 3CWZA 1XDBA 2IYRA 2Q6TA 2HLDA 2GJ9A 421PA 1AS3A 4JVSB 2RGBA 4DVGA 4TMTA 4KITB 1C4OA 4LYAA 4G01B 4CZ2A 2B7BA 3EZFA 4IOMA 4ZKDA 3B2EA 4DLZA 2ZS8A 4BFTA 4WXRA 3GJ4A 1KDTA 1WDTA 3RS0A 1GIAA 2XOKA 1SXJC 1TU4A 3FKSD 4YDHB 5J5CA 1N6OA 3LBIA 4Q7KA 1TEXA 1MRNA 1TL7C 5BYJA 4C4PA 1RRPA 1X86B 5EQTA 1JEEA 3I92A 3WMGA 5K8LA 2XXAB 3C6HA 4C7OB 3GLIA 2YNMA 5AUNB 2GJKA 1T8TA 2IS1A 2VF7A 3TRFA 3MWLA 1AN0A 1S0UA 3BH6A 1VPLA 3AKCA 3MMPA 2DR3A 2ZSAA 3UMRA 2VHCA 2XNDA 2QP3A 5D3MB 1FQKA 2ZM5A 3FMIA 3D31A 4TWZA 5KSYA 3SYNA 2WVJA 5SZIA 1KO1A 3H86A 1YR9A 4WZ6A 1U0JA 2WSSD 1OXUA 2XAUA 4QBIA 1ZU5A 3QG5A 3AEZA 2OAP1 1AS0A 4LGMA 2GRJA 4POAA 3G82C 4I99A 521PA 3P32A 2QN6A 4FCVA 2PMDA 1N5JA 2QMEA 4PXAA 2LKCA 5JHGB 4V0KA 1CS4C 3L8ZA 3T1TA 1DAGA 2GK6A 3EC2A 5JSZA 3HU2A 3ASYA 4QKQA 4UNNA 3PV0A 2ZUDA 4XWAA 3K70D 4KBGA 4TQ9A 1CJMA 5FUXA 4A2QA 1H8HA 2YOHA 3MCAA 1E32A 2K5UA 5EXTA 2XB2A 1G17A 4A0HA 2JJ2A 1KOFA 4B3BA 1CIPA 3A4LA 5TARA 3FHOA 1E9AA 4M0LA 1Z6GA 5KSOA 3SYLA 2FSFA 3OESA 4EQ6A 3H1TA 3V4FA 3ZVMA 3R7WB 2G0TA 3UG6A 4JLDA 3EA5A 2FX3A 1COWA 2HXYA 3A1WA 4LBVA 4IEIA 4BLQA 4F4CA 1XD2A 4C0KA 3PUXA 3A37A 3EARA 5C2FA 4K81B 1US8A 4YDSA 2HLDD 1FTSA 1U9IC 3B9QA 5JRJA 4D2IA 2P2LA 2FEOA 3GLGB 4HUQA 1EX6A 2ZI5A 3EZ9A 3QVUA 1KIMA 5M1KA 2CXXA 1XF9A 4M1YA 1E9CA 2IUTA 1QHXA 3WBJA 4B3CA 2R2AA 2EU8A 3DDCA 4IFBA 4LYHA 1SQ5A 4O2RA 5EP3A 5L3QA 3CZQA 4B71A 4KYIB 4PSKA 4YMSA 2G1JA 3AP3A 4TYNA 1XMVA 3HR7A 3IDQA 5JRZA 2CE2X 3TSWA 3PQCA 5AJWA 2ZR0A 3FFAA 2QMUA 3IBYA 5CB8A 3TBKA 1HYQA 3B5JA 3IPYA 4DZZA 1Z28A 4XVQA 3NBXX 4D0NA 3PVSA 1RYHA 1S2MA 1W47A 1UKZA 1L7VC 1E0SA 4TT3D 2IYLD 1OFTA 1P75A 4GMDA 2H16A 5DHAA 4HI0E 4W7SA 4EPWA 1XMIA 1OSNA 1E1QA 3EIHA 1HA3A 2QMOA 1FNMA 2GEVA 4RFSA 2EYUA 2HCJB 4JLNA 1R0ZA 4MKGA 2QNRA 1XRJA 1ZD1A 1JQJC 2ZVPX 1G5TA 2WAYA 4LOAA 1OYWA 2ZSDA 1W36D 5FL3A 4DDTA 1X1RA 1VCOA 2QUZA 5TVKA 2IBMA 2IL1A 2QL6A 4AKHA 3CF6R 4NZYA 1GKIA 3A1UA 1N6KA 1L4YA 1FUUA 5CYPA 4F7WA 1HQCA 3GLHB 4Q03A 3UIEA 1Z2AA 4TMWA 1SULA 2OCPA 2V6IA 2PCLA 1IBRA 4PZYA 1OHHA 1HUQA 4A9AA 3PUVA 5JWHA 4IVQA 4Q4HB 1N0WA 2QQ0A 4L8GA 4E5UA 1BS1A 4JMPA 4Q4JA 3LX8A 1II0A 3QF4B 5C10A 2QPAA 1JXMA 2VP2A 3NDBB 2Z5FA 4TTRA 5CM8B 3VR2A 3AVYA 1AA9A 5C46F 3PEYA 4FCWA 1COWD 3OE7D 1G7RA 4TSFA 2X2EA 3U44B 1DAEA 4M22A 3T1VA 1DAHA 1DAKA 2VHUA 3U3KA 2GHIA 1GNRA 3EIEA 1WRBA 4MRSA 3WYAA 1IJEA 1AZSC 3GD7A 3U7EB 3AB3A 5B58C 4KSCA 3CNLA 4XH9B 4AYTA 1QHGA 4HZUB 3LD9A 3VU9A 4FMCB 1CULC 2W2TA 3SU8A 1NBMD 1AK2A 1XTRA 1E0KA 5FTLA 3THYB 4JL5A 5FOVA 2C96A 3KFXA 2A78A 1OKKA 1R2QA 3CIOA 5C2JB 1X8LA 1NVUQ 1BH2A 3ECCA 2H92A 3DMNA 4AI6A 3C16C 1WXQA 3OIVA 1HV8A 3CWQA 4RKEA 4PQYA 3C7KA 1G3QA 2O52A 4OHZA 1VYVA 4DDVA 4CEJA 2FF7A 4D82A 1GRQA 5JLJA 3KX2A 2WJGA 4BFVA 621PA 3C4JA 1C9KA 4CF7A 3TH5A 4LHWA 1R5BA 2BBSA 4Q1EA 4Q5IA 5L8VA 3IEUA 1NF3A 4US1R 1WCV1 3B60A 4KBFA 4RZ3A 2BIFA 3HWSA 2CE7A 4QHSA 3SI7A 4Z1MA 3B1WA 2ZS7A 2H8KA 2VRWA 3CRRA 3K9LA 2RGNA 4TTPA 3F8TA 4KJZA 1QF9A 5E7MA 2BDTA 4BRWA 1FZQA 2D3WA 2ZR9A 1YRBA 1JI0A 2GEDA 3U6KA 1ZU4A 2FGJA 1W48A 1P2VA 3PENA 1IN5A 1OE0A 2VO1A 4OQMA 5CIQA 2XXAA 3Q7PA 3X1DA 1ZJ6A 4BLRA 1NVVR 5P21A 3GPLA 2GAAA 4WAUA 2C99A 3PUWA 5CB6A 1KJZA 1XEXB 2DBYA 3OEED 4OQXA 4XJXA 3QIAA 1SZPA 3OHMA 1ZNWA 2BBTA 5DI3B 3FYHA 3SEAA 1T3LA 2C9CA 4O0MA 4MH0R 1QVRA 1GAJA 4BWYA 3NG1A 1MRSA 4BEJA 5D3MA 1OH8A 2GJ8A 2J9RA 2J59A 3GLHE 3K8YA 5FL7A 3TW4A 1PUJA 1OFUX 3AF4A 3AP2A 4RD0A 4HDCA 2B8WA 2GVZC 4NPHA 1G1MA 2PT5A 2WZQA 121PA 3K9HA 1X8KA 1KZ7B 1GRNA 821PA 2VSOA 3SBDA 4XSGA 5K8IA 3NEJA 1UDXA 4GOXA 1CF4A 2Q3FA 2GWHA 4BE7B 1OH5A 2EVWX 3U5ZB 2Z83A 2A7QA 3JZMA 1G291 5FUWA 2QSYA 1WMSA 3QEJA 3VTKA 4D81A 2ONKA 3KZ1E 3VHXA 4AY2A 2IS4A 2AK3A 1P73A 1U2RA 3MSXA 1D8TA 4OI0A 2YOGA 4RFVA 4FWTA 3ZQJA 1N6LA 5B2ZA 1Z6YA 1UBGA 3LH5A 2B6HA 1W46A 4W5JA 2GJSA 3WNCA 4B6FA 1DAFA 2G9NA 5KSZA 1EG7A 2O8DA 1Q1ZA 2BJVA 4JJZA 1AKEA 2ZJZA 1ESMA 1YE8A 4U00A 4OQFA 4I81A 3GLGA 4Q1FA 1P2TA 1P61B 1M34E 1UBFA 2AD1A 5CDFE 4LJ9A 1M2OB 2Q3MA 2QMHA 5L3VA 4L16A 2J0SA 5FBVB 2ORWA 1EK0A 221PA 3EW9A 4LHXA 4EJSC 2OBLA 1ONBA 1CJVC 5AR1A 2F1IA 1TQ4A 5FOUA 2FV8A 3SBEA 1G9XA 2ZRPA 1W4RA 1J2JA 2A5FA 2FOLA 2QBYB 4MYCA 1N5KA 5SZHB 2W6JA 3V4RA 2BBWA 1Z0JA 3NC1C 2OFOA 1OF1A 3LO5A 2C5LA 4CGZA 4UXIA 3NXSA 5JFGA 1XPUA 1YZQA 2KWIA 4TMVA 1AJEA 1KHTA 3MJRA 2FJUA 4V0MA 2JAQA 1MKYA 4B73A 2RGGA 1CU1A 2ZUBA 1SVLA 3ZLJA 2NO0A 1KTVA 1P9WA 3PCRB 4OJKA 4M9SA 4PSVA 1KI7A 4LBWA 1PUIA 1LB1B 1Q0UA 5HE8A 1VDZA 2OV2A 3WBKA 4BPBA 4Q66C 1DAMA 2W6IA 1XZQA 3ND8A 4IRUB 2F1RA 4FD2A 2WWFA 3OFNA 3L0OA 4DEXA 2IK8A 1N6PA 2BC9A 2H57A 1Q3TA 3FDIA 2E87A 3KTAA 5JHHB 2ZUCA 2O8FA 1P5ZB 5EZ5A 4OHWA 2C78A 2D74A 4Q18A 5A4JA 2YWHA 3E70C 4Q4HA 2GKSA 1FW6A 3TSOA 3EC1A 4OI4A 4H9GA 1RPZA 1UEIA 2RGNC 4IKEA 3ADCA 2FPKA 2QP4A 4RZXA 2IWHA 1WE2A 1AQUA 3REFA 4W9MC 3LVRE 5CK4A 2WJVA 2D7CA 4URWR 1EX7A 2O5VA 5M1OA 1WP9A 3WRXC 2B7CA 4LHZA 4Q9HA 3U2QA 3ZDQA 4NCIA 1KJYA 3C5CA 4JBWA 4NCJA 3ICEA 3M4YA 1XTIA 4FINA 1N0VC 2AFIE 2CMKA 4A1FA 1T8UA 1JXOA 5G53C 4Q48A 1TX4B 1AGRA 5G40A 1IY1A 1BYUA 4KLNA 3THYA 1G4AE 1FP7A 3TAHA 1UKVY 4B2IA 4URVR 4LJ5A 3EPJA 3CF2A 1TMKA 3F0TA 2ATXA 2JASA 3K53A 4NKRA 4JVLA 1CBUA 1W0JD 4JZKA 1VCNA 4MQBA 3MJHA 4PO8A 4NONA 1EFTA 1D5CA 2Z4RA 2IXEA 2W6JD 2XSZA 2ZJBA 3MWKA 1MV5A 2IHBA 2Q9AA 5LD2B 2L0XA 2G3YA 1SXJA 2W0MA 3M0EA 2I1QA 4X8HA 1E1RA 1XEWY 2HUPA 4CT4B 1E2DA 4MGYR 2XJ4A 1XPRA 3W3AA 1PLKA 1E2FA 3QEOA 3W6OA 4YXWD 3KQHA 3R8FA 1W36B 1S9HA 4DBLC 1QHYA 4MGZR 1L8QA 2ZRLA 1NIJA 3PFIA 4UJ3A 1VCIA 3QQ5A 1W4AA 1N2CE 4B32A 4TLDA 3SFZA 2EFCB 3KKPA 3DM9B 4A8JB 4BLSA 1HE8B 2J5XA 5EP4A 4AG5A 3Q8XB 4BFXA 2JIZD 2F6RA 4JLJA 4ZDJA 1NL3A 1Z8FA 4NYIR 2ZRNA 1EFRA 2IXGA 4IDOA 1P62B 2H5EA 5J4YA 5A0FA 3ZZ0A 1S1MA 1TQ2A 1OXVA 2ZS9A 4EPVA 5EE3A 4IDQA 1W4CA 4O25A 3Q85A 3K0FB 1RW4A 4NYIQ 3ZS9A 4FCTA 4AKIA 2O8EA 3T06B 1NN3A 4WXPA 3T15A 1XB2A 2QM8A 3MWJA 4I1OA 3VR5A 1T4GA 2F9MA 2CL7X 4A15A 3PEVA 3RSOA 2OXCA 3AVOA 4Q4AB 3KFVA 1FX0B 3QXCA 4EFNA 4OQNA 2CCGA 4MUAA 1BOFA 5EXSA 1ZIOA 3AUXA 4GBMA 1VG0B 5J4VA 2PEYA 2FZ4A 3NC0C 3SDZA 3RWMB 4JVNA 1E9SA 1I2MA 1M1YE 4RKFA 5FTJA 2X77A 1J99A 3TSZA 2ZU6A 1VMAA 1JR3A 2FFBA 4LC1A 4ZDIA 2X2FA 4G5GA 1E2IA 1U81A 1UEJA 4CEHA 4QGAA 5KDLA 1E79A 2V4ZA 2Q21A 1BMFA 2HXSA 4O2LA 4MRVA 2CK3A 2HT1A 1BIFA 2QENA 3FE2A 3BH7A 4KSBA 2GVDC 1YJ5A 4D25A 4CEIB 5JJIA 4Q4LA 3U3RA 2VSFA 4ACAA 2AWNA 1G7SA 3AVTA 4JT2A 2BM0A 2ZR7A 4WIAA 2FPLA 2NGRA 1MR3F 1HY3A 3HU1A 3CLVA 1Z63A 1MO3A 3FB4A 4FMBB 1RIFA 2PMKA 4IVRA 5AUQA 4DCUA 1DG1G 4M1WA 2CLSA 1JAIA 2GXQA 4UNSA 1DVRA 1P6XA 1MO5A 3CRQA 1M7BA 5AJZA 3BC1A 3C8UA 4IXMA 3ZZTA 1GILA 1Z07A 4DT1B 2IYUA 3CRVA 2ZREA 4V0NA 1W44A 4ACBA 1TQDA 2OSBA 1FQJA 1OXXK 2EWWA 3WY9A 4K8OA 2GXUA 3QBTA 1DS6A 1TF2A 4Q9KA 5FFMA 3RDPA 4OBEA 1NG9A 3BGWA 4WVFA 2IYWA 3WNDA 3K1JA 5E7IA 4C0HA 1Q22A 1H8ED 2VHTA 4HB3A 3I62A 5F2EA 1X1SA 4Q7MB 3TKLA 4A82A 4UNRA 4KYUA 1WBDA 2YKGA 2WHXA 4Q00A 3RWOA 4BLPA 2ERXA 4RY2A 4HAXA 5FBQB 4DB4A 2ZJAA 1XX6A 3B82A 2IEZA 2RH5A 3KXKA 5AK0A 2UVQA 4MRPA 5EXXA 3RS3A 4D4LA 2CVFA 4QNRA 3N5CA 2R6DA 1KY3A 1TQ6A 4TMZA 2CLDX 1LS1A 4FW9A 1ZNZA 2NPFA 3VNVA 4QNMA 2RGXA 5CIWA 4DLVA 1JBKA 3D6TB 3UMFA 5A5GA 1ZVQA 1UM8A 2JEOA 3FPAA 2W58A 5K8UA 2CHQA 4NMMA 4DLSA 2ZE8A 2ZITA 1JJVA 1VKJA 5EE1A 2ZRCA 1XCPA 2NOAA 4BFWA 2AL7A 2OHFA 2VHQA 4PO1A 5KYKA 4LZZA 2UZ3A 1NBME 2QSZA 3KQNA 3KDSE 3LXXA 5GJCA 1ZMXA 4W5WA 2VP5A 4TLBA 1W7AA 1ETUA 2GZDA 4IOLA 1G41A 2H18A 1GUAA 1NG1A 1MT0A 2CHGA 3O8RA 2VH5R 2R6GA 3B1XA 5ANRB 4L4UA 3GJ8A 4QBFA 3A58B 1R7RA 2J7PD 5H70A 1I4DD 4D26A 1UPTA 2QG6A 3BK7A 3NTUA 2QT0A 2YINC 1XPOA 1G20E 3EX7C 3LQQA 2WM9B 4ZV4A 4LJAA 3UPUA 3K0AA 1XJQA 1G4UR 4N3NA 1YZUA 3Q5DA 3TK1A 2C9YA 1ZP6A 4YMUA 5DGXA 1PLLA 1FPMA 3B6EA 3WMFA 1F2UA 4Z8XA 1BKDR 1GSIA 2ZEJA 3D8BA 5M1QA 1FTNA 1SHKA 3H0KA 4WBSA 4BQSA 1Y3AA 2A30A 1EWQA 1TUIA 1FUKA 1Z0DA 1GTVA 1R5NA 1UBEA 3QKTA 2ERYA 1S1CA 4KVGA 2BCGY 1MABB 4PAMA 4IW3B 4BGDA 3IPXA 2W2XA 1OYYA 3L43A 3DOEA 1XNJA 2C04A 3OIUA 1SVOA 3I3SR 4KV9A 2KSQA 1W5SA 2YHSA 1KSJA 2NZJA 2O8CB 2RGAA 3HU3A 3TUJC 2CNWA 3T5GA 2WPDD 1EWRA 3ZH9B 1GL7A 2WWIA 3PEWA 1XTSA 1Q1EA 2YWEA 1DPFA 3O47A 4LYJA 1JQLB 1YZNA 1Q57A 4G0NA 3N2IA 2FMXA 5TV2A 3DZDA 3EA0A 1W49A 4G5OA 4LJ4A 1NSTA 4YQFA 2ODWA 4BZQA 4TL8A 1VCMA 3DEFA 4NYJR 2IC5A 2ZYUX 5BN4A 1U94A 3UK6A 1UKEA 5C12A 2A5YB 4LDJA 1C1YA 4E07A 3DM5A 5GVRA 5LB4A 1D9ZA 1NLZA 4PR0A 5EE9A 3GLFB 2GJAA 2ZQ5A 1GWNA 1GDDA 2RB4A 2OXRA 1GNQA 4DLRA 5J4LA 4NYJQ 2ZTSA 2ZJ2A 3AVUA 2SHKA 3PIRA 2QI9C 1HT2E 4P33A 3A1TA 4MYUA 5AJVB 4RD6A 4HB4A 2XOKD 2BHRA 3QNUA 3NKVA 5JEEA 2J45A 4M1SA 1ZM3A 1R8SA 1Z6XA 2HF9A 1E2KA 3OAAA 4DEYA 5B64A 4MYTA 3EPLA 3SJBA 3RSLA 2ZYWX 2XB4A 3CBQA 5G3ZA 2GCPA 1K5GA 2V3CC 2QPTA 1FL9A 1IAQA 5CYOA 3MUFA 4Q4AA 2JJ1A 3UMSA 3A36A 4J0QA 5DHFA 1VTKA 5FBLB 3ZIAA 2WIAA 1YQTA 3ZVLA 3WRYC 1QBKC 3TR5A 2VA8A 1EFHA 1ZYUA 4B2LA 1DAIA 1IY2A 1XMJA 2XEXA 1CKEA 2XNDD 5SZKB 1A2KC 4PTLA 4GZMA 4TZ0A 2ODBA 2ZRDA 5FBRB 4XVUA 2NMVA 1DG3A 3QPWA 3AUYA 4S35A 5EJEA 2AN9A 2I4IA 3IHWA 3MWYW 3UANA 2X1VA 3L82B 1YU9A 2CLCX 3LXRA 1S9DA 1F2TA 1E9DA 1SVMA 3I8XA 4RSGA 4EAQA 3LW7A 3B7GA 1Z22A 2GK7A 3QXHA 2CHVA 2PLRA 1I4LD 4IDHA 4CEIA 4Q1DA 1VIAA 2PCJA 1CJKC 5FTMA 3QE0A 3A4MA 5H68A 4R2HA 2XNSA 2N1BA 3RS4A 2CJWA 2BWJA 1CTQA 3QSYA 4BLOA 2MMCA 2CNWD 2VIIA 4XD7A 2VLIA 4AYXA 1ZUNB 2EYQA 3BOSA 2FN4A 3TVTA 1H8HD 5KDDA 4GDFA 1J8YF 2B21A 4EJSA 2ZRJA 1DO2A 2JJ2D 2ZI6A 2ZI3A 4EPYA 4NP6A 4B43A 2FH5B 3CB4A 5HKKA 1LFDB 3DVLA 3THXB 1MOZA 2F1HA 4Y0VA 2BVNA 4RCYA 4I4LA 2BMJA 4DT1A 2AX4A 2ANCA 2ZU0C 4NTZA 1GFIA 1ZBDA 4LV8B 1CRQA 2BM1A 1IN4A 2ZRMA 4FI3C 1JECA 4B75A 1G3IA 3VR3A 3KKMA 4C0JA 4BFUA 2G1KA 1E2GA 5G41A 2OFXA 2DFNA 3V00A 1N6IA 1YR7A 2G88A 2WSMA 3BAFA 4LJ7A 4F93B 3DPUA 1RJ9A 3DL0A 1G3RA 4P4SB 1II8B 4CYMA 4LX0A 3GLFE 4JT4A 4M1MA 1WBBA 2WBLC 5C4MA 1II9A 1G16A 2FFQA 3A1SA 4B33A 4B44A 4DLTA 4JL8A 5HZHA 5DYGA 1QG4A 6Q21A 1GOTA 3U7GA 4S2EA 2ZXUA 4A36A 2Y8EA 3TJZA 1R6BX 2WMNB 4LC0A 4G5QA 1ZIPA 2JATA 4BFSA 1SVSA 3LFUA 1ZM4A 3ZQ6A 1OW3B 4I1UA 2IWRA 5FPKA 1TU3A 2VSXA 2IXFA 3UATA 4PHGA 3R9XA 1W2GA 3U4QB 1N25A 1G6HA 2ZJYA 1NJFA 3HYRA 2FU5C 4PZLA 5F3WB 2OT3B 3W5JA 4QHTA 1N3BA 2V1XA 1E1QD 2FWRA 2AHOA 4B3DA 5M1PA 2ZVQX 4YC7A 2WJHA 2KBEA 4ERNA 2VQSA 5LD2C 2ATVA 2OEPA 2ZSEA 4XSHA 4BFYA 1NSFA 2QEQA 4US2R 4DSTA 2LKDA 4GI7A 3FWYA 1E96A 2D62A 2FZLA 3GEIA 1OIXA 1VIYA 2QU8A 4C7OA 4FIDA 1NMZA 4R9UC 2JLWA 2Z0MA 4R2IA 3AQ4A 1JAHA 3GMTA 3K09C 1E94E 4HAVA 3IO3A 2JLRA 1SKYE 3FHCB 2DWOA 1N6RA 2R62A 4A8JC 5FR2A 1M6NA 4UKDA 4TN1A 4D4MA 3ADBA 3BB3A 1KO5A 1NVVQ 2OAQ1 1OHHD 3PJRA 5FPSA 4Q9JA 721PA 2C2HA 4HLQB 2GA8A 5LDDC 1JR6A 1W4BA 1GP2A 3IBGA 4B3FX 3I4LA 3U61B 4B34A 2QAJA 4TSFD 3W6NA 5EP1A 2WMOB 1ANKA 2FG5A 3IUYA 2BMDA 4I1VA 3LBHA 3LLMA 3LW8A 3T35A 4Z54A 4C2UA 3GJXC 3S1AB 3SHWA 1KI2A 2QT1A 2D2EA 3W3ZB 1OIVA 3SHFA 1J90A 1Q20A 2ZI4A 4E09A 4OHVA 1KYIA 1Z0AA 1KI6B 3I5XA 5KU1A 2O8CA 5JCPA 2QE7A 2YJTD 5HCIA 4ZCMA 3AVWA 2D06A 4ITRC 1VG8A 4HDOB 2W00A 1W2HA 1OKKD 4NCHA 1Z0FA 4ASUA 4Q9LA 3VFDA 4A0RA 3CO5A 1SVIA 5BW8A 4C0SA 2WJYA 2GBLC 3FHTA 1U8AA 4PC3A 1TNDA 4DUGA 3K0CA 3DMDA 1V5WA 3E2IA 4AK9A 5JJLA 2O8BB 3W8NA 3R7WA 1KO4A 1NRJB 1UADA 3R9WA 5IK2A 3JVUA 5E3HA 1GZSA 1KK1A 3IGFA 1CEEA 2KE5A 4EPXA 3HPQA 2GZAA 2BBOA 4P31A 2OCBA 1EGAA 4AURA 5JZVA 3QY0A 1P60A 3LRPA 3GJ5A 2TMKA 2OE2A 3CR7A 4QFMA 4Z1MD 5BWMA 3D7MA 3QBVA 3TIFA 4JLAA 2C03A 2ZANA 4PZZA 4P3YA 4KFTA 3VHLB 3LA6A 1G7TA 4DLUA 1GL6A 4KLZA 1ZNYA 4KODA 2QRZA 1IXRC 1O3YA 3LBNA 1T3SA 3KJGA 4JSYA 2RCNA 2RHMA 2V7QA 3BIFA 1NKTA 3TQCA 1UBCA 1S96A 4IOJA 4DWJA 1TEVA 2ZJOA 4HSEA 5TDHA 1RC8A 1PVOA 2V54A 3ASZA 1ZD9A 5KNDA 3QJYA 3ZJYA 2IHYA 4DDUA 5H1YA 2XITA 3B8HA 4A0GA 5DSZA 1FFHA 3RC3A 3RS7A 4D4JA 3QKSB 4B6EA 5L3SB 4HLUA 1YR6A 2JDIA 3BFXA 4IDPA 1NN1A 4P4TA 1KJWA 1PZNA 3K9NA 4IDNA 2ZE5A 1VHLA 2ODEA 5FL7D 1NNEA 3VX4A 2DCUA 3BBPA 3EG5A 1YZGA 5JMTA 4PO9A 1UF9A 4ZIRB 3RAPR 3CPEA 2J0UB 3OIYA 1G18A 3K70B 2ASEA 2AK2A 2BV3A 2RAPA 1KK2A 2RMKA 4N0EA 3LV8A 5CM9C 1QVAA 1ZM7A 3SNHA 2XZLA 4LUCA 3LY5A 3HDTA 4NE2A 4DCSA 1U99A 3VQTA 1IN6A 1T6NA 1KMHB 2WAXA 4RD1A 1Q1BA 1E6CA 2G77B 4M2LA 4KU4A 1QG2A 3CRMA 3GLHA 4V0OA 1KK0A 1PLJA 3EASA 1U8YA 1RE0A 1UKYA 4HAWA 4MKFA 1ZUHA 3AKEA 3RABA 5AUPB 4JBXA 1D2MA 1UDWA 4GSYA 5HPYB 5KPJA 1YR8A 4DXAA 1E9BA 4PPFA 8OHMA 1XZPA 3BWDD 3QF4A 4MDFA 2VBCA 3SZRA 3THXA 1D9XA 2OM2A 3X1XA 1KNXA 4QXAA 5AWFC 3CF0A 4WZAE 3WXMA 3EPKA 3NBYC 4C0BA 2J46A 3U44A 2PZFA 4HB2A 3LVQE 5KUTA 3P26A 1VG9B 2A9KA 2AFHE 4II7A 3VKGA 1N6HA 3M1IA 1Q3HA 2BJWA 2PJZA 4DJTA 2NIPA 1XFAA 2J0QA 2IF0A 4QJ4A 1ZW6A 4LBZA 1ZD8A 2ODNA 1A5TA 4FMDB 1T91A 3MG9A 1G21E 1P2UA 1IONA 3OEHA 1E2HA 2CL0X 4NL4H 1L2TA 4HZUA 4B35A 1M7HA 3SJZA 1D6JA 1Z5ZA 1H65A 1DELA 3Q5EA 4P4SA 3SS8A 1PJRA 5G3YA 4OK6A 5JI2E 3HR8A 3WHLA 5D3QA 1W0KA 5BN5A 5LBIA 2HV8A 4Q02A 3R20A 4OL0A 4X8LA 4XWOA 4HAZA 2ZYTX 1NKSA 3I73A 1DBSA 2F43B 4RZ2A 4UXHA 4L9SA 5KNCA 4GOJA 4UXJA 5CDFA 2F55A 1RZ3A 2ZAOA 4ZI3A 1E2LA 2IYSA 3P4XA 3WMEA 1XXHE 4LV6A 3WP1B 1R0WA 1OXSC 4ABYA 3TAUA 3ZGXA 4DLWA 3QUSA 3LNCA 2IUUA 2MSCB 1RFLA 3BB1A 1QHHB 2DFTA 4XTRA 1P3JA 1Z08A 2VTKA 1KY2A 1CJUC 2YC4C 4RCZA 4ZKEA 2QAGB 2W6ID 1M74A 2GXAA 3K0CC 4Q7JB 4ZPXA 3OFND 1UFQA 2AD5A 2Q0HA 2RKOA 3CNOA 4TL7A 4AKGA 4EQ6B 4NBSA 1Z3IX 1XEXA 4GPTA 5FUYA 2C95A 1BO6A 4M1TA 2D2FA 1FMJA 3QG1A 4GNKA 5TXGA 1XD2B 5DLQC 5DI3A 4KFRA 3ZS8A 2VP9A 4FN5A 3QXXA 4O3MA 2QRNA 4C30A 3KJEA 1LTQA 2JLSA 1ZCBA 4PPNA 3LLUA 5EZ6B 1WB9A 2QA5A 4HUQB 1E0JA 5GJVC 2VEDA 3IO5A 4F4IA 3CONA 3RRMA 2GNOA 2WOOA 4PX9A 1SHZA 1TF5A 5DO9A 1Z6TA 1K8RA 1QZXA 5DNYB 4F92B 2P6NA 1XWIA 2KI5A 4QC2A 1JPJA 2Q9BA 1GRRA 2ORVA 3W90A 2Z4SA 3KQLA 1AGPA 2RGEA 3IQWA 1T5IA 3AGPA 5CJ2A 2HJVA 1OJLA 3THWB 3UWOA 3AVVA 4EKDA 3F3YA 1HE1C 2C98A 3RYTC 1K6MA 4MYHA 4P32A 3QPVA 4JLMA 3NHAA 3PEUA 2YV5A 3X1YA 4HLUC 3BE4A 4PPQA 1NIPA 3GLIE 1T0JB 1YHNA 2IYYA 1GKYA 4RD3A 4H1VA 4PPGA 4TYPA 4EFLA 2XGJA 1NN5A 5KHOC 2OG2A 2XSZD 2D4HA 4DCTA 1LS6A 3BXZA 5BQ5A 3SYKA 1SXJD 2OESA 3CPJB 4RFSB 5FI0B 5FPYA 2YVUA 1KI1A 2B92A 1E1RD 5DYIA 2EFGA 4FXPA 4JVMA 3FKSA 3V9PA 1ZNXA 4JLBA 1VECA 1ZM2A 3P27A 4CRWB 3JVVA 2VHJA 5H8WA 4RD4A 4R98A 5C2DA 1D2NA 4DLYA 3ADDA 5FPHA 1RRFA 2N42A 2NO7A 4HEJA 1G5PA 4A4DA 1F3OA 3FVQA 2ZE6A 1DE0A 1Z47A 1KGDA 2WJIA 1MO4A 1DTSA 1E98A 4LHVA 2WWXA 2VL7A 3X2SA 2YWGA 3C6AA 1EFRD 4YMTA 2WV9A 2NZ8A 2GAOA 5HR5A 4GOKA 3J81k 1E2JA 4DIDA 3L0PA 1OXTA 2QBYA 2J0VA 2HF8A 2QM7A 1TAGA 2P6UA 5F9FA 2P5TB 3P1JA 3QKSA 2J3EA 4JLVA 1OH6A 2WSSA 3TUZC 1DARA 3T1QA 3EPHA 1M7GA 1E9RA 4PHHA 3I8SA 1QRAA 2D7DA 4PANA 1KDRA 5HCNA 3L8YA 2C77A 1TPZA 3CR8A 3VU9B 1Q12A 2P3SA 4ZIRA 1NLYA 2P67A 2FA9A 4NHOA 1AQYA 4PC7A 3AKYA 2E9SA 1JR3D 4C2TA 3EZ6A 3U60B 3I1FA 2CCJA 5M04A 5DH9A 2OBNA 3AF0A 2PX3A 1E79D 2GCOB 2R9VA 1BMFD 1OFHA 2CK3D 4LRWA 4U5XA 1I2DA 4G5RA 1M8PA 2MSEB 4QM6A 2ZRGA 2NPIA 3KJHA 5AUOB 5DE3A 5IRCD 4TLCA 2A3RA 3CX7A 2GEUA 4AKEA 2QTVB 3LWNA 3E1SA 4BASA 1LVGA 1Z06A 3B1VA 4MA4A 4NU0A 4MGKR 4DC9A 3ZVNA 2V8OA 5JJKA 3P4YA 5KOYA 5C1BA 3R8CA 1LY1A 4B74A 2X19A 3WP0A 3QPUA 3T34A 1IY0A 4TYYA 2ONJA 3NDPA 3TVDA 2BMEA 3KKQA 5HZKA 1G8FA 3TMKA 1QHSA 1XCGB 2DPXA 1XU4A 2LCFA 4JS0A 5FOWA 2NG1A 3TGPA 4RZUA 4QJ3A 3QOFA 3CNNA 4KHZA 4JKIA 4HAYA 4NCNA 4OK5A 3KL4A 1U90A 3T61A 4XWKA 2PEZA 1XTJA 1O87A 1XCMA 2CEAA 1A82A 1FP6A 2RHDA 3C15C 2WWYA 3KB1A 4M8NE 4LJYA 1G3UA 1VHTA 2V1UA 2RGDA 4QGFA 4JYBA 2IYVA 3QI2A 4TT3A 4H1UA 3UKDA 1CJTC 3ADKA 3AP1A 2EFHB 2WJJA 1KSFX 1X8JA 3AF1A 2REOA 2F43A 2UZIR 3M6AA 5FOSA 2FPMA 1N5IA 4NCKA 4ZO4A 3IIJA 3CUEF 1KAGA 2PLFA 1NLFA 2FFHA 3MGCA 2IYZA 4MITA 3T12A 4ESVA 4LHYA 5SZJA 2IS2A 1R0YA 1AM4D 3I61A 1SGWA 2JJ8A 3E5HA 2HT6A 3K09A 1R5OA 5C15A 2P65A 4MKIA 3EWSA 2I3BA 1QHHA 2IA5A 1G6OA 4A8JA 3NH6A 4IFEA 3ETLA 1Q44A 2XZPA 5CLQA 4GP7A 1U0LA 4FMCF 5GJWC 1GL9B 2WTUA 2OCAA 2QAGA 1GVNB 3LQRA 3WHKA 1G8HA 2HJGA 3FKQA 5CITA 3KUDA 2W2VA 4NYMR 4QBHA 1GG2A 2QORA 4EFMA 5FTNA 1CP2A 1J8MF 2ZRIA 3CX8A 1HQYE 2A5DA 2AKAB 4A6XA 1KSHA 1RRGA 4WW0A 1HH4A 4M1KA 3K0FA 3VMFA 4IEEA 1ZINA 2OCYC 2I1VB 1CR1A 3OE7A 3THOA 4URYR 2O8DB 4NYMQ 2WWGA 3GJ3A 3X1ZA 5IT5A 4WOPA 2HYDA 1G5RA 2EWVA 3DZ8A 3QXSA 3ONWA 1OLOA 3VR4A 3SOPA 4AYWA 3AM1A 1FX0A 4KAXA 2YWFA 1V43A 3OF5A 5C4GB 2LWIA 4D6PA 4D80A 2F3TA 3WYGA 1IOZA 1S3SA 3CPHA 1PV4A 1NBMA 2ECKA 5FPTA 4KXFB 2HDNB 2GBLA 2FSGA 5KNBA 1Q1QA 2DWQA 2OLJA 3WYFA 4ZCIA 1XJ0A 4M9XA 1GITA 4AWXA 3BH0A 5IHPA 3THWA 3LAWA 1OPXA 5LB2A 3FTQA 4ARZB 4C9BA 5JS8A 2QTHA 5JECA 4DSNA 4QGGA 4BEBA 4U02A 1XTKA 3D3QA 4DHEA 2W83A 5J47A 3NBZC 4Q1AA 3RC8A 1SKYB 4EPTA 1ZC4A 1HEIA 4IOKA 1FNNA 4KI0A 2FGKA 4BUJA 4D0GA 1HTWA 1XP8A 2XX3A 4NH0A 5L3RA 2YOFA 4ZI2A 1LW7A 2DFKB 3PXGA 1AS2A 4BECA 2BKEA 3RRYA 3HYTA 4HZIA 4DLXA 4B3GA 4PQRA 4LJ6A 3ZZUA 4DDWA 4URUR 4N0DA 3FMOB 4HATA 3PR1A 4PC6A 2IYXA 4MDEA 1KAOA 3NEYA 1P4SA 4RD2A 1KK3A 4DIEA 3BFKA 3AH8A 1KO7A 3K70C 4HYYA 5TY0A 3RANA 1Q21A 4P4UA 2OILA 4I1SA 4TTQA 2BMFA 1WA5A 1MO6A 1IXSB 2R6CA 5ELXA 2R6FA 4C0LA 1ZRHA 4MGIR 2ZI7A 3VKHA 4A0FA 1T5LA 5E95A 2CCKA 2XTMA 2ZAMA 5JI3E 1SKQA 5JS7A 4Q47A 3RRNA 5JBQA 5B30A 3OEEA 1KSGA 2IS6A 3KTAB 1CXZA 4JLKA 4GRAA 3PG5A 3AF2A 2O8FB 2XTNA 3KKOA 3EZ7A 1KO8A 4DRZA 5EXPA 3SR0A 4UNQA 3AVQA 1F60A 2BEKA 2WWHA 1KDPA 2N46A 4CT5A 4IHQA 3L0IB 4Q01A 2Q9CA 1VYTA 4OYHA 3SN6A 4A6PA 4HDQB 1E0AA 4KFUA 2GDJA 4B47A 1JALA 2VP0A 2JLXA 3KJIA 3OAAD 5EUMA 4TZ6A 4ESHA 1G64A 1HURA 2C8VA 4TLAA 2J41A 3C41J 4RJLA 4V03A 4R71A 3TLXA 1R0XA 3FGNA 1TADA 1XTQA 3QKRB 3TW8B 3LX5A 1KI3A 3B85A 2OUKA 1YZLA 1Z0IA 5BYKA 1NP6A 2R65A 2JA1A 5M1NA 2GILA 2CDNA 1NJGA 2G6BA 2JJ1D 4Q1BA 5FTKA 3ZIAD 3EIQA 2JLZA 2A2ZA 2ZPTX 2FNAA 4ILEA 4UQOA 1F48A 2C9OA 2REBA 4JLPA 5DISB 3GLGE 3EXAA 3RS5A 3CW2A 1GM5A 3DKPA 2EQBA 3F5FA 2HCBA 4QGHA 1IN7A 2KB0A 1E2MA 4JKYA 3TE6A 2GCOA 2AR7A 2BKUA 4K46A 4P0TA 1U98A 1QHIA 1SXJB 1WQ1R 1OB5A 2WICA 4YMVA 4C0QC 5EE5B 3GJ7A 2DWPA 3G0HA 4DSUA 1E99A 1W36C 4EDHA 5DI9A 2H17A 3IILA 4CDGA 3TUIC 4QOSA 3MRSA 2DFLA 3OIWA 2VP4A 2VPPA 4PQFA 4CIDA 2JGNA 4BFZA 1OT3A 4JLOA 4XD7D 5HE9A 3CM0A 1P7CA 3L0SA 1U0HC 1Z6AA 3EWAA 3MAAC 4V0ME 1S4QA 3DKVA 2FDCA 4Q7LA 4PAQA 4DSOA 5HKKD 2QAGC 1A2BA 2ZRBA 4XIGS 4TL6A 4LPSA 2HEIA 4HAUA 2Z6VA 1B0UA 2V6JA 4GFDA 4M9QA 1E4YA 1IQPA 3CX6A 3KXIA 1Z83A 4PFSA 5F98A 1OIWA 2F3RA 4D0LB 2ZIAA 1E2EA 4XTCS 1MABA 5M1FA 2IUSA 2HYIC 2PJRA 2NO9A 1Z29A 4DB2A 2O8EB 2ZJ8A 2FE4A 4E03A 1OB2A 3DHWC 4TYQA 2QROA 2AXPA 4TQUS 4KCGA 4PC2A 1LF5A 2P0EA 2GCNA 2MSDB 1IN8A 4HLCA 1QHNA 4WA7A 2H7VA 1G8GA 4UJ5A 3T1OA 4Q21A 1XEFA 2WKPA 1KMQA 1JJ7A 3ZYCA 3CKLA 3AF3A 2CL6X 5TB5A 2J7KA 1YRAA 2OO7A 4PSAA 1GKUB 4OI2A 4DCVA 2PL3A 2RGCA 1JB1A 3QXJA 4F4JA 1X6VA 1ZUIA 4CEHB 1RRCA 2AWOA 3BD9A 4LI0A 1E3MA 4LCBA 1D2EA 4FMDF 4N1AA 1E2PA 1KKMA 2O0HA 3TNFA 3HJNA 3U6BA 1RYFA 3GLFA 5GJBA 1K5DA 1P9NA 1WF3A 2R44A 2FSIA 4EPRA 1G19A 4QG7A 1EXMA 1Y63A 2IYTA 2R6AA 2ZRHA 1KI9A 3GCGA 1ZC3A 2ZI9A 4KVAA 2OLKA 4NDZA 2QZ4A 2PX0A 1N5LA 2FSHA 1EESA 3BORA 4LPKA 1J7KA 3DO6A 4AIIA 5JWRA 5CK5A 3K0EA 3Q3JB 4LV5B 4ON9A 3WNBA 5KDOA 3K0SA 1S8FA 1XD8A 2PZEA 3ZD6A 1XXHB 4UNPA 5FOTA 4GT1A 3DOFA 2GF9A 1T3HA 4V0LA 1JPNA 1SXJE 1E2NA 3BERA 5UKDA 5BXQC 1F6BA 2FEMA 1G7CA 2GETA 2NO6A 4US0R 4D4KA 2DYKA 3B78A 3BS4A 3IKJA 5E4FA 1NMYA 1XJCA 2KJQA 2OFWA 3A1VA 4XVRA 4M21A 2J1LA 4B3XA 3EZ2A 1QDEA 3RS2A 2IF2A 3NIBA 4OHXA 3U3MA 4JJKA 1BYIA 1W0JA 2JLQA 3O8CA 5BN3A 3TQFA 4ARZA 4EIWA 1IM2A 4LY6A 5FBWB 3I32A 2JLVA 4AD8A 4M53A 4C0AC 1XBTA 5KTYA 5F9HA 4GZLA 3W8RA 5FR1A 2AXNA 1E69A 3GFTA 4JIMA 1HT1E 3U7FB 4BLTA 4YXWA 3NH9A 2ZROA 2QE7D 4TL9A 4RVCA 3IIMA 4G3XA 1KNQA 3UG7A 3GJ0A 4LK2A 2F1JA 1NMXA 4WZBE 3LDAA 3CH5A 3RNLA 4AG6A 1N6NA 3G5UA 2DHRA 4ASUD 3QKUA 3SE0A 4TMKA 2JLYA 1TTTA 2QGZA 3N2EA 4X8OA 1P72A 2OZEA
chains in the Genus database with same CATH superfamily
4Q4CA 4QOEA 4MKHA 4BAUA 2VXYA 4AN4A 3R9IA 3IQXA 4II2A 1ZM9A 4Q9IA 3C6MA 3D3EA 4CEFA 2B78A 4I9GA 1N36B 3G89A 5AOCA 2YN0A 3K0AB 4IG3A 1JKJA 1FTYA 2DFEA 3BJIC 3HHPA 5FBZA 5SYMA 2VPTA 1JXAA 4FNGA 2QPOA 2ZXEA 2DY1A 5F3RA 1JCEA 4GYWA 2O7VA 3NBFA 5J40A 1YI8A 1LF0A 4EP1A 5BR1A 4AQ7A 1RQLA 4U6NA 1Y81A 2EG5A 2KYRA 3DLRA 3A6PC 1CK4A 4UVHA 4DDKA 2OANA 1EVYA 3JQ6A 3M33A 4PIMA 3DKRA 3OJSA 3LM8A 2EW1A 1ZCJA 1KEUA 1PSDA 3GFOA 3LX4A 1U1DA 2JFYA 2WIFA 3KKZA 3EISA 1IV0A 5B1IA 4DR2K 4RA9B 3VRHA 3AFMA 3LM9A 3E53A 2JIQA 2B2NA 3FMVA 3AVXA 4B76A 1THTA 5JXHA 1RLTA 3W5VA 3AV0B 4PFJA 1QZ5A 3RFTA 2OHVA 4HV4A 2G8IA 2PKQP 4RMHA 4MXDA 1SEPA 3UK1A 2YZ2A 5IDQA 1PJBA 1E9EA 3KQKA 2Y77A 2KQUA 4E12A 1BDMA 2WYWA 1A9SA 2YWCA 3OCCA 3GYGA 5ABPA 1CDZA 2JIDA 4FGLA 3DB1A 3EGVA 3FI9A 3PFBA 5KQGA 5K4HA 1XXHA 2VYFA 5E9QA 4HG2A 1OZFA 4K42A 3IUQA 2ZRFA 4NICA 5TMDA 3KQWA 3E82A 1JDBC 3A9TA 1XD9A 3GT4A 4BCCA 3EGWA 1S1VA 3QTLA 4Q1VA 5A9SA 3GWGA 3RU3A 4XI9A 3UJNA 1T44A 3FFBA 1RKVA 3SZMA 1LFAA 4NZPA 3FCOA 1KMHA 3N9IA 4WQ4C 4QJIA 3O3GA 1IHUA 4YT4A 2RGBA 4TMTA 1ENYA 2B7BA 4BFTA 2W98A 1KDTA 3DTTA 4HXEB 1XAGA 5FORA 3LBIA 4JKEA 4RTQA 4LXIA 3HBTA 5I7UA 5KQ8A 5IJ0B 2BFOA 1HDXA 1GA4A 1Q91A 4HHTA 2XB9A 1S0UA 1S7CA 4JT8A 4YT8A 3HL4A 2XD4A 4RKYA 3CEPB 4B1YB 1ESZA 4UBKA 1Z33A 1ABBA 4OGCA 3R3UA 3KLEA 5KVSA 3P32A 2SCUA 1DT5A 4J1NA 4U7WA 4F5YA 1SU7A 4HT3B 4KBGA 3U09A 2WIDA 1Y3BE 5JDIA 1Z6GA 2FXUA 3M89A 5C2FA 1PGQA 5ER9A 1C7RA 4CJRA 1B42A 1WTCA 2PZSA 3LVFO 3IJEB 1Y1LA 1LTHR 2EJWA 3LKBA 4B3CA 4D5EA 2DPNA 3JQAB 4IFBA 2JIRA 4R1NA 4QULA 5E84A 3PT5A 3TZ6A 2XUIA 1K8QA 4XVQA 3HHEA 1JCFA 1W4ZA 2PUEA 3R3LA 1IOWA 1R0BA 4U9IS 4DSEA 3FPLA 4GMDA 1XMQK 4H0FA 5DHAA 2C7GA 1GO2A 1JQJC 2FETA 1J1ZA 4I9LA 4N54A 2HNAA 3S8MA 5H0IA 2A5LA 4F11A 2ZT6A 2IBMA 1ATZA 3MILA 3R24A 1I4OA 2R97A 3VTFA 3TFQA 9MHTA 4Q03A 3UIEA 4IUCS 3GUVA 2LD4A 4IVQA 2QQ0A 4Q7QA 1X9JA 4N7BA 5T41A 4FCWA 4UOZA 3AVMA 3S55A 2AP1A 2WD9A 1T5OA 3DZGA 4CJVA 1OR8A 4ZO9A 4AYTA 2W2TA 1KYVA 5D86A 4FYYA 4DOMA 2FEWB 3ECCA 4F5EA 5AW9A 3OIVA 3DD1A 4JD5A 2QB5A 5J2UA 2BBSA 3A4VA 4JNCA 3UTCA 5FNZA 3B1WA 4KGZA 2H8KA 2WDZA 1MXHA 1JI0A 1GTL1 2AVDA 3ND7A 3QFPA 2V0GA 2VI5A 5CIQA 2G9VA 1PNQA 2RG7A 1O95C 3QNWA 2VHZA 4LJKA 3SIRA 5E8RA 3OEED 1YONA 1ZNWA 2H9AA 4YCSA 1T3LA 3ELBA 3PX7A 1RI3A 1H5NA 3Q15C 3JWHA 3NPMA 2Z2KA 4K6KA 1IFXA 5HL7L 1T2VA 5LFAA 1TU0A 1F0YA 1CC1S 3K9HA 2QL7A 4TTSA 2BEWB 1KEZA 2DQYA 2QSYA 3VTKA 1IPHA 3GDQA 3WAKA 2QK4A 4AY2A 1ZD2P 2V7YA 5JQGF 4RFVA 2AFIB 3UJ8A 4RH3A 1M5TA 3QVOA 5K0LA 2G9NA 4MVJM 3ZETA 4HDSB 1UBFA 3C3YA 2V3VA 2O3SA 4LJ9A 1XALA 1JMYA 4NOJA 5CX4A 4Y0WA 1EK0A 3OUUA 2EKPA 2FLVA 1GZ5A 2FK7A 1W4RA 4JC5A 1HG1A 2WY2D 4OSOA 2J9ZB 1O5OA 3ICWA 4ZOLB 4X66K 1YZQA 3BQMB 3SAHA 1SKRA 4IKOA 4G1VA 1C7JA 1CEXA 2EX0A 3WZ2A 2D0IA 1QHTA 5D84A 3UT6A 3HYCA 1P90A 3ELDA 5BSTA 4CM9D 1RT4A 1ATIA 4CWAA 2F4VB 3LZ6A 3OMLA 3UH0A 2ID7A 2F8MA 3MCZA 3P9QA 2PGIA 1QB7A 1SJ9A 2E87A 4Y6SA 3L7DA 1MDBA 4DNFA 3UOGA 2C78A 3N2KB 4M6WB 1IY8A 3CRZA 4NXMB 2RONA 1UEIA 2IWHA 1SIBE 3ZE2B 4AN1A 1GTRA 1GUBA 1TD9A 5LXTA 1Z5PA 5JAHA 4DWVA 2X40A 1TM1E 3ICEA 1QQBA 2IITA 1XZLA 3NBKA 1AGRA 3THYA 3KD3A 1UKVY 1T36B 3FPKA 4O1MA 3WL4A 4DUZB 5ALSA 4OMFG 4PXYA 1KH3A 3L02A 4Z6KA 4M89A 2Q9AA 2CBXA 3ADPA 3AR8A 2FMTA 5KWVA 3QYAA 2HFKA 5AOVA 2V8BA 3MWFA 1KZ4A 4IIJA 1V16B 1VCIA 3DM9B 4A8JB 2W8BA 3T94A 2YZGA 1NL3A 1SCUB 5KHLB 1DBVO 4K05A 2ZVJA 2YW9A 1OXVA 3QWAA 3VMFB 4RHCA 1PCXA 4G63A 4B3MB 5KJ1A 1Z2DA 3KFVA 1UEXC 2AXQA 4KG7A 1H4VB 1U5BB 4G4GA 3SDZA 1NKVA 3COZA 1UEJA 4CEHA 3SX4A 1YJAA 4XQ0A 4DR1B 5M29A 2FBTA 3V1UA 4TX1A 4IIGA 3KJQA 1J06A 2ZWMA 4JT2A 2ENWA 3LQKA 3OT1B 4Y1GA 1X1TA 3QPBA 2BFFA 1S5JA 2CV0A 2I6GA 2CLSA 3NV7A 4ARBA 1TUGA 2ZWVA 3NBMA 3L7CA 4EM6A 5IABA 4LMBA 4HFNA 2ST1A 5JATA 5P8WA 1EB8A 1LI5A 2AE2A 3ER9A 4ZTUB 3G6WA 1Q22A 3A32A 1OMOA 1YACA 3OY2A 3M4NA 2QZZA 5I9BA 2RH5A 4UUBA 3DCYA 5LA6F 3VESA 1CZHA 1NNI1 4FYMA 3R9XB 3WWCA 2JEOA 5FB3A 4EYKA 4BFWA 2OHFA 5F0XA 5WRFA 3AOEA 3GE1A 4FX2A 4KXXA 2P90A 4GC9A 3WZMA 4O4HA 5I7SA 2R6GA 4UM9D 1R7RA 2QV7A 4MR7B 2Z6QA 1RT2A 4HRYA 1HLUA 3UWSA 1WZNA 1DKOA 4O4IA 1WMFA 4X92A 4L6AA 5BOSB 2Q5FA 4Y67A 2BCGY 4D41A 4PGGA 4IYRA 3T52A 3L43A 1TCBA 3JYPA 3SJHA 1H6CA 2J9FB 3PJEA 4Y1FA 4OM7A 2X0JA 2HA4A 1Q1EA 2QL9A 4C6TB 4CM5A 4LJ4A 3GPBA 1Q1GA 4RG8A 3L2VA 1L7EA 3PR3A 1ZBLA 2Q28A 2ZQZA 2YRFA 3NVMA 1N2HA 2RB4A 2OXRA 2ZTSA 2A4MA 4BVJA 5ICCA 2BP7B 4A62A 3QNUA 2NZVG 2H7YA 4MV0A 1V1JA 1E2KA 4NB4A 4MYTA 1EFDN 5DHPA 1G55A 1YL7A 4R2WA 1NXSA 5CURA 3UB3A 1BAPA 3MUFA 4D02A 3UMSA 2PYJA 3TR5A 4BIIA 5KIAA 5EWJA 4DJAA 3WBFA 2ZRDA 3I83A 1Q18A 3S70A 1ZFNA 1DT3A 1FNDA 4JR2A 1C0UA 3B7GA 4OJYA 1Z22A 2CHVA 5J2TA 4YRAA 3VEWA 1GCIA 3GFQA 2Q3DA 4CF4A 4TKUA 2I5PO 4FW2A 1L8XA 4KP7A 1UOCA 3NTQA 4CKWA 4NP6A 2EG9A 1UT5A 4BE0A 3AJ9A 4RKQA 4Q12A 1O58A 3BWCA 3CMEN 3DPUA 5F3DA 3KSMA 4OP2A 1MTOA 3UUWA 5TC4A 4K9QA 1YB1A 3ISJA 1D1SA 2X0KA 4EEXA 4PHGA 1W2GA 2R7NA 1NJFA 4GM1A 3UEOA 5EOYA 2FWRA 3OZBA 3E05A 2KBEA 2R4QA 4OSPA 2O2DA 2OLEA 2WYOA 4LXXA 4V3CA 1KAHA 1E96A 4Z3OA 4GM0A 3LUPA 1TVEA 2HF2A 4YACA 3IMCA 3MXJA 4F5WA 1M6NA 1IZ0A 2BGKA 4Q9JA 4K40A 4QXOA 3L79A 3DV2A 1P6QA 1NBWA 3UB2A 4B34A 3SXJA 1ANKA 3ENZA 4Z54A 2ASOA 4X44A 4ZAWA 2OWDA 2PV0A 3DOLA 4DBZA 1KAZA 1NKEA 1VE6A 2YCBA 3KKKA 4DQSA 1YVEI 5KOJA 4ZCMA 5IT4A 3AVWA 3AT1A 2Q45A 1RQNA 4CJ4A 5H1SQ 2O8BB 4MW0A 1UZLA 1U1GA 5SY4A 4WH0A 3LRPA 3GJ5A 1FQWA 5BT8A 5BWMA 4UBIA 2I9KA 3LA6A 4GVPA 5T4FA 1Z5NA 3WGHA 4BS9A 4E89A 4K8ZA 2AYZA 2SKCA 3ZZMA 2PLNA 4I9QA 2XKAA 5DEIA 4XDHA 1UA1A 1FLDA 1Y7LA 4LECA 1NN1A 1HK7A 1EIWA 4H35A 2VDJA 4GPEA 1O9BA 1RWKA 1T26A 2VAWA 3L49A 4U2EA 1XHFA 3ZT4A 1JLLB 1Y8CA 2O1EA 4LF6B 1U99A 1Q1BA 4KU4A 2J5KA 2RE2A 1BGWA 2XGOA 1U8YA 1UKYA 1LQ2A 3ZD9A 2C29D 2WSIA 3ND6A 4X1OA 3H17A 5BYBA 4QXAA 3OURA 2B1IA 4II7A 1V6AA 2EEZA 3M1IA 1Z25A 2W2PA 5GPBA 4QJ4A 4YRRA 5I7AA 4QD3A 1A5TA 1T91A 4RW9A 1G21E 3RV3A 1LJLA 3C3WA 5C51B 1D6JA 2GCEA 3HYSA 5JI2E 1T3ZA 3LPUA 5BN5A 5IH7A 1BA3A 4Z4EA 5BV8A 2C1EA 5KVVA 2V51B 2HMVA 3DNPA 4BNDB 1E2LA 2O4IA 3L1KA 4ENVA 5HOQA 4XUDA 1T1SA 1GN8A 1KY2A 2W48A 3NDRA 5BN1A 4YDQA 1DC4A 3JQ9A 4RHEA 1EQAA 5K4GA 5KTQA 2HOEA 2DR0A 4ZAZA 1POWA 3ZS8A 2VT7A 2BFBA 4OF4A 3VTZA 1VE7A 1SNYA 3LDGA 1RSZA 1QZXA 2GK4A 3C3EA 1XRSB 2HJVA 3G79A 3L4IA 2IE0A 2FUEA 4P32A 2HA7A 4K6HA 5I7WA 3C48A 4HPWA 5HP4A 3EZWA 1G4HA 1NJSA 4TYPA 1NN5A 3WXJA 5KHOC 3FCUB 5FI0B 2Y0PA 3CX3A 4HL6A 1FFYA 3AGKA 2IH4A 4S1VA 1VECA 3P27A 4GV6A 1AE1A 4AVYA 1PGOA 5D7BA 1U4SA 3OIGA 1DE0A 5ALYA 1J8QA 5AK5A 4O1HA 3SQ4A 1G98A 2NZ8A 1PNRA 4G1EB 3L0PA 1JHUA 3D2FB 2P6UA 3RR7A 4N9WA 2BHTA 5JSUA 3CW9A 1N2CA 1TEHA 3ULDA 3OY7A 4C4AA 4PHHA 5F1XA 1E89A 2PGXA 1F21A 1DRVA 1GV1A 3P4IA 1XN1A 4I9UA 4Y6QA 3ZQUA 1AQYA 2QQ5A 1MB0A 3BXPA 3I1FA 2PWYA 3ZSXA 3ZXSA 2CK3D 1JLHA 4G5RA 4UTNA 1SHLA 1TKAA 5AUOB 4FX5A 3T3GA 4AKEA 1TI7A 3FA2A 4CI9A 3QRWA 3LF2A 2WTBA 1WB6A 3UBMA 4LI3X 1IY0A 4MQ5A 2Q3EA 2IYOA 3KKQA 2DBQA 1HSOA 4FKMA 4GDMA 4BL5A 1HX7A 3ROFA 2CEAA 1YUWA 2KFNA 4KKVA 3KB1A 5DYTA 3RF6A 4JYBA 3NHWA 1HJRA 4B7AA 2XQJA 2G1UA 3TAPA 2REOA 2XIQA 1WU8A 4FQ8A 1Q92A 4PYNA 4ZO4A 2FLWA 3V97A 4R8KA 2OQ2A 5IU6A 1AM4D 1XROA 2AUTA 3BJMA 2WLSA 2FG7C 3J7AP 3VN5A 3KYBA 2FY8A 2JFZA 1ZC6A 7MHTA 3LQRA 1RDBA 4LF4K 4RH0A 4QBHA 4TMFA 1HQYE 1L4GA 4R2MA 2VJAA 1WEKA 4IEEA 3D4OA 3P2KA 2OCYC 1QOQB 4RF5A 1UMBB 4NG4A 1YTLA 3QXSA 2G5GX 2DFFA 3EQZA 3L01A 1Q7EA 3COPA 3NM5A 4RTMA 4LOHA 3CEJA 5BUZA 4IQGA 2FSGA 4XYGA 4FJJA 5EZYB 3BH0A 1XZGA 4EYEA 2DF8A 3LAWA 1WZEA 1NNSA 4PLGA 3ASVA 5TX7A 2OOSA 2F9TA 2WUSA 1SKYB 4LA4A 1RU3A 1HEIA 3UKUA 1X7YA 1HX1A 2Z1MA 1TKDA 4TKZA 2E85A 4KQEA 3OEWA 2MR5A 3EFOB 3G8CA 3RRGA 1O95D 4X6XA 3MEDA 4FPBA 4C76A 3EQ2A 2XTMA 3OEEA 1M1UA 1XC7A 4GI5A 3LK6A 3PG5A 3LP3A 4C8LA 3OP4A 4WINA 4P53A 3JQ8B 4X60A 1WS6A 3JRXA 3VENA 2QI9F 4NENB 2QOEA 3GPDG 2C8VA 4TLAA 3PKZA 3TW8B 1XTQA 3B85A 1RT6A 3LBYA 4OL9A 3O9VA 4Q1BA 3LBFA 3HUTA 2JLZA 4QYIB 2Z8ZA 3EXAA 5KWSA 4H7DA 2RH4A 3RUDA 3ACCA 3KYDB 5DCUA 1CRZA 2RN2A 3O3FA 3O0DA 1BCRA 2R79A 2WF5A 1WBJB 1EP3B 1LWFA 4EDHA 1E3LA 2YVAA 4R7TA 5JJCA 5BREA 3MRSA 5LCXA 2WA2A 4PLYA 3CM0A 5FWAA 3OOWA 4C8MA 3QOYA 2QAGC 3HSKA 2X7JA 2W9XA 4M9QA 3EE8A 3H1AA 3MBIA 4DR5K 1DKUA 4A2CA 2P6OA 2FE4A 4GGMX 4GICA 1JLFA 5CU7A 3RAGA 3V2IA 1WCWA 4CM9A 5DK5A 1YRAA 3FW1A 2B8EA 2D5CA 5C8YF 4GX0A 3MT8A 1J23A 1RGIA 4OV6B 3AHGA 2V7BA 4H8KA 1RYFA 1GPYA 4BHTA 4NESA 2FSIA 1E7MA 4ZHQF 1Y63A 3QW4B 2CJFA 1OBFO 2ATQA 1J00A 2P0YA 4GEKA 4NQRA 1W88B 3AFGA 1G8AA 1OBHA 5CK5A 1VSDA 5IKEA 1HRKA 4R01A 4P5EA 1VL2A 1ULHA 5DV9A 1SXJE 3BS4A 3A8YA 3PA8A 1YQWA 2OFWA 4RPLA 2J6HA 3PHLA 5JVDA 1L5ZA 1Z2NX 1C1HA 3WL8A 1DRUA 1GOCA 4ARZA 4EIWA 1YRYE 1IM2A 4M53A 5FR1A 4DQUA 2AXNA 3HZZA 4QFCA 1HPZA 1QXSA 1QTNA 2FPSA 3DE0X 3RVJA 4EY4A 2ZT8A 2IHNA 4AT1A 3UE5A 2F1JA 2Q4RA 3JSAA 3MS4A 4TMKA 4YA6A 1YVDA 2I99A 2PZGA 3ER8A 4TKMA 1JR4A 4WN9B 5HBGA 2P6PA 1QNFA 1WOQA 5A2GA 1YJCA 1N0UA 3V6DA 4ZDKA 3OWHA 4LVNA 4OUDA 1S8AA 3CXUA 2R6R1 5HM6A 5D51S 4O4JB 3P9IA 3JTEA 3QJ5A 4F46A 3PQ6A 4O59O 3NVKI 4K0KB 1KGSA 1KAQA 4YQZA 4TUYB 5JU6A 3F7TA 3SMVA 2HSGA 1JNYA 1O6ZA 1XQ6A 4KXNA 3MQFA 1JFSA 3MEEA 3ZXIA 3F98A 3OIDA 4B3TK 2JDID 4WX2B 1SURA 3B13B 3OBIA 4NDAA 5HM8A 3JZAA 1GCAA 2X3YA 1WB4A 1PR5A 2IH5A 3GFPA 3PITA 2GM4A 3TSPA 4PE5B 3U62A 2O2HA 1STOA 1OLSA 5KTMA 3OYNA 3O4QA 3ZSYA 5ILQA 4A92A 1OYVA 2XUJA 4XGRA 5IJZA 3RWUA 2VNJA 4I5DA 1Q8IA 3Q0EA 1WXGA 1PD1A 3MFYA 1O94C 2NTYC 1Z36A 2R8PA 5KO2A 3VX3A 1Z0KA 1XYYA 4L3OA 3E9CA 3VPBA 3WJ2A 1XLVA 3NTXA 1UMCA 2ZD1A 3S1AA 4PLCA 3KALA 2B99A 1DV2A 3DEJA 3TAQA 3ZWKA 1VLZA 3O4IA 4FJ1A 3ILYA 2PH1A 1KY4A 2WAOA 2UZAA 3QX3A 4HNSA 4QHYA 1ODFA 1ZONA 2AFHA 4PHFA 3UGKA 5KNCD 3W4IA 3CVUA 2XLCA 2GF0A 4FFMA 1ORVA 5KJCA 2X4GA 4R1SA 1KWKA 2PK3A 1DXOA 3AERB 3ZGZA 3WA7A 2AG1A 3BSYA 1NI3A 4G8BA 1UJ2A 3S40A 3IUJA 2YICA 3MLEA 1RDFA 3ILHA 4EUNA 3IUCA 1VYUA 4U4AA 4CJWA 3N8IA 4JB2A 3C14C 2X5JO 2EX1A 3AEYA 2JA2A 3WBBA 2BTEA 4JBYA 5GINE 3B5IA 1U1FA 2J0UA 3DO5A 3FWKA 2PKCA 4ZV9A 3AA2A 4CEZA 1V7PC 2QTDA 2JCSA 4EF6A 3I72A 5AH0A 4OHYA 5C8ZA 2AJCA 1R59O 3ZWBA 1J1UA 1QOPB 3ZWOA 1R6AA 2ZS8A 2HKIA 3K35A 1GIAA 1AZLA 5J5CA 1MX5A 1LLQA 4EL5A 3UPDA 4C4PA 1O7JA 4R2LA 3L1UA 3RM3A 4C7OB 2WM3A 3TRFA 1E5TA 5C0OE 3ESYA 5G2OA 1K6YA 3TCXB 5AQ1A 5LZ4A 3C1AA 4UFNA 4LWOA 1YF3A 3FMIA 4TWZA 4RVOA 3OPMA 1F7UA 3P96A 4KK3A 1UWLA 1CB7A 2W6ZA 1OXUA 2OAP1 2XXJA 1U6JA 2OPBA 1R8XA 1CS4C 1UKCA 3OC0A 4HVLA 4BYMA 3PO5A 2JGEA 3OCVA 2BEUB 2Z6UA 3ONEA 3MTIA 4JFRA 3CUTA 3NETA 4KZPA 3HP9A 4M0LA 4AUEA 2FPPA 1DJOA 1IY9A 1T35A 1NE2A 3TDMA 2ZJPL 3VU8A 2FEOA 4F3YA 5AFUA 1RBQA 5K0TA 4FONA 3ETNA 3EAGA 5B1YA 5L3QA 4FLYA 2XGGA 4LSZA 1R37A 1S1XA 4PZ9A 4R2JA 2D0OB 1S2MA 5C81A 4A16A 3LPTA 1XKXA 4E1JA 1L7NA 4JOQA 1LC0A 4IIEA 3E0XA 3WRWA 1X1RA 4MQ3A 5KOHB 1KR5A 2WR8A 2WTAA 1NDQA 1FYEA 1V9SA 5CR4A 5GMOA 4TMWA 2I29A 4PWYA 3IE1A 4WHMA 2NXNA 4JC0A 4K9OA 3M34A 1LWCA 3PEYA 3KAPA 3PD7A 5FQOA 4RWEA 3U44B 3IQZA 4M22A 2JJQA 3PHGA 1AZSC 1RJGA 4F9FA 4YUWA 3VU9A 2C96A 3RMCA 3OOHA 5E6SA 1WETA 4D9GA 1X8LA 2GAIA 1BH2A 5LQAA 2HCRA 1WXQA 5BQFA 2XH8A 621PA 1OX5A 2H3EA 3SZ2A 3QFCA 2O1SA 4QU8A 5H59A 2ZR9A 1BS9A 3DEZA 3RJ5A 1E3IA 4Y2UA 3B6MA 1U0NA 1Z37A 5J23A 1U2SA 4XJXA 4MGHA 2FJ0A 2WFZA 1LI7A 1XV5A 4HMPA 3ZWMA 3P2IA 4R9NA 3O9SA 1GZHB 2XT0A 2C9CA 4K8XA 1QVRA 3P2MA 2Y1WA 1PUJA 4MQFA 1OFUX 4RD0A 2B8WA 2GVZC 4GR4A 5ECWA 4BCDA 4BO0A 4XSGA 4AKTA 3KELA 4ZYLA 4Y1CA 4BRFA 1ACJA 5KQPA 3H46O 2A7QA 1F0PA 1JKXA 3CVOA 3S28A 1GQQA 2ID4A 5IYZA 3GHHA 3FDXA 4X20A 2I3DA 1Z6YA 3AHFA 5AKYA 5AZIB 3LKZA 2X0FA 1L4FA 4H77A 1MN6A 1V3QE 2BJVA 2ZJZA 4QASA 3GLGA 5TSDA 4AZ0A 3ANYB 2O8VA 1VLMA 5AR1A 3HB9A 5FOUA 3MQ4A 3I53A 1G9XA 3L4JA 2VNAA 3Q7BA 4N18A 1YCDA 3RV4A 4DLNA 4H27A 5JFGA 4QXQA 4Z5XA 1DNPA 4UHEA 1JN0A 1XXLA 3LA8A 1W52X 4RQAA 1MIHA 5BN9A 5L6LB 1Q0UA 4ARCA 4YALA 1CNMA 3WBKA 1SL1A 2OWEA 1HNNA 4WOBA 2X6NA 4ILKA 1L5GB 1C0TA 1QPZA 1M1YB 3EC1A 4CJFA 3OU7A 3JXEA 3R6GA 4M7RA 4HDNB 4D9BA 1PT6A 2O5VA 5M1OA 2PRZA 3ZDQA 4QA9A 1Y7TA 3FSRA 3BA1A 1M8KA 1K6JA 3R4CA 5D7NA 3AARA 4Q48A 4WQ4A 2OFPA 4B4VA 2C1ZA 4LF9K 4QQNA 1BQ3A 4PZ0A 1XZHA 1QFXA 4C8KA 2HJWA 4KX5A 3FNBA 2QVCA 3S3TA 3PSFA 4ZT5A 1GNVA 2F4NA 2OBFA 3NF7A 2IZ0A 2E3JA 4L5YA 2J5QA 4DBLC 1BCSA 3PQ4A 5HRRA 3IPRA 3PC8C 4GMHA 3R0XA 5BMVF 4TLDA 2OYCA 1V41E 5COAA 4HPXB 3K1YA 1ZRSA 1LDMA 2BYTA 1Z8FA 1SD1A 1GUYA 2PPVA 4IDOA 3ZSOA 4GM4A 1CF2O 4G0PA 3HCPA 5A9TA 3COJA 4OHBA 4IJUA 2HNBA 4BKRA 4FCTA 4O4LB 4G0MA 4KIJA 4EFNA 2B9EA 5DYYA 4GBMA 3IKVA 2H48A 3RJZA 2ZU6A 3FGPA 2FFBA 3OMWA 2X2FA 4Y2SA 2P2DA 4H6WA 4O2LA 2CK3A 2QENA 3EEBA 4PX2A 3E9DA 4YY3K 1O6CA 2R6JA 3MVEA 3ELYA 2FMIA 4QYSA 4WIAA 1K8ZB 1EUDA 1IBLK 1F12A 1RQ2A 2PYLA 4B4DA 2AN4A 2Q4EA 4V0NA 3SC6A 3AUUA 3I5MA 4ZI7A 1TF2A 3WLPA 4GKAA 5FFMA 3GFVA 5G02A 2AEFA 1JB9A 2JHGA 3CEHA 2AJBA 1J0EA 4Q00A 4GV9A 4IQ0A 3RR8A 1JIQA 4D4LA 4HKTA 4YT5A 1LS1A 3GEBA 1KEKA 5EE1A 4F85A 1CERA 4OQEA 2CMHA 1NBME 4ECEA 1SMKA 1XDGA 5JPDA 3ZNPA 5BSHA 2PRYA 2WQ6A 2QG6A 5KEIA 1DLJA 3EX7C 2C8KA 1N78A 4EGFA 1LSUA 1QBGA 4CMEC 3M1LA 3L8HA 1Z0DA 5B6IA 3L2WA 1S1CA 1J20A 2P69A 2CSUA 3L8DA 4OPKA 2C9ZA 2VXCA 4KQ9A 3CUUA 1PQPA 3ULEA 1OVMA 1S8NA 3JQPA 1O95A 3FHJA 2I4OA 2ODWA 4BZQA 2X6TA 5C5EA 2C07A 4E07A 2UZ4A 5LB4A 4QFBA 3D6VA 3FPJA 4F56A 1TK9A 2Y68A 4NYJQ 4W1RA 4BFLA 4BMZA 5AJVB 1WF6A 5TVGA 2VCEA 2HRCA 1MF7A 4ML3A 1HGXA 1CUZA 3K2QA 3RSLA 1OZ0A 3NH2A 1UBTS 3PZBA 2QX4A 3NFAA 3NM6B 3PL1A 2G8HA 4B9UA 5SZKB 4YVFA 3HABA 5TR9A 2IRWA 3LW7A 4JGBA 4X85A 4U39A 3V81A 4HYTA 1AXGA 2MMCA 4NJEA 4GMKA 3HY3A 4FPAA 5EIFA 3RC2A 4JI8K 3CB4A 3CLKA 4KAFA 4PGHA 3THXB 4I4LA 2AX4A 4WRRA 4W1SA 5EIBC 4FGKA 3UHAA 1C8BA 4C7JA 1CXQA 5HZMA 3AW8A 4GR9A 1B93A 2W43A 3A1SA 4JL8A 5DYGA 6Q21A 2CFRA 1RWQA 1L8OA 3BIOA 3T1AA 3N0TA 3NQ41 2VTBB 4UEQA 4YCNA 1A9PA 2AG0A 3TW6A 3FR8A 1G6HA 4MWSA 4BV9A 3EGIA 4H3KB 3MJTA 4C7VA 2WJHA 4Q3EA 4XSHA 3KG2A 4DSTA 2LKDA 3FWYA 2BT4A 1NMZA 4R1MA 5TKWA 4WK6A 1ZN9A 4P7GA 4DFDA 1ODKA 5SZTA 1MQSA 4D4MA 2EX3A 3PJRA 2ORYA 1N77A 4HLQB 5DX0A 2QUAA 5EP1A 3LBHA 1LRJA 2D2EA 4NG5A 2I6TA 4BO6A 3RVKA 1W30A 1DTTA 4UDYX 3KZOA 3IP8A 3CMCO 1Q1AA 5IANA 4DCGA 1SVIA 4L3QA 4B1VA 4J91A 2WJYA 3PGXA 2LCQA 3KLHA 5KKCA 4M3WA 4QELA 1CEEA 4B9TA 1NVKA 3HPQA 2GZAA 5CT6A 1K5HA 4AF7A 1M6VB 2EFJA 3PXDA 3FJYA 4PZZA 5FCDA 3TQOA 1I10A 4EY8A 3QJGA 3OQPA 3HUDA 1V7CA 3WGTA 3H42B 1TKBA 5ESRA 3FBWA 5H7XA 1DWPA 2JDIA 4KNYA 7YASA 3KETA 3PC7A 2JI6A 3UGQA 4G56A 3HBAA 5H80A 2ODEA 5FL7D 3H18A 4BYGA 4Q34A 1IHOA 2BGMA 2BF4A 4XE5A 4FOLA 4FXDA 5LMZA 3UTDA 1EE9A 1I3MA 4WKGA 1S1TA 4CFCA 1RE0A 3WLKX 4MKFA 1D0SA 1UDWA 3ZE6A 2O7RA 4AF6A 1PT5A 3NBYC 5E6RA 3W4KA 3OBBA 1S89A 4X1IA 3RREA 1M5RA 1SCNE 3AUJB 1L2TA 2QVZX 3PDWA 2AN1A 3AHEA 4RTJA 4L9SA 5KNCA 3HI6A 4MV8A 5I9IA 4OGWA 1JJAA 4R2XA 1L9KA 5HRPA 1OXSC 1POXA 5L40A 3SCZA 4P0QB 4W6QA 5CFPA 4E7KA 3FSEA 1EG2A 2SNIE 1Y80A 3GRZA 4RHXA 2YMPA 1WG8A 2C20A 2C8LA 2XQGA 3X2EA 4RYDA 4E51A 4EJ2A 3QVMA 5FPDA 1KVTA 4D92A 3RADC 3JQQA 4K6OA 3VPDA 1SHZA 1WHSA 2C9BA 5DK6A 4A23A 3HH8A 1AHHA 1F2DA 2RGEA 1JJIA 1NVDA 3M8RA 4EKDA 4JJ6A 3AVIA 1FLAA 4B6OA 2XMDA 4PPQA 2V03A 2CXOA 1T0JB 4NF2A 1IATA 3PPWA 5IBPA 1RRKA 5MN5A 1E61A 4PHCA 5KQLA 5HBMA 4BLVA 3ZY4A 5DCYA 4KUEA 1AF4A 1BROA 1ZM2A 3GZNA 3CYFA 2ZE6A 1I14A 4LYDA 1JFLA 3WNHA 1VLJA 1K7XB 4D8VA 3ENHA 3I1JA 2J0VA 3H6HA 1GCGA 4JI2K 2MWMA 3D1JA 5DM0A 3WGMA 2X9GA 5ETJA 3GA0A 5TGDA 2D7DA 1WV1A 1KDRA 3PFWO 1V1RA 2FI1A 4DYHA 2VJQA 4HS4A 3I4CA 4E6PA 4IHJA 1THZA 3WK6A 1QHFA 4LRWA 3LXUX 3O3CA 3W1WA 5A71A 4YLYA 2MSEB 2ZRGA 2A3RA 3CX7A 5AQNA 4BASA 4M36A 3SBTA 3EH1A 3KSDO 3OA2A 1GUDA 3R8CA 3Q3HA 4TYYA 2ONJA 3BWVA 1S22A 2GZSA 1XU4A 1B6GA 3JD0A 2ZWPA 1DI0A 3Q41A 4E88A 4KQKA 1YF5L 5AKZA 1UMDB 1VHTA 2RGDA 4BQIA 4ALIA 2OD7A 2FBVA 3DTNA 4X7RA 4YRZA 3K32A 2PLFA 4F5ZA 3CLRD 2IC3A 1R0YA 5GONA 2JJ8A 4G6ZA 4ZQHA 5HF8A 3DL4A 1QHHA 4TWJA 4IFEA 3HOTA 1AB5A 3AVAA 4CIGA 3WGYA 3DOUA 1CQWA 2GUPA 4H03B 2UXBK 1A7KA 4Q3BA 5BOVA 4BN0A 2O2IA 4HXGA 2XKJE 2HYDA 2B36A 1QRRA 3DZ8A 2QR2A 5AMXA 4BX2A 1HLDA 2YWFA 4IZOA 3AUAA 2XBLA 3WB0A 4LC9A 1NJ1A 3ME5A 5FADA 3NHGA 4FW8A 1GITA 4JOCA 4IZIA 1THGA 3KWIA 4DCCA 5JECA 3RRFA 2Z98A 1N5OX 3GAMA 1GJRA 2B6NA 1ZQ1A 4K9PA 2QRVA 4HEA6 2CFOA 1ODTC 1VFNA 1LW7A 3VQ8A 5EUBA 5LZ2A 5FDLA 2FTKE 5DGCA 1I1QB 2YJ5A 3AH8A 1EUZA 5TY0A 1Q21A 1ZK2A 1GLLO 1ARZA 3DHEA 3AVCA 5B30A 3IMGA 3QK7A 3AF2A 2JL1A 3I09A 3S1LA 3P4UA 5HUQA 3DBRA 3DEHA 1HURA 4WWHA 4R71A 1VCHA 5BYKA 1NP6A 2KPOA 4KE6A 3AEKA 1HQDA 3WTBA 4J2AA 3A3PA 4DLBA 3NAZA 2D54A 4M7WA 3WYEA 1QHIA 5C37A 4AQYB 1OB5A 2VNSA 3TXYA 1W5AA 5K0ZA 3PUHA 2ZUUA 4HSGA 3T1HK 1BD3A 3RNOA 2DFLA 4PQFA 2JGNA 1MHPA 4JJFA 3MAAC 4FR5A 4PLVA 3F67A 3NBAA 3DB2A 1IQ0A 2GFHA 2FG6C 5KTOA 4NBNA 1IQPA 3U4MA 1XHZA 1Z83A 2E1PA 4M3RA 4REOA 4E5VA 1GL3A 5BURA 2ZJ8A 5FIUA 3IE0A 4BVLA 1YMQA 1GZ6A 3H2GA 1JZTA 1JEJA 5EKXA 1I51A 4DCVA 3DZJA 3K72B 1WV0A 2P9NA 3EBOA 8ABPA 3ZIUA 1ZDMA 3JQDA 3KK1A 3PVZA 3KRTA 2DETA 2OYRA 5AK6A 4QG7A 1KI9A 4BMXA 4WNAB 3CU5A 4ZXFA 3EXHC 3BORA 5GV8A 3M3PA 2X2PA 4Q3LA 1S8FA 3HPOA 2B35A 4P4NA 2WMDA 4F4HA 4ZVPA 5E4FA 4CCSA 3TE7A 2Y9PB 5LWHA 2VTEA 2P9KB 2JLCA 4C0AC 3TWOA 4GOND 1AHPA 3E9RA 2D6FA 5EQFA 3IIMA 3GJ0A 3V2GA 1AGNA 1TTTA 5KBYA 3PKIA 1Z35A 1Q2XA 2R68A 3A8TA 3NT4A 4HH1A 1Y37A 2ZJ5A 3SC3A 2WONA 4JYCA 4ZMSA 1DADA 3PQDA 2DG2A 4ND6A 4IDGA 4URFA 4BP3A 1TCAA 3OLWA 5E4JA 1XJ5A 2QSJA 4GP6A 2IPNA 1D4OA 4EGJA 5BNIA 4TV9A 4BNVA 3HP1A 4LK3A 1EFUA 4YJDA 3VISA 4Q1CA 2P3OA 3UV3A 1WWKA 4BVEA 2RKWA 2PRJA 1R0RE 5TQ0A 4YJFB 4AXXA 4UTVA 2OV6A 1I24A 2AOWA 3Q7QA 2VDQB 3FIJA 4CR8A 3AEQB 3H2YA 3KYJB 4HTFB 4KDFA 3M83A 2O0KA 4F91B 4BRCA 2VJOA 4XASA 2HWWA 4UPEA 3VI3B 2Q5IA 4BVHA 3MWEA 3F6SA 4CJPA 1R8QA 3LWBA 1ZCAA 4FFWA 4P35A 4C2AA 1Z5VA 2IY9A 1SVWA 4RF4A 4E2WA 4QL3A 3CNEA 5DN6A 5JUWA 3WO1A 4JI3K 1CLUA 2VF5X 4BZPA <