4IFEA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with atp
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
448
structure length
434
Chain Sequence
INPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 145
structure length 434
sequence length 448
ec nomenclature
pdb deposition date 2012-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ifeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ifeA01
3LBIA 1KI9A 2JAQA 1OFHA 2VPPA 4E22A 3THOA 4PPNA 1ZNXA 4W5HA 3GLIA 1E9DA 3TIFA 1AQYA 2YWHA 2YWFA 5CM9C 1P2SA 1G21E 3PQCA 1CR2A 2PZGA 4GMDA 4EPRA 2FX3A 5A4JA 2ORWA 2WSMA 4IFBA 3K8YA 4GSYA 2GCNA 4TMWA 2YWGA 5F98A 4ZCLA 1QHSA 1S2MA 2DB3A 4KU4A 1CP2A 2KBFA 3GJ5A 1CS4C 2OBMA 4HAZA 1KIMA 4RKFA 3R9IA 1FNNA 4B34A 1KI4A 1TQ6A 1VG0B 1FFHA 1XXHB 4LBVA 4US1R 4PFSA 1D9XA 1N6LA 3CPJB 3A6PC 2VF8A 2GBLC 4B3BA 2OESA 2HEIA 4L16A 5JCZA 1OH6A 4DUGD 1KO7A 2GJ9A 1VYVA 2EYQA 1E9SA 2C03A 4XTCS 2WAYA 4JLPA 2ZRGA 1DOAA 3TSOA 3GJ8A 2FFHA 3UG6A 2NG1A 3W8RA 2ZTSA 2QTVB 5JMTA 3D8BA 1XMSA 2BWJA 1G8FA 2BEKA 3LY5A 2BMEA 1N0WA 3OESA 2W58A 5E7IA 3X1YA 3AF2A 3NDPA 2EFDB 3GJ6A 3TE6A 4Y0VA 4LCBA 2ZSBA 4AYWA 2O0KA 3FKQA 3PIRA 2QY9A 4PHHA 1II8A 4HB3A 1IXRC 1R8SA 2RGCA 3WNDA 3H84A 4Q19A 2VSOA 2C9OA 4IJMA 4UNRA 1IXZA 2NO9A 5DISB 4Q48A 1J70A 3NTUA 1GKUB 3GJXC 4BRUA 1UJ2A 1FQKA 2X2EA 5FOTA 1GFIA 1T91A 1HTWA 4GDFA 3ZD7A 4GOXA 1P2VA 1GKIA 1BKDR 1E69A 1ESNA 1DAHA 3K9HA 2R2AA 4CW7A 1OJLA 2HLDD 1SGWA 2P2LA 2Q9BA 2FA9A 3SHWA 1KSGA 3FMOB 2VYFA 5SZIA 3D3QA 1W4RA 5JZVA 4XOIA 2J59A 4A36A 1ZUIA 1GILA 1FW6A 1T0HB 1U0LA 3AP3A 1NMZA 2E1RA 1KO5A 4K46A 1H8EA 2FPLA 1PLLA 1W0JA 2J41A 2VHCA 3EZ6A 4O3MA 1WE2A 4G01B 3KQLA 1VCMA 2QT1A 3LQQA 4M0LA 4EAQA 1FTSA 1QRAA 3DM5A 4MGIR 3ZH9B 3U7HB 4GZMA 1CRPA 1G4UR 3O8DA 2ZRCA 3EWAA 3LA6A 2IEZA 3FDIA 4LRWA 4OI1A 3VR5A 4HZUA 4OI4A 3IGFA 2QTFA 5E7MA 4U02A 3FE2A 5G3ZA 2ORVA 1Q1ZA 1SKQA 3CONA 4NMMA 1AK2A 1X8KA 3S1AA 2EFGA 2F3TA 3A4NA 1EFTA 1ZU5A 3N5CA 2QAJA 2P65A 3BXZA 4FD2A 4EQ6A 1GOTA 2XNSA 2C99A 5EE9A 2ZR0A 1XJ0A 3CR8A 1KZ7B 2RGNA 1US8B 1TQDA 3QG5A 1NSFA 4RFVA 5FBQB 2A78A 4C2TA 2LKDA 3LXXA 1DAGA 4IDQA 2FDCA 5C2DA 2FFBA 4QHSA 5IT5A 1P75A 1ZC3A 3QF4A 2NZJA 1SZPA 3QBTA 4DT1A 1JNYA 2XNDD 2I1VB 4NTZA 1XTQA 3DKPA 2O0JA 4DLSA 1EK0A 3U3KA 1E2PA 1U8AA 4QJ4A 5FR2A 2AFIE 1IHUA 4D4KA 3BB4A 2XJ9A 2RHDA 3ADBA 4EJSA 2PT5A 2C9YA 4MUBA 2W6IA 4EPXA 2GNOA 4R7ZA 2OCYC 5EQTA 5JEEA 1FX0B 1GL6A 4G0NA 4PXAA 1LF5A 4BLOA 2ZRFA 3CBQA 4KVAA 3K0FA 2J0UB 3HYTA 5L3QB 1RJ9A 4LYAA 3P4YA 1AGPA 1W0KD 2ZSAA 3EG5A 5EXSA 1DARA 1NY5A 2A5GA 5IK2D 3OIYA 2CL7X 2I4IA 4Q03A 5K8TA 2JJ2A 2IX3A 3PG5A 1W2GA 5C18A 5FBLB 1KMQA 1E0JA 3PCRB 4P33A 2XB2A 2JEOA 1ZVQA 2IUSA 1GWNA 4TT3A 1XFAA 2ZS7A 3ZQ6A 1KK0A 4KV9A 4BQSA 4CYMA 2HT6A 4IRUB 4AG6A 2GXUA 3W3AA 1OXVA 3MWKA 5FBVB 1XD2B 5DIFA 5SZJA 4QBIA 2JIZD 4OJQA 4DLRA 1D2EA 1KKLA 5C2FA 1OE0A 1VHTA 1IONA 2ZI7A 3AUXA 4GOJA 1JI0A 4BFVA 4JKYA 2A30A 4JL6A 4TTQA 4D4LA 2D06A 3EIEA 2Q21A 2VL7A 3REGA 3VHLB 1QHNA 3U4QA 2XEXA 1RYHA 1XMVA 2RGGA 3SEAA 3GPLA 1KI6A 4RCYA 1XJCA 4HAUA 3AKCA 3VFDA 5FI1B 1NVVQ 1OYYA 1OPXA 2ZU0C 2IYZA 2XB4A 5JCPA 5J4LA 4DIDA 1GRNA 2QA5A 5BW8A 4US0R 4IDHA 4M1TA 3UATA 2PEZA 4LBYA 1G17A 1S8FA 2G77B 3MWLA 1KI1A 1Q1BA 3QXSA 4TWZA 3WHLA 1TPZA 4BLSA 3OAAD 2WSSA 4NCJA 3GJ7A 2YHSA 3FB4A 4XJXA 4DUGA 1YE8A 1KDTA 4DCSA 5GJBA 1TQ4A 5KDDA 2OCBA 3EZ7A 4PO1A 4MH0R 3TUJC 4DB4A 1Z3IX 3ZVNA 4M1KA 3X1DA 2GBLA 3OEED 3OIWA 3IBYA 4FXPA 4FCVA 5UKDA 1QZXA 3N70A 2ODNA 4WVFA 2QMHA 2BC9A 3N2EA 2RHMA 2JLUA 2ZPTX 4PO8A 1ZUHA 3PFIA 2ONJA 5M1QA 3KTAA 4BRWA 3CNOA 3DHWC 2B6HA 3T1TA 3X1ZA 1T5LA 2R6AA 4XSGA 1HV8A 3C41J 1ZCAA 3MMPA 3ADDA 5M1NA 2ZS9A 1E2EA 1VDZA 1H8HD 1QHXA 4MKHA 3EPLA 1CEEA 2FFQA 1NIJA 4C2UA 4DDWA 2ZR9A 4JT2A 4H1VA 5BYJA 3KUDA 3SJBA 4N0EA 4R9UC 3KFVA 3AKDA 2HLDA 2IYUA 5B30A 3THYA 3IQWA 4KITB 5JWOA 1KI3A 3MWYW 1JXMA 4OK5A 4PHFA 2W6JA 3QE0A 1ZIOA 4LGMA 1Z08A 2FEOA 4JSTA 4Q1DA 1M8PA 1KJWA 2REXB 3GJ3A 2FE4A 1R0WA 5E4FA 4Q21A 3GMTA 2GESA 1UADA 5L3VA 5JSZB 1NVVR 1GZSA 1TQ2A 4DSUA 3UXMA 1XBTA 3V00A 1E0KA 1G3RA 2XZPA 3GFTA 1IN7A 4ZDWA 4TQUS 4B43A 1AKEA 2CLSA 1XTKA 1WF3A 3W8NA 3IEUA 4C9BA 4XVUA 1Q44A 3THWA 2OAP1 4ZDKA 4EKDA 1P3JA 2EWWA 2V54A 1ZNYA 4M1YA 3MG9A 1N6NA 4KVGA 5EE3A 2WWFA 1GL9B 1IN8A 3PITA 5DLQC 1XWIA 1VPLA 4JLJA 3WNCA 2HXYA 5CLQA 3U3JA 1E1QA 2BKUA 4A0RA 4M8NE 1TTTA 1M34E 4TN1A 1N5LA 2EYUA 5AWFC 3ND9A 2F9MA 5ELXA 4BEJA 1Z6AA 2H1LA 1UKEA 1G9XA 4TSFD 4U5XA 1DTSA 2DYKA 1G291 4CEIA 5DI9A 5EE0A 4TMVA 4KCGA 2DY1A 4A82A 1ZAKA 5GVRA 4A4DA 3NKVA 5L3RA 3DMNA 3OE7D 1VIYA 4M22A 5FUVA 1YZGA 4YMTA 2VHJA 5KU1A 4PAOA 1Z6TA 2CNWA 4PSKA 3VR4A 3W6PA 1WRBA 2HCJB 2WJYA 4NE2A 1LB1B 3VX3A 1FP6A 3B2EA 1LS1A 3AVVA 3EX7C 5E7JA 3KUCA 3WP0A 1JXOA 4IEEA 4B6FA 1R0YA 5IK2A 2W0SA 2IYQA 4N3NA 4CZ2A 4PC7A 1Z0IA 2ZI3A 4F91B 1W5TA 3W90A 3G0HA 2ZJBA 1HUQA 3IDQA 2AXNA 2GCPA 2QAGB 3P20A 3UG7A 5LB2A 3U7EB 2PJRA 1XTJA 1AJEA 4AK9A 2QL6A 3I73A 4XWOA 3A1UA 1DG3A 2DWQA 4Q4HA 1LVGA 1K6MA 3DDCA 1N5JA 3UMRA 1SKYB 3MCAA 2ZYTX 5K8LA 2GK6A 1XF9A 1E6CA 5A5GA 3B60A 4LDJA 4FCWA 4YONB 2IT1A 1F2TB 3EWSA 2MMGA 5HE9A 4O25A 2JJ8A 4WA7A 1DO0A 3RS7A 2QE7A 4TYNA 3IUYA 5HR5A 1U9IA 1SXJE 4A9AA 3QI2A 3IIJA 2G88A 1FTNA 2MSEB 1Z2AA 3QKRA 3QKUA 2W0MA 1KTVA 4KJZA 1S3GA 5M1PA 4HLDA 4QNRA 3TJZA 2GF9A 5JFGA 1TUIA 2PX0A 1L2TA 2AXPA 3FFAA 2A7QA 3KKQA 3V9PA 4PSVA 2JCSA 1UKYA 4RFSA 1GTVA 2BJWA 4TMZA 2XXAB 1GRRA 1ZU4A 2F6RA 4WXPA 3EIHA 3TBKA 3AVPA 4Q4JA 4WZBE 2J5XA 4Q9JA 3VU9B 3LWNA 1SVIA 2IWHA 1KMHA 1R5NA 3SJCA 2O8FA 1NBMD 4URUR 1EXMA 2HF9A 4MRVA 4ZIRB 1W7AA 3NBYC 3LAWA 1T4GA 4B6EA 4UJ5A 4NBSA 5KTYA 4DLUA 3GD7A 3U61B 2W2TA 2CE2X 2BBOA 4GOKA 1VMAA 4A8JB 4QJ5A 4A0HA 2WJIA 3QVVA 2WWXA 1E2MA 4NKRA 5EZ5A 1M6NA 4BECA 3A37A 3CNNA 5CJ2A 5J47A 2QBYB 4C0SA 4JLBA 5FL3A 3SQXA 4C3ZA 2ZQ5A 1HEIA 4YMSA 2AK3A 1MABA 5EP4A 3AGPA 5AUNB 5FOUA 3BFXA 3C16C 5JI2E 2ZROA 2ANBA 2J7KA 1G8GA 4LC0A 3TH5A 1H8HA 3ZZUA 1LS6A 3R20A 2G0NA 1JR6A 5B57C 1KNQA 4II7A 1VG1A 3W6OA 5CYPA 6Q21A 4JVNA 2XTZA 2IF2A 4Q02A 3FMIA 4Q7LA 5KUTA 4TYPA 2ANCA 4UNSA 1PUJA 2ZRLA 1OFUX 2CBZA 2VSFA 3HU3A 4JVMA 2QM8A 4FI3C 5DSZA 3BD9A 2ZETA 4FMDB 1RC8A 4IDOA 5E3HA 3GFOA 4L4UA 4PQRA 4R2IA 1XXHE 5DGXA 4DZZA 1E2KA 1XEXA 5JLJA 2GCOA 2H57A 4DCUA 4F7WA 4M9QA 2VP6A 4LV5B 2IF0A 1ZP6A 3IBGA 4KBGA 4R71A 3EAQA 3DZ8A 4Q00A 4FMDF 4ZO4A 2D7DA 4IOKA 2XZLA 1JQLB 2CHQA 1PJRA 4BZQA 2NZ8A 5FTJA 1R5BA 2Q3MA 1HH4A 3U3MA 3P4XA 2G0TA 1IY1A 3U60B 1H8ED 4JS0A 2PMKA 4IVPA 1W0JD 2F1IA 1E98A 4GT1A 3HWSA 4MUAA 2R6FA 3BK7A 3GLHB 5KPJA 3ICEA 1JECA 1NP6A 3I8XA 2C96A 1SHZA 4PHTA 1QF9A 4B76A 1AQUA 5HPYB 4LJAA 4LSGA 4MRSA 5DI3A 2KWIA 4HUQB 4MYUA 2PZFA 2ODBA 5DH9A 4HB4A 1II0A 1YZTA 2F7SA 2XTMA 4B33A 4U7DA 3NH6A 2OLJA 3CF0A 2IYXA 4A2PA 3QENA 4C30A 1G16A 1NI3A 2VA8A 1U99A 1UF9A 4PO9A 4BFXA 3K9NA 3L8ZA 4Q47A 1SXJA 3Q72A 3QNUA 1ZC4A 2OAQ1 1WXQA 5JS7A 3ZVLA 4UNNA 5B2ZA 5F3WB 2PT7A 2SHKA 2REBA 3SDZA 4A6PA 4DDVA 3OE7A 2QGZA 1G5TA 3I32A 4LHWA 3BERA 4I4LA 1F3OA 1Q20A 2IYWA 3NBFA 3QY0A 4UXIA 1UDXA 2NPFA 4B71A 3CX8A 4EJSC 4KODA 4Q4AB 5C4MA 4BFYA 1GM5A 4O0MA 5IF9A 2BCGY 1QHGA 2JA1A 2V1UA 1B0UA 1DAEA 3VR1A 1GKYA 5CYOA 4BWYA 2W6ID 4M9SA 4MKGA 1T8UA 2GK7A 1E9EA 2BJVA 1A2BA 2C98A 2H7VA 4DCVA 2AX4A 2O8CB 1OH7A 3O8RA 2ZJYA 5IHPA 2IBMA 4Q1FA 2WHXA 5E95A 3U5ZB 4OI0A 4OBEA 4DKXA 4CF7A 4JBYA 1U0JA 3IILA 5FUYA 2IEYA 4EPVA 3K1JA 4IFEA 1LFDB 3K0AB 4Q9IA 1CLUA 1TF7A 3PUWA 3LH5A 4L15A 2W2XA 3J81k 4LZZA 4UXHA 2JATA 3HPQA 1R4AA 2JJ2D 3CF6R 4TZ0A 2CJWB 2NO6A 2R9VA 2H16A 3AVOA 4D4JA 4TTRA 1KDPA 3RC8A 1DVRA 4ILEA 3F3YA 4TT3D 1AS0A 1G64A 4LK2A 3T34A 1L7VC 1E94E 3B5JA 4IEIA 3CWQA 4NYMR 2VIIA 4QFMA 2NTYC 2IA5A 2OLKA 2WICA 2C77A 3E2IA 4HLUC 2Q6TA 1JBKA 3CRVA 4NCNA 3T12A 4LJ8A 4OQFA 3UMFA 1DAFA 4ZCMA 5TXGA 1NMXA 3VTKA 4FW9A 4A2WA 4MYHA 4RVCA 2TMKA 5KNBA 2ZRIA 3RRYA 1Z0AA 2F43B 1WCV1 3OHMA 4I81A 3ZGXA 1I4LD 4EDHA 3MD0A 1Z0FA 3O8CA 1KY3A 2ZRDA 3A58B 4A15A 3KDSE 4ZI2A 2FFAA 4NONA 2WJGA 4DRZA 2CXXA 1NBMA 1TMKA 3CZQA 1SHKA 2Q3FA 3KKMA 1DAMA 2UZIR 4S2EA 2NO7A 1Z63A 2ZE8A 3C6AA 2ZS8A 4KSBA 1CJTC 2D3WA 4C0KA 2G6BA 1GVNB 3C6HA 4A92A 3G5UA 2RMKA 1PLJA 4PR0A 3LBNA 3RS4A 1S0UA 2J3EA 2O8DB 4TYWA 2WZQA 2JDIA 3LD9A 5G40A 2QMUA 2HYDA 1V5WA 3CH4B 1NLYA 2BMJA 2OT3B 1W5SA 1G3IA 4RKEA 2B7BA 3SR0A 1WBBA 3TLXA 5KOYA 2NIPA 4FCTA 3PJRA 2WSSD 1CR1A 3CNLA 1BYIA 1T8TA 1UEIA 2ATVA 4P4SB 4ERNA 3K09C 3DO6A 4TLBA 1JPNA 4D6PA 1BYUA 2YKGA 4JLKA 4QHYA 2LCFA 4URYR 3GP8A 2BBWA 2JLQA 2KE5A 3WMEA 4AC9A 4RD1A 5EJEA 1P2TA 5TMPA 3GLIB 5KO2A 3CPHA 3FKSA 3CZPA 1OLOA 1MH1A 1QG2A 4RSGA 3QPUA 4CGZA 1KKMA 2O52A 1MOZA 2WWGA 2CVFA 3KXLA 4CVNA 4Z8YA 1XEFA 2GVDC 3KKPA 1N6PA 1G6OA 1Q3HA 3KJGA 4G5GA 2ZM5A 1F6BA 4TYQA 1ESMA 1P61B 2P5SA 4IW3B 3FMFA 4TLAA 5AR1A 1ZUNB 5A0FA 4P32A 1X8LA 121PA 3VX4A 1G41A 4W7SA 2Q9AA 1VG9B 1DELA 2ZU6A 5C4GB 3U6KA 3RRNA 1ELOA 2PJZA 4FIDA 5G41A 4NZYA 2ZE7A 3OIVA 4QM6A 2J0SA 1R0ZA 5HTKA 1QHHA 3WYAA 3TSWA 1E0SA 1N6IA 2H92A 3FHOA 5CK5A 3C14C 4LWZA 2QORA 4B3FX 4LJ9A 2W6JD 2Z83A 4QBGB 1IXSB 4OL0A 3NDBB 2FSGA 1CR4A 2ONKA 4PZYA 3ECCA 4PAQA 1ZCBA 4DJTA 2GTPA 4K81B 4AD8A 4ESHA 4LHZA 1NVXQ 1E2JA 1ETUA 4OYHA 1OB2A 4B3DA 5DHFA 1G7SA 1II8B 3OZXA 4DCTA 2D4HA 2ZJAA 3P1JA 4V0LA 5FR1A 2X8AA 1KI2A 1IN6A 1JAIA 5BWMA 4BLRA 3SI7A 1TNDA 5FPHA 4CT5A 1IAQA 4ITRC 3WY9A 4C0BA 3PEUA 4G5RA 4IVRA 1BMFA 4OI2A 5FL7A 4OK3A 4I99A 4DLWA 2R6CA 2R62A 4GPTA 2ZVPX 1RZ3A 2WVJA 1SVWA 4BLTA 3K70C 2VH5R 3LW8A 3AVTA 2BHRA 1KJYA 1N6HA 4PTLA 1VIAA 3TK1A 3VR6A 5LDDC 2ZEJA 4WZ6A 5J4HA 1VCIA 3BFKA 1F48A 4KO8A 1E1QD 5FI0B 4CEJA 1PZNA 2OILA 4M1WA 3K70D 1XTIA 2AKAB 2O8EA 4HSEA 4NCIA 1A4RA 1J7KA 4G5QA 2EFHB 2FZLA 4BUJA 3LO5A 4ASUA 3W5JA 2WKPA 4B2PA 2RGBA 1Z0JA 2J45A 3ZDQA 3WRYC 1SULA 2NMVA 5IDVA 2MSDB 4HZUB 5AUQA 4D0GA 1G3UA 3IQXA 1D5CA 3MSXA 4B48A 1M7HA 1Z0KA 4LJ6A 3REFA 3U7GA 2CNWD 3S1AB 2ZAOA 2BBTA 3LX8A 5GJWC 521PA 2VP9A 2WPDA 4Q5IA 2BMDA 4P31A 2CDNA 1IJEA 3E70C 4EQ6B 1E0AA 3ASYA 1Z06A 3LVRE 4RZ3A 2J0VA 1Z8FA 1ZD8A 2OZEA 1Z6XA 1CIPA 4FINA 1KI7A 2P3SA 4JT4A 2WWHA 4AYXA 2CCJA 1OFIA 1EGAA 5JWRA 3UKDA 3OEHA 1XZPA 1N5KA 5J4VA 4LJ5A 3SZRA 3QF4B 1OXXK 4PZZA 3R9WA 2FNAA 3PR1A 4ARZA 4DT1B 2FN4A 1CXZA 2GETA 3C7KA 2NPIA 4D0NA 4URZR 1OF1A 4FMCB 4MRPA 2H17A 2QN6A 4AI6A 4RD3A 2ZRPA 4KYIB 1Z83A 2PH1A 4AKHA 4EJSB 1U9IC 4A2QA 2AR7A 1RKBA 3DOEA 2V4ZA 1YZKA 1DE0A 3T5DA 4FMCF 5FPTA 4HLUA 4TMXA 2EQBA 4XD7A 1Y63A 3KKOA 2QE7D 4XWKA 4M53A 3K0FB 3RRZA 1P9NA 2YNMA 3ZQJA 1RJ9B 4KSCA 4Q9HA 3AKYA 1NMYA 1NVUQ 1TX4B 4OQXA 4DLZA 2GAAA 3GJ4A 4HDOB 4QG7A 3KB2A 3UMSA 1KK1A 2F1RA 4DLYA 5FH9A 3VNVA 4X8LA 1HQYE 1XMIA 3EA5A 4I1UA 3I72A 2DFKB 3WMGA 3Q3JB 1HE1C 3RS5A 3R7WA 1CRQA 2QSZA 3T1VA 5C12A 2NQ2C 4JMPA 4C7OA 2CE7A 1SVKA 4DIEA 4YLGA 1CTQA 3QKSA 3TW4A 3PEYA 1R7RA 1U8YA 2YOHA 2OFXA 3RWOA 1RVDA 2GZAA 3GLFE 2QT0A 3RVBA 2A5YB 3KXKA 4DDUA 5H1YA 4YC7A 2QPAA 1E2IA 1W49A 5JI3E 3KL4A 3K09A 1R10A 3HR8A 4ABYA 2R8RA 3NXSA 3ZIAA 3U4QB 1TUEA 3I3SR 2PCLA 3RNLA 4QOSA 4RCZA 4QGGA 1Z6GA 4YXWA 1M7BA 2YVUA 3EASA 3LFUA 1KI6B 1M74A 1M2OB 1NF3A 1X1RA 1YR7A 2CHVA 1OV4A 3AQ4A 3AP1A 1W1WA 3BC1A 3I92A 5D3MA 1COWD 2ZAMA 1G5RA 1MO5A 1TF5A 3CB4A 1TF2A 3P27A 2AHOA 1O87A 2BIFA 2ODEA 4LJYA 3IIKA 3GLGE 2ZI4A 4D80A 1E9CA 1IN4A 1R6BX 3L0IB 4ZI3A 4Z8XA 1E79A 5KDOA 1ZJ6A 3DKVA 2FEMA 2HDNB 2DR3A 5HKKA 2G1JA 4D25A 2RGEA 3A1SA 1KO1A 3E5HA 3EIQA 4X8MA 2GJKA 4URVR 2WIBA 1JR3E 1TU4A 2VHQA 2WKQA 1MRSA 3SNHA 5L3SA 1OH5A 4M1MA 4U00A 1G8YA 1VCNA 5JHGB 2IYSA 1GNPA 5FOWA 2WWWA 2DFLA 1EFHA 1DO2A 1O3YA 2BBSA 1DS6A 2IHYA 5AJZA 3VNUA 1AM4D 3EPKA 2FZ4A 2WJHA 2X2FA 1A82A 3C5HA 3F5FA 3I1FA 2EFCB 2ZRJA 5EXPA 1QVAA 1DADA 2FWRA 4Q9LA 1FMLA 3MJHA 5AJYA 5DE3A 5EUMA 2QP3A 1LNZA 1X1SA 2VP2A 4QBFA 3GFPA 3KTAB 3SFVA 4W9MC 1CF4A 1QBKC 2WMNB 1FMJA 1G6HA 2IWRA 4XH9B 2HYIC 1AZTA 3BJIC 2ZRHA 5K8UA 3NHBA 4BPBA 2BM0A 3SJAA 2KJQA 3ZS9A 1P6XA 3H86A 2Z6VA 2GRJA 3B1VA 1DPFA 4R2HA 2DFNA 2OHFA 3CX6A 2D7CA 4Q1EA 4N1AA 3THYB 3QKTA 1LV7A 3ZZTA 3NIBA 4A6XA 2WMOB 5DHAA 4TQAA 1NNEA 4US2R 1SXJC 3RYTC 5CDFE 2RKOA 4DEYA 1R5OA 2XSZA 1MT0A 3MUFA 5HE8A 3I4LA 2NO0A 2BEJA 1EG7A 2Z4SA 1C1YA 4Q66C 4F4JA 1E99A 4BLPA 3PV0A 1SXJD 2CK3A 3WRXC 3HDTA 5HCIA 3A4MA 3LLUA 2WBLC 1KYIA 4HATA 4TYYA 4JL8A 5J5CA 5BYKA 1OFTA 3OIUA 1R0XA 3LQRA 4LI0A 1G7RA 1FUUA 3THWB 5EE1A 3U2QA 3T15A 1ZM3A 3LVQE 4HAYA 5G3YA 1W46A 3KXIA 2YWEA 2PLFA 3ZLJA 1E9BA 5C15A 1MV5A 3CLVA 3GLFA 3WBKA 4XVQA 4AY2A 3GEIA 4CIDA 3VKHA 2IW3A 2I1QA 5LB4A 3K70B 1NY6A 4CEHA 2IC5A 4X8HA 4NYIQ 3T06B 4DEXA 4EUNA 2YC2C 1ZNZA 2H18A 1LY1A 3HU2A 2ZITA 4BFTA 1KDOA 2RB4A 3VQTA 4TQ9A 2ZI9A 4CEIB 1F5NA 5JBQA 2ZUBA 2ZJOA 4UJ3A 1RRFA 5JWHA 1EX6A 2JLVA 1YHNA 3V4FA 4B35A 2AN9A 4ZPXA 4E5UA 1OKKD 3A1TA 3GLGA 4XIGS 2ZRAA 4TMKA 2IYVA 3NG1A 4V0ME 4E03A 4ZDIA 3AV0B 3THXA 2O0HA 2FPKA 2NOAA 1G7CA 4CDGA 1G7TA 5CM8B 4DC9A 1W2HA 2IUTA 2YYZA 1JR3A 1KJZA 3B9QA 3CRRA 2B21A 1YRBA 4M1SA 4C0JA 3LX5A 2AL7A 3AEZA 1J99A 1M7GA 3CIOA 4QNMA 1WDTA 5FUXA 2F9LA 2QM7A 4JYBA 3CWZA 1WA5A 4A0GA 3EW9A 4HI0E 4R98A 2LKCA 4OHVA 2KBEA 4GI7A 2I3BA 2D74A 2VP5A 1HY3A 2C95A 3SC3A 3PXGA 3KQHA 4Q4HB 2V3CC 3QOFA 1D9ZA 1OIWA 4NU0A 621PA 5HZHA 4NPHA 1KOFA 2FPMA 2GXQA 4MDEA 3H0KA 2OFWA 3TAUA 1JALA 1OXUA 3RSOA 4MQBA 5KNDA 4RD2A 5EXXA 4E09A 4IXNA 2K5UA 2JDID 1P2UA 2ZREA 4LYHA 4QGAA 2R6GA 2NO1A 4MGKR 1VCOA 4TLDA 2D62A 2FV8A 4DLVA 3ZVMA 3IO5A 1YR6A 4KHZA 3JVVA 3GQBA 4LBWA 5M1OA 3HU1A 4AURA 3THXB 3D7MA 4NYJQ 3U44A 2ZJ8A 5DN6D 3W9YA 1NG1A 2GF0A 4QGHA 3CF2A 4KLNA 5TB5A 1COWA 3QKRB 1A2KC 4NHOA 3RC3A 1FUKA 3NC1C 3FKSD 4RFSB 4JLDA 3TSZA 2A3RA 1GNQA 4KXFB 3T1OA 5CDFA 1I4DD 2H5EA 3N2IA 4GP7A 2F1HA 4Q4JB 3ONWA 2VEDA 1HT2E 1CJVC 4HYYA 4NYIR 4EPWA 5KYKA 1KMHB 1YKSA 2YJTD 1RFLA 2DCUA 2O8FB 3M4YA 3AP2A 3L8YA 2ZUDA 3IKJA 3RANA 2XJ4A 2YOGA 5GVSA 3RRMA 3M1IA 1OHHA 1ZYUA 2FU5C 3Q8XB 1XEWY 2PEYA 2FMXA 1F2UA 4IXMA 1XPRA 2JLRA 2JLYA 2FGJA 1RRCA 1WP9A 2ZRKA 4IDPA 2L0XA 4G5SA 3VHXA 3AVQA 2ZRBA 3EPHA 2UVQA 2ZJ5A 3OFNA 4D81A 4HLCA 1IBRA 821PA 2ZXUA 2UZ3A 2W00A 1MABB 1Z29A 2CMKA 5L8VA 1JB1A 1OXTA 3PUVA 4HLQB 4GL2A 4QC2A 4WZAE 1T9HA 1W44A 4ZDJA 1L4UA 2YV5A 2WJVA 4UNQA 5JJIA 1P7CA 2DFTA 3FPAA 5D3QA 2CEAA 2OXCA 3QPWA 3DMDA 4WBSA 1OT3A 3DL0A 4TLCA 1Z22A 4JKIA 5GJCA 2VF7A 3BWDD 4BFZA 3NBZC 2CLCX 4MYTA 5FL7D 1BMFD 1XEXB 2GCOB 2VQSA 3L0SA 4F4IA 1XZQA 1NN5A 3SYLA 4P0TA 3C8UA 2C5LA 3PUZA 3TR5A 3GJ0A 1UM8A 3DM9B 3BH0A 3BIFA 1FPMA 4NYJR 3K0SA 3CX7A 2AK2A 4ESVA 4DLTA 2OBLA 3Q7PA 4QHTA 1K5GA 1UBGA 2GEDA 4BGDA 4RY2A 1C4OA 2GDJA 4G5OA 1EWRA 1NJGA 4OHWA 3BH6A 2OG2A 5FFMA 5GJVC 1P73A 1NKSA 1JJVA 1K8RA 4WIAA 4EIWA 2BV3A 1DG1G 4ASUD 1EFCA 4FMBB 4B75A 1XNJA 2ZYVX 1DAIA 1N2CE 1YR9A 1XEWX 3BFVA 4H9GA 1W4BA 3HYRA 5DI3B 5AUPB 2OFOA 4B74A 2G83A 1J90A 1HA3A 1FP7A 1K5DA 2V7QA 2QG6A 5AK0A 3PVSA 1U2RA 3NEYA 1A1VA 2WPDD 2VP0A 3D6TB 1BIFA 1XMJA 2OXRA 1NVWQ 4PX9A 421PA 1KAOA 3SBEA 1SXJB 4QL3A 2PLRA 4Q4LA 3QXJA 4MA4A 1L8QA 2C2HA 1EFRA 2GKSA 2VHTA 1XD9A 3LDAA 1S9DA 1WBDA 5LD2C 3ZZ0A 2JJ1D 2HV8A 3K0CA 3OEHD 4J0QA 1NN3A 3WXMA 1P60A 1UBFA 1OKKA 3LBHA 4JBXA 3FMPB 3KQUA 2PX3A 1AS3A 1SVOA 1ZIPA 2J7PA 3ETLA 4W5WA 4AKEA 4HUTA 4KI0A 2ZE5A 1ZM7A 4QGFA 4RD4A 2J46A 5CB8A 4F92B 1HT1E 4YDSA 4Z54A 1XP8A 4ACAA 5TV2A 1P9WA 4BFSA 3RWMB 4LJ7A 3TAHA 4LV8B 1BOFA 1D6JA 1NN1A 2VP4A 1Y3AA 1CKEA 4LX0A 1N0UA 4OJKA 4XD7D 1Q1EA 1XXHA 5BQ5A 4OQMA 5AJVB 1Z5ZA 2W2VA 2G1KA 2D2EA 2V6JA 3QUSA 5KSYA 2FF7A 1GP2A 5H8WA 5DYIA 1CJKC 3GEEA 1JEDA 4P3YA 1E32A 4Q9KA 3R8FA 2CL0X 3CRW1 3KJEA 4XTRA 2CHGA 5FTKA 1TU3A 1E2LA 4G3XA 2ZE6A 4ACBA 2RCNA 3RHFA 2VSXA 2XITA 3MGCA 1CBUA 4GNKA 1BS1A 3KJHA 5ANRB 2QRNA 4LPSA 4B3XA 4C4PA 1YZLA 1DAKA 1U8ZA 3ZVRA 3BS4A 5DN6A 1X8JA 3SQWA 4JZKA 4L8GA 1XD8A 3RLFA 5AUOB 2QSYA 2PMDA 2P6UA 2Y8EA 1FOEB 1KNXA 1ZMXA 2QP9X 5LPNA 1AA9A 3B8HA 1KO8A 1ZD1A 1QHYA 2G9NA 3ZIAD 1AZSC 3X1XA 4D0LB 1XU4A 4MITA 5C2JB 1UFQA 3HJNA 4URXR 2XX3A 3UIEA 4M1OA 1G3QA 2LWIA 4YXWD 4F4CA 2OE2A 3RS2A 2AD1A 2ERXA 3L0OA 3CRQA 1KK3A 3T1QA 2E87A 2QNRA 2R65A 1NLFA 3G82C 5P21A 2X77A 1N5IA 1LW7A 2IUUA 1S9HA 1S1CA 3TGPA 3OF5A 4KFTA 2X19A 2WWYA 3NWJA 4UQOA 3HR7A 2IXGA 3O8BA 4YMVA 1B23P 1E79D 2KB0A 4DHEA 4GP6A 5HKKD 3QEOA 3WHKA 2ZUCA 1H65A 1KY2A 4B73A 1WB9A 1E2DA 4HZIA 1T3HA 3NBXX 1W36C 2BM1A 3GEHA 3SN6A 2IYTA 4KYUA 5IRCD 2QROA 3FTQA 2GJSA 1E96A 4JL5A 4ZKDA 5BN3A 5B64A 4OQNA 2JGNA 4V02A 4A1FA 1RE0A 3I62A 4GFDA 1ZINA 2Q9CA 1JAHA 1W36D 2HCBA 2O8BA 2DWOA 4DCNA 2GAOA 1NIPA 3LLMA 4YQFA 1JPJA 1PUIA 2MMCA 3SBDA 4ZV4A 1UBCA 4I1OA 3SYNA 4EFMA 4W5JA 2A9KA 2ZRMA 3VR2A 1GNRA 2J9RA 4XWAA 4YMUA 2J87A 1US8A 1S1MA 3B7GA 3EC1A 1NG9A 3B1YA 1PV4A 3TVDA 1LF0A 2Z43A 2A5DA 2EU8A 2ZYUX 3WMFA 4M2LA 2NGRA 3B1WA 4DSNA 3B82A 1XCGB 3SFZA 1IOZA 1D2NA 1Q1QA 4GMXA 2HXSA 4URWR 5JRZA 4BZXA 1QHHB 1GIAA 2GEVA 3EXAA 3TNFA 1ZW6A 4OQLA 3AF4A 1NSTA 3I5XA 1UPTA 1GITA 1U0HC 3PUXA 1FX0A 5HCNA 4Z51A 4MYCA 2C9CA 2QI9C 1U98A 3T35A 2OM2A 2XSZD 4MRRA 4DSTA 3I5YA 4PSAA 4D82A 2VO1A 5EP3A 2CCKA 2J0UA 2O8BB 3QF7A 3TQCA 5L3QA 1U90A 2CK3D 1VKJA 2OEPA 3FHCB 2QAGC 1Z28A 2DHRA 3AF3A 4KFSA 2GZHA 5DO9A 4AKGA 1NJFA 3FOZA 3H4MA 4O2RA 1FQJA 1BH2A 2IL1A 3MRSA 5C1BA 3JVUA 2HF8A 3M6AA 2GXSA 1NN0A 2QPTA 3FGNA 5KNCA 3E1SA 2QRZA 4OHYA 1GUAA 4BZPA 1OB5A 1YRAA 2WOJA 2BCJQ 2QU8A 1UEJA 3WP1B 1J8YF 1XD2A 1BO6A 3K9GA 4M9ZA 4RZ2A 1KO4A 1W47A 4WW0A 2F1JA 4B47A 5CB6A 4Q1AA 2KSQA 2Z4RA 4CEJB 1ZBDA 2JJ1A 2GEUA 2Z0MA 3T61A 4HDQB 1G4AE 2XOKA 2EW1A 5KHOC 2O8EB 1MRNA 3B85A 2VTKA 3RS3A 1G5PA 1RPZA 4IOMA 3BORA 2D2FA 1Q22A 3GCGA 3LV8A 2ODWA 3U3OA 5F9HA 4JBWA 4TZ6A 5H68A 2A2ZA 3WBJA 4QKQA 2GA8A 2ZYWX 1E9RA 3W5IA 4K8OA 2N1BA 2C04A 2FOLA 4JVSB 5TARA 1LTQA 1ODFA 2WTUA 1GDDA 3A1WA 4KFUA 2FSHA 2OO7A 1T0JB 2IHBA 2H8KA 1QDEA 5CIQA 2JLSA 3B1XA 2IS2A 1DBSA 5F9FA 1MKYA 4I1SA 2RH5A 3FFBA 1P72A 4NH0A 2VHUA 4LUCA 4Q7JB 3WNBA 4V0KA 3QG1A 4Z1MA 3AVXA 5BN4A 4RD6A 1OW3B 5FBRB 2G3YA 4LYFA 3U6BA 4ON9A 4RZXA 2P0EA 3A1VA 3EZ9A 1P4SA 1KDRA 2ECKA 2QENA 3EZFA 3QIAA 1J2JA 3VR3A 1JR3D 1G1MA 3F0TA 2FH5B 3UWKA 4A8JC 5M1KA 1Z07A 2V55B 3MFYA 4C0LA 4TLEA 3TRFA 4O2LA 4DWJA 4DDTA 1Q57A 2ZI5A 1MO4A 5M1FA 1NL3A 3RDPA 3ZJYA 4ARZB 1UKVY 4Q1BA 2QMEA 3ZS8A 4C0HA 2QP4A 1G19A 3K53A 4L5BA 1UDWA 5KSZA 1SKYE 2MSCB 5LD2B 3DPUA 2WAXA 3MWJA 4LBZA 2V1XA 2V8OA 4P4TA 4JLMA 2WM9B 4ZCIA 2QGNA 3CRMA 3KFXA 1UKZA 4BLQA 3SE0A 1ZM2A 3R9XA 1A7JA 1J8MF 5KSOA 1SVSA 4KLZA 3DEFA 4LJ4A 2GHIA 1S96A 1VYUA 5TY0A 1VHLA 3BRWD 3I8SA 3LNCA 3SS8A 1XRJA 5J4YA 4QBHA 2R44A 1E3MA 3AF1A 1OH8A 1M1YE 3AGQA 3W34A 1AIPA 5FOSA 4F93B 3H2YA 4PHGA 4PPFA 1OIVA 2QQEA 1TAGA 3BB3A 4PZLA 3R7WB 1GRQA 3IHLA 4MGYR 3SYKA 4JLOA 1Q21A 4JJKA 3NC0C 3X1WA 1KI8A 2ATXA 2ORIA 3AUYA 4C7OB 5JS8A 3QKSB 3AVWA 221PA 1A5TA 4DSOA 2OUKA 4PPQA 2HJGA 1KAGA 1TL7C 1YZQA 2OBNA 3ZD6A 3IHWA 2WV9A 2ERYA 2F55A 3B9PA 5JECA 3QBVA 4IDNA 5FTNA 5JSZA 1IJFA 2VBCA 1OHHD 3CKLA 4DLXA 1EWQA 2Z5FA 5CIWA 2UKDA 3IPYA 1XJQA 2QUZA 3M0EA 2BDTA 2AFHE 1AN0A 5G53C 2ZSFA 1X6VA 4MKFA 4D4MA 4PC3A 4Q7KA 1RRGA 1IQPA 1FNMA 2A5FA 2OV2A 2XTNA 3C5CA 4B44A 3D31A 3QXXA 2BKEA 4IKEA 4NL4H 3OFND 5D3MB 4RJLA 5JEDA 2WIAA 5FOXA 4AYTA 3Q5DA 3AVUA 1EESA 2IYYA 4P4UA 2N42A 1ONBA 3AH8A 5SZHB 2BOVA 1NRJB 2QQ0A 4V0NA 4GRAA 3H1TA 5F2EA 2ASEA 3TVTA 3A8TA 2QZ4A 1G18A 3B6EA 3L43A 3LW7A 1KZGB 1YZNA 4LHVA 4PPGA 1ZM4A 3KX2A 1EX7A 1T3LA 5L3SB 1AGRA 3NH9A 3TR0A 1W4CA 4LPKA 2WWIA 1E4YA 1E4VA 3EC2A 2FSFA 4JYCA 4OK6A 4MKIA 1W36B 5K8IA 2JLXA 4KAXA 5BN5A 2E9SA 2HJVA 3IPXA 4B32A 1QG4A 1X86B 3CPEA 2XGJA 4EFLA 3AVYA 3EARA 5B58C 2ZIAA 1YQTA 5EP1A 2YINC 1MO6A 2DWPA 2ZJ2A 5KDLA 2AWNA 1W48A 3QJYA 4M21A 1UAAA 2IS1A 1N25A 2A5JA 4H1UA 4RZUA 3DOFA 2ZANA 2QAGA 1TEXA 4HAWA 3FYHA 2XNDA 2QTHA 3KB1A 4WAUA 3GLHE 4BFUA 1YJ5A 2FSIA 2JASA 4M9XA 3JZAA 3L2OB 3MJRA 2V6IA 2BVNA 1JEEA 4EPTA 4L9SA 1CR0A 1ZM9A 5EZ6B 4B2IA 4B2LA 2RGDA 2IS4A 2DPXA 3TUZC 3WYGA 3U7FB 2V7QD 3QPVA 2ZVQX 3B13B 1F2TA 4LHXA 5CK4A 3SOPA 3BOSA 3B1ZA 1ZRHA 1KK2A 5TDHA 4AKIA 1RIFA 1OSNA 1Z6YA 4QJ3A 1TEVA 3CR7A 2C78A 4JVLA 2FG5A 1HQCA 3K0CC 1CJMA 3Q5EA 2GWHA 1I2DA 3PEWA 4PQYA 1W0KA 1Q0UA 1YR8A 1EFRD 1RW4A 1ZNWA 2XAUA 3L82B 3RABA 4GZLA 3TMKA 2CVHA 4MGZR 2Q3HA 3ASZA 2XXAA 3A36A 1E2QA 3KJIA 4FN5A 2YC4C 5CJPA 1XB2A 1DEKA 3Q7QA 4HB2A 2AD5A 4DB2A 1F60A 1CU1A 1WQ1R 2J7PD 3K0EA 3BGWA 3HPRA 2PL3A 1XTSA 4PC2A 3VU9A 4DXAA 4GBMA 4EPYA 1AKYA 3QEJA 5C46F 4M4SA 1X3SA 2YOFA 3GLFB 3UK6A 4ZIRA 3EPJA 2JIZA 5JJLA 1VECA 1E1RD 1IN5A 1N3BA 4WXRA 3R8CA 1V43A 4PC1A 1I4TD 3B78A 4FWTA 3MLEA 2V9PA 1Z47A 4CEHB 1E2NA 3RAPR 1G20E 4A8JA 4FWIB 1IY2A 4KBFA 5H70A 1E2FA 3UANA 4V03A 1T5IA 1E2HA 1SVLA 1P9RA 2EVWX 4DVGA 1NLZA 1PVOA 4X8OA 4CT4B 2X1VA 4C0QC 4XSHA 2QBYA 5J4KA 2AWOA 1OIXA 2VLIA 1FZQA 1YZUA 2B8WA 2EWVA 5DYGA 4B3GA 2P5TB 4YDHB 4WOPA 2FJUA 1UBEA 5FBWB 4BASA 1NKTA 4XVRA 4PANA 1XPOA 3GLGB 2IXEA 4TL9A 2IXFA 1EFUA 3IIMA 4ZKEA 4NCHA 3RSLA 3OAAA 5FPSA 4HAXA 4KFRA 3NVAA 4HDCA 4PC6A 2F3RA 1HURA 3X2SA 5AJWA 1AS2A 1VTKA 4LOAA 2DBYA 1SQ5A 3C15C 1U81A 3VMFA 1HE8B 4D2IA 5EP2A 5M04A 5CITA 8OHMA 1N6OA 2CLDX 3WYFA 1KSHA 4OKSA 4AIIA 3FVQA 3SHFA 1GL7A 1GSIA 3JZMA 3OEEA 3PUYA 1KSJA 1XCMA 2J1LA 4Q18A 1HYQA 1Q12A 3BB1A 1R8QA 3AF0A 5EUQB 3SJZA 1OXSC 4OHXA 3TUIC 5C10A 1RYFA 5EXTA 3CO5A 3W6NA 5TVKA 4UNPA 4Q01A 2GVZC 1QVRA 3CW2A 1IM2A 3DVLA 1E9AA 1XDBA 4B3CA 3SU8A 1T3SA 1TADA 2PBRA 2RGAA 2OSBA 3CM0A 3MAAC 1XX6A 2AKYA 3P26A 1CJUC 4POAA 5FTLA 1I2MA 2B8TA 2PCJA 5EE5B 1II9A 1ZD9A 2GILA 4F38A 3U44B 1N6KA 1KSFX 3GLHA 4BEBA 4D26A 1W4AA 2CL6X 4C0AC 4HB0A 4LV6A 2RAPA 4L9WA 5JRJA 2FGKA 5FPYA 1RRPA 3GLIE 1XCPA 3UPUA 1C9KA 1G8PA 1GAJA 3HP1A 3DZDA 3ADKA 4HUQA 3RS0A 2RGXA 3KKNA 2ZSEA 4AWXA 2HT1A 3EZ2A 3LRPA 1QHIA 2N46A 3FWYA 1E9FA 5KSPA 4TL6A 3CH5A 2REOA 3P32A 4MRNA 5DNYB 2GZDA 1ANKA 2JLZA 4OHZA 1NBME 4A0FA 3QSYA 2BMFA 1MR3F 4MDFA 2VRWA 3NEJA 4V0OA 5SZKB 1FL9A 1N0VC 2P67A 2HUPA 2PZEA 4IVQA 5BXQC 3AB3A 1E2GA 3ZYCA 4DBLC 2B92A 4YMWA 1F2UB 1KGDA 4JLAA 2QPOA 3FHTA 3UWOA 5LBIA 3V4RA 4Q4AA 4NYMQ 4BFWA 5JHHB 4V0MA 3QVUA 1Q3TA 4QRHA 2WKRA 3VKGA 4PQFA 4JLNA 3TKLA 5KPDA 1Z0DA 3PEVA 4LYJA 4Q1CA 1Z2CA 3CUEF 2OCAA 3T5GA 3VAAA 4G1UC 4LHYA 1GG2A 2B7CA 1D8TA 2QEQA 2YZ2A 3L0PA 3IO3A 4HAVA 1U94A 2O8CA 2ZJZA 1VG8A 2RGNC 2R6DA 1XTRA 2GXAA 3O47A 3F8TA 3QXCA 4NCKA 4TL8A 4Y0AA 2J0QA 3A4LA 1SVMA 4LY6A 4TSFA 2XZOA 3ND8A 4TTPA 3K0AA 4JLVA 2IK8A 1S3SA 3C4JA 3IEVA 4IOJA 4LC1A 3QQ5A 4JIMA 3ICQB 4BE7B 4NDZA 2ZR7A 2GJ8A 1R2QA 1T6NA 2QMOA 1G3MA 1OYWA 2CJWA 4QXAA 2EFEB 4CRWB 1D2MA 3NHAA 4E07A 2JLWA 1G8HA 2ZI6A 4RD0A 4TMTA 3U3RA 4JSYA 5FOVA 4HEJA 721PA 5AJXA 3BAFA 4AG5A 2C8VA 3Q85A 2IYLD 1L4YA 3Q9LA 4UKDA 3VKWA 4IOLA 1P62B 4PAMA 1S4QA 2IS6A 1IY0A 1XPUA 4QM7A 5GADl 1JJ7A 2F43A 2IYRA 2XOKD 2OCPA 5J40A 3KQNA 3K9LA 1YVDA 1KHTA 4UXJA 3BH7A 1VYTA 3KQKA 5FPKA 1CULC 3AKEA 4JJZA 1JQJC 3EA0A 4Q7MB 2W83A 3W3ZB 3BE4A 3LXRA 3TW8B 5FUWA 2ZSDA 1E1RA 4NP6A 2O8DA 4I1VA 1YU9A 4N0DA 2CCGA 3I61A 1PLKA 2P6RA 1WMSA 5CLLA 3KZ1E 5HZKA 1N6RA 2P6NA 4IHQA 4S35A 2KI5A 2Q0HA 5JJKA 1MO3A 4TL7A 3PENA 4Z1MD 2GJAA 1P5ZB 2WOOA 3TQFA 3BBPA 5FTMA 4P4SA 2ZRNA 3ADCA 3AM1A 2WJJA 3QXHA 4EFNA 2O5VA
chains in the Genus database with same CATH superfamily
1C9EA 1ZNXA 4QREA 4PV7A 4W5HA 1O4VA 3KB6A 1M9NA 5ILGA 3UJHA 3PUJA 3WJ1A 4QOZB 5FPNA 1QTRA 3VBEA 5B7NA 4F3YA 2FW1A 2C7OA 4Y1DA 3RJTA 4C76A 3AWDA 1V16B 3K0HA 3LK6A 3F49S 5IDYA 1RZRD 2BGGA 3D7EO 4HNSA 1KJIA 3TSOA 3ISTA 4P36A 1P90A 1U5BA 5JMTA 1VSBA 4CK3A 1PZMA 3JCZA 3X1YA 3L92A 3LL3A 1IM8A 3HFRA 1IXRC 1H0KA 3L8CA 3QA3E 3KKRA 1A7UA 1FSZA 1RAHA 1GGHA 5EMJA 4O59O 1ISIA 4Z9XA 4IG0A 1MW8X 3MMNA 2WD7B 3WT0A 2M1ZA 3KQLA 3DXKA 1B0PA 4UHKA 5A3QA 1K8AO 4BX2A 1CEXA 2QUHA 4LTMA 5LMNB 4A91A 1H9AA 1LW0A 2GSWA 2F90A 3N5CA 3GG4A 2ZBDA 4UU1A 1QPGA 4WQ5C 1H4TA 1Z8DA 1N92A 2IE8A 3ZCSA 2NZJA 3QGMA 4TN5A 5IYZF 3ZC3A 3RTAA 4KKOA 3P0IA 1K1EA 2VJQA 3NIWA 4MUBA 3PBKA 4EPXA 1FX0B 1UBUS 1RLOA 2TMGA 3ASMA 1SQGA 3CBQA 3VYWA 3JALA 4HFNA 4JP3A 3HUDA 5EXSA 4PS0A 3Q2OA 3O1BA 1ZICA 2JJ2A 3A1NA 3B89A 1W2GA 3VYUB 1TVKA 4D8VA 4JDPA 2XODA 3SAHA 3S7TA 3WXJA 3MWKA 5DIFA 3BHJA 1O9GA 1D2EA 3V32A 3AUXA 4G0XA 1H2YA 2GUIA 2J9ZB 4EF5A 1KVTA 2IOCA 1O94C 1WUAA 4E2ZA 5FI1B 1NVVQ 2ZU0C 5I7HA 2XB4A 3K2PA 2QA5A 1QSGA 3OQIA 3L6CA 1D7OA 3SBXA 1W6UA 4LOIA 1BXRB 1NJZA 5T57A 1K4YA 1X9JA 3T9DA 2AQIA 5GJBA 1H0HA 2BEWA 2OCBA 3EZ7A 5CFMA 2JGLA 3N8HA 3Q3VA 1GDTA 4BGUA 4HJRA 2X2PA 5UKDA 4GWKA 3R3LA 3TABA 3R8EA 3O73A 4ZHQA 4CLXA 3FFIA 5F2KA 3HN6A 5EHXA 4UC0A 1Z56C 3N9IA 4R83A 4KXUA 2H6EA 2O7RA 4N0EA 3TZKA 1T1RA 3DXXA 5FCDA 2FZKA 3TTCA 2EX4A 4JJAA 4XH1A 3H1BA 2R8PA 5DXJA 4F8JA 4W1SA 3M4NA 1M8PA 4K05A 1S8NA 2FE4A 1JLLB 2X4DA 2ZUWA 2XF8A 1C8LA 3W8NA 3THWA 3CC7N 4DQDA 2V54A 2AMLA 2ZVJA 4EHDA 3GBVA 4IFTA 3L02A 5EJGA 1NLMA 1XWIA 5IWCA 1LBIA 1DRVA 1Y8QA 3DOKA 2BKUA 1CEYA 4A0RA 1FXWA 1WAMA 2CZCA 1N5LA 4RMHA 2P6MA 4IDGA 1S4MA 3QLEA 1DTSA 4LRYA 4NLCA 4HN2A 2IKSA 3CVJA 4BR5A 2J08A 3U13A 2X4LA 4X24A 2D0PB 1QIDA 1C0MA 1A1SA 4BCDA 1TRHA 3EA4A 3I5MA 3T5MA 3G2JA 2O2EA 2G5TA 4GX2A 1ZBSA 4I4TA 3HVJA 4YHHB 4O2BA 2ZYTX 3G23A 4TV8A 3AT1A 2P9NA 1A3CA 2IT1A 1X9IA 3QI2A 3OEWA 3NHPA 2G88A 4BNZA 2GN9A 3W5HA 4L07A 3S4YA 5EMLA 1RJDA 1ZA2A 1L2TA 2AXPA 2EP7A 3D54D 3TNJA 3UW1A 1GRRA 1FS4A 2PGAA 3ULDA 3VU9B 1KFKB 1NJ8A 4FLVA 1DTWA 1W7AA 2YY6A 1IG8A 3SUOA 3NBYC 1XF1A 4UJ5A 4EATA 4DSZA 1XZEA 1PWZA 2H51A 3DLBA 1W96A 4P7GA 4WASA 3PSAA 4YCJA 3SQXA 1BGVA 1RGIA 4ERXA 4JI7B 2Q4BA 1DEXA 2W6KA 1K0FA 4PWYA 3ZJVA 3OSZA 1GGKA 3HU3A 1A8IA 2VSFA 5CJJA 4MV7A 4YFYA 2ZETA 5E3HA 5CH3A 2RK6A 2YN2A 1IHOA 1NKEA 2UDPA 1H3FA 4LKRA 5AQSA 1N8NA 1UXGA 4DZTA 4K6MA 4L2IA 3TAMA 1XZGA 4FM1A 1HNZK 4HNVA 3T7EA 4IQ0A 1SXQA 3OCUA 5AQFA 1JHZA 4BKPA 4C04A 4XWGA 3HWSA 4R1PA 5LN1A 4LJAA 1HNXK 2KQ2A 4B9UA 1NUHA 1GFWA 5JPDA 4HB4A 2CJYA 2WK1A 1EWYA 4E0BA 3FPJA 4RJIA 5ER6A 5GADP 1IHPA 4RGBA 2D4WA 4RESA 2SHKA 4I2VA 3Q88A 3OQVA 2XBLA 4DV1K 4F46A 3MC1A 4O0MA 1GNVA 4M9SA 3CCQN 3MS2A 3D02A 2O8CB 1EFVA 5E95A 2IQIA 3MJDA 3FM9A 1XRMA 3EGDB 1GTG1 2QXUA 3O0DA 2G82A 1CV2A 3H6GA 1Q84A 3AW9A 3AV3A 3CRVA 2FWNA 2J4DA 2HWUA 2YNMC 2NO4A 3GV0A 4HS4A 3T5TA 1EFVB 3ITDA 4A15A 4CERA 4D9BA 3ZEUA 4YV7A 3RS4A 4DV2K 3C2QA 3ITHA 5G40A 4L8RB 3CE6A 3DRPA 2WSSD 4M83A 1WOMA 3PSFA 1A77A 2PX8A 2WM2A 3LOQA 3R3UA 4RVFA 4S3MA 3ELBA 2IE0A 3V1YA 1ULSA 2FKNA 2CVFA 3IKVA 3L2QA 2OO3A 2H2WA 1ESMA 2JBAA 3ZNQA 5AR1A 3WGNA 4MUMA 3LHIA 3RSZA 3CMCO 5C4GB 3RRNA 3UK7A 2FW9A 4QM6A 4RAOA 3MFQA 4AO7A 2PBDA 5CLGA 3AR4A 1FPQA 3UXYA 2W6JD 2Z83A 4PZYA 3S2EA 2IVNA 4GMKA 1Z4KA 2P9UA 5D7NA 2OP0A 2FR0A 2HJWA 1Q0TA 2A9OA 3INYA 2DCMA 4ITRC 5KTKA 3OPYA 4QSHA 1INLA 2R6CA 4NPCA 1OWLA 2ZVPX 1B73A 2WVJA 3LW8A 4XQ9A 5B53A 4HRVA 1KJYA 4WZ6A 4L73A 2B8EA 4FS3A 2DUJA 3DOHA 3UV6A 5KQSA 3GCDA 1S3FA 1A4RA 4ASUA 1Z0JA 3I2GA 3ZDQA 5BN9A 5IJ0A 2COUA 1RQPA 4D0GA 2E2PA 3VR4D 1K68A 1CUGA 3NF8A 1GLBG 4K8RB 4FXDA 3SEZA 1Z33A 2IY8A 3IAAA 1GZHB 3AI1A 5LJWA 3DUFA 1OXXK 1NGJA 1G63A 3DE4X 2DPGA 3J80O 4G5FA 5I5GA 4H4DA 3W5VA 3OYLA 1A5VA 4TMXA 3U3YA 3YASA 3OG9A 2XMZA 1WHSA 1RLTA 1EIZA 1MMFB 1IZYA 4YUYA 1KK1A 2F1RA 5MN6A 3ZJ4A 4Z86A 3SKYA 1YJCA 3MEDA 2QW1A 2IDOA 2YTZA 4QUIA 3QBJA 3KXKA 5KREA 4G4SP 4YC7A 4PN7A 4F3KA 3WGIA 4BACA 1H2RS 3RAJA 4JK9A 1QHAA 3V7FA 1WCIB 2ZWPA 4O08A 5F4BA 2BIFA 3NGIA 3PLNA 3HABA 1E9CA 1O6GA 3NTRA 5HKKA 2DR3A 5FWXA 4BR9A 2JGJA 4X8MA 3JD3A 5F9MA 3SNHA 4M1MA 1WHTB 2E6MA 1EFHA 1DS6A 3AGKA 2RC5A 5CX1B 2EFCB 3LO8A 4TWJA 4Q9LA 1FMLA 3DFMA 3EXHC 1V39A 3SFVA 3NAGA 3ENOA 2ZJPL 3DBHB 1I10A 4GLLA 2HYIC 1AZTA 1H1LB 4UCQA 4N48A 2PZAA 5EFOA 2OHFA 2DJ5A 1XROA 3ZNOA 4UEWA 1FLVA 4HWTA 4BAUA 1RRMA 3LP5A 3I4LA 1RTJA 4ZZ3A 5A1TA 3PGXA 1HPLA 3TIGA 3HDTA 4BJ1A 2PR7A 3IAM6 1RBUA 3BL5A 1KYIA 1IMJA 3OJCA 5J5CA 1PR9A 4HHEA 4NR0A 1WUTA 4CJRA 1RJEA 2PL1A 2PLFA 1QTNA 4LDRA 5KYWA 1RAFA 3CLVA 3O8OB 2FN9A 5CGZA 3GUHA 1ZOLA 2I1QA 3EZWA 4CEBA 1LY1A 2GN6A 1MAUA 1OA0A 1L4MA 5JWHA 1G0OA 2IYNA 3ID6A 3G79A 1N2EA 1MC4A 4PAGA 3QFSA 1U8FO 1U0GA 1YRBA 3O74A 5MFZA 4C0JA 1UAYA 2QM7A 2FUG6 4R98A 1I1NA 1E59A 3WRWA 5GOZA 3G0DA 1VPVA 3HOSA 4NU0A 1JALA 4GR9A 5FLXA 3QOWA 5EXXA 4ETWA 3CZAA 5CZ1A 4EENA 4IQ8A 3VZBA 2A9RA 2P11A 2EDAA 2Z9BA 5DM7L 3OZUA 4JLDA 2Y1KA 1HRHA 3HLTA 4PG6A 3VGJA 5JANA 4B0PA 4CBUA 1YKSA 1DG9A 1T15A 2YOGA 3RRMA 2PL5A 2JVKA 3FVRA 1XEWY 1T9AA 2JLYA 2ACEA 4TZKA 3ULKA 4DV3K 4J90A 3EPHA 3ZIDA 3PQ4A 4R2LA 3P38A 2ZJ0A 1JXEA 1T9HA 4P81A 3TTSA 4ARUA 4CGIA 2J3JA 1HBJA 3CX4A 1NOJA 3G89A 1BMFD 4UDNA 1WY5A 4F4IA 4ZYZA 2PNJA 3ZZNA 4NULA 3PUFA 4Z0NA 5JTUA 9ABPA 1ADYA 1D5WA 3QLVA 1TZKA 3KSBC 1UBGA 1DDIA 1XLTA 1EWRA 1NXSA 4MUEA 1SY7A 1WY7A 1PL0A 4FMBB 2XUQA 2QL9A 4DTJA 3D5TA 3HKBB 3BFVA 5JXJA 3M6LA 1HRDA 4YJ2A 1SKAA 4URFA 4U2GA 3N2GA 4UE3S 3SBEA 3C1AA 3HCOA 4MA4A 4N3CA 4H17A 3K35A 2UYHA 2X5KO 3COZA 3LDAA 5SICE 5JQGF 3L4SO 3FMPB 2WZCA 1DAOA 3VU1A 3N39C 1RIIA 1AF7A 3VQ7A 3ZE1B 1NXXA 1QRSA 4DJDC 2PRYA 4ITVA 5BQ5A 1K6YA 4B4KA 4WTOA 1WUIS 3VV2A 3GP3A 3ZY6A 1K7XB 5CDYA 3HB9A 4FM2A 4R5PA 3GVIA 4G0QA 2YWJA 4DBVO 4CZMA 4JY7A 3EVTA 1JHYA 2JCVA 3EVGA 2ZXEA 1LDBA 5BQPA 4CTMA 2VOEA 3TOZA 1ASVA 4QXOA 4R51A 4ZO7A 1KAYA 2NZXA 2YX6A 3S6JA 3IUJA 1AKUA 4YNQA 4YROA 2J8ZA 4EGFA 2CH6A 1P1HA 5F7JA 3IKTA 5FORA 5I4CA 3WHKA 3EO3A 1D1QA 2KQUA 1USIA 1OI2A 4ID3A 2G04A 2YR0A 2WJ6A 1Y1LA 2D5BA 2P9QA 2Q9CA 2WYUA 4MIOA 4ZJYA 1QZ3A 1X80A 1NGIA 2RHLA 1JPJA 4UASA 4GOMD 3BG5A 4KQHA 3OKCA 4CV3A 2Q50A 3SQLA 1GPLA 5JW6A 3O4QA 3B82A 4ZC1A 1HK7A 3GRRA 1TM1E 3R7LA 4NESA 3IUSA 3KDAA 3OKFA 4L95C 3RC7A 3PK0A 2QTLA 1YFLA 3NP9A 4ZCSA 4CHNA 3JQ7A 4HN4B 2Q6IA 4H2DA 5DU2A 1C9NA 2V45A 4CZGA 5C1BA 2F67A 4EARA 3FGNA 2Q5OA 1XU7A 1CRZA 5BSRA 4M9ZA 4RZ2A 4WW0A 2KSQA 2Z4RA 4CEJB 1G4AE 4LNUB 1EWKA 4YFUA 3SXUB 2GA8A 2N1BA 2FOLA 2YZGA 3GRAA 2OXTA 4DADA 1QDEA 2W43A 1DXOA 2D1QA 3AVKA 3E2PA 4LUCA 1OW3B 4RZXA 2D13A 1KDRA 2QENA 3OUTA 4A8JC 5TRTA 1IPHA 4DWJA 4TTAA 1P0QA 1MO4A 1NMSA 2HEGA 4OP1A 4C0HA 4E13A 5J43A 2QP4A 1UDWA 2PO7A 3NHYA 5DT9A 4P4TA 4J1TC 2QGNA 4XDZA 4RBNA 3P7MA 1C4XA 5KNDD 1HI9A 1XRJA 1Y6RA 1JX6A 4OJMX 4HUGA 1MA3A 1YDHA 3AHGA 1AKRA 4IX1A 5KS2A 3LUDA 3VPZA 4MS1A 4RNCA 3B9PA 3AA3A 4JUFA 2LNDA 1EXWA 3WXIA 2UKDA 5COQA 4IJUA 1XCBA 3M8QA 1QIIA 5GAEP 1XWFA 5EXDA 2P90A 2YDYA 1J07A 1DDOA 2VN8A 1ZXBA 3FHLA 5C80A 4MUYA 4C7JA 2ASEA 1EUDB 3N0XA 1ABEA 4M99A 1ZM4A 1YRQA 1FRVA 2E88A 1E4YA 4R1NA 3GEMA 3M6MD 4CN9A 4K9RA 3IRUA 2X0JA 2PYJA 1XLWA 4UBIA 4CKEA 4FSDA 2VQEK 4PLYA 3CLSD 4NMXB 3GFSA 2Z09A 1UWCA 2QTHA 3JZAA 1X7XB 3PWSA 1RM3A 2BVNA 2P2YA 5AICA 3HM9A 3AB7A 3Q41A 3FTFA 3T3OA 4I5FA 3IT3A 3QKIA 1M8FA 2VG7A 2VQDA 1I0LA 3H9BA 5HRSA 4OV6B 2QZZA 2NRTA 2PHZA 3OWOA 4HB2A 3WKBA 2J7PD 3WWEA 1L3TA 5IULC 2H5LA 3H83A 4G36A 3NF6A 4AHTA 2HDHA 3FNIA 3R77A 1KSPA 4M4SA 1USUA 3UK6A 5ALFA 1NUUA 1V43A 4XWYA 4DR4B 1DC4A 3VDQA 1IY2A 1E2HA 2HK9A 2OGWA 4IZIA 2VVTA 5DTJA 2DFDA 1UOCA 1VJ0A 2PWPA 1QNLA 4HQLA 1N0IA 2O9JA 3GG9A 4LOAA 1N6OA 1W25A 3D64A 2PT6A 1T5OA 3HQ4O 1NVDA 1Q12A 3LM9A 4N5IX 5C34B 1ISGA 2P77A 1KMNA 1ZH0A 2OSBA 1ZJJA 4POAA 2OCIA 1ND6A 2PM8A 4FYKA 3BSWA 5JRJA 4DTRA 3GLIE 1RMQA 4HUQA 2ZSEA 4E5DA 1QHIA 2N46A 1LNQA 5KSPA 3CH5A 1E3WA 2EJTA 2JIBA 1MDFA 3HPGA 4MHTA 4YJHB 1UFRA 4QPPA 3LPAA 2HUPA 1PD0A 1E2GA 1JLKA 3G8DA 3TINA 2KPOA 3CM6A 3VKGA 3MWEA 1CUJA 1Z0DA 1N5YA 4DFKA 4L28A 2ZIEA 4Q1CA 3DQQA 1QFZA 2B4QA 4QPDA 1K66A 4HAVA 4E5KA 1OGIA 2HWKA 1SVMA 4IHJA 2E37A 2ZJ3A 1YIDA 1H2EA 1R2QA 5AJ3K 1DT5A 4KBYA 2H9YA 2BP7A 3HJTA 1XVVA 4CRWB 2IX9A 3R40A 2C8VA 3EGXA 3Q9LA 2EWMA 3RBXA 2DVMA 3GDQA 4IOLA 3EZ5A 2PD6A 1PFKA 1XPUA 4K6KA 3MXOA 3ROXA 2FP4B 4BTEA 3OZBA 2VF5X 3H9GA 4F85A 3AA4A 4KQEA 3BXEA 4JUCA 3ABQB 4YRRA 1UKCA 2ZKLA 4PQGA 5CLLA 4UBOA 1U0TA 4ETIA 5H81A 1IYZA 2XDWA 1BS9A 5U4QA 1KPIA 3QINA 3OZVA 4IXCA 1HLGA 5E4JA 3U62A 3VSEA 2VDLB 1GDHA 5H59A 1G21E 4GMDA 5KJCA 1ADBA 3K8YA 3VAZA 1UA0A 4RW9A 4KU4A 3T9BA 3R5JA 1KI4A 2F8LA 2BL4A 3VO2A 4US1R 1IPFA 1R6XA 3E7DA 2HEIA 1IG0A 4U7TB 3VQBA 4TV9A 1M2FA 2ZTSA 3R0JA 1CXQA 2BWJA 2H1FA 4YJFB 3RH0A 3KIPA 1QSYA 1DWQA 2RGRA 5DM70 3FKQA 5HJ2A 2V6MA 3DP9A 4LSMA 1SXPA 2Q2NA 4IUYA 4UHJA 2G9UA 2C9OA 2H4ZA 3A04A 3RYIA 1TT7A 5HK8A 2P8SA 2XCQA 1HTWA 3GAAA 4GOXA 5I9NA 4DTMA 3MVEA 2H4WA 3PPWA 3LZ6A 2QN9A 1KSGA 4FNMA 3E9LA 5JZVA 2CVOA 2J59A 3OA9A 1U0LA 2NO5A 3BA6A 2W37A 2I7DA 3QHAA 5KTSA 4MGHA 1QRAA 5AQMA 3VR5A 3KSDO 3E03A 4XWWA 1TECE 2ZBUA 2ORVA 1BCOA 4GZ5A 3K5PA 2F3TA 3NF7A 2H08A 1J5EK 1VK0A 4XLTA 4DNQA 3GLKA 4OLFA 1TQDA 5ADWA 3ZWQA 2FFBA 5KTMA 1HLDA 4UEKA 1IHUA 1L6IA 1O97C 1ISRA 5DLYA 4ILHA 2HHXA 3R75A 2Q5HA 2VNSA 2XMBA 3RPEA 4G5HA 2VT3A 3DLKA 2I9KA 3KG2A 3RFCA 1FSGA 2JL1A 2C5SA 2ENUA 3KSUA 4LYAA 1DX4A 4WX2B 3TN7A 5BN1A 2ZSAA 2PAAA 4QUKA 4C4RA 4LF4B 1YNOA 1N2IA 4RTNA 2Z56A 1ZVQA 4LD0A 4CF0A 2HAEA 1OXVA 4CM4A 2GAIA 3VDMA 3AUFA 3IDAA 1JI0A 4BFVA 3GRYA 4TTQA 4B1FA 3VHLB 1QP0A 4ZQBA 4LRTB 4XRGA 3QEWA 4HDRA 3QWFA 2ZDQA 3RRBA 1BA0A 4CEOA 1QYXA 4RZHA 1DKPA 1NNI1 2FSVA 4M1TA 4NZOA 4LBYA 3TL2A 2G77B 4UU0A 1KI1A 3GFRA 4DUGA 4HBGA 3U7JA 3D7LA 1ISMA 4MGEA 2ST1A 4UFNA 1FDIA 1QZXA 5DVZA 3MGGA 3LY8A 3TPFA 3VTAA 2ONJA 4Q34A 3ROGA 3LP6A 3UB5A 4JASB 5E6UB 1JH9A 1WZIA 1QHXA 2JEYA 3PE4A 4H0VB 3CZCA 5IX8A 2WC9A 1JXMA 1BRTA 1EGHA 1Y64A 1HSOA 4B8WA 4M7XA 5D8DA 2W71A 4Q7QA 4I19A 4S0ZA 3EGOA 1KY5A 5L3VA 1AHNA 3VETA 2F8TA 1NVVR 1XBTA 1X7YA 2XZPA 3ZJTA 1IHYA 1GZ6A 5I7WA 2IZ6A 1JUDA 4PLVA 4QYSA 3OJSA 4C7XA 3A06A 3DV0B 1TYCA 3SBOA 1E1QA 2FHSA 1P29A 2YZMA 4FJ9A 1WSBA 1S9GA 3VR4H 2DYKA 5IBPA 4DUYB 3T1AA 2CNWA 1ZKDA 3LI2A 3JYTA 5LL6Z 3UAWA 1QQTA 5IK2A 2PS3A 1P0MA 4N3NA 4F91B 2ZI3A 2VTBB 3HXOA 2XF2A 5LB2A 4ELVA 2DWQA 3EHDA 3SD7A 3LDLA 1SKYB 5HVNA 1SNYA 4GOLD 4RANA 2GK6A 4C8MA 3DOLA 4R84A 4BQIA 3OYBA 3A6GA 3O9RA 3PC7A 1DO0A 1DWOA 4TYNA 1NJWA 1QP8A 1ABBA 4A9AA 4DQVA 2XUZA 4K9LA 2F59A 4JJ8A 1LGYA 1GTVA 4C8OA 4IO9L 2FPGA 3VPCA 4X91A 1EBBA 4DIKA 3O75A 2HQBA 2PJDA 3J7AP 4HGOA 4JJ7A 5I48A 3WKDA 1AD2A 2FUCA 3JD1A 2ZSHA 3PGVA 1VQON 2UXBB 4E5VA 1N36B 5BUQA 2GUWA 4HWGA 1JFLA 4A73A 5JE8A 3ETHA 4V1CB 5IDXA 2AJBA 3M3PA 3HM8A 4LC0A 4JB2A 3A05A 3IDZA 3OFJA 1GPDG 4UNSA 3PQ7A 1OFUX 1BCMA 1TYDE 1RC8A 4R2IA 1XEXA 1U3FA 3PEFA 2ETXA 4RULA 2PMEA 2VDQB 4B7AA 3M4JA 3EXHA 4WLUA 3COSA 4E70A 2C4MA 5FBHA 3HCEA 3JWGA 1TVEA 5EESA 1UK9A 2H4FA 2C96A 3DEYX 1RKVA 4GVXA 2KWIA 1J8QA 5EUCA 3IAYA 4I55B 3G5AA 2XMGA 1XA4A 4MUFA 5H3HA 1UK7A 5IP5A 2O0MA 5ISMA 4A6PA 1P39A 1JHRA 3FD8A 3I32A 1B8UA 1YQEA 3ROTA 4B71A 4Q1VA 5BRAA 1B0UA 3GBSA 4B1XB 1T8UA 2R7YA 1H1VA 1A2BA 2H7VA 2AX4A 3R1XA 5IHPA 3HP7A 4OI0A 3C5VA 1CLUA 1UFVA 4LVCA 3J81k 4JKBA 3G1UA 1D6SA 4AHVA 1XAHA 4OD0A 4TTRA 1DVRA 3BSYA 3DHYA 1AS0A 5DCYA 3B5JA 4IEIA 3TG2A 3GWGA 4B6GA 3T12A 4LDQA 4ECAA 4OO1J 1ESVA 1GPKA 3VPAA 2M98A 4Y9DA 3V1RA 1Z0FA 3KDSE 2FFAA 4M7RA 1F0PA 1D6NA 1DKNA 4LSLA 4GC9A 4QEDA 2QN1A 1GAXA 2ZCJA 1T3VA 4TYWA 2BMJA 4ENVA 4TXJA 5A9SA 4TLBA 3VNRA 1JEOA 4B3IA 2HU8A 4URYR 1NUQA 1S5PA 3KUKA 4RD1A 3W1EA 2W2OA 1PG5A 1Q9XA 1Z2PX 1YGPA 3TRIA 2UXDB 4KN5A 2RHHA 3I23A 1FFWA 2GAFA 4TLAA 3EQ2A 3RVSA 4GPBA 1UMBA 3NHGA 5AFSA 3TFOA 4OM8A 3IBSA 5AFUH 1IXSB 4X7RA 3NDBB 4BZZA 4ONEA 1JH8A 3WL6A 5ED4A 1QONA 5AKXA 3QTTA 4N40A 5E6SB 4B8CA 4BLRA 1RM4A 2B30A 3M6VA 3PEUA 1UXOA 1RHKA 1RZ3A 1SVWA 2ZUUA 3WBFA 3BL6A 5DSTA 3HJUA 4KO8A 4JV5B 1IU9A 5IH7A 4HSEA 4G5QA 4GXNA 4F6LA 3W5JA 3NHKA 2PX6A 5KSWB 3TTUA 4IDCA 2MSDB 1M7HA 1M6VB 3U7GA 4N5NA 1XQ9A 4UDXX 3MB8A 1T44A 1GGJA 5BV0A 3GFGA 1AQJA 4D8UA 4J3NA 2KLBA 4M36A 5ALDA 2OZEA 2IZ0A 1ZN9A 3PR1A 1CSEE 1V5EA 5EPOA 3MPOA 2WFLB 2LDBA 4MINA 3ID6C 4FW2A 2KFZA 1NK8A 1JSZA 4BE1A 4XWKA 4M53A 4AHCA 2XYVA 1Z16A 2YRFA 4KSCA 4QGBA 3VNVA 3C3DA 2A9PA 1SVKA 4FEEA 4YLGA 2VQ6A 3CKKA 2QK4A 5FJJA 5JD3A 1UA1A 3ATVA 3JVDA 4ZHSA 3KL4A 2UUAK 3C7CB 3KPYA 4QFBA 5HIMA 4YXWA 3EASA 1U0SY 1M2OB 5HRAA 5A03A 5ILOA 4JI2B 4ZCPA 1ZLXA 5LIPA 1TF5A 1LPOA 4E4YA 1CVLA 3QSGA 4LJYA 1VCHA 3GLGE 1KOLA 1IN4A 1DCMA 1HEYA 1U80A 3KHSA 1HYEA 1PFWA 3BZKA 5BSMA 2RG7A 4TSKA 5K3FA 3OYIA 5ITZA 5EHIA 4CF3A 4R9VA 3A3NA 1OWNA 4DCMA 5FJIA 3ENQA 2EZUA 2HHTA 4EI9A 3JWJA 2ZRHA 1NPDA 5D00A 2JW5A 3HDQA 4J2TA 4MCHA 1VE3A 1AO0A 3JARA 6LDHA 5TMBA 2XSZA 2Z1HA 3QPDA 5BR1A 2CK3A 1RT1A 3GIWA 1DQSA 3DE7X 4EUHA 3UFXA 4XIFA 2MSLA 4DDMA 3T15A 1YJWN 2C97A 1AKWA 1GQYA 2FBXA 1FSPA 3PC8C 1RDAA 3OJFA 4QXQA 4CEHA 1JLBA 4DUPA 2N9UA 1BUPA 4CEIB 4E33A 2IVPA 4UJ3A 3N3BC 1Q50A 2M32A 1PNOA 5BPMA 4DR6K 1XTBA 4JLWA 1T2DA 1I32A 2B5JA 2XCTB 4H0NA 1H2BA 2F64A 1KJZA 3WLTA 1KYZA 1X1BA 5KNDH 3QELB 1BA2A 1OC4A 1L5VA 3OYNA 1L6RA 1YR6A 4KO4S 3L4QA 4XVHA 4Z4IA 1RU3A 2PVSA 3VF4A 4NHEA 4Q93A 1LJLA 3N7TA 4RHCA 3ZQKA 3RC3A 2WD8A 4AJIA 2ID4A 4RTLA 2HADA 3E2MA 3EQ9A 1M34A 3MJ4A 3KNZA 4Y3UA 2XJ4A 2Y99A 1ZYUA 3ZCQA 2JPDA 1UIMA 3AUAA 4N6NA 4TXHA 2B83A 5BN8A 5IAOA 3ZSWA 1WQ3A 1H2HA 4WZAE 1HPZA 1FDSA 3S3MA 1Z12A 3OCJA 3ZHTA 5HZGA 1X1QA 5D3QA 1K6JA 4WBSA 3I33A 1E3IA 3SG0A 3G5TA 3WIOA 2P4UA 4MPJA 1KFEB 3MRTA 4N3AA 2CLCX 4HAIA 3AO5A 3P0HA 5BRHA 4W9NC 2JHPA 4R9RA 2QWNA 2D1YA 4L1KA 3LTEA 3BIFA 5KQGA 4RY2A 1BEEA 4NPAA 1X0VA 5LLSA 1E7WA 3UPDA 1N2CE 5BV1A 1T1EA 2DPNA 3HYRA 1RAAA 3LHSA 1K5DA 3HYNA 5A04A 2OD2A 4LY3A 4RNDB 1WMFA 3T9EA 1XAGA 4PX9A 421PA 1Z88A 5JJ5A 1Z5NA 2J0EA 4ZOLF 1Z8NA 2XMPA 2C2HA 2VHTA 5C8ZA 1XCJA 4E1NA 4JI5B 1NGHA 4QXRA 3PLRA 4IUDS 5F1KA 3UOAB 5C1PA 1HDGO 2VH1A 1MEOA 1VP9A 2EX0A 2NU6B 2R47A 4N5MA 2W48A 3I6YA 5AJVB 1V16A 3LDHA 3RVKA 3CRW1 4EB6B 4YUWA 1B43A 3SXJA 4CG3A 2Z1NA 1JIJA 1YQWA 1QGAA 3SQWA 3DEAA 4TWIA 5F73A 3NAQA 5HA5A 1SRQA 3NKLA 4HX2A 4Q3AA 1AA9A 1VP3A 1KO8A 3P2IA 4HGZA 1HYVA 3SNNA 1COZA 4HQOA 3HBFA 2OE2A 2ERXA 3L0OA 3O31A 3B53X 1N5IA 2WD7A 2WWYA 3W78A 3SLRA 4TXNA 2ISCA 1OBFO 4UBLA 3GEGA 3G2NA 3BF8A 4PCVA 3FPGA 4R1OA 4UCXA 1WSAA 2QIPA 3M6GA 4P4NA 3SYNA 1HYSA 3EVZA 1W19A 2PGDA 3ZD9A 1JLEA 1S1MA 5AHWA 5AVVA 2PUAA 1D2NA 1WMDA 3HUFA 1QVGM 5ALLA 3H1GA 3KYIB 5JLFA 1D4ZA 1ZW6A 1W73A 2V0NA 1FX0A 3LSTA 4MYCA 1WXIA 2XLBA 2QI9C 1E62A 3HTXA 5GV7A 4G56A 4AM8A 3FHCB 3F1LA 4KUGA 5HJEA 3SZMA 3FUTA 1K5PA 1MC5A 1P7YA 1RZVA 3ATUA 4IDFA 4Q3OA 2WOJA 1LWFA 2R2GA 2BLLA 3QVSA 1J8YF 1H2ZA 4JA2A 2HA0A 1ESZA 1ZOOA 4HDQB 4Q05A 1RDFA 2NTNA 5HRCA 4OL9A 1CG6A 1Q22A 4HQRA 4M1QA 4HDNB 3EZLA 1E9RA 5ECWA 1GDDA 1BXRA 2Q2VA 4G5YA 2Y68A 3OOWA 2G3YA 1ML3A 3VR3A 2VAWA 2IS3A 4LSWA 3F0TA 3UWKA 1FYFA 3MFYA 2V55B 1RM0A 2RAFA 3Q2IA 2DFPA 1IBCA 3K53A 4L5BA 5KSZA 1B74A 4FJ8A 3IESA 3OCCA 1J8MF 4CF9A 1J8FA 4KLZA 2I7XA 3MJVA 1VYUA 2R44A 4F21A 3CIPA 3H2YA 3A2FA 2QQEA 4Y6QA 2R68A 4E89A 2WMDA 4GKKB 3NC0C 1N2SA 5CT5A 3VKVA 3AVWA 3NASA 4X64K 2F55A 1JLLA 2MDTA 1SCAA 2J9XB 4DLXA 4YYEA 1KR2A 4XJTA 3DF7A 5G53C 1V2HE 2GK3A 5KOIA 2I7NA 3VC7A 4AYTA 3Q5DA 3KQYA 1EESA 3MJTA 4TSXA 1VXRA 4E46A 1NRJB 4QODA 3MD9A 1Q77A 1EX7A 2OYQA 1Q0RA 1Q7TA 5I9IA 2AE1A 1W36B 1S8AA 1T26A 3GGSA 4RTRA 1HR0K 2D0PA 5K3DA 1FDOA 4NVRA 1O77A 4DG8A 1QE0A 4NYFA 2V6IA 5EHQA 4WA8A 3PHIA 4IIFA 2IS4A 3Q5GA 2AEJA 3HY3A 3TLMA 3E66A 3L5KA 1Z6YA 5IVPA 1C8BA 2QEXN 3D8HA 5HBGA 4PQYA 2HMAA 3E9CA 4G1QA 3IOBA 3R3XA 4IJAA 1DIOB 4GZLA 3I83A 2Q3HA 4L4SA 4HV4A 1QV6A 3VU9A 2DKFA 3S8MA 3CQ8A 3GF4A 3ZKAA 3DD5A 5JJLA 2DLDA 1IN5A 1HFWA 3DLCA 4FWTA 3MLEA 3RVDA 1IDOA 4NCAA 4BJ3A 4OXIA 1ODKA 2PIDA 3DLAA 1W8DA 4Z0UA 1QGDA 4GVLA 5A3VA 1IK4A 3ZUPA 4YRCA 4TL9A 5EIWA 3NVAA 4NE9A 3A7EA 5CITA 1KSHA 4IJKA 2GD0A 2HK6A 1K88A 1M66A 1KGSA 1T2VA 3FWHA 3SJZA 4CJ5A 4OKKA 1N78A 3FAKA 1NGFA 1YC2A 1SR8A 1F8XA 4YBRA 3RBZA 3GIDA 2B4KA 1II9A 1ZD9A 2ZIUB 2I66A 3NHMA 2JI9A 2O54A 1XCPA 4P2BA 3HEAA 2EEZA 2HF4A 4TL6A 3V97A 5LJVA 2HLPA 4JH0A 3NEJA 4CHOA 3RU7A 1IVNA 3OU6A 2QYTA 5ESWA 3HUUA 4DBLC 4JLAA 5LBIA 3FTDA 3G1TA 5BW4A 1WKBA 2W42A 1BEZA 1SB9A 3AU9A 3U4DA 2ZM6K 4LHYA 2ZZKA 2O8CA 2ZJZA 1YAHA 5I42A 1DRKA 3QFRA 4M8LA 4I9UA 1S3SA 3TSPA 3BF3A 1Q19A 3QQ5A 1VE7A 2PA3A 3MILA 3EGDA 3AEQB 4E2WA 5HXAA 2ZI6A 5GWXA 1XEAA 4HEJA 2FW7A 1MAWA 3AI3A 3EIOA 3UUGA 1C1XB 5DX1A 3LCCA 1IY0A 3L4IA 2I6XA 1YUMA 4FJLA 1UPXA 2G36A 5I8PA 2LR0A 3KWLA 1YVDA 1ZDMA 4EX6A 3O08A 1M2VB 1V9CA 1T3ZA 1IQRA 4MIYA 5EERA 3RK4A 4E94A 4N0DA 4CBXA 3D4LA 2NADA 4WESB 4D74A 2R11A 3NB0A 3ZDAA 2V7PA 1S6YA 2G8IA 4Z1MD 3BBPA 2PUHA 1U49A 2Q0SA 3KEMA 1HC7A 2BE9A 5LBTA 3D59A 1Y1QA 1E9DA 2FWIA 3SM3A 4CL0A 4KR2A 1I94B 4OHBA 5JS1A 5ADXH 2FSVC 1Y9DA 5HDQA 4ZCLA 3LAMA 4JSRA 5D5QA 1PJ8A 1OZFA 3HDGA 4KEAA 5IT9A 2WYVA 1OH6A 4OJRA 2GJ9A 4MQ3A 1WJGA 3QWBA 1NXTA 3L9WA 4IIDA 4OXNA 3UPTA 1CLQA 4NCGA 2HRQA 1PGQA 4OPHA 4DV5B 2W58A 1JIXA 4X61A 3B36A 4IIUA 1I6KA 5ADVA 2WB4A 2RGCA 4W5OA 4MHSA 4GE0A 4Q19A 4IJMA 4GMHA 3ZBPA 5FOTA 4MP8A 4M86A 3TNLA 1SIBE 3NF9A 1ZMTA 4AAYA 3K94A 2XT0A 3BEDA 4XUGB 2I7CA 1CS0B 1C3LA 4ROSA 4PGAA 3ZETB 3R0QA 1GILA 1T0HB 1KO5A 1H8EA 1FYXA 2FPLA 4ZALA 4MW7A 2B98A 1CRPA 3O8DA 1ES9A 3FDIA 1NMDA 1RXVA 4BMCA 5LZ4A 1Q1ZA 2VDMB 1TAHA 1C3EA 3F78A 5JIBA 4PIMA 4J0GA 5FBQB 4XDHA 1JNYA 4OUKX 2VPYA 3HPOA 4D4KA 2EIXA 1QVWA 1YCGA 3OJWA 2YFYA 3PUIA 3U3ZA 3FPSA 4LMBA 3PJEA 1EB8A 3U48A 1LF5A 5BY2A 3ZBQA 5EEGA 1ML4A 4Q0BA 2YMPA 4IGAA 3P4YA 3KQSA 3DMYA 1NY5A 5KYYB 4RENA 3A6HA 5BNTA 3FZGA 4QLOA 2BFFB 2BZ1A 2IIVA 3GLUA