4CEDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cedA00
1L3TA 3QNNA 1DTTA 3OYHA 2YNHA 3AVGA 3G10A 1SV5A 4H8KA 3LZJA 1YVUA 1JLEA 3AVNA 3MEEA 2HNDA 3TAMA 3VQDA 2FBYA 3OYKA 3C95A 1NKEA 2F8TA 1S5JA 3OYNA 3HVTA 1L3VA 2ZQBA 3AVMA 3V6DA 3NGYA 1GOCA 4CEAA 1HRHA 4CECA 1O1WA 3SV4A 3SCXA 4DWIA 2D5RA 4OGEA 4DFKA 4DSLA 3RMCA 1TK0A 4CFDA 3QETA 4WE1A 4OKKA 1B9DA 1NK7A 1NK0A 3QERA 4DSJA 3KLIA 1S1XA 2B4JA 1BIZA 4BE1A 3SPZA 3ISNC 3ZSWA 3HT3A 1X9MA 1WAFA 4Z4HA 5KGXA 5JS2A 3VQPA 4W5RA 3EZ5A 1A5WA 1KVBA 5CYMA 3K5MA 4DTNA 4DS4A 4FJ5A 2Z1GA 2KQ2A 3KK3A 3ALYA 4Z4FA 1LAWA 4IFYA 4CIGA 4W5OA 3VQAA 4JS4A 3LAKA 5J2PA 4DS5A 5E41A 4JS5A 2G8HA 4FXDA 4IG0A 3V9XA 3ZT4A 2IS3A 1Y97A 4OKJA 3V1RA 4Q5VA 3ULDA 3VQ7A 1Q8IA 4E7HA 3F73A 4N76A 1RT6A 3SQ2A 4FZZA 2HVHA 3RMBA 1F21A 1VK0A 3DRPA 4CGGA 4C8MA 1NK4A 5HP1A 4EZ6A 4E89A 4NCBA 4F2RA 4DQQA 4FLZA 4NYNA 1TK5A 4J2EA 3HPOA 3NDKA 2G8IA 4BWJA 1RT3A 2XY6A 4RW6A 2IDOA 4FJJA 2IGIA 5CZ1A 3LP0A 2KTQA 1TL3A 2EX3A 4LD0A 1FXXA 1VRTA 1IKXA 4W5TA 5HROA 3IG1A 5FRNA 2P51A 4O4GA 1FKOA 4FLWA 4DTPA 4DSIA 3ZCMA 1KLMA 3ZT2A 4AHCA 3EY1A 2BGGA 3SQ1A 1SKWA 1HYZA 1ITGA 1BCMA 3RMAA 1JLBA 4DFPA 1R0AA 3HPHA 1T7PA 4B8CA 4FJ7A 3VQ8A 4FM2A 2HHQA 2Y1JA 2VG6A 1NJXA 4B8AB 4B9MA 5FDLA 4M3WA 1DTQA 1RBRA 4CJ5A 4DTSA 4DLGA 3WNHA 3S3NA 4ZTJA 1ZYQA 4CESA 2HMIA 4IG3A 3ZT3A 2QK9A 1TKTA 2PY5A 2IOCA 4CHZA 4YNQA 3NAEA 3OYFA 4DFJA 4DQPA 4FJHA 1BHLA 1RBTA 5C24A 4FVMA 3SUNA 2X78A 3LPUA 3HO1A 3QLHA 4FJ9A 4IFVA 1DLOA 4ID5A 1BI4B 1J5OA 3AO1A 1GOBA 3DI6A 3NGZA 4BDZA 4HUGA 5KGWA 1Z26A 3VQQA 3ZSVA 3KLFA 3NF7A 3K57A 1KVCA 1UWBA 1WAJA 4AHUA 1U45A 4RW9A 2O4IA 3LP2A 2B6AA 3PX4A 4AHTA 3JSMA 3NF6A 4DF4A 3ASMA 2WONA 5EU7A 1VSEA 1X1PA 1XI1A 3THVA 1WSFA 3ZSZA 2HW3A 1VSFA 3KLEA 3TANA 3C6TA 3T19A 1RBVA 1EP4A 2F8SA 2KZZA 1BQMA 1VSKA 2ETJA 4CJWA 5I3UA 1S9GA 3OS0A 4O44A 3LWMA 4OPJA 4DTJA 3SQ0A 1S1TA 3KK1A 3SUPA 3L2WA 1XC9A 4FK0A 4OKEA 5DK5A 2XHBA 2E4LA 2QKKA 2P5OA 1WSGA 4MQ3A 3VQEA 4DFMA 4J2BA 4N5SA 4ICLA 4TSXA 4O0JA 4GW6A 2LSNA 3VA3A 4KI4A 2OYQA 3RR8A 3LANA 1W0HA 3KLHA 1B9FA 1REVA 5C42A 2PZSA 2WOMA 4DQIA 4HHTA 1CZBA 2Z1HA 3PO5A 4OGCA 2P1JA 4CGJA 4I9QA 1Z25A 2I5JA 4CF2A 4HUEA 1JLQA 4HUFA 3O3GA 1KFSA 4KAZA 4UQGA 4KHNA 4E7IA 1VSIA 5KTQA 1N6QA 4BE2A 1EETA 1U47A 2HHUA 1RDDA 2DFEA 5CZ2A 2VWJA 4DQSA 4CGDA 3K58A 1LV5A 3D45A 3E01A 1JXBA 3U3YA 1SKRA 3BDPA 1TV6A 4FJKA 1UAXA 1U04A 3HP9A 3DLRA 3S3OA 1D9FA 1RBUA 3PUFA 3SPYA 4C8OA 2A1RA 3TI0A 3L3VA 4FLXA 1NK6A 1ZBIA 4Q0BA 1BQNA 3SYZA 1NJWA 1TK8A 3L2QA 1IKYA 3PX0A 1JLGA 1WSEA 3QEXA 2DY4A 3DLGA 2RKIA 4HCBA 4FW2A 3H08A 4CK3A 4CEEA 1ZBUA 4J2DA 3MXIA 4FJXA 3CG7A 3U3GA 4FLVA 4F2SA 1CLQA 4KTQA 5J1EA 4AILC 3QINA 3AVLA 3G0ZA 4JLHA 4PY5A 3HVRA 2F96A 2IAJA 3OY9A 3SUOA 5FRMA 1L3UA 4CE9A 4W5QA 5K14A 4BACA 2YNFA 1WSJA 4ZTFA 1NJYA 3ITHA 1HNIA 3AVCA 3QEIA 3KD5E 4F3OA 1FKPA 3O4QA 4LSLA 3CQ8A 2R7YA 4KB0A 4FM1A 3TAFA 1VSDA 3JYTA 4QOZB 1HYSA 4E7JA 2YKNA 4CJLA 3DYAA 1SKSA 5JS1A 1SL2A 3AO5A 1C1CA 1B92A 1RT4A 4I2QA 4OVLA 1D9DA 1HYVA 2JLEA 3VN5A 1IO2A 2HNZA 2G8KA 1ZBHA 1RT5A 1S6QA 3ZSRA 3M8QA 5T7BA 3CM6A 3DRRA 4ZHRA 1U48A 4M3UA 1MU2A 3TR8A 4B08A 3QEVA 4KHQA 4W5NA 2OZSA 4CJTA 3OYBA 4KRFA 3L2UA 4CFCA 2Z1JA 4CK2A 1T05A 4O0IA 1QSSA 4Y1CA 1KFDA 4AHVA 4FJIA 5KRSA 3AVBA 2YNIA 5CYQA 4DF8A 1S9EA 4CJSA 3OYIA 3RRHA 3TARA 3MXMA 3AA2A 4HTUA 4FZXC 1XWLA 4CJQA 3DMJA 4E1MA 2PYJA 1RT7A 1UA1A 2A1SA 4KI6A 3MEGA 3TAPA 4DLEA 2XY7A 1U49A 2DTUA 2RN2A 3AA5X 1C1BA 2PYLA 4BWMA 3VQCA 3C6UA 2XRIA 3HPGA 3SV3A 3TAQA 4MFBA 3VQ5A 1QSLA 4C8LA 3RWUA 1RDCA 1JL2A 1BIUA 3VQBA 1D8YA 1VSMA 2D0BA 1C0MA 3AO2A 4O5BA 3RMDA 4M3TA 2Q3SA 4Z4IA 1JL1A 5FROA 4YFUA 4IDKA 4IKFA 4M42A 1GOAA 5HBMA 3WNEA 2OZMA 1D5AA 2VG7A 5SZTA 2HNYA 4CHPA 3V9UA 3M8SA 4L8RB 1SL0A 2Z1IA 2NUBA 3LDSA 1ZBLA 3VA0A 3KD1E 4F3TA 4LSNA 2KZMA 4B9LA 1NKBA 4E1NA 3OYGA 4OJRA 4AH9A 4FLTA 1CZ9A 1KTQA 4CGFA 3M8RA 3CFRA 1BL3A 3U6FA 1XHZA 1U4BA 4KREA 2HHVA 1VSHA 2IC3A 4RW4A 3NE6A 1NOYA 3S3MA 4PQUA 4DTUA 1LWCA 2FBXA 1HQUA 3NH2A 4CERA 1LWFA 3V81A 1I39A 1RDAA 2YHBA 4DTMA 2ITGA 3LAMA 3B6OA 5KI6A 3D0PA 3V9ZA 3V4IA 4ELUA 4FJMA 1J53A 2XY5A 4B3OA 2HVIA 1C6VA 1X9SA 2OPSA 4CEZA 4B9TA 3CFPA 3DLKA 4KFBA 1KCFA 2X74A 1YT3A 3NF9A 5HRNA 2G8WA 4FK4A 5KRTA 3K5LA 4BE0A 1TVRA 1TGOA 4AHRA 2BANA 1C1AA 3WNFA 3L2VA 4CK1A 3DOKA 4DSKA 1HPZA 4FJGA 1RILA 1WLJA 4B9UA 4N47A 4KHWA 1EXQA 3ZT0A 4HVJA 4JRPA 4CEDA 1WN7A 4DU1A 4CEFA 3LPTA 4CF8A 3OYDA 2OA8A 3HJFA 1J54A 4DQRA 4FJNA 4CEOA 3MAQA 3KLGA 3AO4A 3S9HA 3OYAA 1I3AA 4FM0A 3LP1A 1IKWA 1NKCA 3VQ6A 1Q9YA 2FC0A 2DFHA 2ZD1A 4F8RA 3DOLA 3MXJA 4RW8A 3UIQA 3L2RA 3P83D 4FYDA 3V1QA 1TL1A 1K6YA 2VG5A 5CY4A 3NGIA 3L8BA 4FCYA 4E0DA 2KFNA 4RG8A 1FK9A 2HHSA 1RNHA 1WSHA 2B5JA 4Z4CA 3OYLA 2KFZA 1L3SA 1S1WA 3NHGA 4KHUA 1TKDA 3IRXA 2HHWA 4Z0UA 4I2PA 1S6PA 4KO0A 4NCGA 3TAEA 4ELVA 1ASUA 3HXMA 3KJVA 3DLEA 4M41A 1CXQA 4DTOA 1QHTA 1JKHA 2HB5A 3I0SA 2QKBA 1A5VA 4XIUA 3PY8A 1RDBA 3IAYA 3AVAA 3HL8A 4KV8A 2FBTA 1BISA 1JXEA 1RBSA 4CJRA 4HCCA 4LY7A 3DLBA 1C0TA 1LWEA 3OJUA 3TWHA 1BCOA 1RTHA 4CHOA 3LALA 1CXUA 1JLFA 4Z4EA 1NK9A 4CHNA 4FK2A 1BI4A 1RTJA 3NBPA 4OLAA 4QCLA 1TKZA 3K59A 4CCHA 1KVAA 5SWMA 5D3GA 5J2NA 2AJQA 4DU4A 1W9HA 1RT1A 3KKRA 3OS2A 3CYMA 3FFIA 3MECA 2E6LA 3ZSXA 3OYEA 4OPKA 4DTXA 4E3SA 4I9LA 1NOZA 5HRPA 4JRQA 3RR7A 3OS1A 3RRGA 4K8XA 1JLCA 1QE1A 3IS9A 1T03A 1ASWA 3F9KA 4CJKA 2EHGA 4GVMA 3AVKA 4N41A 4KHYA 3SI6A 4J2AA 1QQCA 1LAVA 1TAUA 2W42A 1VSJA 4C8KA 1NJZA 3AA4A 4H4OA 4M45A 3K2PA 3T3FA 1NK8A 4CJVA 3T1AA 3ZSOA 4R5PA 3WNGA 4CHYA 3NCIA 4NCAA 1KRPA 1LW2A 4N56A 3CM5A 4DSEA 3P5JA 4KKOA 4DMNA 1WNSA 3QESA 1ZBFA 3KTQA 3HSTB 1TKXA 5HRSA 3NH0A 4Y1DA 3QEPA 4B9NA 4CIFA 3OYCA 3HM9A 4DTRA 3O3FA 2E6MA 2OPQA 4CFBA 2ATQA 3HK2A 4RW7A 1HJRA 4PUOA 3DM2A 1YTAA 1UA0A 3V9WA 3HP6A 2O4GA 1EX4A 4LH5A 4G1QA 1A5XA 4QAGA 3KIOA 2YV0X 3AA3A 1JLAA 3DLHA 1NK5A 4KTZA 3QEWA 1C0UA 3ZSQA 3OYJA 4PA1A 1WSIA 3BGRA 3KK2A 3A2FA 2KW4A 3V1OA 3ZSYA 1UOCA 1L5UA 2Y1IA 4K8ZA 1LW0A 1QTMA 3CFOA 3V9SA 4NYFA 4OLBA 4CJEA 1G15A 4CJ3A 3OYMA 1KLNA 3LWLA 4KTWA 4CF1A 4I7FA 3SJJA 3TAGA 2P5GA 3QIOA 3I0RA 1VRUA 3C94A 2RPIA 4M3RA 1RTDA 1J9AA 2X6SA 1QS4A 1X9WA 3MEDA 3AVIA 1QSYA 1IKVA 4Z4GA 1BGXT 4O55A 2YKMA 1SUQA 3AVFA 3AVHA 5DMRA 4DU3A 3SNNA 3O3HA 4BDPA 1XHXA 1HNVA 1RCHA 2G8UA 4H4MA 1IH7A 4FLUA 3NF8A 4CJ4A 3I8DA 1VSLA 3PV8A 2OPRA 4DSFA 1Q9XA 2JGUA 3LZIA 4M3ZA 3QIPA 4B9SA 4F4KA 5C25A 4CF0A 4PWDA 2HHTA 2X6NA 3AV9A 4GMJB 4DG1A 4CHQA 3PO4A 3VQ4A 3RTVA 4B9VA 3NFAA 3K5NA 3SUQA 4AHSA 4CEBA 3SQ4A 2YHAA 4CJPA 4ELTA 2RF2A 4CJUA 1N5YA 4KPYA 4IBNA 4CIEA 1IG9A 1YTUA 2DFFA 2OPPA 2ZE2A 3QO9A 1ASVA 3AVJA 4CEQA 4E19A 4EP4A 1SL1A 4CGHA 1T8EA 3LP3A 2D0AA 2QXFA 4FLYA 3QNOA 4CFAA 1HQEA 4FW1A 1TAQA 3VQ9A 3TABA 5J2MA 2XY8A 4CGIA 4BDYA 3B6PA 2BDPA 4FJLA 3KKSA 3ZT1A 3NH1A 1HMVA 2XO7A 3DRSA 5J2QA 1S1VA 3P1GA 3EYZA 4EZ9A 3M8PA 4EP5A 3OVNA 3OJSA 2HHXA 4CJFA 4M3YA 4M3XA 1S1UA 4CF9A 3AO3A 4E7LA 5HLFA 2YNGA 3K5OA 3O4NA 2G8VA 2BE2A 4E7KA 1RTIA 2VWKA 3L3UA 2GV9A 2FBVA 3HYFA 4ID1A 5HRRA 4FZYA 2GUIA 1EKEA 2GBZA 1KSPA 2D0CA 1RT2A 5I42A 4C8NA 4LH4A 2G8FA 4KHSA 3SZ2A 3PX6A 4KB1A 4FJ8A
chains in the Genus database with same CATH superfamily
4FPBA 4B1UB 1L3TA 1DTTA 3OYHA 3O5BA 4DV2K 4BQZA 1M1KO 1U2VB 4DV1K 5AQQA 3OYKA 2F8TA 4IOXA 3IDHA 3A5LC 3NGYA 3V6DA 1B9DA 1NK7A 3QERA 4DSJA 5GIPA 3KLIA 1S1XA 4BE1A 5BRHA 3SPZA 2OTLN 3C0BA 3ISNC 4DR4K 4DV6K 5KGXA 3NAEA 3T1HK 3VQPA 2HHUA 1A5WA 1BO5O 1KVBA 3K5MA 1HPMA 4DS4A 4WFBL 3KK3A 4Z4FA 4IFYA 3W3DA 5E41A 3W0LA 4OKJA 3C6AA 3PSIA 1Q8IA 4FZZA 3E9PA 1VK0A 1KAZA 4BREA 3VF6A 4JKDA 4A59A 3T69A 5BR8K 4DQQA 2G8IA 1RFQA 1ATRA 4FO0A 1GLBG 4WQ5A 1FXXA 5FRNA 1HKGA 1IG8A 1YJ9N 4DSIA 4X64K 4FWPA 4DFPA 1R0AA 3HPHA 1T7PA 2QWPA 4B8CA 5JVHL 5AQYA 1NJXA 4B9MA 1DTQA 3S3NA 2HMIA 5M1QA 4CESA 4O5FA 5IT9O 2IOCA 4CHZA 4DFJA 1RBTA 5C24A 3SUNA 4H0VB 3VEZA 4B1ZA 4H0OA 4WYBA 2BUPA 4EFHA 4A5AA 1DLOA 3NGZA 1Y64A 3CMAN 2HBKA 4EAHD 1E3MA 3KLFA 2A40A 3NF7A 1WAJA 2ZF5O 4RW9A 3LM2A 4KH5A 4CZFA 1Q82O 4FOIA 3JSMA 4DB3A 3IFRA 3KZBA 5HOOA 3CCSN 2I7NA 1VSFA 3TANA 4BRAA 1RBVA 4BRGA 2KZZA 4CJWA 3CPEA 3KK1A 1N33K 1MDUB 3L2WA 4FK0A 2P9IB 4OKEA 1U6ZA 5DK5A 4B1YB 2E4LA 2QKKA 3VEOA 3MN9A 3VQEA 4J2BA 5LL6Z 2OYQA 3RR8A 3LANA 4XH5A 2J4RA 5C2DA 2WBNA 2OTJN 1CZBA 3CJ1A 3PO5A 1NGEA 1CZAN 4I9QA 2I5JA 4KAZA 3PLAA 1VSIA 5KTQA 1XMQK 1N6QA 4KHPK 1U47A 2DFEA 4BGAA 5LY3A 4CGDA 1LV5A 3D45A 3U3YA 1DEJA 1TV6A 3HP9A 1D9FA 1W7AA 2P9KA 1WUAA 2O8CA 4C8OA 3E9LA 3TI0A 4WQ5C 3BF1A 3VENA 4A57A 4DR3K 1IKYA 3D2EA 1WSEA 3QEXA 4X66K 3DLGA 4HCBA 3H08A 1BUPA 4JKFA 3MXIA 4FLVA 1CLQA 4XH1A 3G0ZA 3CHWA 4JLHA 2F96A 3OY9A 3SUOA 4CE9A 4W5QA 1NJYA 2FXUA 3DLHA 1WSJA 3QMLA 3AVCA 3QEIA 4F3OA 3WQUA 1ILYA 1VSDA 5JS1A 2YKNA 1SKSA 4PKIA 4L3QA 4I2QA 1D9DA 3CF5L 3GDQA 3VN5A 2KHOA 2HNZA 1S6QA 2YJEA 2OZSA 4W5NA 1W2BM 2YNIA 4CJSA 1NWKA 3MXMA 3ATUA 2YHWA 4A2BA 4CJQA 3EN9A 1UA1A 4JI5K 4KI6A 3MEGA 1HNWK 4FWRA 4HTLA 2DTUA 4NLBA 1VQLN 2QWNA 4JD2B 2PYLA 1VQPN 4BWMA 3TAQA 3SV3A 3RWUA 4XEIA 3CCUN 1D8YA 4EHTA 4IKFA 1GOAA 3U9DA 5SZTA 3CCVN 4B1XB 3K9KA 2KZMA 3H3NO 4E1NA 3ID8A 1TYQA 4CGFA 1D4XA 4FOEA 3L4IA 1S72N 5I9EB 1LWCA 2FBXA 1HQUA 4JKHA 3VTHA 4JK9A 1RDAA 4WFAL 2NRTA 3LAMA 1GLFO 1BWFO 4B3OA 3WT0A 4B9TA 2FSNA 1YT3A 4FK4A 4FSVA 4JNEA 4C1NI 4B1VA 4XH4A 1RILA 3F9MA 3RSEA 4HVJA 2HF3A 4JRPA 4CEDA 3UE5A 4GNIA 1SQKA 3WEEA 4CEOA 3CC2N 3MAQA 3A5OC 3OYAA 1I3AA 4FM0A 1NKCA 1IKWA 4JI8K 2ZD1A 4RW8A 3L2RA 4FYDA 3RVCA 5CY4A 5M1PA 1FK9A 1NMNA 1WSHA 5JICA 1NGDA 1TKDA 1GLJO 4NCGA 4KO0A 3TAEA 3HXMA 1EWRA 4JHDA 4M41A 4BR2A 3KJVA 1S3XA 5AQHA 2HB5A 3AVAA 2UXDK 1X9JA 1JXEA 1RBSA 2NRZA 3OJUA 3LALA 1JLFA 4A2AA 5C2FA 5BN8A 2GX9A 1TKZA 3F5TA 1T6DA 3AY9A 4YOUA 4DU4A 3KKRA 2E20A 4IJAA 3OYEA 4DUYK 4DTXA 4I9LA 1NOZA 4JI7K 1JLCA 3IS9A 1GLDG 2ZJQL 1T03A 2O8DB 4CJKA 1YITN 1KXPA 3SI6A 4FWNA 3FZHA 3J80O 4M45A 3O1WA 2WUSA 3ZSOA 1P90A 2F7TA 4NCAA 3CM5A 3THWB 4NB4A 3QESA 5HRSA 3THXA 3ENHA 2YHYA 4Y1DA 3QEPA 3UKUB 5F1XA 1HLUA 2O4GA 1FW6A 4JI3K 3BZKA 5GAEP 3GG4A 3KK7A 2O8FB 1OVYA 1VQ4N 4G9ZA 3D6RA 2UU9K 3QEWA 2RHKA 2F4VK 4PA1A 2E5LK 1K8KB 3BGRA 2F9TA 1Q18A 3A2FA 3V1OA 1UOCA 2Y1IA 4FWLA 2H3GX 1NGCA 1G15A 1KLNA 3FR0A 3OBWA 3TAGA 5AFUH 3QIOA 4BG8A 1N36K 1RTDA 1J9AA 1IKVA 3PSFA 3AVHA 3QB0A 4IDHA 4DU3A 3O3HA 1G99A 2HSTA 1XHXA 2G8UA 1RCHA 4H4MA 2YJFA 4LC9B 3BEXA 3M6GA 1VSLA 4BQLA 1YXQA 3LZIA 4F4KA 4CBUA 3AV9A 3MWPA 3RTVA 2CGKA 2P9NB 3SUQA 4CEBA 3EKSA 4BR5A 3UB5A 3VEXA 4PL8A 4IBNA 1YTUA 2OPPA 2ZE2A 3LDPA 4BRKA 3EEQA 3AVJA 1SL1A 1T8EA 4EP4A 4CFAA 1HQEA 4FW1A 1TAQA 4B3TK 3DJCA 3TABA 5M1NA 4CGIA 5ADXH 4BDYA 1Z05A 3B8AX 3ZT1A 3NH1A 2HBJA 4ILJA 2XO7A 3P1GA 4EZ9A 3TSPA 4M3YA 1S1UA 4YORA 4CF9A 3AO3A 1QVGM 1KAXA 3K5OA 1ESVA 4B3MK 2FF6A 4MLHA 2GUIA 2GBZA 4M7XA 2D0CA 4DR2K 2QEXN 4C8NA 4KHSA 2G8FA 3PX6A 4FJ8A 3CCQN 3CCEN 1FJGK 1SV5A 2HNDA 2FBYA 1NKEA 1S5JA 3OYNA 3HVTA 4K41A 2ZQBA 1GOCA 4CECA 3MMVA 1NU0A 3WXKA 3A5NC 3ULEA 2D5RA 4OGEA 2O8EA 3RMCA 1Z6RA 2ZJPL 5AFUA 1NK0A 1KC8O 2B4JA 4GV3A 3ZSWA 1WAFA 4C23A 4Z4HA 4W5RA 2QWLA 2RE2A 4BVOA 3G6EN 3ENOA 2VGMA 3UKRB 2Z1GA 2KQ2A 2VYPA 4CIGA 5J2PA 3LAKA 5KPZA 4DS5A 1K73O 4IG0A 3ZT4A 1Y97A 4E7HA 1VQ6N 1RT6A 4BRFA 5HP1A 4F2RA 3EZWA 5GAGP 3CETA 3HPOA 3SLCA 3FZMA 1HUXA 4FJJA 3BZCA 1XQSC 3LP0A 1XUPO 2EX3A 4UY8O 4H5VA 4W5TA 4BRIA 5HROA 2P51A 3P39A 1K9MO 3TTCA 4AHCA 3ZT2A 1SKWA 1ITGA 1OH6A 3MCPA 4GVEA 4PKGA 4FJ7A 3VQ8A 3D2FB 2Y1JA 2CH5A 3BF3A 4OPHA 4Z4IA 1RBRA 4CJ5A 2NLXA 4DLGA 4B3RK 2DPNA 4WF9L 2W40A 3ZT3A 3L4QA 4NLCA 4DQPA 1NGFA 4FVMA 2GEMA 3HO1A 4FJ9A 4IFVA 2VQEK 1J5OA 4BDZA 1GOBA 3DI6A 1ZBSA 3VF4A 5JVGL 2ZWHA 3IMXA 3THYB 5AJ3K 3VQQA 1N32K 3K57A 1OH8A 4LFCK 3AGRA 5AQNA 2BH1A 3LDNA 3LP2A 4YOXA 4IOAL 4DF4A 3NF6A 1VSEA 3O6WA 1X1PA 1XI1A 1QQOA 4JKGB 1J5EK 3ZSZA 5CE3A 3O9TA 3C6TA 1TUUA 1VQ7N 2AA4A 3C7NB 1SAZA 1HJOA 2ETJA 3I33A 4DTJA 4WQ4C 2P9UB 3PIPL 4N5SA 3O80A 4GW6A 2LSNA 2O8BA 4H03B 1B9FA 1REVA 4DR1K 2PZSA 3DXKA 4CGJA 1YIJN 1BOTO 1Z25A 4X65K 1KFSA 3O3GA 5AZJB 4UQGA 4JKBA 1RDDA 1OH7A 4KH6A 3BDPA 4FJKA 3J7ZO 3S3OA 3DLRA 2PAVA 1RBUA 3PUFA 3GE1A 3SPYA 2A1RA 4FLXA 3EL2A 3J81O 3H45C 1JLGA 1IBMK 4FW2A 2E88A 1T6CA 3U3GA 3VETA 4BVPA 2ASPA 5BPLA 3AVLA 2FSJA 4PY5A 5BRFA 5AR0A 5FRMA 2YNFA 3DLLL 3OA9A 4AF1A 3O4QA 3TAFA 3JYTA 4QOZB 4CJLA 4CZGA 1EQYA 1RT4A 4YOYA 2JLEA 1GLCG 2G8KA 1ZBHA 1U48A 3DRRA 4ZHRA 4CZMA 3WQTA 4BC4A 3H46O 4KRFA 1T05A 4CK2A 4O0IA 5JMVA 4FJIA 5CYQA 4A5BA 4HTUA 3TPQA 1XWLA 1KAYA 2QWMA 2PYJA 1BA1A 1RT7A 4ISGA 2A1SA 4U7BA 2W6LA 3CMEN 3R9PA 1C1BA 2Q1NA 3ZX2A 1JCEA 3HPGA 2IVPA 1HKCA 3VOVA 3H6EA 1RDCA 2D0BA 1C0MA 4J8FA 4FWOA 1JL1A 5FROA 4YFUA 4IDKA 1QVFM 3WNEA 2OZMA 2VG7A 4JEPA 2HNYA 3U4LA 4L8RB 3LDSA 3KD1E 4ILHA 3VMFB 4BROA 4AH9A 4FLTA 1IBKK 4PQUA 3FZLA 4CERA 3V81A 1I39A 1WB9A 4ELUA 3D0PA 3V9ZA 1X3MA 3V4IA 3O9SA 1C6VA 2NNWA 4HWIA 2ZGZA 1X9SA 2PBDA 3NF9A 2G8WA 3ZX0A 2NRHA 5AQTA 1TGOA 3ZETA 2E2QA 1V4TA 2ASMA 3DWLA 3DXMA 1LCUA 3L0QA 4CF8A 1J54A 4ISFA 4FJNA 1YJWN 5E84A 4CZLA 2IVOA 3S9HA 4H0XB 2FC0A 4F8RA 3DOLA 3MXJA 1MWMA 3MN6A 3FGUA 5AZIA 3V1QA 3O9QA 2VG5A 4E0DA 4RG8A 1RNHA 4LF5K 4JAXA 4Z4CA 3OYLA 1L3SA 1S1WA 3NHGA 4Z0UA 1S6PA 3MN7A 1CXQA 4DTOA 1JKHA 2UXBK 3I0SA 1A5VA 4XIUA 5F2RA 4PHTX 1GLLO 4Z4EA 4BGBA 2UXCK 1NK9A 1JCFA 1BI4A 4FK2A 3NBPA 4OLAA 4QCLA 2QWRA 2ZJRL 1KVAA 3VGLA 3FE1A 3SMSA 4IFEA 2D0OA 1XC3A 5EX5A 4OPAA 3RR7A 3CJCA 3OS1A 1QE1A 5FPDA 1ASWA 1QQMA 2EHGA 5BPNA 1HNZK 1XNRK 1QQCA 1TAUA 4CBXA 2W42A 1VSJA 2Q2RA 4CBWA 1NJZA 2W6KA 3HM8A 5E26A 4H4OA 4CJVA 4BR4A 4R5PA 4BR0A 4Z94A 5BN9A 4CHYA 3NCIA 3P5JA 4KKOA 1WNSA 3KTQA 1TKXA 1HR0K 3NH0A 3N4QA 1GLEG 3CJAA 3ZYYX 5FPNA 4BG9A 3OYCA 3HM9A 1N34K 1YI2N 1QHAA 2ATQA 4RW7A 1HJRA 4PUOA 1NBWA 3DM2A 1UA0A 4G1QA 4QAGA 4DHYA 3AA3A 1JLAA 4LF8K 1JJ2M 3ZSQA 2FSKA 1WSIA 2KW4A 5FPEA 4JI4K 4K8ZA 4YDUA 1X3NA 3V9SA 4CJEA 4CJ3A 1XNQK 3C94A 5C10A 4AM7A 2X6SA 3VEYA 3MEDA 3TU5A 1SUQA 4K43A 3SNNA 4BDPA 2WC9A 2V52B 1NG9A 3VEWA 1IBLK 2O8DA 2OPRA 1Q9XA 4M3ZA 2Q36A 2O8CB 4FL9A 5C25A 2HHTA 1H1VA 2X6NA 2NRRA 1BU6O 3K5NA 5KPRA 3D2EB 4CJPA 4KPYA 4CIEA 1YJNN 5JLFA 2DFFA 1WBDA 3VESA 1ASVA 4CEQA 3N4PA 1RDUA 4H5NA 4E1JA 1NGAA 3VQ9A 4BRHA 1OH5A 3R3LA 3IKMA 5J2MA 3MK6A 2XY8A 3JS6A 3B6PA 1HMVA 1E4GT 3TTFA 1T3VA 1S1VA 3EYZA 3OVNA 3WXLA 3AAQA 2HHXA 4M3XA 3CCJN 4CI6A 3O4NA 2G8VA 2BE2A 4IWVA 3J8AA 2VWKA 3HYFA 1DGKN 3SAHA 1EKEA 3ZX3A 2AP1A 4LH4A 3SZ2A 4KB1A 2P9LA 2NZTA 4ISEA 3AVGA 4H8KA 3LDOA 1YVUA 1JLEA 3AVNA 3MEEA 2WTUA 4DCHA 3TAMA 3VQDA 4YDUC 4MDBA 3CC7N 1ATSA 2WFBA 3CI5A 4FWSA 1L3VA 2QI2A 2HOEA 1BG3A 4CEAA 5LMNK 1HRHA 1O1WA 4DKWA 3SV4A 4DWIA 5M1KA 4DFKA 4BC5A 4DSLA 2E2OA 4CFDA 1TYQB 4OKKA 4WE1A 3NVMA 1VQ5N 2YCHA 3HT3A 4V19S 3EZ5A 5JS2A 4DTNA 4FJ5A 2OCEA 3CIPA 1LAWA 1J6ZA 3VQAA 4JS4A 1QZ6A 2G8HA 3OBYA 1EWQA 4N76A 3SQ2A 3RMBA 4CGGA 4EZ6A 4J2EA 3MCAB 1TK5A 3RSEB 3NDKA 4BWJA 1RT3A 1IV0A 4RW6A 2IDOA 3WEEB 4LD0A 1VRTA 3I55N 3IG1A 4O4GA 1FKOA 4FLWA 1KLMA 2IIRA 3SQ1A 1HYZA 1BCMA 2E2PA 2VCPA 5DM6L 2HHQA 4FM2A 2VG6A 5FDLA 4DTSA 4JHDB 2QM1A 4IG3A 3GL1A 1NGHA 2QK9A 1TKTA 2PY5A 4FJHA 2A6AA 5JLHA 3OTOK 3K0SA 3T1YK 2X78A 4WFNL 2V7YA 4ID5A 4CJ7A 3AO1A 2P9SA 5KGWA 1Z26A 3VTIA 3VGMA 1UWBA 4YY3K 1GLAG 3PX4A 3MN5A 4AHTA 2WONA 4BRQA 3THVA 2HW3A 3KLEA 3H1VX 3ATVA 1EP4A 2F8SA 3QICA 5GADP 5I3UA 3OS0A 3HBTA 3LWMA 1S1TA 4AM6A 2QWOA 2UUBK 1ZC6A 3VF2A 3THXB 4O0JA 2D1KA 3VA3A 1YAGA 1T44A 1W0HA 3KLHA 4CZJA 4DQIA 5H1SQ 4JI2K 4HHTA 4OGCA 3WXMB 2NRWA 4CF2A 4NXNK 1JLQA 4HUFA 4BE2A 1EETA 3P31A 1DT9A 5EVZA 2HF4A 3K58A 4JI0K 4I6MA 1SKRA 4LF6K 1UAXA 1U04A 3TSUA 3QBWA 1YHQN 2P9PA 1YF5L 3L3VA 1NK6A 3TSQA 3SYZA 1NJWA 4BRMA 3NVKA 5AQFA 4CEEA 5KQDA 1ZBUA 4WQ4A 4GV9A 4RTFD 3CG7A 4GY2B 5J1EA 4AILC 3I56N 4CD3A 2VGNA 2HMPA 1L3UA 4ZTFA 4BACA 3KD5E 5GIOA 1HNIA 3VPZA 3G71N 1FKPA 4LSLA 3SK3A 3CQ8A 4KB0A 2Q31A 1VQ9N 4QS8A 1SL2A 4OVLA 1HYVA 3P4IA 1RT5A 3BP8A 1OVQA 3TR8A 4B08A 4A61A 2GTDA 4KHQA 4CJTA 3OYBA 2Z1JA 1QSSA 4AHVA 1KFDA 5KRSA 3AVBA 4DF8A 5AQRA 4QS9A 4FZXC 3DMJA 3H3OB 1BA0A 3ZEUA 3TAPA 4OX9K 2XY7A 5LMUK 3VQCA 4CVNE 1QSLA 4MFBA 3VQ5A 3HOSA 1U2VA 4IEIA 1VSMA 3RMDA 3R8EA 5ADXA 4RCHA 3EE9A 4M42A 3PIOL 1KD1O 4R79A 4CHPA 1SL0A 2Z1IA 4H0PA 4DQ8A 3VA0A 4LSNA 3CERA 3OYGA 4LF4K 1XHZA 1CZ9A 3M1FA 3U6FA 5GINA 3CFRA 1U4BA 2HHVA 2D4WA 1VSHA 4C1NK 2IC3A 3NE6A 1DKGD 4H0TB 4DTUA 3NH2A 3AARA 2E1YA 4YOWA 2CGJA 2YHBA 2UUCK 2ITGA 3B6OA 1NGJA 2XY5A 2HVIA 5CR4A 2OPSA 3CFPA 3DLKA 1KCFA 5HRNA 5KRTA 4BE0A 4H5TA 4AHRA 2BANA 1C1AA 3LL3A 4CK1A 3DOKA 3ULEB 1HPZA 2O8EB 5AQUA 2ITMA 1ATNA 4CEFA 5AQKA 3HJFA 4DQRA 3GOIA 2PFUA 3KLGA 3AAPA 4M7YA 3VQ6A 1EO1A 3NGIA 2KFNA 4FCYA 2NRVA 1Q86O 5IWAK 2HHSA 4BR9A 2KFZA 4KHUA 4I2PA 3DLEA 5C12A 1QHTA 4JKAA 2QKBA 4PKHA 3SMPA 2FF3B 5TKYA 4FWMA 3HL8A 2FBTA 5C15A 4HCCA 3CCMN 3TWHA 1BCOA 1MA9B 1RTHA 2I7PA 4CHOA 4NXMK 3K59A 3KWGA 1NGGA 5D3GA 5J2NA 1W9HA 3OS2A 4LFBK 3FFIA 3LM9A 3ZSXA 4OPKA 2QTDA 4E3SA 5HRPA 3RRGA 1NNEA 2V51B 4BRNA 3F9KA 4GVMA 4N41A 4C8KA 4QS7A 1IJJA 2P9IA 1LW2A 4N56A 4DSEA 1E4FT 4DMNA 4AQYK 4B9NA 4CIFA 3O3FA 2OPQA 4CFBA 1W97L 4DV5K 1LOTB 1YTAA 3JXUA 3HP6A 4CD1A 4FWKA 1A5XA 4GKJK 1TUYA 3KIOA 2YV0X 4K42A 3J7AP 1NK5A 4KTZA 3WUHA 4IO9L 4JI1K 3OYJA 3KK2A 1V4SA 1LW0A 1QTMA 3CFOA 5KQ8A 2O8BB 5LJVA 4CF1A 4I7FA 3A5MC 4LF7K 3U8XA 4Y0WA 2RPIA 3C6HA 5GAHP 1C0GA 3DXKB 1QS4A 1X9WA 3AVIA 4O55A 3AVFA 5DMRA 2GWJA 3M5RA 5CHIA 4GKKK 4IO8A 4FLUA 5AQSA 3I8DA 1VQNN 4DSFA 2JGUA 3QIPA 3J7YP 4B9SA 1BDGA 1YVNA 5HL7L 4PWDA 4DG1A 3PO4A 4B9VA 4ILGB 4AHSA 4ELTA 2RF2A 5AQJA 5AQPA 1IG9A 5AQGA 3E66A 1RGIA 3EE8A 3H1QA 4IXCA 4DV3K 4CGHA 4B1WB 2BTFA 2D0AA 3QNOA 1WBBA 5AQIA 4JD2A 4FJLA 5AQXA 5J2QA 3E9OA 3Q7CA 4EP5A 4H0YB 3U9ZA 1VAZA 3OJSA 1RDWX 3IUCA 5HLFA 3A8YA 3HTVA 1RTIA 2CH6A 3L3UA 2GV9A 4FZYA 5HRRA 3D7EO 5I42A 4YOVA 3QNNA 2YNHA 3G10A 2HBLA 2YHXA 3LZJA 3R6MA 1SZ2A 1N8RO 3C95A 4IEEA 4JK8A 3AVMA 4JYAK 2A41A 3SCXA 3M3ZA 1TK0A 3QETA 3OHRA 4BRDA 1BIZA 5BPMA 5AQOA 1X9MA 1YUWA 5CYMA 4DUZK 5AQZA 3O08A 4FWQA 3ALYA 4W5OA 3OW2M 5F0XA 4JS5A 3HRGA 4B3SK 4FXDA 3V9XA 2IS3A 3V1RA 4Q5VA 3ULDA 3VQ7A 2V7ZA 3F73A 2HVHA 1F21A 3ZETB 3DRPA 1O13A 4C8MA 4K0KK 2E1ZA 3KHYA 1NK4A 2QXLA 3DXMB 4E89A 4NCBA 3NMUA 3VERA 4EHUA 4FLZA 4NYNA 4DR6K 2XY6A 2QW9A 4DV7K 2IGIA 5CZ1A 2ZM6K 1TL3A 4OO1J 1IKXA 4DR7K 1HKBA 3FZFA 5EOYA 4DTPA 3ZCMA 5AZIB 3QFPA 3EY1A 2BGGA 3GBTA 2KLAA 4CZIA 3RMAA 1JLBA 3SBTA 5B8HA 3SAGA 5TKWA 1NLVA 4B8AB 4M3WA 3WNHA 4ZTJA 1ZYQA 2VWBA 1NM1A 3MDQA 3HSCA 4A62A 2P9KB 4YNQA 4BRPA 4LFAK 3OYFA 1BHLA 3LPUA 5ELZA 3QLHA 3P38A 1BI4B 1S22A 4JV5K 2NRXA 4HUGA 3THWA 2QA4N 3ZSVA 3HOTA 3UKUA 1KVCA 4O8KA 1VQON 3I8BA 4AHUA 1U45A 2O4IA 1VHXA 2B6AA 4M63C 3ASMA 3FLCO 5EU7A 1NJIO 1WSFA 2O8FA 3BUZB 3T19A 4O8UA 1Q7YO 1SS6A 1BQMA 1NGBA 1VSKA 3A0IX 1S9GA 3SQ0A 4O44A 4OPJA 5EY4A 1K8KA 3SUPA 1XC9A 3QDKA 2XHBA 2P5OA 1WSGA 4MQ3A 2Q97A 4DFMA 1VQMN 2FLOA 1HNXK 4ICLA 4K25A 4TSXA 3EKUA 4KI4A 3G4SN 4BC2A 5C42A 2WOMA 4RWTA 4JN4A 2Z1HA 4B9QA 2P1JA 4DR5K 2UUAK 4HUEA 4KHNA 3CQYA 1QZ5A 1ZXOA 4E7IA 3O9RA 5CZ2A 2VWJA 4DQSA 3E01A 5M1OA 1JXBA 1OKJA 2ZGYA 3QFUA 3VEVA 2IVNA 3KWIA 1ZBIA 2GWKA 4Q0BA 1BQNA 2P9NA 1TK8A 3VGKA 5AQLA 3L2QA 3PX0A 2DY4A 2RKIA 5FPMA 4CK3A 3SJHA 3G25A 4J2DA 4FJXA 3HI0A 4F2SA 4KTQA 4MDAA 2E8AA 3QINA 4EIAA 2ASOA 3HVRA 2IAJA 1Q81O 2JWKA 5K14A 3ITHA 4JI6K 2R7YA 4FM1A 1HYSA 4E7JA 3DYAA 1WOQA 3AO5A 1C1CA 1B92A 4FVUA 1JCGA 1IO2A 3ZSRA 3M8QA 5T7BA 3CM6A 4CW7B 2A3ZA 1M90O 4M3UA 1MU2A 2A5XA 3QEVA 2EWSA 3CJ7A 3L2UA 4CFCA 4Y1CA 4U67L 4CZHA 3CD6N 1S9EA 3TARA 3OYIA 3CCRN 3RRHA 2VQFK 4FPAA 3AA2A 2UYTA 4E1MA 3CJ9A 3FZKA 4DLEA 1U49A 2RN2A 3AA5X 3SAFA 3C6UA 1HX1A 2XRIA 3CPWM 4C8LA 1JL2A 1BIUA 3VQBA 3AO2A 4M3TA 4O5BA 2Q3SA 5BRDA 2Q0RA 4YOTA 5DM7L 2YX6A 3O8MA 5HBMA 2GELA 1D5AA 4CZKA 3T7ZA 3V9UA 3M8SA 3R1XA 2NUBA 1VQ8N 1ZBLA 3O4WA 4F3TA 3L6QA 4B9LA 3FFKB 1NKBA 4OJRA 1KTQA 3M8RA 1BL3A 4KREA 3CXCM 4RW4A 1NOYA 3S3MA 2P9LB 4CZEA 1LWFA 3UKRA 5BR9A 3AGKA 4DTMA 5KI6A 4FJMA 1J53A 3K9JA 4CEZA 4KFBA 3ZLJA 2X74A 3K5LA 1NGIA 1TVRA 3WNFA 3L2VA 4DSKA 4FJGA 1WLJA 4B9UA 4N47A 4KHWA 1EXQA 2W41A 3ZT0A 1WN7A 4PL7A 4DU1A 3LPTA 3OYDA 2OA8A 2QWQA 3LDLA 3MX2A 3KVGA 1K8AO 3AO4A 4BRCA 1Q9YA 3QBXA 3LP1A 4YHHK 2KTQA 1KQSM 2DFHA 4H5WA 3HZ6A 3WXJA 3UIQA 3MX5A 2F9WA 3P83D 1TL1A 1K6YA 3L8BA 2B5JA 1XMOK 1NMDA 3S41A 5KPTA 3IRXA 2HHWA 3D2FA 4ELVA 1ASUA 4WCEL 4MO5A 3E1YA 3PY8A 1RDBA 3IAYA 3F2KA 4KV8A 1BISA 4CJRA 4LY7A 3DLBA 1C0TA 1LWEA 1CXUA 3O1BA 2HHHK 4BRLA 1QQNA 4IOCL 4CHNA 1RTJA 4NO7A 4MLEA 4CCHA 3THYA 1R59O 3CC4N 5SWMA 4X62K 2AJQA 1RT1A 2E2NA 3CYMA 3MECA 2E6LA 5MLCQ 3CJBA 4JRQA 4K8XA 3AVKA 4JKGA 4KHYA 4J2AA 1LAVA 3C7NA 3AA4A 3T3FA 3K2PA 1NK8A 3CQXA 2KKZA 3T1AA 3WNGA 1KRPA 2P9UA 2P9SB 4JK7A 1ZBFA 4MO4A 3HSTB 3SBGA 4KBOA 3BY5A 4DTRA 2E6MA 5AQMA 3C65A 4JKCA 3HK2A 3Q7BA 4DV0K 3DAWA 5C0YA 3V9WA 1EX4A 4LH5A 5AZJA 2OANA 5A2QO 4GV6A 3ENBA 4KH4A 1C0UA 3JAMO 3ZSYA 4BY9C 1C0FA 1P8ZA 1L5UA 4OLBA 4NYFA 3OYMA 3LWLA 2JWLA 4KTWA 2P5GA 3SJJA 4DV4K 3I0RA 1VRUA 4M3RA 3EO3A 1VQKN 4Z4GA 1QSYA 1BGXT 2YI1A 2YKMA 5EXWA 4H5RA 1HNVA 2A42A 1IH7A 3NF8A 4CJ4A 4I6MB 3PV8A 2Q0UA 2P9PB 4CF0A 4GMJB 4CHQA 3VQ4A 3NFAA 3SQ4A 2YHAA 2D0PA 5FLXO 3ID6A 2CGLA 4CJUA 1N5YA 2HBMA 3CCLN 3QO9A 4E19A 3LP3A 4F9OA 2QXFA 3WXIA 4FLYA 1I94K 4BR7A 2BDPA 4LF9K 3KKSA 3O9UA 3DRSA 3TTDA 3LDQA 3M8PA 1MWKA 4IJNA 5BREA 4CJFA 4E7LA 2YNGA 3MWTA 5AQVA 4E7KA 5LJWA 2GUPA 4BC3A 3ZEUB 2FBVA 4ID1A 4IZ9A 1KSPA 1RT2A 5M1FA 4JKEA 5AQWA
chains in the Genus database with same CATH topology
1L3TA 3QNNA 1DTTA 3OYHA 2YNHA 3AVGA 3G10A 1SV5A 4H8KA 3LZJA 1YVUA 1JLEA 3AVNA 3MEEA 2HNDA 3TAMA 3VQDA 2FBYA 3OYKA 3C95A 1NKEA 2F8TA 1S5JA 3OYNA 3HVTA 1L3VA 2ZQBA 3AVMA 3V6DA 3NGYA 1GOCA 4CEAA 1HRHA 4CECA 1O1WA 3SV4A 3SCXA 4DWIA 2D5RA 4OGEA 4DFKA 4DSLA 3RMCA 1TK0A 4CFDA 3QETA 4WE1A 4OKKA 1B9DA 1NK7A 1NK0A 3QERA 4DSJA 3KLIA 1S1XA 2B4JA 1BIZA 4BE1A 3SPZA 3ISNC 3ZSWA 3HT3A 1X9MA 1WAFA 4Z4HA 5KGXA 5JS2A 3VQPA 4W5RA 3EZ5A 1A5WA 1KVBA 5CYMA 3K5MA 4DTNA 4DS4A 4FJ5A 2Z1GA 2KQ2A 3KK3A 3ALYA 4Z4FA 1LAWA 4IFYA 4CIGA 4W5OA 3VQAA 4JS4A 3LAKA 5J2PA 4DS5A 5E41A 4JS5A 2G8HA 4FXDA 4IG0A 3V9XA 3ZT4A 2IS3A 1Y97A 4OKJA 3V1RA 4Q5VA 3ULDA 3VQ7A 1Q8IA 4E7HA 3F73A 4N76A 1RT6A 3SQ2A 4FZZA 2HVHA 3RMBA 1F21A 1VK0A 3DRPA 4CGGA 4C8MA 1NK4A 5HP1A 4EZ6A 4E89A 4NCBA 4F2RA 4DQQA 4FLZA 4NYNA 1TK5A 4J2EA 3HPOA 3NDKA 2G8IA 4BWJA 1RT3A 2XY6A 4RW6A 2IDOA 4FJJA 2IGIA 5CZ1A 3LP0A 2KTQA 1TL3A 2EX3A 4LD0A 1FXXA 1VRTA 1IKXA 4W5TA 5HROA 3IG1A 5FRNA 2P51A 4O4GA 1FKOA 4FLWA 4DTPA 4DSIA 3ZCMA 1KLMA 3ZT2A 4AHCA 3EY1A 2BGGA 3SQ1A 1SKWA 1HYZA 1ITGA 1BCMA 3RMAA 1JLBA 4DFPA 1R0AA 3HPHA 1T7PA 4B8CA 4FJ7A 3VQ8A 4FM2A 2HHQA 2Y1JA 2VG6A 1NJXA 4B8AB 4B9MA 5FDLA 4M3WA 1DTQA 1RBRA 4CJ5A 4DTSA 4DLGA 3WNHA 3S3NA 4ZTJA 1ZYQA 4CESA 2HMIA 4IG3A 3ZT3A 2QK9A 1TKTA 2PY5A 2IOCA 4CHZA 4YNQA 3NAEA 3OYFA 4DFJA 4DQPA 4FJHA 1BHLA 1RBTA 5C24A 4FVMA 3SUNA 2X78A 3LPUA 3HO1A 3QLHA 4FJ9A 4IFVA 1DLOA 4ID5A 1BI4B 1J5OA 3AO1A 1GOBA 3DI6A 3NGZA 4BDZA 4HUGA 5KGWA 1Z26A 3VQQA 3ZSVA 3KLFA 3NF7A 3K57A 1KVCA 1UWBA 1WAJA 4AHUA 1U45A 4RW9A 2O4IA 3LP2A 2B6AA 3PX4A 4AHTA 3JSMA 3NF6A 4DF4A 3ASMA 2WONA 5EU7A 1VSEA 1X1PA 1XI1A 3THVA 1WSFA 3ZSZA 2HW3A 1VSFA 3KLEA 3TANA 3C6TA 3T19A 1RBVA 1EP4A 2F8SA 2KZZA 1BQMA 1VSKA 2ETJA 4CJWA 5I3UA 1S9GA 3OS0A 4O44A 3LWMA 4OPJA 4DTJA 3SQ0A 1S1TA 3KK1A 3SUPA 3L2WA 1XC9A 4FK0A 4OKEA 5DK5A 2XHBA 2E4LA 2QKKA 2P5OA 1WSGA 4MQ3A 3VQEA 4DFMA 4J2BA 4N5SA 4ICLA 4TSXA 4O0JA 4GW6A 2LSNA 3VA3A 4KI4A 2OYQA 3RR8A 3LANA 1W0HA 3KLHA 1B9FA 1REVA 5C42A 2PZSA 2WOMA 4DQIA 4HHTA 1CZBA 2Z1HA 3PO5A 4OGCA 2P1JA 4CGJA 4I9QA 1Z25A 2I5JA 4CF2A 4HUEA 1JLQA 4HUFA 3O3GA 1KFSA 4KAZA 4UQGA 4KHNA 4E7IA 1VSIA 5KTQA 1N6QA 4BE2A 1EETA 1U47A 2HHUA 1RDDA 2DFEA 5CZ2A 2VWJA 4DQSA 4CGDA 3K58A 1LV5A 3D45A 3E01A 1JXBA 3U3YA 1SKRA 3BDPA 1TV6A 4FJKA 1UAXA 1U04A 3HP9A 3DLRA 3S3OA 1D9FA 1RBUA 3PUFA 3SPYA 4C8OA 2A1RA 3TI0A 3L3VA 4FLXA 1NK6A 1ZBIA 4Q0BA 1BQNA 3SYZA 1NJWA 1TK8A 3L2QA 1IKYA 3PX0A 1JLGA 1WSEA 3QEXA 2DY4A 3DLGA 2RKIA 4HCBA 4FW2A 3H08A 4CK3A 4CEEA 1ZBUA 4J2DA 3MXIA 4FJXA 3CG7A 3U3GA 4FLVA 4F2SA 1CLQA 4KTQA 5J1EA 4AILC 3QINA 3AVLA 3G0ZA 4JLHA 4PY5A 3HVRA 2F96A 2IAJA 3OY9A 3SUOA 5FRMA 1L3UA 4CE9A 4W5QA 5K14A 4BACA 2YNFA 1WSJA 4ZTFA 1NJYA 3ITHA 1HNIA 3AVCA 3QEIA 3KD5E 4F3OA 1FKPA 3O4QA 4LSLA 3CQ8A 2R7YA 4KB0A 4FM1A 3TAFA 1VSDA 3JYTA 4QOZB 1HYSA 4E7JA 2YKNA 4CJLA 3DYAA 1SKSA 5JS1A 1SL2A 3AO5A 1C1CA 1B92A 1RT4A 4I2QA 4OVLA 1D9DA 1HYVA 2JLEA 3VN5A 1IO2A 2HNZA 2G8KA 1ZBHA 1RT5A 1S6QA 3ZSRA 3M8QA 5T7BA 3CM6A 3DRRA 4ZHRA 1U48A 4M3UA 1MU2A 3TR8A 4B08A 3QEVA 4KHQA 4W5NA 2OZSA 4CJTA 3OYBA 4KRFA 3L2UA 4CFCA 2Z1JA 4CK2A 1T05A 4O0IA 1QSSA 4Y1CA 1KFDA 4AHVA 4FJIA 5KRSA 3AVBA 2YNIA 5CYQA 4DF8A 1S9EA 4CJSA 3OYIA 3RRHA 3TARA 3MXMA 3AA2A 4HTUA 4FZXC 1XWLA 4CJQA 3DMJA 4E1MA 2PYJA 1RT7A 1UA1A 2A1SA 4KI6A 3MEGA 3TAPA 4DLEA 2XY7A 1U49A 2DTUA 2RN2A 3AA5X 1C1BA 2PYLA 4BWMA 3VQCA 3C6UA 2XRIA 3HPGA 3SV3A 3TAQA 4MFBA 3VQ5A 1QSLA 4C8LA 3RWUA 1RDCA 1JL2A 1BIUA 3VQBA 1D8YA 1VSMA 2D0BA 1C0MA 3AO2A 4O5BA 3RMDA 4M3TA 2Q3SA 4Z4IA 1JL1A 5FROA 4YFUA 4IDKA 4IKFA 4M42A 1GOAA 5HBMA 3WNEA 2OZMA 1D5AA 2VG7A 5SZTA 2HNYA 4CHPA 3V9UA 3M8SA 4L8RB 1SL0A 2Z1IA 2NUBA 3LDSA 1ZBLA 3VA0A 3KD1E 4F3TA 4LSNA 2KZMA 4B9LA 1NKBA 4E1NA 3OYGA 4OJRA 4AH9A 4FLTA 1CZ9A 1KTQA 4CGFA 3M8RA 3CFRA 1BL3A 3U6FA 1XHZA 1U4BA 4KREA 2HHVA 1VSHA 2IC3A 4RW4A 3NE6A 1NOYA 3S3MA 4PQUA 4DTUA 1LWCA 2FBXA 1HQUA 3NH2A 4CERA 1LWFA 3V81A 1I39A 1RDAA 2YHBA 4DTMA 2ITGA 3LAMA 3B6OA 5KI6A 3D0PA 3V9ZA 3V4IA 4ELUA 4FJMA 1J53A 2XY5A 4B3OA 2HVIA 1C6VA 1X9SA 2OPSA 4CEZA 4B9TA 3CFPA 3DLKA 4KFBA 1KCFA 2X74A 1YT3A 3NF9A 5HRNA 2G8WA 4FK4A 5KRTA 3K5LA 4BE0A 1TVRA 1TGOA 4AHRA 2BANA 1C1AA 3WNFA 3L2VA 4CK1A 3DOKA 4DSKA 1HPZA 4FJGA 1RILA 1WLJA 4B9UA 4N47A 4KHWA 1EXQA 3ZT0A 4HVJA 4JRPA 4CEDA 1WN7A 4DU1A 4CEFA 3LPTA 4CF8A 3OYDA 2OA8A 3HJFA 1J54A 4DQRA 4FJNA 4CEOA 3MAQA 3KLGA 3AO4A 3S9HA 3OYAA 1I3AA 4FM0A 3LP1A 1IKWA 1NKCA 3VQ6A 1Q9YA 2FC0A 2DFHA 2ZD1A 4F8RA 3DOLA 3MXJA 4RW8A 3UIQA 3L2RA 3P83D 4FYDA 3V1QA 1TL1A 1K6YA 2VG5A 5CY4A 3NGIA 3L8BA 4FCYA 4E0DA 2KFNA 4RG8A 1FK9A 2HHSA 1RNHA 1WSHA 2B5JA 4Z4CA 3OYLA 2KFZA 1L3SA 1S1WA 3NHGA 4KHUA 1TKDA 3IRXA 2HHWA 4Z0UA 4I2PA 1S6PA 4KO0A 4NCGA 3TAEA 4ELVA 1ASUA 3HXMA 3KJVA 3DLEA 4M41A 1CXQA 4DTOA 1QHTA 1JKHA 2HB5A 3I0SA 2QKBA 1A5VA 4XIUA 3PY8A 1RDBA 3IAYA 3AVAA 3HL8A 4KV8A 2FBTA 1BISA 1JXEA 1RBSA 4CJRA 4HCCA 4LY7A 3DLBA 1C0TA 1LWEA 3OJUA 3TWHA 1BCOA 1RTHA 4CHOA 3LALA 1CXUA 1JLFA 4Z4EA 1NK9A 4CHNA 4FK2A 1BI4A 1RTJA 3NBPA 4OLAA 4QCLA 1TKZA 3K59A 4CCHA 1KVAA 5SWMA 5D3GA 5J2NA 2AJQA 4DU4A 1W9HA 1RT1A 3KKRA 3OS2A 3CYMA 3FFIA 3MECA 2E6LA 3ZSXA 3OYEA 4OPKA 4DTXA 4E3SA 4I9LA 1NOZA 5HRPA 4JRQA 3RR7A 3OS1A 3RRGA 4K8XA 1JLCA 1QE1A 3IS9A 1T03A 1ASWA 3F9KA 4CJKA 2EHGA 4GVMA 3AVKA 4N41A 4KHYA 3SI6A 4J2AA 1QQCA 1LAVA 1TAUA 2W42A 1VSJA 4C8KA 1NJZA 3AA4A 4H4OA 4M45A 3K2PA 3T3FA 1NK8A 4CJVA 3T1AA 3ZSOA 4R5PA 3WNGA 4CHYA 3NCIA 4NCAA 1KRPA 1LW2A 4N56A 3CM5A 4DSEA 3P5JA 4KKOA 4DMNA 1WNSA 3QESA 1ZBFA 3KTQA 3HSTB 1TKXA 5HRSA 3NH0A 4Y1DA 3QEPA 4B9NA 4CIFA 3OYCA 3HM9A 4DTRA 3O3FA 2E6MA 2OPQA 4CFBA 2ATQA 3HK2A 4RW7A 1HJRA 4PUOA 3DM2A 1YTAA 1UA0A 3V9WA 3HP6A 2O4GA 1EX4A 4LH5A 4G1QA 1A5XA 4QAGA 3KIOA 2YV0X 3AA3A 1JLAA 3DLHA 1NK5A 4KTZA 3QEWA 1C0UA 3ZSQA 3OYJA 4PA1A 1WSIA 3BGRA 3KK2A 3A2FA 2KW4A 3V1OA 3ZSYA 1UOCA 1L5UA 2Y1IA 4K8ZA 1LW0A 1QTMA 3CFOA 3V9SA 4NYFA 4OLBA 4CJEA 1G15A 4CJ3A 3OYMA 1KLNA 3LWLA 4KTWA 4CF1A 4I7FA 3SJJA 3TAGA 2P5GA 3QIOA 3I0RA 1VRUA 3C94A 2RPIA 4M3RA 1RTDA 1J9AA 2X6SA 1QS4A 1X9WA 3MEDA 3AVIA 1QSYA 1IKVA 4Z4GA 1BGXT 4O55A 2YKMA 1SUQA 3AVFA 3AVHA 5DMRA 4DU3A 3SNNA 3O3HA 4BDPA 1XHXA 1HNVA 1RCHA 2G8UA 4H4MA 1IH7A 4FLUA 3NF8A 4CJ4A 3I8DA 1VSLA 3PV8A 2OPRA 4DSFA 1Q9XA 2JGUA 3LZIA 4M3ZA 3QIPA 4B9SA 4F4KA 5C25A 4CF0A 4PWDA 2HHTA 2X6NA 3AV9A 4GMJB 4DG1A 4CHQA 3PO4A 3VQ4A 3RTVA 4B9VA 3NFAA 3K5NA 3SUQA 4AHSA 4CEBA 3SQ4A 2YHAA 4CJPA 4ELTA 2RF2A 4CJUA 1N5YA 4KPYA 4IBNA 4CIEA 1IG9A 1YTUA 2DFFA 2OPPA 2ZE2A 3QO9A 1ASVA 3AVJA 4CEQA 4E19A 4EP4A 1SL1A 4CGHA 1T8EA 3LP3A 2D0AA 2QXFA 4FLYA 3QNOA 4CFAA 1HQEA 4FW1A 1TAQA 3VQ9A 3TABA 5J2MA 2XY8A 4CGIA 4BDYA 3B6PA 2BDPA 4FJLA 3KKSA 3ZT1A 3NH1A 1HMVA 2XO7A 3DRSA 5J2QA 1S1VA 3P1GA 3EYZA 4EZ9A 3M8PA 4EP5A 3OVNA 3OJSA 2HHXA 4CJFA 4M3YA 4M3XA 1S1UA 4CF9A 3AO3A 4E7LA 5HLFA 2YNGA 3K5OA 3O4NA 2G8VA 2BE2A 4E7KA 1RTIA 2VWKA 3L3UA 2GV9A 2FBVA 3HYFA 4ID1A 5HRRA 4FZYA 2GUIA 1EKEA 2GBZA 1KSPA 2D0CA 1RT2A 5I42A 4C8NA 4LH4A 2G8FA 4KHSA 3SZ2A 3PX6A 4KB1A 4FJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3T A;  3QNN A;  1DTT A;  3OYH A;  2YNH A;  3AVG A;  3G10 A;  1SV5 A;  4H8K A;  3LZJ A;  1YVU A;  1JLE A;  3AVN A;  3MEE A;  2HND A;  3TAM A;  3VQD A;  2FBY A;  3OYK A;  3C95 A;  1NKE A;  2F8T A;  1S5J A;  3OYN A;  3HVT A;  1L3V A;  2ZQB A;  3AVM A;  3V6D A;  3NGY A;  1GOC A;  4CEA A;  1HRH A;  4CEC A;  1O1W A;  3SV4 A;  3SCX A;  4DWI A;  2D5R A;  4OGE A;  4DFK A;  4DSL A;  3RMC A;  1TK0 A;  4CFD A;  3QET A;  4WE1 A;  4OKK A;  1B9D A;  1NK7 A;  1NK0 A;  3QER A;  4DSJ A;  3KLI A;  1S1X A;  2B4J A;  1BIZ A;  4BE1 A;  3SPZ A;  3ISN C;  3ZSW A;  3HT3 A;  1X9M A;  1WAF A;  4Z4H A;  5KGX A;  5JS2 A;  3VQP A;  4W5R A;  3EZ5 A;  1A5W A;  1KVB A;  5CYM A;  3K5M A;  4DTN A;  4DS4 A;  4FJ5 A;  2Z1G A;  2KQ2 A;  3KK3 A;  3ALY A;  4Z4F A;  1LAW A;  4IFY A;  4CIG A;  4W5O A;  3VQA A;  4JS4 A;  3LAK A;  5J2P A;  4DS5 A;  5E41 A;  4JS5 A;  2G8H A;  4FXD A;  4IG0 A;  3V9X A;  3ZT4 A;  2IS3 A;  1Y97 A;  4OKJ A;  3V1R A;  4Q5V A;  3ULD A;  3VQ7 A;  1Q8I A;  4E7H A;  3F73 A;  4N76 A;  1RT6 A;  3SQ2 A;  4FZZ A;  2HVH A;  3RMB A;  1F21 A;  1VK0 A;  3DRP A;  4CGG A;  4C8M A;  1NK4 A;  5HP1 A;  4EZ6 A;  4E89 A;  4NCB A;  4F2R A;  4DQQ A;  4FLZ A;  4NYN A;  1TK5 A;  4J2E A;  3HPO A;  3NDK A;  2G8I A;  4BWJ A;  1RT3 A;  2XY6 A;  4RW6 A;  2IDO A;  4FJJ A;  2IGI A;  5CZ1 A;  3LP0 A;  2KTQ A;  1TL3 A;  2EX3 A;  4LD0 A;  1FXX A;  1VRT A;  1IKX A;  4W5T A;  5HRO A;  3IG1 A;  5FRN A;  2P51 A;  4O4G A;  1FKO A;  4FLW A;  4DTP A;  4DSI A;  3ZCM A;  1KLM A;  3ZT2 A;  4AHC A;  3EY1 A;  2BGG A;  3SQ1 A;  1SKW A;  1HYZ A;  1ITG A;  1BCM A;  3RMA A;  1JLB A;  4DFP A;  1R0A A;  3HPH A;  1T7P A;  4B8C A;  4FJ7 A;  3VQ8 A;  4FM2 A;  2HHQ A;  2Y1J A;  2VG6 A;  1NJX A;  4B8A B;  4B9M A;  5FDL A;  4M3W A;  1DTQ A;  1RBR A;  4CJ5 A;  4DTS A;  4DLG A;  3WNH A;  3S3N A;  4ZTJ A;  1ZYQ A;  4CES A;  2HMI A;  4IG3 A;  3ZT3 A;  2QK9 A;  1TKT A;  2PY5 A;  2IOC A;  4CHZ A;  4YNQ A;  3NAE A;  3OYF A;  4DFJ A;  4DQP A;  4FJH A;  1BHL A;  1RBT A;  5C24 A;  4FVM A;  3SUN A;  2X78 A;  3LPU A;  3HO1 A;  3QLH A;  4FJ9 A;  4IFV A;  1DLO A;  4ID5 A;  1BI4 B;  1J5O A;  3AO1 A;  1GOB A;  3DI6 A;  3NGZ A;  4BDZ A;  4HUG A;  5KGW A;  1Z26 A;  3VQQ A;  3ZSV A;  3KLF A;  3NF7 A;  3K57 A;  1KVC A;  1UWB A;  1WAJ A;  4AHU A;  1U45 A;  4RW9 A;  2O4I A;  3LP2 A;  2B6A A;  3PX4 A;  4AHT A;  3JSM A;  3NF6 A;  4DF4 A;  3ASM A;  2WON A;  5EU7 A;  1VSE A;  1X1P A;  1XI1 A;  3THV A;  1WSF A;  3ZSZ A;  2HW3 A;  1VSF A;  3KLE A;  3TAN A;  3C6T A;  3T19 A;  1RBV A;  1EP4 A;  2F8S A;  2KZZ A;  1BQM A;  1VSK A;  2ETJ A;  4CJW A;  5I3U A;  1S9G A;  3OS0 A;  4O44 A;  3LWM A;  4OPJ A;  4DTJ A;  3SQ0 A;  1S1T A;  3KK1 A;  3SUP A;  3L2W A;  1XC9 A;  4FK0 A;  4OKE A;  5DK5 A;  2XHB A;  2E4L A;  2QKK A;  2P5O A;  1WSG A;  4MQ3 A;  3VQE A;  4DFM A;  4J2B A;  4N5S A;  4ICL A;  4TSX A;  4O0J A;  4GW6 A;  2LSN A;  3VA3 A;  4KI4 A;  2OYQ A;  3RR8 A;  3LAN A;  1W0H A;  3KLH A;  1B9F A;  1REV A;  5C42 A;  2PZS A;  2WOM A;  4DQI A;  4HHT A;  1CZB A;  2Z1H A;  3PO5 A;  4OGC A;  2P1J A;  4CGJ A;  4I9Q A;  1Z25 A;  2I5J A;  4CF2 A;  4HUE A;  1JLQ A;  4HUF A;  3O3G A;  1KFS A;  4KAZ A;  4UQG A;  4KHN A;  4E7I A;  1VSI A;  5KTQ A;  1N6Q A;  4BE2 A;  1EET A;  1U47 A;  2HHU A;  1RDD A;  2DFE A;  5CZ2 A;  2VWJ A;  4DQS A;  4CGD A;  3K58 A;  1LV5 A;  3D45 A;  3E01 A;  1JXB A;  3U3Y A;  1SKR A;  3BDP A;  1TV6 A;  4FJK A;  1UAX A;  1U04 A;  3HP9 A;  3DLR A;  3S3O A;  1D9F A;  1RBU A;  3PUF A;  3SPY A;  4C8O A;  2A1R A;  3TI0 A;  3L3V A;  4FLX A;  1NK6 A;  1ZBI A;  4Q0B A;  1BQN A;  3SYZ A;  1NJW A;  1TK8 A;  3L2Q A;  1IKY A;  3PX0 A;  1JLG A;  1WSE A;  3QEX A;  2DY4 A;  3DLG A;  2RKI A;  4HCB A;  4FW2 A;  3H08 A;  4CK3 A;  4CEE A;  1ZBU A;  4J2D A;  3MXI A;  4FJX A;  3CG7 A;  3U3G A;  4FLV A;  4F2S A;  1CLQ A;  4KTQ A;  5J1E A;  4AIL C;  3QIN A;  3AVL A;  3G0Z A;  4JLH A;  4PY5 A;  3HVR A;  2F96 A;  2IAJ A;  3OY9 A;  3SUO A;  5FRM A;  1L3U A;  4CE9 A;  4W5Q A;  5K14 A;  4BAC A;  2YNF A;  1WSJ A;  4ZTF A;  1NJY A;  3ITH A;  1HNI A;  3AVC A;  3QEI A;  3KD5 E;  4F3O A;  1FKP A;  3O4Q A;  4LSL A;  3CQ8 A;  2R7Y A;  4KB0 A;  4FM1 A;  3TAF A;  1VSD A;  3JYT A;  4QOZ B;  1HYS A;  4E7J A;  2YKN A;  4CJL A;  3DYA A;  1SKS A;  5JS1 A;  1SL2 A;  3AO5 A;  1C1C A;  1B92 A;  1RT4 A;  4I2Q A;  4OVL A;  1D9D A;  1HYV A;  2JLE A;  3VN5 A;  1IO2 A;  2HNZ A;  2G8K A;  1ZBH A;  1RT5 A;  1S6Q A;  3ZSR A;  3M8Q A;  5T7B A;  3CM6 A;  3DRR A;  4ZHR A;  1U48 A;  4M3U A;  1MU2 A;  3TR8 A;  4B08 A;  3QEV A;  4KHQ A;  4W5N A;  2OZS A;  4CJT A;  3OYB A;  4KRF A;  3L2U A;  4CFC A;  2Z1J A;  4CK2 A;  1T05 A;  4O0I A;  1QSS A;  4Y1C A;  1KFD A;  4AHV A;  4FJI A;  5KRS A;  3AVB A;  2YNI A;  5CYQ A;  4DF8 A;  1S9E A;  4CJS A;  3OYI A;  3RRH A;  3TAR A;  3MXM A;  3AA2 A;  4HTU A;  4FZX C;  1XWL A;  4CJQ A;  3DMJ A;  4E1M A;  2PYJ A;  1RT7 A;  1UA1 A;  2A1S A;  4KI6 A;  3MEG A;  3TAP A;  4DLE A;  2XY7 A;  1U49 A;  2DTU A;  2RN2 A;  3AA5 X;  1C1B A;  2PYL A;  4BWM A;  3VQC A;  3C6U A;  2XRI A;  3HPG A;  3SV3 A;  3TAQ A;  4MFB A;  3VQ5 A;  1QSL A;  4C8L A;  3RWU A;  1RDC A;  1JL2 A;  1BIU A;  3VQB A;  1D8Y A;  1VSM A;  2D0B A;  1C0M A;  3AO2 A;  4O5B A;  3RMD A;  4M3T A;  2Q3S A;  4Z4I A;  1JL1 A;  5FRO A;  4YFU A;  4IDK A;  4IKF A;  4M42 A;  1GOA A;  5HBM A;  3WNE A;  2OZM A;  1D5A A;  2VG7 A;  5SZT A;  2HNY A;  4CHP A;  3V9U A;  3M8S A;  4L8R B;  1SL0 A;  2Z1I A;  2NUB A;  3LDS A;  1ZBL A;  3VA0 A;  3KD1 E;  4F3T A;  4LSN A;  2KZM A;  4B9L A;  1NKB A;  4E1N A;  3OYG A;  4OJR A;  4AH9 A;  4FLT A;  1CZ9 A;  1KTQ A;  4CGF A;  3M8R A;  3CFR A;  1BL3 A;  3U6F A;  1XHZ A;  1U4B A;  4KRE A;  2HHV A;  1VSH A;  2IC3 A;  4RW4 A;  3NE6 A;  1NOY A;  3S3M A;  4PQU A;  4DTU A;  1LWC A;  2FBX A;  1HQU A;  3NH2 A;  4CER A;  1LWF A;  3V81 A;  1I39 A;  1RDA A;  2YHB A;  4DTM A;  2ITG A;  3LAM A;  3B6O A;  5KI6 A;  3D0P A;  3V9Z A;  3V4I A;  4ELU A;  4FJM A;  1J53 A;  2XY5 A;  4B3O A;  2HVI A;  1C6V A;  1X9S A;  2OPS A;  4CEZ A;  4B9T A;  3CFP A;  3DLK A;  4KFB A;  1KCF A;  2X74 A;  1YT3 A;  3NF9 A;  5HRN A;  2G8W A;  4FK4 A;  5KRT A;  3K5L A;  4BE0 A;  1TVR A;  1TGO A;  4AHR A;  2BAN A;  1C1A A;  3WNF A;  3L2V A;  4CK1 A;  3DOK A;  4DSK A;  1HPZ A;  4FJG A;  1RIL A;  1WLJ A;  4B9U A;  4N47 A;  4KHW A;  1EXQ A;  3ZT0 A;  4HVJ A;  4JRP A;  4CED A;  1WN7 A;  4DU1 A;  4CEF A;  3LPT A;  4CF8 A;  3OYD A;  2OA8 A;  3HJF A;  1J54 A;  4DQR A;  4FJN A;  4CEO A;  3MAQ A;  3KLG A;  3AO4 A;  3S9H A;  3OYA A;  1I3A A;  4FM0 A;  3LP1 A;  1IKW A;  1NKC A;  3VQ6 A;  1Q9Y A;  2FC0 A;  2DFH A;  2ZD1 A;  4F8R A;  3DOL A;  3MXJ A;  4RW8 A;  3UIQ A;  3L2R A;  3P83 D;  4FYD A;  3V1Q A;  1TL1 A;  1K6Y A;  2VG5 A;  5CY4 A;  3NGI A;  3L8B A;  4FCY A;  4E0D A;  2KFN A;  4RG8 A;  1FK9 A;  2HHS A;  1RNH A;  1WSH A;  2B5J A;  4Z4C A;  3OYL A;  2KFZ A;  1L3S A;  1S1W A;  3NHG A;  4KHU A;  1TKD A;  3IRX A;  2HHW A;  4Z0U A;  4I2P A;  1S6P A;  4KO0 A;  4NCG A;  3TAE A;  4ELV A;  1ASU A;  3HXM A;  3KJV A;  3DLE A;  4M41 A;  1CXQ A;  4DTO A;  1QHT A;  1JKH A;  2HB5 A;  3I0S A;  2QKB A;  1A5V A;  4XIU A;  3PY8 A;  1RDB A;  3IAY A;  3AVA A;  3HL8 A;  4KV8 A;  2FBT A;  1BIS A;  1JXE A;  1RBS A;  4CJR A;  4HCC A;  4LY7 A;  3DLB A;  1C0T A;  1LWE A;  3OJU A;  3TWH A;  1BCO A;  1RTH A;  4CHO A;  3LAL A;  1CXU A;  1JLF A;  4Z4E A;  1NK9 A;  4CHN A;  4FK2 A;  1BI4 A;  1RTJ A;  3NBP A;  4OLA A;  4QCL A;  1TKZ A;  3K59 A;  4CCH A;  1KVA A;  5SWM A;  5D3G A;  5J2N A;  2AJQ A;  4DU4 A;  1W9H A;  1RT1 A;  3KKR A;  3OS2 A;  3CYM A;  3FFI A;  3MEC A;  2E6L A;  3ZSX A;  3OYE A;  4OPK A;  4DTX A;  4E3S A;  4I9L A;  1NOZ A;  5HRP A;  4JRQ A;  3RR7 A;  3OS1 A;  3RRG A;  4K8X A;  1JLC A;  1QE1 A;  3IS9 A;  1T03 A;  1ASW A;  3F9K A;  4CJK A;  2EHG A;  4GVM A;  3AVK A;  4N41 A;  4KHY A;  3SI6 A;  4J2A A;  1QQC A;  1LAV A;  1TAU A;  2W42 A;  1VSJ A;  4C8K A;  1NJZ A;  3AA4 A;  4H4O A;  4M45 A;  3K2P A;  3T3F A;  1NK8 A;  4CJV A;  3T1A A;  3ZSO A;  4R5P A;  3WNG A;  4CHY A;  3NCI A;  4NCA A;  1KRP A;  1LW2 A;  4N56 A;  3CM5 A;  4DSE A;  3P5J A;  4KKO A;  4DMN A;  1WNS A;  3QES A;  1ZBF A;  3KTQ A;  3HST B;  1TKX A;  5HRS A;  3NH0 A;  4Y1D A;  3QEP A;  4B9N A;  4CIF A;  3OYC A;  3HM9 A;  4DTR A;  3O3F A;  2E6M A;  2OPQ A;  4CFB A;  2ATQ A;  3HK2 A;  4RW7 A;  1HJR A;  4PUO A;  3DM2 A;  1YTA A;  1UA0 A;  3V9W A;  3HP6 A;  2O4G A;  1EX4 A;  4LH5 A;  4G1Q A;  1A5X A;  4QAG A;  3KIO A;  2YV0 X;  3AA3 A;  1JLA A;  3DLH A;  1NK5 A;  4KTZ A;  3QEW A;  1C0U A;  3ZSQ A;  3OYJ A;  4PA1 A;  1WSI A;  3BGR A;  3KK2 A;  3A2F A;  2KW4 A;  3V1O A;  3ZSY A;  1UOC A;  1L5U A;  2Y1I A;  4K8Z A;  1LW0 A;  1QTM A;  3CFO A;  3V9S A;  4NYF A;  4OLB A;  4CJE A;  1G15 A;  4CJ3 A;  3OYM A;  1KLN A;  3LWL A;  4KTW A;  4CF1 A;  4I7F A;  3SJJ A;  3TAG A;  2P5G A;  3QIO A;  3I0R A;  1VRU A;  3C94 A;  2RPI A;  4M3R A;  1RTD A;  1J9A A;  2X6S A;  1QS4 A;  1X9W A;  3MED A;  3AVI A;  1QSY A;  1IKV A;  4Z4G A;  1BGX T;  4O55 A;  2YKM A;  1SUQ A;  3AVF A;  3AVH A;  5DMR A;  4DU3 A;  3SNN A;  3O3H A;  4BDP A;  1XHX A;  1HNV A;  1RCH A;  2G8U A;  4H4M A;  1IH7 A;  4FLU A;  3NF8 A;  4CJ4 A;  3I8D A;  1VSL A;  3PV8 A;  2OPR A;  4DSF A;  1Q9X A;  2JGU A;  3LZI A;  4M3Z A;  3QIP A;  4B9S A;  4F4K A;  5C25 A;  4CF0 A;  4PWD A;  2HHT A;  2X6N A;  3AV9 A;  4GMJ B;  4DG1 A;  4CHQ A;  3PO4 A;  3VQ4 A;  3RTV A;  4B9V A;  3NFA A;  3K5N A;  3SUQ A;  4AHS A;  4CEB A;  3SQ4 A;  2YHA A;  4CJP A;  4ELT A;  2RF2 A;  4CJU A;  1N5Y A;  4KPY A;  4IBN A;  4CIE A;  1IG9 A;  1YTU A;  2DFF A;  2OPP A;  2ZE2 A;  3QO9 A;  1ASV A;  3AVJ A;  4CEQ A;  4E19 A;  4EP4 A;  1SL1 A;  4CGH A;  1T8E A;  3LP3 A;  2D0A A;  2QXF A;  4FLY A;  3QNO A;  4CFA A;  1HQE A;  4FW1 A;  1TAQ A;  3VQ9 A;  3TAB A;  5J2M A;  2XY8 A;  4CGI A;  4BDY A;  3B6P A;  2BDP A;  4FJL A;  3KKS A;  3ZT1 A;  3NH1 A;  1HMV A;  2XO7 A;  3DRS A;  5J2Q A;  1S1V A;  3P1G A;  3EYZ A;  4EZ9 A;  3M8P A;  4EP5 A;  3OVN A;  3OJS A;  2HHX A;  4CJF A;  4M3Y A;  4M3X A;  1S1U A;  4CF9 A;  3AO3 A;  4E7L A;  5HLF A;  2YNG A;  3K5O A;  3O4N A;  2G8V A;  2BE2 A;  4E7K A;  1RTI A;  2VWK A;  3L3U A;  2GV9 A;  2FBV A;  3HYF A;  4ID1 A;  5HRR A;  4FZY A;  2GUI A;  1EKE A;  2GBZ A;  1KSP A;  2D0C A;  1RT2 A;  5I42 A;  4C8N A;  4LH4 A;  2G8F A;  4KHS A;  3SZ2 A;  3PX6 A;  4KB1 A;  4FJ8 A; 
#chains in the Genus database with same CATH topology
 4FPB A;  4B1U B;  1L3T A;  1DTT A;  3OYH A;  3O5B A;  4DV2 K;  4BQZ A;  1M1K O;  1U2V B;  4DV1 K;  5AQQ A;  3OYK A;  2F8T A;  4IOX A;  3IDH A;  3A5L C;  3NGY A;  3V6D A;  1B9D A;  1NK7 A;  3QER A;  4DSJ A;  5GIP A;  3KLI A;  1S1X A;  4BE1 A;  5BRH A;  3SPZ A;  2OTL N;  3C0B A;  3ISN C;  4DR4 K;  4DV6 K;  5KGX A;  3NAE A;  3T1H K;  3VQP A;  2HHU A;  1A5W A;  1BO5 O;  1KVB A;  3K5M A;  1HPM A;  4DS4 A;  4WFB L;  3KK3 A;  4Z4F A;  4IFY A;  3W3D A;  5E41 A;  3W0L A;  4OKJ A;  3C6A A;  3PSI A;  1Q8I A;  4FZZ A;  3E9P A;  1VK0 A;  1KAZ A;  4BRE A;  3VF6 A;  4JKD A;  4A59 A;  3T69 A;  5BR8 K;  4DQQ A;  2G8I A;  1RFQ A;  1ATR A;  4FO0 A;  1GLB G;  4WQ5 A;  1FXX A;  5FRN A;  1HKG A;  1IG8 A;  1YJ9 N;  4DSI A;  4X64 K;  4FWP A;  4DFP A;  1R0A A;  3HPH A;  1T7P A;  2QWP A;  4B8C A;  5JVH L;  5AQY A;  1NJX A;  4B9M A;  1DTQ A;  3S3N A;  2HMI A;  5M1Q A;  4CES A;  4O5F A;  5IT9 O;  2IOC A;  4CHZ A;  4DFJ A;  1RBT A;  5C24 A;  3SUN A;  4H0V B;  3VEZ A;  4B1Z A;  4H0O A;  4WYB A;  2BUP A;  4EFH A;  4A5A A;  1DLO A;  3NGZ A;  1Y64 A;  3CMA N;  2HBK A;  4EAH D;  1E3M A;  3KLF A;  2A40 A;  3NF7 A;  1WAJ A;  2ZF5 O;  4RW9 A;  3LM2 A;  4KH5 A;  4CZF A;  1Q82 O;  4FOI A;  3JSM A;  4DB3 A;  3IFR A;  3KZB A;  5HOO A;  3CCS N;  2I7N A;  1VSF A;  3TAN A;  4BRA A;  1RBV A;  4BRG A;  2KZZ A;  4CJW A;  3CPE A;  3KK1 A;  1N33 K;  1MDU B;  3L2W A;  4FK0 A;  2P9I B;  4OKE A;  1U6Z A;  5DK5 A;  4B1Y B;  2E4L A;  2QKK A;  3VEO A;  3MN9 A;  3VQE A;  4J2B A;  5LL6 Z;  2OYQ A;  3RR8 A;  3LAN A;  4XH5 A;  2J4R A;  5C2D A;  2WBN A;  2OTJ N;  1CZB A;  3CJ1 A;  3PO5 A;  1NGE A;  1CZA N;  4I9Q A;  2I5J A;  4KAZ A;  3PLA A;  1VSI A;  5KTQ A;  1XMQ K;  1N6Q A;  4KHP K;  1U47 A;  2DFE A;  4BGA A;  5LY3 A;  4CGD A;  1LV5 A;  3D45 A;  3U3Y A;  1DEJ A;  1TV6 A;  3HP9 A;  1D9F A;  1W7A A;  2P9K A;  1WUA A;  2O8C A;  4C8O A;  3E9L A;  3TI0 A;  4WQ5 C;  3BF1 A;  3VEN A;  4A57 A;  4DR3 K;  1IKY A;  3D2E A;  1WSE A;  3QEX A;  4X66 K;  3DLG A;  4HCB A;  3H08 A;  1BUP A;  4JKF A;  3MXI A;  4FLV A;  1CLQ A;  4XH1 A;  3G0Z A;  3CHW A;  4JLH A;  2F96 A;  3OY9 A;  3SUO A;  4CE9 A;  4W5Q A;  1NJY A;  2FXU A;  3DLH A;  1WSJ A;  3QML A;  3AVC A;  3QEI A;  4F3O A;  3WQU A;  1ILY A;  1VSD A;  5JS1 A;  2YKN A;  1SKS A;  4PKI A;  4L3Q A;  4I2Q A;  1D9D A;  3CF5 L;  3GDQ A;  3VN5 A;  2KHO A;  2HNZ A;  1S6Q A;  2YJE A;  2OZS A;  4W5N A;  1W2B M;  2YNI A;  4CJS A;  1NWK A;  3MXM A;  3ATU A;  2YHW A;  4A2B A;  4CJQ A;  3EN9 A;  1UA1 A;  4JI5 K;  4KI6 A;  3MEG A;  1HNW K;  4FWR A;  4HTL A;  2DTU A;  4NLB A;  1VQL N;  2QWN A;  4JD2 B;  2PYL A;  1VQP N;  4BWM A;  3TAQ A;  3SV3 A;  3RWU A;  4XEI A;  3CCU N;  1D8Y A;  4EHT A;  4IKF A;  1GOA A;  3U9D A;  5SZT A;  3CCV N;  4B1X B;  3K9K A;  2KZM A;  3H3N O;  4E1N A;  3ID8 A;  1TYQ A;  4CGF A;  1D4X A;  4FOE A;  3L4I A;  1S72 N;  5I9E B;  1LWC A;  2FBX A;  1HQU A;  4JKH A;  3VTH A;  4JK9 A;  1RDA A;  4WFA L;  2NRT A;  3LAM A;  1GLF O;  1BWF O;  4B3O A;  3WT0 A;  4B9T A;  2FSN A;  1YT3 A;  4FK4 A;  4FSV A;  4JNE A;  4C1N I;  4B1V A;  4XH4 A;  1RIL A;  3F9M A;  3RSE A;  4HVJ A;  2HF3 A;  4JRP A;  4CED A;  3UE5 A;  4GNI A;  1SQK A;  3WEE A;  4CEO A;  3CC2 N;  3MAQ A;  3A5O C;  3OYA A;  1I3A A;  4FM0 A;  1NKC A;  1IKW A;  4JI8 K;  2ZD1 A;  4RW8 A;  3L2R A;  4FYD A;  3RVC A;  5CY4 A;  5M1P A;  1FK9 A;  1NMN A;  1WSH A;  5JIC A;  1NGD A;  1TKD A;  1GLJ O;  4NCG A;  4KO0 A;  3TAE A;  3HXM A;  1EWR A;  4JHD A;  4M41 A;  4BR2 A;  3KJV A;  1S3X A;  5AQH A;  2HB5 A;  3AVA A;  2UXD K;  1X9J A;  1JXE A;  1RBS A;  2NRZ A;  3OJU A;  3LAL A;  1JLF A;  4A2A A;  5C2F A;  5BN8 A;  2GX9 A;  1TKZ A;  3F5T A;  1T6D A;  3AY9 A;  4YOU A;  4DU4 A;  3KKR A;  2E20 A;  4IJA A;  3OYE A;  4DUY K;  4DTX A;  4I9L A;  1NOZ A;  4JI7 K;  1JLC A;  3IS9 A;  1GLD G;  2ZJQ L;  1T03 A;  2O8D B;  4CJK A;  1YIT N;  1KXP A;  3SI6 A;  4FWN A;  3FZH A;  3J80 O;  4M45 A;  3O1W A;  2WUS A;  3ZSO A;  1P90 A;  2F7T A;  4NCA A;  3CM5 A;  3THW B;  4NB4 A;  3QES A;  5HRS A;  3THX A;  3ENH A;  2YHY A;  4Y1D A;  3QEP A;  3UKU B;  5F1X A;  1HLU A;  2O4G A;  1FW6 A;  4JI3 K;  3BZK A;  5GAE P;  3GG4 A;  3KK7 A;  2O8F B;  1OVY A;  1VQ4 N;  4G9Z A;  3D6R A;  2UU9 K;  3QEW A;  2RHK A;  2F4V K;  4PA1 A;  2E5L K;  1K8K B;  3BGR A;  2F9T A;  1Q18 A;  3A2F A;  3V1O A;  1UOC A;  2Y1I A;  4FWL A;  2H3G X;  1NGC A;  1G15 A;  1KLN A;  3FR0 A;  3OBW A;  3TAG A;  5AFU H;  3QIO A;  4BG8 A;  1N36 K;  1RTD A;  1J9A A;  1IKV A;  3PSF A;  3AVH A;  3QB0 A;  4IDH A;  4DU3 A;  3O3H A;  1G99 A;  2HST A;  1XHX A;  2G8U A;  1RCH A;  4H4M A;  2YJF A;  4LC9 B;  3BEX A;  3M6G A;  1VSL A;  4BQL A;  1YXQ A;  3LZI A;  4F4K A;  4CBU A;  3AV9 A;  3MWP A;  3RTV A;  2CGK A;  2P9N B;  3SUQ A;  4CEB A;  3EKS A;  4BR5 A;  3UB5 A;  3VEX A;  4PL8 A;  4IBN A;  1YTU A;  2OPP A;  2ZE2 A;  3LDP A;  4BRK A;  3EEQ A;  3AVJ A;  1SL1 A;  1T8E A;  4EP4 A;  4CFA A;  1HQE A;  4FW1 A;  1TAQ A;  4B3T K;  3DJC A;  3TAB A;  5M1N A;  4CGI A;  5ADX H;  4BDY A;  1Z05 A;  3B8A X;  3ZT1 A;  3NH1 A;  2HBJ A;  4ILJ A;  2XO7 A;  3P1G A;  4EZ9 A;  3TSP A;  4M3Y A;  1S1U A;  4YOR A;  4CF9 A;  3AO3 A;  1QVG M;  1KAX A;  3K5O A;  1ESV A;  4B3M K;  2FF6 A;  4MLH A;  2GUI A;  2GBZ A;  4M7X A;  2D0C A;  4DR2 K;  2QEX N;  4C8N A;  4KHS A;  2G8F A;  3PX6 A;  4FJ8 A;  3CCQ N;  3CCE N;  1FJG K;  1SV5 A;  2HND A;  2FBY A;  1NKE A;  1S5J A;  3OYN A;  3HVT A;  4K41 A;  2ZQB A;  1GOC A;  4CEC A;  3MMV A;  1NU0 A;  3WXK A;  3A5N C;  3ULE A;  2D5R A;  4OGE A;  2O8E A;  3RMC A;  1Z6R A;  2ZJP L;  5AFU A;  1NK0 A;  1KC8 O;  2B4J A;  4GV3 A;  3ZSW A;  1WAF A;  4C23 A;  4Z4H A;  4W5R A;  2QWL A;  2RE2 A;  4BVO A;  3G6E N;  3ENO A;  2VGM A;  3UKR B;  2Z1G A;  2KQ2 A;  2VYP A;  4CIG A;  5J2P A;  3LAK A;  5KPZ A;  4DS5 A;  1K73 O;  4IG0 A;  3ZT4 A;  1Y97 A;  4E7H A;  1VQ6 N;  1RT6 A;  4BRF A;  5HP1 A;  4F2R A;  3EZW A;  5GAG P;  3CET A;  3HPO A;  3SLC A;  3FZM A;  1HUX A;  4FJJ A;  3BZC A;  1XQS C;  3LP0 A;  1XUP O;  2EX3 A;  4UY8 O;  4H5V A;  4W5T A;  4BRI A;  5HRO A;  2P51 A;  3P39 A;  1K9M O;  3TTC A;  4AHC A;  3ZT2 A;  1SKW A;  1ITG A;  1OH6 A;  3MCP A;  4GVE A;  4PKG A;  4FJ7 A;  3VQ8 A;  3D2F B;  2Y1J A;  2CH5 A;  3BF3 A;  4OPH A;  4Z4I A;  1RBR A;  4CJ5 A;  2NLX A;  4DLG A;  4B3R K;  2DPN A;  4WF9 L;  2W40 A;  3ZT3 A;  3L4Q A;  4NLC A;  4DQP A;  1NGF A;  4FVM A;  2GEM A;  3HO1 A;  4FJ9 A;  4IFV A;  2VQE K;  1J5O A;  4BDZ A;  1GOB A;  3DI6 A;  1ZBS A;  3VF4 A;  5JVG L;  2ZWH A;  3IMX A;  3THY B;  5AJ3 K;  3VQQ A;  1N32 K;  3K57 A;  1OH8 A;  4LFC K;  3AGR A;  5AQN A;  2BH1 A;  3LDN A;  3LP2 A;  4YOX A;  4IOA L;  4DF4 A;  3NF6 A;  1VSE A;  3O6W A;  1X1P A;  1XI1 A;  1QQO A;  4JKG B;  1J5E K;  3ZSZ A;  5CE3 A;  3O9T A;  3C6T A;  1TUU A;  1VQ7 N;  2AA4 A;  3C7N B;  1SAZ A;  1HJO A;  2ETJ A;  3I33 A;  4DTJ A;  4WQ4 C;  2P9U B;  3PIP L;  4N5S A;  3O80 A;  4GW6 A;  2LSN A;  2O8B A;  4H03 B;  1B9F A;  1REV A;  4DR1 K;  2PZS A;  3DXK A;  4CGJ A;  1YIJ N;  1BOT O;  1Z25 A;  4X65 K;  1KFS A;  3O3G A;  5AZJ B;  4UQG A;  4JKB A;  1RDD A;  1OH7 A;  4KH6 A;  3BDP A;  4FJK A;  3J7Z O;  3S3O A;  3DLR A;  2PAV A;  1RBU A;  3PUF A;  3GE1 A;  3SPY A;  2A1R A;  4FLX A;  3EL2 A;  3J81 O;  3H45 C;  1JLG A;  1IBM K;  4FW2 A;  2E88 A;  1T6C A;  3U3G A;  3VET A;  4BVP A;  2ASP A;  5BPL A;  3AVL A;  2FSJ A;  4PY5 A;  5BRF A;  5AR0 A;  5FRM A;  2YNF A;  3DLL L;  3OA9 A;  4AF1 A;  3O4Q A;  3TAF A;  3JYT A;  4QOZ B;  4CJL A;  4CZG A;  1EQY A;  1RT4 A;  4YOY A;  2JLE A;  1GLC G;  2G8K A;  1ZBH A;  1U48 A;  3DRR A;  4ZHR A;  4CZM A;  3WQT A;  4BC4 A;  3H46 O;  4KRF A;  1T05 A;  4CK2 A;  4O0I A;  5JMV A;  4FJI A;  5CYQ A;  4A5B A;  4HTU A;  3TPQ A;  1XWL A;  1KAY A;  2QWM A;  2PYJ A;  1BA1 A;  1RT7 A;  4ISG A;  2A1S A;  4U7B A;  2W6L A;  3CME N;  3R9P A;  1C1B A;  2Q1N A;  3ZX2 A;  1JCE A;  3HPG A;  2IVP A;  1HKC A;  3VOV A;  3H6E A;  1RDC A;  2D0B A;  1C0M A;  4J8F A;  4FWO A;  1JL1 A;  5FRO A;  4YFU A;  4IDK A;  1QVF M;  3WNE A;  2OZM A;  2VG7 A;  4JEP A;  2HNY A;  3U4L A;  4L8R B;  3LDS A;  3KD1 E;  4ILH A;  3VMF B;  4BRO A;  4AH9 A;  4FLT A;  1IBK K;  4PQU A;  3FZL A;  4CER A;  3V81 A;  1I39 A;  1WB9 A;  4ELU A;  3D0P A;  3V9Z A;  1X3M A;  3V4I A;  3O9S A;  1C6V A;  2NNW A;  4HWI A;  2ZGZ A;  1X9S A;  2PBD A;  3NF9 A;  2G8W A;  3ZX0 A;  2NRH A;  5AQT A;  1TGO A;  3ZET A;  2E2Q A;  1V4T A;  2ASM A;  3DWL A;  3DXM A;  1LCU A;  3L0Q A;  4CF8 A;  1J54 A;  4ISF A;  4FJN A;  1YJW N;  5E84 A;  4CZL A;  2IVO A;  3S9H A;  4H0X B;  2FC0 A;  4F8R A;  3DOL A;  3MXJ A;  1MWM A;  3MN6 A;  3FGU A;  5AZI A;  3V1Q A;  3O9Q A;  2VG5 A;  4E0D A;  4RG8 A;  1RNH A;  4LF5 K;  4JAX A;  4Z4C A;  3OYL A;  1L3S A;  1S1W A;  3NHG A;  4Z0U A;  1S6P A;  3MN7 A;  1CXQ A;  4DTO A;  1JKH A;  2UXB K;  3I0S A;  1A5V A;  4XIU A;  5F2R A;  4PHT X;  1GLL O;  4Z4E A;  4BGB A;  2UXC K;  1NK9 A;  1JCF A;  1BI4 A;  4FK2 A;  3NBP A;  4OLA A;  4QCL A;  2QWR A;  2ZJR L;  1KVA A;  3VGL A;  3FE1 A;  3SMS A;  4IFE A;  2D0O A;  1XC3 A;  5EX5 A;  4OPA A;  3RR7 A;  3CJC A;  3OS1 A;  1QE1 A;  5FPD A;  1ASW A;  1QQM A;  2EHG A;  5BPN A;  1HNZ K;  1XNR K;  1QQC A;  1TAU A;  4CBX A;  2W42 A;  1VSJ A;  2Q2R A;  4CBW A;  1NJZ A;  2W6K A;  3HM8 A;  5E26 A;  4H4O A;  4CJV A;  4BR4 A;  4R5P A;  4BR0 A;  4Z94 A;  5BN9 A;  4CHY A;  3NCI A;  3P5J A;  4KKO A;  1WNS A;  3KTQ A;  1TKX A;  1HR0 K;  3NH0 A;  3N4Q A;  1GLE G;  3CJA A;  3ZYY X;  5FPN A;  4BG9 A;  3OYC A;  3HM9 A;  1N34 K;  1YI2 N;  1QHA A;  2ATQ A;  4RW7 A;  1HJR A;  4PUO A;  1NBW A;  3DM2 A;  1UA0 A;  4G1Q A;  4QAG A;  4DHY A;  3AA3 A;  1JLA A;  4LF8 K;  1JJ2 M;  3ZSQ A;  2FSK A;  1WSI A;  2KW4 A;  5FPE A;  4JI4 K;  4K8Z A;  4YDU A;  1X3N A;  3V9S A;  4CJE A;  4CJ3 A;  1XNQ K;  3C94 A;  5C10 A;  4AM7 A;  2X6S A;  3VEY A;  3MED A;  3TU5 A;  1SUQ A;  4K43 A;  3SNN A;  4BDP A;  2WC9 A;  2V52 B;  1NG9 A;  3VEW A;  1IBL K;  2O8D A;  2OPR A;  1Q9X A;  4M3Z A;  2Q36 A;  2O8C B;  4FL9 A;  5C25 A;  2HHT A;  1H1V A;  2X6N A;  2NRR A;  1BU6 O;  3K5N A;  5KPR A;  3D2E B;  4CJP A;  4KPY A;  4CIE A;  1YJN N;  5JLF A;  2DFF A;  1WBD A;  3VES A;  1ASV A;  4CEQ A;  3N4P A;  1RDU A;  4H5N A;  4E1J A;  1NGA A;  3VQ9 A;  4BRH A;  1OH5 A;  3R3L A;  3IKM A;  5J2M A;  3MK6 A;  2XY8 A;  3JS6 A;  3B6P A;  1HMV A;  1E4G T;  3TTF A;  1T3V A;  1S1V A;  3EYZ A;  3OVN A;  3WXL A;  3AAQ A;  2HHX A;  4M3X A;  3CCJ N;  4CI6 A;  3O4N A;  2G8V A;  2BE2 A;  4IWV A;  3J8A A;  2VWK A;  3HYF A;  1DGK N;  3SAH A;  1EKE A;  3ZX3 A;  2AP1 A;  4LH4 A;  3SZ2 A;  4KB1 A;  2P9L A;  2NZT A;  4ISE A;  3AVG A;  4H8K A;  3LDO A;  1YVU A;  1JLE A;  3AVN A;  3MEE A;  2WTU A;  4DCH A;  3TAM A;  3VQD A;  4YDU C;  4MDB A;  3CC7 N;  1ATS A;  2WFB A;  3CI5 A;  4FWS A;  1L3V A;  2QI2 A;  2HOE A;  1BG3 A;  4CEA A;  5LMN K;  1HRH A;  1O1W A;  4DKW A;  3SV4 A;  4DWI A;  5M1K A;  4DFK A;  4BC5 A;  4DSL A;  2E2O A;  4CFD A;  1TYQ B;  4OKK A;  4WE1 A;  3NVM A;  1VQ5 N;  2YCH A;  3HT3 A;  4V19 S;  3EZ5 A;  5JS2 A;  4DTN A;  4FJ5 A;  2OCE A;  3CIP A;  1LAW A;  1J6Z A;  3VQA A;  4JS4 A;  1QZ6 A;  2G8H A;  3OBY A;  1EWQ A;  4N76 A;  3SQ2 A;  3RMB A;  4CGG A;  4EZ6 A;  4J2E A;  3MCA B;  1TK5 A;  3RSE B;  3NDK A;  4BWJ A;  1RT3 A;  1IV0 A;  4RW6 A;  2IDO A;  3WEE B;  4LD0 A;  1VRT A;  3I55 N;  3IG1 A;  4O4G A;  1FKO A;  4FLW A;  1KLM A;  2IIR A;  3SQ1 A;  1HYZ A;  1BCM A;  2E2P A;  2VCP A;  5DM6 L;  2HHQ A;  4FM2 A;  2VG6 A;  5FDL A;  4DTS A;  4JHD B;  2QM1 A;  4IG3 A;  3GL1 A;  1NGH A;  2QK9 A;  1TKT A;  2PY5 A;  4FJH A;  2A6A A;  5JLH A;  3OTO K;  3K0S A;  3T1Y K;  2X78 A;  4WFN L;  2V7Y A;  4ID5 A;  4CJ7 A;  3AO1 A;  2P9S A;  5KGW A;  1Z26 A;  3VTI A;  3VGM A;  1UWB A;  4YY3 K;  1GLA G;  3PX4 A;  3MN5 A;  4AHT A;  2WON A;  4BRQ A;  3THV A;  2HW3 A;  3KLE A;  3H1V X;  3ATV A;  1EP4 A;  2F8S A;  3QIC A;  5GAD P;  5I3U A;  3OS0 A;  3HBT A;  3LWM A;  1S1T A;  4AM6 A;  2QWO A;  2UUB K;  1ZC6 A;  3VF2 A;  3THX B;  4O0J A;  2D1K A;  3VA3 A;  1YAG A;  1T44 A;  1W0H A;  3KLH A;  4CZJ A;  4DQI A;  5H1S Q;  4JI2 K;  4HHT A;  4OGC A;  3WXM B;  2NRW A;  4CF2 A;  4NXN K;  1JLQ A;  4HUF A;  4BE2 A;  1EET A;  3P31 A;  1DT9 A;  5EVZ A;  2HF4 A;  3K58 A;  4JI0 K;  4I6M A;  1SKR A;  4LF6 K;  1UAX A;  1U04 A;  3TSU A;  3QBW A;  1YHQ N;  2P9P A;  1YF5 L;  3L3V A;  1NK6 A;  3TSQ A;  3SYZ A;  1NJW A;  4BRM A;  3NVK A;  5AQF A;  4CEE A;  5KQD A;  1ZBU A;  4WQ4 A;  4GV9 A;  4RTF D;  3CG7 A;  4GY2 B;  5J1E A;  4AIL C;  3I56 N;  4CD3 A;  2VGN A;  2HMP A;  1L3U A;  4ZTF A;  4BAC A;  3KD5 E;  5GIO A;  1HNI A;  3VPZ A;  3G71 N;  1FKP A;  4LSL A;  3SK3 A;  3CQ8 A;  4KB0 A;  2Q31 A;  1VQ9 N;  4QS8 A;  1SL2 A;  4OVL A;  1HYV A;  3P4I A;  1RT5 A;  3BP8 A;  1OVQ A;  3TR8 A;  4B08 A;  4A61 A;  2GTD A;  4KHQ A;  4CJT A;  3OYB A;  2Z1J A;  1QSS A;  4AHV A;  1KFD A;  5KRS A;  3AVB A;  4DF8 A;  5AQR A;  4QS9 A;  4FZX C;  3DMJ A;  3H3O B;  1BA0 A;  3ZEU A;  3TAP A;  4OX9 K;  2XY7 A;  5LMU K;  3VQC A;  4CVN E;  1QSL A;  4MFB A;  3VQ5 A;  3HOS A;  1U2V A;  4IEI A;  1VSM A;  3RMD A;  3R8E A;  5ADX A;  4RCH A;  3EE9 A;  4M42 A;  3PIO L;  1KD1 O;  4R79 A;  4CHP A;  1SL0 A;  2Z1I A;  4H0P A;  4DQ8 A;  3VA0 A;  4LSN A;  3CER A;  3OYG A;  4LF4 K;  1XHZ A;  1CZ9 A;  3M1F A;  3U6F A;  5GIN A;  3CFR A;  1U4B A;  2HHV A;  2D4W A;  1VSH A;  4C1N K;  2IC3 A;  3NE6 A;  1DKG D;  4H0T B;  4DTU A;  3NH2 A;  3AAR A;  2E1Y A;  4YOW A;  2CGJ A;  2YHB A;  2UUC K;  2ITG A;  3B6O A;  1NGJ A;  2XY5 A;  2HVI A;  5CR4 A;  2OPS A;  3CFP A;  3DLK A;  1KCF A;  5HRN A;  5KRT A;  4BE0 A;  4H5T A;  4AHR A;  2BAN A;  1C1A A;  3LL3 A;  4CK1 A;  3DOK A;  3ULE B;  1HPZ A;  2O8E B;  5AQU A;  2ITM A;  1ATN A;  4CEF A;  5AQK A;  3HJF A;  4DQR A;  3GOI A;  2PFU A;  3KLG A;  3AAP A;  4M7Y A;  3VQ6 A;  1EO1 A;  3NGI A;  2KFN A;  4FCY A;  2NRV A;  1Q86 O;  5IWA K;  2HHS A;  4BR9 A;  2KFZ A;  4KHU A;  4I2P A;  3DLE A;  5C12 A;  1QHT A;  4JKA A;  2QKB A;  4PKH A;  3SMP A;  2FF3 B;  5TKY A;  4FWM A;  3HL8 A;  2FBT A;  5C15 A;  4HCC A;  3CCM N;  3TWH A;  1BCO A;  1MA9 B;  1RTH A;  2I7P A;  4CHO A;  4NXM K;  3K59 A;  3KWG A;  1NGG A;  5D3G A;  5J2N A;  1W9H A;  3OS2 A;  4LFB K;  3FFI A;  3LM9 A;  3ZSX A;  4OPK A;  2QTD A;  4E3S A;  5HRP A;  3RRG A;  1NNE A;  2V51 B;  4BRN A;  3F9K A;  4GVM A;  4N41 A;  4C8K A;  4QS7 A;  1IJJ A;  2P9I A;  1LW2 A;  4N56 A;  4DSE A;  1E4F T;  4DMN A;  4AQY K;  4B9N A;  4CIF A;  3O3F A;  2OPQ A;  4CFB A;  1W97 L;  4DV5 K;  1LOT B;  1YTA A;  3JXU A;  3HP6 A;  4CD1 A;  4FWK A;  1A5X A;  4GKJ K;  1TUY A;  3KIO A;  2YV0 X;  4K42 A;  3J7A P;  1NK5 A;  4KTZ A;  3WUH A;  4IO9 L;  4JI1 K;  3OYJ A;  3KK2 A;  1V4S A;  1LW0 A;  1QTM A;  3CFO A;  5KQ8 A;  2O8B B;  5LJV A;  4CF1 A;  4I7F A;  3A5M C;  4LF7 K;  3U8X A;  4Y0W A;  2RPI A;  3C6H A;  5GAH P;  1C0G A;  3DXK B;  1QS4 A;  1X9W A;  3AVI A;  4O55 A;  3AVF A;  5DMR A;  2GWJ A;  3M5R A;  5CHI A;  4GKK K;  4IO8 A;  4FLU A;  5AQS A;  3I8D A;  1VQN N;  4DSF A;  2JGU A;  3QIP A;  3J7Y P;  4B9S A;  1BDG A;  1YVN A;  5HL7 L;  4PWD A;  4DG1 A;  3PO4 A;  4B9V A;  4ILG B;  4AHS A;  4ELT A;  2RF2 A;  5AQJ A;  5AQP A;  1IG9 A;  5AQG A;  3E66 A;  1RGI A;  3EE8 A;  3H1Q A;  4IXC A;  4DV3 K;  4CGH A;  4B1W B;  2BTF A;  2D0A A;  3QNO A;  1WBB A;  5AQI A;  4JD2 A;  4FJL A;  5AQX A;  5J2Q A;  3E9O A;  3Q7C A;  4EP5 A;  4H0Y B;  3U9Z A;  1VAZ A;  3OJS A;  1RDW X;  3IUC A;  5HLF A;  3A8Y A;  3HTV A;  1RTI A;  2CH6 A;  3L3U A;  2GV9 A;  4FZY A;  5HRR A;  3D7E O;  5I42 A;  4YOV A;  3QNN A;  2YNH A;  3G10 A;  2HBL A;  2YHX A;  3LZJ A;  3R6M A;  1SZ2 A;  1N8R O;  3C95 A;  4IEE A;  4JK8 A;  3AVM A;  4JYA K;  2A41 A;  3SCX A;  3M3Z A;  1TK0 A;  3QET A;  3OHR A;  4BRD A;  1BIZ A;  5BPM A;  5AQO A;  1X9M A;  1YUW A;  5CYM A;  4DUZ K;  5AQZ A;  3O08 A;  4FWQ A;  3ALY A;  4W5O A;  3OW2 M;  5F0X A;  4JS5 A;  3HRG A;  4B3S K;  4FXD A;  3V9X A;  2IS3 A;  3V1R A;  4Q5V A;  3ULD A;  3VQ7 A;  2V7Z A;  3F73 A;  2HVH A;  1F21 A;  3ZET B;  3DRP A;  1O13 A;  4C8M A;  4K0K K;  2E1Z A;  3KHY A;  1NK4 A;  2QXL A;  3DXM B;  4E89 A;  4NCB A;  3NMU A;  3VER A;  4EHU A;  4FLZ A;  4NYN A;  4DR6 K;  2XY6 A;  2QW9 A;  4DV7 K;  2IGI A;  5CZ1 A;  2ZM6 K;  1TL3 A;  4OO1 J;  1IKX A;  4DR7 K;  1HKB A;  3FZF A;  5EOY A;  4DTP A;  3ZCM A;  5AZI B;  3QFP A;  3EY1 A;  2BGG A;  3GBT A;  2KLA A;  4CZI A;  3RMA A;  1JLB A;  3SBT A;  5B8H A;  3SAG A;  5TKW A;  1NLV A;  4B8A B;  4M3W A;  3WNH A;  4ZTJ A;  1ZYQ A;  2VWB A;  1NM1 A;  3MDQ A;  3HSC A;  4A62 A;  2P9K B;  4YNQ A;  4BRP A;  4LFA K;  3OYF A;  1BHL A;  3LPU A;  5ELZ A;  3QLH A;  3P38 A;  1BI4 B;  1S22 A;  4JV5 K;  2NRX A;  4HUG A;  3THW A;  2QA4 N;  3ZSV A;  3HOT A;  3UKU A;  1KVC A;  4O8K A;  1VQO N;  3I8B A;  4AHU A;  1U45 A;  2O4I A;  1VHX A;  2B6A A;  4M63 C;  3ASM A;  3FLC O;  5EU7 A;  1NJI O;  1WSF A;  2O8F A;  3BUZ B;  3T19 A;  4O8U A;  1Q7Y O;  1SS6 A;  1BQM A;  1NGB A;  1VSK A;  3A0I X;  1S9G A;  3SQ0 A;  4O44 A;  4OPJ A;  5EY4 A;  1K8K A;  3SUP A;  1XC9 A;  3QDK A;  2XHB A;  2P5O A;  1WSG A;  4MQ3 A;  2Q97 A;  4DFM A;  1VQM N;  2FLO A;  1HNX K;  4ICL A;  4K25 A;  4TSX A;  3EKU A;  4KI4 A;  3G4S N;  4BC2 A;  5C42 A;  2WOM A;  4RWT A;  4JN4 A;  2Z1H A;  4B9Q A;  2P1J A;  4DR5 K;  2UUA K;  4HUE A;  4KHN A;  3CQY A;  1QZ5 A;  1ZXO A;  4E7I A;  3O9R A;  5CZ2 A;  2VWJ A;  4DQS A;  3E01 A;  5M1O A;  1JXB A;  1OKJ A;  2ZGY A;  3QFU A;  3VEV A;  2IVN A;  3KWI A;  1ZBI A;  2GWK A;  4Q0B A;  1BQN A;  2P9N A;  1TK8 A;  3VGK A;  5AQL A;  3L2Q A;  3PX0 A;  2DY4 A;  2RKI A;  5FPM A;  4CK3 A;  3SJH A;  3G25 A;  4J2D A;  4FJX A;  3HI0 A;  4F2S A;  4KTQ A;  4MDA A;  2E8A A;  3QIN A;  4EIA A;  2ASO A;  3HVR A;  2IAJ A;  1Q81 O;  2JWK A;  5K14 A;  3ITH A;  4JI6 K;  2R7Y A;  4FM1 A;  1HYS A;  4E7J A;  3DYA A;  1WOQ A;  3AO5 A;  1C1C A;  1B92 A;  4FVU A;  1JCG A;  1IO2 A;  3ZSR A;  3M8Q A;  5T7B A;  3CM6 A;  4CW7 B;  2A3Z A;  1M90 O;  4M3U A;  1MU2 A;  2A5X A;  3QEV A;  2EWS A;  3CJ7 A;  3L2U A;  4CFC A;  4Y1C A;  4U67 L;  4CZH A;  3CD6 N;  1S9E A;  3TAR A;  3OYI A;  3CCR N;  3RRH A;  2VQF K;  4FPA A;  3AA2 A;  2UYT A;  4E1M A;  3CJ9 A;  3FZK A;  4DLE A;  1U49 A;  2RN2 A;  3AA5 X;  3SAF A;  3C6U A;  1HX1 A;  2XRI A;  3CPW M;  4C8L A;  1JL2 A;  1BIU A;  3VQB A;  3AO2 A;  4M3T A;  4O5B A;  2Q3S A;  5BRD A;  2Q0R A;  4YOT A;  5DM7 L;  2YX6 A;  3O8M A;  5HBM A;  2GEL A;  1D5A A;  4CZK A;  3T7Z A;  3V9U A;  3M8S A;  3R1X A;  2NUB A;  1VQ8 N;  1ZBL A;  3O4W A;  4F3T A;  3L6Q A;  4B9L A;  3FFK B;  1NKB A;  4OJR A;  1KTQ A;  3M8R A;  1BL3 A;  4KRE A;  3CXC M;  4RW4 A;  1NOY A;  3S3M A;  2P9L B;  4CZE A;  1LWF A;  3UKR A;  5BR9 A;  3AGK A;  4DTM A;  5KI6 A;  4FJM A;  1J53 A;  3K9J A;  4CEZ A;  4KFB A;  3ZLJ A;  2X74 A;  3K5L A;  1NGI A;  1TVR A;  3WNF A;  3L2V A;  4DSK A;  4FJG A;  1WLJ A;  4B9U A;  4N47 A;  4KHW A;  1EXQ A;  2W41 A;  3ZT0 A;  1WN7 A;  4PL7 A;  4DU1 A;  3LPT A;  3OYD A;  2OA8 A;  2QWQ A;  3LDL A;  3MX2 A;  3KVG A;  1K8A O;  3AO4 A;  4BRC A;  1Q9Y A;  3QBX A;  3LP1 A;  4YHH K;  2KTQ A;  1KQS M;  2DFH A;  4H5W A;  3HZ6 A;  3WXJ A;  3UIQ A;  3MX5 A;  2F9W A;  3P83 D;  1TL1 A;  1K6Y A;  3L8B A;  2B5J A;  1XMO K;  1NMD A;  3S41 A;  5KPT A;  3IRX A;  2HHW A;  3D2F A;  4ELV A;  1ASU A;  4WCE L;  4MO5 A;  3E1Y A;  3PY8 A;  1RDB A;  3IAY A;  3F2K A;  4KV8 A;  1BIS A;  4CJR A;  4LY7 A;  3DLB A;  1C0T A;  1LWE A;  1CXU A;  3O1B A;  2HHH K;  4BRL A;  1QQN A;  4IOC L;  4CHN A;  1RTJ A;  4NO7 A;  4MLE A;  4CCH A;  3THY A;  1R59 O;  3CC4 N;  5SWM A;  4X62 K;  2AJQ A;  1RT1 A;  2E2N A;  3CYM A;  3MEC A;  2E6L A;  5MLC Q;  3CJB A;  4JRQ A;  4K8X A;  3AVK A;  4JKG A;  4KHY A;  4J2A A;  1LAV A;  3C7N A;  3AA4 A;  3T3F A;  3K2P A;  1NK8 A;  3CQX A;  2KKZ A;  3T1A A;  3WNG A;  1KRP A;  2P9U A;  2P9S B;  4JK7 A;  1ZBF A;  4MO4 A;  3HST B;  3SBG A;  4KBO A;  3BY5 A;  4DTR A;  2E6M A;  5AQM A;  3C65 A;  4JKC A;  3HK2 A;  3Q7B A;  4DV0 K;  3DAW A;  5C0Y A;  3V9W A;  1EX4 A;  4LH5 A;  5AZJ A;  2OAN A;  5A2Q O;  4GV6 A;  3ENB A;  4KH4 A;  1C0U A;  3JAM O;  3ZSY A;  4BY9 C;  1C0F A;  1P8Z A;  1L5U A;  4OLB A;  4NYF A;  3OYM A;  3LWL A;  2JWL A;  4KTW A;  2P5G A;  3SJJ A;  4DV4 K;  3I0R A;  1VRU A;  4M3R A;  3EO3 A;  1VQK N;  4Z4G A;  1QSY A;  1BGX T;  2YI1 A;  2YKM A;  5EXW A;  4H5R A;  1HNV A;  2A42 A;  1IH7 A;  3NF8 A;  4CJ4 A;  4I6M B;  3PV8 A;  2Q0U A;  2P9P B;  4CF0 A;  4GMJ B;  4CHQ A;  3VQ4 A;  3NFA A;  3SQ4 A;  2YHA A;  2D0P A;  5FLX O;  3ID6 A;  2CGL A;  4CJU A;  1N5Y A;  2HBM A;  3CCL N;  3QO9 A;  4E19 A;  3LP3 A;  4F9O A;  2QXF A;  3WXI A;  4FLY A;  1I94 K;  4BR7 A;  2BDP A;  4LF9 K;  3KKS A;  3O9U A;  3DRS A;  3TTD A;  3LDQ A;  3M8P A;  1MWK A;  4IJN A;  5BRE A;  4CJF A;  4E7L A;  2YNG A;  3MWT A;  5AQV A;  4E7K A;  5LJW A;  2GUP A;  4BC3 A;  3ZEU B;  2FBV A;  4ID1 A;  4IZ9 A;  1KSP A;  1RT2 A;  5M1F A;  4JKE A;  5AQW A; 
#chains in the Genus database with same CATH homology
 1L3T A;  3QNN A;  1DTT A;  3OYH A;  2YNH A;  3AVG A;  3G10 A;  1SV5 A;  4H8K A;  3LZJ A;  1YVU A;  1JLE A;  3AVN A;  3MEE A;  2HND A;  3TAM A;  3VQD A;  2FBY A;  3OYK A;  3C95 A;  1NKE A;  2F8T A;  1S5J A;  3OYN A;  3HVT A;  1L3V A;  2ZQB A;  3AVM A;  3V6D A;  3NGY A;  1GOC A;  4CEA A;  1HRH A;  4CEC A;  1O1W A;  3SV4 A;  3SCX A;  4DWI A;  2D5R A;  4OGE A;  4DFK A;  4DSL A;  3RMC A;  1TK0 A;  4CFD A;  3QET A;  4WE1 A;  4OKK A;  1B9D A;  1NK7 A;  1NK0 A;  3QER A;  4DSJ A;  3KLI A;  1S1X A;  2B4J A;  1BIZ A;  4BE1 A;  3SPZ A;  3ISN C;  3ZSW A;  3HT3 A;  1X9M A;  1WAF A;  4Z4H A;  5KGX A;  5JS2 A;  3VQP A;  4W5R A;  3EZ5 A;  1A5W A;  1KVB A;  5CYM A;  3K5M A;  4DTN A;  4DS4 A;  4FJ5 A;  2Z1G A;  2KQ2 A;  3KK3 A;  3ALY A;  4Z4F A;  1LAW A;  4IFY A;  4CIG A;  4W5O A;  3VQA A;  4JS4 A;  3LAK A;  5J2P A;  4DS5 A;  5E41 A;  4JS5 A;  2G8H A;  4FXD A;  4IG0 A;  3V9X A;  3ZT4 A;  2IS3 A;  1Y97 A;  4OKJ A;  3V1R A;  4Q5V A;  3ULD A;  3VQ7 A;  1Q8I A;  4E7H A;  3F73 A;  4N76 A;  1RT6 A;  3SQ2 A;  4FZZ A;  2HVH A;  3RMB A;  1F21 A;  1VK0 A;  3DRP A;  4CGG A;  4C8M A;  1NK4 A;  5HP1 A;  4EZ6 A;  4E89 A;  4NCB A;  4F2R A;  4DQQ A;  4FLZ A;  4NYN A;  1TK5 A;  4J2E A;  3HPO A;  3NDK A;  2G8I A;  4BWJ A;  1RT3 A;  2XY6 A;  4RW6 A;  2IDO A;  4FJJ A;  2IGI A;  5CZ1 A;  3LP0 A;  2KTQ A;  1TL3 A;  2EX3 A;  4LD0 A;  1FXX A;  1VRT A;  1IKX A;  4W5T A;  5HRO A;  3IG1 A;  5FRN A;  2P51 A;  4O4G A;  1FKO A;  4FLW A;  4DTP A;  4DSI A;  3ZCM A;  1KLM A;  3ZT2 A;  4AHC A;  3EY1 A;  2BGG A;  3SQ1 A;  1SKW A;  1HYZ A;  1ITG A;  1BCM A;  3RMA A;  1JLB A;  4DFP A;  1R0A A;  3HPH A;  1T7P A;  4B8C A;  4FJ7 A;  3VQ8 A;  4FM2 A;  2HHQ A;  2Y1J A;  2VG6 A;  1NJX A;  4B8A B;  4B9M A;  5FDL A;  4M3W A;  1DTQ A;  1RBR A;  4CJ5 A;  4DTS A;  4DLG A;  3WNH A;  3S3N A;  4ZTJ A;  1ZYQ A;  4CES A;  2HMI A;  4IG3 A;  3ZT3 A;  2QK9 A;  1TKT A;  2PY5 A;  2IOC A;  4CHZ A;  4YNQ A;  3NAE A;  3OYF A;  4DFJ A;  4DQP A;  4FJH A;  1BHL A;  1RBT A;  5C24 A;  4FVM A;  3SUN A;  2X78 A;  3LPU A;  3HO1 A;  3QLH A;  4FJ9 A;  4IFV A;  1DLO A;  4ID5 A;  1BI4 B;  1J5O A;  3AO1 A;  1GOB A;  3DI6 A;  3NGZ A;  4BDZ A;  4HUG A;  5KGW A;  1Z26 A;  3VQQ A;  3ZSV A;  3KLF A;  3NF7 A;  3K57 A;  1KVC A;  1UWB A;  1WAJ A;  4AHU A;  1U45 A;  4RW9 A;  2O4I A;  3LP2 A;  2B6A A;  3PX4 A;  4AHT A;  3JSM A;  3NF6 A;  4DF4 A;  3ASM A;  2WON A;  5EU7 A;  1VSE A;  1X1P A;  1XI1 A;  3THV A;  1WSF A;  3ZSZ A;  2HW3 A;  1VSF A;  3KLE A;  3TAN A;  3C6T A;  3T19 A;  1RBV A;  1EP4 A;  2F8S A;  2KZZ A;  1BQM A;  1VSK A;  2ETJ A;  4CJW A;  5I3U A;  1S9G A;  3OS0 A;  4O44 A;  3LWM A;  4OPJ A;  4DTJ A;  3SQ0 A;  1S1T A;  3KK1 A;  3SUP A;  3L2W A;  1XC9 A;  4FK0 A;  4OKE A;  5DK5 A;  2XHB A;  2E4L A;  2QKK A;  2P5O A;  1WSG A;  4MQ3 A;  3VQE A;  4DFM A;  4J2B A;  4N5S A;  4ICL A;  4TSX A;  4O0J A;  4GW6 A;  2LSN A;  3VA3 A;  4KI4 A;  2OYQ A;  3RR8 A;  3LAN A;  1W0H A;  3KLH A;  1B9F A;  1REV A;  5C42 A;  2PZS A;  2WOM A;  4DQI A;  4HHT A;  1CZB A;  2Z1H A;  3PO5 A;  4OGC A;  2P1J A;  4CGJ A;  4I9Q A;  1Z25 A;  2I5J A;  4CF2 A;  4HUE A;  1JLQ A;  4HUF A;  3O3G A;  1KFS A;  4KAZ A;  4UQG A;  4KHN A;  4E7I A;  1VSI A;  5KTQ A;  1N6Q A;  4BE2 A;  1EET A;  1U47 A;  2HHU A;  1RDD A;  2DFE A;  5CZ2 A;  2VWJ A;  4DQS A;  4CGD A;  3K58 A;  1LV5 A;  3D45 A;  3E01 A;  1JXB A;  3U3Y A;  1SKR A;  3BDP A;  1TV6 A;  4FJK A;  1UAX A;  1U04 A;  3HP9 A;  3DLR A;  3S3O A;  1D9F A;  1RBU A;  3PUF A;  3SPY A;  4C8O A;  2A1R A;  3TI0 A;  3L3V A;  4FLX A;  1NK6 A;  1ZBI A;  4Q0B A;  1BQN A;  3SYZ A;  1NJW A;  1TK8 A;  3L2Q A;  1IKY A;  3PX0 A;  1JLG A;  1WSE A;  3QEX A;  2DY4 A;  3DLG A;  2RKI A;  4HCB A;  4FW2 A;  3H08 A;  4CK3 A;  4CEE A;  1ZBU A;  4J2D A;  3MXI A;  4FJX A;  3CG7 A;  3U3G A;  4FLV A;  4F2S A;  1CLQ A;  4KTQ A;  5J1E A;  4AIL C;  3QIN A;  3AVL A;  3G0Z A;  4JLH A;  4PY5 A;  3HVR A;  2F96 A;  2IAJ A;  3OY9 A;  3SUO A;  5FRM A;  1L3U A;  4CE9 A;  4W5Q A;  5K14 A;  4BAC A;  2YNF A;  1WSJ A;  4ZTF A;  1NJY A;  3ITH A;  1HNI A;  3AVC A;  3QEI A;  3KD5 E;  4F3O A;  1FKP A;  3O4Q A;  4LSL A;  3CQ8 A;  2R7Y A;  4KB0 A;  4FM1 A;  3TAF A;  1VSD A;  3JYT A;  4QOZ B;  1HYS A;  4E7J A;  2YKN A;  4CJL A;  3DYA A;  1SKS A;  5JS1 A;  1SL2 A;  3AO5 A;  1C1C A;  1B92 A;  1RT4 A;  4I2Q A;  4OVL A;  1D9D A;  1HYV A;  2JLE A;  3VN5 A;  1IO2 A;  2HNZ A;  2G8K A;  1ZBH A;  1RT5 A;  1S6Q A;  3ZSR A;  3M8Q A;  5T7B A;  3CM6 A;  3DRR A;  4ZHR A;  1U48 A;  4M3U A;  1MU2 A;  3TR8 A;  4B08 A;  3QEV A;  4KHQ A;  4W5N A;  2OZS A;  4CJT A;  3OYB A;  4KRF A;  3L2U A;  4CFC A;  2Z1J A;  4CK2 A;  1T05 A;  4O0I A;  1QSS A;  4Y1C A;  1KFD A;  4AHV A;  4FJI A;  5KRS A;  3AVB A;  2YNI A;  5CYQ A;  4DF8 A;  1S9E A;  4CJS A;  3OYI A;  3RRH A;  3TAR A;  3MXM A;  3AA2 A;  4HTU A;  4FZX C;  1XWL A;  4CJQ A;  3DMJ A;  4E1M A;  2PYJ A;  1RT7 A;  1UA1 A;  2A1S A;  4KI6 A;  3MEG A;  3TAP A;  4DLE A;  2XY7 A;  1U49 A;  2DTU A;  2RN2 A;  3AA5 X;  1C1B A;  2PYL A;  4BWM A;  3VQC A;  3C6U A;  2XRI A;  3HPG A;  3SV3 A;  3TAQ A;  4MFB A;  3VQ5 A;  1QSL A;  4C8L A;  3RWU A;  1RDC A;  1JL2 A;  1BIU A;  3VQB A;  1D8Y A;  1VSM A;  2D0B A;  1C0M A;  3AO2 A;  4O5B A;  3RMD A;  4M3T A;  2Q3S A;  4Z4I A;  1JL1 A;  5FRO A;  4YFU A;  4IDK A;  4IKF A;  4M42 A;  1GOA A;  5HBM A;  3WNE A;  2OZM A;  1D5A A;  2VG7 A;  5SZT A;  2HNY A;  4CHP A;  3V9U A;  3M8S A;  4L8R B;  1SL0 A;  2Z1I A;  2NUB A;  3LDS A;  1ZBL A;  3VA0 A;  3KD1 E;  4F3T A;  4LSN A;  2KZM A;  4B9L A;  1NKB A;  4E1N A;  3OYG A;  4OJR A;  4AH9 A;  4FLT A;  1CZ9 A;  1KTQ A;  4CGF A;  3M8R A;  3CFR A;  1BL3 A;  3U6F A;  1XHZ A;  1U4B A;  4KRE A;  2HHV A;  1VSH A;  2IC3 A;  4RW4 A;  3NE6 A;  1NOY A;  3S3M A;  4PQU A;  4DTU A;  1LWC A;  2FBX A;  1HQU A;  3NH2 A;  4CER A;  1LWF A;  3V81 A;  1I39 A;  1RDA A;  2YHB A;  4DTM A;  2ITG A;  3LAM A;  3B6O A;  5KI6 A;  3D0P A;  3V9Z A;  3V4I A;  4ELU A;  4FJM A;  1J53 A;  2XY5 A;  4B3O A;  2HVI A;  1C6V A;  1X9S A;  2OPS A;  4CEZ A;  4B9T A;  3CFP A;  3DLK A;  4KFB A;  1KCF A;  2X74 A;  1YT3 A;  3NF9 A;  5HRN A;  2G8W A;  4FK4 A;  5KRT A;  3K5L A;  4BE0 A;  1TVR A;  1TGO A;  4AHR A;  2BAN A;  1C1A A;  3WNF A;  3L2V A;  4CK1 A;  3DOK A;  4DSK A;  1HPZ A;  4FJG A;  1RIL A;  1WLJ A;  4B9U A;  4N47 A;  4KHW A;  1EXQ A;  3ZT0 A;  4HVJ A;  4JRP A;  4CED A;  1WN7 A;  4DU1 A;  4CEF A;  3LPT A;  4CF8 A;  3OYD A;  2OA8 A;  3HJF A;  1J54 A;  4DQR A;  4FJN A;  4CEO A;  3MAQ A;  3KLG A;  3AO4 A;  3S9H A;  3OYA A;  1I3A A;  4FM0 A;  3LP1 A;  1IKW A;  1NKC A;  3VQ6 A;  1Q9Y A;  2FC0 A;  2DFH A;  2ZD1 A;  4F8R A;  3DOL A;  3MXJ A;  4RW8 A;  3UIQ A;  3L2R A;  3P83 D;  4FYD A;  3V1Q A;  1TL1 A;  1K6Y A;  2VG5 A;  5CY4 A;  3NGI A;  3L8B A;  4FCY A;  4E0D A;  2KFN A;  4RG8 A;  1FK9 A;  2HHS A;  1RNH A;  1WSH A;  2B5J A;  4Z4C A;  3OYL A;  2KFZ A;  1L3S A;  1S1W A;  3NHG A;  4KHU A;  1TKD A;  3IRX A;  2HHW A;  4Z0U A;  4I2P A;  1S6P A;  4KO0 A;  4NCG A;  3TAE A;  4ELV A;  1ASU A;  3HXM A;  3KJV A;  3DLE A;  4M41 A;  1CXQ A;  4DTO A;  1QHT A;  1JKH A;  2HB5 A;  3I0S A;  2QKB A;  1A5V A;  4XIU A;  3PY8 A;  1RDB A;  3IAY A;  3AVA A;  3HL8 A;  4KV8 A;  2FBT A;  1BIS A;  1JXE A;  1RBS A;  4CJR A;  4HCC A;  4LY7 A;  3DLB A;  1C0T A;  1LWE A;  3OJU A;  3TWH A;  1BCO A;  1RTH A;  4CHO A;  3LAL A;  1CXU A;  1JLF A;  4Z4E A;  1NK9 A;  4CHN A;  4FK2 A;  1BI4 A;  1RTJ A;  3NBP A;  4OLA A;  4QCL A;  1TKZ A;  3K59 A;  4CCH A;  1KVA A;  5SWM A;  5D3G A;  5J2N A;  2AJQ A;  4DU4 A;  1W9H A;  1RT1 A;  3KKR A;  3OS2 A;  3CYM A;  3FFI A;  3MEC A;  2E6L A;  3ZSX A;  3OYE A;  4OPK A;  4DTX A;  4E3S A;  4I9L A;  1NOZ A;  5HRP A;  4JRQ A;  3RR7 A;  3OS1 A;  3RRG A;  4K8X A;  1JLC A;  1QE1 A;  3IS9 A;  1T03 A;  1ASW A;  3F9K A;  4CJK A;  2EHG A;  4GVM A;  3AVK A;  4N41 A;  4KHY A;  3SI6 A;  4J2A A;  1QQC A;  1LAV A;  1TAU A;  2W42 A;  1VSJ A;  4C8K A;  1NJZ A;  3AA4 A;  4H4O A;  4M45 A;  3K2P A;  3T3F A;  1NK8 A;  4CJV A;  3T1A A;  3ZSO A;  4R5P A;  3WNG A;  4CHY A;  3NCI A;  4NCA A;  1KRP A;  1LW2 A;  4N56 A;  3CM5 A;  4DSE A;  3P5J A;  4KKO A;  4DMN A;  1WNS A;  3QES A;  1ZBF A;  3KTQ A;  3HST B;  1TKX A;  5HRS A;  3NH0 A;  4Y1D A;  3QEP A;  4B9N A;  4CIF A;  3OYC A;  3HM9 A;  4DTR A;  3O3F A;  2E6M A;  2OPQ A;  4CFB A;  2ATQ A;  3HK2 A;  4RW7 A;  1HJR A;  4PUO A;  3DM2 A;  1YTA A;  1UA0 A;  3V9W A;  3HP6 A;  2O4G A;  1EX4 A;  4LH5 A;  4G1Q A;  1A5X A;  4QAG A;  3KIO A;  2YV0 X;  3AA3 A;  1JLA A;  3DLH A;  1NK5 A;  4KTZ A;  3QEW A;  1C0U A;  3ZSQ A;  3OYJ A;  4PA1 A;  1WSI A;  3BGR A;  3KK2 A;  3A2F A;  2KW4 A;  3V1O A;  3ZSY A;  1UOC A;  1L5U A;  2Y1I A;  4K8Z A;  1LW0 A;  1QTM A;  3CFO A;  3V9S A;  4NYF A;  4OLB A;  4CJE A;  1G15 A;  4CJ3 A;  3OYM A;  1KLN A;  3LWL A;  4KTW A;  4CF1 A;  4I7F A;  3SJJ A;  3TAG A;  2P5G A;  3QIO A;  3I0R A;  1VRU A;  3C94 A;  2RPI A;  4M3R A;  1RTD A;  1J9A A;  2X6S A;  1QS4 A;  1X9W A;  3MED A;  3AVI A;  1QSY A;  1IKV A;  4Z4G A;  1BGX T;  4O55 A;  2YKM A;  1SUQ A;  3AVF A;  3AVH A;  5DMR A;  4DU3 A;  3SNN A;  3O3H A;  4BDP A;  1XHX A;  1HNV A;  1RCH A;  2G8U A;  4H4M A;  1IH7 A;  4FLU A;  3NF8 A;  4CJ4 A;  3I8D A;  1VSL A;  3PV8 A;  2OPR A;  4DSF A;  1Q9X A;  2JGU A;  3LZI A;  4M3Z A;  3QIP A;  4B9S A;  4F4K A;  5C25 A;  4CF0 A;  4PWD A;  2HHT A;  2X6N A;  3AV9 A;  4GMJ B;  4DG1 A;  4CHQ A;  3PO4 A;  3VQ4 A;  3RTV A;  4B9V A;  3NFA A;  3K5N A;  3SUQ A;  4AHS A;  4CEB A;  3SQ4 A;  2YHA A;  4CJP A;  4ELT A;  2RF2 A;  4CJU A;  1N5Y A;  4KPY A;  4IBN A;  4CIE A;  1IG9 A;  1YTU A;  2DFF A;  2OPP A;  2ZE2 A;  3QO9 A;  1ASV A;  3AVJ A;  4CEQ A;  4E19 A;  4EP4 A;  1SL1 A;  4CGH A;  1T8E A;  3LP3 A;  2D0A A;  2QXF A;  4FLY A;  3QNO A;  4CFA A;  1HQE A;  4FW1 A;  1TAQ A;  3VQ9 A;  3TAB A;  5J2M A;  2XY8 A;  4CGI A;  4BDY A;  3B6P A;  2BDP A;  4FJL A;  3KKS A;  3ZT1 A;  3NH1 A;  1HMV A;  2XO7 A;  3DRS A;  5J2Q A;  1S1V A;  3P1G A;  3EYZ A;  4EZ9 A;  3M8P A;  4EP5 A;  3OVN A;  3OJS A;  2HHX A;  4CJF A;  4M3Y A;  4M3X A;  1S1U A;  4CF9 A;  3AO3 A;  4E7L A;  5HLF A;  2YNG A;  3K5O A;  3O4N A;  2G8V A;  2BE2 A;  4E7K A;  1RTI A;  2VWK A;  3L3U A;  2GV9 A;  2FBV A;  3HYF A;  4ID1 A;  5HRR A;  4FZY A;  2GUI A;  1EKE A;  2GBZ A;  1KSP A;  2D0C A;  1RT2 A;  5I42 A;  4C8N A;  4LH4 A;  2G8F A;  4KHS A;  3SZ2 A;  3PX6 A;  4KB1 A;  4FJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...