4CEDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cedA00
3NBPA 2DY4A 2QK9A 5HRPA 3B6OA 4CJPA 3D0PA 2P5GA 3HVTA 3CFOA 4F3OA 2X6SA 4B9LA 1HYZA 1B9DA 1RDCA 3CYMA 4B9UA 3PX0A 4OJRA 3F73A 2HB5A 2Q3SA 3SNNA 1IG9A 2D0CA 3RR8A 4KI6A 1BIUA 3E01A 4NCGA 4ID5A 4CGGA 4DFPA 4CF0A 2A1SA 1UA1A 3CFPA 3IRXA 1CZBA 2E6MA 4DG1A 3M8RA 3OYCA 4KB0A 4AHCA 4AILC 4CJLA 3F9KA 4HUGA 3C94A 1Q9YA 4ID1A 3DYAA 4W5NA 4PUOA 2JGUA 3S3NA 4CHNA 4NYNA 1HPZA 1VK0A 4CGFA 4W5RA 4ELTA 3L2UA 1SL0A 4N41A 1HJRA 4AHTA 3PO4A 2P5OA 4Q0BA 2R7YA 3C6UA 1T05A 4FLZA 2QKKA 2OYQA 2BGGA 2KZMA 4J2AA 2BANA 4CEEA 3U3YA 1ASVA 1S1XA 2PY5A 2QXFA 3CFRA 3VQAA 4DTRA 2I5JA 4CK3A 3TARA 3VQ8A 5C24A 4CGJA 3VA0A 1HNVA 4FLXA 4CJ3A 2Z1GA 3OS1A 1B9FA 2XRIA 3ZCMA 4CGHA 1QS4A 3VQ9A 3SI6A 3MXJA 3EZ5A 1QSLA 4QOZB 4DTSA 3QIOA 4PY5A 4BE1A 1NK5A 3RMCA 3NH1A 3TABA 4AHVA 2RN2A 1C1CA 4EP4A 5FRNA 1S9GA 2ZQBA 4CFAA 3PX6A 4O5BA 1A5VA 1WSGA 3K59A 2F96A 3T19A 3P1GA 1TGOA 4K8XA 3K5OA 4J2DA 3NDKA 4Q5VA 1U45A 1LAWA 4FJ8A 2GV9A 3NGIA 3PV8A 1VSMA 2OA8A 2HNZA 1RTHA 2Z1IA 2VWJA 3RRHA 4RG8A 3SUNA 3LP0A 1KSPA 4FM1A 4N76A 5JS1A 5SWMA 3KLGA 1KVCA 1WN7A 1XC9A 2F8SA 1U04A 3HYFA 5J2PA 2OPPA 4FLTA 4DQSA 1QSYA 4KHQA 2RPIA 2DFEA 5K14A 1EX4A 3AVLA 1HYVA 4FJHA 2XHBA 3SPZA 3AO5A 3OYBA 4I2QA 4CHQA 3QNOA 3VQ6A 1GOAA 3RR7A 4B08A 2LSNA 2DFHA 2VG7A 3QIPA 3QLHA 1JKHA 3T3FA 3V6DA 1NK4A 4FJJA 4UQGA 3O3GA 2IC3A 3DRRA 3ZSZA 1NK9A 4OKJA 4DTOA 1RCHA 2VWKA 3VQEA 4M3YA 4AHRA 3HO1A 3OYFA 4FJGA 4Z4IA 3NHGA 3TWHA 2HNDA 3ZT2A 4KV8A 4NCBA 5CY4A 3ZT0A 2AJQA 1WAJA 1KVBA 5HRSA 4ZTJA 1NJZA 1KVAA 4KRFA 1RILA 4F4KA 3P5JA 4CE9A 4CF9A 3AVKA 3LAKA 3HPOA 1WSHA 3MXMA 4KHUA 1WSIA 4Z4EA 3LPUA 4BWJA 2HHWA 3KLHA 2XY5A 1TVRA 2WONA 3O3FA 3OYGA 1RT6A 1VSFA 3NF6A 4FJ9A 4NYFA 4DFKA 4CJVA 1U48A 1CLQA 1YTAA 4CESA 5J2QA 1HQEA 1RBUA 1VSKA 4CIGA 2OPRA 4IFYA 4FLVA 4DS5A 1X9SA 1J5OA 4M3TA 1C0TA 3ITHA 3VQBA 5E41A 3MECA 1JLBA 4FW1A 1JXBA 3KLIA 1VSJA 1BI4A 1DTTA 3KLFA 1FXXA 4DSKA 4BDPA 4M3UA 1XWLA 3ZSOA 4DSFA 4IBNA 3EYZA 3AA5X 4R5PA 4AH9A 3VA3A 4BDZA 1NK8A 3LPTA 1NOYA 4FJNA 4M3ZA 3SJJA 3TAEA 3NAEA 3DMJA 2EX3A 1U49A 1ZBUA 3O4NA 2ETJA 3OYHA 4CEDA 1UAXA 1XI1A 2KQ2A 3PX4A 2XO7A 4CJKA 4KHWA 5C25A 1FKPA 4LY7A 3SPYA 1S1TA 5HP1A 3HK2A 1WNSA 3KK1A 4BACA 2JLEA 3MEEA 3AVIA 3RTVA 2Z1JA 1NKBA 2IDOA 4ZTFA 3TAQA 4HHTA 4FK0A 3AVNA 4IDKA 3H08A 3SQ0A 1LWCA 3I0SA 3V9ZA 2KW4A 4JRQA 2A1RA 1S1VA 3WNFA 1Z25A 4HVJA 4Z4HA 1TK0A 3V1OA 1WSJA 4DSJA 2HHQA 1VRTA 4CGIA 1L3SA 4BWMA 1J9AA 1FKOA 1BI4B 3O3HA 5HBMA 3OS2A 4CJ4A 2QKBA 3HJFA 3DLHA 2B6AA 1S6PA 4PWDA 4DQPA 1VSDA 4CCHA 4M3RA 4QAGA 4DFMA 4KAZA 1B92A 1UWBA 2YHBA 2VG5A 1RT2A 4E1NA 4EP5A 5HRNA 4B9SA 1NK0A 1QSSA 4F8RA 3QEVA 2FBXA 4E7JA 3SQ2A 3IG1A 3K58A 3NH2A 3OYKA 3NGZA 2PYLA 4OLAA 2G8HA 4M41A 1QE1A 3K2PA 1KFDA 4O55A 3NH0A 3TAPA 3AA3A 1LWFA 2XY7A 4KPYA 4FJKA 1JL1A 2D5RA 3MXIA 4XIUA 2OPSA 3OY9A 2F8TA 4CEFA 1KLMA 4JS4A 1NJWA 1TAUA 4AHUA 3KLEA 5HLFA 1WLJA 2GUIA 1RT1A 4CERA 4NCAA 1JLQA 1NOZA 3HSTB 4IFVA 2HNYA 2B5JA 3ZSYA 1ZYQA 4B3OA 1ASWA 2GBZA 3HL8A 3SQ4A 1RBRA 2ATQA 3CM5A 1GOCA 3OYNA 1I3AA 4BE0A 2OPQA 4DTPA 4CJFA 3CQ8A 2BDPA 2NUBA 4I7FA 4CJTA 4IKFA 3O4QA 4DLGA 2HHXA 1ZBHA 1TK8A 4E3SA 2WOMA 1KCFA 2BE2A 4OVLA 3G10A 5CZ1A 5I42A 1JLFA 4M42A 4YFUA 4OKEA 3HPGA 3NE6A 2HHSA 2EHGA 1A5WA 1RTDA 3B6PA 2E6LA 3OYLA 4JRPA 1NJYA 3QEIA 3ASMA 4DTNA 2YHAA 4CJQA 3SYZA 4E1MA 3WNHA 1XHXA 2G8KA 1S9EA 2Z1HA 3QINA 4OGCA 4CHYA 2VG6A 2YNHA 3AVCA 3FFIA 3S3MA 1T7PA 4RW9A 4F2RA 2HHUA 1VSEA 3QEXA 4M45A 3TI0A 4Z0UA 3P83D 3K57A 4FZZA 3U3GA 5FRMA 2KZZA 4FW2A 1CZ9A 4EZ6A 4I2PA 4CEZA 3V1QA 3RRGA 1LV5A 5KGXA 1JLCA 3HVRA 3RMAA 5D3GA 2ZD1A 3SV4A 4DTMA 3HP6A 4CHZA 3KD1E 1WAFA 3VQ5A 1RT4A 3ZSQA 4DU4A 4O4GA 3K5LA 1TKXA 3L2VA 4H8KA 1BHLA 3ALYA 3T1AA 2YKNA 1EETA 3VQ7A 4FLUA 3QETA 5KTQA 1ITGA 1IH7A 4I9LA 4E19A 4B8AB 2FBYA 4DF8A 1BQNA 1FK9A 1D5AA 1D9FA 4G1QA 1RDBA 4O0JA 2O4GA 1NJXA 1YTUA 4CFDA 5SZTA 4KREA 1RTJA 1G15A 2IOCA 4CHOA 4FJMA 2YKMA 1DTQA 3VQ4A 1SL1A 3AA2A 2XY8A 4DSIA 4CJ5A 1EXQA 2W42A 4CK1A 1S6QA 4H4MA 4LH5A 4DU1A 2KTQA 1WSEA 2E4LA 2FC0A 3SQ1A 1NKCA 1D9DA 1RT3A 3OYJA 3WNGA 5C42A 1X9MA 4TSXA 3C6TA 4KB1A 5DK5A 5KGWA 1K6YA 1O1WA 1W9HA 3AVBA 3M8SA 4IG3A 1MU2A 2G8UA 3VQDA 1RDDA 4PQUA 1RDAA 4FZYA 4CF2A 2HVIA 4FLYA 2OZMA 4MQ3A 2IAJA 3DOLA 4JLHA 4IG0A 4I9QA 3I0RA 1L3VA 1JLAA 3KK3A 2DTUA 1UA0A 4W5OA 3IAYA 3K5MA 4C8OA 2RF2A 4Y1DA 4F2SA 4CJWA 4OLBA 3OYIA 1D8YA 3HM9A 4KO0A 4AHSA 1X9WA 2IS3A 3AV9A 3LP2A 3TAGA 4FXDA 3A2FA 1C6VA 3DLGA 1RBVA 4CHPA 4FZXC 3QESA 4E0DA 5EU7A 3WNEA 1Q8IA 1YVUA 3KK2A 4JS5A 1IKXA 1RTIA 4GVMA 4KHSA 2HHTA 3VQPA 4CK2A 5FDLA 1C0UA 4C8KA 4HCCA 2ZE2A 1EP4A 4FYDA 4CJSA 3DI6A 3DRSA 4B9TA 3SCXA 1HQUA 1RBTA 2G8VA 1JL2A 4GMJB 4OGEA 4DU3A 3AO3A 3QEWA 1JLEA 4RW6A 5KRSA 3OS0A 4B9MA 4KFBA 1WSFA 3EY1A 3LZJA 1IO2A 4FK4A 2G8FA 3M8QA 4MFBA 1RT5A 3OYDA 3CG7A 3AVJA 4LD0A 1TL1A 4DF4A 3RMBA 4E7LA 3UIQA 3MEGA 3ZT4A 4ZHRA 1C0MA 4CEBA 1S1WA 1QQCA 1ZBFA 2P51A 2YV0X 4CFBA 2O4IA 4E7HA 3TAMA 4KHYA 3SUOA 2X6NA 2D0BA 4RW4A 2G8IA 1BGXT 3L3UA 4OKKA 4CEAA 4KTQA 4HTUA 3THVA 4DTJA 1KFSA 3PO5A 4B9VA 3OVNA 1RNHA 3DLEA 2HMIA 1I39A 2X78A 3LALA 3KIOA 2OZSA 4CJEA 1KRPA 3LZIA 3NF7A 1BIZA 1F21A 1Y97A 1S1UA 3M8PA 3VQCA 3LWLA 3TANA 4H4OA 3ULDA 5CZ2A 2Y1JA 2PYJA 3DLKA 1L3UA 3HXMA 4DWIA 3QEPA 3L2QA 3ZT1A 3LP3A 5KI6A 4CEOA 4CJUA 2P1JA 3SV3A 3V4IA 1X1PA 3KTQA 1XHZA 3OYEA 4FJXA 1U47A 1ZBIA 1KLNA 2ITGA 3VQQA 3AO2A 4W5TA 1TKTA 3L8BA 4K8ZA 3QNNA 4M3XA 3AVMA 3LDSA 1LW2A 1DLOA 4CIFA 1U4BA 1N6QA 4KTZA 1TKZA 2RKIA 4J2BA 3SUQA 3G0ZA 1Q9XA 4Z4GA 1N5YA 4DS4A 3TR8A 1A5XA 3DM2A 3LAMA 4DQQA 1BCOA 1GOBA 1NKEA 1IKWA 3ISNC 3SUPA 3NF8A 3KD5E 1CXQA 4CFCA 3K5NA 2Y1IA 5JS2A 3L2RA 1LWEA 3SZ2A 2G8WA 3PUFA 3OJSA 3RWUA 3ZSVA 5J2NA 2HW3A 4FJLA 4ELUA 1TK5A 1CXUA 1SL2A 1SKWA 4N56A 1C1BA 1YT3A 3NFAA 3RMDA 3ZSXA 4FLWA 3AO1A 1W0HA 3ZSWA 1HYSA 2B4JA 3KKSA 4N47A 4CF8A 4DFJA 3OYAA 1RBSA 2YNIA 3NF9A 4BE2A 3V9SA 2KFZA 4F3TA 4WE1A 4FCYA 1TAQA 1ZBLA 1SV5A 3S3OA 1L3TA 2DFFA 3NGYA 3QO9A 3PY8A 1VSLA 1SKSA 4DTXA 4CECA 3C95A 1VSHA 4FK2A 1HNIA 1VRUA 5CYQA 1TV6A 1Z26A 3MEDA 1SKRA 3VN5A 1HMVA 1KTQA 1SUQA 1VSIA 3DRPA 4CJRA 3V9WA 2FBTA 3L3VA 5HRRA 3V81A 1BISA 5FROA 3ZSRA 1TKDA 4FJIA 4B8CA 4L8RB 4CF1A 2KFNA 3AVFA 1QTMA 1BQMA 4B9NA 4RW7A 1TL3A 2FBVA 3TAFA 1REVA 3AVGA 5CYMA 4ELVA 3HPHA 4N5SA 3D45A 1NK6A 1L5UA 4O44A 4FVMA 4E7KA 1JLGA 4FJ5A 2PZSA 4KI4A 1HRHA 3BGRA 3MAQA 3AA4A 1BL3A 3LP1A 4KKOA 3NCIA 4FM0A 1LAVA 5J2MA 4CIEA 4HUEA 4KTWA 4M3WA 3V1RA 2IGIA 3AO4A 3DOKA 3LWMA 1IKYA 1ASUA 4DQIA 1UOCA 4GW6A 3JYTA 4OPJA 1T8EA 1NK7A 4E89A 3OJUA 5J1EA 5I3UA 4OPKA 3CM6A 4FM2A 4C8NA 4Y1CA 1EKEA 4FJ7A 1QHTA 1RT7A 3KKRA 3AVHA 3KJVA 5T7BA 4LSNA 4BDYA 2HVHA 4DSLA 4DMNA 4W5QA 3OYMA 2YNGA 4CEQA 3QERA 2D0AA 4RW8A 4PA1A 4LH4A 4DSEA 4O0IA 3V9UA 3I8DA 3HP9A 3HT3A 4HCBA 4CGDA 4LSLA 4J2EA 2XY6A 4DQRA 3U6FA 2X74A 1R0AA 4YNQA 3LANA 3ZT3A 4HUFA 3JSMA 2YNFA 1IKVA 4DLEA 3DLBA 3BDPA 3DLRA 1LW0A 1BCMA 4KHNA 4EZ9A 1C1AA 4C8LA 5KRTA 5DMRA 4Z4FA 3IS9A 4DTUA 5HROA 1J54A 3S9HA 3V9XA 1J53A 4QCLA 4ICLA 4C8MA 1T03A 1JXEA 3L2WA 4Z4CA 4E7IA 3AVAA 1S5JA 2HHVA
chains in the Genus database with same CATH superfamily
3NBPA 2DY4A 2QK9A 1HYZA 2UYTA 3N4PA 4X62K 4B9UA 4OJRA 2HB5A 3H3NO 2P9LB 5FPDA 4NCGA 4WQ4C 5JMVA 4DFPA 4JAXA 3IRXA 4A2AA 1KAYA 5MLCQ 3SMPA 5C2FA 4HUGA 3CHWA 1XMQK 2W40A 3G6EN 4PUOA 1BU6O 3A5MC 4B3SK 4W5RA 4ELTA 3L2UA 5AQZA 1NGJA 2P5OA 1T05A 4FLZA 1DKGD 2YHYA 2PY5A 4M7YA 3CFRA 3VQAA 3DXMA 4CGJA 5BRHA 5HOOA 4JKDA 3ZCMA 3VESA 4PY5A 4BE1A 2V52B 3DXKB 3RMCA 1NK5A 3VGKA 4AHVA 5AQHA 4CFAA 1WSGA 3K59A 1TGOA 2GEMA 3K5OA 2O8CA 3ZX0A 3PV8A 3TTCA 1V4SA 1RTHA 4H5WA 4N76A 2QM1A 1KSPA 3KLGA 3JAMO 1JCEA 2OPPA 4MDAA 4FLTA 4DQSA 1QSYA 2O8BA 3SBTA 3SPZA 3OYBA 4CHQA 3QNOA 3O1WA 1GOAA 1K9MO 3RR7A 2VG7A 3GDQA 1JKHA 4FJJA 3DRRA 1RCHA 4M3YA 2HF4A 3OYFA 3T7ZA 4Z4IA 1T44A 5CY4A 4ISEA 4NXMK 3M5RA 5BPMA 1QQNA 2WTUA 5EVZA 4KHUA 3MXMA 3CETA 4Z4EA 4JI2K 3LPUA 4BWJA 4B1UB 3KLHA 2WONA 4EHUA 3CCJN 4NYFA 4DFKA 5J2QA 4GY2B 1X9SA 3VF4A 1C0TA 5E41A 1YHQN 1JLBA 3WEEB 3WUHA 3KLIA 1BI4A 1EQYA 4DSKA 1XWLA 4DSFA 4IBNA 1VQ6N 1SAZA 5CR4A 3VA3A 4BDZA 1VQ9N 3LPTA 3ZLJA 4FJNA 4B1ZA 3FGUA 3OYHA 5C25A 3SPYA 3KK1A 2JLEA 3AVIA 3DJCA 3LDNA 4FPBA 4HHTA 3CC7N 3AVNA 4IDKA 4JN4A 5C2DA 5BR8K 4BR7A 4FK0A 1LWCA 3I0SA 2E2QA 4FWOA 5KQDA 1Z25A 1TK0A 3TPQA 3V1OA 3VERA 1YIJN 3D2FA 3HRGA 4CGIA 4BWMA 1U6ZA 3H1VX 3EKSA 2B6AA 2FXUA 1HNWK 4QAGA 1B92A 1UWBA 3J7YP 1OH6A 2Q31A 4E1NA 5HRNA 2ZJQL 4LC9B 4B9SA 2PFUA 2HMPA 1HJOA 3QEVA 5AR0A 4CZKA 4BC4A 2PYLA 4OLAA 3TAPA 3BP8A 2D5RA 4WF9L 1YAGA 4K0KK 3KLEA 5ADXH 3CERA 4CERA 4NCAA 1NOZA 4IFVA 4PHTX 2HSTA 1N33K 3SQ4A 3OYNA 4BE0A 2NUBA 2QEXN 1NU0A 3O4QA 1TK8A 2BE2A 3G10A 4M42A 4GV9A 4YFUA 2HBKA 4OKEA 2EHGA 2QWRA 1A5WA 3B6PA 3OYLA 1NJYA 3WXMB 3QEIA 3ASMA 4DTNA 2O8DA 3WNHA 1S9EA 4GV6A 3QINA 4JKEA 2FF3B 3AVCA 2PAVA 1XUPO 4F2RA 4CI6A 3QEXA 5C15A 3P83D 4FZZA 5FRMA 2KZZA 4CVNE 2ZGZA 3DLLL 3PSFA 2E1YA 1R59O 3SAHA 4JI6K 1LV5A 3MK6A 1NNEA 4YDUA 4DTMA 2QI2A 4IOAL 4DU4A 3K5LA 2P9NB 4H8KA 1ATNA 1X3MA 4WQ5C 4WYBA 3VQ7A 4FLUA 3E66A 4B8AB 3O9QA 5JICA 3CI5A 1D9FA 3EN9A 3CF5L 1NJXA 4CFDA 3AARA 1RTJA 4ILHA 1SL1A 1VQLN 4JHDA 5AQFA 4YOVA 4CK1A 1S6QA 5EOYA 1IBMK 3VGLA 4DU1A 3QICA 2P9PB 1NKCA 1D9DA 1EWQA 3SLCA 3C6TA 3I33A 5DM6L 5KGWA 1W9HA 1WUAA 3GE1A 3LDPA 4PQUA 2IAJA 5M1FA 2NRZA 1L3VA 2F9TA 3KK3A 3IAYA 3K5MA 1M1KO 4C8OA 3UKRA 2YX6A 1C6VA 4CHPA 1IKXA 3CJ7A 2WUSA 4HCCA 2ZE2A 3A0IX 4FYDA 1QQMA 3DI6A 4B9TA 2G8VA 1RBTA 2EWSA 3CJ1A 3O5BA 3AO3A 4IDHA 2JWLA 1WSFA 4CZGA 3EY1A 3LZJA 1IV0A 4B3MK 4R79A 4FK4A 4DR1K 4K41A 1HKBA 4RWTA 1RT5A 2NRRA 3MEGA 4BRMA 4EAHD 3DAWA 2X6NA 4F9OA 3OBWA 1BGXT 2JWKA 3W0LA 4DTJA 3DLEA 3WT0A 2OZSA 4CJEA 3KK7A 3NF7A 3QMLA 3U8XA 1Y97A 3VQCA 4XEIA 3ULDA 1LCUA 1VQNN 4YOXA 3ENOA 3QEPA 4CJUA 1MWKA 2ITMA 1X1PA 3KTQA 1XHZA 3E9OA 1WB9A 4W5TA 5ELZA 1TKTA 1DLOA 4CW7B 3ID6A 1N6QA 3SUQA 4MO4A 4Z4GA 4BG9A 4DS4A 2P9UB 3DM2A 4X65K 1QVGM 1BCOA 3NMUA 3NF8A 3K5NA 4CZJA 5JS2A 3SAFA 2OTJN 4FO0A 4B3RK 5J2NA 2HW3A 4ELUA 1CXUA 1SL2A 3R1XA 3EL2A 3NFAA 3BEXA 4HWIA 5BN9A 1HYSA 3H1QA 4N47A 3AGRA 4IO9L 4LF9K 4B1WB 2YNIA 3QO9A 1HR0K 1VSLA 4DTXA 1VSHA 1NGGA 4JD2A 3LDQA 4I6MB 3VN5A 1KTQA 1SUQA 3MMVA 3O80A 3V81A 2FBTA 3ZSRA 4L8RB 2KFNA 1TUUA 1BQMA 3CCQN 4B9NA 3AVGA 5CYMA 3O08A 1L5UA 2VYPA 2PZSA 3R9PA 3CXCM 4CZIA 3J7ZO 2IGIA 1OVQA 4OPJA 1T8EA 1OVYA 2RHKA 5J1EA 4FM2A 1QHTA 4DV5K 3AVHA 3VEWA 4BGAA 1DT9A 4DMNA 3QERA 2YNGA 4CEQA 4RW8A 3AAQA 5AQOA 2ZM6K 4DV6K 3P38A 1E4FT 3V9UA 3I8DA 4BRNA 4A62A 2KKZA 4AF1A 1R0AA 3CQYA 2YNFA 4DLEA 3DLBA 3BDPA 5F2RA 4L3QA 2FSNA 4C8LA 3RSEB 1HUXA 4H0VB 5AQPA 3V9XA 4KHPK 1J53A 4QCLA 2ZGYA 4CZMA 2YJEA 1S5JA 4CJPA 3CQXA 3CFOA 4F3OA 3OA9A 1RDCA 3J81O 4IFEA 4FVUA 3CYMA 4YDUC 3ENHA 3PX0A 3F73A 3SNNA 1IG9A 4KI6A 1D4XA 3O1BA 4ID5A 4CF0A 2A1SA 1UA1A 4YY3K 3CFPA 1RDWX 3H46O 3OYCA 3BF1A 4AILC 4IXCA 1KD1O 1Q9YA 4W5NA 2HHHK 3E9PA 4NYNA 1HPZA 4IOXA 1MWMA 1QZ5A 4N41A 1KAZA 5EX5A 5KPTA 2R7YA 3C6UA 2BGGA 4ILGB 2IVNA 2KZMA 4A59A 4DV3K 4B9QA 5M1QA 2BANA 5EY4A 4CEEA 3U3YA 1K8KA 4BRQA 2A40A 3VQ8A 1HNVA 3HSCA 1DEJA 4PKIA 4DR5K 3CC2N 4PL8A 4OX9K 3TABA 2RN2A 4DV7K 3DWLA 1S9GA 3PX6A 3E9LA 2A6AA 3QFUA 4QS8A 3I8BA 4J2DA 4NLBA 3VMFB 4H5NA 1VSMA 2IVOA 2OA8A 2HNZA 2VWJA 3LP0A 4JI1K 5SWMA 5IT9O 1W97L 4CBXA 1OH5A 4KHQA 3DXMB 2ASMA 4FJHA 3AO5A 4JYAK 4RTFD 1EO1A 3F2KA 2LSNA 2DFHA 1NK4A 3QLHA 3V6DA 3EKUA 3O3GA 1NK9A 4OKJA 4EIAA 3WXJA 4DUZK 4DKWA 4AHRA 1YI2N 4FSVA 3M6GA 2HNDA 3ZT2A 3IKMA 2AJQA 1KVBA 4JKAA 2O8CB 4YOUA 3HPOA 1NG9A 1HKCA 3AAPA 2HHWA 2XY5A 3OYGA 3H3OB 3O3FA 4FPAA 2O8BB 4PKHA 3WXKA 3NF6A 4KH5A 2GWJA 1XNRK 1HQEA 1RBUA 1X3NA 4IFYA 4M3TA 2HOEA 3MECA 3VETA 4DV4K 3KLFA 1FXXA 1HX1A 4R5PA 3TAEA 3DMJA 1J5EK 3O4NA 3OTOK 1NGBA 3PX4A 3R3LA 4KHWA 2QWOA 4FWPA 1S1TA 4BGBA 1WNSA 1XNQK 3MEEA 1TUYA 2A41A 4DQ8A 3ZETA 2IDOA 3FZLA 4DUYK 3V9ZA 3C7NA 4JRQA 2A1RA 3D6RA 3EO3A 3WNFA 4HVJA 4A5AA 4M63C 1WOQA 3MDQA 3P39A 1J9AA 1BI4B 2QKBA 1FW6A 3KWIA 4PWDA 4IO8A 3LL3A 4DFMA 1NK0A 4F8RA 5LJWA 2OCEA 2FBXA 2IIRA 3NH2A 3OYKA 1TYQA 4BROA 2G8HA 1QE1A 1KFDA 2VGMA 3AA3A 1LWFA 4XIUA 2F8TA 3MWPA 2DPNA 1NJWA 2VQEK 2FSJA 2QWMA 2UUCK 1WLJA 1JLQA 3ZSYA 1ZYQA 2B5JA 4KBOA 2F4VK 2ATQA 3D2FB 3CM5A 1GOCA 3BUZB 3MCPA 4DTPA 4CJFA 4I7FA 3CPEA 4OVLA 1OH8A 3NE6A 2HHSA 3VTIA 3R8EA 2E6LA 3PIPL 4E1MA 3VEZA 3ZYYX 2Z1HA 4OGCA 3C0BA 1WBDA 3J7AP 3FFIA 4RW9A 1S22A 2Q97A 4M45A 3TI0A 3EE9A 4FW2A 5BPNA 1CZ9A 4CEZA 3V1QA 1JLCA 3HVRA 2YHWA 3T1HK 5D3GA 3MN5A 3HP6A 4CHZA 1WAFA 4IJAA 1T6CA 4O4GA 1TKXA 3ALYA 1EETA 3C6HA 4FWLA 5M1OA 3AGKA 1BQNA 2O8DB 2O4GA 1YTUA 5SZTA 4JKGA 4KREA 1G15A 4CHOA 4FJMA 3VQ4A 3AA2A 2XY8A 4DSIA 4BRFA 2QWNA 4H4MA 1S3XA 2E4LA 2FC0A 4IJNA 4OPAA 5C42A 3SJHA 4TSXA 4OO1J 3O9SA 5DK5A 1K6YA 1P8ZA 5JVHL 2NRWA 3M8SA 1RDDA 4FZYA 4FLYA 4XH5A 4MQ3A 2OZMA 3DOLA 3ZX2A 3A8YA 4M7XA 2WBNA 2VGNA 2YCHA 1MDUB 1UA0A 2RF2A 3W3DA 4Y1DA 4F2SA 2YHXA 4YORA 4OLBA 3OYIA 2AA4A 1D8YA 4KH6A 4KO0A 4AHSA 3Q7CA 3ATVA 3AV9A 3LP2A 2QA4N 1S72N 1RBVA 4FZXC 4JHDB 3WNEA 3TSQA 3KK2A 4JS5A 1RTIA 2I7NA 4KHSA 4CK2A 1C0UA 2V7YA 1EP4A 3DRSA 1HQUA 4LF8K 1JL2A 4GMJB 4DU3A 2CGLA 3QEWA 2P9SA 5KRSA 2CH6A 1Z6RA 4DCHA 3GOIA 5GAHP 2BH1A 3UKRB 2E1ZA 1YJWN 4MFBA 2D0PA 3AVJA 4LD0A 1TL1A 5AQSA 5AJ3K 5E26A 1C0MA 4ISGA 1S1WA 1QQCA 1ZBFA 3UE5A 2YV0X 4CFBA 2O4IA 4E7HA 3TAMA 4KHYA 5AQRA 3SUOA 2D0BA 4BG8A 1KAXA 3L3UA 1ATSA 3CCMN 3THVA 3OVNA 4IEEA 1RNHA 4BQLA 2X78A 4BRGA 3KIOA 2A42A 2GWKA 1KRPA 4MO5A 1BIZA 1S1UA 3M8PA 5CZ2A 2UUAK 1L3UA 3LP3A 5KI6A 3SV3A 2P1JA 3TSPA 3O8MA 4FJXA 3LDLA 2QXLA 2ITGA 3VQQA 5AQLA 5GIPA 1U4BA 3N4QA 4J2BA 4KTZA 2RKIA 1ZXOA 3T69A 4C1NK 2ZJRL 1A5XA 3LAMA 1SZ2A 1IKWA 4CFCA 2GTDA 4Z94A 3L2RA 1LWEA 3RWUA 1Q82O 2GX9A 4GVEA 4FJLA 4XH4A 5AZIA 1SKWA 4K43A 1C1BA 2KLAA 4CJ7A 4H5TA 4FLWA 5GAEP 2B4JA 3KKSA 4CF8A 1RBSA 4F3TA 4FCYA 1TAQA 1ZBLA 4LF4K 3S3OA 2DFFA 3ZEUA 4NLCA 5LL6Z 4FK2A 4CECA 1HNIA 4MLEA 3PSIA 2Q1NA 1TV6A 3O9UA 2P9IA 4B1YB 2G8WA 3DRPA 3L3VA 5HRRA 1BISA 5TKYA 2QWPA 3EZWA 5M1KA 5LMUK 4RW7A 1TL3A 4ELVA 3H6EA 3HPHA 4N5SA 1NK6A 3THXA 4O44A 1JLGA 3MAQA 3LP1A 4KKOA 3NCIA 3CMAN 5J2MA 1YITN 3QBWA 1ZBSA 3A5OC 3HM8A 1UOCA 4GW6A 3JYTA 4JI4K 1Q18A 4E89A 3OJUA 5I3UA 1G99A 3CM6A 4BRHA 4C8NA 2A5XA 4JD2B 3HOSA 4LSNA 4BDYA 1BG3A 4LF5K 4DSEA 4O0IA 3JXUA 2P9KA 4HCBA 3AY9A 5LY3A 4X66K 3GBTA 4LSLA 3THYA 4DQRA 4QS9A 4YNQA 4HUFA 1NGEA 4V19S 3GG4A 3PLAA 2QWQA 4EZ9A 4LF6K 5DMRA 4Z4FA 3IS9A 4DTUA 3HI0A 5HROA 1J54A 1XQSC 2Q0UA 3L2WA 4E7IA 3AVAA 5KQ8A 4JI3K 3D0PA 3HVTA 5AQMA 2X6SA 4A61A 1B9DA 3TSUA 2Q3SA 1KXPA 3RR8A 3E01A 2E6MA 4DG1A 1GLFO 3TTDA 1SS6A 4AHCA 4CJLA 4A5BA 4FWNA 4CZFA 3C6AA 5DM7L 3DYAA 3ULEB 3U9ZA 1NM1A 2CGJA 3S3NA 4CHNA 1VK0A 1OKJA 1HJRA 4AHTA 3PO4A 3MWTA 4Q0BA 4QS7A 2QKKA 3VEXA 4J2AA 2QXFA 1M90O 4DTRA 2I5JA 3TARA 4FLXA 2Z1GA 3Q7BA 1B9FA 2XRIA 3OS1A 4C23A 3VOVA 4BRIA 3SI6A 4Y0WA 3EZ5A 4QOZB 1YJ9N 5BR9A 3L0QA 1W7AA 4EP4A 5FRNA 2ZQBA 4BR4A 1VQON 4O5BA 2F96A 3P1GA 4E1JA 4Q5VA 1LAWA 1Q86O 4FJ8A 2F7TA 3QFPA 3SMSA 3SUNA 3ATUA 4H5VA 2O8FA 2F8SA 4WFBL 1U04A 1JJ2M 2RPIA 1K8KB 1GLAG 3AVLA 4AM7A 2QTDA 3VQ6A 4NB4A 5IWAK 5ADXA 2VWKA 4WQ4A 1YUWA 1ZC6A 3TWHA 4NCBA 3ZT0A 1WAJA 5HRSA 4ZTJA 1RDUA 4U67L 4KRFA 4F4KA 3P5JA 4CF9A 3AVKA 3LAKA 1BOTO 1WSIA 3L6QA 3CCUN 4JI8K 1TVRA 1RT6A 4DR4K 2CH5A 4FJ9A 1HPMA 4LF7K 3F5TA 4EHTA 1J5OA 1BA0A 1VAZA 1YXQA 1NLVA 4FOEA 4FW1A 1JXBA 1VSJA 1DTTA 4M3UA 1IBKK 1NOYA 4M3ZA 4H0PA 3SJJA 1U2VB 4O5FA 2QWLA 2HF3A 2NZTA 2ETJA 4FOIA 4CEDA 1UAXA 1XI1A 4K42A 3QBXA 3ULEA 2XO7A 3BZKA 3LM2A 5HP1A 3HK2A 4BACA 2OTLN 2Z1JA 3P4IA 2ASPA 3TAQA 1HNXK 3H08A 4JNEA 3SQ0A 1IBLK 2KW4A 2IVPA 5AQGA 1T3VA 5FLXO 4H0YB 4DSJA 4ISFA 1WSJA 1VRTA 3O3HA 1FKOA 4JKBA 3HJFA 4DQPA 5GIOA 3THWA 4M3RA 2Q36A 1T6DA 2VG5A 4EP5A 1QSSA 3CCLN 4LFBK 3SQ2A 5CHIA 3HZ6A 3NGZA 4M41A 3UKUA 3M1FA 1MA9B 3NH0A 4KPYA 5BPLA 4GNIA 1JL1A 3ZETB 3KVGA 2OPSA 4JS4A 1TAUA 2NRHA 4BY9C 3C7NB 1EWRA 2HNYA 2FLOA 1ASWA 3SAGA 2GBZA 1RBRA 1I3AA 2OPQA 2BDPA 3CQ8A 2HHXA 3K0SA 5I42A 1JLFA 3HPGA 4BC2A 4JRPA 2YHAA 4CJQA 5GAGP 5KPZA 5LMNK 1TYQB 3JS6A 1JCFA 2YNHA 3TTFA 4DR6K 2HHUA 1VSEA 5E84A 4Z0UA 3K57A 4BRKA 4YOYA 4EZ6A 3NVMA 3MX2A 4XH1A 1HLUA 1BO5O 3HBTA 3SV4A 2GUPA 3VQ5A 1RT4A 3WXLA 4BQZA 4DB3A 5C10A 2YKNA 1HKGA 5KTQA 1ITGA 2OANA 4I9LA 2FBYA 1E3MA 1FK9A 1NBWA 2O8EA 5BREA 4G1QA 1GLLO 1RDBA 1U2VA 3VF6A 2W6KA 2E2PA 3O4WA 2IOCA 4CBUA 5GADP 2W42A 1EXQA 4LH5A 3IUCA 4IEIA 5LJVA 1WSEA 2KTQA 3SQ1A 1RT3A 1X9MA 2E2NA 2HBJA 4AM6A 2G8UA 1MU2A 4NXNK 4BC3A 1NGHA 1DGKN 4CF2A 2HVIA 4I9QA 3I0RA 1JLAA 5JVGL 2DTUA 3CJCA 2E2OA 4CJWA 3KHYA 1X9WA 3E1YA 2IS3A 4JKGB 4FXDA 5AQQA 3DLGA 1Q8IA 1YVUA 3P31A 4GVMA 2HHTA 5FDLA 4C8KA 1Q7YO 2W41A 3SCXA 4JKCA 1KC8O 1JLEA 4RW6A 3OS0A 4B9MA 4KFBA 5GINA 3FE1A 1IO2A 2G8FA 2E8AA 5AZJA 3M8QA 4CD3A 4O8KA 3VEOA 3OYDA 5BRFA 3CG7A 3RMBA 4ZHRA 2G8IA 4RW4A 4OKKA 4CEAA 4CZLA 1YF5L 1KFSA 4B9VA 3PO5A 3LALA 3CC4N 3CPWM 3LWLA 3HO1A 5AQTA 2PYJA 3TANA 2Y1JA 4H0XB 3DLKA 4DWIA 4GV3A 3FLCO 2P9SB 3ZT1A 4CEOA 3V4IA 1V4TA 3OYEA 4IZ9A 1U47A 4DHYA 1KLNA 3WQUA 2BTFA 3AO2A 3L8BA 4K8ZA 3AVMA 4PL7A 4JKFA 3QB0A 3G0ZA 5AQJA 1N5YA 2CGKA 3TR8A 3PIOL 4DQQA 1GOBA 1ATRA 3ENBA 3G25A 1NKEA 3ISNC 3SUPA 2NRTA 1N8RO 2Y1IA 1H1VA 3SBGA 3PUFA 4J8FA 2FSKA 1K73O 2UUBK 4YHHK 3ZSVA 3CJBA 4H5RA 5AQXA 1YT3A 3CCVN 3ZSXA 3AO1A 1RFQA 4DFJA 2ZF5O 3NF9A 4CBWA 1Q81O 3C95A 1VRUA 3CCRN 5CYQA 1Z26A 1SKRA 4CJRA 1HMVA 3VEVA 5FPEA 1TKDA 4CF1A 1QTMA 3MCAB 4JI7K 2HBLA 3D45A 5AZIB 3KWGA 4E7KA 4FJ5A 1HRHA 3BGRA 3MN6A 3AA4A 4IWVA 5AQIA 1VQMN 4HTLA 3OW2M 3AO4A 3LWMA 3ZEUB 1IKYA 1ASUA 5TKWA 4DQIA 3O6WA 4JK7A 1WBBA 4OPKA 3M3ZA 2P9IB 3J8AA 2E88A 2NRVA 4BVPA 1BUPA 3KJVA 5T7BA 2HVHA 4DSLA 2D0AA 4PA1A 4LH4A 3O9RA 3FFKB 4PKGA 3HP9A 3HT3A 1C0GA 3THXB 4JI5K 3NVKA 4CGDA 3U9DA 2XY6A 3U6FA 4BRLA 2P9LA 2X74A 4YOTA 3ID8A 1IKVA 1NGCA 2D0OA 3DLRA 1LW0A 4KHNA 3IMXA 4BREA 1GLEG 4C8MA 4Z4CA 3OHRA 3CCEN 2HHVA 1IG8A 3L4QA 5FPNA 3B6OA 5HRPA 2P5GA 1LOTB 3CJAA 4B9LA 4CD1A 2P9KB 4FWQA 3THYB 2D0CA 1BIUA 4CGGA 4KB0A 3M8RA 1CZBA 4NO7A 3DXKA 3F9KA 3C94A 4ID1A 3J80O 2JGUA 4JKHA 3I56N 1O13A 5B8HA 4CGFA 1SL0A 3QDKA 4BR2A 3RVCA 2UXBK 2OYQA 1N34K 1ASVA 1S1XA 4CK3A 5C24A 1Z05A 3VA0A 1XC3A 3MX5A 4CJ3A 2H3GX 4C1NI 4DR2K 4CGHA 1QS4A 4MLHA 3VQ9A 3MXJA 2AP1A 4DV0K 1QSLA 4DTSA 3QIOA 1BA1A 3NH1A 3U4LA 1C1CA 1A5VA 3T19A 3HOTA 2A3ZA 4K8XA 1NGAA 3NDKA 1K8AO 5A2QO 1U45A 2GV9A 3NGIA 2Z1IA 3RRHA 4RG8A 4JI0K 1GLDG 4FM1A 5JS1A 1KVCA 1WN7A 1XC9A 5BRDA 3S41A 1IJJA 3HYFA 5J2PA 2DFEA 4FL9A 5K14A 1EX4A 3VENA 5JLHA 1HYVA 2XHBA 1YVNA 4K25A 4I2QA 1QVFM 4B08A 3QIPA 3T3FA 4UQGA 2IC3A 3ZSZA 3A5LC 4DTOA 3VQEA 3WEEA 4B3TK 4FJGA 3NHGA 3BY5A 4KV8A 1VQ4N 3CCSN 1NJZA 1KVAA 1RILA 3VF2A 1GLCG 4CE9A 4A57A 1WSHA 3MN7A 4DR7K 4DV1K 2O8FB 3GL1A 2QW9A 1VSFA 5AQUA 5AQYA 4CJVA 1U48A 1CLQA 4B1XB 1YTAA 4CESA 4YOWA 1VSKA 4CIGA 4FLVA 1YJNN 2OPRA 4DS5A 4BRDA 3ITHA 3VQBA 3TU5A 4U7BA 4BDPA 4WFNL 3ZSOA 3EYZA 1P90A 3AA5X 1NK8A 4AH9A 3NAEA 1JCGA 2EX3A 1U49A 1ZBUA 2KQ2A 4CJKA 1FKPA 4LY7A 3D7EO 3RTVA 1NKBA 4ZTFA 4FWRA 5HL7L 2WFBA 4H0TB 1N36K 1S1VA 2HHQA 2UU9K 4Z4HA 2UXDK 1L3SA 3FZKA 3OS2A 5HBMA 4CJ4A 3DLHA 3R6MA 1S6PA 4H03B 1VSDA 2BUPA 3IDHA 4CCHA 4KAZA 2YHBA 1ESVA 1RT2A 3H45C 4LFCK 2GELA 3FZMA 4E7JA 1GLJO 3IG1A 3K58A 3D2EB 3K2PA 4O55A 2XY7A 4FJKA 1VQ5N 3MXIA 3OY9A 4CEFA 1KLMA 1KQSM 4AHUA 1X9JA 5AFUH 5HLFA 2GUIA 2E5LK 1RT1A 1QQOA 4O8UA 3HSTB 4WCEL 3CMEN 4B3OA 4BC5A 3HL8A 1I94K 4CJTA 4IKFA 1BWFO 4DLGA 3THWB 1ZBHA 4OPHA 4E3SA 2WOMA 1KCFA 2VCPA 2P9NA 3K9JA 5CZ1A 5M1PA 4BR9A 5CE3A 2Q0RA 2NNWA 1RTDA 2J4RA 5AQVA 3LM9A 3SYZA 3UKUB 1XHXA 3BF3A 2G8KA 4CHYA 2VG6A 3ZX3A 3S3MA 1T7PA 4EFHA 5C0YA 2E20A 5H1SQ 2PBDA 3U3GA 1QHAA 4BR5A 4I2PA 1FJGK 3RRGA 5KGXA 2P9PA 3RMAA 5F1XA 2ZD1A 4ILJA 3KD1E 3ZSQA 3L2VA 1BHLA 1W2BM 1NMNA 3T1AA 3QETA 1IH7A 4E19A 4DF8A 1D5AA 3T1YK 4O0JA 4B1VA 4MDBA 5FPMA 2W6LA 2I7PA 4BR0A 5M1NA 1Y64A 2YKMA 1DTQA 4CZHA 4CJ5A 3FZHA 1OH7A 1VQ7N 2Q2RA 3I55N 1RGIA 3OYJA 3WNGA 4KB1A 1O1WA 3AVBA 2UXCK 4IG3A 3VQDA 4JK8A 1RDAA 4JLHA 3G71N 4IG0A 3IFRA 4W5OA 2O8EB 3HM9A 3VGMA 4X64K 2V7ZA 4A2BA 1NJIO 2KHOA 3TAGA 3A2FA 3D2EA 3QESA 3BZCA 3OBYA 5EU7A 4E0DA 3VQPA 4CJSA 2FF6A 4DR3K 4UY8O 4OGEA 4BRCA 3CIPA 3C65A 3VEYA 4H0OA 4BVOA 4RCHA 1NWKA 1VQPN 3FR0A 1N32K 4BRAA 5C12A 3UIQA 4DF4A 4E7LA 2YJFA 3ZT4A 1C0FA 4CEBA 2P51A 1VQKN 2P9UA 5KPRA 2NRXA 2ASOA 4KTQA 4HTUA 1VHXA 3L4IA 1I39A 2HMIA 2ZWHA 1NGFA 3LZIA 5F0XA 1F21A 4CZEA 3HTVA 4H4OA 3HXMA 3L2QA 5AZJB 5BN8A 1ZBIA 4BRPA 4IOCL 3QNNA 4M3XA 3LDSA 4KH4A 1LW2A 4CIFA 1TKZA 3EE8A 1Q9XA 1CZAN 3MN9A 2V51B 3VTHA 4I6MA 2D1KA 3KD5E 3CJ9A 1CXQA 3SZ2A 3OJSA 3UB5A 2RE2A 3SK3A 1TK5A 2YI1A 4N56A 5JLFA 3RMDA 1W0HA 3ZSWA 2WC9A 3KZBA 3OYAA 3V9SA 4BE2A 2KFZA 3WXIA 4WE1A 1J6ZA 3B8AX 1QZ6A 1SV5A 4FWMA 4WFAL 3NGYA 2ZJPL 1L3TA 3PY8A 3A5NC 1SKSA 2VWBA 5AQNA 3MEDA 3O9TA 1VSIA 3V9WA 5FROA 1ILYA 2D4WA 4FJIA 4B8CA 3WQTA 3AVFA 2FBVA 3TAFA 1REVA 1XMOK 5AFUA 4GKJK 4FVMA 1NGDA 4KI4A 5AQKA 1BL3A 4JK9A 4FM0A 1LAVA 4CIEA 5EXWA 4HUEA 4KTWA 4M3WA 3V1RA 3CD6N 3DOKA 2HBMA 3RSEA 4FWKA 1NK7A 4GKKK 1E4GT 1NGIA 4Y1CA 1EKEA 3LDOA 4FJ7A 1RT7A 3KKRA 5AQWA 3VPZA 4LFAK 4W5QA 3OYMA 2NLXA 2VQFK 1SQKA 4AQYK 4J2EA 1BDGA 3EEQA 3F9MA 1GLBG 4FWSA 2F9WA 3LANA 3ZT3A 4G9ZA 3K9KA 3JSMA 1BCMA 1NMDA 3FZFA 4JEPA 1C1AA 5KRTA 4WQ5A 1VQ8N 3S9HA 4ICLA 1T03A 1HNZK 1JXEA 4JV5K 4DV2K 3G4SN 5I9EB
chains in the Genus database with same CATH topology
3NBPA 2DY4A 2QK9A 5HRPA 3B6OA 4CJPA 3D0PA 2P5GA 3HVTA 3CFOA 4F3OA 2X6SA 4B9LA 1HYZA 1B9DA 1RDCA 3CYMA 4B9UA 3PX0A 4OJRA 3F73A 2HB5A 2Q3SA 3SNNA 1IG9A 2D0CA 3RR8A 4KI6A 1BIUA 3E01A 4NCGA 4ID5A 4CGGA 4DFPA 4CF0A 2A1SA 1UA1A 3CFPA 3IRXA 1CZBA 2E6MA 4DG1A 3M8RA 3OYCA 4KB0A 4AHCA 4AILC 4CJLA 3F9KA 4HUGA 3C94A 1Q9YA 4ID1A 3DYAA 4W5NA 4PUOA 2JGUA 3S3NA 4CHNA 4NYNA 1HPZA 1VK0A 4CGFA 4W5RA 4ELTA 3L2UA 1SL0A 4N41A 1HJRA 4AHTA 3PO4A 2P5OA 4Q0BA 2R7YA 3C6UA 1T05A 4FLZA 2QKKA 2OYQA 2BGGA 2KZMA 4J2AA 2BANA 4CEEA 3U3YA 1ASVA 1S1XA 2PY5A 2QXFA 3CFRA 3VQAA 4DTRA 2I5JA 4CK3A 3TARA 3VQ8A 5C24A 4CGJA 3VA0A 1HNVA 4FLXA 4CJ3A 2Z1GA 3OS1A 1B9FA 2XRIA 3ZCMA 4CGHA 1QS4A 3VQ9A 3SI6A 3MXJA 3EZ5A 1QSLA 4QOZB 4DTSA 3QIOA 4PY5A 4BE1A 1NK5A 3RMCA 3NH1A 3TABA 4AHVA 2RN2A 1C1CA 4EP4A 5FRNA 1S9GA 2ZQBA 4CFAA 3PX6A 4O5BA 1A5VA 1WSGA 3K59A 2F96A 3T19A 3P1GA 1TGOA 4K8XA 3K5OA 4J2DA 3NDKA 4Q5VA 1U45A 1LAWA 4FJ8A 2GV9A 3NGIA 3PV8A 1VSMA 2OA8A 2HNZA 1RTHA 2Z1IA 2VWJA 3RRHA 4RG8A 3SUNA 3LP0A 1KSPA 4FM1A 4N76A 5JS1A 5SWMA 3KLGA 1KVCA 1WN7A 1XC9A 2F8SA 1U04A 3HYFA 5J2PA 2OPPA 4FLTA 4DQSA 1QSYA 4KHQA 2RPIA 2DFEA 5K14A 1EX4A 3AVLA 1HYVA 4FJHA 2XHBA 3SPZA 3AO5A 3OYBA 4I2QA 4CHQA 3QNOA 3VQ6A 1GOAA 3RR7A 4B08A 2LSNA 2DFHA 2VG7A 3QIPA 3QLHA 1JKHA 3T3FA 3V6DA 1NK4A 4FJJA 4UQGA 3O3GA 2IC3A 3DRRA 3ZSZA 1NK9A 4OKJA 4DTOA 1RCHA 2VWKA 3VQEA 4M3YA 4AHRA 3HO1A 3OYFA 4FJGA 4Z4IA 3NHGA 3TWHA 2HNDA 3ZT2A 4KV8A 4NCBA 5CY4A 3ZT0A 2AJQA 1WAJA 1KVBA 5HRSA 4ZTJA 1NJZA 1KVAA 4KRFA 1RILA 4F4KA 3P5JA 4CE9A 4CF9A 3AVKA 3LAKA 3HPOA 1WSHA 3MXMA 4KHUA 1WSIA 4Z4EA 3LPUA 4BWJA 2HHWA 3KLHA 2XY5A 1TVRA 2WONA 3O3FA 3OYGA 1RT6A 1VSFA 3NF6A 4FJ9A 4NYFA 4DFKA 4CJVA 1U48A 1CLQA 1YTAA 4CESA 5J2QA 1HQEA 1RBUA 1VSKA 4CIGA 2OPRA 4IFYA 4FLVA 4DS5A 1X9SA 1J5OA 4M3TA 1C0TA 3ITHA 3VQBA 5E41A 3MECA 1JLBA 4FW1A 1JXBA 3KLIA 1VSJA 1BI4A 1DTTA 3KLFA 1FXXA 4DSKA 4BDPA 4M3UA 1XWLA 3ZSOA 4DSFA 4IBNA 3EYZA 3AA5X 4R5PA 4AH9A 3VA3A 4BDZA 1NK8A 3LPTA 1NOYA 4FJNA 4M3ZA 3SJJA 3TAEA 3NAEA 3DMJA 2EX3A 1U49A 1ZBUA 3O4NA 2ETJA 3OYHA 4CEDA 1UAXA 1XI1A 2KQ2A 3PX4A 2XO7A 4CJKA 4KHWA 5C25A 1FKPA 4LY7A 3SPYA 1S1TA 5HP1A 3HK2A 1WNSA 3KK1A 4BACA 2JLEA 3MEEA 3AVIA 3RTVA 2Z1JA 1NKBA 2IDOA 4ZTFA 3TAQA 4HHTA 4FK0A 3AVNA 4IDKA 3H08A 3SQ0A 1LWCA 3I0SA 3V9ZA 2KW4A 4JRQA 2A1RA 1S1VA 3WNFA 1Z25A 4HVJA 4Z4HA 1TK0A 3V1OA 1WSJA 4DSJA 2HHQA 1VRTA 4CGIA 1L3SA 4BWMA 1J9AA 1FKOA 1BI4B 3O3HA 5HBMA 3OS2A 4CJ4A 2QKBA 3HJFA 3DLHA 2B6AA 1S6PA 4PWDA 4DQPA 1VSDA 4CCHA 4M3RA 4QAGA 4DFMA 4KAZA 1B92A 1UWBA 2YHBA 2VG5A 1RT2A 4E1NA 4EP5A 5HRNA 4B9SA 1NK0A 1QSSA 4F8RA 3QEVA 2FBXA 4E7JA 3SQ2A 3IG1A 3K58A 3NH2A 3OYKA 3NGZA 2PYLA 4OLAA 2G8HA 4M41A 1QE1A 3K2PA 1KFDA 4O55A 3NH0A 3TAPA 3AA3A 1LWFA 2XY7A 4KPYA 4FJKA 1JL1A 2D5RA 3MXIA 4XIUA 2OPSA 3OY9A 2F8TA 4CEFA 1KLMA 4JS4A 1NJWA 1TAUA 4AHUA 3KLEA 5HLFA 1WLJA 2GUIA 1RT1A 4CERA 4NCAA 1JLQA 1NOZA 3HSTB 4IFVA 2HNYA 2B5JA 3ZSYA 1ZYQA 4B3OA 1ASWA 2GBZA 3HL8A 3SQ4A 1RBRA 2ATQA 3CM5A 1GOCA 3OYNA 1I3AA 4BE0A 2OPQA 4DTPA 4CJFA 3CQ8A 2BDPA 2NUBA 4I7FA 4CJTA 4IKFA 3O4QA 4DLGA 2HHXA 1ZBHA 1TK8A 4E3SA 2WOMA 1KCFA 2BE2A 4OVLA 3G10A 5CZ1A 5I42A 1JLFA 4M42A 4YFUA 4OKEA 3HPGA 3NE6A 2HHSA 2EHGA 1A5WA 1RTDA 3B6PA 2E6LA 3OYLA 4JRPA 1NJYA 3QEIA 3ASMA 4DTNA 2YHAA 4CJQA 3SYZA 4E1MA 3WNHA 1XHXA 2G8KA 1S9EA 2Z1HA 3QINA 4OGCA 4CHYA 2VG6A 2YNHA 3AVCA 3FFIA 3S3MA 1T7PA 4RW9A 4F2RA 2HHUA 1VSEA 3QEXA 4M45A 3TI0A 4Z0UA 3P83D 3K57A 4FZZA 3U3GA 5FRMA 2KZZA 4FW2A 1CZ9A 4EZ6A 4I2PA 4CEZA 3V1QA 3RRGA 1LV5A 5KGXA 1JLCA 3HVRA 3RMAA 5D3GA 2ZD1A 3SV4A 4DTMA 3HP6A 4CHZA 3KD1E 1WAFA 3VQ5A 1RT4A 3ZSQA 4DU4A 4O4GA 3K5LA 1TKXA 3L2VA 4H8KA 1BHLA 3ALYA 3T1AA 2YKNA 1EETA 3VQ7A 4FLUA 3QETA 5KTQA 1ITGA 1IH7A 4I9LA 4E19A 4B8AB 2FBYA 4DF8A 1BQNA 1FK9A 1D5AA 1D9FA 4G1QA 1RDBA 4O0JA 2O4GA 1NJXA 1YTUA 4CFDA 5SZTA 4KREA 1RTJA 1G15A 2IOCA 4CHOA 4FJMA 2YKMA 1DTQA 3VQ4A 1SL1A 3AA2A 2XY8A 4DSIA 4CJ5A 1EXQA 2W42A 4CK1A 1S6QA 4H4MA 4LH5A 4DU1A 2KTQA 1WSEA 2E4LA 2FC0A 3SQ1A 1NKCA 1D9DA 1RT3A 3OYJA 3WNGA 5C42A 1X9MA 4TSXA 3C6TA 4KB1A 5DK5A 5KGWA 1K6YA 1O1WA 1W9HA 3AVBA 3M8SA 4IG3A 1MU2A 2G8UA 3VQDA 1RDDA 4PQUA 1RDAA 4FZYA 4CF2A 2HVIA 4FLYA 2OZMA 4MQ3A 2IAJA 3DOLA 4JLHA 4IG0A 4I9QA 3I0RA 1L3VA 1JLAA 3KK3A 2DTUA 1UA0A 4W5OA 3IAYA 3K5MA 4C8OA 2RF2A 4Y1DA 4F2SA 4CJWA 4OLBA 3OYIA 1D8YA 3HM9A 4KO0A 4AHSA 1X9WA 2IS3A 3AV9A 3LP2A 3TAGA 4FXDA 3A2FA 1C6VA 3DLGA 1RBVA 4CHPA 4FZXC 3QESA 4E0DA 5EU7A 3WNEA 1Q8IA 1YVUA 3KK2A 4JS5A 1IKXA 1RTIA 4GVMA 4KHSA 2HHTA 3VQPA 4CK2A 5FDLA 1C0UA 4C8KA 4HCCA 2ZE2A 1EP4A 4FYDA 4CJSA 3DI6A 3DRSA 4B9TA 3SCXA 1HQUA 1RBTA 2G8VA 1JL2A 4GMJB 4OGEA 4DU3A 3AO3A 3QEWA 1JLEA 4RW6A 5KRSA 3OS0A 4B9MA 4KFBA 1WSFA 3EY1A 3LZJA 1IO2A 4FK4A 2G8FA 3M8QA 4MFBA 1RT5A 3OYDA 3CG7A 3AVJA 4LD0A 1TL1A 4DF4A 3RMBA 4E7LA 3UIQA 3MEGA 3ZT4A 4ZHRA 1C0MA 4CEBA 1S1WA 1QQCA 1ZBFA 2P51A 2YV0X 4CFBA 2O4IA 4E7HA 3TAMA 4KHYA 3SUOA 2X6NA 2D0BA 4RW4A 2G8IA 1BGXT 3L3UA 4OKKA 4CEAA 4KTQA 4HTUA 3THVA 4DTJA 1KFSA 3PO5A 4B9VA 3OVNA 1RNHA 3DLEA 2HMIA 1I39A 2X78A 3LALA 3KIOA 2OZSA 4CJEA 1KRPA 3LZIA 3NF7A 1BIZA 1F21A 1Y97A 1S1UA 3M8PA 3VQCA 3LWLA 3TANA 4H4OA 3ULDA 5CZ2A 2Y1JA 2PYJA 3DLKA 1L3UA 3HXMA 4DWIA 3QEPA 3L2QA 3ZT1A 3LP3A 5KI6A 4CEOA 4CJUA 2P1JA 3SV3A 3V4IA 1X1PA 3KTQA 1XHZA 3OYEA 4FJXA 1U47A 1ZBIA 1KLNA 2ITGA 3VQQA 3AO2A 4W5TA 1TKTA 3L8BA 4K8ZA 3QNNA 4M3XA 3AVMA 3LDSA 1LW2A 1DLOA 4CIFA 1U4BA 1N6QA 4KTZA 1TKZA 2RKIA 4J2BA 3SUQA 3G0ZA 1Q9XA 4Z4GA 1N5YA 4DS4A 3TR8A 1A5XA 3DM2A 3LAMA 4DQQA 1BCOA 1GOBA 1NKEA 1IKWA 3ISNC 3SUPA 3NF8A 3KD5E 1CXQA 4CFCA 3K5NA 2Y1IA 5JS2A 3L2RA 1LWEA 3SZ2A 2G8WA 3PUFA 3OJSA 3RWUA 3ZSVA 5J2NA 2HW3A 4FJLA 4ELUA 1TK5A 1CXUA 1SL2A 1SKWA 4N56A 1C1BA 1YT3A 3NFAA 3RMDA 3ZSXA 4FLWA 3AO1A 1W0HA 3ZSWA 1HYSA 2B4JA 3KKSA 4N47A 4CF8A 4DFJA 3OYAA 1RBSA 2YNIA 3NF9A 4BE2A 3V9SA 2KFZA 4F3TA 4WE1A 4FCYA 1TAQA 1ZBLA 1SV5A 3S3OA 1L3TA 2DFFA 3NGYA 3QO9A 3PY8A 1VSLA 1SKSA 4DTXA 4CECA 3C95A 1VSHA 4FK2A 1HNIA 1VRUA 5CYQA 1TV6A 1Z26A 3MEDA 1SKRA 3VN5A 1HMVA 1KTQA 1SUQA 1VSIA 3DRPA 4CJRA 3V9WA 2FBTA 3L3VA 5HRRA 3V81A 1BISA 5FROA 3ZSRA 1TKDA 4FJIA 4B8CA 4L8RB 4CF1A 2KFNA 3AVFA 1QTMA 1BQMA 4B9NA 4RW7A 1TL3A 2FBVA 3TAFA 1REVA 3AVGA 5CYMA 4ELVA 3HPHA 4N5SA 3D45A 1NK6A 1L5UA 4O44A 4FVMA 4E7KA 1JLGA 4FJ5A 2PZSA 4KI4A 1HRHA 3BGRA 3MAQA 3AA4A 1BL3A 3LP1A 4KKOA 3NCIA 4FM0A 1LAVA 5J2MA 4CIEA 4HUEA 4KTWA 4M3WA 3V1RA 2IGIA 3AO4A 3DOKA 3LWMA 1IKYA 1ASUA 4DQIA 1UOCA 4GW6A 3JYTA 4OPJA 1T8EA 1NK7A 4E89A 3OJUA 5J1EA 5I3UA 4OPKA 3CM6A 4FM2A 4C8NA 4Y1CA 1EKEA 4FJ7A 1QHTA 1RT7A 3KKRA 3AVHA 3KJVA 5T7BA 4LSNA 4BDYA 2HVHA 4DSLA 4DMNA 4W5QA 3OYMA 2YNGA 4CEQA 3QERA 2D0AA 4RW8A 4PA1A 4LH4A 4DSEA 4O0IA 3V9UA 3I8DA 3HP9A 3HT3A 4HCBA 4CGDA 4LSLA 4J2EA 2XY6A 4DQRA 3U6FA 2X74A 1R0AA 4YNQA 3LANA 3ZT3A 4HUFA 3JSMA 2YNFA 1IKVA 4DLEA 3DLBA 3BDPA 3DLRA 1LW0A 1BCMA 4KHNA 4EZ9A 1C1AA 4C8LA 5KRTA 5DMRA 4Z4FA 3IS9A 4DTUA 5HROA 1J54A 3S9HA 3V9XA 1J53A 4QCLA 4ICLA 4C8MA 1T03A 1JXEA 3L2WA 4Z4CA 4E7IA 3AVAA 1S5JA 2HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBP A;  2DY4 A;  2QK9 A;  5HRP A;  3B6O A;  4CJP A;  3D0P A;  2P5G A;  3HVT A;  3CFO A;  4F3O A;  2X6S A;  4B9L A;  1HYZ A;  1B9D A;  1RDC A;  3CYM A;  4B9U A;  3PX0 A;  4OJR A;  3F73 A;  2HB5 A;  2Q3S A;  3SNN A;  1IG9 A;  2D0C A;  3RR8 A;  4KI6 A;  1BIU A;  3E01 A;  4NCG A;  4ID5 A;  4CGG A;  4DFP A;  4CF0 A;  2A1S A;  1UA1 A;  3CFP A;  3IRX A;  1CZB A;  2E6M A;  4DG1 A;  3M8R A;  3OYC A;  4KB0 A;  4AHC A;  4AIL C;  4CJL A;  3F9K A;  4HUG A;  3C94 A;  1Q9Y A;  4ID1 A;  3DYA A;  4W5N A;  4PUO A;  2JGU A;  3S3N A;  4CHN A;  4NYN A;  1HPZ A;  1VK0 A;  4CGF A;  4W5R A;  4ELT A;  3L2U A;  1SL0 A;  4N41 A;  1HJR A;  4AHT A;  3PO4 A;  2P5O A;  4Q0B A;  2R7Y A;  3C6U A;  1T05 A;  4FLZ A;  2QKK A;  2OYQ A;  2BGG A;  2KZM A;  4J2A A;  2BAN A;  4CEE A;  3U3Y A;  1ASV A;  1S1X A;  2PY5 A;  2QXF A;  3CFR A;  3VQA A;  4DTR A;  2I5J A;  4CK3 A;  3TAR A;  3VQ8 A;  5C24 A;  4CGJ A;  3VA0 A;  1HNV A;  4FLX A;  4CJ3 A;  2Z1G A;  3OS1 A;  1B9F A;  2XRI A;  3ZCM A;  4CGH A;  1QS4 A;  3VQ9 A;  3SI6 A;  3MXJ A;  3EZ5 A;  1QSL A;  4QOZ B;  4DTS A;  3QIO A;  4PY5 A;  4BE1 A;  1NK5 A;  3RMC A;  3NH1 A;  3TAB A;  4AHV A;  2RN2 A;  1C1C A;  4EP4 A;  5FRN A;  1S9G A;  2ZQB A;  4CFA A;  3PX6 A;  4O5B A;  1A5V A;  1WSG A;  3K59 A;  2F96 A;  3T19 A;  3P1G A;  1TGO A;  4K8X A;  3K5O A;  4J2D A;  3NDK A;  4Q5V A;  1U45 A;  1LAW A;  4FJ8 A;  2GV9 A;  3NGI A;  3PV8 A;  1VSM A;  2OA8 A;  2HNZ A;  1RTH A;  2Z1I A;  2VWJ A;  3RRH A;  4RG8 A;  3SUN A;  3LP0 A;  1KSP A;  4FM1 A;  4N76 A;  5JS1 A;  5SWM A;  3KLG A;  1KVC A;  1WN7 A;  1XC9 A;  2F8S A;  1U04 A;  3HYF A;  5J2P A;  2OPP A;  4FLT A;  4DQS A;  1QSY A;  4KHQ A;  2RPI A;  2DFE A;  5K14 A;  1EX4 A;  3AVL A;  1HYV A;  4FJH A;  2XHB A;  3SPZ A;  3AO5 A;  3OYB A;  4I2Q A;  4CHQ A;  3QNO A;  3VQ6 A;  1GOA A;  3RR7 A;  4B08 A;  2LSN A;  2DFH A;  2VG7 A;  3QIP A;  3QLH A;  1JKH A;  3T3F A;  3V6D A;  1NK4 A;  4FJJ A;  4UQG A;  3O3G A;  2IC3 A;  3DRR A;  3ZSZ A;  1NK9 A;  4OKJ A;  4DTO A;  1RCH A;  2VWK A;  3VQE A;  4M3Y A;  4AHR A;  3HO1 A;  3OYF A;  4FJG A;  4Z4I A;  3NHG A;  3TWH A;  2HND A;  3ZT2 A;  4KV8 A;  4NCB A;  5CY4 A;  3ZT0 A;  2AJQ A;  1WAJ A;  1KVB A;  5HRS A;  4ZTJ A;  1NJZ A;  1KVA A;  4KRF A;  1RIL A;  4F4K A;  3P5J A;  4CE9 A;  4CF9 A;  3AVK A;  3LAK A;  3HPO A;  1WSH A;  3MXM A;  4KHU A;  1WSI A;  4Z4E A;  3LPU A;  4BWJ A;  2HHW A;  3KLH A;  2XY5 A;  1TVR A;  2WON A;  3O3F A;  3OYG A;  1RT6 A;  1VSF A;  3NF6 A;  4FJ9 A;  4NYF A;  4DFK A;  4CJV A;  1U48 A;  1CLQ A;  1YTA A;  4CES A;  5J2Q A;  1HQE A;  1RBU A;  1VSK A;  4CIG A;  2OPR A;  4IFY A;  4FLV A;  4DS5 A;  1X9S A;  1J5O A;  4M3T A;  1C0T A;  3ITH A;  3VQB A;  5E41 A;  3MEC A;  1JLB A;  4FW1 A;  1JXB A;  3KLI A;  1VSJ A;  1BI4 A;  1DTT A;  3KLF A;  1FXX A;  4DSK A;  4BDP A;  4M3U A;  1XWL A;  3ZSO A;  4DSF A;  4IBN A;  3EYZ A;  3AA5 X;  4R5P A;  4AH9 A;  3VA3 A;  4BDZ A;  1NK8 A;  3LPT A;  1NOY A;  4FJN A;  4M3Z A;  3SJJ A;  3TAE A;  3NAE A;  3DMJ A;  2EX3 A;  1U49 A;  1ZBU A;  3O4N A;  2ETJ A;  3OYH A;  4CED A;  1UAX A;  1XI1 A;  2KQ2 A;  3PX4 A;  2XO7 A;  4CJK A;  4KHW A;  5C25 A;  1FKP A;  4LY7 A;  3SPY A;  1S1T A;  5HP1 A;  3HK2 A;  1WNS A;  3KK1 A;  4BAC A;  2JLE A;  3MEE A;  3AVI A;  3RTV A;  2Z1J A;  1NKB A;  2IDO A;  4ZTF A;  3TAQ A;  4HHT A;  4FK0 A;  3AVN A;  4IDK A;  3H08 A;  3SQ0 A;  1LWC A;  3I0S A;  3V9Z A;  2KW4 A;  4JRQ A;  2A1R A;  1S1V A;  3WNF A;  1Z25 A;  4HVJ A;  4Z4H A;  1TK0 A;  3V1O A;  1WSJ A;  4DSJ A;  2HHQ A;  1VRT A;  4CGI A;  1L3S A;  4BWM A;  1J9A A;  1FKO A;  1BI4 B;  3O3H A;  5HBM A;  3OS2 A;  4CJ4 A;  2QKB A;  3HJF A;  3DLH A;  2B6A A;  1S6P A;  4PWD A;  4DQP A;  1VSD A;  4CCH A;  4M3R A;  4QAG A;  4DFM A;  4KAZ A;  1B92 A;  1UWB A;  2YHB A;  2VG5 A;  1RT2 A;  4E1N A;  4EP5 A;  5HRN A;  4B9S A;  1NK0 A;  1QSS A;  4F8R A;  3QEV A;  2FBX A;  4E7J A;  3SQ2 A;  3IG1 A;  3K58 A;  3NH2 A;  3OYK A;  3NGZ A;  2PYL A;  4OLA A;  2G8H A;  4M41 A;  1QE1 A;  3K2P A;  1KFD A;  4O55 A;  3NH0 A;  3TAP A;  3AA3 A;  1LWF A;  2XY7 A;  4KPY A;  4FJK A;  1JL1 A;  2D5R A;  3MXI A;  4XIU A;  2OPS A;  3OY9 A;  2F8T A;  4CEF A;  1KLM A;  4JS4 A;  1NJW A;  1TAU A;  4AHU A;  3KLE A;  5HLF A;  1WLJ A;  2GUI A;  1RT1 A;  4CER A;  4NCA A;  1JLQ A;  1NOZ A;  3HST B;  4IFV A;  2HNY A;  2B5J A;  3ZSY A;  1ZYQ A;  4B3O A;  1ASW A;  2GBZ A;  3HL8 A;  3SQ4 A;  1RBR A;  2ATQ A;  3CM5 A;  1GOC A;  3OYN A;  1I3A A;  4BE0 A;  2OPQ A;  4DTP A;  4CJF A;  3CQ8 A;  2BDP A;  2NUB A;  4I7F A;  4CJT A;  4IKF A;  3O4Q A;  4DLG A;  2HHX A;  1ZBH A;  1TK8 A;  4E3S A;  2WOM A;  1KCF A;  2BE2 A;  4OVL A;  3G10 A;  5CZ1 A;  5I42 A;  1JLF A;  4M42 A;  4YFU A;  4OKE A;  3HPG A;  3NE6 A;  2HHS A;  2EHG A;  1A5W A;  1RTD A;  3B6P A;  2E6L A;  3OYL A;  4JRP A;  1NJY A;  3QEI A;  3ASM A;  4DTN A;  2YHA A;  4CJQ A;  3SYZ A;  4E1M A;  3WNH A;  1XHX A;  2G8K A;  1S9E A;  2Z1H A;  3QIN A;  4OGC A;  4CHY A;  2VG6 A;  2YNH A;  3AVC A;  3FFI A;  3S3M A;  1T7P A;  4RW9 A;  4F2R A;  2HHU A;  1VSE A;  3QEX A;  4M45 A;  3TI0 A;  4Z0U A;  3P83 D;  3K57 A;  4FZZ A;  3U3G A;  5FRM A;  2KZZ A;  4FW2 A;  1CZ9 A;  4EZ6 A;  4I2P A;  4CEZ A;  3V1Q A;  3RRG A;  1LV5 A;  5KGX A;  1JLC A;  3HVR A;  3RMA A;  5D3G A;  2ZD1 A;  3SV4 A;  4DTM A;  3HP6 A;  4CHZ A;  3KD1 E;  1WAF A;  3VQ5 A;  1RT4 A;  3ZSQ A;  4DU4 A;  4O4G A;  3K5L A;  1TKX A;  3L2V A;  4H8K A;  1BHL A;  3ALY A;  3T1A A;  2YKN A;  1EET A;  3VQ7 A;  4FLU A;  3QET A;  5KTQ A;  1ITG A;  1IH7 A;  4I9L A;  4E19 A;  4B8A B;  2FBY A;  4DF8 A;  1BQN A;  1FK9 A;  1D5A A;  1D9F A;  4G1Q A;  1RDB A;  4O0J A;  2O4G A;  1NJX A;  1YTU A;  4CFD A;  5SZT A;  4KRE A;  1RTJ A;  1G15 A;  2IOC A;  4CHO A;  4FJM A;  2YKM A;  1DTQ A;  3VQ4 A;  1SL1 A;  3AA2 A;  2XY8 A;  4DSI A;  4CJ5 A;  1EXQ A;  2W42 A;  4CK1 A;  1S6Q A;  4H4M A;  4LH5 A;  4DU1 A;  2KTQ A;  1WSE A;  2E4L A;  2FC0 A;  3SQ1 A;  1NKC A;  1D9D A;  1RT3 A;  3OYJ A;  3WNG A;  5C42 A;  1X9M A;  4TSX A;  3C6T A;  4KB1 A;  5DK5 A;  5KGW A;  1K6Y A;  1O1W A;  1W9H A;  3AVB A;  3M8S A;  4IG3 A;  1MU2 A;  2G8U A;  3VQD A;  1RDD A;  4PQU A;  1RDA A;  4FZY A;  4CF2 A;  2HVI A;  4FLY A;  2OZM A;  4MQ3 A;  2IAJ A;  3DOL A;  4JLH A;  4IG0 A;  4I9Q A;  3I0R A;  1L3V A;  1JLA A;  3KK3 A;  2DTU A;  1UA0 A;  4W5O A;  3IAY A;  3K5M A;  4C8O A;  2RF2 A;  4Y1D A;  4F2S A;  4CJW A;  4OLB A;  3OYI A;  1D8Y A;  3HM9 A;  4KO0 A;  4AHS A;  1X9W A;  2IS3 A;  3AV9 A;  3LP2 A;  3TAG A;  4FXD A;  3A2F A;  1C6V A;  3DLG A;  1RBV A;  4CHP A;  4FZX C;  3QES A;  4E0D A;  5EU7 A;  3WNE A;  1Q8I A;  1YVU A;  3KK2 A;  4JS5 A;  1IKX A;  1RTI A;  4GVM A;  4KHS A;  2HHT A;  3VQP A;  4CK2 A;  5FDL A;  1C0U A;  4C8K A;  4HCC A;  2ZE2 A;  1EP4 A;  4FYD A;  4CJS A;  3DI6 A;  3DRS A;  4B9T A;  3SCX A;  1HQU A;  1RBT A;  2G8V A;  1JL2 A;  4GMJ B;  4OGE A;  4DU3 A;  3AO3 A;  3QEW A;  1JLE A;  4RW6 A;  5KRS A;  3OS0 A;  4B9M A;  4KFB A;  1WSF A;  3EY1 A;  3LZJ A;  1IO2 A;  4FK4 A;  2G8F A;  3M8Q A;  4MFB A;  1RT5 A;  3OYD A;  3CG7 A;  3AVJ A;  4LD0 A;  1TL1 A;  4DF4 A;  3RMB A;  4E7L A;  3UIQ A;  3MEG A;  3ZT4 A;  4ZHR A;  1C0M A;  4CEB A;  1S1W A;  1QQC A;  1ZBF A;  2P51 A;  2YV0 X;  4CFB A;  2O4I A;  4E7H A;  3TAM A;  4KHY A;  3SUO A;  2X6N A;  2D0B A;  4RW4 A;  2G8I A;  1BGX T;  3L3U A;  4OKK A;  4CEA A;  4KTQ A;  4HTU A;  3THV A;  4DTJ A;  1KFS A;  3PO5 A;  4B9V A;  3OVN A;  1RNH A;  3DLE A;  2HMI A;  1I39 A;  2X78 A;  3LAL A;  3KIO A;  2OZS A;  4CJE A;  1KRP A;  3LZI A;  3NF7 A;  1BIZ A;  1F21 A;  1Y97 A;  1S1U A;  3M8P A;  3VQC A;  3LWL A;  3TAN A;  4H4O A;  3ULD A;  5CZ2 A;  2Y1J A;  2PYJ A;  3DLK A;  1L3U A;  3HXM A;  4DWI A;  3QEP A;  3L2Q A;  3ZT1 A;  3LP3 A;  5KI6 A;  4CEO A;  4CJU A;  2P1J A;  3SV3 A;  3V4I A;  1X1P A;  3KTQ A;  1XHZ A;  3OYE A;  4FJX A;  1U47 A;  1ZBI A;  1KLN A;  2ITG A;  3VQQ A;  3AO2 A;  4W5T A;  1TKT A;  3L8B A;  4K8Z A;  3QNN A;  4M3X A;  3AVM A;  3LDS A;  1LW2 A;  1DLO A;  4CIF A;  1U4B A;  1N6Q A;  4KTZ A;  1TKZ A;  2RKI A;  4J2B A;  3SUQ A;  3G0Z A;  1Q9X A;  4Z4G A;  1N5Y A;  4DS4 A;  3TR8 A;  1A5X A;  3DM2 A;  3LAM A;  4DQQ A;  1BCO A;  1GOB A;  1NKE A;  1IKW A;  3ISN C;  3SUP A;  3NF8 A;  3KD5 E;  1CXQ A;  4CFC A;  3K5N A;  2Y1I A;  5JS2 A;  3L2R A;  1LWE A;  3SZ2 A;  2G8W A;  3PUF A;  3OJS A;  3RWU A;  3ZSV A;  5J2N A;  2HW3 A;  4FJL A;  4ELU A;  1TK5 A;  1CXU A;  1SL2 A;  1SKW A;  4N56 A;  1C1B A;  1YT3 A;  3NFA A;  3RMD A;  3ZSX A;  4FLW A;  3AO1 A;  1W0H A;  3ZSW A;  1HYS A;  2B4J A;  3KKS A;  4N47 A;  4CF8 A;  4DFJ A;  3OYA A;  1RBS A;  2YNI A;  3NF9 A;  4BE2 A;  3V9S A;  2KFZ A;  4F3T A;  4WE1 A;  4FCY A;  1TAQ A;  1ZBL A;  1SV5 A;  3S3O A;  1L3T A;  2DFF A;  3NGY A;  3QO9 A;  3PY8 A;  1VSL A;  1SKS A;  4DTX A;  4CEC A;  3C95 A;  1VSH A;  4FK2 A;  1HNI A;  1VRU A;  5CYQ A;  1TV6 A;  1Z26 A;  3MED A;  1SKR A;  3VN5 A;  1HMV A;  1KTQ A;  1SUQ A;  1VSI A;  3DRP A;  4CJR A;  3V9W A;  2FBT A;  3L3V A;  5HRR A;  3V81 A;  1BIS A;  5FRO A;  3ZSR A;  1TKD A;  4FJI A;  4B8C A;  4L8R B;  4CF1 A;  2KFN A;  3AVF A;  1QTM A;  1BQM A;  4B9N A;  4RW7 A;  1TL3 A;  2FBV A;  3TAF A;  1REV A;  3AVG A;  5CYM A;  4ELV A;  3HPH A;  4N5S A;  3D45 A;  1NK6 A;  1L5U A;  4O44 A;  4FVM A;  4E7K A;  1JLG A;  4FJ5 A;  2PZS A;  4KI4 A;  1HRH A;  3BGR A;  3MAQ A;  3AA4 A;  1BL3 A;  3LP1 A;  4KKO A;  3NCI A;  4FM0 A;  1LAV A;  5J2M A;  4CIE A;  4HUE A;  4KTW A;  4M3W A;  3V1R A;  2IGI A;  3AO4 A;  3DOK A;  3LWM A;  1IKY A;  1ASU A;  4DQI A;  1UOC A;  4GW6 A;  3JYT A;  4OPJ A;  1T8E A;  1NK7 A;  4E89 A;  3OJU A;  5J1E A;  5I3U A;  4OPK A;  3CM6 A;  4FM2 A;  4C8N A;  4Y1C A;  1EKE A;  4FJ7 A;  1QHT A;  1RT7 A;  3KKR A;  3AVH A;  3KJV A;  5T7B A;  4LSN A;  4BDY A;  2HVH A;  4DSL A;  4DMN A;  4W5Q A;  3OYM A;  2YNG A;  4CEQ A;  3QER A;  2D0A A;  4RW8 A;  4PA1 A;  4LH4 A;  4DSE A;  4O0I A;  3V9U A;  3I8D A;  3HP9 A;  3HT3 A;  4HCB A;  4CGD A;  4LSL A;  4J2E A;  2XY6 A;  4DQR A;  3U6F A;  2X74 A;  1R0A A;  4YNQ A;  3LAN A;  3ZT3 A;  4HUF A;  3JSM A;  2YNF A;  1IKV A;  4DLE A;  3DLB A;  3BDP A;  3DLR A;  1LW0 A;  1BCM A;  4KHN A;  4EZ9 A;  1C1A A;  4C8L A;  5KRT A;  5DMR A;  4Z4F A;  3IS9 A;  4DTU A;  5HRO A;  1J54 A;  3S9H A;  3V9X A;  1J53 A;  4QCL A;  4ICL A;  4C8M A;  1T03 A;  1JXE A;  3L2W A;  4Z4C A;  4E7I A;  3AVA A;  1S5J A;  2HHV A; 
#chains in the Genus database with same CATH topology
 3NBP A;  2DY4 A;  2QK9 A;  1HYZ A;  2UYT A;  3N4P A;  4X62 K;  4B9U A;  4OJR A;  2HB5 A;  3H3N O;  2P9L B;  5FPD A;  4NCG A;  4WQ4 C;  5JMV A;  4DFP A;  4JAX A;  3IRX A;  4A2A A;  1KAY A;  5MLC Q;  3SMP A;  5C2F A;  4HUG A;  3CHW A;  1XMQ K;  2W40 A;  3G6E N;  4PUO A;  1BU6 O;  3A5M C;  4B3S K;  4W5R A;  4ELT A;  3L2U A;  5AQZ A;  1NGJ A;  2P5O A;  1T05 A;  4FLZ A;  1DKG D;  2YHY A;  2PY5 A;  4M7Y A;  3CFR A;  3VQA A;  3DXM A;  4CGJ A;  5BRH A;  5HOO A;  4JKD A;  3ZCM A;  3VES A;  4PY5 A;  4BE1 A;  2V52 B;  3DXK B;  3RMC A;  1NK5 A;  3VGK A;  4AHV A;  5AQH A;  4CFA A;  1WSG A;  3K59 A;  1TGO A;  2GEM A;  3K5O A;  2O8C A;  3ZX0 A;  3PV8 A;  3TTC A;  1V4S A;  1RTH A;  4H5W A;  4N76 A;  2QM1 A;  1KSP A;  3KLG A;  3JAM O;  1JCE A;  2OPP A;  4MDA A;  4FLT A;  4DQS A;  1QSY A;  2O8B A;  3SBT A;  3SPZ A;  3OYB A;  4CHQ A;  3QNO A;  3O1W A;  1GOA A;  1K9M O;  3RR7 A;  2VG7 A;  3GDQ A;  1JKH A;  4FJJ A;  3DRR A;  1RCH A;  4M3Y A;  2HF4 A;  3OYF A;  3T7Z A;  4Z4I A;  1T44 A;  5CY4 A;  4ISE A;  4NXM K;  3M5R A;  5BPM A;  1QQN A;  2WTU A;  5EVZ A;  4KHU A;  3MXM A;  3CET A;  4Z4E A;  4JI2 K;  3LPU A;  4BWJ A;  4B1U B;  3KLH A;  2WON A;  4EHU A;  3CCJ N;  4NYF A;  4DFK A;  5J2Q A;  4GY2 B;  1X9S A;  3VF4 A;  1C0T A;  5E41 A;  1YHQ N;  1JLB A;  3WEE B;  3WUH A;  3KLI A;  1BI4 A;  1EQY A;  4DSK A;  1XWL A;  4DSF A;  4IBN A;  1VQ6 N;  1SAZ A;  5CR4 A;  3VA3 A;  4BDZ A;  1VQ9 N;  3LPT A;  3ZLJ A;  4FJN A;  4B1Z A;  3FGU A;  3OYH A;  5C25 A;  3SPY A;  3KK1 A;  2JLE A;  3AVI A;  3DJC A;  3LDN A;  4FPB A;  4HHT A;  3CC7 N;  3AVN A;  4IDK A;  4JN4 A;  5C2D A;  5BR8 K;  4BR7 A;  4FK0 A;  1LWC A;  3I0S A;  2E2Q A;  4FWO A;  5KQD A;  1Z25 A;  1TK0 A;  3TPQ A;  3V1O A;  3VER A;  1YIJ N;  3D2F A;  3HRG A;  4CGI A;  4BWM A;  1U6Z A;  3H1V X;  3EKS A;  2B6A A;  2FXU A;  1HNW K;  4QAG A;  1B92 A;  1UWB A;  3J7Y P;  1OH6 A;  2Q31 A;  4E1N A;  5HRN A;  2ZJQ L;  4LC9 B;  4B9S A;  2PFU A;  2HMP A;  1HJO A;  3QEV A;  5AR0 A;  4CZK A;  4BC4 A;  2PYL A;  4OLA A;  3TAP A;  3BP8 A;  2D5R A;  4WF9 L;  1YAG A;  4K0K K;  3KLE A;  5ADX H;  3CER A;  4CER A;  4NCA A;  1NOZ A;  4IFV A;  4PHT X;  2HST A;  1N33 K;  3SQ4 A;  3OYN A;  4BE0 A;  2NUB A;  2QEX N;  1NU0 A;  3O4Q A;  1TK8 A;  2BE2 A;  3G10 A;  4M42 A;  4GV9 A;  4YFU A;  2HBK A;  4OKE A;  2EHG A;  2QWR A;  1A5W A;  3B6P A;  3OYL A;  1NJY A;  3WXM B;  3QEI A;  3ASM A;  4DTN A;  2O8D A;  3WNH A;  1S9E A;  4GV6 A;  3QIN A;  4JKE A;  2FF3 B;  3AVC A;  2PAV A;  1XUP O;  4F2R A;  4CI6 A;  3QEX A;  5C15 A;  3P83 D;  4FZZ A;  5FRM A;  2KZZ A;  4CVN E;  2ZGZ A;  3DLL L;  3PSF A;  2E1Y A;  1R59 O;  3SAH A;  4JI6 K;  1LV5 A;  3MK6 A;  1NNE A;  4YDU A;  4DTM A;  2QI2 A;  4IOA L;  4DU4 A;  3K5L A;  2P9N B;  4H8K A;  1ATN A;  1X3M A;  4WQ5 C;  4WYB A;  3VQ7 A;  4FLU A;  3E66 A;  4B8A B;  3O9Q A;  5JIC A;  3CI5 A;  1D9F A;  3EN9 A;  3CF5 L;  1NJX A;  4CFD A;  3AAR A;  1RTJ A;  4ILH A;  1SL1 A;  1VQL N;  4JHD A;  5AQF A;  4YOV A;  4CK1 A;  1S6Q A;  5EOY A;  1IBM K;  3VGL A;  4DU1 A;  3QIC A;  2P9P B;  1NKC A;  1D9D A;  1EWQ A;  3SLC A;  3C6T A;  3I33 A;  5DM6 L;  5KGW A;  1W9H A;  1WUA A;  3GE1 A;  3LDP A;  4PQU A;  2IAJ A;  5M1F A;  2NRZ A;  1L3V A;  2F9T A;  3KK3 A;  3IAY A;  3K5M A;  1M1K O;  4C8O A;  3UKR A;  2YX6 A;  1C6V A;  4CHP A;  1IKX A;  3CJ7 A;  2WUS A;  4HCC A;  2ZE2 A;  3A0I X;  4FYD A;  1QQM A;  3DI6 A;  4B9T A;  2G8V A;  1RBT A;  2EWS A;  3CJ1 A;  3O5B A;  3AO3 A;  4IDH A;  2JWL A;  1WSF A;  4CZG A;  3EY1 A;  3LZJ A;  1IV0 A;  4B3M K;  4R79 A;  4FK4 A;  4DR1 K;  4K41 A;  1HKB A;  4RWT A;  1RT5 A;  2NRR A;  3MEG A;  4BRM A;  4EAH D;  3DAW A;  2X6N A;  4F9O A;  3OBW A;  1BGX T;  2JWK A;  3W0L A;  4DTJ A;  3DLE A;  3WT0 A;  2OZS A;  4CJE A;  3KK7 A;  3NF7 A;  3QML A;  3U8X A;  1Y97 A;  3VQC A;  4XEI A;  3ULD A;  1LCU A;  1VQN N;  4YOX A;  3ENO A;  3QEP A;  4CJU A;  1MWK A;  2ITM A;  1X1P A;  3KTQ A;  1XHZ A;  3E9O A;  1WB9 A;  4W5T A;  5ELZ A;  1TKT A;  1DLO A;  4CW7 B;  3ID6 A;  1N6Q A;  3SUQ A;  4MO4 A;  4Z4G A;  4BG9 A;  4DS4 A;  2P9U B;  3DM2 A;  4X65 K;  1QVG M;  1BCO A;  3NMU A;  3NF8 A;  3K5N A;  4CZJ A;  5JS2 A;  3SAF A;  2OTJ N;  4FO0 A;  4B3R K;  5J2N A;  2HW3 A;  4ELU A;  1CXU A;  1SL2 A;  3R1X A;  3EL2 A;  3NFA A;  3BEX A;  4HWI A;  5BN9 A;  1HYS A;  3H1Q A;  4N47 A;  3AGR A;  4IO9 L;  4LF9 K;  4B1W B;  2YNI A;  3QO9 A;  1HR0 K;  1VSL A;  4DTX A;  1VSH A;  1NGG A;  4JD2 A;  3LDQ A;  4I6M B;  3VN5 A;  1KTQ A;  1SUQ A;  3MMV A;  3O80 A;  3V81 A;  2FBT A;  3ZSR A;  4L8R B;  2KFN A;  1TUU A;  1BQM A;  3CCQ N;  4B9N A;  3AVG A;  5CYM A;  3O08 A;  1L5U A;  2VYP A;  2PZS A;  3R9P A;  3CXC M;  4CZI A;  3J7Z O;  2IGI A;  1OVQ A;  4OPJ A;  1T8E A;  1OVY A;  2RHK A;  5J1E A;  4FM2 A;  1QHT A;  4DV5 K;  3AVH A;  3VEW A;  4BGA A;  1DT9 A;  4DMN A;  3QER A;  2YNG A;  4CEQ A;  4RW8 A;  3AAQ A;  5AQO A;  2ZM6 K;  4DV6 K;  3P38 A;  1E4F T;  3V9U A;  3I8D A;  4BRN A;  4A62 A;  2KKZ A;  4AF1 A;  1R0A A;  3CQY A;  2YNF A;  4DLE A;  3DLB A;  3BDP A;  5F2R A;  4L3Q A;  2FSN A;  4C8L A;  3RSE B;  1HUX A;  4H0V B;  5AQP A;  3V9X A;  4KHP K;  1J53 A;  4QCL A;  2ZGY A;  4CZM A;  2YJE A;  1S5J A;  4CJP A;  3CQX A;  3CFO A;  4F3O A;  3OA9 A;  1RDC A;  3J81 O;  4IFE A;  4FVU A;  3CYM A;  4YDU C;  3ENH A;  3PX0 A;  3F73 A;  3SNN A;  1IG9 A;  4KI6 A;  1D4X A;  3O1B A;  4ID5 A;  4CF0 A;  2A1S A;  1UA1 A;  4YY3 K;  3CFP A;  1RDW X;  3H46 O;  3OYC A;  3BF1 A;  4AIL C;  4IXC A;  1KD1 O;  1Q9Y A;  4W5N A;  2HHH K;  3E9P A;  4NYN A;  1HPZ A;  4IOX A;  1MWM A;  1QZ5 A;  4N41 A;  1KAZ A;  5EX5 A;  5KPT A;  2R7Y A;  3C6U A;  2BGG A;  4ILG B;  2IVN A;  2KZM A;  4A59 A;  4DV3 K;  4B9Q A;  5M1Q A;  2BAN A;  5EY4 A;  4CEE A;  3U3Y A;  1K8K A;  4BRQ A;  2A40 A;  3VQ8 A;  1HNV A;  3HSC A;  1DEJ A;  4PKI A;  4DR5 K;  3CC2 N;  4PL8 A;  4OX9 K;  3TAB A;  2RN2 A;  4DV7 K;  3DWL A;  1S9G A;  3PX6 A;  3E9L A;  2A6A A;  3QFU A;  4QS8 A;  3I8B A;  4J2D A;  4NLB A;  3VMF B;  4H5N A;  1VSM A;  2IVO A;  2OA8 A;  2HNZ A;  2VWJ A;  3LP0 A;  4JI1 K;  5SWM A;  5IT9 O;  1W97 L;  4CBX A;  1OH5 A;  4KHQ A;  3DXM B;  2ASM A;  4FJH A;  3AO5 A;  4JYA K;  4RTF D;  1EO1 A;  3F2K A;  2LSN A;  2DFH A;  1NK4 A;  3QLH A;  3V6D A;  3EKU A;  3O3G A;  1NK9 A;  4OKJ A;  4EIA A;  3WXJ A;  4DUZ K;  4DKW A;  4AHR A;  1YI2 N;  4FSV A;  3M6G A;  2HND A;  3ZT2 A;  3IKM A;  2AJQ A;  1KVB A;  4JKA A;  2O8C B;  4YOU A;  3HPO A;  1NG9 A;  1HKC A;  3AAP A;  2HHW A;  2XY5 A;  3OYG A;  3H3O B;  3O3F A;  4FPA A;  2O8B B;  4PKH A;  3WXK A;  3NF6 A;  4KH5 A;  2GWJ A;  1XNR K;  1HQE A;  1RBU A;  1X3N A;  4IFY A;  4M3T A;  2HOE A;  3MEC A;  3VET A;  4DV4 K;  3KLF A;  1FXX A;  1HX1 A;  4R5P A;  3TAE A;  3DMJ A;  1J5E K;  3O4N A;  3OTO K;  1NGB A;  3PX4 A;  3R3L A;  4KHW A;  2QWO A;  4FWP A;  1S1T A;  4BGB A;  1WNS A;  1XNQ K;  3MEE A;  1TUY A;  2A41 A;  4DQ8 A;  3ZET A;  2IDO A;  3FZL A;  4DUY K;  3V9Z A;  3C7N A;  4JRQ A;  2A1R A;  3D6R A;  3EO3 A;  3WNF A;  4HVJ A;  4A5A A;  4M63 C;  1WOQ A;  3MDQ A;  3P39 A;  1J9A A;  1BI4 B;  2QKB A;  1FW6 A;  3KWI A;  4PWD A;  4IO8 A;  3LL3 A;  4DFM A;  1NK0 A;  4F8R A;  5LJW A;  2OCE A;  2FBX A;  2IIR A;  3NH2 A;  3OYK A;  1TYQ A;  4BRO A;  2G8H A;  1QE1 A;  1KFD A;  2VGM A;  3AA3 A;  1LWF A;  4XIU A;  2F8T A;  3MWP A;  2DPN A;  1NJW A;  2VQE K;  2FSJ A;  2QWM A;  2UUC K;  1WLJ A;  1JLQ A;  3ZSY A;  1ZYQ A;  2B5J A;  4KBO A;  2F4V K;  2ATQ A;  3D2F B;  3CM5 A;  1GOC A;  3BUZ B;  3MCP A;  4DTP A;  4CJF A;  4I7F A;  3CPE A;  4OVL A;  1OH8 A;  3NE6 A;  2HHS A;  3VTI A;  3R8E A;  2E6L A;  3PIP L;  4E1M A;  3VEZ A;  3ZYY X;  2Z1H A;  4OGC A;  3C0B A;  1WBD A;  3J7A P;  3FFI A;  4RW9 A;  1S22 A;  2Q97 A;  4M45 A;  3TI0 A;  3EE9 A;  4FW2 A;  5BPN A;  1CZ9 A;  4CEZ A;  3V1Q A;  1JLC A;  3HVR A;  2YHW A;  3T1H K;  5D3G A;  3MN5 A;  3HP6 A;  4CHZ A;  1WAF A;  4IJA A;  1T6C A;  4O4G A;  1TKX A;  3ALY A;  1EET A;  3C6H A;  4FWL A;  5M1O A;  3AGK A;  1BQN A;  2O8D B;  2O4G A;  1YTU A;  5SZT A;  4JKG A;  4KRE A;  1G15 A;  4CHO A;  4FJM A;  3VQ4 A;  3AA2 A;  2XY8 A;  4DSI A;  4BRF A;  2QWN A;  4H4M A;  1S3X A;  2E4L A;  2FC0 A;  4IJN A;  4OPA A;  5C42 A;  3SJH A;  4TSX A;  4OO1 J;  3O9S A;  5DK5 A;  1K6Y A;  1P8Z A;  5JVH L;  2NRW A;  3M8S A;  1RDD A;  4FZY A;  4FLY A;  4XH5 A;  4MQ3 A;  2OZM A;  3DOL A;  3ZX2 A;  3A8Y A;  4M7X A;  2WBN A;  2VGN A;  2YCH A;  1MDU B;  1UA0 A;  2RF2 A;  3W3D A;  4Y1D A;  4F2S A;  2YHX A;  4YOR A;  4OLB A;  3OYI A;  2AA4 A;  1D8Y A;  4KH6 A;  4KO0 A;  4AHS A;  3Q7C A;  3ATV A;  3AV9 A;  3LP2 A;  2QA4 N;  1S72 N;  1RBV A;  4FZX C;  4JHD B;  3WNE A;  3TSQ A;  3KK2 A;  4JS5 A;  1RTI A;  2I7N A;  4KHS A;  4CK2 A;  1C0U A;  2V7Y A;  1EP4 A;  3DRS A;  1HQU A;  4LF8 K;  1JL2 A;  4GMJ B;  4DU3 A;  2CGL A;  3QEW A;  2P9S A;  5KRS A;  2CH6 A;  1Z6R A;  4DCH A;  3GOI A;  5GAH P;  2BH1 A;  3UKR B;  2E1Z A;  1YJW N;  4MFB A;  2D0P A;  3AVJ A;  4LD0 A;  1TL1 A;  5AQS A;  5AJ3 K;  5E26 A;  1C0M A;  4ISG A;  1S1W A;  1QQC A;  1ZBF A;  3UE5 A;  2YV0 X;  4CFB A;  2O4I A;  4E7H A;  3TAM A;  4KHY A;  5AQR A;  3SUO A;  2D0B A;  4BG8 A;  1KAX A;  3L3U A;  1ATS A;  3CCM N;  3THV A;  3OVN A;  4IEE A;  1RNH A;  4BQL A;  2X78 A;  4BRG A;  3KIO A;  2A42 A;  2GWK A;  1KRP A;  4MO5 A;  1BIZ A;  1S1U A;  3M8P A;  5CZ2 A;  2UUA K;  1L3U A;  3LP3 A;  5KI6 A;  3SV3 A;  2P1J A;  3TSP A;  3O8M A;  4FJX A;  3LDL A;  2QXL A;  2ITG A;  3VQQ A;  5AQL A;  5GIP A;  1U4B A;  3N4Q A;  4J2B A;  4KTZ A;  2RKI A;  1ZXO A;  3T69 A;  4C1N K;  2ZJR L;  1A5X A;  3LAM A;  1SZ2 A;  1IKW A;  4CFC A;  2GTD A;  4Z94 A;  3L2R A;  1LWE A;  3RWU A;  1Q82 O;  2GX9 A;  4GVE A;  4FJL A;  4XH4 A;  5AZI A;  1SKW A;  4K43 A;  1C1B A;  2KLA A;  4CJ7 A;  4H5T A;  4FLW A;  5GAE P;  2B4J A;  3KKS A;  4CF8 A;  1RBS A;  4F3T A;  4FCY A;  1TAQ A;  1ZBL A;  4LF4 K;  3S3O A;  2DFF A;  3ZEU A;  4NLC A;  5LL6 Z;  4FK2 A;  4CEC A;  1HNI A;  4MLE A;  3PSI A;  2Q1N A;  1TV6 A;  3O9U A;  2P9I A;  4B1Y B;  2G8W A;  3DRP A;  3L3V A;  5HRR A;  1BIS A;  5TKY A;  2QWP A;  3EZW A;  5M1K A;  5LMU K;  4RW7 A;  1TL3 A;  4ELV A;  3H6E A;  3HPH A;  4N5S A;  1NK6 A;  3THX A;  4O44 A;  1JLG A;  3MAQ A;  3LP1 A;  4KKO A;  3NCI A;  3CMA N;  5J2M A;  1YIT N;  3QBW A;  1ZBS A;  3A5O C;  3HM8 A;  1UOC A;  4GW6 A;  3JYT A;  4JI4 K;  1Q18 A;  4E89 A;  3OJU A;  5I3U A;  1G99 A;  3CM6 A;  4BRH A;  4C8N A;  2A5X A;  4JD2 B;  3HOS A;  4LSN A;  4BDY A;  1BG3 A;  4LF5 K;  4DSE A;  4O0I A;  3JXU A;  2P9K A;  4HCB A;  3AY9 A;  5LY3 A;  4X66 K;  3GBT A;  4LSL A;  3THY A;  4DQR A;  4QS9 A;  4YNQ A;  4HUF A;  1NGE A;  4V19 S;  3GG4 A;  3PLA A;  2QWQ A;  4EZ9 A;  4LF6 K;  5DMR A;  4Z4F A;  3IS9 A;  4DTU A;  3HI0 A;  5HRO A;  1J54 A;  1XQS C;  2Q0U A;  3L2W A;  4E7I A;  3AVA A;  5KQ8 A;  4JI3 K;  3D0P A;  3HVT A;  5AQM A;  2X6S A;  4A61 A;  1B9D A;  3TSU A;  2Q3S A;  1KXP A;  3RR8 A;  3E01 A;  2E6M A;  4DG1 A;  1GLF O;  3TTD A;  1SS6 A;  4AHC A;  4CJL A;  4A5B A;  4FWN A;  4CZF A;  3C6A A;  5DM7 L;  3DYA A;  3ULE B;  3U9Z A;  1NM1 A;  2CGJ A;  3S3N A;  4CHN A;  1VK0 A;  1OKJ A;  1HJR A;  4AHT A;  3PO4 A;  3MWT A;  4Q0B A;  4QS7 A;  2QKK A;  3VEX A;  4J2A A;  2QXF A;  1M90 O;  4DTR A;  2I5J A;  3TAR A;  4FLX A;  2Z1G A;  3Q7B A;  1B9F A;  2XRI A;  3OS1 A;  4C23 A;  3VOV A;  4BRI A;  3SI6 A;  4Y0W A;  3EZ5 A;  4QOZ B;  1YJ9 N;  5BR9 A;  3L0Q A;  1W7A A;  4EP4 A;  5FRN A;  2ZQB A;  4BR4 A;  1VQO N;  4O5B A;  2F96 A;  3P1G A;  4E1J A;  4Q5V A;  1LAW A;  1Q86 O;  4FJ8 A;  2F7T A;  3QFP A;  3SMS A;  3SUN A;  3ATU A;  4H5V A;  2O8F A;  2F8S A;  4WFB L;  1U04 A;  1JJ2 M;  2RPI A;  1K8K B;  1GLA G;  3AVL A;  4AM7 A;  2QTD A;  3VQ6 A;  4NB4 A;  5IWA K;  5ADX A;  2VWK A;  4WQ4 A;  1YUW A;  1ZC6 A;  3TWH A;  4NCB A;  3ZT0 A;  1WAJ A;  5HRS A;  4ZTJ A;  1RDU A;  4U67 L;  4KRF A;  4F4K A;  3P5J A;  4CF9 A;  3AVK A;  3LAK A;  1BOT O;  1WSI A;  3L6Q A;  3CCU N;  4JI8 K;  1TVR A;  1RT6 A;  4DR4 K;  2CH5 A;  4FJ9 A;  1HPM A;  4LF7 K;  3F5T A;  4EHT A;  1J5O A;  1BA0 A;  1VAZ A;  1YXQ A;  1NLV A;  4FOE A;  4FW1 A;  1JXB A;  1VSJ A;  1DTT A;  4M3U A;  1IBK K;  1NOY A;  4M3Z A;  4H0P A;  3SJJ A;  1U2V B;  4O5F A;  2QWL A;  2HF3 A;  2NZT A;  2ETJ A;  4FOI A;  4CED A;  1UAX A;  1XI1 A;  4K42 A;  3QBX A;  3ULE A;  2XO7 A;  3BZK A;  3LM2 A;  5HP1 A;  3HK2 A;  4BAC A;  2OTL N;  2Z1J A;  3P4I A;  2ASP A;  3TAQ A;  1HNX K;  3H08 A;  4JNE A;  3SQ0 A;  1IBL K;  2KW4 A;  2IVP A;  5AQG A;  1T3V A;  5FLX O;  4H0Y B;  4DSJ A;  4ISF A;  1WSJ A;  1VRT A;  3O3H A;  1FKO A;  4JKB A;  3HJF A;  4DQP A;  5GIO A;  3THW A;  4M3R A;  2Q36 A;  1T6D A;  2VG5 A;  4EP5 A;  1QSS A;  3CCL N;  4LFB K;  3SQ2 A;  5CHI A;  3HZ6 A;  3NGZ A;  4M41 A;  3UKU A;  3M1F A;  1MA9 B;  3NH0 A;  4KPY A;  5BPL A;  4GNI A;  1JL1 A;  3ZET B;  3KVG A;  2OPS A;  4JS4 A;  1TAU A;  2NRH A;  4BY9 C;  3C7N B;  1EWR A;  2HNY A;  2FLO A;  1ASW A;  3SAG A;  2GBZ A;  1RBR A;  1I3A A;  2OPQ A;  2BDP A;  3CQ8 A;  2HHX A;  3K0S A;  5I42 A;  1JLF A;  3HPG A;  4BC2 A;  4JRP A;  2YHA A;  4CJQ A;  5GAG P;  5KPZ A;  5LMN K;  1TYQ B;  3JS6 A;  1JCF A;  2YNH A;  3TTF A;  4DR6 K;  2HHU A;  1VSE A;  5E84 A;  4Z0U A;  3K57 A;  4BRK A;  4YOY A;  4EZ6 A;  3NVM A;  3MX2 A;  4XH1 A;  1HLU A;  1BO5 O;  3HBT A;  3SV4 A;  2GUP A;  3VQ5 A;  1RT4 A;  3WXL A;  4BQZ A;  4DB3 A;  5C10 A;  2YKN A;  1HKG A;  5KTQ A;  1ITG A;  2OAN A;  4I9L A;  2FBY A;  1E3M A;  1FK9 A;  1NBW A;  2O8E A;  5BRE A;  4G1Q A;  1GLL O;  1RDB A;  1U2V A;  3VF6 A;  2W6K A;  2E2P A;  3O4W A;  2IOC A;  4CBU A;  5GAD P;  2W42 A;  1EXQ A;  4LH5 A;  3IUC A;  4IEI A;  5LJV A;  1WSE A;  2KTQ A;  3SQ1 A;  1RT3 A;  1X9M A;  2E2N A;  2HBJ A;  4AM6 A;  2G8U A;  1MU2 A;  4NXN K;  4BC3 A;  1NGH A;  1DGK N;  4CF2 A;  2HVI A;  4I9Q A;  3I0R A;  1JLA A;  5JVG L;  2DTU A;  3CJC A;  2E2O A;  4CJW A;  3KHY A;  1X9W A;  3E1Y A;  2IS3 A;  4JKG B;  4FXD A;  5AQQ A;  3DLG A;  1Q8I A;  1YVU A;  3P31 A;  4GVM A;  2HHT A;  5FDL A;  4C8K A;  1Q7Y O;  2W41 A;  3SCX A;  4JKC A;  1KC8 O;  1JLE A;  4RW6 A;  3OS0 A;  4B9M A;  4KFB A;  5GIN A;  3FE1 A;  1IO2 A;  2G8F A;  2E8A A;  5AZJ A;  3M8Q A;  4CD3 A;  4O8K A;  3VEO A;  3OYD A;  5BRF A;  3CG7 A;  3RMB A;  4ZHR A;  2G8I A;  4RW4 A;  4OKK A;  4CEA A;  4CZL A;  1YF5 L;  1KFS A;  4B9V A;  3PO5 A;  3LAL A;  3CC4 N;  3CPW M;  3LWL A;  3HO1 A;  5AQT A;  2PYJ A;  3TAN A;  2Y1J A;  4H0X B;  3DLK A;  4DWI A;  4GV3 A;  3FLC O;  2P9S B;  3ZT1 A;  4CEO A;  3V4I A;  1V4T A;  3OYE A;  4IZ9 A;  1U47 A;  4DHY A;  1KLN A;  3WQU A;  2BTF A;  3AO2 A;  3L8B A;  4K8Z A;  3AVM A;  4PL7 A;  4JKF A;  3QB0 A;  3G0Z A;  5AQJ A;  1N5Y A;  2CGK A;  3TR8 A;  3PIO L;  4DQQ A;  1GOB A;  1ATR A;  3ENB A;  3G25 A;  1NKE A;  3ISN C;  3SUP A;  2NRT A;  1N8R O;  2Y1I A;  1H1V A;  3SBG A;  3PUF A;  4J8F A;  2FSK A;  1K73 O;  2UUB K;  4YHH K;  3ZSV A;  3CJB A;  4H5R A;  5AQX A;  1YT3 A;  3CCV N;  3ZSX A;  3AO1 A;  1RFQ A;  4DFJ A;  2ZF5 O;  3NF9 A;  4CBW A;  1Q81 O;  3C95 A;  1VRU A;  3CCR N;  5CYQ A;  1Z26 A;  1SKR A;  4CJR A;  1HMV A;  3VEV A;  5FPE A;  1TKD A;  4CF1 A;  1QTM A;  3MCA B;  4JI7 K;  2HBL A;  3D45 A;  5AZI B;  3KWG A;  4E7K A;  4FJ5 A;  1HRH A;  3BGR A;  3MN6 A;  3AA4 A;  4IWV A;  5AQI A;  1VQM N;  4HTL A;  3OW2 M;  3AO4 A;  3LWM A;  3ZEU B;  1IKY A;  1ASU A;  5TKW A;  4DQI A;  3O6W A;  4JK7 A;  1WBB A;  4OPK A;  3M3Z A;  2P9I B;  3J8A A;  2E88 A;  2NRV A;  4BVP A;  1BUP A;  3KJV A;  5T7B A;  2HVH A;  4DSL A;  2D0A A;  4PA1 A;  4LH4 A;  3O9R A;  3FFK B;  4PKG A;  3HP9 A;  3HT3 A;  1C0G A;  3THX B;  4JI5 K;  3NVK A;  4CGD A;  3U9D A;  2XY6 A;  3U6F A;  4BRL A;  2P9L A;  2X74 A;  4YOT A;  3ID8 A;  1IKV A;  1NGC A;  2D0O A;  3DLR A;  1LW0 A;  4KHN A;  3IMX A;  4BRE A;  1GLE G;  4C8M A;  4Z4C A;  3OHR A;  3CCE N;  2HHV A;  1IG8 A;  3L4Q A;  5FPN A;  3B6O A;  5HRP A;  2P5G A;  1LOT B;  3CJA A;  4B9L A;  4CD1 A;  2P9K B;  4FWQ A;  3THY B;  2D0C A;  1BIU A;  4CGG A;  4KB0 A;  3M8R A;  1CZB A;  4NO7 A;  3DXK A;  3F9K A;  3C94 A;  4ID1 A;  3J80 O;  2JGU A;  4JKH A;  3I56 N;  1O13 A;  5B8H A;  4CGF A;  1SL0 A;  3QDK A;  4BR2 A;  3RVC A;  2UXB K;  2OYQ A;  1N34 K;  1ASV A;  1S1X A;  4CK3 A;  5C24 A;  1Z05 A;  3VA0 A;  1XC3 A;  3MX5 A;  4CJ3 A;  2H3G X;  4C1N I;  4DR2 K;  4CGH A;  1QS4 A;  4MLH A;  3VQ9 A;  3MXJ A;  2AP1 A;  4DV0 K;  1QSL A;  4DTS A;  3QIO A;  1BA1 A;  3NH1 A;  3U4L A;  1C1C A;  1A5V A;  3T19 A;  3HOT A;  2A3Z A;  4K8X A;  1NGA A;  3NDK A;  1K8A O;  5A2Q O;  1U45 A;  2GV9 A;  3NGI A;  2Z1I A;  3RRH A;  4RG8 A;  4JI0 K;  1GLD G;  4FM1 A;  5JS1 A;  1KVC A;  1WN7 A;  1XC9 A;  5BRD A;  3S41 A;  1IJJ A;  3HYF A;  5J2P A;  2DFE A;  4FL9 A;  5K14 A;  1EX4 A;  3VEN A;  5JLH A;  1HYV A;  2XHB A;  1YVN A;  4K25 A;  4I2Q A;  1QVF M;  4B08 A;  3QIP A;  3T3F A;  4UQG A;  2IC3 A;  3ZSZ A;  3A5L C;  4DTO A;  3VQE A;  3WEE A;  4B3T K;  4FJG A;  3NHG A;  3BY5 A;  4KV8 A;  1VQ4 N;  3CCS N;  1NJZ A;  1KVA A;  1RIL A;  3VF2 A;  1GLC G;  4CE9 A;  4A57 A;  1WSH A;  3MN7 A;  4DR7 K;  4DV1 K;  2O8F B;  3GL1 A;  2QW9 A;  1VSF A;  5AQU A;  5AQY A;  4CJV A;  1U48 A;  1CLQ A;  4B1X B;  1YTA A;  4CES A;  4YOW A;  1VSK A;  4CIG A;  4FLV A;  1YJN N;  2OPR A;  4DS5 A;  4BRD A;  3ITH A;  3VQB A;  3TU5 A;  4U7B A;  4BDP A;  4WFN L;  3ZSO A;  3EYZ A;  1P90 A;  3AA5 X;  1NK8 A;  4AH9 A;  3NAE A;  1JCG A;  2EX3 A;  1U49 A;  1ZBU A;  2KQ2 A;  4CJK A;  1FKP A;  4LY7 A;  3D7E O;  3RTV A;  1NKB A;  4ZTF A;  4FWR A;  5HL7 L;  2WFB A;  4H0T B;  1N36 K;  1S1V A;  2HHQ A;  2UU9 K;  4Z4H A;  2UXD K;  1L3S A;  3FZK A;  3OS2 A;  5HBM A;  4CJ4 A;  3DLH A;  3R6M A;  1S6P A;  4H03 B;  1VSD A;  2BUP A;  3IDH A;  4CCH A;  4KAZ A;  2YHB A;  1ESV A;  1RT2 A;  3H45 C;  4LFC K;  2GEL A;  3FZM A;  4E7J A;  1GLJ O;  3IG1 A;  3K58 A;  3D2E B;  3K2P A;  4O55 A;  2XY7 A;  4FJK A;  1VQ5 N;  3MXI A;  3OY9 A;  4CEF A;  1KLM A;  1KQS M;  4AHU A;  1X9J A;  5AFU H;  5HLF A;  2GUI A;  2E5L K;  1RT1 A;  1QQO A;  4O8U A;  3HST B;  4WCE L;  3CME N;  4B3O A;  4BC5 A;  3HL8 A;  1I94 K;  4CJT A;  4IKF A;  1BWF O;  4DLG A;  3THW B;  1ZBH A;  4OPH A;  4E3S A;  2WOM A;  1KCF A;  2VCP A;  2P9N A;  3K9J A;  5CZ1 A;  5M1P A;  4BR9 A;  5CE3 A;  2Q0R A;  2NNW A;  1RTD A;  2J4R A;  5AQV A;  3LM9 A;  3SYZ A;  3UKU B;  1XHX A;  3BF3 A;  2G8K A;  4CHY A;  2VG6 A;  3ZX3 A;  3S3M A;  1T7P A;  4EFH A;  5C0Y A;  2E20 A;  5H1S Q;  2PBD A;  3U3G A;  1QHA A;  4BR5 A;  4I2P A;  1FJG K;  3RRG A;  5KGX A;  2P9P A;  3RMA A;  5F1X A;  2ZD1 A;  4ILJ A;  3KD1 E;  3ZSQ A;  3L2V A;  1BHL A;  1W2B M;  1NMN A;  3T1A A;  3QET A;  1IH7 A;  4E19 A;  4DF8 A;  1D5A A;  3T1Y K;  4O0J A;  4B1V A;  4MDB A;  5FPM A;  2W6L A;  2I7P A;  4BR0 A;  5M1N A;  1Y64 A;  2YKM A;  1DTQ A;  4CZH A;  4CJ5 A;  3FZH A;  1OH7 A;  1VQ7 N;  2Q2R A;  3I55 N;  1RGI A;  3OYJ A;  3WNG A;  4KB1 A;  1O1W A;  3AVB A;  2UXC K;  4IG3 A;  3VQD A;  4JK8 A;  1RDA A;  4JLH A;  3G71 N;  4IG0 A;  3IFR A;  4W5O A;  2O8E B;  3HM9 A;  3VGM A;  4X64 K;  2V7Z A;  4A2B A;  1NJI O;  2KHO A;  3TAG A;  3A2F A;  3D2E A;  3QES A;  3BZC A;  3OBY A;  5EU7 A;  4E0D A;  3VQP A;  4CJS A;  2FF6 A;  4DR3 K;  4UY8 O;  4OGE A;  4BRC A;  3CIP A;  3C65 A;  3VEY A;  4H0O A;  4BVO A;  4RCH A;  1NWK A;  1VQP N;  3FR0 A;  1N32 K;  4BRA A;  5C12 A;  3UIQ A;  4DF4 A;  4E7L A;  2YJF A;  3ZT4 A;  1C0F A;  4CEB A;  2P51 A;  1VQK N;  2P9U A;  5KPR A;  2NRX A;  2ASO A;  4KTQ A;  4HTU A;  1VHX A;  3L4I A;  1I39 A;  2HMI A;  2ZWH A;  1NGF A;  3LZI A;  5F0X A;  1F21 A;  4CZE A;  3HTV A;  4H4O A;  3HXM A;  3L2Q A;  5AZJ B;  5BN8 A;  1ZBI A;  4BRP A;  4IOC L;  3QNN A;  4M3X A;  3LDS A;  4KH4 A;  1LW2 A;  4CIF A;  1TKZ A;  3EE8 A;  1Q9X A;  1CZA N;  3MN9 A;  2V51 B;  3VTH A;  4I6M A;  2D1K A;  3KD5 E;  3CJ9 A;  1CXQ A;  3SZ2 A;  3OJS A;  3UB5 A;  2RE2 A;  3SK3 A;  1TK5 A;  2YI1 A;  4N56 A;  5JLF A;  3RMD A;  1W0H A;  3ZSW A;  2WC9 A;  3KZB A;  3OYA A;  3V9S A;  4BE2 A;  2KFZ A;  3WXI A;  4WE1 A;  1J6Z A;  3B8A X;  1QZ6 A;  1SV5 A;  4FWM A;  4WFA L;  3NGY A;  2ZJP L;  1L3T A;  3PY8 A;  3A5N C;  1SKS A;  2VWB A;  5AQN A;  3MED A;  3O9T A;  1VSI A;  3V9W A;  5FRO A;  1ILY A;  2D4W A;  4FJI A;  4B8C A;  3WQT A;  3AVF A;  2FBV A;  3TAF A;  1REV A;  1XMO K;  5AFU A;  4GKJ K;  4FVM A;  1NGD A;  4KI4 A;  5AQK A;  1BL3 A;  4JK9 A;  4FM0 A;  1LAV A;  4CIE A;  5EXW A;  4HUE A;  4KTW A;  4M3W A;  3V1R A;  3CD6 N;  3DOK A;  2HBM A;  3RSE A;  4FWK A;  1NK7 A;  4GKK K;  1E4G T;  1NGI A;  4Y1C A;  1EKE A;  3LDO A;  4FJ7 A;  1RT7 A;  3KKR A;  5AQW A;  3VPZ A;  4LFA K;  4W5Q A;  3OYM A;  2NLX A;  2VQF K;  1SQK A;  4AQY K;  4J2E A;  1BDG A;  3EEQ A;  3F9M A;  1GLB G;  4FWS A;  2F9W A;  3LAN A;  3ZT3 A;  4G9Z A;  3K9K A;  3JSM A;  1BCM A;  1NMD A;  3FZF A;  4JEP A;  1C1A A;  5KRT A;  4WQ5 A;  1VQ8 N;  3S9H A;  4ICL A;  1T03 A;  1HNZ K;  1JXE A;  4JV5 K;  4DV2 K;  3G4S N;  5I9E B; 
#chains in the Genus database with same CATH homology
 3NBP A;  2DY4 A;  2QK9 A;  5HRP A;  3B6O A;  4CJP A;  3D0P A;  2P5G A;  3HVT A;  3CFO A;  4F3O A;  2X6S A;  4B9L A;  1HYZ A;  1B9D A;  1RDC A;  3CYM A;  4B9U A;  3PX0 A;  4OJR A;  3F73 A;  2HB5 A;  2Q3S A;  3SNN A;  1IG9 A;  2D0C A;  3RR8 A;  4KI6 A;  1BIU A;  3E01 A;  4NCG A;  4ID5 A;  4CGG A;  4DFP A;  4CF0 A;  2A1S A;  1UA1 A;  3CFP A;  3IRX A;  1CZB A;  2E6M A;  4DG1 A;  3M8R A;  3OYC A;  4KB0 A;  4AHC A;  4AIL C;  4CJL A;  3F9K A;  4HUG A;  3C94 A;  1Q9Y A;  4ID1 A;  3DYA A;  4W5N A;  4PUO A;  2JGU A;  3S3N A;  4CHN A;  4NYN A;  1HPZ A;  1VK0 A;  4CGF A;  4W5R A;  4ELT A;  3L2U A;  1SL0 A;  4N41 A;  1HJR A;  4AHT A;  3PO4 A;  2P5O A;  4Q0B A;  2R7Y A;  3C6U A;  1T05 A;  4FLZ A;  2QKK A;  2OYQ A;  2BGG A;  2KZM A;  4J2A A;  2BAN A;  4CEE A;  3U3Y A;  1ASV A;  1S1X A;  2PY5 A;  2QXF A;  3CFR A;  3VQA A;  4DTR A;  2I5J A;  4CK3 A;  3TAR A;  3VQ8 A;  5C24 A;  4CGJ A;  3VA0 A;  1HNV A;  4FLX A;  4CJ3 A;  2Z1G A;  3OS1 A;  1B9F A;  2XRI A;  3ZCM A;  4CGH A;  1QS4 A;  3VQ9 A;  3SI6 A;  3MXJ A;  3EZ5 A;  1QSL A;  4QOZ B;  4DTS A;  3QIO A;  4PY5 A;  4BE1 A;  1NK5 A;  3RMC A;  3NH1 A;  3TAB A;  4AHV A;  2RN2 A;  1C1C A;  4EP4 A;  5FRN A;  1S9G A;  2ZQB A;  4CFA A;  3PX6 A;  4O5B A;  1A5V A;  1WSG A;  3K59 A;  2F96 A;  3T19 A;  3P1G A;  1TGO A;  4K8X A;  3K5O A;  4J2D A;  3NDK A;  4Q5V A;  1U45 A;  1LAW A;  4FJ8 A;  2GV9 A;  3NGI A;  3PV8 A;  1VSM A;  2OA8 A;  2HNZ A;  1RTH A;  2Z1I A;  2VWJ A;  3RRH A;  4RG8 A;  3SUN A;  3LP0 A;  1KSP A;  4FM1 A;  4N76 A;  5JS1 A;  5SWM A;  3KLG A;  1KVC A;  1WN7 A;  1XC9 A;  2F8S A;  1U04 A;  3HYF A;  5J2P A;  2OPP A;  4FLT A;  4DQS A;  1QSY A;  4KHQ A;  2RPI A;  2DFE A;  5K14 A;  1EX4 A;  3AVL A;  1HYV A;  4FJH A;  2XHB A;  3SPZ A;  3AO5 A;  3OYB A;  4I2Q A;  4CHQ A;  3QNO A;  3VQ6 A;  1GOA A;  3RR7 A;  4B08 A;  2LSN A;  2DFH A;  2VG7 A;  3QIP A;  3QLH A;  1JKH A;  3T3F A;  3V6D A;  1NK4 A;  4FJJ A;  4UQG A;  3O3G A;  2IC3 A;  3DRR A;  3ZSZ A;  1NK9 A;  4OKJ A;  4DTO A;  1RCH A;  2VWK A;  3VQE A;  4M3Y A;  4AHR A;  3HO1 A;  3OYF A;  4FJG A;  4Z4I A;  3NHG A;  3TWH A;  2HND A;  3ZT2 A;  4KV8 A;  4NCB A;  5CY4 A;  3ZT0 A;  2AJQ A;  1WAJ A;  1KVB A;  5HRS A;  4ZTJ A;  1NJZ A;  1KVA A;  4KRF A;  1RIL A;  4F4K A;  3P5J A;  4CE9 A;  4CF9 A;  3AVK A;  3LAK A;  3HPO A;  1WSH A;  3MXM A;  4KHU A;  1WSI A;  4Z4E A;  3LPU A;  4BWJ A;  2HHW A;  3KLH A;  2XY5 A;  1TVR A;  2WON A;  3O3F A;  3OYG A;  1RT6 A;  1VSF A;  3NF6 A;  4FJ9 A;  4NYF A;  4DFK A;  4CJV A;  1U48 A;  1CLQ A;  1YTA A;  4CES A;  5J2Q A;  1HQE A;  1RBU A;  1VSK A;  4CIG A;  2OPR A;  4IFY A;  4FLV A;  4DS5 A;  1X9S A;  1J5O A;  4M3T A;  1C0T A;  3ITH A;  3VQB A;  5E41 A;  3MEC A;  1JLB A;  4FW1 A;  1JXB A;  3KLI A;  1VSJ A;  1BI4 A;  1DTT A;  3KLF A;  1FXX A;  4DSK A;  4BDP A;  4M3U A;  1XWL A;  3ZSO A;  4DSF A;  4IBN A;  3EYZ A;  3AA5 X;  4R5P A;  4AH9 A;  3VA3 A;  4BDZ A;  1NK8 A;  3LPT A;  1NOY A;  4FJN A;  4M3Z A;  3SJJ A;  3TAE A;  3NAE A;  3DMJ A;  2EX3 A;  1U49 A;  1ZBU A;  3O4N A;  2ETJ A;  3OYH A;  4CED A;  1UAX A;  1XI1 A;  2KQ2 A;  3PX4 A;  2XO7 A;  4CJK A;  4KHW A;  5C25 A;  1FKP A;  4LY7 A;  3SPY A;  1S1T A;  5HP1 A;  3HK2 A;  1WNS A;  3KK1 A;  4BAC A;  2JLE A;  3MEE A;  3AVI A;  3RTV A;  2Z1J A;  1NKB A;  2IDO A;  4ZTF A;  3TAQ A;  4HHT A;  4FK0 A;  3AVN A;  4IDK A;  3H08 A;  3SQ0 A;  1LWC A;  3I0S A;  3V9Z A;  2KW4 A;  4JRQ A;  2A1R A;  1S1V A;  3WNF A;  1Z25 A;  4HVJ A;  4Z4H A;  1TK0 A;  3V1O A;  1WSJ A;  4DSJ A;  2HHQ A;  1VRT A;  4CGI A;  1L3S A;  4BWM A;  1J9A A;  1FKO A;  1BI4 B;  3O3H A;  5HBM A;  3OS2 A;  4CJ4 A;  2QKB A;  3HJF A;  3DLH A;  2B6A A;  1S6P A;  4PWD A;  4DQP A;  1VSD A;  4CCH A;  4M3R A;  4QAG A;  4DFM A;  4KAZ A;  1B92 A;  1UWB A;  2YHB A;  2VG5 A;  1RT2 A;  4E1N A;  4EP5 A;  5HRN A;  4B9S A;  1NK0 A;  1QSS A;  4F8R A;  3QEV A;  2FBX A;  4E7J A;  3SQ2 A;  3IG1 A;  3K58 A;  3NH2 A;  3OYK A;  3NGZ A;  2PYL A;  4OLA A;  2G8H A;  4M41 A;  1QE1 A;  3K2P A;  1KFD A;  4O55 A;  3NH0 A;  3TAP A;  3AA3 A;  1LWF A;  2XY7 A;  4KPY A;  4FJK A;  1JL1 A;  2D5R A;  3MXI A;  4XIU A;  2OPS A;  3OY9 A;  2F8T A;  4CEF A;  1KLM A;  4JS4 A;  1NJW A;  1TAU A;  4AHU A;  3KLE A;  5HLF A;  1WLJ A;  2GUI A;  1RT1 A;  4CER A;  4NCA A;  1JLQ A;  1NOZ A;  3HST B;  4IFV A;  2HNY A;  2B5J A;  3ZSY A;  1ZYQ A;  4B3O A;  1ASW A;  2GBZ A;  3HL8 A;  3SQ4 A;  1RBR A;  2ATQ A;  3CM5 A;  1GOC A;  3OYN A;  1I3A A;  4BE0 A;  2OPQ A;  4DTP A;  4CJF A;  3CQ8 A;  2BDP A;  2NUB A;  4I7F A;  4CJT A;  4IKF A;  3O4Q A;  4DLG A;  2HHX A;  1ZBH A;  1TK8 A;  4E3S A;  2WOM A;  1KCF A;  2BE2 A;  4OVL A;  3G10 A;  5CZ1 A;  5I42 A;  1JLF A;  4M42 A;  4YFU A;  4OKE A;  3HPG A;  3NE6 A;  2HHS A;  2EHG A;  1A5W A;  1RTD A;  3B6P A;  2E6L A;  3OYL A;  4JRP A;  1NJY A;  3QEI A;  3ASM A;  4DTN A;  2YHA A;  4CJQ A;  3SYZ A;  4E1M A;  3WNH A;  1XHX A;  2G8K A;  1S9E A;  2Z1H A;  3QIN A;  4OGC A;  4CHY A;  2VG6 A;  2YNH A;  3AVC A;  3FFI A;  3S3M A;  1T7P A;  4RW9 A;  4F2R A;  2HHU A;  1VSE A;  3QEX A;  4M45 A;  3TI0 A;  4Z0U A;  3P83 D;  3K57 A;  4FZZ A;  3U3G A;  5FRM A;  2KZZ A;  4FW2 A;  1CZ9 A;  4EZ6 A;  4I2P A;  4CEZ A;  3V1Q A;  3RRG A;  1LV5 A;  5KGX A;  1JLC A;  3HVR A;  3RMA A;  5D3G A;  2ZD1 A;  3SV4 A;  4DTM A;  3HP6 A;  4CHZ A;  3KD1 E;  1WAF A;  3VQ5 A;  1RT4 A;  3ZSQ A;  4DU4 A;  4O4G A;  3K5L A;  1TKX A;  3L2V A;  4H8K A;  1BHL A;  3ALY A;  3T1A A;  2YKN A;  1EET A;  3VQ7 A;  4FLU A;  3QET A;  5KTQ A;  1ITG A;  1IH7 A;  4I9L A;  4E19 A;  4B8A B;  2FBY A;  4DF8 A;  1BQN A;  1FK9 A;  1D5A A;  1D9F A;  4G1Q A;  1RDB A;  4O0J A;  2O4G A;  1NJX A;  1YTU A;  4CFD A;  5SZT A;  4KRE A;  1RTJ A;  1G15 A;  2IOC A;  4CHO A;  4FJM A;  2YKM A;  1DTQ A;  3VQ4 A;  1SL1 A;  3AA2 A;  2XY8 A;  4DSI A;  4CJ5 A;  1EXQ A;  2W42 A;  4CK1 A;  1S6Q A;  4H4M A;  4LH5 A;  4DU1 A;  2KTQ A;  1WSE A;  2E4L A;  2FC0 A;  3SQ1 A;  1NKC A;  1D9D A;  1RT3 A;  3OYJ A;  3WNG A;  5C42 A;  1X9M A;  4TSX A;  3C6T A;  4KB1 A;  5DK5 A;  5KGW A;  1K6Y A;  1O1W A;  1W9H A;  3AVB A;  3M8S A;  4IG3 A;  1MU2 A;  2G8U A;  3VQD A;  1RDD A;  4PQU A;  1RDA A;  4FZY A;  4CF2 A;  2HVI A;  4FLY A;  2OZM A;  4MQ3 A;  2IAJ A;  3DOL A;  4JLH A;  4IG0 A;  4I9Q A;  3I0R A;  1L3V A;  1JLA A;  3KK3 A;  2DTU A;  1UA0 A;  4W5O A;  3IAY A;  3K5M A;  4C8O A;  2RF2 A;  4Y1D A;  4F2S A;  4CJW A;  4OLB A;  3OYI A;  1D8Y A;  3HM9 A;  4KO0 A;  4AHS A;  1X9W A;  2IS3 A;  3AV9 A;  3LP2 A;  3TAG A;  4FXD A;  3A2F A;  1C6V A;  3DLG A;  1RBV A;  4CHP A;  4FZX C;  3QES A;  4E0D A;  5EU7 A;  3WNE A;  1Q8I A;  1YVU A;  3KK2 A;  4JS5 A;  1IKX A;  1RTI A;  4GVM A;  4KHS A;  2HHT A;  3VQP A;  4CK2 A;  5FDL A;  1C0U A;  4C8K A;  4HCC A;  2ZE2 A;  1EP4 A;  4FYD A;  4CJS A;  3DI6 A;  3DRS A;  4B9T A;  3SCX A;  1HQU A;  1RBT A;  2G8V A;  1JL2 A;  4GMJ B;  4OGE A;  4DU3 A;  3AO3 A;  3QEW A;  1JLE A;  4RW6 A;  5KRS A;  3OS0 A;  4B9M A;  4KFB A;  1WSF A;  3EY1 A;  3LZJ A;  1IO2 A;  4FK4 A;  2G8F A;  3M8Q A;  4MFB A;  1RT5 A;  3OYD A;  3CG7 A;  3AVJ A;  4LD0 A;  1TL1 A;  4DF4 A;  3RMB A;  4E7L A;  3UIQ A;  3MEG A;  3ZT4 A;  4ZHR A;  1C0M A;  4CEB A;  1S1W A;  1QQC A;  1ZBF A;  2P51 A;  2YV0 X;  4CFB A;  2O4I A;  4E7H A;  3TAM A;  4KHY A;  3SUO A;  2X6N A;  2D0B A;  4RW4 A;  2G8I A;  1BGX T;  3L3U A;  4OKK A;  4CEA A;  4KTQ A;  4HTU A;  3THV A;  4DTJ A;  1KFS A;  3PO5 A;  4B9V A;  3OVN A;  1RNH A;  3DLE A;  2HMI A;  1I39 A;  2X78 A;  3LAL A;  3KIO A;  2OZS A;  4CJE A;  1KRP A;  3LZI A;  3NF7 A;  1BIZ A;  1F21 A;  1Y97 A;  1S1U A;  3M8P A;  3VQC A;  3LWL A;  3TAN A;  4H4O A;  3ULD A;  5CZ2 A;  2Y1J A;  2PYJ A;  3DLK A;  1L3U A;  3HXM A;  4DWI A;  3QEP A;  3L2Q A;  3ZT1 A;  3LP3 A;  5KI6 A;  4CEO A;  4CJU A;  2P1J A;  3SV3 A;  3V4I A;  1X1P A;  3KTQ A;  1XHZ A;  3OYE A;  4FJX A;  1U47 A;  1ZBI A;  1KLN A;  2ITG A;  3VQQ A;  3AO2 A;  4W5T A;  1TKT A;  3L8B A;  4K8Z A;  3QNN A;  4M3X A;  3AVM A;  3LDS A;  1LW2 A;  1DLO A;  4CIF A;  1U4B A;  1N6Q A;  4KTZ A;  1TKZ A;  2RKI A;  4J2B A;  3SUQ A;  3G0Z A;  1Q9X A;  4Z4G A;  1N5Y A;  4DS4 A;  3TR8 A;  1A5X A;  3DM2 A;  3LAM A;  4DQQ A;  1BCO A;  1GOB A;  1NKE A;  1IKW A;  3ISN C;  3SUP A;  3NF8 A;  3KD5 E;  1CXQ A;  4CFC A;  3K5N A;  2Y1I A;  5JS2 A;  3L2R A;  1LWE A;  3SZ2 A;  2G8W A;  3PUF A;  3OJS A;  3RWU A;  3ZSV A;  5J2N A;  2HW3 A;  4FJL A;  4ELU A;  1TK5 A;  1CXU A;  1SL2 A;  1SKW A;  4N56 A;  1C1B A;  1YT3 A;  3NFA A;  3RMD A;  3ZSX A;  4FLW A;  3AO1 A;  1W0H A;  3ZSW A;  1HYS A;  2B4J A;  3KKS A;  4N47 A;  4CF8 A;  4DFJ A;  3OYA A;  1RBS A;  2YNI A;  3NF9 A;  4BE2 A;  3V9S A;  2KFZ A;  4F3T A;  4WE1 A;  4FCY A;  1TAQ A;  1ZBL A;  1SV5 A;  3S3O A;  1L3T A;  2DFF A;  3NGY A;  3QO9 A;  3PY8 A;  1VSL A;  1SKS A;  4DTX A;  4CEC A;  3C95 A;  1VSH A;  4FK2 A;  1HNI A;  1VRU A;  5CYQ A;  1TV6 A;  1Z26 A;  3MED A;  1SKR A;  3VN5 A;  1HMV A;  1KTQ A;  1SUQ A;  1VSI A;  3DRP A;  4CJR A;  3V9W A;  2FBT A;  3L3V A;  5HRR A;  3V81 A;  1BIS A;  5FRO A;  3ZSR A;  1TKD A;  4FJI A;  4B8C A;  4L8R B;  4CF1 A;  2KFN A;  3AVF A;  1QTM A;  1BQM A;  4B9N A;  4RW7 A;  1TL3 A;  2FBV A;  3TAF A;  1REV A;  3AVG A;  5CYM A;  4ELV A;  3HPH A;  4N5S A;  3D45 A;  1NK6 A;  1L5U A;  4O44 A;  4FVM A;  4E7K A;  1JLG A;  4FJ5 A;  2PZS A;  4KI4 A;  1HRH A;  3BGR A;  3MAQ A;  3AA4 A;  1BL3 A;  3LP1 A;  4KKO A;  3NCI A;  4FM0 A;  1LAV A;  5J2M A;  4CIE A;  4HUE A;  4KTW A;  4M3W A;  3V1R A;  2IGI A;  3AO4 A;  3DOK A;  3LWM A;  1IKY A;  1ASU A;  4DQI A;  1UOC A;  4GW6 A;  3JYT A;  4OPJ A;  1T8E A;  1NK7 A;  4E89 A;  3OJU A;  5J1E A;  5I3U A;  4OPK A;  3CM6 A;  4FM2 A;  4C8N A;  4Y1C A;  1EKE A;  4FJ7 A;  1QHT A;  1RT7 A;  3KKR A;  3AVH A;  3KJV A;  5T7B A;  4LSN A;  4BDY A;  2HVH A;  4DSL A;  4DMN A;  4W5Q A;  3OYM A;  2YNG A;  4CEQ A;  3QER A;  2D0A A;  4RW8 A;  4PA1 A;  4LH4 A;  4DSE A;  4O0I A;  3V9U A;  3I8D A;  3HP9 A;  3HT3 A;  4HCB A;  4CGD A;  4LSL A;  4J2E A;  2XY6 A;  4DQR A;  3U6F A;  2X74 A;  1R0A A;  4YNQ A;  3LAN A;  3ZT3 A;  4HUF A;  3JSM A;  2YNF A;  1IKV A;  4DLE A;  3DLB A;  3BDP A;  3DLR A;  1LW0 A;  1BCM A;  4KHN A;  4EZ9 A;  1C1A A;  4C8L A;  5KRT A;  5DMR A;  4Z4F A;  3IS9 A;  4DTU A;  5HRO A;  1J54 A;  3S9H A;  3V9X A;  1J53 A;  4QCL A;  4ICL A;  4C8M A;  1T03 A;  1JXE A;  3L2W A;  4Z4C A;  4E7I A;  3AVA A;  1S5J A;  2HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...