3O9RA

Effector domain of ns1 from influenza a/pr/8/34 containing a w187a mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
118
structure length
118
Chain Sequence
ASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
total genus 36
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9rA00
3O9TA 3RVCA 4OPAA 2RHKA 2GX9A 3D6RA 3O9SA 3P31A 3O9QA 3EE8A 3F5TA 4OPHA 3KWGA 3EE9A 3P39A 2KKZA 3OA9A 3O9RA 3P38A 3M5RA 3KWIA 3O9UA 3L4QA
chains in the Genus database with same CATH superfamily
2IDOA 3QEWA 4BDYA 3OHRA 2D0AA 3GBTA 4E7KA 3SAFA 4CF9A 5EX5A 2ITMA 4FWMA 1X3NA 3S9HA 1T6CA 3O08A 1QQMA 2LSNA 3AVIA 2ZQBA 1S1UA 1UAXA 3SJHA 3OBWA 3HVRA 5C42A 3CQYA 4OKEA 2NNWA 4H0YB 1GLJO 1TKXA 1NJIO 1B9DA 5DMRA 4CGIA 5I42A 3ZT1A 1N8RO 3EKSA 3LPTA 2BDPA 1JLGA 1GLEG 2P1JA 4W5NA 1JLBA 3WNHA 1T44A 3G10A 3VEXA 2FSNA 1MU2A 4G9ZA 4JI1K 3PY8A 2YJEA 4Z4IA 3PSFA 4YOWA 3HVTA 4IWVA 4LF4K 1MWMA 2XHBA 4AM7A 5HRSA 3ZSXA 2P9LB 1C6VA 3T1YK 4BVPA 4CE9A 1VQ8N 3LDOA 1DLOA 2Z1HA 4DCHA 4B1YB 3PLAA 3CJBA 4HHTA 2KHOA 5FRMA 1QTMA 4NCAA 3K5LA 1CXQA 2QM1A 3V1RA 1J6ZA 5CYQA 2VG7A 3V4IA 4EIAA 3I8DA 1GOAA 1SQKA 1ILYA 4DR4K 5KI6A 2KZMA 4JRQA 3KD5E 1KAYA 3AVLA 5BRHA 4HTUA 5AQGA 2OYQA 4JKEA 3NF6A 4AHTA 4BWJA 1Q86O 4G1QA 3HJFA 4JS5A 1KLNA 4IKFA 3RR7A 2HMPA 1XWLA 4WCEL 1C0MA 3U9ZA 1YJNN 1HNVA 3DLKA 1QS4A 3WQTA 5AFUA 2NRZA 3ZX3A 4KI6A 3HM9A 1S6PA 3ZT3A 4O0JA 3ZSQA 4FZXC 4PUOA 1D4XA 3SZ2A 5AQOA 4BRIA 3P31A 3MEGA 4Z4GA 4JK9A 4CZIA 4ISGA 1RT3A 2QWRA 2XO7A 3GDQA 3KWGA 3MN5A 4CEEA 2NUBA 3UKUA 2IVPA 4H0OA 3U6FA 5AQIA 2Z1GA 4A61A 5KPZA 4YOVA 1NK4A 1Q18A 1RDDA 1YVUA 4DSKA 1RTIA 3PO5A 3O1BA 5GAHP 1DTQA 1IBLK 3E66A 5KQDA 1U4BA 4R5PA 3FZFA 3ENOA 3AVFA 5EVZA 3IS9A 4EP4A 1HNXK 1VSDA 3UIQA 3E01A 1CZ9A 2P9UA 1KSPA 4JKCA 1J54A 1TUYA 3F9KA 4M42A 1RDCA 3UKUB 1BU6O 4E3SA 3HOSA 4DFPA 2O4IA 4CHQA 3VEOA 3CJ9A 1EKEA 2HNYA 1KCFA 4KREA 5BREA 3L8BA 1EO1A 4GNIA 1VSFA 3TAGA 1ZBFA 3MXMA 3L6QA 1VQ7N 2X74A 5JS1A 4O4GA 5F2RA 5AQHA 4DFKA 1RGIA 1QQNA 3E1YA 4IG0A 2P9UB 4FPAA 1GLCG 1NGHA 3QFPA 1MA9B 4BRQA 3PSIA 4MLEA 1D8YA 2PFUA 1HKBA 1WSFA 1YT3A 2GUPA 5AFUH 4O5BA 5GIPA 2E88A 3OVNA 5BR8K 2HHXA 1P90A 1HNWK 1XQSC 3K5OA 4DTSA 3BP8A 1EQYA 2B6AA 4NO7A 1JKHA 3LDQA 4B9TA 3VERA 2ATQA 3T7ZA 1RDWX 1ZYQA 3LM9A 3I33A 4Q5VA 3LL3A 3O4NA 1NNEA 4OGCA 3CJ1A 4M41A 1NBWA 1TGOA 3AA3A 1C0FA 1WBDA 4CJEA 2WFBA 4B9VA 5KPTA 1J5OA 5FROA 4CK3A 2OTLN 5C2FA 1T7PA 4CCHA 2HW3A 4I9LA 3TPQA 1YUWA 4H5NA 1XC9A 4FWQA 5C15A 3O80A 2UU9K 4PA1A 4C1NI 4CBXA 3EY1A 1NGBA 3R3LA 5HP1A 4DTXA 4PKHA 1D9FA 4BDPA 3G6EN 1S1XA 3H1VX 3KLGA 2EWSA 1GLFO 3KK2A 2PYLA 5AQLA 1EETA 1NLVA 3ATVA 4YFUA 3PX0A 4U67L 3B6OA 2QWLA 3ULEA 3K58A 2OPQA 3QNNA 3SNNA 1HPMA 3CCUN 3TAEA 3ZCMA 3FGUA 3VGLA 1A5WA 5HL7L 1QHAA 4FJIA 1K6YA 1DGKN 3L4IA 2X6NA 4IOAL 2YX6A 1DKGD 1YI2N 3VQEA 2RN2A 4B9UA 1F21A 4QS9A 3OW2M 3SUQA 3S3OA 2DTUA 5C0YA 3RRGA 3SQ1A 2P9IB 3VN5A 3IG1A 4DV1K 2HHQA 5AQSA 1QZ5A 3MDQA 4M7XA 1KQSM 4CGJA 3HPOA 4A5AA 5K14A 3VQPA 1LW2A 2V52B 4QCLA 1BI4A 3K9JA 4B8CA 5BRFA 1NGDA 4LY7A 3KLFA 3HRGA 4FL9A 4M7YA 1EWQA 3G4SN 1WN7A 1S5JA 3VA3A 1NG9A 3E9OA 5IT9O 1WBBA 1WUAA 4M3RA 5JS2A 2HHHK 3NGZA 3PO4A 4DU4A 2ZD1A 3KK7A 4IOCL 4IEEA 4CD3A 5CHIA 2FSJA 3VESA 3LDNA 5DM7L 3OYAA 4NCBA 3AGKA 3LZIA 1H1VA 4C23A 4E7LA 5AQUA 1BI4B 4IO8A 3O3GA 1YVNA 3VEYA 5GAGP 4UQGA 4BRLA 1JLCA 4AHUA 2RPIA 4LFBK 2FBTA 3GG4A 3S3NA 4B3SK 5AQZA 1RCHA 2KQ2A 4KB1A 5AQXA 3QEXA 1DT9A 3OYCA 5GADP 3KKRA 3UE5A 4YDUC 4AQYK 1KD1O 4BR5A 3DJCA 2D0CA 4Z0UA 1N36K 3AAQA 2D0OA 4A5BA 5DK5A 3VENA 5BN9A 1WSEA 2UXCK 2JLEA 1IH7A 5F0XA 1QSYA 2IIRA 2Q0RA 4DQQA 1XI1A 3TWHA 4KBOA 4M3TA 3AVBA 4FWKA 1SKRA 3TAMA 4CI6A 4FZZA 2G8WA 3AA5X 1HYSA 4DUZK 4CF0A 4LD0A 2VQFK 3NF8A 2ZF5O 4OVLA 2HHSA 3C6AA 2GEMA 4LC9B 4KTWA 1W0HA 3KHYA 4BRHA 3AVKA 3K5MA 3RMAA 5AQRA 1KLMA 5MLCQ 1ZBUA 1WB9A 1RILA 3J8AA 2Z1IA 4BACA 3FFIA 3VQ4A 1WSGA 1IBKK 1B92A 4I2QA 1HKCA 4H0VB 3NGYA 2A1RA 2YJFA 1T03A 4JYAK 3AO5A 3O3HA 4CFDA 3SYZA 1TYQA 1RT2A 1VRUA 4DUYK 5CR4A 1WSJA 4LF5K 3N4PA 5AJ3K 4W5TA 3A5LC 2VYPA 4OX9K 2Q2RA 4CJ7A 5AQVA 4B3MK 2FBXA 3H6EA 4FJGA 5FPEA 4C8LA 3LP2A 4YOTA 3P5JA 3CQ8A 3QNOA 1A5XA 1KVAA 4DFJA 4H03B 4BRCA 4AHRA 4BE0A 4WYBA 3L2VA 3E9PA 1QHTA 4X64K 1IBMK 2D1KA 3FZKA 4FVMA 1TYQB 1S9EA 3D6RA 3I0SA 3QLHA 5H1SQ 5CZ1A 4WQ5A 4U7BA 3QERA 2E20A 1M90O 4TSXA 3AY9A 3A0IX 4HUEA 1GLBG 3WEEA 2EHGA 5AZIA 3VEWA 2IGIA 4EZ9A 2PAVA 2YHYA 2AP1A 5ADXH 3OBYA 3O4WA 3V81A 4KAZA 2YNGA 1BUPA 4XH5A 3M8SA 1W2BM 4B1VA 4CESA 3FLCO 5KTQA 3O9TA 4GKJK 1TL3A 3HI0A 4ELTA 2OPSA 4BQLA 4DV7K 2NRTA 2GWKA 4RG8A 4DQIA 4FK4A 3CI5A 4GW6A 4WQ4A 3I55N 3HZ6A 1G99A 1OVYA 1U48A 3M3ZA 3ZT0A 4FW1A 5FPNA 5IWAK 3L2QA 3L3UA 3WEEB 5AZIB 1V4SA 1YJWN 1JLFA 3DLHA 4BVOA 4FJJA 3CCMN 1GOBA 1LCUA 2W40A 3TSUA 2UXDK 1ZBSA 2NRWA 3FE1A 2HOEA 4OLAA 3OYHA 2E1YA 3M8QA 1FXXA 3H1QA 1XMQK 3P39A 4IOXA 3T19A 4KHPK 1REVA 1GLAG 4E1NA 2YI1A 2VWBA 4DV5K 4NXNK 4HCBA 5KGXA 4RW4A 4FXDA 5CY4A 1TV6A 4JKGA 2QXLA 1T6DA 1RTDA 4JI4K 2GUIA 1L3UA 3WXLA 4BRNA 1S6QA 3THWB 2Q0UA 3BY5A 3VQ7A 4FPBA 3ZSWA 4CJ3A 2QKKA 3DM2A 3OTOK 3VPZA 2UXBK 1BL3A 4KH6A 3O9RA 2NRHA 1ATRA 3BDPA 3B6PA 2A3ZA 1NK5A 3TTFA 4CJTA 4IFEA 4JHDA 4JI8K 4B3OA 1RDUA 4W5OA 4PY5A 4BC2A 1Q9XA 4DS4A 3AVMA 4JKGB 4DR2K 2O8CA 2QWPA 2NRRA 3DI6A 4N56A 4FLWA 1FKPA 4FSVA 4I6MA 3HOTA 3A5MC 3L0QA 3MN7A 2D0BA 1M1KO 2RHKA 3DLGA 3EZWA 1TK0A 4JHDB 1VQNN 4CFAA 2NRVA 2KZZA 2Y1JA 4FM1A 4F2SA 1ATSA 3DAWA 2KFZA 4JAXA 5AZJA 3D2EA 1Z26A 3P38A 4Y0WA 2KLAA 4JS4A 4E1JA 4LFCK 4CEFA 4I6MB 3LWLA 3R9PA 4FM2A 5AQQA 4H0PA 4RCHA 4CJKA 1NMDA 3TAQA 3CCQN 4QS7A 1KC8O 1K8KA 1KTQA 3OYKA 2E6LA 1RT1A 3ATUA 1Q81O 3V9ZA 3KZBA 3Q7BA 4NYNA 3OS1A 1ZBLA 4GVEA 3IDHA 3GL1A 4CJFA 5LMNK 4RW7A 3G71N 2KW4A 3RSEA 3RVCA 4N76A 1SL1A 3V9WA 4BR4A 3QBWA 1RBUA 3BF3A 1RT7A 3OYEA 1E4FT 3CCSN 2QXFA 4M45A 4BGAA 2F9TA 4BDZA 5ELZA 2P9SA 3AO3A 1SL2A 4KRFA 2QWOA 4DQPA 4F8RA 1K8KB 4MQ3A 4LFAK 1S1WA 2W42A 2RKIA 1EP4A 4CGFA 4H4OA 4CHZA 5EU7A 1NWKA 3RSEB 4CEOA 1BHLA 5AQFA 3IFRA 5TKWA 1GLDG 1U2VA 3MN9A 2ZGYA 2QI2A 1QE1A 1NGAA 1N33K 4DSJA 2P9SB 2CGLA 5M1OA 4CHPA 1ZC6A 1UA1A 5HRNA 5J2MA 4JEPA 4UY8O 4K8XA 1Q7YO 3NE6A 3EO3A 3OYMA 5AQMA 4B9NA 1TUUA 2ASOA 4N5SA 2P5GA 2P9KA 1IV0A 1WSHA 1R0AA 3K57A 3RMBA 2WOMA 4ZTJA 3KWIA 3NVMA 3VF2A 2I7NA 3J80O 1U2VB 1R59O 4CF8A 4EFHA 2E5LK 2W41A 4B9QA 4M3XA 1IKWA 1OH8A 3D0PA 1U04A 2GX9A 5FLXO 3THXA 1NMNA 1RDBA 2FSKA 3EE9A 5AQYA 1ATNA 1L3TA 4YY3K 4C8OA 2NLXA 1YTUA 1A5VA 3SLCA 3NGIA 5BPNA 2JGUA 3JS6A 3CERA 3VTIA 4I7FA 5EXWA 3L2UA 5AQNA 1GOCA 4LF9K 2YCHA 3AVAA 1NK7A 1ASUA 4DQ8A 4KHUA 2CGKA 2OZMA 1JLQA 4WFBL 1RBRA 2G8FA 3QBXA 2R7YA 4OPHA 3BGRA 3NDKA 3R6MA 1NGIA 2G8UA 3THXB 1TKTA 4CZEA 1IKVA 4FJXA 4QS8A 4C8MA 3WXIA 4DU3A 1ASWA 1YHQN 3A5NC 5GIOA 1TKDA 3CETA 3L4QA 2D0PA 4CK2A 3OYGA 2ASPA 1IKXA 2O4GA 3AO1A 3ZX0A 4CF1A 2YKNA 2IAJA 1X9SA 3I8BA 2WBNA 4HUFA 2KTQA 5CZ2A 3DXKA 1Q8IA 2FF6A 2VG5A 2DFHA 2DY4A 3TI0A 4ID1A 3RR8A 2PY5A 4AHVA 3B8AX 3OJSA 4ILHA 3TARA 2ASMA 4XIUA 1KAZA 4FOEA 3LP0A 2CGJA 3SV4A 4KHQA 4M3YA 4BR7A 4DMNA 2IVNA 4IFYA 3KJVA 3CYMA 3QFUA 3KLIA 4CERA 4KTQA 3SBTA 4DV3K 2XRIA 3SUPA 1NOYA 2FBYA 1IO2A 3P4IA 4LF8K 1HJRA 3U3GA 4A2AA 2IVOA 3DXKB 3AO4A 4CIFA 4N41A 4CGDA 2HNZA 4DLGA 1VQMN 3MEEA 4X62K 3NF9A 3V1OA 1LWFA 1VRTA 4DR3K 2OA8A 3O9SA 4B9LA 3EKUA 4E7HA 4XH1A 2F9WA 3NCIA 2F8TA 4O44A 3ULEB 3O4QA 1NJYA 4JI2K 3H3OB 1LWCA 1P8ZA 3LPUA 1N6QA 2RE2A 5C24A 1SUQA 2QW9A 4FWSA 4HTLA 1BGXT 3TSPA 1D5AA 4EHUA 3WNEA 1G15A 4GY2B 3A8YA 3PIPL 4ELVA 3H46O 4OPAA 3O8MA 4Q0BA 1RNHA 4F9OA 4EZ6A 4BR2A 3TTDA 1BCOA 4DSIA 4NB4A 1BISA 3FZHA 2HHVA 4CZKA 4CFCA 2A6AA 1S9GA 2QTDA 3J7AP 5BN8A 2HF4A 5C25A 1OVQA 1QSSA 1TVRA 5HOOA 3SUNA 4H0TB 4B1WB 4ELUA 5HLFA 1N32K 3KK1A 3NVKA 4FLYA 4WQ5C 1WNSA 2ZWHA 4K0KK 2E4LA 4JKDA 1ESVA 5BR9A 5BRDA 5AQTA 1XHZA 2Z1JA 3AO2A 4KFBA 1U47A 5M1PA 3L2RA 1SKWA 4CEBA 3C94A 4PKGA 3DOLA 3KLEA 4FJ7A 2O8BA 3ZSZA 4H4MA 2UUAK 1V4TA 1Y64A 3ZT4A 1T05A 2I7PA 1BA1A 4XEIA 3I0RA 4E0DA 4DTJA 4WQ4C 2AJQA 2PZSA 2HBKA 1LWEA 3VTHA 1C0UA 2VGNA 3OY9A 4E7JA 1JJ2M 1ZBHA 4KH5A 2HVIA 3LALA 1N5YA 4AM6A 3HT3A 2ETJA 5AQJA 4FJLA 1CZAN 4JKFA 3F9MA 1YITN 3NH2A 3RRHA 3VQ8A 5J1EA 3CQXA 1MWKA 4A62A 2O8BB 5AQKA 4F2RA 4IG3A 1RFQA 3ZEUA 4AF1A 3VF6A 1QQCA 4BREA 4FJ5A 1YF5L 3CF5L 3CHWA 4CVNE 1Z6RA 5GINA 5ADXA 3SQ2A 1Q9YA 2NZTA 2HHWA 3RMDA 2KKZA 2G8VA 3M5RA 3UKRA 4CGGA 4Z4HA 1GLLO 5A2QO 4CEZA 3LM2A 4FWOA 4PL8A 1EX4A 1RBVA 1JL1A 1HYZA 5E41A 4CGHA 4MDBA 2FXUA 4CJWA 1VQLN 3ASMA 4JK7A 1BQNA 1VSKA 3GE1A 4JNEA 3SCXA 4CEAA 3V1QA 3M8RA 2E2PA 2HHTA 1SS6A 4CD1A 3ZEUB 4E7IA 1HYVA 3H45C 3SQ4A 5LL6Z 4BRFA 4CJUA 5LY3A 3ITHA 4JK8A 3N4QA 4FO0A 3EEQA 3SJJA 2A5XA 4BRPA 3M1FA 3UKRB 3THYA 3EL2A 3U4LA 3CCLN 2UYTA 2VWJA 4B08A 4OJRA 4V19S 4PHTX 3QEVA 3THVA 5EY4A 3J7YP 3CC7N 2IS3A 1C1BA 3ISNC 2FBVA 3OA9A 4O0IA 1BG3A 1ZXOA 1JL2A 3SV3A 4BRAA 4BRMA 5JLFA 2D5RA 3VQ6A 1JXBA 3MX5A 3CG7A 2B5JA 4WE1A 3BEXA 1K73O 2A1SA 4IO9L 1SL0A 4B1ZA 3THYB 1LOTB 3Q7CA 4KHWA 4GKKK 4YNQA 3CFPA 1UOCA 2YHXA 5KQ8A 5AQPA 2BH1A 4E1MA 3J7ZO 3ZSOA 5M1FA 4F3OA 4BRGA 1EXQA 3AVGA 4NLCA 3FZMA 3NBPA 5AQWA 4ZHRA 3T1HK 4FLXA 3OJUA 3OS2A 4DSLA 3HBTA 3VOVA 1QZ6A 4C1NK 1W97L 5KRSA 2HBLA 3G25A 4ISFA 2O8FA 5TKYA 3CJ7A 3L2WA 3IUCA 4JKHA 3A2FA 1NJWA 3VMFB 2XY7A 3KTQA 3ZSYA 4F3TA 2NRXA 3OYDA 4JI6K 5DM6L 1U6ZA 4FK2A 3BUZB 5C2DA 3DXMA 1UA0A 4BGBA 2YNHA 4LH4A 4YOUA 5JVHL 4J8FA 1YAGA 3OYFA 4YDUA 2E6MA 3CFRA 2YNIA 4FWPA 4FWNA 2OZSA 4A59A 1I94K 4ISEA 1E3MA 3QICA 4ILGB 1O1WA 4C8NA 1OKJA 1VSMA 2O8FB 3T1AA 2HMIA 3K2PA 3O1WA 2UUBK 4KV8A 1HKGA 5B8HA 4BY9C 4GV9A 4L8RB 5AR0A 3D2FA 4E89A 5GAEP 1E4GT 2FF3B 3OS0A 3OYJA 5C10A 2XY5A 1ASVA 3LDSA 1NGGA 3HTVA 3D7EO 1C1AA 3KLHA 4ZTFA 1RT6A 4CW7B 3O3FA 3WUHA 4DSEA 1RT4A 1X1PA 1XC3A 4CZJA 4BG9A 4NCGA 4LSLA 5E84A 4CIGA 3EYZA 2O8EA 1QVFM 2ZJRL 4DR5K 2G8IA 4KO0A 1XNRK 3HO1A 3VEVA 3CPEA 4N47A 4KH4A 3F73A 3SPZA 1YIJN 4DG1A 1QQOA 1CLQA 3F5TA 3EZ5A 2ZM6K 3D2FB 2P9LA 2E8AA 1JCGA 5CYMA 3QEIA 1BOTO 5FPMA 4CF2A 5M1NA 4DU1A 3VA0A 2F7TA 2HHUA 4CJQA 1KRPA 2X6SA 4FCYA 3ZETA 3MWPA 4RWTA 4A57A 2ZJPL 3C6TA 1S1TA 4CECA 4Z94A 3PX6A 5I3UA 5SWMA 5CE3A 4JI3K 1T8EA 4GV3A 3J81O 1TL1A 1VQ6N 4JLHA 2O8EB 5FDLA 1KFSA 3UB5A 4CZHA 4WF9L 4KHSA 4DS5A 3DLBA 2H3GX 1S1VA 2O8CB 4JKBA 4HUGA 4YHHK 1CXUA 3T69A 4BC5A 4BC4A 4IZ9A 1HQUA 3MECA 1C1CA 2A42A 3CJAA 5FRNA 3AA2A 3HYFA 3ZSVA 2Q3SA 4ID5A 3ZETB 1NU0A 3O9QA 2DFEA 3JSMA 4WFNL 3AA4A 4CZFA 4CZGA 3PUFA 3CCJN 1TK5A 4DR6K 4DR7K 1Z25A 4IFVA 3MK6A 4AILC 1U49A 3CJCA 3C6HA 1HX1A 3G0ZA 4R79A 4IBNA 4K42A 5AZJB 4WFAL 1HLUA 3SK3A 1D9DA 3D2EB 4LF7K 2I5JA 3P1GA 3LANA 2WUSA 1ZBIA 3QDKA 5KRTA 3CD6N 2F4VK 1B9FA 4MO4A 1KVCA 4CK1A 3QIOA 3IKMA 3S3MA 4LF6K 2YNFA 2QEXN 1NKCA 2DPNA 2QK9A 5BPLA 5D3GA 4J2EA 3O9UA 1NK6A 3IRXA 1J9AA 1NGFA 2BTFA 4K43A 3MXJA 3SPYA 4BROA 5BPMA 2Y1IA 3ZT2A 1LAVA 3HP6A 4O5FA 4DF4A 2E1ZA 2W6LA 1FW6A 3ALYA 1LW0A 3T3FA 2ZE2A 3MAQA 3PIOL 2BGGA 2QWNA 2Q97A 1MDUB 1VSEA 4I9QA 4DTNA 4CJLA 1Y97A 4DKWA 2DFFA 4DSFA 4JI7K 4H8KA 4X66K 4KB0A 1VAZA 1S22A 1VSIA 5M1KA 4IDKA 4BR0A 5T7BA 3TAPA 3ENBA 1XHXA 2E2NA 4JV5K 3HPGA 4FK0A 3WXJA 4KTZA 3WNGA 4CJVA 1YXQA 5LMUK 1SKSA 1YTAA 3OYLA 4DTPA 3VQCA 1BCMA 4CBUA 4B9MA 4JKAA 4OKJA 4M3WA 1RBTA 5FPDA 1ITGA 4BR9A 4CHYA 2Q31A 2B4JA 1VK0A 1VQPN 3NMUA 3FR0A 4FM0A 4K8ZA 4CEDA 3W3DA 3O5BA 4LH5A 2ZGZA 3AARA 3OYIA 1QSLA 4QOZB 3DOKA 4NLBA 4Y1CA 3CM6A 1X9JA 4DFMA 3QESA 3DLEA 3CIPA 3JXUA 4DHYA 1TAUA 3OYBA 3VQ9A 1NK8A 4JD2A 1KAXA 2VWKA 3CXCM 1HJOA 3ZSRA 5KPRA 3NH1A 3KK3A 2YKMA 3K9KA 4KHNA 1T3VA 2W6KA 4YOXA 4BRDA 3TABA 2P9KB 3IAYA 3WT0A 4Z4CA 3VEZA 3FFKB 3ENHA 1Q82O 5JICA 4W5QA 4MFBA 3K5NA 4BRKA 1TKZA 2CH6A 3SMPA 3AAPA 3M6GA 3QETA 3C7NA 4MDAA 2PBDA 1SV5A 4MLHA 2XY6A 3C6UA 1NM1A 3SUOA 2A40A 2HBMA 3HXMA 2VCPA 2VG6A 1C0GA 2P5OA 1NKBA 4FLUA 2E2OA 4JD2B 2XY8A 2OANA 1BA0A 3AGRA 1LV5A 4IJAA 3SMSA 4RW8A 3SAGA 4ILJA 1S3XA 4BE1A 4KHYA 2IC3A 4AH9A 2QKBA 4FW2A 4YOYA 3AVJA 4DTRA 5KGWA 3E9LA 1NGCA 2E2QA 5JMVA 1BDGA 2Q36A 1K9MO 4J2BA 3C7NB 4DTUA 4C8KA 1JLAA 4CIEA 3KIOA 2HNDA 1KFDA 3ZLJA 1YJ9N 3DLLL 4CBWA 4RTFD 3HM8A 4O8UA 2D4WA 3OYNA 3CC2N 2V7YA 2HBJA 1Z05A 1XNQK 4B3RK 3FZLA 3TSQA 3VGKA 2GWJA 3HL8A 1WLJA 2ZJQL 1UWBA 3LP3A 4CZLA 1BWFO 3SQ0A 3NF7A 4W5RA 3QINA 1RTJA 3V6DA 3C0BA 5J2PA 4B3TK 4BG8A 2FC0A 4DV4K 3BZKA 1FK9A 2P9IA 3O6WA 2YHAA 4H5VA 3SBGA 2GBZA 3AVNA 4BWMA 3VQQA 4QAGA 3CC4N 3VETA 4H5TA 4FVUA 4M63C 2QWQA 3D45A 4J2DA 3M8PA 1J5EK 1CZBA 4LSNA 1SZ2A 1NK0A 3W0LA 4AHCA 1JLEA 1NK9A 2QWMA 3DMJA 3WNFA 4DR1K 3LDPA 3SI6A 3U9DA 4DV6K 4H0XB 1VQKN 4FWLA 2GTDA 3CMEN 1TK8A 1HQEA 4IEIA 4IDHA 4HWIA 4FLZA 4DQRA 4DTMA 3AV9A 1NJZA 3DRRA 3H08A 1OH7A 5I9EB 4FJHA 3VQDA 3WQUA 3ID6A 4KKOA 1S72N 3DRPA 2GELA 4H5RA 5HRRA 1OH6A 3DLRA 4O8KA 3AVCA 4PQUA 4B8AB 5JVGL 4E19A 1J53A 2V51B 1DEJA 3P83D 5J2QA 1VHXA 1TAQA 1HR0K 4JN4A 1X9MA 4OPKA 4L3QA 3K59A 1VSJA 2P9PA 4JI0K 3MWTA 4DF8A 5HBMA 1HNZK 1HMVA 4EHTA 5HROA 4KI4A 1VSLA 3U8XA 5C12A 4O55A 1L5UA 1HPZA 2FLOA 3VGMA 4HVJA 2F8SA 1NKEA 3CM5A 4DQSA 5EOYA 3TU5A 4JI5K 4GV6A 3A5OC 4J2AA 2A41A 3DYAA 4CJPA 3TAFA 3LDLA 3PX4A 2O8DA 1JCEA 2WC9A 3NH0A 3ID8A 3NHGA 1I39A 5LJVA 3U3YA 1L3VA 1BQMA 4H5WA 2P9PB 3K0SA 4JRPA 3DRSA 3HSTB 4Y1DA 3V9SA 3CCRN 1N34K 4FLTA 4GMJB 1FKOA 1EWRA 4RW6A 1JCFA 3L3VA 3EE8A 1O13A 3WXKA 5F1XA 4M3UA 1XUPO 2JWLA 4FJKA 3F2KA 2QA4N 3LZJA 4AHSA 4FJNA 3EN9A 2V7ZA 1NJXA 2O8DB 2G8HA 1HNIA 4IJNA 4CFBA 1W7AA 4FJ9A 4BQZA 3VQ5A 4CJ5A 3MXIA 5SZTA 2IOCA 3IMXA 1VQ5N 4CHOA 1I3AA 4PL7A 3C95A 1XMOK 3GOIA 4DLEA 4A2BA 2Q1NA 1L3SA 4CJ4A 1VQ9N 4PWDA 4BC3A 2CH5A 3R1XA 4K25A 2P51A 1NGJA 3KVGA 1RTHA 4CHNA 2YHBA 3CFOA 4FJ8A 3RWUA 4B9SA 3RMCA 4OGEA 3QO9A 1LAWA 3CPWM 3HK2A 3MEDA 5LJWA 2RF2A 3NFAA 2YHWA 3RTVA 3ZX2A 4B1XB 3QIPA 4FOIA 3PV8A 3TTCA 5HRPA 4FZYA 1RBSA 2YV0X 4PKIA 1K8AO 4FWRA 4HCCA 3CCVN 2VQEK 3MCPA 4FYDA 3CMAN 2HSTA 1U45A 2OTJN 4DB3A 3VQAA 3V9XA 4OKKA 4DWIA 1VQON 3MN6A 1WAJA 1OH5A 4EP5A 2JWKA 1RDAA 1BO5O 3NAEA 1W9HA 2GV9A 4DTOA 4ICLA 2PYJA 1HRHA 3JYTA 4CEQA 3WXMB 3HSCA 3KKSA 2OCEA 4OPJA 4RW9A 2VGMA 1KXPA 1SAZA 4FJMA 2EX3A 4IXCA 3HPHA 4DV0K 3S41A 1HUXA 1IG8A 1BIUA 2UUCK 2F96A 4BE2A 1IG9A 4OLBA 1JXEA 3VQBA 2OPPA 1X3MA 1X9WA 3TANA 3AVHA 4GVMA 4OO1J 3MMVA 4Z4FA 4CZMA 3V9UA 3KD1E 4KPYA 1C0TA 4MO5A 5J2NA 1WSIA 1NOZA 3LP1A 1NGEA 3H3NO 2WTUA 4M3ZA 3BF1A 1FJGK 1IJJA 1RT5A 2J4RA 4EAHD 3R8EA 2HF3A 3QMLA 4NYFA 1VQ4N 3DWLA 2OPRA 4NXMK 1DTTA 4I2PA 2P9NA 2HVHA 3LWMA 5E26A 2BUPA 4DV2K 2HB5A 4FLVA 2G8KA 2BANA 3CCEN 4YORA 3TR8A 3LAMA 1WAFA 2BE2A 1BIZA 3ULDA 3ZYYX 3THWA 2X78A 4F4KA 3LAKA 4B1UB 4CJRA 3BZCA 3C65A 3JAMO 3VF4A 1KVBA 2ITGA 3QEPA 3MX2A 3SAHA 1WOQA 1IKYA 4Z4EA 2AA4A 2P9NB 1VSHA 3DXMB 2KFNA 3I56N 5M1QA 3QB0A 3MCAB 4CJSA 4X65K 3HP9A 4K41A 5JLHA 4XH4A 1QVGM 2WONA
chains in the Genus database with same CATH topology
1VQMN 1S22A 5M1KA 3OHRA 4BR0A 3GBTA 3ENBA 3SAFA 5AQRA 5EX5A 2ITMA 2E2NA 4FWMA 5MLCQ 1X3NA 1T6CA 3J8AA 3O08A 1QQMA 3WXJA 3O9SA 1YXQA 3EKUA 3SJHA 3OBWA 4XH1A 2F9WA 4CBUA 1HKCA 4H0VB 4JKAA 3ULEB 3CQYA 2YJFA 5FPDA 4BR9A 3H3OB 2NNWA 4H0YB 1P8ZA 2Q31A 1GLJO 2RE2A 1NJIO 1VQPN 2QW9A 4FWSA 3NMUA 1N8RO 4HTLA 3EKSA 3FR0A 3CCVN 1TYQA 3TSPA 4EHUA 3W3DA 3O5BA 4GY2B 2ZGZA 1GLEG 3A8YA 3PIPL 3AARA 3H46O 4OPAA 3O8MA 5CR4A 4F9OA 4NLBA 3N4PA 4BR2A 1T44A 3TTDA 3VEXA 3A5LC 2FSNA 4G9ZA 2VYPA 2Q2RA 4CJ7A 1X9JA 5AQVA 4NB4A 3H6EA 3CIPA 5FPEA 2YJEA 3FZHA 3JXUA 4DHYA 4CZKA 2A6AA 4JD2A 1KAXA 3CXCM 4YOTA 1HJOA 4YOWA 2QTDA 5KPRA 3K9KA 1T3VA 4IWVA 5BN8A 2HF4A 1MWMA 4H03B 4AM7A 4YOXA 4BRCA 4BRDA 5HOOA 2P9KB 4H0TB 2P9LB 4B1WB 4WYBA 4BVPA 3WT0A 3E9PA 3VEZA 3NVKA 3FFKB 3ENHA 4WQ5C 2ZWHA 3LDOA 1VQ8N 1Q82O 4DCHA 4B1YB 4JKDA 5JICA 3PLAA 2D1KA 3FZKA 1TYQB 1ESVA 3CJBA 5BR9A 4BRKA 5BRDA 2KHOA 3D6RA 2CH6A 5AQTA 3SMPA 3AAPA 3M6GA 5H1SQ 3C7NA 4WQ5A 4MDAA 2E20A 2PBDA 4U7BA 1M90O 3AY9A 5M1PA 3A0IX 2QM1A 4MLHA 1GLBG 1NM1A 3WEEA 1J6ZA 2A40A 4PKGA 5AZIA 2HBMA 2VCPA 3VEWA 4EIAA 2PAVA 1C0GA 1SQKA 1V4TA 1Y64A 2AP1A 2YHYA 1ILYA 2I7PA 1BA1A 3O4WA 2E2OA 3OBYA 4JD2B 5ADXH 2OANA 4XEIA 1BA0A 1BUPA 3AGRA 1KAYA 4XH5A 5BRHA 1W2BM 4B1VA 5AQGA 3FLCO 4IJAA 3SMSA 3O9TA 3SAGA 4JKEA 4ILJA 4WQ4C 1S3XA 2HBKA 3VTHA 3HI0A 2VGNA 1Q86O 1JJ2M 4BQLA 2NRTA 4KH5A 2GWKA 4YOYA 3CI5A 3I55N 4WQ4A 4AM6A 3HZ6A 1G99A 3E9LA 1NGCA 1OVYA 2HMPA 5AQJA 4WCEL 2E2QA 5JMVA 1BDGA 2Q36A 1CZAN 3M3ZA 1K9MO 4JKFA 3C7NB 3F9MA 5FPNA 3U9ZA 1YJNN 1YITN 3WQTA 3WEEB 2NRZA 5AFUA 3ZX3A 5AZIB 1V4SA 3CQXA 1MWKA 1YJ9N 4A62A 3DLLL 1YJWN 5AQKA 4CBWA 4RTFD 3HM8A 4O8UA 4BVOA 2D4WA 3CCMN 1RFQA 3CC2N 1D4XA 2V7YA 3ZEUA 1LCUA 2HBJA 2W40A 3TSUA 3VF6A 4AF1A 5AQOA 1ZBSA 2NRWA 3FE1A 1Z05A 2HOEA 4BRIA 3FZLA 4BREA 1YF5L 3P31A 3CF5L 3TSQA 3CHWA 4JK9A 3VGKA 4CZIA 2GWJA 4ISGA 2E1YA 2QWRA 3GDQA 3KWGA 3MN5A 1Z6RA 5GINA 3H1QA 5ADXA 3P39A 4IOXA 3UKUA 2NZTA 2ZJQL 4CZLA 1GLAG 1BWFO 2KKZA 2IVPA 2YI1A 4H0OA 2VWBA 5AQIA 3M5RA 3UKRA 3C0BA 4A61A 1GLLO 5KPZA 3LM2A 4FWOA 4PL8A 4YOVA 1Q18A 4BG8A 4H5VA 2P9IA 3O6WA 3SBGA 4JKGA 3O1BA 2QXLA 5GAHP 1T6DA 4MDBA 3CC4N 2FXUA 3WXLA 3E66A 4JK7A 5KQDA 3VETA 4BRNA 1VQLN 3GE1A 2Q0UA 4H5TA 4JNEA 2QWQA 3FZFA 4M63C 4FVUA 3ENOA 2E2PA 1SS6A 5EVZA 4FPBA 4CD1A 1SZ2A 3ZEUB 3H45C 3W0LA 3VPZA 4BRFA 4KH6A 2P9UA 5LY3A 3O9RA 2NRHA 1ATRA 1TUYA 3N4QA 4JK8A 4JKCA 2QWMA 3UKUB 1BU6O 2A3ZA 4FO0A 3LDPA 3HOSA 2A5XA 3TTFA 3U9DA 4BRPA 4H0XB 4IFEA 4FWLA 3M1FA 4JHDA 1RDUA 2GTDA 3UKRB 1VQKN 3EL2A 3CMEN 4IEIA 4IDHA 3U4LA 4BC2A 3CCLN 2UYTA 4HWIA 3VEOA 3CJ9A 4JKGB 2QWPA 2NRRA 5BREA 1EO1A 5I9EB 4GNIA 4PHTX 5EY4A 3CC7N 3WQUA 3ID6A 3OA9A 3L6QA 1VQ7N 1BG3A 1ZXOA 4FSVA 4I6MA 3HOTA 1S72N 5F2RA 5AQHA 2GELA 4H5RA 1RGIA 4BRAA 3A5MC 1QQNA 4O8KA 4BRMA 3L0QA 5JLFA 3E1YA 3MN7A 2P9UB 4FPAA 1GLCG 1NGHA 3QFPA 3MX5A 1MA9B 4BRQA 3BEXA 1M1KO 5JVGL 1K73O 2RHKA 4MLEA 2V51B 3EZWA 4IO9L 2PFUA 1DEJA 1HKBA 2GUPA 5AFUH 4JHDB 4B1ZA 1VQNN 1LOTB 4JN4A 2NRVA 3Q7CA 5GIPA 2E88A 2YHXA 4L3QA 5KQ8A 5AQPA 2BH1A 2P9PA 1ATSA 3J7ZO 1P90A 3DAWA 4JAXA 5M1FA 5AZJA 3D2EA 3MWTA 1XQSC 4BRGA 3P38A 4Y0WA 2KLAA 4EHTA 3BP8A 4NLCA 4E1JA 3U8XA 1EQYA 3FZMA 5AQWA 5C12A 3VGMA 2FLOA 4NO7A 3LDQA 4I6MB 3R9PA 3VERA 3T7ZA 5EOYA 3TU5A 3HBTA 3VOVA 1RDWX 1QZ6A 4GV6A 3LM9A 3A5OC 3I33A 5AQQA 4C1NK 4H0PA 3LL3A 1W97L 4RCHA 2A41A 2HBLA 3CJ1A 3G25A 1NBWA 1NMDA 3LDLA 4ISFA 1C0FA 3CCQN 4QS7A 1JCEA 2WC9A 5TKYA 3CJ7A 1K8KA 1KC8O 2WFBA 3ATUA 3ID8A 5LJVA 3IUCA 4JKHA 5KPTA 1Q81O 4H5WA 3KZBA 3Q7BA 2OTLN 3VMFB 2P9PB 5C2FA 3TPQA 4GVEA 3IDHA 3GL1A 1YUWA 2NRXA 4H5NA 3CCRN 5DM6L 3G71N 3RSEA 3RVCA 1U6ZA 4FWQA 5C15A 3O80A 3BUZB 4BR4A 3QBWA 5C2DA 3DXMA 1JCFA 4C1NI 4CBXA 3BF3A 4BGBA 4YOUA 1E4FT 3CCSN 5JVHL 4J8FA 1NGBA 1YAGA 3EE8A 4YDUA 1O13A 3R3LA 3WXKA 4BGAA 5F1XA 4FWPA 4FWNA 1XUPO 2JWLA 4PKHA 3F2KA 2F9TA 4A59A 2P9SA 5ELZA 3H1VX 4ISEA 3G6EN 2EWSA 2QWOA 3QICA 4ILGB 2QA4N 1GLFO 3EN9A 1OKJA 2V7ZA 1K8KB 4IJNA 5AQLA 1NLVA 3ATVA 3O1WA 4BQZA 4U67L 1HKGA 5B8HA 4BY9C 2QWLA 3IMXA 4BRHA 1VQ5N 4GV9A 4PL7A 5AR0A 3ULEA 3GOIA 3D2FA 4A2BA 2Q1NA 1HPMA 3CCUN 5GAEP 1E4GT 2FF3B 3FGUA 1NWKA 3RSEB 4BC3A 3VGLA 1VQ9N 5HL7L 2CH5A 1QHAA 3R1XA 5AQFA 3IFRA 5TKWA 5C10A 1GLDG 1DGKN 3L4IA 1U2VA 3MN9A 4K25A 2YX6A 4IOAL 1NGJA 1NGGA 3KVGA 3HTVA 2ZGYA 2QI2A 3D7EO 1DKGD 1YI2N 3WUHA 1NGAA 4QS9A 1XC3A 3OW2M 4CZJA 2P9SB 4BG9A 2CGLA 5M1OA 5E84A 1ZC6A 3CPWM 1QVFM 2ZJRL 5C0YA 5LJWA 4JEPA 4UY8O 2P9IB 1Q7YO 2YHWA 3CPEA 3VEVA 3EO3A 4KH4A 3ZX2A 5AQSA 1QZ5A 3MDQA 1QQOA 4B1XB 1YIJN 3F5TA 4M7XA 5AQMA 1TUUA 2ASOA 4FOIA 1KQSM 2P9KA 3D2FB 3TTCA 2P9LA 2E8AA 1JCGA 4A5AA 4PKIA 1K8AO 4FWRA 1BOTO 5FPMA 2V52B 3MCPA 3KWIA 5M1NA 3NVMA 3CMAN 2HSTA 3K9JA 5BRFA 3VF2A 2I7NA 1NGDA 2OTJN 2F7TA 1U2VB 1R59O 3HRGA 4DB3A 4EFHA 2W41A 4FL9A 4M7YA 4B9QA 3ZETA 3MN6A 3MWPA 4RWTA 1VQON 4A57A 2ZJPL 3G4SN 4Z94A 2GX9A 5CE3A 2JWKA 1BO5O 4GV3A 1VQ6N 3UB5A 3E9OA 2FSKA 4CZHA 4WF9L 1WUAA 3EE9A 5AQYA 1ATNA 3WXMB 3KK7A 4IOCL 2H3GX 3HSCA 4IEEA 4JKBA 2NLXA 4CD3A 5CHIA 2FSJA 3SLCA 2VGMA 1KXPA 3VESA 5BPNA 1SAZA 3LDNA 5DM7L 4IXCA 3JS6A 3AGKA 3T69A 4BC5A 3CERA 1H1VA 4IZ9A 3S41A 3VTIA 5EXWA 4BC4A 4C23A 5AQUA 1HUXA 5AQNA 1IG8A 2YCHA 4IO8A 2A42A 1YVNA 4DQ8A 3VEYA 3CJAA 5GAGP 2CGKA 4BRLA 3ZETB 1X3MA 4WFBL 3O9QA 3QBXA 4WFNL 4OPHA 3R6MA 1NGIA 4CZFA 3GG4A 4OO1J 4CZGA 3CCJN 4CZEA 3MMVA 4CZMA 5AQZA 3MK6A 4QS8A 3WXIA 1YHQN 4MO5A 3A5NC 5GIOA 1NGEA 3CJCA 3C6HA 1HX1A 3CETA 3H3NO 5AQXA 3L4QA 3BF1A 4R79A 4K42A 2D0PA 2ASPA 5AZJB 1IJJA 1HLUA 1DT9A 3SK3A 3D2EB 5GADP 4WFAL 2J4RA 4EAHD 3R8EA 3UE5A 3ZX0A 2HF3A 3QMLA 4YDUC 1VQ4N 3DWLA 2WUSA 3QDKA 1KD1O 2P9NA 3CD6N 3I8BA 2WBNA 3DJCA 4BR5A 5E26A 2BUPA 3CCEN 3DXKA 3AAQA 4MO4A 4YORA 2D0OA 4A5BA 2FF6A 3IKMA 3VENA 2QEXN 5BN9A 2DPNA 5BPLA 3O9UA 3ZYYX 3B8AX 2BTFA 1NGFA 4ILHA 4K43A 5F0XA 2IIRA 2Q0RA 4BROA 5BPMA 2ASMA 4B1UB 4KBOA 1KAZA 3C65A 4FOEA 3VF4A 2CGJA 4O5FA 2E1ZA 4FWKA 3MX2A 4BR7A 2IVNA 3SAHA 3QFUA 1WOQA 4CI6A 3SBTA 2AA4A 3PIOL 2P9NB 3P4IA 3DXMB 2ZF5O 2Q97A 1MDUB 2QWNA 4A2AA 3I56N 2IVOA 5M1QA 3QB0A 3MCAB 3DXKB 3C6AA 2GEMA 4LC9B 4K41A 4DKWA 5JLHA 4XH4A 3KHYA 1QVGM 1VAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9T A;  3RVC A;  4OPA A;  2RHK A;  2GX9 A;  3D6R A;  3O9S A;  3P31 A;  3O9Q A;  3EE8 A;  3F5T A;  4OPH A;  3KWG A;  3EE9 A;  3P39 A;  2KKZ A;  3OA9 A;  3O9R A;  3P38 A;  3M5R A;  3KWI A;  3O9U A;  3L4Q A; 
#chains in the Genus database with same CATH topology
 2IDO A;  3QEW A;  4BDY A;  3OHR A;  2D0A A;  3GBT A;  4E7K A;  3SAF A;  4CF9 A;  5EX5 A;  2ITM A;  4FWM A;  1X3N A;  3S9H A;  1T6C A;  3O08 A;  1QQM A;  2LSN A;  3AVI A;  2ZQB A;  1S1U A;  1UAX A;  3SJH A;  3OBW A;  3HVR A;  5C42 A;  3CQY A;  4OKE A;  2NNW A;  4H0Y B;  1GLJ O;  1TKX A;  1NJI O;  1B9D A;  5DMR A;  4CGI A;  5I42 A;  3ZT1 A;  1N8R O;  3EKS A;  3LPT A;  2BDP A;  1JLG A;  1GLE G;  2P1J A;  4W5N A;  1JLB A;  3WNH A;  1T44 A;  3G10 A;  3VEX A;  2FSN A;  1MU2 A;  4G9Z A;  4JI1 K;  3PY8 A;  2YJE A;  4Z4I A;  3PSF A;  4YOW A;  3HVT A;  4IWV A;  4LF4 K;  1MWM A;  2XHB A;  4AM7 A;  5HRS A;  3ZSX A;  2P9L B;  1C6V A;  3T1Y K;  4BVP A;  4CE9 A;  1VQ8 N;  3LDO A;  1DLO A;  2Z1H A;  4DCH A;  4B1Y B;  3PLA A;  3CJB A;  4HHT A;  2KHO A;  5FRM A;  1QTM A;  4NCA A;  3K5L A;  1CXQ A;  2QM1 A;  3V1R A;  1J6Z A;  5CYQ A;  2VG7 A;  3V4I A;  4EIA A;  3I8D A;  1GOA A;  1SQK A;  1ILY A;  4DR4 K;  5KI6 A;  2KZM A;  4JRQ A;  3KD5 E;  1KAY A;  3AVL A;  5BRH A;  4HTU A;  5AQG A;  2OYQ A;  4JKE A;  3NF6 A;  4AHT A;  4BWJ A;  1Q86 O;  4G1Q A;  3HJF A;  4JS5 A;  1KLN A;  4IKF A;  3RR7 A;  2HMP A;  1XWL A;  4WCE L;  1C0M A;  3U9Z A;  1YJN N;  1HNV A;  3DLK A;  1QS4 A;  3WQT A;  5AFU A;  2NRZ A;  3ZX3 A;  4KI6 A;  3HM9 A;  1S6P A;  3ZT3 A;  4O0J A;  3ZSQ A;  4FZX C;  4PUO A;  1D4X A;  3SZ2 A;  5AQO A;  4BRI A;  3P31 A;  3MEG A;  4Z4G A;  4JK9 A;  4CZI A;  4ISG A;  1RT3 A;  2QWR A;  2XO7 A;  3GDQ A;  3KWG A;  3MN5 A;  4CEE A;  2NUB A;  3UKU A;  2IVP A;  4H0O A;  3U6F A;  5AQI A;  2Z1G A;  4A61 A;  5KPZ A;  4YOV A;  1NK4 A;  1Q18 A;  1RDD A;  1YVU A;  4DSK A;  1RTI A;  3PO5 A;  3O1B A;  5GAH P;  1DTQ A;  1IBL K;  3E66 A;  5KQD A;  1U4B A;  4R5P A;  3FZF A;  3ENO A;  3AVF A;  5EVZ A;  3IS9 A;  4EP4 A;  1HNX K;  1VSD A;  3UIQ A;  3E01 A;  1CZ9 A;  2P9U A;  1KSP A;  4JKC A;  1J54 A;  1TUY A;  3F9K A;  4M42 A;  1RDC A;  3UKU B;  1BU6 O;  4E3S A;  3HOS A;  4DFP A;  2O4I A;  4CHQ A;  3VEO A;  3CJ9 A;  1EKE A;  2HNY A;  1KCF A;  4KRE A;  5BRE A;  3L8B A;  1EO1 A;  4GNI A;  1VSF A;  3TAG A;  1ZBF A;  3MXM A;  3L6Q A;  1VQ7 N;  2X74 A;  5JS1 A;  4O4G A;  5F2R A;  5AQH A;  4DFK A;  1RGI A;  1QQN A;  3E1Y A;  4IG0 A;  2P9U B;  4FPA A;  1GLC G;  1NGH A;  3QFP A;  1MA9 B;  4BRQ A;  3PSI A;  4MLE A;  1D8Y A;  2PFU A;  1HKB A;  1WSF A;  1YT3 A;  2GUP A;  5AFU H;  4O5B A;  5GIP A;  2E88 A;  3OVN A;  5BR8 K;  2HHX A;  1P90 A;  1HNW K;  1XQS C;  3K5O A;  4DTS A;  3BP8 A;  1EQY A;  2B6A A;  4NO7 A;  1JKH A;  3LDQ A;  4B9T A;  3VER A;  2ATQ A;  3T7Z A;  1RDW X;  1ZYQ A;  3LM9 A;  3I33 A;  4Q5V A;  3LL3 A;  3O4N A;  1NNE A;  4OGC A;  3CJ1 A;  4M41 A;  1NBW A;  1TGO A;  3AA3 A;  1C0F A;  1WBD A;  4CJE A;  2WFB A;  4B9V A;  5KPT A;  1J5O A;  5FRO A;  4CK3 A;  2OTL N;  5C2F A;  1T7P A;  4CCH A;  2HW3 A;  4I9L A;  3TPQ A;  1YUW A;  4H5N A;  1XC9 A;  4FWQ A;  5C15 A;  3O80 A;  2UU9 K;  4PA1 A;  4C1N I;  4CBX A;  3EY1 A;  1NGB A;  3R3L A;  5HP1 A;  4DTX A;  4PKH A;  1D9F A;  4BDP A;  3G6E N;  1S1X A;  3H1V X;  3KLG A;  2EWS A;  1GLF O;  3KK2 A;  2PYL A;  5AQL A;  1EET A;  1NLV A;  3ATV A;  4YFU A;  3PX0 A;  4U67 L;  3B6O A;  2QWL A;  3ULE A;  3K58 A;  2OPQ A;  3QNN A;  3SNN A;  1HPM A;  3CCU N;  3TAE A;  3ZCM A;  3FGU A;  3VGL A;  1A5W A;  5HL7 L;  1QHA A;  4FJI A;  1K6Y A;  1DGK N;  3L4I A;  2X6N A;  4IOA L;  2YX6 A;  1DKG D;  1YI2 N;  3VQE A;  2RN2 A;  4B9U A;  1F21 A;  4QS9 A;  3OW2 M;  3SUQ A;  3S3O A;  2DTU A;  5C0Y A;  3RRG A;  3SQ1 A;  2P9I B;  3VN5 A;  3IG1 A;  4DV1 K;  2HHQ A;  5AQS A;  1QZ5 A;  3MDQ A;  4M7X A;  1KQS M;  4CGJ A;  3HPO A;  4A5A A;  5K14 A;  3VQP A;  1LW2 A;  2V52 B;  4QCL A;  1BI4 A;  3K9J A;  4B8C A;  5BRF A;  1NGD A;  4LY7 A;  3KLF A;  3HRG A;  4FL9 A;  4M7Y A;  1EWQ A;  3G4S N;  1WN7 A;  1S5J A;  3VA3 A;  1NG9 A;  3E9O A;  5IT9 O;  1WBB A;  1WUA A;  4M3R A;  5JS2 A;  2HHH K;  3NGZ A;  3PO4 A;  4DU4 A;  2ZD1 A;  3KK7 A;  4IOC L;  4IEE A;  4CD3 A;  5CHI A;  2FSJ A;  3VES A;  3LDN A;  5DM7 L;  3OYA A;  4NCB A;  3AGK A;  3LZI A;  1H1V A;  4C23 A;  4E7L A;  5AQU A;  1BI4 B;  4IO8 A;  3O3G A;  1YVN A;  3VEY A;  5GAG P;  4UQG A;  4BRL A;  1JLC A;  4AHU A;  2RPI A;  4LFB K;  2FBT A;  3GG4 A;  3S3N A;  4B3S K;  5AQZ A;  1RCH A;  2KQ2 A;  4KB1 A;  5AQX A;  3QEX A;  1DT9 A;  3OYC A;  5GAD P;  3KKR A;  3UE5 A;  4YDU C;  4AQY K;  1KD1 O;  4BR5 A;  3DJC A;  2D0C A;  4Z0U A;  1N36 K;  3AAQ A;  2D0O A;  4A5B A;  5DK5 A;  3VEN A;  5BN9 A;  1WSE A;  2UXC K;  2JLE A;  1IH7 A;  5F0X A;  1QSY A;  2IIR A;  2Q0R A;  4DQQ A;  1XI1 A;  3TWH A;  4KBO A;  4M3T A;  3AVB A;  4FWK A;  1SKR A;  3TAM A;  4CI6 A;  4FZZ A;  2G8W A;  3AA5 X;  1HYS A;  4DUZ K;  4CF0 A;  4LD0 A;  2VQF K;  3NF8 A;  2ZF5 O;  4OVL A;  2HHS A;  3C6A A;  2GEM A;  4LC9 B;  4KTW A;  1W0H A;  3KHY A;  4BRH A;  3AVK A;  3K5M A;  3RMA A;  5AQR A;  1KLM A;  5MLC Q;  1ZBU A;  1WB9 A;  1RIL A;  3J8A A;  2Z1I A;  4BAC A;  3FFI A;  3VQ4 A;  1WSG A;  1IBK K;  1B92 A;  4I2Q A;  1HKC A;  4H0V B;  3NGY A;  2A1R A;  2YJF A;  1T03 A;  4JYA K;  3AO5 A;  3O3H A;  4CFD A;  3SYZ A;  1TYQ A;  1RT2 A;  1VRU A;  4DUY K;  5CR4 A;  1WSJ A;  4LF5 K;  3N4P A;  5AJ3 K;  4W5T A;  3A5L C;  2VYP A;  4OX9 K;  2Q2R A;  4CJ7 A;  5AQV A;  4B3M K;  2FBX A;  3H6E A;  4FJG A;  5FPE A;  4C8L A;  3LP2 A;  4YOT A;  3P5J A;  3CQ8 A;  3QNO A;  1A5X A;  1KVA A;  4DFJ A;  4H03 B;  4BRC A;  4AHR A;  4BE0 A;  4WYB A;  3L2V A;  3E9P A;  1QHT A;  4X64 K;  1IBM K;  2D1K A;  3FZK A;  4FVM A;  1TYQ B;  1S9E A;  3D6R A;  3I0S A;  3QLH A;  5H1S Q;  5CZ1 A;  4WQ5 A;  4U7B A;  3QER A;  2E20 A;  1M90 O;  4TSX A;  3AY9 A;  3A0I X;  4HUE A;  1GLB G;  3WEE A;  2EHG A;  5AZI A;  3VEW A;  2IGI A;  4EZ9 A;  2PAV A;  2YHY A;  2AP1 A;  5ADX H;  3OBY A;  3O4W A;  3V81 A;  4KAZ A;  2YNG A;  1BUP A;  4XH5 A;  3M8S A;  1W2B M;  4B1V A;  4CES A;  3FLC O;  5KTQ A;  3O9T A;  4GKJ K;  1TL3 A;  3HI0 A;  4ELT A;  2OPS A;  4BQL A;  4DV7 K;  2NRT A;  2GWK A;  4RG8 A;  4DQI A;  4FK4 A;  3CI5 A;  4GW6 A;  4WQ4 A;  3I55 N;  3HZ6 A;  1G99 A;  1OVY A;  1U48 A;  3M3Z A;  3ZT0 A;  4FW1 A;  5FPN A;  5IWA K;  3L2Q A;  3L3U A;  3WEE B;  5AZI B;  1V4S A;  1YJW N;  1JLF A;  3DLH A;  4BVO A;  4FJJ A;  3CCM N;  1GOB A;  1LCU A;  2W40 A;  3TSU A;  2UXD K;  1ZBS A;  2NRW A;  3FE1 A;  2HOE A;  4OLA A;  3OYH A;  2E1Y A;  3M8Q A;  1FXX A;  3H1Q A;  1XMQ K;  3P39 A;  4IOX A;  3T19 A;  4KHP K;  1REV A;  1GLA G;  4E1N A;  2YI1 A;  2VWB A;  4DV5 K;  4NXN K;  4HCB A;  5KGX A;  4RW4 A;  4FXD A;  5CY4 A;  1TV6 A;  4JKG A;  2QXL A;  1T6D A;  1RTD A;  4JI4 K;  2GUI A;  1L3U A;  3WXL A;  4BRN A;  1S6Q A;  3THW B;  2Q0U A;  3BY5 A;  3VQ7 A;  4FPB A;  3ZSW A;  4CJ3 A;  2QKK A;  3DM2 A;  3OTO K;  3VPZ A;  2UXB K;  1BL3 A;  4KH6 A;  3O9R A;  2NRH A;  1ATR A;  3BDP A;  3B6P A;  2A3Z A;  1NK5 A;  3TTF A;  4CJT A;  4IFE A;  4JHD A;  4JI8 K;  4B3O A;  1RDU A;  4W5O A;  4PY5 A;  4BC2 A;  1Q9X A;  4DS4 A;  3AVM A;  4JKG B;  4DR2 K;  2O8C A;  2QWP A;  2NRR A;  3DI6 A;  4N56 A;  4FLW A;  1FKP A;  4FSV A;  4I6M A;  3HOT A;  3A5M C;  3L0Q A;  3MN7 A;  2D0B A;  1M1K O;  2RHK A;  3DLG A;  3EZW A;  1TK0 A;  4JHD B;  1VQN N;  4CFA A;  2NRV A;  2KZZ A;  2Y1J A;  4FM1 A;  4F2S A;  1ATS A;  3DAW A;  2KFZ A;  4JAX A;  5AZJ A;  3D2E A;  1Z26 A;  3P38 A;  4Y0W A;  2KLA A;  4JS4 A;  4E1J A;  4LFC K;  4CEF A;  4I6M B;  3LWL A;  3R9P A;  4FM2 A;  5AQQ A;  4H0P A;  4RCH A;  4CJK A;  1NMD A;  3TAQ A;  3CCQ N;  4QS7 A;  1KC8 O;  1K8K A;  1KTQ A;  3OYK A;  2E6L A;  1RT1 A;  3ATU A;  1Q81 O;  3V9Z A;  3KZB A;  3Q7B A;  4NYN A;  3OS1 A;  1ZBL A;  4GVE A;  3IDH A;  3GL1 A;  4CJF A;  5LMN K;  4RW7 A;  3G71 N;  2KW4 A;  3RSE A;  3RVC A;  4N76 A;  1SL1 A;  3V9W A;  4BR4 A;  3QBW A;  1RBU A;  3BF3 A;  1RT7 A;  3OYE A;  1E4F T;  3CCS N;  2QXF A;  4M45 A;  4BGA A;  2F9T A;  4BDZ A;  5ELZ A;  2P9S A;  3AO3 A;  1SL2 A;  4KRF A;  2QWO A;  4DQP A;  4F8R A;  1K8K B;  4MQ3 A;  4LFA K;  1S1W A;  2W42 A;  2RKI A;  1EP4 A;  4CGF A;  4H4O A;  4CHZ A;  5EU7 A;  1NWK A;  3RSE B;  4CEO A;  1BHL A;  5AQF A;  3IFR A;  5TKW A;  1GLD G;  1U2V A;  3MN9 A;  2ZGY A;  2QI2 A;  1QE1 A;  1NGA A;  1N33 K;  4DSJ A;  2P9S B;  2CGL A;  5M1O A;  4CHP A;  1ZC6 A;  1UA1 A;  5HRN A;  5J2M A;  4JEP A;  4UY8 O;  4K8X A;  1Q7Y O;  3NE6 A;  3EO3 A;  3OYM A;  5AQM A;  4B9N A;  1TUU A;  2ASO A;  4N5S A;  2P5G A;  2P9K A;  1IV0 A;  1WSH A;  1R0A A;  3K57 A;  3RMB A;  2WOM A;  4ZTJ A;  3KWI A;  3NVM A;  3VF2 A;  2I7N A;  3J80 O;  1U2V B;  1R59 O;  4CF8 A;  4EFH A;  2E5L K;  2W41 A;  4B9Q A;  4M3X A;  1IKW A;  1OH8 A;  3D0P A;  1U04 A;  2GX9 A;  5FLX O;  3THX A;  1NMN A;  1RDB A;  2FSK A;  3EE9 A;  5AQY A;  1ATN A;  1L3T A;  4YY3 K;  4C8O A;  2NLX A;  1YTU A;  1A5V A;  3SLC A;  3NGI A;  5BPN A;  2JGU A;  3JS6 A;  3CER A;  3VTI A;  4I7F A;  5EXW A;  3L2U A;  5AQN A;  1GOC A;  4LF9 K;  2YCH A;  3AVA A;  1NK7 A;  1ASU A;  4DQ8 A;  4KHU A;  2CGK A;  2OZM A;  1JLQ A;  4WFB L;  1RBR A;  2G8F A;  3QBX A;  2R7Y A;  4OPH A;  3BGR A;  3NDK A;  3R6M A;  1NGI A;  2G8U A;  3THX B;  1TKT A;  4CZE A;  1IKV A;  4FJX A;  4QS8 A;  4C8M A;  3WXI A;  4DU3 A;  1ASW A;  1YHQ N;  3A5N C;  5GIO A;  1TKD A;  3CET A;  3L4Q A;  2D0P A;  4CK2 A;  3OYG A;  2ASP A;  1IKX A;  2O4G A;  3AO1 A;  3ZX0 A;  4CF1 A;  2YKN A;  2IAJ A;  1X9S A;  3I8B A;  2WBN A;  4HUF A;  2KTQ A;  5CZ2 A;  3DXK A;  1Q8I A;  2FF6 A;  2VG5 A;  2DFH A;  2DY4 A;  3TI0 A;  4ID1 A;  3RR8 A;  2PY5 A;  4AHV A;  3B8A X;  3OJS A;  4ILH A;  3TAR A;  2ASM A;  4XIU A;  1KAZ A;  4FOE A;  3LP0 A;  2CGJ A;  3SV4 A;  4KHQ A;  4M3Y A;  4BR7 A;  4DMN A;  2IVN A;  4IFY A;  3KJV A;  3CYM A;  3QFU A;  3KLI A;  4CER A;  4KTQ A;  3SBT A;  4DV3 K;  2XRI A;  3SUP A;  1NOY A;  2FBY A;  1IO2 A;  3P4I A;  4LF8 K;  1HJR A;  3U3G A;  4A2A A;  2IVO A;  3DXK B;  3AO4 A;  4CIF A;  4N41 A;  4CGD A;  2HNZ A;  4DLG A;  1VQM N;  3MEE A;  4X62 K;  3NF9 A;  3V1O A;  1LWF A;  1VRT A;  4DR3 K;  2OA8 A;  3O9S A;  4B9L A;  3EKU A;  4E7H A;  4XH1 A;  2F9W A;  3NCI A;  2F8T A;  4O44 A;  3ULE B;  3O4Q A;  1NJY A;  4JI2 K;  3H3O B;  1LWC A;  1P8Z A;  3LPU A;  1N6Q A;  2RE2 A;  5C24 A;  1SUQ A;  2QW9 A;  4FWS A;  4HTL A;  1BGX T;  3TSP A;  1D5A A;  4EHU A;  3WNE A;  1G15 A;  4GY2 B;  3A8Y A;  3PIP L;  4ELV A;  3H46 O;  4OPA A;  3O8M A;  4Q0B A;  1RNH A;  4F9O A;  4EZ6 A;  4BR2 A;  3TTD A;  1BCO A;  4DSI A;  4NB4 A;  1BIS A;  3FZH A;  2HHV A;  4CZK A;  4CFC A;  2A6A A;  1S9G A;  2QTD A;  3J7A P;  5BN8 A;  2HF4 A;  5C25 A;  1OVQ A;  1QSS A;  1TVR A;  5HOO A;  3SUN A;  4H0T B;  4B1W B;  4ELU A;  5HLF A;  1N32 K;  3KK1 A;  3NVK A;  4FLY A;  4WQ5 C;  1WNS A;  2ZWH A;  4K0K K;  2E4L A;  4JKD A;  1ESV A;  5BR9 A;  5BRD A;  5AQT A;  1XHZ A;  2Z1J A;  3AO2 A;  4KFB A;  1U47 A;  5M1P A;  3L2R A;  1SKW A;  4CEB A;  3C94 A;  4PKG A;  3DOL A;  3KLE A;  4FJ7 A;  2O8B A;  3ZSZ A;  4H4M A;  2UUA K;  1V4T A;  1Y64 A;  3ZT4 A;  1T05 A;  2I7P A;  1BA1 A;  4XEI A;  3I0R A;  4E0D A;  4DTJ A;  4WQ4 C;  2AJQ A;  2PZS A;  2HBK A;  1LWE A;  3VTH A;  1C0U A;  2VGN A;  3OY9 A;  4E7J A;  1JJ2 M;  1ZBH A;  4KH5 A;  2HVI A;  3LAL A;  1N5Y A;  4AM6 A;  3HT3 A;  2ETJ A;  5AQJ A;  4FJL A;  1CZA N;  4JKF A;  3F9M A;  1YIT N;  3NH2 A;  3RRH A;  3VQ8 A;  5J1E A;  3CQX A;  1MWK A;  4A62 A;  2O8B B;  5AQK A;  4F2R A;  4IG3 A;  1RFQ A;  3ZEU A;  4AF1 A;  3VF6 A;  1QQC A;  4BRE A;  4FJ5 A;  1YF5 L;  3CF5 L;  3CHW A;  4CVN E;  1Z6R A;  5GIN A;  5ADX A;  3SQ2 A;  1Q9Y A;  2NZT A;  2HHW A;  3RMD A;  2KKZ A;  2G8V A;  3M5R A;  3UKR A;  4CGG A;  4Z4H A;  1GLL O;  5A2Q O;  4CEZ A;  3LM2 A;  4FWO A;  4PL8 A;  1EX4 A;  1RBV A;  1JL1 A;  1HYZ A;  5E41 A;  4CGH A;  4MDB A;  2FXU A;  4CJW A;  1VQL N;  3ASM A;  4JK7 A;  1BQN A;  1VSK A;  3GE1 A;  4JNE A;  3SCX A;  4CEA A;  3V1Q A;  3M8R A;  2E2P A;  2HHT A;  1SS6 A;  4CD1 A;  3ZEU B;  4E7I A;  1HYV A;  3H45 C;  3SQ4 A;  5LL6 Z;  4BRF A;  4CJU A;  5LY3 A;  3ITH A;  4JK8 A;  3N4Q A;  4FO0 A;  3EEQ A;  3SJJ A;  2A5X A;  4BRP A;  3M1F A;  3UKR B;  3THY A;  3EL2 A;  3U4L A;  3CCL N;  2UYT A;  2VWJ A;  4B08 A;  4OJR A;  4V19 S;  4PHT X;  3QEV A;  3THV A;  5EY4 A;  3J7Y P;  3CC7 N;  2IS3 A;  1C1B A;  3ISN C;  2FBV A;  3OA9 A;  4O0I A;  1BG3 A;  1ZXO A;  1JL2 A;  3SV3 A;  4BRA A;  4BRM A;  5JLF A;  2D5R A;  3VQ6 A;  1JXB A;  3MX5 A;  3CG7 A;  2B5J A;  4WE1 A;  3BEX A;  1K73 O;  2A1S A;  4IO9 L;  1SL0 A;  4B1Z A;  3THY B;  1LOT B;  3Q7C A;  4KHW A;  4GKK K;  4YNQ A;  3CFP A;  1UOC A;  2YHX A;  5KQ8 A;  5AQP A;  2BH1 A;  4E1M A;  3J7Z O;  3ZSO A;  5M1F A;  4F3O A;  4BRG A;  1EXQ A;  3AVG A;  4NLC A;  3FZM A;  3NBP A;  5AQW A;  4ZHR A;  3T1H K;  4FLX A;  3OJU A;  3OS2 A;  4DSL A;  3HBT A;  3VOV A;  1QZ6 A;  4C1N K;  1W97 L;  5KRS A;  2HBL A;  3G25 A;  4ISF A;  2O8F A;  5TKY A;  3CJ7 A;  3L2W A;  3IUC A;  4JKH A;  3A2F A;  1NJW A;  3VMF B;  2XY7 A;  3KTQ A;  3ZSY A;  4F3T A;  2NRX A;  3OYD A;  4JI6 K;  5DM6 L;  1U6Z A;  4FK2 A;  3BUZ B;  5C2D A;  3DXM A;  1UA0 A;  4BGB A;  2YNH A;  4LH4 A;  4YOU A;  5JVH L;  4J8F A;  1YAG A;  3OYF A;  4YDU A;  2E6M A;  3CFR A;  2YNI A;  4FWP A;  4FWN A;  2OZS A;  4A59 A;  1I94 K;  4ISE A;  1E3M A;  3QIC A;  4ILG B;  1O1W A;  4C8N A;  1OKJ A;  1VSM A;  2O8F B;  3T1A A;  2HMI A;  3K2P A;  3O1W A;  2UUB K;  4KV8 A;  1HKG A;  5B8H A;  4BY9 C;  4GV9 A;  4L8R B;  5AR0 A;  3D2F A;  4E89 A;  5GAE P;  1E4G T;  2FF3 B;  3OS0 A;  3OYJ A;  5C10 A;  2XY5 A;  1ASV A;  3LDS A;  1NGG A;  3HTV A;  3D7E O;  1C1A A;  3KLH A;  4ZTF A;  1RT6 A;  4CW7 B;  3O3F A;  3WUH A;  4DSE A;  1RT4 A;  1X1P A;  1XC3 A;  4CZJ A;  4BG9 A;  4NCG A;  4LSL A;  5E84 A;  4CIG A;  3EYZ A;  2O8E A;  1QVF M;  2ZJR L;  4DR5 K;  2G8I A;  4KO0 A;  1XNR K;  3HO1 A;  3VEV A;  3CPE A;  4N47 A;  4KH4 A;  3F73 A;  3SPZ A;  1YIJ N;  4DG1 A;  1QQO A;  1CLQ A;  3F5T A;  3EZ5 A;  2ZM6 K;  3D2F B;  2P9L A;  2E8A A;  1JCG A;  5CYM A;  3QEI A;  1BOT O;  5FPM A;  4CF2 A;  5M1N A;  4DU1 A;  3VA0 A;  2F7T A;  2HHU A;  4CJQ A;  1KRP A;  2X6S A;  4FCY A;  3ZET A;  3MWP A;  4RWT A;  4A57 A;  2ZJP L;  3C6T A;  1S1T A;  4CEC A;  4Z94 A;  3PX6 A;  5I3U A;  5SWM A;  5CE3 A;  4JI3 K;  1T8E A;  4GV3 A;  3J81 O;  1TL1 A;  1VQ6 N;  4JLH A;  2O8E B;  5FDL A;  1KFS A;  3UB5 A;  4CZH A;  4WF9 L;  4KHS A;  4DS5 A;  3DLB A;  2H3G X;  1S1V A;  2O8C B;  4JKB A;  4HUG A;  4YHH K;  1CXU A;  3T69 A;  4BC5 A;  4BC4 A;  4IZ9 A;  1HQU A;  3MEC A;  1C1C A;  2A42 A;  3CJA A;  5FRN A;  3AA2 A;  3HYF A;  3ZSV A;  2Q3S A;  4ID5 A;  3ZET B;  1NU0 A;  3O9Q A;  2DFE A;  3JSM A;  4WFN L;  3AA4 A;  4CZF A;  4CZG A;  3PUF A;  3CCJ N;  1TK5 A;  4DR6 K;  4DR7 K;  1Z25 A;  4IFV A;  3MK6 A;  4AIL C;  1U49 A;  3CJC A;  3C6H A;  1HX1 A;  3G0Z A;  4R79 A;  4IBN A;  4K42 A;  5AZJ B;  4WFA L;  1HLU A;  3SK3 A;  1D9D A;  3D2E B;  4LF7 K;  2I5J A;  3P1G A;  3LAN A;  2WUS A;  1ZBI A;  3QDK A;  5KRT A;  3CD6 N;  2F4V K;  1B9F A;  4MO4 A;  1KVC A;  4CK1 A;  3QIO A;  3IKM A;  3S3M A;  4LF6 K;  2YNF A;  2QEX N;  1NKC A;  2DPN A;  2QK9 A;  5BPL A;  5D3G A;  4J2E A;  3O9U A;  1NK6 A;  3IRX A;  1J9A A;  1NGF A;  2BTF A;  4K43 A;  3MXJ A;  3SPY A;  4BRO A;  5BPM A;  2Y1I A;  3ZT2 A;  1LAV A;  3HP6 A;  4O5F A;  4DF4 A;  2E1Z A;  2W6L A;  1FW6 A;  3ALY A;  1LW0 A;  3T3F A;  2ZE2 A;  3MAQ A;  3PIO L;  2BGG A;  2QWN A;  2Q97 A;  1MDU B;  1VSE A;  4I9Q A;  4DTN A;  4CJL A;  1Y97 A;  4DKW A;  2DFF A;  4DSF A;  4JI7 K;  4H8K A;  4X66 K;  4KB0 A;  1VAZ A;  1S22 A;  1VSI A;  5M1K A;  4IDK A;  4BR0 A;  5T7B A;  3TAP A;  3ENB A;  1XHX A;  2E2N A;  4JV5 K;  3HPG A;  4FK0 A;  3WXJ A;  4KTZ A;  3WNG A;  4CJV A;  1YXQ A;  5LMU K;  1SKS A;  1YTA A;  3OYL A;  4DTP A;  3VQC A;  1BCM A;  4CBU A;  4B9M A;  4JKA A;  4OKJ A;  4M3W A;  1RBT A;  5FPD A;  1ITG A;  4BR9 A;  4CHY A;  2Q31 A;  2B4J A;  1VK0 A;  1VQP N;  3NMU A;  3FR0 A;  4FM0 A;  4K8Z A;  4CED A;  3W3D A;  3O5B A;  4LH5 A;  2ZGZ A;  3AAR A;  3OYI A;  1QSL A;  4QOZ B;  3DOK A;  4NLB A;  4Y1C A;  3CM6 A;  1X9J A;  4DFM A;  3QES A;  3DLE A;  3CIP A;  3JXU A;  4DHY A;  1TAU A;  3OYB A;  3VQ9 A;  1NK8 A;  4JD2 A;  1KAX A;  2VWK A;  3CXC M;  1HJO A;  3ZSR A;  5KPR A;  3NH1 A;  3KK3 A;  2YKM A;  3K9K A;  4KHN A;  1T3V A;  2W6K A;  4YOX A;  4BRD A;  3TAB A;  2P9K B;  3IAY A;  3WT0 A;  4Z4C A;  3VEZ A;  3FFK B;  3ENH A;  1Q82 O;  5JIC A;  4W5Q A;  4MFB A;  3K5N A;  4BRK A;  1TKZ A;  2CH6 A;  3SMP A;  3AAP A;  3M6G A;  3QET A;  3C7N A;  4MDA A;  2PBD A;  1SV5 A;  4MLH A;  2XY6 A;  3C6U A;  1NM1 A;  3SUO A;  2A40 A;  2HBM A;  3HXM A;  2VCP A;  2VG6 A;  1C0G A;  2P5O A;  1NKB A;  4FLU A;  2E2O A;  4JD2 B;  2XY8 A;  2OAN A;  1BA0 A;  3AGR A;  1LV5 A;  4IJA A;  3SMS A;  4RW8 A;  3SAG A;  4ILJ A;  1S3X A;  4BE1 A;  4KHY A;  2IC3 A;  4AH9 A;  2QKB A;  4FW2 A;  4YOY A;  3AVJ A;  4DTR A;  5KGW A;  3E9L A;  1NGC A;  2E2Q A;  5JMV A;  1BDG A;  2Q36 A;  1K9M O;  4J2B A;  3C7N B;  4DTU A;  4C8K A;  1JLA A;  4CIE A;  3KIO A;  2HND A;  1KFD A;  3ZLJ A;  1YJ9 N;  3DLL L;  4CBW A;  4RTF D;  3HM8 A;  4O8U A;  2D4W A;  3OYN A;  3CC2 N;  2V7Y A;  2HBJ A;  1Z05 A;  1XNQ K;  4B3R K;  3FZL A;  3TSQ A;  3VGK A;  2GWJ A;  3HL8 A;  1WLJ A;  2ZJQ L;  1UWB A;  3LP3 A;  4CZL A;  1BWF O;  3SQ0 A;  3NF7 A;  4W5R A;  3QIN A;  1RTJ A;  3V6D A;  3C0B A;  5J2P A;  4B3T K;  4BG8 A;  2FC0 A;  4DV4 K;  3BZK A;  1FK9 A;  2P9I A;  3O6W A;  2YHA A;  4H5V A;  3SBG A;  2GBZ A;  3AVN A;  4BWM A;  3VQQ A;  4QAG A;  3CC4 N;  3VET A;  4H5T A;  4FVU A;  4M63 C;  2QWQ A;  3D45 A;  4J2D A;  3M8P A;  1J5E K;  1CZB A;  4LSN A;  1SZ2 A;  1NK0 A;  3W0L A;  4AHC A;  1JLE A;  1NK9 A;  2QWM A;  3DMJ A;  3WNF A;  4DR1 K;  3LDP A;  3SI6 A;  3U9D A;  4DV6 K;  4H0X B;  1VQK N;  4FWL A;  2GTD A;  3CME N;  1TK8 A;  1HQE A;  4IEI A;  4IDH A;  4HWI A;  4FLZ A;  4DQR A;  4DTM A;  3AV9 A;  1NJZ A;  3DRR A;  3H08 A;  1OH7 A;  5I9E B;  4FJH A;  3VQD A;  3WQU A;  3ID6 A;  4KKO A;  1S72 N;  3DRP A;  2GEL A;  4H5R A;  5HRR A;  1OH6 A;  3DLR A;  4O8K A;  3AVC A;  4PQU A;  4B8A B;  5JVG L;  4E19 A;  1J53 A;  2V51 B;  1DEJ A;  3P83 D;  5J2Q A;  1VHX A;  1TAQ A;  1HR0 K;  4JN4 A;  1X9M A;  4OPK A;  4L3Q A;  3K59 A;  1VSJ A;  2P9P A;  4JI0 K;  3MWT A;  4DF8 A;  5HBM A;  1HNZ K;  1HMV A;  4EHT A;  5HRO A;  4KI4 A;  1VSL A;  3U8X A;  5C12 A;  4O55 A;  1L5U A;  1HPZ A;  2FLO A;  3VGM A;  4HVJ A;  2F8S A;  1NKE A;  3CM5 A;  4DQS A;  5EOY A;  3TU5 A;  4JI5 K;  4GV6 A;  3A5O C;  4J2A A;  2A41 A;  3DYA A;  4CJP A;  3TAF A;  3LDL A;  3PX4 A;  2O8D A;  1JCE A;  2WC9 A;  3NH0 A;  3ID8 A;  3NHG A;  1I39 A;  5LJV A;  3U3Y A;  1L3V A;  1BQM A;  4H5W A;  2P9P B;  3K0S A;  4JRP A;  3DRS A;  3HST B;  4Y1D A;  3V9S A;  3CCR N;  1N34 K;  4FLT A;  4GMJ B;  1FKO A;  1EWR A;  4RW6 A;  1JCF A;  3L3V A;  3EE8 A;  1O13 A;  3WXK A;  5F1X A;  4M3U A;  1XUP O;  2JWL A;  4FJK A;  3F2K A;  2QA4 N;  3LZJ A;  4AHS A;  4FJN A;  3EN9 A;  2V7Z A;  1NJX A;  2O8D B;  2G8H A;  1HNI A;  4IJN A;  4CFB A;  1W7A A;  4FJ9 A;  4BQZ A;  3VQ5 A;  4CJ5 A;  3MXI A;  5SZT A;  2IOC A;  3IMX A;  1VQ5 N;  4CHO A;  1I3A A;  4PL7 A;  3C95 A;  1XMO K;  3GOI A;  4DLE A;  4A2B A;  2Q1N A;  1L3S A;  4CJ4 A;  1VQ9 N;  4PWD A;  4BC3 A;  2CH5 A;  3R1X A;  4K25 A;  2P51 A;  1NGJ A;  3KVG A;  1RTH A;  4CHN A;  2YHB A;  3CFO A;  4FJ8 A;  3RWU A;  4B9S A;  3RMC A;  4OGE A;  3QO9 A;  1LAW A;  3CPW M;  3HK2 A;  3MED A;  5LJW A;  2RF2 A;  3NFA A;  2YHW A;  3RTV A;  3ZX2 A;  4B1X B;  3QIP A;  4FOI A;  3PV8 A;  3TTC A;  5HRP A;  4FZY A;  1RBS A;  2YV0 X;  4PKI A;  1K8A O;  4FWR A;  4HCC A;  3CCV N;  2VQE K;  3MCP A;  4FYD A;  3CMA N;  2HST A;  1U45 A;  2OTJ N;  4DB3 A;  3VQA A;  3V9X A;  4OKK A;  4DWI A;  1VQO N;  3MN6 A;  1WAJ A;  1OH5 A;  4EP5 A;  2JWK A;  1RDA A;  1BO5 O;  3NAE A;  1W9H A;  2GV9 A;  4DTO A;  4ICL A;  2PYJ A;  1HRH A;  3JYT A;  4CEQ A;  3WXM B;  3HSC A;  3KKS A;  2OCE A;  4OPJ A;  4RW9 A;  2VGM A;  1KXP A;  1SAZ A;  4FJM A;  2EX3 A;  4IXC A;  3HPH A;  4DV0 K;  3S41 A;  1HUX A;  1IG8 A;  1BIU A;  2UUC K;  2F96 A;  4BE2 A;  1IG9 A;  4OLB A;  1JXE A;  3VQB A;  2OPP A;  1X3M A;  1X9W A;  3TAN A;  3AVH A;  4GVM A;  4OO1 J;  3MMV A;  4Z4F A;  4CZM A;  3V9U A;  3KD1 E;  4KPY A;  1C0T A;  4MO5 A;  5J2N A;  1WSI A;  1NOZ A;  3LP1 A;  1NGE A;  3H3N O;  2WTU A;  4M3Z A;  3BF1 A;  1FJG K;  1IJJ A;  1RT5 A;  2J4R A;  4EAH D;  3R8E A;  2HF3 A;  3QML A;  4NYF A;  1VQ4 N;  3DWL A;  2OPR A;  4NXM K;  1DTT A;  4I2P A;  2P9N A;  2HVH A;  3LWM A;  5E26 A;  2BUP A;  4DV2 K;  2HB5 A;  4FLV A;  2G8K A;  2BAN A;  3CCE N;  4YOR A;  3TR8 A;  3LAM A;  1WAF A;  2BE2 A;  1BIZ A;  3ULD A;  3ZYY X;  3THW A;  2X78 A;  4F4K A;  3LAK A;  4B1U B;  4CJR A;  3BZC A;  3C65 A;  3JAM O;  3VF4 A;  1KVB A;  2ITG A;  3QEP A;  3MX2 A;  3SAH A;  1WOQ A;  1IKY A;  4Z4E A;  2AA4 A;  2P9N B;  1VSH A;  3DXM B;  2KFN A;  3I56 N;  5M1Q A;  3QB0 A;  3MCA B;  4CJS A;  4X65 K;  3HP9 A;  4K41 A;  5JLH A;  4XH4 A;  1QVG M;  2WON A; 
#chains in the Genus database with same CATH homology
 1VQM N;  1S22 A;  5M1K A;  3OHR A;  4BR0 A;  3GBT A;  3ENB A;  3SAF A;  5AQR A;  5EX5 A;  2ITM A;  2E2N A;  4FWM A;  5MLC Q;  1X3N A;  1T6C A;  3J8A A;  3O08 A;  1QQM A;  3WXJ A;  3O9S A;  1YXQ A;  3EKU A;  3SJH A;  3OBW A;  4XH1 A;  2F9W A;  4CBU A;  1HKC A;  4H0V B;  4JKA A;  3ULE B;  3CQY A;  2YJF A;  5FPD A;  4BR9 A;  3H3O B;  2NNW A;  4H0Y B;  1P8Z A;  2Q31 A;  1GLJ O;  2RE2 A;  1NJI O;  1VQP N;  2QW9 A;  4FWS A;  3NMU A;  1N8R O;  4HTL A;  3EKS A;  3FR0 A;  3CCV N;  1TYQ A;  3TSP A;  4EHU A;  3W3D A;  3O5B A;  4GY2 B;  2ZGZ A;  1GLE G;  3A8Y A;  3PIP L;  3AAR A;  3H46 O;  4OPA A;  3O8M A;  5CR4 A;  4F9O A;  4NLB A;  3N4P A;  4BR2 A;  1T44 A;  3TTD A;  3VEX A;  3A5L C;  2FSN A;  4G9Z A;  2VYP A;  2Q2R A;  4CJ7 A;  1X9J A;  5AQV A;  4NB4 A;  3H6E A;  3CIP A;  5FPE A;  2YJE A;  3FZH A;  3JXU A;  4DHY A;  4CZK A;  2A6A A;  4JD2 A;  1KAX A;  3CXC M;  4YOT A;  1HJO A;  4YOW A;  2QTD A;  5KPR A;  3K9K A;  1T3V A;  4IWV A;  5BN8 A;  2HF4 A;  1MWM A;  4H03 B;  4AM7 A;  4YOX A;  4BRC A;  4BRD A;  5HOO A;  2P9K B;  4H0T B;  2P9L B;  4B1W B;  4WYB A;  4BVP A;  3WT0 A;  3E9P A;  3VEZ A;  3NVK A;  3FFK B;  3ENH A;  4WQ5 C;  2ZWH A;  3LDO A;  1VQ8 N;  1Q82 O;  4DCH A;  4B1Y B;  4JKD A;  5JIC A;  3PLA A;  2D1K A;  3FZK A;  1TYQ B;  1ESV A;  3CJB A;  5BR9 A;  4BRK A;  5BRD A;  2KHO A;  3D6R A;  2CH6 A;  5AQT A;  3SMP A;  3AAP A;  3M6G A;  5H1S Q;  3C7N A;  4WQ5 A;  4MDA A;  2E20 A;  2PBD A;  4U7B A;  1M90 O;  3AY9 A;  5M1P A;  3A0I X;  2QM1 A;  4MLH A;  1GLB G;  1NM1 A;  3WEE A;  1J6Z A;  2A40 A;  4PKG A;  5AZI A;  2HBM A;  2VCP A;  3VEW A;  4EIA A;  2PAV A;  1C0G A;  1SQK A;  1V4T A;  1Y64 A;  2AP1 A;  2YHY A;  1ILY A;  2I7P A;  1BA1 A;  3O4W A;  2E2O A;  3OBY A;  4JD2 B;  5ADX H;  2OAN A;  4XEI A;  1BA0 A;  1BUP A;  3AGR A;  1KAY A;  4XH5 A;  5BRH A;  1W2B M;  4B1V A;  5AQG A;  3FLC O;  4IJA A;  3SMS A;  3O9T A;  3SAG A;  4JKE A;  4ILJ A;  4WQ4 C;  1S3X A;  2HBK A;  3VTH A;  3HI0 A;  2VGN A;  1Q86 O;  1JJ2 M;  4BQL A;  2NRT A;  4KH5 A;  2GWK A;  4YOY A;  3CI5 A;  3I55 N;  4WQ4 A;  4AM6 A;  3HZ6 A;  1G99 A;  3E9L A;  1NGC A;  1OVY A;  2HMP A;  5AQJ A;  4WCE L;  2E2Q A;  5JMV A;  1BDG A;  2Q36 A;  1CZA N;  3M3Z A;  1K9M O;  4JKF A;  3C7N B;  3F9M A;  5FPN A;  3U9Z A;  1YJN N;  1YIT N;  3WQT A;  3WEE B;  2NRZ A;  5AFU A;  3ZX3 A;  5AZI B;  1V4S A;  3CQX A;  1MWK A;  1YJ9 N;  4A62 A;  3DLL L;  1YJW N;  5AQK A;  4CBW A;  4RTF D;  3HM8 A;  4O8U A;  4BVO A;  2D4W A;  3CCM N;  1RFQ A;  3CC2 N;  1D4X A;  2V7Y A;  3ZEU A;  1LCU A;  2HBJ A;  2W40 A;  3TSU A;  3VF6 A;  4AF1 A;  5AQO A;  1ZBS A;  2NRW A;  3FE1 A;  1Z05 A;  2HOE A;  4BRI A;  3FZL A;  4BRE A;  1YF5 L;  3P31 A;  3CF5 L;  3TSQ A;  3CHW A;  4JK9 A;  3VGK A;  4CZI A;  2GWJ A;  4ISG A;  2E1Y A;  2QWR A;  3GDQ A;  3KWG A;  3MN5 A;  1Z6R A;  5GIN A;  3H1Q A;  5ADX A;  3P39 A;  4IOX A;  3UKU A;  2NZT A;  2ZJQ L;  4CZL A;  1GLA G;  1BWF O;  2KKZ A;  2IVP A;  2YI1 A;  4H0O A;  2VWB A;  5AQI A;  3M5R A;  3UKR A;  3C0B A;  4A61 A;  1GLL O;  5KPZ A;  3LM2 A;  4FWO A;  4PL8 A;  4YOV A;  1Q18 A;  4BG8 A;  4H5V A;  2P9I A;  3O6W A;  3SBG A;  4JKG A;  3O1B A;  2QXL A;  5GAH P;  1T6D A;  4MDB A;  3CC4 N;  2FXU A;  3WXL A;  3E66 A;  4JK7 A;  5KQD A;  3VET A;  4BRN A;  1VQL N;  3GE1 A;  2Q0U A;  4H5T A;  4JNE A;  2QWQ A;  3FZF A;  4M63 C;  4FVU A;  3ENO A;  2E2P A;  1SS6 A;  5EVZ A;  4FPB A;  4CD1 A;  1SZ2 A;  3ZEU B;  3H45 C;  3W0L A;  3VPZ A;  4BRF A;  4KH6 A;  2P9U A;  5LY3 A;  3O9R A;  2NRH A;  1ATR A;  1TUY A;  3N4Q A;  4JK8 A;  4JKC A;  2QWM A;  3UKU B;  1BU6 O;  2A3Z A;  4FO0 A;  3LDP A;  3HOS A;  2A5X A;  3TTF A;  3U9D A;  4BRP A;  4H0X B;  4IFE A;  4FWL A;  3M1F A;  4JHD A;  1RDU A;  2GTD A;  3UKR B;  1VQK N;  3EL2 A;  3CME N;  4IEI A;  4IDH A;  3U4L A;  4BC2 A;  3CCL N;  2UYT A;  4HWI A;  3VEO A;  3CJ9 A;  4JKG B;  2QWP A;  2NRR A;  5BRE A;  1EO1 A;  5I9E B;  4GNI A;  4PHT X;  5EY4 A;  3CC7 N;  3WQU A;  3ID6 A;  3OA9 A;  3L6Q A;  1VQ7 N;  1BG3 A;  1ZXO A;  4FSV A;  4I6M A;  3HOT A;  1S72 N;  5F2R A;  5AQH A;  2GEL A;  4H5R A;  1RGI A;  4BRA A;  3A5M C;  1QQN A;  4O8K A;  4BRM A;  3L0Q A;  5JLF A;  3E1Y A;  3MN7 A;  2P9U B;  4FPA A;  1GLC G;  1NGH A;  3QFP A;  3MX5 A;  1MA9 B;  4BRQ A;  3BEX A;  1M1K O;  5JVG L;  1K73 O;  2RHK A;  4MLE A;  2V51 B;  3EZW A;  4IO9 L;  2PFU A;  1DEJ A;  1HKB A;  2GUP A;  5AFU H;  4JHD B;  4B1Z A;  1VQN N;  1LOT B;  4JN4 A;  2NRV A;  3Q7C A;  5GIP A;  2E88 A;  2YHX A;  4L3Q A;  5KQ8 A;  5AQP A;  2BH1 A;  2P9P A;  1ATS A;  3J7Z O;  1P90 A;  3DAW A;  4JAX A;  5M1F A;  5AZJ A;  3D2E A;  3MWT A;  1XQS C;  4BRG A;  3P38 A;  4Y0W A;  2KLA A;  4EHT A;  3BP8 A;  4NLC A;  4E1J A;  3U8X A;  1EQY A;  3FZM A;  5AQW A;  5C12 A;  3VGM A;  2FLO A;  4NO7 A;  3LDQ A;  4I6M B;  3R9P A;  3VER A;  3T7Z A;  5EOY A;  3TU5 A;  3HBT A;  3VOV A;  1RDW X;  1QZ6 A;  4GV6 A;  3LM9 A;  3A5O C;  3I33 A;  5AQQ A;  4C1N K;  4H0P A;  3LL3 A;  1W97 L;  4RCH A;  2A41 A;  2HBL A;  3CJ1 A;  3G25 A;  1NBW A;  1NMD A;  3LDL A;  4ISF A;  1C0F A;  3CCQ N;  4QS7 A;  1JCE A;  2WC9 A;  5TKY A;  3CJ7 A;  1K8K A;  1KC8 O;  2WFB A;  3ATU A;  3ID8 A;  5LJV A;  3IUC A;  4JKH A;  5KPT A;  1Q81 O;  4H5W A;  3KZB A;  3Q7B A;  2OTL N;  3VMF B;  2P9P B;  5C2F A;  3TPQ A;  4GVE A;  3IDH A;  3GL1 A;  1YUW A;  2NRX A;  4H5N A;  3CCR N;  5DM6 L;  3G71 N;  3RSE A;  3RVC A;  1U6Z A;  4FWQ A;  5C15 A;  3O80 A;  3BUZ B;  4BR4 A;  3QBW A;  5C2D A;  3DXM A;  1JCF A;  4C1N I;  4CBX A;  3BF3 A;  4BGB A;  4YOU A;  1E4F T;  3CCS N;  5JVH L;  4J8F A;  1NGB A;  1YAG A;  3EE8 A;  4YDU A;  1O13 A;  3R3L A;  3WXK A;  4BGA A;  5F1X A;  4FWP A;  4FWN A;  1XUP O;  2JWL A;  4PKH A;  3F2K A;  2F9T A;  4A59 A;  2P9S A;  5ELZ A;  3H1V X;  4ISE A;  3G6E N;  2EWS A;  2QWO A;  3QIC A;  4ILG B;  2QA4 N;  1GLF O;  3EN9 A;  1OKJ A;  2V7Z A;  1K8K B;  4IJN A;  5AQL A;  1NLV A;  3ATV A;  3O1W A;  4BQZ A;  4U67 L;  1HKG A;  5B8H A;  4BY9 C;  2QWL A;  3IMX A;  4BRH A;  1VQ5 N;  4GV9 A;  4PL7 A;  5AR0 A;  3ULE A;  3GOI A;  3D2F A;  4A2B A;  2Q1N A;  1HPM A;  3CCU N;  5GAE P;  1E4G T;  2FF3 B;  3FGU A;  1NWK A;  3RSE B;  4BC3 A;  3VGL A;  1VQ9 N;  5HL7 L;  2CH5 A;  1QHA A;  3R1X A;  5AQF A;  3IFR A;  5TKW A;  5C10 A;  1GLD G;  1DGK N;  3L4I A;  1U2V A;  3MN9 A;  4K25 A;  2YX6 A;  4IOA L;  1NGJ A;  1NGG A;  3KVG A;  3HTV A;  2ZGY A;  2QI2 A;  3D7E O;  1DKG D;  1YI2 N;  3WUH A;  1NGA A;  4QS9 A;  1XC3 A;  3OW2 M;  4CZJ A;  2P9S B;  4BG9 A;  2CGL A;  5M1O A;  5E84 A;  1ZC6 A;  3CPW M;  1QVF M;  2ZJR L;  5C0Y A;  5LJW A;  4JEP A;  4UY8 O;  2P9I B;  1Q7Y O;  2YHW A;  3CPE A;  3VEV A;  3EO3 A;  4KH4 A;  3ZX2 A;  5AQS A;  1QZ5 A;  3MDQ A;  1QQO A;  4B1X B;  1YIJ N;  3F5T A;  4M7X A;  5AQM A;  1TUU A;  2ASO A;  4FOI A;  1KQS M;  2P9K A;  3D2F B;  3TTC A;  2P9L A;  2E8A A;  1JCG A;  4A5A A;  4PKI A;  1K8A O;  4FWR A;  1BOT O;  5FPM A;  2V52 B;  3MCP A;  3KWI A;  5M1N A;  3NVM A;  3CMA N;  2HST A;  3K9J A;  5BRF A;  3VF2 A;  2I7N A;  1NGD A;  2OTJ N;  2F7T A;  1U2V B;  1R59 O;  3HRG A;  4DB3 A;  4EFH A;  2W41 A;  4FL9 A;  4M7Y A;  4B9Q A;  3ZET A;  3MN6 A;  3MWP A;  4RWT A;  1VQO N;  4A57 A;  2ZJP L;  3G4S N;  4Z94 A;  2GX9 A;  5CE3 A;  2JWK A;  1BO5 O;  4GV3 A;  1VQ6 N;  3UB5 A;  3E9O A;  2FSK A;  4CZH A;  4WF9 L;  1WUA A;  3EE9 A;  5AQY A;  1ATN A;  3WXM B;  3KK7 A;  4IOC L;  2H3G X;  3HSC A;  4IEE A;  4JKB A;  2NLX A;  4CD3 A;  5CHI A;  2FSJ A;  3SLC A;  2VGM A;  1KXP A;  3VES A;  5BPN A;  1SAZ A;  3LDN A;  5DM7 L;  4IXC A;  3JS6 A;  3AGK A;  3T69 A;  4BC5 A;  3CER A;  1H1V A;  4IZ9 A;  3S41 A;  3VTI A;  5EXW A;  4BC4 A;  4C23 A;  5AQU A;  1HUX A;  5AQN A;  1IG8 A;  2YCH A;  4IO8 A;  2A42 A;  1YVN A;  4DQ8 A;  3VEY A;  3CJA A;  5GAG P;  2CGK A;  4BRL A;  3ZET B;  1X3M A;  4WFB L;  3O9Q A;  3QBX A;  4WFN L;  4OPH A;  3R6M A;  1NGI A;  4CZF A;  3GG4 A;  4OO1 J;  4CZG A;  3CCJ N;  4CZE A;  3MMV A;  4CZM A;  5AQZ A;  3MK6 A;  4QS8 A;  3WXI A;  1YHQ N;  4MO5 A;  3A5N C;  5GIO A;  1NGE A;  3CJC A;  3C6H A;  1HX1 A;  3CET A;  3H3N O;  5AQX A;  3L4Q A;  3BF1 A;  4R79 A;  4K42 A;  2D0P A;  2ASP A;  5AZJ B;  1IJJ A;  1HLU A;  1DT9 A;  3SK3 A;  3D2E B;  5GAD P;  4WFA L;  2J4R A;  4EAH D;  3R8E A;  3UE5 A;  3ZX0 A;  2HF3 A;  3QML A;  4YDU C;  1VQ4 N;  3DWL A;  2WUS A;  3QDK A;  1KD1 O;  2P9N A;  3CD6 N;  3I8B A;  2WBN A;  3DJC A;  4BR5 A;  5E26 A;  2BUP A;  3CCE N;  3DXK A;  3AAQ A;  4MO4 A;  4YOR A;  2D0O A;  4A5B A;  2FF6 A;  3IKM A;  3VEN A;  2QEX N;  5BN9 A;  2DPN A;  5BPL A;  3O9U A;  3ZYY X;  3B8A X;  2BTF A;  1NGF A;  4ILH A;  4K43 A;  5F0X A;  2IIR A;  2Q0R A;  4BRO A;  5BPM A;  2ASM A;  4B1U B;  4KBO A;  1KAZ A;  3C65 A;  4FOE A;  3VF4 A;  2CGJ A;  4O5F A;  2E1Z A;  4FWK A;  3MX2 A;  4BR7 A;  2IVN A;  3SAH A;  3QFU A;  1WOQ A;  4CI6 A;  3SBT A;  2AA4 A;  3PIO L;  2P9N B;  3P4I A;  3DXM B;  2ZF5 O;  2Q97 A;  1MDU B;  2QWN A;  4A2A A;  3I56 N;  2IVO A;  5M1Q A;  3QB0 A;  3MCA B;  3DXK B;  3C6A A;  2GEM A;  4LC9 B;  4K41 A;  4DKW A;  5JLH A;  4XH4 A;  3KHY A;  1QVG M;  1VAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...