3O9RA

Effector domain of ns1 from influenza a/pr/8/34 containing a w187a mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
118
structure length
118
Chain Sequence
ASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
molecule keywords Nonstructural protein 1
total genus 36
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9rA00
3EE8A 2KKZA 3L4QA 4OPAA 3F5TA 3O9SA 3EE9A 3RVCA 2GX9A 3OA9A 3O9TA 3P31A 3D6RA 3O9QA 2RHKA 3P39A 3O9RA 3KWGA 3M5RA 4OPHA 3KWIA 3O9UA 3P38A
chains in the Genus database with same CATH superfamily
1I39A 1NGFA 3RMDA 4BC2A 3FLCO 3WXLA 2PFUA 2QM1A 5EOYA 1VHXA 1SZ2A 4YOVA 4JNEA 3VQ7A 4E0DA 1K8KA 2E20A 1BG3A 4DTXA 3WUHA 1T05A 1EQYA 4ISFA 4BQZA 2G8KA 3WEEA 4JI4K 4E1JA 3C0BA 3UKUA 1FJGK 4DMNA 4GV3A 1QVGM 2OTJN 1LAVA 2GWKA 4NB4A 4B1VA 1RDUA 1S1VA 4DF8A 3V1RA 4DV1K 3QINA 2G8VA 3B6OA 1HQUA 2IAJA 4F4KA 1ZBIA 2OTLN 1RDBA 1GLLO 3AAPA 4A5AA 4ICLA 4NCGA 3F73A 3EYZA 3WNGA 5C10A 4ELVA 3N4QA 3OYLA 3BDPA 3OYJA 2V51B 4BY9C 2OPQA 4H5WA 3QEIA 5EVZA 3CPEA 3JSMA 3TTFA 3CHWA 5KPZA 5AQHA 1LW2A 3H08A 4FM2A 5A2QO 1KTQA 2V52B 1KCFA 1WSGA 4KKOA 3AVNA 4N56A 4HUGA 1U6ZA 2KLAA 3CETA 4B8AB 3VEVA 5GIPA 3MXJA 3OA9A 4M3WA 1W9HA 4B8CA 4IFEA 1YTAA 4JKDA 5C2DA 1HYVA 4JKAA 2G8WA 4DTSA 4FW1A 3AGRA 4NYFA 1BUPA 2P9NA 2O8CA 1TKTA 1IKYA 4DFMA 3SQ4A 3CCQN 1TL3A 4W5QA 1L3VA 4IO9L 3ID8A 2W41A 3A5LC 3C6TA 4DUYK 4AM7A 3LDSA 4NLBA 5SZTA 2QI2A 3G6EN 3AVIA 4B9MA 5GADP 2WFBA 4RW7A 4B1UB 3LAKA 3QICA 4JKCA 3CMAN 4IG3A 4B9SA 1RBVA 4OX9K 4YOYA 2ZJPL 1WOQA 4CGIA 2UUCK 2FSJA 1BI4B 5C25A 4HCBA 1YJ9N 3SAGA 4MQ3A 4PUOA 2GELA 3G71N 2DFEA 2IDOA 3RMCA 1VRUA 5EX5A 4UY8O 1EETA 2WOMA 3EKSA 1W97L 4FJ9A 3D0PA 4FWNA 1FKPA 3E1YA 2X78A 2FBYA 4AF1A 1ASVA 2EHGA 2YHWA 4PKIA 2ZF5O 2H3GX 4H8KA 5J2NA 4CJRA 1EKEA 3NE6A 4CEEA 4G9ZA 3QEXA 4BRDA 4JI1K 2P9NB 2G8FA 3WXKA 1QZ6A 3OYAA 3OJUA 1NJXA 3CCJN 3RSEB 4EFHA 3ZLJA 4XIUA 3THXB 4CIFA 3VEZA 3SPYA 3G10A 4JK8A 1QQOA 2KQ2A 4DTRA 3VTHA 2HHXA 4E7LA 3OYDA 4KB0A 3IFRA 2OZMA 3MX2A 5MLCQ 2HNZA 3C7NA 3F9KA 3R8EA 2Z1HA 1CXQA 4GV9A 1T7PA 4OPKA 3ZX3A 3SNNA 2R7YA 3HRGA 2JWLA 5AQYA 5BRHA 4GVMA 5ADXH 5BRFA 5JS1A 4JK7A 4BGAA 4U67L 2HW3A 2E2OA 1YUWA 5BPMA 1HNWK 1HLUA 1NJZA 1HYZA 2KKZA 4CECA 3THXA 4DR5K 3R6MA 1RFQA 1JCFA 1D5AA 1GLAG 4CEQA 3THYB 4G1QA 3BP8A 4Q0BA 2EX3A 2YNHA 1OH6A 5AQRA 2YHYA 4AHTA 4BVOA 3SV3A 4QS8A 3O9QA 4LF9K 4LF7K 3MCPA 4YOTA 2G8HA 4PL8A 3QBWA 3WNEA 4O0IA 4YNQA 1VQ5N 1A5WA 4ISEA 3V9SA 1WNSA 2YNIA 3OYKA 4V19S 3AA4A 1RTDA 2CGKA 1SL2A 4EZ6A 5I9EB 4FCYA 2G8UA 3R1XA 3CI5A 4CIEA 2QTDA 3QFPA 3CQYA 3VQ8A 3QETA 3QNOA 3HOSA 4DFJA 2E6MA 5J2QA 3GE1A 5HLFA 5M1FA 1XUPO 4PY5A 2FLOA 4IZ9A 1QQMA 1X3NA 5DMRA 4CZLA 2EWSA 4CJQA 2NRWA 4CF1A 4DG1A 4BACA 3S3MA 1UOCA 4J2DA 2ZJQL 3KVGA 3O8MA 1RGIA 2P9UA 3AVKA 1NOYA 2ITGA 2OA8A 5EY4A 5J2PA 3AVAA 4DCHA 4IEEA 2PYJA 4EP5A 4KPYA 5GAHP 2YHAA 4KH5A 3LDQA 3P5JA 1NJIO 3SUOA 1O1WA 3KLIA 3VQBA 1IKXA 1JLBA 1U45A 1NGAA 3A8YA 1W2BM 1D9FA 2IIRA 3EZWA 1RDDA 3ENOA 3L2QA 3VGMA 4KHPK 1ATRA 4WE1A 1XNQK 5C0YA 3CJ7A 2GUIA 1L3UA 3K57A 1IBLK 4F2SA 1WSEA 4M42A 2ASPA 1ZYQA 1LV5A 1YJNN 3L3VA 2HOEA 1XHZA 1TKDA 3CCUN 1QHTA 4JS5A 5D3GA 2D4WA 4BROA 3FGUA 5F1XA 3D2EA 2PYLA 1NKCA 3ZSQA 1NGIA 1GOBA 3SZ2A 4DSLA 2A40A 3V9WA 3H3OB 3JXUA 3L2RA 4CW7B 5C2FA 5FPDA 4IDKA 2VWKA 3J7YP 4X65K 4WQ4C 4FM1A 1VSHA 3DLHA 3CF5L 2A1RA 2FXUA 4CJEA 5E26A 4BRQA 3DMJA 4F3OA 3NVKA 2WC9A 3AVJA 4J8FA 3OY9A 3THYA 1NMDA 4AHSA 1GOCA 1VAZA 2HHSA 3CJ1A 4C8MA 2HVIA 3HP9A 3LM9A 3O9TA 4EP4A 3DI6A 4X64K 3I8DA 4DV2K 1IH7A 4CEDA 4LFAK 1TV6A 4LH4A 5LJWA 4F9OA 3G25A 4GY2B 2E2QA 3EEQA 1DLOA 1SUQA 3LPTA 4AM6A 3L4QA 1KAZA 1RCHA 4KHWA 2IS3A 3LDPA 3O1WA 4BWJA 1Q82O 3AO4A 2E6LA 1DT9A 1FXXA 1E4GT 2P1JA 4F8RA 3TAQA 4I6MA 4CZKA 5AQMA 3CJBA 1TAQA 3HVTA 4H5NA 4MLHA 3PSFA 3VETA 4QCLA 4FWOA 2O8EB 4CI6A 5JS2A 4LY7A 2GTDA 3WXIA 1XC9A 3VGKA 1JLCA 4BE0A 4E7IA 4KV8A 2BUPA 4CZFA 4CJ3A 3PX0A 3ZT1A 2Z1IA 3T1AA 3S41A 2X6NA 1SL1A 2F8TA 5GIOA 4PKGA 1N8RO 1Q8IA 5HRPA 3AVLA 3R9PA 4AQYK 4LF4K 1MU2A 4O8UA 1TUUA 3V81A 2J4RA 3LANA 3CD6N 3SMSA 3AO3A 5DK5A 1NGBA 4DFPA 5HROA 4FJMA 3BZKA 3U6FA 3TI0A 3D7EO 4CGFA 2WBNA 4JRQA 3B8AX 4K8ZA 1HNIA 2ETJA 4LF5K 3ZSWA 4MFBA 4CBWA 3ZX0A 3DJCA 4A61A 4NYNA 3TSPA 4PL7A 1UA1A 3AVGA 3PO4A 2NNWA 4I6MB 3NF9A 3I56N 4ELUA 2D0AA 2P9SB 5BR8K 1RT2A 1VSLA 2HBKA 2YNFA 2E4LA 2VWBA 5FROA 2B6AA 3HZ6A 2DY4A 1R59O 4CJ7A 5FPMA 1BO5O 3H46O 1BDGA 3D45A 1NKEA 3M3ZA 1OH5A 1NBWA 2KFNA 3VPZA 1SL0A 1FW6A 4JV5K 3HP6A 4NCBA 3PY8A 4CHZA 3DAWA 5KQ8A 2IVOA 1EO1A 2FBXA 5SWMA 3JAMO 4JLHA 3LWLA 4FJ5A 2GBZA 3O1BA 4BRMA 1P8ZA 3WXJA 3I0SA 3TPQA 1QVFM 5AFUA 2HF3A 3NF6A 4M7YA 5T7BA 3THWA 2E5LK 2OPSA 5TKWA 3HTVA 1K6YA 3RR7A 4FJ8A 1J53A 4EAHD 4N76A 1BOTO 3HXMA 4JAXA 1Q86O 3KHYA 4BG8A 1S6PA 3D6RA 4CF2A 3BF3A 1NJWA 4KI4A 1NLVA 3C7NB 1U2VA 2F4VK 3IMXA 5FPNA 1N34K 3O80A 2P9IB 3T1HK 4HTLA 2XRIA 4Z4FA 2UXBK 5AQGA 4EIAA 3KJVA 3L4IA 3RSEA 4KHSA 1RTIA 2QEXN 1IKWA 4FJXA 2GV9A 2VGNA 4RW9A 2ZE2A 5AQNA 1ZBUA 3CYMA 4KHYA 3E66A 3I8BA 4CFBA 1N36K 4CGGA 1WSHA 2NZTA 4KFBA 2CH5A 3M8PA 1CLQA 3HI0A 1KLNA 4W5RA 5LMNK 1KRPA 3WNHA 3AVHA 4DU1A 4CGDA 4BDPA 1K8KB 3LALA 4E19A 4KH6A 3LPUA 4ZHRA 4H0XB 1LCUA 1EXQA 2FF3B 2P5GA 3T3FA 2D0BA 2W42A 5CYMA 1HYSA 1L3SA 2NRRA 2A5XA 1KXPA 4JI0K 1B9DA 3OS2A 1GOAA 4JN4A 1W7AA 2ZGYA 4DQPA 3A5NC 2Q97A 1BISA 1X9JA 3SUQA 4EHUA 4OLBA 4DUZK 3EE9A 4CF9A 5J1EA 1N33K 3ENBA 2PY5A 4JK9A 4UQGA 1QQNA 4B1ZA 3C95A 3NH0A 2HF4A 4QS7A 1NK8A 4M3XA 4Z4HA 4FYDA 1JCEA 3KLGA 4CIGA 3CG7A 4JS4A 1ZBSA 3OJSA 2VWJA 4RCHA 3VQCA 4WFNL 3TWHA 3LDOA 5CZ2A 1JLAA 5FLXO 4DTPA 3VESA 1M90O 3FZKA 2YKMA 3DLGA 4CBUA 4YHHK 3QEWA 3K5NA 3HT3A 5BPLA 3KK2A 1NGDA 3QDKA 4WQ5C 1OH7A 4PHTX 2HBLA 5JLHA 1GLFO 1OKJA 1Z25A 3RR8A 4B3RK 4Z4CA 3MAQA 4JKGA 1HNXK 4CEFA 4K0KK 1OVYA 4BWMA 1BA0A 4H4OA 4H0PA 1T3VA 4I7FA 4CGHA 3MN9A 2YX6A 3CC4N 4DQQA 2F7TA 4AH9A 4EHTA 3V9ZA 5CY4A 5AZJB 2RKIA 3PX6A 2UXCK 3E9OA 4ILGB 3DRPA 3E01A 1CZAN 3P39A 3UKRB 3KK3A 3QERA 2NRHA 1E4FT 3M5RA 5E84A 4YDUA 3VQDA 3DRRA 4CJ4A 3TANA 3CCVN 2E2PA 3U3GA 1SS6A 1BA1A 4OPAA 2E2NA 3O5BA 3PUFA 4FJKA 1BL3A 3NH2A 4IJAA 1NJYA 4HHTA 4FZYA 4K25A 4A2AA 2HVHA 3CERA 3DLKA 3IUCA 3UKRA 2NRXA 1D9DA 3SJHA 3EZ5A 4FWSA 3QMLA 4B1XB 3CMEN 1HX1A 3OYBA 3NCIA 3RRHA 2X74A 2HBMA 4BGBA 1TUYA 3PIPL 1EX4A 5AQZA 3PO5A 3ZT3A 4FVUA 1X9MA 1P90A 4DU3A 4LFCK 3HM8A 2ZGZA 4EZ9A 2A41A 1N32K 4CZIA 1NK4A 4FWLA 5GINA 4CEZA 2D0PA 3CM5A 1C0TA 3HPGA 1NM1A 3E9LA 2PAVA 3KD1E 3M1FA 4WFAL 1GLDG 2Y1IA 3DXKB 1W0HA 1S5JA 2Q2RA 4DTJA 4ZTFA 1KC8O 5AQJA 1DGKN 3MX5A 3CIPA 1TK0A 4L3QA 4H0YB 3VERA 2YV0X 2P9LA 4KHQA 3VQAA 2E8AA 4CEBA 4FK0A 5C15A 1G99A 4KO0A 1Y97A 3HSTB 3CCSN 4JI7K 4OKKA 3V9XA 2YKNA 5AQWA 2O8FB 1NGEA 5AQIA 1VQPN 1J9AA 1QZ5A 4OPJA 3CCMN 1LAWA 3EO3A 3QNNA 2OCEA 5ADXA 3VGLA 4BC4A 1I3AA 2B4JA 1VQNN 4H5TA 4KBOA 5IWAK 4C8LA 3VF6A 2VG6A 3LP2A 5AQPA 2QWOA 4WCEL 4DFKA 2G8IA 2WUSA 4JI8K 3O9SA 2ITMA 3CC7N 3JS6A 1BWFO 2F9TA 3U9DA 2BDPA 2VGMA 2WTUA 4BVPA 5HOOA 4JI2K 3WXMB 3AA2A 1VQON 4BR5A 1WSIA 3DLBA 1OH8A 1VSMA 1NU0A 2QW9A 3O08A 3R3LA 2P5OA 2YHXA 2D0CA 4DLEA 2Z1GA 1QSLA 1U49A 1HJOA 2P9PB 4JI6K 1CZBA 1LWEA 5AQTA 4CCHA 1NK7A 3AA5X 4XH1A 1DTQA 1NNEA 2RHKA 4NCAA 1XMOK 1U2VB 3O9UA 3I0RA 3O3FA 1G15A 4WQ4A 2HHTA 1TL1A 4JI5K 2V7YA 4QS9A 4R79A 3CFOA 4J2EA 5AJ3K 3RRGA 2FF6A 2BH1A 3J8AA 3FZHA 1GLJO 5KGXA 2QKBA 3QB0A 4CGJA 4B9QA 4BDZA 4KTWA 3A2FA 3VTIA 3MECA 5JMVA 1TKXA 1OVQA 1KVCA 1QHAA 3GL1A 1YITN 1YTUA 1YT3A 1BGXT 5FRNA 1NGGA 2AA4A 4YFUA 4CJPA 2ZJRL 3H1QA 3MCAB 4RW6A 4ZTJA 3QEVA 4KB1A 3MXMA 4CFDA 2YNGA 2XY6A 3J7AP 3J80O 5C42A 1IKVA 3ISNC 4RW8A 3TTDA 1KD1O 1ZC6A 1XI1A 3D2FB 3OBYA 4CJWA 4H5RA 1BIUA 1NK9A 1BCOA 1WAJA 3KWIA 4ID5A 3TSQA 3HL8A 1RDCA 1BQNA 1WLJA 2O4IA 5M1KA 3CFRA 4LC9B 1VQ6N 3IKMA 1HR0K 1RT3A 3A5MC 5BREA 4IFVA 4E7HA 2NRTA 4FSVA 2QWRA 1WSJA 2P9UB 4CJTA 1T8EA 1REVA 1QS4A 3C6UA 1GLEG 4A57A 1HNZK 4AHUA 3MDQA 4B3SK 4YY3K 1NKBA 4PKHA 4WFBL 4BQLA 1IJJA 5JICA 4FJHA 2P51A 4RG8A 1U4BA 1U04A 4XEIA 3SUNA 1C6VA 3MXIA 5IT9O 4XH5A 1S6QA 4B9UA 1JLFA 3OVNA 4NXMK 4CJ5A 3ZSVA 2GX9A 5HP1A 1NMNA 2QXFA 1U48A 1RBRA 1VQLN 1Q9YA 1RT5A 5TKYA 4CJFA 2O8CB 2QWPA 3PSIA 1JLEA 4M3ZA 3UE5A 3MEDA 3VF2A 3VQ9A 4FLTA 4ILHA 1S9GA 4B08A 3TAEA 4Z94A 1RBUA 1V4TA 3VA0A 4K43A 2KZMA 1BIZA 4KHNA 4DV7K 2NRZA 4O55A 3NGZA 1KSPA 1QE1A 4JKHA 3K5LA 2DTUA 3NGIA 3ZYYX 4BRGA 1VQ8N 3LWMA 4FJJA 1JLGA 4CZHA 1K8AO 2HNYA 4CEOA 4RW4A 4FLZA 1HNVA 3SMPA 3SK3A 3CCRN 3VA3A 3ULEA 4C1NK 1JCGA 3OW2M 5K14A 1VSJA 2ATQA 1RNHA 2I5JA 3H6EA 1FKOA 3ITHA 5ELZA 3DLEA 4CBXA 5I3UA 1C0UA 4LF6K 5KI6A 3ATUA 5HBMA 4YDUC 3ZSYA 4RWTA 3FZMA 3ID6A 1KFSA 4CJUA 3RMBA 3ATVA 2QXLA 1DEJA 4HTUA 3HSCA 4ILJA 3THVA 3CCLN 1ESVA 4LF8K 3VMFB 2UU9K 2E1YA 1M1KO 3MEEA 4FOEA 3TARA 1ZXOA 5KTQA 1U47A 1VSEA 3IS9A 2FC0A 1FK9A 4FWKA 4IBNA 4ELTA 2W6LA 2A3ZA 3ZT4A 1KAYA 4Z4GA 4FO0A 4KTZA 3K5OA 3EL2A 3BZCA 3L2VA 2HBJA 1LWFA 1TYQB 3ZEUB 4BG9A 1YIJN 4H0OA 4CJKA 2P9SA 3L0QA 3DOLA 3T1YK 4Y1CA 3CC2N 1BU6O 5DM7L 3VN5A 3ZETB 3TAGA 4JD2B 1S72N 4NXNK 3ASMA 2RE2A 5J2MA 5KRTA 4TSXA 1KQSM 3ULDA 4IDHA 4FOIA 4PWDA 1S1UA 1NOZA 2GEMA 2KW4A 4FZZA 5AQXA 4LSNA 3JYTA 3A5OC 2WONA 3KD5E 1S22A 1GLCG 2O8FA 3VEOA 5CR4A 3VENA 4BREA 3FFKB 3AARA 2PZSA 3V6DA 1KVBA 3LP1A 2E1ZA 3W0LA 4M7XA 4H03B 4M3YA 4IOAL 2NRVA 2O8DB 1SKSA 2D0OA 4LFBK 3OYEA 3KZBA 1JXBA 5HL7L 3SBTA 3AO2A 3M8RA 4GNIA 4A62A 1N6QA 1C1BA 4HVJA 2Q1NA 5BN8A 1WBDA 4JI3K 3C6HA 2YI1A 5AQKA 1ITGA 1SAZA 3KKRA 4CF8A 1NWKA 1TKZA 4OLAA 2P9KA 3TTCA 1JJ2M 3K0SA 3H1VX 3AVCA 3RVCA 2D5RA 3CM6A 4E89A 1H1VA 4B1YB 2BGGA 4FJIA 4OGEA 1UA0A 1MWMA 5M1NA 3P83D 4M63C 1CZ9A 1L5UA 4K8XA 4N47A 1SKWA 3EKUA 4CJSA 2UUBK 1Z05A 3NVMA 4DTNA 4FPAA 1WSFA 4CFAA 2IOCA 4CHOA 3HK2A 3L2UA 5GAEP 2BANA 4F2RA 3C94A 3LDLA 3MN5A 1VSDA 3E9PA 4J2AA 3UKUB 3QBXA 1IBKK 1IO2A 2X6SA 1O13A 2AJQA 1K73O 1T6CA 3NH1A 4E1MA 3HYFA 5LMUK 4AILC 2KTQA 1SV5A 3CPWM 3ZT0A 5F0XA 4JEPA 3MMVA 4MDBA 1JKHA 4M41A 3OS0A 3ZSZA 1XNRK 4I2QA 4FM0A 3F5TA 1YJWN 4JKGB 4DWIA 4FPBA 4FVMA 1XMQK 4DR4K 1HPMA 5DM6L 1HUXA 4R5PA 3SYZA 4OVLA 3VF4A 1XHXA 1RT4A 5AZIA 3AGKA 1DKGD 5HRNA 2XHBA 4A59A 1S3XA 3SJJA 4OO1J 3T69A 2O8BA 4C8KA 1HJRA 3TABA 4IKFA 1ILYA 5JVHL 4CHPA 4FJLA 1S9EA 2P9PA 3B6PA 4KTQA 2VCPA 3KK7A 3IDHA 4E3SA 1T03A 4O44A 1C0GA 3U4LA 3CFPA 4CD1A 4CE9A 3WQTA 1E3MA 4M3TA 4I9LA 1IV0A 4CZEA 3S3OA 1ATSA 2YJFA 3HVRA 5C24A 3M8SA 3DXMB 5CE3A 4CJVA 4DHYA 2PBDA 2XO7A 1ASWA 3VQPA 4OGCA 4B9NA 4OKEA 2W40A 2BE2A 4FW2A 3DOKA 3LP0A 1NK0A 3BY5A 5B8HA 3DRSA 2ZD1A 3DWLA 4DV0K 4DSJA 3NHGA 2LSNA 4JRPA 4W5TA 3LZIA 4HCCA 4OPHA 1K9MO 3K9JA 4DSEA 4IEIA 3VEYA 5KGWA 4GVEA 2QA4N 1C0MA 3DXMA 4AHVA 3O4QA 2RF2A 4CHQA 1NGHA 2HHUA 4Y1DA 5JVGL 2HMPA 3U9ZA 1KLMA 5M1PA 3O9RA 2QWNA 4FLYA 3U8XA 2HMIA 1XC3A 4GV6A 3K9KA 3ZEUA 1TYQA 5HRRA 1VQ7N 1IG8A 4BE1A 3KIOA 1ZBFA 3HBTA 5AZIB 1L3TA 3LAMA 3FZLA 3SQ2A 3V1QA 3EN9A 4FWMA 3LM2A 3S3NA 3V1OA 2I7PA 3L2WA 3VQQA 3QO9A 1A5VA 4DR6K 3BEXA 4BRNA 3OYMA 3LL3A 2NLXA 4DU4A 3SQ1A 4JKFA 1YHQN 5F2RA 4DR3K 3KKSA 4CESA 3J7ZO 3UIQA 2XY5A 2HNDA 5LL6Z 4I9QA 3GDQA 2KHOA 4ID1A 3ZCMA 4DQRA 3O4WA 1N5YA 3VOVA 1X3MA 3KWGA 2GUPA 4NO7A 3VEXA 2DPNA 4CHYA 3H3NO 4KAZA 4CHNA 3RMAA 4DV5K 4DTMA 3OBWA 3SPZA 3G4SN 3O4NA 2Q0UA 3BGRA 4CK3A 2CGLA 3AV9A 4H0TB 4FJ7A 2AP1A 5AQUA 3FZFA 4FJGA 4W5NA 1HMVA 4IXCA 3GG4A 2O4GA 1KAXA 2JGUA 3K2PA 4O0JA 4K42A 5HRSA 1NK5A 1WUAA 4DR1K 3T19A 2IVNA 1J6ZA 1RBSA 2IC3A 3ZT2A 4Z4IA 1J5EK 1CXUA 3TR8A 5BN9A 1VQKN 4QOZB 3AAQA 3ZSXA 4DLGA 1NK6A 3EE8A 5EXWA 1B92A 4DV6K 4C8OA 5AZJA 3NMUA 3OYGA 4DQSA 2B5JA 1NG9A 4O5FA 3MN6A 2VG5A 5FPEA 4IFYA 4QAGA 3TAMA 3IG1A 2BTFA 4BC3A 2QWQA 1VSIA 4X62K 1BI4A 3SAFA 1ASUA 5KPRA 3RWUA 3WQUA 1TVRA 1GLBG 1RT1A 3VQ5A 4FL9A 3OYIA 3AVBA 4HUEA 4MO4A 4BRLA 4U7BA 1YI2N 1HKBA 3DLLL 2UUAK 1JL2A 3O3HA 1VSKA 1JL1A 4B3MK 1XWLA 5AQVA 5AFUH 4FJNA 2OPRA 4N41A 2OYQA 4CZJA 2FBVA 4PQUA 1HPZA 3L6QA 4CFCA 5FRMA 1D8YA 4CK2A 4AHCA 1VQ9N 4ISGA 1RT7A 2ASOA 4GKKK 4X66K 2O8BB 2CGJA 4BRIA 4CVNE 4O4GA 4GW6A 4WYBA 4E1NA 4IO8A 1MA9B 2QKKA 3P31A 4Z0UA 2JWKA 4W5OA 2KFZA 2HSTA 3AVFA 3Q7CA 4C1NI 3O3GA 5AR0A 3HPOA 3SAHA 2RN2A 1RDWX 4DSKA 2ZM6K 4E7JA 2A42A 2QWLA 3MWTA 2D1KA 3DYAA 4CF0A 1KVAA 4PA1A 3QFUA 4DSIA 4B1WB 4OKJA 4BR9A 4HWIA 4DR7K 3GBTA 3SLCA 1Z26A 3NAEA 1WBBA 4JKBA 4NLCA 2HB5A 4M3UA 3NFAA 3M6GA 5CHIA 2HHQA 4AHRA 3OYCA 1IBMK 5AQSA 4FZXC 3K5MA 4YOUA 4M3RA 4YOWA 3MWPA 5CYQA 4N5SA 3OHRA 5LY3A 1VQ4N 1X9WA 4BRPA 5M1QA 1UAXA 4DV3K 4B3TK 5M1OA 4GMJB 2ZQBA 4DTUA 4H4MA 1QSYA 1IG9A 4DF4A 3SBGA 3NF7A 4BC5A 2I7NA 3WEEB 3M8QA 2OZSA 4DS5A 3KLHA 2QK9A 2FSNA 4C23A 3KTQA 1J54A 1T6DA 3CJCA 5LJVA 1NGJA 3CCEN 2P9KB 2XY7A 1WN7A 4DV4K 3AO1A 3HO1A 1RDAA 5AQFA 3CXCM 1Y64A 4Y0WA 4CJLA 2JLEA 4FWQA 4KH4A 4FWRA 1NGCA 2YCHA 4KI6A 2ZWHA 1BCMA 3BUZB 3NGYA 1DTTA 2DFFA 3J81O 1B9FA 2O8DA 1HRHA 1EP4A 1YF5L 5AQQA 1LW0A 3CJAA 3ZX2A 1ZBHA 2IGIA 3DLRA 3P38A 4IWVA 5EU7A 1QTMA 4CEAA 4WQ5A 2UXDK 1VSFA 4Q5VA 3OTOK 4MLEA 3MK6A 3CQXA 3ZSOA 2A6AA 4GKJK 3FFIA 4MDAA 1BQMA 3OS1A 3AO5A 3LP3A 1A5XA 3F2KA 4WF9L 1HKCA 3G0ZA 2Y1JA 1LOTB 4RTFD 3EY1A 2XY8A 5E41A 4DSFA 4JD2A 3PIOL 4H0VB 2OANA 4DQIA 3KLFA 5AQLA 3ZETA 3H45C 5GAGP 4FLVA 4O8KA 3T7ZA 4FLUA 1S1XA 2P9LB 3OYFA 3K58A 1RILA 4O5BA 3SCXA 4BRHA 5BR9A 1WB9A 1ATNA 4IOCL 1Q7YO 3TU5A 4FK4A 4BRCA 2HHVA 2QWMA 3V9UA 3K59A 3DXKA 3W3DA 4A2BA 1YVUA 1C1CA 3CQ8A 4FXDA 4H5VA 2F96A 3C6AA 4XH4A 5CZ1A 3DM2A 2KZZA 2DFHA 1YAGA 4LH5A 2VYPA 5KQDA 4HUFA 2UYTA 1RBTA 3GOIA 3OYHA 2HHWA 1Q18A 2Q31A 1MWKA 3A0IX 3AVMA 3L3UA 1C1AA 1RTHA 1X1PA 2Q3SA 4BR4A 5C12A 1QQCA 1KFDA 4YORA 1TK8A 4I2PA 3V4IA 2P9IA 4FK2A 3O6WA 4B3OA 2A1SA 3HPHA 1Z6RA 3VQ6A 1X9SA 4IG0A 2O8EA 3VQ4A 1HKGA 3ULEB 4CK1A 3PX4A 2HHHK 3OYNA 2Q36A 1TK5A 3AA3A 3THWB 3HOTA 3BF1A 1S1TA 2NUBA 3NBPA 4KRFA 4CZGA 4BRFA 4DS4A 3SQ0A 4CERA 3QIOA 4CZMA 5AQOA 2W6KA 2F8SA 3P1GA 5JLFA 1RT6A 3KLEA 5BPNA 1EWQA 1ZBLA 4F3TA 2YHBA 5H1SQ 1MDUB 1QSSA 2OPPA 1VK0A 3F9MA 3Q7BA 3LDNA 3QIPA 3I55N 1F21A 4DTOA 3S9HA 3WNFA 3MN7A 3VEWA 2E88A 3MEGA 3CJ9A 2IVPA 3RTVA 2F9WA 5FDLA 4B9TA 1HQEA 2CH6A 3N4PA 2Z1JA 3TSUA 4JHDA 4YOXA 4FLWA 3HM9A 3NF8A 2VQFK 4BR2A 3ENHA 1WAFA 4IJNA 4B9LA 2VG7A 3SUPA 4CD3A 1UWBA 4FWPA 1R0AA 4IOXA 1J5OA 3U3YA 3HJFA 3C65A 3D2EB 1V4SA 3AY9A 3KK1A 4L8RB 1T44A 4BE2A 2FSKA 3ALYA 2Q0RA 3FE1A 4B9VA 2V7ZA 3QEPA 1VRTA 3VQEA 4BR7A 3TAFA 4BDYA 1SQKA 4BRKA 4C8NA 4FLXA 1LWCA 1C0FA 2VQEK 4DR2K 1SKRA 4OJRA 2GWJA 1Q81O 4A5BA 4DKWA 1TGOA 3TAPA 3I33A 5I42A 2RPIA 3D2FA 3IAYA 3P4IA 3FR0A 3PLAA 1D4XA 3ZSRA 2FBTA 4K41A 4E7KA 1TAUA 4KREA 1RTJA 4Z4EA 4JYAK 1JXEA 3IRXA 3QLHA 4MO5A 1BHLA 4LSLA 1YVNA 3LZJA 1VQMN 4BR0A 1Q9XA 3QESA 4JKEA 1S1WA 5BRDA 1EWRA 1I94K 3SI6A 1YXQA 3UB5A 3NDKA 2YJEA 3PV8A 4DQ8A 3SV4A 4JHDB 4LD0A 5KRSA 4J2BA 4BRAA 4DB3A 4KHUA 4M45A 5KPTA 3L8BA 1XQSC 1JLQA 2ASMA 3WT0A
chains in the Genus database with same CATH topology
1NGFA 2Q0UA 4A61A 4BC2A 3FLCO 4LC9B 1VQ6N 3TSPA 3WXLA 2PFUA 2CGLA 3IKMA 4H0TB 2QM1A 4PL7A 5EOYA 3A5MC 1SZ2A 2AP1A 5AQUA 4YOVA 3FZFA 4JNEA 5BREA 1K8KA 2E20A 2NNWA 1BG3A 4IXCA 3GG4A 4I6MB 3I56N 1KAXA 2NRTA 3WUHA 1EQYA 2P9SB 4FSVA 4ISFA 2HBKA 4K42A 2QWRA 2VWBA 2P9UB 4BQZA 3WEEA 1GLEG 4E1JA 4A57A 3C0BA 1WUAA 3HZ6A 3UKUA 3MDQA 1R59O 2IVNA 1J6ZA 5FPMA 4CJ7A 1QVGM 4GV3A 2OTJN 1BO5O 2GWKA 3H46O 1BDGA 4NB4A 4PKHA 4B1VA 1RDUA 4WFBL 4BQLA 1IJJA 5BN9A 5JICA 1VQKN 3AAQA 3M3ZA 3EE8A 4XEIA 5EXWA 1NBWA 5AZJA 3VPZA 3NMUA 2OTLN 1GLLO 3AAPA 4XH5A 4A5AA 3DAWA 4O5FA 5KQ8A 3MN6A 2GX9A 2IVOA 5FPEA 1EO1A 5C10A 3N4QA 2BTFA 4BC3A 2QWQA 3O1BA 4BRMA 1VQLN 1P8ZA 2V51B 3WXJA 3SAFA 5TKYA 3TPQA 4H5WA 4BY9C 2QWPA 5AFUA 5KPRA 1QVFM 5EVZA 3CPEA 3WQUA 3UE5A 3TTFA 3VF2A 1GLBG 2HF3A 3CHWA 4ILHA 5KPZA 5AQHA 4FL9A 4M7YA 4Z94A 1V4TA 2V52B 4MO4A 4BRLA 4U7BA 5TKWA 1YI2N 1HKBA 3HTVA 3DLLL 4K43A 4EAHD 1BOTO 1U6ZA 4JAXA 2KLAA 1Q86O 3KHYA 4BG8A 3CETA 3VEVA 2NRZA 5GIPA 3OA9A 5AQVA 5AFUH 3D6RA 3BF3A 4IFEA 1NLVA 3C7NB 1U2VA 4CZJA 3IMXA 4JKHA 5FPNA 3O80A 2P9IB 3ZYYX 4BRGA 4JKDA 4HTLA 3L6QA 5C2DA 1VQ8N 4JKAA 1VQ9N 4ISGA 3AGRA 2ASOA 5AQGA 4EIAA 1BUPA 2P9NA 4CZHA 1K8AO 3L4IA 3RSEA 2CGJA 4BRIA 3CCQN 2QEXN 3SMPA 3SK3A 3CCRN 4WYBA 2VGNA 3ULEA 4C1NK 1JCGA 3ID8A 2W41A 4IO8A 5AQNA 4IO9L 3OW2M 3A5LC 1MA9B 3E66A 3H6EA 4AM7A 3P31A 3I8BA 2JWKA 5ELZA 2HSTA 4NLBA 4CBXA 2NZTA 2QI2A 3G6EN 3Q7CA 4C1NI 2CH5A 3HI0A 5AR0A 3SAHA 5GADP 2WFBA 1RDWX 4B1UB 2A42A 3ATUA 2QWLA 3MWTA 3QICA 4JKCA 2D1KA 3CMAN 3QFUA 4YDUC 4B1WB 4BR9A 4HWIA 4RWTA 3GBTA 3FZMA 1K8KB 3SLCA 3ID6A 4YOYA 2ZJPL 1WOQA 3ATVA 2FSJA 2QXLA 1DEJA 4JKBA 4KH6A 4NLCA 3HSCA 4H0XB 4ILJA 3CCLN 1ESVA 1YJ9N 3M6GA 5CHIA 3VMFB 1LCUA 3SAGA 2FF3B 2E1YA 1M1KO 4FOEA 2GELA 1ZXOA 5AQSA 3G71N 5EX5A 4YOUA 4UY8O 3EKSA 2NRRA 1W97L 4YOWA 3MWPA 1VQ4N 3OHRA 5LY3A 4FWNA 2A5XA 3E1YA 4AF1A 1KXPA 4BRPA 5M1QA 2YHWA 4FWKA 4PKIA 2ZF5O 4JN4A 2A3ZA 2H3GX 2ZGYA 3A5NC 5M1OA 1KAYA 2Q97A 4FO0A 1X9JA 4G9ZA 3EL2A 3SBGA 4BRDA 4EHUA 2HBJA 2P9NB 4BC5A 2I7NA 3EE9A 3WXKA 1TYQB 3WEEB 3ZEUB 1QZ6A 4BG9A 4H0OA 1YIJN 3ENBA 2P9SA 3L0QA 3CC2N 1BU6O 2FSNA 4C23A 4JK9A 5DM7L 1QQNA 4B1ZA 3CCJN 1T6DA 3ZETB 3CJCA 5LJVA 1NGJA 3RSEB 3CCEN 2HF4A 4EFHA 4QS7A 2P9KB 4JD2B 1S72N 1JCEA 2RE2A 3VEZA 1KQSM 4JK8A 5AQFA 3CXCM 1QQOA 1ZBSA 1Y64A 4IDHA 4RCHA 4Y0WA 4FOIA 3VTHA 3LDOA 4WFNL 3VESA 3IFRA 2GEMA 3FZKA 1M90O 3MX2A 4FWQA 5MLCQ 4CBUA 5AQXA 4KH4A 3C7NA 5BPLA 3A5OC 4FWRA 3R8EA 1NGDA 1NGCA 2YCHA 3QDKA 4WQ5C 1S22A 1GLCG 4PHTX 2HBLA 5CR4A 3VEOA 2ZWHA 3VENA 4BREA 5JLHA 4GV9A 1GLFO 3ZX3A 1OKJA 3FFKB 3BUZB 3HRGA 2JWLA 3AARA 4JKGA 5AQYA 5BRHA 5ADXH 5BRFA 4JK7A 4BGAA 4U67L 1OVYA 2E2OA 1BA0A 1YUWA 5BPMA 4H0PA 1T3VA 5AQQA 1YF5L 3ZX2A 1HLUA 3CJAA 2E1ZA 3W0LA 4M7XA 3P38A 4H03B 4IWVA 2KKZA 3MN9A 4IOAL 2YX6A 2NRVA 2D0OA 3CC4N 2F7TA 3R6MA 4WQ5A 1RFQA 4EHTA 1JCFA 3KZBA 1GLAG 4MLEA 3BP8A 5HL7L 3MK6A 3CQXA 5AZJB 3SBTA 2A6AA 5AQRA 2YHYA 3E9OA 4ILGB 4BVOA 4MDAA 4GNIA 4QS8A 4A62A 3O9QA 1CZAN 3MCPA 4YOTA 3P39A 3UKRB 4PL8A 3QBWA 2NRHA 1E4FT 2Q1NA 3M5RA 5E84A 4YDUA 5BN8A 3F2KA 4WF9L 3C6HA 2YI1A 5AQKA 1HKCA 1VQ5N 1SAZA 1LOTB 4ISEA 4RTFD 3CCVN 1NWKA 2E2PA 1SS6A 1BA1A 2P9KA 2E2NA 3O5BA 4JD2A 4H0VB 4OPAA 2CGKA 2OANA 3TTCA 3PIOL 1JJ2M 5AQLA 5I9EB 3ZETA 3R1XA 3CI5A 3H45C 4IJAA 2QTDA 3H1VX 5GAGP 4O8KA 3T7ZA 3QFPA 4K25A 2P9LB 3RVCA 3CQYA 4A2AA 3HOSA 1H1VA 4BRHA 4B1YB 5BR9A 1ATNA 4IOCL 3CERA 1MWMA 3GE1A 3TU5A 1Q7YO 5M1NA 5M1FA 4M63C 1XUPO 3IUCA 3UKRA 2QWMA 2NRXA 3EKUA 4BRCA 3SJHA 1Z05A 4FWSA 2FLOA 3NVMA 4IZ9A 4FPAA 3DXKA 1QQMA 3QMLA 1X3NA 3W3DA 4A2BA 4B1XB 4CZLA 3CMEN 2EWSA 1HX1A 2NRWA 5GAEP 4H5VA 3LDLA 3C6AA 4XH4A 3MN5A 2HBMA 4BGBA 2ZJQL 3E9PA 3UKUB 1YAGA 3QBXA 1TUYA 3KVGA 3O8MA 1O13A 5AQZA 2VYPA 1RGIA 3PIPL 1K73O 2P9UA 1T6CA 2UYTA 5KQDA 3GOIA 4FVUA 1P90A 5EY4A 4DCHA 4IEEA 3HM8A 3CPWM 1Q18A 2Q31A 1MWKA 3A0IX 2ZGZA 5F0XA 5GAHP 4JEPA 4KH5A 2A41A 4CZIA 3MMVA 4MDBA 3LDQA 4BR4A 1NJIO 4FWLA 5GINA 5C12A 2D0PA 4YORA 1NM1A 1NGAA 3A8YA 1W2BM 3E9LA 2PAVA 2IIRA 3EZWA 2P9IA 3F5TA 3ENOA 3M1FA 3O6WA 3VGMA 1YJWN 4JKGB 4WFAL 1GLDG 4FPBA 1ATRA 1Z6RA 5C0YA 3CJ7A 3DXKB 1HPMA 5DM6L 1HUXA 1HKGA 3VF4A 3ULEB 2Q2RA 1KC8O 5AQJA 1DGKN 2Q36A 3MX5A 3AGKA 5AZIA 1DKGD 3CIPA 4A59A 2ASPA 1S3XA 4OO1J 3T69A 1YJNN 3HOTA 4L3QA 1ILYA 2HOEA 3BF1A 4H0YB 3VERA 5JVHL 3CCUN 2P9LA 2P9PA 4BRFA 2E8AA 4CZGA 2D4WA 4BROA 3FGUA 1G99A 3D2EA 5C15A 5F1XA 2VCPA 3KK7A 3IDHA 3CCSN 4CZMA 5AQOA 1NGIA 1C0GA 3U4LA 5AQWA 5JLFA 2A40A 4CD1A 3WQTA 3H3OB 1NGEA 3JXUA 5BPNA 5AQIA 1VQPN 1QZ5A 4CZEA 5C2FA 3CCMN 5FPDA 1ATSA 3EO3A 4WQ4C 2YJFA 5H1SQ 3CF5L 3DXMB 1MDUB 5CE3A 5ADXA 2FXUA 3VGLA 4DHYA 5E26A 4BC4A 2PBDA 4BRQA 3F9MA 3NVKA 2WC9A 3Q7BA 3LDNA 1VQNN 4H5TA 4KBOA 4J8FA 1NMDA 3VF6A 3I55N 1VAZA 5AQPA 2QWOA 4WCEL 2W40A 2WUSA 3MN7A 3CJ1A 3O9SA 2ITMA 3VEWA 3CC7N 2E88A 5B8HA 3CJ9A 2IVPA 3JS6A 3DWLA 1BWFO 3LM9A 2F9WA 2F9TA 3O9TA 3U9DA 2VGMA 2CH6A 4BVPA 5HOOA 3N4PA 3WXMB 1VQON 4OPHA 5LJWA 1K9MO 3K9JA 4JHDA 3TSUA 4BR5A 4IEIA 3G25A 3VEYA 4F9OA 4GY2B 2E2QA 4YOXA 4BR2A 3ENHA 2QW9A 4IJNA 3O08A 3R3LA 4GVEA 2QA4N 2YHXA 4AM6A 4CD3A 3L4QA 1KAZA 4FWPA 3DXMA 4IOXA 3C65A 3LDPA 3O1WA 1Q82O 3D2EB 1V4SA 1HJOA 3AY9A 1DT9A 1NGHA 1T44A 2P9PB 2FSKA 1E4GT 5JVGL 2HMPA 3U9ZA 5AQTA 5M1PA 4I6MA 4CZKA 4XH1A 2Q0RA 2RHKA 3FE1A 2QWNA 3CJBA 3O9RA 5AQMA 2V7ZA 4H5NA 1U2VB 4MLHA 3U8XA 4BR7A 1XC3A 3VETA 1SQKA 3O9UA 4FWOA 4BRKA 3K9KA 4CI6A 4GV6A 4WQ4A 3ZEUA 1C0FA 1TYQA 2GTDA 2V7YA 4QS9A 3WXIA 4R79A 1VQ7N 1IG8A 2GWJA 3VGKA 1Q81O 4A5BA 2FF6A 2BH1A 4DKWA 3J8AA 3HBTA 3FZHA 3I33A 1GLJO 5AZIB 4CZFA 2BUPA 3D2FA 3FZLA 3QB0A 3P4IA 3EN9A 3FR0A 4FWMA 3LM2A 3PLAA 1D4XA 4K41A 3S41A 4B9QA 2I7PA 3VTIA 5GIOA 4PKGA 5JMVA 1N8RO 3BEXA 4BRNA 1QHAA 3GL1A 3R9PA 1YITN 4MO5A 1NGGA 4O8UA 1TUUA 1YVNA 2AA4A 2J4RA 3LL3A 2NLXA 3CD6N 3SMSA 2ZJRL 3H1QA 1VQMN 3MCAB 1NGBA 1YHQN 4JKFA 4BR0A 4JKEA 5F2RA 5BRDA 3J7ZO 1YXQA 3UB5A 3D7EO 2YJEA 3GDQA 2WBNA 2KHOA 3B8AX 4DQ8A 1KD1O 3O4WA 3TTDA 1ZC6A 4JHDB 3D2FB 3OBYA 4H5RA 3VOVA 4BRAA 1X3MA 4DB3A 3KWGA 2GUPA 4NO7A 4CBWA 3ZX0A 5KPTA 3KWIA 3TSQA 2DPNA 3VEXA 3DJCA 3H3NO 1XQSC 2ASMA 3OBWA 3WT0A 3G4SN 5M1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE8 A;  2KKZ A;  3L4Q A;  4OPA A;  3F5T A;  3O9S A;  3EE9 A;  3RVC A;  2GX9 A;  3OA9 A;  3O9T A;  3P31 A;  3D6R A;  3O9Q A;  2RHK A;  3P39 A;  3O9R A;  3KWG A;  3M5R A;  4OPH A;  3KWI A;  3O9U A;  3P38 A; 
#chains in the Genus database with same CATH topology
 1I39 A;  1NGF A;  3RMD A;  4BC2 A;  3FLC O;  3WXL A;  2PFU A;  2QM1 A;  5EOY A;  1VHX A;  1SZ2 A;  4YOV A;  4JNE A;  3VQ7 A;  4E0D A;  1K8K A;  2E20 A;  1BG3 A;  4DTX A;  3WUH A;  1T05 A;  1EQY A;  4ISF A;  4BQZ A;  2G8K A;  3WEE A;  4JI4 K;  4E1J A;  3C0B A;  3UKU A;  1FJG K;  4DMN A;  4GV3 A;  1QVG M;  2OTJ N;  1LAV A;  2GWK A;  4NB4 A;  4B1V A;  1RDU A;  1S1V A;  4DF8 A;  3V1R A;  4DV1 K;  3QIN A;  2G8V A;  3B6O A;  1HQU A;  2IAJ A;  4F4K A;  1ZBI A;  2OTL N;  1RDB A;  1GLL O;  3AAP A;  4A5A A;  4ICL A;  4NCG A;  3F73 A;  3EYZ A;  3WNG A;  5C10 A;  4ELV A;  3N4Q A;  3OYL A;  3BDP A;  3OYJ A;  2V51 B;  4BY9 C;  2OPQ A;  4H5W A;  3QEI A;  5EVZ A;  3CPE A;  3JSM A;  3TTF A;  3CHW A;  5KPZ A;  5AQH A;  1LW2 A;  3H08 A;  4FM2 A;  5A2Q O;  1KTQ A;  2V52 B;  1KCF A;  1WSG A;  4KKO A;  3AVN A;  4N56 A;  4HUG A;  1U6Z A;  2KLA A;  3CET A;  4B8A B;  3VEV A;  5GIP A;  3MXJ A;  3OA9 A;  4M3W A;  1W9H A;  4B8C A;  4IFE A;  1YTA A;  4JKD A;  5C2D A;  1HYV A;  4JKA A;  2G8W A;  4DTS A;  4FW1 A;  3AGR A;  4NYF A;  1BUP A;  2P9N A;  2O8C A;  1TKT A;  1IKY A;  4DFM A;  3SQ4 A;  3CCQ N;  1TL3 A;  4W5Q A;  1L3V A;  4IO9 L;  3ID8 A;  2W41 A;  3A5L C;  3C6T A;  4DUY K;  4AM7 A;  3LDS A;  4NLB A;  5SZT A;  2QI2 A;  3G6E N;  3AVI A;  4B9M A;  5GAD P;  2WFB A;  4RW7 A;  4B1U B;  3LAK A;  3QIC A;  4JKC A;  3CMA N;  4IG3 A;  4B9S A;  1RBV A;  4OX9 K;  4YOY A;  2ZJP L;  1WOQ A;  4CGI A;  2UUC K;  2FSJ A;  1BI4 B;  5C25 A;  4HCB A;  1YJ9 N;  3SAG A;  4MQ3 A;  4PUO A;  2GEL A;  3G71 N;  2DFE A;  2IDO A;  3RMC A;  1VRU A;  5EX5 A;  4UY8 O;  1EET A;  2WOM A;  3EKS A;  1W97 L;  4FJ9 A;  3D0P A;  4FWN A;  1FKP A;  3E1Y A;  2X78 A;  2FBY A;  4AF1 A;  1ASV A;  2EHG A;  2YHW A;  4PKI A;  2ZF5 O;  2H3G X;  4H8K A;  5J2N A;  4CJR A;  1EKE A;  3NE6 A;  4CEE A;  4G9Z A;  3QEX A;  4BRD A;  4JI1 K;  2P9N B;  2G8F A;  3WXK A;  1QZ6 A;  3OYA A;  3OJU A;  1NJX A;  3CCJ N;  3RSE B;  4EFH A;  3ZLJ A;  4XIU A;  3THX B;  4CIF A;  3VEZ A;  3SPY A;  3G10 A;  4JK8 A;  1QQO A;  2KQ2 A;  4DTR A;  3VTH A;  2HHX A;  4E7L A;  3OYD A;  4KB0 A;  3IFR A;  2OZM A;  3MX2 A;  5MLC Q;  2HNZ A;  3C7N A;  3F9K A;  3R8E A;  2Z1H A;  1CXQ A;  4GV9 A;  1T7P A;  4OPK A;  3ZX3 A;  3SNN A;  2R7Y A;  3HRG A;  2JWL A;  5AQY A;  5BRH A;  4GVM A;  5ADX H;  5BRF A;  5JS1 A;  4JK7 A;  4BGA A;  4U67 L;  2HW3 A;  2E2O A;  1YUW A;  5BPM A;  1HNW K;  1HLU A;  1NJZ A;  1HYZ A;  2KKZ A;  4CEC A;  3THX A;  4DR5 K;  3R6M A;  1RFQ A;  1JCF A;  1D5A A;  1GLA G;  4CEQ A;  3THY B;  4G1Q A;  3BP8 A;  4Q0B A;  2EX3 A;  2YNH A;  1OH6 A;  5AQR A;  2YHY A;  4AHT A;  4BVO A;  3SV3 A;  4QS8 A;  3O9Q A;  4LF9 K;  4LF7 K;  3MCP A;  4YOT A;  2G8H A;  4PL8 A;  3QBW A;  3WNE A;  4O0I A;  4YNQ A;  1VQ5 N;  1A5W A;  4ISE A;  3V9S A;  1WNS A;  2YNI A;  3OYK A;  4V19 S;  3AA4 A;  1RTD A;  2CGK A;  1SL2 A;  4EZ6 A;  5I9E B;  4FCY A;  2G8U A;  3R1X A;  3CI5 A;  4CIE A;  2QTD A;  3QFP A;  3CQY A;  3VQ8 A;  3QET A;  3QNO A;  3HOS A;  4DFJ A;  2E6M A;  5J2Q A;  3GE1 A;  5HLF A;  5M1F A;  1XUP O;  4PY5 A;  2FLO A;  4IZ9 A;  1QQM A;  1X3N A;  5DMR A;  4CZL A;  2EWS A;  4CJQ A;  2NRW A;  4CF1 A;  4DG1 A;  4BAC A;  3S3M A;  1UOC A;  4J2D A;  2ZJQ L;  3KVG A;  3O8M A;  1RGI A;  2P9U A;  3AVK A;  1NOY A;  2ITG A;  2OA8 A;  5EY4 A;  5J2P A;  3AVA A;  4DCH A;  4IEE A;  2PYJ A;  4EP5 A;  4KPY A;  5GAH P;  2YHA A;  4KH5 A;  3LDQ A;  3P5J A;  1NJI O;  3SUO A;  1O1W A;  3KLI A;  3VQB A;  1IKX A;  1JLB A;  1U45 A;  1NGA A;  3A8Y A;  1W2B M;  1D9F A;  2IIR A;  3EZW A;  1RDD A;  3ENO A;  3L2Q A;  3VGM A;  4KHP K;  1ATR A;  4WE1 A;  1XNQ K;  5C0Y A;  3CJ7 A;  2GUI A;  1L3U A;  3K57 A;  1IBL K;  4F2S A;  1WSE A;  4M42 A;  2ASP A;  1ZYQ A;  1LV5 A;  1YJN N;  3L3V A;  2HOE A;  1XHZ A;  1TKD A;  3CCU N;  1QHT A;  4JS5 A;  5D3G A;  2D4W A;  4BRO A;  3FGU A;  5F1X A;  3D2E A;  2PYL A;  1NKC A;  3ZSQ A;  1NGI A;  1GOB A;  3SZ2 A;  4DSL A;  2A40 A;  3V9W A;  3H3O B;  3JXU A;  3L2R A;  4CW7 B;  5C2F A;  5FPD A;  4IDK A;  2VWK A;  3J7Y P;  4X65 K;  4WQ4 C;  4FM1 A;  1VSH A;  3DLH A;  3CF5 L;  2A1R A;  2FXU A;  4CJE A;  5E26 A;  4BRQ A;  3DMJ A;  4F3O A;  3NVK A;  2WC9 A;  3AVJ A;  4J8F A;  3OY9 A;  3THY A;  1NMD A;  4AHS A;  1GOC A;  1VAZ A;  2HHS A;  3CJ1 A;  4C8M A;  2HVI A;  3HP9 A;  3LM9 A;  3O9T A;  4EP4 A;  3DI6 A;  4X64 K;  3I8D A;  4DV2 K;  1IH7 A;  4CED A;  4LFA K;  1TV6 A;  4LH4 A;  5LJW A;  4F9O A;  3G25 A;  4GY2 B;  2E2Q A;  3EEQ A;  1DLO A;  1SUQ A;  3LPT A;  4AM6 A;  3L4Q A;  1KAZ A;  1RCH A;  4KHW A;  2IS3 A;  3LDP A;  3O1W A;  4BWJ A;  1Q82 O;  3AO4 A;  2E6L A;  1DT9 A;  1FXX A;  1E4G T;  2P1J A;  4F8R A;  3TAQ A;  4I6M A;  4CZK A;  5AQM A;  3CJB A;  1TAQ A;  3HVT A;  4H5N A;  4MLH A;  3PSF A;  3VET A;  4QCL A;  4FWO A;  2O8E B;  4CI6 A;  5JS2 A;  4LY7 A;  2GTD A;  3WXI A;  1XC9 A;  3VGK A;  1JLC A;  4BE0 A;  4E7I A;  4KV8 A;  2BUP A;  4CZF A;  4CJ3 A;  3PX0 A;  3ZT1 A;  2Z1I A;  3T1A A;  3S41 A;  2X6N A;  1SL1 A;  2F8T A;  5GIO A;  4PKG A;  1N8R O;  1Q8I A;  5HRP A;  3AVL A;  3R9P A;  4AQY K;  4LF4 K;  1MU2 A;  4O8U A;  1TUU A;  3V81 A;  2J4R A;  3LAN A;  3CD6 N;  3SMS A;  3AO3 A;  5DK5 A;  1NGB A;  4DFP A;  5HRO A;  4FJM A;  3BZK A;  3U6F A;  3TI0 A;  3D7E O;  4CGF A;  2WBN A;  4JRQ A;  3B8A X;  4K8Z A;  1HNI A;  2ETJ A;  4LF5 K;  3ZSW A;  4MFB A;  4CBW A;  3ZX0 A;  3DJC A;  4A61 A;  4NYN A;  3TSP A;  4PL7 A;  1UA1 A;  3AVG A;  3PO4 A;  2NNW A;  4I6M B;  3NF9 A;  3I56 N;  4ELU A;  2D0A A;  2P9S B;  5BR8 K;  1RT2 A;  1VSL A;  2HBK A;  2YNF A;  2E4L A;  2VWB A;  5FRO A;  2B6A A;  3HZ6 A;  2DY4 A;  1R59 O;  4CJ7 A;  5FPM A;  1BO5 O;  3H46 O;  1BDG A;  3D45 A;  1NKE A;  3M3Z A;  1OH5 A;  1NBW A;  2KFN A;  3VPZ A;  1SL0 A;  1FW6 A;  4JV5 K;  3HP6 A;  4NCB A;  3PY8 A;  4CHZ A;  3DAW A;  5KQ8 A;  2IVO A;  1EO1 A;  2FBX A;  5SWM A;  3JAM O;  4JLH A;  3LWL A;  4FJ5 A;  2GBZ A;  3O1B A;  4BRM A;  1P8Z A;  3WXJ A;  3I0S A;  3TPQ A;  1QVF M;  5AFU A;  2HF3 A;  3NF6 A;  4M7Y A;  5T7B A;  3THW A;  2E5L K;  2OPS A;  5TKW A;  3HTV A;  1K6Y A;  3RR7 A;  4FJ8 A;  1J53 A;  4EAH D;  4N76 A;  1BOT O;  3HXM A;  4JAX A;  1Q86 O;  3KHY A;  4BG8 A;  1S6P A;  3D6R A;  4CF2 A;  3BF3 A;  1NJW A;  4KI4 A;  1NLV A;  3C7N B;  1U2V A;  2F4V K;  3IMX A;  5FPN A;  1N34 K;  3O80 A;  2P9I B;  3T1H K;  4HTL A;  2XRI A;  4Z4F A;  2UXB K;  5AQG A;  4EIA A;  3KJV A;  3L4I A;  3RSE A;  4KHS A;  1RTI A;  2QEX N;  1IKW A;  4FJX A;  2GV9 A;  2VGN A;  4RW9 A;  2ZE2 A;  5AQN A;  1ZBU A;  3CYM A;  4KHY A;  3E66 A;  3I8B A;  4CFB A;  1N36 K;  4CGG A;  1WSH A;  2NZT A;  4KFB A;  2CH5 A;  3M8P A;  1CLQ A;  3HI0 A;  1KLN A;  4W5R A;  5LMN K;  1KRP A;  3WNH A;  3AVH A;  4DU1 A;  4CGD A;  4BDP A;  1K8K B;  3LAL A;  4E19 A;  4KH6 A;  3LPU A;  4ZHR A;  4H0X B;  1LCU A;  1EXQ A;  2FF3 B;  2P5G A;  3T3F A;  2D0B A;  2W42 A;  5CYM A;  1HYS A;  1L3S A;  2NRR A;  2A5X A;  1KXP A;  4JI0 K;  1B9D A;  3OS2 A;  1GOA A;  4JN4 A;  1W7A A;  2ZGY A;  4DQP A;  3A5N C;  2Q97 A;  1BIS A;  1X9J A;  3SUQ A;  4EHU A;  4OLB A;  4DUZ K;  3EE9 A;  4CF9 A;  5J1E A;  1N33 K;  3ENB A;  2PY5 A;  4JK9 A;  4UQG A;  1QQN A;  4B1Z A;  3C95 A;  3NH0 A;  2HF4 A;  4QS7 A;  1NK8 A;  4M3X A;  4Z4H A;  4FYD A;  1JCE A;  3KLG A;  4CIG A;  3CG7 A;  4JS4 A;  1ZBS A;  3OJS A;  2VWJ A;  4RCH A;  3VQC A;  4WFN L;  3TWH A;  3LDO A;  5CZ2 A;  1JLA A;  5FLX O;  4DTP A;  3VES A;  1M90 O;  3FZK A;  2YKM A;  3DLG A;  4CBU A;  4YHH K;  3QEW A;  3K5N A;  3HT3 A;  5BPL A;  3KK2 A;  1NGD A;  3QDK A;  4WQ5 C;  1OH7 A;  4PHT X;  2HBL A;  5JLH A;  1GLF O;  1OKJ A;  1Z25 A;  3RR8 A;  4B3R K;  4Z4C A;  3MAQ A;  4JKG A;  1HNX K;  4CEF A;  4K0K K;  1OVY A;  4BWM A;  1BA0 A;  4H4O A;  4H0P A;  1T3V A;  4I7F A;  4CGH A;  3MN9 A;  2YX6 A;  3CC4 N;  4DQQ A;  2F7T A;  4AH9 A;  4EHT A;  3V9Z A;  5CY4 A;  5AZJ B;  2RKI A;  3PX6 A;  2UXC K;  3E9O A;  4ILG B;  3DRP A;  3E01 A;  1CZA N;  3P39 A;  3UKR B;  3KK3 A;  3QER A;  2NRH A;  1E4F T;  3M5R A;  5E84 A;  4YDU A;  3VQD A;  3DRR A;  4CJ4 A;  3TAN A;  3CCV N;  2E2P A;  3U3G A;  1SS6 A;  1BA1 A;  4OPA A;  2E2N A;  3O5B A;  3PUF A;  4FJK A;  1BL3 A;  3NH2 A;  4IJA A;  1NJY A;  4HHT A;  4FZY A;  4K25 A;  4A2A A;  2HVH A;  3CER A;  3DLK A;  3IUC A;  3UKR A;  2NRX A;  1D9D A;  3SJH A;  3EZ5 A;  4FWS A;  3QML A;  4B1X B;  3CME N;  1HX1 A;  3OYB A;  3NCI A;  3RRH A;  2X74 A;  2HBM A;  4BGB A;  1TUY A;  3PIP L;  1EX4 A;  5AQZ A;  3PO5 A;  3ZT3 A;  4FVU A;  1X9M A;  1P90 A;  4DU3 A;  4LFC K;  3HM8 A;  2ZGZ A;  4EZ9 A;  2A41 A;  1N32 K;  4CZI A;  1NK4 A;  4FWL A;  5GIN A;  4CEZ A;  2D0P A;  3CM5 A;  1C0T A;  3HPG A;  1NM1 A;  3E9L A;  2PAV A;  3KD1 E;  3M1F A;  4WFA L;  1GLD G;  2Y1I A;  3DXK B;  1W0H A;  1S5J A;  2Q2R A;  4DTJ A;  4ZTF A;  1KC8 O;  5AQJ A;  1DGK N;  3MX5 A;  3CIP A;  1TK0 A;  4L3Q A;  4H0Y B;  3VER A;  2YV0 X;  2P9L A;  4KHQ A;  3VQA A;  2E8A A;  4CEB A;  4FK0 A;  5C15 A;  1G99 A;  4KO0 A;  1Y97 A;  3HST B;  3CCS N;  4JI7 K;  4OKK A;  3V9X A;  2YKN A;  5AQW A;  2O8F B;  1NGE A;  5AQI A;  1VQP N;  1J9A A;  1QZ5 A;  4OPJ A;  3CCM N;  1LAW A;  3EO3 A;  3QNN A;  2OCE A;  5ADX A;  3VGL A;  4BC4 A;  1I3A A;  2B4J A;  1VQN N;  4H5T A;  4KBO A;  5IWA K;  4C8L A;  3VF6 A;  2VG6 A;  3LP2 A;  5AQP A;  2QWO A;  4WCE L;  4DFK A;  2G8I A;  2WUS A;  4JI8 K;  3O9S A;  2ITM A;  3CC7 N;  3JS6 A;  1BWF O;  2F9T A;  3U9D A;  2BDP A;  2VGM A;  2WTU A;  4BVP A;  5HOO A;  4JI2 K;  3WXM B;  3AA2 A;  1VQO N;  4BR5 A;  1WSI A;  3DLB A;  1OH8 A;  1VSM A;  1NU0 A;  2QW9 A;  3O08 A;  3R3L A;  2P5O A;  2YHX A;  2D0C A;  4DLE A;  2Z1G A;  1QSL A;  1U49 A;  1HJO A;  2P9P B;  4JI6 K;  1CZB A;  1LWE A;  5AQT A;  4CCH A;  1NK7 A;  3AA5 X;  4XH1 A;  1DTQ A;  1NNE A;  2RHK A;  4NCA A;  1XMO K;  1U2V B;  3O9U A;  3I0R A;  3O3F A;  1G15 A;  4WQ4 A;  2HHT A;  1TL1 A;  4JI5 K;  2V7Y A;  4QS9 A;  4R79 A;  3CFO A;  4J2E A;  5AJ3 K;  3RRG A;  2FF6 A;  2BH1 A;  3J8A A;  3FZH A;  1GLJ O;  5KGX A;  2QKB A;  3QB0 A;  4CGJ A;  4B9Q A;  4BDZ A;  4KTW A;  3A2F A;  3VTI A;  3MEC A;  5JMV A;  1TKX A;  1OVQ A;  1KVC A;  1QHA A;  3GL1 A;  1YIT N;  1YTU A;  1YT3 A;  1BGX T;  5FRN A;  1NGG A;  2AA4 A;  4YFU A;  4CJP A;  2ZJR L;  3H1Q A;  3MCA B;  4RW6 A;  4ZTJ A;  3QEV A;  4KB1 A;  3MXM A;  4CFD A;  2YNG A;  2XY6 A;  3J7A P;  3J80 O;  5C42 A;  1IKV A;  3ISN C;  4RW8 A;  3TTD A;  1KD1 O;  1ZC6 A;  1XI1 A;  3D2F B;  3OBY A;  4CJW A;  4H5R A;  1BIU A;  1NK9 A;  1BCO A;  1WAJ A;  3KWI A;  4ID5 A;  3TSQ A;  3HL8 A;  1RDC A;  1BQN A;  1WLJ A;  2O4I A;  5M1K A;  3CFR A;  4LC9 B;  1VQ6 N;  3IKM A;  1HR0 K;  1RT3 A;  3A5M C;  5BRE A;  4IFV A;  4E7H A;  2NRT A;  4FSV A;  2QWR A;  1WSJ A;  2P9U B;  4CJT A;  1T8E A;  1REV A;  1QS4 A;  3C6U A;  1GLE G;  4A57 A;  1HNZ K;  4AHU A;  3MDQ A;  4B3S K;  4YY3 K;  1NKB A;  4PKH A;  4WFB L;  4BQL A;  1IJJ A;  5JIC A;  4FJH A;  2P51 A;  4RG8 A;  1U4B A;  1U04 A;  4XEI A;  3SUN A;  1C6V A;  3MXI A;  5IT9 O;  4XH5 A;  1S6Q A;  4B9U A;  1JLF A;  3OVN A;  4NXM K;  4CJ5 A;  3ZSV A;  2GX9 A;  5HP1 A;  1NMN A;  2QXF A;  1U48 A;  1RBR A;  1VQL N;  1Q9Y A;  1RT5 A;  5TKY A;  4CJF A;  2O8C B;  2QWP A;  3PSI A;  1JLE A;  4M3Z A;  3UE5 A;  3MED A;  3VF2 A;  3VQ9 A;  4FLT A;  4ILH A;  1S9G A;  4B08 A;  3TAE A;  4Z94 A;  1RBU A;  1V4T A;  3VA0 A;  4K43 A;  2KZM A;  1BIZ A;  4KHN A;  4DV7 K;  2NRZ A;  4O55 A;  3NGZ A;  1KSP A;  1QE1 A;  4JKH A;  3K5L A;  2DTU A;  3NGI A;  3ZYY X;  4BRG A;  1VQ8 N;  3LWM A;  4FJJ A;  1JLG A;  4CZH A;  1K8A O;  2HNY A;  4CEO A;  4RW4 A;  4FLZ A;  1HNV A;  3SMP A;  3SK3 A;  3CCR N;  3VA3 A;  3ULE A;  4C1N K;  1JCG A;  3OW2 M;  5K14 A;  1VSJ A;  2ATQ A;  1RNH A;  2I5J A;  3H6E A;  1FKO A;  3ITH A;  5ELZ A;  3DLE A;  4CBX A;  5I3U A;  1C0U A;  4LF6 K;  5KI6 A;  3ATU A;  5HBM A;  4YDU C;  3ZSY A;  4RWT A;  3FZM A;  3ID6 A;  1KFS A;  4CJU A;  3RMB A;  3ATV A;  2QXL A;  1DEJ A;  4HTU A;  3HSC A;  4ILJ A;  3THV A;  3CCL N;  1ESV A;  4LF8 K;  3VMF B;  2UU9 K;  2E1Y A;  1M1K O;  3MEE A;  4FOE A;  3TAR A;  1ZXO A;  5KTQ A;  1U47 A;  1VSE A;  3IS9 A;  2FC0 A;  1FK9 A;  4FWK A;  4IBN A;  4ELT A;  2W6L A;  2A3Z A;  3ZT4 A;  1KAY A;  4Z4G A;  4FO0 A;  4KTZ A;  3K5O A;  3EL2 A;  3BZC A;  3L2V A;  2HBJ A;  1LWF A;  1TYQ B;  3ZEU B;  4BG9 A;  1YIJ N;  4H0O A;  4CJK A;  2P9S A;  3L0Q A;  3DOL A;  3T1Y K;  4Y1C A;  3CC2 N;  1BU6 O;  5DM7 L;  3VN5 A;  3ZET B;  3TAG A;  4JD2 B;  1S72 N;  4NXN K;  3ASM A;  2RE2 A;  5J2M A;  5KRT A;  4TSX A;  1KQS M;  3ULD A;  4IDH A;  4FOI A;  4PWD A;  1S1U A;  1NOZ A;  2GEM A;  2KW4 A;  4FZZ A;  5AQX A;  4LSN A;  3JYT A;  3A5O C;  2WON A;  3KD5 E;  1S22 A;  1GLC G;  2O8F A;  3VEO A;  5CR4 A;  3VEN A;  4BRE A;  3FFK B;  3AAR A;  2PZS A;  3V6D A;  1KVB A;  3LP1 A;  2E1Z A;  3W0L A;  4M7X A;  4H03 B;  4M3Y A;  4IOA L;  2NRV A;  2O8D B;  1SKS A;  2D0O A;  4LFB K;  3OYE A;  3KZB A;  1JXB A;  5HL7 L;  3SBT A;  3AO2 A;  3M8R A;  4GNI A;  4A62 A;  1N6Q A;  1C1B A;  4HVJ A;  2Q1N A;  5BN8 A;  1WBD A;  4JI3 K;  3C6H A;  2YI1 A;  5AQK A;  1ITG A;  1SAZ A;  3KKR A;  4CF8 A;  1NWK A;  1TKZ A;  4OLA A;  2P9K A;  3TTC A;  1JJ2 M;  3K0S A;  3H1V X;  3AVC A;  3RVC A;  2D5R A;  3CM6 A;  4E89 A;  1H1V A;  4B1Y B;  2BGG A;  4FJI A;  4OGE A;  1UA0 A;  1MWM A;  5M1N A;  3P83 D;  4M63 C;  1CZ9 A;  1L5U A;  4K8X A;  4N47 A;  1SKW A;  3EKU A;  4CJS A;  2UUB K;  1Z05 A;  3NVM A;  4DTN A;  4FPA A;  1WSF A;  4CFA A;  2IOC A;  4CHO A;  3HK2 A;  3L2U A;  5GAE P;  2BAN A;  4F2R A;  3C94 A;  3LDL A;  3MN5 A;  1VSD A;  3E9P A;  4J2A A;  3UKU B;  3QBX A;  1IBK K;  1IO2 A;  2X6S A;  1O13 A;  2AJQ A;  1K73 O;  1T6C A;  3NH1 A;  4E1M A;  3HYF A;  5LMU K;  4AIL C;  2KTQ A;  1SV5 A;  3CPW M;  3ZT0 A;  5F0X A;  4JEP A;  3MMV A;  4MDB A;  1JKH A;  4M41 A;  3OS0 A;  3ZSZ A;  1XNR K;  4I2Q A;  4FM0 A;  3F5T A;  1YJW N;  4JKG B;  4DWI A;  4FPB A;  4FVM A;  1XMQ K;  4DR4 K;  1HPM A;  5DM6 L;  1HUX A;  4R5P A;  3SYZ A;  4OVL A;  3VF4 A;  1XHX A;  1RT4 A;  5AZI A;  3AGK A;  1DKG D;  5HRN A;  2XHB A;  4A59 A;  1S3X A;  3SJJ A;  4OO1 J;  3T69 A;  2O8B A;  4C8K A;  1HJR A;  3TAB A;  4IKF A;  1ILY A;  5JVH L;  4CHP A;  4FJL A;  1S9E A;  2P9P A;  3B6P A;  4KTQ A;  2VCP A;  3KK7 A;  3IDH A;  4E3S A;  1T03 A;  4O44 A;  1C0G A;  3U4L A;  3CFP A;  4CD1 A;  4CE9 A;  3WQT A;  1E3M A;  4M3T A;  4I9L A;  1IV0 A;  4CZE A;  3S3O A;  1ATS A;  2YJF A;  3HVR A;  5C24 A;  3M8S A;  3DXM B;  5CE3 A;  4CJV A;  4DHY A;  2PBD A;  2XO7 A;  1ASW A;  3VQP A;  4OGC A;  4B9N A;  4OKE A;  2W40 A;  2BE2 A;  4FW2 A;  3DOK A;  3LP0 A;  1NK0 A;  3BY5 A;  5B8H A;  3DRS A;  2ZD1 A;  3DWL A;  4DV0 K;  4DSJ A;  3NHG A;  2LSN A;  4JRP A;  4W5T A;  3LZI A;  4HCC A;  4OPH A;  1K9M O;  3K9J A;  4DSE A;  4IEI A;  3VEY A;  5KGW A;  4GVE A;  2QA4 N;  1C0M A;  3DXM A;  4AHV A;  3O4Q A;  2RF2 A;  4CHQ A;  1NGH A;  2HHU A;  4Y1D A;  5JVG L;  2HMP A;  3U9Z A;  1KLM A;  5M1P A;  3O9R A;  2QWN A;  4FLY A;  3U8X A;  2HMI A;  1XC3 A;  4GV6 A;  3K9K A;  3ZEU A;  1TYQ A;  5HRR A;  1VQ7 N;  1IG8 A;  4BE1 A;  3KIO A;  1ZBF A;  3HBT A;  5AZI B;  1L3T A;  3LAM A;  3FZL A;  3SQ2 A;  3V1Q A;  3EN9 A;  4FWM A;  3LM2 A;  3S3N A;  3V1O A;  2I7P A;  3L2W A;  3VQQ A;  3QO9 A;  1A5V A;  4DR6 K;  3BEX A;  4BRN A;  3OYM A;  3LL3 A;  2NLX A;  4DU4 A;  3SQ1 A;  4JKF A;  1YHQ N;  5F2R A;  4DR3 K;  3KKS A;  4CES A;  3J7Z O;  3UIQ A;  2XY5 A;  2HND A;  5LL6 Z;  4I9Q A;  3GDQ A;  2KHO A;  4ID1 A;  3ZCM A;  4DQR A;  3O4W A;  1N5Y A;  3VOV A;  1X3M A;  3KWG A;  2GUP A;  4NO7 A;  3VEX A;  2DPN A;  4CHY A;  3H3N O;  4KAZ A;  4CHN A;  3RMA A;  4DV5 K;  4DTM A;  3OBW A;  3SPZ A;  3G4S N;  3O4N A;  2Q0U A;  3BGR A;  4CK3 A;  2CGL A;  3AV9 A;  4H0T B;  4FJ7 A;  2AP1 A;  5AQU A;  3FZF A;  4FJG A;  4W5N A;  1HMV A;  4IXC A;  3GG4 A;  2O4G A;  1KAX A;  2JGU A;  3K2P A;  4O0J A;  4K42 A;  5HRS A;  1NK5 A;  1WUA A;  4DR1 K;  3T19 A;  2IVN A;  1J6Z A;  1RBS A;  2IC3 A;  3ZT2 A;  4Z4I A;  1J5E K;  1CXU A;  3TR8 A;  5BN9 A;  1VQK N;  4QOZ B;  3AAQ A;  3ZSX A;  4DLG A;  1NK6 A;  3EE8 A;  5EXW A;  1B92 A;  4DV6 K;  4C8O A;  5AZJ A;  3NMU A;  3OYG A;  4DQS A;  2B5J A;  1NG9 A;  4O5F A;  3MN6 A;  2VG5 A;  5FPE A;  4IFY A;  4QAG A;  3TAM A;  3IG1 A;  2BTF A;  4BC3 A;  2QWQ A;  1VSI A;  4X62 K;  1BI4 A;  3SAF A;  1ASU A;  5KPR A;  3RWU A;  3WQU A;  1TVR A;  1GLB G;  1RT1 A;  3VQ5 A;  4FL9 A;  3OYI A;  3AVB A;  4HUE A;  4MO4 A;  4BRL A;  4U7B A;  1YI2 N;  1HKB A;  3DLL L;  2UUA K;  1JL2 A;  3O3H A;  1VSK A;  1JL1 A;  4B3M K;  1XWL A;  5AQV A;  5AFU H;  4FJN A;  2OPR A;  4N41 A;  2OYQ A;  4CZJ A;  2FBV A;  4PQU A;  1HPZ A;  3L6Q A;  4CFC A;  5FRM A;  1D8Y A;  4CK2 A;  4AHC A;  1VQ9 N;  4ISG A;  1RT7 A;  2ASO A;  4GKK K;  4X66 K;  2O8B B;  2CGJ A;  4BRI A;  4CVN E;  4O4G A;  4GW6 A;  4WYB A;  4E1N A;  4IO8 A;  1MA9 B;  2QKK A;  3P31 A;  4Z0U A;  2JWK A;  4W5O A;  2KFZ A;  2HST A;  3AVF A;  3Q7C A;  4C1N I;  3O3G A;  5AR0 A;  3HPO A;  3SAH A;  2RN2 A;  1RDW X;  4DSK A;  2ZM6 K;  4E7J A;  2A42 A;  2QWL A;  3MWT A;  2D1K A;  3DYA A;  4CF0 A;  1KVA A;  4PA1 A;  3QFU A;  4DSI A;  4B1W B;  4OKJ A;  4BR9 A;  4HWI A;  4DR7 K;  3GBT A;  3SLC A;  1Z26 A;  3NAE A;  1WBB A;  4JKB A;  4NLC A;  2HB5 A;  4M3U A;  3NFA A;  3M6G A;  5CHI A;  2HHQ A;  4AHR A;  3OYC A;  1IBM K;  5AQS A;  4FZX C;  3K5M A;  4YOU A;  4M3R A;  4YOW A;  3MWP A;  5CYQ A;  4N5S A;  3OHR A;  5LY3 A;  1VQ4 N;  1X9W A;  4BRP A;  5M1Q A;  1UAX A;  4DV3 K;  4B3T K;  5M1O A;  4GMJ B;  2ZQB A;  4DTU A;  4H4M A;  1QSY A;  1IG9 A;  4DF4 A;  3SBG A;  3NF7 A;  4BC5 A;  2I7N A;  3WEE B;  3M8Q A;  2OZS A;  4DS5 A;  3KLH A;  2QK9 A;  2FSN A;  4C23 A;  3KTQ A;  1J54 A;  1T6D A;  3CJC A;  5LJV A;  1NGJ A;  3CCE N;  2P9K B;  2XY7 A;  1WN7 A;  4DV4 K;  3AO1 A;  3HO1 A;  1RDA A;  5AQF A;  3CXC M;  1Y64 A;  4Y0W A;  4CJL A;  2JLE A;  4FWQ A;  4KH4 A;  4FWR A;  1NGC A;  2YCH A;  4KI6 A;  2ZWH A;  1BCM A;  3BUZ B;  3NGY A;  1DTT A;  2DFF A;  3J81 O;  1B9F A;  2O8D A;  1HRH A;  1EP4 A;  1YF5 L;  5AQQ A;  1LW0 A;  3CJA A;  3ZX2 A;  1ZBH A;  2IGI A;  3DLR A;  3P38 A;  4IWV A;  5EU7 A;  1QTM A;  4CEA A;  4WQ5 A;  2UXD K;  1VSF A;  4Q5V A;  3OTO K;  4MLE A;  3MK6 A;  3CQX A;  3ZSO A;  2A6A A;  4GKJ K;  3FFI A;  4MDA A;  1BQM A;  3OS1 A;  3AO5 A;  3LP3 A;  1A5X A;  3F2K A;  4WF9 L;  1HKC A;  3G0Z A;  2Y1J A;  1LOT B;  4RTF D;  3EY1 A;  2XY8 A;  5E41 A;  4DSF A;  4JD2 A;  3PIO L;  4H0V B;  2OAN A;  4DQI A;  3KLF A;  5AQL A;  3ZET A;  3H45 C;  5GAG P;  4FLV A;  4O8K A;  3T7Z A;  4FLU A;  1S1X A;  2P9L B;  3OYF A;  3K58 A;  1RIL A;  4O5B A;  3SCX A;  4BRH A;  5BR9 A;  1WB9 A;  1ATN A;  4IOC L;  1Q7Y O;  3TU5 A;  4FK4 A;  4BRC A;  2HHV A;  2QWM A;  3V9U A;  3K59 A;  3DXK A;  3W3D A;  4A2B A;  1YVU A;  1C1C A;  3CQ8 A;  4FXD A;  4H5V A;  2F96 A;  3C6A A;  4XH4 A;  5CZ1 A;  3DM2 A;  2KZZ A;  2DFH A;  1YAG A;  4LH5 A;  2VYP A;  5KQD A;  4HUF A;  2UYT A;  1RBT A;  3GOI A;  3OYH A;  2HHW A;  1Q18 A;  2Q31 A;  1MWK A;  3A0I X;  3AVM A;  3L3U A;  1C1A A;  1RTH A;  1X1P A;  2Q3S A;  4BR4 A;  5C12 A;  1QQC A;  1KFD A;  4YOR A;  1TK8 A;  4I2P A;  3V4I A;  2P9I A;  4FK2 A;  3O6W A;  4B3O A;  2A1S A;  3HPH A;  1Z6R A;  3VQ6 A;  1X9S A;  4IG0 A;  2O8E A;  3VQ4 A;  1HKG A;  3ULE B;  4CK1 A;  3PX4 A;  2HHH K;  3OYN A;  2Q36 A;  1TK5 A;  3AA3 A;  3THW B;  3HOT A;  3BF1 A;  1S1T A;  2NUB A;  3NBP A;  4KRF A;  4CZG A;  4BRF A;  4DS4 A;  3SQ0 A;  4CER A;  3QIO A;  4CZM A;  5AQO A;  2W6K A;  2F8S A;  3P1G A;  5JLF A;  1RT6 A;  3KLE A;  5BPN A;  1EWQ A;  1ZBL A;  4F3T A;  2YHB A;  5H1S Q;  1MDU B;  1QSS A;  2OPP A;  1VK0 A;  3F9M A;  3Q7B A;  3LDN A;  3QIP A;  3I55 N;  1F21 A;  4DTO A;  3S9H A;  3WNF A;  3MN7 A;  3VEW A;  2E88 A;  3MEG A;  3CJ9 A;  2IVP A;  3RTV A;  2F9W A;  5FDL A;  4B9T A;  1HQE A;  2CH6 A;  3N4P A;  2Z1J A;  3TSU A;  4JHD A;  4YOX A;  4FLW A;  3HM9 A;  3NF8 A;  2VQF K;  4BR2 A;  3ENH A;  1WAF A;  4IJN A;  4B9L A;  2VG7 A;  3SUP A;  4CD3 A;  1UWB A;  4FWP A;  1R0A A;  4IOX A;  1J5O A;  3U3Y A;  3HJF A;  3C65 A;  3D2E B;  1V4S A;  3AY9 A;  3KK1 A;  4L8R B;  1T44 A;  4BE2 A;  2FSK A;  3ALY A;  2Q0R A;  3FE1 A;  4B9V A;  2V7Z A;  3QEP A;  1VRT A;  3VQE A;  4BR7 A;  3TAF A;  4BDY A;  1SQK A;  4BRK A;  4C8N A;  4FLX A;  1LWC A;  1C0F A;  2VQE K;  4DR2 K;  1SKR A;  4OJR A;  2GWJ A;  1Q81 O;  4A5B A;  4DKW A;  1TGO A;  3TAP A;  3I33 A;  5I42 A;  2RPI A;  3D2F A;  3IAY A;  3P4I A;  3FR0 A;  3PLA A;  1D4X A;  3ZSR A;  2FBT A;  4K41 A;  4E7K A;  1TAU A;  4KRE A;  1RTJ A;  4Z4E A;  4JYA K;  1JXE A;  3IRX A;  3QLH A;  4MO5 A;  1BHL A;  4LSL A;  1YVN A;  3LZJ A;  1VQM N;  4BR0 A;  1Q9X A;  3QES A;  4JKE A;  1S1W A;  5BRD A;  1EWR A;  1I94 K;  3SI6 A;  1YXQ A;  3UB5 A;  3NDK A;  2YJE A;  3PV8 A;  4DQ8 A;  3SV4 A;  4JHD B;  4LD0 A;  5KRS A;  4J2B A;  4BRA A;  4DB3 A;  4KHU A;  4M45 A;  5KPT A;  3L8B A;  1XQS C;  1JLQ A;  2ASM A;  3WT0 A; 
#chains in the Genus database with same CATH homology
 1NGF A;  2Q0U A;  4A61 A;  4BC2 A;  3FLC O;  4LC9 B;  1VQ6 N;  3TSP A;  3WXL A;  2PFU A;  2CGL A;  3IKM A;  4H0T B;  2QM1 A;  4PL7 A;  5EOY A;  3A5M C;  1SZ2 A;  2AP1 A;  5AQU A;  4YOV A;  3FZF A;  4JNE A;  5BRE A;  1K8K A;  2E20 A;  2NNW A;  1BG3 A;  4IXC A;  3GG4 A;  4I6M B;  3I56 N;  1KAX A;  2NRT A;  3WUH A;  1EQY A;  2P9S B;  4FSV A;  4ISF A;  2HBK A;  4K42 A;  2QWR A;  2VWB A;  2P9U B;  4BQZ A;  3WEE A;  1GLE G;  4E1J A;  4A57 A;  3C0B A;  1WUA A;  3HZ6 A;  3UKU A;  3MDQ A;  1R59 O;  2IVN A;  1J6Z A;  5FPM A;  4CJ7 A;  1QVG M;  4GV3 A;  2OTJ N;  1BO5 O;  2GWK A;  3H46 O;  1BDG A;  4NB4 A;  4PKH A;  4B1V A;  1RDU A;  4WFB L;  4BQL A;  1IJJ A;  5BN9 A;  5JIC A;  1VQK N;  3AAQ A;  3M3Z A;  3EE8 A;  4XEI A;  5EXW A;  1NBW A;  5AZJ A;  3VPZ A;  3NMU A;  2OTL N;  1GLL O;  3AAP A;  4XH5 A;  4A5A A;  3DAW A;  4O5F A;  5KQ8 A;  3MN6 A;  2GX9 A;  2IVO A;  5FPE A;  1EO1 A;  5C10 A;  3N4Q A;  2BTF A;  4BC3 A;  2QWQ A;  3O1B A;  4BRM A;  1VQL N;  1P8Z A;  2V51 B;  3WXJ A;  3SAF A;  5TKY A;  3TPQ A;  4H5W A;  4BY9 C;  2QWP A;  5AFU A;  5KPR A;  1QVF M;  5EVZ A;  3CPE A;  3WQU A;  3UE5 A;  3TTF A;  3VF2 A;  1GLB G;  2HF3 A;  3CHW A;  4ILH A;  5KPZ A;  5AQH A;  4FL9 A;  4M7Y A;  4Z94 A;  1V4T A;  2V52 B;  4MO4 A;  4BRL A;  4U7B A;  5TKW A;  1YI2 N;  1HKB A;  3HTV A;  3DLL L;  4K43 A;  4EAH D;  1BOT O;  1U6Z A;  4JAX A;  2KLA A;  1Q86 O;  3KHY A;  4BG8 A;  3CET A;  3VEV A;  2NRZ A;  5GIP A;  3OA9 A;  5AQV A;  5AFU H;  3D6R A;  3BF3 A;  4IFE A;  1NLV A;  3C7N B;  1U2V A;  4CZJ A;  3IMX A;  4JKH A;  5FPN A;  3O80 A;  2P9I B;  3ZYY X;  4BRG A;  4JKD A;  4HTL A;  3L6Q A;  5C2D A;  1VQ8 N;  4JKA A;  1VQ9 N;  4ISG A;  3AGR A;  2ASO A;  5AQG A;  4EIA A;  1BUP A;  2P9N A;  4CZH A;  1K8A O;  3L4I A;  3RSE A;  2CGJ A;  4BRI A;  3CCQ N;  2QEX N;  3SMP A;  3SK3 A;  3CCR N;  4WYB A;  2VGN A;  3ULE A;  4C1N K;  1JCG A;  3ID8 A;  2W41 A;  4IO8 A;  5AQN A;  4IO9 L;  3OW2 M;  3A5L C;  1MA9 B;  3E66 A;  3H6E A;  4AM7 A;  3P31 A;  3I8B A;  2JWK A;  5ELZ A;  2HST A;  4NLB A;  4CBX A;  2NZT A;  2QI2 A;  3G6E N;  3Q7C A;  4C1N I;  2CH5 A;  3HI0 A;  5AR0 A;  3SAH A;  5GAD P;  2WFB A;  1RDW X;  4B1U B;  2A42 A;  3ATU A;  2QWL A;  3MWT A;  3QIC A;  4JKC A;  2D1K A;  3CMA N;  3QFU A;  4YDU C;  4B1W B;  4BR9 A;  4HWI A;  4RWT A;  3GBT A;  3FZM A;  1K8K B;  3SLC A;  3ID6 A;  4YOY A;  2ZJP L;  1WOQ A;  3ATV A;  2FSJ A;  2QXL A;  1DEJ A;  4JKB A;  4KH6 A;  4NLC A;  3HSC A;  4H0X B;  4ILJ A;  3CCL N;  1ESV A;  1YJ9 N;  3M6G A;  5CHI A;  3VMF B;  1LCU A;  3SAG A;  2FF3 B;  2E1Y A;  1M1K O;  4FOE A;  2GEL A;  1ZXO A;  5AQS A;  3G71 N;  5EX5 A;  4YOU A;  4UY8 O;  3EKS A;  2NRR A;  1W97 L;  4YOW A;  3MWP A;  1VQ4 N;  3OHR A;  5LY3 A;  4FWN A;  2A5X A;  3E1Y A;  4AF1 A;  1KXP A;  4BRP A;  5M1Q A;  2YHW A;  4FWK A;  4PKI A;  2ZF5 O;  4JN4 A;  2A3Z A;  2H3G X;  2ZGY A;  3A5N C;  5M1O A;  1KAY A;  2Q97 A;  4FO0 A;  1X9J A;  4G9Z A;  3EL2 A;  3SBG A;  4BRD A;  4EHU A;  2HBJ A;  2P9N B;  4BC5 A;  2I7N A;  3EE9 A;  3WXK A;  1TYQ B;  3WEE B;  3ZEU B;  1QZ6 A;  4BG9 A;  4H0O A;  1YIJ N;  3ENB A;  2P9S A;  3L0Q A;  3CC2 N;  1BU6 O;  2FSN A;  4C23 A;  4JK9 A;  5DM7 L;  1QQN A;  4B1Z A;  3CCJ N;  1T6D A;  3ZET B;  3CJC A;  5LJV A;  1NGJ A;  3RSE B;  3CCE N;  2HF4 A;  4EFH A;  4QS7 A;  2P9K B;  4JD2 B;  1S72 N;  1JCE A;  2RE2 A;  3VEZ A;  1KQS M;  4JK8 A;  5AQF A;  3CXC M;  1QQO A;  1ZBS A;  1Y64 A;  4IDH A;  4RCH A;  4Y0W A;  4FOI A;  3VTH A;  3LDO A;  4WFN L;  3VES A;  3IFR A;  2GEM A;  3FZK A;  1M90 O;  3MX2 A;  4FWQ A;  5MLC Q;  4CBU A;  5AQX A;  4KH4 A;  3C7N A;  5BPL A;  3A5O C;  4FWR A;  3R8E A;  1NGD A;  1NGC A;  2YCH A;  3QDK A;  4WQ5 C;  1S22 A;  1GLC G;  4PHT X;  2HBL A;  5CR4 A;  3VEO A;  2ZWH A;  3VEN A;  4BRE A;  5JLH A;  4GV9 A;  1GLF O;  3ZX3 A;  1OKJ A;  3FFK B;  3BUZ B;  3HRG A;  2JWL A;  3AAR A;  4JKG A;  5AQY A;  5BRH A;  5ADX H;  5BRF A;  4JK7 A;  4BGA A;  4U67 L;  1OVY A;  2E2O A;  1BA0 A;  1YUW A;  5BPM A;  4H0P A;  1T3V A;  5AQQ A;  1YF5 L;  3ZX2 A;  1HLU A;  3CJA A;  2E1Z A;  3W0L A;  4M7X A;  3P38 A;  4H03 B;  4IWV A;  2KKZ A;  3MN9 A;  4IOA L;  2YX6 A;  2NRV A;  2D0O A;  3CC4 N;  2F7T A;  3R6M A;  4WQ5 A;  1RFQ A;  4EHT A;  1JCF A;  3KZB A;  1GLA G;  4MLE A;  3BP8 A;  5HL7 L;  3MK6 A;  3CQX A;  5AZJ B;  3SBT A;  2A6A A;  5AQR A;  2YHY A;  3E9O A;  4ILG B;  4BVO A;  4MDA A;  4GNI A;  4QS8 A;  4A62 A;  3O9Q A;  1CZA N;  3MCP A;  4YOT A;  3P39 A;  3UKR B;  4PL8 A;  3QBW A;  2NRH A;  1E4F T;  2Q1N A;  3M5R A;  5E84 A;  4YDU A;  5BN8 A;  3F2K A;  4WF9 L;  3C6H A;  2YI1 A;  5AQK A;  1HKC A;  1VQ5 N;  1SAZ A;  1LOT B;  4ISE A;  4RTF D;  3CCV N;  1NWK A;  2E2P A;  1SS6 A;  1BA1 A;  2P9K A;  2E2N A;  3O5B A;  4JD2 A;  4H0V B;  4OPA A;  2CGK A;  2OAN A;  3TTC A;  3PIO L;  1JJ2 M;  5AQL A;  5I9E B;  3ZET A;  3R1X A;  3CI5 A;  3H45 C;  4IJA A;  2QTD A;  3H1V X;  5GAG P;  4O8K A;  3T7Z A;  3QFP A;  4K25 A;  2P9L B;  3RVC A;  3CQY A;  4A2A A;  3HOS A;  1H1V A;  4BRH A;  4B1Y B;  5BR9 A;  1ATN A;  4IOC L;  3CER A;  1MWM A;  3GE1 A;  3TU5 A;  1Q7Y O;  5M1N A;  5M1F A;  4M63 C;  1XUP O;  3IUC A;  3UKR A;  2QWM A;  2NRX A;  3EKU A;  4BRC A;  3SJH A;  1Z05 A;  4FWS A;  2FLO A;  3NVM A;  4IZ9 A;  4FPA A;  3DXK A;  1QQM A;  3QML A;  1X3N A;  3W3D A;  4A2B A;  4B1X B;  4CZL A;  3CME N;  2EWS A;  1HX1 A;  2NRW A;  5GAE P;  4H5V A;  3LDL A;  3C6A A;  4XH4 A;  3MN5 A;  2HBM A;  4BGB A;  2ZJQ L;  3E9P A;  3UKU B;  1YAG A;  3QBX A;  1TUY A;  3KVG A;  3O8M A;  1O13 A;  5AQZ A;  2VYP A;  1RGI A;  3PIP L;  1K73 O;  2P9U A;  1T6C A;  2UYT A;  5KQD A;  3GOI A;  4FVU A;  1P90 A;  5EY4 A;  4DCH A;  4IEE A;  3HM8 A;  3CPW M;  1Q18 A;  2Q31 A;  1MWK A;  3A0I X;  2ZGZ A;  5F0X A;  5GAH P;  4JEP A;  4KH5 A;  2A41 A;  4CZI A;  3MMV A;  4MDB A;  3LDQ A;  4BR4 A;  1NJI O;  4FWL A;  5GIN A;  5C12 A;  2D0P A;  4YOR A;  1NM1 A;  1NGA A;  3A8Y A;  1W2B M;  3E9L A;  2PAV A;  2IIR A;  3EZW A;  2P9I A;  3F5T A;  3ENO A;  3M1F A;  3O6W A;  3VGM A;  1YJW N;  4JKG B;  4WFA L;  1GLD G;  4FPB A;  1ATR A;  1Z6R A;  5C0Y A;  3CJ7 A;  3DXK B;  1HPM A;  5DM6 L;  1HUX A;  1HKG A;  3VF4 A;  3ULE B;  2Q2R A;  1KC8 O;  5AQJ A;  1DGK N;  2Q36 A;  3MX5 A;  3AGK A;  5AZI A;  1DKG D;  3CIP A;  4A59 A;  2ASP A;  1S3X A;  4OO1 J;  3T69 A;  1YJN N;  3HOT A;  4L3Q A;  1ILY A;  2HOE A;  3BF1 A;  4H0Y B;  3VER A;  5JVH L;  3CCU N;  2P9L A;  2P9P A;  4BRF A;  2E8A A;  4CZG A;  2D4W A;  4BRO A;  3FGU A;  1G99 A;  3D2E A;  5C15 A;  5F1X A;  2VCP A;  3KK7 A;  3IDH A;  3CCS N;  4CZM A;  5AQO A;  1NGI A;  1C0G A;  3U4L A;  5AQW A;  5JLF A;  2A40 A;  4CD1 A;  3WQT A;  3H3O B;  1NGE A;  3JXU A;  5BPN A;  5AQI A;  1VQP N;  1QZ5 A;  4CZE A;  5C2F A;  3CCM N;  5FPD A;  1ATS A;  3EO3 A;  4WQ4 C;  2YJF A;  5H1S Q;  3CF5 L;  3DXM B;  1MDU B;  5CE3 A;  5ADX A;  2FXU A;  3VGL A;  4DHY A;  5E26 A;  4BC4 A;  2PBD A;  4BRQ A;  3F9M A;  3NVK A;  2WC9 A;  3Q7B A;  3LDN A;  1VQN N;  4H5T A;  4KBO A;  4J8F A;  1NMD A;  3VF6 A;  3I55 N;  1VAZ A;  5AQP A;  2QWO A;  4WCE L;  2W40 A;  2WUS A;  3MN7 A;  3CJ1 A;  3O9S A;  2ITM A;  3VEW A;  3CC7 N;  2E88 A;  5B8H A;  3CJ9 A;  2IVP A;  3JS6 A;  3DWL A;  1BWF O;  3LM9 A;  2F9W A;  2F9T A;  3O9T A;  3U9D A;  2VGM A;  2CH6 A;  4BVP A;  5HOO A;  3N4P A;  3WXM B;  1VQO N;  4OPH A;  5LJW A;  1K9M O;  3K9J A;  4JHD A;  3TSU A;  4BR5 A;  4IEI A;  3G25 A;  3VEY A;  4F9O A;  4GY2 B;  2E2Q A;  4YOX A;  4BR2 A;  3ENH A;  2QW9 A;  4IJN A;  3O08 A;  3R3L A;  4GVE A;  2QA4 N;  2YHX A;  4AM6 A;  4CD3 A;  3L4Q A;  1KAZ A;  4FWP A;  3DXM A;  4IOX A;  3C65 A;  3LDP A;  3O1W A;  1Q82 O;  3D2E B;  1V4S A;  1HJO A;  3AY9 A;  1DT9 A;  1NGH A;  1T44 A;  2P9P B;  2FSK A;  1E4G T;  5JVG L;  2HMP A;  3U9Z A;  5AQT A;  5M1P A;  4I6M A;  4CZK A;  4XH1 A;  2Q0R A;  2RHK A;  3FE1 A;  2QWN A;  3CJB A;  3O9R A;  5AQM A;  2V7Z A;  4H5N A;  1U2V B;  4MLH A;  3U8X A;  4BR7 A;  1XC3 A;  3VET A;  1SQK A;  3O9U A;  4FWO A;  4BRK A;  3K9K A;  4CI6 A;  4GV6 A;  4WQ4 A;  3ZEU A;  1C0F A;  1TYQ A;  2GTD A;  2V7Y A;  4QS9 A;  3WXI A;  4R79 A;  1VQ7 N;  1IG8 A;  2GWJ A;  3VGK A;  1Q81 O;  4A5B A;  2FF6 A;  2BH1 A;  4DKW A;  3J8A A;  3HBT A;  3FZH A;  3I33 A;  1GLJ O;  5AZI B;  4CZF A;  2BUP A;  3D2F A;  3FZL A;  3QB0 A;  3P4I A;  3EN9 A;  3FR0 A;  4FWM A;  3LM2 A;  3PLA A;  1D4X A;  4K41 A;  3S41 A;  4B9Q A;  2I7P A;  3VTI A;  5GIO A;  4PKG A;  5JMV A;  1N8R O;  3BEX A;  4BRN A;  1QHA A;  3GL1 A;  3R9P A;  1YIT N;  4MO5 A;  1NGG A;  4O8U A;  1TUU A;  1YVN A;  2AA4 A;  2J4R A;  3LL3 A;  2NLX A;  3CD6 N;  3SMS A;  2ZJR L;  3H1Q A;  1VQM N;  3MCA B;  1NGB A;  1YHQ N;  4JKF A;  4BR0 A;  4JKE A;  5F2R A;  5BRD A;  3J7Z O;  1YXQ A;  3UB5 A;  3D7E O;  2YJE A;  3GDQ A;  2WBN A;  2KHO A;  3B8A X;  4DQ8 A;  1KD1 O;  3O4W A;  3TTD A;  1ZC6 A;  4JHD B;  3D2F B;  3OBY A;  4H5R A;  3VOV A;  4BRA A;  1X3M A;  4DB3 A;  3KWG A;  2GUP A;  4NO7 A;  4CBW A;  3ZX0 A;  5KPT A;  3KWI A;  3TSQ A;  2DPN A;  3VEX A;  3DJC A;  3H3N O;  1XQS C;  2ASM A;  3OBW A;  3WT0 A;  3G4S N;  5M1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...