3O9RA

Effector domain of ns1 from influenza a/pr/8/34 containing a w187a mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
118
structure length
118
Chain Sequence
ASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 36
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9rA00
3KWIA 3O9UA 3P31A 3O9QA 3RVCA 3L4QA 2KKZA 4OPAA 3M5RA 2GX9A 3EE8A 4OPHA 3KWGA 3OA9A 3EE9A 3P39A 3F5TA 3O9SA 3O9TA 3D6RA 3O9RA 3P38A 2RHKA
chains in the Genus database with same CATH superfamily
1HLUA 3OJUA 4JHDA 3H3OB 1IKWA 3R1XA 3FE1A 2AP1A 3QNOA 3SAGA 4NYNA 3ZYYX 4DWIA 3FLCO 4CEOA 4GVEA 5MLCQ 4HUFA 3ZSOA 4BRIA 1QSSA 3QLHA 5BPLA 4RW7A 4CIEA 3OYLA 4GNIA 2Y1IA 3ZX2A 4ZTJA 3TAMA 2F8TA 4JNEA 3DLHA 3J7YP 1NGGA 4FJJA 4DB3A 4FWQA 1X1PA 4CESA 2YKMA 3RR7A 4FVMA 3MN6A 2UXCK 1VK0A 2ZGYA 4DSLA 2CGJA 4A61A 4FZYA 2A42A 1DT9A 2WUSA 4LF5K 1S1UA 4NLBA 4DU1A 3DI6A 1WBBA 3TTCA 4KH5A 2P9KA 2O8CA 2D5RA 2QW9A 1NGIA 1NKBA 2FC0A 4IG3A 4LFBK 4EP5A 3GBTA 4E7LA 3GE1A 1NGAA 4JKDA 3VENA 1HQUA 1X3MA 3MN7A 1NK8A 2HHTA 3J7AP 3O08A 1O13A 3PO5A 2CGKA 3FFKB 3VA3A 4J8FA 4DQIA 4FK4A 3VQCA 3H1QA 4EFHA 3SLCA 3L6QA 1X9SA 3RRHA 4M41A 4C8KA 1VSLA 3VEXA 1VSJA 3AVFA 5BPNA 4AHRA 4KB0A 4DV2K 4CI6A 4B1XB 3KK3A 4FW2A 4CF2A 2P9SB 4GY2B 2HBJA 2Z1JA 4JV5K 1D9DA 1TYQB 4NXNK 1S1VA 4JKGB 1OKJA 3ID8A 2FBYA 3MEGA 5GIOA 3VQDA 3MN9A 4BROA 4LC9B 4C8NA 4XIUA 4AM7A 1VSMA 2OZMA 5M1NA 3K57A 2A1RA 4YOVA 2VQEK 1RTHA 3SNNA 4BRNA 4JLHA 4MDAA 4BE1A 2G8UA 5BN9A 3L2RA 3DRPA 2RKIA 3ZSWA 1BA1A 2E1ZA 1KSPA 2F4VK 5SWMA 4DTNA 4DQPA 1Q81O 5AQTA 5AJ3K 3KK7A 1SAZA 3OYIA 3P38A 3C6HA 1VRUA 1C0MA 3QMLA 4B9UA 3A2FA 4FLVA 3ID6A 4K0KK 1LCUA 3NGZA 3ENBA 4B8AB 4DV0K 4OPJA 1B9FA 3VEZA 1EWRA 3O8MA 4YOTA 3TAPA 2GWJA 1HKBA 2P9SA 4KHQA 5ADXA 3BEXA 3EN9A 2IC3A 2E5LK 4CHPA 4F3OA 3VTIA 3EZ5A 2FXUA 1W9HA 3TAGA 4KI4A 4XH1A 4CJ4A 2YCHA 4B3MK 5EX5A 4CEQA 3FFIA 3PIPL 2Q2RA 5KPZA 2A1SA 4DUYK 3OS0A 2V51B 2BUPA 1QZ6A 4N5SA 2QWQA 2P5OA 4FM1A 4DR2K 5M1PA 2FSKA 5HRNA 4X65K 4WFAL 4DSIA 1RBSA 1Q82O 4BRGA 4IDHA 4DSFA 3NGIA 1NK9A 4E1MA 2YNHA 2UUBK 1U45A 4RTFD 1NGHA 4BRQA 4DHYA 2YHXA 4W5QA 4NB4A 4DTOA 4FLXA 2ASOA 4QS9A 2A5XA 5HP1A 1NGCA 3T1HK 1HYVA 3OYKA 2VWBA 4CERA 4OGCA 3LDLA 4NO7A 1J5EK 4FL9A 2QK9A 3EEQA 4OKJA 3HT3A 1RDAA 3VF2A 4Z4HA 3TSQA 4QOZB 1EETA 4XH4A 4CJWA 3I0RA 2KZZA 2R7YA 1S1XA 1TL1A 4M3ZA 2E2QA 1NMNA 2YKNA 3SMSA 3A5OC 3O9TA 3CM6A 1HPZA 2HF3A 3O9RA 1WUAA 1DEJA 3DWLA 3SCXA 1C1AA 1HNWK 1UA0A 3QEIA 4CHZA 4YFUA 3WNFA 4CF1A 1WNSA 4LF9K 4J2EA 4BR0A 3QEXA 1QHTA 4W5NA 4A57A 4BRKA 2QKBA 1B9DA 4IOXA 2OANA 4IO9L 4DQRA 1M1KO 5BRFA 3S3OA 4B1VA 3RWUA 4BG8A 3V9SA 5BR9A 3CG7A 2O8DB 2DFHA 4FZXC 3CIPA 4HCCA 1S9EA 1TK0A 1U2VB 3C94A 3PO4A 2E2NA 4K43A 5EOYA 4CK3A 4FJGA 2VQFK 1S6QA 5HLFA 1KAYA 2D4WA 3AGKA 5ELZA 4NYFA 2HNZA 4H5VA 2PAVA 3ULDA 2QWLA 2QXFA 3TWHA 3B6OA 1Y97A 4E7IA 1JLCA 4H5WA 1SL0A 4B9TA 4LF8K 3DRRA 3F2KA 1KFSA 3CJCA 4FJIA 3LDOA 4JRPA 3O5BA 2E6MA 3TSPA 4O4GA 3OBWA 2P9IB 4IFVA 1A5XA 3W3DA 1J9AA 2IVOA 3UIQA 5FLXO 4CZIA 2YX6A 2HNYA 2LSNA 3C0BA 3U9ZA 3S3NA 1NNEA 4FYDA 4JI3K 3AA2A 4CGGA 2QKKA 1JLFA 3NVKA 2O8DA 1NG9A 4OVLA 4H4MA 2YV0X 4DQ8A 3OJSA 1U2VA 4N41A 4EIAA 3MXIA 3BDPA 3OYJA 4O8UA 3A5MC 4DS5A 3N4QA 3CCJN 3VTHA 4DSEA 4WQ5C 5GAEP 1X9MA 2F8SA 5JVGL 3FZHA 1RT1A 1ATSA 2GEMA 3CJBA 2WTUA 3SAFA 2YNFA 2ZJQL 4ICLA 3Q7CA 3SMPA 4EHTA 4DV7K 3QEPA 1VSFA 2AA4A 3O3GA 4FJ8A 3RVCA 5LL6Z 3S3MA 1T6DA 1Z05A 1RDBA 1HKCA 2OTJN 1BCMA 1RT6A 2JGUA 3MWTA 2FF6A 2OPQA 3PSIA 2P9IA 5AQRA 4PA1A 4AQYK 1K8KA 1HR0K 3KZBA 3LDQA 2FF3B 3HOSA 1BI4A 1QS4A 3G10A 3ZT1A 3KKSA 4WCEL 4NLCA 4WE1A 4FWLA 4FPAA 3VQ7A 3DXMB 3S9HA 1C6VA 4BE2A 4DCHA 4CZMA 3QIPA 4Z4IA 4CJSA 4KI6A 1BO5O 2A6AA 3U3GA 3QO9A 1BU6O 1WSHA 3WQUA 2Y1JA 3PX4A 2D0BA 3TPQA 1SKSA 4I6MB 1L3VA 2PY5A 3IS9A 2OPSA 4DTSA 4W5TA 3CMAN 4E1NA 4FLZA 5AZIB 3QEVA 3M8PA 5TKYA 1N6QA 3SQ1A 4DU4A 1LV5A 1SKWA 5EXWA 3CCQN 3V9WA 3OY9A 1UAXA 4B3RK 1RT7A 4O5BA 4AF1A 4K42A 1QQCA 3DLGA 4RG8A 5BRDA 1S22A 3C65A 2YI1A 3HP6A 2IS3A 3J7ZO 4KTZA 1XHZA 4BC4A 1JXBA 4HTLA 3U8XA 1XC3A 1HNXK 2W6KA 3FZMA 4BRDA 1U49A 4N76A 4BREA 4ISFA 4CGDA 3ZX3A 2FLOA 2QWOA 3RMDA 3OTOK 1RTJA 4BDZA 5I3UA 4FVUA 3AO4A 4FM0A 4JKCA 3G71N 3HL8A 1T6CA 3LDSA 1SZ2A 4AHTA 4BC5A 4B3SK 3JS6A 1O1WA 5C25A 2PYLA 3L0QA 3JYTA 1NJYA 1QSLA 1S72N 5JS1A 3QBXA 4I2QA 1ZXOA 2QA4N 1LW2A 3L2WA 4YOWA 2ETJA 2KKZA 3D2EA 1HX1A 3AO3A 3HK2A 4B8CA 2IOCA 3O3HA 4PY5A 4M3YA 4CD3A 4CZEA 4DTPA 3HO1A 3QINA 3L8BA 4IFYA 1QQOA 1TV6A 3KK1A 3HPHA 2VG7A 2PFUA 1XNQK 1KQSM 3E66A 2G8FA 1VQON 2G8WA 1VSEA 3KVGA 4BRLA 2RF2A 5HRPA 3OYNA 1VQMN 3A5NC 5DM6L 2NLXA 2NRXA 5KRSA 3P5JA 3D2FB 2KHOA 5BREA 3OYGA 3K5LA 1VQLN 2E2PA 4RW8A 2JLEA 4KH6A 4IKFA 3R6MA 1RDWX 3F9MA 5JLFA 4KHSA 2P9LB 5M1KA 2ZGZA 3VQ9A 2XY8A 3ZT3A 5M1FA 3GG4A 3EL2A 3NH0A 1IKYA 5GAHP 4Q0BA 3HSCA 1KRPA 3O4NA 1NKCA 1J53A 1JCEA 2KLAA 2XRIA 2X78A 3I55N 2V52B 3WUHA 4GV9A 3OYAA 3V1RA 1A5VA 2NUBA 2Q97A 1BOTO 1HNIA 4IOAL 4DQQA 3PSFA 4YDUA 1QSYA 4GW6A 1EQYA 3CJ7A 3L2UA 5HBMA 1XNRK 2Z1HA 2NRWA 3SV4A 2E20A 1K73O 4MO5A 4YHHK 4WFBL 2P9UA 4KHWA 1VSHA 5BN8A 4W5OA 3PV8A 5AZJB 4O0JA 3ZEUA 3C6TA 1ILYA 5A2QO 4M3WA 4CEEA 2V7YA 3QNNA 3VPZA 3QDKA 3R9PA 4BG9A 1RTDA 4FLTA 5AQVA 3LAKA 3A8YA 4AHVA 1VRTA 4DSKA 4FSVA 3WXIA 5J2PA 2KFZA 2FSNA 1KAZA 3HPGA 4J2BA 4UQGA 4DV6K 3L3VA 2GUIA 1JLAA 3AA4A 3P1GA 1EWQA 2QWMA 3SQ0A 2BANA 3KWGA 3CETA 4CFCA 3I33A 4O0IA 4BRAA 3KHYA 2A41A 4Q5VA 4Z0UA 3C95A 4CJEA 4J2DA 1XHXA 4BRPA 5CR4A 3UKRA 4F2RA 4GV6A 1WSJA 1TGOA 4KKOA 1JKHA 5KGXA 4FLWA 4B9LA 3KLIA 1N36K 4BQLA 3FZLA 1FJGK 3NFAA 3NAEA 1BQNA 1GLCG 4ISEA 5GINA 1JCGA 4LFCK 5AQMA 5FRNA 4KFBA 4CFDA 3MXJA 1NM1A 3N4PA 3QICA 3R8EA 5C15A 3KLHA 3Q7BA 4BR2A 3TU5A 1NJZA 4CHYA 4CFBA 4ISGA 3PY8A 5E41A 4RCHA 1S9GA 3HI0A 2GBZA 1VAZA 2YHBA 4H0XB 2V7ZA 1QTMA 5LMNK 3AAQA 2G8VA 3NF6A 4JD2B 1VQNN 4KREA 4H8KA 1EX4A 4DR3K 3M8RA 3CC2N 4JKAA 3F9KA 2ITGA 1EP4A 5LJVA 3V81A 2OYQA 2X6NA 5DM7L 3DAWA 3IUCA 3KWIA 3DLEA 1EO1A 3BY5A 1WBDA 3NGYA 3T7ZA 1KCFA 3THXB 3LAMA 1C0FA 1XI1A 3CM5A 4GVMA 4FJKA 2KZMA 4M63C 3VEOA 4KH4A 3D45A 3NBPA 2QWPA 3T1AA 3EE9A 4JI8K 4CJQA 5AQWA 3G4SN 3CCMN 1ZBFA 2YNGA 3SQ2A 4LF6K 3BGRA 4H4OA 4AILC 4MDBA 3AVNA 1EXQA 4M7YA 3UE5A 1RCHA 2O8EB 3DYAA 1VSIA 4FOIA 1L3SA 4R5PA 1DTQA 5DK5A 4M45A 1FXXA 5AQHA 5I42A 1QHAA 1W97L 3THWB 1NK7A 1U48A 2KTQA 3OW2M 1HYSA 4LD0A 1C1CA 1QVGM 1CZAN 2HHHK 3L2VA 3SPYA 1TYQA 4IBNA 3QEWA 1NJIO 1ASUA 2WBNA 2ZQBA 2NRVA 4JKGA 1EKEA 4H5RA 4DFMA 1CZ9A 1DKGD 4H0VB 4Z94A 5AQXA 2OTLN 3LALA 1G15A 1RBRA 1TUUA 4EZ6A 1NU0A 4L8RB 3K9JA 3VEVA 2H3GX 1IBLK 5EY4A 4H0YB 2O8FB 2AJQA 1D9FA 2EHGA 3D7EO 2YNIA 1T05A 4JI0K 4KBOA 5AQSA 2VWJA 3ZSRA 2P9PB 4JS4A 4I9LA 3IDHA 2GWKA 2CH6A 4HVJA 1RT3A 4BRHA 1E4FT 4BACA 2B5JA 2OPPA 1XWLA 4BRCA 4ZHRA 3ITHA 4OLAA 1VQ6N 3VQ4A 3IFRA 1S1TA 3SI6A 4YNQA 2VWKA 1TKZA 4CK1A 3IAYA 3DOLA 3O1BA 3V6DA 2XY6A 3AVLA 4JKFA 4BQZA 4WQ4C 1YAGA 1R0AA 3LL3A 1IV0A 4QAGA 3NMUA 4TSXA 4CJ3A 1T03A 4IO8A 4B1ZA 5AFUH 3VQAA 2FSJA 1TK5A 4LSLA 1NOYA 3HM9A 5FDLA 4JN4A 4IG0A 4V19S 3ASMA 1ASVA 2Q1NA 2RPIA 3SBGA 3HZ6A 2ZD1A 2O8FA 2ZJRL 4OGEA 3VGKA 3LM9A 2UYTA 1BCOA 3KLGA 3C7NB 1QQMA 2P9PA 1OH7A 2YHYA 3SPZA 5E84A 3CCVN 4FJLA 2VYPA 1KAXA 1RT2A 4IXCA 3VGMA 4BR7A 4PKHA 1LAVA 1C0GA 1WAFA 1BDGA 3VQ6A 1P8ZA 3OYBA 1LWFA 4JI5K 3MK6A 3SBTA 1RBVA 3VQPA 2I7PA 2ZF5O 3QETA 4WFNL 3ZCMA 1TVRA 4I2PA 3CMEN 1C0TA 1FW6A 3WXJA 5AQQA 1RT5A 2ZM6K 1YI2N 4CZJA 4C1NI 1XC9A 5FPEA 3UKUB 3V1QA 4FLYA 4CJVA 3JAMO 1L5UA 4K8ZA 3ENOA 3AVGA 5DMRA 3RTVA 4A5AA 4BRMA 1BISA 3AVKA 2HBKA 3DRSA 5FPMA 3NF7A 5J2NA 3CF5L 4IDKA 3CHWA 3U4LA 4CJ5A 3ZSQA 4DF4A 3ATUA 3OS1A 4IZ9A 3CCRN 3WEEB 3C7NA 3BZKA 3FZFA 1TAQA 4B9QA 4NCBA 1J54A 2E88A 3CQYA 1RTIA 2HVIA 5KTQA 3ZSVA 3VGLA 5AQYA 5HRRA 3SJHA 4K8XA 4OO1J 4F9OA 4KPYA 5AQJA 3EY1A 1JLEA 3AVJA 4CEZA 1W7AA 3K0SA 3G6EN 4U7BA 2ATQA 4DTUA 4CECA 5AQZA 3I8DA 3F73A 5J2QA 4KB1A 3CFPA 4CJRA 3E9LA 3ZETB 3WXKA 3WNGA 5AQGA 1JJ2M 4IEIA 3L2QA 1SL2A 3CC4N 1W2BM 1NJWA 3CJ1A 1JXEA 1IBKK 1NK6A 1RBTA 4DTJA 1VSKA 2IIRA 5KQ8A 1KD1O 4LF7K 3KD1E 4RW4A 3OBYA 2NNWA 3WT0A 3SV3A 1Z25A 1WOQA 3LDPA 5AQPA 4AH9A 1I3AA 3SJJA 3CCLN 2HB5A 2D0PA 1KTQA 3O3FA 4BR4A 1UA1A 1YVNA 3AO1A 4E7JA 4HWIA 4F4KA 1SKRA 3AY9A 2D1KA 4BWMA 3K5NA 2EWSA 1MWKA 4JI4K 1NKEA 4JK9A 1GLFO 4CBWA 3VOVA 4CEBA 1R59O 3EKSA 5KPRA 1X9WA 1NBWA 4CF0A 1IG9A 4LY7A 5JLHA 3O9UA 3LP2A 4E7HA 1WSGA 3E1YA 3ATVA 4DMNA 3I0SA 4ZTFA 2HBLA 4J2AA 2O4GA 4BDPA 3K9KA 3E01A 4IFEA 4CF8A 4IWVA 2NZTA 1YJ9N 1NK0A 1LOTB 2HHXA 1IKXA 1GLLO 4M3UA 3OYEA 4GKJK 4RW6A 4CJ7A 4PUOA 4Y0WA 4FOEA 4JS5A 2BE2A 3AAPA 3QFPA 3CQXA 2VG5A 4WQ5A 5F2RA 4M7XA 4DV3K 1K9MO 4BWJA 4FXDA 1GLDG 4F8RA 3O4WA 2NRRA 2PBDA 3OS2A 3CI5A 3EYZA 4FJXA 3V9UA 1ITGA 1NK5A 4BC3A 3CPWM 1Q18A 4AHUA 4O8KA 4XEIA 4PL8A 4FWPA 3TARA 4CEAA 1KFDA 5BR8K 3CCSN 1CLQA 3THYB 3DXKB 4KTQA 3H46O 4K41A 3RRGA 4BR5A 3RR8A 5LY3A 1C0UA 5FROA 1HMVA 2QTDA 1ZC6A 1SUQA 4DV1K 3DXMA 4OPAA 2O8BB 3C6UA 3LZIA 1V4TA 4QS8A 1HPMA 3L4IA 4JI1K 5GADP 1OVQA 3DLKA 2VGNA 5E26A 3CQ8A 4DR1K 1N33K 1D4XA 3AVMA 4K25A 1KVCA 2E1YA 5HRSA 3HOTA 3DLRA 5F0XA 3MMVA 2W42A 3SUPA 4KHNA 3MWPA 4I6MA 4FZZA 5J2MA 5LMUK 5AZIA 1RT4A 4ID1A 4O44A 4HCBA 4DKWA 3LDNA 3T1YK 5H1SQ 1YXQA 1Q9XA 1TK8A 2E8AA 1LWEA 4I7FA 3HPOA 3RSEB 4E3SA 3SAHA 1V4SA 2HBMA 1RILA 1GLEG 4YOYA 4CJTA 3HM8A 4YORA 1E3MA 2VGMA 3EKUA 3AO2A 1GOBA 3V9ZA 3H6EA 1TKDA 1VQ8N 1W0HA 1TL3A 5I9EB 1RFQA 5AQIA 2HHUA 2QI2A 3BF1A 3G25A 4OKKA 2KW4A 2Q3SA 3SK3A 3AARA 2F9TA 2HHQA 2WOMA 1WLJA 4LFAK 5GIPA 5ADXH 4CZGA 2PZSA 3OYDA 4F3TA 3S41A 1WSFA 1Z6RA 1N5YA 1XMQK 1WB9A 2JWLA 4KAZA 4BE0A 1U4BA 1N32K 3CFRA 2Z1GA 3WXMB 4CZHA 4JHDB 2EX3A 4H0OA 4BC2A 1YJWN 4Z4EA 1T44A 2J4RA 5TKWA 1D5AA 2I5JA 4CZFA 4N56A 2HOEA 4DUZK 5C0YA 1N34K 3SUNA 1B92A 4JI2K 4JKBA 4FK0A 1K6YA 1S6PA 1VSDA 3P31A 3RSEA 2HHWA 4Y1CA 4ILHA 2UUCK 4LSNA 1VQ9N 2KQ2A 4BRFA 3MN5A 5AQOA 4O55A 3QIOA 3VQBA 1OH6A 1Q86O 4KHPK 1MDUB 4FWRA 1MA9B 3AVCA 3GL1A 2QM1A 4H0PA 4B9SA 3WNEA 2UXDK 1YIJN 3OYCA 3TAEA 1HKGA 2P5GA 1YVUA 3NE6A 3AV9A 4JI6K 2O8CB 3KTQA 3ISNC 1C1BA 2XY7A 3AA5X 3D2FA 4MQ3A 4DTMA 2X6SA 4NCAA 4N47A 4DR7K 4QCLA 3VMFB 2XHBA 1QE1A 1VQ4N 2P9LA 4DFKA 1RGIA 4OX9K 2ITMA 4E19A 3HVRA 5JS2A 4ELVA 2WFBA 1BL3A 1ZBLA 4B3OA 1Q9YA 1J6ZA 3BUZB 3ENHA 2PYJA 3HSTB 1NGDA 2ASMA 3PUFA 1BGXT 4CIGA 3MCPA 3FGUA 4WF9L 1ESVA 5AR0A 3LM2A 1NK4A 1TAUA 4FLUA 4FJNA 2BH1A 4Z4FA 4BGBA 4ELUA 1BA0A 3NH1A 4CD1A 3PLAA 1XQSC 4OPHA 2UUAK 4DF8A 1BUPA 3GDQA 1WSIA 4FM2A 4YOXA 2BGGA 5M1QA 3K5MA 2W40A 4KV8A 5AZJA 2ZJPL 4AM6A 3KKRA 3MX2A 3O9QA 3PX0A 4E0DA 2HVHA 4CF9A 1VQPN 2YHWA 4CCHA 1UOCA 3QESA 3VF6A 2Q31A 5CZ1A 3L3UA 3MDQA 4QS7A 1S1WA 4FWNA 4CBXA 3OA9A 3ZX0A 4H5TA 1CXQA 5AQLA 1KLNA 2Q36A 1YT3A 3D6RA 1HRHA 3SYZA 4C8LA 2QXLA 4FWOA 2BDPA 1SL1A 1N8RO 1J5OA 4BDYA 1NGJA 3KLFA 1ZBHA 3LP3A 1NGFA 2F9WA 2P9NB 3DMJA 1I94K 5IT9O 1NMDA 3DJCA 1SV5A 4NCGA 5AQNA 1S3XA 3TI0A 4AHCA 4UY8O 2UU9K 1ZBIA 2WC9A 4CHQA 3M6GA 5BPMA 1L3UA 5LJWA 1LWCA 1GOCA 3VEYA 1GLBG 2IGIA 2DFEA 4CHNA 1TKXA 1ZYQA 3VESA 1OVYA 3VF4A 1F21A 3QFUA 3OYHA 5C2DA 2FBXA 2HNDA 3ALYA 4JD2A 5EU7A 2W6LA 3NH2A 3NCIA 5GAGP 4X66K 3BP8A 2IAJA 2W41A 4FCYA 1HNZK 3TAFA 5C10A 4CGIA 2P1JA 5C12A 1Q7YO 3IG1A 2CH5A 3OHRA 1FKOA 3HYFA 3V9XA 2QEXN 3THXA 3D0PA 2ZWHA 3EE8A 3NDKA 5AQUA 5IWAK 3U9DA 2DPNA 2P9NA 2RN2A 1CXUA 1T8EA 4DQSA 4A2BA 4FJ9A 2YJEA 1NLVA 5F1XA 3AVAA 4CJLA 1KXPA 3EZWA 3AO5A 1IH7A 3E9PA 2D0CA 3J8AA 2B6AA 5FPDA 4B1UB 4YY3K 1QQNA 2OPRA 4CK2A 1RDUA 3LANA 2O8EA 1JL1A 3R3LA 4PQUA 3M1FA 4Z4GA 3THWA 1G99A 3H08A 1DGKN 4B1WB 1MU2A 1IO2A 1Y64A 2G8KA 2Q0UA 4E7KA 2E2OA 4GKKK 3HTVA 4M3TA 1T3VA 1XUPO 2OCEA 4NXMK 1D8YA 5T7BA 2DFFA 3ZT2A 4BVPA 3AVHA 3JSMA 2XO7A 1JL2A 4YOUA 2IVNA 4IJAA 1E4GT 3IRXA 4B3TK 1YUWA 2BTFA 4H0TB 3O9SA 4WYBA 1H1VA 4C8MA 2RE2A 5C24A 4LH4A 1WSEA 4FJ5A 4LH5A 5JICA 2IDOA 2YHAA 4DFPA 2HF4A 4H03B 4CZKA 4FJMA 4EAHD 3ZLJA 1WN7A 2JWKA 3K2PA 1YTAA 4CBUA 5AQKA 3CYMA 3P4IA 3HP9A 2GV9A 3AVBA 4L3QA 4C1NK 1X3NA 3ZT4A 4HHTA 4M3XA 1X9JA 5KI6A 4MLHA 2DTUA 5C2FA 1TUYA 3LWMA 1HYZA 1BIZA 4WQ4A 4OLBA 4CIFA 2A40A 4R79A 3THVA 1ASWA 3CJAA 1LW0A 3MEDA 4CGJA 3KIOA 2GX9A 4FWMA 3DLLL 1QVFM 3FR0A 2HMPA 3B8AX 3MEEA 2P51A 4Z4CA 4GV3A 3OVNA 2E4LA 3PX6A 4CGFA 5CYQA 3NF8A 5D3GA 2GTDA 5JMVA 2DY4A 1A5WA 1KVBA 1RNHA 5KPTA 4M42A 2ZE2A 1IJJA 2D0AA 4E1JA 2FBTA 5J1EA 1FK9A 5SZTA 4FO0A 4G9ZA 5FRMA 1RBUA 3CCEN 4CW7B 1Q8IA 1BG3A 4IJNA 4CJKA 1P90A 3CD6N 4PHTX 4RWTA 5B8HA 4PL7A 1HJOA 3AA3A 3LPTA 3MXMA 1U6ZA 2QWNA 3IMXA 3IKMA 1YTUA 3C6AA 3H3NO 3RMBA 2O4IA 4RW9A 1QZ5A 4PKIA 5KQDA 3UKUA 1K8KB 4BGAA 2VG6A 4ILJA 4CHOA 4C23A 1BI4B 4DS4A 4A59A 3F5TA 1ZBUA 4JRQA 5CYMA 4PKGA 4KHUA 3VQ5A 1BHLA 4JEPA 3T19A 4FK2A 4ELTA 4PWDA 1MWMA 4OKEA 4MFBA 3V1OA 4B9NA 4B9MA 4H5NA 1JCFA 4KO0A 3ZSYA 3WEEA 2B4JA 1IG8A 3JXUA 3ZSZA 3CC7N 3ULEB 1VQ5N 4FWKA 1HQEA 3K58A 3HJFA 3CJ9A 3M8SA 1UWBA 4CJFA 4MLEA 3WNHA 3RMAA 3DLBA 4DR5K 5HROA 3O80A 2D0OA 2ASPA 2WONA 4FJ7A 2F7TA 1LAWA 4B9VA 1YITN 4FW1A 2OZSA 3AGRA 3ZETA 2Q0RA 3SZ2A 1HNVA 4MO4A 3DOKA 3EO3A 1L3TA 4U67L 4FPBA 1YF5L 3AVIA 3K59A 4A5BA 5CZ2A 3A5LC 3NF9A 3HBTA 1ATRA 4AHSA 1NOZA 1JLQA 3BZCA 3K5OA 4KTWA 4A2AA 1SQKA 4CEDA 4HUGA 4KRFA 3CERA 1T7PA 3SQ4A 1U47A 1S5JA 3U3YA 2A3ZA 3H1VX 4E89A 3G0ZA 4I9QA 3TAQA 2E6LA 4DR6K 2FBVA 1KVAA 3MAQA 1NWKA 5CE3A 3CXCM 3ULEA 2IVPA 3QB0A 1HUXA 3VQQA 3CFOA 4JK7A 4C8OA 2RHKA 3P83D 4OPKA 5BRHA 3TR8A 3RMCA 5KGWA 3FZKA 1DTTA 3SUQA 1NGEA 1XMOK 4FJHA 3TTDA 4X64K 2G8HA 1GOAA 4B08A 2OA8A 5AFUA 3LP1A 3WXLA 2KFNA 3M5RA 4DFJA 5C42A 4XH5A 3TTFA 2QWRA 2NRHA 4OJRA 3U6FA 5FPNA 3BF3A 3VETA 4JKEA 1HJRA 4IEEA 1KLMA 4KHYA 3M8QA 1NGBA 3OYMA 2HW3A 4JK8A 4O5FA 1SS6A 3D2EB 3OYFA 1FKPA 3HRGA 1M90O 1WAJA 4DV5K 3QBWA 3LP0A 4DU3A 4CJUA 3MECA 4JI7K 3NVMA 1BQMA 5KRTA 5HOOA 1BWFO 1TKTA 4DSJA 3I56N 3P39A 2GELA 3HXMA 4BVOA 4DTRA 4JAXA 3J80O 4DR4K 4GMJB 3VEWA 1IKVA 2XY5A 4A62A 4EZ9A 3LZJA 1ATNA 4M3RA 3B6PA 4ILGB 3NHGA 4CJPA 1NJXA 1RDCA 1GLAG 4LF4K 1CZBA 4CZLA 3THYA 3VA0A 3DXKA 1VQKN 3L4QA 1REVA 5JVHL 3UB5A 2HHVA 3KD5E 2NRZA 4CFAA 4DLEA 2YJFA 4BR9A 3CPEA 1YJNN 2O8BA 4DLGA 3ZT0A 3KLEA 3VERA 3V4IA 1IBMK 1VQ7N 2CGLA 3O1WA 2HSTA 1ZBSA 4G1QA 1OH8A 3MX5A 3GOIA 2X74A 3LPUA 3T3FA 1GLJO 3J81O 4CGHA 4JYAK 1U04A 4YDUC 4DG1A 4CE9A 4CVNE 1OH5A 3TSUA 4BY9C 1VHXA 1JLBA 3VN5A 5M1OA 1K8AO 4JKHA 1DLOA 1RDDA 5AQFA 3T69A 4EP4A 2NRTA 2P9UB 3QERA 3W0LA 3PIOL 3O6WA 2VCPA 3O4QA 3HVTA 4HTUA 3ZEUB 3DM2A 3M3ZA 4IOCL 3A0IX 3TABA 2HMIA 3KJVA 4EHUA 4ID5A 4F2SA 5CY4A 4FWSA 3ZSXA 4X62K 5K14A 1BIUA 1JLGA 2F96A 2GUPA 3SUOA 3WQTA 3CCUN 1I39A 4DTXA 2Z1IA 3VQ8A 5HL7L 5EVZA 3TANA 1KC8O 4Y1DA 4B1YB 4W5RA 3KK2A 4DV4K 1Z26A 3LWLA 2G8IA 3H45C 3MCAB 3VQEA 2UXBK 3I8BA 2P9KB 2I7NA 4HUEA 3UKRB 5CHIA 1YHQN 3E9OA 2HHSA 4CEFA
chains in the Genus database with same CATH topology
2W41A 1HLUA 3WEEB 3C7NA 4JHDA 3FZFA 3H3OB 3R1XA 4B9QA 3FE1A 2E88A 3CQYA 5BRDA 5C10A 1S22A 2AP1A 3C65A 3SAGA 3VGLA 2YI1A 3ZYYX 5AQYA 3SJHA 5C12A 1Q7YO 2CH5A 3OHRA 4OO1J 4F9OA 2QEXN 3J7ZO 5AQJA 3FLCO 4GVEA 5MLCQ 2ZWHA 4BC4A 4BRIA 3EE8A 4HTLA 3U8XA 5AQUA 5BPLA 3U9DA 1XC3A 2DPNA 2P9NA 4U7BA 3G6EN 5AQZA 4GNIA 3FZMA 4BRDA 4A2BA 2YJEA 1NLVA 4ISFA 3ZX2A 4BREA 5F1XA 3E9LA 1KXPA 3EZWA 4JNEA 3ZETB 3E9PA 3WXKA 5AQGA 3ZX3A 2FLOA 2QWOA 1JJ2M 3J8AA 1NGGA 5FPDA 4IEIA 4DB3A 4FWQA 3CC4N 4B1UB 1W2BM 4FVUA 3CJ1A 1QQNA 1RDUA 3MN6A 3R3LA 4JKCA 2ZGYA 2CGJA 4A61A 3M1FA 2A42A 3G71N 1T6CA 5KQ8A 1DT9A 2IIRA 1KD1O 2WUSA 1G99A 1SZ2A 4B1WB 1DGKN 4NLBA 1Y64A 4BC5A 3JS6A 3OBYA 3TTCA 2Q0UA 2E2OA 2NNWA 4KH5A 2P9KA 3WT0A 3HTVA 1WOQA 3LDPA 1T3VA 1XUPO 2QW9A 1NGIA 5AQPA 3L0QA 1S72N 3CCLN 3QBXA 2D0PA 1ZXOA 3GBTA 4BVPA 3GE1A 2QA4N 1NGAA 4BR4A 1YVNA 4YOWA 4JKDA 4HWIA 3VENA 2KKZA 4YOUA 2IVNA 1HX1A 3D2EA 3AY9A 1X3MA 2D1KA 3MN7A 4IJAA 2EWSA 3O08A 1MWKA 1O13A 2CGKA 1E4GT 3FFKB 1YUWA 4CD3A 2BTFA 4H0TB 4J8FA 3O9SA 3H1QA 4WYBA 4CZEA 4EFHA 1H1VA 3SLCA 3L6QA 4JK9A 1GLFO 1QQOA 2RE2A 4CBWA 3VEXA 3VOVA 2PFUA 1R59O 3EKSA 5JICA 5KPRA 1KQSM 5BPNA 3E66A 1NBWA 2HF4A 4H03B 4CZKA 1VQON 5JLHA 3O9UA 3KVGA 4BRLA 4EAHD 4CI6A 4B1XB 1VQMN 2P9SB 4GY2B 3A5NC 3ATVA 3E1YA 2NLXA 5GAGP 5DM6L 2JWKA 2HBJA 2NRXA 2HBLA 1TYQB 3D2FB 2KHOA 4JKGB 5AQKA 4CBUA 5BREA 2E2PA 1VQLN 1OKJA 3ID8A 3P4IA 5GIOA 3MN9A 4BROA 4L3QA 3K9KA 4LC9B 4C1NK 4KH6A 1X3NA 4IFEA 4IWVA 2NZTA 4AM7A 1YJ9N 1LOTB 5M1NA 1GLLO 1X9JA 1RDWX 3R6MA 4YOVA 4MLHA 3F9MA 5JLFA 2P9LB 5M1KA 5C2FA 2ZGZA 4CJ7A 4Y0WA 4FOEA 4BRNA 1TUYA 4MDAA 5M1FA 3AAPA 3GG4A 3CQXA 3QFPA 4WQ5A 4WQ4A 4M7XA 5F2RA 5BN9A 3EL2A 1K9MO 2A40A 4R79A 5GAHP 1GLDG 3CJAA 3O4WA 2NRRA 2PBDA 1BA1A 3CI5A 3HSCA 2KLAA 1JCEA 2E1ZA 2GX9A 4FWMA 3DLLL 3I55N 2V52B 3WUHA 5AQTA 4BC3A 1Q81O 4GV9A 3FR0A 2HMPA 3CPWM 1Q18A 1QVFM 3B8AX 3KK7A 4O8KA 1SAZA 4XEIA 2Q97A 1BOTO 4PL8A 4IOAL 4FWPA 3P38A 4GV3A 3C6HA 3QMLA 4YDUA 3CCSN 3ID6A 1EQYA 2GTDA 5JMVA 3DXKB 1LCUA 3CJ7A 3ENBA 5KPTA 3H46O 4K41A 1IJJA 2NRWA 2E20A 4BR5A 5LY3A 1K73O 3VEZA 4MO5A 2QTDA 4E1JA 1ZC6A 4WFBL 2P9UA 3O8MA 4FO0A 4YOTA 2GWJA 3DXMA 4OPAA 4G9ZA 1HKBA 2P9SA 5ADXA 1V4TA 3BEXA 3EN9A 4QS8A 5BN8A 3CCEN 5AZJB 1HPMA 3ZEUA 1BG3A 3VTIA 4IJNA 3L4IA 2FXUA 1P90A 3CD6N 4PHTX 1ILYA 4RWTA 2V7YA 5GADP 3VPZA 3QDKA 3R9PA 4XH1A 4BG9A 2YCHA 2VGNA 5E26A 5AQVA 5B8HA 1HJOA 4PL7A 1D4XA 1U6ZA 3A8YA 2E1YA 4K25A 2QWNA 3IMXA 3IKMA 5EX5A 4FSVA 3HOTA 3WXIA 5F0XA 3PIPL 3MMVA 2Q2RA 5KPZA 3C6AA 3MWPA 3H3NO 4I6MA 2V51B 2FSNA 2BUPA 1KAZA 1QZ6A 2QWQA 5KQDA 1QZ5A 4PKIA 3UKUA 5M1PA 2FSKA 1K8KB 4BGAA 2QWMA 4ILJA 5AZIA 4C23A 3KWGA 3CETA 4WFAL 3I33A 4BRAA 3KHYA 3LDNA 4A59A 3F5TA 4BRGA 4DKWA 1Q82O 5H1SQ 1YXQA 2A41A 4IDHA 2E8AA 4PKGA 4JEPA 4BRPA 3RSEB 1MWMA 5CR4A 3UKRA 4GV6A 4RTFD 3SAHA 1NGHA 1V4SA 2HBMA 1GLEG 4BRQA 4H5NA 1JCFA 4DHYA 4YOYA 4BQLA 2YHXA 3FZLA 3HM8A 4NB4A 4YORA 1IG8A 3WEEA 2ASOA 2VGMA 3EKUA 4QS9A 3JXUA 2A5XA 3CC7N 1GLCG 4ISEA 3ULEB 4FWKA 5GINA 3H6EA 1VQ5N 1VQ8N 1JCGA 5AQMA 1NGCA 3CJ9A 5I9EB 1RFQA 4MLEA 1NM1A 3N4PA 3QICA 5AQIA 3R8EA 5C15A 2QI2A 3BF1A 3Q7BA 4BR2A 2VWBA 3TU5A 3O80A 3G25A 3LDLA 4ISGA 4NO7A 2D0OA 2ASPA 4FL9A 3SK3A 4RCHA 3AARA 2F7TA 2F9TA 3HI0A 3VF2A 1YITN 5GIPA 1VAZA 5ADXH 3AGRA 4H0XB 2V7ZA 2Q0RA 3TSQA 3ZETA 4XH4A 3AAQA 4CZGA 4MO4A 3EO3A 4U67L 4FPBA 4JD2B 1YF5L 3S41A 1VQNN 1Z6RA 4A5BA 3A5LC 2E2QA 2JWLA 3HBTA 1ATRA 3CC2N 4JKAA 3SMSA 3WXMB 4A2AA 1SQKA 3A5OC 4CZHA 3O9TA 4H0OA 4JHDB 4BC2A 1YJWN 1T44A 2J4RA 5TKWA 2HF3A 3O9RA 1WUAA 5LJVA 4CZFA 3CERA 1DEJA 3DWLA 2HOEA 5C0YA 5DM7L 3DAWA 4JKBA 3IUCA 3KWIA 1EO1A 3T7ZA 2A3ZA 3H1VX 3P31A 3RSEA 4BR0A 4ILHA 1C0FA 4A57A 4BRKA 1VQ9N 4IOXA 2OANA 4M63C 1NWKA 4IO9L 5CE3A 3VEOA 1M1KO 3CXCM 4KH4A 4BRFA 5BRFA 3MN5A 3ULEA 2QWPA 2IVPA 3EE9A 3QB0A 4B1VA 5AQOA 1HUXA 5AQWA 4BG8A 3G4SN 3CCMN 1Q86O 4JK7A 1MDUB 4FWRA 5BR9A 2RHKA 1MA9B 4MDBA 5BRHA 3GL1A 2QM1A 3FZKA 4M7YA 4H0PA 3CIPA 3UE5A 1NGEA 4FOIA 1U2VB 3TTDA 2E2NA 4K43A 1YIJN 5EOYA 5AFUA 5AQHA 3WXLA 1QHAA 1W97L 1HKGA 3OW2M 3M5RA 1KAYA 1QVGM 2D4WA 1CZAN 3AGKA 4XH5A 3TTFA 2QWRA 5ELZA 2NRHA 1TYQA 1NJIO 4H5VA 2WBNA 3D2FA 2PAVA 2NRVA 3BF3A 4JKGA 4JKEA 5FPNA 3VETA 4IEEA 2QWLA 4H5RA 1DKGD 4H0VB 4Z94A 5AQXA 2OTLN 3VMFB 1NGBA 4H5WA 1TUUA 3F2KA 4JK8A 4O5FA 1SS6A 3D2EB 2H3GX 3K9JA 3CJCA 3VEVA 3LDOA 1VQ4N 5EY4A 3HRGA 1M90O 2P9LA 4H0YB 3O5BA 1RGIA 3QBWA 3TSPA 3OBWA 2P9IB 3D7EO 2ITMA 3NVMA 3W3DA 4KBOA 5AQSA 1BWFO 2IVOA 2WFBA 5HOOA 3I56N 2P9PB 3P39A 1J6ZA 3BUZB 4CZIA 2GELA 2YX6A 3ENHA 2GWKA 3IDHA 2CH6A 4BVOA 1NGDA 2ASMA 4JAXA 1E4FT 4BRHA 3C0BA 3U9ZA 4BRCA 3VEWA 3MCPA 3FGUA 4A62A 4WF9L 1ATNA 1VQ6N 1ESVA 3NVKA 4ILGB 5AR0A 3IFRA 3LM2A 1GLAG 4CZLA 3DXKA 2BH1A 4DQ8A 3O1BA 4BGBA 1BA0A 3L4QA 1VQKN 1U2VA 4EIAA 5JVHL 4CD1A 3UB5A 4O8UA 3A5MC 2NRZA 1XQSC 3N4QA 4OPHA 3PLAA 2YJFA 4BR9A 3CPEA 3VTHA 3CCJN 4BQZA 4JKFA 1YJNN 4WQ4C 1BUPA 3GDQA 4WQ5C 1YAGA 5GAEP 3LL3A 4YOXA 5JVGL 3NMUA 5M1QA 3FZHA 2W40A 1ATSA 2GEMA 3CJBA 5AZJA 3SAFA 3VERA 2ZJQL 4IO8A 4B1ZA 3Q7CA 3SMPA 4EHTA 2ZJPL 5AFUH 4AM6A 1VQ7N 2CGLA 2FSJA 3O1WA 2AA4A 2HSTA 1ZBSA 3MX2A 3O9QA 4JN4A 3RVCA 3MX5A 3GOIA 1VQPN 2Q1NA 2YHWA 3SBGA 1T6DA 1Z05A 2Q31A 3VF6A 1GLJO 1HKCA 3HZ6A 4YDUC 3MDQA 2OTJN 4QS7A 3TSUA 4BY9C 2ZJRL 4FWNA 3MWTA 4CBXA 2FF6A 2P9IA 3OA9A 3ZX0A 5M1OA 4H5TA 3LM9A 2UYTA 3VGKA 1K8AO 5AQLA 5AQRA 2Q36A 3C7NB 3D6RA 1K8KA 3KZBA 1QQMA 2FF3B 2P9PA 2YHYA 3LDQA 4JKHA 3HOSA 5E84A 5AQFA 3T69A 4WCEL 3CCVN 2NRTA 4NLCA 2QXLA 2VYPA 4FWLA 4FWOA 4FPAA 2P9UB 1N8RO 1KAXA 3W0LA 3DXMB 4IXCA 3PIOL 3VGMA 4BR7A 3O6WA 4PKHA 1C0GA 2VCPA 1NGJA 3ZEUB 4DCHA 3M3ZA 1NGFA 4CZMA 2F9WA 4IOCL 1BDGA 2P9NB 1P8ZA 3A0IX 1NMDA 3DJCA 4EHUA 5AQNA 1S3XA 3MK6A 4FWSA 3SBTA 2I7PA 1BO5O 2A6AA 2ZF5O 4UY8O 4WFNL 1BU6O 2WC9A 3WQUA 2GUPA 3TPQA 3CMEN 3M6GA 3WQTA 3CCUN 4I6MB 5BPMA 5LJWA 3WXJA 5AQQA 1YI2N 4CZJA 4C1NI 3VEYA 1GLBG 5FPEA 3UKUB 5EVZA 5HL7L 3CMAN 1KC8O 4B1YB 3ENOA 3VESA 1OVYA 5AZIB 3VF4A 5TKYA 4A5AA 4BRMA 3QFUA 3H45C 3MCAB 2HBKA 5C2DA 5FPMA 3I8BA 5EXWA 4JD2A 2P9KB 2I7NA 3CCQN 3CF5L 3UKRB 3CHWA 3U4LA 5CHIA 3ATUA 3E9OA 1YHQN 4AF1A 4IZ9A 3CCRN 4K42A 3BP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWI A;  3O9U A;  3P31 A;  3O9Q A;  3RVC A;  3L4Q A;  2KKZ A;  4OPA A;  3M5R A;  2GX9 A;  3EE8 A;  4OPH A;  3KWG A;  3OA9 A;  3EE9 A;  3P39 A;  3F5T A;  3O9S A;  3O9T A;  3D6R A;  3O9R A;  3P38 A;  2RHK A; 
#chains in the Genus database with same CATH topology
 1HLU A;  3OJU A;  4JHD A;  3H3O B;  1IKW A;  3R1X A;  3FE1 A;  2AP1 A;  3QNO A;  3SAG A;  4NYN A;  3ZYY X;  4DWI A;  3FLC O;  4CEO A;  4GVE A;  5MLC Q;  4HUF A;  3ZSO A;  4BRI A;  1QSS A;  3QLH A;  5BPL A;  4RW7 A;  4CIE A;  3OYL A;  4GNI A;  2Y1I A;  3ZX2 A;  4ZTJ A;  3TAM A;  2F8T A;  4JNE A;  3DLH A;  3J7Y P;  1NGG A;  4FJJ A;  4DB3 A;  4FWQ A;  1X1P A;  4CES A;  2YKM A;  3RR7 A;  4FVM A;  3MN6 A;  2UXC K;  1VK0 A;  2ZGY A;  4DSL A;  2CGJ A;  4A61 A;  4FZY A;  2A42 A;  1DT9 A;  2WUS A;  4LF5 K;  1S1U A;  4NLB A;  4DU1 A;  3DI6 A;  1WBB A;  3TTC A;  4KH5 A;  2P9K A;  2O8C A;  2D5R A;  2QW9 A;  1NGI A;  1NKB A;  2FC0 A;  4IG3 A;  4LFB K;  4EP5 A;  3GBT A;  4E7L A;  3GE1 A;  1NGA A;  4JKD A;  3VEN A;  1HQU A;  1X3M A;  3MN7 A;  1NK8 A;  2HHT A;  3J7A P;  3O08 A;  1O13 A;  3PO5 A;  2CGK A;  3FFK B;  3VA3 A;  4J8F A;  4DQI A;  4FK4 A;  3VQC A;  3H1Q A;  4EFH A;  3SLC A;  3L6Q A;  1X9S A;  3RRH A;  4M41 A;  4C8K A;  1VSL A;  3VEX A;  1VSJ A;  3AVF A;  5BPN A;  4AHR A;  4KB0 A;  4DV2 K;  4CI6 A;  4B1X B;  3KK3 A;  4FW2 A;  4CF2 A;  2P9S B;  4GY2 B;  2HBJ A;  2Z1J A;  4JV5 K;  1D9D A;  1TYQ B;  4NXN K;  1S1V A;  4JKG B;  1OKJ A;  3ID8 A;  2FBY A;  3MEG A;  5GIO A;  3VQD A;  3MN9 A;  4BRO A;  4LC9 B;  4C8N A;  4XIU A;  4AM7 A;  1VSM A;  2OZM A;  5M1N A;  3K57 A;  2A1R A;  4YOV A;  2VQE K;  1RTH A;  3SNN A;  4BRN A;  4JLH A;  4MDA A;  4BE1 A;  2G8U A;  5BN9 A;  3L2R A;  3DRP A;  2RKI A;  3ZSW A;  1BA1 A;  2E1Z A;  1KSP A;  2F4V K;  5SWM A;  4DTN A;  4DQP A;  1Q81 O;  5AQT A;  5AJ3 K;  3KK7 A;  1SAZ A;  3OYI A;  3P38 A;  3C6H A;  1VRU A;  1C0M A;  3QML A;  4B9U A;  3A2F A;  4FLV A;  3ID6 A;  4K0K K;  1LCU A;  3NGZ A;  3ENB A;  4B8A B;  4DV0 K;  4OPJ A;  1B9F A;  3VEZ A;  1EWR A;  3O8M A;  4YOT A;  3TAP A;  2GWJ A;  1HKB A;  2P9S A;  4KHQ A;  5ADX A;  3BEX A;  3EN9 A;  2IC3 A;  2E5L K;  4CHP A;  4F3O A;  3VTI A;  3EZ5 A;  2FXU A;  1W9H A;  3TAG A;  4KI4 A;  4XH1 A;  4CJ4 A;  2YCH A;  4B3M K;  5EX5 A;  4CEQ A;  3FFI A;  3PIP L;  2Q2R A;  5KPZ A;  2A1S A;  4DUY K;  3OS0 A;  2V51 B;  2BUP A;  1QZ6 A;  4N5S A;  2QWQ A;  2P5O A;  4FM1 A;  4DR2 K;  5M1P A;  2FSK A;  5HRN A;  4X65 K;  4WFA L;  4DSI A;  1RBS A;  1Q82 O;  4BRG A;  4IDH A;  4DSF A;  3NGI A;  1NK9 A;  4E1M A;  2YNH A;  2UUB K;  1U45 A;  4RTF D;  1NGH A;  4BRQ A;  4DHY A;  2YHX A;  4W5Q A;  4NB4 A;  4DTO A;  4FLX A;  2ASO A;  4QS9 A;  2A5X A;  5HP1 A;  1NGC A;  3T1H K;  1HYV A;  3OYK A;  2VWB A;  4CER A;  4OGC A;  3LDL A;  4NO7 A;  1J5E K;  4FL9 A;  2QK9 A;  3EEQ A;  4OKJ A;  3HT3 A;  1RDA A;  3VF2 A;  4Z4H A;  3TSQ A;  4QOZ B;  1EET A;  4XH4 A;  4CJW A;  3I0R A;  2KZZ A;  2R7Y A;  1S1X A;  1TL1 A;  4M3Z A;  2E2Q A;  1NMN A;  2YKN A;  3SMS A;  3A5O C;  3O9T A;  3CM6 A;  1HPZ A;  2HF3 A;  3O9R A;  1WUA A;  1DEJ A;  3DWL A;  3SCX A;  1C1A A;  1HNW K;  1UA0 A;  3QEI A;  4CHZ A;  4YFU A;  3WNF A;  4CF1 A;  1WNS A;  4LF9 K;  4J2E A;  4BR0 A;  3QEX A;  1QHT A;  4W5N A;  4A57 A;  4BRK A;  2QKB A;  1B9D A;  4IOX A;  2OAN A;  4IO9 L;  4DQR A;  1M1K O;  5BRF A;  3S3O A;  4B1V A;  3RWU A;  4BG8 A;  3V9S A;  5BR9 A;  3CG7 A;  2O8D B;  2DFH A;  4FZX C;  3CIP A;  4HCC A;  1S9E A;  1TK0 A;  1U2V B;  3C94 A;  3PO4 A;  2E2N A;  4K43 A;  5EOY A;  4CK3 A;  4FJG A;  2VQF K;  1S6Q A;  5HLF A;  1KAY A;  2D4W A;  3AGK A;  5ELZ A;  4NYF A;  2HNZ A;  4H5V A;  2PAV A;  3ULD A;  2QWL A;  2QXF A;  3TWH A;  3B6O A;  1Y97 A;  4E7I A;  1JLC A;  4H5W A;  1SL0 A;  4B9T A;  4LF8 K;  3DRR A;  3F2K A;  1KFS A;  3CJC A;  4FJI A;  3LDO A;  4JRP A;  3O5B A;  2E6M A;  3TSP A;  4O4G A;  3OBW A;  2P9I B;  4IFV A;  1A5X A;  3W3D A;  1J9A A;  2IVO A;  3UIQ A;  5FLX O;  4CZI A;  2YX6 A;  2HNY A;  2LSN A;  3C0B A;  3U9Z A;  3S3N A;  1NNE A;  4FYD A;  4JI3 K;  3AA2 A;  4CGG A;  2QKK A;  1JLF A;  3NVK A;  2O8D A;  1NG9 A;  4OVL A;  4H4M A;  2YV0 X;  4DQ8 A;  3OJS A;  1U2V A;  4N41 A;  4EIA A;  3MXI A;  3BDP A;  3OYJ A;  4O8U A;  3A5M C;  4DS5 A;  3N4Q A;  3CCJ N;  3VTH A;  4DSE A;  4WQ5 C;  5GAE P;  1X9M A;  2F8S A;  5JVG L;  3FZH A;  1RT1 A;  1ATS A;  2GEM A;  3CJB A;  2WTU A;  3SAF A;  2YNF A;  2ZJQ L;  4ICL A;  3Q7C A;  3SMP A;  4EHT A;  4DV7 K;  3QEP A;  1VSF A;  2AA4 A;  3O3G A;  4FJ8 A;  3RVC A;  5LL6 Z;  3S3M A;  1T6D A;  1Z05 A;  1RDB A;  1HKC A;  2OTJ N;  1BCM A;  1RT6 A;  2JGU A;  3MWT A;  2FF6 A;  2OPQ A;  3PSI A;  2P9I A;  5AQR A;  4PA1 A;  4AQY K;  1K8K A;  1HR0 K;  3KZB A;  3LDQ A;  2FF3 B;  3HOS A;  1BI4 A;  1QS4 A;  3G10 A;  3ZT1 A;  3KKS A;  4WCE L;  4NLC A;  4WE1 A;  4FWL A;  4FPA A;  3VQ7 A;  3DXM B;  3S9H A;  1C6V A;  4BE2 A;  4DCH A;  4CZM A;  3QIP A;  4Z4I A;  4CJS A;  4KI6 A;  1BO5 O;  2A6A A;  3U3G A;  3QO9 A;  1BU6 O;  1WSH A;  3WQU A;  2Y1J A;  3PX4 A;  2D0B A;  3TPQ A;  1SKS A;  4I6M B;  1L3V A;  2PY5 A;  3IS9 A;  2OPS A;  4DTS A;  4W5T A;  3CMA N;  4E1N A;  4FLZ A;  5AZI B;  3QEV A;  3M8P A;  5TKY A;  1N6Q A;  3SQ1 A;  4DU4 A;  1LV5 A;  1SKW A;  5EXW A;  3CCQ N;  3V9W A;  3OY9 A;  1UAX A;  4B3R K;  1RT7 A;  4O5B A;  4AF1 A;  4K42 A;  1QQC A;  3DLG A;  4RG8 A;  5BRD A;  1S22 A;  3C65 A;  2YI1 A;  3HP6 A;  2IS3 A;  3J7Z O;  4KTZ A;  1XHZ A;  4BC4 A;  1JXB A;  4HTL A;  3U8X A;  1XC3 A;  1HNX K;  2W6K A;  3FZM A;  4BRD A;  1U49 A;  4N76 A;  4BRE A;  4ISF A;  4CGD A;  3ZX3 A;  2FLO A;  2QWO A;  3RMD A;  3OTO K;  1RTJ A;  4BDZ A;  5I3U A;  4FVU A;  3AO4 A;  4FM0 A;  4JKC A;  3G71 N;  3HL8 A;  1T6C A;  3LDS A;  1SZ2 A;  4AHT A;  4BC5 A;  4B3S K;  3JS6 A;  1O1W A;  5C25 A;  2PYL A;  3L0Q A;  3JYT A;  1NJY A;  1QSL A;  1S72 N;  5JS1 A;  3QBX A;  4I2Q A;  1ZXO A;  2QA4 N;  1LW2 A;  3L2W A;  4YOW A;  2ETJ A;  2KKZ A;  3D2E A;  1HX1 A;  3AO3 A;  3HK2 A;  4B8C A;  2IOC A;  3O3H A;  4PY5 A;  4M3Y A;  4CD3 A;  4CZE A;  4DTP A;  3HO1 A;  3QIN A;  3L8B A;  4IFY A;  1QQO A;  1TV6 A;  3KK1 A;  3HPH A;  2VG7 A;  2PFU A;  1XNQ K;  1KQS M;  3E66 A;  2G8F A;  1VQO N;  2G8W A;  1VSE A;  3KVG A;  4BRL A;  2RF2 A;  5HRP A;  3OYN A;  1VQM N;  3A5N C;  5DM6 L;  2NLX A;  2NRX A;  5KRS A;  3P5J A;  3D2F B;  2KHO A;  5BRE A;  3OYG A;  3K5L A;  1VQL N;  2E2P A;  4RW8 A;  2JLE A;  4KH6 A;  4IKF A;  3R6M A;  1RDW X;  3F9M A;  5JLF A;  4KHS A;  2P9L B;  5M1K A;  2ZGZ A;  3VQ9 A;  2XY8 A;  3ZT3 A;  5M1F A;  3GG4 A;  3EL2 A;  3NH0 A;  1IKY A;  5GAH P;  4Q0B A;  3HSC A;  1KRP A;  3O4N A;  1NKC A;  1J53 A;  1JCE A;  2KLA A;  2XRI A;  2X78 A;  3I55 N;  2V52 B;  3WUH A;  4GV9 A;  3OYA A;  3V1R A;  1A5V A;  2NUB A;  2Q97 A;  1BOT O;  1HNI A;  4IOA L;  4DQQ A;  3PSF A;  4YDU A;  1QSY A;  4GW6 A;  1EQY A;  3CJ7 A;  3L2U A;  5HBM A;  1XNR K;  2Z1H A;  2NRW A;  3SV4 A;  2E20 A;  1K73 O;  4MO5 A;  4YHH K;  4WFB L;  2P9U A;  4KHW A;  1VSH A;  5BN8 A;  4W5O A;  3PV8 A;  5AZJ B;  4O0J A;  3ZEU A;  3C6T A;  1ILY A;  5A2Q O;  4M3W A;  4CEE A;  2V7Y A;  3QNN A;  3VPZ A;  3QDK A;  3R9P A;  4BG9 A;  1RTD A;  4FLT A;  5AQV A;  3LAK A;  3A8Y A;  4AHV A;  1VRT A;  4DSK A;  4FSV A;  3WXI A;  5J2P A;  2KFZ A;  2FSN A;  1KAZ A;  3HPG A;  4J2B A;  4UQG A;  4DV6 K;  3L3V A;  2GUI A;  1JLA A;  3AA4 A;  3P1G A;  1EWQ A;  2QWM A;  3SQ0 A;  2BAN A;  3KWG A;  3CET A;  4CFC A;  3I33 A;  4O0I A;  4BRA A;  3KHY A;  2A41 A;  4Q5V A;  4Z0U A;  3C95 A;  4CJE A;  4J2D A;  1XHX A;  4BRP A;  5CR4 A;  3UKR A;  4F2R A;  4GV6 A;  1WSJ A;  1TGO A;  4KKO A;  1JKH A;  5KGX A;  4FLW A;  4B9L A;  3KLI A;  1N36 K;  4BQL A;  3FZL A;  1FJG K;  3NFA A;  3NAE A;  1BQN A;  1GLC G;  4ISE A;  5GIN A;  1JCG A;  4LFC K;  5AQM A;  5FRN A;  4KFB A;  4CFD A;  3MXJ A;  1NM1 A;  3N4P A;  3QIC A;  3R8E A;  5C15 A;  3KLH A;  3Q7B A;  4BR2 A;  3TU5 A;  1NJZ A;  4CHY A;  4CFB A;  4ISG A;  3PY8 A;  5E41 A;  4RCH A;  1S9G A;  3HI0 A;  2GBZ A;  1VAZ A;  2YHB A;  4H0X B;  2V7Z A;  1QTM A;  5LMN K;  3AAQ A;  2G8V A;  3NF6 A;  4JD2 B;  1VQN N;  4KRE A;  4H8K A;  1EX4 A;  4DR3 K;  3M8R A;  3CC2 N;  4JKA A;  3F9K A;  2ITG A;  1EP4 A;  5LJV A;  3V81 A;  2OYQ A;  2X6N A;  5DM7 L;  3DAW A;  3IUC A;  3KWI A;  3DLE A;  1EO1 A;  3BY5 A;  1WBD A;  3NGY A;  3T7Z A;  1KCF A;  3THX B;  3LAM A;  1C0F A;  1XI1 A;  3CM5 A;  4GVM A;  4FJK A;  2KZM A;  4M63 C;  3VEO A;  4KH4 A;  3D45 A;  3NBP A;  2QWP A;  3T1A A;  3EE9 A;  4JI8 K;  4CJQ A;  5AQW A;  3G4S N;  3CCM N;  1ZBF A;  2YNG A;  3SQ2 A;  4LF6 K;  3BGR A;  4H4O A;  4AIL C;  4MDB A;  3AVN A;  1EXQ A;  4M7Y A;  3UE5 A;  1RCH A;  2O8E B;  3DYA A;  1VSI A;  4FOI A;  1L3S A;  4R5P A;  1DTQ A;  5DK5 A;  4M45 A;  1FXX A;  5AQH A;  5I42 A;  1QHA A;  1W97 L;  3THW B;  1NK7 A;  1U48 A;  2KTQ A;  3OW2 M;  1HYS A;  4LD0 A;  1C1C A;  1QVG M;  1CZA N;  2HHH K;  3L2V A;  3SPY A;  1TYQ A;  4IBN A;  3QEW A;  1NJI O;  1ASU A;  2WBN A;  2ZQB A;  2NRV A;  4JKG A;  1EKE A;  4H5R A;  4DFM A;  1CZ9 A;  1DKG D;  4H0V B;  4Z94 A;  5AQX A;  2OTL N;  3LAL A;  1G15 A;  1RBR A;  1TUU A;  4EZ6 A;  1NU0 A;  4L8R B;  3K9J A;  3VEV A;  2H3G X;  1IBL K;  5EY4 A;  4H0Y B;  2O8F B;  2AJQ A;  1D9F A;  2EHG A;  3D7E O;  2YNI A;  1T05 A;  4JI0 K;  4KBO A;  5AQS A;  2VWJ A;  3ZSR A;  2P9P B;  4JS4 A;  4I9L A;  3IDH A;  2GWK A;  2CH6 A;  4HVJ A;  1RT3 A;  4BRH A;  1E4F T;  4BAC A;  2B5J A;  2OPP A;  1XWL A;  4BRC A;  4ZHR A;  3ITH A;  4OLA A;  1VQ6 N;  3VQ4 A;  3IFR A;  1S1T A;  3SI6 A;  4YNQ A;  2VWK A;  1TKZ A;  4CK1 A;  3IAY A;  3DOL A;  3O1B A;  3V6D A;  2XY6 A;  3AVL A;  4JKF A;  4BQZ A;  4WQ4 C;  1YAG A;  1R0A A;  3LL3 A;  1IV0 A;  4QAG A;  3NMU A;  4TSX A;  4CJ3 A;  1T03 A;  4IO8 A;  4B1Z A;  5AFU H;  3VQA A;  2FSJ A;  1TK5 A;  4LSL A;  1NOY A;  3HM9 A;  5FDL A;  4JN4 A;  4IG0 A;  4V19 S;  3ASM A;  1ASV A;  2Q1N A;  2RPI A;  3SBG A;  3HZ6 A;  2ZD1 A;  2O8F A;  2ZJR L;  4OGE A;  3VGK A;  3LM9 A;  2UYT A;  1BCO A;  3KLG A;  3C7N B;  1QQM A;  2P9P A;  1OH7 A;  2YHY A;  3SPZ A;  5E84 A;  3CCV N;  4FJL A;  2VYP A;  1KAX A;  1RT2 A;  4IXC A;  3VGM A;  4BR7 A;  4PKH A;  1LAV A;  1C0G A;  1WAF A;  1BDG A;  3VQ6 A;  1P8Z A;  3OYB A;  1LWF A;  4JI5 K;  3MK6 A;  3SBT A;  1RBV A;  3VQP A;  2I7P A;  2ZF5 O;  3QET A;  4WFN L;  3ZCM A;  1TVR A;  4I2P A;  3CME N;  1C0T A;  1FW6 A;  3WXJ A;  5AQQ A;  1RT5 A;  2ZM6 K;  1YI2 N;  4CZJ A;  4C1N I;  1XC9 A;  5FPE A;  3UKU B;  3V1Q A;  4FLY A;  4CJV A;  3JAM O;  1L5U A;  4K8Z A;  3ENO A;  3AVG A;  5DMR A;  3RTV A;  4A5A A;  4BRM A;  1BIS A;  3AVK A;  2HBK A;  3DRS A;  5FPM A;  3NF7 A;  5J2N A;  3CF5 L;  4IDK A;  3CHW A;  3U4L A;  4CJ5 A;  3ZSQ A;  4DF4 A;  3ATU A;  3OS1 A;  4IZ9 A;  3CCR N;  3WEE B;  3C7N A;  3BZK A;  3FZF A;  1TAQ A;  4B9Q A;  4NCB A;  1J54 A;  2E88 A;  3CQY A;  1RTI A;  2HVI A;  5KTQ A;  3ZSV A;  3VGL A;  5AQY A;  5HRR A;  3SJH A;  4K8X A;  4OO1 J;  4F9O A;  4KPY A;  5AQJ A;  3EY1 A;  1JLE A;  3AVJ A;  4CEZ A;  1W7A A;  3K0S A;  3G6E N;  4U7B A;  2ATQ A;  4DTU A;  4CEC A;  5AQZ A;  3I8D A;  3F73 A;  5J2Q A;  4KB1 A;  3CFP A;  4CJR A;  3E9L A;  3ZET B;  3WXK A;  3WNG A;  5AQG A;  1JJ2 M;  4IEI A;  3L2Q A;  1SL2 A;  3CC4 N;  1W2B M;  1NJW A;  3CJ1 A;  1JXE A;  1IBK K;  1NK6 A;  1RBT A;  4DTJ A;  1VSK A;  2IIR A;  5KQ8 A;  1KD1 O;  4LF7 K;  3KD1 E;  4RW4 A;  3OBY A;  2NNW A;  3WT0 A;  3SV3 A;  1Z25 A;  1WOQ A;  3LDP A;  5AQP A;  4AH9 A;  1I3A A;  3SJJ A;  3CCL N;  2HB5 A;  2D0P A;  1KTQ A;  3O3F A;  4BR4 A;  1UA1 A;  1YVN A;  3AO1 A;  4E7J A;  4HWI A;  4F4K A;  1SKR A;  3AY9 A;  2D1K A;  4BWM A;  3K5N A;  2EWS A;  1MWK A;  4JI4 K;  1NKE A;  4JK9 A;  1GLF O;  4CBW A;  3VOV A;  4CEB A;  1R59 O;  3EKS A;  5KPR A;  1X9W A;  1NBW A;  4CF0 A;  1IG9 A;  4LY7 A;  5JLH A;  3O9U A;  3LP2 A;  4E7H A;  1WSG A;  3E1Y A;  3ATV A;  4DMN A;  3I0S A;  4ZTF A;  2HBL A;  4J2A A;  2O4G A;  4BDP A;  3K9K A;  3E01 A;  4IFE A;  4CF8 A;  4IWV A;  2NZT A;  1YJ9 N;  1NK0 A;  1LOT B;  2HHX A;  1IKX A;  1GLL O;  4M3U A;  3OYE A;  4GKJ K;  4RW6 A;  4CJ7 A;  4PUO A;  4Y0W A;  4FOE A;  4JS5 A;  2BE2 A;  3AAP A;  3QFP A;  3CQX A;  2VG5 A;  4WQ5 A;  5F2R A;  4M7X A;  4DV3 K;  1K9M O;  4BWJ A;  4FXD A;  1GLD G;  4F8R A;  3O4W A;  2NRR A;  2PBD A;  3OS2 A;  3CI5 A;  3EYZ A;  4FJX A;  3V9U A;  1ITG A;  1NK5 A;  4BC3 A;  3CPW M;  1Q18 A;  4AHU A;  4O8K A;  4XEI A;  4PL8 A;  4FWP A;  3TAR A;  4CEA A;  1KFD A;  5BR8 K;  3CCS N;  1CLQ A;  3THY B;  3DXK B;  4KTQ A;  3H46 O;  4K41 A;  3RRG A;  4BR5 A;  3RR8 A;  5LY3 A;  1C0U A;  5FRO A;  1HMV A;  2QTD A;  1ZC6 A;  1SUQ A;  4DV1 K;  3DXM A;  4OPA A;  2O8B B;  3C6U A;  3LZI A;  1V4T A;  4QS8 A;  1HPM A;  3L4I A;  4JI1 K;  5GAD P;  1OVQ A;  3DLK A;  2VGN A;  5E26 A;  3CQ8 A;  4DR1 K;  1N33 K;  1D4X A;  3AVM A;  4K25 A;  1KVC A;  2E1Y A;  5HRS A;  3HOT A;  3DLR A;  5F0X A;  3MMV A;  2W42 A;  3SUP A;  4KHN A;  3MWP A;  4I6M A;  4FZZ A;  5J2M A;  5LMU K;  5AZI A;  1RT4 A;  4ID1 A;  4O44 A;  4HCB A;  4DKW A;  3LDN A;  3T1Y K;  5H1S Q;  1YXQ A;  1Q9X A;  1TK8 A;  2E8A A;  1LWE A;  4I7F A;  3HPO A;  3RSE B;  4E3S A;  3SAH A;  1V4S A;  2HBM A;  1RIL A;  1GLE G;  4YOY A;  4CJT A;  3HM8 A;  4YOR A;  1E3M A;  2VGM A;  3EKU A;  3AO2 A;  1GOB A;  3V9Z A;  3H6E A;  1TKD A;  1VQ8 N;  1W0H A;  1TL3 A;  5I9E B;  1RFQ A;  5AQI A;  2HHU A;  2QI2 A;  3BF1 A;  3G25 A;  4OKK A;  2KW4 A;  2Q3S A;  3SK3 A;  3AAR A;  2F9T A;  2HHQ A;  2WOM A;  1WLJ A;  4LFA K;  5GIP A;  5ADX H;  4CZG A;  2PZS A;  3OYD A;  4F3T A;  3S41 A;  1WSF A;  1Z6R A;  1N5Y A;  1XMQ K;  1WB9 A;  2JWL A;  4KAZ A;  4BE0 A;  1U4B A;  1N32 K;  3CFR A;  2Z1G A;  3WXM B;  4CZH A;  4JHD B;  2EX3 A;  4H0O A;  4BC2 A;  1YJW N;  4Z4E A;  1T44 A;  2J4R A;  5TKW A;  1D5A A;  2I5J A;  4CZF A;  4N56 A;  2HOE A;  4DUZ K;  5C0Y A;  1N34 K;  3SUN A;  1B92 A;  4JI2 K;  4JKB A;  4FK0 A;  1K6Y A;  1S6P A;  1VSD A;  3P31 A;  3RSE A;  2HHW A;  4Y1C A;  4ILH A;  2UUC K;  4LSN A;  1VQ9 N;  2KQ2 A;  4BRF A;  3MN5 A;  5AQO A;  4O55 A;  3QIO A;  3VQB A;  1OH6 A;  1Q86 O;  4KHP K;  1MDU B;  4FWR A;  1MA9 B;  3AVC A;  3GL1 A;  2QM1 A;  4H0P A;  4B9S A;  3WNE A;  2UXD K;  1YIJ N;  3OYC A;  3TAE A;  1HKG A;  2P5G A;  1YVU A;  3NE6 A;  3AV9 A;  4JI6 K;  2O8C B;  3KTQ A;  3ISN C;  1C1B A;  2XY7 A;  3AA5 X;  3D2F A;  4MQ3 A;  4DTM A;  2X6S A;  4NCA A;  4N47 A;  4DR7 K;  4QCL A;  3VMF B;  2XHB A;  1QE1 A;  1VQ4 N;  2P9L A;  4DFK A;  1RGI A;  4OX9 K;  2ITM A;  4E19 A;  3HVR A;  5JS2 A;  4ELV A;  2WFB A;  1BL3 A;  1ZBL A;  4B3O A;  1Q9Y A;  1J6Z A;  3BUZ B;  3ENH A;  2PYJ A;  3HST B;  1NGD A;  2ASM A;  3PUF A;  1BGX T;  4CIG A;  3MCP A;  3FGU A;  4WF9 L;  1ESV A;  5AR0 A;  3LM2 A;  1NK4 A;  1TAU A;  4FLU A;  4FJN A;  2BH1 A;  4Z4F A;  4BGB A;  4ELU A;  1BA0 A;  3NH1 A;  4CD1 A;  3PLA A;  1XQS C;  4OPH A;  2UUA K;  4DF8 A;  1BUP A;  3GDQ A;  1WSI A;  4FM2 A;  4YOX A;  2BGG A;  5M1Q A;  3K5M A;  2W40 A;  4KV8 A;  5AZJ A;  2ZJP L;  4AM6 A;  3KKR A;  3MX2 A;  3O9Q A;  3PX0 A;  4E0D A;  2HVH A;  4CF9 A;  1VQP N;  2YHW A;  4CCH A;  1UOC A;  3QES A;  3VF6 A;  2Q31 A;  5CZ1 A;  3L3U A;  3MDQ A;  4QS7 A;  1S1W A;  4FWN A;  4CBX A;  3OA9 A;  3ZX0 A;  4H5T A;  1CXQ A;  5AQL A;  1KLN A;  2Q36 A;  1YT3 A;  3D6R A;  1HRH A;  3SYZ A;  4C8L A;  2QXL A;  4FWO A;  2BDP A;  1SL1 A;  1N8R O;  1J5O A;  4BDY A;  1NGJ A;  3KLF A;  1ZBH A;  3LP3 A;  1NGF A;  2F9W A;  2P9N B;  3DMJ A;  1I94 K;  5IT9 O;  1NMD A;  3DJC A;  1SV5 A;  4NCG A;  5AQN A;  1S3X A;  3TI0 A;  4AHC A;  4UY8 O;  2UU9 K;  1ZBI A;  2WC9 A;  4CHQ A;  3M6G A;  5BPM A;  1L3U A;  5LJW A;  1LWC A;  1GOC A;  3VEY A;  1GLB G;  2IGI A;  2DFE A;  4CHN A;  1TKX A;  1ZYQ A;  3VES A;  1OVY A;  3VF4 A;  1F21 A;  3QFU A;  3OYH A;  5C2D A;  2FBX A;  2HND A;  3ALY A;  4JD2 A;  5EU7 A;  2W6L A;  3NH2 A;  3NCI A;  5GAG P;  4X66 K;  3BP8 A;  2IAJ A;  2W41 A;  4FCY A;  1HNZ K;  3TAF A;  5C10 A;  4CGI A;  2P1J A;  5C12 A;  1Q7Y O;  3IG1 A;  2CH5 A;  3OHR A;  1FKO A;  3HYF A;  3V9X A;  2QEX N;  3THX A;  3D0P A;  2ZWH A;  3EE8 A;  3NDK A;  5AQU A;  5IWA K;  3U9D A;  2DPN A;  2P9N A;  2RN2 A;  1CXU A;  1T8E A;  4DQS A;  4A2B A;  4FJ9 A;  2YJE A;  1NLV A;  5F1X A;  3AVA A;  4CJL A;  1KXP A;  3EZW A;  3AO5 A;  1IH7 A;  3E9P A;  2D0C A;  3J8A A;  2B6A A;  5FPD A;  4B1U B;  4YY3 K;  1QQN A;  2OPR A;  4CK2 A;  1RDU A;  3LAN A;  2O8E A;  1JL1 A;  3R3L A;  4PQU A;  3M1F A;  4Z4G A;  3THW A;  1G99 A;  3H08 A;  1DGK N;  4B1W B;  1MU2 A;  1IO2 A;  1Y64 A;  2G8K A;  2Q0U A;  4E7K A;  2E2O A;  4GKK K;  3HTV A;  4M3T A;  1T3V A;  1XUP O;  2OCE A;  4NXM K;  1D8Y A;  5T7B A;  2DFF A;  3ZT2 A;  4BVP A;  3AVH A;  3JSM A;  2XO7 A;  1JL2 A;  4YOU A;  2IVN A;  4IJA A;  1E4G T;  3IRX A;  4B3T K;  1YUW A;  2BTF A;  4H0T B;  3O9S A;  4WYB A;  1H1V A;  4C8M A;  2RE2 A;  5C24 A;  4LH4 A;  1WSE A;  4FJ5 A;  4LH5 A;  5JIC A;  2IDO A;  2YHA A;  4DFP A;  2HF4 A;  4H03 B;  4CZK A;  4FJM A;  4EAH D;  3ZLJ A;  1WN7 A;  2JWK A;  3K2P A;  1YTA A;  4CBU A;  5AQK A;  3CYM A;  3P4I A;  3HP9 A;  2GV9 A;  3AVB A;  4L3Q A;  4C1N K;  1X3N A;  3ZT4 A;  4HHT A;  4M3X A;  1X9J A;  5KI6 A;  4MLH A;  2DTU A;  5C2F A;  1TUY A;  3LWM A;  1HYZ A;  1BIZ A;  4WQ4 A;  4OLB A;  4CIF A;  2A40 A;  4R79 A;  3THV A;  1ASW A;  3CJA A;  1LW0 A;  3MED A;  4CGJ A;  3KIO A;  2GX9 A;  4FWM A;  3DLL L;  1QVF M;  3FR0 A;  2HMP A;  3B8A X;  3MEE A;  2P51 A;  4Z4C A;  4GV3 A;  3OVN A;  2E4L A;  3PX6 A;  4CGF A;  5CYQ A;  3NF8 A;  5D3G A;  2GTD A;  5JMV A;  2DY4 A;  1A5W A;  1KVB A;  1RNH A;  5KPT A;  4M42 A;  2ZE2 A;  1IJJ A;  2D0A A;  4E1J A;  2FBT A;  5J1E A;  1FK9 A;  5SZT A;  4FO0 A;  4G9Z A;  5FRM A;  1RBU A;  3CCE N;  4CW7 B;  1Q8I A;  1BG3 A;  4IJN A;  4CJK A;  1P90 A;  3CD6 N;  4PHT X;  4RWT A;  5B8H A;  4PL7 A;  1HJO A;  3AA3 A;  3LPT A;  3MXM A;  1U6Z A;  2QWN A;  3IMX A;  3IKM A;  1YTU A;  3C6A A;  3H3N O;  3RMB A;  2O4I A;  4RW9 A;  1QZ5 A;  4PKI A;  5KQD A;  3UKU A;  1K8K B;  4BGA A;  2VG6 A;  4ILJ A;  4CHO A;  4C23 A;  1BI4 B;  4DS4 A;  4A59 A;  3F5T A;  1ZBU A;  4JRQ A;  5CYM A;  4PKG A;  4KHU A;  3VQ5 A;  1BHL A;  4JEP A;  3T19 A;  4FK2 A;  4ELT A;  4PWD A;  1MWM A;  4OKE A;  4MFB A;  3V1O A;  4B9N A;  4B9M A;  4H5N A;  1JCF A;  4KO0 A;  3ZSY A;  3WEE A;  2B4J A;  1IG8 A;  3JXU A;  3ZSZ A;  3CC7 N;  3ULE B;  1VQ5 N;  4FWK A;  1HQE A;  3K58 A;  3HJF A;  3CJ9 A;  3M8S A;  1UWB A;  4CJF A;  4MLE A;  3WNH A;  3RMA A;  3DLB A;  4DR5 K;  5HRO A;  3O80 A;  2D0O A;  2ASP A;  2WON A;  4FJ7 A;  2F7T A;  1LAW A;  4B9V A;  1YIT N;  4FW1 A;  2OZS A;  3AGR A;  3ZET A;  2Q0R A;  3SZ2 A;  1HNV A;  4MO4 A;  3DOK A;  3EO3 A;  1L3T A;  4U67 L;  4FPB A;  1YF5 L;  3AVI A;  3K59 A;  4A5B A;  5CZ2 A;  3A5L C;  3NF9 A;  3HBT A;  1ATR A;  4AHS A;  1NOZ A;  1JLQ A;  3BZC A;  3K5O A;  4KTW A;  4A2A A;  1SQK A;  4CED A;  4HUG A;  4KRF A;  3CER A;  1T7P A;  3SQ4 A;  1U47 A;  1S5J A;  3U3Y A;  2A3Z A;  3H1V X;  4E89 A;  3G0Z A;  4I9Q A;  3TAQ A;  2E6L A;  4DR6 K;  2FBV A;  1KVA A;  3MAQ A;  1NWK A;  5CE3 A;  3CXC M;  3ULE A;  2IVP A;  3QB0 A;  1HUX A;  3VQQ A;  3CFO A;  4JK7 A;  4C8O A;  2RHK A;  3P83 D;  4OPK A;  5BRH A;  3TR8 A;  3RMC A;  5KGW A;  3FZK A;  1DTT A;  3SUQ A;  1NGE A;  1XMO K;  4FJH A;  3TTD A;  4X64 K;  2G8H A;  1GOA A;  4B08 A;  2OA8 A;  5AFU A;  3LP1 A;  3WXL A;  2KFN A;  3M5R A;  4DFJ A;  5C42 A;  4XH5 A;  3TTF A;  2QWR A;  2NRH A;  4OJR A;  3U6F A;  5FPN A;  3BF3 A;  3VET A;  4JKE A;  1HJR A;  4IEE A;  1KLM A;  4KHY A;  3M8Q A;  1NGB A;  3OYM A;  2HW3 A;  4JK8 A;  4O5F A;  1SS6 A;  3D2E B;  3OYF A;  1FKP A;  3HRG A;  1M90 O;  1WAJ A;  4DV5 K;  3QBW A;  3LP0 A;  4DU3 A;  4CJU A;  3MEC A;  4JI7 K;  3NVM A;  1BQM A;  5KRT A;  5HOO A;  1BWF O;  1TKT A;  4DSJ A;  3I56 N;  3P39 A;  2GEL A;  3HXM A;  4BVO A;  4DTR A;  4JAX A;  3J80 O;  4DR4 K;  4GMJ B;  3VEW A;  1IKV A;  2XY5 A;  4A62 A;  4EZ9 A;  3LZJ A;  1ATN A;  4M3R A;  3B6P A;  4ILG B;  3NHG A;  4CJP A;  1NJX A;  1RDC A;  1GLA G;  4LF4 K;  1CZB A;  4CZL A;  3THY A;  3VA0 A;  3DXK A;  1VQK N;  3L4Q A;  1REV A;  5JVH L;  3UB5 A;  2HHV A;  3KD5 E;  2NRZ A;  4CFA A;  4DLE A;  2YJF A;  4BR9 A;  3CPE A;  1YJN N;  2O8B A;  4DLG A;  3ZT0 A;  3KLE A;  3VER A;  3V4I A;  1IBM K;  1VQ7 N;  2CGL A;  3O1W A;  2HST A;  1ZBS A;  4G1Q A;  1OH8 A;  3MX5 A;  3GOI A;  2X74 A;  3LPU A;  3T3F A;  1GLJ O;  3J81 O;  4CGH A;  4JYA K;  1U04 A;  4YDU C;  4DG1 A;  4CE9 A;  4CVN E;  1OH5 A;  3TSU A;  4BY9 C;  1VHX A;  1JLB A;  3VN5 A;  5M1O A;  1K8A O;  4JKH A;  1DLO A;  1RDD A;  5AQF A;  3T69 A;  4EP4 A;  2NRT A;  2P9U B;  3QER A;  3W0L A;  3PIO L;  3O6W A;  2VCP A;  3O4Q A;  3HVT A;  4HTU A;  3ZEU B;  3DM2 A;  3M3Z A;  4IOC L;  3A0I X;  3TAB A;  2HMI A;  3KJV A;  4EHU A;  4ID5 A;  4F2S A;  5CY4 A;  4FWS A;  3ZSX A;  4X62 K;  5K14 A;  1BIU A;  1JLG A;  2F96 A;  2GUP A;  3SUO A;  3WQT A;  3CCU N;  1I39 A;  4DTX A;  2Z1I A;  3VQ8 A;  5HL7 L;  5EVZ A;  3TAN A;  1KC8 O;  4Y1D A;  4B1Y B;  4W5R A;  3KK2 A;  4DV4 K;  1Z26 A;  3LWL A;  2G8I A;  3H45 C;  3MCA B;  3VQE A;  2UXB K;  3I8B A;  2P9K B;  2I7N A;  4HUE A;  3UKR B;  5CHI A;  1YHQ N;  3E9O A;  2HHS A;  4CEF A; 
#chains in the Genus database with same CATH homology
 2W41 A;  1HLU A;  3WEE B;  3C7N A;  4JHD A;  3FZF A;  3H3O B;  3R1X A;  4B9Q A;  3FE1 A;  2E88 A;  3CQY A;  5BRD A;  5C10 A;  1S22 A;  2AP1 A;  3C65 A;  3SAG A;  3VGL A;  2YI1 A;  3ZYY X;  5AQY A;  3SJH A;  5C12 A;  1Q7Y O;  2CH5 A;  3OHR A;  4OO1 J;  4F9O A;  2QEX N;  3J7Z O;  5AQJ A;  3FLC O;  4GVE A;  5MLC Q;  2ZWH A;  4BC4 A;  4BRI A;  3EE8 A;  4HTL A;  3U8X A;  5AQU A;  5BPL A;  3U9D A;  1XC3 A;  2DPN A;  2P9N A;  4U7B A;  3G6E N;  5AQZ A;  4GNI A;  3FZM A;  4BRD A;  4A2B A;  2YJE A;  1NLV A;  4ISF A;  3ZX2 A;  4BRE A;  5F1X A;  3E9L A;  1KXP A;  3EZW A;  4JNE A;  3ZET B;  3E9P A;  3WXK A;  5AQG A;  3ZX3 A;  2FLO A;  2QWO A;  1JJ2 M;  3J8A A;  1NGG A;  5FPD A;  4IEI A;  4DB3 A;  4FWQ A;  3CC4 N;  4B1U B;  1W2B M;  4FVU A;  3CJ1 A;  1QQN A;  1RDU A;  3MN6 A;  3R3L A;  4JKC A;  2ZGY A;  2CGJ A;  4A61 A;  3M1F A;  2A42 A;  3G71 N;  1T6C A;  5KQ8 A;  1DT9 A;  2IIR A;  1KD1 O;  2WUS A;  1G99 A;  1SZ2 A;  4B1W B;  1DGK N;  4NLB A;  1Y64 A;  4BC5 A;  3JS6 A;  3OBY A;  3TTC A;  2Q0U A;  2E2O A;  2NNW A;  4KH5 A;  2P9K A;  3WT0 A;  3HTV A;  1WOQ A;  3LDP A;  1T3V A;  1XUP O;  2QW9 A;  1NGI A;  5AQP A;  3L0Q A;  1S72 N;  3CCL N;  3QBX A;  2D0P A;  1ZXO A;  3GBT A;  4BVP A;  3GE1 A;  2QA4 N;  1NGA A;  4BR4 A;  1YVN A;  4YOW A;  4JKD A;  4HWI A;  3VEN A;  2KKZ A;  4YOU A;  2IVN A;  1HX1 A;  3D2E A;  3AY9 A;  1X3M A;  2D1K A;  3MN7 A;  4IJA A;  2EWS A;  3O08 A;  1MWK A;  1O13 A;  2CGK A;  1E4G T;  3FFK B;  1YUW A;  4CD3 A;  2BTF A;  4H0T B;  4J8F A;  3O9S A;  3H1Q A;  4WYB A;  4CZE A;  4EFH A;  1H1V A;  3SLC A;  3L6Q A;  4JK9 A;  1GLF O;  1QQO A;  2RE2 A;  4CBW A;  3VEX A;  3VOV A;  2PFU A;  1R59 O;  3EKS A;  5JIC A;  5KPR A;  1KQS M;  5BPN A;  3E66 A;  1NBW A;  2HF4 A;  4H03 B;  4CZK A;  1VQO N;  5JLH A;  3O9U A;  3KVG A;  4BRL A;  4EAH D;  4CI6 A;  4B1X B;  1VQM N;  2P9S B;  4GY2 B;  3A5N C;  3ATV A;  3E1Y A;  2NLX A;  5GAG P;  5DM6 L;  2JWK A;  2HBJ A;  2NRX A;  2HBL A;  1TYQ B;  3D2F B;  2KHO A;  4JKG B;  5AQK A;  4CBU A;  5BRE A;  2E2P A;  1VQL N;  1OKJ A;  3ID8 A;  3P4I A;  5GIO A;  3MN9 A;  4BRO A;  4L3Q A;  3K9K A;  4LC9 B;  4C1N K;  4KH6 A;  1X3N A;  4IFE A;  4IWV A;  2NZT A;  4AM7 A;  1YJ9 N;  1LOT B;  5M1N A;  1GLL O;  1X9J A;  1RDW X;  3R6M A;  4YOV A;  4MLH A;  3F9M A;  5JLF A;  2P9L B;  5M1K A;  5C2F A;  2ZGZ A;  4CJ7 A;  4Y0W A;  4FOE A;  4BRN A;  1TUY A;  4MDA A;  5M1F A;  3AAP A;  3GG4 A;  3CQX A;  3QFP A;  4WQ5 A;  4WQ4 A;  4M7X A;  5F2R A;  5BN9 A;  3EL2 A;  1K9M O;  2A40 A;  4R79 A;  5GAH P;  1GLD G;  3CJA A;  3O4W A;  2NRR A;  2PBD A;  1BA1 A;  3CI5 A;  3HSC A;  2KLA A;  1JCE A;  2E1Z A;  2GX9 A;  4FWM A;  3DLL L;  3I55 N;  2V52 B;  3WUH A;  5AQT A;  4BC3 A;  1Q81 O;  4GV9 A;  3FR0 A;  2HMP A;  3CPW M;  1Q18 A;  1QVF M;  3B8A X;  3KK7 A;  4O8K A;  1SAZ A;  4XEI A;  2Q97 A;  1BOT O;  4PL8 A;  4IOA L;  4FWP A;  3P38 A;  4GV3 A;  3C6H A;  3QML A;  4YDU A;  3CCS N;  3ID6 A;  1EQY A;  2GTD A;  5JMV A;  3DXK B;  1LCU A;  3CJ7 A;  3ENB A;  5KPT A;  3H46 O;  4K41 A;  1IJJ A;  2NRW A;  2E20 A;  4BR5 A;  5LY3 A;  1K73 O;  3VEZ A;  4MO5 A;  2QTD A;  4E1J A;  1ZC6 A;  4WFB L;  2P9U A;  3O8M A;  4FO0 A;  4YOT A;  2GWJ A;  3DXM A;  4OPA A;  4G9Z A;  1HKB A;  2P9S A;  5ADX A;  1V4T A;  3BEX A;  3EN9 A;  4QS8 A;  5BN8 A;  3CCE N;  5AZJ B;  1HPM A;  3ZEU A;  1BG3 A;  3VTI A;  4IJN A;  3L4I A;  2FXU A;  1P90 A;  3CD6 N;  4PHT X;  1ILY A;  4RWT A;  2V7Y A;  5GAD P;  3VPZ A;  3QDK A;  3R9P A;  4XH1 A;  4BG9 A;  2YCH A;  2VGN A;  5E26 A;  5AQV A;  5B8H A;  1HJO A;  4PL7 A;  1D4X A;  1U6Z A;  3A8Y A;  2E1Y A;  4K25 A;  2QWN A;  3IMX A;  3IKM A;  5EX5 A;  4FSV A;  3HOT A;  3WXI A;  5F0X A;  3PIP L;  3MMV A;  2Q2R A;  5KPZ A;  3C6A A;  3MWP A;  3H3N O;  4I6M A;  2V51 B;  2FSN A;  2BUP A;  1KAZ A;  1QZ6 A;  2QWQ A;  5KQD A;  1QZ5 A;  4PKI A;  3UKU A;  5M1P A;  2FSK A;  1K8K B;  4BGA A;  2QWM A;  4ILJ A;  5AZI A;  4C23 A;  3KWG A;  3CET A;  4WFA L;  3I33 A;  4BRA A;  3KHY A;  3LDN A;  4A59 A;  3F5T A;  4BRG A;  4DKW A;  1Q82 O;  5H1S Q;  1YXQ A;  2A41 A;  4IDH A;  2E8A A;  4PKG A;  4JEP A;  4BRP A;  3RSE B;  1MWM A;  5CR4 A;  3UKR A;  4GV6 A;  4RTF D;  3SAH A;  1NGH A;  1V4S A;  2HBM A;  1GLE G;  4BRQ A;  4H5N A;  1JCF A;  4DHY A;  4YOY A;  4BQL A;  2YHX A;  3FZL A;  3HM8 A;  4NB4 A;  4YOR A;  1IG8 A;  3WEE A;  2ASO A;  2VGM A;  3EKU A;  4QS9 A;  3JXU A;  2A5X A;  3CC7 N;  1GLC G;  4ISE A;  3ULE B;  4FWK A;  5GIN A;  3H6E A;  1VQ5 N;  1VQ8 N;  1JCG A;  5AQM A;  1NGC A;  3CJ9 A;  5I9E B;  1RFQ A;  4MLE A;  1NM1 A;  3N4P A;  3QIC A;  5AQI A;  3R8E A;  5C15 A;  2QI2 A;  3BF1 A;  3Q7B A;  4BR2 A;  2VWB A;  3TU5 A;  3O80 A;  3G25 A;  3LDL A;  4ISG A;  4NO7 A;  2D0O A;  2ASP A;  4FL9 A;  3SK3 A;  4RCH A;  3AAR A;  2F7T A;  2F9T A;  3HI0 A;  3VF2 A;  1YIT N;  5GIP A;  1VAZ A;  5ADX H;  3AGR A;  4H0X B;  2V7Z A;  2Q0R A;  3TSQ A;  3ZET A;  4XH4 A;  3AAQ A;  4CZG A;  4MO4 A;  3EO3 A;  4U67 L;  4FPB A;  4JD2 B;  1YF5 L;  3S41 A;  1VQN N;  1Z6R A;  4A5B A;  3A5L C;  2E2Q A;  2JWL A;  3HBT A;  1ATR A;  3CC2 N;  4JKA A;  3SMS A;  3WXM B;  4A2A A;  1SQK A;  3A5O C;  4CZH A;  3O9T A;  4H0O A;  4JHD B;  4BC2 A;  1YJW N;  1T44 A;  2J4R A;  5TKW A;  2HF3 A;  3O9R A;  1WUA A;  5LJV A;  4CZF A;  3CER A;  1DEJ A;  3DWL A;  2HOE A;  5C0Y A;  5DM7 L;  3DAW A;  4JKB A;  3IUC A;  3KWI A;  1EO1 A;  3T7Z A;  2A3Z A;  3H1V X;  3P31 A;  3RSE A;  4BR0 A;  4ILH A;  1C0F A;  4A57 A;  4BRK A;  1VQ9 N;  4IOX A;  2OAN A;  4M63 C;  1NWK A;  4IO9 L;  5CE3 A;  3VEO A;  1M1K O;  3CXC M;  4KH4 A;  4BRF A;  5BRF A;  3MN5 A;  3ULE A;  2QWP A;  2IVP A;  3EE9 A;  3QB0 A;  4B1V A;  5AQO A;  1HUX A;  5AQW A;  4BG8 A;  3G4S N;  3CCM N;  1Q86 O;  4JK7 A;  1MDU B;  4FWR A;  5BR9 A;  2RHK A;  1MA9 B;  4MDB A;  5BRH A;  3GL1 A;  2QM1 A;  3FZK A;  4M7Y A;  4H0P A;  3CIP A;  3UE5 A;  1NGE A;  4FOI A;  1U2V B;  3TTD A;  2E2N A;  4K43 A;  1YIJ N;  5EOY A;  5AFU A;  5AQH A;  3WXL A;  1QHA A;  1W97 L;  1HKG A;  3OW2 M;  3M5R A;  1KAY A;  1QVG M;  2D4W A;  1CZA N;  3AGK A;  4XH5 A;  3TTF A;  2QWR A;  5ELZ A;  2NRH A;  1TYQ A;  1NJI O;  4H5V A;  2WBN A;  3D2F A;  2PAV A;  2NRV A;  3BF3 A;  4JKG A;  4JKE A;  5FPN A;  3VET A;  4IEE A;  2QWL A;  4H5R A;  1DKG D;  4H0V B;  4Z94 A;  5AQX A;  2OTL N;  3VMF B;  1NGB A;  4H5W A;  1TUU A;  3F2K A;  4JK8 A;  4O5F A;  1SS6 A;  3D2E B;  2H3G X;  3K9J A;  3CJC A;  3VEV A;  3LDO A;  1VQ4 N;  5EY4 A;  3HRG A;  1M90 O;  2P9L A;  4H0Y B;  3O5B A;  1RGI A;  3QBW A;  3TSP A;  3OBW A;  2P9I B;  3D7E O;  2ITM A;  3NVM A;  3W3D A;  4KBO A;  5AQS A;  1BWF O;  2IVO A;  2WFB A;  5HOO A;  3I56 N;  2P9P B;  3P39 A;  1J6Z A;  3BUZ B;  4CZI A;  2GEL A;  2YX6 A;  3ENH A;  2GWK A;  3IDH A;  2CH6 A;  4BVO A;  1NGD A;  2ASM A;  4JAX A;  1E4F T;  4BRH A;  3C0B A;  3U9Z A;  4BRC A;  3VEW A;  3MCP A;  3FGU A;  4A62 A;  4WF9 L;  1ATN A;  1VQ6 N;  1ESV A;  3NVK A;  4ILG B;  5AR0 A;  3IFR A;  3LM2 A;  1GLA G;  4CZL A;  3DXK A;  2BH1 A;  4DQ8 A;  3O1B A;  4BGB A;  1BA0 A;  3L4Q A;  1VQK N;  1U2V A;  4EIA A;  5JVH L;  4CD1 A;  3UB5 A;  4O8U A;  3A5M C;  2NRZ A;  1XQS C;  3N4Q A;  4OPH A;  3PLA A;  2YJF A;  4BR9 A;  3CPE A;  3VTH A;  3CCJ N;  4BQZ A;  4JKF A;  1YJN N;  4WQ4 C;  1BUP A;  3GDQ A;  4WQ5 C;  1YAG A;  5GAE P;  3LL3 A;  4YOX A;  5JVG L;  3NMU A;  5M1Q A;  3FZH A;  2W40 A;  1ATS A;  2GEM A;  3CJB A;  5AZJ A;  3SAF A;  3VER A;  2ZJQ L;  4IO8 A;  4B1Z A;  3Q7C A;  3SMP A;  4EHT A;  2ZJP L;  5AFU H;  4AM6 A;  1VQ7 N;  2CGL A;  2FSJ A;  3O1W A;  2AA4 A;  2HST A;  1ZBS A;  3MX2 A;  3O9Q A;  4JN4 A;  3RVC A;  3MX5 A;  3GOI A;  1VQP N;  2Q1N A;  2YHW A;  3SBG A;  1T6D A;  1Z05 A;  2Q31 A;  3VF6 A;  1GLJ O;  1HKC A;  3HZ6 A;  4YDU C;  3MDQ A;  2OTJ N;  4QS7 A;  3TSU A;  4BY9 C;  2ZJR L;  4FWN A;  3MWT A;  4CBX A;  2FF6 A;  2P9I A;  3OA9 A;  3ZX0 A;  5M1O A;  4H5T A;  3LM9 A;  2UYT A;  3VGK A;  1K8A O;  5AQL A;  5AQR A;  2Q36 A;  3C7N B;  3D6R A;  1K8K A;  3KZB A;  1QQM A;  2FF3 B;  2P9P A;  2YHY A;  3LDQ A;  4JKH A;  3HOS A;  5E84 A;  5AQF A;  3T69 A;  4WCE L;  3CCV N;  2NRT A;  4NLC A;  2QXL A;  2VYP A;  4FWL A;  4FWO A;  4FPA A;  2P9U B;  1N8R O;  1KAX A;  3W0L A;  3DXM B;  4IXC A;  3PIO L;  3VGM A;  4BR7 A;  3O6W A;  4PKH A;  1C0G A;  2VCP A;  1NGJ A;  3ZEU B;  4DCH A;  3M3Z A;  1NGF A;  4CZM A;  2F9W A;  4IOC L;  1BDG A;  2P9N B;  1P8Z A;  3A0I X;  1NMD A;  3DJC A;  4EHU A;  5AQN A;  1S3X A;  3MK6 A;  4FWS A;  3SBT A;  2I7P A;  1BO5 O;  2A6A A;  2ZF5 O;  4UY8 O;  4WFN L;  1BU6 O;  2WC9 A;  3WQU A;  2GUP A;  3TPQ A;  3CME N;  3M6G A;  3WQT A;  3CCU N;  4I6M B;  5BPM A;  5LJW A;  3WXJ A;  5AQQ A;  1YI2 N;  4CZJ A;  4C1N I;  3VEY A;  1GLB G;  5FPE A;  3UKU B;  5EVZ A;  5HL7 L;  3CMA N;  1KC8 O;  4B1Y B;  3ENO A;  3VES A;  1OVY A;  5AZI B;  3VF4 A;  5TKY A;  4A5A A;  4BRM A;  3QFU A;  3H45 C;  3MCA B;  2HBK A;  5C2D A;  5FPM A;  3I8B A;  5EXW A;  4JD2 A;  2P9K B;  2I7N A;  3CCQ N;  3CF5 L;  3UKR B;  3CHW A;  3U4L A;  5CHI A;  3ATU A;  3E9O A;  1YHQ N;  4AF1 A;  4IZ9 A;  3CCR N;  4K42 A;  3BP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...