2FBYA

Wrn exonuclease, eu complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbyA00
4LD0A 4CIGA 3HO1A 4FJ8A 4F3TA 1EETA 3ZSQA 4CJFA 4FM2A 3A2FA 4W5TA 4FJIA 1RCHA 4N47A 4CJUA 1FK9A 4FLZA 1JLAA 3TAFA 4E1MA 3LP2A 3PV8A 3S3NA 2JLEA 3DRSA 4Z4FA 4FJKA 3AA5X 4B9SA 3ZSOA 1QHTA 3C6UA 1QQCA 3OVNA 5J2NA 4CGIA 1XI1A 3H08A 3KIOA 3KKSA 4CEBA 3V4IA 5KTQA 1RBTA 3DRRA 3NF8A 3L2UA 5HRNA 3OS0A 3F9KA 3LALA 3LZIA 3NGYA 4HUFA 1LWFA 3UIQA 2OZSA 3NH0A 1IG9A 1D9FA 1B92A 4DTOA 2KZZA 3DM2A 4KTWA 4DLEA 3ITHA 3NGZA 3F73A 4FZYA 2RKIA 4Q5VA 3JSMA 3NDKA 3VQ9A 2Y1IA 3QINA 3TARA 4CESA 4K8XA 4KHUA 1B9DA 1U4BA 5HLFA 1LW0A 3QEIA 4CHPA 1QSYA 4B3OA 3QNNA 1XHXA 4CF9A 3KLFA 4PWDA 3HPGA 3IRXA 3JYTA 2ZE2A 2D0BA 4KTQA 4N56A 5FRMA 4DTSA 1GOAA 1JLFA 4OKJA 4HVJA 3LDSA 1S1XA 3EY1A 3AVGA 4DTRA 3TWHA 4QOZB 4FK4A 3L2VA 3CG7A 3OYEA 4HUEA 4FK0A 4CJQA 1TAQA 4GMJB 4FLYA 4CHOA 4KHWA 4E7JA 1JLEA 1RILA 1S1WA 4KB1A 2D5RA 1KVAA 1LW2A 1RBSA 3ZSYA 4CK1A 4N5SA 3HSTB 3KK3A 4FCYA 3U3GA 3PY8A 1YTAA 4DSEA 2B4JA 2DFFA 2IAJA 1ASUA 1TGOA 4HCCA 4RW7A 5JS1A 2OA8A 4BE1A 3OYGA 4CGHA 3ZCMA 1HNVA 4KPYA 1TKTA 3C6TA 2OPSA 2X74A 3SJJA 3TI0A 3ISNC 1Q8IA 4J2AA 4ZHRA 2BANA 4KFBA 1WSFA 4KTZA 1HQUA 2WOMA 1HJRA 3QERA 4CHZA 3PUFA 4NYNA 1TKZA 1GOBA 2ZQBA 3AVMA 2YHAA 4OKEA 4DS4A 3KKRA 4KAZA 4M3XA 3HP9A 4OPKA 4CCHA 4I9LA 1ZBFA 2RF2A 3OS1A 2KZMA 1WSJA 4CJ4A 4OPJA 4RW8A 1Q9XA 4O5BA 3KK2A 3CFPA 2YNFA 3OYHA 4I2PA 1BIZA 1JL1A 4CIEA 1C6VA 1LWEA 4CK3A 4FLUA 2PZSA 3IS9A 3PO5A 2F8SA 4MQ3A 1RT7A 3NAEA 1X9SA 5DK5A 1JLGA 4AILC 3AO1A 3AVBA 3PX0A 2VG5A 3I8DA 4DQIA 4M3ZA 2O4IA 3QO9A 4ZTJA 4FJ9A 1T03A 3AVLA 4M3RA 2A1RA 1REVA 4BWJA 3S9HA 3MECA 3VQ6A 3K59A 3LP3A 5I42A 1KLNA 3K58A 1KVCA 4DSLA 1LWCA 2P1JA 4FZZA 4KI6A 4MFBA 2IS3A 1ZBLA 4E7IA 1CLQA 4Y1CA 3MEEA 3V9WA 3K2PA 4E19A 4DTJA 3DLGA 4FLWA 4Y1DA 4B9MA 1RT3A 2E6LA 4OGEA 1GOCA 2BDPA 3MEGA 4FK2A 4CJEA 1U47A 4W5OA 3LWMA 3NF6A 4CJKA 3PX4A 1HYVA 3PO4A 4IFYA 4E1NA 3AVHA 1VSDA 1X9MA 1HRHA 4CGGA 3KK1A 3AO5A 1N5YA 4Z4EA 4J2DA 1IO2A 2EHGA 1K6YA 4NYFA 4JRPA 1X9WA 1SKSA 1RDBA 1L3UA 3RR8A 1S6PA 1CZ9A 2VG6A 5CYQA 4CEAA 3ASMA 4FW2A 3VA3A 1SL1A 1IKXA 3L2WA 3K5NA 1NKBA 2DFHA 4O0JA 1YTUA 2RN2A 2FBXA 5J2MA 4KRFA 4CIFA 3SV3A 2HB5A 4O0IA 2YNGA 1ASWA 3RMBA 4IKFA 1ITGA 4DF4A 3ZT0A 3ULDA 1TK0A 5HP1A 1WAJA 1T05A 1D9DA 5HRPA 1J5OA 3VQ7A 4CJ5A 2RPIA 1RDAA 1UA1A 1NK8A 4FJHA 2XO7A 3MXIA 1QSSA 4H4MA 1BISA 4FLTA 2X6SA 2ATQA 3WNEA 5KRTA 1UA0A 3DOKA 4DFJA 3KLIA 4FZXC 3K5OA 4G1QA 1RBUA 3DI6A 4BACA 1TK5A 4QAGA 2X6NA 4DU4A 2KFZA 4I9QA 3AVIA 1KTQA 1RDCA 4CEDA 1RTJA 3CQ8A 1NJZA 3T19A 4JLHA 3SQ4A 1NKCA 1L3TA 1JXBA 3VQAA 4R5PA 3NHGA 3KJVA 1T7PA 1KVBA 4CF2A 4RW9A 3RMCA 4QCLA 4AHSA 3D45A 2AJQA 4M3YA 2Z1JA 4KB0A 4I2QA 3OYNA 1C0UA 1VSFA 2HHSA 4ID5A 5HRRA 4FYDA 4Z4IA 1VSLA 5KI6A 4B8AB 2I5JA 2DTUA 3SUPA 1RTDA 4RW6A 4OLAA 4GVMA 2B6AA 3P83D 3QLHA 3TAEA 2W42A 2HHXA 1IKVA 3O3FA 1CXUA 1VSHA 4LSNA 1RBRA 3I0RA 3O4QA 4YNQA 4DSKA 3PX6A 2KW4A 2KTQA 1JLQA 1T8EA 5KGXA 1TKDA 1IH7A 3SQ2A 1NJXA 3EYZA 3TAQA 1KSPA 2G8VA 3IG1A 3TAPA 4Q0BA 2A1SA 4LY7A 1JXEA 3TANA 1HMVA 2OPPA 2B5JA 3SPYA 3LP1A 3VQQA 4HUGA 3DYAA 5HROA 1D5AA 3SNNA 4CEOA 1I3AA 4I7FA 4DSIA 3G10A 3RTVA 3DLRA 1BQNA 1SL2A 3NCIA 1LAVA 4FVMA 2KQ2A 3QEXA 3SQ0A 3S3MA 4Z4HA 1L3SA 1B9FA 2FBYA 1S9EA 3C94A 3V9ZA 1BIUA 3WNGA 2X78A 4ZTFA 3E01A 4FJLA 3V1QA 5J1EA 4W5RA 2Q3SA 3CFOA 4AHVA 1L5UA 2OZMA 2YKMA 2VWJA 4FJJA 3TR8A 3RMDA 4W5QA 3DLBA 1O1WA 1CZBA 3SYZA 4BDYA 4DFPA 4CFBA 3DLHA 3VQPA 1ZBHA 4DF8A 5E41A 1S5JA 4Z4CA 1WSHA 4B9LA 1QSLA 1U04A 3L2RA 3AVCA 3SUOA 4CE9A 4E3SA 4DQSA 2GBZA 1QTMA 3BDPA 4OGCA 5D3GA 3CM6A 3HYFA 1RT5A 3OY9A 1UWBA 2VG7A 1UOCA 3ALYA 5DMRA 4KHSA 3AA3A 1HPZA 2OPQA 3HJFA 3RWUA 4NCGA 5CYMA 3RRGA 1NOZA 2F96A 4E89A 4CF0A 4DFKA 1JKHA 3ZSXA 1Q9YA 4O44A 4TSXA 1Z26A 1TKXA 4FJ7A 2QK9A 4C8MA 2R7YA 3OJSA 3LP0A 4FLXA 1U45A 4FJNA 3AO2A 3VQEA 3CYMA 4K8ZA 4B9NA 2DY4A 1VSIA 1JLBA 4FM0A 1TL1A 2XY7A 1S1VA 4CFAA 1NKEA 1W9HA 1BHLA 3LWLA 1QE1A 3DMJA 3T1AA 4CJLA 2HMIA 4J2EA 2Z1HA 1G15A 3SZ2A 3OYFA 2QXFA 3VA0A 4AHUA 3HP6A 3QEPA 4NCBA 3QNOA 3L2QA 4Z4GA 4RW4A 4ELUA 4JS5A 3AO3A 4F3OA 4KI4A 3OYIA 4CEQA 2IOCA 4KO0A 1VSMA 2HVIA 1UAXA 4M3WA 1U49A 1NK5A 1RT6A 3AV9A 2ETJA 4IG3A 4L8RB 1NK7A 4O4GA 3AA4A 1NK4A 3SUNA 4KHQA 1VSEA 1WSEA 3MEDA 4M3TA 1RT4A 3AA2A 1RTIA 4FJ5A 2HHWA 3KLEA 3OYJA 1HYSA 3LAMA 3WNHA 3ZSRA 3ZT1A 3KLHA 3LZJA 4OKKA 2G8HA 4J2BA 5I3UA 3ZSWA 1BCMA 4DLGA 1BGXT 1RT2A 2Y1JA 4M3UA 3VQ4A 3HPOA 2F8TA 3VQ8A 2XHBA 4LSLA 1R0AA 1L3VA 4B08A 3OYAA 4DQRA 1VRUA 3O4NA 4O55A 3BGRA 3K57A 3U3YA 3LAKA 3MXJA 3EZ5A 1IKWA 1JLCA 2HVHA 2LSNA 3NH1A 2HNYA 3OYKA 4AH9A 4DU3A 4CGFA 4FJXA 1ZBIA 5SWMA 3THVA 3I0SA 3NFAA 1KFSA 1ZYQA 4PY5A 2D0AA 3DRPA 1TVRA 4ICLA 3VQBA 3LANA 4BE2A 3OYMA 1SL0A 3V9SA 4FW1A 1NK6A 3U6FA 2PYLA 3P1GA 4CJRA 3B6PA 4UQGA 4KHNA 1RBVA 2YKNA 2WONA 3AVJA 1KLMA 3LPTA 1EKEA 3LPUA 3D0PA 1HNIA 1EP4A 2XY8A 4BE0A 4DTPA 1RTHA 3OYCA 3KLGA 5C24A 1KRPA 2PY5A 3HL8A 1ZBUA 4CEZA 4PA1A 4KHYA 4CJPA 3S3OA 3M8RA 4CEFA 2G8UA 1BI4B 4CJVA 2HHUA 1DTTA 4B8CA 1SV5A 1MU2A 1TL3A 3AO4A 4CFDA 4ELTA 4E7HA 3IAYA 1S6QA 1NOYA 4FXDA 1A5VA 1XHZA 3TABA 1KCFA 4F2SA 4DG1A 4EP4A 4JS4A 5HRSA 1CXQA 5C25A 3T3FA 1VRTA 2BE2A 3L3UA 3SCXA 1TK8A 2KFNA 3L8BA 4EP5A 4LH5A 3SPZA 3VQ5A 4OLBA 2GUIA 5CZ1A 4BWMA 1RNHA 1BI4A 1VSJA 3HPHA 1DTQA 5CY4A 3VN5A 5KRSA 1Z25A 1D8YA 1LAWA 2HHTA 3OYBA 5T7BA 3MAQA 4CJSA 3C95A 1YT3A 4AHRA 4HCBA 3QIOA 1RT1A 1LV5A 1EX4A 2P5OA 1SKRA 4N76A 2JGUA 2ZD1A 4PQUA 3OYDA 1DLOA 1EXQA 1J9AA 2D0CA 3NGIA 3AVNA 4DTXA 3B6OA 2IGIA 5KGWA 2OPRA 4KKOA 5J2QA 4DS5A 4DQQA 3V1OA 3OJUA 3M8QA 1SKWA 1A5XA 2IDOA 4F8RA 4E7LA 4CK2A 1J54A 1FXXA 2E4LA 4CHNA 4NCAA 4GW6A 4IG0A 1S9GA 4LH4A 3TAMA 3HVTA 2E6MA 4WE1A 4YFUA 3NH2A 3TAGA 4FJGA 4DTNA 3V1RA 5FROA 4W5NA 4DMNA 4E7KA 2P5GA 4CEEA 4OJRA 4B9TA 4IFVA 1C0TA 3ZT4A 4JRQA 3QIPA 1S1UA 3KD5E 2HW3A 5K14A 2O4GA 4CF8A 5FRNA 1BL3A 4EZ6A 3VQDA 3QEWA 1WAFA 4CGJA 3HXMA 3NF7A 5CZ2A 4CFCA 4FM1A 3QETA 3V81A 3WNFA 2G8FA 3K5MA 4HTUA 4OVLA 4IBNA 3CM5A 3CFRA 3KTQA 4C8LA 4CGDA 3HT3A 1VSKA 4B9VA 4E0DA 4CJ3A 4DSJA 3SV4A 5FDLA 4DSFA 5EU7A 3RMAA 1HYZA 1X1PA 1XWLA 2DFEA 2NUBA 2Z1GA 1J53A 3FFIA 4KV8A 4CJWA 3O3HA 2BGGA 4CERA 3M8SA 4ID1A 2YHBA 2YNHA 2YNIA 3DOLA 1S1TA 3OS2A 1I39A 3V9UA 4C8KA 1SUQA 4CHYA 4XIUA 5C42A 4M42A 3ZSVA 3K5LA 3AVAA 5HBMA 3ZT2A 3L3VA 4PUOA 2FC0A 1C0MA 2P51A 4IDKA 3OYLA 3NE6A 1C1BA 1A5WA 2Z1IA 3O3GA 2HHQA 1VK0A 4DFMA 1QS4A 1WNSA 2VWKA 4HHTA 1U48A 1C1AA 1BCOA 2FBVA 2G8WA 1NK9A 1N6QA 3KD1E 4DTUA 4F4KA 4AHCA 2XY5A 1WSIA 4BDZA 5JS2A 1BQMA 4FLVA 2QKBA 3AVKA 2EX3A 4DTMA 3G0ZA 2G8KA 3ZT3A 3HM9A 3MXMA 1F21A 5J2PA 2XY6A 4N41A 1WSGA 1NJWA 4AHTA 4ELVA 3DLKA 3HVRA 3V9XA 4B9UA 3SUQA 3AVFA 2FBTA 2PYJA 4F2RA 4C8OA 2G8IA 4CJTA 3RR7A 1C1CA 1Y97A 2HNDA 1IKYA 2HNZA 2HHVA 2XRIA 4DQPA 1WLJA 1ASVA 1WN7A 5SZTA 3NF9A 3RRHA 4FJMA 1FKPA 3P5JA 4RG8A 3QEVA 2OYQA 4DU1A 3M8PA 4DWIA 1TAUA 1FKOA 1HQEA 4M41A 2GV9A 2QKKA 4C8NA 3SQ1A 3SI6A 2YV0X 4M45A 3V6DA 3QESA 1XC9A 1JL2A 3NBPA 4H4OA 4Z0UA 1KFDA 4EZ9A 1NK0A 4CHQA 4CECA 1W0HA 1TV6A 4BDPA 4KREA 3DLEA 1RDDA 1YVUA 2IC3A 2ITGA 3HK2A 3VQCA 1NJYA 4H8KA 4CF1A 3ZSZA
chains in the Genus database with same CATH superfamily
4CJFA 4N47A 1FK9A 4FLZA 3TAFA 4E1MA 4H0TB 3C7NA 4FJKA 1XC3A 4B9SA 2HBMA 4CD3A 3C6UA 4BRDA 1HPMA 3OVNA 3V4IA 2V7YA 2QW9A 1RBTA 1WUAA 3CCSN 3EE9A 5M1QA 2P9NB 1RDWX 1IG9A 5M1FA 1YUWA 3ITHA 4BREA 4Q5VA 3NDKA 4X64K 3QINA 5AQLA 3LDNA 1U4BA 1IV0A 2E2PA 3QNNA 1XHXA 5ELZA 1RFQA 3THYA 2D0BA 3AGRA 3LDSA 4DTRA 4DR1K 3TWHA 2D1KA 2OTJN 3BF3A 1YXQA 4FK0A 2VCPA 1TAQA 4CBWA 2E20A 1JLEA 1RILA 5M1KA 2D5RA 1NGFA 1RBSA 4FCYA 4CK1A 3HSTB 3LDOA 1QQOA 3U3GA 3A5NC 2NRWA 4DSEA 4Z94A 4FWOA 4HCCA 4RW7A 2OA8A 1NWKA 4BE1A 3OYGA 1HNVA 2OPSA 2X74A 4JKFA 4GV9A 4ZHRA 4KFBA 4KTZA 5AQVA 5E84A 1HQUA 3A8YA 4NLBA 5AQZA 1TKZA 1GOBA 3J80O 2FXUA 5GINA 4BVPA 3HP9A 4M3XA 4JN4A 2O8DB 4CZLA 1Q9XA 1JL1A 4FLUA 4FVUA 3NAEA 1X9SA 5BREA 1JLGA 4LF7K 4BG9A 2P9IB 5JMVA 2NLXA 2VG5A 1VQLN 5H1SQ 4DQIA 4M3RA 4BWJA 3MECA 3VQ6A 4BG8A 4FZZA 3CCJN 3O9UA 1S22A 1ZBLA 3O9TA 2E5LK 4U7BA 4BRCA 4FLWA 4Y1DA 3TTFA 4B9MA 4FK2A 1GOCA 1U47A 4W5OA 3NF6A 1WBDA 3PX4A 1NNEA 3PO4A 1W2BM 3KK1A 1N5YA 5KPRA 2EHGA 4DR3K 3WXJA 1X9WA 1SKSA 1S6PA 4CEAA 3ASMA 3G71N 3K5NA 5JLFA 2VQEK 2VWBA 5AFUA 5J2MA 5AQXA 3WXIA 1NGJA 1BO5O 4BR0A 3HZ6A 4GVEA 1T05A 1BA1A 1UA1A 4NXNK 3G4SN 2I7PA 1VQKN 1BISA 3SBTA 2P9UA 3K5OA 4K42A 4BACA 2KFZA 2FLOA 3J8AA 4KH6A 4DKWA 1RTJA 3CQ8A 1NJZA 4IZ9A 4DB3A 3T19A 1T7PA 3DWLA 4M3YA 4KB0A 3O1WA 3OYNA 1C0UA 4FPAA 5HRRA 1Q81O 4FYDA 4Z4IA 3PSFA 3SUPA 4M7YA 4GVMA 3TAEA 1CXUA 1RBRA 3O4QA 4FO0A 1KAXA 4A2BA 3PX6A 3T1YK 1HR0K 3IG1A 2J4RA 3TAPA 4WFBL 3D2FA 1HMVA 5HROA 2B5JA 4XH4A 3VQQA 4WFNL 1D5AA 4CEOA 4DSIA 1JCFA 3DLRA 4PL8A 1BQNA 3W3DA 4FSVA 4JKEA 4BC2A 3C94A 3V9ZA 2X78A 3HOSA 4JI3K 3CFOA 3SMPA 2YKMA 2VWJA 2UUCK 3RMDA 4W5QA 1CZBA 4BDYA 4CZIA 1SS6A 4BQLA 3W0LA 4A62A 3CJ1A 4Z4CA 1VQPN 4B9LA 3EL2A 4FOIA 3I56N 4ISFA 2GBZA 1QTMA 4JD2A 2ZJPL 3OY9A 4A5BA 1UWBA 2WBNA 5DMRA 3AA3A 3HJFA 4CZKA 3RWUA 5IWAK 5CYMA 3THXA 4CF0A 3CCLN 3MN5A 3H45C 4TSXA 1TKXA 4C8MA 3WEEB 1U45A 3VQEA 4BR2A 4FM0A 2E2NA 5AQQA 1OKJA 4F9OA 5GAHP 1YITN 2O8FA 3ATVA 1NKEA 2P9KA 3O1BA 4JEPA 3MCAB 4AHUA 3HP6A 3L2QA 4Z4GA 4RW4A 4ELUA 4JS5A 4F3OA 4KI4A 5AQPA 1VSMA 5JVGL 1QVFM 4M3WA 3NMUA 3AV9A 2ETJA 4BGAA 4C23A 3MEDA 1GLCG 5BPMA 3LAMA 1HYSA 1BUPA 3ZT1A 4LF5K 3J7AP 1BCMA 3VQ4A 2XHBA 4LSLA 4IOCL 3H3NO 3OYAA 4JI5K 3LAKA 3OBYA 3MN6A 3ENHA 3DXKB 4JK8A 1ZBIA 1ZYQA 4PY5A 2D0AA 3L4QA 1TVRA 3VQBA 3V9SA 1NK6A 4O5FA 3B6PA 3AAPA 3LPTA 3AVJA 2KZZA 3D0PA 4JHDA 1KRPA 1U2VB 3MN9A 1VQ7N 4GNIA 4YHHK 3KWGA 1BI4B 1Q7YO 2JWLA 1SV5A 4B8CA 1A5VA 1KCFA 4F2SA 4H0VB 4EP4A 3R8EA 3H1VX 1VRTA 2YCHA 2FSNA 1TK8A 3GE1A 1BDGA 3SPZA 4O8UA 4OLBA 4IWVA 5CZ1A 3HPHA 1DTQA 5CY4A 1D8YA 4CJSA 1HUXA 3QIOA 5AZJB 4B3TK 1SKRA 4N76A 4PQUA 5KQDA 2D0CA 3NGIA 1X3NA 3E9OA 5M1OA 4DV4K 4DS5A 4CJ7A 3OJUA 1SKWA 3VMFB 4NO7A 1A5XA 4F8RA 4BRIA 4CHNA 1S9GA 4LH4A 3HVTA 4FJGA 2CH6A 5FROA 1WOQA 4DMNA 2P5GA 3CCEN 3ZT4A 3QIPA 4DHYA 3G25A 2O4GA 2V51B 1IG8A 4EZ6A 2CH5A 2ZJQL 3E9LA 1WAFA 3HI0A 3QEWA 3WNFA 2G8FA 3K5MA 2Q0RA 3KTQA 4BC5A 4CBUA 1SZ2A 5AQUA 2IIRA 4YDUC 3VGKA 4DUZK 4IFEA 2Z1GA 2BGGA 2V7ZA 4ID1A 3FE1A 4Z4EA 4CZHA 4CHYA 5C42A 1NLVA 3K5LA 4PKGA 4WQ5C 1MWMA 4PUOA 4IJAA 3O9QA 3O3GA 1VK0A 3QFUA 5EOYA 1U48A 2G8WA 2FBVA 2ITMA 4BR7A 5EY4A 4BDZA 1QHAA 3KWIA 3O6WA 3U4LA 4FLVA 3AVKA 2ZJRL 4DTMA 3HM9A 3MXMA 4HWIA 4N41A 1WSGA 3IKMA 1HNZK 3LL3A 1NJWA 4BY9C 3HVRA 3SUQA 2IVOA 5FLXO 4B1ZA 4JI7K 4HTLA 2PYJA 2G8IA 4CJTA 1IKYA 1WLJA 3GDQA 4X65K 3U9ZA 1ASVA 1WN7A 4YOUA 3NF9A 5SZTA 2A41A 2OYQA 2YI1A 1VQ8N 3AARA 4DWIA 2GV9A 2QKKA 3SQ1A 3V6DA 3QESA 1YVNA 1JL2A 1NK0A 1D4XA 4KREA 5EX5A 2P9SA 3T1HK 2ITGA 3ZYYX 5F0XA 2QI2A 5C2FA 1Q82O 1NGHA 1YJWN 1FJGK 2IVPA 1EETA 2HHVA 4FJIA 4W5TA 1XMQK 3PV8A 3MDQA 4Z4FA 4JKBA 3ZSOA 1SAZA 4FL9A 4CGIA 3SLCA 3KIOA 4CEBA 1BA0A 1KAYA 3P39A 5KTQA 2FSKA 3DRRA 3NF8A 4YORA 3LZIA 3UIQA 4H5TA 4J8FA 3NH0A 1D9FA 4FZYA 2ASPA 2RKIA 3JSMA 4JKAA 3TARA 4CESA 4K8XA 1B9DA 4IEEA 1QSYA 4CHPA 3R6MA 3KLFA 3CCVN 3HPGA 3J81O 1S3XA 3SJHA 4N56A 2W6LA 5FRMA 5EXWA 2VQFK 4H5RA 1GOAA 1JLFA 4OKJA 4HVJA 3EY1A 3LM9A 3UKUB 1HLUA 4FK4A 3GG4A 3CG7A 4LC9B 3CQYA 5CHIA 4BRNA 3NVMA 4CHOA 4KHWA 3D7EO 3GL1A 4N5SA 3KK3A 3WXLA 3PY8A 2UUBK 2DFFA 1TGOA 3VEVA 1O13A 3TSUA 4CGHA 4J2AA 4JV5K 3TI0A 1Q8IA 2BANA 1HKGA 2P9PA 2WOMA 3QERA 3EKSA 3OW2M 5FPMA 4BR5A 4OKEA 4DS4A 3KKRA 4KAZA 1QZ6A 1YF5L 4I9LA 1ZBFA 2RF2A 4CCHA 4OPJA 4CJ4A 3CFPA 3OYHA 2QEXN 1BIZA 4JKGB 5CR4A 3PIPL 1ATRA 4CZEA 1Z05A 3I8DA 3BP8A 4XH1A 1EO1A 4M3ZA 3BZCA 4BC3A 1YIJN 3RSEA 1T03A 3AVLA 5I42A 2GX9A 3K59A 3LP3A 1KLNA 3K58A 1KVCA 1P90A 2P1JA 4KI6A 4MFBA 1Z6RA 4ISGA 3MEEA 4JKDA 1KXPA 3K2PA 1J6ZA 4DTJA 1RT3A 2BDPA 3LWMA 4B1WB 4OO1J 3F2KA 4CJKA 4DUYK 4B1VA 4E1NA 1VSDA 4CGGA 3BEXA 4J2DA 4H0YB 4JRPA 1OH5A 1RDBA 3RR8A 1CZ9A 2VG6A 2O8EA 1IKXA 2DFHA 4O0JA 2OCEA 2FBXA 4KRFA 3ID6A 4ILJA 1ASWA 3RMBA 4IKFA 3QMLA 3ZT0A 3ULDA 5LMUK 1BOTO 1J5OA 3VQ7A 2RPIA 1RDAA 4MDAA 1NK8A 2XO7A 3MXIA 1JJ2M 1GLLO 1XNQK 5AQWA 4FLTA 3WNEA 5KRTA 3PLAA 4FZXC 4G1QA 1TK5A 4QAGA 3H3OB 3Q7BA 1OVQA 5KPTA 3CCUN 3CJCA 1JXBA 3NHGA 4YOXA 1L3TA 2D0OA 4QCLA 1KVBA 1T44A 3RMCA 2P9LA 3D45A 1WBBA 5TKYA 3DXMB 3M3ZA 2Q36A 3MWPA 5KI6A 1RTDA 1N8RO 2B6AA 1U2VA 4PL7A 2AA4A 3O3FA 4IEIA 3M6GA 4YNQA 3ZETB 4DSKA 2GWJA 2KTQA 1JLQA 5KGXA 1TKDA 1IH7A 3EYZA 4DV7K 4NB4A 5BRHA 5FPEA 3ZX2A 2Q97A 2A1SA 1VQMN 4LY7A 2OPPA 3SPYA 2DPNA 3LP1A 3DYAA 4JI6K 1I3AA 1JCEA 5GIOA 2NRRA 3M5RA 4FVMA 1YJNN 1L3SA 2F9TA 2FBYA 1S9EA 3WQTA 3C0BA 4H5VA 5J1EA 4W5RA 2FF3B 3SBGA 3SYZA 5CE3A 4H0XB 4BRAA 4BRLA 1WSHA 1ZXOA 5AQOA 4FWKA 4WQ4C 3AVCA 3SUOA 4CE9A 4DQSA 5BRFA 5D3GA 3L6QA 1RT5A 2VG7A 5GAGP 2OPQA 2F96A 4E89A 3MX2A 2O8BA 3ZSXA 5C10A 3FGUA 4WF9L 5TKWA 4EHUA 3CC4N 1VQNN 5GIPA 4XEIA 3G6EN 4B9NA 4LF4K 2DY4A 3MK6A 1TL1A 4DR2K 1S1VA 4H5NA 3LWLA 3T1AA 4CJLA 5AQYA 2Z1HA 1G15A 3DJCA 3CJBA 3ULEA 1ESVA 3CIPA 3LDPA 1RDUA 2HVIA 1UAXA 3CJAA 3PSIA 5AQRA 1U49A 5IT9O 1RT6A 1GLFO 4ISEA 1NK4A 4YY3K 5AR0A 1WSEA 1RTIA 4FJ5A 3KLEA 3WNHA 3LZJA 2W41A 3EE8A 3VEYA 4DLGA 4EIAA 4BQZA 4B08A 3O80A 2JWKA 3O4NA 3K57A 3EZ5A 1IKWA 2HVHA 1H1VA 4DU3A 4AH9A 1DT9A 4FJXA 5SWMA 3NFAA 3MX5A 3DRPA 4BE2A 1L3VA 3LANA 3OYMA 4FW1A 2PYLA 1TYQB 1NJIO 4CJRA 4A61A 4UQGA 3A5LC 1X3MA 2WONA 4JI0K 1EP4A 1HNIA 4DTPA 1GLEG 5C24A 1ZBUA 4BROA 4CEZA 4KHYA 4YOVA 1NGDA 2HHUA 4CFDA 4JK9A 1YAGA 4FXDA 3TABA 3Q7CA 2NZTA 4DG1A 1FW6A 5AZIA 3JS6A 2KFNA 3L8BA 4EP5A 4LF9K 4BWMA 5GAEP 5AQSA 1RNHA 1VSJA 3VN5A 5KRSA 3D2EB 5AQIA 2HHTA 2DTUA 5T7BA 3MAQA 5ADXA 1YT3A 3AVNA 3B6OA 4KKOA 4FWSA 3THWB 3S41A 3A5MC 3M8QA 2ZGZA 1BWFO 4K25A 1J54A 4DV1K 2E4LA 4IG0A 3CD6N 3TAMA 3NH2A 2E6MA 4FWPA 4WE1A 4CZFA 4CW7B 4DTNA 3H6EA 1DKGD 4W5NA 4CEEA 4OJRA 1IBLK 2GTDA 3MWTA 3KD5E 2HW3A 4CF8A 5FRNA 1BL3A 5M1NA 4JI1K 3V81A 4CGJA 4FM1A 3QETA 1C0FA 4IOXA 4C8LA 4JKHA 4JYAK 4B9VA 3CHWA 2CGLA 5EU7A 2ZGYA 3CJ9A 4BRGA 2NUBA 1X1PA 2DFEA 3VTIA 3O3HA 3QB0A 3M8SA 2YHBA 2YNHA 4QS7A 1S1TA 3OS2A 4M42A 1SUQA 4XIUA 1N33K 4FWQA 2ASOA 5HBMA 3ZT2A 4CZGA 1YJ9N 4IDKA 1C1BA 2Z1IA 2HHQA 4DFMA 1QS4A 3ZEUA 1C1AA 1BCOA 1NK9A 1N6QA 3KD1E 2XY5A 2KLAA 2QKBA 4BRMA 2EWSA 2EX3A 3IUCA 3LDLA 3ZT3A 2QWLA 4ELVA 1MDUB 4C8OA 4AF1A 1Y97A 5MLCQ 4DCHA 5LJVA 3RRHA 4L3QA 2HBKA 1NBWA 4FJMA 3P5JA 2RHKA 3QEVA 4DU1A 4I6MA 1TAUA 1HQEA 2QWQA 4C8NA 1T6CA 4GY2B 1ATSA 5AQFA 4M45A 3C7NB 1XC9A 3VGLA 4H4OA 4Z0UA 1GLAG 4CHQA 2NRTA 4BRFA 1TV6A 4CECA 4BDPA 5AQTA 2IC3A 3UKRA 3VQCA 2GWKA 4H8KA 5BPNA 3QDKA 2AP1A 4FJ8A 3HTVA 3ZSQA 1RCHA 4CJUA 4FJJA 1JLAA 1LCUA 1N32K 1K73O 4CZMA 1XI1A 3AY9A 3H08A 3KKSA 1XNRK 2PFUA 3VPZA 3L2UA 2V52B 3OS0A 3LALA 1N36K 1NMNA 3THYB 4DTOA 3DM2A 4KTWA 3NGZA 3CETA 4OPHA 1SQKA 1GLBG 3I33A 3VQ9A 2Y1IA 4AQYK 4KHUA 5HLFA 1LW0A 1GLDG 3LM2A 3F5TA 3QEIA 4B3OA 3CCRN 4CF9A 3JYTA 2ZE2A 4LFBK 2P9NA 1E4GT 4KTQA 5GADP 1HJOA 3KK7A 3ZX0A 2E8AA 2F4VK 1S1XA 3AVGA 2QXLA 4QOZB 3VEOA 3L2VA 2VYPA 4IXCA 3DXMA 3OYEA 4CZJA 1ILYA 1NGCA 4GMJB 2ASMA 3U9DA 1KVAA 3ZSYA 3I55N 1YTAA 2A5XA 2B4JA 2IAJA 1ASUA 1KC8O 5JS1A 4B9QA 3ZCMA 1TKTA 3SJJA 5BN8A 3ISNC 3JXUA 3IFRA 3A5OC 1HJRA 2ZQBA 4EFHA 3AVMA 4KH4A 1G99A 1K9MO 4YDUA 1WSJA 2YNFA 4I2PA 3KHYA 2ZF5O 1LWEA 2A3ZA 4MQ3A 1RT7A 2QWRA 3AO1A 3AVBA 4WQ5A 4AILC 4BRHA 3PX0A 1QQMA 2O8DA 3QO9A 4FJ9A 2A1RA 5DM7L 4BVOA 1LWCA 3VF4A 2A42A 4E7IA 1CLQA 4Y0WA 4Y1CA 2P9IA 3V9WA 4JAXA 3J7YP 4OGEA 2E6LA 3OBWA 4CJEA 4B3SK 5FPNA 2WTUA 3MCPA 4CBXA 3VEXA 3AVHA 1HRHA 1IO2A 2IVNA 4NYFA 1L3UA 4FW2A 5KQ8A 3C6HA 3FZHA 2RN2A 2HB5A 2YNGA 1NGIA 1ATNA 1ITGA 2P9UB 1TK0A 1D9DA 3AAQA 3HSCA 3CC7N 1BG3A 4FJHA 5AQGA 4H4MA 1S72N 1K8AO 4JNEA 5EVZA 3DOKA 4DFJA 3KLIA 1RBUA 3DI6A 3K9KA 2D0PA 3TSPA 3AVIA 1KTQA 1RDCA 4CEDA 1RGIA 5BR9A 3SQ4A 4JLHA 1NKCA 3FR0A 4CF2A 4AHSA 2Q2RA 4OX9K 2AJQA 1WB9A 4CVNE 2Z1JA 5LY3A 4I2QA 1Q86O 4BRPA 1VSFA 4X66K 2HHHK 1VSLA 2YHYA 2I5JA 3B8AX 4RW6A 5JICA 4OLAA 4G9ZA 5BR8K 3D2FB 3QLHA 4RTFD 2HHXA 3EKUA 4LSNA 2O8CB 1C0GA 2KW4A 4JI4K 1T8EA 2YHWA 3R1XA 3TAQA 1IBMK 2I7NA 2E2OA 3TANA 4HUGA 4I7FA 2HMPA 5HOOA 2HSTA 3VF6A 3NCIA 3ZLJA 4BR4A 5FPDA 3QEXA 3CXCM 4Z4HA 5HL7L 4FJLA 3E01A 1VQ9N 2Q3SA 4ILGB 3SMSA 4AHVA 1L5UA 2OZMA 1DGKN 3TR8A 5C15A 3DLBA 1O1WA 3DLHA 4DFPA 1ZBHA 2E1ZA 3THXB 3VQPA 3SAGA 1S5JA 1LOTB 2NRXA 1U04A 3GOIA 4OGCA 3GBTA 1IBKK 3CM6A 4JI8K 2OTLN 3ALYA 1HPZA 4BRKA 4DV2K 2O8FB 4CD1A 3CF5L 3QFPA 2P9KB 4DFKA 4PKHA 2HF3A 1Q9YA 4O44A 4FJ7A 2QK9A 3OJSA 2PAVA 4FJNA 4K8ZA 3BZKA 1BHLA 2WC9A 3A0IX 2E1YA 1QE1A 3DMJA 2HMIA 4J2EA 1N34K 3SZ2A 2QXFA 5C2DA 3QEPA 3WEEA 2VGMA 4NCBA 5JVHL 3QNOA 1VHXA 2GELA 3AO3A 3FZFA 4WCEL 3OYIA 1ZC6A 4CEQA 4KO0A 3VETA 4E1JA 1NK5A 4IG3A 4O4GA 3AA4A 1Y64A 4K41A 1NMDA 1V4TA 2HHWA 2QWMA 3OYJA 4B1UB 2G8HA 3ZSRA 1VQON 3KLHA 4J2BA 4OKKA 5I3UA 2Y1JA 4M3UA 2F8TA 3HPOA 1R0AA 3SK3A 1VRUA 2NRHA 2GUPA 4JHDB 3MXJA 1JLCA 3NH1A 3IDHA 2HNYA 1W97L 1QVGM 3THVA 3AGKA 5AFUH 4ICLA 5LJWA 1XMOK 3U6FA 2CGJA 4KHNA 1RBVA 3HK2A 3LPUA 1EKEA 4BE0A 4IDHA 3CC2N 4K0KK 3H46O 4A57A 3DXKA 4CJPA 2G8UA 4CJVA 1YHQN 4ELTA 1GLJO 4E7HA 3E1YA 3P31A 3IAYA 3CJ7A 1S6QA 1NOYA 1HNXK 1XHZA 1X9JA 2HF4A 2QWNA 1CXQA 3T3FA 2BE2A 3SCXA 1KQSM 4O8KA 1HNWK 3VQ5A 1BI4A 4KBOA 2KHOA 1Z25A 3UB5A 3OYBA 5AQJA 4EHTA 4YOTA 4AHRA 1EX4A 2JGUA 2ZD1A 1DLOA 1EXQA 1U6ZA 5KGWA 1M90O 1QQNA 3CMAN 5J2QA 4DQQA 3V1OA 4CK2A 1FXXA 4NCAA 4GW6A 2HHSA 5AZJA 4YFUA 1XQSC 3V1RA 4E7KA 5ADXH 4B9TA 4IFVA 1C0TA 3VQDA 2E88A 3HXMA 4A5AA 4CFCA 3OA9A 4HTUA 4OVLA 4IBNA 3CM5A 3CFRA 1NM1A 4CGDA 3HT3A 1VSKA 1NG9A 4B1YB 4CJ3A 4DSJA 3O4WA 4FPBA 3RMAA 4DR4K 1HYZA 4KV8A 5AQHA 4CERA 4WQ4A 3DOLA 1BU6O 4C8KA 1I39A 1OVYA 3ZSVA 2UYTA 1OH6A 5M1PA 3NE6A 1A5WA 1T3VA 3WXMB 2VWKA 4MO4A 1NGAA 4DTUA 4AHCA 1WSIA 5JS2A 1T6DA 2W6KA 2G8KA 4DR6K 4BGBA 2XY6A 4ILHA 5LL6Z 4AHTA 2ZM6K 5B8HA 3CI5A 3SAFA 2HNDA 2HNZA 2XRIA 3JAMO 4GKKK 2BTFA 1EWQA 2UU9K 2P9SB 4MO5A 1FKPA 4RG8A 3L4IA 3M8PA 4GV6A 3OHRA 1FKOA 4M41A 5KPZA 3SI6A 3MN7A 2QA4N 1KFDA 4EZ9A 4KH5A 1W0HA 2NRVA 3DLEA 3QBXA 1RDDA 1YVUA 3QICA 1NJYA 2YHXA 4CF1A 3ZSZA 4LD0A 4CIGA 4U67L 1DEJA 4AM7A 2D4WA 3SQ0A 3HO1A 4F3TA 3ATUA 4FM2A 3HRGA 3A2FA 4IJNA 3S3NA 3LP2A 2JLEA 3DRSA 3AA5X 5JLHA 1QHTA 1QQCA 4FWMA 5J2NA 3ENBA 5BN9A 4WYBA 5HRNA 3F9KA 1IJJA 2PBDA 3R3LA 4AM6A 2QM1A 3BY5A 3NGYA 4HUFA 1LWFA 4LF6K 2OZSA 1OH8A 1B92A 3PIOL 4DLEA 3F73A 5BPLA 3VESA 4FWNA 4MLEA 3EN9A 4PWDA 5A2QO 4GV3A 3IRXA 4JKCA 5LMNK 4DTSA 4PHTX 3FZMA 3ZX3A 3WT0A 1K8KB 4OPAA 2H3GX 4HUEA 3CQXA 4CJQA 4BC4A 4FLYA 2A40A 4E7JA 1S1WA 2GEMA 2P9PB 3J7ZO 1KD1O 4KB1A 4FWLA 1LW2A 4PKIA 2F9WA 1OH7A 4DV0K 3U8XA 2A6AA 2FSJA 3UKUA 2O8CA 5C0YA 3TPQA 4DQ8A 4KPYA 3C6TA 4RCHA 3VEZA 1HKCA 1WSFA 2HBLA 4CHZA 3PUFA 4NYNA 1R59O 2YHAA 3LDQA 4OPKA 4DR5K 3OS1A 2KZMA 4RW8A 4O5BA 3KK2A 3RSEB 2BH1A 5C12A 3E66A 4CIEA 1C6VA 4CK3A 1VQ4N 2PZSA 3IS9A 3PO5A 2F8SA 5DK5A 3EZWA 2HOEA 3M1FA 3R9PA 1MWKA 2O4IA 4ZTJA 4DR7K 1REVA 3S9HA 4DSLA 4JKGA 4MDBA 2UXBK 2NNWA 2QWOA 2IS3A 4X62K 1YI2N 1Q18A 3HM8A 3SAHA 4E19A 3DLGA 2O8EB 3O5BA 4LFAK 3MEGA 3CCMN 1V4SA 1HYVA 4IFYA 4YOYA 1X9MA 3HBTA 3AO5A 1K6YA 3CERA 3EEQA 3FZKA 3VENA 4EAHD 4JK7A 5CYQA 1SL1A 3VA3A 3L2WA 1NKBA 1YTUA 1QZ5A 3WUHA 4R79A 4CIFA 3SV3A 4O0IA 4V19S 5F1XA 4DF4A 3L0QA 5HP1A 1WAJA 4BRQA 1E4FT 4M7XA 5HRPA 1I94K 4CJ5A 1VQ6N 3TTDA 1QSSA 2QTDA 5AJ3K 2X6SA 2ATQA 2P9LB 1UA0A 3T7ZA 3KZBA 2WUSA 4H03B 2X6NA 4DU4A 4I9QA 4H0OA 2NRZA 5AQNA 3N4PA 3VQAA 1NU0A 4R5PA 3KJVA 4RW9A 4K43A 3K0SA 4IOAL 3DLLL 3C65A 2CGKA 4ID5A 3P4IA 3FLCO 4B8AB 5BRDA 3F9MA 4C1NI 3P83D 2W42A 1IKVA 1VSHA 3I0RA 3CPWM 3O9SA 4A59A 3BF1A 3O08A 1NJXA 3SQ2A 4H5WA 1KSPA 2G8VA 3NVKA 4WFAL 1NGGA 4Q0BA 1KAZA 3VGMA 1JXEA 2F7TA 3SNNA 1HX1A 3G10A 3RTVA 4RWTA 4QS8A 1SL2A 3ZETA 1CZAN 1LAVA 1TUUA 3VERA 2KQ2A 4FWRA 3S3MA 1B9FA 4ZTFA 1BIUA 3WNGA 4UY8O 3V1QA 2Q0UA 4CFBA 4DF8A 5E41A 2O8BB 3BUZB 1JCGA 1QSLA 3L2RA 4E3SA 3BDPA 1MA9B 3CCQN 1EQYA 3HYFA 1UOCA 3N4QA 4KHSA 3T69A 4NCGA 5F2RA 3RRGA 1NOZA 1TUYA 1JKHA 3ENOA 1Z26A 3D6RA 3OTOK 2R7YA 1J5EK 3LP0A 4FLXA 3AO2A 3IMXA 4DV6K 3CYMA 3I8BA 3ULEB 1VSIA 1JLBA 2XY7A 4CFAA 4DV3K 1W7AA 1W9HA 2E2QA 3OYFA 3VA0A 4H0PA 4NLCA 3FFKB 2IOCA 2ZWHA 4B3RK 2QWPA 1M1KO 4KHQA 4L8RB 1NK7A 3SUNA 2YJEA 1VSEA 2UUAK 4M3TA 1RT4A 3AA2A 3ZSWA 3HOTA 1BGXT 1VQ5N 1RT2A 3VQ8A 2FF6A 4BR9A 4DQRA 3U3YA 4O55A 3BGRA 4A2AA 1XUPO 2LSNA 3CMEN 3ID8A 3OYKA 4CGFA 3I0SA 1KFSA 1ZBSA 3VTHA 1SL0A 2KKZA 3P1GA 4B1XB 2YKNA 1KLMA 5AZIB 2XY8A 3WQUA 1RTHA 3OYCA 3KLGA 2PY5A 5DM6L 3HL8A 2W40A 3RVCA 4PA1A 3S3OA 3M8RA 4LFCK 4CEFA 1DTTA 1MU2A 1TL3A 3AO4A 3CPEA 1TYQA 2YJFA 4JS4A 5HRSA 5C25A 4JI2K 2UXDK 4KHPK 3L3UA 4LH5A 2OANA 2GUIA 3O8MA 1LAWA 2VGNA 3C95A 4NXMK 4HCBA 2HBJA 1RT1A 1LV5A 2P5OA 2Q1NA 3OYDA 1J9AA 3E9PA 4DTXA 2IGIA 2OPRA 1P8ZA 3KVGA 4IO8A 2IDOA 3D2EA 4E7LA 5AQKA 3K9JA 5I9EB 4JD2B 3TAGA 4M63C 3O9RA 4QS9A 1NGEA 4JRQA 1S1UA 3H1QA 5K14A 4B3MK 1EWRA 3THWA 3FZLA 3NF7A 5CZ2A 2YX6A 3TTCA 3P38A 3TU5A 1K8KA 4MLHA 4E0DA 3SV4A 5FDLA 4DSFA 5AQMA 3FFIA 1XWLA 1J53A 4CJWA 3ZEUB 2YNIA 3V9UA 3VEWA 4CI6A 3AVAA 2BUPA 3L3VA 2FC0A 1C0MA 2P51A 3EO3A 1WNSA 4HHTA 4F4KA 1VAZA 3C6AA 3TSQA 1NGBA 5E26A 3MMVA 4FOEA 1BQMA 4LF8K 3G0ZA 3WXKA 1F21A 5J2PA 3DLKA 3VOVA 3V9XA 4DV5K 4B9UA 3AVFA 4I6MB 2FBTA 3QBWA 4XH5A 4F2RA 3RR7A 1C1CA 3UE5A 4DQPA 2Q31A 2RE2A 4IO9L 2UXCK 3UKRB 2WFBA 2YV0X 1HKBA 3NBPA 4GKJK 3VF2A 3DAWA 1E3MA 4C1NK 4YOWA 3OYLA
chains in the Genus database with same CATH topology
4LD0A 4CIGA 3HO1A 4FJ8A 4F3TA 1EETA 3ZSQA 4CJFA 4FM2A 3A2FA 4W5TA 4FJIA 1RCHA 4N47A 4CJUA 1FK9A 4FLZA 1JLAA 3TAFA 4E1MA 3LP2A 3PV8A 3S3NA 2JLEA 3DRSA 4Z4FA 4FJKA 3AA5X 4B9SA 3ZSOA 1QHTA 3C6UA 1QQCA 3OVNA 5J2NA 4CGIA 1XI1A 3H08A 3KIOA 3KKSA 4CEBA 3V4IA 5KTQA 1RBTA 3DRRA 3NF8A 3L2UA 5HRNA 3OS0A 3F9KA 3LALA 3LZIA 3NGYA 4HUFA 1LWFA 3UIQA 2OZSA 3NH0A 1IG9A 1D9FA 1B92A 4DTOA 2KZZA 3DM2A 4KTWA 4DLEA 3ITHA 3NGZA 3F73A 4FZYA 2RKIA 4Q5VA 3JSMA 3NDKA 3VQ9A 2Y1IA 3QINA 3TARA 4CESA 4K8XA 4KHUA 1B9DA 1U4BA 5HLFA 1LW0A 3QEIA 4CHPA 1QSYA 4B3OA 3QNNA 1XHXA 4CF9A 3KLFA 4PWDA 3HPGA 3IRXA 3JYTA 2ZE2A 2D0BA 4KTQA 4N56A 5FRMA 4DTSA 1GOAA 1JLFA 4OKJA 4HVJA 3LDSA 1S1XA 3EY1A 3AVGA 4DTRA 3TWHA 4QOZB 4FK4A 3L2VA 3CG7A 3OYEA 4HUEA 4FK0A 4CJQA 1TAQA 4GMJB 4FLYA 4CHOA 4KHWA 4E7JA 1JLEA 1RILA 1S1WA 4KB1A 2D5RA 1KVAA 1LW2A 1RBSA 3ZSYA 4CK1A 4N5SA 3HSTB 3KK3A 4FCYA 3U3GA 3PY8A 1YTAA 4DSEA 2B4JA 2DFFA 2IAJA 1ASUA 1TGOA 4HCCA 4RW7A 5JS1A 2OA8A 4BE1A 3OYGA 4CGHA 3ZCMA 1HNVA 4KPYA 1TKTA 3C6TA 2OPSA 2X74A 3SJJA 3TI0A 3ISNC 1Q8IA 4J2AA 4ZHRA 2BANA 4KFBA 1WSFA 4KTZA 1HQUA 2WOMA 1HJRA 3QERA 4CHZA 3PUFA 4NYNA 1TKZA 1GOBA 2ZQBA 3AVMA 2YHAA 4OKEA 4DS4A 3KKRA 4KAZA 4M3XA 3HP9A 4OPKA 4CCHA 4I9LA 1ZBFA 2RF2A 3OS1A 2KZMA 1WSJA 4CJ4A 4OPJA 4RW8A 1Q9XA 4O5BA 3KK2A 3CFPA 2YNFA 3OYHA 4I2PA 1BIZA 1JL1A 4CIEA 1C6VA 1LWEA 4CK3A 4FLUA 2PZSA 3IS9A 3PO5A 2F8SA 4MQ3A 1RT7A 3NAEA 1X9SA 5DK5A 1JLGA 4AILC 3AO1A 3AVBA 3PX0A 2VG5A 3I8DA 4DQIA 4M3ZA 2O4IA 3QO9A 4ZTJA 4FJ9A 1T03A 3AVLA 4M3RA 2A1RA 1REVA 4BWJA 3S9HA 3MECA 3VQ6A 3K59A 3LP3A 5I42A 1KLNA 3K58A 1KVCA 4DSLA 1LWCA 2P1JA 4FZZA 4KI6A 4MFBA 2IS3A 1ZBLA 4E7IA 1CLQA 4Y1CA 3MEEA 3V9WA 3K2PA 4E19A 4DTJA 3DLGA 4FLWA 4Y1DA 4B9MA 1RT3A 2E6LA 4OGEA 1GOCA 2BDPA 3MEGA 4FK2A 4CJEA 1U47A 4W5OA 3LWMA 3NF6A 4CJKA 3PX4A 1HYVA 3PO4A 4IFYA 4E1NA 3AVHA 1VSDA 1X9MA 1HRHA 4CGGA 3KK1A 3AO5A 1N5YA 4Z4EA 4J2DA 1IO2A 2EHGA 1K6YA 4NYFA 4JRPA 1X9WA 1SKSA 1RDBA 1L3UA 3RR8A 1S6PA 1CZ9A 2VG6A 5CYQA 4CEAA 3ASMA 4FW2A 3VA3A 1SL1A 1IKXA 3L2WA 3K5NA 1NKBA 2DFHA 4O0JA 1YTUA 2RN2A 2FBXA 5J2MA 4KRFA 4CIFA 3SV3A 2HB5A 4O0IA 2YNGA 1ASWA 3RMBA 4IKFA 1ITGA 4DF4A 3ZT0A 3ULDA 1TK0A 5HP1A 1WAJA 1T05A 1D9DA 5HRPA 1J5OA 3VQ7A 4CJ5A 2RPIA 1RDAA 1UA1A 1NK8A 4FJHA 2XO7A 3MXIA 1QSSA 4H4MA 1BISA 4FLTA 2X6SA 2ATQA 3WNEA 5KRTA 1UA0A 3DOKA 4DFJA 3KLIA 4FZXC 3K5OA 4G1QA 1RBUA 3DI6A 4BACA 1TK5A 4QAGA 2X6NA 4DU4A 2KFZA 4I9QA 3AVIA 1KTQA 1RDCA 4CEDA 1RTJA 3CQ8A 1NJZA 3T19A 4JLHA 3SQ4A 1NKCA 1L3TA 1JXBA 3VQAA 4R5PA 3NHGA 3KJVA 1T7PA 1KVBA 4CF2A 4RW9A 3RMCA 4QCLA 4AHSA 3D45A 2AJQA 4M3YA 2Z1JA 4KB0A 4I2QA 3OYNA 1C0UA 1VSFA 2HHSA 4ID5A 5HRRA 4FYDA 4Z4IA 1VSLA 5KI6A 4B8AB 2I5JA 2DTUA 3SUPA 1RTDA 4RW6A 4OLAA 4GVMA 2B6AA 3P83D 3QLHA 3TAEA 2W42A 2HHXA 1IKVA 3O3FA 1CXUA 1VSHA 4LSNA 1RBRA 3I0RA 3O4QA 4YNQA 4DSKA 3PX6A 2KW4A 2KTQA 1JLQA 1T8EA 5KGXA 1TKDA 1IH7A 3SQ2A 1NJXA 3EYZA 3TAQA 1KSPA 2G8VA 3IG1A 3TAPA 4Q0BA 2A1SA 4LY7A 1JXEA 3TANA 1HMVA 2OPPA 2B5JA 3SPYA 3LP1A 3VQQA 4HUGA 3DYAA 5HROA 1D5AA 3SNNA 4CEOA 1I3AA 4I7FA 4DSIA 3G10A 3RTVA 3DLRA 1BQNA 1SL2A 3NCIA 1LAVA 4FVMA 2KQ2A 3QEXA 3SQ0A 3S3MA 4Z4HA 1L3SA 1B9FA 2FBYA 1S9EA 3C94A 3V9ZA 1BIUA 3WNGA 2X78A 4ZTFA 3E01A 4FJLA 3V1QA 5J1EA 4W5RA 2Q3SA 3CFOA 4AHVA 1L5UA 2OZMA 2YKMA 2VWJA 4FJJA 3TR8A 3RMDA 4W5QA 3DLBA 1O1WA 1CZBA 3SYZA 4BDYA 4DFPA 4CFBA 3DLHA 3VQPA 1ZBHA 4DF8A 5E41A 1S5JA 4Z4CA 1WSHA 4B9LA 1QSLA 1U04A 3L2RA 3AVCA 3SUOA 4CE9A 4E3SA 4DQSA 2GBZA 1QTMA 3BDPA 4OGCA 5D3GA 3CM6A 3HYFA 1RT5A 3OY9A 1UWBA 2VG7A 1UOCA 3ALYA 5DMRA 4KHSA 3AA3A 1HPZA 2OPQA 3HJFA 3RWUA 4NCGA 5CYMA 3RRGA 1NOZA 2F96A 4E89A 4CF0A 4DFKA 1JKHA 3ZSXA 1Q9YA 4O44A 4TSXA 1Z26A 1TKXA 4FJ7A 2QK9A 4C8MA 2R7YA 3OJSA 3LP0A 4FLXA 1U45A 4FJNA 3AO2A 3VQEA 3CYMA 4K8ZA 4B9NA 2DY4A 1VSIA 1JLBA 4FM0A 1TL1A 2XY7A 1S1VA 4CFAA 1NKEA 1W9HA 1BHLA 3LWLA 1QE1A 3DMJA 3T1AA 4CJLA 2HMIA 4J2EA 2Z1HA 1G15A 3SZ2A 3OYFA 2QXFA 3VA0A 4AHUA 3HP6A 3QEPA 4NCBA 3QNOA 3L2QA 4Z4GA 4RW4A 4ELUA 4JS5A 3AO3A 4F3OA 4KI4A 3OYIA 4CEQA 2IOCA 4KO0A 1VSMA 2HVIA 1UAXA 4M3WA 1U49A 1NK5A 1RT6A 3AV9A 2ETJA 4IG3A 4L8RB 1NK7A 4O4GA 3AA4A 1NK4A 3SUNA 4KHQA 1VSEA 1WSEA 3MEDA 4M3TA 1RT4A 3AA2A 1RTIA 4FJ5A 2HHWA 3KLEA 3OYJA 1HYSA 3LAMA 3WNHA 3ZSRA 3ZT1A 3KLHA 3LZJA 4OKKA 2G8HA 4J2BA 5I3UA 3ZSWA 1BCMA 4DLGA 1BGXT 1RT2A 2Y1JA 4M3UA 3VQ4A 3HPOA 2F8TA 3VQ8A 2XHBA 4LSLA 1R0AA 1L3VA 4B08A 3OYAA 4DQRA 1VRUA 3O4NA 4O55A 3BGRA 3K57A 3U3YA 3LAKA 3MXJA 3EZ5A 1IKWA 1JLCA 2HVHA 2LSNA 3NH1A 2HNYA 3OYKA 4AH9A 4DU3A 4CGFA 4FJXA 1ZBIA 5SWMA 3THVA 3I0SA 3NFAA 1KFSA 1ZYQA 4PY5A 2D0AA 3DRPA 1TVRA 4ICLA 3VQBA 3LANA 4BE2A 3OYMA 1SL0A 3V9SA 4FW1A 1NK6A 3U6FA 2PYLA 3P1GA 4CJRA 3B6PA 4UQGA 4KHNA 1RBVA 2YKNA 2WONA 3AVJA 1KLMA 3LPTA 1EKEA 3LPUA 3D0PA 1HNIA 1EP4A 2XY8A 4BE0A 4DTPA 1RTHA 3OYCA 3KLGA 5C24A 1KRPA 2PY5A 3HL8A 1ZBUA 4CEZA 4PA1A 4KHYA 4CJPA 3S3OA 3M8RA 4CEFA 2G8UA 1BI4B 4CJVA 2HHUA 1DTTA 4B8CA 1SV5A 1MU2A 1TL3A 3AO4A 4CFDA 4ELTA 4E7HA 3IAYA 1S6QA 1NOYA 4FXDA 1A5VA 1XHZA 3TABA 1KCFA 4F2SA 4DG1A 4EP4A 4JS4A 5HRSA 1CXQA 5C25A 3T3FA 1VRTA 2BE2A 3L3UA 3SCXA 1TK8A 2KFNA 3L8BA 4EP5A 4LH5A 3SPZA 3VQ5A 4OLBA 2GUIA 5CZ1A 4BWMA 1RNHA 1BI4A 1VSJA 3HPHA 1DTQA 5CY4A 3VN5A 5KRSA 1Z25A 1D8YA 1LAWA 2HHTA 3OYBA 5T7BA 3MAQA 4CJSA 3C95A 1YT3A 4AHRA 4HCBA 3QIOA 1RT1A 1LV5A 1EX4A 2P5OA 1SKRA 4N76A 2JGUA 2ZD1A 4PQUA 3OYDA 1DLOA 1EXQA 1J9AA 2D0CA 3NGIA 3AVNA 4DTXA 3B6OA 2IGIA 5KGWA 2OPRA 4KKOA 5J2QA 4DS5A 4DQQA 3V1OA 3OJUA 3M8QA 1SKWA 1A5XA 2IDOA 4F8RA 4E7LA 4CK2A 1J54A 1FXXA 2E4LA 4CHNA 4NCAA 4GW6A 4IG0A 1S9GA 4LH4A 3TAMA 3HVTA 2E6MA 4WE1A 4YFUA 3NH2A 3TAGA 4FJGA 4DTNA 3V1RA 5FROA 4W5NA 4DMNA 4E7KA 2P5GA 4CEEA 4OJRA 4B9TA 4IFVA 1C0TA 3ZT4A 4JRQA 3QIPA 1S1UA 3KD5E 2HW3A 5K14A 2O4GA 4CF8A 5FRNA 1BL3A 4EZ6A 3VQDA 3QEWA 1WAFA 4CGJA 3HXMA 3NF7A 5CZ2A 4CFCA 4FM1A 3QETA 3V81A 3WNFA 2G8FA 3K5MA 4HTUA 4OVLA 4IBNA 3CM5A 3CFRA 3KTQA 4C8LA 4CGDA 3HT3A 1VSKA 4B9VA 4E0DA 4CJ3A 4DSJA 3SV4A 5FDLA 4DSFA 5EU7A 3RMAA 1HYZA 1X1PA 1XWLA 2DFEA 2NUBA 2Z1GA 1J53A 3FFIA 4KV8A 4CJWA 3O3HA 2BGGA 4CERA 3M8SA 4ID1A 2YHBA 2YNHA 2YNIA 3DOLA 1S1TA 3OS2A 1I39A 3V9UA 4C8KA 1SUQA 4CHYA 4XIUA 5C42A 4M42A 3ZSVA 3K5LA 3AVAA 5HBMA 3ZT2A 3L3VA 4PUOA 2FC0A 1C0MA 2P51A 4IDKA 3OYLA 3NE6A 1C1BA 1A5WA 2Z1IA 3O3GA 2HHQA 1VK0A 4DFMA 1QS4A 1WNSA 2VWKA 4HHTA 1U48A 1C1AA 1BCOA 2FBVA 2G8WA 1NK9A 1N6QA 3KD1E 4DTUA 4F4KA 4AHCA 2XY5A 1WSIA 4BDZA 5JS2A 1BQMA 4FLVA 2QKBA 3AVKA 2EX3A 4DTMA 3G0ZA 2G8KA 3ZT3A 3HM9A 3MXMA 1F21A 5J2PA 2XY6A 4N41A 1WSGA 1NJWA 4AHTA 4ELVA 3DLKA 3HVRA 3V9XA 4B9UA 3SUQA 3AVFA 2FBTA 2PYJA 4F2RA 4C8OA 2G8IA 4CJTA 3RR7A 1C1CA 1Y97A 2HNDA 1IKYA 2HNZA 2HHVA 2XRIA 4DQPA 1WLJA 1ASVA 1WN7A 5SZTA 3NF9A 3RRHA 4FJMA 1FKPA 3P5JA 4RG8A 3QEVA 2OYQA 4DU1A 3M8PA 4DWIA 1TAUA 1FKOA 1HQEA 4M41A 2GV9A 2QKKA 4C8NA 3SQ1A 3SI6A 2YV0X 4M45A 3V6DA 3QESA 1XC9A 1JL2A 3NBPA 4H4OA 4Z0UA 1KFDA 4EZ9A 1NK0A 4CHQA 4CECA 1W0HA 1TV6A 4BDPA 4KREA 3DLEA 1RDDA 1YVUA 2IC3A 2ITGA 3HK2A 3VQCA 1NJYA 4H8KA 4CF1A 3ZSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD0 A;  4CIG A;  3HO1 A;  4FJ8 A;  4F3T A;  1EET A;  3ZSQ A;  4CJF A;  4FM2 A;  3A2F A;  4W5T A;  4FJI A;  1RCH A;  4N47 A;  4CJU A;  1FK9 A;  4FLZ A;  1JLA A;  3TAF A;  4E1M A;  3LP2 A;  3PV8 A;  3S3N A;  2JLE A;  3DRS A;  4Z4F A;  4FJK A;  3AA5 X;  4B9S A;  3ZSO A;  1QHT A;  3C6U A;  1QQC A;  3OVN A;  5J2N A;  4CGI A;  1XI1 A;  3H08 A;  3KIO A;  3KKS A;  4CEB A;  3V4I A;  5KTQ A;  1RBT A;  3DRR A;  3NF8 A;  3L2U A;  5HRN A;  3OS0 A;  3F9K A;  3LAL A;  3LZI A;  3NGY A;  4HUF A;  1LWF A;  3UIQ A;  2OZS A;  3NH0 A;  1IG9 A;  1D9F A;  1B92 A;  4DTO A;  2KZZ A;  3DM2 A;  4KTW A;  4DLE A;  3ITH A;  3NGZ A;  3F73 A;  4FZY A;  2RKI A;  4Q5V A;  3JSM A;  3NDK A;  3VQ9 A;  2Y1I A;  3QIN A;  3TAR A;  4CES A;  4K8X A;  4KHU A;  1B9D A;  1U4B A;  5HLF A;  1LW0 A;  3QEI A;  4CHP A;  1QSY A;  4B3O A;  3QNN A;  1XHX A;  4CF9 A;  3KLF A;  4PWD A;  3HPG A;  3IRX A;  3JYT A;  2ZE2 A;  2D0B A;  4KTQ A;  4N56 A;  5FRM A;  4DTS A;  1GOA A;  1JLF A;  4OKJ A;  4HVJ A;  3LDS A;  1S1X A;  3EY1 A;  3AVG A;  4DTR A;  3TWH A;  4QOZ B;  4FK4 A;  3L2V A;  3CG7 A;  3OYE A;  4HUE A;  4FK0 A;  4CJQ A;  1TAQ A;  4GMJ B;  4FLY A;  4CHO A;  4KHW A;  4E7J A;  1JLE A;  1RIL A;  1S1W A;  4KB1 A;  2D5R A;  1KVA A;  1LW2 A;  1RBS A;  3ZSY A;  4CK1 A;  4N5S A;  3HST B;  3KK3 A;  4FCY A;  3U3G A;  3PY8 A;  1YTA A;  4DSE A;  2B4J A;  2DFF A;  2IAJ A;  1ASU A;  1TGO A;  4HCC A;  4RW7 A;  5JS1 A;  2OA8 A;  4BE1 A;  3OYG A;  4CGH A;  3ZCM A;  1HNV A;  4KPY A;  1TKT A;  3C6T A;  2OPS A;  2X74 A;  3SJJ A;  3TI0 A;  3ISN C;  1Q8I A;  4J2A A;  4ZHR A;  2BAN A;  4KFB A;  1WSF A;  4KTZ A;  1HQU A;  2WOM A;  1HJR A;  3QER A;  4CHZ A;  3PUF A;  4NYN A;  1TKZ A;  1GOB A;  2ZQB A;  3AVM A;  2YHA A;  4OKE A;  4DS4 A;  3KKR A;  4KAZ A;  4M3X A;  3HP9 A;  4OPK A;  4CCH A;  4I9L A;  1ZBF A;  2RF2 A;  3OS1 A;  2KZM A;  1WSJ A;  4CJ4 A;  4OPJ A;  4RW8 A;  1Q9X A;  4O5B A;  3KK2 A;  3CFP A;  2YNF A;  3OYH A;  4I2P A;  1BIZ A;  1JL1 A;  4CIE A;  1C6V A;  1LWE A;  4CK3 A;  4FLU A;  2PZS A;  3IS9 A;  3PO5 A;  2F8S A;  4MQ3 A;  1RT7 A;  3NAE A;  1X9S A;  5DK5 A;  1JLG A;  4AIL C;  3AO1 A;  3AVB A;  3PX0 A;  2VG5 A;  3I8D A;  4DQI A;  4M3Z A;  2O4I A;  3QO9 A;  4ZTJ A;  4FJ9 A;  1T03 A;  3AVL A;  4M3R A;  2A1R A;  1REV A;  4BWJ A;  3S9H A;  3MEC A;  3VQ6 A;  3K59 A;  3LP3 A;  5I42 A;  1KLN A;  3K58 A;  1KVC A;  4DSL A;  1LWC A;  2P1J A;  4FZZ A;  4KI6 A;  4MFB A;  2IS3 A;  1ZBL A;  4E7I A;  1CLQ A;  4Y1C A;  3MEE A;  3V9W A;  3K2P A;  4E19 A;  4DTJ A;  3DLG A;  4FLW A;  4Y1D A;  4B9M A;  1RT3 A;  2E6L A;  4OGE A;  1GOC A;  2BDP A;  3MEG A;  4FK2 A;  4CJE A;  1U47 A;  4W5O A;  3LWM A;  3NF6 A;  4CJK A;  3PX4 A;  1HYV A;  3PO4 A;  4IFY A;  4E1N A;  3AVH A;  1VSD A;  1X9M A;  1HRH A;  4CGG A;  3KK1 A;  3AO5 A;  1N5Y A;  4Z4E A;  4J2D A;  1IO2 A;  2EHG A;  1K6Y A;  4NYF A;  4JRP A;  1X9W A;  1SKS A;  1RDB A;  1L3U A;  3RR8 A;  1S6P A;  1CZ9 A;  2VG6 A;  5CYQ A;  4CEA A;  3ASM A;  4FW2 A;  3VA3 A;  1SL1 A;  1IKX A;  3L2W A;  3K5N A;  1NKB A;  2DFH A;  4O0J A;  1YTU A;  2RN2 A;  2FBX A;  5J2M A;  4KRF A;  4CIF A;  3SV3 A;  2HB5 A;  4O0I A;  2YNG A;  1ASW A;  3RMB A;  4IKF A;  1ITG A;  4DF4 A;  3ZT0 A;  3ULD A;  1TK0 A;  5HP1 A;  1WAJ A;  1T05 A;  1D9D A;  5HRP A;  1J5O A;  3VQ7 A;  4CJ5 A;  2RPI A;  1RDA A;  1UA1 A;  1NK8 A;  4FJH A;  2XO7 A;  3MXI A;  1QSS A;  4H4M A;  1BIS A;  4FLT A;  2X6S A;  2ATQ A;  3WNE A;  5KRT A;  1UA0 A;  3DOK A;  4DFJ A;  3KLI A;  4FZX C;  3K5O A;  4G1Q A;  1RBU A;  3DI6 A;  4BAC A;  1TK5 A;  4QAG A;  2X6N A;  4DU4 A;  2KFZ A;  4I9Q A;  3AVI A;  1KTQ A;  1RDC A;  4CED A;  1RTJ A;  3CQ8 A;  1NJZ A;  3T19 A;  4JLH A;  3SQ4 A;  1NKC A;  1L3T A;  1JXB A;  3VQA A;  4R5P A;  3NHG A;  3KJV A;  1T7P A;  1KVB A;  4CF2 A;  4RW9 A;  3RMC A;  4QCL A;  4AHS A;  3D45 A;  2AJQ A;  4M3Y A;  2Z1J A;  4KB0 A;  4I2Q A;  3OYN A;  1C0U A;  1VSF A;  2HHS A;  4ID5 A;  5HRR A;  4FYD A;  4Z4I A;  1VSL A;  5KI6 A;  4B8A B;  2I5J A;  2DTU A;  3SUP A;  1RTD A;  4RW6 A;  4OLA A;  4GVM A;  2B6A A;  3P83 D;  3QLH A;  3TAE A;  2W42 A;  2HHX A;  1IKV A;  3O3F A;  1CXU A;  1VSH A;  4LSN A;  1RBR A;  3I0R A;  3O4Q A;  4YNQ A;  4DSK A;  3PX6 A;  2KW4 A;  2KTQ A;  1JLQ A;  1T8E A;  5KGX A;  1TKD A;  1IH7 A;  3SQ2 A;  1NJX A;  3EYZ A;  3TAQ A;  1KSP A;  2G8V A;  3IG1 A;  3TAP A;  4Q0B A;  2A1S A;  4LY7 A;  1JXE A;  3TAN A;  1HMV A;  2OPP A;  2B5J A;  3SPY A;  3LP1 A;  3VQQ A;  4HUG A;  3DYA A;  5HRO A;  1D5A A;  3SNN A;  4CEO A;  1I3A A;  4I7F A;  4DSI A;  3G10 A;  3RTV A;  3DLR A;  1BQN A;  1SL2 A;  3NCI A;  1LAV A;  4FVM A;  2KQ2 A;  3QEX A;  3SQ0 A;  3S3M A;  4Z4H A;  1L3S A;  1B9F A;  2FBY A;  1S9E A;  3C94 A;  3V9Z A;  1BIU A;  3WNG A;  2X78 A;  4ZTF A;  3E01 A;  4FJL A;  3V1Q A;  5J1E A;  4W5R A;  2Q3S A;  3CFO A;  4AHV A;  1L5U A;  2OZM A;  2YKM A;  2VWJ A;  4FJJ A;  3TR8 A;  3RMD A;  4W5Q A;  3DLB A;  1O1W A;  1CZB A;  3SYZ A;  4BDY A;  4DFP A;  4CFB A;  3DLH A;  3VQP A;  1ZBH A;  4DF8 A;  5E41 A;  1S5J A;  4Z4C A;  1WSH A;  4B9L A;  1QSL A;  1U04 A;  3L2R A;  3AVC A;  3SUO A;  4CE9 A;  4E3S A;  4DQS A;  2GBZ A;  1QTM A;  3BDP A;  4OGC A;  5D3G A;  3CM6 A;  3HYF A;  1RT5 A;  3OY9 A;  1UWB A;  2VG7 A;  1UOC A;  3ALY A;  5DMR A;  4KHS A;  3AA3 A;  1HPZ A;  2OPQ A;  3HJF A;  3RWU A;  4NCG A;  5CYM A;  3RRG A;  1NOZ A;  2F96 A;  4E89 A;  4CF0 A;  4DFK A;  1JKH A;  3ZSX A;  1Q9Y A;  4O44 A;  4TSX A;  1Z26 A;  1TKX A;  4FJ7 A;  2QK9 A;  4C8M A;  2R7Y A;  3OJS A;  3LP0 A;  4FLX A;  1U45 A;  4FJN A;  3AO2 A;  3VQE A;  3CYM A;  4K8Z A;  4B9N A;  2DY4 A;  1VSI A;  1JLB A;  4FM0 A;  1TL1 A;  2XY7 A;  1S1V A;  4CFA A;  1NKE A;  1W9H A;  1BHL A;  3LWL A;  1QE1 A;  3DMJ A;  3T1A A;  4CJL A;  2HMI A;  4J2E A;  2Z1H A;  1G15 A;  3SZ2 A;  3OYF A;  2QXF A;  3VA0 A;  4AHU A;  3HP6 A;  3QEP A;  4NCB A;  3QNO A;  3L2Q A;  4Z4G A;  4RW4 A;  4ELU A;  4JS5 A;  3AO3 A;  4F3O A;  4KI4 A;  3OYI A;  4CEQ A;  2IOC A;  4KO0 A;  1VSM A;  2HVI A;  1UAX A;  4M3W A;  1U49 A;  1NK5 A;  1RT6 A;  3AV9 A;  2ETJ A;  4IG3 A;  4L8R B;  1NK7 A;  4O4G A;  3AA4 A;  1NK4 A;  3SUN A;  4KHQ A;  1VSE A;  1WSE A;  3MED A;  4M3T A;  1RT4 A;  3AA2 A;  1RTI A;  4FJ5 A;  2HHW A;  3KLE A;  3OYJ A;  1HYS A;  3LAM A;  3WNH A;  3ZSR A;  3ZT1 A;  3KLH A;  3LZJ A;  4OKK A;  2G8H A;  4J2B A;  5I3U A;  3ZSW A;  1BCM A;  4DLG A;  1BGX T;  1RT2 A;  2Y1J A;  4M3U A;  3VQ4 A;  3HPO A;  2F8T A;  3VQ8 A;  2XHB A;  4LSL A;  1R0A A;  1L3V A;  4B08 A;  3OYA A;  4DQR A;  1VRU A;  3O4N A;  4O55 A;  3BGR A;  3K57 A;  3U3Y A;  3LAK A;  3MXJ A;  3EZ5 A;  1IKW A;  1JLC A;  2HVH A;  2LSN A;  3NH1 A;  2HNY A;  3OYK A;  4AH9 A;  4DU3 A;  4CGF A;  4FJX A;  1ZBI A;  5SWM A;  3THV A;  3I0S A;  3NFA A;  1KFS A;  1ZYQ A;  4PY5 A;  2D0A A;  3DRP A;  1TVR A;  4ICL A;  3VQB A;  3LAN A;  4BE2 A;  3OYM A;  1SL0 A;  3V9S A;  4FW1 A;  1NK6 A;  3U6F A;  2PYL A;  3P1G A;  4CJR A;  3B6P A;  4UQG A;  4KHN A;  1RBV A;  2YKN A;  2WON A;  3AVJ A;  1KLM A;  3LPT A;  1EKE A;  3LPU A;  3D0P A;  1HNI A;  1EP4 A;  2XY8 A;  4BE0 A;  4DTP A;  1RTH A;  3OYC A;  3KLG A;  5C24 A;  1KRP A;  2PY5 A;  3HL8 A;  1ZBU A;  4CEZ A;  4PA1 A;  4KHY A;  4CJP A;  3S3O A;  3M8R A;  4CEF A;  2G8U A;  1BI4 B;  4CJV A;  2HHU A;  1DTT A;  4B8C A;  1SV5 A;  1MU2 A;  1TL3 A;  3AO4 A;  4CFD A;  4ELT A;  4E7H A;  3IAY A;  1S6Q A;  1NOY A;  4FXD A;  1A5V A;  1XHZ A;  3TAB A;  1KCF A;  4F2S A;  4DG1 A;  4EP4 A;  4JS4 A;  5HRS A;  1CXQ A;  5C25 A;  3T3F A;  1VRT A;  2BE2 A;  3L3U A;  3SCX A;  1TK8 A;  2KFN A;  3L8B A;  4EP5 A;  4LH5 A;  3SPZ A;  3VQ5 A;  4OLB A;  2GUI A;  5CZ1 A;  4BWM A;  1RNH A;  1BI4 A;  1VSJ A;  3HPH A;  1DTQ A;  5CY4 A;  3VN5 A;  5KRS A;  1Z25 A;  1D8Y A;  1LAW A;  2HHT A;  3OYB A;  5T7B A;  3MAQ A;  4CJS A;  3C95 A;  1YT3 A;  4AHR A;  4HCB A;  3QIO A;  1RT1 A;  1LV5 A;  1EX4 A;  2P5O A;  1SKR A;  4N76 A;  2JGU A;  2ZD1 A;  4PQU A;  3OYD A;  1DLO A;  1EXQ A;  1J9A A;  2D0C A;  3NGI A;  3AVN A;  4DTX A;  3B6O A;  2IGI A;  5KGW A;  2OPR A;  4KKO A;  5J2Q A;  4DS5 A;  4DQQ A;  3V1O A;  3OJU A;  3M8Q A;  1SKW A;  1A5X A;  2IDO A;  4F8R A;  4E7L A;  4CK2 A;  1J54 A;  1FXX A;  2E4L A;  4CHN A;  4NCA A;  4GW6 A;  4IG0 A;  1S9G A;  4LH4 A;  3TAM A;  3HVT A;  2E6M A;  4WE1 A;  4YFU A;  3NH2 A;  3TAG A;  4FJG A;  4DTN A;  3V1R A;  5FRO A;  4W5N A;  4DMN A;  4E7K A;  2P5G A;  4CEE A;  4OJR A;  4B9T A;  4IFV A;  1C0T A;  3ZT4 A;  4JRQ A;  3QIP A;  1S1U A;  3KD5 E;  2HW3 A;  5K14 A;  2O4G A;  4CF8 A;  5FRN A;  1BL3 A;  4EZ6 A;  3VQD A;  3QEW A;  1WAF A;  4CGJ A;  3HXM A;  3NF7 A;  5CZ2 A;  4CFC A;  4FM1 A;  3QET A;  3V81 A;  3WNF A;  2G8F A;  3K5M A;  4HTU A;  4OVL A;  4IBN A;  3CM5 A;  3CFR A;  3KTQ A;  4C8L A;  4CGD A;  3HT3 A;  1VSK A;  4B9V A;  4E0D A;  4CJ3 A;  4DSJ A;  3SV4 A;  5FDL A;  4DSF A;  5EU7 A;  3RMA A;  1HYZ A;  1X1P A;  1XWL A;  2DFE A;  2NUB A;  2Z1G A;  1J53 A;  3FFI A;  4KV8 A;  4CJW A;  3O3H A;  2BGG A;  4CER A;  3M8S A;  4ID1 A;  2YHB A;  2YNH A;  2YNI A;  3DOL A;  1S1T A;  3OS2 A;  1I39 A;  3V9U A;  4C8K A;  1SUQ A;  4CHY A;  4XIU A;  5C42 A;  4M42 A;  3ZSV A;  3K5L A;  3AVA A;  5HBM A;  3ZT2 A;  3L3V A;  4PUO A;  2FC0 A;  1C0M A;  2P51 A;  4IDK A;  3OYL A;  3NE6 A;  1C1B A;  1A5W A;  2Z1I A;  3O3G A;  2HHQ A;  1VK0 A;  4DFM A;  1QS4 A;  1WNS A;  2VWK A;  4HHT A;  1U48 A;  1C1A A;  1BCO A;  2FBV A;  2G8W A;  1NK9 A;  1N6Q A;  3KD1 E;  4DTU A;  4F4K A;  4AHC A;  2XY5 A;  1WSI A;  4BDZ A;  5JS2 A;  1BQM A;  4FLV A;  2QKB A;  3AVK A;  2EX3 A;  4DTM A;  3G0Z A;  2G8K A;  3ZT3 A;  3HM9 A;  3MXM A;  1F21 A;  5J2P A;  2XY6 A;  4N41 A;  1WSG A;  1NJW A;  4AHT A;  4ELV A;  3DLK A;  3HVR A;  3V9X A;  4B9U A;  3SUQ A;  3AVF A;  2FBT A;  2PYJ A;  4F2R A;  4C8O A;  2G8I A;  4CJT A;  3RR7 A;  1C1C A;  1Y97 A;  2HND A;  1IKY A;  2HNZ A;  2HHV A;  2XRI A;  4DQP A;  1WLJ A;  1ASV A;  1WN7 A;  5SZT A;  3NF9 A;  3RRH A;  4FJM A;  1FKP A;  3P5J A;  4RG8 A;  3QEV A;  2OYQ A;  4DU1 A;  3M8P A;  4DWI A;  1TAU A;  1FKO A;  1HQE A;  4M41 A;  2GV9 A;  2QKK A;  4C8N A;  3SQ1 A;  3SI6 A;  2YV0 X;  4M45 A;  3V6D A;  3QES A;  1XC9 A;  1JL2 A;  3NBP A;  4H4O A;  4Z0U A;  1KFD A;  4EZ9 A;  1NK0 A;  4CHQ A;  4CEC A;  1W0H A;  1TV6 A;  4BDP A;  4KRE A;  3DLE A;  1RDD A;  1YVU A;  2IC3 A;  2ITG A;  3HK2 A;  3VQC A;  1NJY A;  4H8K A;  4CF1 A;  3ZSZ A; 
#chains in the Genus database with same CATH topology
 4CJF A;  4N47 A;  1FK9 A;  4FLZ A;  3TAF A;  4E1M A;  4H0T B;  3C7N A;  4FJK A;  1XC3 A;  4B9S A;  2HBM A;  4CD3 A;  3C6U A;  4BRD A;  1HPM A;  3OVN A;  3V4I A;  2V7Y A;  2QW9 A;  1RBT A;  1WUA A;  3CCS N;  3EE9 A;  5M1Q A;  2P9N B;  1RDW X;  1IG9 A;  5M1F A;  1YUW A;  3ITH A;  4BRE A;  4Q5V A;  3NDK A;  4X64 K;  3QIN A;  5AQL A;  3LDN A;  1U4B A;  1IV0 A;  2E2P A;  3QNN A;  1XHX A;  5ELZ A;  1RFQ A;  3THY A;  2D0B A;  3AGR A;  3LDS A;  4DTR A;  4DR1 K;  3TWH A;  2D1K A;  2OTJ N;  3BF3 A;  1YXQ A;  4FK0 A;  2VCP A;  1TAQ A;  4CBW A;  2E20 A;  1JLE A;  1RIL A;  5M1K A;  2D5R A;  1NGF A;  1RBS A;  4FCY A;  4CK1 A;  3HST B;  3LDO A;  1QQO A;  3U3G A;  3A5N C;  2NRW A;  4DSE A;  4Z94 A;  4FWO A;  4HCC A;  4RW7 A;  2OA8 A;  1NWK A;  4BE1 A;  3OYG A;  1HNV A;  2OPS A;  2X74 A;  4JKF A;  4GV9 A;  4ZHR A;  4KFB A;  4KTZ A;  5AQV A;  5E84 A;  1HQU A;  3A8Y A;  4NLB A;  5AQZ A;  1TKZ A;  1GOB A;  3J80 O;  2FXU A;  5GIN A;  4BVP A;  3HP9 A;  4M3X A;  4JN4 A;  2O8D B;  4CZL A;  1Q9X A;  1JL1 A;  4FLU A;  4FVU A;  3NAE A;  1X9S A;  5BRE A;  1JLG A;  4LF7 K;  4BG9 A;  2P9I B;  5JMV A;  2NLX A;  2VG5 A;  1VQL N;  5H1S Q;  4DQI A;  4M3R A;  4BWJ A;  3MEC A;  3VQ6 A;  4BG8 A;  4FZZ A;  3CCJ N;  3O9U A;  1S22 A;  1ZBL A;  3O9T A;  2E5L K;  4U7B A;  4BRC A;  4FLW A;  4Y1D A;  3TTF A;  4B9M A;  4FK2 A;  1GOC A;  1U47 A;  4W5O A;  3NF6 A;  1WBD A;  3PX4 A;  1NNE A;  3PO4 A;  1W2B M;  3KK1 A;  1N5Y A;  5KPR A;  2EHG A;  4DR3 K;  3WXJ A;  1X9W A;  1SKS A;  1S6P A;  4CEA A;  3ASM A;  3G71 N;  3K5N A;  5JLF A;  2VQE K;  2VWB A;  5AFU A;  5J2M A;  5AQX A;  3WXI A;  1NGJ A;  1BO5 O;  4BR0 A;  3HZ6 A;  4GVE A;  1T05 A;  1BA1 A;  1UA1 A;  4NXN K;  3G4S N;  2I7P A;  1VQK N;  1BIS A;  3SBT A;  2P9U A;  3K5O A;  4K42 A;  4BAC A;  2KFZ A;  2FLO A;  3J8A A;  4KH6 A;  4DKW A;  1RTJ A;  3CQ8 A;  1NJZ A;  4IZ9 A;  4DB3 A;  3T19 A;  1T7P A;  3DWL A;  4M3Y A;  4KB0 A;  3O1W A;  3OYN A;  1C0U A;  4FPA A;  5HRR A;  1Q81 O;  4FYD A;  4Z4I A;  3PSF A;  3SUP A;  4M7Y A;  4GVM A;  3TAE A;  1CXU A;  1RBR A;  3O4Q A;  4FO0 A;  1KAX A;  4A2B A;  3PX6 A;  3T1Y K;  1HR0 K;  3IG1 A;  2J4R A;  3TAP A;  4WFB L;  3D2F A;  1HMV A;  5HRO A;  2B5J A;  4XH4 A;  3VQQ A;  4WFN L;  1D5A A;  4CEO A;  4DSI A;  1JCF A;  3DLR A;  4PL8 A;  1BQN A;  3W3D A;  4FSV A;  4JKE A;  4BC2 A;  3C94 A;  3V9Z A;  2X78 A;  3HOS A;  4JI3 K;  3CFO A;  3SMP A;  2YKM A;  2VWJ A;  2UUC K;  3RMD A;  4W5Q A;  1CZB A;  4BDY A;  4CZI A;  1SS6 A;  4BQL A;  3W0L A;  4A62 A;  3CJ1 A;  4Z4C A;  1VQP N;  4B9L A;  3EL2 A;  4FOI A;  3I56 N;  4ISF A;  2GBZ A;  1QTM A;  4JD2 A;  2ZJP L;  3OY9 A;  4A5B A;  1UWB A;  2WBN A;  5DMR A;  3AA3 A;  3HJF A;  4CZK A;  3RWU A;  5IWA K;  5CYM A;  3THX A;  4CF0 A;  3CCL N;  3MN5 A;  3H45 C;  4TSX A;  1TKX A;  4C8M A;  3WEE B;  1U45 A;  3VQE A;  4BR2 A;  4FM0 A;  2E2N A;  5AQQ A;  1OKJ A;  4F9O A;  5GAH P;  1YIT N;  2O8F A;  3ATV A;  1NKE A;  2P9K A;  3O1B A;  4JEP A;  3MCA B;  4AHU A;  3HP6 A;  3L2Q A;  4Z4G A;  4RW4 A;  4ELU A;  4JS5 A;  4F3O A;  4KI4 A;  5AQP A;  1VSM A;  5JVG L;  1QVF M;  4M3W A;  3NMU A;  3AV9 A;  2ETJ A;  4BGA A;  4C23 A;  3MED A;  1GLC G;  5BPM A;  3LAM A;  1HYS A;  1BUP A;  3ZT1 A;  4LF5 K;  3J7A P;  1BCM A;  3VQ4 A;  2XHB A;  4LSL A;  4IOC L;  3H3N O;  3OYA A;  4JI5 K;  3LAK A;  3OBY A;  3MN6 A;  3ENH A;  3DXK B;  4JK8 A;  1ZBI A;  1ZYQ A;  4PY5 A;  2D0A A;  3L4Q A;  1TVR A;  3VQB A;  3V9S A;  1NK6 A;  4O5F A;  3B6P A;  3AAP A;  3LPT A;  3AVJ A;  2KZZ A;  3D0P A;  4JHD A;  1KRP A;  1U2V B;  3MN9 A;  1VQ7 N;  4GNI A;  4YHH K;  3KWG A;  1BI4 B;  1Q7Y O;  2JWL A;  1SV5 A;  4B8C A;  1A5V A;  1KCF A;  4F2S A;  4H0V B;  4EP4 A;  3R8E A;  3H1V X;  1VRT A;  2YCH A;  2FSN A;  1TK8 A;  3GE1 A;  1BDG A;  3SPZ A;  4O8U A;  4OLB A;  4IWV A;  5CZ1 A;  3HPH A;  1DTQ A;  5CY4 A;  1D8Y A;  4CJS A;  1HUX A;  3QIO A;  5AZJ B;  4B3T K;  1SKR A;  4N76 A;  4PQU A;  5KQD A;  2D0C A;  3NGI A;  1X3N A;  3E9O A;  5M1O A;  4DV4 K;  4DS5 A;  4CJ7 A;  3OJU A;  1SKW A;  3VMF B;  4NO7 A;  1A5X A;  4F8R A;  4BRI A;  4CHN A;  1S9G A;  4LH4 A;  3HVT A;  4FJG A;  2CH6 A;  5FRO A;  1WOQ A;  4DMN A;  2P5G A;  3CCE N;  3ZT4 A;  3QIP A;  4DHY A;  3G25 A;  2O4G A;  2V51 B;  1IG8 A;  4EZ6 A;  2CH5 A;  2ZJQ L;  3E9L A;  1WAF A;  3HI0 A;  3QEW A;  3WNF A;  2G8F A;  3K5M A;  2Q0R A;  3KTQ A;  4BC5 A;  4CBU A;  1SZ2 A;  5AQU A;  2IIR A;  4YDU C;  3VGK A;  4DUZ K;  4IFE A;  2Z1G A;  2BGG A;  2V7Z A;  4ID1 A;  3FE1 A;  4Z4E A;  4CZH A;  4CHY A;  5C42 A;  1NLV A;  3K5L A;  4PKG A;  4WQ5 C;  1MWM A;  4PUO A;  4IJA A;  3O9Q A;  3O3G A;  1VK0 A;  3QFU A;  5EOY A;  1U48 A;  2G8W A;  2FBV A;  2ITM A;  4BR7 A;  5EY4 A;  4BDZ A;  1QHA A;  3KWI A;  3O6W A;  3U4L A;  4FLV A;  3AVK A;  2ZJR L;  4DTM A;  3HM9 A;  3MXM A;  4HWI A;  4N41 A;  1WSG A;  3IKM A;  1HNZ K;  3LL3 A;  1NJW A;  4BY9 C;  3HVR A;  3SUQ A;  2IVO A;  5FLX O;  4B1Z A;  4JI7 K;  4HTL A;  2PYJ A;  2G8I A;  4CJT A;  1IKY A;  1WLJ A;  3GDQ A;  4X65 K;  3U9Z A;  1ASV A;  1WN7 A;  4YOU A;  3NF9 A;  5SZT A;  2A41 A;  2OYQ A;  2YI1 A;  1VQ8 N;  3AAR A;  4DWI A;  2GV9 A;  2QKK A;  3SQ1 A;  3V6D A;  3QES A;  1YVN A;  1JL2 A;  1NK0 A;  1D4X A;  4KRE A;  5EX5 A;  2P9S A;  3T1H K;  2ITG A;  3ZYY X;  5F0X A;  2QI2 A;  5C2F A;  1Q82 O;  1NGH A;  1YJW N;  1FJG K;  2IVP A;  1EET A;  2HHV A;  4FJI A;  4W5T A;  1XMQ K;  3PV8 A;  3MDQ A;  4Z4F A;  4JKB A;  3ZSO A;  1SAZ A;  4FL9 A;  4CGI A;  3SLC A;  3KIO A;  4CEB A;  1BA0 A;  1KAY A;  3P39 A;  5KTQ A;  2FSK A;  3DRR A;  3NF8 A;  4YOR A;  3LZI A;  3UIQ A;  4H5T A;  4J8F A;  3NH0 A;  1D9F A;  4FZY A;  2ASP A;  2RKI A;  3JSM A;  4JKA A;  3TAR A;  4CES A;  4K8X A;  1B9D A;  4IEE A;  1QSY A;  4CHP A;  3R6M A;  3KLF A;  3CCV N;  3HPG A;  3J81 O;  1S3X A;  3SJH A;  4N56 A;  2W6L A;  5FRM A;  5EXW A;  2VQF K;  4H5R A;  1GOA A;  1JLF A;  4OKJ A;  4HVJ A;  3EY1 A;  3LM9 A;  3UKU B;  1HLU A;  4FK4 A;  3GG4 A;  3CG7 A;  4LC9 B;  3CQY A;  5CHI A;  4BRN A;  3NVM A;  4CHO A;  4KHW A;  3D7E O;  3GL1 A;  4N5S A;  3KK3 A;  3WXL A;  3PY8 A;  2UUB K;  2DFF A;  1TGO A;  3VEV A;  1O13 A;  3TSU A;  4CGH A;  4J2A A;  4JV5 K;  3TI0 A;  1Q8I A;  2BAN A;  1HKG A;  2P9P A;  2WOM A;  3QER A;  3EKS A;  3OW2 M;  5FPM A;  4BR5 A;  4OKE A;  4DS4 A;  3KKR A;  4KAZ A;  1QZ6 A;  1YF5 L;  4I9L A;  1ZBF A;  2RF2 A;  4CCH A;  4OPJ A;  4CJ4 A;  3CFP A;  3OYH A;  2QEX N;  1BIZ A;  4JKG B;  5CR4 A;  3PIP L;  1ATR A;  4CZE A;  1Z05 A;  3I8D A;  3BP8 A;  4XH1 A;  1EO1 A;  4M3Z A;  3BZC A;  4BC3 A;  1YIJ N;  3RSE A;  1T03 A;  3AVL A;  5I42 A;  2GX9 A;  3K59 A;  3LP3 A;  1KLN A;  3K58 A;  1KVC A;  1P90 A;  2P1J A;  4KI6 A;  4MFB A;  1Z6R A;  4ISG A;  3MEE A;  4JKD A;  1KXP A;  3K2P A;  1J6Z A;  4DTJ A;  1RT3 A;  2BDP A;  3LWM A;  4B1W B;  4OO1 J;  3F2K A;  4CJK A;  4DUY K;  4B1V A;  4E1N A;  1VSD A;  4CGG A;  3BEX A;  4J2D A;  4H0Y B;  4JRP A;  1OH5 A;  1RDB A;  3RR8 A;  1CZ9 A;  2VG6 A;  2O8E A;  1IKX A;  2DFH A;  4O0J A;  2OCE A;  2FBX A;  4KRF A;  3ID6 A;  4ILJ A;  1ASW A;  3RMB A;  4IKF A;  3QML A;  3ZT0 A;  3ULD A;  5LMU K;  1BOT O;  1J5O A;  3VQ7 A;  2RPI A;  1RDA A;  4MDA A;  1NK8 A;  2XO7 A;  3MXI A;  1JJ2 M;  1GLL O;  1XNQ K;  5AQW A;  4FLT A;  3WNE A;  5KRT A;  3PLA A;  4FZX C;  4G1Q A;  1TK5 A;  4QAG A;  3H3O B;  3Q7B A;  1OVQ A;  5KPT A;  3CCU N;  3CJC A;  1JXB A;  3NHG A;  4YOX A;  1L3T A;  2D0O A;  4QCL A;  1KVB A;  1T44 A;  3RMC A;  2P9L A;  3D45 A;  1WBB A;  5TKY A;  3DXM B;  3M3Z A;  2Q36 A;  3MWP A;  5KI6 A;  1RTD A;  1N8R O;  2B6A A;  1U2V A;  4PL7 A;  2AA4 A;  3O3F A;  4IEI A;  3M6G A;  4YNQ A;  3ZET B;  4DSK A;  2GWJ A;  2KTQ A;  1JLQ A;  5KGX A;  1TKD A;  1IH7 A;  3EYZ A;  4DV7 K;  4NB4 A;  5BRH A;  5FPE A;  3ZX2 A;  2Q97 A;  2A1S A;  1VQM N;  4LY7 A;  2OPP A;  3SPY A;  2DPN A;  3LP1 A;  3DYA A;  4JI6 K;  1I3A A;  1JCE A;  5GIO A;  2NRR A;  3M5R A;  4FVM A;  1YJN N;  1L3S A;  2F9T A;  2FBY A;  1S9E A;  3WQT A;  3C0B A;  4H5V A;  5J1E A;  4W5R A;  2FF3 B;  3SBG A;  3SYZ A;  5CE3 A;  4H0X B;  4BRA A;  4BRL A;  1WSH A;  1ZXO A;  5AQO A;  4FWK A;  4WQ4 C;  3AVC A;  3SUO A;  4CE9 A;  4DQS A;  5BRF A;  5D3G A;  3L6Q A;  1RT5 A;  2VG7 A;  5GAG P;  2OPQ A;  2F96 A;  4E89 A;  3MX2 A;  2O8B A;  3ZSX A;  5C10 A;  3FGU A;  4WF9 L;  5TKW A;  4EHU A;  3CC4 N;  1VQN N;  5GIP A;  4XEI A;  3G6E N;  4B9N A;  4LF4 K;  2DY4 A;  3MK6 A;  1TL1 A;  4DR2 K;  1S1V A;  4H5N A;  3LWL A;  3T1A A;  4CJL A;  5AQY A;  2Z1H A;  1G15 A;  3DJC A;  3CJB A;  3ULE A;  1ESV A;  3CIP A;  3LDP A;  1RDU A;  2HVI A;  1UAX A;  3CJA A;  3PSI A;  5AQR A;  1U49 A;  5IT9 O;  1RT6 A;  1GLF O;  4ISE A;  1NK4 A;  4YY3 K;  5AR0 A;  1WSE A;  1RTI A;  4FJ5 A;  3KLE A;  3WNH A;  3LZJ A;  2W41 A;  3EE8 A;  3VEY A;  4DLG A;  4EIA A;  4BQZ A;  4B08 A;  3O80 A;  2JWK A;  3O4N A;  3K57 A;  3EZ5 A;  1IKW A;  2HVH A;  1H1V A;  4DU3 A;  4AH9 A;  1DT9 A;  4FJX A;  5SWM A;  3NFA A;  3MX5 A;  3DRP A;  4BE2 A;  1L3V A;  3LAN A;  3OYM A;  4FW1 A;  2PYL A;  1TYQ B;  1NJI O;  4CJR A;  4A61 A;  4UQG A;  3A5L C;  1X3M A;  2WON A;  4JI0 K;  1EP4 A;  1HNI A;  4DTP A;  1GLE G;  5C24 A;  1ZBU A;  4BRO A;  4CEZ A;  4KHY A;  4YOV A;  1NGD A;  2HHU A;  4CFD A;  4JK9 A;  1YAG A;  4FXD A;  3TAB A;  3Q7C A;  2NZT A;  4DG1 A;  1FW6 A;  5AZI A;  3JS6 A;  2KFN A;  3L8B A;  4EP5 A;  4LF9 K;  4BWM A;  5GAE P;  5AQS A;  1RNH A;  1VSJ A;  3VN5 A;  5KRS A;  3D2E B;  5AQI A;  2HHT A;  2DTU A;  5T7B A;  3MAQ A;  5ADX A;  1YT3 A;  3AVN A;  3B6O A;  4KKO A;  4FWS A;  3THW B;  3S41 A;  3A5M C;  3M8Q A;  2ZGZ A;  1BWF O;  4K25 A;  1J54 A;  4DV1 K;  2E4L A;  4IG0 A;  3CD6 N;  3TAM A;  3NH2 A;  2E6M A;  4FWP A;  4WE1 A;  4CZF A;  4CW7 B;  4DTN A;  3H6E A;  1DKG D;  4W5N A;  4CEE A;  4OJR A;  1IBL K;  2GTD A;  3MWT A;  3KD5 E;  2HW3 A;  4CF8 A;  5FRN A;  1BL3 A;  5M1N A;  4JI1 K;  3V81 A;  4CGJ A;  4FM1 A;  3QET A;  1C0F A;  4IOX A;  4C8L A;  4JKH A;  4JYA K;  4B9V A;  3CHW A;  2CGL A;  5EU7 A;  2ZGY A;  3CJ9 A;  4BRG A;  2NUB A;  1X1P A;  2DFE A;  3VTI A;  3O3H A;  3QB0 A;  3M8S A;  2YHB A;  2YNH A;  4QS7 A;  1S1T A;  3OS2 A;  4M42 A;  1SUQ A;  4XIU A;  1N33 K;  4FWQ A;  2ASO A;  5HBM A;  3ZT2 A;  4CZG A;  1YJ9 N;  4IDK A;  1C1B A;  2Z1I A;  2HHQ A;  4DFM A;  1QS4 A;  3ZEU A;  1C1A A;  1BCO A;  1NK9 A;  1N6Q A;  3KD1 E;  2XY5 A;  2KLA A;  2QKB A;  4BRM A;  2EWS A;  2EX3 A;  3IUC A;  3LDL A;  3ZT3 A;  2QWL A;  4ELV A;  1MDU B;  4C8O A;  4AF1 A;  1Y97 A;  5MLC Q;  4DCH A;  5LJV A;  3RRH A;  4L3Q A;  2HBK A;  1NBW A;  4FJM A;  3P5J A;  2RHK A;  3QEV A;  4DU1 A;  4I6M A;  1TAU A;  1HQE A;  2QWQ A;  4C8N A;  1T6C A;  4GY2 B;  1ATS A;  5AQF A;  4M45 A;  3C7N B;  1XC9 A;  3VGL A;  4H4O A;  4Z0U A;  1GLA G;  4CHQ A;  2NRT A;  4BRF A;  1TV6 A;  4CEC A;  4BDP A;  5AQT A;  2IC3 A;  3UKR A;  3VQC A;  2GWK A;  4H8K A;  5BPN A;  3QDK A;  2AP1 A;  4FJ8 A;  3HTV A;  3ZSQ A;  1RCH A;  4CJU A;  4FJJ A;  1JLA A;  1LCU A;  1N32 K;  1K73 O;  4CZM A;  1XI1 A;  3AY9 A;  3H08 A;  3KKS A;  1XNR K;  2PFU A;  3VPZ A;  3L2U A;  2V52 B;  3OS0 A;  3LAL A;  1N36 K;  1NMN A;  3THY B;  4DTO A;  3DM2 A;  4KTW A;  3NGZ A;  3CET A;  4OPH A;  1SQK A;  1GLB G;  3I33 A;  3VQ9 A;  2Y1I A;  4AQY K;  4KHU A;  5HLF A;  1LW0 A;  1GLD G;  3LM2 A;  3F5T A;  3QEI A;  4B3O A;  3CCR N;  4CF9 A;  3JYT A;  2ZE2 A;  4LFB K;  2P9N A;  1E4G T;  4KTQ A;  5GAD P;  1HJO A;  3KK7 A;  3ZX0 A;  2E8A A;  2F4V K;  1S1X A;  3AVG A;  2QXL A;  4QOZ B;  3VEO A;  3L2V A;  2VYP A;  4IXC A;  3DXM A;  3OYE A;  4CZJ A;  1ILY A;  1NGC A;  4GMJ B;  2ASM A;  3U9D A;  1KVA A;  3ZSY A;  3I55 N;  1YTA A;  2A5X A;  2B4J A;  2IAJ A;  1ASU A;  1KC8 O;  5JS1 A;  4B9Q A;  3ZCM A;  1TKT A;  3SJJ A;  5BN8 A;  3ISN C;  3JXU A;  3IFR A;  3A5O C;  1HJR A;  2ZQB A;  4EFH A;  3AVM A;  4KH4 A;  1G99 A;  1K9M O;  4YDU A;  1WSJ A;  2YNF A;  4I2P A;  3KHY A;  2ZF5 O;  1LWE A;  2A3Z A;  4MQ3 A;  1RT7 A;  2QWR A;  3AO1 A;  3AVB A;  4WQ5 A;  4AIL C;  4BRH A;  3PX0 A;  1QQM A;  2O8D A;  3QO9 A;  4FJ9 A;  2A1R A;  5DM7 L;  4BVO A;  1LWC A;  3VF4 A;  2A42 A;  4E7I A;  1CLQ A;  4Y0W A;  4Y1C A;  2P9I A;  3V9W A;  4JAX A;  3J7Y P;  4OGE A;  2E6L A;  3OBW A;  4CJE A;  4B3S K;  5FPN A;  2WTU A;  3MCP A;  4CBX A;  3VEX A;  3AVH A;  1HRH A;  1IO2 A;  2IVN A;  4NYF A;  1L3U A;  4FW2 A;  5KQ8 A;  3C6H A;  3FZH A;  2RN2 A;  2HB5 A;  2YNG A;  1NGI A;  1ATN A;  1ITG A;  2P9U B;  1TK0 A;  1D9D A;  3AAQ A;  3HSC A;  3CC7 N;  1BG3 A;  4FJH A;  5AQG A;  4H4M A;  1S72 N;  1K8A O;  4JNE A;  5EVZ A;  3DOK A;  4DFJ A;  3KLI A;  1RBU A;  3DI6 A;  3K9K A;  2D0P A;  3TSP A;  3AVI A;  1KTQ A;  1RDC A;  4CED A;  1RGI A;  5BR9 A;  3SQ4 A;  4JLH A;  1NKC A;  3FR0 A;  4CF2 A;  4AHS A;  2Q2R A;  4OX9 K;  2AJQ A;  1WB9 A;  4CVN E;  2Z1J A;  5LY3 A;  4I2Q A;  1Q86 O;  4BRP A;  1VSF A;  4X66 K;  2HHH K;  1VSL A;  2YHY A;  2I5J A;  3B8A X;  4RW6 A;  5JIC A;  4OLA A;  4G9Z A;  5BR8 K;  3D2F B;  3QLH A;  4RTF D;  2HHX A;  3EKU A;  4LSN A;  2O8C B;  1C0G A;  2KW4 A;  4JI4 K;  1T8E A;  2YHW A;  3R1X A;  3TAQ A;  1IBM K;  2I7N A;  2E2O A;  3TAN A;  4HUG A;  4I7F A;  2HMP A;  5HOO A;  2HST A;  3VF6 A;  3NCI A;  3ZLJ A;  4BR4 A;  5FPD A;  3QEX A;  3CXC M;  4Z4H A;  5HL7 L;  4FJL A;  3E01 A;  1VQ9 N;  2Q3S A;  4ILG B;  3SMS A;  4AHV A;  1L5U A;  2OZM A;  1DGK N;  3TR8 A;  5C15 A;  3DLB A;  1O1W A;  3DLH A;  4DFP A;  1ZBH A;  2E1Z A;  3THX B;  3VQP A;  3SAG A;  1S5J A;  1LOT B;  2NRX A;  1U04 A;  3GOI A;  4OGC A;  3GBT A;  1IBK K;  3CM6 A;  4JI8 K;  2OTL N;  3ALY A;  1HPZ A;  4BRK A;  4DV2 K;  2O8F B;  4CD1 A;  3CF5 L;  3QFP A;  2P9K B;  4DFK A;  4PKH A;  2HF3 A;  1Q9Y A;  4O44 A;  4FJ7 A;  2QK9 A;  3OJS A;  2PAV A;  4FJN A;  4K8Z A;  3BZK A;  1BHL A;  2WC9 A;  3A0I X;  2E1Y A;  1QE1 A;  3DMJ A;  2HMI A;  4J2E A;  1N34 K;  3SZ2 A;  2QXF A;  5C2D A;  3QEP A;  3WEE A;  2VGM A;  4NCB A;  5JVH L;  3QNO A;  1VHX A;  2GEL A;  3AO3 A;  3FZF A;  4WCE L;  3OYI A;  1ZC6 A;  4CEQ A;  4KO0 A;  3VET A;  4E1J A;  1NK5 A;  4IG3 A;  4O4G A;  3AA4 A;  1Y64 A;  4K41 A;  1NMD A;  1V4T A;  2HHW A;  2QWM A;  3OYJ A;  4B1U B;  2G8H A;  3ZSR A;  1VQO N;  3KLH A;  4J2B A;  4OKK A;  5I3U A;  2Y1J A;  4M3U A;  2F8T A;  3HPO A;  1R0A A;  3SK3 A;  1VRU A;  2NRH A;  2GUP A;  4JHD B;  3MXJ A;  1JLC A;  3NH1 A;  3IDH A;  2HNY A;  1W97 L;  1QVG M;  3THV A;  3AGK A;  5AFU H;  4ICL A;  5LJW A;  1XMO K;  3U6F A;  2CGJ A;  4KHN A;  1RBV A;  3HK2 A;  3LPU A;  1EKE A;  4BE0 A;  4IDH A;  3CC2 N;  4K0K K;  3H46 O;  4A57 A;  3DXK A;  4CJP A;  2G8U A;  4CJV A;  1YHQ N;  4ELT A;  1GLJ O;  4E7H A;  3E1Y A;  3P31 A;  3IAY A;  3CJ7 A;  1S6Q A;  1NOY A;  1HNX K;  1XHZ A;  1X9J A;  2HF4 A;  2QWN A;  1CXQ A;  3T3F A;  2BE2 A;  3SCX A;  1KQS M;  4O8K A;  1HNW K;  3VQ5 A;  1BI4 A;  4KBO A;  2KHO A;  1Z25 A;  3UB5 A;  3OYB A;  5AQJ A;  4EHT A;  4YOT A;  4AHR A;  1EX4 A;  2JGU A;  2ZD1 A;  1DLO A;  1EXQ A;  1U6Z A;  5KGW A;  1M90 O;  1QQN A;  3CMA N;  5J2Q A;  4DQQ A;  3V1O A;  4CK2 A;  1FXX A;  4NCA A;  4GW6 A;  2HHS A;  5AZJ A;  4YFU A;  1XQS C;  3V1R A;  4E7K A;  5ADX H;  4B9T A;  4IFV A;  1C0T A;  3VQD A;  2E88 A;  3HXM A;  4A5A A;  4CFC A;  3OA9 A;  4HTU A;  4OVL A;  4IBN A;  3CM5 A;  3CFR A;  1NM1 A;  4CGD A;  3HT3 A;  1VSK A;  1NG9 A;  4B1Y B;  4CJ3 A;  4DSJ A;  3O4W A;  4FPB A;  3RMA A;  4DR4 K;  1HYZ A;  4KV8 A;  5AQH A;  4CER A;  4WQ4 A;  3DOL A;  1BU6 O;  4C8K A;  1I39 A;  1OVY A;  3ZSV A;  2UYT A;  1OH6 A;  5M1P A;  3NE6 A;  1A5W A;  1T3V A;  3WXM B;  2VWK A;  4MO4 A;  1NGA A;  4DTU A;  4AHC A;  1WSI A;  5JS2 A;  1T6D A;  2W6K A;  2G8K A;  4DR6 K;  4BGB A;  2XY6 A;  4ILH A;  5LL6 Z;  4AHT A;  2ZM6 K;  5B8H A;  3CI5 A;  3SAF A;  2HND A;  2HNZ A;  2XRI A;  3JAM O;  4GKK K;  2BTF A;  1EWQ A;  2UU9 K;  2P9S B;  4MO5 A;  1FKP A;  4RG8 A;  3L4I A;  3M8P A;  4GV6 A;  3OHR A;  1FKO A;  4M41 A;  5KPZ A;  3SI6 A;  3MN7 A;  2QA4 N;  1KFD A;  4EZ9 A;  4KH5 A;  1W0H A;  2NRV A;  3DLE A;  3QBX A;  1RDD A;  1YVU A;  3QIC A;  1NJY A;  2YHX A;  4CF1 A;  3ZSZ A;  4LD0 A;  4CIG A;  4U67 L;  1DEJ A;  4AM7 A;  2D4W A;  3SQ0 A;  3HO1 A;  4F3T A;  3ATU A;  4FM2 A;  3HRG A;  3A2F A;  4IJN A;  3S3N A;  3LP2 A;  2JLE A;  3DRS A;  3AA5 X;  5JLH A;  1QHT A;  1QQC A;  4FWM A;  5J2N A;  3ENB A;  5BN9 A;  4WYB A;  5HRN A;  3F9K A;  1IJJ A;  2PBD A;  3R3L A;  4AM6 A;  2QM1 A;  3BY5 A;  3NGY A;  4HUF A;  1LWF A;  4LF6 K;  2OZS A;  1OH8 A;  1B92 A;  3PIO L;  4DLE A;  3F73 A;  5BPL A;  3VES A;  4FWN A;  4MLE A;  3EN9 A;  4PWD A;  5A2Q O;  4GV3 A;  3IRX A;  4JKC A;  5LMN K;  4DTS A;  4PHT X;  3FZM A;  3ZX3 A;  3WT0 A;  1K8K B;  4OPA A;  2H3G X;  4HUE A;  3CQX A;  4CJQ A;  4BC4 A;  4FLY A;  2A40 A;  4E7J A;  1S1W A;  2GEM A;  2P9P B;  3J7Z O;  1KD1 O;  4KB1 A;  4FWL A;  1LW2 A;  4PKI A;  2F9W A;  1OH7 A;  4DV0 K;  3U8X A;  2A6A A;  2FSJ A;  3UKU A;  2O8C A;  5C0Y A;  3TPQ A;  4DQ8 A;  4KPY A;  3C6T A;  4RCH A;  3VEZ A;  1HKC A;  1WSF A;  2HBL A;  4CHZ A;  3PUF A;  4NYN A;  1R59 O;  2YHA A;  3LDQ A;  4OPK A;  4DR5 K;  3OS1 A;  2KZM A;  4RW8 A;  4O5B A;  3KK2 A;  3RSE B;  2BH1 A;  5C12 A;  3E66 A;  4CIE A;  1C6V A;  4CK3 A;  1VQ4 N;  2PZS A;  3IS9 A;  3PO5 A;  2F8S A;  5DK5 A;  3EZW A;  2HOE A;  3M1F A;  3R9P A;  1MWK A;  2O4I A;  4ZTJ A;  4DR7 K;  1REV A;  3S9H A;  4DSL A;  4JKG A;  4MDB A;  2UXB K;  2NNW A;  2QWO A;  2IS3 A;  4X62 K;  1YI2 N;  1Q18 A;  3HM8 A;  3SAH A;  4E19 A;  3DLG A;  2O8E B;  3O5B A;  4LFA K;  3MEG A;  3CCM N;  1V4S A;  1HYV A;  4IFY A;  4YOY A;  1X9M A;  3HBT A;  3AO5 A;  1K6Y A;  3CER A;  3EEQ A;  3FZK A;  3VEN A;  4EAH D;  4JK7 A;  5CYQ A;  1SL1 A;  3VA3 A;  3L2W A;  1NKB A;  1YTU A;  1QZ5 A;  3WUH A;  4R79 A;  4CIF A;  3SV3 A;  4O0I A;  4V19 S;  5F1X A;  4DF4 A;  3L0Q A;  5HP1 A;  1WAJ A;  4BRQ A;  1E4F T;  4M7X A;  5HRP A;  1I94 K;  4CJ5 A;  1VQ6 N;  3TTD A;  1QSS A;  2QTD A;  5AJ3 K;  2X6S A;  2ATQ A;  2P9L B;  1UA0 A;  3T7Z A;  3KZB A;  2WUS A;  4H03 B;  2X6N A;  4DU4 A;  4I9Q A;  4H0O A;  2NRZ A;  5AQN A;  3N4P A;  3VQA A;  1NU0 A;  4R5P A;  3KJV A;  4RW9 A;  4K43 A;  3K0S A;  4IOA L;  3DLL L;  3C65 A;  2CGK A;  4ID5 A;  3P4I A;  3FLC O;  4B8A B;  5BRD A;  3F9M A;  4C1N I;  3P83 D;  2W42 A;  1IKV A;  1VSH A;  3I0R A;  3CPW M;  3O9S A;  4A59 A;  3BF1 A;  3O08 A;  1NJX A;  3SQ2 A;  4H5W A;  1KSP A;  2G8V A;  3NVK A;  4WFA L;  1NGG A;  4Q0B A;  1KAZ A;  3VGM A;  1JXE A;  2F7T A;  3SNN A;  1HX1 A;  3G10 A;  3RTV A;  4RWT A;  4QS8 A;  1SL2 A;  3ZET A;  1CZA N;  1LAV A;  1TUU A;  3VER A;  2KQ2 A;  4FWR A;  3S3M A;  1B9F A;  4ZTF A;  1BIU A;  3WNG A;  4UY8 O;  3V1Q A;  2Q0U A;  4CFB A;  4DF8 A;  5E41 A;  2O8B B;  3BUZ B;  1JCG A;  1QSL A;  3L2R A;  4E3S A;  3BDP A;  1MA9 B;  3CCQ N;  1EQY A;  3HYF A;  1UOC A;  3N4Q A;  4KHS A;  3T69 A;  4NCG A;  5F2R A;  3RRG A;  1NOZ A;  1TUY A;  1JKH A;  3ENO A;  1Z26 A;  3D6R A;  3OTO K;  2R7Y A;  1J5E K;  3LP0 A;  4FLX A;  3AO2 A;  3IMX A;  4DV6 K;  3CYM A;  3I8B A;  3ULE B;  1VSI A;  1JLB A;  2XY7 A;  4CFA A;  4DV3 K;  1W7A A;  1W9H A;  2E2Q A;  3OYF A;  3VA0 A;  4H0P A;  4NLC A;  3FFK B;  2IOC A;  2ZWH A;  4B3R K;  2QWP A;  1M1K O;  4KHQ A;  4L8R B;  1NK7 A;  3SUN A;  2YJE A;  1VSE A;  2UUA K;  4M3T A;  1RT4 A;  3AA2 A;  3ZSW A;  3HOT A;  1BGX T;  1VQ5 N;  1RT2 A;  3VQ8 A;  2FF6 A;  4BR9 A;  4DQR A;  3U3Y A;  4O55 A;  3BGR A;  4A2A A;  1XUP O;  2LSN A;  3CME N;  3ID8 A;  3OYK A;  4CGF A;  3I0S A;  1KFS A;  1ZBS A;  3VTH A;  1SL0 A;  2KKZ A;  3P1G A;  4B1X B;  2YKN A;  1KLM A;  5AZI B;  2XY8 A;  3WQU A;  1RTH A;  3OYC A;  3KLG A;  2PY5 A;  5DM6 L;  3HL8 A;  2W40 A;  3RVC A;  4PA1 A;  3S3O A;  3M8R A;  4LFC K;  4CEF A;  1DTT A;  1MU2 A;  1TL3 A;  3AO4 A;  3CPE A;  1TYQ A;  2YJF A;  4JS4 A;  5HRS A;  5C25 A;  4JI2 K;  2UXD K;  4KHP K;  3L3U A;  4LH5 A;  2OAN A;  2GUI A;  3O8M A;  1LAW A;  2VGN A;  3C95 A;  4NXM K;  4HCB A;  2HBJ A;  1RT1 A;  1LV5 A;  2P5O A;  2Q1N A;  3OYD A;  1J9A A;  3E9P A;  4DTX A;  2IGI A;  2OPR A;  1P8Z A;  3KVG A;  4IO8 A;  2IDO A;  3D2E A;  4E7L A;  5AQK A;  3K9J A;  5I9E B;  4JD2 B;  3TAG A;  4M63 C;  3O9R A;  4QS9 A;  1NGE A;  4JRQ A;  1S1U A;  3H1Q A;  5K14 A;  4B3M K;  1EWR A;  3THW A;  3FZL A;  3NF7 A;  5CZ2 A;  2YX6 A;  3TTC A;  3P38 A;  3TU5 A;  1K8K A;  4MLH A;  4E0D A;  3SV4 A;  5FDL A;  4DSF A;  5AQM A;  3FFI A;  1XWL A;  1J53 A;  4CJW A;  3ZEU B;  2YNI A;  3V9U A;  3VEW A;  4CI6 A;  3AVA A;  2BUP A;  3L3V A;  2FC0 A;  1C0M A;  2P51 A;  3EO3 A;  1WNS A;  4HHT A;  4F4K A;  1VAZ A;  3C6A A;  3TSQ A;  1NGB A;  5E26 A;  3MMV A;  4FOE A;  1BQM A;  4LF8 K;  3G0Z A;  3WXK A;  1F21 A;  5J2P A;  3DLK A;  3VOV A;  3V9X A;  4DV5 K;  4B9U A;  3AVF A;  4I6M B;  2FBT A;  3QBW A;  4XH5 A;  4F2R A;  3RR7 A;  1C1C A;  3UE5 A;  4DQP A;  2Q31 A;  2RE2 A;  4IO9 L;  2UXC K;  3UKR B;  2WFB A;  2YV0 X;  1HKB A;  3NBP A;  4GKJ K;  3VF2 A;  3DAW A;  1E3M A;  4C1N K;  4YOW A;  3OYL A; 
#chains in the Genus database with same CATH homology
 4LD0 A;  4CIG A;  3HO1 A;  4FJ8 A;  4F3T A;  1EET A;  3ZSQ A;  4CJF A;  4FM2 A;  3A2F A;  4W5T A;  4FJI A;  1RCH A;  4N47 A;  4CJU A;  1FK9 A;  4FLZ A;  1JLA A;  3TAF A;  4E1M A;  3LP2 A;  3PV8 A;  3S3N A;  2JLE A;  3DRS A;  4Z4F A;  4FJK A;  3AA5 X;  4B9S A;  3ZSO A;  1QHT A;  3C6U A;  1QQC A;  3OVN A;  5J2N A;  4CGI A;  1XI1 A;  3H08 A;  3KIO A;  3KKS A;  4CEB A;  3V4I A;  5KTQ A;  1RBT A;  3DRR A;  3NF8 A;  3L2U A;  5HRN A;  3OS0 A;  3F9K A;  3LAL A;  3LZI A;  3NGY A;  4HUF A;  1LWF A;  3UIQ A;  2OZS A;  3NH0 A;  1IG9 A;  1D9F A;  1B92 A;  4DTO A;  2KZZ A;  3DM2 A;  4KTW A;  4DLE A;  3ITH A;  3NGZ A;  3F73 A;  4FZY A;  2RKI A;  4Q5V A;  3JSM A;  3NDK A;  3VQ9 A;  2Y1I A;  3QIN A;  3TAR A;  4CES A;  4K8X A;  4KHU A;  1B9D A;  1U4B A;  5HLF A;  1LW0 A;  3QEI A;  4CHP A;  1QSY A;  4B3O A;  3QNN A;  1XHX A;  4CF9 A;  3KLF A;  4PWD A;  3HPG A;  3IRX A;  3JYT A;  2ZE2 A;  2D0B A;  4KTQ A;  4N56 A;  5FRM A;  4DTS A;  1GOA A;  1JLF A;  4OKJ A;  4HVJ A;  3LDS A;  1S1X A;  3EY1 A;  3AVG A;  4DTR A;  3TWH A;  4QOZ B;  4FK4 A;  3L2V A;  3CG7 A;  3OYE A;  4HUE A;  4FK0 A;  4CJQ A;  1TAQ A;  4GMJ B;  4FLY A;  4CHO A;  4KHW A;  4E7J A;  1JLE A;  1RIL A;  1S1W A;  4KB1 A;  2D5R A;  1KVA A;  1LW2 A;  1RBS A;  3ZSY A;  4CK1 A;  4N5S A;  3HST B;  3KK3 A;  4FCY A;  3U3G A;  3PY8 A;  1YTA A;  4DSE A;  2B4J A;  2DFF A;  2IAJ A;  1ASU A;  1TGO A;  4HCC A;  4RW7 A;  5JS1 A;  2OA8 A;  4BE1 A;  3OYG A;  4CGH A;  3ZCM A;  1HNV A;  4KPY A;  1TKT A;  3C6T A;  2OPS A;  2X74 A;  3SJJ A;  3TI0 A;  3ISN C;  1Q8I A;  4J2A A;  4ZHR A;  2BAN A;  4KFB A;  1WSF A;  4KTZ A;  1HQU A;  2WOM A;  1HJR A;  3QER A;  4CHZ A;  3PUF A;  4NYN A;  1TKZ A;  1GOB A;  2ZQB A;  3AVM A;  2YHA A;  4OKE A;  4DS4 A;  3KKR A;  4KAZ A;  4M3X A;  3HP9 A;  4OPK A;  4CCH A;  4I9L A;  1ZBF A;  2RF2 A;  3OS1 A;  2KZM A;  1WSJ A;  4CJ4 A;  4OPJ A;  4RW8 A;  1Q9X A;  4O5B A;  3KK2 A;  3CFP A;  2YNF A;  3OYH A;  4I2P A;  1BIZ A;  1JL1 A;  4CIE A;  1C6V A;  1LWE A;  4CK3 A;  4FLU A;  2PZS A;  3IS9 A;  3PO5 A;  2F8S A;  4MQ3 A;  1RT7 A;  3NAE A;  1X9S A;  5DK5 A;  1JLG A;  4AIL C;  3AO1 A;  3AVB A;  3PX0 A;  2VG5 A;  3I8D A;  4DQI A;  4M3Z A;  2O4I A;  3QO9 A;  4ZTJ A;  4FJ9 A;  1T03 A;  3AVL A;  4M3R A;  2A1R A;  1REV A;  4BWJ A;  3S9H A;  3MEC A;  3VQ6 A;  3K59 A;  3LP3 A;  5I42 A;  1KLN A;  3K58 A;  1KVC A;  4DSL A;  1LWC A;  2P1J A;  4FZZ A;  4KI6 A;  4MFB A;  2IS3 A;  1ZBL A;  4E7I A;  1CLQ A;  4Y1C A;  3MEE A;  3V9W A;  3K2P A;  4E19 A;  4DTJ A;  3DLG A;  4FLW A;  4Y1D A;  4B9M A;  1RT3 A;  2E6L A;  4OGE A;  1GOC A;  2BDP A;  3MEG A;  4FK2 A;  4CJE A;  1U47 A;  4W5O A;  3LWM A;  3NF6 A;  4CJK A;  3PX4 A;  1HYV A;  3PO4 A;  4IFY A;  4E1N A;  3AVH A;  1VSD A;  1X9M A;  1HRH A;  4CGG A;  3KK1 A;  3AO5 A;  1N5Y A;  4Z4E A;  4J2D A;  1IO2 A;  2EHG A;  1K6Y A;  4NYF A;  4JRP A;  1X9W A;  1SKS A;  1RDB A;  1L3U A;  3RR8 A;  1S6P A;  1CZ9 A;  2VG6 A;  5CYQ A;  4CEA A;  3ASM A;  4FW2 A;  3VA3 A;  1SL1 A;  1IKX A;  3L2W A;  3K5N A;  1NKB A;  2DFH A;  4O0J A;  1YTU A;  2RN2 A;  2FBX A;  5J2M A;  4KRF A;  4CIF A;  3SV3 A;  2HB5 A;  4O0I A;  2YNG A;  1ASW A;  3RMB A;  4IKF A;  1ITG A;  4DF4 A;  3ZT0 A;  3ULD A;  1TK0 A;  5HP1 A;  1WAJ A;  1T05 A;  1D9D A;  5HRP A;  1J5O A;  3VQ7 A;  4CJ5 A;  2RPI A;  1RDA A;  1UA1 A;  1NK8 A;  4FJH A;  2XO7 A;  3MXI A;  1QSS A;  4H4M A;  1BIS A;  4FLT A;  2X6S A;  2ATQ A;  3WNE A;  5KRT A;  1UA0 A;  3DOK A;  4DFJ A;  3KLI A;  4FZX C;  3K5O A;  4G1Q A;  1RBU A;  3DI6 A;  4BAC A;  1TK5 A;  4QAG A;  2X6N A;  4DU4 A;  2KFZ A;  4I9Q A;  3AVI A;  1KTQ A;  1RDC A;  4CED A;  1RTJ A;  3CQ8 A;  1NJZ A;  3T19 A;  4JLH A;  3SQ4 A;  1NKC A;  1L3T A;  1JXB A;  3VQA A;  4R5P A;  3NHG A;  3KJV A;  1T7P A;  1KVB A;  4CF2 A;  4RW9 A;  3RMC A;  4QCL A;  4AHS A;  3D45 A;  2AJQ A;  4M3Y A;  2Z1J A;  4KB0 A;  4I2Q A;  3OYN A;  1C0U A;  1VSF A;  2HHS A;  4ID5 A;  5HRR A;  4FYD A;  4Z4I A;  1VSL A;  5KI6 A;  4B8A B;  2I5J A;  2DTU A;  3SUP A;  1RTD A;  4RW6 A;  4OLA A;  4GVM A;  2B6A A;  3P83 D;  3QLH A;  3TAE A;  2W42 A;  2HHX A;  1IKV A;  3O3F A;  1CXU A;  1VSH A;  4LSN A;  1RBR A;  3I0R A;  3O4Q A;  4YNQ A;  4DSK A;  3PX6 A;  2KW4 A;  2KTQ A;  1JLQ A;  1T8E A;  5KGX A;  1TKD A;  1IH7 A;  3SQ2 A;  1NJX A;  3EYZ A;  3TAQ A;  1KSP A;  2G8V A;  3IG1 A;  3TAP A;  4Q0B A;  2A1S A;  4LY7 A;  1JXE A;  3TAN A;  1HMV A;  2OPP A;  2B5J A;  3SPY A;  3LP1 A;  3VQQ A;  4HUG A;  3DYA A;  5HRO A;  1D5A A;  3SNN A;  4CEO A;  1I3A A;  4I7F A;  4DSI A;  3G10 A;  3RTV A;  3DLR A;  1BQN A;  1SL2 A;  3NCI A;  1LAV A;  4FVM A;  2KQ2 A;  3QEX A;  3SQ0 A;  3S3M A;  4Z4H A;  1L3S A;  1B9F A;  2FBY A;  1S9E A;  3C94 A;  3V9Z A;  1BIU A;  3WNG A;  2X78 A;  4ZTF A;  3E01 A;  4FJL A;  3V1Q A;  5J1E A;  4W5R A;  2Q3S A;  3CFO A;  4AHV A;  1L5U A;  2OZM A;  2YKM A;  2VWJ A;  4FJJ A;  3TR8 A;  3RMD A;  4W5Q A;  3DLB A;  1O1W A;  1CZB A;  3SYZ A;  4BDY A;  4DFP A;  4CFB A;  3DLH A;  3VQP A;  1ZBH A;  4DF8 A;  5E41 A;  1S5J A;  4Z4C A;  1WSH A;  4B9L A;  1QSL A;  1U04 A;  3L2R A;  3AVC A;  3SUO A;  4CE9 A;  4E3S A;  4DQS A;  2GBZ A;  1QTM A;  3BDP A;  4OGC A;  5D3G A;  3CM6 A;  3HYF A;  1RT5 A;  3OY9 A;  1UWB A;  2VG7 A;  1UOC A;  3ALY A;  5DMR A;  4KHS A;  3AA3 A;  1HPZ A;  2OPQ A;  3HJF A;  3RWU A;  4NCG A;  5CYM A;  3RRG A;  1NOZ A;  2F96 A;  4E89 A;  4CF0 A;  4DFK A;  1JKH A;  3ZSX A;  1Q9Y A;  4O44 A;  4TSX A;  1Z26 A;  1TKX A;  4FJ7 A;  2QK9 A;  4C8M A;  2R7Y A;  3OJS A;  3LP0 A;  4FLX A;  1U45 A;  4FJN A;  3AO2 A;  3VQE A;  3CYM A;  4K8Z A;  4B9N A;  2DY4 A;  1VSI A;  1JLB A;  4FM0 A;  1TL1 A;  2XY7 A;  1S1V A;  4CFA A;  1NKE A;  1W9H A;  1BHL A;  3LWL A;  1QE1 A;  3DMJ A;  3T1A A;  4CJL A;  2HMI A;  4J2E A;  2Z1H A;  1G15 A;  3SZ2 A;  3OYF A;  2QXF A;  3VA0 A;  4AHU A;  3HP6 A;  3QEP A;  4NCB A;  3QNO A;  3L2Q A;  4Z4G A;  4RW4 A;  4ELU A;  4JS5 A;  3AO3 A;  4F3O A;  4KI4 A;  3OYI A;  4CEQ A;  2IOC A;  4KO0 A;  1VSM A;  2HVI A;  1UAX A;  4M3W A;  1U49 A;  1NK5 A;  1RT6 A;  3AV9 A;  2ETJ A;  4IG3 A;  4L8R B;  1NK7 A;  4O4G A;  3AA4 A;  1NK4 A;  3SUN A;  4KHQ A;  1VSE A;  1WSE A;  3MED A;  4M3T A;  1RT4 A;  3AA2 A;  1RTI A;  4FJ5 A;  2HHW A;  3KLE A;  3OYJ A;  1HYS A;  3LAM A;  3WNH A;  3ZSR A;  3ZT1 A;  3KLH A;  3LZJ A;  4OKK A;  2G8H A;  4J2B A;  5I3U A;  3ZSW A;  1BCM A;  4DLG A;  1BGX T;  1RT2 A;  2Y1J A;  4M3U A;  3VQ4 A;  3HPO A;  2F8T A;  3VQ8 A;  2XHB A;  4LSL A;  1R0A A;  1L3V A;  4B08 A;  3OYA A;  4DQR A;  1VRU A;  3O4N A;  4O55 A;  3BGR A;  3K57 A;  3U3Y A;  3LAK A;  3MXJ A;  3EZ5 A;  1IKW A;  1JLC A;  2HVH A;  2LSN A;  3NH1 A;  2HNY A;  3OYK A;  4AH9 A;  4DU3 A;  4CGF A;  4FJX A;  1ZBI A;  5SWM A;  3THV A;  3I0S A;  3NFA A;  1KFS A;  1ZYQ A;  4PY5 A;  2D0A A;  3DRP A;  1TVR A;  4ICL A;  3VQB A;  3LAN A;  4BE2 A;  3OYM A;  1SL0 A;  3V9S A;  4FW1 A;  1NK6 A;  3U6F A;  2PYL A;  3P1G A;  4CJR A;  3B6P A;  4UQG A;  4KHN A;  1RBV A;  2YKN A;  2WON A;  3AVJ A;  1KLM A;  3LPT A;  1EKE A;  3LPU A;  3D0P A;  1HNI A;  1EP4 A;  2XY8 A;  4BE0 A;  4DTP A;  1RTH A;  3OYC A;  3KLG A;  5C24 A;  1KRP A;  2PY5 A;  3HL8 A;  1ZBU A;  4CEZ A;  4PA1 A;  4KHY A;  4CJP A;  3S3O A;  3M8R A;  4CEF A;  2G8U A;  1BI4 B;  4CJV A;  2HHU A;  1DTT A;  4B8C A;  1SV5 A;  1MU2 A;  1TL3 A;  3AO4 A;  4CFD A;  4ELT A;  4E7H A;  3IAY A;  1S6Q A;  1NOY A;  4FXD A;  1A5V A;  1XHZ A;  3TAB A;  1KCF A;  4F2S A;  4DG1 A;  4EP4 A;  4JS4 A;  5HRS A;  1CXQ A;  5C25 A;  3T3F A;  1VRT A;  2BE2 A;  3L3U A;  3SCX A;  1TK8 A;  2KFN A;  3L8B A;  4EP5 A;  4LH5 A;  3SPZ A;  3VQ5 A;  4OLB A;  2GUI A;  5CZ1 A;  4BWM A;  1RNH A;  1BI4 A;  1VSJ A;  3HPH A;  1DTQ A;  5CY4 A;  3VN5 A;  5KRS A;  1Z25 A;  1D8Y A;  1LAW A;  2HHT A;  3OYB A;  5T7B A;  3MAQ A;  4CJS A;  3C95 A;  1YT3 A;  4AHR A;  4HCB A;  3QIO A;  1RT1 A;  1LV5 A;  1EX4 A;  2P5O A;  1SKR A;  4N76 A;  2JGU A;  2ZD1 A;  4PQU A;  3OYD A;  1DLO A;  1EXQ A;  1J9A A;  2D0C A;  3NGI A;  3AVN A;  4DTX A;  3B6O A;  2IGI A;  5KGW A;  2OPR A;  4KKO A;  5J2Q A;  4DS5 A;  4DQQ A;  3V1O A;  3OJU A;  3M8Q A;  1SKW A;  1A5X A;  2IDO A;  4F8R A;  4E7L A;  4CK2 A;  1J54 A;  1FXX A;  2E4L A;  4CHN A;  4NCA A;  4GW6 A;  4IG0 A;  1S9G A;  4LH4 A;  3TAM A;  3HVT A;  2E6M A;  4WE1 A;  4YFU A;  3NH2 A;  3TAG A;  4FJG A;  4DTN A;  3V1R A;  5FRO A;  4W5N A;  4DMN A;  4E7K A;  2P5G A;  4CEE A;  4OJR A;  4B9T A;  4IFV A;  1C0T A;  3ZT4 A;  4JRQ A;  3QIP A;  1S1U A;  3KD5 E;  2HW3 A;  5K14 A;  2O4G A;  4CF8 A;  5FRN A;  1BL3 A;  4EZ6 A;  3VQD A;  3QEW A;  1WAF A;  4CGJ A;  3HXM A;  3NF7 A;  5CZ2 A;  4CFC A;  4FM1 A;  3QET A;  3V81 A;  3WNF A;  2G8F A;  3K5M A;  4HTU A;  4OVL A;  4IBN A;  3CM5 A;  3CFR A;  3KTQ A;  4C8L A;  4CGD A;  3HT3 A;  1VSK A;  4B9V A;  4E0D A;  4CJ3 A;  4DSJ A;  3SV4 A;  5FDL A;  4DSF A;  5EU7 A;  3RMA A;  1HYZ A;  1X1P A;  1XWL A;  2DFE A;  2NUB A;  2Z1G A;  1J53 A;  3FFI A;  4KV8 A;  4CJW A;  3O3H A;  2BGG A;  4CER A;  3M8S A;  4ID1 A;  2YHB A;  2YNH A;  2YNI A;  3DOL A;  1S1T A;  3OS2 A;  1I39 A;  3V9U A;  4C8K A;  1SUQ A;  4CHY A;  4XIU A;  5C42 A;  4M42 A;  3ZSV A;  3K5L A;  3AVA A;  5HBM A;  3ZT2 A;  3L3V A;  4PUO A;  2FC0 A;  1C0M A;  2P51 A;  4IDK A;  3OYL A;  3NE6 A;  1C1B A;  1A5W A;  2Z1I A;  3O3G A;  2HHQ A;  1VK0 A;  4DFM A;  1QS4 A;  1WNS A;  2VWK A;  4HHT A;  1U48 A;  1C1A A;  1BCO A;  2FBV A;  2G8W A;  1NK9 A;  1N6Q A;  3KD1 E;  4DTU A;  4F4K A;  4AHC A;  2XY5 A;  1WSI A;  4BDZ A;  5JS2 A;  1BQM A;  4FLV A;  2QKB A;  3AVK A;  2EX3 A;  4DTM A;  3G0Z A;  2G8K A;  3ZT3 A;  3HM9 A;  3MXM A;  1F21 A;  5J2P A;  2XY6 A;  4N41 A;  1WSG A;  1NJW A;  4AHT A;  4ELV A;  3DLK A;  3HVR A;  3V9X A;  4B9U A;  3SUQ A;  3AVF A;  2FBT A;  2PYJ A;  4F2R A;  4C8O A;  2G8I A;  4CJT A;  3RR7 A;  1C1C A;  1Y97 A;  2HND A;  1IKY A;  2HNZ A;  2HHV A;  2XRI A;  4DQP A;  1WLJ A;  1ASV A;  1WN7 A;  5SZT A;  3NF9 A;  3RRH A;  4FJM A;  1FKP A;  3P5J A;  4RG8 A;  3QEV A;  2OYQ A;  4DU1 A;  3M8P A;  4DWI A;  1TAU A;  1FKO A;  1HQE A;  4M41 A;  2GV9 A;  2QKK A;  4C8N A;  3SQ1 A;  3SI6 A;  2YV0 X;  4M45 A;  3V6D A;  3QES A;  1XC9 A;  1JL2 A;  3NBP A;  4H4O A;  4Z0U A;  1KFD A;  4EZ9 A;  1NK0 A;  4CHQ A;  4CEC A;  1W0H A;  1TV6 A;  4BDP A;  4KRE A;  3DLE A;  1RDD A;  1YVU A;  2IC3 A;  2ITG A;  3HK2 A;  3VQC A;  1NJY A;  4H8K A;  4CF1 A;  3ZSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...