2FBYA

Wrn exonuclease, eu complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Werner syndrome helicase
total genus 66
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbyA00
4MQ3A 2G8KA 1TVRA 3M8PA 4CF9A 4NCBA 4E1MA 4KHWA 1HNVA 2YKMA 3P5JA 1A5VA 2IGIA 2OPRA 3LP1A 3VQ7A 4DTPA 4DQQA 3DLRA 2GBZA 1C0TA 4E7HA 2A1RA 1QSYA 2G8UA 4CGIA 4I9LA 1U04A 3VQEA 4DSEA 4E7JA 2PY5A 3PY8A 3UIQA 2IC3A 1LW2A 2YNFA 5C42A 3I8DA 3V6DA 1WSHA 2P1JA 2DTUA 2D0AA 2I5JA 1TKDA 3LP3A 1ZBFA 3O3HA 2R7YA 4DFPA 1KFSA 1RT7A 1RTDA 1Q9XA 4E0DA 4AHVA 4CF2A 3LWLA 4KTZA 3KK3A 2P51A 2KW4A 3K57A 4HHTA 4JRPA 2HHSA 3LPUA 2ATQA 3PO5A 3QERA 2WONA 3VQ8A 4DU1A 4OVLA 1NKEA 1VK0A 2VG5A 2KZMA 3VQQA 4FLZA 3SUNA 4CJPA 4B9TA 2KFZA 3H08A 4ZHRA 1BCMA 1YT3A 4CEQA 3KJVA 4IKFA 1EX4A 5FROA 1LV5A 1WAFA 4E7LA 3NH0A 1GOCA 4HCBA 4GW6A 4OGCA 4CJ4A 3CFRA 3KLIA 2FBVA 2FC0A 4E19A 4B9NA 1T8EA 3KIOA 1XI1A 2ETJA 1Q8IA 3NF9A 4CFAA 5C24A 3ZSYA 4DLEA 4B8CA 1C1AA 4AHUA 3ZSXA 4I2QA 3TR8A 4CERA 2XRIA 4FW1A 3LAKA 3LZJA 1S6PA 3M8RA 1YVUA 4LH4A 3ZSVA 4OKJA 2RKIA 3OYFA 4ZTJA 3AA3A 3VA0A 3QNOA 4E7IA 3LALA 1JXBA 1XHZA 1XC9A 1VSDA 1IKYA 1L3SA 2HMIA 3L3UA 3HVTA 2D0CA 3C95A 3I0RA 1S9GA 1IG9A 5KGXA 3IG1A 3AVIA 4N41A 3AA2A 1EXQA 2X74A 3SYZA 4J2EA 1YTUA 1SKRA 1WLJA 4AILC 1Q9YA 4CJKA 5HRSA 2W42A 5SZTA 4Z4GA 3DLHA 3VQ4A 2G8HA 3ZT2A 3TAFA 3CFOA 3WNEA 3VQAA 5KI6A 3KD1E 3RR7A 5J2PA 3PX6A 4FJNA 2OZMA 1N6QA 4Z0UA 3V81A 3EYZA 2BGGA 2D5RA 4HUEA 1UWBA 3PUFA 4DTMA 1RILA 4CK1A 3SNNA 1RBVA 3ZT0A 1K6YA 3AVBA 4N5SA 4CJEA 3L2QA 3AVNA 4LY7A 3OVNA 4DQIA 1ASWA 1RBTA 2HHQA 1X9SA 3ALYA 2F96A 1IKXA 3M8SA 4Z4FA 2QKKA 1LWFA 1WNSA 4CEEA 2YHAA 4CHYA 1TGOA 4CK2A 1RT1A 1SV5A 5HRRA 1RCHA 1UA0A 2F8SA 4E1NA 2OA8A 1JKHA 3KTQA 1VRTA 1BGXT 1WSGA 3SQ2A 3TAMA 4JRQA 3OYEA 3BDPA 1BIZA 4GMJB 3HPOA 3ZSQA 3LAMA 1BI4B 4N76A 4KRFA 3SCXA 4DTXA 1HPZA 1QS4A 2IS3A 4KV8A 4F4KA 3K58A 1NJZA 4FJKA 2IAJA 3OYBA 4KREA 2WOMA 1VSHA 3AVJA 5EU7A 2HHVA 1HNIA 1KLMA 4FK0A 4M3UA 1S6QA 3AO5A 4HCCA 2BE2A 4W5OA 3IS9A 2F8TA 2B5JA 3ZSOA 4CHNA 4Q0BA 3QIOA 2KZZA 3V9SA 4DQSA 1FXXA 4LD0A 4KTWA 4M41A 4B9VA 4FZZA 4H4MA 2HB5A 4EZ6A 4DMNA 1S1VA 4BDYA 3G0ZA 3ASMA 3OYCA 1KLNA 4NCGA 3AVMA 1L5UA 2D0BA 1KCFA 4Z4IA 3HL8A 2PZSA 4CFDA 3AVCA 4AHRA 2HNYA 4KAZA 4CE9A 2QKBA 2VWKA 3L2RA 3RRHA 4DS5A 3ITHA 1ZBUA 3QETA 1ZBIA 4RW7A 1DTQA 1RDCA 3SZ2A 4ID1A 4JLHA 3K59A 1S9EA 1IO2A 4UQGA 4M3YA 4ICLA 1T05A 3U6FA 3PO4A 1LWCA 1D5AA 4F2RA 4LSLA 2VG6A 5D3GA 4AHSA 2FBXA 1RT5A 4KB1A 2VWJA 4PWDA 4FJMA 3LPTA 1FK9A 5K14A 3M8QA 4QCLA 1BL3A 1REVA 1W0HA 4CJRA 3OYGA 4CIGA 4Z4EA 1JLGA 1RDAA 3KD5E 3U3GA 4H8KA 2Z1GA 1LWEA 4RG8A 4EP4A 4KHQA 2JLEA 3MEEA 1UOCA 3VN5A 4OLAA 3OYKA 1VSLA 4EZ9A 4N47A 4K8XA 4CJLA 3T3FA 2KFNA 3NBPA 4OPJA 4B9MA 2O4IA 3VA3A 1JLFA 4LSNA 2HHXA 1KVBA 4RW9A 3NFAA 4M42A 4FJIA 4Z4CA 2AJQA 3V1OA 3LWMA 4YFUA 3NGIA 4DSLA 5CYQA 3PX0A 4DTOA 1I3AA 4O55A 1Z25A 4DFMA 2YNHA 3F9KA 3L8BA 3SI6A 3V1RA 3OYMA 5HRPA 3DRSA 3E01A 1NK5A 4FXDA 5FRNA 1TL1A 1BISA 3ISNC 2Y1IA 1N5YA 4C8LA 4FJHA 4FJ8A 3S3NA 4FW2A 1JLCA 3NF7A 5SWMA 2JGUA 1X9MA 3KK2A 3NGYA 3ZT1A 1HJRA 1NOZA 1BQNA 3DM2A 1QE1A 3PV8A 1JLBA 2PYJA 4F2SA 3SV3A 1RDBA 3SPZA 4B9UA 3OYLA 1HQEA 3K5OA 3OJSA 3QEXA 5CZ2A 4I2PA 3HVRA 4KHNA 1MU2A 1S1UA 1NK4A 3DOLA 1WN7A 4M3RA 3OYNA 4HTUA 1SL2A 1KRPA 4ELTA 4I9QA 2DFHA 4BDPA 1I39A 4IBNA 4W5TA 4W5RA 2OZSA 2HVIA 1RT6A 4CJ5A 3HO1A 2HHTA 4CFBA 1TAQA 1S5JA 4FM0A 1T03A 3CM6A 4E3SA 4AHTA 5E41A 3O3GA 1NKBA 1CZ9A 3V1QA 1D9FA 4DFKA 1S1TA 3CYMA 2E6LA 4CGFA 1RT3A 4CHOA 4FK4A 4CEBA 3NGZA 2GUIA 2YKNA 3O4QA 3HT3A 4DTNA 4OKEA 4B9LA 3DOKA 3TAQA 4O44A 1ZBLA 3NH1A 4FK2A 3A2FA 2Z1JA 3AVLA 1S1XA 3LDSA 1SUQA 1TV6A 4NYFA 1BQMA 4CJQA 4YNQA 4KPYA 2RF2A 4DTRA 1TK0A 4FM2A 2ZQBA 4NCAA 4B8AB 2PYLA 3SUPA 3TANA 3F73A 4M3XA 4CEOA 4FM1A 4BWMA 2HHUA 1RDDA 3S3MA 4MFBA 3NF8A 3NDKA 5FDLA 3D45A 4IG0A 1YTAA 1J5OA 1RNHA 3OS2A 4F3OA 1G15A 1KVCA 1VSJA 3EZ5A 4AH9A 4O0JA 4F8RA 3ZT4A 3L2VA 4BE2A 1C1CA 3DI6A 4PQUA 1KVAA 1J9AA 3DLKA 3WNFA 1ITGA 2XY6A 1JL1A 3O4NA 1HYVA 1ZYQA 5I42A 1LAWA 3G10A 4F3TA 4C8MA 3QLHA 3AO1A 3ZSWA 3HP6A 2HW3A 3L2WA 4LH5A 3OS0A 4DSFA 3SQ0A 4CCHA 4M3WA 1RT4A 4IG3A 3SQ1A 3K5NA 2X6SA 3HYFA 1GOBA 5J2QA 1EETA 5DMRA 1NKCA 2B6AA 4ELVA 3VQPA 2XY7A 4QAGA 1VRUA 1L3UA 2HNZA 4NYNA 3HK2A 1HYZA 1EP4A 1IH7A 3P1GA 3ZSRA 2IDOA 4E89A 4CK3A 3MXMA 1L3TA 5T7BA 3RWUA 1W9HA 1HYSA 4DU4A 3HM9A 1NK8A 3HPHA 4J2DA 1RTJA 4CEDA 3QESA 4DSIA 3DMJA 1VSEA 1EKEA 1NK6A 4CFCA 4M45A 2Y1JA 4J2BA 2RN2A 2YV0X 3AV9A 4PA1A 3ZSZA 5C25A 3VQ9A 4W5NA 1C0MA 3RTVA 4IFVA 2Z1HA 5KRTA 5J1EA 1NK0A 1JLEA 3HPGA 1Y97A 4O5BA 4CJ3A 5J2MA 2G8FA 4KI4A 4DFJA 3V9WA 1UA1A 3RR8A 1DTTA 1NOYA 2KQ2A 4ID5A 4Z4HA 1TL3A 4FLYA 4CF1A 4DSJA 3V9ZA 3SPYA 4DLGA 3TI0A 3SUQA 2HNDA 3VQDA 4KTQA 4HUFA 3O3FA 3MECA 3AA5X 2LSNA 2XY5A 4JS4A 1HMVA 3QINA 1RBUA 3K5MA 3MXIA 3AO3A 3OYHA 1R0AA 1NJYA 2G8IA 4CJUA 2XO7A 3K5LA 1L3VA 2KTQA 4BACA 2XY8A 1NK9A 2B4JA 1KFDA 4FZXC 3DLGA 3L2UA 3K2PA 3KLGA 2FBTA 4CIFA 3V9XA 4B3OA 1IKVA 2EX3A 3AVHA 4BE0A 1NJWA 3I0SA 1QSSA 1C0UA 2G8VA 2QK9A 3RMDA 2XHBA 3LP2A 5JS1A 3AVGA 5JS2A 4EP5A 4KFBA 4CEAA 3VQCA 1UAXA 3QNNA 1TKZA 4BWJA 4CHQA 1CLQA 1RTIA 3JYTA 5HP1A 1WSEA 4FLWA 2FBYA 3FFIA 4FJ9A 2G8WA 3NH2A 3SQ4A 2GV9A 2O4GA 4RW4A 1KTQA 2OYQA 3OYDA 3PX4A 1KSPA 3HP9A 3JSMA 4DTUA 1QHTA 3RMCA 4RW6A 3D0PA 3LZIA 4DTSA 3S9HA 3TARA 5I3UA 3TAEA 1D8YA 2OPPA 3CFPA 3NE6A 3MXJA 3MAQA 2IOCA 2BDPA 4DS4A 1Z26A 3AVKA 1ASUA 1WSIA 3DLEA 3OJUA 3HSTB 1DLOA 4CGJA 4BDZA 4B9SA 4M3TA 4FJ7A 2BANA 1A5XA 3QEVA 1XWLA 4CEZA 5KRSA 1NK7A 2QXFA 1QQCA 3V4IA 5DK5A 3SV4A 2YHBA 5HRNA 2DY4A 1X1PA 3TABA 1SKWA 4I7FA 2RPIA 2OPSA 3RRGA 3OYJA 4DQPA 3THVA 4M3ZA 5CY4A 3NAEA 2ITGA 4H4OA 3T19A 4R5PA 4WE1A 3QEIA 4BE1A 1XHXA 4TSXA 4O0IA 4OGEA 4CIEA 1O1WA 3NHGA 3U3YA 1BIUA 4C8KA 4QOZB 1TKXA 2Z1IA 4IFYA 1SL1A 3TWHA 3KLEA 3C94A 1NJXA 4KB0A 1B92A 3AO4A 4DU3A 1BHLA 4CJFA 4DQRA 1FKPA 4OJRA 3S3OA 4Y1DA 1J54A 3L3VA 3OS1A 4FLVA 2ZD1A 4CJVA 1VSKA 1B9FA 4HVJA 1U49A 4FJXA 3SJJA 3KKSA 2P5GA 4FJLA 3ZCMA 3DLBA 1VSFA 2X6NA 4CF8A 3QEWA 1SL0A 1TK5A 2OPQA 3DRRA 1JLAA 4XIUA 1RT2A 5FRMA 4PUOA 1FKOA 4B08A 2EHGA 1GOAA 1WAJA 1RTHA 5CZ1A 2YNGA 3BGRA 1TK8A 1S1WA 4AHCA 1T7PA 1SKSA 4FCYA 4L8RB 1ASVA 3AA4A 2X78A 1BCOA 4OPKA 3ULDA 3QIPA 3TAPA 3NF6A 4CGHA 3SUOA 1HQUA 1VSMA 1IKWA 1WSJA 1CZBA 3OYIA 1CXUA 4J2AA 3CQ8A 2HVHA 3LP0A 3OYAA 1J53A 4HUGA 4ZTFA 3VQ6A 4FZYA 4FYDA 3WNGA 1LAVA 1F21A 1VSIA 1U48A 1JLQA 4PY5A 3RMAA 1HRHA 3VQBA 1A5WA 3KLFA 1U4BA 4FJ5A 5CYMA 3KK1A 3HXMA 3AVAA 3DYAA 4JS5A 3CG7A 4CF0A 4CJTA 1QSLA 1LW0A 4K8ZA 4CESA 4KHSA 3AO2A 3LANA 4FJGA 2E4LA 1BI4A 1CXQA 4KHYA 4C8NA 3HJFA 4FLXA 4IDKA 4CHZA 4CHPA 1U45A 5J2NA 4C8OA 4ELUA 4FJJA 2HHWA 1C6VA 4DTJA 4OLBA 1JL2A 4RW8A 1U47A 3MEGA 4DF4A 3AVFA 3C6TA 4DSKA 1TAUA 1B9DA 5KGWA 3RMBA 4CECA 3EY1A 4FLTA 2NUBA 3V9UA 4FLUA 3WNHA 4OKKA 4CJSA 1RBRA 3B6PA 4CGGA 4Y1CA 2DFEA 3P83D 3OY9A 1JXEA 4KO0A 1ZBHA 3T1AA 4KKOA 3B6OA 4DF8A 4O4GA 3ZT3A 1X9WA 1C1BA 4G1QA 4KI6A 4KHUA 1TKTA 3QO9A 4CJWA 1QTMA 2YNIA 3CM5A 3VQ5A 4E7KA 4GVMA 3NCIA 4CGDA 5KTQA 2ZE2A 3KKRA 1WSFA 3DRPA 1RBSA 4N56A 2P5OA 5HBMA 3IRXA 2E6MA 3TAGA 4DWIA 1D9DA 3IAYA 2VG7A 4Q5VA 3C6UA 4W5QA 3KLHA 3QEPA 5HROA 3MEDA 2Q3SA 4FVMA 4CEFA 4DG1A 2A1SA 2DFFA 5HLFA
chains in the Genus database with same CATH superfamily
3GE1A 3M8PA 3SAFA 4CD1A 2V52B 4FOIA 4KHWA 2YKMA 1A5VA 1OKJA 2HBLA 1IBLK 2G8UA 2IVOA 2PY5A 4FOEA 3F9MA 4HWIA 3V6DA 1WSHA 2P1JA 3MK6A 2I5JA 4H0XB 2P9UA 5FPEA 1RT7A 3VPZA 1Q18A 4KTZA 1J6ZA 4BQLA 2P51A 4HHTA 1SZ2A 4JRPA 1Y64A 3LPUA 3FFKB 1WB9A 3QERA 4DU1A 1W97L 4KH5A 2VG5A 3SUNA 2P9NA 2P9IB 3MCAB 3H08A 3NMUA 3TSUA 4OO1J 1LV5A 5JVHL 4E7LA 1GOCA 4CJ4A 1HR0K 4EHUA 4EFHA 2YI1A 5ADXA 3CERA 4JKDA 4CZHA 4M7YA 2FC0A 5AQNA 4PKIA 3ZEUB 3ZSYA 3TR8A 5CHIA 3OYFA 5M1NA 1E3MA 2D0CA 3I0RA 3J7AP 4JI7K 4NLCA 3AA2A 2Q0UA 4ISGA 3LL3A 5HRSA 4H5RA 3VQ4A 2G8HA 3TAFA 3C7NB 2UXDK 1YF5L 3UKUA 2OZMA 1N6QA 3VGMA 2D5RA 4YHHK 3L2QA 1K6YA 3AVBA 4CJEA 4Z4FA 4CEEA 3TPQA 4CHYA 4O8KA 4QS9A 4E1NA 5LY3A 2ZJRL 1WSGA 2Q0RA 3TAMA 1NBWA 1OVYA 3HPOA 3LAMA 1BI4B 1YUWA 3EO3A 4C1NK 4DCHA 3DLLL 4DV2K 2ZWHA 4FK0A 1S6QA 3AO5A 2BE2A 3PLAA 3IKMA 5F1XA 4Q0BA 4CHNA 4FWQA 3A0IX 3VF4A 1FXXA 4LD0A 2GX9A 3ASMA 3OYCA 1KLNA 1GLEG 2P9SB 3ZEUA 2PZSA 4DQ8A 4AHRA 3M1FA 4WFAL 4CZMA 4U7BA 4DS5A 4JV5K 1ZBIA 1RDCA 4C23A 1S9EA 1IO2A 1T05A 2WTUA 2VG6A 2FBXA 4FJMA 3F5TA 4CZJA 4DR6K 4OPHA 3M8QA 1REVA 4YDUA 1RDAA 3KD5E 4H8KA 2Z1GA 1LWEA 4RG8A 1JCFA 4EP4A 2ASPA 4LFCK 2JLEA 4KHQA 4EZ9A 4CJLA 2KFNA 3A5LC 3NBPA 3R3LA 2O4IA 2Q1NA 3VA3A 1JLFA 2PFUA 4RW9A 3NFAA 3OBWA 3ULEB 4FJIA 3CCVN 2AJQA 4DSLA 4YFUA 3NGIA 4LF9K 4O55A 4DFMA 3THWB 4FWMA 1NK5A 4FXDA 2Y1IA 4C8LA 4FSVA 5SWMA 2JGUA 2VWBA 4GKJK 1C0GA 5AQPA 3O8MA 3IDHA 1NOZA 4JD2A 1BQNA 3PIPL 2PYJA 1EO1A 3M6GA 5I9EB 4LF6K 2E2QA 3OYLA 1XC3A 3SAGA 1HQEA 4WYBA 2UUAK 3GG4A 1S1UA 3LDQA 1WN7A 3OYNA 4ELTA 4I9QA 4JI3K 3CC2N 2OZSA 2J4RA 1MDUB 4CFBA 1TAQA 1S5JA 4E3SA 4IDHA 4BG8A 4CHOA 4FK4A 3DOKA 2FF6A 1ZBLA 5AQTA 5BR9A 3DXMA 3A2FA 3LDSA 1SUQA 4CJQA 4KPYA 2PYLA 4IOXA 3SUPA 2I7PA 3TANA 1NNEA 3MDQA 1RDDA 3NDKA 1YTAA 3OS2A 4F3OA 3G6EN 1KVCA 2O8EA 4O0JA 1SS6A 4PQUA 3DI6A 2XY6A 3R6MA 4A5AA 2Q36A 4H0PA 4OPAA 4DV5K 4F3TA 3O9TA 3QLHA 1W7AA 3AO1A 2QW9A 4JI5K 2HW3A 4CCHA 1YXQA 3OS0A 4DSFA 4M3WA 3SQ1A 4ISEA 5DMRA 4QAGA 2HNZA 3ATVA 3HK2A 1IH7A 3EZWA 3RWUA 3FE1A 3MXMA 1L3TA 1NK8A 3HPHA 3SK3A 2IVNA 1RTJA 4J2DA 4BQZA 4WFNL 3QESA 4DSIA 2ZGYA 3SBGA 1VSEA 5AQFA 5JLHA 5C25A 1G99A 2Z1HA 1X9JA 5J1EA 1NK0A 3HPGA 4KI4A 5EVZA 4IFEA 2KQ2A 4ID5A 1TL3A 1DEJA 4CF1A 3SPYA 4BY9C 4CZGA 4JS4A 1HMVA 2W40A 1RBUA 1NJYA 3AO3A 4CJUA 1KD1O 4BACA 5CR4A 4B3TK 4PHTX 2FBTA 1IKVA 4CZIA 2EX3A 4K25A 1NJWA 2G8VA 4K42A 2XHBA 5JS1A 5DM6L 3OTOK 5JS2A 4KFBA 3VQCA 4BWJA 5AQOA 4FLWA 2NZTA 4FJ9A 4YOVA 5JICA 1QHTA 3VEVA 4FVUA 3A8YA 3H46O 4BG9A 2E1ZA 3O1BA 5I3UA 1YIJN 3CFPA 4MDBA 5DM7L 4H5WA 5JVGL 1ASUA 4B9SA 3HSTB 4WF9L 3CMEN 4M3TA 4FJ7A 4DR4K 1A5XA 4PKGA 1N8RO 3V4IA 5DK5A 3SV4A 1P90A 5H1SQ 4I7FA 2GELA 2QWOA 1K9MO 2OPSA 3WXIA 4DR7K 5CY4A 3ENOA 3NAEA 2BTFA 4WE1A 4BE1A 4BRQA 3U3YA 1BIUA 4C8KA 2Z1IA 5E84A 1QQNA 1SL1A 3B8AX 3KLEA 4BR9A 5C2FA 4DQRA 4JAXA 3L3VA 5BRDA 4CD3A 1B9FA 2P5GA 2X6NA 4JI1K 4E1JA 1JLAA 2VGMA 3BUZB 3Q7CA 1WAJA 5AQMA 5KQDA 1T7PA 1VQKN 4FCYA 3WXMB 1M1KO 3AA4A 4LC9B 3QIPA 1BU6O 3O6WA 1CXUA 3LP0A 3OYAA 1J53A 4ZTFA 3CF5L 2OCEA 4FYDA 1HUXA 1F21A 4XEIA 1JLQA 3J7YP 3LDNA 3THYB 4FWPA 5AQLA 4GNIA 3KK1A 3VMFB 4CF0A 1LW0A 3H45C 1DKGD 4YORA 2E4LA 4IDKA 4ELUA 5A2QO 3BF1A 1LCUA 4XH1A 3THXA 3VESA 4OLBA 4YOXA 3EKSA 3MEGA 4I6MA 5KGWA 1YJ9N 1QVFM 4LF7K 2F4VK 3CCLN 3I55N 4CI6A 4RWTA 2QXLA 1NMNA 4BC4A 4BRKA 4DF8A 4JNEA 3AY9A 4G1QA 1JCEA 2YNIA 4E7KA 4GVMA 5JMVA 3NVMA 3OW2M 2P5OA 1WSFA 1BA0A 2E6MA 1D9DA 3IAYA 4Q5VA 4W5QA 3QEPA 2V7YA 1U2VA 4FWLA 2A1SA 2DFFA 1N5YA 4MQ3A 1TVRA 2HOEA 1NG9A 3P5JA 4NB4A 2IGIA 2OPRA 5ELZA 4DQQA 1NGBA 1ZC6A 4X62K 1T44A 2GBZA 3GOIA 3W3DA 1OVQA 4CGIA 4I9LA 1U04A 4DSEA 3UIQA 2DPNA 2IC3A 3E9PA 5AQKA 3K9JA 1XMOK 1TKDA 3O3HA 4DFPA 5AFUA 1RTDA 4AHVA 3LWLA 4JI0K 2KW4A 4FWRA 4FWNA 4H0VB 2HHSA 3PO5A 3LM2A 4OVLA 1NKEA 1NGGA 1Q86O 5AQJA 4B9TA 2KFZA 4YY3K 2AP1A 4ZHRA 3HSCA 4WQ4A 5FROA 4GW6A 3FZLA 3HRGA 2UXBK 1C0FA 3I33A 4B9NA 2VYPA 3KIOA 1XI1A 1T8EA 2ETJA 5EX5A 3U9ZA 4BR4A 3HBTA 3I8BA 2E88A 4AHUA 4I2QA 4X64K 2XRIA 4RTFD 1VQLN 3O08A 3M8RA 3O9UA 4LH4A 4OKJA 1XC9A 4ZTJA 4IXCA 3VA0A 4E7IA 2HMIA 4JKBA 3WUHA 1XNRK 2FF3B 4JN4A 3IG1A 2X74A 3SYZA 4J2EA 3QICA 1WLJA 4AILC 4C1NI 5AQXA 3KHYA 4DR5K 1EQYA 3WNEA 3VQAA 4DR2K 5KI6A 3KD1E 3RR7A 5J2PA 3ENHA 2YHXA 4JI2K 1UWBA 3PUFA 4DTMA 4V19S 3SNNA 3AARA 1BO5O 4LY7A 2O8EB 1RBTA 2HHQA 2O8FB 1IKXA 4BRIA 5HOOA 2YHAA 1TGOA 3MWPA 1OH5A 3THXB 1BGXT 1MWKA 3KK7A 4JRQA 4CVNE 3CPWM 2VGNA 3SCXA 4HTLA 3K58A 5KPTA 4LF8K 4KREA 1IG8A 4JHDB 1KLMA 4I6MB 2F8TA 3V9SA 1MA9B 2ITMA 1VQMN 4B9VA 2EWSA 3DWLA 4FZZA 2HB5A 2NRWA 3MN6A 4JI4K 1NM1A 2QA4N 4CFDA 3AVCA 1QQOA 2HNYA 5EXWA 3WXKA 1X3NA 3RRHA 3EKUA 1ZBUA 3SZ2A 4M3YA 1GLLO 4F2RA 5BPMA 2Q97A 4KB1A 1RT5A 4PWDA 2A6AA 1VHXA 3LPTA 3TSQA 4BR2A 4DV1K 4DV4K 3OYGA 1JLGA 4PKHA 1UOCA 3OYKA 1VSLA 4CW7B 4K8XA 4OPJA 4H0TB 3V1OA 4L3QA 3WXJA 2FXUA 5AR0A 3PX0A 5BN8A 4DTOA 2YNHA 3OYMA 3U4LA 5FRNA 1BISA 5M1QA 3S3NA 3J80O 3QMLA 3ZT1A 1QE1A 3SV3A 5AQHA 3SPZA 3S41A 2O8DA 4B9UA 3K5OA 3QEXA 1QQMA 4I2PA 1ZBHA 3J7ZO 5AZIA 4W5TA 3WQTA 5M1PA 4W5RA 1K8AO 1RT6A 3N4PA 4CJ5A 3HO1A 1T03A 3CM6A 5E41A 3DXMB 3V1QA 4DFKA 1S1TA 5TKWA 1JJ2M 4BRGA 4DUYK 3C6HA 4CGFA 3BZKA 1NGHA 2GUIA 3O4QA 2VQFK 3NH1A 3CJ1A 1W2BM 1BQMA 4FPBA 2RF2A 1TK0A 3CC7N 1VQNN 5ADXH 3SBTA 1GLDG 1TYQA 4IEEA 4FM1A 4BWMA 2HHUA 3S3MA 4MFBA 3NF8A 3D45A 4IG0A 3TU5A 3D2FA 3JAMO 3QB0A 1J9AA 2I7NA 3DLKA 2F9WA 4X66K 1HYVA 5I42A 5CE3A 1LAWA 3ENBA 3ZYYX 3HP6A 3L2WA 4LH5A 3SQ0A 3IUCA 3JS6A 3HOTA 1GOBA 3CQYA 1NKCA 2B6AA 1ATNA 4ELVA 1V4SA 1HYZA 2ZGZA 4CBWA 1W9HA 4F9OA 1YVNA 3AAPA 4CEDA 4JKAA 1IV0A 1EKEA 4GKKK 2OANA 4W5NA 3RTVA 4IFVA 4BRFA 4OX9K 1JLEA 5J2MA 3RR8A 1DTTA 3UE5A 1NOYA 5GADP 2UUCK 3ZLJA 2NRVA 3DAWA 2HNDA 3VQDA 3O4WA 4HUFA 3O3FA 3AA5X 2BDPA 3MXIA 3QINA 3CXCM 3K5MA 3OYHA 4BREA 2XO7A 3K5LA 4BC5A 3KLGA 3V9XA 1D4XA 1QSSA 2O8DB 2QK9A 2QWNA 3CHWA 3C0BA 1UAXA 4DV6K 4H0YB 1RTIA 2V7ZA 3M5RA 3JYTA 4WQ5C 3NH2A 1N33K 3SQ4A 2O4GA 1KTQA 3PX4A 2O8CB 1KAXA 4DTUA 3RMCA 2BUPA 3SMPA 1QZ5A 1K8KA 2YJFA 4H5TA 4FWKA 3TAEA 1D8YA 2OPPA 1GLFO 3NE6A 2IOCA 1Z26A 2D0PA 3DLEA 4CGJA 2GEMA 2BANA 3QEVA 1YITN 5KRSA 1GLCG 1QQCA 3E9LA 2CH6A 4A5BA 4IOAL 2GTDA 5HRNA 2DY4A 3TABA 1SKWA 3EE8A 3RRGA 5BRHA 4M3ZA 5TKYA 4BRLA 4H4OA 3G4SN 1N34K 1M90O 4OGEA 4JKGA 1WUAA 2ZJQL 1TKXA 5BPNA 1ATSA 3TWHA 3C94A 4KB0A 4DU3A 1BHLA 1E4GT 2PBDA 1FKPA 1J54A 3OS1A 4CJVA 3MCPA 1VSKA 3CJ7A 4YOYA 3ZCMA 2QI2A 1VSFA 3PSFA 3P4IA 3L6QA 2EHGA 5M1KA 2YNGA 1TK8A 4AHCA 1SKSA 4OPKA 2NRZA 1BCOA 4A62A 4CGHA 2RE2A 3SUOA 3HI0A 1VSMA 4B1YB 2NNWA 2HVHA 1GLJO 4IOCL 4FZYA 3MWTA 1I94K 1LAVA 4JEPA 1VSIA 4IO9L 1U48A 4JKHA 3UKRB 1HRHA 3VQBA 4EAHD 3O9RA 5CYMA 4JS5A 3HXMA 3VERA 4FJGA 3LANA 5M1OA 1BI4A 1CXQA 4CHZA 2WUSA 4FJJA 2HHWA 3T7ZA 5AQYA 5AZIB 3JXUA 4DTJA 1JL2A 3AVFA 4A59A 3G25A 3WEEB 3V9UA 2NUBA 4QS8A 2KKZA 1KQSM 4OKKA 2QWQA 5FLXO 2QWPA 3WEEA 4CGGA 2DFEA 4B1WB 4DR3K 2KLAA 2UYTA 1TKTA 4CJWA 1QTMA 5F2RA 3CM5A 3VQ5A 3BY5A 4CGDA 1YJNN 3KKRA 3DRPA 3O80A 4A2AA 3IRXA 4B3RK 3KLHA 5LMUK 5HROA 4FVMA 1GLAG 1U49A 3CCSN 5HLFA 4PL8A 1N36K 4B3SK 4CF9A 4NCBA 4E1MA 3LDLA 3LP1A 3VQ7A 3DLRA 3PSIA 2P9IA 1C0TA 4GV9A 3RVCA 2PAVA 1QSYA 3THWA 2NRTA 3VQEA 4MLEA 3PY8A 5C42A 1JCGA 2D0AA 2H3GX 3D7EO 2R7YA 3ID6A 1KFSA 3E1YA 4E0DA 1Q9XA 5HL7L 4CF2A 5B8HA 3KK3A 3K57A 1VQ5N 4BROA 3EL2A 2ATQA 2CH5A 1WOQA 2WONA 5AJ3K 1VK0A 2KZMA 4AQYK 5AQIA 3G71N 1BCMA 4CEQA 3KJVA 1QHAA 4IKFA 1HNWK 4XH5A 1WAFA 3NH0A 3WQUA 3CI5A 3ID8A 3FZMA 3HOSA 2FBVA 3WT0A 4E19A 3J8AA 1Q8IA 4CFAA 2Q2RA 4CERA 1NGEA 1S6PA 1YVUA 4FL9A 3AA3A 1XHZA 3QNOA 1JXBA 1VSDA 1IKYA 2WFBA 3C95A 1IG9A 1V4TA 4CJKA 1RDWX 3DLHA 3E9OA 3ZT2A 3O9SA 4GV3A 4FJNA 3H1VX 4Z0UA 4GY2B 2BGGA 1P8ZA 4UY8O 1RBVA 3AVNA 2ZJPL 3ALYA 2F96A 1EWRA 4WFBL 1K8KB 1LWFA 3CCUN 1RT1A 4WQ5A 3KVGA 1U2VB 5HRRA 1K73O 1RCHA 2F8SA 3KTQA 1VRTA 5AQZA 1GLBG 3OYEA 3BDPA 1BIZA 4GMJB 5GAEP 3ZSQA 4N76A 4KRFA 1HPZA 1QS4A 2YHYA 4DR1K 4F4KA 3VETA 4FJKA 2IAJA 4G9ZA 1VSHA 2HHVA 1HNIA 4H0OA 4U67L 4W5OA 3IS9A 4K41A 2O8CA 3P31A 3ZSOA 3QIOA 1E4FT 4DQSA 4B9QA 4M41A 4H4MA 4EZ6A 1S1VA 4BDYA 3G0ZA 3R9PA 3TTFA 1ESVA 3HZ6A 4Z4IA 3HL8A 3LDPA 5BR8K 3H3NO 2QKBA 3RSEA 2VWKA 5LL6Z 3L2RA 3ITHA 3QBWA 3QETA 1HNXK 5C15A 1Z6RA 4NXNK 4ID1A 2P9LA 3K59A 4JK9A 3U6FA 3CCQN 3PO4A 4K0KK 4JI6K 3CCEN 2GUPA 1FK9A 4QCLA 1BL3A 4CJRA 4Z4EA 3U3GA 5C2DA 1YHQN 4DKWA 3T3FA 4BC2A 4ILJA 4JKCA 4B9MA 4LSNA 2HHXA 4MDAA 4IO8A 4J8FA 5CYQA 3CC4N 1I3AA 3VGKA 1Z25A 3SI6A 2P9NB 3F9KA 3V1RA 5HRPA 3E01A 3ISNC 2O8FA 1JLCA 5BREA 3KK2A 1HJRA 3DM2A 1VQ6N 2NLXA 3L4IA 4JD2B 3HM8A 4KHNA 1NK4A 4Z94A 3DOLA 4M3RA 4HTUA 1SL2A 4DB3A 2HVIA 1I39A 4IBNA 3U9DA 3ZX2A 1RDUA 2HHTA 2NRRA 2ZF5O 1CZ9A 1D9FA 4JK7A 3CYMA 1RT3A 2E5LK 4CEBA 3NGZA 2YKNA 2E20A 3HT3A 3TAQA 4O44A 1IJJA 4FK2A 3AVLA 4YDUC 4DTRA 4NCAA 2E2OA 1N32K 3VEWA 1G15A 4M7XA 4AH9A 2HHHK 3L2VA 1KVAA 5EOYA 1JL1A 3O4NA 3CCRN 3L0QA 3G10A 4C8MA 3MMVA 1RT4A 4IG3A 5J2QA 1TUUA 1EETA 2P9LB 3VQPA 1SQKA 5C10A 4E89A 3SAHA 5T7BA 1HYSA 4DU4A 3HM9A 2HSTA 2AA4A 4BRMA 1X3MA 3VTHA 1TUYA 2Y1JA 4J2BA 2RN2A 3AV9A 4PA1A 3ZSZA 1NGIA 1C0MA 4BRCA 3MX5A 5KRTA 1OH8A 1Y97A 4O5BA 2G8FA 4DFJA 2YJEA 4JKGB 1UA1A 1VQON 2D4WA 3VEXA 3U8XA 4DSJA 3V9ZA 5AQQA 1KAZA 1S22A 4KTQA 3BEXA 4J2AA 3MECA 2XY5A 2LSNA 2VCPA 2P9KB 5JLFA 1R0AA 2G8IA 3IMXA 4JHDA 1L3VA 2KTQA 2XY8A 1NK9A 4FZXC 3DLGA 3D2FB 3K2PA 3C65A 2D0OA 3LDOA 3AVHA 5LJWA 4BE0A 3I0SA 1C0UA 4B1XB 1FW6A 3MX2A 3RMDA 3LP2A 1BDGA 2F9TA 3SJHA 1TKZA 1NJIO 5FPMA 2ASOA 4MO4A 4O5FA 5AQRA 2G8WA 3BF3A 3VEYA 2GV9A 4RW4A 3T1YK 2OYQA 3JSMA 1TYQB 2D1KA 3IFRA 4H5NA 3MN5A 3FGUA 3AVKA 1XNQK 5C0YA 3OJUA 4BDZA 4R79A 1XWLA 2QXFA 5AZJB 2F7TA 4BGAA 2HBKA 1NMDA 4AM6A 4DQPA 3THVA 1Q82O 3UKUB 1YAGA 4R5PA 3QEIA 4B1UB 1O1WA 3NHGA 4QOZB 2WBNA 1VQ9N 3TTDA 1NJXA 3VEOA 3DXKB 4BGBA 4CJFA 4DV0K 3S3OA 4OJRA 4FLVA 1NLVA 2ZD1A 1KC8O 3A5MC 4HVJA 3VEZA 2JWLA 3SJJA 4AM7A 4FJLA 1ZBSA 3AGKA 3DLBA 4CF8A 3QEWA 2E8AA 4XH4A 4FWSA 1HPMA 2OPQA 1T3VA 3DRRA 4XIUA 5FRMA 4A57A 1BOTO 3GL1A 4B08A 5LJVA 5IT9O 1XMQK 5GAGP 3CIPA 4K43A 1S1WA 3O9QA 1WBBA 1ASVA 2X78A 3TAPA 2WC9A 3ULDA 2GWKA 3NF6A 1HQUA 3J81O 1WSJA 3OYIA 3UKRA 1HNZK 2UU9K 3CQ8A 1R59O 3VQ6A 5GINA 3WNGA 5KQ8A 3FZHA 4PY5A 3RMAA 3CJBA 3GDQA 1U4BA 4EHTA 3CG7A 3K9KA 1QSLA 1NGFA 4BR0A 4CESA 4JK8A 3AO2A 4NO7A 2OTLN 5FPNA 4KHYA 4CHPA 5J2NA 4JYAK 5AQWA 1C6VA 3BP8A 4RW8A 1U47A 4DF4A 3C6TA 3D6RA 1VQ7N 1B9DA 4CECA 5AQVA 4CJSA 3WNHA 3I56N 1NGAA 5M1FA 4IJAA 4GV6A 3OY9A 1ZXOA 1S72N 1X9WA 1C1BA 3Q7BA 4PL7A 3CETA 5BRFA 5KTQA 2ZE2A 3W0LA 3TAGA 3H3OB 3C6UA 4CEFA 4DG1A 1GOAA 2G8KA 3OBYA 3VF2A 1HNVA 3FZKA 4BRDA 1LOTB 4DTPA 4E7HA 3LM9A 2A1RA 2YCHA 1HJOA 2QM1A 4E7JA 2YNFA 1LW2A 3I8DA 1DT9A 2DTUA 4BC3A 3CCMN 3LP3A 1ZBFA 3L4QA 3C6AA 3UB5A 4A61A 5FPDA 4CBUA 4BRAA 3VQ8A 3T1HK 1BA1A 3VQQA 4FLZA 4CJPA 1YT3A 1EX4A 4HCBA 3H1QA 4OGCA 3CPEA 2IVPA 3CFRA 3KLIA 3FLCO 2A5XA 3FZFA 5AFUH 3NF9A 5C24A 4CZEA 2QWLA 4DLEA 4B8CA 1C1AA 3MN9A 3ZSXA 3LZJA 3D2EB 4FW1A 3LAKA 3ZSVA 2RKIA 3LALA 1L3SA 3L3UA 3HVTA 1S9GA 1HLUA 5KGXA 3AVIA 4N41A 1EXQA 2P9PB 5GIOA 2UXCK 3AGRA 1YTUA 1SKRA 3H6EA 4FO0A 1Q9YA 4IEIA 3CQXA 2W42A 5SZTA 4Z4GA 3CFOA 3CD6N 3PX6A 3V81A 3EYZA 3ZX3A 2BH1A 2A42A 4HUEA 2HF4A 1RILA 4CK1A 3ZT0A 4N5SA 4DQIA 3OVNA 1ASWA 1O13A 1X9SA 3M8SA 2QKKA 1WNSA 3K0SA 2RHKA 4CK2A 1SV5A 3O1WA 1KXPA 1UA0A 2OA8A 1JKHA 1HX1A 2NRXA 4NXMK 2UUBK 1DGKN 3SQ2A 1CZAN 4BRNA 2IIRA 4DTXA 4KV8A 2IS3A 4YOTA 3EEQA 2OTJN 1NJZA 1T6DA 3OYBA 2WOMA 4EIAA 3AVJA 5EU7A 1HKGA 1ILYA 4O8UA 4M3UA 4MLHA 4HCCA 2B5JA 4CZKA 2KZZA 4KTWA 5MLCQ 5LMNK 1XQSC 4DMNA 3QBXA 4DUZK 3CJCA 4NCGA 5EY4A 3AVMA 1L5UA 2D0BA 3EN9A 1KCFA 4H03B 4NLBA 2E2NA 4KAZA 4CE9A 3D2EA 3VF6A 4CZFA 4YOWA 4RW7A 1DTQA 4Y0WA 4JLHA 1SAZA 3VOVA 2YHWA 4UQGA 5E26A 4ICLA 3MN7A 1Q7YO 1LWCA 5AQGA 1D5AA 3FR0A 4LSLA 3PIOL 3ZX0A 5D3GA 4AHSA 4M63C 2VWJA 3EE9A 1HKCA 5K14A 1W0HA 4CIGA 2ASMA 3E66A 3ULEA 3MEEA 4OLAA 3VN5A 3A5OC 5GIPA 4N47A 1VQPN 2A41A 1KVBA 2FSJA 4M42A 4Z4CA 3LWMA 2CGKA 4GVEA 3L8BA 3P39A 3DXKA 2W6LA 3DRSA 1KAYA 1TL1A 4FJHA 4ISFA 3GBTA 4FJ8A 4FW2A 3NF7A 1OH7A 1X9MA 4DV7K 3NGYA 3PV8A 4F2SA 1NGDA 1JLBA 1RDBA 1MWMA 3OJSA 5CZ2A 3HVRA 1MU2A 2CGJA 1QZ6A 1KRPA 2DFHA 4BDPA 2E1YA 3KWIA 3T69A 1FJGK 1H1VA 4FM0A 1NKBA 4AHTA 3O3GA 2FLOA 2E6LA 2Q31A 4DTNA 4B9LA 4OKEA 5F0XA 2YX6A 1S1XA 2Z1JA 1TV6A 4NYFA 4MO5A 4YNQA 4DHYA 4FM2A 2ZQBA 4KH6A 4B8AB 4BR5A 3F73A 4AF1A 4CEOA 4M3XA 2P9KA 1NWKA 1VQ4N 5AQSA 1J5OA 5FDLA 1RNHA 4JKEA 1VSJA 3EZ5A 5AQUA 4F8RA 3ZT4A 4BE2A 1C1CA 1T6CA 3WNFA 1ITGA 3OHRA 3TSPA 1ZYQA 3CJ9A 2GWJA 3ZSWA 1RFQA 3K5NA 1EWQA 3QDKA 2X6SA 4LF4K 3HYFA 5BN9A 1J5EK 2XY7A 1L3UA 1VRUA 4NYNA 3P1GA 1EP4A 3ZSRA 4CK3A 2IDOA 1Q81O 4ILGB 3DMJA 1NK6A 4CFCA 2FSNA 4M45A 4BVPA 2YV0X 3VQ9A 4CJ3A 2P9SA 4X65K 3OA9A 3V9WA 3SLCA 3SMSA 4Z4HA 4LFBK 1XUPO 4LFAK 4FLYA 4CZLA 4DLGA 3TI0A 3SUQA 4RCHA 1U6ZA 3WXLA 2QWRA 3VENA 3CMAN 2B4JA 1KFDA 3L2UA 2V51B 4CIFA 4B3OA 3P38A 3N4QA 1OH6A 4JI8K 2FSKA 2E2PA 4IZ9A 3AVGA 4EP5A 4CEAA 3QNNA 4CHQA 3CCJN 1CLQA 4A2BA 5HP1A 1WSEA 2FBYA 3FFIA 3RSEB 4B1ZA 4B1VA 3KZBA 3OYDA 5BPLA 1YI2N 1KSPA 3HP9A 3ATUA 3A5NC 4RW6A 3D0PA 3CJAA 3LZIA 4DTSA 3S9HA 3TARA 2CGLA 1NGJA 1QVGM 3HTVA 5C12A 3MXJA 3KWGA 3MAQA 4DS4A 1WSIA 4CJ7A 4IWVA 1DLOA 1HKBA 3TTCA 4B3MK 4CEZA 1NK7A 3R8EA 2P9PA 2A40A 2YHBA 5IWAK 1X1PA 3ZETA 4WCEL 2RPIA 2JWKA 3BZCA 3OYJA 2ITGA 3T19A 1XHXA 4TSXA 1S3XA 4O0IA 4JKFA 4CIEA 3VTIA 4FWOA 3QFPA 4BR7A 4KHPK 4IFYA 2QTDA 1B92A 3AO4A 4Y1DA 2P9UB 1IBKK 3M3ZA 2ZM6K 4FJXA 3KKSA 3R1XA 1SL0A 1TK5A 2KHOA 1RT2A 4PUOA 1FKOA 4BRHA 1RTHA 4IJNA 5CZ1A 1NGCA 4KH4A 4BVOA 3BGRA 3C7NA 4FPAA 4L8RB 4CBXA 2QWMA 3DJCA 2W6KA 1IKWA 1CZBA 3THYA 4ILHA 4QS7A 2A3ZA 1BWFO 4HUGA 3ZETB 4BRPA 1A5WA 3KLFA 4FJ5A 3AVAA 3DYAA 4CJTA 2HBMA 4K8ZA 4KHSA 1RGIA 1Z05A 3F2KA 5KPZA 4KBOA 1BUPA 4C8NA 5AZJA 4FLXA 1U45A 3HJFA 2O8BB 3O5BA 4C8OA 5KPRA 2O8BA 1IBMK 4DSKA 2QEXN 4LF5K 4DV3K 3RMBA 1TAUA 3EY1A 4FLTA 4WQ4C 4FLUA 1NU0A 1RBRA 2HF3A 2NRHA 3B6PA 1WBDA 4Y1CA 3P83D 4H5VA 2HMPA 1JXEA 4KO0A 3T1AA 4KKOA 2VQEK 3B6OA 3NVKA 4O4GA 3ZT3A 4YOUA 1YJWN 3QFUA 4KI6A 4KHUA 3QO9A 2HBJA 2W41A 5GAHP 3NCIA 1RBSA 4N56A 5HBMA 4DWIA 1BG3A 3AAQA 2VG7A 1VAZA 3MEDA 2Q3SA 3VGLA 1ATRA 1VQ8N
chains in the Genus database with same CATH topology
4MQ3A 2G8KA 1TVRA 3M8PA 4CF9A 4NCBA 4E1MA 4KHWA 1HNVA 2YKMA 3P5JA 1A5VA 2IGIA 2OPRA 3LP1A 3VQ7A 4DTPA 4DQQA 3DLRA 2GBZA 1C0TA 4E7HA 2A1RA 1QSYA 2G8UA 4CGIA 4I9LA 1U04A 3VQEA 4DSEA 4E7JA 2PY5A 3PY8A 3UIQA 2IC3A 1LW2A 2YNFA 5C42A 3I8DA 3V6DA 1WSHA 2P1JA 2DTUA 2D0AA 2I5JA 1TKDA 3LP3A 1ZBFA 3O3HA 2R7YA 4DFPA 1KFSA 1RT7A 1RTDA 1Q9XA 4E0DA 4AHVA 4CF2A 3LWLA 4KTZA 3KK3A 2P51A 2KW4A 3K57A 4HHTA 4JRPA 2HHSA 3LPUA 2ATQA 3PO5A 3QERA 2WONA 3VQ8A 4DU1A 4OVLA 1NKEA 1VK0A 2VG5A 2KZMA 3VQQA 4FLZA 3SUNA 4CJPA 4B9TA 2KFZA 3H08A 4ZHRA 1BCMA 1YT3A 4CEQA 3KJVA 4IKFA 1EX4A 5FROA 1LV5A 1WAFA 4E7LA 3NH0A 1GOCA 4HCBA 4GW6A 4OGCA 4CJ4A 3CFRA 3KLIA 2FBVA 2FC0A 4E19A 4B9NA 1T8EA 3KIOA 1XI1A 2ETJA 1Q8IA 3NF9A 4CFAA 5C24A 3ZSYA 4DLEA 4B8CA 1C1AA 4AHUA 3ZSXA 4I2QA 3TR8A 4CERA 2XRIA 4FW1A 3LAKA 3LZJA 1S6PA 3M8RA 1YVUA 4LH4A 3ZSVA 4OKJA 2RKIA 3OYFA 4ZTJA 3AA3A 3VA0A 3QNOA 4E7IA 3LALA 1JXBA 1XHZA 1XC9A 1VSDA 1IKYA 1L3SA 2HMIA 3L3UA 3HVTA 2D0CA 3C95A 3I0RA 1S9GA 1IG9A 5KGXA 3IG1A 3AVIA 4N41A 3AA2A 1EXQA 2X74A 3SYZA 4J2EA 1YTUA 1SKRA 1WLJA 4AILC 1Q9YA 4CJKA 5HRSA 2W42A 5SZTA 4Z4GA 3DLHA 3VQ4A 2G8HA 3ZT2A 3TAFA 3CFOA 3WNEA 3VQAA 5KI6A 3KD1E 3RR7A 5J2PA 3PX6A 4FJNA 2OZMA 1N6QA 4Z0UA 3V81A 3EYZA 2BGGA 2D5RA 4HUEA 1UWBA 3PUFA 4DTMA 1RILA 4CK1A 3SNNA 1RBVA 3ZT0A 1K6YA 3AVBA 4N5SA 4CJEA 3L2QA 3AVNA 4LY7A 3OVNA 4DQIA 1ASWA 1RBTA 2HHQA 1X9SA 3ALYA 2F96A 1IKXA 3M8SA 4Z4FA 2QKKA 1LWFA 1WNSA 4CEEA 2YHAA 4CHYA 1TGOA 4CK2A 1RT1A 1SV5A 5HRRA 1RCHA 1UA0A 2F8SA 4E1NA 2OA8A 1JKHA 3KTQA 1VRTA 1BGXT 1WSGA 3SQ2A 3TAMA 4JRQA 3OYEA 3BDPA 1BIZA 4GMJB 3HPOA 3ZSQA 3LAMA 1BI4B 4N76A 4KRFA 3SCXA 4DTXA 1HPZA 1QS4A 2IS3A 4KV8A 4F4KA 3K58A 1NJZA 4FJKA 2IAJA 3OYBA 4KREA 2WOMA 1VSHA 3AVJA 5EU7A 2HHVA 1HNIA 1KLMA 4FK0A 4M3UA 1S6QA 3AO5A 4HCCA 2BE2A 4W5OA 3IS9A 2F8TA 2B5JA 3ZSOA 4CHNA 4Q0BA 3QIOA 2KZZA 3V9SA 4DQSA 1FXXA 4LD0A 4KTWA 4M41A 4B9VA 4FZZA 4H4MA 2HB5A 4EZ6A 4DMNA 1S1VA 4BDYA 3G0ZA 3ASMA 3OYCA 1KLNA 4NCGA 3AVMA 1L5UA 2D0BA 1KCFA 4Z4IA 3HL8A 2PZSA 4CFDA 3AVCA 4AHRA 2HNYA 4KAZA 4CE9A 2QKBA 2VWKA 3L2RA 3RRHA 4DS5A 3ITHA 1ZBUA 3QETA 1ZBIA 4RW7A 1DTQA 1RDCA 3SZ2A 4ID1A 4JLHA 3K59A 1S9EA 1IO2A 4UQGA 4M3YA 4ICLA 1T05A 3U6FA 3PO4A 1LWCA 1D5AA 4F2RA 4LSLA 2VG6A 5D3GA 4AHSA 2FBXA 1RT5A 4KB1A 2VWJA 4PWDA 4FJMA 3LPTA 1FK9A 5K14A 3M8QA 4QCLA 1BL3A 1REVA 1W0HA 4CJRA 3OYGA 4CIGA 4Z4EA 1JLGA 1RDAA 3KD5E 3U3GA 4H8KA 2Z1GA 1LWEA 4RG8A 4EP4A 4KHQA 2JLEA 3MEEA 1UOCA 3VN5A 4OLAA 3OYKA 1VSLA 4EZ9A 4N47A 4K8XA 4CJLA 3T3FA 2KFNA 3NBPA 4OPJA 4B9MA 2O4IA 3VA3A 1JLFA 4LSNA 2HHXA 1KVBA 4RW9A 3NFAA 4M42A 4FJIA 4Z4CA 2AJQA 3V1OA 3LWMA 4YFUA 3NGIA 4DSLA 5CYQA 3PX0A 4DTOA 1I3AA 4O55A 1Z25A 4DFMA 2YNHA 3F9KA 3L8BA 3SI6A 3V1RA 3OYMA 5HRPA 3DRSA 3E01A 1NK5A 4FXDA 5FRNA 1TL1A 1BISA 3ISNC 2Y1IA 1N5YA 4C8LA 4FJHA 4FJ8A 3S3NA 4FW2A 1JLCA 3NF7A 5SWMA 2JGUA 1X9MA 3KK2A 3NGYA 3ZT1A 1HJRA 1NOZA 1BQNA 3DM2A 1QE1A 3PV8A 1JLBA 2PYJA 4F2SA 3SV3A 1RDBA 3SPZA 4B9UA 3OYLA 1HQEA 3K5OA 3OJSA 3QEXA 5CZ2A 4I2PA 3HVRA 4KHNA 1MU2A 1S1UA 1NK4A 3DOLA 1WN7A 4M3RA 3OYNA 4HTUA 1SL2A 1KRPA 4ELTA 4I9QA 2DFHA 4BDPA 1I39A 4IBNA 4W5TA 4W5RA 2OZSA 2HVIA 1RT6A 4CJ5A 3HO1A 2HHTA 4CFBA 1TAQA 1S5JA 4FM0A 1T03A 3CM6A 4E3SA 4AHTA 5E41A 3O3GA 1NKBA 1CZ9A 3V1QA 1D9FA 4DFKA 1S1TA 3CYMA 2E6LA 4CGFA 1RT3A 4CHOA 4FK4A 4CEBA 3NGZA 2GUIA 2YKNA 3O4QA 3HT3A 4DTNA 4OKEA 4B9LA 3DOKA 3TAQA 4O44A 1ZBLA 3NH1A 4FK2A 3A2FA 2Z1JA 3AVLA 1S1XA 3LDSA 1SUQA 1TV6A 4NYFA 1BQMA 4CJQA 4YNQA 4KPYA 2RF2A 4DTRA 1TK0A 4FM2A 2ZQBA 4NCAA 4B8AB 2PYLA 3SUPA 3TANA 3F73A 4M3XA 4CEOA 4FM1A 4BWMA 2HHUA 1RDDA 3S3MA 4MFBA 3NF8A 3NDKA 5FDLA 3D45A 4IG0A 1YTAA 1J5OA 1RNHA 3OS2A 4F3OA 1G15A 1KVCA 1VSJA 3EZ5A 4AH9A 4O0JA 4F8RA 3ZT4A 3L2VA 4BE2A 1C1CA 3DI6A 4PQUA 1KVAA 1J9AA 3DLKA 3WNFA 1ITGA 2XY6A 1JL1A 3O4NA 1HYVA 1ZYQA 5I42A 1LAWA 3G10A 4F3TA 4C8MA 3QLHA 3AO1A 3ZSWA 3HP6A 2HW3A 3L2WA 4LH5A 3OS0A 4DSFA 3SQ0A 4CCHA 4M3WA 1RT4A 4IG3A 3SQ1A 3K5NA 2X6SA 3HYFA 1GOBA 5J2QA 1EETA 5DMRA 1NKCA 2B6AA 4ELVA 3VQPA 2XY7A 4QAGA 1VRUA 1L3UA 2HNZA 4NYNA 3HK2A 1HYZA 1EP4A 1IH7A 3P1GA 3ZSRA 2IDOA 4E89A 4CK3A 3MXMA 1L3TA 5T7BA 3RWUA 1W9HA 1HYSA 4DU4A 3HM9A 1NK8A 3HPHA 4J2DA 1RTJA 4CEDA 3QESA 4DSIA 3DMJA 1VSEA 1EKEA 1NK6A 4CFCA 4M45A 2Y1JA 4J2BA 2RN2A 2YV0X 3AV9A 4PA1A 3ZSZA 5C25A 3VQ9A 4W5NA 1C0MA 3RTVA 4IFVA 2Z1HA 5KRTA 5J1EA 1NK0A 1JLEA 3HPGA 1Y97A 4O5BA 4CJ3A 5J2MA 2G8FA 4KI4A 4DFJA 3V9WA 1UA1A 3RR8A 1DTTA 1NOYA 2KQ2A 4ID5A 4Z4HA 1TL3A 4FLYA 4CF1A 4DSJA 3V9ZA 3SPYA 4DLGA 3TI0A 3SUQA 2HNDA 3VQDA 4KTQA 4HUFA 3O3FA 3MECA 3AA5X 2LSNA 2XY5A 4JS4A 1HMVA 3QINA 1RBUA 3K5MA 3MXIA 3AO3A 3OYHA 1R0AA 1NJYA 2G8IA 4CJUA 2XO7A 3K5LA 1L3VA 2KTQA 4BACA 2XY8A 1NK9A 2B4JA 1KFDA 4FZXC 3DLGA 3L2UA 3K2PA 3KLGA 2FBTA 4CIFA 3V9XA 4B3OA 1IKVA 2EX3A 3AVHA 4BE0A 1NJWA 3I0SA 1QSSA 1C0UA 2G8VA 2QK9A 3RMDA 2XHBA 3LP2A 5JS1A 3AVGA 5JS2A 4EP5A 4KFBA 4CEAA 3VQCA 1UAXA 3QNNA 1TKZA 4BWJA 4CHQA 1CLQA 1RTIA 3JYTA 5HP1A 1WSEA 4FLWA 2FBYA 3FFIA 4FJ9A 2G8WA 3NH2A 3SQ4A 2GV9A 2O4GA 4RW4A 1KTQA 2OYQA 3OYDA 3PX4A 1KSPA 3HP9A 3JSMA 4DTUA 1QHTA 3RMCA 4RW6A 3D0PA 3LZIA 4DTSA 3S9HA 3TARA 5I3UA 3TAEA 1D8YA 2OPPA 3CFPA 3NE6A 3MXJA 3MAQA 2IOCA 2BDPA 4DS4A 1Z26A 3AVKA 1ASUA 1WSIA 3DLEA 3OJUA 3HSTB 1DLOA 4CGJA 4BDZA 4B9SA 4M3TA 4FJ7A 2BANA 1A5XA 3QEVA 1XWLA 4CEZA 5KRSA 1NK7A 2QXFA 1QQCA 3V4IA 5DK5A 3SV4A 2YHBA 5HRNA 2DY4A 1X1PA 3TABA 1SKWA 4I7FA 2RPIA 2OPSA 3RRGA 3OYJA 4DQPA 3THVA 4M3ZA 5CY4A 3NAEA 2ITGA 4H4OA 3T19A 4R5PA 4WE1A 3QEIA 4BE1A 1XHXA 4TSXA 4O0IA 4OGEA 4CIEA 1O1WA 3NHGA 3U3YA 1BIUA 4C8KA 4QOZB 1TKXA 2Z1IA 4IFYA 1SL1A 3TWHA 3KLEA 3C94A 1NJXA 4KB0A 1B92A 3AO4A 4DU3A 1BHLA 4CJFA 4DQRA 1FKPA 4OJRA 3S3OA 4Y1DA 1J54A 3L3VA 3OS1A 4FLVA 2ZD1A 4CJVA 1VSKA 1B9FA 4HVJA 1U49A 4FJXA 3SJJA 3KKSA 2P5GA 4FJLA 3ZCMA 3DLBA 1VSFA 2X6NA 4CF8A 3QEWA 1SL0A 1TK5A 2OPQA 3DRRA 1JLAA 4XIUA 1RT2A 5FRMA 4PUOA 1FKOA 4B08A 2EHGA 1GOAA 1WAJA 1RTHA 5CZ1A 2YNGA 3BGRA 1TK8A 1S1WA 4AHCA 1T7PA 1SKSA 4FCYA 4L8RB 1ASVA 3AA4A 2X78A 1BCOA 4OPKA 3ULDA 3QIPA 3TAPA 3NF6A 4CGHA 3SUOA 1HQUA 1VSMA 1IKWA 1WSJA 1CZBA 3OYIA 1CXUA 4J2AA 3CQ8A 2HVHA 3LP0A 3OYAA 1J53A 4HUGA 4ZTFA 3VQ6A 4FZYA 4FYDA 3WNGA 1LAVA 1F21A 1VSIA 1U48A 1JLQA 4PY5A 3RMAA 1HRHA 3VQBA 1A5WA 3KLFA 1U4BA 4FJ5A 5CYMA 3KK1A 3HXMA 3AVAA 3DYAA 4JS5A 3CG7A 4CF0A 4CJTA 1QSLA 1LW0A 4K8ZA 4CESA 4KHSA 3AO2A 3LANA 4FJGA 2E4LA 1BI4A 1CXQA 4KHYA 4C8NA 3HJFA 4FLXA 4IDKA 4CHZA 4CHPA 1U45A 5J2NA 4C8OA 4ELUA 4FJJA 2HHWA 1C6VA 4DTJA 4OLBA 1JL2A 4RW8A 1U47A 3MEGA 4DF4A 3AVFA 3C6TA 4DSKA 1TAUA 1B9DA 5KGWA 3RMBA 4CECA 3EY1A 4FLTA 2NUBA 3V9UA 4FLUA 3WNHA 4OKKA 4CJSA 1RBRA 3B6PA 4CGGA 4Y1CA 2DFEA 3P83D 3OY9A 1JXEA 4KO0A 1ZBHA 3T1AA 4KKOA 3B6OA 4DF8A 4O4GA 3ZT3A 1X9WA 1C1BA 4G1QA 4KI6A 4KHUA 1TKTA 3QO9A 4CJWA 1QTMA 2YNIA 3CM5A 3VQ5A 4E7KA 4GVMA 3NCIA 4CGDA 5KTQA 2ZE2A 3KKRA 1WSFA 3DRPA 1RBSA 4N56A 2P5OA 5HBMA 3IRXA 2E6MA 3TAGA 4DWIA 1D9DA 3IAYA 2VG7A 4Q5VA 3C6UA 4W5QA 3KLHA 3QEPA 5HROA 3MEDA 2Q3SA 4FVMA 4CEFA 4DG1A 2A1SA 2DFFA 5HLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ3 A;  2G8K A;  1TVR A;  3M8P A;  4CF9 A;  4NCB A;  4E1M A;  4KHW A;  1HNV A;  2YKM A;  3P5J A;  1A5V A;  2IGI A;  2OPR A;  3LP1 A;  3VQ7 A;  4DTP A;  4DQQ A;  3DLR A;  2GBZ A;  1C0T A;  4E7H A;  2A1R A;  1QSY A;  2G8U A;  4CGI A;  4I9L A;  1U04 A;  3VQE A;  4DSE A;  4E7J A;  2PY5 A;  3PY8 A;  3UIQ A;  2IC3 A;  1LW2 A;  2YNF A;  5C42 A;  3I8D A;  3V6D A;  1WSH A;  2P1J A;  2DTU A;  2D0A A;  2I5J A;  1TKD A;  3LP3 A;  1ZBF A;  3O3H A;  2R7Y A;  4DFP A;  1KFS A;  1RT7 A;  1RTD A;  1Q9X A;  4E0D A;  4AHV A;  4CF2 A;  3LWL A;  4KTZ A;  3KK3 A;  2P51 A;  2KW4 A;  3K57 A;  4HHT A;  4JRP A;  2HHS A;  3LPU A;  2ATQ A;  3PO5 A;  3QER A;  2WON A;  3VQ8 A;  4DU1 A;  4OVL A;  1NKE A;  1VK0 A;  2VG5 A;  2KZM A;  3VQQ A;  4FLZ A;  3SUN A;  4CJP A;  4B9T A;  2KFZ A;  3H08 A;  4ZHR A;  1BCM A;  1YT3 A;  4CEQ A;  3KJV A;  4IKF A;  1EX4 A;  5FRO A;  1LV5 A;  1WAF A;  4E7L A;  3NH0 A;  1GOC A;  4HCB A;  4GW6 A;  4OGC A;  4CJ4 A;  3CFR A;  3KLI A;  2FBV A;  2FC0 A;  4E19 A;  4B9N A;  1T8E A;  3KIO A;  1XI1 A;  2ETJ A;  1Q8I A;  3NF9 A;  4CFA A;  5C24 A;  3ZSY A;  4DLE A;  4B8C A;  1C1A A;  4AHU A;  3ZSX A;  4I2Q A;  3TR8 A;  4CER A;  2XRI A;  4FW1 A;  3LAK A;  3LZJ A;  1S6P A;  3M8R A;  1YVU A;  4LH4 A;  3ZSV A;  4OKJ A;  2RKI A;  3OYF A;  4ZTJ A;  3AA3 A;  3VA0 A;  3QNO A;  4E7I A;  3LAL A;  1JXB A;  1XHZ A;  1XC9 A;  1VSD A;  1IKY A;  1L3S A;  2HMI A;  3L3U A;  3HVT A;  2D0C A;  3C95 A;  3I0R A;  1S9G A;  1IG9 A;  5KGX A;  3IG1 A;  3AVI A;  4N41 A;  3AA2 A;  1EXQ A;  2X74 A;  3SYZ A;  4J2E A;  1YTU A;  1SKR A;  1WLJ A;  4AIL C;  1Q9Y A;  4CJK A;  5HRS A;  2W42 A;  5SZT A;  4Z4G A;  3DLH A;  3VQ4 A;  2G8H A;  3ZT2 A;  3TAF A;  3CFO A;  3WNE A;  3VQA A;  5KI6 A;  3KD1 E;  3RR7 A;  5J2P A;  3PX6 A;  4FJN A;  2OZM A;  1N6Q A;  4Z0U A;  3V81 A;  3EYZ A;  2BGG A;  2D5R A;  4HUE A;  1UWB A;  3PUF A;  4DTM A;  1RIL A;  4CK1 A;  3SNN A;  1RBV A;  3ZT0 A;  1K6Y A;  3AVB A;  4N5S A;  4CJE A;  3L2Q A;  3AVN A;  4LY7 A;  3OVN A;  4DQI A;  1ASW A;  1RBT A;  2HHQ A;  1X9S A;  3ALY A;  2F96 A;  1IKX A;  3M8S A;  4Z4F A;  2QKK A;  1LWF A;  1WNS A;  4CEE A;  2YHA A;  4CHY A;  1TGO A;  4CK2 A;  1RT1 A;  1SV5 A;  5HRR A;  1RCH A;  1UA0 A;  2F8S A;  4E1N A;  2OA8 A;  1JKH A;  3KTQ A;  1VRT A;  1BGX T;  1WSG A;  3SQ2 A;  3TAM A;  4JRQ A;  3OYE A;  3BDP A;  1BIZ A;  4GMJ B;  3HPO A;  3ZSQ A;  3LAM A;  1BI4 B;  4N76 A;  4KRF A;  3SCX A;  4DTX A;  1HPZ A;  1QS4 A;  2IS3 A;  4KV8 A;  4F4K A;  3K58 A;  1NJZ A;  4FJK A;  2IAJ A;  3OYB A;  4KRE A;  2WOM A;  1VSH A;  3AVJ A;  5EU7 A;  2HHV A;  1HNI A;  1KLM A;  4FK0 A;  4M3U A;  1S6Q A;  3AO5 A;  4HCC A;  2BE2 A;  4W5O A;  3IS9 A;  2F8T A;  2B5J A;  3ZSO A;  4CHN A;  4Q0B A;  3QIO A;  2KZZ A;  3V9S A;  4DQS A;  1FXX A;  4LD0 A;  4KTW A;  4M41 A;  4B9V A;  4FZZ A;  4H4M A;  2HB5 A;  4EZ6 A;  4DMN A;  1S1V A;  4BDY A;  3G0Z A;  3ASM A;  3OYC A;  1KLN A;  4NCG A;  3AVM A;  1L5U A;  2D0B A;  1KCF A;  4Z4I A;  3HL8 A;  2PZS A;  4CFD A;  3AVC A;  4AHR A;  2HNY A;  4KAZ A;  4CE9 A;  2QKB A;  2VWK A;  3L2R A;  3RRH A;  4DS5 A;  3ITH A;  1ZBU A;  3QET A;  1ZBI A;  4RW7 A;  1DTQ A;  1RDC A;  3SZ2 A;  4ID1 A;  4JLH A;  3K59 A;  1S9E A;  1IO2 A;  4UQG A;  4M3Y A;  4ICL A;  1T05 A;  3U6F A;  3PO4 A;  1LWC A;  1D5A A;  4F2R A;  4LSL A;  2VG6 A;  5D3G A;  4AHS A;  2FBX A;  1RT5 A;  4KB1 A;  2VWJ A;  4PWD A;  4FJM A;  3LPT A;  1FK9 A;  5K14 A;  3M8Q A;  4QCL A;  1BL3 A;  1REV A;  1W0H A;  4CJR A;  3OYG A;  4CIG A;  4Z4E A;  1JLG A;  1RDA A;  3KD5 E;  3U3G A;  4H8K A;  2Z1G A;  1LWE A;  4RG8 A;  4EP4 A;  4KHQ A;  2JLE A;  3MEE A;  1UOC A;  3VN5 A;  4OLA A;  3OYK A;  1VSL A;  4EZ9 A;  4N47 A;  4K8X A;  4CJL A;  3T3F A;  2KFN A;  3NBP A;  4OPJ A;  4B9M A;  2O4I A;  3VA3 A;  1JLF A;  4LSN A;  2HHX A;  1KVB A;  4RW9 A;  3NFA A;  4M42 A;  4FJI A;  4Z4C A;  2AJQ A;  3V1O A;  3LWM A;  4YFU A;  3NGI A;  4DSL A;  5CYQ A;  3PX0 A;  4DTO A;  1I3A A;  4O55 A;  1Z25 A;  4DFM A;  2YNH A;  3F9K A;  3L8B A;  3SI6 A;  3V1R A;  3OYM A;  5HRP A;  3DRS A;  3E01 A;  1NK5 A;  4FXD A;  5FRN A;  1TL1 A;  1BIS A;  3ISN C;  2Y1I A;  1N5Y A;  4C8L A;  4FJH A;  4FJ8 A;  3S3N A;  4FW2 A;  1JLC A;  3NF7 A;  5SWM A;  2JGU A;  1X9M A;  3KK2 A;  3NGY A;  3ZT1 A;  1HJR A;  1NOZ A;  1BQN A;  3DM2 A;  1QE1 A;  3PV8 A;  1JLB A;  2PYJ A;  4F2S A;  3SV3 A;  1RDB A;  3SPZ A;  4B9U A;  3OYL A;  1HQE A;  3K5O A;  3OJS A;  3QEX A;  5CZ2 A;  4I2P A;  3HVR A;  4KHN A;  1MU2 A;  1S1U A;  1NK4 A;  3DOL A;  1WN7 A;  4M3R A;  3OYN A;  4HTU A;  1SL2 A;  1KRP A;  4ELT A;  4I9Q A;  2DFH A;  4BDP A;  1I39 A;  4IBN A;  4W5T A;  4W5R A;  2OZS A;  2HVI A;  1RT6 A;  4CJ5 A;  3HO1 A;  2HHT A;  4CFB A;  1TAQ A;  1S5J A;  4FM0 A;  1T03 A;  3CM6 A;  4E3S A;  4AHT A;  5E41 A;  3O3G A;  1NKB A;  1CZ9 A;  3V1Q A;  1D9F A;  4DFK A;  1S1T A;  3CYM A;  2E6L A;  4CGF A;  1RT3 A;  4CHO A;  4FK4 A;  4CEB A;  3NGZ A;  2GUI A;  2YKN A;  3O4Q A;  3HT3 A;  4DTN A;  4OKE A;  4B9L A;  3DOK A;  3TAQ A;  4O44 A;  1ZBL A;  3NH1 A;  4FK2 A;  3A2F A;  2Z1J A;  3AVL A;  1S1X A;  3LDS A;  1SUQ A;  1TV6 A;  4NYF A;  1BQM A;  4CJQ A;  4YNQ A;  4KPY A;  2RF2 A;  4DTR A;  1TK0 A;  4FM2 A;  2ZQB A;  4NCA A;  4B8A B;  2PYL A;  3SUP A;  3TAN A;  3F73 A;  4M3X A;  4CEO A;  4FM1 A;  4BWM A;  2HHU A;  1RDD A;  3S3M A;  4MFB A;  3NF8 A;  3NDK A;  5FDL A;  3D45 A;  4IG0 A;  1YTA A;  1J5O A;  1RNH A;  3OS2 A;  4F3O A;  1G15 A;  1KVC A;  1VSJ A;  3EZ5 A;  4AH9 A;  4O0J A;  4F8R A;  3ZT4 A;  3L2V A;  4BE2 A;  1C1C A;  3DI6 A;  4PQU A;  1KVA A;  1J9A A;  3DLK A;  3WNF A;  1ITG A;  2XY6 A;  1JL1 A;  3O4N A;  1HYV A;  1ZYQ A;  5I42 A;  1LAW A;  3G10 A;  4F3T A;  4C8M A;  3QLH A;  3AO1 A;  3ZSW A;  3HP6 A;  2HW3 A;  3L2W A;  4LH5 A;  3OS0 A;  4DSF A;  3SQ0 A;  4CCH A;  4M3W A;  1RT4 A;  4IG3 A;  3SQ1 A;  3K5N A;  2X6S A;  3HYF A;  1GOB A;  5J2Q A;  1EET A;  5DMR A;  1NKC A;  2B6A A;  4ELV A;  3VQP A;  2XY7 A;  4QAG A;  1VRU A;  1L3U A;  2HNZ A;  4NYN A;  3HK2 A;  1HYZ A;  1EP4 A;  1IH7 A;  3P1G A;  3ZSR A;  2IDO A;  4E89 A;  4CK3 A;  3MXM A;  1L3T A;  5T7B A;  3RWU A;  1W9H A;  1HYS A;  4DU4 A;  3HM9 A;  1NK8 A;  3HPH A;  4J2D A;  1RTJ A;  4CED A;  3QES A;  4DSI A;  3DMJ A;  1VSE A;  1EKE A;  1NK6 A;  4CFC A;  4M45 A;  2Y1J A;  4J2B A;  2RN2 A;  2YV0 X;  3AV9 A;  4PA1 A;  3ZSZ A;  5C25 A;  3VQ9 A;  4W5N A;  1C0M A;  3RTV A;  4IFV A;  2Z1H A;  5KRT A;  5J1E A;  1NK0 A;  1JLE A;  3HPG A;  1Y97 A;  4O5B A;  4CJ3 A;  5J2M A;  2G8F A;  4KI4 A;  4DFJ A;  3V9W A;  1UA1 A;  3RR8 A;  1DTT A;  1NOY A;  2KQ2 A;  4ID5 A;  4Z4H A;  1TL3 A;  4FLY A;  4CF1 A;  4DSJ A;  3V9Z A;  3SPY A;  4DLG A;  3TI0 A;  3SUQ A;  2HND A;  3VQD A;  4KTQ A;  4HUF A;  3O3F A;  3MEC A;  3AA5 X;  2LSN A;  2XY5 A;  4JS4 A;  1HMV A;  3QIN A;  1RBU A;  3K5M A;  3MXI A;  3AO3 A;  3OYH A;  1R0A A;  1NJY A;  2G8I A;  4CJU A;  2XO7 A;  3K5L A;  1L3V A;  2KTQ A;  4BAC A;  2XY8 A;  1NK9 A;  2B4J A;  1KFD A;  4FZX C;  3DLG A;  3L2U A;  3K2P A;  3KLG A;  2FBT A;  4CIF A;  3V9X A;  4B3O A;  1IKV A;  2EX3 A;  3AVH A;  4BE0 A;  1NJW A;  3I0S A;  1QSS A;  1C0U A;  2G8V A;  2QK9 A;  3RMD A;  2XHB A;  3LP2 A;  5JS1 A;  3AVG A;  5JS2 A;  4EP5 A;  4KFB A;  4CEA A;  3VQC A;  1UAX A;  3QNN A;  1TKZ A;  4BWJ A;  4CHQ A;  1CLQ A;  1RTI A;  3JYT A;  5HP1 A;  1WSE A;  4FLW A;  2FBY A;  3FFI A;  4FJ9 A;  2G8W A;  3NH2 A;  3SQ4 A;  2GV9 A;  2O4G A;  4RW4 A;  1KTQ A;  2OYQ A;  3OYD A;  3PX4 A;  1KSP A;  3HP9 A;  3JSM A;  4DTU A;  1QHT A;  3RMC A;  4RW6 A;  3D0P A;  3LZI A;  4DTS A;  3S9H A;  3TAR A;  5I3U A;  3TAE A;  1D8Y A;  2OPP A;  3CFP A;  3NE6 A;  3MXJ A;  3MAQ A;  2IOC A;  2BDP A;  4DS4 A;  1Z26 A;  3AVK A;  1ASU A;  1WSI A;  3DLE A;  3OJU A;  3HST B;  1DLO A;  4CGJ A;  4BDZ A;  4B9S A;  4M3T A;  4FJ7 A;  2BAN A;  1A5X A;  3QEV A;  1XWL A;  4CEZ A;  5KRS A;  1NK7 A;  2QXF A;  1QQC A;  3V4I A;  5DK5 A;  3SV4 A;  2YHB A;  5HRN A;  2DY4 A;  1X1P A;  3TAB A;  1SKW A;  4I7F A;  2RPI A;  2OPS A;  3RRG A;  3OYJ A;  4DQP A;  3THV A;  4M3Z A;  5CY4 A;  3NAE A;  2ITG A;  4H4O A;  3T19 A;  4R5P A;  4WE1 A;  3QEI A;  4BE1 A;  1XHX A;  4TSX A;  4O0I A;  4OGE A;  4CIE A;  1O1W A;  3NHG A;  3U3Y A;  1BIU A;  4C8K A;  4QOZ B;  1TKX A;  2Z1I A;  4IFY A;  1SL1 A;  3TWH A;  3KLE A;  3C94 A;  1NJX A;  4KB0 A;  1B92 A;  3AO4 A;  4DU3 A;  1BHL A;  4CJF A;  4DQR A;  1FKP A;  4OJR A;  3S3O A;  4Y1D A;  1J54 A;  3L3V A;  3OS1 A;  4FLV A;  2ZD1 A;  4CJV A;  1VSK A;  1B9F A;  4HVJ A;  1U49 A;  4FJX A;  3SJJ A;  3KKS A;  2P5G A;  4FJL A;  3ZCM A;  3DLB A;  1VSF A;  2X6N A;  4CF8 A;  3QEW A;  1SL0 A;  1TK5 A;  2OPQ A;  3DRR A;  1JLA A;  4XIU A;  1RT2 A;  5FRM A;  4PUO A;  1FKO A;  4B08 A;  2EHG A;  1GOA A;  1WAJ A;  1RTH A;  5CZ1 A;  2YNG A;  3BGR A;  1TK8 A;  1S1W A;  4AHC A;  1T7P A;  1SKS A;  4FCY A;  4L8R B;  1ASV A;  3AA4 A;  2X78 A;  1BCO A;  4OPK A;  3ULD A;  3QIP A;  3TAP A;  3NF6 A;  4CGH A;  3SUO A;  1HQU A;  1VSM A;  1IKW A;  1WSJ A;  1CZB A;  3OYI A;  1CXU A;  4J2A A;  3CQ8 A;  2HVH A;  3LP0 A;  3OYA A;  1J53 A;  4HUG A;  4ZTF A;  3VQ6 A;  4FZY A;  4FYD A;  3WNG A;  1LAV A;  1F21 A;  1VSI A;  1U48 A;  1JLQ A;  4PY5 A;  3RMA A;  1HRH A;  3VQB A;  1A5W A;  3KLF A;  1U4B A;  4FJ5 A;  5CYM A;  3KK1 A;  3HXM A;  3AVA A;  3DYA A;  4JS5 A;  3CG7 A;  4CF0 A;  4CJT A;  1QSL A;  1LW0 A;  4K8Z A;  4CES A;  4KHS A;  3AO2 A;  3LAN A;  4FJG A;  2E4L A;  1BI4 A;  1CXQ A;  4KHY A;  4C8N A;  3HJF A;  4FLX A;  4IDK A;  4CHZ A;  4CHP A;  1U45 A;  5J2N A;  4C8O A;  4ELU A;  4FJJ A;  2HHW A;  1C6V A;  4DTJ A;  4OLB A;  1JL2 A;  4RW8 A;  1U47 A;  3MEG A;  4DF4 A;  3AVF A;  3C6T A;  4DSK A;  1TAU A;  1B9D A;  5KGW A;  3RMB A;  4CEC A;  3EY1 A;  4FLT A;  2NUB A;  3V9U A;  4FLU A;  3WNH A;  4OKK A;  4CJS A;  1RBR A;  3B6P A;  4CGG A;  4Y1C A;  2DFE A;  3P83 D;  3OY9 A;  1JXE A;  4KO0 A;  1ZBH A;  3T1A A;  4KKO A;  3B6O A;  4DF8 A;  4O4G A;  3ZT3 A;  1X9W A;  1C1B A;  4G1Q A;  4KI6 A;  4KHU A;  1TKT A;  3QO9 A;  4CJW A;  1QTM A;  2YNI A;  3CM5 A;  3VQ5 A;  4E7K A;  4GVM A;  3NCI A;  4CGD A;  5KTQ A;  2ZE2 A;  3KKR A;  1WSF A;  3DRP A;  1RBS A;  4N56 A;  2P5O A;  5HBM A;  3IRX A;  2E6M A;  3TAG A;  4DWI A;  1D9D A;  3IAY A;  2VG7 A;  4Q5V A;  3C6U A;  4W5Q A;  3KLH A;  3QEP A;  5HRO A;  3MED A;  2Q3S A;  4FVM A;  4CEF A;  4DG1 A;  2A1S A;  2DFF A;  5HLF A; 
#chains in the Genus database with same CATH topology
 3GE1 A;  3M8P A;  3SAF A;  4CD1 A;  2V52 B;  4FOI A;  4KHW A;  2YKM A;  1A5V A;  1OKJ A;  2HBL A;  1IBL K;  2G8U A;  2IVO A;  2PY5 A;  4FOE A;  3F9M A;  4HWI A;  3V6D A;  1WSH A;  2P1J A;  3MK6 A;  2I5J A;  4H0X B;  2P9U A;  5FPE A;  1RT7 A;  3VPZ A;  1Q18 A;  4KTZ A;  1J6Z A;  4BQL A;  2P51 A;  4HHT A;  1SZ2 A;  4JRP A;  1Y64 A;  3LPU A;  3FFK B;  1WB9 A;  3QER A;  4DU1 A;  1W97 L;  4KH5 A;  2VG5 A;  3SUN A;  2P9N A;  2P9I B;  3MCA B;  3H08 A;  3NMU A;  3TSU A;  4OO1 J;  1LV5 A;  5JVH L;  4E7L A;  1GOC A;  4CJ4 A;  1HR0 K;  4EHU A;  4EFH A;  2YI1 A;  5ADX A;  3CER A;  4JKD A;  4CZH A;  4M7Y A;  2FC0 A;  5AQN A;  4PKI A;  3ZEU B;  3ZSY A;  3TR8 A;  5CHI A;  3OYF A;  5M1N A;  1E3M A;  2D0C A;  3I0R A;  3J7A P;  4JI7 K;  4NLC A;  3AA2 A;  2Q0U A;  4ISG A;  3LL3 A;  5HRS A;  4H5R A;  3VQ4 A;  2G8H A;  3TAF A;  3C7N B;  2UXD K;  1YF5 L;  3UKU A;  2OZM A;  1N6Q A;  3VGM A;  2D5R A;  4YHH K;  3L2Q A;  1K6Y A;  3AVB A;  4CJE A;  4Z4F A;  4CEE A;  3TPQ A;  4CHY A;  4O8K A;  4QS9 A;  4E1N A;  5LY3 A;  2ZJR L;  1WSG A;  2Q0R A;  3TAM A;  1NBW A;  1OVY A;  3HPO A;  3LAM A;  1BI4 B;  1YUW A;  3EO3 A;  4C1N K;  4DCH A;  3DLL L;  4DV2 K;  2ZWH A;  4FK0 A;  1S6Q A;  3AO5 A;  2BE2 A;  3PLA A;  3IKM A;  5F1X A;  4Q0B A;  4CHN A;  4FWQ A;  3A0I X;  3VF4 A;  1FXX A;  4LD0 A;  2GX9 A;  3ASM A;  3OYC A;  1KLN A;  1GLE G;  2P9S B;  3ZEU A;  2PZS A;  4DQ8 A;  4AHR A;  3M1F A;  4WFA L;  4CZM A;  4U7B A;  4DS5 A;  4JV5 K;  1ZBI A;  1RDC A;  4C23 A;  1S9E A;  1IO2 A;  1T05 A;  2WTU A;  2VG6 A;  2FBX A;  4FJM A;  3F5T A;  4CZJ A;  4DR6 K;  4OPH A;  3M8Q A;  1REV A;  4YDU A;  1RDA A;  3KD5 E;  4H8K A;  2Z1G A;  1LWE A;  4RG8 A;  1JCF A;  4EP4 A;  2ASP A;  4LFC K;  2JLE A;  4KHQ A;  4EZ9 A;  4CJL A;  2KFN A;  3A5L C;  3NBP A;  3R3L A;  2O4I A;  2Q1N A;  3VA3 A;  1JLF A;  2PFU A;  4RW9 A;  3NFA A;  3OBW A;  3ULE B;  4FJI A;  3CCV N;  2AJQ A;  4DSL A;  4YFU A;  3NGI A;  4LF9 K;  4O55 A;  4DFM A;  3THW B;  4FWM A;  1NK5 A;  4FXD A;  2Y1I A;  4C8L A;  4FSV A;  5SWM A;  2JGU A;  2VWB A;  4GKJ K;  1C0G A;  5AQP A;  3O8M A;  3IDH A;  1NOZ A;  4JD2 A;  1BQN A;  3PIP L;  2PYJ A;  1EO1 A;  3M6G A;  5I9E B;  4LF6 K;  2E2Q A;  3OYL A;  1XC3 A;  3SAG A;  1HQE A;  4WYB A;  2UUA K;  3GG4 A;  1S1U A;  3LDQ A;  1WN7 A;  3OYN A;  4ELT A;  4I9Q A;  4JI3 K;  3CC2 N;  2OZS A;  2J4R A;  1MDU B;  4CFB A;  1TAQ A;  1S5J A;  4E3S A;  4IDH A;  4BG8 A;  4CHO A;  4FK4 A;  3DOK A;  2FF6 A;  1ZBL A;  5AQT A;  5BR9 A;  3DXM A;  3A2F A;  3LDS A;  1SUQ A;  4CJQ A;  4KPY A;  2PYL A;  4IOX A;  3SUP A;  2I7P A;  3TAN A;  1NNE A;  3MDQ A;  1RDD A;  3NDK A;  1YTA A;  3OS2 A;  4F3O A;  3G6E N;  1KVC A;  2O8E A;  4O0J A;  1SS6 A;  4PQU A;  3DI6 A;  2XY6 A;  3R6M A;  4A5A A;  2Q36 A;  4H0P A;  4OPA A;  4DV5 K;  4F3T A;  3O9T A;  3QLH A;  1W7A A;  3AO1 A;  2QW9 A;  4JI5 K;  2HW3 A;  4CCH A;  1YXQ A;  3OS0 A;  4DSF A;  4M3W A;  3SQ1 A;  4ISE A;  5DMR A;  4QAG A;  2HNZ A;  3ATV A;  3HK2 A;  1IH7 A;  3EZW A;  3RWU A;  3FE1 A;  3MXM A;  1L3T A;  1NK8 A;  3HPH A;  3SK3 A;  2IVN A;  1RTJ A;  4J2D A;  4BQZ A;  4WFN L;  3QES A;  4DSI A;  2ZGY A;  3SBG A;  1VSE A;  5AQF A;  5JLH A;  5C25 A;  1G99 A;  2Z1H A;  1X9J A;  5J1E A;  1NK0 A;  3HPG A;  4KI4 A;  5EVZ A;  4IFE A;  2KQ2 A;  4ID5 A;  1TL3 A;  1DEJ A;  4CF1 A;  3SPY A;  4BY9 C;  4CZG A;  4JS4 A;  1HMV A;  2W40 A;  1RBU A;  1NJY A;  3AO3 A;  4CJU A;  1KD1 O;  4BAC A;  5CR4 A;  4B3T K;  4PHT X;  2FBT A;  1IKV A;  4CZI A;  2EX3 A;  4K25 A;  1NJW A;  2G8V A;  4K42 A;  2XHB A;  5JS1 A;  5DM6 L;  3OTO K;  5JS2 A;  4KFB A;  3VQC A;  4BWJ A;  5AQO A;  4FLW A;  2NZT A;  4FJ9 A;  4YOV A;  5JIC A;  1QHT A;  3VEV A;  4FVU A;  3A8Y A;  3H46 O;  4BG9 A;  2E1Z A;  3O1B A;  5I3U A;  1YIJ N;  3CFP A;  4MDB A;  5DM7 L;  4H5W A;  5JVG L;  1ASU A;  4B9S A;  3HST B;  4WF9 L;  3CME N;  4M3T A;  4FJ7 A;  4DR4 K;  1A5X A;  4PKG A;  1N8R O;  3V4I A;  5DK5 A;  3SV4 A;  1P90 A;  5H1S Q;  4I7F A;  2GEL A;  2QWO A;  1K9M O;  2OPS A;  3WXI A;  4DR7 K;  5CY4 A;  3ENO A;  3NAE A;  2BTF A;  4WE1 A;  4BE1 A;  4BRQ A;  3U3Y A;  1BIU A;  4C8K A;  2Z1I A;  5E84 A;  1QQN A;  1SL1 A;  3B8A X;  3KLE A;  4BR9 A;  5C2F A;  4DQR A;  4JAX A;  3L3V A;  5BRD A;  4CD3 A;  1B9F A;  2P5G A;  2X6N A;  4JI1 K;  4E1J A;  1JLA A;  2VGM A;  3BUZ B;  3Q7C A;  1WAJ A;  5AQM A;  5KQD A;  1T7P A;  1VQK N;  4FCY A;  3WXM B;  1M1K O;  3AA4 A;  4LC9 B;  3QIP A;  1BU6 O;  3O6W A;  1CXU A;  3LP0 A;  3OYA A;  1J53 A;  4ZTF A;  3CF5 L;  2OCE A;  4FYD A;  1HUX A;  1F21 A;  4XEI A;  1JLQ A;  3J7Y P;  3LDN A;  3THY B;  4FWP A;  5AQL A;  4GNI A;  3KK1 A;  3VMF B;  4CF0 A;  1LW0 A;  3H45 C;  1DKG D;  4YOR A;  2E4L A;  4IDK A;  4ELU A;  5A2Q O;  3BF1 A;  1LCU A;  4XH1 A;  3THX A;  3VES A;  4OLB A;  4YOX A;  3EKS A;  3MEG A;  4I6M A;  5KGW A;  1YJ9 N;  1QVF M;  4LF7 K;  2F4V K;  3CCL N;  3I55 N;  4CI6 A;  4RWT A;  2QXL A;  1NMN A;  4BC4 A;  4BRK A;  4DF8 A;  4JNE A;  3AY9 A;  4G1Q A;  1JCE A;  2YNI A;  4E7K A;  4GVM A;  5JMV A;  3NVM A;  3OW2 M;  2P5O A;  1WSF A;  1BA0 A;  2E6M A;  1D9D A;  3IAY A;  4Q5V A;  4W5Q A;  3QEP A;  2V7Y A;  1U2V A;  4FWL A;  2A1S A;  2DFF A;  1N5Y A;  4MQ3 A;  1TVR A;  2HOE A;  1NG9 A;  3P5J A;  4NB4 A;  2IGI A;  2OPR A;  5ELZ A;  4DQQ A;  1NGB A;  1ZC6 A;  4X62 K;  1T44 A;  2GBZ A;  3GOI A;  3W3D A;  1OVQ A;  4CGI A;  4I9L A;  1U04 A;  4DSE A;  3UIQ A;  2DPN A;  2IC3 A;  3E9P A;  5AQK A;  3K9J A;  1XMO K;  1TKD A;  3O3H A;  4DFP A;  5AFU A;  1RTD A;  4AHV A;  3LWL A;  4JI0 K;  2KW4 A;  4FWR A;  4FWN A;  4H0V B;  2HHS A;  3PO5 A;  3LM2 A;  4OVL A;  1NKE A;  1NGG A;  1Q86 O;  5AQJ A;  4B9T A;  2KFZ A;  4YY3 K;  2AP1 A;  4ZHR A;  3HSC A;  4WQ4 A;  5FRO A;  4GW6 A;  3FZL A;  3HRG A;  2UXB K;  1C0F A;  3I33 A;  4B9N A;  2VYP A;  3KIO A;  1XI1 A;  1T8E A;  2ETJ A;  5EX5 A;  3U9Z A;  4BR4 A;  3HBT A;  3I8B A;  2E88 A;  4AHU A;  4I2Q A;  4X64 K;  2XRI A;  4RTF D;  1VQL N;  3O08 A;  3M8R A;  3O9U A;  4LH4 A;  4OKJ A;  1XC9 A;  4ZTJ A;  4IXC A;  3VA0 A;  4E7I A;  2HMI A;  4JKB A;  3WUH A;  1XNR K;  2FF3 B;  4JN4 A;  3IG1 A;  2X74 A;  3SYZ A;  4J2E A;  3QIC A;  1WLJ A;  4AIL C;  4C1N I;  5AQX A;  3KHY A;  4DR5 K;  1EQY A;  3WNE A;  3VQA A;  4DR2 K;  5KI6 A;  3KD1 E;  3RR7 A;  5J2P A;  3ENH A;  2YHX A;  4JI2 K;  1UWB A;  3PUF A;  4DTM A;  4V19 S;  3SNN A;  3AAR A;  1BO5 O;  4LY7 A;  2O8E B;  1RBT A;  2HHQ A;  2O8F B;  1IKX A;  4BRI A;  5HOO A;  2YHA A;  1TGO A;  3MWP A;  1OH5 A;  3THX B;  1BGX T;  1MWK A;  3KK7 A;  4JRQ A;  4CVN E;  3CPW M;  2VGN A;  3SCX A;  4HTL A;  3K58 A;  5KPT A;  4LF8 K;  4KRE A;  1IG8 A;  4JHD B;  1KLM A;  4I6M B;  2F8T A;  3V9S A;  1MA9 B;  2ITM A;  1VQM N;  4B9V A;  2EWS A;  3DWL A;  4FZZ A;  2HB5 A;  2NRW A;  3MN6 A;  4JI4 K;  1NM1 A;  2QA4 N;  4CFD A;  3AVC A;  1QQO A;  2HNY A;  5EXW A;  3WXK A;  1X3N A;  3RRH A;  3EKU A;  1ZBU A;  3SZ2 A;  4M3Y A;  1GLL O;  4F2R A;  5BPM A;  2Q97 A;  4KB1 A;  1RT5 A;  4PWD A;  2A6A A;  1VHX A;  3LPT A;  3TSQ A;  4BR2 A;  4DV1 K;  4DV4 K;  3OYG A;  1JLG A;  4PKH A;  1UOC A;  3OYK A;  1VSL A;  4CW7 B;  4K8X A;  4OPJ A;  4H0T B;  3V1O A;  4L3Q A;  3WXJ A;  2FXU A;  5AR0 A;  3PX0 A;  5BN8 A;  4DTO A;  2YNH A;  3OYM A;  3U4L A;  5FRN A;  1BIS A;  5M1Q A;  3S3N A;  3J80 O;  3QML A;  3ZT1 A;  1QE1 A;  3SV3 A;  5AQH A;  3SPZ A;  3S41 A;  2O8D A;  4B9U A;  3K5O A;  3QEX A;  1QQM A;  4I2P A;  1ZBH A;  3J7Z O;  5AZI A;  4W5T A;  3WQT A;  5M1P A;  4W5R A;  1K8A O;  1RT6 A;  3N4P A;  4CJ5 A;  3HO1 A;  1T03 A;  3CM6 A;  5E41 A;  3DXM B;  3V1Q A;  4DFK A;  1S1T A;  5TKW A;  1JJ2 M;  4BRG A;  4DUY K;  3C6H A;  4CGF A;  3BZK A;  1NGH A;  2GUI A;  3O4Q A;  2VQF K;  3NH1 A;  3CJ1 A;  1W2B M;  1BQM A;  4FPB A;  2RF2 A;  1TK0 A;  3CC7 N;  1VQN N;  5ADX H;  3SBT A;  1GLD G;  1TYQ A;  4IEE A;  4FM1 A;  4BWM A;  2HHU A;  3S3M A;  4MFB A;  3NF8 A;  3D45 A;  4IG0 A;  3TU5 A;  3D2F A;  3JAM O;  3QB0 A;  1J9A A;  2I7N A;  3DLK A;  2F9W A;  4X66 K;  1HYV A;  5I42 A;  5CE3 A;  1LAW A;  3ENB A;  3ZYY X;  3HP6 A;  3L2W A;  4LH5 A;  3SQ0 A;  3IUC A;  3JS6 A;  3HOT A;  1GOB A;  3CQY A;  1NKC A;  2B6A A;  1ATN A;  4ELV A;  1V4S A;  1HYZ A;  2ZGZ A;  4CBW A;  1W9H A;  4F9O A;  1YVN A;  3AAP A;  4CED A;  4JKA A;  1IV0 A;  1EKE A;  4GKK K;  2OAN A;  4W5N A;  3RTV A;  4IFV A;  4BRF A;  4OX9 K;  1JLE A;  5J2M A;  3RR8 A;  1DTT A;  3UE5 A;  1NOY A;  5GAD P;  2UUC K;  3ZLJ A;  2NRV A;  3DAW A;  2HND A;  3VQD A;  3O4W A;  4HUF A;  3O3F A;  3AA5 X;  2BDP A;  3MXI A;  3QIN A;  3CXC M;  3K5M A;  3OYH A;  4BRE A;  2XO7 A;  3K5L A;  4BC5 A;  3KLG A;  3V9X A;  1D4X A;  1QSS A;  2O8D B;  2QK9 A;  2QWN A;  3CHW A;  3C0B A;  1UAX A;  4DV6 K;  4H0Y B;  1RTI A;  2V7Z A;  3M5R A;  3JYT A;  4WQ5 C;  3NH2 A;  1N33 K;  3SQ4 A;  2O4G A;  1KTQ A;  3PX4 A;  2O8C B;  1KAX A;  4DTU A;  3RMC A;  2BUP A;  3SMP A;  1QZ5 A;  1K8K A;  2YJF A;  4H5T A;  4FWK A;  3TAE A;  1D8Y A;  2OPP A;  1GLF O;  3NE6 A;  2IOC A;  1Z26 A;  2D0P A;  3DLE A;  4CGJ A;  2GEM A;  2BAN A;  3QEV A;  1YIT N;  5KRS A;  1GLC G;  1QQC A;  3E9L A;  2CH6 A;  4A5B A;  4IOA L;  2GTD A;  5HRN A;  2DY4 A;  3TAB A;  1SKW A;  3EE8 A;  3RRG A;  5BRH A;  4M3Z A;  5TKY A;  4BRL A;  4H4O A;  3G4S N;  1N34 K;  1M90 O;  4OGE A;  4JKG A;  1WUA A;  2ZJQ L;  1TKX A;  5BPN A;  1ATS A;  3TWH A;  3C94 A;  4KB0 A;  4DU3 A;  1BHL A;  1E4G T;  2PBD A;  1FKP A;  1J54 A;  3OS1 A;  4CJV A;  3MCP A;  1VSK A;  3CJ7 A;  4YOY A;  3ZCM A;  2QI2 A;  1VSF A;  3PSF A;  3P4I A;  3L6Q A;  2EHG A;  5M1K A;  2YNG A;  1TK8 A;  4AHC A;  1SKS A;  4OPK A;  2NRZ A;  1BCO A;  4A62 A;  4CGH A;  2RE2 A;  3SUO A;  3HI0 A;  1VSM A;  4B1Y B;  2NNW A;  2HVH A;  1GLJ O;  4IOC L;  4FZY A;  3MWT A;  1I94 K;  1LAV A;  4JEP A;  1VSI A;  4IO9 L;  1U48 A;  4JKH A;  3UKR B;  1HRH A;  3VQB A;  4EAH D;  3O9R A;  5CYM A;  4JS5 A;  3HXM A;  3VER A;  4FJG A;  3LAN A;  5M1O A;  1BI4 A;  1CXQ A;  4CHZ A;  2WUS A;  4FJJ A;  2HHW A;  3T7Z A;  5AQY A;  5AZI B;  3JXU A;  4DTJ A;  1JL2 A;  3AVF A;  4A59 A;  3G25 A;  3WEE B;  3V9U A;  2NUB A;  4QS8 A;  2KKZ A;  1KQS M;  4OKK A;  2QWQ A;  5FLX O;  2QWP A;  3WEE A;  4CGG A;  2DFE A;  4B1W B;  4DR3 K;  2KLA A;  2UYT A;  1TKT A;  4CJW A;  1QTM A;  5F2R A;  3CM5 A;  3VQ5 A;  3BY5 A;  4CGD A;  1YJN N;  3KKR A;  3DRP A;  3O80 A;  4A2A A;  3IRX A;  4B3R K;  3KLH A;  5LMU K;  5HRO A;  4FVM A;  1GLA G;  1U49 A;  3CCS N;  5HLF A;  4PL8 A;  1N36 K;  4B3S K;  4CF9 A;  4NCB A;  4E1M A;  3LDL A;  3LP1 A;  3VQ7 A;  3DLR A;  3PSI A;  2P9I A;  1C0T A;  4GV9 A;  3RVC A;  2PAV A;  1QSY A;  3THW A;  2NRT A;  3VQE A;  4MLE A;  3PY8 A;  5C42 A;  1JCG A;  2D0A A;  2H3G X;  3D7E O;  2R7Y A;  3ID6 A;  1KFS A;  3E1Y A;  4E0D A;  1Q9X A;  5HL7 L;  4CF2 A;  5B8H A;  3KK3 A;  3K57 A;  1VQ5 N;  4BRO A;  3EL2 A;  2ATQ A;  2CH5 A;  1WOQ A;  2WON A;  5AJ3 K;  1VK0 A;  2KZM A;  4AQY K;  5AQI A;  3G71 N;  1BCM A;  4CEQ A;  3KJV A;  1QHA A;  4IKF A;  1HNW K;  4XH5 A;  1WAF A;  3NH0 A;  3WQU A;  3CI5 A;  3ID8 A;  3FZM A;  3HOS A;  2FBV A;  3WT0 A;  4E19 A;  3J8A A;  1Q8I A;  4CFA A;  2Q2R A;  4CER A;  1NGE A;  1S6P A;  1YVU A;  4FL9 A;  3AA3 A;  1XHZ A;  3QNO A;  1JXB A;  1VSD A;  1IKY A;  2WFB A;  3C95 A;  1IG9 A;  1V4T A;  4CJK A;  1RDW X;  3DLH A;  3E9O A;  3ZT2 A;  3O9S A;  4GV3 A;  4FJN A;  3H1V X;  4Z0U A;  4GY2 B;  2BGG A;  1P8Z A;  4UY8 O;  1RBV A;  3AVN A;  2ZJP L;  3ALY A;  2F96 A;  1EWR A;  4WFB L;  1K8K B;  1LWF A;  3CCU N;  1RT1 A;  4WQ5 A;  3KVG A;  1U2V B;  5HRR A;  1K73 O;  1RCH A;  2F8S A;  3KTQ A;  1VRT A;  5AQZ A;  1GLB G;  3OYE A;  3BDP A;  1BIZ A;  4GMJ B;  5GAE P;  3ZSQ A;  4N76 A;  4KRF A;  1HPZ A;  1QS4 A;  2YHY A;  4DR1 K;  4F4K A;  3VET A;  4FJK A;  2IAJ A;  4G9Z A;  1VSH A;  2HHV A;  1HNI A;  4H0O A;  4U67 L;  4W5O A;  3IS9 A;  4K41 A;  2O8C A;  3P31 A;  3ZSO A;  3QIO A;  1E4F T;  4DQS A;  4B9Q A;  4M41 A;  4H4M A;  4EZ6 A;  1S1V A;  4BDY A;  3G0Z A;  3R9P A;  3TTF A;  1ESV A;  3HZ6 A;  4Z4I A;  3HL8 A;  3LDP A;  5BR8 K;  3H3N O;  2QKB A;  3RSE A;  2VWK A;  5LL6 Z;  3L2R A;  3ITH A;  3QBW A;  3QET A;  1HNX K;  5C15 A;  1Z6R A;  4NXN K;  4ID1 A;  2P9L A;  3K59 A;  4JK9 A;  3U6F A;  3CCQ N;  3PO4 A;  4K0K K;  4JI6 K;  3CCE N;  2GUP A;  1FK9 A;  4QCL A;  1BL3 A;  4CJR A;  4Z4E A;  3U3G A;  5C2D A;  1YHQ N;  4DKW A;  3T3F A;  4BC2 A;  4ILJ A;  4JKC A;  4B9M A;  4LSN A;  2HHX A;  4MDA A;  4IO8 A;  4J8F A;  5CYQ A;  3CC4 N;  1I3A A;  3VGK A;  1Z25 A;  3SI6 A;  2P9N B;  3F9K A;  3V1R A;  5HRP A;  3E01 A;  3ISN C;  2O8F A;  1JLC A;  5BRE A;  3KK2 A;  1HJR A;  3DM2 A;  1VQ6 N;  2NLX A;  3L4I A;  4JD2 B;  3HM8 A;  4KHN A;  1NK4 A;  4Z94 A;  3DOL A;  4M3R A;  4HTU A;  1SL2 A;  4DB3 A;  2HVI A;  1I39 A;  4IBN A;  3U9D A;  3ZX2 A;  1RDU A;  2HHT A;  2NRR A;  2ZF5 O;  1CZ9 A;  1D9F A;  4JK7 A;  3CYM A;  1RT3 A;  2E5L K;  4CEB A;  3NGZ A;  2YKN A;  2E20 A;  3HT3 A;  3TAQ A;  4O44 A;  1IJJ A;  4FK2 A;  3AVL A;  4YDU C;  4DTR A;  4NCA A;  2E2O A;  1N32 K;  3VEW A;  1G15 A;  4M7X A;  4AH9 A;  2HHH K;  3L2V A;  1KVA A;  5EOY A;  1JL1 A;  3O4N A;  3CCR N;  3L0Q A;  3G10 A;  4C8M A;  3MMV A;  1RT4 A;  4IG3 A;  5J2Q A;  1TUU A;  1EET A;  2P9L B;  3VQP A;  1SQK A;  5C10 A;  4E89 A;  3SAH A;  5T7B A;  1HYS A;  4DU4 A;  3HM9 A;  2HST A;  2AA4 A;  4BRM A;  1X3M A;  3VTH A;  1TUY A;  2Y1J A;  4J2B A;  2RN2 A;  3AV9 A;  4PA1 A;  3ZSZ A;  1NGI A;  1C0M A;  4BRC A;  3MX5 A;  5KRT A;  1OH8 A;  1Y97 A;  4O5B A;  2G8F A;  4DFJ A;  2YJE A;  4JKG B;  1UA1 A;  1VQO N;  2D4W A;  3VEX A;  3U8X A;  4DSJ A;  3V9Z A;  5AQQ A;  1KAZ A;  1S22 A;  4KTQ A;  3BEX A;  4J2A A;  3MEC A;  2XY5 A;  2LSN A;  2VCP A;  2P9K B;  5JLF A;  1R0A A;  2G8I A;  3IMX A;  4JHD A;  1L3V A;  2KTQ A;  2XY8 A;  1NK9 A;  4FZX C;  3DLG A;  3D2F B;  3K2P A;  3C65 A;  2D0O A;  3LDO A;  3AVH A;  5LJW A;  4BE0 A;  3I0S A;  1C0U A;  4B1X B;  1FW6 A;  3MX2 A;  3RMD A;  3LP2 A;  1BDG A;  2F9T A;  3SJH A;  1TKZ A;  1NJI O;  5FPM A;  2ASO A;  4MO4 A;  4O5F A;  5AQR A;  2G8W A;  3BF3 A;  3VEY A;  2GV9 A;  4RW4 A;  3T1Y K;  2OYQ A;  3JSM A;  1TYQ B;  2D1K A;  3IFR A;  4H5N A;  3MN5 A;  3FGU A;  3AVK A;  1XNQ K;  5C0Y A;  3OJU A;  4BDZ A;  4R79 A;  1XWL A;  2QXF A;  5AZJ B;  2F7T A;  4BGA A;  2HBK A;  1NMD A;  4AM6 A;  4DQP A;  3THV A;  1Q82 O;  3UKU B;  1YAG A;  4R5P A;  3QEI A;  4B1U B;  1O1W A;  3NHG A;  4QOZ B;  2WBN A;  1VQ9 N;  3TTD A;  1NJX A;  3VEO A;  3DXK B;  4BGB A;  4CJF A;  4DV0 K;  3S3O A;  4OJR A;  4FLV A;  1NLV A;  2ZD1 A;  1KC8 O;  3A5M C;  4HVJ A;  3VEZ A;  2JWL A;  3SJJ A;  4AM7 A;  4FJL A;  1ZBS A;  3AGK A;  3DLB A;  4CF8 A;  3QEW A;  2E8A A;  4XH4 A;  4FWS A;  1HPM A;  2OPQ A;  1T3V A;  3DRR A;  4XIU A;  5FRM A;  4A57 A;  1BOT O;  3GL1 A;  4B08 A;  5LJV A;  5IT9 O;  1XMQ K;  5GAG P;  3CIP A;  4K43 A;  1S1W A;  3O9Q A;  1WBB A;  1ASV A;  2X78 A;  3TAP A;  2WC9 A;  3ULD A;  2GWK A;  3NF6 A;  1HQU A;  3J81 O;  1WSJ A;  3OYI A;  3UKR A;  1HNZ K;  2UU9 K;  3CQ8 A;  1R59 O;  3VQ6 A;  5GIN A;  3WNG A;  5KQ8 A;  3FZH A;  4PY5 A;  3RMA A;  3CJB A;  3GDQ A;  1U4B A;  4EHT A;  3CG7 A;  3K9K A;  1QSL A;  1NGF A;  4BR0 A;  4CES A;  4JK8 A;  3AO2 A;  4NO7 A;  2OTL N;  5FPN A;  4KHY A;  4CHP A;  5J2N A;  4JYA K;  5AQW A;  1C6V A;  3BP8 A;  4RW8 A;  1U47 A;  4DF4 A;  3C6T A;  3D6R A;  1VQ7 N;  1B9D A;  4CEC A;  5AQV A;  4CJS A;  3WNH A;  3I56 N;  1NGA A;  5M1F A;  4IJA A;  4GV6 A;  3OY9 A;  1ZXO A;  1S72 N;  1X9W A;  1C1B A;  3Q7B A;  4PL7 A;  3CET A;  5BRF A;  5KTQ A;  2ZE2 A;  3W0L A;  3TAG A;  3H3O B;  3C6U A;  4CEF A;  4DG1 A;  1GOA A;  2G8K A;  3OBY A;  3VF2 A;  1HNV A;  3FZK A;  4BRD A;  1LOT B;  4DTP A;  4E7H A;  3LM9 A;  2A1R A;  2YCH A;  1HJO A;  2QM1 A;  4E7J A;  2YNF A;  1LW2 A;  3I8D A;  1DT9 A;  2DTU A;  4BC3 A;  3CCM N;  3LP3 A;  1ZBF A;  3L4Q A;  3C6A A;  3UB5 A;  4A61 A;  5FPD A;  4CBU A;  4BRA A;  3VQ8 A;  3T1H K;  1BA1 A;  3VQQ A;  4FLZ A;  4CJP A;  1YT3 A;  1EX4 A;  4HCB A;  3H1Q A;  4OGC A;  3CPE A;  2IVP A;  3CFR A;  3KLI A;  3FLC O;  2A5X A;  3FZF A;  5AFU H;  3NF9 A;  5C24 A;  4CZE A;  2QWL A;  4DLE A;  4B8C A;  1C1A A;  3MN9 A;  3ZSX A;  3LZJ A;  3D2E B;  4FW1 A;  3LAK A;  3ZSV A;  2RKI A;  3LAL A;  1L3S A;  3L3U A;  3HVT A;  1S9G A;  1HLU A;  5KGX A;  3AVI A;  4N41 A;  1EXQ A;  2P9P B;  5GIO A;  2UXC K;  3AGR A;  1YTU A;  1SKR A;  3H6E A;  4FO0 A;  1Q9Y A;  4IEI A;  3CQX A;  2W42 A;  5SZT A;  4Z4G A;  3CFO A;  3CD6 N;  3PX6 A;  3V81 A;  3EYZ A;  3ZX3 A;  2BH1 A;  2A42 A;  4HUE A;  2HF4 A;  1RIL A;  4CK1 A;  3ZT0 A;  4N5S A;  4DQI A;  3OVN A;  1ASW A;  1O13 A;  1X9S A;  3M8S A;  2QKK A;  1WNS A;  3K0S A;  2RHK A;  4CK2 A;  1SV5 A;  3O1W A;  1KXP A;  1UA0 A;  2OA8 A;  1JKH A;  1HX1 A;  2NRX A;  4NXM K;  2UUB K;  1DGK N;  3SQ2 A;  1CZA N;  4BRN A;  2IIR A;  4DTX A;  4KV8 A;  2IS3 A;  4YOT A;  3EEQ A;  2OTJ N;  1NJZ A;  1T6D A;  3OYB A;  2WOM A;  4EIA A;  3AVJ A;  5EU7 A;  1HKG A;  1ILY A;  4O8U A;  4M3U A;  4MLH A;  4HCC A;  2B5J A;  4CZK A;  2KZZ A;  4KTW A;  5MLC Q;  5LMN K;  1XQS C;  4DMN A;  3QBX A;  4DUZ K;  3CJC A;  4NCG A;  5EY4 A;  3AVM A;  1L5U A;  2D0B A;  3EN9 A;  1KCF A;  4H03 B;  4NLB A;  2E2N A;  4KAZ A;  4CE9 A;  3D2E A;  3VF6 A;  4CZF A;  4YOW A;  4RW7 A;  1DTQ A;  4Y0W A;  4JLH A;  1SAZ A;  3VOV A;  2YHW A;  4UQG A;  5E26 A;  4ICL A;  3MN7 A;  1Q7Y O;  1LWC A;  5AQG A;  1D5A A;  3FR0 A;  4LSL A;  3PIO L;  3ZX0 A;  5D3G A;  4AHS A;  4M63 C;  2VWJ A;  3EE9 A;  1HKC A;  5K14 A;  1W0H A;  4CIG A;  2ASM A;  3E66 A;  3ULE A;  3MEE A;  4OLA A;  3VN5 A;  3A5O C;  5GIP A;  4N47 A;  1VQP N;  2A41 A;  1KVB A;  2FSJ A;  4M42 A;  4Z4C A;  3LWM A;  2CGK A;  4GVE A;  3L8B A;  3P39 A;  3DXK A;  2W6L A;  3DRS A;  1KAY A;  1TL1 A;  4FJH A;  4ISF A;  3GBT A;  4FJ8 A;  4FW2 A;  3NF7 A;  1OH7 A;  1X9M A;  4DV7 K;  3NGY A;  3PV8 A;  4F2S A;  1NGD A;  1JLB A;  1RDB A;  1MWM A;  3OJS A;  5CZ2 A;  3HVR A;  1MU2 A;  2CGJ A;  1QZ6 A;  1KRP A;  2DFH A;  4BDP A;  2E1Y A;  3KWI A;  3T69 A;  1FJG K;  1H1V A;  4FM0 A;  1NKB A;  4AHT A;  3O3G A;  2FLO A;  2E6L A;  2Q31 A;  4DTN A;  4B9L A;  4OKE A;  5F0X A;  2YX6 A;  1S1X A;  2Z1J A;  1TV6 A;  4NYF A;  4MO5 A;  4YNQ A;  4DHY A;  4FM2 A;  2ZQB A;  4KH6 A;  4B8A B;  4BR5 A;  3F73 A;  4AF1 A;  4CEO A;  4M3X A;  2P9K A;  1NWK A;  1VQ4 N;  5AQS A;  1J5O A;  5FDL A;  1RNH A;  4JKE A;  1VSJ A;  3EZ5 A;  5AQU A;  4F8R A;  3ZT4 A;  4BE2 A;  1C1C A;  1T6C A;  3WNF A;  1ITG A;  3OHR A;  3TSP A;  1ZYQ A;  3CJ9 A;  2GWJ A;  3ZSW A;  1RFQ A;  3K5N A;  1EWQ A;  3QDK A;  2X6S A;  4LF4 K;  3HYF A;  5BN9 A;  1J5E K;  2XY7 A;  1L3U A;  1VRU A;  4NYN A;  3P1G A;  1EP4 A;  3ZSR A;  4CK3 A;  2IDO A;  1Q81 O;  4ILG B;  3DMJ A;  1NK6 A;  4CFC A;  2FSN A;  4M45 A;  4BVP A;  2YV0 X;  3VQ9 A;  4CJ3 A;  2P9S A;  4X65 K;  3OA9 A;  3V9W A;  3SLC A;  3SMS A;  4Z4H A;  4LFB K;  1XUP O;  4LFA K;  4FLY A;  4CZL A;  4DLG A;  3TI0 A;  3SUQ A;  4RCH A;  1U6Z A;  3WXL A;  2QWR A;  3VEN A;  3CMA N;  2B4J A;  1KFD A;  3L2U A;  2V51 B;  4CIF A;  4B3O A;  3P38 A;  3N4Q A;  1OH6 A;  4JI8 K;  2FSK A;  2E2P A;  4IZ9 A;  3AVG A;  4EP5 A;  4CEA A;  3QNN A;  4CHQ A;  3CCJ N;  1CLQ A;  4A2B A;  5HP1 A;  1WSE A;  2FBY A;  3FFI A;  3RSE B;  4B1Z A;  4B1V A;  3KZB A;  3OYD A;  5BPL A;  1YI2 N;  1KSP A;  3HP9 A;  3ATU A;  3A5N C;  4RW6 A;  3D0P A;  3CJA A;  3LZI A;  4DTS A;  3S9H A;  3TAR A;  2CGL A;  1NGJ A;  1QVG M;  3HTV A;  5C12 A;  3MXJ A;  3KWG A;  3MAQ A;  4DS4 A;  1WSI A;  4CJ7 A;  4IWV A;  1DLO A;  1HKB A;  3TTC A;  4B3M K;  4CEZ A;  1NK7 A;  3R8E A;  2P9P A;  2A40 A;  2YHB A;  5IWA K;  1X1P A;  3ZET A;  4WCE L;  2RPI A;  2JWK A;  3BZC A;  3OYJ A;  2ITG A;  3T19 A;  1XHX A;  4TSX A;  1S3X A;  4O0I A;  4JKF A;  4CIE A;  3VTI A;  4FWO A;  3QFP A;  4BR7 A;  4KHP K;  4IFY A;  2QTD A;  1B92 A;  3AO4 A;  4Y1D A;  2P9U B;  1IBK K;  3M3Z A;  2ZM6 K;  4FJX A;  3KKS A;  3R1X A;  1SL0 A;  1TK5 A;  2KHO A;  1RT2 A;  4PUO A;  1FKO A;  4BRH A;  1RTH A;  4IJN A;  5CZ1 A;  1NGC A;  4KH4 A;  4BVO A;  3BGR A;  3C7N A;  4FPA A;  4L8R B;  4CBX A;  2QWM A;  3DJC A;  2W6K A;  1IKW A;  1CZB A;  3THY A;  4ILH A;  4QS7 A;  2A3Z A;  1BWF O;  4HUG A;  3ZET B;  4BRP A;  1A5W A;  3KLF A;  4FJ5 A;  3AVA A;  3DYA A;  4CJT A;  2HBM A;  4K8Z A;  4KHS A;  1RGI A;  1Z05 A;  3F2K A;  5KPZ A;  4KBO A;  1BUP A;  4C8N A;  5AZJ A;  4FLX A;  1U45 A;  3HJF A;  2O8B B;  3O5B A;  4C8O A;  5KPR A;  2O8B A;  1IBM K;  4DSK A;  2QEX N;  4LF5 K;  4DV3 K;  3RMB A;  1TAU A;  3EY1 A;  4FLT A;  4WQ4 C;  4FLU A;  1NU0 A;  1RBR A;  2HF3 A;  2NRH A;  3B6P A;  1WBD A;  4Y1C A;  3P83 D;  4H5V A;  2HMP A;  1JXE A;  4KO0 A;  3T1A A;  4KKO A;  2VQE K;  3B6O A;  3NVK A;  4O4G A;  3ZT3 A;  4YOU A;  1YJW N;  3QFU A;  4KI6 A;  4KHU A;  3QO9 A;  2HBJ A;  2W41 A;  5GAH P;  3NCI A;  1RBS A;  4N56 A;  5HBM A;  4DWI A;  1BG3 A;  3AAQ A;  2VG7 A;  1VAZ A;  3MED A;  2Q3S A;  3VGL A;  1ATR A;  1VQ8 N; 
#chains in the Genus database with same CATH homology
 4MQ3 A;  2G8K A;  1TVR A;  3M8P A;  4CF9 A;  4NCB A;  4E1M A;  4KHW A;  1HNV A;  2YKM A;  3P5J A;  1A5V A;  2IGI A;  2OPR A;  3LP1 A;  3VQ7 A;  4DTP A;  4DQQ A;  3DLR A;  2GBZ A;  1C0T A;  4E7H A;  2A1R A;  1QSY A;  2G8U A;  4CGI A;  4I9L A;  1U04 A;  3VQE A;  4DSE A;  4E7J A;  2PY5 A;  3PY8 A;  3UIQ A;  2IC3 A;  1LW2 A;  2YNF A;  5C42 A;  3I8D A;  3V6D A;  1WSH A;  2P1J A;  2DTU A;  2D0A A;  2I5J A;  1TKD A;  3LP3 A;  1ZBF A;  3O3H A;  2R7Y A;  4DFP A;  1KFS A;  1RT7 A;  1RTD A;  1Q9X A;  4E0D A;  4AHV A;  4CF2 A;  3LWL A;  4KTZ A;  3KK3 A;  2P51 A;  2KW4 A;  3K57 A;  4HHT A;  4JRP A;  2HHS A;  3LPU A;  2ATQ A;  3PO5 A;  3QER A;  2WON A;  3VQ8 A;  4DU1 A;  4OVL A;  1NKE A;  1VK0 A;  2VG5 A;  2KZM A;  3VQQ A;  4FLZ A;  3SUN A;  4CJP A;  4B9T A;  2KFZ A;  3H08 A;  4ZHR A;  1BCM A;  1YT3 A;  4CEQ A;  3KJV A;  4IKF A;  1EX4 A;  5FRO A;  1LV5 A;  1WAF A;  4E7L A;  3NH0 A;  1GOC A;  4HCB A;  4GW6 A;  4OGC A;  4CJ4 A;  3CFR A;  3KLI A;  2FBV A;  2FC0 A;  4E19 A;  4B9N A;  1T8E A;  3KIO A;  1XI1 A;  2ETJ A;  1Q8I A;  3NF9 A;  4CFA A;  5C24 A;  3ZSY A;  4DLE A;  4B8C A;  1C1A A;  4AHU A;  3ZSX A;  4I2Q A;  3TR8 A;  4CER A;  2XRI A;  4FW1 A;  3LAK A;  3LZJ A;  1S6P A;  3M8R A;  1YVU A;  4LH4 A;  3ZSV A;  4OKJ A;  2RKI A;  3OYF A;  4ZTJ A;  3AA3 A;  3VA0 A;  3QNO A;  4E7I A;  3LAL A;  1JXB A;  1XHZ A;  1XC9 A;  1VSD A;  1IKY A;  1L3S A;  2HMI A;  3L3U A;  3HVT A;  2D0C A;  3C95 A;  3I0R A;  1S9G A;  1IG9 A;  5KGX A;  3IG1 A;  3AVI A;  4N41 A;  3AA2 A;  1EXQ A;  2X74 A;  3SYZ A;  4J2E A;  1YTU A;  1SKR A;  1WLJ A;  4AIL C;  1Q9Y A;  4CJK A;  5HRS A;  2W42 A;  5SZT A;  4Z4G A;  3DLH A;  3VQ4 A;  2G8H A;  3ZT2 A;  3TAF A;  3CFO A;  3WNE A;  3VQA A;  5KI6 A;  3KD1 E;  3RR7 A;  5J2P A;  3PX6 A;  4FJN A;  2OZM A;  1N6Q A;  4Z0U A;  3V81 A;  3EYZ A;  2BGG A;  2D5R A;  4HUE A;  1UWB A;  3PUF A;  4DTM A;  1RIL A;  4CK1 A;  3SNN A;  1RBV A;  3ZT0 A;  1K6Y A;  3AVB A;  4N5S A;  4CJE A;  3L2Q A;  3AVN A;  4LY7 A;  3OVN A;  4DQI A;  1ASW A;  1RBT A;  2HHQ A;  1X9S A;  3ALY A;  2F96 A;  1IKX A;  3M8S A;  4Z4F A;  2QKK A;  1LWF A;  1WNS A;  4CEE A;  2YHA A;  4CHY A;  1TGO A;  4CK2 A;  1RT1 A;  1SV5 A;  5HRR A;  1RCH A;  1UA0 A;  2F8S A;  4E1N A;  2OA8 A;  1JKH A;  3KTQ A;  1VRT A;  1BGX T;  1WSG A;  3SQ2 A;  3TAM A;  4JRQ A;  3OYE A;  3BDP A;  1BIZ A;  4GMJ B;  3HPO A;  3ZSQ A;  3LAM A;  1BI4 B;  4N76 A;  4KRF A;  3SCX A;  4DTX A;  1HPZ A;  1QS4 A;  2IS3 A;  4KV8 A;  4F4K A;  3K58 A;  1NJZ A;  4FJK A;  2IAJ A;  3OYB A;  4KRE A;  2WOM A;  1VSH A;  3AVJ A;  5EU7 A;  2HHV A;  1HNI A;  1KLM A;  4FK0 A;  4M3U A;  1S6Q A;  3AO5 A;  4HCC A;  2BE2 A;  4W5O A;  3IS9 A;  2F8T A;  2B5J A;  3ZSO A;  4CHN A;  4Q0B A;  3QIO A;  2KZZ A;  3V9S A;  4DQS A;  1FXX A;  4LD0 A;  4KTW A;  4M41 A;  4B9V A;  4FZZ A;  4H4M A;  2HB5 A;  4EZ6 A;  4DMN A;  1S1V A;  4BDY A;  3G0Z A;  3ASM A;  3OYC A;  1KLN A;  4NCG A;  3AVM A;  1L5U A;  2D0B A;  1KCF A;  4Z4I A;  3HL8 A;  2PZS A;  4CFD A;  3AVC A;  4AHR A;  2HNY A;  4KAZ A;  4CE9 A;  2QKB A;  2VWK A;  3L2R A;  3RRH A;  4DS5 A;  3ITH A;  1ZBU A;  3QET A;  1ZBI A;  4RW7 A;  1DTQ A;  1RDC A;  3SZ2 A;  4ID1 A;  4JLH A;  3K59 A;  1S9E A;  1IO2 A;  4UQG A;  4M3Y A;  4ICL A;  1T05 A;  3U6F A;  3PO4 A;  1LWC A;  1D5A A;  4F2R A;  4LSL A;  2VG6 A;  5D3G A;  4AHS A;  2FBX A;  1RT5 A;  4KB1 A;  2VWJ A;  4PWD A;  4FJM A;  3LPT A;  1FK9 A;  5K14 A;  3M8Q A;  4QCL A;  1BL3 A;  1REV A;  1W0H A;  4CJR A;  3OYG A;  4CIG A;  4Z4E A;  1JLG A;  1RDA A;  3KD5 E;  3U3G A;  4H8K A;  2Z1G A;  1LWE A;  4RG8 A;  4EP4 A;  4KHQ A;  2JLE A;  3MEE A;  1UOC A;  3VN5 A;  4OLA A;  3OYK A;  1VSL A;  4EZ9 A;  4N47 A;  4K8X A;  4CJL A;  3T3F A;  2KFN A;  3NBP A;  4OPJ A;  4B9M A;  2O4I A;  3VA3 A;  1JLF A;  4LSN A;  2HHX A;  1KVB A;  4RW9 A;  3NFA A;  4M42 A;  4FJI A;  4Z4C A;  2AJQ A;  3V1O A;  3LWM A;  4YFU A;  3NGI A;  4DSL A;  5CYQ A;  3PX0 A;  4DTO A;  1I3A A;  4O55 A;  1Z25 A;  4DFM A;  2YNH A;  3F9K A;  3L8B A;  3SI6 A;  3V1R A;  3OYM A;  5HRP A;  3DRS A;  3E01 A;  1NK5 A;  4FXD A;  5FRN A;  1TL1 A;  1BIS A;  3ISN C;  2Y1I A;  1N5Y A;  4C8L A;  4FJH A;  4FJ8 A;  3S3N A;  4FW2 A;  1JLC A;  3NF7 A;  5SWM A;  2JGU A;  1X9M A;  3KK2 A;  3NGY A;  3ZT1 A;  1HJR A;  1NOZ A;  1BQN A;  3DM2 A;  1QE1 A;  3PV8 A;  1JLB A;  2PYJ A;  4F2S A;  3SV3 A;  1RDB A;  3SPZ A;  4B9U A;  3OYL A;  1HQE A;  3K5O A;  3OJS A;  3QEX A;  5CZ2 A;  4I2P A;  3HVR A;  4KHN A;  1MU2 A;  1S1U A;  1NK4 A;  3DOL A;  1WN7 A;  4M3R A;  3OYN A;  4HTU A;  1SL2 A;  1KRP A;  4ELT A;  4I9Q A;  2DFH A;  4BDP A;  1I39 A;  4IBN A;  4W5T A;  4W5R A;  2OZS A;  2HVI A;  1RT6 A;  4CJ5 A;  3HO1 A;  2HHT A;  4CFB A;  1TAQ A;  1S5J A;  4FM0 A;  1T03 A;  3CM6 A;  4E3S A;  4AHT A;  5E41 A;  3O3G A;  1NKB A;  1CZ9 A;  3V1Q A;  1D9F A;  4DFK A;  1S1T A;  3CYM A;  2E6L A;  4CGF A;  1RT3 A;  4CHO A;  4FK4 A;  4CEB A;  3NGZ A;  2GUI A;  2YKN A;  3O4Q A;  3HT3 A;  4DTN A;  4OKE A;  4B9L A;  3DOK A;  3TAQ A;  4O44 A;  1ZBL A;  3NH1 A;  4FK2 A;  3A2F A;  2Z1J A;  3AVL A;  1S1X A;  3LDS A;  1SUQ A;  1TV6 A;  4NYF A;  1BQM A;  4CJQ A;  4YNQ A;  4KPY A;  2RF2 A;  4DTR A;  1TK0 A;  4FM2 A;  2ZQB A;  4NCA A;  4B8A B;  2PYL A;  3SUP A;  3TAN A;  3F73 A;  4M3X A;  4CEO A;  4FM1 A;  4BWM A;  2HHU A;  1RDD A;  3S3M A;  4MFB A;  3NF8 A;  3NDK A;  5FDL A;  3D45 A;  4IG0 A;  1YTA A;  1J5O A;  1RNH A;  3OS2 A;  4F3O A;  1G15 A;  1KVC A;  1VSJ A;  3EZ5 A;  4AH9 A;  4O0J A;  4F8R A;  3ZT4 A;  3L2V A;  4BE2 A;  1C1C A;  3DI6 A;  4PQU A;  1KVA A;  1J9A A;  3DLK A;  3WNF A;  1ITG A;  2XY6 A;  1JL1 A;  3O4N A;  1HYV A;  1ZYQ A;  5I42 A;  1LAW A;  3G10 A;  4F3T A;  4C8M A;  3QLH A;  3AO1 A;  3ZSW A;  3HP6 A;  2HW3 A;  3L2W A;  4LH5 A;  3OS0 A;  4DSF A;  3SQ0 A;  4CCH A;  4M3W A;  1RT4 A;  4IG3 A;  3SQ1 A;  3K5N A;  2X6S A;  3HYF A;  1GOB A;  5J2Q A;  1EET A;  5DMR A;  1NKC A;  2B6A A;  4ELV A;  3VQP A;  2XY7 A;  4QAG A;  1VRU A;  1L3U A;  2HNZ A;  4NYN A;  3HK2 A;  1HYZ A;  1EP4 A;  1IH7 A;  3P1G A;  3ZSR A;  2IDO A;  4E89 A;  4CK3 A;  3MXM A;  1L3T A;  5T7B A;  3RWU A;  1W9H A;  1HYS A;  4DU4 A;  3HM9 A;  1NK8 A;  3HPH A;  4J2D A;  1RTJ A;  4CED A;  3QES A;  4DSI A;  3DMJ A;  1VSE A;  1EKE A;  1NK6 A;  4CFC A;  4M45 A;  2Y1J A;  4J2B A;  2RN2 A;  2YV0 X;  3AV9 A;  4PA1 A;  3ZSZ A;  5C25 A;  3VQ9 A;  4W5N A;  1C0M A;  3RTV A;  4IFV A;  2Z1H A;  5KRT A;  5J1E A;  1NK0 A;  1JLE A;  3HPG A;  1Y97 A;  4O5B A;  4CJ3 A;  5J2M A;  2G8F A;  4KI4 A;  4DFJ A;  3V9W A;  1UA1 A;  3RR8 A;  1DTT A;  1NOY A;  2KQ2 A;  4ID5 A;  4Z4H A;  1TL3 A;  4FLY A;  4CF1 A;  4DSJ A;  3V9Z A;  3SPY A;  4DLG A;  3TI0 A;  3SUQ A;  2HND A;  3VQD A;  4KTQ A;  4HUF A;  3O3F A;  3MEC A;  3AA5 X;  2LSN A;  2XY5 A;  4JS4 A;  1HMV A;  3QIN A;  1RBU A;  3K5M A;  3MXI A;  3AO3 A;  3OYH A;  1R0A A;  1NJY A;  2G8I A;  4CJU A;  2XO7 A;  3K5L A;  1L3V A;  2KTQ A;  4BAC A;  2XY8 A;  1NK9 A;  2B4J A;  1KFD A;  4FZX C;  3DLG A;  3L2U A;  3K2P A;  3KLG A;  2FBT A;  4CIF A;  3V9X A;  4B3O A;  1IKV A;  2EX3 A;  3AVH A;  4BE0 A;  1NJW A;  3I0S A;  1QSS A;  1C0U A;  2G8V A;  2QK9 A;  3RMD A;  2XHB A;  3LP2 A;  5JS1 A;  3AVG A;  5JS2 A;  4EP5 A;  4KFB A;  4CEA A;  3VQC A;  1UAX A;  3QNN A;  1TKZ A;  4BWJ A;  4CHQ A;  1CLQ A;  1RTI A;  3JYT A;  5HP1 A;  1WSE A;  4FLW A;  2FBY A;  3FFI A;  4FJ9 A;  2G8W A;  3NH2 A;  3SQ4 A;  2GV9 A;  2O4G A;  4RW4 A;  1KTQ A;  2OYQ A;  3OYD A;  3PX4 A;  1KSP A;  3HP9 A;  3JSM A;  4DTU A;  1QHT A;  3RMC A;  4RW6 A;  3D0P A;  3LZI A;  4DTS A;  3S9H A;  3TAR A;  5I3U A;  3TAE A;  1D8Y A;  2OPP A;  3CFP A;  3NE6 A;  3MXJ A;  3MAQ A;  2IOC A;  2BDP A;  4DS4 A;  1Z26 A;  3AVK A;  1ASU A;  1WSI A;  3DLE A;  3OJU A;  3HST B;  1DLO A;  4CGJ A;  4BDZ A;  4B9S A;  4M3T A;  4FJ7 A;  2BAN A;  1A5X A;  3QEV A;  1XWL A;  4CEZ A;  5KRS A;  1NK7 A;  2QXF A;  1QQC A;  3V4I A;  5DK5 A;  3SV4 A;  2YHB A;  5HRN A;  2DY4 A;  1X1P A;  3TAB A;  1SKW A;  4I7F A;  2RPI A;  2OPS A;  3RRG A;  3OYJ A;  4DQP A;  3THV A;  4M3Z A;  5CY4 A;  3NAE A;  2ITG A;  4H4O A;  3T19 A;  4R5P A;  4WE1 A;  3QEI A;  4BE1 A;  1XHX A;  4TSX A;  4O0I A;  4OGE A;  4CIE A;  1O1W A;  3NHG A;  3U3Y A;  1BIU A;  4C8K A;  4QOZ B;  1TKX A;  2Z1I A;  4IFY A;  1SL1 A;  3TWH A;  3KLE A;  3C94 A;  1NJX A;  4KB0 A;  1B92 A;  3AO4 A;  4DU3 A;  1BHL A;  4CJF A;  4DQR A;  1FKP A;  4OJR A;  3S3O A;  4Y1D A;  1J54 A;  3L3V A;  3OS1 A;  4FLV A;  2ZD1 A;  4CJV A;  1VSK A;  1B9F A;  4HVJ A;  1U49 A;  4FJX A;  3SJJ A;  3KKS A;  2P5G A;  4FJL A;  3ZCM A;  3DLB A;  1VSF A;  2X6N A;  4CF8 A;  3QEW A;  1SL0 A;  1TK5 A;  2OPQ A;  3DRR A;  1JLA A;  4XIU A;  1RT2 A;  5FRM A;  4PUO A;  1FKO A;  4B08 A;  2EHG A;  1GOA A;  1WAJ A;  1RTH A;  5CZ1 A;  2YNG A;  3BGR A;  1TK8 A;  1S1W A;  4AHC A;  1T7P A;  1SKS A;  4FCY A;  4L8R B;  1ASV A;  3AA4 A;  2X78 A;  1BCO A;  4OPK A;  3ULD A;  3QIP A;  3TAP A;  3NF6 A;  4CGH A;  3SUO A;  1HQU A;  1VSM A;  1IKW A;  1WSJ A;  1CZB A;  3OYI A;  1CXU A;  4J2A A;  3CQ8 A;  2HVH A;  3LP0 A;  3OYA A;  1J53 A;  4HUG A;  4ZTF A;  3VQ6 A;  4FZY A;  4FYD A;  3WNG A;  1LAV A;  1F21 A;  1VSI A;  1U48 A;  1JLQ A;  4PY5 A;  3RMA A;  1HRH A;  3VQB A;  1A5W A;  3KLF A;  1U4B A;  4FJ5 A;  5CYM A;  3KK1 A;  3HXM A;  3AVA A;  3DYA A;  4JS5 A;  3CG7 A;  4CF0 A;  4CJT A;  1QSL A;  1LW0 A;  4K8Z A;  4CES A;  4KHS A;  3AO2 A;  3LAN A;  4FJG A;  2E4L A;  1BI4 A;  1CXQ A;  4KHY A;  4C8N A;  3HJF A;  4FLX A;  4IDK A;  4CHZ A;  4CHP A;  1U45 A;  5J2N A;  4C8O A;  4ELU A;  4FJJ A;  2HHW A;  1C6V A;  4DTJ A;  4OLB A;  1JL2 A;  4RW8 A;  1U47 A;  3MEG A;  4DF4 A;  3AVF A;  3C6T A;  4DSK A;  1TAU A;  1B9D A;  5KGW A;  3RMB A;  4CEC A;  3EY1 A;  4FLT A;  2NUB A;  3V9U A;  4FLU A;  3WNH A;  4OKK A;  4CJS A;  1RBR A;  3B6P A;  4CGG A;  4Y1C A;  2DFE A;  3P83 D;  3OY9 A;  1JXE A;  4KO0 A;  1ZBH A;  3T1A A;  4KKO A;  3B6O A;  4DF8 A;  4O4G A;  3ZT3 A;  1X9W A;  1C1B A;  4G1Q A;  4KI6 A;  4KHU A;  1TKT A;  3QO9 A;  4CJW A;  1QTM A;  2YNI A;  3CM5 A;  3VQ5 A;  4E7K A;  4GVM A;  3NCI A;  4CGD A;  5KTQ A;  2ZE2 A;  3KKR A;  1WSF A;  3DRP A;  1RBS A;  4N56 A;  2P5O A;  5HBM A;  3IRX A;  2E6M A;  3TAG A;  4DWI A;  1D9D A;  3IAY A;  2VG7 A;  4Q5V A;  3C6U A;  4W5Q A;  3KLH A;  3QEP A;  5HRO A;  3MED A;  2Q3S A;  4FVM A;  4CEF A;  4DG1 A;  2A1S A;  2DFF A;  5HLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...