2FBYA

Wrn exonuclease, eu complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbyA00
4CHNA 4IG3A 3AO4A 1RBVA 2B4JA 3OVNA 4NCAA 2XO7A 4H4OA 4W5QA 2XY5A 4DWIA 5EU7A 1YTAA 5KTQA 3VA0A 3C95A 1D9FA 3NFAA 1RDBA 3SJJA 4KI4A 3HK2A 2HHUA 4CFBA 1T7PA 4QOZB 1I39A 4ZTFA 2VG7A 4DFKA 3ALYA 3CQ8A 4FK2A 1JL2A 3ASMA 4HTUA 4RW8A 1RT1A 1G15A 3ISNC 3NAEA 3D45A 4FVMA 4CGJA 2ZQBA 4CJ4A 4FLYA 4EP4A 4PY5A 5HBMA 1NK4A 1L3VA 3OS0A 1QHTA 3T19A 4M3YA 1RT3A 4HUGA 4Q5VA 4W5RA 3NDKA 4G1QA 4CF8A 4FJKA 3VQDA 4DTSA 1LAVA 3O3GA 4E7IA 1NKBA 1SKRA 2G8HA 3LANA 4B9TA 4CEAA 1VRUA 1R0AA 1IH7A 4DU4A 3QEWA 1U04A 1MU2A 1NJWA 2JLEA 4I2PA 3V1OA 1UA0A 1HQEA 2BE2A 3PY8A 3KLFA 3HVTA 1BCOA 1RTIA 3G0ZA 4E3SA 4C8OA 2HB5A 2KZMA 4CFDA 1KTQA 1RBUA 3RTVA 1KSPA 2Q3SA 4E7LA 1SUQA 3LAMA 4KTQA 1VSKA 4AILC 4FW1A 3QLHA 3VQPA 3L2UA 1T03A 4GVMA 3NH0A 2I5JA 2ITGA 4DU3A 4FM2A 3MXMA 3B6OA 2HVIA 1TK0A 2G8VA 2RF2A 4E19A 2Y1IA 3RR8A 1QTMA 2X74A 3V1QA 4W5NA 1S9EA 4Y1DA 2B6AA 3P5JA 4DSEA 4E1MA 2FBYA 4E7KA 1KLNA 4QCLA 3ZT0A 3KLHA 4FJJA 3OYAA 2OPSA 4NYNA 2KTQA 4CJLA 4DLEA 1VSEA 3K57A 3LP3A 1J53A 1IG9A 1TKXA 2O4GA 3SQ2A 2F96A 3OYKA 3PO5A 4FZXC 3VQ9A 4IKFA 1TL1A 4M3UA 1RDDA 1DLOA 4CF2A 3HYFA 2HHQA 4DFMA 1J5OA 1HNVA 1L3SA 1WAJA 3P1GA 4CJPA 1JL1A 1JLEA 4FJIA 3VQCA 3NF9A 4FLXA 1WSIA 5CY4A 4C8MA 4M3RA 3ZT4A 1VSHA 3LPTA 2VWJA 2VWKA 3HPGA 2D5RA 3V81A 2XY6A 3TABA 3SUNA 4K8XA 1VSLA 1X1PA 4DTJA 1XC9A 4J2AA 4JS4A 1JLCA 1GOAA 2XRIA 3AVIA 3P83D 2QKKA 4DQQA 5FRMA 1W0HA 2YHBA 5HRSA 1ZBLA 3KK2A 4OKJA 5K14A 1RNHA 3AVFA 3HPHA 3NGZA 3OYFA 1XI1A 3O4QA 2HMIA 3OYDA 2RKIA 3ITHA 4F2SA 4LSLA 4IDKA 1S9GA 4DQIA 3H08A 4BE1A 4B9UA 3PX4A 1ITGA 3UIQA 4ELVA 1F21A 4HCCA 4FZZA 2BGGA 3SV3A 4CJRA 2OPQA 3MECA 1L3TA 1VSFA 2IOCA 2WOMA 3SI6A 2KZZA 4DTPA 4FJNA 3TAPA 4LSNA 3RRHA 3OYJA 3SQ4A 1A5WA 1NK9A 4DQSA 3TAMA 1BGXT 3LDSA 3PV8A 3ZSWA 4CEBA 3AVMA 3DMJA 4H8KA 3OYGA 1X9SA 4FJ8A 1GOCA 1UAXA 4NCBA 1IKVA 2LSNA 3DRSA 3KIOA 1TGOA 4KV8A 4LH5A 3HT3A 3LP2A 3KJVA 4IFVA 3QIPA 2P5GA 3DLGA 1ZBHA 3TARA 4ZTJA 2DTUA 2YNHA 4Z0UA 1YVUA 1HYVA 3ZT2A 3KLEA 3AO1A 2KFZA 2FBVA 2DY4A 1IKYA 4O0JA 4CGGA 3QEVA 3RMBA 1BIUA 3MEDA 1NKEA 4M41A 4B9VA 4CERA 1VRTA 3V4IA 5CZ1A 5HLFA 3SV4A 2GV9A 2KFNA 4O55A 3VQQA 3PO4A 3VA3A 3U3YA 4DS4A 2YKMA 1C0MA 5JS1A 4OGEA 1WSFA 3SUQA 4CIGA 3KTQA 1HYSA 4E1NA 1YT3A 4CJ3A 4B9MA 1KVAA 3F9KA 3OJUA 4KTWA 4ELUA 1LWEA 3SZ2A 3LWLA 1ASVA 3QESA 3DLHA 1IKXA 2Z1HA 3V6DA 3RMDA 1SL2A 4OPJA 1WSJA 4CF9A 4YFUA 1X9MA 3VQ7A 1RT4A 1JXBA 4CEFA 3AV9A 4OVLA 3NE6A 1S1UA 3LAKA 3ZSRA 1S1TA 3E01A 3DLEA 4HVJA 2HHTA 4BDYA 3PUFA 4FW2A 3CFOA 4CEEA 4M45A 4DF4A 1CZ9A 2RPIA 4O0IA 2D0AA 4B9SA 4DQPA 2YNFA 2DFFA 3S3OA 4O4GA 3KLGA 3HP6A 5HRRA 1EETA 3MEGA 1NK7A 2FC0A 3QINA 2IDOA 2E6MA 3CG7A 5KI6A 1ZBUA 3AO3A 2A1SA 4H4MA 3AVHA 3AO2A 2Y1JA 2ZE2A 3LPUA 1KFDA 4C8NA 3OS2A 2YNIA 2X6NA 4CJWA 4DTUA 3WNFA 2EX3A 1RCHA 4DSJA 1CXQA 1O1WA 1ASUA 2HNYA 2OYQA 4E89A 3AVBA 1SKWA 4Z4IA 1W9HA 3K5MA 3ZSQA 1S5JA 1BL3A 3AA4A 3C6UA 4OJRA 3OYLA 4OKEA 2GUIA 3WNGA 3HM9A 4FJ5A 3QEIA 3DLRA 3VQ5A 3L3VA 4CK2A 3C94A 3BGRA 3DRPA 3LALA 4N56A 4KAZA 1RTHA 3L2VA 1HRHA 4PQUA 3FFIA 3SPZA 5HROA 4J2DA 1VSJA 2G8FA 1DTTA 4HHTA 3MXJA 5KRTA 1SV5A 4R5PA 3QNNA 1IO2A 4FM1A 5J2QA 1RBSA 4DTMA 1U47A 1QSSA 1RBTA 2E4LA 1VSIA 3LP1A 2G8UA 1BCMA 3NF7A 4CIEA 5T7BA 3JSMA 1UA1A 2YKNA 4M3WA 4M3ZA 3B6PA 4KHQA 4DFPA 4O44A 2VG5A 4Q0BA 3QETA 1C0TA 1NJZA 3OY9A 1EX4A 3L3UA 5C24A 3OYBA 3U6FA 4B9NA 1ZBFA 3M8QA 4HCBA 1N6QA 3VQAA 4Z4HA 3O3HA 2P5OA 4CFCA 3V9ZA 1BQNA 1TVRA 3OJSA 4CK3A 3ULDA 4JRQA 2EHGA 4FJMA 5DMRA 3AVGA 2QK9A 2BDPA 2IC3A 1D8YA 2OZMA 4O5BA 1RTJA 4MFBA 3JYTA 2PYLA 4E0DA 4FJ9A 4HUFA 1T8EA 3TWHA 4FLZA 2RN2A 1BISA 4CEZA 1WNSA 1TKDA 4HUEA 4L8RB 2G8IA 4DSLA 4I9QA 3LZJA 3HVRA 4DQRA 2BANA 2DFHA 2X78A 4DMNA 5DK5A 5KGXA 3QEPA 2PY5A 4FK0A 3K5LA 5HRPA 1XHZA 1NJYA 4CHOA 2HHSA 1JLQA 3PX6A 5J2PA 3K59A 4DF8A 3S3NA 4B8AB 1QSYA 1UWBA 1IKWA 4I9LA 2B5JA 4CJKA 2D0CA 3S3MA 2HNZA 3TAQA 1BI4A 1BQMA 5D3GA 1TL3A 1WAFA 1FKPA 4ZHRA 4B3OA 2AJQA 3VQEA 1VSMA 4W5OA 3LWMA 5SWMA 3RMAA 1JXEA 4CCHA 1XWLA 4AHCA 3KK1A 4FCYA 1VK0A 1BHLA 3F73A 1WSEA 3RR7A 4KHWA 2G8KA 5I3UA 5J1EA 4W5TA 1NK5A 4C8LA 1B9FA 2ATQA 1WLJA 2W42A 2ETJA 4MQ3A 4CHZA 3M8SA 4IBNA 4CESA 4BWMA 3HPOA 1D9DA 3KD1E 3AA2A 2O4IA 3WNHA 1TKTA 3L8BA 1KVCA 4AHTA 4GMJB 4BE2A 3ZCMA 4AHRA 4JS5A 1L5UA 2PYJA 3OYEA 1CLQA 4Z4GA 3QERA 3OYCA 4F4KA 1KCFA 5CYQA 4KI6A 4UQGA 1NK0A 3HXMA 3CM5A 4DTRA 3NH1A 5FRNA 4NYFA 3PX0A 3NHGA 3AA5X 3AVCA 3NGIA 3VQ8A 1LAWA 3O4NA 3L2RA 4E7HA 1TK8A 1HYZA 3M8PA 4F3TA 2HVHA 2E6LA 1C0UA 3DOLA 4N5SA 3CM6A 4DG1A 2OPPA 3OS1A 3VQ6A 2XY7A 1C1BA 1J54A 4KFBA 1SL1A 4FZYA 4JLHA 2YV0X 3V1RA 4B9LA 5SZTA 1C1AA 4NCGA 3K58A 4FJHA 3TI0A 4BACA 4M3TA 3HL8A 4CHQA 4DSKA 3LZIA 2JGUA 4N41A 4OPKA 1RDCA 4XIUA 4AHSA 2IS3A 1JLGA 4Z4CA 3S9HA 4EZ6A 1S1XA 3DM2A 1BI4B 4IFYA 4EP5A 4AH9A 3AVJA 2XY8A 1U4BA 4ID5A 4CE9A 1RTDA 4K8ZA 1RDAA 1Q8IA 3ZSXA 1LV5A 3BDPA 3HO1A 4I2QA 3OYIA 2A1RA 1ZYQA 3LP0A 3V9XA 2Z1JA 3THVA 1ZBIA 2DFEA 3DLKA 3SQ1A 3TAEA 1NJXA 3TANA 2YNGA 3G10A 1KLMA 1TK5A 3KD5E 4CJFA 3OYNA 4KHUA 4OGCA 4E7JA 3A2FA 3AA3A 5J2MA 4JRPA 4WE1A 3M8RA 1KRPA 3I0RA 4B08A 3KK3A 5J2NA 3NF6A 4QAGA 1LWCA 4C8KA 1L3UA 1UOCA 2ZD1A 1RT5A 4CJTA 4CJUA 1CZBA 4YNQA 1RBRA 4CECA 4FJGA 3K5OA 4B8CA 3EY1A 4F2RA 4DTXA 4CGHA 4BDZA 2IAJA 3HSTB 3RMCA 1S6QA 4OLAA 1X9WA 1NOZA 1FK9A 2QKBA 1QE1A 3L2QA 1FXXA 1S1VA 4FLUA 1B9DA 3IRXA 3K5NA 4RW9A 1NKCA 1Q9XA 4F8RA 3NCIA 1NK8A 3C6TA 3VQBA 3TAFA 3IAYA 2HHXA 3NF8A 4KO0A 3VQ4A 4N47A 4LY7A 1WN7A 2Z1IA 5C25A 4FK4A 1HQUA 1BIZA 3NBPA 4RW6A 1QSLA 1JLAA 1JLBA 3AVNA 1S6PA 1LWFA 5CZ2A 1LW0A 4N76A 4FJ7A 4LH4A 3ZSVA 1J9AA 3I8DA 3SUOA 3SQ0A 2R7YA 4RG8A 1TV6A 1N5YA 1FKOA 1WSHA 2KW4A 4DU1A 1CXUA 1C1CA 2X6SA 1LW2A 1HNIA 2HHVA 4KHYA 3I0SA 5HRNA 2OA8A 4KPYA 3KKSA 3SCXA 5I42A 3SUPA 4M42A 1SKSA 4KRFA 1RT7A 3AO5A 4FJXA 1RT6A 2Z1GA 3DLBA 5KRSA 4DLGA 1REVA 3ZSZA 3CYMA 4CK1A 4CF1A 5E41A 2HHWA 3AVLA 4RW4A 5FROA 1I3AA 3IS9A 4Y1CA 3T1AA 4DTOA 1QQCA 3SNNA 3HP9A 3KKRA 1EXQA 1NOYA 4GW6A 3TAGA 3DYAA 3OYHA 3EYZA 5JS2A 4KREA 4PWDA 3DRRA 3SPYA 4OLBA 3IG1A 4CJSA 4DTNA 1U48A 3ZSYA 4ELTA 3SYZA 2NUBA 3O3FA 2WONA 1T05A 4CJEA 2VG6A 3U3GA 2P51A 4DFJA 1NK6A 2OPRA 3HJFA 1TAUA 1EKEA 2G8WA 4PUOA 4BDPA 1Y97A 1K6YA 1SL0A 4Z4FA 1C6VA 4M3XA 4AHUA 3EZ5A 3CFPA 1EP4A 1WSGA 1HJRA 1VSDA 3OYMA 3QEXA 2XHBA 4J2BA 5KGWA 4CHPA 4CGDA 4FXDA 1TAQA 2FBXA 3NGYA 4CHYA 4CIFA 3ZT3A 1Z26A 5C42A 5FDLA 3D0PA 1ASWA 1DTQA 4ID1A 3V9SA 4CEOA 3T3FA 2PZSA 4AHVA 2F8SA 4KKOA 3V9WA 3L2WA 4CJVA 3QIOA 1YTUA 2FBTA 3VN5A 4CGIA 3DOKA 3NH2A 1RILA 4BWJA 4FLWA 1XHXA 2P1JA 1D5AA 1Z25A 1HMVA 3RWUA 2IGIA 4CGFA 2YHAA 3V9UA 3RRGA 3MAQA 4F3OA 4J2EA 4KHNA 4EZ9A 5CYMA 4RW7A 1KFSA 3CFRA 1B92A 3K2PA 3TR8A 1U45A 3ZSOA 3QO9A 1KVBA 4CF0A 2QXFA 5HP1A 4ICLA 1S1WA 4CJ5A 4TSXA 4FLVA 4KB1A 3DI6A 4CEDA 4DSIA 2KQ2A 4I7FA 4BE0A 4PA1A 3AVAA 3MEEA 3ZT1A 4CEQA 1U49A 1GOBA 1RT2A 4DS5A 4FLTA 4KHSA 3WNEA 3QNOA 4FYDA 2D0BA 2GBZA 4KB0A 4OKKA 1A5XA 4CJQA 1HPZA 4Z4EA 1A5VA 4DSFA 2HW3A 4FJLA 4FM0A 1JLFA 4LD0A 1Q9YA 3MXIA 4CFAA 1JKHA 1TKZA 3KLIA 4IG0A 4KTZA 2F8TA 2OZSA 2HNDA 3AVKA 1QS4A
chains in the Genus database with same CATH superfamily
4CHNA 3OVNA 1WUAA 3CJ7A 1SAZA 2XY5A 2Q31A 5ADXH 1D9FA 3HK2A 3SJJA 2BUPA 1T7PA 4DFKA 4B9QA 1G15A 2QWOA 2ZGYA 3NAEA 4CGJA 5JVHL 4FLYA 3CPWM 1YXQA 1C0FA 3GG4A 3TTCA 3O6WA 5AQPA 4HUGA 4Q5VA 4FJKA 2ASPA 1LAVA 2G8HA 4FOIA 4B9TA 4CEAA 1VRUA 1R0AA 5C0YA 1U04A 2JLEA 3V1OA 1UA0A 2NZTA 2BE2A 3PY8A 3KLFA 1BCOA 3G0ZA 1WBDA 3W0LA 3I55N 4AILC 3QMLA 3QLHA 1T03A 1HNZK 3DJCA 4GVMA 2I5JA 3MXMA 4A2BA 1BO5O 4B1YB 4E19A 1VQ8N 2Y1IA 3RR8A 1QTMA 2X74A 4CVNE 2FBYA 3CCSN 2OPSA 3O9SA 4GV9A 1VQNN 4FWPA 3SQ2A 4FZXC 3VQ9A 1TL1A 4HWIA 1RDDA 1HNVA 1L3SA 4FLXA 5CY4A 4M3RA 3ZT4A 3V81A 3WXIA 3I8BA 1W0HA 1ZBLA 3KK2A 5K14A 4FWRA 3CC2N 3OYFA 4IXCA 3PIOL 1YAGA 3O4QA 2RKIA 4LSLA 4CZFA 1S9GA 3DWLA 3TPQA 1F21A 1T6CA 3T1YK 3SV3A 3O9RA 2OPQA 3A8YA 1L3TA 1VSFA 4CJ7A 2KZZA 4FJNA 3P4IA 3MN7A 4KH4A 4DQSA 3TAMA 3PV8A 4DB3A 3AGRA 1LOTB 2HBKA 3DRSA 5LY3A 1TGOA 3HT3A 5AQVA 3KJVA 3QIPA 1XMQK 1OH8A 4ZTJA 1GLJO 2DY4A 1YUWA 3AO1A 4DR7K 1IKYA 1X3NA 3QEVA 3CQYA 4H5NA 4X66K 4NB4A 4B9VA 4GVEA 5AZJB 4CERA 3V4IA 5CZ1A 4O55A 4BRKA 4DS4A 4B3SK 3DXMB 4OGEA 4RCHA 4CIGA 3KTQA 1HYSA 1KVAA 3F9KA 4KTWA 1ASVA 3U9ZA 4C1NK 1WSJA 4CEFA 3AV9A 4OVLA 4CZIA 1S1TA 2HHTA 4KH6A 2HF3A 3C6HA 4DV2K 1CZ9A 3SMPA 4L3QA 2RPIA 1SZ2A 2D0AA 4B9SA 2YNFA 3MEGA 3QINA 4C8NA 3ENOA 3OS2A 4DTUA 3HM8A 2EX3A 5E84A 1O1WA 3NVKA 1ASUA 2OYQA 1SKWA 4Z4IA 2DPNA 1W9HA 1BL3A 3AA4A 3C6UA 3P31A 3UB5A 4CI6A 1T3VA 4DV0K 4OKEA 2GUIA 3WNGA 4DV4K 1VQ6N 3TU5A 3L3VA 4B3TK 3CIPA 4N56A 3PSIA 2P9UA 3FFKB 1RTHA 2IVOA 3VEXA 2JWKA 3FFIA 5HROA 5HOOA 1VSJA 3TSQA 4DUZK 4MLEA 1NGJA 2FSKA 5C2DA 4R5PA 1U47A 5AZIA 3F5TA 2E5LK 4CIEA 4JK8A 1UA1A 4M3WA 4M3ZA 5AR0A 4KHQA 4I6MB 4O44A 5ADXA 1VQLN 2HBJA 5AQTA 3CCUN 2O8CA 3GE1A 3CJ1A 3LDOA 3U6FA 4LFAK 4BVOA 4B9NA 4HCBA 4R79A 1N6QA 1TVRA 3SBTA 3AVGA 1D8YA 3A0IX 1NGHA 4MFBA 4BRNA 3ENHA 1JCFA 3MCPA 4FLZA 3OA9A 2RN2A 1BISA 3O1BA 2ZJPL 1WNSA 5GAEP 4IEIA 5JICA 4HUEA 2G8IA 2BANA 4FK0A 4BRPA 1GLBG 5HRPA 2QW9A 3ZX0A 2HHSA 3PX6A 1DKGD 3EKSA 1UWBA 4CJKA 3G71N 3S3MA 5E26A 3M6GA 1TL3A 1WAFA 2AJQA 2PFUA 2ZWHA 1VSMA 4B1WB 4H5TA 1XWLA 4FCYA 1VK0A 4BRLA 1BHLA 1WSEA 3RR7A 2G8KA 4BC5A 4W5TA 2E20A 2HOEA 2ETJA 3AA2A 1TKTA 3L8BA 4AHTA 3E66A 3OYEA 3D2FB 1KCFA 4DTRA 2BTFA 3AA5X 3NGIA 4E7HA 3BUZB 1HYZA 3EKUA 4F3TA 2E6LA 4N5SA 3CM6A 3VQ6A 3WUHA 2O8DB 5FPNA 5SZTA 5BN9A 1KQSM 3O9UA 4M3TA 3LZIA 3VGKA 4XIUA 3WQTA 2IS3A 2O8FB 3CPEA 3WT0A 3AY9A 3VETA 1RTDA 3DLLL 1Q8IA 1TYQA 1LV5A 2HBLA 2A1RA 1ZYQA 2VQFK 1U6ZA 3THVA 1ZBIA 2DFEA 3DLKA 1NJXA 1KLMA 3MCAB 3R8EA 4E7JA 4KH5A 2YJEA 4HTLA 1OKJA 4OO1J 2KLAA 5GINA 2P9PB 4CJTA 4CJUA 4YOTA 4H0VB 1CZBA 4YNQA 4CECA 5LL6Z 4B8CA 3O80A 4F2RA 4CGHA 4BDZA 4B1XB 4OLAA 3RMCA 5M1KA 1S6QA 4B3MK 2VCPA 3NCIA 2VWBA 3TAFA 1NK8A 4BRFA 4IOAL 5GAGP 1WN7A 2Z1IA 4DHYA 2YHYA 1S6PA 3L0QA 5KPTA 1MA9B 4LH4A 3ZSVA 1XMOK 3I8DA 3IKMA 1CXUA 1C1CA 1LW2A 2HHVA 1OVQA 1HX1A 4GV6A 1NGFA 5EY4A 1SKSA 1KAZA 1NBWA 2Z1GA 3DLBA 3C7NA 3SNNA 5KQ8A 1QQCA 1EXQA 3BZKA 3DYAA 3DRRA 4ELTA 3SYZA 3WEEB 1H1VA 3M5RA 4GKJK 2P9NB 4DFJA 3HJFA 1R59O 1TAUA 3RVCA 4LF5K 1Y97A 4H5WA 5AZJA 5KQDA 3SAFA 2F9TA 4AM6A 1HJRA 1VSDA 4YORA 2XHBA 4J2BA 2FBXA 3NGYA 2O8BA 3ZT3A 2IIRA 4YOWA 5C42A 3FGUA 5FDLA 2D1KA 3V9SA 4ID1A 4CEOA 4XH4A 2F8SA 4FPAA 3V9WA 4QS9A 3QIOA 1K9MO 1YTUA 3VN5A 3DOKA 3EL2A 4FLWA 2YHWA 1XHXA 2P1JA 2ASMA 1D5AA 1BG3A 1NGDA 2IGIA 1Z6RA 3ENBA 3V9UA 4J2EA 4EZ9A 5CYMA 4H0YB 3TR8A 3UKUB 3ZSOA 4CF0A 5HP1A 4BR2A 4TSXA 5LMUK 5AFUA 2KQ2A 1U2VA 4PA1A 3ZT1A 1RT2A 4FLTA 3MDQA 1BU6O 5TKWA 2D0BA 2GBZA 4KB0A 4LFCK 3KHYA 3HZ6A 3VF6A 2A41A 4U7BA 4FM0A 1Q9YA 3MXIA 3L4IA 3KLIA 4KTZA 2F8TA 1NGGA 2QWMA 4IG3A 4JI1K 4H4OA 3GDQA 4NLBA 5TKYA 3CJAA 2ZM6K 3IDHA 4LF9K 1YTAA 5KTQA 3VA0A 3NFAA 4CFBA 2WTUA 2VG7A 3VMFB 1WBBA 2PAVA 4RW8A 4CZJA 3D45A 4FVMA 1HNWK 4CJ4A 4QS7A 4EP4A 4EHUA 5FPEA 3D7EO 3CCLN 3T19A 1RT3A 2JWLA 5AQZA 5M1QA 1NNEA 3NDKA 4CF8A 5CE3A 3O3GA 4E7IA 1SKRA 4QS8A 4DU4A 1MU2A 1FJGK 1NJWA 3ULEB 2QWPA 4BRHA 1HQEA 3O8MA 3O5BA 1ESVA 4E3SA 2KZMA 2D0PA 3EZWA 3THYA 1KTQA 1RBUA 1KSPA 2Q3SA 2HF4A 1VSKA 4XEIA 3L2UA 1GLLO 2ITGA 2WBNA 5B8HA 3IUCA 3O9QA 4B1VA 2G8VA 1KAYA 4C1NI 1S9EA 2B6AA 1X3MA 4E7KA 4QCLA 1KLNA 3KLHA 4CJLA 4DLEA 1VSEA 3K57A 1J53A 1IG9A 2F96A 4CF2A 2ASOA 5GADP 4CJPA 1JLEA 4DV1K 2BH1A 1WSIA 2YCHA 3LPTA 5AQKA 3HPGA 3TABA 2P9SB 1JLCA 1GOAA 3P83D 4DQQA 3FZKA 5M1FA 5FRMA 2Q0UA 4JKEA 4FL9A 3AVFA 4BG9A 3NGZA 1XI1A 2HMIA 4WQ5A 4IDKA 3VGLA 4A57A 4K0KK 2O8DA 2E8AA 4ELVA 1HUXA 4OPHA 3CCMN 4F9OA 3MECA 1N34K 1N8RO 4LF8K 3SI6A 5LMNK 3QICA 3TAPA 3OYJA 3C65A 1A5WA 1BGXT 3DMJA 4YDUA 3ZX2A 3KIOA 5AQHA 2GEMA 4PKGA 3LP2A 4FO0A 2P5GA 3DXKA 2WUSA 3DLGA 5BR9A 2IVPA 2KFZA 2Q2RA 4ILHA 4A2AA 5AQXA 2KFNA 3VQQA 2D0OA 1C0MA 1J5EK 3SUQA 3TTDA 3QFUA 2HMPA 4E1NA 4DV7K 4B9MA 4U67L 1LWEA 3SZ2A 5BRHA 1EWQA 1IKXA 1Q86O 5AQOA 4FWSA 5AJ3K 4OPJA 3NMUA 3UKRB 1QQNA 1JXBA 1NJIO 3IMXA 2HHHK 1S1UA 3LAKA 3ZSRA 3G4SN 3FZMA 4IOXA 3H45C 3VEZA 3CFOA 4M45A 4DF4A 4O8UA 1BDGA 4WFNL 5BRFA 3J7ZO 1EO1A 4DQPA 2DFFA 3S3OA 1EETA 1NK7A 5GIOA 4H0TB 2QWLA 1ZBUA 2A1SA 3ZETB 2YNIA 4CJWA 1VQON 1BA1A 3OBYA 4DSJA 2HNYA 4RWTA 3RSEB 3HM9A 1MWKA 4WFBL 4FJ5A 2CH6A 2QA4N 3QEIA 1HKGA 3ID6A 4PQUA 1OH6A 2E1YA 3QFPA 4CZHA 1DTTA 3QNNA 1RBSA 4JN4A 3HRGA 1JJ2M 2E4LA 2Q0RA 2G8UA 4YHHK 3JSMA 3B6PA 4DFPA 5C15A 1WB9A 4Q0BA 2WFBA 3HBTA 4PL7A 4H5VA 2O8EB 3O3HA 2P5OA 1JCEA 4EFHA 2QK9A 1YJWN 2IC3A 2OZMA 5M1PA 4FJ9A 4HUFA 1K8KA 2FSNA 4YOUA 4L8RB 3M3ZA 1GLDG 3HVRA 1VQ4N 1ATRA 2DFHA 2X78A 4IJNA 5DK5A 4DMNA 5KGXA 3K5LA 5C12A 3K59A 4DF8A 3S3NA 4B8AB 3KWGA 2D0CA 4CZMA 3O08A 3TAQA 1BI4A 3RMAA 1V4TA 4CCHA 2NRZA 3MN6A 5EOYA 1TUYA 4KHWA 5J1EA 2D4WA 2Q1NA 1E4GT 2ATQA 2W42A 3M8SA 4IBNA 1T44A 3VERA 4BWMA 2O4IA 4BRAA 1K8AO 4BE2A 3QERA 3OYCA 4E1JA 3CM5A 5FRNA 4NYFA 4DV5K 2IVNA 3A5OC 3S41A 1TK8A 1C0UA 2OPPA 4O8KA 1C1BA 4KFBA 4DR4K 2NRWA 3CC4N 4JLHA 3ZX3A 3ULEA 3AAPA 3V1RA 1BOTO 4NCGA 3K58A 4FJHA 3TI0A 4BACA 3HL8A 4N41A 4OPKA 1XQSC 4EZ6A 4BC2A 1S1XA 4V19S 3N4PA 4IFYA 1YI2N 3AVJA 2XY8A 3D2EA 1U4BA 4K8ZA 2W41A 3TSPA 4YY3K 1K73O 4I2QA 3OYIA 4BVPA 3LP0A 3SJHA 1V4SA 2Z1JA 4K43A 3A5MC 3TAEA 3G10A 4EIAA 3THXA 4KHUA 4OGCA 5J2MA 1KRPA 4B08A 3DAWA 5AQNA 4H0XB 3VF4A 5F2RA 1RBRA 1YF5L 1VQ5N 3EY1A 3HSTB 2P9KB 1NOZA 1FK9A 2QKBA 4DR5K 4FLUA 4PKIA 1NKCA 3IRXA 3K5NA 1Q9XA 3CCQN 3PSFA 3SLCA 2YHXA 4IEEA 4KO0A 4BRIA 4N47A 5C25A 3CJCA 1HQUA 1BIZA 3C6AA 3AVNA 1LWFA 4JD2A 5LJWA 1LW0A 3FLCO 4FJ7A 2P9IA 3SQ0A 2PBDA 3LDNA 3R1XA 3O4WA 1FKOA 1WSHA 1S22A 4FOEA 1HNIA 3CF5L 5AQLA 1OH5A 2OA8A 2YJFA 3AO5A 3HOTA 4WQ5C 4DLGA 4JK9A 2HHWA 5FROA 4DTOA 4LF7K 2A42A 3HP9A 2ITMA 4BC4A 3SPYA 4OLBA 3IG1A 4J8FA 1RFQA 3CCJN 2NUBA 4NO7A 4NXNK 2A5XA 3SBGA 3U3GA 4CJEA 5CHIA 2P51A 1I94K 1IG8A 2QEXN 3BP8A 2G8WA 4O5FA 1NLVA 1P8ZA 3P39A 1K6YA 1SL0A 4YDUC 4M3XA 4IOCL 1HJOA 5JLHA 4JKFA 2F4VK 3GBTA 2P9LB 4JKGA 5KGWA 4FXDA 4CIFA 2CGKA 5HL7L 1NU0A 1OH7A 3D0PA 2E2NA 2PZSA 4JKCA 4AHVA 4KKOA 3CCVN 5C2FA 2FBTA 3ZEUB 3U8XA 4BWJA 4JYAK 4XH1A 4MDBA 3B8AX 1Z25A 3E9LA 3RWUA 4DQ8A 2Q36A 3RRGA 2FXUA 4RW7A 1KVBA 2QXFA 2VGNA 1DGKN 4FLVA 1YIJN 3DI6A 4CEDA 4KB1A 2NRTA 4BR7A 4DSIA 1U49A 3AVAA 4JI4K 1HPMA 4CEQA 4MLHA 3EE8A 4KHSA 2V52B 4FYDA 4GY2B 4IDHA 2I7NA 1A5VA 4IZ9A 3BZCA 4CBWA 4LD0A 3J7AP 5AQSA 3THWB 1VQ7N 4IG0A 2HNDA 1QS4A 5FPMA 1RBVA 2B4JA 4NCAA 4JNEA 2XO7A 4W5QA 1YVNA 2GWJA 4DWIA 3SAHA 4IO9L 2WC9A 4H5RA 3H3NO 2HHUA 1RDBA 1I39A 4ZTFA 3ALYA 3CQ8A 3ASMA 4HTUA 3QDKA 1RT1A 4DR1K 2ZQBA 4PY5A 1L3VA 3OS0A 1QHTA 2QWNA 4M3YA 4A5BA 3VEVA 4W5RA 3VQDA 4DTSA 1NKBA 3CC7N 3LANA 1QZ6A 5AQUA 1IH7A 3JS6A 3EN9A 3D6RA 2OANA 2ZF5O 4JV5K 4A61A 1RTIA 4C8OA 2FF3B 2HB5A 3J7YP 4CFDA 4AM7A 4JHDB 3A5NC 4E7LA 3J80O 1SUQA 5JLFA 3VESA 4KTQA 1YHQN 1IBMK 1Q7YO 2F7TA 4BROA 1VQPN 3L6QA 3NH0A 1HKBA 1ZC6A 5BPLA 4DU3A 2HVIA 4KBOA 4W5NA 4XH5A 4Y1DA 4DSEA 5BPNA 3VF2A 3OYAA 4FJJA 4BR0A 3CQXA 1Y64A 3LP3A 1TKXA 3W3DA 3OYKA 1DLOA 4H0PA 3HYFA 4DFMA 2CGJA 3P1GA 3M1FA 1GLCG 4FJIA 2VWJA 4ISGA 4BRDA 4K8XA 3SUNA 4DTJA 1XC9A 4M7XA 3FZFA 4J2AA 3CD6N 5M1OA 2QKKA 1DT9A 2UXBK 5BPMA 3DXMA 4OKJA 3G25A 5IWAK 4JI2K 4BE1A 4B9UA 4HCCA 4FZZA 4EAHD 2IOCA 4DTPA 1NK9A 5FPDA 4CEBA 3AVMA 3OYGA 4LF6K 4IFEA 1X9SA 1GOCA 1UAXA 1IKVA 5JVGL 4LH5A 4LC9B 3ZYYX 3VPZA 3TARA 2DTUA 3ZT2A 3KLEA 2FBVA 4O0JA 4FWQA 3O1WA 3G6EN 1KXPA 1BIUA 3MEDA 2UYTA 1VRTA 4BR4A 3SV4A 2GV9A 4DR3K 4H03B 3U3YA 3EE9A 2YKMA 5JS1A 2HBMA 1WSFA 1ILYA 3OW2M 3T69A 1YT3A 3H1VX 3OJUA 4ELUA 4FWKA 4CBUA 3QESA 3V6DA 1SL2A 4CF9A 1X9MA 1RT4A 5IT9O 3DLEA 3H3OB 2NRVA 1KD1O 1YITN 2QI2A 4B1UB 4BGAA 4I6MA 4WYBA 2W40A 5ELZA 3CCEN 2IDOA 2E6MA 5KI6A 4H4MA 3AVHA 3AO2A 3LPUA 1IBLK 4DR6K 3WNFA 1RCHA 2KHOA 1CXQA 4E89A 3AVBA 3K5MA 1S5JA 3ID8A 3VQ5A 2CH5A 3C94A 3DRPA 3L2VA 1HRHA 3SPZA 4J2DA 2G8FA 1GLFO 4ILGB 4HHTA 5KRTA 1SV5A 4FM1A 4DTMA 2E88A 3I33A 4M63C 1Q81O 1RBTA 1VSIA 1BCMA 5T7BA 2YKNA 3N4QA 2VG5A 3QETA 1C0TA 1NJZA 3OY9A 1EX4A 3L3UA 5C24A 3OYBA 1ZBFA 3M8QA 3V9ZA 1ATSA 3D2FA 4FWOA 3WQUA 4CK3A 3OJSA 2EHGA 4JRQA 3ULDA 5DMRA 1HNXK 4O5BA 2PYLA 4E0DA 2HSTA 1NGBA 3E9PA 4JK7A 3FZLA 4KHPK 3HTVA 2I7PA 1TKDA 2KKZA 3SAGA 4DQRA 1VQKN 2EWSA 2AA4A 2P9UB 1XHZA 3L4QA 4CHOA 1NJYA 1S72N 1QSYA 4I9LA 2FF6A 2B5JA 2O8FA 2H3GX 1BQMA 4ZHRA 5EX5A 1W97L 1VHXA 5AZIB 4JKHA 3VQEA 3T7ZA 3LWMA 5SWMA 3OHRA 5I9EB 4AHCA 2OTLN 3LM2A 5I3UA 4C8LA 3QBWA 5EXWA 1X9JA 1WLJA 4MQ3A 3HPOA 2O8CB 2UU9K 4GMJB 4BR5A 3ZCMA 4AHRA 2PYJA 1MDUB 3U9DA 5GAHP 4Z4GA 3BY5A 2F9WA 5CYQA 2P9PA 4BREA 1NK0A 4X65K 3HXMA 3NH1A 1S3XA 3CJ9A 4BRGA 3AVCA 3VQ8A 3M8PA 3DOLA 4DG1A 4ISFA 1J54A 5JMVA 2YV0X 4DV3K 2ZJRL 1E4FT 4B9LA 4NLCA 4CHQA 2VGMA 1RDCA 1JLGA 3DM2A 1ZXOA 4EP5A 4AH9A 3JXUA 1RDWX 4JI3K 4CE9A 3VOVA 1RDAA 3SK3A 3HO1A 3MX5A 4YOYA 3V9XA 3VTIA 3SQ1A 3WXKA 3KD5E 3AA3A 4JRPA 3M8RA 1QZ5A 3I0RA 3KK3A 5J2NA 3NF6A 3HOSA 4WF9L 1LWCA 2UXCK 1L3UA 3F9MA 1C0GA 1RT5A 1W2BM 4DV6K 4DTXA 3WEEA 1VQ9N 1QQOA 2IAJA 3KWIA 4FWLA 2P9NA 4G9ZA 1QE1A 4FWNA 1B9DA 4RW9A 4F8RA 2HHXA 3C6TA 4JEPA 1XUPO 3QB0A 3VQ4A 4LY7A 3VGMA 4DUYK 1KAXA 3NBPA 1QSLA 5CZ2A 1XNQK 4N76A 3SUOA 4RG8A 1TV6A 2KW4A 1IBKK 1TYQB 2NLXA 1SS6A 2X6SA 5HRNA 4KPYA 1GLEG 3KKSA 5I42A 4FSVA 1RT7A 5KRSA 4CK1A 3CYMA 5E41A 4RW4A 4Y1CA 3OBWA 4FVUA 3KKRA 1NOYA 5KPRA 4GW6A 3TAGA 5MLCQ 3UKUA 1NG9A 1BA0A 3OYHA 4KREA 3BEXA 1P90A 3ZSYA 4PHTX 3AAQA 3O3FA 1T05A 2VG6A 1NK6A 2OPRA 4LFBK 3KVGA 4BDPA 1DEJA 1C6VA 4AHUA 5AQFA 1EP4A 5AQRA 3QEXA 4CHPA 4CGDA 4IJAA 4CHYA 4GNIA 1Z26A 1ASWA 1DTQA 2A3ZA 3L2WA 1QHAA 4BRCA 4JKDA 1O13A 4M7YA 2FLOA 4YOVA 2NRHA 3LL3A 3FE1A 4JI5K 3C7NB 2YHAA 3GOIA 3K9KA 4CGFA 3MAQA 4KHNA 3MWTA 3JAMO 4K42A 3CFRA 1B92A 3K2PA 3ATUA 3TSUA 2E1ZA 4ICLA 3T1HK 1S1WA 2NRRA 5GIPA 4CJ5A 4ISEA 4AQYK 4CBXA 4BE0A 1KC8O 3MN9A 1GOBA 4DS5A 3WNEA 1VAZA 4OKKA 4CJQA 5BR8K 4Z4EA 2E2PA 2QXLA 2QWQA 1JLFA 5CR4A 4CFAA 3AARA 1TKZA 2VYPA 2O8BB 5AQJA 2AP1A 3AO4A 1RGIA 1XNRK 2OCEA 4Z94A 5AQQA 5EU7A 1NWKA 4BRMA 4BRQA 3C95A 4KI4A 4BQLA 4QOZB 1M1KO 4FK2A 1JL2A 2E2OA 3ISNC 5DM7L 5HBMA 1NK4A 4RTFD 4G1QA 3WXMB 2YI1A 4B1ZA 1U2VB 3QEWA 2P9SA 3VEYA 3R9PA 5A2QO 4I2PA 1NM1A 3H6EA 4UY8O 3HVTA 3CERA 3RTVA 2VQEK 3LAMA 1XC3A 4FW1A 4BC3A 3VQPA 4FM2A 3B6OA 1TK0A 2RF2A 3K9JA 2W6KA 3MX2A 3V1QA 3P5JA 1NGIA 4E1MA 3ZT0A 1G99A 4NYNA 4WCEL 2KTQA 3VTHA 2O4GA 1M90O 4IKFA 3PO5A 4M3UA 4BR9A 2HHQA 1J5OA 1WAJA 1JL1A 1Q18A 3VQCA 4A62A 3NF9A 4BY9C 4CZKA 4C8MA 1LCUA 1VSHA 5BN8A 4JKAA 1W7AA 2VWKA 3H46O 2D5RA 2XY6A 1VSLA 1X1PA 5AFUH 1ZBSA 5EVZA 4JS4A 2XRIA 3AVIA 4K41A 3CI5A 2YHBA 5HRSA 2ZJQL 1RNHA 3HPHA 3THYB 5BREA 3OYDA 3ITHA 3J81O 4F2SA 4DQIA 1JCGA 2NNWA 3H08A 3CMAN 1ITGA 5H1SQ 3PX4A 3UIQA 3Q7BA 1IV0A 4CZGA 2BGGA 4CJRA 3UKRA 4C23A 2WOMA 2OZSA 1CZAN 4LSNA 3RRHA 3SQ4A 5C10A 4EHTA 3LDSA 3BF1A 3ZSWA 4MO5A 4H8KA 1MWMA 4FJ8A 4NCBA 2LSNA 4KV8A 3ZLJA 4WQ4A 4IFVA 2UXDK 3F2KA 3ZETA 1ZBHA 2A40A 2YNHA 4Z0UA 1YVUA 1HYVA 3CJBA 4CGGA 3RMBA 1NKEA 4M41A 4NXMK 5HLFA 4WFAL 4JAXA 3PO4A 3RSEA 3VA3A 3EO3A 4AF1A 5KPZA 3R3LA 2V51B 4CJ3A 2GELA 2V7YA 3LWLA 3DLHA 2Z1HA 3RMDA 4FPBA 4YFUA 3VQ7A 3NE6A 2NRXA 3MMVA 3E01A 4HVJA 4GV3A 4BDYA 3PUFA 4FW2A 4CEEA 1EQYA 1NGAA 2GWKA 4O0IA 3Q7CA 3MK6A 5AQYA 4O4GA 3KLGA 3HP6A 5HRRA 3J8AA 2FC0A 3CG7A 3PIPL 3DXKB 3AO3A 2O8EA 2Y1JA 2ZE2A 1KFDA 2X6NA 2GTDA 3C0BA 5AQIA 4CW7B 4CZEA 3PLAA 1NGCA 1QQMA 1J6ZA 3ZSQA 4OJRA 3VEWA 3OYLA 1WOQA 1HR0K 3DLRA 4CK2A 4KAZA 3BGRA 3LALA 4CD1A 4CD3A 3BF3A 3MXJA 3TTFA 3MN5A 4Y0WA 1QVGM 1IO2A 5J2QA 1QSSA 5DM6L 4MDAA 3LP1A 3NF7A 3NVMA 3A5LC 3U4LA 2UUBK 1Z05A 1T6DA 1E3MA 3CETA 2QM1A 3VQAA 4Z4HA 2UUAK 5F1XA 4CFCA 1BQNA 4FWMA 3CMEN 4FJMA 4OPAA 2J4RA 2RHKA 2BDPA 4IO8A 1RTJA 3JYTA 1YJ9N 3TWHA 3WXJA 1T8EA 1ATNA 4CEZA 3ATVA 4DSLA 2W6LA 1RDUA 3LZJA 4I9QA 4B3RK 3QEPA 2PY5A 4GKKK 3FR0A 1JLQA 4BG8A 5J2PA 1IKWA 2Q97A 2V7ZA 2HNZA 4B3OA 5D3GA 1FKPA 4W5OA 3OTOK 1JXEA 3KK1A 3F73A 1NK5A 1B9FA 4H0OA 4CHZA 4CESA 3HSCA 3K0SA 1D9DA 3KD1E 3WNHA 1KVCA 5LJVA 4JS5A 1L5UA 1CLQA 4F4KA 4KI6A 4UQGA 3PX0A 3CHWA 3NHGA 3E9OA 1LAWA 2RE2A 1K8KB 2P9KA 3O4NA 3L2RA 2HVHA 5F0XA 3OS1A 1NGEA 2XY7A 1HLUA 1SL1A 4FZYA 3LDLA 1C1AA 3FZHA 4DSKA 2JGUA 1QVFM 4AHSA 3S9HA 4Z4CA 4YOXA 1BI4B 5FLXO 3KK7A 3WXLA 4LF4K 2GX9A 4ID5A 4DCHA 3SMSA 3QBXA 3LDQA 3P38A 3ZSXA 3BDPA 5AQGA 3VENA 1NMDA 3HI0A 3TANA 2YNGA 1TK5A 4CJFA 3R6MA 3OYNA 3A2FA 4WE1A 4QAGA 4JI6K 4C8KA 3E1YA 1D4XA 1UOCA 1FW6A 2ZD1A 1N32K 1SQKA 3K5OA 4FJGA 4X62K 2QWRA 5M1NA 1X9WA 4JI0K 3L2QA 1FXXA 1S1VA 1NMNA 3IAYA 3KZBA 3VQBA 3NF8A 1OVYA 1IJJA 2P9LA 4FK4A 4RW6A 3MWPA 1JLAA 1JLBA 4BQZA 1VQMN 2YX6A 1J9AA 3D2EB 2R7YA 1N5YA 4DU1A 4KHYA 4MO4A 3ZEUA 3I0SA 3AGKA 1YJNN 3SCXA 4IWVA 5AQMA 3SUPA 4M42A 2OTJN 4KRFA 3THXB 3O9TA 4FJXA 1RT6A 1REVA 3ZSZA 3CCRN 4CF1A 3AVLA 1I3AA 3IS9A 3T1AA 2ZGZA 1HKCA 3EYZA 5JS2A 2FSJA 4PWDA 4CJSA 4DTNA 1U48A 1GLAG 1BWFO 2WONA 3VEOA 4DR2K 4X64K 3LM9A 3IFRA 5AQWA 1EKEA 4PUOA 4Z4FA 3EZ5A 3CFPA 4WQ4C 1WSGA 3OYMA 1TAQA 3THWA 3EEQA 4JD2B 3UE5A 4OX9K 1EWRA 2P9IB 3T3FA 3LDPA 3I56N 4A59A 4CJVA 1TUUA 4ILJA 4JKBA 4BGBA 4CGIA 3NH2A 4K25A 1RILA 2E2QA 1N36K 1HMVA 2QTDA 4F3OA 4PL8A 5BRDA 4PKHA 1KFSA 1U45A 1BUPA 3QO9A 3CXCM 1Q82O 2A6AA 4I7FA 3MEEA 4JI8K 3QNOA 1A5XA 1HPZA 1N33K 2GUPA 2UUCK 4DSFA 2HW3A 4FJLA 4DKWA 4JHDA 4JKGB 2CGLA 4A5AA 3GL1A 1JKHA 4JI7K 4CZLA 3AVKA 3H1QA
chains in the Genus database with same CATH topology
4CHNA 4IG3A 3AO4A 1RBVA 2B4JA 3OVNA 4NCAA 2XO7A 4H4OA 4W5QA 2XY5A 4DWIA 5EU7A 1YTAA 5KTQA 3VA0A 3C95A 1D9FA 3NFAA 1RDBA 3SJJA 4KI4A 3HK2A 2HHUA 4CFBA 1T7PA 4QOZB 1I39A 4ZTFA 2VG7A 4DFKA 3ALYA 3CQ8A 4FK2A 1JL2A 3ASMA 4HTUA 4RW8A 1RT1A 1G15A 3ISNC 3NAEA 3D45A 4FVMA 4CGJA 2ZQBA 4CJ4A 4FLYA 4EP4A 4PY5A 5HBMA 1NK4A 1L3VA 3OS0A 1QHTA 3T19A 4M3YA 1RT3A 4HUGA 4Q5VA 4W5RA 3NDKA 4G1QA 4CF8A 4FJKA 3VQDA 4DTSA 1LAVA 3O3GA 4E7IA 1NKBA 1SKRA 2G8HA 3LANA 4B9TA 4CEAA 1VRUA 1R0AA 1IH7A 4DU4A 3QEWA 1U04A 1MU2A 1NJWA 2JLEA 4I2PA 3V1OA 1UA0A 1HQEA 2BE2A 3PY8A 3KLFA 3HVTA 1BCOA 1RTIA 3G0ZA 4E3SA 4C8OA 2HB5A 2KZMA 4CFDA 1KTQA 1RBUA 3RTVA 1KSPA 2Q3SA 4E7LA 1SUQA 3LAMA 4KTQA 1VSKA 4AILC 4FW1A 3QLHA 3VQPA 3L2UA 1T03A 4GVMA 3NH0A 2I5JA 2ITGA 4DU3A 4FM2A 3MXMA 3B6OA 2HVIA 1TK0A 2G8VA 2RF2A 4E19A 2Y1IA 3RR8A 1QTMA 2X74A 3V1QA 4W5NA 1S9EA 4Y1DA 2B6AA 3P5JA 4DSEA 4E1MA 2FBYA 4E7KA 1KLNA 4QCLA 3ZT0A 3KLHA 4FJJA 3OYAA 2OPSA 4NYNA 2KTQA 4CJLA 4DLEA 1VSEA 3K57A 3LP3A 1J53A 1IG9A 1TKXA 2O4GA 3SQ2A 2F96A 3OYKA 3PO5A 4FZXC 3VQ9A 4IKFA 1TL1A 4M3UA 1RDDA 1DLOA 4CF2A 3HYFA 2HHQA 4DFMA 1J5OA 1HNVA 1L3SA 1WAJA 3P1GA 4CJPA 1JL1A 1JLEA 4FJIA 3VQCA 3NF9A 4FLXA 1WSIA 5CY4A 4C8MA 4M3RA 3ZT4A 1VSHA 3LPTA 2VWJA 2VWKA 3HPGA 2D5RA 3V81A 2XY6A 3TABA 3SUNA 4K8XA 1VSLA 1X1PA 4DTJA 1XC9A 4J2AA 4JS4A 1JLCA 1GOAA 2XRIA 3AVIA 3P83D 2QKKA 4DQQA 5FRMA 1W0HA 2YHBA 5HRSA 1ZBLA 3KK2A 4OKJA 5K14A 1RNHA 3AVFA 3HPHA 3NGZA 3OYFA 1XI1A 3O4QA 2HMIA 3OYDA 2RKIA 3ITHA 4F2SA 4LSLA 4IDKA 1S9GA 4DQIA 3H08A 4BE1A 4B9UA 3PX4A 1ITGA 3UIQA 4ELVA 1F21A 4HCCA 4FZZA 2BGGA 3SV3A 4CJRA 2OPQA 3MECA 1L3TA 1VSFA 2IOCA 2WOMA 3SI6A 2KZZA 4DTPA 4FJNA 3TAPA 4LSNA 3RRHA 3OYJA 3SQ4A 1A5WA 1NK9A 4DQSA 3TAMA 1BGXT 3LDSA 3PV8A 3ZSWA 4CEBA 3AVMA 3DMJA 4H8KA 3OYGA 1X9SA 4FJ8A 1GOCA 1UAXA 4NCBA 1IKVA 2LSNA 3DRSA 3KIOA 1TGOA 4KV8A 4LH5A 3HT3A 3LP2A 3KJVA 4IFVA 3QIPA 2P5GA 3DLGA 1ZBHA 3TARA 4ZTJA 2DTUA 2YNHA 4Z0UA 1YVUA 1HYVA 3ZT2A 3KLEA 3AO1A 2KFZA 2FBVA 2DY4A 1IKYA 4O0JA 4CGGA 3QEVA 3RMBA 1BIUA 3MEDA 1NKEA 4M41A 4B9VA 4CERA 1VRTA 3V4IA 5CZ1A 5HLFA 3SV4A 2GV9A 2KFNA 4O55A 3VQQA 3PO4A 3VA3A 3U3YA 4DS4A 2YKMA 1C0MA 5JS1A 4OGEA 1WSFA 3SUQA 4CIGA 3KTQA 1HYSA 4E1NA 1YT3A 4CJ3A 4B9MA 1KVAA 3F9KA 3OJUA 4KTWA 4ELUA 1LWEA 3SZ2A 3LWLA 1ASVA 3QESA 3DLHA 1IKXA 2Z1HA 3V6DA 3RMDA 1SL2A 4OPJA 1WSJA 4CF9A 4YFUA 1X9MA 3VQ7A 1RT4A 1JXBA 4CEFA 3AV9A 4OVLA 3NE6A 1S1UA 3LAKA 3ZSRA 1S1TA 3E01A 3DLEA 4HVJA 2HHTA 4BDYA 3PUFA 4FW2A 3CFOA 4CEEA 4M45A 4DF4A 1CZ9A 2RPIA 4O0IA 2D0AA 4B9SA 4DQPA 2YNFA 2DFFA 3S3OA 4O4GA 3KLGA 3HP6A 5HRRA 1EETA 3MEGA 1NK7A 2FC0A 3QINA 2IDOA 2E6MA 3CG7A 5KI6A 1ZBUA 3AO3A 2A1SA 4H4MA 3AVHA 3AO2A 2Y1JA 2ZE2A 3LPUA 1KFDA 4C8NA 3OS2A 2YNIA 2X6NA 4CJWA 4DTUA 3WNFA 2EX3A 1RCHA 4DSJA 1CXQA 1O1WA 1ASUA 2HNYA 2OYQA 4E89A 3AVBA 1SKWA 4Z4IA 1W9HA 3K5MA 3ZSQA 1S5JA 1BL3A 3AA4A 3C6UA 4OJRA 3OYLA 4OKEA 2GUIA 3WNGA 3HM9A 4FJ5A 3QEIA 3DLRA 3VQ5A 3L3VA 4CK2A 3C94A 3BGRA 3DRPA 3LALA 4N56A 4KAZA 1RTHA 3L2VA 1HRHA 4PQUA 3FFIA 3SPZA 5HROA 4J2DA 1VSJA 2G8FA 1DTTA 4HHTA 3MXJA 5KRTA 1SV5A 4R5PA 3QNNA 1IO2A 4FM1A 5J2QA 1RBSA 4DTMA 1U47A 1QSSA 1RBTA 2E4LA 1VSIA 3LP1A 2G8UA 1BCMA 3NF7A 4CIEA 5T7BA 3JSMA 1UA1A 2YKNA 4M3WA 4M3ZA 3B6PA 4KHQA 4DFPA 4O44A 2VG5A 4Q0BA 3QETA 1C0TA 1NJZA 3OY9A 1EX4A 3L3UA 5C24A 3OYBA 3U6FA 4B9NA 1ZBFA 3M8QA 4HCBA 1N6QA 3VQAA 4Z4HA 3O3HA 2P5OA 4CFCA 3V9ZA 1BQNA 1TVRA 3OJSA 4CK3A 3ULDA 4JRQA 2EHGA 4FJMA 5DMRA 3AVGA 2QK9A 2BDPA 2IC3A 1D8YA 2OZMA 4O5BA 1RTJA 4MFBA 3JYTA 2PYLA 4E0DA 4FJ9A 4HUFA 1T8EA 3TWHA 4FLZA 2RN2A 1BISA 4CEZA 1WNSA 1TKDA 4HUEA 4L8RB 2G8IA 4DSLA 4I9QA 3LZJA 3HVRA 4DQRA 2BANA 2DFHA 2X78A 4DMNA 5DK5A 5KGXA 3QEPA 2PY5A 4FK0A 3K5LA 5HRPA 1XHZA 1NJYA 4CHOA 2HHSA 1JLQA 3PX6A 5J2PA 3K59A 4DF8A 3S3NA 4B8AB 1QSYA 1UWBA 1IKWA 4I9LA 2B5JA 4CJKA 2D0CA 3S3MA 2HNZA 3TAQA 1BI4A 1BQMA 5D3GA 1TL3A 1WAFA 1FKPA 4ZHRA 4B3OA 2AJQA 3VQEA 1VSMA 4W5OA 3LWMA 5SWMA 3RMAA 1JXEA 4CCHA 1XWLA 4AHCA 3KK1A 4FCYA 1VK0A 1BHLA 3F73A 1WSEA 3RR7A 4KHWA 2G8KA 5I3UA 5J1EA 4W5TA 1NK5A 4C8LA 1B9FA 2ATQA 1WLJA 2W42A 2ETJA 4MQ3A 4CHZA 3M8SA 4IBNA 4CESA 4BWMA 3HPOA 1D9DA 3KD1E 3AA2A 2O4IA 3WNHA 1TKTA 3L8BA 1KVCA 4AHTA 4GMJB 4BE2A 3ZCMA 4AHRA 4JS5A 1L5UA 2PYJA 3OYEA 1CLQA 4Z4GA 3QERA 3OYCA 4F4KA 1KCFA 5CYQA 4KI6A 4UQGA 1NK0A 3HXMA 3CM5A 4DTRA 3NH1A 5FRNA 4NYFA 3PX0A 3NHGA 3AA5X 3AVCA 3NGIA 3VQ8A 1LAWA 3O4NA 3L2RA 4E7HA 1TK8A 1HYZA 3M8PA 4F3TA 2HVHA 2E6LA 1C0UA 3DOLA 4N5SA 3CM6A 4DG1A 2OPPA 3OS1A 3VQ6A 2XY7A 1C1BA 1J54A 4KFBA 1SL1A 4FZYA 4JLHA 2YV0X 3V1RA 4B9LA 5SZTA 1C1AA 4NCGA 3K58A 4FJHA 3TI0A 4BACA 4M3TA 3HL8A 4CHQA 4DSKA 3LZIA 2JGUA 4N41A 4OPKA 1RDCA 4XIUA 4AHSA 2IS3A 1JLGA 4Z4CA 3S9HA 4EZ6A 1S1XA 3DM2A 1BI4B 4IFYA 4EP5A 4AH9A 3AVJA 2XY8A 1U4BA 4ID5A 4CE9A 1RTDA 4K8ZA 1RDAA 1Q8IA 3ZSXA 1LV5A 3BDPA 3HO1A 4I2QA 3OYIA 2A1RA 1ZYQA 3LP0A 3V9XA 2Z1JA 3THVA 1ZBIA 2DFEA 3DLKA 3SQ1A 3TAEA 1NJXA 3TANA 2YNGA 3G10A 1KLMA 1TK5A 3KD5E 4CJFA 3OYNA 4KHUA 4OGCA 4E7JA 3A2FA 3AA3A 5J2MA 4JRPA 4WE1A 3M8RA 1KRPA 3I0RA 4B08A 3KK3A 5J2NA 3NF6A 4QAGA 1LWCA 4C8KA 1L3UA 1UOCA 2ZD1A 1RT5A 4CJTA 4CJUA 1CZBA 4YNQA 1RBRA 4CECA 4FJGA 3K5OA 4B8CA 3EY1A 4F2RA 4DTXA 4CGHA 4BDZA 2IAJA 3HSTB 3RMCA 1S6QA 4OLAA 1X9WA 1NOZA 1FK9A 2QKBA 1QE1A 3L2QA 1FXXA 1S1VA 4FLUA 1B9DA 3IRXA 3K5NA 4RW9A 1NKCA 1Q9XA 4F8RA 3NCIA 1NK8A 3C6TA 3VQBA 3TAFA 3IAYA 2HHXA 3NF8A 4KO0A 3VQ4A 4N47A 4LY7A 1WN7A 2Z1IA 5C25A 4FK4A 1HQUA 1BIZA 3NBPA 4RW6A 1QSLA 1JLAA 1JLBA 3AVNA 1S6PA 1LWFA 5CZ2A 1LW0A 4N76A 4FJ7A 4LH4A 3ZSVA 1J9AA 3I8DA 3SUOA 3SQ0A 2R7YA 4RG8A 1TV6A 1N5YA 1FKOA 1WSHA 2KW4A 4DU1A 1CXUA 1C1CA 2X6SA 1LW2A 1HNIA 2HHVA 4KHYA 3I0SA 5HRNA 2OA8A 4KPYA 3KKSA 3SCXA 5I42A 3SUPA 4M42A 1SKSA 4KRFA 1RT7A 3AO5A 4FJXA 1RT6A 2Z1GA 3DLBA 5KRSA 4DLGA 1REVA 3ZSZA 3CYMA 4CK1A 4CF1A 5E41A 2HHWA 3AVLA 4RW4A 5FROA 1I3AA 3IS9A 4Y1CA 3T1AA 4DTOA 1QQCA 3SNNA 3HP9A 3KKRA 1EXQA 1NOYA 4GW6A 3TAGA 3DYAA 3OYHA 3EYZA 5JS2A 4KREA 4PWDA 3DRRA 3SPYA 4OLBA 3IG1A 4CJSA 4DTNA 1U48A 3ZSYA 4ELTA 3SYZA 2NUBA 3O3FA 2WONA 1T05A 4CJEA 2VG6A 3U3GA 2P51A 4DFJA 1NK6A 2OPRA 3HJFA 1TAUA 1EKEA 2G8WA 4PUOA 4BDPA 1Y97A 1K6YA 1SL0A 4Z4FA 1C6VA 4M3XA 4AHUA 3EZ5A 3CFPA 1EP4A 1WSGA 1HJRA 1VSDA 3OYMA 3QEXA 2XHBA 4J2BA 5KGWA 4CHPA 4CGDA 4FXDA 1TAQA 2FBXA 3NGYA 4CHYA 4CIFA 3ZT3A 1Z26A 5C42A 5FDLA 3D0PA 1ASWA 1DTQA 4ID1A 3V9SA 4CEOA 3T3FA 2PZSA 4AHVA 2F8SA 4KKOA 3V9WA 3L2WA 4CJVA 3QIOA 1YTUA 2FBTA 3VN5A 4CGIA 3DOKA 3NH2A 1RILA 4BWJA 4FLWA 1XHXA 2P1JA 1D5AA 1Z25A 1HMVA 3RWUA 2IGIA 4CGFA 2YHAA 3V9UA 3RRGA 3MAQA 4F3OA 4J2EA 4KHNA 4EZ9A 5CYMA 4RW7A 1KFSA 3CFRA 1B92A 3K2PA 3TR8A 1U45A 3ZSOA 3QO9A 1KVBA 4CF0A 2QXFA 5HP1A 4ICLA 1S1WA 4CJ5A 4TSXA 4FLVA 4KB1A 3DI6A 4CEDA 4DSIA 2KQ2A 4I7FA 4BE0A 4PA1A 3AVAA 3MEEA 3ZT1A 4CEQA 1U49A 1GOBA 1RT2A 4DS5A 4FLTA 4KHSA 3WNEA 3QNOA 4FYDA 2D0BA 2GBZA 4KB0A 4OKKA 1A5XA 4CJQA 1HPZA 4Z4EA 1A5VA 4DSFA 2HW3A 4FJLA 4FM0A 1JLFA 4LD0A 1Q9YA 3MXIA 4CFAA 1JKHA 1TKZA 3KLIA 4IG0A 4KTZA 2F8TA 2OZSA 2HNDA 3AVKA 1QS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHN A;  4IG3 A;  3AO4 A;  1RBV A;  2B4J A;  3OVN A;  4NCA A;  2XO7 A;  4H4O A;  4W5Q A;  2XY5 A;  4DWI A;  5EU7 A;  1YTA A;  5KTQ A;  3VA0 A;  3C95 A;  1D9F A;  3NFA A;  1RDB A;  3SJJ A;  4KI4 A;  3HK2 A;  2HHU A;  4CFB A;  1T7P A;  4QOZ B;  1I39 A;  4ZTF A;  2VG7 A;  4DFK A;  3ALY A;  3CQ8 A;  4FK2 A;  1JL2 A;  3ASM A;  4HTU A;  4RW8 A;  1RT1 A;  1G15 A;  3ISN C;  3NAE A;  3D45 A;  4FVM A;  4CGJ A;  2ZQB A;  4CJ4 A;  4FLY A;  4EP4 A;  4PY5 A;  5HBM A;  1NK4 A;  1L3V A;  3OS0 A;  1QHT A;  3T19 A;  4M3Y A;  1RT3 A;  4HUG A;  4Q5V A;  4W5R A;  3NDK A;  4G1Q A;  4CF8 A;  4FJK A;  3VQD A;  4DTS A;  1LAV A;  3O3G A;  4E7I A;  1NKB A;  1SKR A;  2G8H A;  3LAN A;  4B9T A;  4CEA A;  1VRU A;  1R0A A;  1IH7 A;  4DU4 A;  3QEW A;  1U04 A;  1MU2 A;  1NJW A;  2JLE A;  4I2P A;  3V1O A;  1UA0 A;  1HQE A;  2BE2 A;  3PY8 A;  3KLF A;  3HVT A;  1BCO A;  1RTI A;  3G0Z A;  4E3S A;  4C8O A;  2HB5 A;  2KZM A;  4CFD A;  1KTQ A;  1RBU A;  3RTV A;  1KSP A;  2Q3S A;  4E7L A;  1SUQ A;  3LAM A;  4KTQ A;  1VSK A;  4AIL C;  4FW1 A;  3QLH A;  3VQP A;  3L2U A;  1T03 A;  4GVM A;  3NH0 A;  2I5J A;  2ITG A;  4DU3 A;  4FM2 A;  3MXM A;  3B6O A;  2HVI A;  1TK0 A;  2G8V A;  2RF2 A;  4E19 A;  2Y1I A;  3RR8 A;  1QTM A;  2X74 A;  3V1Q A;  4W5N A;  1S9E A;  4Y1D A;  2B6A A;  3P5J A;  4DSE A;  4E1M A;  2FBY A;  4E7K A;  1KLN A;  4QCL A;  3ZT0 A;  3KLH A;  4FJJ A;  3OYA A;  2OPS A;  4NYN A;  2KTQ A;  4CJL A;  4DLE A;  1VSE A;  3K57 A;  3LP3 A;  1J53 A;  1IG9 A;  1TKX A;  2O4G A;  3SQ2 A;  2F96 A;  3OYK A;  3PO5 A;  4FZX C;  3VQ9 A;  4IKF A;  1TL1 A;  4M3U A;  1RDD A;  1DLO A;  4CF2 A;  3HYF A;  2HHQ A;  4DFM A;  1J5O A;  1HNV A;  1L3S A;  1WAJ A;  3P1G A;  4CJP A;  1JL1 A;  1JLE A;  4FJI A;  3VQC A;  3NF9 A;  4FLX A;  1WSI A;  5CY4 A;  4C8M A;  4M3R A;  3ZT4 A;  1VSH A;  3LPT A;  2VWJ A;  2VWK A;  3HPG A;  2D5R A;  3V81 A;  2XY6 A;  3TAB A;  3SUN A;  4K8X A;  1VSL A;  1X1P A;  4DTJ A;  1XC9 A;  4J2A A;  4JS4 A;  1JLC A;  1GOA A;  2XRI A;  3AVI A;  3P83 D;  2QKK A;  4DQQ A;  5FRM A;  1W0H A;  2YHB A;  5HRS A;  1ZBL A;  3KK2 A;  4OKJ A;  5K14 A;  1RNH A;  3AVF A;  3HPH A;  3NGZ A;  3OYF A;  1XI1 A;  3O4Q A;  2HMI A;  3OYD A;  2RKI A;  3ITH A;  4F2S A;  4LSL A;  4IDK A;  1S9G A;  4DQI A;  3H08 A;  4BE1 A;  4B9U A;  3PX4 A;  1ITG A;  3UIQ A;  4ELV A;  1F21 A;  4HCC A;  4FZZ A;  2BGG A;  3SV3 A;  4CJR A;  2OPQ A;  3MEC A;  1L3T A;  1VSF A;  2IOC A;  2WOM A;  3SI6 A;  2KZZ A;  4DTP A;  4FJN A;  3TAP A;  4LSN A;  3RRH A;  3OYJ A;  3SQ4 A;  1A5W A;  1NK9 A;  4DQS A;  3TAM A;  1BGX T;  3LDS A;  3PV8 A;  3ZSW A;  4CEB A;  3AVM A;  3DMJ A;  4H8K A;  3OYG A;  1X9S A;  4FJ8 A;  1GOC A;  1UAX A;  4NCB A;  1IKV A;  2LSN A;  3DRS A;  3KIO A;  1TGO A;  4KV8 A;  4LH5 A;  3HT3 A;  3LP2 A;  3KJV A;  4IFV A;  3QIP A;  2P5G A;  3DLG A;  1ZBH A;  3TAR A;  4ZTJ A;  2DTU A;  2YNH A;  4Z0U A;  1YVU A;  1HYV A;  3ZT2 A;  3KLE A;  3AO1 A;  2KFZ A;  2FBV A;  2DY4 A;  1IKY A;  4O0J A;  4CGG A;  3QEV A;  3RMB A;  1BIU A;  3MED A;  1NKE A;  4M41 A;  4B9V A;  4CER A;  1VRT A;  3V4I A;  5CZ1 A;  5HLF A;  3SV4 A;  2GV9 A;  2KFN A;  4O55 A;  3VQQ A;  3PO4 A;  3VA3 A;  3U3Y A;  4DS4 A;  2YKM A;  1C0M A;  5JS1 A;  4OGE A;  1WSF A;  3SUQ A;  4CIG A;  3KTQ A;  1HYS A;  4E1N A;  1YT3 A;  4CJ3 A;  4B9M A;  1KVA A;  3F9K A;  3OJU A;  4KTW A;  4ELU A;  1LWE A;  3SZ2 A;  3LWL A;  1ASV A;  3QES A;  3DLH A;  1IKX A;  2Z1H A;  3V6D A;  3RMD A;  1SL2 A;  4OPJ A;  1WSJ A;  4CF9 A;  4YFU A;  1X9M A;  3VQ7 A;  1RT4 A;  1JXB A;  4CEF A;  3AV9 A;  4OVL A;  3NE6 A;  1S1U A;  3LAK A;  3ZSR A;  1S1T A;  3E01 A;  3DLE A;  4HVJ A;  2HHT A;  4BDY A;  3PUF A;  4FW2 A;  3CFO A;  4CEE A;  4M45 A;  4DF4 A;  1CZ9 A;  2RPI A;  4O0I A;  2D0A A;  4B9S A;  4DQP A;  2YNF A;  2DFF A;  3S3O A;  4O4G A;  3KLG A;  3HP6 A;  5HRR A;  1EET A;  3MEG A;  1NK7 A;  2FC0 A;  3QIN A;  2IDO A;  2E6M A;  3CG7 A;  5KI6 A;  1ZBU A;  3AO3 A;  2A1S A;  4H4M A;  3AVH A;  3AO2 A;  2Y1J A;  2ZE2 A;  3LPU A;  1KFD A;  4C8N A;  3OS2 A;  2YNI A;  2X6N A;  4CJW A;  4DTU A;  3WNF A;  2EX3 A;  1RCH A;  4DSJ A;  1CXQ A;  1O1W A;  1ASU A;  2HNY A;  2OYQ A;  4E89 A;  3AVB A;  1SKW A;  4Z4I A;  1W9H A;  3K5M A;  3ZSQ A;  1S5J A;  1BL3 A;  3AA4 A;  3C6U A;  4OJR A;  3OYL A;  4OKE A;  2GUI A;  3WNG A;  3HM9 A;  4FJ5 A;  3QEI A;  3DLR A;  3VQ5 A;  3L3V A;  4CK2 A;  3C94 A;  3BGR A;  3DRP A;  3LAL A;  4N56 A;  4KAZ A;  1RTH A;  3L2V A;  1HRH A;  4PQU A;  3FFI A;  3SPZ A;  5HRO A;  4J2D A;  1VSJ A;  2G8F A;  1DTT A;  4HHT A;  3MXJ A;  5KRT A;  1SV5 A;  4R5P A;  3QNN A;  1IO2 A;  4FM1 A;  5J2Q A;  1RBS A;  4DTM A;  1U47 A;  1QSS A;  1RBT A;  2E4L A;  1VSI A;  3LP1 A;  2G8U A;  1BCM A;  3NF7 A;  4CIE A;  5T7B A;  3JSM A;  1UA1 A;  2YKN A;  4M3W A;  4M3Z A;  3B6P A;  4KHQ A;  4DFP A;  4O44 A;  2VG5 A;  4Q0B A;  3QET A;  1C0T A;  1NJZ A;  3OY9 A;  1EX4 A;  3L3U A;  5C24 A;  3OYB A;  3U6F A;  4B9N A;  1ZBF A;  3M8Q A;  4HCB A;  1N6Q A;  3VQA A;  4Z4H A;  3O3H A;  2P5O A;  4CFC A;  3V9Z A;  1BQN A;  1TVR A;  3OJS A;  4CK3 A;  3ULD A;  4JRQ A;  2EHG A;  4FJM A;  5DMR A;  3AVG A;  2QK9 A;  2BDP A;  2IC3 A;  1D8Y A;  2OZM A;  4O5B A;  1RTJ A;  4MFB A;  3JYT A;  2PYL A;  4E0D A;  4FJ9 A;  4HUF A;  1T8E A;  3TWH A;  4FLZ A;  2RN2 A;  1BIS A;  4CEZ A;  1WNS A;  1TKD A;  4HUE A;  4L8R B;  2G8I A;  4DSL A;  4I9Q A;  3LZJ A;  3HVR A;  4DQR A;  2BAN A;  2DFH A;  2X78 A;  4DMN A;  5DK5 A;  5KGX A;  3QEP A;  2PY5 A;  4FK0 A;  3K5L A;  5HRP A;  1XHZ A;  1NJY A;  4CHO A;  2HHS A;  1JLQ A;  3PX6 A;  5J2P A;  3K59 A;  4DF8 A;  3S3N A;  4B8A B;  1QSY A;  1UWB A;  1IKW A;  4I9L A;  2B5J A;  4CJK A;  2D0C A;  3S3M A;  2HNZ A;  3TAQ A;  1BI4 A;  1BQM A;  5D3G A;  1TL3 A;  1WAF A;  1FKP A;  4ZHR A;  4B3O A;  2AJQ A;  3VQE A;  1VSM A;  4W5O A;  3LWM A;  5SWM A;  3RMA A;  1JXE A;  4CCH A;  1XWL A;  4AHC A;  3KK1 A;  4FCY A;  1VK0 A;  1BHL A;  3F73 A;  1WSE A;  3RR7 A;  4KHW A;  2G8K A;  5I3U A;  5J1E A;  4W5T A;  1NK5 A;  4C8L A;  1B9F A;  2ATQ A;  1WLJ A;  2W42 A;  2ETJ A;  4MQ3 A;  4CHZ A;  3M8S A;  4IBN A;  4CES A;  4BWM A;  3HPO A;  1D9D A;  3KD1 E;  3AA2 A;  2O4I A;  3WNH A;  1TKT A;  3L8B A;  1KVC A;  4AHT A;  4GMJ B;  4BE2 A;  3ZCM A;  4AHR A;  4JS5 A;  1L5U A;  2PYJ A;  3OYE A;  1CLQ A;  4Z4G A;  3QER A;  3OYC A;  4F4K A;  1KCF A;  5CYQ A;  4KI6 A;  4UQG A;  1NK0 A;  3HXM A;  3CM5 A;  4DTR A;  3NH1 A;  5FRN A;  4NYF A;  3PX0 A;  3NHG A;  3AA5 X;  3AVC A;  3NGI A;  3VQ8 A;  1LAW A;  3O4N A;  3L2R A;  4E7H A;  1TK8 A;  1HYZ A;  3M8P A;  4F3T A;  2HVH A;  2E6L A;  1C0U A;  3DOL A;  4N5S A;  3CM6 A;  4DG1 A;  2OPP A;  3OS1 A;  3VQ6 A;  2XY7 A;  1C1B A;  1J54 A;  4KFB A;  1SL1 A;  4FZY A;  4JLH A;  2YV0 X;  3V1R A;  4B9L A;  5SZT A;  1C1A A;  4NCG A;  3K58 A;  4FJH A;  3TI0 A;  4BAC A;  4M3T A;  3HL8 A;  4CHQ A;  4DSK A;  3LZI A;  2JGU A;  4N41 A;  4OPK A;  1RDC A;  4XIU A;  4AHS A;  2IS3 A;  1JLG A;  4Z4C A;  3S9H A;  4EZ6 A;  1S1X A;  3DM2 A;  1BI4 B;  4IFY A;  4EP5 A;  4AH9 A;  3AVJ A;  2XY8 A;  1U4B A;  4ID5 A;  4CE9 A;  1RTD A;  4K8Z A;  1RDA A;  1Q8I A;  3ZSX A;  1LV5 A;  3BDP A;  3HO1 A;  4I2Q A;  3OYI A;  2A1R A;  1ZYQ A;  3LP0 A;  3V9X A;  2Z1J A;  3THV A;  1ZBI A;  2DFE A;  3DLK A;  3SQ1 A;  3TAE A;  1NJX A;  3TAN A;  2YNG A;  3G10 A;  1KLM A;  1TK5 A;  3KD5 E;  4CJF A;  3OYN A;  4KHU A;  4OGC A;  4E7J A;  3A2F A;  3AA3 A;  5J2M A;  4JRP A;  4WE1 A;  3M8R A;  1KRP A;  3I0R A;  4B08 A;  3KK3 A;  5J2N A;  3NF6 A;  4QAG A;  1LWC A;  4C8K A;  1L3U A;  1UOC A;  2ZD1 A;  1RT5 A;  4CJT A;  4CJU A;  1CZB A;  4YNQ A;  1RBR A;  4CEC A;  4FJG A;  3K5O A;  4B8C A;  3EY1 A;  4F2R A;  4DTX A;  4CGH A;  4BDZ A;  2IAJ A;  3HST B;  3RMC A;  1S6Q A;  4OLA A;  1X9W A;  1NOZ A;  1FK9 A;  2QKB A;  1QE1 A;  3L2Q A;  1FXX A;  1S1V A;  4FLU A;  1B9D A;  3IRX A;  3K5N A;  4RW9 A;  1NKC A;  1Q9X A;  4F8R A;  3NCI A;  1NK8 A;  3C6T A;  3VQB A;  3TAF A;  3IAY A;  2HHX A;  3NF8 A;  4KO0 A;  3VQ4 A;  4N47 A;  4LY7 A;  1WN7 A;  2Z1I A;  5C25 A;  4FK4 A;  1HQU A;  1BIZ A;  3NBP A;  4RW6 A;  1QSL A;  1JLA A;  1JLB A;  3AVN A;  1S6P A;  1LWF A;  5CZ2 A;  1LW0 A;  4N76 A;  4FJ7 A;  4LH4 A;  3ZSV A;  1J9A A;  3I8D A;  3SUO A;  3SQ0 A;  2R7Y A;  4RG8 A;  1TV6 A;  1N5Y A;  1FKO A;  1WSH A;  2KW4 A;  4DU1 A;  1CXU A;  1C1C A;  2X6S A;  1LW2 A;  1HNI A;  2HHV A;  4KHY A;  3I0S A;  5HRN A;  2OA8 A;  4KPY A;  3KKS A;  3SCX A;  5I42 A;  3SUP A;  4M42 A;  1SKS A;  4KRF A;  1RT7 A;  3AO5 A;  4FJX A;  1RT6 A;  2Z1G A;  3DLB A;  5KRS A;  4DLG A;  1REV A;  3ZSZ A;  3CYM A;  4CK1 A;  4CF1 A;  5E41 A;  2HHW A;  3AVL A;  4RW4 A;  5FRO A;  1I3A A;  3IS9 A;  4Y1C A;  3T1A A;  4DTO A;  1QQC A;  3SNN A;  3HP9 A;  3KKR A;  1EXQ A;  1NOY A;  4GW6 A;  3TAG A;  3DYA A;  3OYH A;  3EYZ A;  5JS2 A;  4KRE A;  4PWD A;  3DRR A;  3SPY A;  4OLB A;  3IG1 A;  4CJS A;  4DTN A;  1U48 A;  3ZSY A;  4ELT A;  3SYZ A;  2NUB A;  3O3F A;  2WON A;  1T05 A;  4CJE A;  2VG6 A;  3U3G A;  2P51 A;  4DFJ A;  1NK6 A;  2OPR A;  3HJF A;  1TAU A;  1EKE A;  2G8W A;  4PUO A;  4BDP A;  1Y97 A;  1K6Y A;  1SL0 A;  4Z4F A;  1C6V A;  4M3X A;  4AHU A;  3EZ5 A;  3CFP A;  1EP4 A;  1WSG A;  1HJR A;  1VSD A;  3OYM A;  3QEX A;  2XHB A;  4J2B A;  5KGW A;  4CHP A;  4CGD A;  4FXD A;  1TAQ A;  2FBX A;  3NGY A;  4CHY A;  4CIF A;  3ZT3 A;  1Z26 A;  5C42 A;  5FDL A;  3D0P A;  1ASW A;  1DTQ A;  4ID1 A;  3V9S A;  4CEO A;  3T3F A;  2PZS A;  4AHV A;  2F8S A;  4KKO A;  3V9W A;  3L2W A;  4CJV A;  3QIO A;  1YTU A;  2FBT A;  3VN5 A;  4CGI A;  3DOK A;  3NH2 A;  1RIL A;  4BWJ A;  4FLW A;  1XHX A;  2P1J A;  1D5A A;  1Z25 A;  1HMV A;  3RWU A;  2IGI A;  4CGF A;  2YHA A;  3V9U A;  3RRG A;  3MAQ A;  4F3O A;  4J2E A;  4KHN A;  4EZ9 A;  5CYM A;  4RW7 A;  1KFS A;  3CFR A;  1B92 A;  3K2P A;  3TR8 A;  1U45 A;  3ZSO A;  3QO9 A;  1KVB A;  4CF0 A;  2QXF A;  5HP1 A;  4ICL A;  1S1W A;  4CJ5 A;  4TSX A;  4FLV A;  4KB1 A;  3DI6 A;  4CED A;  4DSI A;  2KQ2 A;  4I7F A;  4BE0 A;  4PA1 A;  3AVA A;  3MEE A;  3ZT1 A;  4CEQ A;  1U49 A;  1GOB A;  1RT2 A;  4DS5 A;  4FLT A;  4KHS A;  3WNE A;  3QNO A;  4FYD A;  2D0B A;  2GBZ A;  4KB0 A;  4OKK A;  1A5X A;  4CJQ A;  1HPZ A;  4Z4E A;  1A5V A;  4DSF A;  2HW3 A;  4FJL A;  4FM0 A;  1JLF A;  4LD0 A;  1Q9Y A;  3MXI A;  4CFA A;  1JKH A;  1TKZ A;  3KLI A;  4IG0 A;  4KTZ A;  2F8T A;  2OZS A;  2HND A;  3AVK A;  1QS4 A; 
#chains in the Genus database with same CATH topology
 4CHN A;  3OVN A;  1WUA A;  3CJ7 A;  1SAZ A;  2XY5 A;  2Q31 A;  5ADX H;  1D9F A;  3HK2 A;  3SJJ A;  2BUP A;  1T7P A;  4DFK A;  4B9Q A;  1G15 A;  2QWO A;  2ZGY A;  3NAE A;  4CGJ A;  5JVH L;  4FLY A;  3CPW M;  1YXQ A;  1C0F A;  3GG4 A;  3TTC A;  3O6W A;  5AQP A;  4HUG A;  4Q5V A;  4FJK A;  2ASP A;  1LAV A;  2G8H A;  4FOI A;  4B9T A;  4CEA A;  1VRU A;  1R0A A;  5C0Y A;  1U04 A;  2JLE A;  3V1O A;  1UA0 A;  2NZT A;  2BE2 A;  3PY8 A;  3KLF A;  1BCO A;  3G0Z A;  1WBD A;  3W0L A;  3I55 N;  4AIL C;  3QML A;  3QLH A;  1T03 A;  1HNZ K;  3DJC A;  4GVM A;  2I5J A;  3MXM A;  4A2B A;  1BO5 O;  4B1Y B;  4E19 A;  1VQ8 N;  2Y1I A;  3RR8 A;  1QTM A;  2X74 A;  4CVN E;  2FBY A;  3CCS N;  2OPS A;  3O9S A;  4GV9 A;  1VQN N;  4FWP A;  3SQ2 A;  4FZX C;  3VQ9 A;  1TL1 A;  4HWI A;  1RDD A;  1HNV A;  1L3S A;  4FLX A;  5CY4 A;  4M3R A;  3ZT4 A;  3V81 A;  3WXI A;  3I8B A;  1W0H A;  1ZBL A;  3KK2 A;  5K14 A;  4FWR A;  3CC2 N;  3OYF A;  4IXC A;  3PIO L;  1YAG A;  3O4Q A;  2RKI A;  4LSL A;  4CZF A;  1S9G A;  3DWL A;  3TPQ A;  1F21 A;  1T6C A;  3T1Y K;  3SV3 A;  3O9R A;  2OPQ A;  3A8Y A;  1L3T A;  1VSF A;  4CJ7 A;  2KZZ A;  4FJN A;  3P4I A;  3MN7 A;  4KH4 A;  4DQS A;  3TAM A;  3PV8 A;  4DB3 A;  3AGR A;  1LOT B;  2HBK A;  3DRS A;  5LY3 A;  1TGO A;  3HT3 A;  5AQV A;  3KJV A;  3QIP A;  1XMQ K;  1OH8 A;  4ZTJ A;  1GLJ O;  2DY4 A;  1YUW A;  3AO1 A;  4DR7 K;  1IKY A;  1X3N A;  3QEV A;  3CQY A;  4H5N A;  4X66 K;  4NB4 A;  4B9V A;  4GVE A;  5AZJ B;  4CER A;  3V4I A;  5CZ1 A;  4O55 A;  4BRK A;  4DS4 A;  4B3S K;  3DXM B;  4OGE A;  4RCH A;  4CIG A;  3KTQ A;  1HYS A;  1KVA A;  3F9K A;  4KTW A;  1ASV A;  3U9Z A;  4C1N K;  1WSJ A;  4CEF A;  3AV9 A;  4OVL A;  4CZI A;  1S1T A;  2HHT A;  4KH6 A;  2HF3 A;  3C6H A;  4DV2 K;  1CZ9 A;  3SMP A;  4L3Q A;  2RPI A;  1SZ2 A;  2D0A A;  4B9S A;  2YNF A;  3MEG A;  3QIN A;  4C8N A;  3ENO A;  3OS2 A;  4DTU A;  3HM8 A;  2EX3 A;  5E84 A;  1O1W A;  3NVK A;  1ASU A;  2OYQ A;  1SKW A;  4Z4I A;  2DPN A;  1W9H A;  1BL3 A;  3AA4 A;  3C6U A;  3P31 A;  3UB5 A;  4CI6 A;  1T3V A;  4DV0 K;  4OKE A;  2GUI A;  3WNG A;  4DV4 K;  1VQ6 N;  3TU5 A;  3L3V A;  4B3T K;  3CIP A;  4N56 A;  3PSI A;  2P9U A;  3FFK B;  1RTH A;  2IVO A;  3VEX A;  2JWK A;  3FFI A;  5HRO A;  5HOO A;  1VSJ A;  3TSQ A;  4DUZ K;  4MLE A;  1NGJ A;  2FSK A;  5C2D A;  4R5P A;  1U47 A;  5AZI A;  3F5T A;  2E5L K;  4CIE A;  4JK8 A;  1UA1 A;  4M3W A;  4M3Z A;  5AR0 A;  4KHQ A;  4I6M B;  4O44 A;  5ADX A;  1VQL N;  2HBJ A;  5AQT A;  3CCU N;  2O8C A;  3GE1 A;  3CJ1 A;  3LDO A;  3U6F A;  4LFA K;  4BVO A;  4B9N A;  4HCB A;  4R79 A;  1N6Q A;  1TVR A;  3SBT A;  3AVG A;  1D8Y A;  3A0I X;  1NGH A;  4MFB A;  4BRN A;  3ENH A;  1JCF A;  3MCP A;  4FLZ A;  3OA9 A;  2RN2 A;  1BIS A;  3O1B A;  2ZJP L;  1WNS A;  5GAE P;  4IEI A;  5JIC A;  4HUE A;  2G8I A;  2BAN A;  4FK0 A;  4BRP A;  1GLB G;  5HRP A;  2QW9 A;  3ZX0 A;  2HHS A;  3PX6 A;  1DKG D;  3EKS A;  1UWB A;  4CJK A;  3G71 N;  3S3M A;  5E26 A;  3M6G A;  1TL3 A;  1WAF A;  2AJQ A;  2PFU A;  2ZWH A;  1VSM A;  4B1W B;  4H5T A;  1XWL A;  4FCY A;  1VK0 A;  4BRL A;  1BHL A;  1WSE A;  3RR7 A;  2G8K A;  4BC5 A;  4W5T A;  2E20 A;  2HOE A;  2ETJ A;  3AA2 A;  1TKT A;  3L8B A;  4AHT A;  3E66 A;  3OYE A;  3D2F B;  1KCF A;  4DTR A;  2BTF A;  3AA5 X;  3NGI A;  4E7H A;  3BUZ B;  1HYZ A;  3EKU A;  4F3T A;  2E6L A;  4N5S A;  3CM6 A;  3VQ6 A;  3WUH A;  2O8D B;  5FPN A;  5SZT A;  5BN9 A;  1KQS M;  3O9U A;  4M3T A;  3LZI A;  3VGK A;  4XIU A;  3WQT A;  2IS3 A;  2O8F B;  3CPE A;  3WT0 A;  3AY9 A;  3VET A;  1RTD A;  3DLL L;  1Q8I A;  1TYQ A;  1LV5 A;  2HBL A;  2A1R A;  1ZYQ A;  2VQF K;  1U6Z A;  3THV A;  1ZBI A;  2DFE A;  3DLK A;  1NJX A;  1KLM A;  3MCA B;  3R8E A;  4E7J A;  4KH5 A;  2YJE A;  4HTL A;  1OKJ A;  4OO1 J;  2KLA A;  5GIN A;  2P9P B;  4CJT A;  4CJU A;  4YOT A;  4H0V B;  1CZB A;  4YNQ A;  4CEC A;  5LL6 Z;  4B8C A;  3O80 A;  4F2R A;  4CGH A;  4BDZ A;  4B1X B;  4OLA A;  3RMC A;  5M1K A;  1S6Q A;  4B3M K;  2VCP A;  3NCI A;  2VWB A;  3TAF A;  1NK8 A;  4BRF A;  4IOA L;  5GAG P;  1WN7 A;  2Z1I A;  4DHY A;  2YHY A;  1S6P A;  3L0Q A;  5KPT A;  1MA9 B;  4LH4 A;  3ZSV A;  1XMO K;  3I8D A;  3IKM A;  1CXU A;  1C1C A;  1LW2 A;  2HHV A;  1OVQ A;  1HX1 A;  4GV6 A;  1NGF A;  5EY4 A;  1SKS A;  1KAZ A;  1NBW A;  2Z1G A;  3DLB A;  3C7N A;  3SNN A;  5KQ8 A;  1QQC A;  1EXQ A;  3BZK A;  3DYA A;  3DRR A;  4ELT A;  3SYZ A;  3WEE B;  1H1V A;  3M5R A;  4GKJ K;  2P9N B;  4DFJ A;  3HJF A;  1R59 O;  1TAU A;  3RVC A;  4LF5 K;  1Y97 A;  4H5W A;  5AZJ A;  5KQD A;  3SAF A;  2F9T A;  4AM6 A;  1HJR A;  1VSD A;  4YOR A;  2XHB A;  4J2B A;  2FBX A;  3NGY A;  2O8B A;  3ZT3 A;  2IIR A;  4YOW A;  5C42 A;  3FGU A;  5FDL A;  2D1K A;  3V9S A;  4ID1 A;  4CEO A;  4XH4 A;  2F8S A;  4FPA A;  3V9W A;  4QS9 A;  3QIO A;  1K9M O;  1YTU A;  3VN5 A;  3DOK A;  3EL2 A;  4FLW A;  2YHW A;  1XHX A;  2P1J A;  2ASM A;  1D5A A;  1BG3 A;  1NGD A;  2IGI A;  1Z6R A;  3ENB A;  3V9U A;  4J2E A;  4EZ9 A;  5CYM A;  4H0Y B;  3TR8 A;  3UKU B;  3ZSO A;  4CF0 A;  5HP1 A;  4BR2 A;  4TSX A;  5LMU K;  5AFU A;  2KQ2 A;  1U2V A;  4PA1 A;  3ZT1 A;  1RT2 A;  4FLT A;  3MDQ A;  1BU6 O;  5TKW A;  2D0B A;  2GBZ A;  4KB0 A;  4LFC K;  3KHY A;  3HZ6 A;  3VF6 A;  2A41 A;  4U7B A;  4FM0 A;  1Q9Y A;  3MXI A;  3L4I A;  3KLI A;  4KTZ A;  2F8T A;  1NGG A;  2QWM A;  4IG3 A;  4JI1 K;  4H4O A;  3GDQ A;  4NLB A;  5TKY A;  3CJA A;  2ZM6 K;  3IDH A;  4LF9 K;  1YTA A;  5KTQ A;  3VA0 A;  3NFA A;  4CFB A;  2WTU A;  2VG7 A;  3VMF B;  1WBB A;  2PAV A;  4RW8 A;  4CZJ A;  3D45 A;  4FVM A;  1HNW K;  4CJ4 A;  4QS7 A;  4EP4 A;  4EHU A;  5FPE A;  3D7E O;  3CCL N;  3T19 A;  1RT3 A;  2JWL A;  5AQZ A;  5M1Q A;  1NNE A;  3NDK A;  4CF8 A;  5CE3 A;  3O3G A;  4E7I A;  1SKR A;  4QS8 A;  4DU4 A;  1MU2 A;  1FJG K;  1NJW A;  3ULE B;  2QWP A;  4BRH A;  1HQE A;  3O8M A;  3O5B A;  1ESV A;  4E3S A;  2KZM A;  2D0P A;  3EZW A;  3THY A;  1KTQ A;  1RBU A;  1KSP A;  2Q3S A;  2HF4 A;  1VSK A;  4XEI A;  3L2U A;  1GLL O;  2ITG A;  2WBN A;  5B8H A;  3IUC A;  3O9Q A;  4B1V A;  2G8V A;  1KAY A;  4C1N I;  1S9E A;  2B6A A;  1X3M A;  4E7K A;  4QCL A;  1KLN A;  3KLH A;  4CJL A;  4DLE A;  1VSE A;  3K57 A;  1J53 A;  1IG9 A;  2F96 A;  4CF2 A;  2ASO A;  5GAD P;  4CJP A;  1JLE A;  4DV1 K;  2BH1 A;  1WSI A;  2YCH A;  3LPT A;  5AQK A;  3HPG A;  3TAB A;  2P9S B;  1JLC A;  1GOA A;  3P83 D;  4DQQ A;  3FZK A;  5M1F A;  5FRM A;  2Q0U A;  4JKE A;  4FL9 A;  3AVF A;  4BG9 A;  3NGZ A;  1XI1 A;  2HMI A;  4WQ5 A;  4IDK A;  3VGL A;  4A57 A;  4K0K K;  2O8D A;  2E8A A;  4ELV A;  1HUX A;  4OPH A;  3CCM N;  4F9O A;  3MEC A;  1N34 K;  1N8R O;  4LF8 K;  3SI6 A;  5LMN K;  3QIC A;  3TAP A;  3OYJ A;  3C65 A;  1A5W A;  1BGX T;  3DMJ A;  4YDU A;  3ZX2 A;  3KIO A;  5AQH A;  2GEM A;  4PKG A;  3LP2 A;  4FO0 A;  2P5G A;  3DXK A;  2WUS A;  3DLG A;  5BR9 A;  2IVP A;  2KFZ A;  2Q2R A;  4ILH A;  4A2A A;  5AQX A;  2KFN A;  3VQQ A;  2D0O A;  1C0M A;  1J5E K;  3SUQ A;  3TTD A;  3QFU A;  2HMP A;  4E1N A;  4DV7 K;  4B9M A;  4U67 L;  1LWE A;  3SZ2 A;  5BRH A;  1EWQ A;  1IKX A;  1Q86 O;  5AQO A;  4FWS A;  5AJ3 K;  4OPJ A;  3NMU A;  3UKR B;  1QQN A;  1JXB A;  1NJI O;  3IMX A;  2HHH K;  1S1U A;  3LAK A;  3ZSR A;  3G4S N;  3FZM A;  4IOX A;  3H45 C;  3VEZ A;  3CFO A;  4M45 A;  4DF4 A;  4O8U A;  1BDG A;  4WFN L;  5BRF A;  3J7Z O;  1EO1 A;  4DQP A;  2DFF A;  3S3O A;  1EET A;  1NK7 A;  5GIO A;  4H0T B;  2QWL A;  1ZBU A;  2A1S A;  3ZET B;  2YNI A;  4CJW A;  1VQO N;  1BA1 A;  3OBY A;  4DSJ A;  2HNY A;  4RWT A;  3RSE B;  3HM9 A;  1MWK A;  4WFB L;  4FJ5 A;  2CH6 A;  2QA4 N;  3QEI A;  1HKG A;  3ID6 A;  4PQU A;  1OH6 A;  2E1Y A;  3QFP A;  4CZH A;  1DTT A;  3QNN A;  1RBS A;  4JN4 A;  3HRG A;  1JJ2 M;  2E4L A;  2Q0R A;  2G8U A;  4YHH K;  3JSM A;  3B6P A;  4DFP A;  5C15 A;  1WB9 A;  4Q0B A;  2WFB A;  3HBT A;  4PL7 A;  4H5V A;  2O8E B;  3O3H A;  2P5O A;  1JCE A;  4EFH A;  2QK9 A;  1YJW N;  2IC3 A;  2OZM A;  5M1P A;  4FJ9 A;  4HUF A;  1K8K A;  2FSN A;  4YOU A;  4L8R B;  3M3Z A;  1GLD G;  3HVR A;  1VQ4 N;  1ATR A;  2DFH A;  2X78 A;  4IJN A;  5DK5 A;  4DMN A;  5KGX A;  3K5L A;  5C12 A;  3K59 A;  4DF8 A;  3S3N A;  4B8A B;  3KWG A;  2D0C A;  4CZM A;  3O08 A;  3TAQ A;  1BI4 A;  3RMA A;  1V4T A;  4CCH A;  2NRZ A;  3MN6 A;  5EOY A;  1TUY A;  4KHW A;  5J1E A;  2D4W A;  2Q1N A;  1E4G T;  2ATQ A;  2W42 A;  3M8S A;  4IBN A;  1T44 A;  3VER A;  4BWM A;  2O4I A;  4BRA A;  1K8A O;  4BE2 A;  3QER A;  3OYC A;  4E1J A;  3CM5 A;  5FRN A;  4NYF A;  4DV5 K;  2IVN A;  3A5O C;  3S41 A;  1TK8 A;  1C0U A;  2OPP A;  4O8K A;  1C1B A;  4KFB A;  4DR4 K;  2NRW A;  3CC4 N;  4JLH A;  3ZX3 A;  3ULE A;  3AAP A;  3V1R A;  1BOT O;  4NCG A;  3K58 A;  4FJH A;  3TI0 A;  4BAC A;  3HL8 A;  4N41 A;  4OPK A;  1XQS C;  4EZ6 A;  4BC2 A;  1S1X A;  4V19 S;  3N4P A;  4IFY A;  1YI2 N;  3AVJ A;  2XY8 A;  3D2E A;  1U4B A;  4K8Z A;  2W41 A;  3TSP A;  4YY3 K;  1K73 O;  4I2Q A;  3OYI A;  4BVP A;  3LP0 A;  3SJH A;  1V4S A;  2Z1J A;  4K43 A;  3A5M C;  3TAE A;  3G10 A;  4EIA A;  3THX A;  4KHU A;  4OGC A;  5J2M A;  1KRP A;  4B08 A;  3DAW A;  5AQN A;  4H0X B;  3VF4 A;  5F2R A;  1RBR A;  1YF5 L;  1VQ5 N;  3EY1 A;  3HST B;  2P9K B;  1NOZ A;  1FK9 A;  2QKB A;  4DR5 K;  4FLU A;  4PKI A;  1NKC A;  3IRX A;  3K5N A;  1Q9X A;  3CCQ N;  3PSF A;  3SLC A;  2YHX A;  4IEE A;  4KO0 A;  4BRI A;  4N47 A;  5C25 A;  3CJC A;  1HQU A;  1BIZ A;  3C6A A;  3AVN A;  1LWF A;  4JD2 A;  5LJW A;  1LW0 A;  3FLC O;  4FJ7 A;  2P9I A;  3SQ0 A;  2PBD A;  3LDN A;  3R1X A;  3O4W A;  1FKO A;  1WSH A;  1S22 A;  4FOE A;  1HNI A;  3CF5 L;  5AQL A;  1OH5 A;  2OA8 A;  2YJF A;  3AO5 A;  3HOT A;  4WQ5 C;  4DLG A;  4JK9 A;  2HHW A;  5FRO A;  4DTO A;  4LF7 K;  2A42 A;  3HP9 A;  2ITM A;  4BC4 A;  3SPY A;  4OLB A;  3IG1 A;  4J8F A;  1RFQ A;  3CCJ N;  2NUB A;  4NO7 A;  4NXN K;  2A5X A;  3SBG A;  3U3G A;  4CJE A;  5CHI A;  2P51 A;  1I94 K;  1IG8 A;  2QEX N;  3BP8 A;  2G8W A;  4O5F A;  1NLV A;  1P8Z A;  3P39 A;  1K6Y A;  1SL0 A;  4YDU C;  4M3X A;  4IOC L;  1HJO A;  5JLH A;  4JKF A;  2F4V K;  3GBT A;  2P9L B;  4JKG A;  5KGW A;  4FXD A;  4CIF A;  2CGK A;  5HL7 L;  1NU0 A;  1OH7 A;  3D0P A;  2E2N A;  2PZS A;  4JKC A;  4AHV A;  4KKO A;  3CCV N;  5C2F A;  2FBT A;  3ZEU B;  3U8X A;  4BWJ A;  4JYA K;  4XH1 A;  4MDB A;  3B8A X;  1Z25 A;  3E9L A;  3RWU A;  4DQ8 A;  2Q36 A;  3RRG A;  2FXU A;  4RW7 A;  1KVB A;  2QXF A;  2VGN A;  1DGK N;  4FLV A;  1YIJ N;  3DI6 A;  4CED A;  4KB1 A;  2NRT A;  4BR7 A;  4DSI A;  1U49 A;  3AVA A;  4JI4 K;  1HPM A;  4CEQ A;  4MLH A;  3EE8 A;  4KHS A;  2V52 B;  4FYD A;  4GY2 B;  4IDH A;  2I7N A;  1A5V A;  4IZ9 A;  3BZC A;  4CBW A;  4LD0 A;  3J7A P;  5AQS A;  3THW B;  1VQ7 N;  4IG0 A;  2HND A;  1QS4 A;  5FPM A;  1RBV A;  2B4J A;  4NCA A;  4JNE A;  2XO7 A;  4W5Q A;  1YVN A;  2GWJ A;  4DWI A;  3SAH A;  4IO9 L;  2WC9 A;  4H5R A;  3H3N O;  2HHU A;  1RDB A;  1I39 A;  4ZTF A;  3ALY A;  3CQ8 A;  3ASM A;  4HTU A;  3QDK A;  1RT1 A;  4DR1 K;  2ZQB A;  4PY5 A;  1L3V A;  3OS0 A;  1QHT A;  2QWN A;  4M3Y A;  4A5B A;  3VEV A;  4W5R A;  3VQD A;  4DTS A;  1NKB A;  3CC7 N;  3LAN A;  1QZ6 A;  5AQU A;  1IH7 A;  3JS6 A;  3EN9 A;  3D6R A;  2OAN A;  2ZF5 O;  4JV5 K;  4A61 A;  1RTI A;  4C8O A;  2FF3 B;  2HB5 A;  3J7Y P;  4CFD A;  4AM7 A;  4JHD B;  3A5N C;  4E7L A;  3J80 O;  1SUQ A;  5JLF A;  3VES A;  4KTQ A;  1YHQ N;  1IBM K;  1Q7Y O;  2F7T A;  4BRO A;  1VQP N;  3L6Q A;  3NH0 A;  1HKB A;  1ZC6 A;  5BPL A;  4DU3 A;  2HVI A;  4KBO A;  4W5N A;  4XH5 A;  4Y1D A;  4DSE A;  5BPN A;  3VF2 A;  3OYA A;  4FJJ A;  4BR0 A;  3CQX A;  1Y64 A;  3LP3 A;  1TKX A;  3W3D A;  3OYK A;  1DLO A;  4H0P A;  3HYF A;  4DFM A;  2CGJ A;  3P1G A;  3M1F A;  1GLC G;  4FJI A;  2VWJ A;  4ISG A;  4BRD A;  4K8X A;  3SUN A;  4DTJ A;  1XC9 A;  4M7X A;  3FZF A;  4J2A A;  3CD6 N;  5M1O A;  2QKK A;  1DT9 A;  2UXB K;  5BPM A;  3DXM A;  4OKJ A;  3G25 A;  5IWA K;  4JI2 K;  4BE1 A;  4B9U A;  4HCC A;  4FZZ A;  4EAH D;  2IOC A;  4DTP A;  1NK9 A;  5FPD A;  4CEB A;  3AVM A;  3OYG A;  4LF6 K;  4IFE A;  1X9S A;  1GOC A;  1UAX A;  1IKV A;  5JVG L;  4LH5 A;  4LC9 B;  3ZYY X;  3VPZ A;  3TAR A;  2DTU A;  3ZT2 A;  3KLE A;  2FBV A;  4O0J A;  4FWQ A;  3O1W A;  3G6E N;  1KXP A;  1BIU A;  3MED A;  2UYT A;  1VRT A;  4BR4 A;  3SV4 A;  2GV9 A;  4DR3 K;  4H03 B;  3U3Y A;  3EE9 A;  2YKM A;  5JS1 A;  2HBM A;  1WSF A;  1ILY A;  3OW2 M;  3T69 A;  1YT3 A;  3H1V X;  3OJU A;  4ELU A;  4FWK A;  4CBU A;  3QES A;  3V6D A;  1SL2 A;  4CF9 A;  1X9M A;  1RT4 A;  5IT9 O;  3DLE A;  3H3O B;  2NRV A;  1KD1 O;  1YIT N;  2QI2 A;  4B1U B;  4BGA A;  4I6M A;  4WYB A;  2W40 A;  5ELZ A;  3CCE N;  2IDO A;  2E6M A;  5KI6 A;  4H4M A;  3AVH A;  3AO2 A;  3LPU A;  1IBL K;  4DR6 K;  3WNF A;  1RCH A;  2KHO A;  1CXQ A;  4E89 A;  3AVB A;  3K5M A;  1S5J A;  3ID8 A;  3VQ5 A;  2CH5 A;  3C94 A;  3DRP A;  3L2V A;  1HRH A;  3SPZ A;  4J2D A;  2G8F A;  1GLF O;  4ILG B;  4HHT A;  5KRT A;  1SV5 A;  4FM1 A;  4DTM A;  2E88 A;  3I33 A;  4M63 C;  1Q81 O;  1RBT A;  1VSI A;  1BCM A;  5T7B A;  2YKN A;  3N4Q A;  2VG5 A;  3QET A;  1C0T A;  1NJZ A;  3OY9 A;  1EX4 A;  3L3U A;  5C24 A;  3OYB A;  1ZBF A;  3M8Q A;  3V9Z A;  1ATS A;  3D2F A;  4FWO A;  3WQU A;  4CK3 A;  3OJS A;  2EHG A;  4JRQ A;  3ULD A;  5DMR A;  1HNX K;  4O5B A;  2PYL A;  4E0D A;  2HST A;  1NGB A;  3E9P A;  4JK7 A;  3FZL A;  4KHP K;  3HTV A;  2I7P A;  1TKD A;  2KKZ A;  3SAG A;  4DQR A;  1VQK N;  2EWS A;  2AA4 A;  2P9U B;  1XHZ A;  3L4Q A;  4CHO A;  1NJY A;  1S72 N;  1QSY A;  4I9L A;  2FF6 A;  2B5J A;  2O8F A;  2H3G X;  1BQM A;  4ZHR A;  5EX5 A;  1W97 L;  1VHX A;  5AZI B;  4JKH A;  3VQE A;  3T7Z A;  3LWM A;  5SWM A;  3OHR A;  5I9E B;  4AHC A;  2OTL N;  3LM2 A;  5I3U A;  4C8L A;  3QBW A;  5EXW A;  1X9J A;  1WLJ A;  4MQ3 A;  3HPO A;  2O8C B;  2UU9 K;  4GMJ B;  4BR5 A;  3ZCM A;  4AHR A;  2PYJ A;  1MDU B;  3U9D A;  5GAH P;  4Z4G A;  3BY5 A;  2F9W A;  5CYQ A;  2P9P A;  4BRE A;  1NK0 A;  4X65 K;  3HXM A;  3NH1 A;  1S3X A;  3CJ9 A;  4BRG A;  3AVC A;  3VQ8 A;  3M8P A;  3DOL A;  4DG1 A;  4ISF A;  1J54 A;  5JMV A;  2YV0 X;  4DV3 K;  2ZJR L;  1E4F T;  4B9L A;  4NLC A;  4CHQ A;  2VGM A;  1RDC A;  1JLG A;  3DM2 A;  1ZXO A;  4EP5 A;  4AH9 A;  3JXU A;  1RDW X;  4JI3 K;  4CE9 A;  3VOV A;  1RDA A;  3SK3 A;  3HO1 A;  3MX5 A;  4YOY A;  3V9X A;  3VTI A;  3SQ1 A;  3WXK A;  3KD5 E;  3AA3 A;  4JRP A;  3M8R A;  1QZ5 A;  3I0R A;  3KK3 A;  5J2N A;  3NF6 A;  3HOS A;  4WF9 L;  1LWC A;  2UXC K;  1L3U A;  3F9M A;  1C0G A;  1RT5 A;  1W2B M;  4DV6 K;  4DTX A;  3WEE A;  1VQ9 N;  1QQO A;  2IAJ A;  3KWI A;  4FWL A;  2P9N A;  4G9Z A;  1QE1 A;  4FWN A;  1B9D A;  4RW9 A;  4F8R A;  2HHX A;  3C6T A;  4JEP A;  1XUP O;  3QB0 A;  3VQ4 A;  4LY7 A;  3VGM A;  4DUY K;  1KAX A;  3NBP A;  1QSL A;  5CZ2 A;  1XNQ K;  4N76 A;  3SUO A;  4RG8 A;  1TV6 A;  2KW4 A;  1IBK K;  1TYQ B;  2NLX A;  1SS6 A;  2X6S A;  5HRN A;  4KPY A;  1GLE G;  3KKS A;  5I42 A;  4FSV A;  1RT7 A;  5KRS A;  4CK1 A;  3CYM A;  5E41 A;  4RW4 A;  4Y1C A;  3OBW A;  4FVU A;  3KKR A;  1NOY A;  5KPR A;  4GW6 A;  3TAG A;  5MLC Q;  3UKU A;  1NG9 A;  1BA0 A;  3OYH A;  4KRE A;  3BEX A;  1P90 A;  3ZSY A;  4PHT X;  3AAQ A;  3O3F A;  1T05 A;  2VG6 A;  1NK6 A;  2OPR A;  4LFB K;  3KVG A;  4BDP A;  1DEJ A;  1C6V A;  4AHU A;  5AQF A;  1EP4 A;  5AQR A;  3QEX A;  4CHP A;  4CGD A;  4IJA A;  4CHY A;  4GNI A;  1Z26 A;  1ASW A;  1DTQ A;  2A3Z A;  3L2W A;  1QHA A;  4BRC A;  4JKD A;  1O13 A;  4M7Y A;  2FLO A;  4YOV A;  2NRH A;  3LL3 A;  3FE1 A;  4JI5 K;  3C7N B;  2YHA A;  3GOI A;  3K9K A;  4CGF A;  3MAQ A;  4KHN A;  3MWT A;  3JAM O;  4K42 A;  3CFR A;  1B92 A;  3K2P A;  3ATU A;  3TSU A;  2E1Z A;  4ICL A;  3T1H K;  1S1W A;  2NRR A;  5GIP A;  4CJ5 A;  4ISE A;  4AQY K;  4CBX A;  4BE0 A;  1KC8 O;  3MN9 A;  1GOB A;  4DS5 A;  3WNE A;  1VAZ A;  4OKK A;  4CJQ A;  5BR8 K;  4Z4E A;  2E2P A;  2QXL A;  2QWQ A;  1JLF A;  5CR4 A;  4CFA A;  3AAR A;  1TKZ A;  2VYP A;  2O8B B;  5AQJ A;  2AP1 A;  3AO4 A;  1RGI A;  1XNR K;  2OCE A;  4Z94 A;  5AQQ A;  5EU7 A;  1NWK A;  4BRM A;  4BRQ A;  3C95 A;  4KI4 A;  4BQL A;  4QOZ B;  1M1K O;  4FK2 A;  1JL2 A;  2E2O A;  3ISN C;  5DM7 L;  5HBM A;  1NK4 A;  4RTF D;  4G1Q A;  3WXM B;  2YI1 A;  4B1Z A;  1U2V B;  3QEW A;  2P9S A;  3VEY A;  3R9P A;  5A2Q O;  4I2P A;  1NM1 A;  3H6E A;  4UY8 O;  3HVT A;  3CER A;  3RTV A;  2VQE K;  3LAM A;  1XC3 A;  4FW1 A;  4BC3 A;  3VQP A;  4FM2 A;  3B6O A;  1TK0 A;  2RF2 A;  3K9J A;  2W6K A;  3MX2 A;  3V1Q A;  3P5J A;  1NGI A;  4E1M A;  3ZT0 A;  1G99 A;  4NYN A;  4WCE L;  2KTQ A;  3VTH A;  2O4G A;  1M90 O;  4IKF A;  3PO5 A;  4M3U A;  4BR9 A;  2HHQ A;  1J5O A;  1WAJ A;  1JL1 A;  1Q18 A;  3VQC A;  4A62 A;  3NF9 A;  4BY9 C;  4CZK A;  4C8M A;  1LCU A;  1VSH A;  5BN8 A;  4JKA A;  1W7A A;  2VWK A;  3H46 O;  2D5R A;  2XY6 A;  1VSL A;  1X1P A;  5AFU H;  1ZBS A;  5EVZ A;  4JS4 A;  2XRI A;  3AVI A;  4K41 A;  3CI5 A;  2YHB A;  5HRS A;  2ZJQ L;  1RNH A;  3HPH A;  3THY B;  5BRE A;  3OYD A;  3ITH A;  3J81 O;  4F2S A;  4DQI A;  1JCG A;  2NNW A;  3H08 A;  3CMA N;  1ITG A;  5H1S Q;  3PX4 A;  3UIQ A;  3Q7B A;  1IV0 A;  4CZG A;  2BGG A;  4CJR A;  3UKR A;  4C23 A;  2WOM A;  2OZS A;  1CZA N;  4LSN A;  3RRH A;  3SQ4 A;  5C10 A;  4EHT A;  3LDS A;  3BF1 A;  3ZSW A;  4MO5 A;  4H8K A;  1MWM A;  4FJ8 A;  4NCB A;  2LSN A;  4KV8 A;  3ZLJ A;  4WQ4 A;  4IFV A;  2UXD K;  3F2K A;  3ZET A;  1ZBH A;  2A40 A;  2YNH A;  4Z0U A;  1YVU A;  1HYV A;  3CJB A;  4CGG A;  3RMB A;  1NKE A;  4M41 A;  4NXM K;  5HLF A;  4WFA L;  4JAX A;  3PO4 A;  3RSE A;  3VA3 A;  3EO3 A;  4AF1 A;  5KPZ A;  3R3L A;  2V51 B;  4CJ3 A;  2GEL A;  2V7Y A;  3LWL A;  3DLH A;  2Z1H A;  3RMD A;  4FPB A;  4YFU A;  3VQ7 A;  3NE6 A;  2NRX A;  3MMV A;  3E01 A;  4HVJ A;  4GV3 A;  4BDY A;  3PUF A;  4FW2 A;  4CEE A;  1EQY A;  1NGA A;  2GWK A;  4O0I A;  3Q7C A;  3MK6 A;  5AQY A;  4O4G A;  3KLG A;  3HP6 A;  5HRR A;  3J8A A;  2FC0 A;  3CG7 A;  3PIP L;  3DXK B;  3AO3 A;  2O8E A;  2Y1J A;  2ZE2 A;  1KFD A;  2X6N A;  2GTD A;  3C0B A;  5AQI A;  4CW7 B;  4CZE A;  3PLA A;  1NGC A;  1QQM A;  1J6Z A;  3ZSQ A;  4OJR A;  3VEW A;  3OYL A;  1WOQ A;  1HR0 K;  3DLR A;  4CK2 A;  4KAZ A;  3BGR A;  3LAL A;  4CD1 A;  4CD3 A;  3BF3 A;  3MXJ A;  3TTF A;  3MN5 A;  4Y0W A;  1QVG M;  1IO2 A;  5J2Q A;  1QSS A;  5DM6 L;  4MDA A;  3LP1 A;  3NF7 A;  3NVM A;  3A5L C;  3U4L A;  2UUB K;  1Z05 A;  1T6D A;  1E3M A;  3CET A;  2QM1 A;  3VQA A;  4Z4H A;  2UUA K;  5F1X A;  4CFC A;  1BQN A;  4FWM A;  3CME N;  4FJM A;  4OPA A;  2J4R A;  2RHK A;  2BDP A;  4IO8 A;  1RTJ A;  3JYT A;  1YJ9 N;  3TWH A;  3WXJ A;  1T8E A;  1ATN A;  4CEZ A;  3ATV A;  4DSL A;  2W6L A;  1RDU A;  3LZJ A;  4I9Q A;  4B3R K;  3QEP A;  2PY5 A;  4GKK K;  3FR0 A;  1JLQ A;  4BG8 A;  5J2P A;  1IKW A;  2Q97 A;  2V7Z A;  2HNZ A;  4B3O A;  5D3G A;  1FKP A;  4W5O A;  3OTO K;  1JXE A;  3KK1 A;  3F73 A;  1NK5 A;  1B9F A;  4H0O A;  4CHZ A;  4CES A;  3HSC A;  3K0S A;  1D9D A;  3KD1 E;  3WNH A;  1KVC A;  5LJV A;  4JS5 A;  1L5U A;  1CLQ A;  4F4K A;  4KI6 A;  4UQG A;  3PX0 A;  3CHW A;  3NHG A;  3E9O A;  1LAW A;  2RE2 A;  1K8K B;  2P9K A;  3O4N A;  3L2R A;  2HVH A;  5F0X A;  3OS1 A;  1NGE A;  2XY7 A;  1HLU A;  1SL1 A;  4FZY A;  3LDL A;  1C1A A;  3FZH A;  4DSK A;  2JGU A;  1QVF M;  4AHS A;  3S9H A;  4Z4C A;  4YOX A;  1BI4 B;  5FLX O;  3KK7 A;  3WXL A;  4LF4 K;  2GX9 A;  4ID5 A;  4DCH A;  3SMS A;  3QBX A;  3LDQ A;  3P38 A;  3ZSX A;  3BDP A;  5AQG A;  3VEN A;  1NMD A;  3HI0 A;  3TAN A;  2YNG A;  1TK5 A;  4CJF A;  3R6M A;  3OYN A;  3A2F A;  4WE1 A;  4QAG A;  4JI6 K;  4C8K A;  3E1Y A;  1D4X A;  1UOC A;  1FW6 A;  2ZD1 A;  1N32 K;  1SQK A;  3K5O A;  4FJG A;  4X62 K;  2QWR A;  5M1N A;  1X9W A;  4JI0 K;  3L2Q A;  1FXX A;  1S1V A;  1NMN A;  3IAY A;  3KZB A;  3VQB A;  3NF8 A;  1OVY A;  1IJJ A;  2P9L A;  4FK4 A;  4RW6 A;  3MWP A;  1JLA A;  1JLB A;  4BQZ A;  1VQM N;  2YX6 A;  1J9A A;  3D2E B;  2R7Y A;  1N5Y A;  4DU1 A;  4KHY A;  4MO4 A;  3ZEU A;  3I0S A;  3AGK A;  1YJN N;  3SCX A;  4IWV A;  5AQM A;  3SUP A;  4M42 A;  2OTJ N;  4KRF A;  3THX B;  3O9T A;  4FJX A;  1RT6 A;  1REV A;  3ZSZ A;  3CCR N;  4CF1 A;  3AVL A;  1I3A A;  3IS9 A;  3T1A A;  2ZGZ A;  1HKC A;  3EYZ A;  5JS2 A;  2FSJ A;  4PWD A;  4CJS A;  4DTN A;  1U48 A;  1GLA G;  1BWF O;  2WON A;  3VEO A;  4DR2 K;  4X64 K;  3LM9 A;  3IFR A;  5AQW A;  1EKE A;  4PUO A;  4Z4F A;  3EZ5 A;  3CFP A;  4WQ4 C;  1WSG A;  3OYM A;  1TAQ A;  3THW A;  3EEQ A;  4JD2 B;  3UE5 A;  4OX9 K;  1EWR A;  2P9I B;  3T3F A;  3LDP A;  3I56 N;  4A59 A;  4CJV A;  1TUU A;  4ILJ A;  4JKB A;  4BGB A;  4CGI A;  3NH2 A;  4K25 A;  1RIL A;  2E2Q A;  1N36 K;  1HMV A;  2QTD A;  4F3O A;  4PL8 A;  5BRD A;  4PKH A;  1KFS A;  1U45 A;  1BUP A;  3QO9 A;  3CXC M;  1Q82 O;  2A6A A;  4I7F A;  3MEE A;  4JI8 K;  3QNO A;  1A5X A;  1HPZ A;  1N33 K;  2GUP A;  2UUC K;  4DSF A;  2HW3 A;  4FJL A;  4DKW A;  4JHD A;  4JKG B;  2CGL A;  4A5A A;  3GL1 A;  1JKH A;  4JI7 K;  4CZL A;  3AVK A;  3H1Q A; 
#chains in the Genus database with same CATH homology
 4CHN A;  4IG3 A;  3AO4 A;  1RBV A;  2B4J A;  3OVN A;  4NCA A;  2XO7 A;  4H4O A;  4W5Q A;  2XY5 A;  4DWI A;  5EU7 A;  1YTA A;  5KTQ A;  3VA0 A;  3C95 A;  1D9F A;  3NFA A;  1RDB A;  3SJJ A;  4KI4 A;  3HK2 A;  2HHU A;  4CFB A;  1T7P A;  4QOZ B;  1I39 A;  4ZTF A;  2VG7 A;  4DFK A;  3ALY A;  3CQ8 A;  4FK2 A;  1JL2 A;  3ASM A;  4HTU A;  4RW8 A;  1RT1 A;  1G15 A;  3ISN C;  3NAE A;  3D45 A;  4FVM A;  4CGJ A;  2ZQB A;  4CJ4 A;  4FLY A;  4EP4 A;  4PY5 A;  5HBM A;  1NK4 A;  1L3V A;  3OS0 A;  1QHT A;  3T19 A;  4M3Y A;  1RT3 A;  4HUG A;  4Q5V A;  4W5R A;  3NDK A;  4G1Q A;  4CF8 A;  4FJK A;  3VQD A;  4DTS A;  1LAV A;  3O3G A;  4E7I A;  1NKB A;  1SKR A;  2G8H A;  3LAN A;  4B9T A;  4CEA A;  1VRU A;  1R0A A;  1IH7 A;  4DU4 A;  3QEW A;  1U04 A;  1MU2 A;  1NJW A;  2JLE A;  4I2P A;  3V1O A;  1UA0 A;  1HQE A;  2BE2 A;  3PY8 A;  3KLF A;  3HVT A;  1BCO A;  1RTI A;  3G0Z A;  4E3S A;  4C8O A;  2HB5 A;  2KZM A;  4CFD A;  1KTQ A;  1RBU A;  3RTV A;  1KSP A;  2Q3S A;  4E7L A;  1SUQ A;  3LAM A;  4KTQ A;  1VSK A;  4AIL C;  4FW1 A;  3QLH A;  3VQP A;  3L2U A;  1T03 A;  4GVM A;  3NH0 A;  2I5J A;  2ITG A;  4DU3 A;  4FM2 A;  3MXM A;  3B6O A;  2HVI A;  1TK0 A;  2G8V A;  2RF2 A;  4E19 A;  2Y1I A;  3RR8 A;  1QTM A;  2X74 A;  3V1Q A;  4W5N A;  1S9E A;  4Y1D A;  2B6A A;  3P5J A;  4DSE A;  4E1M A;  2FBY A;  4E7K A;  1KLN A;  4QCL A;  3ZT0 A;  3KLH A;  4FJJ A;  3OYA A;  2OPS A;  4NYN A;  2KTQ A;  4CJL A;  4DLE A;  1VSE A;  3K57 A;  3LP3 A;  1J53 A;  1IG9 A;  1TKX A;  2O4G A;  3SQ2 A;  2F96 A;  3OYK A;  3PO5 A;  4FZX C;  3VQ9 A;  4IKF A;  1TL1 A;  4M3U A;  1RDD A;  1DLO A;  4CF2 A;  3HYF A;  2HHQ A;  4DFM A;  1J5O A;  1HNV A;  1L3S A;  1WAJ A;  3P1G A;  4CJP A;  1JL1 A;  1JLE A;  4FJI A;  3VQC A;  3NF9 A;  4FLX A;  1WSI A;  5CY4 A;  4C8M A;  4M3R A;  3ZT4 A;  1VSH A;  3LPT A;  2VWJ A;  2VWK A;  3HPG A;  2D5R A;  3V81 A;  2XY6 A;  3TAB A;  3SUN A;  4K8X A;  1VSL A;  1X1P A;  4DTJ A;  1XC9 A;  4J2A A;  4JS4 A;  1JLC A;  1GOA A;  2XRI A;  3AVI A;  3P83 D;  2QKK A;  4DQQ A;  5FRM A;  1W0H A;  2YHB A;  5HRS A;  1ZBL A;  3KK2 A;  4OKJ A;  5K14 A;  1RNH A;  3AVF A;  3HPH A;  3NGZ A;  3OYF A;  1XI1 A;  3O4Q A;  2HMI A;  3OYD A;  2RKI A;  3ITH A;  4F2S A;  4LSL A;  4IDK A;  1S9G A;  4DQI A;  3H08 A;  4BE1 A;  4B9U A;  3PX4 A;  1ITG A;  3UIQ A;  4ELV A;  1F21 A;  4HCC A;  4FZZ A;  2BGG A;  3SV3 A;  4CJR A;  2OPQ A;  3MEC A;  1L3T A;  1VSF A;  2IOC A;  2WOM A;  3SI6 A;  2KZZ A;  4DTP A;  4FJN A;  3TAP A;  4LSN A;  3RRH A;  3OYJ A;  3SQ4 A;  1A5W A;  1NK9 A;  4DQS A;  3TAM A;  1BGX T;  3LDS A;  3PV8 A;  3ZSW A;  4CEB A;  3AVM A;  3DMJ A;  4H8K A;  3OYG A;  1X9S A;  4FJ8 A;  1GOC A;  1UAX A;  4NCB A;  1IKV A;  2LSN A;  3DRS A;  3KIO A;  1TGO A;  4KV8 A;  4LH5 A;  3HT3 A;  3LP2 A;  3KJV A;  4IFV A;  3QIP A;  2P5G A;  3DLG A;  1ZBH A;  3TAR A;  4ZTJ A;  2DTU A;  2YNH A;  4Z0U A;  1YVU A;  1HYV A;  3ZT2 A;  3KLE A;  3AO1 A;  2KFZ A;  2FBV A;  2DY4 A;  1IKY A;  4O0J A;  4CGG A;  3QEV A;  3RMB A;  1BIU A;  3MED A;  1NKE A;  4M41 A;  4B9V A;  4CER A;  1VRT A;  3V4I A;  5CZ1 A;  5HLF A;  3SV4 A;  2GV9 A;  2KFN A;  4O55 A;  3VQQ A;  3PO4 A;  3VA3 A;  3U3Y A;  4DS4 A;  2YKM A;  1C0M A;  5JS1 A;  4OGE A;  1WSF A;  3SUQ A;  4CIG A;  3KTQ A;  1HYS A;  4E1N A;  1YT3 A;  4CJ3 A;  4B9M A;  1KVA A;  3F9K A;  3OJU A;  4KTW A;  4ELU A;  1LWE A;  3SZ2 A;  3LWL A;  1ASV A;  3QES A;  3DLH A;  1IKX A;  2Z1H A;  3V6D A;  3RMD A;  1SL2 A;  4OPJ A;  1WSJ A;  4CF9 A;  4YFU A;  1X9M A;  3VQ7 A;  1RT4 A;  1JXB A;  4CEF A;  3AV9 A;  4OVL A;  3NE6 A;  1S1U A;  3LAK A;  3ZSR A;  1S1T A;  3E01 A;  3DLE A;  4HVJ A;  2HHT A;  4BDY A;  3PUF A;  4FW2 A;  3CFO A;  4CEE A;  4M45 A;  4DF4 A;  1CZ9 A;  2RPI A;  4O0I A;  2D0A A;  4B9S A;  4DQP A;  2YNF A;  2DFF A;  3S3O A;  4O4G A;  3KLG A;  3HP6 A;  5HRR A;  1EET A;  3MEG A;  1NK7 A;  2FC0 A;  3QIN A;  2IDO A;  2E6M A;  3CG7 A;  5KI6 A;  1ZBU A;  3AO3 A;  2A1S A;  4H4M A;  3AVH A;  3AO2 A;  2Y1J A;  2ZE2 A;  3LPU A;  1KFD A;  4C8N A;  3OS2 A;  2YNI A;  2X6N A;  4CJW A;  4DTU A;  3WNF A;  2EX3 A;  1RCH A;  4DSJ A;  1CXQ A;  1O1W A;  1ASU A;  2HNY A;  2OYQ A;  4E89 A;  3AVB A;  1SKW A;  4Z4I A;  1W9H A;  3K5M A;  3ZSQ A;  1S5J A;  1BL3 A;  3AA4 A;  3C6U A;  4OJR A;  3OYL A;  4OKE A;  2GUI A;  3WNG A;  3HM9 A;  4FJ5 A;  3QEI A;  3DLR A;  3VQ5 A;  3L3V A;  4CK2 A;  3C94 A;  3BGR A;  3DRP A;  3LAL A;  4N56 A;  4KAZ A;  1RTH A;  3L2V A;  1HRH A;  4PQU A;  3FFI A;  3SPZ A;  5HRO A;  4J2D A;  1VSJ A;  2G8F A;  1DTT A;  4HHT A;  3MXJ A;  5KRT A;  1SV5 A;  4R5P A;  3QNN A;  1IO2 A;  4FM1 A;  5J2Q A;  1RBS A;  4DTM A;  1U47 A;  1QSS A;  1RBT A;  2E4L A;  1VSI A;  3LP1 A;  2G8U A;  1BCM A;  3NF7 A;  4CIE A;  5T7B A;  3JSM A;  1UA1 A;  2YKN A;  4M3W A;  4M3Z A;  3B6P A;  4KHQ A;  4DFP A;  4O44 A;  2VG5 A;  4Q0B A;  3QET A;  1C0T A;  1NJZ A;  3OY9 A;  1EX4 A;  3L3U A;  5C24 A;  3OYB A;  3U6F A;  4B9N A;  1ZBF A;  3M8Q A;  4HCB A;  1N6Q A;  3VQA A;  4Z4H A;  3O3H A;  2P5O A;  4CFC A;  3V9Z A;  1BQN A;  1TVR A;  3OJS A;  4CK3 A;  3ULD A;  4JRQ A;  2EHG A;  4FJM A;  5DMR A;  3AVG A;  2QK9 A;  2BDP A;  2IC3 A;  1D8Y A;  2OZM A;  4O5B A;  1RTJ A;  4MFB A;  3JYT A;  2PYL A;  4E0D A;  4FJ9 A;  4HUF A;  1T8E A;  3TWH A;  4FLZ A;  2RN2 A;  1BIS A;  4CEZ A;  1WNS A;  1TKD A;  4HUE A;  4L8R B;  2G8I A;  4DSL A;  4I9Q A;  3LZJ A;  3HVR A;  4DQR A;  2BAN A;  2DFH A;  2X78 A;  4DMN A;  5DK5 A;  5KGX A;  3QEP A;  2PY5 A;  4FK0 A;  3K5L A;  5HRP A;  1XHZ A;  1NJY A;  4CHO A;  2HHS A;  1JLQ A;  3PX6 A;  5J2P A;  3K59 A;  4DF8 A;  3S3N A;  4B8A B;  1QSY A;  1UWB A;  1IKW A;  4I9L A;  2B5J A;  4CJK A;  2D0C A;  3S3M A;  2HNZ A;  3TAQ A;  1BI4 A;  1BQM A;  5D3G A;  1TL3 A;  1WAF A;  1FKP A;  4ZHR A;  4B3O A;  2AJQ A;  3VQE A;  1VSM A;  4W5O A;  3LWM A;  5SWM A;  3RMA A;  1JXE A;  4CCH A;  1XWL A;  4AHC A;  3KK1 A;  4FCY A;  1VK0 A;  1BHL A;  3F73 A;  1WSE A;  3RR7 A;  4KHW A;  2G8K A;  5I3U A;  5J1E A;  4W5T A;  1NK5 A;  4C8L A;  1B9F A;  2ATQ A;  1WLJ A;  2W42 A;  2ETJ A;  4MQ3 A;  4CHZ A;  3M8S A;  4IBN A;  4CES A;  4BWM A;  3HPO A;  1D9D A;  3KD1 E;  3AA2 A;  2O4I A;  3WNH A;  1TKT A;  3L8B A;  1KVC A;  4AHT A;  4GMJ B;  4BE2 A;  3ZCM A;  4AHR A;  4JS5 A;  1L5U A;  2PYJ A;  3OYE A;  1CLQ A;  4Z4G A;  3QER A;  3OYC A;  4F4K A;  1KCF A;  5CYQ A;  4KI6 A;  4UQG A;  1NK0 A;  3HXM A;  3CM5 A;  4DTR A;  3NH1 A;  5FRN A;  4NYF A;  3PX0 A;  3NHG A;  3AA5 X;  3AVC A;  3NGI A;  3VQ8 A;  1LAW A;  3O4N A;  3L2R A;  4E7H A;  1TK8 A;  1HYZ A;  3M8P A;  4F3T A;  2HVH A;  2E6L A;  1C0U A;  3DOL A;  4N5S A;  3CM6 A;  4DG1 A;  2OPP A;  3OS1 A;  3VQ6 A;  2XY7 A;  1C1B A;  1J54 A;  4KFB A;  1SL1 A;  4FZY A;  4JLH A;  2YV0 X;  3V1R A;  4B9L A;  5SZT A;  1C1A A;  4NCG A;  3K58 A;  4FJH A;  3TI0 A;  4BAC A;  4M3T A;  3HL8 A;  4CHQ A;  4DSK A;  3LZI A;  2JGU A;  4N41 A;  4OPK A;  1RDC A;  4XIU A;  4AHS A;  2IS3 A;  1JLG A;  4Z4C A;  3S9H A;  4EZ6 A;  1S1X A;  3DM2 A;  1BI4 B;  4IFY A;  4EP5 A;  4AH9 A;  3AVJ A;  2XY8 A;  1U4B A;  4ID5 A;  4CE9 A;  1RTD A;  4K8Z A;  1RDA A;  1Q8I A;  3ZSX A;  1LV5 A;  3BDP A;  3HO1 A;  4I2Q A;  3OYI A;  2A1R A;  1ZYQ A;  3LP0 A;  3V9X A;  2Z1J A;  3THV A;  1ZBI A;  2DFE A;  3DLK A;  3SQ1 A;  3TAE A;  1NJX A;  3TAN A;  2YNG A;  3G10 A;  1KLM A;  1TK5 A;  3KD5 E;  4CJF A;  3OYN A;  4KHU A;  4OGC A;  4E7J A;  3A2F A;  3AA3 A;  5J2M A;  4JRP A;  4WE1 A;  3M8R A;  1KRP A;  3I0R A;  4B08 A;  3KK3 A;  5J2N A;  3NF6 A;  4QAG A;  1LWC A;  4C8K A;  1L3U A;  1UOC A;  2ZD1 A;  1RT5 A;  4CJT A;  4CJU A;  1CZB A;  4YNQ A;  1RBR A;  4CEC A;  4FJG A;  3K5O A;  4B8C A;  3EY1 A;  4F2R A;  4DTX A;  4CGH A;  4BDZ A;  2IAJ A;  3HST B;  3RMC A;  1S6Q A;  4OLA A;  1X9W A;  1NOZ A;  1FK9 A;  2QKB A;  1QE1 A;  3L2Q A;  1FXX A;  1S1V A;  4FLU A;  1B9D A;  3IRX A;  3K5N A;  4RW9 A;  1NKC A;  1Q9X A;  4F8R A;  3NCI A;  1NK8 A;  3C6T A;  3VQB A;  3TAF A;  3IAY A;  2HHX A;  3NF8 A;  4KO0 A;  3VQ4 A;  4N47 A;  4LY7 A;  1WN7 A;  2Z1I A;  5C25 A;  4FK4 A;  1HQU A;  1BIZ A;  3NBP A;  4RW6 A;  1QSL A;  1JLA A;  1JLB A;  3AVN A;  1S6P A;  1LWF A;  5CZ2 A;  1LW0 A;  4N76 A;  4FJ7 A;  4LH4 A;  3ZSV A;  1J9A A;  3I8D A;  3SUO A;  3SQ0 A;  2R7Y A;  4RG8 A;  1TV6 A;  1N5Y A;  1FKO A;  1WSH A;  2KW4 A;  4DU1 A;  1CXU A;  1C1C A;  2X6S A;  1LW2 A;  1HNI A;  2HHV A;  4KHY A;  3I0S A;  5HRN A;  2OA8 A;  4KPY A;  3KKS A;  3SCX A;  5I42 A;  3SUP A;  4M42 A;  1SKS A;  4KRF A;  1RT7 A;  3AO5 A;  4FJX A;  1RT6 A;  2Z1G A;  3DLB A;  5KRS A;  4DLG A;  1REV A;  3ZSZ A;  3CYM A;  4CK1 A;  4CF1 A;  5E41 A;  2HHW A;  3AVL A;  4RW4 A;  5FRO A;  1I3A A;  3IS9 A;  4Y1C A;  3T1A A;  4DTO A;  1QQC A;  3SNN A;  3HP9 A;  3KKR A;  1EXQ A;  1NOY A;  4GW6 A;  3TAG A;  3DYA A;  3OYH A;  3EYZ A;  5JS2 A;  4KRE A;  4PWD A;  3DRR A;  3SPY A;  4OLB A;  3IG1 A;  4CJS A;  4DTN A;  1U48 A;  3ZSY A;  4ELT A;  3SYZ A;  2NUB A;  3O3F A;  2WON A;  1T05 A;  4CJE A;  2VG6 A;  3U3G A;  2P51 A;  4DFJ A;  1NK6 A;  2OPR A;  3HJF A;  1TAU A;  1EKE A;  2G8W A;  4PUO A;  4BDP A;  1Y97 A;  1K6Y A;  1SL0 A;  4Z4F A;  1C6V A;  4M3X A;  4AHU A;  3EZ5 A;  3CFP A;  1EP4 A;  1WSG A;  1HJR A;  1VSD A;  3OYM A;  3QEX A;  2XHB A;  4J2B A;  5KGW A;  4CHP A;  4CGD A;  4FXD A;  1TAQ A;  2FBX A;  3NGY A;  4CHY A;  4CIF A;  3ZT3 A;  1Z26 A;  5C42 A;  5FDL A;  3D0P A;  1ASW A;  1DTQ A;  4ID1 A;  3V9S A;  4CEO A;  3T3F A;  2PZS A;  4AHV A;  2F8S A;  4KKO A;  3V9W A;  3L2W A;  4CJV A;  3QIO A;  1YTU A;  2FBT A;  3VN5 A;  4CGI A;  3DOK A;  3NH2 A;  1RIL A;  4BWJ A;  4FLW A;  1XHX A;  2P1J A;  1D5A A;  1Z25 A;  1HMV A;  3RWU A;  2IGI A;  4CGF A;  2YHA A;  3V9U A;  3RRG A;  3MAQ A;  4F3O A;  4J2E A;  4KHN A;  4EZ9 A;  5CYM A;  4RW7 A;  1KFS A;  3CFR A;  1B92 A;  3K2P A;  3TR8 A;  1U45 A;  3ZSO A;  3QO9 A;  1KVB A;  4CF0 A;  2QXF A;  5HP1 A;  4ICL A;  1S1W A;  4CJ5 A;  4TSX A;  4FLV A;  4KB1 A;  3DI6 A;  4CED A;  4DSI A;  2KQ2 A;  4I7F A;  4BE0 A;  4PA1 A;  3AVA A;  3MEE A;  3ZT1 A;  4CEQ A;  1U49 A;  1GOB A;  1RT2 A;  4DS5 A;  4FLT A;  4KHS A;  3WNE A;  3QNO A;  4FYD A;  2D0B A;  2GBZ A;  4KB0 A;  4OKK A;  1A5X A;  4CJQ A;  1HPZ A;  4Z4E A;  1A5V A;  4DSF A;  2HW3 A;  4FJL A;  4FM0 A;  1JLF A;  4LD0 A;  1Q9Y A;  3MXI A;  4CFA A;  1JKH A;  1TKZ A;  3KLI A;  4IG0 A;  4KTZ A;  2F8T A;  2OZS A;  2HND A;  3AVK A;  1QS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...