2FBYA

Wrn exonuclease, eu complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbyA00
1RT6A 3KKSA 2P1JA 4CGHA 3KK2A 2I5JA 4DTJA 1BGXT 2HNZA 1ZBIA 4XIUA 3KIOA 3U6FA 2KFNA 4BACA 3AVJA 1BIUA 2Z1GA 3HVRA 2G8WA 4KHWA 4CF2A 1TGOA 4CIEA 3L2UA 4IKFA 2XO7A 3LALA 2XY6A 3M8RA 1UWBA 1JLCA 1WAFA 3AVCA 3AVIA 1TVRA 1WSEA 4OKJA 4CFBA 2YKMA 1NOZA 4BWJA 4Z0UA 3OYAA 4CEFA 5KRSA 4FLXA 1RDDA 3CM5A 4FLTA 1FKOA 1C1AA 3DOKA 1RBTA 2X6NA 3IRXA 3NFAA 3QIOA 4O0IA 3OYDA 1C0UA 2XHBA 3DOLA 4FLVA 1RT4A 3OS2A 5KGXA 4BWMA 1TAQA 1NK9A 3AA5X 2IGIA 2FBTA 4BDYA 3F73A 3SCXA 2KTQA 3DRPA 4KPYA 1XWLA 1QSSA 5HP1A 3NH2A 1VSMA 3SPZA 3ZSOA 1TKDA 4B9SA 3V9UA 1WSJA 4E7LA 2AJQA 3SNNA 1L3VA 5HRPA 3VQCA 4FJ7A 3AA2A 4BE0A 4JS4A 2GV9A 3T1AA 3P5JA 2HVHA 1J9AA 4BE2A 2EX3A 2OPPA 3PO4A 3ZT3A 2OZMA 5J2NA 1U04A 1IKVA 2D0BA 1RCHA 2D0CA 3L2RA 3SV3A 2D0AA 4DFJA 3BDPA 2HVIA 4DSFA 3NAEA 2NUBA 1BQMA 3ASMA 3K5MA 3OYBA 3LP2A 2P51A 4CJLA 3O3FA 3SJJA 4CJWA 3NF6A 4KKOA 3KD1E 1VSKA 4E3SA 3NF9A 4CJPA 3OYFA 3LPTA 3DLGA 1NK6A 4NCAA 4J2BA 3QEWA 3MEEA 1F21A 5KTQA 3C94A 2OA8A 3T3FA 4CGFA 1IKXA 4B9VA 4Z4CA 2BE2A 2ZQBA 3ISNC 3KLHA 5J2QA 1D9FA 1KLMA 4FJHA 4I2PA 1RTIA 4Y1CA 4AHCA 2A1RA 1ZYQA 3QLHA 4CF0A 2HW3A 1EP4A 4DLEA 4CEAA 3VQ4A 3CFOA 3LZIA 1KVBA 4RW4A 5CZ1A 3RMDA 4FK4A 3OYHA 1RNHA 3VA0A 1R0AA 4NYNA 4M3WA 4FJMA 1XI1A 3KD5E 2ZD1A 5FROA 3F9KA 4CJVA 4M3UA 5DK5A 4W5QA 3PV8A 3MXMA 3S3MA 1Z26A 3TANA 5HRNA 4NCBA 3ZSQA 1YTAA 3AVHA 4DTPA 1I39A 3HK2A 1HYSA 4LSLA 1CZBA 3ZSZA 1EX4A 4CK3A 5EU7A 1RBUA 3SV4A 4Z4HA 1LAWA 4M3YA 5FRMA 1HNVA 1GOCA 1RBSA 4CJ3A 1Z25A 1S9EA 1RTHA 1S1TA 4CEQA 4KHNA 4FYDA 3QO9A 3V1OA 1L5UA 1D9DA 1VSLA 1JXBA 4FLUA 1W0HA 1JLGA 3MXJA 4B9NA 1YT3A 5CY4A 2P5OA 3S9HA 4HCBA 3DRRA 4RW7A 1QSLA 4FXDA 1JLBA 1TKZA 1BCOA 2DFFA 4DQRA 1L3SA 1YVUA 1KFDA 3TAEA 3IAYA 3FFIA 1RBVA 3K5LA 4DSEA 4HUFA 4CHQA 1TKXA 4N47A 3LAMA 3U3GA 1LV5A 1KRPA 1EETA 1UA0A 2DFHA 4NYFA 3VQAA 3OYCA 1LWFA 4PA1A 4J2EA 3ZT2A 1RILA 3TAGA 2PYJA 4CF1A 4DSLA 4IG0A 3S3OA 4ID5A 3SUQA 3L3UA 3D0PA 3V9SA 2B4JA 1HNIA 3QINA 4CIFA 4CF8A 3SYZA 2X74A 1UOCA 1N6QA 3ITHA 1WSGA 1LWCA 2GUIA 5C25A 3ULDA 2VWKA 2Y1IA 4RW6A 3QEVA 3MECA 3LPUA 4IG3A 5CZ2A 1C0TA 3IS9A 5I42A 4F4KA 1J53A 1VRUA 4G1QA 4E89A 3PO5A 1WSFA 1ZBFA 1RDBA 2XY8A 4DTMA 1XHZA 4E0DA 4DQSA 3G10A 3LWMA 3K5NA 3M8PA 3MXIA 1ASVA 1T05A 4FJKA 1LAVA 1VSFA 4H4MA 4M3RA 3PX4A 1KLNA 4AH9A 4CFDA 2QKBA 3HO1A 3L8BA 3K5OA 4FLZA 3HPGA 2G8KA 1FXXA 2YKNA 4AILC 4B8CA 3AVBA 1U45A 2QXFA 3LZJA 3KK3A 1S9GA 2ZE2A 3M8SA 1CZ9A 4OPJA 1T7PA 2WONA 1A5VA 1TL3A 1WNSA 4NCGA 4OKKA 4DSKA 2HHUA 4HCCA 4CGDA 3OS1A 3B6PA 1HQEA 1S1VA 2DFEA 1JXEA 4AHTA 3NGZA 2HHVA 3ZSWA 1HQUA 1QE1A 1WAJA 3K2PA 4R5PA 1K6YA 4Z4FA 4W5RA 3OYKA 1NJYA 1QS4A 4EP5A 3NF7A 4FJ5A 3AV9A 4E7HA 5E41A 2QK9A 4CEEA 1IKWA 4IBNA 3HL8A 4RG8A 3RMCA 1U4BA 4GW6A 3M8QA 3I0RA 1Q8IA 3RRHA 2KZMA 1VSEA 3AVFA 4KTWA 3AVKA 3U3YA 1HRHA 3P1GA 4CGJA 3V81A 4MFBA 4CK1A 2RN2A 2FC0A 1RT3A 3OYMA 3L2WA 4FLYA 2OPRA 2VG5A 4DS4A 4DQQA 2E4LA 3DI6A 4DFKA 2QKKA 1DLOA 4ELTA 1EXQA 2YNHA 2IOCA 1NK7A 1VK0A 4FM2A 2F96A 1HPZA 2IC3A 1IO2A 4RW9A 3OVNA 5HBMA 3O3HA 3S3NA 4B3OA 4C8NA 1T03A 4L8RB 1LWEA 1TL1A 4IFVA 4KV8A 5JS1A 1NK4A 4KB1A 3V6DA 4C8LA 1SV5A 1SL0A 3LAKA 2HHQA 3V1QA 3L2VA 3DLEA 3V9WA 2IDOA 1A5XA 1D8YA 3CFRA 4O0JA 3CYMA 4DTRA 1JLFA 1EKEA 3HSTB 4CHZA 4OPKA 3VQ6A 2Z1HA 3ZSRA 4CJFA 3VQPA 3EY1A 1L3TA 3OYIA 3MEDA 1QSYA 4FVMA 3NH1A 4WE1A 3RR8A 3HYFA 4W5OA 3K59A 3ZSVA 1JLEA 3TAPA 2HMIA 4C8MA 3AA3A 4I7FA 4CGIA 3NCIA 1SL2A 1WSHA 1DTTA 2YV0X 4LH4A 4HHTA 3KTQA 4DFPA 4H8KA 1Q9YA 1RTDA 3LANA 4CJ4A 1U47A 3RWUA 5C24A 1FK9A 1RT7A 3VQ9A 1TK5A 4EZ6A 4AHUA 4CK2A 4MQ3A 4JLHA 3I8DA 2XRIA 4FJXA 4N41A 3KLGA 3CG7A 3THVA 2PZSA 3C95A 2B5JA 4CHPA 1O1WA 4HUGA 4CJSA 3QEXA 4DG1A 1ASWA 2D5RA 3O4NA 4AHRA 4F8RA 2EHGA 3JSMA 1SUQA 4DU3A 3AO1A 4CFCA 4DTUA 1HMVA 3AO3A 5J2MA 4CECA 1NJZA 4OGEA 4DF4A 4FZXC 4KRFA 2Z1IA 3HP6A 1U49A 3WNEA 4B9UA 4KI6A 3HT3A 4HTUA 1W9HA 4DTNA 4O4GA 2Y1JA 3H08A 2LSNA 2ATQA 1JL2A 2ETJA 2W42A 4I9LA 1NK0A 5J2PA 4KO0A 1NOYA 2FBXA 3UIQA 3QEIA 5CYQA 4DS5A 4OJRA 2XY5A 1N5YA 3DYAA 1BL3A 3JYTA 1T8EA 1RT2A 1U48A 4Z4IA 1S1XA 1VRTA 3ZCMA 4FJ8A 4FJLA 2YNIA 4DQPA 3NE6A 3WNFA 3CM6A 2FBVA 1S1UA 1SKWA 3T19A 4B8AB 1BQNA 4CHOA 2YHBA 3V9XA 4KB0A 2XY7A 3QNNA 1G15A 2VG7A 3O3GA 1C6VA 1C1CA 2Q3SA 3OS0A 1J5OA 1XHXA 4OGCA 4CEBA 4J2DA 3KLEA 3VQ5A 1ITGA 3SUOA 1B9FA 2HHWA 3HXMA 5C42A 3D45A 3IG1A 3HPOA 1QTMA 4CGGA 4W5TA 4CJEA 3CFPA 3PX0A 3SQ1A 1NKCA 1KSPA 3WNGA 1VSDA 4BE1A 5HLFA 3VN5A 3ZT0A 4E1NA 1ZBHA 1VSJA 2KZZA 2HHSA 5D3GA 4M42A 1FKPA 4LH5A 5FDLA 2KQ2A 3HPHA 4O5BA 4DQIA 2FBYA 2DY4A 4W5NA 4RW8A 4ID1A 1I3AA 4Q5VA 2KFZA 4KTZA 1TV6A 4CF9A 3QEPA 4AHSA 1NK5A 2O4GA 2IS3A 3VQ8A 3ALYA 1C1BA 4N56A 1S1WA 4CEDA 4C8KA 4CFAA 4FM1A 4ZTFA 4F2SA 4IFYA 5T7BA 3DLBA 3NGIA 4B9TA 1ZBUA 1IG9A 3TAQA 3KK1A 3RR7A 4QOZB 3LWLA 3OJSA 4CCHA 2A1SA 3RMBA 3PY8A 4I9QA 1XC9A 2G8VA 1GOBA 4FK0A 4CERA 3ZSXA 1SKRA 4OLAA 3SZ2A 3V1RA 5KGWA 3SUNA 3OYLA 4E7KA 4N5SA 1BIZA 1KTQA 3NF8A 4KFBA 4HVJA 3SQ2A 1KVCA 4M3ZA 3MEGA 3TAFA 4ZHRA 1CLQA 2IAJA 3HM9A 4CHNA 4FJIA 4M3XA 3VQDA 5HRRA 4E1MA 4F3TA 1X1PA 4FW2A 1LW2A 2DTUA 1HYZA 2Z1JA 2ITGA 3OYGA 4KHYA 1SL1A 3AVAA 3PUFA 4AHVA 2VG6A 3DLRA 4KHQA 3V4IA 3VA3A 2HNDA 3QETA 3NHGA 3LDSA 2HB5A 3ZT4A 3OY9A 4K8XA 3QIPA 4TSXA 3QERA 3TABA 1JKHA 3C6TA 1IKYA 4JS5A 1J54A 3TR8A 1TK8A 2F8TA 2E6LA 4CJQA 4BDZA 2YNGA 4HUEA 3SPYA 4FCYA 3E01A 4I2QA 1X9MA 1S6QA 4KAZA 2G8UA 4F2RA 4LY7A 4CJKA 1BISA 2O4IA 4FM0A 3AO5A 4DTXA 1X9WA 4KTQA 2G8IA 1B9DA 1L3UA 2X6SA 1HYVA 4M41A 1KCFA 3L3VA 4FZYA 3CQ8A 2RKIA 3OYEA 3L2QA 3SUPA 4ELVA 4FZZA 1UAXA 4LD0A 3V9ZA 3SQ4A 5K14A 2YNFA 4IDKA 3VQBA 2KW4A 4Z4EA 3MAQA 3TARA 2OPQA 1QHTA 5CYMA 4FLWA 4DU4A 4CJUA 4E19A 3K58A 4B9LA 2OPSA 4FJ9A 3KLIA 3O4QA 3AVMA 3VQQA 3ZSYA 3AO2A 5HROA 1GOAA 4DSJA 1RBRA 4CEZA 4DLGA 4DTSA 2RF2A 4CJRA 3EZ5A 4BDPA 3KJVA 3DLHA 4QAGA 3QNOA 1NKBA 1BI4A 1JLAA 1DTQA 4KHSA 4ELUA 1ZBLA 4DSIA 3HJFA 1KFSA 1NJXA 4EZ9A 5SZTA 3A2FA 4M3TA 4CIGA 5I3UA 4F3OA 3AVGA 4GVMA 2F8SA 4Y1DA 4FJJA 1Y97A 1BHLA 3HP9A 2R7YA 3TAMA 4YNQA 2E6MA 2BGGA 1TAUA 4B9MA 4DU1A 3OYJA 5KRTA 1WLJA 2HHTA 5HRSA 1S5JA 3G0ZA 1B92A 1RDAA 4KHUA 1REVA 1WN7A 4K8ZA 4DTOA 4FK2A 2B6AA 2PYLA 1NK8A 3KKRA 3C6UA 2GBZA 1SKSA 1WSIA 3DLKA 1D5AA 5SWMA 1LW0A 2BDPA 1TK0A 3NH0A 5FRNA 2OZSA 4FJGA 2JLEA 1YTUA 1S6PA 2BANA 3RMAA 4FJNA 4O44A 3ZT1A 4CJ5A 3VQ7A 3RRGA 5JS2A 3AA4A 3WNHA 2YHAA 3BGRA 4LSNA 3AVLA 1C0MA 3QESA 4DF8A 3LP1A 4QCLA 4FW1A 1JL1A 5DMRA 4CE9A 1RDCA 3LP0A 4PQUA 2VWJA 4KREA 4JRPA 4H4OA 3PX6A 2HHXA 4PUOA 3SI6A 1KVAA 2WOMA 3B6OA 3RTVA 4E7IA 2PY5A 1Q9XA 1JLQA 1ASUA 5J1EA 3EYZA 4PY5A 4C8OA 3NDKA 3LP3A 3OJUA 3TWHA 5KI6A 1RT5A 1VSHA 1TKTA 2RPIA 3DMJA 3DRSA 2OYQA 4Z4GA 4JRQA 3SQ0A 4ZTJA 1HJRA 2X78A 2JGUA 1NKEA 4J2AA 4O55A 1QQCA 1NJWA 3AVNA 3VQEA 4E7JA 4DFMA 4CJTA 1CXUA 1X9SA 4OVLA 4CHYA 4DWIA 4Q0BA 4ICLA 3I0SA 4GMJB 2G8HA 1BI4B 1BCMA 3DM2A 3KLFA 4KI4A 1A5WA 1RTJA 2P5GA 1MU2A 4UQGA 4CEOA 4N76A 4PWDA 4OKEA 1IH7A 2G8FA 3K57A 1RT1A 3P83D 3HVTA 4YFUA 3TI0A 2HNYA 3NGYA 1VSIA 3AO4A 4M45A 1CXQA 3NBPA 4B08A 4CESA 4DMNA 1UA1A 4OLBA 3OYNA 4EP4A
chains in the Genus database with same CATH superfamily
3AARA 1RT6A 2P1JA 4CGHA 4K41A 2UUCK 3QBXA 3CC2N 3ZEUB 4XIUA 3KIOA 3U6FA 4BACA 3AVJA 1WUAA 1QHAA 5GAGP 5AQMA 4DV2K 1TGOA 2D1KA 1YAGA 2XO7A 4IKFA 2XY6A 2QWNA 4LF7K 4Z4IA 4CFBA 3OYAA 4LFCK 4IO9L 1RDDA 1FKOA 1C1AA 3OYDA 1RBTA 2X6NA 2XHBA 4O0IA 2OZSA 3ZX0A 4BWMA 2P9SA 2FBTA 3M3ZA 3ZETA 1BUPA 4BR2A 3SCXA 1QSSA 5HP1A 3SPZA 4EIAA 3ZSOA 3GG4A 5BRFA 3SNNA 1L3VA 3J8AA 1D4XA 3VQCA 4JI2K 3UKRB 2GV9A 3P5JA 5MLCQ 3THYB 2EX3A 3PO4A 1U04A 1IKVA 3QB0A 3TU5A 2NUBA 3SJJA 2QXLA 3MN9A 4AM6A 3NF6A 4KKOA 4CJWA 5AQYA 1VSKA 2O8EA 4CJPA 1NK6A 1MWKA 3DLGA 2NRHA 3MEEA 5JICA 2I7NA 3T3FA 4Z4CA 2BE2A 5J2QA 4CZJA 1D9FA 4CZGA 4Y1CA 2A1RA 2O8DA 3P31A 3C6HA 4DLEA 3WXKA 1XUPO 3VA0A 1YJWN 3MK6A 1QQNA 4JHDB 1XMOK 1RFQA 1RDWX 5FROA 3HOSA 4M3UA 1HKCA 3S3MA 1W2BM 3E1YA 4JKAA 4DUZK 1Z26A 2ZJQL 3TANA 4NCBA 3ZSQA 4JK8A 1I39A 1CZBA 4CK3A 2HF3A 1GOCA 1RBSA 3KVGA 2YHWA 4CJ3A 4XH4A 3CJ9A 1U2VA 4CZHA 2PBDA 1W0HA 4B9NA 1WBBA 1KAZA 3S9HA 1QSLA 3ZX3A 1JLBA 2P9UB 3SMPA 1YVUA 3IAYA 1VQ6N 2O8BA 3TTDA 4BC4A 1HLUA 1TKXA 4N47A 3DWLA 1LWFA 4NXMK 4WQ4C 4ID5A 3L3UA 3V9SA 5JVGL 4JK9A 3ATVA 2B4JA 2VYPA 4CF8A 3QDKA 1YXQA 4K42A 5C25A 2VWKA 4RW6A 2Q1NA 3NVKA 3MECA 3IS9A 5F0XA 3AAPA 4G1QA 3O6WA 3SBTA 4DV6K 1XHZA 4E0DA 1SZ2A 1N8RO 1ATNA 2GTDA 2NRXA 3MXIA 1FW6A 3CPEA 1LAVA 4H4MA 3PX4A 4AH9A 4CFDA 5AQRA 3HO1A 2YI1A 1XNQK 5H1SQ 2G8KA 3P38A 3C65A 4B8CA 1U45A 1S9GA 3M8SA 4OPJA 1T7PA 1A5VA 1TL3A 1WNSA 2E2QA 3B6PA 4AHTA 2DFEA 3FLCO 2ZM6K 4WCEL 3MMVA 1K6YA 4Z4FA 4W5RA 3AGKA 3JS6A 4EP5A 2UXBK 4FJ5A 4IBNA 3LM9A 3HZ6A 1U4BA 3M8QA 1BOTO 2KZMA 1VSEA 1G99A 4MFBA 1OKJA 4CK1A 4FLYA 1RT3A 2OPRA 3A0IX 3ULEB 4BC5A 2YNHA 1NK7A 4FM2A 5AQNA 2NNWA 4RW9A 5B8HA 1IO2A 5HBMA 4B3OA 5JS1A 1NK4A 4C8LA 4YDUC 3L2VA 1D8YA 3CFRA 3CYMA 3AGRA 2AP1A 1EKEA 4U67L 1NGCA 4CHZA 4OPAA 3VQPA 1L3TA 3CJCA 4W5OA 3K59A 1JLEA 2QI2A 3AA3A 4I7FA 1SL2A 5M1NA 3P39A 2KHOA 4H8KA 1Q9YA 1NGFA 2P9LA 3RWUA 1RT7A 3VQ9A 2OCEA 1DT9A 2UUAK 2GX9A 4N41A 3CG7A 3C95A 2B5JA 5I9EB 2D5RA 1IBMK 3D2FB 1SUQA 4DU3A 3C0BA 3AO1A 4DTUA 3AO3A 1NJZA 4FZXC 3D6RA 4B9UA 4KI6A 3C7NA 4O8UA 3HT3A 2Q0RA 5AFUA 4FOEA 3MX5A 1HUXA 2LSNA 3HTVA 2ETJA 1NK0A 5J2PA 4KO0A 4DS5A 4OJRA 5GINA 1N5YA 1JCEA 4GNIA 3JYTA 4CZMA 4IEEA 4FJLA 3CM6A 3O08A 1N34K 1GLDG 4LFAK 2YHBA 1G15A 3CJ1A 3OS0A 4J2DA 4QS7A 3KLEA 3KWIA 3SUOA 3HXMA 3IG1A 4U7BA 4A5AA 1VSDA 4BE1A 5HLFA 3VN5A 2HHSA 1FKPA 4W5NA 1GLJO 4MLHA 5LJVA 1I3AA 4C1NI 3LDLA 3VQ8A 3ALYA 3PSIA 3H1QA 4FM1A 1HPMA 4F2SA 5T7BA 2NRRA 3NGIA 4GKJK 2JWLA 1OVQA 4AF1A 4B9TA 1ZBUA 2ITMA 1NBWA 3TAQA 3RR7A 2VCPA 3J7YP 3AAQA 5AQPA 3PY8A 4BRDA 1GOBA 4CERA 1KAYA 3V1RA 4PL7A 3NF8A 4KFBA 1TYQB 3CXCM 1GLEG 1JCGA 4BG8A 1CLQA 4FJIA 4CHNA 3VQDA 4E1MA 4F3TA 1O13A 2DTUA 1M90O 3OYGA 3SMSA 3AVAA 4AHVA 3QETA 4B1YB 2HB5A 4OPHA 2I7PA 3FE1A 3TABA 3C6TA 3M1FA 4HUEA 4I6MB 1X9JA 1X9MA 4MO5A 1EO1A 3AO5A 4DR5K 2RKIA 4GY2B 3SUPA 1EQYA 4IDKA 2KW4A 4RCHA 4Z4EA 3MAQA 3EZWA 1IBLK 4O8KA 5CYMA 4E19A 4B9LA 2OPSA 1NGBA 5JLFA 3KLIA 1ESVA 1GOAA 3K9JA 2RF2A 4IOAL 3VTIA 1SQKA 3QNOA 1DTQA 4A61A 3THWA 3EN9A 1ZBLA 4DSIA 3VETA 4EZ9A 5AQXA 4F3OA 3AVGA 4GVMA 4B3RK 4L3QA 1BHLA 2BGGA 3LDOA 5DM7L 5KRTA 5HRSA 1S5JA 1DGKN 4KHUA 1WN7A 4YOYA 1NK8A 1K9MO 1NGEA 2ZJRL 1SKSA 1D5AA 3NH0A 5FRNA 4FJGA 3CCQN 2BANA 5EY4A 2W6KA 4LSNA 5C2FA 3QESA 2D0OA 4FW1A 4PQUA 1RDCA 4H4OA 3PX6A 1ZC6A 2PFUA 5J1EA 4PY5A 1C0GA 4C8OA 3LP3A 1YI2N 3L0QA 3DMJA 4NXNK 1QQCA 4DV7K 1JJ2M 2E20A 2HBKA 3L4QA 4CJTA 1X9SA 5KPRA 3Q7BA 4GMJB 1BCMA 4X62K 4KI4A 1A5WA 1RTJA 3R6MA 1NGDA 3VTHA 5M1PA 2G8FA 4B1UB 3TI0A 4M45A 1UA1A 3RRHA 4BC3A 3KK2A 5KPTA 2O8CB 3C6AA 2I5JA 4DTJA 4A2BA 1BGXT 1ZBIA 4B9QA 1BIUA 2D0PA 2Z1GA 4JV5K 4BRGA 1T6CA 3L2UA 3SBGA 3AVCA 5J2NA 1TVRA 1Z6RA 2A6AA 4CEFA 4BY9C 3DOKA 4H0VB 4FZZA 1Q9XA 3DOLA 5KGXA 1TAQA 3CCSN 4KPYA 4BQLA 1TKDA 3NH2A 1VSMA 2ZGZA 5HRPA 4PKGA 4JS4A 3VF6A 4CD1A 2OPPA 3QFPA 2D0BA 2D0CA 5CE3A 2HVIA 2D0AA 3E9OA 1YUWA 3NAEA 1BQMA 3OYBA 3UE5A 4CJLA 3KD1E 2A3ZA 3CPWM 5TKWA 3QEWA 3PSFA 1F21A 3ZX2A 3C94A 3CCRN 1IKXA 3KLHA 5AQWA 4J8FA 4FJHA 1W7AA 4I2PA 1RTIA 4EHTA 4AHCA 2V52B 4CF0A 4CEAA 3CFOA 1Z05A 1KVBA 3RMDA 4FK4A 3OYHA 4NYNA 1GLCG 5HRNA 1YTAA 3AVHA 4LSLA 3J7AP 4JKGA 3OBWA 1RBUA 3SV4A 2UXCK 1LAWA 3FFKB 1IG8A 3SK3A 5AZJA 1Z25A 2A42A 4CEQA 1BO5O 1JCFA 4M7XA 3V1OA 3I55N 1L5UA 4FYDA 4JAXA 4BR5A 1JLGA 3MXJA 2D4WA 3J7ZO 2Q97A 3DXMA 1TYQA 2ZGYA 1TKZA 5AQHA 1RBVA 2FSJA 2P9KA 1TUUA 1WOQA 4HUFA 4BRLA 1LV5A 3ID8A 1KRPA 3VQAA 4CI6A 4J2EA 1K8AO 1RILA 2PYJA 4CF1A 4IG0A 3S3OA 3SUQA 1FJGK 3FZLA 3N4QA 4F9OA 2BH1A 1RGIA 3SYZA 3ITHA 1WSGA 2GUIA 2Y1IA 3TSQA 3LPUA 1C0TA 5I42A 1MDUB 3PO5A 1WSFA 2XY8A 4DQSA 2QWPA 4JEPA 1ASVA 4HTLA 1VSFA 2A40A 4FO0A 2QM1A 5JLHA 5KQDA 3CJBA 5C10A 1FXXA 3G71N 3AVBA 3OTOK 5EOYA 4CZFA 2WONA 4CW7B 3OS1A 1E4GT 1S1VA 2HHVA 1HQUA 1WAJA 4H0XB 1QS4A 4Z94A 5E41A 2QK9A 3HL8A 1ILYA 4YOTA 4A57A 3HOTA 3I0RA 3AVFA 4DR6K 2RN2A 2FC0A 3L2WA 4DQQA 1VQ4N 1XQSC 1DLOA 4X64K 1EXQA 4DV5K 2F96A 1EWQA 3DXKB 2WC9A 5BRDA 1T03A 1TL1A 4IFVA 4KV8A 3V6DA 1SL0A 3WXJA 3WUHA 1BWFO 5AZIA 3THXA 3EEQA 2YJEA 3BZCA 3L6QA 4XEIA 1JLFA 4X65K 1K8KA 2WUSA 3VQ6A 4CJFA 3EY1A 2F9TA 3OYIA 3A8YA 3T1HK 3NH1A 4IJAA 4WE1A 3ZSVA 4CGIA 3NCIA 2O8FA 2GEMA 2YV0X 3D2EB 4ISFA 3O1BA 3VMFB 3LANA 1U47A 5C24A 1FK9A 4CK2A 4MQ3A 4FJXA 3EKSA 4A2AA 4F8RA 4CJSA 2P9NA 5BPMA 3JSMA 3ENBA 5AQGA 4CFCA 4BRQA 3A5MC 4OGEA 4DF4A 4KRFA 3WEEB 2RE2A 1U49A 3WNEA 2V7YA 4HTUA 1W9HA 4DTNA 4O4GA 2Y1JA 2FXUA 2O8CA 1J6ZA 2FBXA 5CYQA 5M1FA 1NJIO 2E5LK 5GAHP 3UKUB 1VRTA 3ZCMA 5AJ3K 3U9ZA 3NE6A 1QVFM 3O4WA 3T19A 4B8AB 3V9XA 4KB0A 3QNNA 2ASMA 2Q3SA 3LL3A 3CCJN 4CEBA 1P8ZA 4GVEA 1ITGA 2UUBK 1B9FA 3D45A 3HPOA 4JNEA 4CGGA 4CJEA 4JD2B 1KSPA 3WNGA 1QQMA 3MN7A 3ZT0A 4JYAK 4E1NA 4JKDA 1ZBHA 2KZZA 5D3GA 4M42A 3W0LA 5FDLA 3EO3A 4WYBA 4DQIA 4CZIA 2DY4A 2WFBA 4ID1A 1NGGA 4KTZA 1W97L 2IVOA 4AHSA 1S3XA 2UYTA 3RSEB 4N56A 4CEDA 4C8KA 4ZTFA 3T1YK 3O9QA 5GAEP 4QS9A 1IG9A 3IUCA 4DV4K 3LDPA 2A1SA 2G8VA 4FK0A 3ZSXA 1QQOA 4NO7A 2AA4A 3ZYYX 4M3ZA 3TAFA 4ZHRA 3CCUN 2IAJA 2J4RA 3HM9A 3VF2A 3G4SN 4FW2A 2ITGA 3MWTA 3CHWA 4YOWA 2VG6A 4JI1K 3DLRA 1NWKA 4FWLA 3VA3A 5AQSA 3NHGA 1HKBA 3LDSA 1BA0A 3OY9A 1Q7YO 4TSXA 3OBYA 3QIPA 3PIOL 1J54A 3TR8A 4BVPA 3CCLN 3SPYA 4I2QA 1OH7A 1S6QA 2G8UA 4X66K 4LY7A 1BISA 4BQZA 4FM0A 4NB4A 4DTXA 1B9DA 4WQ5C 1HYVA 3U8XA 2QWQA 3CQ8A 1UAXA 3U9DA 5K14A 4DU4A 4CJUA 3K58A 3O4QA 4FWSA 3ZSYA 5LJWA 1RBRA 4ILJA 5AQLA 4DLGA 3MN6A 3F5TA 4QAGA 1BI4A 3HJFA 1KFSA 3VEVA 4BRIA 2IVPA 2F8SA 3OW2M 3QICA 3TAMA 2FLOA 3BZKA 1TAUA 4DUYK 3OYJA 1RDAA 4DTOA 3DLLL 3VPZA 3ZEUA 5SWMA 2VGNA 3BP8A 3W3DA 2BDPA 4BRHA 2JLEA 1ZXOA 4FJNA 4O44A 3VQ7A 3JAMO 1KXPA 2YHAA 1MWMA 1Q81O 4DF8A 1JL1A 5DMRA 4CE9A 2VWJA 4PUOA 3SI6A 3EE9A 1JLQA 2HBLA 3T7ZA 3TWHA 1RT5A 4DB3A 1YVNA 1X3MA 3UKRA 4O5FA 1YJNN 1NKEA 1YHQN 1EWRA 1BG3A 3AVNA 3VQEA 3THYA 4E7JA 4MDBA 1ATRA 4KBOA 4CHYA 2OTJN 3CCEN 4Q0BA 4ICLA 3I0SA 2G8HA 4BRAA 3CQYA 4UQGA 5AQOA 4OKEA 3FZKA 3MN5A 4DMNA 4B08A 4FWPA 3KKSA 4H03B 1VQON 2HNZA 2KFNA 4K25A 2F7TA 1VQLN 4M63C 2G8WA 4KHWA 2P9PB 4CIEA 3LALA 4JHDA 4C1NK 1UWBA 1WSEA 4OKJA 3QEXA 3E9LA 2YKMA 1NOZA 4FLTA 3EE8A 4ILGB 3CM5A 3IRXA 3HM8A 3MCAB 4CD3A 1C0UA 3VEOA 4FLVA 1RT4A 3CJAA 1NK9A 3AA5X 3MWPA 2IGIA 4BDYA 3F73A 2KTQA 1XWLA 4E7LA 4FJ7A 2FSNA 2F9WA 3AA2A 4H5NA 4BE0A 3BEXA 3LM2A 4DHYA 1VQPN 2P9UA 3ZT3A 2OZMA 3MCPA 1RCHA 3SV3A 3BDPA 1S22A 3ASMA 3K5MA 4V19S 4HWIA 2P51A 1HNXK 3CMAN 3LDNA 4DV3K 3OYFA 5LMNK 3TTFA 3LPTA 4NCAA 4J2BA 3QMLA 5KTQA 4PKHA 2V51B 3LDQA 1KLMA 1ZYQA 4H5WA 3CC4N 2DPNA 3QLHA 2HW3A 4JI0K 4FPBA 3CF5L 4JN4A 1RNHA 4YORA 1R0AA 3WQUA 4M3WA 4FJMA 1XI1A 4LFBK 3KD5E 3H1VX 1KAXA 3IMXA 3KWGA 4CJVA 4MO4A 4DV1K 3MXMA 3BF3A 2QA4N 1HYSA 3HK2A 2EWSA 1HJOA 2HF4A 5IT9O 1EX4A 5EU7A 5FRMA 2P9SB 3IFRA 3ZETB 4KHNA 5BPNA 3K9KA 3I33A 2W40A 1VSLA 1JXBA 4WQ4A 1YT3A 5CY4A 2P5OA 4A59A 1T44A 1BCOA 2DFFA 4DQ8A 3TAEA 1KFDA 3FFIA 1KD1O 4WFNL 4BR9A 4DSEA 3U3GA 3LAMA 2ASPA 1UA0A 2DFHA 3VOVA 5M1KA 3OYCA 3ULEA 3ZT2A 5C0YA 1Q18A 4R79A 3D0PA 4YOUA 3QINA 1HNIA 2VGMA 4CIFA 5M1QA 2HSTA 4B1VA 4F4KA 1J53A 3AY9A 4E89A 5ADXH 2HOEA 4DTMA 3BF1A 3G10A 3LWMA 3A5LC 1T05A 2NLXA 4DR3K 4FJKA 2FF6A 3K5OA 1QZ5A 3FZFA 4AILC 4BRNA 3LZJA 5BREA 3KK3A 1IV0A 4NCGA 3R8EA 2HHUA 1VHXA 4HCCA 1JXEA 3ZSWA 4WFBL 1U2VB 3K2PA 3OYKA 3D2FA 4E7HA 4CEEA 1IBKK 1IKWA 1VQ9N 4GW6A 3ENHA 2O8BB 2E1ZA 4KTWA 5E26A 3V81A 4YDUA 4ILHA 3OYMA 4DFKA 2E4LA 4FWKA 1E4FT 1VK0A 1HPZA 2IC3A 4AQYK 2NRWA 5AQIA 4B1ZA 4C8NA 1WB9A 3SAGA 2QW9A 1HR0K 4LF5K 1SV5A 3LAKA 3V1QA 2IDOA 5AQVA 4FPAA 5CHIA 3IDHA 3O80A 1Q82O 4DTRA 3HSTB 3GDQA 3RR8A 4RWTA 3IKMA 3R1XA 2Q36A 4C8MA 2HMIA 4LF4K 4B9MA 4LH4A 4CVNE 4ISEA 2E88A 4HHTA 4DFPA 4WF9L 4OLBA 4EHUA 1RTDA 5EVZA 4IWVA 4MLEA 4JLHA 4BREA 4GV9A 5FPDA 3R3LA 3THVA 1KQSM 2QWOA 3VEXA 3CETA 4HUGA 4DG1A 3O4NA 4DR2K 1OH6A 5J2MA 5CR4A 2E2OA 1NG9A 3H46O 3HP6A 3M6GA 3MDQA 1VQKN 2ATQA 1JL2A 2W42A 4I9LA 4YOVA 3UIQA 3QEIA 4CZKA 4B3TK 5GADP 1BL3A 3VENA 1RT2A 3O9SA 1S1XA 4JI6K 4K43A 4FJ8A 4DQPA 2P9PA 5GIPA 1S1UA 1I94K 1LCUA 1XC3A 1LOTB 4CHOA 2FSKA 3WT0A 2PAVA 3VEWA 2VG7A 3O3GA 1C6VA 1J5OA 1XHXA 4OGCA 1YJ9N 4GKKK 3VQ5A 1NGIA 2HHWA 3FZMA 5C42A 2IVNA 4KH5A 4W5TA 4I6MA 4IO8A 3E66A 3SQ1A 4IFEA 3CC7N 3EL2A 4Y0WA 4NLCA 1H1VA 2CGKA 2NRZA 5FLXO 2KQ2A 3HPHA 4O5BA 2FBYA 2P9LB 4H5RA 1TV6A 4CF9A 3QEPA 4H0YB 5A2QO 1C1BA 1S1WA 1E3MA 3J80O 2WTUA 5GIOA 5KQ8A 1BU6O 1HX1A 4UY8O 2CGLA 4I9QA 4CCHA 2Q2RA 3RMBA 3C7NB 4BVOA 1SKRA 3SZ2A 4OX9K 3I8BA 3WXLA 5KGWA 3SUNA 2V7ZA 3OYLA 4E7KA 4N5SA 4HVJA 3MEGA 4M3XA 4WFAL 1LW2A 2Z1JA 3KK7A 3PUFA 3CCVN 4LC9B 4KHQA 1VAZA 2HNDA 4DR1K 4JKEA 3ZT4A 3O1WA 1JKHA 4JS5A 1IKYA 2F8TA 1TK8A 4CJQA 4BC2A 1HNWK 2UXDK 5F2RA 2O4IA 1BDGA 1L3UA 3N4PA 1NU0A 4FZYA 3L2QA 3M5RA 4KH6A 4ELVA 4KH4A 5ELZA 4LD0A 3SQ4A 2QEXN 2YNFA 3VGLA 4H5VA 3HSCA 5EX5A 3TARA 2OPQA 2ZWHA 1QHTA 1T3VA 1WBDA 1QVGM 3FGUA 1VQMN 5BR9A 4FJ9A 2ZJPL 3AO2A 5HROA 4CEZA 4DTSA 3EZ5A 5AQFA 4BDPA 1NKBA 3ZLJA 1JLAA 3H3NO 3HI0A 4CIGA 1CZAN 1Y97A 3HP9A 2R7YA 4DU1A 5LY3A 2HHTA 3G0ZA 1REVA 1NMDA 4FK2A 2B6AA 3WQTA 2PYLA 4IDHA 3DLKA 5AQTA 3QBWA 1RDUA 4LF6K 4AM7A 5BR8K 5JS2A 4H0TB 4YOXA 2KKZA 3P4IA 3AVLA 1C0MA 4QCLA 3LP1A 3VGKA 4IXCA 4KREA 2A41A 4E7IA 3RTVA 2PY5A 1ATSA 3EYZA 1ASUA 2YX6A 3NDKA 4GV6A 5C15A 5ADXA 5KI6A 1VSHA 2RPIA 4Z4GA 3DRSA 2OYQA 4JRQA 3SQ0A 4ZTJA 1HJRA 2X78A 1HKGA 4O55A 1NJWA 4YY3K 4IOCL 1OH5A 1CXUA 3KHYA 4BRCA 3THWB 2P5GA 1NMNA 4CEOA 4N76A 4PWDA 1IH7A 1XMQK 4B1XB 3K57A 1V4SA 2HNYA 3AO4A 1CXQA 4EP4A 3NMUA 2BTFA 3VGMA 4BRKA 4JKHA 4EAHD 3HVRA 2CH5A 4CF2A 2QWMA 4FWOA 3M8RA 1JLCA 1WAFA 3AVIA 3LZIA 5HL7L 4FLXA 4BWJA 4Z0UA 1NGJA 5KRSA 3U4LA 3NFAA 3QIOA 1D9DA 4KHYA 3KTQA 3OS2A 3DRPA 3CI5A 3QFUA 4B9SA 3V9UA 4K0KK 1WSJA 3D7EO 2AJQA 4BG9A 4JI3K 3A5NC 3T1AA 5BPLA 2HVHA 3CIPA 1J9AA 4BE2A 3L2RA 4DFJA 4DKWA 1NGHA 2E2NA 4DSFA 5FPEA 3LP2A 3O3FA 3WXMB 5BRHA 3GL1A 3NVMA 1GLLO 3NF9A 4E3SA 1T6DA 1YIJN 3FZHA 2A5XA 4YHHK 4DR4K 2OA8A 4CGFA 4B9VA 5JVHL 2ZQBA 3ISNC 1GLAG 3R9PA 2NRTA 1KC8O 3BUZB 1U6ZA 5AQJA 4JI5K 1EP4A 3VQ4A 4B3SK 2OANA 4RW4A 5CZ1A 1K73O 2H3GX 2ZD1A 3F9KA 2P9IB 3GE1A 3SAHA 5DK5A 4W5QA 3PV8A 5EXWA 4DTPA 3ZSZA 2WBNA 3EKUA 4Z4HA 4M3YA 1HNVA 3CJ7A 3VF4A 1SAZA 2NZTA 1S9EA 1RTHA 4QS8A 1S1TA 3DAWA 3QO9A 1R59O 3FR0A 5C2DA 3UB5A 4FLUA 3H3OB 2Q31A 4HCBA 3DRRA 4RW7A 4G9ZA 4FXDA 4DQRA 1L3SA 3K5LA 5F1XA 4JK7A 4CHQA 1EETA 2W6LA 4NYFA 5AQUA 4PA1A 2E1YA 3TAGA 4DSLA 1S72N 4FL9A 3DXKA 3F2KA 4M7YA 2X74A 1UOCA 1N6QA 1LWCA 3ULDA 3MX2A 3QEVA 4IG3A 4LF8K 5CZ2A 1VRUA 2YCHA 1ZBFA 1RDBA 3HRGA 2JWKA 2VQEK 3DJCA 3B8AX 3TPQA 3K5NA 3M8PA 4JI8K 1QZ6A 1C0FA 1KLNA 4M3RA 4BGBA 2VQFK 2QKBA 3S41A 1N33K 3O9RA 3L8BA 2E8AA 4FLZA 3HPGA 4CJ7A 2YKNA 4XH1A 4MDAA 5HOOA 2QXFA 4JI4K 3PLAA 4JI7K 3D2EA 2ZE2A 1CZ9A 4JKGB 3GOIA 4OKKA 1N36K 4DSKA 4CGDA 5AZJB 1HQEA 3NGZA 1QE1A 3OA9A 4R5PA 1NJYA 3NF7A 3AV9A 3DXMB 4E1JA 3JXUA 4RG8A 3RMCA 1Q8IA 2RHKA 2W41A 3WEEA 2P9KB 3U3YA 3AVKA 1HRHA 3P1GA 4CGJA 4DS4A 4FSVA 2QKKA 2VG5A 3DI6A 4ELTA 4DCHA 3O5BA 2IOCA 4FVUA 2KLAA 3UKUA 3ID6A 3OVNA 3O3HA 3S3NA 5AQKA 4L8RB 1LWEA 4KB1A 4BRMA 4BROA 4CBWA 4C23A 2HHQA 1OH8A 3V9WA 3DLEA 4H0PA 3Q7CA 1A5XA 2HBJA 4O0JA 3O9TA 3TSUA 4OPKA 2Z1HA 3ZSRA 4A5BA 1QSYA 4JD2A 3MEDA 4FVMA 3HYFA 3SLCA 3TAPA 1TUYA 2E2PA 3VEYA 4FWNA 1WSHA 1DTTA 4CJ4A 3OYNA 1GLBG 1TK5A 4EZ6A 4AHUA 3RSEA 3I8DA 3RVCA 2XRIA 1MA9B 4FWRA 4BGAA 3KLGA 5TKYA 2PZSA 4CHPA 1O1WA 5LMUK 4LF9K 1ASWA 4AHRA 4FWMA 2EHGA 4FWQA 1HMVA 1YF5L 5DM6L 4CECA 4BR7A 1OVYA 2Z1IA 2Q0UA 3H08A 5AR0A 5E84A 1NNEA 1NOYA 4CZEA 2XY5A 3DYAA 1T8EA 3TTCA 2QTDA 1U48A 2YNIA 1ZBSA 3SJHA 3WNFA 2FBVA 1SKWA 1BQNA 5IWAK 2XY7A 2O8EB 3THXB 5AZIB 3I56N 1C1CA 1DKGD 4PKIA 2FF3B 2YHXA 1NLVA 1K8KB 1QTMA 3CFPA 3PX0A 2O8DB 1NKCA 3ATUA 5BN9A 1DEJA 3H6EA 4OO1J 1VSJA 2GUPA 2O8FB 4LH5A 2OTLN 4RW8A 1N32K 4Q5VA 2KFZA 4NLBA 1NK5A 2O4GA 3CD6N 2IS3A 3HBTA 4CFAA 5M1OA 1VQ7N 3PIPL 3ENOA 4IFYA 3DLBA 2P9NB 4RTFD 3TSPA 3KK1A 2CGJA 4QOZB 3LWLA 3OJSA 1XC9A 1VQNN 4OLAA 3L4IA 3SQ2A 1BIZA 1KTQA 3VEZA 4A62A 1KVCA 4IOXA 1XNRK 2BUPA 4IZ9A 2UU9K 4B3MK 2F4VK 5HRRA 3CCMN 1X1PA 1HYZA 1SL1A 2P9IA 3V4IA 3O8MA 4DR7K 5C12A 4WQ5A 2CH6A 4K8XA 3QERA 3O9UA 4IEIA 2ZF5O 2E6LA 4BDZA 2YNGA 4IJNA 4FCYA 3E01A 4KAZA 3VERA 1VQ5N 3A5OC 4F2RA 2QWRA 4CJKA 4PL8A 4KTQA 1X9WA 1X3NA 4CBUA 2G8IA 1HNZK 2X6SA 4B1WB 4JKFA 4M41A 1KCFA 1Y64A 3L3VA 2QWLA 3OYEA 3KZBA 3V9ZA 4BRPA 4JKBA 3VQBA 3CERA 3G6EN 4FLWA 4BR4A 2HHHK 4EFHA 4DSJA 3AVMA 3VQQA 3CQXA 5KPZA 4XH5A 4DV0K 4CJRA 3KJVA 3DLHA 1IJJA 1P90A 4KHPK 4KHSA 4ELUA 1NJXA 5SZTA 3A2FA 4M3TA 3BY5A 3WXIA 5I3UA 2ASOA 4ISGA 4BRFA 4Y1DA 4FJJA 2NRVA 3F9MA 4YNQA 2E6MA 1J5EK 1WLJA 1B92A 4K8ZA 5AQQA 3H45C 3KKRA 3C6UA 2GBZA 1WSIA 4BR0A 3J81O 2YHYA 1LW0A 1TK0A 4CZLA 3SAFA 1YTUA 1S6PA 3OHRA 3RMAA 1Q86O 4GV3A 3ZT1A 4H5TA 4CJ5A 3RRGA 3AA4A 3WNHA 3BGRA 2GWJA 1SS6A 2HMPA 3LP0A 3VESA 4JRPA 2HHXA 2HBMA 1KVAA 5AFUH 2WOMA 3B6OA 2IIRA 5BN8A 1V4TA 4PHTX 1YITN 4CBXA 3E9PA 3OJUA 4FOIA 1TKTA 1M1KO 1NM1A 5JMVA 2VWBA 2JGUA 4J2AA 3G25A 5AQZA 4DFMA 5FPMA 3CMEN 1NGAA 4OVLA 4DWIA 3GBTA 3K0SA 1BI4B 3DM2A 3KLFA 2GWKA 5LL6Z 1MU2A 2YJFA 2GELA 1BA1A 1VQ8N 3T69A 1RT1A 3P83D 3HVTA 4YFUA 4JKCA 3NGYA 1VSIA 3NBPA 5FPNA 4CESA 4H0OA 1GLFO
chains in the Genus database with same CATH topology
1RT6A 3KKSA 2P1JA 4CGHA 3KK2A 2I5JA 4DTJA 1BGXT 2HNZA 1ZBIA 4XIUA 3KIOA 3U6FA 2KFNA 4BACA 3AVJA 1BIUA 2Z1GA 3HVRA 2G8WA 4KHWA 4CF2A 1TGOA 4CIEA 3L2UA 4IKFA 2XO7A 3LALA 2XY6A 3M8RA 1UWBA 1JLCA 1WAFA 3AVCA 3AVIA 1TVRA 1WSEA 4OKJA 4CFBA 2YKMA 1NOZA 4BWJA 4Z0UA 3OYAA 4CEFA 5KRSA 4FLXA 1RDDA 3CM5A 4FLTA 1FKOA 1C1AA 3DOKA 1RBTA 2X6NA 3IRXA 3NFAA 3QIOA 4O0IA 3OYDA 1C0UA 2XHBA 3DOLA 4FLVA 1RT4A 3OS2A 5KGXA 4BWMA 1TAQA 1NK9A 3AA5X 2IGIA 2FBTA 4BDYA 3F73A 3SCXA 2KTQA 3DRPA 4KPYA 1XWLA 1QSSA 5HP1A 3NH2A 1VSMA 3SPZA 3ZSOA 1TKDA 4B9SA 3V9UA 1WSJA 4E7LA 2AJQA 3SNNA 1L3VA 5HRPA 3VQCA 4FJ7A 3AA2A 4BE0A 4JS4A 2GV9A 3T1AA 3P5JA 2HVHA 1J9AA 4BE2A 2EX3A 2OPPA 3PO4A 3ZT3A 2OZMA 5J2NA 1U04A 1IKVA 2D0BA 1RCHA 2D0CA 3L2RA 3SV3A 2D0AA 4DFJA 3BDPA 2HVIA 4DSFA 3NAEA 2NUBA 1BQMA 3ASMA 3K5MA 3OYBA 3LP2A 2P51A 4CJLA 3O3FA 3SJJA 4CJWA 3NF6A 4KKOA 3KD1E 1VSKA 4E3SA 3NF9A 4CJPA 3OYFA 3LPTA 3DLGA 1NK6A 4NCAA 4J2BA 3QEWA 3MEEA 1F21A 5KTQA 3C94A 2OA8A 3T3FA 4CGFA 1IKXA 4B9VA 4Z4CA 2BE2A 2ZQBA 3ISNC 3KLHA 5J2QA 1D9FA 1KLMA 4FJHA 4I2PA 1RTIA 4Y1CA 4AHCA 2A1RA 1ZYQA 3QLHA 4CF0A 2HW3A 1EP4A 4DLEA 4CEAA 3VQ4A 3CFOA 3LZIA 1KVBA 4RW4A 5CZ1A 3RMDA 4FK4A 3OYHA 1RNHA 3VA0A 1R0AA 4NYNA 4M3WA 4FJMA 1XI1A 3KD5E 2ZD1A 5FROA 3F9KA 4CJVA 4M3UA 5DK5A 4W5QA 3PV8A 3MXMA 3S3MA 1Z26A 3TANA 5HRNA 4NCBA 3ZSQA 1YTAA 3AVHA 4DTPA 1I39A 3HK2A 1HYSA 4LSLA 1CZBA 3ZSZA 1EX4A 4CK3A 5EU7A 1RBUA 3SV4A 4Z4HA 1LAWA 4M3YA 5FRMA 1HNVA 1GOCA 1RBSA 4CJ3A 1Z25A 1S9EA 1RTHA 1S1TA 4CEQA 4KHNA 4FYDA 3QO9A 3V1OA 1L5UA 1D9DA 1VSLA 1JXBA 4FLUA 1W0HA 1JLGA 3MXJA 4B9NA 1YT3A 5CY4A 2P5OA 3S9HA 4HCBA 3DRRA 4RW7A 1QSLA 4FXDA 1JLBA 1TKZA 1BCOA 2DFFA 4DQRA 1L3SA 1YVUA 1KFDA 3TAEA 3IAYA 3FFIA 1RBVA 3K5LA 4DSEA 4HUFA 4CHQA 1TKXA 4N47A 3LAMA 3U3GA 1LV5A 1KRPA 1EETA 1UA0A 2DFHA 4NYFA 3VQAA 3OYCA 1LWFA 4PA1A 4J2EA 3ZT2A 1RILA 3TAGA 2PYJA 4CF1A 4DSLA 4IG0A 3S3OA 4ID5A 3SUQA 3L3UA 3D0PA 3V9SA 2B4JA 1HNIA 3QINA 4CIFA 4CF8A 3SYZA 2X74A 1UOCA 1N6QA 3ITHA 1WSGA 1LWCA 2GUIA 5C25A 3ULDA 2VWKA 2Y1IA 4RW6A 3QEVA 3MECA 3LPUA 4IG3A 5CZ2A 1C0TA 3IS9A 5I42A 4F4KA 1J53A 1VRUA 4G1QA 4E89A 3PO5A 1WSFA 1ZBFA 1RDBA 2XY8A 4DTMA 1XHZA 4E0DA 4DQSA 3G10A 3LWMA 3K5NA 3M8PA 3MXIA 1ASVA 1T05A 4FJKA 1LAVA 1VSFA 4H4MA 4M3RA 3PX4A 1KLNA 4AH9A 4CFDA 2QKBA 3HO1A 3L8BA 3K5OA 4FLZA 3HPGA 2G8KA 1FXXA 2YKNA 4AILC 4B8CA 3AVBA 1U45A 2QXFA 3LZJA 3KK3A 1S9GA 2ZE2A 3M8SA 1CZ9A 4OPJA 1T7PA 2WONA 1A5VA 1TL3A 1WNSA 4NCGA 4OKKA 4DSKA 2HHUA 4HCCA 4CGDA 3OS1A 3B6PA 1HQEA 1S1VA 2DFEA 1JXEA 4AHTA 3NGZA 2HHVA 3ZSWA 1HQUA 1QE1A 1WAJA 3K2PA 4R5PA 1K6YA 4Z4FA 4W5RA 3OYKA 1NJYA 1QS4A 4EP5A 3NF7A 4FJ5A 3AV9A 4E7HA 5E41A 2QK9A 4CEEA 1IKWA 4IBNA 3HL8A 4RG8A 3RMCA 1U4BA 4GW6A 3M8QA 3I0RA 1Q8IA 3RRHA 2KZMA 1VSEA 3AVFA 4KTWA 3AVKA 3U3YA 1HRHA 3P1GA 4CGJA 3V81A 4MFBA 4CK1A 2RN2A 2FC0A 1RT3A 3OYMA 3L2WA 4FLYA 2OPRA 2VG5A 4DS4A 4DQQA 2E4LA 3DI6A 4DFKA 2QKKA 1DLOA 4ELTA 1EXQA 2YNHA 2IOCA 1NK7A 1VK0A 4FM2A 2F96A 1HPZA 2IC3A 1IO2A 4RW9A 3OVNA 5HBMA 3O3HA 3S3NA 4B3OA 4C8NA 1T03A 4L8RB 1LWEA 1TL1A 4IFVA 4KV8A 5JS1A 1NK4A 4KB1A 3V6DA 4C8LA 1SV5A 1SL0A 3LAKA 2HHQA 3V1QA 3L2VA 3DLEA 3V9WA 2IDOA 1A5XA 1D8YA 3CFRA 4O0JA 3CYMA 4DTRA 1JLFA 1EKEA 3HSTB 4CHZA 4OPKA 3VQ6A 2Z1HA 3ZSRA 4CJFA 3VQPA 3EY1A 1L3TA 3OYIA 3MEDA 1QSYA 4FVMA 3NH1A 4WE1A 3RR8A 3HYFA 4W5OA 3K59A 3ZSVA 1JLEA 3TAPA 2HMIA 4C8MA 3AA3A 4I7FA 4CGIA 3NCIA 1SL2A 1WSHA 1DTTA 2YV0X 4LH4A 4HHTA 3KTQA 4DFPA 4H8KA 1Q9YA 1RTDA 3LANA 4CJ4A 1U47A 3RWUA 5C24A 1FK9A 1RT7A 3VQ9A 1TK5A 4EZ6A 4AHUA 4CK2A 4MQ3A 4JLHA 3I8DA 2XRIA 4FJXA 4N41A 3KLGA 3CG7A 3THVA 2PZSA 3C95A 2B5JA 4CHPA 1O1WA 4HUGA 4CJSA 3QEXA 4DG1A 1ASWA 2D5RA 3O4NA 4AHRA 4F8RA 2EHGA 3JSMA 1SUQA 4DU3A 3AO1A 4CFCA 4DTUA 1HMVA 3AO3A 5J2MA 4CECA 1NJZA 4OGEA 4DF4A 4FZXC 4KRFA 2Z1IA 3HP6A 1U49A 3WNEA 4B9UA 4KI6A 3HT3A 4HTUA 1W9HA 4DTNA 4O4GA 2Y1JA 3H08A 2LSNA 2ATQA 1JL2A 2ETJA 2W42A 4I9LA 1NK0A 5J2PA 4KO0A 1NOYA 2FBXA 3UIQA 3QEIA 5CYQA 4DS5A 4OJRA 2XY5A 1N5YA 3DYAA 1BL3A 3JYTA 1T8EA 1RT2A 1U48A 4Z4IA 1S1XA 1VRTA 3ZCMA 4FJ8A 4FJLA 2YNIA 4DQPA 3NE6A 3WNFA 3CM6A 2FBVA 1S1UA 1SKWA 3T19A 4B8AB 1BQNA 4CHOA 2YHBA 3V9XA 4KB0A 2XY7A 3QNNA 1G15A 2VG7A 3O3GA 1C6VA 1C1CA 2Q3SA 3OS0A 1J5OA 1XHXA 4OGCA 4CEBA 4J2DA 3KLEA 3VQ5A 1ITGA 3SUOA 1B9FA 2HHWA 3HXMA 5C42A 3D45A 3IG1A 3HPOA 1QTMA 4CGGA 4W5TA 4CJEA 3CFPA 3PX0A 3SQ1A 1NKCA 1KSPA 3WNGA 1VSDA 4BE1A 5HLFA 3VN5A 3ZT0A 4E1NA 1ZBHA 1VSJA 2KZZA 2HHSA 5D3GA 4M42A 1FKPA 4LH5A 5FDLA 2KQ2A 3HPHA 4O5BA 4DQIA 2FBYA 2DY4A 4W5NA 4RW8A 4ID1A 1I3AA 4Q5VA 2KFZA 4KTZA 1TV6A 4CF9A 3QEPA 4AHSA 1NK5A 2O4GA 2IS3A 3VQ8A 3ALYA 1C1BA 4N56A 1S1WA 4CEDA 4C8KA 4CFAA 4FM1A 4ZTFA 4F2SA 4IFYA 5T7BA 3DLBA 3NGIA 4B9TA 1ZBUA 1IG9A 3TAQA 3KK1A 3RR7A 4QOZB 3LWLA 3OJSA 4CCHA 2A1SA 3RMBA 3PY8A 4I9QA 1XC9A 2G8VA 1GOBA 4FK0A 4CERA 3ZSXA 1SKRA 4OLAA 3SZ2A 3V1RA 5KGWA 3SUNA 3OYLA 4E7KA 4N5SA 1BIZA 1KTQA 3NF8A 4KFBA 4HVJA 3SQ2A 1KVCA 4M3ZA 3MEGA 3TAFA 4ZHRA 1CLQA 2IAJA 3HM9A 4CHNA 4FJIA 4M3XA 3VQDA 5HRRA 4E1MA 4F3TA 1X1PA 4FW2A 1LW2A 2DTUA 1HYZA 2Z1JA 2ITGA 3OYGA 4KHYA 1SL1A 3AVAA 3PUFA 4AHVA 2VG6A 3DLRA 4KHQA 3V4IA 3VA3A 2HNDA 3QETA 3NHGA 3LDSA 2HB5A 3ZT4A 3OY9A 4K8XA 3QIPA 4TSXA 3QERA 3TABA 1JKHA 3C6TA 1IKYA 4JS5A 1J54A 3TR8A 1TK8A 2F8TA 2E6LA 4CJQA 4BDZA 2YNGA 4HUEA 3SPYA 4FCYA 3E01A 4I2QA 1X9MA 1S6QA 4KAZA 2G8UA 4F2RA 4LY7A 4CJKA 1BISA 2O4IA 4FM0A 3AO5A 4DTXA 1X9WA 4KTQA 2G8IA 1B9DA 1L3UA 2X6SA 1HYVA 4M41A 1KCFA 3L3VA 4FZYA 3CQ8A 2RKIA 3OYEA 3L2QA 3SUPA 4ELVA 4FZZA 1UAXA 4LD0A 3V9ZA 3SQ4A 5K14A 2YNFA 4IDKA 3VQBA 2KW4A 4Z4EA 3MAQA 3TARA 2OPQA 1QHTA 5CYMA 4FLWA 4DU4A 4CJUA 4E19A 3K58A 4B9LA 2OPSA 4FJ9A 3KLIA 3O4QA 3AVMA 3VQQA 3ZSYA 3AO2A 5HROA 1GOAA 4DSJA 1RBRA 4CEZA 4DLGA 4DTSA 2RF2A 4CJRA 3EZ5A 4BDPA 3KJVA 3DLHA 4QAGA 3QNOA 1NKBA 1BI4A 1JLAA 1DTQA 4KHSA 4ELUA 1ZBLA 4DSIA 3HJFA 1KFSA 1NJXA 4EZ9A 5SZTA 3A2FA 4M3TA 4CIGA 5I3UA 4F3OA 3AVGA 4GVMA 2F8SA 4Y1DA 4FJJA 1Y97A 1BHLA 3HP9A 2R7YA 3TAMA 4YNQA 2E6MA 2BGGA 1TAUA 4B9MA 4DU1A 3OYJA 5KRTA 1WLJA 2HHTA 5HRSA 1S5JA 3G0ZA 1B92A 1RDAA 4KHUA 1REVA 1WN7A 4K8ZA 4DTOA 4FK2A 2B6AA 2PYLA 1NK8A 3KKRA 3C6UA 2GBZA 1SKSA 1WSIA 3DLKA 1D5AA 5SWMA 1LW0A 2BDPA 1TK0A 3NH0A 5FRNA 2OZSA 4FJGA 2JLEA 1YTUA 1S6PA 2BANA 3RMAA 4FJNA 4O44A 3ZT1A 4CJ5A 3VQ7A 3RRGA 5JS2A 3AA4A 3WNHA 2YHAA 3BGRA 4LSNA 3AVLA 1C0MA 3QESA 4DF8A 3LP1A 4QCLA 4FW1A 1JL1A 5DMRA 4CE9A 1RDCA 3LP0A 4PQUA 2VWJA 4KREA 4JRPA 4H4OA 3PX6A 2HHXA 4PUOA 3SI6A 1KVAA 2WOMA 3B6OA 3RTVA 4E7IA 2PY5A 1Q9XA 1JLQA 1ASUA 5J1EA 3EYZA 4PY5A 4C8OA 3NDKA 3LP3A 3OJUA 3TWHA 5KI6A 1RT5A 1VSHA 1TKTA 2RPIA 3DMJA 3DRSA 2OYQA 4Z4GA 4JRQA 3SQ0A 4ZTJA 1HJRA 2X78A 2JGUA 1NKEA 4J2AA 4O55A 1QQCA 1NJWA 3AVNA 3VQEA 4E7JA 4DFMA 4CJTA 1CXUA 1X9SA 4OVLA 4CHYA 4DWIA 4Q0BA 4ICLA 3I0SA 4GMJB 2G8HA 1BI4B 1BCMA 3DM2A 3KLFA 4KI4A 1A5WA 1RTJA 2P5GA 1MU2A 4UQGA 4CEOA 4N76A 4PWDA 4OKEA 1IH7A 2G8FA 3K57A 1RT1A 3P83D 3HVTA 4YFUA 3TI0A 2HNYA 3NGYA 1VSIA 3AO4A 4M45A 1CXQA 3NBPA 4B08A 4CESA 4DMNA 1UA1A 4OLBA 3OYNA 4EP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT6 A;  3KKS A;  2P1J A;  4CGH A;  3KK2 A;  2I5J A;  4DTJ A;  1BGX T;  2HNZ A;  1ZBI A;  4XIU A;  3KIO A;  3U6F A;  2KFN A;  4BAC A;  3AVJ A;  1BIU A;  2Z1G A;  3HVR A;  2G8W A;  4KHW A;  4CF2 A;  1TGO A;  4CIE A;  3L2U A;  4IKF A;  2XO7 A;  3LAL A;  2XY6 A;  3M8R A;  1UWB A;  1JLC A;  1WAF A;  3AVC A;  3AVI A;  1TVR A;  1WSE A;  4OKJ A;  4CFB A;  2YKM A;  1NOZ A;  4BWJ A;  4Z0U A;  3OYA A;  4CEF A;  5KRS A;  4FLX A;  1RDD A;  3CM5 A;  4FLT A;  1FKO A;  1C1A A;  3DOK A;  1RBT A;  2X6N A;  3IRX A;  3NFA A;  3QIO A;  4O0I A;  3OYD A;  1C0U A;  2XHB A;  3DOL A;  4FLV A;  1RT4 A;  3OS2 A;  5KGX A;  4BWM A;  1TAQ A;  1NK9 A;  3AA5 X;  2IGI A;  2FBT A;  4BDY A;  3F73 A;  3SCX A;  2KTQ A;  3DRP A;  4KPY A;  1XWL A;  1QSS A;  5HP1 A;  3NH2 A;  1VSM A;  3SPZ A;  3ZSO A;  1TKD A;  4B9S A;  3V9U A;  1WSJ A;  4E7L A;  2AJQ A;  3SNN A;  1L3V A;  5HRP A;  3VQC A;  4FJ7 A;  3AA2 A;  4BE0 A;  4JS4 A;  2GV9 A;  3T1A A;  3P5J A;  2HVH A;  1J9A A;  4BE2 A;  2EX3 A;  2OPP A;  3PO4 A;  3ZT3 A;  2OZM A;  5J2N A;  1U04 A;  1IKV A;  2D0B A;  1RCH A;  2D0C A;  3L2R A;  3SV3 A;  2D0A A;  4DFJ A;  3BDP A;  2HVI A;  4DSF A;  3NAE A;  2NUB A;  1BQM A;  3ASM A;  3K5M A;  3OYB A;  3LP2 A;  2P51 A;  4CJL A;  3O3F A;  3SJJ A;  4CJW A;  3NF6 A;  4KKO A;  3KD1 E;  1VSK A;  4E3S A;  3NF9 A;  4CJP A;  3OYF A;  3LPT A;  3DLG A;  1NK6 A;  4NCA A;  4J2B A;  3QEW A;  3MEE A;  1F21 A;  5KTQ A;  3C94 A;  2OA8 A;  3T3F A;  4CGF A;  1IKX A;  4B9V A;  4Z4C A;  2BE2 A;  2ZQB A;  3ISN C;  3KLH A;  5J2Q A;  1D9F A;  1KLM A;  4FJH A;  4I2P A;  1RTI A;  4Y1C A;  4AHC A;  2A1R A;  1ZYQ A;  3QLH A;  4CF0 A;  2HW3 A;  1EP4 A;  4DLE A;  4CEA A;  3VQ4 A;  3CFO A;  3LZI A;  1KVB A;  4RW4 A;  5CZ1 A;  3RMD A;  4FK4 A;  3OYH A;  1RNH A;  3VA0 A;  1R0A A;  4NYN A;  4M3W A;  4FJM A;  1XI1 A;  3KD5 E;  2ZD1 A;  5FRO A;  3F9K A;  4CJV A;  4M3U A;  5DK5 A;  4W5Q A;  3PV8 A;  3MXM A;  3S3M A;  1Z26 A;  3TAN A;  5HRN A;  4NCB A;  3ZSQ A;  1YTA A;  3AVH A;  4DTP A;  1I39 A;  3HK2 A;  1HYS A;  4LSL A;  1CZB A;  3ZSZ A;  1EX4 A;  4CK3 A;  5EU7 A;  1RBU A;  3SV4 A;  4Z4H A;  1LAW A;  4M3Y A;  5FRM A;  1HNV A;  1GOC A;  1RBS A;  4CJ3 A;  1Z25 A;  1S9E A;  1RTH A;  1S1T A;  4CEQ A;  4KHN A;  4FYD A;  3QO9 A;  3V1O A;  1L5U A;  1D9D A;  1VSL A;  1JXB A;  4FLU A;  1W0H A;  1JLG A;  3MXJ A;  4B9N A;  1YT3 A;  5CY4 A;  2P5O A;  3S9H A;  4HCB A;  3DRR A;  4RW7 A;  1QSL A;  4FXD A;  1JLB A;  1TKZ A;  1BCO A;  2DFF A;  4DQR A;  1L3S A;  1YVU A;  1KFD A;  3TAE A;  3IAY A;  3FFI A;  1RBV A;  3K5L A;  4DSE A;  4HUF A;  4CHQ A;  1TKX A;  4N47 A;  3LAM A;  3U3G A;  1LV5 A;  1KRP A;  1EET A;  1UA0 A;  2DFH A;  4NYF A;  3VQA A;  3OYC A;  1LWF A;  4PA1 A;  4J2E A;  3ZT2 A;  1RIL A;  3TAG A;  2PYJ A;  4CF1 A;  4DSL A;  4IG0 A;  3S3O A;  4ID5 A;  3SUQ A;  3L3U A;  3D0P A;  3V9S A;  2B4J A;  1HNI A;  3QIN A;  4CIF A;  4CF8 A;  3SYZ A;  2X74 A;  1UOC A;  1N6Q A;  3ITH A;  1WSG A;  1LWC A;  2GUI A;  5C25 A;  3ULD A;  2VWK A;  2Y1I A;  4RW6 A;  3QEV A;  3MEC A;  3LPU A;  4IG3 A;  5CZ2 A;  1C0T A;  3IS9 A;  5I42 A;  4F4K A;  1J53 A;  1VRU A;  4G1Q A;  4E89 A;  3PO5 A;  1WSF A;  1ZBF A;  1RDB A;  2XY8 A;  4DTM A;  1XHZ A;  4E0D A;  4DQS A;  3G10 A;  3LWM A;  3K5N A;  3M8P A;  3MXI A;  1ASV A;  1T05 A;  4FJK A;  1LAV A;  1VSF A;  4H4M A;  4M3R A;  3PX4 A;  1KLN A;  4AH9 A;  4CFD A;  2QKB A;  3HO1 A;  3L8B A;  3K5O A;  4FLZ A;  3HPG A;  2G8K A;  1FXX A;  2YKN A;  4AIL C;  4B8C A;  3AVB A;  1U45 A;  2QXF A;  3LZJ A;  3KK3 A;  1S9G A;  2ZE2 A;  3M8S A;  1CZ9 A;  4OPJ A;  1T7P A;  2WON A;  1A5V A;  1TL3 A;  1WNS A;  4NCG A;  4OKK A;  4DSK A;  2HHU A;  4HCC A;  4CGD A;  3OS1 A;  3B6P A;  1HQE A;  1S1V A;  2DFE A;  1JXE A;  4AHT A;  3NGZ A;  2HHV A;  3ZSW A;  1HQU A;  1QE1 A;  1WAJ A;  3K2P A;  4R5P A;  1K6Y A;  4Z4F A;  4W5R A;  3OYK A;  1NJY A;  1QS4 A;  4EP5 A;  3NF7 A;  4FJ5 A;  3AV9 A;  4E7H A;  5E41 A;  2QK9 A;  4CEE A;  1IKW A;  4IBN A;  3HL8 A;  4RG8 A;  3RMC A;  1U4B A;  4GW6 A;  3M8Q A;  3I0R A;  1Q8I A;  3RRH A;  2KZM A;  1VSE A;  3AVF A;  4KTW A;  3AVK A;  3U3Y A;  1HRH A;  3P1G A;  4CGJ A;  3V81 A;  4MFB A;  4CK1 A;  2RN2 A;  2FC0 A;  1RT3 A;  3OYM A;  3L2W A;  4FLY A;  2OPR A;  2VG5 A;  4DS4 A;  4DQQ A;  2E4L A;  3DI6 A;  4DFK A;  2QKK A;  1DLO A;  4ELT A;  1EXQ A;  2YNH A;  2IOC A;  1NK7 A;  1VK0 A;  4FM2 A;  2F96 A;  1HPZ A;  2IC3 A;  1IO2 A;  4RW9 A;  3OVN A;  5HBM A;  3O3H A;  3S3N A;  4B3O A;  4C8N A;  1T03 A;  4L8R B;  1LWE A;  1TL1 A;  4IFV A;  4KV8 A;  5JS1 A;  1NK4 A;  4KB1 A;  3V6D A;  4C8L A;  1SV5 A;  1SL0 A;  3LAK A;  2HHQ A;  3V1Q A;  3L2V A;  3DLE A;  3V9W A;  2IDO A;  1A5X A;  1D8Y A;  3CFR A;  4O0J A;  3CYM A;  4DTR A;  1JLF A;  1EKE A;  3HST B;  4CHZ A;  4OPK A;  3VQ6 A;  2Z1H A;  3ZSR A;  4CJF A;  3VQP A;  3EY1 A;  1L3T A;  3OYI A;  3MED A;  1QSY A;  4FVM A;  3NH1 A;  4WE1 A;  3RR8 A;  3HYF A;  4W5O A;  3K59 A;  3ZSV A;  1JLE A;  3TAP A;  2HMI A;  4C8M A;  3AA3 A;  4I7F A;  4CGI A;  3NCI A;  1SL2 A;  1WSH A;  1DTT A;  2YV0 X;  4LH4 A;  4HHT A;  3KTQ A;  4DFP A;  4H8K A;  1Q9Y A;  1RTD A;  3LAN A;  4CJ4 A;  1U47 A;  3RWU A;  5C24 A;  1FK9 A;  1RT7 A;  3VQ9 A;  1TK5 A;  4EZ6 A;  4AHU A;  4CK2 A;  4MQ3 A;  4JLH A;  3I8D A;  2XRI A;  4FJX A;  4N41 A;  3KLG A;  3CG7 A;  3THV A;  2PZS A;  3C95 A;  2B5J A;  4CHP A;  1O1W A;  4HUG A;  4CJS A;  3QEX A;  4DG1 A;  1ASW A;  2D5R A;  3O4N A;  4AHR A;  4F8R A;  2EHG A;  3JSM A;  1SUQ A;  4DU3 A;  3AO1 A;  4CFC A;  4DTU A;  1HMV A;  3AO3 A;  5J2M A;  4CEC A;  1NJZ A;  4OGE A;  4DF4 A;  4FZX C;  4KRF A;  2Z1I A;  3HP6 A;  1U49 A;  3WNE A;  4B9U A;  4KI6 A;  3HT3 A;  4HTU A;  1W9H A;  4DTN A;  4O4G A;  2Y1J A;  3H08 A;  2LSN A;  2ATQ A;  1JL2 A;  2ETJ A;  2W42 A;  4I9L A;  1NK0 A;  5J2P A;  4KO0 A;  1NOY A;  2FBX A;  3UIQ A;  3QEI A;  5CYQ A;  4DS5 A;  4OJR A;  2XY5 A;  1N5Y A;  3DYA A;  1BL3 A;  3JYT A;  1T8E A;  1RT2 A;  1U48 A;  4Z4I A;  1S1X A;  1VRT A;  3ZCM A;  4FJ8 A;  4FJL A;  2YNI A;  4DQP A;  3NE6 A;  3WNF A;  3CM6 A;  2FBV A;  1S1U A;  1SKW A;  3T19 A;  4B8A B;  1BQN A;  4CHO A;  2YHB A;  3V9X A;  4KB0 A;  2XY7 A;  3QNN A;  1G15 A;  2VG7 A;  3O3G A;  1C6V A;  1C1C A;  2Q3S A;  3OS0 A;  1J5O A;  1XHX A;  4OGC A;  4CEB A;  4J2D A;  3KLE A;  3VQ5 A;  1ITG A;  3SUO A;  1B9F A;  2HHW A;  3HXM A;  5C42 A;  3D45 A;  3IG1 A;  3HPO A;  1QTM A;  4CGG A;  4W5T A;  4CJE A;  3CFP A;  3PX0 A;  3SQ1 A;  1NKC A;  1KSP A;  3WNG A;  1VSD A;  4BE1 A;  5HLF A;  3VN5 A;  3ZT0 A;  4E1N A;  1ZBH A;  1VSJ A;  2KZZ A;  2HHS A;  5D3G A;  4M42 A;  1FKP A;  4LH5 A;  5FDL A;  2KQ2 A;  3HPH A;  4O5B A;  4DQI A;  2FBY A;  2DY4 A;  4W5N A;  4RW8 A;  4ID1 A;  1I3A A;  4Q5V A;  2KFZ A;  4KTZ A;  1TV6 A;  4CF9 A;  3QEP A;  4AHS A;  1NK5 A;  2O4G A;  2IS3 A;  3VQ8 A;  3ALY A;  1C1B A;  4N56 A;  1S1W A;  4CED A;  4C8K A;  4CFA A;  4FM1 A;  4ZTF A;  4F2S A;  4IFY A;  5T7B A;  3DLB A;  3NGI A;  4B9T A;  1ZBU A;  1IG9 A;  3TAQ A;  3KK1 A;  3RR7 A;  4QOZ B;  3LWL A;  3OJS A;  4CCH A;  2A1S A;  3RMB A;  3PY8 A;  4I9Q A;  1XC9 A;  2G8V A;  1GOB A;  4FK0 A;  4CER A;  3ZSX A;  1SKR A;  4OLA A;  3SZ2 A;  3V1R A;  5KGW A;  3SUN A;  3OYL A;  4E7K A;  4N5S A;  1BIZ A;  1KTQ A;  3NF8 A;  4KFB A;  4HVJ A;  3SQ2 A;  1KVC A;  4M3Z A;  3MEG A;  3TAF A;  4ZHR A;  1CLQ A;  2IAJ A;  3HM9 A;  4CHN A;  4FJI A;  4M3X A;  3VQD A;  5HRR A;  4E1M A;  4F3T A;  1X1P A;  4FW2 A;  1LW2 A;  2DTU A;  1HYZ A;  2Z1J A;  2ITG A;  3OYG A;  4KHY A;  1SL1 A;  3AVA A;  3PUF A;  4AHV A;  2VG6 A;  3DLR A;  4KHQ A;  3V4I A;  3VA3 A;  2HND A;  3QET A;  3NHG A;  3LDS A;  2HB5 A;  3ZT4 A;  3OY9 A;  4K8X A;  3QIP A;  4TSX A;  3QER A;  3TAB A;  1JKH A;  3C6T A;  1IKY A;  4JS5 A;  1J54 A;  3TR8 A;  1TK8 A;  2F8T A;  2E6L A;  4CJQ A;  4BDZ A;  2YNG A;  4HUE A;  3SPY A;  4FCY A;  3E01 A;  4I2Q A;  1X9M A;  1S6Q A;  4KAZ A;  2G8U A;  4F2R A;  4LY7 A;  4CJK A;  1BIS A;  2O4I A;  4FM0 A;  3AO5 A;  4DTX A;  1X9W A;  4KTQ A;  2G8I A;  1B9D A;  1L3U A;  2X6S A;  1HYV A;  4M41 A;  1KCF A;  3L3V A;  4FZY A;  3CQ8 A;  2RKI A;  3OYE A;  3L2Q A;  3SUP A;  4ELV A;  4FZZ A;  1UAX A;  4LD0 A;  3V9Z A;  3SQ4 A;  5K14 A;  2YNF A;  4IDK A;  3VQB A;  2KW4 A;  4Z4E A;  3MAQ A;  3TAR A;  2OPQ A;  1QHT A;  5CYM A;  4FLW A;  4DU4 A;  4CJU A;  4E19 A;  3K58 A;  4B9L A;  2OPS A;  4FJ9 A;  3KLI A;  3O4Q A;  3AVM A;  3VQQ A;  3ZSY A;  3AO2 A;  5HRO A;  1GOA A;  4DSJ A;  1RBR A;  4CEZ A;  4DLG A;  4DTS A;  2RF2 A;  4CJR A;  3EZ5 A;  4BDP A;  3KJV A;  3DLH A;  4QAG A;  3QNO A;  1NKB A;  1BI4 A;  1JLA A;  1DTQ A;  4KHS A;  4ELU A;  1ZBL A;  4DSI A;  3HJF A;  1KFS A;  1NJX A;  4EZ9 A;  5SZT A;  3A2F A;  4M3T A;  4CIG A;  5I3U A;  4F3O A;  3AVG A;  4GVM A;  2F8S A;  4Y1D A;  4FJJ A;  1Y97 A;  1BHL A;  3HP9 A;  2R7Y A;  3TAM A;  4YNQ A;  2E6M A;  2BGG A;  1TAU A;  4B9M A;  4DU1 A;  3OYJ A;  5KRT A;  1WLJ A;  2HHT A;  5HRS A;  1S5J A;  3G0Z A;  1B92 A;  1RDA A;  4KHU A;  1REV A;  1WN7 A;  4K8Z A;  4DTO A;  4FK2 A;  2B6A A;  2PYL A;  1NK8 A;  3KKR A;  3C6U A;  2GBZ A;  1SKS A;  1WSI A;  3DLK A;  1D5A A;  5SWM A;  1LW0 A;  2BDP A;  1TK0 A;  3NH0 A;  5FRN A;  2OZS A;  4FJG A;  2JLE A;  1YTU A;  1S6P A;  2BAN A;  3RMA A;  4FJN A;  4O44 A;  3ZT1 A;  4CJ5 A;  3VQ7 A;  3RRG A;  5JS2 A;  3AA4 A;  3WNH A;  2YHA A;  3BGR A;  4LSN A;  3AVL A;  1C0M A;  3QES A;  4DF8 A;  3LP1 A;  4QCL A;  4FW1 A;  1JL1 A;  5DMR A;  4CE9 A;  1RDC A;  3LP0 A;  4PQU A;  2VWJ A;  4KRE A;  4JRP A;  4H4O A;  3PX6 A;  2HHX A;  4PUO A;  3SI6 A;  1KVA A;  2WOM A;  3B6O A;  3RTV A;  4E7I A;  2PY5 A;  1Q9X A;  1JLQ A;  1ASU A;  5J1E A;  3EYZ A;  4PY5 A;  4C8O A;  3NDK A;  3LP3 A;  3OJU A;  3TWH A;  5KI6 A;  1RT5 A;  1VSH A;  1TKT A;  2RPI A;  3DMJ A;  3DRS A;  2OYQ A;  4Z4G A;  4JRQ A;  3SQ0 A;  4ZTJ A;  1HJR A;  2X78 A;  2JGU A;  1NKE A;  4J2A A;  4O55 A;  1QQC A;  1NJW A;  3AVN A;  3VQE A;  4E7J A;  4DFM A;  4CJT A;  1CXU A;  1X9S A;  4OVL A;  4CHY A;  4DWI A;  4Q0B A;  4ICL A;  3I0S A;  4GMJ B;  2G8H A;  1BI4 B;  1BCM A;  3DM2 A;  3KLF A;  4KI4 A;  1A5W A;  1RTJ A;  2P5G A;  1MU2 A;  4UQG A;  4CEO A;  4N76 A;  4PWD A;  4OKE A;  1IH7 A;  2G8F A;  3K57 A;  1RT1 A;  3P83 D;  3HVT A;  4YFU A;  3TI0 A;  2HNY A;  3NGY A;  1VSI A;  3AO4 A;  4M45 A;  1CXQ A;  3NBP A;  4B08 A;  4CES A;  4DMN A;  1UA1 A;  4OLB A;  3OYN A;  4EP4 A; 
#chains in the Genus database with same CATH topology
 3AAR A;  1RT6 A;  2P1J A;  4CGH A;  4K41 A;  2UUC K;  3QBX A;  3CC2 N;  3ZEU B;  4XIU A;  3KIO A;  3U6F A;  4BAC A;  3AVJ A;  1WUA A;  1QHA A;  5GAG P;  5AQM A;  4DV2 K;  1TGO A;  2D1K A;  1YAG A;  2XO7 A;  4IKF A;  2XY6 A;  2QWN A;  4LF7 K;  4Z4I A;  4CFB A;  3OYA A;  4LFC K;  4IO9 L;  1RDD A;  1FKO A;  1C1A A;  3OYD A;  1RBT A;  2X6N A;  2XHB A;  4O0I A;  2OZS A;  3ZX0 A;  4BWM A;  2P9S A;  2FBT A;  3M3Z A;  3ZET A;  1BUP A;  4BR2 A;  3SCX A;  1QSS A;  5HP1 A;  3SPZ A;  4EIA A;  3ZSO A;  3GG4 A;  5BRF A;  3SNN A;  1L3V A;  3J8A A;  1D4X A;  3VQC A;  4JI2 K;  3UKR B;  2GV9 A;  3P5J A;  5MLC Q;  3THY B;  2EX3 A;  3PO4 A;  1U04 A;  1IKV A;  3QB0 A;  3TU5 A;  2NUB A;  3SJJ A;  2QXL A;  3MN9 A;  4AM6 A;  3NF6 A;  4KKO A;  4CJW A;  5AQY A;  1VSK A;  2O8E A;  4CJP A;  1NK6 A;  1MWK A;  3DLG A;  2NRH A;  3MEE A;  5JIC A;  2I7N A;  3T3F A;  4Z4C A;  2BE2 A;  5J2Q A;  4CZJ A;  1D9F A;  4CZG A;  4Y1C A;  2A1R A;  2O8D A;  3P31 A;  3C6H A;  4DLE A;  3WXK A;  1XUP O;  3VA0 A;  1YJW N;  3MK6 A;  1QQN A;  4JHD B;  1XMO K;  1RFQ A;  1RDW X;  5FRO A;  3HOS A;  4M3U A;  1HKC A;  3S3M A;  1W2B M;  3E1Y A;  4JKA A;  4DUZ K;  1Z26 A;  2ZJQ L;  3TAN A;  4NCB A;  3ZSQ A;  4JK8 A;  1I39 A;  1CZB A;  4CK3 A;  2HF3 A;  1GOC A;  1RBS A;  3KVG A;  2YHW A;  4CJ3 A;  4XH4 A;  3CJ9 A;  1U2V A;  4CZH A;  2PBD A;  1W0H A;  4B9N A;  1WBB A;  1KAZ A;  3S9H A;  1QSL A;  3ZX3 A;  1JLB A;  2P9U B;  3SMP A;  1YVU A;  3IAY A;  1VQ6 N;  2O8B A;  3TTD A;  4BC4 A;  1HLU A;  1TKX A;  4N47 A;  3DWL A;  1LWF A;  4NXM K;  4WQ4 C;  4ID5 A;  3L3U A;  3V9S A;  5JVG L;  4JK9 A;  3ATV A;  2B4J A;  2VYP A;  4CF8 A;  3QDK A;  1YXQ A;  4K42 A;  5C25 A;  2VWK A;  4RW6 A;  2Q1N A;  3NVK A;  3MEC A;  3IS9 A;  5F0X A;  3AAP A;  4G1Q A;  3O6W A;  3SBT A;  4DV6 K;  1XHZ A;  4E0D A;  1SZ2 A;  1N8R O;  1ATN A;  2GTD A;  2NRX A;  3MXI A;  1FW6 A;  3CPE A;  1LAV A;  4H4M A;  3PX4 A;  4AH9 A;  4CFD A;  5AQR A;  3HO1 A;  2YI1 A;  1XNQ K;  5H1S Q;  2G8K A;  3P38 A;  3C65 A;  4B8C A;  1U45 A;  1S9G A;  3M8S A;  4OPJ A;  1T7P A;  1A5V A;  1TL3 A;  1WNS A;  2E2Q A;  3B6P A;  4AHT A;  2DFE A;  3FLC O;  2ZM6 K;  4WCE L;  3MMV A;  1K6Y A;  4Z4F A;  4W5R A;  3AGK A;  3JS6 A;  4EP5 A;  2UXB K;  4FJ5 A;  4IBN A;  3LM9 A;  3HZ6 A;  1U4B A;  3M8Q A;  1BOT O;  2KZM A;  1VSE A;  1G99 A;  4MFB A;  1OKJ A;  4CK1 A;  4FLY A;  1RT3 A;  2OPR A;  3A0I X;  3ULE B;  4BC5 A;  2YNH A;  1NK7 A;  4FM2 A;  5AQN A;  2NNW A;  4RW9 A;  5B8H A;  1IO2 A;  5HBM A;  4B3O A;  5JS1 A;  1NK4 A;  4C8L A;  4YDU C;  3L2V A;  1D8Y A;  3CFR A;  3CYM A;  3AGR A;  2AP1 A;  1EKE A;  4U67 L;  1NGC A;  4CHZ A;  4OPA A;  3VQP A;  1L3T A;  3CJC A;  4W5O A;  3K59 A;  1JLE A;  2QI2 A;  3AA3 A;  4I7F A;  1SL2 A;  5M1N A;  3P39 A;  2KHO A;  4H8K A;  1Q9Y A;  1NGF A;  2P9L A;  3RWU A;  1RT7 A;  3VQ9 A;  2OCE A;  1DT9 A;  2UUA K;  2GX9 A;  4N41 A;  3CG7 A;  3C95 A;  2B5J A;  5I9E B;  2D5R A;  1IBM K;  3D2F B;  1SUQ A;  4DU3 A;  3C0B A;  3AO1 A;  4DTU A;  3AO3 A;  1NJZ A;  4FZX C;  3D6R A;  4B9U A;  4KI6 A;  3C7N A;  4O8U A;  3HT3 A;  2Q0R A;  5AFU A;  4FOE A;  3MX5 A;  1HUX A;  2LSN A;  3HTV A;  2ETJ A;  1NK0 A;  5J2P A;  4KO0 A;  4DS5 A;  4OJR A;  5GIN A;  1N5Y A;  1JCE A;  4GNI A;  3JYT A;  4CZM A;  4IEE A;  4FJL A;  3CM6 A;  3O08 A;  1N34 K;  1GLD G;  4LFA K;  2YHB A;  1G15 A;  3CJ1 A;  3OS0 A;  4J2D A;  4QS7 A;  3KLE A;  3KWI A;  3SUO A;  3HXM A;  3IG1 A;  4U7B A;  4A5A A;  1VSD A;  4BE1 A;  5HLF A;  3VN5 A;  2HHS A;  1FKP A;  4W5N A;  1GLJ O;  4MLH A;  5LJV A;  1I3A A;  4C1N I;  3LDL A;  3VQ8 A;  3ALY A;  3PSI A;  3H1Q A;  4FM1 A;  1HPM A;  4F2S A;  5T7B A;  2NRR A;  3NGI A;  4GKJ K;  2JWL A;  1OVQ A;  4AF1 A;  4B9T A;  1ZBU A;  2ITM A;  1NBW A;  3TAQ A;  3RR7 A;  2VCP A;  3J7Y P;  3AAQ A;  5AQP A;  3PY8 A;  4BRD A;  1GOB A;  4CER A;  1KAY A;  3V1R A;  4PL7 A;  3NF8 A;  4KFB A;  1TYQ B;  3CXC M;  1GLE G;  1JCG A;  4BG8 A;  1CLQ A;  4FJI A;  4CHN A;  3VQD A;  4E1M A;  4F3T A;  1O13 A;  2DTU A;  1M90 O;  3OYG A;  3SMS A;  3AVA A;  4AHV A;  3QET A;  4B1Y B;  2HB5 A;  4OPH A;  2I7P A;  3FE1 A;  3TAB A;  3C6T A;  3M1F A;  4HUE A;  4I6M B;  1X9J A;  1X9M A;  4MO5 A;  1EO1 A;  3AO5 A;  4DR5 K;  2RKI A;  4GY2 B;  3SUP A;  1EQY A;  4IDK A;  2KW4 A;  4RCH A;  4Z4E A;  3MAQ A;  3EZW A;  1IBL K;  4O8K A;  5CYM A;  4E19 A;  4B9L A;  2OPS A;  1NGB A;  5JLF A;  3KLI A;  1ESV A;  1GOA A;  3K9J A;  2RF2 A;  4IOA L;  3VTI A;  1SQK A;  3QNO A;  1DTQ A;  4A61 A;  3THW A;  3EN9 A;  1ZBL A;  4DSI A;  3VET A;  4EZ9 A;  5AQX A;  4F3O A;  3AVG A;  4GVM A;  4B3R K;  4L3Q A;  1BHL A;  2BGG A;  3LDO A;  5DM7 L;  5KRT A;  5HRS A;  1S5J A;  1DGK N;  4KHU A;  1WN7 A;  4YOY A;  1NK8 A;  1K9M O;  1NGE A;  2ZJR L;  1SKS A;  1D5A A;  3NH0 A;  5FRN A;  4FJG A;  3CCQ N;  2BAN A;  5EY4 A;  2W6K A;  4LSN A;  5C2F A;  3QES A;  2D0O A;  4FW1 A;  4PQU A;  1RDC A;  4H4O A;  3PX6 A;  1ZC6 A;  2PFU A;  5J1E A;  4PY5 A;  1C0G A;  4C8O A;  3LP3 A;  1YI2 N;  3L0Q A;  3DMJ A;  4NXN K;  1QQC A;  4DV7 K;  1JJ2 M;  2E20 A;  2HBK A;  3L4Q A;  4CJT A;  1X9S A;  5KPR A;  3Q7B A;  4GMJ B;  1BCM A;  4X62 K;  4KI4 A;  1A5W A;  1RTJ A;  3R6M A;  1NGD A;  3VTH A;  5M1P A;  2G8F A;  4B1U B;  3TI0 A;  4M45 A;  1UA1 A;  3RRH A;  4BC3 A;  3KK2 A;  5KPT A;  2O8C B;  3C6A A;  2I5J A;  4DTJ A;  4A2B A;  1BGX T;  1ZBI A;  4B9Q A;  1BIU A;  2D0P A;  2Z1G A;  4JV5 K;  4BRG A;  1T6C A;  3L2U A;  3SBG A;  3AVC A;  5J2N A;  1TVR A;  1Z6R A;  2A6A A;  4CEF A;  4BY9 C;  3DOK A;  4H0V B;  4FZZ A;  1Q9X A;  3DOL A;  5KGX A;  1TAQ A;  3CCS N;  4KPY A;  4BQL A;  1TKD A;  3NH2 A;  1VSM A;  2ZGZ A;  5HRP A;  4PKG A;  4JS4 A;  3VF6 A;  4CD1 A;  2OPP A;  3QFP A;  2D0B A;  2D0C A;  5CE3 A;  2HVI A;  2D0A A;  3E9O A;  1YUW A;  3NAE A;  1BQM A;  3OYB A;  3UE5 A;  4CJL A;  3KD1 E;  2A3Z A;  3CPW M;  5TKW A;  3QEW A;  3PSF A;  1F21 A;  3ZX2 A;  3C94 A;  3CCR N;  1IKX A;  3KLH A;  5AQW A;  4J8F A;  4FJH A;  1W7A A;  4I2P A;  1RTI A;  4EHT A;  4AHC A;  2V52 B;  4CF0 A;  4CEA A;  3CFO A;  1Z05 A;  1KVB A;  3RMD A;  4FK4 A;  3OYH A;  4NYN A;  1GLC G;  5HRN A;  1YTA A;  3AVH A;  4LSL A;  3J7A P;  4JKG A;  3OBW A;  1RBU A;  3SV4 A;  2UXC K;  1LAW A;  3FFK B;  1IG8 A;  3SK3 A;  5AZJ A;  1Z25 A;  2A42 A;  4CEQ A;  1BO5 O;  1JCF A;  4M7X A;  3V1O A;  3I55 N;  1L5U A;  4FYD A;  4JAX A;  4BR5 A;  1JLG A;  3MXJ A;  2D4W A;  3J7Z O;  2Q97 A;  3DXM A;  1TYQ A;  2ZGY A;  1TKZ A;  5AQH A;  1RBV A;  2FSJ A;  2P9K A;  1TUU A;  1WOQ A;  4HUF A;  4BRL A;  1LV5 A;  3ID8 A;  1KRP A;  3VQA A;  4CI6 A;  4J2E A;  1K8A O;  1RIL A;  2PYJ A;  4CF1 A;  4IG0 A;  3S3O A;  3SUQ A;  1FJG K;  3FZL A;  3N4Q A;  4F9O A;  2BH1 A;  1RGI A;  3SYZ A;  3ITH A;  1WSG A;  2GUI A;  2Y1I A;  3TSQ A;  3LPU A;  1C0T A;  5I42 A;  1MDU B;  3PO5 A;  1WSF A;  2XY8 A;  4DQS A;  2QWP A;  4JEP A;  1ASV A;  4HTL A;  1VSF A;  2A40 A;  4FO0 A;  2QM1 A;  5JLH A;  5KQD A;  3CJB A;  5C10 A;  1FXX A;  3G71 N;  3AVB A;  3OTO K;  5EOY A;  4CZF A;  2WON A;  4CW7 B;  3OS1 A;  1E4G T;  1S1V A;  2HHV A;  1HQU A;  1WAJ A;  4H0X B;  1QS4 A;  4Z94 A;  5E41 A;  2QK9 A;  3HL8 A;  1ILY A;  4YOT A;  4A57 A;  3HOT A;  3I0R A;  3AVF A;  4DR6 K;  2RN2 A;  2FC0 A;  3L2W A;  4DQQ A;  1VQ4 N;  1XQS C;  1DLO A;  4X64 K;  1EXQ A;  4DV5 K;  2F96 A;  1EWQ A;  3DXK B;  2WC9 A;  5BRD A;  1T03 A;  1TL1 A;  4IFV A;  4KV8 A;  3V6D A;  1SL0 A;  3WXJ A;  3WUH A;  1BWF O;  5AZI A;  3THX A;  3EEQ A;  2YJE A;  3BZC A;  3L6Q A;  4XEI A;  1JLF A;  4X65 K;  1K8K A;  2WUS A;  3VQ6 A;  4CJF A;  3EY1 A;  2F9T A;  3OYI A;  3A8Y A;  3T1H K;  3NH1 A;  4IJA A;  4WE1 A;  3ZSV A;  4CGI A;  3NCI A;  2O8F A;  2GEM A;  2YV0 X;  3D2E B;  4ISF A;  3O1B A;  3VMF B;  3LAN A;  1U47 A;  5C24 A;  1FK9 A;  4CK2 A;  4MQ3 A;  4FJX A;  3EKS A;  4A2A A;  4F8R A;  4CJS A;  2P9N A;  5BPM A;  3JSM A;  3ENB A;  5AQG A;  4CFC A;  4BRQ A;  3A5M C;  4OGE A;  4DF4 A;  4KRF A;  3WEE B;  2RE2 A;  1U49 A;  3WNE A;  2V7Y A;  4HTU A;  1W9H A;  4DTN A;  4O4G A;  2Y1J A;  2FXU A;  2O8C A;  1J6Z A;  2FBX A;  5CYQ A;  5M1F A;  1NJI O;  2E5L K;  5GAH P;  3UKU B;  1VRT A;  3ZCM A;  5AJ3 K;  3U9Z A;  3NE6 A;  1QVF M;  3O4W A;  3T19 A;  4B8A B;  3V9X A;  4KB0 A;  3QNN A;  2ASM A;  2Q3S A;  3LL3 A;  3CCJ N;  4CEB A;  1P8Z A;  4GVE A;  1ITG A;  2UUB K;  1B9F A;  3D45 A;  3HPO A;  4JNE A;  4CGG A;  4CJE A;  4JD2 B;  1KSP A;  3WNG A;  1QQM A;  3MN7 A;  3ZT0 A;  4JYA K;  4E1N A;  4JKD A;  1ZBH A;  2KZZ A;  5D3G A;  4M42 A;  3W0L A;  5FDL A;  3EO3 A;  4WYB A;  4DQI A;  4CZI A;  2DY4 A;  2WFB A;  4ID1 A;  1NGG A;  4KTZ A;  1W97 L;  2IVO A;  4AHS A;  1S3X A;  2UYT A;  3RSE B;  4N56 A;  4CED A;  4C8K A;  4ZTF A;  3T1Y K;  3O9Q A;  5GAE P;  4QS9 A;  1IG9 A;  3IUC A;  4DV4 K;  3LDP A;  2A1S A;  2G8V A;  4FK0 A;  3ZSX A;  1QQO A;  4NO7 A;  2AA4 A;  3ZYY X;  4M3Z A;  3TAF A;  4ZHR A;  3CCU N;  2IAJ A;  2J4R A;  3HM9 A;  3VF2 A;  3G4S N;  4FW2 A;  2ITG A;  3MWT A;  3CHW A;  4YOW A;  2VG6 A;  4JI1 K;  3DLR A;  1NWK A;  4FWL A;  3VA3 A;  5AQS A;  3NHG A;  1HKB A;  3LDS A;  1BA0 A;  3OY9 A;  1Q7Y O;  4TSX A;  3OBY A;  3QIP A;  3PIO L;  1J54 A;  3TR8 A;  4BVP A;  3CCL N;  3SPY A;  4I2Q A;  1OH7 A;  1S6Q A;  2G8U A;  4X66 K;  4LY7 A;  1BIS A;  4BQZ A;  4FM0 A;  4NB4 A;  4DTX A;  1B9D A;  4WQ5 C;  1HYV A;  3U8X A;  2QWQ A;  3CQ8 A;  1UAX A;  3U9D A;  5K14 A;  4DU4 A;  4CJU A;  3K58 A;  3O4Q A;  4FWS A;  3ZSY A;  5LJW A;  1RBR A;  4ILJ A;  5AQL A;  4DLG A;  3MN6 A;  3F5T A;  4QAG A;  1BI4 A;  3HJF A;  1KFS A;  3VEV A;  4BRI A;  2IVP A;  2F8S A;  3OW2 M;  3QIC A;  3TAM A;  2FLO A;  3BZK A;  1TAU A;  4DUY K;  3OYJ A;  1RDA A;  4DTO A;  3DLL L;  3VPZ A;  3ZEU A;  5SWM A;  2VGN A;  3BP8 A;  3W3D A;  2BDP A;  4BRH A;  2JLE A;  1ZXO A;  4FJN A;  4O44 A;  3VQ7 A;  3JAM O;  1KXP A;  2YHA A;  1MWM A;  1Q81 O;  4DF8 A;  1JL1 A;  5DMR A;  4CE9 A;  2VWJ A;  4PUO A;  3SI6 A;  3EE9 A;  1JLQ A;  2HBL A;  3T7Z A;  3TWH A;  1RT5 A;  4DB3 A;  1YVN A;  1X3M A;  3UKR A;  4O5F A;  1YJN N;  1NKE A;  1YHQ N;  1EWR A;  1BG3 A;  3AVN A;  3VQE A;  3THY A;  4E7J A;  4MDB A;  1ATR A;  4KBO A;  4CHY A;  2OTJ N;  3CCE N;  4Q0B A;  4ICL A;  3I0S A;  2G8H A;  4BRA A;  3CQY A;  4UQG A;  5AQO A;  4OKE A;  3FZK A;  3MN5 A;  4DMN A;  4B08 A;  4FWP A;  3KKS A;  4H03 B;  1VQO N;  2HNZ A;  2KFN A;  4K25 A;  2F7T A;  1VQL N;  4M63 C;  2G8W A;  4KHW A;  2P9P B;  4CIE A;  3LAL A;  4JHD A;  4C1N K;  1UWB A;  1WSE A;  4OKJ A;  3QEX A;  3E9L A;  2YKM A;  1NOZ A;  4FLT A;  3EE8 A;  4ILG B;  3CM5 A;  3IRX A;  3HM8 A;  3MCA B;  4CD3 A;  1C0U A;  3VEO A;  4FLV A;  1RT4 A;  3CJA A;  1NK9 A;  3AA5 X;  3MWP A;  2IGI A;  4BDY A;  3F73 A;  2KTQ A;  1XWL A;  4E7L A;  4FJ7 A;  2FSN A;  2F9W A;  3AA2 A;  4H5N A;  4BE0 A;  3BEX A;  3LM2 A;  4DHY A;  1VQP N;  2P9U A;  3ZT3 A;  2OZM A;  3MCP A;  1RCH A;  3SV3 A;  3BDP A;  1S22 A;  3ASM A;  3K5M A;  4V19 S;  4HWI A;  2P51 A;  1HNX K;  3CMA N;  3LDN A;  4DV3 K;  3OYF A;  5LMN K;  3TTF A;  3LPT A;  4NCA A;  4J2B A;  3QML A;  5KTQ A;  4PKH A;  2V51 B;  3LDQ A;  1KLM A;  1ZYQ A;  4H5W A;  3CC4 N;  2DPN A;  3QLH A;  2HW3 A;  4JI0 K;  4FPB A;  3CF5 L;  4JN4 A;  1RNH A;  4YOR A;  1R0A A;  3WQU A;  4M3W A;  4FJM A;  1XI1 A;  4LFB K;  3KD5 E;  3H1V X;  1KAX A;  3IMX A;  3KWG A;  4CJV A;  4MO4 A;  4DV1 K;  3MXM A;  3BF3 A;  2QA4 N;  1HYS A;  3HK2 A;  2EWS A;  1HJO A;  2HF4 A;  5IT9 O;  1EX4 A;  5EU7 A;  5FRM A;  2P9S B;  3IFR A;  3ZET B;  4KHN A;  5BPN A;  3K9K A;  3I33 A;  2W40 A;  1VSL A;  1JXB A;  4WQ4 A;  1YT3 A;  5CY4 A;  2P5O A;  4A59 A;  1T44 A;  1BCO A;  2DFF A;  4DQ8 A;  3TAE A;  1KFD A;  3FFI A;  1KD1 O;  4WFN L;  4BR9 A;  4DSE A;  3U3G A;  3LAM A;  2ASP A;  1UA0 A;  2DFH A;  3VOV A;  5M1K A;  3OYC A;  3ULE A;  3ZT2 A;  5C0Y A;  1Q18 A;  4R79 A;  3D0P A;  4YOU A;  3QIN A;  1HNI A;  2VGM A;  4CIF A;  5M1Q A;  2HST A;  4B1V A;  4F4K A;  1J53 A;  3AY9 A;  4E89 A;  5ADX H;  2HOE A;  4DTM A;  3BF1 A;  3G10 A;  3LWM A;  3A5L C;  1T05 A;  2NLX A;  4DR3 K;  4FJK A;  2FF6 A;  3K5O A;  1QZ5 A;  3FZF A;  4AIL C;  4BRN A;  3LZJ A;  5BRE A;  3KK3 A;  1IV0 A;  4NCG A;  3R8E A;  2HHU A;  1VHX A;  4HCC A;  1JXE A;  3ZSW A;  4WFB L;  1U2V B;  3K2P A;  3OYK A;  3D2F A;  4E7H A;  4CEE A;  1IBK K;  1IKW A;  1VQ9 N;  4GW6 A;  3ENH A;  2O8B B;  2E1Z A;  4KTW A;  5E26 A;  3V81 A;  4YDU A;  4ILH A;  3OYM A;  4DFK A;  2E4L A;  4FWK A;  1E4F T;  1VK0 A;  1HPZ A;  2IC3 A;  4AQY K;  2NRW A;  5AQI A;  4B1Z A;  4C8N A;  1WB9 A;  3SAG A;  2QW9 A;  1HR0 K;  4LF5 K;  1SV5 A;  3LAK A;  3V1Q A;  2IDO A;  5AQV A;  4FPA A;  5CHI A;  3IDH A;  3O80 A;  1Q82 O;  4DTR A;  3HST B;  3GDQ A;  3RR8 A;  4RWT A;  3IKM A;  3R1X A;  2Q36 A;  4C8M A;  2HMI A;  4LF4 K;  4B9M A;  4LH4 A;  4CVN E;  4ISE A;  2E88 A;  4HHT A;  4DFP A;  4WF9 L;  4OLB A;  4EHU A;  1RTD A;  5EVZ A;  4IWV A;  4MLE A;  4JLH A;  4BRE A;  4GV9 A;  5FPD A;  3R3L A;  3THV A;  1KQS M;  2QWO A;  3VEX A;  3CET A;  4HUG A;  4DG1 A;  3O4N A;  4DR2 K;  1OH6 A;  5J2M A;  5CR4 A;  2E2O A;  1NG9 A;  3H46 O;  3HP6 A;  3M6G A;  3MDQ A;  1VQK N;  2ATQ A;  1JL2 A;  2W42 A;  4I9L A;  4YOV A;  3UIQ A;  3QEI A;  4CZK A;  4B3T K;  5GAD P;  1BL3 A;  3VEN A;  1RT2 A;  3O9S A;  1S1X A;  4JI6 K;  4K43 A;  4FJ8 A;  4DQP A;  2P9P A;  5GIP A;  1S1U A;  1I94 K;  1LCU A;  1XC3 A;  1LOT B;  4CHO A;  2FSK A;  3WT0 A;  2PAV A;  3VEW A;  2VG7 A;  3O3G A;  1C6V A;  1J5O A;  1XHX A;  4OGC A;  1YJ9 N;  4GKK K;  3VQ5 A;  1NGI A;  2HHW A;  3FZM A;  5C42 A;  2IVN A;  4KH5 A;  4W5T A;  4I6M A;  4IO8 A;  3E66 A;  3SQ1 A;  4IFE A;  3CC7 N;  3EL2 A;  4Y0W A;  4NLC A;  1H1V A;  2CGK A;  2NRZ A;  5FLX O;  2KQ2 A;  3HPH A;  4O5B A;  2FBY A;  2P9L B;  4H5R A;  1TV6 A;  4CF9 A;  3QEP A;  4H0Y B;  5A2Q O;  1C1B A;  1S1W A;  1E3M A;  3J80 O;  2WTU A;  5GIO A;  5KQ8 A;  1BU6 O;  1HX1 A;  4UY8 O;  2CGL A;  4I9Q A;  4CCH A;  2Q2R A;  3RMB A;  3C7N B;  4BVO A;  1SKR A;  3SZ2 A;  4OX9 K;  3I8B A;  3WXL A;  5KGW A;  3SUN A;  2V7Z A;  3OYL A;  4E7K A;  4N5S A;  4HVJ A;  3MEG A;  4M3X A;  4WFA L;  1LW2 A;  2Z1J A;  3KK7 A;  3PUF A;  3CCV N;  4LC9 B;  4KHQ A;  1VAZ A;  2HND A;  4DR1 K;  4JKE A;  3ZT4 A;  3O1W A;  1JKH A;  4JS5 A;  1IKY A;  2F8T A;  1TK8 A;  4CJQ A;  4BC2 A;  1HNW K;  2UXD K;  5F2R A;  2O4I A;  1BDG A;  1L3U A;  3N4P A;  1NU0 A;  4FZY A;  3L2Q A;  3M5R A;  4KH6 A;  4ELV A;  4KH4 A;  5ELZ A;  4LD0 A;  3SQ4 A;  2QEX N;  2YNF A;  3VGL A;  4H5V A;  3HSC A;  5EX5 A;  3TAR A;  2OPQ A;  2ZWH A;  1QHT A;  1T3V A;  1WBD A;  1QVG M;  3FGU A;  1VQM N;  5BR9 A;  4FJ9 A;  2ZJP L;  3AO2 A;  5HRO A;  4CEZ A;  4DTS A;  3EZ5 A;  5AQF A;  4BDP A;  1NKB A;  3ZLJ A;  1JLA A;  3H3N O;  3HI0 A;  4CIG A;  1CZA N;  1Y97 A;  3HP9 A;  2R7Y A;  4DU1 A;  5LY3 A;  2HHT A;  3G0Z A;  1REV A;  1NMD A;  4FK2 A;  2B6A A;  3WQT A;  2PYL A;  4IDH A;  3DLK A;  5AQT A;  3QBW A;  1RDU A;  4LF6 K;  4AM7 A;  5BR8 K;  5JS2 A;  4H0T B;  4YOX A;  2KKZ A;  3P4I A;  3AVL A;  1C0M A;  4QCL A;  3LP1 A;  3VGK A;  4IXC A;  4KRE A;  2A41 A;  4E7I A;  3RTV A;  2PY5 A;  1ATS A;  3EYZ A;  1ASU A;  2YX6 A;  3NDK A;  4GV6 A;  5C15 A;  5ADX A;  5KI6 A;  1VSH A;  2RPI A;  4Z4G A;  3DRS A;  2OYQ A;  4JRQ A;  3SQ0 A;  4ZTJ A;  1HJR A;  2X78 A;  1HKG A;  4O55 A;  1NJW A;  4YY3 K;  4IOC L;  1OH5 A;  1CXU A;  3KHY A;  4BRC A;  3THW B;  2P5G A;  1NMN A;  4CEO A;  4N76 A;  4PWD A;  1IH7 A;  1XMQ K;  4B1X B;  3K57 A;  1V4S A;  2HNY A;  3AO4 A;  1CXQ A;  4EP4 A;  3NMU A;  2BTF A;  3VGM A;  4BRK A;  4JKH A;  4EAH D;  3HVR A;  2CH5 A;  4CF2 A;  2QWM A;  4FWO A;  3M8R A;  1JLC A;  1WAF A;  3AVI A;  3LZI A;  5HL7 L;  4FLX A;  4BWJ A;  4Z0U A;  1NGJ A;  5KRS A;  3U4L A;  3NFA A;  3QIO A;  1D9D A;  4KHY A;  3KTQ A;  3OS2 A;  3DRP A;  3CI5 A;  3QFU A;  4B9S A;  3V9U A;  4K0K K;  1WSJ A;  3D7E O;  2AJQ A;  4BG9 A;  4JI3 K;  3A5N C;  3T1A A;  5BPL A;  2HVH A;  3CIP A;  1J9A A;  4BE2 A;  3L2R A;  4DFJ A;  4DKW A;  1NGH A;  2E2N A;  4DSF A;  5FPE A;  3LP2 A;  3O3F A;  3WXM B;  5BRH A;  3GL1 A;  3NVM A;  1GLL O;  3NF9 A;  4E3S A;  1T6D A;  1YIJ N;  3FZH A;  2A5X A;  4YHH K;  4DR4 K;  2OA8 A;  4CGF A;  4B9V A;  5JVH L;  2ZQB A;  3ISN C;  1GLA G;  3R9P A;  2NRT A;  1KC8 O;  3BUZ B;  1U6Z A;  5AQJ A;  4JI5 K;  1EP4 A;  3VQ4 A;  4B3S K;  2OAN A;  4RW4 A;  5CZ1 A;  1K73 O;  2H3G X;  2ZD1 A;  3F9K A;  2P9I B;  3GE1 A;  3SAH A;  5DK5 A;  4W5Q A;  3PV8 A;  5EXW A;  4DTP A;  3ZSZ A;  2WBN A;  3EKU A;  4Z4H A;  4M3Y A;  1HNV A;  3CJ7 A;  3VF4 A;  1SAZ A;  2NZT A;  1S9E A;  1RTH A;  4QS8 A;  1S1T A;  3DAW A;  3QO9 A;  1R59 O;  3FR0 A;  5C2D A;  3UB5 A;  4FLU A;  3H3O B;  2Q31 A;  4HCB A;  3DRR A;  4RW7 A;  4G9Z A;  4FXD A;  4DQR A;  1L3S A;  3K5L A;  5F1X A;  4JK7 A;  4CHQ A;  1EET A;  2W6L A;  4NYF A;  5AQU A;  4PA1 A;  2E1Y A;  3TAG A;  4DSL A;  1S72 N;  4FL9 A;  3DXK A;  3F2K A;  4M7Y A;  2X74 A;  1UOC A;  1N6Q A;  1LWC A;  3ULD A;  3MX2 A;  3QEV A;  4IG3 A;  4LF8 K;  5CZ2 A;  1VRU A;  2YCH A;  1ZBF A;  1RDB A;  3HRG A;  2JWK A;  2VQE K;  3DJC A;  3B8A X;  3TPQ A;  3K5N A;  3M8P A;  4JI8 K;  1QZ6 A;  1C0F A;  1KLN A;  4M3R A;  4BGB A;  2VQF K;  2QKB A;  3S41 A;  1N33 K;  3O9R A;  3L8B A;  2E8A A;  4FLZ A;  3HPG A;  4CJ7 A;  2YKN A;  4XH1 A;  4MDA A;  5HOO A;  2QXF A;  4JI4 K;  3PLA A;  4JI7 K;  3D2E A;  2ZE2 A;  1CZ9 A;  4JKG B;  3GOI A;  4OKK A;  1N36 K;  4DSK A;  4CGD A;  5AZJ B;  1HQE A;  3NGZ A;  1QE1 A;  3OA9 A;  4R5P A;  1NJY A;  3NF7 A;  3AV9 A;  3DXM B;  4E1J A;  3JXU A;  4RG8 A;  3RMC A;  1Q8I A;  2RHK A;  2W41 A;  3WEE A;  2P9K B;  3U3Y A;  3AVK A;  1HRH A;  3P1G A;  4CGJ A;  4DS4 A;  4FSV A;  2QKK A;  2VG5 A;  3DI6 A;  4ELT A;  4DCH A;  3O5B A;  2IOC A;  4FVU A;  2KLA A;  3UKU A;  3ID6 A;  3OVN A;  3O3H A;  3S3N A;  5AQK A;  4L8R B;  1LWE A;  4KB1 A;  4BRM A;  4BRO A;  4CBW A;  4C23 A;  2HHQ A;  1OH8 A;  3V9W A;  3DLE A;  4H0P A;  3Q7C A;  1A5X A;  2HBJ A;  4O0J A;  3O9T A;  3TSU A;  4OPK A;  2Z1H A;  3ZSR A;  4A5B A;  1QSY A;  4JD2 A;  3MED A;  4FVM A;  3HYF A;  3SLC A;  3TAP A;  1TUY A;  2E2P A;  3VEY A;  4FWN A;  1WSH A;  1DTT A;  4CJ4 A;  3OYN A;  1GLB G;  1TK5 A;  4EZ6 A;  4AHU A;  3RSE A;  3I8D A;  3RVC A;  2XRI A;  1MA9 B;  4FWR A;  4BGA A;  3KLG A;  5TKY A;  2PZS A;  4CHP A;  1O1W A;  5LMU K;  4LF9 K;  1ASW A;  4AHR A;  4FWM A;  2EHG A;  4FWQ A;  1HMV A;  1YF5 L;  5DM6 L;  4CEC A;  4BR7 A;  1OVY A;  2Z1I A;  2Q0U A;  3H08 A;  5AR0 A;  5E84 A;  1NNE A;  1NOY A;  4CZE A;  2XY5 A;  3DYA A;  1T8E A;  3TTC A;  2QTD A;  1U48 A;  2YNI A;  1ZBS A;  3SJH A;  3WNF A;  2FBV A;  1SKW A;  1BQN A;  5IWA K;  2XY7 A;  2O8E B;  3THX B;  5AZI B;  3I56 N;  1C1C A;  1DKG D;  4PKI A;  2FF3 B;  2YHX A;  1NLV A;  1K8K B;  1QTM A;  3CFP A;  3PX0 A;  2O8D B;  1NKC A;  3ATU A;  5BN9 A;  1DEJ A;  3H6E A;  4OO1 J;  1VSJ A;  2GUP A;  2O8F B;  4LH5 A;  2OTL N;  4RW8 A;  1N32 K;  4Q5V A;  2KFZ A;  4NLB A;  1NK5 A;  2O4G A;  3CD6 N;  2IS3 A;  3HBT A;  4CFA A;  5M1O A;  1VQ7 N;  3PIP L;  3ENO A;  4IFY A;  3DLB A;  2P9N B;  4RTF D;  3TSP A;  3KK1 A;  2CGJ A;  4QOZ B;  3LWL A;  3OJS A;  1XC9 A;  1VQN N;  4OLA A;  3L4I A;  3SQ2 A;  1BIZ A;  1KTQ A;  3VEZ A;  4A62 A;  1KVC A;  4IOX A;  1XNR K;  2BUP A;  4IZ9 A;  2UU9 K;  4B3M K;  2F4V K;  5HRR A;  3CCM N;  1X1P A;  1HYZ A;  1SL1 A;  2P9I A;  3V4I A;  3O8M A;  4DR7 K;  5C12 A;  4WQ5 A;  2CH6 A;  4K8X A;  3QER A;  3O9U A;  4IEI A;  2ZF5 O;  2E6L A;  4BDZ A;  2YNG A;  4IJN A;  4FCY A;  3E01 A;  4KAZ A;  3VER A;  1VQ5 N;  3A5O C;  4F2R A;  2QWR A;  4CJK A;  4PL8 A;  4KTQ A;  1X9W A;  1X3N A;  4CBU A;  2G8I A;  1HNZ K;  2X6S A;  4B1W B;  4JKF A;  4M41 A;  1KCF A;  1Y64 A;  3L3V A;  2QWL A;  3OYE A;  3KZB A;  3V9Z A;  4BRP A;  4JKB A;  3VQB A;  3CER A;  3G6E N;  4FLW A;  4BR4 A;  2HHH K;  4EFH A;  4DSJ A;  3AVM A;  3VQQ A;  3CQX A;  5KPZ A;  4XH5 A;  4DV0 K;  4CJR A;  3KJV A;  3DLH A;  1IJJ A;  1P90 A;  4KHP K;  4KHS A;  4ELU A;  1NJX A;  5SZT A;  3A2F A;  4M3T A;  3BY5 A;  3WXI A;  5I3U A;  2ASO A;  4ISG A;  4BRF A;  4Y1D A;  4FJJ A;  2NRV A;  3F9M A;  4YNQ A;  2E6M A;  1J5E K;  1WLJ A;  1B92 A;  4K8Z A;  5AQQ A;  3H45 C;  3KKR A;  3C6U A;  2GBZ A;  1WSI A;  4BR0 A;  3J81 O;  2YHY A;  1LW0 A;  1TK0 A;  4CZL A;  3SAF A;  1YTU A;  1S6P A;  3OHR A;  3RMA A;  1Q86 O;  4GV3 A;  3ZT1 A;  4H5T A;  4CJ5 A;  3RRG A;  3AA4 A;  3WNH A;  3BGR A;  2GWJ A;  1SS6 A;  2HMP A;  3LP0 A;  3VES A;  4JRP A;  2HHX A;  2HBM A;  1KVA A;  5AFU H;  2WOM A;  3B6O A;  2IIR A;  5BN8 A;  1V4T A;  4PHT X;  1YIT N;  4CBX A;  3E9P A;  3OJU A;  4FOI A;  1TKT A;  1M1K O;  1NM1 A;  5JMV A;  2VWB A;  2JGU A;  4J2A A;  3G25 A;  5AQZ A;  4DFM A;  5FPM A;  3CME N;  1NGA A;  4OVL A;  4DWI A;  3GBT A;  3K0S A;  1BI4 B;  3DM2 A;  3KLF A;  2GWK A;  5LL6 Z;  1MU2 A;  2YJF A;  2GEL A;  1BA1 A;  1VQ8 N;  3T69 A;  1RT1 A;  3P83 D;  3HVT A;  4YFU A;  4JKC A;  3NGY A;  1VSI A;  3NBP A;  5FPN A;  4CES A;  4H0O A;  1GLF O; 
#chains in the Genus database with same CATH homology
 1RT6 A;  3KKS A;  2P1J A;  4CGH A;  3KK2 A;  2I5J A;  4DTJ A;  1BGX T;  2HNZ A;  1ZBI A;  4XIU A;  3KIO A;  3U6F A;  2KFN A;  4BAC A;  3AVJ A;  1BIU A;  2Z1G A;  3HVR A;  2G8W A;  4KHW A;  4CF2 A;  1TGO A;  4CIE A;  3L2U A;  4IKF A;  2XO7 A;  3LAL A;  2XY6 A;  3M8R A;  1UWB A;  1JLC A;  1WAF A;  3AVC A;  3AVI A;  1TVR A;  1WSE A;  4OKJ A;  4CFB A;  2YKM A;  1NOZ A;  4BWJ A;  4Z0U A;  3OYA A;  4CEF A;  5KRS A;  4FLX A;  1RDD A;  3CM5 A;  4FLT A;  1FKO A;  1C1A A;  3DOK A;  1RBT A;  2X6N A;  3IRX A;  3NFA A;  3QIO A;  4O0I A;  3OYD A;  1C0U A;  2XHB A;  3DOL A;  4FLV A;  1RT4 A;  3OS2 A;  5KGX A;  4BWM A;  1TAQ A;  1NK9 A;  3AA5 X;  2IGI A;  2FBT A;  4BDY A;  3F73 A;  3SCX A;  2KTQ A;  3DRP A;  4KPY A;  1XWL A;  1QSS A;  5HP1 A;  3NH2 A;  1VSM A;  3SPZ A;  3ZSO A;  1TKD A;  4B9S A;  3V9U A;  1WSJ A;  4E7L A;  2AJQ A;  3SNN A;  1L3V A;  5HRP A;  3VQC A;  4FJ7 A;  3AA2 A;  4BE0 A;  4JS4 A;  2GV9 A;  3T1A A;  3P5J A;  2HVH A;  1J9A A;  4BE2 A;  2EX3 A;  2OPP A;  3PO4 A;  3ZT3 A;  2OZM A;  5J2N A;  1U04 A;  1IKV A;  2D0B A;  1RCH A;  2D0C A;  3L2R A;  3SV3 A;  2D0A A;  4DFJ A;  3BDP A;  2HVI A;  4DSF A;  3NAE A;  2NUB A;  1BQM A;  3ASM A;  3K5M A;  3OYB A;  3LP2 A;  2P51 A;  4CJL A;  3O3F A;  3SJJ A;  4CJW A;  3NF6 A;  4KKO A;  3KD1 E;  1VSK A;  4E3S A;  3NF9 A;  4CJP A;  3OYF A;  3LPT A;  3DLG A;  1NK6 A;  4NCA A;  4J2B A;  3QEW A;  3MEE A;  1F21 A;  5KTQ A;  3C94 A;  2OA8 A;  3T3F A;  4CGF A;  1IKX A;  4B9V A;  4Z4C A;  2BE2 A;  2ZQB A;  3ISN C;  3KLH A;  5J2Q A;  1D9F A;  1KLM A;  4FJH A;  4I2P A;  1RTI A;  4Y1C A;  4AHC A;  2A1R A;  1ZYQ A;  3QLH A;  4CF0 A;  2HW3 A;  1EP4 A;  4DLE A;  4CEA A;  3VQ4 A;  3CFO A;  3LZI A;  1KVB A;  4RW4 A;  5CZ1 A;  3RMD A;  4FK4 A;  3OYH A;  1RNH A;  3VA0 A;  1R0A A;  4NYN A;  4M3W A;  4FJM A;  1XI1 A;  3KD5 E;  2ZD1 A;  5FRO A;  3F9K A;  4CJV A;  4M3U A;  5DK5 A;  4W5Q A;  3PV8 A;  3MXM A;  3S3M A;  1Z26 A;  3TAN A;  5HRN A;  4NCB A;  3ZSQ A;  1YTA A;  3AVH A;  4DTP A;  1I39 A;  3HK2 A;  1HYS A;  4LSL A;  1CZB A;  3ZSZ A;  1EX4 A;  4CK3 A;  5EU7 A;  1RBU A;  3SV4 A;  4Z4H A;  1LAW A;  4M3Y A;  5FRM A;  1HNV A;  1GOC A;  1RBS A;  4CJ3 A;  1Z25 A;  1S9E A;  1RTH A;  1S1T A;  4CEQ A;  4KHN A;  4FYD A;  3QO9 A;  3V1O A;  1L5U A;  1D9D A;  1VSL A;  1JXB A;  4FLU A;  1W0H A;  1JLG A;  3MXJ A;  4B9N A;  1YT3 A;  5CY4 A;  2P5O A;  3S9H A;  4HCB A;  3DRR A;  4RW7 A;  1QSL A;  4FXD A;  1JLB A;  1TKZ A;  1BCO A;  2DFF A;  4DQR A;  1L3S A;  1YVU A;  1KFD A;  3TAE A;  3IAY A;  3FFI A;  1RBV A;  3K5L A;  4DSE A;  4HUF A;  4CHQ A;  1TKX A;  4N47 A;  3LAM A;  3U3G A;  1LV5 A;  1KRP A;  1EET A;  1UA0 A;  2DFH A;  4NYF A;  3VQA A;  3OYC A;  1LWF A;  4PA1 A;  4J2E A;  3ZT2 A;  1RIL A;  3TAG A;  2PYJ A;  4CF1 A;  4DSL A;  4IG0 A;  3S3O A;  4ID5 A;  3SUQ A;  3L3U A;  3D0P A;  3V9S A;  2B4J A;  1HNI A;  3QIN A;  4CIF A;  4CF8 A;  3SYZ A;  2X74 A;  1UOC A;  1N6Q A;  3ITH A;  1WSG A;  1LWC A;  2GUI A;  5C25 A;  3ULD A;  2VWK A;  2Y1I A;  4RW6 A;  3QEV A;  3MEC A;  3LPU A;  4IG3 A;  5CZ2 A;  1C0T A;  3IS9 A;  5I42 A;  4F4K A;  1J53 A;  1VRU A;  4G1Q A;  4E89 A;  3PO5 A;  1WSF A;  1ZBF A;  1RDB A;  2XY8 A;  4DTM A;  1XHZ A;  4E0D A;  4DQS A;  3G10 A;  3LWM A;  3K5N A;  3M8P A;  3MXI A;  1ASV A;  1T05 A;  4FJK A;  1LAV A;  1VSF A;  4H4M A;  4M3R A;  3PX4 A;  1KLN A;  4AH9 A;  4CFD A;  2QKB A;  3HO1 A;  3L8B A;  3K5O A;  4FLZ A;  3HPG A;  2G8K A;  1FXX A;  2YKN A;  4AIL C;  4B8C A;  3AVB A;  1U45 A;  2QXF A;  3LZJ A;  3KK3 A;  1S9G A;  2ZE2 A;  3M8S A;  1CZ9 A;  4OPJ A;  1T7P A;  2WON A;  1A5V A;  1TL3 A;  1WNS A;  4NCG A;  4OKK A;  4DSK A;  2HHU A;  4HCC A;  4CGD A;  3OS1 A;  3B6P A;  1HQE A;  1S1V A;  2DFE A;  1JXE A;  4AHT A;  3NGZ A;  2HHV A;  3ZSW A;  1HQU A;  1QE1 A;  1WAJ A;  3K2P A;  4R5P A;  1K6Y A;  4Z4F A;  4W5R A;  3OYK A;  1NJY A;  1QS4 A;  4EP5 A;  3NF7 A;  4FJ5 A;  3AV9 A;  4E7H A;  5E41 A;  2QK9 A;  4CEE A;  1IKW A;  4IBN A;  3HL8 A;  4RG8 A;  3RMC A;  1U4B A;  4GW6 A;  3M8Q A;  3I0R A;  1Q8I A;  3RRH A;  2KZM A;  1VSE A;  3AVF A;  4KTW A;  3AVK A;  3U3Y A;  1HRH A;  3P1G A;  4CGJ A;  3V81 A;  4MFB A;  4CK1 A;  2RN2 A;  2FC0 A;  1RT3 A;  3OYM A;  3L2W A;  4FLY A;  2OPR A;  2VG5 A;  4DS4 A;  4DQQ A;  2E4L A;  3DI6 A;  4DFK A;  2QKK A;  1DLO A;  4ELT A;  1EXQ A;  2YNH A;  2IOC A;  1NK7 A;  1VK0 A;  4FM2 A;  2F96 A;  1HPZ A;  2IC3 A;  1IO2 A;  4RW9 A;  3OVN A;  5HBM A;  3O3H A;  3S3N A;  4B3O A;  4C8N A;  1T03 A;  4L8R B;  1LWE A;  1TL1 A;  4IFV A;  4KV8 A;  5JS1 A;  1NK4 A;  4KB1 A;  3V6D A;  4C8L A;  1SV5 A;  1SL0 A;  3LAK A;  2HHQ A;  3V1Q A;  3L2V A;  3DLE A;  3V9W A;  2IDO A;  1A5X A;  1D8Y A;  3CFR A;  4O0J A;  3CYM A;  4DTR A;  1JLF A;  1EKE A;  3HST B;  4CHZ A;  4OPK A;  3VQ6 A;  2Z1H A;  3ZSR A;  4CJF A;  3VQP A;  3EY1 A;  1L3T A;  3OYI A;  3MED A;  1QSY A;  4FVM A;  3NH1 A;  4WE1 A;  3RR8 A;  3HYF A;  4W5O A;  3K59 A;  3ZSV A;  1JLE A;  3TAP A;  2HMI A;  4C8M A;  3AA3 A;  4I7F A;  4CGI A;  3NCI A;  1SL2 A;  1WSH A;  1DTT A;  2YV0 X;  4LH4 A;  4HHT A;  3KTQ A;  4DFP A;  4H8K A;  1Q9Y A;  1RTD A;  3LAN A;  4CJ4 A;  1U47 A;  3RWU A;  5C24 A;  1FK9 A;  1RT7 A;  3VQ9 A;  1TK5 A;  4EZ6 A;  4AHU A;  4CK2 A;  4MQ3 A;  4JLH A;  3I8D A;  2XRI A;  4FJX A;  4N41 A;  3KLG A;  3CG7 A;  3THV A;  2PZS A;  3C95 A;  2B5J A;  4CHP A;  1O1W A;  4HUG A;  4CJS A;  3QEX A;  4DG1 A;  1ASW A;  2D5R A;  3O4N A;  4AHR A;  4F8R A;  2EHG A;  3JSM A;  1SUQ A;  4DU3 A;  3AO1 A;  4CFC A;  4DTU A;  1HMV A;  3AO3 A;  5J2M A;  4CEC A;  1NJZ A;  4OGE A;  4DF4 A;  4FZX C;  4KRF A;  2Z1I A;  3HP6 A;  1U49 A;  3WNE A;  4B9U A;  4KI6 A;  3HT3 A;  4HTU A;  1W9H A;  4DTN A;  4O4G A;  2Y1J A;  3H08 A;  2LSN A;  2ATQ A;  1JL2 A;  2ETJ A;  2W42 A;  4I9L A;  1NK0 A;  5J2P A;  4KO0 A;  1NOY A;  2FBX A;  3UIQ A;  3QEI A;  5CYQ A;  4DS5 A;  4OJR A;  2XY5 A;  1N5Y A;  3DYA A;  1BL3 A;  3JYT A;  1T8E A;  1RT2 A;  1U48 A;  4Z4I A;  1S1X A;  1VRT A;  3ZCM A;  4FJ8 A;  4FJL A;  2YNI A;  4DQP A;  3NE6 A;  3WNF A;  3CM6 A;  2FBV A;  1S1U A;  1SKW A;  3T19 A;  4B8A B;  1BQN A;  4CHO A;  2YHB A;  3V9X A;  4KB0 A;  2XY7 A;  3QNN A;  1G15 A;  2VG7 A;  3O3G A;  1C6V A;  1C1C A;  2Q3S A;  3OS0 A;  1J5O A;  1XHX A;  4OGC A;  4CEB A;  4J2D A;  3KLE A;  3VQ5 A;  1ITG A;  3SUO A;  1B9F A;  2HHW A;  3HXM A;  5C42 A;  3D45 A;  3IG1 A;  3HPO A;  1QTM A;  4CGG A;  4W5T A;  4CJE A;  3CFP A;  3PX0 A;  3SQ1 A;  1NKC A;  1KSP A;  3WNG A;  1VSD A;  4BE1 A;  5HLF A;  3VN5 A;  3ZT0 A;  4E1N A;  1ZBH A;  1VSJ A;  2KZZ A;  2HHS A;  5D3G A;  4M42 A;  1FKP A;  4LH5 A;  5FDL A;  2KQ2 A;  3HPH A;  4O5B A;  4DQI A;  2FBY A;  2DY4 A;  4W5N A;  4RW8 A;  4ID1 A;  1I3A A;  4Q5V A;  2KFZ A;  4KTZ A;  1TV6 A;  4CF9 A;  3QEP A;  4AHS A;  1NK5 A;  2O4G A;  2IS3 A;  3VQ8 A;  3ALY A;  1C1B A;  4N56 A;  1S1W A;  4CED A;  4C8K A;  4CFA A;  4FM1 A;  4ZTF A;  4F2S A;  4IFY A;  5T7B A;  3DLB A;  3NGI A;  4B9T A;  1ZBU A;  1IG9 A;  3TAQ A;  3KK1 A;  3RR7 A;  4QOZ B;  3LWL A;  3OJS A;  4CCH A;  2A1S A;  3RMB A;  3PY8 A;  4I9Q A;  1XC9 A;  2G8V A;  1GOB A;  4FK0 A;  4CER A;  3ZSX A;  1SKR A;  4OLA A;  3SZ2 A;  3V1R A;  5KGW A;  3SUN A;  3OYL A;  4E7K A;  4N5S A;  1BIZ A;  1KTQ A;  3NF8 A;  4KFB A;  4HVJ A;  3SQ2 A;  1KVC A;  4M3Z A;  3MEG A;  3TAF A;  4ZHR A;  1CLQ A;  2IAJ A;  3HM9 A;  4CHN A;  4FJI A;  4M3X A;  3VQD A;  5HRR A;  4E1M A;  4F3T A;  1X1P A;  4FW2 A;  1LW2 A;  2DTU A;  1HYZ A;  2Z1J A;  2ITG A;  3OYG A;  4KHY A;  1SL1 A;  3AVA A;  3PUF A;  4AHV A;  2VG6 A;  3DLR A;  4KHQ A;  3V4I A;  3VA3 A;  2HND A;  3QET A;  3NHG A;  3LDS A;  2HB5 A;  3ZT4 A;  3OY9 A;  4K8X A;  3QIP A;  4TSX A;  3QER A;  3TAB A;  1JKH A;  3C6T A;  1IKY A;  4JS5 A;  1J54 A;  3TR8 A;  1TK8 A;  2F8T A;  2E6L A;  4CJQ A;  4BDZ A;  2YNG A;  4HUE A;  3SPY A;  4FCY A;  3E01 A;  4I2Q A;  1X9M A;  1S6Q A;  4KAZ A;  2G8U A;  4F2R A;  4LY7 A;  4CJK A;  1BIS A;  2O4I A;  4FM0 A;  3AO5 A;  4DTX A;  1X9W A;  4KTQ A;  2G8I A;  1B9D A;  1L3U A;  2X6S A;  1HYV A;  4M41 A;  1KCF A;  3L3V A;  4FZY A;  3CQ8 A;  2RKI A;  3OYE A;  3L2Q A;  3SUP A;  4ELV A;  4FZZ A;  1UAX A;  4LD0 A;  3V9Z A;  3SQ4 A;  5K14 A;  2YNF A;  4IDK A;  3VQB A;  2KW4 A;  4Z4E A;  3MAQ A;  3TAR A;  2OPQ A;  1QHT A;  5CYM A;  4FLW A;  4DU4 A;  4CJU A;  4E19 A;  3K58 A;  4B9L A;  2OPS A;  4FJ9 A;  3KLI A;  3O4Q A;  3AVM A;  3VQQ A;  3ZSY A;  3AO2 A;  5HRO A;  1GOA A;  4DSJ A;  1RBR A;  4CEZ A;  4DLG A;  4DTS A;  2RF2 A;  4CJR A;  3EZ5 A;  4BDP A;  3KJV A;  3DLH A;  4QAG A;  3QNO A;  1NKB A;  1BI4 A;  1JLA A;  1DTQ A;  4KHS A;  4ELU A;  1ZBL A;  4DSI A;  3HJF A;  1KFS A;  1NJX A;  4EZ9 A;  5SZT A;  3A2F A;  4M3T A;  4CIG A;  5I3U A;  4F3O A;  3AVG A;  4GVM A;  2F8S A;  4Y1D A;  4FJJ A;  1Y97 A;  1BHL A;  3HP9 A;  2R7Y A;  3TAM A;  4YNQ A;  2E6M A;  2BGG A;  1TAU A;  4B9M A;  4DU1 A;  3OYJ A;  5KRT A;  1WLJ A;  2HHT A;  5HRS A;  1S5J A;  3G0Z A;  1B92 A;  1RDA A;  4KHU A;  1REV A;  1WN7 A;  4K8Z A;  4DTO A;  4FK2 A;  2B6A A;  2PYL A;  1NK8 A;  3KKR A;  3C6U A;  2GBZ A;  1SKS A;  1WSI A;  3DLK A;  1D5A A;  5SWM A;  1LW0 A;  2BDP A;  1TK0 A;  3NH0 A;  5FRN A;  2OZS A;  4FJG A;  2JLE A;  1YTU A;  1S6P A;  2BAN A;  3RMA A;  4FJN A;  4O44 A;  3ZT1 A;  4CJ5 A;  3VQ7 A;  3RRG A;  5JS2 A;  3AA4 A;  3WNH A;  2YHA A;  3BGR A;  4LSN A;  3AVL A;  1C0M A;  3QES A;  4DF8 A;  3LP1 A;  4QCL A;  4FW1 A;  1JL1 A;  5DMR A;  4CE9 A;  1RDC A;  3LP0 A;  4PQU A;  2VWJ A;  4KRE A;  4JRP A;  4H4O A;  3PX6 A;  2HHX A;  4PUO A;  3SI6 A;  1KVA A;  2WOM A;  3B6O A;  3RTV A;  4E7I A;  2PY5 A;  1Q9X A;  1JLQ A;  1ASU A;  5J1E A;  3EYZ A;  4PY5 A;  4C8O A;  3NDK A;  3LP3 A;  3OJU A;  3TWH A;  5KI6 A;  1RT5 A;  1VSH A;  1TKT A;  2RPI A;  3DMJ A;  3DRS A;  2OYQ A;  4Z4G A;  4JRQ A;  3SQ0 A;  4ZTJ A;  1HJR A;  2X78 A;  2JGU A;  1NKE A;  4J2A A;  4O55 A;  1QQC A;  1NJW A;  3AVN A;  3VQE A;  4E7J A;  4DFM A;  4CJT A;  1CXU A;  1X9S A;  4OVL A;  4CHY A;  4DWI A;  4Q0B A;  4ICL A;  3I0S A;  4GMJ B;  2G8H A;  1BI4 B;  1BCM A;  3DM2 A;  3KLF A;  4KI4 A;  1A5W A;  1RTJ A;  2P5G A;  1MU2 A;  4UQG A;  4CEO A;  4N76 A;  4PWD A;  4OKE A;  1IH7 A;  2G8F A;  3K57 A;  1RT1 A;  3P83 D;  3HVT A;  4YFU A;  3TI0 A;  2HNY A;  3NGY A;  1VSI A;  3AO4 A;  4M45 A;  1CXQ A;  3NBP A;  4B08 A;  4CES A;  4DMN A;  1UA1 A;  4OLB A;  3OYN A;  4EP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...