2FBYA

Wrn exonuclease, eu complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
196
structure length
196
Chain Sequence
b'HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbyA00
3OYDA 4CCHA 3ULDA 4DTNA 1NKBA 4LY7A 1SL1A 3HT3A 2G8KA 1B9FA 4ZHRA 3K5LA 3TAGA 1IO2A 3SQ1A 4N41A 3DOLA 1ZBHA 4O0IA 3OYBA 4F3OA 2QKBA 2WOMA 4QOZB 4KTWA 4MQ3A 1BQNA 4B9NA 1NJZA 2PY5A 4N47A 4F8RA 3V6DA 3K2PA 4M3ZA 1S9EA 1HQEA 2E6LA 4RW7A 1VSHA 5T7BA 3V9XA 2HB5A 3HPOA 1U49A 4CEZA 4CFCA 1A5WA 2A1SA 3NE6A 4I9LA 2YHAA 3AV9A 3E01A 3MXJA 4DFKA 1KCFA 1W0HA 4MFBA 3ZSOA 1DTQA 4AHTA 1TKZA 3QINA 3JYTA 4OKJA 3TI0A 4CHYA 3OYMA 2P5GA 3NGIA 2G8VA 5DMRA 3TAPA 3FFIA 4NYFA 3EY1A 2OZMA 1D5AA 4CGGA 4CHZA 4CEAA 3SYZA 5C42A 1R0AA 2G8HA 1RCHA 3AVFA 3VQ9A 2BE2A 3OS1A 1VSDA 1NK6A 2Q3SA 4HHTA 2YNGA 4FCYA 1U48A 4E7IA 2XRIA 4DSEA 3EZ5A 1ASVA 2D5RA 3PX0A 1RILA 3ZSXA 2G8WA 4ID5A 4J2EA 1S1TA 4B9SA 4B08A 5DK5A 4ICLA 3ZSRA 4CF1A 1NK4A 3OYEA 3VQCA 2Z1IA 3TAMA 4CJVA 3LAMA 3T3FA 3CM5A 3ZCMA 3V1RA 4RW4A 3SQ2A 3NF6A 3HP9A 1SKWA 3IAYA 3SQ4A 4NCAA 2OZSA 3VQ7A 3AVBA 4FJNA 4HCBA 3V4IA 1ZYQA 4B8AB 3SNNA 4E1NA 5J1EA 1NK5A 1GOBA 4B9UA 2VWJA 1RTDA 4C8LA 3MEDA 4CJQA 2B4JA 3KK2A 3L2VA 3WNHA 3ZSZA 4HTUA 4CEEA 2GV9A 2GBZA 3IRXA 1GOAA 1D9DA 4CJ4A 3NGZA 4CJ3A 1S1UA 5I42A 3KD1E 4Q0BA 1A5VA 1REVA 1UAXA 3NH2A 4KHUA 2HW3A 2HHVA 1NJWA 5K14A 4FJKA 2HNYA 4CGJA 1XC9A 4AHRA 4CHOA 4CJLA 3CFOA 4O55A 4Z4CA 4B9LA 4H4MA 4IFYA 4PUOA 3DLKA 4PA1A 5FRNA 1YVUA 4OGEA 1EP4A 1S9GA 2YHBA 4FK0A 4E19A 3OYJA 3AA2A 3VQDA 4KRFA 2O4IA 2FBYA 2KW4A 3L2QA 1CXQA 1UOCA 1VSFA 4O5BA 3L2WA 4E7JA 3QEIA 4PY5A 1C0UA 3B6PA 1XHZA 3DYAA 4O0JA 4CIEA 4HCCA 2YNHA 4CJPA 3QNOA 4I2PA 3SV4A 4LH4A 4DLGA 2IC3A 3OYKA 3V1QA 4W5QA 1TK8A 4DSJA 3ZSYA 4CFAA 3MAQA 4M3WA 4CFBA 4K8ZA 3O4QA 4ID1A 1W9HA 3MXIA 5JS2A 3OYHA 3NF8A 3AA4A 4FJJA 4FZXC 4WE1A 2KZMA 3MXMA 3THVA 1C1BA 3C6TA 4AHVA 4DFMA 1N6QA 1J5OA 5J2QA 4OJRA 3NF7A 1ZBLA 4FJLA 4R5PA 3ZT3A 4DTPA 4QAGA 3OYLA 4FJGA 2OA8A 2BANA 4AHCA 5CY4A 2KQ2A 4CIGA 3MEEA 4OKKA 5EU7A 1CZBA 3BDPA 3HL8A 5C24A 2R7YA 1T8EA 3LP0A 2NUBA 3VQ5A 1BCMA 3QO9A 3KK1A 3M8SA 4F2RA 4FM1A 3OYAA 4IBNA 3NF9A 1C1CA 3HP6A 4E7KA 1DLOA 4RW8A 1TK0A 1WSJA 4LSLA 3DOKA 4DFPA 4DS4A 4KREA 1YTAA 1S1WA 2IS3A 2X78A 3KJVA 3L3VA 5CYQA 1HQUA 1Z26A 4EZ6A 3AA5X 3VQ6A 1JXBA 1RBUA 3RRHA 3QESA 3AO2A 3V9ZA 1JL1A 3ZT1A 2JGUA 1F21A 3VQ8A 3QLHA 1NOYA 2KZZA 4CK1A 1QSYA 3O3FA 2I5JA 1S1VA 4JS5A 4CK3A 3VN5A 3RRGA 1BQMA 4Q5VA 3HYFA 2G8IA 3V81A 4B8CA 2JLEA 3C95A 3MECA 3AVLA 1J53A 1VSMA 3DLRA 3K57A 2Z1GA 3M8QA 5KGXA 1JLCA 3CFPA 2DFFA 2ZQBA 1WSIA 3KLHA 4TSXA 1IH7A 2Y1IA 3TAEA 1XHXA 1TKDA 3WNGA 4C8OA 3LANA 3TABA 1L3VA 4FLYA 3LWMA 3AA3A 1U04A 1S6QA 1LV5A 3HSTB 3ZT2A 1KRPA 4CEOA 3SJJA 5KRSA 4BDZA 1C6VA 1QE1A 2HNDA 1BIUA 4KHYA 3QERA 2QKKA 2AJQA 4FZYA 1BIZA 1XWLA 4CESA 4J2DA 4Y1CA 4FYDA 2RPIA 4CF8A 1RT6A 1I3AA 4KB1A 5CZ2A 4DU3A 4H4OA 4DTJA 2OPSA 3D0PA 1MU2A 3AVKA 2P5OA 3VA0A 4F4KA 1LWEA 1VSLA 3DLEA 1UWBA 4NYNA 2XO7A 4DTUA 2XY6A 3KLIA 3SUOA 3O3GA 4CIFA 3H08A 3S3NA 2OPRA 1J54A 1L3TA 4K8XA 3HJFA 4IFVA 3SQ0A 2QK9A 3RMDA 1SL0A 1RT7A 1RNHA 4OPKA 3BGRA 2P1JA 1JLBA 1I39A 4BE2A 3RR7A 3VQPA 2PZSA 1QS4A 3V9UA 1JLAA 3IS9A 1JXEA 3NFAA 1SKRA 4CHNA 4FLWA 1HNVA 3DRPA 3KK3A 4KTZA 3LPUA 2HHUA 3HPGA 4CHPA 4CHQA 1VSIA 4CJ5A 4BDYA 4KAZA 4UQGA 1ZBFA 2YKNA 1RBVA 1WN7A 2E6MA 4LSNA 3OS0A 4JLHA 4YNQA 1LWFA 4FJ5A 1J9AA 1LAWA 1RDBA 5KI6A 4FJMA 3RMAA 4OLBA 1ITGA 3L3UA 4I7FA 1IG9A 2HVHA 1N5YA 1L5UA 2XY7A 4FJHA 3DRSA 4G1QA 4DF8A 3OY9A 1RT1A 2IDOA 4B9VA 1HYZA 2HHSA 1WAFA 4CGFA 2LSNA 1KFSA 4O44A 1WSFA 3K5MA 4C8NA 4FLUA 1S5JA 4ELTA 4M42A 3QEPA 2FC0A 3CG7A 3HM9A 4KV8A 1XI1A 2D0AA 5KRTA 4FM0A 2PYJA 2F8TA 4CJWA 4CEQA 1B9DA 2FBXA 3KTQA 3V9WA 3LZIA 4C8MA 1HPZA 4ZTJA 4IG0A 4AHUA 1HJRA 4E1MA 1Q8IA 4CF9A 4LD0A 1RT4A 3ASMA 3KIOA 1FK9A 4E7HA 4NCBA 1SL2A 4DLEA 4FM2A 4OKEA 4I2QA 4CE9A 4DTMA 4B9TA 1S1XA 3SCXA 4EZ9A 1TL3A 4CJSA 2A1RA 2GUIA 2D0CA 1D9FA 1YT3A 2YV0X 4C8KA 4DMNA 3ZT4A 3ALYA 5HLFA 5J2PA 2RN2A 2ITGA 3S3OA 1KSPA 4B9MA 3KKRA 4FLXA 4AILC 2G8UA 1BI4A 4E3SA 4KPYA 3NBPA 2DFHA 3AO5A 5E41A 4KHWA 1RBSA 1S6PA 2YKMA 3JSMA 3NHGA 3QEWA 2XY5A 4Z4FA 3AVNA 4RW6A 1TAUA 1G15A 3NGYA 1UA0A 2Z1JA 4W5OA 4J2BA 3IG1A 4FLTA 3RR8A 1NKCA 2O4GA 3QEXA 3K59A 5HRPA 4DU4A 3LP2A 3PO4A 5HRSA 4Y1DA 1KVAA 3O3HA 1KFDA 4HUGA 4N5SA 1X9SA 2RKIA 4CFDA 1SUQA 4BACA 1NK7A 2EHGA 1NK9A 2BDPA 3QEVA 3LP1A 3V9SA 1ASUA 3NH1A 3LWLA 1U45A 3LALA 1BI4B 3VQQA 3OYNA 1X1PA 3F73A 3HO1A 3RMBA 2Y1JA 1EETA 2X74A 3QIOA 3MEGA 1TAQA 1K6YA 4FJ7A 4CK2A 3PV8A 1RT3A 3WNFA 3OYFA 1IKXA 4M45A 4DG1A 3WNEA 4CEFA 2XHBA 3AVMA 5SZTA 4CF0A 4GMJB 4CGIA 2ETJA 5KGWA 4DTSA 4AH9A 5HP1A 2OYQA 1LW2A 4KHSA 3NCIA 3NAEA 3TAFA 1NKEA 1X9MA 1VSJA 4CECA 1T7PA 3QETA 4KI6A 2VG5A 3A2FA 3U3GA 4YFUA 3K5NA 3AVIA 4Z4GA 2D0BA 1FXXA 3OVNA 2KFNA 1HYVA 4CGHA 4B3OA 3QIPA 4W5TA 1FKOA 1TKTA 4DSKA 1HYSA 2XY8A 1LW0A 3I8DA 3U6FA 4F2SA 4DTOA 1VSKA 3AVHA 3LPTA 3KD5E 1WSHA 4DQPA 1A5XA 3AVGA 4DWIA 3CFRA 2KTQA 4DF4A 2F96A 4KI4A 4FJ9A 4FXDA 3RTVA 1T03A 2HVIA 3SV3A 4FJIA 1QSLA 1BISA 1TGOA 2EX3A 1RDAA 3P83D 4CEDA 4ZTFA 3HXMA 2WONA 2HHWA 3KKSA 3CQ8A 4M3TA 5CYMA 4OVLA 4HVJA 1WSGA 4CJRA 3VQAA 1NOZA 1Z25A 4BWMA 4DS5A 3OS2A 2W42A 3DLBA 3HK2A 1TK5A 1JKHA 1RTHA 3KLGA 4L8RB 1EXQA 3DM2A 4J2AA 1CLQA 1GOCA 1QQCA 4QCLA 1D8YA 2IAJA 1C0MA 3AO1A 3O4NA 4O4GA 4W5RA 5SWMA 5FDLA 3LZJA 1WAJA 4F3TA 4DU1A 1CXUA 3DMJA 2P51A 1C1AA 1IKYA 4M3RA 5FRMA 5D3GA 1EX4A 3U3YA 3SZ2A 1Q9XA 3LDSA 1WLJA 3HVTA 4FLZA 4CEBA 3DI6A 5JS1A 5CZ1A 4E89A 4W5NA 3VQBA 3P1GA 1VRUA 4I9QA 1O1WA 3L2RA 3SPZA 1VK0A 1Y97A 2RF2A 3TAQA 4FK4A 3NDKA 5KTQA 1IKWA 3LAKA 4DSFA 3ZT0A 1NJXA 3AO4A 4E0DA 5HBMA 1VRTA 3OYIA 3OYGA 4HUFA 4DTRA 4PWDA 1T05A 1RTIA 1BL3A 4IDKA 4Z0UA 4CERA 3K58A 4BE1A 3AVCA 2HMIA 4FK2A 4M3XA 2IGIA 2F8SA 1RDDA 5HRRA 4JRPA 3TARA 2HNZA 4FVMA 3K5OA 4N56A 4IKFA 1BGXT 3HPHA 3AO3A 3L8BA 3VA3A 4Z4EA 2OPQA 1BHLA 2VWKA 4Z4IA 2DY4A 2ZE2A 3AVAA 1QTMA 3SUNA 1HMVA 1TKXA 3SI6A 1JLEA 3SUQA 2FBVA 4CF2A 4BDPA 3NH0A 1L3UA 1FKPA 1SV5A 1JLFA 4OLAA 1KTQA 4N76A 5HRNA 4DSIA 1U4BA 4DQQA 1TV6A 4FLVA 4LH5A 3D45A 4M3YA 4GVMA 2FBTA 4DSLA 4OPJA 1KLMA 3T19A 3HVRA 1IKVA 4FW2A 3T1AA 4DQRA 1C0TA 4FJXA 3TANA 3S9HA 2B5JA 3CYMA 4IG3A 4OGCA 5J2NA 4ELUA 1ASWA 4NCGA 1JLQA 1RT2A 2Z1HA 1U47A 1QSSA 3DLHA 1EKEA 2ATQA 2QXFA 2B6AA 4KO0A 3PY8A 4GW6A 3L2UA 5J2MA 3G10A 2YNIA 3EYZA 3UIQA 1RTJA 4XIUA 4EP5A 4JRQA 1KLNA 3PX6A 4EP4A 3QNNA 3PX4A 1RT5A 4CJTA 3PO5A 3G0ZA 4KHQA 3P5JA 1TL1A 4M41A 3VQEA 3OJUA 3ZSQA 1VSEA 2VG7A 3OJSA 4CJFA 3S3MA 1YTUA 4KB0A 4RW9A 4FJ8A 4DTXA 1RBRA 4KFBA 1SKSA 3PUFA 3VQ4A 4BE0A 4BWJA 2OPPA 3SPYA 1X9WA 1L3SA 3ISNC 3KLEA 1DTTA 3DLGA 4E7LA 2HHTA 1BCOA 1WNSA 2E4LA 4RG8A 1Q9YA 4ELVA 3CM6A 3F9KA 1QHTA 2YNFA 2ZD1A 5FROA 4CJEA 2KFZA 2G8FA 4KKOA 3C94A 4AHSA 1LAVA 4H8KA 3ZSVA 2PYLA 5HROA 1UA1A 4M3UA 1HNIA 1JLGA 2VG6A 4CJUA 1NK8A 4DQSA 3LP3A 4Z4HA 3RMCA 2X6SA 5C25A 4PQUA 3ZSWA 1RBTA 4DQIA 3B6OA 4KHNA 2BGGA 3I0RA 1NK0A 1RDCA 1CZ9A 3C6UA 1B92A 1JL2A 4FW1A 4CJKA 3RWUA 3M8PA 1KVCA 1ZBIA 1HRHA 1WSEA 4JS4A 3M8RA 3ITHA 3V1OA 1ZBUA 3OYCA 4DFJA 3SUPA 3KLFA 4KTQA 4HUEA 3DRRA 3TWHA 4FZZA 1LWCA 1NJYA 3AVJA 3I0SA 3TR8A 2DTUA 2HHQA 2X6NA 1KVBA 5I3UA 2HHXA 2IOCA 2DFEA 4CGDA 1TVRA
chains in the Genus database with same CATH superfamily
4CZKA 3H6EA 4CZIA 4ZHRA 4K25A 3TAGA 1IO2A 4QOZB 1ZBHA 1NM1A 5LY3A 2FXUA 4RCHA 5B8HA 2P9PB 4N47A 1NJZA 4B3RK 1MA9B 3HPOA 4CZHA 1KAZA 4I9LA 4IEEA 1SQKA 3KZBA 1DTQA 4WF9L 5M1QA 3TI0A 2A6AA 3UKRB 2P5GA 2QWPA 4NYFA 2HF4A 1BA1A 2YJFA 1D5AA 4CHZA 3A5MC 4CEAA 1HKGA 1R0AA 1RCHA 3VQ9A 5AFUH 2BE2A 3DWLA 1VQ4N 3QDKA 4BRNA 2XRIA 1TUYA 2UUCK 2DPNA 5DM6L 4ICLA 1Z05A 4CF1A 3OYEA 3VQCA 4EFHA 3HTVA 3MCPA 4H5VA 3T3FA 3O9UA 3V1RA 4RW4A 1SS6A 4HCBA 1DGKN 3UKUB 2ZGZA 3FZLA 5J1EA 1NK5A 4DR7K 2QXLA 1RTDA 3MEDA 2B4JA 4HTUA 2GV9A 4PKHA 4EHUA 3NGZA 4CJ3A 1VHXA 5I42A 4Q0BA 2UUBK 1NMDA 3VEOA 4JKBA 1NJWA 4O55A 3WEEA 4H4MA 4NXNK 4JKGB 1S9GA 4E19A 3OYJA 5AQYA 2CH5A 3AA2A 4YDUC 3L2QA 1YITN 1CXQA 3L2WA 3QEIA 1C0UA 3BUZB 4B1ZA 4HCCA 4A59A 3QNOA 3SV4A 4LH4A 4FWKA 3OYKA 3ZSYA 4CFAA 3ULEB 4GKKK 4K8ZA 2OCEA 3MXIA 1K8KA 3U9DA 4FJJA 3MXMA 3CQXA 1J5OA 2NRVA 1ZBLA 4FJLA 1M90O 3U9ZA 3OYLA 4FJGA 3BF1A 4WQ4A 4K41A 4OX9K 2KQ2A 4IWVA 3MEEA 1CZBA 2P9PA 4A61A 3QO9A 4X62K 1YI2N 3OYAA 4IBNA 3HP6A 4RW8A 4DFPA 4DS4A 4B1YB 3KJVA 3DXKB 3L3VA 3TSQA 1KXPA 3AA5X 4R79A 2O8FB 3EO3A 3ZT1A 3VQ8A 1NOYA 3UKRA 3CCLN 1GLDG 3WXLA 4U67L 5IT9O 1YHQN 2JLEA 5FPMA 4YORA 1Y64A 1JLCA 4WQ5A 4CBXA 2QEXN 1D4XA 1IH7A 4BR5A 4C8OA 4LF6K 3LWMA 3CERA 3WXJA 3HSTB 4NLBA 1NNEA 2FSJA 4CEOA 3WQUA 4LC9B 4KHYA 2QKKA 2ASOA 3UKUA 3BZKA 2OPSA 1MU2A 3L6QA 2VQEK 4F4KA 4JK7A 4DTUA 4BRPA 3HOTA 1CZAN 3SBTA 3SAHA 3HJFA 1J54A 4K8XA 2Q0UA 4A57A 1NGGA 1RNHA 4JK8A 3VQPA 3V9UA 3IS9A 1JXEA 4FLWA 3VPZA 3CCVN 4KTZA 2YHYA 1VSIA 4CJ5A 2NRZA 4UQGA 1ZBFA 4CW7B 4LSNA 2E6MA 3OS0A 5KI6A 3RMAA 4I7FA 2GWJA 3VEYA 4CZGA 4G1QA 4DF8A 4B9VA 2IDOA 2AP1A 2LSNA 3WUHA 4O44A 4ELTA 4C8NA 3SK3A 3QEPA 4MO5A 2JWKA 3CG7A 4PY5A 1XI1A 4NB4A 4CJWA 3ZX3A 3KTQA 2PAVA 5EY4A 5FPDA 4C8MA 4ZTJA 1HJRA 1E3MA 4LD0A 4KH6A 1JCEA 4EHTA 4EZ9A 3HZ6A 2YV0X 2KHOA 4C8KA 4DMNA 3ZT4A 1YJ9N 2ZGYA 1KSPA 3S3OA 4NLCA 4FLXA 4FWOA 2XY5A 1TAUA 3LDOA 4G9ZA 4RW6A 1NGHA 3T1YK 4J2BA 3IG1A 3P38A 2CGLA 5KPZA 3QEXA 3CXCM 2P9LB 5HRPA 3PO4A 1W7AA 5HRSA 1KVAA 1KFDA 4ISEA 4N5SA 4B3MK 1QHAA 1SUQA 2E2QA 4X64K 4RTFD 1HKBA 1OH7A 4HTLA 3NH1A 3HO1A 1BI4B 3F73A 4BRDA 1EETA 3MEGA 3E66A 4CK2A 2D0OA 1RT3A 3BF3A 3O8MA 4M45A 4WFAL 1E4FT 5SZTA 4DTSA 4KHSA 4AH9A 2GTDA 1VSJA 4A2BA 1T7PA 3E9OA 4DCHA 3H46O 1C0FA 1QQMA 3DJCA 3QIPA 4V19S 4H5WA 4DSKA 2P9UA 1JJ2M 3ZEUB 2E20A 4ILGB 5HL7L 4DQPA 3AVGA 3B8AX 4MLEA 4E1JA 4FXDA 1J6ZA 5AQJA 1TGOA 1RDAA 3BP8A 2HHWA 4DHYA 4M3TA 3Q7BA 2YX6A 4O8KA 3FZHA 2W42A 1TK5A 5AQFA 3THXA 1JKHA 4YDUA 4L8RB 1QQCA 2IAJA 1C0MA 2YCHA 1YJWN 3CC2N 3O4NA 1YIJN 4M7XA 5FDLA 4DKWA 3LZJA 4CZFA 3DMJA 2P51A 1C1AA 5FRMA 1EX4A 4JKAA 2O8BB 1WLJA 4NXMK 2WTUA 5CZ1A 4E89A 4W5NA 4DR4K 2ASMA 1O1WA 3L2RA 3SPZA 4LF8K 2D1KA 5EX5A 3CC7N 2E2NA 1ILYA 5KTQA 4DSFA 3G6EN 3AO4A 3GL1A 1VRTA 3OYGA 5GADP 4FZXC 1BL3A 4M3XA 2HMIA 4LF9K 2F8SA 4JD2B 4JAXA 2F7TA 4N56A 3ID8A 4PL7A 3HPHA 1BHLA 1NGBA 3AVAA 1N34K 3SUNA 2P9LA 4CVNE 4BDPA 1NGEA 1BA0A 3TPQA 1SV5A 4QS9A 5BPNA 5HRNA 4DSIA 1TV6A 4FLVA 3CJ9A 5I9EB 4DSLA 3HVRA 4DQRA 4FJXA 3TANA 2B5JA 3CYMA 2KLAA 3R8EA 4OGCA 1KC8O 1QVFM 2NRRA 4IXCA 2A41A 3K0SA 2ATQA 4KO0A 2E2OA 2YNIA 3EYZA 3E9PA 3CMEN 3D2EB 4EP4A 1RT5A 2E1ZA 3VGLA 3P5JA 2ZWHA 2VYPA 4M41A 3ZSQA 1VSEA 2QWNA 1HJOA 1OKJA 4KH5A 4DTXA 3WXMB 4BE0A 4BWJA 1X9WA 3ZEUA 1EO1A 1DTTA 3E1YA 1WNSA 4FSVA 4RG8A 1DT9A 1RDWX 5FROA 4CJEA 5KPRA 3ZSVA 4C23A 1UA1A 1JLGA 2VG6A 4CJUA 1NK8A 3P4IA 3RMCA 2X6SA 5JLFA 4DQIA 2BGGA 3I0RA 1NK0A 2W41A 1V4SA 1ZBIA 4JS4A 1ZBUA 4DFJA 3SUPA 2O8EB 3KLFA 3GOIA 4HUEA 3T7ZA 3EEQA 2DTUA 3AVJA 3TR8A 5AZJB 5I3UA 3ULDA 1SL1A 3NVKA 3HT3A 1B9FA 3K5LA 2E2PA 3OYBA 3O6WA 1BQNA 3LM2A 2PY5A 3W3DA 2P9NB 3K2PA 3O9RA 5GAHP 1HQEA 2E6LA 5T7BA 1U49A 3VOVA 4CEZA 3AV9A 3CJBA 1RFQA 1W0HA 3EE8A 1TKZA 3QINA 4JI1K 4AM7A 2ASPA 3NGIA 2G8VA 2F9TA 3EY1A 2OZMA 4B9QA 4MDBA 1QQOA 2HF3A 3H45C 2G8HA 3MN6A 3FZMA 3PIPL 2HBLA 1I94K 4DSEA 4FO0A 5AQVA 3EZ5A 1ASVA 2D5RA 2QWQA 1OH8A 5AQOA 3J80O 1S1TA 5KPTA 5DK5A 2QI2A 3FLCO 3PSIA 3LAMA 4H0TB 3SAGA 3CM5A 3ZCMA 4BC5A 1U2VA 3HP9A 4AF1A 5GAGP 3IAYA 4NCAA 3DLLL 3VTIA 5JMVA 3VMFB 1WOQA 3S41A 3M1FA 3SNNA 4E1NA 1IBMK 4C8LA 4WQ5C 4XH1A 2VWJA 3KK2A 3PSFA 4JKDA 3ZSZA 4CEEA 2V7ZA 3IRXA 3CIPA 1GOAA 2BTFA 1D9DA 2HW3A 1A5VA 4FPBA 4JI3K 4FJKA 3C7NB 3ZETA 5CHIA 2HVIA 1VQLN 3CFOA 4PUOA 3VGMA 1YVUA 5A2QO 2CGJA 1VQ5N 1EP4A 2YHBA 4FK0A 4JN4A 3VQDA 4KRFA 5LJVA 2O4IA 2FBYA 2KW4A 1VSFA 1WUAA 2HBKA 5EOYA 3B6PA 1XHZA 3DYAA 4BROA 4JI8K 3VF2A 4CJPA 4DLGA 5IWAK 3V1QA 4DSJA 3VGKA 1ZXOA 5F1XA 4ID1A 2FSNA 2O8EA 3N4PA 3OYHA 3NF8A 4WE1A 3ATVA 4DFMA 1N6QA 3CCUN 4B3TK 4WYBA 1GLJO 4BRKA 4DTPA 1SAZA 4QAGA 2BANA 5BPMA 3UE5A 4BGAA 5AQQA 4J8FA 1HNXK 3LP0A 2NUBA 2P9NA 3NF9A 1YUWA 2YHWA 5BN8A 1TK0A 5M1FA 1YAGA 3SBGA 4BC3A 1HQUA 4GV3A 1XUPO 4DUYK 1JL1A 4BRGA 2JGUA 1F21A 1R59O 3QLHA 2QA4N 4DV3K 4CK1A 2UUAK 1S1VA 4JS5A 3SMSA 3RRGA 1BQMA 3HYFA 4B8CA 3AVLA 5C10A 1J53A 3M3ZA 4BRLA 2Z1GA 5AJ3K 2DFFA 2ZQBA 3KLHA 3ZYYX 2Y1IA 2Q97A 4K43A 3K9JA 3A0IX 3LANA 4FLYA 1LV5A 4GVEA 1JCGA 1C6VA 2HBMA 1BIZA 1XWLA 1S3XA 3H1QA 3OW2M 1I3AA 3EZWA 4KB1A 5CZ2A 2V7YA 5JICA 4DTJA 3N4QA 3AVKA 4U7BA 3VA0A 3RVCA 4NYNA 1H1VA 3KLIA 4CIFA 3A8YA 3S3NA 2OPRA 3MDQA 3A5OC 4OPKA 4BE2A 1I39A 2I7PA 1U6ZA 2PZSA 3C7NA 4CHNA 4CZJA 1EWRA 3TSPA 5E84A 3LPUA 2HHUA 3HPGA 4FL9A 4CHPA 4CHQA 5C2DA 2YKNA 5CR4A 1RBVA 4JLHA 4YNQA 1YXQA 3VEXA 1RDUA 4FJ5A 4LF5K 1J9AA 1RDBA 2P9KA 1K8AO 4FWNA 3R3LA 3L3UA 2HVHA 4FJHA 1L5UA 3WT0A 3DRSA 4BR4A 1RT1A 4EIAA 4AQYK 1XQSC 3SAFA 3EKSA 4KV8A 2NRHA 5KRTA 4FM0A 2F8TA 4GY2B 1B9DA 3I56N 4YOXA 2QWLA 5ADXA 2F4VK 1Q8IA 4ILJA 4CF9A 3ASMA 4B3SK 3KIOA 1FK9A 4NCBA 1SL2A 4DLEA 4FM2A 3LDPA 1NGJA 1S1XA 2CH6A 3SCXA 5FLXO 1TL3A 3HI0A 2P9IB 2GUIA 4CJSA 5DM7L 1OH6A 4JK9A 4AILC 1DEJA 1LCUA 1T6CA 3NBPA 2DFHA 3AO5A 5E41A 4KHWA 3KWIA 3QEWA 3ENBA 4BRAA 3CQYA 4CZEA 4JKEA 2O4GA 3THYA 3K59A 1VQ7N 3O3HA 3TU5A 3H3NO 4BACA 1T44A 2EHGA 2UU9K 1YF5L 3V9SA 4XH5A 3LWLA 2KZZA 1X1PA 2Y1JA 4PKIA 1XNRK 1OVQA 4FJ7A 5AQUA 3OYFA 3CPEA 2VQFK 1IKXA 2XHBA 3T1HK 1V4TA 4GMJB 5HP1A 5KGWA 5C2FA 2OYQA 3NCIA 3NAEA 3TAFA 3CCMN 1NKEA 1X9MA 1IV0A 3QETA 4KI6A 2VG5A 3K5NA 4FWPA 4AM6A 4CGHA 4W5TA 1TKTA 1HYSA 4JI0K 1VSKA 3AVHA 1WSHA 3CFRA 2KTQA 4BRFA 2F96A 4KI4A 1Q82O 1NBWA 3RTVA 1T03A 4JI5K 4FJIA 2EX3A 4CEDA 4ZTFA 3IFRA 3C0BA 3HXMA 2A42A 4JYAK 4OVLA 1ATRA 4CJRA 3I8BA 4O5FA 3VQAA 4BWMA 3OS2A 3FGUA 5KQ8A 2P9UB 5BRDA 1CLQA 3DM2A 4A5BA 4O4GA 5SWMA 5F2RA 4DV5K 3G25A 5JVHL 3NMUA 3HVTA 5JS1A 4IO9L 3VQBA 5FPNA 1NJIO 1VK0A 2P9IA 2QTDA 4LFCK 3WXKA 2RF2A 1J5EK 3THXB 3NDKA 1NJXA 4DTRA 4PWDA 4CERA 2CGKA 4IDKA 5AQXA 4BE1A 3AVCA 4JRPA 2HNZA 4FVMA 5M1PA 1LOTB 2I7NA 3L8BA 4Z4EA 1YJNN 2VWKA 3AARA 4A2AA 1HMVA 2NRXA 1WBBA 4CF2A 5C12A 1JLFA 3PIOL 4LH5A 3ZX2A 4Z94A 4OPAA 4JI7K 4JI6K 3T19A 2VGNA 1IKVA 3VESA 5AQKA 1MDUB 2Z1HA 2E8AA 1U47A 1EKEA 4GW6A 4H0YB 3UIQA 1RTJA 3PX6A 1MWKA 3PX4A 1XMOK 4CJTA 5F0XA 3G0ZA 4WCEL 5M1KA 1TL1A 3WXIA 1P8ZA 3CC4N 2VG7A 5AQSA 3L4IA 4CJFA 3S3MA 5AFUA 1RBRA 4KFBA 2NLXA 4FWQA 2OPPA 1L3SA 3U8XA 1Q9YA 2KFZA 1MWMA 3VEVA 5BN9A 4AHSA 4H8KA 2PYLA 4M3UA 5HROA 1HNIA 3ENHA 4Z4HA 2HOEA 2Q31A 3UB5A 4CJKA 5AQLA 2BH1A 3GE1A 1WSEA 2QM1A 3ITHA 5C15A 1ATNA 1WBDA 4IEIA 3TWHA 1EWQA 4JI4K 4H5TA 1KVBA 2HHXA 4B1VA 2ITMA 3OYMA 4CCHA 2WFBA 4DTNA 2A5XA 4I6MB 2G8KA 2Q2RA 2QKBA 3DOLA 4O0IA 2VCPA 4DV6K 2WOMA 4KTWA 4MQ3A 2RHKA 3Q7CA 3V6DA 4M3ZA 5E26A 1S9EA 1VSHA 3V9XA 2HB5A 2QWOA 4LF7K 3VERA 3VETA 4CFCA 3R6MA 1A5WA 3VEWA 2A1SA 2YHAA 1VQ9N 3BZCA 1KCFA 3ZSOA 4AHTA 3JYTA 4CHYA 3FFIA 3QFUA 4CGGA 5C42A 5JVGL 3AVFA 3JXUA 1NK6A 3MN5A 1HNWK 2YNGA 2E5LK 2GEMA 3ZSXA 4YOVA 3GG4A 4J2EA 3ZSRA 3LL3A 3HRGA 2V52B 2Z1IA 4YOUA 4CJVA 2UXBK 5AQHA 1Q18A 3SQ4A 3AVBA 4FJNA 3NVMA 4IOCL 3R1XA 5AQPA 4DV1K 4CJQA 4JKCA 3ENOA 5BRHA 2Q1NA 1IBKK 2GBZA 2ZJQL 4CJ4A 1UAXA 3NH2A 2HHVA 3VEZA 1NGCA 4DR1K 2PFUA 2PBDA 3O9SA 1JCFA 2HNYA 1XC9A 1U2VB 4AHRA 4CHOA 4CJLA 4B9LA 4PA1A 4OGEA 4DV0K 1UOCA 3RSEA 1N36K 4O0JA 4CIEA 1BOTO 3J81O 1QQNA 2IC3A 4CFBA 2YHXA 4DR6K 3ZETB 3AA4A 2KZMA 4PKGA 3THVA 5BREA 1KQSM 1C1BA 3LM9A 5J2QA 1HX1A 2ZJRL 3OBWA 4I6MA 1RGIA 1VQ6N 4BVPA 2OA8A 4CIGA 4PHTX 5EU7A 5C24A 4IO8A 3M8SA 3KK1A 4E7KA 1WSJA 4CZLA 4KREA 1BG3A 1YTAA 3I33A 2IS3A 2X78A 4M63C 2JWLA 3VQ6A 1JXBA 3QESA 3V9ZA 5M1NA 3CF5L 4F9OA 2NZTA 4BREA 2I5JA 1ZC6A 4CK3A 3VN5A 3DXMA 5GAEP 4Q5VA 5LJWA 2G8IA 3V81A 3MECA 4BY9C 3DLRA 5BRFA 4M7YA 3CFPA 3HM8A 1TKDA 3WNGA 3TABA 3DAWA 1L3VA 5ADXH 2GELA 1U04A 1HNZK 4MLHA 1GLFO 2WC9A 3F5TA 1NGDA 3SJJA 5KRSA 1QE1A 3OA9A 3QERA 2AJQA 2O8DB 4J2DA 1C0GA 3QMLA 4BRMA 1XMQK 1RT6A 1OVYA 3CD6N 2QWRA 3D6RA 1BO5O 3D0PA 3QBWA 1LWEA 1ESVA 3DLEA 1UWBA 2XY6A 3SUOA 3O3GA 4B1WB 3J8AA 1L3TA 3O9QA 3SQ0A 2QK9A 1SL0A 1RT7A 1JLBA 2W6LA 4BGBA 1JLAA 1HNVA 3DRPA 3L4QA 3KK3A 4H5RA 4BC2A 4JEPA 4KAZA 1WN7A 3KHYA 1LWFA 1LAWA 4OLBA 3ZLJA 1ITGA 3D2FB 3CHWA 1W2BM 3OY9A 2HHSA 4CGFA 4BRHA 2NRTA 1WSFA 3K5MA 5BR9A 3O1BA 4ISGA 2FC0A 1E4GT 4CEQA 5C0YA 1HPZA 4IG0A 4AHUA 4E1MA 3C65A 3MWTA 1Q7YO 3O9TA 4E7HA 3OHRA 1HKCA 3FZKA 3LDLA 1T6DA 3GBTA 2AA4A 2P9KB 3AAPA 2A1RA 2OTJN 2V51B 3ALYA 5HLFA 1VQON 1Q86O 2RN2A 4ISFA 3WQTA 2G8UA 2W40A 2YKMA 3K9KA 3JSMA 3AVNA 1QZ6A 3NGYA 4IFEA 4DR2K 1HUXA 3RR8A 3CJAA 1NKCA 3LP2A 4Y1DA 4IOXA 1X9SA 3CCRN 1NMNA 4CFDA 1NK7A 3QEVA 3LP1A 1ASUA 3LALA 3KK7A 2X74A 3QIOA 1TAQA 5MLCQ 1K6YA 3PV8A 3WNFA 3THYB 3VENA 4CF0A 2ETJA 3F9MA 2O8DA 5AZIA 3HBTA 3U3GA 4YFUA 3AVIA 2D0BA 3OVNA 4BR2A 1FKOA 2XY8A 1LW0A 4YHHK 4CZMA 3I8DA 3U6FA 4A5AA 4DTOA 1BU6O 3KD5E 1YVNA 3BY5A 3IDHA 4IDHA 4DF4A 3CPWM 4MO4A 1VQPN 3SV3A 4YOYA 4FOEA 4LF4K 3KKSA 3CQ8A 2Q36A 3THWB 4HVJA 2YI1A 1NOZA 3R9PA 1Z25A 3W0LA 2HBJA 3D2FA 4KH4A 1RTHA 4C1NI 5AQGA 1EXQA 4J2AA 1QZ5A 1GOCA 3EL2A 4H0OA 4DV2K 4QCLA 1HR0K 5LMNK 1D8YA 3AO1A 5AQRA 3O80A 4C1NK 4W5RA 1TUUA 3VTHA 1WAJA 1CXUA 1K9MO 4FLZA 2Q0RA 4CEBA 1KD1O 1IJJA 1Z6RA 4FVUA 4JKFA 3C6HA 2FF3B 2GX9A 3QBXA 3TAQA 4CI6A 4FK4A 3ZT0A 4OO1J 1S22A 3OYIA 4HUFA 4K42A 3MX2A 1RTIA 1T05A 4JNEA 2IGIA 1T3VA 1RDDA 5HRRA 3TARA 3EE9A 3K5OA 4IKFA 1BGXT 2O8CA 4CD3A 4Z4IA 2ZE2A 2NRWA 1TKXA 3SUQA 5AQMA 1FKPA 4GV9A 4OLAA 1KTQA 4N76A 3SLCA 4DQQA 1U4BA 3D45A 3L0QA 3FFKB 4M3YA 1N32K 4H0PA 4OPJA 1KLMA 3LDNA 1QVGM 3T1AA 3SJHA 3P31A 3S9HA 5J2NA 4ELUA 1ASWA 4NCGA 1JLQA 1RT2A 4ILHA 4JI2K 1QSSA 2HHHK 3DLHA 3IKMA 3PY8A 5J2MA 1NLVA 2F9WA 3KVGA 5TKWA 4JRQA 3QNNA 5CE3A 3PO5A 1NGIA 1NGFA 3OJUA 5AQNA 3BEXA 4KB0A 2FF6A 3A5NC 4IZ9A 5KQDA 1SKSA 1M1KO 3PUFA 3SPYA 3ISNC 3KLEA 3GDQA 3DLGA 4E7LA 1BCOA 3M6GA 4BR0A 3CM6A 3F9KA 2ZD1A 2YNFA 3MWPA 4GV6A 3J7AP 4DQSA 1GLEG 4QS7A 4PQUA 3THWA 1RBTA 4RWTA 4DQ8A 3B6OA 4BR7A 4KHNA 3C6UA 1JL2A 3RWUA 3M8PA 1KVCA 2H3GX 1HRHA 3M8RA 3AGRA 3OYCA 5GIOA 1K73O 3I0SA 4DUZK 2X6NA 5CYMA 4CGDA 1TVRA 3OYDA 1NKBA 4LY7A 1GLLO 4BQZA 2QW9A 3SQ1A 4N41A 4F3OA 4B9NA 4F8RA 5ELZA 3CCQN 4RW7A 2E1YA 4H0VB 3NE6A 5AQZA 3E01A 3MXJA 4DFKA 4MFBA 1IBLK 4MDAA 4YOWA 4OKJA 3OBYA 5DMRA 3TAPA 3EN9A 2WUSA 3CMAN 3SYZA 2E88A 3OS1A 1VSDA 1WB9A 2Q3SA 4HHTA 2VWBA 4FCYA 1U48A 3J7YP 4E7IA 4FOIA 1NG9A 4JKHA 2G8WA 3PX0A 1RILA 4ID5A 4B9SA 4KBOA 4OPHA 4Y0WA 4B08A 5BPLA 3MN9A 1NK4A 2EWSA 3TAMA 3C6AA 3SQ2A 3NF6A 1SKWA 1KAYA 2OZSA 3VQ7A 3AGKA 3V4IA 4JKGA 5LL6Z 1ZYQA 4B8AB 1GOBA 4B9UA 3L2VA 3WNHA 5GIPA 2OTLN 4UY8O 2YJEA 2P9SB 4LFAK 1S1UA 3CCJN 3KD1E 1REVA 4KHUA 3ULEA 4H5NA 5K14A 3MK6A 4CGJA 3O08A 1SZ2A 1BUPA 4Z4CA 4LFBK 4IFYA 3DLKA 5FRNA 1DKGD 3TTDA 4BC4A 2HMPA 4O5BA 4E7JA 3FR0A 3G4SN 2YNHA 3MMVA 3PLAA 4I2PA 3CI5A 1TK8A 4W5QA 4H0XB 4M3WA 3MAQA 3O4QA 1W9HA 5JS2A 3DXKA 2O8FA 4B1XB 5H1SQ 3C6TA 4AHVA 5FPEA 2D0PA 2NNWA 4OJRA 3NF7A 1G99A 4R5PA 3ZT3A 3E9LA 2KKZA 4JV5K 3RSEB 4AHCA 5CY4A 4OKKA 4BR9A 3VF4A 3BDPA 3HL8A 4KHPK 2R7YA 1T8EA 3VQ5A 1BCMA 4XH4A 4F2RA 3FE1A 4GNIA 4FM1A 1C1CA 1DLOA 4LSLA 2IVNA 3DOKA 3CCSN 1S1WA 5CYQA 1Z26A 4EZ6A 1RBUA 3RRHA 3AO2A 1VQ8N 1QSYA 3O3FA 3HOSA 2IVOA 4FWRA 3C95A 1X9JA 1N8RO 1VSMA 3K57A 3M8QA 4BG8A 5KGXA 3IMXA 1WSIA 1S72N 4TSXA 3CCEN 3TAEA 1XHXA 1KAXA 3AA3A 3I55N 1S6QA 4FPAA 3ZT2A 1KRPA 1HLUA 3MCAB 4BDZA 2HNDA 1BIUA 3J7ZO 4FZYA 4CESA 4Y1CA 4FYDA 2RPIA 4CF8A 2A40A 4PL8A 3DXMB 4FWMA 4DU3A 4H4OA 2P5OA 1VSLA 3TTFA 2XO7A 3O5BA 3H08A 3U4LA 2P9SA 4IFVA 3SMPA 4CD1A 3RMDA 2P1JA 3BGRA 3RR7A 1QS4A 3NFAA 1SKRA 2FSKA 4BDYA 3D7EO 3O1WA 1NU0A 4X66K 4FJMA 3ZX0A 4FWSA 1ATSA 1IG9A 5HOOA 1N5YA 2XY7A 3LDQA 2BUPA 3CJ7A 1HYZA 1WAFA 1KFSA 4M42A 4FLUA 1S5JA 4DV4K 3HM9A 4X65K 3MN7A 2PYJA 2D0AA 2FBXA 4QS8A 5AR0A 3V9WA 3LZIA 4JHDB 3CETA 1RT4A 1GLCG 3M5RA 4OKEA 4I2QA 4CE9A 3H3OB 4DTMA 4B9TA 2D0CA 1D9FA 1YT3A 1NGAA 5J2PA 1X3NA 2ITGA 4B9MA 3KKRA 1BI4A 4E3SA 4KPYA 4Z4FA 1RBSA 1S6PA 4BRIA 3NHGA 2RE2A 4DR3K 1NWKA 1TYQB 2GUPA 1G15A 2UXDK 1UA0A 2Z1JA 4W5OA 4FLTA 5TKYA 1N33K 4HWIA 4DU4A 1EQYA 3KWGA 3QFPA 4B1UB 4HUGA 2W6KA 4CJ7A 2RKIA 1ZBSA 3T69A 1NK9A 1X3MA 2BDPA 5JLHA 3IUCA 1O13A 1U45A 3VQQA 3OYNA 1W97L 3H1VX 4H03B 3RMBA 4A62A 4DG1A 3WNEA 4CEFA 3AVMA 3EKUA 4CGIA 3CJCA 3FZFA 1LW2A 2FLOA 4BG9A 4CECA 5GINA 3A2FA 3A5LC 4Z4GA 2KFNA 1FXXA 2GWKA 4YY3K 1HYVA 3TSUA 1FJGK 4B3OA 4F2SA 3HSCA 2OANA 3LPTA 1VQMN 1A5XA 5EVZA 4DWIA 4FJ9A 1QSLA 1BISA 4CBUA 3P83D 1Q81O 4IJNA 2WONA 5AQWA 4YOTA 3JAMO 2O8BA 5AZIB 1WSGA 3ATUA 4WFBL 1P90A 1GLAG 4DS5A 3HK2A 3DLBA 2UXCK 3KLGA 1XNQK 1BDGA 2ZM6K 3CJ1A 4JD2A 4WQ4C 1VQNN 4F3TA 4DU1A 4JHDA 4NO7A 1IKYA 4M3RA 3VF6A 1IG8A 1HPMA 3U3YA 3SZ2A 1Q9XA 5D3GA 3LDSA 3DI6A 3P1GA 1VRUA 3OTOK 4I9QA 5LMUK 2WBNA 1Y97A 3TTCA 1IKWA 3JS6A 3LAKA 2UYTA 4E0DA 5HBMA 1GLBG 3K58A 4Z0UA 4FK2A 4DV7K 3F2KA 1TYQA 3AO3A 3VA3A 2J4RA 2OPQA 5EXWA 2DY4A 1QTMA 3ID6A 3D2EA 3SI6A 4BRQA 1JLEA 2A3ZA 4GKJK 2FBVA 3NH0A 1L3UA 2D4WA 4BVOA 1FW6A 4FWLA 3G71N 3QICA 2FBTA 4GVMA 5M1OA 4FW2A 3O4WA 5AQTA 4BQLA 1C0TA 4IG3A 4O8UA 3AY9A 4XEIA 4BRCA 2QWMA 2QXFA 2O8CB 2B6AA 3L2UA 2IIRA 3G10A 1KLNA 4XIUA 3MX5A 4EP5A 2HSTA 4KHQA 3P39A 3VQEA 4WFNL 4DB3A 3OJSA 4K0KK 1YTUA 1OH5A 4RW9A 4FJ8A 2VGMA 2ZF5O 3VQ4A 4DR5K 4IOAL 2IVPA 2HHTA 2E4LA 4ELVA 3WEEB 5AZJA 1QHTA 2G8FA 4KKOA 3C94A 1LAVA 2ZJPL 3QB0A 5BR8K 3LP3A 5C25A 3ZSWA 1RDCA 4CBWA 1CZ9A 4IJAA 1B92A 4EAHD 1VQKN 4FW1A 1VAZA 3AAQA 3V1OA 1BWFO 5AQIA 4KTQA 1K8KB 3DRRA 1XC3A 1LWCA 1NJYA 4FZZA 4L3QA 2HHQA 2IOCA 2DFEA
chains in the Genus database with same CATH topology
3OYDA 4CCHA 3ULDA 4DTNA 1NKBA 4LY7A 1SL1A 3HT3A 2G8KA 1B9FA 4ZHRA 3K5LA 3TAGA 1IO2A 3SQ1A 4N41A 3DOLA 1ZBHA 4O0IA 3OYBA 4F3OA 2QKBA 2WOMA 4QOZB 4KTWA 4MQ3A 1BQNA 4B9NA 1NJZA 2PY5A 4N47A 4F8RA 3V6DA 3K2PA 4M3ZA 1S9EA 1HQEA 2E6LA 4RW7A 1VSHA 5T7BA 3V9XA 2HB5A 3HPOA 1U49A 4CEZA 4CFCA 1A5WA 2A1SA 3NE6A 4I9LA 2YHAA 3AV9A 3E01A 3MXJA 4DFKA 1KCFA 1W0HA 4MFBA 3ZSOA 1DTQA 4AHTA 1TKZA 3QINA 3JYTA 4OKJA 3TI0A 4CHYA 3OYMA 2P5GA 3NGIA 2G8VA 5DMRA 3TAPA 3FFIA 4NYFA 3EY1A 2OZMA 1D5AA 4CGGA 4CHZA 4CEAA 3SYZA 5C42A 1R0AA 2G8HA 1RCHA 3AVFA 3VQ9A 2BE2A 3OS1A 1VSDA 1NK6A 2Q3SA 4HHTA 2YNGA 4FCYA 1U48A 4E7IA 2XRIA 4DSEA 3EZ5A 1ASVA 2D5RA 3PX0A 1RILA 3ZSXA 2G8WA 4ID5A 4J2EA 1S1TA 4B9SA 4B08A 5DK5A 4ICLA 3ZSRA 4CF1A 1NK4A 3OYEA 3VQCA 2Z1IA 3TAMA 4CJVA 3LAMA 3T3FA 3CM5A 3ZCMA 3V1RA 4RW4A 3SQ2A 3NF6A 3HP9A 1SKWA 3IAYA 3SQ4A 4NCAA 2OZSA 3VQ7A 3AVBA 4FJNA 4HCBA 3V4IA 1ZYQA 4B8AB 3SNNA 4E1NA 5J1EA 1NK5A 1GOBA 4B9UA 2VWJA 1RTDA 4C8LA 3MEDA 4CJQA 2B4JA 3KK2A 3L2VA 3WNHA 3ZSZA 4HTUA 4CEEA 2GV9A 2GBZA 3IRXA 1GOAA 1D9DA 4CJ4A 3NGZA 4CJ3A 1S1UA 5I42A 3KD1E 4Q0BA 1A5VA 1REVA 1UAXA 3NH2A 4KHUA 2HW3A 2HHVA 1NJWA 5K14A 4FJKA 2HNYA 4CGJA 1XC9A 4AHRA 4CHOA 4CJLA 3CFOA 4O55A 4Z4CA 4B9LA 4H4MA 4IFYA 4PUOA 3DLKA 4PA1A 5FRNA 1YVUA 4OGEA 1EP4A 1S9GA 2YHBA 4FK0A 4E19A 3OYJA 3AA2A 3VQDA 4KRFA 2O4IA 2FBYA 2KW4A 3L2QA 1CXQA 1UOCA 1VSFA 4O5BA 3L2WA 4E7JA 3QEIA 4PY5A 1C0UA 3B6PA 1XHZA 3DYAA 4O0JA 4CIEA 4HCCA 2YNHA 4CJPA 3QNOA 4I2PA 3SV4A 4LH4A 4DLGA 2IC3A 3OYKA 3V1QA 4W5QA 1TK8A 4DSJA 3ZSYA 4CFAA 3MAQA 4M3WA 4CFBA 4K8ZA 3O4QA 4ID1A 1W9HA 3MXIA 5JS2A 3OYHA 3NF8A 3AA4A 4FJJA 4FZXC 4WE1A 2KZMA 3MXMA 3THVA 1C1BA 3C6TA 4AHVA 4DFMA 1N6QA 1J5OA 5J2QA 4OJRA 3NF7A 1ZBLA 4FJLA 4R5PA 3ZT3A 4DTPA 4QAGA 3OYLA 4FJGA 2OA8A 2BANA 4AHCA 5CY4A 2KQ2A 4CIGA 3MEEA 4OKKA 5EU7A 1CZBA 3BDPA 3HL8A 5C24A 2R7YA 1T8EA 3LP0A 2NUBA 3VQ5A 1BCMA 3QO9A 3KK1A 3M8SA 4F2RA 4FM1A 3OYAA 4IBNA 3NF9A 1C1CA 3HP6A 4E7KA 1DLOA 4RW8A 1TK0A 1WSJA 4LSLA 3DOKA 4DFPA 4DS4A 4KREA 1YTAA 1S1WA 2IS3A 2X78A 3KJVA 3L3VA 5CYQA 1HQUA 1Z26A 4EZ6A 3AA5X 3VQ6A 1JXBA 1RBUA 3RRHA 3QESA 3AO2A 3V9ZA 1JL1A 3ZT1A 2JGUA 1F21A 3VQ8A 3QLHA 1NOYA 2KZZA 4CK1A 1QSYA 3O3FA 2I5JA 1S1VA 4JS5A 4CK3A 3VN5A 3RRGA 1BQMA 4Q5VA 3HYFA 2G8IA 3V81A 4B8CA 2JLEA 3C95A 3MECA 3AVLA 1J53A 1VSMA 3DLRA 3K57A 2Z1GA 3M8QA 5KGXA 1JLCA 3CFPA 2DFFA 2ZQBA 1WSIA 3KLHA 4TSXA 1IH7A 2Y1IA 3TAEA 1XHXA 1TKDA 3WNGA 4C8OA 3LANA 3TABA 1L3VA 4FLYA 3LWMA 3AA3A 1U04A 1S6QA 1LV5A 3HSTB 3ZT2A 1KRPA 4CEOA 3SJJA 5KRSA 4BDZA 1C6VA 1QE1A 2HNDA 1BIUA 4KHYA 3QERA 2QKKA 2AJQA 4FZYA 1BIZA 1XWLA 4CESA 4J2DA 4Y1CA 4FYDA 2RPIA 4CF8A 1RT6A 1I3AA 4KB1A 5CZ2A 4DU3A 4H4OA 4DTJA 2OPSA 3D0PA 1MU2A 3AVKA 2P5OA 3VA0A 4F4KA 1LWEA 1VSLA 3DLEA 1UWBA 4NYNA 2XO7A 4DTUA 2XY6A 3KLIA 3SUOA 3O3GA 4CIFA 3H08A 3S3NA 2OPRA 1J54A 1L3TA 4K8XA 3HJFA 4IFVA 3SQ0A 2QK9A 3RMDA 1SL0A 1RT7A 1RNHA 4OPKA 3BGRA 2P1JA 1JLBA 1I39A 4BE2A 3RR7A 3VQPA 2PZSA 1QS4A 3V9UA 1JLAA 3IS9A 1JXEA 3NFAA 1SKRA 4CHNA 4FLWA 1HNVA 3DRPA 3KK3A 4KTZA 3LPUA 2HHUA 3HPGA 4CHPA 4CHQA 1VSIA 4CJ5A 4BDYA 4KAZA 4UQGA 1ZBFA 2YKNA 1RBVA 1WN7A 2E6MA 4LSNA 3OS0A 4JLHA 4YNQA 1LWFA 4FJ5A 1J9AA 1LAWA 1RDBA 5KI6A 4FJMA 3RMAA 4OLBA 1ITGA 3L3UA 4I7FA 1IG9A 2HVHA 1N5YA 1L5UA 2XY7A 4FJHA 3DRSA 4G1QA 4DF8A 3OY9A 1RT1A 2IDOA 4B9VA 1HYZA 2HHSA 1WAFA 4CGFA 2LSNA 1KFSA 4O44A 1WSFA 3K5MA 4C8NA 4FLUA 1S5JA 4ELTA 4M42A 3QEPA 2FC0A 3CG7A 3HM9A 4KV8A 1XI1A 2D0AA 5KRTA 4FM0A 2PYJA 2F8TA 4CJWA 4CEQA 1B9DA 2FBXA 3KTQA 3V9WA 3LZIA 4C8MA 1HPZA 4ZTJA 4IG0A 4AHUA 1HJRA 4E1MA 1Q8IA 4CF9A 4LD0A 1RT4A 3ASMA 3KIOA 1FK9A 4E7HA 4NCBA 1SL2A 4DLEA 4FM2A 4OKEA 4I2QA 4CE9A 4DTMA 4B9TA 1S1XA 3SCXA 4EZ9A 1TL3A 4CJSA 2A1RA 2GUIA 2D0CA 1D9FA 1YT3A 2YV0X 4C8KA 4DMNA 3ZT4A 3ALYA 5HLFA 5J2PA 2RN2A 2ITGA 3S3OA 1KSPA 4B9MA 3KKRA 4FLXA 4AILC 2G8UA 1BI4A 4E3SA 4KPYA 3NBPA 2DFHA 3AO5A 5E41A 4KHWA 1RBSA 1S6PA 2YKMA 3JSMA 3NHGA 3QEWA 2XY5A 4Z4FA 3AVNA 4RW6A 1TAUA 1G15A 3NGYA 1UA0A 2Z1JA 4W5OA 4J2BA 3IG1A 4FLTA 3RR8A 1NKCA 2O4GA 3QEXA 3K59A 5HRPA 4DU4A 3LP2A 3PO4A 5HRSA 4Y1DA 1KVAA 3O3HA 1KFDA 4HUGA 4N5SA 1X9SA 2RKIA 4CFDA 1SUQA 4BACA 1NK7A 2EHGA 1NK9A 2BDPA 3QEVA 3LP1A 3V9SA 1ASUA 3NH1A 3LWLA 1U45A 3LALA 1BI4B 3VQQA 3OYNA 1X1PA 3F73A 3HO1A 3RMBA 2Y1JA 1EETA 2X74A 3QIOA 3MEGA 1TAQA 1K6YA 4FJ7A 4CK2A 3PV8A 1RT3A 3WNFA 3OYFA 1IKXA 4M45A 4DG1A 3WNEA 4CEFA 2XHBA 3AVMA 5SZTA 4CF0A 4GMJB 4CGIA 2ETJA 5KGWA 4DTSA 4AH9A 5HP1A 2OYQA 1LW2A 4KHSA 3NCIA 3NAEA 3TAFA 1NKEA 1X9MA 1VSJA 4CECA 1T7PA 3QETA 4KI6A 2VG5A 3A2FA 3U3GA 4YFUA 3K5NA 3AVIA 4Z4GA 2D0BA 1FXXA 3OVNA 2KFNA 1HYVA 4CGHA 4B3OA 3QIPA 4W5TA 1FKOA 1TKTA 4DSKA 1HYSA 2XY8A 1LW0A 3I8DA 3U6FA 4F2SA 4DTOA 1VSKA 3AVHA 3LPTA 3KD5E 1WSHA 4DQPA 1A5XA 3AVGA 4DWIA 3CFRA 2KTQA 4DF4A 2F96A 4KI4A 4FJ9A 4FXDA 3RTVA 1T03A 2HVIA 3SV3A 4FJIA 1QSLA 1BISA 1TGOA 2EX3A 1RDAA 3P83D 4CEDA 4ZTFA 3HXMA 2WONA 2HHWA 3KKSA 3CQ8A 4M3TA 5CYMA 4OVLA 4HVJA 1WSGA 4CJRA 3VQAA 1NOZA 1Z25A 4BWMA 4DS5A 3OS2A 2W42A 3DLBA 3HK2A 1TK5A 1JKHA 1RTHA 3KLGA 4L8RB 1EXQA 3DM2A 4J2AA 1CLQA 1GOCA 1QQCA 4QCLA 1D8YA 2IAJA 1C0MA 3AO1A 3O4NA 4O4GA 4W5RA 5SWMA 5FDLA 3LZJA 1WAJA 4F3TA 4DU1A 1CXUA 3DMJA 2P51A 1C1AA 1IKYA 4M3RA 5FRMA 5D3GA 1EX4A 3U3YA 3SZ2A 1Q9XA 3LDSA 1WLJA 3HVTA 4FLZA 4CEBA 3DI6A 5JS1A 5CZ1A 4E89A 4W5NA 3VQBA 3P1GA 1VRUA 4I9QA 1O1WA 3L2RA 3SPZA 1VK0A 1Y97A 2RF2A 3TAQA 4FK4A 3NDKA 5KTQA 1IKWA 3LAKA 4DSFA 3ZT0A 1NJXA 3AO4A 4E0DA 5HBMA 1VRTA 3OYIA 3OYGA 4HUFA 4DTRA 4PWDA 1T05A 1RTIA 1BL3A 4IDKA 4Z0UA 4CERA 3K58A 4BE1A 3AVCA 2HMIA 4FK2A 4M3XA 2IGIA 2F8SA 1RDDA 5HRRA 4JRPA 3TARA 2HNZA 4FVMA 3K5OA 4N56A 4IKFA 1BGXT 3HPHA 3AO3A 3L8BA 3VA3A 4Z4EA 2OPQA 1BHLA 2VWKA 4Z4IA 2DY4A 2ZE2A 3AVAA 1QTMA 3SUNA 1HMVA 1TKXA 3SI6A 1JLEA 3SUQA 2FBVA 4CF2A 4BDPA 3NH0A 1L3UA 1FKPA 1SV5A 1JLFA 4OLAA 1KTQA 4N76A 5HRNA 4DSIA 1U4BA 4DQQA 1TV6A 4FLVA 4LH5A 3D45A 4M3YA 4GVMA 2FBTA 4DSLA 4OPJA 1KLMA 3T19A 3HVRA 1IKVA 4FW2A 3T1AA 4DQRA 1C0TA 4FJXA 3TANA 3S9HA 2B5JA 3CYMA 4IG3A 4OGCA 5J2NA 4ELUA 1ASWA 4NCGA 1JLQA 1RT2A 2Z1HA 1U47A 1QSSA 3DLHA 1EKEA 2ATQA 2QXFA 2B6AA 4KO0A 3PY8A 4GW6A 3L2UA 5J2MA 3G10A 2YNIA 3EYZA 3UIQA 1RTJA 4XIUA 4EP5A 4JRQA 1KLNA 3PX6A 4EP4A 3QNNA 3PX4A 1RT5A 4CJTA 3PO5A 3G0ZA 4KHQA 3P5JA 1TL1A 4M41A 3VQEA 3OJUA 3ZSQA 1VSEA 2VG7A 3OJSA 4CJFA 3S3MA 1YTUA 4KB0A 4RW9A 4FJ8A 4DTXA 1RBRA 4KFBA 1SKSA 3PUFA 3VQ4A 4BE0A 4BWJA 2OPPA 3SPYA 1X9WA 1L3SA 3ISNC 3KLEA 1DTTA 3DLGA 4E7LA 2HHTA 1BCOA 1WNSA 2E4LA 4RG8A 1Q9YA 4ELVA 3CM6A 3F9KA 1QHTA 2YNFA 2ZD1A 5FROA 4CJEA 2KFZA 2G8FA 4KKOA 3C94A 4AHSA 1LAVA 4H8KA 3ZSVA 2PYLA 5HROA 1UA1A 4M3UA 1HNIA 1JLGA 2VG6A 4CJUA 1NK8A 4DQSA 3LP3A 4Z4HA 3RMCA 2X6SA 5C25A 4PQUA 3ZSWA 1RBTA 4DQIA 3B6OA 4KHNA 2BGGA 3I0RA 1NK0A 1RDCA 1CZ9A 3C6UA 1B92A 1JL2A 4FW1A 4CJKA 3RWUA 3M8PA 1KVCA 1ZBIA 1HRHA 1WSEA 4JS4A 3M8RA 3ITHA 3V1OA 1ZBUA 3OYCA 4DFJA 3SUPA 3KLFA 4KTQA 4HUEA 3DRRA 3TWHA 4FZZA 1LWCA 1NJYA 3AVJA 3I0SA 3TR8A 2DTUA 2HHQA 2X6NA 1KVBA 5I3UA 2HHXA 2IOCA 2DFEA 4CGDA 1TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYD A;  4CCH A;  3ULD A;  4DTN A;  1NKB A;  4LY7 A;  1SL1 A;  3HT3 A;  2G8K A;  1B9F A;  4ZHR A;  3K5L A;  3TAG A;  1IO2 A;  3SQ1 A;  4N41 A;  3DOL A;  1ZBH A;  4O0I A;  3OYB A;  4F3O A;  2QKB A;  2WOM A;  4QOZ B;  4KTW A;  4MQ3 A;  1BQN A;  4B9N A;  1NJZ A;  2PY5 A;  4N47 A;  4F8R A;  3V6D A;  3K2P A;  4M3Z A;  1S9E A;  1HQE A;  2E6L A;  4RW7 A;  1VSH A;  5T7B A;  3V9X A;  2HB5 A;  3HPO A;  1U49 A;  4CEZ A;  4CFC A;  1A5W A;  2A1S A;  3NE6 A;  4I9L A;  2YHA A;  3AV9 A;  3E01 A;  3MXJ A;  4DFK A;  1KCF A;  1W0H A;  4MFB A;  3ZSO A;  1DTQ A;  4AHT A;  1TKZ A;  3QIN A;  3JYT A;  4OKJ A;  3TI0 A;  4CHY A;  3OYM A;  2P5G A;  3NGI A;  2G8V A;  5DMR A;  3TAP A;  3FFI A;  4NYF A;  3EY1 A;  2OZM A;  1D5A A;  4CGG A;  4CHZ A;  4CEA A;  3SYZ A;  5C42 A;  1R0A A;  2G8H A;  1RCH A;  3AVF A;  3VQ9 A;  2BE2 A;  3OS1 A;  1VSD A;  1NK6 A;  2Q3S A;  4HHT A;  2YNG A;  4FCY A;  1U48 A;  4E7I A;  2XRI A;  4DSE A;  3EZ5 A;  1ASV A;  2D5R A;  3PX0 A;  1RIL A;  3ZSX A;  2G8W A;  4ID5 A;  4J2E A;  1S1T A;  4B9S A;  4B08 A;  5DK5 A;  4ICL A;  3ZSR A;  4CF1 A;  1NK4 A;  3OYE A;  3VQC A;  2Z1I A;  3TAM A;  4CJV A;  3LAM A;  3T3F A;  3CM5 A;  3ZCM A;  3V1R A;  4RW4 A;  3SQ2 A;  3NF6 A;  3HP9 A;  1SKW A;  3IAY A;  3SQ4 A;  4NCA A;  2OZS A;  3VQ7 A;  3AVB A;  4FJN A;  4HCB A;  3V4I A;  1ZYQ A;  4B8A B;  3SNN A;  4E1N A;  5J1E A;  1NK5 A;  1GOB A;  4B9U A;  2VWJ A;  1RTD A;  4C8L A;  3MED A;  4CJQ A;  2B4J A;  3KK2 A;  3L2V A;  3WNH A;  3ZSZ A;  4HTU A;  4CEE A;  2GV9 A;  2GBZ A;  3IRX A;  1GOA A;  1D9D A;  4CJ4 A;  3NGZ A;  4CJ3 A;  1S1U A;  5I42 A;  3KD1 E;  4Q0B A;  1A5V A;  1REV A;  1UAX A;  3NH2 A;  4KHU A;  2HW3 A;  2HHV A;  1NJW A;  5K14 A;  4FJK A;  2HNY A;  4CGJ A;  1XC9 A;  4AHR A;  4CHO A;  4CJL A;  3CFO A;  4O55 A;  4Z4C A;  4B9L A;  4H4M A;  4IFY A;  4PUO A;  3DLK A;  4PA1 A;  5FRN A;  1YVU A;  4OGE A;  1EP4 A;  1S9G A;  2YHB A;  4FK0 A;  4E19 A;  3OYJ A;  3AA2 A;  3VQD A;  4KRF A;  2O4I A;  2FBY A;  2KW4 A;  3L2Q A;  1CXQ A;  1UOC A;  1VSF A;  4O5B A;  3L2W A;  4E7J A;  3QEI A;  4PY5 A;  1C0U A;  3B6P A;  1XHZ A;  3DYA A;  4O0J A;  4CIE A;  4HCC A;  2YNH A;  4CJP A;  3QNO A;  4I2P A;  3SV4 A;  4LH4 A;  4DLG A;  2IC3 A;  3OYK A;  3V1Q A;  4W5Q A;  1TK8 A;  4DSJ A;  3ZSY A;  4CFA A;  3MAQ A;  4M3W A;  4CFB A;  4K8Z A;  3O4Q A;  4ID1 A;  1W9H A;  3MXI A;  5JS2 A;  3OYH A;  3NF8 A;  3AA4 A;  4FJJ A;  4FZX C;  4WE1 A;  2KZM A;  3MXM A;  3THV A;  1C1B A;  3C6T A;  4AHV A;  4DFM A;  1N6Q A;  1J5O A;  5J2Q A;  4OJR A;  3NF7 A;  1ZBL A;  4FJL A;  4R5P A;  3ZT3 A;  4DTP A;  4QAG A;  3OYL A;  4FJG A;  2OA8 A;  2BAN A;  4AHC A;  5CY4 A;  2KQ2 A;  4CIG A;  3MEE A;  4OKK A;  5EU7 A;  1CZB A;  3BDP A;  3HL8 A;  5C24 A;  2R7Y A;  1T8E A;  3LP0 A;  2NUB A;  3VQ5 A;  1BCM A;  3QO9 A;  3KK1 A;  3M8S A;  4F2R A;  4FM1 A;  3OYA A;  4IBN A;  3NF9 A;  1C1C A;  3HP6 A;  4E7K A;  1DLO A;  4RW8 A;  1TK0 A;  1WSJ A;  4LSL A;  3DOK A;  4DFP A;  4DS4 A;  4KRE A;  1YTA A;  1S1W A;  2IS3 A;  2X78 A;  3KJV A;  3L3V A;  5CYQ A;  1HQU A;  1Z26 A;  4EZ6 A;  3AA5 X;  3VQ6 A;  1JXB A;  1RBU A;  3RRH A;  3QES A;  3AO2 A;  3V9Z A;  1JL1 A;  3ZT1 A;  2JGU A;  1F21 A;  3VQ8 A;  3QLH A;  1NOY A;  2KZZ A;  4CK1 A;  1QSY A;  3O3F A;  2I5J A;  1S1V A;  4JS5 A;  4CK3 A;  3VN5 A;  3RRG A;  1BQM A;  4Q5V A;  3HYF A;  2G8I A;  3V81 A;  4B8C A;  2JLE A;  3C95 A;  3MEC A;  3AVL A;  1J53 A;  1VSM A;  3DLR A;  3K57 A;  2Z1G A;  3M8Q A;  5KGX A;  1JLC A;  3CFP A;  2DFF A;  2ZQB A;  1WSI A;  3KLH A;  4TSX A;  1IH7 A;  2Y1I A;  3TAE A;  1XHX A;  1TKD A;  3WNG A;  4C8O A;  3LAN A;  3TAB A;  1L3V A;  4FLY A;  3LWM A;  3AA3 A;  1U04 A;  1S6Q A;  1LV5 A;  3HST B;  3ZT2 A;  1KRP A;  4CEO A;  3SJJ A;  5KRS A;  4BDZ A;  1C6V A;  1QE1 A;  2HND A;  1BIU A;  4KHY A;  3QER A;  2QKK A;  2AJQ A;  4FZY A;  1BIZ A;  1XWL A;  4CES A;  4J2D A;  4Y1C A;  4FYD A;  2RPI A;  4CF8 A;  1RT6 A;  1I3A A;  4KB1 A;  5CZ2 A;  4DU3 A;  4H4O A;  4DTJ A;  2OPS A;  3D0P A;  1MU2 A;  3AVK A;  2P5O A;  3VA0 A;  4F4K A;  1LWE A;  1VSL A;  3DLE A;  1UWB A;  4NYN A;  2XO7 A;  4DTU A;  2XY6 A;  3KLI A;  3SUO A;  3O3G A;  4CIF A;  3H08 A;  3S3N A;  2OPR A;  1J54 A;  1L3T A;  4K8X A;  3HJF A;  4IFV A;  3SQ0 A;  2QK9 A;  3RMD A;  1SL0 A;  1RT7 A;  1RNH A;  4OPK A;  3BGR A;  2P1J A;  1JLB A;  1I39 A;  4BE2 A;  3RR7 A;  3VQP A;  2PZS A;  1QS4 A;  3V9U A;  1JLA A;  3IS9 A;  1JXE A;  3NFA A;  1SKR A;  4CHN A;  4FLW A;  1HNV A;  3DRP A;  3KK3 A;  4KTZ A;  3LPU A;  2HHU A;  3HPG A;  4CHP A;  4CHQ A;  1VSI A;  4CJ5 A;  4BDY A;  4KAZ A;  4UQG A;  1ZBF A;  2YKN A;  1RBV A;  1WN7 A;  2E6M A;  4LSN A;  3OS0 A;  4JLH A;  4YNQ A;  1LWF A;  4FJ5 A;  1J9A A;  1LAW A;  1RDB A;  5KI6 A;  4FJM A;  3RMA A;  4OLB A;  1ITG A;  3L3U A;  4I7F A;  1IG9 A;  2HVH A;  1N5Y A;  1L5U A;  2XY7 A;  4FJH A;  3DRS A;  4G1Q A;  4DF8 A;  3OY9 A;  1RT1 A;  2IDO A;  4B9V A;  1HYZ A;  2HHS A;  1WAF A;  4CGF A;  2LSN A;  1KFS A;  4O44 A;  1WSF A;  3K5M A;  4C8N A;  4FLU A;  1S5J A;  4ELT A;  4M42 A;  3QEP A;  2FC0 A;  3CG7 A;  3HM9 A;  4KV8 A;  1XI1 A;  2D0A A;  5KRT A;  4FM0 A;  2PYJ A;  2F8T A;  4CJW A;  4CEQ A;  1B9D A;  2FBX A;  3KTQ A;  3V9W A;  3LZI A;  4C8M A;  1HPZ A;  4ZTJ A;  4IG0 A;  4AHU A;  1HJR A;  4E1M A;  1Q8I A;  4CF9 A;  4LD0 A;  1RT4 A;  3ASM A;  3KIO A;  1FK9 A;  4E7H A;  4NCB A;  1SL2 A;  4DLE A;  4FM2 A;  4OKE A;  4I2Q A;  4CE9 A;  4DTM A;  4B9T A;  1S1X A;  3SCX A;  4EZ9 A;  1TL3 A;  4CJS A;  2A1R A;  2GUI A;  2D0C A;  1D9F A;  1YT3 A;  2YV0 X;  4C8K A;  4DMN A;  3ZT4 A;  3ALY A;  5HLF A;  5J2P A;  2RN2 A;  2ITG A;  3S3O A;  1KSP A;  4B9M A;  3KKR A;  4FLX A;  4AIL C;  2G8U A;  1BI4 A;  4E3S A;  4KPY A;  3NBP A;  2DFH A;  3AO5 A;  5E41 A;  4KHW A;  1RBS A;  1S6P A;  2YKM A;  3JSM A;  3NHG A;  3QEW A;  2XY5 A;  4Z4F A;  3AVN A;  4RW6 A;  1TAU A;  1G15 A;  3NGY A;  1UA0 A;  2Z1J A;  4W5O A;  4J2B A;  3IG1 A;  4FLT A;  3RR8 A;  1NKC A;  2O4G A;  3QEX A;  3K59 A;  5HRP A;  4DU4 A;  3LP2 A;  3PO4 A;  5HRS A;  4Y1D A;  1KVA A;  3O3H A;  1KFD A;  4HUG A;  4N5S A;  1X9S A;  2RKI A;  4CFD A;  1SUQ A;  4BAC A;  1NK7 A;  2EHG A;  1NK9 A;  2BDP A;  3QEV A;  3LP1 A;  3V9S A;  1ASU A;  3NH1 A;  3LWL A;  1U45 A;  3LAL A;  1BI4 B;  3VQQ A;  3OYN A;  1X1P A;  3F73 A;  3HO1 A;  3RMB A;  2Y1J A;  1EET A;  2X74 A;  3QIO A;  3MEG A;  1TAQ A;  1K6Y A;  4FJ7 A;  4CK2 A;  3PV8 A;  1RT3 A;  3WNF A;  3OYF A;  1IKX A;  4M45 A;  4DG1 A;  3WNE A;  4CEF A;  2XHB A;  3AVM A;  5SZT A;  4CF0 A;  4GMJ B;  4CGI A;  2ETJ A;  5KGW A;  4DTS A;  4AH9 A;  5HP1 A;  2OYQ A;  1LW2 A;  4KHS A;  3NCI A;  3NAE A;  3TAF A;  1NKE A;  1X9M A;  1VSJ A;  4CEC A;  1T7P A;  3QET A;  4KI6 A;  2VG5 A;  3A2F A;  3U3G A;  4YFU A;  3K5N A;  3AVI A;  4Z4G A;  2D0B A;  1FXX A;  3OVN A;  2KFN A;  1HYV A;  4CGH A;  4B3O A;  3QIP A;  4W5T A;  1FKO A;  1TKT A;  4DSK A;  1HYS A;  2XY8 A;  1LW0 A;  3I8D A;  3U6F A;  4F2S A;  4DTO A;  1VSK A;  3AVH A;  3LPT A;  3KD5 E;  1WSH A;  4DQP A;  1A5X A;  3AVG A;  4DWI A;  3CFR A;  2KTQ A;  4DF4 A;  2F96 A;  4KI4 A;  4FJ9 A;  4FXD A;  3RTV A;  1T03 A;  2HVI A;  3SV3 A;  4FJI A;  1QSL A;  1BIS A;  1TGO A;  2EX3 A;  1RDA A;  3P83 D;  4CED A;  4ZTF A;  3HXM A;  2WON A;  2HHW A;  3KKS A;  3CQ8 A;  4M3T A;  5CYM A;  4OVL A;  4HVJ A;  1WSG A;  4CJR A;  3VQA A;  1NOZ A;  1Z25 A;  4BWM A;  4DS5 A;  3OS2 A;  2W42 A;  3DLB A;  3HK2 A;  1TK5 A;  1JKH A;  1RTH A;  3KLG A;  4L8R B;  1EXQ A;  3DM2 A;  4J2A A;  1CLQ A;  1GOC A;  1QQC A;  4QCL A;  1D8Y A;  2IAJ A;  1C0M A;  3AO1 A;  3O4N A;  4O4G A;  4W5R A;  5SWM A;  5FDL A;  3LZJ A;  1WAJ A;  4F3T A;  4DU1 A;  1CXU A;  3DMJ A;  2P51 A;  1C1A A;  1IKY A;  4M3R A;  5FRM A;  5D3G A;  1EX4 A;  3U3Y A;  3SZ2 A;  1Q9X A;  3LDS A;  1WLJ A;  3HVT A;  4FLZ A;  4CEB A;  3DI6 A;  5JS1 A;  5CZ1 A;  4E89 A;  4W5N A;  3VQB A;  3P1G A;  1VRU A;  4I9Q A;  1O1W A;  3L2R A;  3SPZ A;  1VK0 A;  1Y97 A;  2RF2 A;  3TAQ A;  4FK4 A;  3NDK A;  5KTQ A;  1IKW A;  3LAK A;  4DSF A;  3ZT0 A;  1NJX A;  3AO4 A;  4E0D A;  5HBM A;  1VRT A;  3OYI A;  3OYG A;  4HUF A;  4DTR A;  4PWD A;  1T05 A;  1RTI A;  1BL3 A;  4IDK A;  4Z0U A;  4CER A;  3K58 A;  4BE1 A;  3AVC A;  2HMI A;  4FK2 A;  4M3X A;  2IGI A;  2F8S A;  1RDD A;  5HRR A;  4JRP A;  3TAR A;  2HNZ A;  4FVM A;  3K5O A;  4N56 A;  4IKF A;  1BGX T;  3HPH A;  3AO3 A;  3L8B A;  3VA3 A;  4Z4E A;  2OPQ A;  1BHL A;  2VWK A;  4Z4I A;  2DY4 A;  2ZE2 A;  3AVA A;  1QTM A;  3SUN A;  1HMV A;  1TKX A;  3SI6 A;  1JLE A;  3SUQ A;  2FBV A;  4CF2 A;  4BDP A;  3NH0 A;  1L3U A;  1FKP A;  1SV5 A;  1JLF A;  4OLA A;  1KTQ A;  4N76 A;  5HRN A;  4DSI A;  1U4B A;  4DQQ A;  1TV6 A;  4FLV A;  4LH5 A;  3D45 A;  4M3Y A;  4GVM A;  2FBT A;  4DSL A;  4OPJ A;  1KLM A;  3T19 A;  3HVR A;  1IKV A;  4FW2 A;  3T1A A;  4DQR A;  1C0T A;  4FJX A;  3TAN A;  3S9H A;  2B5J A;  3CYM A;  4IG3 A;  4OGC A;  5J2N A;  4ELU A;  1ASW A;  4NCG A;  1JLQ A;  1RT2 A;  2Z1H A;  1U47 A;  1QSS A;  3DLH A;  1EKE A;  2ATQ A;  2QXF A;  2B6A A;  4KO0 A;  3PY8 A;  4GW6 A;  3L2U A;  5J2M A;  3G10 A;  2YNI A;  3EYZ A;  3UIQ A;  1RTJ A;  4XIU A;  4EP5 A;  4JRQ A;  1KLN A;  3PX6 A;  4EP4 A;  3QNN A;  3PX4 A;  1RT5 A;  4CJT A;  3PO5 A;  3G0Z A;  4KHQ A;  3P5J A;  1TL1 A;  4M41 A;  3VQE A;  3OJU A;  3ZSQ A;  1VSE A;  2VG7 A;  3OJS A;  4CJF A;  3S3M A;  1YTU A;  4KB0 A;  4RW9 A;  4FJ8 A;  4DTX A;  1RBR A;  4KFB A;  1SKS A;  3PUF A;  3VQ4 A;  4BE0 A;  4BWJ A;  2OPP A;  3SPY A;  1X9W A;  1L3S A;  3ISN C;  3KLE A;  1DTT A;  3DLG A;  4E7L A;  2HHT A;  1BCO A;  1WNS A;  2E4L A;  4RG8 A;  1Q9Y A;  4ELV A;  3CM6 A;  3F9K A;  1QHT A;  2YNF A;  2ZD1 A;  5FRO A;  4CJE A;  2KFZ A;  2G8F A;  4KKO A;  3C94 A;  4AHS A;  1LAV A;  4H8K A;  3ZSV A;  2PYL A;  5HRO A;  1UA1 A;  4M3U A;  1HNI A;  1JLG A;  2VG6 A;  4CJU A;  1NK8 A;  4DQS A;  3LP3 A;  4Z4H A;  3RMC A;  2X6S A;  5C25 A;  4PQU A;  3ZSW A;  1RBT A;  4DQI A;  3B6O A;  4KHN A;  2BGG A;  3I0R A;  1NK0 A;  1RDC A;  1CZ9 A;  3C6U A;  1B92 A;  1JL2 A;  4FW1 A;  4CJK A;  3RWU A;  3M8P A;  1KVC A;  1ZBI A;  1HRH A;  1WSE A;  4JS4 A;  3M8R A;  3ITH A;  3V1O A;  1ZBU A;  3OYC A;  4DFJ A;  3SUP A;  3KLF A;  4KTQ A;  4HUE A;  3DRR A;  3TWH A;  4FZZ A;  1LWC A;  1NJY A;  3AVJ A;  3I0S A;  3TR8 A;  2DTU A;  2HHQ A;  2X6N A;  1KVB A;  5I3U A;  2HHX A;  2IOC A;  2DFE A;  4CGD A;  1TVR A; 
#chains in the Genus database with same CATH topology
 4CZK A;  3H6E A;  4CZI A;  4ZHR A;  4K25 A;  3TAG A;  1IO2 A;  4QOZ B;  1ZBH A;  1NM1 A;  5LY3 A;  2FXU A;  4RCH A;  5B8H A;  2P9P B;  4N47 A;  1NJZ A;  4B3R K;  1MA9 B;  3HPO A;  4CZH A;  1KAZ A;  4I9L A;  4IEE A;  1SQK A;  3KZB A;  1DTQ A;  4WF9 L;  5M1Q A;  3TI0 A;  2A6A A;  3UKR B;  2P5G A;  2QWP A;  4NYF A;  2HF4 A;  1BA1 A;  2YJF A;  1D5A A;  4CHZ A;  3A5M C;  4CEA A;  1HKG A;  1R0A A;  1RCH A;  3VQ9 A;  5AFU H;  2BE2 A;  3DWL A;  1VQ4 N;  3QDK A;  4BRN A;  2XRI A;  1TUY A;  2UUC K;  2DPN A;  5DM6 L;  4ICL A;  1Z05 A;  4CF1 A;  3OYE A;  3VQC A;  4EFH A;  3HTV A;  3MCP A;  4H5V A;  3T3F A;  3O9U A;  3V1R A;  4RW4 A;  1SS6 A;  4HCB A;  1DGK N;  3UKU B;  2ZGZ A;  3FZL A;  5J1E A;  1NK5 A;  4DR7 K;  2QXL A;  1RTD A;  3MED A;  2B4J A;  4HTU A;  2GV9 A;  4PKH A;  4EHU A;  3NGZ A;  4CJ3 A;  1VHX A;  5I42 A;  4Q0B A;  2UUB K;  1NMD A;  3VEO A;  4JKB A;  1NJW A;  4O55 A;  3WEE A;  4H4M A;  4NXN K;  4JKG B;  1S9G A;  4E19 A;  3OYJ A;  5AQY A;  2CH5 A;  3AA2 A;  4YDU C;  3L2Q A;  1YIT N;  1CXQ A;  3L2W A;  3QEI A;  1C0U A;  3BUZ B;  4B1Z A;  4HCC A;  4A59 A;  3QNO A;  3SV4 A;  4LH4 A;  4FWK A;  3OYK A;  3ZSY A;  4CFA A;  3ULE B;  4GKK K;  4K8Z A;  2OCE A;  3MXI A;  1K8K A;  3U9D A;  4FJJ A;  3MXM A;  3CQX A;  1J5O A;  2NRV A;  1ZBL A;  4FJL A;  1M90 O;  3U9Z A;  3OYL A;  4FJG A;  3BF1 A;  4WQ4 A;  4K41 A;  4OX9 K;  2KQ2 A;  4IWV A;  3MEE A;  1CZB A;  2P9P A;  4A61 A;  3QO9 A;  4X62 K;  1YI2 N;  3OYA A;  4IBN A;  3HP6 A;  4RW8 A;  4DFP A;  4DS4 A;  4B1Y B;  3KJV A;  3DXK B;  3L3V A;  3TSQ A;  1KXP A;  3AA5 X;  4R79 A;  2O8F B;  3EO3 A;  3ZT1 A;  3VQ8 A;  1NOY A;  3UKR A;  3CCL N;  1GLD G;  3WXL A;  4U67 L;  5IT9 O;  1YHQ N;  2JLE A;  5FPM A;  4YOR A;  1Y64 A;  1JLC A;  4WQ5 A;  4CBX A;  2QEX N;  1D4X A;  1IH7 A;  4BR5 A;  4C8O A;  4LF6 K;  3LWM A;  3CER A;  3WXJ A;  3HST B;  4NLB A;  1NNE A;  2FSJ A;  4CEO A;  3WQU A;  4LC9 B;  4KHY A;  2QKK A;  2ASO A;  3UKU A;  3BZK A;  2OPS A;  1MU2 A;  3L6Q A;  2VQE K;  4F4K A;  4JK7 A;  4DTU A;  4BRP A;  3HOT A;  1CZA N;  3SBT A;  3SAH A;  3HJF A;  1J54 A;  4K8X A;  2Q0U A;  4A57 A;  1NGG A;  1RNH A;  4JK8 A;  3VQP A;  3V9U A;  3IS9 A;  1JXE A;  4FLW A;  3VPZ A;  3CCV N;  4KTZ A;  2YHY A;  1VSI A;  4CJ5 A;  2NRZ A;  4UQG A;  1ZBF A;  4CW7 B;  4LSN A;  2E6M A;  3OS0 A;  5KI6 A;  3RMA A;  4I7F A;  2GWJ A;  3VEY A;  4CZG A;  4G1Q A;  4DF8 A;  4B9V A;  2IDO A;  2AP1 A;  2LSN A;  3WUH A;  4O44 A;  4ELT A;  4C8N A;  3SK3 A;  3QEP A;  4MO5 A;  2JWK A;  3CG7 A;  4PY5 A;  1XI1 A;  4NB4 A;  4CJW A;  3ZX3 A;  3KTQ A;  2PAV A;  5EY4 A;  5FPD A;  4C8M A;  4ZTJ A;  1HJR A;  1E3M A;  4LD0 A;  4KH6 A;  1JCE A;  4EHT A;  4EZ9 A;  3HZ6 A;  2YV0 X;  2KHO A;  4C8K A;  4DMN A;  3ZT4 A;  1YJ9 N;  2ZGY A;  1KSP A;  3S3O A;  4NLC A;  4FLX A;  4FWO A;  2XY5 A;  1TAU A;  3LDO A;  4G9Z A;  4RW6 A;  1NGH A;  3T1Y K;  4J2B A;  3IG1 A;  3P38 A;  2CGL A;  5KPZ A;  3QEX A;  3CXC M;  2P9L B;  5HRP A;  3PO4 A;  1W7A A;  5HRS A;  1KVA A;  1KFD A;  4ISE A;  4N5S A;  4B3M K;  1QHA A;  1SUQ A;  2E2Q A;  4X64 K;  4RTF D;  1HKB A;  1OH7 A;  4HTL A;  3NH1 A;  3HO1 A;  1BI4 B;  3F73 A;  4BRD A;  1EET A;  3MEG A;  3E66 A;  4CK2 A;  2D0O A;  1RT3 A;  3BF3 A;  3O8M A;  4M45 A;  4WFA L;  1E4F T;  5SZT A;  4DTS A;  4KHS A;  4AH9 A;  2GTD A;  1VSJ A;  4A2B A;  1T7P A;  3E9O A;  4DCH A;  3H46 O;  1C0F A;  1QQM A;  3DJC A;  3QIP A;  4V19 S;  4H5W A;  4DSK A;  2P9U A;  1JJ2 M;  3ZEU B;  2E20 A;  4ILG B;  5HL7 L;  4DQP A;  3AVG A;  3B8A X;  4MLE A;  4E1J A;  4FXD A;  1J6Z A;  5AQJ A;  1TGO A;  1RDA A;  3BP8 A;  2HHW A;  4DHY A;  4M3T A;  3Q7B A;  2YX6 A;  4O8K A;  3FZH A;  2W42 A;  1TK5 A;  5AQF A;  3THX A;  1JKH A;  4YDU A;  4L8R B;  1QQC A;  2IAJ A;  1C0M A;  2YCH A;  1YJW N;  3CC2 N;  3O4N A;  1YIJ N;  4M7X A;  5FDL A;  4DKW A;  3LZJ A;  4CZF A;  3DMJ A;  2P51 A;  1C1A A;  5FRM A;  1EX4 A;  4JKA A;  2O8B B;  1WLJ A;  4NXM K;  2WTU A;  5CZ1 A;  4E89 A;  4W5N A;  4DR4 K;  2ASM A;  1O1W A;  3L2R A;  3SPZ A;  4LF8 K;  2D1K A;  5EX5 A;  3CC7 N;  2E2N A;  1ILY A;  5KTQ A;  4DSF A;  3G6E N;  3AO4 A;  3GL1 A;  1VRT A;  3OYG A;  5GAD P;  4FZX C;  1BL3 A;  4M3X A;  2HMI A;  4LF9 K;  2F8S A;  4JD2 B;  4JAX A;  2F7T A;  4N56 A;  3ID8 A;  4PL7 A;  3HPH A;  1BHL A;  1NGB A;  3AVA A;  1N34 K;  3SUN A;  2P9L A;  4CVN E;  4BDP A;  1NGE A;  1BA0 A;  3TPQ A;  1SV5 A;  4QS9 A;  5BPN A;  5HRN A;  4DSI A;  1TV6 A;  4FLV A;  3CJ9 A;  5I9E B;  4DSL A;  3HVR A;  4DQR A;  4FJX A;  3TAN A;  2B5J A;  3CYM A;  2KLA A;  3R8E A;  4OGC A;  1KC8 O;  1QVF M;  2NRR A;  4IXC A;  2A41 A;  3K0S A;  2ATQ A;  4KO0 A;  2E2O A;  2YNI A;  3EYZ A;  3E9P A;  3CME N;  3D2E B;  4EP4 A;  1RT5 A;  2E1Z A;  3VGL A;  3P5J A;  2ZWH A;  2VYP A;  4M41 A;  3ZSQ A;  1VSE A;  2QWN A;  1HJO A;  1OKJ A;  4KH5 A;  4DTX A;  3WXM B;  4BE0 A;  4BWJ A;  1X9W A;  3ZEU A;  1EO1 A;  1DTT A;  3E1Y A;  1WNS A;  4FSV A;  4RG8 A;  1DT9 A;  1RDW X;  5FRO A;  4CJE A;  5KPR A;  3ZSV A;  4C23 A;  1UA1 A;  1JLG A;  2VG6 A;  4CJU A;  1NK8 A;  3P4I A;  3RMC A;  2X6S A;  5JLF A;  4DQI A;  2BGG A;  3I0R A;  1NK0 A;  2W41 A;  1V4S A;  1ZBI A;  4JS4 A;  1ZBU A;  4DFJ A;  3SUP A;  2O8E B;  3KLF A;  3GOI A;  4HUE A;  3T7Z A;  3EEQ A;  2DTU A;  3AVJ A;  3TR8 A;  5AZJ B;  5I3U A;  3ULD A;  1SL1 A;  3NVK A;  3HT3 A;  1B9F A;  3K5L A;  2E2P A;  3OYB A;  3O6W A;  1BQN A;  3LM2 A;  2PY5 A;  3W3D A;  2P9N B;  3K2P A;  3O9R A;  5GAH P;  1HQE A;  2E6L A;  5T7B A;  1U49 A;  3VOV A;  4CEZ A;  3AV9 A;  3CJB A;  1RFQ A;  1W0H A;  3EE8 A;  1TKZ A;  3QIN A;  4JI1 K;  4AM7 A;  2ASP A;  3NGI A;  2G8V A;  2F9T A;  3EY1 A;  2OZM A;  4B9Q A;  4MDB A;  1QQO A;  2HF3 A;  3H45 C;  2G8H A;  3MN6 A;  3FZM A;  3PIP L;  2HBL A;  1I94 K;  4DSE A;  4FO0 A;  5AQV A;  3EZ5 A;  1ASV A;  2D5R A;  2QWQ A;  1OH8 A;  5AQO A;  3J80 O;  1S1T A;  5KPT A;  5DK5 A;  2QI2 A;  3FLC O;  3PSI A;  3LAM A;  4H0T B;  3SAG A;  3CM5 A;  3ZCM A;  4BC5 A;  1U2V A;  3HP9 A;  4AF1 A;  5GAG P;  3IAY A;  4NCA A;  3DLL L;  3VTI A;  5JMV A;  3VMF B;  1WOQ A;  3S41 A;  3M1F A;  3SNN A;  4E1N A;  1IBM K;  4C8L A;  4WQ5 C;  4XH1 A;  2VWJ A;  3KK2 A;  3PSF A;  4JKD A;  3ZSZ A;  4CEE A;  2V7Z A;  3IRX A;  3CIP A;  1GOA A;  2BTF A;  1D9D A;  2HW3 A;  1A5V A;  4FPB A;  4JI3 K;  4FJK A;  3C7N B;  3ZET A;  5CHI A;  2HVI A;  1VQL N;  3CFO A;  4PUO A;  3VGM A;  1YVU A;  5A2Q O;  2CGJ A;  1VQ5 N;  1EP4 A;  2YHB A;  4FK0 A;  4JN4 A;  3VQD A;  4KRF A;  5LJV A;  2O4I A;  2FBY A;  2KW4 A;  1VSF A;  1WUA A;  2HBK A;  5EOY A;  3B6P A;  1XHZ A;  3DYA A;  4BRO A;  4JI8 K;  3VF2 A;  4CJP A;  4DLG A;  5IWA K;  3V1Q A;  4DSJ A;  3VGK A;  1ZXO A;  5F1X A;  4ID1 A;  2FSN A;  2O8E A;  3N4P A;  3OYH A;  3NF8 A;  4WE1 A;  3ATV A;  4DFM A;  1N6Q A;  3CCU N;  4B3T K;  4WYB A;  1GLJ O;  4BRK A;  4DTP A;  1SAZ A;  4QAG A;  2BAN A;  5BPM A;  3UE5 A;  4BGA A;  5AQQ A;  4J8F A;  1HNX K;  3LP0 A;  2NUB A;  2P9N A;  3NF9 A;  1YUW A;  2YHW A;  5BN8 A;  1TK0 A;  5M1F A;  1YAG A;  3SBG A;  4BC3 A;  1HQU A;  4GV3 A;  1XUP O;  4DUY K;  1JL1 A;  4BRG A;  2JGU A;  1F21 A;  1R59 O;  3QLH A;  2QA4 N;  4DV3 K;  4CK1 A;  2UUA K;  1S1V A;  4JS5 A;  3SMS A;  3RRG A;  1BQM A;  3HYF A;  4B8C A;  3AVL A;  5C10 A;  1J53 A;  3M3Z A;  4BRL A;  2Z1G A;  5AJ3 K;  2DFF A;  2ZQB A;  3KLH A;  3ZYY X;  2Y1I A;  2Q97 A;  4K43 A;  3K9J A;  3A0I X;  3LAN A;  4FLY A;  1LV5 A;  4GVE A;  1JCG A;  1C6V A;  2HBM A;  1BIZ A;  1XWL A;  1S3X A;  3H1Q A;  3OW2 M;  1I3A A;  3EZW A;  4KB1 A;  5CZ2 A;  2V7Y A;  5JIC A;  4DTJ A;  3N4Q A;  3AVK A;  4U7B A;  3VA0 A;  3RVC A;  4NYN A;  1H1V A;  3KLI A;  4CIF A;  3A8Y A;  3S3N A;  2OPR A;  3MDQ A;  3A5O C;  4OPK A;  4BE2 A;  1I39 A;  2I7P A;  1U6Z A;  2PZS A;  3C7N A;  4CHN A;  4CZJ A;  1EWR A;  3TSP A;  5E84 A;  3LPU A;  2HHU A;  3HPG A;  4FL9 A;  4CHP A;  4CHQ A;  5C2D A;  2YKN A;  5CR4 A;  1RBV A;  4JLH A;  4YNQ A;  1YXQ A;  3VEX A;  1RDU A;  4FJ5 A;  4LF5 K;  1J9A A;  1RDB A;  2P9K A;  1K8A O;  4FWN A;  3R3L A;  3L3U A;  2HVH A;  4FJH A;  1L5U A;  3WT0 A;  3DRS A;  4BR4 A;  1RT1 A;  4EIA A;  4AQY K;  1XQS C;  3SAF A;  3EKS A;  4KV8 A;  2NRH A;  5KRT A;  4FM0 A;  2F8T A;  4GY2 B;  1B9D A;  3I56 N;  4YOX A;  2QWL A;  5ADX A;  2F4V K;  1Q8I A;  4ILJ A;  4CF9 A;  3ASM A;  4B3S K;  3KIO A;  1FK9 A;  4NCB A;  1SL2 A;  4DLE A;  4FM2 A;  3LDP A;  1NGJ A;  1S1X A;  2CH6 A;  3SCX A;  5FLX O;  1TL3 A;  3HI0 A;  2P9I B;  2GUI A;  4CJS A;  5DM7 L;  1OH6 A;  4JK9 A;  4AIL C;  1DEJ A;  1LCU A;  1T6C A;  3NBP A;  2DFH A;  3AO5 A;  5E41 A;  4KHW A;  3KWI A;  3QEW A;  3ENB A;  4BRA A;  3CQY A;  4CZE A;  4JKE A;  2O4G A;  3THY A;  3K59 A;  1VQ7 N;  3O3H A;  3TU5 A;  3H3N O;  4BAC A;  1T44 A;  2EHG A;  2UU9 K;  1YF5 L;  3V9S A;  4XH5 A;  3LWL A;  2KZZ A;  1X1P A;  2Y1J A;  4PKI A;  1XNR K;  1OVQ A;  4FJ7 A;  5AQU A;  3OYF A;  3CPE A;  2VQF K;  1IKX A;  2XHB A;  3T1H K;  1V4T A;  4GMJ B;  5HP1 A;  5KGW A;  5C2F A;  2OYQ A;  3NCI A;  3NAE A;  3TAF A;  3CCM N;  1NKE A;  1X9M A;  1IV0 A;  3QET A;  4KI6 A;  2VG5 A;  3K5N A;  4FWP A;  4AM6 A;  4CGH A;  4W5T A;  1TKT A;  1HYS A;  4JI0 K;  1VSK A;  3AVH A;  1WSH A;  3CFR A;  2KTQ A;  4BRF A;  2F96 A;  4KI4 A;  1Q82 O;  1NBW A;  3RTV A;  1T03 A;  4JI5 K;  4FJI A;  2EX3 A;  4CED A;  4ZTF A;  3IFR A;  3C0B A;  3HXM A;  2A42 A;  4JYA K;  4OVL A;  1ATR A;  4CJR A;  3I8B A;  4O5F A;  3VQA A;  4BWM A;  3OS2 A;  3FGU A;  5KQ8 A;  2P9U B;  5BRD A;  1CLQ A;  3DM2 A;  4A5B A;  4O4G A;  5SWM A;  5F2R A;  4DV5 K;  3G25 A;  5JVH L;  3NMU A;  3HVT A;  5JS1 A;  4IO9 L;  3VQB A;  5FPN A;  1NJI O;  1VK0 A;  2P9I A;  2QTD A;  4LFC K;  3WXK A;  2RF2 A;  1J5E K;  3THX B;  3NDK A;  1NJX A;  4DTR A;  4PWD A;  4CER A;  2CGK A;  4IDK A;  5AQX A;  4BE1 A;  3AVC A;  4JRP A;  2HNZ A;  4FVM A;  5M1P A;  1LOT B;  2I7N A;  3L8B A;  4Z4E A;  1YJN N;  2VWK A;  3AAR A;  4A2A A;  1HMV A;  2NRX A;  1WBB A;  4CF2 A;  5C12 A;  1JLF A;  3PIO L;  4LH5 A;  3ZX2 A;  4Z94 A;  4OPA A;  4JI7 K;  4JI6 K;  3T19 A;  2VGN A;  1IKV A;  3VES A;  5AQK A;  1MDU B;  2Z1H A;  2E8A A;  1U47 A;  1EKE A;  4GW6 A;  4H0Y B;  3UIQ A;  1RTJ A;  3PX6 A;  1MWK A;  3PX4 A;  1XMO K;  4CJT A;  5F0X A;  3G0Z A;  4WCE L;  5M1K A;  1TL1 A;  3WXI A;  1P8Z A;  3CC4 N;  2VG7 A;  5AQS A;  3L4I A;  4CJF A;  3S3M A;  5AFU A;  1RBR A;  4KFB A;  2NLX A;  4FWQ A;  2OPP A;  1L3S A;  3U8X A;  1Q9Y A;  2KFZ A;  1MWM A;  3VEV A;  5BN9 A;  4AHS A;  4H8K A;  2PYL A;  4M3U A;  5HRO A;  1HNI A;  3ENH A;  4Z4H A;  2HOE A;  2Q31 A;  3UB5 A;  4CJK A;  5AQL A;  2BH1 A;  3GE1 A;  1WSE A;  2QM1 A;  3ITH A;  5C15 A;  1ATN A;  1WBD A;  4IEI A;  3TWH A;  1EWQ A;  4JI4 K;  4H5T A;  1KVB A;  2HHX A;  4B1V A;  2ITM A;  3OYM A;  4CCH A;  2WFB A;  4DTN A;  2A5X A;  4I6M B;  2G8K A;  2Q2R A;  2QKB A;  3DOL A;  4O0I A;  2VCP A;  4DV6 K;  2WOM A;  4KTW A;  4MQ3 A;  2RHK A;  3Q7C A;  3V6D A;  4M3Z A;  5E26 A;  1S9E A;  1VSH A;  3V9X A;  2HB5 A;  2QWO A;  4LF7 K;  3VER A;  3VET A;  4CFC A;  3R6M A;  1A5W A;  3VEW A;  2A1S A;  2YHA A;  1VQ9 N;  3BZC A;  1KCF A;  3ZSO A;  4AHT A;  3JYT A;  4CHY A;  3FFI A;  3QFU A;  4CGG A;  5C42 A;  5JVG L;  3AVF A;  3JXU A;  1NK6 A;  3MN5 A;  1HNW K;  2YNG A;  2E5L K;  2GEM A;  3ZSX A;  4YOV A;  3GG4 A;  4J2E A;  3ZSR A;  3LL3 A;  3HRG A;  2V52 B;  2Z1I A;  4YOU A;  4CJV A;  2UXB K;  5AQH A;  1Q18 A;  3SQ4 A;  3AVB A;  4FJN A;  3NVM A;  4IOC L;  3R1X A;  5AQP A;  4DV1 K;  4CJQ A;  4JKC A;  3ENO A;  5BRH A;  2Q1N A;  1IBK K;  2GBZ A;  2ZJQ L;  4CJ4 A;  1UAX A;  3NH2 A;  2HHV A;  3VEZ A;  1NGC A;  4DR1 K;  2PFU A;  2PBD A;  3O9S A;  1JCF A;  2HNY A;  1XC9 A;  1U2V B;  4AHR A;  4CHO A;  4CJL A;  4B9L A;  4PA1 A;  4OGE A;  4DV0 K;  1UOC A;  3RSE A;  1N36 K;  4O0J A;  4CIE A;  1BOT O;  3J81 O;  1QQN A;  2IC3 A;  4CFB A;  2YHX A;  4DR6 K;  3ZET B;  3AA4 A;  2KZM A;  4PKG A;  3THV A;  5BRE A;  1KQS M;  1C1B A;  3LM9 A;  5J2Q A;  1HX1 A;  2ZJR L;  3OBW A;  4I6M A;  1RGI A;  1VQ6 N;  4BVP A;  2OA8 A;  4CIG A;  4PHT X;  5EU7 A;  5C24 A;  4IO8 A;  3M8S A;  3KK1 A;  4E7K A;  1WSJ A;  4CZL A;  4KRE A;  1BG3 A;  1YTA A;  3I33 A;  2IS3 A;  2X78 A;  4M63 C;  2JWL A;  3VQ6 A;  1JXB A;  3QES A;  3V9Z A;  5M1N A;  3CF5 L;  4F9O A;  2NZT A;  4BRE A;  2I5J A;  1ZC6 A;  4CK3 A;  3VN5 A;  3DXM A;  5GAE P;  4Q5V A;  5LJW A;  2G8I A;  3V81 A;  3MEC A;  4BY9 C;  3DLR A;  5BRF A;  4M7Y A;  3CFP A;  3HM8 A;  1TKD A;  3WNG A;  3TAB A;  3DAW A;  1L3V A;  5ADX H;  2GEL A;  1U04 A;  1HNZ K;  4MLH A;  1GLF O;  2WC9 A;  3F5T A;  1NGD A;  3SJJ A;  5KRS A;  1QE1 A;  3OA9 A;  3QER A;  2AJQ A;  2O8D B;  4J2D A;  1C0G A;  3QML A;  4BRM A;  1XMQ K;  1RT6 A;  1OVY A;  3CD6 N;  2QWR A;  3D6R A;  1BO5 O;  3D0P A;  3QBW A;  1LWE A;  1ESV A;  3DLE A;  1UWB A;  2XY6 A;  3SUO A;  3O3G A;  4B1W B;  3J8A A;  1L3T A;  3O9Q A;  3SQ0 A;  2QK9 A;  1SL0 A;  1RT7 A;  1JLB A;  2W6L A;  4BGB A;  1JLA A;  1HNV A;  3DRP A;  3L4Q A;  3KK3 A;  4H5R A;  4BC2 A;  4JEP A;  4KAZ A;  1WN7 A;  3KHY A;  1LWF A;  1LAW A;  4OLB A;  3ZLJ A;  1ITG A;  3D2F B;  3CHW A;  1W2B M;  3OY9 A;  2HHS A;  4CGF A;  4BRH A;  2NRT A;  1WSF A;  3K5M A;  5BR9 A;  3O1B A;  4ISG A;  2FC0 A;  1E4G T;  4CEQ A;  5C0Y A;  1HPZ A;  4IG0 A;  4AHU A;  4E1M A;  3C65 A;  3MWT A;  1Q7Y O;  3O9T A;  4E7H A;  3OHR A;  1HKC A;  3FZK A;  3LDL A;  1T6D A;  3GBT A;  2AA4 A;  2P9K B;  3AAP A;  2A1R A;  2OTJ N;  2V51 B;  3ALY A;  5HLF A;  1VQO N;  1Q86 O;  2RN2 A;  4ISF A;  3WQT A;  2G8U A;  2W40 A;  2YKM A;  3K9K A;  3JSM A;  3AVN A;  1QZ6 A;  3NGY A;  4IFE A;  4DR2 K;  1HUX A;  3RR8 A;  3CJA A;  1NKC A;  3LP2 A;  4Y1D A;  4IOX A;  1X9S A;  3CCR N;  1NMN A;  4CFD A;  1NK7 A;  3QEV A;  3LP1 A;  1ASU A;  3LAL A;  3KK7 A;  2X74 A;  3QIO A;  1TAQ A;  5MLC Q;  1K6Y A;  3PV8 A;  3WNF A;  3THY B;  3VEN A;  4CF0 A;  2ETJ A;  3F9M A;  2O8D A;  5AZI A;  3HBT A;  3U3G A;  4YFU A;  3AVI A;  2D0B A;  3OVN A;  4BR2 A;  1FKO A;  2XY8 A;  1LW0 A;  4YHH K;  4CZM A;  3I8D A;  3U6F A;  4A5A A;  4DTO A;  1BU6 O;  3KD5 E;  1YVN A;  3BY5 A;  3IDH A;  4IDH A;  4DF4 A;  3CPW M;  4MO4 A;  1VQP N;  3SV3 A;  4YOY A;  4FOE A;  4LF4 K;  3KKS A;  3CQ8 A;  2Q36 A;  3THW B;  4HVJ A;  2YI1 A;  1NOZ A;  3R9P A;  1Z25 A;  3W0L A;  2HBJ A;  3D2F A;  4KH4 A;  1RTH A;  4C1N I;  5AQG A;  1EXQ A;  4J2A A;  1QZ5 A;  1GOC A;  3EL2 A;  4H0O A;  4DV2 K;  4QCL A;  1HR0 K;  5LMN K;  1D8Y A;  3AO1 A;  5AQR A;  3O80 A;  4C1N K;  4W5R A;  1TUU A;  3VTH A;  1WAJ A;  1CXU A;  1K9M O;  4FLZ A;  2Q0R A;  4CEB A;  1KD1 O;  1IJJ A;  1Z6R A;  4FVU A;  4JKF A;  3C6H A;  2FF3 B;  2GX9 A;  3QBX A;  3TAQ A;  4CI6 A;  4FK4 A;  3ZT0 A;  4OO1 J;  1S22 A;  3OYI A;  4HUF A;  4K42 A;  3MX2 A;  1RTI A;  1T05 A;  4JNE A;  2IGI A;  1T3V A;  1RDD A;  5HRR A;  3TAR A;  3EE9 A;  3K5O A;  4IKF A;  1BGX T;  2O8C A;  4CD3 A;  4Z4I A;  2ZE2 A;  2NRW A;  1TKX A;  3SUQ A;  5AQM A;  1FKP A;  4GV9 A;  4OLA A;  1KTQ A;  4N76 A;  3SLC A;  4DQQ A;  1U4B A;  3D45 A;  3L0Q A;  3FFK B;  4M3Y A;  1N32 K;  4H0P A;  4OPJ A;  1KLM A;  3LDN A;  1QVG M;  3T1A A;  3SJH A;  3P31 A;  3S9H A;  5J2N A;  4ELU A;  1ASW A;  4NCG A;  1JLQ A;  1RT2 A;  4ILH A;  4JI2 K;  1QSS A;  2HHH K;  3DLH A;  3IKM A;  3PY8 A;  5J2M A;  1NLV A;  2F9W A;  3KVG A;  5TKW A;  4JRQ A;  3QNN A;  5CE3 A;  3PO5 A;  1NGI A;  1NGF A;  3OJU A;  5AQN A;  3BEX A;  4KB0 A;  2FF6 A;  3A5N C;  4IZ9 A;  5KQD A;  1SKS A;  1M1K O;  3PUF A;  3SPY A;  3ISN C;  3KLE A;  3GDQ A;  3DLG A;  4E7L A;  1BCO A;  3M6G A;  4BR0 A;  3CM6 A;  3F9K A;  2ZD1 A;  2YNF A;  3MWP A;  4GV6 A;  3J7A P;  4DQS A;  1GLE G;  4QS7 A;  4PQU A;  3THW A;  1RBT A;  4RWT A;  4DQ8 A;  3B6O A;  4BR7 A;  4KHN A;  3C6U A;  1JL2 A;  3RWU A;  3M8P A;  1KVC A;  2H3G X;  1HRH A;  3M8R A;  3AGR A;  3OYC A;  5GIO A;  1K73 O;  3I0S A;  4DUZ K;  2X6N A;  5CYM A;  4CGD A;  1TVR A;  3OYD A;  1NKB A;  4LY7 A;  1GLL O;  4BQZ A;  2QW9 A;  3SQ1 A;  4N41 A;  4F3O A;  4B9N A;  4F8R A;  5ELZ A;  3CCQ N;  4RW7 A;  2E1Y A;  4H0V B;  3NE6 A;  5AQZ A;  3E01 A;  3MXJ A;  4DFK A;  4MFB A;  1IBL K;  4MDA A;  4YOW A;  4OKJ A;  3OBY A;  5DMR A;  3TAP A;  3EN9 A;  2WUS A;  3CMA N;  3SYZ A;  2E88 A;  3OS1 A;  1VSD A;  1WB9 A;  2Q3S A;  4HHT A;  2VWB A;  4FCY A;  1U48 A;  3J7Y P;  4E7I A;  4FOI A;  1NG9 A;  4JKH A;  2G8W A;  3PX0 A;  1RIL A;  4ID5 A;  4B9S A;  4KBO A;  4OPH A;  4Y0W A;  4B08 A;  5BPL A;  3MN9 A;  1NK4 A;  2EWS A;  3TAM A;  3C6A A;  3SQ2 A;  3NF6 A;  1SKW A;  1KAY A;  2OZS A;  3VQ7 A;  3AGK A;  3V4I A;  4JKG A;  5LL6 Z;  1ZYQ A;  4B8A B;  1GOB A;  4B9U A;  3L2V A;  3WNH A;  5GIP A;  2OTL N;  4UY8 O;  2YJE A;  2P9S B;  4LFA K;  1S1U A;  3CCJ N;  3KD1 E;  1REV A;  4KHU A;  3ULE A;  4H5N A;  5K14 A;  3MK6 A;  4CGJ A;  3O08 A;  1SZ2 A;  1BUP A;  4Z4C A;  4LFB K;  4IFY A;  3DLK A;  5FRN A;  1DKG D;  3TTD A;  4BC4 A;  2HMP A;  4O5B A;  4E7J A;  3FR0 A;  3G4S N;  2YNH A;  3MMV A;  3PLA A;  4I2P A;  3CI5 A;  1TK8 A;  4W5Q A;  4H0X B;  4M3W A;  3MAQ A;  3O4Q A;  1W9H A;  5JS2 A;  3DXK A;  2O8F A;  4B1X B;  5H1S Q;  3C6T A;  4AHV A;  5FPE A;  2D0P A;  2NNW A;  4OJR A;  3NF7 A;  1G99 A;  4R5P A;  3ZT3 A;  3E9L A;  2KKZ A;  4JV5 K;  3RSE B;  4AHC A;  5CY4 A;  4OKK A;  4BR9 A;  3VF4 A;  3BDP A;  3HL8 A;  4KHP K;  2R7Y A;  1T8E A;  3VQ5 A;  1BCM A;  4XH4 A;  4F2R A;  3FE1 A;  4GNI A;  4FM1 A;  1C1C A;  1DLO A;  4LSL A;  2IVN A;  3DOK A;  3CCS N;  1S1W A;  5CYQ A;  1Z26 A;  4EZ6 A;  1RBU A;  3RRH A;  3AO2 A;  1VQ8 N;  1QSY A;  3O3F A;  3HOS A;  2IVO A;  4FWR A;  3C95 A;  1X9J A;  1N8R O;  1VSM A;  3K57 A;  3M8Q A;  4BG8 A;  5KGX A;  3IMX A;  1WSI A;  1S72 N;  4TSX A;  3CCE N;  3TAE A;  1XHX A;  1KAX A;  3AA3 A;  3I55 N;  1S6Q A;  4FPA A;  3ZT2 A;  1KRP A;  1HLU A;  3MCA B;  4BDZ A;  2HND A;  1BIU A;  3J7Z O;  4FZY A;  4CES A;  4Y1C A;  4FYD A;  2RPI A;  4CF8 A;  2A40 A;  4PL8 A;  3DXM B;  4FWM A;  4DU3 A;  4H4O A;  2P5O A;  1VSL A;  3TTF A;  2XO7 A;  3O5B A;  3H08 A;  3U4L A;  2P9S A;  4IFV A;  3SMP A;  4CD1 A;  3RMD A;  2P1J A;  3BGR A;  3RR7 A;  1QS4 A;  3NFA A;  1SKR A;  2FSK A;  4BDY A;  3D7E O;  3O1W A;  1NU0 A;  4X66 K;  4FJM A;  3ZX0 A;  4FWS A;  1ATS A;  1IG9 A;  5HOO A;  1N5Y A;  2XY7 A;  3LDQ A;  2BUP A;  3CJ7 A;  1HYZ A;  1WAF A;  1KFS A;  4M42 A;  4FLU A;  1S5J A;  4DV4 K;  3HM9 A;  4X65 K;  3MN7 A;  2PYJ A;  2D0A A;  2FBX A;  4QS8 A;  5AR0 A;  3V9W A;  3LZI A;  4JHD B;  3CET A;  1RT4 A;  1GLC G;  3M5R A;  4OKE A;  4I2Q A;  4CE9 A;  3H3O B;  4DTM A;  4B9T A;  2D0C A;  1D9F A;  1YT3 A;  1NGA A;  5J2P A;  1X3N A;  2ITG A;  4B9M A;  3KKR A;  1BI4 A;  4E3S A;  4KPY A;  4Z4F A;  1RBS A;  1S6P A;  4BRI A;  3NHG A;  2RE2 A;  4DR3 K;  1NWK A;  1TYQ B;  2GUP A;  1G15 A;  2UXD K;  1UA0 A;  2Z1J A;  4W5O A;  4FLT A;  5TKY A;  1N33 K;  4HWI A;  4DU4 A;  1EQY A;  3KWG A;  3QFP A;  4B1U B;  4HUG A;  2W6K A;  4CJ7 A;  2RKI A;  1ZBS A;  3T69 A;  1NK9 A;  1X3M A;  2BDP A;  5JLH A;  3IUC A;  1O13 A;  1U45 A;  3VQQ A;  3OYN A;  1W97 L;  3H1V X;  4H03 B;  3RMB A;  4A62 A;  4DG1 A;  3WNE A;  4CEF A;  3AVM A;  3EKU A;  4CGI A;  3CJC A;  3FZF A;  1LW2 A;  2FLO A;  4BG9 A;  4CEC A;  5GIN A;  3A2F A;  3A5L C;  4Z4G A;  2KFN A;  1FXX A;  2GWK A;  4YY3 K;  1HYV A;  3TSU A;  1FJG K;  4B3O A;  4F2S A;  3HSC A;  2OAN A;  3LPT A;  1VQM N;  1A5X A;  5EVZ A;  4DWI A;  4FJ9 A;  1QSL A;  1BIS A;  4CBU A;  3P83 D;  1Q81 O;  4IJN A;  2WON A;  5AQW A;  4YOT A;  3JAM O;  2O8B A;  5AZI B;  1WSG A;  3ATU A;  4WFB L;  1P90 A;  1GLA G;  4DS5 A;  3HK2 A;  3DLB A;  2UXC K;  3KLG A;  1XNQ K;  1BDG A;  2ZM6 K;  3CJ1 A;  4JD2 A;  4WQ4 C;  1VQN N;  4F3T A;  4DU1 A;  4JHD A;  4NO7 A;  1IKY A;  4M3R A;  3VF6 A;  1IG8 A;  1HPM A;  3U3Y A;  3SZ2 A;  1Q9X A;  5D3G A;  3LDS A;  3DI6 A;  3P1G A;  1VRU A;  3OTO K;  4I9Q A;  5LMU K;  2WBN A;  1Y97 A;  3TTC A;  1IKW A;  3JS6 A;  3LAK A;  2UYT A;  4E0D A;  5HBM A;  1GLB G;  3K58 A;  4Z0U A;  4FK2 A;  4DV7 K;  3F2K A;  1TYQ A;  3AO3 A;  3VA3 A;  2J4R A;  2OPQ A;  5EXW A;  2DY4 A;  1QTM A;  3ID6 A;  3D2E A;  3SI6 A;  4BRQ A;  1JLE A;  2A3Z A;  4GKJ K;  2FBV A;  3NH0 A;  1L3U A;  2D4W A;  4BVO A;  1FW6 A;  4FWL A;  3G71 N;  3QIC A;  2FBT A;  4GVM A;  5M1O A;  4FW2 A;  3O4W A;  5AQT A;  4BQL A;  1C0T A;  4IG3 A;  4O8U A;  3AY9 A;  4XEI A;  4BRC A;  2QWM A;  2QXF A;  2O8C B;  2B6A A;  3L2U A;  2IIR A;  3G10 A;  1KLN A;  4XIU A;  3MX5 A;  4EP5 A;  2HST A;  4KHQ A;  3P39 A;  3VQE A;  4WFN L;  4DB3 A;  3OJS A;  4K0K K;  1YTU A;  1OH5 A;  4RW9 A;  4FJ8 A;  2VGM A;  2ZF5 O;  3VQ4 A;  4DR5 K;  4IOA L;  2IVP A;  2HHT A;  2E4L A;  4ELV A;  3WEE B;  5AZJ A;  1QHT A;  2G8F A;  4KKO A;  3C94 A;  1LAV A;  2ZJP L;  3QB0 A;  5BR8 K;  3LP3 A;  5C25 A;  3ZSW A;  1RDC A;  4CBW A;  1CZ9 A;  4IJA A;  1B92 A;  4EAH D;  1VQK N;  4FW1 A;  1VAZ A;  3AAQ A;  3V1O A;  1BWF O;  5AQI A;  4KTQ A;  1K8K B;  3DRR A;  1XC3 A;  1LWC A;  1NJY A;  4FZZ A;  4L3Q A;  2HHQ A;  2IOC A;  2DFE A; 
#chains in the Genus database with same CATH homology
 3OYD A;  4CCH A;  3ULD A;  4DTN A;  1NKB A;  4LY7 A;  1SL1 A;  3HT3 A;  2G8K A;  1B9F A;  4ZHR A;  3K5L A;  3TAG A;  1IO2 A;  3SQ1 A;  4N41 A;  3DOL A;  1ZBH A;  4O0I A;  3OYB A;  4F3O A;  2QKB A;  2WOM A;  4QOZ B;  4KTW A;  4MQ3 A;  1BQN A;  4B9N A;  1NJZ A;  2PY5 A;  4N47 A;  4F8R A;  3V6D A;  3K2P A;  4M3Z A;  1S9E A;  1HQE A;  2E6L A;  4RW7 A;  1VSH A;  5T7B A;  3V9X A;  2HB5 A;  3HPO A;  1U49 A;  4CEZ A;  4CFC A;  1A5W A;  2A1S A;  3NE6 A;  4I9L A;  2YHA A;  3AV9 A;  3E01 A;  3MXJ A;  4DFK A;  1KCF A;  1W0H A;  4MFB A;  3ZSO A;  1DTQ A;  4AHT A;  1TKZ A;  3QIN A;  3JYT A;  4OKJ A;  3TI0 A;  4CHY A;  3OYM A;  2P5G A;  3NGI A;  2G8V A;  5DMR A;  3TAP A;  3FFI A;  4NYF A;  3EY1 A;  2OZM A;  1D5A A;  4CGG A;  4CHZ A;  4CEA A;  3SYZ A;  5C42 A;  1R0A A;  2G8H A;  1RCH A;  3AVF A;  3VQ9 A;  2BE2 A;  3OS1 A;  1VSD A;  1NK6 A;  2Q3S A;  4HHT A;  2YNG A;  4FCY A;  1U48 A;  4E7I A;  2XRI A;  4DSE A;  3EZ5 A;  1ASV A;  2D5R A;  3PX0 A;  1RIL A;  3ZSX A;  2G8W A;  4ID5 A;  4J2E A;  1S1T A;  4B9S A;  4B08 A;  5DK5 A;  4ICL A;  3ZSR A;  4CF1 A;  1NK4 A;  3OYE A;  3VQC A;  2Z1I A;  3TAM A;  4CJV A;  3LAM A;  3T3F A;  3CM5 A;  3ZCM A;  3V1R A;  4RW4 A;  3SQ2 A;  3NF6 A;  3HP9 A;  1SKW A;  3IAY A;  3SQ4 A;  4NCA A;  2OZS A;  3VQ7 A;  3AVB A;  4FJN A;  4HCB A;  3V4I A;  1ZYQ A;  4B8A B;  3SNN A;  4E1N A;  5J1E A;  1NK5 A;  1GOB A;  4B9U A;  2VWJ A;  1RTD A;  4C8L A;  3MED A;  4CJQ A;  2B4J A;  3KK2 A;  3L2V A;  3WNH A;  3ZSZ A;  4HTU A;  4CEE A;  2GV9 A;  2GBZ A;  3IRX A;  1GOA A;  1D9D A;  4CJ4 A;  3NGZ A;  4CJ3 A;  1S1U A;  5I42 A;  3KD1 E;  4Q0B A;  1A5V A;  1REV A;  1UAX A;  3NH2 A;  4KHU A;  2HW3 A;  2HHV A;  1NJW A;  5K14 A;  4FJK A;  2HNY A;  4CGJ A;  1XC9 A;  4AHR A;  4CHO A;  4CJL A;  3CFO A;  4O55 A;  4Z4C A;  4B9L A;  4H4M A;  4IFY A;  4PUO A;  3DLK A;  4PA1 A;  5FRN A;  1YVU A;  4OGE A;  1EP4 A;  1S9G A;  2YHB A;  4FK0 A;  4E19 A;  3OYJ A;  3AA2 A;  3VQD A;  4KRF A;  2O4I A;  2FBY A;  2KW4 A;  3L2Q A;  1CXQ A;  1UOC A;  1VSF A;  4O5B A;  3L2W A;  4E7J A;  3QEI A;  4PY5 A;  1C0U A;  3B6P A;  1XHZ A;  3DYA A;  4O0J A;  4CIE A;  4HCC A;  2YNH A;  4CJP A;  3QNO A;  4I2P A;  3SV4 A;  4LH4 A;  4DLG A;  2IC3 A;  3OYK A;  3V1Q A;  4W5Q A;  1TK8 A;  4DSJ A;  3ZSY A;  4CFA A;  3MAQ A;  4M3W A;  4CFB A;  4K8Z A;  3O4Q A;  4ID1 A;  1W9H A;  3MXI A;  5JS2 A;  3OYH A;  3NF8 A;  3AA4 A;  4FJJ A;  4FZX C;  4WE1 A;  2KZM A;  3MXM A;  3THV A;  1C1B A;  3C6T A;  4AHV A;  4DFM A;  1N6Q A;  1J5O A;  5J2Q A;  4OJR A;  3NF7 A;  1ZBL A;  4FJL A;  4R5P A;  3ZT3 A;  4DTP A;  4QAG A;  3OYL A;  4FJG A;  2OA8 A;  2BAN A;  4AHC A;  5CY4 A;  2KQ2 A;  4CIG A;  3MEE A;  4OKK A;  5EU7 A;  1CZB A;  3BDP A;  3HL8 A;  5C24 A;  2R7Y A;  1T8E A;  3LP0 A;  2NUB A;  3VQ5 A;  1BCM A;  3QO9 A;  3KK1 A;  3M8S A;  4F2R A;  4FM1 A;  3OYA A;  4IBN A;  3NF9 A;  1C1C A;  3HP6 A;  4E7K A;  1DLO A;  4RW8 A;  1TK0 A;  1WSJ A;  4LSL A;  3DOK A;  4DFP A;  4DS4 A;  4KRE A;  1YTA A;  1S1W A;  2IS3 A;  2X78 A;  3KJV A;  3L3V A;  5CYQ A;  1HQU A;  1Z26 A;  4EZ6 A;  3AA5 X;  3VQ6 A;  1JXB A;  1RBU A;  3RRH A;  3QES A;  3AO2 A;  3V9Z A;  1JL1 A;  3ZT1 A;  2JGU A;  1F21 A;  3VQ8 A;  3QLH A;  1NOY A;  2KZZ A;  4CK1 A;  1QSY A;  3O3F A;  2I5J A;  1S1V A;  4JS5 A;  4CK3 A;  3VN5 A;  3RRG A;  1BQM A;  4Q5V A;  3HYF A;  2G8I A;  3V81 A;  4B8C A;  2JLE A;  3C95 A;  3MEC A;  3AVL A;  1J53 A;  1VSM A;  3DLR A;  3K57 A;  2Z1G A;  3M8Q A;  5KGX A;  1JLC A;  3CFP A;  2DFF A;  2ZQB A;  1WSI A;  3KLH A;  4TSX A;  1IH7 A;  2Y1I A;  3TAE A;  1XHX A;  1TKD A;  3WNG A;  4C8O A;  3LAN A;  3TAB A;  1L3V A;  4FLY A;  3LWM A;  3AA3 A;  1U04 A;  1S6Q A;  1LV5 A;  3HST B;  3ZT2 A;  1KRP A;  4CEO A;  3SJJ A;  5KRS A;  4BDZ A;  1C6V A;  1QE1 A;  2HND A;  1BIU A;  4KHY A;  3QER A;  2QKK A;  2AJQ A;  4FZY A;  1BIZ A;  1XWL A;  4CES A;  4J2D A;  4Y1C A;  4FYD A;  2RPI A;  4CF8 A;  1RT6 A;  1I3A A;  4KB1 A;  5CZ2 A;  4DU3 A;  4H4O A;  4DTJ A;  2OPS A;  3D0P A;  1MU2 A;  3AVK A;  2P5O A;  3VA0 A;  4F4K A;  1LWE A;  1VSL A;  3DLE A;  1UWB A;  4NYN A;  2XO7 A;  4DTU A;  2XY6 A;  3KLI A;  3SUO A;  3O3G A;  4CIF A;  3H08 A;  3S3N A;  2OPR A;  1J54 A;  1L3T A;  4K8X A;  3HJF A;  4IFV A;  3SQ0 A;  2QK9 A;  3RMD A;  1SL0 A;  1RT7 A;  1RNH A;  4OPK A;  3BGR A;  2P1J A;  1JLB A;  1I39 A;  4BE2 A;  3RR7 A;  3VQP A;  2PZS A;  1QS4 A;  3V9U A;  1JLA A;  3IS9 A;  1JXE A;  3NFA A;  1SKR A;  4CHN A;  4FLW A;  1HNV A;  3DRP A;  3KK3 A;  4KTZ A;  3LPU A;  2HHU A;  3HPG A;  4CHP A;  4CHQ A;  1VSI A;  4CJ5 A;  4BDY A;  4KAZ A;  4UQG A;  1ZBF A;  2YKN A;  1RBV A;  1WN7 A;  2E6M A;  4LSN A;  3OS0 A;  4JLH A;  4YNQ A;  1LWF A;  4FJ5 A;  1J9A A;  1LAW A;  1RDB A;  5KI6 A;  4FJM A;  3RMA A;  4OLB A;  1ITG A;  3L3U A;  4I7F A;  1IG9 A;  2HVH A;  1N5Y A;  1L5U A;  2XY7 A;  4FJH A;  3DRS A;  4G1Q A;  4DF8 A;  3OY9 A;  1RT1 A;  2IDO A;  4B9V A;  1HYZ A;  2HHS A;  1WAF A;  4CGF A;  2LSN A;  1KFS A;  4O44 A;  1WSF A;  3K5M A;  4C8N A;  4FLU A;  1S5J A;  4ELT A;  4M42 A;  3QEP A;  2FC0 A;  3CG7 A;  3HM9 A;  4KV8 A;  1XI1 A;  2D0A A;  5KRT A;  4FM0 A;  2PYJ A;  2F8T A;  4CJW A;  4CEQ A;  1B9D A;  2FBX A;  3KTQ A;  3V9W A;  3LZI A;  4C8M A;  1HPZ A;  4ZTJ A;  4IG0 A;  4AHU A;  1HJR A;  4E1M A;  1Q8I A;  4CF9 A;  4LD0 A;  1RT4 A;  3ASM A;  3KIO A;  1FK9 A;  4E7H A;  4NCB A;  1SL2 A;  4DLE A;  4FM2 A;  4OKE A;  4I2Q A;  4CE9 A;  4DTM A;  4B9T A;  1S1X A;  3SCX A;  4EZ9 A;  1TL3 A;  4CJS A;  2A1R A;  2GUI A;  2D0C A;  1D9F A;  1YT3 A;  2YV0 X;  4C8K A;  4DMN A;  3ZT4 A;  3ALY A;  5HLF A;  5J2P A;  2RN2 A;  2ITG A;  3S3O A;  1KSP A;  4B9M A;  3KKR A;  4FLX A;  4AIL C;  2G8U A;  1BI4 A;  4E3S A;  4KPY A;  3NBP A;  2DFH A;  3AO5 A;  5E41 A;  4KHW A;  1RBS A;  1S6P A;  2YKM A;  3JSM A;  3NHG A;  3QEW A;  2XY5 A;  4Z4F A;  3AVN A;  4RW6 A;  1TAU A;  1G15 A;  3NGY A;  1UA0 A;  2Z1J A;  4W5O A;  4J2B A;  3IG1 A;  4FLT A;  3RR8 A;  1NKC A;  2O4G A;  3QEX A;  3K59 A;  5HRP A;  4DU4 A;  3LP2 A;  3PO4 A;  5HRS A;  4Y1D A;  1KVA A;  3O3H A;  1KFD A;  4HUG A;  4N5S A;  1X9S A;  2RKI A;  4CFD A;  1SUQ A;  4BAC A;  1NK7 A;  2EHG A;  1NK9 A;  2BDP A;  3QEV A;  3LP1 A;  3V9S A;  1ASU A;  3NH1 A;  3LWL A;  1U45 A;  3LAL A;  1BI4 B;  3VQQ A;  3OYN A;  1X1P A;  3F73 A;  3HO1 A;  3RMB A;  2Y1J A;  1EET A;  2X74 A;  3QIO A;  3MEG A;  1TAQ A;  1K6Y A;  4FJ7 A;  4CK2 A;  3PV8 A;  1RT3 A;  3WNF A;  3OYF A;  1IKX A;  4M45 A;  4DG1 A;  3WNE A;  4CEF A;  2XHB A;  3AVM A;  5SZT A;  4CF0 A;  4GMJ B;  4CGI A;  2ETJ A;  5KGW A;  4DTS A;  4AH9 A;  5HP1 A;  2OYQ A;  1LW2 A;  4KHS A;  3NCI A;  3NAE A;  3TAF A;  1NKE A;  1X9M A;  1VSJ A;  4CEC A;  1T7P A;  3QET A;  4KI6 A;  2VG5 A;  3A2F A;  3U3G A;  4YFU A;  3K5N A;  3AVI A;  4Z4G A;  2D0B A;  1FXX A;  3OVN A;  2KFN A;  1HYV A;  4CGH A;  4B3O A;  3QIP A;  4W5T A;  1FKO A;  1TKT A;  4DSK A;  1HYS A;  2XY8 A;  1LW0 A;  3I8D A;  3U6F A;  4F2S A;  4DTO A;  1VSK A;  3AVH A;  3LPT A;  3KD5 E;  1WSH A;  4DQP A;  1A5X A;  3AVG A;  4DWI A;  3CFR A;  2KTQ A;  4DF4 A;  2F96 A;  4KI4 A;  4FJ9 A;  4FXD A;  3RTV A;  1T03 A;  2HVI A;  3SV3 A;  4FJI A;  1QSL A;  1BIS A;  1TGO A;  2EX3 A;  1RDA A;  3P83 D;  4CED A;  4ZTF A;  3HXM A;  2WON A;  2HHW A;  3KKS A;  3CQ8 A;  4M3T A;  5CYM A;  4OVL A;  4HVJ A;  1WSG A;  4CJR A;  3VQA A;  1NOZ A;  1Z25 A;  4BWM A;  4DS5 A;  3OS2 A;  2W42 A;  3DLB A;  3HK2 A;  1TK5 A;  1JKH A;  1RTH A;  3KLG A;  4L8R B;  1EXQ A;  3DM2 A;  4J2A A;  1CLQ A;  1GOC A;  1QQC A;  4QCL A;  1D8Y A;  2IAJ A;  1C0M A;  3AO1 A;  3O4N A;  4O4G A;  4W5R A;  5SWM A;  5FDL A;  3LZJ A;  1WAJ A;  4F3T A;  4DU1 A;  1CXU A;  3DMJ A;  2P51 A;  1C1A A;  1IKY A;  4M3R A;  5FRM A;  5D3G A;  1EX4 A;  3U3Y A;  3SZ2 A;  1Q9X A;  3LDS A;  1WLJ A;  3HVT A;  4FLZ A;  4CEB A;  3DI6 A;  5JS1 A;  5CZ1 A;  4E89 A;  4W5N A;  3VQB A;  3P1G A;  1VRU A;  4I9Q A;  1O1W A;  3L2R A;  3SPZ A;  1VK0 A;  1Y97 A;  2RF2 A;  3TAQ A;  4FK4 A;  3NDK A;  5KTQ A;  1IKW A;  3LAK A;  4DSF A;  3ZT0 A;  1NJX A;  3AO4 A;  4E0D A;  5HBM A;  1VRT A;  3OYI A;  3OYG A;  4HUF A;  4DTR A;  4PWD A;  1T05 A;  1RTI A;  1BL3 A;  4IDK A;  4Z0U A;  4CER A;  3K58 A;  4BE1 A;  3AVC A;  2HMI A;  4FK2 A;  4M3X A;  2IGI A;  2F8S A;  1RDD A;  5HRR A;  4JRP A;  3TAR A;  2HNZ A;  4FVM A;  3K5O A;  4N56 A;  4IKF A;  1BGX T;  3HPH A;  3AO3 A;  3L8B A;  3VA3 A;  4Z4E A;  2OPQ A;  1BHL A;  2VWK A;  4Z4I A;  2DY4 A;  2ZE2 A;  3AVA A;  1QTM A;  3SUN A;  1HMV A;  1TKX A;  3SI6 A;  1JLE A;  3SUQ A;  2FBV A;  4CF2 A;  4BDP A;  3NH0 A;  1L3U A;  1FKP A;  1SV5 A;  1JLF A;  4OLA A;  1KTQ A;  4N76 A;  5HRN A;  4DSI A;  1U4B A;  4DQQ A;  1TV6 A;  4FLV A;  4LH5 A;  3D45 A;  4M3Y A;  4GVM A;  2FBT A;  4DSL A;  4OPJ A;  1KLM A;  3T19 A;  3HVR A;  1IKV A;  4FW2 A;  3T1A A;  4DQR A;  1C0T A;  4FJX A;  3TAN A;  3S9H A;  2B5J A;  3CYM A;  4IG3 A;  4OGC A;  5J2N A;  4ELU A;  1ASW A;  4NCG A;  1JLQ A;  1RT2 A;  2Z1H A;  1U47 A;  1QSS A;  3DLH A;  1EKE A;  2ATQ A;  2QXF A;  2B6A A;  4KO0 A;  3PY8 A;  4GW6 A;  3L2U A;  5J2M A;  3G10 A;  2YNI A;  3EYZ A;  3UIQ A;  1RTJ A;  4XIU A;  4EP5 A;  4JRQ A;  1KLN A;  3PX6 A;  4EP4 A;  3QNN A;  3PX4 A;  1RT5 A;  4CJT A;  3PO5 A;  3G0Z A;  4KHQ A;  3P5J A;  1TL1 A;  4M41 A;  3VQE A;  3OJU A;  3ZSQ A;  1VSE A;  2VG7 A;  3OJS A;  4CJF A;  3S3M A;  1YTU A;  4KB0 A;  4RW9 A;  4FJ8 A;  4DTX A;  1RBR A;  4KFB A;  1SKS A;  3PUF A;  3VQ4 A;  4BE0 A;  4BWJ A;  2OPP A;  3SPY A;  1X9W A;  1L3S A;  3ISN C;  3KLE A;  1DTT A;  3DLG A;  4E7L A;  2HHT A;  1BCO A;  1WNS A;  2E4L A;  4RG8 A;  1Q9Y A;  4ELV A;  3CM6 A;  3F9K A;  1QHT A;  2YNF A;  2ZD1 A;  5FRO A;  4CJE A;  2KFZ A;  2G8F A;  4KKO A;  3C94 A;  4AHS A;  1LAV A;  4H8K A;  3ZSV A;  2PYL A;  5HRO A;  1UA1 A;  4M3U A;  1HNI A;  1JLG A;  2VG6 A;  4CJU A;  1NK8 A;  4DQS A;  3LP3 A;  4Z4H A;  3RMC A;  2X6S A;  5C25 A;  4PQU A;  3ZSW A;  1RBT A;  4DQI A;  3B6O A;  4KHN A;  2BGG A;  3I0R A;  1NK0 A;  1RDC A;  1CZ9 A;  3C6U A;  1B92 A;  1JL2 A;  4FW1 A;  4CJK A;  3RWU A;  3M8P A;  1KVC A;  1ZBI A;  1HRH A;  1WSE A;  4JS4 A;  3M8R A;  3ITH A;  3V1O A;  1ZBU A;  3OYC A;  4DFJ A;  3SUP A;  3KLF A;  4KTQ A;  4HUE A;  3DRR A;  3TWH A;  4FZZ A;  1LWC A;  1NJY A;  3AVJ A;  3I0S A;  3TR8 A;  2DTU A;  2HHQ A;  2X6N A;  1KVB A;  5I3U A;  2HHX A;  2IOC A;  2DFE A;  4CGD A;  1TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...