2WBNA

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
178
structure length
178
Chain Sequence
VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TERMINASE LARGE SUBUNIT
publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
source organism Bacillus phage spp1
total genus 48
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wbnA00
2WBNA 2WC9A 4DKWA
chains in the Genus database with same CATH superfamily
1C0TA 4JI7K 4BRHA 1T6CA 4FWPA 4GNIA 3G71N 4CEBA 2GEMA 3P38A 3H6EA 3WUHA 2UUAK 2CGJA 4CK1A 4WF9L 1VQ9N 1W97L 3QNOA 3HOTA 4JAXA 4BRIA 3D6RA 4IFEA 3UKRA 3DMJA 4CJVA 3ENOA 1VSJA 1YJWN 2B5JA 2YKNA 5JICA 2NRRA 1KFSA 4LF6K 5EXWA 3HZ6A 1JXBA 3QINA 4RW6A 3VQQA 4IEEA 1VSIA 1SL0A 2Q2RA 3OS1A 3EY1A 1KCFA 1CXQA 3D7EO 4FWLA 1TK8A 4KHQA 1HNVA 2VG6A 3QEIA 3V1QA 1NJIO 3N4QA 3CHWA 1M1KO 5AZJB 3THVA 5AZJA 1N34K 4DQRA 3NHGA 4A2AA 3VEYA 3UIQA 3VTIA 3SLCA 3K5NA 1WSGA 4CF9A 2OYQA 5ELZA 2P5GA 2VGNA 2IAJA 1BA0A 3K5MA 1LV5A 4KKOA 1S5JA 4LF8K 2P1JA 3ENHA 5AFUH 4CZMA 4AH9A 3LDOA 3SUOA 2QEXN 2P9SB 2YKMA 3KLGA 1REVA 3FZHA 3LP0A 5GAEP 3TANA 4DS4A 4J2AA 1KLMA 3HRGA 3S41A 4BR9A 1Q81O 1YTUA 3P31A 5EOYA 4F3OA 1SQKA 5EU7A 2JGUA 5I3UA 4FJ7A 1HKBA 1BGXT 2X6SA 2DY4A 2KKZA 4U67L 1VQ8N 3CM5A 1BWFO 4J8FA 4KAZA 4FOIA 3AV9A 2G8UA 4FOEA 4B1WB 4CHQA 4JRPA 2E1YA 4FVMA 5CZ1A 3VQEA 4K43A 4JI4K 3VQDA 1U04A 3OYAA 3NF7A 3MWTA 1SL1A 4JLHA 3QETA 4PWDA 1HJRA 4B3OA 1CXUA 4OKKA 3VERA 4ILHA 3FR0A 1NK6A 4JS5A 4BQZA 4YOYA 4DF8A 3VEWA 4FWRA 1LOTB 5AQWA 1L5UA 4OPJA 3UB5A 4DS5A 1UA1A 1DT9A 2HNYA 1EQYA 1VQ6N 4G9ZA 2IGIA 3LM2A 2YHBA 3O4QA 4M3RA 3TTFA 1ATRA 2PBDA 3WNGA 1NK0A 4RW9A 4CIFA 3HTVA 3ENBA 4B3SK 3CQYA 2HW3A 2HBKA 3NH1A 5AQFA 4GV3A 5GADP 2QWRA 4DU3A 3K58A 3RVCA 4DV4K 1SKWA 2QWQA 4WYBA 3MN6A 3L2UA 4IDHA 4A2BA 3SAHA 3AA2A 4W5NA 3AVBA 4F3TA 3T19A 4ILGB 3HO1A 1NK9A 2VWKA 1HPZA 1V4TA 4KI4A 3J81O 4IO9L 1P90A 4CHPA 3F73A 2BE2A 1VSEA 1S6QA 5BN8A 3CJBA 3EEQA 4YNQA 3K57A 4FLXA 3OHRA 3A5MC 2GWKA 3THXB 4B3TK 3SV4A 4PUOA 4NLBA 1Q86O 4CJRA 3D2FB 4GVMA 2ZD1A 3THXA 3DXMB 1RDUA 1YUWA 3LP3A 4FPAA 3WNEA 4H03B 4BRGA 3TAGA 4L3QA 2O8CB 4DB3A 3C95A 1OKJA 3ULDA 5KPTA 3LDNA 1VQKN 2O8CA 3AO2A 4DKWA 3AVNA 2R7YA 1M90O 2XY8A 1NGFA 4J2BA 4CJ7A 1Z6RA 1TUUA 4WQ5C 1J6ZA 1Q9YA 4BGBA 1VRUA 4UQGA 1OH7A 3R1XA 2AJQA 1U2VB 1KVAA 1EWRA 4EHUA 3VENA 2WONA 4M42A 1BISA 3I55N 3FLCO 1U2VA 3U3GA 3QBXA 1JJ2M 4BDPA 1F21A 2OZMA 2D0AA 1JL1A 4CK3A 4EFHA 3O8MA 3PSIA 1LW2A 3TABA 4E19A 3GOIA 3C7NB 4I2QA 1S1VA 4BR7A 1A5WA 3AO4A 3HVRA 1BO5O 3L2RA 3C7NA 1ATSA 4M63C 2P9KB 4FZYA 4M45A 1WBBA 3P5JA 2HBLA 2P9KA 1JKHA 4R5PA 2Z1HA 3AGRA 3QEWA 3IG1A 4IG0A 4O55A 4CIEA 4BRNA 1B9FA 1NMDA 5BR8K 3AO3A 2F9TA 2F9WA 3LM9A 3CPEA 3KK2A 3MN9A 1D9FA 3IRXA 2YHXA 1BOTO 3V81A 3HSCA 2VGMA 3AVJA 3CCLN 1YI2N 1BI4A 2RPIA 3FZFA 5AQSA 5J2NA 3OS0A 4N76A 4CGDA 2Q31A 3IS9A 1NM1A 3MX5A 4C1NI 3N4PA 3SK3A 4JHDB 3LWMA 2G8VA 4DTMA 1IKVA 3HK2A 1T44A 2QWOA 3HBTA 3R6MA 1MWMA 2PYLA 3O9QA 5M1QA 4KREA 3TSQA 4DSLA 1ZBHA 4DSIA 2BGGA 2UXDK 4B9NA 2IOCA 4LC9B 2O8DA 1RTHA 2FSKA 3ISNC 2HNZA 4DLGA 1S1UA 3C94A 3V4IA 4EZ6A 4Q0BA 2E5LK 1GOCA 1C1CA 2GV9A 3NDKA 3ZSYA 3LDQA 2IVNA 4GW6A 5IWAK 3AA3A 3PX4A 1Z05A 2G8IA 3AVGA 4CZHA 3FZLA 5HROA 1S1WA 4FW1A 3CFRA 4PL7A 4DV5K 2IVOA 1LAWA 2P51A 2V52B 3MWPA 2KTQA 1FW6A 1R59O 1GOAA 2QK9A 4NXMK 1U49A 2O8FA 3MMVA 1KXPA 1A5VA 3L0QA 1YF5L 4PL8A 2E20A 1Q9XA 3OYEA 1NGBA 2NLXA 2QI2A 5AQRA 3KK1A 3WQUA 5BPMA 5AQLA 4FLVA 3J7YP 1JLGA 5FPDA 4DU4A 1QE1A 4O0IA 1BHLA 1HNXK 4F4KA 3LP1A 4E7LA 3ZSRA 4A62A 4CZFA 4JI8K 3THYB 4N41A 3NBPA 4DTPA 4PY5A 3BDPA 4CJSA 2WC9A 4FWQA 3THYA 2G8KA 3NF8A 1XWLA 5AQQA 3F2KA 3G4SN 4DR5K 4FJGA 1NGDA 1VSFA 2QWNA 4O5FA 1XUPO 5HRSA 1WAJA 3K5OA 2BTFA 3O5BA 3I8DA 4DR6K 2J4RA 1RT7A 2OPSA 4AHVA 2QWLA 3M6GA 1E3MA 3THWA 3E01A 3ZT1A 4AM7A 4CJUA 1IKWA 1O13A 4ELVA 1X3MA 4QOZB 3SNNA 2IS3A 4B1UB 1NGJA 2IC3A 3BGRA 3WEEB 5C42A 4F2RA 3NF9A 4B9TA 5FPMA 1S9GA 3CYMA 4XEIA 1A5XA 4CEQA 1LWFA 4DTOA 4AHUA 3TI0A 3BY5A 4DF4A 3VGKA 1HYZA 1LWEA 5C2FA 4U7BA 4DV3K 3HXMA 1WNSA 1Q82O 4H0OA 2YNGA 4I7FA 2O8BB 1ZBFA 4CJ4A 4B9MA 4EAHD 3EKUA 4BRQA 2O8BA 3MCPA 3P1GA 2VYPA 4KH6A 4FCYA 5J2MA 1J5EK 3ZSVA 4O5BA 1QSYA 4CZEA 2KZZA 1LW0A 1T6DA 2YNHA 4JKCA 1T8EA 3EKSA 2P9LB 2QA4N 5J2QA 3OJSA 3WNFA 5JLFA 1XQSC 2H3GX 5KGXA 4H5NA 1RTJA 1D4XA 1TL3A 1EP4A 4JRQA 2A41A 4CW7B 5A2QO 2X74A 1JLQA 4ZTFA 4JI2K 3VEXA 3ID6A 2ASMA 4FWKA 4DV0K 2D5RA 4RTFD 3DRRA 4BROA 3L2QA 4CZJA 5BREA 3KWGA 4BE1A 4CEEA 3L2WA 3CCSN 4JI3K 3RSEB 3LDLA 1WOQA 4JKFA 2E6MA 4FJJA 4CF1A 2FSNA 3TAEA 4M3WA 3L3UA 3WXLA 2P5OA 4NCBA 3O6WA 1QHAA 5AFUA 1IKYA 4BRLA 5DK5A 3VQ6A 2F4VK 4CK2A 1MA9B 3ATUA 2FBXA 2KW4A 1EO1A 3LZIA 4E7KA 3ZX3A 4ELTA 4HUEA 4BDYA 4OVLA 4BGAA 3SQ4A 4FK0A 1WSFA 1SZ2A 4W5TA 4BR5A 2OTLN 1IJJA 4IO8A 4BE0A 2D4WA 3NGIA 3IDHA 4CJEA 3V6DA 3DYAA 1T7PA 1ITGA 2FLOA 3TAPA 3KD5E 1JLAA 4BC5A 4DFMA 3SZ2A 1IKXA 5JMVA 2W6KA 1V4SA 2E4LA 5SZTA 4GVEA 1ZBIA 2Q1NA 1XC9A 3DLLL 3V9WA 1U47A 1C6VA 4CEDA 2XRIA 3UKRB 3LALA 5GAHP 1OH6A 2HMIA 4L8RB 4CFBA 1LAVA 1RBTA 4CJPA 2GUPA 4BVPA 3M8QA 4KH5A 3ZX2A 2BH1A 3CC7N 3LDSA 4OLAA 1ZBUA 4IKFA 4FLZA 3AVCA 1RCHA 2HBJA 3TAMA 3M8PA 3HP6A 2JWKA 3HPOA 1IBKK 4JKBA 4IDKA 1QSLA 1OH5A 2GX9A 3R8EA 2GWJA 4PKHA 4DTUA 1RDBA 2VWBA 4AHSA 4EZ9A 4A61A 3BEXA 1NBWA 1QS4A 4B1ZA 1TAQA 1KTQA 4RW7A 3UKUB 5KRSA 4BC2A 4CJLA 2YNIA 4QS8A 3P83D 1YT3A 3UKUA 1YJ9N 5F1XA 4X62K 4GKJK 4R79A 4CF2A 4JEPA 4M3XA 3DJCA 3L3VA 4YOXA 5AQGA 3CERA 1BIUA 5KQ8A 2G8FA 3CI5A 4K41A 1GLBG 3L8BA 1T03A 3JSMA 1HLUA 1QZ5A 1Y64A 3O3HA 4YORA 3J7AP 2Z1IA 1JLBA 2IVPA 3AARA 3OVNA 4DTNA 3R3LA 4MO4A 3KLHA 3SQ2A 1VHXA 3VOVA 4DTSA 1VQ7N 4B1VA 3MK6A 3KLEA 4NCGA 1YVUA 5EX5A 4OX9K 3L2VA 1U48A 1R0AA 3TWHA 1J53A 4CJTA 3PLAA 2FF6A 4CHNA 2WOMA 1EWQA 1VQNN 3Q7BA 2XY5A 3WXIA 4M41A 3CIPA 1BIZA 1W0HA 4KH4A 2DFEA 5BRHA 4JI1K 1YVNA 4JKAA 4DU1A 4B9VA 2I7NA 2QM1A 4H4MA 4Y0WA 4CHZA 3CCRN 3HSTB 2WTUA 4MFBA 1BCMA 3T1HK 2PFUA 4FJMA 5BR9A 1L3VA 2NRHA 2D0PA 3HI0A 3SJHA 3V9XA 4YOUA 2HHUA 4BRDA 2WFBA 2HOEA 3ZEUA 4FZZA 3VQPA 1HYSA 1IG8A 3MXJA 2O4IA 4B9LA 1VQLN 4KBOA 2QTDA 3VA3A 3BZKA 3O9UA 1U4BA 4AF1A 1RBRA 3H3NO 3FFKB 1JLFA 3O1WA 3ITHA 5F2RA 2FSJA 3RRGA 4A5BA 1Q8IA 3L4IA 5LY3A 1RTDA 3ZSZA 2HF3A 1HQUA 1RT1A 2O8EA 2A1RA 5JS2A 1WSHA 3A8YA 3HJFA 3OYBA 2XHBA 4YY3K 3FZMA 4JK8A 1TKZA 1D5AA 4BQLA 1NK4A 3JAMO 4B08A 2YX6A 3VTHA 2HHTA 2KQ2A 5JLHA 3HP9A 1YXQA 3PY8A 4X65K 4GV9A 1NU0A 4B9QA 1TVRA 2NNWA 3E9PA 3O9SA 4Z94A 4BACA 1X9JA 3DXKA 4I9LA 4B1XB 4DV2K 3L4QA 3NVMA 2DPNA 1K6YA 3CC2N 1WUAA 2X6NA 5AQZA 1X9MA 3LAMA 3ZYYX 1ZBLA 1N33K 3GG4A 3J80O 2UUCK 3ZLJA 2RE2A 1RT4A 3DWLA 1ILYA 4G1QA 4BRAA 2DFHA 3AGKA 3EE9A 3AVIA 3H1VX 2QW9A 1K73O 3QLHA 1WLJA 4KB0A 1J54A 5D3GA 1J5OA 2G8WA 4FK4A 5KPRA 1RDDA 2LSNA 3O4NA 3O3GA 2NUBA 3AVAA 3VEOA 1QVFM 3AY9A 3GL1A 4IFVA 2YCHA 4QAGA 4IZ9A 4OPAA 1HUXA 3FE1A 5JVGL 3SUNA 1RFQA 3QERA 4ELUA 4NLCA 1GLAG 3VMFB 1LCUA 4PHTX 3OYGA 2VG7A 4V19S 2E2PA 3RR8A 3OYNA 4PKGA 3MXMA 1CZ9A 5TKYA 3EZWA 3ZSQA 1S9EA 3DM2A 4FWSA 3FZKA 3UE5A 1U45A 2D1KA 2P9UA 5DMRA 1MWKA 1NJYA 3CCUN 2P9PB 3I8BA 2KFZA 1GLCG 1BDGA 5LJWA 3T69A 2P9PA 1VK0A 2YJFA 3CCJN 1NG9A 2GELA 4H5VA 3KLFA 1TKXA 3FGUA 4WQ4A 3V1OA 1RBUA 1WB9A 5DM7L 4FWOA 4H8KA 4AHTA 4OPHA 5BN9A 3CCMN 1W7AA 3VGLA 1S3XA 3CPWM 4B1YB 4KHWA 1N6QA 3V9ZA 4CGGA 1Z26A 4CBUA 4HVJA 2A42A 4FM0A 4MLEA 4LSNA 4ISEA 1G99A 3ZT4A 1BI4B 1WAFA 4CFCA 4Z4IA 3LPUA 1VSDA 3RMBA 2ZE2A 2A1SA 3PIOL 4FLUA 1NKCA 3MCAB 4DV1K 3NGZA 4DR1K 3AAPA 1NJZA 3EE8A 2FXUA 4YOVA 3KKSA 3ZT0A 5E41A 3OW2M 4IOXA 4C23A 1VQ4N 4O8UA 4JI5K 3TSPA 1KRPA 4CF8A 5C0YA 1QQMA 4WQ4C 5CR4A 2OCEA 5AQPA 1BUPA 2VCPA 4BR0A 1FXXA 4YHHK 4ZTJA 1XMOK 4H0PA 1HYVA 2O8DB 1EXQA 4MDBA 3L6QA 1RT3A 3MEGA 4FW2A 3VETA 4UY8O 1JXEA 3V9SA 2CH6A 3SI6A 5JS1A 2CGKA 3OYIA 2HHXA 3T3FA 1EKEA 3SPYA 3FFIA 3OS2A 2RKIA 4FPBA 4CVNE 3B6PA 5HBMA 4FJ8A 4X66K 5T7BA 1S6PA 3RR7A 1HR0K 1NKBA 4IXCA 2HHQA 4JD2A 1HNIA 5AR0A 4E7IA 4DMNA 4EIAA 4AHCA 1JLCA 3OYLA 4FWMA 2E2QA 2IDOA 5SWMA 3EL2A 4JK9A 5CZ2A 4JI0K 3T1AA 3D45A 2DFFA 2VQEK 3OYDA 4Z0UA 1C0GA 1L3UA 4CI6A 3CJ7A 4K25A 2O8FB 4ISFA 3MEDA 4DUZK 4CJWA 4A59A 1C0FA 4DV6K 1QTMA 1XMQK 2UXBK 4DHYA 1JCFA 2DTUA 5H1SQ 1TKTA 4KFBA 3VF2A 1HRHA 3G0ZA 2NRWA 2EWSA 5LL6Z 3TR8A 5EVZA 1KAZA 1KAYA 2O4GA 5LMNK 1CLQA 4BVOA 3CQ8A 4C8OA 5CY4A 4JS4A 2CH5A 2FBTA 2YV0X 2YNFA 3WNHA 4DLEA 5KGWA 4CBWA 3C6HA 4LH4A 1N36K 4BR4A 1ZYQA 1H1VA 3OYJA 5HRNA 1KAXA 4JKEA 4RWTA 1W2BM 1Z25A 4CFAA 1NGHA 2ZGZA 1N8RO 4DWIA 5HLFA 4A57A 4BRCA 4NYNA 3VQ4A 1GLDG 1TK5A 3RTVA 5HL7L 4OKJA 4N5SA 4HUFA 1NGAA 2GBZA 3HL8A 2V7ZA 1NGEA 4FVUA 2KZMA 3A5LC 4H0YB 5CYQA 3O80A 4YDUA 3B8AX 4FK2A 1HX1A 3ZETB 4FJLA 3THWB 3VF6A 1QQCA 2E1ZA 1IBMK 1G15A 3WT0A 4JKGA 3ZETA 4BR2A 4M3TA 4KTWA 4MO5A 3IUCA 5FRMA 1K8KA 1VQ5N 2V51B 5BPNA 1NKEA 4XH5A 1SUQA 1DGKN 2E8AA 4BE2A 4CGFA 4CECA 1DKGD 4B9SA 3NH0A 2ETJA 4WE1A 2I7PA 3PSFA 4QS9A 2A3ZA 5K14A 4HHTA 3QDKA 3SCXA 4JK7A 1OH8A 4E3SA 1TK0A 1C1AA 3G10A 3G6EN 2BUPA 5AQTA 1NJXA 1ESVA 1RDWX 1OVYA 1EX4A 3EZ5A 3DOLA 3QO9A 3VA0A 4N56A 3TAFA 5FLXO 1FK9A 4LFBK 3PO5A 2ZQBA 4BC4A 4CJFA 1W9HA 1SS6A 4RG8A 5GIPA 3CJAA 4YOWA 4AILC 4IWVA 3DRSA 4LF4K 5ADXH 4BDZA 4CGHA 1DLOA 4CZLA 3C6UA 3QFUA 4K42A 4B3RK 3DLRA 4KHPK 2PZSA 5CYMA 1NK5A 4FJIA 3CCEN 1QQNA 1SAZA 4HTUA 3U8XA 1KSPA 3RRHA 2QWMA 1WSJA 3CM6A 5I42A 4CJ3A 1NK7A 2NRTA 3WQTA 4M3UA 5KPZA 1KVCA 3VEVA 3AVFA 3LP2A 4XH4A 1Y97A 4CEAA 1UWBA 4BWMA 3QBWA 3DLEA 1KLNA 4IFYA 4DQSA 3F5TA 3M3ZA 3ALYA 2FC0A 3DLKA 4FXDA 5I9EB 4HTLA 3KKRA 3CJ1A 2E6LA 1DEJA 5AZIB 4BREA 5FPNA 2A5XA 3HM8A 3K5LA 2CGLA 5AZIA 1NJWA 5AQJA 4JNEA 4IOAL 1NWKA 3W0LA 1JL2A 4DQIA 5J1EA 3M8SA 3AVLA 4H5WA 4O4GA 1QSSA 2RHKA 4FM2A 1VSMA 4KHYA 2A40A 5M1OA 4GKKK 1MU2A 3B6OA 1HKCA 4ID1A 4BC3A 4LSLA 3TARA 4MDAA 4HUGA 3QNNA 3DLHA 3KVGA 3BUZB 1RILA 4LH5A 4FLWA 3O3FA 2YHAA 3KZBA 4CHOA 2ZJPL 4C8MA 3VQ7A 4CZGA 4BRMA 2B4JA 3C65A 4E1MA 4DFJA 5FRNA 3WXMB 1IG9A 2YJEA 4KO0A 3CC4N 5FDLA 4CZKA 3HT3A 4FM1A 3KD1E 1X3NA 3OYMA 2HHHK 2HSTA 3SMSA 1S1TA 3NFAA 5AQMA 2OPPA 4FJKA 1L3TA 5LJVA 4YFUA 4I2PA 1HPMA 5HP1A 1ASUA 1GLEG 4KB1A 3CFPA 4NXNK 4F9OA 1CZBA 1XHXA 1VQON 2ZGYA 4DFPA 4C1NK 3M1FA 3TTCA 4Z4EA 1UOCA 1U6ZA 4RW4A 2QKBA 2OPRA 2F8TA 1P8ZA 1E4FT 3HOSA 1ZXOA 4M7YA 3DLBA 2QWPA 1ASVA 3O4WA 4O44A 3QMLA 1BCOA 5AQUA 3SAFA 3NE6A 4LFCK 3CCVN 2AP1A 4MQ3A 2OZSA 4M3ZA 4TSXA 3E66A 4WFNL 5GINA 3VQ9A 1VSKA 2A6AA 3IKMA 3I0SA 4JKDA 3NCIA 3KWIA 3CJCA 4ISGA 4B3MK 4C8LA 5C25A 3SQ1A 3A2FA 3NGYA 4KPYA 4AHRA 4FO0A 3SUQA 1NMNA 3H3OB 3U4LA 2UXCK 1X9SA 1IV0A 3QIPA 4FYDA 4JV5K 4Z4CA 3Q7CA 2FBVA 4JN4A 1D8YA 1DTTA 1VQMN 4GY2B 3O1BA 3VGMA 1N5YA 4A5AA 2F8SA 4Z4GA 3HVTA 5KRTA 1QQOA 4IOCL 4I9QA 4H0VB 2Y1JA 4DV7K 1TAUA 4BG9A 2W6LA 5C24A 4XIUA 1NGIA 4E7HA 3T7ZA 2P9SA 1C0MA 3KTQA 4IBNA 1WBDA 2V7YA 2OPQA 3IFRA 4FZXC 4C8KA 1KD1O 3I56N 3MN7A 4RW8A 3VQCA 5C10A 4FJHA 1JCGA 1FKPA 3SJJA 4PA1A 1JLEA 3QICA 4B9UA 3U3YA 4DQPA 2Z1GA 3MDQA 1VQPN 3U9ZA 4IG3A 2XY6A 1O1WA 1NOYA 1TKDA 2PYJA 1HQEA 2FF3B 3JS6A 5LMUK 1GLLO 3ZEUB 4CIGA 5KQDA 3SPZA 5C12A 3CQXA 3EO3A 2ITGA 2VQFK 3VF4A 4JI6K 1RGIA 3GE1A 3F9MA 3VN5A 3OYKA 4OKEA 1YHQN 2E2NA 4BRFA 3LWLA 3DAWA 1KQSM 3CETA 4DTRA 5AJ3K 2UYTA 3C6TA 2RF2A 4IJNA 2O8EB 3K0SA 3PX6A 4DR2K 2EX3A 4MLHA 4K0KK 1C0UA 3OYFA 4FLTA 1UAXA 2B6AA 3LZJA 1B9DA 1TGOA 1VSLA 1VRTA 3S3MA 2P9NB 3CMAN 3J8AA 3JYTA 2P9NA 3DXKB 1HNZK 3ZCMA 3CCQN 3OBWA 2OTJN 3TPQA 3LANA 2YI1A 5AQNA 4B8CA 5JVHL 4CHYA 3ATVA 3JXUA 4FJNA 2GUIA 2HNDA 4FJ9A 3QEXA 1ASWA 4LD0A 5IT9O 4H4OA 1I3AA 4CGJA 4DQQA 1LWCA 4KI6A 4JKHA 4C8NA 4H5TA 4Z4FA 3SBGA 2KFNA 1I94K 3ZT3A 4WQ5A 5HOOA 4AQYK 3V9UA 3GBTA 3HPHA 3O08A 1JCEA 4LF5K 3BP8A 4JYAK 4CJ5A 1YTAA 4XH1A 4J2DA 4QS7A 1VSHA 3RMCA 1BQNA 4GMJB 4DQ8A 5CHIA 2E88A 3VPZA 2PAVA 1VAZA 1B92A 4OGCA 3MAQA 3D2FA 4E1JA 1NOZA 3DXMA 1K9MO 4DTJA 3H45C 4YOTA 4DSJA 5E26A 4BWJA 4DR7K 4ID5A 3NF6A 1SL2A 3OJUA 4GV6A 5C15A 1E4GT 2XO7A 2P9UB 3ID8A 1SKSA 3QEPA 3NMUA 3SV3A 2NRVA 4FWNA 3SAGA 2NRZA 3OY9A 3S3OA 3OYHA 1BA1A 4M7XA 2KLAA 3K9JA 3WXKA 3OBYA 1RBSA 1ZBSA 2BANA 3CG7A 3O9RA 5AQIA 5AQOA 1RNHA 2OANA 4IEIA 4CD1A 2ZJQL 2F7TA 3A5OC 3K2PA 3AO1A 4BRPA 2IIRA 2ATQA 2F96A 3IAYA 2OA8A 1ATNA 4H0XB 3V1RA 3IMXA 1X9WA 1QHTA 3G25A 3HM9A 3O9TA 4CCHA 1J9AA 5B8HA 4OLBA 3ZSWA 3CD6N 1WN7A 3R9PA 3PV8A 1HNWK 4H5RA 2KHOA 3GDQA 3RMDA 1QZ6A 2EHGA 4DCHA 4M3YA 2Z1JA 1OVQA 4AM6A 3HYFA 4E0DA 3LAKA 3W3DA 3QIOA 2E2OA 3P39A 3VEZA 4CE9A 1XC3A 5KTQA 2WUSA 5KI6A 3ULEB 1IH7A 4EP4A 5AQVA 4DR3K 4CZIA 3C6AA 2D0CA 3A5NC 3ULEA 4DR4K 5GAGP 1MDUB 1GLJO 4CF0A 1IO2A 1RT5A 3KK7A 1NK8A 5E84A 1NGGA 4KV8A 1TUYA 5EY4A 1K8AO 2Q36A 3MX2A 5AQXA 4NCAA 1CZAN 5DM6L 1UA0A 3OA9A 1GLFO 4W5QA 3I33A 4K8XA 1BG3A 1RDAA 4JHDA 2D0OA 3F9KA 4LFAK 3SBTA 3T1YK 1RT6A 3DOKA 4JD2B 1S1XA 1HMVA 4BRKA 3QFPA 5TKWA 5CE3A 1N32K 5BRDA 4WFAL 4Z4HA 4HCCA 2W40A 3RWUA 1T3VA 3K9KA 4KRFA 3BZCA 2NZTA 3M5RA 1YIJN 3U6FA 3NAEA 5M1FA 3LDPA 3C0BA 4W5RA 1RT2A 4FJ5A 4KTZA 2UUBK 4X64K 1BQMA 4ICLA 3E9OA 4CEOA 2ITMA 2Q0RA 2Q0UA 2W41A 3KK3A 2HB5A 2HVHA 2ZF5O 4E89A 1L3SA 4OO1J 4E1NA 1TYQB 4F8RA 1XNQK 3ZT2A 1NNEA 2ZM6K 3DI6A 2HHVA 3ASMA 4EHTA 5ADXA 5FPEA 1TYQA 4I6MB 4DG1A 2HF4A 3P4IA 1T05A 4CEFA 1HKGA 4I6MA 4DSKA 4Y1CA 2QXLA 3SYZA 4CESA 3AVHA 2QXFA 3EN9A 4O8KA 2YHYA 1Q18A 1FKOA 3H08A 5BPLA 1YITN 2VG5A 4O0JA 4N47A 2ASPA 4K8ZA 5GIOA 1FJGK 1HJOA 3OYCA 1XI1A 4NO7A 2JLEA 1YJNN 3H46O 3ZSOA 5AQHA 1NGCA 3LL3A 3LPTA 3H1QA 3MEEA 4WFBL 4LY7A 4JKGB 4OPKA 2G8HA 1X1PA 5M1KA 5M1PA 1BU6O 2HBMA 3CJ9A 3RMAA 3EYZA 1RBVA 1K8KB 2RN2A 1DTQA 2P9IB 4HCBA 3I0RA 4DFKA 4DSFA 3OTOK 4E7JA 3PX0A 2P9IA 3PUFA 4FSVA 2Y1IA 1ZC6A 2HHSA 2PY5A 5C2DA 2HVIA 4DSEA 5F0XA 5FROA 2D0BA 3M8RA 3CXCM 2Q97A 1WSIA 2ASOA 3CMEN 4OJRA 5BRFA 2HMPA 3TAQA 4LF9K 2AA4A 2W42A 4J2EA 3TTDA 1Q7YO 4CFDA 3AVMA 3AA4A 2BDPA 3DLGA 4YDUC 3SMPA 4H0TB 3WEEA 3ZSXA 1S72N 1I39A 5MLCQ 3PO4A 1KFDA 4KHNA 3AO5A 1IBLK 4BY9C 4KHSA 3VQ8A 3TSUA 3VQBA 4ZHRA 3D2EB 3DRPA 3NVKA 1SKRA 3KJVA 1XHZA 3QEVA 2FBYA 3BF1A 3KHYA 2UU9K 4KHUA 3D2EA 3KLIA 2Q3SA 3QB0A 3A0IX 3HPGA 3AVKA 3J7ZO 3MXIA 1QVGM 2X78A 4CBXA 4PQUA 3CF5L 2NRXA 4CGIA 3KIOA 2ZJRL 3BF3A 2P9LA 1RDCA 3TU5A 2XY7A 4QCLA 4IJAA 3U9DA 4LF7K 1EETA 4CERA 4EP5A 3S3NA 4PKIA 4DTXA 3PIPL 3QESA 2I5JA 4BG8A 5HRPA 4ILJA 4FLYA 1KVBA 3SQ0A 4W5OA 4CJKA 2GTDA 4HWIA 4CD3A 3E9LA 1WSEA 1SV5A 5M1NA 3S9HA 4KTQA 3RSEA 1C1BA 3D0PA 1NLVA 3VESA 3E1YA 4NB4A 3MN5A 5AQYA 3VQ5A 1XNRK 4NYFA 4FJXA 3AA5X 1TL1A 4FL9A 2QKKA 4CJQA 4WCEL 4Y1DA 3AAQA 3SUPA 2YHWA 1BL3A 3WXJA 3CFOA 2JWLA 1D9DA 5AQKA 4CEZA 1TV6A 1GOBA 4RCHA 3NH2A 4B8AB 3K59A 5J2PA 3MECA 3VQAA 4OGEA 4Q5VA 4F2SA 1S22A 1YAGA 2ZWHA 1RTIA 3ZX0A 2HHWA 2WBNA 2VWJA 4DUYK 1KC8O 5HRRA
chains in the Genus database with same CATH topology
4BRHA 1T6CA 3OW2M 4FWPA 4GNIA 5FPMA 4IOXA 3G71N 4C23A 2GEMA 1VQ4N 4O8UA 3P38A 3TSPA 3H6EA 3WUHA 2CGJA 5C0YA 1QQMA 4WQ4C 4WF9L 4XEIA 2P9NB 1W97L 5CR4A 1VQ9N 3HOTA 4JAXA 5AQPA 1BUPA 3CMAN 2VCPA 3J8AA 4BRIA 4BR0A 2P9NA 3DXKB 3D6RA 4IFEA 3VGKA 3UKRA 3CCQN 3OBWA 5C2FA 4U7BA 2OTJN 3TPQA 3ENOA 2YI1A 4H0PA 1YJWN 1Q82O 5AQNA 5JVHL 4MDBA 3ATVA 3JXUA 3L6QA 4H0OA 3VETA 5JICA 2NRRA 4UY8O 4EAHD 3EKUA 4BRQA 2CH6A 5EXWA 2CGKA 3HZ6A 3MCPA 4IEEA 2VYPA 2Q2RA 4KH6A 4JKHA 3D7EO 4H5TA 4FPBA 4FWLA 3SBGA 4CZEA 4WQ5A 1NJIO 1T6DA 4IXCA 3N4QA 5HOOA 4JD2A 4JKCA 3EKSA 3GBTA 2P9LB 3CHWA 5AR0A 5AZJB 4EIAA 3O08A 1JCEA 1M1KO 2QA4N 4FWMA 2E2QA 3BP8A 3EL2A 5AZJA 4JK9A 4XH1A 5JLFA 1XQSC 2H3GX 4QS7A 4H5NA 4A2AA 3VEYA 1D4XA 3VTIA 3SLCA 4DQ8A 5CHIA 2E88A 1C0GA 5ELZA 3VPZA 4CI6A 2PAVA 2A41A 1VAZA 2VGNA 3CJ7A 4K25A 1BA0A 4ISFA 3VEXA 3ENHA 3ID6A 5AFUH 3D2FA 4E1JA 2ASMA 4FWKA 4CZMA 3DXMA 3LDOA 2QEXN 1K9MO 2P9SB 3H45C 4YOTA 5E26A 3FZHA 4RTFD 4A59A 4BROA 1C0FA 4CZJA 5GAEP 5BREA 3KWGA 3HRGA 3S41A 1JCFA 4BR9A 4DHYA 5H1SQ 1Q81O 3P31A 5EOYA 4GV6A 1SQKA 1E4GT 3VF2A 5C15A 2NRWA 2EWSA 3RSEB 3CCSN 3LDLA 1WOQA 5EVZA 4JKFA 1HKBA 1KAZA 2P9UB 3ID8A 2KKZA 3NMUA 4U67L 1KAYA 2FSNA 2NRVA 4BVOA 4FWNA 1VQ8N 3SAGA 2NRZA 1BA1A 1BWFO 4J8FA 3WXLA 4M7XA 2KLAA 3O6WA 2CH5A 3K9JA 4FOIA 3WXKA 3OBYA 1QHAA 4FOEA 4B1WB 1ZBSA 3O9RA 5AFUA 5AQIA 4BRLA 4CBWA 3C6HA 5AQOA 2E1YA 1H1VA 4BR4A 2OANA 4IEIA 4CD1A 2ZJQL 4RWTA 1KAXA 2F7TA 3A5OC 4JKEA 4K43A 4BRPA 1W2BM 1NGHA 2IIRA 1MA9B 2ZGZA 3ATUA 1N8RO 3MWTA 4A57A 1EO1A 4BRCA 1ATNA 1GLDG 4H0XB 5HL7L 3ZX3A 3IMXA 1NGAA 4BGAA 2V7ZA 1NGEA 3VERA 4ILHA 3G25A 4FVUA 1SZ2A 3O9TA 3A5LC 4H0YB 3FR0A 4BR5A 5B8HA 3O80A 4YDUA 2OTLN 3B8AX 3CD6N 1IJJA 1HX1A 4IO8A 3R9PA 3ZETB 2D4WA 4BQZA 4H5RA 2E1ZA 2KHOA 3GDQA 3IDHA 3VF6A 1QZ6A 4DCHA 4YOYA 3VEWA 3WT0A 4FWRA 1LOTB 4JKGA 5AQWA 3ZETA 4AM6A 4BR2A 3W3DA 3UB5A 1DT9A 2FLOA 2E2OA 1EQYA 3P39A 4MO5A 1XC3A 3IUCA 3VEZA 1VQ6N 1K8KA 4BC5A 3LM2A 2WUSA 1VQ5N 2V51B 4G9ZA 5JMVA 5BPNA 3ULEB 4XH5A 1V4SA 5AQVA 1DGKN 2E8AA 4CZIA 4GVEA 2Q1NA 3TTFA 1ATRA 3C6AA 3DLLL 3A5NC 3ULEA 5GAGP 2PBDA 1MDUB 1GLJO 1DKGD 3KK7A 5E84A 3UKRB 1NGGA 2I7PA 4QS9A 1TUYA 2A3ZA 5EY4A 3HTVA 3ENBA 1K8AO 5GAHP 3CQYA 3QDKA 4JK7A 2Q36A 3MX2A 5AQXA 2HBKA 1KC8O 1CZAN 5DM6L 3G6EN 2BUPA 5AQTA 1ESVA 1RDWX 2GUPA 5AQFA 1OVYA 4KH5A 2QWRA 3ZX2A 4BVPA 3OA9A 1GLFO 5GADP 3I33A 2BH1A 3RVCA 3CC7N 1BG3A 2QWQA 4WYBA 3MN6A 4IDHA 4A2BA 3SAHA 4BC4A 4JHDA 2HBJA 2D0OA 1SS6A 5GIPA 3CJAA 2JWKA 4YOWA 3SBTA 4ILGB 4JD2B 4JKBA 4IWVA 4BRKA 1V4TA 3QFPA 5TKWA 5ADXH 5CE3A 2GX9A 5BRDA 4WFAL 4IO9L 3R8EA 4CZLA 1P90A 3QFUA 4K42A 2GWJA 4PKHA 2W40A 2VWBA 1T3VA 4A61A 5BN8A 3CJBA 3BEXA 3K9KA 1YIJN 2NZTA 3M5RA 1QQNA 1SAZA 3CCEN 5M1FA 1NBWA 3U8XA 4B1ZA 3LDPA 2QWMA 3C0BA 3OHRA 3A5MC 2GWKA 3E9OA 3UKUB 2ITMA 2NRTA 2Q0RA 4BC2A 2Q0UA 2W41A 4NLBA 3WQTA 3D2FB 4QS8A 1Q86O 5KPZA 3DXMB 4GV3A 1RDUA 1YUWA 2ZF5O 4FPAA 3UKUA 4H03B 4BRGA 5F1XA 1YJ9N 4OO1J 1TYQB 3VEVA 4L3QA 4R79A 4XH4A 4JEPA 4EHTA 5ADXA 4DB3A 5FPEA 1TYQA 1OKJA 3DJCA 5KPTA 4I6MB 3LDNA 4YOXA 1VQKN 5AQGA 3QBWA 3CERA 2HF4A 5KQ8A 3P4IA 4DKWA 3CI5A 4K41A 1GLBG 1HKGA 4I6MA 3F5TA 3M3ZA 1HLUA 2QXLA 5I9EB 1QZ5A 1Y64A 4YORA 4HTLA 1M90O 3CJ1A 2IVPA 3AARA 3R3LA 1NGFA 4MO4A 1DEJA 3VOVA 5AZIB 4CJ7A 4BREA 5FPNA 4B1VA 1VQ7N 1Z6RA 3MK6A 2A5XA 3HM8A 3EN9A 4O8KA 1TUUA 4WQ5C 2CGLA 1J6ZA 5EX5A 5AZIA 4BGBA 5AQJA 3R1XA 4JNEA 2YHYA 4IOAL 1U2VB 4EHUA 1NWKA 1Q18A 3VENA 3W0LA 5BPLA 3I55N 3FLCO 3PLAA 1U2VA 1YITN 2FF6A 4H5WA 3QBXA 1JJ2M 2RHKA 1VQNN 2ASPA 3Q7BA 3WXIA 2A40A 5GIOA 1HJOA 3CIPA 5M1OA 4EFHA 4KH4A 4NO7A 3O8MA 5BRHA 1YVNA 4JKAA 1HKCA 1YJNN 3H46O 2I7NA 2QM1A 4Y0WA 4BC3A 5AQHA 3GOIA 4MDAA 3CCRN 1NGCA 3C7NB 3LL3A 3H1QA 3KVGA 4WFBL 3BUZB 4BR7A 2PFUA 4JKGB 5BR9A 1BO5O 3C7NA 5M1KA 2NRHA 3KZBA 1ATSA 4M63C 5M1PA 2P9KB 2ZJPL 2D0PA 1BU6O 2HBMA 3CJ9A 3HI0A 3SJHA 4BRMA 4CZGA 3C65A 2HBLA 4YOUA 3WXMB 1K8KB 4BRDA 2P9KA 2WFBA 2HOEA 2YJEA 3ZEUA 3CC4N 4CZKA 3AGRA 2P9IB 1IG8A 1X3NA 4BRNA 1NMDA 2P9IA 2QTDA 4KBOA 2HSTA 4FSVA 3SMSA 1VQLN 1ZC6A 2F9TA 3O9UA 4AF1A 2F9WA 3H3NO 3CPEA 3LM9A 5AQMA 5C2DA 5F0XA 5LJVA 3FFKB 3MN9A 3CXCM 2Q97A 3O1WA 1HPMA 2YHXA 5F2RA 1BOTO 2FSJA 4A5BA 3HSCA 2ASOA 3L4IA 5LY3A 5BRFA 3CMEN 2VGMA 1GLEG 3CCLN 2HMPA 1YI2N 3FZFA 5AQSA 2HF3A 2AA4A 4F9OA 3TTDA 1Q7YO 3A8YA 1VQON 2ZGYA 4C1NK 3M1FA 2Q31A 1NM1A 3MX5A 3TTCA 4C1NI 3FZMA 4JK8A 1U6ZA 3N4PA 4YDUC 4JHDB 3SK3A 3SMPA 4H0TB 3WEEA 1P8ZA 1E4FT 1S72N 3HOSA 5MLCQ 4BQLA 1T44A 4BY9C 1ZXOA 4M7YA 2QWOA 2QWPA 3HBTA 2YX6A 3R6MA 1MWMA 3VTHA 3TSUA 5JLHA 3O4WA 1YXQA 3O9QA 5M1QA 4GV9A 3QMLA 3TSQA 4B9QA 5AQUA 2NNWA 3E9PA 3SAFA 3O9SA 4Z94A 3CCVN 3D2EB 3NVKA 1X9JA 3DXKA 2AP1A 3BF1A 3KHYA 4B1XB 3D2EA 3E66A 3L4QA 3NVMA 4LC9B 5GINA 2DPNA 4WFNL 2A6AA 3CC2N 3IKMA 3QB0A 1WUAA 2FSKA 3A0IX 5AQZA 3ZYYX 4JKDA 3J7ZO 3GG4A 1QVGM 3KWIA 3CJCA 4ISGA 2RE2A 3DWLA 1ILYA 4BRAA 4CBXA 3AGKA 3EE9A 3H1VX 2QW9A 4FO0A 1K73O 3H3OB 3U4LA 3CF5L 2NRXA 5KPRA 2ZJRL 3LDQA 3Q7CA 2IVNA 3BF3A 2P9LA 3TU5A 1Z05A 4JN4A 4IJAA 4CZHA 3FZLA 3U9DA 1VQMN 4PL7A 4GY2B 3VEOA 2IVOA 3O1BA 3VGMA 1QVFM 4A5AA 3AY9A 3GL1A 2V52B 2YCHA 3MWPA 4PKIA 4IZ9A 4OPAA 1HUXA 3FE1A 3PIPL 5JVGL 1QQOA 4BG8A 1R59O 4IOCL 1RFQA 4H0VB 4ILJA 4NLCA 1GLAG 3MMVA 3VMFB 1KXPA 3L0QA 4BG9A 1LCUA 4PHTX 1YF5L 1NGIA 2E20A 2GTDA 4PL8A 3T7ZA 4HWIA 2E2PA 2P9SA 4CD3A 1NGBA 2V7YA 2NLXA 2QI2A 3E9LA 5AQRA 3IFRA 3WQUA 5BPMA 1KD1O 4PKGA 3I56N 5M1NA 5AQLA 5TKYA 3EZWA 3MN7A 5C10A 1JCGA 3RSEA 4FWSA 3FZKA 3UE5A 5FPDA 1NLVA 2D1KA 3QICA 2P9UA 3VESA 1MWKA 3E1YA 3CCUN 4NB4A 2P9PB 3I8BA 4A62A 3MN5A 5AQYA 1GLCG 4CZFA 3MDQA 1VQPN 1BDGA 3U9ZA 5LJWA 3T69A 2P9PA 2YJFA 3CCJN 2GELA 4H5VA 2WC9A 4FWQA 3FGUA 4WQ4A 2FF3B 5AQQA 3JS6A 5DM7L 1GLLO 3F2KA 4FL9A 4FWOA 3ZEUB 5KQDA 3G4SN 4OPHA 4WCEL 1NGDA 5C12A 2QWNA 3CQXA 3EO3A 4O5FA 1XUPO 5BN9A 3CCMN 3AAQA 3VGLA 2YHWA 1S3XA 3VF4A 3CPWM 2BTFA 1RGIA 4B1YB 3O5BA 3GE1A 3F9MA 3WXJA 2JWLA 2J4RA 5AQKA 1YHQN 2E2NA 4BRFA 4CBUA 3DAWA 4RCHA 1KQSM 3CETA 2A42A 2UYTA 4MLEA 4ISEA 2QWLA 3M6GA 1G99A 4IJNA 4AM7A 1S22A 1YAGA 1O13A 3PIOL 1X3MA 2ZWHA 3MCAB 3ZX0A 3AAPA 4B1UB 3EE8A 4MLHA 1NGJA 2WBNA 2FXUA 3WEEB 4YOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBN A;  2WC9 A;  4DKW A; 
#chains in the Genus database with same CATH topology
 1C0T A;  4JI7 K;  4BRH A;  1T6C A;  4FWP A;  4GNI A;  3G71 N;  4CEB A;  2GEM A;  3P38 A;  3H6E A;  3WUH A;  2UUA K;  2CGJ A;  4CK1 A;  4WF9 L;  1VQ9 N;  1W97 L;  3QNO A;  3HOT A;  4JAX A;  4BRI A;  3D6R A;  4IFE A;  3UKR A;  3DMJ A;  4CJV A;  3ENO A;  1VSJ A;  1YJW N;  2B5J A;  2YKN A;  5JIC A;  2NRR A;  1KFS A;  4LF6 K;  5EXW A;  3HZ6 A;  1JXB A;  3QIN A;  4RW6 A;  3VQQ A;  4IEE A;  1VSI A;  1SL0 A;  2Q2R A;  3OS1 A;  3EY1 A;  1KCF A;  1CXQ A;  3D7E O;  4FWL A;  1TK8 A;  4KHQ A;  1HNV A;  2VG6 A;  3QEI A;  3V1Q A;  1NJI O;  3N4Q A;  3CHW A;  1M1K O;  5AZJ B;  3THV A;  5AZJ A;  1N34 K;  4DQR A;  3NHG A;  4A2A A;  3VEY A;  3UIQ A;  3VTI A;  3SLC A;  3K5N A;  1WSG A;  4CF9 A;  2OYQ A;  5ELZ A;  2P5G A;  2VGN A;  2IAJ A;  1BA0 A;  3K5M A;  1LV5 A;  4KKO A;  1S5J A;  4LF8 K;  2P1J A;  3ENH A;  5AFU H;  4CZM A;  4AH9 A;  3LDO A;  3SUO A;  2QEX N;  2P9S B;  2YKM A;  3KLG A;  1REV A;  3FZH A;  3LP0 A;  5GAE P;  3TAN A;  4DS4 A;  4J2A A;  1KLM A;  3HRG A;  3S41 A;  4BR9 A;  1Q81 O;  1YTU A;  3P31 A;  5EOY A;  4F3O A;  1SQK A;  5EU7 A;  2JGU A;  5I3U A;  4FJ7 A;  1HKB A;  1BGX T;  2X6S A;  2DY4 A;  2KKZ A;  4U67 L;  1VQ8 N;  3CM5 A;  1BWF O;  4J8F A;  4KAZ A;  4FOI A;  3AV9 A;  2G8U A;  4FOE A;  4B1W B;  4CHQ A;  4JRP A;  2E1Y A;  4FVM A;  5CZ1 A;  3VQE A;  4K43 A;  4JI4 K;  3VQD A;  1U04 A;  3OYA A;  3NF7 A;  3MWT A;  1SL1 A;  4JLH A;  3QET A;  4PWD A;  1HJR A;  4B3O A;  1CXU A;  4OKK A;  3VER A;  4ILH A;  3FR0 A;  1NK6 A;  4JS5 A;  4BQZ A;  4YOY A;  4DF8 A;  3VEW A;  4FWR A;  1LOT B;  5AQW A;  1L5U A;  4OPJ A;  3UB5 A;  4DS5 A;  1UA1 A;  1DT9 A;  2HNY A;  1EQY A;  1VQ6 N;  4G9Z A;  2IGI A;  3LM2 A;  2YHB A;  3O4Q A;  4M3R A;  3TTF A;  1ATR A;  2PBD A;  3WNG A;  1NK0 A;  4RW9 A;  4CIF A;  3HTV A;  3ENB A;  4B3S K;  3CQY A;  2HW3 A;  2HBK A;  3NH1 A;  5AQF A;  4GV3 A;  5GAD P;  2QWR A;  4DU3 A;  3K58 A;  3RVC A;  4DV4 K;  1SKW A;  2QWQ A;  4WYB A;  3MN6 A;  3L2U A;  4IDH A;  4A2B A;  3SAH A;  3AA2 A;  4W5N A;  3AVB A;  4F3T A;  3T19 A;  4ILG B;  3HO1 A;  1NK9 A;  2VWK A;  1HPZ A;  1V4T A;  4KI4 A;  3J81 O;  4IO9 L;  1P90 A;  4CHP A;  3F73 A;  2BE2 A;  1VSE A;  1S6Q A;  5BN8 A;  3CJB A;  3EEQ A;  4YNQ A;  3K57 A;  4FLX A;  3OHR A;  3A5M C;  2GWK A;  3THX B;  4B3T K;  3SV4 A;  4PUO A;  4NLB A;  1Q86 O;  4CJR A;  3D2F B;  4GVM A;  2ZD1 A;  3THX A;  3DXM B;  1RDU A;  1YUW A;  3LP3 A;  4FPA A;  3WNE A;  4H03 B;  4BRG A;  3TAG A;  4L3Q A;  2O8C B;  4DB3 A;  3C95 A;  1OKJ A;  3ULD A;  5KPT A;  3LDN A;  1VQK N;  2O8C A;  3AO2 A;  4DKW A;  3AVN A;  2R7Y A;  1M90 O;  2XY8 A;  1NGF A;  4J2B A;  4CJ7 A;  1Z6R A;  1TUU A;  4WQ5 C;  1J6Z A;  1Q9Y A;  4BGB A;  1VRU A;  4UQG A;  1OH7 A;  3R1X A;  2AJQ A;  1U2V B;  1KVA A;  1EWR A;  4EHU A;  3VEN A;  2WON A;  4M42 A;  1BIS A;  3I55 N;  3FLC O;  1U2V A;  3U3G A;  3QBX A;  1JJ2 M;  4BDP A;  1F21 A;  2OZM A;  2D0A A;  1JL1 A;  4CK3 A;  4EFH A;  3O8M A;  3PSI A;  1LW2 A;  3TAB A;  4E19 A;  3GOI A;  3C7N B;  4I2Q A;  1S1V A;  4BR7 A;  1A5W A;  3AO4 A;  3HVR A;  1BO5 O;  3L2R A;  3C7N A;  1ATS A;  4M63 C;  2P9K B;  4FZY A;  4M45 A;  1WBB A;  3P5J A;  2HBL A;  2P9K A;  1JKH A;  4R5P A;  2Z1H A;  3AGR A;  3QEW A;  3IG1 A;  4IG0 A;  4O55 A;  4CIE A;  4BRN A;  1B9F A;  1NMD A;  5BR8 K;  3AO3 A;  2F9T A;  2F9W A;  3LM9 A;  3CPE A;  3KK2 A;  3MN9 A;  1D9F A;  3IRX A;  2YHX A;  1BOT O;  3V81 A;  3HSC A;  2VGM A;  3AVJ A;  3CCL N;  1YI2 N;  1BI4 A;  2RPI A;  3FZF A;  5AQS A;  5J2N A;  3OS0 A;  4N76 A;  4CGD A;  2Q31 A;  3IS9 A;  1NM1 A;  3MX5 A;  4C1N I;  3N4P A;  3SK3 A;  4JHD B;  3LWM A;  2G8V A;  4DTM A;  1IKV A;  3HK2 A;  1T44 A;  2QWO A;  3HBT A;  3R6M A;  1MWM A;  2PYL A;  3O9Q A;  5M1Q A;  4KRE A;  3TSQ A;  4DSL A;  1ZBH A;  4DSI A;  2BGG A;  2UXD K;  4B9N A;  2IOC A;  4LC9 B;  2O8D A;  1RTH A;  2FSK A;  3ISN C;  2HNZ A;  4DLG A;  1S1U A;  3C94 A;  3V4I A;  4EZ6 A;  4Q0B A;  2E5L K;  1GOC A;  1C1C A;  2GV9 A;  3NDK A;  3ZSY A;  3LDQ A;  2IVN A;  4GW6 A;  5IWA K;  3AA3 A;  3PX4 A;  1Z05 A;  2G8I A;  3AVG A;  4CZH A;  3FZL A;  5HRO A;  1S1W A;  4FW1 A;  3CFR A;  4PL7 A;  4DV5 K;  2IVO A;  1LAW A;  2P51 A;  2V52 B;  3MWP A;  2KTQ A;  1FW6 A;  1R59 O;  1GOA A;  2QK9 A;  4NXM K;  1U49 A;  2O8F A;  3MMV A;  1KXP A;  1A5V A;  3L0Q A;  1YF5 L;  4PL8 A;  2E20 A;  1Q9X A;  3OYE A;  1NGB A;  2NLX A;  2QI2 A;  5AQR A;  3KK1 A;  3WQU A;  5BPM A;  5AQL A;  4FLV A;  3J7Y P;  1JLG A;  5FPD A;  4DU4 A;  1QE1 A;  4O0I A;  1BHL A;  1HNX K;  4F4K A;  3LP1 A;  4E7L A;  3ZSR A;  4A62 A;  4CZF A;  4JI8 K;  3THY B;  4N41 A;  3NBP A;  4DTP A;  4PY5 A;  3BDP A;  4CJS A;  2WC9 A;  4FWQ A;  3THY A;  2G8K A;  3NF8 A;  1XWL A;  5AQQ A;  3F2K A;  3G4S N;  4DR5 K;  4FJG A;  1NGD A;  1VSF A;  2QWN A;  4O5F A;  1XUP O;  5HRS A;  1WAJ A;  3K5O A;  2BTF A;  3O5B A;  3I8D A;  4DR6 K;  2J4R A;  1RT7 A;  2OPS A;  4AHV A;  2QWL A;  3M6G A;  1E3M A;  3THW A;  3E01 A;  3ZT1 A;  4AM7 A;  4CJU A;  1IKW A;  1O13 A;  4ELV A;  1X3M A;  4QOZ B;  3SNN A;  2IS3 A;  4B1U B;  1NGJ A;  2IC3 A;  3BGR A;  3WEE B;  5C42 A;  4F2R A;  3NF9 A;  4B9T A;  5FPM A;  1S9G A;  3CYM A;  4XEI A;  1A5X A;  4CEQ A;  1LWF A;  4DTO A;  4AHU A;  3TI0 A;  3BY5 A;  4DF4 A;  3VGK A;  1HYZ A;  1LWE A;  5C2F A;  4U7B A;  4DV3 K;  3HXM A;  1WNS A;  1Q82 O;  4H0O A;  2YNG A;  4I7F A;  2O8B B;  1ZBF A;  4CJ4 A;  4B9M A;  4EAH D;  3EKU A;  4BRQ A;  2O8B A;  3MCP A;  3P1G A;  2VYP A;  4KH6 A;  4FCY A;  5J2M A;  1J5E K;  3ZSV A;  4O5B A;  1QSY A;  4CZE A;  2KZZ A;  1LW0 A;  1T6D A;  2YNH A;  4JKC A;  1T8E A;  3EKS A;  2P9L B;  2QA4 N;  5J2Q A;  3OJS A;  3WNF A;  5JLF A;  1XQS C;  2H3G X;  5KGX A;  4H5N A;  1RTJ A;  1D4X A;  1TL3 A;  1EP4 A;  4JRQ A;  2A41 A;  4CW7 B;  5A2Q O;  2X74 A;  1JLQ A;  4ZTF A;  4JI2 K;  3VEX A;  3ID6 A;  2ASM A;  4FWK A;  4DV0 K;  2D5R A;  4RTF D;  3DRR A;  4BRO A;  3L2Q A;  4CZJ A;  5BRE A;  3KWG A;  4BE1 A;  4CEE A;  3L2W A;  3CCS N;  4JI3 K;  3RSE B;  3LDL A;  1WOQ A;  4JKF A;  2E6M A;  4FJJ A;  4CF1 A;  2FSN A;  3TAE A;  4M3W A;  3L3U A;  3WXL A;  2P5O A;  4NCB A;  3O6W A;  1QHA A;  5AFU A;  1IKY A;  4BRL A;  5DK5 A;  3VQ6 A;  2F4V K;  4CK2 A;  1MA9 B;  3ATU A;  2FBX A;  2KW4 A;  1EO1 A;  3LZI A;  4E7K A;  3ZX3 A;  4ELT A;  4HUE A;  4BDY A;  4OVL A;  4BGA A;  3SQ4 A;  4FK0 A;  1WSF A;  1SZ2 A;  4W5T A;  4BR5 A;  2OTL N;  1IJJ A;  4IO8 A;  4BE0 A;  2D4W A;  3NGI A;  3IDH A;  4CJE A;  3V6D A;  3DYA A;  1T7P A;  1ITG A;  2FLO A;  3TAP A;  3KD5 E;  1JLA A;  4BC5 A;  4DFM A;  3SZ2 A;  1IKX A;  5JMV A;  2W6K A;  1V4S A;  2E4L A;  5SZT A;  4GVE A;  1ZBI A;  2Q1N A;  1XC9 A;  3DLL L;  3V9W A;  1U47 A;  1C6V A;  4CED A;  2XRI A;  3UKR B;  3LAL A;  5GAH P;  1OH6 A;  2HMI A;  4L8R B;  4CFB A;  1LAV A;  1RBT A;  4CJP A;  2GUP A;  4BVP A;  3M8Q A;  4KH5 A;  3ZX2 A;  2BH1 A;  3CC7 N;  3LDS A;  4OLA A;  1ZBU A;  4IKF A;  4FLZ A;  3AVC A;  1RCH A;  2HBJ A;  3TAM A;  3M8P A;  3HP6 A;  2JWK A;  3HPO A;  1IBK K;  4JKB A;  4IDK A;  1QSL A;  1OH5 A;  2GX9 A;  3R8E A;  2GWJ A;  4PKH A;  4DTU A;  1RDB A;  2VWB A;  4AHS A;  4EZ9 A;  4A61 A;  3BEX A;  1NBW A;  1QS4 A;  4B1Z A;  1TAQ A;  1KTQ A;  4RW7 A;  3UKU B;  5KRS A;  4BC2 A;  4CJL A;  2YNI A;  4QS8 A;  3P83 D;  1YT3 A;  3UKU A;  1YJ9 N;  5F1X A;  4X62 K;  4GKJ K;  4R79 A;  4CF2 A;  4JEP A;  4M3X A;  3DJC A;  3L3V A;  4YOX A;  5AQG A;  3CER A;  1BIU A;  5KQ8 A;  2G8F A;  3CI5 A;  4K41 A;  1GLB G;  3L8B A;  1T03 A;  3JSM A;  1HLU A;  1QZ5 A;  1Y64 A;  3O3H A;  4YOR A;  3J7A P;  2Z1I A;  1JLB A;  2IVP A;  3AAR A;  3OVN A;  4DTN A;  3R3L A;  4MO4 A;  3KLH A;  3SQ2 A;  1VHX A;  3VOV A;  4DTS A;  1VQ7 N;  4B1V A;  3MK6 A;  3KLE A;  4NCG A;  1YVU A;  5EX5 A;  4OX9 K;  3L2V A;  1U48 A;  1R0A A;  3TWH A;  1J53 A;  4CJT A;  3PLA A;  2FF6 A;  4CHN A;  2WOM A;  1EWQ A;  1VQN N;  3Q7B A;  2XY5 A;  3WXI A;  4M41 A;  3CIP A;  1BIZ A;  1W0H A;  4KH4 A;  2DFE A;  5BRH A;  4JI1 K;  1YVN A;  4JKA A;  4DU1 A;  4B9V A;  2I7N A;  2QM1 A;  4H4M A;  4Y0W A;  4CHZ A;  3CCR N;  3HST B;  2WTU A;  4MFB A;  1BCM A;  3T1H K;  2PFU A;  4FJM A;  5BR9 A;  1L3V A;  2NRH A;  2D0P A;  3HI0 A;  3SJH A;  3V9X A;  4YOU A;  2HHU A;  4BRD A;  2WFB A;  2HOE A;  3ZEU A;  4FZZ A;  3VQP A;  1HYS A;  1IG8 A;  3MXJ A;  2O4I A;  4B9L A;  1VQL N;  4KBO A;  2QTD A;  3VA3 A;  3BZK A;  3O9U A;  1U4B A;  4AF1 A;  1RBR A;  3H3N O;  3FFK B;  1JLF A;  3O1W A;  3ITH A;  5F2R A;  2FSJ A;  3RRG A;  4A5B A;  1Q8I A;  3L4I A;  5LY3 A;  1RTD A;  3ZSZ A;  2HF3 A;  1HQU A;  1RT1 A;  2O8E A;  2A1R A;  5JS2 A;  1WSH A;  3A8Y A;  3HJF A;  3OYB A;  2XHB A;  4YY3 K;  3FZM A;  4JK8 A;  1TKZ A;  1D5A A;  4BQL A;  1NK4 A;  3JAM O;  4B08 A;  2YX6 A;  3VTH A;  2HHT A;  2KQ2 A;  5JLH A;  3HP9 A;  1YXQ A;  3PY8 A;  4X65 K;  4GV9 A;  1NU0 A;  4B9Q A;  1TVR A;  2NNW A;  3E9P A;  3O9S A;  4Z94 A;  4BAC A;  1X9J A;  3DXK A;  4I9L A;  4B1X B;  4DV2 K;  3L4Q A;  3NVM A;  2DPN A;  1K6Y A;  3CC2 N;  1WUA A;  2X6N A;  5AQZ A;  1X9M A;  3LAM A;  3ZYY X;  1ZBL A;  1N33 K;  3GG4 A;  3J80 O;  2UUC K;  3ZLJ A;  2RE2 A;  1RT4 A;  3DWL A;  1ILY A;  4G1Q A;  4BRA A;  2DFH A;  3AGK A;  3EE9 A;  3AVI A;  3H1V X;  2QW9 A;  1K73 O;  3QLH A;  1WLJ A;  4KB0 A;  1J54 A;  5D3G A;  1J5O A;  2G8W A;  4FK4 A;  5KPR A;  1RDD A;  2LSN A;  3O4N A;  3O3G A;  2NUB A;  3AVA A;  3VEO A;  1QVF M;  3AY9 A;  3GL1 A;  4IFV A;  2YCH A;  4QAG A;  4IZ9 A;  4OPA A;  1HUX A;  3FE1 A;  5JVG L;  3SUN A;  1RFQ A;  3QER A;  4ELU A;  4NLC A;  1GLA G;  3VMF B;  1LCU A;  4PHT X;  3OYG A;  2VG7 A;  4V19 S;  2E2P A;  3RR8 A;  3OYN A;  4PKG A;  3MXM A;  1CZ9 A;  5TKY A;  3EZW A;  3ZSQ A;  1S9E A;  3DM2 A;  4FWS A;  3FZK A;  3UE5 A;  1U45 A;  2D1K A;  2P9U A;  5DMR A;  1MWK A;  1NJY A;  3CCU N;  2P9P B;  3I8B A;  2KFZ A;  1GLC G;  1BDG A;  5LJW A;  3T69 A;  2P9P A;  1VK0 A;  2YJF A;  3CCJ N;  1NG9 A;  2GEL A;  4H5V A;  3KLF A;  1TKX A;  3FGU A;  4WQ4 A;  3V1O A;  1RBU A;  1WB9 A;  5DM7 L;  4FWO A;  4H8K A;  4AHT A;  4OPH A;  5BN9 A;  3CCM N;  1W7A A;  3VGL A;  1S3X A;  3CPW M;  4B1Y B;  4KHW A;  1N6Q A;  3V9Z A;  4CGG A;  1Z26 A;  4CBU A;  4HVJ A;  2A42 A;  4FM0 A;  4MLE A;  4LSN A;  4ISE A;  1G99 A;  3ZT4 A;  1BI4 B;  1WAF A;  4CFC A;  4Z4I A;  3LPU A;  1VSD A;  3RMB A;  2ZE2 A;  2A1S A;  3PIO L;  4FLU A;  1NKC A;  3MCA B;  4DV1 K;  3NGZ A;  4DR1 K;  3AAP A;  1NJZ A;  3EE8 A;  2FXU A;  4YOV A;  3KKS A;  3ZT0 A;  5E41 A;  3OW2 M;  4IOX A;  4C23 A;  1VQ4 N;  4O8U A;  4JI5 K;  3TSP A;  1KRP A;  4CF8 A;  5C0Y A;  1QQM A;  4WQ4 C;  5CR4 A;  2OCE A;  5AQP A;  1BUP A;  2VCP A;  4BR0 A;  1FXX A;  4YHH K;  4ZTJ A;  1XMO K;  4H0P A;  1HYV A;  2O8D B;  1EXQ A;  4MDB A;  3L6Q A;  1RT3 A;  3MEG A;  4FW2 A;  3VET A;  4UY8 O;  1JXE A;  3V9S A;  2CH6 A;  3SI6 A;  5JS1 A;  2CGK A;  3OYI A;  2HHX A;  3T3F A;  1EKE A;  3SPY A;  3FFI A;  3OS2 A;  2RKI A;  4FPB A;  4CVN E;  3B6P A;  5HBM A;  4FJ8 A;  4X66 K;  5T7B A;  1S6P A;  3RR7 A;  1HR0 K;  1NKB A;  4IXC A;  2HHQ A;  4JD2 A;  1HNI A;  5AR0 A;  4E7I A;  4DMN A;  4EIA A;  4AHC A;  1JLC A;  3OYL A;  4FWM A;  2E2Q A;  2IDO A;  5SWM A;  3EL2 A;  4JK9 A;  5CZ2 A;  4JI0 K;  3T1A A;  3D45 A;  2DFF A;  2VQE K;  3OYD A;  4Z0U A;  1C0G A;  1L3U A;  4CI6 A;  3CJ7 A;  4K25 A;  2O8F B;  4ISF A;  3MED A;  4DUZ K;  4CJW A;  4A59 A;  1C0F A;  4DV6 K;  1QTM A;  1XMQ K;  2UXB K;  4DHY A;  1JCF A;  2DTU A;  5H1S Q;  1TKT A;  4KFB A;  3VF2 A;  1HRH A;  3G0Z A;  2NRW A;  2EWS A;  5LL6 Z;  3TR8 A;  5EVZ A;  1KAZ A;  1KAY A;  2O4G A;  5LMN K;  1CLQ A;  4BVO A;  3CQ8 A;  4C8O A;  5CY4 A;  4JS4 A;  2CH5 A;  2FBT A;  2YV0 X;  2YNF A;  3WNH A;  4DLE A;  5KGW A;  4CBW A;  3C6H A;  4LH4 A;  1N36 K;  4BR4 A;  1ZYQ A;  1H1V A;  3OYJ A;  5HRN A;  1KAX A;  4JKE A;  4RWT A;  1W2B M;  1Z25 A;  4CFA A;  1NGH A;  2ZGZ A;  1N8R O;  4DWI A;  5HLF A;  4A57 A;  4BRC A;  4NYN A;  3VQ4 A;  1GLD G;  1TK5 A;  3RTV A;  5HL7 L;  4OKJ A;  4N5S A;  4HUF A;  1NGA A;  2GBZ A;  3HL8 A;  2V7Z A;  1NGE A;  4FVU A;  2KZM A;  3A5L C;  4H0Y B;  5CYQ A;  3O80 A;  4YDU A;  3B8A X;  4FK2 A;  1HX1 A;  3ZET B;  4FJL A;  3THW B;  3VF6 A;  1QQC A;  2E1Z A;  1IBM K;  1G15 A;  3WT0 A;  4JKG A;  3ZET A;  4BR2 A;  4M3T A;  4KTW A;  4MO5 A;  3IUC A;  5FRM A;  1K8K A;  1VQ5 N;  2V51 B;  5BPN A;  1NKE A;  4XH5 A;  1SUQ A;  1DGK N;  2E8A A;  4BE2 A;  4CGF A;  4CEC A;  1DKG D;  4B9S A;  3NH0 A;  2ETJ A;  4WE1 A;  2I7P A;  3PSF A;  4QS9 A;  2A3Z A;  5K14 A;  4HHT A;  3QDK A;  3SCX A;  4JK7 A;  1OH8 A;  4E3S A;  1TK0 A;  1C1A A;  3G10 A;  3G6E N;  2BUP A;  5AQT A;  1NJX A;  1ESV A;  1RDW X;  1OVY A;  1EX4 A;  3EZ5 A;  3DOL A;  3QO9 A;  3VA0 A;  4N56 A;  3TAF A;  5FLX O;  1FK9 A;  4LFB K;  3PO5 A;  2ZQB A;  4BC4 A;  4CJF A;  1W9H A;  1SS6 A;  4RG8 A;  5GIP A;  3CJA A;  4YOW A;  4AIL C;  4IWV A;  3DRS A;  4LF4 K;  5ADX H;  4BDZ A;  4CGH A;  1DLO A;  4CZL A;  3C6U A;  3QFU A;  4K42 A;  4B3R K;  3DLR A;  4KHP K;  2PZS A;  5CYM A;  1NK5 A;  4FJI A;  3CCE N;  1QQN A;  1SAZ A;  4HTU A;  3U8X A;  1KSP A;  3RRH A;  2QWM A;  1WSJ A;  3CM6 A;  5I42 A;  4CJ3 A;  1NK7 A;  2NRT A;  3WQT A;  4M3U A;  5KPZ A;  1KVC A;  3VEV A;  3AVF A;  3LP2 A;  4XH4 A;  1Y97 A;  4CEA A;  1UWB A;  4BWM A;  3QBW A;  3DLE A;  1KLN A;  4IFY A;  4DQS A;  3F5T A;  3M3Z A;  3ALY A;  2FC0 A;  3DLK A;  4FXD A;  5I9E B;  4HTL A;  3KKR A;  3CJ1 A;  2E6L A;  1DEJ A;  5AZI B;  4BRE A;  5FPN A;  2A5X A;  3HM8 A;  3K5L A;  2CGL A;  5AZI A;  1NJW A;  5AQJ A;  4JNE A;  4IOA L;  1NWK A;  3W0L A;  1JL2 A;  4DQI A;  5J1E A;  3M8S A;  3AVL A;  4H5W A;  4O4G A;  1QSS A;  2RHK A;  4FM2 A;  1VSM A;  4KHY A;  2A40 A;  5M1O A;  4GKK K;  1MU2 A;  3B6O A;  1HKC A;  4ID1 A;  4BC3 A;  4LSL A;  3TAR A;  4MDA A;  4HUG A;  3QNN A;  3DLH A;  3KVG A;  3BUZ B;  1RIL A;  4LH5 A;  4FLW A;  3O3F A;  2YHA A;  3KZB A;  4CHO A;  2ZJP L;  4C8M A;  3VQ7 A;  4CZG A;  4BRM A;  2B4J A;  3C65 A;  4E1M A;  4DFJ A;  5FRN A;  3WXM B;  1IG9 A;  2YJE A;  4KO0 A;  3CC4 N;  5FDL A;  4CZK A;  3HT3 A;  4FM1 A;  3KD1 E;  1X3N A;  3OYM A;  2HHH K;  2HST A;  3SMS A;  1S1T A;  3NFA A;  5AQM A;  2OPP A;  4FJK A;  1L3T A;  5LJV A;  4YFU A;  4I2P A;  1HPM A;  5HP1 A;  1ASU A;  1GLE G;  4KB1 A;  3CFP A;  4NXN K;  4F9O A;  1CZB A;  1XHX A;  1VQO N;  2ZGY A;  4DFP A;  4C1N K;  3M1F A;  3TTC A;  4Z4E A;  1UOC A;  1U6Z A;  4RW4 A;  2QKB A;  2OPR A;  2F8T A;  1P8Z A;  1E4F T;  3HOS A;  1ZXO A;  4M7Y A;  3DLB A;  2QWP A;  1ASV A;  3O4W A;  4O44 A;  3QML A;  1BCO A;  5AQU A;  3SAF A;  3NE6 A;  4LFC K;  3CCV N;  2AP1 A;  4MQ3 A;  2OZS A;  4M3Z A;  4TSX A;  3E66 A;  4WFN L;  5GIN A;  3VQ9 A;  1VSK A;  2A6A A;  3IKM A;  3I0S A;  4JKD A;  3NCI A;  3KWI A;  3CJC A;  4ISG A;  4B3M K;  4C8L A;  5C25 A;  3SQ1 A;  3A2F A;  3NGY A;  4KPY A;  4AHR A;  4FO0 A;  3SUQ A;  1NMN A;  3H3O B;  3U4L A;  2UXC K;  1X9S A;  1IV0 A;  3QIP A;  4FYD A;  4JV5 K;  4Z4C A;  3Q7C A;  2FBV A;  4JN4 A;  1D8Y A;  1DTT A;  1VQM N;  4GY2 B;  3O1B A;  3VGM A;  1N5Y A;  4A5A A;  2F8S A;  4Z4G A;  3HVT A;  5KRT A;  1QQO A;  4IOC L;  4I9Q A;  4H0V B;  2Y1J A;  4DV7 K;  1TAU A;  4BG9 A;  2W6L A;  5C24 A;  4XIU A;  1NGI A;  4E7H A;  3T7Z A;  2P9S A;  1C0M A;  3KTQ A;  4IBN A;  1WBD A;  2V7Y A;  2OPQ A;  3IFR A;  4FZX C;  4C8K A;  1KD1 O;  3I56 N;  3MN7 A;  4RW8 A;  3VQC A;  5C10 A;  4FJH A;  1JCG A;  1FKP A;  3SJJ A;  4PA1 A;  1JLE A;  3QIC A;  4B9U A;  3U3Y A;  4DQP A;  2Z1G A;  3MDQ A;  1VQP N;  3U9Z A;  4IG3 A;  2XY6 A;  1O1W A;  1NOY A;  1TKD A;  2PYJ A;  1HQE A;  2FF3 B;  3JS6 A;  5LMU K;  1GLL O;  3ZEU B;  4CIG A;  5KQD A;  3SPZ A;  5C12 A;  3CQX A;  3EO3 A;  2ITG A;  2VQF K;  3VF4 A;  4JI6 K;  1RGI A;  3GE1 A;  3F9M A;  3VN5 A;  3OYK A;  4OKE A;  1YHQ N;  2E2N A;  4BRF A;  3LWL A;  3DAW A;  1KQS M;  3CET A;  4DTR A;  5AJ3 K;  2UYT A;  3C6T A;  2RF2 A;  4IJN A;  2O8E B;  3K0S A;  3PX6 A;  4DR2 K;  2EX3 A;  4MLH A;  4K0K K;  1C0U A;  3OYF A;  4FLT A;  1UAX A;  2B6A A;  3LZJ A;  1B9D A;  1TGO A;  1VSL A;  1VRT A;  3S3M A;  2P9N B;  3CMA N;  3J8A A;  3JYT A;  2P9N A;  3DXK B;  1HNZ K;  3ZCM A;  3CCQ N;  3OBW A;  2OTJ N;  3TPQ A;  3LAN A;  2YI1 A;  5AQN A;  4B8C A;  5JVH L;  4CHY A;  3ATV A;  3JXU A;  4FJN A;  2GUI A;  2HND A;  4FJ9 A;  3QEX A;  1ASW A;  4LD0 A;  5IT9 O;  4H4O A;  1I3A A;  4CGJ A;  4DQQ A;  1LWC A;  4KI6 A;  4JKH A;  4C8N A;  4H5T A;  4Z4F A;  3SBG A;  2KFN A;  1I94 K;  3ZT3 A;  4WQ5 A;  5HOO A;  4AQY K;  3V9U A;  3GBT A;  3HPH A;  3O08 A;  1JCE A;  4LF5 K;  3BP8 A;  4JYA K;  4CJ5 A;  1YTA A;  4XH1 A;  4J2D A;  4QS7 A;  1VSH A;  3RMC A;  1BQN A;  4GMJ B;  4DQ8 A;  5CHI A;  2E88 A;  3VPZ A;  2PAV A;  1VAZ A;  1B92 A;  4OGC A;  3MAQ A;  3D2F A;  4E1J A;  1NOZ A;  3DXM A;  1K9M O;  4DTJ A;  3H45 C;  4YOT A;  4DSJ A;  5E26 A;  4BWJ A;  4DR7 K;  4ID5 A;  3NF6 A;  1SL2 A;  3OJU A;  4GV6 A;  5C15 A;  1E4G T;  2XO7 A;  2P9U B;  3ID8 A;  1SKS A;  3QEP A;  3NMU A;  3SV3 A;  2NRV A;  4FWN A;  3SAG A;  2NRZ A;  3OY9 A;  3S3O A;  3OYH A;  1BA1 A;  4M7X A;  2KLA A;  3K9J A;  3WXK A;  3OBY A;  1RBS A;  1ZBS A;  2BAN A;  3CG7 A;  3O9R A;  5AQI A;  5AQO A;  1RNH A;  2OAN A;  4IEI A;  4CD1 A;  2ZJQ L;  2F7T A;  3A5O C;  3K2P A;  3AO1 A;  4BRP A;  2IIR A;  2ATQ A;  2F96 A;  3IAY A;  2OA8 A;  1ATN A;  4H0X B;  3V1R A;  3IMX A;  1X9W A;  1QHT A;  3G25 A;  3HM9 A;  3O9T A;  4CCH A;  1J9A A;  5B8H A;  4OLB A;  3ZSW A;  3CD6 N;  1WN7 A;  3R9P A;  3PV8 A;  1HNW K;  4H5R A;  2KHO A;  3GDQ A;  3RMD A;  1QZ6 A;  2EHG A;  4DCH A;  4M3Y A;  2Z1J A;  1OVQ A;  4AM6 A;  3HYF A;  4E0D A;  3LAK A;  3W3D A;  3QIO A;  2E2O A;  3P39 A;  3VEZ A;  4CE9 A;  1XC3 A;  5KTQ A;  2WUS A;  5KI6 A;  3ULE B;  1IH7 A;  4EP4 A;  5AQV A;  4DR3 K;  4CZI A;  3C6A A;  2D0C A;  3A5N C;  3ULE A;  4DR4 K;  5GAG P;  1MDU B;  1GLJ O;  4CF0 A;  1IO2 A;  1RT5 A;  3KK7 A;  1NK8 A;  5E84 A;  1NGG A;  4KV8 A;  1TUY A;  5EY4 A;  1K8A O;  2Q36 A;  3MX2 A;  5AQX A;  4NCA A;  1CZA N;  5DM6 L;  1UA0 A;  3OA9 A;  1GLF O;  4W5Q A;  3I33 A;  4K8X A;  1BG3 A;  1RDA A;  4JHD A;  2D0O A;  3F9K A;  4LFA K;  3SBT A;  3T1Y K;  1RT6 A;  3DOK A;  4JD2 B;  1S1X A;  1HMV A;  4BRK A;  3QFP A;  5TKW A;  5CE3 A;  1N32 K;  5BRD A;  4WFA L;  4Z4H A;  4HCC A;  2W40 A;  3RWU A;  1T3V A;  3K9K A;  4KRF A;  3BZC A;  2NZT A;  3M5R A;  1YIJ N;  3U6F A;  3NAE A;  5M1F A;  3LDP A;  3C0B A;  4W5R A;  1RT2 A;  4FJ5 A;  4KTZ A;  2UUB K;  4X64 K;  1BQM A;  4ICL A;  3E9O A;  4CEO A;  2ITM A;  2Q0R A;  2Q0U A;  2W41 A;  3KK3 A;  2HB5 A;  2HVH A;  2ZF5 O;  4E89 A;  1L3S A;  4OO1 J;  4E1N A;  1TYQ B;  4F8R A;  1XNQ K;  3ZT2 A;  1NNE A;  2ZM6 K;  3DI6 A;  2HHV A;  3ASM A;  4EHT A;  5ADX A;  5FPE A;  1TYQ A;  4I6M B;  4DG1 A;  2HF4 A;  3P4I A;  1T05 A;  4CEF A;  1HKG A;  4I6M A;  4DSK A;  4Y1C A;  2QXL A;  3SYZ A;  4CES A;  3AVH A;  2QXF A;  3EN9 A;  4O8K A;  2YHY A;  1Q18 A;  1FKO A;  3H08 A;  5BPL A;  1YIT N;  2VG5 A;  4O0J A;  4N47 A;  2ASP A;  4K8Z A;  5GIO A;  1FJG K;  1HJO A;  3OYC A;  1XI1 A;  4NO7 A;  2JLE A;  1YJN N;  3H46 O;  3ZSO A;  5AQH A;  1NGC A;  3LL3 A;  3LPT A;  3H1Q A;  3MEE A;  4WFB L;  4LY7 A;  4JKG B;  4OPK A;  2G8H A;  1X1P A;  5M1K A;  5M1P A;  1BU6 O;  2HBM A;  3CJ9 A;  3RMA A;  3EYZ A;  1RBV A;  1K8K B;  2RN2 A;  1DTQ A;  2P9I B;  4HCB A;  3I0R A;  4DFK A;  4DSF A;  3OTO K;  4E7J A;  3PX0 A;  2P9I A;  3PUF A;  4FSV A;  2Y1I A;  1ZC6 A;  2HHS A;  2PY5 A;  5C2D A;  2HVI A;  4DSE A;  5F0X A;  5FRO A;  2D0B A;  3M8R A;  3CXC M;  2Q97 A;  1WSI A;  2ASO A;  3CME N;  4OJR A;  5BRF A;  2HMP A;  3TAQ A;  4LF9 K;  2AA4 A;  2W42 A;  4J2E A;  3TTD A;  1Q7Y O;  4CFD A;  3AVM A;  3AA4 A;  2BDP A;  3DLG A;  4YDU C;  3SMP A;  4H0T B;  3WEE A;  3ZSX A;  1S72 N;  1I39 A;  5MLC Q;  3PO4 A;  1KFD A;  4KHN A;  3AO5 A;  1IBL K;  4BY9 C;  4KHS A;  3VQ8 A;  3TSU A;  3VQB A;  4ZHR A;  3D2E B;  3DRP A;  3NVK A;  1SKR A;  3KJV A;  1XHZ A;  3QEV A;  2FBY A;  3BF1 A;  3KHY A;  2UU9 K;  4KHU A;  3D2E A;  3KLI A;  2Q3S A;  3QB0 A;  3A0I X;  3HPG A;  3AVK A;  3J7Z O;  3MXI A;  1QVG M;  2X78 A;  4CBX A;  4PQU A;  3CF5 L;  2NRX A;  4CGI A;  3KIO A;  2ZJR L;  3BF3 A;  2P9L A;  1RDC A;  3TU5 A;  2XY7 A;  4QCL A;  4IJA A;  3U9D A;  4LF7 K;  1EET A;  4CER A;  4EP5 A;  3S3N A;  4PKI A;  4DTX A;  3PIP L;  3QES A;  2I5J A;  4BG8 A;  5HRP A;  4ILJ A;  4FLY A;  1KVB A;  3SQ0 A;  4W5O A;  4CJK A;  2GTD A;  4HWI A;  4CD3 A;  3E9L A;  1WSE A;  1SV5 A;  5M1N A;  3S9H A;  4KTQ A;  3RSE A;  1C1B A;  3D0P A;  1NLV A;  3VES A;  3E1Y A;  4NB4 A;  3MN5 A;  5AQY A;  3VQ5 A;  1XNR K;  4NYF A;  4FJX A;  3AA5 X;  1TL1 A;  4FL9 A;  2QKK A;  4CJQ A;  4WCE L;  4Y1D A;  3AAQ A;  3SUP A;  2YHW A;  1BL3 A;  3WXJ A;  3CFO A;  2JWL A;  1D9D A;  5AQK A;  4CEZ A;  1TV6 A;  1GOB A;  4RCH A;  3NH2 A;  4B8A B;  3K59 A;  5J2P A;  3MEC A;  3VQA A;  4OGE A;  4Q5V A;  4F2S A;  1S22 A;  1YAG A;  2ZWH A;  1RTI A;  3ZX0 A;  2HHW A;  2WBN A;  2VWJ A;  4DUY K;  1KC8 O;  5HRR A; 
#chains in the Genus database with same CATH homology
 4BRH A;  1T6C A;  3OW2 M;  4FWP A;  4GNI A;  5FPM A;  4IOX A;  3G71 N;  4C23 A;  2GEM A;  1VQ4 N;  4O8U A;  3P38 A;  3TSP A;  3H6E A;  3WUH A;  2CGJ A;  5C0Y A;  1QQM A;  4WQ4 C;  4WF9 L;  4XEI A;  2P9N B;  1W97 L;  5CR4 A;  1VQ9 N;  3HOT A;  4JAX A;  5AQP A;  1BUP A;  3CMA N;  2VCP A;  3J8A A;  4BRI A;  4BR0 A;  2P9N A;  3DXK B;  3D6R A;  4IFE A;  3VGK A;  3UKR A;  3CCQ N;  3OBW A;  5C2F A;  4U7B A;  2OTJ N;  3TPQ A;  3ENO A;  2YI1 A;  4H0P A;  1YJW N;  1Q82 O;  5AQN A;  5JVH L;  4MDB A;  3ATV A;  3JXU A;  3L6Q A;  4H0O A;  3VET A;  5JIC A;  2NRR A;  4UY8 O;  4EAH D;  3EKU A;  4BRQ A;  2CH6 A;  5EXW A;  2CGK A;  3HZ6 A;  3MCP A;  4IEE A;  2VYP A;  2Q2R A;  4KH6 A;  4JKH A;  3D7E O;  4H5T A;  4FPB A;  4FWL A;  3SBG A;  4CZE A;  4WQ5 A;  1NJI O;  1T6D A;  4IXC A;  3N4Q A;  5HOO A;  4JD2 A;  4JKC A;  3EKS A;  3GBT A;  2P9L B;  3CHW A;  5AR0 A;  5AZJ B;  4EIA A;  3O08 A;  1JCE A;  1M1K O;  2QA4 N;  4FWM A;  2E2Q A;  3BP8 A;  3EL2 A;  5AZJ A;  4JK9 A;  4XH1 A;  5JLF A;  1XQS C;  2H3G X;  4QS7 A;  4H5N A;  4A2A A;  3VEY A;  1D4X A;  3VTI A;  3SLC A;  4DQ8 A;  5CHI A;  2E88 A;  1C0G A;  5ELZ A;  3VPZ A;  4CI6 A;  2PAV A;  2A41 A;  1VAZ A;  2VGN A;  3CJ7 A;  4K25 A;  1BA0 A;  4ISF A;  3VEX A;  3ENH A;  3ID6 A;  5AFU H;  3D2F A;  4E1J A;  2ASM A;  4FWK A;  4CZM A;  3DXM A;  3LDO A;  2QEX N;  1K9M O;  2P9S B;  3H45 C;  4YOT A;  5E26 A;  3FZH A;  4RTF D;  4A59 A;  4BRO A;  1C0F A;  4CZJ A;  5GAE P;  5BRE A;  3KWG A;  3HRG A;  3S41 A;  1JCF A;  4BR9 A;  4DHY A;  5H1S Q;  1Q81 O;  3P31 A;  5EOY A;  4GV6 A;  1SQK A;  1E4G T;  3VF2 A;  5C15 A;  2NRW A;  2EWS A;  3RSE B;  3CCS N;  3LDL A;  1WOQ A;  5EVZ A;  4JKF A;  1HKB A;  1KAZ A;  2P9U B;  3ID8 A;  2KKZ A;  3NMU A;  4U67 L;  1KAY A;  2FSN A;  2NRV A;  4BVO A;  4FWN A;  1VQ8 N;  3SAG A;  2NRZ A;  1BA1 A;  1BWF O;  4J8F A;  3WXL A;  4M7X A;  2KLA A;  3O6W A;  2CH5 A;  3K9J A;  4FOI A;  3WXK A;  3OBY A;  1QHA A;  4FOE A;  4B1W B;  1ZBS A;  3O9R A;  5AFU A;  5AQI A;  4BRL A;  4CBW A;  3C6H A;  5AQO A;  2E1Y A;  1H1V A;  4BR4 A;  2OAN A;  4IEI A;  4CD1 A;  2ZJQ L;  4RWT A;  1KAX A;  2F7T A;  3A5O C;  4JKE A;  4K43 A;  4BRP A;  1W2B M;  1NGH A;  2IIR A;  1MA9 B;  2ZGZ A;  3ATU A;  1N8R O;  3MWT A;  4A57 A;  1EO1 A;  4BRC A;  1ATN A;  1GLD G;  4H0X B;  5HL7 L;  3ZX3 A;  3IMX A;  1NGA A;  4BGA A;  2V7Z A;  1NGE A;  3VER A;  4ILH A;  3G25 A;  4FVU A;  1SZ2 A;  3O9T A;  3A5L C;  4H0Y B;  3FR0 A;  4BR5 A;  5B8H A;  3O80 A;  4YDU A;  2OTL N;  3B8A X;  3CD6 N;  1IJJ A;  1HX1 A;  4IO8 A;  3R9P A;  3ZET B;  2D4W A;  4BQZ A;  4H5R A;  2E1Z A;  2KHO A;  3GDQ A;  3IDH A;  3VF6 A;  1QZ6 A;  4DCH A;  4YOY A;  3VEW A;  3WT0 A;  4FWR A;  1LOT B;  4JKG A;  5AQW A;  3ZET A;  4AM6 A;  4BR2 A;  3W3D A;  3UB5 A;  1DT9 A;  2FLO A;  2E2O A;  1EQY A;  3P39 A;  4MO5 A;  1XC3 A;  3IUC A;  3VEZ A;  1VQ6 N;  1K8K A;  4BC5 A;  3LM2 A;  2WUS A;  1VQ5 N;  2V51 B;  4G9Z A;  5JMV A;  5BPN A;  3ULE B;  4XH5 A;  1V4S A;  5AQV A;  1DGK N;  2E8A A;  4CZI A;  4GVE A;  2Q1N A;  3TTF A;  1ATR A;  3C6A A;  3DLL L;  3A5N C;  3ULE A;  5GAG P;  2PBD A;  1MDU B;  1GLJ O;  1DKG D;  3KK7 A;  5E84 A;  3UKR B;  1NGG A;  2I7P A;  4QS9 A;  1TUY A;  2A3Z A;  5EY4 A;  3HTV A;  3ENB A;  1K8A O;  5GAH P;  3CQY A;  3QDK A;  4JK7 A;  2Q36 A;  3MX2 A;  5AQX A;  2HBK A;  1KC8 O;  1CZA N;  5DM6 L;  3G6E N;  2BUP A;  5AQT A;  1ESV A;  1RDW X;  2GUP A;  5AQF A;  1OVY A;  4KH5 A;  2QWR A;  3ZX2 A;  4BVP A;  3OA9 A;  1GLF O;  5GAD P;  3I33 A;  2BH1 A;  3RVC A;  3CC7 N;  1BG3 A;  2QWQ A;  4WYB A;  3MN6 A;  4IDH A;  4A2B A;  3SAH A;  4BC4 A;  4JHD A;  2HBJ A;  2D0O A;  1SS6 A;  5GIP A;  3CJA A;  2JWK A;  4YOW A;  3SBT A;  4ILG B;  4JD2 B;  4JKB A;  4IWV A;  4BRK A;  1V4T A;  3QFP A;  5TKW A;  5ADX H;  5CE3 A;  2GX9 A;  5BRD A;  4WFA L;  4IO9 L;  3R8E A;  4CZL A;  1P90 A;  3QFU A;  4K42 A;  2GWJ A;  4PKH A;  2W40 A;  2VWB A;  1T3V A;  4A61 A;  5BN8 A;  3CJB A;  3BEX A;  3K9K A;  1YIJ N;  2NZT A;  3M5R A;  1QQN A;  1SAZ A;  3CCE N;  5M1F A;  1NBW A;  3U8X A;  4B1Z A;  3LDP A;  2QWM A;  3C0B A;  3OHR A;  3A5M C;  2GWK A;  3E9O A;  3UKU B;  2ITM A;  2NRT A;  2Q0R A;  4BC2 A;  2Q0U A;  2W41 A;  4NLB A;  3WQT A;  3D2F B;  4QS8 A;  1Q86 O;  5KPZ A;  3DXM B;  4GV3 A;  1RDU A;  1YUW A;  2ZF5 O;  4FPA A;  3UKU A;  4H03 B;  4BRG A;  5F1X A;  1YJ9 N;  4OO1 J;  1TYQ B;  3VEV A;  4L3Q A;  4R79 A;  4XH4 A;  4JEP A;  4EHT A;  5ADX A;  4DB3 A;  5FPE A;  1TYQ A;  1OKJ A;  3DJC A;  5KPT A;  4I6M B;  3LDN A;  4YOX A;  1VQK N;  5AQG A;  3QBW A;  3CER A;  2HF4 A;  5KQ8 A;  3P4I A;  4DKW A;  3CI5 A;  4K41 A;  1GLB G;  1HKG A;  4I6M A;  3F5T A;  3M3Z A;  1HLU A;  2QXL A;  5I9E B;  1QZ5 A;  1Y64 A;  4YOR A;  4HTL A;  1M90 O;  3CJ1 A;  2IVP A;  3AAR A;  3R3L A;  1NGF A;  4MO4 A;  1DEJ A;  3VOV A;  5AZI B;  4CJ7 A;  4BRE A;  5FPN A;  4B1V A;  1VQ7 N;  1Z6R A;  3MK6 A;  2A5X A;  3HM8 A;  3EN9 A;  4O8K A;  1TUU A;  4WQ5 C;  2CGL A;  1J6Z A;  5EX5 A;  5AZI A;  4BGB A;  5AQJ A;  3R1X A;  4JNE A;  2YHY A;  4IOA L;  1U2V B;  4EHU A;  1NWK A;  1Q18 A;  3VEN A;  3W0L A;  5BPL A;  3I55 N;  3FLC O;  3PLA A;  1U2V A;  1YIT N;  2FF6 A;  4H5W A;  3QBX A;  1JJ2 M;  2RHK A;  1VQN N;  2ASP A;  3Q7B A;  3WXI A;  2A40 A;  5GIO A;  1HJO A;  3CIP A;  5M1O A;  4EFH A;  4KH4 A;  4NO7 A;  3O8M A;  5BRH A;  1YVN A;  4JKA A;  1HKC A;  1YJN N;  3H46 O;  2I7N A;  2QM1 A;  4Y0W A;  4BC3 A;  5AQH A;  3GOI A;  4MDA A;  3CCR N;  1NGC A;  3C7N B;  3LL3 A;  3H1Q A;  3KVG A;  4WFB L;  3BUZ B;  4BR7 A;  2PFU A;  4JKG B;  5BR9 A;  1BO5 O;  3C7N A;  5M1K A;  2NRH A;  3KZB A;  1ATS A;  4M63 C;  5M1P A;  2P9K B;  2ZJP L;  2D0P A;  1BU6 O;  2HBM A;  3CJ9 A;  3HI0 A;  3SJH A;  4BRM A;  4CZG A;  3C65 A;  2HBL A;  4YOU A;  3WXM B;  1K8K B;  4BRD A;  2P9K A;  2WFB A;  2HOE A;  2YJE A;  3ZEU A;  3CC4 N;  4CZK A;  3AGR A;  2P9I B;  1IG8 A;  1X3N A;  4BRN A;  1NMD A;  2P9I A;  2QTD A;  4KBO A;  2HST A;  4FSV A;  3SMS A;  1VQL N;  1ZC6 A;  2F9T A;  3O9U A;  4AF1 A;  2F9W A;  3H3N O;  3CPE A;  3LM9 A;  5AQM A;  5C2D A;  5F0X A;  5LJV A;  3FFK B;  3MN9 A;  3CXC M;  2Q97 A;  3O1W A;  1HPM A;  2YHX A;  5F2R A;  1BOT O;  2FSJ A;  4A5B A;  3HSC A;  2ASO A;  3L4I A;  5LY3 A;  5BRF A;  3CME N;  2VGM A;  1GLE G;  3CCL N;  2HMP A;  1YI2 N;  3FZF A;  5AQS A;  2HF3 A;  2AA4 A;  4F9O A;  3TTD A;  1Q7Y O;  3A8Y A;  1VQO N;  2ZGY A;  4C1N K;  3M1F A;  2Q31 A;  1NM1 A;  3MX5 A;  3TTC A;  4C1N I;  3FZM A;  4JK8 A;  1U6Z A;  3N4P A;  4YDU C;  4JHD B;  3SK3 A;  3SMP A;  4H0T B;  3WEE A;  1P8Z A;  1E4F T;  1S72 N;  3HOS A;  5MLC Q;  4BQL A;  1T44 A;  4BY9 C;  1ZXO A;  4M7Y A;  2QWO A;  2QWP A;  3HBT A;  2YX6 A;  3R6M A;  1MWM A;  3VTH A;  3TSU A;  5JLH A;  3O4W A;  1YXQ A;  3O9Q A;  5M1Q A;  4GV9 A;  3QML A;  3TSQ A;  4B9Q A;  5AQU A;  2NNW A;  3E9P A;  3SAF A;  3O9S A;  4Z94 A;  3CCV N;  3D2E B;  3NVK A;  1X9J A;  3DXK A;  2AP1 A;  3BF1 A;  3KHY A;  4B1X B;  3D2E A;  3E66 A;  3L4Q A;  3NVM A;  4LC9 B;  5GIN A;  2DPN A;  4WFN L;  2A6A A;  3CC2 N;  3IKM A;  3QB0 A;  1WUA A;  2FSK A;  3A0I X;  5AQZ A;  3ZYY X;  4JKD A;  3J7Z O;  3GG4 A;  1QVG M;  3KWI A;  3CJC A;  4ISG A;  2RE2 A;  3DWL A;  1ILY A;  4BRA A;  4CBX A;  3AGK A;  3EE9 A;  3H1V X;  2QW9 A;  4FO0 A;  1K73 O;  3H3O B;  3U4L A;  3CF5 L;  2NRX A;  5KPR A;  2ZJR L;  3LDQ A;  3Q7C A;  2IVN A;  3BF3 A;  2P9L A;  3TU5 A;  1Z05 A;  4JN4 A;  4IJA A;  4CZH A;  3FZL A;  3U9D A;  1VQM N;  4PL7 A;  4GY2 B;  3VEO A;  2IVO A;  3O1B A;  3VGM A;  1QVF M;  4A5A A;  3AY9 A;  3GL1 A;  2V52 B;  2YCH A;  3MWP A;  4PKI A;  4IZ9 A;  4OPA A;  1HUX A;  3FE1 A;  3PIP L;  5JVG L;  1QQO A;  4BG8 A;  1R59 O;  4IOC L;  1RFQ A;  4H0V B;  4ILJ A;  4NLC A;  1GLA G;  3MMV A;  3VMF B;  1KXP A;  3L0Q A;  4BG9 A;  1LCU A;  4PHT X;  1YF5 L;  1NGI A;  2E20 A;  2GTD A;  4PL8 A;  3T7Z A;  4HWI A;  2E2P A;  2P9S A;  4CD3 A;  1NGB A;  2V7Y A;  2NLX A;  2QI2 A;  3E9L A;  5AQR A;  3IFR A;  3WQU A;  5BPM A;  1KD1 O;  4PKG A;  3I56 N;  5M1N A;  5AQL A;  5TKY A;  3EZW A;  3MN7 A;  5C10 A;  1JCG A;  3RSE A;  4FWS A;  3FZK A;  3UE5 A;  5FPD A;  1NLV A;  2D1K A;  3QIC A;  2P9U A;  3VES A;  1MWK A;  3E1Y A;  3CCU N;  4NB4 A;  2P9P B;  3I8B A;  4A62 A;  3MN5 A;  5AQY A;  1GLC G;  4CZF A;  3MDQ A;  1VQP N;  1BDG A;  3U9Z A;  5LJW A;  3T69 A;  2P9P A;  2YJF A;  3CCJ N;  2GEL A;  4H5V A;  2WC9 A;  4FWQ A;  3FGU A;  4WQ4 A;  2FF3 B;  5AQQ A;  3JS6 A;  5DM7 L;  1GLL O;  3F2K A;  4FL9 A;  4FWO A;  3ZEU B;  5KQD A;  3G4S N;  4OPH A;  4WCE L;  1NGD A;  5C12 A;  2QWN A;  3CQX A;  3EO3 A;  4O5F A;  1XUP O;  5BN9 A;  3CCM N;  3AAQ A;  3VGL A;  2YHW A;  1S3X A;  3VF4 A;  3CPW M;  2BTF A;  1RGI A;  4B1Y B;  3O5B A;  3GE1 A;  3F9M A;  3WXJ A;  2JWL A;  2J4R A;  5AQK A;  1YHQ N;  2E2N A;  4BRF A;  4CBU A;  3DAW A;  4RCH A;  1KQS M;  3CET A;  2A42 A;  2UYT A;  4MLE A;  4ISE A;  2QWL A;  3M6G A;  1G99 A;  4IJN A;  4AM7 A;  1S22 A;  1YAG A;  1O13 A;  3PIO L;  1X3M A;  2ZWH A;  3MCA B;  3ZX0 A;  3AAP A;  4B1U B;  3EE8 A;  4MLH A;  1NGJ A;  2WBN A;  2FXU A;  3WEE B;  4YOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...