2WBNA

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
178
structure length
178
Chain Sequence
b'VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TERMINASE LARGE SUBUNIT
publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 48
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wbnA00
2WC9A 2WBNA 4DKWA
chains in the Genus database with same CATH superfamily
1NGCA 3O9SA 4OLAA 4CEOA 1RBSA 1XQSC 3FZKA 3NE6A 4K8XA 4R79A 4NCAA 2HHHK 2QK9A 1VQKN 1BI4A 1J5OA 3M8QA 4BR2A 4FLWA 3LP2A 4YOYA 3M8SA 1WB9A 4K42A 1R59O 2KQ2A 4LFBK 4J2AA 4FLYA 1HNIA 2KTQA 3C6TA 4CFDA 1HYZA 1Y64A 3PUFA 1TYQA 3T1AA 5IT9O 1RFQA 2A41A 1GLFO 3O08A 4WQ4C 1SKSA 4FWKA 5AQGA 3MWTA 2HNYA 4W5NA 2NUBA 1KTQA 1RT1A 3L2VA 5HRPA 3VGLA 1RT7A 4DSIA 4FPBA 3D2EA 1EXQA 4FZZA 2FC0A 4BRDA 4DLGA 4E7HA 4TSXA 1C0MA 4FWNA 4FJLA 4KHUA 3K9JA 3HOSA 3LZIA 1HMVA 4FXDA 3ULEB 3L4QA 5AQWA 3UE5A 4ZHRA 2YJFA 3QESA 2HB5A 4DV4K 4Y0WA 3ZYYX 4CJTA 2GUIA 3QEXA 1ATNA 3S3NA 3RTVA 2ITMA 4DV0K 3J7AP 3G0ZA 4DFKA 4CGGA 4CJVA 1HNWK 2GELA 2A5XA 3ITHA 1B9FA 4CEAA 4JRQA 4LY7A 2KZZA 3QIPA 4DKWA 4B9NA 1K8AO 4FM1A 3CC7N 2HHQA 3R1XA 3UKUA 4H0PA 3H3NO 4DMNA 4CHQA 1GLJO 3VQ9A 2F9WA 3VQEA 4X65K 4XIUA 3O8MA 5C2FA 1X3MA 3U6FA 5IWAK 2UU9K 2QWLA 2Y1IA 4FZYA 3WNEA 1HPZA 4E89A 1Q81O 4A59A 4Z4HA 3CCLN 3KHYA 4F9OA 1T03A 2Y1JA 2VWBA 4YDUC 4GV3A 1O1WA 1W9HA 4JKFA 3WEEA 1Z25A 1BA1A 4CIEA 4CJ3A 3FE1A 2EWSA 4CJRA 3C0BA 3WNFA 1QVGM 2NRWA 4CGJA 3SQ1A 4KB0A 2ZF5O 1FJGK 3G25A 3HPHA 4IG3A 4QCLA 1RDUA 2PZSA 4PL8A 3V9UA 4LH4A 4MQ3A 3WXLA 1YT3A 3FFKB 1IG9A 3AARA 1OVYA 1NKEA 1LWFA 1UA0A 2Z1GA 4BDPA 1T3VA 4Q0BA 4EP4A 3CQ8A 3S9HA 4DS4A 1RBRA 1RDCA 3O1BA 2G8KA 3THYB 4ZTJA 3ATVA 4CJLA 1SL1A 4HUEA 1VQPN 4CD3A 4O0JA 4B1ZA 4G9ZA 1K73O 4BACA 3ID6A 2CGJA 4BQZA 4KTQA 3IKMA 2UUBK 3VQDA 4MLEA 1UWBA 3L2QA 4RTFD 3SI6A 1QSYA 4CHYA 4AILC 4X66K 3N4QA 2WUSA 3OHRA 4BRGA 3I55N 5J2NA 1BHLA 5GINA 2R7YA 1T05A 5HL7L 1MU2A 3O3GA 4QS9A 4B8CA 3EY1A 4IFVA 3MEDA 1RTHA 1WSEA 1YTAA 1JLQA 3NVKA 2BANA 4DR5K 2GBZA 3L6QA 5HRSA 5M1OA 5KI6A 3A2FA 3OYHA 4BE2A 3RSEB 4OPJA 3AVCA 4CGFA 4B3RK 1A5WA 3RRGA 2BH1A 2E88A 3NBPA 3TPQA 3ULDA 1TUYA 3QMLA 4U7BA 4FWPA 1B92A 1NGAA 1J5EK 4N41A 1J6ZA 3TSPA 1QSLA 2FBYA 4FL9A 4IJAA 3KLIA 4E7KA 4LFCK 3LDOA 1SKRA 2OPPA 2VG6A 2E8AA 3CC2N 5JS2A 2NRXA 3C95A 1ZBIA 2QWOA 4KTZA 2OZSA 1RBTA 4IEEA 4C8MA 3DRPA 4DR2K 4CVNE 3KTQA 2Z1JA 3L4IA 1VQLN 4FJMA 1LAWA 3BZKA 3O6WA 4YNQA 4CIFA 4CZMA 4M3UA 4I2PA 3CD6N 1KFDA 5CZ1A 4OLBA 2VCPA 3L3VA 4EHTA 3A8YA 4J2EA 2P9NA 3DXKA 4CZJA 4R5PA 3NGZA 3VN5A 3OY9A 4F3TA 4B1XB 5FROA 3OW2M 3DM2A 1EKEA 2D4WA 4KI4A 4BGBA 2HHSA 3CC4N 3IS9A 4ISEA 4ZTFA 3VA0A 2I7PA 4CHPA 1Q8IA 1K9MO 2UXDK 1A5XA 1F21A 3CCMN 4K43A 5GAGP 5JLFA 4BVOA 1X3NA 2E5LK 3VQ5A 1O13A 5KGWA 3CJ1A 4B9TA 3MXJA 4MO5A 1WUAA 4CJPA 4DTOA 1NMDA 3BY5A 1U4BA 3NH1A 3BF3A 4FWQA 4WQ4A 4DB3A 3SAGA 1K8KB 3AO2A 4M63C 3ENBA 5AR0A 3CCEN 3O3HA 4DSEA 1XUPO 1MA9B 1NKBA 1S9GA 1JLGA 1XMOK 4KHWA 3V9XA 3WNGA 4IOAL 3NF9A 3WXJA 3THWB 2NRRA 3ATUA 3M1FA 5EX5A 4G1QA 2G8VA 4EAHD 3TAFA 3NHGA 3RRHA 2GUPA 1L3UA 4ILGB 4CD1A 5BN9A 3QDKA 3QERA 4UQGA 3TAGA 3HVRA 1QTMA 3I0RA 4I9QA 1W7AA 4ELUA 2B5JA 2UXCK 4WFBL 3BUZB 1Q82O 2HF4A 5EY4A 4DQRA 4CZGA 3QICA 3VQ8A 4H0XB 4FLTA 3EYZA 2OZMA 4RW4A 4FK4A 3KKRA 3LWLA 3RMAA 1NWKA 4DV6K 5M1QA 1KD1O 2VQFK 2V7ZA 1ZBHA 2OTJN 3ZCMA 4JI7K 5AQRA 4ISGA 2A1RA 4GKKK 4DWIA 3F73A 4BRKA 4AF1A 3WNHA 1VAZA 1ZBUA 2B6AA 1T8EA 2W40A 2P9SA 3ZSXA 4YDUA 4KHSA 3V9SA 2GV9A 3RWUA 4MDBA 4LSNA 4FOEA 3CPWM 4KH4A 3PV8A 3VESA 1GLLO 3O4WA 3QEWA 1L3SA 1YJNN 4I6MA 3O5BA 1HX1A 4FJ7A 2PBDA 4Z4GA 1JXEA 4BRPA 3OYBA 3L8BA 1NK4A 3O80A 1NBWA 2ATQA 2NRTA 3THXB 2VQEK 1D9FA 4JI4K 1S1TA 4IXCA 3WXKA 4FWRA 1RCHA 1JLFA 3P83D 3CERA 1N34K 4LF5K 1L3TA 3MEEA 4RCHA 5EOYA 4FLVA 2RE2A 4LFAK 3QNOA 4FYDA 1CZAN 3HZ6A 2PFUA 3VF6A 3V1RA 3K58A 5FPDA 2A1SA 3AVLA 4CJSA 1OKJA 1P8ZA 3F5TA 3J7ZO 1JL1A 4DUYK 3GBTA 2A40A 3D6RA 4JI6K 3H3OB 3CFOA 5AQFA 1E3MA 4ICLA 4CJ4A 3NF6A 3AA3A 3DXMB 1Q9XA 3NH0A 3ID8A 3RMDA 1C0GA 4E7IA 1GLCG 1HKBA 4FPAA 2BDPA 1QZ5A 1S1WA 4IOCL 3PLAA 1S6PA 3TABA 4FK0A 2NRHA 3K59A 1HRHA 3ZEUB 4DQQA 4KRFA 4CFAA 4KBOA 1TKDA 4YORA 4LF4K 1BGXT 5AZJB 5KGXA 4FK2A 4DTSA 3L3UA 3DOLA 3NF8A 4FLUA 4HCBA 4E1NA 2W6KA 4DR7K 2ASOA 3SJHA 4BE0A 1VRUA 2I5JA 1WSIA 2VG7A 1CXUA 1RILA 3HBTA 1TL1A 5AQPA 2O8EA 3LPTA 4B3TK 1LCUA 1KAXA 3K5NA 4JD2B 1VQ9N 3CCJN 4JK7A 1QZ6A 3NDKA 3K0SA 5KPTA 1KVBA 4JKHA 2DFHA 4CGDA 5I3UA 3BGRA 4DQIA 4FJJA 4K0KK 1CZ9A 5AQNA 1I39A 3BEXA 1N36K 1LAVA 3SPYA 1CXQA 3CCSN 3KLEA 4FJGA 5DMRA 3DLHA 3HRGA 5FPMA 3U9DA 3EE8A 4E7JA 4JKAA 4FLZA 2KW4A 1OH7A 3H46O 3SUPA 1VSJA 5TKWA 1YI2N 3OS2A 1VQ4N 2XRIA 3G4SN 2HMIA 2P9PB 3LAMA 4KH5A 3SK3A 1IBKK 3RVCA 3VEVA 1MWKA 2P9KB 2X6NA 3EE9A 3QLHA 1Z6RA 1NJYA 1XWLA 1WOQA 1NKCA 3P39A 4YOVA 2VWJA 1BU6O 2O8DA 3GOIA 1BDGA 1WSJA 3DI6A 2G8FA 4WFNL 2XO7A 4H0YB 3E1YA 3OJSA 2E20A 4HUGA 4DTPA 3PX0A 1FXXA 4LF7K 1S1XA 1TV6A 1V4SA 1SL0A 5FRNA 5AQYA 2ZJQL 5AFUA 4W5RA 2O8BB 1BWFO 1RDAA 3VQCA 3J7YP 2F8TA 1TK5A 1REVA 5AQVA 4B9VA 4JI2K 2V7YA 3ISNC 1ILYA 1J53A 3VEXA 2KHOA 4IZ9A 4ELTA 3MWPA 1HJRA 1OH6A 1B9DA 4PL7A 3EKSA 5AQQA 2QWPA 3SMPA 3O9QA 3CETA 4BC3A 3PSFA 3AA2A 4DQSA 3DLBA 4WFAL 4IBNA 5KQ8A 4BQLA 3VQAA 1UA1A 4JEPA 1VSKA 3QFUA 1E4FT 3KD1E 2OCEA 2BE2A 4O4GA 3D2EB 3LDNA 3ZT3A 2D0OA 1S1UA 1BQNA 4CW7B 1TGOA 5DK5A 4N56A 5AQHA 1BIUA 4H4MA 2IVNA 3CCQN 2HHVA 1DLOA 4DFPA 4JI8K 1BA0A 4FWLA 3DLGA 2IS3A 4W5QA 2FSKA 1C0TA 5KRSA 2DFFA 3A5NC 1NGIA 3AGKA 4DFJA 4BC4A 3MECA 2FLOA 4CK1A 4BGAA 3OYIA 3AVIA 4AM7A 4DTUA 1X9JA 3O3FA 2QWMA 4QAGA 4Q5VA 3MN6A 1HKCA 4OGEA 4M7XA 4B3OA 4EIAA 3ZSWA 2ASMA 4OPAA 2RHKA 1XC9A 4IEIA 4CF1A 3G6EN 3PIOL 2D0AA 3GE1A 4CK2A 5MLCQ 4ID5A 3UKUB 5J2PA 4QOZB 3ZT2A 2DTUA 3VQ4A 4K41A 4PQUA 4E7LA 4K25A 3L2WA 3T1HK 1BIZA 4C23A 1Q18A 3TAQA 2P1JA 4EZ6A 1TAUA 2QKBA 5BREA 4PKHA 1SL2A 3VENA 3VQBA 4BRLA 4DV3K 3AO5A 2HOEA 1HR0K 1RNHA 3IAYA 2O4IA 2ITGA 1IBLK 2NRZA 1RT6A 3AO1A 4CERA 3SPZA 2HBLA 4Z4CA 5LJWA 2PY5A 4CZHA 4FO0A 1FW6A 1KQSM 4HHTA 2QTDA 1QQNA 1RT2A 1KVAA 4C8NA 3G10A 1DTQA 4H0VB 1VRTA 3FFIA 1JCGA 3VEWA 4CHOA 4O0IA 3KVGA 1ZC6A 4CJ7A 1UOCA 3MDQA 4JI3K 4H0OA 5EU7A 1CZBA 4H5WA 3UKRA 4CJKA 3OYGA 2YJEA 2KFNA 2X78A 2RKIA 3FZLA 2OA8A 1RTDA 3V9WA 3KWGA 4CJEA 3VEZA 4F2RA 1FK9A 1RGIA 5KPZA 3QB0A 4IWVA 3MK6A 2HNDA 4KTWA 1BISA 3HT3A 3TARA 3CQYA 3MX5A 5F1XA 5C24A 4B3SK 4M3ZA 4C1NI 1QS4A 2RF2A 3I8BA 4M41A 4IKFA 1YJWN 1KLMA 3E9OA 5AQUA 2X6SA 4GV6A 4CE9A 1YJ9N 1C0UA 2FBTA 4NO7A 2ZJPL 4GW6A 3K5MA 3LP3A 4WQ5C 4FWSA 2F8SA 4AHTA 3D0PA 3AVHA 4DS5A 4OKKA 3KKSA 4CBXA 2YHBA 1WNSA 4NLCA 3EO3A 4BE1A 3BZCA 1KSPA 3LP1A 2Q3SA 1HPMA 4O8KA 4A2BA 4BC2A 1KAYA 1JJ2M 4FJNA 3WQUA 3FZFA 4XH4A 1JLAA 2YI1A 1A5VA 1RTIA 2JGUA 1LWEA 1EP4A 4BY9C 1X9SA 3NMUA 5J2MA 4OPKA 2UYTA 1RT3A 3VOVA 2AA4A 4CJUA 4CJFA 3T19A 2ZQBA 1TKTA 5AQIA 5GAHP 1WSFA 1RT4A 4DLEA 2HNZA 1XMQK 4JKGB 5DM6L 1N6QA 4FVUA 4JKEA 5AQJA 2I7NA 1KFSA 2HVIA 3LM2A 4RWTA 3E66A 3TTDA 3JSMA 3T69A 4AHSA 3CMEN 4KO0A 3F9KA 2IVPA 3HO1A 4DR3K 3VGKA 2P9NB 4A2AA 2JWKA 1YIJN 2WBNA 4FSVA 3HJFA 1QQMA 3KK2A 1ZBLA 2HBKA 3DLEA 4DTJA 3OYCA 1DEJA 3PX6A 4FJKA 1GLDG 3N4PA 4ELVA 1K8KA 1NM1A 2KZMA 1JLEA 2UUAK 2HHWA 2QWQA 2IVOA 1RBUA 2E6LA 2P51A 3VMFB 1N8RO 1U6ZA 3EEQA 2VGMA 1NK8A 2QKKA 5C0YA 3QFPA 1VQ8N 2OTLN 2Z1IA 3CFPA 5F2RA 1NGHA 2YHXA 3P1GA 4HWIA 3SV3A 4AHCA 4DR1K 1VQ5N 5KTQA 1BQMA 4CFCA 2Z1HA 3M5RA 1U04A 4DV1K 3D7EO 4H03B 2E2OA 4DTRA 1C0FA 1X1PA 3B6PA 4FW2A 3SBGA 4CIGA 5FRMA 3AY9A 5J1EA 4H5NA 3OYFA 1SKWA 2FF6A 3IFRA 3OYLA 1S72N 4JHDA 2P9UA 4E0DA 4FM0A 2V51B 3AAQA 1QQCA 2Q2RA 3C94A 2H3GX 1ASWA 3QINA 4YOXA 1NGGA 4FVMA 3O9TA 3ZT0A 1C6VA 4IFEA 1TUUA 5CY4A 4F3OA 4JLHA 3OA9A 1C1CA 2E4LA 3A0IX 4EHUA 4E19A 1YVNA 1FKOA 1FKPA 5FPNA 3HPGA 4FWOA 4FCYA 3ZETB 2YKMA 1GOAA 3WQTA 4LF8K 4YY3K 5HRNA 1Q9YA 3BDPA 3D2FB 5C12A 3OS0A 3K5LA 3AVGA 2P9IA 4NXNK 5E41A 1LWCA 3KWIA 3TAPA 1E4GT 1VQ6N 2IAJA 4WF9L 1N5YA 1T44A 4MO4A 2YHWA 2XY6A 4F8RA 1KC8O 1CLQA 3IMXA 4KHYA 4I2QA 3CJBA 1G15A 1WAFA 4QS7A 4IO9L 3JXUA 1S1VA 3OBYA 2P9LB 4LF6K 3NCIA 1EETA 4J2BA 4A61A 3P5JA 5CZ2A 3E01A 2P9SB 3HTVA 2HSTA 3TSUA 4DR6K 4FWMA 4AH9A 3M8RA 4BRIA 2WTUA 5C25A 2W6LA 3ZX3A 5J2QA 3LANA 4DU3A 4I6MB 4CZKA 3F9MA 4LD0A 1TL3A 4H5RA 1G99A 4CESA 4CHNA 4M7YA 1YXQA 2ZM6K 3A5OC 4FM2A 1NU0A 2WC9A 2BGGA 4FW1A 4AM6A 5JICA 2G8WA 4B1WB 4B3MK 5HP1A 1U45A 1LV5A 3SUQA 1JCEA 2ETJA 4PUOA 4O5BA 4IDKA 2O8CB 5BPNA 1ZBSA 3RMCA 1D4XA 3LDSA 1HNXK 2G8HA 3SUOA 3Q7CA 1NGJA 1VQON 4IJNA 4BR5A 4HTUA 1HQUA 4I7FA 1QQOA 1VSHA 2O8FB 3BF1A 1YITN 5C42A 3LDLA 5JVHL 2YHYA 3J81O 3NGYA 3CHWA 5AZIB 3QEVA 3CF5L 4A5AA 4MDAA 3O9UA 4CJQA 2ZE2A 4Z4FA 4DSFA 5LL6Z 4FJ5A 4GKJK 1RDWX 2HMPA 5FLXO 1KCFA 3QBXA 3HYFA 3O1WA 3ZEUA 3SAHA 4F2SA 1YF5L 5BR9A 4DV2K 2HF3A 3HSCA 3VF2A 4V19S 1TVRA 3MN7A 3MCPA 2HVHA 2JLEA 5AZJA 1VSMA 1HYSA 1NK5A 2X74A 5HRRA 4DG1A 3OYEA 1BCMA 4JI0K 3EKUA 1IV0A 3GG4A 1NK0A 4RW6A 3TANA 5C10A 2IGIA 3CYMA 3MX2A 4FZXC 3AGRA 2IDOA 3ZX0A 4M42A 4CF0A 4M3YA 4DTMA 3F2KA 2RPIA 3K5OA 3U8XA 2G8UA 3CPEA 2FXUA 3OYAA 2XHBA 3NFAA 4ISFA 4JD2A 4B9UA 3IRXA 3KK3A 1BUPA 2FBXA 4BRFA 1HLUA 4IOXA 2NRVA 5ELZA 1BG3A 4OPHA 1XNQK 3DAWA 4QS8A 1I3AA 3I0SA 4NYNA 1U2VA 1VSEA 4NXMK 3V1QA 4GVMA 4Z4EA 1IG8A 3AVNA 4BRAA 3GL1A 1S22A 3T3FA 3W3DA 4PKIA 5H1SQ 3TAEA 3FLCO 4A62A 2NLXA 1VSDA 1NGEA 3AO4A 1SV5A 4GV9A 3QBWA 5JVGL 4B8AB 1RT5A 4RG8A 4YOUA 2YNFA 5AFUH 3NGIA 4DQ8A 3SQ0A 2AP1A 3PSIA 2GWJA 3LL3A 2P9PA 1JXBA 4KV8A 3B6OA 3L0QA 4J8FA 4U67L 3S41A 1GOCA 5CE3A 1ASVA 3HP6A 3C7NA 2HBMA 3CJCA 1NJIO 4W5OA 4RW8A 4CF9A 2UUCK 2P5OA 4DR4K 4C8OA 1ESVA 3LM9A 1IKWA 5ADXA 4BRHA 1NGDA 2VGNA 1ZYQA 5K14A 1HNZK 4CHZA 3VTHA 2E6MA 3VPZA 4IO8A 3SZ2A 1OH5A 3CM5A 4DSLA 1IH7A 4N47A 3H1VX 2HW3A 3O4QA 1NGBA 1ASUA 3WXIA 3LDQA 5C2DA 2F7TA 2O8BA 3AA5X 2D1KA 3HI0A 2KLAA 2O8DB 3HM8A 2YCHA 5HOOA 5HROA 2GEMA 1Q7YO 4JS5A 3EZWA 1BI4B 4XEIA 3U3GA 4JV5K 1HNVA 2VYPA 3MEGA 2YV0X 1N32K 1R0AA 2EHGA 3ASMA 3LALA 4L3QA 4RW7A 1HJOA 1ZXOA 3DJCA 3DYAA 1EX4A 1TYQB 3AA4A 2G8IA 1S3XA 3ULEA 2OPRA 1WBBA 3IUCA 2WFBA 4BROA 3R6MA 3B8AX 4YHHK 1ITGA 5GADP 2V52B 4KFBA 4CBWA 2NZTA 4DV7K 4H5VA 3I56N 1M90O 5M1KA 4AHUA 2ZD1A 2EX3A 2CH5A 4BR0A 4E1MA 2QI2A 5EXWA 1LW0A 3NF7A 4HUFA 3ZX2A 4DF8A 2RN2A 1GOBA 4GNIA 3K57A 1QHTA 5AQLA 2WOMA 5CHIA 2CH6A 4BVPA 3CFRA 3C6AA 3TSQA 1XHZA 1EQYA 3DMJA 3TTCA 1Q86O 1K6YA 5B8HA 1ATRA 3WT0A 5GIOA 3U3YA 2GWKA 4GMJB 3QEIA 1GLBG 1DT9A 2KKZA 5LMNK 3OS1A 4JRPA 3R8EA 4DU1A 2F4VK 1H1VA 4CEFA 4PA1A 4NYFA 4B9SA 5JLHA 4BC5A 4Y1DA 1LW2A 2PYLA 4GY2B 1JKHA 4HTLA 4Z94A 5T7BA 2D0PA 2Q0UA 4GVEA 1P90A 3KIOA 4O44A 4H0TB 2D5RA 1ATSA 4DHYA 5AQKA 3ZSOA 3WEEB 4A5BA 1TK8A 3ZLJA 4CBUA 3KD5E 4JN4A 2YKNA 3AVKA 4OVLA 1KVCA 4FJHA 1W97L 1OH8A 1WN7A 2IC3A 1QHAA 1WBDA 2QEXN 3TR8A 4JAXA 1SAZA 3LAKA 3J8AA 2CGKA 5C15A 1XI1A 4ILJA 1BCOA 3LZJA 3LWMA 3NAEA 2P5GA 1T6CA 5KPRA 5GIPA 1M1KO 5JMVA 1VSFA 2LSNA 3A5MC 4JI1K 2F96A 3THYA 4W5TA 2IOCA 4CEDA 4DCHA 2Q97A 3ENOA 5A2QO 4YOWA 4XH5A 4AQYK 3V6DA 4CJWA 3VGMA 1VQNN 1NMNA 2ASPA 3PX4A 4FOIA 5CR4A 3TWHA 3FGUA 5LY3A 3QNNA 2Q36A 3UIQA 4IDHA 4NCBA 4M3WA 3JS6A 5E84A 4JK8A 1TAQA 4BG8A 1MDUB 1WAJA 1C1AA 3UKRB 4H5TA 3S3OA 1W2BM 3TAMA 2ZGYA 3MN5A 4B08A 3SQ4A 4CEZA 2ZJRL 3E9PA 1IO2A 4KKOA 4KAZA 4YFUA 3PIPL 2IIRA 1DKGD 3R9PA 3RSEA 1NJXA 5BPLA 4JI5K 3V1OA 4BRMA 2QXLA 1KXPA 4IG0A 4CECA 1VHXA 4JKBA 3FZHA 3H1QA 1NLVA 4X64K 1HYVA 3OYJA 3SUNA 3S3MA 4M3XA 4PWDA 1GLEG 2D0CA 3OYMA 3PO4A 3GDQA 2WONA 1X9WA 1DTTA 4CFBA 1TKZA 2OPQA 3ZSYA 4CCHA 4BRCA 1N33K 3SBTA 3HOTA 1D9DA 3SMSA 3ZSRA 3ENHA 3U4LA 3V9ZA 1XNRK 3SCXA 4KH6A 3J80O 3C6UA 5GAEP 4LSLA 3VF4A 4K8ZA 3TI0A 2HHXA 4BDZA 4KHQA 4CZIA 5DM7L 4EFHA 2YX6A 3AVJA 5SZTA 4JKGA 1WLJA 3E9LA 4DQPA 1KRPA 3HXMA 2Q31A 4Z4IA 2QM1A 3ZSVA 4BWJA 4DUZK 4OO1J 4MLHA 3V81A 4KPYA 3G71N 5M1NA 1JLCA 1WSHA 3VETA 4LC9B 2QXFA 4B1VA 4CJ5A 4CF8A 1T6DA 5CYQA 3CXCM 4X62K 2DFEA 2BTFA 4WE1A 3DXKB 2B4JA 3MN9A 4B9MA 2F9TA 1NGFA 2QWRA 3DRSA 2Q1NA 4Y1CA 3PY8A 1EWQA 3P4IA 5LJVA 5AQZA 3LP0A 4N5SA 4H8KA 3C65A 5EVZA 1KAZA 4PY5A 2Q0RA 2YHAA 1RDDA 4DTNA 2GX9A 1NOZA 3EL2A 3UB5A 1BOTO 3CJAA 3VQ6A 4CGHA 1NK9A 4OJRA 2FSJA 3M8PA 3AVFA 3VEYA 3DLKA 3DOKA 4EZ9A 4NLBA 3THWA 3SQ2A 4JYAK 2OPSA 4BDYA 2VWKA 3T7ZA 3TTFA 3CJ7A 3DWLA 3SV4A 2A42A 1Z05A 4KREA 3ZT4A 1VQMN 3KLFA 5KRTA 4C1NK 4A57A 4MFBA 1VSLA 2FSNA 1IKVA 5AQMA 5BRDA 3KLHA 3TU5A 4WCEL 3ZSZA 5BRFA 2DPNA 1BL3A 3EN9A 4CK3A 1L3VA 3PO5A 1J54A 2FBVA 3L2UA 3O9RA 1IJJA 5JS1A 3FR0A 4FJ8A 1C1BA 3QETA 1S5JA 5BN8A 5AQSA 5I9EB 4OX9K 5BR8K 4WYBA 1HQEA 4O8UA 1NJWA 4KB1A 4EP5A 4BG9A 1XHXA 1YUWA 4O5FA 3AVMA 4DFMA 1T7PA 1YVUA 4KI6A 4JHDB 2JWLA 2P9UB 3HPOA 3KZBA 4M3TA 3AO3A 3ZETA 4UY8O 3HP9A 2O4GA 3SLCA 3MXIA 3IG1A 3CCRN 1RDBA 1NNEA 5F0XA 4CEEA 4FJ9A 4OKJA 2KFZA 3D2FA 1U49A 4B1UB 5FDLA 3A5LC 3VQQA 4CZLA 3M3ZA 3RR8A 3RMBA 3ZT1A 1U48A 3H6EA 1X9MA 3CI5A 4HCCA 3AV9A 3VQPA 3NVMA 3WUHA 2P9LA 1IBMK 2QA4N 1SQKA 3HSTB 3CCVN 2P9IB 3LPUA 3THVA 3DLRA 2CGLA 2XY5A 3THXA 4CZEA 1L5UA 4DSJA 1SZ2A 2AJQA 5AQOA 3HM9A 4BR4A 2OYQA 4I9LA 4B1YB 4F4KA 1LOTB 4DF4A 2E1YA 3KLGA 5LMUK 3K2PA 1QVFM 4B9LA 5E26A 1QE1A 5AQTA 3JYTA 4CEQA 4CI6A 3MCAB 3KK7A 3VA3A 3OJUA 2W42A 2ZWHA 2PYJA 3AVAA 3OYNA 3LDPA 3OVNA 4NCGA 3I33A 1D5AA 3H45C 2O8CA 1OVQA 3SNNA 4AHVA 3SAFA 3VEOA 4BREA 2QWNA 4CZFA 3HL8A 4ID1A 1VSIA 3U9ZA 2O8FA 3DXMA 4E3SA 1NOYA 1YHQN 1XC3A 2QW9A 3I8DA 5AZIA 4KHNA 3NH2A 2DY4A 4N76A 2NNWA 5HLFA 4C8KA 1IKYA 1S9EA 2E2PA 3VQ7A 3SYZA 1W0HA 3M6GA 4OGCA 2HBJA 5BPMA 2YNHA 3C6HA 3ZSQA 5M1FA 4LH5A 4BRNA 3CM6A 4CF2A 3QO9A 4BR9A 1QSSA 1EWRA 1KLNA 2D0BA 1ZBFA 4WQ5A 4BWMA 3MMVA 3RR7A 2E2NA 4BRQA 5FPEA 5AJ3K 4Z0UA 4JNEA 1JCFA 3WXMB 4M45A 3JAMO 1NK6A 1DGKN 4DTXA 4BR7A 1HKGA 4RW9A 3D45A 3CCUN 5I42A 4YOTA 2XY8A 2GTDA 4AHRA 1SUQA 4JKCA 1UAXA 5SWMA 2YNIA 3K9KA 1WSGA 5KQDA 5HBMA 1VK0A 3CMAN 4CEBA 1V4TA 2A3ZA 3OYDA 4PKGA 4JK9A 2OANA 2VG5A 3BP8A 3QIOA 4O55A 1JL2A 1TKXA 5ADXH 1MWMA 1VQ7N 4CGIA 1HUXA 3CIPA 1J9AA 1U47A 4E1JA 2O8EB 3SJJA 3ALYA 3Q7BA 3KK1A 1IKXA 1I94K 3OYKA 3AVBA 4FJXA 3CJ9A 3HK2A 4PHTX 1Y97A 2A6AA 3DRRA 5CYMA 3VERA 3OTOK 4JKDA 4H4OA 2W41A 3L2RA 1U2VB 4M3RA 2HHTA 3AAPA 4IFYA 1GLAG 4OKEA 5D3GA 3P38A 3KJVA 1BO5O 1Z26A 2FF3B 4L8RB 2PAVA 4JS4A 5BRHA 1RTJA 3MXMA 2BUPA 1TK0A 2HHUA 2J4RA 3FZMA 1NJZA 3O4NA 1RBVA 3QEPA 2YNGA 5M1PA 3CG7A 1S6QA 3IDHA 2P9KA 3H08A 4FJIA 4J2DA 1EO1A 4B9QA 3VTIA 3DLLL 1JLBA 2E2QA 4KHPK 4C8LA 2XY7A 4DV5K 4LF9K 1YAGA 3CQXA 4NB4A 4DU4A 3T1YK 3P31A 4DSKA 3V4IA 5AQXA 1NG9A 2E1ZA 4ILHA 3MAQA 2ZGZA 1YTUA 3OBWA 1SS6A 3W0LA 3C7NB 1D8YA 4FLXA 3EZ5A 3HVTA 2UXBK 3R3LA 1NK7A 4HVJA 5TKYA 4XH1A
chains in the Genus database with same CATH topology
2QEXN 1NGCA 2WBNA 4FSVA 4JAXA 3O9SA 1SAZA 5EOYA 1QQMA 2RE2A 2CGKA 3J8AA 5C15A 2HBKA 1CZAN 3HZ6A 4ILJA 1XQSC 3FZKA 1DEJA 2PFUA 4R79A 1GLDG 1T6CA 3N4PA 5KPRA 3VF6A 5GIPA 5JMVA 1M1KO 1K8KA 1NM1A 5FPDA 3A5MC 1VQKN 1OKJA 1P8ZA 2QWQA 3F5TA 2IVOA 3J7ZO 3VMFB 1N8RO 4DCHA 1U6ZA 2Q97A 2VGMA 3ENOA 2A40A 3D6RA 3GBTA 4XH5A 4BR2A 4YOWA 3QFPA 1VQ8N 5C0YA 2OTLN 4YOYA 3H3OB 5AQFA 3VGMA 4K42A 3DXMB 1R59O 5F2RA 1VQNN 1NGHA 2YHXA 3ID8A 2ASPA 4HWIA 1C0GA 4FOIA 5CR4A 1GLCG 1Y64A 1HKBA 3FGUA 5LY3A 2Q36A 1VQ5N 4IDHA 1TYQA 4FPAA 1RFQA 2A41A 1GLFO 3JS6A 3M5RA 4JK8A 5E84A 1QZ5A 3O08A 4BG8A 4IOCL 4WQ4C 3D7EO 3PLAA 4FWKA 5AQGA 3MWTA 1MDUB 2E2OA 4H03B 3UKRB 4H5TA 1C0FA 2NRHA 3SBGA 3ZEUB 1W2BM 3AY9A 4KBOA 2ZGYA 3MN5A 4H5NA 3VGLA 4YORA 4FPBA 3D2EA 2FF6A 3IFRA 4BRDA 2ZJRL 3E9PA 4FWNA 5AZJB 1S72N 3K9JA 3HOSA 4JHDA 2P9UA 2V51B 3AAQA 3PIPL 3ULEB 2Q2RA 2IIRA 4YOXA 2H3GX 1NGGA 3L4QA 1DKGD 2ASOA 5AQWA 3O9TA 3SJHA 3UE5A 3R9PA 4IFEA 2YJFA 3RSEA 1TUUA 5BPLA 4BRMA 2QXLA 1KXPA 4Y0WA 3ZYYX 3HBTA 4JKBA 3FZHA 3H1QA 3OA9A 1NLVA 5AQPA 1GLEG 1ATNA 1LCUA 3A0IX 1KAXA 4EHUA 3GDQA 2ITMA 4JD2B 1VQ9N 3CCJN 1YVNA 4JK7A 5FPNA 1YIJN 1QZ6A 4FWOA 3ZETB 2GELA 3WQTA 4BRCA 2A5XA 3SBTA 5KPTA 4JKHA 3HOTA 3D2FB 5C12A 3SMSA 3ENHA 2P9IA 3U4LA 4DKWA 3KWIA 5AQNA 3BEXA 1K8AO 4KH6A 1E4GT 1VQ6N 4WF9L 3CCSN 5GAEP 3CC7N 3VF4A 1T44A 3R1XA 4MO4A 2YHWA 4CZIA 3UKUA 4H0PA 5DM7L 1KC8O 3H3NO 3HRGA 3IMXA 3CJBA 4EFHA 2YX6A 1GLJO 2F9WA 5FPMA 3U9DA 4QS7A 4IO9L 3JXUA 3O8MA 5C2FA 1X3MA 3OBYA 3EE8A 4JKGA 2P9LB 4JKAA 2QWLA 3H46O 3E9LA 5TKWA 1YI2N 1Q81O 1VQ4N 4A59A 4A61A 3CCLN 2Q31A 3KHYA 4F9OA 2P9SB 3G4SN 3HTVA 2P9PB 2QM1A 2VWBA 4YDUC 4OO1J 4GV3A 4MLHA 2HSTA 3TSUA 4JKFA 4KH5A 3WEEA 3G71N 4FWMA 3SK3A 5M1NA 4BRIA 3VETA 3RVCA 1BA1A 4LC9B 3VEVA 3ZX3A 4B1VA 3FE1A 1MWKA 1T6DA 3CXCM 2P9KB 4I6MB 4CZKA 3F9MA 2BTFA 2EWSA 3DXKB 3EE9A 3C0BA 1Z6RA 3MN9A 2F9TA 2QWRA 1NGFA 1G99A 1WOQA 2Q1NA 4H5RA 3P39A 4YOVA 1QVGM 2NRWA 4M7YA 1BU6O 3P4IA 5LJVA 1YXQA 5AQZA 3GOIA 3A5OC 2WC9A 2ZF5O 3C65A 1BDGA 1KAZA 3G25A 5EVZA 2Q0RA 4AM6A 5JICA 4B1WB 1RDUA 4WFNL 4PL8A 1JCEA 2GX9A 3EL2A 4H0YB 3UB5A 1BOTO 5BPNA 3CJAA 3E1YA 1ZBSA 3WXLA 2E20A 1D4XA 2FSJA 3Q7CA 1NGJA 1VQON 4IJNA 4BR5A 1V4SA 5AQYA 2ZJQL 3VEYA 1QQOA 5AFUA 3FFKB 3BF1A 1YITN 3AARA 1OVYA 3LDLA 5JVHL 1BWFO 2YHYA 4NLBA 3CHWA 1T3VA 5AZIB 3T7ZA 3TTFA 3CJ7A 3DWLA 3CF5L 4A5AA 4MDAA 2A42A 3O9UA 1Z05A 3O1BA 3ATVA 5AQVA 1RDWX 2HMPA 2V7YA 1VQMN 1ILYA 3QBXA 1VQPN 4C1NK 4A57A 3VEXA 4CD3A 2KHOA 2FSNA 3O1WA 4IZ9A 5AQMA 3ZEUA 4B1ZA 3ID6A 3MWPA 3SAHA 1YF5L 2CGJA 5BR9A 1K73O 4BQZA 4PL7A 5BRDA 3IKMA 3TU5A 2HF3A 3EKSA 3HSCA 5AQQA 3VF2A 4WCEL 3MN7A 5BRFA 2DPNA 2QWPA 3O9QA 3SMPA 3CETA 3MCPA 4BC3A 5AZJA 4MLEA 3EN9A 4RTFD 3EKUA 4WFAL 5KQ8A 4BQLA 3N4QA 4JEPA 3GG4A 2WUSA 3O9RA 1IJJA 3OHRA 4BRGA 5C10A 3FR0A 3I55N 3QFUA 3MX2A 3AGRA 1E4FT 5GINA 3ZX0A 5BN8A 5AQSA 5I9EB 3F2KA 4WYBA 4O8UA 3U8XA 5HL7L 3CPEA 3D2EB 3LDNA 2FXUA 1YUWA 2D0OA 4BG9A 4O5FA 4QS9A 4ISFA 3NVKA 4JD2A 4JHDB 2P9UB 2JWLA 3KZBA 1BUPA 5AQHA 4BRFA 1HLUA 4IOXA 3L6QA 2NRVA 5ELZA 5M1OA 3ZETA 4UY8O 1BG3A 4OPHA 3DAWA 4QS8A 3SLCA 3CCRN 5F0XA 1U2VA 3RSEB 1IG8A 3D2FA 2IVNA 3CCQN 4B1UB 3A5LC 4BRAA 4CZLA 1BA0A 3GL1A 1S22A 4FWLA 3W3DA 4PKIA 2BH1A 2FSKA 3M3ZA 2E88A 3TPQA 5H1SQ 3A5NC 1TUYA 3QMLA 1NGIA 4FWPA 4U7BA 3FLCO 3AGKA 4A62A 4BC4A 1NGAA 2FLOA 2NLXA 1J6ZA 3TSPA 4BGAA 3H6EA 1NGEA 3CI5A 1X9JA 4AM7A 2QWMA 4GV9A 3QBWA 3NVMA 5JVGL 4FL9A 4IJAA 3WUHA 3MN6A 3LDOA 2P9LA 1HKCA 2QA4N 4YOUA 4M7XA 2E8AA 1SQKA 3CC2N 5AFUH 4DQ8A 3CCVN 4EIAA 2NRXA 2P9IB 2AP1A 2GWJA 2QWOA 2ASMA 4OPAA 4IEEA 3LL3A 2CGLA 2P9PA 4CZEA 2RHKA 4IEIA 1SZ2A 3G6EN 3L0QA 5AQOA 3PIOL 3GE1A 4J8FA 4BR4A 4U67L 3L4IA 3S41A 4B1YB 1VQLN 5CE3A 5TKYA 5MLCQ 3O6WA 3UKUB 1LOTB 3C7NA 2HBMA 3CJCA 4CZMA 3CD6N 2E1YA 4K41A 1NJIO 2VCPA 4K25A 1QVFM 4EHTA 3A8YA 4C23A 1Q18A 2P9NA 3DXKA 5E26A 4CZJA 1ESVA 3LM9A 5ADXA 5AQTA 4B1XB 1NGDA 2VGNA 4BRHA 4CI6A 3OW2M 2D4WA 4BGBA 4PKHA 5BREA 3MCAB 3CC4N 4ISEA 3KK7A 3VTHA 3VENA 2I7PA 1K9MO 4BRLA 3VPZA 4IO8A 2HOEA 2ZWHA 3CCMN 3H1VX 2NRZA 3LDPA 4K43A 3I33A 3H45C 2HBLA 5GAGP 5LJWA 5JLFA 4FVUA 4BVOA 1NGBA 1X3NA 4FO0A 4CZHA 3SAFA 1O13A 3WXIA 3VEOA 3LDQA 1KQSM 4BREA 5C2DA 2QWNA 3CJ1A 2QTDA 1QQNA 4CZFA 4MO5A 1WUAA 3U9ZA 2F7TA 3DXMA 1YHQN 1XC3A 2QW9A 4H0VB 1JCGA 1NMDA 2D1KA 3HI0A 2KLAA 3HM8A 2YCHA 5AZIA 3VEWA 5HOOA 3BF3A 4FWQA 2GEMA 4WQ4A 3KVGA 4DB3A 2NNWA 1Q7YO 1ZC6A 3EZWA 3SAGA 4CJ7A 1K8KB 2E2PA 3MDQA 4M63C 3ENBA 4H0OA 3M6GA 5AR0A 2HBJA 4H5WA 4XEIA 3UKRA 5BPMA 3CCEN 3C6HA 2YJEA 1XUPO 5M1FA 1MA9B 2VYPA 4BRNA 3FZLA 4BR9A 4L3QA 3KWGA 1HJOA 3VEZA 1ZXOA 4IOAL 3DJCA 3WXJA 1RGIA 2NRRA 3ATUA 3M1FA 5EX5A 4WQ5A 5KPZA 1TYQB 4EAHD 3MMVA 3QB0A 1S3XA 3ULEA 4IWVA 3MK6A 2E2NA 4BRQA 5FPEA 3CQYA 3MX5A 5F1XA 4JNEA 1JCFA 2GUPA 3WXMB 1DGKN 4BR7A 3IUCA 4ILGB 2WFBA 4C1NI 4CD1A 1HKGA 4BROA 5BN9A 3R6MA 3I8BA 3QDKA 3CCUN 3B8AX 4YOTA 5GADP 2GTDA 2V52B 1YJWN 4JKCA 3E9OA 3K9KA 5AQUA 4CBWA 2NZTA 5KQDA 1YJ9N 4GV6A 4H5VA 3I56N 4NO7A 1M90O 3CMAN 5M1KA 2ZJPL 1V4TA 2A3ZA 4PKGA 4JK9A 2OANA 3BP8A 4WQ5C 4FWSA 4WFBL 3BUZB 1Q82O 2CH5A 2HF4A 4BR0A 5EY4A 2QI2A 3QICA 5EXWA 4CBXA 4CZGA 1MWMA 5ADXH 1VQ7N 4NLCA 3ZX2A 1HUXA 3CIPA 3EO3A 4H0XB 4GNIA 4E1JA 3Q7BA 1NWKA 5AQLA 5CHIA 5M1QA 1HPMA 2CH6A 4O8KA 1KD1O 3CJ9A 4A2BA 4BC2A 1KAYA 4PHTX 1JJ2M 2V7ZA 3WQUA 2A6AA 4BVPA 3FZFA 3VERA 3C6AA 4XH4A 4JKDA 3TSQA 2OTJN 2W41A 5AQRA 1EQYA 4ISGA 3TTCA 1U2VB 2YI1A 3AAPA 1GLAG 1Q86O 4BRKA 5B8HA 4BY9C 4AF1A 1ATRA 1VAZA 3P38A 3WT0A 5GIOA 3NMUA 2W40A 1BO5O 2P9SA 4YDUA 2GWKA 2FF3B 4MDBA 2UYTA 2PAVA 3VOVA 1GLBG 1DT9A 2AA4A 2KKZA 4FOEA 5BRHA 3CPWM 4KH4A 3R8EA 2BUPA 2J4RA 3FZMA 3VESA 1GLLO 5AQIA 3O4WA 1H1VA 5GAHP 5M1PA 5JLHA 3IDHA 4BC5A 2P9KA 4I6MA 1YJNN 4GY2B 3O5BA 4HTLA 4Z94A 4JKGB 5DM6L 2D0PA 1EO1A 4B9QA 2Q0UA 1HX1A 4GVEA 4JKEA 1P90A 2PBDA 5AQJA 2I7NA 3VTIA 3DLLL 2E2QA 4BRPA 4G9ZA 4H0TB 3O80A 1NBWA 2NRTA 1YAGA 3CQXA 4NB4A 3P31A 3LM2A 4RWTA 1ATSA 4DHYA 3E66A 5AQXA 3TTDA 3T69A 5AQKA 2E1ZA 4ILHA 3WEEB 4A5BA 2ZGZA 3CMEN 3OBWA 4CBUA 1SS6A 4IXCA 3W0LA 2IVPA 3C7NB 4FWRA 3WXKA 4JN4A 3R3LA 3CERA 3VGKA 1W97L 2P9NB 1QHAA 4A2AA 4RCHA 2JWKA 4XH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC9 A;  2WBN A;  4DKW A; 
#chains in the Genus database with same CATH topology
 1NGC A;  3O9S A;  4OLA A;  4CEO A;  1RBS A;  1XQS C;  3FZK A;  3NE6 A;  4K8X A;  4R79 A;  4NCA A;  2HHH K;  2QK9 A;  1VQK N;  1BI4 A;  1J5O A;  3M8Q A;  4BR2 A;  4FLW A;  3LP2 A;  4YOY A;  3M8S A;  1WB9 A;  4K42 A;  1R59 O;  2KQ2 A;  4LFB K;  4J2A A;  4FLY A;  1HNI A;  2KTQ A;  3C6T A;  4CFD A;  1HYZ A;  1Y64 A;  3PUF A;  1TYQ A;  3T1A A;  5IT9 O;  1RFQ A;  2A41 A;  1GLF O;  3O08 A;  4WQ4 C;  1SKS A;  4FWK A;  5AQG A;  3MWT A;  2HNY A;  4W5N A;  2NUB A;  1KTQ A;  1RT1 A;  3L2V A;  5HRP A;  3VGL A;  1RT7 A;  4DSI A;  4FPB A;  3D2E A;  1EXQ A;  4FZZ A;  2FC0 A;  4BRD A;  4DLG A;  4E7H A;  4TSX A;  1C0M A;  4FWN A;  4FJL A;  4KHU A;  3K9J A;  3HOS A;  3LZI A;  1HMV A;  4FXD A;  3ULE B;  3L4Q A;  5AQW A;  3UE5 A;  4ZHR A;  2YJF A;  3QES A;  2HB5 A;  4DV4 K;  4Y0W A;  3ZYY X;  4CJT A;  2GUI A;  3QEX A;  1ATN A;  3S3N A;  3RTV A;  2ITM A;  4DV0 K;  3J7A P;  3G0Z A;  4DFK A;  4CGG A;  4CJV A;  1HNW K;  2GEL A;  2A5X A;  3ITH A;  1B9F A;  4CEA A;  4JRQ A;  4LY7 A;  2KZZ A;  3QIP A;  4DKW A;  4B9N A;  1K8A O;  4FM1 A;  3CC7 N;  2HHQ A;  3R1X A;  3UKU A;  4H0P A;  3H3N O;  4DMN A;  4CHQ A;  1GLJ O;  3VQ9 A;  2F9W A;  3VQE A;  4X65 K;  4XIU A;  3O8M A;  5C2F A;  1X3M A;  3U6F A;  5IWA K;  2UU9 K;  2QWL A;  2Y1I A;  4FZY A;  3WNE A;  1HPZ A;  4E89 A;  1Q81 O;  4A59 A;  4Z4H A;  3CCL N;  3KHY A;  4F9O A;  1T03 A;  2Y1J A;  2VWB A;  4YDU C;  4GV3 A;  1O1W A;  1W9H A;  4JKF A;  3WEE A;  1Z25 A;  1BA1 A;  4CIE A;  4CJ3 A;  3FE1 A;  2EWS A;  4CJR A;  3C0B A;  3WNF A;  1QVG M;  2NRW A;  4CGJ A;  3SQ1 A;  4KB0 A;  2ZF5 O;  1FJG K;  3G25 A;  3HPH A;  4IG3 A;  4QCL A;  1RDU A;  2PZS A;  4PL8 A;  3V9U A;  4LH4 A;  4MQ3 A;  3WXL A;  1YT3 A;  3FFK B;  1IG9 A;  3AAR A;  1OVY A;  1NKE A;  1LWF A;  1UA0 A;  2Z1G A;  4BDP A;  1T3V A;  4Q0B A;  4EP4 A;  3CQ8 A;  3S9H A;  4DS4 A;  1RBR A;  1RDC A;  3O1B A;  2G8K A;  3THY B;  4ZTJ A;  3ATV A;  4CJL A;  1SL1 A;  4HUE A;  1VQP N;  4CD3 A;  4O0J A;  4B1Z A;  4G9Z A;  1K73 O;  4BAC A;  3ID6 A;  2CGJ A;  4BQZ A;  4KTQ A;  3IKM A;  2UUB K;  3VQD A;  4MLE A;  1UWB A;  3L2Q A;  4RTF D;  3SI6 A;  1QSY A;  4CHY A;  4AIL C;  4X66 K;  3N4Q A;  2WUS A;  3OHR A;  4BRG A;  3I55 N;  5J2N A;  1BHL A;  5GIN A;  2R7Y A;  1T05 A;  5HL7 L;  1MU2 A;  3O3G A;  4QS9 A;  4B8C A;  3EY1 A;  4IFV A;  3MED A;  1RTH A;  1WSE A;  1YTA A;  1JLQ A;  3NVK A;  2BAN A;  4DR5 K;  2GBZ A;  3L6Q A;  5HRS A;  5M1O A;  5KI6 A;  3A2F A;  3OYH A;  4BE2 A;  3RSE B;  4OPJ A;  3AVC A;  4CGF A;  4B3R K;  1A5W A;  3RRG A;  2BH1 A;  2E88 A;  3NBP A;  3TPQ A;  3ULD A;  1TUY A;  3QML A;  4U7B A;  4FWP A;  1B92 A;  1NGA A;  1J5E K;  4N41 A;  1J6Z A;  3TSP A;  1QSL A;  2FBY A;  4FL9 A;  4IJA A;  3KLI A;  4E7K A;  4LFC K;  3LDO A;  1SKR A;  2OPP A;  2VG6 A;  2E8A A;  3CC2 N;  5JS2 A;  2NRX A;  3C95 A;  1ZBI A;  2QWO A;  4KTZ A;  2OZS A;  1RBT A;  4IEE A;  4C8M A;  3DRP A;  4DR2 K;  4CVN E;  3KTQ A;  2Z1J A;  3L4I A;  1VQL N;  4FJM A;  1LAW A;  3BZK A;  3O6W A;  4YNQ A;  4CIF A;  4CZM A;  4M3U A;  4I2P A;  3CD6 N;  1KFD A;  5CZ1 A;  4OLB A;  2VCP A;  3L3V A;  4EHT A;  3A8Y A;  4J2E A;  2P9N A;  3DXK A;  4CZJ A;  4R5P A;  3NGZ A;  3VN5 A;  3OY9 A;  4F3T A;  4B1X B;  5FRO A;  3OW2 M;  3DM2 A;  1EKE A;  2D4W A;  4KI4 A;  4BGB A;  2HHS A;  3CC4 N;  3IS9 A;  4ISE A;  4ZTF A;  3VA0 A;  2I7P A;  4CHP A;  1Q8I A;  1K9M O;  2UXD K;  1A5X A;  1F21 A;  3CCM N;  4K43 A;  5GAG P;  5JLF A;  4BVO A;  1X3N A;  2E5L K;  3VQ5 A;  1O13 A;  5KGW A;  3CJ1 A;  4B9T A;  3MXJ A;  4MO5 A;  1WUA A;  4CJP A;  4DTO A;  1NMD A;  3BY5 A;  1U4B A;  3NH1 A;  3BF3 A;  4FWQ A;  4WQ4 A;  4DB3 A;  3SAG A;  1K8K B;  3AO2 A;  4M63 C;  3ENB A;  5AR0 A;  3CCE N;  3O3H A;  4DSE A;  1XUP O;  1MA9 B;  1NKB A;  1S9G A;  1JLG A;  1XMO K;  4KHW A;  3V9X A;  3WNG A;  4IOA L;  3NF9 A;  3WXJ A;  3THW B;  2NRR A;  3ATU A;  3M1F A;  5EX5 A;  4G1Q A;  2G8V A;  4EAH D;  3TAF A;  3NHG A;  3RRH A;  2GUP A;  1L3U A;  4ILG B;  4CD1 A;  5BN9 A;  3QDK A;  3QER A;  4UQG A;  3TAG A;  3HVR A;  1QTM A;  3I0R A;  4I9Q A;  1W7A A;  4ELU A;  2B5J A;  2UXC K;  4WFB L;  3BUZ B;  1Q82 O;  2HF4 A;  5EY4 A;  4DQR A;  4CZG A;  3QIC A;  3VQ8 A;  4H0X B;  4FLT A;  3EYZ A;  2OZM A;  4RW4 A;  4FK4 A;  3KKR A;  3LWL A;  3RMA A;  1NWK A;  4DV6 K;  5M1Q A;  1KD1 O;  2VQF K;  2V7Z A;  1ZBH A;  2OTJ N;  3ZCM A;  4JI7 K;  5AQR A;  4ISG A;  2A1R A;  4GKK K;  4DWI A;  3F73 A;  4BRK A;  4AF1 A;  3WNH A;  1VAZ A;  1ZBU A;  2B6A A;  1T8E A;  2W40 A;  2P9S A;  3ZSX A;  4YDU A;  4KHS A;  3V9S A;  2GV9 A;  3RWU A;  4MDB A;  4LSN A;  4FOE A;  3CPW M;  4KH4 A;  3PV8 A;  3VES A;  1GLL O;  3O4W A;  3QEW A;  1L3S A;  1YJN N;  4I6M A;  3O5B A;  1HX1 A;  4FJ7 A;  2PBD A;  4Z4G A;  1JXE A;  4BRP A;  3OYB A;  3L8B A;  1NK4 A;  3O80 A;  1NBW A;  2ATQ A;  2NRT A;  3THX B;  2VQE K;  1D9F A;  4JI4 K;  1S1T A;  4IXC A;  3WXK A;  4FWR A;  1RCH A;  1JLF A;  3P83 D;  3CER A;  1N34 K;  4LF5 K;  1L3T A;  3MEE A;  4RCH A;  5EOY A;  4FLV A;  2RE2 A;  4LFA K;  3QNO A;  4FYD A;  1CZA N;  3HZ6 A;  2PFU A;  3VF6 A;  3V1R A;  3K58 A;  5FPD A;  2A1S A;  3AVL A;  4CJS A;  1OKJ A;  1P8Z A;  3F5T A;  3J7Z O;  1JL1 A;  4DUY K;  3GBT A;  2A40 A;  3D6R A;  4JI6 K;  3H3O B;  3CFO A;  5AQF A;  1E3M A;  4ICL A;  4CJ4 A;  3NF6 A;  3AA3 A;  3DXM B;  1Q9X A;  3NH0 A;  3ID8 A;  3RMD A;  1C0G A;  4E7I A;  1GLC G;  1HKB A;  4FPA A;  2BDP A;  1QZ5 A;  1S1W A;  4IOC L;  3PLA A;  1S6P A;  3TAB A;  4FK0 A;  2NRH A;  3K59 A;  1HRH A;  3ZEU B;  4DQQ A;  4KRF A;  4CFA A;  4KBO A;  1TKD A;  4YOR A;  4LF4 K;  1BGX T;  5AZJ B;  5KGX A;  4FK2 A;  4DTS A;  3L3U A;  3DOL A;  3NF8 A;  4FLU A;  4HCB A;  4E1N A;  2W6K A;  4DR7 K;  2ASO A;  3SJH A;  4BE0 A;  1VRU A;  2I5J A;  1WSI A;  2VG7 A;  1CXU A;  1RIL A;  3HBT A;  1TL1 A;  5AQP A;  2O8E A;  3LPT A;  4B3T K;  1LCU A;  1KAX A;  3K5N A;  4JD2 B;  1VQ9 N;  3CCJ N;  4JK7 A;  1QZ6 A;  3NDK A;  3K0S A;  5KPT A;  1KVB A;  4JKH A;  2DFH A;  4CGD A;  5I3U A;  3BGR A;  4DQI A;  4FJJ A;  4K0K K;  1CZ9 A;  5AQN A;  1I39 A;  3BEX A;  1N36 K;  1LAV A;  3SPY A;  1CXQ A;  3CCS N;  3KLE A;  4FJG A;  5DMR A;  3DLH A;  3HRG A;  5FPM A;  3U9D A;  3EE8 A;  4E7J A;  4JKA A;  4FLZ A;  2KW4 A;  1OH7 A;  3H46 O;  3SUP A;  1VSJ A;  5TKW A;  1YI2 N;  3OS2 A;  1VQ4 N;  2XRI A;  3G4S N;  2HMI A;  2P9P B;  3LAM A;  4KH5 A;  3SK3 A;  1IBK K;  3RVC A;  3VEV A;  1MWK A;  2P9K B;  2X6N A;  3EE9 A;  3QLH A;  1Z6R A;  1NJY A;  1XWL A;  1WOQ A;  1NKC A;  3P39 A;  4YOV A;  2VWJ A;  1BU6 O;  2O8D A;  3GOI A;  1BDG A;  1WSJ A;  3DI6 A;  2G8F A;  4WFN L;  2XO7 A;  4H0Y B;  3E1Y A;  3OJS A;  2E20 A;  4HUG A;  4DTP A;  3PX0 A;  1FXX A;  4LF7 K;  1S1X A;  1TV6 A;  1V4S A;  1SL0 A;  5FRN A;  5AQY A;  2ZJQ L;  5AFU A;  4W5R A;  2O8B B;  1BWF O;  1RDA A;  3VQC A;  3J7Y P;  2F8T A;  1TK5 A;  1REV A;  5AQV A;  4B9V A;  4JI2 K;  2V7Y A;  3ISN C;  1ILY A;  1J53 A;  3VEX A;  2KHO A;  4IZ9 A;  4ELT A;  3MWP A;  1HJR A;  1OH6 A;  1B9D A;  4PL7 A;  3EKS A;  5AQQ A;  2QWP A;  3SMP A;  3O9Q A;  3CET A;  4BC3 A;  3PSF A;  3AA2 A;  4DQS A;  3DLB A;  4WFA L;  4IBN A;  5KQ8 A;  4BQL A;  3VQA A;  1UA1 A;  4JEP A;  1VSK A;  3QFU A;  1E4F T;  3KD1 E;  2OCE A;  2BE2 A;  4O4G A;  3D2E B;  3LDN A;  3ZT3 A;  2D0O A;  1S1U A;  1BQN A;  4CW7 B;  1TGO A;  5DK5 A;  4N56 A;  5AQH A;  1BIU A;  4H4M A;  2IVN A;  3CCQ N;  2HHV A;  1DLO A;  4DFP A;  4JI8 K;  1BA0 A;  4FWL A;  3DLG A;  2IS3 A;  4W5Q A;  2FSK A;  1C0T A;  5KRS A;  2DFF A;  3A5N C;  1NGI A;  3AGK A;  4DFJ A;  4BC4 A;  3MEC A;  2FLO A;  4CK1 A;  4BGA A;  3OYI A;  3AVI A;  4AM7 A;  4DTU A;  1X9J A;  3O3F A;  2QWM A;  4QAG A;  4Q5V A;  3MN6 A;  1HKC A;  4OGE A;  4M7X A;  4B3O A;  4EIA A;  3ZSW A;  2ASM A;  4OPA A;  2RHK A;  1XC9 A;  4IEI A;  4CF1 A;  3G6E N;  3PIO L;  2D0A A;  3GE1 A;  4CK2 A;  5MLC Q;  4ID5 A;  3UKU B;  5J2P A;  4QOZ B;  3ZT2 A;  2DTU A;  3VQ4 A;  4K41 A;  4PQU A;  4E7L A;  4K25 A;  3L2W A;  3T1H K;  1BIZ A;  4C23 A;  1Q18 A;  3TAQ A;  2P1J A;  4EZ6 A;  1TAU A;  2QKB A;  5BRE A;  4PKH A;  1SL2 A;  3VEN A;  3VQB A;  4BRL A;  4DV3 K;  3AO5 A;  2HOE A;  1HR0 K;  1RNH A;  3IAY A;  2O4I A;  2ITG A;  1IBL K;  2NRZ A;  1RT6 A;  3AO1 A;  4CER A;  3SPZ A;  2HBL A;  4Z4C A;  5LJW A;  2PY5 A;  4CZH A;  4FO0 A;  1FW6 A;  1KQS M;  4HHT A;  2QTD A;  1QQN A;  1RT2 A;  1KVA A;  4C8N A;  3G10 A;  1DTQ A;  4H0V B;  1VRT A;  3FFI A;  1JCG A;  3VEW A;  4CHO A;  4O0I A;  3KVG A;  1ZC6 A;  4CJ7 A;  1UOC A;  3MDQ A;  4JI3 K;  4H0O A;  5EU7 A;  1CZB A;  4H5W A;  3UKR A;  4CJK A;  3OYG A;  2YJE A;  2KFN A;  2X78 A;  2RKI A;  3FZL A;  2OA8 A;  1RTD A;  3V9W A;  3KWG A;  4CJE A;  3VEZ A;  4F2R A;  1FK9 A;  1RGI A;  5KPZ A;  3QB0 A;  4IWV A;  3MK6 A;  2HND A;  4KTW A;  1BIS A;  3HT3 A;  3TAR A;  3CQY A;  3MX5 A;  5F1X A;  5C24 A;  4B3S K;  4M3Z A;  4C1N I;  1QS4 A;  2RF2 A;  3I8B A;  4M41 A;  4IKF A;  1YJW N;  1KLM A;  3E9O A;  5AQU A;  2X6S A;  4GV6 A;  4CE9 A;  1YJ9 N;  1C0U A;  2FBT A;  4NO7 A;  2ZJP L;  4GW6 A;  3K5M A;  3LP3 A;  4WQ5 C;  4FWS A;  2F8S A;  4AHT A;  3D0P A;  3AVH A;  4DS5 A;  4OKK A;  3KKS A;  4CBX A;  2YHB A;  1WNS A;  4NLC A;  3EO3 A;  4BE1 A;  3BZC A;  1KSP A;  3LP1 A;  2Q3S A;  1HPM A;  4O8K A;  4A2B A;  4BC2 A;  1KAY A;  1JJ2 M;  4FJN A;  3WQU A;  3FZF A;  4XH4 A;  1JLA A;  2YI1 A;  1A5V A;  1RTI A;  2JGU A;  1LWE A;  1EP4 A;  4BY9 C;  1X9S A;  3NMU A;  5J2M A;  4OPK A;  2UYT A;  1RT3 A;  3VOV A;  2AA4 A;  4CJU A;  4CJF A;  3T19 A;  2ZQB A;  1TKT A;  5AQI A;  5GAH P;  1WSF A;  1RT4 A;  4DLE A;  2HNZ A;  1XMQ K;  4JKG B;  5DM6 L;  1N6Q A;  4FVU A;  4JKE A;  5AQJ A;  2I7N A;  1KFS A;  2HVI A;  3LM2 A;  4RWT A;  3E66 A;  3TTD A;  3JSM A;  3T69 A;  4AHS A;  3CME N;  4KO0 A;  3F9K A;  2IVP A;  3HO1 A;  4DR3 K;  3VGK A;  2P9N B;  4A2A A;  2JWK A;  1YIJ N;  2WBN A;  4FSV A;  3HJF A;  1QQM A;  3KK2 A;  1ZBL A;  2HBK A;  3DLE A;  4DTJ A;  3OYC A;  1DEJ A;  3PX6 A;  4FJK A;  1GLD G;  3N4P A;  4ELV A;  1K8K A;  1NM1 A;  2KZM A;  1JLE A;  2UUA K;  2HHW A;  2QWQ A;  2IVO A;  1RBU A;  2E6L A;  2P51 A;  3VMF B;  1N8R O;  1U6Z A;  3EEQ A;  2VGM A;  1NK8 A;  2QKK A;  5C0Y A;  3QFP A;  1VQ8 N;  2OTL N;  2Z1I A;  3CFP A;  5F2R A;  1NGH A;  2YHX A;  3P1G A;  4HWI A;  3SV3 A;  4AHC A;  4DR1 K;  1VQ5 N;  5KTQ A;  1BQM A;  4CFC A;  2Z1H A;  3M5R A;  1U04 A;  4DV1 K;  3D7E O;  4H03 B;  2E2O A;  4DTR A;  1C0F A;  1X1P A;  3B6P A;  4FW2 A;  3SBG A;  4CIG A;  5FRM A;  3AY9 A;  5J1E A;  4H5N A;  3OYF A;  1SKW A;  2FF6 A;  3IFR A;  3OYL A;  1S72 N;  4JHD A;  2P9U A;  4E0D A;  4FM0 A;  2V51 B;  3AAQ A;  1QQC A;  2Q2R A;  3C94 A;  2H3G X;  1ASW A;  3QIN A;  4YOX A;  1NGG A;  4FVM A;  3O9T A;  3ZT0 A;  1C6V A;  4IFE A;  1TUU A;  5CY4 A;  4F3O A;  4JLH A;  3OA9 A;  1C1C A;  2E4L A;  3A0I X;  4EHU A;  4E19 A;  1YVN A;  1FKO A;  1FKP A;  5FPN A;  3HPG A;  4FWO A;  4FCY A;  3ZET B;  2YKM A;  1GOA A;  3WQT A;  4LF8 K;  4YY3 K;  5HRN A;  1Q9Y A;  3BDP A;  3D2F B;  5C12 A;  3OS0 A;  3K5L A;  3AVG A;  2P9I A;  4NXN K;  5E41 A;  1LWC A;  3KWI A;  3TAP A;  1E4G T;  1VQ6 N;  2IAJ A;  4WF9 L;  1N5Y A;  1T44 A;  4MO4 A;  2YHW A;  2XY6 A;  4F8R A;  1KC8 O;  1CLQ A;  3IMX A;  4KHY A;  4I2Q A;  3CJB A;  1G15 A;  1WAF A;  4QS7 A;  4IO9 L;  3JXU A;  1S1V A;  3OBY A;  2P9L B;  4LF6 K;  3NCI A;  1EET A;  4J2B A;  4A61 A;  3P5J A;  5CZ2 A;  3E01 A;  2P9S B;  3HTV A;  2HST A;  3TSU A;  4DR6 K;  4FWM A;  4AH9 A;  3M8R A;  4BRI A;  2WTU A;  5C25 A;  2W6L A;  3ZX3 A;  5J2Q A;  3LAN A;  4DU3 A;  4I6M B;  4CZK A;  3F9M A;  4LD0 A;  1TL3 A;  4H5R A;  1G99 A;  4CES A;  4CHN A;  4M7Y A;  1YXQ A;  2ZM6 K;  3A5O C;  4FM2 A;  1NU0 A;  2WC9 A;  2BGG A;  4FW1 A;  4AM6 A;  5JIC A;  2G8W A;  4B1W B;  4B3M K;  5HP1 A;  1U45 A;  1LV5 A;  3SUQ A;  1JCE A;  2ETJ A;  4PUO A;  4O5B A;  4IDK A;  2O8C B;  5BPN A;  1ZBS A;  3RMC A;  1D4X A;  3LDS A;  1HNX K;  2G8H A;  3SUO A;  3Q7C A;  1NGJ A;  1VQO N;  4IJN A;  4BR5 A;  4HTU A;  1HQU A;  4I7F A;  1QQO A;  1VSH A;  2O8F B;  3BF1 A;  1YIT N;  5C42 A;  3LDL A;  5JVH L;  2YHY A;  3J81 O;  3NGY A;  3CHW A;  5AZI B;  3QEV A;  3CF5 L;  4A5A A;  4MDA A;  3O9U A;  4CJQ A;  2ZE2 A;  4Z4F A;  4DSF A;  5LL6 Z;  4FJ5 A;  4GKJ K;  1RDW X;  2HMP A;  5FLX O;  1KCF A;  3QBX A;  3HYF A;  3O1W A;  3ZEU A;  3SAH A;  4F2S A;  1YF5 L;  5BR9 A;  4DV2 K;  2HF3 A;  3HSC A;  3VF2 A;  4V19 S;  1TVR A;  3MN7 A;  3MCP A;  2HVH A;  2JLE A;  5AZJ A;  1VSM A;  1HYS A;  1NK5 A;  2X74 A;  5HRR A;  4DG1 A;  3OYE A;  1BCM A;  4JI0 K;  3EKU A;  1IV0 A;  3GG4 A;  1NK0 A;  4RW6 A;  3TAN A;  5C10 A;  2IGI A;  3CYM A;  3MX2 A;  4FZX C;  3AGR A;  2IDO A;  3ZX0 A;  4M42 A;  4CF0 A;  4M3Y A;  4DTM A;  3F2K A;  2RPI A;  3K5O A;  3U8X A;  2G8U A;  3CPE A;  2FXU A;  3OYA A;  2XHB A;  3NFA A;  4ISF A;  4JD2 A;  4B9U A;  3IRX A;  3KK3 A;  1BUP A;  2FBX A;  4BRF A;  1HLU A;  4IOX A;  2NRV A;  5ELZ A;  1BG3 A;  4OPH A;  1XNQ K;  3DAW A;  4QS8 A;  1I3A A;  3I0S A;  4NYN A;  1U2V A;  1VSE A;  4NXM K;  3V1Q A;  4GVM A;  4Z4E A;  1IG8 A;  3AVN A;  4BRA A;  3GL1 A;  1S22 A;  3T3F A;  3W3D A;  4PKI A;  5H1S Q;  3TAE A;  3FLC O;  4A62 A;  2NLX A;  1VSD A;  1NGE A;  3AO4 A;  1SV5 A;  4GV9 A;  3QBW A;  5JVG L;  4B8A B;  1RT5 A;  4RG8 A;  4YOU A;  2YNF A;  5AFU H;  3NGI A;  4DQ8 A;  3SQ0 A;  2AP1 A;  3PSI A;  2GWJ A;  3LL3 A;  2P9P A;  1JXB A;  4KV8 A;  3B6O A;  3L0Q A;  4J8F A;  4U67 L;  3S41 A;  1GOC A;  5CE3 A;  1ASV A;  3HP6 A;  3C7N A;  2HBM A;  3CJC A;  1NJI O;  4W5O A;  4RW8 A;  4CF9 A;  2UUC K;  2P5O A;  4DR4 K;  4C8O A;  1ESV A;  3LM9 A;  1IKW A;  5ADX A;  4BRH A;  1NGD A;  2VGN A;  1ZYQ A;  5K14 A;  1HNZ K;  4CHZ A;  3VTH A;  2E6M A;  3VPZ A;  4IO8 A;  3SZ2 A;  1OH5 A;  3CM5 A;  4DSL A;  1IH7 A;  4N47 A;  3H1V X;  2HW3 A;  3O4Q A;  1NGB A;  1ASU A;  3WXI A;  3LDQ A;  5C2D A;  2F7T A;  2O8B A;  3AA5 X;  2D1K A;  3HI0 A;  2KLA A;  2O8D B;  3HM8 A;  2YCH A;  5HOO A;  5HRO A;  2GEM A;  1Q7Y O;  4JS5 A;  3EZW A;  1BI4 B;  4XEI A;  3U3G A;  4JV5 K;  1HNV A;  2VYP A;  3MEG A;  2YV0 X;  1N32 K;  1R0A A;  2EHG A;  3ASM A;  3LAL A;  4L3Q A;  4RW7 A;  1HJO A;  1ZXO A;  3DJC A;  3DYA A;  1EX4 A;  1TYQ B;  3AA4 A;  2G8I A;  1S3X A;  3ULE A;  2OPR A;  1WBB A;  3IUC A;  2WFB A;  4BRO A;  3R6M A;  3B8A X;  4YHH K;  1ITG A;  5GAD P;  2V52 B;  4KFB A;  4CBW A;  2NZT A;  4DV7 K;  4H5V A;  3I56 N;  1M90 O;  5M1K A;  4AHU A;  2ZD1 A;  2EX3 A;  2CH5 A;  4BR0 A;  4E1M A;  2QI2 A;  5EXW A;  1LW0 A;  3NF7 A;  4HUF A;  3ZX2 A;  4DF8 A;  2RN2 A;  1GOB A;  4GNI A;  3K57 A;  1QHT A;  5AQL A;  2WOM A;  5CHI A;  2CH6 A;  4BVP A;  3CFR A;  3C6A A;  3TSQ A;  1XHZ A;  1EQY A;  3DMJ A;  3TTC A;  1Q86 O;  1K6Y A;  5B8H A;  1ATR A;  3WT0 A;  5GIO A;  3U3Y A;  2GWK A;  4GMJ B;  3QEI A;  1GLB G;  1DT9 A;  2KKZ A;  5LMN K;  3OS1 A;  4JRP A;  3R8E A;  4DU1 A;  2F4V K;  1H1V A;  4CEF A;  4PA1 A;  4NYF A;  4B9S A;  5JLH A;  4BC5 A;  4Y1D A;  1LW2 A;  2PYL A;  4GY2 B;  1JKH A;  4HTL A;  4Z94 A;  5T7B A;  2D0P A;  2Q0U A;  4GVE A;  1P90 A;  3KIO A;  4O44 A;  4H0T B;  2D5R A;  1ATS A;  4DHY A;  5AQK A;  3ZSO A;  3WEE B;  4A5B A;  1TK8 A;  3ZLJ A;  4CBU A;  3KD5 E;  4JN4 A;  2YKN A;  3AVK A;  4OVL A;  1KVC A;  4FJH A;  1W97 L;  1OH8 A;  1WN7 A;  2IC3 A;  1QHA A;  1WBD A;  2QEX N;  3TR8 A;  4JAX A;  1SAZ A;  3LAK A;  3J8A A;  2CGK A;  5C15 A;  1XI1 A;  4ILJ A;  1BCO A;  3LZJ A;  3LWM A;  3NAE A;  2P5G A;  1T6C A;  5KPR A;  5GIP A;  1M1K O;  5JMV A;  1VSF A;  2LSN A;  3A5M C;  4JI1 K;  2F96 A;  3THY A;  4W5T A;  2IOC A;  4CED A;  4DCH A;  2Q97 A;  3ENO A;  5A2Q O;  4YOW A;  4XH5 A;  4AQY K;  3V6D A;  4CJW A;  3VGM A;  1VQN N;  1NMN A;  2ASP A;  3PX4 A;  4FOI A;  5CR4 A;  3TWH A;  3FGU A;  5LY3 A;  3QNN A;  2Q36 A;  3UIQ A;  4IDH A;  4NCB A;  4M3W A;  3JS6 A;  5E84 A;  4JK8 A;  1TAQ A;  4BG8 A;  1MDU B;  1WAJ A;  1C1A A;  3UKR B;  4H5T A;  3S3O A;  1W2B M;  3TAM A;  2ZGY A;  3MN5 A;  4B08 A;  3SQ4 A;  4CEZ A;  2ZJR L;  3E9P A;  1IO2 A;  4KKO A;  4KAZ A;  4YFU A;  3PIP L;  2IIR A;  1DKG D;  3R9P A;  3RSE A;  1NJX A;  5BPL A;  4JI5 K;  3V1O A;  4BRM A;  2QXL A;  1KXP A;  4IG0 A;  4CEC A;  1VHX A;  4JKB A;  3FZH A;  3H1Q A;  1NLV A;  4X64 K;  1HYV A;  3OYJ A;  3SUN A;  3S3M A;  4M3X A;  4PWD A;  1GLE G;  2D0C A;  3OYM A;  3PO4 A;  3GDQ A;  2WON A;  1X9W A;  1DTT A;  4CFB A;  1TKZ A;  2OPQ A;  3ZSY A;  4CCH A;  4BRC A;  1N33 K;  3SBT A;  3HOT A;  1D9D A;  3SMS A;  3ZSR A;  3ENH A;  3U4L A;  3V9Z A;  1XNR K;  3SCX A;  4KH6 A;  3J80 O;  3C6U A;  5GAE P;  4LSL A;  3VF4 A;  4K8Z A;  3TI0 A;  2HHX A;  4BDZ A;  4KHQ A;  4CZI A;  5DM7 L;  4EFH A;  2YX6 A;  3AVJ A;  5SZT A;  4JKG A;  1WLJ A;  3E9L A;  4DQP A;  1KRP A;  3HXM A;  2Q31 A;  4Z4I A;  2QM1 A;  3ZSV A;  4BWJ A;  4DUZ K;  4OO1 J;  4MLH A;  3V81 A;  4KPY A;  3G71 N;  5M1N A;  1JLC A;  1WSH A;  3VET A;  4LC9 B;  2QXF A;  4B1V A;  4CJ5 A;  4CF8 A;  1T6D A;  5CYQ A;  3CXC M;  4X62 K;  2DFE A;  2BTF A;  4WE1 A;  3DXK B;  2B4J A;  3MN9 A;  4B9M A;  2F9T A;  1NGF A;  2QWR A;  3DRS A;  2Q1N A;  4Y1C A;  3PY8 A;  1EWQ A;  3P4I A;  5LJV A;  5AQZ A;  3LP0 A;  4N5S A;  4H8K A;  3C65 A;  5EVZ A;  1KAZ A;  4PY5 A;  2Q0R A;  2YHA A;  1RDD A;  4DTN A;  2GX9 A;  1NOZ A;  3EL2 A;  3UB5 A;  1BOT O;  3CJA A;  3VQ6 A;  4CGH A;  1NK9 A;  4OJR A;  2FSJ A;  3M8P A;  3AVF A;  3VEY A;  3DLK A;  3DOK A;  4EZ9 A;  4NLB A;  3THW A;  3SQ2 A;  4JYA K;  2OPS A;  4BDY A;  2VWK A;  3T7Z A;  3TTF A;  3CJ7 A;  3DWL A;  3SV4 A;  2A42 A;  1Z05 A;  4KRE A;  3ZT4 A;  1VQM N;  3KLF A;  5KRT A;  4C1N K;  4A57 A;  4MFB A;  1VSL A;  2FSN A;  1IKV A;  5AQM A;  5BRD A;  3KLH A;  3TU5 A;  4WCE L;  3ZSZ A;  5BRF A;  2DPN A;  1BL3 A;  3EN9 A;  4CK3 A;  1L3V A;  3PO5 A;  1J54 A;  2FBV A;  3L2U A;  3O9R A;  1IJJ A;  5JS1 A;  3FR0 A;  4FJ8 A;  1C1B A;  3QET A;  1S5J A;  5BN8 A;  5AQS A;  5I9E B;  4OX9 K;  5BR8 K;  4WYB A;  1HQE A;  4O8U A;  1NJW A;  4KB1 A;  4EP5 A;  4BG9 A;  1XHX A;  1YUW A;  4O5F A;  3AVM A;  4DFM A;  1T7P A;  1YVU A;  4KI6 A;  4JHD B;  2JWL A;  2P9U B;  3HPO A;  3KZB A;  4M3T A;  3AO3 A;  3ZET A;  4UY8 O;  3HP9 A;  2O4G A;  3SLC A;  3MXI A;  3IG1 A;  3CCR N;  1RDB A;  1NNE A;  5F0X A;  4CEE A;  4FJ9 A;  4OKJ A;  2KFZ A;  3D2F A;  1U49 A;  4B1U B;  5FDL A;  3A5L C;  3VQQ A;  4CZL A;  3M3Z A;  3RR8 A;  3RMB A;  3ZT1 A;  1U48 A;  3H6E A;  1X9M A;  3CI5 A;  4HCC A;  3AV9 A;  3VQP A;  3NVM A;  3WUH A;  2P9L A;  1IBM K;  2QA4 N;  1SQK A;  3HST B;  3CCV N;  2P9I B;  3LPU A;  3THV A;  3DLR A;  2CGL A;  2XY5 A;  3THX A;  4CZE A;  1L5U A;  4DSJ A;  1SZ2 A;  2AJQ A;  5AQO A;  3HM9 A;  4BR4 A;  2OYQ A;  4I9L A;  4B1Y B;  4F4K A;  1LOT B;  4DF4 A;  2E1Y A;  3KLG A;  5LMU K;  3K2P A;  1QVF M;  4B9L A;  5E26 A;  1QE1 A;  5AQT A;  3JYT A;  4CEQ A;  4CI6 A;  3MCA B;  3KK7 A;  3VA3 A;  3OJU A;  2W42 A;  2ZWH A;  2PYJ A;  3AVA A;  3OYN A;  3LDP A;  3OVN A;  4NCG A;  3I33 A;  1D5A A;  3H45 C;  2O8C A;  1OVQ A;  3SNN A;  4AHV A;  3SAF A;  3VEO A;  4BRE A;  2QWN A;  4CZF A;  3HL8 A;  4ID1 A;  1VSI A;  3U9Z A;  2O8F A;  3DXM A;  4E3S A;  1NOY A;  1YHQ N;  1XC3 A;  2QW9 A;  3I8D A;  5AZI A;  4KHN A;  3NH2 A;  2DY4 A;  4N76 A;  2NNW A;  5HLF A;  4C8K A;  1IKY A;  1S9E A;  2E2P A;  3VQ7 A;  3SYZ A;  1W0H A;  3M6G A;  4OGC A;  2HBJ A;  5BPM A;  2YNH A;  3C6H A;  3ZSQ A;  5M1F A;  4LH5 A;  4BRN A;  3CM6 A;  4CF2 A;  3QO9 A;  4BR9 A;  1QSS A;  1EWR A;  1KLN A;  2D0B A;  1ZBF A;  4WQ5 A;  4BWM A;  3MMV A;  3RR7 A;  2E2N A;  4BRQ A;  5FPE A;  5AJ3 K;  4Z0U A;  4JNE A;  1JCF A;  3WXM B;  4M45 A;  3JAM O;  1NK6 A;  1DGK N;  4DTX A;  4BR7 A;  1HKG A;  4RW9 A;  3D45 A;  3CCU N;  5I42 A;  4YOT A;  2XY8 A;  2GTD A;  4AHR A;  1SUQ A;  4JKC A;  1UAX A;  5SWM A;  2YNI A;  3K9K A;  1WSG A;  5KQD A;  5HBM A;  1VK0 A;  3CMA N;  4CEB A;  1V4T A;  2A3Z A;  3OYD A;  4PKG A;  4JK9 A;  2OAN A;  2VG5 A;  3BP8 A;  3QIO A;  4O55 A;  1JL2 A;  1TKX A;  5ADX H;  1MWM A;  1VQ7 N;  4CGI A;  1HUX A;  3CIP A;  1J9A A;  1U47 A;  4E1J A;  2O8E B;  3SJJ A;  3ALY A;  3Q7B A;  3KK1 A;  1IKX A;  1I94 K;  3OYK A;  3AVB A;  4FJX A;  3CJ9 A;  3HK2 A;  4PHT X;  1Y97 A;  2A6A A;  3DRR A;  5CYM A;  3VER A;  3OTO K;  4JKD A;  4H4O A;  2W41 A;  3L2R A;  1U2V B;  4M3R A;  2HHT A;  3AAP A;  4IFY A;  1GLA G;  4OKE A;  5D3G A;  3P38 A;  3KJV A;  1BO5 O;  1Z26 A;  2FF3 B;  4L8R B;  2PAV A;  4JS4 A;  5BRH A;  1RTJ A;  3MXM A;  2BUP A;  1TK0 A;  2HHU A;  2J4R A;  3FZM A;  1NJZ A;  3O4N A;  1RBV A;  3QEP A;  2YNG A;  5M1P A;  3CG7 A;  1S6Q A;  3IDH A;  2P9K A;  3H08 A;  4FJI A;  4J2D A;  1EO1 A;  4B9Q A;  3VTI A;  3DLL L;  1JLB A;  2E2Q A;  4KHP K;  4C8L A;  2XY7 A;  4DV5 K;  4LF9 K;  1YAG A;  3CQX A;  4NB4 A;  4DU4 A;  3T1Y K;  3P31 A;  4DSK A;  3V4I A;  5AQX A;  1NG9 A;  2E1Z A;  4ILH A;  3MAQ A;  2ZGZ A;  1YTU A;  3OBW A;  1SS6 A;  3W0L A;  3C7N B;  1D8Y A;  4FLX A;  3EZ5 A;  3HVT A;  2UXB K;  3R3L A;  1NK7 A;  4HVJ A;  5TKY A;  4XH1 A; 
#chains in the Genus database with same CATH homology
 2QEX N;  1NGC A;  2WBN A;  4FSV A;  4JAX A;  3O9S A;  1SAZ A;  5EOY A;  1QQM A;  2RE2 A;  2CGK A;  3J8A A;  5C15 A;  2HBK A;  1CZA N;  3HZ6 A;  4ILJ A;  1XQS C;  3FZK A;  1DEJ A;  2PFU A;  4R79 A;  1GLD G;  1T6C A;  3N4P A;  5KPR A;  3VF6 A;  5GIP A;  5JMV A;  1M1K O;  1K8K A;  1NM1 A;  5FPD A;  3A5M C;  1VQK N;  1OKJ A;  1P8Z A;  2QWQ A;  3F5T A;  2IVO A;  3J7Z O;  3VMF B;  1N8R O;  4DCH A;  1U6Z A;  2Q97 A;  2VGM A;  3ENO A;  2A40 A;  3D6R A;  3GBT A;  4XH5 A;  4BR2 A;  4YOW A;  3QFP A;  1VQ8 N;  5C0Y A;  2OTL N;  4YOY A;  3H3O B;  5AQF A;  3VGM A;  4K42 A;  3DXM B;  1R59 O;  5F2R A;  1VQN N;  1NGH A;  2YHX A;  3ID8 A;  2ASP A;  4HWI A;  1C0G A;  4FOI A;  5CR4 A;  1GLC G;  1Y64 A;  1HKB A;  3FGU A;  5LY3 A;  2Q36 A;  1VQ5 N;  4IDH A;  1TYQ A;  4FPA A;  1RFQ A;  2A41 A;  1GLF O;  3JS6 A;  3M5R A;  4JK8 A;  5E84 A;  1QZ5 A;  3O08 A;  4BG8 A;  4IOC L;  4WQ4 C;  3D7E O;  3PLA A;  4FWK A;  5AQG A;  3MWT A;  1MDU B;  2E2O A;  4H03 B;  3UKR B;  4H5T A;  1C0F A;  2NRH A;  3SBG A;  3ZEU B;  1W2B M;  3AY9 A;  4KBO A;  2ZGY A;  3MN5 A;  4H5N A;  3VGL A;  4YOR A;  4FPB A;  3D2E A;  2FF6 A;  3IFR A;  4BRD A;  2ZJR L;  3E9P A;  4FWN A;  5AZJ B;  1S72 N;  3K9J A;  3HOS A;  4JHD A;  2P9U A;  2V51 B;  3AAQ A;  3PIP L;  3ULE B;  2Q2R A;  2IIR A;  4YOX A;  2H3G X;  1NGG A;  3L4Q A;  1DKG D;  2ASO A;  5AQW A;  3O9T A;  3SJH A;  3UE5 A;  3R9P A;  4IFE A;  2YJF A;  3RSE A;  1TUU A;  5BPL A;  4BRM A;  2QXL A;  1KXP A;  4Y0W A;  3ZYY X;  3HBT A;  4JKB A;  3FZH A;  3H1Q A;  3OA9 A;  1NLV A;  5AQP A;  1GLE G;  1ATN A;  1LCU A;  3A0I X;  1KAX A;  4EHU A;  3GDQ A;  2ITM A;  4JD2 B;  1VQ9 N;  3CCJ N;  1YVN A;  4JK7 A;  5FPN A;  1YIJ N;  1QZ6 A;  4FWO A;  3ZET B;  2GEL A;  3WQT A;  4BRC A;  2A5X A;  3SBT A;  5KPT A;  4JKH A;  3HOT A;  3D2F B;  5C12 A;  3SMS A;  3ENH A;  2P9I A;  3U4L A;  4DKW A;  3KWI A;  5AQN A;  3BEX A;  1K8A O;  4KH6 A;  1E4G T;  1VQ6 N;  4WF9 L;  3CCS N;  5GAE P;  3CC7 N;  3VF4 A;  1T44 A;  3R1X A;  4MO4 A;  2YHW A;  4CZI A;  3UKU A;  4H0P A;  5DM7 L;  1KC8 O;  3H3N O;  3HRG A;  3IMX A;  3CJB A;  4EFH A;  2YX6 A;  1GLJ O;  2F9W A;  5FPM A;  3U9D A;  4QS7 A;  4IO9 L;  3JXU A;  3O8M A;  5C2F A;  1X3M A;  3OBY A;  3EE8 A;  4JKG A;  2P9L B;  4JKA A;  2QWL A;  3H46 O;  3E9L A;  5TKW A;  1YI2 N;  1Q81 O;  1VQ4 N;  4A59 A;  4A61 A;  3CCL N;  2Q31 A;  3KHY A;  4F9O A;  2P9S B;  3G4S N;  3HTV A;  2P9P B;  2QM1 A;  2VWB A;  4YDU C;  4OO1 J;  4GV3 A;  4MLH A;  2HST A;  3TSU A;  4JKF A;  4KH5 A;  3WEE A;  3G71 N;  4FWM A;  3SK3 A;  5M1N A;  4BRI A;  3VET A;  3RVC A;  1BA1 A;  4LC9 B;  3VEV A;  3ZX3 A;  4B1V A;  3FE1 A;  1MWK A;  1T6D A;  3CXC M;  2P9K B;  4I6M B;  4CZK A;  3F9M A;  2BTF A;  2EWS A;  3DXK B;  3EE9 A;  3C0B A;  1Z6R A;  3MN9 A;  2F9T A;  2QWR A;  1NGF A;  1G99 A;  1WOQ A;  2Q1N A;  4H5R A;  3P39 A;  4YOV A;  1QVG M;  2NRW A;  4M7Y A;  1BU6 O;  3P4I A;  5LJV A;  1YXQ A;  5AQZ A;  3GOI A;  3A5O C;  2WC9 A;  2ZF5 O;  3C65 A;  1BDG A;  1KAZ A;  3G25 A;  5EVZ A;  2Q0R A;  4AM6 A;  5JIC A;  4B1W B;  1RDU A;  4WFN L;  4PL8 A;  1JCE A;  2GX9 A;  3EL2 A;  4H0Y B;  3UB5 A;  1BOT O;  5BPN A;  3CJA A;  3E1Y A;  1ZBS A;  3WXL A;  2E20 A;  1D4X A;  2FSJ A;  3Q7C A;  1NGJ A;  1VQO N;  4IJN A;  4BR5 A;  1V4S A;  5AQY A;  2ZJQ L;  3VEY A;  1QQO A;  5AFU A;  3FFK B;  3BF1 A;  1YIT N;  3AAR A;  1OVY A;  3LDL A;  5JVH L;  1BWF O;  2YHY A;  4NLB A;  3CHW A;  1T3V A;  5AZI B;  3T7Z A;  3TTF A;  3CJ7 A;  3DWL A;  3CF5 L;  4A5A A;  4MDA A;  2A42 A;  3O9U A;  1Z05 A;  3O1B A;  3ATV A;  5AQV A;  1RDW X;  2HMP A;  2V7Y A;  1VQM N;  1ILY A;  3QBX A;  1VQP N;  4C1N K;  4A57 A;  3VEX A;  4CD3 A;  2KHO A;  2FSN A;  3O1W A;  4IZ9 A;  5AQM A;  3ZEU A;  4B1Z A;  3ID6 A;  3MWP A;  3SAH A;  1YF5 L;  2CGJ A;  5BR9 A;  1K73 O;  4BQZ A;  4PL7 A;  5BRD A;  3IKM A;  3TU5 A;  2HF3 A;  3EKS A;  3HSC A;  5AQQ A;  3VF2 A;  4WCE L;  3MN7 A;  5BRF A;  2DPN A;  2QWP A;  3O9Q A;  3SMP A;  3CET A;  3MCP A;  4BC3 A;  5AZJ A;  4MLE A;  3EN9 A;  4RTF D;  3EKU A;  4WFA L;  5KQ8 A;  4BQL A;  3N4Q A;  4JEP A;  3GG4 A;  2WUS A;  3O9R A;  1IJJ A;  3OHR A;  4BRG A;  5C10 A;  3FR0 A;  3I55 N;  3QFU A;  3MX2 A;  3AGR A;  1E4F T;  5GIN A;  3ZX0 A;  5BN8 A;  5AQS A;  5I9E B;  3F2K A;  4WYB A;  4O8U A;  3U8X A;  5HL7 L;  3CPE A;  3D2E B;  3LDN A;  2FXU A;  1YUW A;  2D0O A;  4BG9 A;  4O5F A;  4QS9 A;  4ISF A;  3NVK A;  4JD2 A;  4JHD B;  2P9U B;  2JWL A;  3KZB A;  1BUP A;  5AQH A;  4BRF A;  1HLU A;  4IOX A;  3L6Q A;  2NRV A;  5ELZ A;  5M1O A;  3ZET A;  4UY8 O;  1BG3 A;  4OPH A;  3DAW A;  4QS8 A;  3SLC A;  3CCR N;  5F0X A;  1U2V A;  3RSE B;  1IG8 A;  3D2F A;  2IVN A;  3CCQ N;  4B1U B;  3A5L C;  4BRA A;  4CZL A;  1BA0 A;  3GL1 A;  1S22 A;  4FWL A;  3W3D A;  4PKI A;  2BH1 A;  2FSK A;  3M3Z A;  2E88 A;  3TPQ A;  5H1S Q;  3A5N C;  1TUY A;  3QML A;  1NGI A;  4FWP A;  4U7B A;  3FLC O;  3AGK A;  4A62 A;  4BC4 A;  1NGA A;  2FLO A;  2NLX A;  1J6Z A;  3TSP A;  4BGA A;  3H6E A;  1NGE A;  3CI5 A;  1X9J A;  4AM7 A;  2QWM A;  4GV9 A;  3QBW A;  3NVM A;  5JVG L;  4FL9 A;  4IJA A;  3WUH A;  3MN6 A;  3LDO A;  2P9L A;  1HKC A;  2QA4 N;  4YOU A;  4M7X A;  2E8A A;  1SQK A;  3CC2 N;  5AFU H;  4DQ8 A;  3CCV N;  4EIA A;  2NRX A;  2P9I B;  2AP1 A;  2GWJ A;  2QWO A;  2ASM A;  4OPA A;  4IEE A;  3LL3 A;  2CGL A;  2P9P A;  4CZE A;  2RHK A;  4IEI A;  1SZ2 A;  3G6E N;  3L0Q A;  5AQO A;  3PIO L;  3GE1 A;  4J8F A;  4BR4 A;  4U67 L;  3L4I A;  3S41 A;  4B1Y B;  1VQL N;  5CE3 A;  5TKY A;  5MLC Q;  3O6W A;  3UKU B;  1LOT B;  3C7N A;  2HBM A;  3CJC A;  4CZM A;  3CD6 N;  2E1Y A;  4K41 A;  1NJI O;  2VCP A;  4K25 A;  1QVF M;  4EHT A;  3A8Y A;  4C23 A;  1Q18 A;  2P9N A;  3DXK A;  5E26 A;  4CZJ A;  1ESV A;  3LM9 A;  5ADX A;  5AQT A;  4B1X B;  1NGD A;  2VGN A;  4BRH A;  4CI6 A;  3OW2 M;  2D4W A;  4BGB A;  4PKH A;  5BRE A;  3MCA B;  3CC4 N;  4ISE A;  3KK7 A;  3VTH A;  3VEN A;  2I7P A;  1K9M O;  4BRL A;  3VPZ A;  4IO8 A;  2HOE A;  2ZWH A;  3CCM N;  3H1V X;  2NRZ A;  3LDP A;  4K43 A;  3I33 A;  3H45 C;  2HBL A;  5GAG P;  5LJW A;  5JLF A;  4FVU A;  4BVO A;  1NGB A;  1X3N A;  4FO0 A;  4CZH A;  3SAF A;  1O13 A;  3WXI A;  3VEO A;  3LDQ A;  1KQS M;  4BRE A;  5C2D A;  2QWN A;  3CJ1 A;  2QTD A;  1QQN A;  4CZF A;  4MO5 A;  1WUA A;  3U9Z A;  2F7T A;  3DXM A;  1YHQ N;  1XC3 A;  2QW9 A;  4H0V B;  1JCG A;  1NMD A;  2D1K A;  3HI0 A;  2KLA A;  3HM8 A;  2YCH A;  5AZI A;  3VEW A;  5HOO A;  3BF3 A;  4FWQ A;  2GEM A;  4WQ4 A;  3KVG A;  4DB3 A;  2NNW A;  1Q7Y O;  1ZC6 A;  3EZW A;  3SAG A;  4CJ7 A;  1K8K B;  2E2P A;  3MDQ A;  4M63 C;  3ENB A;  4H0O A;  3M6G A;  5AR0 A;  2HBJ A;  4H5W A;  4XEI A;  3UKR A;  5BPM A;  3CCE N;  3C6H A;  2YJE A;  1XUP O;  5M1F A;  1MA9 B;  2VYP A;  4BRN A;  3FZL A;  4BR9 A;  4L3Q A;  3KWG A;  1HJO A;  3VEZ A;  1ZXO A;  4IOA L;  3DJC A;  3WXJ A;  1RGI A;  2NRR A;  3ATU A;  3M1F A;  5EX5 A;  4WQ5 A;  5KPZ A;  1TYQ B;  4EAH D;  3MMV A;  3QB0 A;  1S3X A;  3ULE A;  4IWV A;  3MK6 A;  2E2N A;  4BRQ A;  5FPE A;  3CQY A;  3MX5 A;  5F1X A;  4JNE A;  1JCF A;  2GUP A;  3WXM B;  1DGK N;  4BR7 A;  3IUC A;  4ILG B;  2WFB A;  4C1N I;  4CD1 A;  1HKG A;  4BRO A;  5BN9 A;  3R6M A;  3I8B A;  3QDK A;  3CCU N;  3B8A X;  4YOT A;  5GAD P;  2GTD A;  2V52 B;  1YJW N;  4JKC A;  3E9O A;  3K9K A;  5AQU A;  4CBW A;  2NZT A;  5KQD A;  1YJ9 N;  4GV6 A;  4H5V A;  3I56 N;  4NO7 A;  1M90 O;  3CMA N;  5M1K A;  2ZJP L;  1V4T A;  2A3Z A;  4PKG A;  4JK9 A;  2OAN A;  3BP8 A;  4WQ5 C;  4FWS A;  4WFB L;  3BUZ B;  1Q82 O;  2CH5 A;  2HF4 A;  4BR0 A;  5EY4 A;  2QI2 A;  3QIC A;  5EXW A;  4CBX A;  4CZG A;  1MWM A;  5ADX H;  1VQ7 N;  4NLC A;  3ZX2 A;  1HUX A;  3CIP A;  3EO3 A;  4H0X B;  4GNI A;  4E1J A;  3Q7B A;  1NWK A;  5AQL A;  5CHI A;  5M1Q A;  1HPM A;  2CH6 A;  4O8K A;  1KD1 O;  3CJ9 A;  4A2B A;  4BC2 A;  1KAY A;  4PHT X;  1JJ2 M;  2V7Z A;  3WQU A;  2A6A A;  4BVP A;  3FZF A;  3VER A;  3C6A A;  4XH4 A;  4JKD A;  3TSQ A;  2OTJ N;  2W41 A;  5AQR A;  1EQY A;  4ISG A;  3TTC A;  1U2V B;  2YI1 A;  3AAP A;  1GLA G;  1Q86 O;  4BRK A;  5B8H A;  4BY9 C;  4AF1 A;  1ATR A;  1VAZ A;  3P38 A;  3WT0 A;  5GIO A;  3NMU A;  2W40 A;  1BO5 O;  2P9S A;  4YDU A;  2GWK A;  2FF3 B;  4MDB A;  2UYT A;  2PAV A;  3VOV A;  1GLB G;  1DT9 A;  2AA4 A;  2KKZ A;  4FOE A;  5BRH A;  3CPW M;  4KH4 A;  3R8E A;  2BUP A;  2J4R A;  3FZM A;  3VES A;  1GLL O;  5AQI A;  3O4W A;  1H1V A;  5GAH P;  5M1P A;  5JLH A;  3IDH A;  4BC5 A;  2P9K A;  4I6M A;  1YJN N;  4GY2 B;  3O5B A;  4HTL A;  4Z94 A;  4JKG B;  5DM6 L;  2D0P A;  1EO1 A;  4B9Q A;  2Q0U A;  1HX1 A;  4GVE A;  4JKE A;  1P90 A;  2PBD A;  5AQJ A;  2I7N A;  3VTI A;  3DLL L;  2E2Q A;  4BRP A;  4G9Z A;  4H0T B;  3O80 A;  1NBW A;  2NRT A;  1YAG A;  3CQX A;  4NB4 A;  3P31 A;  3LM2 A;  4RWT A;  1ATS A;  4DHY A;  3E66 A;  5AQX A;  3TTD A;  3T69 A;  5AQK A;  2E1Z A;  4ILH A;  3WEE B;  4A5B A;  2ZGZ A;  3CME N;  3OBW A;  4CBU A;  1SS6 A;  4IXC A;  3W0L A;  2IVP A;  3C7N B;  4FWR A;  3WXK A;  4JN4 A;  3R3L A;  3CER A;  3VGK A;  1W97 L;  2P9N B;  1QHA A;  4A2A A;  4RCH A;  2JWK A;  4XH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...