2WBNA

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
178
structure length
178
Chain Sequence
VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TERMINASE LARGE SUBUNIT
publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 48
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wbnA00
2WBNA 2WC9A 4DKWA
chains in the Genus database with same CATH superfamily
4DR3K 1XC3A 4PKGA 3KZBA 3P31A 3UB5A 4CF9A 2P9NA 4AILC 1QZ5A 3TAPA 1BWFO 1KFSA 1SZ2A 5E84A 4CESA 1W9HA 4BACA 4FJ9A 4UY8O 4JI6K 2QKKA 2FLOA 3DLLL 3G10A 1LV5A 3NF8A 4EHTA 3JAMO 4DQQA 3VERA 3RMCA 3HVRA 3CQYA 4OLBA 4WF9L 4H0XB 2HHHK 4W5QA 1GLBG 4WYBA 3NH2A 5KQ8A 2UXBK 1HNVA 4CF2A 4EIAA 1NGFA 4YOWA 3SI6A 2P51A 4XEIA 5KRTA 3CMAN 3SAHA 3GBTA 2R7YA 1Z25A 1U2VB 2FC0A 1X3MA 1YXQA 3KK3A 2YHYA 3ZT4A 3HL8A 5DM7L 5I9EB 1OH8A 5AQKA 2VGMA 1TV6A 2G8FA 4CCHA 4IZ9A 2E2OA 2P9LB 4JI3K 4TSXA 3MN6A 4DQ8A 3CPWM 3HOSA 3E9PA 3KKSA 5HP1A 1BGXT 2Q3SA 4R5PA 1O1WA 4JKGB 4CEEA 1QQNA 4X66K 4LFCK 4BR7A 3CYMA 3KHYA 1C0MA 5CY4A 1NKEA 1ZBUA 3DLRA 1XWLA 2ZM6K 3TSUA 4CGGA 3HPGA 3CERA 2JWKA 3VGMA 3LDPA 4DFJA 3A2FA 1I3AA 3AARA 4W5RA 3FR0A 3K5NA 4IO9L 3VA0A 3CG7A 2QXFA 1JLAA 2GELA 4OKKA 3L0QA 3AVFA 3TR8A 3RRHA 3SQ2A 4B1YB 2HHVA 1W97L 1ESVA 3V4IA 3CETA 1HJRA 1N5YA 1WUAA 3KIOA 4JKFA 3I0RA 4DTSA 4GV3A 3SV3A 3VF6A 4E7LA 3RMBA 2A3ZA 2JLEA 4YFUA 5FRMA 3A5NC 3HOTA 5AJ3K 1JLBA 1NJWA 3DLGA 2NRVA 3H1VX 3SK3A 2HSTA 3MECA 4FJ8A 4ID1A 4QS7A 4O0IA 3CM5A 3QIPA 2CH6A 4CVNE 2CGJA 1GLFO 1XC9A 4B3OA 2PAVA 3AGKA 2WOMA 3K5LA 3AA5X 2YJEA 3CJ7A 4KH5A 4DKWA 1K6YA 4LY7A 5AQGA 1D9FA 3QFUA 3K0SA 1DGKN 3TPQA 4BY9C 3UKUA 3I55N 3O1WA 2IC3A 3F5TA 4NYFA 3NH1A 2YJFA 4RW4A 4IEIA 3TAQA 3RRGA 4CZHA 4C8NA 2JGUA 4NXNK 5AZIB 4BC5A 5FDLA 3MWPA 3LWLA 3EE8A 4K43A 4V19S 1N8RO 1KFDA 5H1SQ 4JK7A 4JKEA 3R8EA 4IOCL 3EL2A 2IVNA 3VQPA 4MDAA 2QKBA 5TKYA 4ZTFA 1U48A 5FLXO 3C7NA 4DSLA 4B1ZA 3H6EA 1MA9B 1T6DA 3L8BA 3AVKA 2KZZA 4NYNA 4JK8A 2O8EB 1HLUA 4OGCA 2Q1NA 3MEEA 1KVCA 3OYCA 1XQSC 3K58A 3SJHA 1CXUA 3AO4A 3HP9A 1K8AO 1HUXA 2ASPA 2JWLA 2WUSA 4JV5K 3QB0A 4FW2A 5AFUA 1NK8A 5BN8A 4M3TA 4C8OA 1VQNN 3AVCA 4IXCA 3O6WA 4FM1A 3HT3A 3CF5L 5JS2A 2ITGA 1UAXA 2FSNA 2GWKA 3KD5E 3THYB 5CR4A 2QTDA 4CHYA 1YJNN 3OW2M 3F9KA 3O9TA 1N34K 4C8MA 2DFEA 3LDLA 4LFAK 3QEIA 3NE6A 4MFBA 1RT7A 4CZKA 3Q7BA 4FW1A 5GADP 4IDHA 4ELTA 4DSIA 4K41A 4OVLA 3QMLA 3L4QA 3V9XA 4CJRA 2HVHA 4LSLA 3CM6A 4B9NA 5AQLA 1VSDA 3NFAA 4DQIA 4K0KK 4Z4GA 2D4WA 1CXQA 3AA2A 1L5UA 3OYJA 4IEEA 3J7ZO 2F9WA 1NGJA 1NBWA 4JHDA 2ZD1A 4CFBA 4DU4A 3T1YK 4MDBA 2ZGYA 3QERA 3THXB 4AHUA 4DV4K 3CMEN 2Y1IA 1FKPA 3PSFA 1BG3A 3DYAA 2V52B 3QO9A 5CZ1A 2A40A 1OVQA 1LOTB 3L2VA 4BE1A 3CJAA 4HWIA 3H1QA 3SQ4A 4HUEA 1JXEA 3VQBA 4JI5K 2YNGA 4C1NI 2OTLN 3DRPA 3DLKA 4KHQA 2F7TA 1KAYA 3VQDA 1YIJN 2O8BB 3KWGA 4F9OA 4F2SA 4EZ6A 4KV8A 5F0XA 4FLUA 1N36K 3ULEB 4CJ5A 2BH1A 1F21A 5LL6Z 5E41A 2E6LA 1RT1A 1XI1A 5GINA 2PYJA 2HMIA 3OS2A 5C2FA 2O8DA 1SKSA 2NRTA 4AHCA 3WNHA 4A5AA 4CGJA 4IG0A 4DLGA 4BQLA 4DTNA 2XO7A 1GOBA 3OYLA 2KTQA 4Q5VA 1QSYA 2OZSA 2OZMA 2V7YA 1YITN 4BRHA 1IKXA 4DS4A 3WEEA 3ZX2A 4BRGA 3A5MC 1E3MA 1MWMA 1XMOK 3W3DA 2ZGZA 2D0OA 1RTHA 4YY3K 4QAGA 2W6KA 1ATNA 4BRPA 4BG9A 4R79A 3FGUA 1NOZA 4NB4A 4OKJA 3D2FA 3NGYA 1NM1A 1RDAA 3LDSA 4ILGB 3P1GA 4KPYA 1Y97A 4K8XA 2YHWA 1ILYA 4DF8A 3EO3A 3O3HA 3ZSVA 3TTCA 3RSEB 1SKRA 4FWSA 3ZSXA 1VQON 5BRFA 4FLTA 1RTIA 3E9LA 4DFMA 4BRAA 3DXMB 4DR7K 2QW9A 4IDKA 1EWRA 1VSLA 1HNXK 1BI4A 1NU0A 4KTQA 1ZYQA 3KLGA 1S72N 4FJKA 4BRDA 5J1EA 5JLHA 2RN2A 3OVNA 5ELZA 4BRIA 3MN5A 1Q8IA 1BA1A 4DTPA 1Q7YO 3J81O 4FL9A 3ZT0A 4L8RB 3THWB 5FPDA 3AVGA 2F9TA 2W6LA 4FJGA 1VSEA 5FPMA 4B1XB 2E20A 2WONA 3UE5A 1TAQA 4IBNA 4FLZA 3O9UA 3OJSA 3NVKA 5A2QO 2P9IB 4GMJB 1GLEG 3E9OA 4B3RK 4LSNA 1YUWA 4I7FA 4AQYK 4M3WA 3SQ0A 1CZBA 3GG4A 1S3XA 4A61A 5DK5A 2HHUA 4RW7A 1HX1A 1HRHA 2NLXA 2OPQA 4Y0WA 4DSFA 1WLJA 5J2NA 4DTJA 2P9UA 1KQSM 2P1JA 4PKHA 4CEQA 4E1NA 3SMPA 4FVUA 3ID6A 2Q0UA 4KBOA 5HOOA 4PL7A 1VSMA 1L3TA 3H3OB 2Q97A 4OPKA 2QXLA 4PA1A 3AGRA 3C6AA 1RT2A 1SV5A 4CGFA 3U9ZA 1RT5A 4XH1A 3WT0A 3OYEA 4CZEA 3A5LC 4BRKA 4RTFD 4BRCA 4H5TA 1YJ9N 2ZQBA 4BR9A 1L3SA 1IBMK 3O08A 1LCUA 3O3GA 1T05A 1RFQA 4M63C 3HM9A 3ASMA 1BA0A 2WC9A 3OYKA 3HSCA 4KREA 4KTZA 5C2DA 2NRRA 2Q36A 4FJIA 3O3FA 3CCRN 2NRWA 5HRSA 5M1NA 2O8FB 2DFHA 3KKRA 3SUNA 1NGEA 4KAZA 1S22A 4G9ZA 4CEDA 1NJZA 3CFRA 3ZLJA 2P5GA 5AQOA 3CJ9A 1R0AA 1VQLN 3UKRA 4Z4FA 1RBVA 2V7ZA 3C94A 3OJUA 4Z0UA 2XY8A 5HRNA 1IH7A 2QWQA 3LL3A 3R9PA 4Q0BA 4K8ZA 2F96A 3CC4N 3T69A 4DG1A 4CHPA 4FCYA 1Q18A 4F3OA 2PY5A 3O4NA 3OYFA 4FM0A 4OO1J 2DTUA 3K2PA 3ZX3A 1U04A 4ZHRA 1XMQK 2ZE2A 3HXMA 4KI6A 4BQZA 4DTMA 5FPNA 3AO5A 1Q86O 5HRRA 1JLFA 2EWSA 1LW2A 4WFNL 3NCIA 1TUYA 1ASWA 1EKEA 4OPAA 3EZWA 1HR0K 1S6QA 2VCPA 3O5BA 1YT3A 2GEMA 3C6HA 4DU3A 1B9DA 4JS4A 2P9KB 3THVA 4Z94A 4CJSA 4B1WB 3KLFA 4CZJA 3CJ1A 3DI6A 3GE1A 4Z4IA 1RILA 3G6EN 3L3VA 3IG1A 4JRPA 4B9VA 2YX6A 3WXKA 1RDUA 2IGIA 4DR4K 5DM6L 2QWMA 3CCQN 2YHXA 3U6FA 4PHTX 3SNNA 1DLOA 1OH7A 2A42A 4AM6A 3VTIA 5FPEA 1SL0A 3CJCA 2P9PA 3IUCA 5EX5A 3QNNA 1U49A 3I56N 4RW6A 4GKKK 2DFFA 3D2EB 4EHUA 2YCHA 3AVMA 3K59A 4YOVA 2GBZA 2AJQA 5BRHA 4OKEA 3G4SN 3P38A 3RTVA 4ID5A 4CIFA 3T1AA 3CFPA 3K5MA 2OPSA 1NWKA 3ZSQA 3PX6A 1RDWX 4B9UA 1HKBA 1NLVA 3ITHA 2VG7A 4Y1DA 3ID8A 3DMJA 3KLHA 4H4OA 4FLWA 3MEGA 1J53A 2RKIA 4RWTA 1IG8A 5JMVA 3DXKA 3VQAA 2NNWA 4FWPA 3L2UA 4DV1K 4FLYA 4BGBA 1YAGA 2QWNA 4LF7K 5GAGP 2Q0RA 4EZ9A 4I9QA 2YKMA 3FLCO 3H3NO 3OY9A 5I42A 3AO2A 1I39A 4CD1A 4CHQA 3ZETB 2PBDA 4WCEL 1EETA 1S1UA 2CGLA 4CIGA 2X6SA 1VSKA 4B8AB 3J8AA 4CGIA 4DV5K 4KH6A 3BF1A 1JCFA 3B6PA 2E6MA 1GLLO 3VENA 1SKWA 1HJOA 2Q2RA 3DJCA 2VWJA 1RT3A 4IKFA 1NGGA 3DOKA 2HHWA 3S3NA 4NLBA 4FLVA 2OCEA 4MLEA 1LAVA 2HBMA 5FROA 3BUZB 4CJ4A 3AVIA 1S1VA 1UOCA 2YNFA 3KK2A 4WQ4C 3NH0A 3F9MA 5KI6A 1SS6A 3B8AX 2QWLA 4O44A 5HROA 4BDYA 1DTQA 3QICA 2EX3A 3LM9A 1NK0A 2G8IA 1JLGA 1WSJA 3NDKA 5C10A 1EQYA 1BO5O 2WFBA 4WE1A 2VQEK 2F4VK 3PY8A 1C0FA 1VQKN 1X1PA 1TAUA 2P9NB 1ATRA 1TL3A 2E2QA 1NKBA 4BR5A 1RTJA 3KWIA 4BDZA 3LDNA 1ZBLA 1RDDA 4U7BA 4KFBA 4H8KA 1S6PA 4E7KA 4CFCA 2HMPA 1OH6A 3ULDA 2PYLA 1LAWA 1KCFA 1RCHA 2I7NA 3L6QA 3HP6A 3RMAA 3ATUA 2O8CB 4DSEA 3NHGA 2OTJN 1KRPA 1JLEA 2ETJA 4OJRA 4FVMA 4E1JA 2YI1A 1BCOA 3AVNA 1S1TA 4FWMA 2RF2A 3O9QA 4LC9B 3UIQA 3GL1A 1VK0A 4IJAA 4PY5A 5GIOA 2W41A 3AA3A 3OS0A 1J6ZA 3D45A 2QWPA 3ZT3A 3O1BA 3CIPA 4UQGA 3H08A 2LSNA 3SAFA 4DR1K 3HVTA 3KVGA 4FJNA 1RBUA 2AA4A 2BTFA 2FF3B 4CZLA 1LWCA 4K25A 4DWIA 3VGKA 3WXJA 2A5XA 1KXPA 2NZTA 1D5AA 2D5RA 2KFZA 2HNDA 1IKYA 1JLQA 4M42A 2XHBA 4DFKA 4H0PA 4B9QA 4CK1A 1REVA 5B8HA 4I6MA 2YNHA 3ZSRA 4KKOA 1TKTA 1T44A 4QOZB 1QQCA 4O5BA 2G8KA 3ZEUB 1D9DA 4FK0A 3ENBA 3OYDA 4YDUC 3CCUN 1K9MO 2BANA 1E4GT 4H5NA 4ISGA 4DR6K 3MX2A 5AQZA 2XRIA 5BPNA 4CF0A 3IFRA 1VQPN 2RPIA 4FSVA 3OYBA 4FOEA 5IWAK 3SV4A 1RTDA 3AVHA 5M1OA 4FM2A 4IWVA 4JS5A 1U47A 3MEDA 2IVOA 3MX5A 1NGCA 3PIOL 1XUPO 1HQUA 2D1KA 1VSHA 4CJUA 2O4IA 3PX0A 2FF6A 4JI1K 2HVIA 3ALYA 1X9SA 1HNZK 2V51B 1KAXA 1W7AA 2D0PA 1LWFA 3G0ZA 3QEXA 4X64K 5AZJA 4RCHA 2J4RA 3LZJA 2YHAA 5TKWA 4DS5A 3M8QA 1FJGK 3TABA 3QDKA 3Q7CA 4JI7K 4CEFA 3UKUB 1Q9YA 3VETA 3KK1A 1M1KO 4ISEA 1VQMN 4JEPA 4HHTA 3J7AP 4O0JA 4AHRA 1QE1A 3LAMA 1X9JA 1HPZA 4ISFA 4YOYA 3L2WA 5M1PA 5J2QA 3MXJA 4KHWA 5AQXA 2UXDK 3VQCA 2HNYA 3N4PA 2IAJA 2A1RA 1N33K 4YOXA 3S3MA 2G8HA 1Q9XA 3C7NB 4PL8A 5LMUK 4X62K 3M6GA 3LM2A 1S9EA 1C0GA 5KRSA 1X3NA 1D4XA 3P4IA 5AQSA 4CHOA 3OYIA 1G15A 4XH5A 4LH5A 4CZMA 3SBGA 5I3UA 2IOCA 1NJXA 4OX9K 4YORA 4CEAA 2B6AA 4M41A 1HYVA 5BREA 4LF6K 4J2EA 4DV2K 3K9JA 1U6ZA 1IKVA 3VF4A 2W40A 3QNOA 4DUZK 5C15A 5C25A 3PLAA 4KB1A 4E0DA 3RSEA 4MO5A 4FJLA 2O4GA 3CI5A 3TWHA 4FWNA 4FLXA 3SPZA 4B08A 5KGXA 3LZIA 3V1OA 3NGZA 1R59O 1K8KA 3MXIA 4JKHA 2UUBK 3LWMA 3A5OC 1DKGD 3PV8A 2E2NA 1NK7A 3ATVA 5BRDA 4DR2K 3QBXA 5HLFA 3FE1A 2CGKA 1JL2A 4NCAA 1VRUA 1UA0A 5ADXA 3M8PA 4NCBA 2P9IA 3PX4A 2P9SA 4FK4A 4YNQA 4JHDB 5C42A 2Y1JA 3QESA 4H0YB 5CZ2A 3OYMA 2Z1GA 3H46O 4Z4EA 2VQFK 1QQMA 2F8SA 1JCGA 4E3SA 3SUOA 3WXLA 3V1RA 1IV0A 2FBTA 3SPYA 2OPRA 1YF5L 2ASOA 3C95A 3NGIA 3O9SA 1MDUB 4JLHA 3VQ9A 4E89A 3BF3A 4A59A 1WAFA 4JI0K 5M1QA 3N4QA 2A6AA 1X9MA 1NK9A 4JNEA 1Z6RA 4AF1A 1OKJA 1EO1A 1EWQA 1UWBA 1XNRK 1Q82O 1NK6A 2GV9A 3LALA 4NLCA 1DEJA 1RDCA 2RE2A 5AQTA 3WXMB 1WNSA 1HYZA 5ADXH 1TYQA 4CFDA 2HBKA 1V4TA 1JL1A 3DRRA 3F2KA 4CK3A 4C1NK 2ZJQL 5M1FA 3VQ4A 2D0BA 3VEWA 3DLEA 4FZZA 4KHSA 4CEBA 1QSSA 4A2AA 1UA1A 3ISNC 1IKWA 2O8FA 1EP4A 4BC4A 4IJNA 5LY3A 2RHKA 4M7XA 1B92A 3ZT2A 2QEXN 4DUYK 3VGLA 3KK7A 4NCGA 4WFAL 4FXDA 3WEEB 3M3ZA 1IBKK 2BGGA 1P8ZA 4CJLA 3BP8A 3VEZA 4IOXA 3FZHA 5CE3A 4XIUA 3BZKA 3ZSYA 4KO0A 1S1XA 3EE9A 1N6QA 1BOTO 4B1UB 4JD2A 1NGDA 5D3GA 3FFIA 3VQ8A 4FYDA 3D2FB 1RDBA 3ENHA 1OVYA 2PZSA 4JN4A 5AQYA 4BRQA 4BRFA 4BDPA 4E1MA 1BU6O 2UXCK 1C0UA 1QS4A 3FZKA 4HTLA 3CCLN 1SL2A 1IO2A 1RBRA 3LP0A 4BREA 4BROA 5MLCQ 3LDOA 2NUBA 1YI2N 1IG9A 4X65K 1C1BA 3VQ7A 4PKIA 1TKDA 1BI4B 2XY6A 5AQNA 1HNIA 1RGIA 4E7IA 2G8WA 3IRXA 1HQEA 4J2DA 3AAQA 1EXQA 1Q81O 3VEYA 4CGDA 4N47A 1NK4A 3TSPA 3NVMA 4IOAL 1S9GA 3HO1A 3VEXA 5KPRA 3B6OA 1YHQN 3DOLA 2OA8A 4GV9A 4AHVA 1CZAN 3QIOA 3SZ2A 2HF3A 3WUHA 4LF9K 1A5XA 3MK6A 3T3FA 3SLCA 4M7YA 1HKGA 1QHTA 1KSPA 1RNHA 1JLCA 1HKCA 4DB3A 1Y64A 3FZLA 3U3GA 3O4QA 1BL3A 3U9DA 1RT4A 3IMXA 4F8RA 3HM8A 2UUCK 2Z1JA 3V9SA 2X6NA 4BE0A 2P9UB 3VF2A 2A41A 3MN9A 3RMDA 3R1XA 3P83D 2QI2A 1DTTA 3EZ5A 2D0AA 3VA3A 4BR2A 4AHTA 4FJJA 3TANA 1TUUA 4CJVA 3BY5A 3CCEN 2E8AA 2FBXA 1J5EK 4JK9A 5AQJA 2UUAK 5EY4A 1T7PA 1BUPA 4DTUA 1BIZA 1GLAG 1J5OA 1V4SA 2BE2A 3RVCA 1VQ7N 4DF4A 1JKHA 2QWOA 4DHYA 2ZWHA 3DLHA 5HRPA 1C1CA 4JKDA 3O9RA 1Z05A 2YNIA 1C6VA 1IJJA 3H45C 1G99A 1U2VA 3CXCM 2I7PA 3UKRB 2E4LA 4E7HA 4ELUA 1XHXA 1WBDA 4QS9A 3TU5A 3VEOA 2P9LA 4LF8K 5C24A 4OPHA 4CZGA 5SZTA 3HRGA 2VGNA 4CD3A 1IBLK 4LF4K 2I5JA 1SL1A 3I0SA 4A62A 3U8XA 4F4KA 5IT9O 1GOAA 4BWJA 4Y1CA 4CEOA 2W42A 1JXBA 4JKGA 4O8KA 1NKCA 1NOYA 3EY1A 3MMVA 1X9WA 2E1ZA 3CCVN 5HL7L 3PSIA 4EP4A 2QA4N 4HUGA 4CJPA 3VQ6A 5KTQA 1K73O 5AQIA 3VQQA 1VSJA 4H0OA 2QWRA 4ILHA 4N56A 4H0VB 3IDHA 3T1HK 4BRMA 5KPTA 3VEVA 4FWQA 1HNWK 3MCPA 2GX9A 4LH4A 4CGHA 4MO4A 3ZSWA 1XNQK 5GIPA 1QHAA 1LW0A 2X78A 3LANA 4CZFA 3BZCA 3HBTA 3EKUA 2O8CA 2G8VA 3LAKA 5EOYA 5HBMA 3C6UA 4JKBA 5J2MA 3RR8A 3AVLA 2P9PB 5JVGL 1T8EA 1SAZA 2H3GX 3SCXA 2VWKA 5JVHL 3ZSOA 4DTXA 4FJMA 3ZCMA 2IVPA 3VPZA 3TAFA 2OPPA 4BC2A 2QK9A 3NMUA 1WSGA 4GVMA 4E19A 1S1WA 4KRFA 4H0TB 3BEXA 1NGHA 4LFBK 4B9MA 1ASVA 3HZ6A 1CLQA 1RBSA 4M3ZA 2HNZA 4JYAK 1T6CA 2D0CA 3MDQA 2E5LK 1FW6A 4E7JA 1BDGA 5AZIA 1VAZA 2E2PA 1NGBA 4J2AA 3SUPA 3WXIA 3IKMA 1YTAA 2KFNA 3C6TA 4NXMK 3ZEUA 2VG6A 3DXKB 3QEWA 4CBUA 4DQPA 2WTUA 4KHNA 4HCBA 4FO0A 4DV3K 4RW9A 1MU2A 1L3UA 3BDPA 2IIRA 1HMVA 4DCHA 4LD0A 3QINA 3SUQA 3M8RA 3OS1A 4B8CA 1I94K 2ZJRL 5F2RA 2O8EA 3P5JA 1S5JA 4H5RA 4DQRA 4F3TA 5CYQA 1TK8A 3WNFA 3TAEA 3DRSA 3ZYYX 2YV0X 4KHYA 4M3RA 3PO4A 4JAXA 2OANA 3TARA 2UYTA 3E01A 4B3SK 3J7YP 4L3QA 2KW4A 4WFBL 5JS1A 1U45A 4PQUA 4FJHA 2E1YA 1VQ6N 3C65A 1KLNA 4JRQA 2ASMA 3LP1A 4B9TA 3THYA 2DY4A 4FJ7A 4GKJK 3EYZA 5AQHA 3J80O 1J54A 3HSTB 4BVOA 4CF1A 3WQTA 4GVEA 3TTFA 3L2RA 4O8UA 4C23A 4DU1A 1WSFA 4KHPK 2HHSA 4CE9A 1VSIA 2GTDA 4JI8K 5C12A 3CHWA 2HOEA 1ATSA 1TKXA 3SJJA 1T03A 2GUPA 1B9FA 4C8KA 4HUFA 4O5FA 1JJ2M 1N32K 1WB9A 2HW3A 3V1QA 1ZBSA 5AQMA 4N41A 3PUFA 2FBYA 3DAWA 4H03B 4DQSA 4M3UA 4BGAA 3CC7N 5JICA 4FWRA 3RR7A 4ICLA 3SBTA 4FJ5A 4K42A 1QVGM 4G1QA 5SWMA 3GOIA 2A1SA 3THXA 4LF5K 1EX4A 5AQPA 4ZTJA 1QVFM 1WN7A 3FZFA 1NG9A 4CJKA 3G25A 2QM1A 1GLDG 3EEQA 4CJWA 4CK2A 5F1XA 3CQ8A 1NMNA 3ENOA 2FSJA 4O55A 2O8BA 1W2BM 1O13A 3AA4A 1ZBHA 4B9LA 3ZT1A 5DMRA 3VTHA 5J2PA 1QTMA 2F8TA 3ULEA 3C0BA 4WQ4A 5BPLA 2FBVA 1TL1A 4I6MB 3CCJN 1KLMA 3M1FA 4HCCA 3G71N 3K57A 1BISA 1NGIA 3S41A 2PFUA 1OH5A 3NBPA 4KB0A 3AY9A 3D6RA 4IG3A 3V81A 4DV0K 3DLBA 4DLEA 4JI2K 3OYGA 4FZYA 2Z1HA 5AFUH 3AO1A 2IDOA 4CHZA 1KAZA 4CEZA 1VQ8N 4BR4A 5KGWA 3U4LA 3HK2A 1WSIA 3VN5A 5AQQA 4CF8A 1QQOA 3HI0A 3T7ZA 3KTQA 4FJXA 1NMDA 1W0HA 5K14A 3KJVA 3IAYA 4N5SA 3PO5A 3WNEA 1ZBIA 1MWKA 3AVBA 1FKOA 3D7EO 5EVZA 1VQ4N 3V6DA 1NGAA 5FRNA 4KH4A 5GAEP 4I2PA 5AQRA 5AZJB 4CBXA 2E88A 2HBLA 1YJWN 4IFEA 4M3XA 4B1VA 5CYMA 4DMNA 2B4JA 3DXMA 2KZMA 4JI4K 3P39A 1C0TA 3MXMA 3CJBA 1BCMA 1P90A 4DTRA 1YVNA 4CJ7A 4DV7K 3NAEA 2HHXA 4WQ5C 1M90O 5GAHP 3TAGA 3THWA 4A5BA 3MCAB 3ZX0A 2IS3A 5EU7A 2GUIA 4W5OA 3QETA 4PUOA 3T19A 2HBJA 3A8YA 3V9ZA 3K9KA 3HJFA 3QEPA 3CCSN 1YTUA 1WBBA 4YDUA 3JSMA 4BE2A 3JS6A 3I8BA 4IO8A 5LJWA 3PIPL 2Z1IA 1A5WA 2BDPA 4BRNA 4EFHA 2GWJA 4O4GA 3NF7A 3GDQA 2B5JA 1VQ9N 4OGEA 1VRTA 1BIUA 2UU9K 3SMSA 1KTQA 1ZC6A 2KKZA 3OHRA 4DSJA 3CPEA 3JXUA 3KLEA 4Z4CA 3OTOK 1TK0A 4BR0A 3NF6A 1SQKA 4KI4A 4DFPA 2NRHA 4IFYA 4AH9A 3VESA 4B3TK 4BG8A 1GLCG 4HVJA 3A0IX 4BWMA 3LPTA 5C0YA 3QLHA 5LMNK 3O8MA 4MQ3A 4H5VA 3F73A 3VQEA 5EXWA 1FK9A 1NNEA 5CHIA 4FOIA 3I33A 3TSQA 2O8DB 3AAPA 3R3LA 1BQNA 1SUQA 2X74A 1A5VA 4CJEA 1K8KB 1E4FT 1RBTA 3KD1E 2EHGA 2OYQA 1DT9A 1FXXA 3O4WA 3CCMN 1KC8O 5BN9A 3L3UA 4RW8A 2G8UA 4CJ3A 5M1KA 2ATQA 4FWKA 5BPMA 4EAHD 2NRXA 3D0PA 3VQ5A 1GLJO 2P9SB 4CJTA 1J9AA 2Q31A 2ITMA 3M5RA 4BC3A 3CQXA 4CI6A 1ZBFA 3OYAA 3TI0A 2HHQA 4F2RA 1L3VA 4MLHA 3LDQA 3BGRA 3I8DA 4B3MK 2CH5A 3S3OA 1VQ5N 4CW7B 4A57A 4C8LA 3JYTA 4EP5A 1KVAA 4YOTA 3AV9A 3EN9A 4BRLA 1HPMA 4DV6K 3E1YA 1C1AA 1Z26A 4OPJA 3RWUA 4W5NA 4QS8A 3LPUA 3E66A 1KVBA 3EKSA 2HF4A 3MWTA 2P9KA 1TGOA 1VHXA 3OYNA 4IFVA 1TYQB 3O80A 4CIEA 3L2QA 4FPBA 3R6MA 4ILJA 3LP2A 5T7BA 4M45A 4J2BA 4XH4A 1NJIO 2VYPA 4ELVA 3SYZA 4WQ5A 1BHLA 4FK2A 1JCEA 3AO3A 4GV6A 4FPAA 1BQMA 4DR5K 4M3YA 1YVUA 4JKAA 1ITGA 4PWDA 3OYHA 4CFAA 5BR8K 1KD1O 2XY7A 5JLFA 1WOQA 2YKNA 3HPHA 3WQUA 3D2EA 4FZXC 3FZMA 1ASUA 3QEVA 4J8FA 3CC2N 4QCLA 3V9UA 3VMFB 3OA9A 1CZ9A 1RT6A 4U67L 2VG5A 4JD2B 4I2QA 4I9LA 1VSFA 3HTVA 3W0LA 5KPZA 3U3YA 3KLIA 1GOCA 2KHOA 4DTOA 4DSKA 1LWEA 1QZ6A 2BUPA 4N76A 2XY5A 3WNGA 1U4BA 3HPOA 1TK5A 4H4MA 3FFKB 2KLAA 4KTWA 3SAGA 1QSLA 4B9SA 4KHUA 2VWBA 3OBYA 3MN7A 1D8YA 2ZF5O 1NJYA 1HYSA 1TKZA 4FWOA 1WSEA 4BVPA 5BR9A 3LP3A 3M8SA 2HB5A 4JKCA 4CBWA 3V9WA 4H5WA 5KQDA 4GNIA 4YHHK 4CZIA 3SQ1A 4GY2B 2FSKA 4FWLA 2WBNA 3TAMA 4Z4HA 3ZETA 3DM2A 3K5OA 4YOUA 3NF9A 3CFOA 2P5OA 1TVRA 3CD6N 3VOVA 1H1VA 4CJQA 2ZJPL 3AVJA 3L4IA 4GW6A 4RG8A 3OBWA 3S9HA 1ZXOA 3DWLA 4A2BA 4CECA 3QBWA 3ZSZA 2HHTA 4CJFA 5LJVA 4W5TA 2FXUA 4HTUA 3MAQA 3HYFA 5AQWA 1NK5A 4OLAA 2AP1A 1XHZA 3IS9A 4CERA 2YHBA 5E26A 4AHSA 4CHNA 5AQUA 1T3VA 3TTDA 3AVAA 2KQ2A 4NO7A 1WAJA 2DPNA 3QFPA 1WSHA 2NRZA 4AM7A 5AQFA 5AR0A 5AQVA
chains in the Genus database with same CATH topology
4BVOA 3U9ZA 3WQTA 4GVEA 1XC3A 3TTFA 4O8UA 4C23A 4XH1A 4PKGA 3WT0A 3KZBA 3P31A 3A5LC 4MO5A 3RSEA 3UB5A 4CZEA 3CI5A 4BRKA 2GTDA 4FWNA 4RTFD 4H5TA 4BRCA 5C12A 1YJ9N 3CHWA 2P9NA 4BR9A 1QZ5A 2HOEA 1ATSA 1BWFO 1LCUA 1SZ2A 3O08A 1RFQA 5E84A 4M63C 4UY8O 1BA0A 2GUPA 1R59O 2FLOA 3DLLL 1K8KA 2WC9A 4O5FA 1JJ2M 4JKHA 4EHTA 3HSCA 5C2DA 2NRRA 1ZBSA 2Q36A 5AQMA 3A5OC 3VERA 1DKGD 2E2NA 3CQYA 2NRWA 3CCRN 3ATVA 5BRDA 4WF9L 3QBXA 4H0XB 5M1NA 1GLBG 3DAWA 3FE1A 2CGKA 4WYBA 5KQ8A 1NGEA 4G9ZA 1S22A 4H03B 4EIAA 1NGFA 4YOWA 4BGAA 3CC7N 5ADXA 5JICA 4FWRA 5AQOA 3CJ9A 4XEIA 1VQLN 3CMAN 3UKRA 3SAHA 3GBTA 2P9IA 3SBTA 2V7ZA 4K42A 1U2VB 2P9SA 1QVGM 1X3MA 1YXQA 3GOIA 4JHDB 4H0YB 2YHYA 3H46O 2QWQA 3LL3A 5DM7L 5I9EB 3R9PA 1QQMA 5AQKA 5AQPA 1QVFM 4IZ9A 3CC4N 2E2OA 1JCGA 3T69A 2P9LB 3FZFA 1Q18A 3G25A 3WXLA 2QM1A 1GLDG 1YF5L 2ASOA 3MN6A 4OO1J 4DQ8A 3ZX3A 3CPWM 3HOSA 3E9PA 3O9SA 5F1XA 1MDUB 3BF3A 4A59A 5M1QA 3ENOA 3N4QA 5FPNA 4BQZA 2A6AA 2FSJA 1Q86O 4JKGB 1QQNA 1O13A 4JNEA 1W2BM 1Z6RA 4AF1A 3VTHA 2EWSA 4BR7A 3KHYA 1OKJA 3ULEA 1EO1A 3C0BA 4WQ4A 4WFNL 5BPLA 1Q82O 1TUYA 4NLCA 1DEJA 2RE2A 5AQTA 3WXMB 3TSUA 4OPAA 4I6MB 5ADXH 3EZWA 1TYQA 3CERA 2JWKA 2VCPA 3O5BA 3VGMA 3CCJN 2HBKA 3LDPA 1V4TA 2GEMA 3C6HA 3M1FA 2P9KB 3G71N 3AARA 3F2KA 3FR0A 1NGIA 4IO9L 4Z94A 4C1NK 2ZJQL 3S41A 2GELA 4B1WB 2PFUA 5M1FA 4CZJA 3L0QA 3CJ1A 3GE1A 4B1YB 3G6EN 3AY9A 3D6RA 3VEWA 1W97L 1ESVA 2YX6A 3WXKA 1RDUA 4A2AA 3CETA 5DM6L 2QWMA 3CCQN 2YHXA 1WUAA 4BC4A 4PHTX 4IJNA 4JKFA 4GV3A 5LY3A 2RHKA 4M7XA 2A42A 4AM6A 3VTIA 5FPEA 3CJCA 2QEXN 3VF6A 3VGLA 2P9PA 3KK7A 4WFAL 2A3ZA 3WEEB 3M3ZA 5AFUH 3IUCA 5EX5A 1KAZA 1P8ZA 1VQ8N 3BP8A 4BR4A 3A5NC 3U4LA 3VEZA 3I56N 3HOTA 4IOXA 5AQQA 3FZHA 5CE3A 2NRVA 1QQOA 3H1VX 3D2EB 4EHUA 3HI0A 3T7ZA 1NMDA 2HSTA 3SK3A 3EE9A 2YCHA 1BOTO 4QS7A 4B1UB 4JD2A 1NGDA 4YOVA 2CH6A 2CGJA 1GLFO 2PAVA 1MWKA 3AGKA 3D7EO 5EVZA 5BRHA 1VQ4N 3D2FB 1NGAA 3ENHA 3P38A 4KH4A 1OVYA 3G4SN 3CJ7A 2YJEA 4KH5A 4JN4A 5AQYA 4BRQA 4DKWA 5AQGA 5GAEP 5AQRA 3QFUA 5AZJB 4BRFA 4CBXA 2E88A 1DGKN 1BU6O 3TPQA 3FZKA 1NWKA 2HBLA 4BY9C 3UKUA 4HTLA 4IFEA 3I55N 1YJWN 4B1VA 3CCLN 3O1WA 1RDWX 3F5TA 1HKBA 3DXMA 1NLVA 4BREA 2YJFA 4BROA 4IEIA 3ID8A 3LDOA 5MLCQ 4CZHA 3P39A 3CJBA 5AZIB 4BC5A 1YI2N 1P90A 1YVNA 4CJ7A 4RWTA 1IG8A 3MWPA 4PKIA 5JMVA 3EE8A 4WQ5C 1M90O 5GAHP 4K43A 5AQNA 3DXKA 4A5BA 2NNWA 1N8RO 3MCAB 4FWPA 3ZX0A 1RGIA 5H1SQ 4JK7A 4BGBA 1YAGA 4JKEA 2QWNA 3R8EA 2HBJA 3A8YA 5GAGP 4IOCL 3AAQA 2IVNA 2Q0RA 3EL2A 3VEYA 1Q81O 3K9KA 4MDAA 5TKYA 3CCSN 3TSPA 3NVMA 4IOAL 3FLCO 3H3NO 4YDUA 3VEXA 5KPRA 3C7NA 3JS6A 3I8BA 4B1ZA 4CD1A 3H6EA 1MA9B 1T6DA 1YHQN 3ZETB 2PBDA 4WCEL 4IO8A 5LJWA 3PIPL 4GV9A 1CZAN 4JK8A 2CGLA 1HLUA 2HF3A 4BRNA 3J8AA 4EFHA 2GWJA 3WUHA 2Q1NA 4KH6A 3BF1A 1JCFA 3GDQA 3MK6A 3SLCA 1XQSC 4M7YA 1VQ9N 1HKGA 1GLLO 3VENA 1HKCA 3SJHA 4DB3A 3SMSA 1HJOA 1Y64A 1ZC6A 2KKZA 2Q2RA 3FZLA 3OHRA 3DJCA 3CPEA 3IMXA 3U9DA 1K8AO 3HM8A 1HUXA 1NGGA 2ASPA 2JWLA 2WUSA 3JXUA 4NLBA 2P9UB 3QB0A 3VF2A 5AFUA 2A41A 4MLEA 3MN9A 4BR0A 2HBMA 5BN8A 3BUZB 3R1XA 1SQKA 2NRHA 3VESA 1VQNN 4IXCA 4WQ4C 2QI2A 3O6WA 1GLCG 4BG8A 3F9MA 1SS6A 3B8AX 3A0IX 2QWLA 5AR0A 5C0YA 3CF5L 3QICA 3O8MA 2FSNA 2GWKA 3LM9A 5CR4A 4BR2A 2QTDA 1YJNN 5C10A 1EQYA 1BO5O 3OW2M 1TUUA 2WFBA 4H5VA 3O9TA 5EXWA 3CCEN 2E8AA 5CHIA 3LDLA 1C0FA 4FOIA 3I33A 1VQKN 2P9NB 4JK9A 1ATRA 3TSQA 5AQJA 2E2QA 3AAPA 3R3LA 4BR5A 4CZKA 3Q7BA 5EY4A 5GADP 4IDHA 1BUPA 3KWIA 1GLAG 3LDNA 1V4SA 3RVCA 4K41A 4U7BA 1K8KB 1E4FT 3L4QA 3QMLA 1VQ7N 1DT9A 2QWOA 2HMPA 2ZWHA 4DHYA 3O4WA 3CCMN 1KC8O 5BN9A 5AQLA 4JKDA 2I7NA 2D4WA 3O9RA 1Z05A 3L6QA 5M1KA 3ATUA 2OTJN 4FWKA 5BPMA 1IJJA 2NRXA 3H45C 4IEEA 1G99A 4EAHD 1U2VA 3J7ZO 2F9WA 3CXCM 1NGJA 2I7PA 1NBWA 4JHDA 4E1JA 2YI1A 3UKRB 4MDBA 1GLJO 2P9SB 4FWMA 4LC9B 3O9QA 2ZGYA 3GL1A 4QS9A 3TU5A 4IJAA 3VEOA 5GIOA 2W41A 3CMEN 2P9LA 1J6ZA 2Q31A 2QWPA 2ITMA 1BG3A 3M5RA 3O1BA 4BC3A 3CQXA 3CIPA 4OPHA 4CI6A 2V52B 4CZGA 3HRGA 2VGNA 4CD3A 2A40A 3SAFA 1LOTB 4MLHA 3LDQA 3KVGA 3CJAA 4HWIA 2AA4A 2BTFA 2FF3B 3H1QA 4A62A 3U8XA 4CZLA 2CH5A 4K25A 3VGKA 1VQ5N 3WXJA 2A5XA 4A57A 1KXPA 2NZTA 4JKGA 4C1NI 4O8KA 2OTLN 3MMVA 4YOTA 3EN9A 2E1ZA 1HPMA 4BRLA 3CCVN 3E1YA 2F7TA 1KAYA 5HL7L 2QA4N 1YIJN 3KWGA 4F9OA 4QS8A 4H0PA 4B9QA 1K73O 5F0XA 5AQIA 5B8HA 4I6MA 3ULEB 3E66A 4H0OA 2BH1A 3EKSA 2QWRA 4ILHA 2HF4A 3MWTA 4H0VB 2P9KA 3IDHA 1T44A 3ZEUB 5GINA 1TYQB 3O80A 4BRMA 5KPTA 5C2FA 4FPBA 3ENBA 3R6MA 2NRTA 4FWQA 3VEVA 4YDUC 3MCPA 4ILJA 2GX9A 4A5AA 3CCUN 1K9MO 4BQLA 1E4GT 4MO4A 4H5NA 4ISGA 3MX2A 4XH4A 5AQZA 5GIPA 5BPNA 1QHAA 1NJIO 2VYPA 3IFRA 1VQPN 4FSVA 4WQ5A 4CZFA 4FOEA 2V7YA 1JCEA 1YITN 5M1OA 4BRHA 4GV6A 4FPAA 3HBTA 4IWVA 3EKUA 4JKAA 3WEEA 3ZX2A 2IVOA 3MX5A 4BRGA 5EOYA 4JKBA 3A5MC 1NGCA 1KD1O 3PIOL 1XUPO 2D1KA 1MWMA 2P9PB 5JLFA 1WOQA 5JVGL 3W3DA 3WQUA 2ZGZA 3D2EA 1SAZA 2FF6A 2D0OA 2H3GX 5JVHL 1ATNA 2V51B 3FZMA 4BRPA 1KAXA 4J8FA 4BG9A 3CC2N 2IVPA 3FGUA 4R79A 2D0PA 3VMFB 3OA9A 3VPZA 4NB4A 3D2FA 1NM1A 4BC2A 3NMUA 4U67L 4JD2B 4ILGB 4H0TB 2YHWA 5AZJA 4RCHA 1ILYA 2J4RA 3HTVA 3BEXA 3W0LA 1NGHA 5KPZA 3EO3A 3HZ6A 5TKWA 2KHOA 3QDKA 3Q7CA 2BUPA 1QZ6A 3RSEB 3TTCA 4FWSA 1VQON 5BRFA 3UKUB 1T6CA 3MDQA 3E9LA 3VETA 1BDGA 4BRAA 5AZIA 3DXMB 1M1KO 1VAZA 2QW9A 4ISEA 1VQMN 4JEPA 3FFKB 2KLAA 3SAGA 2E2PA 1S72N 4BRDA 1NGBA 5JLHA 3WXIA 2VWBA 3OBYA 3IKMA 3MN7A 5ELZA 2ZF5O 4BRIA 3MN5A 1X9JA 1BA1A 3DXKB 3ZEUA 4ISFA 4FL9A 4CBUA 1Q7YO 4FO0A 4FWOA 5FPDA 4YOYA 2F9TA 4BVPA 5M1PA 5BR9A 4JKCA 5FPMA 4B1XB 4CBWA 4H5WA 2E20A 4GNIA 5KQDA 4CZIA 2IIRA 4GY2B 2FSKA 4FWLA 2WBNA 5AQXA 3UE5A 4DCHA 3N4PA 3O9UA 3ZETA 4YOXA 3NVKA 4YOUA 2P9IB 3C7NB 2ZJRL 4PL8A 5F2RA 1GLEG 3E9OA 1YUWA 4H5RA 3CD6N 3VOVA 1H1VA 2ZJPL 3L4IA 3M6GA 3OBWA 3LM2A 1C0GA 3GG4A 1S3XA 1X3NA 1ZXOA 3DWLA 4A2BA 4A61A 3ZYYX 1D4XA 1HX1A 3P4IA 5AQSA 2NLXA 3QBWA 4XH5A 4Y0WA 4CZMA 4JAXA 3SBGA 2OANA 2P9UA 2UYTA 5LJVA 1KQSM 4PKHA 2FXUA 4YORA 4L3QA 3SMPA 4WFBL 5BREA 5AQWA 3ID6A 4FVUA 2Q0UA 4KBOA 2AP1A 3K9JA 1U6ZA 2E1YA 5HOOA 5E26A 4PL7A 5AQUA 1T3VA 3C65A 3TTDA 1VQ6N 3H3OB 2Q97A 3VF4A 2W40A 4NO7A 2ASMA 2DPNA 3QFPA 5C15A 2NRZA 4AM7A 2QXLA 3AGRA 5AQFA 3PLAA 3C6AA 5AQHA 2VGMA 5AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBN A;  2WC9 A;  4DKW A; 
#chains in the Genus database with same CATH topology
 4DR3 K;  1XC3 A;  4PKG A;  3KZB A;  3P31 A;  3UB5 A;  4CF9 A;  2P9N A;  4AIL C;  1QZ5 A;  3TAP A;  1BWF O;  1KFS A;  1SZ2 A;  5E84 A;  4CES A;  1W9H A;  4BAC A;  4FJ9 A;  4UY8 O;  4JI6 K;  2QKK A;  2FLO A;  3DLL L;  3G10 A;  1LV5 A;  3NF8 A;  4EHT A;  3JAM O;  4DQQ A;  3VER A;  3RMC A;  3HVR A;  3CQY A;  4OLB A;  4WF9 L;  4H0X B;  2HHH K;  4W5Q A;  1GLB G;  4WYB A;  3NH2 A;  5KQ8 A;  2UXB K;  1HNV A;  4CF2 A;  4EIA A;  1NGF A;  4YOW A;  3SI6 A;  2P51 A;  4XEI A;  5KRT A;  3CMA N;  3SAH A;  3GBT A;  2R7Y A;  1Z25 A;  1U2V B;  2FC0 A;  1X3M A;  1YXQ A;  3KK3 A;  2YHY A;  3ZT4 A;  3HL8 A;  5DM7 L;  5I9E B;  1OH8 A;  5AQK A;  2VGM A;  1TV6 A;  2G8F A;  4CCH A;  4IZ9 A;  2E2O A;  2P9L B;  4JI3 K;  4TSX A;  3MN6 A;  4DQ8 A;  3CPW M;  3HOS A;  3E9P A;  3KKS A;  5HP1 A;  1BGX T;  2Q3S A;  4R5P A;  1O1W A;  4JKG B;  4CEE A;  1QQN A;  4X66 K;  4LFC K;  4BR7 A;  3CYM A;  3KHY A;  1C0M A;  5CY4 A;  1NKE A;  1ZBU A;  3DLR A;  1XWL A;  2ZM6 K;  3TSU A;  4CGG A;  3HPG A;  3CER A;  2JWK A;  3VGM A;  3LDP A;  4DFJ A;  3A2F A;  1I3A A;  3AAR A;  4W5R A;  3FR0 A;  3K5N A;  4IO9 L;  3VA0 A;  3CG7 A;  2QXF A;  1JLA A;  2GEL A;  4OKK A;  3L0Q A;  3AVF A;  3TR8 A;  3RRH A;  3SQ2 A;  4B1Y B;  2HHV A;  1W97 L;  1ESV A;  3V4I A;  3CET A;  1HJR A;  1N5Y A;  1WUA A;  3KIO A;  4JKF A;  3I0R A;  4DTS A;  4GV3 A;  3SV3 A;  3VF6 A;  4E7L A;  3RMB A;  2A3Z A;  2JLE A;  4YFU A;  5FRM A;  3A5N C;  3HOT A;  5AJ3 K;  1JLB A;  1NJW A;  3DLG A;  2NRV A;  3H1V X;  3SK3 A;  2HST A;  3MEC A;  4FJ8 A;  4ID1 A;  4QS7 A;  4O0I A;  3CM5 A;  3QIP A;  2CH6 A;  4CVN E;  2CGJ A;  1GLF O;  1XC9 A;  4B3O A;  2PAV A;  3AGK A;  2WOM A;  3K5L A;  3AA5 X;  2YJE A;  3CJ7 A;  4KH5 A;  4DKW A;  1K6Y A;  4LY7 A;  5AQG A;  1D9F A;  3QFU A;  3K0S A;  1DGK N;  3TPQ A;  4BY9 C;  3UKU A;  3I55 N;  3O1W A;  2IC3 A;  3F5T A;  4NYF A;  3NH1 A;  2YJF A;  4RW4 A;  4IEI A;  3TAQ A;  3RRG A;  4CZH A;  4C8N A;  2JGU A;  4NXN K;  5AZI B;  4BC5 A;  5FDL A;  3MWP A;  3LWL A;  3EE8 A;  4K43 A;  4V19 S;  1N8R O;  1KFD A;  5H1S Q;  4JK7 A;  4JKE A;  3R8E A;  4IOC L;  3EL2 A;  2IVN A;  3VQP A;  4MDA A;  2QKB A;  5TKY A;  4ZTF A;  1U48 A;  5FLX O;  3C7N A;  4DSL A;  4B1Z A;  3H6E A;  1MA9 B;  1T6D A;  3L8B A;  3AVK A;  2KZZ A;  4NYN A;  4JK8 A;  2O8E B;  1HLU A;  4OGC A;  2Q1N A;  3MEE A;  1KVC A;  3OYC A;  1XQS C;  3K58 A;  3SJH A;  1CXU A;  3AO4 A;  3HP9 A;  1K8A O;  1HUX A;  2ASP A;  2JWL A;  2WUS A;  4JV5 K;  3QB0 A;  4FW2 A;  5AFU A;  1NK8 A;  5BN8 A;  4M3T A;  4C8O A;  1VQN N;  3AVC A;  4IXC A;  3O6W A;  4FM1 A;  3HT3 A;  3CF5 L;  5JS2 A;  2ITG A;  1UAX A;  2FSN A;  2GWK A;  3KD5 E;  3THY B;  5CR4 A;  2QTD A;  4CHY A;  1YJN N;  3OW2 M;  3F9K A;  3O9T A;  1N34 K;  4C8M A;  2DFE A;  3LDL A;  4LFA K;  3QEI A;  3NE6 A;  4MFB A;  1RT7 A;  4CZK A;  3Q7B A;  4FW1 A;  5GAD P;  4IDH A;  4ELT A;  4DSI A;  4K41 A;  4OVL A;  3QML A;  3L4Q A;  3V9X A;  4CJR A;  2HVH A;  4LSL A;  3CM6 A;  4B9N A;  5AQL A;  1VSD A;  3NFA A;  4DQI A;  4K0K K;  4Z4G A;  2D4W A;  1CXQ A;  3AA2 A;  1L5U A;  3OYJ A;  4IEE A;  3J7Z O;  2F9W A;  1NGJ A;  1NBW A;  4JHD A;  2ZD1 A;  4CFB A;  4DU4 A;  3T1Y K;  4MDB A;  2ZGY A;  3QER A;  3THX B;  4AHU A;  4DV4 K;  3CME N;  2Y1I A;  1FKP A;  3PSF A;  1BG3 A;  3DYA A;  2V52 B;  3QO9 A;  5CZ1 A;  2A40 A;  1OVQ A;  1LOT B;  3L2V A;  4BE1 A;  3CJA A;  4HWI A;  3H1Q A;  3SQ4 A;  4HUE A;  1JXE A;  3VQB A;  4JI5 K;  2YNG A;  4C1N I;  2OTL N;  3DRP A;  3DLK A;  4KHQ A;  2F7T A;  1KAY A;  3VQD A;  1YIJ N;  2O8B B;  3KWG A;  4F9O A;  4F2S A;  4EZ6 A;  4KV8 A;  5F0X A;  4FLU A;  1N36 K;  3ULE B;  4CJ5 A;  2BH1 A;  1F21 A;  5LL6 Z;  5E41 A;  2E6L A;  1RT1 A;  1XI1 A;  5GIN A;  2PYJ A;  2HMI A;  3OS2 A;  5C2F A;  2O8D A;  1SKS A;  2NRT A;  4AHC A;  3WNH A;  4A5A A;  4CGJ A;  4IG0 A;  4DLG A;  4BQL A;  4DTN A;  2XO7 A;  1GOB A;  3OYL A;  2KTQ A;  4Q5V A;  1QSY A;  2OZS A;  2OZM A;  2V7Y A;  1YIT N;  4BRH A;  1IKX A;  4DS4 A;  3WEE A;  3ZX2 A;  4BRG A;  3A5M C;  1E3M A;  1MWM A;  1XMO K;  3W3D A;  2ZGZ A;  2D0O A;  1RTH A;  4YY3 K;  4QAG A;  2W6K A;  1ATN A;  4BRP A;  4BG9 A;  4R79 A;  3FGU A;  1NOZ A;  4NB4 A;  4OKJ A;  3D2F A;  3NGY A;  1NM1 A;  1RDA A;  3LDS A;  4ILG B;  3P1G A;  4KPY A;  1Y97 A;  4K8X A;  2YHW A;  1ILY A;  4DF8 A;  3EO3 A;  3O3H A;  3ZSV A;  3TTC A;  3RSE B;  1SKR A;  4FWS A;  3ZSX A;  1VQO N;  5BRF A;  4FLT A;  1RTI A;  3E9L A;  4DFM A;  4BRA A;  3DXM B;  4DR7 K;  2QW9 A;  4IDK A;  1EWR A;  1VSL A;  1HNX K;  1BI4 A;  1NU0 A;  4KTQ A;  1ZYQ A;  3KLG A;  1S72 N;  4FJK A;  4BRD A;  5J1E A;  5JLH A;  2RN2 A;  3OVN A;  5ELZ A;  4BRI A;  3MN5 A;  1Q8I A;  1BA1 A;  4DTP A;  1Q7Y O;  3J81 O;  4FL9 A;  3ZT0 A;  4L8R B;  3THW B;  5FPD A;  3AVG A;  2F9T A;  2W6L A;  4FJG A;  1VSE A;  5FPM A;  4B1X B;  2E20 A;  2WON A;  3UE5 A;  1TAQ A;  4IBN A;  4FLZ A;  3O9U A;  3OJS A;  3NVK A;  5A2Q O;  2P9I B;  4GMJ B;  1GLE G;  3E9O A;  4B3R K;  4LSN A;  1YUW A;  4I7F A;  4AQY K;  4M3W A;  3SQ0 A;  1CZB A;  3GG4 A;  1S3X A;  4A61 A;  5DK5 A;  2HHU A;  4RW7 A;  1HX1 A;  1HRH A;  2NLX A;  2OPQ A;  4Y0W A;  4DSF A;  1WLJ A;  5J2N A;  4DTJ A;  2P9U A;  1KQS M;  2P1J A;  4PKH A;  4CEQ A;  4E1N A;  3SMP A;  4FVU A;  3ID6 A;  2Q0U A;  4KBO A;  5HOO A;  4PL7 A;  1VSM A;  1L3T A;  3H3O B;  2Q97 A;  4OPK A;  2QXL A;  4PA1 A;  3AGR A;  3C6A A;  1RT2 A;  1SV5 A;  4CGF A;  3U9Z A;  1RT5 A;  4XH1 A;  3WT0 A;  3OYE A;  4CZE A;  3A5L C;  4BRK A;  4RTF D;  4BRC A;  4H5T A;  1YJ9 N;  2ZQB A;  4BR9 A;  1L3S A;  1IBM K;  3O08 A;  1LCU A;  3O3G A;  1T05 A;  1RFQ A;  4M63 C;  3HM9 A;  3ASM A;  1BA0 A;  2WC9 A;  3OYK A;  3HSC A;  4KRE A;  4KTZ A;  5C2D A;  2NRR A;  2Q36 A;  4FJI A;  3O3F A;  3CCR N;  2NRW A;  5HRS A;  5M1N A;  2O8F B;  2DFH A;  3KKR A;  3SUN A;  1NGE A;  4KAZ A;  1S22 A;  4G9Z A;  4CED A;  1NJZ A;  3CFR A;  3ZLJ A;  2P5G A;  5AQO A;  3CJ9 A;  1R0A A;  1VQL N;  3UKR A;  4Z4F A;  1RBV A;  2V7Z A;  3C94 A;  3OJU A;  4Z0U A;  2XY8 A;  5HRN A;  1IH7 A;  2QWQ A;  3LL3 A;  3R9P A;  4Q0B A;  4K8Z A;  2F96 A;  3CC4 N;  3T69 A;  4DG1 A;  4CHP A;  4FCY A;  1Q18 A;  4F3O A;  2PY5 A;  3O4N A;  3OYF A;  4FM0 A;  4OO1 J;  2DTU A;  3K2P A;  3ZX3 A;  1U04 A;  4ZHR A;  1XMQ K;  2ZE2 A;  3HXM A;  4KI6 A;  4BQZ A;  4DTM A;  5FPN A;  3AO5 A;  1Q86 O;  5HRR A;  1JLF A;  2EWS A;  1LW2 A;  4WFN L;  3NCI A;  1TUY A;  1ASW A;  1EKE A;  4OPA A;  3EZW A;  1HR0 K;  1S6Q A;  2VCP A;  3O5B A;  1YT3 A;  2GEM A;  3C6H A;  4DU3 A;  1B9D A;  4JS4 A;  2P9K B;  3THV A;  4Z94 A;  4CJS A;  4B1W B;  3KLF A;  4CZJ A;  3CJ1 A;  3DI6 A;  3GE1 A;  4Z4I A;  1RIL A;  3G6E N;  3L3V A;  3IG1 A;  4JRP A;  4B9V A;  2YX6 A;  3WXK A;  1RDU A;  2IGI A;  4DR4 K;  5DM6 L;  2QWM A;  3CCQ N;  2YHX A;  3U6F A;  4PHT X;  3SNN A;  1DLO A;  1OH7 A;  2A42 A;  4AM6 A;  3VTI A;  5FPE A;  1SL0 A;  3CJC A;  2P9P A;  3IUC A;  5EX5 A;  3QNN A;  1U49 A;  3I56 N;  4RW6 A;  4GKK K;  2DFF A;  3D2E B;  4EHU A;  2YCH A;  3AVM A;  3K59 A;  4YOV A;  2GBZ A;  2AJQ A;  5BRH A;  4OKE A;  3G4S N;  3P38 A;  3RTV A;  4ID5 A;  4CIF A;  3T1A A;  3CFP A;  3K5M A;  2OPS A;  1NWK A;  3ZSQ A;  3PX6 A;  1RDW X;  4B9U A;  1HKB A;  1NLV A;  3ITH A;  2VG7 A;  4Y1D A;  3ID8 A;  3DMJ A;  3KLH A;  4H4O A;  4FLW A;  3MEG A;  1J53 A;  2RKI A;  4RWT A;  1IG8 A;  5JMV A;  3DXK A;  3VQA A;  2NNW A;  4FWP A;  3L2U A;  4DV1 K;  4FLY A;  4BGB A;  1YAG A;  2QWN A;  4LF7 K;  5GAG P;  2Q0R A;  4EZ9 A;  4I9Q A;  2YKM A;  3FLC O;  3H3N O;  3OY9 A;  5I42 A;  3AO2 A;  1I39 A;  4CD1 A;  4CHQ A;  3ZET B;  2PBD A;  4WCE L;  1EET A;  1S1U A;  2CGL A;  4CIG A;  2X6S A;  1VSK A;  4B8A B;  3J8A A;  4CGI A;  4DV5 K;  4KH6 A;  3BF1 A;  1JCF A;  3B6P A;  2E6M A;  1GLL O;  3VEN A;  1SKW A;  1HJO A;  2Q2R A;  3DJC A;  2VWJ A;  1RT3 A;  4IKF A;  1NGG A;  3DOK A;  2HHW A;  3S3N A;  4NLB A;  4FLV A;  2OCE A;  4MLE A;  1LAV A;  2HBM A;  5FRO A;  3BUZ B;  4CJ4 A;  3AVI A;  1S1V A;  1UOC A;  2YNF A;  3KK2 A;  4WQ4 C;  3NH0 A;  3F9M A;  5KI6 A;  1SS6 A;  3B8A X;  2QWL A;  4O44 A;  5HRO A;  4BDY A;  1DTQ A;  3QIC A;  2EX3 A;  3LM9 A;  1NK0 A;  2G8I A;  1JLG A;  1WSJ A;  3NDK A;  5C10 A;  1EQY A;  1BO5 O;  2WFB A;  4WE1 A;  2VQE K;  2F4V K;  3PY8 A;  1C0F A;  1VQK N;  1X1P A;  1TAU A;  2P9N B;  1ATR A;  1TL3 A;  2E2Q A;  1NKB A;  4BR5 A;  1RTJ A;  3KWI A;  4BDZ A;  3LDN A;  1ZBL A;  1RDD A;  4U7B A;  4KFB A;  4H8K A;  1S6P A;  4E7K A;  4CFC A;  2HMP A;  1OH6 A;  3ULD A;  2PYL A;  1LAW A;  1KCF A;  1RCH A;  2I7N A;  3L6Q A;  3HP6 A;  3RMA A;  3ATU A;  2O8C B;  4DSE A;  3NHG A;  2OTJ N;  1KRP A;  1JLE A;  2ETJ A;  4OJR A;  4FVM A;  4E1J A;  2YI1 A;  1BCO A;  3AVN A;  1S1T A;  4FWM A;  2RF2 A;  3O9Q A;  4LC9 B;  3UIQ A;  3GL1 A;  1VK0 A;  4IJA A;  4PY5 A;  5GIO A;  2W41 A;  3AA3 A;  3OS0 A;  1J6Z A;  3D45 A;  2QWP A;  3ZT3 A;  3O1B A;  3CIP A;  4UQG A;  3H08 A;  2LSN A;  3SAF A;  4DR1 K;  3HVT A;  3KVG A;  4FJN A;  1RBU A;  2AA4 A;  2BTF A;  2FF3 B;  4CZL A;  1LWC A;  4K25 A;  4DWI A;  3VGK A;  3WXJ A;  2A5X A;  1KXP A;  2NZT A;  1D5A A;  2D5R A;  2KFZ A;  2HND A;  1IKY A;  1JLQ A;  4M42 A;  2XHB A;  4DFK A;  4H0P A;  4B9Q A;  4CK1 A;  1REV A;  5B8H A;  4I6M A;  2YNH A;  3ZSR A;  4KKO A;  1TKT A;  1T44 A;  4QOZ B;  1QQC A;  4O5B A;  2G8K A;  3ZEU B;  1D9D A;  4FK0 A;  3ENB A;  3OYD A;  4YDU C;  3CCU N;  1K9M O;  2BAN A;  1E4G T;  4H5N A;  4ISG A;  4DR6 K;  3MX2 A;  5AQZ A;  2XRI A;  5BPN A;  4CF0 A;  3IFR A;  1VQP N;  2RPI A;  4FSV A;  3OYB A;  4FOE A;  5IWA K;  3SV4 A;  1RTD A;  3AVH A;  5M1O A;  4FM2 A;  4IWV A;  4JS5 A;  1U47 A;  3MED A;  2IVO A;  3MX5 A;  1NGC A;  3PIO L;  1XUP O;  1HQU A;  2D1K A;  1VSH A;  4CJU A;  2O4I A;  3PX0 A;  2FF6 A;  4JI1 K;  2HVI A;  3ALY A;  1X9S A;  1HNZ K;  2V51 B;  1KAX A;  1W7A A;  2D0P A;  1LWF A;  3G0Z A;  3QEX A;  4X64 K;  5AZJ A;  4RCH A;  2J4R A;  3LZJ A;  2YHA A;  5TKW A;  4DS5 A;  3M8Q A;  1FJG K;  3TAB A;  3QDK A;  3Q7C A;  4JI7 K;  4CEF A;  3UKU B;  1Q9Y A;  3VET A;  3KK1 A;  1M1K O;  4ISE A;  1VQM N;  4JEP A;  4HHT A;  3J7A P;  4O0J A;  4AHR A;  1QE1 A;  3LAM A;  1X9J A;  1HPZ A;  4ISF A;  4YOY A;  3L2W A;  5M1P A;  5J2Q A;  3MXJ A;  4KHW A;  5AQX A;  2UXD K;  3VQC A;  2HNY A;  3N4P A;  2IAJ A;  2A1R A;  1N33 K;  4YOX A;  3S3M A;  2G8H A;  1Q9X A;  3C7N B;  4PL8 A;  5LMU K;  4X62 K;  3M6G A;  3LM2 A;  1S9E A;  1C0G A;  5KRS A;  1X3N A;  1D4X A;  3P4I A;  5AQS A;  4CHO A;  3OYI A;  1G15 A;  4XH5 A;  4LH5 A;  4CZM A;  3SBG A;  5I3U A;  2IOC A;  1NJX A;  4OX9 K;  4YOR A;  4CEA A;  2B6A A;  4M41 A;  1HYV A;  5BRE A;  4LF6 K;  4J2E A;  4DV2 K;  3K9J A;  1U6Z A;  1IKV A;  3VF4 A;  2W40 A;  3QNO A;  4DUZ K;  5C15 A;  5C25 A;  3PLA A;  4KB1 A;  4E0D A;  3RSE A;  4MO5 A;  4FJL A;  2O4G A;  3CI5 A;  3TWH A;  4FWN A;  4FLX A;  3SPZ A;  4B08 A;  5KGX A;  3LZI A;  3V1O A;  3NGZ A;  1R59 O;  1K8K A;  3MXI A;  4JKH A;  2UUB K;  3LWM A;  3A5O C;  1DKG D;  3PV8 A;  2E2N A;  1NK7 A;  3ATV A;  5BRD A;  4DR2 K;  3QBX A;  5HLF A;  3FE1 A;  2CGK A;  1JL2 A;  4NCA A;  1VRU A;  1UA0 A;  5ADX A;  3M8P A;  4NCB A;  2P9I A;  3PX4 A;  2P9S A;  4FK4 A;  4YNQ A;  4JHD B;  5C42 A;  2Y1J A;  3QES A;  4H0Y B;  5CZ2 A;  3OYM A;  2Z1G A;  3H46 O;  4Z4E A;  2VQF K;  1QQM A;  2F8S A;  1JCG A;  4E3S A;  3SUO A;  3WXL A;  3V1R A;  1IV0 A;  2FBT A;  3SPY A;  2OPR A;  1YF5 L;  2ASO A;  3C95 A;  3NGI A;  3O9S A;  1MDU B;  4JLH A;  3VQ9 A;  4E89 A;  3BF3 A;  4A59 A;  1WAF A;  4JI0 K;  5M1Q A;  3N4Q A;  2A6A A;  1X9M A;  1NK9 A;  4JNE A;  1Z6R A;  4AF1 A;  1OKJ A;  1EO1 A;  1EWQ A;  1UWB A;  1XNR K;  1Q82 O;  1NK6 A;  2GV9 A;  3LAL A;  4NLC A;  1DEJ A;  1RDC A;  2RE2 A;  5AQT A;  3WXM B;  1WNS A;  1HYZ A;  5ADX H;  1TYQ A;  4CFD A;  2HBK A;  1V4T A;  1JL1 A;  3DRR A;  3F2K A;  4CK3 A;  4C1N K;  2ZJQ L;  5M1F A;  3VQ4 A;  2D0B A;  3VEW A;  3DLE A;  4FZZ A;  4KHS A;  4CEB A;  1QSS A;  4A2A A;  1UA1 A;  3ISN C;  1IKW A;  2O8F A;  1EP4 A;  4BC4 A;  4IJN A;  5LY3 A;  2RHK A;  4M7X A;  1B92 A;  3ZT2 A;  2QEX N;  4DUY K;  3VGL A;  3KK7 A;  4NCG A;  4WFA L;  4FXD A;  3WEE B;  3M3Z A;  1IBK K;  2BGG A;  1P8Z A;  4CJL A;  3BP8 A;  3VEZ A;  4IOX A;  3FZH A;  5CE3 A;  4XIU A;  3BZK A;  3ZSY A;  4KO0 A;  1S1X A;  3EE9 A;  1N6Q A;  1BOT O;  4B1U B;  4JD2 A;  1NGD A;  5D3G A;  3FFI A;  3VQ8 A;  4FYD A;  3D2F B;  1RDB A;  3ENH A;  1OVY A;  2PZS A;  4JN4 A;  5AQY A;  4BRQ A;  4BRF A;  4BDP A;  4E1M A;  1BU6 O;  2UXC K;  1C0U A;  1QS4 A;  3FZK A;  4HTL A;  3CCL N;  1SL2 A;  1IO2 A;  1RBR A;  3LP0 A;  4BRE A;  4BRO A;  5MLC Q;  3LDO A;  2NUB A;  1YI2 N;  1IG9 A;  4X65 K;  1C1B A;  3VQ7 A;  4PKI A;  1TKD A;  1BI4 B;  2XY6 A;  5AQN A;  1HNI A;  1RGI A;  4E7I A;  2G8W A;  3IRX A;  1HQE A;  4J2D A;  3AAQ A;  1EXQ A;  1Q81 O;  3VEY A;  4CGD A;  4N47 A;  1NK4 A;  3TSP A;  3NVM A;  4IOA L;  1S9G A;  3HO1 A;  3VEX A;  5KPR A;  3B6O A;  1YHQ N;  3DOL A;  2OA8 A;  4GV9 A;  4AHV A;  1CZA N;  3QIO A;  3SZ2 A;  2HF3 A;  3WUH A;  4LF9 K;  1A5X A;  3MK6 A;  3T3F A;  3SLC A;  4M7Y A;  1HKG A;  1QHT A;  1KSP A;  1RNH A;  1JLC A;  1HKC A;  4DB3 A;  1Y64 A;  3FZL A;  3U3G A;  3O4Q A;  1BL3 A;  3U9D A;  1RT4 A;  3IMX A;  4F8R A;  3HM8 A;  2UUC K;  2Z1J A;  3V9S A;  2X6N A;  4BE0 A;  2P9U B;  3VF2 A;  2A41 A;  3MN9 A;  3RMD A;  3R1X A;  3P83 D;  2QI2 A;  1DTT A;  3EZ5 A;  2D0A A;  3VA3 A;  4BR2 A;  4AHT A;  4FJJ A;  3TAN A;  1TUU A;  4CJV A;  3BY5 A;  3CCE N;  2E8A A;  2FBX A;  1J5E K;  4JK9 A;  5AQJ A;  2UUA K;  5EY4 A;  1T7P A;  1BUP A;  4DTU A;  1BIZ A;  1GLA G;  1J5O A;  1V4S A;  2BE2 A;  3RVC A;  1VQ7 N;  4DF4 A;  1JKH A;  2QWO A;  4DHY A;  2ZWH A;  3DLH A;  5HRP A;  1C1C A;  4JKD A;  3O9R A;  1Z05 A;  2YNI A;  1C6V A;  1IJJ A;  3H45 C;  1G99 A;  1U2V A;  3CXC M;  2I7P A;  3UKR B;  2E4L A;  4E7H A;  4ELU A;  1XHX A;  1WBD A;  4QS9 A;  3TU5 A;  3VEO A;  2P9L A;  4LF8 K;  5C24 A;  4OPH A;  4CZG A;  5SZT A;  3HRG A;  2VGN A;  4CD3 A;  1IBL K;  4LF4 K;  2I5J A;  1SL1 A;  3I0S A;  4A62 A;  3U8X A;  4F4K A;  5IT9 O;  1GOA A;  4BWJ A;  4Y1C A;  4CEO A;  2W42 A;  1JXB A;  4JKG A;  4O8K A;  1NKC A;  1NOY A;  3EY1 A;  3MMV A;  1X9W A;  2E1Z A;  3CCV N;  5HL7 L;  3PSI A;  4EP4 A;  2QA4 N;  4HUG A;  4CJP A;  3VQ6 A;  5KTQ A;  1K73 O;  5AQI A;  3VQQ A;  1VSJ A;  4H0O A;  2QWR A;  4ILH A;  4N56 A;  4H0V B;  3IDH A;  3T1H K;  4BRM A;  5KPT A;  3VEV A;  4FWQ A;  1HNW K;  3MCP A;  2GX9 A;  4LH4 A;  4CGH A;  4MO4 A;  3ZSW A;  1XNQ K;  5GIP A;  1QHA A;  1LW0 A;  2X78 A;  3LAN A;  4CZF A;  3BZC A;  3HBT A;  3EKU A;  2O8C A;  2G8V A;  3LAK A;  5EOY A;  5HBM A;  3C6U A;  4JKB A;  5J2M A;  3RR8 A;  3AVL A;  2P9P B;  5JVG L;  1T8E A;  1SAZ A;  2H3G X;  3SCX A;  2VWK A;  5JVH L;  3ZSO A;  4DTX A;  4FJM A;  3ZCM A;  2IVP A;  3VPZ A;  3TAF A;  2OPP A;  4BC2 A;  2QK9 A;  3NMU A;  1WSG A;  4GVM A;  4E19 A;  1S1W A;  4KRF A;  4H0T B;  3BEX A;  1NGH A;  4LFB K;  4B9M A;  1ASV A;  3HZ6 A;  1CLQ A;  1RBS A;  4M3Z A;  2HNZ A;  4JYA K;  1T6C A;  2D0C A;  3MDQ A;  2E5L K;  1FW6 A;  4E7J A;  1BDG A;  5AZI A;  1VAZ A;  2E2P A;  1NGB A;  4J2A A;  3SUP A;  3WXI A;  3IKM A;  1YTA A;  2KFN A;  3C6T A;  4NXM K;  3ZEU A;  2VG6 A;  3DXK B;  3QEW A;  4CBU A;  4DQP A;  2WTU A;  4KHN A;  4HCB A;  4FO0 A;  4DV3 K;  4RW9 A;  1MU2 A;  1L3U A;  3BDP A;  2IIR A;  1HMV A;  4DCH A;  4LD0 A;  3QIN A;  3SUQ A;  3M8R A;  3OS1 A;  4B8C A;  1I94 K;  2ZJR L;  5F2R A;  2O8E A;  3P5J A;  1S5J A;  4H5R A;  4DQR A;  4F3T A;  5CYQ A;  1TK8 A;  3WNF A;  3TAE A;  3DRS A;  3ZYY X;  2YV0 X;  4KHY A;  4M3R A;  3PO4 A;  4JAX A;  2OAN A;  3TAR A;  2UYT A;  3E01 A;  4B3S K;  3J7Y P;  4L3Q A;  2KW4 A;  4WFB L;  5JS1 A;  1U45 A;  4PQU A;  4FJH A;  2E1Y A;  1VQ6 N;  3C65 A;  1KLN A;  4JRQ A;  2ASM A;  3LP1 A;  4B9T A;  3THY A;  2DY4 A;  4FJ7 A;  4GKJ K;  3EYZ A;  5AQH A;  3J80 O;  1J54 A;  3HST B;  4BVO A;  4CF1 A;  3WQT A;  4GVE A;  3TTF A;  3L2R A;  4O8U A;  4C23 A;  4DU1 A;  1WSF A;  4KHP K;  2HHS A;  4CE9 A;  1VSI A;  2GTD A;  4JI8 K;  5C12 A;  3CHW A;  2HOE A;  1ATS A;  1TKX A;  3SJJ A;  1T03 A;  2GUP A;  1B9F A;  4C8K A;  4HUF A;  4O5F A;  1JJ2 M;  1N32 K;  1WB9 A;  2HW3 A;  3V1Q A;  1ZBS A;  5AQM A;  4N41 A;  3PUF A;  2FBY A;  3DAW A;  4H03 B;  4DQS A;  4M3U A;  4BGA A;  3CC7 N;  5JIC A;  4FWR A;  3RR7 A;  4ICL A;  3SBT A;  4FJ5 A;  4K42 A;  1QVG M;  4G1Q A;  5SWM A;  3GOI A;  2A1S A;  3THX A;  4LF5 K;  1EX4 A;  5AQP A;  4ZTJ A;  1QVF M;  1WN7 A;  3FZF A;  1NG9 A;  4CJK A;  3G25 A;  2QM1 A;  1GLD G;  3EEQ A;  4CJW A;  4CK2 A;  5F1X A;  3CQ8 A;  1NMN A;  3ENO A;  2FSJ A;  4O55 A;  2O8B A;  1W2B M;  1O13 A;  3AA4 A;  1ZBH A;  4B9L A;  3ZT1 A;  5DMR A;  3VTH A;  5J2P A;  1QTM A;  2F8T A;  3ULE A;  3C0B A;  4WQ4 A;  5BPL A;  2FBV A;  1TL1 A;  4I6M B;  3CCJ N;  1KLM A;  3M1F A;  4HCC A;  3G71 N;  3K57 A;  1BIS A;  1NGI A;  3S41 A;  2PFU A;  1OH5 A;  3NBP A;  4KB0 A;  3AY9 A;  3D6R A;  4IG3 A;  3V81 A;  4DV0 K;  3DLB A;  4DLE A;  4JI2 K;  3OYG A;  4FZY A;  2Z1H A;  5AFU H;  3AO1 A;  2IDO A;  4CHZ A;  1KAZ A;  4CEZ A;  1VQ8 N;  4BR4 A;  5KGW A;  3U4L A;  3HK2 A;  1WSI A;  3VN5 A;  5AQQ A;  4CF8 A;  1QQO A;  3HI0 A;  3T7Z A;  3KTQ A;  4FJX A;  1NMD A;  1W0H A;  5K14 A;  3KJV A;  3IAY A;  4N5S A;  3PO5 A;  3WNE A;  1ZBI A;  1MWK A;  3AVB A;  1FKO A;  3D7E O;  5EVZ A;  1VQ4 N;  3V6D A;  1NGA A;  5FRN A;  4KH4 A;  5GAE P;  4I2P A;  5AQR A;  5AZJ B;  4CBX A;  2E88 A;  2HBL A;  1YJW N;  4IFE A;  4M3X A;  4B1V A;  5CYM A;  4DMN A;  2B4J A;  3DXM A;  2KZM A;  4JI4 K;  3P39 A;  1C0T A;  3MXM A;  3CJB A;  1BCM A;  1P90 A;  4DTR A;  1YVN A;  4CJ7 A;  4DV7 K;  3NAE A;  2HHX A;  4WQ5 C;  1M90 O;  5GAH P;  3TAG A;  3THW A;  4A5B A;  3MCA B;  3ZX0 A;  2IS3 A;  5EU7 A;  2GUI A;  4W5O A;  3QET A;  4PUO A;  3T19 A;  2HBJ A;  3A8Y A;  3V9Z A;  3K9K A;  3HJF A;  3QEP A;  3CCS N;  1YTU A;  1WBB A;  4YDU A;  3JSM A;  4BE2 A;  3JS6 A;  3I8B A;  4IO8 A;  5LJW A;  3PIP L;  2Z1I A;  1A5W A;  2BDP A;  4BRN A;  4EFH A;  2GWJ A;  4O4G A;  3NF7 A;  3GDQ A;  2B5J A;  1VQ9 N;  4OGE A;  1VRT A;  1BIU A;  2UU9 K;  3SMS A;  1KTQ A;  1ZC6 A;  2KKZ A;  3OHR A;  4DSJ A;  3CPE A;  3JXU A;  3KLE A;  4Z4C A;  3OTO K;  1TK0 A;  4BR0 A;  3NF6 A;  1SQK A;  4KI4 A;  4DFP A;  2NRH A;  4IFY A;  4AH9 A;  3VES A;  4B3T K;  4BG8 A;  1GLC G;  4HVJ A;  3A0I X;  4BWM A;  3LPT A;  5C0Y A;  3QLH A;  5LMN K;  3O8M A;  4MQ3 A;  4H5V A;  3F73 A;  3VQE A;  5EXW A;  1FK9 A;  1NNE A;  5CHI A;  4FOI A;  3I33 A;  3TSQ A;  2O8D B;  3AAP A;  3R3L A;  1BQN A;  1SUQ A;  2X74 A;  1A5V A;  4CJE A;  1K8K B;  1E4F T;  1RBT A;  3KD1 E;  2EHG A;  2OYQ A;  1DT9 A;  1FXX A;  3O4W A;  3CCM N;  1KC8 O;  5BN9 A;  3L3U A;  4RW8 A;  2G8U A;  4CJ3 A;  5M1K A;  2ATQ A;  4FWK A;  5BPM A;  4EAH D;  2NRX A;  3D0P A;  3VQ5 A;  1GLJ O;  2P9S B;  4CJT A;  1J9A A;  2Q31 A;  2ITM A;  3M5R A;  4BC3 A;  3CQX A;  4CI6 A;  1ZBF A;  3OYA A;  3TI0 A;  2HHQ A;  4F2R A;  1L3V A;  4MLH A;  3LDQ A;  3BGR A;  3I8D A;  4B3M K;  2CH5 A;  3S3O A;  1VQ5 N;  4CW7 B;  4A57 A;  4C8L A;  3JYT A;  4EP5 A;  1KVA A;  4YOT A;  3AV9 A;  3EN9 A;  4BRL A;  1HPM A;  4DV6 K;  3E1Y A;  1C1A A;  1Z26 A;  4OPJ A;  3RWU A;  4W5N A;  4QS8 A;  3LPU A;  3E66 A;  1KVB A;  3EKS A;  2HF4 A;  3MWT A;  2P9K A;  1TGO A;  1VHX A;  3OYN A;  4IFV A;  1TYQ B;  3O80 A;  4CIE A;  3L2Q A;  4FPB A;  3R6M A;  4ILJ A;  3LP2 A;  5T7B A;  4M45 A;  4J2B A;  4XH4 A;  1NJI O;  2VYP A;  4ELV A;  3SYZ A;  4WQ5 A;  1BHL A;  4FK2 A;  1JCE A;  3AO3 A;  4GV6 A;  4FPA A;  1BQM A;  4DR5 K;  4M3Y A;  1YVU A;  4JKA A;  1ITG A;  4PWD A;  3OYH A;  4CFA A;  5BR8 K;  1KD1 O;  2XY7 A;  5JLF A;  1WOQ A;  2YKN A;  3HPH A;  3WQU A;  3D2E A;  4FZX C;  3FZM A;  1ASU A;  3QEV A;  4J8F A;  3CC2 N;  4QCL A;  3V9U A;  3VMF B;  3OA9 A;  1CZ9 A;  1RT6 A;  4U67 L;  2VG5 A;  4JD2 B;  4I2Q A;  4I9L A;  1VSF A;  3HTV A;  3W0L A;  5KPZ A;  3U3Y A;  3KLI A;  1GOC A;  2KHO A;  4DTO A;  4DSK A;  1LWE A;  1QZ6 A;  2BUP A;  4N76 A;  2XY5 A;  3WNG A;  1U4B A;  3HPO A;  1TK5 A;  4H4M A;  3FFK B;  2KLA A;  4KTW A;  3SAG A;  1QSL A;  4B9S A;  4KHU A;  2VWB A;  3OBY A;  3MN7 A;  1D8Y A;  2ZF5 O;  1NJY A;  1HYS A;  1TKZ A;  4FWO A;  1WSE A;  4BVP A;  5BR9 A;  3LP3 A;  3M8S A;  2HB5 A;  4JKC A;  4CBW A;  3V9W A;  4H5W A;  5KQD A;  4GNI A;  4YHH K;  4CZI A;  3SQ1 A;  4GY2 B;  2FSK A;  4FWL A;  2WBN A;  3TAM A;  4Z4H A;  3ZET A;  3DM2 A;  3K5O A;  4YOU A;  3NF9 A;  3CFO A;  2P5O A;  1TVR A;  3CD6 N;  3VOV A;  1H1V A;  4CJQ A;  2ZJP L;  3AVJ A;  3L4I A;  4GW6 A;  4RG8 A;  3OBW A;  3S9H A;  1ZXO A;  3DWL A;  4A2B A;  4CEC A;  3QBW A;  3ZSZ A;  2HHT A;  4CJF A;  5LJV A;  4W5T A;  2FXU A;  4HTU A;  3MAQ A;  3HYF A;  5AQW A;  1NK5 A;  4OLA A;  2AP1 A;  1XHZ A;  3IS9 A;  4CER A;  2YHB A;  5E26 A;  4AHS A;  4CHN A;  5AQU A;  1T3V A;  3TTD A;  3AVA A;  2KQ2 A;  4NO7 A;  1WAJ A;  2DPN A;  3QFP A;  1WSH A;  2NRZ A;  4AM7 A;  5AQF A;  5AR0 A;  5AQV A; 
#chains in the Genus database with same CATH homology
 4BVO A;  3U9Z A;  3WQT A;  4GVE A;  1XC3 A;  3TTF A;  4O8U A;  4C23 A;  4XH1 A;  4PKG A;  3WT0 A;  3KZB A;  3P31 A;  3A5L C;  4MO5 A;  3RSE A;  3UB5 A;  4CZE A;  3CI5 A;  4BRK A;  2GTD A;  4FWN A;  4RTF D;  4H5T A;  4BRC A;  5C12 A;  1YJ9 N;  3CHW A;  2P9N A;  4BR9 A;  1QZ5 A;  2HOE A;  1ATS A;  1BWF O;  1LCU A;  1SZ2 A;  3O08 A;  1RFQ A;  5E84 A;  4M63 C;  4UY8 O;  1BA0 A;  2GUP A;  1R59 O;  2FLO A;  3DLL L;  1K8K A;  2WC9 A;  4O5F A;  1JJ2 M;  4JKH A;  4EHT A;  3HSC A;  5C2D A;  2NRR A;  1ZBS A;  2Q36 A;  5AQM A;  3A5O C;  3VER A;  1DKG D;  2E2N A;  3CQY A;  2NRW A;  3CCR N;  3ATV A;  5BRD A;  4WF9 L;  3QBX A;  4H0X B;  5M1N A;  1GLB G;  3DAW A;  3FE1 A;  2CGK A;  4WYB A;  5KQ8 A;  1NGE A;  4G9Z A;  1S22 A;  4H03 B;  4EIA A;  1NGF A;  4YOW A;  4BGA A;  3CC7 N;  5ADX A;  5JIC A;  4FWR A;  5AQO A;  3CJ9 A;  4XEI A;  1VQL N;  3CMA N;  3UKR A;  3SAH A;  3GBT A;  2P9I A;  3SBT A;  2V7Z A;  4K42 A;  1U2V B;  2P9S A;  1QVG M;  1X3M A;  1YXQ A;  3GOI A;  4JHD B;  4H0Y B;  2YHY A;  3H46 O;  2QWQ A;  3LL3 A;  5DM7 L;  5I9E B;  3R9P A;  1QQM A;  5AQK A;  5AQP A;  1QVF M;  4IZ9 A;  3CC4 N;  2E2O A;  1JCG A;  3T69 A;  2P9L B;  3FZF A;  1Q18 A;  3G25 A;  3WXL A;  2QM1 A;  1GLD G;  1YF5 L;  2ASO A;  3MN6 A;  4OO1 J;  4DQ8 A;  3ZX3 A;  3CPW M;  3HOS A;  3E9P A;  3O9S A;  5F1X A;  1MDU B;  3BF3 A;  4A59 A;  5M1Q A;  3ENO A;  3N4Q A;  5FPN A;  4BQZ A;  2A6A A;  2FSJ A;  1Q86 O;  4JKG B;  1QQN A;  1O13 A;  4JNE A;  1W2B M;  1Z6R A;  4AF1 A;  3VTH A;  2EWS A;  4BR7 A;  3KHY A;  1OKJ A;  3ULE A;  1EO1 A;  3C0B A;  4WQ4 A;  4WFN L;  5BPL A;  1Q82 O;  1TUY A;  4NLC A;  1DEJ A;  2RE2 A;  5AQT A;  3WXM B;  3TSU A;  4OPA A;  4I6M B;  5ADX H;  3EZW A;  1TYQ A;  3CER A;  2JWK A;  2VCP A;  3O5B A;  3VGM A;  3CCJ N;  2HBK A;  3LDP A;  1V4T A;  2GEM A;  3C6H A;  3M1F A;  2P9K B;  3G71 N;  3AAR A;  3F2K A;  3FR0 A;  1NGI A;  4IO9 L;  4Z94 A;  4C1N K;  2ZJQ L;  3S41 A;  2GEL A;  4B1W B;  2PFU A;  5M1F A;  4CZJ A;  3L0Q A;  3CJ1 A;  3GE1 A;  4B1Y B;  3G6E N;  3AY9 A;  3D6R A;  3VEW A;  1W97 L;  1ESV A;  2YX6 A;  3WXK A;  1RDU A;  4A2A A;  3CET A;  5DM6 L;  2QWM A;  3CCQ N;  2YHX A;  1WUA A;  4BC4 A;  4PHT X;  4IJN A;  4JKF A;  4GV3 A;  5LY3 A;  2RHK A;  4M7X A;  2A42 A;  4AM6 A;  3VTI A;  5FPE A;  3CJC A;  2QEX N;  3VF6 A;  3VGL A;  2P9P A;  3KK7 A;  4WFA L;  2A3Z A;  3WEE B;  3M3Z A;  5AFU H;  3IUC A;  5EX5 A;  1KAZ A;  1P8Z A;  1VQ8 N;  3BP8 A;  4BR4 A;  3A5N C;  3U4L A;  3VEZ A;  3I56 N;  3HOT A;  4IOX A;  5AQQ A;  3FZH A;  5CE3 A;  2NRV A;  1QQO A;  3H1V X;  3D2E B;  4EHU A;  3HI0 A;  3T7Z A;  1NMD A;  2HST A;  3SK3 A;  3EE9 A;  2YCH A;  1BOT O;  4QS7 A;  4B1U B;  4JD2 A;  1NGD A;  4YOV A;  2CH6 A;  2CGJ A;  1GLF O;  2PAV A;  1MWK A;  3AGK A;  3D7E O;  5EVZ A;  5BRH A;  1VQ4 N;  3D2F B;  1NGA A;  3ENH A;  3P38 A;  4KH4 A;  1OVY A;  3G4S N;  3CJ7 A;  2YJE A;  4KH5 A;  4JN4 A;  5AQY A;  4BRQ A;  4DKW A;  5AQG A;  5GAE P;  5AQR A;  3QFU A;  5AZJ B;  4BRF A;  4CBX A;  2E88 A;  1DGK N;  1BU6 O;  3TPQ A;  3FZK A;  1NWK A;  2HBL A;  4BY9 C;  3UKU A;  4HTL A;  4IFE A;  3I55 N;  1YJW N;  4B1V A;  3CCL N;  3O1W A;  1RDW X;  3F5T A;  1HKB A;  3DXM A;  1NLV A;  4BRE A;  2YJF A;  4BRO A;  4IEI A;  3ID8 A;  3LDO A;  5MLC Q;  4CZH A;  3P39 A;  3CJB A;  5AZI B;  4BC5 A;  1YI2 N;  1P90 A;  1YVN A;  4CJ7 A;  4RWT A;  1IG8 A;  3MWP A;  4PKI A;  5JMV A;  3EE8 A;  4WQ5 C;  1M90 O;  5GAH P;  4K43 A;  5AQN A;  3DXK A;  4A5B A;  2NNW A;  1N8R O;  3MCA B;  4FWP A;  3ZX0 A;  1RGI A;  5H1S Q;  4JK7 A;  4BGB A;  1YAG A;  4JKE A;  2QWN A;  3R8E A;  2HBJ A;  3A8Y A;  5GAG P;  4IOC L;  3AAQ A;  2IVN A;  2Q0R A;  3EL2 A;  3VEY A;  1Q81 O;  3K9K A;  4MDA A;  5TKY A;  3CCS N;  3TSP A;  3NVM A;  4IOA L;  3FLC O;  3H3N O;  4YDU A;  3VEX A;  5KPR A;  3C7N A;  3JS6 A;  3I8B A;  4B1Z A;  4CD1 A;  3H6E A;  1MA9 B;  1T6D A;  1YHQ N;  3ZET B;  2PBD A;  4WCE L;  4IO8 A;  5LJW A;  3PIP L;  4GV9 A;  1CZA N;  4JK8 A;  2CGL A;  1HLU A;  2HF3 A;  4BRN A;  3J8A A;  4EFH A;  2GWJ A;  3WUH A;  2Q1N A;  4KH6 A;  3BF1 A;  1JCF A;  3GDQ A;  3MK6 A;  3SLC A;  1XQS C;  4M7Y A;  1VQ9 N;  1HKG A;  1GLL O;  3VEN A;  1HKC A;  3SJH A;  4DB3 A;  3SMS A;  1HJO A;  1Y64 A;  1ZC6 A;  2KKZ A;  2Q2R A;  3FZL A;  3OHR A;  3DJC A;  3CPE A;  3IMX A;  3U9D A;  1K8A O;  3HM8 A;  1HUX A;  1NGG A;  2ASP A;  2JWL A;  2WUS A;  3JXU A;  4NLB A;  2P9U B;  3QB0 A;  3VF2 A;  5AFU A;  2A41 A;  4MLE A;  3MN9 A;  4BR0 A;  2HBM A;  5BN8 A;  3BUZ B;  3R1X A;  1SQK A;  2NRH A;  3VES A;  1VQN N;  4IXC A;  4WQ4 C;  2QI2 A;  3O6W A;  1GLC G;  4BG8 A;  3F9M A;  1SS6 A;  3B8A X;  3A0I X;  2QWL A;  5AR0 A;  5C0Y A;  3CF5 L;  3QIC A;  3O8M A;  2FSN A;  2GWK A;  3LM9 A;  5CR4 A;  4BR2 A;  2QTD A;  1YJN N;  5C10 A;  1EQY A;  1BO5 O;  3OW2 M;  1TUU A;  2WFB A;  4H5V A;  3O9T A;  5EXW A;  3CCE N;  2E8A A;  5CHI A;  3LDL A;  1C0F A;  4FOI A;  3I33 A;  1VQK N;  2P9N B;  4JK9 A;  1ATR A;  3TSQ A;  5AQJ A;  2E2Q A;  3AAP A;  3R3L A;  4BR5 A;  4CZK A;  3Q7B A;  5EY4 A;  5GAD P;  4IDH A;  1BUP A;  3KWI A;  1GLA G;  3LDN A;  1V4S A;  3RVC A;  4K41 A;  4U7B A;  1K8K B;  1E4F T;  3L4Q A;  3QML A;  1VQ7 N;  1DT9 A;  2QWO A;  2HMP A;  2ZWH A;  4DHY A;  3O4W A;  3CCM N;  1KC8 O;  5BN9 A;  5AQL A;  4JKD A;  2I7N A;  2D4W A;  3O9R A;  1Z05 A;  3L6Q A;  5M1K A;  3ATU A;  2OTJ N;  4FWK A;  5BPM A;  1IJJ A;  2NRX A;  3H45 C;  4IEE A;  1G99 A;  4EAH D;  1U2V A;  3J7Z O;  2F9W A;  3CXC M;  1NGJ A;  2I7P A;  1NBW A;  4JHD A;  4E1J A;  2YI1 A;  3UKR B;  4MDB A;  1GLJ O;  2P9S B;  4FWM A;  4LC9 B;  3O9Q A;  2ZGY A;  3GL1 A;  4QS9 A;  3TU5 A;  4IJA A;  3VEO A;  5GIO A;  2W41 A;  3CME N;  2P9L A;  1J6Z A;  2Q31 A;  2QWP A;  2ITM A;  1BG3 A;  3M5R A;  3O1B A;  4BC3 A;  3CQX A;  3CIP A;  4OPH A;  4CI6 A;  2V52 B;  4CZG A;  3HRG A;  2VGN A;  4CD3 A;  2A40 A;  3SAF A;  1LOT B;  4MLH A;  3LDQ A;  3KVG A;  3CJA A;  4HWI A;  2AA4 A;  2BTF A;  2FF3 B;  3H1Q A;  4A62 A;  3U8X A;  4CZL A;  2CH5 A;  4K25 A;  3VGK A;  1VQ5 N;  3WXJ A;  2A5X A;  4A57 A;  1KXP A;  2NZT A;  4JKG A;  4C1N I;  4O8K A;  2OTL N;  3MMV A;  4YOT A;  3EN9 A;  2E1Z A;  1HPM A;  4BRL A;  3CCV N;  3E1Y A;  2F7T A;  1KAY A;  5HL7 L;  2QA4 N;  1YIJ N;  3KWG A;  4F9O A;  4QS8 A;  4H0P A;  4B9Q A;  1K73 O;  5F0X A;  5AQI A;  5B8H A;  4I6M A;  3ULE B;  3E66 A;  4H0O A;  2BH1 A;  3EKS A;  2QWR A;  4ILH A;  2HF4 A;  3MWT A;  4H0V B;  2P9K A;  3IDH A;  1T44 A;  3ZEU B;  5GIN A;  1TYQ B;  3O80 A;  4BRM A;  5KPT A;  5C2F A;  4FPB A;  3ENB A;  3R6M A;  2NRT A;  4FWQ A;  3VEV A;  4YDU C;  3MCP A;  4ILJ A;  2GX9 A;  4A5A A;  3CCU N;  1K9M O;  4BQL A;  1E4G T;  4MO4 A;  4H5N A;  4ISG A;  3MX2 A;  4XH4 A;  5AQZ A;  5GIP A;  5BPN A;  1QHA A;  1NJI O;  2VYP A;  3IFR A;  1VQP N;  4FSV A;  4WQ5 A;  4CZF A;  4FOE A;  2V7Y A;  1JCE A;  1YIT N;  5M1O A;  4BRH A;  4GV6 A;  4FPA A;  3HBT A;  4IWV A;  3EKU A;  4JKA A;  3WEE A;  3ZX2 A;  2IVO A;  3MX5 A;  4BRG A;  5EOY A;  4JKB A;  3A5M C;  1NGC A;  1KD1 O;  3PIO L;  1XUP O;  2D1K A;  1MWM A;  2P9P B;  5JLF A;  1WOQ A;  5JVG L;  3W3D A;  3WQU A;  2ZGZ A;  3D2E A;  1SAZ A;  2FF6 A;  2D0O A;  2H3G X;  5JVH L;  1ATN A;  2V51 B;  3FZM A;  4BRP A;  1KAX A;  4J8F A;  4BG9 A;  3CC2 N;  2IVP A;  3FGU A;  4R79 A;  2D0P A;  3VMF B;  3OA9 A;  3VPZ A;  4NB4 A;  3D2F A;  1NM1 A;  4BC2 A;  3NMU A;  4U67 L;  4JD2 B;  4ILG B;  4H0T B;  2YHW A;  5AZJ A;  4RCH A;  1ILY A;  2J4R A;  3HTV A;  3BEX A;  3W0L A;  1NGH A;  5KPZ A;  3EO3 A;  3HZ6 A;  5TKW A;  2KHO A;  3QDK A;  3Q7C A;  2BUP A;  1QZ6 A;  3RSE B;  3TTC A;  4FWS A;  1VQO N;  5BRF A;  3UKU B;  1T6C A;  3MDQ A;  3E9L A;  3VET A;  1BDG A;  4BRA A;  5AZI A;  3DXM B;  1M1K O;  1VAZ A;  2QW9 A;  4ISE A;  1VQM N;  4JEP A;  3FFK B;  2KLA A;  3SAG A;  2E2P A;  1S72 N;  4BRD A;  1NGB A;  5JLH A;  3WXI A;  2VWB A;  3OBY A;  3IKM A;  3MN7 A;  5ELZ A;  2ZF5 O;  4BRI A;  3MN5 A;  1X9J A;  1BA1 A;  3DXK B;  3ZEU A;  4ISF A;  4FL9 A;  4CBU A;  1Q7Y O;  4FO0 A;  4FWO A;  5FPD A;  4YOY A;  2F9T A;  4BVP A;  5M1P A;  5BR9 A;  4JKC A;  5FPM A;  4B1X B;  4CBW A;  4H5W A;  2E20 A;  4GNI A;  5KQD A;  4CZI A;  2IIR A;  4GY2 B;  2FSK A;  4FWL A;  2WBN A;  5AQX A;  3UE5 A;  4DCH A;  3N4P A;  3O9U A;  3ZET A;  4YOX A;  3NVK A;  4YOU A;  2P9I B;  3C7N B;  2ZJR L;  4PL8 A;  5F2R A;  1GLE G;  3E9O A;  1YUW A;  4H5R A;  3CD6 N;  3VOV A;  1H1V A;  2ZJP L;  3L4I A;  3M6G A;  3OBW A;  3LM2 A;  1C0G A;  3GG4 A;  1S3X A;  1X3N A;  1ZXO A;  3DWL A;  4A2B A;  4A61 A;  3ZYY X;  1D4X A;  1HX1 A;  3P4I A;  5AQS A;  2NLX A;  3QBW A;  4XH5 A;  4Y0W A;  4CZM A;  4JAX A;  3SBG A;  2OAN A;  2P9U A;  2UYT A;  5LJV A;  1KQS M;  4PKH A;  2FXU A;  4YOR A;  4L3Q A;  3SMP A;  4WFB L;  5BRE A;  5AQW A;  3ID6 A;  4FVU A;  2Q0U A;  4KBO A;  2AP1 A;  3K9J A;  1U6Z A;  2E1Y A;  5HOO A;  5E26 A;  4PL7 A;  5AQU A;  1T3V A;  3C65 A;  3TTD A;  1VQ6 N;  3H3O B;  2Q97 A;  3VF4 A;  2W40 A;  4NO7 A;  2ASM A;  2DPN A;  3QFP A;  5C15 A;  2NRZ A;  4AM7 A;  2QXL A;  3AGR A;  5AQF A;  3PLA A;  3C6A A;  5AQH A;  2VGM A;  5AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...