4BRIA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg umppnp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 117
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4briA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4briA02
4PL8A 2GELA 1D4XA 3P4IA 2Q2RA 1ATRA 4WQ5A 2Q1NA 4B1ZA 1C0GA 3J8AA 5BPLA 3QMLA 4HWIA 4K42A 1GLDG 3VF4A 3QICA 5AQRA 4FWSA 3DXMB 3WEEA 2A6AA 1IJJA 1LOTB 4K25A 1KAXA 3TU5A 4RWTA 3BUZB 4QS8A 1JCGA 4BRPA 3WQTA 4JD2A 4BR4A 1MWKA 1BDGA 1X3NA 2GEMA 3U8XA 4K41A 1NM1A 4FWMA 4DHYA 1WUAA 3GOIA 1QZ5A 1HJOA 1GLJO 2ASMA 4FWNA 3EKUA 3KZBA 4I6MA 3A5LC 2ASOA 4M7YA 3RSEB 4EAHD 3EL2A 3BP8A 1YXQA 2P9UB 3FLCO 3A5NC 2Q0RA 2P9NA 1S22A 2P9SB 5ELZA 4IWVA 1U2VA 3CERA 4CZFA 4YDUA 2P9LB 4A61A 5AQGA 3WXJA 4IO8A 5AQOA 3FZLA 3FZFA 3MCPA 1K8KA 3EO3A 2IVPA 3VERA 5AQJA 1XC3A 2KHOA 4L3QA 4CZJA 5AR0A 1CZAN 5KPRA 1TYQA 1BWFO 2WUSA 1GLFO 4FWQA 5JMVA 1KXPA 1HKCA 2V51B 3LDOA 2AA4A 4CD3A 1ZC6A 1H1VA 4I6MB 3VPZA 2IVOA 3WXIA 4BC3A 4FWPA 5LJWA 5LJVA 3A8YA 3EZWA 3H3NO 4FPAA 3QB0A 3LM2A 1C0FA 1ATSA 4H0OA 4ISGA 3FR0A 4J8FA 3CJ7A 5JLFA 1HLUA 5CE3A 4M7XA 3L4IA 5ADXA 3FE1A 4FSVA 2CGJA 1T6CA 3H3OB 4EHTA 3CQXA 1X3MA 2CH6A 2VYPA 3CJCA 2Q31A 3CI5A 5BN9A 3VGLA 5FPEA 1V4SA 4BROA 2QWQA 5AFUA 2QW9A 4PL7A 1XQSC 1WOQA 4H0PA 4IZ9A 4YDUC 1BO5O 3HM8A 2F9TA 2YHWA 3IFRA 3M3ZA 3DXMA 3MMVA 4Y0WA 3O6WA 2D0PA 3O08A 4B1WB 4BRMA 2YJEA 2D0OA 3DAWA 3O1BA 4BRIA 4B1XB 2QWOA 3H1QA 4H5RA 2I7NA 2E88A 1YAGA 5BRFA 4H5WA 4BC4A 3QFUA 2VCPA 4FWOA 4CD1A 4AM6A 1G99A 2V7YA 5AQXA 4DB3A 1SQKA 2P9KB 3LDLA 4BGBA 4BRQA 1YUWA 2E8AA 2P9UA 3L0QA 1DGKN 5BR9A 4H0VB 4H5VA 2P9SA 4IJAA 2YJFA 3VF6A 3GG4A 1E4FT 3CJ9A 2P9LA 3A5OC 3WUHA 4MO5A 4FPBA 4IJNA 1QZ6A 5AQPA 5B8HA 5TKYA 4H0TB 4PKIA 2PAVA 3U4LA 1NWKA 3IDHA 4A2BA 1HX1A 1GLCG 1QQMA 2CGLA 4MO4A 3CIPA 1MWMA 3QBWA 3H1VX 5I9EB 1Z05A 3I33A 4CBWA 1EQYA 1GLBG 4XEIA 5ADXH 3SMSA 2NRHA 2QM1A 3GBTA 4CZIA 1QQNA 4IXCA 3ULEA 3MDQA 3S41A 1BU6O 1P8ZA 4RCHA 3ENHA 5AFUH 3HZ6A 3ENOA 3R8EA 4BR5A 5F0XA 4NO7A 4CZLA 2YCHA 3VEXA 5AZIB 3CJAA 4F9OA 4CZKA 5FPNA 2A40A 1ATNA 2QXLA 4BRLA 3QFPA 4BG9A 4E1JA 4WQ5C 4BREA 1NGDA 4CZEA 3QBXA 4BRHA 3FGUA 4FO0A 1R59O 3VOVA 3D7EO 4BGAA 3CJBA 1SZ2A 4DCHA 3VEZA 4JN4A 4FL9A 2YI1A 5AQNA 1GLAG 3ULEB 2FSJA 4XH5A 1YVNA 1BA1A 3M6GA 5F2RA 2E1YA 2FSNA 4B9QA 3AAQA 5AQKA 3AAPA 4C23A 3R6MA 2P9IB 4FWKA 4QS9A 5EOYA 2ZGYA 2F9WA 3VF2A 1NGFA 1DEJA 2A3ZA 2P9KA 3WT0A 1T44A 2HMPA 3BEXA 1RGIA 4XH1A 3C7NB 2GTDA 3MN7A 4JNEA 1Q18A 4KBOA 3O8MA 1JCEA 3CETA 5BREA 3ATUA 3VETA 3VGKA 4LC9B 5BN8A 4BRAA 4H03B 2VWBA 5EY4A 4BR9A 2P9PB 1OKJA 3D2FB 2IIRA 1NGEA 5FPDA 4M63C 1HUXA 1XUPO 4PKHA 3VENA 1BA0A 3KVGA 4CZMA 2J4RA 3L6QA 3BF1A 2QWNA 1NBWA 1KAZA 4O8KA 3LDNA 4CZHA 4FOIA 5AQVA 3IUCA 4Z94A 2GWJA 3OHRA 2BUPA 3CHWA 5AQIA 5AQHA 5EX5A 3CJ1A 3VEOA 3ZETB 2QWMA 4EHUA 2Q36A 5AZJB 4CI6A 3I8BA 1NMDA 5E84A 3DXKB 3MK6A 3ZX2A 5BRHA 1TUYA 2OANA 3UKUA 4BRCA 4JAXA 4BC5A 5F1XA 4BRFA 4JHDB 2HOEA 1QHAA 3D2EB 1RFQA 4BQZA 3VGMA 5AZIA 3QDKA 4CZGA 4GNIA 3LDQA 3H46O 5AQYA 4BRKA 3KHYA 3A5MC 3VEVA 3H6EA 2BTFA 2QWRA 2NLXA 3WXLA 5JLHA 1Y64A 4BQLA 3DJCA 4H0XB 3A0IX 4HTLA 2E2PA 4BRDA 1NGAA 2A42A 4BR0A 1NGGA 1ESVA 3MN6A 1NGHA 2Q97A 4BR7A 2Q0UA 2HF4A 1NGIA 5EXWA 4MLHA 2E2OA 4A62A 3UKUB 3SLCA 3BF3A 1NGJA 3UKRB 5BPNA 3ZEUB 2HF3A 3SJHA 3HSCA 2P9IA 2ASPA 5AQTA 3ATVA 4O5FA 5JICA 5AQQA 1V4TA 5AQFA 4GY2B 4XH4A 3UE5A 3C7NA 4BG8A 1HKBA 1X9JA 4FOEA 3WQUA 2QWLA 3AARA 2W40A 3HTVA 2PBDA 3FZHA 2W41A 3FZMA 3ID8A 4FWRA 3LL3A 3EN9A 3O1WA 4H5NA 2P9PA 1IG8A 5BPMA 3O5BA 3ZX0A 3D2FA 4RTFD 3JS6A 1DKGD 4BRGA 3GL1A 2E2QA 3AY9A 3VEYA 5AQMA 4B1YB 4MLEA 1GLEG 3SK3A 3WEEB 2UYTA 2FLOA 1NGCA 2A41A 4H0YB 3GE1A 3ZX3A 4B1UB 5E26A 2FF3B 3HI0A 4B1VA 3FFKB 4CBXA 4EIAA 5KQDA 4JD2B 2ZF5O 2YHYA 4CBUA 3WXKA 1MA9B 1ZBSA 3ZETA 1S3XA 2NZTA 4BVOA 5KPZA 3SMPA 2V7ZA 4ISEA 3VEWA 5AZJA 3M1FA 3O4WA 1BUPA 1QQOA 1KAYA 1NLVA 2E20A 3DXKA 2I7PA 1E4GT 2D4WA 4WQ4A 3R9PA 1ZXOA 4BC2A 3MN5A 4WYBA 5AQZA 4AM7A 4BRNA 1J6ZA 2GWKA 3H45C 4ISFA 2P9NB 4JHDA 3D2EA 2ZGZA 5BRDA 3U9DA 3W3DA 1U2VB 3IMXA 2CH5A 1JCFA 5AQWA 2E1ZA 3GDQA 3G25A 3DWLA 1HPMA 2E2NA 1MDUB 2D1KA 1U6ZA 2CGKA 4PKGA 2FSKA 4EFHA 3HBTA 1K8KB 2IVNA 5AQSA 1HKGA 5KQ8A 2FXUA 3U9ZA 3LM9A 1BOTO 4H5TA 5FPMA 4FWLA 3EKSA 1TYQB 1LCUA 5EVZA 2ZWHA 2H3GX 2A5XA 5LY3A 3MN9A 4NB4A 2ITMA 1SAZA 4DQ8A 4K43A 3C0BA 3B8AX 2DPNA 5AQLA 1RDWX 3CQYA 3UKRA 3ZEUA 3F9MA 3LDPA 1GLLO 5KPTA 4A2AA 2GUPA 3FZKA 3UB5A 3JXUA 3W0LA 3TPQA 2FF6A 3O80A 1TUUA 3VESA 1NGBA 4BVPA 4BR2A 4WQ4C 1Z6RA 2V52B 2EWSA 3RSEA 1BG3A 4CJ7A 1T6DA 2AP1A 2YHXA 2QWPA 4QS7A 5AQUA
chains in the Genus database with same CATH superfamily
3MXJA 4B3SK 4CEEA 2BDPA 4C8NA 2IDOA 3P4IA 2Q2RA 2W42A 1TKZA 3TTCA 3SJJA 2Q1NA 5BPLA 1VQLN 1GLDG 3Q7BA 3VF4A 4HUEA 3QICA 5AQRA 3TSUA 3AVLA 4CJRA 4IO9L 4C8KA 1IJJA 5C0YA 1KAXA 2XY7A 3C6AA 4GV9A 3CCMN 4KHWA 1VQNN 4J2BA 2EX3A 2GEMA 5FRMA 1RDUA 1GOAA 2NRXA 2ASMA 3SPZA 3G6EN 4EAHD 1YITN 1ITGA 4IOXA 3A5NC 2YNFA 2P9SB 1RT5A 2WONA 4B9UA 2G8VA 1HYSA 4YDUA 2W6LA 4FLTA 5AQGA 3WXJA 1S1TA 3Q7CA 2RHKA 1X9SA 1Q9YA 1W2BM 3OYIA 3KIOA 1KFSA 1K8KA 3VERA 2IVPA 4IFYA 1XC3A 3OBWA 4OJRA 5AR0A 3PX6A 3DLEA 3O4NA 1HKCA 4CHYA 1WB9A 2FC0A 3NHGA 1OH6A 2IVOA 3OY9A 3QERA 3QNOA 1HYZA 3A8YA 4OPKA 2P51A 4JRQA 2WC9A 4FPAA 3KWIA 3FR0A 1XI1A 5JLFA 4DKWA 2D0BA 4JKDA 4FSVA 2CGJA 4MFBA 3L2QA 1T6CA 2YHBA 4JV5K 1FJGK 3RVCA 5BN9A 3C94A 4CEZA 3VGLA 1S6PA 2DFFA 4BE0A 2QW9A 4KFBA 4PL7A 4LF4K 4CERA 1A5XA 2F9TA 2YHWA 1G15A 3CPWM 1JLEA 1Q81O 3O08A 4BRMA 3TABA 1L3VA 4BRIA 5M1QA 2FBYA 2HW3A 3J81O 2I7NA 4ID5A 4CHPA 5BRFA 4FJGA 5J2QA 2VCPA 4FWOA 3G4SN 4G1QA 2V7YA 1WSEA 1SQKA 1YUWA 1XMOK 5CZ1A 3L0QA 2O8BB 1DGKN 1FK9A 1RT6A 5BR9A 4H0VB 4H5VA 3J7AP 2P9SA 2JWKA 3TTFA 4DWIA 1NJXA 3HRGA 1E4FT 1RTDA 1Q8IA 5JS2A 4MO5A 4DG1A 4PY5A 5MLCQ 5M1OA 3QO9A 3HP6A 4PKIA 2PAVA 3O9UA 3KK2A 4B9VA 1C0MA 3U3YA 5C24A 2IGIA 4CEAA 3VQEA 3EEQA 3OW2M 2RPIA 4G9ZA 4H4MA 4XEIA 1QVFM 1C1AA 3SMSA 3PLAA 4M41A 1WSJA 3GBTA 2UXBK 3U3GA 4CZIA 3RRHA 1QQNA 4W5TA 3NVKA 1EWQA 2YNIA 4JEPA 4J2EA 4FYDA 1P8ZA 4RCHA 3QEPA 5AFUH 3VQ4A 2OZMA 2NRVA 1NJWA 2HBMA 3RMDA 1EWRA 4QOZB 4CZLA 2YCHA 3PIPL 3VEXA 5AZIB 1NK9A 3M8PA 3T1HK 2QI2A 5FPNA 2E6LA 2DFHA 3OYHA 2O8EB 4KKOA 1ATNA 1ZBUA 2VG5A 3HK2A 1KTQA 2Y1JA 1NGDA 2D5RA 3QBXA 4FZXC 1R59O 1HQEA 3O9SA 3VOVA 1NJYA 1EKEA 4OKEA 3V9UA 4UQGA 4B08A 1NG9A 4CJ5A 2WFBA 3P31A 4OX9K 2QK9A 3ULEB 3HYFA 1RBSA 3EYZA 4E7JA 4OKKA 1JLCA 3R1XA 3KKRA 4DTUA 5EOYA 3T7ZA 1NKBA 3AVCA 1U04A 2ZE2A 5TKWA 3E1YA 2A3ZA 3LAMA 2YHAA 1N36K 2O8BA 3PUFA 1J5EK 4JNEA 3MXIA 1XHZA 3O8MA 3HP9A 3ZLJA 4PUOA 3SI6A 1QSSA 3ATUA 3VETA 1B9DA 5KGWA 5T7BA 2VWBA 3VA0A 4FW1A 4BR9A 4PHTX 3P39A 5FPDA 1IBLK 1Y97A 2BE2A 4B9TA 3IG1A 4PKHA 4J2AA 4BDZA 3AO5A 4CZMA 2J4RA 4YOYA 1KAZA 4CZHA 1T8EA 1BL3A 3V1OA 4N47A 3CJ1A 4CFAA 1Q86O 4DU3A 3ZETB 1Z25A 4JI7K 4BWMA 3DLBA 3ZT4A 3QEIA 2E4LA 1L3TA 2KQ2A 1NK4A 3ZX2A 1KVBA 3OYFA 4BRCA 4JAXA 1WBDA 3RMBA 4BC5A 5F1XA 4IFVA 1QHAA 5AZIA 4M3UA 4CZGA 4GNIA 3H46O 4CIEA 4BRKA 3KHYA 2O8EA 2DFEA 3H6EA 2BTFA 4CE9A 1LWFA 1FKOA 3OBYA 5H1SQ 4LSNA 4JI4K 2E2PA 1NGGA 3MN6A 3TTDA 2Q97A 4CEOA 4FJMA 4FLWA 2HF4A 1NGIA 3O3HA 4MLHA 5M1NA 4KH4A 3UKUB 4GW6A 1DTQA 2HF3A 1IBKK 4JKEA 2ASPA 1K73O 5AQTA 1J9AA 3ATVA 4O5FA 1FKPA 4JKFA 4GY2B 3K9KA 1HKBA 3E9LA 5E41A 4FOEA 1VAZA 3WQUA 1ZYQA 1RDCA 4IDHA 3AO2A 3FZHA 4FK0A 1JL1A 3FZMA 4CJQA 3LL3A 3J80O 3O5BA 1ILYA 4BRGA 3AY9A 4KTQA 3OYLA 4B1YB 4MLEA 2JGUA 3GE1A 3ZX3A 4DV2K 5CYQA 2GUIA 1TL3A 3HI0A 3SV3A 5KQDA 4JD2B 1MA9B 3VQPA 1RT7A 3R3LA 3JYTA 3ZETA 4BVOA 2KFNA 4ISEA 2Y1IA 4F3TA 3CM5A 2HSTA 1BUPA 1NLVA 5GINA 2F7TA 3C6HA 4BC2A 2LSNA 2NRZA 4AM7A 3OS1A 3KWGA 3V6DA 2ZGZA 4DU1A 1WAJA 3W3DA 1VQ7N 4HUFA 1O13A 4IEIA 4JRPA 5AQWA 1RBVA 3G25A 4LF6K 1HPMA 3D45A 4EP4A 4DSLA 3N4PA 1DTTA 2D1KA 4C8LA 1VQMN 2D0CA 3PSIA 4B8AB 1CZ9A 4FLUA 1HKGA 1NK0A 4FJ7A 2GX9A 3U9ZA 3AGRA 1VQKN 4ICLA 3EKSA 1TYQB 4FM0A 4Y1CA 2H3GX 1XC9A 1RDDA 4NLCA 3RR8A 3MEGA 2E5LK 4DQ8A 3SCXA 4ZTJA 2OA8A 4CEFA 3F9MA 3DRPA 3NGIA 1GLLO 4CJKA 2GUPA 3QIPA 4L8RB 4DTMA 3W0LA 3SUOA 3O80A 4BR2A 2V52B 3RSEA 4CJ7A 4YHHK 3TAGA 2QA4N 1WAFA 3ENBA 1LW0A 1LAWA 2GELA 4DFJA 4CF1A 1ATRA 4WQ5A 4CJUA 4B1ZA 1C0GA 3OJUA 4AH9A 2UU9K 2A6AA 1BHLA 4K25A 3NFAA 3WQTA 4JD2A 3ZSQA 4BR4A 1MWKA 1VSMA 3CD6N 1X3NA 3U8XA 4DF4A 4K41A 4FWMA 1IG9A 1C0TA 3NH2A 4CEQA 1GLJO 4MQ3A 5C2FA 1RTHA 3TARA 4LF5K 4CVNE 3KLEA 1HNWK 3SPYA 4I6MA 4OLAA 4FLZA 4KH6A 3BP8A 3F73A 3L8BA 3ZT2A 3THWB 1YXQA 2P9UB 3FLCO 2FBTA 2OPRA 1TK0A 1I3AA 1S22A 5LMUK 2G8IA 5D3GA 4I9QA 3CERA 3L2VA 4CZFA 4GKJK 2P9LB 1KVCA 4O8UA 3SUPA 4IO8A 3FZLA 4NCAA 4DQPA 3VQ6A 5J2PA 4Y1DA 5AQJA 3CYMA 1K9MO 4LF7K 4CZJA 4DSFA 1CZAN 2VG7A 3CQ8A 4E3SA 3OVNA 1TYQA 1KXPA 1LW2A 2V51B 2WOMA 4DUYK 1XNQK 2KKZA 5KRTA 1BQNA 4CIGA 1H1VA 5FRNA 1YTAA 4H8KA 3VPZA 5C2DA 1M1KO 5LJWA 1B92A 1WSIA 4DF8A 3SBTA 4IBNA 3LM2A 1ATSA 4H0OA 1HJRA 4M7XA 5ADXA 1U4BA 4CF8A 3CQXA 4FLYA 1X3MA 4NCBA 3CI5A 4OGCA 4E89A 1QE1A 1VSFA 5GAGP 1HPZA 3PX4A 4BROA 2QWQA 3RMCA 4CJWA 1OH8A 1WOQA 2W6KA 4H0PA 4YDUC 5HROA 4O5BA 5C15A 4CK2A 4JK9A 1YTUA 4MDBA 3PIOL 5BR8K 4B1WB 4YFUA 4OO1J 2YJEA 3IRXA 4AQYK 2NRTA 1JL2A 3WNHA 3D0PA 4CHNA 4CW7B 3H1QA 4H5RA 4RW8A 2E88A 5CHIA 3LPUA 4HVJA 4DU4A 3THYB 5AQXA 3LZIA 3THWA 3K58A 2YKMA 2AJQA 2E8AA 2P9UA 2O8FB 4E0DA 4I7FA 1ZBIA 4AHSA 3KD1E 3OJSA 5IT9O 2YJFA 4ELTA 3GG4A 4E7IA 2P9LA 4M42A 4DTNA 2VQEK 3QEXA 1YVUA 1QZ6A 4IJNA 5B8HA 5TKYA 4H0TB 3EY1A 4O0JA 2XY6A 5IWAK 4OPJA 2B5JA 3IDHA 4O55A 3QEWA 4A2BA 2IS3A 1GLCG 1QQMA 2CGLA 5CR4A 4Z4HA 2OZSA 1T05A 4M3YA 4DV6K 1Z05A 3I33A 1X1PA 1EQYA 3O9RA 5M1PA 3SAGA 4C8OA 1D9FA 1NJIO 2QM1A 4DR5K 2QKBA 3MDQA 3S41A 3IKMA 5KGXA 4K8XA 4E1NA 4BR5A 3R8EA 5FROA 1LWCA 3MX2A 2F4VK 2OTLN 3TAEA 3DLRA 3NAEA 4F4KA 4Z4IA 2QXLA 4BG9A 3SZ2A 5SZTA 2G8UA 4C8MA 1VSLA 3D7EO 1NKEA 3CJBA 1Q9XA 3E66A 3LPTA 4JN4A 3VEZA 4YOXA 5SWMA 4XH5A 2RKIA 1D5AA 3NF8A 5LL6Z 3M6GA 5F2RA 2HHVA 1RCHA 2HNYA 3MEDA 3R6MA 3F5TA 3CPEA 1LAVA 4FJIA 4FWKA 4YORA 2ZGYA 3THYA 2YKNA 3WT0A 1NK6A 3BEXA 2O8FA 4XH1A 1RGIA 3S3MA 1Q18A 4U7BA 5DK5A 3K57A 3VGKA 4LC9B 2JLEA 2YNHA 3VQCA 5BN8A 4K0KK 1T03A 1OKJA 3D2FB 2HHWA 2IIRA 1NGEA 4DLGA 1HUXA 2HNDA 1BA0A 3KVGA 3VQ7A 4KI6A 4DV7K 2QWNA 4NYFA 4O8KA 3OYJA 4DQQA 1ZBHA 4FJHA 2GWJA 2BUPA 1EX4A 1IV0A 3VMFB 5EX5A 1IKWA 4CK1A 4EHUA 4ILJA 4DTSA 1YJWN 4AHRA 1NMDA 2KZZA 3PV8A 1QS4A 3L2RA 1J5OA 2DY4A 4B9NA 4FXDA 3LP3A 4KI4A 1S9EA 4BY9C 1WLJA 2UUCK 2HOEA 4FJ5A 3VGMA 3WNGA 3MEEA 4F2SA 3AVKA 1TVRA 5AQYA 4O44A 4BACA 5M1FA 3V81A 3L3VA 2NLXA 3HSTB 3DMJA 3HPHA 5JLHA 5JVGL 4BQLA 3DJCA 3A0IX 3RTVA 1K6YA 3KLFA 3L4QA 4HTLA 1NGAA 1ESVA 1VQON 2ZQBA 3HL8A 1NGHA 3T1YK 4BR7A 2Q0UA 5EXWA 3RWUA 3HT3A 2E2OA 3I55N 4PWDA 3OYAA 5HRNA 1GOBA 3BF3A 3UKRB 3ZEUB 4CJLA 4KHUA 1C1BA 2QKKA 1KC8O 3QESA 2PY5A 1LWEA 1V4TA 1Z26A 4XH4A 3UE5A 4CGGA 1X9JA 3SQ1A 2B6AA 2QWLA 3VN5A 4C1NK 3K0SA 1VRUA 2W41A 4KPYA 3E9OA 4KHQA 2A1SA 4IEEA 1HNZK 3O1WA 1IG8A 5BPMA 3ZX0A 3D2FA 4RTFD 3P38A 3GL1A 3WNEA 2Z1HA 3AA5X 1GLEG 4IG0A 2A41A 4B1UB 5E26A 4M45A 3OTOK 4CGIA 3SAHA 2ZF5O 2YHYA 4CBUA 3SQ0A 4WFAL 2ETJA 3SMPA 2ITGA 3K59A 3AVGA 4E19A 1R0AA 2E20A 3AO3A 3BZKA 3CM6A 4R79A 3DI6A 2I7PA 4O4GA 4WQ4A 3KK1A 3V9WA 1ZXOA 3BY5A 1E3MA 1IKXA 3MN5A 1A5VA 3P83D 3H45C 4KTWA 3MCAB 4FCYA 5C25A 3BDPA 5BRDA 3CC7N 5GIPA 3U9DA 4FJKA 3AA3A 3IMXA 1JCFA 4OVLA 2E2NA 4M3TA 4H4OA 2VWJA 2CGKA 4EFHA 3ZSWA 3AVBA 4FZYA 3HBTA 5AQSA 2FXUA 5DM7L 2P5GA 4CEDA 2HNZA 1S72N 1NU0A 2ZWHA 5LY3A 1SL1A 1CLQA 2ITMA 1OVYA 1SAZA 4YOTA 4IOCL 4C1NI 3B8AX 2O4IA 2DPNA 3UKRA 5CY4A 4DR2K 3ZEUA 2OPQA 3PSFA 5HBMA 4BWJA 3NH1A 4KB1A 4DFKA 3QIOA 2G8WA 3ISNC 3JXUA 4JI3K 1QQCA 3TPQA 1TUUA 3TSPA 3VESA 4BVPA 2EWSA 1BG3A 2HVIA 4A59A 2AP1A 1N8RO 4MDAA 2QWPA 3HVRA 3CFOA 3QEVA 1D4XA 4OPAA 4IG3A 4TSXA 2VWKA 3J8AA 4JKHA 2X74A 4K42A 3T69A 1TGOA 1EO1A 1OH5A 4FWSA 4A57A 2PZSA 4IOAL 3OYDA 4B9MA 4CF0A 4RWTA 4QS8A 1JCGA 4BRPA 1YT3A 1DT9A 4ZHRA 3PO4A 1P90A 1RTJA 3B6PA 1IH7A 1NM1A 1WUAA 2YV0X 4EZ6A 1SV5A 3GOIA 2ZJPL 1HJOA 1W9HA 4ZTFA 2NRWA 3OA9A 3KZBA 3MXMA 1XNRK 3CMAN 4M7YA 3RSEB 3EL2A 4CK3A 2ATQA 4DTXA 3VQ5A 2Q0RA 4FVMA 2VGMA 3TR8A 4RW7A 5ELZA 4IWVA 3OYGA 3EZ5A 3ZSOA 4A61A 1KLMA 5AQOA 3SUQA 3SNNA 3HM9A 4CESA 4BDYA 1VSIA 2WBNA 2KHOA 1JLQA 3HPGA 3HO1A 3F9KA 5C12A 4FWQA 1IO2A 5JMVA 3O3GA 3SQ4A 4YY3K 3LDOA 3LP0A 3V9ZA 3RRGA 2JWLA 3AO1A 4F2RA 4CGDA 4JI5K 4CJTA 3I0SA 3OYKA 4I6MB 3WXIA 4BC3A 4B3OA 4DQSA 3DOKA 3NF9A 4F8RA 4N41A 2X6NA 3EZWA 3CFRA 3QB0A 4AF1A 4ISGA 2NNWA 3CJ7A 1HLUA 5CE3A 1WNSA 4LF9K 1UA1A 3AVFA 3L4IA 2CH6A 3CJCA 1CZBA 3P5JA 2Q31A 1VQPN 4N5SA 2XO7A 4DLEA 1N33K 2PFUA 1KLNA 1D9DA 1FW6A 4IZ9A 3CCJN 4Z4EA 2NRRA 3MMVA 4O0IA 1EXQA 2D0OA 3O1BA 4WE1A 3S3OA 1CXUA 2QWOA 4A5BA 1YAGA 4H5WA 4AHCA 3QFUA 3LDSA 1YF5L 1JLAA 4CD1A 4AM6A 4DB3A 1VSDA 2HVHA 4BGBA 4DTJA 3NF6A 1WSHA 4RW9A 4NXMK 4U67L 2E6MA 1U48A 4JI8K 4FM1A 3DLLL 3CJ9A 3M8RA 3A5OC 3KTQA 4DR1K 2UUAK 3K5LA 3ALYA 2NUBA 1YI2N 3U4LA 4FZZA 2O8CB 1U49A 1NWKA 3AVAA 2FBVA 4LH4A 5HRPA 3VA3A 3AVJA 3C65A 3DLHA 1RBRA 4MO4A 1RDAA 3CIPA 5GAHP 3JAMO 5GIOA 4CCHA 5C42A 2QXFA 3AVIA 1GLBG 5ADXH 5CYMA 5HLFA 1ASVA 3QLHA 5KTQA 4IXCA 4CEBA 2FBXA 3HVTA 1BU6O 3ENHA 3HXMA 2O8DB 4CGHA 1RT3A 3ENOA 5F0XA 4NO7A 5FDLA 4A5AA 1LV5A 4F9OA 2HHQA 1VQ8N 4CZKA 3VQ8A 4KHNA 2G8HA 3AVHA 5AJ3K 2ZJRL 3S3NA 1KRPA 1NKCA 1N6QA 5C10A 2GBZA 3BGRA 4BRLA 4DTRA 3QFPA 4E1JA 4R5PA 4E7KA 1T7PA 1JLBA 1F21A 2UXDK 1SZ2A 4CF9A 3KLIA 4DCHA 3KLGA 2G8FA 3I56N 4FL9A 3HOSA 2YI1A 4JI1K 5AQNA 4B9SA 4KHSA 2FSJA 1VHXA 1YVNA 4Q0BA 1BA1A 4CHQA 2HMIA 2FSNA 4B9QA 3NCIA 5AQKA 3OYBA 4C23A 4GKKK 4X62K 4QS9A 2F9WA 3AVMA 3ID6A 2XRIA 3VF2A 3ZT3A 4CF2A 3ULDA 2HMPA 3DOLA 3ZYYX 3C7NB 2GTDA 1VSJA 5EU7A 4KBOA 3T3FA 4CHOA 5GADP 5BREA 2OPSA 2RE2A 2HHHK 1REVA 4H03B 1SKRA 3I0RA 2P9PB 2WTUA 2BGGA 1VQ5N 4JI6K 3NGYA 4M63C 3K5NA 3VQBA 1XUPO 2UUBK 4KH5A 1N34K 2O8CA 3OYNA 3OYCA 3L6QA 4E7LA 3E01A 4KHYA 2ZM6K 1KCFA 4FOIA 4Z94A 4PA1A 3CHWA 5AQIA 2VG6A 5AQHA 4AILC 4DS4A 4V19S 2QWMA 2Q36A 4X64K 5AZJB 3I8BA 5E84A 3DXKB 2EHGA 1YIJN 5BRHA 2OPPA 1XWLA 2IOCA 1SKWA 4DQIA 1WSFA 2F96A 1L3SA 2O8DA 4CFDA 4BRFA 3D2EB 1RFQA 1VSKA 4BQZA 1K8AO 3V9SA 3TAMA 2ZJQL 1XMQK 3VEVA 3A5MC 4LFCK 4JKAA 3UIQA 4FJ8A 4OPHA 4DV0K 4F3OA 4JK7A 3NBPA 2QWRA 4JKGB 1NK5A 1Y64A 3CXCM 4JYAK 2QEXN 1KQSM 4LY7A 4AHTA 4CGJA 2HBKA 1WN7A 3NGZA 3SBGA 1NMNA 2A42A 3ITHA 4BR0A 4HUGA 3E9PA 1OVQA 3K5MA 5GAEP 4JKCA 1NGJA 2KTQA 4B3TK 1U45A 3SJHA 5HRRA 1BGXT 1HNIA 5JICA 5AQFA 3C7NA 3ZSRA 3AARA 3HTVA 1KSPA 2PBDA 3ID8A 4OLBA 4H5NA 2P9PA 4KV8A 4AHUA 3MWPA 3JS6A 4DMNA 2E2QA 1QSYA 1JXEA 5AQMA 3AVNA 3HJFA 5JVHL 3SAFA 2OTJN 3SK3A 3WEEB 2FLOA 4FJ9A 4FJLA 3MX5A 4FVUA 2X78A 4CBXA 4EIAA 3WXKA 1ZBSA 1S3XA 3EE8A 5KPZA 1HQUA 3VEWA 1VSHA 5AZJA 1KAYA 4GV3A 1C0UA 4ID1A 3DXKA 3TAQA 3C95A 1DLOA 1E4GT 2D4WA 3R9PA 3T1AA 1JJ2M 4GVEA 4KB0A 4FK4A 4BE1A 1RT2A 4WYBA 4BRNA 3V1RA 1J6ZA 4Z4GA 3SUNA 2P9NB 2IAJA 3D2EA 1CXQA 1OH7A 1U2VB 5K14A 1NOYA 1GOCA 3KLHA 2E1ZA 3GDQA 1KD1O 1KFDA 2PYLA 4CFCA 1U6ZA 3VTHA 4WFNL 2FSKA 4DSEA 4B9LA 4JKGA 3TAPA 2IVNA 1VRTA 2A1RA 1ASWA 3CCSN 1S9GA 3LM9A 4H5TA 5FPMA 3T19A 1TV6A 4FWLA 2I5JA 4X65K 3CC4N 3LZJA 2D0AA 4Z4FA 2A5XA 3MN9A 4NB4A 4YOWA 3J7YP 4I9LA 4HCBA 3O4QA 3L2UA 3U6FA 3C0BA 1TKDA 3VTIA 5AQLA 4QAGA 1WSGA 3DRRA 5LMNK 3K9JA 3LDPA 4NLBA 4AHVA 2OYQA 2G8KA 4A2AA 3CCUN 3CCQN 1UA0A 4W5NA 2FF6A 1QHTA 4OKJA 4WQ4C 2YHXA 3SQ2A 1BCOA 4PL8A 3WXMB 1W7AA 1IBMK 3NH0A 4FM2A 1TKXA 3CCLN 4B3MK 4EP5A 2HB5A 3QMLA 4HWIA 4DTOA 3LALA 1SL0A 3ASMA 3VQQA 4DV4K 3AA2A 3WEEA 3DXMB 1LOTB 3DYAA 4LH5A 3TU5A 3BUZB 3CF5L 1QSLA 4Q5VA 4DSKA 1NJZA 1BDGA 1SS6A 3LWLA 3HOTA 4DHYA 4JKBA 2IC3A 3CCEN 1QZ5A 1A5WA 3DRSA 3V9XA 4FWNA 5KI6A 3KD5E 1S6QA 3EKUA 4JS5A 3M8QA 5HRSA 1JKHA 2ASOA 3A5LC 4WCEL 3O3FA 4DV5K 4FJJA 2P9NA 2B4JA 1S5JA 4FLVA 1U2VA 2Z1GA 1YJNN 4CJ3A 1HNVA 3ZSXA 3NDKA 4W5OA 1NNEA 4FK2A 3OS0A 3MECA 3QNNA 3FZFA 3MCPA 4N76A 3EO3A 4W5RA 3VQ9A 4L3QA 1QVGM 2BANA 3CMEN 5KPRA 1BWFO 2WUSA 1GLFO 5I42A 3C6TA 2AA4A 4RW6A 2XHBA 4CD3A 1ZC6A 4GMJB 3TI0A 3PO5A 4ELVA 2RF2A 4CJVA 3K2PA 4FWPA 1W0HA 5LJVA 3DLKA 4N56A 2X6SA 3N4QA 4CJ4A 3H3NO 4CFBA 5I3UA 3L3UA 1C0FA 5DM6L 4ELUA 4J8FA 1UWBA 1FXXA 4HCCA 2HHSA 1BISA 4YNQA 2HBJA 3FE1A 1TK5A 2HHXA 3M8SA 4LFAK 3H3OB 4EHTA 5J2MA 4IKFA 2VYPA 1SUQA 4KHPK 1HMVA 5FPEA 2Z1JA 1V4SA 3AGKA 5AFUA 1XQSC 4DS5A 1T3VA 1MU2A 3OS2A 5KRSA 1BO5O 1QTMA 1X9WA 3CCVN 3HM8A 4KO0A 3J7ZO 3IFRA 3M3ZA 1RBUA 3DXMA 4DFMA 3ZSVA 4Y0WA 3O6WA 2D0PA 4DFPA 4DSIA 3EE9A 3AA4A 4YOUA 1KVAA 3LP2A 2DTUA 3DAWA 3DLGA 3L2WA 4OGEA 4B1XB 4E7HA 4JLHA 2R7YA 2KFZA 1C6VA 4BC4A 1JLFA 1G99A 2HHUA 4B3RK 3LDLA 2P9KB 4BRQA 1N32K 4J2DA 4DSJA 3NE6A 4GV6A 2RN2A 4XIUA 1TK8A 4IJAA 3WNFA 1BQMA 1RT1A 3ZT1A 3VF6A 2GV9A 1NK7A 4DTPA 3WUHA 2OCEA 4FPBA 5AQPA 3ZCMA 1S1WA 3TWHA 1TAUA 3ZSYA 3NVMA 1W97L 3CC2N 1BCMA 3CG7A 4UY8O 1UOCA 1HX1A 3MAQA 4IFEA 2QTDA 1MWMA 1NK8A 1U47A 3QBWA 1BIUA 3H1VX 3THVA 4BDPA 5I9EB 4CBWA 3TSQA 3PX0A 2NRHA 4ILGB 4X66K 1TKTA 2VGNA 1Q82O 3ULEA 5HOOA 3VQAA 3HZ6A 3K5OA 4K8ZA 1ASUA 3CFPA 5JS1A 1TL1A 2KLAA 1TAQA 3CJAA 2PYJA 4FJXA 2A40A 3PY8A 4CHZA 1VSEA 3NF7A 4JS4A 4Z4CA 1RTIA 3G71N 4WQ5C 4BREA 4CZEA 1B9FA 4BRHA 3FGUA 4FO0A 3KK3A 1VQ6N 4NYNA 4BGAA 4NCGA 4JI0K 1IKYA 3IS9A 3QINA 4DQRA 4IDKA 1S1XA 1GLAG 3CCRN 1O1WA 4DR7K 2E1YA 2P5OA 4CJSA 1BI4B 3AAQA 3AV9A 3AAPA 1RDBA 2P9IB 1HYVA 3G0ZA 4NXNK 1NGFA 1DEJA 2P9KA 1J54A 1RBTA 1T44A 3P1GA 3THXB 4LF8K 3MN7A 4KAZA 1NOZA 4W5QA 1JCEA 3CETA 1I39A 5HP1A 4BRAA 5EY4A 3LAKA 1EP4A 4I2QA 1ZBLA 4KTZA 3H08A 1M90O 4B8CA 4WFBL 3VENA 1S1VA 1S1UA 1RILA 3BF1A 2XY5A 1NBWA 1X9MA 3LDNA 3O9TA 5AQVA 2HBLA 3IUCA 3OHRA 2BH1A 1SKSA 4DR6K 3A2FA 3VEOA 1L5UA 4ILHA 3ZSZA 5CZ2A 1VQ9N 3F2KA 4CI6A 4E1MA 3RMAA 4LSLA 3MK6A 4CGFA 1TUYA 2OANA 3UKUA 4KREA 3KJVA 4DR3K 3KK7A 4JHDB 3OYMA 3MWTA 1HNXK 4JK8A 3QDKA 4KRFA 2YNGA 4FJNA 3TAFA 3LDQA 4DV3K 1WBBA 4I2PA 2F8SA 1YJ9N 4DUZK 3WXLA 4FLXA 2KW4A 4H0XB 2Q3SA 4BRDA 2ZD1A 4LFBK 3AO4A 4DR4K 4DV1K 1YHQN 4A62A 1HRHA 1SL2A 3SLCA 5HL7L 1N5YA 1BI4A 5BPNA 4FW2A 3B6OA 3HSCA 2P9IA 3VQDA 5AQQA 3THXA 4BG8A 2KZMA 2Z1IA 1RT4A 5M1KA 2W40A 3HPOA 4FWRA 2P1JA 3EN9A 1JLGA 4QCLA 1I94K 3TANA 1VQ4N 4HHTA 1D8YA 1IKVA 1DKGD 1JXBA 4M3WA 3VEYA 4WF9L 3LP1A 4CJFA 4PQUA 3SV4A 3LANA 4HTUA 2UYTA 1NGCA 4H0YB 1RNHA 1UAXA 2FF3B 4B1VA 4M3RA 3FFKB 4CIFA 3C6UA 2NZTA 2V7ZA 3BZCA 3M1FA 3O4WA 5J2NA 1QQOA 1ZBFA 4M3ZA 3FFIA 5FLXO 4BE2A 3DM2A 3G10A 3SYZA 3IAYA 2XY8A 5DMRA 5A2QO 2GWKA 3NMUA 4ISFA 4JHDA 4RG8A 5J1EA 1VK0A 4Z0UA 2CH5A 2F8TA 2YX6A 4M3XA 3DWLA 3LWMA 4YOVA 1MDUB 4LD0A 3I8DA 4PKGA 2VQFK 3V4IA 3O9QA 1K8KB 5KQ8A 2UXCK 2O4GA 1J53A 1EETA 4CJPA 1BOTO 3D6RA 3V1QA 3M5RA 1LCUA 1XHXA 5EVZA 4JI2K 3ZT0A 3JSMA 1L3UA 4K43A 3S9HA 1RDWX 3CQYA 4CJEA 4EZ9A 2HHTA 4CECA 5KPTA 4GVMA 3OYEA 3FZKA 3UB5A 1Q7YO 1BIZA 1HR0K 1NGBA 3QETA 3RR7A 1Z6RA 1C1CA 1T6DA 4RW4A 5AQZA 3KKSA 4QS7A 5AQUA
chains in the Genus database with same CATH topology
4PL8A 3ENBA 3WXMB 2GELA 1D4XA 4OPAA 3P4IA 2Q2RA 3TTCA 1ATRA 4WQ5A 3CCLN 2Q1NA 4B1ZA 1C0GA 3J8AA 4JKHA 3QMLA 5BPLA 4HWIA 4K42A 1VQLN 1GLDG 3Q7BA 3T69A 3VF4A 3QICA 5AQRA 3TSUA 1EO1A 4FWSA 3DXMB 3WEEA 2A6AA 1IJJA 1LOTB 4K25A 4A57A 4IO9L 4IOAL 1KAXA 5C0YA 3TU5A 3C6AA 3BUZB 4RWTA 4QS8A 3CCMN 4GV9A 1JCGA 4BRPA 3WQTA 3CF5L 4JD2A 1VQNN 1DT9A 4BR4A 1MWKA 1BDGA 1SS6A 1X3NA 1P90A 1RDUA 2GEMA 3U8XA 3HOTA 4K41A 3CD6N 1NM1A 4FWMA 4DHYA 1WUAA 2NRXA 4JKBA 3GOIA 3CCEN 1QZ5A 1HJOA 2ZJPL 1GLJO 5C2FA 2ASMA 4FWNA 2NRWA 3EKUA 3OA9A 3KZBA 4I6MA 3G6EN 3A5LC 2ASOA 4M7YA 4WCEL 3RSEB 4EAHD 3EL2A 3CMAN 4KH6A 1YITN 3BP8A 1YXQA 2P9UB 3FLCO 4IOXA 3A5NC 2Q0RA 2P9NA 2VGMA 1S22A 2P9SB 5ELZA 4IWVA 1U2VA 3CERA 4CZFA 1YJNN 4YDUA 2P9LB 4A61A 5AQGA 4O8UA 3WXJA 3Q7CA 4IO8A 2RHKA 3FZLA 5AQOA 1W2BM 3FZFA 3MCPA 2WBNA 1K8KA 3EO3A 2IVPA 3VERA 5AQJA 1K9MO 1XC3A 2KHOA 4L3QA 3OBWA 4CZJA 1QVGM 5AR0A 1CZAN 3CMEN 5KPRA 1TYQA 1BWFO 2WUSA 1GLFO 5C12A 4FWQA 5JMVA 1KXPA 1HKCA 2V51B 3LDOA 2AA4A 2JWLA 2KKZA 4CD3A 1ZC6A 1H1VA 4I6MB 3VPZA 2IVOA 3WXIA 4BC3A 5C2DA 1M1KO 4FWPA 5LJWA 5LJVA 3N4QA 3A8YA 2WC9A 3EZWA 3H3NO 3SBTA 4FPAA 3QB0A 4AF1A 3LM2A 1C0FA 1ATSA 4H0OA 3KWIA 4ISGA 5DM6L 3FR0A 2NNWA 3CJ7A 4J8FA 1HLUA 4DKWA 5CE3A 5JLFA 4M7XA 4JKDA 3L4IA 5ADXA 2HBJA 3FE1A 2CGJA 4FSVA 1T6CA 3H3OB 4EHTA 3CQXA 1VQ4N 1X3MA 2CH6A 2VYPA 3CJCA 3RVCA 2Q31A 3CI5A 5BN9A 1VQPN 3VGLA 5FPEA 1V4SA 5GAGP 3AGKA 2PFUA 4BROA 2QWQA 5AFUA 2QW9A 4PL7A 1XQSC 1WOQA 1T3VA 4H0PA 4IZ9A 3CCJN 4YDUC 1BO5O 5C15A 3CCVN 3HM8A 3J7ZO 2F9TA 2YHWA 3IFRA 3M3ZA 4JK9A 2NRRA 3DXMA 4MDBA 3PIOL 3CPWM 3MMVA 1Q81O 4Y0WA 3O6WA 2D0PA 3O08A 3EE9A 4B1WB 4OO1J 4BRMA 2YJEA 4YOUA 2D0OA 3DAWA 2NRTA 3O1BA 4BRIA 5M1QA 4B1XB 2QWOA 3H1QA 4H5RA 4A5BA 2I7NA 5CHIA 2E88A 1YAGA 5BRFA 4H5WA 4BC4A 3QFUA 1YF5L 2VCPA 4FWOA 3G4SN 4CD1A 4AM6A 1G99A 2V7YA 5AQXA 4DB3A 1SQKA 2P9KB 3LDLA 4BGBA 4BRQA 1YUWA 2E8AA 2P9UA 3L0QA 4GV6A 4U67L 1DGKN 5BR9A 4H0VB 4H5VA 2P9SA 4IJAA 2JWKA 3TTFA 2YJFA 3HRGA 3VF6A 3GG4A 1E4FT 3DLLL 3CJ9A 2P9LA 3A5OC 3WUHA 4MO5A 4FPBA 4IJNA 1QZ6A 5AQPA 5B8HA 5TKYA 5MLCQ 5M1OA 4H0TB 1YI2N 4PKIA 2PAVA 3O9UA 3U4LA 3NVMA 1W97L 3CC2N 4UY8O 1NWKA 3IDHA 4A2BA 1HX1A 3C65A 1GLCG 1QQMA 2CGLA 5CR4A 4MO4A 4IFEA 2QTDA 3CIPA 5GAHP 1MWMA 3QBWA 5GIOA 3H1VX 3OW2M 5I9EB 4G9ZA 1Z05A 3I33A 4CBWA 1EQYA 1GLBG 3O9RA 4XEIA 5M1PA 3SMSA 3TSQA 2NRHA 5ADXH 3SAGA 1QVFM 3PLAA 4ILGB 1NJIO 2QM1A 3GBTA 4CZIA 3NVKA 1QQNA 4IXCA 2VGNA 1Q82O 3ULEA 4JEPA 5HOOA 3MDQA 3S41A 1BU6O 1P8ZA 3IKMA 4RCHA 3ENHA 5AFUH 3HZ6A 2NRVA 2HBMA 3ENOA 3R8EA 4BR5A 5F0XA 4NO7A 4CZLA 2YCHA 4A5AA 3VEXA 3PIPL 2KLAA 5AZIB 3CJAA 4F9OA 3MX2A 2QI2A 4CZKA 1VQ8N 5FPNA 2OTLN 2ZJRL 2A40A 5C10A 1ATNA 2QXLA 4BRLA 3QFPA 4BG9A 4E1JA 3G71N 4WQ5C 4BREA 1NGDA 4CZEA 3QBXA 4BRHA 3FGUA 4FO0A 1R59O 3O9SA 3VOVA 3D7EO 1VQ6N 4BGAA 3CJBA 1SZ2A 4DCHA 3E66A 3VEZA 4JN4A 3I56N 4FL9A 4YOXA 3HOSA 2YI1A 5AQNA 2WFBA 1GLAG 3P31A 3ULEB 2FSJA 4XH5A 1YVNA 3CCRN 1BA1A 3M6GA 5F2RA 2E1YA 2FSNA 4B9QA 3AAQA 5AQKA 3AAPA 4C23A 3R6MA 3F5TA 3CPEA 3R1XA 2P9IB 4FWKA 4QS9A 4YORA 5EOYA 3T7ZA 2ZGYA 2F9WA 3ID6A 3VF2A 5TKWA 1NGFA 1DEJA 2A3ZA 2P9KA 3E1YA 3WT0A 1T44A 2HMPA 3BEXA 1RGIA 4XH1A 3ZYYX 3C7NB 2GTDA 3MN7A 4JNEA 1Q18A 4KBOA 4U7BA 3O8MA 1JCEA 3CETA 5GADP 5BREA 3ATUA 3VETA 3VGKA 4LC9B 5BN8A 2RE2A 4BRAA 4H03B 2VWBA 5EY4A 4BR9A 2P9PB 1VQ5N 1OKJA 3D2FB 4PHTX 3P39A 2IIRA 1NGEA 5FPDA 4M63C 1HUXA 1M90O 4WFBL 1XUPO 4KH5A 4PKHA 1BA0A 3VENA 3KVGA 4CZMA 2J4RA 3L6QA 3BF1A 2QWNA 4YOYA 1NBWA 1KAZA 4O8KA 3LDNA 3O9TA 4CZHA 4FOIA 5AQVA 2HBLA 3IUCA 4Z94A 2GWJA 3OHRA 2BUPA 3CHWA 3VMFB 2BH1A 5AQIA 5AQHA 5EX5A 3CJ1A 1Q86O 3VEOA 3ZETB 2QWMA 4ILHA 4ILJA 4EHUA 2Q36A 5AZJB 1YJWN 1VQ9N 3F2KA 4CI6A 3I8BA 1NMDA 5E84A 3DXKB 3MK6A 3ZX2A 1YIJN 5BRHA 1TUYA 2OANA 3UKUA 4BRCA 4JAXA 4BY9C 3KK7A 4BC5A 5F1XA 4BRFA 4JHDB 2HOEA 1QHAA 3D2EB 1RFQA 4BQZA 3VGMA 3MWTA 5AZIA 4JK8A 1K8AO 3QDKA 4CZGA 4GNIA 3LDQA 3H46O 5AQYA 2ZJQL 4BRKA 3KHYA 3A5MC 3VEVA 4JKAA 5M1FA 3H6EA 1YJ9N 4OPHA 4JK7A 2BTFA 2QWRA 2NLXA 4JKGB 3WXLA 3OBYA 5JLHA 5H1SQ 1Y64A 5JVGL 4BQLA 3CXCM 3DJCA 4H0XB 2QEXN 3A0IX 1KQSM 3L4QA 2HBKA 4HTLA 2E2PA 3SBGA 1NGAA 2A42A 4BRDA 4BR0A 1NGGA 1ESVA 1VQON 3E9PA 3MN6A 3TTDA 1NGHA 2Q97A 5GAEP 4BR7A 2Q0UA 2HF4A 1NGIA 5EXWA 4MLHA 5M1NA 2E2OA 4KH4A 3I55N 1YHQN 4A62A 3UKUB 4JKCA 3SLCA 5HL7L 3BF3A 1NGJA 3UKRB 5BPNA 3ZEUB 2HF3A 3SJHA 3HSCA 2P9IA 4JKEA 2ASPA 1K73O 5AQTA 1KC8O 3ATVA 4O5FA 4JKFA 5JICA 5AQQA 1V4TA 5AQFA 4GY2B 4XH4A 3UE5A 3C7NA 3K9KA 4BG8A 1HKBA 3E9LA 1X9JA 4FOEA 1VAZA 3WQUA 2QWLA 3AARA 5M1KA 4C1NK 2W40A 3HTVA 4IDHA 2PBDA 3FZHA 2W41A 3FZMA 3ID8A 3E9OA 4FWRA 4IEEA 3LL3A 3EN9A 3O1WA 4H5NA 2P9PA 1IG8A 5BPMA 1ILYA 3O5BA 3ZX0A 3D2FA 3MWPA 3JS6A 3P38A 1DKGD 4RTFD 3GL1A 4BRGA 2E2QA 3AY9A 3VEYA 5AQMA 4WF9L 4B1YB 5JVHL 4MLEA 1GLEG 3SAFA 2OTJN 3SK3A 3WEEB 2UYTA 2FLOA 1NGCA 2A41A 4H0YB 3GE1A 3ZX3A 4B1UB 3MX5A 2FF3B 5E26A 4FVUA 3HI0A 4B1VA 3FFKB 3SAHA 4CBXA 4EIAA 5KQDA 4JD2B 2ZF5O 2YHYA 4CBUA 3WXKA 1MA9B 4WFAL 3R3LA 1ZBSA 3ZETA 1S3XA 2NZTA 3EE8A 4BVOA 3SMPA 2V7ZA 5KPZA 4ISEA 3VEWA 5AZJA 2HSTA 3M1FA 3O4WA 1BUPA 1QQOA 1KAYA 1NLVA 2E20A 4GV3A 4R79A 3DXKA 5GINA 2I7PA 1E4GT 2D4WA 4WQ4A 3R9PA 1JJ2M 4GVEA 2F7TA 1ZXOA 3C6HA 4BC2A 3MN5A 4WYBA 5AQZA 2NRZA 4AM7A 4BRNA 1J6ZA 2GWKA 3H45C 3MCAB 4ISFA 3NMUA 2P9NB 4JHDA 3D2EA 3KWGA 2ZGZA 5BRDA 5GIPA 3U9DA 3W3DA 1VQ7N 3CC7N 1U2VB 3IMXA 2CH5A 1O13A 1JCFA 4IEIA 5AQWA 2E1ZA 3GDQA 1KD1O 2YX6A 3G25A 3DWLA 1HPMA 2E2NA 4YOVA 3N4PA 1MDUB 2D1KA 1VQMN 1U6ZA 2CGKA 4PKGA 2FSKA 3VTHA 4WFNL 4EFHA 4JKGA 3HBTA 3O9QA 1K8KB 2IVNA 5AQSA 1HKGA 5KQ8A 3CCSN 2FXUA 2GX9A 5DM7L 3AGRA 3LM9A 3U9ZA 1BOTO 3D6RA 4H5TA 5FPMA 1S72N 1VQKN 4FWLA 3CC4N 3EKSA 1TYQB 3M5RA 1LCUA 5EVZA 2ZWHA 2H3GX 2A5XA 5LY3A 3MN9A 4NB4A 4YOWA 4NLCA 2ITMA 1OVYA 1SAZA 4YOTA 4DQ8A 4IOCL 4C1NI 4K43A 3C0BA 3B8AX 3VTIA 2DPNA 5AQLA 1RDWX 3CQYA 3UKRA 3ZEUA 3F9MA 3K9JA 3LDPA 1GLLO 4NLBA 5KPTA 4A2AA 2GUPA 3CCUN 3FZKA 3CCQN 3UB5A 1Q7YO 3JXUA 3W0LA 3TPQA 2FF6A 3O80A 1TUUA 3TSPA 3VESA 1NGBA 4BVPA 4BR2A 4WQ4C 1Z6RA 2V52B 2EWSA 3RSEA 1BG3A 4CJ7A 4A59A 1T6DA 2AP1A 2YHXA 4MDAA 1N8RO 2QWPA 2QA4N 4QS7A 5AQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PL8 A;  2GEL A;  1D4X A;  3P4I A;  2Q2R A;  1ATR A;  4WQ5 A;  2Q1N A;  4B1Z A;  1C0G A;  3J8A A;  5BPL A;  3QML A;  4HWI A;  4K42 A;  1GLD G;  3VF4 A;  3QIC A;  5AQR A;  4FWS A;  3DXM B;  3WEE A;  2A6A A;  1IJJ A;  1LOT B;  4K25 A;  1KAX A;  3TU5 A;  4RWT A;  3BUZ B;  4QS8 A;  1JCG A;  4BRP A;  3WQT A;  4JD2 A;  4BR4 A;  1MWK A;  1BDG A;  1X3N A;  2GEM A;  3U8X A;  4K41 A;  1NM1 A;  4FWM A;  4DHY A;  1WUA A;  3GOI A;  1QZ5 A;  1HJO A;  1GLJ O;  2ASM A;  4FWN A;  3EKU A;  3KZB A;  4I6M A;  3A5L C;  2ASO A;  4M7Y A;  3RSE B;  4EAH D;  3EL2 A;  3BP8 A;  1YXQ A;  2P9U B;  3FLC O;  3A5N C;  2Q0R A;  2P9N A;  1S22 A;  2P9S B;  5ELZ A;  4IWV A;  1U2V A;  3CER A;  4CZF A;  4YDU A;  2P9L B;  4A61 A;  5AQG A;  3WXJ A;  4IO8 A;  5AQO A;  3FZL A;  3FZF A;  3MCP A;  1K8K A;  3EO3 A;  2IVP A;  3VER A;  5AQJ A;  1XC3 A;  2KHO A;  4L3Q A;  4CZJ A;  5AR0 A;  1CZA N;  5KPR A;  1TYQ A;  1BWF O;  2WUS A;  1GLF O;  4FWQ A;  5JMV A;  1KXP A;  1HKC A;  2V51 B;  3LDO A;  2AA4 A;  4CD3 A;  1ZC6 A;  1H1V A;  4I6M B;  3VPZ A;  2IVO A;  3WXI A;  4BC3 A;  4FWP A;  5LJW A;  5LJV A;  3A8Y A;  3EZW A;  3H3N O;  4FPA A;  3QB0 A;  3LM2 A;  1C0F A;  1ATS A;  4H0O A;  4ISG A;  3FR0 A;  4J8F A;  3CJ7 A;  5JLF A;  1HLU A;  5CE3 A;  4M7X A;  3L4I A;  5ADX A;  3FE1 A;  4FSV A;  2CGJ A;  1T6C A;  3H3O B;  4EHT A;  3CQX A;  1X3M A;  2CH6 A;  2VYP A;  3CJC A;  2Q31 A;  3CI5 A;  5BN9 A;  3VGL A;  5FPE A;  1V4S A;  4BRO A;  2QWQ A;  5AFU A;  2QW9 A;  4PL7 A;  1XQS C;  1WOQ A;  4H0P A;  4IZ9 A;  4YDU C;  1BO5 O;  3HM8 A;  2F9T A;  2YHW A;  3IFR A;  3M3Z A;  3DXM A;  3MMV A;  4Y0W A;  3O6W A;  2D0P A;  3O08 A;  4B1W B;  4BRM A;  2YJE A;  2D0O A;  3DAW A;  3O1B A;  4BRI A;  4B1X B;  2QWO A;  3H1Q A;  4H5R A;  2I7N A;  2E88 A;  1YAG A;  5BRF A;  4H5W A;  4BC4 A;  3QFU A;  2VCP A;  4FWO A;  4CD1 A;  4AM6 A;  1G99 A;  2V7Y A;  5AQX A;  4DB3 A;  1SQK A;  2P9K B;  3LDL A;  4BGB A;  4BRQ A;  1YUW A;  2E8A A;  2P9U A;  3L0Q A;  1DGK N;  5BR9 A;  4H0V B;  4H5V A;  2P9S A;  4IJA A;  2YJF A;  3VF6 A;  3GG4 A;  1E4F T;  3CJ9 A;  2P9L A;  3A5O C;  3WUH A;  4MO5 A;  4FPB A;  4IJN A;  1QZ6 A;  5AQP A;  5B8H A;  5TKY A;  4H0T B;  4PKI A;  2PAV A;  3U4L A;  1NWK A;  3IDH A;  4A2B A;  1HX1 A;  1GLC G;  1QQM A;  2CGL A;  4MO4 A;  3CIP A;  1MWM A;  3QBW A;  3H1V X;  5I9E B;  1Z05 A;  3I33 A;  4CBW A;  1EQY A;  1GLB G;  4XEI A;  5ADX H;  3SMS A;  2NRH A;  2QM1 A;  3GBT A;  4CZI A;  1QQN A;  4IXC A;  3ULE A;  3MDQ A;  3S41 A;  1BU6 O;  1P8Z A;  4RCH A;  3ENH A;  5AFU H;  3HZ6 A;  3ENO A;  3R8E A;  4BR5 A;  5F0X A;  4NO7 A;  4CZL A;  2YCH A;  3VEX A;  5AZI B;  3CJA A;  4F9O A;  4CZK A;  5FPN A;  2A40 A;  1ATN A;  2QXL A;  4BRL A;  3QFP A;  4BG9 A;  4E1J A;  4WQ5 C;  4BRE A;  1NGD A;  4CZE A;  3QBX A;  4BRH A;  3FGU A;  4FO0 A;  1R59 O;  3VOV A;  3D7E O;  4BGA A;  3CJB A;  1SZ2 A;  4DCH A;  3VEZ A;  4JN4 A;  4FL9 A;  2YI1 A;  5AQN A;  1GLA G;  3ULE B;  2FSJ A;  4XH5 A;  1YVN A;  1BA1 A;  3M6G A;  5F2R A;  2E1Y A;  2FSN A;  4B9Q A;  3AAQ A;  5AQK A;  3AAP A;  4C23 A;  3R6M A;  2P9I B;  4FWK A;  4QS9 A;  5EOY A;  2ZGY A;  2F9W A;  3VF2 A;  1NGF A;  1DEJ A;  2A3Z A;  2P9K A;  3WT0 A;  1T44 A;  2HMP A;  3BEX A;  1RGI A;  4XH1 A;  3C7N B;  2GTD A;  3MN7 A;  4JNE A;  1Q18 A;  4KBO A;  3O8M A;  1JCE A;  3CET A;  5BRE A;  3ATU A;  3VET A;  3VGK A;  4LC9 B;  5BN8 A;  4BRA A;  4H03 B;  2VWB A;  5EY4 A;  4BR9 A;  2P9P B;  1OKJ A;  3D2F B;  2IIR A;  1NGE A;  5FPD A;  4M63 C;  1HUX A;  1XUP O;  4PKH A;  3VEN A;  1BA0 A;  3KVG A;  4CZM A;  2J4R A;  3L6Q A;  3BF1 A;  2QWN A;  1NBW A;  1KAZ A;  4O8K A;  3LDN A;  4CZH A;  4FOI A;  5AQV A;  3IUC A;  4Z94 A;  2GWJ A;  3OHR A;  2BUP A;  3CHW A;  5AQI A;  5AQH A;  5EX5 A;  3CJ1 A;  3VEO A;  3ZET B;  2QWM A;  4EHU A;  2Q36 A;  5AZJ B;  4CI6 A;  3I8B A;  1NMD A;  5E84 A;  3DXK B;  3MK6 A;  3ZX2 A;  5BRH A;  1TUY A;  2OAN A;  3UKU A;  4BRC A;  4JAX A;  4BC5 A;  5F1X A;  4BRF A;  4JHD B;  2HOE A;  1QHA A;  3D2E B;  1RFQ A;  4BQZ A;  3VGM A;  5AZI A;  3QDK A;  4CZG A;  4GNI A;  3LDQ A;  3H46 O;  5AQY A;  4BRK A;  3KHY A;  3A5M C;  3VEV A;  3H6E A;  2BTF A;  2QWR A;  2NLX A;  3WXL A;  5JLH A;  1Y64 A;  4BQL A;  3DJC A;  4H0X B;  3A0I X;  4HTL A;  2E2P A;  4BRD A;  1NGA A;  2A42 A;  4BR0 A;  1NGG A;  1ESV A;  3MN6 A;  1NGH A;  2Q97 A;  4BR7 A;  2Q0U A;  2HF4 A;  1NGI A;  5EXW A;  4MLH A;  2E2O A;  4A62 A;  3UKU B;  3SLC A;  3BF3 A;  1NGJ A;  3UKR B;  5BPN A;  3ZEU B;  2HF3 A;  3SJH A;  3HSC A;  2P9I A;  2ASP A;  5AQT A;  3ATV A;  4O5F A;  5JIC A;  5AQQ A;  1V4T A;  5AQF A;  4GY2 B;  4XH4 A;  3UE5 A;  3C7N A;  4BG8 A;  1HKB A;  1X9J A;  4FOE A;  3WQU A;  2QWL A;  3AAR A;  2W40 A;  3HTV A;  2PBD A;  3FZH A;  2W41 A;  3FZM A;  3ID8 A;  4FWR A;  3LL3 A;  3EN9 A;  3O1W A;  4H5N A;  2P9P A;  1IG8 A;  5BPM A;  3O5B A;  3ZX0 A;  3D2F A;  4RTF D;  3JS6 A;  1DKG D;  4BRG A;  3GL1 A;  2E2Q A;  3AY9 A;  3VEY A;  5AQM A;  4B1Y B;  4MLE A;  1GLE G;  3SK3 A;  3WEE B;  2UYT A;  2FLO A;  1NGC A;  2A41 A;  4H0Y B;  3GE1 A;  3ZX3 A;  4B1U B;  5E26 A;  2FF3 B;  3HI0 A;  4B1V A;  3FFK B;  4CBX A;  4EIA A;  5KQD A;  4JD2 B;  2ZF5 O;  2YHY A;  4CBU A;  3WXK A;  1MA9 B;  1ZBS A;  3ZET A;  1S3X A;  2NZT A;  4BVO A;  5KPZ A;  3SMP A;  2V7Z A;  4ISE A;  3VEW A;  5AZJ A;  3M1F A;  3O4W A;  1BUP A;  1QQO A;  1KAY A;  1NLV A;  2E20 A;  3DXK A;  2I7P A;  1E4G T;  2D4W A;  4WQ4 A;  3R9P A;  1ZXO A;  4BC2 A;  3MN5 A;  4WYB A;  5AQZ A;  4AM7 A;  4BRN A;  1J6Z A;  2GWK A;  3H45 C;  4ISF A;  2P9N B;  4JHD A;  3D2E A;  2ZGZ A;  5BRD A;  3U9D A;  3W3D A;  1U2V B;  3IMX A;  2CH5 A;  1JCF A;  5AQW A;  2E1Z A;  3GDQ A;  3G25 A;  3DWL A;  1HPM A;  2E2N A;  1MDU B;  2D1K A;  1U6Z A;  2CGK A;  4PKG A;  2FSK A;  4EFH A;  3HBT A;  1K8K B;  2IVN A;  5AQS A;  1HKG A;  5KQ8 A;  2FXU A;  3U9Z A;  3LM9 A;  1BOT O;  4H5T A;  5FPM A;  4FWL A;  3EKS A;  1TYQ B;  1LCU A;  5EVZ A;  2ZWH A;  2H3G X;  2A5X A;  5LY3 A;  3MN9 A;  4NB4 A;  2ITM A;  1SAZ A;  4DQ8 A;  4K43 A;  3C0B A;  3B8A X;  2DPN A;  5AQL A;  1RDW X;  3CQY A;  3UKR A;  3ZEU A;  3F9M A;  3LDP A;  1GLL O;  5KPT A;  4A2A A;  2GUP A;  3FZK A;  3UB5 A;  3JXU A;  3W0L A;  3TPQ A;  2FF6 A;  3O80 A;  1TUU A;  3VES A;  1NGB A;  4BVP A;  4BR2 A;  4WQ4 C;  1Z6R A;  2V52 B;  2EWS A;  3RSE A;  1BG3 A;  4CJ7 A;  1T6D A;  2AP1 A;  2YHX A;  2QWP A;  4QS7 A;  5AQU A; 
#chains in the Genus database with same CATH topology
 3MXJ A;  4B3S K;  4CEE A;  2BDP A;  4C8N A;  2IDO A;  3P4I A;  2Q2R A;  2W42 A;  1TKZ A;  3TTC A;  3SJJ A;  2Q1N A;  5BPL A;  1VQL N;  1GLD G;  3Q7B A;  3VF4 A;  4HUE A;  3QIC A;  5AQR A;  3TSU A;  3AVL A;  4CJR A;  4IO9 L;  4C8K A;  1IJJ A;  5C0Y A;  1KAX A;  2XY7 A;  3C6A A;  4GV9 A;  3CCM N;  4KHW A;  1VQN N;  4J2B A;  2EX3 A;  2GEM A;  5FRM A;  1RDU A;  1GOA A;  2NRX A;  2ASM A;  3SPZ A;  3G6E N;  4EAH D;  1YIT N;  1ITG A;  4IOX A;  3A5N C;  2YNF A;  2P9S B;  1RT5 A;  2WON A;  4B9U A;  2G8V A;  1HYS A;  4YDU A;  2W6L A;  4FLT A;  5AQG A;  3WXJ A;  1S1T A;  3Q7C A;  2RHK A;  1X9S A;  1Q9Y A;  1W2B M;  3OYI A;  3KIO A;  1KFS A;  1K8K A;  3VER A;  2IVP A;  4IFY A;  1XC3 A;  3OBW A;  4OJR A;  5AR0 A;  3PX6 A;  3DLE A;  3O4N A;  1HKC A;  4CHY A;  1WB9 A;  2FC0 A;  3NHG A;  1OH6 A;  2IVO A;  3OY9 A;  3QER A;  3QNO A;  1HYZ A;  3A8Y A;  4OPK A;  2P51 A;  4JRQ A;  2WC9 A;  4FPA A;  3KWI A;  3FR0 A;  1XI1 A;  5JLF A;  4DKW A;  2D0B A;  4JKD A;  4FSV A;  2CGJ A;  4MFB A;  3L2Q A;  1T6C A;  2YHB A;  4JV5 K;  1FJG K;  3RVC A;  5BN9 A;  3C94 A;  4CEZ A;  3VGL A;  1S6P A;  2DFF A;  4BE0 A;  2QW9 A;  4KFB A;  4PL7 A;  4LF4 K;  4CER A;  1A5X A;  2F9T A;  2YHW A;  1G15 A;  3CPW M;  1JLE A;  1Q81 O;  3O08 A;  4BRM A;  3TAB A;  1L3V A;  4BRI A;  5M1Q A;  2FBY A;  2HW3 A;  3J81 O;  2I7N A;  4ID5 A;  4CHP A;  5BRF A;  4FJG A;  5J2Q A;  2VCP A;  4FWO A;  3G4S N;  4G1Q A;  2V7Y A;  1WSE A;  1SQK A;  1YUW A;  1XMO K;  5CZ1 A;  3L0Q A;  2O8B B;  1DGK N;  1FK9 A;  1RT6 A;  5BR9 A;  4H0V B;  4H5V A;  3J7A P;  2P9S A;  2JWK A;  3TTF A;  4DWI A;  1NJX A;  3HRG A;  1E4F T;  1RTD A;  1Q8I A;  5JS2 A;  4MO5 A;  4DG1 A;  4PY5 A;  5MLC Q;  5M1O A;  3QO9 A;  3HP6 A;  4PKI A;  2PAV A;  3O9U A;  3KK2 A;  4B9V A;  1C0M A;  3U3Y A;  5C24 A;  2IGI A;  4CEA A;  3VQE A;  3EEQ A;  3OW2 M;  2RPI A;  4G9Z A;  4H4M A;  4XEI A;  1QVF M;  1C1A A;  3SMS A;  3PLA A;  4M41 A;  1WSJ A;  3GBT A;  2UXB K;  3U3G A;  4CZI A;  3RRH A;  1QQN A;  4W5T A;  3NVK A;  1EWQ A;  2YNI A;  4JEP A;  4J2E A;  4FYD A;  1P8Z A;  4RCH A;  3QEP A;  5AFU H;  3VQ4 A;  2OZM A;  2NRV A;  1NJW A;  2HBM A;  3RMD A;  1EWR A;  4QOZ B;  4CZL A;  2YCH A;  3PIP L;  3VEX A;  5AZI B;  1NK9 A;  3M8P A;  3T1H K;  2QI2 A;  5FPN A;  2E6L A;  2DFH A;  3OYH A;  2O8E B;  4KKO A;  1ATN A;  1ZBU A;  2VG5 A;  3HK2 A;  1KTQ A;  2Y1J A;  1NGD A;  2D5R A;  3QBX A;  4FZX C;  1R59 O;  1HQE A;  3O9S A;  3VOV A;  1NJY A;  1EKE A;  4OKE A;  3V9U A;  4UQG A;  4B08 A;  1NG9 A;  4CJ5 A;  2WFB A;  3P31 A;  4OX9 K;  2QK9 A;  3ULE B;  3HYF A;  1RBS A;  3EYZ A;  4E7J A;  4OKK A;  1JLC A;  3R1X A;  3KKR A;  4DTU A;  5EOY A;  3T7Z A;  1NKB A;  3AVC A;  1U04 A;  2ZE2 A;  5TKW A;  3E1Y A;  2A3Z A;  3LAM A;  2YHA A;  1N36 K;  2O8B A;  3PUF A;  1J5E K;  4JNE A;  3MXI A;  1XHZ A;  3O8M A;  3HP9 A;  3ZLJ A;  4PUO A;  3SI6 A;  1QSS A;  3ATU A;  3VET A;  1B9D A;  5KGW A;  5T7B A;  2VWB A;  3VA0 A;  4FW1 A;  4BR9 A;  4PHT X;  3P39 A;  5FPD A;  1IBL K;  1Y97 A;  2BE2 A;  4B9T A;  3IG1 A;  4PKH A;  4J2A A;  4BDZ A;  3AO5 A;  4CZM A;  2J4R A;  4YOY A;  1KAZ A;  4CZH A;  1T8E A;  1BL3 A;  3V1O A;  4N47 A;  3CJ1 A;  4CFA A;  1Q86 O;  4DU3 A;  3ZET B;  1Z25 A;  4JI7 K;  4BWM A;  3DLB A;  3ZT4 A;  3QEI A;  2E4L A;  1L3T A;  2KQ2 A;  1NK4 A;  3ZX2 A;  1KVB A;  3OYF A;  4BRC A;  4JAX A;  1WBD A;  3RMB A;  4BC5 A;  5F1X A;  4IFV A;  1QHA A;  5AZI A;  4M3U A;  4CZG A;  4GNI A;  3H46 O;  4CIE A;  4BRK A;  3KHY A;  2O8E A;  2DFE A;  3H6E A;  2BTF A;  4CE9 A;  1LWF A;  1FKO A;  3OBY A;  5H1S Q;  4LSN A;  4JI4 K;  2E2P A;  1NGG A;  3MN6 A;  3TTD A;  2Q97 A;  4CEO A;  4FJM A;  4FLW A;  2HF4 A;  1NGI A;  3O3H A;  4MLH A;  5M1N A;  4KH4 A;  3UKU B;  4GW6 A;  1DTQ A;  2HF3 A;  1IBK K;  4JKE A;  2ASP A;  1K73 O;  5AQT A;  1J9A A;  3ATV A;  4O5F A;  1FKP A;  4JKF A;  4GY2 B;  3K9K A;  1HKB A;  3E9L A;  5E41 A;  4FOE A;  1VAZ A;  3WQU A;  1ZYQ A;  1RDC A;  4IDH A;  3AO2 A;  3FZH A;  4FK0 A;  1JL1 A;  3FZM A;  4CJQ A;  3LL3 A;  3J80 O;  3O5B A;  1ILY A;  4BRG A;  3AY9 A;  4KTQ A;  3OYL A;  4B1Y B;  4MLE A;  2JGU A;  3GE1 A;  3ZX3 A;  4DV2 K;  5CYQ A;  2GUI A;  1TL3 A;  3HI0 A;  3SV3 A;  5KQD A;  4JD2 B;  1MA9 B;  3VQP A;  1RT7 A;  3R3L A;  3JYT A;  3ZET A;  4BVO A;  2KFN A;  4ISE A;  2Y1I A;  4F3T A;  3CM5 A;  2HST A;  1BUP A;  1NLV A;  5GIN A;  2F7T A;  3C6H A;  4BC2 A;  2LSN A;  2NRZ A;  4AM7 A;  3OS1 A;  3KWG A;  3V6D A;  2ZGZ A;  4DU1 A;  1WAJ A;  3W3D A;  1VQ7 N;  4HUF A;  1O13 A;  4IEI A;  4JRP A;  5AQW A;  1RBV A;  3G25 A;  4LF6 K;  1HPM A;  3D45 A;  4EP4 A;  4DSL A;  3N4P A;  1DTT A;  2D1K A;  4C8L A;  1VQM N;  2D0C A;  3PSI A;  4B8A B;  1CZ9 A;  4FLU A;  1HKG A;  1NK0 A;  4FJ7 A;  2GX9 A;  3U9Z A;  3AGR A;  1VQK N;  4ICL A;  3EKS A;  1TYQ B;  4FM0 A;  4Y1C A;  2H3G X;  1XC9 A;  1RDD A;  4NLC A;  3RR8 A;  3MEG A;  2E5L K;  4DQ8 A;  3SCX A;  4ZTJ A;  2OA8 A;  4CEF A;  3F9M A;  3DRP A;  3NGI A;  1GLL O;  4CJK A;  2GUP A;  3QIP A;  4L8R B;  4DTM A;  3W0L A;  3SUO A;  3O80 A;  4BR2 A;  2V52 B;  3RSE A;  4CJ7 A;  4YHH K;  3TAG A;  2QA4 N;  1WAF A;  3ENB A;  1LW0 A;  1LAW A;  2GEL A;  4DFJ A;  4CF1 A;  1ATR A;  4WQ5 A;  4CJU A;  4B1Z A;  1C0G A;  3OJU A;  4AH9 A;  2UU9 K;  2A6A A;  1BHL A;  4K25 A;  3NFA A;  3WQT A;  4JD2 A;  3ZSQ A;  4BR4 A;  1MWK A;  1VSM A;  3CD6 N;  1X3N A;  3U8X A;  4DF4 A;  4K41 A;  4FWM A;  1IG9 A;  1C0T A;  3NH2 A;  4CEQ A;  1GLJ O;  4MQ3 A;  5C2F A;  1RTH A;  3TAR A;  4LF5 K;  4CVN E;  3KLE A;  1HNW K;  3SPY A;  4I6M A;  4OLA A;  4FLZ A;  4KH6 A;  3BP8 A;  3F73 A;  3L8B A;  3ZT2 A;  3THW B;  1YXQ A;  2P9U B;  3FLC O;  2FBT A;  2OPR A;  1TK0 A;  1I3A A;  1S22 A;  5LMU K;  2G8I A;  5D3G A;  4I9Q A;  3CER A;  3L2V A;  4CZF A;  4GKJ K;  2P9L B;  1KVC A;  4O8U A;  3SUP A;  4IO8 A;  3FZL A;  4NCA A;  4DQP A;  3VQ6 A;  5J2P A;  4Y1D A;  5AQJ A;  3CYM A;  1K9M O;  4LF7 K;  4CZJ A;  4DSF A;  1CZA N;  2VG7 A;  3CQ8 A;  4E3S A;  3OVN A;  1TYQ A;  1KXP A;  1LW2 A;  2V51 B;  2WOM A;  4DUY K;  1XNQ K;  2KKZ A;  5KRT A;  1BQN A;  4CIG A;  1H1V A;  5FRN A;  1YTA A;  4H8K A;  3VPZ A;  5C2D A;  1M1K O;  5LJW A;  1B92 A;  1WSI A;  4DF8 A;  3SBT A;  4IBN A;  3LM2 A;  1ATS A;  4H0O A;  1HJR A;  4M7X A;  5ADX A;  1U4B A;  4CF8 A;  3CQX A;  4FLY A;  1X3M A;  4NCB A;  3CI5 A;  4OGC A;  4E89 A;  1QE1 A;  1VSF A;  5GAG P;  1HPZ A;  3PX4 A;  4BRO A;  2QWQ A;  3RMC A;  4CJW A;  1OH8 A;  1WOQ A;  2W6K A;  4H0P A;  4YDU C;  5HRO A;  4O5B A;  5C15 A;  4CK2 A;  4JK9 A;  1YTU A;  4MDB A;  3PIO L;  5BR8 K;  4B1W B;  4YFU A;  4OO1 J;  2YJE A;  3IRX A;  4AQY K;  2NRT A;  1JL2 A;  3WNH A;  3D0P A;  4CHN A;  4CW7 B;  3H1Q A;  4H5R A;  4RW8 A;  2E88 A;  5CHI A;  3LPU A;  4HVJ A;  4DU4 A;  3THY B;  5AQX A;  3LZI A;  3THW A;  3K58 A;  2YKM A;  2AJQ A;  2E8A A;  2P9U A;  2O8F B;  4E0D A;  4I7F A;  1ZBI A;  4AHS A;  3KD1 E;  3OJS A;  5IT9 O;  2YJF A;  4ELT A;  3GG4 A;  4E7I A;  2P9L A;  4M42 A;  4DTN A;  2VQE K;  3QEX A;  1YVU A;  1QZ6 A;  4IJN A;  5B8H A;  5TKY A;  4H0T B;  3EY1 A;  4O0J A;  2XY6 A;  5IWA K;  4OPJ A;  2B5J A;  3IDH A;  4O55 A;  3QEW A;  4A2B A;  2IS3 A;  1GLC G;  1QQM A;  2CGL A;  5CR4 A;  4Z4H A;  2OZS A;  1T05 A;  4M3Y A;  4DV6 K;  1Z05 A;  3I33 A;  1X1P A;  1EQY A;  3O9R A;  5M1P A;  3SAG A;  4C8O A;  1D9F A;  1NJI O;  2QM1 A;  4DR5 K;  2QKB A;  3MDQ A;  3S41 A;  3IKM A;  5KGX A;  4K8X A;  4E1N A;  4BR5 A;  3R8E A;  5FRO A;  1LWC A;  3MX2 A;  2F4V K;  2OTL N;  3TAE A;  3DLR A;  3NAE A;  4F4K A;  4Z4I A;  2QXL A;  4BG9 A;  3SZ2 A;  5SZT A;  2G8U A;  4C8M A;  1VSL A;  3D7E O;  1NKE A;  3CJB A;  1Q9X A;  3E66 A;  3LPT A;  4JN4 A;  3VEZ A;  4YOX A;  5SWM A;  4XH5 A;  2RKI A;  1D5A A;  3NF8 A;  5LL6 Z;  3M6G A;  5F2R A;  2HHV A;  1RCH A;  2HNY A;  3MED A;  3R6M A;  3F5T A;  3CPE A;  1LAV A;  4FJI A;  4FWK A;  4YOR A;  2ZGY A;  3THY A;  2YKN A;  3WT0 A;  1NK6 A;  3BEX A;  2O8F A;  4XH1 A;  1RGI A;  3S3M A;  1Q18 A;  4U7B A;  5DK5 A;  3K57 A;  3VGK A;  4LC9 B;  2JLE A;  2YNH A;  3VQC A;  5BN8 A;  4K0K K;  1T03 A;  1OKJ A;  3D2F B;  2HHW A;  2IIR A;  1NGE A;  4DLG A;  1HUX A;  2HND A;  1BA0 A;  3KVG A;  3VQ7 A;  4KI6 A;  4DV7 K;  2QWN A;  4NYF A;  4O8K A;  3OYJ A;  4DQQ A;  1ZBH A;  4FJH A;  2GWJ A;  2BUP A;  1EX4 A;  1IV0 A;  3VMF B;  5EX5 A;  1IKW A;  4CK1 A;  4EHU A;  4ILJ A;  4DTS A;  1YJW N;  4AHR A;  1NMD A;  2KZZ A;  3PV8 A;  1QS4 A;  3L2R A;  1J5O A;  2DY4 A;  4B9N A;  4FXD A;  3LP3 A;  4KI4 A;  1S9E A;  4BY9 C;  1WLJ A;  2UUC K;  2HOE A;  4FJ5 A;  3VGM A;  3WNG A;  3MEE A;  4F2S A;  3AVK A;  1TVR A;  5AQY A;  4O44 A;  4BAC A;  5M1F A;  3V81 A;  3L3V A;  2NLX A;  3HST B;  3DMJ A;  3HPH A;  5JLH A;  5JVG L;  4BQL A;  3DJC A;  3A0I X;  3RTV A;  1K6Y A;  3KLF A;  3L4Q A;  4HTL A;  1NGA A;  1ESV A;  1VQO N;  2ZQB A;  3HL8 A;  1NGH A;  3T1Y K;  4BR7 A;  2Q0U A;  5EXW A;  3RWU A;  3HT3 A;  2E2O A;  3I55 N;  4PWD A;  3OYA A;  5HRN A;  1GOB A;  3BF3 A;  3UKR B;  3ZEU B;  4CJL A;  4KHU A;  1C1B A;  2QKK A;  1KC8 O;  3QES A;  2PY5 A;  1LWE A;  1V4T A;  1Z26 A;  4XH4 A;  3UE5 A;  4CGG A;  1X9J A;  3SQ1 A;  2B6A A;  2QWL A;  3VN5 A;  4C1N K;  3K0S A;  1VRU A;  2W41 A;  4KPY A;  3E9O A;  4KHQ A;  2A1S A;  4IEE A;  1HNZ K;  3O1W A;  1IG8 A;  5BPM A;  3ZX0 A;  3D2F A;  4RTF D;  3P38 A;  3GL1 A;  3WNE A;  2Z1H A;  3AA5 X;  1GLE G;  4IG0 A;  2A41 A;  4B1U B;  5E26 A;  4M45 A;  3OTO K;  4CGI A;  3SAH A;  2ZF5 O;  2YHY A;  4CBU A;  3SQ0 A;  4WFA L;  2ETJ A;  3SMP A;  2ITG A;  3K59 A;  3AVG A;  4E19 A;  1R0A A;  2E20 A;  3AO3 A;  3BZK A;  3CM6 A;  4R79 A;  3DI6 A;  2I7P A;  4O4G A;  4WQ4 A;  3KK1 A;  3V9W A;  1ZXO A;  3BY5 A;  1E3M A;  1IKX A;  3MN5 A;  1A5V A;  3P83 D;  3H45 C;  4KTW A;  3MCA B;  4FCY A;  5C25 A;  3BDP A;  5BRD A;  3CC7 N;  5GIP A;  3U9D A;  4FJK A;  3AA3 A;  3IMX A;  1JCF A;  4OVL A;  2E2N A;  4M3T A;  4H4O A;  2VWJ A;  2CGK A;  4EFH A;  3ZSW A;  3AVB A;  4FZY A;  3HBT A;  5AQS A;  2FXU A;  5DM7 L;  2P5G A;  4CED A;  2HNZ A;  1S72 N;  1NU0 A;  2ZWH A;  5LY3 A;  1SL1 A;  1CLQ A;  2ITM A;  1OVY A;  1SAZ A;  4YOT A;  4IOC L;  4C1N I;  3B8A X;  2O4I A;  2DPN A;  3UKR A;  5CY4 A;  4DR2 K;  3ZEU A;  2OPQ A;  3PSF A;  5HBM A;  4BWJ A;  3NH1 A;  4KB1 A;  4DFK A;  3QIO A;  2G8W A;  3ISN C;  3JXU A;  4JI3 K;  1QQC A;  3TPQ A;  1TUU A;  3TSP A;  3VES A;  4BVP A;  2EWS A;  1BG3 A;  2HVI A;  4A59 A;  2AP1 A;  1N8R O;  4MDA A;  2QWP A;  3HVR A;  3CFO A;  3QEV A;  1D4X A;  4OPA A;  4IG3 A;  4TSX A;  2VWK A;  3J8A A;  4JKH A;  2X74 A;  4K42 A;  3T69 A;  1TGO A;  1EO1 A;  1OH5 A;  4FWS A;  4A57 A;  2PZS A;  4IOA L;  3OYD A;  4B9M A;  4CF0 A;  4RWT A;  4QS8 A;  1JCG A;  4BRP A;  1YT3 A;  1DT9 A;  4ZHR A;  3PO4 A;  1P90 A;  1RTJ A;  3B6P A;  1IH7 A;  1NM1 A;  1WUA A;  2YV0 X;  4EZ6 A;  1SV5 A;  3GOI A;  2ZJP L;  1HJO A;  1W9H A;  4ZTF A;  2NRW A;  3OA9 A;  3KZB A;  3MXM A;  1XNR K;  3CMA N;  4M7Y A;  3RSE B;  3EL2 A;  4CK3 A;  2ATQ A;  4DTX A;  3VQ5 A;  2Q0R A;  4FVM A;  2VGM A;  3TR8 A;  4RW7 A;  5ELZ A;  4IWV A;  3OYG A;  3EZ5 A;  3ZSO A;  4A61 A;  1KLM A;  5AQO A;  3SUQ A;  3SNN A;  3HM9 A;  4CES A;  4BDY A;  1VSI A;  2WBN A;  2KHO A;  1JLQ A;  3HPG A;  3HO1 A;  3F9K A;  5C12 A;  4FWQ A;  1IO2 A;  5JMV A;  3O3G A;  3SQ4 A;  4YY3 K;  3LDO A;  3LP0 A;  3V9Z A;  3RRG A;  2JWL A;  3AO1 A;  4F2R A;  4CGD A;  4JI5 K;  4CJT A;  3I0S A;  3OYK A;  4I6M B;  3WXI A;  4BC3 A;  4B3O A;  4DQS A;  3DOK A;  3NF9 A;  4F8R A;  4N41 A;  2X6N A;  3EZW A;  3CFR A;  3QB0 A;  4AF1 A;  4ISG A;  2NNW A;  3CJ7 A;  1HLU A;  5CE3 A;  1WNS A;  4LF9 K;  1UA1 A;  3AVF A;  3L4I A;  2CH6 A;  3CJC A;  1CZB A;  3P5J A;  2Q31 A;  1VQP N;  4N5S A;  2XO7 A;  4DLE A;  1N33 K;  2PFU A;  1KLN A;  1D9D A;  1FW6 A;  4IZ9 A;  3CCJ N;  4Z4E A;  2NRR A;  3MMV A;  4O0I A;  1EXQ A;  2D0O A;  3O1B A;  4WE1 A;  3S3O A;  1CXU A;  2QWO A;  4A5B A;  1YAG A;  4H5W A;  4AHC A;  3QFU A;  3LDS A;  1YF5 L;  1JLA A;  4CD1 A;  4AM6 A;  4DB3 A;  1VSD A;  2HVH A;  4BGB A;  4DTJ A;  3NF6 A;  1WSH A;  4RW9 A;  4NXM K;  4U67 L;  2E6M A;  1U48 A;  4JI8 K;  4FM1 A;  3DLL L;  3CJ9 A;  3M8R A;  3A5O C;  3KTQ A;  4DR1 K;  2UUA K;  3K5L A;  3ALY A;  2NUB A;  1YI2 N;  3U4L A;  4FZZ A;  2O8C B;  1U49 A;  1NWK A;  3AVA A;  2FBV A;  4LH4 A;  5HRP A;  3VA3 A;  3AVJ A;  3C65 A;  3DLH A;  1RBR A;  4MO4 A;  1RDA A;  3CIP A;  5GAH P;  3JAM O;  5GIO A;  4CCH A;  5C42 A;  2QXF A;  3AVI A;  1GLB G;  5ADX H;  5CYM A;  5HLF A;  1ASV A;  3QLH A;  5KTQ A;  4IXC A;  4CEB A;  2FBX A;  3HVT A;  1BU6 O;  3ENH A;  3HXM A;  2O8D B;  4CGH A;  1RT3 A;  3ENO A;  5F0X A;  4NO7 A;  5FDL A;  4A5A A;  1LV5 A;  4F9O A;  2HHQ A;  1VQ8 N;  4CZK A;  3VQ8 A;  4KHN A;  2G8H A;  3AVH A;  5AJ3 K;  2ZJR L;  3S3N A;  1KRP A;  1NKC A;  1N6Q A;  5C10 A;  2GBZ A;  3BGR A;  4BRL A;  4DTR A;  3QFP A;  4E1J A;  4R5P A;  4E7K A;  1T7P A;  1JLB A;  1F21 A;  2UXD K;  1SZ2 A;  4CF9 A;  3KLI A;  4DCH A;  3KLG A;  2G8F A;  3I56 N;  4FL9 A;  3HOS A;  2YI1 A;  4JI1 K;  5AQN A;  4B9S A;  4KHS A;  2FSJ A;  1VHX A;  1YVN A;  4Q0B A;  1BA1 A;  4CHQ A;  2HMI A;  2FSN A;  4B9Q A;  3NCI A;  5AQK A;  3OYB A;  4C23 A;  4GKK K;  4X62 K;  4QS9 A;  2F9W A;  3AVM A;  3ID6 A;  2XRI A;  3VF2 A;  3ZT3 A;  4CF2 A;  3ULD A;  2HMP A;  3DOL A;  3ZYY X;  3C7N B;  2GTD A;  1VSJ A;  5EU7 A;  4KBO A;  3T3F A;  4CHO A;  5GAD P;  5BRE A;  2OPS A;  2RE2 A;  2HHH K;  1REV A;  4H03 B;  1SKR A;  3I0R A;  2P9P B;  2WTU A;  2BGG A;  1VQ5 N;  4JI6 K;  3NGY A;  4M63 C;  3K5N A;  3VQB A;  1XUP O;  2UUB K;  4KH5 A;  1N34 K;  2O8C A;  3OYN A;  3OYC A;  3L6Q A;  4E7L A;  3E01 A;  4KHY A;  2ZM6 K;  1KCF A;  4FOI A;  4Z94 A;  4PA1 A;  3CHW A;  5AQI A;  2VG6 A;  5AQH A;  4AIL C;  4DS4 A;  4V19 S;  2QWM A;  2Q36 A;  4X64 K;  5AZJ B;  3I8B A;  5E84 A;  3DXK B;  2EHG A;  1YIJ N;  5BRH A;  2OPP A;  1XWL A;  2IOC A;  1SKW A;  4DQI A;  1WSF A;  2F96 A;  1L3S A;  2O8D A;  4CFD A;  4BRF A;  3D2E B;  1RFQ A;  1VSK A;  4BQZ A;  1K8A O;  3V9S A;  3TAM A;  2ZJQ L;  1XMQ K;  3VEV A;  3A5M C;  4LFC K;  4JKA A;  3UIQ A;  4FJ8 A;  4OPH A;  4DV0 K;  4F3O A;  4JK7 A;  3NBP A;  2QWR A;  4JKG B;  1NK5 A;  1Y64 A;  3CXC M;  4JYA K;  2QEX N;  1KQS M;  4LY7 A;  4AHT A;  4CGJ A;  2HBK A;  1WN7 A;  3NGZ A;  3SBG A;  1NMN A;  2A42 A;  3ITH A;  4BR0 A;  4HUG A;  3E9P A;  1OVQ A;  3K5M A;  5GAE P;  4JKC A;  1NGJ A;  2KTQ A;  4B3T K;  1U45 A;  3SJH A;  5HRR A;  1BGX T;  1HNI A;  5JIC A;  5AQF A;  3C7N A;  3ZSR A;  3AAR A;  3HTV A;  1KSP A;  2PBD A;  3ID8 A;  4OLB A;  4H5N A;  2P9P A;  4KV8 A;  4AHU A;  3MWP A;  3JS6 A;  4DMN A;  2E2Q A;  1QSY A;  1JXE A;  5AQM A;  3AVN A;  3HJF A;  5JVH L;  3SAF A;  2OTJ N;  3SK3 A;  3WEE B;  2FLO A;  4FJ9 A;  4FJL A;  3MX5 A;  4FVU A;  2X78 A;  4CBX A;  4EIA A;  3WXK A;  1ZBS A;  1S3X A;  3EE8 A;  5KPZ A;  1HQU A;  3VEW A;  1VSH A;  5AZJ A;  1KAY A;  4GV3 A;  1C0U A;  4ID1 A;  3DXK A;  3TAQ A;  3C95 A;  1DLO A;  1E4G T;  2D4W A;  3R9P A;  3T1A A;  1JJ2 M;  4GVE A;  4KB0 A;  4FK4 A;  4BE1 A;  1RT2 A;  4WYB A;  4BRN A;  3V1R A;  1J6Z A;  4Z4G A;  3SUN A;  2P9N B;  2IAJ A;  3D2E A;  1CXQ A;  1OH7 A;  1U2V B;  5K14 A;  1NOY A;  1GOC A;  3KLH A;  2E1Z A;  3GDQ A;  1KD1 O;  1KFD A;  2PYL A;  4CFC A;  1U6Z A;  3VTH A;  4WFN L;  2FSK A;  4DSE A;  4B9L A;  4JKG A;  3TAP A;  2IVN A;  1VRT A;  2A1R A;  1ASW A;  3CCS N;  1S9G A;  3LM9 A;  4H5T A;  5FPM A;  3T19 A;  1TV6 A;  4FWL A;  2I5J A;  4X65 K;  3CC4 N;  3LZJ A;  2D0A A;  4Z4F A;  2A5X A;  3MN9 A;  4NB4 A;  4YOW A;  3J7Y P;  4I9L A;  4HCB A;  3O4Q A;  3L2U A;  3U6F A;  3C0B A;  1TKD A;  3VTI A;  5AQL A;  4QAG A;  1WSG A;  3DRR A;  5LMN K;  3K9J A;  3LDP A;  4NLB A;  4AHV A;  2OYQ A;  2G8K A;  4A2A A;  3CCU N;  3CCQ N;  1UA0 A;  4W5N A;  2FF6 A;  1QHT A;  4OKJ A;  4WQ4 C;  2YHX A;  3SQ2 A;  1BCO A;  4PL8 A;  3WXM B;  1W7A A;  1IBM K;  3NH0 A;  4FM2 A;  1TKX A;  3CCL N;  4B3M K;  4EP5 A;  2HB5 A;  3QML A;  4HWI A;  4DTO A;  3LAL A;  1SL0 A;  3ASM A;  3VQQ A;  4DV4 K;  3AA2 A;  3WEE A;  3DXM B;  1LOT B;  3DYA A;  4LH5 A;  3TU5 A;  3BUZ B;  3CF5 L;  1QSL A;  4Q5V A;  4DSK A;  1NJZ A;  1BDG A;  1SS6 A;  3LWL A;  3HOT A;  4DHY A;  4JKB A;  2IC3 A;  3CCE N;  1QZ5 A;  1A5W A;  3DRS A;  3V9X A;  4FWN A;  5KI6 A;  3KD5 E;  1S6Q A;  3EKU A;  4JS5 A;  3M8Q A;  5HRS A;  1JKH A;  2ASO A;  3A5L C;  4WCE L;  3O3F A;  4DV5 K;  4FJJ A;  2P9N A;  2B4J A;  1S5J A;  4FLV A;  1U2V A;  2Z1G A;  1YJN N;  4CJ3 A;  1HNV A;  3ZSX A;  3NDK A;  4W5O A;  1NNE A;  4FK2 A;  3OS0 A;  3MEC A;  3QNN A;  3FZF A;  3MCP A;  4N76 A;  3EO3 A;  4W5R A;  3VQ9 A;  4L3Q A;  1QVG M;  2BAN A;  3CME N;  5KPR A;  1BWF O;  2WUS A;  1GLF O;  5I42 A;  3C6T A;  2AA4 A;  4RW6 A;  2XHB A;  4CD3 A;  1ZC6 A;  4GMJ B;  3TI0 A;  3PO5 A;  4ELV A;  2RF2 A;  4CJV A;  3K2P A;  4FWP A;  1W0H A;  5LJV A;  3DLK A;  4N56 A;  2X6S A;  3N4Q A;  4CJ4 A;  3H3N O;  4CFB A;  5I3U A;  3L3U A;  1C0F A;  5DM6 L;  4ELU A;  4J8F A;  1UWB A;  1FXX A;  4HCC A;  2HHS A;  1BIS A;  4YNQ A;  2HBJ A;  3FE1 A;  1TK5 A;  2HHX A;  3M8S A;  4LFA K;  3H3O B;  4EHT A;  5J2M A;  4IKF A;  2VYP A;  1SUQ A;  4KHP K;  1HMV A;  5FPE A;  2Z1J A;  1V4S A;  3AGK A;  5AFU A;  1XQS C;  4DS5 A;  1T3V A;  1MU2 A;  3OS2 A;  5KRS A;  1BO5 O;  1QTM A;  1X9W A;  3CCV N;  3HM8 A;  4KO0 A;  3J7Z O;  3IFR A;  3M3Z A;  1RBU A;  3DXM A;  4DFM A;  3ZSV A;  4Y0W A;  3O6W A;  2D0P A;  4DFP A;  4DSI A;  3EE9 A;  3AA4 A;  4YOU A;  1KVA A;  3LP2 A;  2DTU A;  3DAW A;  3DLG A;  3L2W A;  4OGE A;  4B1X B;  4E7H A;  4JLH A;  2R7Y A;  2KFZ A;  1C6V A;  4BC4 A;  1JLF A;  1G99 A;  2HHU A;  4B3R K;  3LDL A;  2P9K B;  4BRQ A;  1N32 K;  4J2D A;  4DSJ A;  3NE6 A;  4GV6 A;  2RN2 A;  4XIU A;  1TK8 A;  4IJA A;  3WNF A;  1BQM A;  1RT1 A;  3ZT1 A;  3VF6 A;  2GV9 A;  1NK7 A;  4DTP A;  3WUH A;  2OCE A;  4FPB A;  5AQP A;  3ZCM A;  1S1W A;  3TWH A;  1TAU A;  3ZSY A;  3NVM A;  1W97 L;  3CC2 N;  1BCM A;  3CG7 A;  4UY8 O;  1UOC A;  1HX1 A;  3MAQ A;  4IFE A;  2QTD A;  1MWM A;  1NK8 A;  1U47 A;  3QBW A;  1BIU A;  3H1V X;  3THV A;  4BDP A;  5I9E B;  4CBW A;  3TSQ A;  3PX0 A;  2NRH A;  4ILG B;  4X66 K;  1TKT A;  2VGN A;  1Q82 O;  3ULE A;  5HOO A;  3VQA A;  3HZ6 A;  3K5O A;  4K8Z A;  1ASU A;  3CFP A;  5JS1 A;  1TL1 A;  2KLA A;  1TAQ A;  3CJA A;  2PYJ A;  4FJX A;  2A40 A;  3PY8 A;  4CHZ A;  1VSE A;  3NF7 A;  4JS4 A;  4Z4C A;  1RTI A;  3G71 N;  4WQ5 C;  4BRE A;  4CZE A;  1B9F A;  4BRH A;  3FGU A;  4FO0 A;  3KK3 A;  1VQ6 N;  4NYN A;  4BGA A;  4NCG A;  4JI0 K;  1IKY A;  3IS9 A;  3QIN A;  4DQR A;  4IDK A;  1S1X A;  1GLA G;  3CCR N;  1O1W A;  4DR7 K;  2E1Y A;  2P5O A;  4CJS A;  1BI4 B;  3AAQ A;  3AV9 A;  3AAP A;  1RDB A;  2P9I B;  1HYV A;  3G0Z A;  4NXN K;  1NGF A;  1DEJ A;  2P9K A;  1J54 A;  1RBT A;  1T44 A;  3P1G A;  3THX B;  4LF8 K;  3MN7 A;  4KAZ A;  1NOZ A;  4W5Q A;  1JCE A;  3CET A;  1I39 A;  5HP1 A;  4BRA A;  5EY4 A;  3LAK A;  1EP4 A;  4I2Q A;  1ZBL A;  4KTZ A;  3H08 A;  1M90 O;  4B8C A;  4WFB L;  3VEN A;  1S1V A;  1S1U A;  1RIL A;  3BF1 A;  2XY5 A;  1NBW A;  1X9M A;  3LDN A;  3O9T A;  5AQV A;  2HBL A;  3IUC A;  3OHR A;  2BH1 A;  1SKS A;  4DR6 K;  3A2F A;  3VEO A;  1L5U A;  4ILH A;  3ZSZ A;  5CZ2 A;  1VQ9 N;  3F2K A;  4CI6 A;  4E1M A;  3RMA A;  4LSL A;  3MK6 A;  4CGF A;  1TUY A;  2OAN A;  3UKU A;  4KRE A;  3KJV A;  4DR3 K;  3KK7 A;  4JHD B;  3OYM A;  3MWT A;  1HNX K;  4JK8 A;  3QDK A;  4KRF A;  2YNG A;  4FJN A;  3TAF A;  3LDQ A;  4DV3 K;  1WBB A;  4I2P A;  2F8S A;  1YJ9 N;  4DUZ K;  3WXL A;  4FLX A;  2KW4 A;  4H0X B;  2Q3S A;  4BRD A;  2ZD1 A;  4LFB K;  3AO4 A;  4DR4 K;  4DV1 K;  1YHQ N;  4A62 A;  1HRH A;  1SL2 A;  3SLC A;  5HL7 L;  1N5Y A;  1BI4 A;  5BPN A;  4FW2 A;  3B6O A;  3HSC A;  2P9I A;  3VQD A;  5AQQ A;  3THX A;  4BG8 A;  2KZM A;  2Z1I A;  1RT4 A;  5M1K A;  2W40 A;  3HPO A;  4FWR A;  2P1J A;  3EN9 A;  1JLG A;  4QCL A;  1I94 K;  3TAN A;  1VQ4 N;  4HHT A;  1D8Y A;  1IKV A;  1DKG D;  1JXB A;  4M3W A;  3VEY A;  4WF9 L;  3LP1 A;  4CJF A;  4PQU A;  3SV4 A;  3LAN A;  4HTU A;  2UYT A;  1NGC A;  4H0Y B;  1RNH A;  1UAX A;  2FF3 B;  4B1V A;  4M3R A;  3FFK B;  4CIF A;  3C6U A;  2NZT A;  2V7Z A;  3BZC A;  3M1F A;  3O4W A;  5J2N A;  1QQO A;  1ZBF A;  4M3Z A;  3FFI A;  5FLX O;  4BE2 A;  3DM2 A;  3G10 A;  3SYZ A;  3IAY A;  2XY8 A;  5DMR A;  5A2Q O;  2GWK A;  3NMU A;  4ISF A;  4JHD A;  4RG8 A;  5J1E A;  1VK0 A;  4Z0U A;  2CH5 A;  2F8T A;  2YX6 A;  4M3X A;  3DWL A;  3LWM A;  4YOV A;  1MDU B;  4LD0 A;  3I8D A;  4PKG A;  2VQF K;  3V4I A;  3O9Q A;  1K8K B;  5KQ8 A;  2UXC K;  2O4G A;  1J53 A;  1EET A;  4CJP A;  1BOT O;  3D6R A;  3V1Q A;  3M5R A;  1LCU A;  1XHX A;  5EVZ A;  4JI2 K;  3ZT0 A;  3JSM A;  1L3U A;  4K43 A;  3S9H A;  1RDW X;  3CQY A;  4CJE A;  4EZ9 A;  2HHT A;  4CEC A;  5KPT A;  4GVM A;  3OYE A;  3FZK A;  3UB5 A;  1Q7Y O;  1BIZ A;  1HR0 K;  1NGB A;  3QET A;  3RR7 A;  1Z6R A;  1C1C A;  1T6D A;  4RW4 A;  5AQZ A;  3KKS A;  4QS7 A;  5AQU A; 
#chains in the Genus database with same CATH homology
 4PL8 A;  3ENB A;  3WXM B;  2GEL A;  1D4X A;  4OPA A;  3P4I A;  2Q2R A;  3TTC A;  1ATR A;  4WQ5 A;  3CCL N;  2Q1N A;  4B1Z A;  1C0G A;  3J8A A;  4JKH A;  3QML A;  5BPL A;  4HWI A;  4K42 A;  1VQL N;  1GLD G;  3Q7B A;  3T69 A;  3VF4 A;  3QIC A;  5AQR A;  3TSU A;  1EO1 A;  4FWS A;  3DXM B;  3WEE A;  2A6A A;  1IJJ A;  1LOT B;  4K25 A;  4A57 A;  4IO9 L;  4IOA L;  1KAX A;  5C0Y A;  3TU5 A;  3C6A A;  3BUZ B;  4RWT A;  4QS8 A;  3CCM N;  4GV9 A;  1JCG A;  4BRP A;  3WQT A;  3CF5 L;  4JD2 A;  1VQN N;  1DT9 A;  4BR4 A;  1MWK A;  1BDG A;  1SS6 A;  1X3N A;  1P90 A;  1RDU A;  2GEM A;  3U8X A;  3HOT A;  4K41 A;  3CD6 N;  1NM1 A;  4FWM A;  4DHY A;  1WUA A;  2NRX A;  4JKB A;  3GOI A;  3CCE N;  1QZ5 A;  1HJO A;  2ZJP L;  1GLJ O;  5C2F A;  2ASM A;  4FWN A;  2NRW A;  3EKU A;  3OA9 A;  3KZB A;  4I6M A;  3G6E N;  3A5L C;  2ASO A;  4M7Y A;  4WCE L;  3RSE B;  4EAH D;  3EL2 A;  3CMA N;  4KH6 A;  1YIT N;  3BP8 A;  1YXQ A;  2P9U B;  3FLC O;  4IOX A;  3A5N C;  2Q0R A;  2P9N A;  2VGM A;  1S22 A;  2P9S B;  5ELZ A;  4IWV A;  1U2V A;  3CER A;  4CZF A;  1YJN N;  4YDU A;  2P9L B;  4A61 A;  5AQG A;  4O8U A;  3WXJ A;  3Q7C A;  4IO8 A;  2RHK A;  3FZL A;  5AQO A;  1W2B M;  3FZF A;  3MCP A;  2WBN A;  1K8K A;  3EO3 A;  2IVP A;  3VER A;  5AQJ A;  1K9M O;  1XC3 A;  2KHO A;  4L3Q A;  3OBW A;  4CZJ A;  1QVG M;  5AR0 A;  1CZA N;  3CME N;  5KPR A;  1TYQ A;  1BWF O;  2WUS A;  1GLF O;  5C12 A;  4FWQ A;  5JMV A;  1KXP A;  1HKC A;  2V51 B;  3LDO A;  2AA4 A;  2JWL A;  2KKZ A;  4CD3 A;  1ZC6 A;  1H1V A;  4I6M B;  3VPZ A;  2IVO A;  3WXI A;  4BC3 A;  5C2D A;  1M1K O;  4FWP A;  5LJW A;  5LJV A;  3N4Q A;  3A8Y A;  2WC9 A;  3EZW A;  3H3N O;  3SBT A;  4FPA A;  3QB0 A;  4AF1 A;  3LM2 A;  1C0F A;  1ATS A;  4H0O A;  3KWI A;  4ISG A;  5DM6 L;  3FR0 A;  2NNW A;  3CJ7 A;  4J8F A;  1HLU A;  4DKW A;  5CE3 A;  5JLF A;  4M7X A;  4JKD A;  3L4I A;  5ADX A;  2HBJ A;  3FE1 A;  2CGJ A;  4FSV A;  1T6C A;  3H3O B;  4EHT A;  3CQX A;  1VQ4 N;  1X3M A;  2CH6 A;  2VYP A;  3CJC A;  3RVC A;  2Q31 A;  3CI5 A;  5BN9 A;  1VQP N;  3VGL A;  5FPE A;  1V4S A;  5GAG P;  3AGK A;  2PFU A;  4BRO A;  2QWQ A;  5AFU A;  2QW9 A;  4PL7 A;  1XQS C;  1WOQ A;  1T3V A;  4H0P A;  4IZ9 A;  3CCJ N;  4YDU C;  1BO5 O;  5C15 A;  3CCV N;  3HM8 A;  3J7Z O;  2F9T A;  2YHW A;  3IFR A;  3M3Z A;  4JK9 A;  2NRR A;  3DXM A;  4MDB A;  3PIO L;  3CPW M;  3MMV A;  1Q81 O;  4Y0W A;  3O6W A;  2D0P A;  3O08 A;  3EE9 A;  4B1W B;  4OO1 J;  4BRM A;  2YJE A;  4YOU A;  2D0O A;  3DAW A;  2NRT A;  3O1B A;  4BRI A;  5M1Q A;  4B1X B;  2QWO A;  3H1Q A;  4H5R A;  4A5B A;  2I7N A;  5CHI A;  2E88 A;  1YAG A;  5BRF A;  4H5W A;  4BC4 A;  3QFU A;  1YF5 L;  2VCP A;  4FWO A;  3G4S N;  4CD1 A;  4AM6 A;  1G99 A;  2V7Y A;  5AQX A;  4DB3 A;  1SQK A;  2P9K B;  3LDL A;  4BGB A;  4BRQ A;  1YUW A;  2E8A A;  2P9U A;  3L0Q A;  4GV6 A;  4U67 L;  1DGK N;  5BR9 A;  4H0V B;  4H5V A;  2P9S A;  4IJA A;  2JWK A;  3TTF A;  2YJF A;  3HRG A;  3VF6 A;  3GG4 A;  1E4F T;  3DLL L;  3CJ9 A;  2P9L A;  3A5O C;  3WUH A;  4MO5 A;  4FPB A;  4IJN A;  1QZ6 A;  5AQP A;  5B8H A;  5TKY A;  5MLC Q;  5M1O A;  4H0T B;  1YI2 N;  4PKI A;  2PAV A;  3O9U A;  3U4L A;  3NVM A;  1W97 L;  3CC2 N;  4UY8 O;  1NWK A;  3IDH A;  4A2B A;  1HX1 A;  3C65 A;  1GLC G;  1QQM A;  2CGL A;  5CR4 A;  4MO4 A;  4IFE A;  2QTD A;  3CIP A;  5GAH P;  1MWM A;  3QBW A;  5GIO A;  3H1V X;  3OW2 M;  5I9E B;  4G9Z A;  1Z05 A;  3I33 A;  4CBW A;  1EQY A;  1GLB G;  3O9R A;  4XEI A;  5M1P A;  3SMS A;  3TSQ A;  2NRH A;  5ADX H;  3SAG A;  1QVF M;  3PLA A;  4ILG B;  1NJI O;  2QM1 A;  3GBT A;  4CZI A;  3NVK A;  1QQN A;  4IXC A;  2VGN A;  1Q82 O;  3ULE A;  4JEP A;  5HOO A;  3MDQ A;  3S41 A;  1BU6 O;  1P8Z A;  3IKM A;  4RCH A;  3ENH A;  5AFU H;  3HZ6 A;  2NRV A;  2HBM A;  3ENO A;  3R8E A;  4BR5 A;  5F0X A;  4NO7 A;  4CZL A;  2YCH A;  4A5A A;  3VEX A;  3PIP L;  2KLA A;  5AZI B;  3CJA A;  4F9O A;  3MX2 A;  2QI2 A;  4CZK A;  1VQ8 N;  5FPN A;  2OTL N;  2ZJR L;  2A40 A;  5C10 A;  1ATN A;  2QXL A;  4BRL A;  3QFP A;  4BG9 A;  4E1J A;  3G71 N;  4WQ5 C;  4BRE A;  1NGD A;  4CZE A;  3QBX A;  4BRH A;  3FGU A;  4FO0 A;  1R59 O;  3O9S A;  3VOV A;  3D7E O;  1VQ6 N;  4BGA A;  3CJB A;  1SZ2 A;  4DCH A;  3E66 A;  3VEZ A;  4JN4 A;  3I56 N;  4FL9 A;  4YOX A;  3HOS A;  2YI1 A;  5AQN A;  2WFB A;  1GLA G;  3P31 A;  3ULE B;  2FSJ A;  4XH5 A;  1YVN A;  3CCR N;  1BA1 A;  3M6G A;  5F2R A;  2E1Y A;  2FSN A;  4B9Q A;  3AAQ A;  5AQK A;  3AAP A;  4C23 A;  3R6M A;  3F5T A;  3CPE A;  3R1X A;  2P9I B;  4FWK A;  4QS9 A;  4YOR A;  5EOY A;  3T7Z A;  2ZGY A;  2F9W A;  3ID6 A;  3VF2 A;  5TKW A;  1NGF A;  1DEJ A;  2A3Z A;  2P9K A;  3E1Y A;  3WT0 A;  1T44 A;  2HMP A;  3BEX A;  1RGI A;  4XH1 A;  3ZYY X;  3C7N B;  2GTD A;  3MN7 A;  4JNE A;  1Q18 A;  4KBO A;  4U7B A;  3O8M A;  1JCE A;  3CET A;  5GAD P;  5BRE A;  3ATU A;  3VET A;  3VGK A;  4LC9 B;  5BN8 A;  2RE2 A;  4BRA A;  4H03 B;  2VWB A;  5EY4 A;  4BR9 A;  2P9P B;  1VQ5 N;  1OKJ A;  3D2F B;  4PHT X;  3P39 A;  2IIR A;  1NGE A;  5FPD A;  4M63 C;  1HUX A;  1M90 O;  4WFB L;  1XUP O;  4KH5 A;  4PKH A;  1BA0 A;  3VEN A;  3KVG A;  4CZM A;  2J4R A;  3L6Q A;  3BF1 A;  2QWN A;  4YOY A;  1NBW A;  1KAZ A;  4O8K A;  3LDN A;  3O9T A;  4CZH A;  4FOI A;  5AQV A;  2HBL A;  3IUC A;  4Z94 A;  2GWJ A;  3OHR A;  2BUP A;  3CHW A;  3VMF B;  2BH1 A;  5AQI A;  5AQH A;  5EX5 A;  3CJ1 A;  1Q86 O;  3VEO A;  3ZET B;  2QWM A;  4ILH A;  4ILJ A;  4EHU A;  2Q36 A;  5AZJ B;  1YJW N;  1VQ9 N;  3F2K A;  4CI6 A;  3I8B A;  1NMD A;  5E84 A;  3DXK B;  3MK6 A;  3ZX2 A;  1YIJ N;  5BRH A;  1TUY A;  2OAN A;  3UKU A;  4BRC A;  4JAX A;  4BY9 C;  3KK7 A;  4BC5 A;  5F1X A;  4BRF A;  4JHD B;  2HOE A;  1QHA A;  3D2E B;  1RFQ A;  4BQZ A;  3VGM A;  3MWT A;  5AZI A;  4JK8 A;  1K8A O;  3QDK A;  4CZG A;  4GNI A;  3LDQ A;  3H46 O;  5AQY A;  2ZJQ L;  4BRK A;  3KHY A;  3A5M C;  3VEV A;  4JKA A;  5M1F A;  3H6E A;  1YJ9 N;  4OPH A;  4JK7 A;  2BTF A;  2QWR A;  2NLX A;  4JKG B;  3WXL A;  3OBY A;  5JLH A;  5H1S Q;  1Y64 A;  5JVG L;  4BQL A;  3CXC M;  3DJC A;  4H0X B;  2QEX N;  3A0I X;  1KQS M;  3L4Q A;  2HBK A;  4HTL A;  2E2P A;  3SBG A;  1NGA A;  2A42 A;  4BRD A;  4BR0 A;  1NGG A;  1ESV A;  1VQO N;  3E9P A;  3MN6 A;  3TTD A;  1NGH A;  2Q97 A;  5GAE P;  4BR7 A;  2Q0U A;  2HF4 A;  1NGI A;  5EXW A;  4MLH A;  5M1N A;  2E2O A;  4KH4 A;  3I55 N;  1YHQ N;  4A62 A;  3UKU B;  4JKC A;  3SLC A;  5HL7 L;  3BF3 A;  1NGJ A;  3UKR B;  5BPN A;  3ZEU B;  2HF3 A;  3SJH A;  3HSC A;  2P9I A;  4JKE A;  2ASP A;  1K73 O;  5AQT A;  1KC8 O;  3ATV A;  4O5F A;  4JKF A;  5JIC A;  5AQQ A;  1V4T A;  5AQF A;  4GY2 B;  4XH4 A;  3UE5 A;  3C7N A;  3K9K A;  4BG8 A;  1HKB A;  3E9L A;  1X9J A;  4FOE A;  1VAZ A;  3WQU A;  2QWL A;  3AAR A;  5M1K A;  4C1N K;  2W40 A;  3HTV A;  4IDH A;  2PBD A;  3FZH A;  2W41 A;  3FZM A;  3ID8 A;  3E9O A;  4FWR A;  4IEE A;  3LL3 A;  3EN9 A;  3O1W A;  4H5N A;  2P9P A;  1IG8 A;  5BPM A;  1ILY A;  3O5B A;  3ZX0 A;  3D2F A;  3MWP A;  3JS6 A;  3P38 A;  1DKG D;  4RTF D;  3GL1 A;  4BRG A;  2E2Q A;  3AY9 A;  3VEY A;  5AQM A;  4WF9 L;  4B1Y B;  5JVH L;  4MLE A;  1GLE G;  3SAF A;  2OTJ N;  3SK3 A;  3WEE B;  2UYT A;  2FLO A;  1NGC A;  2A41 A;  4H0Y B;  3GE1 A;  3ZX3 A;  4B1U B;  3MX5 A;  2FF3 B;  5E26 A;  4FVU A;  3HI0 A;  4B1V A;  3FFK B;  3SAH A;  4CBX A;  4EIA A;  5KQD A;  4JD2 B;  2ZF5 O;  2YHY A;  4CBU A;  3WXK A;  1MA9 B;  4WFA L;  3R3L A;  1ZBS A;  3ZET A;  1S3X A;  2NZT A;  3EE8 A;  4BVO A;  3SMP A;  2V7Z A;  5KPZ A;  4ISE A;  3VEW A;  5AZJ A;  2HST A;  3M1F A;  3O4W A;  1BUP A;  1QQO A;  1KAY A;  1NLV A;  2E20 A;  4GV3 A;  4R79 A;  3DXK A;  5GIN A;  2I7P A;  1E4G T;  2D4W A;  4WQ4 A;  3R9P A;  1JJ2 M;  4GVE A;  2F7T A;  1ZXO A;  3C6H A;  4BC2 A;  3MN5 A;  4WYB A;  5AQZ A;  2NRZ A;  4AM7 A;  4BRN A;  1J6Z A;  2GWK A;  3H45 C;  3MCA B;  4ISF A;  3NMU A;  2P9N B;  4JHD A;  3D2E A;  3KWG A;  2ZGZ A;  5BRD A;  5GIP A;  3U9D A;  3W3D A;  1VQ7 N;  3CC7 N;  1U2V B;  3IMX A;  2CH5 A;  1O13 A;  1JCF A;  4IEI A;  5AQW A;  2E1Z A;  3GDQ A;  1KD1 O;  2YX6 A;  3G25 A;  3DWL A;  1HPM A;  2E2N A;  4YOV A;  3N4P A;  1MDU B;  2D1K A;  1VQM N;  1U6Z A;  2CGK A;  4PKG A;  2FSK A;  3VTH A;  4WFN L;  4EFH A;  4JKG A;  3HBT A;  3O9Q A;  1K8K B;  2IVN A;  5AQS A;  1HKG A;  5KQ8 A;  3CCS N;  2FXU A;  2GX9 A;  5DM7 L;  3AGR A;  3LM9 A;  3U9Z A;  1BOT O;  3D6R A;  4H5T A;  5FPM A;  1S72 N;  1VQK N;  4FWL A;  3CC4 N;  3EKS A;  1TYQ B;  3M5R A;  1LCU A;  5EVZ A;  2ZWH A;  2H3G X;  2A5X A;  5LY3 A;  3MN9 A;  4NB4 A;  4YOW A;  4NLC A;  2ITM A;  1OVY A;  1SAZ A;  4YOT A;  4DQ8 A;  4IOC L;  4C1N I;  4K43 A;  3C0B A;  3B8A X;  3VTI A;  2DPN A;  5AQL A;  1RDW X;  3CQY A;  3UKR A;  3ZEU A;  3F9M A;  3K9J A;  3LDP A;  1GLL O;  4NLB A;  5KPT A;  4A2A A;  2GUP A;  3CCU N;  3FZK A;  3CCQ N;  3UB5 A;  1Q7Y O;  3JXU A;  3W0L A;  3TPQ A;  2FF6 A;  3O80 A;  1TUU A;  3TSP A;  3VES A;  1NGB A;  4BVP A;  4BR2 A;  4WQ4 C;  1Z6R A;  2V52 B;  2EWS A;  3RSE A;  1BG3 A;  4CJ7 A;  4A59 A;  1T6D A;  2AP1 A;  2YHX A;  4MDA A;  1N8R O;  2QWP A;  2QA4 N;  4QS7 A;  5AQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...