4BRIA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg umppnp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 117
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4briA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4briA02
1DKGD 4O8KA 3ZETA 4GNIA 1U6ZA 2I7NA 2P9SB 4QS8A 4ISFA 3H1QA 4H03B 3F9MA 3H1VX 4H5RA 3WQUA 3UKUA 4BQZA 4CZGA 3VGKA 4CJ7A 4FWKA 5AQQA 1T6CA 2A41A 1QZ5A 3VERA 3SMSA 3QBXA 2BTFA 3QMLA 2ITMA 3SJHA 3O1WA 1YXQA 3H46O 2A3ZA 4C23A 1S22A 1HPMA 2PAVA 3EN9A 3HM8A 4FWNA 5EVZA 2A5XA 4BRIA 2Q31A 4EHUA 5EXWA 1GLAG 3ENOA 4BRDA 4JD2A 5AQFA 4NO7A 3GE1A 3AARA 5KPRA 4HTLA 2F9TA 3FFKB 4BG8A 3ULEA 4H5NA 4BRPA 2P9LB 1C0FA 1MWMA 1SAZA 3UKRA 2GUPA 2UYTA 2E88A 3R8EA 2E1ZA 3WXJA 2ZF5O 4K42A 1TUUA 5B8HA 3IFRA 2E2QA 3VEVA 2A6AA 4IWVA 1ATNA 1QQOA 2FSNA 3DXKB 1RFQA 4IO8A 4QS9A 1K8KB 1EQYA 4IJAA 4A2BA 4WQ4A 1SQKA 3VEYA 4BR7A 2P9IA 2J4RA 3RSEA 3IUCA 3FE1A 5AQZA 2FF3B 3QICA 1R59O 3MDQA 1H1VA 5FPMA 3VGLA 3W0LA 1U2VA 3D2FA 4EIAA 1T6DA 1NGCA 3FZLA 1BO5O 1X9JA 4WYBA 3I8BA 2FXUA 1LOTB 5AQSA 2QM1A 3ZETB 2IVPA 5AQUA 4KBOA 1NGBA 5JMVA 2QW9A 4L3QA 3SK3A 2DPNA 1HKCA 3CERA 2AP1A 4IJNA 4B1UB 1KAYA 3G25A 1DGKN 4JN4A 5ADXA 2A42A 4NB4A 1NGAA 1NMDA 4BRMA 1SZ2A 4FWLA 4BR5A 4FWRA 3WXKA 1WUAA 3VF6A 2GELA 3JS6A 4WQ5C 3HTVA 4EFHA 1E4FT 4B1YB 4RTFD 4BC3A 4BRLA 3GOIA 1NGGA 2VWBA 1HKBA 2CGKA 1YVNA 4M7XA 1GLFO 1XC3A 1Q18A 4WQ5A 5BR9A 1ZXOA 3O4WA 4RCHA 5AFUH 2IIRA 3BUZB 3WXLA 5AQXA 2NRHA 2Q36A 4DQ8A 3MN5A 1NGFA 1HLUA 3D2EB 5AQJA 4DCHA 4BQLA 2F9WA 5KQDA 4B9QA 3CJ7A 3BEXA 1J6ZA 3ID8A 3FZKA 1GLBG 4B1XB 5JLHA 3UB5A 5AFUA 2YCHA 4IXCA 2V52B 4AM6A 4BRQA 4B1WB 2P9NA 2ASPA 1KAXA 4YDUC 2P9KB 4M7YA 3SLCA 2YI1A 2FSKA 3EL2A 4FWMA 5F1XA 5AQPA 3DXMB 2NZTA 3MN6A 2QWQA 2FF6A 2GWKA 3ZEUA 4J8FA 4A62A 3GL1A 3CJAA 3R9PA 2YHYA 1GLJO 3LM9A 4WQ4C 5AQYA 4CBUA 4Z94A 3GG4A 2QWMA 2QWOA 3L6QA 1RGIA 3BF3A 2HF3A 3KHYA 4FWPA 5BN9A 4BRCA 3O80A 3LM2A 5KQ8A 5AQKA 2P9UA 4XH5A 3CJBA 5AZJB 3P4IA 1QHAA 3C7NA 1LCUA 2P9NB 4LC9B 2NLXA 3MN7A 5FPNA 3ULEB 5JICA 1ESVA 2HF4A 2QWRA 5BRDA 3U9DA 4O5FA 2V51B 4GY2B 1NGDA 1NBWA 3H45C 4B1ZA 4BRHA 2QWNA 4BREA 3D2EA 2FLOA 3DXKA 3LDLA 4QS7A 3B8AX 1JCGA 1Y64A 5BRHA 2V7YA 3A8YA 2E2NA 4CZFA 4BC2A 1NM1A 2V7ZA 2W41A 5BREA 1BU6O 1QZ6A 3H3OB 5BN8A 5AQVA 3CETA 1T44A 1G99A 3ATUA 1X3MA 3VESA 4H0XB 5FPEA 1XUPO 3DXMA 4BVOA 4B1VA 2YJEA 1U2VB 4FSVA 4H5VA 2EWSA 4BRFA 3O8MA 4FOIA 1NGEA 4H0VB 4IZ9A 2E2PA 1E4GT 1JCFA 4FWOA 5AQWA 3VETA 1HUXA 4PL7A 1JCEA 2P9IB 4H5WA 2CH6A 5JLFA 3VOVA 5AQOA 1NGJA 3QB0A 1HKGA 2A40A 1HJOA 5LJVA 4JHDB 3C0BA 1NLVA 5EOYA 3U8XA 3DWLA 4CI6A 4BRNA 2Q0UA 3WXIA 3L0QA 3A5LC 5AQTA 4F9OA 3H3NO 4PKHA 3VF4A 3J8AA 4H0PA 5BRFA 2P9SA 1BA0A 4ISGA 4E1JA 3O1BA 4CD1A 4BRAA 3ZX3A 1RDWX 2QWLA 3EKUA 3OHRA 3UKRB 5AQIA 2P9LA 3A0IX 3MCPA 4H0TB 2YJFA 4CBWA 2FSJA 3GBTA 1Z6RA 3AAQA 1IJJA 3HSCA 2E1YA 3O6WA 2IVNA 5AQRA 4CZLA 5ADXH 1KXPA 1ZBSA 2CH5A 5E84A 4BR2A 5I9EB 3AY9A 4BG9A 2P9KA 4BC5A 2OANA 4FPAA 3S41A 1BUPA 4RWTA 3RSEB 2D1KA 4CZKA 4BGAA 2E20A 1V4SA 3MMVA 5LY3A 1DEJA 1K8KA 2Q97A 3UKUB 5F2RA 1OKJA 2QXLA 1ATSA 5EY4A 1BOTO 5AZIB 2ASOA 2IVOA 3BF1A 3QFUA 2W40A 4XH1A 3VEOA 1MWKA 3EZWA 1BA1A 3VENA 5AZJA 5AQMA 3WEEA 2CGLA 3IMXA 1TYQB 4BRKA 4CZEA 3ZX0A 1X3NA 2E8AA 1CZAN 2KHOA 3U9ZA 4BR4A 1P8ZA 1MA9B 2D4WA 4H5TA 1KAZA 2YHWA 3MK6A 5AQLA 2Q1NA 4BROA 1IG8A 3WQTA 2ZGZA 1C0GA 3FGUA 3EKSA 3FZMA 5KPTA 3M1FA 4A61A 1HX1A 2YHXA 3HI0A 3BP8A 2P9PB 3LDQA 1YUWA 3A5NC 1XQSC 3VEZA 3QDKA 3DJCA 4H0OA 4CZJA 3CQXA 2ASMA 5ELZA 2HOEA 5EX5A 3LDOA 3KVGA 3WEEB 5AQHA 4ISEA 2VCPA 3FZFA 4HWIA 2GEMA 4K25A 4YDUA 4EHTA 1GLCG 2Q0RA 2P9UB 3R6MA 4I6MB 5FPDA 1GLLO 3CJCA 4XH4A 3L4IA 3IDHA 4PKIA 5BPLA 3C7NB 3TU5A 2VYPA 1V4TA 1ZC6A 3HBTA 3A5MC 3CJ1A 5E26A 3M3ZA 4MO4A 3FR0A 5TKYA 4K41A 4CBXA 5BPNA 1YAGA 3ENHA 4BR0A 1D4XA 5AR0A 4BRGA 3M6GA 2P9PA 3LDPA 2BUPA 4CZHA 3ATVA 5BPMA 3HZ6A 3LDNA 2I7PA 3CI5A 2AA4A 1NGHA 4CZMA 2HMPA 3VPZA 3VF2A 2PBDA 2Q2RA 3GDQA 3FLCO 2CGJA 3O08A 4FWQA 3MN9A 3SMPA 3CHWA 1ATRA 3ZX2A 3QBWA 4BGBA 4FPBA 4FWSA 3VEXA 4PL8A 2ZWHA 1BDGA 2H3GX 5F0XA 2QWPA 3KZBA 3D7EO 1Z05A 1GLDG 3AAPA 1S3XA 3VGMA 3ZEUB 4DB3A 2WUSA 4JD2B 4M63C 4BC4A 3VEWA 4CZIA 4A2AA 4DHYA 1TUYA 4MO5A 1NGIA 5KPZA 4Y0WA 2D0PA 1BG3A 3D2FB 5AZIA 4CD3A 1BWFO 3JXUA 4AM7A 3FZHA 3H6EA 3CJ9A 1TYQA 3TPQA 3WT0A 3CIPA 3QFPA 3EO3A 3A5OC 3WUHA 4JHDA 1GLEG 3DAWA 4XEIA 4FL9A 3U4LA 5CE3A 1NWKA 1QQMA 4I6MA 5AQGA 4BVPA 4PKGA 3I33A 1QQNA 2GWJA 4MLHA 4BR9A 2D0OA 3UE5A 3W3DA 3O5BA 2ZGYA 4JAXA 2GTDA 3CQYA 4FO0A 4H0YB 4K43A 4EAHD 4JNEA 4MLEA 1WOQA 5LJWA 1MDUB 3LL3A 4FOEA 5AQNA 2E2OA
chains in the Genus database with same CATH superfamily
3CFPA 3ZETA 3SNNA 4GNIA 2P9SB 4QS8A 5C42A 3PX4A 5BR8K 1TKTA 1BL3A 4KHWA 1T6CA 1VAZA 3SMSA 4OPKA 1LAVA 2Z1IA 2BTFA 2XHBA 3NGYA 3K57A 3OA9A 4DV0K 1WBDA 1YHQN 1YXQA 4C23A 4IKFA 2O8FA 3EN9A 1GLAG 1IG9A 5AQFA 4NO7A 1FXXA 3AARA 5KPRA 1BI4A 4N41A 3OW2M 1IKYA 3M5RA 2P9LB 1MWMA 1SAZA 3UKRA 1TVRA 2E88A 3R8EA 4B9SA 4FJNA 3PSFA 4N56A 1TUUA 3I56N 2O8BB 1L3TA 2E2QA 3VEVA 3V1OA 2A6AA 4X65K 3DXKB 4IO8A 1RFQA 3TWHA 4IJAA 3THXA 4WQ4A 1NMNA 3FE1A 1XMQK 1A5XA 1R59O 1H1VA 4IEEA 3VGLA 3J7ZO 3OTOK 4O4GA 1T6DA 1NGCA 1X9JA 1KVBA 1W7AA 3L2UA 1VQ6N 4B3OA 1IKWA 1T03A 2P5GA 5AQUA 4I7FA 4KBOA 4BY9C 2DPNA 3CERA 4B1UB 4F3OA 4LFBK 1KAYA 3E9LA 4JN4A 3VMFB 5ADXA 1KLMA 2A42A 4ZTJA 1J9AA 1NMDA 3K58A 4E7LA 2QK9A 4ILJA 4CEQA 3BZKA 1UA1A 4DV6K 3C6HA 1W2BM 4NXNK 3GOIA 2X74A 4A57A 3DLEA 1NJIO 4JK9A 2HHSA 1NGGA 1HKBA 3SBTA 4CJUA 4LF7K 1LWEA 3IAYA 5KRSA 1E3MA 3L2QA 4KREA 3ZSWA 2UXBK 4KI6A 2DY4A 3MN5A 4W5OA 1RTDA 3OYIA 5KQDA 3CJ7A 4B9TA 2F7TA 1GLBG 1VQ4N 1XC9A 4B1XB 4DQRA 3JAMO 2X78A 5DMRA 1L5UA 4IXCA 4BRQA 1EXQA 4B1WB 1Q7YO 2ASPA 2HHWA 4M7YA 3VTHA 4XIUA 3AGRA 2FSKA 4KHNA 1YF5L 4FWMA 4ELVA 1ZBHA 3VQ5A 2OPQA 5AQPA 4CK3A 4MQ3A 4OX9K 2KW4A 3O9UA 5C10A 1DLOA 2QWQA 2WC9A 2YNFA 3ZEUA 3PIPL 1FW6A 3CJAA 1FK9A 3WXMB 2YHYA 4CVNE 3GG4A 1VHXA 3LAMA 5CZ1A 4DV5K 1RCHA 5BN9A 1HNXK 3OBWA 3LM2A 4YHHK 3MXMA 2KQ2A 4XH5A 4JS5A 4DSJA 1QHAA 2IC3A 3SPZA 4I9LA 3MN7A 3Q7BA 3T7ZA 3ULEB 1HQEA 1C1CA 1LV5A 4F2RA 2QWRA 3CQ8A 1U4BA 2GUIA 4W5RA 4MDBA 1N32K 3QEPA 4IFEA 3BY5A 3H45C 4BRHA 4CEZA 2FLOA 3LP0A 4JK8A 5LMUK 3G0ZA 1JCGA 1Y64A 2V7YA 3A8YA 2HHQA 4R79A 1EKEA 2OPPA 3QETA 3WNGA 1S1XA 1ZBFA 3AA5X 1ASWA 4AH9A 3NH0A 5AQVA 1KSPA 4FJLA 3CETA 1BISA 3VQEA 3LZJA 4O8UA 5M1KA 2YNHA 1W0HA 5FPEA 1XUPO 2VQFK 2YJEA 1U2VB 4KKOA 4H5VA 2XRIA 1JCFA 3VETA 1NKBA 1BIZA 1VQPN 2P9IB 4JRQA 1S6PA 3HVTA 3MX5A 1YJ9N 4K0KK 4DKWA 1N5YA 3VTIA 5FRNA 5HROA 1HKGA 1HJOA 5GIOA 1WBBA 1XNQK 3A5LC 5LL6Z 3VF4A 4H0PA 1TK0A 2P9SA 3OYMA 2B5JA 4BRAA 4DG1A 4CF0A 4EP4A 3UKRB 3KK1A 4J2EA 3P5JA 4CGIA 4BE0A 1N33K 4OJRA 4LF6K 3A0IX 2YJFA 1Z6RA 1VQ9N 1LW0A 2E1YA 4C1NK 2PYJA 2YKNA 2GX9A 1KXPA 4BACA 3HP9A 2CH5A 4DSLA 3I0RA 4E7JA 4C8NA 3K9KA 1BUPA 4RWTA 4V19S 1BI4B 1V4SA 3CD6N 3OYGA 1KRPA 4CF1A 1Q86O 1ATSA 5H1SQ 4FM2A 4XH1A 5KRTA 3OJSA 3VEOA 3VENA 5AZJA 5AQMA 3WEEA 4L8RB 1N6QA 4BRKA 3IMXA 4PQUA 3QESA 3HOTA 3AVNA 1CZAN 4DTNA 5C25A 3T1HK 1NK0A 1P8ZA 3MAQA 1BCMA 4DTSA 4U7BA 3WQTA 3FGUA 3AVMA 3EKSA 3SAHA 3CC2N 1JL2A 2BDPA 1VSFA 4FLZA 2JGUA 2YV0X 2F4VK 3ID6A 3HI0A 3CCJN 1C1AA 4CHNA 1YUWA 3A5NC 3VEZA 4GV9A 3HL8A 3U6FA 3QDKA 2X6NA 3AVCA 3N4QA 4H0OA 2RHKA 2W42A 1I94K 2ASMA 3THWB 3WEEB 5AQHA 4CHQA 2VCPA 3FZFA 4YDUA 2P9UB 1KFDA 4I6MB 3NGZA 3OVNA 3ZSRA 4AHSA 3E01A 1QTMA 2PFUA 3PV8A 3M8RA 2D5RA 1ZC6A 1RT1A 3CJ1A 4W5TA 2GV9A 5I3UA 5TKYA 4CBXA 1VQ7N 1U49A 3OYLA 3PO5A 4DQIA 1U04A 3M6GA 1TL3A 4Z4HA 2BUPA 4CZHA 4FLUA 4KAZA 3MWTA 4CZMA 3CI5A 4NCAA 1NGHA 1JXBA 3VPZA 1Q9YA 3MEEA 3SMPA 4FLVA 1D9FA 3HT3A 2PZSA 3VEXA 4PL8A 2H3GX 3AAPA 4OVLA 2HVHA 1S3XA 4PHTX 4JD2B 4M63C 2UU9K 3JSMA 5HRSA 3V9XA 3KKRA 4DHYA 3NF7A 1TUYA 4MO5A 1NGIA 3L4QA 4Y0WA 4B08A 4DV7K 1OH7A 5AZIA 3SCXA 1CZBA 4CEDA 3CJ9A 1SV5A 1A5WA 3TPQA 3EO3A 4WFAL 4O0IA 3ENBA 2NRWA 5GIPA 3LAKA 1HPZA 4I6MA 3T1YK 3I33A 4BR9A 2GWJA 4HCCA 2DFEA 3PIOL 3W3DA 4CFDA 5M1PA 2ZGYA 4K43A 4FO0A 1YTAA 4ID5A 3TARA 5HRPA 2A1RA 4CJLA 3O4QA 2G8HA 2W6KA 1T7PA 4O8KA 4R5PA 4HHTA 2D0CA 1BQMA 4ISFA 3ZSXA 4DR4K 4H5RA 4OPAA 3NVMA 4CZGA 3VGKA 4CJ7A 3AVJA 4FWKA 5AQQA 4KFBA 4CHOA 1JLBA 4JS4A 2B4JA 1YT3A 2A3ZA 4CJSA 1HYVA 4CIFA 1ASVA 1S9GA 2VG6A 4FWNA 2A5XA 4BRIA 4LH4A 4EHUA 1FKPA 3ENOA 4BRDA 2ZQBA 1Y97A 4GW6A 1KCFA 1VQKN 4HTLA 4CK2A 4BG8A 5C15A 4X66K 2GUPA 2KZMA 4DV2K 3AO2A 2E1ZA 3WXJA 2ZF5O 4K42A 3QEXA 5KGWA 2UUAK 3SJJA 4Q0BA 4LSLA 1ATNA 5C2DA 2FSNA 1VRUA 3ISNC 1EQYA 2O8DB 1RBSA 4BR7A 3CCQN 3L3VA 1XHXA 3MDQA 4ID1A 4DR5K 3W0LA 4OLBA 4Q5VA 1BO5O 4WYBA 3VQBA 4FW2A 2W6LA 4FZXC 1W9HA 5JMVA 2OTJN 4B9MA 5J1EA 4DV4K 4FVUA 1DGKN 1JLAA 4CECA 3DLLL 2RKIA 1NK9A 1HQUA 3WXKA 2O4IA 4OPHA 1WUAA 4Z0UA 3VF6A 4WQ5C 4E7IA 3S3OA 1E4FT 4C8KA 4RTFD 4F8RA 5K14A 3TSQA 1TGOA 5M1NA 1VSMA 1K9MO 2PY5A 2CGKA 1RTJA 4M7XA 2KLAA 5M1FA 1C0UA 1XC3A 4WQ5A 5BR9A 4OLAA 3BUZB 3LPUA 1FKOA 3WXLA 4CESA 2NRHA 4FYDA 3OJUA 3D2EB 4CJ3A 3OYJA 5AQJA 3S9HA 4DCHA 3AVHA 4BQLA 4LFCK 1T05A 3DYAA 3BEXA 2XY7A 4MFBA 1J6ZA 1TAQA 3C6TA 4M3ZA 3CPWM 3UB5A 5AFUA 3O9RA 1WAJA 3RMCA 2P9NA 2P9KB 3UIQA 1EWQA 1VQMN 3T69A 2OCEA 1T8EA 2YNIA 4O5BA 5J2QA 3D45A 1KLNA 3HJFA 2NZTA 3MN6A 2HNZA 3V9SA 4J8FA 4JI1K 4DLGA 3SPYA 1JLCA 2UXDK 4CEAA 4HVJA 4WQ4C 1TV6A 3RWUA 4DWIA 3PY8A 2HF3A 4BWJA 3KHYA 1KTQA 4E7HA 1ASUA 3ASMA 5KQ8A 1ITGA 5JVGL 2VGMA 1WLJA 3CJBA 2P9NB 5JICA 1NOYA 4FJKA 3U9DA 3KLFA 2V51B 3DI6A 4GY2B 4IDKA 5J2PA 1HR0K 2O8BA 2OTLN 3K5MA 4LFAK 4B1ZA 1RT5A 4CGHA 4BREA 3CG7A 3D2EA 3DXKA 4QS7A 3KWGA 3HPOA 5BRHA 1REVA 1M90O 4ILHA 4JKDA 1NM1A 3LZIA 3H3OB 1S1UA 1XMOK 4LSNA 4CGJA 1IBKK 3CM5A 3VESA 3SZ2A 4JI5K 1RTIA 1MU2A 3NAEA 4WFNL 2DFHA 3KK7A 4FSVA 5GAHP 3CMAN 2EWSA 4CFCA 4IZ9A 2QKKA 3DOLA 5AQWA 3IRXA 2KFZA 2G8FA 2CH6A 4C8MA 4NYNA 4GVMA 3KKSA 1NGJA 3QB0A 4JKCA 4A5AA 4DTXA 3B6PA 5LJVA 1Q9XA 3P83D 3C0BA 3QINA 4JKBA 2YKMA 3QIOA 1IO2A 4F9OA 4FJMA 1IKXA 3VQCA 5BRFA 4W5NA 4IFVA 3HPGA 1K8AO 3ZX3A 1HNIA 3EKUA 2UUCK 5AQIA 4PWDA 3GBTA 3KD5E 3OYBA 1JLFA 1EP4A 3N4PA 3P39A 2P5OA 3O6WA 1ZBSA 4B3TK 1KD1O 5E84A 4CJPA 2P1JA 2BGGA 3EEQA 3WNFA 2OZSA 2D1KA 2EX3A 5I42A 3M8PA 2NUBA 2BE2A 4KB0A 5LY3A 2RE2A 4DTRA 2F96A 5F2RA 4NLBA 4AHVA 3CMEN 2W40A 4YOVA 3V9WA 3THVA 1BA1A 3K2PA 3AO3A 4CHPA 4FLXA 2CGLA 4CERA 1TYQB 1RTHA 1X3NA 3OYNA 2ZD1A 4BR4A 1VQ8N 3SUQA 3KLHA 2YHWA 3MK6A 5AQLA 5KGXA 4KO0A 1IG8A 3HVRA 2BANA 1C0GA 4CIEA 5GAGP 1IV0A 4PY5A 1BHLA 4KTZA 3CF5L 2HVIA 4OGEA 1RNHA 3BP8A 3SI6A 3LDQA 4O55A 2VG7A 4DTJA 1N36K 3DJCA 1B9FA 3LANA 4CZJA 4FK0A 2HB5A 3RMDA 4DTOA 4B8AB 1OVYA 1VRTA 3LDOA 3ITHA 2OPSA 4YY3K 4B9LA 1BGXT 4IO9L 3RRHA 1GLCG 4EZ9A 3CYMA 3R6MA 1CLQA 2EHGA 4E1NA 3OYCA 5FPDA 3CJCA 2WFBA 3CCEN 2IGIA 3C7NB 1SS6A 3HBTA 3A5MC 3M3ZA 4MO4A 5BPNA 4G1QA 1NK8A 1YAGA 3NGIA 4LF8K 1D4XA 5AR0A 4KH4A 1B9DA 2B6AA 3G10A 4Y1DA 3CCRN 2KKZA 3LDPA 2AA4A 1JJ2M 3GDQA 3AVIA 2CGJA 4AHCA 4BDPA 1WSHA 4IFYA 3MXIA 4B3MK 3ZX2A 4E3SA 3K5NA 3QEWA 4JKFA 3QBWA 2X6SA 1TKDA 4Z4EA 4CFBA 1BDGA 2QWPA 3D7EO 3ZEUB 1Z05A 3I0SA 1N8RO 4M3WA 4GVEA 1VQNN 1LWFA 3SQ2A 3VEWA 4DU1A 5C12A 4A2AA 3HYFA 1QE1A 5M1QA 1WN7A 3TR8A 3J7AP 4J2BA 3D2FB 1RT3A 3CM6A 2HHHK 2Q3SA 4PUOA 3SUOA 3FZHA 4AILC 3WT0A 3DM2A 3CIPA 3QFPA 3K0SA 3WUHA 4DR7K 4XEIA 3SQ0A 3OYFA 4DV1K 4JKGA 4NXMK 4MLHA 2O8CB 4EAHD 5DM7L 4JNEA 3F9KA 2I5JA 1MDUB 2HHTA 3TTCA 4BE2A 4CHZA 1JLEA 3VQ6A 4C8OA 1DKGD 4GV6A 1WSGA 2QI2A 2FBYA 1U6ZA 2IDOA 4OPJA 3H1QA 4G9ZA 5IWAK 3H1VX 3OY9A 3UKUA 2O8EB 3THWA 2A41A 5M1OA 3I55N 3OS0A 2UXCK 1VSEA 3QBXA 1YVUA 3AVGA 4NCGA 4NLCA 4Z4IA 2ITMA 3KWIA 2JWLA 3O1WA 3H46O 1NOZA 1HPMA 2PAVA 2OYQA 4KH6A 2G8WA 2Q31A 1RBVA 3QIPA 1VQLN 1X9WA 3OYKA 3LWLA 3HO1A 4C8LA 4KB1A 3KLEA 3GE1A 1C0TA 2IAJA 4DSFA 4RW4A 3FFKB 1G15A 4LH5A 2G8KA 4H5NA 4YOTA 4H8KA 4BE1A 4DR1K 2UYTA 5HLFA 2HBJA 2HBKA 4DTUA 5HBMA 3O3GA 4DTMA 1YITN 4IG3A 3IFRA 4IWVA 1QQOA 1K8KB 4FK2A 4A2BA 4NCBA 2P9IA 4IDHA 3C6AA 5AQZA 2FF3B 3RR7A 1HYZA 3WNHA 5CZ2A 1SL2A 2UUBK 1U2VA 1VSHA 5C24A 3TAEA 4EIAA 1QVGM 3AO1A 3FZLA 3DMJA 3I8BA 3MX2A 3TAFA 1LOTB 5AQSA 1C0MA 4CFAA 2WOMA 4H4MA 4WFBL 3ZETB 2IVPA 1NGBA 3SK3A 4CJ4A 4IJNA 4DFPA 1A5VA 1VQON 3U3YA 1S1WA 5CHIA 4CEEA 4NB4A 4AHTA 4BR5A 3I8DA 4AHRA 1C6VA 1GOBA 2GELA 4LF5K 3LWMA 1HRHA 3LDSA 2IOCA 5C2FA 1UOCA 4DS5A 3QEVA 2BH1A 1WNSA 3MXJA 2VWBA 3M8QA 2E4LA 4JEPA 5J2MA 4X64K 4JI7K 1EX4A 4DUYK 1Q18A 1HNWK 1ZXOA 3O4WA 4RCHA 1RDDA 3CPEA 5AQXA 4Z4GA 1VSKA 3IG1A 4FLWA 2Q36A 1RDCA 4DQ8A 2Z1HA 1YTUA 4B9QA 4OO1J 4PA1A 4DFMA 3V4IA 5JLHA 2FBXA 3G71N 1WSEA 3PSIA 4IOCL 2YCHA 4AM6A 3NE6A 4YDUC 3SV4A 2DFFA 2XY5A 2HBMA 3HM9A 3EL2A 3PO4A 5F1XA 3LP3A 4DU3A 2NRTA 4K8XA 4HTUA 2VGNA 2GWKA 3R3LA 3AVAA 2WONA 4A62A 3GL1A 2QKBA 4WCEL 2G8VA 3MCAB 5HP1A 1GLJO 3VQ7A 5FLXO 3P38A 4LY7A 5A2QO 1EO1A 2QWMA 2QWOA 4CJFA 3L6QA 4JI8K 4FWPA 4BRCA 4QCLA 3SYZA 4RW7A 1NNEA 4GV3A 4F3TA 2P51A 2P9UA 3AVLA 4WF9L 1JLQA 3CFOA 3LPTA 3EE9A 5AZJB 3SQ4A 1EWRA 3P4IA 4B3SK 4JRPA 1LCUA 2NLXA 5FPNA 3O3HA 2QTDA 4DR3K 1ESVA 1SKRA 3AO4A 1VK0A 1TL1A 4O5FA 2JLEA 1NGDA 1NBWA 2R7YA 3VQDA 2QWNA 3LDLA 2QA4N 1GOAA 4FZYA 1S1VA 1J5EK 2E2NA 4CZFA 4BC2A 1L3UA 4CK1A 3NDKA 2V7ZA 5BREA 1BU6O 3AA2A 3AVBA 3J80O 4H4OA 3VN5A 4FCYA 3KJVA 3P1GA 2E5LK 4FOIA 4QAGA 4H0VB 2ZJRL 4IBNA 1IH7A 4FWOA 1S72N 3TAMA 3THXB 1YJNN 4CW7B 2RN2A 4CGFA 1JCEA 3TAGA 4H5WA 5JLFA 4DQQA 4JHDB 2VQEK 3QEIA 5EOYA 3U8XA 3DWLA 2VWJA 4BRNA 3WXIA 4CEFA 5AQTA 3H3NO 3ZCMA 4JI0K 4PKHA 2F8SA 2WBNA 2O8EA 3NF9A 1BA0A 5CR4A 4E1JA 4KHPK 3O1BA 3L8BA 5HOOA 4KTWA 2QWLA 3OHRA 4CF2A 2QEXN 3PLAA 2HNDA 3MCPA 4CBWA 2FSJA 1IJJA 4HUEA 3V9UA 3HSCA 4CCHA 4RG8A 2IVNA 3FFIA 4CZLA 3A2FA 3LALA 1BCOA 4M45A 3SV3A 4BR2A 2QXFA 5I9EB 4DF4A 1HMVA 3EE8A 1IKVA 2P9KA 2ZJQL 3V6DA 4DSEA 3RSEB 3K5LA 2ITGA 3PX0A 2HSTA 1ZYQA 2E20A 1KQSM 3O9TA 4J2AA 2Q97A 1P90A 1OKJA 1QHTA 3RR8A 2QXLA 3VQPA 5EY4A 1BOTO 2ASOA 2IVOA 2FBVA 2LSNA 1MWKA 3EZWA 3L2RA 1D9DA 1RT6A 3G6EN 1FJGK 1VSDA 4AQYK 4FZZA 5HRNA 5T7BA 4TSXA 3EY1A 1KAZA 4ELUA 2Q1NA 3HRGA 1X9SA 2ZGZA 1X9MA 1TK8A 5KPTA 4KV8A 1HX1A 1CXQA 3ZT0A 5HRRA 4BWMA 5J2NA 1KFSA 1VSJA 1SKSA 1TKXA 1EETA 4B9NA 1SL0A 1QQCA 1XQSC 4DS4A 1Q8IA 4GKJK 4KI4A 4DLEA 3OBYA 3NH2A 4NYFA 1Z26A 4E89A 1SUQA 3F73A 4CJKA 5EX5A 3KVGA 1NJZA 4I2QA 3BZCA 4ISEA 1JL1A 1J5OA 4HWIA 3RTVA 3NCIA 4EHTA 2Q0RA 3Q7CA 4KHYA 3IDHA 2NRRA 5BPLA 3TU5A 2G8UA 3AV9A 3ZSQA 3CXCM 3RVCA 2F8TA 4Y1CA 3FR0A 1NK4A 4K41A 3OS2A 2YNGA 1DTQA 1T3VA 4M42A 3HZ6A 3LDNA 2I7PA 1L3VA 3DOKA 3VF2A 1QSSA 2PBDA 3L3UA 4DF8A 2PYLA 4UQGA 4M3UA 1CXUA 2HHUA 1ILYA 4FWSA 1M1KO 2ZWHA 1XNRK 1SL1A 5F0XA 4DB3A 3VGMA 3K9JA 4LD0A 1NKEA 3QO9A 4GMJB 2WUSA 3E9OA 3HOSA 3S3MA 4M3TA 4I9QA 4BC4A 4CZIA 3VA0A 1J54A 4RW8A 1RT4A 3VQ8A 4OKJA 2XO7A 3D6RA 1BWFO 3JXUA 3MEDA 3KD1E 1WSJA 3G4SN 3H6EA 3NMUA 3MWPA 1TYQA 4CHYA 1WSFA 3A5OC 4JHDA 1GLEG 5TKWA 4CJRA 3DRPA 4FL9A 3U4LA 1RBTA 4HUGA 1O1WA 4BVPA 1QQMA 3CFRA 4PKGA 1Z25A 3UE5A 4JKEA 1WB9A 4JAXA 2GTDA 3CQYA 4F4KA 2KFNA 4MLEA 3CCLN 5AJ3K 1WOQA 4OGCA 3LL3A 1UA0A 4FOEA 2A1SA 3P31A 1JLGA 2XY8A 4Z4FA 2D0BA 2E2OA 1R0AA 1TAUA 2I7NA 4CGGA 4FW1A 3SUPA 3S3NA 2AJQA 4H03B 3F9MA 2D0AA 3WQUA 2E6LA 3SAFA 3J7YP 4BQZA 3HXMA 4FJ7A 1QZ5A 2YHAA 3VERA 3QNNA 2RPIA 1LWCA 4CJEA 1RT2A 3QMLA 3V81A 3SJHA 3DLKA 3RMBA 3O4NA 4MDAA 1S22A 3J81O 3HM8A 5EVZA 4KHQA 5EXWA 4BDYA 3NFAA 3CC7N 4JD2A 3CCUN 2JWKA 3KTQA 4B9VA 2NNWA 2OA8A 4B9UA 2F9TA 4YOYA 4JI3K 1OH8A 4FK4A 4FVMA 4CJVA 3ULEA 4BRPA 1C1BA 1C0FA 3T3FA 3ZSVA 4DV3K 4N76A 1NK6A 4AF1A 4OKEA 3OYEA 5B8HA 4FJGA 3AVFA 4DSKA 1UAXA 3TAPA 2FBTA 4QS9A 1VSLA 3CCSN 5FROA 2HMIA 1GOCA 1BIUA 1SQKA 3VEYA 3AGKA 5GADP 2J4RA 3RSEA 3DLGA 3IUCA 3QICA 1OH5A 4FJHA 5FPMA 4FJ5A 4DTPA 3VQQA 1XWLA 3D2FA 3CC4N 1RDBA 4FJ9A 1RBUA 1HNZK 4KPYA 4UY8O 5DM6L 4HUFA 4BDZA 2HHVA 1QSLA 2Z1JA 1XI1A 2FXUA 5C0YA 2QM1A 2YX6A 3DLBA 1U48A 5JVHL 2QW9A 4L3QA 3T19A 1HKCA 3TAQA 2AP1A 3NF8A 3G25A 3ZLJA 1X1PA 1LAWA 1RDUA 3ZYYX 1NGAA 3K5OA 4BRMA 1SZ2A 3O9SA 4FWLA 2O4GA 4FWRA 4KHSA 1KC8O 3VQ9A 3JS6A 1OH6A 3E9PA 3HTVA 4EFHA 5DK5A 4B1YB 3HK2A 4BC3A 4CF9A 4BRLA 4CE9A 1J53A 1DTTA 4KH5A 4KHUA 5E41A 1YVNA 2VWKA 4YFUA 1NJXA 3IS9A 1UWBA 4IEIA 1L3SA 5GAEP 1GLFO 3BDPA 4O44A 5AFUH 2IIRA 1S9EA 1NK7A 4YORA 1NGFA 1HLUA 3ULDA 3SBGA 3EYZA 4E19A 3KK2A 2F9WA 1Q81O 4E7KA 3HSTB 4FJ8A 3TSUA 3ID8A 3FZKA 3D0PA 5IT9O 2Y1JA 1D8YA 3PUFA 2V52B 3ZT1A 1KAXA 4DFJA 3OYDA 3SLCA 2YI1A 4M3YA 1IBLK 4DMNA 3DXMB 2FF6A 3C95A 4JV5K 3R9PA 4JK7A 4JI2K 3LM9A 4CJQA 5AQYA 2YHBA 5CYMA 4CBUA 4B3RK 3AA3A 4Z94A 3E1YA 1RGIA 3BF3A 1NU0A 3V1QA 5LMNK 1KVAA 3T1AA 3VA3A 3O80A 1VSIA 3MECA 1NJYA 5AQKA 1ZBIA 1S5JA 3MEGA 4K8ZA 4DR2K 3QLHA 3NHGA 2O8FB 3C7NA 4LC9B 2HNYA 1QSYA 4A5BA 2HF4A 3WNEA 5BRDA 4DQSA 4JLHA 2ZJPL 3KLIA 1I3AA 2HW3A 5MLCQ 4IOAL 2E6MA 1QS4A 3AA4A 1W97L 3B8AX 3ZSOA 1OVQA 3ZSZA 3TANA 3TTFA 3TTDA 4EP5A 4YOXA 2NRVA 2W41A 1WAFA 4M41A 1QZ6A 5BN8A 3QNOA 4DFKA 2ZM6K 3C6UA 2O8DA 1K73O 1T44A 1G99A 3B6OA 1N34K 3ATUA 1X3MA 3ZT4A 4H0XB 1YI2N 3NH1A 1LW2A 3KLGA 4DR6K 3DXMA 4BVOA 2DTUA 4FLTA 4B1VA 3DRSA 1WSIA 4FJJA 4BRFA 3O8MA 1NGEA 2E2PA 1E4GT 3CCVN 3E66A 1HUXA 3TSPA 4FLYA 5EU7A 4PL7A 5KTQA 1U47A 4CGDA 4RW9A 4EZ6A 4KTQA 3VOVA 4WE1A 5AQOA 2HHXA 4ILGB 1VQ5N 4DQPA 2KZZA 4YNQA 2A40A 1RDAA 4JKAA 3HP6A 1NLVA 4CI6A 5SWMA 2OPRA 2Q0UA 3L0QA 1HYSA 1QVFM 3U3GA 1D5AA 1TKZA 3DRRA 3J8AA 4OKKA 4JI4K 2KTQA 3PX6A 4ISGA 4CD1A 4RW6A 1RDWX 2FC0A 2XY6A 1S1TA 4Z4CA 4ICLA 3NVKA 2P9LA 4H0TB 3NBPA 5GINA 3AAQA 2O8CA 4HCBA 4IG0A 4E1MA 3SUNA 5AQRA 5ADXH 3L2WA 4N47A 4YOWA 1I39A 1RT7A 3LP2A 3KIOA 4U67L 1O13A 3AY9A 3H08A 4BG9A 3M8SA 3V9ZA 2NRXA 4BC5A 1NG9A 2OANA 3JYTA 4FPAA 3KK3A 4FM0A 3QERA 3S41A 2ZE2A 3VQ4A 4CZKA 4BGAA 4FJXA 3MMVA 1DEJA 1K8KA 2ETJA 2OZMA 4KRFA 3UKUB 3VQAA 3ZT2A 5AZIB 5FDLA 3BF1A 3QFUA 3ALYA 4JKGB 4O0JA 5JS2A 4CZEA 3ZX0A 1RBRA 2E8AA 2KHOA 3U9ZA 4QOZB 4JKHA 2ATQA 2D4WA 1MA9B 2VG5A 4H5TA 4JI6K 4CEOA 4BROA 4CIGA 4CJTA 2Z1GA 1SKWA 1XHZA 3FZMA 4M3XA 2NRZA 4FM1A 3M1FA 4A61A 3OS1A 3C65A 3TI0A 2YHXA 1KVCA 3O3FA 2P9PB 3THYA 4DU4A 1K6YA 3ZT3A 4FJIA 3L2VA 3ZSYA 5KI6A 1S6QA 3NF6A 3CQXA 5ELZA 5FRMA 3SAGA 4CEBA 2HOEA 4X62K 3LP1A 4DSIA 2IS3A 3AO5A 2GBZA 2GEMA 4K25A 2G8IA 5CY4A 3OYHA 3AVKA 1B92A 1TK5A 1GLLO 1NK5A 4XH4A 3L4IA 4ZTFA 4PKIA 4ELTA 1DT9A 4LF9K 2VYPA 1V4TA 1RILA 5E26A 3ENHA 4YOUA 4ZHRA 4BR0A 4BRGA 2RF2A 1F21A 4N5SA 4E0DA 2P9PA 3THYB 3RRGA 3C94A 3ATVA 4IOXA 5BPMA 1YJWN 2HMPA 1HJRA 3TABA 4FXDA 2Q2RA 4CF8A 3FLCO 1NJWA 3O08A 4FWQA 3MN9A 1NKCA 1JXEA 3CHWA 5HL7L 1ATRA 4CJ5A 1JKHA 3BGRA 4W5QA 1BQNA 4DUZK 2Y1IA 4BGBA 1CZ9A 4FPBA 3R1XA 3DLRA 5JS1A 1U45A 3KZBA 1ZBLA 4J2DA 1GLDG 1HNVA 4F2SA 4CJWA 5D3GA 3IKMA 3V1RA 4M3RA 4C1NI 5KPZA 1YIJN 4A59A 3HPHA 4AHUA 2D0PA 1BG3A 2WTUA 3CCMN 5SZTA 1ZBUA 4I2PA 3O9QA 4CD3A 3EZ5A 3DLHA 1IBMK 4AM7A 4B8CA 3SQ1A 2HBLA 3F5TA 3DAWA 4GKKK 4LF4K 3RMAA 5CE3A 3K59A 1NWKA 5AQGA 1QQNA 1Q82O 2D0OA 5CYQA 3O5BA 4H0YB 5LJWA 4JYAK 3F2KA 3OYAA 5AQNA
chains in the Genus database with same CATH topology
1DKGD 4O8KA 4GV6A 2QI2A 3ZETA 4GNIA 1U6ZA 2I7NA 2P9SB 4QS8A 4ISFA 3H1QA 4G9ZA 4H03B 3F9MA 3H1VX 4H5RA 4OPAA 3NVMA 3WQUA 3SAFA 3UKUA 4BQZA 4CZGA 3VGKA 4CJ7A 4FWKA 5AQQA 1T6CA 2A41A 5M1OA 1QZ5A 3I55N 1VAZA 3VERA 3SMSA 3QBXA 2BTFA 3OA9A 4NLCA 3QMLA 2ITMA 3KWIA 2JWLA 3SJHA 3O1WA 1YHQN 1YXQA 3H46O 2A3ZA 4C23A 4MDAA 1S22A 1HPMA 2PAVA 3EN9A 3HM8A 4FWNA 4KH6A 5EVZA 2A5XA 4BRIA 2Q31A 4EHUA 5EXWA 1VQLN 1GLAG 3ENOA 4BRDA 3CC7N 4JD2A 5AQFA 3CCUN 4NO7A 3GE1A 2JWKA 3AARA 1VQKN 2NNWA 5KPRA 4HTLA 2F9TA 3FFKB 4YOYA 3OW2M 4BG8A 3ULEA 4H5NA 3M5RA 2P9LB 4BRPA 5C15A 1C0FA 1MWMA 4YOTA 1SAZA 3UKRA 2GUPA 2UYTA 2HBJA 2E88A 3R8EA 2E1ZA 2HBKA 3WXJA 4AF1A 2ZF5O 4K42A 1TUUA 3I56N 5B8HA 1YITN 3IFRA 2E2QA 3VEVA 2A6AA 4IWVA 1ATNA 1QQOA 2FSNA 3DXKB 1RFQA 4IO8A 4QS9A 5C2DA 3CCSN 1K8KB 1EQYA 4IJAA 4A2BA 4WQ4A 1SQKA 3VEYA 4BR7A 3CCQN 2P9IA 4IDHA 3C6AA 3AGKA 5GADP 2J4RA 3RSEA 3IUCA 3FE1A 5AQZA 2FF3B 3QICA 1R59O 3MDQA 1H1VA 4IEEA 5FPMA 3VGLA 3W0LA 3J7ZO 1U2VA 3D2FA 4EIAA 3CC4N 1QVGM 1T6DA 1NGCA 3FZLA 5DM6L 1BO5O 1X9JA 4WYBA 4UY8O 3I8BA 3MX2A 1VQ6N 2FXUA 5C0YA 1LOTB 5AQSA 2QM1A 4WFBL 3ZETB 2IVPA 5AQUA 4KBOA 1NGBA 5JMVA 2YX6A 2OTJN 5JVHL 2QW9A 4L3QA 3SK3A 4FVUA 4BY9C 2DPNA 1HKCA 3CERA 2AP1A 4IJNA 4B1UB 1KAYA 3E9LA 3G25A 1DGKN 4JN4A 3VMFB 5ADXA 5CHIA 1VQON 2A42A 1RDUA 4NB4A 3ZYYX 1NGAA 3DLLL 1NMDA 4BRMA 1SZ2A 3O9SA 4FWLA 4BR5A 4ILJA 4FWRA 3WXKA 1KC8O 4OPHA 1WUAA 3VF6A 2GELA 3JS6A 4WQ5C 3E9PA 3HTVA 4EFHA 1E4FT 3C6HA 4B1YB 4RTFD 4BC3A 5C2FA 1W2BM 4BRLA 3GOIA 3TSQA 4A57A 2BH1A 5M1NA 1NJIO 4JK9A 4KH5A 1NGGA 2VWBA 1HKBA 1K9MO 2CGKA 3SBTA 1YVNA 4M7XA 2KLAA 4JEPA 4IEIA 5M1FA 5GAEP 1GLFO 1XC3A 1Q18A 4WQ5A 5BR9A 1ZXOA 3O4WA 4RCHA 5AFUH 2IIRA 3BUZB 3CPEA 5AQXA 3WXLA 2NRHA 2Q36A 4YORA 4DQ8A 3MN5A 1NGFA 1HLUA 3SBGA 3D2EB 5AQJA 4DCHA 4BQLA 2F9WA 5KQDA 1Q81O 4B9QA 3CJ7A 3BEXA 4OO1J 2F7TA 1J6ZA 3ID8A 3FZKA 3TSUA 1GLBG 1VQ4N 4B1XB 5JLHA 3CPWM 3UB5A 5AFUA 3O9RA 3G71N 4IOCL 2YCHA 4IXCA 2V52B 4AM6A 4BRQA 4B1WB 2P9NA 1Q7YO 2ASPA 1KAXA 4YDUC 2P9KB 1VQMN 4M7YA 3SLCA 3VTHA 3T69A 2HBMA 2YI1A 3AGRA 2FSKA 1YF5L 3EL2A 4FWMA 5F1XA 5AQPA 3DXMB 2NZTA 3MN6A 2NRTA 3O9UA 5C10A 2QWQA 2VGNA 2WC9A 2FF6A 2GWKA 3R3LA 3ZEUA 4J8FA 4A62A 3CJAA 3GL1A 3PIPL 4WCEL 3R9PA 3WXMB 3MCAB 4JK7A 2YHYA 1GLJO 3LM9A 4WQ4C 5AQYA 4CBUA 3P38A 4Z94A 3GG4A 1EO1A 2QWMA 3E1YA 2QWOA 3L6QA 1RGIA 3BF3A 2HF3A 3KHYA 4FWPA 5BN9A 4BRCA 3OBWA 3O80A 3LM2A 5KQ8A 5JVGL 4GV3A 5AQKA 2P9UA 2VGMA 4WF9L 4XH5A 3EE9A 3CJBA 5AZJB 3P4IA 1QHAA 3C7NA 1LCUA 2P9NB 4LC9B 2NLXA 3MN7A 3Q7BA 5FPNA 3T7ZA 3ULEB 4A5BA 2QTDA 5JICA 1ESVA 2HF4A 2QWRA 5BRDA 3U9DA 4O5FA 4MDBA 2V51B 4GY2B 2ZJPL 4IFEA 1NGDA 1NBWA 2OTLN 3H45C 4B1ZA 4BRHA 2QWNA 4BREA 5MLCQ 3D2EA 2FLOA 3DXKA 4IOAL 3LDLA 2QA4N 4JK8A 3KWGA 4QS7A 1W97L 3B8AX 1JCGA 1Y64A 5BRHA 2V7YA 3A8YA 1M90O 4ILHA 3TTFA 4R79A 3TTDA 2E2NA 4CZFA 4BC2A 4JKDA 4YOXA 2NRVA 1NM1A 2V7ZA 2W41A 5BREA 1BU6O 1QZ6A 3H3OB 5BN8A 5AQVA 3CETA 1K73O 1T44A 1G99A 4O8UA 5M1KA 3ATUA 1X3MA 3VESA 4H0XB 1YI2N 5FPEA 1XUPO 3DXMA 4BVOA 4B1VA 4WFNL 3KK7A 2YJEA 1U2VB 4FSVA 5GAHP 3CMAN 4H5VA 2EWSA 4BRFA 3O8MA 4FOIA 1NGEA 4H0VB 4IZ9A 2ZJRL 2E2PA 1E4GT 3CCVN 1JCFA 4FWOA 5AQWA 3E66A 3VETA 1HUXA 1S72N 3TSPA 1YJNN 1VQPN 4PL7A 1JCEA 2P9IB 4H5WA 2CH6A 3MX5A 5JLFA 1YJ9N 3VOVA 5AQOA 4ILGB 1NGJA 4DKWA 3QB0A 4JKCA 4A5AA 3VTIA 1VQ5N 1HKGA 2A40A 1HJOA 4JKAA 5GIOA 5LJVA 4JHDB 3C0BA 1NLVA 5EOYA 3U8XA 3DWLA 4CI6A 4JKBA 2Q0UA 3WXIA 3L0QA 4BRNA 3A5LC 5AQTA 4F9OA 3H3NO 1QVFM 4PKHA 3VF4A 3J8AA 4H0PA 5BRFA 2WBNA 2P9SA 1BA0A 5CR4A 4ISGA 4E1JA 1K8AO 3O1BA 4CD1A 5HOOA 4BRAA 3ZX3A 1RDWX 2QWLA 3EKUA 3OHRA 3UKRB 2QEXN 3PLAA 3NVKA 5AQIA 2P9LA 3A0IX 3MCPA 4H0TB 2YJFA 5GINA 4CBWA 2FSJA 3GBTA 1Z6RA 3AAQA 1VQ9N 1IJJA 3HSCA 2E1YA 4C1NK 3N4PA 3P39A 3O6WA 2IVNA 5AQRA 4CZLA 5ADXH 4YOWA 2GX9A 1KXPA 1ZBSA 1KD1O 2CH5A 4U67L 5E84A 4BR2A 4DB3A 1O13A 5I9EB 3AY9A 4BG9A 3EE8A 2P9KA 2NRXA 4BC5A 2OANA 2ZJQL 4FPAA 3K9KA 3S41A 1BUPA 4RWTA 3RSEB 2D1KA 4CZKA 4BGAA 2HSTA 1KQSM 2E20A 1V4SA 3MMVA 5H1SQ 3CD6N 3O9TA 5LY3A 1DEJA 1K8KA 2Q97A 2RE2A 1P90A 3UKUB 5F2RA 1OKJA 4NLBA 2QXLA 1Q86O 1ATSA 5EY4A 1BOTO 5AZIB 2ASOA 2IVOA 3BF1A 3QFUA 2W40A 4XH1A 3CMEN 3VEOA 4JKGB 4YOVA 1MWKA 3EZWA 1BA1A 3VENA 5AZJA 5AQMA 3WEEA 2CGLA 3IMXA 1TYQB 4BRKA 4CZEA 3G6EN 3ZX0A 3HOTA 1X3NA 2E8AA 1CZAN 2KHOA 3U9ZA 4BR4A 1VQ8N 4JKHA 1P8ZA 1MA9B 2D4WA 4H5TA 1KAZA 2YHWA 3MK6A 5AQLA 2Q1NA 4BROA 1IG8A 4U7BA 3HRGA 3WQTA 2ZGZA 1C0GA 3FGUA 3EKSA 5GAGP 3FZMA 3SAHA 3CC2N 3CF5L 2NRZA 5KPTA 3M1FA 4A61A 1HX1A 3C65A 2YHXA 3ID6A 3HI0A 3BP8A 2P9PB 3CCJN 3LDQA 1YUWA 3A5NC 1XQSC 3VEZA 4GV9A 3OBYA 3QDKA 3DJCA 3N4QA 4H0OA 2RHKA 4CZJA 3CQXA 2ASMA 5ELZA 3SAGA 2HOEA 5EX5A 1OVYA 3KVGA 3LDOA 3WEEB 5AQHA 4ISEA 2VCPA 3FZFA 4HWIA 2GEMA 4K25A 4YDUA 4IO9L 4EHTA 1GLCG 2Q0RA 2P9UB 3R6MA 3Q7CA 4I6MB 5FPDA 1GLLO 2PFUA 2WFBA 3CJCA 3IDHA 3L4IA 4XH4A 3CCEN 2NRRA 4PKIA 1DT9A 5BPLA 3C7NB 3TU5A 2VYPA 1SS6A 1V4TA 1ZC6A 3HBTA 3A5MC 3CJ1A 5E26A 3CXCM 3M3ZA 4MO4A 3RVCA 3FR0A 5TKYA 4K41A 4CBXA 5BPNA 1VQ7N 1YAGA 3ENHA 4YOUA 4BR0A 1D4XA 5AR0A 4BRGA 4KH4A 1Q82O 3M6GA 1T3VA 2P9PA 3CCRN 2KKZA 3LDPA 2BUPA 4CZHA 3ATVA 4IOXA 5BPMA 1YJWN 3HZ6A 3MWTA 3LDNA 2I7PA 3CI5A 2AA4A 1NGHA 4CZMA 2HMPA 3VPZA 3VF2A 1JJ2M 2PBDA 2Q2RA 3GDQA 3FLCO 2CGJA 3O08A 4FWQA 3MN9A 3SMPA 3CHWA 5HL7L 1ATRA 3ZX2A 4JKFA 3QBWA 4BGBA 4FPBA 1ILYA 4FWSA 3VEXA 3R1XA 2ZWHA 4PL8A 1BDGA 2H3GX 1M1KO 5F0XA 2QWPA 3AAPA 3D7EO 1Z05A 1GLDG 3KZBA 1S3XA 3K9JA 3VGMA 3ZEUB 4GVEA 1N8RO 1VQNN 2WUSA 3E9OA 4PHTX 4JD2B 4M63C 3HOSA 4BC4A 3IKMA 3VEWA 5C12A 4CZIA 4A2AA 5M1QA 4C1NI 4DHYA 1TUYA 4MO5A 1NGIA 4A59A 5KPZA 1YIJN 3L4QA 4Y0WA 3D6RA 2D0PA 1BG3A 3D2FB 5AZIA 3CCMN 4CD3A 1BWFO 3O9QA 3JXUA 4AM7A 3G4SN 3FZHA 3H6EA 3CJ9A 2HBLA 3MWPA 3NMUA 1TYQA 3TPQA 3WT0A 3CIPA 3QFPA 3EO3A 3A5OC 3WUHA 3F5TA 4WFAL 3ENBA 4JHDA 1GLEG 3DAWA 2NRWA 5TKWA 4XEIA 5GIPA 4FL9A 3U4LA 5CE3A 1NWKA 1QQMA 4I6MA 4JKGA 5AQGA 4PKGA 4BVPA 3I33A 1QQNA 2GWJA 4MLHA 4BR9A 2D0OA 3UE5A 4JKEA 3W3DA 3PIOL 3O5BA 5M1PA 2ZGYA 4JAXA 2GTDA 3CQYA 4FO0A 4H0YB 4K43A 4EAHD 4JNEA 4MLEA 5DM7L 3CCLN 1WOQA 5LJWA 1MDUB 3LL3A 3F2KA 4FOEA 3P31A 3TTCA 5AQNA 2E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DKG D;  4O8K A;  3ZET A;  4GNI A;  1U6Z A;  2I7N A;  2P9S B;  4QS8 A;  4ISF A;  3H1Q A;  4H03 B;  3F9M A;  3H1V X;  4H5R A;  3WQU A;  3UKU A;  4BQZ A;  4CZG A;  3VGK A;  4CJ7 A;  4FWK A;  5AQQ A;  1T6C A;  2A41 A;  1QZ5 A;  3VER A;  3SMS A;  3QBX A;  2BTF A;  3QML A;  2ITM A;  3SJH A;  3O1W A;  1YXQ A;  3H46 O;  2A3Z A;  4C23 A;  1S22 A;  1HPM A;  2PAV A;  3EN9 A;  3HM8 A;  4FWN A;  5EVZ A;  2A5X A;  4BRI A;  2Q31 A;  4EHU A;  5EXW A;  1GLA G;  3ENO A;  4BRD A;  4JD2 A;  5AQF A;  4NO7 A;  3GE1 A;  3AAR A;  5KPR A;  4HTL A;  2F9T A;  3FFK B;  4BG8 A;  3ULE A;  4H5N A;  4BRP A;  2P9L B;  1C0F A;  1MWM A;  1SAZ A;  3UKR A;  2GUP A;  2UYT A;  2E88 A;  3R8E A;  2E1Z A;  3WXJ A;  2ZF5 O;  4K42 A;  1TUU A;  5B8H A;  3IFR A;  2E2Q A;  3VEV A;  2A6A A;  4IWV A;  1ATN A;  1QQO A;  2FSN A;  3DXK B;  1RFQ A;  4IO8 A;  4QS9 A;  1K8K B;  1EQY A;  4IJA A;  4A2B A;  4WQ4 A;  1SQK A;  3VEY A;  4BR7 A;  2P9I A;  2J4R A;  3RSE A;  3IUC A;  3FE1 A;  5AQZ A;  2FF3 B;  3QIC A;  1R59 O;  3MDQ A;  1H1V A;  5FPM A;  3VGL A;  3W0L A;  1U2V A;  3D2F A;  4EIA A;  1T6D A;  1NGC A;  3FZL A;  1BO5 O;  1X9J A;  4WYB A;  3I8B A;  2FXU A;  1LOT B;  5AQS A;  2QM1 A;  3ZET B;  2IVP A;  5AQU A;  4KBO A;  1NGB A;  5JMV A;  2QW9 A;  4L3Q A;  3SK3 A;  2DPN A;  1HKC A;  3CER A;  2AP1 A;  4IJN A;  4B1U B;  1KAY A;  3G25 A;  1DGK N;  4JN4 A;  5ADX A;  2A42 A;  4NB4 A;  1NGA A;  1NMD A;  4BRM A;  1SZ2 A;  4FWL A;  4BR5 A;  4FWR A;  3WXK A;  1WUA A;  3VF6 A;  2GEL A;  3JS6 A;  4WQ5 C;  3HTV A;  4EFH A;  1E4F T;  4B1Y B;  4RTF D;  4BC3 A;  4BRL A;  3GOI A;  1NGG A;  2VWB A;  1HKB A;  2CGK A;  1YVN A;  4M7X A;  1GLF O;  1XC3 A;  1Q18 A;  4WQ5 A;  5BR9 A;  1ZXO A;  3O4W A;  4RCH A;  5AFU H;  2IIR A;  3BUZ B;  3WXL A;  5AQX A;  2NRH A;  2Q36 A;  4DQ8 A;  3MN5 A;  1NGF A;  1HLU A;  3D2E B;  5AQJ A;  4DCH A;  4BQL A;  2F9W A;  5KQD A;  4B9Q A;  3CJ7 A;  3BEX A;  1J6Z A;  3ID8 A;  3FZK A;  1GLB G;  4B1X B;  5JLH A;  3UB5 A;  5AFU A;  2YCH A;  4IXC A;  2V52 B;  4AM6 A;  4BRQ A;  4B1W B;  2P9N A;  2ASP A;  1KAX A;  4YDU C;  2P9K B;  4M7Y A;  3SLC A;  2YI1 A;  2FSK A;  3EL2 A;  4FWM A;  5F1X A;  5AQP A;  3DXM B;  2NZT A;  3MN6 A;  2QWQ A;  2FF6 A;  2GWK A;  3ZEU A;  4J8F A;  4A62 A;  3GL1 A;  3CJA A;  3R9P A;  2YHY A;  1GLJ O;  3LM9 A;  4WQ4 C;  5AQY A;  4CBU A;  4Z94 A;  3GG4 A;  2QWM A;  2QWO A;  3L6Q A;  1RGI A;  3BF3 A;  2HF3 A;  3KHY A;  4FWP A;  5BN9 A;  4BRC A;  3O80 A;  3LM2 A;  5KQ8 A;  5AQK A;  2P9U A;  4XH5 A;  3CJB A;  5AZJ B;  3P4I A;  1QHA A;  3C7N A;  1LCU A;  2P9N B;  4LC9 B;  2NLX A;  3MN7 A;  5FPN A;  3ULE B;  5JIC A;  1ESV A;  2HF4 A;  2QWR A;  5BRD A;  3U9D A;  4O5F A;  2V51 B;  4GY2 B;  1NGD A;  1NBW A;  3H45 C;  4B1Z A;  4BRH A;  2QWN A;  4BRE A;  3D2E A;  2FLO A;  3DXK A;  3LDL A;  4QS7 A;  3B8A X;  1JCG A;  1Y64 A;  5BRH A;  2V7Y A;  3A8Y A;  2E2N A;  4CZF A;  4BC2 A;  1NM1 A;  2V7Z A;  2W41 A;  5BRE A;  1BU6 O;  1QZ6 A;  3H3O B;  5BN8 A;  5AQV A;  3CET A;  1T44 A;  1G99 A;  3ATU A;  1X3M A;  3VES A;  4H0X B;  5FPE A;  1XUP O;  3DXM A;  4BVO A;  4B1V A;  2YJE A;  1U2V B;  4FSV A;  4H5V A;  2EWS A;  4BRF A;  3O8M A;  4FOI A;  1NGE A;  4H0V B;  4IZ9 A;  2E2P A;  1E4G T;  1JCF A;  4FWO A;  5AQW A;  3VET A;  1HUX A;  4PL7 A;  1JCE A;  2P9I B;  4H5W A;  2CH6 A;  5JLF A;  3VOV A;  5AQO A;  1NGJ A;  3QB0 A;  1HKG A;  2A40 A;  1HJO A;  5LJV A;  4JHD B;  3C0B A;  1NLV A;  5EOY A;  3U8X A;  3DWL A;  4CI6 A;  4BRN A;  2Q0U A;  3WXI A;  3L0Q A;  3A5L C;  5AQT A;  4F9O A;  3H3N O;  4PKH A;  3VF4 A;  3J8A A;  4H0P A;  5BRF A;  2P9S A;  1BA0 A;  4ISG A;  4E1J A;  3O1B A;  4CD1 A;  4BRA A;  3ZX3 A;  1RDW X;  2QWL A;  3EKU A;  3OHR A;  3UKR B;  5AQI A;  2P9L A;  3A0I X;  3MCP A;  4H0T B;  2YJF A;  4CBW A;  2FSJ A;  3GBT A;  1Z6R A;  3AAQ A;  1IJJ A;  3HSC A;  2E1Y A;  3O6W A;  2IVN A;  5AQR A;  4CZL A;  5ADX H;  1KXP A;  1ZBS A;  2CH5 A;  5E84 A;  4BR2 A;  5I9E B;  3AY9 A;  4BG9 A;  2P9K A;  4BC5 A;  2OAN A;  4FPA A;  3S41 A;  1BUP A;  4RWT A;  3RSE B;  2D1K A;  4CZK A;  4BGA A;  2E20 A;  1V4S A;  3MMV A;  5LY3 A;  1DEJ A;  1K8K A;  2Q97 A;  3UKU B;  5F2R A;  1OKJ A;  2QXL A;  1ATS A;  5EY4 A;  1BOT O;  5AZI B;  2ASO A;  2IVO A;  3BF1 A;  3QFU A;  2W40 A;  4XH1 A;  3VEO A;  1MWK A;  3EZW A;  1BA1 A;  3VEN A;  5AZJ A;  5AQM A;  3WEE A;  2CGL A;  3IMX A;  1TYQ B;  4BRK A;  4CZE A;  3ZX0 A;  1X3N A;  2E8A A;  1CZA N;  2KHO A;  3U9Z A;  4BR4 A;  1P8Z A;  1MA9 B;  2D4W A;  4H5T A;  1KAZ A;  2YHW A;  3MK6 A;  5AQL A;  2Q1N A;  4BRO A;  1IG8 A;  3WQT A;  2ZGZ A;  1C0G A;  3FGU A;  3EKS A;  3FZM A;  5KPT A;  3M1F A;  4A61 A;  1HX1 A;  2YHX A;  3HI0 A;  3BP8 A;  2P9P B;  3LDQ A;  1YUW A;  3A5N C;  1XQS C;  3VEZ A;  3QDK A;  3DJC A;  4H0O A;  4CZJ A;  3CQX A;  2ASM A;  5ELZ A;  2HOE A;  5EX5 A;  3LDO A;  3KVG A;  3WEE B;  5AQH A;  4ISE A;  2VCP A;  3FZF A;  4HWI A;  2GEM A;  4K25 A;  4YDU A;  4EHT A;  1GLC G;  2Q0R A;  2P9U B;  3R6M A;  4I6M B;  5FPD A;  1GLL O;  3CJC A;  4XH4 A;  3L4I A;  3IDH A;  4PKI A;  5BPL A;  3C7N B;  3TU5 A;  2VYP A;  1V4T A;  1ZC6 A;  3HBT A;  3A5M C;  3CJ1 A;  5E26 A;  3M3Z A;  4MO4 A;  3FR0 A;  5TKY A;  4K41 A;  4CBX A;  5BPN A;  1YAG A;  3ENH A;  4BR0 A;  1D4X A;  5AR0 A;  4BRG A;  3M6G A;  2P9P A;  3LDP A;  2BUP A;  4CZH A;  3ATV A;  5BPM A;  3HZ6 A;  3LDN A;  2I7P A;  3CI5 A;  2AA4 A;  1NGH A;  4CZM A;  2HMP A;  3VPZ A;  3VF2 A;  2PBD A;  2Q2R A;  3GDQ A;  3FLC O;  2CGJ A;  3O08 A;  4FWQ A;  3MN9 A;  3SMP A;  3CHW A;  1ATR A;  3ZX2 A;  3QBW A;  4BGB A;  4FPB A;  4FWS A;  3VEX A;  4PL8 A;  2ZWH A;  1BDG A;  2H3G X;  5F0X A;  2QWP A;  3KZB A;  3D7E O;  1Z05 A;  1GLD G;  3AAP A;  1S3X A;  3VGM A;  3ZEU B;  4DB3 A;  2WUS A;  4JD2 B;  4M63 C;  4BC4 A;  3VEW A;  4CZI A;  4A2A A;  4DHY A;  1TUY A;  4MO5 A;  1NGI A;  5KPZ A;  4Y0W A;  2D0P A;  1BG3 A;  3D2F B;  5AZI A;  4CD3 A;  1BWF O;  3JXU A;  4AM7 A;  3FZH A;  3H6E A;  3CJ9 A;  1TYQ A;  3TPQ A;  3WT0 A;  3CIP A;  3QFP A;  3EO3 A;  3A5O C;  3WUH A;  4JHD A;  1GLE G;  3DAW A;  4XEI A;  4FL9 A;  3U4L A;  5CE3 A;  1NWK A;  1QQM A;  4I6M A;  5AQG A;  4BVP A;  4PKG A;  3I33 A;  1QQN A;  2GWJ A;  4MLH A;  4BR9 A;  2D0O A;  3UE5 A;  3W3D A;  3O5B A;  2ZGY A;  4JAX A;  2GTD A;  3CQY A;  4FO0 A;  4H0Y B;  4K43 A;  4EAH D;  4JNE A;  4MLE A;  1WOQ A;  5LJW A;  1MDU B;  3LL3 A;  4FOE A;  5AQN A;  2E2O A; 
#chains in the Genus database with same CATH topology
 3CFP A;  3ZET A;  3SNN A;  4GNI A;  2P9S B;  4QS8 A;  5C42 A;  3PX4 A;  5BR8 K;  1TKT A;  1BL3 A;  4KHW A;  1T6C A;  1VAZ A;  3SMS A;  4OPK A;  1LAV A;  2Z1I A;  2BTF A;  2XHB A;  3NGY A;  3K57 A;  3OA9 A;  4DV0 K;  1WBD A;  1YHQ N;  1YXQ A;  4C23 A;  4IKF A;  2O8F A;  3EN9 A;  1GLA G;  1IG9 A;  5AQF A;  4NO7 A;  1FXX A;  3AAR A;  5KPR A;  1BI4 A;  4N41 A;  3OW2 M;  1IKY A;  3M5R A;  2P9L B;  1MWM A;  1SAZ A;  3UKR A;  1TVR A;  2E88 A;  3R8E A;  4B9S A;  4FJN A;  3PSF A;  4N56 A;  1TUU A;  3I56 N;  2O8B B;  1L3T A;  2E2Q A;  3VEV A;  3V1O A;  2A6A A;  4X65 K;  3DXK B;  4IO8 A;  1RFQ A;  3TWH A;  4IJA A;  3THX A;  4WQ4 A;  1NMN A;  3FE1 A;  1XMQ K;  1A5X A;  1R59 O;  1H1V A;  4IEE A;  3VGL A;  3J7Z O;  3OTO K;  4O4G A;  1T6D A;  1NGC A;  1X9J A;  1KVB A;  1W7A A;  3L2U A;  1VQ6 N;  4B3O A;  1IKW A;  1T03 A;  2P5G A;  5AQU A;  4I7F A;  4KBO A;  4BY9 C;  2DPN A;  3CER A;  4B1U B;  4F3O A;  4LFB K;  1KAY A;  3E9L A;  4JN4 A;  3VMF B;  5ADX A;  1KLM A;  2A42 A;  4ZTJ A;  1J9A A;  1NMD A;  3K58 A;  4E7L A;  2QK9 A;  4ILJ A;  4CEQ A;  3BZK A;  1UA1 A;  4DV6 K;  3C6H A;  1W2B M;  4NXN K;  3GOI A;  2X74 A;  4A57 A;  3DLE A;  1NJI O;  4JK9 A;  2HHS A;  1NGG A;  1HKB A;  3SBT A;  4CJU A;  4LF7 K;  1LWE A;  3IAY A;  5KRS A;  1E3M A;  3L2Q A;  4KRE A;  3ZSW A;  2UXB K;  4KI6 A;  2DY4 A;  3MN5 A;  4W5O A;  1RTD A;  3OYI A;  5KQD A;  3CJ7 A;  4B9T A;  2F7T A;  1GLB G;  1VQ4 N;  1XC9 A;  4B1X B;  4DQR A;  3JAM O;  2X78 A;  5DMR A;  1L5U A;  4IXC A;  4BRQ A;  1EXQ A;  4B1W B;  1Q7Y O;  2ASP A;  2HHW A;  4M7Y A;  3VTH A;  4XIU A;  3AGR A;  2FSK A;  4KHN A;  1YF5 L;  4FWM A;  4ELV A;  1ZBH A;  3VQ5 A;  2OPQ A;  5AQP A;  4CK3 A;  4MQ3 A;  4OX9 K;  2KW4 A;  3O9U A;  5C10 A;  1DLO A;  2QWQ A;  2WC9 A;  2YNF A;  3ZEU A;  3PIP L;  1FW6 A;  3CJA A;  1FK9 A;  3WXM B;  2YHY A;  4CVN E;  3GG4 A;  1VHX A;  3LAM A;  5CZ1 A;  4DV5 K;  1RCH A;  5BN9 A;  1HNX K;  3OBW A;  3LM2 A;  4YHH K;  3MXM A;  2KQ2 A;  4XH5 A;  4JS5 A;  4DSJ A;  1QHA A;  2IC3 A;  3SPZ A;  4I9L A;  3MN7 A;  3Q7B A;  3T7Z A;  3ULE B;  1HQE A;  1C1C A;  1LV5 A;  4F2R A;  2QWR A;  3CQ8 A;  1U4B A;  2GUI A;  4W5R A;  4MDB A;  1N32 K;  3QEP A;  4IFE A;  3BY5 A;  3H45 C;  4BRH A;  4CEZ A;  2FLO A;  3LP0 A;  4JK8 A;  5LMU K;  3G0Z A;  1JCG A;  1Y64 A;  2V7Y A;  3A8Y A;  2HHQ A;  4R79 A;  1EKE A;  2OPP A;  3QET A;  3WNG A;  1S1X A;  1ZBF A;  3AA5 X;  1ASW A;  4AH9 A;  3NH0 A;  5AQV A;  1KSP A;  4FJL A;  3CET A;  1BIS A;  3VQE A;  3LZJ A;  4O8U A;  5M1K A;  2YNH A;  1W0H A;  5FPE A;  1XUP O;  2VQF K;  2YJE A;  1U2V B;  4KKO A;  4H5V A;  2XRI A;  1JCF A;  3VET A;  1NKB A;  1BIZ A;  1VQP N;  2P9I B;  4JRQ A;  1S6P A;  3HVT A;  3MX5 A;  1YJ9 N;  4K0K K;  4DKW A;  1N5Y A;  3VTI A;  5FRN A;  5HRO A;  1HKG A;  1HJO A;  5GIO A;  1WBB A;  1XNQ K;  3A5L C;  5LL6 Z;  3VF4 A;  4H0P A;  1TK0 A;  2P9S A;  3OYM A;  2B5J A;  4BRA A;  4DG1 A;  4CF0 A;  4EP4 A;  3UKR B;  3KK1 A;  4J2E A;  3P5J A;  4CGI A;  4BE0 A;  1N33 K;  4OJR A;  4LF6 K;  3A0I X;  2YJF A;  1Z6R A;  1VQ9 N;  1LW0 A;  2E1Y A;  4C1N K;  2PYJ A;  2YKN A;  2GX9 A;  1KXP A;  4BAC A;  3HP9 A;  2CH5 A;  4DSL A;  3I0R A;  4E7J A;  4C8N A;  3K9K A;  1BUP A;  4RWT A;  4V19 S;  1BI4 B;  1V4S A;  3CD6 N;  3OYG A;  1KRP A;  4CF1 A;  1Q86 O;  1ATS A;  5H1S Q;  4FM2 A;  4XH1 A;  5KRT A;  3OJS A;  3VEO A;  3VEN A;  5AZJ A;  5AQM A;  3WEE A;  4L8R B;  1N6Q A;  4BRK A;  3IMX A;  4PQU A;  3QES A;  3HOT A;  3AVN A;  1CZA N;  4DTN A;  5C25 A;  3T1H K;  1NK0 A;  1P8Z A;  3MAQ A;  1BCM A;  4DTS A;  4U7B A;  3WQT A;  3FGU A;  3AVM A;  3EKS A;  3SAH A;  3CC2 N;  1JL2 A;  2BDP A;  1VSF A;  4FLZ A;  2JGU A;  2YV0 X;  2F4V K;  3ID6 A;  3HI0 A;  3CCJ N;  1C1A A;  4CHN A;  1YUW A;  3A5N C;  3VEZ A;  4GV9 A;  3HL8 A;  3U6F A;  3QDK A;  2X6N A;  3AVC A;  3N4Q A;  4H0O A;  2RHK A;  2W42 A;  1I94 K;  2ASM A;  3THW B;  3WEE B;  5AQH A;  4CHQ A;  2VCP A;  3FZF A;  4YDU A;  2P9U B;  1KFD A;  4I6M B;  3NGZ A;  3OVN A;  3ZSR A;  4AHS A;  3E01 A;  1QTM A;  2PFU A;  3PV8 A;  3M8R A;  2D5R A;  1ZC6 A;  1RT1 A;  3CJ1 A;  4W5T A;  2GV9 A;  5I3U A;  5TKY A;  4CBX A;  1VQ7 N;  1U49 A;  3OYL A;  3PO5 A;  4DQI A;  1U04 A;  3M6G A;  1TL3 A;  4Z4H A;  2BUP A;  4CZH A;  4FLU A;  4KAZ A;  3MWT A;  4CZM A;  3CI5 A;  4NCA A;  1NGH A;  1JXB A;  3VPZ A;  1Q9Y A;  3MEE A;  3SMP A;  4FLV A;  1D9F A;  3HT3 A;  2PZS A;  3VEX A;  4PL8 A;  2H3G X;  3AAP A;  4OVL A;  2HVH A;  1S3X A;  4PHT X;  4JD2 B;  4M63 C;  2UU9 K;  3JSM A;  5HRS A;  3V9X A;  3KKR A;  4DHY A;  3NF7 A;  1TUY A;  4MO5 A;  1NGI A;  3L4Q A;  4Y0W A;  4B08 A;  4DV7 K;  1OH7 A;  5AZI A;  3SCX A;  1CZB A;  4CED A;  3CJ9 A;  1SV5 A;  1A5W A;  3TPQ A;  3EO3 A;  4WFA L;  4O0I A;  3ENB A;  2NRW A;  5GIP A;  3LAK A;  1HPZ A;  4I6M A;  3T1Y K;  3I33 A;  4BR9 A;  2GWJ A;  4HCC A;  2DFE A;  3PIO L;  3W3D A;  4CFD A;  5M1P A;  2ZGY A;  4K43 A;  4FO0 A;  1YTA A;  4ID5 A;  3TAR A;  5HRP A;  2A1R A;  4CJL A;  3O4Q A;  2G8H A;  2W6K A;  1T7P A;  4O8K A;  4R5P A;  4HHT A;  2D0C A;  1BQM A;  4ISF A;  3ZSX A;  4DR4 K;  4H5R A;  4OPA A;  3NVM A;  4CZG A;  3VGK A;  4CJ7 A;  3AVJ A;  4FWK A;  5AQQ A;  4KFB A;  4CHO A;  1JLB A;  4JS4 A;  2B4J A;  1YT3 A;  2A3Z A;  4CJS A;  1HYV A;  4CIF A;  1ASV A;  1S9G A;  2VG6 A;  4FWN A;  2A5X A;  4BRI A;  4LH4 A;  4EHU A;  1FKP A;  3ENO A;  4BRD A;  2ZQB A;  1Y97 A;  4GW6 A;  1KCF A;  1VQK N;  4HTL A;  4CK2 A;  4BG8 A;  5C15 A;  4X66 K;  2GUP A;  2KZM A;  4DV2 K;  3AO2 A;  2E1Z A;  3WXJ A;  2ZF5 O;  4K42 A;  3QEX A;  5KGW A;  2UUA K;  3SJJ A;  4Q0B A;  4LSL A;  1ATN A;  5C2D A;  2FSN A;  1VRU A;  3ISN C;  1EQY A;  2O8D B;  1RBS A;  4BR7 A;  3CCQ N;  3L3V A;  1XHX A;  3MDQ A;  4ID1 A;  4DR5 K;  3W0L A;  4OLB A;  4Q5V A;  1BO5 O;  4WYB A;  3VQB A;  4FW2 A;  2W6L A;  4FZX C;  1W9H A;  5JMV A;  2OTJ N;  4B9M A;  5J1E A;  4DV4 K;  4FVU A;  1DGK N;  1JLA A;  4CEC A;  3DLL L;  2RKI A;  1NK9 A;  1HQU A;  3WXK A;  2O4I A;  4OPH A;  1WUA A;  4Z0U A;  3VF6 A;  4WQ5 C;  4E7I A;  3S3O A;  1E4F T;  4C8K A;  4RTF D;  4F8R A;  5K14 A;  3TSQ A;  1TGO A;  5M1N A;  1VSM A;  1K9M O;  2PY5 A;  2CGK A;  1RTJ A;  4M7X A;  2KLA A;  5M1F A;  1C0U A;  1XC3 A;  4WQ5 A;  5BR9 A;  4OLA A;  3BUZ B;  3LPU A;  1FKO A;  3WXL A;  4CES A;  2NRH A;  4FYD A;  3OJU A;  3D2E B;  4CJ3 A;  3OYJ A;  5AQJ A;  3S9H A;  4DCH A;  3AVH A;  4BQL A;  4LFC K;  1T05 A;  3DYA A;  3BEX A;  2XY7 A;  4MFB A;  1J6Z A;  1TAQ A;  3C6T A;  4M3Z A;  3CPW M;  3UB5 A;  5AFU A;  3O9R A;  1WAJ A;  3RMC A;  2P9N A;  2P9K B;  3UIQ A;  1EWQ A;  1VQM N;  3T69 A;  2OCE A;  1T8E A;  2YNI A;  4O5B A;  5J2Q A;  3D45 A;  1KLN A;  3HJF A;  2NZT A;  3MN6 A;  2HNZ A;  3V9S A;  4J8F A;  4JI1 K;  4DLG A;  3SPY A;  1JLC A;  2UXD K;  4CEA A;  4HVJ A;  4WQ4 C;  1TV6 A;  3RWU A;  4DWI A;  3PY8 A;  2HF3 A;  4BWJ A;  3KHY A;  1KTQ A;  4E7H A;  1ASU A;  3ASM A;  5KQ8 A;  1ITG A;  5JVG L;  2VGM A;  1WLJ A;  3CJB A;  2P9N B;  5JIC A;  1NOY A;  4FJK A;  3U9D A;  3KLF A;  2V51 B;  3DI6 A;  4GY2 B;  4IDK A;  5J2P A;  1HR0 K;  2O8B A;  2OTL N;  3K5M A;  4LFA K;  4B1Z A;  1RT5 A;  4CGH A;  4BRE A;  3CG7 A;  3D2E A;  3DXK A;  4QS7 A;  3KWG A;  3HPO A;  5BRH A;  1REV A;  1M90 O;  4ILH A;  4JKD A;  1NM1 A;  3LZI A;  3H3O B;  1S1U A;  1XMO K;  4LSN A;  4CGJ A;  1IBK K;  3CM5 A;  3VES A;  3SZ2 A;  4JI5 K;  1RTI A;  1MU2 A;  3NAE A;  4WFN L;  2DFH A;  3KK7 A;  4FSV A;  5GAH P;  3CMA N;  2EWS A;  4CFC A;  4IZ9 A;  2QKK A;  3DOL A;  5AQW A;  3IRX A;  2KFZ A;  2G8F A;  2CH6 A;  4C8M A;  4NYN A;  4GVM A;  3KKS A;  1NGJ A;  3QB0 A;  4JKC A;  4A5A A;  4DTX A;  3B6P A;  5LJV A;  1Q9X A;  3P83 D;  3C0B A;  3QIN A;  4JKB A;  2YKM A;  3QIO A;  1IO2 A;  4F9O A;  4FJM A;  1IKX A;  3VQC A;  5BRF A;  4W5N A;  4IFV A;  3HPG A;  1K8A O;  3ZX3 A;  1HNI A;  3EKU A;  2UUC K;  5AQI A;  4PWD A;  3GBT A;  3KD5 E;  3OYB A;  1JLF A;  1EP4 A;  3N4P A;  3P39 A;  2P5O A;  3O6W A;  1ZBS A;  4B3T K;  1KD1 O;  5E84 A;  4CJP A;  2P1J A;  2BGG A;  3EEQ A;  3WNF A;  2OZS A;  2D1K A;  2EX3 A;  5I42 A;  3M8P A;  2NUB A;  2BE2 A;  4KB0 A;  5LY3 A;  2RE2 A;  4DTR A;  2F96 A;  5F2R A;  4NLB A;  4AHV A;  3CME N;  2W40 A;  4YOV A;  3V9W A;  3THV A;  1BA1 A;  3K2P A;  3AO3 A;  4CHP A;  4FLX A;  2CGL A;  4CER A;  1TYQ B;  1RTH A;  1X3N A;  3OYN A;  2ZD1 A;  4BR4 A;  1VQ8 N;  3SUQ A;  3KLH A;  2YHW A;  3MK6 A;  5AQL A;  5KGX A;  4KO0 A;  1IG8 A;  3HVR A;  2BAN A;  1C0G A;  4CIE A;  5GAG P;  1IV0 A;  4PY5 A;  1BHL A;  4KTZ A;  3CF5 L;  2HVI A;  4OGE A;  1RNH A;  3BP8 A;  3SI6 A;  3LDQ A;  4O55 A;  2VG7 A;  4DTJ A;  1N36 K;  3DJC A;  1B9F A;  3LAN A;  4CZJ A;  4FK0 A;  2HB5 A;  3RMD A;  4DTO A;  4B8A B;  1OVY A;  1VRT A;  3LDO A;  3ITH A;  2OPS A;  4YY3 K;  4B9L A;  1BGX T;  4IO9 L;  3RRH A;  1GLC G;  4EZ9 A;  3CYM A;  3R6M A;  1CLQ A;  2EHG A;  4E1N A;  3OYC A;  5FPD A;  3CJC A;  2WFB A;  3CCE N;  2IGI A;  3C7N B;  1SS6 A;  3HBT A;  3A5M C;  3M3Z A;  4MO4 A;  5BPN A;  4G1Q A;  1NK8 A;  1YAG A;  3NGI A;  4LF8 K;  1D4X A;  5AR0 A;  4KH4 A;  1B9D A;  2B6A A;  3G10 A;  4Y1D A;  3CCR N;  2KKZ A;  3LDP A;  2AA4 A;  1JJ2 M;  3GDQ A;  3AVI A;  2CGJ A;  4AHC A;  4BDP A;  1WSH A;  4IFY A;  3MXI A;  4B3M K;  3ZX2 A;  4E3S A;  3K5N A;  3QEW A;  4JKF A;  3QBW A;  2X6S A;  1TKD A;  4Z4E A;  4CFB A;  1BDG A;  2QWP A;  3D7E O;  3ZEU B;  1Z05 A;  3I0S A;  1N8R O;  4M3W A;  4GVE A;  1VQN N;  1LWF A;  3SQ2 A;  3VEW A;  4DU1 A;  5C12 A;  4A2A A;  3HYF A;  1QE1 A;  5M1Q A;  1WN7 A;  3TR8 A;  3J7A P;  4J2B A;  3D2F B;  1RT3 A;  3CM6 A;  2HHH K;  2Q3S A;  4PUO A;  3SUO A;  3FZH A;  4AIL C;  3WT0 A;  3DM2 A;  3CIP A;  3QFP A;  3K0S A;  3WUH A;  4DR7 K;  4XEI A;  3SQ0 A;  3OYF A;  4DV1 K;  4JKG A;  4NXM K;  4MLH A;  2O8C B;  4EAH D;  5DM7 L;  4JNE A;  3F9K A;  2I5J A;  1MDU B;  2HHT A;  3TTC A;  4BE2 A;  4CHZ A;  1JLE A;  3VQ6 A;  4C8O A;  1DKG D;  4GV6 A;  1WSG A;  2QI2 A;  2FBY A;  1U6Z A;  2IDO A;  4OPJ A;  3H1Q A;  4G9Z A;  5IWA K;  3H1V X;  3OY9 A;  3UKU A;  2O8E B;  3THW A;  2A41 A;  5M1O A;  3I55 N;  3OS0 A;  2UXC K;  1VSE A;  3QBX A;  1YVU A;  3AVG A;  4NCG A;  4NLC A;  4Z4I A;  2ITM A;  3KWI A;  2JWL A;  3O1W A;  3H46 O;  1NOZ A;  1HPM A;  2PAV A;  2OYQ A;  4KH6 A;  2G8W A;  2Q31 A;  1RBV A;  3QIP A;  1VQL N;  1X9W A;  3OYK A;  3LWL A;  3HO1 A;  4C8L A;  4KB1 A;  3KLE A;  3GE1 A;  1C0T A;  2IAJ A;  4DSF A;  4RW4 A;  3FFK B;  1G15 A;  4LH5 A;  2G8K A;  4H5N A;  4YOT A;  4H8K A;  4BE1 A;  4DR1 K;  2UYT A;  5HLF A;  2HBJ A;  2HBK A;  4DTU A;  5HBM A;  3O3G A;  4DTM A;  1YIT N;  4IG3 A;  3IFR A;  4IWV A;  1QQO A;  1K8K B;  4FK2 A;  4A2B A;  4NCB A;  2P9I A;  4IDH A;  3C6A A;  5AQZ A;  2FF3 B;  3RR7 A;  1HYZ A;  3WNH A;  5CZ2 A;  1SL2 A;  2UUB K;  1U2V A;  1VSH A;  5C24 A;  3TAE A;  4EIA A;  1QVG M;  3AO1 A;  3FZL A;  3DMJ A;  3I8B A;  3MX2 A;  3TAF A;  1LOT B;  5AQS A;  1C0M A;  4CFA A;  2WOM A;  4H4M A;  4WFB L;  3ZET B;  2IVP A;  1NGB A;  3SK3 A;  4CJ4 A;  4IJN A;  4DFP A;  1A5V A;  1VQO N;  3U3Y A;  1S1W A;  5CHI A;  4CEE A;  4NB4 A;  4AHT A;  4BR5 A;  3I8D A;  4AHR A;  1C6V A;  1GOB A;  2GEL A;  4LF5 K;  3LWM A;  1HRH A;  3LDS A;  2IOC A;  5C2F A;  1UOC A;  4DS5 A;  3QEV A;  2BH1 A;  1WNS A;  3MXJ A;  2VWB A;  3M8Q A;  2E4L A;  4JEP A;  5J2M A;  4X64 K;  4JI7 K;  1EX4 A;  4DUY K;  1Q18 A;  1HNW K;  1ZXO A;  3O4W A;  4RCH A;  1RDD A;  3CPE A;  5AQX A;  4Z4G A;  1VSK A;  3IG1 A;  4FLW A;  2Q36 A;  1RDC A;  4DQ8 A;  2Z1H A;  1YTU A;  4B9Q A;  4OO1 J;  4PA1 A;  4DFM A;  3V4I A;  5JLH A;  2FBX A;  3G71 N;  1WSE A;  3PSI A;  4IOC L;  2YCH A;  4AM6 A;  3NE6 A;  4YDU C;  3SV4 A;  2DFF A;  2XY5 A;  2HBM A;  3HM9 A;  3EL2 A;  3PO4 A;  5F1X A;  3LP3 A;  4DU3 A;  2NRT A;  4K8X A;  4HTU A;  2VGN A;  2GWK A;  3R3L A;  3AVA A;  2WON A;  4A62 A;  3GL1 A;  2QKB A;  4WCE L;  2G8V A;  3MCA B;  5HP1 A;  1GLJ O;  3VQ7 A;  5FLX O;  3P38 A;  4LY7 A;  5A2Q O;  1EO1 A;  2QWM A;  2QWO A;  4CJF A;  3L6Q A;  4JI8 K;  4FWP A;  4BRC A;  4QCL A;  3SYZ A;  4RW7 A;  1NNE A;  4GV3 A;  4F3T A;  2P51 A;  2P9U A;  3AVL A;  4WF9 L;  1JLQ A;  3CFO A;  3LPT A;  3EE9 A;  5AZJ B;  3SQ4 A;  1EWR A;  3P4I A;  4B3S K;  4JRP A;  1LCU A;  2NLX A;  5FPN A;  3O3H A;  2QTD A;  4DR3 K;  1ESV A;  1SKR A;  3AO4 A;  1VK0 A;  1TL1 A;  4O5F A;  2JLE A;  1NGD A;  1NBW A;  2R7Y A;  3VQD A;  2QWN A;  3LDL A;  2QA4 N;  1GOA A;  4FZY A;  1S1V A;  1J5E K;  2E2N A;  4CZF A;  4BC2 A;  1L3U A;  4CK1 A;  3NDK A;  2V7Z A;  5BRE A;  1BU6 O;  3AA2 A;  3AVB A;  3J80 O;  4H4O A;  3VN5 A;  4FCY A;  3KJV A;  3P1G A;  2E5L K;  4FOI A;  4QAG A;  4H0V B;  2ZJR L;  4IBN A;  1IH7 A;  4FWO A;  1S72 N;  3TAM A;  3THX B;  1YJN N;  4CW7 B;  2RN2 A;  4CGF A;  1JCE A;  3TAG A;  4H5W A;  5JLF A;  4DQQ A;  4JHD B;  2VQE K;  3QEI A;  5EOY A;  3U8X A;  3DWL A;  2VWJ A;  4BRN A;  3WXI A;  4CEF A;  5AQT A;  3H3N O;  3ZCM A;  4JI0 K;  4PKH A;  2F8S A;  2WBN A;  2O8E A;  3NF9 A;  1BA0 A;  5CR4 A;  4E1J A;  4KHP K;  3O1B A;  3L8B A;  5HOO A;  4KTW A;  2QWL A;  3OHR A;  4CF2 A;  2QEX N;  3PLA A;  2HND A;  3MCP A;  4CBW A;  2FSJ A;  1IJJ A;  4HUE A;  3V9U A;  3HSC A;  4CCH A;  4RG8 A;  2IVN A;  3FFI A;  4CZL A;  3A2F A;  3LAL A;  1BCO A;  4M45 A;  3SV3 A;  4BR2 A;  2QXF A;  5I9E B;  4DF4 A;  1HMV A;  3EE8 A;  1IKV A;  2P9K A;  2ZJQ L;  3V6D A;  4DSE A;  3RSE B;  3K5L A;  2ITG A;  3PX0 A;  2HST A;  1ZYQ A;  2E20 A;  1KQS M;  3O9T A;  4J2A A;  2Q97 A;  1P90 A;  1OKJ A;  1QHT A;  3RR8 A;  2QXL A;  3VQP A;  5EY4 A;  1BOT O;  2ASO A;  2IVO A;  2FBV A;  2LSN A;  1MWK A;  3EZW A;  3L2R A;  1D9D A;  1RT6 A;  3G6E N;  1FJG K;  1VSD A;  4AQY K;  4FZZ A;  5HRN A;  5T7B A;  4TSX A;  3EY1 A;  1KAZ A;  4ELU A;  2Q1N A;  3HRG A;  1X9S A;  2ZGZ A;  1X9M A;  1TK8 A;  5KPT A;  4KV8 A;  1HX1 A;  1CXQ A;  3ZT0 A;  5HRR A;  4BWM A;  5J2N A;  1KFS A;  1VSJ A;  1SKS A;  1TKX A;  1EET A;  4B9N A;  1SL0 A;  1QQC A;  1XQS C;  4DS4 A;  1Q8I A;  4GKJ K;  4KI4 A;  4DLE A;  3OBY A;  3NH2 A;  4NYF A;  1Z26 A;  4E89 A;  1SUQ A;  3F73 A;  4CJK A;  5EX5 A;  3KVG A;  1NJZ A;  4I2Q A;  3BZC A;  4ISE A;  1JL1 A;  1J5O A;  4HWI A;  3RTV A;  3NCI A;  4EHT A;  2Q0R A;  3Q7C A;  4KHY A;  3IDH A;  2NRR A;  5BPL A;  3TU5 A;  2G8U A;  3AV9 A;  3ZSQ A;  3CXC M;  3RVC A;  2F8T A;  4Y1C A;  3FR0 A;  1NK4 A;  4K41 A;  3OS2 A;  2YNG A;  1DTQ A;  1T3V A;  4M42 A;  3HZ6 A;  3LDN A;  2I7P A;  1L3V A;  3DOK A;  3VF2 A;  1QSS A;  2PBD A;  3L3U A;  4DF8 A;  2PYL A;  4UQG A;  4M3U A;  1CXU A;  2HHU A;  1ILY A;  4FWS A;  1M1K O;  2ZWH A;  1XNR K;  1SL1 A;  5F0X A;  4DB3 A;  3VGM A;  3K9J A;  4LD0 A;  1NKE A;  3QO9 A;  4GMJ B;  2WUS A;  3E9O A;  3HOS A;  3S3M A;  4M3T A;  4I9Q A;  4BC4 A;  4CZI A;  3VA0 A;  1J54 A;  4RW8 A;  1RT4 A;  3VQ8 A;  4OKJ A;  2XO7 A;  3D6R A;  1BWF O;  3JXU A;  3MED A;  3KD1 E;  1WSJ A;  3G4S N;  3H6E A;  3NMU A;  3MWP A;  1TYQ A;  4CHY A;  1WSF A;  3A5O C;  4JHD A;  1GLE G;  5TKW A;  4CJR A;  3DRP A;  4FL9 A;  3U4L A;  1RBT A;  4HUG A;  1O1W A;  4BVP A;  1QQM A;  3CFR A;  4PKG A;  1Z25 A;  3UE5 A;  4JKE A;  1WB9 A;  4JAX A;  2GTD A;  3CQY A;  4F4K A;  2KFN A;  4MLE A;  3CCL N;  5AJ3 K;  1WOQ A;  4OGC A;  3LL3 A;  1UA0 A;  4FOE A;  2A1S A;  3P31 A;  1JLG A;  2XY8 A;  4Z4F A;  2D0B A;  2E2O A;  1R0A A;  1TAU A;  2I7N A;  4CGG A;  4FW1 A;  3SUP A;  3S3N A;  2AJQ A;  4H03 B;  3F9M A;  2D0A A;  3WQU A;  2E6L A;  3SAF A;  3J7Y P;  4BQZ A;  3HXM A;  4FJ7 A;  1QZ5 A;  2YHA A;  3VER A;  3QNN A;  2RPI A;  1LWC A;  4CJE A;  1RT2 A;  3QML A;  3V81 A;  3SJH A;  3DLK A;  3RMB A;  3O4N A;  4MDA A;  1S22 A;  3J81 O;  3HM8 A;  5EVZ A;  4KHQ A;  5EXW A;  4BDY A;  3NFA A;  3CC7 N;  4JD2 A;  3CCU N;  2JWK A;  3KTQ A;  4B9V A;  2NNW A;  2OA8 A;  4B9U A;  2F9T A;  4YOY A;  4JI3 K;  1OH8 A;  4FK4 A;  4FVM A;  4CJV A;  3ULE A;  4BRP A;  1C1B A;  1C0F A;  3T3F A;  3ZSV A;  4DV3 K;  4N76 A;  1NK6 A;  4AF1 A;  4OKE A;  3OYE A;  5B8H A;  4FJG A;  3AVF A;  4DSK A;  1UAX A;  3TAP A;  2FBT A;  4QS9 A;  1VSL A;  3CCS N;  5FRO A;  2HMI A;  1GOC A;  1BIU A;  1SQK A;  3VEY A;  3AGK A;  5GAD P;  2J4R A;  3RSE A;  3DLG A;  3IUC A;  3QIC A;  1OH5 A;  4FJH A;  5FPM A;  4FJ5 A;  4DTP A;  3VQQ A;  1XWL A;  3D2F A;  3CC4 N;  1RDB A;  4FJ9 A;  1RBU A;  1HNZ K;  4KPY A;  4UY8 O;  5DM6 L;  4HUF A;  4BDZ A;  2HHV A;  1QSL A;  2Z1J A;  1XI1 A;  2FXU A;  5C0Y A;  2QM1 A;  2YX6 A;  3DLB A;  1U48 A;  5JVH L;  2QW9 A;  4L3Q A;  3T19 A;  1HKC A;  3TAQ A;  2AP1 A;  3NF8 A;  3G25 A;  3ZLJ A;  1X1P A;  1LAW A;  1RDU A;  3ZYY X;  1NGA A;  3K5O A;  4BRM A;  1SZ2 A;  3O9S A;  4FWL A;  2O4G A;  4FWR A;  4KHS A;  1KC8 O;  3VQ9 A;  3JS6 A;  1OH6 A;  3E9P A;  3HTV A;  4EFH A;  5DK5 A;  4B1Y B;  3HK2 A;  4BC3 A;  4CF9 A;  4BRL A;  4CE9 A;  1J53 A;  1DTT A;  4KH5 A;  4KHU A;  5E41 A;  1YVN A;  2VWK A;  4YFU A;  1NJX A;  3IS9 A;  1UWB A;  4IEI A;  1L3S A;  5GAE P;  1GLF O;  3BDP A;  4O44 A;  5AFU H;  2IIR A;  1S9E A;  1NK7 A;  4YOR A;  1NGF A;  1HLU A;  3ULD A;  3SBG A;  3EYZ A;  4E19 A;  3KK2 A;  2F9W A;  1Q81 O;  4E7K A;  3HST B;  4FJ8 A;  3TSU A;  3ID8 A;  3FZK A;  3D0P A;  5IT9 O;  2Y1J A;  1D8Y A;  3PUF A;  2V52 B;  3ZT1 A;  1KAX A;  4DFJ A;  3OYD A;  3SLC A;  2YI1 A;  4M3Y A;  1IBL K;  4DMN A;  3DXM B;  2FF6 A;  3C95 A;  4JV5 K;  3R9P A;  4JK7 A;  4JI2 K;  3LM9 A;  4CJQ A;  5AQY A;  2YHB A;  5CYM A;  4CBU A;  4B3R K;  3AA3 A;  4Z94 A;  3E1Y A;  1RGI A;  3BF3 A;  1NU0 A;  3V1Q A;  5LMN K;  1KVA A;  3T1A A;  3VA3 A;  3O80 A;  1VSI A;  3MEC A;  1NJY A;  5AQK A;  1ZBI A;  1S5J A;  3MEG A;  4K8Z A;  4DR2 K;  3QLH A;  3NHG A;  2O8F B;  3C7N A;  4LC9 B;  2HNY A;  1QSY A;  4A5B A;  2HF4 A;  3WNE A;  5BRD A;  4DQS A;  4JLH A;  2ZJP L;  3KLI A;  1I3A A;  2HW3 A;  5MLC Q;  4IOA L;  2E6M A;  1QS4 A;  3AA4 A;  1W97 L;  3B8A X;  3ZSO A;  1OVQ A;  3ZSZ A;  3TAN A;  3TTF A;  3TTD A;  4EP5 A;  4YOX A;  2NRV A;  2W41 A;  1WAF A;  4M41 A;  1QZ6 A;  5BN8 A;  3QNO A;  4DFK A;  2ZM6 K;  3C6U A;  2O8D A;  1K73 O;  1T44 A;  1G99 A;  3B6O A;  1N34 K;  3ATU A;  1X3M A;  3ZT4 A;  4H0X B;  1YI2 N;  3NH1 A;  1LW2 A;  3KLG A;  4DR6 K;  3DXM A;  4BVO A;  2DTU A;  4FLT A;  4B1V A;  3DRS A;  1WSI A;  4FJJ A;  4BRF A;  3O8M A;  1NGE A;  2E2P A;  1E4G T;  3CCV N;  3E66 A;  1HUX A;  3TSP A;  4FLY A;  5EU7 A;  4PL7 A;  5KTQ A;  1U47 A;  4CGD A;  4RW9 A;  4EZ6 A;  4KTQ A;  3VOV A;  4WE1 A;  5AQO A;  2HHX A;  4ILG B;  1VQ5 N;  4DQP A;  2KZZ A;  4YNQ A;  2A40 A;  1RDA A;  4JKA A;  3HP6 A;  1NLV A;  4CI6 A;  5SWM A;  2OPR A;  2Q0U A;  3L0Q A;  1HYS A;  1QVF M;  3U3G A;  1D5A A;  1TKZ A;  3DRR A;  3J8A A;  4OKK A;  4JI4 K;  2KTQ A;  3PX6 A;  4ISG A;  4CD1 A;  4RW6 A;  1RDW X;  2FC0 A;  2XY6 A;  1S1T A;  4Z4C A;  4ICL A;  3NVK A;  2P9L A;  4H0T B;  3NBP A;  5GIN A;  3AAQ A;  2O8C A;  4HCB A;  4IG0 A;  4E1M A;  3SUN A;  5AQR A;  5ADX H;  3L2W A;  4N47 A;  4YOW A;  1I39 A;  1RT7 A;  3LP2 A;  3KIO A;  4U67 L;  1O13 A;  3AY9 A;  3H08 A;  4BG9 A;  3M8S A;  3V9Z A;  2NRX A;  4BC5 A;  1NG9 A;  2OAN A;  3JYT A;  4FPA A;  3KK3 A;  4FM0 A;  3QER A;  3S41 A;  2ZE2 A;  3VQ4 A;  4CZK A;  4BGA A;  4FJX A;  3MMV A;  1DEJ A;  1K8K A;  2ETJ A;  2OZM A;  4KRF A;  3UKU B;  3VQA A;  3ZT2 A;  5AZI B;  5FDL A;  3BF1 A;  3QFU A;  3ALY A;  4JKG B;  4O0J A;  5JS2 A;  4CZE A;  3ZX0 A;  1RBR A;  2E8A A;  2KHO A;  3U9Z A;  4QOZ B;  4JKH A;  2ATQ A;  2D4W A;  1MA9 B;  2VG5 A;  4H5T A;  4JI6 K;  4CEO A;  4BRO A;  4CIG A;  4CJT A;  2Z1G A;  1SKW A;  1XHZ A;  3FZM A;  4M3X A;  2NRZ A;  4FM1 A;  3M1F A;  4A61 A;  3OS1 A;  3C65 A;  3TI0 A;  2YHX A;  1KVC A;  3O3F A;  2P9P B;  3THY A;  4DU4 A;  1K6Y A;  3ZT3 A;  4FJI A;  3L2V A;  3ZSY A;  5KI6 A;  1S6Q A;  3NF6 A;  3CQX A;  5ELZ A;  5FRM A;  3SAG A;  4CEB A;  2HOE A;  4X62 K;  3LP1 A;  4DSI A;  2IS3 A;  3AO5 A;  2GBZ A;  2GEM A;  4K25 A;  2G8I A;  5CY4 A;  3OYH A;  3AVK A;  1B92 A;  1TK5 A;  1GLL O;  1NK5 A;  4XH4 A;  3L4I A;  4ZTF A;  4PKI A;  4ELT A;  1DT9 A;  4LF9 K;  2VYP A;  1V4T A;  1RIL A;  5E26 A;  3ENH A;  4YOU A;  4ZHR A;  4BR0 A;  4BRG A;  2RF2 A;  1F21 A;  4N5S A;  4E0D A;  2P9P A;  3THY B;  3RRG A;  3C94 A;  3ATV A;  4IOX A;  5BPM A;  1YJW N;  2HMP A;  1HJR A;  3TAB A;  4FXD A;  2Q2R A;  4CF8 A;  3FLC O;  1NJW A;  3O08 A;  4FWQ A;  3MN9 A;  1NKC A;  1JXE A;  3CHW A;  5HL7 L;  1ATR A;  4CJ5 A;  1JKH A;  3BGR A;  4W5Q A;  1BQN A;  4DUZ K;  2Y1I A;  4BGB A;  1CZ9 A;  4FPB A;  3R1X A;  3DLR A;  5JS1 A;  1U45 A;  3KZB A;  1ZBL A;  4J2D A;  1GLD G;  1HNV A;  4F2S A;  4CJW A;  5D3G A;  3IKM A;  3V1R A;  4M3R A;  4C1N I;  5KPZ A;  1YIJ N;  4A59 A;  3HPH A;  4AHU A;  2D0P A;  1BG3 A;  2WTU A;  3CCM N;  5SZT A;  1ZBU A;  4I2P A;  3O9Q A;  4CD3 A;  3EZ5 A;  3DLH A;  1IBM K;  4AM7 A;  4B8C A;  3SQ1 A;  2HBL A;  3F5T A;  3DAW A;  4GKK K;  4LF4 K;  3RMA A;  5CE3 A;  3K59 A;  1NWK A;  5AQG A;  1QQN A;  1Q82 O;  2D0O A;  5CYQ A;  3O5B A;  4H0Y B;  5LJW A;  4JYA K;  3F2K A;  3OYA A;  5AQN A; 
#chains in the Genus database with same CATH homology
 1DKG D;  4O8K A;  4GV6 A;  2QI2 A;  3ZET A;  4GNI A;  1U6Z A;  2I7N A;  2P9S B;  4QS8 A;  4ISF A;  3H1Q A;  4G9Z A;  4H03 B;  3F9M A;  3H1V X;  4H5R A;  4OPA A;  3NVM A;  3WQU A;  3SAF A;  3UKU A;  4BQZ A;  4CZG A;  3VGK A;  4CJ7 A;  4FWK A;  5AQQ A;  1T6C A;  2A41 A;  5M1O A;  1QZ5 A;  3I55 N;  1VAZ A;  3VER A;  3SMS A;  3QBX A;  2BTF A;  3OA9 A;  4NLC A;  3QML A;  2ITM A;  3KWI A;  2JWL A;  3SJH A;  3O1W A;  1YHQ N;  1YXQ A;  3H46 O;  2A3Z A;  4C23 A;  4MDA A;  1S22 A;  1HPM A;  2PAV A;  3EN9 A;  3HM8 A;  4FWN A;  4KH6 A;  5EVZ A;  2A5X A;  4BRI A;  2Q31 A;  4EHU A;  5EXW A;  1VQL N;  1GLA G;  3ENO A;  4BRD A;  3CC7 N;  4JD2 A;  5AQF A;  3CCU N;  4NO7 A;  3GE1 A;  2JWK A;  3AAR A;  1VQK N;  2NNW A;  5KPR A;  4HTL A;  2F9T A;  3FFK B;  4YOY A;  3OW2 M;  4BG8 A;  3ULE A;  4H5N A;  3M5R A;  2P9L B;  4BRP A;  5C15 A;  1C0F A;  1MWM A;  4YOT A;  1SAZ A;  3UKR A;  2GUP A;  2UYT A;  2HBJ A;  2E88 A;  3R8E A;  2E1Z A;  2HBK A;  3WXJ A;  4AF1 A;  2ZF5 O;  4K42 A;  1TUU A;  3I56 N;  5B8H A;  1YIT N;  3IFR A;  2E2Q A;  3VEV A;  2A6A A;  4IWV A;  1ATN A;  1QQO A;  2FSN A;  3DXK B;  1RFQ A;  4IO8 A;  4QS9 A;  5C2D A;  3CCS N;  1K8K B;  1EQY A;  4IJA A;  4A2B A;  4WQ4 A;  1SQK A;  3VEY A;  4BR7 A;  3CCQ N;  2P9I A;  4IDH A;  3C6A A;  3AGK A;  5GAD P;  2J4R A;  3RSE A;  3IUC A;  3FE1 A;  5AQZ A;  2FF3 B;  3QIC A;  1R59 O;  3MDQ A;  1H1V A;  4IEE A;  5FPM A;  3VGL A;  3W0L A;  3J7Z O;  1U2V A;  3D2F A;  4EIA A;  3CC4 N;  1QVG M;  1T6D A;  1NGC A;  3FZL A;  5DM6 L;  1BO5 O;  1X9J A;  4WYB A;  4UY8 O;  3I8B A;  3MX2 A;  1VQ6 N;  2FXU A;  5C0Y A;  1LOT B;  5AQS A;  2QM1 A;  4WFB L;  3ZET B;  2IVP A;  5AQU A;  4KBO A;  1NGB A;  5JMV A;  2YX6 A;  2OTJ N;  5JVH L;  2QW9 A;  4L3Q A;  3SK3 A;  4FVU A;  4BY9 C;  2DPN A;  1HKC A;  3CER A;  2AP1 A;  4IJN A;  4B1U B;  1KAY A;  3E9L A;  3G25 A;  1DGK N;  4JN4 A;  3VMF B;  5ADX A;  5CHI A;  1VQO N;  2A42 A;  1RDU A;  4NB4 A;  3ZYY X;  1NGA A;  3DLL L;  1NMD A;  4BRM A;  1SZ2 A;  3O9S A;  4FWL A;  4BR5 A;  4ILJ A;  4FWR A;  3WXK A;  1KC8 O;  4OPH A;  1WUA A;  3VF6 A;  2GEL A;  3JS6 A;  4WQ5 C;  3E9P A;  3HTV A;  4EFH A;  1E4F T;  3C6H A;  4B1Y B;  4RTF D;  4BC3 A;  5C2F A;  1W2B M;  4BRL A;  3GOI A;  3TSQ A;  4A57 A;  2BH1 A;  5M1N A;  1NJI O;  4JK9 A;  4KH5 A;  1NGG A;  2VWB A;  1HKB A;  1K9M O;  2CGK A;  3SBT A;  1YVN A;  4M7X A;  2KLA A;  4JEP A;  4IEI A;  5M1F A;  5GAE P;  1GLF O;  1XC3 A;  1Q18 A;  4WQ5 A;  5BR9 A;  1ZXO A;  3O4W A;  4RCH A;  5AFU H;  2IIR A;  3BUZ B;  3CPE A;  5AQX A;  3WXL A;  2NRH A;  2Q36 A;  4YOR A;  4DQ8 A;  3MN5 A;  1NGF A;  1HLU A;  3SBG A;  3D2E B;  5AQJ A;  4DCH A;  4BQL A;  2F9W A;  5KQD A;  1Q81 O;  4B9Q A;  3CJ7 A;  3BEX A;  4OO1 J;  2F7T A;  1J6Z A;  3ID8 A;  3FZK A;  3TSU A;  1GLB G;  1VQ4 N;  4B1X B;  5JLH A;  3CPW M;  3UB5 A;  5AFU A;  3O9R A;  3G71 N;  4IOC L;  2YCH A;  4IXC A;  2V52 B;  4AM6 A;  4BRQ A;  4B1W B;  2P9N A;  1Q7Y O;  2ASP A;  1KAX A;  4YDU C;  2P9K B;  1VQM N;  4M7Y A;  3SLC A;  3VTH A;  3T69 A;  2HBM A;  2YI1 A;  3AGR A;  2FSK A;  1YF5 L;  3EL2 A;  4FWM A;  5F1X A;  5AQP A;  3DXM B;  2NZT A;  3MN6 A;  2NRT A;  3O9U A;  5C10 A;  2QWQ A;  2VGN A;  2WC9 A;  2FF6 A;  2GWK A;  3R3L A;  3ZEU A;  4J8F A;  4A62 A;  3CJA A;  3GL1 A;  3PIP L;  4WCE L;  3R9P A;  3WXM B;  3MCA B;  4JK7 A;  2YHY A;  1GLJ O;  3LM9 A;  4WQ4 C;  5AQY A;  4CBU A;  3P38 A;  4Z94 A;  3GG4 A;  1EO1 A;  2QWM A;  3E1Y A;  2QWO A;  3L6Q A;  1RGI A;  3BF3 A;  2HF3 A;  3KHY A;  4FWP A;  5BN9 A;  4BRC A;  3OBW A;  3O80 A;  3LM2 A;  5KQ8 A;  5JVG L;  4GV3 A;  5AQK A;  2P9U A;  2VGM A;  4WF9 L;  4XH5 A;  3EE9 A;  3CJB A;  5AZJ B;  3P4I A;  1QHA A;  3C7N A;  1LCU A;  2P9N B;  4LC9 B;  2NLX A;  3MN7 A;  3Q7B A;  5FPN A;  3T7Z A;  3ULE B;  4A5B A;  2QTD A;  5JIC A;  1ESV A;  2HF4 A;  2QWR A;  5BRD A;  3U9D A;  4O5F A;  4MDB A;  2V51 B;  4GY2 B;  2ZJP L;  4IFE A;  1NGD A;  1NBW A;  2OTL N;  3H45 C;  4B1Z A;  4BRH A;  2QWN A;  4BRE A;  5MLC Q;  3D2E A;  2FLO A;  3DXK A;  4IOA L;  3LDL A;  2QA4 N;  4JK8 A;  3KWG A;  4QS7 A;  1W97 L;  3B8A X;  1JCG A;  1Y64 A;  5BRH A;  2V7Y A;  3A8Y A;  1M90 O;  4ILH A;  3TTF A;  4R79 A;  3TTD A;  2E2N A;  4CZF A;  4BC2 A;  4JKD A;  4YOX A;  2NRV A;  1NM1 A;  2V7Z A;  2W41 A;  5BRE A;  1BU6 O;  1QZ6 A;  3H3O B;  5BN8 A;  5AQV A;  3CET A;  1K73 O;  1T44 A;  1G99 A;  4O8U A;  5M1K A;  3ATU A;  1X3M A;  3VES A;  4H0X B;  1YI2 N;  5FPE A;  1XUP O;  3DXM A;  4BVO A;  4B1V A;  4WFN L;  3KK7 A;  2YJE A;  1U2V B;  4FSV A;  5GAH P;  3CMA N;  4H5V A;  2EWS A;  4BRF A;  3O8M A;  4FOI A;  1NGE A;  4H0V B;  4IZ9 A;  2ZJR L;  2E2P A;  1E4G T;  3CCV N;  1JCF A;  4FWO A;  5AQW A;  3E66 A;  3VET A;  1HUX A;  1S72 N;  3TSP A;  1YJN N;  1VQP N;  4PL7 A;  1JCE A;  2P9I B;  4H5W A;  2CH6 A;  3MX5 A;  5JLF A;  1YJ9 N;  3VOV A;  5AQO A;  4ILG B;  1NGJ A;  4DKW A;  3QB0 A;  4JKC A;  4A5A A;  3VTI A;  1VQ5 N;  1HKG A;  2A40 A;  1HJO A;  4JKA A;  5GIO A;  5LJV A;  4JHD B;  3C0B A;  1NLV A;  5EOY A;  3U8X A;  3DWL A;  4CI6 A;  4JKB A;  2Q0U A;  3WXI A;  3L0Q A;  4BRN A;  3A5L C;  5AQT A;  4F9O A;  3H3N O;  1QVF M;  4PKH A;  3VF4 A;  3J8A A;  4H0P A;  5BRF A;  2WBN A;  2P9S A;  1BA0 A;  5CR4 A;  4ISG A;  4E1J A;  1K8A O;  3O1B A;  4CD1 A;  5HOO A;  4BRA A;  3ZX3 A;  1RDW X;  2QWL A;  3EKU A;  3OHR A;  3UKR B;  2QEX N;  3PLA A;  3NVK A;  5AQI A;  2P9L A;  3A0I X;  3MCP A;  4H0T B;  2YJF A;  5GIN A;  4CBW A;  2FSJ A;  3GBT A;  1Z6R A;  3AAQ A;  1VQ9 N;  1IJJ A;  3HSC A;  2E1Y A;  4C1N K;  3N4P A;  3P39 A;  3O6W A;  2IVN A;  5AQR A;  4CZL A;  5ADX H;  4YOW A;  2GX9 A;  1KXP A;  1ZBS A;  1KD1 O;  2CH5 A;  4U67 L;  5E84 A;  4BR2 A;  4DB3 A;  1O13 A;  5I9E B;  3AY9 A;  4BG9 A;  3EE8 A;  2P9K A;  2NRX A;  4BC5 A;  2OAN A;  2ZJQ L;  4FPA A;  3K9K A;  3S41 A;  1BUP A;  4RWT A;  3RSE B;  2D1K A;  4CZK A;  4BGA A;  2HST A;  1KQS M;  2E20 A;  1V4S A;  3MMV A;  5H1S Q;  3CD6 N;  3O9T A;  5LY3 A;  1DEJ A;  1K8K A;  2Q97 A;  2RE2 A;  1P90 A;  3UKU B;  5F2R A;  1OKJ A;  4NLB A;  2QXL A;  1Q86 O;  1ATS A;  5EY4 A;  1BOT O;  5AZI B;  2ASO A;  2IVO A;  3BF1 A;  3QFU A;  2W40 A;  4XH1 A;  3CME N;  3VEO A;  4JKG B;  4YOV A;  1MWK A;  3EZW A;  1BA1 A;  3VEN A;  5AZJ A;  5AQM A;  3WEE A;  2CGL A;  3IMX A;  1TYQ B;  4BRK A;  4CZE A;  3G6E N;  3ZX0 A;  3HOT A;  1X3N A;  2E8A A;  1CZA N;  2KHO A;  3U9Z A;  4BR4 A;  1VQ8 N;  4JKH A;  1P8Z A;  1MA9 B;  2D4W A;  4H5T A;  1KAZ A;  2YHW A;  3MK6 A;  5AQL A;  2Q1N A;  4BRO A;  1IG8 A;  4U7B A;  3HRG A;  3WQT A;  2ZGZ A;  1C0G A;  3FGU A;  3EKS A;  5GAG P;  3FZM A;  3SAH A;  3CC2 N;  3CF5 L;  2NRZ A;  5KPT A;  3M1F A;  4A61 A;  1HX1 A;  3C65 A;  2YHX A;  3ID6 A;  3HI0 A;  3BP8 A;  2P9P B;  3CCJ N;  3LDQ A;  1YUW A;  3A5N C;  1XQS C;  3VEZ A;  4GV9 A;  3OBY A;  3QDK A;  3DJC A;  3N4Q A;  4H0O A;  2RHK A;  4CZJ A;  3CQX A;  2ASM A;  5ELZ A;  3SAG A;  2HOE A;  5EX5 A;  1OVY A;  3KVG A;  3LDO A;  3WEE B;  5AQH A;  4ISE A;  2VCP A;  3FZF A;  4HWI A;  2GEM A;  4K25 A;  4YDU A;  4IO9 L;  4EHT A;  1GLC G;  2Q0R A;  2P9U B;  3R6M A;  3Q7C A;  4I6M B;  5FPD A;  1GLL O;  2PFU A;  2WFB A;  3CJC A;  3IDH A;  3L4I A;  4XH4 A;  3CCE N;  2NRR A;  4PKI A;  1DT9 A;  5BPL A;  3C7N B;  3TU5 A;  2VYP A;  1SS6 A;  1V4T A;  1ZC6 A;  3HBT A;  3A5M C;  3CJ1 A;  5E26 A;  3CXC M;  3M3Z A;  4MO4 A;  3RVC A;  3FR0 A;  5TKY A;  4K41 A;  4CBX A;  5BPN A;  1VQ7 N;  1YAG A;  3ENH A;  4YOU A;  4BR0 A;  1D4X A;  5AR0 A;  4BRG A;  4KH4 A;  1Q82 O;  3M6G A;  1T3V A;  2P9P A;  3CCR N;  2KKZ A;  3LDP A;  2BUP A;  4CZH A;  3ATV A;  4IOX A;  5BPM A;  1YJW N;  3HZ6 A;  3MWT A;  3LDN A;  2I7P A;  3CI5 A;  2AA4 A;  1NGH A;  4CZM A;  2HMP A;  3VPZ A;  3VF2 A;  1JJ2 M;  2PBD A;  2Q2R A;  3GDQ A;  3FLC O;  2CGJ A;  3O08 A;  4FWQ A;  3MN9 A;  3SMP A;  3CHW A;  5HL7 L;  1ATR A;  3ZX2 A;  4JKF A;  3QBW A;  4BGB A;  4FPB A;  1ILY A;  4FWS A;  3VEX A;  3R1X A;  2ZWH A;  4PL8 A;  1BDG A;  2H3G X;  1M1K O;  5F0X A;  2QWP A;  3AAP A;  3D7E O;  1Z05 A;  1GLD G;  3KZB A;  1S3X A;  3K9J A;  3VGM A;  3ZEU B;  4GVE A;  1N8R O;  1VQN N;  2WUS A;  3E9O A;  4PHT X;  4JD2 B;  4M63 C;  3HOS A;  4BC4 A;  3IKM A;  3VEW A;  5C12 A;  4CZI A;  4A2A A;  5M1Q A;  4C1N I;  4DHY A;  1TUY A;  4MO5 A;  1NGI A;  4A59 A;  5KPZ A;  1YIJ N;  3L4Q A;  4Y0W A;  3D6R A;  2D0P A;  1BG3 A;  3D2F B;  5AZI A;  3CCM N;  4CD3 A;  1BWF O;  3O9Q A;  3JXU A;  4AM7 A;  3G4S N;  3FZH A;  3H6E A;  3CJ9 A;  2HBL A;  3MWP A;  3NMU A;  1TYQ A;  3TPQ A;  3WT0 A;  3CIP A;  3QFP A;  3EO3 A;  3A5O C;  3WUH A;  3F5T A;  4WFA L;  3ENB A;  4JHD A;  1GLE G;  3DAW A;  2NRW A;  5TKW A;  4XEI A;  5GIP A;  4FL9 A;  3U4L A;  5CE3 A;  1NWK A;  1QQM A;  4I6M A;  4JKG A;  5AQG A;  4PKG A;  4BVP A;  3I33 A;  1QQN A;  2GWJ A;  4MLH A;  4BR9 A;  2D0O A;  3UE5 A;  4JKE A;  3W3D A;  3PIO L;  3O5B A;  5M1P A;  2ZGY A;  4JAX A;  2GTD A;  3CQY A;  4FO0 A;  4H0Y B;  4K43 A;  4EAH D;  4JNE A;  4MLE A;  5DM7 L;  3CCL N;  1WOQ A;  5LJW A;  1MDU B;  3LL3 A;  3F2K A;  4FOE A;  3P31 A;  3TTC A;  5AQN A;  2E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...