4BRIA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg umppnp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 117
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4briA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4briA02
4XH5A 4GY2B 4L3QA 1SZ2A 2D4WA 4ISFA 4Y0WA 1T44A 1H1VA 4AM7A 4B1XB 2P9NB 4BROA 3VGKA 1HKCA 5EXWA 5AQHA 5BPNA 2ZGYA 3FGUA 1X3NA 3FR0A 3LDPA 3BF3A 1NM1A 2E2QA 1P8ZA 5AQTA 3WXKA 3H45C 4CZLA 3C7NA 4BR2A 4QS8A 1TUUA 1V4SA 3U4LA 1T6DA 5JLFA 3ATUA 3A5LC 4B9QA 1Y64A 2I7NA 4H03B 4BRCA 4EHUA 5AQVA 4EAHD 3IDHA 2E2NA 3QB0A 4BRDA 3CI5A 5EY4A 1HJOA 2FF6A 3DXMA 4YDUC 2WUSA 3U8XA 4FWMA 5AQNA 1GLFO 5AQWA 3FZHA 2HF3A 3CJAA 2DPNA 2P9PB 5EOYA 4JD2A 1J6ZA 1U6ZA 4CZMA 4FL9A 3WXLA 3CQYA 2GWKA 3SK3A 5AQGA 4CBXA 5E26A 4BRHA 2D0OA 4NB4A 4XH1A 1GLDG 3TU5A 2CH6A 3O08A 3EN9A 2QXLA 4K43A 4FWOA 3H3NO 1BOTO 3VF2A 4B1VA 1NMDA 1KXPA 2P9PA 3AAPA 4ISGA 5I9EB 1YXQA 3R6MA 4BRKA 4BR5A 5AQXA 1U2VB 2W40A 1ATNA 2BUPA 5AQSA 3R8EA 1Q18A 3KZBA 1X3MA 3EKSA 3U9DA 2V51B 3EO3A 3DXKA 1HLUA 3QFPA 4IWVA 3VPZA 1CZAN 1TYQB 2P9UA 3W0LA 2F9TA 3F9MA 3SLCA 2V7YA 4A2BA 5B8HA 4FWSA 4XEIA 4BRMA 2ASOA 3SJHA 1SQKA 1NGJA 5AZJB 3FLCO 3VERA 2FF3B 1RFQA 1ESVA 3H6EA 3O1BA 3ZEUA 4BQLA 3W3DA 3FZFA 5F0XA 1TYQA 3ENHA 1HKBA 4PL8A 1S3XA 1QQMA 1LOTB 1WOQA 4BGAA 3WXIA 4FO0A 1IG8A 2F9WA 3D2EB 4HTLA 1QZ5A 1OKJA 1NGGA 4H0XB 4CD3A 4B1ZA 1QQOA 2UYTA 3HM8A 4JHDB 2AP1A 3CIPA 4WQ5A 5AQOA 4FWNA 3FZMA 1KAZA 5BN8A 3IMXA 2NZTA 1XUPO 4H0YB 5FPEA 4BRNA 1RDWX 3MN5A 2D0PA 4Z94A 4HWIA 4CBUA 3EKUA 2QWMA 2P9LA 1GLBG 1BA1A 3HZ6A 4K42A 5AFUA 3JS6A 4GNIA 1KAXA 2QW9A 2YHWA 3VEZA 4PKIA 4QS9A 3S41A 3M1FA 2QWRA 2QWNA 1DEJA 1RGIA 1ATSA 3QMLA 3ZX0A 2FSNA 1QHAA 2GUPA 5E84A 3HTVA 4BRQA 2OANA 3O5BA 3HBTA 4DQ8A 3RSEA 3BF1A 2A6AA 1YUWA 2FSKA 2FLOA 3C7NB 4BVOA 4F9OA 3HI0A 3H1VX 5BPMA 3O1WA 1T6CA 5AFUH 4QS7A 1GLCG 2IVPA 3D7EO 1R59O 1Z6RA 4J8FA 1IJJA 5AQLA 5KQDA 3DWLA 2P9SA 3DXMB 5AZIA 3ZETA 1NGBA 1NGFA 2Q31A 4CZJA 1NGHA 4FWQA 2VYPA 3B8AX 5BRHA 5ELZA 3O4WA 5TKYA 2A40A 3HSCA 3QICA 2BTFA 3LDNA 4JD2B 3ZX2A 1ZBSA 2CGKA 3LDLA 3WEEA 3L0QA 3SMPA 2CGLA 5KQ8A 4H0PA 4M7YA 2YCHA 2J4RA 4CZEA 1NGEA 4BREA 4BQZA 3A5MC 3VEYA 3QBWA 4BVPA 4EHTA 5BRDA 3D2FA 3UB5A 4BR9A 1GLJO 3R9PA 4A61A 2QWQA 3UKUA 5EVZA 4K25A 1DGKN 3ULEA 1NGDA 4FPAA 1BUPA 2ZGZA 3L4IA 1Z05A 4RCHA 3WUHA 4EFHA 4DB3A 4MLEA 2Q36A 3TPQA 3H46O 5BPLA 2D1KA 1WUAA 1GLEG 3CJ1A 4BRIA 3DJCA 3DXKB 3MMVA 5CE3A 1NGIA 2P9UB 4FOEA 3VEVA 4C23A 4IO8A 2A41A 4M63C 3CJ7A 1C0GA 1NBWA 2QM1A 3KVGA 5LJVA 4M7XA 4PKGA 1KAYA 5EX5A 5FPDA 3ZX3A 1QQNA 4FWLA 2Q2RA 1K8KA 3ENOA 1NGCA 3ZEUB 2VCPA 5KPTA 4WYBA 4FOIA 2E1YA 1HUXA 3WXJA 4FWRA 1E4GT 1BA0A 4BC4A 2YHYA 3VEXA 5AQMA 2QWOA 4K41A 2GELA 2IVOA 5AQKA 1GLAG 3AY9A 1NLVA 1HX1A 2Q0UA 4WQ4A 3IFRA 3VETA 3O8MA 5AQFA 5AQRA 3FZLA 4IJAA 1QZ6A 3BP8A 4CJ7A 2P9LB 1YVNA 3AARA 3KHYA 3LM9A 3BEXA 2VWBA 4WQ5C 4JNEA 1DKGD 3C0BA 3CJCA 4CI6A 1C0FA 3GOIA 3RSEB 3G25A 4I6MA 3UKRA 3DAWA 4IJNA 2YJEA 3VESA 5AQPA 1HKGA 5ADXA 4BR4A 2E2PA 2QWPA 2NLXA 4PL7A 5BR9A 4H0TB 2P9SB 2ASMA 2A5XA 3EL2A 5AZIB 3ZETB 4FPBA 2PBDA 1BDGA 4H5WA 4KBOA 3GL1A 2H3GX 3BUZB 3VENA 3H1QA 3H3OB 4IZ9A 2ITMA 2I7PA 4LC9B 4EIAA 3O80A 4CZKA 3A0IX 5LJWA 3WEEB 1HPMA 5BREA 1JCGA 4ISEA 5ADXH 3A8YA 2EWSA 2GTDA 2HMPA 4PKHA 4A62A 4BRLA 1XC3A 4XH4A 1LCUA 5FPMA 4BGBA 3QBXA 4BC3A 5KPRA 4CZFA 4BG8A 3D2FB 2E2OA 3FFKB 4RTFD 3UKUB 2CGJA 1BG3A 3ULEB 3MK6A 1MWMA 3MN7A 4BRPA 1BO5O 1YAGA 2QWLA 2GWJA 2NRHA 5BRFA 3MDQA 1V4TA 5AQJA 2FSJA 2E88A 3A5NC 5F2RA 1MA9B 2P9NA 3MN9A 1ATRA 1D4XA 4CD1A 3VF6A 4FWKA 3AAQA 4A2AA 4AM6A 1K8KB 3VGMA 2FXUA 5JMVA 2CH5A 5AR0A 4BR7A 3I33A 3J8AA 2HF4A 3A5OC 4H5NA 4YDUA 1NWKA 4H5RA 2KHOA 1BU6O 3P4IA 3CHWA 2HOEA 4BRGA 2ZWHA 3ATVA 5AQIA 4E1JA 5JLHA 3CETA 3FZKA 3M6GA 1S22A 4H0OA 4BC5A 3LDQA 5BN9A 1G99A 5F1XA 4MLHA 4RWTA 3IUCA 3MN6A 4CBWA 2W41A 4H0VB 4CZHA 2P9KB 4BRAA 3U9ZA 4B1WB 2Q97A 3WT0A 4FWPA 2YI1A 4WQ4C 2P9IB 5AQYA 3VEOA 3VEWA 2IIRA 3QDKA 2A3ZA 2A42A 4BRFA 4B1YB 5FPNA 2ASPA 4BR0A 4BG9A 2IVNA 2YJFA 2PAVA 2V7ZA 3I8BA 4I6MB 3UKRB 4CZIA 1ZC6A 2P9KA 3O6WA 3UE5A 1U2VA 1JCFA 3GDQA 4MO5A 1NGAA 3VOVA 4H5VA 3JXUA 3OHRA 2E1ZA 3QFUA 4IXCA 2P9IA 1E4FT 1SAZA 5LY3A 3L6QA 2V52B 4O5FA 1XQSC 3CJ9A 1MDUB 4NO7A 3FE1A 4H5TA 3WQUA 3LL3A 1MWKA 5KPZA 4JAXA 5AQQA 2E8AA 4B1UB 1X9JA 3M3ZA 3WQTA 4FSVA 3VF4A 5AZJA 2AA4A 2GEMA 3LDOA 4MO4A 1ZXOA 1TUYA 4JN4A 1EQYA 3ID8A 3GG4A 3CJBA 3VGLA 2Q0RA 1BWFO 2Q1NA 3CQXA 4BC2A 3EZWA 4O8KA 5JICA 3GE1A 5AQUA 3SMSA 3LM2A 4DCHA 1JCEA 3CERA 2E20A 1GLLO 3MCPA 4DHYA 2ZF5O 3D2EA 4CZGA 2YHXA 3GBTA 4JHDA 5AQZA
chains in the Genus database with same CATH superfamily
2KQ2A 1A5VA 4GY2B 3TAMA 3RRHA 3U6FA 3FFIA 4MQ3A 1H1VA 2YX6A 3HRGA 4CGDA 1XMQK 2HW3A 5BPNA 4FJKA 3KKRA 2IGIA 2YHAA 4B3SK 2E2QA 3AVAA 3WXKA 3F5TA 2PY5A 3C7NA 4QS8A 1V4SA 1J53A 3MWTA 3THXB 3ATUA 2FBTA 1NK0A 4B9QA 3O9TA 4CF0A 1L3VA 2UUAK 3IDHA 3PUFA 4BRDA 5EY4A 4B3TK 3K0SA 4DSIA 5AQWA 4OKKA 3NCIA 3CJAA 4B3RK 4JD2A 1J6ZA 2XY8A 5GAHP 3G6EN 5J2NA 4FL9A 1IBLK 4DQSA 3SK3A 3K5OA 4BRHA 1HJRA 1L3UA 4JS5A 4XH1A 3OA9A 3ZSVA 1KVBA 4RW6A 2CH6A 3O08A 3CPWM 3AA5X 3MXIA 4K43A 4CJRA 2B6AA 1XNQK 4DFKA 4NYNA 4BY9C 3VF2A 1EX4A 3DMJA 1NMDA 2RHKA 4B1VA 1VAZA 2OZMA 3CYMA 4ISGA 1YXQA 3R6MA 2G8UA 1U2VB 2W40A 3DRPA 2XY7A 1X3MA 3OY9A 2V51B 3DXKA 4IWVA 5KGXA 3VPZA 1TYQB 4W5TA 2P9UA 3ZLJA 1NK5A 3SLCA 2PFUA 3L2RA 4XEIA 4Q0BA 4LD0A 4BRMA 2ASOA 4DTXA 3E9LA 4A5AA 3TWHA 4FJHA 1WSJA 4BWJA 4FW1A 3ZEUA 3O1BA 4BQLA 2KLAA 3ENHA 2WOMA 5HRSA 1S3XA 5J1EA 3N4PA 4BGAA 3K59A 4ELUA 4NYFA 2O8DB 3VQ7A 4Z4EA 4H0XB 1C0UA 4CHQA 1J5OA 3CIPA 2ZQBA 4KREA 3RR8A 1KAZA 5BN8A 4M3YA 1XUPO 4ZTJA 4BRNA 4CBUA 3MWPA 1RDBA 4E7HA 4ICLA 3M1FA 5C25A 2QWNA 1DEJA 5LL6Z 5HOOA 3QMLA 3ZX0A 2FSNA 3AVGA 3QLHA 3CCRN 4KHNA 4FZXC 3RSEA 3EE9A 2FSKA 3SQ4A 1CLQA 3E01A 1HR0K 1C0MA 1VQLN 3H1VX 2JLEA 5BPMA 3D7EO 1Z6RA 4J8FA 4JI5K 4DR2K 2JGUA 5KQDA 3HPOA 1QS4A 3PSFA 2P9SA 4DTUA 2GV9A 2Q31A 1QVGM 1HNZK 4JV5K 3B8AX 3S3NA 1FKOA 4UQGA 3HSCA 1B9FA 2BTFA 4B9VA 3ZX2A 4IOAL 1ZBSA 4DSEA 3LDLA 3O9QA 4CJFA 3PIOL 3J7YP 3L0QA 2FBVA 3LWLA 3MEDA 5KQ8A 1Q8IA 4FLVA 2J4RA 4KV8A 4DG1A 3OVNA 1OVQA 5FRMA 1QE1A 1NGEA 3SUPA 4FJLA 1HYSA 3D2FA 3TSQA 4BR9A 1GLJO 3R9PA 3UIQA 5EVZA 4M3TA 2OYQA 4AHVA 4FPAA 4AHRA 4EFHA 3TPQA 1WUAA 1RILA 4BRIA 2O8BA 1WSHA 4DR3K 4CJ4A 3L2UA 4KI6A 1QHTA 5DMRA 2QM1A 2E5LK 2GX9A 1JJ2M 5C12A 5EX5A 2HMIA 4OPKA 4KTZA 1QQNA 4G9ZA 4E1NA 2O8CA 1SV5A 3T7ZA 1HUXA 3HVRA 4DFPA 3RMBA 3KK7A 1SKSA 3WXJA 4WCEL 4FWRA 3SPYA 3K5LA 3SUNA 2YHYA 5J2MA 5AQMA 1ILYA 2G8HA 3KLIA 2Q0UA 3O8MA 5AQFA 3J7ZO 3FZLA 3I56N 3TANA 3BP8A 4DTNA 2P9LB 3AARA 3KHYA 3LM9A 1TV6A 3TI0A 3MEEA 4JEPA 4DR7K 1NKBA 4KPYA 1RBVA 1X9MA 4NXNK 3QINA 4CI6A 4YOUA 3G25A 4DUYK 3VQ6A 3VQCA 1X9WA 1REVA 1YJNN 1HKGA 3C95A 4BR4A 3NHGA 2QWPA 2RPIA 4AILC 1D8YA 1TAUA 5AZIB 3ZETB 2RF2A 4H5WA 1VQMN 1T8EA 4IFVA 3L2VA 1KD1O 4ID5A 4FZZA 3VENA 5GIOA 3NVMA 2I7PA 3O80A 4CZKA 5LJWA 1BI4B 5BREA 3CG7A 1HNVA 3V9XA 2EWSA 3J80O 2HMPA 4BRLA 4CJWA 4C8OA 4CGHA 4BC3A 4HVJA 5KPRA 4F2SA 3V9UA 3J81O 1VQKN 2E2OA 2CGJA 1VQ5N 3ULEB 1Q81O 1NOYA 2I5JA 3HO1A 1YAGA 4E0DA 4H4OA 5CYQA 1JLAA 3LP0A 3CF5L 2W6LA 3A5NC 3MN9A 2P9NA 1GOBA 4XIUA 3NE6A 4A2AA 2PZSA 1OH6A 3SI6A 2HHXA 1LAVA 1WAFA 1OVYA 4H5NA 1VQ6N 4YDUA 1NWKA 5IWAK 1BCOA 4H5RA 2KHOA 2BGGA 4DWIA 1BU6O 1UA0A 5M1OA 3HJFA 2ZWHA 5J2QA 3M8QA 2WC9A 3M6GA 2QXFA 1KLNA 5FLXO 3OYHA 3LP1A 1EWRA 5BN9A 1YHQN 5F1XA 1IH7A 3IUCA 3MN6A 4CBWA 1K6YA 4I9LA 4M42A 5HLFA 3V9WA 4B1WB 4MDBA 3WT0A 2YI1A 2P9IB 5AQYA 3S3MA 3VEOA 3VEWA 3CFPA 2HHTA 4W5RA 4AQYK 3R1XA 1KRPA 2A42A 4BRFA 3NBPA 2ASPA 4BR0A 2YJFA 2PAVA 4I6MB 4CZIA 2ZD1A 4HCBA 1ZC6A 3O6WA 1QQCA 3UE5A 2ZJPL 2OZSA 1VSJA 1JCFA 1RT3A 3VOVA 3ZT1A 3LP3A 4H5VA 1XMOK 4AF1A 1E4FT 1SAZA 5LY3A 2QTDA 4C1NI 1XQSC 1JLGA 3SJJA 2HB5A 5KPZA 3OYDA 1KC8O 4B1UB 4M3RA 4DR5K 1WB9A 4EZ6A 4FSVA 5AZJA 4JKGB 3LANA 1TUYA 4JN4A 5GINA 2WFBA 1HQUA 1JXBA 4JRQA 3OS2A 4DR6K 1RDDA 4YOXA 1Q82O 2D0CA 3THWB 3ZSWA 1TKXA 1XWLA 2IOCA 3QEXA 4DTJA 5FDLA 4HCCA 3NDKA 3VMFB 5HRPA 3GBTA 4JHDA 3MXMA 4OJRA 1YJWN 3KK3A 2UXDK 1QSLA 4IFYA 1VSMA 2BANA 1HRHA 1S9EA 3NAEA 1SZ2A 4ISFA 1XHXA 4Y0WA 2O4IA 4AM7A 4B1XB 3PO4A 3M5RA 4F8RA 3TTDA 5GIPA 3TSPA 1K73O 2ETJA 3OYEA 4DF8A 2HVIA 3FGUA 1X3NA 3LDPA 1RT5A 3KKSA 1P8ZA 4CZLA 3QESA 4AH9A 3ZT2A 3CQ8A 3OTOK 3U4LA 4GV9A 4DQPA 2XY6A 4CK2A 2YNHA 3V1OA 3A5LC 3V1QA 2I7NA 4FK4A 1NKCA 1HQEA 3VN5A 4EAHD 3TAQA 3CI5A 3P1GA 1HJOA 2QEXN 3AVMA 4B9NA 3OYGA 3FZHA 1BHLA 5EOYA 1IBKK 2QI2A 1JKHA 3CQYA 2GWKA 4H8KA 3K57A 1KFDA 5AQGA 1P90A 2D0OA 4FLUA 2ZJRL 1GLDG 3K5MA 3C6UA 3EN9A 4CF9A 2O8EA 4FLWA 3VA0A 4AHCA 1QTMA 3ZCMA 4FJ8A 4GVEA 1KXPA 1EO1A 2P9PA 4N47A 3ZSXA 4A59A 4Q5VA 3RTVA 5CZ1A 5D3GA 1N33K 1FKPA 5AQSA 5C42A 5J2PA 4BWMA 3KZBA 1IBMK 2VGNA 4FJGA 3EEQA 2Z1IA 4LF5K 3EO3A 4FJJA 2VG5A 4ID1A 1YT3A 3AVHA 4FZYA 1CZAN 3F9MA 3HVTA 1NJYA 1VQ7N 4A2BA 5B8HA 2HNDA 3CCSN 4CW7B 4DSFA 3PO5A 3ULDA 1YF5L 4E19A 4JKAA 3PLAA 3NH1A 4BDPA 5F0XA 2F4VK 4BACA 1HKBA 4RG8A 2D0AA 3PX4A 4J2BA 3SCXA 3AO4A 1OKJA 4DV4K 4CD3A 3BGRA 3HM8A 1C1CA 2UYTA 2AP1A 4WQ5A 4QAGA 1RDUA 4EZ9A 1K8AO 4CFAA 4CIFA 1ITGA 4E7JA 3NF9A 2NZTA 3NF6A 4BE0A 2E6LA 4H0YB 4I7FA 3SAGA 1SL1A 1RDWX 1WNSA 4JK9A 3EKUA 1NMNA 4FLXA 3HZ6A 4CJLA 5LMNK 1WSGA 3SUOA 5HBMA 3VEZA 2YHWA 4PKIA 2W6KA 3ID6A 4CCHA 1ATSA 4BE1A 3O4QA 5E84A 3PIPL 2OANA 1NK6A 1SL0A 3AVCA 4CJVA 3WNHA 4H4MA 4DTMA 2VWJA 2A6AA 3VQAA 1YUWA 3RWUA 4F9OA 2RN2A 1T6CA 1RTJA 5HRNA 3SZ2A 4Z4GA 3EY1A 4CEEA 4K0KK 5AQLA 1EKEA 4HTUA 3DWLA 3ENBA 1A5XA 3DXMB 1TAQA 4CZJA 1Z26A 4FWQA 2VYPA 1M1KO 4AHUA 5TKYA 3SBTA 3QICA 1NNEA 3RR7A 1NK8A 4OKEA 1HYVA 3WEEA 4DTSA 2G8IA 4E7KA 1I39A 3OYIA 2YCHA 2BH1A 1TKDA 5CZ2A 1VHXA 3VEYA 2XHBA 4BVPA 3KJVA 4OLAA 5TKWA 4OKJA 4U7BA 3CFRA 3UKUA 1DGKN 4RCHA 1BUPA 2ZGZA 3WUHA 3H46O 3VQ4A 5BPLA 2D1KA 3ZSOA 3TABA 1GLEG 2KW4A 3MMVA 3TAPA 3CXCM 1TK8A 4IO8A 2A41A 4M41A 3LWMA 5CR4A 3KLGA 1W97L 4U67L 3CJ7A 1NBWA 5LJVA 4J2EA 1RBTA 4M7XA 2HHHK 3DRSA 1TVRA 3ZX3A 1OH7A 1K8KA 2NRVA 2WTUA 3O9SA 3DLLL 3WNFA 1D9FA 1QVFM 1E4GT 1BA0A 4BC4A 1TGOA 4N41A 2QWOA 2G8VA 4K41A 2ATQA 2GELA 5AQKA 3WXMB 1GLAG 1NK7A 1HX1A 5M1QA 4MDAA 4WQ4A 5KGWA 4NCAA 2HHSA 3ZT0A 2OTJN 4IJAA 3LPUA 3E9OA 1ZBHA 3I55N 3TTCA 4CF2A 1JLEA 4B9TA 1HYZA 3IS9A 1FW6A 3BEXA 3SNNA 2VWBA 4JNEA 4BDYA 3C0BA 3K2PA 3F9KA 3VQDA 2VGMA 5SWMA 3OJSA 1FK9A 3DAWA 4OPAA 3VESA 5AQPA 5ADXA 1BQNA 4W5OA 3BY5A 4FJ9A 5BR9A 2VQFK 3RRGA 4H0TB 3D0PA 3G4SN 2PBDA 4KBOA 1ZYQA 4LSLA 3GL1A 1F21A 1Y97A 2QK9A 1JXEA 3ZSZA 3BUZB 1NKEA 4N56A 3RMDA 3H3OB 4IZ9A 2ITMA 5KI6A 4DUZK 4EIAA 1XHZA 1JL1A 4ISEA 5ADXH 4K8XA 1LV5A 1B9DA 4PKHA 4A62A 3AVBA 4DR4K 1XC3A 4JI0K 1KLMA 3NFAA 4BGBA 3QBXA 4M3UA 4CK1A 4F2RA 3FFKB 3ISNC 2RKIA 3MK6A 1TK5A 1VSEA 1WLJA 5M1NA 3MN7A 3L2WA 4C8LA 1C1BA 3KWGA 2YNIA 3A2FA 3S9HA 1S5JA 2GWJA 2NRHA 2Z1GA 4FW2A 4QCLA 3V9SA 4HHTA 3AV9A 1V4TA 5AQJA 2FSJA 4LF6K 2E88A 3LAKA 5M1PA 4M3WA 4CIEA 1X1PA 3VGMA 4NLCA 4GKJK 4DF4A 2HF4A 1LAWA 3IKMA 3KLFA 4EP4A 3THXA 3CHWA 2HOEA 4IFEA 1SL2A 3M8PA 1IV0A 4E1JA 5JLHA 2UXBK 3FZKA 1S22A 3CM5A 3G0ZA 4BC5A 3F73A 3AVJA 3LDQA 4FJMA 3CD6N 3N4QA 4MLHA 4F3TA 4E7IA 3LDSA 1OH8A 3QO9A 1HMVA 3KD5E 1L5UA 1S1TA 3S3OA 1S72N 3QERA 3R3LA 3AO3A 2IIRA 4C8MA 4JKCA 4DU1A 4OGEA 5FPNA 2YNFA 4BG9A 4DLEA 1VK0A 5M1FA 3HOSA 3I8BA 3UKRB 2EHGA 4J2DA 5HRRA 1QSSA 1U2VA 4MO5A 4JRPA 3CC4N 1O13A 3QFUA 3C6TA 4B9UA 4KO0A 1IKWA 2HSTA 3LZJA 1NG9A 3L6QA 4O44A 4DTRA 3FE1A 3LL3A 4CHZA 2PYJA 2X6NA 1Q7YO 1N36K 5AQQA 4M3XA 1U04A 3K9KA 3O9UA 2Z1JA 3AVNA 1ZXOA 4MO4A 4FJXA 4KTQA 4YOYA 2Q0RA 1HNWK 4JKFA 3CQXA 2O8FA 4CJSA 3GE1A 2O8DA 4Z4CA 3CERA 2E20A 4RW8A 4J2AA 2WONA 4W5QA 4OPHA 5AQZA 4JKEA 3ZT4A 1NK9A 4XH5A 3VQ9A 4CGIA 4E1MA 1RDCA 3NGIA 3OS1A 2E4LA 1Q86O 1BIZA 3IRXA 1I94K 4IKFA 2D4WA 1DT9A 1T44A 4OGCA 5DK5A 2F8TA 3AO1A 1HNIA 1T7PA 3CCVN 1HKCA 3D45A 5EXWA 1RNHA 2ZGYA 2YKNA 3BF3A 1IO2A 1NM1A 3H45C 3OYLA 1T05A 1T03A 2HBKA 3P31A 5JLFA 1TUUA 1T6DA 4IEIA 3ZSRA 4DU4A 1Y64A 1EWQA 4H03B 4N5SA 4BRCA 3RMAA 4EHUA 3O3FA 4JS4A 4CEFA 2FF6A 2WUSA 3U8XA 4N76A 5AQNA 3DYAA 1DTTA 1VSHA 3HP9A 2P9PB 4CZMA 3WXLA 4LFAK 1LWFA 4CBXA 1IG9A 1RT7A 4X66K 3TU5A 3ZSYA 4PHTX 2QXLA 1RT2A 2X6SA 4PUOA 3ITHA 4FWOA 3H3NO 1S1XA 4PA1A 2P1JA 1LWEA 5I9EB 2R7YA 4DV2K 4BR5A 3MAQA 2XO7A 3OYMA 1ATNA 1EETA 2RE2A 1JL2A 1Q18A 3EKSA 3U9DA 1ASVA 1S6QA 3KTQA 4CHPA 2AJQA 3QFPA 3RMCA 3KIOA 4CEZA 3W0LA 1A5WA 2F9TA 4DV7K 4FWSA 2A1SA 1RTIA 3SJHA 1SQKA 2IDOA 4FCYA 1KVCA 3D6RA 3FLCO 3VERA 1KQSM 2FF3B 1RFQA 1UWBA 2NUBA 3NGZA 1N5YA 4CGGA 4KHYA 2HHQA 5KTQA 4DKWA 4PL8A 3VTIA 4CFCA 4KH4A 4CEDA 1LOTB 4KFBA 4DQRA 3WXIA 1XI1A 4FO0A 1IG8A 3THYB 4YORA 4NLBA 4L8RB 4CJKA 1W0HA 1VSFA 4WFBL 2F9WA 3WNEA 4CGFA 3D2EB 4HTLA 1QZ5A 1Q9YA 1NGGA 3HL8A 4JKHA 2VG7A 3G10A 4B1ZA 3PX0A 3L4QA 4KHWA 3FZMA 1VQON 1VQ9N 4B9LA 1BGXT 2UXCK 2D0PA 4Z94A 4W5NA 2QWMA 2P9LA 1GLBG 1BA1A 5FROA 1WBBA 3AVKA 4GNIA 1KAXA 2QW9A 3LP2A 3S41A 4QS9A 4CJPA 3THVA 3O3GA 1RGIA 1W7AA 2GUPA 3O5BA 3KK2A 4DQ8A 3HPGA 1IKVA 1U45A 2FC0A 2FLOA 3C7NB 1J9AA 4BVOA 1M90O 3ALYA 3VQEA 4QS7A 2OTLN 1VRTA 2IVPA 3IG1A 3SBGA 1IJJA 1J54A 2G8KA 4ELVA 3T1YK 3DM2A 5AZIA 3ZETA 4OLBA 5BRHA 5ELZA 3VTHA 5GAEP 2A1RA 3VQ8A 4CFDA 3LDNA 4JD2B 4O5BA 4OPJA 1U48A 3JSMA 3CM6A 1BI4A 2VWKA 4JI4K 1JLBA 3SMPA 3KLEA 3OYFA 2CGLA 3H08A 3LAMA 3AVIA 3TSUA 4CZEA 4BREA 5HL7L 2G8WA 1UA1A 1O1WA 1YTUA 3QBWA 3MCAB 5BRDA 2ZM6K 1WSFA 2QWQA 3ULEA 1NGDA 3L4IA 3SQ2A 1Z05A 1JLQA 2HVHA 3T1AA 4DB3A 4MLEA 4FLYA 1RBRA 1G15A 3CJ1A 3DJCA 3DXKB 5CE3A 4DMNA 3VQBA 2WBNA 2P9UB 4B3MK 3VEVA 3AO5A 1C0GA 4PKGA 4FJ7A 5FPDA 2OPPA 3V4IA 2DY4A 4FWLA 2Q2RA 3ENOA 3K9JA 1YJ9N 2B4JA 3ZEUB 2VCPA 5KPTA 4BE2A 5H1SQ 2NRWA 4WYBA 4FOIA 3MX2A 1S9GA 4MFBA 2NRZA 1S1UA 4E89A 4JI8K 2HHWA 2IVOA 4IG0A 1TL1A 3AY9A 5CY4A 2YKMA 3P83D 4M3ZA 3NF7A 3DLHA 5I3UA 2VQEK 4FK2A 1QZ6A 3C65A 3U3GA 1YIJN 4X65K 3E1YA 1YVNA 2X78A 4DTOA 3OYJA 3SUQA 4CF1A 1QSYA 3CJCA 3VQ5A 1CXQA 4FLTA 3GOIA 3RSEB 2OA8A 2KFZA 4I6MA 2JWKA 4IJNA 2E6MA 2YJEA 2IS3A 3SPZA 1WSEA 1K9MO 4WF9L 3HOTA 2E2PA 3KWIA 2D5RA 2NLXA 4PL7A 3SYZA 2P9SB 4PQUA 2ASMA 3SAFA 4HUFA 1BDGA 4B9MA 2OCEA 4GW6A 4O55A 3OYKA 5DM7L 3AA2A 1SUQA 3SV3A 1U49A 1RT6A 4JKGA 4LF7K 4UY8O 3A0IX 5HP1A 1HPMA 3I8DA 4CVNE 3CFOA 3LALA 3V9ZA 4FVUA 4KH6A 5CHIA 1LCUA 5FPMA 3QEVA 3THWA 3MX5A 3P39A 4CZFA 4BG8A 3D2FB 4RTFD 1BG3A 3PV8A 1NJIO 4CK3A 4RW4A 2JWLA 4BRPA 3CCLN 1BO5O 1VRUA 5MLCQ 1KFSA 2O8BB 4HUEA 1S6PA 2QWLA 5BRFA 3MDQA 3BDPA 1XNRK 4RW9A 2YHBA 4X64K 1BQMA 3B6PA 5I42A 3E66A 1CZBA 3AAQA 4GV3A 2FXUA 3LPTA 5JMVA 3I33A 3Q7BA 3HP6A 3J8AA 1TK0A 1D5AA 4JI6K 4DV5K 2O8CB 5SZTA 4E3SA 3CCMN 4CESA 3OW2M 4K8ZA 3P4IA 1C6VA 4I2PA 3HK2A 4CJQA 4BRGA 2P5GA 5AQIA 4FJ5A 3CETA 1S1VA 1J5EK 4CFBA 4H0OA 3VA3A 1NOZA 4KKOA 1VQ8N 2P51A 4OX9K 5LMUK 1G99A 2EX3A 1Q9XA 1BL3A 2KZMA 4DFJA 1FJGK 1BCMA 3KK1A 4BRAA 3U9ZA 3QNOA 2Q97A 3NVKA 4FWPA 4O4GA 5C2DA 1E3MA 2NRRA 3G71N 2ITGA 4KRFA 3QDKA 3T1HK 2A3ZA 2UU9K 4B1YB 3K58A 5C15A 4YFUA 1MU2A 2V7ZA 2G8FA 4JLHA 2P9KA 2NNWA 3T69A 4C8KA 3AO2A 4LFCK 3OHRA 4CERA 4IXCA 4ILGB 3DOLA 4LY7A 2V52B 4TSXA 4O5FA 2IC3A 1MDUB 4NO7A 2IAJA 1XC9A 3DLEA 3CMEN 3EZ5A 4JAXA 2O8FB 4CJ5A 3J7AP 3NGYA 5JS1A 3M3ZA 1X9SA 3VF4A 3OYBA 2AA4A 2GEMA 1Z25A 3AGRA 2OPRA 3LDOA 1EQYA 3GG4A 3CJBA 1DTQA 5GADP 4IOXA 3MXJA 1L3SA 4O8KA 5JICA 5AQUA 3LM2A 4DCHA 1JCEA 2HNYA 2ZE2A 4E7LA 2UUBK 1GLLO 3MCPA 4GKKK 4CZGA 3U3YA 3SQ0A 2YHXA 5JVGL 5EU7A 4DSKA 4FM1A 4KB1A 3SQ1A 3C6AA 1ASWA 1VSIA 4L3QA 1KVAA 2GUIA 3V1RA 5GAGP 2P9NB 4BROA 4JK8A 3VGKA 2HBLA 4WFNL 4JI1K 4CJEA 3HXMA 5AJ3K 3M8SA 5AQHA 4CJUA 3PX6A 1YI2N 3FR0A 1N32K 5AQTA 3HYFA 3E9PA 4KI4A 4BR2A 3DRRA 5CYMA 1RTHA 4YOWA 4YHHK 3QEIA 4OO1J 4FYDA 3WNGA 4JK7A 4CHNA 3HM9A 4C8NA 4O0JA 5AQVA 4DV6K 2E2NA 3QB0A 1JLFA 4KHPK 3OBYA 4YDUC 3DXMA 1HPZA 3MECA 4FWMA 3AA3A 1TKTA 1GLFO 3V81A 5KRTA 2HF3A 1BISA 4DV1K 1VQ4N 2DPNA 1U6ZA 4DQQA 1U4BA 5E26A 3L8BA 4NB4A 4OVLA 4LF8K 5DM6L 1KTQA 4CEAA 3BZCA 3L3UA 1C0TA 1D9DA 4KB0A 1BOTO 4CE9A 4CJTA 3NMUA 3DLRA 3AAPA 3ZSQA 5A2QO 4DLGA 4LFBK 4BRKA 4DFMA 1WAJA 5AQXA 4C1NK 1FXXA 2Y1IA 1UAXA 2BUPA 3TTFA 4AHTA 3TAGA 1LW2A 3R8EA 4Y1DA 4CEQA 2GBZA 3MEGA 3DLBA 4V19S 4IOCL 1HLUA 5C2FA 1YITN 1RDAA 2V7YA 4DS5A 1JLCA 4F3OA 1NGJA 5AZJB 1NK4A 3PY8A 1NJXA 3VQPA 1R0AA 1ESVA 2HBJA 3H6EA 3TAFA 4I9QA 5C0YA 3W3DA 3FZFA 4CJ3A 1TYQA 1EP4A 4X62K 1QQMA 1WOQA 4ELTA 3IAYA 4GVMA 2QA4N 1QQOA 4JHDB 1ZBIA 5AQOA 1UOCA 1ZBFA 4FWNA 2BE2A 3IMXA 3AVFA 4NCGA 3NF8A 5FPEA 5HROA 3MN5A 3OYNA 4HWIA 3TR8A 1NJZA 4IO9L 1N34K 4B3OA 4K42A 4IBNA 5AFUA 3JS6A 4CEBA 1WBDA 4Z4HA 2QWRA 4A5BA 3P5JA 3TAEA 1QHAA 3HTVA 3K5NA 4BRQA 1ZBLA 3KLHA 3HBTA 2QKBA 2NRXA 3BF1A 2NRTA 1IKYA 3HI0A 1RTDA 4R79A 3O1WA 5AFUH 4B9SA 5JS2A 1GLCG 3OS0A 2YV0X 1R59O 1NJWA 4CHYA 4WE1A 4CEOA 1KCFA 4G1QA 2DTUA 2HNZA 2Q3SA 1NGBA 1NGFA 3JYTA 1W9HA 1NGHA 1RT4A 4HUGA 2XRIA 2KTQA 3O4WA 2A40A 4LH5A 2HBMA 4YOTA 2CGKA 4LF4K 4CECA 3VQQA 3DLGA 4A57A 4FM2A 2VG6A 4H0PA 4M7YA 4FJIA 3DOKA 2O8EB 4BQZA 3A5MC 4EHTA 3UB5A 4Y1CA 1CXUA 4A61A 4NCBA 3EYZA 4K25A 3Q7CA 2X74A 2Q36A 5K14A 1CZ9A 1NGIA 1W2BM 3QEPA 4FOEA 3ASMA 2W42A 4JKBA 4C23A 4M45A 4M63C 3ZT3A 4Z0UA 3KVGA 1KAYA 4FVMA 3HSTB 4CIGA 1BIUA 1NGCA 1RBUA 2B5JA 1IKXA 1B92A 2E1YA 1VQPN 4B8CA 4O0IA 4DTPA 1VSDA 3OYCA 5BR8K 3OYAA 3VEXA 2YNGA 5IT9O 4DV0K 1RBSA 1NLVA 4LH4A 3VETA 3IFRA 5AQRA 3BZKA 1L3TA 5M1KA 4CJ7A 3AGKA 2ZJQL 4FXDA 2HHUA 3M8RA 3P38A 2UUCK 4FK0A 3CCQN 4WQ5C 1DKGD 3OJUA 2KKZA 4KTWA 2QKKA 1EXQA 4YY3K 1RCHA 2FBYA 4CHOA 3QIPA 1C0FA 2LSNA 3UKRA 3AVLA 2KFNA 1LWCA 4IDHA 2O4GA 3DI6A 4IEEA 4DSLA 1VSLA 3B6OA 3V6DA 4KAZA 2A5XA 3EL2A 2DFEA 3HT3A 4FPBA 1S1WA 3EE8A 2F8SA 2HHVA 2H3GX 4IG3A 3DLKA 3H1QA 4LC9B 3WEEB 1JCGA 3O4NA 2D0BA 4Z4FA 3A8YA 4KH5A 2OPQA 2GTDA 4KHSA 1KSPA 4XH4A 1I3AA 3SV4A 1YTAA 3I0SA 4CGJA 3UKUB 1MWMA 4I2QA 4JKDA 3QNNA 5KRSA 1WSIA 4NXMK 4YOVA 3CPEA 4DU3A 4LSNA 3NH2A 1N6QA 3KD1E 4DQIA 1HNXK 3CCEN 4JI7K 3CC2N 5F2RA 2XY5A 1MA9B 3C94A 1ATRA 1D4XA 4CD1A 3VF6A 4FWKA 4AM6A 2OPSA 1NU0A 1T3VA 1K8KB 4F4KA 2CH5A 5AR0A 4BR7A 4CF8A 3PSIA 1OH5A 3O3HA 3A5OC 4R5PA 4PY5A 1U47A 4IDKA 4B8AB 1GOCA 3CC7N 4KHQA 3O9RA 4JI3K 1TL3A 4ILJA 5JVHL 1C1AA 3ATVA 2DFFA 4B08A 2FBXA 4RW7A 1SKRA 4O8UA 4PWDA 4BDZA 3I0RA 1SKWA 2P5OA 1WN7A 4Z4IA 4YNQA 4RWTA 4DS4A 4JI2K 2W41A 4H0VB 3QIOA 4CZHA 4LF9K 2P9KB 1YVUA 1ZBUA 1N8RO 4DV3K 3QETA 2F7TA 1SS6A 1LW0A 1VSKA 5FRNA 4WQ4C 5T7BA 3OBWA 2BDPA 3ZYYX 1ASUA 3RVCA 2IVNA 2F96A 5E41A 2PYLA 3GDQA 4KHUA 1NGAA 3JXUA 3TARA 2E1ZA 4GMJB 4ZHRA 4FM0A 2P9IA 5C10A 1GOAA 3NH0A 3CJ9A 3F2KA 3HPHA 4WFAL 4H5TA 3WQUA 1MWKA 4EP5A 5C24A 2E8AA 4ILHA 1X9JA 4AHSA 3WQTA 3CCJN 3L2QA 4QOZB 1TKZA 3ID8A 4ZTFA 3T19A 4DSJA 3L3VA 4FJNA 3AA4A 2Y1JA 1VQNN 3VGLA 2DFHA 4DR1K 1BWFO 2Q1NA 4BC2A 3CMAN 4FLZA 3JAMO 3CCUN 2Z1HA 4JYAK 3EZWA 1DLOA 3QEWA 2KZZA 3SMSA 4GV6A 3THYA 3SAHA 3LZIA 4DHYA 2ZF5O 3C6HA 3D2EA 3T3FA 1RT1A
chains in the Genus database with same CATH topology
4JKEA 5JVGL 1YJWN 4XH5A 3C6AA 1Q86O 4GY2B 4L3QA 1SZ2A 2D4WA 1DT9A 4ISFA 4Y0WA 1T44A 1H1VA 2YX6A 4AM7A 4B1XB 5GAGP 2P9NB 3HRGA 4BROA 3M5RA 4JK8A 3VGKA 2HBLA 4WFNL 3TTDA 5GIPA 3CCVN 1HKCA 3TSPA 1K73O 5EXWA 5AQHA 5BPNA 2ZGYA 3FGUA 1YI2N 1X3NA 3FR0A 3LDPA 3BF3A 1NM1A 2E2QA 1P8ZA 5AQTA 3F5TA 3H45C 3WXKA 4CZLA 2HBKA 3C7NA 3E9PA 3P31A 4BR2A 4QS8A 1TUUA 1V4SA 3MWTA 1T6DA 3U4LA 5JLFA 4YOWA 4IEIA 4GV9A 3ATUA 4OO1J 4JK7A 3A5LC 4B9QA 1Y64A 2I7NA 3O9TA 4H03B 4BRCA 4EHUA 5AQVA 4EAHD 3IDHA 2E2NA 3QB0A 4BRDA 3CI5A 5EY4A 3OBYA 1HJOA 2FF6A 3DXMA 4YDUC 2QEXN 2WUSA 3U8XA 4FWMA 5AQNA 1GLFO 5AQWA 3FZHA 2HF3A 3CJAA 1VQ4N 2DPNA 2P9PB 5EOYA 4JD2A 1J6ZA 5GAHP 1U6ZA 4CZMA 3G6EN 2QI2A 4FL9A 3WXLA 3CQYA 2GWKA 3SK3A 5AQGA 4CBXA 5E26A 4BRHA 1P90A 2D0OA 4NB4A 4XH1A 3OA9A 2ZJRL 1GLDG 3TU5A 5DM6L 2CH6A 3O08A 4PHTX 3EN9A 2QXLA 3CPWM 4K43A 4FWOA 3H3NO 1BOTO 4BY9C 3VF2A 4B1VA 3NMUA 1NMDA 2RHKA 4GVEA 1KXPA 1VAZA 2P9PA 3AAPA 4A59A 1EO1A 4ISGA 5I9EB 1YXQA 3R6MA 4BRKA 4BR5A 5AQXA 1U2VB 2W40A 4C1NK 1ATNA 2BUPA 3TTFA 2RE2A 5AQSA 3R8EA 1Q18A 3KZBA 2VGNA 1X3MA 3EKSA 3U9DA 2V51B 3EO3A 4IOCL 3DXKA 1HLUA 3QFPA 4IWVA 5C2FA 3VPZA 1YITN 1CZAN 1TYQB 2P9UA 3W0LA 2F9TA 3F9MA 3SLCA 2PFUA 2V7YA 1VQ7N 4A2BA 5B8HA 4FWSA 4XEIA 3CCSN 4BRMA 2ASOA 3SJHA 1SQKA 3E9LA 4A5AA 1NGJA 5AZJB 3D6RA 3FLCO 3VERA 1YF5L 1KQSM 2FF3B 1RFQA 4JKAA 3PLAA 1ESVA 2HBJA 3H6EA 3O1BA 3ZEUA 4BQLA 2KLAA 5C0YA 3W3DA 3FZFA 5F0XA 1TYQA 3ENHA 4DKWA 1HKBA 4PL8A 1S3XA 1QQMA 3VTIA 4KH4A 1LOTB 1WOQA 3N4PA 3WXIA 4BGAA 4FO0A 1IG8A 4YORA 4NLBA 4WFBL 2F9WA 3D2EB 4HTLA 1QZ5A 1OKJA 2QA4N 1NGGA 4H0XB 4JKHA 4B1ZA 4CD3A 1QQOA 2UYTA 3HM8A 4JHDB 2AP1A 3CIPA 3L4QA 4WQ5A 5AQOA 4FWNA 1RDUA 3FZMA 1VQON 1K8AO 1VQ9N 1KAZA 5BN8A 3IMXA 2NZTA 1XUPO 4H0YB 3SAGA 5FPEA 4BRNA 1RDWX 3MN5A 2D0PA 4Z94A 4HWIA 4JK9A 4CBUA 4IO9L 2QWMA 3EKUA 3MWPA 2P9LA 1GLBG 1BA1A 3HZ6A 4K42A 5AFUA 3JS6A 4GNIA 1KAXA 2QW9A 2YHWA 3VEZA 4PKIA 4QS9A 3S41A 3M1FA 3ID6A 2QWRA 4A5BA 5HOOA 2QWNA 1DEJA 1RGIA 1ATSA 3QMLA 3ZX0A 2FSNA 3CCRN 1QHAA 2GUPA 5E84A 3PIPL 3HTVA 4BRQA 2OANA 3O5BA 3HBTA 4DQ8A 2NRXA 3BF1A 2A6AA 3EE9A 3RSEA 1YUWA 2FSKA 2FLOA 3C7NB 4BVOA 4F9OA 2NRTA 3HI0A 4R79A 3H1VX 1VQLN 1M90O 5BPMA 3O1WA 1T6CA 5AFUH 4QS7A 2OTLN 1GLCG 2IVPA 3D7EO 1R59O 1Z6RA 4J8FA 3SBGA 1IJJA 5AQLA 5KQDA 3DWLA 2P9SA 3ENBA 3DXMB 5AZIA 3ZETA 1NGBA 1NGFA 2Q31A 4CZJA 1QVGM 1NGHA 4FWQA 2VYPA 3B8AX 5BRHA 1M1KO 5ELZA 3VTHA 3O4WA 5GAEP 5TKYA 2A40A 3HSCA 3SBTA 3QICA 2BTFA 3LDNA 4IOAL 4JD2B 3ZX2A 2HBMA 4YOTA 1ZBSA 2CGKA 3LDLA 3O9QA 3PIOL 3WEEA 3L0QA 4A57A 3SMPA 2CGLA 5KQ8A 4H0PA 4M7YA 2YCHA 2J4RA 3TSUA 4CZEA 2BH1A 1NGEA 4BREA 5HL7L 4BQZA 3A5MC 3VEYA 3QBWA 3MCAB 4BVPA 4EHTA 5BRDA 3D2FA 3UB5A 3TSQA 5TKWA 1GLJO 3R9PA 4A61A 4BR9A 2QWQA 4U7BA 3UKUA 5EVZA 4K25A 1DGKN 3ULEA 3Q7CA 1NGDA 4FPAA 1BUPA 2ZGZA 3L4IA 1Z05A 4RCHA 3WUHA 4EFHA 4DB3A 4MLEA 2Q36A 3TPQA 3H46O 5BPLA 2D1KA 1WUAA 1GLEG 3CJ1A 4BRIA 3DJCA 3DXKB 3MMVA 5CE3A 1NGIA 1W2BM 3CXCM 2WBNA 2P9UB 4FOEA 3VEVA 4JKBA 4C23A 4IO8A 2A41A 5CR4A 1W97L 4M63C 4U67L 3CJ7A 1C0GA 1NBWA 2QM1A 3KVGA 2GX9A 5LJVA 4M7XA 4PKGA 1JJ2M 1KAYA 5C12A 5EX5A 5FPDA 3ZX3A 1QQNA 4FWLA 2Q2RA 1K8KA 3ENOA 3K9JA 1YJ9N 2NRVA 1NGCA 3ZEUB 4G9ZA 2VCPA 5KPTA 5H1SQ 2NRWA 4WYBA 3T7ZA 4FOIA 2E1YA 1VQPN 3MX2A 1HUXA 3O9SA 3DLLL 1QVFM 3KK7A 3WXJA 4WCEL 4FWRA 1E4GT 1BA0A 4BC4A 2YHYA 3VEXA 5AQMA 2NRZA 2QWOA 1ILYA 4K41A 2GELA 2IVOA 5AQKA 3WXMB 1GLAG 3AY9A 1NLVA 1HX1A 5M1QA 2Q0UA 4MDAA 4WQ4A 3IFRA 3VETA 3O8MA 5AQFA 3J7ZO 5AQRA 3FZLA 2OTJN 3I56N 4IJAA 1QZ6A 3C65A 3BP8A 3E9OA 5M1KA 4CJ7A 3I55N 3TTCA 1YIJN 3AGKA 2P9LB 3E1YA 2ZJQL 1YVNA 3AARA 3KHYA 3LM9A 3P38A 3BEXA 2VWBA 4JEPA 4JNEA 1DKGD 4WQ5C 3CCQN 2KKZA 3C0BA 3CJCA 2VGMA 4CI6A 4YOUA 1C0FA 3GOIA 3RSEB 3G25A 4I6MA 2JWKA 3UKRA 3DAWA 4OPAA 4IJNA 2YJEA 3VESA 1K9MO 5AQPA 4WF9L 1YJNN 3HOTA 1HKGA 4IDHA 4BR4A 2E2PA 2QWPA 3KWIA 4IEEA 5ADXA 2NLXA 4PL7A 5BR9A 4H0TB 2P9SB 3G4SN 2ASMA 3SAFA 2A5XA 3EL2A 5AZIB 3ZETB 4FPBA 2PBDA 1BDGA 3EE8A 4H5WA 4KBOA 1VQMN 5DM7L 3GL1A 1KD1O 2H3GX 3BUZB 3VENA 5GIOA 3H1QA 3NVMA 3H3OB 4IZ9A 4JKGA 2ITMA 2I7PA 4LC9B 4EIAA 3O80A 4CZKA 3A0IX 5LJWA 3WEEB 4UY8O 1HPMA 5BREA 1JCGA 4ISEA 5ADXH 3A8YA 2EWSA 4KH5A 2GTDA 2HMPA 4PKHA 4A62A 4FVUA 4BRLA 1XC3A 4KH6A 5CHIA 4XH4A 1LCUA 5FPMA 4BGBA 3MX5A 3P39A 3QBXA 4BC3A 5KPRA 4CZFA 4BG8A 3D2FB 1VQKN 2E2OA 3FFKB 4RTFD 3UKUB 2CGJA 1VQ5N 1BG3A 1NJIO 3ULEB 3MK6A 1MWMA 1Q81O 5M1NA 2JWLA 3MN7A 4JKDA 4BRPA 1BO5O 3CCLN 5MLCQ 1YAGA 3KWGA 2QWLA 4YOVA 2GWJA 2NRHA 3CPEA 5BRFA 3MDQA 3CF5L 3CCEN 3CC2N 1V4TA 5AQJA 2FSJA 2E88A 3A5NC 5F2RA 1MA9B 2P9NA 3MN9A 1ATRA 1D4XA 3E66A 4CD1A 5M1PA 3VF6A 4FWKA 3AAQA 4A2AA 4AM6A 1T3VA 1K8KB 3VGMA 4GV3A 2FXUA 5JMVA 4NLCA 2CH5A 5AR0A 4BR7A 3I33A 3Q7BA 1OVYA 3J8AA 2HF4A 3A5OC 3IKMA 4H5NA 1VQ6N 4YDUA 1NWKA 3CCMN 4H5RA 2KHOA 3CC7N 3OW2M 1BU6O 3P4IA 3O9RA 3CHWA 2HOEA 4IFEA 4ILJA 5M1OA 5JVHL 4BRGA 2ZWHA 3ATVA 5AQIA 4E1JA 5JLHA 3CETA 2WC9A 3FZKA 1S22A 3M6GA 4H0OA 4O8UA 1VQ8N 4BC5A 3LDQA 5BN9A 1G99A 3CD6N 1YHQN 5F1XA 3N4QA 4MLHA 4RWTA 3IUCA 3MN6A 4CBWA 2W41A 4H0VB 4CZHA 2P9KB 1N8RO 4BRAA 3U9ZA 4B1WB 2Q97A 3NVKA 2F7TA 1SS6A 4MDBA 3WT0A 1S72N 4FWPA 2YI1A 3R3LA 4WQ4C 2P9IB 5AQYA 5C2DA 2NRRA 3VEOA 3VEWA 2IIRA 3G71N 3QDKA 3OBWA 3ZYYX 3R1XA 2A3ZA 4JKCA 2A42A 4BRFA 4B1YB 5FPNA 2ASPA 3RVCA 4BG9A 4BR0A 2IVNA 2YJFA 2PAVA 5C15A 5M1FA 2V7ZA 3HOSA 3I8BA 4I6MB 3UKRB 4CZIA 1ZC6A 2P9KA 2NNWA 3O6WA 3T69A 3UE5A 2ZJPL 1U2VA 1JCFA 3GDQA 4MO5A 1NGAA 3VOVA 4H5VA 3JXUA 3OHRA 4AF1A 3CC4N 1O13A 2E1ZA 3QFUA 4IXCA 2P9IA 1E4FT 1SAZA 5C10A 5LY3A 4ILGB 2QTDA 2HSTA 3L6QA 2V52B 4C1NI 4O5FA 1XQSC 3CJ9A 3F2KA 1MDUB 4NO7A 4WFAL 3FE1A 4H5TA 3WQUA 3LL3A 1MWKA 5KPZA 3CMEN 4JAXA 1Q7YO 1KC8O 5AQQA 2E8AA 4B1UB 4ILHA 1X9JA 3M3ZA 3WQTA 4FSVA 3VF4A 3CCJN 5AZJA 2AA4A 3K9KA 4JKGB 2GEMA 3O9UA 3AGRA 3LDOA 4MO4A 1ZXOA 1TUYA 4JN4A 1EQYA 5GINA 2WFBA 3ID8A 3GG4A 3CJBA 4YOYA 1VQNN 3VGLA 2Q0RA 4IOXA 5GADP 1BWFO 2Q1NA 4JKFA 3CQXA 4BC2A 4YOXA 3CMAN 1Q82O 3CCUN 3EZWA 4O8KA 5JICA 3GE1A 5AQUA 3SMSA 3LM2A 4GV6A 4DCHA 1JCEA 3CERA 2E20A 1GLLO 3SAHA 3MCPA 4DHYA 2ZF5O 3C6HA 3D2EA 4CZGA 3VMFB 2YHXA 4OPHA 3GBTA 4JHDA 5AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XH5 A;  4GY2 B;  4L3Q A;  1SZ2 A;  2D4W A;  4ISF A;  4Y0W A;  1T44 A;  1H1V A;  4AM7 A;  4B1X B;  2P9N B;  4BRO A;  3VGK A;  1HKC A;  5EXW A;  5AQH A;  5BPN A;  2ZGY A;  3FGU A;  1X3N A;  3FR0 A;  3LDP A;  3BF3 A;  1NM1 A;  2E2Q A;  1P8Z A;  5AQT A;  3WXK A;  3H45 C;  4CZL A;  3C7N A;  4BR2 A;  4QS8 A;  1TUU A;  1V4S A;  3U4L A;  1T6D A;  5JLF A;  3ATU A;  3A5L C;  4B9Q A;  1Y64 A;  2I7N A;  4H03 B;  4BRC A;  4EHU A;  5AQV A;  4EAH D;  3IDH A;  2E2N A;  3QB0 A;  4BRD A;  3CI5 A;  5EY4 A;  1HJO A;  2FF6 A;  3DXM A;  4YDU C;  2WUS A;  3U8X A;  4FWM A;  5AQN A;  1GLF O;  5AQW A;  3FZH A;  2HF3 A;  3CJA A;  2DPN A;  2P9P B;  5EOY A;  4JD2 A;  1J6Z A;  1U6Z A;  4CZM A;  4FL9 A;  3WXL A;  3CQY A;  2GWK A;  3SK3 A;  5AQG A;  4CBX A;  5E26 A;  4BRH A;  2D0O A;  4NB4 A;  4XH1 A;  1GLD G;  3TU5 A;  2CH6 A;  3O08 A;  3EN9 A;  2QXL A;  4K43 A;  4FWO A;  3H3N O;  1BOT O;  3VF2 A;  4B1V A;  1NMD A;  1KXP A;  2P9P A;  3AAP A;  4ISG A;  5I9E B;  1YXQ A;  3R6M A;  4BRK A;  4BR5 A;  5AQX A;  1U2V B;  2W40 A;  1ATN A;  2BUP A;  5AQS A;  3R8E A;  1Q18 A;  3KZB A;  1X3M A;  3EKS A;  3U9D A;  2V51 B;  3EO3 A;  3DXK A;  1HLU A;  3QFP A;  4IWV A;  3VPZ A;  1CZA N;  1TYQ B;  2P9U A;  3W0L A;  2F9T A;  3F9M A;  3SLC A;  2V7Y A;  4A2B A;  5B8H A;  4FWS A;  4XEI A;  4BRM A;  2ASO A;  3SJH A;  1SQK A;  1NGJ A;  5AZJ B;  3FLC O;  3VER A;  2FF3 B;  1RFQ A;  1ESV A;  3H6E A;  3O1B A;  3ZEU A;  4BQL A;  3W3D A;  3FZF A;  5F0X A;  1TYQ A;  3ENH A;  1HKB A;  4PL8 A;  1S3X A;  1QQM A;  1LOT B;  1WOQ A;  4BGA A;  3WXI A;  4FO0 A;  1IG8 A;  2F9W A;  3D2E B;  4HTL A;  1QZ5 A;  1OKJ A;  1NGG A;  4H0X B;  4CD3 A;  4B1Z A;  1QQO A;  2UYT A;  3HM8 A;  4JHD B;  2AP1 A;  3CIP A;  4WQ5 A;  5AQO A;  4FWN A;  3FZM A;  1KAZ A;  5BN8 A;  3IMX A;  2NZT A;  1XUP O;  4H0Y B;  5FPE A;  4BRN A;  1RDW X;  3MN5 A;  2D0P A;  4Z94 A;  4HWI A;  4CBU A;  3EKU A;  2QWM A;  2P9L A;  1GLB G;  1BA1 A;  3HZ6 A;  4K42 A;  5AFU A;  3JS6 A;  4GNI A;  1KAX A;  2QW9 A;  2YHW A;  3VEZ A;  4PKI A;  4QS9 A;  3S41 A;  3M1F A;  2QWR A;  2QWN A;  1DEJ A;  1RGI A;  1ATS A;  3QML A;  3ZX0 A;  2FSN A;  1QHA A;  2GUP A;  5E84 A;  3HTV A;  4BRQ A;  2OAN A;  3O5B A;  3HBT A;  4DQ8 A;  3RSE A;  3BF1 A;  2A6A A;  1YUW A;  2FSK A;  2FLO A;  3C7N B;  4BVO A;  4F9O A;  3HI0 A;  3H1V X;  5BPM A;  3O1W A;  1T6C A;  5AFU H;  4QS7 A;  1GLC G;  2IVP A;  3D7E O;  1R59 O;  1Z6R A;  4J8F A;  1IJJ A;  5AQL A;  5KQD A;  3DWL A;  2P9S A;  3DXM B;  5AZI A;  3ZET A;  1NGB A;  1NGF A;  2Q31 A;  4CZJ A;  1NGH A;  4FWQ A;  2VYP A;  3B8A X;  5BRH A;  5ELZ A;  3O4W A;  5TKY A;  2A40 A;  3HSC A;  3QIC A;  2BTF A;  3LDN A;  4JD2 B;  3ZX2 A;  1ZBS A;  2CGK A;  3LDL A;  3WEE A;  3L0Q A;  3SMP A;  2CGL A;  5KQ8 A;  4H0P A;  4M7Y A;  2YCH A;  2J4R A;  4CZE A;  1NGE A;  4BRE A;  4BQZ A;  3A5M C;  3VEY A;  3QBW A;  4BVP A;  4EHT A;  5BRD A;  3D2F A;  3UB5 A;  4BR9 A;  1GLJ O;  3R9P A;  4A61 A;  2QWQ A;  3UKU A;  5EVZ A;  4K25 A;  1DGK N;  3ULE A;  1NGD A;  4FPA A;  1BUP A;  2ZGZ A;  3L4I A;  1Z05 A;  4RCH A;  3WUH A;  4EFH A;  4DB3 A;  4MLE A;  2Q36 A;  3TPQ A;  3H46 O;  5BPL A;  2D1K A;  1WUA A;  1GLE G;  3CJ1 A;  4BRI A;  3DJC A;  3DXK B;  3MMV A;  5CE3 A;  1NGI A;  2P9U B;  4FOE A;  3VEV A;  4C23 A;  4IO8 A;  2A41 A;  4M63 C;  3CJ7 A;  1C0G A;  1NBW A;  2QM1 A;  3KVG A;  5LJV A;  4M7X A;  4PKG A;  1KAY A;  5EX5 A;  5FPD A;  3ZX3 A;  1QQN A;  4FWL A;  2Q2R A;  1K8K A;  3ENO A;  1NGC A;  3ZEU B;  2VCP A;  5KPT A;  4WYB A;  4FOI A;  2E1Y A;  1HUX A;  3WXJ A;  4FWR A;  1E4G T;  1BA0 A;  4BC4 A;  2YHY A;  3VEX A;  5AQM A;  2QWO A;  4K41 A;  2GEL A;  2IVO A;  5AQK A;  1GLA G;  3AY9 A;  1NLV A;  1HX1 A;  2Q0U A;  4WQ4 A;  3IFR A;  3VET A;  3O8M A;  5AQF A;  5AQR A;  3FZL A;  4IJA A;  1QZ6 A;  3BP8 A;  4CJ7 A;  2P9L B;  1YVN A;  3AAR A;  3KHY A;  3LM9 A;  3BEX A;  2VWB A;  4WQ5 C;  4JNE A;  1DKG D;  3C0B A;  3CJC A;  4CI6 A;  1C0F A;  3GOI A;  3RSE B;  3G25 A;  4I6M A;  3UKR A;  3DAW A;  4IJN A;  2YJE A;  3VES A;  5AQP A;  1HKG A;  5ADX A;  4BR4 A;  2E2P A;  2QWP A;  2NLX A;  4PL7 A;  5BR9 A;  4H0T B;  2P9S B;  2ASM A;  2A5X A;  3EL2 A;  5AZI B;  3ZET B;  4FPB A;  2PBD A;  1BDG A;  4H5W A;  4KBO A;  3GL1 A;  2H3G X;  3BUZ B;  3VEN A;  3H1Q A;  3H3O B;  4IZ9 A;  2ITM A;  2I7P A;  4LC9 B;  4EIA A;  3O80 A;  4CZK A;  3A0I X;  5LJW A;  3WEE B;  1HPM A;  5BRE A;  1JCG A;  4ISE A;  5ADX H;  3A8Y A;  2EWS A;  2GTD A;  2HMP A;  4PKH A;  4A62 A;  4BRL A;  1XC3 A;  4XH4 A;  1LCU A;  5FPM A;  4BGB A;  3QBX A;  4BC3 A;  5KPR A;  4CZF A;  4BG8 A;  3D2F B;  2E2O A;  3FFK B;  4RTF D;  3UKU B;  2CGJ A;  1BG3 A;  3ULE B;  3MK6 A;  1MWM A;  3MN7 A;  4BRP A;  1BO5 O;  1YAG A;  2QWL A;  2GWJ A;  2NRH A;  5BRF A;  3MDQ A;  1V4T A;  5AQJ A;  2FSJ A;  2E88 A;  3A5N C;  5F2R A;  1MA9 B;  2P9N A;  3MN9 A;  1ATR A;  1D4X A;  4CD1 A;  3VF6 A;  4FWK A;  3AAQ A;  4A2A A;  4AM6 A;  1K8K B;  3VGM A;  2FXU A;  5JMV A;  2CH5 A;  5AR0 A;  4BR7 A;  3I33 A;  3J8A A;  2HF4 A;  3A5O C;  4H5N A;  4YDU A;  1NWK A;  4H5R A;  2KHO A;  1BU6 O;  3P4I A;  3CHW A;  2HOE A;  4BRG A;  2ZWH A;  3ATV A;  5AQI A;  4E1J A;  5JLH A;  3CET A;  3FZK A;  3M6G A;  1S22 A;  4H0O A;  4BC5 A;  3LDQ A;  5BN9 A;  1G99 A;  5F1X A;  4MLH A;  4RWT A;  3IUC A;  3MN6 A;  4CBW A;  2W41 A;  4H0V B;  4CZH A;  2P9K B;  4BRA A;  3U9Z A;  4B1W B;  2Q97 A;  3WT0 A;  4FWP A;  2YI1 A;  4WQ4 C;  2P9I B;  5AQY A;  3VEO A;  3VEW A;  2IIR A;  3QDK A;  2A3Z A;  2A42 A;  4BRF A;  4B1Y B;  5FPN A;  2ASP A;  4BR0 A;  4BG9 A;  2IVN A;  2YJF A;  2PAV A;  2V7Z A;  3I8B A;  4I6M B;  3UKR B;  4CZI A;  1ZC6 A;  2P9K A;  3O6W A;  3UE5 A;  1U2V A;  1JCF A;  3GDQ A;  4MO5 A;  1NGA A;  3VOV A;  4H5V A;  3JXU A;  3OHR A;  2E1Z A;  3QFU A;  4IXC A;  2P9I A;  1E4F T;  1SAZ A;  5LY3 A;  3L6Q A;  2V52 B;  4O5F A;  1XQS C;  3CJ9 A;  1MDU B;  4NO7 A;  3FE1 A;  4H5T A;  3WQU A;  3LL3 A;  1MWK A;  5KPZ A;  4JAX A;  5AQQ A;  2E8A A;  4B1U B;  1X9J A;  3M3Z A;  3WQT A;  4FSV A;  3VF4 A;  5AZJ A;  2AA4 A;  2GEM A;  3LDO A;  4MO4 A;  1ZXO A;  1TUY A;  4JN4 A;  1EQY A;  3ID8 A;  3GG4 A;  3CJB A;  3VGL A;  2Q0R A;  1BWF O;  2Q1N A;  3CQX A;  4BC2 A;  3EZW A;  4O8K A;  5JIC A;  3GE1 A;  5AQU A;  3SMS A;  3LM2 A;  4DCH A;  1JCE A;  3CER A;  2E20 A;  1GLL O;  3MCP A;  4DHY A;  2ZF5 O;  3D2E A;  4CZG A;  2YHX A;  3GBT A;  4JHD A;  5AQZ A; 
#chains in the Genus database with same CATH topology
 2KQ2 A;  1A5V A;  4GY2 B;  3TAM A;  3RRH A;  3U6F A;  3FFI A;  4MQ3 A;  1H1V A;  2YX6 A;  3HRG A;  4CGD A;  1XMQ K;  2HW3 A;  5BPN A;  4FJK A;  3KKR A;  2IGI A;  2YHA A;  4B3S K;  2E2Q A;  3AVA A;  3WXK A;  3F5T A;  2PY5 A;  3C7N A;  4QS8 A;  1V4S A;  1J53 A;  3MWT A;  3THX B;  3ATU A;  2FBT A;  1NK0 A;  4B9Q A;  3O9T A;  4CF0 A;  1L3V A;  2UUA K;  3IDH A;  3PUF A;  4BRD A;  5EY4 A;  4B3T K;  3K0S A;  4DSI A;  5AQW A;  4OKK A;  3NCI A;  3CJA A;  4B3R K;  4JD2 A;  1J6Z A;  2XY8 A;  5GAH P;  3G6E N;  5J2N A;  4FL9 A;  1IBL K;  4DQS A;  3SK3 A;  3K5O A;  4BRH A;  1HJR A;  1L3U A;  4JS5 A;  4XH1 A;  3OA9 A;  3ZSV A;  1KVB A;  4RW6 A;  2CH6 A;  3O08 A;  3CPW M;  3AA5 X;  3MXI A;  4K43 A;  4CJR A;  2B6A A;  1XNQ K;  4DFK A;  4NYN A;  4BY9 C;  3VF2 A;  1EX4 A;  3DMJ A;  1NMD A;  2RHK A;  4B1V A;  1VAZ A;  2OZM A;  3CYM A;  4ISG A;  1YXQ A;  3R6M A;  2G8U A;  1U2V B;  2W40 A;  3DRP A;  2XY7 A;  1X3M A;  3OY9 A;  2V51 B;  3DXK A;  4IWV A;  5KGX A;  3VPZ A;  1TYQ B;  4W5T A;  2P9U A;  3ZLJ A;  1NK5 A;  3SLC A;  2PFU A;  3L2R A;  4XEI A;  4Q0B A;  4LD0 A;  4BRM A;  2ASO A;  4DTX A;  3E9L A;  4A5A A;  3TWH A;  4FJH A;  1WSJ A;  4BWJ A;  4FW1 A;  3ZEU A;  3O1B A;  4BQL A;  2KLA A;  3ENH A;  2WOM A;  5HRS A;  1S3X A;  5J1E A;  3N4P A;  4BGA A;  3K59 A;  4ELU A;  4NYF A;  2O8D B;  3VQ7 A;  4Z4E A;  4H0X B;  1C0U A;  4CHQ A;  1J5O A;  3CIP A;  2ZQB A;  4KRE A;  3RR8 A;  1KAZ A;  5BN8 A;  4M3Y A;  1XUP O;  4ZTJ A;  4BRN A;  4CBU A;  3MWP A;  1RDB A;  4E7H A;  4ICL A;  3M1F A;  5C25 A;  2QWN A;  1DEJ A;  5LL6 Z;  5HOO A;  3QML A;  3ZX0 A;  2FSN A;  3AVG A;  3QLH A;  3CCR N;  4KHN A;  4FZX C;  3RSE A;  3EE9 A;  2FSK A;  3SQ4 A;  1CLQ A;  3E01 A;  1HR0 K;  1C0M A;  1VQL N;  3H1V X;  2JLE A;  5BPM A;  3D7E O;  1Z6R A;  4J8F A;  4JI5 K;  4DR2 K;  2JGU A;  5KQD A;  3HPO A;  1QS4 A;  3PSF A;  2P9S A;  4DTU A;  2GV9 A;  2Q31 A;  1QVG M;  1HNZ K;  4JV5 K;  3B8A X;  3S3N A;  1FKO A;  4UQG A;  3HSC A;  1B9F A;  2BTF A;  4B9V A;  3ZX2 A;  4IOA L;  1ZBS A;  4DSE A;  3LDL A;  3O9Q A;  4CJF A;  3PIO L;  3J7Y P;  3L0Q A;  2FBV A;  3LWL A;  3MED A;  5KQ8 A;  1Q8I A;  4FLV A;  2J4R A;  4KV8 A;  4DG1 A;  3OVN A;  1OVQ A;  5FRM A;  1QE1 A;  1NGE A;  3SUP A;  4FJL A;  1HYS A;  3D2F A;  3TSQ A;  4BR9 A;  1GLJ O;  3R9P A;  3UIQ A;  5EVZ A;  4M3T A;  2OYQ A;  4AHV A;  4FPA A;  4AHR A;  4EFH A;  3TPQ A;  1WUA A;  1RIL A;  4BRI A;  2O8B A;  1WSH A;  4DR3 K;  4CJ4 A;  3L2U A;  4KI6 A;  1QHT A;  5DMR A;  2QM1 A;  2E5L K;  2GX9 A;  1JJ2 M;  5C12 A;  5EX5 A;  2HMI A;  4OPK A;  4KTZ A;  1QQN A;  4G9Z A;  4E1N A;  2O8C A;  1SV5 A;  3T7Z A;  1HUX A;  3HVR A;  4DFP A;  3RMB A;  3KK7 A;  1SKS A;  3WXJ A;  4WCE L;  4FWR A;  3SPY A;  3K5L A;  3SUN A;  2YHY A;  5J2M A;  5AQM A;  1ILY A;  2G8H A;  3KLI A;  2Q0U A;  3O8M A;  5AQF A;  3J7Z O;  3FZL A;  3I56 N;  3TAN A;  3BP8 A;  4DTN A;  2P9L B;  3AAR A;  3KHY A;  3LM9 A;  1TV6 A;  3TI0 A;  3MEE A;  4JEP A;  4DR7 K;  1NKB A;  4KPY A;  1RBV A;  1X9M A;  4NXN K;  3QIN A;  4CI6 A;  4YOU A;  3G25 A;  4DUY K;  3VQ6 A;  3VQC A;  1X9W A;  1REV A;  1YJN N;  1HKG A;  3C95 A;  4BR4 A;  3NHG A;  2QWP A;  2RPI A;  4AIL C;  1D8Y A;  1TAU A;  5AZI B;  3ZET B;  2RF2 A;  4H5W A;  1VQM N;  1T8E A;  4IFV A;  3L2V A;  1KD1 O;  4ID5 A;  4FZZ A;  3VEN A;  5GIO A;  3NVM A;  2I7P A;  3O80 A;  4CZK A;  5LJW A;  1BI4 B;  5BRE A;  3CG7 A;  1HNV A;  3V9X A;  2EWS A;  3J80 O;  2HMP A;  4BRL A;  4CJW A;  4C8O A;  4CGH A;  4BC3 A;  4HVJ A;  5KPR A;  4F2S A;  3V9U A;  3J81 O;  1VQK N;  2E2O A;  2CGJ A;  1VQ5 N;  3ULE B;  1Q81 O;  1NOY A;  2I5J A;  3HO1 A;  1YAG A;  4E0D A;  4H4O A;  5CYQ A;  1JLA A;  3LP0 A;  3CF5 L;  2W6L A;  3A5N C;  3MN9 A;  2P9N A;  1GOB A;  4XIU A;  3NE6 A;  4A2A A;  2PZS A;  1OH6 A;  3SI6 A;  2HHX A;  1LAV A;  1WAF A;  1OVY A;  4H5N A;  1VQ6 N;  4YDU A;  1NWK A;  5IWA K;  1BCO A;  4H5R A;  2KHO A;  2BGG A;  4DWI A;  1BU6 O;  1UA0 A;  5M1O A;  3HJF A;  2ZWH A;  5J2Q A;  3M8Q A;  2WC9 A;  3M6G A;  2QXF A;  1KLN A;  5FLX O;  3OYH A;  3LP1 A;  1EWR A;  5BN9 A;  1YHQ N;  5F1X A;  1IH7 A;  3IUC A;  3MN6 A;  4CBW A;  1K6Y A;  4I9L A;  4M42 A;  5HLF A;  3V9W A;  4B1W B;  4MDB A;  3WT0 A;  2YI1 A;  2P9I B;  5AQY A;  3S3M A;  3VEO A;  3VEW A;  3CFP A;  2HHT A;  4W5R A;  4AQY K;  3R1X A;  1KRP A;  2A42 A;  4BRF A;  3NBP A;  2ASP A;  4BR0 A;  2YJF A;  2PAV A;  4I6M B;  4CZI A;  2ZD1 A;  4HCB A;  1ZC6 A;  3O6W A;  1QQC A;  3UE5 A;  2ZJP L;  2OZS A;  1VSJ A;  1JCF A;  1RT3 A;  3VOV A;  3ZT1 A;  3LP3 A;  4H5V A;  1XMO K;  4AF1 A;  1E4F T;  1SAZ A;  5LY3 A;  2QTD A;  4C1N I;  1XQS C;  1JLG A;  3SJJ A;  2HB5 A;  5KPZ A;  3OYD A;  1KC8 O;  4B1U B;  4M3R A;  4DR5 K;  1WB9 A;  4EZ6 A;  4FSV A;  5AZJ A;  4JKG B;  3LAN A;  1TUY A;  4JN4 A;  5GIN A;  2WFB A;  1HQU A;  1JXB A;  4JRQ A;  3OS2 A;  4DR6 K;  1RDD A;  4YOX A;  1Q82 O;  2D0C A;  3THW B;  3ZSW A;  1TKX A;  1XWL A;  2IOC A;  3QEX A;  4DTJ A;  5FDL A;  4HCC A;  3NDK A;  3VMF B;  5HRP A;  3GBT A;  4JHD A;  3MXM A;  4OJR A;  1YJW N;  3KK3 A;  2UXD K;  1QSL A;  4IFY A;  1VSM A;  2BAN A;  1HRH A;  1S9E A;  3NAE A;  1SZ2 A;  4ISF A;  1XHX A;  4Y0W A;  2O4I A;  4AM7 A;  4B1X B;  3PO4 A;  3M5R A;  4F8R A;  3TTD A;  5GIP A;  3TSP A;  1K73 O;  2ETJ A;  3OYE A;  4DF8 A;  2HVI A;  3FGU A;  1X3N A;  3LDP A;  1RT5 A;  3KKS A;  1P8Z A;  4CZL A;  3QES A;  4AH9 A;  3ZT2 A;  3CQ8 A;  3OTO K;  3U4L A;  4GV9 A;  4DQP A;  2XY6 A;  4CK2 A;  2YNH A;  3V1O A;  3A5L C;  3V1Q A;  2I7N A;  4FK4 A;  1NKC A;  1HQE A;  3VN5 A;  4EAH D;  3TAQ A;  3CI5 A;  3P1G A;  1HJO A;  2QEX N;  3AVM A;  4B9N A;  3OYG A;  3FZH A;  1BHL A;  5EOY A;  1IBK K;  2QI2 A;  1JKH A;  3CQY A;  2GWK A;  4H8K A;  3K57 A;  1KFD A;  5AQG A;  1P90 A;  2D0O A;  4FLU A;  2ZJR L;  1GLD G;  3K5M A;  3C6U A;  3EN9 A;  4CF9 A;  2O8E A;  4FLW A;  3VA0 A;  4AHC A;  1QTM A;  3ZCM A;  4FJ8 A;  4GVE A;  1KXP A;  1EO1 A;  2P9P A;  4N47 A;  3ZSX A;  4A59 A;  4Q5V A;  3RTV A;  5CZ1 A;  5D3G A;  1N33 K;  1FKP A;  5AQS A;  5C42 A;  5J2P A;  4BWM A;  3KZB A;  1IBM K;  2VGN A;  4FJG A;  3EEQ A;  2Z1I A;  4LF5 K;  3EO3 A;  4FJJ A;  2VG5 A;  4ID1 A;  1YT3 A;  3AVH A;  4FZY A;  1CZA N;  3F9M A;  3HVT A;  1NJY A;  1VQ7 N;  4A2B A;  5B8H A;  2HND A;  3CCS N;  4CW7 B;  4DSF A;  3PO5 A;  3ULD A;  1YF5 L;  4E19 A;  4JKA A;  3PLA A;  3NH1 A;  4BDP A;  5F0X A;  2F4V K;  4BAC A;  1HKB A;  4RG8 A;  2D0A A;  3PX4 A;  4J2B A;  3SCX A;  3AO4 A;  1OKJ A;  4DV4 K;  4CD3 A;  3BGR A;  3HM8 A;  1C1C A;  2UYT A;  2AP1 A;  4WQ5 A;  4QAG A;  1RDU A;  4EZ9 A;  1K8A O;  4CFA A;  4CIF A;  1ITG A;  4E7J A;  3NF9 A;  2NZT A;  3NF6 A;  4BE0 A;  2E6L A;  4H0Y B;  4I7F A;  3SAG A;  1SL1 A;  1RDW X;  1WNS A;  4JK9 A;  3EKU A;  1NMN A;  4FLX A;  3HZ6 A;  4CJL A;  5LMN K;  1WSG A;  3SUO A;  5HBM A;  3VEZ A;  2YHW A;  4PKI A;  2W6K A;  3ID6 A;  4CCH A;  1ATS A;  4BE1 A;  3O4Q A;  5E84 A;  3PIP L;  2OAN A;  1NK6 A;  1SL0 A;  3AVC A;  4CJV A;  3WNH A;  4H4M A;  4DTM A;  2VWJ A;  2A6A A;  3VQA A;  1YUW A;  3RWU A;  4F9O A;  2RN2 A;  1T6C A;  1RTJ A;  5HRN A;  3SZ2 A;  4Z4G A;  3EY1 A;  4CEE A;  4K0K K;  5AQL A;  1EKE A;  4HTU A;  3DWL A;  3ENB A;  1A5X A;  3DXM B;  1TAQ A;  4CZJ A;  1Z26 A;  4FWQ A;  2VYP A;  1M1K O;  4AHU A;  5TKY A;  3SBT A;  3QIC A;  1NNE A;  3RR7 A;  1NK8 A;  4OKE A;  1HYV A;  3WEE A;  4DTS A;  2G8I A;  4E7K A;  1I39 A;  3OYI A;  2YCH A;  2BH1 A;  1TKD A;  5CZ2 A;  1VHX A;  3VEY A;  2XHB A;  4BVP A;  3KJV A;  4OLA A;  5TKW A;  4OKJ A;  4U7B A;  3CFR A;  3UKU A;  1DGK N;  4RCH A;  1BUP A;  2ZGZ A;  3WUH A;  3H46 O;  3VQ4 A;  5BPL A;  2D1K A;  3ZSO A;  3TAB A;  1GLE G;  2KW4 A;  3MMV A;  3TAP A;  3CXC M;  1TK8 A;  4IO8 A;  2A41 A;  4M41 A;  3LWM A;  5CR4 A;  3KLG A;  1W97 L;  4U67 L;  3CJ7 A;  1NBW A;  5LJV A;  4J2E A;  1RBT A;  4M7X A;  2HHH K;  3DRS A;  1TVR A;  3ZX3 A;  1OH7 A;  1K8K A;  2NRV A;  2WTU A;  3O9S A;  3DLL L;  3WNF A;  1D9F A;  1QVF M;  1E4G T;  1BA0 A;  4BC4 A;  1TGO A;  4N41 A;  2QWO A;  2G8V A;  4K41 A;  2ATQ A;  2GEL A;  5AQK A;  3WXM B;  1GLA G;  1NK7 A;  1HX1 A;  5M1Q A;  4MDA A;  4WQ4 A;  5KGW A;  4NCA A;  2HHS A;  3ZT0 A;  2OTJ N;  4IJA A;  3LPU A;  3E9O A;  1ZBH A;  3I55 N;  3TTC A;  4CF2 A;  1JLE A;  4B9T A;  1HYZ A;  3IS9 A;  1FW6 A;  3BEX A;  3SNN A;  2VWB A;  4JNE A;  4BDY A;  3C0B A;  3K2P A;  3F9K A;  3VQD A;  2VGM A;  5SWM A;  3OJS A;  1FK9 A;  3DAW A;  4OPA A;  3VES A;  5AQP A;  5ADX A;  1BQN A;  4W5O A;  3BY5 A;  4FJ9 A;  5BR9 A;  2VQF K;  3RRG A;  4H0T B;  3D0P A;  3G4S N;  2PBD A;  4KBO A;  1ZYQ A;  4LSL A;  3GL1 A;  1F21 A;  1Y97 A;  2QK9 A;  1JXE A;  3ZSZ A;  3BUZ B;  1NKE A;  4N56 A;  3RMD A;  3H3O B;  4IZ9 A;  2ITM A;  5KI6 A;  4DUZ K;  4EIA A;  1XHZ A;  1JL1 A;  4ISE A;  5ADX H;  4K8X A;  1LV5 A;  1B9D A;  4PKH A;  4A62 A;  3AVB A;  4DR4 K;  1XC3 A;  4JI0 K;  1KLM A;  3NFA A;  4BGB A;  3QBX A;  4M3U A;  4CK1 A;  4F2R A;  3FFK B;  3ISN C;  2RKI A;  3MK6 A;  1TK5 A;  1VSE A;  1WLJ A;  5M1N A;  3MN7 A;  3L2W A;  4C8L A;  1C1B A;  3KWG A;  2YNI A;  3A2F A;  3S9H A;  1S5J A;  2GWJ A;  2NRH A;  2Z1G A;  4FW2 A;  4QCL A;  3V9S A;  4HHT A;  3AV9 A;  1V4T A;  5AQJ A;  2FSJ A;  4LF6 K;  2E88 A;  3LAK A;  5M1P A;  4M3W A;  4CIE A;  1X1P A;  3VGM A;  4NLC A;  4GKJ K;  4DF4 A;  2HF4 A;  1LAW A;  3IKM A;  3KLF A;  4EP4 A;  3THX A;  3CHW A;  2HOE A;  4IFE A;  1SL2 A;  3M8P A;  1IV0 A;  4E1J A;  5JLH A;  2UXB K;  3FZK A;  1S22 A;  3CM5 A;  3G0Z A;  4BC5 A;  3F73 A;  3AVJ A;  3LDQ A;  4FJM A;  3CD6 N;  3N4Q A;  4MLH A;  4F3T A;  4E7I A;  3LDS A;  1OH8 A;  3QO9 A;  1HMV A;  3KD5 E;  1L5U A;  1S1T A;  3S3O A;  1S72 N;  3QER A;  3R3L A;  3AO3 A;  2IIR A;  4C8M A;  4JKC A;  4DU1 A;  4OGE A;  5FPN A;  2YNF A;  4BG9 A;  4DLE A;  1VK0 A;  5M1F A;  3HOS A;  3I8B A;  3UKR B;  2EHG A;  4J2D A;  5HRR A;  1QSS A;  1U2V A;  4MO5 A;  4JRP A;  3CC4 N;  1O13 A;  3QFU A;  3C6T A;  4B9U A;  4KO0 A;  1IKW A;  2HST A;  3LZJ A;  1NG9 A;  3L6Q A;  4O44 A;  4DTR A;  3FE1 A;  3LL3 A;  4CHZ A;  2PYJ A;  2X6N A;  1Q7Y O;  1N36 K;  5AQQ A;  4M3X A;  1U04 A;  3K9K A;  3O9U A;  2Z1J A;  3AVN A;  1ZXO A;  4MO4 A;  4FJX A;  4KTQ A;  4YOY A;  2Q0R A;  1HNW K;  4JKF A;  3CQX A;  2O8F A;  4CJS A;  3GE1 A;  2O8D A;  4Z4C A;  3CER A;  2E20 A;  4RW8 A;  4J2A A;  2WON A;  4W5Q A;  4OPH A;  5AQZ A;  4JKE A;  3ZT4 A;  1NK9 A;  4XH5 A;  3VQ9 A;  4CGI A;  4E1M A;  1RDC A;  3NGI A;  3OS1 A;  2E4L A;  1Q86 O;  1BIZ A;  3IRX A;  1I94 K;  4IKF A;  2D4W A;  1DT9 A;  1T44 A;  4OGC A;  5DK5 A;  2F8T A;  3AO1 A;  1HNI A;  1T7P A;  3CCV N;  1HKC A;  3D45 A;  5EXW A;  1RNH A;  2ZGY A;  2YKN A;  3BF3 A;  1IO2 A;  1NM1 A;  3H45 C;  3OYL A;  1T05 A;  1T03 A;  2HBK A;  3P31 A;  5JLF A;  1TUU A;  1T6D A;  4IEI A;  3ZSR A;  4DU4 A;  1Y64 A;  1EWQ A;  4H03 B;  4N5S A;  4BRC A;  3RMA A;  4EHU A;  3O3F A;  4JS4 A;  4CEF A;  2FF6 A;  2WUS A;  3U8X A;  4N76 A;  5AQN A;  3DYA A;  1DTT A;  1VSH A;  3HP9 A;  2P9P B;  4CZM A;  3WXL A;  4LFA K;  1LWF A;  4CBX A;  1IG9 A;  1RT7 A;  4X66 K;  3TU5 A;  3ZSY A;  4PHT X;  2QXL A;  1RT2 A;  2X6S A;  4PUO A;  3ITH A;  4FWO A;  3H3N O;  1S1X A;  4PA1 A;  2P1J A;  1LWE A;  5I9E B;  2R7Y A;  4DV2 K;  4BR5 A;  3MAQ A;  2XO7 A;  3OYM A;  1ATN A;  1EET A;  2RE2 A;  1JL2 A;  1Q18 A;  3EKS A;  3U9D A;  1ASV A;  1S6Q A;  3KTQ A;  4CHP A;  2AJQ A;  3QFP A;  3RMC A;  3KIO A;  4CEZ A;  3W0L A;  1A5W A;  2F9T A;  4DV7 K;  4FWS A;  2A1S A;  1RTI A;  3SJH A;  1SQK A;  2IDO A;  4FCY A;  1KVC A;  3D6R A;  3FLC O;  3VER A;  1KQS M;  2FF3 B;  1RFQ A;  1UWB A;  2NUB A;  3NGZ A;  1N5Y A;  4CGG A;  4KHY A;  2HHQ A;  5KTQ A;  4DKW A;  4PL8 A;  3VTI A;  4CFC A;  4KH4 A;  4CED A;  1LOT B;  4KFB A;  4DQR A;  3WXI A;  1XI1 A;  4FO0 A;  1IG8 A;  3THY B;  4YOR A;  4NLB A;  4L8R B;  4CJK A;  1W0H A;  1VSF A;  4WFB L;  2F9W A;  3WNE A;  4CGF A;  3D2E B;  4HTL A;  1QZ5 A;  1Q9Y A;  1NGG A;  3HL8 A;  4JKH A;  2VG7 A;  3G10 A;  4B1Z A;  3PX0 A;  3L4Q A;  4KHW A;  3FZM A;  1VQO N;  1VQ9 N;  4B9L A;  1BGX T;  2UXC K;  2D0P A;  4Z94 A;  4W5N A;  2QWM A;  2P9L A;  1GLB G;  1BA1 A;  5FRO A;  1WBB A;  3AVK A;  4GNI A;  1KAX A;  2QW9 A;  3LP2 A;  3S41 A;  4QS9 A;  4CJP A;  3THV A;  3O3G A;  1RGI A;  1W7A A;  2GUP A;  3O5B A;  3KK2 A;  4DQ8 A;  3HPG A;  1IKV A;  1U45 A;  2FC0 A;  2FLO A;  3C7N B;  1J9A A;  4BVO A;  1M90 O;  3ALY A;  3VQE A;  4QS7 A;  2OTL N;  1VRT A;  2IVP A;  3IG1 A;  3SBG A;  1IJJ A;  1J54 A;  2G8K A;  4ELV A;  3T1Y K;  3DM2 A;  5AZI A;  3ZET A;  4OLB A;  5BRH A;  5ELZ A;  3VTH A;  5GAE P;  2A1R A;  3VQ8 A;  4CFD A;  3LDN A;  4JD2 B;  4O5B A;  4OPJ A;  1U48 A;  3JSM A;  3CM6 A;  1BI4 A;  2VWK A;  4JI4 K;  1JLB A;  3SMP A;  3KLE A;  3OYF A;  2CGL A;  3H08 A;  3LAM A;  3AVI A;  3TSU A;  4CZE A;  4BRE A;  5HL7 L;  2G8W A;  1UA1 A;  1O1W A;  1YTU A;  3QBW A;  3MCA B;  5BRD A;  2ZM6 K;  1WSF A;  2QWQ A;  3ULE A;  1NGD A;  3L4I A;  3SQ2 A;  1Z05 A;  1JLQ A;  2HVH A;  3T1A A;  4DB3 A;  4MLE A;  4FLY A;  1RBR A;  1G15 A;  3CJ1 A;  3DJC A;  3DXK B;  5CE3 A;  4DMN A;  3VQB A;  2WBN A;  2P9U B;  4B3M K;  3VEV A;  3AO5 A;  1C0G A;  4PKG A;  4FJ7 A;  5FPD A;  2OPP A;  3V4I A;  2DY4 A;  4FWL A;  2Q2R A;  3ENO A;  3K9J A;  1YJ9 N;  2B4J A;  3ZEU B;  2VCP A;  5KPT A;  4BE2 A;  5H1S Q;  2NRW A;  4WYB A;  4FOI A;  3MX2 A;  1S9G A;  4MFB A;  2NRZ A;  1S1U A;  4E89 A;  4JI8 K;  2HHW A;  2IVO A;  4IG0 A;  1TL1 A;  3AY9 A;  5CY4 A;  2YKM A;  3P83 D;  4M3Z A;  3NF7 A;  3DLH A;  5I3U A;  2VQE K;  4FK2 A;  1QZ6 A;  3C65 A;  3U3G A;  1YIJ N;  4X65 K;  3E1Y A;  1YVN A;  2X78 A;  4DTO A;  3OYJ A;  3SUQ A;  4CF1 A;  1QSY A;  3CJC A;  3VQ5 A;  1CXQ A;  4FLT A;  3GOI A;  3RSE B;  2OA8 A;  2KFZ A;  4I6M A;  2JWK A;  4IJN A;  2E6M A;  2YJE A;  2IS3 A;  3SPZ A;  1WSE A;  1K9M O;  4WF9 L;  3HOT A;  2E2P A;  3KWI A;  2D5R A;  2NLX A;  4PL7 A;  3SYZ A;  2P9S B;  4PQU A;  2ASM A;  3SAF A;  4HUF A;  1BDG A;  4B9M A;  2OCE A;  4GW6 A;  4O55 A;  3OYK A;  5DM7 L;  3AA2 A;  1SUQ A;  3SV3 A;  1U49 A;  1RT6 A;  4JKG A;  4LF7 K;  4UY8 O;  3A0I X;  5HP1 A;  1HPM A;  3I8D A;  4CVN E;  3CFO A;  3LAL A;  3V9Z A;  4FVU A;  4KH6 A;  5CHI A;  1LCU A;  5FPM A;  3QEV A;  3THW A;  3MX5 A;  3P39 A;  4CZF A;  4BG8 A;  3D2F B;  4RTF D;  1BG3 A;  3PV8 A;  1NJI O;  4CK3 A;  4RW4 A;  2JWL A;  4BRP A;  3CCL N;  1BO5 O;  1VRU A;  5MLC Q;  1KFS A;  2O8B B;  4HUE A;  1S6P A;  2QWL A;  5BRF A;  3MDQ A;  3BDP A;  1XNR K;  4RW9 A;  2YHB A;  4X64 K;  1BQM A;  3B6P A;  5I42 A;  3E66 A;  1CZB A;  3AAQ A;  4GV3 A;  2FXU A;  3LPT A;  5JMV A;  3I33 A;  3Q7B A;  3HP6 A;  3J8A A;  1TK0 A;  1D5A A;  4JI6 K;  4DV5 K;  2O8C B;  5SZT A;  4E3S A;  3CCM N;  4CES A;  3OW2 M;  4K8Z A;  3P4I A;  1C6V A;  4I2P A;  3HK2 A;  4CJQ A;  4BRG A;  2P5G A;  5AQI A;  4FJ5 A;  3CET A;  1S1V A;  1J5E K;  4CFB A;  4H0O A;  3VA3 A;  1NOZ A;  4KKO A;  1VQ8 N;  2P51 A;  4OX9 K;  5LMU K;  1G99 A;  2EX3 A;  1Q9X A;  1BL3 A;  2KZM A;  4DFJ A;  1FJG K;  1BCM A;  3KK1 A;  4BRA A;  3U9Z A;  3QNO A;  2Q97 A;  3NVK A;  4FWP A;  4O4G A;  5C2D A;  1E3M A;  2NRR A;  3G71 N;  2ITG A;  4KRF A;  3QDK A;  3T1H K;  2A3Z A;  2UU9 K;  4B1Y B;  3K58 A;  5C15 A;  4YFU A;  1MU2 A;  2V7Z A;  2G8F A;  4JLH A;  2P9K A;  2NNW A;  3T69 A;  4C8K A;  3AO2 A;  4LFC K;  3OHR A;  4CER A;  4IXC A;  4ILG B;  3DOL A;  4LY7 A;  2V52 B;  4TSX A;  4O5F A;  2IC3 A;  1MDU B;  4NO7 A;  2IAJ A;  1XC9 A;  3DLE A;  3CME N;  3EZ5 A;  4JAX A;  2O8F B;  4CJ5 A;  3J7A P;  3NGY A;  5JS1 A;  3M3Z A;  1X9S A;  3VF4 A;  3OYB A;  2AA4 A;  2GEM A;  1Z25 A;  3AGR A;  2OPR A;  3LDO A;  1EQY A;  3GG4 A;  3CJB A;  1DTQ A;  5GAD P;  4IOX A;  3MXJ A;  1L3S A;  4O8K A;  5JIC A;  5AQU A;  3LM2 A;  4DCH A;  1JCE A;  2HNY A;  2ZE2 A;  4E7L A;  2UUB K;  1GLL O;  3MCP A;  4GKK K;  4CZG A;  3U3Y A;  3SQ0 A;  2YHX A;  5JVG L;  5EU7 A;  4DSK A;  4FM1 A;  4KB1 A;  3SQ1 A;  3C6A A;  1ASW A;  1VSI A;  4L3Q A;  1KVA A;  2GUI A;  3V1R A;  5GAG P;  2P9N B;  4BRO A;  4JK8 A;  3VGK A;  2HBL A;  4WFN L;  4JI1 K;  4CJE A;  3HXM A;  5AJ3 K;  3M8S A;  5AQH A;  4CJU A;  3PX6 A;  1YI2 N;  3FR0 A;  1N32 K;  5AQT A;  3HYF A;  3E9P A;  4KI4 A;  4BR2 A;  3DRR A;  5CYM A;  1RTH A;  4YOW A;  4YHH K;  3QEI A;  4OO1 J;  4FYD A;  3WNG A;  4JK7 A;  4CHN A;  3HM9 A;  4C8N A;  4O0J A;  5AQV A;  4DV6 K;  2E2N A;  3QB0 A;  1JLF A;  4KHP K;  3OBY A;  4YDU C;  3DXM A;  1HPZ A;  3MEC A;  4FWM A;  3AA3 A;  1TKT A;  1GLF O;  3V81 A;  5KRT A;  2HF3 A;  1BIS A;  4DV1 K;  1VQ4 N;  2DPN A;  1U6Z A;  4DQQ A;  1U4B A;  5E26 A;  3L8B A;  4NB4 A;  4OVL A;  4LF8 K;  5DM6 L;  1KTQ A;  4CEA A;  3BZC A;  3L3U A;  1C0T A;  1D9D A;  4KB0 A;  1BOT O;  4CE9 A;  4CJT A;  3NMU A;  3DLR A;  3AAP A;  3ZSQ A;  5A2Q O;  4DLG A;  4LFB K;  4BRK A;  4DFM A;  1WAJ A;  5AQX A;  4C1N K;  1FXX A;  2Y1I A;  1UAX A;  2BUP A;  3TTF A;  4AHT A;  3TAG A;  1LW2 A;  3R8E A;  4Y1D A;  4CEQ A;  2GBZ A;  3MEG A;  3DLB A;  4V19 S;  4IOC L;  1HLU A;  5C2F A;  1YIT N;  1RDA A;  2V7Y A;  4DS5 A;  1JLC A;  4F3O A;  1NGJ A;  5AZJ B;  1NK4 A;  3PY8 A;  1NJX A;  3VQP A;  1R0A A;  1ESV A;  2HBJ A;  3H6E A;  3TAF A;  4I9Q A;  5C0Y A;  3W3D A;  3FZF A;  4CJ3 A;  1TYQ A;  1EP4 A;  4X62 K;  1QQM A;  1WOQ A;  4ELT A;  3IAY A;  4GVM A;  2QA4 N;  1QQO A;  4JHD B;  1ZBI A;  5AQO A;  1UOC A;  1ZBF A;  4FWN A;  2BE2 A;  3IMX A;  3AVF A;  4NCG A;  3NF8 A;  5FPE A;  5HRO A;  3MN5 A;  3OYN A;  4HWI A;  3TR8 A;  1NJZ A;  4IO9 L;  1N34 K;  4B3O A;  4K42 A;  4IBN A;  5AFU A;  3JS6 A;  4CEB A;  1WBD A;  4Z4H A;  2QWR A;  4A5B A;  3P5J A;  3TAE A;  1QHA A;  3HTV A;  3K5N A;  4BRQ A;  1ZBL A;  3KLH A;  3HBT A;  2QKB A;  2NRX A;  3BF1 A;  2NRT A;  1IKY A;  3HI0 A;  1RTD A;  4R79 A;  3O1W A;  5AFU H;  4B9S A;  5JS2 A;  1GLC G;  3OS0 A;  2YV0 X;  1R59 O;  1NJW A;  4CHY A;  4WE1 A;  4CEO A;  1KCF A;  4G1Q A;  2DTU A;  2HNZ A;  2Q3S A;  1NGB A;  1NGF A;  3JYT A;  1W9H A;  1NGH A;  1RT4 A;  4HUG A;  2XRI A;  2KTQ A;  3O4W A;  2A40 A;  4LH5 A;  2HBM A;  4YOT A;  2CGK A;  4LF4 K;  4CEC A;  3VQQ A;  3DLG A;  4A57 A;  4FM2 A;  2VG6 A;  4H0P A;  4M7Y A;  4FJI A;  3DOK A;  2O8E B;  4BQZ A;  3A5M C;  4EHT A;  3UB5 A;  4Y1C A;  1CXU A;  4A61 A;  4NCB A;  3EYZ A;  4K25 A;  3Q7C A;  2X74 A;  2Q36 A;  5K14 A;  1CZ9 A;  1NGI A;  1W2B M;  3QEP A;  4FOE A;  3ASM A;  2W42 A;  4JKB A;  4C23 A;  4M45 A;  4M63 C;  3ZT3 A;  4Z0U A;  3KVG A;  1KAY A;  4FVM A;  3HST B;  4CIG A;  1BIU A;  1NGC A;  1RBU A;  2B5J A;  1IKX A;  1B92 A;  2E1Y A;  1VQP N;  4B8C A;  4O0I A;  4DTP A;  1VSD A;  3OYC A;  5BR8 K;  3OYA A;  3VEX A;  2YNG A;  5IT9 O;  4DV0 K;  1RBS A;  1NLV A;  4LH4 A;  3VET A;  3IFR A;  5AQR A;  3BZK A;  1L3T A;  5M1K A;  4CJ7 A;  3AGK A;  2ZJQ L;  4FXD A;  2HHU A;  3M8R A;  3P38 A;  2UUC K;  4FK0 A;  3CCQ N;  4WQ5 C;  1DKG D;  3OJU A;  2KKZ A;  4KTW A;  2QKK A;  1EXQ A;  4YY3 K;  1RCH A;  2FBY A;  4CHO A;  3QIP A;  1C0F A;  2LSN A;  3UKR A;  3AVL A;  2KFN A;  1LWC A;  4IDH A;  2O4G A;  3DI6 A;  4IEE A;  4DSL A;  1VSL A;  3B6O A;  3V6D A;  4KAZ A;  2A5X A;  3EL2 A;  2DFE A;  3HT3 A;  4FPB A;  1S1W A;  3EE8 A;  2F8S A;  2HHV A;  2H3G X;  4IG3 A;  3DLK A;  3H1Q A;  4LC9 B;  3WEE B;  1JCG A;  3O4N A;  2D0B A;  4Z4F A;  3A8Y A;  4KH5 A;  2OPQ A;  2GTD A;  4KHS A;  1KSP A;  4XH4 A;  1I3A A;  3SV4 A;  1YTA A;  3I0S A;  4CGJ A;  3UKU B;  1MWM A;  4I2Q A;  4JKD A;  3QNN A;  5KRS A;  1WSI A;  4NXM K;  4YOV A;  3CPE A;  4DU3 A;  4LSN A;  3NH2 A;  1N6Q A;  3KD1 E;  4DQI A;  1HNX K;  3CCE N;  4JI7 K;  3CC2 N;  5F2R A;  2XY5 A;  1MA9 B;  3C94 A;  1ATR A;  1D4X A;  4CD1 A;  3VF6 A;  4FWK A;  4AM6 A;  2OPS A;  1NU0 A;  1T3V A;  1K8K B;  4F4K A;  2CH5 A;  5AR0 A;  4BR7 A;  4CF8 A;  3PSI A;  1OH5 A;  3O3H A;  3A5O C;  4R5P A;  4PY5 A;  1U47 A;  4IDK A;  4B8A B;  1GOC A;  3CC7 N;  4KHQ A;  3O9R A;  4JI3 K;  1TL3 A;  4ILJ A;  5JVH L;  1C1A A;  3ATV A;  2DFF A;  4B08 A;  2FBX A;  4RW7 A;  1SKR A;  4O8U A;  4PWD A;  4BDZ A;  3I0R A;  1SKW A;  2P5O A;  1WN7 A;  4Z4I A;  4YNQ A;  4RWT A;  4DS4 A;  4JI2 K;  2W41 A;  4H0V B;  3QIO A;  4CZH A;  4LF9 K;  2P9K B;  1YVU A;  1ZBU A;  1N8R O;  4DV3 K;  3QET A;  2F7T A;  1SS6 A;  1LW0 A;  1VSK A;  5FRN A;  4WQ4 C;  5T7B A;  3OBW A;  2BDP A;  3ZYY X;  1ASU A;  3RVC A;  2IVN A;  2F96 A;  5E41 A;  2PYL A;  3GDQ A;  4KHU A;  1NGA A;  3JXU A;  3TAR A;  2E1Z A;  4GMJ B;  4ZHR A;  4FM0 A;  2P9I A;  5C10 A;  1GOA A;  3NH0 A;  3CJ9 A;  3F2K A;  3HPH A;  4WFA L;  4H5T A;  3WQU A;  1MWK A;  4EP5 A;  5C24 A;  2E8A A;  4ILH A;  1X9J A;  4AHS A;  3WQT A;  3CCJ N;  3L2Q A;  4QOZ B;  1TKZ A;  3ID8 A;  4ZTF A;  3T19 A;  4DSJ A;  3L3V A;  4FJN A;  3AA4 A;  2Y1J A;  1VQN N;  3VGL A;  2DFH A;  4DR1 K;  1BWF O;  2Q1N A;  4BC2 A;  3CMA N;  4FLZ A;  3JAM O;  3CCU N;  2Z1H A;  4JYA K;  3EZW A;  1DLO A;  3QEW A;  2KZZ A;  3SMS A;  4GV6 A;  3THY A;  3SAH A;  3LZI A;  4DHY A;  2ZF5 O;  3C6H A;  3D2E A;  3T3F A;  1RT1 A; 
#chains in the Genus database with same CATH homology
 4JKE A;  5JVG L;  1YJW N;  4XH5 A;  3C6A A;  1Q86 O;  4GY2 B;  4L3Q A;  1SZ2 A;  2D4W A;  1DT9 A;  4ISF A;  4Y0W A;  1T44 A;  1H1V A;  2YX6 A;  4AM7 A;  4B1X B;  5GAG P;  2P9N B;  3HRG A;  4BRO A;  3M5R A;  4JK8 A;  3VGK A;  2HBL A;  4WFN L;  3TTD A;  5GIP A;  3CCV N;  1HKC A;  3TSP A;  1K73 O;  5EXW A;  5AQH A;  5BPN A;  2ZGY A;  3FGU A;  1YI2 N;  1X3N A;  3FR0 A;  3LDP A;  3BF3 A;  1NM1 A;  2E2Q A;  1P8Z A;  5AQT A;  3F5T A;  3H45 C;  3WXK A;  4CZL A;  2HBK A;  3C7N A;  3E9P A;  3P31 A;  4BR2 A;  4QS8 A;  1TUU A;  1V4S A;  3MWT A;  1T6D A;  3U4L A;  5JLF A;  4YOW A;  4IEI A;  4GV9 A;  3ATU A;  4OO1 J;  4JK7 A;  3A5L C;  4B9Q A;  1Y64 A;  2I7N A;  3O9T A;  4H03 B;  4BRC A;  4EHU A;  5AQV A;  4EAH D;  3IDH A;  2E2N A;  3QB0 A;  4BRD A;  3CI5 A;  5EY4 A;  3OBY A;  1HJO A;  2FF6 A;  3DXM A;  4YDU C;  2QEX N;  2WUS A;  3U8X A;  4FWM A;  5AQN A;  1GLF O;  5AQW A;  3FZH A;  2HF3 A;  3CJA A;  1VQ4 N;  2DPN A;  2P9P B;  5EOY A;  4JD2 A;  1J6Z A;  5GAH P;  1U6Z A;  4CZM A;  3G6E N;  2QI2 A;  4FL9 A;  3WXL A;  3CQY A;  2GWK A;  3SK3 A;  5AQG A;  4CBX A;  5E26 A;  4BRH A;  1P90 A;  2D0O A;  4NB4 A;  4XH1 A;  3OA9 A;  2ZJR L;  1GLD G;  3TU5 A;  5DM6 L;  2CH6 A;  3O08 A;  4PHT X;  3EN9 A;  2QXL A;  3CPW M;  4K43 A;  4FWO A;  3H3N O;  1BOT O;  4BY9 C;  3VF2 A;  4B1V A;  3NMU A;  1NMD A;  2RHK A;  4GVE A;  1KXP A;  1VAZ A;  2P9P A;  3AAP A;  4A59 A;  1EO1 A;  4ISG A;  5I9E B;  1YXQ A;  3R6M A;  4BRK A;  4BR5 A;  5AQX A;  1U2V B;  2W40 A;  4C1N K;  1ATN A;  2BUP A;  3TTF A;  2RE2 A;  5AQS A;  3R8E A;  1Q18 A;  3KZB A;  2VGN A;  1X3M A;  3EKS A;  3U9D A;  2V51 B;  3EO3 A;  4IOC L;  3DXK A;  1HLU A;  3QFP A;  4IWV A;  5C2F A;  3VPZ A;  1YIT N;  1CZA N;  1TYQ B;  2P9U A;  3W0L A;  2F9T A;  3F9M A;  3SLC A;  2PFU A;  2V7Y A;  1VQ7 N;  4A2B A;  5B8H A;  4FWS A;  4XEI A;  3CCS N;  4BRM A;  2ASO A;  3SJH A;  1SQK A;  3E9L A;  4A5A A;  1NGJ A;  5AZJ B;  3D6R A;  3FLC O;  3VER A;  1YF5 L;  1KQS M;  2FF3 B;  1RFQ A;  4JKA A;  3PLA A;  1ESV A;  2HBJ A;  3H6E A;  3O1B A;  3ZEU A;  4BQL A;  2KLA A;  5C0Y A;  3W3D A;  3FZF A;  5F0X A;  1TYQ A;  3ENH A;  4DKW A;  1HKB A;  4PL8 A;  1S3X A;  1QQM A;  3VTI A;  4KH4 A;  1LOT B;  1WOQ A;  3N4P A;  3WXI A;  4BGA A;  4FO0 A;  1IG8 A;  4YOR A;  4NLB A;  4WFB L;  2F9W A;  3D2E B;  4HTL A;  1QZ5 A;  1OKJ A;  2QA4 N;  1NGG A;  4H0X B;  4JKH A;  4B1Z A;  4CD3 A;  1QQO A;  2UYT A;  3HM8 A;  4JHD B;  2AP1 A;  3CIP A;  3L4Q A;  4WQ5 A;  5AQO A;  4FWN A;  1RDU A;  3FZM A;  1VQO N;  1K8A O;  1VQ9 N;  1KAZ A;  5BN8 A;  3IMX A;  2NZT A;  1XUP O;  4H0Y B;  3SAG A;  5FPE A;  4BRN A;  1RDW X;  3MN5 A;  2D0P A;  4Z94 A;  4HWI A;  4JK9 A;  4CBU A;  4IO9 L;  2QWM A;  3EKU A;  3MWP A;  2P9L A;  1GLB G;  1BA1 A;  3HZ6 A;  4K42 A;  5AFU A;  3JS6 A;  4GNI A;  1KAX A;  2QW9 A;  2YHW A;  3VEZ A;  4PKI A;  4QS9 A;  3S41 A;  3M1F A;  3ID6 A;  2QWR A;  4A5B A;  5HOO A;  2QWN A;  1DEJ A;  1RGI A;  1ATS A;  3QML A;  3ZX0 A;  2FSN A;  3CCR N;  1QHA A;  2GUP A;  5E84 A;  3PIP L;  3HTV A;  4BRQ A;  2OAN A;  3O5B A;  3HBT A;  4DQ8 A;  2NRX A;  3BF1 A;  2A6A A;  3EE9 A;  3RSE A;  1YUW A;  2FSK A;  2FLO A;  3C7N B;  4BVO A;  4F9O A;  2NRT A;  3HI0 A;  4R79 A;  3H1V X;  1VQL N;  1M90 O;  5BPM A;  3O1W A;  1T6C A;  5AFU H;  4QS7 A;  2OTL N;  1GLC G;  2IVP A;  3D7E O;  1R59 O;  1Z6R A;  4J8F A;  3SBG A;  1IJJ A;  5AQL A;  5KQD A;  3DWL A;  2P9S A;  3ENB A;  3DXM B;  5AZI A;  3ZET A;  1NGB A;  1NGF A;  2Q31 A;  4CZJ A;  1QVG M;  1NGH A;  4FWQ A;  2VYP A;  3B8A X;  5BRH A;  1M1K O;  5ELZ A;  3VTH A;  3O4W A;  5GAE P;  5TKY A;  2A40 A;  3HSC A;  3SBT A;  3QIC A;  2BTF A;  3LDN A;  4IOA L;  4JD2 B;  3ZX2 A;  2HBM A;  4YOT A;  1ZBS A;  2CGK A;  3LDL A;  3O9Q A;  3PIO L;  3WEE A;  3L0Q A;  4A57 A;  3SMP A;  2CGL A;  5KQ8 A;  4H0P A;  4M7Y A;  2YCH A;  2J4R A;  3TSU A;  4CZE A;  2BH1 A;  1NGE A;  4BRE A;  5HL7 L;  4BQZ A;  3A5M C;  3VEY A;  3QBW A;  3MCA B;  4BVP A;  4EHT A;  5BRD A;  3D2F A;  3UB5 A;  3TSQ A;  5TKW A;  1GLJ O;  3R9P A;  4A61 A;  4BR9 A;  2QWQ A;  4U7B A;  3UKU A;  5EVZ A;  4K25 A;  1DGK N;  3ULE A;  3Q7C A;  1NGD A;  4FPA A;  1BUP A;  2ZGZ A;  3L4I A;  1Z05 A;  4RCH A;  3WUH A;  4EFH A;  4DB3 A;  4MLE A;  2Q36 A;  3TPQ A;  3H46 O;  5BPL A;  2D1K A;  1WUA A;  1GLE G;  3CJ1 A;  4BRI A;  3DJC A;  3DXK B;  3MMV A;  5CE3 A;  1NGI A;  1W2B M;  3CXC M;  2WBN A;  2P9U B;  4FOE A;  3VEV A;  4JKB A;  4C23 A;  4IO8 A;  2A41 A;  5CR4 A;  1W97 L;  4M63 C;  4U67 L;  3CJ7 A;  1C0G A;  1NBW A;  2QM1 A;  3KVG A;  2GX9 A;  5LJV A;  4M7X A;  4PKG A;  1JJ2 M;  1KAY A;  5C12 A;  5EX5 A;  5FPD A;  3ZX3 A;  1QQN A;  4FWL A;  2Q2R A;  1K8K A;  3ENO A;  3K9J A;  1YJ9 N;  2NRV A;  1NGC A;  3ZEU B;  4G9Z A;  2VCP A;  5KPT A;  5H1S Q;  2NRW A;  4WYB A;  3T7Z A;  4FOI A;  2E1Y A;  1VQP N;  3MX2 A;  1HUX A;  3O9S A;  3DLL L;  1QVF M;  3KK7 A;  3WXJ A;  4WCE L;  4FWR A;  1E4G T;  1BA0 A;  4BC4 A;  2YHY A;  3VEX A;  5AQM A;  2NRZ A;  2QWO A;  1ILY A;  4K41 A;  2GEL A;  2IVO A;  5AQK A;  3WXM B;  1GLA G;  3AY9 A;  1NLV A;  1HX1 A;  5M1Q A;  2Q0U A;  4MDA A;  4WQ4 A;  3IFR A;  3VET A;  3O8M A;  5AQF A;  3J7Z O;  5AQR A;  3FZL A;  2OTJ N;  3I56 N;  4IJA A;  1QZ6 A;  3C65 A;  3BP8 A;  3E9O A;  5M1K A;  4CJ7 A;  3I55 N;  3TTC A;  1YIJ N;  3AGK A;  2P9L B;  3E1Y A;  2ZJQ L;  1YVN A;  3AAR A;  3KHY A;  3LM9 A;  3P38 A;  3BEX A;  2VWB A;  4JEP A;  4JNE A;  1DKG D;  4WQ5 C;  3CCQ N;  2KKZ A;  3C0B A;  3CJC A;  2VGM A;  4CI6 A;  4YOU A;  1C0F A;  3GOI A;  3RSE B;  3G25 A;  4I6M A;  2JWK A;  3UKR A;  3DAW A;  4OPA A;  4IJN A;  2YJE A;  3VES A;  1K9M O;  5AQP A;  4WF9 L;  1YJN N;  3HOT A;  1HKG A;  4IDH A;  4BR4 A;  2E2P A;  2QWP A;  3KWI A;  4IEE A;  5ADX A;  2NLX A;  4PL7 A;  5BR9 A;  4H0T B;  2P9S B;  3G4S N;  2ASM A;  3SAF A;  2A5X A;  3EL2 A;  5AZI B;  3ZET B;  4FPB A;  2PBD A;  1BDG A;  3EE8 A;  4H5W A;  4KBO A;  1VQM N;  5DM7 L;  3GL1 A;  1KD1 O;  2H3G X;  3BUZ B;  3VEN A;  5GIO A;  3H1Q A;  3NVM A;  3H3O B;  4IZ9 A;  4JKG A;  2ITM A;  2I7P A;  4LC9 B;  4EIA A;  3O80 A;  4CZK A;  3A0I X;  5LJW A;  3WEE B;  4UY8 O;  1HPM A;  5BRE A;  1JCG A;  4ISE A;  5ADX H;  3A8Y A;  2EWS A;  4KH5 A;  2GTD A;  2HMP A;  4PKH A;  4A62 A;  4FVU A;  4BRL A;  1XC3 A;  4KH6 A;  5CHI A;  4XH4 A;  1LCU A;  5FPM A;  4BGB A;  3MX5 A;  3P39 A;  3QBX A;  4BC3 A;  5KPR A;  4CZF A;  4BG8 A;  3D2F B;  1VQK N;  2E2O A;  3FFK B;  4RTF D;  3UKU B;  2CGJ A;  1VQ5 N;  1BG3 A;  1NJI O;  3ULE B;  3MK6 A;  1MWM A;  1Q81 O;  5M1N A;  2JWL A;  3MN7 A;  4JKD A;  4BRP A;  1BO5 O;  3CCL N;  5MLC Q;  1YAG A;  3KWG A;  2QWL A;  4YOV A;  2GWJ A;  2NRH A;  3CPE A;  5BRF A;  3MDQ A;  3CF5 L;  3CCE N;  3CC2 N;  1V4T A;  5AQJ A;  2FSJ A;  2E88 A;  3A5N C;  5F2R A;  1MA9 B;  2P9N A;  3MN9 A;  1ATR A;  1D4X A;  3E66 A;  4CD1 A;  5M1P A;  3VF6 A;  4FWK A;  3AAQ A;  4A2A A;  4AM6 A;  1T3V A;  1K8K B;  3VGM A;  4GV3 A;  2FXU A;  5JMV A;  4NLC A;  2CH5 A;  5AR0 A;  4BR7 A;  3I33 A;  3Q7B A;  1OVY A;  3J8A A;  2HF4 A;  3A5O C;  3IKM A;  4H5N A;  1VQ6 N;  4YDU A;  1NWK A;  3CCM N;  4H5R A;  2KHO A;  3CC7 N;  3OW2 M;  1BU6 O;  3P4I A;  3O9R A;  3CHW A;  2HOE A;  4IFE A;  4ILJ A;  5M1O A;  5JVH L;  4BRG A;  2ZWH A;  3ATV A;  5AQI A;  4E1J A;  5JLH A;  3CET A;  2WC9 A;  3FZK A;  1S22 A;  3M6G A;  4H0O A;  4O8U A;  1VQ8 N;  4BC5 A;  3LDQ A;  5BN9 A;  1G99 A;  3CD6 N;  1YHQ N;  5F1X A;  3N4Q A;  4MLH A;  4RWT A;  3IUC A;  3MN6 A;  4CBW A;  2W41 A;  4H0V B;  4CZH A;  2P9K B;  1N8R O;  4BRA A;  3U9Z A;  4B1W B;  2Q97 A;  3NVK A;  2F7T A;  1SS6 A;  4MDB A;  3WT0 A;  1S72 N;  4FWP A;  2YI1 A;  3R3L A;  4WQ4 C;  2P9I B;  5AQY A;  5C2D A;  2NRR A;  3VEO A;  3VEW A;  2IIR A;  3G71 N;  3QDK A;  3OBW A;  3ZYY X;  3R1X A;  2A3Z A;  4JKC A;  2A42 A;  4BRF A;  4B1Y B;  5FPN A;  2ASP A;  3RVC A;  4BG9 A;  4BR0 A;  2IVN A;  2YJF A;  2PAV A;  5C15 A;  5M1F A;  2V7Z A;  3HOS A;  3I8B A;  4I6M B;  3UKR B;  4CZI A;  1ZC6 A;  2P9K A;  2NNW A;  3O6W A;  3T69 A;  3UE5 A;  2ZJP L;  1U2V A;  1JCF A;  3GDQ A;  4MO5 A;  1NGA A;  3VOV A;  4H5V A;  3JXU A;  3OHR A;  4AF1 A;  3CC4 N;  1O13 A;  2E1Z A;  3QFU A;  4IXC A;  2P9I A;  1E4F T;  1SAZ A;  5C10 A;  5LY3 A;  4ILG B;  2QTD A;  2HST A;  3L6Q A;  2V52 B;  4C1N I;  4O5F A;  1XQS C;  3CJ9 A;  3F2K A;  1MDU B;  4NO7 A;  4WFA L;  3FE1 A;  4H5T A;  3WQU A;  3LL3 A;  1MWK A;  5KPZ A;  3CME N;  4JAX A;  1Q7Y O;  1KC8 O;  5AQQ A;  2E8A A;  4B1U B;  4ILH A;  1X9J A;  3M3Z A;  3WQT A;  4FSV A;  3VF4 A;  3CCJ N;  5AZJ A;  2AA4 A;  3K9K A;  4JKG B;  2GEM A;  3O9U A;  3AGR A;  3LDO A;  4MO4 A;  1ZXO A;  1TUY A;  4JN4 A;  1EQY A;  5GIN A;  2WFB A;  3ID8 A;  3GG4 A;  3CJB A;  4YOY A;  1VQN N;  3VGL A;  2Q0R A;  4IOX A;  5GAD P;  1BWF O;  2Q1N A;  4JKF A;  3CQX A;  4BC2 A;  4YOX A;  3CMA N;  1Q82 O;  3CCU N;  3EZW A;  4O8K A;  5JIC A;  3GE1 A;  5AQU A;  3SMS A;  3LM2 A;  4GV6 A;  4DCH A;  1JCE A;  3CER A;  2E20 A;  1GLL O;  3SAH A;  3MCP A;  4DHY A;  2ZF5 O;  3C6H A;  3D2E A;  4CZG A;  3VMF B;  2YHX A;  4OPH A;  3GBT A;  4JHD A;  5AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...