4BRIA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg umppnp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
359
structure length
359
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 117
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4briA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4briA02
4FWRA 2QWNA 5AQSA 2ITMA 3UB5A 4BC5A 4QS8A 1BUPA 2YHYA 1BA1A 2GWKA 4JD2A 3CERA 2Q1NA 3GOIA 3M3ZA 1QZ6A 1U2VA 4BC2A 4A61A 3EL2A 3ATUA 2YCHA 5AZJA 3QBWA 1TUYA 4MO5A 1QQNA 4XH1A 1HKGA 1GLEG 1YUWA 2Q0RA 5AQKA 3F9MA 3O1WA 5BRHA 2ZGZA 3O8MA 5TKYA 3ZX3A 2E1YA 3FZLA 4XH4A 2BUPA 3BF3A 2QWRA 3LDOA 4HTLA 5BREA 2V51B 3MMVA 1EQYA 3LDNA 2WUSA 4FL9A 4KBOA 3VF6A 5LJVA 2IVNA 4FO0A 3WXIA 4WQ4A 3EO3A 4BREA 1R59O 1YAGA 3EZWA 2FXUA 3ZEUA 4M63C 3L6QA 3H1QA 1ATNA 3AAQA 4FPBA 4FWOA 2E20A 3VPZA 4BR9A 3UKRB 1U6ZA 1LCUA 2F9WA 1YXQA 4A2AA 3C7NA 4CZMA 1GLJO 5E84A 4K25A 5AR0A 3MN7A 4CZGA 2NLXA 2E2QA 4E1JA 4MLEA 3DXKB 3WXLA 3ZX0A 2QWMA 1NGCA 2E2PA 4EFHA 5FPMA 1MA9B 5AQNA 1SQKA 3H46O 5EXWA 1QQMA 4PKIA 1DKGD 3H45C 4B1XB 2GUPA 1IG8A 1QQOA 2E88A 2P9SB 1NWKA 1JCFA 4FWLA 1E4FT 5F0XA 4H0VB 3AAPA 2HOEA 4H0OA 2P9SA 2ZF5O 3L0QA 2DPNA 4CJ7A 1Z6RA 2P9KB 4CZEA 3ULEA 5JLFA 2HF3A 2PAVA 4BRAA 2NRHA 3SMPA 3GG4A 2IIRA 4CZKA 1ESVA 1U2VB 1Y64A 3A5LC 4H5WA 3VEZA 3ULEB 2ASPA 1GLCG 3JS6A 1OKJA 4WYBA 2W40A 3DWLA 4WQ5A 3O5BA 3C7NB 4FOIA 1CZAN 1NGJA 4BRQA 3VGMA 5AQGA 3R9PA 3R6MA 4JD2B 5BPMA 4H03B 3IDHA 4AM6A 1MDUB 2PBDA 3U4LA 1NGAA 4H5NA 4CZHA 4H5RA 3QMLA 3CJAA 5BN8A 1BO5O 1NGGA 5BRDA 4B1ZA 4H0YB 4LC9B 3CJ1A 3WUHA 3AARA 4FWSA 4CBUA 2QWPA 4BG8A 5I9EB 3CJCA 3L4IA 3U8XA 2ZGYA 4PL7A 4B1WB 1GLDG 4JHDB 3VEVA 3ZX2A 2P9UA 4DB3A 3DXMB 5AFUH 2YJEA 5AZJB 4ISGA 4JHDA 2V52B 3D2FA 4JN4A 3D2EA 3JXUA 4BRNA 1MWKA 3FZKA 3TU5A 3TPQA 3CETA 4YDUA 2OANA 3H1VX 3A5MC 1HJOA 2BTFA 3VOVA 4EHUA 4PKHA 1GLBG 1QHAA 5F1XA 2GELA 3FE1A 4K42A 3GBTA 4FWMA 1JCGA 2YHWA 5KPRA 1Z05A 3CJBA 3EN9A 1K8KB 4K43A 3CI5A 3FLCO 4CI6A 4CZJA 3UKUA 3ZETB 4EIAA 4M7XA 1GLLO 2D4WA 1NGDA 3ID8A 3U9DA 3SJHA 2A40A 2ZWHA 3O1BA 4WQ5C 1T44A 4IJAA 4CBXA 4A2BA 3B8AX 2QM1A 2QWQA 4EAHD 2E2OA 5KPZA 5AQHA 3SMSA 5EOYA 4BRDA 2A3ZA 3FR0A 1E4GT 3W3DA 1V4TA 3BF1A 1X3NA 2AA4A 3H6EA 5AQZA 4B1YB 3EKSA 1KXPA 2E1ZA 4H0TB 4B1UB 3CHWA 5FPNA 3HZ6A 4BC3A 2P9IA 3FZHA 3IUCA 2AP1A 2I7NA 3VETA 2EWSA 3VEWA 3C0BA 4IWVA 2Q36A 4RWTA 4FWPA 5AQXA 5AQRA 3RSEB 3VF2A 3MK6A 1SZ2A 3QDKA 4BRHA 4BQZA 1KAZA 2CGJA 1Q18A 5ADXA 5BPNA 3VF4A 1WOQA 1RGIA 1X3MA 5AQUA 1ZBSA 2GEMA 5EY4A 2D1KA 4GY2B 5AQFA 3M6GA 4BRMA 4BQLA 1TUUA 1NGHA 4BRCA 4I6MA 4EHTA 4CD1A 3W0LA 3HTVA 2YHXA 1RFQA 2QW9A 4XH5A 5BN9A 3VENA 3WQTA 3FZMA 3GE1A 1T6DA 3D7EO 1XC3A 1BDGA 3LM9A 3HI0A 5AQJA 5LY3A 3I33A 2P9PB 4IO8A 4AM7A 1HLUA 3VGLA 4DHYA 3U9ZA 5EX5A 4BC4A 1HKCA 2V7ZA 3D2EB 3QB0A 4CZIA 4BRGA 3LL3A 5AQMA 3R8EA 3ZETA 4NB4A 4BG9A 3KVGA 3FZFA 1K8KA 2P9PA 4JNEA 3KHYA 3DXMA 3HBTA 2P9LB 2GWJA 3UKRA 3LM2A 4BRFA 4WQ4C 1XUPO 2HF4A 3ENHA 4M7YA 4Y0WA 1ATRA 3LDLA 3J8AA 3ZEUB 4GNIA 2J4RA 4YDUC 4PKGA 1NMDA 3SLCA 4C23A 2FSJA 2I7PA 2CGKA 1NGFA 3D2FB 4K41A 1ZC6A 4MO4A 2P9LA 2YI1A 4QS7A 1H1VA 5FPDA 3VESA 4FWQA 3FFKB 5B8HA 4ISEA 4PL8A 2V7YA 5AQVA 3O6WA 1JCEA 1J6ZA 3WQUA 4BGAA 3UE5A 3QICA 3WXJA 3BP8A 2P9NB 4H0PA 2QXLA 1RDWX 1C0GA 3IFRA 1MWMA 4FPAA 3QFUA 4DQ8A 5AQTA 3O4WA 1BOTO 1HKBA 1NGEA 4FOEA 1BA0A 3CQYA 4L3QA 4BGBA 3H3OB 1KAYA 1NM1A 3A5NC 4H5TA 4F9OA 2FSNA 3OHRA 2YJFA 3LDQA 1S22A 3AY9A 4FWNA 5AQLA 5AQQA 3MCPA 5KQDA 3DAWA 3M1FA 1NGIA 1T6CA 4FSVA 4O8KA 1KAXA 4IJNA 1GLFO 1S3XA 2P9UB 3BUZB 2Q31A 4BRKA 1SAZA 1HPMA 4BVPA 2P9KA 2UYTA 4BVOA 5JICA 2E8AA 3LDPA 1ZXOA 4O5FA 5AQPA 3I8BA 5FPEA 4A62A 4BR0A 2GTDA 2FF3B 3ENOA 3QFPA 4JAXA 4NO7A 3S41A 4Z94A 3WEEB 4BR7A 4HWIA 5BRFA 4H0XB 2CGLA 1YVNA 3SK3A 4CD3A 3RSEA 5LJWA 3CJ9A 2FLOA 2FF6A 3VEYA 4CBWA 1P8ZA 1DEJA 3DXKA 1BG3A 2IVPA 5AQIA 5BPLA 1TYQA 5AZIA 4DCHA 4J8FA 2W41A 3WT0A 5ADXH 3VGKA 3A5OC 5ELZA 2QWOA 3CQXA 3P4IA 4BRPA 3VEXA 4BRLA 1IJJA 1NLVA 2E2NA 2ASMA 4RCHA 2Q0UA 3G25A 2Q97A 2D0PA 2VWBA 3MN5A 3BEXA 5AQOA 3O80A 3KZBA 4B1VA 3QBXA 1TYQB 5AZIB 5KQ8A 3HM8A 2Q2RA 2A6AA 4BRIA 3O08A 2KHOA 4XEIA 1V4SA 2FSKA 1NGBA 3UKUB 3DJCA 3VEOA 4I6MB 4RTFD 2P9IB 1X9JA 4IXCA 4BR2A 3HSCA 2ASOA 5JLHA 5EVZA 4B9QA 1LOTB 3A8YA 1DGKN 4BROA 1BU6O 2NZTA 3MN6A 1D4XA 5KPTA 3WEEA 1ATSA 3ATVA 2H3GX 5AQWA 5CE3A 2P9NA 3H3NO 5JMVA 4BR5A 1NBWA 3GL1A 2F9TA 3FGUA 4IZ9A 3A0IX 4CZFA 1G99A 2CH6A 2QWLA 1QZ5A 2VCPA 3EKUA 1WUAA 3MDQA 5BR9A 1BWFO 4QS9A 2VYPA 5AFUA 3GDQA 3MN9A 4ISFA 5AQYA 2A42A 2D0OA 2A5XA 2A41A 1GLAG 2HMPA 3IMXA 2IVOA 3VERA 4FWKA 4MLHA 4BR4A 5F2RA 1C0FA 2CH5A 1HUXA 4CZLA 3WXKA 1HX1A 3CJ7A 5E26A 4H5VA 1XQSC 3CIPA
chains in the Genus database with same CATH superfamily
2JLEA 1WBDA 1YTUA 3UB5A 4YOVA 1BUPA 1VAZA 1WAJA 2O8EB 1ASWA 2Q1NA 1ZBLA 3M3ZA 1U2VA 4BC2A 4DLEA 1VSEA 4A61A 2YCHA 3O9SA 4DFJA 4AILC 1JLGA 1QQNA 3VMFB 4Z4HA 4FJGA 1HRHA 1HKGA 4JLHA 3O9RA 3J81O 4CHZA 4CJ3A 5CHIA 5BRHA 2YHBA 3F73A 3O8MA 3L2UA 3LDOA 4HHTA 2V51B 4MFBA 3HVTA 4KBOA 3TSPA 1YJWN 1S1XA 2HW3A 3CFPA 4BREA 3P83D 1HYSA 1YAGA 3EZWA 2FXUA 3LP3A 2FC0A 3OYNA 3V9SA 2VG6A 1ATNA 5KI6A 3VPZA 4BR9A 4H4OA 1S9GA 2GBZA 3AVFA 4W5RA 4K25A 3MX5A 3MN7A 3K5OA 3HOSA 3ZX0A 1NGCA 2E2PA 5EXWA 4PKIA 1XHXA 2XO7A 1Y97A 1UA1A 4JKHA 1QQOA 2P9SB 3RMBA 1Q7YO 5KTQA 3N4QA 4LSLA 4M45A 3K2PA 2NRWA 2P9SA 3L0QA 1WSEA 4KH4A 3ULEA 5JLFA 3PO4A 3KD5E 3NDKA 1LV5A 4FM1A 2JGUA 4BRAA 1IG9A 3OS1A 1YF5L 3SMPA 1VQ7N 1NK5A 1Z25A 1RT3A 1Y64A 4IOCL 2HBLA 3ULEB 4IOAL 2ASPA 3BY5A 3I0SA 1RTHA 4WYBA 1HYZA 1WSIA 3DWLA 4NLCA 1WNSA 4HUGA 3SV3A 1IBLK 3C7NB 4JEPA 1CZAN 3V4IA 1FKPA 2PZSA 3SZ2A 2VGMA 3VGMA 4BRQA 3R6MA 4FW2A 3P5JA 2B4JA 4FLZA 4H5NA 2W42A 5BN8A 1NGGA 3CCQN 4B1ZA 4DSIA 4CE9A 4LC9B 3TSQA 3WUHA 4I9QA 5I9EB 1C1AA 4A5BA 4KREA 4B1WB 1HNXK 3VEVA 3SBGA 3ZX2A 2P9UA 2YJEA 3LWLA 3HL8A 4W5TA 1QHTA 2IDOA 4ISGA 5D3GA 4A57A 3M8RA 1EP4A 3D2EA 1BISA 5J1EA 1MWKA 3HVRA 3TPQA 3I55N 4YDUA 2QA4N 3H1VX 3O9UA 1RNHA 1LAWA 1GLBG 1NJYA 5KGXA 5CZ1A 4L8RB 1QHAA 1UAXA 5F1XA 3K0SA 3FE1A 3F9KA 4K42A 2HHXA 4FWMA 2O8DB 1VSKA 3EN9A 1A5XA 4FJMA 2D4WA 4JI3K 3ID8A 3NBPA 3CMAN 1Q81O 4CGDA 2UXBK 3HPGA 3QERA 2WBNA 3IRXA 3RVCA 3PX0A 4A59A 1IBKK 2QM1A 4KI4A 4GKJK 1K6YA 3LZIA 2ZJRL 4FZXC 1E4GT 3W3DA 4DQPA 1V4TA 4NYNA 2AA4A 1KFDA 3H6EA 5AQZA 2AJQA 3IG1A 1VHXA 3AGRA 4DU3A 1VSMA 1L3UA 4H0TB 4M3RA 4F3OA 4BC3A 2P9IA 1EWQA 3IUCA 4GV3A 2NRRA 1VSDA 5JS2A 3VEWA 4IWVA 4E0DA 2F4VK 4YY3K 3CM6A 3VF2A 3RSEB 1S6PA 4BDPA 1J9AA 1SZ2A 4MDBA 3S3NA 2QK9A 1NK4A 3OYAA 3SV4A 5BPNA 3VF4A 1WOQA 1B9DA 4IDHA 2GEMA 2D1KA 1YJ9N 3KK3A 3V1RA 2Z1JA 1U45A 4BQLA 3MEGA 1BI4A 4CJVA 3NGYA 4BRCA 4I6MA 4CHYA 4GKKK 4FLVA 1J53A 4CD1A 2YHXA 5BN9A 1ASUA 5EU7A 3SPZA 3TAPA 1FK9A 1S1WA 3GE1A 3Q7CA 1TKXA 3SI6A 4CJ5A 2P9PB 2BGGA 1HLUA 3U9ZA 2KQ2A 5EX5A 3OYCA 1HKCA 1U47A 2O8FA 2V7ZA 4CZIA 4BRGA 4CJFA 2D0BA 3U3GA 2G8IA 2ATQA 2P9PA 2YV0X 4AH9A 4CHNA 4OLAA 4BE1A 1XUPO 3VQDA 4FM0A 4N5SA 3AGKA 3ENHA 1WSGA 3KLGA 4KFBA 1T7PA 1ZBIA 2B5JA 1NMDA 3SLCA 1RTIA 2CGKA 4QOZB 1NGFA 5CY4A 1ZC6A 3JAMO 4FWQA 1T05A 1J5OA 4KHPK 4DTPA 2V7YA 2RN2A 4E7JA 2XHBA 3THYA 1J6ZA 4WF9L 3L3UA 3G10A 3VQ9A 3WXJA 3BP8A 1CXQA 3D0PA 1RBSA 4I2QA 1C0UA 1VSHA 3T1HK 5C24A 1NGEA 3CQYA 1J54A 3V9ZA 3H3OB 1C1CA 3PUFA 3V6DA 4LF7K 5AQLA 5CYQA 1RDBA 3KLFA 4EZ9A 5M1KA 4YOYA 1XNQK 2Y1IA 2DY4A 3M5RA 4BRKA 3DMJA 2G8KA 1SAZA 3JYTA 2PYJA 5FPEA 4FK0A 4N41A 4FVUA 4IG0A 5JS1A 4DR3K 2FF3B 1IO2A 4Z94A 3S41A 4KAZA 4HWIA 2KKZA 2CGLA 2ZQBA 3SK3A 3ZSVA 3NH2A 3RSEA 2FLOA 2HSTA 4FJNA 3VN5A 4DFPA 3BDPA 4CEOA 4CBWA 1P8ZA 4J2DA 2X6SA 1BG3A 2WC9A 5AQIA 2Z1GA 3E9OA 1P90A 1TYQA 5AZIA 5HL7L 3DLKA 4J2BA 3C6HA 1VQNN 2W41A 5ADXH 3VGKA 1U4BA 5DM7L 2QWOA 4CGFA 3LWMA 3O9TA 4BRPA 4C1NI 4Z4CA 4WFNL 4RCHA 3ZSXA 1C1BA 3MN5A 1S1TA 2NRZA 3KZBA 3NH1A 3AVBA 5FRMA 1XMOK 1ILYA 4DFKA 2A6AA 4W5QA 4UQGA 3ZT4A 3OYFA 2KHOA 4XEIA 1V4SA 4DTNA 3DJCA 3MECA 2XY8A 2YHAA 3VA3A 1QQCA 2P9IB 3TR8A 3O9QA 1VQ6N 1IV0A 1KVCA 1KVAA 4JKGB 5EVZA 4B9QA 3OYGA 1KLNA 1R0AA 4I7FA 4H4MA 4HUFA 3NHGA 3GL1A 5J2MA 3FGUA 3DLBA 4IZ9A 3LP2A 1QZ5A 3TTDA 2E5LK 2QKBA 1MU2A 4IDKA 4ISFA 1S1VA 3LAKA 2A5XA 3AO1A 4JK7A 4CF0A 2OPSA 3T3FA 3MXMA 4B9MA 4DR7K 4MLHA 2CH5A 4CZLA 4WE1A 4DU1A 4F3TA 3CIPA 1N34K 4J2AA 1D8YA 5AQSA 4BC5A 3TWHA 1OH7A 2YHYA 3MEEA 1QSLA 4B9TA 2KFNA 4JD2A 1NMNA 1RT2A 1QZ6A 3ATUA 1TUYA 2XRIA 4MO5A 1JLEA 1HNZK 1YUWA 1S9EA 2Q0RA 1X1PA 3F9MA 5C0YA 3FZLA 4XH4A 2BUPA 3BF3A 1YHQN 1KRPA 4DQQA 3MMVA 1T03A 4IG3A 2WUSA 1GOCA 3KLEA 4CF8A 1KD1O 3AO4A 3TTFA 5FROA 3WXIA 4WQ4A 3EO3A 4BY9C 1R59O 3NF7A 1VSLA 3G71N 3AAQA 2E20A 3CC4N 1Q82O 3U3YA 3EZ5A 1LWEA 4NYFA 3J80O 1HYVA 3VQ8A 1U6ZA 3LP1A 4A2AA 2NRTA 3CC2N 4CZMA 2ZD1A 4ID5A 1BCOA 4NCBA 1TL3A 4DWIA 3NF6A 3TAFA 2O4IA 1JL1A 4E1JA 4MLEA 3WNGA 3V9WA 1ZBHA 3SQ1A 5AQNA 2FBYA 1SQKA 1QQMA 1RTJA 3QIOA 4DSJA 4CK1A 2GUPA 1IG8A 1XHZA 2BH1A 4FXDA 1JCFA 4FWLA 5F0XA 4H0VB 1YITN 3OA9A 3AAPA 2VWKA 4R5PA 3CCJN 1REVA 3SYZA 2KZZA 4JYAK 4OJRA 4JKEA 3IKMA 4CZEA 5GAEP 2HF3A 2IS3A 1XNRK 1KLMA 3K59A 4DU4A 4KI6A 4Z4GA 3ZSQA 2NRHA 5T7BA 3SQ0A 2IIRA 4E7LA 4JKBA 1KC8O 3A5LC 4H5WA 3VEZA 3HJFA 1GLCG 2B6AA 2UUCK 1ZBFA 3D45A 1OKJA 1TKZA 3AV9A 4BWMA 3CCLN 3ENBA 4AHUA 1JKHA 1ZYQA 4KH6A 4FOIA 1VQLN 3AVMA 4FLWA 5LL6Z 1SV5A 3CPEA 4JK9A 5AQGA 2OZMA 1HNVA 3TAGA 4JD2B 1XMQK 4WFAL 3AO5A 2W6KA 4KHQA 4CZHA 4DTRA 4H5RA 3CJAA 5BRDA 2PYLA 3S3OA 4FM2A 4CFDA 2QWPA 4BG8A 4BDYA 3CJCA 5A2QO 1BCMA 1T3VA 1RT7A 1GLDG 4JHDB 3OJUA 4NCAA 4DB3A 3CCUN 3OYLA 1SL1A 5M1FA 4HUEA 2V52B 1N32K 3THXB 4DV5K 4BRNA 2D0CA 1RILA 3NF9A 1RTDA 3AVLA 3E66A 3V9UA 2ZJPL 3CETA 5GIPA 4WFBL 3HXMA 3A5MC 1N8RO 2YX6A 2G8HA 3CMEN 3VOVA 4IEEA 4JKDA 2XY6A 3SUPA 4JS5A 1VSJA 4CF9A 1JCGA 1Z05A 4CJ4A 4CI6A 4K43A 3CI5A 4CZJA 3UKUA 3A2FA 1GLLO 4M7XA 3UIQA 3H08A 3K9JA 2A40A 4DV1K 3OJSA 1S72N 3ZLJA 4IJAA 4QCLA 1TV6A 4A2BA 3B8AX 3K9KA 5JVHL 2O8CB 4M3TA 4GV9A 4F4KA 2QWQA 2FBXA 4CHOA 1NG9A 3T1AA 4HCBA 5AQHA 3QEPA 1WSHA 2F96A 3BF1A 3NH0A 4YOUA 4YFUA 4B1YB 2DTUA 1W9HA 1KXPA 1RDAA 2FBVA 3HP6A 2E1ZA 3TTCA 2GV9A 3VQ6A 4B1UB 3MXIA 3MAQA 4LFCK 4R79A 4RWTA 4FWPA 5AQXA 3MWPA 3MK6A 3CFRA 3QEWA 1U04A 1KAZA 2CGJA 4CEZA 1OH5A 4ELTA 4PY5A 1RGIA 1X3MA 5KRTA 1ZBSA 3MWTA 3ZSZA 3E01A 3AVJA 4GY2B 3F2KA 3AO2A 4BRMA 1L5UA 3EE9A 4DUZK 2Q3SA 4M3WA 1IKYA 3MX2A 4FVMA 2UUAK 1CXUA 3HTVA 1RFQA 2QW9A 4TSXA 4KH5A 4RW4A 3J7ZO 1T6DA 1XC3A 1TVRA 5HRRA 5FLXO 5AQJA 1HMVA 3I33A 4CEDA 1WB9A 4AM7A 1NKCA 1OVYA 3VGLA 4DHYA 4CGJA 1IKWA 5M1NA 3D2EB 4KHSA 2HB5A 3KLHA 3LL3A 3ZETA 4NB4A 3KVGA 3FZFA 1K8KA 4RW7A 3RMCA 3ZSYA 1UA0A 3DXMA 2P9LB 3R3LA 3UKRA 3O4NA 3LM2A 4JI6K 3L8BA 4WQ4C 2RHKA 3T69A 2HF4A 4Y0WA 4DSLA 1LW2A 1ATRA 4FJKA 1TK0A 3O3FA 4F8RA 4GNIA 5MLCQ 5JVGL 1DTTA 2J4RA 3SAFA 1RT4A 3C6AA 3O3HA 4PKGA 5KGWA 4C23A 2FSJA 4LF6K 2ETJA 1C0TA 1JLFA 3QLHA 1A5VA 1SS6A 4MO4A 1NK7A 3VESA 3FFKB 5B8HA 4ISEA 1NU0A 4PL8A 3ZT2A 4FJHA 1HNWK 4LD0A 4B9NA 4ZTFA 2HHQA 2OPPA 4BGAA 1NJIO 4JS4A 2P9NB 2YNFA 3B6OA 3IFRA 1Q86O 3RR8A 4YNQA 1NK6A 4DQ8A 5AQTA 1HR0K 3O4WA 1BOTO 3CM5A 2YNIA 4DV7K 4L3QA 1NM1A 3VQBA 1VQ9N 4KB1A 1YIJN 4F9OA 4K8XA 4CJEA 1B9FA 4B8CA 2VGNA 5AQQA 1S22A 1RCHA 4G1QA 3DLHA 1ZBUA 4BE0A 3QEIA 3PO5A 4DV0K 3DAWA 1X9SA 1NGIA 3DM2A 3CC7N 1S3XA 4CK2A 4IEIA 2P9UB 1I94K 4LFAK 1HPMA 2P9KA 2UYTA 4JK8A 5JICA 2WONA 4OPJA 1NNEA 4J2EA 3EEQA 1ZXOA 4W5NA 4FZYA 2O8CA 1EWRA 1TK8A 2GTDA 4JAXA 4NO7A 2HHTA 2O8BB 1RDDA 3AA2A 4CHQA 4BWJA 4CD3A 1JXBA 4QAGA 4LSNA 2FF6A 4IKFA 4FJIA 3VEYA 1DEJA 2YKNA 1RBUA 2IVPA 2E4LA 4DCHA 4YHHK 3PIOL 4OPAA 4ELUA 1LWCA 4C1NK 3WT0A 5GINA 5ELZA 4AHSA 3TARA 4BRLA 3AA5X 1JJ2M 4OPKA 2OYQA 3OS0A 1RT1A 2HHUA 5C2DA 1O13A 3PIPL 2IOCA 3O80A 5AQOA 1W0HA 1TGOA 4B1VA 3SCXA 1VK0A 1TYQB 5AZIB 1KFSA 5KQ8A 1D9FA 3SUQA 3QNOA 1NGBA 3VEOA 1DLOA 4I6MB 4JKAA 4RTFD 4IXCA 4BR2A 2G8VA 3HSCA 1BQMA 3L4QA 3M8PA 5JLHA 1LOTB 3OVNA 3A8YA 4E1MA 4E19A 3ZYYX 3C94A 3MN6A 1D4XA 4CEAA 3QETA 1ATSA 3ATVA 2H3GX 5AQWA 2P9NA 1FKOA 2VQFK 1TL1A 4BR5A 3KJVA 4DR5K 4B9VA 1N36K 4DV4K 3PV8A 1Q8IA 3KIOA 4KB0A 3ZT1A 1TKTA 2VCPA 3MDQA 5AFUA 3GDQA 4DS4A 4AQYK 2A42A 2D0OA 4LF4K 5H1SQ 4KTWA 2OTLN 1EX4A 2IVOA 2IAJA 3HPHA 5F2RA 3NE6A 3I56N 2VQEK 1X9MA 1HUXA 3HT3A 3WXKA 3CQ8A 1HX1A 5E26A 4H5VA 3ZSRA 4FWRA 2QWNA 3KD1E 2ITMA 5GAHP 3C6TA 5K14A 1BA1A 1NOZA 1KSPA 4DV3K 1L3SA 3KKSA 5C12A 5HBMA 3S3MA 1OH6A 3CF5L 4JI1K 1GLEG 5HROA 5AQKA 4W5OA 3V9XA 4A5AA 4DR6K 2I5JA 4AHRA 3ZX3A 1E3MA 5BREA 5C2FA 3LDNA 4Z0UA 2O8EA 3T7ZA 4HCCA 5LJVA 4FYDA 4FK2A 4K0KK 2IVNA 3NVMA 3SUNA 5CZ2A 3CD6N 1UOCA 3ZEUA 3L6QA 1ASVA 3CCRN 4FWOA 4OKJA 3UKRB 1LCUA 5LMNK 4KHUA 1NJZA 4Q5VA 3DLGA 1DT9A 4Q0BA 1GLJO 2NRVA 1NK8A 1N33K 5AR0A 2FBTA 2E2QA 4OGCA 1Q9YA 4EFHA 2HHVA 5FDLA 4CEBA 1X9WA 3H46O 1RBTA 4DSEA 3H45C 3AA3A 2E88A 4DTOA 4FJ8A 3T19A 1NWKA 4CEEA 3RTVA 4FCYA 2KTQA 4O0JA 4E7HA 4H0OA 3RRHA 1SKWA 4KTZA 2DPNA 1Z6RA 2P9KB 2WFBA 4UY8O 4NXMK 3WNEA 3VA0A 2P1JA 4B3OA 3GG4A 2F8SA 3AA4A 4CZKA 1U2VB 4YOTA 1OVQA 2PY5A 3E1YA 4DG1A 3CYMA 4CEQA 3JS6A 3L3VA 2RF2A 3HOTA 4KHYA 2HVIA 3C65A 2RE2A 4KKOA 4DR1K 2OZSA 5CR4A 4I2PA 1NK9A 4H03B 4AM6A 1MDUB 2PBDA 3U4LA 1NGAA 1TAQA 1S5JA 1BO5O 5DM6L 3PY8A 4FWSA 4CBUA 4AHCA 3QNNA 4LF9K 3L4IA 4HTUA 2HNYA 1I39A 2BANA 3U8XA 4PL7A 2YNHA 5J2QA 3DXMB 5AFUH 3Q7BA 5IT9O 3WNFA 4JN4A 1LAVA 3JXUA 4O8UA 3FZKA 3TU5A 4CFBA 4M41A 4EP4A 1HJOA 1BQNA 3SPYA 4I9LA 4PQUA 3MCAB 4DKWA 1EKEA 2IC3A 1L3TA 5HRSA 2YHWA 5KPRA 2QTDA 3CJBA 1K8KB 2O4GA 4EIAA 4IOXA 3KLIA 5TKWA 5HP1A 1RT6A 3ZSOA 2UU9K 3SJHA 3MXJA 4B9LA 2ZWHA 4CVNE 4Z4IA 4WQ5C 1TK5A 5DK5A 4F2SA 2HBKA 3HPOA 4FLUA 1GOAA 1BGXT 3J7AP 4EAHD 3NFAA 2E2OA 1I3AA 1KTQA 3SMSA 3FR0A 3PLAA 1X3NA 1RBRA 4FJ9A 3EKSA 2BDPA 3C6UA 4B3MK 3VQCA 3CHWA 1CLQA 1C0MA 3KTQA 1IKXA 4N56A 3FZHA 3O3GA 2AP1A 2EWSA 3DLRA 1F21A 3C0BA 4CJWA 3FFIA 2EHGA 3MEDA 1N6QA 3DRSA 3QDKA 4BRHA 4BQZA 4IFVA 3QESA 4ID1A 4B9SA 5ADXA 3QINA 5AQUA 5EY4A 1QTMA 4GMJB 5E41A 3RMDA 5M1PA 4GVEA 3M8SA 1JLBA 1KVBA 3CCEN 4CJSA 1YT3A 4O4GA 1QVGM 3HRGA 1HNIA 3VENA 4FLXA 3FZMA 1QE1A 4U7BA 1BDGA 3LM9A 3P31A 4FK4A 5KRSA 5LY3A 2ITGA 2Y1JA 1QSSA 3DYAA 4G9ZA 2WTUA 1EETA 1VQON 5AQMA 3R8EA 2IGIA 4BG9A 4JNEA 5AJ3K 3HBTA 4PA1A 4DF8A 2A1RA 3OBWA 4M7YA 1EO1A 4WCEL 4DS5A 3J8AA 3EE8A 2KFZA 2HNDA 3O4QA 1J5EK 1NKBA 2I7PA 3NGZA 4OLBA 4X65K 3NGIA 3NCIA 1VQKN 4K41A 5GAGP 2NRXA 2P9LA 4CECA 4QS7A 3HM9A 1H1VA 5FPDA 1IBMK 4CERA 5AQVA 3OYBA 1U49A 2HBJA 1JL2A 4ZTJA 1JCEA 3WQUA 4K8ZA 4DR2K 3RMAA 1VQ4N 3UE5A 3AO3A 4CFAA 4H0PA 2QXLA 1C0GA 1BHLA 3KWGA 1WAFA 1MWMA 4FPAA 1B92A 1M1KO 4E89A 4CESA 1HQEA 3LPTA 1LW0A 5SWMA 1BA0A 4JKGA 4X66K 4BGBA 1K9MO 1KAYA 3LANA 3A5NC 3THWA 2VG5A 2KZMA 4FJ5A 4N47A 1VRTA 3OYMA 3AVHA 3OHRA 2YJFA 4OPHA 4M3YA 3AY9A 3ID6A 3JSMA 1T6CA 4O8KA 4IJNA 1D5AA 4DV6K 3BUZB 3VQAA 3SAGA 4H8KA 3CCVN 4BVOA 1SUQA 2E8AA 2DFHA 4DV2K 3SNNA 3S9HA 5AQPA 1NOYA 3I8BA 5CYMA 1CZBA 1K8AO 1U48A 4A62A 4BR0A 1WSFA 2NUBA 3DI6A 3QO9A 4B08A 3NVKA 1NKEA 3VQ5A 4BR7A 4H0XB 1YVNA 5SZTA 3ZSWA 5LJWA 1YTAA 1L3VA 1SKSA 4GVMA 2OCEA 3THWB 4FJJA 2XY5A 3ASMA 3DXKA 3VQQA 5BR8K 5BPLA 4RW6A 1NJWA 3CFOA 4NCGA 1FJGK 4KHNA 4DLGA 1QSYA 3CG7A 5HLFA 2DFFA 3OS2A 3CQXA 3P4IA 3VEXA 3THVA 2E2NA 2Q0UA 3G25A 2Q97A 2VWBA 3DRRA 4AHTA 4BE2A 3QBXA 3ALYA 2Q2RA 4BRIA 5C15A 4E7KA 3UKUB 2QXFA 1VSFA 1X9JA 3RR7A 3N4PA 2ASOA 3DLLL 4DTJA 1HJRA 2X74A 2NZTA 1N5YA 3LDSA 3WEEA 1YVUA 4MQ3A 1KQSM 1NBWA 2XY7A 2F9TA 3P1GA 4JI4K 2QWLA 4DUYK 4OX9K 4GW6A 4KHWA 2ZE2A 3TI0A 3EKUA 5BR9A 4FZZA 4QS9A 2VYPA 3CCMN 2E6LA 4FLYA 4CJLA 4RW8A 4DFMA 3L2VA 2O8DA 2A41A 3ISNC 3VERA 4FWKA 4X64K 2VG7A 1IKVA 1XQSC 1BL3A 4QS8A 4CW7B 2GWKA 4KV8A 3CERA 3GOIA 3EL2A 5AZJA 3QBWA 1XC9A 4GV6A 4XH1A 1HQUA 3O1WA 3P38A 4Y1CA 4JI0K 1VQPN 2ZGZA 5TKYA 2UXDK 2E1YA 3AVCA 4HTLA 2QWRA 5FRNA 2GUIA 1EQYA 1QS4A 2P5OA 2RPIA 4CJUA 4Y1DA 4FL9A 4CK3A 3C95A 3VF6A 4CIGA 4M42A 4FO0A 4IFEA 1UWBA 3KK1A 3EY1A 4CJPA 4IBNA 1JLAA 4M63C 3TABA 3SUOA 3H1QA 1RDCA 4FPBA 4PWDA 2EX3A 3R1XA 2D0AA 2O8BA 2F9WA 1YXQA 4IFYA 4Z4EA 3C7NA 2JWLA 4ILJA 5E84A 4DTMA 4O44A 3TAEA 4CZGA 3ULDA 2G8FA 2NLXA 1W7AA 2F7TA 3WXLA 3DXKB 2PFUA 2QWMA 4YOWA 3KKRA 4LF5K 2GX9A 5FPMA 1MA9B 4CJQA 1W97L 1DKGD 4DTUA 4B1XB 3I8DA 4ICLA 2X78A 1E4FT 2KLAA 4LY7A 1D9DA 1LWFA 1O1WA 3HK2A 3OTOK 3VQEA 3L2QA 4C8MA 5C10A 2HOEA 4DQIA 3IS9A 2BE2A 4ILHA 2ZF5O 4CJ7A 2PAVA 4YOXA 4O5BA 1T8EA 5J2PA 4CIFA 3RWUA 1ESVA 1VQ5N 2HMIA 2UUBK 5I3UA 3DLEA 4DSKA 3V81A 3V1OA 2W40A 3K57A 5J2NA 4WQ5A 3O5BA 2HBMA 5HRPA 4DR4K 4LH5A 4U67L 1NGJA 3TAMA 4OVLA 4E7IA 3R9PA 5BPMA 2D5RA 3IDHA 1K73O 3DOKA 1TAUA 2G8WA 1BIZA 1Z26A 4B8AB 3QMLA 3K5LA 4CCHA 3LAMA 4H0YB 3KK7A 4V19S 3CJ1A 3AARA 2QKKA 4AHVA 3SBTA 3BZCA 3PX6A 1VQ8N 2ZGYA 3G6EN 2A1SA 5DMRA 1ITGA 4JRQA 4KTQA 3F5TA 3HYFA 4EP5A 3J7YP 2HHWA 5AZJB 4JHDA 2WOMA 4C8NA 2W6LA 3D2FA 3AVGA 1FXXA 4ILGB 5GADP 2OANA 2ZJQL 4B9UA 4LF8K 4NLBA 2BTFA 2R7YA 2HHHK 3DOLA 4EHUA 4DSFA 4PKHA 3U6FA 2ZM6K 4JI5K 5IWAK 3OYIA 2GELA 3AVIA 3GBTA 5M1OA 1A5WA 3K5NA 4OGEA 3FLCO 1W2BM 1S1UA 3ZETB 1BIUA 1NGDA 1XWLA 4CGIA 3U9DA 5C42A 2OTJN 3BGRA 3O1BA 1WSJA 1T44A 4N76A 2QEXN 2P5GA 4CBXA 4PHTX 3OYHA 2OPRA 4CFCA 4XIUA 5GIOA 5KPZA 4CEFA 1IH7A 5EOYA 4BRDA 1JLQA 2A3ZA 1M90O 5HRNA 3ZT3A 4FW1A 3ZT0A 2OA8A 4E3SA 4CHPA 3G0ZA 1G15A 4CGGA 4E1NA 5FPNA 3HZ6A 1RBVA 1JLCA 2JWKA 5HOOA 3K5MA 2HVHA 2I7NA 3VETA 2Q36A 1XI1A 4KRFA 5AQRA 4JRPA 3D6RA 3SQ4A 3OBYA 1NK0A 1Q18A 4C8LA 3V1QA 3T1YK 3OYEA 1TKDA 3PX4A 1C6VA 2YKMA 1WN7A 5AQFA 3M6GA 3EYZA 3TSUA 1TUUA 1NGHA 1RDUA 4DMNA 2KW4A 4CJTA 4M3ZA 4EHTA 4KPYA 3AVAA 3W0LA 4XH5A 3WQTA 3LALA 3D7EO 4RW9A 4O0IA 1FW6A 3HI0A 3OYDA 4LH4A 2Z1IA 4IO8A 4JKCA 4OO1J 3L2RA 3LZJA 3WNHA 3L2WA 4M3UA 4BC4A 4HVJA 3QB0A 3CCSN 3CXCM 4MDAA 4O55A 1YJNN 3OY9A 3OYJA 3KHYA 3PSIA 3SJJA 3P39A 1QVFM 3WXMB 3ZCMA 1OH8A 2GWJA 3ITHA 4BRFA 4C8OA 3BZKA 3E9PA 3LDLA 3QEXA 1RT5A 3ZEUB 4RG8A 4YDUC 4CF2A 4OKKA 1WBBA 3AVKA 3D2FB 2HNZA 1VSIA 2YI1A 4M3XA 4CGHA 1BI4B 4DTXA 4B3TK 2O8FB 3O6WA 1JXEA 1GOBA 4NXNK 3HO1A 3VQ4A 2QI2A 3QICA 4LFBK 4DQRA 1RDWX 3NMUA 2HHSA 4KO0A 1VQMN 4BACA 3THYB 3I0RA 3QFUA 1HKBA 1WLJA 4FOEA 4DF4A 1NJXA 4FJ7A 4H5TA 2DFEA 3AVNA 1SKRA 2FSNA 4DQSA 3LDQA 4FWNA 3MCPA 5KQDA 2LSNA 3M1FA 4ELVA 4FSVA 1KAXA 1GLFO 1CZ9A 2OPQA 3QIPA 2Q31A 2VWJA 4CJKA 4F2RA 2RKIA 4BVPA 1S6QA 4JI2K 5LMUK 5M1QA 4AF1A 3LDPA 4O5FA 4JKFA 3PSFA 3VTIA 3KK2A 3ENOA 3QFPA 3WEEB 3SAHA 4B3RK 5BRFA 4CIEA 1KCFA 3NF8A 2YNGA 3B6PA 2Z1HA 3CJ9A 4FJLA 4FLTA 1HPZA 3KWIA 4B3SK 1YI2N 1DTQA 3OYKA 2E6MA 5C25A 4J8FA 4ZHRA 3NAEA 3A5OC 4PUOA 1IJJA 1NLVA 4EZ6A 2ASMA 2D0PA 1EXQA 3VQPA 4CF1A 5I42A 3BEXA 4CJRA 2P51A 4OKEA 2G8UA 3VTHA 3QEVA 4IO9L 3HM8A 3CPWM 4JI7K 4DTSA 3O08A 4BDZA 2FSKA 4JI8K 3HP9A 4FJXA 2UXCK 3LP0A 3E9LA 3TANA 1DGKN 4BROA 2X6NA 1BU6O 3G4SN 3IAYA 5KPTA 3K58A 4C8KA 4Z4FA 3VQ7A 4JV5K 5CE3A 3H3NO 5JMVA 2NNWA 1VRUA 3RRGA 1SL0A 3A0IX 4CZFA 1G99A 2CH6A 3M8QA 3TAQA 3THXA 4YORA 1WUAA 2F8TA 1BWFO 3HSTB 3MN9A 1SL2A 3SQ2A 5AQYA 1GLAG 3OW2M 1Q9XA 2HMPA 3IMXA 3LPUA 4BR4A 3DRPA 1C0FA 3CJ7A 4X62K
chains in the Genus database with same CATH topology
4FWRA 2QWNA 5AQSA 2ITMA 5GAHP 3UB5A 4BC5A 4QS8A 4YOVA 1BUPA 1VAZA 2YHYA 1BA1A 2GWKA 4JD2A 3CERA 2Q1NA 3GOIA 3M3ZA 1QZ6A 1U2VA 4BC2A 4A61A 3EL2A 3ATUA 2YCHA 5AZJA 3O9SA 3QBWA 1TUYA 5C12A 4MO5A 1QQNA 3VMFB 4GV6A 4XH1A 3CF5L 1HKGA 1GLEG 1YUWA 2Q0RA 3O9RA 5AQKA 3F9MA 3O1WA 4A5AA 3P38A 5CHIA 5BRHA 1VQPN 2ZGZA 3O8MA 5TKYA 3ZX3A 5C0YA 2E1YA 3FZLA 4XH4A 2BUPA 3BF3A 2QWRA 3LDOA 4HTLA 5BREA 5C2FA 1YHQN 2V51B 3MMVA 1EQYA 3LDNA 2WUSA 4FL9A 3T7ZA 4KBOA 3TSPA 3VF6A 5LJVA 1YJWN 1KD1O 2IVNA 3NVMA 4FO0A 3TTFA 3WXIA 3CD6N 4WQ4A 3EO3A 4BREA 4IFEA 4BY9C 1R59O 1YAGA 3EZWA 2FXUA 3ZEUA 4M63C 3G71N 3L6QA 3H1QA 1ATNA 3AAQA 4FPBA 3CCRN 4FWOA 2E20A 3CC4N 1Q82O 3VPZA 4BR9A 3R1XA 3UKRB 1U6ZA 1LCUA 2F9WA 1YXQA 4A2AA 2NRTA 3CC2N 1DT9A 3C7NA 4CZMA 1GLJO 2NRVA 2JWLA 4ILJA 5E84A 4K25A 3MX5A 5AR0A 3MN7A 4CZGA 2NLXA 2E2QA 2F7TA 4E1JA 3HOSA 4MLEA 3DXKB 3WXLA 3ZX0A 2PFUA 2QWMA 4YOWA 1NGCA 2E2PA 4EFHA 2GX9A 5FPMA 1MA9B 5AQNA 1SQKA 3H46O 5EXWA 1QQMA 4PKIA 1W97L 1DKGD 3H45C 4B1XB 4JKHA 2GUPA 1IG8A 2BH1A 1QQOA 2E88A 2P9SB 1NWKA 1JCFA 4FWLA 1E4FT 5F0XA 2KLAA 4H0VB 1Q7YO 3N4QA 1YITN 3OA9A 3AAPA 5C10A 2HOEA 3CCJN 4H0OA 4ILHA 2NRWA 2P9SA 2ZF5O 3L0QA 2DPNA 4CJ7A 1Z6RA 2P9KB 2WFBA 3IKMA 4JKEA 4KH4A 2HF3A 3ULEA 2PAVA 4CZEA 5GAEP 5JLFA 4YOXA 4UY8O 4BRAA 1YF5L 2NRHA 3SMPA 3GG4A 2IIRA 4JKBA 1VQ7N 4CZKA 1ESVA 1U2VB 1Y64A 3A5LC 4H5WA 4IOCL 1KC8O 1VQ5N 2HBLA 4YOTA 3ULEB 3VEZA 4IOAL 2ASPA 1GLCG 3E1YA 3JS6A 1OKJA 4WYBA 2W40A 3CCLN 3DWLA 3ENBA 4NLCA 4WQ5A 3HOTA 3O5BA 2HBMA 3C7NB 4KH6A 3C65A 2RE2A 4FOIA 1CZAN 1NGJA 4JEPA 4U67L 1VQLN 5CR4A 3CPEA 2VGMA 4JK9A 5AQGA 3VGMA 3R9PA 3R6MA 4BRQA 4JD2B 5BPMA 4H03B 3IDHA 1K73O 4WFAL 4AM6A 1MDUB 2PBDA 3U4LA 1NGAA 4H5NA 4CZHA 4H5RA 3QMLA 3CJAA 5BN8A 1BO5O 1NGGA 5BRDA 5DM6L 3CCQN 4B1ZA 4H0YB 3KK7A 4LC9B 3TSQA 3CJ1A 3WUHA 3AARA 4FWSA 4CBUA 2QWPA 4BG8A 5I9EB 3SBTA 3CJCA 3L4IA 4A5BA 1VQ8N 3U8XA 1T3VA 2ZGYA 4PL7A 3G6EN 4B1WB 1GLDG 4JHDB 3VEVA 3SBGA 3ZX2A 2P9UA 4DB3A 3CCUN 3DXMB 3F5TA 2YJEA 5AFUH 3Q7BA 5AZJB 4ISGA 4JHDA 5M1FA 2V52B 4A57A 3D2FA 4JN4A 3D2EA 3JXUA 4O8UA 4BRNA 1MWKA 3FZKA 3TU5A 3E66A 3TPQA 3I55N 4ILGB 2ZJPL 3CETA 4YDUA 5GADP 2OANA 2ZJQL 5GIPA 3H1VX 2QA4N 3O9UA 4WFBL 3A5MC 4NLBA 1N8RO 1HJOA 2BTFA 2YX6A 3CMEN 3VOVA 4EHUA 4PKHA 1GLBG 4IEEA 1QHAA 3MCAB 4DKWA 4JKDA 5F1XA 2GELA 3FE1A 4K42A 3GBTA 4FWMA 5M1OA 1JCGA 2YHWA 5KPRA 2QTDA 1Z05A 3CJBA 3EN9A 1K8KB 4K43A 3CI5A 3FLCO 4CI6A 4CZJA 3UKUA 3ZETB 4EIAA 1W2BM 4M7XA 1GLLO 2D4WA 4IOXA 1NGDA 3ID8A 5TKWA 3CMAN 3U9DA 1Q81O 2OTJN 3K9JA 3SJHA 2A40A 2ZWHA 3O1BA 4WQ5C 2WBNA 1T44A 1S72N 2QEXN 4IJAA 4CBXA 2HBKA 3B8AX 3RVCA 4A2BA 3K9KA 4A59A 4PHTX 5JVHL 4GV9A 2QM1A 2QWQA 4EAHD 5GIOA 2E2OA 5KPZA 5AQHA 2ZJRL 3SMSA 5EOYA 4BRDA 2A3ZA 3FR0A 1E4GT 3W3DA 1M90O 3PLAA 1V4TA 3BF1A 1X3NA 4YOUA 2AA4A 3H6EA 5AQZA 4B1YB 3EKSA 1KXPA 2E1ZA 3TTCA 3AGRA 4H0TB 4B1UB 3CHWA 5FPNA 3HZ6A 4BC3A 2P9IA 2JWKA 3FZHA 3IUCA 5HOOA 2AP1A 2NRRA 2I7NA 3VETA 2EWSA 3VEWA 3C0BA 4IWVA 4R79A 2Q36A 4RWTA 4FWPA 5AQXA 5AQRA 3MWPA 3RSEB 3VF2A 3D6RA 3MK6A 1SZ2A 3QDKA 3OBYA 4MDBA 4BRHA 4BQZA 1KAZA 2CGJA 1Q18A 5ADXA 5BPNA 3VF4A 1WOQA 1RGIA 1X3MA 5AQUA 4IDHA 1ZBSA 2GEMA 3MWTA 5EY4A 2D1KA 1YJ9N 4GY2B 5M1PA 5AQFA 3M6GA 3F2KA 4BRMA 4BQLA 3TSUA 1TUUA 1NGHA 1RDUA 3EE9A 4GVEA 4BRCA 3MX2A 4I6MA 3CCEN 4EHTA 4CD1A 3W0LA 3HTVA 2YHXA 1RFQA 2QW9A 3HRGA 1QVGM 4KH5A 4XH5A 5BN9A 3VENA 3WQTA 3FZMA 3GE1A 3J7ZO 1T6DA 3D7EO 1XC3A 3Q7CA 4U7BA 1BDGA 3LM9A 3P31A 3HI0A 5AQJA 5LY3A 3I33A 2P9PB 4IO8A 4AM7A 4G9ZA 1HLUA 4JKCA 1OVYA 3VGLA 4DHYA 4OO1J 3U9ZA 5M1NA 5EX5A 4BC4A 1HKCA 2V7ZA 3D2EB 3QB0A 1VQON 4CZIA 4BRGA 3CCSN 3LL3A 5AQMA 3R8EA 3CXCM 3ZETA 4NB4A 4BG9A 3KVGA 3FZFA 1K8KA 2P9PA 4MDAA 1YJNN 4JNEA 3KHYA 1QVFM 3DXMA 3P39A 3HBTA 2P9LB 3WXMB 3R3LA 2GWJA 3UKRA 3LM2A 4BRFA 3OBWA 4WQ4C 1XUPO 3E9PA 2RHKA 3AGKA 3T69A 2HF4A 3ENHA 4M7YA 4Y0WA 4WCEL 1EO1A 1ATRA 3LDLA 3J8AA 3ZEUB 3EE8A 4GNIA 5MLCQ 5JVGL 2J4RA 3SAFA 4YDUC 3C6AA 4PKGA 1NMDA 3SLCA 4C23A 2FSJA 2I7PA 2CGKA 1NGFA 3D2FB 1VQKN 4K41A 1ZC6A 5GAGP 1SS6A 4MO4A 2NRXA 2P9LA 2YI1A 4QS7A 1H1VA 5FPDA 3VESA 4FWQA 3FFKB 5B8HA 4ISEA 4PL8A 2V7YA 5AQVA 2HBJA 3O6WA 1JCEA 1J6ZA 4WF9L 3WQUA 1VQ4N 4BGAA 3UE5A 2QI2A 1NJIO 3QICA 3WXJA 3BP8A 2P9NB 4H0PA 2QXLA 1RDWX 3NMUA 1C0GA 3KWGA 3IFRA 1MWMA 1Q86O 1VQMN 4FPAA 3QFUA 1M1KO 4DQ8A 5AQTA 3O4WA 1BOTO 1HKBA 1NGEA 4FOEA 1BA0A 3CQYA 4JKGA 4L3QA 3H3OB 4BGBA 1KAYA 1NM1A 1K9MO 1VQ9N 3A5NC 4H5TA 1YIJN 4F9OA 2FSNA 3OHRA 2YJFA 4OPHA 2VGNA 3LDQA 1S22A 3AY9A 3ID6A 4FWNA 5AQLA 5AQQA 3MCPA 5KQDA 3DAWA 3M1FA 5M1KA 4YOYA 1NGIA 1T6CA 4FSVA 4O8KA 1KAXA 4IJNA 1GLFO 3CC7N 1S3XA 4IEIA 2P9UB 3BUZB 2Q31A 3M5RA 4BRKA 3SAGA 3CCVN 1SAZA 1HPMA 4BVPA 2P9KA 2UYTA 4JK8A 4BVOA 5JICA 2E8AA 5M1QA 4AF1A 3LDPA 1ZXOA 4O5FA 5AQPA 3I8BA 5FPEA 4JKFA 1K8AO 4FVUA 4A62A 4BR0A 3VTIA 2GTDA 2FF3B 3ENOA 3QFPA 4JAXA 4NO7A 3S41A 4Z94A 3WEEB 3SAHA 3NVKA 4BR7A 4HWIA 5BRFA 4H0XB 2KKZA 2CGLA 1YVNA 3SK3A 4CD3A 3RSEA 5LJWA 3CJ9A 2FLOA 2HSTA 2FF6A 3VEYA 4CBWA 1P8ZA 1DEJA 3KWIA 3DXKA 1BG3A 2IVPA 2WC9A 5AQIA 5BPLA 1YI2N 3E9OA 1P90A 1TYQA 5AZIA 4DCHA 5HL7L 4J8FA 3PIOL 4OPAA 3C6HA 1VQNN 4C1NK 2W41A 3WT0A 5ADXH 3VGKA 3A5OC 5GINA 5DM7L 5ELZA 2QWOA 3CQXA 3P4IA 3O9TA 4BRPA 4C1NI 3VEXA 4WFNL 4BRLA 1JJ2M 1IJJA 1NLVA 2E2NA 2ASMA 4RCHA 2Q0UA 3G25A 2Q97A 2D0PA 2VWBA 3MN5A 5C2DA 1O13A 3PIPL 2NRZA 3BEXA 3O80A 5AQOA 3KZBA 4B1VA 3QBXA 1TYQB 5AZIB 3VTHA 4IO9L 1ILYA 5KQ8A 3HM8A 2Q2RA 2A6AA 4BRIA 5C15A 3CPWM 3O08A 2KHOA 4XEIA 1V4SA 2FSKA 1NGBA 3UKUB 3DJCA 3VEOA 4I6MB 4JKAA 4RTFD 2P9IB 1X9JA 4IXCA 4BR2A 3HSCA 3N4PA 3L4QA 3O9QA 2ASOA 3DLLL 5JLHA 5EVZA 4JKGB 4B9QA 1VQ6N 1LOTB 3E9LA 3A8YA 1DGKN 4BROA 3ZYYX 1BU6O 3G4SN 2NZTA 3MN6A 1D4XA 5KPTA 3WEEA 1ATSA 1KQSM 3ATVA 2H3GX 5AQWA 5CE3A 2P9NA 3H3NO 5JMVA 4BR5A 1NBWA 3GL1A 2F9TA 3FGUA 2NNWA 4IZ9A 3A0IX 4CZFA 1G99A 2CH6A 2QWLA 1QZ5A 2VCPA 4YORA 1WUAA 3EKUA 3MDQA 3TTDA 5BR9A 1BWFO 4QS9A 2VYPA 5AFUA 3GDQA 3CCMN 3MN9A 4ISFA 5AQYA 2A42A 2D0OA 5H1SQ 2A5XA 4JK7A 2A41A 4GV3A 1GLAG 2OTLN 3OW2M 2HMPA 3IMXA 2IVOA 3VERA 4FWKA 4MLHA 4BR4A 5F2RA 1C0FA 3I56N 2CH5A 1HUXA 4CZLA 3WXKA 1HX1A 3CJ7A 5E26A 4H5VA 1XQSC 3CIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWR A;  2QWN A;  5AQS A;  2ITM A;  3UB5 A;  4BC5 A;  4QS8 A;  1BUP A;  2YHY A;  1BA1 A;  2GWK A;  4JD2 A;  3CER A;  2Q1N A;  3GOI A;  3M3Z A;  1QZ6 A;  1U2V A;  4BC2 A;  4A61 A;  3EL2 A;  3ATU A;  2YCH A;  5AZJ A;  3QBW A;  1TUY A;  4MO5 A;  1QQN A;  4XH1 A;  1HKG A;  1GLE G;  1YUW A;  2Q0R A;  5AQK A;  3F9M A;  3O1W A;  5BRH A;  2ZGZ A;  3O8M A;  5TKY A;  3ZX3 A;  2E1Y A;  3FZL A;  4XH4 A;  2BUP A;  3BF3 A;  2QWR A;  3LDO A;  4HTL A;  5BRE A;  2V51 B;  3MMV A;  1EQY A;  3LDN A;  2WUS A;  4FL9 A;  4KBO A;  3VF6 A;  5LJV A;  2IVN A;  4FO0 A;  3WXI A;  4WQ4 A;  3EO3 A;  4BRE A;  1R59 O;  1YAG A;  3EZW A;  2FXU A;  3ZEU A;  4M63 C;  3L6Q A;  3H1Q A;  1ATN A;  3AAQ A;  4FPB A;  4FWO A;  2E20 A;  3VPZ A;  4BR9 A;  3UKR B;  1U6Z A;  1LCU A;  2F9W A;  1YXQ A;  4A2A A;  3C7N A;  4CZM A;  1GLJ O;  5E84 A;  4K25 A;  5AR0 A;  3MN7 A;  4CZG A;  2NLX A;  2E2Q A;  4E1J A;  4MLE A;  3DXK B;  3WXL A;  3ZX0 A;  2QWM A;  1NGC A;  2E2P A;  4EFH A;  5FPM A;  1MA9 B;  5AQN A;  1SQK A;  3H46 O;  5EXW A;  1QQM A;  4PKI A;  1DKG D;  3H45 C;  4B1X B;  2GUP A;  1IG8 A;  1QQO A;  2E88 A;  2P9S B;  1NWK A;  1JCF A;  4FWL A;  1E4F T;  5F0X A;  4H0V B;  3AAP A;  2HOE A;  4H0O A;  2P9S A;  2ZF5 O;  3L0Q A;  2DPN A;  4CJ7 A;  1Z6R A;  2P9K B;  4CZE A;  3ULE A;  5JLF A;  2HF3 A;  2PAV A;  4BRA A;  2NRH A;  3SMP A;  3GG4 A;  2IIR A;  4CZK A;  1ESV A;  1U2V B;  1Y64 A;  3A5L C;  4H5W A;  3VEZ A;  3ULE B;  2ASP A;  1GLC G;  3JS6 A;  1OKJ A;  4WYB A;  2W40 A;  3DWL A;  4WQ5 A;  3O5B A;  3C7N B;  4FOI A;  1CZA N;  1NGJ A;  4BRQ A;  3VGM A;  5AQG A;  3R9P A;  3R6M A;  4JD2 B;  5BPM A;  4H03 B;  3IDH A;  4AM6 A;  1MDU B;  2PBD A;  3U4L A;  1NGA A;  4H5N A;  4CZH A;  4H5R A;  3QML A;  3CJA A;  5BN8 A;  1BO5 O;  1NGG A;  5BRD A;  4B1Z A;  4H0Y B;  4LC9 B;  3CJ1 A;  3WUH A;  3AAR A;  4FWS A;  4CBU A;  2QWP A;  4BG8 A;  5I9E B;  3CJC A;  3L4I A;  3U8X A;  2ZGY A;  4PL7 A;  4B1W B;  1GLD G;  4JHD B;  3VEV A;  3ZX2 A;  2P9U A;  4DB3 A;  3DXM B;  5AFU H;  2YJE A;  5AZJ B;  4ISG A;  4JHD A;  2V52 B;  3D2F A;  4JN4 A;  3D2E A;  3JXU A;  4BRN A;  1MWK A;  3FZK A;  3TU5 A;  3TPQ A;  3CET A;  4YDU A;  2OAN A;  3H1V X;  3A5M C;  1HJO A;  2BTF A;  3VOV A;  4EHU A;  4PKH A;  1GLB G;  1QHA A;  5F1X A;  2GEL A;  3FE1 A;  4K42 A;  3GBT A;  4FWM A;  1JCG A;  2YHW A;  5KPR A;  1Z05 A;  3CJB A;  3EN9 A;  1K8K B;  4K43 A;  3CI5 A;  3FLC O;  4CI6 A;  4CZJ A;  3UKU A;  3ZET B;  4EIA A;  4M7X A;  1GLL O;  2D4W A;  1NGD A;  3ID8 A;  3U9D A;  3SJH A;  2A40 A;  2ZWH A;  3O1B A;  4WQ5 C;  1T44 A;  4IJA A;  4CBX A;  4A2B A;  3B8A X;  2QM1 A;  2QWQ A;  4EAH D;  2E2O A;  5KPZ A;  5AQH A;  3SMS A;  5EOY A;  4BRD A;  2A3Z A;  3FR0 A;  1E4G T;  3W3D A;  1V4T A;  3BF1 A;  1X3N A;  2AA4 A;  3H6E A;  5AQZ A;  4B1Y B;  3EKS A;  1KXP A;  2E1Z A;  4H0T B;  4B1U B;  3CHW A;  5FPN A;  3HZ6 A;  4BC3 A;  2P9I A;  3FZH A;  3IUC A;  2AP1 A;  2I7N A;  3VET A;  2EWS A;  3VEW A;  3C0B A;  4IWV A;  2Q36 A;  4RWT A;  4FWP A;  5AQX A;  5AQR A;  3RSE B;  3VF2 A;  3MK6 A;  1SZ2 A;  3QDK A;  4BRH A;  4BQZ A;  1KAZ A;  2CGJ A;  1Q18 A;  5ADX A;  5BPN A;  3VF4 A;  1WOQ A;  1RGI A;  1X3M A;  5AQU A;  1ZBS A;  2GEM A;  5EY4 A;  2D1K A;  4GY2 B;  5AQF A;  3M6G A;  4BRM A;  4BQL A;  1TUU A;  1NGH A;  4BRC A;  4I6M A;  4EHT A;  4CD1 A;  3W0L A;  3HTV A;  2YHX A;  1RFQ A;  2QW9 A;  4XH5 A;  5BN9 A;  3VEN A;  3WQT A;  3FZM A;  3GE1 A;  1T6D A;  3D7E O;  1XC3 A;  1BDG A;  3LM9 A;  3HI0 A;  5AQJ A;  5LY3 A;  3I33 A;  2P9P B;  4IO8 A;  4AM7 A;  1HLU A;  3VGL A;  4DHY A;  3U9Z A;  5EX5 A;  4BC4 A;  1HKC A;  2V7Z A;  3D2E B;  3QB0 A;  4CZI A;  4BRG A;  3LL3 A;  5AQM A;  3R8E A;  3ZET A;  4NB4 A;  4BG9 A;  3KVG A;  3FZF A;  1K8K A;  2P9P A;  4JNE A;  3KHY A;  3DXM A;  3HBT A;  2P9L B;  2GWJ A;  3UKR A;  3LM2 A;  4BRF A;  4WQ4 C;  1XUP O;  2HF4 A;  3ENH A;  4M7Y A;  4Y0W A;  1ATR A;  3LDL A;  3J8A A;  3ZEU B;  4GNI A;  2J4R A;  4YDU C;  4PKG A;  1NMD A;  3SLC A;  4C23 A;  2FSJ A;  2I7P A;  2CGK A;  1NGF A;  3D2F B;  4K41 A;  1ZC6 A;  4MO4 A;  2P9L A;  2YI1 A;  4QS7 A;  1H1V A;  5FPD A;  3VES A;  4FWQ A;  3FFK B;  5B8H A;  4ISE A;  4PL8 A;  2V7Y A;  5AQV A;  3O6W A;  1JCE A;  1J6Z A;  3WQU A;  4BGA A;  3UE5 A;  3QIC A;  3WXJ A;  3BP8 A;  2P9N B;  4H0P A;  2QXL A;  1RDW X;  1C0G A;  3IFR A;  1MWM A;  4FPA A;  3QFU A;  4DQ8 A;  5AQT A;  3O4W A;  1BOT O;  1HKB A;  1NGE A;  4FOE A;  1BA0 A;  3CQY A;  4L3Q A;  4BGB A;  3H3O B;  1KAY A;  1NM1 A;  3A5N C;  4H5T A;  4F9O A;  2FSN A;  3OHR A;  2YJF A;  3LDQ A;  1S22 A;  3AY9 A;  4FWN A;  5AQL A;  5AQQ A;  3MCP A;  5KQD A;  3DAW A;  3M1F A;  1NGI A;  1T6C A;  4FSV A;  4O8K A;  1KAX A;  4IJN A;  1GLF O;  1S3X A;  2P9U B;  3BUZ B;  2Q31 A;  4BRK A;  1SAZ A;  1HPM A;  4BVP A;  2P9K A;  2UYT A;  4BVO A;  5JIC A;  2E8A A;  3LDP A;  1ZXO A;  4O5F A;  5AQP A;  3I8B A;  5FPE A;  4A62 A;  4BR0 A;  2GTD A;  2FF3 B;  3ENO A;  3QFP A;  4JAX A;  4NO7 A;  3S41 A;  4Z94 A;  3WEE B;  4BR7 A;  4HWI A;  5BRF A;  4H0X B;  2CGL A;  1YVN A;  3SK3 A;  4CD3 A;  3RSE A;  5LJW A;  3CJ9 A;  2FLO A;  2FF6 A;  3VEY A;  4CBW A;  1P8Z A;  1DEJ A;  3DXK A;  1BG3 A;  2IVP A;  5AQI A;  5BPL A;  1TYQ A;  5AZI A;  4DCH A;  4J8F A;  2W41 A;  3WT0 A;  5ADX H;  3VGK A;  3A5O C;  5ELZ A;  2QWO A;  3CQX A;  3P4I A;  4BRP A;  3VEX A;  4BRL A;  1IJJ A;  1NLV A;  2E2N A;  2ASM A;  4RCH A;  2Q0U A;  3G25 A;  2Q97 A;  2D0P A;  2VWB A;  3MN5 A;  3BEX A;  5AQO A;  3O80 A;  3KZB A;  4B1V A;  3QBX A;  1TYQ B;  5AZI B;  5KQ8 A;  3HM8 A;  2Q2R A;  2A6A A;  4BRI A;  3O08 A;  2KHO A;  4XEI A;  1V4S A;  2FSK A;  1NGB A;  3UKU B;  3DJC A;  3VEO A;  4I6M B;  4RTF D;  2P9I B;  1X9J A;  4IXC A;  4BR2 A;  3HSC A;  2ASO A;  5JLH A;  5EVZ A;  4B9Q A;  1LOT B;  3A8Y A;  1DGK N;  4BRO A;  1BU6 O;  2NZT A;  3MN6 A;  1D4X A;  5KPT A;  3WEE A;  1ATS A;  3ATV A;  2H3G X;  5AQW A;  5CE3 A;  2P9N A;  3H3N O;  5JMV A;  4BR5 A;  1NBW A;  3GL1 A;  2F9T A;  3FGU A;  4IZ9 A;  3A0I X;  4CZF A;  1G99 A;  2CH6 A;  2QWL A;  1QZ5 A;  2VCP A;  3EKU A;  1WUA A;  3MDQ A;  5BR9 A;  1BWF O;  4QS9 A;  2VYP A;  5AFU A;  3GDQ A;  3MN9 A;  4ISF A;  5AQY A;  2A42 A;  2D0O A;  2A5X A;  2A41 A;  1GLA G;  2HMP A;  3IMX A;  2IVO A;  3VER A;  4FWK A;  4MLH A;  4BR4 A;  5F2R A;  1C0F A;  2CH5 A;  1HUX A;  4CZL A;  3WXK A;  1HX1 A;  3CJ7 A;  5E26 A;  4H5V A;  1XQS C;  3CIP A; 
#chains in the Genus database with same CATH topology
 2JLE A;  1WBD A;  1YTU A;  3UB5 A;  4YOV A;  1BUP A;  1VAZ A;  1WAJ A;  2O8E B;  1ASW A;  2Q1N A;  1ZBL A;  3M3Z A;  1U2V A;  4BC2 A;  4DLE A;  1VSE A;  4A61 A;  2YCH A;  3O9S A;  4DFJ A;  4AIL C;  1JLG A;  1QQN A;  3VMF B;  4Z4H A;  4FJG A;  1HRH A;  1HKG A;  4JLH A;  3O9R A;  3J81 O;  4CHZ A;  4CJ3 A;  5CHI A;  5BRH A;  2YHB A;  3F73 A;  3O8M A;  3L2U A;  3LDO A;  4HHT A;  2V51 B;  4MFB A;  3HVT A;  4KBO A;  3TSP A;  1YJW N;  1S1X A;  2HW3 A;  3CFP A;  4BRE A;  3P83 D;  1HYS A;  1YAG A;  3EZW A;  2FXU A;  3LP3 A;  2FC0 A;  3OYN A;  3V9S A;  2VG6 A;  1ATN A;  5KI6 A;  3VPZ A;  4BR9 A;  4H4O A;  1S9G A;  2GBZ A;  3AVF A;  4W5R A;  4K25 A;  3MX5 A;  3MN7 A;  3K5O A;  3HOS A;  3ZX0 A;  1NGC A;  2E2P A;  5EXW A;  4PKI A;  1XHX A;  2XO7 A;  1Y97 A;  1UA1 A;  4JKH A;  1QQO A;  2P9S B;  3RMB A;  1Q7Y O;  5KTQ A;  3N4Q A;  4LSL A;  4M45 A;  3K2P A;  2NRW A;  2P9S A;  3L0Q A;  1WSE A;  4KH4 A;  3ULE A;  5JLF A;  3PO4 A;  3KD5 E;  3NDK A;  1LV5 A;  4FM1 A;  2JGU A;  4BRA A;  1IG9 A;  3OS1 A;  1YF5 L;  3SMP A;  1VQ7 N;  1NK5 A;  1Z25 A;  1RT3 A;  1Y64 A;  4IOC L;  2HBL A;  3ULE B;  4IOA L;  2ASP A;  3BY5 A;  3I0S A;  1RTH A;  4WYB A;  1HYZ A;  1WSI A;  3DWL A;  4NLC A;  1WNS A;  4HUG A;  3SV3 A;  1IBL K;  3C7N B;  4JEP A;  1CZA N;  3V4I A;  1FKP A;  2PZS A;  3SZ2 A;  2VGM A;  3VGM A;  4BRQ A;  3R6M A;  4FW2 A;  3P5J A;  2B4J A;  4FLZ A;  4H5N A;  2W42 A;  5BN8 A;  1NGG A;  3CCQ N;  4B1Z A;  4DSI A;  4CE9 A;  4LC9 B;  3TSQ A;  3WUH A;  4I9Q A;  5I9E B;  1C1A A;  4A5B A;  4KRE A;  4B1W B;  1HNX K;  3VEV A;  3SBG A;  3ZX2 A;  2P9U A;  2YJE A;  3LWL A;  3HL8 A;  4W5T A;  1QHT A;  2IDO A;  4ISG A;  5D3G A;  4A57 A;  3M8R A;  1EP4 A;  3D2E A;  1BIS A;  5J1E A;  1MWK A;  3HVR A;  3TPQ A;  3I55 N;  4YDU A;  2QA4 N;  3H1V X;  3O9U A;  1RNH A;  1LAW A;  1GLB G;  1NJY A;  5KGX A;  5CZ1 A;  4L8R B;  1QHA A;  1UAX A;  5F1X A;  3K0S A;  3FE1 A;  3F9K A;  4K42 A;  2HHX A;  4FWM A;  2O8D B;  1VSK A;  3EN9 A;  1A5X A;  4FJM A;  2D4W A;  4JI3 K;  3ID8 A;  3NBP A;  3CMA N;  1Q81 O;  4CGD A;  2UXB K;  3HPG A;  3QER A;  2WBN A;  3IRX A;  3RVC A;  3PX0 A;  4A59 A;  1IBK K;  2QM1 A;  4KI4 A;  4GKJ K;  1K6Y A;  3LZI A;  2ZJR L;  4FZX C;  1E4G T;  3W3D A;  4DQP A;  1V4T A;  4NYN A;  2AA4 A;  1KFD A;  3H6E A;  5AQZ A;  2AJQ A;  3IG1 A;  1VHX A;  3AGR A;  4DU3 A;  1VSM A;  1L3U A;  4H0T B;  4M3R A;  4F3O A;  4BC3 A;  2P9I A;  1EWQ A;  3IUC A;  4GV3 A;  2NRR A;  1VSD A;  5JS2 A;  3VEW A;  4IWV A;  4E0D A;  2F4V K;  4YY3 K;  3CM6 A;  3VF2 A;  3RSE B;  1S6P A;  4BDP A;  1J9A A;  1SZ2 A;  4MDB A;  3S3N A;  2QK9 A;  1NK4 A;  3OYA A;  3SV4 A;  5BPN A;  3VF4 A;  1WOQ A;  1B9D A;  4IDH A;  2GEM A;  2D1K A;  1YJ9 N;  3KK3 A;  3V1R A;  2Z1J A;  1U45 A;  4BQL A;  3MEG A;  1BI4 A;  4CJV A;  3NGY A;  4BRC A;  4I6M A;  4CHY A;  4GKK K;  4FLV A;  1J53 A;  4CD1 A;  2YHX A;  5BN9 A;  1ASU A;  5EU7 A;  3SPZ A;  3TAP A;  1FK9 A;  1S1W A;  3GE1 A;  3Q7C A;  1TKX A;  3SI6 A;  4CJ5 A;  2P9P B;  2BGG A;  1HLU A;  3U9Z A;  2KQ2 A;  5EX5 A;  3OYC A;  1HKC A;  1U47 A;  2O8F A;  2V7Z A;  4CZI A;  4BRG A;  4CJF A;  2D0B A;  3U3G A;  2G8I A;  2ATQ A;  2P9P A;  2YV0 X;  4AH9 A;  4CHN A;  4OLA A;  4BE1 A;  1XUP O;  3VQD A;  4FM0 A;  4N5S A;  3AGK A;  3ENH A;  1WSG A;  3KLG A;  4KFB A;  1T7P A;  1ZBI A;  2B5J A;  1NMD A;  3SLC A;  1RTI A;  2CGK A;  4QOZ B;  1NGF A;  5CY4 A;  1ZC6 A;  3JAM O;  4FWQ A;  1T05 A;  1J5O A;  4KHP K;  4DTP A;  2V7Y A;  2RN2 A;  4E7J A;  2XHB A;  3THY A;  1J6Z A;  4WF9 L;  3L3U A;  3G10 A;  3VQ9 A;  3WXJ A;  3BP8 A;  1CXQ A;  3D0P A;  1RBS A;  4I2Q A;  1C0U A;  1VSH A;  3T1H K;  5C24 A;  1NGE A;  3CQY A;  1J54 A;  3V9Z A;  3H3O B;  1C1C A;  3PUF A;  3V6D A;  4LF7 K;  5AQL A;  5CYQ A;  1RDB A;  3KLF A;  4EZ9 A;  5M1K A;  4YOY A;  1XNQ K;  2Y1I A;  2DY4 A;  3M5R A;  4BRK A;  3DMJ A;  2G8K A;  1SAZ A;  3JYT A;  2PYJ A;  5FPE A;  4FK0 A;  4N41 A;  4FVU A;  4IG0 A;  5JS1 A;  4DR3 K;  2FF3 B;  1IO2 A;  4Z94 A;  3S41 A;  4KAZ A;  4HWI A;  2KKZ A;  2CGL A;  2ZQB A;  3SK3 A;  3ZSV A;  3NH2 A;  3RSE A;  2FLO A;  2HST A;  4FJN A;  3VN5 A;  4DFP A;  3BDP A;  4CEO A;  4CBW A;  1P8Z A;  4J2D A;  2X6S A;  1BG3 A;  2WC9 A;  5AQI A;  2Z1G A;  3E9O A;  1P90 A;  1TYQ A;  5AZI A;  5HL7 L;  3DLK A;  4J2B A;  3C6H A;  1VQN N;  2W41 A;  5ADX H;  3VGK A;  1U4B A;  5DM7 L;  2QWO A;  4CGF A;  3LWM A;  3O9T A;  4BRP A;  4C1N I;  4Z4C A;  4WFN L;  4RCH A;  3ZSX A;  1C1B A;  3MN5 A;  1S1T A;  2NRZ A;  3KZB A;  3NH1 A;  3AVB A;  5FRM A;  1XMO K;  1ILY A;  4DFK A;  2A6A A;  4W5Q A;  4UQG A;  3ZT4 A;  3OYF A;  2KHO A;  4XEI A;  1V4S A;  4DTN A;  3DJC A;  3MEC A;  2XY8 A;  2YHA A;  3VA3 A;  1QQC A;  2P9I B;  3TR8 A;  3O9Q A;  1VQ6 N;  1IV0 A;  1KVC A;  1KVA A;  4JKG B;  5EVZ A;  4B9Q A;  3OYG A;  1KLN A;  1R0A A;  4I7F A;  4H4M A;  4HUF A;  3NHG A;  3GL1 A;  5J2M A;  3FGU A;  3DLB A;  4IZ9 A;  3LP2 A;  1QZ5 A;  3TTD A;  2E5L K;  2QKB A;  1MU2 A;  4IDK A;  4ISF A;  1S1V A;  3LAK A;  2A5X A;  3AO1 A;  4JK7 A;  4CF0 A;  2OPS A;  3T3F A;  3MXM A;  4B9M A;  4DR7 K;  4MLH A;  2CH5 A;  4CZL A;  4WE1 A;  4DU1 A;  4F3T A;  3CIP A;  1N34 K;  4J2A A;  1D8Y A;  5AQS A;  4BC5 A;  3TWH A;  1OH7 A;  2YHY A;  3MEE A;  1QSL A;  4B9T A;  2KFN A;  4JD2 A;  1NMN A;  1RT2 A;  1QZ6 A;  3ATU A;  1TUY A;  2XRI A;  4MO5 A;  1JLE A;  1HNZ K;  1YUW A;  1S9E A;  2Q0R A;  1X1P A;  3F9M A;  5C0Y A;  3FZL A;  4XH4 A;  2BUP A;  3BF3 A;  1YHQ N;  1KRP A;  4DQQ A;  3MMV A;  1T03 A;  4IG3 A;  2WUS A;  1GOC A;  3KLE A;  4CF8 A;  1KD1 O;  3AO4 A;  3TTF A;  5FRO A;  3WXI A;  4WQ4 A;  3EO3 A;  4BY9 C;  1R59 O;  3NF7 A;  1VSL A;  3G71 N;  3AAQ A;  2E20 A;  3CC4 N;  1Q82 O;  3U3Y A;  3EZ5 A;  1LWE A;  4NYF A;  3J80 O;  1HYV A;  3VQ8 A;  1U6Z A;  3LP1 A;  4A2A A;  2NRT A;  3CC2 N;  4CZM A;  2ZD1 A;  4ID5 A;  1BCO A;  4NCB A;  1TL3 A;  4DWI A;  3NF6 A;  3TAF A;  2O4I A;  1JL1 A;  4E1J A;  4MLE A;  3WNG A;  3V9W A;  1ZBH A;  3SQ1 A;  5AQN A;  2FBY A;  1SQK A;  1QQM A;  1RTJ A;  3QIO A;  4DSJ A;  4CK1 A;  2GUP A;  1IG8 A;  1XHZ A;  2BH1 A;  4FXD A;  1JCF A;  4FWL A;  5F0X A;  4H0V B;  1YIT N;  3OA9 A;  3AAP A;  2VWK A;  4R5P A;  3CCJ N;  1REV A;  3SYZ A;  2KZZ A;  4JYA K;  4OJR A;  4JKE A;  3IKM A;  4CZE A;  5GAE P;  2HF3 A;  2IS3 A;  1XNR K;  1KLM A;  3K59 A;  4DU4 A;  4KI6 A;  4Z4G A;  3ZSQ A;  2NRH A;  5T7B A;  3SQ0 A;  2IIR A;  4E7L A;  4JKB A;  1KC8 O;  3A5L C;  4H5W A;  3VEZ A;  3HJF A;  1GLC G;  2B6A A;  2UUC K;  1ZBF A;  3D45 A;  1OKJ A;  1TKZ A;  3AV9 A;  4BWM A;  3CCL N;  3ENB A;  4AHU A;  1JKH A;  1ZYQ A;  4KH6 A;  4FOI A;  1VQL N;  3AVM A;  4FLW A;  5LL6 Z;  1SV5 A;  3CPE A;  4JK9 A;  5AQG A;  2OZM A;  1HNV A;  3TAG A;  4JD2 B;  1XMQ K;  4WFA L;  3AO5 A;  2W6K A;  4KHQ A;  4CZH A;  4DTR A;  4H5R A;  3CJA A;  5BRD A;  2PYL A;  3S3O A;  4FM2 A;  4CFD A;  2QWP A;  4BG8 A;  4BDY A;  3CJC A;  5A2Q O;  1BCM A;  1T3V A;  1RT7 A;  1GLD G;  4JHD B;  3OJU A;  4NCA A;  4DB3 A;  3CCU N;  3OYL A;  1SL1 A;  5M1F A;  4HUE A;  2V52 B;  1N32 K;  3THX B;  4DV5 K;  4BRN A;  2D0C A;  1RIL A;  3NF9 A;  1RTD A;  3AVL A;  3E66 A;  3V9U A;  2ZJP L;  3CET A;  5GIP A;  4WFB L;  3HXM A;  3A5M C;  1N8R O;  2YX6 A;  2G8H A;  3CME N;  3VOV A;  4IEE A;  4JKD A;  2XY6 A;  3SUP A;  4JS5 A;  1VSJ A;  4CF9 A;  1JCG A;  1Z05 A;  4CJ4 A;  4CI6 A;  4K43 A;  3CI5 A;  4CZJ A;  3UKU A;  3A2F A;  1GLL O;  4M7X A;  3UIQ A;  3H08 A;  3K9J A;  2A40 A;  4DV1 K;  3OJS A;  1S72 N;  3ZLJ A;  4IJA A;  4QCL A;  1TV6 A;  4A2B A;  3B8A X;  3K9K A;  5JVH L;  2O8C B;  4M3T A;  4GV9 A;  4F4K A;  2QWQ A;  2FBX A;  4CHO A;  1NG9 A;  3T1A A;  4HCB A;  5AQH A;  3QEP A;  1WSH A;  2F96 A;  3BF1 A;  3NH0 A;  4YOU A;  4YFU A;  4B1Y B;  2DTU A;  1W9H A;  1KXP A;  1RDA A;  2FBV A;  3HP6 A;  2E1Z A;  3TTC A;  2GV9 A;  3VQ6 A;  4B1U B;  3MXI A;  3MAQ A;  4LFC K;  4R79 A;  4RWT A;  4FWP A;  5AQX A;  3MWP A;  3MK6 A;  3CFR A;  3QEW A;  1U04 A;  1KAZ A;  2CGJ A;  4CEZ A;  1OH5 A;  4ELT A;  4PY5 A;  1RGI A;  1X3M A;  5KRT A;  1ZBS A;  3MWT A;  3ZSZ A;  3E01 A;  3AVJ A;  4GY2 B;  3F2K A;  3AO2 A;  4BRM A;  1L5U A;  3EE9 A;  4DUZ K;  2Q3S A;  4M3W A;  1IKY A;  3MX2 A;  4FVM A;  2UUA K;  1CXU A;  3HTV A;  1RFQ A;  2QW9 A;  4TSX A;  4KH5 A;  4RW4 A;  3J7Z O;  1T6D A;  1XC3 A;  1TVR A;  5HRR A;  5FLX O;  5AQJ A;  1HMV A;  3I33 A;  4CED A;  1WB9 A;  4AM7 A;  1NKC A;  1OVY A;  3VGL A;  4DHY A;  4CGJ A;  1IKW A;  5M1N A;  3D2E B;  4KHS A;  2HB5 A;  3KLH A;  3LL3 A;  3ZET A;  4NB4 A;  3KVG A;  3FZF A;  1K8K A;  4RW7 A;  3RMC A;  3ZSY A;  1UA0 A;  3DXM A;  2P9L B;  3R3L A;  3UKR A;  3O4N A;  3LM2 A;  4JI6 K;  3L8B A;  4WQ4 C;  2RHK A;  3T69 A;  2HF4 A;  4Y0W A;  4DSL A;  1LW2 A;  1ATR A;  4FJK A;  1TK0 A;  3O3F A;  4F8R A;  4GNI A;  5MLC Q;  5JVG L;  1DTT A;  2J4R A;  3SAF A;  1RT4 A;  3C6A A;  3O3H A;  4PKG A;  5KGW A;  4C23 A;  2FSJ A;  4LF6 K;  2ETJ A;  1C0T A;  1JLF A;  3QLH A;  1A5V A;  1SS6 A;  4MO4 A;  1NK7 A;  3VES A;  3FFK B;  5B8H A;  4ISE A;  1NU0 A;  4PL8 A;  3ZT2 A;  4FJH A;  1HNW K;  4LD0 A;  4B9N A;  4ZTF A;  2HHQ A;  2OPP A;  4BGA A;  1NJI O;  4JS4 A;  2P9N B;  2YNF A;  3B6O A;  3IFR A;  1Q86 O;  3RR8 A;  4YNQ A;  1NK6 A;  4DQ8 A;  5AQT A;  1HR0 K;  3O4W A;  1BOT O;  3CM5 A;  2YNI A;  4DV7 K;  4L3Q A;  1NM1 A;  3VQB A;  1VQ9 N;  4KB1 A;  1YIJ N;  4F9O A;  4K8X A;  4CJE A;  1B9F A;  4B8C A;  2VGN A;  5AQQ A;  1S22 A;  1RCH A;  4G1Q A;  3DLH A;  1ZBU A;  4BE0 A;  3QEI A;  3PO5 A;  4DV0 K;  3DAW A;  1X9S A;  1NGI A;  3DM2 A;  3CC7 N;  1S3X A;  4CK2 A;  4IEI A;  2P9U B;  1I94 K;  4LFA K;  1HPM A;  2P9K A;  2UYT A;  4JK8 A;  5JIC A;  2WON A;  4OPJ A;  1NNE A;  4J2E A;  3EEQ A;  1ZXO A;  4W5N A;  4FZY A;  2O8C A;  1EWR A;  1TK8 A;  2GTD A;  4JAX A;  4NO7 A;  2HHT A;  2O8B B;  1RDD A;  3AA2 A;  4CHQ A;  4BWJ A;  4CD3 A;  1JXB A;  4QAG A;  4LSN A;  2FF6 A;  4IKF A;  4FJI A;  3VEY A;  1DEJ A;  2YKN A;  1RBU A;  2IVP A;  2E4L A;  4DCH A;  4YHH K;  3PIO L;  4OPA A;  4ELU A;  1LWC A;  4C1N K;  3WT0 A;  5GIN A;  5ELZ A;  4AHS A;  3TAR A;  4BRL A;  3AA5 X;  1JJ2 M;  4OPK A;  2OYQ A;  3OS0 A;  1RT1 A;  2HHU A;  5C2D A;  1O13 A;  3PIP L;  2IOC A;  3O80 A;  5AQO A;  1W0H A;  1TGO A;  4B1V A;  3SCX A;  1VK0 A;  1TYQ B;  5AZI B;  1KFS A;  5KQ8 A;  1D9F A;  3SUQ A;  3QNO A;  1NGB A;  3VEO A;  1DLO A;  4I6M B;  4JKA A;  4RTF D;  4IXC A;  4BR2 A;  2G8V A;  3HSC A;  1BQM A;  3L4Q A;  3M8P A;  5JLH A;  1LOT B;  3OVN A;  3A8Y A;  4E1M A;  4E19 A;  3ZYY X;  3C94 A;  3MN6 A;  1D4X A;  4CEA A;  3QET A;  1ATS A;  3ATV A;  2H3G X;  5AQW A;  2P9N A;  1FKO A;  2VQF K;  1TL1 A;  4BR5 A;  3KJV A;  4DR5 K;  4B9V A;  1N36 K;  4DV4 K;  3PV8 A;  1Q8I A;  3KIO A;  4KB0 A;  3ZT1 A;  1TKT A;  2VCP A;  3MDQ A;  5AFU A;  3GDQ A;  4DS4 A;  4AQY K;  2A42 A;  2D0O A;  4LF4 K;  5H1S Q;  4KTW A;  2OTL N;  1EX4 A;  2IVO A;  2IAJ A;  3HPH A;  5F2R A;  3NE6 A;  3I56 N;  2VQE K;  1X9M A;  1HUX A;  3HT3 A;  3WXK A;  3CQ8 A;  1HX1 A;  5E26 A;  4H5V A;  3ZSR A;  4FWR A;  2QWN A;  3KD1 E;  2ITM A;  5GAH P;  3C6T A;  5K14 A;  1BA1 A;  1NOZ A;  1KSP A;  4DV3 K;  1L3S A;  3KKS A;  5C12 A;  5HBM A;  3S3M A;  1OH6 A;  3CF5 L;  4JI1 K;  1GLE G;  5HRO A;  5AQK A;  4W5O A;  3V9X A;  4A5A A;  4DR6 K;  2I5J A;  4AHR A;  3ZX3 A;  1E3M A;  5BRE A;  5C2F A;  3LDN A;  4Z0U A;  2O8E A;  3T7Z A;  4HCC A;  5LJV A;  4FYD A;  4FK2 A;  4K0K K;  2IVN A;  3NVM A;  3SUN A;  5CZ2 A;  3CD6 N;  1UOC A;  3ZEU A;  3L6Q A;  1ASV A;  3CCR N;  4FWO A;  4OKJ A;  3UKR B;  1LCU A;  5LMN K;  4KHU A;  1NJZ A;  4Q5V A;  3DLG A;  1DT9 A;  4Q0B A;  1GLJ O;  2NRV A;  1NK8 A;  1N33 K;  5AR0 A;  2FBT A;  2E2Q A;  4OGC A;  1Q9Y A;  4EFH A;  2HHV A;  5FDL A;  4CEB A;  1X9W A;  3H46 O;  1RBT A;  4DSE A;  3H45 C;  3AA3 A;  2E88 A;  4DTO A;  4FJ8 A;  3T19 A;  1NWK A;  4CEE A;  3RTV A;  4FCY A;  2KTQ A;  4O0J A;  4E7H A;  4H0O A;  3RRH A;  1SKW A;  4KTZ A;  2DPN A;  1Z6R A;  2P9K B;  2WFB A;  4UY8 O;  4NXM K;  3WNE A;  3VA0 A;  2P1J A;  4B3O A;  3GG4 A;  2F8S A;  3AA4 A;  4CZK A;  1U2V B;  4YOT A;  1OVQ A;  2PY5 A;  3E1Y A;  4DG1 A;  3CYM A;  4CEQ A;  3JS6 A;  3L3V A;  2RF2 A;  3HOT A;  4KHY A;  2HVI A;  3C65 A;  2RE2 A;  4KKO A;  4DR1 K;  2OZS A;  5CR4 A;  4I2P A;  1NK9 A;  4H03 B;  4AM6 A;  1MDU B;  2PBD A;  3U4L A;  1NGA A;  1TAQ A;  1S5J A;  1BO5 O;  5DM6 L;  3PY8 A;  4FWS A;  4CBU A;  4AHC A;  3QNN A;  4LF9 K;  3L4I A;  4HTU A;  2HNY A;  1I39 A;  2BAN A;  3U8X A;  4PL7 A;  2YNH A;  5J2Q A;  3DXM B;  5AFU H;  3Q7B A;  5IT9 O;  3WNF A;  4JN4 A;  1LAV A;  3JXU A;  4O8U A;  3FZK A;  3TU5 A;  4CFB A;  4M41 A;  4EP4 A;  1HJO A;  1BQN A;  3SPY A;  4I9L A;  4PQU A;  3MCA B;  4DKW A;  1EKE A;  2IC3 A;  1L3T A;  5HRS A;  2YHW A;  5KPR A;  2QTD A;  3CJB A;  1K8K B;  2O4G A;  4EIA A;  4IOX A;  3KLI A;  5TKW A;  5HP1 A;  1RT6 A;  3ZSO A;  2UU9 K;  3SJH A;  3MXJ A;  4B9L A;  2ZWH A;  4CVN E;  4Z4I A;  4WQ5 C;  1TK5 A;  5DK5 A;  4F2S A;  2HBK A;  3HPO A;  4FLU A;  1GOA A;  1BGX T;  3J7A P;  4EAH D;  3NFA A;  2E2O A;  1I3A A;  1KTQ A;  3SMS A;  3FR0 A;  3PLA A;  1X3N A;  1RBR A;  4FJ9 A;  3EKS A;  2BDP A;  3C6U A;  4B3M K;  3VQC A;  3CHW A;  1CLQ A;  1C0M A;  3KTQ A;  1IKX A;  4N56 A;  3FZH A;  3O3G A;  2AP1 A;  2EWS A;  3DLR A;  1F21 A;  3C0B A;  4CJW A;  3FFI A;  2EHG A;  3MED A;  1N6Q A;  3DRS A;  3QDK A;  4BRH A;  4BQZ A;  4IFV A;  3QES A;  4ID1 A;  4B9S A;  5ADX A;  3QIN A;  5AQU A;  5EY4 A;  1QTM A;  4GMJ B;  5E41 A;  3RMD A;  5M1P A;  4GVE A;  3M8S A;  1JLB A;  1KVB A;  3CCE N;  4CJS A;  1YT3 A;  4O4G A;  1QVG M;  3HRG A;  1HNI A;  3VEN A;  4FLX A;  3FZM A;  1QE1 A;  4U7B A;  1BDG A;  3LM9 A;  3P31 A;  4FK4 A;  5KRS A;  5LY3 A;  2ITG A;  2Y1J A;  1QSS A;  3DYA A;  4G9Z A;  2WTU A;  1EET A;  1VQO N;  5AQM A;  3R8E A;  2IGI A;  4BG9 A;  4JNE A;  5AJ3 K;  3HBT A;  4PA1 A;  4DF8 A;  2A1R A;  3OBW A;  4M7Y A;  1EO1 A;  4WCE L;  4DS5 A;  3J8A A;  3EE8 A;  2KFZ A;  2HND A;  3O4Q A;  1J5E K;  1NKB A;  2I7P A;  3NGZ A;  4OLB A;  4X65 K;  3NGI A;  3NCI A;  1VQK N;  4K41 A;  5GAG P;  2NRX A;  2P9L A;  4CEC A;  4QS7 A;  3HM9 A;  1H1V A;  5FPD A;  1IBM K;  4CER A;  5AQV A;  3OYB A;  1U49 A;  2HBJ A;  1JL2 A;  4ZTJ A;  1JCE A;  3WQU A;  4K8Z A;  4DR2 K;  3RMA A;  1VQ4 N;  3UE5 A;  3AO3 A;  4CFA A;  4H0P A;  2QXL A;  1C0G A;  1BHL A;  3KWG A;  1WAF A;  1MWM A;  4FPA A;  1B92 A;  1M1K O;  4E89 A;  4CES A;  1HQE A;  3LPT A;  1LW0 A;  5SWM A;  1BA0 A;  4JKG A;  4X66 K;  4BGB A;  1K9M O;  1KAY A;  3LAN A;  3A5N C;  3THW A;  2VG5 A;  2KZM A;  4FJ5 A;  4N47 A;  1VRT A;  3OYM A;  3AVH A;  3OHR A;  2YJF A;  4OPH A;  4M3Y A;  3AY9 A;  3ID6 A;  3JSM A;  1T6C A;  4O8K A;  4IJN A;  1D5A A;  4DV6 K;  3BUZ B;  3VQA A;  3SAG A;  4H8K A;  3CCV N;  4BVO A;  1SUQ A;  2E8A A;  2DFH A;  4DV2 K;  3SNN A;  3S9H A;  5AQP A;  1NOY A;  3I8B A;  5CYM A;  1CZB A;  1K8A O;  1U48 A;  4A62 A;  4BR0 A;  1WSF A;  2NUB A;  3DI6 A;  3QO9 A;  4B08 A;  3NVK A;  1NKE A;  3VQ5 A;  4BR7 A;  4H0X B;  1YVN A;  5SZT A;  3ZSW A;  5LJW A;  1YTA A;  1L3V A;  1SKS A;  4GVM A;  2OCE A;  3THW B;  4FJJ A;  2XY5 A;  3ASM A;  3DXK A;  3VQQ A;  5BR8 K;  5BPL A;  4RW6 A;  1NJW A;  3CFO A;  4NCG A;  1FJG K;  4KHN A;  4DLG A;  1QSY A;  3CG7 A;  5HLF A;  2DFF A;  3OS2 A;  3CQX A;  3P4I A;  3VEX A;  3THV A;  2E2N A;  2Q0U A;  3G25 A;  2Q97 A;  2VWB A;  3DRR A;  4AHT A;  4BE2 A;  3QBX A;  3ALY A;  2Q2R A;  4BRI A;  5C15 A;  4E7K A;  3UKU B;  2QXF A;  1VSF A;  1X9J A;  3RR7 A;  3N4P A;  2ASO A;  3DLL L;  4DTJ A;  1HJR A;  2X74 A;  2NZT A;  1N5Y A;  3LDS A;  3WEE A;  1YVU A;  4MQ3 A;  1KQS M;  1NBW A;  2XY7 A;  2F9T A;  3P1G A;  4JI4 K;  2QWL A;  4DUY K;  4OX9 K;  4GW6 A;  4KHW A;  2ZE2 A;  3TI0 A;  3EKU A;  5BR9 A;  4FZZ A;  4QS9 A;  2VYP A;  3CCM N;  2E6L A;  4FLY A;  4CJL A;  4RW8 A;  4DFM A;  3L2V A;  2O8D A;  2A41 A;  3ISN C;  3VER A;  4FWK A;  4X64 K;  2VG7 A;  1IKV A;  1XQS C;  1BL3 A;  4QS8 A;  4CW7 B;  2GWK A;  4KV8 A;  3CER A;  3GOI A;  3EL2 A;  5AZJ A;  3QBW A;  1XC9 A;  4GV6 A;  4XH1 A;  1HQU A;  3O1W A;  3P38 A;  4Y1C A;  4JI0 K;  1VQP N;  2ZGZ A;  5TKY A;  2UXD K;  2E1Y A;  3AVC A;  4HTL A;  2QWR A;  5FRN A;  2GUI A;  1EQY A;  1QS4 A;  2P5O A;  2RPI A;  4CJU A;  4Y1D A;  4FL9 A;  4CK3 A;  3C95 A;  3VF6 A;  4CIG A;  4M42 A;  4FO0 A;  4IFE A;  1UWB A;  3KK1 A;  3EY1 A;  4CJP A;  4IBN A;  1JLA A;  4M63 C;  3TAB A;  3SUO A;  3H1Q A;  1RDC A;  4FPB A;  4PWD A;  2EX3 A;  3R1X A;  2D0A A;  2O8B A;  2F9W A;  1YXQ A;  4IFY A;  4Z4E A;  3C7N A;  2JWL A;  4ILJ A;  5E84 A;  4DTM A;  4O44 A;  3TAE A;  4CZG A;  3ULD A;  2G8F A;  2NLX A;  1W7A A;  2F7T A;  3WXL A;  3DXK B;  2PFU A;  2QWM A;  4YOW A;  3KKR A;  4LF5 K;  2GX9 A;  5FPM A;  1MA9 B;  4CJQ A;  1W97 L;  1DKG D;  4DTU A;  4B1X B;  3I8D A;  4ICL A;  2X78 A;  1E4F T;  2KLA A;  4LY7 A;  1D9D A;  1LWF A;  1O1W A;  3HK2 A;  3OTO K;  3VQE A;  3L2Q A;  4C8M A;  5C10 A;  2HOE A;  4DQI A;  3IS9 A;  2BE2 A;  4ILH A;  2ZF5 O;  4CJ7 A;  2PAV A;  4YOX A;  4O5B A;  1T8E A;  5J2P A;  4CIF A;  3RWU A;  1ESV A;  1VQ5 N;  2HMI A;  2UUB K;  5I3U A;  3DLE A;  4DSK A;  3V81 A;  3V1O A;  2W40 A;  3K57 A;  5J2N A;  4WQ5 A;  3O5B A;  2HBM A;  5HRP A;  4DR4 K;  4LH5 A;  4U67 L;  1NGJ A;  3TAM A;  4OVL A;  4E7I A;  3R9P A;  5BPM A;  2D5R A;  3IDH A;  1K73 O;  3DOK A;  1TAU A;  2G8W A;  1BIZ A;  1Z26 A;  4B8A B;  3QML A;  3K5L A;  4CCH A;  3LAM A;  4H0Y B;  3KK7 A;  4V19 S;  3CJ1 A;  3AAR A;  2QKK A;  4AHV A;  3SBT A;  3BZC A;  3PX6 A;  1VQ8 N;  2ZGY A;  3G6E N;  2A1S A;  5DMR A;  1ITG A;  4JRQ A;  4KTQ A;  3F5T A;  3HYF A;  4EP5 A;  3J7Y P;  2HHW A;  5AZJ B;  4JHD A;  2WOM A;  4C8N A;  2W6L A;  3D2F A;  3AVG A;  1FXX A;  4ILG B;  5GAD P;  2OAN A;  2ZJQ L;  4B9U A;  4LF8 K;  4NLB A;  2BTF A;  2R7Y A;  2HHH K;  3DOL A;  4EHU A;  4DSF A;  4PKH A;  3U6F A;  2ZM6 K;  4JI5 K;  5IWA K;  3OYI A;  2GEL A;  3AVI A;  3GBT A;  5M1O A;  1A5W A;  3K5N A;  4OGE A;  3FLC O;  1W2B M;  1S1U A;  3ZET B;  1BIU A;  1NGD A;  1XWL A;  4CGI A;  3U9D A;  5C42 A;  2OTJ N;  3BGR A;  3O1B A;  1WSJ A;  1T44 A;  4N76 A;  2QEX N;  2P5G A;  4CBX A;  4PHT X;  3OYH A;  2OPR A;  4CFC A;  4XIU A;  5GIO A;  5KPZ A;  4CEF A;  1IH7 A;  5EOY A;  4BRD A;  1JLQ A;  2A3Z A;  1M90 O;  5HRN A;  3ZT3 A;  4FW1 A;  3ZT0 A;  2OA8 A;  4E3S A;  4CHP A;  3G0Z A;  1G15 A;  4CGG A;  4E1N A;  5FPN A;  3HZ6 A;  1RBV A;  1JLC A;  2JWK A;  5HOO A;  3K5M A;  2HVH A;  2I7N A;  3VET A;  2Q36 A;  1XI1 A;  4KRF A;  5AQR A;  4JRP A;  3D6R A;  3SQ4 A;  3OBY A;  1NK0 A;  1Q18 A;  4C8L A;  3V1Q A;  3T1Y K;  3OYE A;  1TKD A;  3PX4 A;  1C6V A;  2YKM A;  1WN7 A;  5AQF A;  3M6G A;  3EYZ A;  3TSU A;  1TUU A;  1NGH A;  1RDU A;  4DMN A;  2KW4 A;  4CJT A;  4M3Z A;  4EHT A;  4KPY A;  3AVA A;  3W0L A;  4XH5 A;  3WQT A;  3LAL A;  3D7E O;  4RW9 A;  4O0I A;  1FW6 A;  3HI0 A;  3OYD A;  4LH4 A;  2Z1I A;  4IO8 A;  4JKC A;  4OO1 J;  3L2R A;  3LZJ A;  3WNH A;  3L2W A;  4M3U A;  4BC4 A;  4HVJ A;  3QB0 A;  3CCS N;  3CXC M;  4MDA A;  4O55 A;  1YJN N;  3OY9 A;  3OYJ A;  3KHY A;  3PSI A;  3SJJ A;  3P39 A;  1QVF M;  3WXM B;  3ZCM A;  1OH8 A;  2GWJ A;  3ITH A;  4BRF A;  4C8O A;  3BZK A;  3E9P A;  3LDL A;  3QEX A;  1RT5 A;  3ZEU B;  4RG8 A;  4YDU C;  4CF2 A;  4OKK A;  1WBB A;  3AVK A;  3D2F B;  2HNZ A;  1VSI A;  2YI1 A;  4M3X A;  4CGH A;  1BI4 B;  4DTX A;  4B3T K;  2O8F B;  3O6W A;  1JXE A;  1GOB A;  4NXN K;  3HO1 A;  3VQ4 A;  2QI2 A;  3QIC A;  4LFB K;  4DQR A;  1RDW X;  3NMU A;  2HHS A;  4KO0 A;  1VQM N;  4BAC A;  3THY B;  3I0R A;  3QFU A;  1HKB A;  1WLJ A;  4FOE A;  4DF4 A;  1NJX A;  4FJ7 A;  4H5T A;  2DFE A;  3AVN A;  1SKR A;  2FSN A;  4DQS A;  3LDQ A;  4FWN A;  3MCP A;  5KQD A;  2LSN A;  3M1F A;  4ELV A;  4FSV A;  1KAX A;  1GLF O;  1CZ9 A;  2OPQ A;  3QIP A;  2Q31 A;  2VWJ A;  4CJK A;  4F2R A;  2RKI A;  4BVP A;  1S6Q A;  4JI2 K;  5LMU K;  5M1Q A;  4AF1 A;  3LDP A;  4O5F A;  4JKF A;  3PSF A;  3VTI A;  3KK2 A;  3ENO A;  3QFP A;  3WEE B;  3SAH A;  4B3R K;  5BRF A;  4CIE A;  1KCF A;  3NF8 A;  2YNG A;  3B6P A;  2Z1H A;  3CJ9 A;  4FJL A;  4FLT A;  1HPZ A;  3KWI A;  4B3S K;  1YI2 N;  1DTQ A;  3OYK A;  2E6M A;  5C25 A;  4J8F A;  4ZHR A;  3NAE A;  3A5O C;  4PUO A;  1IJJ A;  1NLV A;  4EZ6 A;  2ASM A;  2D0P A;  1EXQ A;  3VQP A;  4CF1 A;  5I42 A;  3BEX A;  4CJR A;  2P51 A;  4OKE A;  2G8U A;  3VTH A;  3QEV A;  4IO9 L;  3HM8 A;  3CPW M;  4JI7 K;  4DTS A;  3O08 A;  4BDZ A;  2FSK A;  4JI8 K;  3HP9 A;  4FJX A;  2UXC K;  3LP0 A;  3E9L A;  3TAN A;  1DGK N;  4BRO A;  2X6N A;  1BU6 O;  3G4S N;  3IAY A;  5KPT A;  3K58 A;  4C8K A;  4Z4F A;  3VQ7 A;  4JV5 K;  5CE3 A;  3H3N O;  5JMV A;  2NNW A;  1VRU A;  3RRG A;  1SL0 A;  3A0I X;  4CZF A;  1G99 A;  2CH6 A;  3M8Q A;  3TAQ A;  3THX A;  4YOR A;  1WUA A;  2F8T A;  1BWF O;  3HST B;  3MN9 A;  1SL2 A;  3SQ2 A;  5AQY A;  1GLA G;  3OW2 M;  1Q9X A;  2HMP A;  3IMX A;  3LPU A;  4BR4 A;  3DRP A;  1C0F A;  3CJ7 A;  4X62 K; 
#chains in the Genus database with same CATH homology
 4FWR A;  2QWN A;  5AQS A;  2ITM A;  5GAH P;  3UB5 A;  4BC5 A;  4QS8 A;  4YOV A;  1BUP A;  1VAZ A;  2YHY A;  1BA1 A;  2GWK A;  4JD2 A;  3CER A;  2Q1N A;  3GOI A;  3M3Z A;  1QZ6 A;  1U2V A;  4BC2 A;  4A61 A;  3EL2 A;  3ATU A;  2YCH A;  5AZJ A;  3O9S A;  3QBW A;  1TUY A;  5C12 A;  4MO5 A;  1QQN A;  3VMF B;  4GV6 A;  4XH1 A;  3CF5 L;  1HKG A;  1GLE G;  1YUW A;  2Q0R A;  3O9R A;  5AQK A;  3F9M A;  3O1W A;  4A5A A;  3P38 A;  5CHI A;  5BRH A;  1VQP N;  2ZGZ A;  3O8M A;  5TKY A;  3ZX3 A;  5C0Y A;  2E1Y A;  3FZL A;  4XH4 A;  2BUP A;  3BF3 A;  2QWR A;  3LDO A;  4HTL A;  5BRE A;  5C2F A;  1YHQ N;  2V51 B;  3MMV A;  1EQY A;  3LDN A;  2WUS A;  4FL9 A;  3T7Z A;  4KBO A;  3TSP A;  3VF6 A;  5LJV A;  1YJW N;  1KD1 O;  2IVN A;  3NVM A;  4FO0 A;  3TTF A;  3WXI A;  3CD6 N;  4WQ4 A;  3EO3 A;  4BRE A;  4IFE A;  4BY9 C;  1R59 O;  1YAG A;  3EZW A;  2FXU A;  3ZEU A;  4M63 C;  3G71 N;  3L6Q A;  3H1Q A;  1ATN A;  3AAQ A;  4FPB A;  3CCR N;  4FWO A;  2E20 A;  3CC4 N;  1Q82 O;  3VPZ A;  4BR9 A;  3R1X A;  3UKR B;  1U6Z A;  1LCU A;  2F9W A;  1YXQ A;  4A2A A;  2NRT A;  3CC2 N;  1DT9 A;  3C7N A;  4CZM A;  1GLJ O;  2NRV A;  2JWL A;  4ILJ A;  5E84 A;  4K25 A;  3MX5 A;  5AR0 A;  3MN7 A;  4CZG A;  2NLX A;  2E2Q A;  2F7T A;  4E1J A;  3HOS A;  4MLE A;  3DXK B;  3WXL A;  3ZX0 A;  2PFU A;  2QWM A;  4YOW A;  1NGC A;  2E2P A;  4EFH A;  2GX9 A;  5FPM A;  1MA9 B;  5AQN A;  1SQK A;  3H46 O;  5EXW A;  1QQM A;  4PKI A;  1W97 L;  1DKG D;  3H45 C;  4B1X B;  4JKH A;  2GUP A;  1IG8 A;  2BH1 A;  1QQO A;  2E88 A;  2P9S B;  1NWK A;  1JCF A;  4FWL A;  1E4F T;  5F0X A;  2KLA A;  4H0V B;  1Q7Y O;  3N4Q A;  1YIT N;  3OA9 A;  3AAP A;  5C10 A;  2HOE A;  3CCJ N;  4H0O A;  4ILH A;  2NRW A;  2P9S A;  2ZF5 O;  3L0Q A;  2DPN A;  4CJ7 A;  1Z6R A;  2P9K B;  2WFB A;  3IKM A;  4JKE A;  4KH4 A;  2HF3 A;  3ULE A;  2PAV A;  4CZE A;  5GAE P;  5JLF A;  4YOX A;  4UY8 O;  4BRA A;  1YF5 L;  2NRH A;  3SMP A;  3GG4 A;  2IIR A;  4JKB A;  1VQ7 N;  4CZK A;  1ESV A;  1U2V B;  1Y64 A;  3A5L C;  4H5W A;  4IOC L;  1KC8 O;  1VQ5 N;  2HBL A;  4YOT A;  3ULE B;  3VEZ A;  4IOA L;  2ASP A;  1GLC G;  3E1Y A;  3JS6 A;  1OKJ A;  4WYB A;  2W40 A;  3CCL N;  3DWL A;  3ENB A;  4NLC A;  4WQ5 A;  3HOT A;  3O5B A;  2HBM A;  3C7N B;  4KH6 A;  3C65 A;  2RE2 A;  4FOI A;  1CZA N;  1NGJ A;  4JEP A;  4U67 L;  1VQL N;  5CR4 A;  3CPE A;  2VGM A;  4JK9 A;  5AQG A;  3VGM A;  3R9P A;  3R6M A;  4BRQ A;  4JD2 B;  5BPM A;  4H03 B;  3IDH A;  1K73 O;  4WFA L;  4AM6 A;  1MDU B;  2PBD A;  3U4L A;  1NGA A;  4H5N A;  4CZH A;  4H5R A;  3QML A;  3CJA A;  5BN8 A;  1BO5 O;  1NGG A;  5BRD A;  5DM6 L;  3CCQ N;  4B1Z A;  4H0Y B;  3KK7 A;  4LC9 B;  3TSQ A;  3CJ1 A;  3WUH A;  3AAR A;  4FWS A;  4CBU A;  2QWP A;  4BG8 A;  5I9E B;  3SBT A;  3CJC A;  3L4I A;  4A5B A;  1VQ8 N;  3U8X A;  1T3V A;  2ZGY A;  4PL7 A;  3G6E N;  4B1W B;  1GLD G;  4JHD B;  3VEV A;  3SBG A;  3ZX2 A;  2P9U A;  4DB3 A;  3CCU N;  3DXM B;  3F5T A;  2YJE A;  5AFU H;  3Q7B A;  5AZJ B;  4ISG A;  4JHD A;  5M1F A;  2V52 B;  4A57 A;  3D2F A;  4JN4 A;  3D2E A;  3JXU A;  4O8U A;  4BRN A;  1MWK A;  3FZK A;  3TU5 A;  3E66 A;  3TPQ A;  3I55 N;  4ILG B;  2ZJP L;  3CET A;  4YDU A;  5GAD P;  2OAN A;  2ZJQ L;  5GIP A;  3H1V X;  2QA4 N;  3O9U A;  4WFB L;  3A5M C;  4NLB A;  1N8R O;  1HJO A;  2BTF A;  2YX6 A;  3CME N;  3VOV A;  4EHU A;  4PKH A;  1GLB G;  4IEE A;  1QHA A;  3MCA B;  4DKW A;  4JKD A;  5F1X A;  2GEL A;  3FE1 A;  4K42 A;  3GBT A;  4FWM A;  5M1O A;  1JCG A;  2YHW A;  5KPR A;  2QTD A;  1Z05 A;  3CJB A;  3EN9 A;  1K8K B;  4K43 A;  3CI5 A;  3FLC O;  4CI6 A;  4CZJ A;  3UKU A;  3ZET B;  4EIA A;  1W2B M;  4M7X A;  1GLL O;  2D4W A;  4IOX A;  1NGD A;  3ID8 A;  5TKW A;  3CMA N;  3U9D A;  1Q81 O;  2OTJ N;  3K9J A;  3SJH A;  2A40 A;  2ZWH A;  3O1B A;  4WQ5 C;  2WBN A;  1T44 A;  1S72 N;  2QEX N;  4IJA A;  4CBX A;  2HBK A;  3B8A X;  3RVC A;  4A2B A;  3K9K A;  4A59 A;  4PHT X;  5JVH L;  4GV9 A;  2QM1 A;  2QWQ A;  4EAH D;  5GIO A;  2E2O A;  5KPZ A;  5AQH A;  2ZJR L;  3SMS A;  5EOY A;  4BRD A;  2A3Z A;  3FR0 A;  1E4G T;  3W3D A;  1M90 O;  3PLA A;  1V4T A;  3BF1 A;  1X3N A;  4YOU A;  2AA4 A;  3H6E A;  5AQZ A;  4B1Y B;  3EKS A;  1KXP A;  2E1Z A;  3TTC A;  3AGR A;  4H0T B;  4B1U B;  3CHW A;  5FPN A;  3HZ6 A;  4BC3 A;  2P9I A;  2JWK A;  3FZH A;  3IUC A;  5HOO A;  2AP1 A;  2NRR A;  2I7N A;  3VET A;  2EWS A;  3VEW A;  3C0B A;  4IWV A;  4R79 A;  2Q36 A;  4RWT A;  4FWP A;  5AQX A;  5AQR A;  3MWP A;  3RSE B;  3VF2 A;  3D6R A;  3MK6 A;  1SZ2 A;  3QDK A;  3OBY A;  4MDB A;  4BRH A;  4BQZ A;  1KAZ A;  2CGJ A;  1Q18 A;  5ADX A;  5BPN A;  3VF4 A;  1WOQ A;  1RGI A;  1X3M A;  5AQU A;  4IDH A;  1ZBS A;  2GEM A;  3MWT A;  5EY4 A;  2D1K A;  1YJ9 N;  4GY2 B;  5M1P A;  5AQF A;  3M6G A;  3F2K A;  4BRM A;  4BQL A;  3TSU A;  1TUU A;  1NGH A;  1RDU A;  3EE9 A;  4GVE A;  4BRC A;  3MX2 A;  4I6M A;  3CCE N;  4EHT A;  4CD1 A;  3W0L A;  3HTV A;  2YHX A;  1RFQ A;  2QW9 A;  3HRG A;  1QVG M;  4KH5 A;  4XH5 A;  5BN9 A;  3VEN A;  3WQT A;  3FZM A;  3GE1 A;  3J7Z O;  1T6D A;  3D7E O;  1XC3 A;  3Q7C A;  4U7B A;  1BDG A;  3LM9 A;  3P31 A;  3HI0 A;  5AQJ A;  5LY3 A;  3I33 A;  2P9P B;  4IO8 A;  4AM7 A;  4G9Z A;  1HLU A;  4JKC A;  1OVY A;  3VGL A;  4DHY A;  4OO1 J;  3U9Z A;  5M1N A;  5EX5 A;  4BC4 A;  1HKC A;  2V7Z A;  3D2E B;  3QB0 A;  1VQO N;  4CZI A;  4BRG A;  3CCS N;  3LL3 A;  5AQM A;  3R8E A;  3CXC M;  3ZET A;  4NB4 A;  4BG9 A;  3KVG A;  3FZF A;  1K8K A;  2P9P A;  4MDA A;  1YJN N;  4JNE A;  3KHY A;  1QVF M;  3DXM A;  3P39 A;  3HBT A;  2P9L B;  3WXM B;  3R3L A;  2GWJ A;  3UKR A;  3LM2 A;  4BRF A;  3OBW A;  4WQ4 C;  1XUP O;  3E9P A;  2RHK A;  3AGK A;  3T69 A;  2HF4 A;  3ENH A;  4M7Y A;  4Y0W A;  4WCE L;  1EO1 A;  1ATR A;  3LDL A;  3J8A A;  3ZEU B;  3EE8 A;  4GNI A;  5MLC Q;  5JVG L;  2J4R A;  3SAF A;  4YDU C;  3C6A A;  4PKG A;  1NMD A;  3SLC A;  4C23 A;  2FSJ A;  2I7P A;  2CGK A;  1NGF A;  3D2F B;  1VQK N;  4K41 A;  1ZC6 A;  5GAG P;  1SS6 A;  4MO4 A;  2NRX A;  2P9L A;  2YI1 A;  4QS7 A;  1H1V A;  5FPD A;  3VES A;  4FWQ A;  3FFK B;  5B8H A;  4ISE A;  4PL8 A;  2V7Y A;  5AQV A;  2HBJ A;  3O6W A;  1JCE A;  1J6Z A;  4WF9 L;  3WQU A;  1VQ4 N;  4BGA A;  3UE5 A;  2QI2 A;  1NJI O;  3QIC A;  3WXJ A;  3BP8 A;  2P9N B;  4H0P A;  2QXL A;  1RDW X;  3NMU A;  1C0G A;  3KWG A;  3IFR A;  1MWM A;  1Q86 O;  1VQM N;  4FPA A;  3QFU A;  1M1K O;  4DQ8 A;  5AQT A;  3O4W A;  1BOT O;  1HKB A;  1NGE A;  4FOE A;  1BA0 A;  3CQY A;  4JKG A;  4L3Q A;  3H3O B;  4BGB A;  1KAY A;  1NM1 A;  1K9M O;  1VQ9 N;  3A5N C;  4H5T A;  1YIJ N;  4F9O A;  2FSN A;  3OHR A;  2YJF A;  4OPH A;  2VGN A;  3LDQ A;  1S22 A;  3AY9 A;  3ID6 A;  4FWN A;  5AQL A;  5AQQ A;  3MCP A;  5KQD A;  3DAW A;  3M1F A;  5M1K A;  4YOY A;  1NGI A;  1T6C A;  4FSV A;  4O8K A;  1KAX A;  4IJN A;  1GLF O;  3CC7 N;  1S3X A;  4IEI A;  2P9U B;  3BUZ B;  2Q31 A;  3M5R A;  4BRK A;  3SAG A;  3CCV N;  1SAZ A;  1HPM A;  4BVP A;  2P9K A;  2UYT A;  4JK8 A;  4BVO A;  5JIC A;  2E8A A;  5M1Q A;  4AF1 A;  3LDP A;  1ZXO A;  4O5F A;  5AQP A;  3I8B A;  5FPE A;  4JKF A;  1K8A O;  4FVU A;  4A62 A;  4BR0 A;  3VTI A;  2GTD A;  2FF3 B;  3ENO A;  3QFP A;  4JAX A;  4NO7 A;  3S41 A;  4Z94 A;  3WEE B;  3SAH A;  3NVK A;  4BR7 A;  4HWI A;  5BRF A;  4H0X B;  2KKZ A;  2CGL A;  1YVN A;  3SK3 A;  4CD3 A;  3RSE A;  5LJW A;  3CJ9 A;  2FLO A;  2HST A;  2FF6 A;  3VEY A;  4CBW A;  1P8Z A;  1DEJ A;  3KWI A;  3DXK A;  1BG3 A;  2IVP A;  2WC9 A;  5AQI A;  5BPL A;  1YI2 N;  3E9O A;  1P90 A;  1TYQ A;  5AZI A;  4DCH A;  5HL7 L;  4J8F A;  3PIO L;  4OPA A;  3C6H A;  1VQN N;  4C1N K;  2W41 A;  3WT0 A;  5ADX H;  3VGK A;  3A5O C;  5GIN A;  5DM7 L;  5ELZ A;  2QWO A;  3CQX A;  3P4I A;  3O9T A;  4BRP A;  4C1N I;  3VEX A;  4WFN L;  4BRL A;  1JJ2 M;  1IJJ A;  1NLV A;  2E2N A;  2ASM A;  4RCH A;  2Q0U A;  3G25 A;  2Q97 A;  2D0P A;  2VWB A;  3MN5 A;  5C2D A;  1O13 A;  3PIP L;  2NRZ A;  3BEX A;  3O80 A;  5AQO A;  3KZB A;  4B1V A;  3QBX A;  1TYQ B;  5AZI B;  3VTH A;  4IO9 L;  1ILY A;  5KQ8 A;  3HM8 A;  2Q2R A;  2A6A A;  4BRI A;  5C15 A;  3CPW M;  3O08 A;  2KHO A;  4XEI A;  1V4S A;  2FSK A;  1NGB A;  3UKU B;  3DJC A;  3VEO A;  4I6M B;  4JKA A;  4RTF D;  2P9I B;  1X9J A;  4IXC A;  4BR2 A;  3HSC A;  3N4P A;  3L4Q A;  3O9Q A;  2ASO A;  3DLL L;  5JLH A;  5EVZ A;  4JKG B;  4B9Q A;  1VQ6 N;  1LOT B;  3E9L A;  3A8Y A;  1DGK N;  4BRO A;  3ZYY X;  1BU6 O;  3G4S N;  2NZT A;  3MN6 A;  1D4X A;  5KPT A;  3WEE A;  1ATS A;  1KQS M;  3ATV A;  2H3G X;  5AQW A;  5CE3 A;  2P9N A;  3H3N O;  5JMV A;  4BR5 A;  1NBW A;  3GL1 A;  2F9T A;  3FGU A;  2NNW A;  4IZ9 A;  3A0I X;  4CZF A;  1G99 A;  2CH6 A;  2QWL A;  1QZ5 A;  2VCP A;  4YOR A;  1WUA A;  3EKU A;  3MDQ A;  3TTD A;  5BR9 A;  1BWF O;  4QS9 A;  2VYP A;  5AFU A;  3GDQ A;  3CCM N;  3MN9 A;  4ISF A;  5AQY A;  2A42 A;  2D0O A;  5H1S Q;  2A5X A;  4JK7 A;  2A41 A;  4GV3 A;  1GLA G;  2OTL N;  3OW2 M;  2HMP A;  3IMX A;  2IVO A;  3VER A;  4FWK A;  4MLH A;  4BR4 A;  5F2R A;  1C0F A;  3I56 N;  2CH5 A;  1HUX A;  4CZL A;  3WXK A;  1HX1 A;  3CJ7 A;  5E26 A;  4H5V A;  1XQS C;  3CIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...