2UUAK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uuaK00
4YY3K 4JI4K 1J5EK 4DV5K 4JI1K 4CVNE 4B3TK 4K0KK 2UXBK 5LMNK 4DR6K 5FLXO 5A2QO 4X65K 1IBLK 1HNXK 2UUAK 4V19S 4JI6K 4LF7K 4AQYK 2VQEK 4LFCK 5AJ3K 2E5LK 3T1YK 1N36K 4LF8K 3OTOK 5IT9O 3T1HK 2UXCK 4X62K 3J81O 4LF4K 4DR1K 4LFBK 4NXMK 1N32K 4DR3K 5LL6Z 3J7AP 4JI8K 4LF6K 5IWAK 2UU9K 3JAMO 4JYAK 4YHHK 4JI5K 2UXDK 4LF9K 2VQFK 5BR8K 1IBMK 4DR4K 4LFAK 1HNWK 4DV0K 1XMOK 4DR5K 1XMQK 1XNQK 4JI2K 4JV5K 4NXNK 1N33K 4OX9K 4DV2K 4DR7K 4X64K 4LF5K 4GKKK 4KHPK 4JI0K 1N34K 4DUZK 1IBKK 2HHHK 4JI3K 1XNRK 4DV4K 2F4VK 4JI7K 4CW7B 2UUBK 1HNZK 4B3SK 3J7YP 4DR2K 1I94K 4GKJK 4B3RK 4DV6K 1HR0K 2UUCK 3J80O 4DV1K 4B3MK 4X66K 1FJGK 4DV7K 4DV3K 5LMUK 4DUYK 2ZM6K
chains in the Genus database with same CATH superfamily
3LM9A 5BN8A 3C6TA 4EHTA 1GLJO 1P90A 4CF0A 4B08A 3K0SA 3CC2N 2YHAA 3MEEA 2KW4A 5AQHA 3HSCA 4CZGA 4EZ6A 4N76A 2DTUA 1LAWA 3H08A 2QWPA 4IJNA 5DM6L 1NGAA 2O8CA 1KAYA 1ASVA 3D6RA 4I7FA 3O5BA 3OHRA 4E0DA 3ZSZA 3CM6A 5HROA 1TYQA 4WQ5A 1XC9A 3UIQA 1Z6RA 1N32K 3C6HA 5DK5A 1NK5A 1KAZA 4YDUC 4XH4A 4BDZA 5IWAK 2UU9K 2WOMA 2YNHA 1OVQA 3E1YA 3I8DA 4CF9A 1M1KO 3LANA 1VSJA 3RWUA 4J2DA 1HRHA 2YI1A 4H0PA 4O55A 2YNIA 1ASWA 1IG8A 5BR8K 4YOYA 2HSTA 4YOTA 2A6AA 1HNWK 1SKSA 4JI2K 4A2BA 1VQ8N 1XWLA 4O44A 4CJWA 2RE2A 1F21A 3GE1A 1HUXA 2VG5A 4MDBA 2X74A 3QNNA 2GUIA 3MK6A 1LWFA 3NH0A 4OPAA 3F73A 1Q86O 2FLOA 4BE0A 3LDQA 3TTFA 4CJQA 3LL3A 3QETA 3AVHA 4KTZA 1VQPN 3CC7N 2IIRA 5GAEP 4DB3A 1HNZK 3U4LA 4M41A 1RT4A 4K8XA 3E01A 4KHSA 4MO5A 1I94K 4KHWA 5AR0A 4NCAA 3BGRA 4DTSA 1YHQN 2ZJQL 3RMDA 5HRPA 1ESVA 1X1PA 3SQ4A 3S3OA 3C7NA 4DFJA 3O1WA 4B3TK 1L3VA 3GOIA 1ZBFA 1VSEA 4IJAA 1TKDA 1WAFA 5AQNA 4CJPA 2A40A 3SUNA 1WBDA 2XY6A 5BRFA 4DSKA 3PO5A 4OGCA 2HHXA 3L3VA 4JI6K 1GOCA 4ZTJA 3MXJA 1WSGA 4JNEA 4FJHA 2YJEA 3ULEA 3UKRB 3H45C 5KGXA 5IT9O 3CMEN 1KC8O 2ZQBA 1GOBA 4B9LA 4KHQA 4FK4A 1VQMN 3QB0A 1Q9YA 3EE8A 2QWOA 3VQ5A 3L2RA 3LP3A 2VGMA 3O9QA 2JWLA 3CCMN 5LL6Z 3OW2M 5AQGA 4JKAA 2XY5A 3JAMO 2EWSA 4BRNA 3IKMA 1KQSM 1RDAA 2Q0UA 5FRNA 4JAXA 3E9PA 1IO2A 4DQRA 4DTUA 4RG8A 4GV6A 1XC3A 2G8WA 3WQTA 4IO8A 2O8DB 4F8RA 4L3QA 1QVFM 5HBMA 1CLQA 1QQNA 4Q0BA 1N33K 1VQLN 3HP9A 2QEXN 3DXKB 3M8SA 3SQ0A 1ILYA 1J6ZA 1K6YA 2NRWA 3O4NA 5JS2A 3VQ6A 5C0YA 1C0FA 3SV3A 2HHHK 2KZMA 3D2FA 3T7ZA 4YFUA 4GMJB 4CD3A 2DFEA 4IEEA 4BVPA 1KVBA 4CW7B 4KV8A 3A8YA 3KLGA 1D9DA 3ULEB 1GLLO 4B9QA 3SUPA 4KHNA 3OBYA 3CG7A 1HQUA 4B3RK 3VTIA 2FC0A 1D5AA 1DGKN 2Z1JA 3C95A 4LSNA 3J80O 2YHBA 2GUPA 4CERA 3OYCA 2YHXA 1DTTA 1B9FA 2NUBA 1BQNA 4DV3K 4YY3K 3QIOA 1NLVA 5LY3A 4OPJA 4IG3A 3CHWA 5HRSA 4BRMA 4KB0A 3M8RA 4K41A 4IWVA 1U45A 1NK4A 2NRHA 1BIUA 4BDPA 1S6QA 3WXLA 4JD2A 2HNYA 3EKSA 3PSFA 5B8HA 1NGJA 1HJOA 3QBWA 3OJUA 3SQ1A 3K58A 4B9NA 3SNNA 5AQUA 5C24A 1W2BM 4LF8K 3QFUA 3VPZA 4JS4A 4FVUA 4U7BA 1TUYA 3A2FA 1BA0A 3CCJN 3AO5A 4E7JA 1VQNN 3QICA 4RTFD 1LWEA 3AVKA 3KVGA 3QERA 3DLKA 5HP1A 2OPPA 4JKCA 1L5UA 5FPEA 3J7AP 3ZYYX 1JLQA 3K5LA 4WCEL 3SZ2A 1T03A 5FPMA 1FK9A 2G8KA 4EIAA 4FK2A 3KKRA 4FWNA 2QWLA 1K8AO 3EKUA 4CEQA 4ZTFA 3CCSN 4JHDB 1RTHA 3HBTA 1IBMK 3TABA 1ZXOA 1TKZA 4LFAK 1OVYA 5EXWA 5TKWA 2QWQA 1NK6A 2ITGA 3VENA 4H5VA 5E41A 4ID5A 4FOIA 3ATUA 1CXQA 3O4QA 4BGAA 3ASMA 2LSNA 4O0IA 1VQ7N 4BRQA 5GADP 2W6LA 3EE9A 3SMPA 3H1QA 5CY4A 5GINA 4Z4EA 1C1BA 1QZ5A 2UUBK 4M3XA 3EN9A 2NRZA 3DOKA 3H1VX 4H5RA 3CFPA 4OKEA 4FLZA 2HMIA 4ICLA 2ZGYA 1JL2A 2GEMA 4JKGB 2E88A 4BRKA 4FJ9A 4BVOA 1RBRA 1HKGA 2A3ZA 4B1ZA 2D0BA 4FSVA 2OPQA 1RDCA 2ETJA 1GLBG 3M1FA 5C42A 4DV5K 3LP1A 5LJVA 3L8BA 4CIGA 3M6GA 2RHKA 4DR6K 5M1QA 4H0VB 2PYLA 2W42A 3SPYA 4DTPA 4DKWA 2HMPA 3VN5A 1QTMA 2OANA 4IZ9A 3JYTA 1WSFA 2F9TA 4E1JA 3C6UA 1NJWA 1SUQA 4CE9A 4CFCA 3PSIA 3TPQA 4JKBA 1G15A 3P4IA 3WXJA 1X9MA 4LFBK 4ILHA 4PKIA 1RT5A 4BE1A 3LDSA 2KTQA 3M8QA 5KPTA 3NDKA 3HK2A 3IRXA 5GIPA 1QE1A 4N5SA 4J2AA 3L4QA 4M45A 3ENHA 1C0UA 2P9NB 3PX4A 2P9UA 5F2RA 1ASUA 1T05A 2O8EA 3O3FA 4CZIA 3O3HA 5C15A 2D0PA 1TK8A 3OYKA 3T69A 1XNQK 3SK3A 3L2UA 3ATVA 3NF8A 2QKKA 2OZSA 4U67L 3ZX3A 1LCUA 2XY7A 2FBVA 2HHQA 4C8OA 3OY9A 2G8VA 5E26A 4JI0K 1OH8A 1LW0A 4FOEA 1HYVA 4FLXA 2P9LB 3HOTA 4FO0A 4A2AA 3CERA 4BGBA 4FLTA 1B92A 3OYJA 1D9FA 1NGBA 4WFAL 1RBTA 3IAYA 2WUSA 3DJCA 4LH4A 3O9UA 2A1RA 4DV6K 4FJ8A 4CIEA 4X66K 3V6DA 4I9LA 2ZJPL 1SL2A 3WNFA 4EP5A 1ZBSA 3HOSA 3LZIA 1Q18A 3OYIA 3VQ9A 4HWIA 4OO1J 4M3RA 4CI6A 3FR0A 3ZLJA 2P5GA 3HPGA 1U48A 3HI0A 3FZMA 1VQ6N 1VSHA 3O4WA 1U2VA 3RTVA 4LF7K 1NWKA 1BGXT 4WE1A 3TAQA 4FJ5A 4GNIA 4DSFA 1SS6A 2O8FB 4CJ3A 1TL1A 1J9AA 5AQTA 4O5BA 4C1NK 1U49A 4HHTA 3SYZA 3HSTB 2JWKA 3PY8A 5J1EA 3HT3A 1HJRA 2YKNA 4NXMK 3AGRA 4A57A 3SBGA 3WXIA 2XRIA 3THXB 4JN4A 4AHVA 2HBKA 5EY4A 1X9JA 1RTDA 2OA8A 3VQ7A 3L2QA 4KI6A 4Z4FA 1NJYA 1X3NA 1BL3A 2UXDK 4IFVA 3G0ZA 3VESA 4UY8O 3HP6A 1N8RO 2QI2A 3AVIA 2GX9A 1YIJN 4DR4K 3OYFA 3FFKB 4DV0K 4FZXC 4BR9A 3HL8A 3VQAA 4JV5K 4DV2K 4KH4A 4CEAA 3ID8A 4CK1A 4AM7A 2A41A 4CF1A 2FSKA 5AQOA 4IKFA 4FWMA 1U6ZA 1LOTB 1JLGA 1A5WA 4OLBA 2G8IA 1IBKK 1U2VB 2VG7A 4IOXA 1C0MA 3WNHA 4FPBA 2NZTA 2O4GA 1L3UA 4BE2A 4AM6A 1BU6O 3QBXA 3P5JA 1S72N 2NRRA 5C25A 3AGKA 5BPLA 1GLEG 1XHZA 1JL1A 3KK1A 4DQSA 3P83D 3A5OC 3C65A 1N6QA 4DUYK 3VEVA 4GW6A 3FZKA 1DLOA 3OVNA 4FPAA 1IKYA 4FWKA 2G8UA 3E9OA 4Z4IA 5AQRA 1ZBHA 1VRUA 3ZT0A 3TSUA 1YJ9N 2GWJA 2FSJA 3HYFA 4JEPA 1K73O 4BDYA 1Q81O 4PL8A 3OYLA 4FJ7A 2A5XA 4FXDA 4XIUA 4B9VA 3OYBA 2E5LK 2ASPA 3P1GA 4YORA 5GAHP 3QEXA 2QA4N 1JXEA 2HB5A 5BRDA 4B9MA 3KK2A 3GL1A 3L2VA 4A61A 4E7KA 2YHYA 2YJFA 3NHGA 3HVTA 2F8SA 4FW1A 3O1BA 3P39A 3OBWA 4A5AA 2OPRA 4O4GA 2HNDA 3OYHA 4AH9A 1X9WA 1GLDG 1VAZA 4TSXA 4FLVA 3EEQA 5AZIB 3CM5A 3WNGA 2KZZA 3CF5L 4HVJA 1VSLA 1NGEA 4DLGA 4KB1A 1NOYA 1J54A 4KAZA 4E1NA 3OYEA 2O4IA 1WAJA 2Q1NA 4FVMA 1IKWA 2VWJA 2Y1JA 3N4QA 3M8PA 1HKCA 1N34K 5D3GA 3CJAA 4CJ7A 4DSEA 1YUWA 1K9MO 3LWLA 4QOZB 2XHBA 2PZSA 4DFPA 2RN2A 4B3SK 1TL3A 1C6VA 3UKRA 5KRTA 4HCCA 2O8BA 3KWGA 4DV1K 4CGDA 3TAFA 5ADXA 3K5NA 4GV9A 2D0AA 1VSKA 5I42A 4M7YA 4DS5A 1SKRA 4EZ9A 3MXMA 4H8KA 4JI1K 5GAGP 2ASOA 4XH5A 3O9TA 4MO4A 1BOTO 4CEDA 4B9TA 3TAPA 1EX4A 4K25A 3MN7A 4I2QA 1T7PA 2D0OA 4IFEA 2O8DA 3Q7CA 1RBSA 2Q97A 1E4FT 4NYNA 1I3AA 3CIPA 4CHOA 3SUOA 3JS6A 1DKGD 3DXKA 4ISEA 4C8NA 5AFUH 3DI6A 4BACA 3O8MA 3MCPA 4I2PA 4BC5A 2G8FA 3KD5E 2H3GX 4PQUA 1VHXA 4BRPA 4DSLA 4JKFA 3R3LA 2F8TA 3CXCM 3DMJA 4JKEA 4CFDA 4Z0UA 1ZBIA 1E4GT 3BP8A 2P5OA 4OLAA 1CZBA 4A62A 5M1PA 3R8EA 2I7NA 3GG4A 1NGDA 4CK3A 4LD0A 2O8BB 2QK9A 3VGKA 4JK8A 4PUOA 2ASMA 1HKBA 1HMVA 1NOZA 4B1WB 4DR7K 4J2EA 3LDPA 3FZHA 4QS7A 2QKBA 4E89A 1WSJA 4QAGA 2V51B 1TUUA 3L3UA 2DFFA 1LW2A 1HYSA 3V1RA 2HBMA 4CF8A 1QSYA 4BR4A 1QSSA 3AA5X 2ITMA 4YOUA 2PFUA 3QIPA 4OJRA 3TSQA 2WTUA 2KFZA 3O9RA 4H0OA 2A42A 1JCGA 3HJFA 3V81A 2IAJA 4BG9A 5CZ2A 2YV0X 3WNEA 1BI4B 3IDHA 3L2WA 1X3MA 2F96A 4UQGA 3AVMA 3HPHA 1RBVA 3V9ZA 5LMUK 2E6LA 4WQ4A 3CCVN 3G10A 5CHIA 2GELA 1BIZA 1WOQA 2VGNA 1REVA 3RMBA 1EETA 3OYAA 2A1SA 2ZF5O 3T3FA 5KQ8A 2UXBK 1VK0A 3NF7A 4F4KA 4QS8A 3BUZB 4FLWA 4O8UA 2W40A 4E7IA 4JHDA 5J2QA 1K8KA 1WLJA 1EKEA 3VTHA 1YI2N 1XQSC 1IH7A 2X78A 3G71N 4FJNA 4CJUA 4BROA 3AVLA 1A5XA 3G25A 4IBNA 1KTQA 3K59A 3U3GA 2IGIA 4NLBA 3T1AA 1ZBLA 3THYA 1RDBA 4XH1A 4CZKA 2B4JA 3EZWA 3TARA 4M3TA 4IOCL 3KLEA 2HW3A 4DR3K 1CZAN 3DLLL 3ZSYA 4DF8A 1QQOA 4AILC 4LF6K 1RNHA 3TU5A 5AQKA 1SZ2A 5HRRA 3LPUA 4ID1A 4E19A 4LF9K 3ZEUA 2D1KA 4ZHRA 4YOWA 4JK9A 2VQFK 3OJSA 4AF1A 2WC9A 2Q36A 2WFBA 3CETA 5FDLA 3ZCMA 4DSIA 1KXPA 1RDDA 4CZEA 4CF2A 4M3ZA 2F9WA 4PY5A 4JKGA 1WN7A 4LSLA 3O3GA 1RT3A 4FL9A 3BY5A 2ZGZA 3QEVA 4BRCA 5AZJA 4RW7A 4W5RA 4IXCA 1HQEA 1UAXA 2PY5A 3MX2A 3ZT4A 2HF4A 1YVUA 4ILJA 1A5VA 3FZLA 4CHZA 1WSEA 1XNRK 3RSEA 3SMSA 2NRVA 1IKVA 1HYZA 1MWKA 2NNWA 4JI7K 3AAPA 1K8KB 4H0YB 4BR5A 2P51A 3OYMA 1TK5A 4WQ5C 3ZETA 3V9UA 4BRLA 1X9SA 4FM0A 1EXQA 2VWBA 4MFBA 3CQ8A 1QQCA 3N4PA 4GVMA 4ISGA 3THYB 4DV7K 1UA1A 2JLEA 5AQIA 4DMNA 2E2PA 4CBUA 3O08A 3VEWA 1S5JA 5BREA 3G6EN 3TTCA 3AVNA 3HTVA 4BRFA 2XO7A 4CHQA 3PLAA 1KVAA 2NLXA 3SQ2A 4HUFA 3ZEUB 1TAUA 5FLXO 4CGJA 2UUAK 2P9NA 3DRRA 4CZLA 1VRTA 3C0BA 1KSPA 5KI6A 1W9HA 2QWRA 4BRIA 3QINA 4EFHA 5M1NA 3FZFA 4DQIA 5J2NA 3NF6A 3T1YK 3NGZA 5J2MA 1JJ2M 4WF9L 1EO1A 3EZ5A 5AQXA 4X62K 3LPTA 5AZJB 4B1UB 4OKJA 4B8AB 4XEIA 3AVJA 5AQSA 3TSPA 2P9LA 3F5TA 2E4LA 3RSEB 4WFNL 3I33A 3CMAN 4YHHK 4AHSA 3AY9A 5KQDA 4PL7A 4FM2A 1TK0A 3HM9A 5KTQA 3ZETB 3LALA 1HNVA 5C10A 3NBPA 1NJZA 4KI4A 2Q31A 1TVRA 2ZWHA 4CEEA 3DM2A 3VEZA 4NXNK 1ZBUA 2YCHA 3K2PA 2ZJRL 4M42A 4CGIA 4Z94A 5C2FA 3AO1A 4FW2A 1XUPO 5J2PA 3CJ9A 5TKYA 4JI3K 4R79A 3VA3A 4DV4K 1S1TA 4DSJA 4EP4A 1KCFA 2HHWA 3CI5A 4F3TA 5HRNA 4FJIA 3IS9A 3SCXA 1NG9A 2O8FA 1Q82O 1O13A 3ZSRA 4B3OA 2NRXA 1OH5A 3BZKA 3B6OA 4NB4A 3MMVA 3KHYA 2IOCA 2OCEA 3THXA 2IVOA 2E20A 3VMFB 1O1WA 3DOLA 3L0QA 4Y0WA 3LDLA 3K9JA 3VF2A 3U8XA 2E1YA 4IG0A 3BZCA 5KPZA 2NRTA 1JLFA 4AQYK 1LAVA 2VWKA 4BREA 2BDPA 3VETA 3V9WA 2HHTA 2OTJN 3OS2A 3C94A 1RDUA 3FLCO 4CJ5A 3CC4N 1L3TA 3DLRA 1Z25A 3HM8A 4BRGA 3ZT2A 3NCIA 3A5MC 1RDWX 4I6MB 5ADXH 2ZD1A 1VQ9N 2CGKA 2Z1GA 2Q0RA 3J81O 4KO0A 3QLHA 1JLEA 3BF1A 3RMAA 4B9SA 2HHSA 5ELZA 4C8LA 1HX1A 1XHXA 4Z4HA 4CJSA 1N5YA 4DTMA 1VQON 4KKOA 4JYAK 1EWRA 2PBDA 3KIOA 1QQMA 3ENOA 1YITN 4M3YA 1IV0A 2EHGA 1S3XA 4CFBA 2PAVA 5JVGL 4FJKA 2AA4A 1D8YA 4FJJA 3OA9A 3TI0A 4DFMA 3KKSA 4DR5K 5JICA 1S22A 2KLAA 4CEFA 4R5PA 4DLEA 3KLHA 1CXUA 3D7EO 3OS0A 2KHOA 3CJ7A 4DTNA 3JSMA 3EO3A 4GKKK 3J8AA 1MDUB 2X6SA 1RTJA 3VERA 4BRDA 3CCEN 4WYBA 1ATRA 4N41A 3WXMB 3L4IA 2Q2RA 1GOAA 4IDHA 3NE6A 3SLCA 3J7YP 1KFDA 3DRSA 1NBWA 1SQKA 3TAEA 1HLUA 2GWKA 1HPMA 2V7ZA 3L6QA 4IOAL 1FKOA 5SWMA 4HTUA 3V1OA 1UOCA 1NNEA 5EX5A 2I5JA 4DFKA 1NJIO 4JI4K 1GLAG 1HNIA 4OGEA 3QO9A 3AO3A 4DTOA 5M1KA 4K0KK 5LMNK 3J7ZO 4CJRA 5AZIA 1JCEA 3UKUB 4PHTX 4CGGA 4H0XB 2KQ2A 4C8KA 4W5QA 1BDGA 3CYMA 3MCAB 4O0JA 4CZFA 4KPYA 3MWTA 3R9PA 4IDKA 4BQZA 5FROA 1NK8A 3NVMA 5AJ3K 5AQVA 3D45A 1NJXA 2QXFA 1C0GA 1VQ5N 1NK7A 4M7XA 3SPZA 4CEOA 3ENBA 2FF3B 1G99A 4B1YB 5CYMA 1NGIA 3A0IX 2YX6A 4L8RB 3TTDA 3CQXA 5I3UA 4JI5K 3GDQA 1QHTA 2I7PA 4BR2A 3PV8A 3JXUA 2GBZA 4CEZA 4CZMA 1WUAA 3NH2A 4HUGA 4B9UA 3BEXA 3AVFA 3P31A 3E66A 4NCGA 3A5NC 3LDNA 3AVAA 5FRMA 4JK7A 1FKPA 1XMOK 3ZSWA 2J4RA 1FW6A 4Y1DA 3KZBA 2KFNA 4CEBA 4KBOA 4W5TA 4DTRA 3RR8A 3V9SA 1IJJA 3ZSOA 4F9OA 1R59O 2UYTA 2BE2A 1ZC6A 4GY2B 3RRHA 4BR7A 1Y64A 4BC3A 5AQWA 3M3ZA 4CJLA 3KWIA 3H3NO 3DXMA 4ISFA 1BO5O 3CJ1A 4BQLA 1KVCA 3WQUA 1J53A 1NGFA 2QXLA 3R6MA 2YNFA 1JXBA 2P9PA 3LWMA 4DQPA 3LDOA 3KK3A 3MN6A 3IFRA 3P38A 2UUCK 3MDQA 1NU0A 4BR0A 1MWMA 5EOYA 2P9KB 3K5OA 1NKEA 3AVCA 1BQMA 2IVPA 5AQZA 3HPOA 1OKJA 1KFSA 1J5OA 2HNZA 5KRSA 4FWRA 1S1XA 3UE5A 3IMXA 3VGMA 4AHUA 3W3DA 2Y1IA 4N56A 4LH5A 4K8ZA 2FBTA 3HZ6A 3E9LA 5T7BA 4JKDA 1BHLA 4CJ4A 5I9EB 4CECA 4RW4A 5CR4A 3MAQA 4RWTA 1EP4A 3AO2A 1RILA 4C23A 3F2KA 3THWA 1S9GA 3VQ4A 1YTUA 4JRPA 3ZT3A 4AHTA 4EHUA 4E7HA 1NK0A 2B5JA 3LZJA 3W0LA 2V7YA 3FE1A 3WT0A 4FZYA 3PX0A 5CZ1A 2DFHA 1VSDA 1E3MA 2YNGA 3DXMB 4CJKA 4QS9A 2OTLN 4AHCA 4GV3A 1QS4A 3D0PA 2P9PB 3I0RA 3HO1A 5JLFA 3KTQA 1BI4A 3QFPA 3NMUA 4Y1CA 1ATSA 4FJLA 4FCYA 3VEXA 4H03B 5JMVA 2E2OA 2O8CB 1KD1O 2P1JA 3K9KA 3U3YA 2D5RA 1TAQA 1I39A 4LF5K 4KTQA 5HOOA 2ATQA 4OVLA 1YVNA 1TYQB 2HOEA 3ZX2A 5AQLA 2P9SA 4FWSA 1S6PA 1MA9B 3VQDA 3C6AA 1U4BA 5BN9A 2F4VK 3HXMA 1RFQA 4B1XB 3CFRA 3RRGA 4J2BA 1RT7A 4AHRA 3DAWA 1C1AA 1L3SA 3V4IA 1V4TA 3CJBA 3TAMA 4CD1A 3AVGA 1WBBA 3WUHA 3THWB 3ZSQA 4CBXA 1UA0A 2QWMA 4GVEA 1VSIA 1GLFO 3KJVA 4KTWA 1NGGA 5JS1A 3ALYA 2FSNA 3K57A 1YJNN 4G1QA 2HVHA 3KD1E 3QDKA 2IVNA 3HRGA 3I0SA 4RW8A 1ITGA 4CVNE 4OKKA 3BF3A 4BC2A 1KRPA 4F2RA 2HVIA 1BWFO 3SAHA 2HHUA 1YT3A 4BG8A 4HTLA 3DRPA 3SBTA 4FWLA 2VQEK 2VCPA 1YAGA 3PUFA 5EU7A 4Z4CA 2E2QA 5KGWA 4BC4A 1YJWN 2HBJA 3U9DA 3CJCA 4CJEA 1QSLA 2CH5A 3UB5A 2IS3A 2FXUA 4EAHD 4DR1K 4FJXA 4NYFA 1EQYA 4FZZA 1S1WA 2E2NA 1SKWA 2P9SB 3KK7A 3C7NB 3ULDA 3ISNC 4IEIA 2AP1A 3TR8A 3G4SN 3FFIA 2QTDA 3WXKA 4B8CA 3T19A 3SV4A 3IUCA 1RGIA 4WFBL 5KPRA 1UWBA 1S1VA 4DU1A 4CK2A 3I55N 1QVGM 4KFBA 2E1ZA 4FLUA 2EX3A 4PKHA 1NM1A 1IG9A 2W6KA 3MWPA 1TKTA 3AA2A 3OYDA 1T8EA 1BCOA 4X64K 1SL0A 3I8BA 3CCRN 1QZ6A 4F2SA 3EYZA 4FWOA 1NKBA 4FM1A 4NCBA 2VYPA 3VQBA 4I9QA 3ZX0A 4F3OA 3GBTA 1NMNA 1Q8IA 3LP2A 1M90O 3H6EA 1JCFA 4DTXA 4CESA 2IDOA 4IFYA 2BH1A 4JRQA 1BUPA 3H46O 1HR0K 1QHAA 4DQQA 4B3MK 3TANA 4CJTA 1SL1A 2KKZA 3LAKA 1YF5L 3NVKA 2RF2A 4LY7A 2W41A 3MN5A 2OYQA 1ATNA 5F1XA 4W5NA 3D2FB 4CGHA 3CCUN 3PIPL 4C1NI 1NGCA 5BPMA 1OH7A 1RT1A 5SZTA 2DY4A 1EWQA 3SAFA 4ELVA 3VF4A 3BDPA 2IC3A 4BWMA 4E3SA 2QWNA 3CPEA 2F7TA 3T1HK 3S9HA 3MN9A 4M3WA 3K5MA 4CJVA 1OH6A 4NLCA 3TAGA 1RCHA 4BWJA 2ZE2A 3QESA 2CH6A 5HL7L 3VA0A 4H4MA 3SJJA 4DF4A 4Q5VA 2BTFA 3KLIA 4DS4A 4CIFA 3VGLA 4CHYA 4JD2B 3VOVA 4CZHA 1Z26A 2X6NA 1U47A 1LV5A 1RBUA 5JVHL 1DEJA 3SAGA 4OX9K 4K43A 4CHNA 2CGLA 3RVCA 1T44A 2OPSA 5AFUA 3QEPA 2OZMA 3B8AX 2WONA 5AQJA 4DUZK 4KH6A 1TV6A 3VQ8A 1FXXA 2BUPA 3LP0A 3SJHA 4H5NA 3VQCA 3Q7BA 1BCMA 4H4OA 4BY9C 1W0HA 3CFOA 1W7AA 2Q3SA 3MXIA 4DCHA 4MLHA 4DR2K 2QM1A 4GKJK 3AA4A 1D4XA 4ELTA 4C8MA 1JLCA 2E6MA 4G9ZA 5FPNA 3QEWA 1R0AA 4PWDA 2BANA 3CQYA 5FPDA 4I6MA 3O80A 1Q9XA 5BR9A 1W97L 1NKCA 4FWPA 1WSHA 2FBYA 2ZM6K 1U04A 3AA3A 4OPHA 5E84A 3LAMA 4B1VA 3U6FA 1J5EK 2D4WA 4H0TB 1S9EA 1BA1A 3M5RA 4MDAA 1IKXA 1Z05A 5EVZA 4A5BA 4E1MA 1T6CA 3ZSXA 1BISA 5GIOA 3PX6A 4X65K 3WEEA 2G8HA 1HNXK 4V19S 1VQKN 4YDUA 1NMDA 1KLMA 2V52B 3I56N 2VG6A 2R7YA 3PIOL 4DU4A 3S41A 5DMRA 3PO4A 3VEOA 3OTOK 4BRAA 3SUQA 1RT6A 3V9XA 5CE3A 1MU2A 4IO9L 1H1VA 4KH5A 3VEYA 3NAEA 1NK9A 2P9IA 1VSMA 1P8ZA 4CCHA 1S1UA 4Z4GA 4JI8K 4CHPA 4RW9A 3RMCA 4FLYA 3NF9A 5DM7L 1DT9A 5C12A 4KHYA 4KREA 2PYJA 4A59A 1JLBA 4FK0A 1LWCA 3LM2A 4WQ4C 3SI6A 1CZ9A 1GLCG 4CJFA 4YOVA 3EL2A 4M3UA 3A5LC 2GTDA 3DLGA 3VQEA 5H1SQ 1TKXA 5C2DA 2JGUA 1RT2A 5CYQA 4KHPK 3CD6N 2CGJA 4H5TA 1JKHA 1BG3A 4PKGA 3UKUA 3WEEB 3VQPA 5AQQA 4DQ8A 2GV9A 4DTJA 1WNSA 4H5WA 3DLHA 4J8FA 4FJMA 3AARA 2Z1IA 1Y97A 2P9UB 3ZSVA 5AQMA 2O8EB 1SAZA 3AAQA 1T3VA 3FGUA 2Z1HA 4BRHA 3NGIA 4RW6A 1T6DA 1C0TA 2D0CA 2P9IB 3F9MA 4CZJA 4N47A 4CGFA 4QCLA 3QEIA 3AO4A 3OYGA 3MX5A 3OS1A 4O8KA 5LJWA 2AJQA 5K14A 3EY1A 3NFAA 5BPNA 2BGGA 5A2QO 1IBLK 1RTIA 4HUEA 2XY8A 1SV5A 3DWLA 1YXQA 2RPIA 2QW9A 2YHWA 3NH1A 1VQ4N 3D2EA 3U9ZA 4LC9B 4LFCK 1VSFA 5M1OA 4YOXA 3RR7A 1N36K 5AQYA 1ZYQA 4NO7A 3MECA 4CFAA 5MLCQ 3VQQA 4CBWA 5AQFA 4ILGB 2UXCK 2E8AA 3IG1A 4YNQA 5HLFA 1XI1A 4O5FA 3ZT1A 4LF4K 3NGYA 3F9KA 1JLAA 3S3NA 4FWQA 4FYDA 4K42A 1DTQA 4MQ3A 3V1QA 4MLEA 4W5OA 1HPZA 2HHVA 3H3OB 3MEDA 1Q7YO 5F0XA 4HCBA 3S3MA 3VF6A 3TWHA 2B6AA 4JLHA 4PA1A 3R1XA 2WBNA 1B9DA 2FF6A 2P9KA 2FBXA 1XMQK 4M63C 4JS5A 5AQPA 3CPWM 3QNOA 5M1FA 4RCHA 4KRFA 1YTAA 5BRHA 3CCQN 1KAXA 3QMLA 2YKMA 3DYAA 3ID6A 4KHUA 4ELUA 4DHYA 1V4SA 3HVRA 1WSIA 3KLFA 3DLEA 1KLNA 4DU3A 1TGOA 3THVA 4JKHA 2HF3A 4DWIA 4DG1A 3O9SA 3D2EB 3AVBA 4E7LA 3O6WA 1WB9A 3CCLN 4OPKA 2RKIA 3OYNA 5JLHA 3ITHA 3B6PA 3MEGA 4FJGA 3DLBA 1FJGK 2DPNA 1C1CA 1NGHA 2HBLA 3AV9A
chains in the Genus database with same CATH topology
4YY3K 4JI4K 1J5EK 4DV5K 4JI1K 4CVNE 4B3TK 4K0KK 2UXBK 5LMNK 4DR6K 5FLXO 5A2QO 4X65K 1IBLK 1HNXK 2UUAK 4V19S 4JI6K 4LF7K 4AQYK 2VQEK 4LFCK 5AJ3K 2E5LK 3T1YK 1N36K 4LF8K 3OTOK 5IT9O 3T1HK 2UXCK 4X62K 3J81O 4LF4K 4DR1K 4LFBK 4NXMK 1N32K 4DR3K 5LL6Z 3J7AP 4JI8K 4LF6K 5IWAK 2UU9K 3JAMO 4JYAK 4YHHK 4JI5K 2UXDK 4LF9K 2VQFK 5BR8K 1IBMK 4DR4K 4LFAK 1HNWK 4DV0K 1XMOK 4DR5K 1XMQK 1XNQK 4JI2K 4JV5K 4NXNK 1N33K 4OX9K 4DV2K 4DR7K 4X64K 4LF5K 4GKKK 4KHPK 4JI0K 1N34K 4DUZK 1IBKK 2HHHK 4JI3K 1XNRK 4DV4K 2F4VK 4JI7K 4CW7B 2UUBK 1HNZK 4B3SK 3J7YP 4DR2K 1I94K 4GKJK 4B3RK 4DV6K 1HR0K 2UUCK 3J80O 4DV1K 4B3MK 4X66K 1FJGK 4DV7K 4DV3K 5LMUK 4DUYK 2ZM6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 K;  4JI4 K;  1J5E K;  4DV5 K;  4JI1 K;  4CVN E;  4B3T K;  4K0K K;  2UXB K;  5LMN K;  4DR6 K;  5FLX O;  5A2Q O;  4X65 K;  1IBL K;  1HNX K;  2UUA K;  4V19 S;  4JI6 K;  4LF7 K;  4AQY K;  2VQE K;  4LFC K;  5AJ3 K;  2E5L K;  3T1Y K;  1N36 K;  4LF8 K;  3OTO K;  5IT9 O;  3T1H K;  2UXC K;  4X62 K;  3J81 O;  4LF4 K;  4DR1 K;  4LFB K;  4NXM K;  1N32 K;  4DR3 K;  5LL6 Z;  3J7A P;  4JI8 K;  4LF6 K;  5IWA K;  2UU9 K;  3JAM O;  4JYA K;  4YHH K;  4JI5 K;  2UXD K;  4LF9 K;  2VQF K;  5BR8 K;  1IBM K;  4DR4 K;  4LFA K;  1HNW K;  4DV0 K;  1XMO K;  4DR5 K;  1XMQ K;  1XNQ K;  4JI2 K;  4JV5 K;  4NXN K;  1N33 K;  4OX9 K;  4DV2 K;  4DR7 K;  4X64 K;  4LF5 K;  4GKK K;  4KHP K;  4JI0 K;  1N34 K;  4DUZ K;  1IBK K;  2HHH K;  4JI3 K;  1XNR K;  4DV4 K;  2F4V K;  4JI7 K;  4CW7 B;  2UUB K;  1HNZ K;  4B3S K;  3J7Y P;  4DR2 K;  1I94 K;  4GKJ K;  4B3R K;  4DV6 K;  1HR0 K;  2UUC K;  3J80 O;  4DV1 K;  4B3M K;  4X66 K;  1FJG K;  4DV7 K;  4DV3 K;  5LMU K;  4DUY K;  2ZM6 K; 
#chains in the Genus database with same CATH topology
 3LM9 A;  5BN8 A;  3C6T A;  4EHT A;  1GLJ O;  1P90 A;  4CF0 A;  4B08 A;  3K0S A;  3CC2 N;  2YHA A;  3MEE A;  2KW4 A;  5AQH A;  3HSC A;  4CZG A;  4EZ6 A;  4N76 A;  2DTU A;  1LAW A;  3H08 A;  2QWP A;  4IJN A;  5DM6 L;  1NGA A;  2O8C A;  1KAY A;  1ASV A;  3D6R A;  4I7F A;  3O5B A;  3OHR A;  4E0D A;  3ZSZ A;  3CM6 A;  5HRO A;  1TYQ A;  4WQ5 A;  1XC9 A;  3UIQ A;  1Z6R A;  1N32 K;  3C6H A;  5DK5 A;  1NK5 A;  1KAZ A;  4YDU C;  4XH4 A;  4BDZ A;  5IWA K;  2UU9 K;  2WOM A;  2YNH A;  1OVQ A;  3E1Y A;  3I8D A;  4CF9 A;  1M1K O;  3LAN A;  1VSJ A;  3RWU A;  4J2D A;  1HRH A;  2YI1 A;  4H0P A;  4O55 A;  2YNI A;  1ASW A;  1IG8 A;  5BR8 K;  4YOY A;  2HST A;  4YOT A;  2A6A A;  1HNW K;  1SKS A;  4JI2 K;  4A2B A;  1VQ8 N;  1XWL A;  4O44 A;  4CJW A;  2RE2 A;  1F21 A;  3GE1 A;  1HUX A;  2VG5 A;  4MDB A;  2X74 A;  3QNN A;  2GUI A;  3MK6 A;  1LWF A;  3NH0 A;  4OPA A;  3F73 A;  1Q86 O;  2FLO A;  4BE0 A;  3LDQ A;  3TTF A;  4CJQ A;  3LL3 A;  3QET A;  3AVH A;  4KTZ A;  1VQP N;  3CC7 N;  2IIR A;  5GAE P;  4DB3 A;  1HNZ K;  3U4L A;  4M41 A;  1RT4 A;  4K8X A;  3E01 A;  4KHS A;  4MO5 A;  1I94 K;  4KHW A;  5AR0 A;  4NCA A;  3BGR A;  4DTS A;  1YHQ N;  2ZJQ L;  3RMD A;  5HRP A;  1ESV A;  1X1P A;  3SQ4 A;  3S3O A;  3C7N A;  4DFJ A;  3O1W A;  4B3T K;  1L3V A;  3GOI A;  1ZBF A;  1VSE A;  4IJA A;  1TKD A;  1WAF A;  5AQN A;  4CJP A;  2A40 A;  3SUN A;  1WBD A;  2XY6 A;  5BRF A;  4DSK A;  3PO5 A;  4OGC A;  2HHX A;  3L3V A;  4JI6 K;  1GOC A;  4ZTJ A;  3MXJ A;  1WSG A;  4JNE A;  4FJH A;  2YJE A;  3ULE A;  3UKR B;  3H45 C;  5KGX A;  5IT9 O;  3CME N;  1KC8 O;  2ZQB A;  1GOB A;  4B9L A;  4KHQ A;  4FK4 A;  1VQM N;  3QB0 A;  1Q9Y A;  3EE8 A;  2QWO A;  3VQ5 A;  3L2R A;  3LP3 A;  2VGM A;  3O9Q A;  2JWL A;  3CCM N;  5LL6 Z;  3OW2 M;  5AQG A;  4JKA A;  2XY5 A;  3JAM O;  2EWS A;  4BRN A;  3IKM A;  1KQS M;  1RDA A;  2Q0U A;  5FRN A;  4JAX A;  3E9P A;  1IO2 A;  4DQR A;  4DTU A;  4RG8 A;  4GV6 A;  1XC3 A;  2G8W A;  3WQT A;  4IO8 A;  2O8D B;  4F8R A;  4L3Q A;  1QVF M;  5HBM A;  1CLQ A;  1QQN A;  4Q0B A;  1N33 K;  1VQL N;  3HP9 A;  2QEX N;  3DXK B;  3M8S A;  3SQ0 A;  1ILY A;  1J6Z A;  1K6Y A;  2NRW A;  3O4N A;  5JS2 A;  3VQ6 A;  5C0Y A;  1C0F A;  3SV3 A;  2HHH K;  2KZM A;  3D2F A;  3T7Z A;  4YFU A;  4GMJ B;  4CD3 A;  2DFE A;  4IEE A;  4BVP A;  1KVB A;  4CW7 B;  4KV8 A;  3A8Y A;  3KLG A;  1D9D A;  3ULE B;  1GLL O;  4B9Q A;  3SUP A;  4KHN A;  3OBY A;  3CG7 A;  1HQU A;  4B3R K;  3VTI A;  2FC0 A;  1D5A A;  1DGK N;  2Z1J A;  3C95 A;  4LSN A;  3J80 O;  2YHB A;  2GUP A;  4CER A;  3OYC A;  2YHX A;  1DTT A;  1B9F A;  2NUB A;  1BQN A;  4DV3 K;  4YY3 K;  3QIO A;  1NLV A;  5LY3 A;  4OPJ A;  4IG3 A;  3CHW A;  5HRS A;  4BRM A;  4KB0 A;  3M8R A;  4K41 A;  4IWV A;  1U45 A;  1NK4 A;  2NRH A;  1BIU A;  4BDP A;  1S6Q A;  3WXL A;  4JD2 A;  2HNY A;  3EKS A;  3PSF A;  5B8H A;  1NGJ A;  1HJO A;  3QBW A;  3OJU A;  3SQ1 A;  3K58 A;  4B9N A;  3SNN A;  5AQU A;  5C24 A;  1W2B M;  4LF8 K;  3QFU A;  3VPZ A;  4JS4 A;  4FVU A;  4U7B A;  1TUY A;  3A2F A;  1BA0 A;  3CCJ N;  3AO5 A;  4E7J A;  1VQN N;  3QIC A;  4RTF D;  1LWE A;  3AVK A;  3KVG A;  3QER A;  3DLK A;  5HP1 A;  2OPP A;  4JKC A;  1L5U A;  5FPE A;  3J7A P;  3ZYY X;  1JLQ A;  3K5L A;  4WCE L;  3SZ2 A;  1T03 A;  5FPM A;  1FK9 A;  2G8K A;  4EIA A;  4FK2 A;  3KKR A;  4FWN A;  2QWL A;  1K8A O;  3EKU A;  4CEQ A;  4ZTF A;  3CCS N;  4JHD B;  1RTH A;  3HBT A;  1IBM K;  3TAB A;  1ZXO A;  1TKZ A;  4LFA K;  1OVY A;  5EXW A;  5TKW A;  2QWQ A;  1NK6 A;  2ITG A;  3VEN A;  4H5V A;  5E41 A;  4ID5 A;  4FOI A;  3ATU A;  1CXQ A;  3O4Q A;  4BGA A;  3ASM A;  2LSN A;  4O0I A;  1VQ7 N;  4BRQ A;  5GAD P;  2W6L A;  3EE9 A;  3SMP A;  3H1Q A;  5CY4 A;  5GIN A;  4Z4E A;  1C1B A;  1QZ5 A;  2UUB K;  4M3X A;  3EN9 A;  2NRZ A;  3DOK A;  3H1V X;  4H5R A;  3CFP A;  4OKE A;  4FLZ A;  2HMI A;  4ICL A;  2ZGY A;  1JL2 A;  2GEM A;  4JKG B;  2E88 A;  4BRK A;  4FJ9 A;  4BVO A;  1RBR A;  1HKG A;  2A3Z A;  4B1Z A;  2D0B A;  4FSV A;  2OPQ A;  1RDC A;  2ETJ A;  1GLB G;  3M1F A;  5C42 A;  4DV5 K;  3LP1 A;  5LJV A;  3L8B A;  4CIG A;  3M6G A;  2RHK A;  4DR6 K;  5M1Q A;  4H0V B;  2PYL A;  2W42 A;  3SPY A;  4DTP A;  4DKW A;  2HMP A;  3VN5 A;  1QTM A;  2OAN A;  4IZ9 A;  3JYT A;  1WSF A;  2F9T A;  4E1J A;  3C6U A;  1NJW A;  1SUQ A;  4CE9 A;  4CFC A;  3PSI A;  3TPQ A;  4JKB A;  1G15 A;  3P4I A;  3WXJ A;  1X9M A;  4LFB K;  4ILH A;  4PKI A;  1RT5 A;  4BE1 A;  3LDS A;  2KTQ A;  3M8Q A;  5KPT A;  3NDK A;  3HK2 A;  3IRX A;  5GIP A;  1QE1 A;  4N5S A;  4J2A A;  3L4Q A;  4M45 A;  3ENH A;  1C0U A;  2P9N B;  3PX4 A;  2P9U A;  5F2R A;  1ASU A;  1T05 A;  2O8E A;  3O3F A;  4CZI A;  3O3H A;  5C15 A;  2D0P A;  1TK8 A;  3OYK A;  3T69 A;  1XNQ K;  3SK3 A;  3L2U A;  3ATV A;  3NF8 A;  2QKK A;  2OZS A;  4U67 L;  3ZX3 A;  1LCU A;  2XY7 A;  2FBV A;  2HHQ A;  4C8O A;  3OY9 A;  2G8V A;  5E26 A;  4JI0 K;  1OH8 A;  1LW0 A;  4FOE A;  1HYV A;  4FLX A;  2P9L B;  3HOT A;  4FO0 A;  4A2A A;  3CER A;  4BGB A;  4FLT A;  1B92 A;  3OYJ A;  1D9F A;  1NGB A;  4WFA L;  1RBT A;  3IAY A;  2WUS A;  3DJC A;  4LH4 A;  3O9U A;  2A1R A;  4DV6 K;  4FJ8 A;  4CIE A;  4X66 K;  3V6D A;  4I9L A;  2ZJP L;  1SL2 A;  3WNF A;  4EP5 A;  1ZBS A;  3HOS A;  3LZI A;  1Q18 A;  3OYI A;  3VQ9 A;  4HWI A;  4OO1 J;  4M3R A;  4CI6 A;  3FR0 A;  3ZLJ A;  2P5G A;  3HPG A;  1U48 A;  3HI0 A;  3FZM A;  1VQ6 N;  1VSH A;  3O4W A;  1U2V A;  3RTV A;  4LF7 K;  1NWK A;  1BGX T;  4WE1 A;  3TAQ A;  4FJ5 A;  4GNI A;  4DSF A;  1SS6 A;  2O8F B;  4CJ3 A;  1TL1 A;  1J9A A;  5AQT A;  4O5B A;  4C1N K;  1U49 A;  4HHT A;  3SYZ A;  3HST B;  2JWK A;  3PY8 A;  5J1E A;  3HT3 A;  1HJR A;  2YKN A;  4NXM K;  3AGR A;  4A57 A;  3SBG A;  3WXI A;  2XRI A;  3THX B;  4JN4 A;  4AHV A;  2HBK A;  5EY4 A;  1X9J A;  1RTD A;  2OA8 A;  3VQ7 A;  3L2Q A;  4KI6 A;  4Z4F A;  1NJY A;  1X3N A;  1BL3 A;  2UXD K;  4IFV A;  3G0Z A;  3VES A;  4UY8 O;  3HP6 A;  1N8R O;  2QI2 A;  3AVI A;  2GX9 A;  1YIJ N;  4DR4 K;  3OYF A;  3FFK B;  4DV0 K;  4FZX C;  4BR9 A;  3HL8 A;  3VQA A;  4JV5 K;  4DV2 K;  4KH4 A;  4CEA A;  3ID8 A;  4CK1 A;  4AM7 A;  2A41 A;  4CF1 A;  2FSK A;  5AQO A;  4IKF A;  4FWM A;  1U6Z A;  1LOT B;  1JLG A;  1A5W A;  4OLB A;  2G8I A;  1IBK K;  1U2V B;  2VG7 A;  4IOX A;  1C0M A;  3WNH A;  4FPB A;  2NZT A;  2O4G A;  1L3U A;  4BE2 A;  4AM6 A;  1BU6 O;  3QBX A;  3P5J A;  1S72 N;  2NRR A;  5C25 A;  3AGK A;  5BPL A;  1GLE G;  1XHZ A;  1JL1 A;  3KK1 A;  4DQS A;  3P83 D;  3A5O C;  3C65 A;  1N6Q A;  4DUY K;  3VEV A;  4GW6 A;  3FZK A;  1DLO A;  3OVN A;  4FPA A;  1IKY A;  4FWK A;  2G8U A;  3E9O A;  4Z4I A;  5AQR A;  1ZBH A;  1VRU A;  3ZT0 A;  3TSU A;  1YJ9 N;  2GWJ A;  2FSJ A;  3HYF A;  4JEP A;  1K73 O;  4BDY A;  1Q81 O;  4PL8 A;  3OYL A;  4FJ7 A;  2A5X A;  4FXD A;  4XIU A;  4B9V A;  3OYB A;  2E5L K;  2ASP A;  3P1G A;  4YOR A;  5GAH P;  3QEX A;  2QA4 N;  1JXE A;  2HB5 A;  5BRD A;  4B9M A;  3KK2 A;  3GL1 A;  3L2V A;  4A61 A;  4E7K A;  2YHY A;  2YJF A;  3NHG A;  3HVT A;  2F8S A;  4FW1 A;  3O1B A;  3P39 A;  3OBW A;  4A5A A;  2OPR A;  4O4G A;  2HND A;  3OYH A;  4AH9 A;  1X9W A;  1GLD G;  1VAZ A;  4TSX A;  4FLV A;  3EEQ A;  5AZI B;  3CM5 A;  3WNG A;  2KZZ A;  3CF5 L;  4HVJ A;  1VSL A;  1NGE A;  4DLG A;  4KB1 A;  1NOY A;  1J54 A;  4KAZ A;  4E1N A;  3OYE A;  2O4I A;  1WAJ A;  2Q1N A;  4FVM A;  1IKW A;  2VWJ A;  2Y1J A;  3N4Q A;  3M8P A;  1HKC A;  1N34 K;  5D3G A;  3CJA A;  4CJ7 A;  4DSE A;  1YUW A;  1K9M O;  3LWL A;  4QOZ B;  2XHB A;  2PZS A;  4DFP A;  2RN2 A;  4B3S K;  1TL3 A;  1C6V A;  3UKR A;  5KRT A;  4HCC A;  2O8B A;  3KWG A;  4DV1 K;  4CGD A;  3TAF A;  5ADX A;  3K5N A;  4GV9 A;  2D0A A;  1VSK A;  5I42 A;  4M7Y A;  4DS5 A;  1SKR A;  4EZ9 A;  3MXM A;  4H8K A;  4JI1 K;  5GAG P;  2ASO A;  4XH5 A;  3O9T A;  4MO4 A;  1BOT O;  4CED A;  4B9T A;  3TAP A;  1EX4 A;  4K25 A;  3MN7 A;  4I2Q A;  1T7P A;  2D0O A;  4IFE A;  2O8D A;  3Q7C A;  1RBS A;  2Q97 A;  1E4F T;  4NYN A;  1I3A A;  3CIP A;  4CHO A;  3SUO A;  3JS6 A;  1DKG D;  3DXK A;  4ISE A;  4C8N A;  5AFU H;  3DI6 A;  4BAC A;  3O8M A;  3MCP A;  4I2P A;  4BC5 A;  2G8F A;  3KD5 E;  2H3G X;  4PQU A;  1VHX A;  4BRP A;  4DSL A;  4JKF A;  3R3L A;  2F8T A;  3CXC M;  3DMJ A;  4JKE A;  4CFD A;  4Z0U A;  1ZBI A;  1E4G T;  3BP8 A;  2P5O A;  4OLA A;  1CZB A;  4A62 A;  5M1P A;  3R8E A;  2I7N A;  3GG4 A;  1NGD A;  4CK3 A;  4LD0 A;  2O8B B;  2QK9 A;  3VGK A;  4JK8 A;  4PUO A;  2ASM A;  1HKB A;  1HMV A;  1NOZ A;  4B1W B;  4DR7 K;  4J2E A;  3LDP A;  3FZH A;  4QS7 A;  2QKB A;  4E89 A;  1WSJ A;  4QAG A;  2V51 B;  1TUU A;  3L3U A;  2DFF A;  1LW2 A;  1HYS A;  3V1R A;  2HBM A;  4CF8 A;  1QSY A;  4BR4 A;  1QSS A;  3AA5 X;  2ITM A;  4YOU A;  2PFU A;  3QIP A;  4OJR A;  3TSQ A;  2WTU A;  2KFZ A;  3O9R A;  4H0O A;  2A42 A;  1JCG A;  3HJF A;  3V81 A;  2IAJ A;  4BG9 A;  5CZ2 A;  2YV0 X;  3WNE A;  1BI4 B;  3IDH A;  3L2W A;  1X3M A;  2F96 A;  4UQG A;  3AVM A;  3HPH A;  1RBV A;  3V9Z A;  5LMU K;  2E6L A;  4WQ4 A;  3CCV N;  3G10 A;  5CHI A;  2GEL A;  1BIZ A;  1WOQ A;  2VGN A;  1REV A;  3RMB A;  1EET A;  3OYA A;  2A1S A;  2ZF5 O;  3T3F A;  5KQ8 A;  2UXB K;  1VK0 A;  3NF7 A;  4F4K A;  4QS8 A;  3BUZ B;  4FLW A;  4O8U A;  2W40 A;  4E7I A;  4JHD A;  5J2Q A;  1K8K A;  1WLJ A;  1EKE A;  3VTH A;  1YI2 N;  1XQS C;  1IH7 A;  2X78 A;  3G71 N;  4FJN A;  4CJU A;  4BRO A;  3AVL A;  1A5X A;  3G25 A;  4IBN A;  1KTQ A;  3K59 A;  3U3G A;  2IGI A;  4NLB A;  3T1A A;  1ZBL A;  3THY A;  1RDB A;  4XH1 A;  4CZK A;  2B4J A;  3EZW A;  3TAR A;  4M3T A;  4IOC L;  3KLE A;  2HW3 A;  4DR3 K;  1CZA N;  3DLL L;  3ZSY A;  4DF8 A;  1QQO A;  4AIL C;  4LF6 K;  1RNH A;  3TU5 A;  5AQK A;  1SZ2 A;  5HRR A;  3LPU A;  4ID1 A;  4E19 A;  4LF9 K;  3ZEU A;  2D1K A;  4ZHR A;  4YOW A;  4JK9 A;  2VQF K;  3OJS A;  4AF1 A;  2WC9 A;  2Q36 A;  2WFB A;  3CET A;  5FDL A;  3ZCM A;  4DSI A;  1KXP A;  1RDD A;  4CZE A;  4CF2 A;  4M3Z A;  2F9W A;  4PY5 A;  4JKG A;  1WN7 A;  4LSL A;  3O3G A;  1RT3 A;  4FL9 A;  3BY5 A;  2ZGZ A;  3QEV A;  4BRC A;  5AZJ A;  4RW7 A;  4W5R A;  4IXC A;  1HQE A;  1UAX A;  2PY5 A;  3MX2 A;  3ZT4 A;  2HF4 A;  1YVU A;  4ILJ A;  1A5V A;  3FZL A;  4CHZ A;  1WSE A;  1XNR K;  3RSE A;  3SMS A;  2NRV A;  1IKV A;  1HYZ A;  1MWK A;  2NNW A;  4JI7 K;  3AAP A;  1K8K B;  4H0Y B;  4BR5 A;  2P51 A;  3OYM A;  1TK5 A;  4WQ5 C;  3ZET A;  3V9U A;  4BRL A;  1X9S A;  4FM0 A;  1EXQ A;  2VWB A;  4MFB A;  3CQ8 A;  1QQC A;  3N4P A;  4GVM A;  4ISG A;  3THY B;  4DV7 K;  1UA1 A;  2JLE A;  5AQI A;  4DMN A;  2E2P A;  4CBU A;  3O08 A;  3VEW A;  1S5J A;  5BRE A;  3G6E N;  3TTC A;  3AVN A;  3HTV A;  4BRF A;  2XO7 A;  4CHQ A;  3PLA A;  1KVA A;  2NLX A;  3SQ2 A;  4HUF A;  3ZEU B;  1TAU A;  5FLX O;  4CGJ A;  2UUA K;  2P9N A;  3DRR A;  4CZL A;  1VRT A;  3C0B A;  1KSP A;  5KI6 A;  1W9H A;  2QWR A;  4BRI A;  3QIN A;  4EFH A;  5M1N A;  3FZF A;  4DQI A;  5J2N A;  3NF6 A;  3T1Y K;  3NGZ A;  5J2M A;  1JJ2 M;  4WF9 L;  1EO1 A;  3EZ5 A;  5AQX A;  4X62 K;  3LPT A;  5AZJ B;  4B1U B;  4OKJ A;  4B8A B;  4XEI A;  3AVJ A;  5AQS A;  3TSP A;  2P9L A;  3F5T A;  2E4L A;  3RSE B;  4WFN L;  3I33 A;  3CMA N;  4YHH K;  4AHS A;  3AY9 A;  5KQD A;  4PL7 A;  4FM2 A;  1TK0 A;  3HM9 A;  5KTQ A;  3ZET B;  3LAL A;  1HNV A;  5C10 A;  3NBP A;  1NJZ A;  4KI4 A;  2Q31 A;  1TVR A;  2ZWH A;  4CEE A;  3DM2 A;  3VEZ A;  4NXN K;  1ZBU A;  2YCH A;  3K2P A;  2ZJR L;  4M42 A;  4CGI A;  4Z94 A;  5C2F A;  3AO1 A;  4FW2 A;  1XUP O;  5J2P A;  3CJ9 A;  5TKY A;  4JI3 K;  4R79 A;  3VA3 A;  4DV4 K;  1S1T A;  4DSJ A;  4EP4 A;  1KCF A;  2HHW A;  3CI5 A;  4F3T A;  5HRN A;  4FJI A;  3IS9 A;  3SCX A;  1NG9 A;  2O8F A;  1Q82 O;  1O13 A;  3ZSR A;  4B3O A;  2NRX A;  1OH5 A;  3BZK A;  3B6O A;  4NB4 A;  3MMV A;  3KHY A;  2IOC A;  2OCE A;  3THX A;  2IVO A;  2E20 A;  3VMF B;  1O1W A;  3DOL A;  3L0Q A;  4Y0W A;  3LDL A;  3K9J A;  3VF2 A;  3U8X A;  2E1Y A;  4IG0 A;  3BZC A;  5KPZ A;  2NRT A;  1JLF A;  4AQY K;  1LAV A;  2VWK A;  4BRE A;  2BDP A;  3VET A;  3V9W A;  2HHT A;  2OTJ N;  3OS2 A;  3C94 A;  1RDU A;  3FLC O;  4CJ5 A;  3CC4 N;  1L3T A;  3DLR A;  1Z25 A;  3HM8 A;  4BRG A;  3ZT2 A;  3NCI A;  3A5M C;  1RDW X;  4I6M B;  5ADX H;  2ZD1 A;  1VQ9 N;  2CGK A;  2Z1G A;  2Q0R A;  3J81 O;  4KO0 A;  3QLH A;  1JLE A;  3BF1 A;  3RMA A;  4B9S A;  2HHS A;  5ELZ A;  4C8L A;  1HX1 A;  1XHX A;  4Z4H A;  4CJS A;  1N5Y A;  4DTM A;  1VQO N;  4KKO A;  4JYA K;  1EWR A;  2PBD A;  3KIO A;  1QQM A;  3ENO A;  1YIT N;  4M3Y A;  1IV0 A;  2EHG A;  1S3X A;  4CFB A;  2PAV A;  5JVG L;  4FJK A;  2AA4 A;  1D8Y A;  4FJJ A;  3OA9 A;  3TI0 A;  4DFM A;  3KKS A;  4DR5 K;  5JIC A;  1S22 A;  2KLA A;  4CEF A;  4R5P A;  4DLE A;  3KLH A;  1CXU A;  3D7E O;  3OS0 A;  2KHO A;  3CJ7 A;  4DTN A;  3JSM A;  3EO3 A;  4GKK K;  3J8A A;  1MDU B;  2X6S A;  1RTJ A;  3VER A;  4BRD A;  3CCE N;  4WYB A;  1ATR A;  4N41 A;  3WXM B;  3L4I A;  2Q2R A;  1GOA A;  4IDH A;  3NE6 A;  3SLC A;  3J7Y P;  1KFD A;  3DRS A;  1NBW A;  1SQK A;  3TAE A;  1HLU A;  2GWK A;  1HPM A;  2V7Z A;  3L6Q A;  4IOA L;  1FKO A;  5SWM A;  4HTU A;  3V1O A;  1UOC A;  1NNE A;  5EX5 A;  2I5J A;  4DFK A;  1NJI O;  4JI4 K;  1GLA G;  1HNI A;  4OGE A;  3QO9 A;  3AO3 A;  4DTO A;  5M1K A;  4K0K K;  5LMN K;  3J7Z O;  4CJR A;  5AZI A;  1JCE A;  3UKU B;  4PHT X;  4CGG A;  4H0X B;  2KQ2 A;  4C8K A;  4W5Q A;  1BDG A;  3CYM A;  3MCA B;  4O0J A;  4CZF A;  4KPY A;  3MWT A;  3R9P A;  4IDK A;  4BQZ A;  5FRO A;  1NK8 A;  3NVM A;  5AJ3 K;  5AQV A;  3D45 A;  1NJX A;  2QXF A;  1C0G A;  1VQ5 N;  1NK7 A;  4M7X A;  3SPZ A;  4CEO A;  3ENB A;  2FF3 B;  1G99 A;  4B1Y B;  5CYM A;  1NGI A;  3A0I X;  2YX6 A;  4L8R B;  3TTD A;  3CQX A;  5I3U A;  4JI5 K;  3GDQ A;  1QHT A;  2I7P A;  4BR2 A;  3PV8 A;  3JXU A;  2GBZ A;  4CEZ A;  4CZM A;  1WUA A;  3NH2 A;  4HUG A;  4B9U A;  3BEX A;  3AVF A;  3P31 A;  3E66 A;  4NCG A;  3A5N C;  3LDN A;  3AVA A;  5FRM A;  4JK7 A;  1FKP A;  1XMO K;  3ZSW A;  2J4R A;  1FW6 A;  4Y1D A;  3KZB A;  2KFN A;  4CEB A;  4KBO A;  4W5T A;  4DTR A;  3RR8 A;  3V9S A;  1IJJ A;  3ZSO A;  4F9O A;  1R59 O;  2UYT A;  2BE2 A;  1ZC6 A;  4GY2 B;  3RRH A;  4BR7 A;  1Y64 A;  4BC3 A;  5AQW A;  3M3Z A;  4CJL A;  3KWI A;  3H3N O;  3DXM A;  4ISF A;  1BO5 O;  3CJ1 A;  4BQL A;  1KVC A;  3WQU A;  1J53 A;  1NGF A;  2QXL A;  3R6M A;  2YNF A;  1JXB A;  2P9P A;  3LWM A;  4DQP A;  3LDO A;  3KK3 A;  3MN6 A;  3IFR A;  3P38 A;  2UUC K;  3MDQ A;  1NU0 A;  4BR0 A;  1MWM A;  5EOY A;  2P9K B;  3K5O A;  1NKE A;  3AVC A;  1BQM A;  2IVP A;  5AQZ A;  3HPO A;  1OKJ A;  1KFS A;  1J5O A;  2HNZ A;  5KRS A;  4FWR A;  1S1X A;  3UE5 A;  3IMX A;  3VGM A;  4AHU A;  3W3D A;  2Y1I A;  4N56 A;  4LH5 A;  4K8Z A;  2FBT A;  3HZ6 A;  3E9L A;  5T7B A;  4JKD A;  1BHL A;  4CJ4 A;  5I9E B;  4CEC A;  4RW4 A;  5CR4 A;  3MAQ A;  4RWT A;  1EP4 A;  3AO2 A;  1RIL A;  4C23 A;  3F2K A;  3THW A;  1S9G A;  3VQ4 A;  1YTU A;  4JRP A;  3ZT3 A;  4AHT A;  4EHU A;  4E7H A;  1NK0 A;  2B5J A;  3LZJ A;  3W0L A;  2V7Y A;  3FE1 A;  3WT0 A;  4FZY A;  3PX0 A;  5CZ1 A;  2DFH A;  1VSD A;  1E3M A;  2YNG A;  3DXM B;  4CJK A;  4QS9 A;  2OTL N;  4AHC A;  4GV3 A;  1QS4 A;  3D0P A;  2P9P B;  3I0R A;  3HO1 A;  5JLF A;  3KTQ A;  1BI4 A;  3QFP A;  3NMU A;  4Y1C A;  1ATS A;  4FJL A;  4FCY A;  3VEX A;  4H03 B;  5JMV A;  2E2O A;  2O8C B;  1KD1 O;  2P1J A;  3K9K A;  3U3Y A;  2D5R A;  1TAQ A;  1I39 A;  4LF5 K;  4KTQ A;  5HOO A;  2ATQ A;  4OVL A;  1YVN A;  1TYQ B;  2HOE A;  3ZX2 A;  5AQL A;  2P9S A;  4FWS A;  1S6P A;  1MA9 B;  3VQD A;  3C6A A;  1U4B A;  5BN9 A;  2F4V K;  3HXM A;  1RFQ A;  4B1X B;  3CFR A;  3RRG A;  4J2B A;  1RT7 A;  4AHR A;  3DAW A;  1C1A A;  1L3S A;  3V4I A;  1V4T A;  3CJB A;  3TAM A;  4CD1 A;  3AVG A;  1WBB A;  3WUH A;  3THW B;  3ZSQ A;  4CBX A;  1UA0 A;  2QWM A;  4GVE A;  1VSI A;  1GLF O;  3KJV A;  4KTW A;  1NGG A;  5JS1 A;  3ALY A;  2FSN A;  3K57 A;  1YJN N;  4G1Q A;  2HVH A;  3KD1 E;  3QDK A;  2IVN A;  3HRG A;  3I0S A;  4RW8 A;  1ITG A;  4CVN E;  4OKK A;  3BF3 A;  4BC2 A;  1KRP A;  4F2R A;  2HVI A;  1BWF O;  3SAH A;  2HHU A;  1YT3 A;  4BG8 A;  4HTL A;  3DRP A;  3SBT A;  4FWL A;  2VQE K;  2VCP A;  1YAG A;  3PUF A;  5EU7 A;  4Z4C A;  2E2Q A;  5KGW A;  4BC4 A;  1YJW N;  2HBJ A;  3U9D A;  3CJC A;  4CJE A;  1QSL A;  2CH5 A;  3UB5 A;  2IS3 A;  2FXU A;  4EAH D;  4DR1 K;  4FJX A;  4NYF A;  1EQY A;  4FZZ A;  1S1W A;  2E2N A;  1SKW A;  2P9S B;  3KK7 A;  3C7N B;  3ULD A;  3ISN C;  4IEI A;  2AP1 A;  3TR8 A;  3G4S N;  3FFI A;  2QTD A;  3WXK A;  4B8C A;  3T19 A;  3SV4 A;  3IUC A;  1RGI A;  4WFB L;  5KPR A;  1UWB A;  1S1V A;  4DU1 A;  4CK2 A;  3I55 N;  1QVG M;  4KFB A;  2E1Z A;  4FLU A;  2EX3 A;  4PKH A;  1NM1 A;  1IG9 A;  2W6K A;  3MWP A;  1TKT A;  3AA2 A;  3OYD A;  1T8E A;  1BCO A;  4X64 K;  1SL0 A;  3I8B A;  3CCR N;  1QZ6 A;  4F2S A;  3EYZ A;  4FWO A;  1NKB A;  4FM1 A;  4NCB A;  2VYP A;  3VQB A;  4I9Q A;  3ZX0 A;  4F3O A;  3GBT A;  1NMN A;  1Q8I A;  3LP2 A;  1M90 O;  3H6E A;  1JCF A;  4DTX A;  4CES A;  2IDO A;  4IFY A;  2BH1 A;  4JRQ A;  1BUP A;  3H46 O;  1HR0 K;  1QHA A;  4DQQ A;  4B3M K;  3TAN A;  4CJT A;  1SL1 A;  2KKZ A;  3LAK A;  1YF5 L;  3NVK A;  2RF2 A;  4LY7 A;  2W41 A;  3MN5 A;  2OYQ A;  1ATN A;  5F1X A;  4W5N A;  3D2F B;  4CGH A;  3CCU N;  3PIP L;  4C1N I;  1NGC A;  5BPM A;  1OH7 A;  1RT1 A;  5SZT A;  2DY4 A;  1EWQ A;  3SAF A;  4ELV A;  3VF4 A;  3BDP A;  2IC3 A;  4BWM A;  4E3S A;  2QWN A;  3CPE A;  2F7T A;  3T1H K;  3S9H A;  3MN9 A;  4M3W A;  3K5M A;  4CJV A;  1OH6 A;  4NLC A;  3TAG A;  1RCH A;  4BWJ A;  2ZE2 A;  3QES A;  2CH6 A;  5HL7 L;  3VA0 A;  4H4M A;  3SJJ A;  4DF4 A;  4Q5V A;  2BTF A;  3KLI A;  4DS4 A;  4CIF A;  3VGL A;  4CHY A;  4JD2 B;  3VOV A;  4CZH A;  1Z26 A;  2X6N A;  1U47 A;  1LV5 A;  1RBU A;  5JVH L;  1DEJ A;  3SAG A;  4OX9 K;  4K43 A;  4CHN A;  2CGL A;  3RVC A;  1T44 A;  2OPS A;  5AFU A;  3QEP A;  2OZM A;  3B8A X;  2WON A;  5AQJ A;  4DUZ K;  4KH6 A;  1TV6 A;  3VQ8 A;  1FXX A;  2BUP A;  3LP0 A;  3SJH A;  4H5N A;  3VQC A;  3Q7B A;  1BCM A;  4H4O A;  4BY9 C;  1W0H A;  3CFO A;  1W7A A;  2Q3S A;  3MXI A;  4DCH A;  4MLH A;  4DR2 K;  2QM1 A;  4GKJ K;  3AA4 A;  1D4X A;  4ELT A;  4C8M A;  1JLC A;  2E6M A;  4G9Z A;  5FPN A;  3QEW A;  1R0A A;  4PWD A;  2BAN A;  3CQY A;  5FPD A;  4I6M A;  3O80 A;  1Q9X A;  5BR9 A;  1W97 L;  1NKC A;  4FWP A;  1WSH A;  2FBY A;  2ZM6 K;  1U04 A;  3AA3 A;  4OPH A;  5E84 A;  3LAM A;  4B1V A;  3U6F A;  1J5E K;  2D4W A;  4H0T B;  1S9E A;  1BA1 A;  3M5R A;  4MDA A;  1IKX A;  1Z05 A;  5EVZ A;  4A5B A;  4E1M A;  1T6C A;  3ZSX A;  1BIS A;  5GIO A;  3PX6 A;  4X65 K;  3WEE A;  2G8H A;  1HNX K;  4V19 S;  1VQK N;  4YDU A;  1NMD A;  1KLM A;  2V52 B;  3I56 N;  2VG6 A;  2R7Y A;  3PIO L;  4DU4 A;  3S41 A;  5DMR A;  3PO4 A;  3VEO A;  3OTO K;  4BRA A;  3SUQ A;  1RT6 A;  3V9X A;  5CE3 A;  1MU2 A;  4IO9 L;  1H1V A;  4KH5 A;  3VEY A;  3NAE A;  1NK9 A;  2P9I A;  1VSM A;  1P8Z A;  4CCH A;  1S1U A;  4Z4G A;  4JI8 K;  4CHP A;  4RW9 A;  3RMC A;  4FLY A;  3NF9 A;  5DM7 L;  1DT9 A;  5C12 A;  4KHY A;  4KRE A;  2PYJ A;  4A59 A;  1JLB A;  4FK0 A;  1LWC A;  3LM2 A;  4WQ4 C;  3SI6 A;  1CZ9 A;  1GLC G;  4CJF A;  4YOV A;  3EL2 A;  4M3U A;  3A5L C;  2GTD A;  3DLG A;  3VQE A;  5H1S Q;  1TKX A;  5C2D A;  2JGU A;  1RT2 A;  5CYQ A;  4KHP K;  3CD6 N;  2CGJ A;  4H5T A;  1JKH A;  1BG3 A;  4PKG A;  3UKU A;  3WEE B;  3VQP A;  5AQQ A;  4DQ8 A;  2GV9 A;  4DTJ A;  1WNS A;  4H5W A;  3DLH A;  4J8F A;  4FJM A;  3AAR A;  2Z1I A;  1Y97 A;  2P9U B;  3ZSV A;  5AQM A;  2O8E B;  1SAZ A;  3AAQ A;  1T3V A;  3FGU A;  2Z1H A;  4BRH A;  3NGI A;  4RW6 A;  1T6D A;  1C0T A;  2D0C A;  2P9I B;  3F9M A;  4CZJ A;  4N47 A;  4CGF A;  4QCL A;  3QEI A;  3AO4 A;  3OYG A;  3MX5 A;  3OS1 A;  4O8K A;  5LJW A;  2AJQ A;  5K14 A;  3EY1 A;  3NFA A;  5BPN A;  2BGG A;  5A2Q O;  1IBL K;  1RTI A;  4HUE A;  2XY8 A;  1SV5 A;  3DWL A;  1YXQ A;  2RPI A;  2QW9 A;  2YHW A;  3NH1 A;  1VQ4 N;  3D2E A;  3U9Z A;  4LC9 B;  4LFC K;  1VSF A;  5M1O A;  4YOX A;  3RR7 A;  1N36 K;  5AQY A;  1ZYQ A;  4NO7 A;  3MEC A;  4CFA A;  5MLC Q;  3VQQ A;  4CBW A;  5AQF A;  4ILG B;  2UXC K;  2E8A A;  3IG1 A;  4YNQ A;  5HLF A;  1XI1 A;  4O5F A;  3ZT1 A;  4LF4 K;  3NGY A;  3F9K A;  1JLA A;  3S3N A;  4FWQ A;  4FYD A;  4K42 A;  1DTQ A;  4MQ3 A;  3V1Q A;  4MLE A;  4W5O A;  1HPZ A;  2HHV A;  3H3O B;  3MED A;  1Q7Y O;  5F0X A;  4HCB A;  3S3M A;  3VF6 A;  3TWH A;  2B6A A;  4JLH A;  4PA1 A;  3R1X A;  2WBN A;  1B9D A;  2FF6 A;  2P9K A;  2FBX A;  1XMQ K;  4M63 C;  4JS5 A;  5AQP A;  3CPW M;  3QNO A;  5M1F A;  4RCH A;  4KRF A;  1YTA A;  5BRH A;  3CCQ N;  1KAX A;  3QML A;  2YKM A;  3DYA A;  3ID6 A;  4KHU A;  4ELU A;  4DHY A;  1V4S A;  3HVR A;  1WSI A;  3KLF A;  3DLE A;  1KLN A;  4DU3 A;  1TGO A;  3THV A;  4JKH A;  2HF3 A;  4DWI A;  4DG1 A;  3O9S A;  3D2E B;  3AVB A;  4E7L A;  3O6W A;  1WB9 A;  3CCL N;  4OPK A;  2RKI A;  3OYN A;  5JLH A;  3ITH A;  3B6P A;  3MEG A;  4FJG A;  3DLB A;  1FJG K;  2DPN A;  1C1C A;  1NGH A;  2HBL A;  3AV9 A; 
#chains in the Genus database with same CATH homology
 4YY3 K;  4JI4 K;  1J5E K;  4DV5 K;  4JI1 K;  4CVN E;  4B3T K;  4K0K K;  2UXB K;  5LMN K;  4DR6 K;  5FLX O;  5A2Q O;  4X65 K;  1IBL K;  1HNX K;  2UUA K;  4V19 S;  4JI6 K;  4LF7 K;  4AQY K;  2VQE K;  4LFC K;  5AJ3 K;  2E5L K;  3T1Y K;  1N36 K;  4LF8 K;  3OTO K;  5IT9 O;  3T1H K;  2UXC K;  4X62 K;  3J81 O;  4LF4 K;  4DR1 K;  4LFB K;  4NXM K;  1N32 K;  4DR3 K;  5LL6 Z;  3J7A P;  4JI8 K;  4LF6 K;  5IWA K;  2UU9 K;  3JAM O;  4JYA K;  4YHH K;  4JI5 K;  2UXD K;  4LF9 K;  2VQF K;  5BR8 K;  1IBM K;  4DR4 K;  4LFA K;  1HNW K;  4DV0 K;  1XMO K;  4DR5 K;  1XMQ K;  1XNQ K;  4JI2 K;  4JV5 K;  4NXN K;  1N33 K;  4OX9 K;  4DV2 K;  4DR7 K;  4X64 K;  4LF5 K;  4GKK K;  4KHP K;  4JI0 K;  1N34 K;  4DUZ K;  1IBK K;  2HHH K;  4JI3 K;  1XNR K;  4DV4 K;  2F4V K;  4JI7 K;  4CW7 B;  2UUB K;  1HNZ K;  4B3S K;  3J7Y P;  4DR2 K;  1I94 K;  4GKJ K;  4B3R K;  4DV6 K;  1HR0 K;  2UUC K;  3J80 O;  4DV1 K;  4B3M K;  4X66 K;  1FJG K;  4DV7 K;  4DV3 K;  5LMU K;  4DUY K;  2ZM6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...