2UUAK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uuaK00
1IBKK 4LF8K 4LF6K 1XNQK 3T1YK 4JI0K 1J5EK 4B3TK 4DV2K 4JI2K 3J81O 4JI4K 2UXCK 1N36K 1XNRK 1FJGK 4LFAK 1I94K 2UUBK 4DV1K 4GKJK 4DR6K 4DV0K 1XMQK 5A2QO 2UUAK 1HNXK 2UU9K 4DR1K 1IBLK 4DR4K 4GKKK 4JI8K 4LFBK 4DV4K 5FLXO 4LFCK 4JYAK 4LF7K 4OX9K 4CVNE 2VQFK 4B3MK 4K0KK 4JI6K 4DUZK 4X64K 3J7YP 4JI7K 4DV3K 4JI3K 4LF4K 1N32K 4DR2K 4JI5K 3J80O 3J7AP 5IT9O 1HNWK 1HNZK 4AQYK 1HR0K 4DV7K 2HHHK 4DV5K 5BR8K 5IWAK 2E5LK 4NXMK 4X66K 5LMNK 4X62K 4LF5K 4YHHK 2UUCK 1IBMK 4JV5K 1XMOK 2UXDK 4X65K 3JAMO 4LF9K 4NXNK 5LL6Z 2ZM6K 2UXBK 3OTOK 3T1HK 4CW7B 5LMUK 1N34K 4KHPK 4DV6K 2VQEK 4V19S 2F4VK 4B3RK 4DR3K 5AJ3K 4DUYK 4YY3K 4B3SK 4DR7K 1N33K 4DR5K 4JI1K
chains in the Genus database with same CATH superfamily
1KAXA 5T7BA 3QNOA 1LWFA 4Z4FA 1IH7A 1L3SA 1QHTA 2QWNA 4EHUA 1RDBA 1GOCA 4DMNA 5C12A 4B3TK 2JGUA 5ADXH 2OANA 4GV9A 4FJGA 3J8AA 1QHAA 2F9TA 2B5JA 2YNGA 3UKRA 2Z1JA 4DTNA 1RT4A 4JD2A 3WXMB 3MK6A 4IOAL 4FW2A 2QWOA 3LZIA 4F2SA 4NCAA 4IXCA 4J2EA 4DSKA 4FL9A 4DFKA 2IOCA 2CH6A 4BR5A 4CHOA 3AVNA 3VQ7A 4IOXA 4E7JA 4CZEA 1TAQA 4KRFA 1Q81O 1X1PA 1WN7A 3OYEA 3HBTA 2R7YA 1W0HA 1KFSA 2PZSA 1ATSA 4CF1A 3O3FA 4FWLA 1LWEA 3V9SA 2HNZA 4JK7A 4A5AA 4KHYA 1YVNA 3RTVA 4M42A 4GNIA 4IDHA 4JHDB 2A1SA 3LWLA 3NFAA 3BUZB 4CGHA 1BQMA 4RCHA 1ZBIA 5IT9O 3NH2A 2P9PB 5KRTA 4ISFA 3QBWA 3ZSXA 3Q7BA 2HHHK 5GIPA 3B6PA 3H46O 5IWAK 3EKUA 5M1OA 3OYFA 3HOSA 3VQCA 3QEWA 4KHNA 4CEZA 5J2QA 4BRGA 4BDPA 2EWSA 3NVKA 3K59A 2PY5A 4DB3A 4JK8A 4RW9A 3TPQA 3A5LC 1HNVA 1SAZA 2ZM6K 3OHRA 1YIJN 3CF5L 3VA0A 4YDUC 1BOTO 4FJJA 3VA3A 4IEEA 4OJRA 4ID1A 4DU3A 3I55N 4O0IA 1JCEA 2WC9A 1S1TA 2HHUA 4IOCL 2PYJA 4LD0A 4OPHA 3WXIA 4CGIA 1TUYA 4EP4A 3CCLN 2FBXA 1IBKK 1WNSA 4EZ6A 3TSQA 3QICA 1TYQA 4GVMA 3HVTA 3IRXA 3L4QA 3MXJA 4FPAA 2QEXN 1I3AA 3SQ1A 1N36K 4JKCA 3OYDA 5AZJA 2Z1HA 1X3NA 4DR1K 2Q3SA 1KAYA 3U9ZA 3V9UA 4DS4A 1BHLA 3OS1A 4JKEA 3KIOA 3KWIA 2ZJPL 4O44A 1S22A 3EE8A 3HT3A 5JS1A 2X6SA 3VQ8A 4FW1A 3CJAA 3BGRA 1KXPA 5KI6A 4BRHA 1WSIA 2XO7A 1JXEA 3H3OB 4RTFD 4JI6K 4DKWA 3DRSA 2E2PA 1DEJA 3VQEA 3TAPA 1W2BM 1YXQA 4ID5A 4FVUA 1L3UA 1DLOA 4FLZA 4BRIA 3B6OA 2I5JA 4MDBA 4FOIA 1RT2A 3SCXA 4YOUA 1RGIA 1YAGA 5M1NA 3KLHA 3MX5A 3ULDA 2HHSA 1HR0K 1T7PA 5AQSA 4FVMA 4CHZA 4WFNL 4LF5K 4MO5A 1BI4B 4YHHK 3G4SN 2O8FB 3C95A 3J7ZO 1NGBA 2V52B 3DWLA 3DXKA 5I9EB 2GUPA 2HBLA 3SUOA 1A5WA 3ENHA 1EWRA 2G8FA 4IJNA 2CGJA 1NBWA 5KGXA 3I56N 2ASMA 4DQRA 3M8PA 4M7XA 5AQKA 1SUQA 4F9OA 3RSEA 1BUPA 1O13A 1HYZA 1DTQA 3QERA 3ZSZA 2IAJA 5CZ1A 4H4OA 2JWLA 1L5UA 4YY3K 1KLNA 4B3SK 3UKUB 4LH4A 1UWBA 4Z4HA 1Q7YO 1UA1A 2W6LA 3G6EN 3RR7A 4FJKA 1K73O 3OYIA 4B9UA 2A5XA 5JLFA 1RTHA 5K14A 3HYFA 3BF3A 4JI2K 5EOYA 1HJRA 4MQ3A 5CYQA 3LAKA 5BR9A 2OTJN 1KSPA 2NRXA 1WSEA 3OY9A 4BWJA 4KI4A 1E4GT 4H0TB 3CFRA 1RBTA 4JN4A 1NJZA 3D0PA 1C1CA 3DJCA 3CM6A 4I7FA 3SBGA 4PA1A 3OYNA 1U2VA 2QI2A 3DXMA 4M3XA 3M8QA 4DS5A 3HSCA 3K5OA 3NF8A 3KLGA 4BC5A 3OS2A 1NK6A 2QKBA 4HWIA 1ITGA 3KLIA 1XWLA 3RMDA 2RHKA 4AHRA 1Z26A 4CJSA 1NK0A 4CZKA 4WCEL 5BN9A 3I8DA 2RKIA 4GMJB 5AFUA 3SMSA 4Z4IA 3A5NC 1KTQA 4N41A 2F9WA 4MLHA 3CC7N 2A42A 2G8KA 2OPPA 3FFIA 4XH1A 2QXFA 4CF9A 5AQNA 2NRVA 3WNHA 4DTOA 2X6NA 2E4LA 3L6QA 4B9MA 2VG6A 4DQQA 1MWMA 3LM2A 1TK8A 3LDQA 3KKRA 3AARA 5CZ2A 4JV5K 2O8EA 4CEOA 4CEQA 3RRHA 4NCGA 1BCMA 1NG9A 5EXWA 4ISGA 4XH4A 1HLUA 2NZTA 4CEAA 3C6UA 2O4IA 2FF6A 4M3TA 4B08A 3MMVA 2O8BA 4CI6A 3ZLJA 3IUCA 4Y1CA 2V7ZA 4PWDA 3SAFA 4DUYK 4FJHA 5KPTA 1XHXA 3FZLA 2DY4A 4OKJA 4FWSA 2P9KA 2F8TA 3HPHA 2FBTA 3IFRA 2BGGA 2GWKA 4WQ5C 2BANA 4LFAK 3MEEA 1D4XA 4M7YA 1TAUA 2VWJA 3C6TA 3VEWA 4DTXA 4DR6K 2FC0A 1X9WA 3SLCA 5A2QO 5JVGL 1ASVA 3DAWA 3M6GA 1L3TA 1Y97A 2LSNA 3KLEA 4JKBA 3R8EA 4FLVA 4OKEA 4CEBA 4CHPA 4CGFA 3ZSYA 4CD3A 1RBRA 2P9NB 1NNEA 4N56A 1NGFA 4WQ4C 2IGIA 3NBPA 1LW2A 3AY9A 3OBYA 3P4IA 3CXCM 2KTQA 3ZEUA 1JKHA 3PO5A 3SV4A 1T05A 4CZIA 4AHUA 1L3VA 2ASOA 3P5JA 3EY1A 4E7KA 4DUZK 1K8AO 4IFYA 4BRDA 4K25A 3OYMA 5J1EA 4MO4A 1KAZA 1Q9XA 4LF4K 1RBSA 1ZBFA 1J53A 3OYBA 4N76A 3O80A 3E9OA 1ZBLA 3H1QA 3VERA 1EETA 4BRNA 3AO4A 4CJRA 3MXMA 2IDOA 3TSPA 3LAMA 4BRPA 3PX6A 4Q5VA 2YHWA 3KD1E 1D9DA 3A5MC 2WOMA 3LM9A 2P5GA 3VQ5A 2D0AA 4CE9A 4ELVA 4H0VB 4WQ5A 4FM2A 3P38A 4J8FA 3DRRA 1GLBG 1RTJA 3N4QA 2RN2A 5FPEA 5JICA 4DV6K 4B9SA 2YHYA 3GG4A 4FOEA 5AQIA 4BE2A 4U7BA 1FKOA 4CIEA 3GOIA 4KAZA 1X9JA 1TGOA 1ZBUA 3AO1A 4CIFA 3G0ZA 2G8VA 5GAEP 2D1KA 4XEIA 1XC9A 3FE1A 5KRSA 5BRHA 4CERA 1QE1A 4H0XB 1WOQA 5M1FA 2QWLA 4FWRA 4BG8A 4CJ3A 3ZX3A 5BN8A 3LL3A 1QZ5A 1RILA 2WFBA 3CJCA 2CGLA 5DMRA 1Z05A 3CJBA 1KC8O 1HPMA 4JEPA 4DV4K 4H5TA 4FK2A 2V51B 3MN5A 5EY4A 5FLXO 4CFDA 3K57A 2P9IA 1JL1A 5AFUH 3QEPA 4ZHRA 3QDKA 3U3YA 2KZMA 3AO2A 5C25A 3HVRA 4M3UA 4X64K 3S41A 3NVMA 2KFZA 3CCMN 2O8DA 1GLDG 3WT0A 4DV3K 1WSFA 1OVYA 2BE2A 3D2FB 1QTMA 1OH5A 4B9NA 1Z6RA 1MWKA 3O9SA 3L2RA 3FLCO 2W6KA 4LSNA 1ESVA 3QETA 2Q97A 1RT7A 1RBUA 5AQPA 1JCGA 1SZ2A 1S72N 3AVIA 5FRNA 2E2QA 5AQTA 2BUPA 1D9FA 4BQZA 5C2DA 2DFFA 4DFMA 5DK5A 3SYZA 1U47A 3DYAA 3PIPL 3VQPA 1NM1A 3MWPA 2B4JA 4KKOA 1T44A 2YCHA 1EQYA 3U4LA 4QOZB 1IJJA 1NGIA 2DFEA 5HP1A 4JAXA 5AJ3K 1TL1A 3A8YA 5AQHA 5E41A 5AZIA 3SI6A 2J4RA 1G15A 1VQMN 2BDPA 1NK9A 2PYLA 3LANA 3T3FA 2P9SB 5TKYA 3R3LA 5CR4A 4DSEA 3O6WA 4PHTX 1MA9B 2ZF5O 4ELUA 1DGKN 4H5VA 3PIOL 5FPMA 1NK5A 2JLEA 1HNXK 3T1AA 5JS2A 1IBLK 4B8AB 1CZ9A 3F9MA 3KVGA 1RCHA 4HUGA 3H45C 3SZ2A 4A61A 4BC2A 4Q0BA 4IG0A 2FSNA 2F96A 3VQDA 4CJTA 5F0XA 3ZT3A 4EAHD 3PO4A 3VEOA 1C6VA 3O3HA 2D0PA 4LF7K 3PSFA 1Q9YA 1M1KO 5C15A 2NRWA 1C1BA 4B1WB 4N5SA 1NK7A 1XQSC 2QWMA 1YI2N 5E84A 4WYBA 4DSIA 1U45A 4NYFA 4O4GA 1SV5A 2Y1IA 4QCLA 3OJSA 5C0YA 3CCQN 1DTTA 3DMJA 2YNHA 1RTDA 3K9KA 1OKJA 5HRNA 2GELA 1VSIA 4M63C 4WFAL 5TKWA 2ZGZA 4F8RA 1HRHA 3BEXA 4Z4CA 1P90A 1SKWA 4NXMK 1C0TA 3CCVN 3ATUA 4B3OA 4C23A 4DQ8A 4CZLA 4LY7A 3TAMA 1NWKA 3TTCA 4Y0WA 2KHOA 3VF4A 4DLEA 4JHDA 3AVCA 4CF2A 4H4MA 4CZJA 2P9PA 3ID8A 4HCBA 1TK0A 4L3QA 1S6PA 4JK9A 3OJUA 4AH9A 4BR0A 1S1VA 2F8SA 3L2QA 1SQKA 2IS3A 1HYVA 2D0OA 1EKEA 2BTFA 4FJMA 4M3YA 3ULEB 1RT6A 2G8UA 4FJ9A 4K8ZA 4CJ7A 1JLQA 3VQ6A 2X74A 3FZHA 3WQTA 4BR7A 4DV2K 4CBWA 2IVPA 1MU2A 4DQPA 4OPAA 3JSMA 4FWKA 1JXBA 3QIOA 4CJWA 1NKCA 4CBUA 4BC3A 1XMQK 2ZGYA 3AVAA 2GUIA 3ZSQA 1BCOA 3C7NB 4FWPA 3CERA 5AQRA 4HTUA 5AQOA 4CEDA 4H0PA 2Q1NA 4OKKA 1KRPA 3K9JA 4QS7A 3U3GA 3BZKA 4BGBA 4CJPA 3EZ5A 1BA1A 3CI5A 3GE1A 3CCRN 4JYAK 5HROA 1GLCG 2HF4A 4J2DA 4ISEA 3ATVA 3KD5E 3V1RA 4F4KA 4H5RA 3SQ2A 2WUSA 2P51A 1WAFA 3VOVA 4CK3A 3WNFA 4QAGA 3D45A 1UA0A 3KK1A 1C1AA 4A2BA 2HSTA 4BRFA 2YNFA 3S3MA 1SKSA 3UB5A 3WNEA 1ASWA 3AA2A 4CFBA 4GY2B 1ATNA 4IDKA 4E1NA 4RWTA 2RE2A 5BR8K 1YJWN 1HQUA 4X62K 4FPBA 1Q82O 1VAZA 3QLHA 3HOTA 1NGEA 4CJQA 3LDOA 1GOAA 4FJXA 3WXLA 4DF4A 2WONA 3LDNA 4FLYA 4O5FA 1WBBA 3SMPA 3D2EB 1D5AA 4OGCA 4ELTA 5LY3A 4MDAA 1JLAA 1EX4A 3F2KA 1Z25A 3EL2A 3LWMA 1BG3A 4BRKA 4BR4A 2ZJQL 3HO1A 4DQIA 4DSFA 4H8KA 3VF2A 1OH7A 1NGDA 1S1XA 4DR7K 1BI4A 2IC3A 1BWFO 2O8FA 3RMBA 1Y64A 3ENBA 4U67L 4LF6K 2G8WA 1NK8A 3T1YK 3LP3A 2HMPA 1VK0A 3THYB 3THVA 3MECA 1WSGA 4EIAA 5HL7L 3MN7A 5KQDA 3AVMA 2JWKA 3VQ9A 4JRPA 5B8HA 3SJHA 1NJIO 1ZC6A 5LJVA 3SK3A 3V9WA 2O8CB 3NGZA 2WBNA 1YJNN 3UKUA 4EFHA 2GEMA 4CJ4A 3LPTA 1Q8IA 5HRSA 4YFUA 3O1WA 4ILGB 4IKFA 4FZYA 1VSHA 3E01A 4FWQA 5J2PA 4BRLA 2VQFK 1JLEA 4FJ5A 3CJ9A 1NJYA 3ZETB 3O4QA 3HPOA 1BL3A 1LOTB 3LP1A 1TKXA 4QS9A 3TAGA 1NU0A 2Y1JA 2A41A 3Q7CA 2KZZA 1NMNA 3ZCMA 4CF8A 3LDPA 3DOKA 4YOWA 2VWBA 5M1PA 4ICLA 2HVHA 3JS6A 4JI5K 1JLCA 1JCFA 4I6MB 4GVEA 3A0IX 4CFCA 3AVBA 1X3MA 2Q2RA 4OPJA 1Q18A 3DLEA 3WEEB 3DRPA 5LL6Z 2VG7A 1RNHA 3C65A 3DLRA 4RW6A 1DKGD 3T1HK 1C0UA 3TABA 4CW7B 2DFHA 3O08A 4YOYA 1N34K 3AAPA 1IKXA 3O9QA 5F2RA 3G71N 1TUUA 4PQUA 4DFJA 4BY9C 1OH6A 3DI6A 4IG3A 4B1YB 2IVNA 3L0QA 5AQJA 4JI1K 3AGRA 2XHBA 3NCIA 4BG9A 1JL2A 4BREA 4ILJA 1GLJO 2E1ZA 1JLGA 1CZBA 2A3ZA 4HCCA 3U6FA 4NLCA 1FJGK 3CCSN 1BQNA 5HRPA 2OCEA 4O55A 1ZBSA 1GLFO 4DV0K 3DLLL 3OYHA 3EYZA 4BC4A 1HKGA 1REVA 3HK2A 3R9PA 1ZXOA 5FDLA 4GKKK 1GLEG 3VEXA 3HM9A 3ZSVA 3V6DA 2A1RA 2AA4A 3E9LA 4FWMA 3THWB 3TR8A 3SUNA 3H08A 1X9SA 4BACA 1RT3A 3QB0A 2IIRA 2XY5A 2H3GX 3SQ4A 3VQ4A 5BREA 4C8OA 4G1QA 4OX9K 4DTRA 1YJ9N 4BGAA 1D8YA 4OO1J 3VGKA 1U4BA 3CC2N 2ETJA 3NAEA 2NUBA 3S3NA 1VSDA 2Q36A 3LALA 3M8RA 3K2PA 3AVHA 3GL1A 3KTQA 3AVFA 3VF6A 3LPUA 1VQLN 1S6QA 3FGUA 3W0LA 3KJVA 4M41A 4DSLA 4KHSA 3KWGA 4WFBL 1QQNA 3TTDA 2P9NA 5M1KA 4LSLA 3CHWA 4FJNA 3H6EA 3ASMA 1YUWA 3ITHA 3V4IA 2FF3B 3AAQA 4PL8A 5FPDA 3CM5A 3O4NA 4I2QA 2UUCK 2KFNA 3KK2A 1NKEA 1YT3A 3V1QA 3FZMA 4JS5A 4FZZA 3QO9A 4JKGB 4JS4A 4B1UB 2IVOA 2Q0RA 3VQBA 1I39A 2EHGA 1GLLO 2NRZA 2YNIA 4B9TA 1CZAN 2QKKA 4V19S 2QM1A 4YNQA 1HQEA 2HB5A 2XRIA 4IBNA 3NDKA 4W5TA 3KZBA 2PBDA 3LDSA 5KGWA 5CHIA 3HP9A 3G25A 4DR5K 4KTWA 3SPYA 3O9UA 1K8KB 1ATRA 3AA3A 5AQMA 4CZFA 4IZ9A 3NE6A 4E0DA 3VTHA 3U8XA 1KVBA 1B9FA 2HF3A 1NLVA 3VQQA 3KK7A 4BROA 1SS6A 3NH1A 4JKAA 4XIUA 2FBYA 1BGXT 1KLMA 4GKJK 2CH5A 3L2VA 4C8MA 5CE3A 1TK5A 4B8CA 4M45A 4B1VA 1T3VA 3HP6A 4PUOA 2GV9A 3TU5A 4LFBK 4CHYA 3MCAB 3P83D 5CY4A 3A5OC 5E26A 4EZ9A 1XI1A 1RDCA 4K42A 4CK1A 4CF0A 1T8EA 2GTDA 4M3RA 4FSVA 4B1ZA 5AR0A 4PKHA 5SWMA 3NF9A 3OBWA 1U49A 4IJAA 1HMVA 4FJ8A 2ATQA 3IKMA 1VQNN 4OVLA 4DU1A 5KQ8A 3J7YP 3PSIA 3ID6A 4FM0A 3P1GA 4L8RB 3QNNA 5JLHA 3CCUN 3QMLA 2EX3A 4UQGA 3R6MA 4DR2K 3EE9A 4H03B 5F1XA 2OYQA 2YKNA 1RTIA 3T7ZA 3M3ZA 1CXQA 1HUXA 1N5YA 4DV7K 5HRRA 3PX0A 3C94A 3KKSA 5ELZA 5LMNK 2HHQA 2HOEA 3BZCA 3DOLA 1FW6A 4BRCA 3KHYA 1B92A 1XMOK 5CYMA 1CXUA 1ZBHA 2HHXA 3QESA 1TKZA 3MEGA 1VSEA 1KD1O 3MXIA 3WNGA 1YITN 2YV0X 3CQXA 3VEVA 4YOVA 3D2FA 3QEVA 5BPMA 3C6HA 3BDPA 4GV6A 3QEXA 4HVJA 1NK4A 1NJWA 5GINA 4BRAA 3C6AA 4FLWA 3W3DA 4H0OA 4E89A 4A57A 3GDQA 5AQQA 4DR3K 1HKBA 3CMAN 4A59A 3MN9A 5BRDA 5BRFA 2ZQBA 4FJLA 4K43A 3J81O 5GAGP 2UXCK 3THXB 1UAXA 4W5OA 1YVUA 4J2AA 2D5RA 1I94K 3JXUA 2UUBK 3ZSWA 3MX2A 1RBVA 2Z1IA 1TKTA 2P9UB 1ILYA 2CGKA 4OGEA 4DR4K 4JI8K 3CMEN 3PLAA 3KLFA 4CESA 5I3UA 3TARA 5KTQA 4IEIA 1YF5L 4KH5A 4Y1DA 5I42A 2P9SA 4O0JA 1RDUA 1J9AA 4KV8A 4CVNE 3K5LA 4FK0A 4K41A 3V1OA 1FXXA 3O1BA 3VEYA 3TI0A 1T03A 3IAYA 5GAHP 3CFOA 3EN9A 2P9LB 2XY6A 3OYAA 1RDWX 1NGHA 1SL2A 2ZWHA 3ALYA 2QWQA 4XH5A 3IS9A 4IO8A 4EP5A 1T6DA 3AVLA 2HNDA 4MFBA 2VYPA 1IKWA 3ZT4A 3CIPA 3NGYA 2QK9A 1NMDA 4IO9L 3E1YA 2P5OA 3BP8A 3K58A 2E5LK 4CZGA 3ZSRA 4AM6A 3CQ8A 3HTVA 4E19A 4X65K 1QSYA 3HL8A 4FZXC 3TANA 2KW4A 3UIQA 3LP2A 1LWCA 1VSJA 1J54A 2QTDA 1JLFA 4F3OA 1J6ZA 5BPLA 3UKRB 1N6QA 3QIPA 2D0CA 4JD2B 4B1XB 4I2PA 1RFQA 2ZJRL 2ASPA 5DM7L 4B3RK 4H5WA 3EZWA 3QFPA 2QW9A 2V7YA 1C0FA 5C42A 3CCEN 1N33K 4BVPA 2YX6A 1C0MA 3VENA 4C8LA 4LF8K 3TSUA 2D4WA 4AHVA 5C10A 1J5EK 4IFEA 3MCPA 3I8BA 1RDDA 4CFAA 3S3OA 1P8ZA 1N8RO 2P1JA 3S9HA 4CJVA 2NRHA 4NO7A 3ULEA 4DTSA 4JRQA 2YHAA 4CCHA 4KHWA 4CGDA 4HTLA 4Z0UA 2NRRA 3SBTA 1FKPA 1OH8A 3OYGA 3T69A 1V4SA 3AO5A 3L2WA 4CEEA 3VN5A 5FRMA 3D6RA 3SJJA 3C7NA 5AQUA 4DTUA 4ZTFA 1WUAA 4OPKA 4W5NA 3V9XA 3SV3A 3RRGA 5JMVA 2D0BA 3WUHA 3ZX2A 1FK9A 4CZHA 4FLUA 3K5NA 4DV5K 4I9QA 3LDLA 4C8NA 4DSJA 2FSKA 3SAGA 4F2RA 3AVJA 1GLAG 3IDHA 5J2NA 3F9KA 4LF9K 1TYQB 5C2FA 5FROA 2UXBK 3HRGA 3OTOK 2NNWA 4CGGA 4YOXA 4QS8A 1IO2A 4AM7A 3I33A 4NB4A 4FWNA 2QXLA 5LMUK 2VQEK 5AZJB 5MLCQ 1TV6A 3ENOA 3CJ7A 4DLGA 4R5PA 2YHBA 1HPZA 3CETA 1IKYA 4KI6A 3VQAA 2ZD1A 5GADP 4GV3A 1DT9A 3H1VX 3HSTB 2HMIA 4LH5A 3D2EA 3OA9A 2BH1A 2WTUA 2HVIA 2VCPA 1OVQA 1XNRK 4AHSA 1VRUA 4JNEA 5AQWA 2XY7A 3KK3A 2HW3A 3K0SA 4FK4A 1WB9A 1CLQA 4YDUA 4N47A 1XC3A 5FPNA 3EO3A 4BRMA 2RF2A 1VQ6N 3VPZA 3BF1A 2I7PA 4B9QA 3V81A 2Z1GA 4H0YB 3THYA 1BO5O 1VQ9N 3QBXA 4CJEA 2YKMA 3HPGA 3SQ0A 4K0KK 3DXKB 1MDUB 3OW2M 5DM6L 4FYDA 3DM2A 4JI7K 1W9HA 3WXKA 3I0SA 2O8CA 1NOZA 1S1UA 1XUPO 1GOBA 4PY5A 1WLJA 1H1VA 3QEIA 1HKCA 1VRTA 5AQFA 2E2OA 1U48A 3RSEB 1LAWA 1S1WA 2YJEA 1LW0A 1HNZK 4C1NK 3NHGA 3O9RA 3O5BA 3RR8A 4CJKA 4X66K 4FO0A 4A2AA 1WSJA 4FCYA 2HHWA 3ZETA 4BR9A 3JAMO 3SUPA 1YHQN 1U6ZA 4FM1A 1RDAA 4IFVA 4KO0A 1QZ6A 4PKGA 4KHPK 3L2UA 1S5JA 3CJ1A 2YJFA 1A5XA 4J2BA 4I6MA 3FFKB 4B9LA 2YI1A 3TWHA 4KFBA 4OLAA 1U2VB 1QS4A 1BISA 4KB1A 1BA0A 1U04A 1BU6O 3DXMB 4MLEA 3L3UA 4RG8A 1KVCA 3R1XA 5HLFA 1LCUA 1IV0A 3WEEA 3NGIA 4CBXA 4JI4K 3VETA 1NJXA 1O1WA 1LAVA 4DCHA 1QVGM 1VQ5N 3AO3A 4Z4GA 4DTPA 2UUAK 4KPYA 3DLBA 3HXMA 2AJQA 2HBJA 2W41A 3EEQA 4C8KA 1NGGA 2VGMA 3ZT2A 5LJWA 3OVNA 3H3NO 4YOTA 4K8XA 4WF9L 4ZTJA 3CG7A 3MEDA 2XY8A 4DF8A 4AHCA 3CPWM 1ASUA 2VG5A 4R79A 3TAFA 3M8SA 4B3MK 1HNIA 4Z94A 3V9ZA 4F3TA 2G8HA 1RT5A 2VWKA 2FXUA 3NMUA 2O8EB 4KHQA 3ZX0A 3I0RA 2HHVA 4E7IA 3L8BA 4KTQA 3WXJA 3B8AX 3ZT1A 2UYTA 2HHTA 3DLKA 2O4GA 2OPQA 4BQLA 1TKDA 1HX1A 3THWA 2AP1A 5KPRA 1IG9A 3ZSOA 4UY8O 3TAEA 2O8BB 1VQ7N 1UOCA 5AQXA 2ZE2A 3ISNC 4M3ZA 5AQGA 2FLOA 3RVCA 3AA5X 3MWTA 3BY5A 5EX5A 4KREA 1KVAA 2GWJA 3G10A 4IWVA 4E3SA 2P9KB 2FBVA 4CJFA 1BIUA 3PX4A 1X9MA 3LP0A 5AQYA 2E88A 3O8MA 2HNYA 2W42A 3UE5A 4HHTA 4NLBA 3T19A 3NH0A 3ZT0A 4AF1A 3FR0A 1K9MO 4RW8A 1EO1A 1NKBA 1QQCA 3K5MA 3VTIA 3M1FA 4JLHA 2DTUA 2F4VK 1J5OA 2A6AA 4JKDA 1NGAA 4FLXA 2A40A 3O9TA 1W7AA 4FJ7A 3FZFA 3PV8A 1M90O 3HI0A 4PL7A 4W5RA 5BPNA 1BDGA 1TVRA 1SL1A 3AVKA 4DTJA 4JI0K 4JKGA 3M5RA 1V4TA 3PY8A 3ZEUB 5HOOA 4KB0A 1JJ2M 2FSJA 1EP4A 1KFDA 3SNNA 5AQZA 2NRTA 1F21A 3CYMA 4RW7A 3IG1A 2E8AA 3RWUA 1VQON 4H5NA 5KPZA 1R59O 1W97L 5ADXA 2W40A 4BDZA 2G8IA 2KQ2A 1K8KA 4TSXA 3SPZA 2OPSA 4DG1A 4EHTA 4CHNA 4O8KA 2E1YA 4LC9B 5EU7A 1YTAA 4OLBA 5AQVA 3SUQA 4DWIA 4BE0A 4CECA 4B9VA 1JLBA 3CFPA 3P39A 1QQMA 4CJUA 3DLHA 2I7NA 2PFUA 4C1NI 1QVFM 4NCBA 4CZMA 3IMXA 3E9PA 1BIZA 4BRQA 4DQSA 2B6AA 1EWQA 3L4IA 4DU4A 4RW4A 4JI3K 1QSLA 1K6YA 2E6MA 4FJIA 4CGJA 3AV9A 4JKHA 3VMFB 2HBKA 1N32K 4AHTA 5GIOA 3J80O 4O8UA 1G99A 4KH4A 3SAHA 3HJFA 4HUFA 4CEFA 4BDYA 3QFUA 2ITGA 1IG8A 3D7EO 4WQ4A 2DPNA 1IKVA 2GBZA 5AQLA 3E66A 1KCFA 3L3VA 5D3GA 1WSHA 1WAJA 4PKIA 3HZ6A 3OYCA 3CCJN 3HM8A 5C24A 1XHZA 2VGNA 4A62A 4ILHA 4KHUA 4KBOA 3VESA 2ITMA 1YTUA 3OS0A 2PAVA 3JYTA 4FXDA 3OYKA 1Q86O 3DLGA 2OPRA 2HBMA 1SL0A 1HYSA 3WQUA 3OYLA 3CD6N 3ZYYX 4FWOA 1NOYA 2E2NA 3RMAA 1XNQK 3AGKA 1E3MA 2OZMA 3N4PA 4WE1A 1NGCA 2P9IB 3MDQA 4HUEA 1T6CA 1VSKA 3VGLA 2F7TA 5EVZA 5HBMA 3AA4A 3F73A 3TAQA 4M3WA 1B9DA 4DV1K 4CIGA 4E7HA 3O4WA 2UU9K 2O8DB 1TL3A 3F5TA 4BE1A 3U9DA 4DFPA 1LV5A 5JVHL 2NLXA 1VQ8N 1ZYQA 4JKFA 4YORA 4E7LA 3EKSA 2YHXA 3VEZA 2Q31A 3MN6A 2QA4N 4W5QA 1EXQA 3PUFA 1VSLA 1E4FT 4Z4EA 2QWRA 3NF6A 4LFCK 3O3GA 3QINA 3THXA 1C0GA 5J2MA 1VSMA 4O5BA 4KH6A 1SKRA 2QWPA 3NF7A 1QQOA 3GBTA 4CD1A 4BWMA 4CHQA 2RPIA 4G9ZA 4A5BA 2P9UA 4E1MA 3C0BA 2OZSA 5SZTA 4KTZA 1A5VA 2E6LA 3CPEA 5H1SQ 2GX9A 4BR2A 2KKZA 3J7AP 3AVGA 3OYJA 1HNWK 1HJOA 3MAQA 3VGMA 2OA8A 3P31A 2OTLN 4AQYK 1RT1A 2Q0UA 5M1QA 1S9EA 2P9LA 1KQSM 5AZIB 1IBMK 4DTMA 1VQKN 4FLTA 4CK2A 2UXDK 4BVOA 1VQ4N 4NXNK 2KLAA 4E1JA 2E20A 4DHYA 1S9GA 1VHXA 4GW6A 1VQPN 3FZKA 1VSFA 4NYNA 4CJ5A 3RMCA 1R0AA 1WBDA 3CQYA 3LZJA 4AILC 3A2FA 3TTFA 2X78A 4I9LA 3CC4N 1NGJA 1QSSA 1S3XA 4CJLA
chains in the Genus database with same CATH topology
1IBKK 4LF8K 4LF6K 1XNQK 3T1YK 4JI0K 1J5EK 4B3TK 4DV2K 4JI2K 3J81O 4JI4K 2UXCK 1N36K 1XNRK 1FJGK 4LFAK 1I94K 2UUBK 4DV1K 4GKJK 4DR6K 4DV0K 1XMQK 5A2QO 2UUAK 1HNXK 2UU9K 4DR1K 1IBLK 4DR4K 4GKKK 4JI8K 4LFBK 4DV4K 5FLXO 4LFCK 4JYAK 4LF7K 4OX9K 4CVNE 2VQFK 4B3MK 4K0KK 4JI6K 4DUZK 4X64K 3J7YP 4JI7K 4DV3K 4JI3K 4LF4K 1N32K 4DR2K 4JI5K 3J80O 3J7AP 5IT9O 1HNWK 1HNZK 4AQYK 1HR0K 4DV7K 2HHHK 4DV5K 5BR8K 5IWAK 2E5LK 4NXMK 4X66K 5LMNK 4X62K 4LF5K 4YHHK 2UUCK 1IBMK 4JV5K 1XMOK 2UXDK 4X65K 3JAMO 4LF9K 4NXNK 5LL6Z 2ZM6K 2UXBK 3OTOK 3T1HK 4CW7B 5LMUK 1N34K 4KHPK 4DV6K 2VQEK 4V19S 2F4VK 4B3RK 4DR3K 5AJ3K 4DUYK 4YY3K 4B3SK 4DR7K 1N33K 4DR5K 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK K;  4LF8 K;  4LF6 K;  1XNQ K;  3T1Y K;  4JI0 K;  1J5E K;  4B3T K;  4DV2 K;  4JI2 K;  3J81 O;  4JI4 K;  2UXC K;  1N36 K;  1XNR K;  1FJG K;  4LFA K;  1I94 K;  2UUB K;  4DV1 K;  4GKJ K;  4DR6 K;  4DV0 K;  1XMQ K;  5A2Q O;  2UUA K;  1HNX K;  2UU9 K;  4DR1 K;  1IBL K;  4DR4 K;  4GKK K;  4JI8 K;  4LFB K;  4DV4 K;  5FLX O;  4LFC K;  4JYA K;  4LF7 K;  4OX9 K;  4CVN E;  2VQF K;  4B3M K;  4K0K K;  4JI6 K;  4DUZ K;  4X64 K;  3J7Y P;  4JI7 K;  4DV3 K;  4JI3 K;  4LF4 K;  1N32 K;  4DR2 K;  4JI5 K;  3J80 O;  3J7A P;  5IT9 O;  1HNW K;  1HNZ K;  4AQY K;  1HR0 K;  4DV7 K;  2HHH K;  4DV5 K;  5BR8 K;  5IWA K;  2E5L K;  4NXM K;  4X66 K;  5LMN K;  4X62 K;  4LF5 K;  4YHH K;  2UUC K;  1IBM K;  4JV5 K;  1XMO K;  2UXD K;  4X65 K;  3JAM O;  4LF9 K;  4NXN K;  5LL6 Z;  2ZM6 K;  2UXB K;  3OTO K;  3T1H K;  4CW7 B;  5LMU K;  1N34 K;  4KHP K;  4DV6 K;  2VQE K;  4V19 S;  2F4V K;  4B3R K;  4DR3 K;  5AJ3 K;  4DUY K;  4YY3 K;  4B3S K;  4DR7 K;  1N33 K;  4DR5 K;  4JI1 K; 
#chains in the Genus database with same CATH topology
 1KAX A;  5T7B A;  3QNO A;  1LWF A;  4Z4F A;  1IH7 A;  1L3S A;  1QHT A;  2QWN A;  4EHU A;  1RDB A;  1GOC A;  4DMN A;  5C12 A;  4B3T K;  2JGU A;  5ADX H;  2OAN A;  4GV9 A;  4FJG A;  3J8A A;  1QHA A;  2F9T A;  2B5J A;  2YNG A;  3UKR A;  2Z1J A;  4DTN A;  1RT4 A;  4JD2 A;  3WXM B;  3MK6 A;  4IOA L;  4FW2 A;  2QWO A;  3LZI A;  4F2S A;  4NCA A;  4IXC A;  4J2E A;  4DSK A;  4FL9 A;  4DFK A;  2IOC A;  2CH6 A;  4BR5 A;  4CHO A;  3AVN A;  3VQ7 A;  4IOX A;  4E7J A;  4CZE A;  1TAQ A;  4KRF A;  1Q81 O;  1X1P A;  1WN7 A;  3OYE A;  3HBT A;  2R7Y A;  1W0H A;  1KFS A;  2PZS A;  1ATS A;  4CF1 A;  3O3F A;  4FWL A;  1LWE A;  3V9S A;  2HNZ A;  4JK7 A;  4A5A A;  4KHY A;  1YVN A;  3RTV A;  4M42 A;  4GNI A;  4IDH A;  4JHD B;  2A1S A;  3LWL A;  3NFA A;  3BUZ B;  4CGH A;  1BQM A;  4RCH A;  1ZBI A;  5IT9 O;  3NH2 A;  2P9P B;  5KRT A;  4ISF A;  3QBW A;  3ZSX A;  3Q7B A;  2HHH K;  5GIP A;  3B6P A;  3H46 O;  5IWA K;  3EKU A;  5M1O A;  3OYF A;  3HOS A;  3VQC A;  3QEW A;  4KHN A;  4CEZ A;  5J2Q A;  4BRG A;  4BDP A;  2EWS A;  3NVK A;  3K59 A;  2PY5 A;  4DB3 A;  4JK8 A;  4RW9 A;  3TPQ A;  3A5L C;  1HNV A;  1SAZ A;  2ZM6 K;  3OHR A;  1YIJ N;  3CF5 L;  3VA0 A;  4YDU C;  1BOT O;  4FJJ A;  3VA3 A;  4IEE A;  4OJR A;  4ID1 A;  4DU3 A;  3I55 N;  4O0I A;  1JCE A;  2WC9 A;  1S1T A;  2HHU A;  4IOC L;  2PYJ A;  4LD0 A;  4OPH A;  3WXI A;  4CGI A;  1TUY A;  4EP4 A;  3CCL N;  2FBX A;  1IBK K;  1WNS A;  4EZ6 A;  3TSQ A;  3QIC A;  1TYQ A;  4GVM A;  3HVT A;  3IRX A;  3L4Q A;  3MXJ A;  4FPA A;  2QEX N;  1I3A A;  3SQ1 A;  1N36 K;  4JKC A;  3OYD A;  5AZJ A;  2Z1H A;  1X3N A;  4DR1 K;  2Q3S A;  1KAY A;  3U9Z A;  3V9U A;  4DS4 A;  1BHL A;  3OS1 A;  4JKE A;  3KIO A;  3KWI A;  2ZJP L;  4O44 A;  1S22 A;  3EE8 A;  3HT3 A;  5JS1 A;  2X6S A;  3VQ8 A;  4FW1 A;  3CJA A;  3BGR A;  1KXP A;  5KI6 A;  4BRH A;  1WSI A;  2XO7 A;  1JXE A;  3H3O B;  4RTF D;  4JI6 K;  4DKW A;  3DRS A;  2E2P A;  1DEJ A;  3VQE A;  3TAP A;  1W2B M;  1YXQ A;  4ID5 A;  4FVU A;  1L3U A;  1DLO A;  4FLZ A;  4BRI A;  3B6O A;  2I5J A;  4MDB A;  4FOI A;  1RT2 A;  3SCX A;  4YOU A;  1RGI A;  1YAG A;  5M1N A;  3KLH A;  3MX5 A;  3ULD A;  2HHS A;  1HR0 K;  1T7P A;  5AQS A;  4FVM A;  4CHZ A;  4WFN L;  4LF5 K;  4MO5 A;  1BI4 B;  4YHH K;  3G4S N;  2O8F B;  3C95 A;  3J7Z O;  1NGB A;  2V52 B;  3DWL A;  3DXK A;  5I9E B;  2GUP A;  2HBL A;  3SUO A;  1A5W A;  3ENH A;  1EWR A;  2G8F A;  4IJN A;  2CGJ A;  1NBW A;  5KGX A;  3I56 N;  2ASM A;  4DQR A;  3M8P A;  4M7X A;  5AQK A;  1SUQ A;  4F9O A;  3RSE A;  1BUP A;  1O13 A;  1HYZ A;  1DTQ A;  3QER A;  3ZSZ A;  2IAJ A;  5CZ1 A;  4H4O A;  2JWL A;  1L5U A;  4YY3 K;  1KLN A;  4B3S K;  3UKU B;  4LH4 A;  1UWB A;  4Z4H A;  1Q7Y O;  1UA1 A;  2W6L A;  3G6E N;  3RR7 A;  4FJK A;  1K73 O;  3OYI A;  4B9U A;  2A5X A;  5JLF A;  1RTH A;  5K14 A;  3HYF A;  3BF3 A;  4JI2 K;  5EOY A;  1HJR A;  4MQ3 A;  5CYQ A;  3LAK A;  5BR9 A;  2OTJ N;  1KSP A;  2NRX A;  1WSE A;  3OY9 A;  4BWJ A;  4KI4 A;  1E4G T;  4H0T B;  3CFR A;  1RBT A;  4JN4 A;  1NJZ A;  3D0P A;  1C1C A;  3DJC A;  3CM6 A;  4I7F A;  3SBG A;  4PA1 A;  3OYN A;  1U2V A;  2QI2 A;  3DXM A;  4M3X A;  3M8Q A;  4DS5 A;  3HSC A;  3K5O A;  3NF8 A;  3KLG A;  4BC5 A;  3OS2 A;  1NK6 A;  2QKB A;  4HWI A;  1ITG A;  3KLI A;  1XWL A;  3RMD A;  2RHK A;  4AHR A;  1Z26 A;  4CJS A;  1NK0 A;  4CZK A;  4WCE L;  5BN9 A;  3I8D A;  2RKI A;  4GMJ B;  5AFU A;  3SMS A;  4Z4I A;  3A5N C;  1KTQ A;  4N41 A;  2F9W A;  4MLH A;  3CC7 N;  2A42 A;  2G8K A;  2OPP A;  3FFI A;  4XH1 A;  2QXF A;  4CF9 A;  5AQN A;  2NRV A;  3WNH A;  4DTO A;  2X6N A;  2E4L A;  3L6Q A;  4B9M A;  2VG6 A;  4DQQ A;  1MWM A;  3LM2 A;  1TK8 A;  3LDQ A;  3KKR A;  3AAR A;  5CZ2 A;  4JV5 K;  2O8E A;  4CEO A;  4CEQ A;  3RRH A;  4NCG A;  1BCM A;  1NG9 A;  5EXW A;  4ISG A;  4XH4 A;  1HLU A;  2NZT A;  4CEA A;  3C6U A;  2O4I A;  2FF6 A;  4M3T A;  4B08 A;  3MMV A;  2O8B A;  4CI6 A;  3ZLJ A;  3IUC A;  4Y1C A;  2V7Z A;  4PWD A;  3SAF A;  4DUY K;  4FJH A;  5KPT A;  1XHX A;  3FZL A;  2DY4 A;  4OKJ A;  4FWS A;  2P9K A;  2F8T A;  3HPH A;  2FBT A;  3IFR A;  2BGG A;  2GWK A;  4WQ5 C;  2BAN A;  4LFA K;  3MEE A;  1D4X A;  4M7Y A;  1TAU A;  2VWJ A;  3C6T A;  3VEW A;  4DTX A;  4DR6 K;  2FC0 A;  1X9W A;  3SLC A;  5A2Q O;  5JVG L;  1ASV A;  3DAW A;  3M6G A;  1L3T A;  1Y97 A;  2LSN A;  3KLE A;  4JKB A;  3R8E A;  4FLV A;  4OKE A;  4CEB A;  4CHP A;  4CGF A;  3ZSY A;  4CD3 A;  1RBR A;  2P9N B;  1NNE A;  4N56 A;  1NGF A;  4WQ4 C;  2IGI A;  3NBP A;  1LW2 A;  3AY9 A;  3OBY A;  3P4I A;  3CXC M;  2KTQ A;  3ZEU A;  1JKH A;  3PO5 A;  3SV4 A;  1T05 A;  4CZI A;  4AHU A;  1L3V A;  2ASO A;  3P5J A;  3EY1 A;  4E7K A;  4DUZ K;  1K8A O;  4IFY A;  4BRD A;  4K25 A;  3OYM A;  5J1E A;  4MO4 A;  1KAZ A;  1Q9X A;  4LF4 K;  1RBS A;  1ZBF A;  1J53 A;  3OYB A;  4N76 A;  3O80 A;  3E9O A;  1ZBL A;  3H1Q A;  3VER A;  1EET A;  4BRN A;  3AO4 A;  4CJR A;  3MXM A;  2IDO A;  3TSP A;  3LAM A;  4BRP A;  3PX6 A;  4Q5V A;  2YHW A;  3KD1 E;  1D9D A;  3A5M C;  2WOM A;  3LM9 A;  2P5G A;  3VQ5 A;  2D0A A;  4CE9 A;  4ELV A;  4H0V B;  4WQ5 A;  4FM2 A;  3P38 A;  4J8F A;  3DRR A;  1GLB G;  1RTJ A;  3N4Q A;  2RN2 A;  5FPE A;  5JIC A;  4DV6 K;  4B9S A;  2YHY A;  3GG4 A;  4FOE A;  5AQI A;  4BE2 A;  4U7B A;  1FKO A;  4CIE A;  3GOI A;  4KAZ A;  1X9J A;  1TGO A;  1ZBU A;  3AO1 A;  4CIF A;  3G0Z A;  2G8V A;  5GAE P;  2D1K A;  4XEI A;  1XC9 A;  3FE1 A;  5KRS A;  5BRH A;  4CER A;  1QE1 A;  4H0X B;  1WOQ A;  5M1F A;  2QWL A;  4FWR A;  4BG8 A;  4CJ3 A;  3ZX3 A;  5BN8 A;  3LL3 A;  1QZ5 A;  1RIL A;  2WFB A;  3CJC A;  2CGL A;  5DMR A;  1Z05 A;  3CJB A;  1KC8 O;  1HPM A;  4JEP A;  4DV4 K;  4H5T A;  4FK2 A;  2V51 B;  3MN5 A;  5EY4 A;  5FLX O;  4CFD A;  3K57 A;  2P9I A;  1JL1 A;  5AFU H;  3QEP A;  4ZHR A;  3QDK A;  3U3Y A;  2KZM A;  3AO2 A;  5C25 A;  3HVR A;  4M3U A;  4X64 K;  3S41 A;  3NVM A;  2KFZ A;  3CCM N;  2O8D A;  1GLD G;  3WT0 A;  4DV3 K;  1WSF A;  1OVY A;  2BE2 A;  3D2F B;  1QTM A;  1OH5 A;  4B9N A;  1Z6R A;  1MWK A;  3O9S A;  3L2R A;  3FLC O;  2W6K A;  4LSN A;  1ESV A;  3QET A;  2Q97 A;  1RT7 A;  1RBU A;  5AQP A;  1JCG A;  1SZ2 A;  1S72 N;  3AVI A;  5FRN A;  2E2Q A;  5AQT A;  2BUP A;  1D9F A;  4BQZ A;  5C2D A;  2DFF A;  4DFM A;  5DK5 A;  3SYZ A;  1U47 A;  3DYA A;  3PIP L;  3VQP A;  1NM1 A;  3MWP A;  2B4J A;  4KKO A;  1T44 A;  2YCH A;  1EQY A;  3U4L A;  4QOZ B;  1IJJ A;  1NGI A;  2DFE A;  5HP1 A;  4JAX A;  5AJ3 K;  1TL1 A;  3A8Y A;  5AQH A;  5E41 A;  5AZI A;  3SI6 A;  2J4R A;  1G15 A;  1VQM N;  2BDP A;  1NK9 A;  2PYL A;  3LAN A;  3T3F A;  2P9S B;  5TKY A;  3R3L A;  5CR4 A;  4DSE A;  3O6W A;  4PHT X;  1MA9 B;  2ZF5 O;  4ELU A;  1DGK N;  4H5V A;  3PIO L;  5FPM A;  1NK5 A;  2JLE A;  1HNX K;  3T1A A;  5JS2 A;  1IBL K;  4B8A B;  1CZ9 A;  3F9M A;  3KVG A;  1RCH A;  4HUG A;  3H45 C;  3SZ2 A;  4A61 A;  4BC2 A;  4Q0B A;  4IG0 A;  2FSN A;  2F96 A;  3VQD A;  4CJT A;  5F0X A;  3ZT3 A;  4EAH D;  3PO4 A;  3VEO A;  1C6V A;  3O3H A;  2D0P A;  4LF7 K;  3PSF A;  1Q9Y A;  1M1K O;  5C15 A;  2NRW A;  1C1B A;  4B1W B;  4N5S A;  1NK7 A;  1XQS C;  2QWM A;  1YI2 N;  5E84 A;  4WYB A;  4DSI A;  1U45 A;  4NYF A;  4O4G A;  1SV5 A;  2Y1I A;  4QCL A;  3OJS A;  5C0Y A;  3CCQ N;  1DTT A;  3DMJ A;  2YNH A;  1RTD A;  3K9K A;  1OKJ A;  5HRN A;  2GEL A;  1VSI A;  4M63 C;  4WFA L;  5TKW A;  2ZGZ A;  4F8R A;  1HRH A;  3BEX A;  4Z4C A;  1P90 A;  1SKW A;  4NXM K;  1C0T A;  3CCV N;  3ATU A;  4B3O A;  4C23 A;  4DQ8 A;  4CZL A;  4LY7 A;  3TAM A;  1NWK A;  3TTC A;  4Y0W A;  2KHO A;  3VF4 A;  4DLE A;  4JHD A;  3AVC A;  4CF2 A;  4H4M A;  4CZJ A;  2P9P A;  3ID8 A;  4HCB A;  1TK0 A;  4L3Q A;  1S6P A;  4JK9 A;  3OJU A;  4AH9 A;  4BR0 A;  1S1V A;  2F8S A;  3L2Q A;  1SQK A;  2IS3 A;  1HYV A;  2D0O A;  1EKE A;  2BTF A;  4FJM A;  4M3Y A;  3ULE B;  1RT6 A;  2G8U A;  4FJ9 A;  4K8Z A;  4CJ7 A;  1JLQ A;  3VQ6 A;  2X74 A;  3FZH A;  3WQT A;  4BR7 A;  4DV2 K;  4CBW A;  2IVP A;  1MU2 A;  4DQP A;  4OPA A;  3JSM A;  4FWK A;  1JXB A;  3QIO A;  4CJW A;  1NKC A;  4CBU A;  4BC3 A;  1XMQ K;  2ZGY A;  3AVA A;  2GUI A;  3ZSQ A;  1BCO A;  3C7N B;  4FWP A;  3CER A;  5AQR A;  4HTU A;  5AQO A;  4CED A;  4H0P A;  2Q1N A;  4OKK A;  1KRP A;  3K9J A;  4QS7 A;  3U3G A;  3BZK A;  4BGB A;  4CJP A;  3EZ5 A;  1BA1 A;  3CI5 A;  3GE1 A;  3CCR N;  4JYA K;  5HRO A;  1GLC G;  2HF4 A;  4J2D A;  4ISE A;  3ATV A;  3KD5 E;  3V1R A;  4F4K A;  4H5R A;  3SQ2 A;  2WUS A;  2P51 A;  1WAF A;  3VOV A;  4CK3 A;  3WNF A;  4QAG A;  3D45 A;  1UA0 A;  3KK1 A;  1C1A A;  4A2B A;  2HST A;  4BRF A;  2YNF A;  3S3M A;  1SKS A;  3UB5 A;  3WNE A;  1ASW A;  3AA2 A;  4CFB A;  4GY2 B;  1ATN A;  4IDK A;  4E1N A;  4RWT A;  2RE2 A;  5BR8 K;  1YJW N;  1HQU A;  4X62 K;  4FPB A;  1Q82 O;  1VAZ A;  3QLH A;  3HOT A;  1NGE A;  4CJQ A;  3LDO A;  1GOA A;  4FJX A;  3WXL A;  4DF4 A;  2WON A;  3LDN A;  4FLY A;  4O5F A;  1WBB A;  3SMP A;  3D2E B;  1D5A A;  4OGC A;  4ELT A;  5LY3 A;  4MDA A;  1JLA A;  1EX4 A;  3F2K A;  1Z25 A;  3EL2 A;  3LWM A;  1BG3 A;  4BRK A;  4BR4 A;  2ZJQ L;  3HO1 A;  4DQI A;  4DSF A;  4H8K A;  3VF2 A;  1OH7 A;  1NGD A;  1S1X A;  4DR7 K;  1BI4 A;  2IC3 A;  1BWF O;  2O8F A;  3RMB A;  1Y64 A;  3ENB A;  4U67 L;  4LF6 K;  2G8W A;  1NK8 A;  3T1Y K;  3LP3 A;  2HMP A;  1VK0 A;  3THY B;  3THV A;  3MEC A;  1WSG A;  4EIA A;  5HL7 L;  3MN7 A;  5KQD A;  3AVM A;  2JWK A;  3VQ9 A;  4JRP A;  5B8H A;  3SJH A;  1NJI O;  1ZC6 A;  5LJV A;  3SK3 A;  3V9W A;  2O8C B;  3NGZ A;  2WBN A;  1YJN N;  3UKU A;  4EFH A;  2GEM A;  4CJ4 A;  3LPT A;  1Q8I A;  5HRS A;  4YFU A;  3O1W A;  4ILG B;  4IKF A;  4FZY A;  1VSH A;  3E01 A;  4FWQ A;  5J2P A;  4BRL A;  2VQF K;  1JLE A;  4FJ5 A;  3CJ9 A;  1NJY A;  3ZET B;  3O4Q A;  3HPO A;  1BL3 A;  1LOT B;  3LP1 A;  1TKX A;  4QS9 A;  3TAG A;  1NU0 A;  2Y1J A;  2A41 A;  3Q7C A;  2KZZ A;  1NMN A;  3ZCM A;  4CF8 A;  3LDP A;  3DOK A;  4YOW A;  2VWB A;  5M1P A;  4ICL A;  2HVH A;  3JS6 A;  4JI5 K;  1JLC A;  1JCF A;  4I6M B;  4GVE A;  3A0I X;  4CFC A;  3AVB A;  1X3M A;  2Q2R A;  4OPJ A;  1Q18 A;  3DLE A;  3WEE B;  3DRP A;  5LL6 Z;  2VG7 A;  1RNH A;  3C65 A;  3DLR A;  4RW6 A;  1DKG D;  3T1H K;  1C0U A;  3TAB A;  4CW7 B;  2DFH A;  3O08 A;  4YOY A;  1N34 K;  3AAP A;  1IKX A;  3O9Q A;  5F2R A;  3G71 N;  1TUU A;  4PQU A;  4DFJ A;  4BY9 C;  1OH6 A;  3DI6 A;  4IG3 A;  4B1Y B;  2IVN A;  3L0Q A;  5AQJ A;  4JI1 K;  3AGR A;  2XHB A;  3NCI A;  4BG9 A;  1JL2 A;  4BRE A;  4ILJ A;  1GLJ O;  2E1Z A;  1JLG A;  1CZB A;  2A3Z A;  4HCC A;  3U6F A;  4NLC A;  1FJG K;  3CCS N;  1BQN A;  5HRP A;  2OCE A;  4O55 A;  1ZBS A;  1GLF O;  4DV0 K;  3DLL L;  3OYH A;  3EYZ A;  4BC4 A;  1HKG A;  1REV A;  3HK2 A;  3R9P A;  1ZXO A;  5FDL A;  4GKK K;  1GLE G;  3VEX A;  3HM9 A;  3ZSV A;  3V6D A;  2A1R A;  2AA4 A;  3E9L A;  4FWM A;  3THW B;  3TR8 A;  3SUN A;  3H08 A;  1X9S A;  4BAC A;  1RT3 A;  3QB0 A;  2IIR A;  2XY5 A;  2H3G X;  3SQ4 A;  3VQ4 A;  5BRE A;  4C8O A;  4G1Q A;  4OX9 K;  4DTR A;  1YJ9 N;  4BGA A;  1D8Y A;  4OO1 J;  3VGK A;  1U4B A;  3CC2 N;  2ETJ A;  3NAE A;  2NUB A;  3S3N A;  1VSD A;  2Q36 A;  3LAL A;  3M8R A;  3K2P A;  3AVH A;  3GL1 A;  3KTQ A;  3AVF A;  3VF6 A;  3LPU A;  1VQL N;  1S6Q A;  3FGU A;  3W0L A;  3KJV A;  4M41 A;  4DSL A;  4KHS A;  3KWG A;  4WFB L;  1QQN A;  3TTD A;  2P9N A;  5M1K A;  4LSL A;  3CHW A;  4FJN A;  3H6E A;  3ASM A;  1YUW A;  3ITH A;  3V4I A;  2FF3 B;  3AAQ A;  4PL8 A;  5FPD A;  3CM5 A;  3O4N A;  4I2Q A;  2UUC K;  2KFN A;  3KK2 A;  1NKE A;  1YT3 A;  3V1Q A;  3FZM A;  4JS5 A;  4FZZ A;  3QO9 A;  4JKG B;  4JS4 A;  4B1U B;  2IVO A;  2Q0R A;  3VQB A;  1I39 A;  2EHG A;  1GLL O;  2NRZ A;  2YNI A;  4B9T A;  1CZA N;  2QKK A;  4V19 S;  2QM1 A;  4YNQ A;  1HQE A;  2HB5 A;  2XRI A;  4IBN A;  3NDK A;  4W5T A;  3KZB A;  2PBD A;  3LDS A;  5KGW A;  5CHI A;  3HP9 A;  3G25 A;  4DR5 K;  4KTW A;  3SPY A;  3O9U A;  1K8K B;  1ATR A;  3AA3 A;  5AQM A;  4CZF A;  4IZ9 A;  3NE6 A;  4E0D A;  3VTH A;  3U8X A;  1KVB A;  1B9F A;  2HF3 A;  1NLV A;  3VQQ A;  3KK7 A;  4BRO A;  1SS6 A;  3NH1 A;  4JKA A;  4XIU A;  2FBY A;  1BGX T;  1KLM A;  4GKJ K;  2CH5 A;  3L2V A;  4C8M A;  5CE3 A;  1TK5 A;  4B8C A;  4M45 A;  4B1V A;  1T3V A;  3HP6 A;  4PUO A;  2GV9 A;  3TU5 A;  4LFB K;  4CHY A;  3MCA B;  3P83 D;  5CY4 A;  3A5O C;  5E26 A;  4EZ9 A;  1XI1 A;  1RDC A;  4K42 A;  4CK1 A;  4CF0 A;  1T8E A;  2GTD A;  4M3R A;  4FSV A;  4B1Z A;  5AR0 A;  4PKH A;  5SWM A;  3NF9 A;  3OBW A;  1U49 A;  4IJA A;  1HMV A;  4FJ8 A;  2ATQ A;  3IKM A;  1VQN N;  4OVL A;  4DU1 A;  5KQ8 A;  3J7Y P;  3PSI A;  3ID6 A;  4FM0 A;  3P1G A;  4L8R B;  3QNN A;  5JLH A;  3CCU N;  3QML A;  2EX3 A;  4UQG A;  3R6M A;  4DR2 K;  3EE9 A;  4H03 B;  5F1X A;  2OYQ A;  2YKN A;  1RTI A;  3T7Z A;  3M3Z A;  1CXQ A;  1HUX A;  1N5Y A;  4DV7 K;  5HRR A;  3PX0 A;  3C94 A;  3KKS A;  5ELZ A;  5LMN K;  2HHQ A;  2HOE A;  3BZC A;  3DOL A;  1FW6 A;  4BRC A;  3KHY A;  1B92 A;  1XMO K;  5CYM A;  1CXU A;  1ZBH A;  2HHX A;  3QES A;  1TKZ A;  3MEG A;  1VSE A;  1KD1 O;  3MXI A;  3WNG A;  1YIT N;  2YV0 X;  3CQX A;  3VEV A;  4YOV A;  3D2F A;  3QEV A;  5BPM A;  3C6H A;  3BDP A;  4GV6 A;  3QEX A;  4HVJ A;  1NK4 A;  1NJW A;  5GIN A;  4BRA A;  3C6A A;  4FLW A;  3W3D A;  4H0O A;  4E89 A;  4A57 A;  3GDQ A;  5AQQ A;  4DR3 K;  1HKB A;  3CMA N;  4A59 A;  3MN9 A;  5BRD A;  5BRF A;  2ZQB A;  4FJL A;  4K43 A;  3J81 O;  5GAG P;  2UXC K;  3THX B;  1UAX A;  4W5O A;  1YVU A;  4J2A A;  2D5R A;  1I94 K;  3JXU A;  2UUB K;  3ZSW A;  3MX2 A;  1RBV A;  2Z1I A;  1TKT A;  2P9U B;  1ILY A;  2CGK A;  4OGE A;  4DR4 K;  4JI8 K;  3CME N;  3PLA A;  3KLF A;  4CES A;  5I3U A;  3TAR A;  5KTQ A;  4IEI A;  1YF5 L;  4KH5 A;  4Y1D A;  5I42 A;  2P9S A;  4O0J A;  1RDU A;  1J9A A;  4KV8 A;  4CVN E;  3K5L A;  4FK0 A;  4K41 A;  3V1O A;  1FXX A;  3O1B A;  3VEY A;  3TI0 A;  1T03 A;  3IAY A;  5GAH P;  3CFO A;  3EN9 A;  2P9L B;  2XY6 A;  3OYA A;  1RDW X;  1NGH A;  1SL2 A;  2ZWH A;  3ALY A;  2QWQ A;  4XH5 A;  3IS9 A;  4IO8 A;  4EP5 A;  1T6D A;  3AVL A;  2HND A;  4MFB A;  2VYP A;  1IKW A;  3ZT4 A;  3CIP A;  3NGY A;  2QK9 A;  1NMD A;  4IO9 L;  3E1Y A;  2P5O A;  3BP8 A;  3K58 A;  2E5L K;  4CZG A;  3ZSR A;  4AM6 A;  3CQ8 A;  3HTV A;  4E19 A;  4X65 K;  1QSY A;  3HL8 A;  4FZX C;  3TAN A;  2KW4 A;  3UIQ A;  3LP2 A;  1LWC A;  1VSJ A;  1J54 A;  2QTD A;  1JLF A;  4F3O A;  1J6Z A;  5BPL A;  3UKR B;  1N6Q A;  3QIP A;  2D0C A;  4JD2 B;  4B1X B;  4I2P A;  1RFQ A;  2ZJR L;  2ASP A;  5DM7 L;  4B3R K;  4H5W A;  3EZW A;  3QFP A;  2QW9 A;  2V7Y A;  1C0F A;  5C42 A;  3CCE N;  1N33 K;  4BVP A;  2YX6 A;  1C0M A;  3VEN A;  4C8L A;  4LF8 K;  3TSU A;  2D4W A;  4AHV A;  5C10 A;  1J5E K;  4IFE A;  3MCP A;  3I8B A;  1RDD A;  4CFA A;  3S3O A;  1P8Z A;  1N8R O;  2P1J A;  3S9H A;  4CJV A;  2NRH A;  4NO7 A;  3ULE A;  4DTS A;  4JRQ A;  2YHA A;  4CCH A;  4KHW A;  4CGD A;  4HTL A;  4Z0U A;  2NRR A;  3SBT A;  1FKP A;  1OH8 A;  3OYG A;  3T69 A;  1V4S A;  3AO5 A;  3L2W A;  4CEE A;  3VN5 A;  5FRM A;  3D6R A;  3SJJ A;  3C7N A;  5AQU A;  4DTU A;  4ZTF A;  1WUA A;  4OPK A;  4W5N A;  3V9X A;  3SV3 A;  3RRG A;  5JMV A;  2D0B A;  3WUH A;  3ZX2 A;  1FK9 A;  4CZH A;  4FLU A;  3K5N A;  4DV5 K;  4I9Q A;  3LDL A;  4C8N A;  4DSJ A;  2FSK A;  3SAG A;  4F2R A;  3AVJ A;  1GLA G;  3IDH A;  5J2N A;  3F9K A;  4LF9 K;  1TYQ B;  5C2F A;  5FRO A;  2UXB K;  3HRG A;  3OTO K;  2NNW A;  4CGG A;  4YOX A;  4QS8 A;  1IO2 A;  4AM7 A;  3I33 A;  4NB4 A;  4FWN A;  2QXL A;  5LMU K;  2VQE K;  5AZJ B;  5MLC Q;  1TV6 A;  3ENO A;  3CJ7 A;  4DLG A;  4R5P A;  2YHB A;  1HPZ A;  3CET A;  1IKY A;  4KI6 A;  3VQA A;  2ZD1 A;  5GAD P;  4GV3 A;  1DT9 A;  3H1V X;  3HST B;  2HMI A;  4LH5 A;  3D2E A;  3OA9 A;  2BH1 A;  2WTU A;  2HVI A;  2VCP A;  1OVQ A;  1XNR K;  4AHS A;  1VRU A;  4JNE A;  5AQW A;  2XY7 A;  3KK3 A;  2HW3 A;  3K0S A;  4FK4 A;  1WB9 A;  1CLQ A;  4YDU A;  4N47 A;  1XC3 A;  5FPN A;  3EO3 A;  4BRM A;  2RF2 A;  1VQ6 N;  3VPZ A;  3BF1 A;  2I7P A;  4B9Q A;  3V81 A;  2Z1G A;  4H0Y B;  3THY A;  1BO5 O;  1VQ9 N;  3QBX A;  4CJE A;  2YKM A;  3HPG A;  3SQ0 A;  4K0K K;  3DXK B;  1MDU B;  3OW2 M;  5DM6 L;  4FYD A;  3DM2 A;  4JI7 K;  1W9H A;  3WXK A;  3I0S A;  2O8C A;  1NOZ A;  1S1U A;  1XUP O;  1GOB A;  4PY5 A;  1WLJ A;  1H1V A;  3QEI A;  1HKC A;  1VRT A;  5AQF A;  2E2O A;  1U48 A;  3RSE B;  1LAW A;  1S1W A;  2YJE A;  1LW0 A;  1HNZ K;  4C1N K;  3NHG A;  3O9R A;  3O5B A;  3RR8 A;  4CJK A;  4X66 K;  4FO0 A;  4A2A A;  1WSJ A;  4FCY A;  2HHW A;  3ZET A;  4BR9 A;  3JAM O;  3SUP A;  1YHQ N;  1U6Z A;  4FM1 A;  1RDA A;  4IFV A;  4KO0 A;  1QZ6 A;  4PKG A;  4KHP K;  3L2U A;  1S5J A;  3CJ1 A;  2YJF A;  1A5X A;  4J2B A;  4I6M A;  3FFK B;  4B9L A;  2YI1 A;  3TWH A;  4KFB A;  4OLA A;  1U2V B;  1QS4 A;  1BIS A;  4KB1 A;  1BA0 A;  1U04 A;  1BU6 O;  3DXM B;  4MLE A;  3L3U A;  4RG8 A;  1KVC A;  3R1X A;  5HLF A;  1LCU A;  1IV0 A;  3WEE A;  3NGI A;  4CBX A;  4JI4 K;  3VET A;  1NJX A;  1O1W A;  1LAV A;  4DCH A;  1QVG M;  1VQ5 N;  3AO3 A;  4Z4G A;  4DTP A;  2UUA K;  4KPY A;  3DLB A;  3HXM A;  2AJQ A;  2HBJ A;  2W41 A;  3EEQ A;  4C8K A;  1NGG A;  2VGM A;  3ZT2 A;  5LJW A;  3OVN A;  3H3N O;  4YOT A;  4K8X A;  4WF9 L;  4ZTJ A;  3CG7 A;  3MED A;  2XY8 A;  4DF8 A;  4AHC A;  3CPW M;  1ASU A;  2VG5 A;  4R79 A;  3TAF A;  3M8S A;  4B3M K;  1HNI A;  4Z94 A;  3V9Z A;  4F3T A;  2G8H A;  1RT5 A;  2VWK A;  2FXU A;  3NMU A;  2O8E B;  4KHQ A;  3ZX0 A;  3I0R A;  2HHV A;  4E7I A;  3L8B A;  4KTQ A;  3WXJ A;  3B8A X;  3ZT1 A;  2UYT A;  2HHT A;  3DLK A;  2O4G A;  2OPQ A;  4BQL A;  1TKD A;  1HX1 A;  3THW A;  2AP1 A;  5KPR A;  1IG9 A;  3ZSO A;  4UY8 O;  3TAE A;  2O8B B;  1VQ7 N;  1UOC A;  5AQX A;  2ZE2 A;  3ISN C;  4M3Z A;  5AQG A;  2FLO A;  3RVC A;  3AA5 X;  3MWT A;  3BY5 A;  5EX5 A;  4KRE A;  1KVA A;  2GWJ A;  3G10 A;  4IWV A;  4E3S A;  2P9K B;  2FBV A;  4CJF A;  1BIU A;  3PX4 A;  1X9M A;  3LP0 A;  5AQY A;  2E88 A;  3O8M A;  2HNY A;  2W42 A;  3UE5 A;  4HHT A;  4NLB A;  3T19 A;  3NH0 A;  3ZT0 A;  4AF1 A;  3FR0 A;  1K9M O;  4RW8 A;  1EO1 A;  1NKB A;  1QQC A;  3K5M A;  3VTI A;  3M1F A;  4JLH A;  2DTU A;  2F4V K;  1J5O A;  2A6A A;  4JKD A;  1NGA A;  4FLX A;  2A40 A;  3O9T A;  1W7A A;  4FJ7 A;  3FZF A;  3PV8 A;  1M90 O;  3HI0 A;  4PL7 A;  4W5R A;  5BPN A;  1BDG A;  1TVR A;  1SL1 A;  3AVK A;  4DTJ A;  4JI0 K;  4JKG A;  3M5R A;  1V4T A;  3PY8 A;  3ZEU B;  5HOO A;  4KB0 A;  1JJ2 M;  2FSJ A;  1EP4 A;  1KFD A;  3SNN A;  5AQZ A;  2NRT A;  1F21 A;  3CYM A;  4RW7 A;  3IG1 A;  2E8A A;  3RWU A;  1VQO N;  4H5N A;  5KPZ A;  1R59 O;  1W97 L;  5ADX A;  2W40 A;  4BDZ A;  2G8I A;  2KQ2 A;  1K8K A;  4TSX A;  3SPZ A;  2OPS A;  4DG1 A;  4EHT A;  4CHN A;  4O8K A;  2E1Y A;  4LC9 B;  5EU7 A;  1YTA A;  4OLB A;  5AQV A;  3SUQ A;  4DWI A;  4BE0 A;  4CEC A;  4B9V A;  1JLB A;  3CFP A;  3P39 A;  1QQM A;  4CJU A;  3DLH A;  2I7N A;  2PFU A;  4C1N I;  1QVF M;  4NCB A;  4CZM A;  3IMX A;  3E9P A;  1BIZ A;  4BRQ A;  4DQS A;  2B6A A;  1EWQ A;  3L4I A;  4DU4 A;  4RW4 A;  4JI3 K;  1QSL A;  1K6Y A;  2E6M A;  4FJI A;  4CGJ A;  3AV9 A;  4JKH A;  3VMF B;  2HBK A;  1N32 K;  4AHT A;  5GIO A;  3J80 O;  4O8U A;  1G99 A;  4KH4 A;  3SAH A;  3HJF A;  4HUF A;  4CEF A;  4BDY A;  3QFU A;  2ITG A;  1IG8 A;  3D7E O;  4WQ4 A;  2DPN A;  1IKV A;  2GBZ A;  5AQL A;  3E66 A;  1KCF A;  3L3V A;  5D3G A;  1WSH A;  1WAJ A;  4PKI A;  3HZ6 A;  3OYC A;  3CCJ N;  3HM8 A;  5C24 A;  1XHZ A;  2VGN A;  4A62 A;  4ILH A;  4KHU A;  4KBO A;  3VES A;  2ITM A;  1YTU A;  3OS0 A;  2PAV A;  3JYT A;  4FXD A;  3OYK A;  1Q86 O;  3DLG A;  2OPR A;  2HBM A;  1SL0 A;  1HYS A;  3WQU A;  3OYL A;  3CD6 N;  3ZYY X;  4FWO A;  1NOY A;  2E2N A;  3RMA A;  1XNQ K;  3AGK A;  1E3M A;  2OZM A;  3N4P A;  4WE1 A;  1NGC A;  2P9I B;  3MDQ A;  4HUE A;  1T6C A;  1VSK A;  3VGL A;  2F7T A;  5EVZ A;  5HBM A;  3AA4 A;  3F73 A;  3TAQ A;  4M3W A;  1B9D A;  4DV1 K;  4CIG A;  4E7H A;  3O4W A;  2UU9 K;  2O8D B;  1TL3 A;  3F5T A;  4BE1 A;  3U9D A;  4DFP A;  1LV5 A;  5JVH L;  2NLX A;  1VQ8 N;  1ZYQ A;  4JKF A;  4YOR A;  4E7L A;  3EKS A;  2YHX A;  3VEZ A;  2Q31 A;  3MN6 A;  2QA4 N;  4W5Q A;  1EXQ A;  3PUF A;  1VSL A;  1E4F T;  4Z4E A;  2QWR A;  3NF6 A;  4LFC K;  3O3G A;  3QIN A;  3THX A;  1C0G A;  5J2M A;  1VSM A;  4O5B A;  4KH6 A;  1SKR A;  2QWP A;  3NF7 A;  1QQO A;  3GBT A;  4CD1 A;  4BWM A;  4CHQ A;  2RPI A;  4G9Z A;  4A5B A;  2P9U A;  4E1M A;  3C0B A;  2OZS A;  5SZT A;  4KTZ A;  1A5V A;  2E6L A;  3CPE A;  5H1S Q;  2GX9 A;  4BR2 A;  2KKZ A;  3J7A P;  3AVG A;  3OYJ A;  1HNW K;  1HJO A;  3MAQ A;  3VGM A;  2OA8 A;  3P31 A;  2OTL N;  4AQY K;  1RT1 A;  2Q0U A;  5M1Q A;  1S9E A;  2P9L A;  1KQS M;  5AZI B;  1IBM K;  4DTM A;  1VQK N;  4FLT A;  4CK2 A;  2UXD K;  4BVO A;  1VQ4 N;  4NXN K;  2KLA A;  4E1J A;  2E20 A;  4DHY A;  1S9G A;  1VHX A;  4GW6 A;  1VQP N;  3FZK A;  1VSF A;  4NYN A;  4CJ5 A;  3RMC A;  1R0A A;  1WBD A;  3CQY A;  3LZJ A;  4AIL C;  3A2F A;  3TTF A;  2X78 A;  4I9L A;  3CC4 N;  1NGJ A;  1QSS A;  1S3X A;  4CJL A; 
#chains in the Genus database with same CATH homology
 1IBK K;  4LF8 K;  4LF6 K;  1XNQ K;  3T1Y K;  4JI0 K;  1J5E K;  4B3T K;  4DV2 K;  4JI2 K;  3J81 O;  4JI4 K;  2UXC K;  1N36 K;  1XNR K;  1FJG K;  4LFA K;  1I94 K;  2UUB K;  4DV1 K;  4GKJ K;  4DR6 K;  4DV0 K;  1XMQ K;  5A2Q O;  2UUA K;  1HNX K;  2UU9 K;  4DR1 K;  1IBL K;  4DR4 K;  4GKK K;  4JI8 K;  4LFB K;  4DV4 K;  5FLX O;  4LFC K;  4JYA K;  4LF7 K;  4OX9 K;  4CVN E;  2VQF K;  4B3M K;  4K0K K;  4JI6 K;  4DUZ K;  4X64 K;  3J7Y P;  4JI7 K;  4DV3 K;  4JI3 K;  4LF4 K;  1N32 K;  4DR2 K;  4JI5 K;  3J80 O;  3J7A P;  5IT9 O;  1HNW K;  1HNZ K;  4AQY K;  1HR0 K;  4DV7 K;  2HHH K;  4DV5 K;  5BR8 K;  5IWA K;  2E5L K;  4NXM K;  4X66 K;  5LMN K;  4X62 K;  4LF5 K;  4YHH K;  2UUC K;  1IBM K;  4JV5 K;  1XMO K;  2UXD K;  4X65 K;  3JAM O;  4LF9 K;  4NXN K;  5LL6 Z;  2ZM6 K;  2UXB K;  3OTO K;  3T1H K;  4CW7 B;  5LMU K;  1N34 K;  4KHP K;  4DV6 K;  2VQE K;  4V19 S;  2F4V K;  4B3R K;  4DR3 K;  5AJ3 K;  4DUY K;  4YY3 K;  4B3S K;  4DR7 K;  1N33 K;  4DR5 K;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...