2UUAK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guc-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uuaK00
5AJ3K 4NXNK 4DR7K 4DV6K 2UXBK 4K0KK 4JI8K 4X65K 5IWAK 3T1YK 3J81O 4X62K 2UXDK 1XMQK 1HNXK 4JI2K 4LFBK 2F4VK 4B3SK 4YHHK 4X64K 1I94K 1HNZK 4B3RK 4AQYK 4X66K 4B3MK 4DR1K 5LL6Z 4LF5K 4DUYK 1XNRK 1N32K 3J80O 1IBLK 1IBMK 4GKKK 4JI6K 1N34K 4LFCK 4DV1K 4JI7K 4JV5K 2HHHK 2UXCK 4JI5K 1HR0K 5LMUK 4OX9K 4NXMK 2VQEK 3JAMO 4DR3K 3T1HK 4B3TK 4V19S 4GKJK 4JI4K 2ZM6K 1J5EK 4LF9K 5LMNK 4DV0K 4KHPK 5A2QO 4LF6K 2UUAK 4LF4K 4DR2K 4DV2K 1HNWK 2VQFK 3J7AP 4DV5K 2UUCK 4DR6K 4YY3K 4JI3K 2UU9K 4JI0K 4CVNE 1IBKK 4LF7K 1N33K 4JYAK 2E5LK 3OTOK 4DV7K 1N36K 1XMOK 4DR5K 5FLXO 4LFAK 4DV4K 4DV3K 3J7YP 1XNQK 4LF8K 4DR4K 5BR8K 4CW7B 4JI1K 4DUZK 5IT9O 2UUBK 1FJGK
chains in the Genus database with same CATH superfamily
1IH7A 3MMVA 3ZT4A 2NRWA 3OJUA 5EY4A 1HUXA 1Z05A 3VA3A 4C1NK 1HX1A 3T1YK 4WCEL 2UXDK 4MLHA 5FPNA 1EQYA 2ITGA 5DM7L 3O9QA 5AQFA 3CHWA 1L5UA 1CLQA 4JKFA 1QZ6A 3THVA 1GLDG 4LF5K 5AFUH 1ZXOA 3LP2A 3VMFB 4BR5A 3RMCA 3U3YA 3TTCA 4NCBA 4DCHA 4QOZB 4RW7A 4O4GA 2OZSA 4OLBA 4BE2A 2FF3B 4KHYA 3HOSA 3K57A 4FO0A 2VQEK 3JAMO 5LJVA 4DSKA 2W42A 1HRHA 4CHOA 3NH2A 4A59A 2HVIA 3CCQN 3S9HA 3SUNA 1TUUA 3V9SA 4IOCL 3T3FA 4DR2K 2A6AA 5DMRA 3KTQA 4XEIA 1EXQA 2IIRA 5LY3A 3K5LA 1D9FA 1GOCA 4IDHA 4Z4FA 2HSTA 2BGGA 3FFIA 4H4OA 1QQOA 3E9PA 4CVNE 4QAGA 1TYQA 1X1PA 2QWPA 3KHYA 3PX4A 3CG7A 4FWQA 2G8UA 4WQ5A 4BRDA 4DV7K 1VRUA 4JRQA 3SUOA 1VQMN 3EZWA 4QS9A 2OANA 3ENBA 3U3GA 4JS4A 2NNWA 2D1KA 4GMJB 2EHGA 1XC3A 4JKEA 3O3GA 3BP8A 3OYBA 4JKAA 4A61A 3I8DA 1WOQA 1NGJA 5BR8K 3Q7BA 1VSLA 3L2QA 4FZZA 3G25A 2BTFA 3F2KA 5I9EB 1NGCA 1Z26A 1U48A 1NGIA 1TKZA 3NHGA 3L2RA 4DR7K 1WB9A 2NRZA 2YJEA 5FPMA 5C42A 3VTHA 4FVMA 1VQLN 5FROA 3QDKA 2Y1IA 4YOWA 1VSEA 4KTZA 1VHXA 4BY9C 1HNXK 1Q7YO 4IO8A 4LFBK 3WXLA 4JLHA 2B6AA 4B3SK 1HYSA 4B3RK 4GVEA 4DTOA 2EWSA 3G0ZA 3U8XA 5J2QA 1VQ9N 1N32K 5CZ1A 5JICA 4CEOA 5M1NA 3DRPA 2D4WA 1TGOA 3LAKA 2OTLN 4G9ZA 4A2AA 4BG9A 4CIGA 3DLEA 5AQUA 3SAGA 2VGMA 1LV5A 1REVA 3QBWA 4BGAA 1TKTA 1HPMA 4DG1A 1JL2A 4JKGB 3EY1A 4J2DA 2ZQBA 1NGGA 3C94A 2UXCK 5FPEA 4JI5K 4GKJK 1Q8IA 1VQ5N 3NH0A 4PKHA 3O9RA 3L4IA 2G8FA 2P9PB 3UKUA 1DT9A 3O1BA 3HSTB 1C1AA 3KWIA 3DLGA 3ZCMA 5AQHA 4BVPA 4PY5A 4L3QA 5M1QA 1BCMA 4DF8A 4FJGA 5HL7L 2P9SA 2V7YA 5GAHP 3NDKA 2CGJA 3V9ZA 2G8VA 4EFHA 5K14A 4E3SA 4HUGA 4C8MA 4PHTX 1L3SA 4W5OA 4EZ9A 1VAZA 3CYMA 1ATRA 4OJRA 2I7NA 1A5VA 3HYFA 4KB0A 4CZJA 2HHWA 2Q0UA 4AHVA 4H5WA 1ZBIA 2QKKA 4XH4A 1D5AA 5I3UA 4JI1K 1TKXA 2NRRA 4BWJA 2KW4A 3VF6A 5CE3A 2HOEA 4CHYA 3VGLA 1LCUA 5AQLA 2XY7A 1NK8A 4OGCA 4PL7A 3E01A 5M1KA 1JLEA 1HLUA 5T7BA 3CJBA 2P9KA 5KQDA 4E7JA 4F2SA 3VQ7A 1XMQK 2P9LA 2ASMA 3HL8A 5BRHA 4NO7A 3VQAA 1OH5A 2F4VK 1TAUA 2HBKA 1HNZK 2HW3A 1G15A 2I5JA 1LW2A 5GAEP 2QA4N 4B3MK 2OPSA 3NBPA 4M7XA 4DR1K 4FLTA 2X78A 4I6MA 2KHOA 2A1SA 1RT3A 3LDQA 3SZ2A 1HQEA 3SV3A 1K8KA 2E1YA 3TR8A 4BR9A 3AVNA 2GUPA 4F2RA 4B9MA 3L3UA 4H0VB 3NF9A 3CCUN 3F73A 1BDGA 1N6QA 5AQOA 1D4XA 3TTDA 2PZSA 3LWLA 4BROA 1GLEG 3LM2A 3ENHA 2I7PA 4B3TK 3HVRA 3L4QA 4IKFA 3DRSA 3JS6A 4DHYA 4OPJA 1NJWA 3RRGA 3G71N 3GOIA 2P9LB 3AVIA 2IVPA 3GG4A 1ASUA 4NLBA 3ID6A 1WBBA 5F0XA 4CF1A 1C0MA 2E2NA 3RSEB 1KAZA 1KC8O 4JI3K 2P9KB 3ZSQA 3O4NA 1JLAA 3AVHA 4CEZA 2NUBA 2E5LK 1HKGA 2HBMA 3AGRA 3BZKA 4RCHA 3NF8A 4FL9A 4BACA 1NGBA 4Z4EA 4LFAK 4Q5VA 1KXPA 3V1RA 2HBJA 3OHRA 3JYTA 1T7PA 4FXDA 1RT6A 5HRNA 3CMEN 5C10A 3HOTA 4FJ7A 3OA9A 2JWLA 3BY5A 1LWCA 2YI1A 1TYQB 2IGIA 1XI1A 4CJPA 3DLHA 2GWKA 3C7NB 1QVGM 2HHXA 1BISA 1BGXT 4WF9L 1JL1A 1X3MA 1LW0A 4YNQA 3K5OA 1BWFO 4CK3A 2E88A 3VQ4A 3W3DA 3O9UA 3CPWM 3THWA 3JSMA 4H0TB 3TTFA 3P4IA 3A8YA 4CEFA 1XNRK 3AAPA 4FPAA 3D2FB 1YJ9N 2Z1HA 2DY4A 4IDKA 1NGDA 1YF5L 1JXBA 3D7EO 3QEXA 1C6VA 4CJUA 3WEEB 2DFHA 3O9TA 5J2MA 3IMXA 3VN5A 3OY9A 2E2QA 2HHHK 3CPEA 1ZBLA 1R59O 1HR0K 3L8BA 1KAYA 3VGKA 1WSIA 1ZYQA 1VK0A 2AP1A 4JKCA 4OLAA 1C1BA 4DV0K 5AQTA 4RW9A 2UUAK 4DQQA 2LSNA 1UOCA 4DLEA 3K0SA 3S3MA 3ZT0A 2Q97A 2YNFA 4BVOA 1RDDA 2VG5A 1CZBA 1SZ2A 2D0OA 3IS9A 4BR7A 3QO9A 3TPQA 1OVYA 4IEEA 4IEIA 1N36K 3V9WA 1RTDA 3CCSN 2QXFA 4DTRA 3WEEA 1MA9B 3MEEA 4AHRA 4OKEA 2E8AA 3A5NC 4E1NA 1S6PA 3NVKA 2O8FA 3NF7A 5CY4A 1DKGD 3I33A 3MN5A 4I6MB 1Q18A 1RCHA 3RWUA 3BF3A 3HPOA 4LF8K 3SQ0A 4ILHA 4DUZK 2HBLA 5CZ2A 1Y64A 3P83D 3ZETA 2RE2A 4W5RA 5BRFA 4DSEA 4GVMA 3IAYA 5E26A 1FK9A 5AR0A 2W40A 2FSKA 2Q0RA 4M42A 3C65A 2DPNA 1V4SA 3AA4A 1R0AA 5BR9A 4JI2K 4DSJA 3QBXA 3NVMA 2O8CA 3G4SN 5J1EA 3MWPA 4CERA 5HRRA 3ZSXA 3S3OA 4GW6A 4H0XB 1KCFA 4H0YB 2AJQA 3IKMA 3ZSYA 1GLLO 1YJWN 3QETA 4ELVA 2VG7A 2YHAA 3SMSA 3SUPA 5HBMA 1A5WA 3NH1A 5KGXA 3EL2A 4E7IA 1ATNA 3R8EA 1S1VA 1C0FA 3RVCA 1ESVA 2OCEA 3SQ4A 4CJ3A 4JS5A 1LOTB 4A2BA 5C15A 2W41A 4KI4A 4DSFA 4IFYA 3MEGA 4DU1A 2W6KA 3KKRA 4IOAL 3SYZA 4RW4A 1W7AA 3O6WA 1YJNN 4FWKA 2E20A 3WT0A 4IJNA 4FJLA 1W97L 2A40A 4AH9A 4FZXC 1M1KO 1BUPA 1VSJA 2FBVA 2YKMA 4CJFA 3T1AA 3NF6A 4CIFA 3AA2A 2O4IA 4YOUA 4FM2A 2QXLA 3KLHA 5IT9O 4HTLA 4IO9L 2V51B 5B8HA 2O8EB 4B08A 1C0TA 3LP3A 5C25A 4CJLA 4JI8K 4FOIA 3CC7N 3FZKA 3MN6A 4FJJA 3ITHA 5AZJA 4BRLA 4AF1A 1MDUB 3FGUA 4C8NA 3ATUA 1KLMA 2Y1JA 3G10A 1OH8A 1MWMA 3T19A 5FRMA 1BO5O 1S9EA 4KH5A 1IV0A 2HF3A 3P31A 4FJKA 4CBUA 1W0HA 5GAGP 3O3HA 3SUQA 4ELUA 4LSLA 3AVAA 3QFPA 4F3TA 3TAMA 3QB0A 2X6NA 4ILJA 4DS4A 2WONA 4LFCK 4BR4A 3NMUA 3M8RA 1NGAA 1YTUA 3GBTA 4DQ8A 2Z1JA 4N76A 4JV5K 1KFDA 1RFQA 1YIJN 1EP4A 4A5AA 2XY8A 1WN7A 3QLHA 5DK5A 4BDZA 3D0PA 4R79A 3I56N 3LZJA 4RW6A 2ZM6K 4H03B 1J5EK 3PV8A 3R3LA 1FKOA 1SV5A 4BRNA 3HP9A 4CJ4A 1VQ7N 4KHPK 1HPZA 4CGFA 1JLBA 3SNNA 2GTDA 3P39A 1UA0A 1KLNA 4ISEA 3VQ6A 1Z25A 3KK1A 2VQFK 3CJCA 4YY3K 3DLRA 4RTFD 1HNVA 2IOCA 3HT3A 4FLUA 3CC2N 1NK0A 5FRNA 3HO1A 1N33K 3M5RA 1XMOK 4GV9A 1MU2A 4BWMA 5BPNA 4HHTA 1VQ8N 4ID1A 1RILA 2QWLA 1D9DA 2P9IA 4GV6A 3LP1A 1NMNA 1KD1O 3QESA 3MDQA 3KK2A 3FFKB 3PSIA 4C1NI 2P51A 2YKNA 4CJKA 1FJGK 1WAJA 4B9VA 2KFZA 2E1ZA 4Z4HA 2A41A 4FWNA 5AJ3K 4NXNK 3AO3A 3I0RA 3TAGA 3L2VA 3MECA 4Y0WA 3M3ZA 5FDLA 3OYAA 3LPTA 3OYHA 3K9JA 1X9MA 2G8IA 2H3GX 3D45A 5CYQA 3H45C 3KVGA 2VCPA 3M1FA 3MN7A 2NRHA 1WAFA 4C23A 1E3MA 3N4PA 4DUYK 4H5RA 2J4RA 4ISGA 3LDPA 4YORA 3M8PA 3SK3A 3RMDA 3DLBA 1T3VA 3O08A 4BRCA 2KFNA 3TSPA 3ULEB 3A5MC 5JLHA 2PFUA 3MCAB 4DV1K 3V1QA 4R5PA 1TL3A 1YXQA 4BRPA 3OYIA 4DSIA 1BI4A 3THXA 2KKZA 4CZIA 3OYDA 4JEPA 2WBNA 4OPKA 3SQ1A 5GADP 3SMPA 4K43A 4M7YA 1IKWA 3OYKA 1NLVA 3MXJA 1BOTO 4TSXA 1JKHA 2O8CB 2DTUA 3RR8A 1HNWK 5TKYA 5LJWA 1YTAA 4DV5K 5J2PA 2UUCK 3HBTA 4FLWA 2HHQA 1ZBFA 4Z94A 3R6MA 3ENOA 3CCJN 3PX0A 4JNEA 3U4LA 4ZTJA 4H5NA 4YOXA 1BIUA 4B1XB 1HMVA 2Q31A 4CEDA 3HPHA 4DR5K 3C6HA 1T8EA 3K59A 1BQMA 4IFEA 2XY6A 4O55A 1JJ2M 4PQUA 4DV4K 5BREA 2NRTA 1EO1A 3D2EB 2HHVA 1BU6O 1KVBA 2OPPA 1NJZA 1J54A 1RDAA 4CBXA 1Q86O 4IBNA 1CXUA 3ASMA 3KWGA 1VQNN 1V4TA 1ASVA 3S3NA 3DXKB 3ZSWA 1RT2A 4N5SA 5AFUA 2VWBA 4FWPA 1NNEA 1RBRA 1U6ZA 3CJAA 4PKIA 3AVKA 2FSNA 3PSFA 1RBSA 3VENA 1C1CA 1NGEA 1TVRA 1T6DA 1K6YA 3P5JA 4IJAA 1RBVA 2ZGYA 3PLAA 4FPBA 2WFBA 4G1QA 1RDCA 5H1SQ 4KTWA 2VWKA 1ITGA 2QWMA 4J2EA 1TKDA 4FJIA 1BA1A 1OH7A 1DEJA 4O5BA 3MAQA 5CYMA 3WUHA 3ZSRA 3SPZA 1X9JA 3KLGA 4KHNA 1N34K 3RR7A 3CXCM 4B9LA 3QEWA 4CZGA 4FJ9A 4JI7K 5DM6L 4DS5A 1JCFA 5AQMA 3EO3A 4ZHRA 5AQVA 3AO5A 4LH4A 4DR3K 2FBTA 2RF2A 1VQKN 2F9TA 3M6GA 4FW1A 3VEVA 5ADXA 4HVJA 3UKRA 4FK0A 1GLFO 2XY5A 4LF9K 1QSLA 3ATVA 5AQGA 2ASOA 4H0PA 2QTDA 3GL1A 3VETA 1HJOA 1SQKA 4ILGB 4DLGA 4W5QA 4DR6K 3RTVA 1NK5A 4OVLA 1JCEA 4DQPA 1IBKK 4M3ZA 1FKPA 4JYAK 1DLOA 4W5NA 4WQ4A 1LWFA 4FCYA 3HM8A 5FLXO 5MLCQ 3NFAA 3ZX0A 4AHCA 3DOKA 3VEWA 3KD1E 1W9HA 4DTSA 2D0BA 3C6TA 3OS2A 1XNQK 3ALYA 2Z1GA 4B9UA 4CJSA 3VQ9A 4DFPA 1EETA 2ASPA 4CE9A 3CMAN 2ZE2A 4KH4A 3CETA 1WSGA 5BPMA 4Y1DA 5AQXA 4DSLA 1ZBUA 4FYDA 4B8CA 1LAVA 3J81O 4AM7A 3SAHA 4BRGA 3TSUA 4E89A 2ZJQL 1YITN 2ZD1A 3OW2M 4ZTFA 3VTIA 3QMLA 3UKRB 3IFRA 1F21A 4JK9A 5CHIA 3OJSA 5SZTA 4C8LA 3AARA 5D3GA 2B4JA 1L3TA 4O44A 4K42A 2KZZA 3EKUA 3J80O 4F4KA 4PWDA 1JCGA 3VQ5A 3AVBA 2F9WA 1TUYA 3MCPA 4AHTA 4DTPA 4K25A 4CEEA 3FR0A 2ZJRL 3DXMA 1RNHA 1P90A 2XO7A 1O1WA 2Q2RA 4GY2B 4CI6A 2P9NA 5KGWA 3V4IA 3AVMA 1EX4A 4E1MA 3G6EN 5HLFA 4K41A 1S1WA 1FW6A 3T1HK 4B9SA 3MX2A 3PY8A 1NM1A 2RKIA 1NJYA 3V9XA 3AY9A 3NGZA 1QS4A 4ICLA 2BH1A 4OKJA 2P9UB 4HWIA 3ZYYX 5EVZA 4CJTA 4F3OA 3MXIA 4BE0A 1S1TA 3QINA 3VOVA 3AO2A 4UQGA 4H5TA 4WFAL 4DTUA 3NE6A 1S1XA 2NRXA 3FZFA 2XHBA 5HOOA 3QEIA 2G8HA 1VQ4N 3ZT3A 3MXMA 1WNSA 3O5BA 3EE8A 4B1WB 4MLEA 4KB1A 3A5OC 4WQ5C 4RWTA 3J7YP 3D6RA 5E41A 2D5RA 3E66A 4LC9B 1RT7A 3TAQA 2KTQA 2YHWA 4DTNA 3IRXA 3SJHA 2WUSA 3TANA 3THYB 3H1QA 1SUQA 4CJEA 5I42A 3JXUA 3CD6N 2UXBK 2O8BA 4CESA 2OZMA 4NYFA 1TK0A 1TK8A 4DQIA 1YAGA 2EX3A 4X62K 3K58A 1RDWX 4CF9A 1NWKA 3O8MA 2HB5A 3KZBA 2WTUA 3BGRA 3SLCA 4CZEA 1DTTA 2D0CA 1LWEA 4CJVA 4AQYK 4DFKA 4DMNA 4X66K 5KRSA 3OYJA 3H3OB 3DRRA 1A5XA 4BDYA 2E4LA 3VA0A 1OKJA 3NGYA 4M45A 2HHTA 3OYNA 3VQQA 3TAEA 1IG8A 1N8RO 4Q0BA 2UYTA 1ZC6A 4DQSA 5AZIA 4BGBA 1QQCA 5F1XA 4M3WA 1WLJA 1EWQA 4AHUA 4V19S 3QNOA 1IG9A 2OA8A 4JI4K 3RSEA 5M1FA 3SV4A 1KFSA 4OPAA 5ELZA 4EP4A 3MWTA 4CEQA 5LMNK 1QQMA 3KLIA 3O1WA 1T05A 3CFPA 4CJWA 5CR4A 4B9TA 2DFEA 1N5YA 1RT1A 5AQRA 5JS1A 3BDPA 3L2WA 3CCMN 4JKHA 5AQQA 2YHYA 2FXUA 4IXCA 1GLCG 1D8YA 1QHAA 4FWSA 2V52B 3CJ9A 4FWMA 4KBOA 5AQPA 5AQKA 4XH5A 2XRIA 1WSFA 1YVNA 2P9NB 1U47A 1EWRA 1W2BM 1BQNA 3DLLL 3QERA 4BE1A 5AQYA 1Q82O 1S22A 4CZLA 3QNNA 4MDBA 4FJNA 2GWJA 2RPIA 3WXIA 2JGUA 1U45A 2HNDA 1J5OA 2HVHA 1S9GA 3J8AA 4RW8A 5KPZA 2KZMA 2ATQA 4DR4K 1JLGA 3VEOA 4NCAA 1T03A 1WUAA 3CF5L 1YI2N 4QS7A 3KK3A 2PYJA 4JD2B 4FJ8A 4DV6K 3ISNC 4CJ5A 4M3XA 2X74A 3V81A 3H1VX 1BA0A 4PKGA 3N4QA 3T69A 3V6DA 3VPZA 1VSFA 3CI5A 1XQSC 2GX9A 4O0JA 2O4GA 1WSEA 2NRVA 4X64K 1I94K 2FSJA 3PO4A 4H0OA 4OPHA 2RHKA 1KVCA 2JLEA 3B8AX 5M1OA 5BN9A 1I3AA 4IFVA 4BQZA 2QM1A 4EHUA 2HMIA 4AM6A 3LDSA 4E19A 3WXMB 4OKKA 2B5JA 2OPRA 4CBWA 4BC5A 1EKEA 3K9KA 1SS6A 2ZGZA 3VEYA 4BRIA 3OYCA 2A42A 3BZCA 4BRAA 3AA5X 1XWLA 4NB4A 2YCHA 4B3OA 3PX6A 1NJXA 1GOAA 4O5FA 1JLFA 3O4WA 3AVCA 1RT4A 2JWKA 4FJ5A 4CECA 4DFJA 1VRTA 5GINA 3M8QA 4OGEA 1RBUA 3SJJA 3SPYA 1DGKN 3VQEA 4KTQA 5AQZA 4MO5A 4JD2A 5JVHL 4BC3A 4CJQA 1JLCA 2NZTA 1U49A 2IVNA 1Z6RA 1I39A 1C0UA 4DF4A 4KV8A 3OTOK 1B9FA 2AA4A 4AHSA 4NLCA 1YHQN 2KLAA 4CHPA 5SWMA 4DKWA 5F2RA 2IC3A 4M3TA 3VQDA 4IWVA 5C0YA 3V9UA 1RDBA 2PYLA 1XUPO 2ZWHA 4MO4A 3NGIA 3HK2A 4CEAA 4BC4A 4KKOA 1K8KB 3VEXA 1S3XA 3D2EA 4LH5A 4ELTA 2YNIA 3TAPA 2QI2A 4B9NA 4IG3A 1S5JA 4KAZA 1T44A 1T6CA 1QVFM 3WXJA 2HHUA 3AVFA 3U6FA 3E1YA 3THWB 4Z0UA 2HMPA 3U9DA 3FZHA 4K0KK 2A3ZA 5JLFA 4B8AB 4BREA 3LM9A 4DTMA 3E9LA 3NCIA 1QSSA 5JVGL 3WXKA 1E4FT 3W0LA 4YHHK 3KIOA 1U2VA 4KFBA 3SQ2A 3DXKA 3P1GA 3WNHA 4BRFA 1KSPA 4FK4A 4JHDB 3A5LC 1KVAA 2O8FB 1NU0A 1IBMK 3HSCA 3SI6A 3OS0A 4N47A 1HYVA 4JI6K 5GIOA 2YV0X 1Q9YA 3HI0A 3VESA 4JAXA 3UB5A 4B1VA 1GLBG 1TV6A 1QTMA 1Q81O 4M63C 3H3NO 4J2AA 4K8ZA 3P38A 5EX5A 3D2FA 5KQ8A 4LD0A 2HF4A 2QKBA 4PUOA 3CQYA 3TWHA 4M3RA 3LWMA 2E6LA 4KHSA 3OVNA 4CEBA 2X6SA 1GLAG 1NMDA 2YNGA 3ZX2A 1BG3A 3SBGA 3HRGA 3K5NA 3ZSZA 4CZHA 3THYA 5KPTA 4LF7K 4BRHA 4WE1A 4C8OA 1E4GT 1KRPA 1QE1A 2A5XA 3HM9A 4EHTA 1WBDA 1S72N 5BN8A 4CZFA 3QEVA 3PO5A 2HNYA 2IDOA 1CXQA 3C95A 4CK2A 2OPQA 3EEQA 1BCOA 2PY5A 2D0PA 4JHDA 3KLEA 1SL1A 4I9QA 3CJ7A 3H46O 1X9SA 4FJXA 3LPUA 4QCLA 4HTUA 4WQ4C 1TAQA 3LANA 1NKBA 2QW9A 3HXMA 3PIOL 4IZ9A 2OYQA 1HKCA 2P9SB 5FPDA 2ITMA 4Y1CA 4I2QA 4BRMA 3M8SA 4KREA 1KAXA 4JN4A 3NAEA 4J8FA 5HP1A 1RTIA 1VSIA 3ZX3A 3J7ZO 4O0IA 2ETJA 4O8UA 1OVQA 1QZ5A 2E2OA 1OH6A 4FLXA 4DTJA 4DQRA 1S6QA 5LL6Z 3OYGA 4HCBA 3VF4A 3CFRA 2GEMA 4CIEA 1UA1A 4AILC 5HRPA 2GUIA 4DU3A 1L3UA 3WNFA 3QIPA 4CCHA 4GV3A 1X3NA 3MK6A 4IOXA 5EXWA 1VQON 4GKKK 3AGKA 3QICA 5KRTA 2DFFA 2FBYA 3O3FA 3QFUA 1ZBSA 2IVOA 3U9ZA 1WSJA 4CGHA 5C2DA 4QS8A 5LMUK 4OX9K 5AQWA 2NLXA 1ILYA 3SCXA 2PAVA 4FWOA 3MN9A 3R1XA 4YOVA 1S1UA 4UY8O 4M41A 4Z4GA 4O8KA 3BEXA 1IKVA 4FW2A 2VGNA 1XHXA 4IG0A 1SKWA 3H08A 2E6MA 3AAQA 4FSVA 4B1UB 4K8XA 5KPRA 3J7AP 2VYPA 2GV9A 1IKYA 1NGHA 4CD3A 3DI6A 4E7HA 3ZETB 1SKSA 1HJRA 4CFBA 4A62A 1IJJA 3OYMA 1QSYA 4ISFA 3AO1A 4M3UA 3AVGA 3EN9A 3VQPA 1JXEA 3F9KA 1L3VA 1NK4A 3IUCA 2D0AA 1LAWA 3O80A 3OYFA 1O13A 4PA1A 2YHXA 2CH6A 3OBYA 3WNGA 2PBDA 2V7ZA 3AO4A 4LSNA 3LZIA 1BIZA 5J2NA 4I9LA 3VEZA 3TAFA 4B9QA 4I2PA 5E84A 3KD5E 4CFDA 3ZEUA 3LAMA 3EE9A 4FLVA 2WOMA 3TI0A 3LL3A 1TL1A 1VSMA 2F8TA 3TARA 3WQUA 2QWNA 4CD1A 3VQCA 4EIAA 2O8BB 3CIPA 4HCCA 4I7FA 2HHSA 3CERA 1X9WA 4C8KA 1ZBHA 3L0QA 4NYNA 5AQJA 2F96A 1BL3A 3ULDA 2O8DA 4CZMA 4LY7A 1B92A 3B6PA 3CCEN 4CFCA 1XHZA 1NOYA 5EU7A 1NG9A 2FC0A 5AZIB 1HYZA 1SL2A 1RTHA 1UWBA 3C6UA 4PL8A 2VG6A 3IG1A 4JKGA 4E0DA 1RTJA 1BHLA 4H5VA 2QWQA 3ZSOA 2P9IB 4CGGA 3UE5A 4BG8A 4E7LA 1NKEA 2CH5A 1K9MO 4U7BA 3TU5A 3VQ8A 3AVLA 4BR2A 3BUZB 4BRQA 1J53A 3AV9A 1RBTA 5A2QO 4LF6K 3EZ5A 2P9UA 3UIQA 1NK7A 5KTQA 2OTJN 4LF4K 4E7KA 1UAXA 4A57A 1NOZA 4CGIA 2VWJA 2FF6A 3FE1A 1CZ9A 1Q9XA 1YVUA 1QQNA 4FLYA 1JLQA 5AQSA 3PIPL 4CF0A 4CHNA 2R7YA 4FZYA 5ADXH 4JK7A 3C7NA 4BDPA 2Q36A 4EZ6A 1SAZA 4B1ZA 4XIUA 4YFUA 3RMBA 4FVUA 4MQ3A 4F8RA 3CQXA 4FWRA 4DWIA 3DMJA 4DV3K 1KTQA 4KPYA 4M3YA 3KLFA 5AQNA 4KO0A 3OBWA 4EP5A 3CCLN 4JKBA 1NBWA 4CF2A 1RT5A 1U2VB 1NK6A 1MWKA 3GE1A 3ID8A 3PUFA 3DWLA 3ZT2A 4BR0A 1VQ6N 2Q1NA 3FLCO 4CF8A 3KJVA 4FJHA 4EAHD 4DFMA 3F9MA 4JRPA 3VERA 2KQ2A 3HP6A 4WYBA 4CHQA 4X65K 3TSQA 1KQSM 2RN2A 3LALA 3DYAA 4WFNL 4XH1A 2QWOA 5EOYA 3IDHA 4A5BA 3L3VA 1G99A 1IKXA 3R9PA 3ZEUB 3I0SA 2BANA 5C24A 4OO1J 4E1JA 3KKSA 3CM6A 3SBTA 2QWRA 4FLZA 5HRSA 1RDUA 4GNIA 4BQLA 3THXB 3MEDA 4CJ7A 1IBLK 3CJ1A 3LP0A 4RG8A 2E2PA 3DAWA 2F8SA 4HUFA 3CQ8A 3DXMB 3WQTA 3CCVN 5BRDA 2YJFA 3MX5A 4L8RB 1NGFA 3QEPA 3VF2A 1U4BA 3AA3A 1NKCA 2QEXN 3SAFA 3K2PA 3HTVA 3EKSA 5M1PA 2IAJA 2FLOA 1HKBA 2BUPA 3FZLA 4H8KA 3FZMA 4YDUC 3ZT1A 1NK9A 2O8DB 1VSKA 4CHZA 3ZSVA 1QHTA 2P1JA 4YOTA 1HNIA 3HJFA 4CFAA 4BRKA 4JK8A 3V1OA 3VQBA 2W6LA 3A0IX 1ATSA 2P9PA 3UKUB 3CCRN 4ID5A 3LDNA 3RRHA 3QIOA 4Z4CA 1J6ZA 2CGLA 2ZJPL 3H6EA 4FM0A 1M90O 3DJCA 2QK9A 4NCGA 4MDAA 3S41A 3OYEA 4YOYA 4FK2A 4YDUA 3HZ6A 4FJMA 3OYLA 4KHUA 2Z1IA 3I8BA 3Q7CA 3I55N 2GBZA 3GDQA 1ASWA 5C12A 3O9SA 2G8WA 2ZF5O 4U67L 1RGIA 4FWLA 2HNZA 4DTXA 5IWAK 4CGJA 5TKWA 3HVTA 4Z4IA 1P8ZA 5GIPA 2YX6A 5HROA 4DU4A 1CZAN 4BC2A 3LDOA 4N41A 3CM5A 2IS3A 3ZLJA 5JMVA 1GLJO 3BF1A 1FXXA 4KRFA 3B6OA 1NJIO 1B9DA 4KHQA 5C2FA 3DLKA 4N56A 2A1RA 3WNEA 1Y97A 4KI6A 2BE2A 1VSDA 4MFBA 4WFBL 1XC9A 4KHWA 4H4MA 1K8AO 3L6QA 5KI6A 4CZKA 2P5GA 3L2UA 3RMAA 4NXMK 2G8KA 1YT3A 3E9OA 1GOBA 3TABA 4B1YB 4CGDA 2GELA 3LDLA 5AZJB 4FM1A 2F7TA 1VSHA 4J2BA 3O4QA 3DOLA 1VQPN 3DM2A 1H1VA 1U04A 4DV2K 3VGMA 3C6AA 3CC4N 2FBXA 3K5MA 4KH6A 2P5OA 1YUWA 3T7ZA 2UU9K 4JI0K 4CJRA 2Q3SA 1IO2A 1HQUA 2O8EA 5BPLA 4FOEA 4JKDA 3OS1A 3ULEA 4CK1A 4W5TA 5AQIA 1WSHA 5JS2A 2BDPA 1J9AA 3KK7A 4F9OA 1BI4B 4DB3A 2YNHA 1C0GA 2YHBA 3HPGA 3A2FA 1SL0A 2WC9A 3F5TA 4CW7B 1DTQA 2CGKA 1TK5A 3C0BA 3AVJA 2UUBK 3CFOA 3EYZA 1K73O 1SKRA 4HUEA
chains in the Genus database with same CATH topology
5AJ3K 4NXNK 4DR7K 4DV6K 2UXBK 4K0KK 4JI8K 4X65K 5IWAK 3T1YK 3J81O 4X62K 2UXDK 1XMQK 1HNXK 4JI2K 4LFBK 2F4VK 4B3SK 4YHHK 4X64K 1I94K 1HNZK 4B3RK 4AQYK 4X66K 4B3MK 4DR1K 5LL6Z 4LF5K 4DUYK 1XNRK 1N32K 3J80O 1IBLK 1IBMK 4GKKK 4JI6K 1N34K 4LFCK 4DV1K 4JI7K 4JV5K 2HHHK 2UXCK 4JI5K 1HR0K 5LMUK 4OX9K 4NXMK 2VQEK 3JAMO 4DR3K 3T1HK 4B3TK 4V19S 4GKJK 4JI4K 2ZM6K 1J5EK 4LF9K 5LMNK 4DV0K 4KHPK 5A2QO 4LF6K 2UUAK 4LF4K 4DR2K 4DV2K 1HNWK 2VQFK 3J7AP 4DV5K 2UUCK 4DR6K 4YY3K 4JI3K 2UU9K 4JI0K 4CVNE 1IBKK 4LF7K 1N33K 4JYAK 2E5LK 3OTOK 4DV7K 1N36K 1XMOK 4DR5K 5FLXO 4LFAK 4DV4K 4DV3K 3J7YP 1XNQK 4LF8K 4DR4K 5BR8K 4CW7B 4JI1K 4DUZK 5IT9O 2UUBK 1FJGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  4NXN K;  4DR7 K;  4DV6 K;  2UXB K;  4K0K K;  4JI8 K;  4X65 K;  5IWA K;  3T1Y K;  3J81 O;  4X62 K;  2UXD K;  1XMQ K;  1HNX K;  4JI2 K;  4LFB K;  2F4V K;  4B3S K;  4YHH K;  4X64 K;  1I94 K;  1HNZ K;  4B3R K;  4AQY K;  4X66 K;  4B3M K;  4DR1 K;  5LL6 Z;  4LF5 K;  4DUY K;  1XNR K;  1N32 K;  3J80 O;  1IBL K;  1IBM K;  4GKK K;  4JI6 K;  1N34 K;  4LFC K;  4DV1 K;  4JI7 K;  4JV5 K;  2HHH K;  2UXC K;  4JI5 K;  1HR0 K;  5LMU K;  4OX9 K;  4NXM K;  2VQE K;  3JAM O;  4DR3 K;  3T1H K;  4B3T K;  4V19 S;  4GKJ K;  4JI4 K;  2ZM6 K;  1J5E K;  4LF9 K;  5LMN K;  4DV0 K;  4KHP K;  5A2Q O;  4LF6 K;  2UUA K;  4LF4 K;  4DR2 K;  4DV2 K;  1HNW K;  2VQF K;  3J7A P;  4DV5 K;  2UUC K;  4DR6 K;  4YY3 K;  4JI3 K;  2UU9 K;  4JI0 K;  4CVN E;  1IBK K;  4LF7 K;  1N33 K;  4JYA K;  2E5L K;  3OTO K;  4DV7 K;  1N36 K;  1XMO K;  4DR5 K;  5FLX O;  4LFA K;  4DV4 K;  4DV3 K;  3J7Y P;  1XNQ K;  4LF8 K;  4DR4 K;  5BR8 K;  4CW7 B;  4JI1 K;  4DUZ K;  5IT9 O;  2UUB K;  1FJG K; 
#chains in the Genus database with same CATH topology
 1IH7 A;  3MMV A;  3ZT4 A;  2NRW A;  3OJU A;  5EY4 A;  1HUX A;  1Z05 A;  3VA3 A;  4C1N K;  1HX1 A;  3T1Y K;  4WCE L;  2UXD K;  4MLH A;  5FPN A;  1EQY A;  2ITG A;  5DM7 L;  3O9Q A;  5AQF A;  3CHW A;  1L5U A;  1CLQ A;  4JKF A;  1QZ6 A;  3THV A;  1GLD G;  4LF5 K;  5AFU H;  1ZXO A;  3LP2 A;  3VMF B;  4BR5 A;  3RMC A;  3U3Y A;  3TTC A;  4NCB A;  4DCH A;  4QOZ B;  4RW7 A;  4O4G A;  2OZS A;  4OLB A;  4BE2 A;  2FF3 B;  4KHY A;  3HOS A;  3K57 A;  4FO0 A;  2VQE K;  3JAM O;  5LJV A;  4DSK A;  2W42 A;  1HRH A;  4CHO A;  3NH2 A;  4A59 A;  2HVI A;  3CCQ N;  3S9H A;  3SUN A;  1TUU A;  3V9S A;  4IOC L;  3T3F A;  4DR2 K;  2A6A A;  5DMR A;  3KTQ A;  4XEI A;  1EXQ A;  2IIR A;  5LY3 A;  3K5L A;  1D9F A;  1GOC A;  4IDH A;  4Z4F A;  2HST A;  2BGG A;  3FFI A;  4H4O A;  1QQO A;  3E9P A;  4CVN E;  4QAG A;  1TYQ A;  1X1P A;  2QWP A;  3KHY A;  3PX4 A;  3CG7 A;  4FWQ A;  2G8U A;  4WQ5 A;  4BRD A;  4DV7 K;  1VRU A;  4JRQ A;  3SUO A;  1VQM N;  3EZW A;  4QS9 A;  2OAN A;  3ENB A;  3U3G A;  4JS4 A;  2NNW A;  2D1K A;  4GMJ B;  2EHG A;  1XC3 A;  4JKE A;  3O3G A;  3BP8 A;  3OYB A;  4JKA A;  4A61 A;  3I8D A;  1WOQ A;  1NGJ A;  5BR8 K;  3Q7B A;  1VSL A;  3L2Q A;  4FZZ A;  3G25 A;  2BTF A;  3F2K A;  5I9E B;  1NGC A;  1Z26 A;  1U48 A;  1NGI A;  1TKZ A;  3NHG A;  3L2R A;  4DR7 K;  1WB9 A;  2NRZ A;  2YJE A;  5FPM A;  5C42 A;  3VTH A;  4FVM A;  1VQL N;  5FRO A;  3QDK A;  2Y1I A;  4YOW A;  1VSE A;  4KTZ A;  1VHX A;  4BY9 C;  1HNX K;  1Q7Y O;  4IO8 A;  4LFB K;  3WXL A;  4JLH A;  2B6A A;  4B3S K;  1HYS A;  4B3R K;  4GVE A;  4DTO A;  2EWS A;  3G0Z A;  3U8X A;  5J2Q A;  1VQ9 N;  1N32 K;  5CZ1 A;  5JIC A;  4CEO A;  5M1N A;  3DRP A;  2D4W A;  1TGO A;  3LAK A;  2OTL N;  4G9Z A;  4A2A A;  4BG9 A;  4CIG A;  3DLE A;  5AQU A;  3SAG A;  2VGM A;  1LV5 A;  1REV A;  3QBW A;  4BGA A;  1TKT A;  1HPM A;  4DG1 A;  1JL2 A;  4JKG B;  3EY1 A;  4J2D A;  2ZQB A;  1NGG A;  3C94 A;  2UXC K;  5FPE A;  4JI5 K;  4GKJ K;  1Q8I A;  1VQ5 N;  3NH0 A;  4PKH A;  3O9R A;  3L4I A;  2G8F A;  2P9P B;  3UKU A;  1DT9 A;  3O1B A;  3HST B;  1C1A A;  3KWI A;  3DLG A;  3ZCM A;  5AQH A;  4BVP A;  4PY5 A;  4L3Q A;  5M1Q A;  1BCM A;  4DF8 A;  4FJG A;  5HL7 L;  2P9S A;  2V7Y A;  5GAH P;  3NDK A;  2CGJ A;  3V9Z A;  2G8V A;  4EFH A;  5K14 A;  4E3S A;  4HUG A;  4C8M A;  4PHT X;  1L3S A;  4W5O A;  4EZ9 A;  1VAZ A;  3CYM A;  1ATR A;  4OJR A;  2I7N A;  1A5V A;  3HYF A;  4KB0 A;  4CZJ A;  2HHW A;  2Q0U A;  4AHV A;  4H5W A;  1ZBI A;  2QKK A;  4XH4 A;  1D5A A;  5I3U A;  4JI1 K;  1TKX A;  2NRR A;  4BWJ A;  2KW4 A;  3VF6 A;  5CE3 A;  2HOE A;  4CHY A;  3VGL A;  1LCU A;  5AQL A;  2XY7 A;  1NK8 A;  4OGC A;  4PL7 A;  3E01 A;  5M1K A;  1JLE A;  1HLU A;  5T7B A;  3CJB A;  2P9K A;  5KQD A;  4E7J A;  4F2S A;  3VQ7 A;  1XMQ K;  2P9L A;  2ASM A;  3HL8 A;  5BRH A;  4NO7 A;  3VQA A;  1OH5 A;  2F4V K;  1TAU A;  2HBK A;  1HNZ K;  2HW3 A;  1G15 A;  2I5J A;  1LW2 A;  5GAE P;  2QA4 N;  4B3M K;  2OPS A;  3NBP A;  4M7X A;  4DR1 K;  4FLT A;  2X78 A;  4I6M A;  2KHO A;  2A1S A;  1RT3 A;  3LDQ A;  3SZ2 A;  1HQE A;  3SV3 A;  1K8K A;  2E1Y A;  3TR8 A;  4BR9 A;  3AVN A;  2GUP A;  4F2R A;  4B9M A;  3L3U A;  4H0V B;  3NF9 A;  3CCU N;  3F73 A;  1BDG A;  1N6Q A;  5AQO A;  1D4X A;  3TTD A;  2PZS A;  3LWL A;  4BRO A;  1GLE G;  3LM2 A;  3ENH A;  2I7P A;  4B3T K;  3HVR A;  3L4Q A;  4IKF A;  3DRS A;  3JS6 A;  4DHY A;  4OPJ A;  1NJW A;  3RRG A;  3G71 N;  3GOI A;  2P9L B;  3AVI A;  2IVP A;  3GG4 A;  1ASU A;  4NLB A;  3ID6 A;  1WBB A;  5F0X A;  4CF1 A;  1C0M A;  2E2N A;  3RSE B;  1KAZ A;  1KC8 O;  4JI3 K;  2P9K B;  3ZSQ A;  3O4N A;  1JLA A;  3AVH A;  4CEZ A;  2NUB A;  2E5L K;  1HKG A;  2HBM A;  3AGR A;  3BZK A;  4RCH A;  3NF8 A;  4FL9 A;  4BAC A;  1NGB A;  4Z4E A;  4LFA K;  4Q5V A;  1KXP A;  3V1R A;  2HBJ A;  3OHR A;  3JYT A;  1T7P A;  4FXD A;  1RT6 A;  5HRN A;  3CME N;  5C10 A;  3HOT A;  4FJ7 A;  3OA9 A;  2JWL A;  3BY5 A;  1LWC A;  2YI1 A;  1TYQ B;  2IGI A;  1XI1 A;  4CJP A;  3DLH A;  2GWK A;  3C7N B;  1QVG M;  2HHX A;  1BIS A;  1BGX T;  4WF9 L;  1JL1 A;  1X3M A;  1LW0 A;  4YNQ A;  3K5O A;  1BWF O;  4CK3 A;  2E88 A;  3VQ4 A;  3W3D A;  3O9U A;  3CPW M;  3THW A;  3JSM A;  4H0T B;  3TTF A;  3P4I A;  3A8Y A;  4CEF A;  1XNR K;  3AAP A;  4FPA A;  3D2F B;  1YJ9 N;  2Z1H A;  2DY4 A;  4IDK A;  1NGD A;  1YF5 L;  1JXB A;  3D7E O;  3QEX A;  1C6V A;  4CJU A;  3WEE B;  2DFH A;  3O9T A;  5J2M A;  3IMX A;  3VN5 A;  3OY9 A;  2E2Q A;  2HHH K;  3CPE A;  1ZBL A;  1R59 O;  1HR0 K;  3L8B A;  1KAY A;  3VGK A;  1WSI A;  1ZYQ A;  1VK0 A;  2AP1 A;  4JKC A;  4OLA A;  1C1B A;  4DV0 K;  5AQT A;  4RW9 A;  2UUA K;  4DQQ A;  2LSN A;  1UOC A;  4DLE A;  3K0S A;  3S3M A;  3ZT0 A;  2Q97 A;  2YNF A;  4BVO A;  1RDD A;  2VG5 A;  1CZB A;  1SZ2 A;  2D0O A;  3IS9 A;  4BR7 A;  3QO9 A;  3TPQ A;  1OVY A;  4IEE A;  4IEI A;  1N36 K;  3V9W A;  1RTD A;  3CCS N;  2QXF A;  4DTR A;  3WEE A;  1MA9 B;  3MEE A;  4AHR A;  4OKE A;  2E8A A;  3A5N C;  4E1N A;  1S6P A;  3NVK A;  2O8F A;  3NF7 A;  5CY4 A;  1DKG D;  3I33 A;  3MN5 A;  4I6M B;  1Q18 A;  1RCH A;  3RWU A;  3BF3 A;  3HPO A;  4LF8 K;  3SQ0 A;  4ILH A;  4DUZ K;  2HBL A;  5CZ2 A;  1Y64 A;  3P83 D;  3ZET A;  2RE2 A;  4W5R A;  5BRF A;  4DSE A;  4GVM A;  3IAY A;  5E26 A;  1FK9 A;  5AR0 A;  2W40 A;  2FSK A;  2Q0R A;  4M42 A;  3C65 A;  2DPN A;  1V4S A;  3AA4 A;  1R0A A;  5BR9 A;  4JI2 K;  4DSJ A;  3QBX A;  3NVM A;  2O8C A;  3G4S N;  5J1E A;  3MWP A;  4CER A;  5HRR A;  3ZSX A;  3S3O A;  4GW6 A;  4H0X B;  1KCF A;  4H0Y B;  2AJQ A;  3IKM A;  3ZSY A;  1GLL O;  1YJW N;  3QET A;  4ELV A;  2VG7 A;  2YHA A;  3SMS A;  3SUP A;  5HBM A;  1A5W A;  3NH1 A;  5KGX A;  3EL2 A;  4E7I A;  1ATN A;  3R8E A;  1S1V A;  1C0F A;  3RVC A;  1ESV A;  2OCE A;  3SQ4 A;  4CJ3 A;  4JS5 A;  1LOT B;  4A2B A;  5C15 A;  2W41 A;  4KI4 A;  4DSF A;  4IFY A;  3MEG A;  4DU1 A;  2W6K A;  3KKR A;  4IOA L;  3SYZ A;  4RW4 A;  1W7A A;  3O6W A;  1YJN N;  4FWK A;  2E20 A;  3WT0 A;  4IJN A;  4FJL A;  1W97 L;  2A40 A;  4AH9 A;  4FZX C;  1M1K O;  1BUP A;  1VSJ A;  2FBV A;  2YKM A;  4CJF A;  3T1A A;  3NF6 A;  4CIF A;  3AA2 A;  2O4I A;  4YOU A;  4FM2 A;  2QXL A;  3KLH A;  5IT9 O;  4HTL A;  4IO9 L;  2V51 B;  5B8H A;  2O8E B;  4B08 A;  1C0T A;  3LP3 A;  5C25 A;  4CJL A;  4JI8 K;  4FOI A;  3CC7 N;  3FZK A;  3MN6 A;  4FJJ A;  3ITH A;  5AZJ A;  4BRL A;  4AF1 A;  1MDU B;  3FGU A;  4C8N A;  3ATU A;  1KLM A;  2Y1J A;  3G10 A;  1OH8 A;  1MWM A;  3T19 A;  5FRM A;  1BO5 O;  1S9E A;  4KH5 A;  1IV0 A;  2HF3 A;  3P31 A;  4FJK A;  4CBU A;  1W0H A;  5GAG P;  3O3H A;  3SUQ A;  4ELU A;  4LSL A;  3AVA A;  3QFP A;  4F3T A;  3TAM A;  3QB0 A;  2X6N A;  4ILJ A;  4DS4 A;  2WON A;  4LFC K;  4BR4 A;  3NMU A;  3M8R A;  1NGA A;  1YTU A;  3GBT A;  4DQ8 A;  2Z1J A;  4N76 A;  4JV5 K;  1KFD A;  1RFQ A;  1YIJ N;  1EP4 A;  4A5A A;  2XY8 A;  1WN7 A;  3QLH A;  5DK5 A;  4BDZ A;  3D0P A;  4R79 A;  3I56 N;  3LZJ A;  4RW6 A;  2ZM6 K;  4H03 B;  1J5E K;  3PV8 A;  3R3L A;  1FKO A;  1SV5 A;  4BRN A;  3HP9 A;  4CJ4 A;  1VQ7 N;  4KHP K;  1HPZ A;  4CGF A;  1JLB A;  3SNN A;  2GTD A;  3P39 A;  1UA0 A;  1KLN A;  4ISE A;  3VQ6 A;  1Z25 A;  3KK1 A;  2VQF K;  3CJC A;  4YY3 K;  3DLR A;  4RTF D;  1HNV A;  2IOC A;  3HT3 A;  4FLU A;  3CC2 N;  1NK0 A;  5FRN A;  3HO1 A;  1N33 K;  3M5R A;  1XMO K;  4GV9 A;  1MU2 A;  4BWM A;  5BPN A;  4HHT A;  1VQ8 N;  4ID1 A;  1RIL A;  2QWL A;  1D9D A;  2P9I A;  4GV6 A;  3LP1 A;  1NMN A;  1KD1 O;  3QES A;  3MDQ A;  3KK2 A;  3FFK B;  3PSI A;  4C1N I;  2P51 A;  2YKN A;  4CJK A;  1FJG K;  1WAJ A;  4B9V A;  2KFZ A;  2E1Z A;  4Z4H A;  2A41 A;  4FWN A;  5AJ3 K;  4NXN K;  3AO3 A;  3I0R A;  3TAG A;  3L2V A;  3MEC A;  4Y0W A;  3M3Z A;  5FDL A;  3OYA A;  3LPT A;  3OYH A;  3K9J A;  1X9M A;  2G8I A;  2H3G X;  3D45 A;  5CYQ A;  3H45 C;  3KVG A;  2VCP A;  3M1F A;  3MN7 A;  2NRH A;  1WAF A;  4C23 A;  1E3M A;  3N4P A;  4DUY K;  4H5R A;  2J4R A;  4ISG A;  3LDP A;  4YOR A;  3M8P A;  3SK3 A;  3RMD A;  3DLB A;  1T3V A;  3O08 A;  4BRC A;  2KFN A;  3TSP A;  3ULE B;  3A5M C;  5JLH A;  2PFU A;  3MCA B;  4DV1 K;  3V1Q A;  4R5P A;  1TL3 A;  1YXQ A;  4BRP A;  3OYI A;  4DSI A;  1BI4 A;  3THX A;  2KKZ A;  4CZI A;  3OYD A;  4JEP A;  2WBN A;  4OPK A;  3SQ1 A;  5GAD P;  3SMP A;  4K43 A;  4M7Y A;  1IKW A;  3OYK A;  1NLV A;  3MXJ A;  1BOT O;  4TSX A;  1JKH A;  2O8C B;  2DTU A;  3RR8 A;  1HNW K;  5TKY A;  5LJW A;  1YTA A;  4DV5 K;  5J2P A;  2UUC K;  3HBT A;  4FLW A;  2HHQ A;  1ZBF A;  4Z94 A;  3R6M A;  3ENO A;  3CCJ N;  3PX0 A;  4JNE A;  3U4L A;  4ZTJ A;  4H5N A;  4YOX A;  1BIU A;  4B1X B;  1HMV A;  2Q31 A;  4CED A;  3HPH A;  4DR5 K;  3C6H A;  1T8E A;  3K59 A;  1BQM A;  4IFE A;  2XY6 A;  4O55 A;  1JJ2 M;  4PQU A;  4DV4 K;  5BRE A;  2NRT A;  1EO1 A;  3D2E B;  2HHV A;  1BU6 O;  1KVB A;  2OPP A;  1NJZ A;  1J54 A;  1RDA A;  4CBX A;  1Q86 O;  4IBN A;  1CXU A;  3ASM A;  3KWG A;  1VQN N;  1V4T A;  1ASV A;  3S3N A;  3DXK B;  3ZSW A;  1RT2 A;  4N5S A;  5AFU A;  2VWB A;  4FWP A;  1NNE A;  1RBR A;  1U6Z A;  3CJA A;  4PKI A;  3AVK A;  2FSN A;  3PSF A;  1RBS A;  3VEN A;  1C1C A;  1NGE A;  1TVR A;  1T6D A;  1K6Y A;  3P5J A;  4IJA A;  1RBV A;  2ZGY A;  3PLA A;  4FPB A;  2WFB A;  4G1Q A;  1RDC A;  5H1S Q;  4KTW A;  2VWK A;  1ITG A;  2QWM A;  4J2E A;  1TKD A;  4FJI A;  1BA1 A;  1OH7 A;  1DEJ A;  4O5B A;  3MAQ A;  5CYM A;  3WUH A;  3ZSR A;  3SPZ A;  1X9J A;  3KLG A;  4KHN A;  1N34 K;  3RR7 A;  3CXC M;  4B9L A;  3QEW A;  4CZG A;  4FJ9 A;  4JI7 K;  5DM6 L;  4DS5 A;  1JCF A;  5AQM A;  3EO3 A;  4ZHR A;  5AQV A;  3AO5 A;  4LH4 A;  4DR3 K;  2FBT A;  2RF2 A;  1VQK N;  2F9T A;  3M6G A;  4FW1 A;  3VEV A;  5ADX A;  4HVJ A;  3UKR A;  4FK0 A;  1GLF O;  2XY5 A;  4LF9 K;  1QSL A;  3ATV A;  5AQG A;  2ASO A;  4H0P A;  2QTD A;  3GL1 A;  3VET A;  1HJO A;  1SQK A;  4ILG B;  4DLG A;  4W5Q A;  4DR6 K;  3RTV A;  1NK5 A;  4OVL A;  1JCE A;  4DQP A;  1IBK K;  4M3Z A;  1FKP A;  4JYA K;  1DLO A;  4W5N A;  4WQ4 A;  1LWF A;  4FCY A;  3HM8 A;  5FLX O;  5MLC Q;  3NFA A;  3ZX0 A;  4AHC A;  3DOK A;  3VEW A;  3KD1 E;  1W9H A;  4DTS A;  2D0B A;  3C6T A;  3OS2 A;  1XNQ K;  3ALY A;  2Z1G A;  4B9U A;  4CJS A;  3VQ9 A;  4DFP A;  1EET A;  2ASP A;  4CE9 A;  3CMA N;  2ZE2 A;  4KH4 A;  3CET A;  1WSG A;  5BPM A;  4Y1D A;  5AQX A;  4DSL A;  1ZBU A;  4FYD A;  4B8C A;  1LAV A;  3J81 O;  4AM7 A;  3SAH A;  4BRG A;  3TSU A;  4E89 A;  2ZJQ L;  1YIT N;  2ZD1 A;  3OW2 M;  4ZTF A;  3VTI A;  3QML A;  3UKR B;  3IFR A;  1F21 A;  4JK9 A;  5CHI A;  3OJS A;  5SZT A;  4C8L A;  3AAR A;  5D3G A;  2B4J A;  1L3T A;  4O44 A;  4K42 A;  2KZZ A;  3EKU A;  3J80 O;  4F4K A;  4PWD A;  1JCG A;  3VQ5 A;  3AVB A;  2F9W A;  1TUY A;  3MCP A;  4AHT A;  4DTP A;  4K25 A;  4CEE A;  3FR0 A;  2ZJR L;  3DXM A;  1RNH A;  1P90 A;  2XO7 A;  1O1W A;  2Q2R A;  4GY2 B;  4CI6 A;  2P9N A;  5KGW A;  3V4I A;  3AVM A;  1EX4 A;  4E1M A;  3G6E N;  5HLF A;  4K41 A;  1S1W A;  1FW6 A;  3T1H K;  4B9S A;  3MX2 A;  3PY8 A;  1NM1 A;  2RKI A;  1NJY A;  3V9X A;  3AY9 A;  3NGZ A;  1QS4 A;  4ICL A;  2BH1 A;  4OKJ A;  2P9U B;  4HWI A;  3ZYY X;  5EVZ A;  4CJT A;  4F3O A;  3MXI A;  4BE0 A;  1S1T A;  3QIN A;  3VOV A;  3AO2 A;  4UQG A;  4H5T A;  4WFA L;  4DTU A;  3NE6 A;  1S1X A;  2NRX A;  3FZF A;  2XHB A;  5HOO A;  3QEI A;  2G8H A;  1VQ4 N;  3ZT3 A;  3MXM A;  1WNS A;  3O5B A;  3EE8 A;  4B1W B;  4MLE A;  4KB1 A;  3A5O C;  4WQ5 C;  4RWT A;  3J7Y P;  3D6R A;  5E41 A;  2D5R A;  3E66 A;  4LC9 B;  1RT7 A;  3TAQ A;  2KTQ A;  2YHW A;  4DTN A;  3IRX A;  3SJH A;  2WUS A;  3TAN A;  3THY B;  3H1Q A;  1SUQ A;  4CJE A;  5I42 A;  3JXU A;  3CD6 N;  2UXB K;  2O8B A;  4CES A;  2OZM A;  4NYF A;  1TK0 A;  1TK8 A;  4DQI A;  1YAG A;  2EX3 A;  4X62 K;  3K58 A;  1RDW X;  4CF9 A;  1NWK A;  3O8M A;  2HB5 A;  3KZB A;  2WTU A;  3BGR A;  3SLC A;  4CZE A;  1DTT A;  2D0C A;  1LWE A;  4CJV A;  4AQY K;  4DFK A;  4DMN A;  4X66 K;  5KRS A;  3OYJ A;  3H3O B;  3DRR A;  1A5X A;  4BDY A;  2E4L A;  3VA0 A;  1OKJ A;  3NGY A;  4M45 A;  2HHT A;  3OYN A;  3VQQ A;  3TAE A;  1IG8 A;  1N8R O;  4Q0B A;  2UYT A;  1ZC6 A;  4DQS A;  5AZI A;  4BGB A;  1QQC A;  5F1X A;  4M3W A;  1WLJ A;  1EWQ A;  4AHU A;  4V19 S;  3QNO A;  1IG9 A;  2OA8 A;  4JI4 K;  3RSE A;  5M1F A;  3SV4 A;  1KFS A;  4OPA A;  5ELZ A;  4EP4 A;  3MWT A;  4CEQ A;  5LMN K;  1QQM A;  3KLI A;  3O1W A;  1T05 A;  3CFP A;  4CJW A;  5CR4 A;  4B9T A;  2DFE A;  1N5Y A;  1RT1 A;  5AQR A;  5JS1 A;  3BDP A;  3L2W A;  3CCM N;  4JKH A;  5AQQ A;  2YHY A;  2FXU A;  4IXC A;  1GLC G;  1D8Y A;  1QHA A;  4FWS A;  2V52 B;  3CJ9 A;  4FWM A;  4KBO A;  5AQP A;  5AQK A;  4XH5 A;  2XRI A;  1WSF A;  1YVN A;  2P9N B;  1U47 A;  1EWR A;  1W2B M;  1BQN A;  3DLL L;  3QER A;  4BE1 A;  5AQY A;  1Q82 O;  1S22 A;  4CZL A;  3QNN A;  4MDB A;  4FJN A;  2GWJ A;  2RPI A;  3WXI A;  2JGU A;  1U45 A;  2HND A;  1J5O A;  2HVH A;  1S9G A;  3J8A A;  4RW8 A;  5KPZ A;  2KZM A;  2ATQ A;  4DR4 K;  1JLG A;  3VEO A;  4NCA A;  1T03 A;  1WUA A;  3CF5 L;  1YI2 N;  4QS7 A;  3KK3 A;  2PYJ A;  4JD2 B;  4FJ8 A;  4DV6 K;  3ISN C;  4CJ5 A;  4M3X A;  2X74 A;  3V81 A;  3H1V X;  1BA0 A;  4PKG A;  3N4Q A;  3T69 A;  3V6D A;  3VPZ A;  1VSF A;  3CI5 A;  1XQS C;  2GX9 A;  4O0J A;  2O4G A;  1WSE A;  2NRV A;  4X64 K;  1I94 K;  2FSJ A;  3PO4 A;  4H0O A;  4OPH A;  2RHK A;  1KVC A;  2JLE A;  3B8A X;  5M1O A;  5BN9 A;  1I3A A;  4IFV A;  4BQZ A;  2QM1 A;  4EHU A;  2HMI A;  4AM6 A;  3LDS A;  4E19 A;  3WXM B;  4OKK A;  2B5J A;  2OPR A;  4CBW A;  4BC5 A;  1EKE A;  3K9K A;  1SS6 A;  2ZGZ A;  3VEY A;  4BRI A;  3OYC A;  2A42 A;  3BZC A;  4BRA A;  3AA5 X;  1XWL A;  4NB4 A;  2YCH A;  4B3O A;  3PX6 A;  1NJX A;  1GOA A;  4O5F A;  1JLF A;  3O4W A;  3AVC A;  1RT4 A;  2JWK A;  4FJ5 A;  4CEC A;  4DFJ A;  1VRT A;  5GIN A;  3M8Q A;  4OGE A;  1RBU A;  3SJJ A;  3SPY A;  1DGK N;  3VQE A;  4KTQ A;  5AQZ A;  4MO5 A;  4JD2 A;  5JVH L;  4BC3 A;  4CJQ A;  1JLC A;  2NZT A;  1U49 A;  2IVN A;  1Z6R A;  1I39 A;  1C0U A;  4DF4 A;  4KV8 A;  3OTO K;  1B9F A;  2AA4 A;  4AHS A;  4NLC A;  1YHQ N;  2KLA A;  4CHP A;  5SWM A;  4DKW A;  5F2R A;  2IC3 A;  4M3T A;  3VQD A;  4IWV A;  5C0Y A;  3V9U A;  1RDB A;  2PYL A;  1XUP O;  2ZWH A;  4MO4 A;  3NGI A;  3HK2 A;  4CEA A;  4BC4 A;  4KKO A;  1K8K B;  3VEX A;  1S3X A;  3D2E A;  4LH5 A;  4ELT A;  2YNI A;  3TAP A;  2QI2 A;  4B9N A;  4IG3 A;  1S5J A;  4KAZ A;  1T44 A;  1T6C A;  1QVF M;  3WXJ A;  2HHU A;  3AVF A;  3U6F A;  3E1Y A;  3THW B;  4Z0U A;  2HMP A;  3U9D A;  3FZH A;  4K0K K;  2A3Z A;  5JLF A;  4B8A B;  4BRE A;  3LM9 A;  4DTM A;  3E9L A;  3NCI A;  1QSS A;  5JVG L;  3WXK A;  1E4F T;  3W0L A;  4YHH K;  3KIO A;  1U2V A;  4KFB A;  3SQ2 A;  3DXK A;  3P1G A;  3WNH A;  4BRF A;  1KSP A;  4FK4 A;  4JHD B;  3A5L C;  1KVA A;  2O8F B;  1NU0 A;  1IBM K;  3HSC A;  3SI6 A;  3OS0 A;  4N47 A;  1HYV A;  4JI6 K;  5GIO A;  2YV0 X;  1Q9Y A;  3HI0 A;  3VES A;  4JAX A;  3UB5 A;  4B1V A;  1GLB G;  1TV6 A;  1QTM A;  1Q81 O;  4M63 C;  3H3N O;  4J2A A;  4K8Z A;  3P38 A;  5EX5 A;  3D2F A;  5KQ8 A;  4LD0 A;  2HF4 A;  2QKB A;  4PUO A;  3CQY A;  3TWH A;  4M3R A;  3LWM A;  2E6L A;  4KHS A;  3OVN A;  4CEB A;  2X6S A;  1GLA G;  1NMD A;  2YNG A;  3ZX2 A;  1BG3 A;  3SBG A;  3HRG A;  3K5N A;  3ZSZ A;  4CZH A;  3THY A;  5KPT A;  4LF7 K;  4BRH A;  4WE1 A;  4C8O A;  1E4G T;  1KRP A;  1QE1 A;  2A5X A;  3HM9 A;  4EHT A;  1WBD A;  1S72 N;  5BN8 A;  4CZF A;  3QEV A;  3PO5 A;  2HNY A;  2IDO A;  1CXQ A;  3C95 A;  4CK2 A;  2OPQ A;  3EEQ A;  1BCO A;  2PY5 A;  2D0P A;  4JHD A;  3KLE A;  1SL1 A;  4I9Q A;  3CJ7 A;  3H46 O;  1X9S A;  4FJX A;  3LPU A;  4QCL A;  4HTU A;  4WQ4 C;  1TAQ A;  3LAN A;  1NKB A;  2QW9 A;  3HXM A;  3PIO L;  4IZ9 A;  2OYQ A;  1HKC A;  2P9S B;  5FPD A;  2ITM A;  4Y1C A;  4I2Q A;  4BRM A;  3M8S A;  4KRE A;  1KAX A;  4JN4 A;  3NAE A;  4J8F A;  5HP1 A;  1RTI A;  1VSI A;  3ZX3 A;  3J7Z O;  4O0I A;  2ETJ A;  4O8U A;  1OVQ A;  1QZ5 A;  2E2O A;  1OH6 A;  4FLX A;  4DTJ A;  4DQR A;  1S6Q A;  5LL6 Z;  3OYG A;  4HCB A;  3VF4 A;  3CFR A;  2GEM A;  4CIE A;  1UA1 A;  4AIL C;  5HRP A;  2GUI A;  4DU3 A;  1L3U A;  3WNF A;  3QIP A;  4CCH A;  4GV3 A;  1X3N A;  3MK6 A;  4IOX A;  5EXW A;  1VQO N;  4GKK K;  3AGK A;  3QIC A;  5KRT A;  2DFF A;  2FBY A;  3O3F A;  3QFU A;  1ZBS A;  2IVO A;  3U9Z A;  1WSJ A;  4CGH A;  5C2D A;  4QS8 A;  5LMU K;  4OX9 K;  5AQW A;  2NLX A;  1ILY A;  3SCX A;  2PAV A;  4FWO A;  3MN9 A;  3R1X A;  4YOV A;  1S1U A;  4UY8 O;  4M41 A;  4Z4G A;  4O8K A;  3BEX A;  1IKV A;  4FW2 A;  2VGN A;  1XHX A;  4IG0 A;  1SKW A;  3H08 A;  2E6M A;  3AAQ A;  4FSV A;  4B1U B;  4K8X A;  5KPR A;  3J7A P;  2VYP A;  2GV9 A;  1IKY A;  1NGH A;  4CD3 A;  3DI6 A;  4E7H A;  3ZET B;  1SKS A;  1HJR A;  4CFB A;  4A62 A;  1IJJ A;  3OYM A;  1QSY A;  4ISF A;  3AO1 A;  4M3U A;  3AVG A;  3EN9 A;  3VQP A;  1JXE A;  3F9K A;  1L3V A;  1NK4 A;  3IUC A;  2D0A A;  1LAW A;  3O80 A;  3OYF A;  1O13 A;  4PA1 A;  2YHX A;  2CH6 A;  3OBY A;  3WNG A;  2PBD A;  2V7Z A;  3AO4 A;  4LSN A;  3LZI A;  1BIZ A;  5J2N A;  4I9L A;  3VEZ A;  3TAF A;  4B9Q A;  4I2P A;  5E84 A;  3KD5 E;  4CFD A;  3ZEU A;  3LAM A;  3EE9 A;  4FLV A;  2WOM A;  3TI0 A;  3LL3 A;  1TL1 A;  1VSM A;  2F8T A;  3TAR A;  3WQU A;  2QWN A;  4CD1 A;  3VQC A;  4EIA A;  2O8B B;  3CIP A;  4HCC A;  4I7F A;  2HHS A;  3CER A;  1X9W A;  4C8K A;  1ZBH A;  3L0Q A;  4NYN A;  5AQJ A;  2F96 A;  1BL3 A;  3ULD A;  2O8D A;  4CZM A;  4LY7 A;  1B92 A;  3B6P A;  3CCE N;  4CFC A;  1XHZ A;  1NOY A;  5EU7 A;  1NG9 A;  2FC0 A;  5AZI B;  1HYZ A;  1SL2 A;  1RTH A;  1UWB A;  3C6U A;  4PL8 A;  2VG6 A;  3IG1 A;  4JKG A;  4E0D A;  1RTJ A;  1BHL A;  4H5V A;  2QWQ A;  3ZSO A;  2P9I B;  4CGG A;  3UE5 A;  4BG8 A;  4E7L A;  1NKE A;  2CH5 A;  1K9M O;  4U7B A;  3TU5 A;  3VQ8 A;  3AVL A;  4BR2 A;  3BUZ B;  4BRQ A;  1J53 A;  3AV9 A;  1RBT A;  5A2Q O;  4LF6 K;  3EZ5 A;  2P9U A;  3UIQ A;  1NK7 A;  5KTQ A;  2OTJ N;  4LF4 K;  4E7K A;  1UAX A;  4A57 A;  1NOZ A;  4CGI A;  2VWJ A;  2FF6 A;  3FE1 A;  1CZ9 A;  1Q9X A;  1YVU A;  1QQN A;  4FLY A;  1JLQ A;  5AQS A;  3PIP L;  4CF0 A;  4CHN A;  2R7Y A;  4FZY A;  5ADX H;  4JK7 A;  3C7N A;  4BDP A;  2Q36 A;  4EZ6 A;  1SAZ A;  4B1Z A;  4XIU A;  4YFU A;  3RMB A;  4FVU A;  4MQ3 A;  4F8R A;  3CQX A;  4FWR A;  4DWI A;  3DMJ A;  4DV3 K;  1KTQ A;  4KPY A;  4M3Y A;  3KLF A;  5AQN A;  4KO0 A;  3OBW A;  4EP5 A;  3CCL N;  4JKB A;  1NBW A;  4CF2 A;  1RT5 A;  1U2V B;  1NK6 A;  1MWK A;  3GE1 A;  3ID8 A;  3PUF A;  3DWL A;  3ZT2 A;  4BR0 A;  1VQ6 N;  2Q1N A;  3FLC O;  4CF8 A;  3KJV A;  4FJH A;  4EAH D;  4DFM A;  3F9M A;  4JRP A;  3VER A;  2KQ2 A;  3HP6 A;  4WYB A;  4CHQ A;  4X65 K;  3TSQ A;  1KQS M;  2RN2 A;  3LAL A;  3DYA A;  4WFN L;  4XH1 A;  2QWO A;  5EOY A;  3IDH A;  4A5B A;  3L3V A;  1G99 A;  1IKX A;  3R9P A;  3ZEU B;  3I0S A;  2BAN A;  5C24 A;  4OO1 J;  4E1J A;  3KKS A;  3CM6 A;  3SBT A;  2QWR A;  4FLZ A;  5HRS A;  1RDU A;  4GNI A;  4BQL A;  3THX B;  3MED A;  4CJ7 A;  1IBL K;  3CJ1 A;  3LP0 A;  4RG8 A;  2E2P A;  3DAW A;  2F8S A;  4HUF A;  3CQ8 A;  3DXM B;  3WQT A;  3CCV N;  5BRD A;  2YJF A;  3MX5 A;  4L8R B;  1NGF A;  3QEP A;  3VF2 A;  1U4B A;  3AA3 A;  1NKC A;  2QEX N;  3SAF A;  3K2P A;  3HTV A;  3EKS A;  5M1P A;  2IAJ A;  2FLO A;  1HKB A;  2BUP A;  3FZL A;  4H8K A;  3FZM A;  4YDU C;  3ZT1 A;  1NK9 A;  2O8D B;  1VSK A;  4CHZ A;  3ZSV A;  1QHT A;  2P1J A;  4YOT A;  1HNI A;  3HJF A;  4CFA A;  4BRK A;  4JK8 A;  3V1O A;  3VQB A;  2W6L A;  3A0I X;  1ATS A;  2P9P A;  3UKU B;  3CCR N;  4ID5 A;  3LDN A;  3RRH A;  3QIO A;  4Z4C A;  1J6Z A;  2CGL A;  2ZJP L;  3H6E A;  4FM0 A;  1M90 O;  3DJC A;  2QK9 A;  4NCG A;  4MDA A;  3S41 A;  3OYE A;  4YOY A;  4FK2 A;  4YDU A;  3HZ6 A;  4FJM A;  3OYL A;  4KHU A;  2Z1I A;  3I8B A;  3Q7C A;  3I55 N;  2GBZ A;  3GDQ A;  1ASW A;  5C12 A;  3O9S A;  2G8W A;  2ZF5 O;  4U67 L;  1RGI A;  4FWL A;  2HNZ A;  4DTX A;  5IWA K;  4CGJ A;  5TKW A;  3HVT A;  4Z4I A;  1P8Z A;  5GIP A;  2YX6 A;  5HRO A;  4DU4 A;  1CZA N;  4BC2 A;  3LDO A;  4N41 A;  3CM5 A;  2IS3 A;  3ZLJ A;  5JMV A;  1GLJ O;  3BF1 A;  1FXX A;  4KRF A;  3B6O A;  1NJI O;  1B9D A;  4KHQ A;  5C2F A;  3DLK A;  4N56 A;  2A1R A;  3WNE A;  1Y97 A;  4KI6 A;  2BE2 A;  1VSD A;  4MFB A;  4WFB L;  1XC9 A;  4KHW A;  4H4M A;  1K8A O;  3L6Q A;  5KI6 A;  4CZK A;  2P5G A;  3L2U A;  3RMA A;  4NXM K;  2G8K A;  1YT3 A;  3E9O A;  1GOB A;  3TAB A;  4B1Y B;  4CGD A;  2GEL A;  3LDL A;  5AZJ B;  4FM1 A;  2F7T A;  1VSH A;  4J2B A;  3O4Q A;  3DOL A;  1VQP N;  3DM2 A;  1H1V A;  1U04 A;  4DV2 K;  3VGM A;  3C6A A;  3CC4 N;  2FBX A;  3K5M A;  4KH6 A;  2P5O A;  1YUW A;  3T7Z A;  2UU9 K;  4JI0 K;  4CJR A;  2Q3S A;  1IO2 A;  1HQU A;  2O8E A;  5BPL A;  4FOE A;  4JKD A;  3OS1 A;  3ULE A;  4CK1 A;  4W5T A;  5AQI A;  1WSH A;  5JS2 A;  2BDP A;  1J9A A;  3KK7 A;  4F9O A;  1BI4 B;  4DB3 A;  2YNH A;  1C0G A;  2YHB A;  3HPG A;  3A2F A;  1SL0 A;  2WC9 A;  3F5T A;  4CW7 B;  1DTQ A;  2CGK A;  1TK5 A;  3C0B A;  3AVJ A;  2UUB K;  3CFO A;  3EYZ A;  1K73 O;  1SKR A;  4HUE A; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  4NXN K;  4DR7 K;  4DV6 K;  2UXB K;  4K0K K;  4JI8 K;  4X65 K;  5IWA K;  3T1Y K;  3J81 O;  4X62 K;  2UXD K;  1XMQ K;  1HNX K;  4JI2 K;  4LFB K;  2F4V K;  4B3S K;  4YHH K;  4X64 K;  1I94 K;  1HNZ K;  4B3R K;  4AQY K;  4X66 K;  4B3M K;  4DR1 K;  5LL6 Z;  4LF5 K;  4DUY K;  1XNR K;  1N32 K;  3J80 O;  1IBL K;  1IBM K;  4GKK K;  4JI6 K;  1N34 K;  4LFC K;  4DV1 K;  4JI7 K;  4JV5 K;  2HHH K;  2UXC K;  4JI5 K;  1HR0 K;  5LMU K;  4OX9 K;  4NXM K;  2VQE K;  3JAM O;  4DR3 K;  3T1H K;  4B3T K;  4V19 S;  4GKJ K;  4JI4 K;  2ZM6 K;  1J5E K;  4LF9 K;  5LMN K;  4DV0 K;  4KHP K;  5A2Q O;  4LF6 K;  2UUA K;  4LF4 K;  4DR2 K;  4DV2 K;  1HNW K;  2VQF K;  3J7A P;  4DV5 K;  2UUC K;  4DR6 K;  4YY3 K;  4JI3 K;  2UU9 K;  4JI0 K;  4CVN E;  1IBK K;  4LF7 K;  1N33 K;  4JYA K;  2E5L K;  3OTO K;  4DV7 K;  1N36 K;  1XMO K;  4DR5 K;  5FLX O;  4LFA K;  4DV4 K;  4DV3 K;  3J7Y P;  1XNQ K;  4LF8 K;  4DR4 K;  5BR8 K;  4CW7 B;  4JI1 K;  4DUZ K;  5IT9 O;  2UUB K;  1FJG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...