2UUBK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uubK00
2UUCK 2UUBK 4JI4K 1HNZK 4K0KK 2UXBK 4YHHK 5LL6Z 1HNXK 4B3TK 5LMUK 1HR0K 4DV4K 4DR3K 4GKKK 3JAMO 4DR6K 4JI5K 4DUYK 3OTOK 3T1YK 4LF6K 4KHPK 5FLXO 3J81O 4DR1K 1XMQK 4JYAK 4GKJK 5IWAK 1N36K 4JI7K 5LMNK 1I94K 4LFCK 2UXDK 4CW7B 4X62K 4OX9K 4DV6K 1N32K 4LF5K 4DV0K 4LFBK 4LF8K 4JI3K 2F4VK 4DV7K 1XNRK 1XMOK 2UXCK 4DUZK 4X65K 2HHHK 1IBKK 4JV5K 1IBLK 4AQYK 5AJ3K 4DR2K 4B3MK 4JI8K 4LF7K 2UU9K 4JI1K 4X66K 4LFAK 4YY3K 4JI6K 1N34K 4JI2K 4DR5K 1IBMK 4DV5K 3J7YP 4JI0K 4B3RK 4LF4K 1J5EK 4DV3K 4DR4K 2VQFK 4LF9K 1HNWK 4X64K 1FJGK 4DR7K 4DV1K 4B3SK 5IT9O 3J80O 2ZM6K 4NXMK 3J7AP 3T1HK 2VQEK 2UUAK 1N33K 4NXNK 4CVNE 5BR8K 1XNQK 5A2QO 2E5LK 4DV2K 4V19S
chains in the Genus database with same CATH superfamily
3CCEN 2NUBA 3AO4A 4XIUA 1KFSA 1YXQA 1IG9A 4H03B 4IOCL 1ZBIA 2QWPA 3HL8A 3WNEA 4RW7A 5AQMA 1I39A 4ILGB 3F9KA 4JD2B 3V81A 3AO5A 1L3VA 1WOQA 2Q97A 2KTQA 3VGMA 2X74A 4E19A 4AILC 5KQ8A 2ITMA 1VQ8N 1GOBA 3J7ZO 4QS7A 2HSTA 3EKUA 3PSIA 1Q81O 3GE1A 1ZBUA 4GKJK 1YVUA 2Z1IA 3PSFA 3ULEA 3SUQA 3IS9A 3CCUN 2P9IB 4DTMA 1ZYQA 1VQ5N 2P9SA 4KHYA 3BF3A 3DJCA 4CW7B 4OGCA 1WSHA 4OX9K 2BE2A 1RDWX 1RBTA 1KAXA 4RCHA 4F3TA 1QSYA 3EE9A 1WAFA 3L2UA 4A57A 1SS6A 1HPZA 5M1OA 2R7YA 2HHHK 3CFOA 3MN5A 4CJUA 4FK4A 3DLRA 1EX4A 3I33A 1NKCA 4BGBA 1LW2A 1NGAA 3TU5A 4XH4A 2BTFA 4C8NA 1BCMA 5FRNA 4JI1K 1JL1A 1KLMA 1U6ZA 4BRKA 2D0CA 2NZTA 3THYB 4FLTA 1LWEA 1RILA 4JI2K 1HQUA 3NFAA 4BACA 4W5RA 1YHQN 3VTIA 3LDSA 3ZCMA 2CH5A 4DV3K 1RNHA 5LY3A 4FJGA 2VQFK 1ASVA 3VPZA 2GEMA 3BZKA 3LAKA 2NRHA 2Q1NA 5M1KA 3T7ZA 1HJOA 1QQMA 3ULDA 3THVA 3KK3A 4CJ3A 1VQ9N 3S9HA 3J7AP 3T1HK 1SV5A 1C0TA 3HSTB 3RMBA 5I3UA 2HHWA 4B9TA 1JLFA 4BVPA 1QHTA 4HUEA 4KPYA 4FWMA 2XY7A 4GW6A 4DFKA 3KLGA 4CJKA 4IDKA 2LSNA 3SQ1A 2UUBK 1NK0A 3IKMA 3DRPA 3I55N 1YJ9N 1IH7A 1HUXA 2HMPA 2KFZA 3NGZA 5LMUK 1ZC6A 3ENOA 4OPHA 4AH9A 3H08A 2G8WA 3BEXA 4DF8A 2E4LA 3TAFA 1D5AA 1QZ5A 4GKKK 1X1PA 4B1XB 4JI5K 4BGAA 3IRXA 4J8FA 3L2QA 4OGEA 2PYLA 4LF6K 1HQEA 4BG8A 1Q86O 3KTQA 3UKUA 1BHLA 4O5BA 1T8EA 1VK0A 3O4WA 4FLWA 3QMLA 1NK9A 4CGFA 2P9KA 3U3GA 3OJSA 4JKAA 1DTQA 4DS5A 4J2AA 5M1FA 3VQ6A 1EO1A 4DSJA 3VQEA 1C0FA 2FC0A 4CHNA 1JLBA 3CCSN 3HM8A 5KRTA 4FJLA 5B8HA 1XMOK 3OYAA 4MDAA 4JKBA 4I6MA 4DSIA 1NMNA 4DTXA 2IVPA 4JKHA 3EY1A 3NHGA 1KRPA 3TTDA 4DFPA 4M45A 3EEQA 4O0IA 1OVQA 4OKKA 1VQPN 1TKXA 3KLEA 3TAMA 3QNOA 5EVZA 3E9PA 4JK8A 2NRRA 3L3VA 4LFAK 2GWKA 3UKRB 2IAJA 2Q2RA 1WN7A 3SI6A 3UIQA 3M1FA 4YOVA 3CJCA 3PV8A 3M8QA 4QCLA 3CYMA 3Q7CA 1QVFM 2XY6A 1EKEA 1T44A 5ELZA 4MQ3A 4DV1K 4JKFA 4OVLA 2WTUA 3AVAA 4HWIA 3VF2A 2Q36A 2IS3A 3AVGA 2UUAK 4DCHA 4IBNA 3OBWA 2P51A 3R6MA 2KLAA 1NLVA 1BIUA 1WSGA 4FO0A 1C6VA 2RE2A 3VTHA 5C2FA 4HVJA 2O8FB 3QEXA 1FKOA 1JCFA 5KGWA 3G10A 4CEAA 3BP8A 5KTQA 4ZTJA 1ZXOA 1S1VA 3D2EA 3O9TA 2E2OA 2RPIA 4YOUA 4XH5A 3LWLA 2PZSA 5AZIB 2QXLA 2WONA 3NF7A 1SL1A 3HRGA 3G4SN 1N8RO 1HNIA 3NH2A 4MFBA 5BREA 3MDQA 2PY5A 1QQCA 4IJAA 2VG5A 3QO9A 4KREA 1VSLA 5T7BA 2QXFA 2ZF5O 5HLFA 2HHTA 3CC4N 1QTMA 5AQTA 5J2NA 5F2RA 5LMNK 3P4IA 3ZSVA 4CK1A 3ZSWA 2NRXA 2UXDK 2HVHA 1N32K 4PKHA 3EO3A 2Y1JA 4FVMA 1J6ZA 4JKGA 4YORA 3U4LA 2HMIA 4DV7K 1XNRK 2AJQA 1G99A 2B4JA 3T19A 1WSJA 4FJHA 3KVGA 4DUZK 2UXCK 1W7AA 4KHQA 4O8KA 2BANA 4A2BA 3AO1A 5HOOA 4CZGA 1G15A 1YIJN 2W41A 4JKDA 3SQ0A 4CJLA 1VQ7N 4DF4A 4O55A 4W5OA 1JLQA 4H8KA 4CJ4A 1EETA 3SUPA 2VWBA 2HHUA 4CE9A 4CK2A 4CZLA 1N5YA 4C8OA 4N47A 3SV4A 1BU6O 1TK0A 1GLCG 3DOLA 4KTWA 5JVGL 1VQ6N 2A40A 1NGDA 3O3HA 1SKRA 4BR9A 3HXMA 1FJGK 5E84A 3OA9A 5AQJA 2HBKA 5KQDA 4F2SA 1QVGM 2IVOA 3EYZA 4FPBA 4H0OA 4XH1A 4GVEA 4CJ7A 4U67L 2VQEK 4BRAA 3PLAA 1HNVA 1WLJA 3VGKA 5FROA 4F8RA 3C6HA 1RBUA 4HTUA 4JKEA 2DY4A 3L0QA 2HNZA 4OJRA 4LY7A 5EOYA 1UWBA 2WBNA 3F2KA 2DFFA 3DXKA 4B9VA 3K5OA 5FPDA 3CC2N 1IKVA 2VCPA 1BQNA 3AVCA 1RGIA 4NB4A 4NYNA 3OY9A 1RTJA 1BG3A 1YF5L 4WFBL 4L8RB 3JYTA 4PQUA 4FWNA 3OYFA 3EKSA 5JLHA 3WEEB 4WFNL 3SJHA 2HW3A 2JLEA 4JRQA 3DAWA 3ENHA 1XHZA 2Z1HA 3B6PA 1T3VA 4JI7K 4IFEA 3V9WA 3LP1A 2B6AA 3CD6N 1D4XA 1QHAA 2FSJA 3SJJA 4CCHA 2CGKA 5C42A 4FLZA 3I8BA 3M5RA 4Z0UA 1P8ZA 3O6WA 4B1UB 4JAXA 2HOEA 4A5AA 1X9JA 1GOAA 1WSFA 3L2WA 3T3FA 5BN8A 2YJEA 4CHPA 3VN5A 2ITGA 4NLCA 2V52B 4IG3A 4JK7A 1RDUA 1YITN 4ICLA 4CIGA 3PO5A 2HVIA 1EP4A 1U4BA 1TL1A 2ASPA 3LDOA 4LSNA 1K9MO 3QESA 1KD1O 2OPPA 1IBMK 4FWQA 3ATVA 1OVYA 3K57A 4CIEA 4FJXA 3OVNA 3HVRA 1Q18A 5AZJA 2IVNA 3LPTA 1HNWK 5TKWA 3HOSA 1TK5A 4MO4A 2ZM6K 1SUQA 3MN6A 2QEXN 3VEXA 1NOZA 3TPQA 4OLAA 3K9KA 4YOYA 4FJMA 3NAEA 3MEEA 1YJNN 3KK2A 3CQXA 3SQ2A 3ATUA 3D7EO 4GMJB 2D0PA 4PKIA 1NBWA 4UQGA 3CXCM 2E6LA 4KH4A 4CJFA 3I0SA 1DTTA 3MWTA 3W0LA 3L2VA 5DMRA 2D0AA 5AQSA 1M1KO 1BIZA 2YKNA 2AP1A 3CPWM 4FJKA 3NF9A 5MLCQ 3ENBA 3OYHA 4FM2A 3HM9A 1DGKN 1S1TA 4AHCA 4M3YA 1NJZA 2V7YA 2FSKA 5C15A 1XMQK 2OANA 4CBWA 2NRVA 3CI5A 4CBUA 1UA1A 5C2DA 5KGXA 3BUZB 4AHVA 2V7ZA 4A59A 3CG7A 3PUFA 1ATRA 4ELVA 3ASMA 1V4SA 4I9QA 4M3ZA 1TKZA 1RDDA 3CHWA 1JLCA 2HBLA 3R8EA 1OH7A 4NCBA 1HYVA 4E1JA 4BC5A 4FK2A 4JEPA 2YHXA 1YTAA 3E01A 3HK2A 3QFPA 1S72N 4LH5A 3AA4A 4JV5K 3DRRA 1JXBA 1QQOA 5AQFA 2G8IA 2JGUA 1W0HA 4CJRA 4FWPA 4PUOA 4EIAA 3GG4A 1C1BA 4M41A 1NK6A 2QWQA 3AVJA 2KQ2A 3LM2A 3DXMB 1DKGD 2HF3A 1B9DA 3LZJA 1VSMA 3ZX3A 1T6CA 1KLNA 3THXB 3CETA 4B9SA 3QIPA 2X6NA 4BRMA 2Q0UA 2P9NA 3D2FB 1YVNA 4DG1A 4U7BA 3SBGA 4CGIA 5EU7A 4IEEA 3CCMN 1NGJA 1RDAA 5GIOA 2UYTA 3ZEUA 4BVOA 5AQHA 3CF5L 4BR5A 5HRNA 1U45A 5C0YA 3MN9A 2E2PA 4UY8O 1T7PA 2BDPA 1BI4B 1GLEG 4BRFA 5SWMA 2O4GA 2VG7A 5CZ2A 2E5LK 2G8VA 2GUPA 3AVMA 1JL2A 3O9SA 5AQZA 1U04A 4A62A 3MXMA 4B3TK 2Z1GA 2YHAA 1S22A 2ETJA 1NGGA 2WUSA 2FXUA 2YJFA 2NRWA 3OJUA 1ZBHA 1WSIA 4TSXA 3AVLA 4CD3A 3AARA 4JS4A 4FM1A 3SUNA 4FJ9A 1LWCA 3MXJA 3O4NA 4PY5A 1NGBA 3DLGA 2FBVA 2YNHA 1KXPA 4Y0WA 1A5XA 1GLLO 3LPUA 2KZZA 1QZ6A 4DB3A 2VYPA 3AO3A 3TARA 4JHDB 1SAZA 2XY8A 5DM6L 2OPRA 5AQLA 3KWGA 3ZYYX 3NGYA 3TTCA 2E6MA 1XQSC 1Z05A 1WSEA 2ZWHA 4IEIA 4X65K 3TSPA 1VRUA 4O44A 3A5OC 4CECA 4F3OA 1TYQB 2FSNA 4K43A 3HO1A 4MO5A 1RFQA 4CZFA 2HNYA 3B6OA 3OYEA 2QWMA 2QWRA 4H0TB 2FF6A 2E2NA 2HBJA 5AQQA 3AVIA 3MK6A 3CCQN 1HKCA 4NYFA 4CJPA 3HYFA 4CGHA 1FW6A 1IG8A 2E1YA 3O3FA 2P9LB 2D0BA 5CYQA 3UB5A 1LCUA 4FW1A 3DLBA 1XUPO 2Q0RA 4DQPA 4WQ5A 4DTJA 5AQXA 2ZQBA 4WE1A 3QBWA 4B3SK 2ZE2A 2O8BB 4B08A 1OH8A 3CFRA 4FK0A 4DTPA 4R79A 3LM9A 3DLLL 3IDHA 4FVUA 3QEWA 2QK9A 3GDQA 3DM2A 1S9EA 4L3QA 3QFUA 1U47A 4EP4A 4N5SA 1VRTA 3MECA 3MAQA 4DV2K 1NJIO 4JI4K 3OYIA 3AA5X 3G71N 4NCGA 3PY8A 1BISA 3BZCA 1NMDA 1S6QA 1KFDA 4H4MA 3JAMO 4DMNA 4FLYA 2PBDA 4H5VA 3WT0A 3OYLA 3QICA 3FE1A 4BREA 3O5BA 5FLXO 4DR1K 2G8KA 1X9MA 1VQMN 4JRPA 4BDPA 5CHIA 4M3XA 3ZT4A 2IC3A 3O3GA 4MLEA 1YT3A 1C0UA 4GY2B 4DTOA 4QS9A 4FW2A 3K9JA 3P1GA 3HP6A 1TKTA 4CZKA 4DQ8A 1VAZA 2PFUA 4OO1J 3ZT3A 2XHBA 3LALA 3PIPL 2ZGYA 2O8DA 2OA8A 2KKZA 3I8DA 3R1XA 4KH5A 3QB0A 3P39A 5HRPA 2F7TA 3RSEB 4CFBA 2JWLA 3KIOA 4O5FA 2P9UA 2FF3B 1TKDA 3L6QA 1JLGA 1X9SA 1SQKA 1VQNN 3A8YA 4JS5A 1W97L 2W6LA 3GOIA 4JLHA 1M90O 4IOXA 1Z25A 3V9SA 4X64K 3MXIA 2Z1JA 2WFBA 3VEZA 4AHRA 4CZJA 4RWTA 4FZYA 2A5XA 3SPZA 4BR7A 1RT3A 2VG6A 4WF9L 4QAGA 4KHNA 2A1SA 2ASOA 3NH1A 1NOYA 4KAZA 4YNQA 4AHSA 3WEEA 4LD0A 2FBTA 5BRDA 1NGFA 4W5QA 3M8RA 4HUGA 2GELA 4KHUA 2HHVA 4FWSA 3AVKA 2P5OA 2GWJA 1K8AO 1X3MA 4N56A 1NG9A 5AQUA 1B92A 5C10A 1K73O 3NVMA 4E7HA 3G25A 1YAGA 3ZT0A 4A61A 4GNIA 4DR6K 3U8XA 4F4KA 1HRHA 5C25A 4EAHD 4DTUA 3C6UA 4CESA 4CJQA 4FYDA 2RKIA 3ZT2A 1RT4A 2I7NA 4WFAL 3ULEB 3DLEA 3U9DA 1RT1A 4WQ5C 3ZSQA 3OBYA 3WXLA 2P9SB 4Z94A 2X6SA 4CF2A 3CJ9A 2HNDA 1S3XA 4KKOA 4C1NK 1U49A 1QSLA 3SAHA 3RMDA 5CZ1A 4ILHA 4DV0K 1ATNA 4RW9A 4H4OA 3M3ZA 1UA0A 4BRCA 1XI1A 3WQUA 1REVA 2D1KA 4IFYA 4CGDA 4FJ5A 3NH0A 3KK1A 5TKYA 3AVNA 4B3MK 1TV6A 4M7XA 4WYBA 3OHRA 4FLVA 1ASUA 1FKPA 3AAQA 4Z4CA 2A1RA 2GTDA 4B8AB 3SBTA 3FZHA 3THWB 1NK4A 4BC3A 4O8UA 4X66K 4FJ7A 4IFVA 3C7NA 4CF1A 3LP0A 2EWSA 5JLFA 4CZMA 4DKWA 4M7YA 1Y64A 4IO9L 3J7YP 4B3RK 3KJVA 3VF6A 1HYSA 1OH5A 3IG1A 3K59A 3ID6A 5JS2A 5LJWA 3PIOL 3ZSXA 4B8CA 4RTFD 4AF1A 1L3SA 3QNNA 3I56N 2EX3A 1BWFO 3V1QA 5DK5A 4DU4A 3KZBA 2CGLA 5H1SQ 1VSKA 5F0XA 4R5PA 3C65A 2P9PA 3ZSOA 3L3UA 4E7LA 4ZTFA 4BE1A 4E1NA 4YHHK 4PHTX 3OYNA 3CMEN 1TAQA 4M3WA 3AV9A 2YHYA 4HHTA 3ZX0A 4H0VB 4CZHA 4DUYK 3E1YA 2GX9A 4KHPK 5FDLA 4FWOA 1W2BM 3BF1A 3SPYA 3SMSA 3UKUB 4CEBA 4BRGA 4CJTA 2H3GX 1N36K 2P9KB 3A0IX 3OYMA 3OYCA 3SAFA 3OW2M 4X62K 3LWMA 3V9UA 4EHUA 4FLUA 3R9PA 3MEDA 4FOEA 1RT6A 1VQKN 1SL0A 3HBTA 4CJEA 2O8CA 3RR8A 3AO2A 4I6MB 3FR0A 3F9MA 4QS8A 1VQLN 3QIOA 4JNEA 1LOTB 3K0SA 5K14A 3WXIA 1K6YA 3A5NC 1NGCA 4H5RA 2Y1IA 3SMPA 3RR7A 5GINA 4BRQA 1NJYA 3T1AA 3U3YA 1B9FA 2FBXA 4ISGA 4DU1A 2DPNA 5AR0A 5GADP 4DV5K 4KH6A 4E7KA 4N76A 1CZ9A 5AQWA 3RMAA 3TAPA 2OTLN 2G8HA 3ZETB 3O9QA 3MCAB 1KTQA 4CEZA 4DTNA 3C94A 1VQ4N 5BR9A 4EHTA 4N41A 3UE5A 4NXMK 1ILYA 3FZKA 4BRDA 3NDKA 2F8TA 4DQQA 2EHGA 3CPEA 1I3AA 4BRIA 3DYAA 1TUYA 1S1XA 1R59O 4CJ5A 4AM7A 2KFNA 4E7IA 4F2RA 4BRNA 4BROA 3CCRN 1BUPA 3AY9A 1FK9A 4ILJA 3FFIA 3MX2A 1ATSA 1C1AA 5AQKA 3HPOA 3WNFA 3A5LC 2E20A 3D2EB 4H5WA 3KKRA 4IZ9A 1E4GT 3HZ6A 1RBSA 3MWPA 4JD2A 4BR4A 3BY5A 3ZLJA 3T1YK 2DFHA 3LDPA 1JLAA 4Y1CA 3ID8A 1DEJA 1WBDA 3V1OA 1WNSA 1EQYA 1TYQA 1NK5A 4CD1A 4JYAK 3AA2A 2J4RA 3SNNA 1XC9A 1TUUA 3QBXA 3MCPA 2P9IA 2HB5A 5M1NA 4XEIA 3K5LA 5FPEA 2I7PA 4OKEA 4CHOA 3OS1A 2E8AA 4FL9A 4JKGB 1NK8A 2HHQA 3TSUA 3TI0A 4DHYA 1HLUA 1IBKK 1FXXA 3KLHA 1HKGA 3HPGA 1NJWA 3DMJA 4A2AA 3AA3A 4J2BA 4K42A 4IJNA 1RDBA 1VQON 4MLHA 2IGIA 2YNIA 4YOXA 2RF2A 2YNFA 3VQ7A 3THYA 3QEVA 4FJ8A 3NF8A 3L4QA 4KFBA 1MA9B 1Q9YA 1QSSA 3VQ5A 3P83D 3RMCA 3IMXA 3ZT1A 3C95A 1L5UA 5AQYA 4M3RA 3FZLA 1IKWA 4K25A 4CFDA 5HROA 4CEQA 1JCGA 1L3TA 1HMVA 3IFRA 1BOTO 1NGEA 4K41A 4CHZA 3R3LA 4E7JA 3VESA 3V6DA 1HNZK 4KB0A 3FLCO 1J9AA 2V51B 3FGUA 4BR0A 2ZJPL 3LDQA 1XWLA 2W40A 1BCOA 3KHYA 4DV4K 3E66A 4DR3K 3HI0A 4FJIA 3OYJA 3V4IA 5F1XA 1HPMA 4JK9A 4FLXA 1MWMA 2GUIA 4J2EA 4FJJA 3K5MA 2D4WA 4E0DA 3LDNA 4BRPA 1VSIA 4W5TA 2Q31A 3HJFA 1J53A 3H46O 1KVCA 4FZZA 4HUFA 3AVHA 3FZFA 2BUPA 3TTFA 2XO7A 3VQCA 4H0XB 3FZMA 3CCJN 1TAUA 2F4VK 1QS4A 5E41A 2NLXA 4FWRA 2NNWA 5CR4A 3OS0A 3CQ8A 4PWDA 3CC7N 5J2QA 4NCAA 3SYZA 4CEEA 2KHOA 1SKSA 5ADXA 4CZEA 3L2RA 2CH6A 3ALYA 3PO4A 4O0JA 5HL7L 1OKJA 1F21A 4FWKA 2ASMA 2A41A 4FJNA 1JXEA 4CF0A 3TAQA 4DFMA 1CLQA 4GV9A 4DTRA 1IKYA 3UKRA 5CE3A 4YY3K 3KKSA 3P5JA 2XY5A 4JI0K 5LJVA 3G6EN 3VQQA 4E1MA 4OPJA 3CCLN 4ELTA 2ZGZA 4IKFA 4RW4A 3VERA 1HJRA 1O1WA 5AZJB 4KO0A 4DR7K 2ZJRL 4BRLA 1KAYA 3TSQA 4KRFA 2YX6A 3V1RA 4I2QA 5FPMA 3RRHA 1IKXA 2BH1A 3VA3A 3H3OB 3LZIA 3KLIA 1N33K 4LH4A 1X9WA 5AQOA 2RN2A 3VF4A 3W3DA 3VQ8A 4CZIA 4NXNK 3OYKA 2O8FA 2F96A 1E3MA 4V19S 4H0PA 3VQ9A 3S41A 4DQSA 3O1WA 4RG8A 4K0KK 4CGJA 4FSVA 4OKJA 5EY4A 2G8FA 2HF4A 1TVRA 3O1BA 3DI6A 5AZIA 3VA0A 1LW0A 3H6EA 5I42A 4AHTA 5JMVA 3L8BA 1NKBA 4C8KA 2RHKA 3LANA 1KCFA 4KHSA 3KD5E 3K5NA 2DFEA 5AFUA 4M42A 1U48A 3WNGA 1MWKA 1RTDA 1D8YA 1E4FT 3QLHA 3THWA 4E3SA 3U6FA 3VQDA 1OH6A 4ID1A 1ASWA 3T69A 4B9MA 1LV5A 1L3UA 1BGXT 2O8EB 3SUOA 4JI3K 5AQRA 1VSHA 4FWLA 3E9OA 1NGHA 4CBXA 4EZ6A 4IWVA 4BY9C 4Z4HA 5BPNA 1NGIA 1BA0A 4FXDA 3HOTA 5FPNA 3O4QA 4O4GA 4I2PA 4Q0BA 1CZBA 1U2VB 4CI6A 5JICA 2AA4A 2I5JA 2P1JA 2A3ZA 3VEOA 3S3MA 1Y97A 4M3TA 3RWUA 3M8SA 1XHXA 2F9TA 1S1UA 3KWIA 4DR4K 4BRHA 3NMUA 2P9NB 4DWIA 1UOCA 2OPSA 4JKCA 4M3UA 5M1QA 4WQ4A 4CERA 3KD1E 5JS1A 3CMAN 4FCYA 3A5MC 3DWLA 2CGJA 3HT3A 2KZMA 5DM7L 1K8KB 4FPAA 4BC4A 4DS4A 4BWJA 5GAHP 3H1VX 2PYJA 1RT5A 4CJSA 3ZEUB 3ZSYA 4IO8A 5HRSA 2OYQA 4B9QA 3CJ7A 3EZWA 1VHXA 3D6RA 2UUCK 5KRSA 5HRRA 4KTZA 4BDZA 4BR2A 4Q5VA 3SCXA 4OPKA 2HHSA 4FM0A 1EWRA 4HCCA 1JCEA 1ESVA 3QERA 4CEDA 4BDYA 3QETA 5GAEP 4ZHRA 4YOWA 5HP1A 4C23A 1JLEA 4CK3A 3J81O 1S5JA 1WAJA 2VWJA 1VSFA 3M6GA 3ZX2A 1KQSM 4DQIA 1QE1A 4PA1A 3VGLA 5ADXH 4Z4EA 1I94K 4LFCK 5BRHA 1RT2A 3CFPA 4KI4A 1Z26A 4LFBK 4BQZA 4IXCA 1J5OA 2OZMA 4LF8K 1GLAG 4M63C 3F73A 2HHXA 2BGGA 3SV3A 4Z4GA 3ZETA 1IBLK 5AJ3K 3WNHA 3SLCA 3TAGA 4W5NA 3C6TA 5E26A 5C12A 5KPZA 1RBRA 4DTSA 3D0PA 1RTIA 3TABA 2QWLA 3O80A 4DR5K 4ID5A 1LWFA 2ZD1A 4DFJA 1IV0A 4LF4K 2FBYA 3ZSRA 1T05A 4JN4A 1D9FA 3EN9A 3WXMB 1VSEA 3BGRA 3M8PA 1O13A 3WXJA 4B1YB 3N4PA 5AQPA 3OYDA 3EL2A 2F8SA 2ATQA 4HCBA 3JXUA 1HYZA 1NK7A 5GIPA 3CJBA 1XNQK 2QA4N 5FRMA 1BL3A 3SK3A 4YDUA 5A2QO 3TANA 5AQVA 4KBOA 2QTDA 3LP2A 3VETA 4Z4IA 1BDGA 2YHWA 2UXBK 5AFUH 1Q82O 1Q7YO 1QQNA 5LL6Z 2HBMA 4PKGA 3WQTA 3AGRA 5BRFA 4CFCA 4RW6A 1NU0A 3LDLA 5CY4A 2KW4A 4PL7A 3CIPA 3CQYA 4B9LA 2OCEA 2DTUA 1NNEA 5I9EB 3KK7A 3K2PA 1C1CA 3VOVA 1ZBLA 3P31A 4QOZB 1VSJA 1S6PA 2QW9A 1BA1A 3TWHA 4AHUA 2YCHA 4BE0A 1TL3A 3QEPA 4WQ4C 4KHWA 3L4IA 3RTVA 5KPRA 3RRGA 4DU3A 1A5WA 3DLKA 3CM5A 2YV0X 4YOTA 3AAPA 3TR8A 4G9ZA 3LP3A 2W6KA 5EX5A 2O8DB 4EP5A 3NBPA 1X3NA 4BQLA 1Z6RA 4JI8K 4LF7K 4PL8A 3WXKA 4ISEA 4G1QA 3AVFA 4EFHA 4B3OA 2NRTA 1Q8IA 4DSFA 1XC3A 3DXMA 3HVTA 2NRZA 1SZ2A 5J1EA 5BPMA 2P9UB 2E88A 4DSLA 1YJWN 5M1PA 4KB1A 4IG0A 4E89A 3THXA 1J5EK 4CF8A 4BG9A 3VQBA 4CEOA 5D3GA 4ISFA 3H45C 3V9XA 3D2FA 3DRSA 4DLEA 2A6AA 3O8MA 2GBZA 4GV6A 1IJJA 3LAMA 4CIFA 1KC8O 1YUWA 3PX4A 1T6DA 2WC9A 3AVBA 4C8LA 1HKBA 1IO2A 1CZAN 1ITGA 1WB9A 4ELUA 1N6QA 1YTUA 3S3OA 3PX6A 4J2DA 2OPQA 5GAGP 4HTLA 4BWMA 4CVNE 1BI4A 4CHQA 1LAVA 4LC9B 4C8MA 4DSEA 3C0BA 2IOCA 4B9NA 1T03A 1RT7A 3SQ4A 1RDCA 1ZBSA 4CJVA 1NWKA 2G8UA 1NM1A 4BC2A 4EZ9A 3RVCA 4B1ZA 1TGOA 4CFAA 2IIRA 3OTOK 1SKWA 4Z4FA 4K8ZA 5BN9A 4H5TA 4H5NA 2QI2A 3ZSZA 3G0ZA 5IWAK 2YNGA 4CEFA 2F9WA 4JHDA 3O9RA 1GLJO 3GBTA 3HTVA 2O4IA 3VQPA 1EXQA 3N4QA 3DLHA 4DV6K 4LF5K 3O08A 4Y1DA 4H0YB 2YHBA 4AM6A 4DQRA 3VEWA 5J2MA 2XRIA 1S9GA 4LSLA 1JKHA 4B1WB 4AQYK 4DR2K 4YDUC 5C24A 2W42A 4RW8A 3H1QA 3EZ5A 3VEVA 3JSMA 4DLGA 3J8AA 1S1WA 2UU9K 4I9LA 4FZXC 5AQIA 1HX1A 3C7NB 2X78A 2QWNA 5SZTA 4A5BA 3MX5A 3IUCA 2VWKA 1N34K 1GLFO 2P9LA 3GL1A 4B9UA 1LAWA 3B8AX 1NJXA 1KAZA 2QKKA 1WUAA 3VQ4A 4MDBA 1TK8A 3CM6A 2O8BA 2Q3SA 1UAXA 3C6AA 4NLBA 5IT9O 2QKBA 3J80O 4KV8A 1W9HA 2E2QA 1MU2A 5J2PA 2E1ZA 1JJ2M 1GLDG 3U9ZA 2WOMA 3WUHA 1V4TA 4FOIA 3E9LA 2P9PB 5BR8K 1D9DA 3PX0A 3A2FA 5KPTA 2B5JA 3OS2A 4IDHA 3VQAA 1HNXK 3H3NO 3O9UA 2FLOA 4K8XA 1HR0K 4KI6A 2ZJQL 4BE2A 2O8EA 3TAEA 1EWQA 3JS6A 3OYBA 2VGMA 2YI1A 3AGKA 2OZSA 3ISNC 4DSKA 3BDPA 1CXQA 3Q7BA 1RCHA 3NVKA 2QWOA 4CF9A 5CYMA 4YFUA 1WBBA 4CGGA 5AQNA 4OPAA 1KSPA 1CXUA 4KTQA 1J54A 3MN7A 4F9OA 1RBVA 2OTJN 4IOAL 4NO7A 3P38A 3NE6A 1U2VA 1Q9XA 3NF6A 2IDOA 3DXKB 3NCIA 4GVMA 5JVHL 4C1NI 2JWKA 1MDUB 1C0MA 4OLBA 1P90A 2O8CB 1C0GA 3QEIA 1ZBFA 2GV9A 1DT9A 3CJAA 3SZ2A 2PAVA 1K8KA 5EXWA 3LL3A 4WCEL 3V9ZA 1VSDA 5KI6A 3F5TA 5BPLA 3HPHA 3VENA 3RSEA 3QDKA 3D45A 3HSCA 1BO5O 2A42A 3CERA 3VEYA 3I0RA 3CCVN 1KVBA 1H1VA 4JI6K 3DOKA 1SL2A 3QINA 1GLBG 3CJ1A 3MEGA 2D0OA 1BQMA 4LF9K 2YKMA 3OYGA 5AQGA 1R0AA 1RTHA 4CHYA 3S3NA 3SAGA 2P5GA 1DLOA 2D5RA 3HP9A 3VMFB 3KLFA 4I7FA 3NGIA 1GOCA 3K58A 2VGNA 4B1VA 3ITHA 1KVAA 1A5VA 3MMVA 5HBMA 3EE8A 1NKEA 2QM1A 1YI2N 3IAYA 4GV3A 4CJWA 3FFKB
chains in the Genus database with same CATH topology
2UUCK 2UUBK 4JI4K 1HNZK 4K0KK 2UXBK 4YHHK 5LL6Z 1HNXK 4B3TK 5LMUK 1HR0K 4DV4K 4DR3K 4GKKK 3JAMO 4DR6K 4JI5K 4DUYK 3OTOK 3T1YK 4LF6K 4KHPK 5FLXO 3J81O 4DR1K 1XMQK 4JYAK 4GKJK 5IWAK 1N36K 4JI7K 5LMNK 1I94K 4LFCK 2UXDK 4CW7B 4X62K 4OX9K 4DV6K 1N32K 4LF5K 4DV0K 4LFBK 4LF8K 4JI3K 2F4VK 4DV7K 1XNRK 1XMOK 2UXCK 4DUZK 4X65K 2HHHK 1IBKK 4JV5K 1IBLK 4AQYK 5AJ3K 4DR2K 4B3MK 4JI8K 4LF7K 2UU9K 4JI1K 4X66K 4LFAK 4YY3K 4JI6K 1N34K 4JI2K 4DR5K 1IBMK 4DV5K 3J7YP 4JI0K 4B3RK 4LF4K 1J5EK 4DV3K 4DR4K 2VQFK 4LF9K 1HNWK 4X64K 1FJGK 4DR7K 4DV1K 4B3SK 5IT9O 3J80O 2ZM6K 4NXMK 3J7AP 3T1HK 2VQEK 2UUAK 1N33K 4NXNK 4CVNE 5BR8K 1XNQK 5A2QO 2E5LK 4DV2K 4V19S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC K;  2UUB K;  4JI4 K;  1HNZ K;  4K0K K;  2UXB K;  4YHH K;  5LL6 Z;  1HNX K;  4B3T K;  5LMU K;  1HR0 K;  4DV4 K;  4DR3 K;  4GKK K;  3JAM O;  4DR6 K;  4JI5 K;  4DUY K;  3OTO K;  3T1Y K;  4LF6 K;  4KHP K;  5FLX O;  3J81 O;  4DR1 K;  1XMQ K;  4JYA K;  4GKJ K;  5IWA K;  1N36 K;  4JI7 K;  5LMN K;  1I94 K;  4LFC K;  2UXD K;  4CW7 B;  4X62 K;  4OX9 K;  4DV6 K;  1N32 K;  4LF5 K;  4DV0 K;  4LFB K;  4LF8 K;  4JI3 K;  2F4V K;  4DV7 K;  1XNR K;  1XMO K;  2UXC K;  4DUZ K;  4X65 K;  2HHH K;  1IBK K;  4JV5 K;  1IBL K;  4AQY K;  5AJ3 K;  4DR2 K;  4B3M K;  4JI8 K;  4LF7 K;  2UU9 K;  4JI1 K;  4X66 K;  4LFA K;  4YY3 K;  4JI6 K;  1N34 K;  4JI2 K;  4DR5 K;  1IBM K;  4DV5 K;  3J7Y P;  4JI0 K;  4B3R K;  4LF4 K;  1J5E K;  4DV3 K;  4DR4 K;  2VQF K;  4LF9 K;  1HNW K;  4X64 K;  1FJG K;  4DR7 K;  4DV1 K;  4B3S K;  5IT9 O;  3J80 O;  2ZM6 K;  4NXM K;  3J7A P;  3T1H K;  2VQE K;  2UUA K;  1N33 K;  4NXN K;  4CVN E;  5BR8 K;  1XNQ K;  5A2Q O;  2E5L K;  4DV2 K;  4V19 S; 
#chains in the Genus database with same CATH topology
 3CCE N;  2NUB A;  3AO4 A;  4XIU A;  1KFS A;  1YXQ A;  1IG9 A;  4H03 B;  4IOC L;  1ZBI A;  2QWP A;  3HL8 A;  3WNE A;  4RW7 A;  5AQM A;  1I39 A;  4ILG B;  3F9K A;  4JD2 B;  3V81 A;  3AO5 A;  1L3V A;  1WOQ A;  2Q97 A;  2KTQ A;  3VGM A;  2X74 A;  4E19 A;  4AIL C;  5KQ8 A;  2ITM A;  1VQ8 N;  1GOB A;  3J7Z O;  4QS7 A;  2HST A;  3EKU A;  3PSI A;  1Q81 O;  3GE1 A;  1ZBU A;  4GKJ K;  1YVU A;  2Z1I A;  3PSF A;  3ULE A;  3SUQ A;  3IS9 A;  3CCU N;  2P9I B;  4DTM A;  1ZYQ A;  1VQ5 N;  2P9S A;  4KHY A;  3BF3 A;  3DJC A;  4CW7 B;  4OGC A;  1WSH A;  4OX9 K;  2BE2 A;  1RDW X;  1RBT A;  1KAX A;  4RCH A;  4F3T A;  1QSY A;  3EE9 A;  1WAF A;  3L2U A;  4A57 A;  1SS6 A;  1HPZ A;  5M1O A;  2R7Y A;  2HHH K;  3CFO A;  3MN5 A;  4CJU A;  4FK4 A;  3DLR A;  1EX4 A;  3I33 A;  1NKC A;  4BGB A;  1LW2 A;  1NGA A;  3TU5 A;  4XH4 A;  2BTF A;  4C8N A;  1BCM A;  5FRN A;  4JI1 K;  1JL1 A;  1KLM A;  1U6Z A;  4BRK A;  2D0C A;  2NZT A;  3THY B;  4FLT A;  1LWE A;  1RIL A;  4JI2 K;  1HQU A;  3NFA A;  4BAC A;  4W5R A;  1YHQ N;  3VTI A;  3LDS A;  3ZCM A;  2CH5 A;  4DV3 K;  1RNH A;  5LY3 A;  4FJG A;  2VQF K;  1ASV A;  3VPZ A;  2GEM A;  3BZK A;  3LAK A;  2NRH A;  2Q1N A;  5M1K A;  3T7Z A;  1HJO A;  1QQM A;  3ULD A;  3THV A;  3KK3 A;  4CJ3 A;  1VQ9 N;  3S9H A;  3J7A P;  3T1H K;  1SV5 A;  1C0T A;  3HST B;  3RMB A;  5I3U A;  2HHW A;  4B9T A;  1JLF A;  4BVP A;  1QHT A;  4HUE A;  4KPY A;  4FWM A;  2XY7 A;  4GW6 A;  4DFK A;  3KLG A;  4CJK A;  4IDK A;  2LSN A;  3SQ1 A;  2UUB K;  1NK0 A;  3IKM A;  3DRP A;  3I55 N;  1YJ9 N;  1IH7 A;  1HUX A;  2HMP A;  2KFZ A;  3NGZ A;  5LMU K;  1ZC6 A;  3ENO A;  4OPH A;  4AH9 A;  3H08 A;  2G8W A;  3BEX A;  4DF8 A;  2E4L A;  3TAF A;  1D5A A;  1QZ5 A;  4GKK K;  1X1P A;  4B1X B;  4JI5 K;  4BGA A;  3IRX A;  4J8F A;  3L2Q A;  4OGE A;  2PYL A;  4LF6 K;  1HQE A;  4BG8 A;  1Q86 O;  3KTQ A;  3UKU A;  1BHL A;  4O5B A;  1T8E A;  1VK0 A;  3O4W A;  4FLW A;  3QML A;  1NK9 A;  4CGF A;  2P9K A;  3U3G A;  3OJS A;  4JKA A;  1DTQ A;  4DS5 A;  4J2A A;  5M1F A;  3VQ6 A;  1EO1 A;  4DSJ A;  3VQE A;  1C0F A;  2FC0 A;  4CHN A;  1JLB A;  3CCS N;  3HM8 A;  5KRT A;  4FJL A;  5B8H A;  1XMO K;  3OYA A;  4MDA A;  4JKB A;  4I6M A;  4DSI A;  1NMN A;  4DTX A;  2IVP A;  4JKH A;  3EY1 A;  3NHG A;  1KRP A;  3TTD A;  4DFP A;  4M45 A;  3EEQ A;  4O0I A;  1OVQ A;  4OKK A;  1VQP N;  1TKX A;  3KLE A;  3TAM A;  3QNO A;  5EVZ A;  3E9P A;  4JK8 A;  2NRR A;  3L3V A;  4LFA K;  2GWK A;  3UKR B;  2IAJ A;  2Q2R A;  1WN7 A;  3SI6 A;  3UIQ A;  3M1F A;  4YOV A;  3CJC A;  3PV8 A;  3M8Q A;  4QCL A;  3CYM A;  3Q7C A;  1QVF M;  2XY6 A;  1EKE A;  1T44 A;  5ELZ A;  4MQ3 A;  4DV1 K;  4JKF A;  4OVL A;  2WTU A;  3AVA A;  4HWI A;  3VF2 A;  2Q36 A;  2IS3 A;  3AVG A;  2UUA K;  4DCH A;  4IBN A;  3OBW A;  2P51 A;  3R6M A;  2KLA A;  1NLV A;  1BIU A;  1WSG A;  4FO0 A;  1C6V A;  2RE2 A;  3VTH A;  5C2F A;  4HVJ A;  2O8F B;  3QEX A;  1FKO A;  1JCF A;  5KGW A;  3G10 A;  4CEA A;  3BP8 A;  5KTQ A;  4ZTJ A;  1ZXO A;  1S1V A;  3D2E A;  3O9T A;  2E2O A;  2RPI A;  4YOU A;  4XH5 A;  3LWL A;  2PZS A;  5AZI B;  2QXL A;  2WON A;  3NF7 A;  1SL1 A;  3HRG A;  3G4S N;  1N8R O;  1HNI A;  3NH2 A;  4MFB A;  5BRE A;  3MDQ A;  2PY5 A;  1QQC A;  4IJA A;  2VG5 A;  3QO9 A;  4KRE A;  1VSL A;  5T7B A;  2QXF A;  2ZF5 O;  5HLF A;  2HHT A;  3CC4 N;  1QTM A;  5AQT A;  5J2N A;  5F2R A;  5LMN K;  3P4I A;  3ZSV A;  4CK1 A;  3ZSW A;  2NRX A;  2UXD K;  2HVH A;  1N32 K;  4PKH A;  3EO3 A;  2Y1J A;  4FVM A;  1J6Z A;  4JKG A;  4YOR A;  3U4L A;  2HMI A;  4DV7 K;  1XNR K;  2AJQ A;  1G99 A;  2B4J A;  3T19 A;  1WSJ A;  4FJH A;  3KVG A;  4DUZ K;  2UXC K;  1W7A A;  4KHQ A;  4O8K A;  2BAN A;  4A2B A;  3AO1 A;  5HOO A;  4CZG A;  1G15 A;  1YIJ N;  2W41 A;  4JKD A;  3SQ0 A;  4CJL A;  1VQ7 N;  4DF4 A;  4O55 A;  4W5O A;  1JLQ A;  4H8K A;  4CJ4 A;  1EET A;  3SUP A;  2VWB A;  2HHU A;  4CE9 A;  4CK2 A;  4CZL A;  1N5Y A;  4C8O A;  4N47 A;  3SV4 A;  1BU6 O;  1TK0 A;  1GLC G;  3DOL A;  4KTW A;  5JVG L;  1VQ6 N;  2A40 A;  1NGD A;  3O3H A;  1SKR A;  4BR9 A;  3HXM A;  1FJG K;  5E84 A;  3OA9 A;  5AQJ A;  2HBK A;  5KQD A;  4F2S A;  1QVG M;  2IVO A;  3EYZ A;  4FPB A;  4H0O A;  4XH1 A;  4GVE A;  4CJ7 A;  4U67 L;  2VQE K;  4BRA A;  3PLA A;  1HNV A;  1WLJ A;  3VGK A;  5FRO A;  4F8R A;  3C6H A;  1RBU A;  4HTU A;  4JKE A;  2DY4 A;  3L0Q A;  2HNZ A;  4OJR A;  4LY7 A;  5EOY A;  1UWB A;  2WBN A;  3F2K A;  2DFF A;  3DXK A;  4B9V A;  3K5O A;  5FPD A;  3CC2 N;  1IKV A;  2VCP A;  1BQN A;  3AVC A;  1RGI A;  4NB4 A;  4NYN A;  3OY9 A;  1RTJ A;  1BG3 A;  1YF5 L;  4WFB L;  4L8R B;  3JYT A;  4PQU A;  4FWN A;  3OYF A;  3EKS A;  5JLH A;  3WEE B;  4WFN L;  3SJH A;  2HW3 A;  2JLE A;  4JRQ A;  3DAW A;  3ENH A;  1XHZ A;  2Z1H A;  3B6P A;  1T3V A;  4JI7 K;  4IFE A;  3V9W A;  3LP1 A;  2B6A A;  3CD6 N;  1D4X A;  1QHA A;  2FSJ A;  3SJJ A;  4CCH A;  2CGK A;  5C42 A;  4FLZ A;  3I8B A;  3M5R A;  4Z0U A;  1P8Z A;  3O6W A;  4B1U B;  4JAX A;  2HOE A;  4A5A A;  1X9J A;  1GOA A;  1WSF A;  3L2W A;  3T3F A;  5BN8 A;  2YJE A;  4CHP A;  3VN5 A;  2ITG A;  4NLC A;  2V52 B;  4IG3 A;  4JK7 A;  1RDU A;  1YIT N;  4ICL A;  4CIG A;  3PO5 A;  2HVI A;  1EP4 A;  1U4B A;  1TL1 A;  2ASP A;  3LDO A;  4LSN A;  1K9M O;  3QES A;  1KD1 O;  2OPP A;  1IBM K;  4FWQ A;  3ATV A;  1OVY A;  3K57 A;  4CIE A;  4FJX A;  3OVN A;  3HVR A;  1Q18 A;  5AZJ A;  2IVN A;  3LPT A;  1HNW K;  5TKW A;  3HOS A;  1TK5 A;  4MO4 A;  2ZM6 K;  1SUQ A;  3MN6 A;  2QEX N;  3VEX A;  1NOZ A;  3TPQ A;  4OLA A;  3K9K A;  4YOY A;  4FJM A;  3NAE A;  3MEE A;  1YJN N;  3KK2 A;  3CQX A;  3SQ2 A;  3ATU A;  3D7E O;  4GMJ B;  2D0P A;  4PKI A;  1NBW A;  4UQG A;  3CXC M;  2E6L A;  4KH4 A;  4CJF A;  3I0S A;  1DTT A;  3MWT A;  3W0L A;  3L2V A;  5DMR A;  2D0A A;  5AQS A;  1M1K O;  1BIZ A;  2YKN A;  2AP1 A;  3CPW M;  4FJK A;  3NF9 A;  5MLC Q;  3ENB A;  3OYH A;  4FM2 A;  3HM9 A;  1DGK N;  1S1T A;  4AHC A;  4M3Y A;  1NJZ A;  2V7Y A;  2FSK A;  5C15 A;  1XMQ K;  2OAN A;  4CBW A;  2NRV A;  3CI5 A;  4CBU A;  1UA1 A;  5C2D A;  5KGX A;  3BUZ B;  4AHV A;  2V7Z A;  4A59 A;  3CG7 A;  3PUF A;  1ATR A;  4ELV A;  3ASM A;  1V4S A;  4I9Q A;  4M3Z A;  1TKZ A;  1RDD A;  3CHW A;  1JLC A;  2HBL A;  3R8E A;  1OH7 A;  4NCB A;  1HYV A;  4E1J A;  4BC5 A;  4FK2 A;  4JEP A;  2YHX A;  1YTA A;  3E01 A;  3HK2 A;  3QFP A;  1S72 N;  4LH5 A;  3AA4 A;  4JV5 K;  3DRR A;  1JXB A;  1QQO A;  5AQF A;  2G8I A;  2JGU A;  1W0H A;  4CJR A;  4FWP A;  4PUO A;  4EIA A;  3GG4 A;  1C1B A;  4M41 A;  1NK6 A;  2QWQ A;  3AVJ A;  2KQ2 A;  3LM2 A;  3DXM B;  1DKG D;  2HF3 A;  1B9D A;  3LZJ A;  1VSM A;  3ZX3 A;  1T6C A;  1KLN A;  3THX B;  3CET A;  4B9S A;  3QIP A;  2X6N A;  4BRM A;  2Q0U A;  2P9N A;  3D2F B;  1YVN A;  4DG1 A;  4U7B A;  3SBG A;  4CGI A;  5EU7 A;  4IEE A;  3CCM N;  1NGJ A;  1RDA A;  5GIO A;  2UYT A;  3ZEU A;  4BVO A;  5AQH A;  3CF5 L;  4BR5 A;  5HRN A;  1U45 A;  5C0Y A;  3MN9 A;  2E2P A;  4UY8 O;  1T7P A;  2BDP A;  1BI4 B;  1GLE G;  4BRF A;  5SWM A;  2O4G A;  2VG7 A;  5CZ2 A;  2E5L K;  2G8V A;  2GUP A;  3AVM A;  1JL2 A;  3O9S A;  5AQZ A;  1U04 A;  4A62 A;  3MXM A;  4B3T K;  2Z1G A;  2YHA A;  1S22 A;  2ETJ A;  1NGG A;  2WUS A;  2FXU A;  2YJF A;  2NRW A;  3OJU A;  1ZBH A;  1WSI A;  4TSX A;  3AVL A;  4CD3 A;  3AAR A;  4JS4 A;  4FM1 A;  3SUN A;  4FJ9 A;  1LWC A;  3MXJ A;  3O4N A;  4PY5 A;  1NGB A;  3DLG A;  2FBV A;  2YNH A;  1KXP A;  4Y0W A;  1A5X A;  1GLL O;  3LPU A;  2KZZ A;  1QZ6 A;  4DB3 A;  2VYP A;  3AO3 A;  3TAR A;  4JHD B;  1SAZ A;  2XY8 A;  5DM6 L;  2OPR A;  5AQL A;  3KWG A;  3ZYY X;  3NGY A;  3TTC A;  2E6M A;  1XQS C;  1Z05 A;  1WSE A;  2ZWH A;  4IEI A;  4X65 K;  3TSP A;  1VRU A;  4O44 A;  3A5O C;  4CEC A;  4F3O A;  1TYQ B;  2FSN A;  4K43 A;  3HO1 A;  4MO5 A;  1RFQ A;  4CZF A;  2HNY A;  3B6O A;  3OYE A;  2QWM A;  2QWR A;  4H0T B;  2FF6 A;  2E2N A;  2HBJ A;  5AQQ A;  3AVI A;  3MK6 A;  3CCQ N;  1HKC A;  4NYF A;  4CJP A;  3HYF A;  4CGH A;  1FW6 A;  1IG8 A;  2E1Y A;  3O3F A;  2P9L B;  2D0B A;  5CYQ A;  3UB5 A;  1LCU A;  4FW1 A;  3DLB A;  1XUP O;  2Q0R A;  4DQP A;  4WQ5 A;  4DTJ A;  5AQX A;  2ZQB A;  4WE1 A;  3QBW A;  4B3S K;  2ZE2 A;  2O8B B;  4B08 A;  1OH8 A;  3CFR A;  4FK0 A;  4DTP A;  4R79 A;  3LM9 A;  3DLL L;  3IDH A;  4FVU A;  3QEW A;  2QK9 A;  3GDQ A;  3DM2 A;  1S9E A;  4L3Q A;  3QFU A;  1U47 A;  4EP4 A;  4N5S A;  1VRT A;  3MEC A;  3MAQ A;  4DV2 K;  1NJI O;  4JI4 K;  3OYI A;  3AA5 X;  3G71 N;  4NCG A;  3PY8 A;  1BIS A;  3BZC A;  1NMD A;  1S6Q A;  1KFD A;  4H4M A;  3JAM O;  4DMN A;  4FLY A;  2PBD A;  4H5V A;  3WT0 A;  3OYL A;  3QIC A;  3FE1 A;  4BRE A;  3O5B A;  5FLX O;  4DR1 K;  2G8K A;  1X9M A;  1VQM N;  4JRP A;  4BDP A;  5CHI A;  4M3X A;  3ZT4 A;  2IC3 A;  3O3G A;  4MLE A;  1YT3 A;  1C0U A;  4GY2 B;  4DTO A;  4QS9 A;  4FW2 A;  3K9J A;  3P1G A;  3HP6 A;  1TKT A;  4CZK A;  4DQ8 A;  1VAZ A;  2PFU A;  4OO1 J;  3ZT3 A;  2XHB A;  3LAL A;  3PIP L;  2ZGY A;  2O8D A;  2OA8 A;  2KKZ A;  3I8D A;  3R1X A;  4KH5 A;  3QB0 A;  3P39 A;  5HRP A;  2F7T A;  3RSE B;  4CFB A;  2JWL A;  3KIO A;  4O5F A;  2P9U A;  2FF3 B;  1TKD A;  3L6Q A;  1JLG A;  1X9S A;  1SQK A;  1VQN N;  3A8Y A;  4JS5 A;  1W97 L;  2W6L A;  3GOI A;  4JLH A;  1M90 O;  4IOX A;  1Z25 A;  3V9S A;  4X64 K;  3MXI A;  2Z1J A;  2WFB A;  3VEZ A;  4AHR A;  4CZJ A;  4RWT A;  4FZY A;  2A5X A;  3SPZ A;  4BR7 A;  1RT3 A;  2VG6 A;  4WF9 L;  4QAG A;  4KHN A;  2A1S A;  2ASO A;  3NH1 A;  1NOY A;  4KAZ A;  4YNQ A;  4AHS A;  3WEE A;  4LD0 A;  2FBT A;  5BRD A;  1NGF A;  4W5Q A;  3M8R A;  4HUG A;  2GEL A;  4KHU A;  2HHV A;  4FWS A;  3AVK A;  2P5O A;  2GWJ A;  1K8A O;  1X3M A;  4N56 A;  1NG9 A;  5AQU A;  1B92 A;  5C10 A;  1K73 O;  3NVM A;  4E7H A;  3G25 A;  1YAG A;  3ZT0 A;  4A61 A;  4GNI A;  4DR6 K;  3U8X A;  4F4K A;  1HRH A;  5C25 A;  4EAH D;  4DTU A;  3C6U A;  4CES A;  4CJQ A;  4FYD A;  2RKI A;  3ZT2 A;  1RT4 A;  2I7N A;  4WFA L;  3ULE B;  3DLE A;  3U9D A;  1RT1 A;  4WQ5 C;  3ZSQ A;  3OBY A;  3WXL A;  2P9S B;  4Z94 A;  2X6S A;  4CF2 A;  3CJ9 A;  2HND A;  1S3X A;  4KKO A;  4C1N K;  1U49 A;  1QSL A;  3SAH A;  3RMD A;  5CZ1 A;  4ILH A;  4DV0 K;  1ATN A;  4RW9 A;  4H4O A;  3M3Z A;  1UA0 A;  4BRC A;  1XI1 A;  3WQU A;  1REV A;  2D1K A;  4IFY A;  4CGD A;  4FJ5 A;  3NH0 A;  3KK1 A;  5TKY A;  3AVN A;  4B3M K;  1TV6 A;  4M7X A;  4WYB A;  3OHR A;  4FLV A;  1ASU A;  1FKP A;  3AAQ A;  4Z4C A;  2A1R A;  2GTD A;  4B8A B;  3SBT A;  3FZH A;  3THW B;  1NK4 A;  4BC3 A;  4O8U A;  4X66 K;  4FJ7 A;  4IFV A;  3C7N A;  4CF1 A;  3LP0 A;  2EWS A;  5JLF A;  4CZM A;  4DKW A;  4M7Y A;  1Y64 A;  4IO9 L;  3J7Y P;  4B3R K;  3KJV A;  3VF6 A;  1HYS A;  1OH5 A;  3IG1 A;  3K59 A;  3ID6 A;  5JS2 A;  5LJW A;  3PIO L;  3ZSX A;  4B8C A;  4RTF D;  4AF1 A;  1L3S A;  3QNN A;  3I56 N;  2EX3 A;  1BWF O;  3V1Q A;  5DK5 A;  4DU4 A;  3KZB A;  2CGL A;  5H1S Q;  1VSK A;  5F0X A;  4R5P A;  3C65 A;  2P9P A;  3ZSO A;  3L3U A;  4E7L A;  4ZTF A;  4BE1 A;  4E1N A;  4YHH K;  4PHT X;  3OYN A;  3CME N;  1TAQ A;  4M3W A;  3AV9 A;  2YHY A;  4HHT A;  3ZX0 A;  4H0V B;  4CZH A;  4DUY K;  3E1Y A;  2GX9 A;  4KHP K;  5FDL A;  4FWO A;  1W2B M;  3BF1 A;  3SPY A;  3SMS A;  3UKU B;  4CEB A;  4BRG A;  4CJT A;  2H3G X;  1N36 K;  2P9K B;  3A0I X;  3OYM A;  3OYC A;  3SAF A;  3OW2 M;  4X62 K;  3LWM A;  3V9U A;  4EHU A;  4FLU A;  3R9P A;  3MED A;  4FOE A;  1RT6 A;  1VQK N;  1SL0 A;  3HBT A;  4CJE A;  2O8C A;  3RR8 A;  3AO2 A;  4I6M B;  3FR0 A;  3F9M A;  4QS8 A;  1VQL N;  3QIO A;  4JNE A;  1LOT B;  3K0S A;  5K14 A;  3WXI A;  1K6Y A;  3A5N C;  1NGC A;  4H5R A;  2Y1I A;  3SMP A;  3RR7 A;  5GIN A;  4BRQ A;  1NJY A;  3T1A A;  3U3Y A;  1B9F A;  2FBX A;  4ISG A;  4DU1 A;  2DPN A;  5AR0 A;  5GAD P;  4DV5 K;  4KH6 A;  4E7K A;  4N76 A;  1CZ9 A;  5AQW A;  3RMA A;  3TAP A;  2OTL N;  2G8H A;  3ZET B;  3O9Q A;  3MCA B;  1KTQ A;  4CEZ A;  4DTN A;  3C94 A;  1VQ4 N;  5BR9 A;  4EHT A;  4N41 A;  3UE5 A;  4NXM K;  1ILY A;  3FZK A;  4BRD A;  3NDK A;  2F8T A;  4DQQ A;  2EHG A;  3CPE A;  1I3A A;  4BRI A;  3DYA A;  1TUY A;  1S1X A;  1R59 O;  4CJ5 A;  4AM7 A;  2KFN A;  4E7I A;  4F2R A;  4BRN A;  4BRO A;  3CCR N;  1BUP A;  3AY9 A;  1FK9 A;  4ILJ A;  3FFI A;  3MX2 A;  1ATS A;  1C1A A;  5AQK A;  3HPO A;  3WNF A;  3A5L C;  2E20 A;  3D2E B;  4H5W A;  3KKR A;  4IZ9 A;  1E4G T;  3HZ6 A;  1RBS A;  3MWP A;  4JD2 A;  4BR4 A;  3BY5 A;  3ZLJ A;  3T1Y K;  2DFH A;  3LDP A;  1JLA A;  4Y1C A;  3ID8 A;  1DEJ A;  1WBD A;  3V1O A;  1WNS A;  1EQY A;  1TYQ A;  1NK5 A;  4CD1 A;  4JYA K;  3AA2 A;  2J4R A;  3SNN A;  1XC9 A;  1TUU A;  3QBX A;  3MCP A;  2P9I A;  2HB5 A;  5M1N A;  4XEI A;  3K5L A;  5FPE A;  2I7P A;  4OKE A;  4CHO A;  3OS1 A;  2E8A A;  4FL9 A;  4JKG B;  1NK8 A;  2HHQ A;  3TSU A;  3TI0 A;  4DHY A;  1HLU A;  1IBK K;  1FXX A;  3KLH A;  1HKG A;  3HPG A;  1NJW A;  3DMJ A;  4A2A A;  3AA3 A;  4J2B A;  4K42 A;  4IJN A;  1RDB A;  1VQO N;  4MLH A;  2IGI A;  2YNI A;  4YOX A;  2RF2 A;  2YNF A;  3VQ7 A;  3THY A;  3QEV A;  4FJ8 A;  3NF8 A;  3L4Q A;  4KFB A;  1MA9 B;  1Q9Y A;  1QSS A;  3VQ5 A;  3P83 D;  3RMC A;  3IMX A;  3ZT1 A;  3C95 A;  1L5U A;  5AQY A;  4M3R A;  3FZL A;  1IKW A;  4K25 A;  4CFD A;  5HRO A;  4CEQ A;  1JCG A;  1L3T A;  1HMV A;  3IFR A;  1BOT O;  1NGE A;  4K41 A;  4CHZ A;  3R3L A;  4E7J A;  3VES A;  3V6D A;  1HNZ K;  4KB0 A;  3FLC O;  1J9A A;  2V51 B;  3FGU A;  4BR0 A;  2ZJP L;  3LDQ A;  1XWL A;  2W40 A;  1BCO A;  3KHY A;  4DV4 K;  3E66 A;  4DR3 K;  3HI0 A;  4FJI A;  3OYJ A;  3V4I A;  5F1X A;  1HPM A;  4JK9 A;  4FLX A;  1MWM A;  2GUI A;  4J2E A;  4FJJ A;  3K5M A;  2D4W A;  4E0D A;  3LDN A;  4BRP A;  1VSI A;  4W5T A;  2Q31 A;  3HJF A;  1J53 A;  3H46 O;  1KVC A;  4FZZ A;  4HUF A;  3AVH A;  3FZF A;  2BUP A;  3TTF A;  2XO7 A;  3VQC A;  4H0X B;  3FZM A;  3CCJ N;  1TAU A;  2F4V K;  1QS4 A;  5E41 A;  2NLX A;  4FWR A;  2NNW A;  5CR4 A;  3OS0 A;  3CQ8 A;  4PWD A;  3CC7 N;  5J2Q A;  4NCA A;  3SYZ A;  4CEE A;  2KHO A;  1SKS A;  5ADX A;  4CZE A;  3L2R A;  2CH6 A;  3ALY A;  3PO4 A;  4O0J A;  5HL7 L;  1OKJ A;  1F21 A;  4FWK A;  2ASM A;  2A41 A;  4FJN A;  1JXE A;  4CF0 A;  3TAQ A;  4DFM A;  1CLQ A;  4GV9 A;  4DTR A;  1IKY A;  3UKR A;  5CE3 A;  4YY3 K;  3KKS A;  3P5J A;  2XY5 A;  4JI0 K;  5LJV A;  3G6E N;  3VQQ A;  4E1M A;  4OPJ A;  3CCL N;  4ELT A;  2ZGZ A;  4IKF A;  4RW4 A;  3VER A;  1HJR A;  1O1W A;  5AZJ B;  4KO0 A;  4DR7 K;  2ZJR L;  4BRL A;  1KAY A;  3TSQ A;  4KRF A;  2YX6 A;  3V1R A;  4I2Q A;  5FPM A;  3RRH A;  1IKX A;  2BH1 A;  3VA3 A;  3H3O B;  3LZI A;  3KLI A;  1N33 K;  4LH4 A;  1X9W A;  5AQO A;  2RN2 A;  3VF4 A;  3W3D A;  3VQ8 A;  4CZI A;  4NXN K;  3OYK A;  2O8F A;  2F96 A;  1E3M A;  4V19 S;  4H0P A;  3VQ9 A;  3S41 A;  4DQS A;  3O1W A;  4RG8 A;  4K0K K;  4CGJ A;  4FSV A;  4OKJ A;  5EY4 A;  2G8F A;  2HF4 A;  1TVR A;  3O1B A;  3DI6 A;  5AZI A;  3VA0 A;  1LW0 A;  3H6E A;  5I42 A;  4AHT A;  5JMV A;  3L8B A;  1NKB A;  4C8K A;  2RHK A;  3LAN A;  1KCF A;  4KHS A;  3KD5 E;  3K5N A;  2DFE A;  5AFU A;  4M42 A;  1U48 A;  3WNG A;  1MWK A;  1RTD A;  1D8Y A;  1E4F T;  3QLH A;  3THW A;  4E3S A;  3U6F A;  3VQD A;  1OH6 A;  4ID1 A;  1ASW A;  3T69 A;  4B9M A;  1LV5 A;  1L3U A;  1BGX T;  2O8E B;  3SUO A;  4JI3 K;  5AQR A;  1VSH A;  4FWL A;  3E9O A;  1NGH A;  4CBX A;  4EZ6 A;  4IWV A;  4BY9 C;  4Z4H A;  5BPN A;  1NGI A;  1BA0 A;  4FXD A;  3HOT A;  5FPN A;  3O4Q A;  4O4G A;  4I2P A;  4Q0B A;  1CZB A;  1U2V B;  4CI6 A;  5JIC A;  2AA4 A;  2I5J A;  2P1J A;  2A3Z A;  3VEO A;  3S3M A;  1Y97 A;  4M3T A;  3RWU A;  3M8S A;  1XHX A;  2F9T A;  1S1U A;  3KWI A;  4DR4 K;  4BRH A;  3NMU A;  2P9N B;  4DWI A;  1UOC A;  2OPS A;  4JKC A;  4M3U A;  5M1Q A;  4WQ4 A;  4CER A;  3KD1 E;  5JS1 A;  3CMA N;  4FCY A;  3A5M C;  3DWL A;  2CGJ A;  3HT3 A;  2KZM A;  5DM7 L;  1K8K B;  4FPA A;  4BC4 A;  4DS4 A;  4BWJ A;  5GAH P;  3H1V X;  2PYJ A;  1RT5 A;  4CJS A;  3ZEU B;  3ZSY A;  4IO8 A;  5HRS A;  2OYQ A;  4B9Q A;  3CJ7 A;  3EZW A;  1VHX A;  3D6R A;  2UUC K;  5KRS A;  5HRR A;  4KTZ A;  4BDZ A;  4BR2 A;  4Q5V A;  3SCX A;  4OPK A;  2HHS A;  4FM0 A;  1EWR A;  4HCC A;  1JCE A;  1ESV A;  3QER A;  4CED A;  4BDY A;  3QET A;  5GAE P;  4ZHR A;  4YOW A;  5HP1 A;  4C23 A;  1JLE A;  4CK3 A;  3J81 O;  1S5J A;  1WAJ A;  2VWJ A;  1VSF A;  3M6G A;  3ZX2 A;  1KQS M;  4DQI A;  1QE1 A;  4PA1 A;  3VGL A;  5ADX H;  4Z4E A;  1I94 K;  4LFC K;  5BRH A;  1RT2 A;  3CFP A;  4KI4 A;  1Z26 A;  4LFB K;  4BQZ A;  4IXC A;  1J5O A;  2OZM A;  4LF8 K;  1GLA G;  4M63 C;  3F73 A;  2HHX A;  2BGG A;  3SV3 A;  4Z4G A;  3ZET A;  1IBL K;  5AJ3 K;  3WNH A;  3SLC A;  3TAG A;  4W5N A;  3C6T A;  5E26 A;  5C12 A;  5KPZ A;  1RBR A;  4DTS A;  3D0P A;  1RTI A;  3TAB A;  2QWL A;  3O80 A;  4DR5 K;  4ID5 A;  1LWF A;  2ZD1 A;  4DFJ A;  1IV0 A;  4LF4 K;  2FBY A;  3ZSR A;  1T05 A;  4JN4 A;  1D9F A;  3EN9 A;  3WXM B;  1VSE A;  3BGR A;  3M8P A;  1O13 A;  3WXJ A;  4B1Y B;  3N4P A;  5AQP A;  3OYD A;  3EL2 A;  2F8S A;  2ATQ A;  4HCB A;  3JXU A;  1HYZ A;  1NK7 A;  5GIP A;  3CJB A;  1XNQ K;  2QA4 N;  5FRM A;  1BL3 A;  3SK3 A;  4YDU A;  5A2Q O;  3TAN A;  5AQV A;  4KBO A;  2QTD A;  3LP2 A;  3VET A;  4Z4I A;  1BDG A;  2YHW A;  2UXB K;  5AFU H;  1Q82 O;  1Q7Y O;  1QQN A;  5LL6 Z;  2HBM A;  4PKG A;  3WQT A;  3AGR A;  5BRF A;  4CFC A;  4RW6 A;  1NU0 A;  3LDL A;  5CY4 A;  2KW4 A;  4PL7 A;  3CIP A;  3CQY A;  4B9L A;  2OCE A;  2DTU A;  1NNE A;  5I9E B;  3KK7 A;  3K2P A;  1C1C A;  3VOV A;  1ZBL A;  3P31 A;  4QOZ B;  1VSJ A;  1S6P A;  2QW9 A;  1BA1 A;  3TWH A;  4AHU A;  2YCH A;  4BE0 A;  1TL3 A;  3QEP A;  4WQ4 C;  4KHW A;  3L4I A;  3RTV A;  5KPR A;  3RRG A;  4DU3 A;  1A5W A;  3DLK A;  3CM5 A;  2YV0 X;  4YOT A;  3AAP A;  3TR8 A;  4G9Z A;  3LP3 A;  2W6K A;  5EX5 A;  2O8D B;  4EP5 A;  3NBP A;  1X3N A;  4BQL A;  1Z6R A;  4JI8 K;  4LF7 K;  4PL8 A;  3WXK A;  4ISE A;  4G1Q A;  3AVF A;  4EFH A;  4B3O A;  2NRT A;  1Q8I A;  4DSF A;  1XC3 A;  3DXM A;  3HVT A;  2NRZ A;  1SZ2 A;  5J1E A;  5BPM A;  2P9U B;  2E88 A;  4DSL A;  1YJW N;  5M1P A;  4KB1 A;  4IG0 A;  4E89 A;  3THX A;  1J5E K;  4CF8 A;  4BG9 A;  3VQB A;  4CEO A;  5D3G A;  4ISF A;  3H45 C;  3V9X A;  3D2F A;  3DRS A;  4DLE A;  2A6A A;  3O8M A;  2GBZ A;  4GV6 A;  1IJJ A;  3LAM A;  4CIF A;  1KC8 O;  1YUW A;  3PX4 A;  1T6D A;  2WC9 A;  3AVB A;  4C8L A;  1HKB A;  1IO2 A;  1CZA N;  1ITG A;  1WB9 A;  4ELU A;  1N6Q A;  1YTU A;  3S3O A;  3PX6 A;  4J2D A;  2OPQ A;  5GAG P;  4HTL A;  4BWM A;  4CVN E;  1BI4 A;  4CHQ A;  1LAV A;  4LC9 B;  4C8M A;  4DSE A;  3C0B A;  2IOC A;  4B9N A;  1T03 A;  1RT7 A;  3SQ4 A;  1RDC A;  1ZBS A;  4CJV A;  1NWK A;  2G8U A;  1NM1 A;  4BC2 A;  4EZ9 A;  3RVC A;  4B1Z A;  1TGO A;  4CFA A;  2IIR A;  3OTO K;  1SKW A;  4Z4F A;  4K8Z A;  5BN9 A;  4H5T A;  4H5N A;  2QI2 A;  3ZSZ A;  3G0Z A;  5IWA K;  2YNG A;  4CEF A;  2F9W A;  4JHD A;  3O9R A;  1GLJ O;  3GBT A;  3HTV A;  2O4I A;  3VQP A;  1EXQ A;  3N4Q A;  3DLH A;  4DV6 K;  4LF5 K;  3O08 A;  4Y1D A;  4H0Y B;  2YHB A;  4AM6 A;  4DQR A;  3VEW A;  5J2M A;  2XRI A;  1S9G A;  4LSL A;  1JKH A;  4B1W B;  4AQY K;  4DR2 K;  4YDU C;  5C24 A;  2W42 A;  4RW8 A;  3H1Q A;  3EZ5 A;  3VEV A;  3JSM A;  4DLG A;  3J8A A;  1S1W A;  2UU9 K;  4I9L A;  4FZX C;  5AQI A;  1HX1 A;  3C7N B;  2X78 A;  2QWN A;  5SZT A;  4A5B A;  3MX5 A;  3IUC A;  2VWK A;  1N34 K;  1GLF O;  2P9L A;  3GL1 A;  4B9U A;  1LAW A;  3B8A X;  1NJX A;  1KAZ A;  2QKK A;  1WUA A;  3VQ4 A;  4MDB A;  1TK8 A;  3CM6 A;  2O8B A;  2Q3S A;  1UAX A;  3C6A A;  4NLB A;  5IT9 O;  2QKB A;  3J80 O;  4KV8 A;  1W9H A;  2E2Q A;  1MU2 A;  5J2P A;  2E1Z A;  1JJ2 M;  1GLD G;  3U9Z A;  2WOM A;  3WUH A;  1V4T A;  4FOI A;  3E9L A;  2P9P B;  5BR8 K;  1D9D A;  3PX0 A;  3A2F A;  5KPT A;  2B5J A;  3OS2 A;  4IDH A;  3VQA A;  1HNX K;  3H3N O;  3O9U A;  2FLO A;  4K8X A;  1HR0 K;  4KI6 A;  2ZJQ L;  4BE2 A;  2O8E A;  3TAE A;  1EWQ A;  3JS6 A;  3OYB A;  2VGM A;  2YI1 A;  3AGK A;  2OZS A;  3ISN C;  4DSK A;  3BDP A;  1CXQ A;  3Q7B A;  1RCH A;  3NVK A;  2QWO A;  4CF9 A;  5CYM A;  4YFU A;  1WBB A;  4CGG A;  5AQN A;  4OPA A;  1KSP A;  1CXU A;  4KTQ A;  1J54 A;  3MN7 A;  4F9O A;  1RBV A;  2OTJ N;  4IOA L;  4NO7 A;  3P38 A;  3NE6 A;  1U2V A;  1Q9X A;  3NF6 A;  2IDO A;  3DXK B;  3NCI A;  4GVM A;  5JVH L;  4C1N I;  2JWK A;  1MDU B;  1C0M A;  4OLB A;  1P90 A;  2O8C B;  1C0G A;  3QEI A;  1ZBF A;  2GV9 A;  1DT9 A;  3CJA A;  3SZ2 A;  2PAV A;  1K8K A;  5EXW A;  3LL3 A;  4WCE L;  3V9Z A;  1VSD A;  5KI6 A;  3F5T A;  5BPL A;  3HPH A;  3VEN A;  3RSE A;  3QDK A;  3D45 A;  3HSC A;  1BO5 O;  2A42 A;  3CER A;  3VEY A;  3I0R A;  3CCV N;  1KVB A;  1H1V A;  4JI6 K;  3DOK A;  1SL2 A;  3QIN A;  1GLB G;  3CJ1 A;  3MEG A;  2D0O A;  1BQM A;  4LF9 K;  2YKM A;  3OYG A;  5AQG A;  1R0A A;  1RTH A;  4CHY A;  3S3N A;  3SAG A;  2P5G A;  1DLO A;  2D5R A;  3HP9 A;  3VMF B;  3KLF A;  4I7F A;  3NGI A;  1GOC A;  3K58 A;  2VGN A;  4B1V A;  3ITH A;  1KVA A;  1A5V A;  3MMV A;  5HBM A;  3EE8 A;  1NKE A;  2QM1 A;  1YI2 N;  3IAY A;  4GV3 A;  4CJW A;  3FFK B; 
#chains in the Genus database with same CATH homology
 2UUC K;  2UUB K;  4JI4 K;  1HNZ K;  4K0K K;  2UXB K;  4YHH K;  5LL6 Z;  1HNX K;  4B3T K;  5LMU K;  1HR0 K;  4DV4 K;  4DR3 K;  4GKK K;  3JAM O;  4DR6 K;  4JI5 K;  4DUY K;  3OTO K;  3T1Y K;  4LF6 K;  4KHP K;  5FLX O;  3J81 O;  4DR1 K;  1XMQ K;  4JYA K;  4GKJ K;  5IWA K;  1N36 K;  4JI7 K;  5LMN K;  1I94 K;  4LFC K;  2UXD K;  4CW7 B;  4X62 K;  4OX9 K;  4DV6 K;  1N32 K;  4LF5 K;  4DV0 K;  4LFB K;  4LF8 K;  4JI3 K;  2F4V K;  4DV7 K;  1XNR K;  1XMO K;  2UXC K;  4DUZ K;  4X65 K;  2HHH K;  1IBK K;  4JV5 K;  1IBL K;  4AQY K;  5AJ3 K;  4DR2 K;  4B3M K;  4JI8 K;  4LF7 K;  2UU9 K;  4JI1 K;  4X66 K;  4LFA K;  4YY3 K;  4JI6 K;  1N34 K;  4JI2 K;  4DR5 K;  1IBM K;  4DV5 K;  3J7Y P;  4JI0 K;  4B3R K;  4LF4 K;  1J5E K;  4DV3 K;  4DR4 K;  2VQF K;  4LF9 K;  1HNW K;  4X64 K;  1FJG K;  4DR7 K;  4DV1 K;  4B3S K;  5IT9 O;  3J80 O;  2ZM6 K;  4NXM K;  3J7A P;  3T1H K;  2VQE K;  2UUA K;  1N33 K;  4NXN K;  4CVN E;  5BR8 K;  1XNQ K;  5A2Q O;  2E5L K;  4DV2 K;  4V19 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...