2UUBK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uubK00
4DR3K 4DV5K 4B3SK 2UXBK 4KHPK 2VQEK 4LF8K 4DR6K 4OX9K 5LMNK 1XNQK 1I94K 4YY3K 2UUCK 4JI7K 5IT9O 4DR4K 4X65K 4V19S 4JYAK 4JI1K 4DV0K 4DV1K 1J5EK 5A2QO 3J7YP 5AJ3K 2E5LK 3T1HK 4B3TK 1IBMK 4CW7B 2HHHK 5LL6Z 4JI3K 1HNXK 4LFBK 4JI8K 1XNRK 2ZM6K 4DR2K 5BR8K 1XMQK 4LF4K 2F4VK 4DUZK 1N34K 4B3MK 4K0KK 2UXDK 4GKJK 4DR1K 3OTOK 1N32K 5FLXO 2VQFK 3T1YK 1HR0K 4DV6K 4CVNE 5LMUK 4LFAK 4GKKK 4JI2K 2UXCK 2UUAK 4LF6K 4AQYK 4DV3K 4DR7K 1IBLK 4JI4K 2UU9K 4DV7K 4NXMK 1N36K 4DV4K 3J80O 1N33K 1HNWK 4B3RK 4X62K 4X64K 4LFCK 4X66K 4NXNK 2UUBK 4JV5K 1FJGK 1HNZK 5IWAK 1IBKK 4JI6K 1XMOK 3J7AP 4LF9K 4DUYK 4JI5K 4DR5K 4LF5K 3JAMO 4DV2K 4LF7K 4YHHK 4JI0K 3J81O
chains in the Genus database with same CATH superfamily
2O8FA 3SPYA 2QEXN 4RTFD 4A2AA 3EZWA 5AFUA 3VQ9A 4IFVA 2YKMA 2CGJA 4CZFA 1EETA 4H0YB 3HM8A 3O9UA 3H08A 3NE6A 4OPAA 4BRPA 3P38A 4J2AA 1K9MO 2D0CA 3F73A 1EX4A 5BRDA 1EWQA 1OVQA 1VSIA 3R1XA 4H5NA 1J5EK 1OH5A 2HMPA 1KXPA 5J2QA 4M3TA 4ILGB 3DAWA 2HBKA 4NLCA 3OS1A 1Q82O 4NO7A 3CF5L 1D9DA 1VRTA 1P90A 4B1VA 4CJSA 3CG7A 2HBJA 5KQDA 3MN5A 5AQSA 2OPPA 4G9ZA 1RBSA 1HQUA 3FLCO 4E7LA 1YVNA 1JLBA 3DRSA 3EZ5A 5JS2A 4KAZA 2FBYA 1RT7A 3I33A 4DTMA 2PY5A 3ATUA 2P9NA 4AHUA 4H03B 3TAPA 3DJCA 3DLRA 3ZETA 4EHUA 3CJ9A 3G4SN 1DKGD 1BWFO 3UKRB 4NYNA 3QEPA 1GLFO 3AVKA 5EOYA 4CHNA 2AP1A 3VA0A 3THYB 3U3YA 3WXLA 1YIJN 3SZ2A 1A5VA 5BPMA 4PUOA 3TTCA 3OVNA 3BP8A 2OPSA 3O5BA 3KD1E 4CJKA 2Q1NA 1LW0A 4DSKA 5M1PA 3WXIA 4CERA 1BU6O 1NGEA 1BG3A 3VQEA 1T03A 3LALA 1C6VA 4JS5A 3KHYA 2V7YA 3U6FA 1W7AA 1KTQA 4FVMA 4B9VA 2FBTA 4DFJA 1TL3A 5LY3A 2VGMA 2ZGZA 1BDGA 1NLVA 5AQTA 3PO5A 4J8FA 3SQ2A 1WSGA 1CZAN 4DR5K 1BI4B 3LWMA 2YHYA 3SK3A 2O8FB 2UXBK 1OVYA 1X9SA 1GOCA 4N5SA 1LWFA 2NUBA 3AVCA 4HWIA 4MFBA 4ILJA 4IOCL 4FJLA 3RR8A 3QESA 3CJCA 3HXMA 2OYQA 2IOCA 3O9QA 1JLCA 1WB9A 4JKGB 4JKEA 3BF3A 4JI1K 2FXUA 3ATVA 3IAYA 2RHKA 3KZBA 4O44A 4E89A 1J9AA 1A5XA 3P5JA 1EKEA 4FL9A 2PFUA 3OYJA 3NGZA 1VSHA 3N4PA 1RCHA 4NYFA 1ASVA 3K5LA 3VN5A 3FZFA 4HCBA 5BPLA 4PY5A 3ZEUA 4FJIA 4WQ5A 3CCUN 2VCPA 3M6GA 2HF3A 4KB1A 3I55N 5FPDA 3JYTA 1VSDA 4FM0A 5HRRA 4DR1K 2X6NA 4AHSA 4JEPA 1XHZA 1UA0A 3I0SA 4CGGA 4CJVA 2BANA 5FLXO 4K41A 3RMDA 3WQTA 4OVLA 4H5TA 4I9LA 1NM1A 2QM1A 1CXUA 1L3TA 5SZTA 4GKKK 4WFNL 2YHBA 1UA1A 4G1QA 4DTUA 3F9MA 2Q3SA 2E6MA 3SQ1A 5AQQA 4DR7K 4M3WA 3ZLJA 2YHAA 3TU5A 3PX0A 2A3ZA 4Z4GA 4B9SA 3O8MA 4LSLA 4DQPA 1TK5A 1Z25A 3PX4A 3TSUA 3ULEA 4AHCA 1ZBHA 5M1QA 3QMLA 2I7PA 3VQQA 1VQPN 4BR2A 4EP5A 5HOOA 4IOAL 4OKKA 5IWAK 1KVAA 4JI6K 2KZZA 1IV0A 3WUHA 2WFBA 4I7FA 3V1OA 1RTJA 3VEYA 3J81O 4MLHA 1HPZA 1ZC6A 1LOTB 2P5OA 1YUWA 4DQIA 3AO2A 3MAQA 1G15A 4CGIA 3QETA 2I7NA 4FM1A 1X9JA 4W5NA 3C7NA 4FZYA 4DLEA 4BROA 2EHGA 4ELUA 4DR4K 3AAPA 3BY5A 4DSIA 3A5OC 4BDPA 3CYMA 1C0UA 2X74A 3IDHA 3TI0A 5KI6A 3SUPA 1Q86O 1VK0A 3C6TA 3OYFA 5AQVA 2NRVA 3V1RA 4JKDA 4JI8K 1BA0A 1NGIA 2YX6A 5C10A 1C1CA 1JCFA 4H5RA 4FJJA 4CIEA 3OW2M 3ZEUB 4BDZA 2ZD1A 3HO1A 3DLGA 4FZXC 1NGCA 2UXDK 3L3VA 4Z4FA 2P9SB 4DMNA 4JN4A 1RGIA 3C6AA 3VQDA 4H4MA 4UQGA 3QFPA 2X6SA 4DQQA 3EE9A 5AQXA 1RTHA 3CIPA 1Q7YO 3C6UA 3VEZA 1KSPA 1YT3A 4LF6K 5AQYA 3QEWA 2YV0X 3B6PA 3IS9A 5AQKA 4HTUA 5KPRA 3C65A 1U47A 3LM2A 2ETJA 1ESVA 2YHXA 4M3YA 1HQEA 2GUIA 4ZTJA 3Q7CA 4GV6A 1P8ZA 4JHDA 2DPNA 3S3OA 4X66K 1U4BA 3KLFA 4LY7A 3KIOA 2GEMA 1R59O 3NMUA 1TKZA 2JLEA 3QINA 4BR7A 3LDSA 4H8KA 4DQRA 4DS4A 4CIGA 4LF9K 1VQ8N 3VESA 3ZT1A 1NGHA 2QWRA 1NMNA 2Z1JA 3VQ6A 4BGBA 4FPBA 3ZX2A 4J2DA 2O8CB 1YJWN 1NJIO 4R5PA 4BRKA 4QOZB 3U3GA 4DSLA 3VEWA 1L5UA 4UY8O 3C7NB 2W41A 3T1AA 4BRLA 5IT9O 1QZ6A 1GLDG 5F1XA 4DV0K 4RWTA 4FJXA 3ZX0A 3OYDA 1C0FA 3O9SA 3DI6A 1YTUA 1RDUA 3A5MC 4DWIA 3FZLA 2CGKA 5LL6Z 1T7PA 4CJLA 4FWKA 4BRAA 3MXIA 4CFAA 3K9JA 3VA3A 2P9IA 1YVUA 4GY2B 1BHLA 3A5NC 4YOXA 2A5XA 4FJHA 4B1WB 1BQMA 3LPUA 4DUZK 4B3MK 4K0KK 1ATSA 1QE1A 4DF4A 4YOWA 1MU2A 2YNIA 1WAFA 1C1AA 5ELZA 2P9UA 3TANA 4DG1A 1HNVA 3FZKA 3CI5A 1W9HA 3ULDA 1VSKA 4OGEA 4FLTA 5JLFA 2ASPA 4DV6K 3DOLA 1ATNA 1B9FA 4WE1A 3ZSZA 3LDNA 3MN7A 3CPWM 2OTLN 3MEGA 4LH5A 4C1NI 4DF8A 4FSVA 2KFZA 4W5TA 1HYSA 4CHYA 1B92A 2FF6A 3I56N 1B9DA 4W5RA 3J80O 5GAHP 1JLEA 4CZIA 3CCQN 1HNWK 3SQ4A 3WEEB 4FOIA 4JHDB 4CJEA 4FZZA 1S1XA 3LPTA 4BR0A 1W97L 3H46O 3G6EN 3I8BA 4AM6A 2GUPA 4IO8A 5JICA 2WTUA 4C8NA 4F3OA 3RRGA 3JAMO 1Y64A 3D2EB 4O55A 1QZ5A 3LAMA 3QDKA 3TSQA 3SUQA 2KTQA 3MDQA 3UKUA 4OGCA 2HMIA 3CJAA 3SLCA 3HL8A 1NU0A 4Y0WA 4I2QA 4CCHA 3DLBA 5MLCQ 4JYAK 4C8LA 4MDBA 3NH1A 4DV1K 3BGRA 1JCGA 4N76A 4ID5A 5A2QO 3I0RA 4CD3A 4CESA 3VQ7A 3OS2A 4HVJA 5LJWA 3E9LA 3CM6A 5KGWA 1HLUA 2VGNA 3L2QA 3CD6N 4FLXA 3KLGA 4IWVA 3MEDA 4QS9A 2VYPA 2G8VA 4ISFA 4CEAA 3NFAA 3W3DA 5LJVA 1TYQB 4KBOA 1NJXA 4O5BA 3HOTA 2NZTA 4DR2K 1W2BM 4U67L 2CH6A 1XMQK 5AQRA 4CJPA 3V81A 5AZIA 1VQKN 4CGFA 3KKRA 4CJ7A 3U9ZA 2VWKA 4PWDA 3IFRA 1QQOA 1QQCA 1HKBA 3ZSRA 4DFPA 4YDUC 4CBXA 4CJTA 1XC3A 4H5VA 4FM2A 1BIZA 2V7ZA 1LV5A 4CK2A 5TKYA 4QAGA 3FFIA 3GG4A 4E3SA 3OYIA 5FRNA 3D0PA 3ENHA 4BQZA 1NK9A 3ID8A 1GLAG 2QWQA 2Q36A 1WOQA 1NGJA 3O1WA 3LP3A 2W6LA 1HJRA 2NRRA 4KO0A 4Q0BA 3KWGA 4KI4A 4BC3A 1BISA 3ZSVA 1IBKK 5AQOA 3V4IA 4W5QA 4DS5A 3A8YA 4JK7A 3OYCA 3HBTA 3HZ6A 3LM9A 2YNFA 4PQUA 4JKAA 3WNEA 4DV5K 4JRQA 4E7KA 4B3SK 5E41A 3JXUA 4NLBA 2HHVA 1JLQA 2GWKA 1VQ4N 4CZEA 1WUAA 3VQAA 4H0OA 1VQ7N 2A6AA 3EN9A 3GBTA 4EZ9A 4ELTA 3DXKB 5CZ2A 1HKGA 4FWSA 4U7BA 4DFMA 2O4GA 2P9KA 4DSEA 1TAUA 2E20A 4FK4A 3JSMA 2BDPA 4CBWA 3HYFA 4IBNA 3THXB 2HHHK 4A61A 1NK6A 4TSXA 3NH2A 3VEOA 1NOYA 3NF8A 1O13A 5HL7L 2WUSA 4KH6A 2WONA 3SBGA 3EL2A 2D5RA 4HUFA 5JMVA 3DMJA 4B3OA 4HUGA 2O8DA 4LF4K 2A1SA 3CERA 1ZBSA 3MX5A 4CIFA 5AZIB 2YNGA 2F8SA 4IJNA 3AY9A 3HTVA 3RMCA 3D7EO 3MN6A 3L2VA 2VG5A 3SUOA 5KRSA 3V9WA 3AARA 2ZJQL 2HNZA 3O3GA 2Y1JA 1C0GA 1BQNA 1HKCA 4CVNE 1G99A 3PLAA 2UUAK 5FPMA 2AA4A 5HLFA 5HRNA 5EX5A 3SBTA 1NGDA 2O8BA 1WSFA 4BG9A 3GDQA 3LZJA 4FLUA 4DQ8A 3WXKA 5I42A 3AVFA 4O8UA 4PL8A 4RG8A 1N36K 4B9TA 4WCEL 3EO3A 2HNDA 2G8WA 2KKZA 2PBDA 4M42A 5AQNA 3PIOL 4BACA 5AQJA 4KHSA 4LC9B 4CZJA 4NXNK 3VMFB 3RVCA 4DTSA 4H4OA 4I6MA 4E0DA 2O8EA 3CXCM 3WNGA 1RBUA 3AGRA 1SQKA 4DV2K 1JXEA 3UE5A 4JI0K 1DT9A 4JD2A 4FLWA 5HBMA 4ID1A 3VQ8A 4CF2A 4KHPK 4CHQA 1Q81O 2ASOA 3AO3A 4EAHD 5GIOA 3L3UA 2G8UA 2V51B 1A5WA 1WSJA 3CCSN 3CJ7A 4YOVA 4XH5A 1DTTA 2QKBA 4BRDA 4DKWA 4FVUA 3LANA 1X9MA 2P9KB 3VQ5A 4BWMA 4GW6A 1SV5A 1J6ZA 1Q8IA 1T6DA 5CYQA 3DOKA 1HJOA 5ADXA 5HRPA 3QERA 4J2BA 4KTWA 4EZ6A 3V6DA 3TTDA 4YOYA 4KRFA 3VOVA 4FJNA 2ZM6K 4JK8A 2HNYA 4EHTA 3LDPA 2O8DB 1IKVA 1JCEA 5KGXA 3HSTB 2NLXA 3MX2A 3OTOK 4FJ9A 4B8AB 2OA8A 2B6AA 3W0LA 4A5BA 3J7ZO 2KW4A 3CC2N 1IG9A 1FKPA 4BE1A 2RKIA 3AA4A 3CETA 3D2FA 5FDLA 5LMUK 1C1BA 3OS0A 4CI6A 1U48A 5BN9A 4B9NA 2O8BB 1JKHA 3PSFA 3TAGA 4ZTFA 2IVNA 4DTNA 3TARA 3P39A 4N56A 1IBLK 1KRPA 2P9NB 3O3FA 1SL0A 4DV7K 2IDOA 4DSJA 3PIPL 3H6EA 3ZETB 3IKMA 3WNFA 1RT1A 4F3TA 3DXMA 5EY4A 1QVGM 3AVAA 4Q5VA 1BA1A 2A42A 3BUZB 4LH4A 3HVRA 1RT5A 3QLHA 3LP1A 1SL1A 4CEBA 1IH7A 1VHXA 3AVBA 4I6MB 4CEFA 1XMOK 2O8EB 2BGGA 3PY8A 1CXQA 3ZSYA 3HOSA 4DTOA 4JD2B 1RDDA 2GBZA 3H1VX 2EWSA 4GVEA 5GAEP 5AQMA 3HI0A 1SKRA 1OH6A 1GLJO 3OYNA 3AA3A 5LMNK 3T3FA 1MWKA 1L3VA 4GMJB 2F96A 2XY6A 1C0MA 4YY3K 1S3XA 1CLQA 5C2FA 4M3RA 3OJUA 5CHIA 3SI6A 4YOTA 2DFFA 3T19A 2IS3A 4YNQA 3U4LA 2QWPA 1VQON 1FW6A 1U2VA 3DRPA 4BVOA 3MEEA 2FBVA 3DYAA 3FZMA 2P1JA 1ITGA 1RT2A 1TKTA 3VGKA 1KLNA 3CHWA 2O4IA 4DSFA 2QTDA 1X9WA 3OYBA 1BCMA 4FOEA 3ZYYX 4AF1A 5BRHA 3FE1A 3MWTA 3DLHA 1IKYA 4GNIA 5AFUH 4CF0A 2ASMA 2PAVA 1GOBA 4DTJA 3O6WA 4GKJK 3G71N 3EE8A 5AQLA 4OPHA 3IRXA 5AQZA 3LDQA 1LAVA 3WT0A 1V4TA 5AZJA 3ID6A 5AQWA 3D2FB 3E9OA 2E2OA 1XI1A 3AA2A 4CF1A 1ZBIA 4AILC 1TK8A 1IG8A 4CE9A 5KPTA 3O1BA 4CK1A 4FLVA 3TR8A 1N5YA 4Y1DA 4BRGA 4FXDA 4B1XB 4BRFA 5FPNA 3R8EA 1KVCA 3SUNA 3TAQA 2E2QA 2R7YA 4JK9A 4BREA 5GIPA 4CZLA 1NWKA 1NKCA 3MN9A 2G8HA 3QIOA 4X62K 4L8RB 3A0IX 1TUUA 3K5MA 3CQXA 1EP4A 1KAYA 2XY8A 4HUEA 2KZMA 2HHUA 4KH4A 4CJ3A 4J2EA 3HM9A 2E2NA 3S3MA 3P31A 3OY9A 3NGIA 4IO9L 4BR4A 2OTJN 1HPMA 3H1QA 2P5GA 3THWA 1QSLA 1CZBA 3KLIA 3TTFA 3AVNA 3ZSXA 4DQSA 3AAQA 3U9DA 3IG1A 5M1NA 3ULEB 3O4NA 3HPGA 3M8PA 2GELA 4XH1A 1RBVA 2HHQA 3F9KA 2DTUA 3SAGA 5I3UA 4KV8A 4IG3A 2Z1GA 4QCLA 4K43A 4F4KA 4DFKA 3O9RA 4OJRA 2F8TA 2W6KA 4MDAA 1GLCG 1KD1O 5C0YA 1U2VB 4B9UA 5CZ1A 4B3TK 1QHTA 5BN8A 3HVTA 5GAGP 5EVZA 3VGLA 1N6QA 3LDLA 2IVPA 2EX3A 3P83D 1S1TA 4CJ4A 3NVKA 4KKOA 3VEXA 3LL3A 4O0JA 3VTHA 1N34K 4KHNA 3LAKA 1S6QA 3AO1A 3HK2A 2ITGA 1QHAA 4FWRA 2HB5A 5C24A 4FLZA 5J2MA 4B9LA 1NJZA 2KHOA 3KVGA 4CJWA 2VQFK 2RN2A 1F21A 1T8EA 3FFKB 1X3MA 1HMVA 1IKWA 4CHOA 1OKJA 2QXLA 3ENBA 3VPZA 1J53A 4A2BA 4PL7A 4FWMA 1TK0A 1C0TA 4RW7A 3CCMN 1OH7A 3ZCMA 4I9QA 2P51A 4DU4A 2CH5A 4PHTX 3AVJA 4E7JA 4Z4CA 2WC9A 3SQ0A 3K5NA 4BRQA 5KRTA 3SPZA 4FWOA 1RNHA 4M3UA 1VQNN 1FJGK 1FKOA 3PX6A 4WQ4A 4BQLA 3OYHA 4O5FA 2BUPA 1X1PA 2NRZA 1S9EA 1K8KA 3SMPA 2GV9A 3KK3A 5DM7L 5C2DA 1KVBA 1YHQN 1REVA 2ZJPL 4M3ZA 4YOUA 1GLLO 1HUXA 4KH5A 3HT3A 4CEZA 3DLEA 3S3NA 3HRGA 1RT3A 4JNEA 1Y97A 5AQIA 4CD1A 2IGIA 2OZSA 3AVGA 3FZHA 1MA9B 3RWUA 4CF9A 1N8RO 4M41A 2RPIA 2ZGYA 5J2PA 4KTZA 2E5LK 4RCHA 3T1HK 5C25A 3QNOA 4BC2A 1TUYA 3C0BA 4JI3K 3OJSA 4WFAL 4YORA 2IAJA 4A5AA 1FK9A 1U49A 3G25A 3LZIA 1DLOA 4DLGA 1KC8O 1NK5A 1NGBA 2JWKA 1YJ9N 4K42A 2UYTA 1S1WA 2E8AA 2HBLA 2YJEA 1QSYA 1R0AA 1K8AO 2F9WA 3PSIA 1VSFA 1RILA 4L3QA 1JLAA 3CQYA 4IOXA 4MQ3A 4ZHRA 4FCYA 3K57A 3AV9A 1E4FT 3KK1A 2P9IB 1VAZA 3J8AA 3I8DA 4FJ7A 5E26A 1Q9YA 3G0ZA 3C95A 4KREA 4B08A 2P9LA 2FSKA 2OCEA 3ZT2A 4KFBA 2P9UB 4KHUA 1ZBFA 1K73O 4Z94A 2E88A 3NCIA 4IFEA 2Q0RA 4CJRA 5AQHA 1CZ9A 1RT6A 2LSNA 4B3RK 3TAFA 3CFOA 1ASWA 1Q18A 4JV5K 2HVIA 4H0XB 1HNZK 4DTXA 3DWLA 1E3MA 3H45C 4EP4A 1K8KB 3GL1A 3N4QA 3CC4N 1MWMA 4DR3K 3KJVA 5AQPA 2VG6A 5CE3A 3SV4A 1I94K 5B8HA 2OPRA 4OPKA 4NCGA 1VRUA 2XHBA 4A62A 1IO2A 4IDHA 3AGKA 3NH0A 1SUQA 4AH9A 4Z0UA 3DM2A 4BG8A 3V9ZA 3CCRN 2X78A 2RE2A 4AHRA 2XO7A 1IBMK 4CW7B 3CFRA 3BDPA 1EQYA 1TAQA 2QK9A 5FROA 2WOMA 1ASUA 2GWJA 3ZX3A 3O4QA 1L3SA 3UKUB 1XNRK 1HX1A 3THYA 1EXQA 3EKSA 3RSEA 3QNNA 2F4VK 2DFHA 2KLAA 4QS7A 4FJMA 5F2RA 4DHYA 1E4GT 4F9OA 3SV3A 4PKHA 3ZSQA 3FR0A 1VSLA 3THVA 2CGLA 1NG9A 5KTQA 2NRXA 4O0IA 2E4LA 2UXCK 4FWLA 1NGGA 2FLOA 4BWJA 1SS6A 4BR5A 3PV8A 4FWNA 1QQNA 3V1QA 4B9QA 4GV9A 1RDCA 4E1JA 5K14A 3OYEA 4BRHA 3DLKA 1S22A 5TKWA 2J4RA 2XY7A 3MCAB 4FWPA 3F5TA 1WAJA 4E1NA 4LFCK 4BVPA 4CEQA 1VQMN 4FYDA 2BE2A 4WF9L 2FF3B 1VSJA 3AVHA 4JKGA 3M8RA 3QEXA 3CMAN 1WSIA 4NCAA 4LF7K 4RW9A 2D1KA 2ZQBA 2GTDA 2IC3A 3KLHA 4B9MA 1NGFA 3A5LC 3M8QA 2E2PA 4A59A 1LWCA 3UIQA 2FSJA 4XEIA 2QWNA 3TWHA 4YFUA 2VWJA 3CCJN 2QKKA 3BZCA 3S41A 2YHWA 2KFNA 2E1YA 3MWPA 3B8AX 3BEXA 1ZXOA 3SCXA 1RFQA 3O9TA 3VENA 2ZF5O 5I9EB 4JKFA 5DMRA 4FK2A 4C23A 3HP6A 1UAXA 4CECA 2OANA 3H3OB 1NK4A 1Z6RA 2QWMA 1V4SA 4H0PA 3FGUA 4FK0A 3OYAA 3EYZA 1S6PA 4GV3A 1Z05A 2ITMA 3RSEB 4CGHA 2YI1A 3IUCA 2NNWA 1TV6A 4IDKA 4NB4A 5CR4A 3OYLA 5GADP 3VGMA 3CJBA 1GLBG 1Z26A 1YF5L 3CQ8A 4JKBA 3NF7A 4ICLA 3QFUA 1M90O 3TSPA 1J54A 1KCFA 3T1YK 5AR0A 1KAXA 3RR7A 1NJYA 2G8IA 4OKJA 3ISNC 1JL1A 3LWLA 1JLFA 4KI6A 3O4WA 4OPJA 2QXFA 4JRPA 2IVOA 4JKCA 3T69A 4AQYK 5JVHL 4DU1A 1VQLN 4BRCA 3VTIA 3EEQA 1YI2N 4JI4K 3D6RA 2ZE2A 2E1ZA 3M1FA 4NXMK 4FJKA 2B5JA 1TKDA 3BZKA 3K2PA 1VSEA 2ZJRL 3QBWA 1RTDA 3ASMA 4N41A 2DFEA 1BIUA 1SKWA 1J5OA 4BRMA 1BUPA 1KFDA 3H3NO 4IZ9A 1T44A 4JI5K 1VQ9N 2YJFA 4K8ZA 3MCPA 3AVMA 4YHHK 4Z4HA 4DU3A 1TGOA 4I2PA 4QS8A 4IXCA 4F8RA 2W40A 4LF8K 1U6ZA 3CFPA 2NRWA 3L2RA 1KLMA 4BRNA 3K59A 1M1KO 4LD0A 3WQUA 1XNQK 5KQ8A 5H1SQ 3OA9A 5AQGA 3TAMA 1LW2A 3HPHA 4X65K 3TABA 4C8MA 3L2WA 4O4GA 5C15A 1NJWA 2P9SA 1D5AA 3E1YA 3WXJA 4F2SA 4Z4IA 3MMVA 4B1ZA 2AJQA 4ILHA 3VF6A 2QWOA 3CCEN 4KB0A 4ISEA 3ZT3A 4BR9A 5DM6L 1XC9A 4BC4A 2BTFA 3V9SA 4DTPA 1GOAA 4H5WA 2F9TA 4CHPA 3L2UA 1S72N 4WFBL 3QBXA 4BDYA 4M3XA 2BH1A 2D0OA 3ZT0A 3VEVA 3E01A 4WQ5C 1YITN 3ITHA 1VQ5N 5BRFA 3LDOA 1N32K 4IJAA 2WBNA 3DRRA 1EWRA 3LP0A 1S9GA 2FBXA 4OLBA 3HP9A 4B1YB 5M1KA 3O3HA 2OZMA 5AQFA 4CFBA 4LFAK 1OH8A 1WSHA 3HSCA 1BCOA 5AQUA 3OBYA 3CM5A 3NHGA 3VF4A 2VG7A 4DV3K 1D9FA 1EO1A 2A41A 4CGDA 2G8KA 4FJ8A 2O8CA 3IMXA 2HSTA 3NGYA 4M45A 1YAGA 2PYLA 3QO9A 2HHTA 4B8CA 1N33K 3AA5X 4N47A 3VQBA 4KHQA 1WN7A 4KHYA 4R79A 3MXMA 4RW4A 4RW6A 1ZBLA 3OHRA 4KHWA 4CF8A 3L6QA 3NF9A 2NRHA 4FWQA 1NK8A 4H0VB 1BL3A 4CZGA 4DB3A 1U04A 2Z1HA 1YJNN 4OX9K 3PUFA 4KTQA 5F0XA 3KK7A 4BGAA 4CBUA 4CEOA 5FPEA 4MLEA 3DXMB 3LP2A 2FSNA 2D0AA 3SAHA 4CJQA 1D8YA 1VQ6N 5D3GA 1RDBA 1JJ2M 3R9PA 1S5JA 3TAEA 3SMSA 4JI7K 1QSSA 1BGXT 4HHTA 1HYVA 3EKUA 1QQMA 5C42A 2D0BA 3E9PA 4XIUA 5DK5A 4LSNA 1GLEG 4BE2A 5CYMA 3QIPA 3T7ZA 1XUPO 1O1WA 4MO5A 5T7BA 2HVHA 4DCHA 3KLEA 1WLJA 3V9XA 3G10A 3VERA 1NK7A 4CZMA 2QI2A 3OYGA 2Q97A 4E7IA 2I5JA 4M63C 5BR8K 2Y1IA 1RBRA 3K58A 1NOZA 4E7HA 4HTLA 5HP1A 1NGAA 2ATQA 2B4JA 4FJGA 1SAZA 2XY5A 1QS4A 3KK2A 1H1VA 3C94A 4O8KA 1XQSC 3K9KA 2F7TA 3WEEA 2HHSA 1DGKN 4CFDA 5BPNA 3SJJA 1RDWX 4CEDA 1WBDA 1QVFM 4CJUA 2A40A 5ADXH 4NCBA 3ALYA 3B6OA 3VQPA 4IKFA 3OYKA 3ENOA 3D2EA 3RMBA 4FLYA 2YNHA 1NKBA 4XH4A 4CFCA 3RTVA 3QB0A 3CCLN 2DY4A 2GX9A 1I39A 3ZSWA 2RF2A 4A57A 5AZJB 2D4WA 4DTRA 3UB5A 4AHTA 1DTQA 1XWLA 2G8FA 3ZT4A 3L4IA 1TKXA 3NBPA 3SAFA 1S1UA 1WSEA 3DLLL 3BF1A 1KFSA 1T05A 2JGUA 3GOIA 2QW9A 1HNIA 2VQEK 1I3AA 2V52B 4H0TB 1U45A 5GINA 1MDUB 5BREA 1TYQA 2KQ2A 3CJ1A 4PA1A 4JS4A 2NRTA 1QTMA 4C1NK 1WBBA 1RDAA 5J1EA 1SZ2A 1BOTO 2PYJA 2JWLA 3NVMA 5JS1A 4FJ5A 1IJJA 4RW8A 3MECA 2H3GX 3THWB 4FO0A 3Q7BA 4F2RA 2YCHA 3RRHA 1ZYQA 4IEIA 1S1VA 1T6CA 3K0SA 2HW3A 4PKGA 5HROA 5M1FA 2P9PA 1NKEA 1X3NA 3VQ4A 3VF2A 4E1MA 4JAXA 1XHXA 1L3UA 2E6LA 1T3VA 3WNHA 1UWBA 3KTQA 4HCCA 4BRIA 1BO5O 2YKNA 1TL1A 1RT4A 1TVRA 5EXWA 3CCVN 3CC7N 1ATRA 4B1UB 3HJFA 2QA4N 1NNEA 2FC0A 4CEEA 2HHWA 3KWIA 5CY4A 1W0HA 3QICA 1LCUA 4WQ4C 3KKSA 1UOCA 4FPAA 4YDUA 3VETA 1JXBA 3O80A 4CZHA 3NDKA 4DV4K 2Q0UA 3E66A 2A1RA 1KQSM 3AVIA 5FRMA 4X64K 4JKHA 3V9UA 1ZBUA 2UUBK 3S9HA 3MXJA 1NMDA 3DXKA 3GE1A 2HOEA 1JLGA 4CGJA 3R3LA 3J7AP 2D0PA 3O08A 4ISGA 3AVLA 3JS6A 5M1OA 3MK6A 2HBMA 3ZSOA 3THXA 1FXXA 4DR6K 2HHXA 4WYBA 1NBWA 1ILYA 4BC5A 2W42A 3R6MA 3QEVA 3OBWA 2UUCK 3RMAA 3EY1A 3NF6A 2OPQA 4BY9C 4ELVA 4V19S 3OYMA 1SL2A 5C12A 4CJFA 3U8XA 4C8OA 3L4QA 3J7YP 5AJ3K 3L8BA 5JVGL 3TPQA 4M7YA 4M7XA 3WXMB 4IG0A 3PO4A 1HNXK 4LFBK 4OKEA 4CJ5A 3NAEA 4AM7A 1NK0A 3SYZA 2HF4A 3P1GA 4GVMA 5KPZA 1LWEA 1RTIA 2P9PB 3L0QA 4C8KA 4MO4A 4CZKA 1BI4A 1IKXA 4AHVA 2VWBA 2QWLA 4CHZA 3HPOA 3M5RA 1SKSA 4KPYA 1KAZA 1YTAA 4K25A 4OO1J 3UKRA 5HRSA 3M8SA 4K8XA 1LAWA 2XRIA 1HR0K 3A2FA 1HRHA 4JI2K 2Q2RA 3K5OA 4PKIA 4JLHA 1JL2A 3F2KA 2Q31A 2PZSA 3M3ZA 4W5OA 1HYZA 3CPEA 2IIRA 3SJHA 4IEEA 4FW2A 5E84A 1YXQA 4EFHA 4BE0A 2UU9K 1D4XA 5EU7A 5J2NA 4EIAA 1RBTA 5BR9A 4FW1A 5JLHA 1DEJA 3AO5A 1K6YA 4CK3A 1Q9XA 3P4IA 3D45A 5SWMA 3SNNA 3VQCA 1WNSA 4Z4EA 4OLAA 3KD5E 3C6HA 3QEIA 2Z1IA 2ZWHA 4E19A 4IFYA 4DUYK 3CMEN 4LF5K 2P9LB 3AO4A 4Y1CA 1VSMA
chains in the Genus database with same CATH topology
4DR3K 4DV5K 4B3SK 2UXBK 4KHPK 2VQEK 4LF8K 4DR6K 4OX9K 5LMNK 1XNQK 1I94K 4YY3K 2UUCK 4JI7K 5IT9O 4DR4K 4X65K 4V19S 4JYAK 4JI1K 4DV0K 4DV1K 1J5EK 5A2QO 3J7YP 5AJ3K 2E5LK 3T1HK 4B3TK 1IBMK 4CW7B 2HHHK 5LL6Z 4JI3K 1HNXK 4LFBK 4JI8K 1XNRK 2ZM6K 4DR2K 5BR8K 1XMQK 4LF4K 2F4VK 4DUZK 1N34K 4B3MK 4K0KK 2UXDK 4GKJK 4DR1K 3OTOK 1N32K 5FLXO 2VQFK 3T1YK 1HR0K 4DV6K 4CVNE 5LMUK 4LFAK 4GKKK 4JI2K 2UXCK 2UUAK 4LF6K 4AQYK 4DV3K 4DR7K 1IBLK 4JI4K 2UU9K 4DV7K 4NXMK 1N36K 4DV4K 3J80O 1N33K 1HNWK 4B3RK 4X62K 4X64K 4LFCK 4X66K 4NXNK 2UUBK 4JV5K 1FJGK 1HNZK 5IWAK 1IBKK 4JI6K 1XMOK 3J7AP 4LF9K 4DUYK 4JI5K 4DR5K 4LF5K 3JAMO 4DV2K 4LF7K 4YHHK 4JI0K 3J81O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 K;  4DV5 K;  4B3S K;  2UXB K;  4KHP K;  2VQE K;  4LF8 K;  4DR6 K;  4OX9 K;  5LMN K;  1XNQ K;  1I94 K;  4YY3 K;  2UUC K;  4JI7 K;  5IT9 O;  4DR4 K;  4X65 K;  4V19 S;  4JYA K;  4JI1 K;  4DV0 K;  4DV1 K;  1J5E K;  5A2Q O;  3J7Y P;  5AJ3 K;  2E5L K;  3T1H K;  4B3T K;  1IBM K;  4CW7 B;  2HHH K;  5LL6 Z;  4JI3 K;  1HNX K;  4LFB K;  4JI8 K;  1XNR K;  2ZM6 K;  4DR2 K;  5BR8 K;  1XMQ K;  4LF4 K;  2F4V K;  4DUZ K;  1N34 K;  4B3M K;  4K0K K;  2UXD K;  4GKJ K;  4DR1 K;  3OTO K;  1N32 K;  5FLX O;  2VQF K;  3T1Y K;  1HR0 K;  4DV6 K;  4CVN E;  5LMU K;  4LFA K;  4GKK K;  4JI2 K;  2UXC K;  2UUA K;  4LF6 K;  4AQY K;  4DV3 K;  4DR7 K;  1IBL K;  4JI4 K;  2UU9 K;  4DV7 K;  4NXM K;  1N36 K;  4DV4 K;  3J80 O;  1N33 K;  1HNW K;  4B3R K;  4X62 K;  4X64 K;  4LFC K;  4X66 K;  4NXN K;  2UUB K;  4JV5 K;  1FJG K;  1HNZ K;  5IWA K;  1IBK K;  4JI6 K;  1XMO K;  3J7A P;  4LF9 K;  4DUY K;  4JI5 K;  4DR5 K;  4LF5 K;  3JAM O;  4DV2 K;  4LF7 K;  4YHH K;  4JI0 K;  3J81 O; 
#chains in the Genus database with same CATH topology
 2O8F A;  3SPY A;  2QEX N;  4RTF D;  4A2A A;  3EZW A;  5AFU A;  3VQ9 A;  4IFV A;  2YKM A;  2CGJ A;  4CZF A;  1EET A;  4H0Y B;  3HM8 A;  3O9U A;  3H08 A;  3NE6 A;  4OPA A;  4BRP A;  3P38 A;  4J2A A;  1K9M O;  2D0C A;  3F73 A;  1EX4 A;  5BRD A;  1EWQ A;  1OVQ A;  1VSI A;  3R1X A;  4H5N A;  1J5E K;  1OH5 A;  2HMP A;  1KXP A;  5J2Q A;  4M3T A;  4ILG B;  3DAW A;  2HBK A;  4NLC A;  3OS1 A;  1Q82 O;  4NO7 A;  3CF5 L;  1D9D A;  1VRT A;  1P90 A;  4B1V A;  4CJS A;  3CG7 A;  2HBJ A;  5KQD A;  3MN5 A;  5AQS A;  2OPP A;  4G9Z A;  1RBS A;  1HQU A;  3FLC O;  4E7L A;  1YVN A;  1JLB A;  3DRS A;  3EZ5 A;  5JS2 A;  4KAZ A;  2FBY A;  1RT7 A;  3I33 A;  4DTM A;  2PY5 A;  3ATU A;  2P9N A;  4AHU A;  4H03 B;  3TAP A;  3DJC A;  3DLR A;  3ZET A;  4EHU A;  3CJ9 A;  3G4S N;  1DKG D;  1BWF O;  3UKR B;  4NYN A;  3QEP A;  1GLF O;  3AVK A;  5EOY A;  4CHN A;  2AP1 A;  3VA0 A;  3THY B;  3U3Y A;  3WXL A;  1YIJ N;  3SZ2 A;  1A5V A;  5BPM A;  4PUO A;  3TTC A;  3OVN A;  3BP8 A;  2OPS A;  3O5B A;  3KD1 E;  4CJK A;  2Q1N A;  1LW0 A;  4DSK A;  5M1P A;  3WXI A;  4CER A;  1BU6 O;  1NGE A;  1BG3 A;  3VQE A;  1T03 A;  3LAL A;  1C6V A;  4JS5 A;  3KHY A;  2V7Y A;  3U6F A;  1W7A A;  1KTQ A;  4FVM A;  4B9V A;  2FBT A;  4DFJ A;  1TL3 A;  5LY3 A;  2VGM A;  2ZGZ A;  1BDG A;  1NLV A;  5AQT A;  3PO5 A;  4J8F A;  3SQ2 A;  1WSG A;  1CZA N;  4DR5 K;  1BI4 B;  3LWM A;  2YHY A;  3SK3 A;  2O8F B;  2UXB K;  1OVY A;  1X9S A;  1GOC A;  4N5S A;  1LWF A;  2NUB A;  3AVC A;  4HWI A;  4MFB A;  4ILJ A;  4IOC L;  4FJL A;  3RR8 A;  3QES A;  3CJC A;  3HXM A;  2OYQ A;  2IOC A;  3O9Q A;  1JLC A;  1WB9 A;  4JKG B;  4JKE A;  3BF3 A;  4JI1 K;  2FXU A;  3ATV A;  3IAY A;  2RHK A;  3KZB A;  4O44 A;  4E89 A;  1J9A A;  1A5X A;  3P5J A;  1EKE A;  4FL9 A;  2PFU A;  3OYJ A;  3NGZ A;  1VSH A;  3N4P A;  1RCH A;  4NYF A;  1ASV A;  3K5L A;  3VN5 A;  3FZF A;  4HCB A;  5BPL A;  4PY5 A;  3ZEU A;  4FJI A;  4WQ5 A;  3CCU N;  2VCP A;  3M6G A;  2HF3 A;  4KB1 A;  3I55 N;  5FPD A;  3JYT A;  1VSD A;  4FM0 A;  5HRR A;  4DR1 K;  2X6N A;  4AHS A;  4JEP A;  1XHZ A;  1UA0 A;  3I0S A;  4CGG A;  4CJV A;  2BAN A;  5FLX O;  4K41 A;  3RMD A;  3WQT A;  4OVL A;  4H5T A;  4I9L A;  1NM1 A;  2QM1 A;  1CXU A;  1L3T A;  5SZT A;  4GKK K;  4WFN L;  2YHB A;  1UA1 A;  4G1Q A;  4DTU A;  3F9M A;  2Q3S A;  2E6M A;  3SQ1 A;  5AQQ A;  4DR7 K;  4M3W A;  3ZLJ A;  2YHA A;  3TU5 A;  3PX0 A;  2A3Z A;  4Z4G A;  4B9S A;  3O8M A;  4LSL A;  4DQP A;  1TK5 A;  1Z25 A;  3PX4 A;  3TSU A;  3ULE A;  4AHC A;  1ZBH A;  5M1Q A;  3QML A;  2I7P A;  3VQQ A;  1VQP N;  4BR2 A;  4EP5 A;  5HOO A;  4IOA L;  4OKK A;  5IWA K;  1KVA A;  4JI6 K;  2KZZ A;  1IV0 A;  3WUH A;  2WFB A;  4I7F A;  3V1O A;  1RTJ A;  3VEY A;  3J81 O;  4MLH A;  1HPZ A;  1ZC6 A;  1LOT B;  2P5O A;  1YUW A;  4DQI A;  3AO2 A;  3MAQ A;  1G15 A;  4CGI A;  3QET A;  2I7N A;  4FM1 A;  1X9J A;  4W5N A;  3C7N A;  4FZY A;  4DLE A;  4BRO A;  2EHG A;  4ELU A;  4DR4 K;  3AAP A;  3BY5 A;  4DSI A;  3A5O C;  4BDP A;  3CYM A;  1C0U A;  2X74 A;  3IDH A;  3TI0 A;  5KI6 A;  3SUP A;  1Q86 O;  1VK0 A;  3C6T A;  3OYF A;  5AQV A;  2NRV A;  3V1R A;  4JKD A;  4JI8 K;  1BA0 A;  1NGI A;  2YX6 A;  5C10 A;  1C1C A;  1JCF A;  4H5R A;  4FJJ A;  4CIE A;  3OW2 M;  3ZEU B;  4BDZ A;  2ZD1 A;  3HO1 A;  3DLG A;  4FZX C;  1NGC A;  2UXD K;  3L3V A;  4Z4F A;  2P9S B;  4DMN A;  4JN4 A;  1RGI A;  3C6A A;  3VQD A;  4H4M A;  4UQG A;  3QFP A;  2X6S A;  4DQQ A;  3EE9 A;  5AQX A;  1RTH A;  3CIP A;  1Q7Y O;  3C6U A;  3VEZ A;  1KSP A;  1YT3 A;  4LF6 K;  5AQY A;  3QEW A;  2YV0 X;  3B6P A;  3IS9 A;  5AQK A;  4HTU A;  5KPR A;  3C65 A;  1U47 A;  3LM2 A;  2ETJ A;  1ESV A;  2YHX A;  4M3Y A;  1HQE A;  2GUI A;  4ZTJ A;  3Q7C A;  4GV6 A;  1P8Z A;  4JHD A;  2DPN A;  3S3O A;  4X66 K;  1U4B A;  3KLF A;  4LY7 A;  3KIO A;  2GEM A;  1R59 O;  3NMU A;  1TKZ A;  2JLE A;  3QIN A;  4BR7 A;  3LDS A;  4H8K A;  4DQR A;  4DS4 A;  4CIG A;  4LF9 K;  1VQ8 N;  3VES A;  3ZT1 A;  1NGH A;  2QWR A;  1NMN A;  2Z1J A;  3VQ6 A;  4BGB A;  4FPB A;  3ZX2 A;  4J2D A;  2O8C B;  1YJW N;  1NJI O;  4R5P A;  4BRK A;  4QOZ B;  3U3G A;  4DSL A;  3VEW A;  1L5U A;  4UY8 O;  3C7N B;  2W41 A;  3T1A A;  4BRL A;  5IT9 O;  1QZ6 A;  1GLD G;  5F1X A;  4DV0 K;  4RWT A;  4FJX A;  3ZX0 A;  3OYD A;  1C0F A;  3O9S A;  3DI6 A;  1YTU A;  1RDU A;  3A5M C;  4DWI A;  3FZL A;  2CGK A;  5LL6 Z;  1T7P A;  4CJL A;  4FWK A;  4BRA A;  3MXI A;  4CFA A;  3K9J A;  3VA3 A;  2P9I A;  1YVU A;  4GY2 B;  1BHL A;  3A5N C;  4YOX A;  2A5X A;  4FJH A;  4B1W B;  1BQM A;  3LPU A;  4DUZ K;  4B3M K;  4K0K K;  1ATS A;  1QE1 A;  4DF4 A;  4YOW A;  1MU2 A;  2YNI A;  1WAF A;  1C1A A;  5ELZ A;  2P9U A;  3TAN A;  4DG1 A;  1HNV A;  3FZK A;  3CI5 A;  1W9H A;  3ULD A;  1VSK A;  4OGE A;  4FLT A;  5JLF A;  2ASP A;  4DV6 K;  3DOL A;  1ATN A;  1B9F A;  4WE1 A;  3ZSZ A;  3LDN A;  3MN7 A;  3CPW M;  2OTL N;  3MEG A;  4LH5 A;  4C1N I;  4DF8 A;  4FSV A;  2KFZ A;  4W5T A;  1HYS A;  4CHY A;  1B92 A;  2FF6 A;  3I56 N;  1B9D A;  4W5R A;  3J80 O;  5GAH P;  1JLE A;  4CZI A;  3CCQ N;  1HNW K;  3SQ4 A;  3WEE B;  4FOI A;  4JHD B;  4CJE A;  4FZZ A;  1S1X A;  3LPT A;  4BR0 A;  1W97 L;  3H46 O;  3G6E N;  3I8B A;  4AM6 A;  2GUP A;  4IO8 A;  5JIC A;  2WTU A;  4C8N A;  4F3O A;  3RRG A;  3JAM O;  1Y64 A;  3D2E B;  4O55 A;  1QZ5 A;  3LAM A;  3QDK A;  3TSQ A;  3SUQ A;  2KTQ A;  3MDQ A;  3UKU A;  4OGC A;  2HMI A;  3CJA A;  3SLC A;  3HL8 A;  1NU0 A;  4Y0W A;  4I2Q A;  4CCH A;  3DLB A;  5MLC Q;  4JYA K;  4C8L A;  4MDB A;  3NH1 A;  4DV1 K;  3BGR A;  1JCG A;  4N76 A;  4ID5 A;  5A2Q O;  3I0R A;  4CD3 A;  4CES A;  3VQ7 A;  3OS2 A;  4HVJ A;  5LJW A;  3E9L A;  3CM6 A;  5KGW A;  1HLU A;  2VGN A;  3L2Q A;  3CD6 N;  4FLX A;  3KLG A;  4IWV A;  3MED A;  4QS9 A;  2VYP A;  2G8V A;  4ISF A;  4CEA A;  3NFA A;  3W3D A;  5LJV A;  1TYQ B;  4KBO A;  1NJX A;  4O5B A;  3HOT A;  2NZT A;  4DR2 K;  1W2B M;  4U67 L;  2CH6 A;  1XMQ K;  5AQR A;  4CJP A;  3V81 A;  5AZI A;  1VQK N;  4CGF A;  3KKR A;  4CJ7 A;  3U9Z A;  2VWK A;  4PWD A;  3IFR A;  1QQO A;  1QQC A;  1HKB A;  3ZSR A;  4DFP A;  4YDU C;  4CBX A;  4CJT A;  1XC3 A;  4H5V A;  4FM2 A;  1BIZ A;  2V7Z A;  1LV5 A;  4CK2 A;  5TKY A;  4QAG A;  3FFI A;  3GG4 A;  4E3S A;  3OYI A;  5FRN A;  3D0P A;  3ENH A;  4BQZ A;  1NK9 A;  3ID8 A;  1GLA G;  2QWQ A;  2Q36 A;  1WOQ A;  1NGJ A;  3O1W A;  3LP3 A;  2W6L A;  1HJR A;  2NRR A;  4KO0 A;  4Q0B A;  3KWG A;  4KI4 A;  4BC3 A;  1BIS A;  3ZSV A;  1IBK K;  5AQO A;  3V4I A;  4W5Q A;  4DS5 A;  3A8Y A;  4JK7 A;  3OYC A;  3HBT A;  3HZ6 A;  3LM9 A;  2YNF A;  4PQU A;  4JKA A;  3WNE A;  4DV5 K;  4JRQ A;  4E7K A;  4B3S K;  5E41 A;  3JXU A;  4NLB A;  2HHV A;  1JLQ A;  2GWK A;  1VQ4 N;  4CZE A;  1WUA A;  3VQA A;  4H0O A;  1VQ7 N;  2A6A A;  3EN9 A;  3GBT A;  4EZ9 A;  4ELT A;  3DXK B;  5CZ2 A;  1HKG A;  4FWS A;  4U7B A;  4DFM A;  2O4G A;  2P9K A;  4DSE A;  1TAU A;  2E20 A;  4FK4 A;  3JSM A;  2BDP A;  4CBW A;  3HYF A;  4IBN A;  3THX B;  2HHH K;  4A61 A;  1NK6 A;  4TSX A;  3NH2 A;  3VEO A;  1NOY A;  3NF8 A;  1O13 A;  5HL7 L;  2WUS A;  4KH6 A;  2WON A;  3SBG A;  3EL2 A;  2D5R A;  4HUF A;  5JMV A;  3DMJ A;  4B3O A;  4HUG A;  2O8D A;  4LF4 K;  2A1S A;  3CER A;  1ZBS A;  3MX5 A;  4CIF A;  5AZI B;  2YNG A;  2F8S A;  4IJN A;  3AY9 A;  3HTV A;  3RMC A;  3D7E O;  3MN6 A;  3L2V A;  2VG5 A;  3SUO A;  5KRS A;  3V9W A;  3AAR A;  2ZJQ L;  2HNZ A;  3O3G A;  2Y1J A;  1C0G A;  1BQN A;  1HKC A;  4CVN E;  1G99 A;  3PLA A;  2UUA K;  5FPM A;  2AA4 A;  5HLF A;  5HRN A;  5EX5 A;  3SBT A;  1NGD A;  2O8B A;  1WSF A;  4BG9 A;  3GDQ A;  3LZJ A;  4FLU A;  4DQ8 A;  3WXK A;  5I42 A;  3AVF A;  4O8U A;  4PL8 A;  4RG8 A;  1N36 K;  4B9T A;  4WCE L;  3EO3 A;  2HND A;  2G8W A;  2KKZ A;  2PBD A;  4M42 A;  5AQN A;  3PIO L;  4BAC A;  5AQJ A;  4KHS A;  4LC9 B;  4CZJ A;  4NXN K;  3VMF B;  3RVC A;  4DTS A;  4H4O A;  4I6M A;  4E0D A;  2O8E A;  3CXC M;  3WNG A;  1RBU A;  3AGR A;  1SQK A;  4DV2 K;  1JXE A;  3UE5 A;  4JI0 K;  1DT9 A;  4JD2 A;  4FLW A;  5HBM A;  4ID1 A;  3VQ8 A;  4CF2 A;  4KHP K;  4CHQ A;  1Q81 O;  2ASO A;  3AO3 A;  4EAH D;  5GIO A;  3L3U A;  2G8U A;  2V51 B;  1A5W A;  1WSJ A;  3CCS N;  3CJ7 A;  4YOV A;  4XH5 A;  1DTT A;  2QKB A;  4BRD A;  4DKW A;  4FVU A;  3LAN A;  1X9M A;  2P9K B;  3VQ5 A;  4BWM A;  4GW6 A;  1SV5 A;  1J6Z A;  1Q8I A;  1T6D A;  5CYQ A;  3DOK A;  1HJO A;  5ADX A;  5HRP A;  3QER A;  4J2B A;  4KTW A;  4EZ6 A;  3V6D A;  3TTD A;  4YOY A;  4KRF A;  3VOV A;  4FJN A;  2ZM6 K;  4JK8 A;  2HNY A;  4EHT A;  3LDP A;  2O8D B;  1IKV A;  1JCE A;  5KGX A;  3HST B;  2NLX A;  3MX2 A;  3OTO K;  4FJ9 A;  4B8A B;  2OA8 A;  2B6A A;  3W0L A;  4A5B A;  3J7Z O;  2KW4 A;  3CC2 N;  1IG9 A;  1FKP A;  4BE1 A;  2RKI A;  3AA4 A;  3CET A;  3D2F A;  5FDL A;  5LMU K;  1C1B A;  3OS0 A;  4CI6 A;  1U48 A;  5BN9 A;  4B9N A;  2O8B B;  1JKH A;  3PSF A;  3TAG A;  4ZTF A;  2IVN A;  4DTN A;  3TAR A;  3P39 A;  4N56 A;  1IBL K;  1KRP A;  2P9N B;  3O3F A;  1SL0 A;  4DV7 K;  2IDO A;  4DSJ A;  3PIP L;  3H6E A;  3ZET B;  3IKM A;  3WNF A;  1RT1 A;  4F3T A;  3DXM A;  5EY4 A;  1QVG M;  3AVA A;  4Q5V A;  1BA1 A;  2A42 A;  3BUZ B;  4LH4 A;  3HVR A;  1RT5 A;  3QLH A;  3LP1 A;  1SL1 A;  4CEB A;  1IH7 A;  1VHX A;  3AVB A;  4I6M B;  4CEF A;  1XMO K;  2O8E B;  2BGG A;  3PY8 A;  1CXQ A;  3ZSY A;  3HOS A;  4DTO A;  4JD2 B;  1RDD A;  2GBZ A;  3H1V X;  2EWS A;  4GVE A;  5GAE P;  5AQM A;  3HI0 A;  1SKR A;  1OH6 A;  1GLJ O;  3OYN A;  3AA3 A;  5LMN K;  3T3F A;  1MWK A;  1L3V A;  4GMJ B;  2F96 A;  2XY6 A;  1C0M A;  4YY3 K;  1S3X A;  1CLQ A;  5C2F A;  4M3R A;  3OJU A;  5CHI A;  3SI6 A;  4YOT A;  2DFF A;  3T19 A;  2IS3 A;  4YNQ A;  3U4L A;  2QWP A;  1VQO N;  1FW6 A;  1U2V A;  3DRP A;  4BVO A;  3MEE A;  2FBV A;  3DYA A;  3FZM A;  2P1J A;  1ITG A;  1RT2 A;  1TKT A;  3VGK A;  1KLN A;  3CHW A;  2O4I A;  4DSF A;  2QTD A;  1X9W A;  3OYB A;  1BCM A;  4FOE A;  3ZYY X;  4AF1 A;  5BRH A;  3FE1 A;  3MWT A;  3DLH A;  1IKY A;  4GNI A;  5AFU H;  4CF0 A;  2ASM A;  2PAV A;  1GOB A;  4DTJ A;  3O6W A;  4GKJ K;  3G71 N;  3EE8 A;  5AQL A;  4OPH A;  3IRX A;  5AQZ A;  3LDQ A;  1LAV A;  3WT0 A;  1V4T A;  5AZJ A;  3ID6 A;  5AQW A;  3D2F B;  3E9O A;  2E2O A;  1XI1 A;  3AA2 A;  4CF1 A;  1ZBI A;  4AIL C;  1TK8 A;  1IG8 A;  4CE9 A;  5KPT A;  3O1B A;  4CK1 A;  4FLV A;  3TR8 A;  1N5Y A;  4Y1D A;  4BRG A;  4FXD A;  4B1X B;  4BRF A;  5FPN A;  3R8E A;  1KVC A;  3SUN A;  3TAQ A;  2E2Q A;  2R7Y A;  4JK9 A;  4BRE A;  5GIP A;  4CZL A;  1NWK A;  1NKC A;  3MN9 A;  2G8H A;  3QIO A;  4X62 K;  4L8R B;  3A0I X;  1TUU A;  3K5M A;  3CQX A;  1EP4 A;  1KAY A;  2XY8 A;  4HUE A;  2KZM A;  2HHU A;  4KH4 A;  4CJ3 A;  4J2E A;  3HM9 A;  2E2N A;  3S3M A;  3P31 A;  3OY9 A;  3NGI A;  4IO9 L;  4BR4 A;  2OTJ N;  1HPM A;  3H1Q A;  2P5G A;  3THW A;  1QSL A;  1CZB A;  3KLI A;  3TTF A;  3AVN A;  3ZSX A;  4DQS A;  3AAQ A;  3U9D A;  3IG1 A;  5M1N A;  3ULE B;  3O4N A;  3HPG A;  3M8P A;  2GEL A;  4XH1 A;  1RBV A;  2HHQ A;  3F9K A;  2DTU A;  3SAG A;  5I3U A;  4KV8 A;  4IG3 A;  2Z1G A;  4QCL A;  4K43 A;  4F4K A;  4DFK A;  3O9R A;  4OJR A;  2F8T A;  2W6K A;  4MDA A;  1GLC G;  1KD1 O;  5C0Y A;  1U2V B;  4B9U A;  5CZ1 A;  4B3T K;  1QHT A;  5BN8 A;  3HVT A;  5GAG P;  5EVZ A;  3VGL A;  1N6Q A;  3LDL A;  2IVP A;  2EX3 A;  3P83 D;  1S1T A;  4CJ4 A;  3NVK A;  4KKO A;  3VEX A;  3LL3 A;  4O0J A;  3VTH A;  1N34 K;  4KHN A;  3LAK A;  1S6Q A;  3AO1 A;  3HK2 A;  2ITG A;  1QHA A;  4FWR A;  2HB5 A;  5C24 A;  4FLZ A;  5J2M A;  4B9L A;  1NJZ A;  2KHO A;  3KVG A;  4CJW A;  2VQF K;  2RN2 A;  1F21 A;  1T8E A;  3FFK B;  1X3M A;  1HMV A;  1IKW A;  4CHO A;  1OKJ A;  2QXL A;  3ENB A;  3VPZ A;  1J53 A;  4A2B A;  4PL7 A;  4FWM A;  1TK0 A;  1C0T A;  4RW7 A;  3CCM N;  1OH7 A;  3ZCM A;  4I9Q A;  2P51 A;  4DU4 A;  2CH5 A;  4PHT X;  3AVJ A;  4E7J A;  4Z4C A;  2WC9 A;  3SQ0 A;  3K5N A;  4BRQ A;  5KRT A;  3SPZ A;  4FWO A;  1RNH A;  4M3U A;  1VQN N;  1FJG K;  1FKO A;  3PX6 A;  4WQ4 A;  4BQL A;  3OYH A;  4O5F A;  2BUP A;  1X1P A;  2NRZ A;  1S9E A;  1K8K A;  3SMP A;  2GV9 A;  3KK3 A;  5DM7 L;  5C2D A;  1KVB A;  1YHQ N;  1REV A;  2ZJP L;  4M3Z A;  4YOU A;  1GLL O;  1HUX A;  4KH5 A;  3HT3 A;  4CEZ A;  3DLE A;  3S3N A;  3HRG A;  1RT3 A;  4JNE A;  1Y97 A;  5AQI A;  4CD1 A;  2IGI A;  2OZS A;  3AVG A;  3FZH A;  1MA9 B;  3RWU A;  4CF9 A;  1N8R O;  4M41 A;  2RPI A;  2ZGY A;  5J2P A;  4KTZ A;  2E5L K;  4RCH A;  3T1H K;  5C25 A;  3QNO A;  4BC2 A;  1TUY A;  3C0B A;  4JI3 K;  3OJS A;  4WFA L;  4YOR A;  2IAJ A;  4A5A A;  1FK9 A;  1U49 A;  3G25 A;  3LZI A;  1DLO A;  4DLG A;  1KC8 O;  1NK5 A;  1NGB A;  2JWK A;  1YJ9 N;  4K42 A;  2UYT A;  1S1W A;  2E8A A;  2HBL A;  2YJE A;  1QSY A;  1R0A A;  1K8A O;  2F9W A;  3PSI A;  1VSF A;  1RIL A;  4L3Q A;  1JLA A;  3CQY A;  4IOX A;  4MQ3 A;  4ZHR A;  4FCY A;  3K57 A;  3AV9 A;  1E4F T;  3KK1 A;  2P9I B;  1VAZ A;  3J8A A;  3I8D A;  4FJ7 A;  5E26 A;  1Q9Y A;  3G0Z A;  3C95 A;  4KRE A;  4B08 A;  2P9L A;  2FSK A;  2OCE A;  3ZT2 A;  4KFB A;  2P9U B;  4KHU A;  1ZBF A;  1K73 O;  4Z94 A;  2E88 A;  3NCI A;  4IFE A;  2Q0R A;  4CJR A;  5AQH A;  1CZ9 A;  1RT6 A;  2LSN A;  4B3R K;  3TAF A;  3CFO A;  1ASW A;  1Q18 A;  4JV5 K;  2HVI A;  4H0X B;  1HNZ K;  4DTX A;  3DWL A;  1E3M A;  3H45 C;  4EP4 A;  1K8K B;  3GL1 A;  3N4Q A;  3CC4 N;  1MWM A;  4DR3 K;  3KJV A;  5AQP A;  2VG6 A;  5CE3 A;  3SV4 A;  1I94 K;  5B8H A;  2OPR A;  4OPK A;  4NCG A;  1VRU A;  2XHB A;  4A62 A;  1IO2 A;  4IDH A;  3AGK A;  3NH0 A;  1SUQ A;  4AH9 A;  4Z0U A;  3DM2 A;  4BG8 A;  3V9Z A;  3CCR N;  2X78 A;  2RE2 A;  4AHR A;  2XO7 A;  1IBM K;  4CW7 B;  3CFR A;  3BDP A;  1EQY A;  1TAQ A;  2QK9 A;  5FRO A;  2WOM A;  1ASU A;  2GWJ A;  3ZX3 A;  3O4Q A;  1L3S A;  3UKU B;  1XNR K;  1HX1 A;  3THY A;  1EXQ A;  3EKS A;  3RSE A;  3QNN A;  2F4V K;  2DFH A;  2KLA A;  4QS7 A;  4FJM A;  5F2R A;  4DHY A;  1E4G T;  4F9O A;  3SV3 A;  4PKH A;  3ZSQ A;  3FR0 A;  1VSL A;  3THV A;  2CGL A;  1NG9 A;  5KTQ A;  2NRX A;  4O0I A;  2E4L A;  2UXC K;  4FWL A;  1NGG A;  2FLO A;  4BWJ A;  1SS6 A;  4BR5 A;  3PV8 A;  4FWN A;  1QQN A;  3V1Q A;  4B9Q A;  4GV9 A;  1RDC A;  4E1J A;  5K14 A;  3OYE A;  4BRH A;  3DLK A;  1S22 A;  5TKW A;  2J4R A;  2XY7 A;  3MCA B;  4FWP A;  3F5T A;  1WAJ A;  4E1N A;  4LFC K;  4BVP A;  4CEQ A;  1VQM N;  4FYD A;  2BE2 A;  4WF9 L;  2FF3 B;  1VSJ A;  3AVH A;  4JKG A;  3M8R A;  3QEX A;  3CMA N;  1WSI A;  4NCA A;  4LF7 K;  4RW9 A;  2D1K A;  2ZQB A;  2GTD A;  2IC3 A;  3KLH A;  4B9M A;  1NGF A;  3A5L C;  3M8Q A;  2E2P A;  4A59 A;  1LWC A;  3UIQ A;  2FSJ A;  4XEI A;  2QWN A;  3TWH A;  4YFU A;  2VWJ A;  3CCJ N;  2QKK A;  3BZC A;  3S41 A;  2YHW A;  2KFN A;  2E1Y A;  3MWP A;  3B8A X;  3BEX A;  1ZXO A;  3SCX A;  1RFQ A;  3O9T A;  3VEN A;  2ZF5 O;  5I9E B;  4JKF A;  5DMR A;  4FK2 A;  4C23 A;  3HP6 A;  1UAX A;  4CEC A;  2OAN A;  3H3O B;  1NK4 A;  1Z6R A;  2QWM A;  1V4S A;  4H0P A;  3FGU A;  4FK0 A;  3OYA A;  3EYZ A;  1S6P A;  4GV3 A;  1Z05 A;  2ITM A;  3RSE B;  4CGH A;  2YI1 A;  3IUC A;  2NNW A;  1TV6 A;  4IDK A;  4NB4 A;  5CR4 A;  3OYL A;  5GAD P;  3VGM A;  3CJB A;  1GLB G;  1Z26 A;  1YF5 L;  3CQ8 A;  4JKB A;  3NF7 A;  4ICL A;  3QFU A;  1M90 O;  3TSP A;  1J54 A;  1KCF A;  3T1Y K;  5AR0 A;  1KAX A;  3RR7 A;  1NJY A;  2G8I A;  4OKJ A;  3ISN C;  1JL1 A;  3LWL A;  1JLF A;  4KI6 A;  3O4W A;  4OPJ A;  2QXF A;  4JRP A;  2IVO A;  4JKC A;  3T69 A;  4AQY K;  5JVH L;  4DU1 A;  1VQL N;  4BRC A;  3VTI A;  3EEQ A;  1YI2 N;  4JI4 K;  3D6R A;  2ZE2 A;  2E1Z A;  3M1F A;  4NXM K;  4FJK A;  2B5J A;  1TKD A;  3BZK A;  3K2P A;  1VSE A;  2ZJR L;  3QBW A;  1RTD A;  3ASM A;  4N41 A;  2DFE A;  1BIU A;  1SKW A;  1J5O A;  4BRM A;  1BUP A;  1KFD A;  3H3N O;  4IZ9 A;  1T44 A;  4JI5 K;  1VQ9 N;  2YJF A;  4K8Z A;  3MCP A;  3AVM A;  4YHH K;  4Z4H A;  4DU3 A;  1TGO A;  4I2P A;  4QS8 A;  4IXC A;  4F8R A;  2W40 A;  4LF8 K;  1U6Z A;  3CFP A;  2NRW A;  3L2R A;  1KLM A;  4BRN A;  3K59 A;  1M1K O;  4LD0 A;  3WQU A;  1XNQ K;  5KQ8 A;  5H1S Q;  3OA9 A;  5AQG A;  3TAM A;  1LW2 A;  3HPH A;  4X65 K;  3TAB A;  4C8M A;  3L2W A;  4O4G A;  5C15 A;  1NJW A;  2P9S A;  1D5A A;  3E1Y A;  3WXJ A;  4F2S A;  4Z4I A;  3MMV A;  4B1Z A;  2AJQ A;  4ILH A;  3VF6 A;  2QWO A;  3CCE N;  4KB0 A;  4ISE A;  3ZT3 A;  4BR9 A;  5DM6 L;  1XC9 A;  4BC4 A;  2BTF A;  3V9S A;  4DTP A;  1GOA A;  4H5W A;  2F9T A;  4CHP A;  3L2U A;  1S72 N;  4WFB L;  3QBX A;  4BDY A;  4M3X A;  2BH1 A;  2D0O A;  3ZT0 A;  3VEV A;  3E01 A;  4WQ5 C;  1YIT N;  3ITH A;  1VQ5 N;  5BRF A;  3LDO A;  1N32 K;  4IJA A;  2WBN A;  3DRR A;  1EWR A;  3LP0 A;  1S9G A;  2FBX A;  4OLB A;  3HP9 A;  4B1Y B;  5M1K A;  3O3H A;  2OZM A;  5AQF A;  4CFB A;  4LFA K;  1OH8 A;  1WSH A;  3HSC A;  1BCO A;  5AQU A;  3OBY A;  3CM5 A;  3NHG A;  3VF4 A;  2VG7 A;  4DV3 K;  1D9F A;  1EO1 A;  2A41 A;  4CGD A;  2G8K A;  4FJ8 A;  2O8C A;  3IMX A;  2HST A;  3NGY A;  4M45 A;  1YAG A;  2PYL A;  3QO9 A;  2HHT A;  4B8C A;  1N33 K;  3AA5 X;  4N47 A;  3VQB A;  4KHQ A;  1WN7 A;  4KHY A;  4R79 A;  3MXM A;  4RW4 A;  4RW6 A;  1ZBL A;  3OHR A;  4KHW A;  4CF8 A;  3L6Q A;  3NF9 A;  2NRH A;  4FWQ A;  1NK8 A;  4H0V B;  1BL3 A;  4CZG A;  4DB3 A;  1U04 A;  2Z1H A;  1YJN N;  4OX9 K;  3PUF A;  4KTQ A;  5F0X A;  3KK7 A;  4BGA A;  4CBU A;  4CEO A;  5FPE A;  4MLE A;  3DXM B;  3LP2 A;  2FSN A;  2D0A A;  3SAH A;  4CJQ A;  1D8Y A;  1VQ6 N;  5D3G A;  1RDB A;  1JJ2 M;  3R9P A;  1S5J A;  3TAE A;  3SMS A;  4JI7 K;  1QSS A;  1BGX T;  4HHT A;  1HYV A;  3EKU A;  1QQM A;  5C42 A;  2D0B A;  3E9P A;  4XIU A;  5DK5 A;  4LSN A;  1GLE G;  4BE2 A;  5CYM A;  3QIP A;  3T7Z A;  1XUP O;  1O1W A;  4MO5 A;  5T7B A;  2HVH A;  4DCH A;  3KLE A;  1WLJ A;  3V9X A;  3G10 A;  3VER A;  1NK7 A;  4CZM A;  2QI2 A;  3OYG A;  2Q97 A;  4E7I A;  2I5J A;  4M63 C;  5BR8 K;  2Y1I A;  1RBR A;  3K58 A;  1NOZ A;  4E7H A;  4HTL A;  5HP1 A;  1NGA A;  2ATQ A;  2B4J A;  4FJG A;  1SAZ A;  2XY5 A;  1QS4 A;  3KK2 A;  1H1V A;  3C94 A;  4O8K A;  1XQS C;  3K9K A;  2F7T A;  3WEE A;  2HHS A;  1DGK N;  4CFD A;  5BPN A;  3SJJ A;  1RDW X;  4CED A;  1WBD A;  1QVF M;  4CJU A;  2A40 A;  5ADX H;  4NCB A;  3ALY A;  3B6O A;  3VQP A;  4IKF A;  3OYK A;  3ENO A;  3D2E A;  3RMB A;  4FLY A;  2YNH A;  1NKB A;  4XH4 A;  4CFC A;  3RTV A;  3QB0 A;  3CCL N;  2DY4 A;  2GX9 A;  1I39 A;  3ZSW A;  2RF2 A;  4A57 A;  5AZJ B;  2D4W A;  4DTR A;  3UB5 A;  4AHT A;  1DTQ A;  1XWL A;  2G8F A;  3ZT4 A;  3L4I A;  1TKX A;  3NBP A;  3SAF A;  1S1U A;  1WSE A;  3DLL L;  3BF1 A;  1KFS A;  1T05 A;  2JGU A;  3GOI A;  2QW9 A;  1HNI A;  2VQE K;  1I3A A;  2V52 B;  4H0T B;  1U45 A;  5GIN A;  1MDU B;  5BRE A;  1TYQ A;  2KQ2 A;  3CJ1 A;  4PA1 A;  4JS4 A;  2NRT A;  1QTM A;  4C1N K;  1WBB A;  1RDA A;  5J1E A;  1SZ2 A;  1BOT O;  2PYJ A;  2JWL A;  3NVM A;  5JS1 A;  4FJ5 A;  1IJJ A;  4RW8 A;  3MEC A;  2H3G X;  3THW B;  4FO0 A;  3Q7B A;  4F2R A;  2YCH A;  3RRH A;  1ZYQ A;  4IEI A;  1S1V A;  1T6C A;  3K0S A;  2HW3 A;  4PKG A;  5HRO A;  5M1F A;  2P9P A;  1NKE A;  1X3N A;  3VQ4 A;  3VF2 A;  4E1M A;  4JAX A;  1XHX A;  1L3U A;  2E6L A;  1T3V A;  3WNH A;  1UWB A;  3KTQ A;  4HCC A;  4BRI A;  1BO5 O;  2YKN A;  1TL1 A;  1RT4 A;  1TVR A;  5EXW A;  3CCV N;  3CC7 N;  1ATR A;  4B1U B;  3HJF A;  2QA4 N;  1NNE A;  2FC0 A;  4CEE A;  2HHW A;  3KWI A;  5CY4 A;  1W0H A;  3QIC A;  1LCU A;  4WQ4 C;  3KKS A;  1UOC A;  4FPA A;  4YDU A;  3VET A;  1JXB A;  3O80 A;  4CZH A;  3NDK A;  4DV4 K;  2Q0U A;  3E66 A;  2A1R A;  1KQS M;  3AVI A;  5FRM A;  4X64 K;  4JKH A;  3V9U A;  1ZBU A;  2UUB K;  3S9H A;  3MXJ A;  1NMD A;  3DXK A;  3GE1 A;  2HOE A;  1JLG A;  4CGJ A;  3R3L A;  3J7A P;  2D0P A;  3O08 A;  4ISG A;  3AVL A;  3JS6 A;  5M1O A;  3MK6 A;  2HBM A;  3ZSO A;  3THX A;  1FXX A;  4DR6 K;  2HHX A;  4WYB A;  1NBW A;  1ILY A;  4BC5 A;  2W42 A;  3R6M A;  3QEV A;  3OBW A;  2UUC K;  3RMA A;  3EY1 A;  3NF6 A;  2OPQ A;  4BY9 C;  4ELV A;  4V19 S;  3OYM A;  1SL2 A;  5C12 A;  4CJF A;  3U8X A;  4C8O A;  3L4Q A;  3J7Y P;  5AJ3 K;  3L8B A;  5JVG L;  3TPQ A;  4M7Y A;  4M7X A;  3WXM B;  4IG0 A;  3PO4 A;  1HNX K;  4LFB K;  4OKE A;  4CJ5 A;  3NAE A;  4AM7 A;  1NK0 A;  3SYZ A;  2HF4 A;  3P1G A;  4GVM A;  5KPZ A;  1LWE A;  1RTI A;  2P9P B;  3L0Q A;  4C8K A;  4MO4 A;  4CZK A;  1BI4 A;  1IKX A;  4AHV A;  2VWB A;  2QWL A;  4CHZ A;  3HPO A;  3M5R A;  1SKS A;  4KPY A;  1KAZ A;  1YTA A;  4K25 A;  4OO1 J;  3UKR A;  5HRS A;  3M8S A;  4K8X A;  1LAW A;  2XRI A;  1HR0 K;  3A2F A;  1HRH A;  4JI2 K;  2Q2R A;  3K5O A;  4PKI A;  4JLH A;  1JL2 A;  3F2K A;  2Q31 A;  2PZS A;  3M3Z A;  4W5O A;  1HYZ A;  3CPE A;  2IIR A;  3SJH A;  4IEE A;  4FW2 A;  5E84 A;  1YXQ A;  4EFH A;  4BE0 A;  2UU9 K;  1D4X A;  5EU7 A;  5J2N A;  4EIA A;  1RBT A;  5BR9 A;  4FW1 A;  5JLH A;  1DEJ A;  3AO5 A;  1K6Y A;  4CK3 A;  1Q9X A;  3P4I A;  3D45 A;  5SWM A;  3SNN A;  3VQC A;  1WNS A;  4Z4E A;  4OLA A;  3KD5 E;  3C6H A;  3QEI A;  2Z1I A;  2ZWH A;  4E19 A;  4IFY A;  4DUY K;  3CME N;  4LF5 K;  2P9L B;  3AO4 A;  4Y1C A;  1VSM A; 
#chains in the Genus database with same CATH homology
 4DR3 K;  4DV5 K;  4B3S K;  2UXB K;  4KHP K;  2VQE K;  4LF8 K;  4DR6 K;  4OX9 K;  5LMN K;  1XNQ K;  1I94 K;  4YY3 K;  2UUC K;  4JI7 K;  5IT9 O;  4DR4 K;  4X65 K;  4V19 S;  4JYA K;  4JI1 K;  4DV0 K;  4DV1 K;  1J5E K;  5A2Q O;  3J7Y P;  5AJ3 K;  2E5L K;  3T1H K;  4B3T K;  1IBM K;  4CW7 B;  2HHH K;  5LL6 Z;  4JI3 K;  1HNX K;  4LFB K;  4JI8 K;  1XNR K;  2ZM6 K;  4DR2 K;  5BR8 K;  1XMQ K;  4LF4 K;  2F4V K;  4DUZ K;  1N34 K;  4B3M K;  4K0K K;  2UXD K;  4GKJ K;  4DR1 K;  3OTO K;  1N32 K;  5FLX O;  2VQF K;  3T1Y K;  1HR0 K;  4DV6 K;  4CVN E;  5LMU K;  4LFA K;  4GKK K;  4JI2 K;  2UXC K;  2UUA K;  4LF6 K;  4AQY K;  4DV3 K;  4DR7 K;  1IBL K;  4JI4 K;  2UU9 K;  4DV7 K;  4NXM K;  1N36 K;  4DV4 K;  3J80 O;  1N33 K;  1HNW K;  4B3R K;  4X62 K;  4X64 K;  4LFC K;  4X66 K;  4NXN K;  2UUB K;  4JV5 K;  1FJG K;  1HNZ K;  5IWA K;  1IBK K;  4JI6 K;  1XMO K;  3J7A P;  4LF9 K;  4DUY K;  4JI5 K;  4DR5 K;  4LF5 K;  3JAM O;  4DV2 K;  4LF7 K;  4YHH K;  4JI0 K;  3J81 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...