2UUBK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uubK00
2ZM6K 4LFBK 4GKJK 1HNWK 4JI4K 3J80O 4LF5K 2F4VK 3T1HK 4DUYK 4X62K 5FLXO 2E5LK 1N34K 4LF4K 4NXNK 4JI2K 3J81O 1HR0K 2UUCK 4JI6K 4JV5K 4DV0K 4CVNE 4B3TK 4LF7K 4DV4K 4B3RK 4X64K 3JAMO 4GKKK 1XNRK 4LFCK 4DV6K 5AJ3K 4DR7K 4AQYK 1I94K 2VQFK 5LMNK 2HHHK 4DV7K 4DR2K 4DV1K 4YY3K 2UXBK 4DV2K 1N36K 2UUAK 5LL6Z 1HNZK 4DR4K 1XMQK 4KHPK 4NXMK 2UXDK 4OX9K 4YHHK 5A2QO 4DR3K 4DR5K 5IWAK 2UXCK 3J7AP 1FJGK 4JI0K 4DR6K 4B3MK 1IBMK 4DV5K 1J5EK 4V19S 3OTOK 4B3SK 1IBKK 4JI3K 2UU9K 1N33K 3J7YP 4DR1K 1XMOK 4JI7K 4LF6K 3T1YK 1XNQK 4CW7B 1N32K 1IBLK 4DUZK 4LFAK 5IT9O 4LF8K 4JI1K 1HNXK 5BR8K 2UUBK 2VQEK 4X66K 5LMUK 4K0KK 4LF9K 4JYAK 4X65K 4DV3K 4JI8K 4JI5K
chains in the Genus database with same CATH superfamily
4CZMA 1HQEA 2XHBA 4GKJK 4IDKA 3SAFA 2P9PB 1R0AA 3I0RA 1W9HA 2E5LK 3LZJA 4H5RA 1VQ6N 4Z4HA 1OH8A 3E9OA 3C6AA 5J2NA 1HMVA 4JAXA 3S9HA 4KBOA 5AQSA 2EWSA 3I33A 2O8DA 4JKGA 2H3GX 1LWCA 3ENHA 2O8DB 3LALA 1UA1A 3KTQA 2HBMA 5M1FA 2D0CA 3VF4A 3SI6A 4F4KA 4PUOA 2O8BB 4B9TA 2G8HA 1ZBFA 1VSFA 2WTUA 3K59A 4PKHA 4B8AB 4IDHA 4JKDA 4CGGA 1S22A 4MO5A 4F2SA 4DCHA 1NK4A 4YY3K 5C2DA 3AA4A 3CCLN 1N36K 3QO9A 2BE2A 4UQGA 3IG1A 5MLCQ 5DM7L 1BU6O 4IOAL 3O4NA 4KHPK 1T6CA 4BY9C 2GEMA 3DRPA 1NGGA 2HF3A 1NWKA 3ZSVA 5GAGP 4BRAA 2XY7A 2E88A 4FJKA 4JK8A 2Y1IA 3O4QA 4BRHA 1NKBA 3AVGA 4JKCA 2KQ2A 3RMAA 5CYQA 1QE1A 1ZBUA 3D45A 3LPUA 4CK1A 3NVMA 2X6NA 1X1PA 2ASPA 4E3SA 3A8YA 4DG1A 1IKWA 3IKMA 3NCIA 3L2VA 3OYFA 4KTWA 3HOSA 2XRIA 4B9QA 2GWJA 4KHSA 1TYQB 5BPLA 3CCUN 3PX4A 1RTHA 3CCSN 4F3OA 3M3ZA 1IJJA 1C0UA 4EFHA 5JS1A 2ZJPL 3OYIA 4KI6A 3DYAA 5LMUK 1J53A 2OA8A 3QB0A 1DLOA 3ID6A 3THYB 1Q7YO 1WSFA 5CR4A 3B8AX 3OYEA 4O44A 3VGKA 1B92A 4NB4A 1RBVA 4IOCL 3SYZA 4LF5K 3NE6A 1YAGA 1OKJA 1KCFA 4OPKA 1N34K 3V9WA 3GBTA 5KTQA 4FK2A 4DS5A 3A0IX 4EZ6A 2A42A 4BRLA 4KV8A 1VQKN 2G8KA 3VEOA 4EHTA 2ATQA 1U4BA 3ZSXA 5EVZA 4RW8A 2CGLA 1KD1O 3SQ1A 3MAQA 1TKXA 1P90A 4ELVA 1JJ2M 1NJIO 1J5OA 2FSKA 3AVMA 4FZXC 2DY4A 3U6FA 5JLFA 4J8FA 4FLTA 4E19A 3SJHA 2QTDA 3TWHA 4DR4K 3CQXA 4CJUA 2QWMA 1WLJA 2Z1HA 1T05A 1WSEA 4CJTA 1TV6A 3QNOA 4O8UA 4CJSA 4DSLA 3C6TA 3MX5A 4GNIA 3GE1A 2RN2A 5AZIA 3T1AA 3SMSA 2W40A 3P1GA 3ZX3A 1TAQA 4FVMA 3J7AP 2ZQBA 2KHOA 1ZC6A 4DMNA 4RW7A 4DR6K 3WXMB 3DLEA 3UE5A 5J2PA 2VWJA 4CIEA 4DSFA 3LDPA 5BR9A 3SQ2A 5BRDA 2QK9A 4BR5A 3QINA 4CIFA 2A5XA 4IZ9A 2W6LA 4C23A 2G8VA 3K5MA 1YJ9N 3CI5A 4BWJA 4FWRA 2GUPA 3UIQA 3UKRB 2G8FA 4Y0WA 2ZJQL 5GIOA 2HVIA 1TVRA 3RSEB 3AA5X 4H5VA 5CE3A 3JSMA 1JLQA 2G8IA 2D0OA 4F2RA 1TKDA 3DRRA 5AQWA 1DTQA 3TAEA 3GG4A 1HLUA 2Q31A 4JI5K 3VQDA 3A5LC 3DRSA 1ESVA 4FJ5A 1KVBA 1TK5A 3T1HK 1D5AA 1EP4A 1SL0A 4CZLA 4CJRA 2BANA 4XH1A 1CXUA 3P83D 4IG0A 1QQMA 1IG8A 3VQ5A 2Q36A 1X9SA 3TI0A 4RCHA 4KTZA 1WB9A 2A41A 5J2QA 4X64K 1XI1A 5M1KA 2NLXA 4GKKK 4BE0A 3DAWA 1VSEA 5AJ3K 3VEXA 1S3XA 2HBJA 4WCEL 3L2QA 3FZKA 3AAPA 4OVLA 3DLKA 2YHYA 2HMIA 4H0PA 3H1VX 4CJKA 2RHKA 5FPMA 4O5FA 5C0YA 5HL7L 3WEEA 1K9MO 1ZBSA 2NRVA 3MECA 3WEEB 4DSJA 3C7NB 4FWMA 3P5JA 3FFIA 1MDUB 4IFVA 3I55N 3U9ZA 4CBWA 3CC4N 4DLGA 2F8TA 1M1KO 4C8KA 1VSDA 1BIZA 1TL3A 4ISGA 4DV5K 3L2WA 1DKGD 5CZ1A 4N5SA 2G8WA 4CESA 4DTSA 3O08A 4H4MA 1KRPA 3EO3A 4JNEA 4DR1K 2P5OA 5C2FA 4LF6K 3AA2A 3BDPA 5FRNA 2JLEA 4C1NI 4H0YB 4IO9L 4LFAK 3WQTA 4JKBA 2F96A 2X6SA 3HSCA 1ASWA 4A61A 3MEDA 1NGDA 3VQQA 3F9KA 5AQGA 2V52B 1J54A 2FSNA 3HI0A 4PHTX 3CHWA 1L3VA 5HRSA 5K14A 3NGYA 4DTRA 4NCBA 4CK2A 1SZ2A 4QS7A 1N6QA 2GV9A 3LP3A 3ULEB 2F7TA 2ETJA 1BI4B 5KPRA 4DUYK 3ULEA 1VAZA 4R5PA 1Q9XA 3MWPA 3LWMA 4BG8A 2QXLA 3TSQA 2QA4N 3L6QA 4DV0K 2KZZA 1GLDG 1SQKA 4HCBA 4CJLA 1S1WA 1LCUA 4Z4CA 3IUCA 4ZTFA 2NRRA 3ZEUB 1Q81O 2P9IB 1ZBLA 3CJBA 4JHDA 4WFAL 4C8OA 4WQ4A 3SZ2A 4B1UB 3ZETA 4N56A 3A2FA 2KZMA 3BP8A 4DKWA 3F73A 4H0OA 4WQ5A 4B1YB 5C15A 3O3HA 3QBWA 1VSMA 4H5WA 3G71N 1R59O 4M7YA 3WXJA 1RBUA 3VEVA 4CZGA 1JLCA 3CJAA 2FBXA 2NRHA 4DR3K 3RRHA 1NGBA 4IO8A 5IWAK 2BUPA 4BRNA 3FZHA 3QEWA 2IAJA 1K8AO 1BOTO 3BGRA 2VWKA 4PKIA 4CEAA 2ZF5O 1BQMA 1U2VA 5AQUA 4AH9A 4FLZA 4BRPA 1VQON 3VEYA 2E4LA 4BRKA 3K57A 5HRRA 4OJRA 3OBYA 1QTMA 3DLGA 3D2EA 4Z4FA 1N33K 5JMVA 4OO1J 1ILYA 1F21A 4ILHA 1K8KA 3K0SA 2QWOA 4BREA 3THWA 1SKWA 3K2PA 4N76A 1BDGA 4BE1A 1RT4A 1S5JA 3E01A 2GTDA 3UKUB 3G0ZA 1LAWA 2GWKA 1NGEA 3HXMA 3AVLA 4YOUA 4JN4A 1NOYA 2ASMA 1NKEA 4YOYA 1O1WA 4OKEA 3PX0A 4FSVA 4EAHD 3HRGA 3G4SN 4CZIA 3U9DA 4CHNA 2HHSA 3VQAA 3MWTA 1IG9A 1YVNA 1BQNA 3O80A 4NXNK 4RTFD 3B6PA 1LV5A 3HZ6A 4CEEA 3MCPA 3D6RA 4FJ9A 3SV4A 1BL3A 3BF1A 1HNVA 3T69A 3KK7A 4DLEA 4CF0A 1Z6RA 4JD2B 3ZEUA 4OGEA 5KGWA 2UYTA 4CGDA 2HHHK 4OPJA 4KHWA 3HOTA 3VQCA 5F2RA 4DR2K 3DLHA 3SBGA 4NLCA 2QKKA 1O13A 1Z05A 1X9JA 4M7XA 3Q7BA 2JGUA 2A40A 1CLQA 2ZJRL 2P9UB 2KTQA 3KK3A 3AGRA 4NXMK 1NGAA 1B9DA 2D5RA 1SS6A 4FPAA 5FRMA 2RKIA 4JI0K 1XHXA 3ZSRA 3KLIA 2FF3B 1RT6A 4IEIA 3QIOA 2OTLN 1NG9A 4OLBA 5EXWA 3OTOK 2VG5A 1JLAA 5AQXA 4LH5A 4CJPA 4HVJA 4CEZA 1GLCG 4CERA 4CF1A 1XNQK 5FPEA 1A5WA 2HB5A 4W5QA 1IBLK 3BZKA 4JKHA 4GMJB 4CZHA 5C42A 4MLHA 4BDZA 5TKWA 3DJCA 5ADXH 1REVA 3KWIA 1X9MA 2V7YA 3PSFA 1GLJO 3VA3A 4XEIA 1RDBA 3UKUA 1FKPA 3MMVA 4DQQA 2KLAA 1KTQA 4H4OA 1NJWA 4LH4A 4CCHA 3TAPA 4XH5A 1EX4A 1RT3A 4HCCA 1T44A 2WUSA 5C10A 4X62K 2A6AA 5HOOA 3LP0A 1UAXA 3OYCA 2UUCK 3VETA 4DFPA 2YNHA 1WBBA 3G25A 4OLAA 3MEGA 4PWDA 4M3RA 4YFUA 3O5BA 4HHTA 4G1QA 2PAVA 2OPSA 4KB1A 2BTFA 2QWQA 3ZT0A 3ZYYX 1RDUA 2P5GA 2EX3A 4IBNA 1C1CA 3L4QA 3V9SA 3O9UA 4CJ3A 3VQEA 4W5RA 1BHLA 4FVUA 2HHVA 1NMDA 3C0BA 3CCJN 3WNHA 3KK2A 5AQKA 3K9KA 4LSNA 2QEXN 2CGKA 1NMNA 4BVOA 1NK5A 1RGIA 1VK0A 1DT9A 1FXXA 3OYNA 3WXKA 4ILJA 4JRPA 1SL2A 3KKRA 4GVEA 1VSLA 4KO0A 1QS4A 4DF4A 2KFNA 3AY9A 2UXCK 4Q0BA 3PY8A 1S1XA 4JKEA 1YHQN 4CJ4A 2IOCA 3LDOA 1NU0A 2NZTA 1NGFA 4FM0A 1NK0A 4QAGA 5E26A 2WONA 5CHIA 3C7NA 4YORA 4M3XA 3AVKA 3MCAB 5FROA 4CEFA 4FO0A 1TL1A 2PFUA 4M3UA 5GADP 3JXUA 1TK8A 4JS5A 1MA9B 3CQ8A 3P31A 4CJFA 2PZSA 1W7AA 5CZ2A 3OYDA 4E7JA 2AJQA 5ADXA 2ASOA 4IKFA 4FM1A 2O8FA 4OPAA 4CGJA 1GLAG 1U45A 4K0KK 4CEOA 2O8FB 3HL8A 4BR0A 3HPHA 1HYZA 5JVHL 1XC9A 3SPZA 1WSHA 2NNWA 4KHYA 3AVCA 2W41A 1KAYA 5J2MA 4EHUA 4WFNL 4E7LA 3WNFA 1KC8O 4Q5VA 4E7IA 3HTVA 4BRQA 5KRTA 2O8BA 3DOLA 1NJZA 1VQNN 4DQRA 1GLLO 4FJNA 2P9NA 1RNHA 3OYLA 4DQPA 2ITGA 1U04A 2VG7A 4DU4A 4Y1CA 4BQLA 2KFZA 4JHDB 4CHPA 2YJEA 1KLMA 3HP9A 4KRFA 3U3GA 4DFJA 2YJFA 1T7PA 3ULDA 3P4IA 4H0VB 4DTXA 3LM2A 3VEZA 1WAJA 1JKHA 3ATVA 1HYSA 4H8KA 4YDUC 4ZTJA 3VF2A 4BRIA 3AA3A 5BPNA 3RMDA 1NK8A 2FSJA 1KAZA 3DLRA 4FZYA 1KVCA 4YHHK 1S9EA 3WXIA 4K8XA 4BRDA 1JXBA 5AQMA 5JS2A 4ISEA 4FL9A 1JLFA 4CBUA 3ITHA 3HM9A 4J2BA 4FW1A 4V19S 1NK6A 2VCPA 3M8RA 2YV0X 1L3SA 3D0PA 1IBKK 2HVHA 4FLVA 1TUUA 1K8KB 4FOEA 3SCXA 3SJJA 2IIRA 3L2RA 2I7PA 3PLAA 2OPPA 1IKXA 2OPQA 1ASUA 1U2VB 2IVNA 4JI1K 5FPNA 1T03A 3J7ZO 3VENA 2BH1A 3LM9A 4C8LA 1EO1A 3O9TA 4CHQA 4ZHRA 3LP2A 3CM6A 3TTDA 4EP5A 3D2EB 4JEPA 3QBXA 4OGCA 1S1VA 3S3MA 5DK5A 4QOZB 4U67L 3M8PA 1VQPN 2BGGA 3THWB 1FK9A 1EQYA 5SZTA 1C6VA 3SLCA 1KSPA 1NGIA 2F4VK 3AARA 3I8BA 3DM2A 2GELA 4O0IA 2QM1A 2XO7A 3DXKB 3QDKA 4MO4A 3H3OB 3ENBA 4JI6K 4A5AA 4C1NK 4L3QA 4FJXA 4CF8A 2Q0RA 1Z25A 5HROA 3NHGA 4K25A 4OPHA 1LWFA 1YT3A 4DV6K 2QWLA 1ZBHA 1WNSA 4BC3A 1HPZA 4UY8O 1D9DA 2E8AA 3ALYA 5LMNK 4M45A 3ZSQA 3BEXA 1HNIA 3DWLA 4CK3A 2X74A 2J4RA 2P9UA 4WQ4C 4HTLA 4E7KA 3BF3A 3MDQA 4FJIA 4K43A 5F0XA 1RBSA 3V1QA 3FGUA 1RFQA 4OKKA 3EEQA 4Z4GA 4HUFA 5FPDA 3LDLA 3KZBA 3K9JA 4DHYA 3WT0A 3TTCA 4BRFA 4DSKA 2DPNA 4M3WA 4I6MA 2CGJA 3CFRA 5D3GA 2NUBA 1Q18A 3BUZB 4AM7A 1IBMK 3BY5A 1QHTA 3G6EN 3EE9A 1QSLA 2ITMA 3V9XA 3IFRA 1IH7A 4KPYA 4FWQA 1RT5A 4MDAA 4NLBA 5KRSA 3J7YP 3LZIA 4IJNA 4R79A 1WOQA 1XMOK 1KFDA 3IDHA 2X78A 5C12A 4CF2A 1BISA 1T6DA 4B08A 1EETA 1Q9YA 3O3GA 3NF9A 4DU1A 3VGLA 1KAXA 3KLHA 1JCEA 3SAGA 5AZJA 3U3YA 1HKBA 4W5OA 4DQ8A 3LAMA 2OYQA 3T7ZA 1LAVA 2P9LA 2HNZA 2YNGA 1YTUA 1NGHA 3AAQA 1D9FA 2JWKA 3QEVA 1RT1A 4CZKA 3SQ4A 1YIJN 4LFBK 1HNWK 5AQQA 4HUEA 1LW2A 3JYTA 4DTNA 2CH5A 4CFBA 1LOTB 4RW9A 5GINA 3SQ0A 3CC7N 4CHOA 3AVJA 4JKAA 4JS4A 2OANA 3HYFA 1L3TA 4BE2A 2OTJN 4CJ5A 2YKMA 3W0LA 5AQOA 4I2PA 3PO5A 4M3ZA 3MXMA 4LFCK 4DTUA 4ELUA 2KW4A 3VF6A 3WNEA 4B8CA 4ELTA 4NCGA 4O0JA 3FLCO 1NGJA 4DQSA 4XH4A 3J8AA 3ZSZA 3CJ7A 1SKSA 4AHVA 3CJ1A 4BDYA 2HBKA 2O8CA 2IC3A 2D0AA 1VHXA 3C94A 4WQ5C 1SAZA 2QI2A 5LY3A 3I8DA 3AVHA 1HNZK 4N47A 3L4IA 4AHUA 3FFKB 4HTUA 4CJ7A 1NK7A 2DFFA 2PBDA 5HP1A 1TGOA 3C6HA 4F3TA 4CZFA 4L8RB 4B1ZA 3MN7A 4FYDA 1BA0A 3EKUA 4NCAA 4JKFA 4FJHA 1H1VA 3HBTA 3VERA 3SUNA 4AHCA 3QICA 4JRQA 3C95A 3EY1A 4LY7A 4BC4A 3O4WA 3AO2A 2GBZA 4IXCA 4AHSA 1DTTA 4WF9L 2HF4A 5AQRA 1C1AA 4YOTA 3HK2A 4AM6A 1WSJA 3QIPA 2P9SA 3TANA 3ZSOA 4FWPA 4PL7A 1BO5O 1W97L 3LDQA 3L0QA 1NM1A 3KLGA 2KKZA 4MDBA 5JICA 4FCYA 2GX9A 1VSKA 3DXMA 2VQEK 4MQ3A 3AO4A 4DB3A 1BG3A 1YVUA 5AQPA 4FJJA 4Z4EA 4CFDA 1N8RO 3FZFA 4C8NA 4PKGA 3HSTB 1X3NA 4O4GA 4CHYA 2Q97A 4DTOA 3RMBA 5FLXO 4BR9A 4M42A 1QHAA 1HR0K 2P9NB 3M8SA 3OY9A 3ZCMA 3NGIA 4DSEA 3CCEN 4BGBA 1CZ9A 4CVNE 3I56N 4NO7A 3QETA 2RF2A 2QWNA 4O55A 1C0GA 3E9PA 4QS9A 1D4XA 1GOCA 2FBYA 4YDUA 1JLEA 2QWRA 4WFBL 4BRMA 2RPIA 4DR7K 3S3OA 1N5YA 1HUXA 3CPWM 5TKYA 1QSYA 2F8SA 5I9EB 3G10A 3D2FA 1WSGA 3P38A 2IVPA 5BN8A 2WOMA 5FDLA 3LDSA 4O8KA 3V81A 1NNEA 1L5UA 3MN9A 3O9SA 4I9QA 3EN9A 3KKSA 1UOCA 4CI6A 4QS8A 3KWGA 4BRCA 4PA1A 5A2QO 4W5TA 1JLBA 3AVBA 2P1JA 1TAUA 1RBTA 1Q82O 3SUPA 4B9VA 2ZWHA 3L2UA 1BCMA 4B9MA 1E4FT 4B3SK 3OS2A 4FJGA 3RR7A 4A5BA 3E66A 1EWRA 2NRTA 2G8UA 2Z1GA 4JI3K 4EZ9A 1YI2N 1BUPA 3HVRA 2DFHA 1EWQA 1U49A 4CE9A 3EZ5A 3OJUA 3CPEA 2FF6A 2HNYA 2E1ZA 1I39A 4GW6A 3CMEN 2WFBA 2JWLA 3AGKA 3ATUA 3P39A 5E41A 2P9KA 3QEXA 1NGCA 1SUQA 5AQHA 3SAHA 2NRZA 4FJLA 3MEEA 2O4GA 3CIPA 3QESA 2E1YA 3VMFB 3UB5A 3VQPA 4X65K 1KVAA 1QZ5A 4DV3K 1QSSA 1RTJA 3K5LA 3EZWA 1VSHA 5LJVA 3DLLL 4JD2A 3IRXA 1YTAA 3OBWA 4FK4A 3CCMN 3CERA 3J81O 3CG7A 4DF8A 2QXFA 3EE8A 1JCFA 3LL3A 2XY6A 3OHRA 3L3UA 3AVIA 5BRHA 2E2OA 2VG6A 3ZT3A 4FK0A 3AV9A 3SMPA 3IMXA 1SKRA 4AQYK 4B3OA 1BI4A 2HHQA 4CEQA 3NH2A 1NKCA 4FLWA 3V9UA 4DV7K 4QCLA 1IV0A 3TR8A 2DTUA 3DXKA 3D2FB 2E2QA 2NRXA 2UXBK 2YCHA 1HJOA 1GLBG 1HYVA 2Q2RA 3H08A 3NF8A 3IAYA 1EXQA 3VQBA 4KHQA 2E2PA 3NGZA 3RVCA 4KH4A 2UXDK 3O9QA 3K5OA 1GLFO 4FZZA 2HHWA 3ASMA 1VQLN 3UKRA 1FJGK 3W3DA 1TYQA 4CEDA 4B3MK 5M1OA 1J5EK 3RSEA 3OJSA 5HRNA 4U7BA 3OYAA 3R9PA 3H46O 2VGMA 3HM8A 3OS1A 3THYA 4IG3A 4JLHA 2FBTA 2YHWA 3R3LA 4CGFA 1M90O 1C0MA 3GL1A 4E1JA 1S72N 3AO1A 5C25A 4F8RA 4LF8K 2HW3A 3MN6A 1K6YA 1XC3A 4H5NA 1GOBA 2V7ZA 4BWMA 1TKTA 4GV9A 2HMPA 3HO1A 4DQIA 2YX6A 4K42A 4RG8A 3HPGA 4FWNA 3CCVN 2NRWA 1JL1A 4B1VA 1Y97A 4XIUA 1VRUA 1CZAN 3L3VA 3NAEA 4FLXA 5EU7A 1IKYA 3ZSYA 4HUGA 5AQIA 4LD0A 4KH6A 4ID5A 4JV5K 1Y64A 3KD1E 3NH0A 1WN7A 3LDNA 4CJEA 4PQUA 4RWTA 2W42A 3CQYA 5EOYA 5KQDA 1XNRK 4PY5A 3LANA 5AQTA 4AHRA 3RR8A 2QWPA 1YJWN 3LPTA 2CH6A 4NYFA 4FJ7A 4GVMA 3ENOA 1CZBA 1VQ4N 1FKOA 1EKEA 3FE1A 3PO4A 3CXCM 1HPMA 4FPBA 5HRPA 2EHGA 3KD5E 3MN5A 1LWEA 5LL6Z 3TAFA 5ELZA 1ATRA 1XMQK 3QLHA 1SV5A 3HPOA 4IFYA 3S41A 2ZGYA 3ZX2A 3F9MA 1XQSC 3PV8A 5F1XA 2RE2A 5DM6L 2FLOA 1WUAA 3DI6A 2B6AA 2Y1JA 4O5BA 4A57A 3V9ZA 2O8CB 4BQZA 5EY4A 1S6QA 4RW6A 3N4PA 4AF1A 1S9GA 1Q8IA 5J1EA 4M3TA 4H5TA 4A59A 4AILC 4KHNA 2E6MA 1TK0A 3DLBA 2FC0A 3KHYA 3QFUA 3O1WA 3H3NO 1ZYQA 2AA4A 3K5NA 3ZLJA 4N41A 5GIPA 4KI4A 2YI1A 4A62A 3OS0A 4CGHA 1QQCA 2QKBA 1Q86O 5AZJB 5BR8K 3RTVA 3CC2N 4X66K 4IOXA 2Z1IA 5JVGL 4B1WB 4YNQA 4DFKA 1U48A 4FWOA 3ZT2A 4J2AA 1VSIA 4JK9A 1W0HA 3NDKA 3VQ7A 3NBPA 4LSLA 3V6DA 2P9IA 1YXQA 1QVGM 3J80O 3ZETB 1VQ7N 1X3MA 4J2DA 5KI6A 5AQFA 1YF5L 2D1KA 1BIUA 3AVAA 3WUHA 3V4IA 1K73O 4IJAA 4DU3A 3ZT1A 4LF7K 4BRGA 1B9FA 3TAGA 3E9LA 3TSPA 2HSTA 2BDPA 3HT3A 2A1RA 3OYHA 4E89A 3QMLA 2Q0UA 3MK6A 4GY2B 3VEWA 1VRTA 2YNIA 4Z94A 5AQVA 4DWIA 4B9SA 1IO2A 3H1QA 3A5OC 3OYKA 1XWLA 2DFEA 1RT2A 1JLGA 3O9RA 1XUPO 4BROA 2A1SA 1HX1A 3VPZA 3PUFA 4WYBA 2OCEA 3S3NA 3OW2M 3WNGA 2FXUA 2E6LA 3CMAN 3VOVA 4GV3A 3NFAA 3TABA 1RDDA 4B1XB 2UU9K 1BA1A 3NVKA 1QQOA 3OVNA 4KB0A 4JI7K 1OVQA 3T1YK 1BGXT 5KPZA 3T19A 1UA0A 1RDWX 4FWKA 3KVGA 3HP6A 1WBDA 3C65A 5DMRA 1QVFM 3FZLA 1RCHA 3O3FA 4Z0UA 2UUBK 1W2BM 2LSNA 1RTIA 5AQNA 3CCQN 3M5RA 1J6ZA 4C8MA 1JXEA 3VN5A 5AR0A 5SWMA 4JYAK 4BDPA 1OH6A 3EYZA 4CFCA 1RILA 2O4IA 4ICLA 3SK3A 2ZM6K 4IFEA 4CD1A 1ATNA 4ISFA 3VTHA 4FJ8A 4IEEA 5AQZA 5AFUA 5HBMA 4BR4A 4LF4K 2P9PA 1YITN 3E1YA 3NF6A 5T7BA 2AP1A 2IGIA 3CYMA 3RRGA 1NBWA 4J2EA 4ID1A 4B9NA 1ZXOA 2I5JA 2F9WA 3CJCA 3V1OA 2ZE2A 1UWBA 3JAMO 3SNNA 5GAHP 1NLVA 1HKGA 2VWBA 1MWMA 1T3VA 4CEBA 2ZD1A 5B8HA 2GUIA 2QW9A 1LW0A 3KK1A 2VYPA 3I0SA 3BZCA 4I6MB 4F9OA 4B9LA 4DV1K 1L3UA 3VA0A 1KXPA 3VGMA 4FJMA 4DV2K 2UUAK 2V51B 5GAEP 1QZ6A 2WBNA 3R8EA 3ZSWA 3O6WA 1X9WA 1WSIA 1HJRA 4FOIA 4E1MA 4EIAA 5AZIB 5BREA 4DR5K 3C6UA 3R1XA 4TSXA 1KQSM 2A3ZA 3PSIA 3JS6A 2WC9A 2PYJA 1OH5A 1U47A 2Z1JA 5AFUH 1D8YA 1BCOA 4OKJA 3B6OA 4A2BA 3TPQA 3R6MA 3LP1A 1C0TA 4DTPA 3F5TA 2W6KA 4YOVA 3MXJA 3TAMA 3ISNC 4M3YA 1U6ZA 3M8QA 5AQJA 4FW2A 5M1NA 3T3FA 1E3MA 5EX5A 3PIOL 3RWUA 1JL2A 4BACA 4BC5A 1A5XA 4EP4A 3VTIA 4AHTA 3HVTA 4M41A 1I3AA 3OYGA 3LAKA 5BRFA 3SV3A 4CBXA 2XY8A 2F9TA 5AQLA 1S6PA 2YHBA 1P8ZA 3AO3A 3EL2A 2Q3SA 4JI8K 3GDQA 1VQ8N 4CGIA 1OVYA 1KFSA 4CJQA 1CXQA 1NK9A 4JI4K 2HHXA 2O8EB 1S1TA 4KH5A 3H45C 5E84A 4DFMA 1NJYA 5M1QA 4CFAA 2O8EA 2HNDA 3CM5A 3A5NC 2E20A 2IVOA 2P9LB 3CFPA 4CECA 3WQUA 4DV4K 2D4WA 4NYNA 5LJWA 3GOIA 5AQYA 4W5NA 1JCGA 2ZGZA 4H0TB 1MU2A 1QQNA 3SUQA 5M1PA 3HJFA 1DGKN 4Z4IA 1HRHA 2VGNA 3F2KA 3QEPA 3VQ6A 4BG9A 3CCRN 2Q1NA 4A2AA 1KLNA 1ASVA 5C24A 2PYLA 1Z26A 3A5MC 4I2QA 3SBTA 3V1RA 3SUOA 5KGXA 4BC2A 3TU5A 2IS3A 5BPMA 4G9ZA 4E0DA 3FR0A 4GV6A 4B9UA 1A5VA 3WXLA 4FWSA 2P51A 3D7EO 1GOAA 4PL8A 2IDOA 4MFBA 3TSUA 3NH1A 3KLFA 5I42A 1RT7A 2P9SB 2R7YA 4FLUA 1XHZA 4DSIA 1ATSA 3U4LA 4I7FA 4DS4A 4RW4A 3ZT4A 3VESA 3NF7A 3OA9A 3CD6N 3KIOA 1RBRA 3DXMB 1OH7A 4KREA 3TTFA 4MLEA 3VQ8A 3VQ9A 1NOZA 3Q7CA 4M63C 4H0XB 4CW7B 5KPTA 1N32K 1YJNN 2YHAA 1E4GT 5IT9O 4CHZA 1ZBIA 3SPYA 3QEIA 2I7NA 3CJ9A 3CFOA 3MXIA 3OYBA 4LF9K 1DEJA 2E2NA 3RMCA 1VQ9N 1SL1A 4YOWA 1G99A 1TUYA 2FBVA 1RTDA 3IS9A 4Y1DA 4KAZA 4DTJA 4K8ZA 3THVA 3L8BA 1HKCA 1FW6A 4FXDA 1TKZA 4HWIA 3O1BA 3O8MA 4FLYA 3OYJA 4JI2K 3AVFA 3ZX0A 1C0FA 5CYMA 4CZEA 3LWLA 4B3TK 3K58A 2YNFA 4JKGB 5HLFA 1MWKA 2OZMA 4LC9B 4B3RK 2B5JA 4CJWA 1RDAA 4H03B 2HOEA 3AVNA 5I3UA 1J9AA 4IWVA 1I94K 2VQFK 3DMJA 5CY4A 1BWFO 2HBLA 3TAQA 3EKSA 2HHUA 3QNNA 1WAFA 3QERA 3N4QA 3H6EA 1S1UA 3MX2A 3DOKA 1VQMN 4K41A 4BVPA 2XY5A 1HQUA 4JK7A 3KJVA 3KLEA 4OX9K 2HHTA 1VSJA 2OPRA 3QFPA 3THXA 3PX6A 5H1SQ 4KHUA 4E1NA 1V4SA 4BR2A 3THXB 5BN9A 3PIPL 3ID8A 3M1FA 4FWLA 4BR7A 1IKVA 2P9KB 4CIGA 4WE1A 4I9LA 4KFBA 3U8XA 4DTMA 3OYMA 4CZJA 1VQ5N 1T8EA 4KTQA 3FZMA 4YOXA 1G15A 5JLHA 3VQ4A 1YUWA 4E7HA 1ITGA 1RDCA 3CETA 3AO5A 4FM2A 3CF5L 4DUZK 2YHXA 2D0PA 1V4TA 2D0BA 1NJXA 2YKNA 4CJVA 1HNXK 2OZSA 5KQ8A 2PY5A 3NMUA 2B4JA 4ILGB 4KKOA 1C1BA 3M6GA 4CF9A 4BGAA 1GLEG 3TARA 4CD3A
chains in the Genus database with same CATH topology
2ZM6K 4LFBK 4GKJK 1HNWK 4JI4K 3J80O 4LF5K 2F4VK 3T1HK 4DUYK 4X62K 5FLXO 2E5LK 1N34K 4LF4K 4NXNK 4JI2K 3J81O 1HR0K 2UUCK 4JI6K 4JV5K 4DV0K 4CVNE 4B3TK 4LF7K 4DV4K 4B3RK 4X64K 3JAMO 4GKKK 1XNRK 4LFCK 4DV6K 5AJ3K 4DR7K 4AQYK 1I94K 2VQFK 5LMNK 2HHHK 4DV7K 4DR2K 4DV1K 4YY3K 2UXBK 4DV2K 1N36K 2UUAK 5LL6Z 1HNZK 4DR4K 1XMQK 4KHPK 4NXMK 2UXDK 4OX9K 4YHHK 5A2QO 4DR3K 4DR5K 5IWAK 2UXCK 3J7AP 1FJGK 4JI0K 4DR6K 4B3MK 1IBMK 4DV5K 1J5EK 4V19S 3OTOK 4B3SK 1IBKK 4JI3K 2UU9K 1N33K 3J7YP 4DR1K 1XMOK 4JI7K 4LF6K 3T1YK 1XNQK 4CW7B 1N32K 1IBLK 4DUZK 4LFAK 5IT9O 4LF8K 4JI1K 1HNXK 5BR8K 2UUBK 2VQEK 4X66K 5LMUK 4K0KK 4LF9K 4JYAK 4X65K 4DV3K 4JI8K 4JI5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 K;  4LFB K;  4GKJ K;  1HNW K;  4JI4 K;  3J80 O;  4LF5 K;  2F4V K;  3T1H K;  4DUY K;  4X62 K;  5FLX O;  2E5L K;  1N34 K;  4LF4 K;  4NXN K;  4JI2 K;  3J81 O;  1HR0 K;  2UUC K;  4JI6 K;  4JV5 K;  4DV0 K;  4CVN E;  4B3T K;  4LF7 K;  4DV4 K;  4B3R K;  4X64 K;  3JAM O;  4GKK K;  1XNR K;  4LFC K;  4DV6 K;  5AJ3 K;  4DR7 K;  4AQY K;  1I94 K;  2VQF K;  5LMN K;  2HHH K;  4DV7 K;  4DR2 K;  4DV1 K;  4YY3 K;  2UXB K;  4DV2 K;  1N36 K;  2UUA K;  5LL6 Z;  1HNZ K;  4DR4 K;  1XMQ K;  4KHP K;  4NXM K;  2UXD K;  4OX9 K;  4YHH K;  5A2Q O;  4DR3 K;  4DR5 K;  5IWA K;  2UXC K;  3J7A P;  1FJG K;  4JI0 K;  4DR6 K;  4B3M K;  1IBM K;  4DV5 K;  1J5E K;  4V19 S;  3OTO K;  4B3S K;  1IBK K;  4JI3 K;  2UU9 K;  1N33 K;  3J7Y P;  4DR1 K;  1XMO K;  4JI7 K;  4LF6 K;  3T1Y K;  1XNQ K;  4CW7 B;  1N32 K;  1IBL K;  4DUZ K;  4LFA K;  5IT9 O;  4LF8 K;  4JI1 K;  1HNX K;  5BR8 K;  2UUB K;  2VQE K;  4X66 K;  5LMU K;  4K0K K;  4LF9 K;  4JYA K;  4X65 K;  4DV3 K;  4JI8 K;  4JI5 K; 
#chains in the Genus database with same CATH topology
 4CZM A;  1HQE A;  2XHB A;  4GKJ K;  4IDK A;  3SAF A;  2P9P B;  1R0A A;  3I0R A;  1W9H A;  2E5L K;  3LZJ A;  4H5R A;  1VQ6 N;  4Z4H A;  1OH8 A;  3E9O A;  3C6A A;  5J2N A;  1HMV A;  4JAX A;  3S9H A;  4KBO A;  5AQS A;  2EWS A;  3I33 A;  2O8D A;  4JKG A;  2H3G X;  1LWC A;  3ENH A;  2O8D B;  3LAL A;  1UA1 A;  3KTQ A;  2HBM A;  5M1F A;  2D0C A;  3VF4 A;  3SI6 A;  4F4K A;  4PUO A;  2O8B B;  4B9T A;  2G8H A;  1ZBF A;  1VSF A;  2WTU A;  3K59 A;  4PKH A;  4B8A B;  4IDH A;  4JKD A;  4CGG A;  1S22 A;  4MO5 A;  4F2S A;  4DCH A;  1NK4 A;  4YY3 K;  5C2D A;  3AA4 A;  3CCL N;  1N36 K;  3QO9 A;  2BE2 A;  4UQG A;  3IG1 A;  5MLC Q;  5DM7 L;  1BU6 O;  4IOA L;  3O4N A;  4KHP K;  1T6C A;  4BY9 C;  2GEM A;  3DRP A;  1NGG A;  2HF3 A;  1NWK A;  3ZSV A;  5GAG P;  4BRA A;  2XY7 A;  2E88 A;  4FJK A;  4JK8 A;  2Y1I A;  3O4Q A;  4BRH A;  1NKB A;  3AVG A;  4JKC A;  2KQ2 A;  3RMA A;  5CYQ A;  1QE1 A;  1ZBU A;  3D45 A;  3LPU A;  4CK1 A;  3NVM A;  2X6N A;  1X1P A;  2ASP A;  4E3S A;  3A8Y A;  4DG1 A;  1IKW A;  3IKM A;  3NCI A;  3L2V A;  3OYF A;  4KTW A;  3HOS A;  2XRI A;  4B9Q A;  2GWJ A;  4KHS A;  1TYQ B;  5BPL A;  3CCU N;  3PX4 A;  1RTH A;  3CCS N;  4F3O A;  3M3Z A;  1IJJ A;  1C0U A;  4EFH A;  5JS1 A;  2ZJP L;  3OYI A;  4KI6 A;  3DYA A;  5LMU K;  1J53 A;  2OA8 A;  3QB0 A;  1DLO A;  3ID6 A;  3THY B;  1Q7Y O;  1WSF A;  5CR4 A;  3B8A X;  3OYE A;  4O44 A;  3VGK A;  1B92 A;  4NB4 A;  1RBV A;  4IOC L;  3SYZ A;  4LF5 K;  3NE6 A;  1YAG A;  1OKJ A;  1KCF A;  4OPK A;  1N34 K;  3V9W A;  3GBT A;  5KTQ A;  4FK2 A;  4DS5 A;  3A0I X;  4EZ6 A;  2A42 A;  4BRL A;  4KV8 A;  1VQK N;  2G8K A;  3VEO A;  4EHT A;  2ATQ A;  1U4B A;  3ZSX A;  5EVZ A;  4RW8 A;  2CGL A;  1KD1 O;  3SQ1 A;  3MAQ A;  1TKX A;  1P90 A;  4ELV A;  1JJ2 M;  1NJI O;  1J5O A;  2FSK A;  3AVM A;  4FZX C;  2DY4 A;  3U6F A;  5JLF A;  4J8F A;  4FLT A;  4E19 A;  3SJH A;  2QTD A;  3TWH A;  4DR4 K;  3CQX A;  4CJU A;  2QWM A;  1WLJ A;  2Z1H A;  1T05 A;  1WSE A;  4CJT A;  1TV6 A;  3QNO A;  4O8U A;  4CJS A;  4DSL A;  3C6T A;  3MX5 A;  4GNI A;  3GE1 A;  2RN2 A;  5AZI A;  3T1A A;  3SMS A;  2W40 A;  3P1G A;  3ZX3 A;  1TAQ A;  4FVM A;  3J7A P;  2ZQB A;  2KHO A;  1ZC6 A;  4DMN A;  4RW7 A;  4DR6 K;  3WXM B;  3DLE A;  3UE5 A;  5J2P A;  2VWJ A;  4CIE A;  4DSF A;  3LDP A;  5BR9 A;  3SQ2 A;  5BRD A;  2QK9 A;  4BR5 A;  3QIN A;  4CIF A;  2A5X A;  4IZ9 A;  2W6L A;  4C23 A;  2G8V A;  3K5M A;  1YJ9 N;  3CI5 A;  4BWJ A;  4FWR A;  2GUP A;  3UIQ A;  3UKR B;  2G8F A;  4Y0W A;  2ZJQ L;  5GIO A;  2HVI A;  1TVR A;  3RSE B;  3AA5 X;  4H5V A;  5CE3 A;  3JSM A;  1JLQ A;  2G8I A;  2D0O A;  4F2R A;  1TKD A;  3DRR A;  5AQW A;  1DTQ A;  3TAE A;  3GG4 A;  1HLU A;  2Q31 A;  4JI5 K;  3VQD A;  3A5L C;  3DRS A;  1ESV A;  4FJ5 A;  1KVB A;  1TK5 A;  3T1H K;  1D5A A;  1EP4 A;  1SL0 A;  4CZL A;  4CJR A;  2BAN A;  4XH1 A;  1CXU A;  3P83 D;  4IG0 A;  1QQM A;  1IG8 A;  3VQ5 A;  2Q36 A;  1X9S A;  3TI0 A;  4RCH A;  4KTZ A;  1WB9 A;  2A41 A;  5J2Q A;  4X64 K;  1XI1 A;  5M1K A;  2NLX A;  4GKK K;  4BE0 A;  3DAW A;  1VSE A;  5AJ3 K;  3VEX A;  1S3X A;  2HBJ A;  4WCE L;  3L2Q A;  3FZK A;  3AAP A;  4OVL A;  3DLK A;  2YHY A;  2HMI A;  4H0P A;  3H1V X;  4CJK A;  2RHK A;  5FPM A;  4O5F A;  5C0Y A;  5HL7 L;  3WEE A;  1K9M O;  1ZBS A;  2NRV A;  3MEC A;  3WEE B;  4DSJ A;  3C7N B;  4FWM A;  3P5J A;  3FFI A;  1MDU B;  4IFV A;  3I55 N;  3U9Z A;  4CBW A;  3CC4 N;  4DLG A;  2F8T A;  1M1K O;  4C8K A;  1VSD A;  1BIZ A;  1TL3 A;  4ISG A;  4DV5 K;  3L2W A;  1DKG D;  5CZ1 A;  4N5S A;  2G8W A;  4CES A;  4DTS A;  3O08 A;  4H4M A;  1KRP A;  3EO3 A;  4JNE A;  4DR1 K;  2P5O A;  5C2F A;  4LF6 K;  3AA2 A;  3BDP A;  5FRN A;  2JLE A;  4C1N I;  4H0Y B;  4IO9 L;  4LFA K;  3WQT A;  4JKB A;  2F96 A;  2X6S A;  3HSC A;  1ASW A;  4A61 A;  3MED A;  1NGD A;  3VQQ A;  3F9K A;  5AQG A;  2V52 B;  1J54 A;  2FSN A;  3HI0 A;  4PHT X;  3CHW A;  1L3V A;  5HRS A;  5K14 A;  3NGY A;  4DTR A;  4NCB A;  4CK2 A;  1SZ2 A;  4QS7 A;  1N6Q A;  2GV9 A;  3LP3 A;  3ULE B;  2F7T A;  2ETJ A;  1BI4 B;  5KPR A;  4DUY K;  3ULE A;  1VAZ A;  4R5P A;  1Q9X A;  3MWP A;  3LWM A;  4BG8 A;  2QXL A;  3TSQ A;  2QA4 N;  3L6Q A;  4DV0 K;  2KZZ A;  1GLD G;  1SQK A;  4HCB A;  4CJL A;  1S1W A;  1LCU A;  4Z4C A;  3IUC A;  4ZTF A;  2NRR A;  3ZEU B;  1Q81 O;  2P9I B;  1ZBL A;  3CJB A;  4JHD A;  4WFA L;  4C8O A;  4WQ4 A;  3SZ2 A;  4B1U B;  3ZET A;  4N56 A;  3A2F A;  2KZM A;  3BP8 A;  4DKW A;  3F73 A;  4H0O A;  4WQ5 A;  4B1Y B;  5C15 A;  3O3H A;  3QBW A;  1VSM A;  4H5W A;  3G71 N;  1R59 O;  4M7Y A;  3WXJ A;  1RBU A;  3VEV A;  4CZG A;  1JLC A;  3CJA A;  2FBX A;  2NRH A;  4DR3 K;  3RRH A;  1NGB A;  4IO8 A;  5IWA K;  2BUP A;  4BRN A;  3FZH A;  3QEW A;  2IAJ A;  1K8A O;  1BOT O;  3BGR A;  2VWK A;  4PKI A;  4CEA A;  2ZF5 O;  1BQM A;  1U2V A;  5AQU A;  4AH9 A;  4FLZ A;  4BRP A;  1VQO N;  3VEY A;  2E4L A;  4BRK A;  3K57 A;  5HRR A;  4OJR A;  3OBY A;  1QTM A;  3DLG A;  3D2E A;  4Z4F A;  1N33 K;  5JMV A;  4OO1 J;  1ILY A;  1F21 A;  4ILH A;  1K8K A;  3K0S A;  2QWO A;  4BRE A;  3THW A;  1SKW A;  3K2P A;  4N76 A;  1BDG A;  4BE1 A;  1RT4 A;  1S5J A;  3E01 A;  2GTD A;  3UKU B;  3G0Z A;  1LAW A;  2GWK A;  1NGE A;  3HXM A;  3AVL A;  4YOU A;  4JN4 A;  1NOY A;  2ASM A;  1NKE A;  4YOY A;  1O1W A;  4OKE A;  3PX0 A;  4FSV A;  4EAH D;  3HRG A;  3G4S N;  4CZI A;  3U9D A;  4CHN A;  2HHS A;  3VQA A;  3MWT A;  1IG9 A;  1YVN A;  1BQN A;  3O80 A;  4NXN K;  4RTF D;  3B6P A;  1LV5 A;  3HZ6 A;  4CEE A;  3MCP A;  3D6R A;  4FJ9 A;  3SV4 A;  1BL3 A;  3BF1 A;  1HNV A;  3T69 A;  3KK7 A;  4DLE A;  4CF0 A;  1Z6R A;  4JD2 B;  3ZEU A;  4OGE A;  5KGW A;  2UYT A;  4CGD A;  2HHH K;  4OPJ A;  4KHW A;  3HOT A;  3VQC A;  5F2R A;  4DR2 K;  3DLH A;  3SBG A;  4NLC A;  2QKK A;  1O13 A;  1Z05 A;  1X9J A;  4M7X A;  3Q7B A;  2JGU A;  2A40 A;  1CLQ A;  2ZJR L;  2P9U B;  2KTQ A;  3KK3 A;  3AGR A;  4NXM K;  1NGA A;  1B9D A;  2D5R A;  1SS6 A;  4FPA A;  5FRM A;  2RKI A;  4JI0 K;  1XHX A;  3ZSR A;  3KLI A;  2FF3 B;  1RT6 A;  4IEI A;  3QIO A;  2OTL N;  1NG9 A;  4OLB A;  5EXW A;  3OTO K;  2VG5 A;  1JLA A;  5AQX A;  4LH5 A;  4CJP A;  4HVJ A;  4CEZ A;  1GLC G;  4CER A;  4CF1 A;  1XNQ K;  5FPE A;  1A5W A;  2HB5 A;  4W5Q A;  1IBL K;  3BZK A;  4JKH A;  4GMJ B;  4CZH A;  5C42 A;  4MLH A;  4BDZ A;  5TKW A;  3DJC A;  5ADX H;  1REV A;  3KWI A;  1X9M A;  2V7Y A;  3PSF A;  1GLJ O;  3VA3 A;  4XEI A;  1RDB A;  3UKU A;  1FKP A;  3MMV A;  4DQQ A;  2KLA A;  1KTQ A;  4H4O A;  1NJW A;  4LH4 A;  4CCH A;  3TAP A;  4XH5 A;  1EX4 A;  1RT3 A;  4HCC A;  1T44 A;  2WUS A;  5C10 A;  4X62 K;  2A6A A;  5HOO A;  3LP0 A;  1UAX A;  3OYC A;  2UUC K;  3VET A;  4DFP A;  2YNH A;  1WBB A;  3G25 A;  4OLA A;  3MEG A;  4PWD A;  4M3R A;  4YFU A;  3O5B A;  4HHT A;  4G1Q A;  2PAV A;  2OPS A;  4KB1 A;  2BTF A;  2QWQ A;  3ZT0 A;  3ZYY X;  1RDU A;  2P5G A;  2EX3 A;  4IBN A;  1C1C A;  3L4Q A;  3V9S A;  3O9U A;  4CJ3 A;  3VQE A;  4W5R A;  1BHL A;  4FVU A;  2HHV A;  1NMD A;  3C0B A;  3CCJ N;  3WNH A;  3KK2 A;  5AQK A;  3K9K A;  4LSN A;  2QEX N;  2CGK A;  1NMN A;  4BVO A;  1NK5 A;  1RGI A;  1VK0 A;  1DT9 A;  1FXX A;  3OYN A;  3WXK A;  4ILJ A;  4JRP A;  1SL2 A;  3KKR A;  4GVE A;  1VSL A;  4KO0 A;  1QS4 A;  4DF4 A;  2KFN A;  3AY9 A;  2UXC K;  4Q0B A;  3PY8 A;  1S1X A;  4JKE A;  1YHQ N;  4CJ4 A;  2IOC A;  3LDO A;  1NU0 A;  2NZT A;  1NGF A;  4FM0 A;  1NK0 A;  4QAG A;  5E26 A;  2WON A;  5CHI A;  3C7N A;  4YOR A;  4M3X A;  3AVK A;  3MCA B;  5FRO A;  4CEF A;  4FO0 A;  1TL1 A;  2PFU A;  4M3U A;  5GAD P;  3JXU A;  1TK8 A;  4JS5 A;  1MA9 B;  3CQ8 A;  3P31 A;  4CJF A;  2PZS A;  1W7A A;  5CZ2 A;  3OYD A;  4E7J A;  2AJQ A;  5ADX A;  2ASO A;  4IKF A;  4FM1 A;  2O8F A;  4OPA A;  4CGJ A;  1GLA G;  1U45 A;  4K0K K;  4CEO A;  2O8F B;  3HL8 A;  4BR0 A;  3HPH A;  1HYZ A;  5JVH L;  1XC9 A;  3SPZ A;  1WSH A;  2NNW A;  4KHY A;  3AVC A;  2W41 A;  1KAY A;  5J2M A;  4EHU A;  4WFN L;  4E7L A;  3WNF A;  1KC8 O;  4Q5V A;  4E7I A;  3HTV A;  4BRQ A;  5KRT A;  2O8B A;  3DOL A;  1NJZ A;  1VQN N;  4DQR A;  1GLL O;  4FJN A;  2P9N A;  1RNH A;  3OYL A;  4DQP A;  2ITG A;  1U04 A;  2VG7 A;  4DU4 A;  4Y1C A;  4BQL A;  2KFZ A;  4JHD B;  4CHP A;  2YJE A;  1KLM A;  3HP9 A;  4KRF A;  3U3G A;  4DFJ A;  2YJF A;  1T7P A;  3ULD A;  3P4I A;  4H0V B;  4DTX A;  3LM2 A;  3VEZ A;  1WAJ A;  1JKH A;  3ATV A;  1HYS A;  4H8K A;  4YDU C;  4ZTJ A;  3VF2 A;  4BRI A;  3AA3 A;  5BPN A;  3RMD A;  1NK8 A;  2FSJ A;  1KAZ A;  3DLR A;  4FZY A;  1KVC A;  4YHH K;  1S9E A;  3WXI A;  4K8X A;  4BRD A;  1JXB A;  5AQM A;  5JS2 A;  4ISE A;  4FL9 A;  1JLF A;  4CBU A;  3ITH A;  3HM9 A;  4J2B A;  4FW1 A;  4V19 S;  1NK6 A;  2VCP A;  3M8R A;  2YV0 X;  1L3S A;  3D0P A;  1IBK K;  2HVH A;  4FLV A;  1TUU A;  1K8K B;  4FOE A;  3SCX A;  3SJJ A;  2IIR A;  3L2R A;  2I7P A;  3PLA A;  2OPP A;  1IKX A;  2OPQ A;  1ASU A;  1U2V B;  2IVN A;  4JI1 K;  5FPN A;  1T03 A;  3J7Z O;  3VEN A;  2BH1 A;  3LM9 A;  4C8L A;  1EO1 A;  3O9T A;  4CHQ A;  4ZHR A;  3LP2 A;  3CM6 A;  3TTD A;  4EP5 A;  3D2E B;  4JEP A;  3QBX A;  4OGC A;  1S1V A;  3S3M A;  5DK5 A;  4QOZ B;  4U67 L;  3M8P A;  1VQP N;  2BGG A;  3THW B;  1FK9 A;  1EQY A;  5SZT A;  1C6V A;  3SLC A;  1KSP A;  1NGI A;  2F4V K;  3AAR A;  3I8B A;  3DM2 A;  2GEL A;  4O0I A;  2QM1 A;  2XO7 A;  3DXK B;  3QDK A;  4MO4 A;  3H3O B;  3ENB A;  4JI6 K;  4A5A A;  4C1N K;  4L3Q A;  4FJX A;  4CF8 A;  2Q0R A;  1Z25 A;  5HRO A;  3NHG A;  4K25 A;  4OPH A;  1LWF A;  1YT3 A;  4DV6 K;  2QWL A;  1ZBH A;  1WNS A;  4BC3 A;  1HPZ A;  4UY8 O;  1D9D A;  2E8A A;  3ALY A;  5LMN K;  4M45 A;  3ZSQ A;  3BEX A;  1HNI A;  3DWL A;  4CK3 A;  2X74 A;  2J4R A;  2P9U A;  4WQ4 C;  4HTL A;  4E7K A;  3BF3 A;  3MDQ A;  4FJI A;  4K43 A;  5F0X A;  1RBS A;  3V1Q A;  3FGU A;  1RFQ A;  4OKK A;  3EEQ A;  4Z4G A;  4HUF A;  5FPD A;  3LDL A;  3KZB A;  3K9J A;  4DHY A;  3WT0 A;  3TTC A;  4BRF A;  4DSK A;  2DPN A;  4M3W A;  4I6M A;  2CGJ A;  3CFR A;  5D3G A;  2NUB A;  1Q18 A;  3BUZ B;  4AM7 A;  1IBM K;  3BY5 A;  1QHT A;  3G6E N;  3EE9 A;  1QSL A;  2ITM A;  3V9X A;  3IFR A;  1IH7 A;  4KPY A;  4FWQ A;  1RT5 A;  4MDA A;  4NLB A;  5KRS A;  3J7Y P;  3LZI A;  4IJN A;  4R79 A;  1WOQ A;  1XMO K;  1KFD A;  3IDH A;  2X78 A;  5C12 A;  4CF2 A;  1BIS A;  1T6D A;  4B08 A;  1EET A;  1Q9Y A;  3O3G A;  3NF9 A;  4DU1 A;  3VGL A;  1KAX A;  3KLH A;  1JCE A;  3SAG A;  5AZJ A;  3U3Y A;  1HKB A;  4W5O A;  4DQ8 A;  3LAM A;  2OYQ A;  3T7Z A;  1LAV A;  2P9L A;  2HNZ A;  2YNG A;  1YTU A;  1NGH A;  3AAQ A;  1D9F A;  2JWK A;  3QEV A;  1RT1 A;  4CZK A;  3SQ4 A;  1YIJ N;  4LFB K;  1HNW K;  5AQQ A;  4HUE A;  1LW2 A;  3JYT A;  4DTN A;  2CH5 A;  4CFB A;  1LOT B;  4RW9 A;  5GIN A;  3SQ0 A;  3CC7 N;  4CHO A;  3AVJ A;  4JKA A;  4JS4 A;  2OAN A;  3HYF A;  1L3T A;  4BE2 A;  2OTJ N;  4CJ5 A;  2YKM A;  3W0L A;  5AQO A;  4I2P A;  3PO5 A;  4M3Z A;  3MXM A;  4LFC K;  4DTU A;  4ELU A;  2KW4 A;  3VF6 A;  3WNE A;  4B8C A;  4ELT A;  4NCG A;  4O0J A;  3FLC O;  1NGJ A;  4DQS A;  4XH4 A;  3J8A A;  3ZSZ A;  3CJ7 A;  1SKS A;  4AHV A;  3CJ1 A;  4BDY A;  2HBK A;  2O8C A;  2IC3 A;  2D0A A;  1VHX A;  3C94 A;  4WQ5 C;  1SAZ A;  2QI2 A;  5LY3 A;  3I8D A;  3AVH A;  1HNZ K;  4N47 A;  3L4I A;  4AHU A;  3FFK B;  4HTU A;  4CJ7 A;  1NK7 A;  2DFF A;  2PBD A;  5HP1 A;  1TGO A;  3C6H A;  4F3T A;  4CZF A;  4L8R B;  4B1Z A;  3MN7 A;  4FYD A;  1BA0 A;  3EKU A;  4NCA A;  4JKF A;  4FJH A;  1H1V A;  3HBT A;  3VER A;  3SUN A;  4AHC A;  3QIC A;  4JRQ A;  3C95 A;  3EY1 A;  4LY7 A;  4BC4 A;  3O4W A;  3AO2 A;  2GBZ A;  4IXC A;  4AHS A;  1DTT A;  4WF9 L;  2HF4 A;  5AQR A;  1C1A A;  4YOT A;  3HK2 A;  4AM6 A;  1WSJ A;  3QIP A;  2P9S A;  3TAN A;  3ZSO A;  4FWP A;  4PL7 A;  1BO5 O;  1W97 L;  3LDQ A;  3L0Q A;  1NM1 A;  3KLG A;  2KKZ A;  4MDB A;  5JIC A;  4FCY A;  2GX9 A;  1VSK A;  3DXM A;  2VQE K;  4MQ3 A;  3AO4 A;  4DB3 A;  1BG3 A;  1YVU A;  5AQP A;  4FJJ A;  4Z4E A;  4CFD A;  1N8R O;  3FZF A;  4C8N A;  4PKG A;  3HST B;  1X3N A;  4O4G A;  4CHY A;  2Q97 A;  4DTO A;  3RMB A;  5FLX O;  4BR9 A;  4M42 A;  1QHA A;  1HR0 K;  2P9N B;  3M8S A;  3OY9 A;  3ZCM A;  3NGI A;  4DSE A;  3CCE N;  4BGB A;  1CZ9 A;  4CVN E;  3I56 N;  4NO7 A;  3QET A;  2RF2 A;  2QWN A;  4O55 A;  1C0G A;  3E9P A;  4QS9 A;  1D4X A;  1GOC A;  2FBY A;  4YDU A;  1JLE A;  2QWR A;  4WFB L;  4BRM A;  2RPI A;  4DR7 K;  3S3O A;  1N5Y A;  1HUX A;  3CPW M;  5TKY A;  1QSY A;  2F8S A;  5I9E B;  3G10 A;  3D2F A;  1WSG A;  3P38 A;  2IVP A;  5BN8 A;  2WOM A;  5FDL A;  3LDS A;  4O8K A;  3V81 A;  1NNE A;  1L5U A;  3MN9 A;  3O9S A;  4I9Q A;  3EN9 A;  3KKS A;  1UOC A;  4CI6 A;  4QS8 A;  3KWG A;  4BRC A;  4PA1 A;  5A2Q O;  4W5T A;  1JLB A;  3AVB A;  2P1J A;  1TAU A;  1RBT A;  1Q82 O;  3SUP A;  4B9V A;  2ZWH A;  3L2U A;  1BCM A;  4B9M A;  1E4F T;  4B3S K;  3OS2 A;  4FJG A;  3RR7 A;  4A5B A;  3E66 A;  1EWR A;  2NRT A;  2G8U A;  2Z1G A;  4JI3 K;  4EZ9 A;  1YI2 N;  1BUP A;  3HVR A;  2DFH A;  1EWQ A;  1U49 A;  4CE9 A;  3EZ5 A;  3OJU A;  3CPE A;  2FF6 A;  2HNY A;  2E1Z A;  1I39 A;  4GW6 A;  3CME N;  2WFB A;  2JWL A;  3AGK A;  3ATU A;  3P39 A;  5E41 A;  2P9K A;  3QEX A;  1NGC A;  1SUQ A;  5AQH A;  3SAH A;  2NRZ A;  4FJL A;  3MEE A;  2O4G A;  3CIP A;  3QES A;  2E1Y A;  3VMF B;  3UB5 A;  3VQP A;  4X65 K;  1KVA A;  1QZ5 A;  4DV3 K;  1QSS A;  1RTJ A;  3K5L A;  3EZW A;  1VSH A;  5LJV A;  3DLL L;  4JD2 A;  3IRX A;  1YTA A;  3OBW A;  4FK4 A;  3CCM N;  3CER A;  3J81 O;  3CG7 A;  4DF8 A;  2QXF A;  3EE8 A;  1JCF A;  3LL3 A;  2XY6 A;  3OHR A;  3L3U A;  3AVI A;  5BRH A;  2E2O A;  2VG6 A;  3ZT3 A;  4FK0 A;  3AV9 A;  3SMP A;  3IMX A;  1SKR A;  4AQY K;  4B3O A;  1BI4 A;  2HHQ A;  4CEQ A;  3NH2 A;  1NKC A;  4FLW A;  3V9U A;  4DV7 K;  4QCL A;  1IV0 A;  3TR8 A;  2DTU A;  3DXK A;  3D2F B;  2E2Q A;  2NRX A;  2UXB K;  2YCH A;  1HJO A;  1GLB G;  1HYV A;  2Q2R A;  3H08 A;  3NF8 A;  3IAY A;  1EXQ A;  3VQB A;  4KHQ A;  2E2P A;  3NGZ A;  3RVC A;  4KH4 A;  2UXD K;  3O9Q A;  3K5O A;  1GLF O;  4FZZ A;  2HHW A;  3ASM A;  1VQL N;  3UKR A;  1FJG K;  3W3D A;  1TYQ A;  4CED A;  4B3M K;  5M1O A;  1J5E K;  3RSE A;  3OJS A;  5HRN A;  4U7B A;  3OYA A;  3R9P A;  3H46 O;  2VGM A;  3HM8 A;  3OS1 A;  3THY A;  4IG3 A;  4JLH A;  2FBT A;  2YHW A;  3R3L A;  4CGF A;  1M90 O;  1C0M A;  3GL1 A;  4E1J A;  1S72 N;  3AO1 A;  5C25 A;  4F8R A;  4LF8 K;  2HW3 A;  3MN6 A;  1K6Y A;  1XC3 A;  4H5N A;  1GOB A;  2V7Z A;  4BWM A;  1TKT A;  4GV9 A;  2HMP A;  3HO1 A;  4DQI A;  2YX6 A;  4K42 A;  4RG8 A;  3HPG A;  4FWN A;  3CCV N;  2NRW A;  1JL1 A;  4B1V A;  1Y97 A;  4XIU A;  1VRU A;  1CZA N;  3L3V A;  3NAE A;  4FLX A;  5EU7 A;  1IKY A;  3ZSY A;  4HUG A;  5AQI A;  4LD0 A;  4KH6 A;  4ID5 A;  4JV5 K;  1Y64 A;  3KD1 E;  3NH0 A;  1WN7 A;  3LDN A;  4CJE A;  4PQU A;  4RWT A;  2W42 A;  3CQY A;  5EOY A;  5KQD A;  1XNR K;  4PY5 A;  3LAN A;  5AQT A;  4AHR A;  3RR8 A;  2QWP A;  1YJW N;  3LPT A;  2CH6 A;  4NYF A;  4FJ7 A;  4GVM A;  3ENO A;  1CZB A;  1VQ4 N;  1FKO A;  1EKE A;  3FE1 A;  3PO4 A;  3CXC M;  1HPM A;  4FPB A;  5HRP A;  2EHG A;  3KD5 E;  3MN5 A;  1LWE A;  5LL6 Z;  3TAF A;  5ELZ A;  1ATR A;  1XMQ K;  3QLH A;  1SV5 A;  3HPO A;  4IFY A;  3S41 A;  2ZGY A;  3ZX2 A;  3F9M A;  1XQS C;  3PV8 A;  5F1X A;  2RE2 A;  5DM6 L;  2FLO A;  1WUA A;  3DI6 A;  2B6A A;  2Y1J A;  4O5B A;  4A57 A;  3V9Z A;  2O8C B;  4BQZ A;  5EY4 A;  1S6Q A;  4RW6 A;  3N4P A;  4AF1 A;  1S9G A;  1Q8I A;  5J1E A;  4M3T A;  4H5T A;  4A59 A;  4AIL C;  4KHN A;  2E6M A;  1TK0 A;  3DLB A;  2FC0 A;  3KHY A;  3QFU A;  3O1W A;  3H3N O;  1ZYQ A;  2AA4 A;  3K5N A;  3ZLJ A;  4N41 A;  5GIP A;  4KI4 A;  2YI1 A;  4A62 A;  3OS0 A;  4CGH A;  1QQC A;  2QKB A;  1Q86 O;  5AZJ B;  5BR8 K;  3RTV A;  3CC2 N;  4X66 K;  4IOX A;  2Z1I A;  5JVG L;  4B1W B;  4YNQ A;  4DFK A;  1U48 A;  4FWO A;  3ZT2 A;  4J2A A;  1VSI A;  4JK9 A;  1W0H A;  3NDK A;  3VQ7 A;  3NBP A;  4LSL A;  3V6D A;  2P9I A;  1YXQ A;  1QVG M;  3J80 O;  3ZET B;  1VQ7 N;  1X3M A;  4J2D A;  5KI6 A;  5AQF A;  1YF5 L;  2D1K A;  1BIU A;  3AVA A;  3WUH A;  3V4I A;  1K73 O;  4IJA A;  4DU3 A;  3ZT1 A;  4LF7 K;  4BRG A;  1B9F A;  3TAG A;  3E9L A;  3TSP A;  2HST A;  2BDP A;  3HT3 A;  2A1R A;  3OYH A;  4E89 A;  3QML A;  2Q0U A;  3MK6 A;  4GY2 B;  3VEW A;  1VRT A;  2YNI A;  4Z94 A;  5AQV A;  4DWI A;  4B9S A;  1IO2 A;  3H1Q A;  3A5O C;  3OYK A;  1XWL A;  2DFE A;  1RT2 A;  1JLG A;  3O9R A;  1XUP O;  4BRO A;  2A1S A;  1HX1 A;  3VPZ A;  3PUF A;  4WYB A;  2OCE A;  3S3N A;  3OW2 M;  3WNG A;  2FXU A;  2E6L A;  3CMA N;  3VOV A;  4GV3 A;  3NFA A;  3TAB A;  1RDD A;  4B1X B;  2UU9 K;  1BA1 A;  3NVK A;  1QQO A;  3OVN A;  4KB0 A;  4JI7 K;  1OVQ A;  3T1Y K;  1BGX T;  5KPZ A;  3T19 A;  1UA0 A;  1RDW X;  4FWK A;  3KVG A;  3HP6 A;  1WBD A;  3C65 A;  5DMR A;  1QVF M;  3FZL A;  1RCH A;  3O3F A;  4Z0U A;  2UUB K;  1W2B M;  2LSN A;  1RTI A;  5AQN A;  3CCQ N;  3M5R A;  1J6Z A;  4C8M A;  1JXE A;  3VN5 A;  5AR0 A;  5SWM A;  4JYA K;  4BDP A;  1OH6 A;  3EYZ A;  4CFC A;  1RIL A;  2O4I A;  4ICL A;  3SK3 A;  2ZM6 K;  4IFE A;  4CD1 A;  1ATN A;  4ISF A;  3VTH A;  4FJ8 A;  4IEE A;  5AQZ A;  5AFU A;  5HBM A;  4BR4 A;  4LF4 K;  2P9P A;  1YIT N;  3E1Y A;  3NF6 A;  5T7B A;  2AP1 A;  2IGI A;  3CYM A;  3RRG A;  1NBW A;  4J2E A;  4ID1 A;  4B9N A;  1ZXO A;  2I5J A;  2F9W A;  3CJC A;  3V1O A;  2ZE2 A;  1UWB A;  3JAM O;  3SNN A;  5GAH P;  1NLV A;  1HKG A;  2VWB A;  1MWM A;  1T3V A;  4CEB A;  2ZD1 A;  5B8H A;  2GUI A;  2QW9 A;  1LW0 A;  3KK1 A;  2VYP A;  3I0S A;  3BZC A;  4I6M B;  4F9O A;  4B9L A;  4DV1 K;  1L3U A;  3VA0 A;  1KXP A;  3VGM A;  4FJM A;  4DV2 K;  2UUA K;  2V51 B;  5GAE P;  1QZ6 A;  2WBN A;  3R8E A;  3ZSW A;  3O6W A;  1X9W A;  1WSI A;  1HJR A;  4FOI A;  4E1M A;  4EIA A;  5AZI B;  5BRE A;  4DR5 K;  3C6U A;  3R1X A;  4TSX A;  1KQS M;  2A3Z A;  3PSI A;  3JS6 A;  2WC9 A;  2PYJ A;  1OH5 A;  1U47 A;  2Z1J A;  5AFU H;  1D8Y A;  1BCO A;  4OKJ A;  3B6O A;  4A2B A;  3TPQ A;  3R6M A;  3LP1 A;  1C0T A;  4DTP A;  3F5T A;  2W6K A;  4YOV A;  3MXJ A;  3TAM A;  3ISN C;  4M3Y A;  1U6Z A;  3M8Q A;  5AQJ A;  4FW2 A;  5M1N A;  3T3F A;  1E3M A;  5EX5 A;  3PIO L;  3RWU A;  1JL2 A;  4BAC A;  4BC5 A;  1A5X A;  4EP4 A;  3VTI A;  4AHT A;  3HVT A;  4M41 A;  1I3A A;  3OYG A;  3LAK A;  5BRF A;  3SV3 A;  4CBX A;  2XY8 A;  2F9T A;  5AQL A;  1S6P A;  2YHB A;  1P8Z A;  3AO3 A;  3EL2 A;  2Q3S A;  4JI8 K;  3GDQ A;  1VQ8 N;  4CGI A;  1OVY A;  1KFS A;  4CJQ A;  1CXQ A;  1NK9 A;  4JI4 K;  2HHX A;  2O8E B;  1S1T A;  4KH5 A;  3H45 C;  5E84 A;  4DFM A;  1NJY A;  5M1Q A;  4CFA A;  2O8E A;  2HND A;  3CM5 A;  3A5N C;  2E20 A;  2IVO A;  2P9L B;  3CFP A;  4CEC A;  3WQU A;  4DV4 K;  2D4W A;  4NYN A;  5LJW A;  3GOI A;  5AQY A;  4W5N A;  1JCG A;  2ZGZ A;  4H0T B;  1MU2 A;  1QQN A;  3SUQ A;  5M1P A;  3HJF A;  1DGK N;  4Z4I A;  1HRH A;  2VGN A;  3F2K A;  3QEP A;  3VQ6 A;  4BG9 A;  3CCR N;  2Q1N A;  4A2A A;  1KLN A;  1ASV A;  5C24 A;  2PYL A;  1Z26 A;  3A5M C;  4I2Q A;  3SBT A;  3V1R A;  3SUO A;  5KGX A;  4BC2 A;  3TU5 A;  2IS3 A;  5BPM A;  4G9Z A;  4E0D A;  3FR0 A;  4GV6 A;  4B9U A;  1A5V A;  3WXL A;  4FWS A;  2P51 A;  3D7E O;  1GOA A;  4PL8 A;  2IDO A;  4MFB A;  3TSU A;  3NH1 A;  3KLF A;  5I42 A;  1RT7 A;  2P9S B;  2R7Y A;  4FLU A;  1XHZ A;  4DSI A;  1ATS A;  3U4L A;  4I7F A;  4DS4 A;  4RW4 A;  3ZT4 A;  3VES A;  3NF7 A;  3OA9 A;  3CD6 N;  3KIO A;  1RBR A;  3DXM B;  1OH7 A;  4KRE A;  3TTF A;  4MLE A;  3VQ8 A;  3VQ9 A;  1NOZ A;  3Q7C A;  4M63 C;  4H0X B;  4CW7 B;  5KPT A;  1N32 K;  1YJN N;  2YHA A;  1E4G T;  5IT9 O;  4CHZ A;  1ZBI A;  3SPY A;  3QEI A;  2I7N A;  3CJ9 A;  3CFO A;  3MXI A;  3OYB A;  4LF9 K;  1DEJ A;  2E2N A;  3RMC A;  1VQ9 N;  1SL1 A;  4YOW A;  1G99 A;  1TUY A;  2FBV A;  1RTD A;  3IS9 A;  4Y1D A;  4KAZ A;  4DTJ A;  4K8Z A;  3THV A;  3L8B A;  1HKC A;  1FW6 A;  4FXD A;  1TKZ A;  4HWI A;  3O1B A;  3O8M A;  4FLY A;  3OYJ A;  4JI2 K;  3AVF A;  3ZX0 A;  1C0F A;  5CYM A;  4CZE A;  3LWL A;  4B3T K;  3K58 A;  2YNF A;  4JKG B;  5HLF A;  1MWK A;  2OZM A;  4LC9 B;  4B3R K;  2B5J A;  4CJW A;  1RDA A;  4H03 B;  2HOE A;  3AVN A;  5I3U A;  1J9A A;  4IWV A;  1I94 K;  2VQF K;  3DMJ A;  5CY4 A;  1BWF O;  2HBL A;  3TAQ A;  3EKS A;  2HHU A;  3QNN A;  1WAF A;  3QER A;  3N4Q A;  3H6E A;  1S1U A;  3MX2 A;  3DOK A;  1VQM N;  4K41 A;  4BVP A;  2XY5 A;  1HQU A;  4JK7 A;  3KJV A;  3KLE A;  4OX9 K;  2HHT A;  1VSJ A;  2OPR A;  3QFP A;  3THX A;  3PX6 A;  5H1S Q;  4KHU A;  4E1N A;  1V4S A;  4BR2 A;  3THX B;  5BN9 A;  3PIP L;  3ID8 A;  3M1F A;  4FWL A;  4BR7 A;  1IKV A;  2P9K B;  4CIG A;  4WE1 A;  4I9L A;  4KFB A;  3U8X A;  4DTM A;  3OYM A;  4CZJ A;  1VQ5 N;  1T8E A;  4KTQ A;  3FZM A;  4YOX A;  1G15 A;  5JLH A;  3VQ4 A;  1YUW A;  4E7H A;  1ITG A;  1RDC A;  3CET A;  3AO5 A;  4FM2 A;  3CF5 L;  4DUZ K;  2YHX A;  2D0P A;  1V4T A;  2D0B A;  1NJX A;  2YKN A;  4CJV A;  1HNX K;  2OZS A;  5KQ8 A;  2PY5 A;  3NMU A;  2B4J A;  4ILG B;  4KKO A;  1C1B A;  3M6G A;  4CF9 A;  4BGA A;  1GLE G;  3TAR A;  4CD3 A; 
#chains in the Genus database with same CATH homology
 2ZM6 K;  4LFB K;  4GKJ K;  1HNW K;  4JI4 K;  3J80 O;  4LF5 K;  2F4V K;  3T1H K;  4DUY K;  4X62 K;  5FLX O;  2E5L K;  1N34 K;  4LF4 K;  4NXN K;  4JI2 K;  3J81 O;  1HR0 K;  2UUC K;  4JI6 K;  4JV5 K;  4DV0 K;  4CVN E;  4B3T K;  4LF7 K;  4DV4 K;  4B3R K;  4X64 K;  3JAM O;  4GKK K;  1XNR K;  4LFC K;  4DV6 K;  5AJ3 K;  4DR7 K;  4AQY K;  1I94 K;  2VQF K;  5LMN K;  2HHH K;  4DV7 K;  4DR2 K;  4DV1 K;  4YY3 K;  2UXB K;  4DV2 K;  1N36 K;  2UUA K;  5LL6 Z;  1HNZ K;  4DR4 K;  1XMQ K;  4KHP K;  4NXM K;  2UXD K;  4OX9 K;  4YHH K;  5A2Q O;  4DR3 K;  4DR5 K;  5IWA K;  2UXC K;  3J7A P;  1FJG K;  4JI0 K;  4DR6 K;  4B3M K;  1IBM K;  4DV5 K;  1J5E K;  4V19 S;  3OTO K;  4B3S K;  1IBK K;  4JI3 K;  2UU9 K;  1N33 K;  3J7Y P;  4DR1 K;  1XMO K;  4JI7 K;  4LF6 K;  3T1Y K;  1XNQ K;  4CW7 B;  1N32 K;  1IBL K;  4DUZ K;  4LFA K;  5IT9 O;  4LF8 K;  4JI1 K;  1HNX K;  5BR8 K;  2UUB K;  2VQE K;  4X66 K;  5LMU K;  4K0K K;  4LF9 K;  4JYA K;  4X65 K;  4DV3 K;  4JI8 K;  4JI5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...