2UUBK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uubK00
1J5EK 4YY3K 4OX9K 4LFBK 1XMQK 1N33K 4JI8K 4NXMK 4GKKK 3OTOK 4LF7K 4AQYK 4CVNE 4DR5K 4DR4K 4DV4K 4LFAK 5LL6Z 4B3MK 4B3SK 1XMOK 4X62K 4DUYK 2F4VK 2UXDK 2VQFK 4DV0K 4LF5K 4V19S 4DV5K 4DR7K 4X64K 4LF6K 4DR1K 4LFCK 5IT9O 5IWAK 5AJ3K 2E5LK 4DV3K 3JAMO 4JI1K 5LMNK 4DV7K 4B3RK 1FJGK 4DV6K 1HNXK 3J80O 1HNZK 2VQEK 1N34K 5LMUK 4JI5K 1IBKK 2ZM6K 4NXNK 4X66K 4DR3K 4B3TK 4GKJK 1XNQK 1N32K 4JYAK 4DR6K 4LF4K 5FLXO 1IBMK 3J7YP 1I94K 1IBLK 1HNWK 2HHHK 2UXCK 4DV2K 4JI2K 4X65K 4DR2K 4JI0K 5A2QO 2UXBK 2UUAK 3T1HK 4JI3K 5BR8K 2UUBK 4KHPK 4YHHK 2UUCK 4JI7K 1XNRK 4CW7B 4JI6K 4LF8K 1HR0K 4LF9K 4JV5K 3J81O 4JI4K 4DUZK 4DV1K 4K0KK 3T1YK 3J7AP 1N36K 2UU9K
chains in the Genus database with same CATH superfamily
3BZKA 3K0SA 1TV6A 1NMDA 2O4GA 2G8FA 3OS1A 3N4PA 4EHUA 4CEQA 2NRHA 4IOXA 5I3UA 4FWKA 3VQ7A 1GLCG 5MLCQ 4OKJA 4Z4EA 1VSEA 3H6EA 3OYKA 4JK7A 3FZFA 5EU7A 3N4QA 2FBYA 3SV3A 1NK7A 3KJVA 3NF9A 4TSXA 3EE9A 4R79A 4B3MK 4BQZA 1C1CA 3K5NA 5M1FA 4FLVA 3A2FA 4F3TA 3V81A 4CECA 2VQFK 4CD1A 1EWQA 4CJVA 3WEEB 4LF5K 4KREA 1HQEA 4KHYA 3PUFA 4FYDA 1KAYA 1QHTA 1IKWA 4M3YA 3DXKB 3VQDA 5AQSA 3P83D 4WYBA 4B1UB 4BGBA 1RTHA 3PV8A 2QK9A 1FJGK 1KTQA 3MAQA 4Z4GA 1YJNN 3ZSYA 4B8AB 3THXA 4JK9A 1TL1A 1WBBA 1J54A 3E1YA 2ATQA 3S41A 2P5GA 4B3TK 4BVOA 1EQYA 1BWFO 3P1GA 5FRNA 1JLCA 3TAGA 1KD1O 1U45A 1OVYA 1K9MO 4NYFA 1RILA 1MU2A 3U6FA 5HRNA 4OPHA 4CJPA 4IG0A 4A2BA 1Q9YA 2A40A 3BZCA 2D0OA 4C23A 4CJLA 5AQJA 3OYEA 1BDGA 4H5NA 3GBTA 3MXJA 4X65K 4FWOA 3OYDA 3PO4A 1J9AA 4AHSA 4FWPA 2NRWA 2NRTA 3EY1A 2UUCK 4FW1A 4JV5K 3QB0A 4WQ4A 2QKBA 1C1BA 3HK2A 5JS2A 3ULEB 1BGXT 3IAYA 2Z1JA 5GIOA 1TAQA 4YY3K 4C1NI 4JKBA 1LAWA 4M41A 4CJRA 1RT7A 1NGCA 3IUCA 3ZSOA 2HBLA 1VQ5N 4AHRA 1D4XA 4ID1A 3M6GA 1K8KA 1NGGA 1GLLO 1TUUA 2KHOA 5C42A 4GKKK 4L3QA 3TANA 1V4TA 2A42A 2ITGA 1BL3A 4H0YB 1JLBA 3U9ZA 3VEOA 4CVNE 4AH9A 1HPZA 3JYTA 2E2OA 3RR8A 3H3NO 5GINA 4DU1A 1LAVA 1I39A 2O8FA 4B1YB 3TAMA 4CBWA 4JKHA 4BRCA 3QFUA 1GLEG 4CIEA 4Z4FA 2NZTA 1A5XA 2P9UB 5KRTA 1IKVA 1X1PA 3L0QA 3KWGA 3HPGA 4BRPA 3DLLL 1KAZA 5K14A 4HHTA 1LWFA 3AVJA 4CEAA 4CD3A 1X9MA 2EHGA 2HNDA 4AM6A 1VQLN 4M3WA 1I3AA 1QZ6A 3SMPA 1Q9XA 2GWJA 1ZC6A 1EX4A 1RGIA 1TKZA 4KB1A 1RDDA 5SWMA 3CD6N 3VN5A 1HJRA 3H1VX 3QEPA 1W0HA 1VQ6N 3BEXA 3DLEA 4FK2A 4DQRA 1RT1A 2QWPA 5KGWA 2FSKA 5ADXH 3V9XA 3FZMA 4EFHA 3ASMA 4C8MA 4CK1A 1OKJA 3DXMB 2D0PA 3O9SA 4FWLA 3OYIA 2O8DA 2CGKA 4H8KA 3T19A 3SJJA 2V51B 4JI3K 1HLUA 4YHHK 3M3ZA 4HUEA 4IG3A 3HBTA 3KZBA 4GV3A 3HYFA 3KTQA 3D2EA 2I7NA 4CGJA 4CHZA 5BPNA 5C0YA 1NK8A 4GW6A 3P4IA 1SV5A 5GAEP 1NGFA 1YVNA 2VGNA 5HRSA 2RE2A 4M63C 5AQLA 1ITGA 3O1BA 1NK9A 3OYCA 1WNSA 1XMQK 3AO4A 4KB0A 3TU5A 1RT6A 3I8BA 3NHGA 1O1WA 4B9VA 3VQBA 3VQ5A 4O5BA 3MDQA 4XH1A 3LM9A 4E1NA 3Q7CA 3AVBA 1BIUA 4B3SK 3VPZA 4MFBA 2I5JA 3WNGA 3HT3A 1EO1A 4F3OA 1NJXA 4W5RA 3AO1A 4DV5K 3OS2A 2OPPA 5GAHP 4DR1K 4WF9L 4LFCK 5JVGL 3LL3A 4CHQA 3LDQA 1YF5L 4G1QA 4H0PA 4K41A 3L2QA 3AVGA 4CJTA 3KVGA 4CF0A 4M3ZA 1HYSA 1RTJA 4E7LA 4JHDA 3ENBA 2HHTA 3QBXA 2VWJA 4JI5K 3FLCO 1JL1A 4JN4A 5GIPA 2HHQA 1A5VA 2A41A 4GKJK 5T7BA 4IBNA 4BRHA 2Q97A 4CGHA 1SUQA 2XY5A 3AVMA 2Z1HA 4WFAL 3P31A 1RDWX 4KH5A 2E1ZA 3ZETB 1ZBSA 4Y1CA 2FBVA 4BR5A 2A6AA 4UQGA 4BRNA 2ZD1A 3AA2A 4CJ3A 4CHNA 2UXCK 5EX5A 5BR9A 1Z05A 3TAFA 2CGLA 4B8CA 3G4SN 3G0ZA 4JD2B 3V9SA 4KHPK 4RTFD 4M7XA 3LZIA 4ELUA 4JI7K 3CQYA 5ELZA 4HTUA 1ASUA 3ZX3A 1NGDA 2FSNA 4FCYA 4C8OA 1D5AA 3KLGA 2V7ZA 3H1QA 3PSIA 3AVCA 1U2VB 3R8EA 3ENHA 2D0AA 4A59A 4UY8O 1ILYA 3B8AX 4RCHA 1DGKN 4PA1A 3TTDA 3G6EN 1N6QA 3QDKA 1NJZA 3FR0A 5KTQA 2OTJN 1TYQB 3ZSRA 2O8EB 4FLWA 2B5JA 4DS4A 1NKEA 4ZTJA 1BO5O 3V9ZA 4AQYK 4DU4A 4DR4K 3NGIA 3NAEA 4WQ5C 4CZIA 1VRTA 3KLIA 4FK4A 4IWVA 4KTQA 3OJSA 1U48A 4FSVA 3ULDA 4J2DA 1IJJA 4DF8A 4LF6K 2HOEA 3BP8A 1RNHA 5IT9O 1MWKA 3LDPA 1M1KO 1QTMA 3A5LC 3CJAA 3P38A 4OJRA 3JS6A 3SCXA 3OYBA 4BRLA 5F1XA 1D8YA 1BIZA 3J80O 3NGZA 3O3HA 1N34K 3H46O 2OZMA 4WCEL 5DMRA 1WOQA 2LSNA 1G15A 1NK4A 1MDUB 3SK3A 1NK6A 3CYMA 2IDOA 5KRSA 1T03A 3VENA 1B9FA 3KLFA 4M3UA 1N32K 5AQZA 5AQIA 3ZSQA 5BPMA 3U9DA 1C0MA 4HWIA 3W0LA 1KRPA 2GUIA 3RMBA 4XH5A 3KK3A 1WB9A 4LF4K 3HOSA 5HLFA 5AQPA 2JWKA 1IBMK 1IKYA 3HM9A 3VQAA 1BISA 3OS0A 3CJCA 1HNWK 1Y97A 2QWOA 3RMDA 3E9LA 2QA4N 4JI2K 1BA1A 4B1ZA 4K8XA 4U7BA 2IC3A 4I6MB 4FZXC 3HTVA 3VA3A 3AA5X 1XQSC 4FVUA 4CFAA 5GADP 3D7EO 1OH6A 2DFFA 1U47A 3D2FA 1VSHA 3T1YK 4CEFA 4C1NK 1GLJO 5C12A 3QIOA 4AF1A 4MDBA 5JLHA 2HBMA 4CI6A 1NM1A 5AZJB 1JLFA 3ZYYX 4CFDA 5HRRA 4IFEA 4BRFA 4BVPA 1NJYA 3QERA 3CC4N 4CEEA 4CJ7A 5H1SQ 4DHYA 2YHBA 1HX1A 4Z4CA 4F4KA 3FGUA 4OKKA 1C6VA 2Q1NA 2ITMA 5JMVA 5J1EA 3CFRA 1WLJA 2QTDA 3M8RA 1C1AA 1Q7YO 4Q0BA 3I56N 1NOZA 3KIOA 2ZJRL 3HZ6A 1KXPA 1W2BM 2ZQBA 2KFNA 2OCEA 1KQSM 4NB4A 1KAXA 1JXEA 1KLMA 5AJ3K 4NYNA 1ZXOA 5FPEA 4PWDA 4CJSA 4FJLA 2WFBA 1N5YA 3PO5A 3TARA 1S3XA 3HO1A 4DSFA 4B1VA 3VQ8A 2R7YA 1J6ZA 3L2UA 3ZT0A 5LMUK 1TGOA 3TPQA 1W7AA 3P39A 4E1MA 4FWNA 3THWA 4NXNK 1DEJA 2HHVA 2O8BB 2OPSA 4BG9A 4DU3A 3BF3A 4MLHA 3IMXA 5AQKA 1IKXA 1BI4A 2XY8A 3C6HA 3MEDA 2XHBA 4EP4A 5SZTA 1D9FA 1RDUA 2NRZA 3OYGA 3L8BA 5AQFA 3OYHA 1Q18A 4Q5VA 3NH2A 1S72N 3J7YP 2O8CB 4QS7A 5BRHA 2FF6A 3DLKA 4KAZA 4FM1A 3ATUA 4M7YA 1TK5A 3MWPA 2F8SA 1UWBA 2WONA 4CEZA 3VQ4A 5AQQA 2EWSA 1W97L 4CF9A 3NE6A 3T1HK 4CHPA 2P1JA 4KO0A 3FZHA 4KRFA 3UE5A 4NO7A 3AV9A 3VEVA 1TUYA 3MXMA 3OVNA 5E26A 3J7AP 2GX9A 3LAKA 3I0SA 3O6WA 4N56A 3CXCM 1L3VA 2QEXN 3AVHA 3O4WA 3DYAA 5J2PA 2CH5A 4DB3A 2P9LA 2P9PA 3ID6A 3LZJA 2Y1JA 4LY7A 1SL0A 4DF4A 4NXMK 3ZEUB 4ISEA 1VQ7N 4FLXA 1QE1A 2W6LA 3L2VA 3AVFA 3CCQN 3QICA 3B6PA 4OLBA 3E66A 4BDYA 1RT4A 5KPZA 4KHUA 3MECA 4Z94A 4A5BA 3KLEA 4L8RB 4B9SA 2RF2A 4IEIA 3G71N 2F8TA 1NK0A 3BDPA 2QWQA 3PX4A 2OZSA 1XC9A 5AQMA 4FWMA 1NJIO 4BC5A 2AA4A 1NJWA 5EXWA 3GL1A 1YI2N 4B3RK 2P9IA 4QAGA 3DOKA 1C0TA 1NKCA 3FFKB 4E0DA 2NNWA 5AFUH 3TTFA 3CC7N 5KPTA 5EVZA 1VSDA 1T6CA 3CHWA 4YOWA 2VCPA 2G8VA 2E8AA 3OY9A 3F9KA 1ATRA 4IO8A 3CCLN 4FJJA 2F9TA 5AFUA 1Y64A 3EEQA 4DFMA 2E1YA 2Q31A 4C8KA 4K8ZA 2CGJA 2P5OA 4OPKA 2QXFA 2CH6A 1VSLA 4N5SA 4JKGA 1JLQA 1VSKA 3OYAA 3FE1A 1RDAA 5EOYA 5KPRA 2ASMA 4XEIA 2BUPA 3IG1A 3VTHA 2ZJPL 1NMNA 3AARA 2Z1IA 1FK9A 1S1WA 3Q7BA 3GDQA 2YKMA 3KK7A 1VQPN 1GLBG 4WFBL 1DTTA 4RWTA 4AHVA 3ZCMA 1SL1A 4LF7K 1M90O 3SQ0A 4IFYA 4DR5K 2OPRA 4DV4K 1C0GA 4X62K 4BR7A 1SQKA 1X3MA 5F2RA 1SKSA 3C7NB 3UKRA 4YFUA 1P90A 4BC2A 4A62A 1U4BA 4HUGA 4DTRA 1RTIA 3L6QA 4Y1DA 1JLEA 2RPIA 3MCAB 3QEXA 2ASPA 4BY9C 4EHTA 3OYLA 3MN5A 1IH7A 4QS9A 3ALYA 3SBTA 3RSEB 3AAQA 1UA1A 5E41A 4IFVA 1RBSA 3V4IA 1KVBA 2IVOA 1YHQN 3CM5A 3THYB 3T69A 3AVNA 4CJFA 4H0VB 1VSJA 2Z1GA 1B92A 1YVUA 4GV6A 4M42A 1TVRA 2WTUA 3O1WA 3S3OA 3NDKA 3SUQA 5DK5A 5CZ2A 5JVHL 1BG3A 4CZLA 4HCBA 3AAPA 3LP1A 4FM2A 3WNEA 4DR6K 1W9HA 4E7JA 1RDCA 3JSMA 3UKUB 3DRRA 5AQTA 4ISFA 1LCUA 3QMLA 4DV2K 2YCHA 4JS4A 3LAMA 3IFRA 5AZIB 3SBGA 4DKWA 4JEPA 4ILGB 4H4OA 3ZSWA 3WXLA 4DSKA 2P9KA 3CMAN 1KFSA 1YTAA 4JK8A 4DUZK 3R6MA 1GLAG 3SLCA 4CGFA 3VA0A 1NOYA 4K43A 3G25A 4J2EA 4DFKA 3FFIA 1HYVA 4W5NA 2AJQA 3NCIA 5J2QA 4CK3A 4I2PA 4EP5A 4M45A 1BHLA 3KK1A 4YDUC 1WSHA 3V6DA 3QFPA 1VRUA 3HSTB 2HHUA 1GOAA 4RW8A 4ICLA 4O4GA 3WQUA 1RT2A 3WEEA 4DTUA 3VEXA 2F96A 4RG8A 2F4VK 4C8LA 3C6TA 1JLGA 2HHXA 5I42A 3L4IA 1S5JA 3QNOA 3DXKA 5M1QA 4JKEA 3NH0A 3MEGA 1NGJA 3F9MA 1QVFM 4FPBA 1R0AA 1LW2A 4FJ7A 1LW0A 2D1KA 5C2FA 5DM7L 3SQ1A 4ZTFA 3V9WA 5AQGA 2ZWHA 1XHZA 4DV6K 2E4LA 4EZ9A 1F21A 1E4GT 4G9ZA 4JAXA 1L3UA 3OJUA 1HNVA 3CIPA 2BE2A 1Z25A 4DQ8A 3HOTA 4PY5A 4NLBA 4DQIA 4EAHD 4H4MA 4CZEA 4B9TA 3LP0A 4JYAK 3OBYA 1ZBUA 2P9NB 4DMNA 5BN8A 2QWLA 4CCHA 4GV9A 1S1XA 4CZMA 4BRKA 4O0IA 5KQ8A 5CR4A 1JL2A 3VTIA 4CK2A 2V52B 2FLOA 4DSLA 4YNQA 4HTLA 1CZAN 1Q81O 3A5OC 3VF6A 1XNRK 4YOYA 2KQ2A 4JI6K 3ULEA 3EKUA 3QEIA 4MLEA 5B8HA 4XH4A 1KVCA 3ZSZA 3L2WA 3ZT3A 3VOVA 5HRPA 3P5JA 4EIAA 4CF1A 4A57A 4J2AA 1BCMA 5C15A 1VQ9N 4RW6A 2HNZA 4FJXA 3EE8A 1QQMA 1BU6O 1CXUA 3OBWA 3MX5A 4CJ5A 4JI8K 3HI0A 2DFHA 4FL9A 4BRGA 1NWKA 4FJIA 4DUYK 5FPDA 1WAFA 4Z0UA 4KHSA 1REVA 1O13A 4I2QA 2HBJA 2P9UA 4IO9L 1S9EA 1ATNA 3QNNA 3KHYA 3BF1A 4FXDA 4OLAA 3CI5A 4JNEA 3TR8A 3NF6A 5BN9A 3CETA 1JXBA 3J7ZO 3SYZA 3SMSA 3CCVN 3K59A 2YNFA 1HPMA 3CJ9A 3H08A 1L3TA 1DKGD 1NG9A 1RBTA 3CCMN 3K58A 1MWMA 1RBRA 2A5XA 2YHYA 4IEEA 2QKKA 1GLFO 4K42A 4U67L 1YAGA 4QOZB 1HQUA 5LJWA 3CF5L 3S3NA 3DWLA 3M8PA 5HBMA 1S6PA 2Q36A 4J8FA 4JRQA 3AO3A 4DG1A 4H0XB 3QEWA 3DXMA 1NGEA 4CJ4A 4KV8A 1B9DA 3MN7A 2BDPA 3O9RA 3LDLA 4LD0A 1XWLA 2FBTA 5C2DA 2QWNA 3L2RA 2V7YA 2UUAK 4B9LA 2J4RA 3C0BA 4CW7B 4CBXA 3J81O 5FPMA 3V9UA 3OA9A 4KPYA 4K0KK 3VGLA 3DJCA 2W6KA 2E2PA 2P9SB 1L5UA 4CESA 2QWRA 3GOIA 5HP1A 1NGAA 2YJEA 2BGGA 1LWEA 5M1PA 1U6ZA 4E7HA 2E2NA 4YOTA 1ZBFA 4I7FA 3K57A 3WXJA 3R3LA 4FW2A 1TAUA 4WQ4C 4KHQA 3RR7A 5FDLA 3ZSXA 5HROA 4FPAA 1XMOK 5BRFA 4V19S 3HRGA 2VG5A 4X64K 3R1XA 1XHXA 3DRPA 3O9TA 3OW2M 2Q2RA 5D3GA 3S9HA 5M1NA 2E5LK 3E9PA 3VQEA 4BC4A 2DY4A 3JAMO 3AVLA 4DSIA 4NLCA 1HKGA 2IS3A 2G8KA 3ITHA 4KBOA 3WQTA 5I9EB 4I9LA 3AO5A 4WE1A 4YOVA 2X6SA 3AY9A 1IBKK 3C95A 3VQ9A 4FJ8A 4X66K 3TWHA 4DR3K 3THXB 3U3YA 4BRIA 4ELTA 3PX6A 5BRDA 2QM1A 1IO2A 3ZETA 3EN9A 1LWCA 3TAQA 3E9OA 2GELA 2RKIA 4BGAA 4B1XB 4B9QA 4JS5A 3CG7A 4CZGA 1XC3A 4KFBA 3S3MA 4CGDA 4E89A 4PL8A 4DSEA 3DLHA 4NCGA 1I94K 4BE0A 4N47A 4GMJB 4OPJA 1QSLA 1VQ8N 2HSTA 4H03B 3DOLA 1IV0A 4GNIA 3AGRA 4QS8A 5F0XA 1OH5A 4JI0K 2KZZA 1HNIA 2PYLA 5LY3A 1KFDA 3EZWA 3WXIA 4A61A 4IJNA 2ZJQL 1U2VA 1TKXA 2XRIA 2YNIA 3K5MA 2E88A 3MXIA 2FBXA 4KH4A 5AQWA 3NH1A 5AQUA 2NRXA 4HUFA 4E1JA 1TYQA 2O8EA 4W5TA 3RWUA 2QXLA 3DLGA 4PKHA 1RT5A 1T8EA 1DTQA 3UIQA 1YXQA 1XI1A 2PZSA 1K8KB 4NCAA 1WSFA 3ZT2A 2JWLA 3CCEN 3LDNA 1JLAA 4FWSA 3C65A 1Q82O 4BROA 3WNFA 2Q3SA 2O8FB 1CLQA 3DLBA 5FRMA 4JRPA 3L3VA 3TSUA 1YTUA 1DLOA 4YORA 1K6YA 3PSFA 2RN2A 2QI2A 1WN7A 3RMCA 1YJWN 3HVRA 3UB5A 5J2MA 1X3NA 4YOUA 2JLEA 1T3VA 3DI6A 4RW4A 4FK0A 5CY4A 1HYZA 2O4IA 4MDAA 3SQ2A 3CJ7A 2YX6A 3O5BA 4BRDA 2YKNA 4DCHA 4E3SA 3U4LA 3KK2A 3HPHA 4O0JA 3CFOA 2PY5A 1HRHA 3O80A 5JS1A 4FJ5A 3U8XA 3SPZA 4BC3A 1T7PA 4W5OA 3SJHA 3OYJA 4FJHA 4PKIA 4IXCA 3LANA 3BY5A 4I6MA 3QIPA 3LDSA 1VK0A 4H5RA 1T44A 4BACA 4DR2K 1J53A 3U3GA 1VSFA 3LP3A 5AQVA 4KI6A 2UUBK 4FLZA 1CXQA 2O8DB 1WSGA 3RVCA 1DT9A 2XY7A 4BR4A 3MWTA 3VF2A 3NVKA 3O9QA 4WQ5A 5EY4A 3C6UA 3SAHA 3NGYA 5AZJA 3D2EB 3JXUA 3K9KA 3T3FA 2YNGA 5BPLA 1J5EK 2E6MA 4IDKA 1T6DA 3NBPA 3IKMA 5JICA 5CHIA 4DSJA 4BREA 2D0BA 5C24A 4FJKA 3VQ6A 4CF8A 1N33K 1WAJA 1X9JA 4CFBA 2YJFA 1JCGA 3A5NC 5CE3A 1YITN 3HJFA 1BA0A 3PIOL 2ETJA 4K25A 1EP4A 3VQQA 5LL6Z 2W42A 1S1VA 3CM6A 3O3FA 1K73O 1NU0A 3O08A 3TSPA 1TKDA 1YUWA 4DR7K 5J2NA 3L3UA 3MN9A 4MO5A 1TL3A 4JKAA 3CPWM 4KTZA 1X9WA 3QLHA 2ZE2A 4B1WB 2IOCA 2F7TA 2FF3B 1RFQA 3M5RA 1C0FA 3SNNA 2GWKA 1JCFA 1ATSA 1BQNA 2O8BA 2VG6A 2ZGYA 3GE1A 4JHDB 4H5TA 1E3MA 3NF7A 4JKCA 3HP6A 3ZSVA 5AQHA 1QQCA 4A2AA 1VSIA 4FOIA 4OPAA 2BH1A 3BGRA 3K5LA 3SI6A 2O8CA 4KI4A 4DQSA 2D5RA 3EL2A 2GEMA 4R5PA 4CBUA 2B4JA 4FLTA 3K5OA 4PHTX 1FXXA 1LOTB 2OPQA 1S22A 3CCUN 4RW7A 5BR8K 4F8RA 1NBWA 2NUBA 1NNEA 4CE9A 3FZLA 4FLYA 2VYPA 2PYJA 4IDHA 4E7KA 5HOOA 5FROA 4MO4A 1H1VA 4ELVA 4OKEA 2DFEA 1JCEA 1FW6A 4LFBK 1Z6RA 1QQNA 4FJNA 1XUPO 2YHWA 1NGHA 3AVKA 4WFNL 3THVA 1RBUA 4LC9B 3ZEUA 4CZHA 2I7PA 2GV9A 1SS6A 3R9PA 4CEDA 3OTOK 3B6OA 5BREA 4MQ3A 2P51A 4RW9A 1EXQA 4JKDA 2PAVA 2KTQA 4O5FA 1BQMA 5CYQA 3LWLA 3KLHA 2X6NA 3PIPL 4B9UA 1RTDA 3M1FA 3PY8A 4IOAL 1SKRA 2X74A 1HKCA 3VEYA 2FC0A 4BQLA 5DM6L 1E4FT 1VQON 3MEEA 5IWAK 3ZLJA 1VQMN 1U49A 1ASWA 4EZ6A 1SL2A 4N41A 4FOEA 3O3GA 3KKRA 5LMNK 4KKOA 3NFAA 3IDHA 2WBNA 3SQ4A 2D4WA 4DTNA 1HNXK 3HSCA 4BR0A 1VHXA 3QINA 2YNHA 2H3GX 3D45A 2DPNA 3LP2A 3CMEN 1RDBA 3HXMA 3EO3A 4ILJA 3ZT4A 3VGMA 1K8AO 2HMIA 2WC9A 4CEBA 4JLHA 3I0RA 4BDPA 5ADXA 1TK8A 4FLUA 1KC8O 4CF2A 2HHWA 2DTUA 3NVMA 1VAZA 3VMFB 1OH7A 3F73A 4GVMA 4M3TA 3D0PA 4DLEA 4H5VA 1HJOA 2UYTA 4CZKA 3QBWA 4CEOA 1QSYA 3KKSA 4J2BA 4GVEA 4AHCA 3G10A 3VERA 1ZBLA 4BR2A 3TSQA 1QHAA 4OGCA 5E84A 3EZ5A 4Z4IA 1HKBA 5C10A 2HHSA 2IVPA 1S1TA 3CERA 3SAFA 3RTVA 1VQKN 1KCFA 3WXMB 3AA4A 3OYFA 3M8SA 2UXBK 3D2FB 3ISNC 4ZHRA 5AQXA 4AM7A 3C6AA 1UAXA 1KVAA 4KTWA 2G8IA 3OYMA 1CZ9A 4DLGA 3VGKA 1QSSA 4IKFA 2E20A 4DFJA 3QO9A 4PKGA 1NGBA 3SAGA 2JGUA 3LPTA 4CGGA 1OH8A 3CJBA 4FWRA 3CQ8A 3SUOA 4Y0WA 3BUZB 2BANA 1WBDA 1NKBA 4IZ9A 2ASOA 3PLAA 3C7NA 3CCRN 3A5MC 2YI1A 3A8YA 1WSEA 2QWMA 1OVQA 3CCJN 3CJ1A 3NMUA 4H5WA 2VWBA 4AHTA 4H0TB 3HM8A 3RSEA 1HUXA 4HCCA 1G99A 3RRHA 3ENOA 2KFZA 1BOTO 4JI1K 4NCBA 1NGIA 3THYA 2IVNA 5AQOA 1KSPA 4CFCA 5LJVA 4DS5A 1BUPA 3ZX2A 3E01A 1X9SA 3EKSA 3I55N 4CJEA 4M3RA 3LWMA 4H0OA 1YIJN 3HPOA 4KHWA 3I8DA 3WXKA 1EKEA 3THWB 3A0IX 3AA3A 3ID8A 4CHYA 2W40A 1XNQK 1Z26A 4DTJA 4M3XA 2EX3A 1IG9A 1ZBHA 3UKUA 4DTMA 3TABA 1FKPA 1BI4B 4BRQA 2PBDA 3WNHA 4IJAA 3VQCA 1CZBA 1S1UA 2HHHK 4YOXA 3DMJA 2HBKA 5AZIA 1ESVA 2E2QA 4N76A 2D0CA 3KD5E 4FJGA 1NLVA 4B3OA 2Q0UA 3O4NA 1Q8IA 3TAPA 4A5AA 4BE1A 4BWMA 3SUPA 3RRGA 2HB5A 3CC2N 1GLDG 3C94A 3KD1E 4CJWA 4CJQA 1N8RO 4LF9K 2KKZA 3PX0A 4DTXA 3KWIA 2VWKA 5C25A 3H45C 1N36K 5AR0A 2UU9K 2G8HA 4B9MA 4OX9K 3VESA 1GOCA 3V1OA 1P8ZA 2Y1IA 4KHNA 3AVAA 2HNYA 2GUPA 2E6LA 3GG4A 2P9LB 2F9WA 2P9PB 3SV4A 1D9DA 1MA9B 1VSMA 1Q86O 1EWRA 4O44A 4AHUA 2HF3A 4BDZA 4LSLA 4CZJA 4LFAK 4FWQA 4F2RA 3HL8A 1QZ5A 2B6AA 4JKFA 2NRRA 4DV0K 3O9UA 3I33A 1IG8A 4O8UA 1WSJA 1UA0A 3ZX0A 1SKWA 3T7ZA 3VEZA 1ZBIA 2HW3A 4B08A 3AO2A 1L3SA 4KH6A 2NRVA 4O55A 1QVGM 3SUNA 2VG7A 4OO1J 4BRAA 3QETA 4GY2B 3DM2A 5AQRA 3AVIA 3ZT1A 4FJMA 1TK0A 3O4QA 4OGEA 2AP1A 2P9IB 3EYZA 3CFPA 4CZFA 4CJKA 3VQPA 3WUHA 4F9OA 4FVMA 4DTPA 4DFPA 3TTCA 5HL7L 3QEVA 5CYMA 2P9NA 3TI0A 3J8AA 3OHRA 2YV0X 2IAJA 2HVIA 1QS4A 3D6RA 2HMPA 3H3OB 2HVHA 1J5OA 3OYNA 5KGXA 4FM0A 2GBZA 1JKHA 4CERA 5JLFA 3CCSN 1SAZA 5AQNA 1ASVA 3IRXA 5AQYA 2WUSA 2GTDA 3F5TA 5TKYA 5KQDA 5A2QO 3FZKA 4YDUA 2RHKA 1YT3A 4CHOA 3MX2A 2YHXA 1HR0K 4JKGB 2BTFA 3TAEA 3CPEA 4JI4K 5M1OA 4E19A 1FKOA 2A1SA 1U04A 3LM2A 5CZ1A 4FJ9A 2WOMA 4F2SA 2HF4A 3DLRA 3LPUA 2VGMA 4QCLA 4DV1K 3MK6A 3SZ2A 1UOCA 4AILC 3M8QA 5M1KA 3O8MA 4JD2A 1T05A 4DTSA 2A3ZA 3F2KA 4IOCL 2A1RA 5TKWA 2IIRA 3V1QA 3LDOA 1A5WA 2X78A 2UXDK 1VQNN 4BE2A 4CJUA 3VEWA 2ZF5O 5KI6A 4LH4A 3MMVA 4CIFA 3K2PA 2W41A 4E7IA 2FXUA 3UKRB 2KLAA 3LALA 1GOBA 1S9GA 2FSJA 1VQ4N 2QW9A 5GAGP 3DRSA 4O8KA 4BWJA 4DV3K 4BRMA 4Z4HA 1S6QA 2G8WA 4DV7K 2G8UA 3VETA 3V1RA 1EETA 2KW4A 1ZYQA 1YJ9N 3DAWA 2ZGZA 1HNZK 2VQEK 4I9QA 4BR9A 4PQUA 1SZ2A 3L4QA 3NF8A 3QESA 3RMAA 2ZM6K 1HMVA 2XO7A 2YHAA 4FO0A 4OVLA 1C0UA 2OYQA 3VF4A 4FZYA 1R59O 1RBVA 1WUAA 4LH5A 4FZZA 4ID5A 2OTLN 2PFUA 1BCOA 1RT3A 4CIGA 1RCHA 3K9JA 3T1AA 3IS9A 2NLXA 5FLXO 1QQOA 4DWIA 2KZMA 3WT0A 4HVJA 1IBLK 3W3DA 4DQPA 4XIUA 3HVTA 4LSNA 4CGIA 1V4SA 1NK5A 3SPYA 3MN6A 3HP9A 3ATVA 4ILHA 4C8NA 4B9NA 1TKTA 4PL7A 4W5QA 3AGKA 2OANA 4DQQA 4PUOA 4LF8K 1LV5A 4ISGA 3MCPA 1KLNA 2OA8A 5FPNA 4DTOA 2P9SA 1JJ2M 4BG8A 2Q0RA 2XY6A 3CQXA 1WSIA 2P9KB 2IGIA
chains in the Genus database with same CATH topology
1J5EK 4YY3K 4OX9K 4LFBK 1XMQK 1N33K 4JI8K 4NXMK 4GKKK 3OTOK 4LF7K 4AQYK 4CVNE 4DR5K 4DR4K 4DV4K 4LFAK 5LL6Z 4B3MK 4B3SK 1XMOK 4X62K 4DUYK 2F4VK 2UXDK 2VQFK 4DV0K 4LF5K 4V19S 4DV5K 4DR7K 4X64K 4LF6K 4DR1K 4LFCK 5IT9O 5IWAK 5AJ3K 2E5LK 4DV3K 3JAMO 4JI1K 5LMNK 4DV7K 4B3RK 1FJGK 4DV6K 1HNXK 3J80O 1HNZK 2VQEK 1N34K 5LMUK 4JI5K 1IBKK 2ZM6K 4NXNK 4X66K 4DR3K 4B3TK 4GKJK 1XNQK 1N32K 4JYAK 4DR6K 4LF4K 5FLXO 1IBMK 3J7YP 1I94K 1IBLK 1HNWK 2HHHK 2UXCK 4DV2K 4JI2K 4X65K 4DR2K 4JI0K 5A2QO 2UXBK 2UUAK 3T1HK 4JI3K 5BR8K 2UUBK 4KHPK 4YHHK 2UUCK 4JI7K 1XNRK 4CW7B 4JI6K 4LF8K 1HR0K 4LF9K 4JV5K 3J81O 4JI4K 4DUZK 4DV1K 4K0KK 3T1YK 3J7AP 1N36K 2UU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E K;  4YY3 K;  4OX9 K;  4LFB K;  1XMQ K;  1N33 K;  4JI8 K;  4NXM K;  4GKK K;  3OTO K;  4LF7 K;  4AQY K;  4CVN E;  4DR5 K;  4DR4 K;  4DV4 K;  4LFA K;  5LL6 Z;  4B3M K;  4B3S K;  1XMO K;  4X62 K;  4DUY K;  2F4V K;  2UXD K;  2VQF K;  4DV0 K;  4LF5 K;  4V19 S;  4DV5 K;  4DR7 K;  4X64 K;  4LF6 K;  4DR1 K;  4LFC K;  5IT9 O;  5IWA K;  5AJ3 K;  2E5L K;  4DV3 K;  3JAM O;  4JI1 K;  5LMN K;  4DV7 K;  4B3R K;  1FJG K;  4DV6 K;  1HNX K;  3J80 O;  1HNZ K;  2VQE K;  1N34 K;  5LMU K;  4JI5 K;  1IBK K;  2ZM6 K;  4NXN K;  4X66 K;  4DR3 K;  4B3T K;  4GKJ K;  1XNQ K;  1N32 K;  4JYA K;  4DR6 K;  4LF4 K;  5FLX O;  1IBM K;  3J7Y P;  1I94 K;  1IBL K;  1HNW K;  2HHH K;  2UXC K;  4DV2 K;  4JI2 K;  4X65 K;  4DR2 K;  4JI0 K;  5A2Q O;  2UXB K;  2UUA K;  3T1H K;  4JI3 K;  5BR8 K;  2UUB K;  4KHP K;  4YHH K;  2UUC K;  4JI7 K;  1XNR K;  4CW7 B;  4JI6 K;  4LF8 K;  1HR0 K;  4LF9 K;  4JV5 K;  3J81 O;  4JI4 K;  4DUZ K;  4DV1 K;  4K0K K;  3T1Y K;  3J7A P;  1N36 K;  2UU9 K; 
#chains in the Genus database with same CATH topology
 3BZK A;  3K0S A;  1TV6 A;  1NMD A;  2O4G A;  2G8F A;  3OS1 A;  3N4P A;  4EHU A;  4CEQ A;  2NRH A;  4IOX A;  5I3U A;  4FWK A;  3VQ7 A;  1GLC G;  5MLC Q;  4OKJ A;  4Z4E A;  1VSE A;  3H6E A;  3OYK A;  4JK7 A;  3FZF A;  5EU7 A;  3N4Q A;  2FBY A;  3SV3 A;  1NK7 A;  3KJV A;  3NF9 A;  4TSX A;  3EE9 A;  4R79 A;  4B3M K;  4BQZ A;  1C1C A;  3K5N A;  5M1F A;  4FLV A;  3A2F A;  4F3T A;  3V81 A;  4CEC A;  2VQF K;  4CD1 A;  1EWQ A;  4CJV A;  3WEE B;  4LF5 K;  4KRE A;  1HQE A;  4KHY A;  3PUF A;  4FYD A;  1KAY A;  1QHT A;  1IKW A;  4M3Y A;  3DXK B;  3VQD A;  5AQS A;  3P83 D;  4WYB A;  4B1U B;  4BGB A;  1RTH A;  3PV8 A;  2QK9 A;  1FJG K;  1KTQ A;  3MAQ A;  4Z4G A;  1YJN N;  3ZSY A;  4B8A B;  3THX A;  4JK9 A;  1TL1 A;  1WBB A;  1J54 A;  3E1Y A;  2ATQ A;  3S41 A;  2P5G A;  4B3T K;  4BVO A;  1EQY A;  1BWF O;  3P1G A;  5FRN A;  1JLC A;  3TAG A;  1KD1 O;  1U45 A;  1OVY A;  1K9M O;  4NYF A;  1RIL A;  1MU2 A;  3U6F A;  5HRN A;  4OPH A;  4CJP A;  4IG0 A;  4A2B A;  1Q9Y A;  2A40 A;  3BZC A;  2D0O A;  4C23 A;  4CJL A;  5AQJ A;  3OYE A;  1BDG A;  4H5N A;  3GBT A;  3MXJ A;  4X65 K;  4FWO A;  3OYD A;  3PO4 A;  1J9A A;  4AHS A;  4FWP A;  2NRW A;  2NRT A;  3EY1 A;  2UUC K;  4FW1 A;  4JV5 K;  3QB0 A;  4WQ4 A;  2QKB A;  1C1B A;  3HK2 A;  5JS2 A;  3ULE B;  1BGX T;  3IAY A;  2Z1J A;  5GIO A;  1TAQ A;  4YY3 K;  4C1N I;  4JKB A;  1LAW A;  4M41 A;  4CJR A;  1RT7 A;  1NGC A;  3IUC A;  3ZSO A;  2HBL A;  1VQ5 N;  4AHR A;  1D4X A;  4ID1 A;  3M6G A;  1K8K A;  1NGG A;  1GLL O;  1TUU A;  2KHO A;  5C42 A;  4GKK K;  4L3Q A;  3TAN A;  1V4T A;  2A42 A;  2ITG A;  1BL3 A;  4H0Y B;  1JLB A;  3U9Z A;  3VEO A;  4CVN E;  4AH9 A;  1HPZ A;  3JYT A;  2E2O A;  3RR8 A;  3H3N O;  5GIN A;  4DU1 A;  1LAV A;  1I39 A;  2O8F A;  4B1Y B;  3TAM A;  4CBW A;  4JKH A;  4BRC A;  3QFU A;  1GLE G;  4CIE A;  4Z4F A;  2NZT A;  1A5X A;  2P9U B;  5KRT A;  1IKV A;  1X1P A;  3L0Q A;  3KWG A;  3HPG A;  4BRP A;  3DLL L;  1KAZ A;  5K14 A;  4HHT A;  1LWF A;  3AVJ A;  4CEA A;  4CD3 A;  1X9M A;  2EHG A;  2HND A;  4AM6 A;  1VQL N;  4M3W A;  1I3A A;  1QZ6 A;  3SMP A;  1Q9X A;  2GWJ A;  1ZC6 A;  1EX4 A;  1RGI A;  1TKZ A;  4KB1 A;  1RDD A;  5SWM A;  3CD6 N;  3VN5 A;  1HJR A;  3H1V X;  3QEP A;  1W0H A;  1VQ6 N;  3BEX A;  3DLE A;  4FK2 A;  4DQR A;  1RT1 A;  2QWP A;  5KGW A;  2FSK A;  5ADX H;  3V9X A;  3FZM A;  4EFH A;  3ASM A;  4C8M A;  4CK1 A;  1OKJ A;  3DXM B;  2D0P A;  3O9S A;  4FWL A;  3OYI A;  2O8D A;  2CGK A;  4H8K A;  3T19 A;  3SJJ A;  2V51 B;  4JI3 K;  1HLU A;  4YHH K;  3M3Z A;  4HUE A;  4IG3 A;  3HBT A;  3KZB A;  4GV3 A;  3HYF A;  3KTQ A;  3D2E A;  2I7N A;  4CGJ A;  4CHZ A;  5BPN A;  5C0Y A;  1NK8 A;  4GW6 A;  3P4I A;  1SV5 A;  5GAE P;  1NGF A;  1YVN A;  2VGN A;  5HRS A;  2RE2 A;  4M63 C;  5AQL A;  1ITG A;  3O1B A;  1NK9 A;  3OYC A;  1WNS A;  1XMQ K;  3AO4 A;  4KB0 A;  3TU5 A;  1RT6 A;  3I8B A;  3NHG A;  1O1W A;  4B9V A;  3VQB A;  3VQ5 A;  4O5B A;  3MDQ A;  4XH1 A;  3LM9 A;  4E1N A;  3Q7C A;  3AVB A;  1BIU A;  4B3S K;  3VPZ A;  4MFB A;  2I5J A;  3WNG A;  3HT3 A;  1EO1 A;  4F3O A;  1NJX A;  4W5R A;  3AO1 A;  4DV5 K;  3OS2 A;  2OPP A;  5GAH P;  4DR1 K;  4WF9 L;  4LFC K;  5JVG L;  3LL3 A;  4CHQ A;  3LDQ A;  1YF5 L;  4G1Q A;  4H0P A;  4K41 A;  3L2Q A;  3AVG A;  4CJT A;  3KVG A;  4CF0 A;  4M3Z A;  1HYS A;  1RTJ A;  4E7L A;  4JHD A;  3ENB A;  2HHT A;  3QBX A;  2VWJ A;  4JI5 K;  3FLC O;  1JL1 A;  4JN4 A;  5GIP A;  2HHQ A;  1A5V A;  2A41 A;  4GKJ K;  5T7B A;  4IBN A;  4BRH A;  2Q97 A;  4CGH A;  1SUQ A;  2XY5 A;  3AVM A;  2Z1H A;  4WFA L;  3P31 A;  1RDW X;  4KH5 A;  2E1Z A;  3ZET B;  1ZBS A;  4Y1C A;  2FBV A;  4BR5 A;  2A6A A;  4UQG A;  4BRN A;  2ZD1 A;  3AA2 A;  4CJ3 A;  4CHN A;  2UXC K;  5EX5 A;  5BR9 A;  1Z05 A;  3TAF A;  2CGL A;  4B8C A;  3G4S N;  3G0Z A;  4JD2 B;  3V9S A;  4KHP K;  4RTF D;  4M7X A;  3LZI A;  4ELU A;  4JI7 K;  3CQY A;  5ELZ A;  4HTU A;  1ASU A;  3ZX3 A;  1NGD A;  2FSN A;  4FCY A;  4C8O A;  1D5A A;  3KLG A;  2V7Z A;  3H1Q A;  3PSI A;  3AVC A;  1U2V B;  3R8E A;  3ENH A;  2D0A A;  4A59 A;  4UY8 O;  1ILY A;  3B8A X;  4RCH A;  1DGK N;  4PA1 A;  3TTD A;  3G6E N;  1N6Q A;  3QDK A;  1NJZ A;  3FR0 A;  5KTQ A;  2OTJ N;  1TYQ B;  3ZSR A;  2O8E B;  4FLW A;  2B5J A;  4DS4 A;  1NKE A;  4ZTJ A;  1BO5 O;  3V9Z A;  4AQY K;  4DU4 A;  4DR4 K;  3NGI A;  3NAE A;  4WQ5 C;  4CZI A;  1VRT A;  3KLI A;  4FK4 A;  4IWV A;  4KTQ A;  3OJS A;  1U48 A;  4FSV A;  3ULD A;  4J2D A;  1IJJ A;  4DF8 A;  4LF6 K;  2HOE A;  3BP8 A;  1RNH A;  5IT9 O;  1MWK A;  3LDP A;  1M1K O;  1QTM A;  3A5L C;  3CJA A;  3P38 A;  4OJR A;  3JS6 A;  3SCX A;  3OYB A;  4BRL A;  5F1X A;  1D8Y A;  1BIZ A;  3J80 O;  3NGZ A;  3O3H A;  1N34 K;  3H46 O;  2OZM A;  4WCE L;  5DMR A;  1WOQ A;  2LSN A;  1G15 A;  1NK4 A;  1MDU B;  3SK3 A;  1NK6 A;  3CYM A;  2IDO A;  5KRS A;  1T03 A;  3VEN A;  1B9F A;  3KLF A;  4M3U A;  1N32 K;  5AQZ A;  5AQI A;  3ZSQ A;  5BPM A;  3U9D A;  1C0M A;  4HWI A;  3W0L A;  1KRP A;  2GUI A;  3RMB A;  4XH5 A;  3KK3 A;  1WB9 A;  4LF4 K;  3HOS A;  5HLF A;  5AQP A;  2JWK A;  1IBM K;  1IKY A;  3HM9 A;  3VQA A;  1BIS A;  3OS0 A;  3CJC A;  1HNW K;  1Y97 A;  2QWO A;  3RMD A;  3E9L A;  2QA4 N;  4JI2 K;  1BA1 A;  4B1Z A;  4K8X A;  4U7B A;  2IC3 A;  4I6M B;  4FZX C;  3HTV A;  3VA3 A;  3AA5 X;  1XQS C;  4FVU A;  4CFA A;  5GAD P;  3D7E O;  1OH6 A;  2DFF A;  1U47 A;  3D2F A;  1VSH A;  3T1Y K;  4CEF A;  4C1N K;  1GLJ O;  5C12 A;  3QIO A;  4AF1 A;  4MDB A;  5JLH A;  2HBM A;  4CI6 A;  1NM1 A;  5AZJ B;  1JLF A;  3ZYY X;  4CFD A;  5HRR A;  4IFE A;  4BRF A;  4BVP A;  1NJY A;  3QER A;  3CC4 N;  4CEE A;  4CJ7 A;  5H1S Q;  4DHY A;  2YHB A;  1HX1 A;  4Z4C A;  4F4K A;  3FGU A;  4OKK A;  1C6V A;  2Q1N A;  2ITM A;  5JMV A;  5J1E A;  3CFR A;  1WLJ A;  2QTD A;  3M8R A;  1C1A A;  1Q7Y O;  4Q0B A;  3I56 N;  1NOZ A;  3KIO A;  2ZJR L;  3HZ6 A;  1KXP A;  1W2B M;  2ZQB A;  2KFN A;  2OCE A;  1KQS M;  4NB4 A;  1KAX A;  1JXE A;  1KLM A;  5AJ3 K;  4NYN A;  1ZXO A;  5FPE A;  4PWD A;  4CJS A;  4FJL A;  2WFB A;  1N5Y A;  3PO5 A;  3TAR A;  1S3X A;  3HO1 A;  4DSF A;  4B1V A;  3VQ8 A;  2R7Y A;  1J6Z A;  3L2U A;  3ZT0 A;  5LMU K;  1TGO A;  3TPQ A;  1W7A A;  3P39 A;  4E1M A;  4FWN A;  3THW A;  4NXN K;  1DEJ A;  2HHV A;  2O8B B;  2OPS A;  4BG9 A;  4DU3 A;  3BF3 A;  4MLH A;  3IMX A;  5AQK A;  1IKX A;  1BI4 A;  2XY8 A;  3C6H A;  3MED A;  2XHB A;  4EP4 A;  5SZT A;  1D9F A;  1RDU A;  2NRZ A;  3OYG A;  3L8B A;  5AQF A;  3OYH A;  1Q18 A;  4Q5V A;  3NH2 A;  1S72 N;  3J7Y P;  2O8C B;  4QS7 A;  5BRH A;  2FF6 A;  3DLK A;  4KAZ A;  4FM1 A;  3ATU A;  4M7Y A;  1TK5 A;  3MWP A;  2F8S A;  1UWB A;  2WON A;  4CEZ A;  3VQ4 A;  5AQQ A;  2EWS A;  1W97 L;  4CF9 A;  3NE6 A;  3T1H K;  4CHP A;  2P1J A;  4KO0 A;  3FZH A;  4KRF A;  3UE5 A;  4NO7 A;  3AV9 A;  3VEV A;  1TUY A;  3MXM A;  3OVN A;  5E26 A;  3J7A P;  2GX9 A;  3LAK A;  3I0S A;  3O6W A;  4N56 A;  3CXC M;  1L3V A;  2QEX N;  3AVH A;  3O4W A;  3DYA A;  5J2P A;  2CH5 A;  4DB3 A;  2P9L A;  2P9P A;  3ID6 A;  3LZJ A;  2Y1J A;  4LY7 A;  1SL0 A;  4DF4 A;  4NXM K;  3ZEU B;  4ISE A;  1VQ7 N;  4FLX A;  1QE1 A;  2W6L A;  3L2V A;  3AVF A;  3CCQ N;  3QIC A;  3B6P A;  4OLB A;  3E66 A;  4BDY A;  1RT4 A;  5KPZ A;  4KHU A;  3MEC A;  4Z94 A;  4A5B A;  3KLE A;  4L8R B;  4B9S A;  2RF2 A;  4IEI A;  3G71 N;  2F8T A;  1NK0 A;  3BDP A;  2QWQ A;  3PX4 A;  2OZS A;  1XC9 A;  5AQM A;  4FWM A;  1NJI O;  4BC5 A;  2AA4 A;  1NJW A;  5EXW A;  3GL1 A;  1YI2 N;  4B3R K;  2P9I A;  4QAG A;  3DOK A;  1C0T A;  1NKC A;  3FFK B;  4E0D A;  2NNW A;  5AFU H;  3TTF A;  3CC7 N;  5KPT A;  5EVZ A;  1VSD A;  1T6C A;  3CHW A;  4YOW A;  2VCP A;  2G8V A;  2E8A A;  3OY9 A;  3F9K A;  1ATR A;  4IO8 A;  3CCL N;  4FJJ A;  2F9T A;  5AFU A;  1Y64 A;  3EEQ A;  4DFM A;  2E1Y A;  2Q31 A;  4C8K A;  4K8Z A;  2CGJ A;  2P5O A;  4OPK A;  2QXF A;  2CH6 A;  1VSL A;  4N5S A;  4JKG A;  1JLQ A;  1VSK A;  3OYA A;  3FE1 A;  1RDA A;  5EOY A;  5KPR A;  2ASM A;  4XEI A;  2BUP A;  3IG1 A;  3VTH A;  2ZJP L;  1NMN A;  3AAR A;  2Z1I A;  1FK9 A;  1S1W A;  3Q7B A;  3GDQ A;  2YKM A;  3KK7 A;  1VQP N;  1GLB G;  4WFB L;  1DTT A;  4RWT A;  4AHV A;  3ZCM A;  1SL1 A;  4LF7 K;  1M90 O;  3SQ0 A;  4IFY A;  4DR5 K;  2OPR A;  4DV4 K;  1C0G A;  4X62 K;  4BR7 A;  1SQK A;  1X3M A;  5F2R A;  1SKS A;  3C7N B;  3UKR A;  4YFU A;  1P90 A;  4BC2 A;  4A62 A;  1U4B A;  4HUG A;  4DTR A;  1RTI A;  3L6Q A;  4Y1D A;  1JLE A;  2RPI A;  3MCA B;  3QEX A;  2ASP A;  4BY9 C;  4EHT A;  3OYL A;  3MN5 A;  1IH7 A;  4QS9 A;  3ALY A;  3SBT A;  3RSE B;  3AAQ A;  1UA1 A;  5E41 A;  4IFV A;  1RBS A;  3V4I A;  1KVB A;  2IVO A;  1YHQ N;  3CM5 A;  3THY B;  3T69 A;  3AVN A;  4CJF A;  4H0V B;  1VSJ A;  2Z1G A;  1B92 A;  1YVU A;  4GV6 A;  4M42 A;  1TVR A;  2WTU A;  3O1W A;  3S3O A;  3NDK A;  3SUQ A;  5DK5 A;  5CZ2 A;  5JVH L;  1BG3 A;  4CZL A;  4HCB A;  3AAP A;  3LP1 A;  4FM2 A;  3WNE A;  4DR6 K;  1W9H A;  4E7J A;  1RDC A;  3JSM A;  3UKU B;  3DRR A;  5AQT A;  4ISF A;  1LCU A;  3QML A;  4DV2 K;  2YCH A;  4JS4 A;  3LAM A;  3IFR A;  5AZI B;  3SBG A;  4DKW A;  4JEP A;  4ILG B;  4H4O A;  3ZSW A;  3WXL A;  4DSK A;  2P9K A;  3CMA N;  1KFS A;  1YTA A;  4JK8 A;  4DUZ K;  3R6M A;  1GLA G;  3SLC A;  4CGF A;  3VA0 A;  1NOY A;  4K43 A;  3G25 A;  4J2E A;  4DFK A;  3FFI A;  1HYV A;  4W5N A;  2AJQ A;  3NCI A;  5J2Q A;  4CK3 A;  4I2P A;  4EP5 A;  4M45 A;  1BHL A;  3KK1 A;  4YDU C;  1WSH A;  3V6D A;  3QFP A;  1VRU A;  3HST B;  2HHU A;  1GOA A;  4RW8 A;  4ICL A;  4O4G A;  3WQU A;  1RT2 A;  3WEE A;  4DTU A;  3VEX A;  2F96 A;  4RG8 A;  2F4V K;  4C8L A;  3C6T A;  1JLG A;  2HHX A;  5I42 A;  3L4I A;  1S5J A;  3QNO A;  3DXK A;  5M1Q A;  4JKE A;  3NH0 A;  3MEG A;  1NGJ A;  3F9M A;  1QVF M;  4FPB A;  1R0A A;  1LW2 A;  4FJ7 A;  1LW0 A;  2D1K A;  5C2F A;  5DM7 L;  3SQ1 A;  4ZTF A;  3V9W A;  5AQG A;  2ZWH A;  1XHZ A;  4DV6 K;  2E4L A;  4EZ9 A;  1F21 A;  1E4G T;  4G9Z A;  4JAX A;  1L3U A;  3OJU A;  1HNV A;  3CIP A;  2BE2 A;  1Z25 A;  4DQ8 A;  3HOT A;  4PY5 A;  4NLB A;  4DQI A;  4EAH D;  4H4M A;  4CZE A;  4B9T A;  3LP0 A;  4JYA K;  3OBY A;  1ZBU A;  2P9N B;  4DMN A;  5BN8 A;  2QWL A;  4CCH A;  4GV9 A;  1S1X A;  4CZM A;  4BRK A;  4O0I A;  5KQ8 A;  5CR4 A;  1JL2 A;  3VTI A;  4CK2 A;  2V52 B;  2FLO A;  4DSL A;  4YNQ A;  4HTL A;  1CZA N;  1Q81 O;  3A5O C;  3VF6 A;  1XNR K;  4YOY A;  2KQ2 A;  4JI6 K;  3ULE A;  3EKU A;  3QEI A;  4MLE A;  5B8H A;  4XH4 A;  1KVC A;  3ZSZ A;  3L2W A;  3ZT3 A;  3VOV A;  5HRP A;  3P5J A;  4EIA A;  4CF1 A;  4A57 A;  4J2A A;  1BCM A;  5C15 A;  1VQ9 N;  4RW6 A;  2HNZ A;  4FJX A;  3EE8 A;  1QQM A;  1BU6 O;  1CXU A;  3OBW A;  3MX5 A;  4CJ5 A;  4JI8 K;  3HI0 A;  2DFH A;  4FL9 A;  4BRG A;  1NWK A;  4FJI A;  4DUY K;  5FPD A;  1WAF A;  4Z0U A;  4KHS A;  1REV A;  1O13 A;  4I2Q A;  2HBJ A;  2P9U A;  4IO9 L;  1S9E A;  1ATN A;  3QNN A;  3KHY A;  3BF1 A;  4FXD A;  4OLA A;  3CI5 A;  4JNE A;  3TR8 A;  3NF6 A;  5BN9 A;  3CET A;  1JXB A;  3J7Z O;  3SYZ A;  3SMS A;  3CCV N;  3K59 A;  2YNF A;  1HPM A;  3CJ9 A;  3H08 A;  1L3T A;  1DKG D;  1NG9 A;  1RBT A;  3CCM N;  3K58 A;  1MWM A;  1RBR A;  2A5X A;  2YHY A;  4IEE A;  2QKK A;  1GLF O;  4K42 A;  4U67 L;  1YAG A;  4QOZ B;  1HQU A;  5LJW A;  3CF5 L;  3S3N A;  3DWL A;  3M8P A;  5HBM A;  1S6P A;  2Q36 A;  4J8F A;  4JRQ A;  3AO3 A;  4DG1 A;  4H0X B;  3QEW A;  3DXM A;  1NGE A;  4CJ4 A;  4KV8 A;  1B9D A;  3MN7 A;  2BDP A;  3O9R A;  3LDL A;  4LD0 A;  1XWL A;  2FBT A;  5C2D A;  2QWN A;  3L2R A;  2V7Y A;  2UUA K;  4B9L A;  2J4R A;  3C0B A;  4CW7 B;  4CBX A;  3J81 O;  5FPM A;  3V9U A;  3OA9 A;  4KPY A;  4K0K K;  3VGL A;  3DJC A;  2W6K A;  2E2P A;  2P9S B;  1L5U A;  4CES A;  2QWR A;  3GOI A;  5HP1 A;  1NGA A;  2YJE A;  2BGG A;  1LWE A;  5M1P A;  1U6Z A;  4E7H A;  2E2N A;  4YOT A;  1ZBF A;  4I7F A;  3K57 A;  3WXJ A;  3R3L A;  4FW2 A;  1TAU A;  4WQ4 C;  4KHQ A;  3RR7 A;  5FDL A;  3ZSX A;  5HRO A;  4FPA A;  1XMO K;  5BRF A;  4V19 S;  3HRG A;  2VG5 A;  4X64 K;  3R1X A;  1XHX A;  3DRP A;  3O9T A;  3OW2 M;  2Q2R A;  5D3G A;  3S9H A;  5M1N A;  2E5L K;  3E9P A;  3VQE A;  4BC4 A;  2DY4 A;  3JAM O;  3AVL A;  4DSI A;  4NLC A;  1HKG A;  2IS3 A;  2G8K A;  3ITH A;  4KBO A;  3WQT A;  5I9E B;  4I9L A;  3AO5 A;  4WE1 A;  4YOV A;  2X6S A;  3AY9 A;  1IBK K;  3C95 A;  3VQ9 A;  4FJ8 A;  4X66 K;  3TWH A;  4DR3 K;  3THX B;  3U3Y A;  4BRI A;  4ELT A;  3PX6 A;  5BRD A;  2QM1 A;  1IO2 A;  3ZET A;  3EN9 A;  1LWC A;  3TAQ A;  3E9O A;  2GEL A;  2RKI A;  4BGA A;  4B1X B;  4B9Q A;  4JS5 A;  3CG7 A;  4CZG A;  1XC3 A;  4KFB A;  3S3M A;  4CGD A;  4E89 A;  4PL8 A;  4DSE A;  3DLH A;  4NCG A;  1I94 K;  4BE0 A;  4N47 A;  4GMJ B;  4OPJ A;  1QSL A;  1VQ8 N;  2HST A;  4H03 B;  3DOL A;  1IV0 A;  4GNI A;  3AGR A;  4QS8 A;  5F0X A;  1OH5 A;  4JI0 K;  2KZZ A;  1HNI A;  2PYL A;  5LY3 A;  1KFD A;  3EZW A;  3WXI A;  4A61 A;  4IJN A;  2ZJQ L;  1U2V A;  1TKX A;  2XRI A;  2YNI A;  3K5M A;  2E88 A;  3MXI A;  2FBX A;  4KH4 A;  5AQW A;  3NH1 A;  5AQU A;  2NRX A;  4HUF A;  4E1J A;  1TYQ A;  2O8E A;  4W5T A;  3RWU A;  2QXL A;  3DLG A;  4PKH A;  1RT5 A;  1T8E A;  1DTQ A;  3UIQ A;  1YXQ A;  1XI1 A;  2PZS A;  1K8K B;  4NCA A;  1WSF A;  3ZT2 A;  2JWL A;  3CCE N;  3LDN A;  1JLA A;  4FWS A;  3C65 A;  1Q82 O;  4BRO A;  3WNF A;  2Q3S A;  2O8F B;  1CLQ A;  3DLB A;  5FRM A;  4JRP A;  3L3V A;  3TSU A;  1YTU A;  1DLO A;  4YOR A;  1K6Y A;  3PSF A;  2RN2 A;  2QI2 A;  1WN7 A;  3RMC A;  1YJW N;  3HVR A;  3UB5 A;  5J2M A;  1X3N A;  4YOU A;  2JLE A;  1T3V A;  3DI6 A;  4RW4 A;  4FK0 A;  5CY4 A;  1HYZ A;  2O4I A;  4MDA A;  3SQ2 A;  3CJ7 A;  2YX6 A;  3O5B A;  4BRD A;  2YKN A;  4DCH A;  4E3S A;  3U4L A;  3KK2 A;  3HPH A;  4O0J A;  3CFO A;  2PY5 A;  1HRH A;  3O80 A;  5JS1 A;  4FJ5 A;  3U8X A;  3SPZ A;  4BC3 A;  1T7P A;  4W5O A;  3SJH A;  3OYJ A;  4FJH A;  4PKI A;  4IXC A;  3LAN A;  3BY5 A;  4I6M A;  3QIP A;  3LDS A;  1VK0 A;  4H5R A;  1T44 A;  4BAC A;  4DR2 K;  1J53 A;  3U3G A;  1VSF A;  3LP3 A;  5AQV A;  4KI6 A;  2UUB K;  4FLZ A;  1CXQ A;  2O8D B;  1WSG A;  3RVC A;  1DT9 A;  2XY7 A;  4BR4 A;  3MWT A;  3VF2 A;  3NVK A;  3O9Q A;  4WQ5 A;  5EY4 A;  3C6U A;  3SAH A;  3NGY A;  5AZJ A;  3D2E B;  3JXU A;  3K9K A;  3T3F A;  2YNG A;  5BPL A;  1J5E K;  2E6M A;  4IDK A;  1T6D A;  3NBP A;  3IKM A;  5JIC A;  5CHI A;  4DSJ A;  4BRE A;  2D0B A;  5C24 A;  4FJK A;  3VQ6 A;  4CF8 A;  1N33 K;  1WAJ A;  1X9J A;  4CFB A;  2YJF A;  1JCG A;  3A5N C;  5CE3 A;  1YIT N;  3HJF A;  1BA0 A;  3PIO L;  2ETJ A;  4K25 A;  1EP4 A;  3VQQ A;  5LL6 Z;  2W42 A;  1S1V A;  3CM6 A;  3O3F A;  1K73 O;  1NU0 A;  3O08 A;  3TSP A;  1TKD A;  1YUW A;  4DR7 K;  5J2N A;  3L3U A;  3MN9 A;  4MO5 A;  1TL3 A;  4JKA A;  3CPW M;  4KTZ A;  1X9W A;  3QLH A;  2ZE2 A;  4B1W B;  2IOC A;  2F7T A;  2FF3 B;  1RFQ A;  3M5R A;  1C0F A;  3SNN A;  2GWK A;  1JCF A;  1ATS A;  1BQN A;  2O8B A;  2VG6 A;  2ZGY A;  3GE1 A;  4JHD B;  4H5T A;  1E3M A;  3NF7 A;  4JKC A;  3HP6 A;  3ZSV A;  5AQH A;  1QQC A;  4A2A A;  1VSI A;  4FOI A;  4OPA A;  2BH1 A;  3BGR A;  3K5L A;  3SI6 A;  2O8C A;  4KI4 A;  4DQS A;  2D5R A;  3EL2 A;  2GEM A;  4R5P A;  4CBU A;  2B4J A;  4FLT A;  3K5O A;  4PHT X;  1FXX A;  1LOT B;  2OPQ A;  1S22 A;  3CCU N;  4RW7 A;  5BR8 K;  4F8R A;  1NBW A;  2NUB A;  1NNE A;  4CE9 A;  3FZL A;  4FLY A;  2VYP A;  2PYJ A;  4IDH A;  4E7K A;  5HOO A;  5FRO A;  4MO4 A;  1H1V A;  4ELV A;  4OKE A;  2DFE A;  1JCE A;  1FW6 A;  4LFB K;  1Z6R A;  1QQN A;  4FJN A;  1XUP O;  2YHW A;  1NGH A;  3AVK A;  4WFN L;  3THV A;  1RBU A;  4LC9 B;  3ZEU A;  4CZH A;  2I7P A;  2GV9 A;  1SS6 A;  3R9P A;  4CED A;  3OTO K;  3B6O A;  5BRE A;  4MQ3 A;  2P51 A;  4RW9 A;  1EXQ A;  4JKD A;  2PAV A;  2KTQ A;  4O5F A;  1BQM A;  5CYQ A;  3LWL A;  3KLH A;  2X6N A;  3PIP L;  4B9U A;  1RTD A;  3M1F A;  3PY8 A;  4IOA L;  1SKR A;  2X74 A;  1HKC A;  3VEY A;  2FC0 A;  4BQL A;  5DM6 L;  1E4F T;  1VQO N;  3MEE A;  5IWA K;  3ZLJ A;  1VQM N;  1U49 A;  1ASW A;  4EZ6 A;  1SL2 A;  4N41 A;  4FOE A;  3O3G A;  3KKR A;  5LMN K;  4KKO A;  3NFA A;  3IDH A;  2WBN A;  3SQ4 A;  2D4W A;  4DTN A;  1HNX K;  3HSC A;  4BR0 A;  1VHX A;  3QIN A;  2YNH A;  2H3G X;  3D45 A;  2DPN A;  3LP2 A;  3CME N;  1RDB A;  3HXM A;  3EO3 A;  4ILJ A;  3ZT4 A;  3VGM A;  1K8A O;  2HMI A;  2WC9 A;  4CEB A;  4JLH A;  3I0R A;  4BDP A;  5ADX A;  1TK8 A;  4FLU A;  1KC8 O;  4CF2 A;  2HHW A;  2DTU A;  3NVM A;  1VAZ A;  3VMF B;  1OH7 A;  3F73 A;  4GVM A;  4M3T A;  3D0P A;  4DLE A;  4H5V A;  1HJO A;  2UYT A;  4CZK A;  3QBW A;  4CEO A;  1QSY A;  3KKS A;  4J2B A;  4GVE A;  4AHC A;  3G10 A;  3VER A;  1ZBL A;  4BR2 A;  3TSQ A;  1QHA A;  4OGC A;  5E84 A;  3EZ5 A;  4Z4I A;  1HKB A;  5C10 A;  2HHS A;  2IVP A;  1S1T A;  3CER A;  3SAF A;  3RTV A;  1VQK N;  1KCF A;  3WXM B;  3AA4 A;  3OYF A;  3M8S A;  2UXB K;  3D2F B;  3ISN C;  4ZHR A;  5AQX A;  4AM7 A;  3C6A A;  1UAX A;  1KVA A;  4KTW A;  2G8I A;  3OYM A;  1CZ9 A;  4DLG A;  3VGK A;  1QSS A;  4IKF A;  2E20 A;  4DFJ A;  3QO9 A;  4PKG A;  1NGB A;  3SAG A;  2JGU A;  3LPT A;  4CGG A;  1OH8 A;  3CJB A;  4FWR A;  3CQ8 A;  3SUO A;  4Y0W A;  3BUZ B;  2BAN A;  1WBD A;  1NKB A;  4IZ9 A;  2ASO A;  3PLA A;  3C7N A;  3CCR N;  3A5M C;  2YI1 A;  3A8Y A;  1WSE A;  2QWM A;  1OVQ A;  3CCJ N;  3CJ1 A;  3NMU A;  4H5W A;  2VWB A;  4AHT A;  4H0T B;  3HM8 A;  3RSE A;  1HUX A;  4HCC A;  1G99 A;  3RRH A;  3ENO A;  2KFZ A;  1BOT O;  4JI1 K;  4NCB A;  1NGI A;  3THY A;  2IVN A;  5AQO A;  1KSP A;  4CFC A;  5LJV A;  4DS5 A;  1BUP A;  3ZX2 A;  3E01 A;  1X9S A;  3EKS A;  3I55 N;  4CJE A;  4M3R A;  3LWM A;  4H0O A;  1YIJ N;  3HPO A;  4KHW A;  3I8D A;  3WXK A;  1EKE A;  3THW B;  3A0I X;  3AA3 A;  3ID8 A;  4CHY A;  2W40 A;  1XNQ K;  1Z26 A;  4DTJ A;  4M3X A;  2EX3 A;  1IG9 A;  1ZBH A;  3UKU A;  4DTM A;  3TAB A;  1FKP A;  1BI4 B;  4BRQ A;  2PBD A;  3WNH A;  4IJA A;  3VQC A;  1CZB A;  1S1U A;  2HHH K;  4YOX A;  3DMJ A;  2HBK A;  5AZI A;  1ESV A;  2E2Q A;  4N76 A;  2D0C A;  3KD5 E;  4FJG A;  1NLV A;  4B3O A;  2Q0U A;  3O4N A;  1Q8I A;  3TAP A;  4A5A A;  4BE1 A;  4BWM A;  3SUP A;  3RRG A;  2HB5 A;  3CC2 N;  1GLD G;  3C94 A;  3KD1 E;  4CJW A;  4CJQ A;  1N8R O;  4LF9 K;  2KKZ A;  3PX0 A;  4DTX A;  3KWI A;  2VWK A;  5C25 A;  3H45 C;  1N36 K;  5AR0 A;  2UU9 K;  2G8H A;  4B9M A;  4OX9 K;  3VES A;  1GOC A;  3V1O A;  1P8Z A;  2Y1I A;  4KHN A;  3AVA A;  2HNY A;  2GUP A;  2E6L A;  3GG4 A;  2P9L B;  2F9W A;  2P9P B;  3SV4 A;  1D9D A;  1MA9 B;  1VSM A;  1Q86 O;  1EWR A;  4O44 A;  4AHU A;  2HF3 A;  4BDZ A;  4LSL A;  4CZJ A;  4LFA K;  4FWQ A;  4F2R A;  3HL8 A;  1QZ5 A;  2B6A A;  4JKF A;  2NRR A;  4DV0 K;  3O9U A;  3I33 A;  1IG8 A;  4O8U A;  1WSJ A;  1UA0 A;  3ZX0 A;  1SKW A;  3T7Z A;  3VEZ A;  1ZBI A;  2HW3 A;  4B08 A;  3AO2 A;  1L3S A;  4KH6 A;  2NRV A;  4O55 A;  1QVG M;  3SUN A;  2VG7 A;  4OO1 J;  4BRA A;  3QET A;  4GY2 B;  3DM2 A;  5AQR A;  3AVI A;  3ZT1 A;  4FJM A;  1TK0 A;  3O4Q A;  4OGE A;  2AP1 A;  2P9I B;  3EYZ A;  3CFP A;  4CZF A;  4CJK A;  3VQP A;  3WUH A;  4F9O A;  4FVM A;  4DTP A;  4DFP A;  3TTC A;  5HL7 L;  3QEV A;  5CYM A;  2P9N A;  3TI0 A;  3J8A A;  3OHR A;  2YV0 X;  2IAJ A;  2HVI A;  1QS4 A;  3D6R A;  2HMP A;  3H3O B;  2HVH A;  1J5O A;  3OYN A;  5KGX A;  4FM0 A;  2GBZ A;  1JKH A;  4CER A;  5JLF A;  3CCS N;  1SAZ A;  5AQN A;  1ASV A;  3IRX A;  5AQY A;  2WUS A;  2GTD A;  3F5T A;  5TKY A;  5KQD A;  5A2Q O;  3FZK A;  4YDU A;  2RHK A;  1YT3 A;  4CHO A;  3MX2 A;  2YHX A;  1HR0 K;  4JKG B;  2BTF A;  3TAE A;  3CPE A;  4JI4 K;  5M1O A;  4E19 A;  1FKO A;  2A1S A;  1U04 A;  3LM2 A;  5CZ1 A;  4FJ9 A;  2WOM A;  4F2S A;  2HF4 A;  3DLR A;  3LPU A;  2VGM A;  4QCL A;  4DV1 K;  3MK6 A;  3SZ2 A;  1UOC A;  4AIL C;  3M8Q A;  5M1K A;  3O8M A;  4JD2 A;  1T05 A;  4DTS A;  2A3Z A;  3F2K A;  4IOC L;  2A1R A;  5TKW A;  2IIR A;  3V1Q A;  3LDO A;  1A5W A;  2X78 A;  2UXD K;  1VQN N;  4BE2 A;  4CJU A;  3VEW A;  2ZF5 O;  5KI6 A;  4LH4 A;  3MMV A;  4CIF A;  3K2P A;  2W41 A;  4E7I A;  2FXU A;  3UKR B;  2KLA A;  3LAL A;  1GOB A;  1S9G A;  2FSJ A;  1VQ4 N;  2QW9 A;  5GAG P;  3DRS A;  4O8K A;  4BWJ A;  4DV3 K;  4BRM A;  4Z4H A;  1S6Q A;  2G8W A;  4DV7 K;  2G8U A;  3VET A;  3V1R A;  1EET A;  2KW4 A;  1ZYQ A;  1YJ9 N;  3DAW A;  2ZGZ A;  1HNZ K;  2VQE K;  4I9Q A;  4BR9 A;  4PQU A;  1SZ2 A;  3L4Q A;  3NF8 A;  3QES A;  3RMA A;  2ZM6 K;  1HMV A;  2XO7 A;  2YHA A;  4FO0 A;  4OVL A;  1C0U A;  2OYQ A;  3VF4 A;  4FZY A;  1R59 O;  1RBV A;  1WUA A;  4LH5 A;  4FZZ A;  4ID5 A;  2OTL N;  2PFU A;  1BCO A;  1RT3 A;  4CIG A;  1RCH A;  3K9J A;  3T1A A;  3IS9 A;  2NLX A;  5FLX O;  1QQO A;  4DWI A;  2KZM A;  3WT0 A;  4HVJ A;  1IBL K;  3W3D A;  4DQP A;  4XIU A;  3HVT A;  4LSN A;  4CGI A;  1V4S A;  1NK5 A;  3SPY A;  3MN6 A;  3HP9 A;  3ATV A;  4ILH A;  4C8N A;  4B9N A;  1TKT A;  4PL7 A;  4W5Q A;  3AGK A;  2OAN A;  4DQQ A;  4PUO A;  4LF8 K;  1LV5 A;  4ISG A;  3MCP A;  1KLN A;  2OA8 A;  5FPN A;  4DTO A;  2P9S A;  1JJ2 M;  4BG8 A;  2Q0R A;  2XY6 A;  3CQX A;  1WSI A;  2P9K B;  2IGI A; 
#chains in the Genus database with same CATH homology
 1J5E K;  4YY3 K;  4OX9 K;  4LFB K;  1XMQ K;  1N33 K;  4JI8 K;  4NXM K;  4GKK K;  3OTO K;  4LF7 K;  4AQY K;  4CVN E;  4DR5 K;  4DR4 K;  4DV4 K;  4LFA K;  5LL6 Z;  4B3M K;  4B3S K;  1XMO K;  4X62 K;  4DUY K;  2F4V K;  2UXD K;  2VQF K;  4DV0 K;  4LF5 K;  4V19 S;  4DV5 K;  4DR7 K;  4X64 K;  4LF6 K;  4DR1 K;  4LFC K;  5IT9 O;  5IWA K;  5AJ3 K;  2E5L K;  4DV3 K;  3JAM O;  4JI1 K;  5LMN K;  4DV7 K;  4B3R K;  1FJG K;  4DV6 K;  1HNX K;  3J80 O;  1HNZ K;  2VQE K;  1N34 K;  5LMU K;  4JI5 K;  1IBK K;  2ZM6 K;  4NXN K;  4X66 K;  4DR3 K;  4B3T K;  4GKJ K;  1XNQ K;  1N32 K;  4JYA K;  4DR6 K;  4LF4 K;  5FLX O;  1IBM K;  3J7Y P;  1I94 K;  1IBL K;  1HNW K;  2HHH K;  2UXC K;  4DV2 K;  4JI2 K;  4X65 K;  4DR2 K;  4JI0 K;  5A2Q O;  2UXB K;  2UUA K;  3T1H K;  4JI3 K;  5BR8 K;  2UUB K;  4KHP K;  4YHH K;  2UUC K;  4JI7 K;  1XNR K;  4CW7 B;  4JI6 K;  4LF8 K;  1HR0 K;  4LF9 K;  4JV5 K;  3J81 O;  4JI4 K;  4DUZ K;  4DV1 K;  4K0K K;  3T1Y K;  3J7A P;  1N36 K;  2UU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...