3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
2YKMA 3TVKA 3RMCA 4YR3A 2ALZA 4EP4A 2VWKA 1N48A 1LAWA 2XGPA 4CF1A 4XO0A 3G6XA 5KFYA 3MR6A 1MU2A 3O3GA 4YQWA 1BCOA 4ZMMA 1TGOA 1KRPA 3MAQA 3MEGB 2E9RX 4KV8A 3GIIA 4ELVA 2FJXA 3NAIA 3MR2A 3ZSXA 4CHNA 3ZT1A 4YMEA 1REVB 4FM0A 4O0JA 2HAIA 5CYQA 1WLJA 2GUIA 5KGWA 4IKAA 4BWMA 5C5JA 3LP1A 4N5SA 2XI3A 4JV2A 2RKIB 1J53A 2IAJA 3NKYA 4IH5A 1C0MA 4X2BA 2HNZA 1QE1A 4CJFA 1RBVA 4R5PB 3HPOA 3WNEA 2YNGB 3I5CA 3HHKA 1JLQA 2VA3A 1UWBA 1KVBA 2B4JA 2W8KA 1S49A 4RU9A 4W5RA 3OYBA 4RW8B 1LW0B 4RZRA 4EBEA 2WTFA 2DTUA 4N47A 2W7PA 4L8RB 2YNHB 3K5LA 3Q8QB 3NH1A 3H08A 1S9EB 3UQSA 1QS4A 4NCBA 4NYZA 3KIOA 4DF8A 5CZ2A 4F4WA 5HP1B 4RW6B 3ISNC 1FK9A 4FBTA 4AILC 1CSJA 1BIZA 3RB4A 4OVLA 4E7HA 1RT4A 5DQHA 4HUGA 3GV8B 4M3TA 5EWFA 4LD0A 4KBIA 3RB0A 3OYAA 3I0SA 4DFPA 2BANA 3VQ4A 4K4ZA 3CM5A 2FVCA 1IKWB 4QWDA 1HYSB 4PQUB 3JYTA 5HRNA 4KKOB 4CJQA 2KZMA 2OPRB 4IRCA 4KB7A 1ZYQA 3KNAA 4EYHB 4YP3A 4DSJA 3KLEB 5KFIA 5CY4A 4KSEB 1S0MA 4JV1A 4RW9B 3NDKA 1LWEA 3E51A 3OYLA 1SV5B 1S6QB 3QGHA 1HMVB 2B5JA 2FBVA 3G10A 4F4YA 4ZPCA 4FM2A 1D8YA 3GIJA 1HARA 3K57A 3LZJA 2VG7B 1C1BB 1JKHA 2HWHA 2W9BA 5FRMA 3UPFA 2FBYA 2IJFA 4OGCA 3V6KA 2JEGA 2XY6A 3F73A 1TKTB 4URQU 4I9LA 2X6SA 5KTQA 1YT3A 5HROA 2WK4A 3DOLA 4JLHA 3NCIA 3CJ5A 2Q3SA 1SH3A 1Q8IA 4RNFA 3Q8PB 5KRTA 3LP2B 3A2FA 1FKOB 1XHXA 5KFRA 2E6MA 4FS1A 4IFVA 2R2UA 5EWEA 4FJKA 4AHTA 4FZYA 4AHUA 3EPGA 3CJ0A 1I6JA 3QEPA 1A5VA 1VSHA 1A5XA 1S1UA 4H8KA 1S6QA 3O3FA 2C2RA 1RTIB 4ID5A 1TKZB 3S3NA 2WOMB 4Q8EA 4CGFA 4TN2A 2HNYB 4K4XA 3S9HA 1D1UA 2BR0A 5CZ1A 3SPZA 4I9QA 1I39A 3DRPB 2XWYA 1S9GB 3OS2A 3VQQA 1VSEA 3MEEB 2FBTA 3VQSA 2AU0A 3AVFA 3C6TB 5K14B 4ZVGA 1SL0A 5L1KA 3OL8A 1EP4B 3VQAA 2BQUA 2W9AA 4QW8A 5J2QA 2YKMB 4WE1A 1X1PA 1RTIA 5KFNA 3I5BA 3UDLA 3RBDA 3S3MA 1TP7A 4FLTA 1N5YA 1XC9A 4ZHRA 5KFGA 1VRTB 4ECQA 5DK5A 2ZQBA 3LAKA 3HT3A 4FYDA 2O4GA 2G8HA 3DRPA 1BHLA 4W5TA 3HP6A 4ECTA 3ZSOA 4J9SA 1ZBHA 3HO1A 1Q9YA 3KLFA 1S0OA 3IRXA 2O4IA 3IN5A 2R8KA 4ZVEA 1FXXA 3ZT3A 3T19A 4CEAA 3VA0A 4M41A 3NL0A 5F8LA 1NK5A 1ASWA 1RDAA 3O3HA 4IG3B 1LWCA 3KMSA 4TYBA 4JRPA 1G15A 1L3UA 3OYGA 3NGDA 2D0BA 3OSNA 4MKBA 2V9WA 4FJNA 5KFQA 4JV0A 3HVRA 3DM2A 3OLAA 3IAYA 1MMLA 4LSLB 3KLFB 3ZSZA 1HQEA 2FLNA 4K8ZA 3ULDA 4B08A 3KK2B 3ISND 4G1QB 1UOCA 3V9SA 3AO4A 1IO2A 1LW2A 2FVPA 1JLFA 3PX6A 4I2PB 2WB4A 3HP9A 3AVAA 3H5SA 3F9KA 4HCCA 1S1TA 4CF9A 1RT5A 4CJRA 3BJYA 4B9MA 4DTOA 5KT4A 2EX3A 3SCXA 5HLFA 1ASVA 3I0SB 1Q9XA 3V9XA 1UAXA 2UVWA 3SQ4A 2AX0A 4OKEA 4FJJA 1BQMA 4W5QA 3KHLA 2HHSA 5J1EB 2OPPB 4XIUA 4I2PA 4ZVHA 4DTRA 2HNZB 3NF8A 3FSIA 3C6UB 4TSXA 2OA8A 1J9AA 3I0RB 2J6UA 1ZBIA 4FLUA 1VSFA 4CJEA 1HQEB 4O4GA 5C24B 4N56A 2QKBA 4RW8A 3SFUA 4KHYA 1TAQA 4E7KA 4C8LA 2YNHA 3KHHA 3NBPB 4R5PA 3C6UA 3AVJA 4FK2A 3LALA 1RTJA 4IH7A 4DSLA 3KLHB 4K4TA 2OH2A 1C0UB 3MR3A 4ED0A 3OL9A 4J9RA 2BRKA 4NRTA 4ECWA 3MF5A 3RMAA 3MEDB 3VQDA 3MECA 4O4GB 4FJ7A 3CDUA 4O55A 3QLHB 4GMJB 2YHAA 4QWEA 3IG1A 3NGIA 2V4QA 2UVUA 1ZTWA 4ECSA 5KG5A 2IM1A 1Z25A 3G6YA 5C25A 2GIRA 2BDPA 3K58A 1NK6A 4B3OB 4K4UA 4CJ4A 2NUBA 3HPHA 1S1WA 1B9DA 3O4QA 2ASDA 3IGNA 3IS9B 2HWIA 3OHAA 4NLPA 4DSKA 3GV7B 3DMJB 5DGBA 5C42A 5KFZA 3BR9A 4IDKA 3CWJA 4ED8A 3QO9A 3NF7A 2WONB 1NK0A 3QLHA 2XO7A 3D0PA 4GC6A 3PO5A 1BL3A 1R0AA 4KHSA 3P1GA 3DRRB 1C2PA 1SH2A 2OZMA 2G8IA 1RTDA 2P5OA 3MTKA 4B3OA 1D9FA 4IKFA 2ASLA 4F2RA 1JL2A 4NLUA 3DLKA 1FKPA 1RT7A 1TL3A 4RW9A 1XWLA 1VSDA 2UVRA 2JLEA 2KW4A 4CJTA 3NGYA 4ZVFA 1WSEA 3PHEA 5E41A 4M3UA 4K4WA 4RG8A 1L3VA 3ZSVA 2R7YA 4QWCA 5KFDA 4OPJA 4KTZA 1T03B 5JS1A 1GX6A 4NLGA 2FJWA 4HHTA 3IS9A 4CFAA 3V1RA 4DTUA 5KFPA 1NOZA 3DOLB 4I7FA 1WSFA 4E1NA 1X9SA 1S4FA 3AVBA 2FC0A 2XY7A 5KT5A 4Q0BA 3M9MB 3KK1B 3CDEA 4F3OA 1BI4B 5KG3A 3OYDA 3CJ2A 3KJVB 5I3UA 3H4BA 4DTSA 3KLIA 3NF6A 3M9NB 3KLGB 2VWJA 1U45A 4J9OA 4J9LA 3OYMA 5KFHA 4O5BA 3QNNA 3RRHA 2RDJA 3H5UA 1IKYB 1TL1B 3T5JA 3OYEA 4DFMA 1K1SA 4DL3A 1BQNA 4Y2CA 2I1RA 4G1QA 2R2SA 2ITGA 4Q5VA 3VQ7A 1HNVA 4O44B 4NLWA 1HRHA 2QKKA 1JLBA 1RT6B 3S3OA 3KK3B 1SL2A 2BQRA 1EX4A 2ZE2A 4DS4A 1RT3A 3GILA 4CF8A 3BSNA 3AVCA 4RNMA 4CGDA 1WSIA 2YNGA 3PVXA 2UUTA 2E6LA 3ZSRA 2AJQA 3I8DA 4CK1A 3QNOA 1IKYA 3LPUA 1FK9B 3PW7A 2OPSB 1SKSA 4QPXA 4NCGA 1HNIB 4CK2A 1S1XA 1WSGA 4E7JA 3KKSA 3SV3A 1C1CB 4HKQA 1NNDA 2B43A 4CECA 4ED7A 1K1QA 4J9NA 4CEEA 2HB5A 1YTUA 2IS3A 1QUVA 3QEVA 5F9LA 3MEDA 2XY5A 3M9OB 4HCBA 3V4IB 3L2VA 5HBMA 3M8QA 3L8BA 2B5JB 3TI0A 3LDSA 4M94A 1B9FA 3MFIA 2XY8A 4EYIB 2IGIA 2QK9A 3M8SA 4HVJA 4CCHA 3OS0A 2HHTA 2V0NA 3AO1A 3SUQA 2E9TA 1RTJB 1C1AA 4CJWA 3EY1A 3TR8A 4KAZA 1QQCA 4IBNA 4EO8A 3BGRB 4JS4A 1JL1A 4KB1A 3QEXA 2ZD1B 1RILA 1W9HA 4CIEA 2HHQA 3OLBA 3WNHA 4OLAA 4DTXA 3V1QA 2OPSA 4PUOA 1JLCB 5L1JA 3RRGA 1FKOA 2KTQA 5KFSA 4CF2A 3NE6A 2YNIA 3TANA 3DRSB 1JXEA 1BQMB 3T3FA 4NYFA 2W9BB 1L5UA 4DG1A 1JLGB 4OKJA 4HTUA 1TKTA 1DTQB 3ITHB 3TAPA 3H59A 5KRSA 4IFYB 2IMWP 4CIFA 2PY5A 3DLEB 4AH9A 5L9XA 3DMJA 1RDBA 2G8VA 3SI6A 1CXUA 4C8MA 2OPQA 1EKEA 2IC3A 3B6OA 3TWHA 4CK3A 4ECYA 2R2RA 4CEBA 2R8IA 2HW3A 4Z4IA 1RTHB 1YVUA 4CESA 3OJSA 4ZTJA 4NLSA 5KFWA 4ZP7A 1S6PB 3FFIB 3GYNA 5J1EA 5T14A 2OPPA 3EPIA 1TK0A 1S9GA 2D3ZA 1S0NA 2YKNB 4WZMA 4CGHA 4BDZA 3WNFA 4AHCA 4KTWA 5KFAA 3OL6A 2RDIA 3SUNA 1RT1B 4O0IA 4B9SA 4DLGA 2KQ2A 3ICLA 4PUOB 5KG1A 2YV0X 3DLBA 3RBEA 3DOKA 2FVSA 5J2QB 2YNIB 3DRSA 4ZPBA 4E19A 4BDYA 3OYJA 4URSA 4DTPA 1N5YB 3DLHA 4IG0B 2IM2A 3BDPA 3RTVA 2G8UA 3KLGA 1JXLA 3KTQA 3QGGA 3U3GA 3IRXB 3BQ2A 1HPZA 4WYLA 2R2TA 4RNHA 4ZP9A 2UUWA 1QSLA 4TYAA 5DG7A 3B6PA 5F8HA 3TAGA 1D5AA 4DFJA 5DGAA 4IR1A 1RYRA 2ETJA 2YNFB 1VSLA 5JS2A 3CJ3A 5C42B 4Y1CA 3HPGA 4FVMA 3RWUA 4FLZA 4DQPA 1JLBB 5SZTA 4FLYA 4DFKA 5I42B 2WONA 4CFDA 4K8XA 3FRZA 2G8FA 2G8KA 1EETA 2XGQA 1NJXA 4E7IA 3QIDA 3MXIA 3E01A 1JLFB 4NLVA 4AHSA 4RUCA 2E4LA 2Y1JA 3MEEA 2GIQA 2Z1HA 4KO0B 5J2NA 3P5JA 2WHOA 3OY9A 5KFXA 5HLFB 1LAVA 3O4NA 2GV9A 1KTQA 1RCHA 3RB6A 4BE1A 3K59A 4KTQA 2HNYA 3KLVA 5JUMA 3NAEA 1TV6A 1T94A 4E1MA 3UIQA 1S9EA 2XI2A 3G6VA 3M8PA 2R8GA 4ECZA 3SFGA 5KFMA 3V9WA 1JLQB 3AVHA 1HQUB 4EBCA 4QWAA 1HYZA 3DI6B 3K2PA 2UVVA 3KMQA 1O1WA 3OYCA 1JLAA 2G8WA 4O44A 1RDCA 3VQPA 4DF4A 3KK1A 1U49A 5L1IA 2EHGA 4ED1A 1DLOA 5KFCA 1S1VA 3C94A 5HP1A 3L2RA 2Z1IA 4FW1A 4MK8A 1F21A 3BGRA 3OL7A 3H2LA 4KO0A 5EDWA 1Z26A 4ZP6A 1TK8A 4WFYA 1IKXB 1GX5A 2ZKUA 4ED2A 1RA6A 4CJLA 2ILYA 1UA1A 5FRNA 2GC8A 2F8EX 4FJXA 4ICLA 1LWCB 4IG3A 5DG8A 5DQGA 3PR5B 3K5MA 4YR0A 3ZT4A 3DLGA 3QEIA 2W9CB 2X6NA 3NH2A 4CHPA 3NF9A 5F8NA 4DQIA 4C8OA 4TQRA 3SQ0A 3PX4A 1C0TB 3CQ8A 4IDKB 3OYHA 4QOZB 1IKXA 4H4MA 4FJ8A 3PW5A 2VG7A 5D3GB 1S1XB 4DU1A 3PJWA 3G0ZA 1S48A 1RT2B 1VRUA 1S1VB 3V81B 2IDOA 2JC0A 3PW4A 1RT5B 5F8MA 4XPCA 1IKVA 3QETA 4NYNA 4NLRA 4LQ3A 1QSYA 3QESA 2P5GA 2I5JB 4ED6A 4B8AB 4WFXA 1KLMB 4YFUA 4B9TA 4DQQA 2CKWA 4ZTFA 4DSFA 3HKWA 3FDSA 5J2PA 4WXWA 5F9NA 3JSMB 1U4BA 4J9QA 1T8EA 1C6VA 1T7PA 1T03A 2VG5A 4R0EA 5KFKA 3DLKB 2X74A 3OYKA 3QZ7A 4I7FB 4MH8A 3PJXA 4Y3CA 3T5HA 3AA2A 3GIKA 4FJ5A 5HRSA 3PY8A 3RB3A 1N4LA 1CXQA 4JUZA 4CJSA 1NK7A 2JEJA 4Z0UA 1ZBFA 4KHWA 4GW6A 4DL7A 2XRIA 3AA5X 4TY9A 4M3XA 3NBPA 1KHVA 4CF0A 3AO2A 4RNNA 2P51A 2DY4A 4NLQA 3P83D 3NGZA 1X9WA 4Z4FA 1KFSA 3QINA 4FJ9A 1HYVA 4FM1A 4LY7A 5DLFA 2HVIA 3IG1B 4NLXA 3TAMA 4N41A 4RW7B 1QAIA 1U04A 2XHBA 2AGQA 2OPRA 5KFFA 2AWZA 1IH7A 4DMNA 3LWLA 4OGEA 4Z4GA 1TL1A 3HVAA 4BDPA 3KLHA 4C8NA 4EZ9A 1C0UA 3AVIA 2JGUA 3HYFA 3OYNA 3QIPA 4IH6A 4FJIA 4PY5A 3BSAA 1IM4A 4F4ZA 2WOMA 2D5RA 5J2MB 3V6DA 3V9UA 4CHOA 4W5NA 1RAJA 4KHQA 1DLOB 1VSJA 1NKCA 2KFNA 3SQ1A 4NLDA 2LSNA 3AVLA 1RDRA 3EZ5A 1L3TA 5KFVA 1BISA 3IGVA 3QGIA 1JIHA 3AVNA 1WAFA 1RA7A 3Q8RB 4B9VA 4M3WA 1JXBA 4ZP8A 1KFDA 4Z4HA 4MK7A 1LWFA 3QERA 4J2DA 3PW2A 3TQ1A 4QCLA 5KFUA 3SV4A 4JS5A 4CHQA 1GOAA 3JYTB 5EU7A 3PX0A 1TK5A 3LAMA 2ILZA 3D28A 1K6YA 3U3YA 3RMBA 4O3SA 3HL8A 1XHZA 3I5AA 5KG7A 4FZXC 4H54A 1KVAA 3CG7A 3L3UA 2IJNA 4Q44A 1HMVA 2ATLA 1S5JA 2BE2A 4F4XA 2D3UA 1NK8A 2BANB 4Y1DA 4KKOA 4CJVA 3L2WA 2ZE2B 1HYSA 1KVCA 3BREA 1DTQA 4O3QA 1T05A 1RYSA 1IG9A 3BSCA 3DM2B 3KKRA 1XI1A 5DMRA 4ZPAA 3OHBA 3AA4A 3LZIA 2BRLA 3CFPA 1XR6A 3HJFA 1TQLA 4CJ5A 3ZSQA 5KT6A 2IOCA 4Q0BB 1HNIA 1U47A 3GQCA 1J54A 3V81A 3VQBA 4CJKA 2DPJA 2B6AA 3VN5A 5HROB 3AO3A 5HRPA 1EXQA 4FK0A 3LANA 3VQ8A 3THVA 3H4DA 1WNSA 3HM9A 3C95A 2IC3B 4FLWA 3SUPA 3OS1A 3OJUA 4CERA 4B8CA 5KFJA 1QTMA 4CHYA 3TARA 4PWDA 1S6PA 3FFIA 2J6SA 3LPTA 2HMIB 3MXJA 4F4KA 1JLEA 2X78A 3VQ9A 2RKIA 1RTDB 3M8RA 3DRRA 3OVNA 3DYAA 4IOBA 3T5KA 5KFEA 5F8JA 3T5LA 4RUAA 2HHVA 4BE0A 3D5MA 2BGGA 1NKEA 4NLYA 3MFHA 1QAJA 3HK2A 5DG9A 3RAXA 4KAIA 1S9FA 4NCGB 4DEZA 5KGXA 4F3TA 4M45A 4PQUA 2DFFA 4BACA 2BQ3A 4ZHRB 3VQEA 1GOCA 2V4RA 1N6QB 2W9CA 1WSHA 1NJWA 3H98A 5KFBA 3QYYA 4ELTA 1TAUA 3TAFA 4F50A 1B92A 4WXOA 1LW0A 4QW9A 1VRTA 2IM3A 4J9MA 1QHTA 4FBUA 2O5DA 5JXSA 3TAQA 2FJVA 1VSMA 3V6HA 2DFHA 1ZBUA 1S1WB 3LP0B 3KLEA 1N6QA 3RAQA 1NHVA 4Q45A 1RBUA 4HYKA 3CFRA 1TKXB 2HVHA 2ZD1A 2FLPA 3ZT0A 1RBRA 2QXFA 3ASMA 2DPIA 4KHNA 1BI4A 2DFEA 5KT2A 2F8SA 3QZ8A 3AVKA 3PR4A 4OPKA 3WNGA 4IFVB 4IQXA 4ECUA 3SI8A 2VA2A 4LH4A 1NKBA 4IG0A 3M8PB 1I3AA 3DDKA 3ZCMA 3QEWA 1JX4A 1TV6B 4ELUA 4KB0A 4KHRA 4QAGA 4FK4A 3SNNA 2F8TA 1FKPB 1RT7B 4M42A 1REVA 4RW4A 3KHRA 3DI6A 4FLVA 1RTHA 3LP1B 3HVTA 2WCXA 4GC7A 1KCFA 2QV6A 5CYQB 2C2DA 3OYFA 1C1BA 1JKHB 2KZZA 3SZ2A 3SYZA 1S1TB 2IM0A 3CO9A 1T05B 4FCYA 2D41A 4CGIA 4E3SA 1UWBB 1U48A 4RW6A 4DTNA 1S1UB 2KFZA 1YTAA 3QIPB 4CJUA 2GBZA 3H5XA 3NMAA 3N6NA 5DQIA 4CFCA 1TKZA 4ID5B 4O4RA 3AVMA 4ICLB 2HHXA 3MXMA 3TAMB 3HVTB 1WAJA 4FJHA 3ZSYA 1QSSA 3PV8A 2YHBA 4E7LA 3KJVA 4O3PA 3H40A 2Y1IA 1NOYA 4FJLA 4H4OB 1X9MA 4MFBB 1GOBA 4MIAA 4LSNA 1C0TA 3CVKA 3N6LA 4EZ6A 1TL3B 2VG6B 1JLCA 4Y34A 2FBXA 3KD1E 1LWEB 4PWDB 4M3YA 4CEFA 1XR5A 1ZBLA 1JLGA 2FLLA 3ZT2A 5FDLA 3KD5E 1S10A 3V9ZA 2HNDB 1VK0A 2D7SA 4TY8B 3SJJA 2I5JA 1Y97A 2XC9A 2D0CA 4EBDA 4ECVA 1IKVB 3OYIA 5DLGA 3CFOA 1SUQB 2OPQB 3CDWA 4DSEA 5D3GA 3KHGA 1NJYA 1TVRA 1JLAB 3H5YA 2JEIA 5HRRA 5CYMA 2IA6A 1NK9A 2BE2B 3L2UA 3SUOA 1RT2A 4BE2A 1RDDA 3QO9B 4LQ9A 4FW2A 4DL4A 1MU2B 5I3UB 4RNOA 2F96A 2YKNA 2R8JA 3KOAA 1KLNA 4XPEA 4Q43A 4KPYA 4M3ZA 4QWBA 3HXMA 2C2EA 5J2NB 1D0EA 4KI6A 4HUEA 1BQNB 1WNEA 3EZUA 4B9LA 4U7CA 4J2EA 1ZETA 4KRFA 4CHZA 1HNVB 4FS2A 1VSKA 3KK3A 1NJZA 5CYMB 1RBTA 3MR5A 4CEQA 3ZSWA 4J2AA 5FDLB 2R8HA 2D0AA 3PUFA 1UA0A 1BCMA 2XCPA 1S97A 4KV8B 1U09A 4DL6A 2W7OA 4DSIA 4M95A 2Z1GA 2HHWA 4TXSA 4NLOA 3ALYA 5EWGA 3CIZA 2RF2A 2FVQA 4DTMA 2WRMA 4ECXA 3PZPA 1CZ9A 4EEYA 4ED3A 1LW2B 4CFBA 4JRQA 1KSPA 4DL2A 3K5NA 2IAJB 3CJ4A 2AGOA 1DTTB 3QIOA 1NK4A 3RR7A 2FVRA 4RW7A 4K4SA 2XCAA 3C6TA 5K14A 4IRDA 5KFTA 4WFZA 3I0RA 4DU3A 4FZZA 2QE5A 1NHUA 3SQ2A 5F8IA 3HSTB 4CEZA 4YR2A 4DTJA 3L2QA 3AO5A 4CGGA 4EP5A 4URGA 5KT7A 5J2MA 3V6DB 4KI4A 1J5OA 4WE1B 2OYQA 1EETB 4I2QA 3BQ1A 4ECRA 5T7BA 5I42A 3VA3A 3JSMA 1CLQA 1ASUA 1RT3B 1WSJA 3NAHA 4NRUA 2C28A 2YNFA 5KI6A 2IBKA 4RW4B 3V1OA 5KFOA 4LSLA 4N76A 2AGPA 2RN2A 4E89A 1TKDA 4FLXA 4W5OA 1YVFA 4LH5A 1J5OB 2JEFA 3E01B 5KT3A 4NCAA 3T1AA 2E9ZA 4K50A 4KFBA 1SKWA 1C1CA 4MFBA 1CZBA 4DQSA 4IFYA 1W0HA 4K4YA 1TKXA 4CIGA 4B9UA 2P1JA 1KLMA 4F8RA 3D45A 5KG2A 4DWIA 3AV9A 1W25A 3V4IA 4Q8FA 4I2QB 2OZSA 3L3VA 4R8UA 4Z4EA 4AHRA 1R0AB 1SL1A 1D9DA 5C25B 2W42A 3GIMA 1QE1B 4M3RA 4Z4CA 3PO4A 4FJGA 4LSNB 3UR0A 1HQUA 4B9NA 2HHUA 2PZSA 4TLRA 2VG6A 1XR7A 3V6JA 1SUQA 4YNQA 3VQCA 3FQLA 4J9PA 4F2SA 1RT4B 3N6MA 4IR9A 1ZTTA 3CYMA 4CJ3A 3M8QB 1BIUA 1L3SA 4NLTA 4CEOA 5KG0A 1RBSA 4ZPDA 4CE9A 4R8UB 3DLGB 3NHGA 4KFBB 1KHWA 3Q8SB 3PW0A 1Z4UA 4CEDA 5KFLA 1ITGA 1SKRA 2PYLA 4CJPA 1T3NA 3AA3A 3ITHA 4KHMA 4DLEA 5C24A 4J9KA 4KE5A 4TQSA 2Z1JA 4U6PA 5F8GA 1SV5A 3RMDA 4MIBA 4KREA 2ASJA 3RR8A 4FJMA 3MECB 4H4MB 1A5WA 2CJQA 1HJRA 4EO6A 1IKWA 2B6AB 2HMIA 1N56A 4DG1B 2JC1A 3DYAB 1VRUB 3FQKA 4OKKA 4J2BA 4PA1A 1OS5A 4GVMA 2A1SA 2AX1A 5EUHA 4KHUA 1EP4A 1BGXT 4BWJA 3DLEA 3TAEA 4G3IA 5FROA 3VQ6A 4MQ3A 4MKAA 4C8KA 3LWMA 4K4VA 3SPYA 4DS5A 4DQRA 1JLEB 4HUFA 1RT6A 3K5OA 4OJRA 2ATQA 3U6FA 2C22A 1WN7A 4O3OA 5J2PB 4ID1A 4DL5A 5SWMA 2VG5B 3KLIB 2HNDA 4Y2AA 3AVGA 2J6TA 3EYZA 4H4OA 5KG6A 4MK9A 3LP3A 4TY8A 2PYJA 3NFAA 4E0DA 1LV5A 2RF2B 1RT1A 3KK2A 2AQ4A 4AHVA 3DOKB 4OLBA 2W8LA 3CM6A 5HBMB 1TVRB 4WYWA 3LP2A 4NZ0A 3HVWA 1RNHA 3DLRA 1LWFB 3BQ0A 2EC0A 1DTTA 3GV5B 3OSPA 1SH0A 3LP0A 3MEGA 3NH0A 2RPIA 4OL8A 4DU4A 4WZQA 4IRKA 3VQ5A 5KG4A 4FXDA 1VSIA 5L1LA 4UQGA 4CGJA 1HPZB 3TABA 3G86A 2A1RA 3BSOA 4O3NA 4O3RA
chains in the Genus database with same CATH superfamily
4ZVSB 3TVKA 3RMCA 4B3SJ 2ALZA 5BN8A 1N48A 2QEXS 2XGPA 4CF1A 1GQEA 4DV7K 5F2RA 1ROFA 3PIOL 4FPIA 3VF2A 4LFCF 4ZKAA 3AODA 1KP6A 3VERA 1R31A 3CQYA 3ZSXA 4CHNA 3IWNC 1OSDA 5GVQA 1REVB 1S79A 1ZOTA 4BS2A 5C7PA 2GUIA 4BWMA 4IKAA 4OZJA 4CH1A 2LLZA 3FZMA 2A18A 4N5SA 1J53A 2YWFA 2V94A 4KPCA 2IAJA 5AQJA 4X2BA 1HA1A 2XSJB 1X4FA 2XMWA 3MMAB 4D3GA 4JI2K 1IWGA 2V50A 3WNEA 2P9UB 1FD2A 1JLQA 2B4JA 1YZ7A 2W8KA 1S49A 1EIYB 1SS6A 3QBWA 3R7BB 5M2RA 3O80A 2W7PA 4IOAQ 5GMKa 2OHDA 1ESVA 1NDKA 1UAWA 3KIOA 4JKGB 1VQ8S 3CCTA 1K0VA 3OD2A 3ISNC 5B0AA 1N54B 4E7HA 5DQHA 4LD0A 5I3QA 3P96A 4K4ZA 3PKMA 2FVCA 1HYSB 3GR1A 3S01A 4KKOB 2OPRB 4IRCA 1ZYQA 4NXMF 3KNAA 4EYHB 4DSJA 5KFIA 5CY4A 1HKAA 3OXGA 5HVFA 3B82A 1SV5B 1S6QB 2FBVA 2J9CA 3ZZRA 4DUYF 1D8YA 1HARA 3LZJA 1NZ8A 1T9VA 1B64A 2W9BA 5FRMA 4PXDA 3F56A 4A5BA 3JSBA 4WTYA 2XY6A 3CIMA 5HMXA 1TKTB 1WTBA 1T9WA 5KTQA 3CC2S 4ILRA 1NPPA 3DOLA 2LEAA 4X62F 4HHUA 1NGHA 4BRPA 2Q3SA 4ID8A 2ZHBA 4RNFA 3Q8PB 2PE8A 3A2FA 1Q95G 1FKOB 3LGNA 4U8VA 5EWEA 4FJKA 3W65A 3HDSA 1EKSA 4P2FA 2AZ3A 2HQIA 1RJJA 3C3LA 1X5SA 1U1MA 2ASMA 4LR8A 3QEPA 1U26A 1U6BA 1VSHA 4DV1J 4DR3F 1S6QA 4IWVA 1TKZB 3I4PA 2FY8A 1VK8A 4Q8EA 4DR1F 4KQZA 4CGFA 4DL0C 1D1UA 2XWYA 4ES1A 2L48A 1S9GB 5FD1A 2FBTA 2DNPA 1TL7B 2NXUA 3AVFA 1Y5LB 2CPEA 2H5IB 3OL8A 1EP4B 5BPNA 2DRAA 2YKMB 1M1HA 1X1PA 1RTIA 5KFNA 1TP7A 4Y2IA 4HTIA 5JVGL 1XBWA 2QWNA 2ZQBA 1WI8A 1ELOA 1N0VC 2HWTA 3U1MA 2HKEA 2WAQD 2O4GA 1K8KA 4JK7A 3HP6A 4JV5F 4PAAA 3T1HJ 1EARA 1FKAF 2XHWA 1S0OA 3ZZPA 3SK3A 1KONA 3IRXA 2J8AA 1UW9A 1VOMA 4QYRA 2O4IA 2F8HA 3N5BA 2CGLA 3HRGA 1FXXA 2A3JA 1FEHA 3NL0A 1VJQA 1S59A 2RE2A 1U1NA 1R27B 4DPUA 4TYBA 4HEA9 3WDOA 4CBWA 1OSCA 4DR6K 1HFEL 3GG1A 3NGDA 4ZPWR 2OIHA 1FJGJ 4MKBA 4FJNA 1WG1A 4JV0A 3HVRA 3DM2A 3IAYA 1MMLA 1JB0C 1LK5A 4PXCA 3KK2B 2LMIA 5ADZA 3ISND 3V9SA 2HYIB 4TKTA 4YY3F 1XNQJ 1JLFA 4I2PB 4HLBA 1VHIA 1JWWA 1S1TA 1WOSA 4CJRA 3PRDA 1S22A 2R42A 4B9MA 4P9SA 3D2WA 2BJ3A 1FXRA 2PA3A 3I82A 3SSQA 2A6AA 3SQ4A 2AX0A 1B70B 1UZHA 5CABA 4W5QA 2HHSA 2VODA 2OPPB 3P49B 2HNZB 3BZCA 2OA8A 1NGCA 1MNEA 5BR8K 1ZBIA 4FLUA 4FN5A 3AJ2A 1VSFA 1IQTA 3EKUA 4AL6A 4N56A 2QKBA 4DB3A 3SFUA 3TW0A 3KXDA 3MN9A 4BR2A 2GO8A 2YNHA 4LF7J 1A9NB 3TVYA 3BH7B 2BA9A 3OXLA 4RL1A 4IH7A 2OH2A 5IXUA 4ED0A 3OL9A 4J9RA 2DGVA 4O4GB 5IZHA 3VV2B 3MD3A 3PYFA 2G2YA 2YHAA 2GVDB 3IG1A 3DCAA 3NGIA 2ZH1A 2V4QA 2UVUA 1KOOA 5D0HA 5KG5A 1K73O 2GIRA 3K58A 3GFXA 3P31A 4B3OB 4CJ4A 2B7CB 2NUBA 1S1WA 5BR8J 2HWIA 3OHAA 4DSKA 2Q66A 2PMWA 2MZ1A 3GV7B 5KFZA 3BR9A 3EZOA 4DX8H 1DZ5A 3CWJA 1J5EF 3LGHA 3DKDA 2BABA 3AB2B 3BH6B 4GC6A 5AXKA 3PO5A 4KHSA 3P1GA 1PBUA 1C2PA 3HM8A 1RTDA 1CULB 3IBCB 2CVEA 4O0NA 1FKPA 2UVRA 3FZBA 2Q1NA 4EFHA 4ZVFA 1WSEA 3TZZA 1L3VA 4CTAB 4ATNA 2APOA 1LEOA 5KFDA 2VQFF 1T03B 5JS1A 1RAGB 1YDLA 4JAXA 3D6RA 1P9YA 4DV3K 3BF3A 3HFKA 3I9V9 1RDWX 1PO6A 1NOZA 2P9IB 1NBEB 1T6DA 4BCAA 3W60A 3M8ZA 4ZJQA 4MKVA 3JB9k 4BVPA 2LQ5A 4YDUA 2QYGA 2HK2A 4CP5A 2QSFA 3M9MB 2IVNA 5DM6Q 4BC2A 4RTFD 3T7ZA 4CO1A 3H8YA 4CNYA 2L08A 3WC0A 2B8PA 1U45A 5C2FA 3OYMA 2C2KB 3ZZUA 3H5UA 1YJWS 4DL3A 1N8RT 1OO0B 3AA9A 1X5TA 1E4GT 5E3RA 2NZTA 3S3OA 4CBXA 4CLWA 3KK3B 1CC8A 2J5AA 3IBWA 1RBAA 3BBFA 1RT3A 2V5HG 4M63A 3TPQA 2HZCA 3FVYA 3BSNA 2KYXA 4RNMA 4JI1J 1VQ9N 1R6VA 4GKJF 3PVXA 2E6LA 4JKAA 1UVIA 3QNOA 1IKYA 1FK9B 2VONA 2OPSB 3GCWP 4GKJJ 2EFGA 1CJVA 4CK2A 1O13A 4E7JA 5L39A 3DXBA 1Y5NB 2QC3A 3W8PA 5BYSA 1BU6O 4WTOB 2RH3A 4K25A 4YOEA 4CECA 1RI7A 4J9NA 1KWMA 3FCHA 3QEVA 1S99A 2ZZNA 1F9FA 2QA1A 3V5RA 4A8OA 1YRXA 7FD1A 1S12A 3L2VA 4F7VA 5HBMA 3VF0B 1V3SA 2LDIA 2QLBB 2DR7A 2QK9A 2XMJA 2A3ZA 3M2RB 1P1TA 4BRAA 3OS0A 3PG9A 3EVMA 4IO9L 3DDIA 3W66A 3SUQA 4ISGA 1C1AA 4CJWA 5AZJA 5D8HB 2K8GA 4ZLPA 3JAMU 4JS4A 4KB1A 3QEXA 1W9HA 4CIEA 3OLBA 3WNHA 1NWKA 3ZLJA 2Q6BA 2DBBA 2OPSA 1JCGA 1X4BA 2BUPA 4YB6A 3NE6A 2YNIA 3H90A 4NYFA 3NS5A 2W9BB 4DR4J 2ZBPA 3AD9C 2MHEA 2YWWA 1TKTA 1P90A 3C15A 5JVHL 2I0XA 2PD1A 3G9CA 3BO4A 3MN7A 3SXLA 3A5LC 4CIFA 2PY5A 3DLEB 2GMLA 4AH9A 4BREA 1XQIA 1CXUA 3B6OA 2FIUA 4CK3A 3TWHA 5BYRA 3NCRA 5LMUK 4ECYA 1FA0A 1RTHB 4CESA 3OJSA 2DO4A 2P9NB 4LF9K 4CZGA 2J7UA 1GLLO 2V4JB 3GYNA 4QZVB 5T14A 3AH6A 4H0OA 2HVZA 2V8GA 3A12A 5CXTA 4KTWA 5KFAA 4ZPTR 2HMPA 2RDIA 4I6MA 5LJ5Y 2F8MA 3ICLA 4H5NA 5BR8F 3QICA 2G2OA 2JH3A 5HK4A 2YNIB 1NRKA 2V52B 1GLBG 5HMWA 4URSA 2JSXA 3DLHA 4IG0B 1QQMA 4WQ4C 2IM2A 3BDPA 2G8UA 3KLGA 4I6YA 4DV0K 4K0KF 4TVAB 3CCUN 1HPZA 1P9QC 2A6OA 1S57A 3T1YJ 4RNHA 3MXHP 2UUWA 3JSRA 4TYAA 5GAGI 3N9UC 1URNA 1UPPA 1WUAA 3L7UA 5F8HA 5FLXO 4JI4K 4LRAA 4DU8A 2O8CB 1RCOB 2EKYA 4QOTA 4YN3B 3FC9A 3IM9A 3JAMY 1RYRA 2YNFB 4KY3A 2G4BA 1UJ6A 4Y1CA 4FSVA 2BMBA 4FVMA 1KNZA 3RWUA 3GFHA 5SZTA 4DFKA 3DXMA 1R8BA 5I42B 3U8XA 2WONA 2LXFA 2PDAA 2G8FA 2UXBK 3MXIA 4USUA 3CCQS 1YUWA 3GYGA 4HTJA 2RQMA 4L73A 3THYA 5KFXA 4ENOA 2E20A 5HLFB 3SBTA 3O4NA 2GV9A 1KTQA 4JD2B 2XMKA 2JWKA 4BE1A 2ACMA 4CDIA 3K0SA 5M2UA 3UIQA 2XI2A 1SC1B 5EOYA 2P9LA 2GHVC 3V9WA 2O01C 4FVCA 5LXYA 2QMXA 1HQUB 4QWAA 3SCIE 1RWVB 1EQMA 4ZIVA 4HTLA 3KMQA 2NRXA 4ED4A 3VMFB 1HHSA 2G8WA 4O44A 3Q83A 3VGKA 4WWSA 1U49A 3R1HA 1RDUA 3C94A 1YTYA 2ZC3A 3VF4A 5HN0A 3VGVA 4MK8A 3OL7A 3H2LA 5EDWA 1VQ5S 3THYB 4WFYA 3O1LA 1EB0A 1RA6A 4CJLA 2ILYA 1UA1A 4JKEA 1FVQA 3GG4A 2O8EB 5DG8A 5DQGA 2G0IA 3FZKA 1V4TA 3G71N 3QEIA 4L76A 2W9CB 2X6NA 4CHPA 3CCES 1Y10A 4J8FA 4HHHA 5F8NA 4AXIA 3H3NO 1BQXA 4B3TF 5I9EB 1UJ4A 4JBCA 3TO8A 3I56N 4IDKB 1H2VZ 1A7GE 4H4MA 2VU5A 2OTLN 1Q0NA 1OPIA 1S48A 1KQGB 1RE1B 1BUXA 3UD4P 2BJ9A 1VRUA 3HZEA 5BREA 5IT4A 1WOOA 1RGIA 2HQDA 5F8MA 4XH1A 1IV0A 3QETA 4NLRA 1QSYA 4LQ3A 2P5GA 2I5JB 4ED6A 4WFXA 3EJMA 1VCTA 3NXZA 1RSCA 4B9TA 2CKWA 4UOHA 2BM0A 5J2PA 2QTDA 4PXBA 1HI8A 5F9NA 2V8DA 4RKUC 3GL1A 1U4BA 1T8EA 4CO3A 1T7PA 3M2VB 1XNRF 4XDCA 4Z94A 2WVCA 4JKHA 4MLHA 1CVJA 2DPNA 3H0PA 5KFKA 3QZ7A 3SCJE 3PJXA 4X62J 1NLVA 4FJ5A 1S5ZA 3PY8A 3RB3A 1QTNB 3KJFB 2QGFB 4Z0UA 5ETVA 1VYAA 1W2BR 4JI6K 4FWOA 2A6MA 4LFAF 4M3XA 1DQ9A 2KHCA 1UVJA 1FNXH 3AO2A 3MDQA 4OHYA 2XBPA 5A8RA 4WFAL 4NLQA 3P83D 3JTOA 5DZ7A 2QZ8A 4FWKA 4FJ9A 3POTA 4OHWA 1GMWD 4FM1A 3MX2A 4YDXA 2ZDPA 4LFAJ 2QA4S 2VB6A 1HKBA 2XHBA 2V68A 2AYBA 2FTRA 2ASYA 4F25A 4WU3A 3KLHA 3AVIA 2JGUA 4HH0A 5F0XA 3QIPA 2DGSA 2QFIA 1FX2A 2D0PA 4CHOA 1X8DA 3OXFA 1T3OA 1UL3A 1NKCA 2PGCA 4C1NI 4NOHA 4NLDA 3RVCA 1U0HA 1VQMS 3EZ5A 1HNWJ 1X4HA 1JIHA 3AVNA 2PT0A 3O08A 3F0NA 2WFBA 3T9NA 4B9VA 2KKHA 1F60B 2FJEB 2QYCA 2Q79A 4DV5F 3CCJN 3TQ1A 2P9PA 4QIEA 1R8HA 4CHQA 1FERA 3ZTOA 5EU7A 4L75A 1TK5A 3LAMA 1FTRA 2ILZA 4LIWA 3HL8A 2F40A 3I5AA 5ETPA 3FMBA 1FE0A 5KG7A 2DY1A 1HBMA 4A8YA 4B3TJ 2H51B 2CPIA 4H5RA 3CG7A 3P3DA 3IRWP 3L3UA 3W3DA 2EFOA 2UUAJ 1HMVA 3NGUA 2D3UA 2QWLA 5EN1A 4PG5A 1GH8A 3WQUA 4KKOA 3QFUA 1HYSA 2Z0GA 1ZM4A 1N5QA 1RAHB 1E6VA 2IVYA 3CC4N 1IG9A 2BUNA 4JI2J 5DMRA 4ZPAA 1HNXJ 3OHBA 3LZIA 1AA1B 3LO3A 3TQEA 4CLUA 4ZCKA 3EM1A 1XR6A 1VQOS 1TQLA 1VQ4S 2HBMA 5KT6A 2IOCA 4Q0BB 3WXJA 3NY0A 1BWEA 1TL4A 4M5GA 4CO2A 1GLDG 3VQBA 2V9KA 4DV3J 3THVA 3H4DA 1WNSA 4NEYA 3GFYA 3FEXB 4FLWA 4KH4A 4CERA 1K0TA 2D1CA 2MLZA 4B8CA 2W2NP 5E3AA 1M1KO 4L72B 4N8NA 2VFUA 3A8EA 2J6SA 4K7QA 1FHTA 2IJRA 4LFBJ 3M8RA 1FESA 2QX0A 2WVEA 3M30B 2HS0A 2GJFA 4IOBA 5KFEA 2FHKA 2R7WA 1XQSC 1WC0A 2HHVA 4BE0A 1WEXA 3ZZOA 1J6ZA 4JI7K 1X5PA 3D5MA 4PXEA 2BGGA 4YB1P 5AQVA 2GA7A 3HK2A 1KC8T 3O9UA 4YS2A 1S9FA 4NCGB 2CNKB 4M45A 2DFFA 3KJQB 1DRZA 4BACA 2BQ3A 4MLEA 1CS4A 4DU7A 1N6QB 5AJ3K 2P2CB 3HULA 1WSHA 3H98A 4CLFA 4WFNL 4H0XB 3R7NB 2HHPA 4LF6F 1QQOA 4CT8A 4ELTA 3CJ1A 1LW0A 4E8UA 4AT1B 2XM3A 1EJ7L 2CAJA 3TAQA 2DNYA 1KTVA 3GJSB 3KLEA 1NHVA 2ZOFA 3ZNJ1 3BO2A 2ZD1A 3DXKB 5DM6L 2DPIA 4KHNA 4C0OC 1IM6A 5KT2A 3QZ8A 4OPKA 4IFVB 2VA2A 1NKBA 3MN6A 4IG0A 3M8PB 4PPDA 2B3TB 3QEWA 5IM0B 3A3NB 3VGTA 4KB0A 4KC5A 1FFSB 1AFJA 4CLPA 2KJWA 2C2NA 2XLIA 1QD1A 3L9ZA 3KHRA 4J7CA 3A13A 3DI6A 4A2AA 3J80U 4GC7A 2WCXA 3UCGA 2LQJA 2HQGA 1KCFA 4W90B 5CYQB 2LECA 3OYFA 1JKHB 1IR2A 2C1EB 1S1TB 3Q8VA 5HQMA 2U2FA 4FCYA 3HZGA 2E5GA 3HT0A 4CGIA 3D68A 4E3SA 3D1QA 5FPEA 2ZC4A 4RW6A 1H2UX 1FO1A 4C11B 4FF1A 1HWJA 2QWQA 4B1YB 2KFZA 1LKZA 1PJ6A 4FXWA 2H9ZA 5DQIA 4CFCA 4CZMA 2HHXA 3TAMB 3HVTB 3QRRA 3PV8A 4LF9J 2N4CA 2WUSA 1N34K 1XEZA 1GLEG 4G1PA 5IC4B 4F0MA 4O3PA 3H40A 2Y1IA 1MWKA 3RRKA 1NOYA 2GELA 1UWAA 1GOBA 1Y9OA 3X1LB 3CVKA 1BWVA 4EZ6A 3BZKA 4Y34A 4TU7A 1V5VA 5J1NA 1L3KA 4FOEA 1XR5A 2MYFA 1WSRA 1ZPWX 5FDLA 4RWTA 1TFWA 3V9ZA 3M6XA 4FKXA 3T9ZA 3CERA 3SJJA 2MSSA 1IKVB 3T1YK 3CFOA 2OPQB 3CDWA 4NPOA 5HRRA 2BE2B 4ILJA 2W25A 3SUOA 3VESA 3H2VE 4U7BA 4LQ9A 1NU4A 2BW7A 3EZWA 1MU2B 5I3UB 1UP1A 3E2EA 2YKNA 1KLNA 3NGSA 1KVIA 4M3ZA 3HXMA 3CI5A 1CZAN 4P52A 2NSBA 2E66A 1BQNB 4CLZA 3EZUA 4NYPA 3ULEA 4J2EA 1NJZA 5CYMB 3ZYYX 1Y0HA 4CEQA 3ZSWA 4LF7K 5FDLB 2OEJA 2E1MC 2G1HA 1MWMA 2YKQA 1ZPVA 2XCPA 4C98A 1NGJA 1U09A 4DL6A 3AHPA 3KNGA 4DSIA 2Z1GA 4JN4A 3ENVA 1HW8A 1EHWA 3WQPA 3CE8A 3U1NA 3Q7BA 3W63A 3W8GA 1X4EA 4CFBA 3R6MA 2UUCK 4I64A 3HHLA 4JYAJ 2IAJB 2HZVA 1OH8A 3WXMB 5KQDA 4RW7A 4IRDA 1FWPA 5LMNF 4M5JA 4WFZA 4DU3A 4LJMA 1NHUA 4FYWB 1HNZF 4A8MP 3HSTB 5KPRA 4YR2A 4DTJA 4URGA 5KT7A 2CPZA 3QBXA 2XMUA 4WE1B 2OYQA 2QRRA 1EETB 3BQ1A 5T7BA 4OPHA 4GVLA 1Q82O 1CLQA 4Y2KA 1JQGA 3P39A 1VBKA 2M0GB 3W62A 3LL3A 4JI1F 4DR7K 2XB2D 3GDQA 4CYUA 3HI0A 4RW4B 4GVBB 2YWKA 1TKDA 3CMES 4FLXA 4W5OA 4FYVB 4DV5K 2LP4A 2NXNA 1VQKS 1J5OB 3QAUA 5K8NA 4C6AA 2C42A 4K50A 3ILLA 2I38A 1GMWA 1SKWA 1C1CA 1W0HA 4K4YA 2IRXA 1QVGM 5KG2A 3AV9A 2KJVA 3EDQB 4I4BA 1CJVB 3L3VA 2C3MA 1QZ6A 4R8UA 3MZIA 2A42A 5CCLA 5CQGA 2FC8A 5C25B 2W42A 2M88A 3PO4A 1X7VA 4FJGA 2FF6A 4LSNB 3U7JA 4ES3A 5AE3A 4QBUA 2XYGB 4FNIA 4TLRA 1XR7A 2HS3A 3W2VA 4J9PA 3N6MA 2HLUA 1HR0J 1AT1B 3AY0A 1L3SA 1BIUA 2YQ0A 4H4KA 4NLTA 5KG0A 3ADAC 3NHGA 1JCEA 5ITHA 3PHTA 1QJHA 1ITGA 4CJPA 1M1GA 4KHMA 3M3ZA 4WF9Q 4DLEA 4KE5A 2DHSA 1J5EJ 1SV5A 4MIBA 4JI5J 2AT1B 3IMQJ 3D2EB 1A5WA 4AQYK 3VEZA 2CJQA 1HJRA 4CNZA 1IKWA 2FHJA 2HMIA 4I6AA 1N56A 3DC2A 1HBOB 1YRUA 2IMOA 3EKSA 2DTJA 4K2JA 3HJVA 1ZZNA 2OD6A 3C15B 2PI5A 2GAHC 1XMOJ 3M6GA 5EUHA 3D1HA 1EP4A 1BGXT 4BWJA 3DLEA 5FROA 1DAXA 3C7NB 4MQ3A 4NA1A 4OYXA 5THWA 1HR0K 4DQRA 2Q3PA 1XMBA 3S1TA 4YOXA 3UD3P 2LYVA 2SXLA 2VG5B 1UZDA 3KLIB 2NR0A 2F4FA 2HNDA 4Y2AA 5KG6A 4C23A 3O9TA 4L3KA 2DNMA 3BP8A 2PYJA 5EX5A 4X64J 2XNQA 2J0SD 2ZHOA 3FZ2A 4AFFA 2YJFA 1TVRB 4HDGA 1YIJS 2DNLA 3J7A1 3BEXA 1LWFB 4DR4K 2IA0A 4GV3A 2EWSA 1N32F 1K9MT 3LP0A 4P71A 3PRBA 2CVIA 4PG8A 4CZCA 4IRKA 5HSPA 5KG4A 3QWUA 4FXDA 1VSIA 3O3LA 4CGJA 1HPZB 3TABA 1XN9A 4O3NA 4O3RA 2YKMA 2G1DA 1Y7PA 4XO0A 3M2UB 1SZ2A 5HOOA 5KFYA 2RILA 2VPWB 4FNHA 2M4MA 4CH7A 1BCOA 3DOMA 2YQ1A 2YWEA 4F67A 2KO1A 4Y2MA 2HFUA 3MR2A 1LQ9A 4TU9A 1ZBTA 3J81U 4FM0A 4YHHJ 1H74A 2QWPA 1EX8A 2XI3A 2RKIB 2HNZA 4J91A 4WQ5A 1QE1A 2DRDA 3L7OA 3PFOA 3D1OA 5D6GA 1FJGF 4M8LA 3RSEA 2AYMA 3N4QA 3NMRA 3EXYA 4OJ3A 1PKUA 5BXIA 1KXPA 4DV1F 1TZ0A 2P6TA 3SDEA 2VV5A 3KG1A 3OYBA 3D0IE 1DGKN 1LW0B 3DFEA 2YNHB 3SSRA 5A8KA 4QJVA 5A0YB 3Q8QB 5AQUA 3H08A 4B3MJ 1QS4A 2D3OR 1WC5A 4NYZA 2GHWA 4LSZB 5CZ2A 5HP1B 4RW6B 4QR2A 2DR6A 4FBTA 4FPAA 3NCPA 5ETOA 1WBBA 1BIZA 3RB4A 2ACYA 4OVLA 4CT9A 1RT4A 1Y3JA 4HUGA 3GV8B 3I4HX 3OYAA 2LFVA 4DFPA 4GKKJ 1T6CA 3CM5A 4CM0A 4QWDA 3R5BA 4PQUB 1U02A 3JYTA 5HRNA 3BYPA 3UD5A 1FJCA 4CJQA 4HVZA 2KFYA 4JI4F 4BR4A 3LF0A 1U1LA 2F9WA 2JOQA 4E1JA 2J9DA 3E51A 5L8RC 3OYLA 4DR1K 3QGHA 2XZTB 2Q97A 3G10A 3CJTA 2A1BA 1MN9A 4F4YA 2DCUB 4ZPCA 2ADCA 3C19A 4DR3J 1P1LA 2VG7B 1JKHA 2KRBA 3JXUA 3HHNB 4LUBA 3UPFA 2FBYA 2X6SA 2WK4A 4W92B 2MKHA 1ZZFA 4JLHA 2I2YA 3CJ5A 3NCIA 1OVYA 2W40A 4B1VA 2V34A 3EGVA 1N52B 4ZCIA 1GXTA 4B3MF 2LA4A 4ZIWA 1OJ4A 4AHUA 2V7ZA 3T6JA 1I6JA 2CIMA 3J7AN 2EPIA 1UEUA 1VQSA 3D6HB 5K8PA 1Q18A 3EEQA 3SAGA 1FFGB 4OX8A 4ID5A 3S3NA 2ROPA 2VFSA 4WJBA 4LT6A 2WVDA 3M8YA 2AEFA 2NLWA 4P2SA 4KIAA 4I9QA 2DGUA 4C7QA 3DRPB 1I39A 4DR6J 1ZXOA 3OS2A 3O44A 4UUXA 1VSEA 1DY3A 2NXCA 3VQSA 5K14B 4ZVGA 1SL0A 5L1KA 3MOZA 3OR2B 2ZM6K 4FWRA 3UDCA 4QW8A 5HVHA 2FHJD 2XMMA 3UDLA 4ZHRA 1VRTB 3LAKA 1CJKB 3NMUA 5IT9U 4W5TA 5LXRA 4DPYA 2NREA 1YJVA 3THTA 3LH2S 3KLFA 5F3TA 2N7CA 2J7WA 2MQOA 3IN5A 2K1RA 1FRMA 4ZVEA 2MQLA 2AJFE 3E9OA 3VA0A 4M41A 4BC3A 2W2QP 1HPMA 4NXNJ 3O3HA 4IG3B 1SJRA 4JRPA 3FGVA 4EK2A 2L9WA 4MJKA 3THXB 4QIFA 3AARA 3OSNA 2CWKA 2V9WA 5KFQA 3OTOJ 4DHVA 1KQSR 3ULDA 2B0GA 4DV6F 4YHHF 3DGPA 3MD1A 2M70A 5EHHA 2ASOA 3A4TA 1PYSB 4HT5A 3PX6A 4K59A 2FSNA 4LFCJ 2JLGA 4HI1A 6FDRA 4HCCA 4CF9A 1RT5A 2CQHA 3JSYA 1U2VA 1RU1A 4FWPA 1K8AO 3ENAA 1M5KC 4DTOA 5KT4A 2Z57B 3I0SB 2YH0A 3BZQA 3QWPA 4RU2A 1UAXA 2QLWA 5DDPC 3CMQA 3KHLA 3T6BA 4XIUA 3OUYA 4ZVHA 4DTRA 5JLFA 2E5LF 3EN9A 3UE2A 3I0RB 2OEKA 4EMDA 1ACMB 1B0TA 3J7YP 3AAPA 4S0MA 3OW2M 2DGOA 3L4BC 2PEHA 3KWMA 3NS7B 4JKBA 4DDFA 1OWXA 2VKRA 2GGPB 4LFCK 2CQ0A 4ZVOB 2VUGA 3KHHA 3VWSA 3C6UA 3LALA 3B78A 4JI8J 4K4TA 3ZETB 1OMSA 2MQMA 3DLLL 2OTJN 2E1YA 2BRKA 3MEDB 1FRKA 2VQFK 1UMJA 3NRBA 4QS9A 3OV7A 3QLHB 2GO9A 4QWEA 1YG0A 4ECSA 4LREA 2IM1A 3OA9A 5C25A 1XMOF 2BDPA 3I56S 1NGBA 3UCZP 4B3RK 3O4QA 3IGNA 1KS2A 4RUHA 4FKYA 1AFIA 3IO1A 4PPZA 5DGBA 2FF3B 3ET6A 4ZCMA 1N36F 2XO7A 3D0PA 3BBBA 1R0AA 4PYDA 2PIIA 3VTHA 1K8KB 3CB4A 3IUCA 5FPMA 2FJBB 2VDIA 2ASLA 4F2RA 1S0VA 4NLUA 4WP9A 3G4SN 2JLEA 1YVNA 2PC6A 3NGYA 1SBRA 3PHEA 3WUHA 4KTZA 1C4CA 1HBOA 3CMEN 3R6GB 2LCWA 2UP1A 1KKHA 3DHXA 2GJ2A 2Y9HA 3IP0A 3DOLB 4C48A 4I7FA 4E1NA 3P6YC 1Y4ZB 4F26A 2DR8A 2P9SA 2VGNA 4I67A 3CO0P 3US5A 3CDEA 4F3OA 1BI4B 2CPHA 2AF6A 2VGMA 3OYDA 4P74A 2OMOA 2DR9A 3KJVB 3H4BA 3KLIA 3MX5A 3W2WB 3NF6A 5C2DA 2DIUA 4L6V3 2XG8A 5KFHA 3QNNA 3RRHA 2RDJA 3G8QA 1V4SA 1LFPA 2I1RA 4G1QA 4A46A 2R2SA 1HNVA 4O44B 3UN5A 2F7VA 1VIOA 3CJCA 4Y0WA 1EX4A 4DS4A 3GILA 3NP5A 3TU5A 2AJQA 4EFAC 4IYQA 3ZSRA 3I8DA 4CK1A 4KR0B 1SVDA 3SDEB 3PW7A 1SKSA 1MWZA 5ETMA 5HMZA 3J7YI 5C2GA 3DWLA 4QPXA 3NG8A 4JI5K 4NX9A 1S1XA 2KU7A 3Q86A 2MZTA 2O8EA 3GIRA 1RHKB 1OQ3A 1HNZJ 4IOAL 3SV3A 3D6FB 2RQ4A 1R0CB 5AT1B 2B43A 4ED7A 1K1QA 3BF1A 1DQAA 1QUVA 2K3IA 1HQ2A 4NLCA 4JYAF 1CQMA 2FUG9 2XY5A 3M9OB 1Q81O 1JXVA 3ZX0A 2DCLA 5GAGP 3L8BA 2B5JB 2J0QD 1O0PA 1N34J 3LDSA 4M94A 1B9FA 5CR4A 3CCMN 3I6PA 2IGIA 3M8SA 4HVJA 2DITA 2ZBRA 2HEKA 2HHTA 4B1XB 4ZOSA 1LXJA 2E9TA 1RTJB 2KHDA 4AL7A 2VD3A 1Q7YO 1Q16B 2B9WA 1R59O 1JL1A 1AUSL 4OLAA 4DOZA 4DTXA 1OVQA 4BR0A 4CZJA 2W2PP 2DNKA 2KTQA 5KFSA 3HOTA 4CF2A 2E2PA 3DRSB 1NH7A 2GS8A 1B7FA 4IZ9A 4HTUA 1YI2N 4LF9F 2NPFA 1O5JA 4B9QA 1DTQB 1MROB 5GMDA 4IFYB 2CA9A 3R9PA 3R3LA 4DV4F 1FNOA 1RDBA 2BXJA 3SI6A 2OPQA 3SMSA 2MZJA 2W7AA 3OVSA 2R7QA 2R2RA 4CEBA 1EQYA 4MDAA 3MM7A 2DISA 4DBQA 4UY85 1QVFR 2DGXA 2FYXA 2VFRA 1VQLN 1S6PB 1G3OA 5TKYA 3SJHA 2OPPA 1NCLA 1TK0A 2EFPA 2D3ZA 2YKNB 1BMQB 4CGHA 4BDZA 4A8KA 3C16B 4F02A 4EU0A 3ENQA 1P8ZA 3CD6N 5J2QB 4QYZJ 1VQ7N 3DRSA 2AZ1A 4FF4A 1JJCB 4DTPA 1N5YB 2AA4A 3RTVA 4UOCA 4Y6IA 1HI0P 4L3NA 4WFBL 1M5VC 3QGGA 3CTRA 3MPVA 3U3GA 4U67L 1SQGA 2Q43A 3BO3A 3IR6B 3UKRB 4DPTA 4WIQA 2M5YA 2RRAA 5C2CA 3C46A 2G0JA 3G82B 3QJLA 4OQJA 3WX4A 1HHTP 4IR1A 5H9EK 1S3XA 5D0EA 1VSLA 1JLBB 3KFWX 5IWAJ 5GADP 1HX1A 2RJZA 1KVKA 1RFQA 2G8KA 1EETA 2CJ9A 3E01A 3JAMO 2IPOB 2Y8YA 2RT3A 2OMLA 4YB7A 1WHWA 5J2NA 2VC1A 4I69A 5M1OA 4H5WA 3OY9A 3PKYA 2DH8A 4DV0F 3WC2A 2X1FA 3BGFA 4C3KA 3MR7A 3R1XA 1FD8A 3ZZYA 1RCHA 3RB6A 2HBYB 5EY4A 3M05A 4DR3K 4KTQA 2XMVA 2HNYA 5JUMA 1Z2ZA 3M6WA 4Z2XA 5HL7Q 2X3GA 4E1MA 5FPDA 5KFMA 4NMLA 1JLQB 3AVHA 4EBCA 2P9IA 3K2PA 2UVVA 2E7XA 1BA0A 5E3CA 1JLAA 4DV3F 2ZUAA 4ED1A 1WJ9A 4DJBA 2YX6A 1EZZB 2BKPA 5IV4A 2Y1LB 1IBCB 2Z1IA 1F21A 3BGRA 3QDKA 3BF4A 4OYZA 2D9PA 1FEEA 3OR1A 4PKDB 1IKXB 2ZKUA 4EI2A 3LW5C 3QNWB 4YORA 4V19X 2GC8A 2F8EX 4BRIA 2X3DA 2Q0RA 1LWCB 5GADU 3W5ZA 3K5MA 4YR0A 4YDDB 3ZT4A 5HQ8A 4DR5J 3NH2A 1JNRB 3BV8A 5AZIB 3NF9A 4NXMK 4LFBF 3CW2C 4DUZJ 4C8OA 2ZBCA 3BN7A 1CQNA 3A8IA 3TSPA 1TTHB 3DRXA 3JTPA 4OX9K 4QOZB 4B02A 3SCLE 1T9UA 4AQYJ 5D3GB 3OTOF 1RT2B 1TL5A 4XEIA 1CS4B 3B4DA 3PW4A 2D3O1 1XMOK 1YJRA 4Q2LA 4XPCA 4OV6A 4NYNA 2R7RA 4O8UA 4BQLA 2N3LA 1RAAB 3GJQB 1HJOA 4DQQA 1C4AA 3C0BA 4ZTFA 2BZ2A 2O1PA 4WXWA 3KWIA 4LFAK 1NH8A 1VS3A 3JSMB 3MUMP 1B99A 5HJYA 4DZDA 1Q7LB 4JI2F 2VG5A 1Q8KA 3VGLA 1H7WA 4R25A 3ZETA 3AA2A 3GIKA 1CXQA 2L9NA 3AXMA 3DXMB 1ZBFA 2VBWA 3GJTB 1U2RA 2CYYA 4OO1J 2WBMA 1OY9A 2XRIA 3CXCM 2CPYA 1O51A 3NBPA 1XMQJ 2F3JA 1XNRK 4RNNA 3AJ1A 2DY4A 1F5CA 1WG4A 3CGIA 1X9WA 4Z4FA 1KFSA 1DEJA 3QINA 1BWFO 2RVJA 1IR1A 4LY7A 5DLFA 4QS7A 2P9EA 4LF2A 2HVIA 4LBPA 1X31C 3QQCD 1N5SA 1G7CB 2AGQA 4LVNP 5KFFA 4OHXA 2AWZA 1IH7A 4DMNA 3LWLA 3MMCA 4OGEA 4Z4GA 3NLCA 4OV1A 5E3PA 4BDPA 3AOBA 1NAQA 1U1QA 3B6BA 3BR8A 4GNIA 3ENHA 4F4ZA 2XTJP 5T7LB 5J2MB 4EAHD 4KHQA 1D3WA 1KBRA 2Q36A 2LSNA 3UB5A 3AVLA 5KFVA 3ZZ0A 3B8AX 3QGIA 3R5DA 2AMCB 3CJSA 3Q8RB 4M3WA 1JXBA 4Z4HA 2UUBF 4MK7A 5TKWA 3BGOP 3QERA 4WK3A 3SLCA 4J2DA 3PW2A 1IBKJ 5E33A 3SMPA 4OLPA 3MGJA 3EMTA 3D28A 1RWOB 3RMBA 3W64A 2VYPA 5B0BA 2V2VA 4JI6F 4H54A 4LF8F 4OFZA 4GKKF 1CLFA 1KVAA 1GTHA 3ILOA 3BN4A 2IJNA 4Q44A 2ATLA 2BE2A 4Y1DA 1R3NA 4BRMA 3L2WA 1FVSA 3HOSA 3A3OB 4QS8A 3DM2B 3KKRA 4AUKA 4J5OA 4LR9A 2BRLA 3CFPA 3ULEB 4BR7A 3N28A 4CJ5A 1I3OB 4UY8T 3GQCA 1HLUA 2Q6CA 3C8YA 1CPZA 3QT6A 1RQ0A 5A2QO 3AO3A 3LDLA 5GAEU 1EXQA 2OFHX 4FK0A 3CC2N 2YHXA 4I1TA 1EWQA 4CHYA 2DXFA 3LM2A 1IJFB 2VQEK 2ZWPA 4CZIA 4PWDA 5IFMA 2ZFHA 1S6PA 3KWGA 3A8JA 3MXJA 1S72N 4JK8A 3Q0AA 5KOWA 2X78A 2QLXA 1Q86O 3R5CA 3MM9A 3DRRA 3NEKA 4BRLA 3DYAA 3KHYA 2J9EA 4X4PA 3T5LA 1NGAA 4WF9L 3H7HB 3SEOA 2COLA 8ATCB 2O8FB 4M5DA 1NKEA 4GV6A 4NLYA 4RJVA 3MFHA 4YOTA 1QAJA 3J81Y 4KAIA 3WT0A 5AQNA 1XIQA 4F3TA 3ZNUA 2CQCA 2RE1A 2R9LA 3VQEA 1GOCA 2V4RA 3D2FA 2W9CA 4JKGA 1NJWA 3OVBA 5MLCV 4GVBA 2C3UA 2B9YA 4CRJA 4FDFA 3TAFA 2M2BA 4RBVA 4F50A 1B92A 4QW9A 1VRTA 1UPMB 2IM3A 3SAFA 2O5DA 4NYOA 3PSFA 5JXSA 2OP5A 2FJVA 2FQQB 2OJ3A 1JNZB 3QGPA 5ELZA 4CZLA 1S1WB 2IHR1 2YPYA 2X7IA 3R6LB 4Q45A 1RBUA 4HYKA 2CQIA 2K1RB 3ID6A 2WBRA 1PBAA 3ZT0A 2VICA 3ASMA 2CADA 1NDLA 1UTAA 1RAFB 5D78A 4K0KJ 4NXNK 2CFXA 2F8SA 2ZH8A 3AVKA 3PR4A 3QJPA 4ECUA 4ZITA 2W6LA 1YWXA 2LQ8A 4XDDA 1PG5B 3QRPA 3DDKA 1SQFA 1IBLK 4PG4A 1NDCA 1TV6B 2ZVSA 1WC3A 4ELUA 3RJMB 3H1QA 1WEZA 3PEHA 1FKPB 3TUIC 1REVA 4RW4A 4BG9A 4JI5F 1JJ4A 5IT9Y 1RGVA 1RWNB 1RTHA 4LF1A 1NSAA 2G2ZA 3OBYA 3MTJA 2QV6A 4WCEQ 1C1BA 2KZZA 3H45C 4A57A 4UT4A 7AT1B 2V8PA 2QL7B 2D41A 2NS1B 2HBZB 3MMAA 4H0TB 2E5JA 3OFHA 2YH1A 4DTNA 3CCEN 4K43A 4RO0A 1IXKA 1NO8A 1HR0F 1F9EB 2AIRB 3H5XA 3NMAA 1YF5L 2AHOB 1TKZA 1RISA 3GSDA 1N8RO 4ICLB 4FJHA 3Q22A 4OX7A 1U25A 1VI7A 4BY9C 4DUTA 4L3QA 5BRDA 3G4SS 2RB7A 4H4OB 2UU9F 4YOYA 2BEFA 4OI3A 4FWLA 3R2CJ 4LSNA 4BC7A 1C0TA 1GNKA 3N6LA 1TL3B 4X4VA 3KD1E 4KGMA 1LWEB 3G87A 1PAEX 1HBNA 4QYZK 2F1FA 3GZ7A 1RTZA 3KD5E 2X51A 3NGKA 1F2HA 2HNDB 4YOVA 2LU2A 2D7SA 3MAAA 4JI8K 3D7SB 2YCHA 1S6OA 2HRTA 3ILIA 3QFWA 1WF2A 4JI3J 2U1AA 4ECVA 3OYIA 4BRGA 1IR0A 4DSEA 5D3GA 3HMJG 1NJYA 1TVRA 2ZOGA 1JLAB 1FI4A 2IA6A 3CCLN 1XK8A 1RT2A 2A41A 4BE2A 3QO9B 1RHUB 1RAIB 4FW2A 4B3SK 3BKUA 1QVGR 4ER8A 1FX4A 4RNOA 2F96A 3KOAA 4KPYA 4LF4K 4X65K 3J81j 3MCMA 1FCAA 4QWBA 4BC9A 2C2EA 4WBFA 1D0EA 4U67Q 2ZJPQ 2MQPA 2Q1LA 2HRYA 3K8VA 2XLKA 2NUHA 4X4NA 2QM1A 3HD2A 4Z37A 3C6HA 2RHQB 2FHMA 2W4CA 2PBDA 4J2AA 3F2KA 2D0AA 4U95A 5A76A 2W7OA 2ZH3A 1RWWB 3MM5A 2VBZA 1C0GA 4NLOA 3ALYA 2QMWA 2FVQA 2WVFA 2OCEA 1Y64A 4ECXA 5LJWA 3PM9A 1VQPN 3PZPA 4EEYA 1LW2B 3IWXA 1A0OB 1TYQA 1JJ2M 3X3UA 1NK4A 3CD7A 2FB0A 2FVRA 1QM9A 2FSKA 5KFTA 4FZZA 2QE5A 5F8IA 1MN7A 1GLCG 2VASA 3L2QA 2N4DA 3V6DB 4P73A 3CJ8A 2F9TA 3QJJA 2F63A 2E5LK 4LRFA 3VA3A 3JSMA 1ASUA 2MGZB 1G1XA 2M3DA 2C3PA 2NSCA 3TP2A 1WSJA 3NAHA 4OZ0A 2YNFA 5F3ZA 2KG1A 1HBUA 1YJ9N 4LSLA 3TJ9A 2Q31A 4B1ZA 4HWIA 1YVFA 1WHYA 4OYWA 2JEFA 3CCVN 3R97A 5JVGQ 4NCAA 1RHJB 3WXLA 1AROP 4H03B 5EGYA 4KFBA 4QU7A 3D6MB 3HTVA 1CZBA 1OYEA 1ZAVA 4PR6A 4DQSA 2LVWA 4GY2B 1CC7A 5AQYA 2RUSA 3DGVA 2ZEJA 4CIGA 4B9UA 2GQQA 1HD1A 4F8RA 4WKRA 4OI6A 3V4IA 1YBAA 4Q8FA 3H46O 4DX5A 4C9DA 1SL1A 5A8KB 3PJ9A 1CG2A 5EVZA 1HQUA 2MY8A 4DPXA 1MA9B 2PZSA 3VTIA 3CCSS 2VG6A 2UXCJ 4ETZA 2A10A 4YNQA 3VQCA 3BGLA 3TJAA 4F2SA 1RT4B 2EXUA 1ZTTA 4ZJOA 1U1RA 2AP6A 2BKNA 1KN6A 2N82B 3OFGA 2GZOA 4CE9A 3WXKA 3DLGB 4KFBB 4JNEA 3EVOA 5E84A 3PW0A 1UW4A 4NWBA 1SKRA 1T3NA 3AA3A 3ITHA 2GNKA 2Z1JA 3VAMA 3EDRB 2MDAA 4U6PA 1PC4A 3O9SA 4R0JA 1IQZA 1V9OA 2VJUA 3EE8A 3UFCX 1KEKA 5AXMA 1WUUA 2OTJS 2JC1A 2DXEA 2GWKA 2Z4PA 4J2BA 3RZAA 1XMQK 1OS5A 1CEZA 2OGUA 1FDNA 2O66A 4KGXB 1FRHA 5M1QA 3LWMA 4K4VA 3OFFA 3SPYA 4DS5A 4Y65A 3CCMS 3EX7B 4HUFA 4JV5K 3K5OA 3U6FA 2C22A 1GEHA 3GYXB 3QT8A 3P45B 5SWMA 4ALZA 3MUVP 3N4PA 4MK9A 4QIVA 1MLAA 4MTPA 2AW0A 4HHJA 4RWWA 1HHQA 1QVFM 4XAKA 1C0FA 2W24A 4E0DA 2F65A 2RF2B 3MMBA 1LV5A 1YHQN 4D3HA 2W8LA 3CM6A 2MJUA 3LP2A 3I8BA 3IM8A 3DLRA 2Z2LA 1UFKA 4LF6J 1DTTA 2VOOA 5LJVA 1TUGB 4JKCA 2E88A 5HMYA 2HFOA 2QSWA 3IR5B 3DNCA 3NH0A 3DRYA 4DU4A 5HL7L 2RIJA 2EKNA 2H48B 1KC8O 3G86A 3ZTSA 3PNIA 4NI2A 3BSOA 2O8DB 2YKOA 1WTFA 2KT3A 3TEHB 2QKKA 5M1PA 1NM1A 4YR3A 4JV5J 3CD0A 3B54A 2UZAA 1LAWA 2X1AA 2QO3A 1NGEA 1MU2A 3M2RA 1FNMA 1VFJA 3O3GA 5K8MA 1KRPA 3MAQA 3MEGB 2E9RX 2CNNB 1RADB 3IFRA 3GIIA 4ELVA 2CQGA 4OZ1A 3ETMA 3ZT1A 4DXLA 4YY3J 4O0JA 2RRNA 5KGWA 1BOTO 1RHMB 5C5JA 3LP1A 3KJNB 2KDOA 1IBKF 4DKWA 3FR0A 3NKYA 1C0MA 4CJFA 3FE1A 2OEMA 2KT5A 2ZH6A 4R5PB 1BA1A 4OI2A 3HPOA 3BUZB 4ILMA 2WZ1A 1WKLA 3HZ6A 2UXDK 3WQTA 3P5BP 3I5CA 3HHKA 2VA3A 1UWBA 1KVBA 2UUBK 4W5RA 3NCQA 3DGPB 1YJUA 4EBEA 2WTFA 2DTUA 2V6AA 2OO4A 3AQOA 4FL9A 1Y5IB 4L8RB 2GGPA 1H3DA 4ZVQB 3D6TB 1U0HB 3I33A 1HNXF 3NH1A 1VLOA 4PG7A 3HSDA 4CLLA 2Y8WA 4F4WA 4JYAK 2K3KA 1FK9A 4AILC 1CSJA 2AJ4A 3BDEA 3GLJA 4M3TA 3VAHA 4QR0A 1WBDA 5H9FK 2JNJA 4UZBA 1X60A 3I0SA 4GKKK 2UXBJ 1NHKL 1IKWB 1X0FA 4A2BA 5M1NA 4FPBA 3TX8A 2KZMA 2KLAA 4YP3A 2JX2A 1RUSA 4DUYJ 4KSEB 1UVKA 3FMWA 4RW9B 2ABYA 4DR1J 1LWEA 4DCPB 4DV5J 4B17A 4A8FA 4DR7J 5GADI 2UUBJ 1HMVB 2EEYA 7FDRA 1RZMA 3GIJA 4JI7F 2ZDOA 4F9OA 3KYLA 1C1BB 2HWHA 4B1WB 3VAFA 4J9UE 1SJQA 4CZFA 4X4TA 2NRWA 3V6KA 2CZVC 4URQU 4I9LA 1YT3A 1ZBSA 2XNRA 1QY7A 3IAS9 3CMAN 2J7KA 2PN6A 2HFNA 4ISEA 1SH3A 3DXKA 1Q8IA 1YI2S 1VGYA 1X5OA 3IWLA 5KRTA 1XHXA 2E6MA 3MEKA 3MM6A 2YY3A 4IFVA 2HVDA 2I8EA 4PQAA 4QQBA 3TSUA 2NQPA 4AHTA 4FZYA 3CETA 3CULA 2NRTA 1NJIT 3EPGA 3B8HA 1S1UA 3ZFVA 2F7TA 2DEJA 3D3BJ 2M8DB 1IBMJ 2W4DA 2WVBA 3O3FA 2RAQA 2HFZA 1RTIB 2P9NA 3A5NC 1MW7A 2WOMB 3L3CA 3FFKB 1Q8LA 4K4XA 1K44A 4FF2A 1E6VB 4AQYF 3HKZD 4NXMJ 5MLCQ 4I6MB 2AU0A 5LJ3Y 3C6TB 1Q79A 4WP3A 2HRUA 3LGMA 1MMDA 1U24A 2BE7D 5ETRA 3ATVA 2A5XA 3VQAA 3VVTA 2WTUA 2BQUA 4X66J 2W9AA 5ETLA 5AXLA 1E6YB 4MYTA 1WEYA 3I5BA 4A8QA 3S3MA 1ZA2B 3H20A 2QW9A 4FLTA 2M9KA 5DK5A 4FYYB 1VQPS 2DNNA 1BHLA 4B3SF 3N4WA 5FPNA 4J9SA 4OZ3A 3EE3A 1ZBHA 2MQ8A 3HO1A 2D69A 4UOGA 2ZBQA 3Q23A 4AF1A 1PYOB 4CO5A 2POKA 2W41A 1R0BG 4MAKA 1FXDA 2R7XA 5KAKA 2CJKA 1QQNA 4V19J 2ZNZA 1BC6A 4H0PA 5F8LA 1OPZA 2P9SB 1I94K 1ASWA 1RDAA 1R8PA 1L3UA 3OYGA 1NZAA 2D0BA 2ITMA 3OLAA 3OTOK 4LSLB 3ZSZA 4OI1A 1HI1A 4BGBA 4B08A 4K5SA 5C0YA 2Y1RI 3CCZA 4G1QB 2E1PA 5B0DA 5HI7A 2DH7A 2EFNA 5DZ6A 4BBYA 3AO4A 1LW2A 2FVPA 2XQCA 4MO5A 2MLXA 4LF4F 1D09B 4BC5A 4WYBA 3G8SA 3AVAA 3H5SA 5AFUA 2V2ZA 1YLXA 1BE4A 3F9KA 3FUYA 5LT5A 2CRLA 4AE5A 4DV7F 1AUDA 1SJ3P 4CO4A 4P7VA 3H6EA 3SCXA 2WC9A 1MWYA 5HLFA 1ASVA 4PKIA 4J90A 1TUVA 4ZK7M 1VRQC 3UW1A 2ZZMA 4FWMA 5J1EB 1J27A 4I2PA 2DHHA 2B9EA 3R5AA 2LXIA 3FSIA 3NF8A 1DURA 2JFKA 2RD5C 1P8GA 3HHLC 4CJEA 3K5PA 4O4GA 2Z58B 5C24B 2OLWA 4JI0K 4RW8A 3H25A 3QPIA 4YOUA 3VGUA 1TAQA 4C8LA 2GX9A 5LSOA 1S7IA 2W01A 1OH5A 4X4RA 1RLDA 3ISZA 1FRLA 3RSEB 3AVJA 2HFVA 4FK2A 1RTJA 1VQYA 1C0UB 2VH7A 2UU9K 3TX0A 2W2MP 2RS8A 2D4WA 4Y28C 3JS6A 4NRTA 4ECWA 3MF5A 2HBKA 4FJ7A 2DHXA 1MG7A 3UKUA 4DPWA 4B1UB 3ZX3A 2HFSA 2FD2A 1DFDA 4ANEA 1ZTWA 1BXNA 1SJFA 1Y3KA 2QLFB 4K4UA 1B9DA 4ZVUB 2ASDA 3IBFB 4NLPA 2H1YA 5C42A 1Z1ZA 4IDKA 3SSSA 3NF7A 4F4AA 5GAGU 1VQ6N 2H65B 1NLKL 3IC1A 1BLUA 3TR5A 3DRRB 1SH2A 2G8IA 1VQNS 2P5OA 3MTKA 4B3OA 3L0QA 1JL2A 3U27A 3QBCA 1RT7A 1YITS 1XWLA 2XS5A 4NZ6A 3G8TA 4ZVPB 5E41A 4K4WA 3LPYA 3L7PA 2J0XA 3VEWA 2WB1D 3ZSVA 2R7YA 3VEVA 4QWCA 1WDTA 3I55N 3THXA 3G2XA 1GX6A 3MUTP 4NLGA 2F5GA 2FJWA 2HHHJ 1CULA 1KDNA 1B7YB 4DTUA 2CQ2A 5KFPA 3ZEUB 3W2VB 1WSFA 3VGSA 1X9SA 4W98A 1V3ZA 1CJUB 3CT9A 3CCQN 3AVBA 2XY7A 2FC0A 4DCJB 3CCVS 5KT5A 3KK1B 2KXHA 4FO0A 2A2DA 5KG3A 2NPIA 3RW6A 4OYBA 5I3UA 3MMVA 1ZA1B 4MIWA 4EHUA 3AOAA 3SIPB 1R8AA 2BOAA 1IKYB 1TL1B 3T5JA 1K1SA 1BQNA 3PLAA 2RSQA 4Q5VA 2ITGA 4NLWA 4DV1K 2DYAA 1JLBA 1RT6B 4UOFA 1NSPA 1OQ6A 2ZE2A 5HAOA 4FXVA 3VR1A 2AKWB 3AVCA 1BDGA 1GLFO 1WSIA 4NASA 2YKAA 4JI0F 3THPA 1VQ9S 2B4OA 4CLSA 1U6ZA 4X62K 1HNIB 3MM8B 1T95A 2H54B 1WSGA 3KKSA 5AR0A 2ZJRL 1C1CB 8AT1B 1NNDA 3CJRA 1XERA 4IO1A 2H3GX 4ZPVR 3D66A 4RUBA 5L38A 3S8SA 2DY9A 5F9LA 5AQIA 2NXEA 3VVUA 3T1HK 3MEDA 2AYEA 3UDEA 5FJ4A 2DHAA 2BM1A 3LA0A 3PIPL 1W2BM 3J8AA 3F9MA 1P6TA 1NGDA 4LC9B 4FWNA 4HL9A 1S4EA 1RKIA 5EX0A 3EY1A 1TMMA 3TR8A 4KAZA 4IBNA 4EO8A 1HIYA 3BGRB 4U96A 3V1QA 4PUOA 5L1JA 1FKOA 5CE3A 3TANA 3JQKA 1BQMB 1N88A 3SQOP 3T3FA 4DG1A 4OKJA 3C14A 1OKJA 1Z2LA 1FXLA 1ICEB 1VBZA 2BKOA 1FDDA 3TAPA 5KRSA 2FHOB 1G99A 1SJ1A 1U2VB 3R5JB 2IMWP 5CD4H 2XMTA 2QWOA 3DMJA 2G8VA 2DRBA 1X9JA 2XZWA 1EKEA 2IC3A 4M63C 4Z4IA 1WOPA 1YVUA 2YWGA 1ZM3A 4ZTJA 2V69A 4NLSA 4ZP7A 2Z56B 3FFIB 1FJGK 2B9XA 3RG6A 2VWBA 4Y0FA 1S9GA 4JK9A 1N36J 1Q82T 3AD7C 2RNEA 1S0NA 4I68A 4WZMA 3GMGA 4AHCA 3BPSP 2YX4A 3OL6A 3M1VA 1TL7A 1RT1B 1RABB 4B9SA 4DLGA 2F9DA 4PUOB 3EE9A 3DLBA 3RBEA 3GB0A 2CPJA 2MMYA 3DXSX 4CD1A 2HGLA 3OYJA 3DLLQ 2N7YA 4C1NK 3CXCR 4GMKA 2EVZA 2O8BB 2AEJA 3MMCB 5CH7B 3C65A 1GXLA 3IRXB 2CG4A 3SQGB 2QT7A 4FP9A 5FLXU 1D8ZA 5DG7A 3MPWA 1TYQB 3M7VA 2CNOB 5K8OA 3K17A 1RHQB 3HFZB 1WF1A 2CNLB 4DFJA 2ZJQQ 2K2PA 3AQPA 2CPXA 5H9EJ 5ETNA 5BPLA 3NOGA 3UNYA 3FCVA 5JS2A 4B3RJ 2MKSA 3HPGA 2B8QA 4FLZA 1WC1A 1CJTA 3U9DA 4FLYA 5AQQA 2YHWA 4CFDA 4K8XA 3L4QA 2XGQA 1NJXA 2PFFB 4E7IA 4Z7CA 1JLFB 2C3OA 1E3MA 4NLVA 3DU5A 2EFQA 2M8HA 1URRA 2Y1JA 3NNCA 2E8AA 2VCPA 3P5JA 2WHOA 2Y3YA 3PSIA 1LAVA 1SIZA 5E7OB 4H5TA 3O8MA 1WHVA 1FRXA 1H1VA 3ID8A 3L6QA 3K59A 2ZH4A 3KLVA 4CZHA 4FVUA 4JI8F 1T94A 5IM0A 4OYAA 3K8WA 1S9EA 3CJKB 2RHKA 3M8PA 2R8GA 4LF7F 4IJAA 2BX6A 1HYZA 3DI6B 1JCFA 2PI4A 4DV2J 1O1WA 3OYCA 1KQSM 3VQPA 2VF3A 1F5BA 1FWLA 1VLYA 1DLOA 2IRUA 4WU2A 5KFCA 1HD0A 4ZN3A 2BJ8A 5HP1A 3L2RA 2ZOMA 4ZN1A 3GU0A 4ZP6A 2MKCA 1TK8A 5LM7E 1TUWA 1M5PC 1IBMK 2B4VA 5IQ6A 5FRNA 4FJXA 3D4JA 4IFEA 1YBUA 2H5JB 1X4GA 4LF5K 3DLGA 1IJEB 4P6QA 3EVWA 3KZBA 4EUVA 4O5FA 2E29A 2I7PA 4DQIA 4X66F 2PMHA 3GFZA 4ANDA 1ATNA 3HSCA 3PX4A 4OX9J 3HBTA 4CM2A 3OYHA 3U1LA 4N77A 2CH6A 5B0GA 3PW5A 2UUCF 2VG7A 1FF2A 1S1XB 2Z8QA 2VIHA 3BKFA 3PJWA 4KGKA 3G0ZA 1SC3B 3MK6A 2GMHA 2JC0A 5AXNA 4ILGB 1HNZK 1IKVA 3QESA 3DN9A 2N3OA 4NXNF 3SBGA 3TA2A 1KLMB 4ERDA 4WFBQ 3FJ2A 4Y00A 4USMA 4DSFA 3HKWA 2BVZA 3FDSA 4LIRA 4JI1K 4CZEA 4QPTA 3RUBL 1LK7A 4J9QA 2V8VA 1VC6A 1C6VA 1H6KX 3MM9B 1T03A 4P75A 2UXDF 3CMAS 3T1HF 3UVJB 1XUPO 5AQHA 2YXLA 3DAWA 4USTA 5D4OA 5D0RA 3T5HA 1P27B 4PL8A 1VQMN 5HRSA 1N4LA 5D4NA 2AEMA 3OTDA 4CJSA 4CI6A 1X4CA 2IVOA 1WDDA 2JJ4D 2HSEB 3WEEA 3LUYA 4DL7A 1X0PA 3PYEA 3GE1A 1KHVA 4CF0A 1RWKB 3NNHA 1UJ5A 4OZNA 3R27A 1TUYA 3ONQA 1ZAXA 2I6WA 3MM7B 1XTZA 1EWRA 3AGKA 3IG1B 3J7Z5 2OFGX 1NJIO 4ZS6A 3CDBA 1F3VA 1X4DA 4RW7B 1U04A 2QIFA 2OPRA 2EG2A 3J7AP 2UXBF 3PXGa 2QL9B 4A47A 1TL1A 3HVAA 4C8NA 3QT5A 4EZ9A 1JJHA 1WORA 4PCQA 2ZH9A 2CZ9A 4FJIA 4IH6A 4YY3K 3MPUB 3A5OC 3WHIA 3BSAA 4ZLLA 1IM4A 2D5RA 4FZVA 3JS9A 2ZBIA 4JHDB 3V9UA 1VQ6S 2C2ZB 4KYZA 3WEEB 2OANA 2OSQA 5LSLA 4M5IA 1L3TA 3IGVA 3ELHA 3OT9A 3FSXA 5CYJA 5D0GA 1FDBA 3M8WA 4OZ5A 2B51A 4WKYA 3OTCA 4DX6A 3S41A 3F5TA 5JICA 2LA6A 3D67A 3P4UB 2JDJA 4QCLA 5KFUA 3EGNA 5JJBA 1YGYA 4JI4J 2JHEA 1GOAA 2UUCJ 3PX0A 4M5MA 1K6YA 4CJ7A 4EIAA 1EO1A 3FZHA 5AZJB 3G96A 4FZXC 3R3TA 1R6YA 2HBJA 5ADXA 4U8YA 5ADXH 3ZTPA 4F4XA