3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
4FXDA 4E19A 4DL4A 2AGQA 3BDPA 4IKAA 4DQPA 2OPRA 1BL3A 4FJNA 1BIZA 4WXOA 3O4QA 4XIUA 1JLQB 2B4JA 3T5KA 2ZD1A 3T1AA 3OS1A 3S3NA 3AVNA 4CJ4A 4M3WA 5DLGA 4DTRA 1U47A 3DLGA 5F8GA 1SV5B 4ZP9A 3CJ3A 5EUHA 3EPIA 3QERA 4E7HA 3MEGA 3OLAA 3RRHA 4EEYA 2A1RA 4RW9A 4B9LA 4IH7A 1Z25A 3UDLA 4BWMA 1NHUA 2ASJA 1VSDA 5EU7A 4FJ7A 1MU2B 3GIKA 4CJUA 1NNDA 5DLFA 4E1NA 4KTQA 4MIAA 1IKXA 4OVLA 3OYBA 2VG7B 4O3OA 1HNVA 5CYMB 2FVRA 3I0RB 3B6OA 3HPOA 4CFAA 2FVSA 4ZVGA 4CIFA 4IRDA 4E7JA 2HNZB 3KD5E 4H8KA 3AVGA 1VSFA 3DMJA 4O55A 3V9XA 5DG8A 3VQ5A 1NHVA 1BI4A 3ZSQA 4DG1B 3SPYA 3IAYA 5KGXA 3HVTA 3CWJA 3SPZA 1TVRA 3MR3A 1YVUA 2DFHA 3V81B 3H4BA 3NGZA 1RT6B 2F8EX 2RF2B 3RBEA 1NOYA 4IFYB 3EPGA 1RDRA 3ZT0A 4NCBA 2KTQA 4DL6A 3I5CA 4NLDA 1KLNA 4J2DA 1FKPA 4KHSA 5C42A 1BQMA 1RTDA 3KK3A 3HVRA 3OYKA 1NK5A 1RTIA 3V6HA 3C95A 2ZQBA 5CYQA 4AHRA 4KB0A 4CFCA 1RA7A 4Q8EA 2FBTA 4QCLA 4CJKA 2G8HA 4RW4B 3DRPA 4O5BA 2G8KA 1LW2B 2DTUA 3TABA 3FFIB 4ECWA 2X78A 3DI6B 5L1LA 3KLEB 4ZTFA 4DU4A 2IDOA 4B9TA 1HMVA 5KTQA 4DL3A 1TKZB 4URQU 4CJFA 4WFZA 4DSLA 4M3TA 4QOZB 5E41A 3AO1A 1CXQA 4IG3B 3VA3A 3RB3A 1U49A 4DU3A 2WONB 4K4UA 3CJ2A 4KE5A 3B6PA 1TK0A 5HP1A 1NJWA 4Q43A 4O4GA 5I3UB 1WAFA 1L5UA 4KKOA 4ED0A 2UVVA 2YHBA 2DPIA 3T5JA 3GIIA 1R0AB 4NLPA 1N5YA 5D3GA 4QW9A 2IBKA 3WNHA 5J2PA 4RG8A 1LW0B 2O4IA 1TGOA 3Q8SB 4ED2A 5KGWA 4IH6A 2R8JA 2J6UA 3V1RA 2I5JA 2OPRB 1GX5A 1NK4A 1RDDA 3E01A 2F8TA 4OLAA 4KB7A 1F21A 4FS2A 4QPXA 3JSMA 1NK6A 3E51A 4ED6A 2ZD1B 4F3TA 4IG0B 3SNNA 1JLGA 4ZTJA 2ATLA 3DLGB 2AGOA 3HHKA 1BCOA 1S6QA 2XY5A 3QEXA 1UOCA 4HTUA 4CJEA 3MEGB 1U09A 1QS4A 3G6VA 4M3UA 3MTKA 4KBIA 4IKFA 4CHOA 1LWCA 4RW9B 1FKOA 1S1VA 1XHXA 4M3ZA 4URGA 5J2QA 2R2TA 1UWBA 4ECSA 2B6AA 3LAKA 2G8UA 4KREA 2FC0A 4CHPA 4ED7A 1IKXB 4WE1A 3H08A 1JLAA 4QWAA 1HNVB 4FM1A 3VQPA 4N76A 4H4OA 4DU1A 4CJ5A 3HVAA 4ZPBA 3BSNA 3D5MA 3KKSA 3DYAA 4ID5A 1WSEA 4J9NA 3ICLA 1LWEA 3NL0A 5SWMA 4NCAA 2AGPA 1BHLA 3DMJB 3GYNA 1YVFA 4RNNA 3THVA 1BI4B 1C1CB 3QO9A 5KFNA 3HVTB 4RUCA 4J9PA 5KFPA 3RB0A 1TVRB 4N56A 3VA0A 4DLEA 1RDAA 2XCAA 4FK4A 1ZBIA 1KSPA 1RAJA 4F8RA 3MEDA 1ZTWA 4K50A 4ZPAA 2W8LA 2C2EA 1IKYA 4K4WA 3PO4A 3KLIA 4WFXA 5EWFA 3GIJA 1C1BA 2W7OA 4N5SA 5DGBA 4F2RA 3MR6A 2J6TA 3OYEA 3KK2A 1QTMA 4M3RA 3G6YA 2UVWA 4HCCA 1FKPB 4KRFA 5C42B 1BQMB 1RTDB 3OL9A 3KK3B 2E9TA 3SUNA 1S0MA 3OL6A 1RTIB 3JYTA 1D0EA 2IS3A 2W9AA 4XPCA 5CYQB 4NRUA 4PQUA 1O1WA 3CM6A 3MECA 4IH5A 4FJHA 1HARA 1HRHA 4YR3A 1D9DA 3QEPA 3O4NA 2OYQA 5KFVA 5DQGA 2YNFA 3VQ4A 1J5OA 3DRPB 4O3SA 3TWHA 4M3YA 4GC7A 4CJRA 4QWEA 4BDYA 4ECYA 4FJLA 1VK0A 3MEEA 1JLFB 3FSIA 3O3HA 4HCBA 2UVRA 2WTFA 4U6PA 3QIPA 4KI6A 1HMVB 5CZ2A 3ZSVA 3VQEA 4QW8A 1SL0A 3TR8A 1RDBA 3AVJA 4IBNA 2FBXA 4CHNA 1RTHA 3OS0A 2B5JA 4CJ3A 1ITGA 3G86A 3NGIA 5KFRA 3P83D 2Z1IA 4B9UA 4YR2A 1VSEA 4O4GB 3GQCA 4YMEA 1RT2A 5KFXA 4KKOB 4I9QA 3FQLA 3PJWA 1WSIA 3QINA 3DM2A 2P1JA 3CFRA 1HQEB 1UA0A 5L9XA 4Q45A 1N5YB 5D3GB 4BE1A 2BQUA 3GIMA 5J2PB 3NAHA 3OL8A 4KAIA 4ECXA 2UUTA 4RW8A 4FZYA 4N41A 3RB6A 4I7FA 2I5JB 3PX4A 3SI6A 4DF4A 2HW3A 5KFZA 5L1KA 3KOAA 2ATQA 3JSMB 3MFHA 4Y1CA 3TI0A 2W8KA 1JLGB 3CJ0A 2RDJA 3CO9A 1D5AA 5KG1A 3OYGA 3SYZA 3K5LA 3FQKA 1S6QB 4F3OA 3QESA 3C6UA 2HB5A 3DLKB 1NK0A 2RPIA 4K4XA 3DDKA 3MAQA 3VQQA 4NCGB 3BJYA 4CIEA 5EWGA 1FKOB 3OYIA 1S1VB 4C8MA 1RT1B 3TQ1A 2UUWA 2IMWP 4DQIA 5J2QB 1UWBB 2E9RX 1RT3A 2B6AB 3MFIA 3LPUA 4ED3A 5JUMA 3V1QA 1S9EA 2HNDA 4YP3A 4FYDA 3NCIA 3ALYA 3CDUA 1JLCB 4WE1B 1A5WA 3PUFA 1C6VA 1JLAB 3RMBA 1S6PA 1SKRA 4H4OB 2XY6A 2YKNA 3RMAA 4CJLA 3NH0A 4FLWA 3DYAB 1JXEA 4W5NA 1K1QA 4NLRA 5KFFA 4JS4A 4M95A 4CEFA 1LWEB 3D0PA 3Q8RB 4XPEA 4TN2A 5KFTA 2HNYA 3EYZA 3QO9B 4CJPA 1NOZA 2YNHA 5I42A 4ZMMA 3IG1A 4CF8A 2RKIA 5J2MA 3V6KA 4CHQA 1S9GA 4PWDA 3MEDB 3NHGA 3I5BA 1KVCA 1IKYB 3TAGA 3KLIB 1IO2A 4O0IA 3PW7A 3QLHA 1C1BB 3TVKA 5J1EA 1NKCA 1RYRA 2AU0A 3KK2B 3RR8A 3DRSA 2OZMA 1YTAA 1WSHA 3OYAA 4F4WA 3JYTB 3ITHA 2GUIA 1D1UA 2XCPA 1X9WA 3MF5A 1T3NA 2OPSA 3V4IB 3MR5A 4PQUB 3MECB 2OPPA 4K4VA 4IFVA 2HHVA 5HLFA 3HT3A 2XI3A 1J5OB 4JV2A 4I9LA 3NH2A 4I2PA 4DLGA 2EHGA 3Q8PB 2OA8A 3NKYA 2DY4A 2BGGA 4DL2A 3TAEA 2F96A 3ZSWA 5KFCA 4NLXA 3ZT3A 5KFAA 4TLRA 1TV6A 3QIPB 3ASMA 3NF8A 3ZSRA 3DLHA 4KSEB 1KHWA 2BANA 1VSJA 3HP6A 4J9OA 3TARA 5EDWA 2OH2A 1C0UA 3K59A 1HYZA 3V6JA 1T03A 4CCHA 3HP9A 1RTHB 3BGRA 2B5JB 3PX0A 2AJQA 1XHZA 4ICLB 3SFUA 4DTNA 5DGAA 4ZPDA 4KV8A 2V4QA 1RT2B 1ZBUA 2GC8A 2IC3A 3AA3A 1NK8A 5FROA 4NRTA 2FJVA 3DM2B 4IOBA 4JLHA 2E6MA 4ID1A 1HYSB 3L8BA 4ZHRB 4OPKA 3KMQA 3OYFA 3AA2A 4RNFA 5HRRA 4CGFA 4RW8B 1BIUA 1S9FA 4I7FB 1TKTA 1CSJA 2YV0X 1RTJA 2AX1A 3N6LA 2E4LA 3ZT2A 2OPQA 4ECVA 4KB1A 4EZ6A 3T3FA 1C0MA 1EKEA 2OZSA 2BRKA 4DFKA 2Y1IA 1S1WA 3KJVA 4K4SA 3AVHA 1BQNA 4WFYA 5KT5A 4O0JA 3M9MB 2C22A 3C6UB 5KT3A 3QGHA 2HHUA 2Y1JA 3PJXA 4TY8A 1RBUA 4CGHA 2IOCA 4FLUA 3DLEA 1YT3A 3VQBA 3GV8B 1KFSA 2HHQA 2LSNA 5DG7A 3BREA 1LAVA 3KIOA 1TAUA 4DTXA 1T7PA 3CYMA 3BQ1A 4NYZA 1RT3B 1S9EB 2GIQA 2HNDB 3M8PA 3AVIA 1QUVA 4EZ9A 3NAIA 4NLSA 4TYBA 5KFMA 4LSLB 5F8HA 1JL2A 3VQ7A 4DL7A 3BR9A 3LDSA 3CVKA 1S6PB 2VA2A 3AV9A 1C0TA 2YKNB 4HHTA 4FJIA 4HKQA 4DS5A 1W9HA 2V9WA 1S0OA 1WSGA 1JKHA 3NAEA 5KFHA 1NKBA 1RDCA 3NF9A 5HROA 3G10A 4HUGA 5KFBA 3PV8A 2YNHB 2Q3SA 4B8CA 4KHRA 4AHVA 3PZPA 4QWDA 1S97A 3IG1B 3NGDA 3A2FA 5J2MB 3EZ5A 4EO6A 1IKWA 3OY9A 1Y97A 4OPJA 4BDPA 4FJMA 1S9GB 4PWDB 3K58A 2BQRA 4DSEA 1B9FA 1C2PA 5J1EB 4O4RA 4Z4FA 1T05B 3ZCMA 3SUOA 1Q9XA 2J6SA 1WSJA 4Z4CA 4KTZA 4NLVA 3ZT4A 3DRSB 3M8RA 4ED1A 4KFBA 3SQ1A 3BSCA 1A5VA 4KHYA 5HRSA 3ISND 4MKBA 1RT5A 4O3QA 4DQSA 3OJUA 3ITHB 3KLFA 1KVBA 2Z1HA 4Z0UA 2QV6A 3LP0A 3HPHA 2OPSB 3OLBA 1JXBA 1TAQA 2OPPB 4IFVB 3L3UA 1KFDA 3QEIA 3H98A 5HLFB 4J2EA 1QAIA 1S1XA 1SKSA 1WLJA 4DFJA 4I2PB 2R8HA 3AVMA 4ECTA 1S49A 3SZ2A 2HHXA 3H5XA 4JV0A 5KFIA 3RR7A 1S48A 1TKDA 3NFAA 2D0AA 3PR4A 2BE2A 1TV6B 4DTOA 4KHWA 3OSPA 2BRLA 3AO4A 2ILYA 2BANB 1NK7A 3D45A 4J9KA 4ECRA 2WOMA 3TAQA 1TKXA 3HSTB 4F2SA 1GOCA 2VG5A 1T03B 2R8IA 4WYWA 4OLBA 4WZMA 3BGRB 1N56A 3OYHA 2PYLA 3GILA 3U6FA 4B8AB 1SH0A 3G6XA 4AHTA 4KV8B 1VSKA 2YKMA 4RW6A 1JLEA 4DTSA 2IC3B 3H40A 4FW1A 2FVQA 3QETA 4OGEA 4MK8A 4DSKA 4CEDA 3H5YA 3VQSA 4J2BA 4TQRA 1G15A 2R7YA 4NZ0A 1K1SA 2HWIA 4FM2A 1VSLA 2AQ4A 2HMIA 2HWHA 4OL8A 5DMRA 3VQCA 3OYCA 4G1QA 4EBCA 1TKTB 4H4MA 1RTJB 1HQUA 3MXIA 4FM0A 4FBTA 3HJFA 4J9SA 2OPQB 4CJTA 2G8VA 2F8SA 3Q8QB 4URSA 3OSNA 4FBUA 4GMJB 3V9WA 4MFBA 3SV3A 4FVMA 5HRNA 1IM4A 1S1WB 4CECA 4BWJA 3RMCA 3HO1A 3AA4A 4C8NA 4AHCA 1JLBA 3KJVB 1BQNB 2CKWA 3LPTA 4E1MA 3CFPA 4KPYA 1IKVA 4RUAA 2JEFA 4TY8B 4Z4HA 4IQXA 4KAZA 4F50A 2FBVA 2R2RA 2XI2A 4M94A 1K6YA 4CHZA 4Q0BA 3K2PA 3VQDA 3SV4A 2QKBA 1I3AA 1BCMA 3PR5B 5JS2A 4DQRA 3M8PB 3DOLA 4ZPCA 1L3UA 1BGXT 1ASVA 5KT6A 5EWEA 2FBYA 1N6QA 3WNFA 3HVWA 1EXQA 1C0TB 2XWYA 4ELUA 4IRKA 4Y2CA 4LSNA 3OYMA 4RW7A 4L8RB 2B43A 1Z4UA 5KFKA 1JKHB 2W9CA 2IA6A 2XY7A 5K14A 2EX3A 4DTJA 1NJXA 1S10A 3QZ8A 3M9OB 4CEZA 5HROB 3GV7B 4ZP7A 4MH8A 4M45A 5KT4A 4K4YA 3IGVA 4FK0A 4Z4IA 1CLQA 5KG0A 2JEGA 4Y3CA 1HYVA 4CEQA 4MK7A 2DPJA 1KCFA 4OKEA 4K4TA 4FLTA 3AVAA 2HVHA 1WN7A 4DEZA 4K8ZA 1I39A 2I1RA 4E7LA 4J9LA 4DTMA 5HP1B 3LP3A 3ZT1A 2WRMA 2D0CA 3OS2A 2WHOA 1RT5B 1SH2A 3HKWA 4LY7A 1GOBA 3KLFB 3LP0B 3K5OA 4ZVFA 3H2LA 1EETA 3T5LA 4Q8FA 4CGDA 3FDSA 4CJVA 2DFFA 5FRMA 1S1XB 3BSAA 4FK2A 5J2NA 3E01B 3ZSZA 4KO0A 3PW4A 4E0DA 4O44A 1X1PA 2RN2A 3T5HA 1ZBLA 4PA1A 2BE2B 4HUEA 3KK1A 5KG3A 3IRXA 3RB4A 2HNZA 2Z1GA 2WOMB 4TYAA 5KG2A 4NLGA 1TKXB 2VG5B 3SCXA 3CFOA 3SQ0A 4FLVA 3HK2A 4B9VA 1C1AA 2V4RA 1GOAA 3RRGA 1LWCB 3UPFA 4B9MA 1X9SA 1MMLA 1XR7A 4HVJA 3MXMA 4CF2A 2YKMB 4RW6B 1JLEB 1RT6A 4Y34A 3NGYA 4YFUA 4NLOA 4C8KA 1SL2A 3KLHA 2D41A 2HMIB 4G1QB 4PY5A 4ID5B 4J9MA 3VQ6A 4H4MB 3QGIA 3OYDA 1HQUB 4EBDA 1I6JA 4NYFA 3OHBA 2DFEA 3U3YA 4R8UA 3PW2A 4OJRA 4DTUA 5KG4A 1IG9A 4DSFA 5C24A 1JLBB 1SUQA 1S1UA 2GBZA 2JEIA 1XC9A 5KT2A 4C8LA 4W5OA 1L3VA 1IKVB 2IGIA 1KLMA 4CF1A 4KTWA 3BQ0A 2PZSA 4MQ3A 4CF9A 3TAFA 1WNSA 4Q0BB 1SKWA 3G0ZA 3AVBA 4AH9A 3SUQA 1QE1A 2BQ3A 2CJQA 1TK5A 1ASUA 4YNQA 5FDLA 5SZTA 3DOLB 1Z26A 4B3OA 4I2QA 1N6QB 2WONA 1J54A 5JXSA 4OKJA 4E3SA 5KI6A 4CESA 4LSNB 5KFEA 2FJXA 2PY5A 2IJFA 4CK3A 4YR0A 2W7PA 3I8DA 2YNFB 2W9CB 3I0SA 4DFPA 3NF6A 2JC1A 4O3NA 4N47A 5L1JA 1DTTA 3NF7A 4LH4A 3MEEB 1HNIA 4EYHB 1ZBFA 3VQ9A 4LQ3A 4F4KA 1JXLA 4NYNA 3ULDA 3N6NA 3DLBA 1WAJA 2FLLA 4CJWA 3CJ4A 2VG6A 4FJ5A 3AVKA 3DRRA 4QAGA 5F9LA 4XO0A 4RU9A 3LWMA 1S0NA 4DSIA 4IG0A 4RNMA 4G3IA 1ASWA 4CK1A 4BDZA 4MIBA 4CGGA 2ILZA 3RAXA 3L2WA 1B9DA 5DQIA 4Y1DA 1RBVA 2QXFA 2JGUA 2WB4A 4NLYA 5KT7A 2X6NA 2D5RA 4BE0A 1EETB 1A5XA 2KZZA 1CZBA 2XGQA 4CEEA 4CGJA 1VRUA 2R8KA 3L2VA 3CQ8A 4K8XA 3UR0A 5J2NB 5CY4A 4DTPA 3NDKA 4KO0B 1VSIA 2ALZA 4CF0A 3I5AA 1L3SA 1LAWA 4RNHA 4O44B 2P51A 4AILC 3EY1A 3LZIA 3KK1B 3OVNA 3LZJA 1LV5A 5F8JA 3IRXB 4WZQA 3BQ2A 1JL1A 1REVA 2VA3A 2YNGA 4R5PA 4IR1A 3SFGA 3K57A 2G8WA 4E7KA 4FJGA 3ISNC 4NLQA 4DMNA 1C1CA 5KFWA 3LP2A 2W42A 3IS9A 3L2UA 1J9AA 5KFQA 3CG7A 5KFYA 1KRPA 4NLWA 1W25A 3WNEA 1S1TA 4B08A 4FLXA 4ECUA 2HVIA 4Z4GA 2FVPA 3NBPA 5F8LA 1U48A 1BISA 3KTQA 2NUBA 1XR5A 2VWJA 1KHVA 1J53A 4LH5A 3KLHB 1XI1A 5KFSA 1IH7A 3HYFA 4NLUA 4MKAA 3L3VA 2KFZA 2IM0A 2IM2A 2FLPA 3RBDA 2RDIA 4HYKA 4CE9A 1KVAA 3DOKA 1ZYQA 3KLGA 4U7CA 2FVCA 4CEOA 4R8UB 5KFJA 4WXWA 4ZP6A 1RA6A 1KTQA 2HNYB 3LP1A 2XY8A 5I42B 3P5JA 4MK9A 5C24B 1SUQB 1S1UB 3M8QA 4LD0A 5F9NA 2RKIB 1VSHA 1HJRA 4OGCA 4O3RA 1VSMA 1TP7A 1ZETA 4PUOA 3AVFA 3SJJA 3V6DA 4NLTA 1T8EA 3QLHB 1JLFA 1KLMB 5L1IA 2X74A 4CERA 1XR6A 3TANA 2KQ2A 4GC6A 2XO7A 3RMDA 1U4BA 5JS1A 4B9SA 1QE1B 4DFMA 1TK8A 1CZ9A 4TY9A 2GIRA 3TAMA 3QYYA 4F4XA 1UAXA 1S4FA 1TL1A 3CIZA 5FDLB 2QK9A 3KLVA 4B3OB 3HL8A 4I2QB 2WCXA 4TSXA 4FJKA 5DQHA 3ZSOA 5KG5A 1D9FA 5C25A 5T7BA 1FK9A 2G8FA 4Q5VA 1HPZA 3U3GA 4ED8A 4IRCA 4CK2A 3I0SB 3EZUA 3VQ8A 3ZSXA 5KFDA 4M3XA 3QIDA 4FCYA 1NKEA 1ZBHA 2KZMA 3KMSA 1DTTB 1HQEA 1TQLA 4Y2AA 4E89A 1HNIB 4ELTA 1QHTA 4K4ZA 4M42A 3MR2A 4W5RA 5DG9A 3GV5B 2VG6B 1QSSA 3L2QA 3O3GA 4BACA 4JRPA 2C2RA 3OJSA 1W0HA 2WK4A 1C0UB 3DRRB 2X6SA 3KKRA 3ZSYA 1RBSA 1B92A 2FLNA 4UQGA 1TL3A 2JLEA 1EP4A 4EYIB 1XWLA 4Z4EA 4EBEA 1YTUA 1NJYA 1RCHA 4J9RA 4QWCA 3KNAA 2VWKA 3DLKA 3M8SA 2ZKUA 1RT7A 4YQWA 5HRPA 1JX4A 4R0EA 2W9BA 4TQSA 2IAJA 4NCGA 1VRUB 5KFUA 3CDWA 4JUZA 1RT1A 1UA1A 3HM9A 4CHYA 1VRTA 3FRZA 4CFDA 3QNOA 2EC0A 4ELVA 1DLOA 2ITGA 3QEVA 1JLCA 1S5JA 4FJXA 2KFNA 3AVCA 2O5DA 3KD1E 4FJ8A 4H54A 4FS1A 1X9MA 2HHWA 5KG6A 3LANA 2O4GA 3NMAA 5HBMA 1T94A 3RWUA 3H5UA 3HXMA 1REVB 1L3TA 2YNGB 3PHEA 4DQQA 4DWIA 4R5PB 1Q9YA 4ECQA 2AWZA 2YNIA 2XRIA 4IDKA 3C6TA 3H4DA 3DLEB 3RTVA 2BDPA 4F4ZA 3PY8A 3LP2B 3NE6A 3IS9B 4KHMA 4CIGA 1JIHA 3V9UA 4KHUA 4WYLA 3KHRA 2C2DA 4B9NA 1S1TB 2PYJA 3AO2A 1RT4A 3SQ2A 3NBPB 2HHTA 3AA5X 3QNNA 3C94A 3D28A 4ECZA 4KI4A 1LWFA 4C8OA 2G8IA 3DOKB 1QAJA 2A1SA 4O3PA 2ZE2A 1DTQA 3KLGB 1RBRA 2D0BA 3CJ5A 4QWBA 3H59A 4DF8A 4RNOA 2ETJA 5KG7A 4GVMA 3LP1B 2XC9A 1SL1A 1WNEA 5KRTA 3LALA 3V4IA 2XGPA 2HAIA 3KHGA 1WSFA 3MXJA 4E7IA 3F9KA 3PO5A 3M8QB 3BSOA 4EP4A 2P5OA 1IKWB 4CFBA 3LAMA 3IGNA 2R2SA 2BR0A 4PUOB 3V6DB 5F8NA 1JLQA 4HUFA 5CZ1A 1NJZA 2AX0A 3OYLA 3SI8A 2JEJA 3PW5A 2GV9A 3WNGA 3V9SA 5F8MA 4KFBB 2FJWA 3TAMB 1SV5A 4KHNA 1TL1B 3RAQA 3TAPA 3PW0A 4AHUA 4FW2A 3O3FA 4M41A 3OYJA 3SUPA 3L2RA 2E6LA 1QSYA 5C25B 2IM1A 4ICLA 1FK9B 1RILA 1HPZB 3CM5A 4EP5A 5C5JA 3H5SA 4AHSA 3K5NA 1MU2A 4Q44A 3KHLA 4JRQA 3QGGA 1ZTTA 3K5MA 2XHBA 2VG7A 1HYSA 4ZHRA 3P1GA 1RNHA 1QQCA 3UIQA 5CYMA 1N48A 3I0RA 1D8YA 4DSJA 2QE5A 3HPGA 4DS4A 4FZXC 1N4LA 1OS5A 3DLRA 3V9ZA 4DG1A 4W5QA 1TL3B 4DL5A 1EP4B 4FLZA 4FJJA 4CEBA 1CXUA 4EO8A 3PVXA 3T19A 3KHHA 3V81A 4OKKA 2ASLA 2QKKA 4JV1A 2R2UA 4ZP8A 1RT7B 2RF2A 1Q8IA 4CEAA 4IFYA 5KFGA 2W9BB 1SH3A 2IJNA 1RBTA 2IAJB 4BE2A 2E9ZA 2D3UA 4FJ9A 2HHSA 4FLYA 2IM3A 1VRTB 3PX6A 4TXSA 3VQAA 4CJQA 1FXXA 3OL7A 3AO5A 1DLOB 4ZVHA 3M9NB 2R8GA 4LSLA 3V1OA 3AVLA 1QSLA 3QEWA 3N6MA 4KHQA 4MFBB 5KRSA 3S9HA 3SQ4A 3S3OA 5HBMB 4W5TA 4RW4A 1EX4A 3AO3A 4IR9A 4X2BA 1LW2A 4RZRA 3QZ7A 3FFIA 3QIOA 2YNIB 2P5GA 4IDKB 3C6TB 2UVUA 3DI6A 5KFLA 3KLEA 1RYSA 4J2AA 3CDEA 3OHAA 1TKZA 4GW6A 2D7SA 5T14A 5FRNA 2C28A 5DK5A 2KW4A 4JS5A 1RT4B 4CJSA 4ZVEA 4IG3A 1GX6A 2JC0A 1T05A 2V0NA 1LWFB 3LWLA 2Z1JA 4FZZA 3NH1A 2YHAA 3VN5A 4RW7B 2D3ZA 1U45A 2ZE2B 1DTQB 5I3UA 4LQ9A 3UQSA 3OYNA 5K14B 3S3MA 1NK9A 3F73A 2ASDA 4J9QA 4CGIA 5F8IA 5KFOA 1U04A 1R0AA 3IN5A 4F4YA 1LW0A
chains in the Genus database with same CATH superfamily
4KHPF 4DL4A 2W6LA 4BQLA 2VOOA 1BL3A 5AQXA 3O4QA 5ETQA 3H1QA 4CZLA 1N34K 4PPDA 1VJWA 3RVCA 3CMQA 3FZHA 3S3NA 4M3WA 1U47A 3BV8A 2Z2YB 3L7PA 1SV5B 5EUHA 5B0DA 2ZOGA 3OLAA 3M05A 2Y0SD 3Q22A 1VQ7N 4B9LA 1MLAA 2ZBPA 3W63A 2E8AA 4EFHA 1FDAA 4BS2A 2F4VF 2G13A 4CJUA 4CTAB 3E9LA 1XTZA 4JYAJ 2H5IB 4AL6A 5AFUH 3WHIA 3HPOA 4J9VA 4E7JA 2GA7A 1V3SA 3MPVA 1Y5IB 2G0CA 3BKUA 3MM8B 4H8KA 4NEYA 3PDNA 3J81Y 1BI4A 2VKZG 1W2IA 1YF5L 4K42A 3VTHA 5GVQA 2HIYA 1IV0A 3ILLA 4YN3B 3D6TB 1BA0A 3CWJA 3DKDA 2QN6B 3SBMA 4JKGB 3BF4A 2DFHA 4JI6K 3NGZA 2G0JA 4FPIA 2QL9B 3N5BA 2RF2B 4X66J 2GVZB 3EPGA 2ZBRA 3P45B 1T6DA 5IT9U 1XUPO 5IWAJ 4HTLA 4WK1A 4H0TB 2LCWA 4DL6A 3I5CA 2MQNA 3MM6A 1HNZF 3PIOL 1Y5NB 1Q82O 4B02A 3C6AA 3HVRA 1RKIA 4RU2A 3TZWA 2QSWA 3BGOP 3ZEUA 1KC8O 1JXVA 1ELOA 5ADXA 4I6WA 1IWGA 2JFKA 4X4UA 1RA7A 2FBTA 2G8HA 3IKMA 2EW9A 3DRPA 4O5BA 2G8KA 3TTFA 2ADCA 4DV4F 3EKUA 4ECWA 1DHMA 4JI7J 4ZTFA 4DU4A 2IDOA 4OQJA 5KTQA 1YIJN 2LEAA 2QZ8A 2MQOA 2GWJA 4M3TA 3O5TB 1IVZA 3HFVA 2MB0B 4X4QA 1CXQA 4IG3B 4B3MF 5F0UA 2P9UB 5BR8J 2F65A 5T7LB 3B6PA 4OZ2A 2VPYB 1MWQA 1NJWA 2JVOA 3LDNA 1AFIA 4QIEA 4H5NA 2G1DA 2VKRA 1L5UA 8ATCB 4YORA 3GIIA 5GAHP 3GP9A 4U8YA 5HO4A 1LK7A 3FZLA 1ZM4A 4RG8A 2O4IA 5AFUA 1TGOA 4ED2A 1KDNA 2WUSA 5KGWA 3WX8A 2J6UA 3V1RA 3M5RA 2OPRB 1GX5A 1RDDA 3E01A 4KB7A 5EGYA 3JSMA 2DEIA 2KRRA 3E51A 5G0RA 4M5JA 2UUAK 4ZPWR 1SI9A 2CJ9A 5B7WA 1OQ3A 3BM7A 3CCQS 3HHKA 4P75A 1BCOA 2XY5A 2RQ4A 3AY0A 2XHCA 3SQOP 3MEGB 1U09A 4JKAA 2KYZA 2JWKA 4M3UA 3NS5A 1XIQA 4PKHA 1OY6A 3BEGB 4RW9B 1FKOA 1DBDA 4GKKF 4NLBA 1Y9OA 2R2TA 1T9YA 3D0HE 2DCLA 4ECSA 2FLOA 3EJMA 2NZTA 1H73A 2FC0A 3W8PA 1JJCB 1FJGK 1IKXB 1JLAA 3S7RA 5IM0A 1J5EK 4HVZA 2XSFA 2B4PA 4AFFA 3FE1A 4F25A 4CJ5A 5AR0A 2KDOA 1WOSA 4ID5A 1S72N 4A8YA 3ICLA 3LDLA 1RHUB 1P9YA 3JTNA 1S6UA 4NCAA 4A8QA 4N7TA 1BHLA 3NGSA 1YVFA 3HZGA 4ILHA 4CDIA 2JFDA 5KFPA 1Q95G 3RB0A 3Q2TC 4DDFA 2G1HA 3JTOA 2GZOA 1ZTWA 4K50A 1SQFA 2IDLA 1C1BA 3CJ1A 4M63C 1RFQA 3QJJA 4CLPA 4PAAA 2AW0A 4QU7A 4WFNQ 3OD2A 5C42B 3NS6A 3OL9A 2F40A 2LP4A 1S0MA 2MHNA 3OL6A 2SXLA 2XLJA 3CMAS 5CYQB 5IT4A 4MKYA 1H2UX 4IH5A 2J8AA 3EICA 2UU9K 1B64A 1HRHA 3OUYB 4YR3A 1D9DA 1RCOB 4RBUA 3FZ2A 3O4NA 2OYQA 5KFVA 5DQGA 2RRAA 4WCEL 2XLKA 1U8SA 4O3SA 4M3YA 1Q79A 4GC7A 4CH0S 5BYRA 4BDYA 4FJLA 4NL5A 5IT9Y 3FBFA 4HCBA 2GTDA 2BJ1A 3TYTA 3QIPA 1SQEA 1GMWD 3HOSA 3BO4A 3LH2S 5ETPA 2LEPA 3G86A 3MK6A 5KFRA 4FWKA 4KH1B 2Z1IA 2UXDK 4YR2A 3KJNB 4O4GB 4USKA 3CERA 1CJTA 3CCQN 1XN9A 2PT0A 2OUGA 2D69A 4W4MA 4YOUA 3D6FB 2P1JA 2DXDA 4C1NK 3CFRA 1HHTP 1HQEB 4Q45A 2CJYB 4BE1A 1WEXA 5J2PB 4IJNA 3UKRB 3MPUB 4ECXA 5A2QO 4FZYA 4BC3A 5E5NA 3GYGA 3RB6A 3ENAA 3PX4A 4DF4A 2HW3A 3Q7BA 5KFZA 2KT5A 3HSGA 1YSJA 2KHOA 2NREA 1UFWA 4M5GA 4PG7A 1WF0A 1GK8A 5KG1A 1X4CA 2DT9A 4OI2A 1DARA 1HBUA 3BH7B 4DBQA 5B8HA 4C1NI 2NS1B 4NO7A 4PXEA 2AA4A 4QR0A 4B3TJ 2K3KA 4M8LA 3MAQA 2QA4G 3BJYA 4CIEA 2DY9A 3P8BB 2KG1A 1S1VB 4C8MA 1RT1B 1KKHA 3TVYA 4DL0C 5JICA 4DQIA 1HWJA 4WIQA 5AJ3F 4DCHA 3W0LA 4RLEA 5U47A 2MKYA 5BRFA 3LPUA 1S9EA 3CDUA 3FVYA 1U7LA 4USTA 4H4OB 2J9DE 3AOBA 3TA1A 4CJLA 1RAGB 3NH0A 2VC1A 1K44A 4FLWA 3KXDA 3DYAB 4NLRA 3DLLQ 4U7UD 1LWEB 1E6YB 3G8TA 4X64J 5KFTA 4UUWA 5E3PA 3C16B 3C14A 2YNHA 5I42A 3R5DA 3IG1A 1Q7LB 3BS9A 4CHQA 1S9GA 3MEDB 3I5BA 3S41A 3QLHA 4B3RJ 5CHIA 1N32F 5J1EA 5IV3A 3AQOA 3I31A 5EX0A 2AU0A 3C15A 3KK2B 2RQKA 1OMSA 4EK2A 2OZMA 4CVNE 3M32B 1YTAA 1X4BA 1B0TA 3UFCX 5BREA 3HSCA 2DISA 5DRKA 3GB0A 1T3NA 2KU7A 2OPSA 3MR5A 3M6GA 4K4VA 5A0YB 1U02A 3I96A 1OSCA 5HLFA 1R27B 3RBXA 4Y2IA 1W2BR 1QD1A 1ZAVA 3NH2A 4DLGA 2EHGA 2RHSB 1LNQA 1VQ9S 1F5AA 1HBNB 4DL2A 3I32A 3ZT3A 5KFAA 4TLRA 1RWPB 4KSEB 3EXYA 4F9OA 4IDHA 1VSJA 3TX8A 2DHHA 2QM1A 3BUZB 3TARA 4JN4A 5EDWA 3MAAB 3OXGA 2W25A 4CCHA 1RACB 3HP9A 2A40A 1FJ7A 2B5JB 1UWAA 3PX0A 3KWMA 2IRYA 1KVIA 1XHZA 3WEEA 4ZPDA 1YBUA 3AA9A 3IR6B 3VVTA 2V4QA 2IC3A 1VQOS 3W9JA 4X4SA 4X66F 1NK8A 1PYOB 1NGBA 3IBFB 3MN9A 4IOBA 1O8BA 1XMQF 2RILA 3GFYA 1PILA 2Y0BB 2WC9A 1HYSB 3L8BA 4RNFA 1PJ7A 4A8OA 3MCPA 5HRRA 1U2RA 1FFGB 1AYEA 4PG4A 1UP1A 1BIUA 5C2CA 3BH6B 2EWHA 2MGZB 2AX1A 1NSKL 2DR5A 2OPQA 4HH0A 4KB1A 3TO8A 3F9MA 3R5BA 3RGIA 3T3FA 1F6TA 2L9WA 1RQ0A 4FSVA 2V7ZA 3PG9A 1E3MA 3MD1A 4DV5K 1U2CA 1WHXA 1S1WA 4FNIA 3AVHA 4WFYA 1EAYC 5LXYA 3NOGA 4ATNA 1X31C 3M9MB 2GO8A 2HBMA 3UVJB 2Y3YA 2HLUA 3C6UB 4HTJA 3HZ6A 3D67A 1TMJA 4TY8A 4CGHA 3DLEA 2VJVA 1YT3A 1HBMA 2HHQA 2E1AA 1RAAB 1TAUA 4XEIA 3THTA 3CYMA 3BQ1A 3M6XA 2VCPA 3NWRA 2ZUGA 3BGUA 4ANEA 1UVMA 2HNDB 3M8PA 3AVIA 2P9IA 3OA9A 1RBOB 3ZYYX 4TYBA 1JL2A 4DL7A 3BR9A 3LDSA 3X3UA 3JTPA 4X4VA 3CTRA 3AV9A 5GAGU 4DR7F 4HKQA 1XC3A 3M1VA 5HMYA 1ZA1B 1NM2A 3NAEA 1XNQJ 3NF9A 3OXLA 3K2YA 1U1NA 3V2UC 1U1QA 1SJFA 1BDGA 4BY9C 1S97A 4KBOA 3R1HA 2PFFB 1SJQA 4DOZA 2VH7A 3OY9A 3TUPA 4DPYA 3T69A 4FJMA 2BEFA 4ER8A 2FC8A 3O44A 1VIOA 3VAIA 4UZCA 1C2PA 4LFBK 4Z4FA 1T05B 3ZCMA 1WSJA 4CD3A 2HURA 3M8RA 4ED1A 5HRSA 4A8WA 2ZHBA 1Q7YO 1KOHA 5KQDA 3KLFA 2HVDA 4Z0UA 3MTJA 2ZGYA 3AAPA 4AQYK 1JXBA 2DJWA 1TAQA 2OPPB 2DHXA 4UY85 3FC9A 1JCGA 4JI8K 2VF3A 3AY9A 4GRSA 2JX2A 1X4HA 5FPMA 1SKSA 3CUNA 1GMUA 4DFJA 3AVMA 2KKHA 1YWXA 5KFIA 1R6YA 1S48A 2B7BB 4K41A 2DIUA 5K9FA 2FSJA 2ILYA 2BANB 1NK7A 1G6BA 4J9KA 3H25A 5BRDA 3Q8UA 1V4TA 1TKXA 3HSTB 4ILMA 1VQKS 1GOCA 3CMEN 1T03B 3MCOA 2ALYB 5CH7B 3BGRB 3E1YA 3OVBA 3C7NA 3ENWA 2RH3A 1QVFR 3RSEB 3HCXA 3IFEA 4B8AB 1FX2A 1SH0A 1R3NA 2YKMA 4DTSA 1JLEA 3VGMA 3H40A 1RDUA 4FW1A 2DB1A 4O23A 5DETA 1OH8A 3S1TA 4JB8B 4DSKA 5GADU 3H5YA 2R7YA 1K1SA 2HWIA 4UOGA 4G1QA 3AXKA 2OGUA 4WKRA 2HFZA 2X1BA 3MXIA 3PM9A 4BRPA 3HJFA 4PR6A 1YJRA 2LDYA 2F8SA 3H8YA 2E7XA 1NO8A 4GMJB 2W4DA 3W5XA 4NXNK 2WW4A 3U8XA 1VQPN 5HRNA 1RAOA 3HO1A 3AA4A 4AHCA 4CQ1A 2MYFA 2PD1A 4H03B 1VHFA 2P9PB 3BGLA 4HWIA 1IKVA 4FYYB 4KAZA 2FBVA 4O0NA 4RKUC 3U1LA 1HKCA 3SV4A 4TU9A 1Z05A 3C2PA 4FYWB 5JS2A 2UXBJ 4U96A 2QC3A 3U4LA 1N6QA 1BUXA 1NDLA 1RB0A 3LDPA 1M1GA 2D3OR 4CLFA 7FD1A 3MMJA 4A8KA 2YHYA 4L8RB 3FBCA 4DR2K 5ETSA 1EKRA 1D8ZA 2EX3A 4CEZA 4PCQA 4PWWA 3B8HA 1ESVA 5HROB 2O01C 3GV7B 3CI5A 1HBOB 4MH8A 3O2IA 1W97L 4BC5A 4W98A 1JQGA 4FK0A 2FHOB 5A2QU 4Z4IA 5KG0A 3G25A 4Y3CA 4EI2A 4H0VB 3TSUA 1KCFA 4K4TA 3NXZA 2Z30B 2HVHA 4K8ZA 4DEZA 2ROEA 5E3AA 3EGZA 4IEEA 3SCIE 3MPDA 4DTMA 3HSDA 4A5BA 3SK3A 2CGKA 1LQ9A 1X4GA 3M2UA 1FD8A 1VQKN 2WBRA 2LDIA 1RT5B 3KJFB 5C2DA 1PYSB 5CXTA 5B0GA 3LP0B 3K5OA 2XO6A 2YX6A 1IWAA 1VQ4S 1WWHA 4PKDB 1FA0A 3OFGA 5C0YA 5DO2A 3MOZA 3C6HA 2AYMA 4CW7B 2L08A 2MLZA 4KO0A 1R8AA 3BKFA 1T95A 5KPZA 3OHRA 4LBIA 1X1PA 3T5HA 1ZBLA 2MLYA 4E8UA 3G4SN 1Y4ZB 5KG3A 2Z1GA 2YY3A 3D1OA 3SMSA 1J2VA 4X64F 2E5LK 2FDNA 2R7SA 3J7YI 3HHEA 2V4RA 1GOAA 1LWCB 1RXOB 5A8KB 2EEYA 3MXMA 2GS8A 4TVAB 4M5HA 2CQ3A 4B3RF 1O0PA 4NLOA 2GVZA 4X4RA 1OY9A 3FSYA 2YKPA 2AP6A 4HACB 3CD6S 2HMIB 4X4NA 3ZNJ1 3GSIA 4J9MA 3QGIA 3OYDA 1NGEA 3MEKA 1U24A 2OANA 5E2QA 4NYFA 2DFEA 2PSZA 5F41A 5ITHA 2BM0A 2NRVA 2V52B 4DHYA 1HR0F 3CQYA 4YHHK 2XQCA 4KQZA 1SUQA 2JEIA 1U6ZA 2YX1A 5KT2A 2HF4A 1KR4A 1KQKA 2NUUG 2IGIA 4P2SA 1VLOA 4CZCA 3G8QA 4CF1A 2CG4A 3BQ0A 5DDOC 3TAFA 2BJDA 4Q0BB 3GDQA 3SUQA 2BTFA 3HSZA 1SIZA 4WWSA 2BX6A 2LECA 1TK5A 3WXLA 3LGNA 5FDLA 2KHCA 3EE9A 2UUBJ 2PN6A 1RGVA 2RAQA 4K59A 5JXSA 2J4RA 3DFEA 4OKJA 1EO1A 3SAGA 3AB4B 2NYHA 2OMLA 2I38A 2KI2A 2Z58B 2YNFB 2W9CB 2OD6A 2HS0A 3L6QA 2FF6A 1CC8A 4NMXA 1S5ZA 3MEEB 4CP5A 5HN0A 4CBUA 4F4KA 4J9UE 4JV5F 2PA3A 3VEXA 2Z57B 3N6NA 1CS4A 3DLBA 2LXIA 4DPOA 2JLFA 3VAFA 3CJ4A 3DOMB 2FLLA 2ASMA 3CCMN 4OLOA 3J8AA 2OFHX 2MZ1A 4H0PA 3MCNA 5F9LA 3ATVA 4RNMA 4EFAC 2PI4A 4CK1A 4BDZA 4MIBA 4CGGA 2ILZA 3NCQA 2EPIA 1OH7A 3BZQA 1APSA 1TL7A 5KQ8A 3TRGA 4A59A 1N5QA 4NLYA 2X6NA 2CPHA 2VWBA 1EETB 2KZZA 3LGMA 1CZBA 5JLFA 2BUPA 1HKBA 5A2QY 4ILRA 2V68A 4M63A 5J2NB 4CNYA 5CY4A 4OJ1A 4E98A 3FEZA 4GMKA 1L3SA 1CJVA 4RNHA 3DDIA 4O44B 3OTDA 2VGNA 2R7TA 1RHQB 3OVNA 4OHXA 1LV5A 1JK9B 5F8JA 3CGIA 4G65A 2H1YA 3BQ2A 2VA3A 2YNGA 4USHA 3AAWB 2G8WA 4O8KA 4F7VA 4B3SJ 4CO2A 4E7KA 3R3LA 1NU0A 2KO1A 2A42A 3L2UA 3VAHA 2VBWA 4I67A 1CJKA 2C2NA 4UZBA 1S1TA 2GAGC 1IBMF 5BN8A 4DR6J 4B1WB 2EBEA 4LRCA 3KTQA 2VWJA 1XR5A 3J7AN 1QJHA 2VBZA 3CCVN 5MAOA 1IH7A 3NVMA 4MKAA 5IQ6A 2KFZA 2IM0A 4NA3A 2FZGB 2FLPA 1G7CB 3MDFA 2A41A 4DV6J 1VQ8S 4U7CA 1I51B 3O8WA 3UW1A 4R8UB 3PYEA 4M5DA 1KTQA 3LP1A 1R0BG 3OFFA 2XY8A 4F0HA 2E5GA 4ZA1A 1MNEA 4MK9A 5C24B 2B9YA 2M4MA 5F9NA 1VSHA 4JI3K 4CLWA 4WKYA 2J8SA 4O3RA 1NB2A 3AVFA 5H9FJ 3Q23A 4HT5A 4NLTA 4P52A 3VV2B 3X1LB 2YWKA 1KLMB 1TUGB 2PFUA 4CERA 2RHKA 2XO7A 4PYDA 4JI0J 2M5YA 1QQOA 2DRAA 1IBKK 2RRNA 2GIRA 3TAMA 3QYYA 3GR1A 3VAMA 4CLTA 3KLVA 4B3OB 4I2QB 3ZSOA 5KG5A 5GIOA 1M0SA 2DRBA 2F7VA 4KPCA 4V19J 3VQ8A 3ZSXA 2RIJA 3QFPA 1U1PA 2WVEA 1ZBHA 5IC6B 4NASA 1DTTB 2V2QA 1HQEA 4CI6A 3R9LA 5DM6Q 4E89A 1Q81T 4RWWA 1W7WA 1J6ZA 1QHTA 3UKRA 5M1FA 2FZCB 3GV5B 3L2QA 3O3GA 3ENOA 1C0UB 2ROGA 3DRRB 4OI6A 3HHLB 2HZVA 1OY8A 3NCPA 2P9GA 1SXLA 2QWLA 2ZKUA 1RT7A 2K3IA 5HRPA 1FFWB 4DR1J 3AGRA 2DPNA 2CQGA 4PXDA 4TQSA 2VZ9A 4FWQA 4C48A 5KFUA 2XNQA 4MO5A 3FLCO 3MX5A 3FCWA 1RT1A 3A3OB 1NH8A 1UA1A 1VRTA 2YWWA 2ZH5A 2UXBF 3W3DA 1OWXA 1UJ6A 2ITGA 4MT1A 2HIQA 1S5JA 4WCEQ 4FJXA 2AJ2A 3HI9A 4FS1A 1OO0B 4DV0J 2HHWA 4CNZA 4OI3A 3MCAB 2FPHX 1X60A 3CJSA 4X62J 3CCUN 1BHNA 3RWUA 3PHEA 3HHLC 4D3HA 4A46A 4ECQA 1E6YA 2AWZA 2VQFK 2QA4S 3GYXB 3MR7A 1QUPA 4IDKA 1NMNA 3C6TA 4C8ZA 1WC0A 2BDPA 2NXCA 4P2FA 3NE6A 4YY3F 3T1YK 4KHMA 3R6GB 3CJBA 1JIHA 3V9UA 4KHUA 2AEFA 2MKJA 1DT9A 1KBRA 2XHWA 3KHRA 5EVZA 2EWSA 2EK6A 1U1OA 1RT4A 1UEUA 1WORA 3TX0A 2HHTA 3AA5X 5GIPA 3C94A 4USIA 3BR8A 5B08A 3CC7S 3DOKB 2NXUA 1DTQA 1RBRA 1YG0A 4ZCLA 3CJ5A 4EUVA 4FL9A 3MPYA 4UUXA 4DF8A 4RNOA 3MXJA 3F9KA 3MM5B 2R7OA 1S4EA 5F1XA 5JVGL 3CCEN 1MWYA 4WP3A 5RUBA 4MLHA 3LO3A 3UDEA 1J5EJ 3ZC4A 2XEXA 1HBNA 1SC3B 2AX0A 2O8DA 2BYCA 5D0GA 4FPBA 2PFDA 1VQMN 3LM9A 2YPZA 3PW5A 4X4TA 3WNGA 4KFBB 5ETLA 1KONA 2QW9A 1X3NA 1U0HB 1TL5A 3TAPA 4AHUA 3OYJA 3UO0A 4LF4F 4X4PA 3U27A 1HPZB 2MQQA 4OJHA 3KKFA 3AH6A 4EP5A 5C5JA 2B9EA 4AHSA 4EU0A 3K5NA 4DZ6A 3ISZA 4K2XA 1HYSA 3P1GA 1TTHB 2PGCA 4RTFD 1YJNS 2C3OA 1I94K 2G2YA 2ZJQQ 3MXHP 4FZXC 4EHUA 4DCOB 2DCUB 1VQ5N 1IR0A 3M2RB 4OX8A 2RDDA 3SCJE 4DG1A 2E66A 1WC1A 4DL5A 1EP4B 2VC0A 5LJVA 3LUYA 4EO8A 2AJ1A 4LR7A 4NXMK 3V81A 2ASYA 5BYQA 5AQLA 2VQEK 1Y3JA 4CEAA 5DZ7A 3NWGA 1KVKA 3I6PA 4QOTA 3WIUA 1RBTA 3I8BA 4BE2A 2E9ZA 3I55N 4FJ9A 2NLWA 3T6JA 2G4BA 2IM3A 3ZFVA 4CJQA 4FN5A 3D2FB 1DLOB 3QATA 1WSRA 2F63A 2R8GA 1YTYA 1OYDA 2UXDJ 1C0GA 3AVLA 2VV5A 3N6MA 3TQEA 3CC7N 3PLAA 4CT9A 5HBMB 2FJAB 2V6AA 2D3O1 3SSRA 4X2BA 1WKKA 3OR2A 4AXJA 4RZRA 3QZ7A 3QIOA 5A8WB 2MZQA 1RYSA 2R7VA 1PC5A 4WU2A 1YJ7A 1XBWA 4CLZA 2F3JA 1PSDA 1URRA 1AROP 2D7SA 5T14A 1WTBA 1NBWA 4JS5A 4IWVA 2YHXA 4FF4A 3JQJA 5LL6Z 1NGFA 2OSRA 1T05A 1LWFB 2Z1JA 1F3VA 4FZZA 2JNJA 3BPDA 2PE8A 5I3UA 2FGCA 3OYNA 4LRAA 2ASDA 3GLJA 5KFOA 1R0AA 1T9TA 2HRTA 1P1LA 1M90T 4U8VA 1G2EA 4F4YA 5MLCV 4EZ9A 2X51A 2CPFA 3BDPA 4IKAA 4KH6A 4FJNA 2L41A 1S7IA 4WXOA 1N54B 4OZ3A 4XIUA 3G71S 3ENQA 2QWNA 2MY8A 2ZD1A 4CLYA 2GMJA 1BD6A 2DYAA 1CJUA 2MKCA 4DV2J 3CJAA 1YJNN 4OHZA 5F8GA 4ISGA 2H5EA 4B3SF 1OPZA 2R7WA 3EPIA 4WFAL 2HMPA 4ZJQA 4IOCL 4IH7A 2M2BA 1HW9A 4HL9A 4ETXA 1N34F 2UUCK 2D74B 2ZH2A 1H38A 5EU7A 1MU2B 1NH7A 4A62A 4E1NA 2CZ9A 3IR7B 4MIAA 4OVLA 3GFXA 2VG7B 5LXRA 2HK3A 3I0RB 4DR5K 3CPWM 2QO3A 1PKUA 2UV8G 1V3RA 1I1GA 3IR5B 4MYTA 3KD5E 3AVGA 2YTCA 2NLXA 1Y7PA 4O55A 3HFZB 3VQ5A 3PRVA 3SPYA 3H2UB 4DB3A 3N79A 4F26A 3DCAA 1FXLA 3PRDA 3F44A 3MR3A 1YVUA 2DTJA 3H4BA 2GNKA 1F9FA 1AZSB 4ZCMA 2P9PA 2OAUA 2IBOA 4XK8C 4OIXA 2W2PP 2CQDA 4IFYB 1T9XA 1RDRA 3RJMB 4JI0F 1HWLA 1F2HA 1N5TA 2HKEA 3G6ES 4BQZA 3IDHA 5AT1B 2AKWB 1B0PA 1WSVA 1KLNA 1NEEA 4USMA 1FKPA 3OBYA 1BQMA 1RTDA 2C3PA 3W2VB 3ETOA 3O3LA 1RTIA 5FJ4A 3ZZ0A 3CIPA 3C95A 2ZQBA 2Z56B 5F0WA 4AHRA 5ETNA 1HD0A 4Q8EA 4FKXA 4ED4A 2IJRA 2GGPA 1Z6RA 4QCLA 4CJKA 4RW4B 1RK8A 3KG4A 1LW2B 5HMZA 1NU4A 1HBOA 5L1LA 3KLEB 1CVJA 3QBCA 4DL3A 4FPRA 2V8DA 1TKZB 4FPAA 4CJFA 2BKOA 4DSLA 3G71N 3AO1A 3C3LA 2MZJA 3OVSA 1U49A 4OX9K 4K4UA 3CJ2A 3VETA 2ZEJA 4KE5A 2BJ7A 4FDFA 5DDQC 2NZCA 2CNOB 1MWZA 5IFMA 1NJIT 2UVVA 1HW8A 3R2CJ 4ANDA 3TR5A 1N5YA 5D3GA 1Q86O 2BE9B 2IBKA 1QQMA 5CZXA 3M1FA 1LW0B 4WU3A 3Q8SB 4IH6A 4HT7A 3MUMP 2P9EA 2F8TA 3L9ZA 1BLUA 4CLKA 1F21A 4QPXA 3ZZPA 1UTAA 1GT8A 4CZHA 1NLVA 6FDRA 1NK6A 4ED6A 4IG0B 1JLGA 3ZX0A 2RE2A 3PTWA 3DHXA 3NVKA 1F2GA 1S6QA 4C11A 3D9BA 5HQLA 1G4CA 4LF9K 4HTUA 1H3DA 4KBIA 3B54A 3HMJG 1LWCA 1ZXOA 2GHVC 2OELA 2G9OA 4OO1J 3O1WA 2UUAF 2B6AA 3LAKA 2G8UA 3TSPA 3AB2B 4ED7A 4WE1A 5BPLA 1FXDA 4QWAA 2KN4A 3GMGA 2NSBA 1GLAG 3HVAA 5HL7L 3BSNA 3T9ZA 1CULA 4QIWD 2H3GX 4J9NA 3ADAC 4I6MA 3ZX2A 1Q5VA 4MMOA 3GYNA 3VTIA 3QFWA 4JI8J 1BI4B 2RB7A 3VHQA 4RUCA 4J9PA 3MZIA 5CQGA 2K1RA 1H0HB 1FJGF 4ZN1A 1J5EF 2XCAA 3H1VX 2E2PA 3GCXP 3W3SA 2MKIA 2W8LA 3ZETA 4JBCA 3KLIA 4WFXA 1HNXK 3IBCB 2W7OA 2CUYA 5DGBA 1YRXA 2J6TA 5HAOA 3IO1A 3OYEA 1MDUB 2K7JA 3MM6B 3G6YA 4IOAL 3QFUA 4KC5A 2AEMA 3JXOA 3LPYA 4JKBA 3JYTA 5H1SV 3PYFA 2IS3A 3ZEUB 3W8GA 4WTOB 5CD4A 1RAFB 1S77D 1WEYA 1O1WA 3CM6A 3E3XA 1HARA 3SSQA 3IAS9 3QEPA 1C4CA 2P9SB 2YNFA 2VUGA 3VQ4A 1J5OA 3DRPB 5AQQA 3T6BA 4QWEA 1K9MT 1TELA 4DX6A 3MEEA 1YZ7A 2A2DA 3O3HA 1KP6A 2UVRA 2WTFA 2DNYA 5AQSA 3QMLA 4KI6A 1R89A 1QQNA 3ZSVA 4QW8A 1Q4RA 4F67A 1K8AT 4NXNJ 3SLCA 1GQEA 4DR3K 2UU9F 4IBNA 4X65K 2OCEA 2RRBA 3IM8A 2CQ2A 1ITGA 3P83D 4IJAA 3M4XA 4Y28C 4AD6A 2E20A 2CG8A 5T41A 3GQCA 4QS8A 3CE8A 1WOQA 1RT2A 5HVGA 3ETMA 5FPEA 1IG8A 3EDRB 3QINA 3DRYA 1N33J 5AQJA 2HHHJ 1HKAA 3W64A 3OL8A 4KAIA 3MAHA 3OW2M 4I7FA 3SI6A 2UXDF 3AOAA 1WDTA 1RZMA 4GV9A 3JSMB 4DR2J 5G0RB 4DV3K 2CJBA 3CJ0A 3CO9A 1F5BA 1RWVB 1YJ9S 4A57A 3K5LA 4F3OA 1UPPA 1XQIA 3DLKB 3AOCA 4CO5A 4K4XA 4DX5A 4AXIA 3MPWA 3AD8C 4NCGB 5EWGA 1FKOB 1FWKA 3S6EA 1FW6A 1U1MA 1NGAA 2UUWA 2EFGA 3CJTA 2IMWP 2U2FA 5EX5A 4UOCA 5JUMA 2BJ8A 4YP3A 4FYDA 3NCIA 3ALYA 1JLAB 5IM0B 1FT8A 2YKNA 2XZTB 2LQBA 4W5NA 1IN0A 2YCHA 2YKAA 3FGVA 2DIVA 4XPEA 3GSDA 4K43A 3MHYA 1FNMA 3CC4S 4JKDA 3TUZC 1NGIA 3KZBA 1YRUA 4CJPA 1NOZA 3ELHA 4ZMMA 2BOAA 5J2MA 4PWDA 1XNRJ 3ZZYA 4KGMA 5JLHA 3TAGA 1OH6A 2PA8D 3MM9A 4O0IA 1C1BB 3TVKA 1FDBA 1NKCA 1RYRA 2DH9A 1QZ6A 5M1KA 3RR8A 2E5LJ 4WYBA 1ZAWA 4MTPA 1WSHA 4FP9A 5BJRA 3G8SA 2HQIA 4F4WA 4IEIA 5EHHA 1WC5A 2XCPA 1X9WA 3MF5A 3V4IB 3UCZP 4J90A 4IFVA 1UFLA 3DU5A 4CZIA 1ZM3A 3M6UA 1U1LA 5H1SQ 4K8RA 4KGVB 2XI3A 3R1XA 1KWMA 4JV2A 2BJEA 3NKYA 4DHVA 4I6YA 2F96A 3ZSWA 4NLXA 4ZOSA 1TV6A 3QIPB 3NF8A 4C0HA 4JD2A 1LWXA 3V4MA 2DEJA 1YBAA 1C0UA 1YJTA 3V6JA 4HHHA 4FOEA 3HHLA 1ZS6A 1VQ6S 1ACMB 4DTNA 2IIHA 1CJTB 4IXCA 4EGLA 2FTRA 1ZBUA 5B0FA 4GKJJ 3AA3A 2UXCK 4NRTA 2YI1A 4JLHA 4ID1A 4ZHRB 2CWKA 4QZVB 5LMNJ 3NLCA 3RZAA 3AA2A 1BOTO 3J7YP 4CGFA 1GLLO 3IP0A 4ZITA 3VF6A 5AQIA 2ZH8A 1TKTA 1CSJA 4OZJA 3U1NA 1RTJA 4KHPJ 3N6LA 4ECVA 4LRBA 5CZVA 4EZ6A 3LM2A 1C0MA 1X3MA 2Y1IA 2X7IA 3I33A 4OYZA 1BQNA 4NLCA 4DMZA 2C22A 3L4QA 4LSZB 4LFCK 1HBUB 1K73O 2HHUA 2F5GA 3CC4N 3PJXA 1RBUA 3HRGA 3VEOA 2IOCA 5BRHA 3NMUA 3EGWB 2Q3PA 2GELA 1KFSA 2LSNA 4A8SA 3KIOA 4ILLA 2IRUA 3QWUA 2MKKA 3C0BA 4NYZA 2DNKA 4DV5F 2V7YA 4WFBQ 1S9EB 4Y0FA 2F4VJ 3UN5A 3NAIA 5F8HA 3VQ7A 2AYGA 3CVKA 4OZLA 1GTHA 2VA2A 5EXWA 2QMWA 1C0TA 4ZK7M 2LQ9A 1W9HA 3QNWB 3G87A 1WELA 2GW8A 1JNZB 2V9WA 4V19S 1JKHA 1YAGA 1O51A 2HFSA 4ZLLA 1EX8A 4NA1A 2KLAA 4ZVQB 3C14B 2YNHB 2DGSA 4KHRA 1VAZA 3PZPA 4QWDA 3MURP 3IG1B 4KH4A 1DAXA 4EO6A 1NCLA 1AA1B 2LA6A 2Q1LA 1S9GB 3K58A 3ID8A 4DR4K 3J7YU 1N5SA 3OT9A 2CRLA 1R6VA 2ZDPA 5J1EB 4O4RA 1TYQB 4DV7K 3C15B 3SUOA 2XMVA 3CIMA 4YUDA 4CZEA 4ZVSB 4BROA 4C4WA 2E2OA 4KFBA 3CCSS 3HKZD 1HNZJ 3WXIA 1NSQA 2HBLA 3OJUA 3UCGA 1FO1A 2Z1HA 2JRSA 2OPSB 1RGIA 4PABA 3OLBA 2E5HA 3QEIA 5HLFB 4ILJA 3ZLJA 4LFBF 5HMXA 4ECTA 1S49A 2QWQA 5M1NA 3TVZA 2F7TA 2POKA 1YVNA 3QGPA 2QI2A 3NFAA 2HBZB 4DV4J 2D0AA 1W7AA 2QTWA 1UVLA 1GXUA 2BRLA 2NPFA 2Q36A 2YKOA 3ID6A 3CCLS 3D1QA 4AQYF 2BH1A 3TAQA 4PG8A 4F2SA 2VG5A 4JI8F 4IO9L 1WKJA 2R8IA 2M8HA 1QAYA 5E3CA 2JJ4D 4OLBA 3M2RA 2CH6A 4GNIA 4B3MJ 2PYLA 3WEEB 3GILA 3C65A 3BYPA 3HFKA 2ZZNA 5AQZA 1R43A 1HUXA 3SBTA 1FEEA 2OTJN 5AQYA 1VSKA 4RW6A 1R31A 2IC3B 1LEOA 1EIYB 2HBYB 2MQMA 4QJVA 4KGZB 2FHJD 4MK8A 4PG5A 4CEDA 3VQSA 2I0XA 4EWTA 2LEBA 1G15A 4NZ0A 2BBEA 3AARA 1IBKJ 4ZLJA 4ANCA 3CCJS 3VQCA 4K25A 3GJQB 4EBCA 4H4MA 1HQUA 4FM0A 2OPQB 1BWFO 1I3OB 1NGJA 3Q8QB 1A7GE 4URSA 3SCLE 2XBPA 4FVMA 1S1WB 4C8NA 1JLBA 2K2PA 5K8NA 3CJ7A 3LPTA 2F9WA 4KPYA 3DWLA 2JEFA 4TY8B 4Z4HA 3O4WA 1M1KT 3MM7A 5D8HB 1HBMB 2C42A 3UDVA 4P74A 4DV1K 2QKBA 2ZH9A 4NXNF 4GKKJ 5EX3A 3MN7A 2DNOA 2VASA 4DQRA 3M8PB 3DOLA 1L3UA 1L3KA 1ASVA 1K9MO 4NA2A 3WNFA 1EXQA 5IS2A 3W5ZA 4RBTA 4IRKA 4LSNA 3M1VB 2B43A 1WC4A 4WF9Q 3ZZZA 2IA6A 1T9UA 2ZM6K 1NJXA 3AHPA 2JSXA 1GEHA 5LL6d 4ZP7A 4ZDNA 4M45A 5KT4A 1NGCA 4LR9A 1MA9B 2ZJRL 4OZ5A 2HBQB 3GJSB 3AODA 1CLQA 1HYVA 1P1TA 3MMVA 2DPJA 4OKEA 3W61A 1KQFB 2W7AA 2HBRB 4DR2F 4FYVB 1WN7A 2OSQA 4L76A 4DUZK 4DPXA 4A61A 2CQHA 2OTLN 2VONA 3L95X 3HHLD 5D0RA 4NYPA 1SH2A 2A6OA 1FWLA 1GOBA 3KLFB 2JZ5A 1E6VA 1NMDA 3T5LA 4CGDA 3GJTB 3PKYA 2DFFA 2DHSA 3JAMO 4FWNA 3BSAA 3WIVA 3ZSZA 3PW4A 3EZOA 4BHQA 4H0YB 1KAXA 3WUHA 1H2VZ 5IOLA 1GLFO 4HUEA 2L9NA 3RB4A 3B78A 2X1AA 4TYAA 5KG2A 2EVZA 1TKXB 2V8VA 2H9ZA 3SQ0A 1CPZA 1LK5A 4BR4A 3DU6A 3HD1A 3FFKB 4K0KK 4B9MA 2P8IA 4MYUA 1X9SA 1XR7A 2OEMA 1KD1T 2HFVA 4CF2A 2YKMB 1JLEB 4Y34A 5AXKA 2RHQB 4DU8A 2CQPA 4C8KA 1NXIA 1SL2A 1SCJB 3KLHA 4ZVOB 3DDNA 2E5LF 4CH1A 2D41A 4JHDA 1AXQA 2F9DA 4OPAA 4G1QB 5A6WA 3VQ6A 4LMZA 3GL1A 3IXQA 4AE5A 3US5A 4DTUA 4OJRA 2IVNA 3AAQA 5CR4A 1VS3A 1NSPA 5KG4A 1GMVA 1SC4B 1IG9A 1WHVA 3JS6A 1VGYA 1S1UA 3WXMB 1RWXB 3CF5Q 4H5TA 1IKVB 3M8WA 5M1QA 3QSYB 3GCWP 2AYBA 3MD3A 1I94J 4JYAK 1UW9A 4TNOA 1QE1A 2FF3B 2XMUA 3IA0A 1OVYA 3I9V9 3SBGA 5AJ3J 3ILOA 1ASUA 4OYXA 4YHHF 3V5RA 5C7PA 1NRKA 1N6QB 5ETTA 1FESA 3IAM9 1DZ5A 2ZJPL 2BJ9A 4GKJF 2HFUA 4CK3A 2W7PA 3VCDA 2FHMA 3B6BA 3QWPA 4OX7A 3NF6A 4C2MA 1JB0C 5L1JA 4LH4A 1HNIA 4Q2MA 4EYHB 1ZBFA 5CHCB 1N8RO 3D7EO 1JXLA 5A8RA 1AT1B 2HPUA 3E66A 4XTTA 5IWAK 4BRDA 1WAJA 4CJWA 2VG6A 4FJ5A 1JJ4A 3VWSA 1PGZA 2M9KA 3N9UC 2CJAA 4RU9A 4DSIA 1N32J 4IG0A 3SAFA 4G3IA 1ASWA 1GFWB 3RAXA 2CA9A 3M2UB 5D0EA 3TNVA 3ZTSA 1B9DA 1N36K 3NNAA 4OZ0A 1RBVA 2QXFA 2KKZA 2PEBA 1RI7A 4UY8T 4BE0A 2E29A 1A5XA 4JKEA 5AXMA 1MWKA 2XGQA 4CEEA 5AQNA 1VRUA 1VC0A 3CCTA 2R8KA 2EXUA 2LMIA 4DCPB 4H0OA 4JI7K 2M52A 2FIUA 3AD7C 4JEPA 3CQ8A 3UR0A 3OVAA 3FMBA 4KO0B 4CLUA 4CF0A 2MZSA 4XH1A 1ZZNA 3PKMA 3K17A 3LZIA 4F3QA 4C8YA 5BR8K 2W01A 1REVA 5GMKa 2OMOA 4R5PA 3ZNUA 3SFGA 4Q7AA 3J7ZO 3THXA 4FJGA 4CI0B 1YJWN 3Q8VA 3FEYB 5HQ8A 3LP2A 2ZUAA 3D1HA 2RUGA 1YITS 1KRPA 4OYMA 4NLWA 4FNHA 2FVPA 2FUG9 1DGKN 1U48A 1XMQJ 1J53A 5KFSA 2QIFA 3H3OB 4NLUA 2W41A 3H45C 1NNEA 2GX9A 3LL3A 3RBDA 2RDIA 3FR0A 4HYKA 4CE9A 2D9OA 4YOEA 4IYQA 4CEOA 4BRGA 1VBZA 1M5PC 4WXWA 4ZP6A 1RBLA 3K0SA 2AZ3A 2OIHA 1U8WA 5AZIA 3P5JA 1SUQB 4LREA 4D3GA 1S0VA 4P73A 1HJRA 2P9SA 4OGCA 3UDCA 3CETA 1VSMA 2ZWOA 4PUOA 1Y00A 3R5CA 3M2VA 4CT8A 4YDUC 1VIXA 5L1IA 1HPMA 2RT3A 2QT7A 2F9TA 3RMDA 5JS1A 1S6OA 1ZPWX 2A18A 4B9SA 1EKSA 4DFMA 2Y8YA 4TY9A 2NQPA 1TUWA 2CQ1A 1HI0P 3ULEA 1TL1A 5FDLB 4B1YB 4LF2A 5AQGA 4BBYA 4JI3F 2WCXA 2J7UA 1XJWB 4OX6A 1X7VA 5C25A 1FK9A 5H9EJ 4Q5VA 4DR7J 5ADZA 3U3GA 4ZJOA 3BZCA 4IRCA 3EZUA 4M3XA 5HL7Q 4CH7A 2KZMA 3SQGB 1QHAA 3BF1A 4WQ4C 1HX1A 1CQMA 1IBKF 2CIMA 3U7JA 4ELTA 1T9VA 2V9KA 4BVPA 3EMTA 1Y64A 1HJOA 5D78A 4B1ZA 1CS4B 2HWTA 3BBBA 3TP2A 3CJQA 4JRPA 4LVNP 5D4OA 2X6SA 3KKRA 1SAZA 4S0MA 4CZMA 4CLSA 4Z7CA 1RBSA 2ZZMA 2N3OA 4LFAK 2JLEA 3MMBA 4OYWA 2GWKA 2P9KA 4EBEA 1YTUA 5BPMA 1TL7B 1IJJA 3DLKA 4IOAQ 1JX4A 2Q43A 3H20A 3BO2A 2W9BA 3LDOA 4F04B 1EHWA 1V5VA 2IPOB 4NCGA 1XERA 3PFEA 3CXCR 4JUZA 3FRZA 1MMNA 2V8GA 2L9DA 2ZH1A 4CFDA 2EC0A 2BA9A 1T3VA 1IJEB 3CSKA 4ISFA 1CJVB 1M1KO 3KD1E 2M7SA 2MQ8A 1HWUA 2HQFA 3GG4A 5AQRA 4JI5K 1BY9A 4YB1P 5KG6A 2O4GA 1SB6A 2YNGB 4DWIA 4BVOA 5DM7Q 5LSLA 2YNIA 2XRIA 1RABB 2OD4A 1HQ2A 3HJVA 3LQVA 4N77A 4WYLA 1NAQA 5GAHU 1CJKB 3RW6A 2O3DA 1S1TB 3EX7B 3AO2A 2H3EB 3QNNA 3OR1A 2KT2A 3D28A 4KI4A 4Z37A 2VQFF 3ZX3A 3DRXA 1X5TA 5J1PA 1VLYA 1VBYA 4O3PA 1SBRA 2D0BA 3T1YF 4JI2K 2VU5A 3VGKA 1F0XA 4FWSA 4M5DB 2E5IA 4QWBA 3MWPA 1B7FA 4GVMA 3LP1B 3ZO7A 1NM1A 1SL1A 3VMFB 4OI1A 1WI6A 3EN9A 3CPWR 3V4IA 2XGPA 2HAIA 3ENVA 1NGHA 4PXBA 4B3TK 4OZ1A 3BSOA 4EP4A 1IKWB 3VPZA 1QVGM 1Z1ZA 3H90A 3RG6A 2CZVC 2BR0A 3NGRA 1NPRA 1JLQA 4HUFA 4PG6A 2R7QA 4DUYK 2A5XA 3TAMB 4CO4A 3DNCA 3CB4A 3I56S 4TKTA 4C7QA 3RAQA 1VQLS 1RUSA 2FGOA 3SIPB 1HD1A 3SUPA 3GTYX 2QYCA 4WFNL 1YI2S 5GMDA 1QSYA 4XDCA 5THWA 1RILA 5GAGI 1BU6O 2VDIA 1UPMB 4Q44A 3KHLA 3BYRA 3R3TA 4QYZJ 2VB6A 1ZM9A 3MI7X 4ZHRA 4PL8A 5HVHA 5CYMA 1D8YA 4DSJA 1R7IA 2YQ0A 2AP1A 1N4LA 1OS5A 2OEJA 2V94A 2H48B 3EZWA 2MZTA 1KTVA 4USWA 3O6QA 3UD3P 1S79A 4MDBA 1CXUA 1HNWK 3KHHA 4U7UK 4ZVRB 2EC2A 4UOFA 4OKKA 2QKKA 4DX8H 1RT7B 2MDAA 1Q8IA 2EFOA 4P2MA 1YJUA 5KFGA 1I94F 4X84A 2COLA 2D3UA 4DR3J 4FLYA 1UJ4A 1VRTB 3PX6A 4X65J 2H4YB 2DR7A 4TXSA 3R2DJ 3VQAA 2UZAA 1Y11A 4ZVHA 4NXMF 3V1OA 1QSLA 4KHQA 4MFBB 3LF0A 2VQEF 3S9HA 2ZHOA 3SQ4A 1GTEA 3QRQA 3CNQP 2ACYA 2F8MA 2BV3A 3FFIA 3CMAN 4IDKB 4CIOA 3TUIC 3C6TB 3IBWA 3DI6A 5KFLA 3TWZA 1FRKA 5DDRC 2FQQB 3CD5A 1R59O 3THYA 1NLKL 5FPDA 3OHAA 3ULHA 4FWPA 1RT4B 5IXUA 3W5YA 6FD1A 3VESA 4ZVEA 3NG8A 4DV3J 1FD2A 1HHSA 4DI6A 1TYQA 2JC0A 2V0NA 3LWLA 4OLPA 5GADI 2YHAA 4RW7B 4BR9A 2UP1A 1DTQB 1J27A 3UQSA 5ELZA 3E9PA 3FK4A 2KT3A 3PSFA 4USUA 4DN9A 3D7SB 2HVEA 2PC6A 1F60B 4I4BA 1YI2N 2A6MA 3DLLL 2YXLA 2DRDA 3L7UA 3TJ9A 3IWXA 4JI4J 1VQNS 3FEXB 3FGUA 1HR0J 2AGQA 1F3FA 4C0BA 2DNHA 2NXJA 4P6QA 4L6V3 2AMCB 1BWVA 2O8DB 1HFEL 2ZBIA 1RU1A 2B4JA 2DR8A 5K5MA 4Y65A 3UN2A 3J80O 3T1AA 1FJEB 3RBZA 1X5OA 3AVNA 4CJ4A 3DLGA 4C3KA 3QERA 2LXUA 4E7HA 3RRHA 3P96A 4EEYA 2E1YA 3PJ9A 4BRMA 3GBTA 1Q8LA 4LF8K 1XNQK 2CAJA 3OTOJ 1Z25A 3P4UB 4ZKAA 2Y8WA 2KH9A 3E9OA 1NHUA 1DKGD 4L72B 1VSDA 4FJ7A 3CPEA 1NNDA 5DLFA 2K06A 2MY7A 1NUEA 3PXGa 1QLNA 4KTQA 2F4FA 3OYBA 1HNVA 2GJFA 1GXTA 2FVRA 3G2XA 4OYPA 2WAQD 2Z2MA 4AM6A 4JV5J 2FVSA 4LBPA 4CIFA 4IRDA 2CPJA 4CBXA 2PO4A 4YB6A 1VSFA 4MJKA 4L75A 3DMJA 4YOXA 3V9XA 1GH8A 5DG8A 1NHVA 2UUCF 4BC4A 3ZSQA 4DG1B 3IAYA 5KGXA 3HVTA 3ENHA 5LSOA 4OJ3A 1TVRA 3JQKA 3V81B 1RHJB 1TR0A 1QZ5A 4DR5F 1SS6A 2R42A 1FX4A 3IUCA 2FY1A 3QMQA 3RBEA 1NOYA 3B4MA 2Q1NA 3PSIA 1KVJA 4WQ5C 2NYIA 3EVWA 4NCBA 2PIIA 1WHYA 2ZBCA 1C4AA 4U67Q 4NLDA 4KHSA 1PAEX 1Y3KA 3KK3A 5LM7E 1VHIA 1NK5A 4FO0A 3V6HA 2BABA 2Z0GA 5CYJA 5G4DA 1N52B 4KB0A 3OW2R 2O8BA 3VR1A 2KFYA 3GG0A 5BPNA 1U1KA 4BC9A 3OR2B 2DTUA 2XSJA 1Z2ZA 1Y0HA 1KC8T 2X78A 3TU5A 1UZHA 1NWKA 4IO9Q 4B9TA 2HF3A 9RUBA 1GLJO 1HMVA 1A0OB 3BY5A 3G82A 3Q2SC 2AZ1A 4LF6K 1VQ9N 5E41A 2I2YA 2FHKA 1IBMJ 3EDQB 2WONB 2H65B 4LRFA 3FBBA 4P10A 5I3UB 4FKYA 4KKOA 3OFHA 4NEZA 2YHBA 1P6TA 3T5JA 1M5KC 4LF5K 1R0AB 2OKQA 2PDAA 4QW9A 2LXFA 1FVQA 2B4UA 3R5JB 3TOQA 1EJ7L 4OX9F 2I5JA 1VQON 5JMNA 3UN3A 4WIIA 4OLAA 1KEKA 4OV1A 2HFOA 2XMMA 3VOVA 2OI2A 2ZD1B 2QA1A 2UXBK 4F3TA 3SNNA 3K89A 1CJUB 1KQGB 1HHQA 2HRYA 2ATLA 4PWUA 3NY0A 2PEHA 1U25A 2GEMA 4CJEA 1QS4A 1XMOK 1EWQA 3MTKA 1F1BB 3TPQA 1FTCA 4CHOA 4RR5A 1WUAA 3A5OC 4NMLA 2WBMA 4UT4A 1OIAA 2OO4A 1XHXA 4M3ZA 4URGA 5J2QA 2RQCA 1UWBA 2JOQA 3DAWA 2X1GA 5JVHL 1H2TZ 1OYEA 2ZOFA 4ZS6A 4AYBD 4CHPA 3H08A 1BA1A 4FM1A 3N4WA 3VQPA 4N76A 3KNGA 1AW0A 2MZRA 4DU1A 4LF9F 3C66A 1EQYA 4ZPBA 5BR9A 2W2OP 3QB0A 4IQMA 3D5MA 3KKSA 1V3ZA 2LA4A 4LC9B 3NL0A 5SWMA 2NSCA 5GMEA 1Q5YA 2AGPA 2HFNA 3QO9A 5FLXO 2QGFB 4N56A 3VA0A 4DLEA 3THWB 1XK8A 1RDAA 4FK4A 1ZBIA 2HGMA 2HK2A 4O5FA 4ZPAA 1WG1A 1IKYA 4K4WA 3GIJA 1WKLA 2ASOA 1UCNA 4N5SA 4F2RA 3LTOA 1KQSM 1K8KB 2AF6A 4LF1A 3GJRB 5D0HA 3N5FA 1QTMA 2UVWA 3C8YA 1FKPB 3HDSA 2FJEB 4BC2A 1BQMB 1RTDB 1RTIB 1D0EA 2XZDB 4USJC 1SIWB 4XPCA 2K7KA 5L46A 4PQUA 3MECA 2VFSA 2VPWB 2XMKA 1AUDA 4LF7K 2B7CB 2E1ZA 5B0AA 2NPIA 2GGPB 2RU3A 3I4HX 4GVLA 1HIYA 1M1HA 5M1PA 3LDQA 2BKPA 4CJRA 3IMQJ 4ECYA 3NOCA 3FSIA 3H3NO 1KN6A 3GONA 2AEJA 4YY3J 5CZ2A 3VQEA 1SL0A 1G1XA 2CVIA 1JJ2R 1RDBA 2KHDA 1BWEA 1RTHA 1MN9A 3OS0A 3NGIA 4B9UA 4PL7A 2Z2ZA 2NCKL 4XAKA 5D4PA 4DCJB 2BM1A 1IR1A 4YMEA 3VGVA 2GQQA 4I9QA 1VISA 2HGLA 3ET6B 5LSRA 3A5MC 3DM2A 5HATA 2P9LA 1MROA 3SSSA 1UA0A 5L9XA 4WJBA 1N5YB 5D3GB 2D1CA 2DGXA 4DR3F 4MLEA 2UUTA 4RW8A 4X65F 4N41A 3ATUA 4F02A 3L7OA 3JS9A 5L1KA 1X4DA 3NS7B 1T44A 1GLCG 3WBZA 2ATQA 4OJGA 2YH1A 2YHWA 2DHAA 3POTA 3T7ZA 4J8FA 4PXCA 1VQ7S 1JLGB 2DHGA 2UUBK 2KXFA 4C0OC 3OYGA 3M8ZA 1S6QB 1ZA2B 4C11B 5LJ3Y 3QESA 2HB5A 2PBDA 2LU1A 4OYOA 4ED5A 3DDKA 4DXLA 3CW2C 1RHKB 3W9IA 5KPTA 3OYIA 4LF4J 2YQ3A 1R8CA 4YDUA 3TQ1A 2ZVIA 4GVEA 2EFVA 2E9RX 1RT3A 2B6AB 3MFIA 2ZJPQ 4DV3F 4ED3A 3V1QA 3HLUA 1XQSC 4WE1B 3OBIA 1A5WA 5HQMA 3PUFA 2C3UA 2GVDA 1S6PA 4JKCA 2XY6A 3RMAA 2QL7B 1EWRA 3MN6A 1RWWB 1K1QA 1CULB 2JL9A 4JS4A 4I64A 1OJ4A 4I6MB 4M95A 3U9DA 2LLZA 2ZH3A 2XMTA 2Z8QA 2MHEA 1VBXA 2HSTA 4JI4F 1WI8A 2K1RB 3H42A 1SJ3P 4CF8A 3VZHA 2HAFA 3N4QA 4WQ4A 2H5JB 3NHGA 3ZETB 4CJ7A 3KLIB 1IO2A 4BR5A 3PW7A 3CEDA 1U26A 2M8DB 4PKIA 2NRRA 3J80U 3DRSA 4I0WA 4OFZA 1CBKA 1WHWA 3EE8A 4KGKA 4K0KJ 3JYTB 3ITHA 1D1UA 4WBFA 4DPTA 3K8VA 3OTOF 1UFKA 1HWKA 4FVCA 3UE5A 3HT3A 1YIJS 5KOWA 2O8EB 2DNRA 1J5OB 3KK7A 4I9LA 4I2PA 3Q8PB 2OA8A 3NNCA 3SQGA 2BGGA 2AJ0A 1FDNA 5KFCA 1VQ4N 4GO5X 2PMZD 4I1TA 3O1BA 2P5VA 4DR6K 1GMWA 3T1HK 3ZSRA 3DLHA 1KHWA 4CYUA 2Z2LA 3HP6A 4CZKA 4J9OA 3D3BJ 5BXIA 4QPTA 2QA2A 3A8IA 3K59A 1HYZA 3CCZA 3O8MA 4DV6K 2MJNA 3CCWA 2N4CA 1DQ8A 4ICLB 3SFUA 5LMUJ 3F56A 3W7BA 4KV8A 1RT2B 4B17A 3M30A 3SAHA 5M2PA 4HI1A 4M5KA 4NOHA 2FJVA 3PIOQ 1X9JA 4F36A 3K7RA 5A6PA 4W92B 1QM9A 2E6MA 1RE1B 2VPZB 3KMQA 4DJBA 5H9FK 3AGKA 1U6FA 1FEHA 1B0VA 3BDEA 2L3MA 3R7SB 1N88A 1S9FA 4I7FB 3TTCA 4JI0K 3ZT2A 4BRLA 1EKEA 1UW4A 3DXMA 2OZSA 4DFKA 4FZVA 4WPAA 2UXCF 3CD6N 3DGPA 3KJVA 4K4SA 1YHQS 2DGQA 3GR0A 5KT5A 2VJUA 3CC2S 4KRWA 4QIVA 3FMWA 5KT3A 2PAVA 1ZZFA 2QRRA 3VQBA 3GV8B 2DNGA 1LAVA 3L4BC 4R79A 3TSQA 1T7PA 3IMXA 1S72S 1N34J 1C0FA 1KOOA 3CULA 4NLSA 4LSLB 2EFQA 1HLUA 4LFCF 2YKNB 3P3DA 4FJIA 1N36J 3RRKA 3J7AP 2MTLA 1S0OA 5KFHA 4J91A 2F1FA 1RADB 2GX8A 3G10A 4M7YA 5KFBA 3PV8A 3WXKA 4B8CA 1IBLK 4AHVA 4DR1K 2DY1A 3MGJA 5B09A 5J2MB 1IKWA 4CD1A 4PWDB 2AV5A 1UVIA 3H7HB 4OHWA 7AT1B 3FCHA 4DSEA 1B9FA 5JJBA 3MM9B 3R97A 1BO5O 3NGUA 5BYSA 4KJIA 2RNEA 2IHR1 1Q9XA 1WTFA 2LQ5A 4G1PA 4NLVA 1QTNB 3ZT4A 4K7QA 3BSCA 1A5VA 4DV0K 4KHYA 4MKBA 3BPSP 4BRAA 1NZAA 3FCVA 2NRHA 4X62K 3EVOA 3QT6A 3HPHA 2M3DA 4USVA 4DR4F 3D4JA 4JI6J 4IFVB 3D6RA 1KFDA 1UAWA 2CPEA 3M6VA 3E8OA 4RO0A 2VODA 1S1XA 4DV7F 1Q7YT 3UR3C 1WLJA 3A8JA 3JQMA 3M7VA 2R8HA 3KUGA 3BBCA 4JV0A 5CE3A 2D4WA 1TKDA 2LVWA 2J9EA 5HI7A 2HRUA 3O9RA 3PR4A 2BE2A 1TV6B 4DTOA 3J80Y 3AO4A 4JD2B 2WOMA 2A2CA 1NGDA 1SC1B 4RWXA 3I9ZA 4J7CA 3OYHA 2PMHA 1DY3A 2VDHA 3TTDA 1YHQN 5FLXU 1PG5B 3H46O 3CC2N 1S3XA 3Q24A 4C6AA 1V4SA 3QETA 1ZM2A 2WFBA 4H4KC 3J7Z5 1URNA 1E4GT 1VMBA 3TA0A 4J2BA 2V69A 4RPFA 3FBEA 5DMRA 2GIFA 2HWHA 3OYCA 5KPRA 3D2EA 3ENBA 1TKTB 1RTJB 5DM6L 5HK4A 4J9SA 3PFOA 3VEWA 4FBUA 3V9WA 2YWGA 4MFBA 4G1IA 1IM4A 4CECA 4BWJA 2UYTA 4C98A 1BQNB 4A8XA 5K8OA 2AIRB 3WQPA 1VQ8N 3CFPA 5A76A 2O8FA 2HS3A 4P72A 4RUAA 4ISEA 2QMXA 2VYPA 3WQTA 4FVUA 2VHGA 4IQXA 4DN0A 1PBAA 4F50A 2XI2A 4M94A 3O9QA 1K6YA 2DO0A 2B51A 3VQDA 4U9RA 3SDEA 1DQAA 1BXNA 3TZXA 2HQDA 2I9SA 4W90B 4LFAJ 4ZPCA 2UUAJ 1BGXT 4OI0A 2VGMA 5KT6A 5EWEA 2BE7D 2FBYA 4ILGB 2CPYA 4H5WA 1C0TB 1ZAXA 4Y2CA 1SPBP 4IZ9A 1NSAA 1AFJA 3OYMA 3D6HB 4RW7A 2B3TB 1Z4UA 5KFKA 3OQ2A 1JKHB 5AE1A 4DV1F 4DTJA 3UCUP 4CLLA 4YOTA 5E33A 3EKSA 2OJ3A 1MSWD 4K4YA 2XWXA 1ZPVA 2JEGA 5LOQA 1LXNA 1FJGJ 1IQTA 2ZFHA 2RS2A 5ETRA 4FLTA 4JI5J 3R8YA 3AVAA 1GLEG 2I1RA 1DFDA 2ZM6F 3HBTA 3ONQA 4J9LA 5HP1B 3LP3A 4K2JA 2YQ1A 3PACA 1MN7A 2P9NA 3OS2A 3M6WA 2CQBA 4ZVFA 3H2LA 2OFGX 5KOXA 1R8HA 3FDSA 3KDNA 2WSEC 5FRMA