3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
1SH2A 3MFIA 4ED1A 3VQ9A 1FKPB 1VSEA 3NH0A 2F8EX 2HVIA 1JLAB 1GOCA 4CHPA 4DQRA 4DFJA 2HHSA 4RW9A 5F8HA 1CSJA 5SZTA 4J9MA 4IG0A 3HVTB 4B9SA 2YNGA 4CHQA 3DLKA 3RBEA 1GOBA 2FLPA 3OYKA 5F8LA 3SV3A 1TK8A 5KT4A 4DF8A 1N6QB 3V6DB 2YNIA 4FJMA 2ATLA 3ZSRA 5CYMB 3LZJA 3HPHA 2OPQA 1LWCA 1J54A 3MECA 3B6OA 5I3UB 1S4FA 4NLTA 2XRIA 4IFYB 4R8UA 2W8LA 3OL8A 4F4YA 1CZBA 3DLBA 3SQ1A 4FJ8A 3D5MA 3HVRA 2FVSA 4E89A 4MK8A 3CG7A 4BE2A 3SUOA 4QWEA 4AHTA 4DL2A 4M3XA 4BACA 4IBNA 3TAPA 1JLEA 4B9NA 3CQ8A 4LY7A 1T05B 3WNFA 4F50A 1S1XB 3ITHA 1GX5A 4WFYA 5J2MB 2A1SA 3V9XA 1JLQA 2YNFA 4F4ZA 4B9UA 5EUHA 3GV5B 2FBYA 4O3PA 3GILA 4B8AB 4KTWA 4CJ4A 2DPIA 3I5CA 4ZVGA 4Z4GA 5KFTA 4W5TA 3MTKA 4CJLA 4KV8A 1T03B 2J6TA 2I5JB 5KFBA 3EZ5A 4YR3A 2AWZA 1U4BA 2UVWA 5KG5A 3QO9A 2IAJB 2VG6A 1UA0A 1NJZA 4QCLA 2R2TA 3VQ5A 5FROA 3SFUA 2XHBA 4CHNA 3OYIA 5E41A 5L9XA 2DFHA 4FJIA 3PY8A 1HQEA 3BR9A 1S6PB 3NH1A 4IDKA 2HHQA 2E4LA 3VN5A 5KFWA 4YR0A 3NGIA 2XCPA 4PQUA 5CZ2A 3OYCA 2OPSB 1T94A 4U6PA 2OA8A 3KLHA 4ZVEA 1XC9A 1BQMB 3V1OA 4WE1B 1HNVB 5L1LA 4NLPA 4H4MB 4K4ZA 3RRGA 4DSKA 4DEZA 3VA0A 4TYAA 4XIUA 3H98A 5DMRA 4YP3A 4DF4A 2AGQA 2WTFA 5KRSA 1QE1B 5J2QB 3MXJA 3LDSA 1RTIA 4ZMMA 3EPGA 3CO9A 3RWUA 3G6XA 1RTJB 3C6TA 3DLGB 1S9FA 1C0TA 3T19A 1BIZA 3AVLA 4AHUA 4FJ7A 1LW0A 4ED8A 2BANA 1F21A 2WB4A 4DWIA 4HCBA 2RPIA 4BWMA 2WOMA 4M95A 3I0RA 4URQU 2XGQA 2FLLA 4DQPA 4KTQA 4DSFA 4NLDA 1RCHA 1C0UA 5KT6A 3RAQA 3F9KA 1HYZA 4K8XA 2E6MA 5KFGA 4M3YA 3PO5A 5CZ1A 3GIIA 4CEAA 1U45A 1DLOB 3VQSA 3UPFA 3BSNA 4DL3A 1UWBA 3KTQA 1RBVA 2I1RA 1HARA 5T14A 2FJWA 1REVA 1U48A 2DFEA 2G8KA 1EXQA 4CEOA 2XY6A 3QNNA 3S9HA 1HNIB 1WAFA 1S1UB 3FQLA 4M3RA 3K5MA 2V4RA 5KT3A 4ED7A 4FK0A 4ZTJA 4CIGA 5K14A 1R0AB 3MEEA 4DTXA 3VQDA 4OLAA 2P5GA 4O4GA 2BQRA 4KKOB 4CIFA 2BE2A 1RT6B 1LWFA 4FZYA 4MK7A 1RA7A 4ECSA 4ELTA 3FFIA 4TQRA 3DLEB 3IG1B 4JRPA 3OYHA 4CESA 1VSLA 5KFQA 1YT3A 4DG1B 1XI1A 3NGYA 3KD5E 3QGIA 2W9BA 5HP1A 1XHXA 4E0DA 4I7FA 4PUOA 2HNYA 1TV6B 5EDWA 1JXBA 3DOKA 1TL1A 3AVNA 5DQHA 4CEFA 4AHSA 1HMVB 4CE9A 4KBIA 1I3AA 4C8NA 4EO6A 1U49A 4DLGA 2FBXA 1TKXB 1B92A 3K5NA 4KB7A 2BR0A 5I42A 3TI0A 5C5JA 2R7YA 3Q8SB 3I0SA 4DL6A 4DSLA 4AHVA 5HBMA 5DGAA 1O1WA 4DFKA 3DRSA 4E7JA 1N5YB 3DYAA 1NJWA 2HHXA 3FSIA 4KREA 3KJVB 1TP7A 4NLGA 4EYHB 3MEGB 3QIOA 3HXMA 1BHLA 3ZT2A 4FK4A 4LH4A 3BSAA 4ZPDA 2V4QA 3QEPA 3SNNA 3VQPA 3NGZA 1BCOA 1WSHA 3LP3A 4TLRA 3V4IB 4FBUA 3N6LA 4ZHRA 3GYNA 4EBDA 3PR4A 3GQCA 4HVJA 4LSNB 5KI6A 4CJTA 4DL4A 3AO5A 1S0MA 4DMNA 4M42A 4CF0A 5J2NB 3M8PA 3KLFB 3LWMA 3SI8A 4N41A 3JYTB 3QEWA 5KFEA 3QEXA 1IKYA 4E3SA 4YQWA 1ZBFA 1RT5B 2EC0A 3K5LA 4G1QA 1Q9XA 4I2QA 4TXSA 3KHLA 4CJFA 1EETB 4JS4A 2XC9A 3KK2B 3FQKA 3JSMA 2HHVA 2IC3B 3CIZA 4WXWA 3PHEA 4F2RA 2W9CB 4O0IA 1NKCA 1S0NA 3HSTB 2JC0A 5HROA 1TK5A 4KHRA 4O44A 1L3TA 3IRXA 2NUBA 4GW6A 4NLXA 3A2FA 3HJFA 2KW4A 3V6HA 4NCGA 2RDJA 3KLGB 5DK5A 4DTMA 1Q9YA 4CHOA 2FVCA 2HNZA 5J1EB 4R5PA 4OKEA 1A5WA 1JKHB 4F3TA 1JLFA 3KK3B 4HUGA 1BCMA 4NYZA 2FLNA 4DS5A 1GOAA 3O4QA 2G8FA 4CF9A 2KFNA 1DTQA 4CJ3A 3EYZA 3BQ1A 2B4JA 3OYLA 3TAFA 1K1SA 3L2QA 4RW9B 3EPIA 2IBKA 2J6UA 2E9TA 2GC8A 3PZPA 2R8JA 4IRKA 3C6UA 1WLJA 2YNGB 3DLKB 5CY4A 3G6YA 3V81B 2YNIB 3CDEA 3ZSQA 5KG1A 4HUFA 1UA1A 1TVRA 2OPQB 4N47A 4DSEA 4RNMA 3AA2A 3MECB 5C24A 4B08A 4NLVA 4R8UB 4ECQA 3VQQA 1KSPA 3AA5X 5KFDA 1RT4A 1NHUA 3L2RA 5JUMA 1RTDA 1ASUA 4CJKA 1S97A 3NAEA 2QXFA 4FJKA 1T8EA 1JLEB 4MKBA 4KFBA 4K4XA 2OPRA 3ITHB 4CJVA 4DTOA 5KFJA 1HYSA 5DG7A 4LH5A 3PVXA 1JLQB 2YNFB 5KFCA 4OKKA 1NOZA 1J5OB 3OVNA 2W8KA 3AV9A 1YVFA 2QV6A 4CF1A 3SPYA 4KRFA 4JV2A 4KV8B 3ZCMA 1TGOA 3I5AA 3CDWA 3DOLA 3CM6A 4CK1A 5T7BA 1X1PA 1Z25A 4ZVFA 5C25A 3QO9B 2VG6B 4QWCA 3LALA 1NK0A 4DQIA 4GVMA 1HQEB 3M8RA 3GIMA 4IQXA 3WNHA 3G86A 3DRRB 1RTHB 4IDKB 2XI3A 4XPEA 5D3GA 4KHQA 3AO2A 4N76A 1NNDA 2IM1A 2O4GA 4TY9A 3MEDB 4ZP7A 3KLHB 5DQIA 3O4NA 2QK9A 3ULDA 1JL2A 3K58A 1IKXB 4IFVA 4C8OA 3THVA 4NLWA 4ED0A 4RNHA 3NDKA 1WAJA 5F8IA 1NK7A 2R8HA 1RTIB 4CECA 2F96A 3IAYA 4HTUA 4MKAA 2OH2A 4Y2AA 4ELVA 3C6TB 2FVQA 2R8IA 2FBTA 1ZTTA 3KLIA 1TK0A 4CHYA 1C0TB 1YVUA 1S9GA 3TAMA 5KG2A 2HB5A 3PW0A 3DM2A 3KNAA 1SL2A 1LW0B 2FC0A 2BANB 4DQSA 2WOMB 3I0RB 3D0PA 2WONA 5KT2A 2ZQBA 3H4BA 2Z1HA 4YNQA 1RYSA 4Y34A 1VSMA 1RT2A 2XWYA 3G0ZA 1C0UB 3HVAA 4EZ9A 4KB1A 3SUQA 4KI4A 4ZPAA 3KOAA 1RT7A 3O3HA 4M94A 3HPGA 1SV5B 3TAQA 4B9LA 3HPOA 1UWBB 4EBCA 1C2PA 3RBDA 4ICLB 3ZSYA 1REVB 3V6JA 5KFMA 4WYWA 1RBRA 4KTZA 3RB3A 3OHAA 4QWDA 4J9LA 1ZYQA 1KRPA 2PY5A 2BQ3A 3PW5A 3OL7A 2HW3A 1WSJA 2FVPA 2ASDA 3L2UA 5K14B 1YTAA 3I5BA 1FXXA 3AVAA 4FLTA 4O4GB 2BE2B 3UQSA 1LWFB 4Y1DA 4ECRA 1ZBUA 3TWHA 4O0JA 4HKQA 4KAZA 3LP1A 3NH2A 2E9RX 4CGFA 1JL1A 1J53A 4J2BA 3ALYA 3NF9A 1RT1A 4GC7A 4FW1A 2W9BB 4FLWA 5HP1B 4RW6A 4I7FB 1NK5A 1T3NA 4PUOB 5L1JA 1KVAA 1Q8IA 4I2PA 2HNYB 4OGEA 1D9DA 3DOKB 1TL1B 4Q8EA 4FJ9A 4Y3CA 3K57A 4JV0A 2RN2A 2KTQA 4CFBA 4IKFA 3SUPA 4TY8B 5I42B 2D0AA 1RNHA 3SQ4A 3DRPA 4ED2A 3MR2A 1JIHA 2BRKA 5HBMB 1ITGA 1TQLA 2AGOA 3DRSB 3U3GA 2GIQA 1QQCA 5J2PA 5C42A 1ASWA 3S3NA 4NCBA 1L3SA 2D41A 3OS2A 1JXLA 1JLCA 3P83D 1QAJA 2V0NA 3HHKA 4FVMA 1SH0A 2JEGA 4DS4A 3MR3A 4KI6A 1S10A 3T1AA 5JS1A 4LQ9A 4YMEA 1W0HA 4URGA 3V9SA 4IH6A 3NBPA 4ZHRB 4IRCA 3L8BA 1MU2A 3AA3A 1RDDA 3AVHA 2IJNA 2X74A 2G8HA 3QZ7A 4JUZA 1XHZA 5FRNA 1RBSA 1NK6A 3M8PB 4H4OA 3QGGA 4MQ3A 3V1QA 1JLGA 2BDPA 5DG9A 3CJ4A 4G3IA 5KG0A 3SJJA 2JC1A 1G15A 1IKYB 3F73A 3KHHA 1XR5A 4BE1A 4K8ZA 4CEBA 5L1KA 4I2QB 1IG9A 3CVKA 2BGGA 1VSKA 5KFHA 2VWJA 4DFPA 3JSMB 3Q8PB 4CGDA 3P5JA 3G6VA 1N48A 3RMCA 4Y2CA 1LW2A 3PW4A 2LSNA 2XCAA 3V6KA 2ILYA 1X9WA 1EP4A 5HROB 1N4LA 3HKWA 3CWJA 1KFDA 3CJ2A 4O44B 3SPZA 3IRXB 1BIUA 4YR2A 1ZBHA 5KFXA 4O3NA 2VG7A 4NCGB 3KLVA 4MK9A 2HWIA 3GIJA 4M3ZA 1IKVA 2WRMA 2QKKA 3RB6A 2HNZB 3VQAA 2G8IA 3VQEA 4FW2A 1SKRA 1QSYA 4R5PB 5EWEA 3ZT0A 3TVKA 3SV4A 1JLFB 5KT7A 1FK9A 4XPCA 4X2BA 4LD0A 3HO1A 5F8NA 4B3OA 3KK1B 3H4DA 1I6JA 4FLXA 1CXQA 3RB0A 4CJ5A 3AVBA 1DTQB 1KHVA 4O3QA 3KKRA 1NK8A 3S3MA 4M3WA 4WYLA 3C6UB 1BI4A 2HHUA 3CDUA 4RW8A 1BISA 4FM1A 3OJUA 4Q8FA 1RDCA 2FVRA 3C94A 4WXOA 3SQ2A 2ZE2A 1VRTA 3U3YA 3KKSA 1S1XA 5CYQA 5C24B 2PYJA 3NF7A 3AA4A 1TKZA 4F4KA 2AX1A 4W5QA 1L5UA 4FJXA 4DTUA 3E51A 3TABA 1RTDB 5HLFA 1U09A 4E7KA 3WNGA 2Q3SA 3RAXA 4CERA 3RMAA 1IKWA 4KFBB 1QHTA 2W7PA 1KVCA 2OPRB 1B9DA 4CEZA 1QSLA 3AVIA 1HYSB 1A5VA 3NAIA 2C22A 4KHWA 1WSFA 4CK2A 2R2UA 4JRQA 3CFPA 2QE5A 3CJ5A 2YNHA 3OYMA 3CJ3A 3PO4A 2W42A 1XWLA 4Q0BA 3HP9A 3H5SA 2DPJA 5KFPA 3PJWA 3V9UA 4O3OA 1D1UA 3LP0A 3OL6A 3DOLB 3T5KA 4M3UA 5C25B 3BREA 2ALZA 1HYVA 1BQMA 3U6FA 2ASJA 4J9QA 3MXIA 2VG5A 3ZT1A 3H5UA 3G10A 1NOYA 5L1IA 4DSIA 4KB0A 3PUFA 1LWEA 5KFUA 2ASLA 1ZTWA 4QWAA 2O4IA 4RW4A 2OPPA 3OYGA 1S1TB 5D3GB 4IOBA 1HJRA 3RR7A 3VQ7A 3GV7B 2G8UA 4CJEA 3PR5B 2ZKUA 4FM2A 2HVHA 1UOCA 2YHAA 2A1RA 3MXMA 3BGRA 4IFVB 3MF5A 2WHOA 1IO2A 3TARA 5KFNA 4HUEA 2AJQA 3OSNA 3HT3A 3OHBA 1C1CA 1SUQA 2JEFA 2FJVA 2FBVA 4Q45A 3ZSVA 4M41A 3M8QA 4NYNA 2R2SA 3ZT4A 3KLIB 2C28A 4W5OA 3Q8RB 1GX6A 3QIPA 1S9GB 3TAMB 3DM2B 2QKBA 1HPZA 1S0OA 2BRLA 4HYKA 2P51A 4NLOA 1OS5A 4TQSA 3OYAA 2WONB 2O5DA 3EY1A 1RT2B 5KFVA 1S1UA 4KHYA 2UUWA 1QAIA 4DQQA 1S1VA 3QGHA 3SZ2A 2W9AA 1RT7B 1ZETA 1L3VA 4IG3A 2UVUA 4MIAA 2UVRA 3O3FA 2DY4A 4J9PA 3N6NA 4IG0B 4ZP9A 2C2RA 2D0CA 3D28A 4KKOA 3VQ8A 1S9EA 4BWJA 5JXSA 4QPXA 2XY5A 1U47A 2PZSA 1SL0A 3V9ZA 4EBEA 4ID5A 1C1BA 2D5RA 1LWCB 4JS5A 3LWLA 4Z4FA 3RRHA 2RF2A 1D9FA 5KT5A 1VSIA 2YKMA 4DL5A 2IMWP 3DMJA 5KFYA 3OJSA 4BDPA 4CF2A 2HNDA 3SI6A 1QTMA 4Z0UA 3PX4A 4J2EA 3VQ4A 1J9AA 3LZIA 3AO3A 1S1WA 1HMVA 4PWDA 4EZ6A 3LP1B 2V9WA 5HRPA 2D7SA 2B5JA 4DU4A 3T3FA 1JLBA 5KFZA 2X78A 1NK9A 4ZPBA 4RW6B 4FJLA 4W5NA 1A5XA 2CJQA 1RT3A 4I2PB 3UR0A 3LANA 5DGBA 1C6VA 5KFAA 3QERA 4FK2A 3M9OB 3OLBA 2OYQA 2RKIA 3ZT3A 2ATQA 4O5BA 3H5YA 4URSA 5DLFA 4M45A 4FJNA 4FBTA 3DRPB 4CJRA 3DI6A 1DTTA 4Z4EA 2P1JA 1ASVA 4OJRA 4DLEA 2FJXA 2IOCA 5C42B 5KFSA 3MR6A 4IR9A 2YV0X 1MMLA 4TN2A 1JLCB 3TQ1A 4PQUB 4M3TA 1VSDA 2C2EA 1TAQA 4F8RA 5SWMA 2IJFA 1SKSA 1EKEA 3VQ6A 4Q43A 4DFMA 1TL3A 3MR5A 4KHMA 3H2LA 4DSJA 4RUAA 3NBPB 2WCXA 4RNNA 1KTQA 3QNOA 4ZP8A 1MU2B 3L2WA 1HQUA 4R0EA 4ELUA 5KFFA 1EETA 1YTUA 4RG8A 1S49A 4L8RB 4J2DA 3N6MA 3KHRA 5KFRA 4NLUA 3NF8A 4O4RA 4H4OB 1JLGB 4KHUA 1RDBA 2ZD1A 4XO0A 3H08A 4RUCA 2WK4A 5F9NA 2HAIA 4B9TA 4BE0A 4DU3A 1CZ9A 1FKOA 5KG7A 2XY8A 4NLYA 3AVKA 3ISNC 1VSHA 4QW8A 3AVFA 4CJWA 2IS3A 4TYBA 3TR8A 4MFBA 2HMIA 3L2VA 3RMDA 2R2RA 1EP4B 3WNEA 3KK3A 1RDAA 4NCAA 3GV8B 1NJYA 3L3UA 1WSGA 4OKJA 1L3UA 2VG7B 1IKVB 1LAVA 1KFSA 4LSLA 1BQNA 4Q44A 4K50A 3MEEB 1IM4A 2CKWA 4RNFA 4KPYA 3V81A 3E01A 4ID1A 1FK9B 4F4XA 4O55A 4CHZA 4B3OB 4OPJA 2B6AA 3HP6A 2YKNA 3FFIB 3PX6A 4Z4IA 3LPUA 1TKTA 3HYFA 3OYJA 3SYZA 4QOZB 2KZZA 3KIOA 5KG6A 4TSXA 1BI4B 4EYIB 4RW8B 5F9LA 1CLQA 2PYLA 2ZE2B 1QSSA 1VRTB 2HWHA 2IM0A 5CYQB 4RW7A 4FZXC 4CJQA 3DLHA 5FDLA 4KO0A 1TKZB 4FM0A 2DTUA 1EX4A 3MFHA 4FCYA 4DTJA 4NLSA 4CFDA 3I0SB 2X6NA 1IH7A 1J5OA 4KAIA 2JGUA 1TAUA 5HLFB 3KLEA 1VRUA 4FLZA 4ECUA 4JV1A 3LP2A 4KHNA 3QLHA 1RBTA 5KG4A 1IKWB 2RDIA 3CFRA 3KMSA 4FS1A 3DYAB 3OY9A 1KCFA 3IS9A 4AHCA 4OPKA 1SH3A 3ZSOA 1RBUA 4B9VA 4CGGA 2YNHB 4Y1CA 1NKBA 2Z1IA 3D45A 4Q0BB 1Z26A 3SCXA 3P1GA 4WZMA 3NCIA 3DRRA 1RTHA 2B43A 1KVBA 3AVGA 2HHTA 3LP0B 3VA3A 3S3OA 4FJGA 1S6QA 4EP4A 2IA6A 3K59A 3IN5A 4BDZA 4IR1A 3MEDA 2XO7A 4E1MA 3BJYA 4OVLA 4KE5A 3AVMA 2VG5B 1WN7A 5DQGA 1IKXA 1KLMA 4FXDA 1RDRA 3HK2A 4IH7A 1LV5A 1LWEB 2KQ2A 1SL1A 3TANA 4RW4B 4G1QB 2OPPB 1QS4A 4J9OA 4F2SA 4Z4HA 2D3UA 4NRUA 4WFZA 4K4WA 1N56A 2XY7A 2D0BA 5KGWA 4NLRA 3ISND 3BGRB 1JXEA 3KD1E 4RNOA 3KMQA 3QINA 2XGPA 4PY5A 4DTSA 3CFOA 4HCCA 4FJHA 4OL8A 1C1CB 1SUQB 4N5SA 4FYDA 1FKPA 3M8QB 4YFUA 3UIQA 2DFFA 1T7PA 4FS2A 1JLAA 3M8SA 3GIKA 4EEYA 3DDKA 1K6YA 2EX3A 3QIPB 3FDSA 1SV5A 1HPZB 4ZTFA 3HVTA 4E7IA 1LAWA 4ICLA 3HVWA 4J9SA 3VQBA 1N6QA 3V6DA 4ECTA 1S48A 3AO4A 3OS0A 5CYMA 4DL7A 1KHWA 1D8YA 5I3UA 4MIBA 3QEIA 4IFYA 1S1VB 3K2PA 3RTVA 4FZZA 4N56A 1Y97A 4IG3B 2Y1IA 5EWGA 4QWBA 2R8GA 2E9ZA 1S9EB 4MH8A 4GC6A 4DTRA 3NMAA 4ZPCA 4ID5B 1C1BB 4J2AA 4CJPA 1T05A 1TVRB 1VSJA 1RA6A 2RF2B 5J2MA 2YKMB 3LAMA 3DMJB 2ITGA 1RT4B 3TAGA 4ECYA 2HNDB 2R8KA 1C1AA 2KFZA 3ZSWA 3PW7A 1S1WB 2UUTA 4PWDB 3OYDA 1SKWA 3QETA 4GMJB 1VSFA 5EWFA 1T03A 3SUNA 1B9FA 2I5JA 1HRHA 2IGIA 3T5LA 4CJUA 2KZMA 2B5JB 3IGNA 4TY8A 4EP5A 1JLBB 4KHSA 3NAHA 2Z1GA 4Z4CA 2IAJA 4NRTA 4QAGA 1RT3B 4W5RA 3TAEA 4J9RA 4QW9A 1ZBLA 2EHGA 3PJXA 1RAJA 3QESA 1S6PA 2IDOA 2UVVA 4E19A 3QEVA 2RKIB 5KGXA 4EO8A 4K4UA 2Y1JA 2OPSA 1JX4A 2AGPA 2GUIA 1QUVA 3UDLA 2HHWA 4CEEA 4WE1A 1HNVA 1CXUA 4H4MA 3I8DA 3DI6B 2F8TA 2XI2A 1DTTB 4NZ0A 3M9MB 4HHTA 4FJ5A 2E6LA 4CEQA 4O3RA 2BQUA 1QE1A 5J2QA 4E7LA 3BSCA 1UAXA 4JLHA 3OS1A 3OL9A 3MAQA 2IM2A 1RTJA 3DLGA 1WSEA 3DLRA 4ECXA 3L3VA 1NK4A 2OZSA 4H54A 1TL3B 1WSIA 3PX0A 2YHBA 1W9HA 5KFOA 3AVCA 4NYFA 4RZRA 1VK0A 3QZ8A 4ZVHA 2Z1JA 4OLBA 1HQUB 3T5JA 4ECZA 3OYBA 2G8VA 1I39A 1WNSA 3H40A 3RMBA 1W25A 3QYYA 2ZD1B 2W7OA 4AHRA 4CCHA 1U04A 3PW2A 1NKEA 5KRTA 4ECVA 1DLOA 4I9QA 1FKOB 4WZQA 2GBZA 3NFAA 3OYNA 2JEJA 4AILC 2JLEA 4J9KA 1HNIA 2AX0A 4MFBB 4CK3A 3OYFA 4IH5A 2HMIB 1WNEA 3ASMA 3ICLA 1R0AA 3RB4A 3LPTA 2AU0A 3ZSXA 4OGCA 1RT6A 3LAKA 1X9SA 4ZP6A 3SQ0A 3H59A 2JEIA 2F8SA 3KK1A 5KFKA 1ZBIA 1C0MA 3Q8QB 3DLEA 4WFXA 3IG1A 4CF8A 5KFIA 5KFLA 3CYMA 4LSLB 1BQNB 4CFCA 4DG1A 2AQ4A 2X6SA 3E01B 5DLGA 2J6SA 1TV6A 3OYEA 3OSPA 3HL8A 4PA1A 4UQGA 3KHGA 1KLNA 4ECWA 4CJSA 3O3GA 2B6AB 2YKNB 5DG8A 1TKTB 2VA2A 1TKXA 3EZUA 5F8MA 1XR7A 4DTNA 4LQ3A 4BDYA 3CM5A 4E7HA 1RT1B 4C8LA 4DTPA 3NL0A 2ILZA 4CIEA 3NE6A 4Q5VA 3SFGA 3AVJA 1N5YA 3RR8A 1NJXA 4RW7B 3KJVA 1BGXT 4CEDA 1D0EA 2P5OA 4CFAA 5FDLB 4KO0B 3MEGA 3FRZA 3IGVA 3V9WA 5HRSA 5KTQA 3M9NB 4FJJA 3NGDA 5JS2A 2D3ZA 5FRMA 3KLEB 1VRUB 3LP2B 3QLHB 3V4IA 3NF6A 4NLQA 3NKYA 4C8KA 4AH9A 3PV8A 5J2PB 1RYRA 4RU9A 4F3OA 1X9MA 4LSNA 3HM9A 1RILA 3IS9B 2GIRA 2IM3A 4IKAA 3BDPA 5J2NA 2GV9A 3ZSZA 4KSEB 3KLFA 4CGJA 4K4SA 2VA3A 4FLYA 5F8GA 3V1RA 4B9MA 3BQ0A 1K1QA 3JYTA 2G8WA 4K4YA 4E1NA 3CJ0A 4K4TA 4FLVA 5EU7A 4CGHA 3NHGA 4I9LA 5F8JA 1RT5A 2ETJA 1S6QB 1S1TA 3H5XA 2C2DA 3KK2A 4K4VA 4O3SA 2IC3A 5HRRA 2VWKA 4C8MA 2W9CA 5KG3A 1S5JA 4FLUA 1KLMB 3AO1A 4U7CA 3VQCA 4ED3A 3BQ2A 1NHVA 3BSOA 4B8CA 4IRDA 4CGIA 3C95A 5HRNA 1D5AA 4DU1A 4H8KA 3T5HA 3KLGA 3B6PA 1TKDA 3K5OA 1XR6A 1LW2B 1BL3A 5J1EA 4F4WA 4ED6A 1JKHA 1Z4UA 3OLAA 4J9NA 3QIDA 2OZMA
chains in the Genus database with same CATH superfamily
4K0KK 1SH2A 4ED1A 4LSZB 4X64J 1FKPB 2VFSA 1NZAA 1U7LA 1ZH5A 2F8EX 2IRXA 2AJ4A 3J7YU 1GOCA 1IWGA 7FD1A 2LCWA 4OYIA 2VH7A 5F8HA 3M05A 5SZTA 2EK1A 3HVTB 3PIOL 2YNGA 1GOBA 4KC5A 2FLPA 3SV3A 1U8SA 4PG7A 2YNIA 2ATLA 1V4TA 1X60A 4RJVA 4NLTA 2XRIA 4R8UA 2MZRA 3LGHA 3MCMA 3M8YA 1T0TV 3DLBA 3V4MA 3D6HB 3G25A 1VLYA 3CG7A 4DL2A 3AY0A 5HO4A 2FZCB 4B9NA 3WNFA 2VFVA 4F50A 3ITHA 1GXLA 3V9XA 3E9LA 4B9UA 3Q2TC 4LRFA 4L3NA 2CQ2A 1IJJA 3EGVA 4DR4J 4ZVGA 2ZH1A 4NEZA 4CJLA 4KV8A 3M1FA 2FJBB 2AWZA 2UVWA 4UOGA 2VASA 5KG5A 1UA0A 4F9OA 5FROA 1SCJB 3B4MA 5L9XA 3BR9A 3R7BB 1UAWA 4IDKA 5G0RA 1RWOB 3NGIA 2QL9B 5CZ2A 4USJC 1FEHA 4WE1B 2CPDA 1QDUB 2GO8A 4K4ZA 3RRGA 1K73T 3MTJA 3H98A 1OH8A 2EVZA 1H1VA 5DMRA 1FI4A 2AV5A 2WTFA 4AXIA 5KRSA 1RTIA 3JQJA 2D3O1 3CCVS 4LUBA 4USHA 4GY2B 3EPGA 3KVGA 3CO9A 2QLWA 1KC8T 4B3MJ 4QPTA 3DXMA 3ENVA 1TL7B 2H5EA 4AHUA 4FJ7A 1LW0A 4A8WA 1KOOA 4DWIA 2ZKTA 4CZLA 2RPIA 3IR5B 4M95A 4U7BA 3KNGA 1T11A 2FLLA 2CZVC 3G6EN 2MJNA 1C0UA 4OX9J 3D1OA 2H3GX 3NGTA 4WTYA 4DUZF 1CG2A 2G1HA 4WFNQ 5CZ1A 3GIIA 4CEAA 2B9WA 2K2PA 4X4VA 5DZ6A 1FNXH 4B3RF 3G71S 3CPEA 1M1KT 2FJWA 1U48A 2DFEA 1EXQA 4JKAA 2XY6A 4JYAF 4PL7A 3GPAA 2QA4N 2ZNZA 1S1UB 1NUEA 1O8BA 3X1LB 3MUMP 5E26A 2QWRA 4EWTA 5ETNA 4ZTJA 3J81O 5K14A 5H1SQ 4LF7F 1E6VA 1WOQA 2XB2D 1PAUB 4EHTA 3SJHA 1LWFA 2VBZA 4MK7A 4WCEQ 4AQYK 5D6GA 3FFIA 2Y8WA 1VQPN 4FPIA 4CESA 1VSLA 1Q7YT 3DOMA 2PA8D 5KFQA 1XI1A 2W25A 3KD5E 3J80U 1FFSB 4M1KA 3TU5A 1XN9A 3FUYA 4I6WA 3O1BA 2HNYA 4UZBA 4EU0A 2ZNYA 2V8HA 3DOKA 1TL1A 4V1Ak 2DH8A 2MKHA 3PFEA 4GVLA 1SJFA 4C8NA 5ETOA 4EO6A 3GFXA 3I4HX 3CMQA 2PMHA 3TI0A 1S72S 1R59O 4DV0K 4AHVA 4AE5A 1VHIA 3A3OB 4EI2A 1WACA 2MJUA 3O1LA 4JI4J 2A2DA 4CTAB 3SQOP 1N5YB 4E7JA 3ZTPA 5FPNA 1YJTA 5LMUK 2KYXA 4EYHB 1Q81O 3QIOA 1BHLA 5CYJA 4MMOA 3QEPA 3O9TA 3M5RA 1DHMA 1VQ6N 4DV6F 3V4IB 4FBUA 3GYNA 1D4XA 4HVJA 4DN9A 5KI6A 4DL4A 3AO5A 4EMDA 3W2VB 1S0MA 4TU9A 3VEXA 2A40A 3M8PA 3SI8A 2L48A 4ZLPA 3QEWA 4HL9A 2PAVA 1IKYA 4YQWA 1F60B 1NLVA 4JD2A 2LKZA 4JS4A 1XNQK 1VQYA 2H1YA 3N28A 2OANA 4WXWA 3PHEA 2CPHA 4F2RA 4LF8K 2YWHA 3AAPA 3HSTB 4BQZA 4AUKA 6FD1A 5HROA 1TK5A 4KHRA 2MKYA 4O44A 1CJKB 3RG6A 3HJFA 2ZVIA 2ZWOA 4NCGA 4PYDA 3UFCX 1Q9YA 2MMYA 4IEIA 4IO8A 5FD1A 1FRLA 2HNZA 2AMCB 1LCUA 3W62A 3AGRA 1GOAA 2E44A 2XHCA 2ZM6J 4P71A 1U0HA 4X64F 1ZM9A 2CQ0A 2A3ZA 3EYZA 2XYPB 3BQ1A 3OYLA 4PHTX 2GW8A 3TO8A 3C6UA 5GAHP 2IIHA 2HHPA 2KHDA 3G6YA 3MPYA 4B1UB 3H46O 3ILLA 1EIYB 1FHTA 2LXIA 2EFNA 3AA2A 4NLVA 3FNNA 3K9KA 3AA9A 3VQQA 1NAQA 1RLDA 1Q8LA 2C3YA 4I67A 2DK2A 4CD1A 1Q7LB 3J7AP 4ZKAA 1WC5A 2X3GA 1AZSA 4FWMA 2ZWHA 4U8YA 4UOCA 1X4FA 2RS2A 4USWA 2YXLA 1HIYA 4FWRA 2UUBJ 3HMJG 4OKKA 2CGKA 2VUGA 3W60A 1NSAA 3EO3A 2W8KA 2C2NA 4LBIA 4CF1A 2DKOB 4DR4F 3THYA 1YLXA 5T41A 3H90A 3H1QA 5D8HB 3G8SA 3FR0A 1TGOA 4X4PA 2DNHA 3G6ES 3QAEA 1BD6A 2AJFE 4CK1A 3PIOQ 2AHOB 4ZVFA 2CAJA 1NJIT 3QO9B 4QWCA 5LSLA 1WWHA 4WP9A 4DQIA 1Q95G 2B7CB 1HD0A 2W7AA 4M5JA 1HQEB 5KAKA 2L08A 3M8RA 2HEKA 2QMUB 3GIMA 4IQXA 2Z30B 1M5PC 2QA4S 4DV2J 2RH3A 2XMWA 2HVDA 4ZP7A 3KLHB 1VRQC 3HLUA 1CQMA 3O4NA 1Q79A 3O4WA 1XMQK 1JL2A 3K58A 4C8OA 4ZPWR 4ZDNA 2FC8A 1F1BB 1G3OA 3V2UC 1WAJA 1OPZA 3EMTA 5F8IA 1NK7A 3HX9A 1VQPS 2BOPA 3NP5A 4CT8A 2XMVA 1R8HA 2E5IA 2J0QD 3IAYA 4FN5A 4DR2J 4KJIA 4Y2AA 2MDAA 3UVJA 2FVQA 2R8IA 2FBTA 3PYFA 1ZTTA 3KLIA 4B3MF 3W64A 5KG2A 2YKAA 2HOEA 1MDUB 3CCLN 3VZHA 5LT5A 2ZQBA 4CH1A 3DXKA 2ALYB 4CRJA 1UZDA 3HFVA 2XWYA 2XS7A 3GR1A 4KB1A 3U7JA 2E66A 4OX9F 3TRGA 3KOAA 4JNEA 4FPBA 1QHAA 3BPDA 2XWXA 5ITHA 3O3HA 3HPGA 4B9LA 2F7VA 1S22A 3HPOA 1UWBB 1WEZA 1ICEB 3OBIA 2HZCA 1REVB 3V6JA 4WYWA 4C8ZA 5BPMA 3WHIA 4J9LA 4E8UA 2GJFA 2BQ3A 3PW5A 4UZCA 1SIWB 4JKEA 2HW3A 1H2TZ 1WSJA 4BRKA 3L2UA 4JKGA 2QYGA 5GADI 3NRBA 3L6QA 1HNWJ 1VQ6S 2Q79A 4O4GB 3C15B 4I64A 3GG0A 2DO4A 3UQSA 1A0OB 4Y1DA 2DO0A 2X3DA 3BF1A 3TWHA 2O8FA 1XTZA 4OJ1A 1U1OA 4C6AA 4CGFA 1JL1A 5DETA 4J2BA 3ALYA 4GC7A 1QVGM 2W9BB 4FLWA 5HP1B 2DNQA 4RWTA 1Q8IA 4H5NA 4JBCA 2MY8A 3FSYA 4HH1A 3W3DA 4DCPB 1WB9A 4OI2A 5FPDA 4CFBA 3DHWC 4HTJA 5I42B 1K8KB 3OTOJ 4GKJK 2D0AA 2HRYA 4RBTA 5HQLA 5K8PA 3SQ4A 2CYYA 4ED2A 3GL1A 2EKNA 1Q5VA 2V68A 5B09A 4JI4F 4OX8A 2XM3A 1ASWA 2W2MP 3S3NA 4CI0B 1L3SA 2D41A 1H2UX 4M7XA 1VK3A 4LRCA 1UZHA 3THXA 3HOTA 2MKJA 2W2QP 1H3DA 2F9JA 2ASMA 4LC9B 1SH0A 2JEGA 2E1MC 2N4DA 1VR6A 4YMEA 4URGA 2Z4PA 4RWXA 4LBHA 3U9ZA 3HHNB 2IJNA 2GJ2A 3I8BA 2CQ1A 2MB0B 4JUZA 1RBSA 3V1QA 4V19J 1N32K 4G3IA 5KG0A 3SJJA 2D3OR 4CNYA 1FEEA 1G15A 3F73A 2D74B 4BRPA 2FJDB 4OYOA 3MM7A 1GLDG 1TMJA 1VSKA 2CGJA 4LFBK 2UXDJ 3DLJA 2O8CA 3A8YA 2V69A 3JTOA 2KLAA 2HKEA 3UKUB 3PW4A 2LSNA 2G2YA 2XCAA 3L4QA 2C2KB 2QL5B 1KFDA 3CJ2A 4BVOA 4YY3K 3IRXB 1HA1A 2XHWA 1AYEA 3KLVA 2FUG9 2CQBA 3VAMA 1MROA 1BOTO 3GIJA 1MNEA 2DHAA 1Q8KA 2WRMA 4K0KJ 4FYYB 1WBBA 2G8IA 4FW2A 1QSYA 3ZT0A 1R0BG 1Y5NB 2IMOA 3CIPA 1JLFB 1SJRA 1J5EK 4XPCA 2IA0A 2YHWA 3SEOA 3H4DA 1I6JA 2CG8A 4YOUA 2AYEA 1CXQA 2ZM6F 3QBXA 1NH8A 3FKBA 1YBTA 4XDCA 1SZ2A 3JSYA 2PN6A 4GV9A 3JAMU 2LQBA 2OKQA 2Z57B 3ZLJA 4ZLLA 1RDCA 5LJ5Y 4RCHA 5HATA 2G0IA 7FDRA 4WXOA 4ZCKA 3SQ2A 2B51A 1VRTA 2HLTA 4AFFA 2CQ4A 5C24B 2YX7A 3NF7A 1TKZA 2DHSA 2DNNA 2UXCJ 2ERRA 1N36K 3FEZA 2D1CA 4NLCA 5CAAA 3CJSA 4DV4J 1FXDA 3SK3A 2CVEA 2VKRA 4E7KA 3MPWA 3QJJA 3HD2A 4BC3A 1KVCA 2E5JA 1B9DA 2QJ3A 1QSLA 4JAXA 3B78A 3ISZA 4P6QA 1A5VA 3NAIA 5DS7A 3NCQA 2C22A 4JKDA 3MGJA 2R7RA 4W4MA 1U0SA 2KKHA 3PRDA 4JRQA 2UUBF 2QE5A 3OUYA 4B17A 3VGKA 2J5AA 3CPWR 4FYVB 5HMXA 3CCLS 4CBUA 3TJ8A 2VQFK 3H5SA 2DPJA 5KFPA 5D0EA 3P4IA 2JWKA 2K3KA 1X9JA 3SDEB 5LJWA 2CRLA 4I4BA 2E5LK 2GQ2A 2LQ8A 3DOLB 3ZX2A 2BJ7A 1VHFA 2VG5A 4UY8O 4DSIA 5L1IA 1LWEA 1YG0A 3MN5A 4JI3K 2M3DA 3IBFB 1GK8A 2E20A 1WDTA 4KPCA 4DV2F 3EZWA 4C3KA 3H20A 5B7WA 2G8UA 3IR7B 3PCOB 2JJ4D 2HVHA 5K20B 1UOCA 3MXMA 2IVFB 2ROPA 3OVSA 3L4IA 1N54B 5JVGL 4DV3K 2JEFA 2FBVA 4KT0C 4DR2F 1M0SA 3KJFB 3K0SA 2WVBA 2KG1A 3CDAA 3QIPA 3TAMB 4DKWA 4FVUA 4HYKA 4NLOA 1OS5A 4JP8A 3OYAA 2M8DB 4NE9C 2CADA 2O5DA 1RT2B 1S1UA 1U02A 2RU3A 4KHYA 2UUWA 2L9WA 3QGHA 1Q1KA 2ZGYA 3Q22A 2W9AA 2DPNA 1L3VA 4J9PA 2F40A 2C2RA 2CNOB 4ZJLA 2XY5A 3US5A 2VL1A 3GIRA 1FRMA 1SL0A 2FXUA 3LWLA 4A59A 4C7QA 3RRHA 3KYLA 2RF2A 1PYTA 2H5JB 3BN4A 2YKMA 1JJ2M 3I82A 4AQYJ 5KFYA 3GTYX 2GWJA 3G87A 1RAAB 1HNWF 1QTMA 3PX4A 2PD1A 5ETMA 4PWDA 4EZ6A 2GMLA 3R3LA 5HRPA 1MWMA 4RPFA 2FQQB 2B5JA 3D2EB 2X78A 4FOIA 3EKUA 3ENAA 5E84A 3VOVA 2NCKL 4WYBA 4MKYA 2VGNA 5AQJA 2H4YB 3MCPA 2UYTA 3OLBA 2RKIA 2N3OA 1RWVB 5J1PA 4DQ8A 3OTOF 2A42A 3JXUA 4URSA 4M45A 4CJRA 1EO1A 3DI6A 3FRYA 3KUGA 1DURA 1DTTA 1WF0A 1CZAN 1WG4A 3NGRA 2JWLA 1VQ9N 5C42B 5LSRA 4A57A 4KQZA 3RVCA 3ZZOA 2W24A 3TQ1A 5I9EB 2I7NA 4PQUB 3O80A 2DR8A 4CP5A 3DU5A 2C2EA 3PTWA 4CT9A 3FZBA 1SKSA 1RBAA 2GMHA 3E9PA 2DNZA 4H0PA 4DSJA 3NBPB 2WCXA 3TZZA 3QNOA 2RRNA 3Q86A 1HQUA 5KFFA 3CDBA 4RG8A 1YTUA 4L8RB 3IP0A 1Y9OA 3D6MB 1VC0A 1TFYA 4NLUA 1YVNA 2FGCA 2KM8C 4JK9A 1JLGB 1N0VC 4RUCA 4LMZA 4ER8A 3F5TA 1XNQJ 4DU3A 1FKOA 2XY8A 1N0UA 2RE2A 1SJQA 2LU1A 2V67A 2J4RA 4LF8J 5E0OA 2RVJA 3W9HA 2XS2A 3JXOA 4Z94A 4CJWA 3OXFA 4GV3A 1OKJA 2UXDF 3R6GB 3CD6N 3RBXA 4ILHA 2GA7A 2RRAA 3RW6A 4TU8A 2HMPA 2Z2ZA 1GLFO 2MQQA 3K7RA 5HVHA 1NJYA 4M5NA 4S0MA 2ZH6A 2VG7B 4YOVA 2KB2A 1BA1A 1U2VB 1KVKA 1N5TA 4HVZA 4DPOA 3NOGA 1XK8A 2G2OA 1IR2A 4K0KF 3VGSA 4KPYA 4O55A 4C11B 1U2CA 4B3OB 2ZH9A 2GGPB 3C8YA 4Z4IA 1XC3A 3SYZA 2NR0A 3R5AA 4A8OA 4TSXA 2COLA 3HJVA 1BI4B 2P9UB 4BR2A 2CJBA 4HLBA 4RW8B 3NNHA 5F9LA 2PYLA 2ZE2B 2HWHA 2NRXA 5CYQB 2GX8A 2QN6B 1U25A 4ZIVA 1YRTA 1UL3A 3NOCA 2DRBA 3LW5C 4FM0A 1EX4A 2UXCF 2ITMA 1IH7A 4KAIA 1TAUA 1UTAA 5HLFB 3KLEA 4OZ1A 2FHKA 4ECUA 4JV1A 1DQ8A 3LP2A 2RQMA 4DV4F 4KHNA 1EHWA 1YHQN 3KMSA 4XDDA 3DYAB 4ANDA 1R8PA 3EN9A 4OPKA 2AKWB 2QRRA 4FOEA 2WVDA 1RBUA 2EFOA 4LRBA 4B9VA 4Y1CA 3H6EA 3SBTA 2AEJA 4FL9A 2PC6A 2FZGB 3CJ7A 4ISFA 2HHTA 2RAQA 2HRTA 1UPMB 4WQ4C 4B1XB 1Q78A 4DCOB 1NMEB 4EK2A 4ISEA 1RAEB 2ASOA 5GADP 3CIMA 2Y0SD 5AXMA 4FXDA 3M2VA 1WG5A 4YEAA 2KQ2A 1VAZA 2DHXA 1EB0A 3SCKE 1AUSL 3D9BA 4RW4B 4G1QB 2OPPB 3LQVA 2EG1A 5GMDA 5GADU 4Z4HA 1WKJA 4NRUA 3DCAA 4K4WA 1N56A 1NDCA 4ES2A 3A8KA 5KGWA 3HSJA 3PYGA 3D6TB 2NXCA 1HBOB 5CZVA 4OZ3A 4OL8A 2CJAA 1IN0A 4BLGA 1C1CB 4ERDA 3M8QB 3UIQA 3CCRN 3CXCR 2MZ1A 4FS2A 2B0GA 2HIYA 2XSJB 3QRQA 3ELHA 4EEYA 2OI2A 4DUYJ 1HPZB 2DVIA 1U8WA 2CFXA 2CIMA 4Z2XA 4PXBA 5C12A 3V6DA 1S48A 3AO4A 3GR0A 1KHWA 1FXRA 2B56A 2QM1A 1D8YA 1NU0A 2G9OA 2QZ8A 1S1VB 1Y97A 2PFUA 4FYXB 5G4DA 2A1BA 1RHUB 1S9EB 3C65A 4MH8A 1VQ9S 2DR7A 4ZVOB 4JI6K 1DGKN 3LL3A 4A2AA 3TP2A 1T05A 4RUHA 3N4PA 1RSCA 5J2MA 2JWNA 3PFOA 3LAMA 3FSXA 4DX8H 5JVGQ 2OEMA 4AQYF 2R8KA 2OUGA 3ZSWA 2UUTA 3OYDA 1SKWA 5EWFA 3SUNA 1B9FA 2KZMA 2W40A 3SLCA 2DNRA 3IGNA 4KHSA 3GLJA 1K8KA 3NAHA 2Z1GA 2CNNB 2IAJA 1M1KO 4A48A 2QMWA 4C1NK 3UD5A 4QW9A 2NLXA 4NLBA 1S6PA 2IDOA 2MZTA 2OHDA 2QWOA 5GMEA 1HBUB 4DV0F 4Y28C 4N77A 3CJ1A 2GIFA 3GE9A 2J8SA 3CD6S 4IOCL 1IBMK 2AGPA 5ADXH 4LVNP 3UDLA 1K0VA 3AXMA 3I8DA 3QPIA 1QZ5A 2P9NB 2XI2A 3ZEUB 1H6KX 1A6LA 3BH7B 5A2QU 4OPHA 3PRVA 5J2QA 3OL9A 1RZMA 4OI3A 1PKUA 3DLGA 1K8AT 2LQ9A 3DLRA 3ZZRA 2HGNA 2DH9A 2AJ0A 1S79A 6AT1B 4CLWA 4RZRA 4OLBA 2IRUA 2JNJA 2UU9J 3T5JA 1M1HA 1U6ZA 2G8VA 4B02A 1I39A 1WNSA 2RT3A 3OR1A 3H40A 3M2RA 3RMBA 3I31A 3MOJB 2HS0A 2MZQA 2PMWA 4AHRA 3BKTA 4CCHA 4LFBJ 1NKEA 2E7VA 2Q36A 1XNQF 4M5DB 1D9AA 3OYNA 2JEJA 1WHYA 2JLEA 3M1VA 3WIVA 4LF8F 4KIAA 1AFJA 1HX1A 4HDGA 2AX0A 4HHHA 2I9SA 4IH5A 4NA3A 3LH2S 3ASMA 1X4DA 2DR9A 2E29A 3LPTA 2CPZA 3VALA 1YHQS 3O9UA 2R7UA 4WFAL 3H59A 1ZBIA 3Q8QB 3DLEA 3NS6A 1SB6A 1GH8A 2GV1A 1W7WA 4CF8A 5KFIA 2HBLA 5KFLA 1FNOA 1UEUA 1TYQB 3W5YA 3U02A 3E01B 5DLGA 2JX2A 4WIQA 2QT7A 1QLNA 4YOEA 1KLNA 4CJSA 2YKNB 1TFWA 2DIVA 1CS4B 3PHTA 5F8MA 4MO4A 5KOXA 4IOXA 4BDYA 3CM5A 1RT1B 2EBGA 4C3LA 3P6YC 4JI7K 2ILZA 1NWKA 2QA1A 2VDIA 3NE6A 2PBDA 3MPVA 4PRFA 3AVJA 3MK6A 2F63A 2H54B 4RW7B 1BGXT 1FDBA 4CFAA 1MWYA 3OR2B 4IEEA 4KO0B 3MEGA 3FRZA 3IGVA 4YB6A 1FJEB 2F65A 5KTQA 4CLZA 2AIRB 3M9NB 1RAHB 4CZGA 2OSQA 1VRUB 4A8YA 4JHDA 3AJ1A 2J0SD 4A62A 4C8KA 4NLQA 3NKYA 2IVOA 4AH9A 3PV8A 2HVZA 5BRHA 1P8ZA 4LSNA 3R27A 3HM9A 3CCRS 1GMUA 2C1EB 3FZMA 3SXLA 1RAIB 3BDPA 2LVWA 3ZSZA 3KLFA 4CGJA 2VC0A 3I9ZA 4JK8A 2HBRB 3V1RA 3BQ0A 3RBZA 2E5LJ 3JYTA 4K4YA 4FLVA 1XMBA 4HTLA 1RLCL 3W2WA 1OY6A 3NHGA 4I9LA 4KH1B 4J90A 2NPFA 2ETJA 1S6QB 2V34A 2R7TA 1N5SA 2C2DA 3B8HA 2K7JA 4O3SA 3W9IA 3IMQJ 4JI3J 1VBYA 2NSBA 2NRVA 4C8MA 2IYIA 1VYAA 3BR8A 3M6VA 1NHVA 3L4BC 3BSOA 2VFRA 4B8CA 4QS9A 3R5DA 2OMOA 2I0XA 5HRNA 2QG9B 1P9YA 4NX9A 1D5AA 2DHGA 1T9TA 4NXMJ 5CQGA 3K0JA 3QFHA 2I6WA 5FLXO 2C3UA 2VU5A 1HNXK 1LW2B 1LQ9A 4DV3J 4JI2K 3KDNA 3ZETB 2YHXA 1RACB 1JKHA 2W4CA 3SCIE 5L8RC 1S0VA 4MIWA 1NJIO 3NH0A 1FXLA 3ZFVA 2HVIA 3D0GE 1JLAB 4CHPA 4DQRA 4DFJA 2HWTA 3AQPA 2YY3A 2KT5A 3DLLL 4DUYF 1ATNA 3M32B 4OZ2A 4CHQA 4DF8A 1BA0A 3DRXA 2G13A 3LZJA 3HPHA 2OPQA 4NXNK 1J54A 3B6OA 4NASA 3CCTA 4IFYB 3CF5Q 1CZBA 4CQ1A 2AZ1A 3D5MA 4J9VA 2FVSA 4E89A 1AT1B 1HD1A 3HI9A 2YHYA 3CCSN 1U26A 5AE2A 4NZ7A 2SXLA 4M3XA 4BACA 2C3OA 1DBDA 2OELA 3C6AA 4JI5J 1GX5A 5BN9A 3D2EA 3FJ2A 5AQZA 4AM7A 1JLQA 1O0PA 3QQCD 1DAXA 5EUHA 1CJUB 4JI8K 4BY9C 2FBYA 4BRHA 4O3PA 3E3XA 2X1BA 4B8AB 4KTWA 2DPIA 3I5CA 3GFZA 2VD3A 2AYGA 1EX8A 2G4BA 1T03B 3CC7N 2J6TA 4ZS6A 5KFBA 2YWKA 3EZ5A 3ZTOA 4YR3A 1R8CA 2KYZA 3ILJA 4F26A 3R1HA 2VG6A 1UKUA 4MLEA 4GO5X 2DD8S 3A4TA 3PY8A 1S99A 1LXJA 4D3HA 2NNWA 3NH1A 1LEOA 2HHQA 2Q2RA 2XCPA 2QWQA 2K7KA 4PQUA 4ZVEA 4CLFA 3BYPA 1YKWA 1HNVB 4H4MB 2KXHA 3MM8A 4DEZA 4XIUA 4CO2A 4YHHK 2AGQA 5B08A 1QE1B 4ZMMA 5HQ8A 2UV8G 2YTCA 3M4XA 2OTLN 3TJ9A 3TTCA 2CQHA 1YBUA 2HBJA 2NYHA 1BIZA 2BANA 4DXLA 4BWMA 4BRQA 1VIOA 2OJ3A 4URQU 2M70A 2MQOA 2MXYA 2UU9F 3O8WA 4KTQA 4NLDA 3SQGB 1NEEA 4BG9A 1RWKB 3D7SB 3F9KA 3A13A 2YBVA 2E6MA 1OH7A 4M3YA 5IQ6A 4X62J 4BQLA 1H98A 1W26A 2AEMA 5E3PA 1OYDA 2DH7A 1U45A 1DLOB 4DL3A 1LOTB 4LFBF 1RBVA 3IDHA 4C0HA 4IOCQ 3W8PA 2HGMA 3VHQA 1EQYA 1Q53A 2M52A 3S9HA 1HNIB 1U2VA 3T9NA 5KT3A 3M6GA 5AZJB 3MEKA 4CIGA 2BUNA 1VBKA 3ZZPA 2NRZA 2P5GA 4KKOB 4JKCA 1RT6B 2RHQB 4OZ5A 2QTDA 1RA7A 4C11A 3GG1A 3J80O 3UDVA 1F6TA 3IG1B 2H65B 3OYHA 1KQSM 3ZZZA 4C8YA 3QGIA 2F3JA 1OVYA 3RSEB 3MM5B 1TV6B 3CMEN 1UCNA 3KWMA 4MKVA 4CEFA 4YDUA 4AHSA 2F4VK 1HMVB 1NSPA 5FLXY 1U49A 4DLGA 1MMNA 3WQUA 3K5NA 2BR0A 3R3TA 2DY1A 1SIZA 2P6SA 5C5JA 2EK6A 5BR8K 4DL6A 4YOYA 4UOFA 1IXKA 3Q8UA 2YQ0A 3CSKA 5HBMA 4WP3A 3PM9A 4DFKA 2O8DA 2HFOA 4BHQA 3MMVA 3DYAA 1IQZA 4OYMA 1NJWA 2NPIA 1N36F 3KJVB 1TP7A 3M30A 4NLGA 2QXLA 1KR4A 3ZT2A 1T9VA 2V2ZA 3BSAA 4WFAQ 2V4QA 4PKIA 3C3LA 5CA5A 1BCOA 3QT6A 3U4LA 3GQCA 5IT9U 2Q31A 4NA1A 2D1KA 2VWBA 4M42A 1S5ZA 4CF0A 2UUCJ 3AT1B 2EWSA 2NRWA 2NUUG 4N41A 5LXYA 2ZH3A 2KJWA 3MD1A 5LM7E 2E5LF 2ZOMA 3QEXA 3WQPA 1W97L 1RT5B 4RUBA 2EC0A 4G1QA 1ZA1B 3U1NA 4TXSA 3MMJA 3KHLA 2XC9A 3KK2B 2OTJN 3TA2A 2KT2A 3JSMA 2HHVA 3J8AA 5JLFA 4C97A 4JI3F 2W9CB 4O0IA 4KY3A 3CCSS 2JC0A 3M7VA 2MQPA 3B54A 1HBOA 1F0XA 2GNKA 3DDNA 1G99A 1L3TA 3OXGA 3S6EA 3A8IA 3DKDA 5DRKA 4GW6A 1W7AA 1UP1A 1TL5A 4NLXA 3A2FA 2KW4A 2RDJA 5DK5A 5LL6d 4NXMF 3D2WA 4B3TJ 1NPKA 4K59A 2MZSA 1TUWA 2N7YA 1X4HA 4EIAA 2NLWA 2ZC3A 4DV3F 2Q1LA 2BACA 4PXDA 4R5PA 4OKEA 1A5WA 4HUGA 2XLJA 2UXBK 2P9LA 2FLNA 4NYZA 4DS5A 3CC7S 3O4QA 2AA4A 5HK4A 1T6DA 4CF9A 1DTQA 2E7WA 4CJ3A 2CDQA 2GCFA 2LP4A 3WEEA 2NUHA 1WC4A 1RJJA 1PC5A 2IBKA 4OV6A 4BRLA 1WLJA 2M0GB 2YNGB 3UN2A 1BWVA 4G1IA 2YNIB 1EKSA 3ZSQA 5AZIA 1UA1A 1BU6O 2FDNA 4ILGB 1FD2A 4N47A 4R8UB 3P39A 2NS1B 4ECQA 1KSPA 5KQ8A 4JI6J 3ZXWA 2KO1A 5KFDA 4CW7B 1FESA 1MA9B 1S97A 4DPTA 3MX5A 4FJKA 2VGMA 4H4KC 4K4XA 1WSVA 3ITHB 4DTOA 5KFJA 1HYSA 4JI5F 5AQGA 2OTLS 5E5NA 4BGBA 4DPWA 1J5OB 5AXNA 3AV9A 1S77D 1TR0A 2DIUA 3I96A 4KRFA 3P96A 2L3MA 3A1YG 5CHIA 4KV8B 1IUJA 1RWUA 1NGAA 3KWIA 1BDGA 1X1PA 5T7BA 4J7CA 1VQKN 4J91A 4GVMA 3GJSB 2WSFC 2FGOA 1B0TA 1LXNA 2B9XA 1IBMJ 3G86A 4IDKB 4JI1K 5G0RB 1WC3A 2D69A 2IVPA 2YJEA 2Y1LB 4ZCMA 2AZ3A 1IVZA 3MEDB 3NWGA 4UT4A 1NDKA 2EPIA 3O5BA 4ZOSA 1IKXB 4IFVA 2LDYA 4RNHA 5ETKA 1NGJA 4KYZA 2FD2A 5K9FA 2R8HA 1XQIA 1RTIB 4CECA 2F96A 4HTUA 4MKAA 4NL5A 4B1YB 2QSWA 3O6WA 3DXMB 4CHYA 4PG5A 4CZIA 2HB5A 2M4MA 3HSZA 1LW0B 2ZVSA 3CMES 4M5DA 4WBFA 3W7BA 3PLAA 4OLOA 4DV1K 3W65A 3FBBA 4GKKJ 1NGBA 2VFTA 3NMUA 2QLJB 1C0UB 2VOOA 4KI4A 3L0QA 2CVIA 4M94A 4X62F 1SV5B 3TAQA 5IWAK 2OSRA 1AW0A 1DT9A 3TUIC 3ZSYA 2R7XA 4UTGA 1CJTA 3OHAA 2W2PP 4WU2A 3BM7A 1NGDA 3QBCA 3UO0A 5E3RA 1JJHA 3OL7A 4FNIA 5E7OB 3HT0A 3Q24A 2A41A 1WOPA 3WBZA 2ZJQL 2ASDA 5K14B 1WOSA 3AVAA 2XNQA 1HQ2A 4R25A 2O67A 2MHEA 1LWFB 4ECRA 1HJOA 4P2FA 1KQFB 2LFVA 3LP1A 3VWSA 5BXIA 3DOMB 2DJWA 4HACB 3P31A 4U7UK 1T3OA 1MG7A 1RT1A 3NF9A 4RW6A 4QIWD 2V9KA 4I2PA 2HNYB 1IV0A 3HDSA 2VZ9A 1NMDA 3DOKB 1TL1B 2EEYA 5DM6Q 2O8EA 3ZTQA 2E88A 1GFWB 3M2UA 2YX4A 2XYHB 2OTJS 4OFZA 3K57A 1M1GA 2KTQA 2RN2A 2O1PA 2V63A 3O6QA 3SUPA 1HUXA 1UW9A 1JIHA 1N8RT 2AGOA 1X4GA 2GIQA 1R6YA 2JFDA 1RXOB 1FX4A 2ZOGA 3RZAA 3UN5A 2ZZNA 3RGIA 3HHKA 3C7NA 1GLLO 3CC4N 2ACMA 2QA2A 5A6WA 4CLPA 1M90O 1B3TA 3EGNA 1S10A 3G8QA 4IH6A 1MU2A 1CJVA 1E3MA 3AA3A 5BYQA 1RDDA 3EXYA 2X74A 2G8HA 1H38A 3QZ7A 5GMKa 5AXLA 4D3GA 3M8PB 4H4OA 3AD8C 2UUCF 2BDPA 3MWTA 5DG9A 2DITA 3EEQA 3NNAA 3MR7A 1SI9A 3LM2A 2P9PA 2JC1A 1IKYB 3UE2A 4K8ZA 2ZBPA 4AD6A 5B8HA 4JD2B 2F8HA 2WBRA 4DR7K 5KFHA 2BJEA 4PPZA 2JSXA 2OFGX 4DFPA 3GCWP 4GMKA 4LRAA 3Q8PB 4BBYA 3P5JA 3G6VA 3AD9C 3Q7BA 1N48A 4QS7A 1LW2A 5BPNA 1YI2N 1N33K 1X9WA 1EP4A 5HROB 3MCNA 3WXLA 3O8MA 4O44B 5D0RA 3SPZA 4C2MA 1CULA 2M7SA 4G65A 1WC1A 1BIUA 4EUVA 2DT9A 2RUSA 3FZKA 4NCGB 3CJKA 2OLWA 4MK9A 2V7ZA 4JKFA 1IKVA 4B3TF 2G1DA 2HNZB 2KH9A 1R43A 3M32A 3VQEA 3ULEA 2L41A 2C42A 1ZBSA 4FWQA 4X2BA 2XNRA 3HO1A 1NDLA 1RHMB 3CCWA 4LIWA 1TUUA 3KK1B 1U0HB 3S3MA 1VQKS 1U1MA 9ATCB 1UEKA 3C6UB 4GRSA 2XG8A 4NXNJ 2N7CA 2HHUA 1VI7A 4FM1A 1O5JA 4Q8FA 3GCXP 4FO0A 1Y5IB 2VQEK 2GVZA 2E1PA 3SSQA 3N5BA 3IO1A 4H5VA 1L5UA 4FJXA 4JI6F 4DTUA 3MXHP 3TABA 1SC1B 2EKYA 4OYWA 4A46A 3MMAA 2Q3SA 3RAXA 4CERA 1AZSB 1HPMA 1YZ7A 4JI8J 2MTLA 3BZKA 3P3DA 1EJ7L 3THWA 4KHWA 3WUHA 4FF3A 1IBLK 2WFBA 2RDDA 2VOPA 4UF4A 5DDRC 3CJ3A 2ABYA 1XWLA 4Q0BA 2LXFA 4PG4A 3HP9A 3THYB 1HKGA 3QFUA 3OL6A 2ZH5A 2V51B 3F44A 2MQ8A 1G4CA 1P1TA 2MZJA 5B0CA 3BREA 2ALZA 1W2BM 2ASJA 4J9QA 3ZT1A 1KKHA 4I6MA 2KDOA 3H5UA 5A6PA 3WT0A 4KB0A 4HI2A 1B99A 5KFUA 5EHHA 1V3RA 1IBMF 2O4IA 3WX4A 4OLPA 3DWLA 4IOBA 3KJNB 1YJUA 2CJKA 4IJAA 4W92B 4YHHJ 3GOIA 3PR5B 4WQ5C 5AFUH 5CXTA 1OWXA 4LFCK 2HQFA 5K8NA 5KFNA 3LDQA 2GELA 2NZ4A 4CZKA 2JVRA 4Y0FA 2ZUAA 4Z7YA 4ZPVR 1E6YA 2FJVA 2U2FA 4M41A 1Y64A 5JLHA 1JJCB 3KG1A 3KLIB 1X8DA 1B7FA 3NGKA 1GX6A 2QKBA 3SBGA 2ADBA 1S0OA 3T1HK 3QWPA 1FRJA 2P51A 1H7XA 2F9WA 1FRXA 1MMDA 4NOHA 2IYGA 4JEPA 3EY1A 4GKKF 5GAEI 1QAIA 1ELOA 1RCXB 4IG3A 2EG2A 3O3FA 1YTYA 3N6NA 4IYQA 1X0FA 4IG0B 3W61A 2FB0A 4KKOA 3VQ8A 4DL0C 1Q82T 4QPXA 1BQXA 1PYSB 4E2FB 4EBEA 1U1PA 2D5RA 3QJLA 1K8AO 5EN1A 1VS3A 3A3PB 2V7YA 3CC4S 4Z4FA 3BP8A 1HBNA 5KT5A 1NPPA 4QIVA 1VSIA 2QLFB 1SJ4P 4DL5A 4M63A 3M8ZA 4JKGB 1PILA 4U67L 3SI6A 4Z0UA 1J9AA 2O8FB 5D4PA 1HMVA 3TSPA 2V9WA 3Q89A 3SAFA 3CJQA 3T3FA 1JLBA 2VIHA 3FK4A 2LQJA 1NK9A 1NMNA 2CG4A 3ENQA 3R5JB 5EOYA 3HULA 3DXSX 4HR2A 1A5XA 1VQMN 3ZX0A 1RT3A 5DGBA 2ADCA 3T41A 5KFAA 3DAWA 5IV4A 5BR8J 2GVDB 3OT9A 4W98A 5AJ3J 2RIJA 2CUYA 2XMUA 2ATQA 4WK1A 2LEBA 4O5BA 1HKCA 3WXKA 1YI2S 4FJNA 4FBTA 1TL4A 5MLCV 4DV7K 2BH1A 2W1BA 5CCMA 4KBOA 1UFWA 1ZAVA 1Q5YA 2ZJQQ 2CNKB 5KFSA 4ATNA 4LF6J 1B0PA 2YV0X 4TN2A 4TU7A 1NZ8A 4PABA 3THXB 2HBYB 1AXQA 1EKEA 3VQ6A 4BRAA 1TL3A 2V2KA 4PWWA 3H2LA 4CI6A 1APSA 4K5SA 3W8GA 3L2WA 4O8UA 4FSVA 2W6KA 1FDAA 4J2DA 2FIUA 5KFRA 2BMBA 4KR0B 1XUPO 1RDBA 4KHUA 4QR2A 3VETA 2WK4A 5F9NA 2JLGA 4K42A 4LJMA 2GWKA 2CQCA 2DRAA 4NLYA 3ISNC 3MM7B 4QW8A 3LDNA 1VQLN 3PJ9A 3AVFA 4A2BA 4TYBA 4WFBQ 2O8CB 4MFBA 2FPHX 2HMIA 2RHKA 1YITN 4MTPA 4M8LA 2YKOA 4KGZB 3GV8B 3L3UA 1WSGA 3CC2N 2KG0A 2DCLA 1DY3A 1MROB 1OY9A 2V2VA 4MYTA 1KFSA 2UXBJ 4JI0J 3MEEB 1IM4A 1RQ0A 4UY85 2AYMA 2HLUA 2B6AA 3HP6A 3MURP 3DRYA 2DBBA 2VC1A 3OYJA 2FJAB 3TQEA 2R7VA 1CLFA 5HOOA 2X7IA 4EYIB 2J7KA 1WHVA 4NXNF 2CPIA 1R27B 1QSSA 1VRTB 3C0BA 2IM0A 4CJQA 4WWSA 5F3TA 1TKZB 1QQNA 2C3PA 2RS8A 2DTUA 2IY5B 4FCYA 4CFDA 2HVEA 3ULHA 1J5OA 3GWCA 1CVJA 4DR5K 2LEAA 3FCWA 2CGLA 2FY8A 4U9RA 5KG4A 4BRNA 3EM1A 3CFRA 4ANCA 2W2OP 4JI8F 1BHNA 3OY9A 4AHCA 1VQ5N 3ZNUA 4BR0A 3CEDA 1FJ7A 3PSFA 3CCEN 3BO4A 3OUYB 2P9EA 2HIQA 2J76E 1NKBA 5THWA 1F2GA 1NB2A 3HHLA 2Z1IA 3D45A 1Z26A 3P1GA 2DHHA 5GAGI 3QSYB 1BMQB 4ZLNA 5EGYA 1D09B 4EP4A 3K59A 3MEDA 2VG5B 4JI1J 2DGTA 1WN7A 3OVBA 1WELA 3I9V9 1IKXA 1KLMA 1RDRA 3CD7A 3G2XA 4IH7A 3G4SN 4EFAC 1LV5A 1LWEB 3L7OA 1HWJA 2Q43A 1SL1A 4A5BA 3O9SA 3TANA 5CR4A 2DGVA 4LFAK 3QFPA 4J9OA 4F2SA 2CPFA 4ANEA 1RE1B 2CWXA 4YHHF 4DR6K 4ZVQB 2XY7A 2RU9A 3BN7A 4DTSA 3CFOA 3EVMA 1V9OA 3C6HA 2PO4A 4LF7K 3NCPA 4YOWA 2DFFA 1T7PA 3UDEA 1MLAA 1WTFA 4FKYA 3QIPB 4X65K 1SV5A 1VQMS 3ZZYA 2WUSA 5A76A 4ZTFA 3KJQB 2XMTA 4J9SA 1N6QA 4ECTA 2OCEA 4CNZA 5CYMA 1DKGD 5IWAJ 3HHDA 5I3UA 4OQJA 4CO5A 1YSJA 3K2PA 3RTVA 1S12A 5EWGA 2CJYB 2VONA 2E9ZA 1KDNA 4G9ZA 3AODA 4FVCA 4CVNE 1DQAA 3NMAA 5L46A 4ZPCA 4U7UD 5D4OA 1F3VA 4CJPA 1TELA 3IUCA 1TVRB 4P52A 5AR0A 2XMJA 2RF2B 2D0OA 4HACA 1EQMA 2YKMB 4AL5A 3LPEA 1R8AA 5CD4H 3T6JA 3QRRA 3PW7A 3TSUA 4PWDB 3JS6A 1H72C 2N3LA 1VSFA 1GQEA 1P8GA 1YJRA 2I5JA 2IVMA 2IGIA 3T5LA 2CPYA 2B5JB 4DV6K 1PYOB 4Z4CA 4MT1A 2AP6A 1K9MO 2G2ZA 3TAEA 4J9RA 2EHGA 3DDIA 3QESA 3MCOA 9RUBA 1VQLS 3AD7C 5BR8F 2HQIA 3QEVA 2RKIB 5AJ3F 4EO8A 5JMNA 2OPSA 1YITS 5A2QO 3DI6B 1LK7A 2F8TA 1DTTB 4NZ0A 4FJ5A 2B8QA 2E6LA 4CEQA 3CC2S 1ZOTA 5L9NA 1S7IA 1UAXA 4U67Q 2LYVA 4LF6F 1FVSA 3DNCA 3UE5A 2R3VA 3MAQA 3ILOA 5M1FA 1RTJA 3THPA 3U8XA 4KGMA 3TSQA 2RNEA 2WTUA 1RBLA 2YHBA 4FPAA 2ZBRA 2XBPA 4NYFA 1OQ3A 3QZ8A 4ZVHA 1HQUB 3MWBA 3OYBA 3JSBA 3E8OA 3QYYA 1YRXA 3F9MA 2VDHA 3MDQA 4OZLA 3ZZTA 1VQ7N 2FF3B 2MKIA 2ACYA 4X64K 4DR7J 3PW2A 5KRTA 3MX2A 4I9QA 1FKOB 4I6YA 4WZQA 1T9UA 2GBZA 3I33A 3NFAA 4AILC 1R6VA 1F5AA 4PYAA 5HQMA 1N33J 1N34J 2KRRA 3VERA 5E3CA 2Z56B 1U2RA 2CWKA 1R0AA 3M6UA 3QBWA 4MYUA 4OGCA 4U95A 5AQXA 4ZP6A 3L3CA 4CYUA 2JEIA 2F8SA 3KK1A 1C0MA 1VQ5S 3H2UB 3C46A 3CCES 4DG1A 2UXBF 2X6SA 4JI0F 3ET6A 2J6SA 5DDPC 3NG8A 3ATVA 1ULRA 3B4DA 3P5TL 4UQGA 3KHGA 3O3GA 3D1HA 2JHEA 5GAHU 2AW0A 2VA2A 1TKXA 1BY9A 4UQTA 4BR5A 4DR4K 5LY3A 1XR7A 4LQ3A 5D4NA 4E7HA 2VQEJ 3TR5A 3NL0A 3BGUA 1B7YB 3J81j 3IAM9 4Q5VA 3SFGA 3TX8A 1NJXA 4GVEA 2WZ1A 5B0FA 4CEDA 3WXIA 5HRSA 3A0IX 4OX7A 3AA8A 3NGDA 4UUXA 5FRMA 3KLEB 3EE9A 3LP2B 2Z2MA 3C14B 3CJAA 1ZXOA 5J2PB 1HBMA 2LU2A 3NEKA 1X9MA 1HR0K 5KOWA 3J81Y 2GIRA 3IBCB 4BCAA 4CH0S 1T3VA 5GAEP 5J2NA 3BKUA 4K4SA 2VA3A 4FLYA 1HI8A 5AQQA 4B9MA 2HF3A 3BO3A 2G8WA 2NXUA 3WZ0A 4AF1A 2HBKA 4NI2B 4B3MK 2O66A 2QL7B 3FE1A 3A5LC 2IC3A 1QQOA 5HRRA 3BZQA 4AL7A 3IM8A 2KXFA 4JI1F 1S5JA 3CQXA 2E8AA 3M2VB 4NEYA 3VQCA 3D67A 1FE4A 3IA0A 2YKQA 3VMFB 4P2XA 3C95A 3CCQN 4DDFA 1Q18A 3KLGA 3B6PA 3K5OA 1XR6A 5I4MA 4LF1A 4WJBA 1KNZA 5J1EA 2H4WB 4QQBA 3MMCA 4F4WA 1U24A 4PKHA 3KUHA 4RR5A 3D3BJ 2YKPA 4RW9A 4DV1F 1CSJA 1WF1A 4J9MA 1OH6A 1Z1ZA 4IG0A 3FMWA 5AE1A 4HDHA 3WXMB 3MZIA 4B9SA 3DLKA 1TK8A 1NBEB 5KT4A 1X0PA 3V6DB 3SMSA 2ZGZA 4FJMA 4ETXA 2A2CA 3ZSRA 1Z2LA 2RB7A 3NXZA 3MECA 5IWAF 5A8KA 1GLBG 3H1VX 3GE1A 2C3MA 4F4YA 1BLUA 5ETVA 1QVFR 1RKIA 4FJ8A 2VPYB 4MK8A 4BE2A 3SUOA 4B1VA 2K1RA 3QWUA 1JNZB 3TAPA 1JLEA 2B9YA 4OJGA 1NB7A 1T05B 1JNRB 1SQKA 4CO0A 5J2MB 4DCJB 1UPPA 4IWVA 2YNFA 4YB5A 1BUXA 3GILA 2MPUA 2GJIA 2KJVA 1FTRA 1F9HA 1PAEX 4J5OA 4Z4GA 5KFTA 2BBEA 2GVDA 3DGPA 1OH5A 2Z2YB 3P38A 1VQ7S 2IAJB 2R2TA 4DX6A 1IBCB 2HFNA 5ETSA 4FJIA 3TNVA 3ZNJ1 5IM0A 2GFFA 1S6PB 3VN5A 4HHUA 3FEYB 4DV7J 3FC9A 1T94A 4ES3A 1BQMB 2F1FA 5L1LA 1KONA 4NLPA 1YJWN 2YX1A 3FGUA 1H0HB 4OX6A 4DSKA 1IJFB 3CNQP 4YP3A 2ZH4A 4DF4A 5J2QB 1XERA 3LDSA 7AT1B 1U1QA 3I32A 1VISA 3RWUA 3C6TA 3OVAA 3DLGB 2W4PA 2B4OA 3O1WA 4DR3K 1S9FA 3VEYA 1YIJN 1C0TA 2FYXA 3HRGA 3AVLA 4ED8A 1F21A 2WB4A 4HCBA 2BE9B 2WOMA 3I0RA 3VAFA 4DQPA 4DSFA 1V4SA 1OYEA 3OR1B 1RCHA 3M2RB 2UV8A 3PDNA 4FKXA 1N8RO 5KT6A 1HYZA 1WJ9A 4K8XA 4I69A 5A8WB 1OSCA 2FF6A 3PO5A 4JOUA 3EX7B 2J9CA 2ZM6K 4QYRA 3UPFA 4DR7F 1HARA 5CCLA 2MHNA 3TUPA 2G8KA 3AB4B 3M1VB 3QNNA 1N33F 1WAFA 1N34F 4M3RA 1DEJA 3K5MA 4RTFD 4ED7A 4FK0A 5ETTA 2WSEC 3HBTA 3MEEA 4F25A 3CJCA 4DTXA 3BBBA 2BQRA 1BO5O 3R8EA 4CIFA 2BE2A 1X4AA 1G7CB 4ELTA 4IO9L 4TQRA 3DLEB 1ILYA 2JDJA 3MCAB 3CULA 1YT3A 2ZUGA 3NGYA 4TKTA 1XHXA 4E0DA 3CPWM 4I7FA 4PUOA 3IAS9 5EDWA 1JXBA 2D9PA 3AVNA 5T7LA 2UUBK 3LOUA 4OJHA 2D4WA 2FBXA 1RK8A 3H0PA 4ZVPB 3O9QA 3WXJA 3UI3A 2M88A 2VQEF 2BEFA 4USIA 5DGAA 2FLOA 1T9YA 3DRSA 4ZN1A 5M1NA 3HFZB 4Y65A 1ZAXA 3CCQS 1ZC6A 1LKZA 3FSIA 2HHXA 4KREA 4DR5J 2KKZA 3KK7A 3MEGB 2BW2A 4K2JA 1S4EA 3MN9A 4LH4A 1FWLA 3SNNA 2B8PA 4FF4A 5IT9O 3GFHA 4JHDB 4YS2A 5M1OA 3QT5A 3LP3A 4TLRA 2XQCA 1Q0NA 4ZHRA 3PR4A 4DX7A 2OEJA 4LSNB 4HI1A 4CJTA 2CQIA 3C16A 4DMNA 3A8EA 3TOQA 2QMXA 1XQSC 2DR5A 3KLFB 1NGHA 3BH6B 3JYTB 4CZCA 3K17A 4DR2K 4RU2A 2KRBA 3W2WB 5KFEA 1BWFO 4MLHA 1UVNA 1FJGK 2E1CA 1Q9XA 5A8RA 4I2QA 3MM6A 2F7TA 3FQKA 2R7QA 2RILA 4X4SA 4ENOA 1TZ0A 1NKCA 3I6PA 1S0NA 2VFUA 2CQ3A 2E2OA 4LFAJ 2PMZD 3R6LB 3KFWX 3UW1A 5C7PA 4DR6J 1NXIA 1N88A 2P9IA 2JL9A 2QX0A 4A8SA 3UKRA 4CHOA 2MY7A 3S1TA 4OV1A 4NZ6A 1RWNB 1JKHB 1IBKK 1Q86O 1QAXA 5EX5A 1XJWB 4X65J 1I1GA 1Y10A 2VF3A 2G8FA 3IRWP 4FDFA 4F3MA 1HNWK 1LFWA 2NXNA 2B4JA 1K1SA 3HSCA 1OPIA 2U1AA 2HRUA 2J6UA 2E9TA 2R8JA 4BC7A 2ROGA 5AQPA 4X66K 2BA9A 2EFQA 3CDEA 4H0OA 4M5GA 5IZHA 5KG1A 2VYPA 1TVRA 2OPQB 4JN4A 2UP1A 3D0HE 1SJ3P 4C4WA 5B0BA 2B9EA 1YJWS 3FEXB 3BPSP 4Q2LA 5JUMA 3MUVP 2HBQB 2V5HG 1RTDA 4CJKA 1T8EA 5MLCQ 3OTOK 4KFBA 3MD3A 5BJRA 2OPRA 3F2KA 4CJVA 2A6OA 1NG9A 5AQVA 2V6AA 4Y2MA 3PVXA 1JLQB 1YIJS 5KFCA 5AQFA 2DGXA 3A5NC 1UVIA 1ZA2B 3OVNA 1FDNA 2I7PA 5LJ3Y 1ZM3A 2QV6A 2F8MA 1YXQA 4CZEA 4DV0J 3CDWA 1U6FA 1Z25A 2CQPA 5C25A 4XAKA 5LL6Z 3OFGA 2VG6B 1FNMA 1FWKA 2ZOFA 3LALA 1NK0A 5LMUJ 3BF3A 1R3NA 2V8PA 5LMNK 1Y0HA 4ALZA 2DYAA 4RO0A 2HQ3A 3WNHA 3DRRB 1H73A 3VEZA 1YAGA 2XI3A 3OTBA 4DMZA 5D3GA 1VOMA 4KHQA 3AO2A 1NNDA 2IM1A 4DV7F 2O4GA 4TY9A 4FNHA 5TKYA 1JWWA 1WUAA 3R8YA 5AQRA 2QK9A 3CJ9A 3MAAA 1X5PA 4JB8B 3MM8B 3NDKA 3AARA 5IT0A 1JCGA 2OH2A 4HHJA 3R97A 5D0GA 3OBYA 1U1RA 1S9GA 3PW0A 3DM2A 1SL2A 3Q83A 1M5VC 2BANB 1R7IA 1SVDA 1NGIA 2DNMA 4DQSA 2F5GA 3NY0A 5FLXU 3F56A 2JZ5A 2WONA 3D0PA 4A8MP 5KT2A 4MJKA 2BKPA 3H4BA 4YNQA 2EC2A 4Y34A 1VSMA 1VK8A 3G0ZA 4EZ9A 5IT9Y 2V8VA 3ZZ0A 1RT7A 4UOHA 4IQMA 2Q0RA 2OP5A 5IC6B 3TPQA 3RBDA 5KFMA 5CE3A 3AQOA 1RBRA 1AA1B 4QWDA 2DGSA 1VLOA 3Q7CA 1QZ6A 1KRPA 5AT1B 3W66A 2FVPA 3N0VA 2P2CB 3I5BA 3ATUA 5H9FK 1UVKA 4J9UE 3VGTA 1ATSA 4DV5K 2GMJA 4C3MA 2UXCK 3E1YA 4HKQA 4KAZA 1FRKA 3NH2A 3SCLE 4DV4K 1JJ4A 4O0NA 1J53A 4FW1A 1T3NA 2OAUA 2H9ZA 4OGEA 1GMWA 5FIIA 4Q8EA 4Y3CA 2AYBA 4IKFA 3HZGA 4TY8B 2YJFA 2XZTB 1RNHA 2XZWA 4ILRA 4UUWA 5E3QA 1S76D 4CBXA 1HLWA 3DRPA 4J8FA 3MR2A 4ED5A 5HBMB 3FVYA 5C2CA 1TQLA 4CBWA 4P2SA 3C14A 2O8DB 2OFHX 2NXJA 5J2PA 4NCBA 1C0FA 3M30B 2YX6A 4IDHA 3BF4A 2XLIA 1JLCA 2YWWA 4DR5F 1QAJA 3P83D 5ETLA 4FVMA 4NYOA 4R0JA 3EJMA 3MR3A 4KI6A 1HR0J 4IO9Q 3E2EA 3T1AA 4LQ9A 1LWXA 3V9SA 4NI2A 4IRCA 3H3OB 5F0UA 3ENOA 2YWGA 3OBWA 3AVHA 2J8AA 4ZVSB 3CCJN 4LF4K 2Z2LA 2ZITA 5KQDA 3CXCM 2P6TA 1XHZA 3IKMA 1NK6A 2QGFB 4ETZA 4MQ3A 2HURA 3CJ4A 4ZVTB 2BM1A 5ADXA 1PBUA 2QYCA 3KHHA 4OHWA 4BE1A 4CEBA 4PXEA 5L1KA 1XMQJ 1V6HA 3CVKA 2BGGA 4L74A 3VF0B 3R5GA 3TW0A 2VWJA 3JSMB 1Q8BA 1B0VA 4CGDA 3RMCA 4Y2CA 1TTHB 3ENBA 3V6KA 1RB0A 3JSRA 2YI1A 1N4LA 3HKWA 4LFAF 5ELZA 3CJBA 1ZM2A 3W0LA 3O2IA 1YGYA 1GLCG 2F4FA 1ZBHA 4A5AA 5KFXA 1HLUA 2J0WA 4DR6F 4PWUA 2NXEA 4RL1A 4L3QA 2HWIA 1ITPA 3VCDA 4M3ZA 3QSIA 2VPXB 1KXPA 4BG8A 3HZEA 3R6MA 3RB6A 4AL6A 3VQAA 3UWTA 2ZHAA 3UCUP 4R5PB 3LGMA 1QUPA 2MQNA 3TVKA 2L9DA 3SV4A 1FK9A 1T9XA 4F36A 1O6XA 5F8NA 1WD6A 2P9LB 3MWPA 3AHPA 4X65F 4FLXA 3RB0A 4CJ5A 3AVBA 1DTQB 1K73O 1KHVA 3KKRA 3TVZA 1NK8A 2DXDA 2V4JA 3FCHA 3WEEB 3PEHA 3I87A 3L7UA 1UJ5A 4WYLA 1X7VA 1H2VZ 4KHPK 3H7HB 3CDUA 1M5HA 2BE7D 1KC8O 2FVRA 5AZIB 3KKSA 2HQCA 3GG4A 2PYJA 2V8GA 2P9SA 3R7NB 2P8IA 3AA4A 1Y3KA 1W2IA 4F4KA 4W5QA 1EQ0A 4P75A 3FCVA 1IG8A 3POTA 1RHQB 1U09A 3WNGA 3RMAA 1IKWA 1QHTA 2W7PA 2F9TA 1KAYA 3AVIA 1HYSB 4RBVA 1WKLA 1FO1A 2VBXA 1WSFA 4CK2A 1ZZFA 2P9KA 3Q23A 3CJ5A 2YNHA 3OYMA 4H0YB 2W42A 4GKJJ 5M1PA 3PJWA 4CO4A 2FZKB 4O3OA 1NO8A 3LP0A 1NDPA 1UETA 3KUEA 4X4TA 4R79A 1XMOK 1IM6A 3T5KA 4M3UA 2ZC4A 1EKRA 1GT8A 1HYVA 1BQMA 3U6FA 2RSQA 5LMUF 1MN9A 5BN8A 3PUFA 4H5RA 2KFYA 2E1ZA 2QI2A 1Q7YO 4FXWA 1NBWA 2HS3A 3RR7A 3GV7B 3EGZA 4CJEA 2YQ3A 2YHAA 3AOCA 2A1RA 4RLEA 3BGRA 4IFVB 1F3FA 3MF5A 2WHOA 2BW7A 3DU6A 4HUEA 2AJQA 3OSNA 3NCRA 3HT3A 4DR3J 4QBUA 3RAMA 1OO0B 1N32J 1SUQA 4K41A 4Q45A 2XSFA 4OIXA 5A8WA 4NYNA 2R2SA 3ZT4A 1FWPA 2C28A 4W5OA 3Q8RB 3MOZA 1C4AA 4DHVA 2GO9A 2BRLA 1YJ7A 3ADAC 4HWIA 4TQSA 3T7ZA 3EVWA 3U1MA 3BZCA 4OYZA 4OJ3A 5D4LA 2NZTA 1KBRA 4YY3J 5H9EK 3AY9A 2UVUA 4MIAA 2UVRA 2DY4A 2LLZA 5ETQA 2D0CA 4JKHA 1YJ9N 2MSTA 1I5OB 4BWJA 4LVOP 1CJTB 3QICA 2PZSA 2ZH2A 4C1NI 1GLJO 2NYIA 4ID5A 1C1BA 3SMPA 4ZVRB 3J7A1 1LWCB 3ZTSA 4DJBA 4JS5A 1HNZK 1J5EJ 2V8DA 2FY1A 1FVQA 3D2FA 2NRTA 3DMJA 2KVQE 4M5HA 2HNDA 4PZVA 4J2EA 4ZA1A 3VQ4A 2O8BA 1QY7A 5C2DA 1S1WA 2VPZB 3CCJS 3LP1B 3D54A 4FP9A 4AT1B 4A8FA 4DU4A 4ZVUB 3VAGA 4BVPA 3M6WA 5C0YA 4QU7A 4RW6B 4W5NA 1SAZA 2CJQA 4I2PB 3UR0A 3S01A 2O8EB 3M2UB 3AB2B 1N36J 3CD0A 1KTVA 3M9OB 2G0JA 1P90A 4X4RA 2EFVA 3UR3C 2OYQA 1F5CA 3ZT3A 3GYXB 3HHLD 1ESVA 4XH4A 4FF1A 3NNCA 5DLFA 3Q0AA 2CPEA 4Z4EA 2P1JA 4DCHA 4OJRA 1RISA 1PC4A 2FJXA 3N5FA 3QDKA 2IHR1 2IIRA 2IDLA 2M8HA 5ETPA 2A0FB 4IR9A 2VCPA 3C7NB 3LTOA 2VQFJ 2MQLA 1VSDA 3OHRA 4M3TA 5SWMA 3IWLA 2IJFA 1VIXA 4DFMA 1HR0F 2ASYA 5HVFA 5AQWA 2DXEA 1AFIA 4LR8A 1G6BA 4ZP8A 2VJUA 4U96A 1MU2B 1CJVB 3CQYA 3LM9A