3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
3NAHA 3KLEA 3EZ5A 3PW2A 4DWIA 3ALYA 3CIZA 4WYWA 4CEQA 4N5SA 4WFYA 1D8YA 1SKWA 1QSLA 3QGIA 4LSNA 4O44A 3DI6B 2DFEA 4HUFA 5KFCA 3PX4A 5J2PA 4ELUA 4U6PA 4FLVA 2IC3A 4O0JA 3V9SA 3VA0A 1UA0A 3V1QA 4O3RA 3DMJB 5I42B 4NCAA 3KLFB 3RB0A 4CEBA 4QPXA 3FQKA 4H4OA 1ASWA 3ZSWA 1NKBA 3IS9B 3AA2A 4Z4GA 1VRTA 1RTJB 5CYQB 2YNFB 2IM3A 3CQ8A 3DRSB 4ECRA 4HHTA 1HJRA 1LWCA 3CJ0A 3KK2A 1QS4A 4CIEA 1RILA 2E9TA 3AVCA 3QERA 4E7LA 1HYZA 4R5PA 1TVRA 4ZPBA 1BQMB 1LWFB 1RBSA 4ZTJA 4B9TA 4O4GA 1S1VA 3NL0A 1YVUA 2IGIA 4DMNA 2ILYA 4MIBA 3ZSYA 2HHTA 1TV6B 3V9UA 4CGHA 1EP4B 2ZKUA 2HNYB 5CY4A 4RU9A 4F8RA 4DL7A 2IOCA 5KFYA 1D1UA 3EY1A 3SQ2A 3OL8A 4FM2A 1RNHA 5KFZA 5KG1A 4BACA 3L3UA 1L3SA 3L8BA 4NLGA 2VG7B 1N48A 3HM9A 4TQRA 2W9BB 1U09A 3SNNA 2A1RA 4NLXA 2HHUA 1F21A 4BWMA 1D9FA 3DLBA 2VA2A 4TSXA 4IQXA 3IG1A 3T5KA 1N4LA 3JSMB 1GX6A 4E7IA 1C6VA 3IG1B 3TAMB 5C5JA 4DTNA 2C2RA 3OL9A 5KT3A 1GOAA 1N5YB 5DQHA 5I3UB 2UVVA 3AVNA 4KHRA 5FDLB 1C1AA 2EC0A 2FBTA 2C22A 1RDCA 3RRHA 3T5JA 2KFZA 4DL3A 1WSJA 3GIMA 3CFOA 3KK3B 1RT1A 4ECZA 4CCHA 2HMIB 5HRNA 4ZHRA 4NLWA 3DLGB 4KHYA 1S9EB 4IG0A 1BISA 2WONA 3UDLA 1C1BA 3THVA 4FW1A 1XR7A 2EX3A 1GX5A 3V6JA 2JLEA 4CFCA 4CFAA 2OPRB 2XY8A 3T5LA 5KG3A 3OS2A 3V81B 1EX4A 1JXEA 5KFJA 2JC0A 1RCHA 1HARA 2HWHA 2Y1JA 1VSEA 3QZ8A 1NNDA 4ZVFA 1QUVA 2FVQA 4JRQA 4O3QA 4N56A 4B08A 5KFGA 1KLNA 4MK8A 5KTQA 4Q8FA 3GIKA 5DG8A 4B3OB 4DG1B 4B9SA 4ICLB 3ZT1A 1I3AA 5CZ1A 4UQGA 3OYBA 4IFVB 3ZT0A 1JLQA 2YNGB 4ECWA 2R8KA 3QLHB 3HXMA 1T7PA 3QZ7A 4J9OA 5KFTA 3RMCA 1ZTWA 3MTKA 3BQ2A 1HRHA 4MFBB 4HVJA 3BR9A 2AGQA 3HPGA 2KZMA 1TL3B 4J9LA 1TP7A 3H08A 4KI6A 4BDYA 4BE2A 1C0TA 4DFMA 4AHSA 4G3IA 5EWGA 3MEDA 1TK0A 4Q44A 4IH6A 3DRSA 4FS1A 3C94A 4CERA 2BE2B 3HHKA 3NF9A 4N41A 2P5OA 4DQPA 4CF0A 4O3SA 1MMLA 3BGRA 5KFAA 2D5RA 2WB4A 3OYCA 4XIUA 5HRSA 2HNYA 3PY8A 4O0IA 4TYBA 1NK8A 4HUGA 3HP9A 1S6PA 2V4QA 1T3NA 4KKOB 2IC3B 3HL8A 4O3PA 4LH5A 3TAEA 1S6PB 3M8QB 4K4WA 3H5UA 3KJVA 3OYLA 1Z25A 1RTHA 4M3XA 4WE1A 3JYTA 3V9XA 2HHVA 3RBEA 1KFSA 2B4JA 4RW9A 4Y34A 4Y1DA 2XGQA 5J2MA 2YKNA 1JXLA 3MXJA 3UQSA 3PV8A 3KTQA 3D28A 3V1OA 1HYSA 1ZBHA 3RMBA 3GYNA 2C2EA 4B8CA 2G8UA 1TAUA 1Z26A 1U48A 5FDLA 4CHQA 3GQCA 4FJ8A 5KFNA 2IBKA 3FFIB 3KLHB 3K58A 1REVB 1BIZA 2FJXA 1VSLA 4QWEA 1TK5A 3AA4A 3I0RA 4EEYA 1NKEA 5L9XA 1WSGA 2YHAA 4FLZA 4ECUA 2R2UA 4ED0A 3H59A 4CJ4A 4IFVA 3AVLA 3PW5A 1S1UA 3M8RA 3SUNA 1N6QA 2G8HA 5F8MA 4DTMA 4CJ3A 3GIJA 2WOMA 2HVIA 3KNAA 3BQ1A 3VQ9A 3WNGA 3I5AA 2G8FA 4FK4A 2GC8A 4G1QA 5DGBA 3NBPB 1LWEA 4CIFA 2XWYA 1K6YA 5D3GA 1T03B 4ZVHA 4J9NA 3OYIA 3HP6A 4IDKA 3TQ1A 3VQ8A 1ZETA 4DQQA 4H4OB 4PQUA 4CJTA 2I5JB 4R0EA 3HT3A 3U6FA 3C6UA 2GIRA 4LQ9A 3OHAA 2FJWA 4JUZA 1NJWA 3V4IA 4CE9A 1HMVB 3QYYA 1D9DA 2OZSA 1XR6A 4LSLA 1W9HA 5E41A 1S1UB 5EDWA 2O4GA 2W8LA 4ZTFA 4C8LA 2WHOA 3SPYA 1T05A 1BCOA 1NK7A 3AVKA 4URSA 4M3TA 3VQAA 4DFPA 3RBDA 4H4MB 4J2AA 4AHCA 3AVMA 2AGOA 4DSJA 2RN2A 4ICLA 3RWUA 4ZP8A 3DYAB 2W9CA 3QNOA 4MKAA 1S0MA 1RBUA 4CJWA 2IMWP 3AO1A 5KG4A 2AQ4A 3OSNA 1VRUB 3NMAA 4IBNA 3IAYA 1JLBB 4DSEA 4CESA 2VG6B 4JRPA 1J53A 3S9HA 2OPQB 2G8VA 3HKWA 4JV1A 3RAQA 2E9RX 4KBIA 3NGIA 2FBXA 1RTHB 4K4VA 2WTFA 3KD1E 1TVRB 4OJRA 4FJIA 3D45A 1VSKA 4O5BA 3GV8B 2UVUA 3RTVA 2RF2A 3N6NA 3NGYA 1S1VB 3H40A 3KHGA 4O55A 1HNIB 1ZBLA 3FSIA 1SL2A 2F8TA 1IKVA 4FCYA 4ECQA 1HYSB 4IDKB 4GMJB 1C0UA 4U7CA 2HHQA 2D7SA 1RT3B 2IAJB 2B6AB 5KFXA 1TKXA 3VQEA 2IS3A 2ASJA 1RT2B 4HYKA 3LWMA 4CHPA 5F8NA 3KLIB 4URQU 1OS5A 3SQ1A 4JV0A 1BIUA 5J2QB 3ASMA 2OPSB 1WNEA 4ECSA 3G6VA 3MXMA 1RTIA 4KHMA 3GILA 3Q8RB 1S1TB 4IR1A 5J1EA 4K4ZA 5KFWA 1HYVA 1RYSA 1VRTB 4IKFA 1TKTB 4IH7A 4M3YA 2VG5B 5JS2A 4IG3B 3KLEB 3B6PA 3EPIA 1J5OA 1RDRA 3NAIA 1Y97A 2R8HA 2FJVA 1SH3A 3QIOA 4DQRA 3I0RB 4CEOA 5J2NB 1W25A 4NLOA 3GV7B 5JUMA 1NK0A 4FLUA 3CVKA 4ZPDA 4ID1A 2VWKA 1XHXA 1NOYA 3MEGA 5KFHA 3H5YA 1VSMA 1KLMB 3HVWA 1KVCA 4CJEA 4OPKA 1S6QB 4CHNA 4IFYA 2IA6A 4TY8B 5KFPA 4ECVA 3ISND 1L3UA 2RDIA 3MR5A 3VQ7A 4IRDA 2P5GA 4RNMA 3RMAA 2O4IA 4JLHA 4DFJA 2QV6A 3OYNA 3HVRA 2FBYA 5HP1B 1KVBA 3LALA 4LD0A 1A5WA 5J2NA 1EETB 3MECB 3RR8A 3MFHA 2V9WA 1IH7A 4DSKA 3VQBA 4DEZA 3DLEB 5KT7A 5CYQA 2BANB 1XC9A 4DL5A 1RDDA 4DS5A 1S9GB 1SL0A 2X78A 4BWJA 4NYZA 1YT3A 2ASDA 1JLCB 5DQGA 4FJHA 2XY5A 3VQ5A 4E0DA 2R8GA 3DMJA 3O4NA 2OZMA 5J2PB 3JSMA 1UWBB 1ZBFA 3NKYA 4Q0BA 3TAGA 5KT4A 1I39A 1LWFA 4DF8A 3SI8A 1EXQA 3OYKA 5I42A 2HAIA 2FLLA 4X2BA 2ZE2A 3T1AA 1HQUB 2AU0A 3IRXB 4HCCA 3HO1A 2ASLA 5HROA 5KRTA 4ZHRB 4TYAA 3ZSXA 5KG5A 2ZD1B 2I5JA 3M8SA 1TKDA 4Y2CA 1RT2A 4CF9A 1O1WA 4K4SA 3L2VA 4MFBA 3FRZA 3AO5A 4Z0UA 3N6LA 3OHBA 2WOMB 4RNOA 3AVGA 4CJSA 4I7FB 2P51A 4AHUA 3SUOA 3PVXA 4F4ZA 1S1XA 1FXXA 4CECA 2JEJA 3VN5A 1S49A 3OJUA 1KHVA 1HPZA 1TL1A 3LWLA 2V0NA 3G10A 2LSNA 4PY5A 1NHVA 3NH2A 3DDKA 3RAXA 2XY6A 4FS2A 3KHLA 3T5HA 2G8WA 1LW2A 3TANA 1KSPA 4DQSA 3PHEA 1CSJA 3VQ6A 3V6HA 4DL6A 3QIPA 4K8XA 1VSFA 1NHUA 3L2WA 1TKZA 4CK1A 2IJNA 3TVKA 4PWDB 3DM2A 1S9EA 4OL8A 4CHZA 4DF4A 1A5VA 2HB5A 3QIDA 4FBUA 4PWDA 5SWMA 4KO0A 4ZVGA 4M3RA 4HTUA 2YHBA 1HQEA 3LP2A 3KHRA 4RNHA 1CZ9A 1EKEA 4MK7A 5KFRA 3KK2B 4I7FA 1SH0A 3TWHA 3V1RA 5KG2A 2YNIB 3ZSQA 3OYJA 4KHNA 1RT1B 3CFRA 1ZYQA 2AX1A 3PW0A 1Q9YA 2XI2A 1KRPA 3QESA 2BQUA 4C8MA 4PA1A 2R2SA 3DLHA 4L8RB 3I0SA 5C24A 4ED8A 4ZVEA 4CK2A 3LP3A 4R8UA 2X6SA 4CF1A 3CDWA 2HNZB 4J2DA 2R8IA 3UIQA 3KK1A 5HROB 5KG6A 2GIQA 2QK9A 3QGHA 1IO2A 3L2UA 4FXDA 3PO4A 4NLQA 4AHVA 4KAZA 1U04A 3SV3A 1S1TA 3NBPA 1KVAA 3OLAA 5KGWA 1HNIA 3RB6A 3E51A 5FRNA 3DRRA 1R0AB 1CXQA 3SUQA 2RDJA 3DRPA 1WAFA 4KE5A 5DG9A 4DTOA 2FVSA 1JX4A 4QWBA 5KFVA 2P1JA 2KZZA 3IN5A 3CM6A 1U47A 2ZD1A 4W5TA 1RDBA 3MR3A 1S97A 4FJ5A 2HMIA 4FJGA 3O3HA 3QIPB 4QWCA 3AA3A 2BGGA 1TKZB 1REVA 3SV4A 3NFAA 4GW6A 4FLXA 1IKWB 4ZP6A 4C8KA 4R8UB 2B6AA 4QAGA 4KI4A 3PR4A 4JS5A 5KG7A 2XRIA 1J9AA 2XGPA 3BSCA 3V9WA 4FK2A 2J6TA 2JEIA 4LH4A 4YP3A 3HYFA 3QINA 1T94A 1N6QB 2PYJA 3SFGA 2YV0X 3ZT4A 4B8AB 4CF2A 3NF8A 3C6TA 1QE1A 2UVRA 4K4TA 1EETA 3MECA 4ECXA 4IOBA 1RBTA 3LP0B 1FKPA 3KLGB 2RPIA 2OPSA 3QO9B 3HSTB 4EBDA 3ITHB 2HNDA 4DU1A 2WRMA 2YNFA 3OYEA 3SYZA 2KTQA 2VG7A 3V6DB 5C25B 1MU2A 3KOAA 2BANA 1C0MA 5EWEA 1BCMA 3FDSA 4CK3A 4DTSA 1K1QA 4IG0B 4QW8A 1C1CB 3RR7A 4ZP7A 4FJ7A 3DM2B 2FBVA 3LPTA 2X74A 1J5OB 4YQWA 2BR0A 1IKXA 1BHLA 1LV5A 3RB3A 4RNFA 3ZSRA 4WYLA 3OS1A 3O3GA 1NJYA 5JXSA 2GV9A 4RW6A 2B5JA 1IKVB 3O3FA 2Z1HA 1NK5A 4BDPA 1RTDB 4NLVA 2B5JB 1SL1A 4KHWA 3T3FA 1WNSA 1RT5B 2FLNA 2NUBA 1LAVA 1VSIA 2AX0A 2ALZA 3RRGA 4I2QB 1IKYA 4CHOA 3LAKA 4CJFA 4CJKA 5KFUA 4E89A 1CZBA 5KT6A 4J2BA 4CFBA 3DOKA 3CWJA 3RB4A 1JLQB 3SQ4A 5CYMA 3ICLA 3PZPA 4CGIA 3HK2A 3V81A 4KAIA 5F8LA 1JXBA 2KQ2A 2BRLA 4N76A 3DLKB 1FK9A 4K4XA 2R2RA 3VQCA 3M9NB 4J2EA 1L3TA 1C0TB 3MFIA 3OY9A 1TL1B 5DLGA 3IGNA 4DQIA 3QEXA 4CF8A 5F8HA 4F4KA 3EPGA 3NGDA 4OPJA 1NJXA 5KFKA 1JL1A 3SCXA 3VQQA 3TI0A 3L2QA 5HP1A 3VQ4A 1S1WA 3OJSA 4Q0BB 1RT7A 1QE1B 4E3SA 3G6YA 1QAJA 4E7HA 3AVFA 3DOLB 3OL7A 4DU4A 3BJYA 1NK6A 1B92A 1SV5A 4EP5A 3AA5X 4KFBA 5KFDA 1SV5B 3HVTA 4FVMA 2YKNB 1R0AA 2XI3A 3LP1A 1S10A 1ASVA 4IR9A 1HQUA 4KB1A 1RA6A 4CEEA 2ILZA 4F4WA 1U49A 3P1GA 3CDEA 3QEWA 4E1NA 1XWLA 3Q8SB 3H98A 4NCGA 1RA7A 1TGOA 1RTDA 3ZT3A 4FYDA 4CJPA 4BDZA 4OLBA 1JLCA 3I0SB 5C24B 3C6UB 4ED6A 4KB0A 2Z1IA 4CJLA 3K59A 3AVIA 1LW0A 3FFIA 1TKXB 3CM5A 2OPQA 5HRPA 4LSLB 3ULDA 5L1KA 2WK4A 1Q8IA 3VQDA 4O4GB 4KFBB 2ETJA 3CO9A 1DTQB 1C1CA 1TV6A 4GVMA 3CJ5A 2F8EX 4K4UA 2PY5A 5J2MB 2E4LA 2QXFA 1GOBA 3OVNA 2W8KA 2FVCA 3KIOA 2OA8A 4C8OA 5KFLA 1S1WB 2IAJA 3S3MA 3CDUA 4ECTA 5L1LA 4IRKA 4KV8A 1RT4B 4ED7A 2QE5A 1D5AA 4EP4A 4J9SA 4KHUA 4XPCA 1DLOB 2Y1IA 4E7JA 3FQLA 5C42A 1JLBA 2IDOA 1S9GA 4NRUA 2HVHA 3IGVA 4CGJA 4NLPA 4GC7A 1ITGA 3LDSA 4LQ3A 3DLGA 3CJ2A 4AHRA 4NLRA 4KTQA 5KFMA 4WZQA 4AH9A 1JLFB 5DK5A 3DOLA 1DTTB 4RUAA 1NOZA 4J9PA 2B43A 3N6MA 5D3GB 2WCXA 1YVFA 3P83D 1X9SA 2AGPA 2DFFA 3TAMA 2EHGA 1LW2B 4KTZA 2VA3A 4KB7A 2J6UA 4CHYA 1RT6A 1S9FA 4HCBA 1NKCA 3IRXA 1CLQA 5K14B 2QKKA 5FRMA 4RW4B 4Z4CA 2BQ3A 4CGFA 3OYGA 4OVLA 2BDPA 4QWAA 2ATLA 3HPOA 5DLFA 1QHTA 4KSEB 4KPYA 3OL6A 4Q5VA 1S6QA 4DG1A 4M94A 2R2TA 4YR0A 4W5NA 5KT5A 4CJUA 4RW9B 4EYIB 3KK1B 2W7PA 1QSSA 1ASUA 3C95A 3CYMA 3RMDA 1NK4A 3MEDB 3KKRA 3AO4A 4KHSA 4CJ5A 4ID5A 4MKBA 1GOCA 1TL3A 3CFPA 4Z4FA 1BL3A 4RW4A 2UUTA 3SPZA 1BI4B 1X1PA 2HNDB 3NH0A 1SKSA 1VSJA 1QQCA 4I9LA 4TXSA 2FVPA 4NLUA 4C8NA 4M45A 2YKMA 5DG7A 2W9BA 3GIIA 4DTXA 1RTIB 2CKWA 4NLSA 3KLHA 1SH2A 4IH5A 4QW9A 1C1BB 4KKOA 3K5NA 3BSNA 3BREA 2E9ZA 2OPPA 4FJ9A 3ZCMA 3NF6A 1IG9A 5EU7A 4I2PA 1UOCA 3E01B 2VG5A 4TQSA 4IKAA 2F96A 4DFKA 1ZBUA 1B9DA 3NH1A 3EZUA 4FW2A 1YTAA 3K5OA 1FKPB 3KLGA 1KTQA 3LZIA 4RUCA 3K2PA 1XR5A 2F8SA 3OYMA 3QEPA 4KHQA 4F2SA 4CFDA 1K1SA 4M3WA 4I2QA 1VK0A 1BI4A 4NCBA 4YNQA 1KLMA 2FLPA 1HPZB 4DTRA 2PZSA 4JS4A 4MQ3A 4W5QA 3HJFA 2D0CA 5F8JA 2C28A 4K50A 4EZ9A 3PX0A 3KLVA 4M42A 2XO7A 3ZSVA 4RW7A 4Z4IA 2KW4A 5KT2A 4B9MA 1WAJA 2D0AA 3DOKB 3M9OB 1N5YA 2JC1A 4AHTA 1G15A 4NYFA 2J6SA 4PUOA 5JS1A 4IG3A 2I1RA 5F9LA 1IKYB 3H4DA 2W42A 4EBCA 1RT6B 3DRPB 4OLAA 2CJQA 3D5MA 3LP0A 2YNIA 3KLIA 4YR2A 2YNGA 3DI6A 2R7YA 1T8EA 3CJ4A 2ATQA 3SUPA 3MF5A 3AVJA 4ED3A 4NRTA 3OLBA 5CZ2A 1HMVA 3QEVA 4OKEA 4DSFA 3O4QA 2E6LA 1UAXA 4ELVA 1QSYA 1WN7A 4I2PB 4ED1A 2HNZA 4PUOB 4ZPAA 1TAQA 1L5UA 1HNVA 1JLAA 3LANA 3OYAA 4K4YA 1SKRA 4OKKA 2BE2A 4HUEA 1HNVB 1S4FA 3B6OA 3OS0A 1RDAA 4KV8B 3I8DA 4B9UA 4F2RA 2E6MA 1DLOA 2RKIB 3NAEA 3SZ2A 3SQ0A 1FKOB 4EBEA 3L3VA 4KTWA 1B9FA 1FKOA 4J9RA 1JKHA 2XHBA 2WONB 3MEEB 3H5SA 4WFXA 5F8IA 3TAPA 4FM1A 1ZTTA 4IFYB 2OPRA 3MAQA 4ECYA 3OYDA 4LSNB 4NLDA 4QOZB 1T05B 4O3NA 3TABA 5L1IA 3PR5B 4F50A 4CGDA 5HBMB 5I3UA 3NDKA 2VG6A 3UPFA 4EO6A 4M41A 2QKBA 4MK9A 5KFSA 4CEDA 1SUQB 4J9KA 4W5OA 4DL4A 3CJ3A 2D3ZA 4OGEA 1BQNB 4RZRA 3KJVB 4FJJA 2D3UA 2GUIA 3IS9A 1JKHB 1RBRA 4K8ZA 2HHWA 4IRCA 4DU3A 4M3UA 4BE0A 2V4RA 3V6KA 4DTUA 3K57A 4TN2A 4Y3CA 4EO8A 3VQSA 3OSPA 1QTMA 4PQUB 4H8KA 1BQMA 2G8IA 2IM2A 1J54A 4FJKA 4O4RA 1S5JA 4DSIA 4OKJA 5CYMB 5J2QA 2JGUA 3LP1B 4RG8A 4TY9A 3HVTB 2BRKA 4NLYA 2HWIA 4J9QA 1TQLA 4RW6B 3PW4A 1EP4A 4FJLA 3BQ0A 2ITGA 3UR0A 2Z1JA 2JEGA 4M95A 1RYRA 1TKTA 3QO9A 2XCPA 1RT5A 1A5XA 4E7KA 2UUWA 5C42B 3KHHA 4NLTA 4KREA 1WSHA 1KFDA 4AILC 2YNHB 2X6NA 3KMQA 3PX6A 3MEEA 1C2PA 4DTJA 3H2LA 1JLEA 3CG7A 2HHXA 3V6DA 1LWCB 5EWFA 1UWBA 4F4XA 2FC0A 3NE6A 2RKIA 1JLEB 1Q9XA 3JYTB 5F8GA 2Z1GA 3A2FA 2O5DA 3ZSOA 1RAJA 1IKWA 4JV2A 1VSDA 3LPUA 3D0PA 1RTJA 4NZ0A 4LY7A 3BSAA 4ZMMA 3NGZA 4O3OA 3HVAA 1WLJA 2G8KA 4XPEA 5KG0A 4TLRA 5KI6A 4RW8B 5C25A 3ZSZA 4CJQA 4DSLA 3PO5A 1S48A 3AO3A 3LAMA 4FLTA 2D0BA 1FK9B 3L2RA 1JIHA 4F3TA 1WSIA 3DYAA 3G6XA 1X9WA 4CEFA 4CJVA 4Y2AA 4NCGB 3DLEA 2R8JA 3AV9A 4ID5B 1MU2B 4E19A 3BSOA 4Z4HA 4FZZA 1QAIA 2W7OA 4Z4EA 1I6JA 3M8PB 5FROA 3F9KA 4WE1B 2HHSA 3M9MB 1IKXB 3AVHA 3SJJA 3C6TB 4YMEA 3VA3A 4ZP9A 3ISNC 1S0NA 1WSEA 2KFNA 3OYFA 1JLGB 3G0ZA 1ZBIA 1X9MA 2OPPB 3AO2A 5HBMA 3GV5B 3KK3A 3DLRA 3BGRB 4G1QB 4YFUA 3HPHA 5F9NA 2UVWA 3ITHA 4M3ZA 3I5BA 1LAWA 3QLHA 1U45A 4FJMA 4F4YA 4WXOA 2PYLA 3V9ZA 4ZPCA 3H4BA 3TR8A 3AVAA 4FM0A 4KO0B 4MIAA 3PUFA 1WSFA 4B3OA 1HQEB 3LP2B 4CJRA 3S3NA 2YNHA 4I9QA 5T14A 4FZXC 1XHZA 1VRUA 3SI6A 4RNNA 4J9MA 4CEAA 3LZJA 4CGGA 3VQPA 4RW8A 4WZMA 1XI1A 3PJXA 3WNFA 3SFUA 4GC6A 4CEZA 1YTUA 4CIGA 5L1JA 1KCFA 4MH8A 4QCLA 4H4MA 2XY7A 1RT3A 1LWEB 2FVRA 1NJZA 4E1MA 1RT4A 5KGXA 2W9AA 2RF2B 5KFQA 4B9NA 3TAQA 2VWJA 3F73A 3ZT2A 1LW0B 3MR6A 3M8PA 4XO0A 4B9VA 3QNNA 1D0EA 2DPJA 3WNHA 3K5LA 5T7BA 5DMRA 3G86A 2OYQA 2C2DA 4DTPA 4URGA 4DLEA 4EZ6A 3TAFA 3DRRB 4H54A 4WXWA 3MXIA 5KFOA 4RW7B 1DTTA 1Z4UA 1JLAB 3DLKA 1JLGA 3KMSA 5DGAA 3E01A 3KD5E 2IM1A 2W9CB 4OGCA 1UA1A 2GBZA 1W0HA 2XCAA 2ZQBA 4FLWA 4FLYA 4FJNA 5SZTA 3QETA 2DPIA 3H5XA 1VSHA 2ZE2B 5HRRA 1S1XB 3T19A 1N56A 5KFIA 3NCIA 1TK8A 3EYZA 5J1EB 4EYHB 4FZYA 1U4BA 2YKMB 4O44B 2DY4A 3U3GA 3M8QA 3V4IB 3Q8QB 5EUHA 3TARA 4QWDA 4DS4A 2D41A 3KKSA 2OH2A 3AVBA 4ED2A 4HKQA 3WNEA 1DTQA 1SUQA 1NK9A 4Y1CA 4Q43A 1RBVA 2DTUA 1JLFA 1KHWA 3U3YA 1RT7B 2BQRA 4N47A 3QGGA 5KFFA 2Q3SA 1C0UB 4FBTA 3S3OA 2XC9A 3K5MA 4ELTA 4F3OA 5HLFB 4Q8EA 3PJWA 5DQIA 5KRSA 1JL2A 4NYNA 1T03A 4FK0A 4KRFA 2AJQA 4DLGA 2IM0A 5K14A 3Q8PB 3I5CA 4FJXA 2IJFA 1L3VA 1S0OA 3NF7A 5KFBA 3MR2A 1CXUA 4BE1A 2AWZA 3P5JA 3MEGB 2JEFA 2DFHA 1IM4A 3BDPA 3OYHA 4YR3A 4DL2A 4WFZA 4R5PB 3NHGA 3PW7A 4Q45A 5KFEA 4W5RA 1BQNA 4TY8A 1BGXT 2A1SA 2HW3A 4B9LA 5HLFA 3KLFA 3QEIA
chains in the Genus database with same CATH superfamily
2X3GA 3LDOA 1VQNS 3NAHA 3KLEA 4BC5A 4LVOP 4DR1K 3KHYA 3CIZA 1X4DA 4CEQA 1SKWA 3TX8A 2MMYA 3QGIA 9RUBA 5GAGI 4NXMJ 2JFKA 1EQYA 3W9JA 5KFCA 4ILGB 5J2PA 5K8PA 3HOSA 4JKGB 5AJ3K 1VHFA 2A3ZA 4CLKA 4JI1K 2P9PA 2QA4S 4CYUA 4O3RA 3DMJB 3BF1A 1Q78A 1AYEA 2IBOA 3Q0AA 3ELHA 1FNXH 3FQKA 1RJJA 1PBUA 1MWZA 3IS9B 3AA2A 1Q81O 4Z4GA 2C2OB 2WB1D 5ADXH 1YHQS 1RTJB 3Q86A 2VFTA 4CZGA 4ZVSB 3K9JA 4PG7A 1XNRJ 4ZKAA 3CJ0A 5C10A 5H9FK 2XULA 1RILA 1WHYA 4HTLA 1U24A 4DU7A 3NWRA 4E7LA 4I4BA 1TVRA 2D3O1 1BQMB 4DR5K 2FHMA 1LWFB 3G9CA 2KDOA 3ZTQA 1VQ9S 1S1VA 2OGUA 4DMNA 1HKGA 2ILYA 3ZSYA 1PAUB 2GO8A 4K43A 4PKHA 3KUGA 1H1VA 2HQCA 3BR8A 4JI0J 3H1VX 5BPMA 4A8YA 5CY4A 2ZNYA 3A8IA 4RU9A 4F8RA 2IOCA 3F5TA 1NH7A 2IA0A 2ZJQL 1RNHA 4PEOA 3ZX2A 5DDQC 1ZH5A 2OMLA 5A2QY 1L3SA 2BJ3A 3X3UA 4P9SA 4PG4A 2VG7B 2W2PP 3B54A 2VYPA 1S57A 1N48A 1CJTB 4TQRA 2W9BB 1U09A 3MD1A 3I56S 4BWMA 3DLBA 5F41A 2P8IA 2QEXS 3TW0A 3TJAA 1NGDA 2JLGA 4IQXA 3T5KA 3TJ8A 4P2FA 3CJBA 1Z1ZA 4H5VA 3IMQJ 5C5JA 2CAJA 2DVIA 3OL9A 2CG4A 2P9SB 4OO1J 3OFFA 1GOAA 5DQHA 3AVNA 2HZVA 1HA1A 2QYGA 2C22A 2KFZA 1OVYA 1T9WA 4PXDA 3G82B 5G0RB 4ECZA 3EKSA 5CHCB 4WIQA 5HRNA 3HSJA 3CJKB 1BISA 2O8FA 3THVA 5D8HB 3BBCA 3NNCA 2VUGA 4ZVPB 4B3RF 3DLLQ 2GGPB 1U1PA 2NR0A 4WTOB 2ZH9A 1N88A 5KG3A 2PEHA 3O9TA 1X4AA 2WVDA 2KKHA 2MJUA 3A8KA 3D2EB 2Y1JA 5LMNJ 1NNDA 4N56A 5KFGA 2GS8A 3JQJA 5E5NA 1XERA 2OEJA 2XLIA 3GIKA 4UY85 3R1HA 1FEEA 1T11A 4ICLB 4UQGA 1VQ4S 3OYBA 1UAWA 3ZT0A 2YNGB 4ECWA 2R8KA 5IXUA 1EWQA 4RO0A 1ZTWA 3MPWA 5ETMA 4OI0A 1Y5NB 2AGQA 4OV6A 4CVNE 4USKA 3H08A 3BO4A 3MEDA 2LMIA 4Q44A 2PI5A 3D1HA 1GH8A 1WI8A 1S6OA 2BE2B 3HHKA 4E8UA 1QJHA 2CVIA 4DQPA 1MMLA 5KFAA 1CJKA 3MPVA 2QI2A 4XIUA 4YDXA 2D74B 5HRSA 2HNYA 3LPYA 5JJBA 3OR1B 3TA2A 1FRIA 1NK8A 4F02A 2ZM6F 2W6KA 3H90A 3FZ2A 2UUBK 1ZM2A 1OJ4A 3FLCO 2OTJN 4LH5A 1WHWA 2F8MA 1TYQB 3K2YA 3KXDA 2RQCA 3TTFA 5BR8K 1RTHA 5A0YA 4OV1A 3C7NB 4AM6A 1FJEB 2UUBF 3RBEA 3IWXA 4DR4F 2HQ3A 5TKYA 3ILOA 4RW9A 4A59A 3W5XA 3AQPA 2MB0B 2GIFA 4Y1DA 1NMDA 3TTCA 4DX7A 3MXJA 3CJCA 4AQYJ 1HYSA 4KC5A 4NI2B 3SBGA 1H2UX 3BF4A 2P9CA 3GYNA 4YS2A 3P5TL 2G8UA 1R8AA 4KHPK 4JI7K 3VGLA 5KFNA 2CPZA 3KLHB 4P72A 1VSLA 3AA4A 1KAZA 2E7XA 2Z0GA 2YHAA 4FLZA 1AROP 1RHQB 3EXYA 5E3QA 3AVLA 3PW5A 4K0KK 3ZEUB 4DCPB 1S1UA 4FKYA 3M8RA 1N6QA 3SUNA 2WOMA 3QGPA 3BQ1A 2CQCA 5FJ4A 1D9AA 3I5AA 2QLWA 4LFAF 5D3GA 4CO2A 1V3ZA 4A8OA 1OPIA 1D09B 3NCRA 4J9NA 4JV5J 1ZETA 4BVOA 3MMVA 5HJXA 1X4CA 4BHQA 1X31C 2GIRA 1RAAB 3CI5A 1NJWA 1NUEA 3POTB 1W9HA 5E41A 1UCNA 4PKDB 3WXIA 4C8LA 3SPYA 3JTNA 2ZBIA 2JWKA 4B3MJ 3ZTOA 3I55N 3M6WA 4HHHA 4M3TA 1KQKA 4ALZA 4FPBA 2A5XA 2AGOA 4WP3A 2HBZB 2B3TB 1WKKA 1Y64A 3DWLA 1ZOTA 2P9UA 3QNOA 2W25A 4KRWA 4CJWA 2WAQD 2O8CB 2I0XA 4UW2A 3OSNA 4IBNA 2W6LA 3IAYA 2FJAB 3A5NC 2F9DA 4BQLA 4H03B 1X4HA 4NWBA 3TU5A 4RWTA 3HKWA 1NJIT 5AQKA 5A8RB 4KBIA 1TVRB 4FJIA 3DHXA 4DV7J 3W8GA 5L9NA 2J9DA 3ENVA 3NGYA 1ICEB 2MZJA 4O55A 3TO8A 1SJFA 3ZZZA 2B0GA 2E1ZA 1IKVA 2DKOB 4RCHA 4IDKB 1U1NA 1C0UA 1VQPS 2B6AB 3D2WA 1Y4ZB 3THXB 2GFFA 2IS3A 4Y0WA 3D6HB 5CYJA 3LDPA 4HYKA 4URQU 4DV3K 4B1VA 1OS5A 5EOYA 2VZ9A 4J7CA 4JV0A 1UP1A 2GMHA 1YI2S 1R6VA 4ECSA 3J7YU 3Q8RB 2VWBA 1NBWA 2HQDA 3G4SS 4CLTA 4ILLA 4IR1A 2XMJA 4A8KA 2ERRA 4LJMA 1TKTB 1VIXA 2VG5B 4DJBA 3KLEB 1RK8A 4BRPA 2DXDA 1J5OA 1Y97A 4NX9A 5BYSA 1SH3A 3I0RB 2QX0A 4NLOA 3GV7B 5JUMA 1LXJA 4DV2J 4BG8A 1ILYA 3CVKA 4J9VA 4ZPDA 3DCAA 1BD6A 4I6MA 4QIVA 5KFHA 2HBJA 1FA0A 4LBPA 4X66F 4DV7F 2LQJA 4CHNA 3I33A 3NOCA 2VCPA 3TZYA 3ISND 3WT0A 2GQ2A 1YJWS 4K41A 2P5GA 3RMAA 2NLWA 3ENOA 1UTAA 4JLHA 2BOAA 2QV6A 2CA9A 2V52B 1FERA 2FBYA 1KVBA 5BRDA 3LALA 3B8AX 3I55S 2EFOA 1QLNA 1R6YA 3UCZP 1IH7A 3VVUA 2NREA 5C2GA 4DS5A 1HBMA 1RDDA 1YITS 2IDEA 2KRRA 1OH6A 3PTWA 5FLXO 2AEJA 3NWGA 3OPKA 4NXMK 3MX5A 4OPAA 4A48A 4E0DA 2WSCC 1M0SA 3RYLA 5J2PB 3JSMA 2JVOA 1CPZA 3CCMN 4UZCA 2R7RA 4Q0BA 3UE5A 4NYPA 2IYIA 3TAGA 1I39A 3SDEB 4FNIA 4RWXA 2HAIA 5HOOA 2FLLA 4X2BA 3NLCA 5EN1A 2FXUA 1HWIA 4C0HA 3HO1A 2KVQE 3ZSXA 1TKDA 3M8SA 2O8FB 4U67Q 4MKVA 4K4SA 4LF9F 2A1BA 4O8KA 4LF6K 5AQUA 5D4PA 1CLFA 2F4VJ 2DH7A 4MFBA 2HHPA 4Z0UA 1O8BA 1YJ9S 4LF2A 4ZVOB 4IO9Q 1IM6A 3QPIA 1Q95G 1WUUA 4CECA 3PRBA 2FY1A 1TL1A 2J9EA 1NHVA 3RAXA 1OQ6A 2CG8A 1VCTA 4OYPA 3EZWA 3PHEA 2WSEC 3VQ6A 3QIPA 3L2WA 4IWVA 2NXUA 3E9LA 1D8ZA 4PWDB 4H5TA 1S9EA 4DF4A 2IY5B 3FNNA 5EGYA 3A12A 4IYQA 4ZVGA 4HTUA 3UI3A 3R1LA 3TWHA 2YNIB 1HI8A 3OXLA 3ZSQA 2YWFA 3MMBB 1OIAA 5IT9U 1RT1B 2N82B 3F56A 1ZYQA 2XLJA 1PILA 1Q9YA 2E2NA 1KRPA 1OKJA 4PA1A 3HSDA 3CCLS 4BRIA 2JFDA 3EGZA 1ZA1B 4R8UA 3LP3A 4J2DA 2R8IA 1SJ4P 4N8OA 3KK1A 2QK9A 1PC4A 3IR7B 3LQVA 1IO2A 3L2UA 2HVDA 3L09A 1N8RT 4IO1A 3W0LA 4OZ1A 3SV3A 4C0BA 3DLLL 1HNIA 3RB6A 1Q7YT 2XMUA 3E51A 3HHLA 2EFGA 1WAFA 3KJNB 4KE5A 5DG9A 1GLCG 4WCEQ 5BR9A 4DPYA 2KZZA 2AJ2A 3CJKA 3AQOA 2ZD1A 1I1GA 2IVOA 2I6WA 4QWCA 3N4WA 2LDYA 5D15A 2UUCF 1REVA 3SV4A 1YBAA 3W66A 5GADP 1RWKB 4L6V3 3MXHP 4QAGA 1JJ2R 2EBGA 3QSYB 5KG7A 5EX0A 4F9OA 1J9AA 2XGPA 5AQHA 5GADU 3OW2M 1K0TA 4YDUC 2AF6A 3HULA 3SFGA 1HR0J 3P8BB 2YV0X 3ZT4A 2KT5A 4K4TA 2Q66A 1QVFR 3H42A 3O5TB 1R8CA 3KLGB 1RISA 2WRMA 2YNFA 1QY7A 2KTQA 2VG7A 2ZEJA 5AQSA 2YH1A 2BANA 3ZTSA 4DX8H 1BCMA 4CK3A 4DTSA 3THWA 3MM8A 4QW8A 1YWXA 1S4EA 3DM2B 2OAUA 4H4KC 1BHLA 1QHAA 1TFYA 1LV5A 2FY8A 1FD2A 1G1XA 3AFGA 2Z1HA 4QS9A 4BDPA 4UTGA 4DUTA 4NLVA 2B5JB 5K8OA 1U02A 1VBKA 3TWZA 1YK9A 4FO0A 1WNSA 1PJ7A 2FLNA 1RKIA 2NUBA 2K8GA 4PKIA 4BRHA 2ALZA 4HACB 1HWUA 3RRGA 4I2QB 1IKYA 2Z2YB 4OX7A 5DM6L 5ETLA 4IZ9A 1F3VA 3LAKA 5HL7Q 4CJKA 5RUBA 3GG4A 5KT6A 5F0UA 1XIQA 2BZ2A 3EICA 3ICLA 1E4FT 4FWRA 4FF3A 2MLXA 4KAIA 4LF5K 2M70A 5AE3A 1WKJA 3M1VB 4PL8A 4K4XA 4EFAC 2RQ4A 5ETPA 3BP8A 3VQCA 1OYEA 5CCLA 4CZJA 4J8FA 1YHQN 4DV4K 2QMWA 3EPGA 4DR2F 1OPZA 1NJXA 4YB7A 1TMMA 2FHOB 3SCXA 2EK1A 4JHDA 2FQQB 1S1WA 3UD4P 1KC8O 1QE1B 3JS6A 3IWNC 3DLJA 2R7OA 1N33F 3VGTA 2VBZA 3OL7A 2V2KA 3UWTA 4UY8T 4JI4F 5KFDA 1SV5B 3RAMA 4CH0S 4B3TK 3D3CJ 2L48A 1Q7LB 3LA0A 4IR9A 4CEEA 4F0MA 2JJ4D 2ILZA 2CJAA 4M5HA 2KI2A 2ZBRA 3CTRA 3G6EN 2DEIA 4XH4A 4F7VA 3NP5A 4X4TA 4MYUA 4CJPA 1JLCA 3I0SB 5C24B 4CJLA 1TKXB 3M2UA 1EZZB 3QAUA 4CNZA 3ULDA 2IIRA 5L1KA 3GU0A 3MAAA 4EI2A 2UUAK 3IM9A 2V50A 2UP1A 4UY8O 1C1CA 1SC4B 2BJEA 3GJSB 4GVMA 4K4UA 1S7IA 4FWKA 2HZAA 4FF4A 1GOBA 3OVNA 4ZVTB 4BG9A 2RSQA 3VENA 4RBUA 1RZMA 2OA8A 4JBCA 3CDUA 1K8KA 4IRKA 4FXVA 4KV8A 3EEQA 2XS5A 2X3DA 2CQGA 4XPCA 3AJ2A 5GAGP 3UD3P 5FIIA 2GTDA 5C42A 1JLBA 3ZNUA 5HATA 2HVHA 2QRRA 2KHCA 2K1RB 1FRJA 1YIJN 4GC7A 3LDSA 1NSAA 4QJVA 3CF5L 3DLGA 4AHRA 2BMBA 2ZBCA 3AAWB 2W01A 4B1ZA 4ZVUB 1OY8A 4AH9A 5DK5A 1DTTB 1VK3A 3CQXA 3QNWB 5D3GB 2DFFA 3WC2A 2LA6A 1LW2B 1D3WA 4AYBD 2X1BA 4TNOA 3CDAA 4X64J 1CLQA 4GKKF 5FRMA 4LR8A 5FD1A 4RW4B 3CMES 1NAQA 4CGFA 3GFHA 1S99A 4OVLA 4TKTA 4QWAA 2AJ0A 4X65K 2ATLA 5DLFA 2IJRA 1QHTA 4BRGA 1WTBA 2ROEA 1NPRA 1IBMK 2W2QP 1WSVA 4EYIB 1QSSA 4ZOSA 5LMUF 3W2WA 4FNHA 2AYGA 3MI7X 4CJ5A 3S7RA 2YKPA 4Z4FA 1TL3A 3R5JB 3FZBA 3AH6A 1G3OA 2E5LF 4FOIA 2UUTA 1IQZA 5KAKA 1CS4B 3VF0B 3NH0A 4BR4A 4YY3F 1VSJA 2Q0RA 1AW0A 2Q6CA 2HFUA 1ATRA 1MWMA 3GIIA 3CCJS 1RTIB 1KEKA 4IEIA 3BZKA 3KLHA 1SH2A 2NXJA 1FXLA 2E9ZA 3GDQA 5ETKA 2YWGA 3QB0A 4I2PA 5CE3A 4DFKA 4USIA 1B9DA 2FZCB 2V8DA 4RUCA 4RBVA 4O8UA 4KHQA 3DXMA 1KOOA 1K1SA 4I2QA 1BI4A 4NCBA 4YNQA 1HPZB 3ATUA 1EIYB 1F2HA 2PA3A 2R7UA 2GHPA 2RHKA 2D0CA 2C28A 1FESA 5FPEA 4P10A 4GKJJ 2E20A 4M5KA 3KLVA 3PSFA 4LF5F 4RLEA 4Z4IA 4OYZA 2KW4A 1WC1A 1YGYA 3NGRA 3LDNA 3PYFA 1VQKS 1N5YA 3M6UA 3VQTA 2ZZMA 1F60B 1WDTA 4PUOA 5JS1A 4PXEA 2I1RA 2AEFA 1IN0A 1DQAA 1RT6B 3VCDA 2UXCJ 2V2ZA 2Q79A 3KLIA 2KYXA 4G1PA 4EHTA 3P4IA 2ZH1A 2KLAA 2ATQA 3A13A 4NRTA 2HGNA 3RW7A 4DSFA 3O4QA 2DGXA 4ZVRB 2HLUA 4ELVA 5EVZA 1HWJA 1QSYA 1ZZFA 4I2PB 4P73A 3IDHA 1M5OC 1HNVA 1GXUA 4X4VA 2FHJA 5DS7A 2VC1A 1HNVB 2WBRA 1FFWB 1U2FA 2E6MA 4LF1A 4ZN1A 2DYAA 4EBEA 3AAPA 2B4VA 2ZZNA 3M8YA 3A1YG 3D66A 3BEGB 2XHBA 2CNOB 2WONB 3NEKA 3KNGA 4FM1A 4EUVA 3HZ6A 3MAQA 4LSNB 4WF9Q 5A8WA 4P71A 2BKPA 2HRTA 5L1IA 2GNKA 2VF3A 5I3UA 3P39A 3IWLA 3NDKA 3OTDA 2VOPA 3O9UA 1I51B 4BY9C 4CEDA 1SUQB 4J9KA 1N34J 1FW6A 2CJ9A 4BRNA 1BQNB 5BR8F 2VPZB 1KQSM 4PAAA 1JKHB 5HK4A 4K8ZA 4XDDA 4IRCA 2V4JB 2V4RA 4Y3CA 1RU2A 3OSPA 4H8KA 1BQMA 1XTZA 2IM2A 4FJKA 4MLEA 1KWMA 4NA3A 3EVMA 2JGUA 1ACMB 4YY3K 1FRMA 3Q22A 3WEEA 3GCWP 4RG8A 3ENQA 1UVNA 4IDHA 2E5LK 2C3UA 3ZLJA 4J9QA 3VTIA 1TQLA 4RW6B 3R6MA 3J80O 3PW4A 2ITGA 2F40A 2JEGA 4L76A 3WZ0A 5GMEA 1RT5A 4DR5F 1U8WA 4RJVA 5C42B 2QFJA 4KREA 4E98A 1KFDA 1U1KA 1HWKA 3HTVA 4AILC 1RAIB 2X6NA 3CG7A 4F0KA 1LWCB 3PEJA 3DJCA 1UWBA 2FC0A 4D3HA 3NE6A 3JYTB 5F8GA 4DV5J 2OI2A 5CD4H 2DNGA 3ZSOA 1RAJA 1IKWA 4BBYA 3D0PA 4LY7A 4CRJA 4HHJA 1YJ7A 1SQEA 1WLJA 2G8KA 4XPEA 2Q43A 3OTOJ 4DSLA 3MGJA 4P2XA 5BR8J 2D0BA 1S12A 1KNZA 1FK9B 2FPHX 3TP2A 3DYAA 2V8GA 1PJ6A 3K8WA 4NEZA 3DU5A 2L41A 4OHVA 5LJVA 1GMWD 2LP4A 1MU2B 4W92B 4PCQA 3TSPA 4FZZA 1DT9A 1QAIA 3M8PB 4NXNK 2HHSA 3PKMA 1JJ2M 1F9HA 3MEKA 2PFUA 2QLJB 4YMEA 3IKMA 1B0PA 3HMJG 2CQ2A 3VA3A 2YPZA 4ZP9A 1HNXF 4GNIA 4X4OA 3ISNC 4Q2LA 1WSEA 2BE9B 4OI6A 4JKHA 3G0ZA 1X4EA 2ZKTA 2DGOA 2RD5C 1GLEG 4IJAA 4A8SA 2AEMA 2N3LA 3BGRB 4YFUA 3HPHA 5F9NA 2UVWA 1XMOF 1B3TA 3I5BA 4AUKA 1NGFA 2HIYA 4AFFA 3QLHA 1U45A 4WXOA 5AE1A 1HQEB 3OVSA 1D4XA 4OI2A 2YNHA 2BV3A 3GL1A 5T14A 4H0YB 4FZXC 2CNLB 4FWSA 1T3VA 3SI6A 4ZJOA 1P8GA 2EK6A 4DV6F 5AFUH 2J0QD 3FCWA 4WZMA 2MZTA 1YTUA 3BYRA 3HI9A 2VIHA 5L1JA 2DGTA 3NGKA 2J7UA 3C16A 4X4NA 1RT3A 2HBYB 2FVRA 4C11B 1C0GA 2X7IA 4R79A 5KFQA 2LVWA 2Q0UA 4UOHA 1X5PA 3HDSA 4JI4K 2Z2ZA 3HHDA 2Y0SD 3G96A 1AFJA 1OQ3A 4DKWA 3NOGA 2EFNA 2ZF5O 3NMUA 1NGBA 4IFEA 4ZK7M 2DRBA 1F0XA 5DMRA 4DTPA 4URGA 3TAFA 5KFOA 3DAWA 4RW7B 4NXMF 1Z4UA 5IWAJ 3E01A 2IM1A 4Q2MA 1QZ5A 1UA1A 3PIPQ 1W0HA 1FTCA 2CPDA 4DCJB 2VDIA 4FLWA 4DV0J 2WW8A 1OH8A 1HJOA 1YJWN 1VSHA 3M2UB 3BGUA 2KG0A 3O80A 4CNYA 3MCMA 1QD1A 1U4BA 4JI3F 3JAMU 4XDCA 4O44B 1LCUA 2H5JB 4HI2A 1Z2ZA 3U3GA 2UYTA 1P8ZA 2ZH5A 2RB7A 4QIWD 2NRHA 3L3CA 4DS4A 1Q8LA 4U8VA 2OH2A 1HKBA 1W2BM 3M30A 3ULEB 3CCUN 4YB5A 4IOCL 1Q53A 1DTQA 3KZBA 2WZ1A 3VPZA 4YEAA 2DTUA 1RBVA 4PR6A 4G9ZA 3QRQA 1J6ZA 3ZYYX 2O8EA 3U9ZA 3T9NA 4RU2A 2BQRA 2Q3SA 4DPWA 2J8AA 2R7QA 3S3OA 4LRCA 4NB4A 1G4CA 4LFAK 1RAHB 5DQIA 4DR4K 5KRSA 4LBHA 1JL2A 4NYNA 3GB0A 2FDNA 3Q8PB 2ASYA 4JB8B 4J5OA 1S0OA 3NF7A 2MKJA 2P9LA 3MWBA 5KFBA 4LFBJ 2PSZA 4ZN3A 2B8QA 1IM4A 2DFHA 3BDPA 3HOTA 4YR3A 2F65A 2DR6A 4R5PB 2G1DA 1EQMA 5E33A 3PW7A 3VAGA 3MPYA 3TR5A 3JXOA 4TY8A 2OTLS 1PC5A 3MCSA 2HF4A 2H4YB 2HW3A 4B9LA 5HLFA 1V5VA 2F7VA 1GXLA 4JI6F 2AMCB 2YHYA 3PW2A 4DWIA 4WYWA 2YHXA 2XM3A 1QSLA 3E8OA 4HUFA 2DFEA 3OVBA 5DDRC 4HDHA 3E9PA 3PX4A 1BQXA 2WFBA 1HD1A 3G8QA 4ELUA 3FCHA 4KH1B 4U6PA 4FLVA 1RCOB 4AE5A 4OX9F 3QJPA 2E1YA 4O0JA 2OEMA 3IR5B 3QICA 4IQMA 5M1KA 4WJBA 3M05A 1DY3A 3AJDA 1TUGB 1WG1A 1YRXA 2WVBA 3KLFB 4CEBA 4QPXA 4A57A 4C1NI 2C3YA 3ZSWA 4A5AA 1FX4A 2YNFB 3TSUA 3AXMA 1YTYA 4NI2A 2IM3A 2YCHA 3CQ8A 1QAYA 3DRSB 4HHTA 3OBIA 2MKYA 1XC3A 1IWGA 1ZM9A 1HYZA 2MZQA 5D0GA 2HFVA 1JK9B 1RBSA 4DR5J 3C65A 3ENBA 4JD2A 4O4GA 3NL0A 5CZVA 2GAHC 4MIBA 3PLAA 4FWMA 4P74A 4CGHA 1NB7A 4A61A 2HNYB 1SJRA 1RQ0A 1C4AA 3QBWA 2QTWA 5KFYA 2NUHA 3EY1A 1N32K 5AZJB 4ED4A 2M52A 3L3UA 2LA4A 2BM0A 3M6GA 4BC9A 3SNNA 1N0VC 3O9RA 4QR0A 3J7AP 2VA2A 1QQNA 4TSXA 4YORA 1KTVA 2V8VA 3JSMB 4E7IA 1C6VA 1ZC6A 2XB2D 4CTAA 5HVGA 1N5YB 5G4DA 4CT8A 1CZAN 5LJWA 1FRHA 3T5JA 3T9ZA 4UUXA 1Y11A 4WFNL 1RT1A 1HW9A 2NRZA 3EZOA 2BOPA 4USJC 4ZHRA 4RKUC 4KHYA 2QWQA 1S9EB 4KGKA 3UDLA 5AQWA 3V2UC 2CPIA 1C1BA 4ZA1A 3SAGA 1XR7A 1KC8T 2D0OA 2K7JA 2EX3A 2NXCA 2V8HA 1GX5A 2WC9A 5CHIA 1N54B 3OTCA 3V6JA 2F3JA 4ES2A 3RZAA 1R0BG 2ZUGA 2YTCA 3OS2A 3V81B 2P9IA 1JXEA 5IT0A 2RHSB 1HARA 5D78A 5FPDA 3QZ8A 4OJGA 2W4CA 1N32F 4ZVFA 2FVQA 2IVMA 4O3QA 1U6FA 4A62A 4B08A 1KLNA 4Q8FA 4KGVB 4GVLA 2X51A 2QLXA 2MQNA 1U1QA 4B3OB 4DG1B 1I3AA 4IFVB 1C0FA 4OI4A 4OX6A 1GK8A 4JAXA 4H4KA 5B0BA 1ZXOA 4HVJA 3BQ2A 4MFBB 4ZITA 1SIWB 3HPGA 2KZMA 1TL3B 3BN7A 3JTOA 3DHWC 4WK1A 2GWKA 1OWXA 4BDYA 1C0TA 4AHSA 1YRTA 1QDUB 1TK0A 4MDBA 1NCLA 2W2OP 4P7TA 2QEXN 1KAXA 3MN7A 1NZ8A 3ILIA 2MQLA 3NF9A 4JKFA 4OJ3A 3NNHA 4CF0A 2J8SA 5DZ6A 3CCUS 1NDCA 5IT4A 2D5RA 3OYCA 1CQMA 4GKKJ 3W9HA 3PY8A 3R9PA 3D68A 4O0IA 3L6QA 4TYBA 1Q86T 3MAHA 2DGWA 3C6AA 4RBTA 3A3OB 1S6PA 5M2RA 5AXLA 1VQ7S 4KKOB 4DV4J 1LOUA 5IV4A 3C15A 1TU0B 5F3TA 5GAGU 5ETQA 1EJ7L 5D0EA 1R8BA 3GONA 4M3XA 4F0HA 4WE1A 4MTPA 3AGKA 3V9XA 1FVSA 4KQZA 4UUWA 1N32J 2XGQA 3CXCR 5J2MA 2YKNA 3FSXA 2W4DA 3PV8A 3MUVP 3V1OA 1J5EJ 4DV2K 3C3LA 4B8CA 2DTJA 4YY3J 3OR2B 2BABA 4JI7J 1FT8A 1HR0K 4IEEA 4C3KA 1X3MA 2FJXA 1HBNB 3I0RA 1Q18A 4UT4A 4DPOA 2MGZA 3D67A 4ED0A 2FJDB 3BKUA 4ED5A 3TVZA 2DGQA 1S22A 2CPXA 3M4XA 2HVIA 4C2MA 3VQ9A 5AZIA 2G8FA 1N8RO 4FK4A 2GC8A 6AT1B 5DGBA 3J7ZO 2HZCA 3HP6A 1VBXA 2BKOA 1SJ1A 4H4OB 4CJTA 2ZNZA 1VQNN 2I5JB 1UFLA 4R0EA 3K7RA 4LQ9A 2CUYA 1S1UB 3A3NB 2O4GA 2MHEA 1A6LA 1T05A 4J90A 1SCJB 1BCOA 3D4JA 2HKEA 4URSA 3ULEA 4ES1A 3LDQA 2JX2A 4DFPA 1NNEA 4KH0B 4AHCA 3NRBA 2ZWOA 3LH2S 1VQYA 3LGNA 4HVZA 4DSJA 3RWUA 2KG1A 3DYAB 3AA8A 3O3LA 3UB5A 2YKAA 1RBUA 4PPZA 2A6AA 4IOAQ 2DIUA 4DSEA 1NWKA 1DRZA 4CESA 1AA1B 4WP8A 2QA2A 4WQ5C 4JRPA 2QWMA 2FGOA 2G8VA 1R3NA 4BRQA 1TELA 2E9RX 1N52B 1RTHB 4K4VA 4FYYB 2BW2A 3RUBL 3D45A 4NASA 1VFJA 2C3PA 1DBDA 3VEZA 2UVUA 3RTVA 2VH7A 3KHGA 3CGIA 2Q3PA 1DAXA 5AQOA 3UDCA 1XMOK 3FSIA 1YUWA 4X65J 2VBWA 1HYSB 5DDPC 2JH3A 3VAJA 2G4BA 4OLOA 3VQEA 1E6YA 1N34K 2YPYA 2ASJA 5AQQA 2DHGA 2V6AA 4OI3A 1RT2B 3EGWB 4CO4A 1U2VA 2QSWA 2VC0A 5J2QB 1GLAG 5M1PA 4JI8F 2OPSB 4PYAA 1WNEA 4JN4A 5K8NA 3G6VA 4KHMA 3UCUP 1RAEB 2YJFA 2VU5A 4CM0A 1HYVA 3G71S 2HBKA 1RYSA 2CJBA 1VRTB 3CJ7A 2UUCK 4IG3B 1JWWA 1RADB 2EC2A 3EPIA 1NLKL 1UWAA 4DQRA 3QIOA 4FOEA 4M7YA 1JQGA 1RWXB 2VFVA 1NK0A 1PKUA 2H9ZA 2MKIA 2VASA 1XHXA 3MEGA 5IM0A 1KLMB 3O9SA 1VOMA 1KVCA 3LO3A 2FSKA 1S6QB 3T1HF 4IFYA 1YI2N 1AB8A 2IA6A 4NO7A 5GMDA 2RDIA 4IRDA 1VQ6S 1P90A 1SZ2A 3OYNA 3EM1A 2UXDJ 1DEJA 3QDKA 4LD0A 5J2NA 1YJ9N 2DISA 5IV3A 1L3KA 4P52A 1EQ0A 3HSZA 2ZH8A 2P6SA 1N0UA 3D2FB 4DEZA 1UFKA 4OLPA 2E5HA 2BANB 4DL5A 5IM0B 1S9GB 2YWHA 1ZS6A 4IJNA 5M1OA 1YT3A 2G2OA 2XY5A 1B99A 2XBPA 3K5PA 2XO6A 2F9WA 1R43A 1LQ9A 1RSCA 1CC8A 2D1KA 2B4OA 4QR1A 4DV5F 3NKYA 4DMZA 3T7ZA 2OD4A 3U4LA 3VHQA 2IVNA 5I42A 4C97A 2CQ1A 3T1AA 1EX8A 1HQUB 5H1SV 3I87A 3ILLA 2AU0A 3IFRA 3GE1A 3IRXB 3CSKA 4GO5X 3GOIA 5KRTA 2HQGA 4ZHRB 1YG0A 2ZD1B 2XNQA 5EHHA 4Y2CA 1FJGF 1FDBA 2E5GA 3ILJA 1RT2A 2YQ3A 5ADXA 4DR1J 3GIRA 2CVEA 5CXTA 1BE4A 3D1OA 3OXGA 1YITN 5D0HA 1ZAVA 2BE7D 2VL1A 4ITSA 2WOMB 3UDEA 4EWTA 4CO1A 4DX5A 2RT3A 4F4ZA 2JEJA 3OJUA 3LWLA 3PFEA 3R5DA 3G10A 3LL3A 3CCJN 4CT9A 3NH2A 4WU3A 1VQKN 4NMLA 3PEHA 4FS2A 3KHLA 3T5HA 3TANA 1GT8A 1DJ0A 4A5BA 3KWGA 4DL6A 4Y2MA 1NHUA 3FFKB 1Q5YA 2IJNA 4ZIVA 3DM2A 1F1BB 1VIOA 3I31A 1TUYA 2D9OA 4CHZA 4DL0C 3BUZB 1NDLA 1H2VZ 2NCKL 3QIDA 4PWDA 1PYOB 2CGKA 1H7XA 4HH0A 5IT9O 4KO0A 3FMWA 4DI6A 3LP2A 3KHRA 4JOUA 4RNHA 4JK7A 1EKEA 3W3DA 4MK7A 3L4BC 3UVJB 3E66A 4FN5A 4MIWA 4FXWA 1R59O 3DXMB 4KHNA 2YX1A 1S72S 3G82A 5G0RA 1BUXA 2OSRA 1DGKN 1MG7A 3D0GE 2DNPA 3HHLB 3CJTA 2R2SA 3DLHA 4L8RB 3OR1A 5C2DA 3B78A 4FSVA 4W98A 2FSNA 4ED8A 1HHSA 3RRKA 3GPAA 4CF1A 1YRUA 2HNZB 2H51B 2RDDA 3UIQA 5TKWA 1NHKL 1WACA 2QJ3A 2RE2A 1IBMF 1VQ6N 2JHEA 1UFWA 2V9KA 3VEXA 2WTUA 4L3QA 1KVAA 5KGWA 2DNLA 2MPUA 2RE1A 3JQMA 3DRRA 2CIMA 1H74A 1CXQA 4CZHA 4CZLA 2RDJA 3DRPA 4MDAA 1TL5A 1A9NB 1F2GA 4DTOA 5E7OB 4Y00A 2QO3A 3IN5A 1RE1B 3DOMB 1UZDA 1RDBA 3MR3A 1S97A 2KRBA 1P27B 2BGGA 1TKZB 4DR2J 3NFAA 4GW6A 3G71N 2IVYA 2R7VA 1YJVA 4R8UB 2B6AA 3R1XA 4USMA 3QATA 4JS5A 2WBNA 2R42A 2DH8A 4ANCA 2VB6A 3CMEN 4E1JA 2ZWHA 1BHNA 2OSQA 1PO6A 2GWJA 3R5GA 2NNWA 1T94A 4ILRA 3QINA 3Q8UA 3KVGA 3NF8A 3C6TA 3LM9A 2ZJQQ 3O08A 3J7YP 3LP0B 2M5YA 1VQ4N 2OPSA 3QO9B 1IR2A 3HSTB 3F0NA 4EBDA 4DU1A 2QTDA 3L0QA 3OYEA 3L95X 3VV2B 3V6DB 3GE9A 4MT1A 1WDDA 3ZZTA 2CPJA 1K1QA 1C1CB 1Z05A 3HCXA 3RR7A 2VFRA 1I94J 3LPTA 1E6YB 2LLZA 2X74A 1J5OB 2VJUA 3EGVA 4YQWA 2BR0A 3G87A 2O8DA 2P9PB 2HPUA 4RNFA 2DGUA 1NJYA 3AJ1A 3MN5A 3ZO7A 3O3FA 2GO9A 4O0NA 2DR8A 3MM6B 4O5FA 3WQTA 4KHWA 5F0XA 1T9XA 2PMHA 4V19S 2O67A 3Q7CA 1SC6A 1J5EK 3KG4A 4CJFA 3NGTA 1CZBA 4CFBA 3CWJA 2DB1A 2DCLA 5CYMA 1J5EF 1VQON 3SSQA 4BRMA 4DUZJ 2KQ2A 2BRLA 4N76A 4M63C 1X60A 1V3RA 2R2RA 3VAFA 2B56A 3AODA 1C0TB 3MFIA 5DLGA 4DQIA 2RVJA 4CF8A 3ZZOA 5KFKA 3SCJE 1NGHA 1JL1A 3C6HA 4KT0C 3L2QA 3OJSA 4Q0BB 4OQJA 2F7TA 4N77A 3J7A1 4A8FA 4YHHK 1RWPB 2J4RA 5C0YA 5LSRA 1V4TA 3FR0A 2CADA 1W7WA 2I9SA 3OR2A 1B92A 1SV5A 2NUUG 1BDGA 4IO8A 5AXNA 2QXLA 2CPEA 4BR7A 4B3TJ 2YKNB 1R0AA 3UNGC 2DRDA 2M8DB 1YKWA 1S10A 4K0KF 1KS2A 3UN3A 4KB1A 5A8RA 1JXVA 1U49A 4K59A 4DV6K 3CDEA 2OTLN 1UEVA 4E1NA 2FUG9 1Q7YO 1M5PC 5DM7Q 3CPEA 1RTDA 4JEPA 3ZT3A 2Z1IA 1LW0A 3CM5A 2EEYA 2OPQA 4OIXA 1ZM3A 4I6MB 1AXQA 3W63A 2NYIA 5FPMA 3AD7C 1UEUA 3ZC4A 3VQDA 3CO9A 4WTYA 3MN9A 2XMTA 3J81Y 4TU7A 3CJ5A 5J2MB 3ZEUA 1Q0NA 2FVCA 5KFLA 5E3PA 2PA8D 2GMLA 4B3MK 3CJQA 1D5AA 2QE5A 2MKKA 4J9SA 3FE1A 3PKYA 1I94K 4QBUA 3ZZPA 3FQLA 3UVJA 2IDOA 1S9GA 4NRUA 1S0VA 3IGVA 2HWTA 1Q86O 3R27A 3T41A 4F04B 4LQ3A 2XYHB 2QA4G 2OFHX 4HDGA 4NLRA 5J1NA 3ETOA 4MO5A 1JLFB 3DOLA 2Z2LA 3HKZD 4YOUA 1FDAA 4F67A 5GAHP 1QTNB 2B43A 4I6YA 3OT9A 3DRXA 1X9SA 3CCLN 4U67L 2QMUB 4DR6K 3TAMA 3R3TA 4CHYA 3UKRB 4HCBA 1KQGB 1VQLS 1NDKA 3EMTA 3KYLA 3MN6A 3HZEA 3C0BA 2EG2A 4F3QA 1NGCA 3J81O 3OYGA 2BDPA 1E6VB 4OHZA 4CH7A 4M5NA 1UZHA 3M7VA 4ZPTR 3W1YC 3OL6A 3EJMA 1S6QA 5LT5A 4DG1A 4M94A 2R2TA 1WKLA 2FF3B 5KT5A 4RW9B 1VAZA 1ZPVA 2DIVA 1ASUA 3C95A 4LRAA 1NK4A 3MEDB 4QIFA 2KT3A 4L75A 2HURA 4YB6A 3VEYA 4KHSA 3KKFA 8AT1B 2IFXA 2PDAA 4JYAK 4BRAA 4BR9A 4M7XA 2BH1A 1RAOA 3FK4A 4ANEA 2ZH7A 2DR9A 1SKSA 1MN7A 2FVPA 1TUVA 4M45A 2YKMA 5IQQA 4KPCA 5LJ3Y 5DG7A 1FWPA 2HVEA 4JYAF 4DR3K 1C1BB 2VHGA 3K5NA 2O8BA 4BC4A 4FJ9A 3ZCMA 3NF6A 2C2KB 4GO7X 1WBDA 3LUYA 3FC9A 2HLTA 4TQSA 2F96A 2VFSA 3NH1A 3EZUA 1YTAA 2FJBB 3KLGA 3LZIA 2HBMA 3T6JA 3J81U 1FEHA 3B82A 4F2SA 4CFDA 1DQ9A 4CLWA 2Q6BA 2H5IB 1Q1KA 1WEZA 1YJNS 3P31A 4DTRA 3QRRA 4JS4A 5H1SQ 4A47A 1CJVA 2VONA 3UKRA 1Q79A 1R31A 1VQMS 4F3MA 2XO7A 3VZHA 4GY2B 3ZSVA 1ZBTA 3O44A 1EB0A 4YN3B 1F9FA 3CCQS 1KKHA 5KT2A 3AA9A 1WAJA 1IBKF 3DOKB 4C3MA 4GMKA 4WFAL 4FF2A 1G15A 4DBQA 4IG3A 5F9LA 1SQGA 2PBDA 5LXYA 2W42A 4EBCA 1I94F 3C2PA 2VOOA 3DDNA 3VR1A 3QWPA 2KL8A 2CJQA 4OYMA 4YR2A 4CBUA 3ADAC 2R7YA 5C12A 3MF5A 2VPXB 4ED3A 1BC6A 3OLBA 1BG3A 3NNAA 1S3XA 1HMVA 5CZ2A 2E6LA 3CCTA 1U1RA 1UAXA 1GQEA 2XLKA 3O1LA 1WN7A 4ED1A 4BRKA 2WBMA 2HFSA 5F3ZA 3RVCA 4ZPAA 4USUA 3PM9A 1L5UA 3R5BA 3WQPA 3OYAA 2ROGA 1NSKL 3MMJA 4OKKA 2BE2A 1Y0HA 3SEOA 4JI1F 4RR5A 2ZC3A 1DARA 4LR7A 2HBLA 1JCFA 2A41A 3I8DA 1O5JA 4AXIA 4B9UA 3FSYA 4F2RA 2E5LJ 4C0OC 4KTWA 2IYGA 1FKOA 1NSPA 4OZLA 1BA0A 3CO0P 4WFXA 2V7YA 4ECYA 2CJXB 1RBOB 1FRXA 3PR5B 2ZJRL 2YBVA 4CGDA 5HBMB 4N8NA 3DU6A 4B3RJ 4EO6A 4HT5A 3QAEA 4QIEA 4MK9A 1FXDA 5KFSA 5AQIA 3MPUB 4NA2A 4DL4A 2EW9A 2D3ZA 4RZRA 1ZPWX 3SSSA 3M1FA 1YVNA 5T7LA 4Y6IA 1HNXJ 3IS9A 2HHWA 5ETNA 5A8KA 4DU3A 2AP6A 1G99A 3K57A 2XZWA 2V63A 3CULA 5DO2A 3R8EA 1QTMA 3CPWM 4PQUB 1J54A 3Q8VA 4O4RA 1S5JA 1P6TA 1NGGA 5CYMB 1EO1A 5IOLA 4WK3A 4D3GA 3DFEA 4LFCK 2DK2A 1K73O 2Q1LA 4TY9A 2BJ8A 4NLYA 1UETA 1I5OB 1KR4A 4FYXB 3EE3A 5FPNA 1EP4A 3UR0A 2Z1JA 3D2FA 1TKTA 4JK8A 5LMUK 2KT2A 2CPFA 1A5XA 4X62K 4E7KA 4ZCMA 4NLTA 2CGLA 4KH4A 3PNIA 2YVSA 2RILA 4ANDA 3J80U 3V5RA 3PCOB 1SS6A 3GBTA 3MEEA 1BOTO 1C2PA 4DTJA 3H2LA 3CMQA 2HHXA 3DXSX 3CCEN 3V6DA 4NYOA 1IV0A 1BLUA 2EFVA 1Q9XA 2Z1GA 4GKKK 2G1HA 2KB2A 2V2QA 4JV2A 1EARA 2L9WA 2OANA 4NZ0A 3CDBA 2QZ8A 3BSAA 2Q2RA 3ZZ0A 3HVAA 4KGMA 2FHKA 4MYTA 1GLJO 3BPDA 4TLRA 4CJQA 1HIYA 2RU9A 1S72N 3I9ZA 3MCOA 3L2RA 4F3TA 3AD9C 5THWA 2EI5A 4DR4J 2NSCA 5AJ3F 3VMFB 4CJVA 1RAFB 2OEKA 4Y2AA 2IRUA 2EWHA 4BREA 3QFUA 3AV9A 4ID5B 4JI5F 2HS0A 4Z4HA 2W7OA 1I6JA 4WBFA 3F9KA 4WE1B 2KM8C 1IKXB 3CJRA 3C6TB 5D0RA 3C15B 5AXMA 2PN6A 2DNYA 5AQVA 2CZ9A 2UZAA 3U1LA 3C46A 3OHRA 4CTAB 1S0NA 1W26A 1FJ7A 3C16B 1HPMA 4OHXA 3WC0A 2OPPB 1Y7PA 3RGIA 4ES3A 6FD1A 3DLRA 3H6EA 1K73T 2C42A 2VQFJ 3CF5Q 2UUAF 1H72C 3LDLA 2PE8A 5BRFA 5ADZA 4WPAA 4XH5A 1N5VA 3P45B 4M3ZA 3S1TA 2W7AA 1LEOA 3GP9A 2QGFB 3L7OA 4FWQA 4F4YA 2PYLA 2PFDA 3A3PB 2GX8A 1WSFA 1RWVB 5AQTA 4K5SA 2XS2A 8RUCA 4Y0FA 3S41A 3MM6A 4I9QA 1VRUA 4GVEA 2G2ZA 3AOCA 5M2UA 1FF2A 4DU8A 1CULB 4KHPF 1XI1A 3SFUA 4CIGA 1VQMN 1O51A 3FJ2A 4H4MA 5CR4A 1ULRA 1AUDA 2XY7A 3FZKA 4LF4K 1UJ6A 5LM7E 4MLHA 4E1MA 2AD9A 1RT4A 2W9AA 3K89A 4TVAB 1N5QA 2E1RA 4B9NA 4USVA 1YJNN 2ZC4A 3BN4A 4I68A 3ZZUA 3F73A 3MM9A 3M8PA 3PHTA 3WUHA 4B9VA 2DPJA 3G2XA 1UVLA 2DNOA 1PYSB 4BGAA 1KD1O 3K5LA 1IR1A 5E3AA 1YJTA 3G86A 3KJFB 3EXCX 3GFXA 4EZ6A 1RDWX 4BRFA 4H54A 4WXWA 3NVKA 1Y9OA 2AHOB 3KMSA 2LFVA 1X5SA 3R2DJ 3N28A 3SMSA 1VJQA 4FLYA 4FJNA 1Y3JA 1ZZNA 1PIEA 4DCHA 2XZTB 2LU1A 2ZE2B 1U26A 1N56A 5J1EB 2BXJA 5LMNK 2YKMB 2XQCA 2JOQA 2DY4A 2JRSA 1YXQA 4CZKA 3I82A 4GKJK 3D3BJ 4B3RK 3M8WA 3W65A 4QWDA 2HK3A 3KKSA 2HMPA 3AVBA 2QMXA 1NPPA 3A8YA 1TTHB 1SUQA 1NK9A 4M1KA 3LW5C 3M2VA 5H9EJ 2C2MB 3QMLA 2I8EA 5FLXU 4JV5F 1R7IA 1RT7B 4M5JA 4N47A 2H1YA 4UQTA 2ZHBA 1M90O 3DXKA 3THWB 2XC9A 3THTA 4F3OA 5HLFB 3R3LA 2FGCA 1H38A 4EK2A 5B09A 4ZCKA 4QR2A 4DLGA 4F4AA 4OX9K 3I5CA 1WOPA 3HI0A 2IJFA 1L3VA 2Z30B 3EX7B 2GELA 4CLZA 3MR2A 3QQCD 2AWZA 1R8PA 3P5JA 4WFZA 3OVAA 4R0JA 3VAIA 3I96A 3NHGA 2HAFA 4Q45A 2ZZTA 1X5OA 4W5RA 1AZSB 1BQNA 3UNYA 4OMFG 1NH8A 1BGXT 1GTEA 4DN0A 4FVUA 3MMCA 2B9XA 2C3OA 3QEIA 5D4LA 3R6LB 1XMBA 3MWTA 3KK7A 2OUGA 2RIJA 5KQDA 3THYB 1RABB 4N5SA 4WFYA 2JSXA 4PKGA 4QS7A 4DUYK 3BY5A 3FCVA 4LSNA 4NEYA 4O44A 1WEXA 3DI6B 3U9DA 1QM9A 4KY3A 2XWXA 3SAFA 2ZBQA 5GADI 2IC3A 1RWMB 2XYPB 3PIOL 3VA0A 1UA0A 4OYOA 2O1PA 3VOVA 3V1QA 2YXLA 4U8YA 3BH6B 3OXFA 4DHYA 5BN8A 5JVGQ 4LF4J 2QWRA 4H4OA 4Y2IA 2J7WA 1FKAF 1VRTA 2FF6A 2CNKB 3TQEA 4EFHA 1HNWF 3BV8A 3CC7S 3SQOP 4ECRA 3CD6N 1HJRA 1LWCA 3U8XA 3IO1A 1QS4A 4CIEA 4DX6A 2H5EA 5ITHA 5CCMA 4R5PA 4QYZK 3BGFA 4WYBA 1WC4A 1GAOA 1IBLF 2IGIA 2QA4N 1K8KB 2HHTA 3P6YC 1TV6B 1VQ7N 2LEAA 3MDQA 1P1LA 4C23A 2LEPA 4DL7A 3A0IX 3D6MB 1D1UA 3SQ2A 5KFZA 4I56A 5KG1A 3L8BA 1RHMB 2J0SD 1RHJB 4NLGA 3IUCA 3JQKA 4CI6A 2A1RA 2PD1A 4CJ7A 1F21A 2XG8A 4CZEA 2RAQA 4DCOB 3MURP 4K5RA 3IG1A 1U0HB 5J1PA 1GX6A 3CB4A 2IPOB 4ZPWR 3O8WA 4H0OA 1VMBA 3TAMB 4DTNA 3FEZA 5KT3A 5I3UB 2UVVA 4JI6K 5FDLB 3QT7A 1T3OA 1LKZA 1RDCA 4JKAA 4BR0A 1WSJA 3W62A 3PRVA 3GIMA 1WD6A 5ETOA 2HMIB 1WG5A 1YBUA 2GJFA 4IG0A 2DEJA 2WONA 3NS7B 1B7FA 3HFZB 3HBTA 9ATCB 2IMOA 2Z8QA 2FZKB 2D69A 3B8HA 2AZ3A 3ZETB 3Q23A 3B4DA 2AJ1A 3H2UB 1WEYA 3HSCA 3VALA 3OA9A 2JLEA 2OIHA 2N7YA 4CFCA 4CFAA 2OPRB 2XY8A 4JI3K 4WKYA 1X7VA 2APOA 2HWHA 4LSZB 3RBXA 1F5BA 3KG0A 2JNJA 3MX2A 1QUVA 2J9DE 3TZZA 1H0HB 3Q83A 4B9SA 5AQRA 3J81j 4QU6A 1HW8A 3OFEA 1YZ7A 2M3DA 3CE8A 1T7PA 4IOAL 3QZ7A 2DJWA 5KFTA 4J9OA 3RMCA 1HRHA 3MTKA 2YQ1A 3VTHA 2IVFB 4MJKA 1HBNA 5AZIB 2GVZA 3SSRA 2ZVSA 1AFIA 4X64K 5IZHA 4J9LA 1TP7A 2ZGYA 2XMWA 4KI6A 5T7LB 4ZDNA 3HJVA 4AQYF 4G3IA 2ZH3A 5EWGA 3IR6B 4XK8C 4DHVA 4LFBK 2A42A 3MUTP 4CIOA 5A6PA 2ASPA 4FS1A 2YX4A 4CERA 2AW0A 3A8EA 4CZMA 4O3SA 3BGRA 5LMUJ 3NGUA 1PAEX 4CZFA 1UJ4A 1WF1A 4HLBA 2OFGX 1R8HA 3ETMA 1PCAA 5D6GA 1V5IB 1E3MA 2V4QA 3F44A 3HL8A 2IC3B 3TAEA 1S6PB 3M8QB 2NSBA 2DBBA 4K4WA 5GAEP 1Z25A 1MLAA 4DV3J 1Z2LA 1HNZK 4K2JA 3TNVA 1XQIA 5GIPA 3WBZA 1KFSA 4Y34A 5K20B 2A6MA 1VLOA 1H7WA 1JXLA 3UQSA 3D28A 3CIPA 2J7KA 1WBBA 4I1TA 1ZBHA 2C2EA 1TAUA 3OTBA 3HT0A 2W24A 5FDLA 3GQCA 4FJ8A 1P1TA 2IBKA 3K58A 1VQOS 1REVB 1SJ3P 2NS1B 2JZ5A 2UXCF 1FI4A 4LFBF 1IBLK 1TK5A 4EEYA 4EAHD 2IIHA 3BZQA 5AQLA 1WSGA 4NXNF 1SC3B 4O23A 1X0FA 4CJ4A 4IFVA 2OLWA 3K17A 4JNEA 1FFSB 2G8HA 5F8MA 4CJ3A 3GIJA 4J91A 3KNAA 5C2FA 1CVJA 1OSCA 1LWEA 4GVBA 1HNWK 5IT9Y 2PO4A 3M32A 1U7LA 3OYIA 4IDKA 3TQ1A 3VQ8A 2VQFK 4PQUA 2D3OR 2J0WA 3HT3A 2DRAA 1V9OA 3C6UA 3WEEB 2ZOMA 4CE9A 2OZSA 4Z7CA 1GEHA 1N33J 2D9PA 2XMVA 5DJBA 1N5TA 2W8LA 2YX7A 2ZWPA 2Y8YA 3AVKA 1XEZA 3MM7A 3VQAA 1WJ9A 2MZSA 5M2PA 3RBDA 1BWVA 4J2AA 4C8ZA 3AVMA 1ZM4A 1IBKK 2P9NB 4ICLA 2UV8A 4ZP8A 2H48B 1IJFB 3U27A 3J7Z5 3AXKA 5KG4A 2AQ4A 4LFCF 3M5RA 3NCQA 1LK5A 3NMAA 1IJEB 3TEGA 1JLBB 3THPA 3U1MA 1T6CA 2KYZA 5AQPA 4HTIA 3OW2R 4OPHA 1NRKA 3S9HA 3SBTA 4K25A 2P9KA 1U2CA 2WTFA 4OJRA 2RUGA 2HSEB 4OZNA 3GV8B 1HHQA 4FKXA 2AYBA 2ASOA 1WOQA 3MTJA 3X1LB 1ZBLA 4JI0F 3FVYA 1SL2A 4BRDA 2F8TA 4FCYA 3BB5A 3F2KA 3H7HB 3CT9A 4GMJB 2HHQA 2D7SA 3VAMA 2IAJB 4RUHA 1TKXA 1H73A 4X66J 4XH1A 5BXIA 4QIGA 3R5AA 4WIIA 1YX2A 3A5OC 4CHPA 2MQPA 2KXNB 3SQ1A 1FWLA 1R89A 2H4WB 2KXHA 1HI0P 1TL7B 3HFKA 2NLXA 3MXMA 1RTIA 2N7CA 4FWLA 5C7PA 5F2RA 4QQBA 1LK7A 4F26A 3SDEA 3KDNA 3S8SA 3D9BA 3EDRB 4B9QA 4IKFA 4IH7A 3EKUA 2EBEA 1YQHA 5IWAK 1RBAA 1RDRA 3NAIA 2QA1A 1K9MT 2FJVA 4XAKA 4CEOA 1HBUB 5J2NB 1RU1A 2NRVA 4YHHJ 1W25A 3CCSS 4FLUA 3QMQA 3M2RB 2XYGB 3MZIA 1H3DA 3H5YA 3PXGa 1HBMB 2SXLA 3TTDA 4B1YB 2JWNA 4Z7YA 5ELZA 4OPKA 3CCRN 2J76E 2VDHA 3DRYA 4TY8B 5KFPA 4C3LA 3ENAA 1SB6A 4ECVA 2FJEB 3ZX3A 3Q2TC 3MR5A 3VQ7A 4CD3A 3QT6A 3PDNA 4LUBA 1WC3A 2O4IA 3CNQP 4DFJA 3O1WA 3HVRA 3IRWP 5HP1B 5LMNF 3UO0A 1A5WA 1EETB 3MECB 3TRGA 3MFHA 2G13A 1PBAA 3MUMP 3VEVA 1U6BA 3DDIA 5KT7A 1XC9A 5KPTA 2AYEA 2XZDB 1E6VA 1HBOA 2Y9HA 4PG6A 2ASDA 5DQGA 4UF4A 3VQ5A 1U1OA 2R8GA 3DMJA 4BC7A 2Z58B 1Y5IB 4X4UA 5K8MA 3O4NA 2OZMA 1IBKJ 1M5VC 3PIPL 5GMKa 5KT4A 3OD2A 3O8MA 4DF8A 3SI8A 1EXQA 4YDDB 2ZE2A 1VR6A 1UPMB 2W1BA 1F3FA 3CC4N 2LDIA 4HCCA 2XSJA 5HROA 2AIRB 1IXKA 4LF4F 4XEIA 4TYAA 5KG5A 3N4PA 3WXLA 3GR0A 4CF9A 1O1WA 4K0KJ 3OBWA 1CULA 3D0IE 4AXJA 4JKEA 2BJ1A 2MQOA 4PXBA 3L2VA 1F6TA 3N6LA 3FMBA 4CJSA 4OYXA 2BACA 4AHUA 3SUOA 3RBZA 3PVXA 4OZ2A 1FXXA 1RKJA 1G7CB 1S49A 1DKGD 1KHVA 2V0NA 2LSNA 4PY5A 1TL4A 3DDKA 2VQEF 4M5IA 1WC5A 1N36J 1FTRA 4TU8A 1LW2A 2KH9A 3SJHA 3J7AN 3DN9A 1CSJA 3SMPA 4K8XA 1VSFA 3PACA 1VJWA 5E84A 3CC2S 3TVKA 1Q81T 1RHRB 5AFUA 2NQPA 2FYXA 2GHVC 4FBUA 2CWXA 2NZ4A 3CCMS 4LF9J 3WXJA 1YBTA 2RS8A 1T0TV 1HNXK 2QG9B 3PSIA 4ENOA 3O2IA 1W7AA 3KK2B 3Q24A 2NRTA 4I7FA 1SH0A 4FPRA 4C11A 4LRFA 3OYJA 1FRKA 2VJVA 2UUBJ 3CEDA 3CFRA 2DH9A 4H0XB 5B0CA 4X64F 3DGVA 3QESA 3R97A 5T41A 4C8MA 4OX8A 5I3PA 1NU0A 2DHHA 4CK2A 3CDWA 3H8YA 5KPZA 5KG6A 3J7ZT 3QGHA 2YX6A 3OUYA 3DKDA 3QFWA 4FXDA 3PO4A 3HZGA 4X62J 3Q2SC 3ONQA 4B3MF 4B3SK 5HVHA 1U04A 1FDDA 1S1TA 5FRNA 3BKFA 3R5CA 2LKZA 1R0AB 7AT1B 3SUQA 1QVGR 1M1KT 5BYRA 5HAOA 2FVSA 1JX4A 5KFVA 2BBEA 5HMWA 1U47A 4W5TA 4FJ5A 2HMIA 1NGAA 4FJGA 3QIPB 1M90T 3JSYA 3OTEA 4FYWB 3CHWA 1K8AO 1K8AT 4FLXA 4ZP6A 4USWA 3GFYA 3MM5A 4CYUB 2XRIA 2A10A 3CQYA 3CJSA 3BSCA 1VQLN 4FK2A 2J6TA 4YP3A 3IP0A 4LFCJ 1N6QB 2PYJA 4B8AB 1B0VA 1QE1A 2UVRA 1J27A 1RDUA 3T1YF 3C7NA 4IOBA 1RBTA 1WC6A 1FKPA 3TYTA 5DM6Q 1CS4A 1IBCB 2VD3A 1MU2A 3KOAA 3SMZA 1C0MA 3M8ZA 2UXDK 1U25A 1B4SA 4FJ7A 1NGJA 3P5BP 4BRCA 1WOSA 1IKXA 3RW6A 3VEOA 1FHTA 3RB3A 3ZSRA 4CZIA 1U1LA 2VFUA 3OS1A 6FDRA 2KHDA 2XTJP 2GV9A 3M2VB 4RW6A 1IKVB 1GXTA 2EXUA 1RTDB 2I2YA 1Z6RA 3T3FA 2WW4A 1RT5B 2A3JA 2OP5A 4DR2K 2AA4A 1LAVA 1VSIA 2UU9J 2B4UA 3L9ZA 4JKBA 2PT0A 5AXKA 3GSDA 4PHTX 2H3EB 1WF0A 4E89A 1WHXA 2OKQA 4J2BA 2YQ0A 3LPEA 2NYHA 4FL9A 4M5GA 1W2BR 2G2YA 1NSQA 3PZPA 4CGIA 4C1NK 3HK2A 3V81A 2P9IB 2C2NA 4LF8F 1FNMA 1XBWA 3M9NB 1OY9A 1L3TA 4OHYA 3OY9A 4BLGA 3RSEA 2ZH2A 3T1YJ 3IGNA 2NPIA 1RXOB 5F8HA 1GTHA 4B1UB 1LFWA 3NGDA 2PGCA 3IAM9 1V4SA 2KO1A 1QVGM 3VQ4A 4RX6A 2FD2A 3BKTA 1HNWJ 3MM9B 3ET6A 4E3SA 2W4PA 2F4VK 2F63A 2QFIA 4JKCA 1QAJA 2DT9A 3AVFA 3DOLB 5ETSA 5IFMA 4EP5A 4UZBA 3AA5X 3HVTA 2CQPA 3MCPA 4JI1J 1S6UA 3B6BA 3AB2B 2XI3A 5DRKA 1HQUA 1VRQC 1RA6A 1Y3KA 4DV6J 4F4WA 5L39A 3P1GA 1XWLA 2GVDB 2FC8A 4DQ8A 1RCXB 1RUSA 2NXEA 3Q8SB 2LU2A 3H98A 4NCGA 1RA7A 3HD1A 2PFFB 1TGOA 1TR0A 3W5ZA 2L3MA 3AB4B 5HSPA 4BDZA 5I9EB 4JP8A 2HBQB 4ED6A 2I38A 2VKZG 2Z2MA 3K59A 2PC6A 3CJ1A