3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
molecule tags Transferase/dna
source organism Human immunodeficiency virus type 1 bh10
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
3H4BA 3MECA 1T05A 3FSIA 4RUAA 3BQ1A 3K2PA 4GMJB 3UR0A 3VQ7A 4CEDA 3KJVA 4WZQA 1Q9YA 1JL1A 1Q9XA 4DFPA 4MFBA 3CVKA 1IKVB 4B8AB 4JLHA 2E4LA 1SH3A 4KI4A 3RB3A 2Z1GA 3AO3A 3ICLA 3ALYA 2KW4A 5F8IA 1S9GB 1W25A 3NGDA 3TABA 1ZTWA 3HVTA 5JS1A 5KFNA 1RT5B 3V4IB 4F2RA 4E1MA 1NKBA 3GYNA 1IKVA 4FS1A 2J6UA 1RTJA 1L5UA 4EBDA 3H5XA 3DOLA 3IGVA 5EDWA 4URSA 4IKFA 3RR8A 4QCLA 3QNOA 1EKEA 4FZYA 2GC8A 1FKOB 3I0RA 3DRSB 4IOBA 2XWYA 1HQUA 3KK1B 4J9QA 1VRUA 3QIDA 2VG6B 4QWEA 1HPZA 2ATQA 5DG8A 2YKMB 1NJWA 3N6LA 1JIHA 2QKBA 4E7HA 4F2SA 1L3UA 4RW9B 5D3GB 3ZSRA 4JUZA 1LW0B 4B08A 2C2EA 1TP7A 3DM2A 1QHTA 3IG1B 2HWIA 5HP1A 2O5DA 1JKHA 4CCHA 2ZQBA 3SUQA 5J2MB 1C0TA 1NK8A 5E41A 3V9UA 1BQNB 4ED2A 4MIBA 4Q8FA 3TAFA 5KT7A 4FXDA 4IH5A 3HP9A 4CHPA 4E89A 3K5LA 3KD5E 4X2BA 4KHNA 3DLGA 4J9PA 3ISND 4KAZA 3D45A 3PHEA 3KLFA 3DRPB 2IM0A 4CHZA 3WNGA 4LQ9A 4B9NA 1B9FA 4IG0B 3QGGA 2HNZB 3KOAA 3ZSVA 3NHGA 1FKPA 5KG4A 2RKIB 4YMEA 3NFAA 4FLXA 2NUBA 1RDBA 3MTKA 2YNIA 3SI6A 4M3UA 1JLBA 3HPGA 3GV8B 4NLDA 2EC0A 4AHVA 2BE2B 2W7PA 4O44A 3V6KA 5KFUA 2XRIA 4RNHA 5KFSA 1RT6B 4ZVHA 2OPQA 2XGQA 1VSFA 3DLBA 3NDKA 4IBNA 1DTTB 3G86A 3AVCA 4DF8A 4CHOA 4RUCA 1WSGA 4ECRA 5EUHA 4ZP9A 1ZBHA 1WSIA 2RDJA 2PZSA 5F8MA 2R7YA 3DYAA 4K4VA 4YP3A 3Q8QB 2CKWA 3OL8A 5FROA 2D3UA 4YNQA 2YNHA 4K4SA 2IA6A 5F8NA 2XC9A 1CLQA 3NBPA 1TAQA 4GW6A 3CFPA 4CJVA 4N5SA 3LPTA 3OLBA 5HROA 3KLHA 3ZSYA 3DDKA 3O4QA 4CF0A 4FJ5A 3DRRA 2YNFB 2GV9A 4ECZA 3T19A 1J5OB 3KK2B 5KFVA 4ECTA 4OGCA 4F8RA 4YR2A 4XIUA 3DRPA 1C0UB 4KE5A 2BDPA 4GVMA 5CYQA 3LZIA 4TLRA 1HNVB 3UQSA 1QUVA 2JEGA 3AVNA 4NLVA 5KFEA 1RT5A 3V4IA 4CGIA 4C8LA 1D8YA 3IG1A 1NKEA 3RB6A 1DTQB 3Q8SB 3AVGA 3OYLA 4RW7A 2IOCA 3G6XA 2ZE2A 4PWDB 2WB4A 2WK4A 1Y97A 5DG9A 3PY8A 3H5YA 4RU9A 4G3IA 4ZPCA 3KLGB 4CGFA 3SUPA 2IMWP 3OYFA 3NH1A 3HO1A 1VSJA 4IFVA 2HMIB 2ILZA 4O3OA 4JV1A 2AX1A 4CF2A 5KFYA 2OZMA 3M9NB 1EP4A 5SWMA 4BE0A 3DOLB 5KFMA 2D0AA 2HHSA 3T3FA 1TKZA 3DOKA 3PR5B 5C25B 3TAEA 2FBXA 4XPCA 3NF8A 1SL1A 1KHVA 2XI3A 4KB7A 1VRUB 4NYZA 3TAQA 3EYZA 4FJLA 5J2PB 2JC0A 1ZBIA 5KT4A 4DG1B 1KTQA 3VA0A 2AX0A 3M8RA 4WXWA 1QSLA 2HB5A 3KK2A 2OA8A 1R0AA 3KKSA 1WSJA 3M9MB 3M8SA 2YKNA 4F4ZA 4CFBA 4E1NA 4R0EA 3NMAA 3TAMA 4Y1DA 2UVUA 3PX0A 2WOMB 4U6PA 4J9LA 5CZ1A 1S10A 3QZ7A 3CM6A 1TK8A 4EP5A 2G8VA 3QIPB 2BQ3A 3SCXA 4OL8A 2JGUA 2KZMA 1XR7A 4HUEA 1TL1A 4ED0A 4BDYA 4FJJA 3ZT3A 4FLTA 2OPQB 4WE1A 4HUFA 4KKOA 2BQRA 1ASWA 3QEWA 4NLQA 1S6QA 4R5PA 2I5JB 3VQQA 3MEEA 5JS2A 4FJKA 4CJ3A 4ZHRA 3PO4A 3DLRA 4J2AA 4CIFA 3KLGA 1O1WA 3RAXA 3FRZA 5L1IA 4RNMA 4CJTA 1K6YA 3VQ4A 4K4UA 4ZVEA 4MKBA 3PO5A 4FS2A 4CEBA 3L2VA 1JXLA 1N5YA 1T94A 4NLOA 3ZSXA 4HHTA 3GQCA 1KRPA 4CEQA 4NRTA 4Z4GA 4QWBA 5HROB 3OYAA 3GILA 4MK7A 1JLQA 1UWBB 4CIGA 4CJ5A 1B9DA 1W0HA 2VG7A 4U7CA 4Q44A 1S48A 5KGXA 1B92A 4CESA 4OLAA 5KFHA 3GIIA 4B9MA 3ISNC 4NLWA 3OS1A 5DLFA 2EX3A 2RF2B 2E6MA 1UA1A 1S4FA 4DTSA 4FJXA 4AHUA 4FZZA 4K4XA 1ZYQA 4M3ZA 4CF8A 5HRSA 1TV6A 3PW5A 1J53A 3KLHB 1LW2A 3SFUA 3AA4A 4B9SA 2VG5B 4JRPA 3HP6A 2J6SA 2VWKA 2R2UA 4EZ6A 1X9WA 3VQCA 4RW8A 2ZE2B 4OGEA 3OYJA 2PYJA 3BGRB 2W42A 3HHKA 4J9SA 2Y1IA 3QEIA 3G6VA 3M8QA 1G15A 2GUIA 3TR8A 1KLMA 2E6LA 3SZ2A 1IG9A 3VQ8A 5F9NA 4K4TA 4W5NA 4DL7A 2QKKA 3PZPA 2IJFA 3BSCA 1LAWA 4O3QA 3KK1A 4I2PB 5J2QB 5F9LA 5KFFA 2KFNA 1NHVA 3H5SA 4KHMA 1KFDA 1XC9A 3KTQA 1IKYA 1REVA 2D41A 4O3SA 3V81B 4WFYA 2W9CA 4F3OA 4W5QA 3BQ0A 4LSNB 3RRGA 1WLJA 2AQ4A 4ECXA 3CJ2A 1RTDB 1EX4A 3C6TA 2D3ZA 4EO8A 4FBUA 3DLKA 1Q8IA 3AVBA 4WE1B 2FVPA 1BQNA 1S6QB 2ZKUA 1S1TB 4CHNA 4H4MB 3NL0A 3HVRA 1S1WA 1RDRA 1LAVA 4ED1A 3LP2A 5F8LA 4DF4A 4M94A 1RT7B 3PJWA 3NGIA 1L3SA 2F8TA 4J9KA 3PW4A 1S9GA 4NYNA 3CFRA 2UUWA 3OY9A 1WN7A 2XY6A 3V6HA 1IO2A 3AA3A 3OYHA 3AA5X 1HYZA 3PVXA 1C6VA 4KTWA 2HNDA 3HVAA 3MEGB 3RWUA 1JXBA 4CEEA 1N48A 2F96A 3AVIA 2E9TA 1IKWA 1SKWA 2BANB 1RAJA 2HAIA 4RG8A 3T5KA 4ICLA 1L3TA 2VG7B 4DSJA 2HVHA 4Z4FA 4J2EA 3AVMA 2DY4A 1TKTA 4FJ7A 3MXJA 3H4DA 3T5HA 2YKMA 5DQGA 1S49A 4FLVA 4FJHA 4PUOB 4KV8B 4KFBA 2BQUA 3KLVA 1JX4A 2AGOA 3HKWA 2QV6A 3KKRA 2IC3B 2YHAA 4QW9A 1NK4A 1RTIB 1DLOB 3CYMA 3CWJA 5KFWA 1RT2A 2WHOA 1K1SA 3FDSA 3I8DA 4QWCA 2V4QA 5I3UA 5HBMA 3IS9B 4GC7A 4ELVA 4WZMA 3G6YA 1T05B 4JS5A 3MR6A 3DLHA 5DK5A 3U3GA 3PX6A 1S1UB 4ZMMA 1FKOA 4TSXA 4KHSA 3I0RB 4KO0B 2LSNA 1RT3A 3O4NA 3BGRA 3NCIA 1F21A 3MXMA 3QNNA 2RF2A 1FK9A 5L9XA 3DRRB 3EZUA 4B9VA 3L2WA 1ASUA 4FLUA 3OYDA 4URGA 5DG7A 4DU3A 4CEAA 4ECUA 3JYTA 4NLYA 1WSFA 1QSYA 1NJYA 4B9TA 4LSLB 1C1AA 2HNYB 3DLEA 4LH5A 1J9AA 3OYKA 1BI4A 5JUMA 4OJRA 4KBIA 3MR3A 1C0MA 4K8XA 2IGIA 1RCHA 4AHTA 1IKXB 1EETB 3OSPA 3MFIA 1A5VA 3I5CA 3DLGB 1XHXA 1VSKA 4DTJA 3DLEB 1U48A 1TL3A 4MK9A 4O5BA 4Q0BA 5KG5A 2QXFA 4NRUA 4KAIA 4FM2A 3QLHA 5L1JA 1D1UA 2RKIA 4I9QA 3C95A 2R8GA 1NK9A 5FDLB 4DL3A 2OPPB 5HP1B 4CJRA 3SQ4A 2IM1A 2W9AA 3UDLA 4IFYB 5C42B 3CDUA 1RTHA 4JV0A 1HMVB 1RDAA 5KFCA 2WONA 4H4OA 4TXSA 1RTDA 4K4WA 1HPZB 4DTOA 3MEDB 1JLEB 4EEYA 1U49A 4M3XA 1JLGB 3THVA 5T7BA 3SPYA 3AO1A 4RNOA 2D0CA 4FBTA 3OYCA 3DM2B 4FJ8A 3LP2B 1HQEB 1NNDA 3H40A 2X6SA 1SUQA 5K14B 1JLEA 3ZSWA 4HCBA 1S9EB 3AA2A 4Y3CA 3SQ1A 4TQSA 1WAFA 5DLGA 4DTRA 1YVUA 3LP1A 4O0JA 5KFIA 1VRTA 1N6QA 1C1CA 4J9MA 3BR9A 3TWHA 4M3RA 4EP4A 1JLAB 3CDWA 4ED3A 4O4RA 2BANA 4ZP8A 3RR7A 3NH0A 4W5TA 3KMSA 1U4BA 5KFAA 3V9WA 3VQPA 1LWFB 4RW4B 1C1BB 2F8SA 1XR6A 2XY8A 4CHYA 4F50A 2XCPA 4KO0A 4N76A 4ID5B 1S0NA 3LAKA 4FJMA 2R2TA 3IRXB 2IDOA 2FVRA 4N56A 2ATLA 1SL2A 3RAQA 1HJRA 1VSDA 2HHXA 5SZTA 4IH6A 4DFMA 2KQ2A 2YKNB 1KLNA 4IR1A 2FLNA 1ZBUA 1RT2B 4MIAA 1BHLA 1U47A 4J9RA 4DTUA 1MU2A 4RNNA 4YFUA 5KFPA 5JXSA 4QWAA 1TQLA 2VA2A 4F4KA 4CJLA 4FW1A 1SKSA 4KPYA 1EXQA 1XWLA 3SUOA 1VSHA 4Y2CA 4DL5A 4R8UA 3IAYA 4PY5A 3DMJB 2Q3SA 3AVAA 3RRHA 4FCYA 4KKOB 5KFXA 4FM0A 2DTUA 4J9OA 1D9DA 1QAJA 4CGJA 1HYVA 3PJXA 2IC3A 4CF9A 1NK0A 1YVFA 5KFKA 1IM4A 3TAPA 4CJQA 1D0EA 1MMLA 2ASJA 1QQCA 1N56A 4DSIA 1TKZB 3RB0A 3DOKB 2X74A 3S3MA 4F3TA 2AGPA 3ZT4A 2JEIA 1HMVA 1TKDA 5J2NA 5C24B 2AJQA 4PQUB 2PYLA 5DGAA 4CJPA 3HXMA 5CYMA 3MECB 3NF6A 3KK3A 3DI6B 1FK9B 3AV9A 2XGPA 2B43A 4FW2A 3MEDA 2FLLA 3CIZA 3QLHB 2W8KA 5L1KA 3ZSOA 2XY5A 3WNFA 3TAMB 3PR4A 1HQUB 4O0IA 2KTQA 2IAJB 3GIMA 2OPPA 3JSMB 2WOMA 2D5RA 2R8HA 2VG6A 4AHRA 4B3OA 5FRNA 1VSEA 5HRNA 5C42A 2W9BB 1WNSA 3QEVA 3AVHA 4IFYA 3VQDA 3O3HA 3OYGA 1RBTA 2BGGA 2X6NA 4IQXA 2UVWA 2UVRA 1RTJB 2YNIB 2I1RA 2OPRA 3TQ1A 2G8HA 1IKXA 1EETA 5EU7A 3ZT0A 1RILA 3Q8PB 3S3OA 4RW6B 2D7SA 3OS2A 4DU4A 3EY1A 3K58A 3UIQA 3V6DA 1Z4UA 1NK5A 3KLEB 4URQU 1GOCA 2BRLA 3MAQA 4TY8B 4N47A 1TKXA 1ZTTA 4MFBB 1LWFA 4RW4A 1BCOA 3EZ5A 3RMDA 3GIKA 3P83D 3VQEA 1HQEA 3FQKA 4CE9A 1N5YB 1YTAA 4QAGA 1SL0A 4H8KA 4TY8A 4I2PA 4TQRA 3LP1B 2OZSA 4TY9A 4NLXA 4LY7A 4IG3B 4FJGA 1RT1A 1C1CB 2UUTA 4XO0A 1S6PB 1C0TB 3NAHA 2FVCA 2BE2A 4C8NA 4Z4CA 3FFIB 3ULDA 3MEGA 5DQIA 3G10A 3ZT1A 4I9LA 4O4GA 3DLKB 2C2RA 2C2DA 4QW8A 3QETA 4KHYA 2RN2A 3OYNA 5HRRA 3D0PA 2E9RX 2ASLA 4NCGB 3OJUA 4KTQA 2BR0A 3H08A 2P5OA 1BGXT 3SJJA 5CY4A 1C0UA 4DS5A 1UAXA 1VK0A 3AVFA 3K5OA 4CHQA 4G1QA 4MH8A 4RNFA 2DFEA 2W9CB 4KHUA 4Y2AA 4IR9A 2VA3A 4DFJA 3AO2A 3KNAA 2GBZA 2G8KA 2B5JB 2C22A 5KG6A 3MR5A 4DL6A 3B6OA 1BCMA 3RTVA 4ZPBA 3V1RA 3IRXA 5C5JA 3ZCMA 3KLFB 3M8QB 1VSMA 1SH2A 4BWMA 3N6NA 1S1WB 3HK2A 3IGNA 3HSTB 3TI0A 3KHRA 4M45A 2J6TA 4KRFA 3K5MA 4FM1A 3KLIA 5EWGA 1UOCA 5KT6A 3C6UA 2AGQA 4KHWA 3OL7A 4EZ9A 2V0NA 4J9NA 1KHWA 4DU1A 3I0SA 4BACA 1CXUA 4TYBA 2W8LA 4PQUA 4KHRA 1WSEA 4Q8EA 5DGBA 4W5OA 4ELTA 1L3VA 1S1TA 1JL2A 3OHBA 2OPSA 3NGYA 2XHBA 1S1VA 3HVWA 4FLYA 4NCGA 4CJWA 1HNVA 5J2MA 1NOZA 4CJKA 5KFLA 3PW2A 4FLZA 1KFSA 2YNHB 4ECVA 4TYAA 1RT6A 3CQ8A 4J2BA 4DWIA 4IFVB 1T03B 3LP3A 3T1AA 5KFGA 2IM3A 5EWFA 4CF1A 3K59A 4W5RA 3ZT2A 4LSLA 1RT4A 1ZETA 4L8RB 3CO9A 3VN5A 4DFKA 4ED8A 3SV3A 4RW6A 3BDPA 4CFAA 2P5GA 4NZ0A 4NLPA 3KLEA 1S1UA 3S3NA 1TKTB 3TAGA 1UA0A 2HHVA 1T3NA 2WONB 4H4OB 1OS5A 3OJSA 1TK0A 4Q5VA 3QEPA 2OYQA 1BIUA 3O3FA 4R5PB 4IDKA 4J2DA 1RDDA 4YR0A 5L1LA 3PW0A 1BQMB 2DPIA 2JLEA 1DLOA 1CXQA 2HMIA 4O55A 1NJZA 3P1GA 1U45A 5KFTA 2IM2A 1RT1B 3BSAA 1S0MA 3C6TB 2RPIA 1S6PA 4KB0A 2R8IA 5KT3A 4AHCA 3ZSZA 4DLGA 1NK7A 1D9FA 3AO5A 4E3SA 3D28A 3L2QA 3NF9A 3LDSA 4HTUA 2KFZA 2P1JA 3CFOA 5T14A 3OVNA 1JLAA 2HHQA 3V6JA 5KT2A 3CG7A 4I2QA 5J1EA 1ZBLA 5F8GA 4KFBB 3MF5A 3H2LA 3CJ3A 4M42A 1C2PA 2R2SA 3VA3A 1SV5A 4OPKA 2GIRA 3GIJA 3OL9A 3NF7A 3RBDA 2DFFA 3OS0A 4G1QB 1QTMA 1I39A 4HCCA 4BE2A 1KCFA 4I2QB 5J1EB 5HBMB 1U04A 1NHUA 3CJ4A 1RBSA 3S9HA 3HYFA 2FVQA 1T03A 3K5NA 1HNIA 3QIPA 1TV6B 4CJUA 1K1QA 3SQ2A 2E9ZA 2YNGB 2YNFA 1X9MA 2VG5A 1S5JA 4ZPAA 3BSNA 4E19A 4FK4A 1TK5A 1S1XB 4DTPA 4ZP6A 4EYIB 2XY7A 4B9LA 4CJEA 3NH2A 3SPZA 5I42B 2A1SA 4DLEA 2I5JA 4RW8B 1FXXA 2JC1A 3ASMA 3RMAA 1R0AB 4K50A 3NAIA 2FBTA 4HVJA 3LWLA 2FJWA 4YQWA 1S1XA 2FLPA 1TGOA 4ID1A 4CGGA 4IDKB 1ITGA 4BDPA 4EO6A 4CJFA 2XI2A 4CFDA 4M41A 3B6PA 4CFCA 4DQPA 3AVKA 4ZVFA 1JLCA 2O4GA 3HM9A 2AWZA 3T5JA 3TANA 3QGIA 5KFZA 4E7KA 4I7FB 3V81A 1RA6A 3NAEA 3QEXA 3D5MA 3SV4A 4ZTJA 2IBKA 4DQRA 4WFXA 3I5BA 4DQQA 1JXEA 1JLGA 4FK0A 2B6AB 5CZ2A 1XI1A 1X1PA 3UPFA 4R8UB 4NCBA 1RDCA 5KG1A 4CECA 4ECYA 2UVVA 1VRTB 3MXIA 4OKEA 2HNYA 1N6QB 1SUQB 5K14A 1SV5B 4AILC 3RMCA 3MFHA 1RTHB 1HYSB 2AU0A 1NK6A 3L8BA 4OKKA 3E01A 1JLFB 4TN2A 3T5LA 3VQSA 3RB4A 4RZRA 2IS3A 2HWHA 4B9UA 3BREA 1IKYB 5KG2A 4O3RA 4DEZA 3V1OA 2HHUA 1RYSA 5F8JA 5KFBA 3HJFA 2FJVA 4ZHRB 1HYSA 1TVRA 3M8PA 1SKRA 1S1VB 4AHSA 2G8IA 5CYMB 1C1BA 3I5AA 1DTTA 1QSSA 4ICLB 4ID5A 3QGHA 1N4LA 5KFQA 5KRSA 1BQMA 1S0OA 3OL6A 1BISA 4F4XA 4DTMA 4E7IA 3E51A 3LP0A 2YHBA 1Z25A 1RNHA 1FKPB 3BJYA 2G8UA 4ZPDA 3QINA 1JLBB 4IRKA 2ASDA 3EPGA 1J54A 5KFJA 1LWCB 3SYZA 3NBPB 1WNEA 4B8CA 2FBVA 3H98A 4DQIA 4CEFA 2HHTA 1QS4A 2Y1JA 3WNEA 5KFOA 2WRMA 3TVKA 5KGWA 2XCAA 1IKWB 1KVBA 2X78A 3L3VA 3BSOA 4FK2A 1Z26A 4IH7A 4WYLA 5HRPA 5HLFA 4LQ3A 2V9WA 3ZSQA 3NGZA 5J2QA 1ASVA 3OLAA 4Q43A 2FJXA 3P5JA 2HNZA 3KD1E 4O3NA 3VQ9A 4OPJA 4M95A 3AVJA 1QE1B 1WSHA 3HT3A 1JKHB 3SUNA 1KVAA 3QYYA 4Y34A 3ITHA 1RBRA 4OVLA 2JEJA 2JEFA 4Z4EA 1HNIB 1JLFA 4NLRA 1QE1A 1CZBA 1DTQA 3BQ2A 2HW3A 5C24A 2VWJA 4K4YA 3DMJA 5KG7A 4LH4A 1RBVA 4E7JA 2FVSA 2R8KA 4PA1A 5KG3A 4CIEA 1TVRB 3M8PB 3OYBA 4Z0UA 4CK3A 3KMQA 4IG0A 4DSEA 2OH2A 1VSIA 2FBYA 3F73A 4NYFA 3IN5A 1TL3B 1TAUA 3GV7B 2W9BA 4KV8A 4IRCA 3RBEA 3RMBA 2ZD1B 3CM5A 5FDLA 3O3GA 3MR2A 4CGHA 1VSLA 3LALA 4OKJA 1S97A 3JYTB 5F8HA 5KG0A 2ITGA 4M3YA 3HPHA 4ED7A 4NLSA 3C94A 3KK3B 2Z1IA 4WXOA 1KSPA 4M3WA 3OHAA 1GOAA 2C28A 2B6AA 2DFHA 1RT3B 1J5OA 1TKXB 2ETJA 4DSFA 4CK1A 4FJIA 1ZBFA 1T8EA 2GIQA 4B3OB 3VQBA 2IJNA 4NLGA 4KB1A 4M3TA 2WTFA 4DMNA 1JLCB 5DMRA 4ZP7A 4FJNA 3PX4A 4K4ZA 4C8MA 1XHZA 3LP0B 1NKCA 4IG3A 3G0ZA 3FQLA 4Y1CA 3ITHB 4KREA 4N41A 1RA7A 4FVMA 3DI6A 4JS4A 4Z4IA 4KHQA 4KI6A 4RW7B 4E0DA 3OYIA 4CEOA 1S9FA 3V9SA 3CDEA 1HRHA 4XPEA 4FLWA 4EYHB 1BL3A 4JRQA 1NOYA 3JSMA 4PUOA 2BRKA 1UWBA 4BE1A 2KZZA 4ECSA 1D5AA 3QESA 5CYQB 5KTQA 1RT7A 2HVIA 4Q0BB 5FRMA 1T7PA 4F4WA 3PUFA 4DS4A 4ELUA 5KI6A 3KJVB 4GC6A 3V9XA 3WNHA 2WCXA 3H5UA 4QPXA 4HYKA 2OPRB 3OYMA 4QWDA 4LD0A 2Z1HA 2O4IA 3KHGA 2B5JA 3HVTB 1BI4B 3VQ6A 1LWCA 1A5XA 4Q45A 4HKQA 4BDZA 5C25A 4DL2A 3PW7A 3LWMA 2XO7A 3L2RA 4PWDA 3NKYA 3FFIA 1IH7A 1MU2B 4C8OA 2RDIA 2F8EX 2B4JA 3K57A 4UQGA 3SFGA 4BWJA 4CK2A 5DQHA 3M9OB 4CERA 3VQ5A 3KLIB 3C6UB 3KHHA 4F4YA 4NCAA 4ECQA 4DSKA 5KT5A 3OYEA 3IS9A 2FC0A 3LZJA 2ZD1A 3AO4A 3F9KA 4CGDA 3VQAA 1RT4B 1TL1B 4DSLA 5J2PA 4OLBA 3HPOA 3LPUA 4DG1A 1JLQB 4FZXC 1CZ9A 4KTZA 3DRSA 2R8JA 5HLFB 4MKAA 4CJSA 3AVLA 1WAJA 1GX6A 2P51A 4ZVGA 1EP4B 2R2RA 2DPJA 2QE5A 4O3PA 1RYRA 1GOBA 2PY5A 1S9EA 2HHWA 1LW0A 4AH9A 3QIOA 4CJ4A 1I6JA 2IAJA 1LW2B 3I0SB 2G8WA 2Z1JA 1QAIA 3V9ZA 1X9SA 3NE6A 4HUGA 4C8KA 4QOZB 3GV5B 3A2FA 4DTNA 4EBCA 1I3AA 3MEEB 4H54A 1HARA 2OPSB 4DQSA 5EWEA 4NLTA 1LV5A 4YR3A 1XR5A 4Z4HA 4KSEB 4RW9A 5D3GA 1YTUA 5I42A 3CJ0A 4IRDA 3HL8A 4H4MA 3OSNA 3U3YA 1GX5A 4WYWA 3TARA 1CSJA 4E7LA 4ED6A 2D0BA 4DL4A 4ECWA 2V4RA 2W7OA 1W9HA 3QZ8A 4FJ9A 1NJXA 4K8ZA 5KRTA 2ALZA 3N6MA 3V1QA 3SI8A 4LSNA 1REVB 4O44B 4ZTFA 2YV0X 4MK8A 3LANA 3QO9B 3L3UA 1RTIA 3KHLA 4NLUA 5J2NB 3Q8RB 1KVCA 5KFRA 3E01B 2QK9A 3CJ5A 3H59A 3EPIA 4IKAA 4CEZA 1A5WA 1KLMB 3PV8A 1SH0A 3SQ0A 2G8FA 3QERA 3V6DB 1LWEB 3QO9A 2A1RA 4O4GB 4MQ3A 1RBUA 2EHGA 3DYAB 3KIOA 3L2UA 4JV2A 4EBEA 1LWEA 5KFDA 3SNNA 1BIZA 3LAMA 2HNDB 4FYDA 1U09A 1YT3A 4DTXA 4WFZA 2CJQA 4I7FA 3U6FA 5I3UB 2YNGA 2ILYA
chains in the Genus database with same CATH superfamily
1R59O 4A5BA 3FSIA 1ZOTA 3GYXB 1NSQA 1T9VA 3VQ7A 3KJVA 1RBOB 3TSQA 3GZ7A 4DFPA 2V69A 1LXNA 1TL5A 1UFLA 1WELA 4KI4A 3RB3A 2K3IA 1H73A 1HW8A 5F8IA 3ZETA 4DV2F 2KVQE 2OD4A 4X66F 3ZZRA 1NDCA 1RT5B 3HHLA 3THWA 4ZS6A 4FS1A 4UUXA 4WP9A 3DOLA 1TYQA 3QNOA 1EKEA 2KYXA 3RRKA 2GC8A 1VI7A 1FKOB 1Y11A 4IOBA 2CZ4A 2XWYA 3R97A 3KK1B 2BM0A 3H0PA 3VEZA 5EVZA 5GINA 1VRUA 2X1GA 3N6LA 1VQ8N 1JIHA 2MJNA 4E7HA 1BQXA 1L3UA 3ZSRA 1TFWA 3R1LA 4B08A 2C2EA 4O8KA 1RAHB 1J6ZA 3OXFA 3D3BJ 4NPOA 1WB9A 1S3XA 3DM2A 4HTLA 1H98A 4YB5A 2HWIA 2BX6A 3KWGA 4JB8B 3J80O 2J8SA 3L7PA 4Q8FA 2ZJRQ 4FXDA 2J0WA 3D9BA 3HZGA 3K5LA 3ATUA 3D67A 4X2BA 3FVYA 4CD1A 5BR8F 4GKKK 3CD5A 5TKYA 4J9PA 4MDBA 4W98A 3MWTA 1A0OB 3D45A 2FF6A 1CJVB 4B17A 2IM0A 2AZ1A 4DR4F 1B9FA 2R4FA 4F4AA 4JV5J 2CQIA 3CERA 4YMEA 2N3OA 3O6WA 1F3VA 3MM8B 1N34F 1NGFA 3HPGA 4NLDA 2FY1A 2PC6A 5A6WA 2W7PA 2QWMA 2XRIA 3UNGC 5JLHA 1RT6B 3Q2TC 2FHJA 1TUGB 3FCVA 2NYIA 5AE3A 4LRFA 1KWMA 3UKRB 4JOUA 3BO3A 3AVCA 2QT7A 1M5KC 4A4JA 4DF8A 5LMNJ 4RUCA 4LF9F 1KQKA 1ZM4A 1BY9A 2GO8A 2DHHA 1WSIA 3CUNA 4WWSA 3W62A 2R7YA 2O8EB 1SC6A 5M2UA 3R7BB 2CKWA 4V19S 2IPOB 2OGUA 4DV6J 1B64A 3GMGA 4LJMA 3VCDA 2XC9A 1CLQA 3NBPA 4GW6A 4OYWA 2LDYA 3KLHA 4X84A 2GGPA 1HPMA 3WDOA 3QPIA 3O4QA 2HURA 2LEPA 2MKSA 3QT6A 4BC3A 4U67L 1M0SA 2YNFB 4IDHA 4C3KA 2KKHA 3K17A 4X4VA 2EEYA 2ZEJA 2XZDB 1GLJO 4ECTA 3P39A 4B1YB 4F0KA 1ICEB 4XIUA 4GVMA 1QQMA 3ONQA 3HJVA 4BRGA 4TLRA 2ZJRL 2YJFA 4C3LA 2JEGA 2LLZA 1RDWX 2BUPA 3V4IA 2E5GA 4C7QA 5DZ6A 1D8YA 2PT0A 3D6MB 2POKA 3Q8SB 3OYLA 1AT1B 4ZDNA 2B4UA 4K2JA 3G6XA 1VQ6N 4PABA 1I5OB 5IQ6A 3CCJS 4PWDB 2I8EA 2WK4A 4CBUA 4ZCLA 3PY8A 4GMKA 1Y7PA 4V19X 2GX8A 3KLGB 5ETTA 2VZ9A 4ZLLA 2IMWP 3NH1A 3UDVA 2HMIB 1YJUA 4O3OA 4CLUA 4CF2A 3OTOF 4KT0C 3CJBA 3SDEB 2Q43A 3S1TA 3DOLB 2KHCA 1C4AA 3T3FA 4QIFA 4BR4A 1TKZA 3DOKA 3PR5B 1WG5A 2J8AA 5BR8J 5C25B 2DO0A 5A8KA 3TAEA 2M5YA 5AQKA 2E1RA 4XPCA 2ADCA 1VRUB 3G4SN 4PR6A 1WHXA 2FC9A 4L73A 3M6XA 4CM2A 5GAGI 4NMLA 3EYZA 4FJLA 3FJ2A 2H65B 3KKFA 5BRDA 4ES1A 5AQRA 1NXIA 5AE1A 3M9MB 2XNQA 1I51B 4DJBA 5E26A 1PC4A 1WWHA 3ATVA 1VQ5N 3FCHA 3Q8VA 4LFBJ 5ETRA 1NSKL 5BYQA 2WSEC 2XSJB 1JNRB 2G8VA 3QIPB 2KZMA 5LL6d 4OI1A 1TL1A 2GVZB 2OPQB 1Y3JA 4M63A 2DR8A 3N4QA 4KKOA 2BQRA 1FX2A 4NLQA 4YOXA 4R5PA 3MEEA 2MZQA 4ZJQA 4WJBA 4FWPA 3AOCA 1IQTA 2G9OA 4DV2J 2ZBIA 2M4MA 3W9HA 5L46A 2X3DA 3C2PA 4K4UA 2EWHA 2DRDA 2NXUA 5GADP 2IJRA 2AYMA 1W2BM 1MMDA 4BS2A 4NLOA 3ZSXA 3GQCA 2O8DB 6FD1A 3W3DA 4TKTA 1OSCA 4ZJOA 5AXMA 4HL9A 1XNRK 1TL7A 3DGPB 4LF6K 2D3O1 3MCAB 3GILA 4MK7A 2KG0A 2MZSA 1IBLK 2VODA 4CIGA 1XMQF 2VG7A 1YIJN 4Q44A 4BRMA 1YQHA 5LY3A 4WFBQ 1SJQA 4JI6F 4CESA 2CA9A 4PPDA 3UVJB 3AT1B 5DLFA 4BGAA 2GFFA 2GO9A 1UVKA 4FJXA 4AHUA 4M5DA 4M3ZA 2JVOA 4DN0A 1VISA 2UUAJ 1KAYA 3KLHB 4I56A 4E98A 1T44A 5LSRA 4FO0A 2GV1A 3UO0A 3VQCA 4OZ3A 5D77A 4FYYB 1RHQB 3OYJA 2PYJA 1SIWB 2Q1NA 2O67A 3HHKA 1RWUA 1NMNA 4LF5J 1WTFA 3MUTP 3M8QA 1G15A 1XMOK 2WW8A 3D2EB 2QO3A 3HRGA 4CVNE 1AZSA 3CJ9A 1IG9A 4LR7A 3VQ8A 1NZAA 4K4TA 1QLNA 1LAWA 3KK1A 4A8OA 2XWXA 2CNNB 3KTQA 2ZGYA 2R7QA 4O3SA 2RS8A 3V81B 2P9LA 1WKKA 1QVFM 1R6YA 4M5NA 4LF2A 3CJ2A 4WFAQ 3KNGA 1Q8IA 5J1NA 1Y3KA 5CZXA 3MMJA 2ZKUA 3VGVA 4H4MB 3SQGB 3CCWA 2MQLA 2MKHA 3BBBA 1RT7B 3PJWA 3NGIA 1RACB 2XY6A 1FT8A 5AZIA 3OYHA 1HYZA 3RWUA 2HNDA 2O8BB 1JXBA 4CEEA 4IJAA 1S59A 3AVIA 2E9TA 2EK6A 3CE8A 1PYTA 4PG7A 2HAIA 3ENWA 2VQEJ 3FGVA 4DSJA 2HVHA 3MPYA 2MQQA 1YJTA 3AVMA 4B1ZA 4FJ7A 3T5HA 4XH1A 1JB0C 3KDNA 4FJHA 2K7KA 4B3MF 2DXEA 4X62K 3F2KA 5A0YA 3HKWA 2QV6A 3KKRA 2IC3B 4QW9A 1NK4A 3M05A 2C3YA 3CWJA 4ZN3A 5KFWA 3TPQA 5D6GA 3TP2A 3FDSA 1KD1O 4FOIA 4DR7K 3VAKA 2Y9HA 1SPBP 2RU9A 4WZMA 4USTA 3F5TA 4BRFA 5DK5A 3PX6A 4ZMMA 3I0RB 1ACMB 4KO0B 3O4NA 1S99A 3AODA 3NCIA 5IZHA 1EWRA 4DV6K 3MXMA 2DISA 3QB0A 2RF2A 5L9XA 1CPZA 4JK8A 1H38A 1ASUA 4URGA 5DG7A 4NLYA 3K9JA 3B4MA 4B9TA 4JI8F 1AUDA 3TZZA 4DHYA 2VONA 2HNYB 3DLEA 4LH5A 1VBXA 2KYZA 5JUMA 1SQGA 4ILGB 1RCHA 2RHSB 3R6GB 2W2PP 1A5VA 1H2TZ 3I5CA 3DLGB 3BGFA 1VSKA 5F1XA 4DTJA 1HWLA 1M5VC 4MK9A 3G8QA 1IBLF 5KG5A 2H3GX 1D1UA 2RKIA 1Z1ZA 3NLCA 4ZCIA 4I9QA 2AF6A 1NK9A 3CTRA 2R9LA 2P9IB 1H6KX 2FDNA 1YTYA 2HLUA 5GAHI 3TUPA 3L6QA 4ILRA 3LDQA 2W9AA 3GONA 4PAAA 4X65F 3OV7A 4JV0A 1ZM3A 4K42A 1RDAA 3BH7B 2R42A 2W2QP 4FWRA 1H0HB 1NH8A 4HH1A 1AYEA 3MEKA 4K4WA 2E88A 2UU9F 5AZJB 4DTOA 4MJKA 4M3XA 1JLGB 5T7BA 1QQNA 3SPYA 3AO1A 4YORA 3ZZPA 3DXKB 4FJ8A 2M0GB 2O8FB 3H40A 3A8JA 3W2WA 3U9DA 3AA2A 3MMBB 5DLGA 4DTRA 3LP1A 4C11B 5KFIA 3O08A 1C1CA 2JX2A 3FZHA 3MWPA 3BR8A 3QSIA 2ACMA 1DRZA 4JKHA 1JLAB 3CDWA 3V2UC 4ED4A 2V9KA 4W5TA 3BEGB 2XSJA 1U4BA 3G71S 1LWFB 1C1BB 2F8SA 2IRUA 3ENAA 3ET6A 3PCOB 2PEHA 4LF8J 3RAQA 2HHXA 1P8ZA 3OBYA 2HZCA 4DFMA 3O9SA 2AW0A 3ZYYX 2O8CB 1ZBUA 3VGLA 4NOHA 4I6WA 1BHLA 3BN4A 3IRWP 5M2PA 4DTUA 1OH8A 4YFUA 3PXGa 1HNZF 1BA0A 1HLUA 1FDBA 5JXSA 4QWAA 4F4KA 1D09B 4CJLA 2L9WA 3QMLA 4QU7A 1EXQA 4AM7A 4BRLA 2VPZB 2QMWA 4EWTA 1WF1A 4JI0K 3TZWA 3DMJB 2F8MA 2DNRA 3AVAA 4A8WA 3PFEA 2HS0A 4QU6A 3U4LA 2ZM6J 3SCIE 2UXBK 2DCUB 2ZBRA 3PJXA 2IC3A 4JI1F 4CF9A 2IDEA 1UFKA 4CI0B 5HAOA 1JJ4A 3ZTQA 1OH5A 3TAPA 2HQFA 4E1JA 5F3TA 4CJQA 1D0EA 3GSIA 3A3OB 1N56A 1I94J 1NM2A 1F2GA 3RB0A 3HI0A 4QYZJ 2X74A 2XQCA 2HKEA 5IT4A 4X4RA 4B3MK 1JCFA 3ZT4A 1YVNA 3D7SB 1OVYA 3MCSA 5C24B 2MQOA 2V4JB 4CO3A 1K8KB 2PYLA 2KM8B 1W97L 3KK3A 3QBCA 3DI6B 2E8AA 3JTPA 1T9XA 2UUCF 2MKCA 4C3MA 2AKWB 1ATRA 2LDIA 3CIZA 2XY5A 3MHYA 2W8KA 5L1KA 3CCRN 3TAMB 4HTJA 4O0IA 5BR8K 2WOMA 5ITHA 1ZM9A 2R8HA 2VG6A 4AHRA 4B3OA 5FRNA 2HEKA 4XDDA 4WF9L 4QS9A 4IQXA 2UVWA 2BE9B 2YH1A 2LQ8A 3N4WA 3GJSB 2OPRA 4IYQA 5EU7A 5ETLA 1DAXA 4O8UA 1IJJA 3TW0A 3Q8PB 4H0TB 3GE1A 1VRQC 2D7SA 3V6DA 1Z4UA 2P9LB 4PXDA 4URQU 1S72N 3MAQA 2KT2A 4N47A 1TKXA 1ZTTA 4B9QA 2P9SB 4DCHA 4RW4A 3EZ5A 4ZOSA 1HQEA 1YGYA 1U24A 5E3AA 1N5YB 3LGNA 4QAGA 5AJ3J 1RCOB 1IG8A 4TY8A 2DCLA 4I2PA 4CZHA 4V1Ak 4FJGA 1CQNA 5GAHP 1X3NA 4KHPF 3EKUA 1EZZB 3FSXA 1C0TB 8RUCA 4B3SK 2LFVA 2B8QA 4K7QA 2EBEA 2AHOB 1EQYA 4KY3A 1XNRJ 1Y5IB 4Z4CA 3ULDA 3G10A 2DB1A 1QZ6A 4I9LA 4O4GA 3DLKB 2C2DA 4AE5A 4FPBA 4WIQA 4KGMA 2Q2RA 2CJYB 2E9RX 1S6OA 1LFPA 2KXHA 2HHHJ 4RU2A 3NNHA 1BGXT 3SJJA 5AFUH 1ZZFA 1VQ6S 1KTVA 1TTHB 3WX8A 4DS5A 1VK0A 4G1QA 4RNFA 4BRKA 3EO3A 4DFJA 3KNAA 4A8SA 2GBZA 4OYIA 3DKDA 3EEQA 2B5JB 2A40A 3RAMA 4PHTX 2C22A 3NGUA 5C5JA 1A6LA 2DNHA 4CQ1A 1NNEA 4KR0B 3T6JA 3G4SS 4GV9A 2QEXN 3L09A 3QMQA 1PYOB 4M45A 1B99A 3J81j 2EXUA 1KQGB 1RHJB 2LVWA 1F5BA 1FRIA 4LFAK 1LKZA 2XLIA 4KHWA 3GR1A 4I64A 4J9NA 3QBXA 1KHWA 4BACA 1CXUA 3CJTA 5K8MA 2QI2A 4PQUA 4KHRA 4UOHA 1N34K 4ELTA 4MKYA 4UY8O 2JLGA 3NNAA 2YQ1A 3NRBA 4OYBA 3C7NA 3NGYA 2NRVA 2X51A 4QR0A 2XHBA 5HK4A 3TO8A 3CI5A 1E3MA 4CP5A 3ZZTA 1IJEB 2DGWA 3UN3A 3S6EA 1IBMF 1CULB 5J2MA 1FJCA 3KVGA 4ECVA 3CQ8A 1CJUB 2Z2MA 1K8KA 2IM3A 3BF4A 1K0VA 2WBRA 3R1HA 3K59A 4IOCL 3ZT2A 2GGPB 1RT4A 3E2EA 2XS2A 3CQXA 3AGKA 4DFKA 1WDTA 4K0KK 4CFAA 2W24A 1S1UA 5F3ZA 2DHXA 5CR4A 4BC7A 3SAFA 2PMZD 3VAIA 2VOPA 4U7UK 1OKJA 3OJSA 4JI1J 1SQKA 4JI5J 2OYQA 1BIUA 2FHKA 1S0VA 4J2DA 4BREA 3PW0A 2DPIA 3QAUA 1DLOA 1Q16B 1CXQA 1P1TA 5B0EA 1U45A 3HFZB 4CNZA 2WFBA 3T1HK 2IM2A 2PEBA 1S0MA 3C6TB 1O0PA 4KB0A 5KT3A 4AHCA 5CQGA 1AXQA 2DNLA 2CUYA 3VAHA 3OTDA 1N54B 3D28A 1EWQA 4HTUA 2KFZA 4BLGA 1JK9B 1GMWD 2F7VA 3CFOA 3ULEA 4CH1A 3EKSA 1JLAA 4I2QA 5J1EA 4LF8F 2F9JA 3CJ3A 1FERA 3A13A 3MWBA 3GIJA 3NF7A 3H1VX 1XUPO 2DFFA 2H3EB 1KCFA 5LMUF 1NHUA 3ENQA 2MHNA 1T03A 1GLFO 1F5AA 5BRFA 3SQ2A 2N7CA 2E9ZA 4FZVA 1UFWA 1QAXA 2VG5A 4FK4A 1TK5A 4DTPA 5EOYA 2XY7A 2OTLN 3UD3P 2HQIA 3VPZA 5AQPA 2I5JA 3P5BP 4B3SF 3RMAA 3NAIA 3IMQJ 2ZBQA 2FJWA 3TNVA 4YQWA 2FLPA 1TGOA 2U1AA 4JYAK 3NGSA 4JKGA 2Q66A 1BA1A 2BE7D 3AVKA 1U1MA 4YY3J 2Y0BB 2UU9J 4WCEQ 2AWZA 4GRSA 2NYHA 5AQWA 3U9ZA 4DPUA 3CF5L 4TLQA 1RA6A 1F5CA 3NAEA 5B0AA 3D5MA 1OQ3A 3AQPA 2W4CA 4DQQA 3HI9A 3AQOA 1Q8KA 4HHJA 2D0OA 5FLXO 2B6AB 3VGUA 4NCBA 2VQFF 4LVOP 2CAJA 4KH0B 4CECA 4EUVA 1U1QA 3MXIA 4OKEA 1N6QB 3UN5A 3DAWA 4AILC 3G8TA 2J76E 2CQ2A 3CC7S 2AU0A 1YITS 1NK6A 3MR7A 1FHTA 4CLZA 3L8BA 4USKA 3VV2B 3VQSA 3QDKA 5LSLA 2IS3A 4HEA9 1IKYB 5KG2A 4RTFD 3J7ZT 4O3RA 4DEZA 1YLXA 3HJFA 4JI8J 3ZTOA 1TVRA 1SKRA 4AHSA 1DTTA 1QSSA 1X31C 2OP5A 2V2ZA 3MM7B 3R6MA 5KRSA 1TUUA 2D1KA 3OL6A 3C16B 2F7TA 4E7IA 1GAOA 2NREA 2YHBA 1NGGA 2CQBA 3BJYA 3VALA 2G8UA 4OI0A 5AQQA 3QINA 1Q7LB 1JLBB 3QICA 1IBMK 4IRKA 3EPGA 1LWCB 3FBEA 2UUBJ 4X62F 2AYEA 2IIRA 4L74A 4DQIA 4USUA 2HHTA 2F4VK 4C97A 2OO4A 3ILLA 3BSOA 4CW7B 5HRPA 4K25A 2IRXA 2W40A 3ZSQA 2FJXA 1R0BG 1JMTA 3JSYA 3VQ9A 5HATA 1QE1B 1JKHB 2GWJA 4OZ1A 2DRAA 4Z94A 5H9EJ 3QYYA 3ITHA 1X7VA 1TUVA 2RS2A 2E7VA 3UKUA 2V2KA 3EXCX 2ABYA 1IXKA 3QRQA 1FI4A 1YSJA 1VR6A 1NSAA 4FXVA 2VWJA 3DMJA 2FVSA 1WF0A 2Z57B 3ZZOA 3TU5A 3M8PB 2I2YA 4CK3A 3WXLA 2ZH3A 4RKUC 4IG0A 1TZ0A 3OD2A 4JKFA 1RBLA 4DUZJ 1KOOA 4YHHK 3KJFB 1TL3B 3PRVA 2BTFA 3CCQS 3BYPA 4KV8A 1FJGJ 4DU8A 4CGHA 4BG8A 3LALA 1T11A 4CTAB 5C12A 4ED7A 3WC2A 2B4VA 2JWKA 3KK3B 1KSPA 2F4VJ 4FWSA 1MWMA 2ZZNA 2VFVA 4M3WA 2RQ4A 1VQNS 1GOAA 3OTCA 4C6AA 2C28A 4B1XB 2DFHA 2QLBB 1D8ZA 3C15A 4CK1A 1IBMJ 2DR6A 1VCTA 2RNEA 2HF4A 1ZBFA 4DV5F 4NXNF 4JD2B 4B3OB 2IJNA 3QGPA 4LF6J 1TMJA 4DV0K 1MN9A 3IWXA 2V8GA 1CVJA 5GIOA 5I3QA 2H5EA 3SIPB 3PX4A 4HWIA 4ZK7M 4C8MA 2CQDA 3LP0B 1XHZA 4CYUA 1ZAVA 1NKCA 3G0ZA 4Y1CA 4N41A 4RBTA 3CJCA 1CULA 2FF3B 5HJYA 2PFDA 1WACA 3W64A 1VQ7S 3V9SA 3CDEA 4XK8C 3I9ZA 1HRHA 4DV3J 1RLDA 4FLWA 2CRLA 3ILIA 4MTPA 1NLVA 5JMNA 2KZZA 4ECSA 2CGKA 1VQ9N 1TUYA 3QESA 5KTQA 2NR0A 5FRMA 1T7PA 4WYBA 1KR4A 4DS4A 2KVIA 1DZ5A 4X4QA 5KI6A 1J2VA 3W66A 2EKYA 2OTJN 3VTHA 1N8RO 2VBXA 2RD5C 2XO6A 2QZ8A 4DDFA 1OPIA 3QT5A 5C25A 2E7WA 5DM7L 5IT9O 4DL2A 5IC4B 2XO7A 4DXLA 4J37A 4LRCA 4I6YA 3W63A 4C8OA 4NB4A 1FWKA 2AZ3A 3FCWA 1RAFB 2B4JA 3EVMA 5ETPA 2UXCF 3SFGA 1WOPA 2CQCA 5GIPA 5DQHA 3M9OB 2KU7A 3BP8A 5AXNA 3C6UB 2LXUA 4B02A 2HFOA 2PIIA 4NCAA 4C48A 2F3JA 5AQVA 3FNNA 1UVNA 2CPZA 2YXLA 2ZD1A 3J81O 1SC4B 3K5PA 5AT1B 4Y0FA 1G99A 1B3TA 1TL1B 2DTJA 2GVZA 4DSLA 1UTAA 2N4CA 3LA0A 4CZGA 4OLBA 4KHPJ 2M3DA 3HPOA 2WVBA 4FZXC 3O1WA 2HZAA 2BVZA 1OQ6A 3AVLA 5FPEA 2R2RA 1V5VA 2QE5A 2BM1A 4Y2KA 4O3PA 1P8GA 3FUYA 3BBFA 1C0FA 4CJ4A 3T9NA 1LW2B 2G8WA 1QAIA 1X3MA 3V9ZA 2R7XA 4USVA 3GCWP 4WQ5A 3UCUP 3A2FA 2WBNA 2VKZG 2V8DA 3M2RB 1LCUA 2VYPA 2AEJA 4H54A 5LMNK 4FKXA 3I56S 2FY8A 2R7TA 4ITSA 1XR5A 2V51B 4F0MA 1FWPA 2ZF5O 4RW9A 4OHZA 1WEYA 4IRDA 1CSJA 4E7LA 5ADXA 3WT0A 2V4RA 1URRA 2N82B 5AQZA 3UDCA 1WUAA 1NJXA 5KRTA 4A47A 2E5JA 4RPFA 3TYTA 2ALZA 2HIQA 1BC6A 3N6MA 2W4DA 1YF5L 4LVNP 4H0YB 3QO9B 4XDCA 3CC2S 3VAGA 3Q8RB 1JJ2R 1WKLA 4Z7CA 1YAGA 4DV7K 1NMEB 2O66A 4H0PA 3H59A 5HJXA 5A76A 1U8WA 4IKAA 3PV8A 4MAKA 4L6V3 1I1GA 3GFYA 4DCOB 1GMVA 3HDSA 4MQ3A 1OH6A 4BCAA 4FF2A 2EHGA 1T3OA 3KIOA 4OZJA 1HNWF 1RWXB 4BRPA 2DK2A 3IP0A 1YT3A 2BKPA 3LDPA 4LIWA 1VQOS 2XS7A 2QXLA 4GKJJ 1HIYA 3SLCA 2YNGA 2L9NA 3H4BA 1IR1A 3H45C 4C0HA 3BQ1A 3K2PA 1YBAA 4GMJB 3UR0A 1YI2S 4WZQA 1D3WA 5HQ8A 1WORA 4C8YA 3CVKA 4I6MA 4OLPA 1T9YA 1HD1A 4PXEA 4JLHA 4GO5X 2HPUA 3ZTRA 3M6VA 2FSJA 2ZH2A 1FA0A 4BVOA 1WC3A 3ICLA 2KW4A 3ALYA 4DX7A 5E5NA 1V4TA 4XEIA 5JS1A 3V4IB 3D0IE 1IKVA 3DLLL 3HX9A 2J6UA 3N9UC 3POTB 2E1CA 4H0XB 3IGVA 3M8WA 4P73A 3MTJA 4FWKA 4N8OA 4HT7A 2W2NP 2AD9A 2PMHA 2OMOA 3ZNUA 1HQUA 2LXIA 4WP3A 2A2DA 1FEEA 5DG8A 3HFKA 4DPTA 1NJWA 2QKBA 3FE1A 4F2SA 2JOQA 5D3GB 2HRTA 3EE9A 4C2MA 2JSXA 2BA9A 3FBCA 4CH0S 1XNQJ 3IG1B 4WQ5C 2QGFB 3SDEA 2O5DA 2P9EA 4YB1P 3O80A 1T9TA 1NK8A 1C0TA 3TA0A 4M8LA 3V9UA 4K5SA 4MIBA 2W6KA 3A12A 2Q6CA 5CCLA 1VBYA 3HP9A 2GELA 4CHPA 4E89A 2A18A 3EDRB 1EJ7L 3AHPA 2Q6BA 2VJVA 5E33A 2VPXB 2VQEF 3ISND 3GFHA 4C1NI 5DRKA 1FJGF 4PKIA 3CO0P 3KLFA 3DRPB 1WEZA 2A0FB 2XB2D 3OUYB 3B8HA 3HHLD 3JSBA 4LQ9A 4B9NA 5GADI 3H42A 4RLEA 2CQ4A 3MDQA 1QY7A 3NFAA 4FLXA 3Q22A 2QEXS 4C1NK 5FJ4A 4ZVOB 1N36F 5D8HB 4N7TA 2FSNA 2VDIA 5KFUA 4RNHA 2K8GA 1HA1A 3WQPA 3UDEA 4WU3A 4CYUB 3DLBA 2HFZA 2B4OA 2C2NA 1DTTB 2DH9A 2OI2A 2M7SA 5ADZA 4M5HA 3HBTA 1FRHA 2P2CB 2FYXA 2RDJA 1X60A 5BPLA 1KC8T 1G4CA 1F1BB 5M1NA 2OIHA 4NE9C 4YNQA 3OTEA 4E2FB 2QM1A 2HRYA 2CDQA 3L7UA 4NLBA 3W5XA 5HROA 2ATCB 3R5AA 2YCHA 1NHKL 2Z4PA 1JCEA 2FGCA 3ZSYA 4ISEA 4DV5J 5HVHA 1X8DA 2GV9A 2MKKA 2XULA 3TEGA 3KK2B 5KFVA 4OGCA 4F8RA 3TJ8A 4PG4A 3TUIC 2HLTA 4KE5A 3CJ7A 1Q86O 5LXYA 3LZIA 3VAFA 4HACA 3CMES 1NGHA 5KFEA 4CGIA 4C8LA 2BACA 1H2VZ 1XERA 2KDOA 3DHXA 1URNA 3H25A 2KKZA 2OUGA 1DKGD 3AVGA 1YRTA 4M5KA 2IOCA 2VBYA 2QMUB 1LOTB 2Z2ZA 2WB4A 4WQ4A 4MLHA 4P7VA 3G96A 1M5SA 4RU9A 4G3IA 2VPYB 3NCPA 1F0XA 1HWJA 3BO4A 3WXKA 1MSWD 4CLPA 2VGNA 4YOVA 4IFVA 4U67Q 2YPYA 1WHVA 5B0DA 2ITMA 2AX1A 5AR0A 2OZMA 1H1VA 3M9NB 4JI7K 3L0QA 4BE0A 4YDDB 5KFMA 4MYUA 1U26A 3HFVA 4C0BA 3FK4A 1SL1A 3NF8A 1KHVA 3T69A 1HJOA 4KB7A 4DPYA 1IQZA 3TAQA 3ULEB 5J2PB 2E5HA 4BR9A 4DV5K 5KT4A 1R3NA 4DG1B 2CQ0A 2YH0A 3UW1A 3THYA 2AX0A 3M8RA 4WXWA 3PTWA 2DH7A 2DVIA 2HB5A 2ZC4A 4KGVB 3GJQB 2PFFB 2YKNA 3RSEB 4CFBA 3RGIA 4DB3A 4Y1DA 3PX0A 4U6PA 3VEWA 2GS8A 2PN6A 4LF4J 4YDXA 2JZ5A 2BQ3A 5KPTA 3SCXA 4OL8A 4OJ3A 4HUEA 5HSPA 4ED0A 4K41A 4BDYA 4FJJA 1HBMB 2CZ9A 4FYVB 2DY1A 4WE1A 3HTVA 1WOOA 1X0FA 3P6YC 1S6QA 2I5JB 1QUPA 2YQ3A 4P10A 3ENBA 4IOAQ 3E9PA 2GAGC 4J2AA 4CIFA 2YKPA 3RAXA 2A5XA 3VQ4A 4MKBA 3ID6A 3PO5A 4FS2A 4CEBA 3LM2A 3SCKE 2DGSA 1T94A 1S22A 3SK3A 4HHTA 1Z2ZA 5D15A 2NPFA 4BVPA 3JQJA 4MKVA 2B0GA 2Q36A 2NRZA 5C2CA 4R79A 1UWBB 2A41A 2P8IA 1B9DA 2QX0A 2YVSA 3X1LB 1H7XA 2N7YA 3D54A 1VQ7N 3ULHA 1WC1A 3ISNC 3OS1A 1DEJA 4CLWA 3M32B 1UA1A 1S4FA 4DTSA 2DEJA 3A8IA 2YHYA 4X4PA 2P9CA 4W92B 1X5OA 2XNRA 5EN1A 5HRSA 1TV6A 3SFUA 2P9UB 2MLXA 2J6SA 3W7BA 1ZBSA 2CVIA 2R2UA 4EZ6A 6AT1B 3ZFVA 1X9WA 3O9UA 1HBUA 5E84A 3J80Y 4RW8A 4DUYJ 2ZE2B 4X64K 4OGEA 1CC8A 3IMXA 3BGRB 1JXVA 4J9SA 3MM9A 4LRDA 4RWTA 2Y1IA 3QEIA 5JVGQ 4K0KJ 5HVGA 2E6LA 4CH7A 2QFIA 3SZ2A 3A3PB 1XEZA 1HHSA 2XMKA 5F9NA 4DL7A 4DX8H 2QKKA 5J1PA 3BSCA 4YDUA 1NDKA 1O51A 3C16A 2OEJA 3M2VA 4DR5K 2CFXA 3H5SA 1KFDA 4KHMA 1XC9A 1X4FA 5LMUJ 1M5PC 1U0HA 3V4MA 5KQDA 2CPFA 4F3OA 2ASPA 3BQ0A 1DY3A 4B3RJ 2YWEA 1WLJA 2AQ4A 3UCGA 2D3ZA 2CGJA 4FBUA 5AZJA 3AVBA 4PG6A 4LF7K 4CO1A 3HMJG 4ETXA 2B9WA 3I6PA 4P71A 4R0JA 2VGMA 3HVRA 3NS5A 3CSKA 1U6ZA 2FHOB 3E9LA 3EGZA 3F0NA 3LP2A 4ED1A 5F8LA 3LO3A 4NX9A 4M7YA 1G3OA 2CWXA 1L3SA 3PW4A 2VV5A 3CFRA 3CPEA 2UUWA 2ZVSA 3OY9A 2D1CA 1WN7A 1J5EF 4A8KA 4P2MA 2YWFA 4KTWA 3U02A 1C6VA 4A59A 1MA9B 5IWAK 2EWSA 1IKWA 1NPKA 3DGPA 1NUEA 3JB9k 3THYB 3CJSA 4ICLA 1HQ2A 2VG7B 3EXYA 4GY2B 4J2EA 1SJRA 1TKTA 3H4DA 3L4QA 1VLYA 2KLAA 3P31A 1S49A 4FLVA 3VETA 4ZIVA 4PUOB 4CO4A 4KV8B 4NA3A 1RAEB 2RVJA 3KLVA 1RKIA 1JX4A 4GVEA 1NDPA 3EMTA 1VQPN 3CYMA 3QWPA 2Z58B 4BC9A 2KL8A 1OVQA 4J91A 1OWXA 3TTCA 1TL4A 5FPNA 2A6AA 3G6YA 4JS5A 1R0CB 2VFTA 3CCQN 1S1UB 3G2XA 4A8FA 2F9WA 1RBAA 5DDOC 4AYBD 3T41A 3UR3C 2GQQA 2JLFA 3EZWA 2NZCA 2QL7B 5AQNA 2MZ1A 3ZC4A 3JYTA 2M52A 1NJYA 4A8XA 1VQNN 3MPWA 4X66J 5F0UA 3Q86A 5HI7A 2Y1RI 3GL1A 2HOEA 2ZHOA 4KBIA 1C0MA 1VQMS 5CZVA 2ZHBA 1HNXF 4K8XA 2R7RA 4EAHD 2YI1A 5AQFA 4H0OA 2E20A 2ASOA 1N34J 3FKBA 1U2VA 3UCZP 2DITA 4NRUA 4KGXB 4FM2A 1YJNN 1X4CA 3C65A 5FDLB 2RHKA 1KBRA 2OPPB 3GFXA 3CDBA 5GADU 3A5OC 3UDLA 4IFYB 1Q1KA 2HWTA 2U2FA 1RTHA 4Y0WA 3MM5B 2ZJQQ 4H4OA 3GWCA 3ETMA 4CT8A 1YHQN 1RTDA 2G2OA 3PACA 4HTIA 3GBTA 5IM0B 3R2CJ 1Y00A 4D3HA 2CQHA 3THVA 2OANA 1RDUA 3SMZA 2OHDA 1XNRF 2E5LJ 3KXDA 2P9SA 3DM2B 1AB8A 5LJVA 1SUQA 5K14B 3BZKA 2IMOA 4Y3CA 3SQ1A 1WAFA 1RUSA 4KGKA 2E1ZA 4G1IA 3CMQA 3WUHA 2P6TA 2BJ3A 1VRTA 4PG5A 1WSVA 1KXPA 4ES3A 3T9ZA 2DKOB 5GMEA 4USMA 2BANA 2COLA 4ZP8A 2XMJA 3RR7A 3NH0A 4L3NA 3KMSA 3I96A 1S12A 4AD6A 5K8NA 7AT1B 2MGZA 2GA7A 4F3MA 5KFAA 3V9WA 1XR6A 1JNZB 4KO0A 5IQQA 5H9FJ 4ID5B 1HI8A 3LAKA 3T1YJ 4H4KA 1VAZA 3CMAN 3WXIA 2I0XA 1VSDA 3CD0A 3R5GA 5SZTA 4IH6A 2HGNA 4B3RF 2QYGA 3TTFA 2M8DB 1KLNA 1RT2B 1S76D 5H1SQ 4IO1A 4J9RA 1MU2A 5LM7E 2FZKB 2YWWA 2CPDA 2GCFA 5KFPA 2K1RB 4R25A 1FE4A 2VA2A 3M2RA 5IFMA 1IWGA 4DUZK 4KPYA 3WIVA 3O1LA 2CVEA 1VSHA 5AQJA 4Y2CA 4PY5A 2HAFA 4DR6J 1IM6A 4JKCA 5HOOA 3CHWA 2DTUA 4J9OA 3CCES 1QAJA 4PXCA 4CGJA 3N0VA 1WUUA 5KFKA 3D68A 1MMLA 1TKZB 3DOKB 4WBFA 1N32J 4LFCJ 3J7AP 3MM6A 1XQSC 1UAWA 1BLUA 2F5GA 4P2SA 2JEIA 3H6EA 5L9NA 3O1BA 1YKWA 2XM3A 2PBDA 3HXMA 1WDDA 3MECB 4U7BA 5DDPC 3GJRB 5LXRA 2CDRB 1TU0B 3WBZA 3QLHB 3WNFA 3FZKA 1L3KA 2NZTA 1PYSB 4UOFA 3JSMB 2VOOA 4DV7F 2CJ9A 1IBLJ 2NS1B 1HR0J 1N0VC 1VSEA 4OV1A 3SBGA 4BRAA 3AVHA 2BGGA 3P49B 3O3HA 3OYGA 4NXMF 1EKSA 2YNIB 3TQ1A 2G8HA 3ZT0A 3IO1A 1SJ4P 1RILA 3FZFA 4CIOA 3D6RA 4RW6B 3OS2A 3LW5C 4DU4A 3K58A 2QWQA 1W26A 1RKJA 2H48B 1GOCA 1FW6A 4DU7A 4TY8B 1LNQA 1G6BA 2BOAA 1LWFA 1ZA1B 1BCOA 3PEHA 3RSEA 3RMDA 3CB4A 1VQLN 3P83D 3FQKA 5MLCQ 4P74A 1DQ9A 3U1MA 1HLWA 1JQGA 4H8KA 3FZMA 1NJIO 2IYIA 4LY7A 4IG3B 4LF4F 2E2OA 4C9DA 2AP1A 3P3DA 5GAEU 1SJ3P 2RUGA 2FVCA 2ROGA 2ZUGA 2AJ4A 3Q23A 4RL1A 2XSFA 3ZT1A 4YUDA 1IJFB 2DNOA 4GNIA 1XMOF 2OLWA 3CXCR 3QETA 4PL8A 2H54B 4BC2A 2RN2A 3OYNA 5HRRA 4ZLNA 2NXNA 2ASLA 1T95A 4KTQA 1U8SA 3H08A 2CQPA 5B0BA 2HGLA 1C0UA 1ELOA 4JP8A 4CLYA 4BC4A 1UAXA 3K5OA 1WBDA 3P8BB 4LF7J 2W9CB 4Y2AA 3VF2A 3K0SA 4ED5A 4LF9K 2EFQA 3L7OA 4RX6A 5IC6B 1B7FA 5GAHU 2E29A 3MR5A 2Z0GA 3QJLA 2GNKA 4HI1A 3B6OA 4P2FA 4ZPBA 1F9EB 3KLFB 4YB6A 3OUYA 5AQUA 3AD8C 1VSMA 4ISFA 4QIGA 4BWMA 3W0LA 1S1WB 3HK2A 1PILA 4DX6A 3TI0A 2W01A 2O8DA 1HWKA 2AP6A 2DR5A 1YITN 2J6TA 3O8WA 2UU9K 3PIPL 1TFYA 2KH9A 5HQMA 3KLIA 5EWGA 4MLEA 2AGQA 3GIRA 3QNWB 4DMZA 3VVTA 4EZ9A 5BYSA 1WC6A 3DGVA 3CCRS 3QFPA 2A3ZA 5ETSA 4FXWA 4X64F 3R5BA 1DURA 2W8LA 2CJBA 3NCRA 3ZX3A 4WKYA 1CJTA 5DGBA 4W5OA 1JL2A 1XMQK 5L39A 4DR5J 3CJAA 4DV1J 4DV7J 4LR8A 4NLCA 2OPSA 1CS4A 1P1LA 1S1VA 3HVWA 4YOWA 5GAGP 2YQ0A 2ROPA 4NCGA 1HNVA 1FX4A 2VB6A 2QA4S 3OFFA 4USHA 5KFLA 4FLZA 3SXLA 4RCHA 4KRWA 4DWIA 4DN9A 1RAGB 2FJDB 2MQ8A 4HDHA 5EWFA 2OMLA 3HT0A 2HSEB 4LSLA 1WI6A 2VHGA 1YJ9S 1ZETA 4QS8A 4ED8A 4JI2K 3BO2A 1N32F 2HGMA 3UWTA 2P5GA 4NZ0A 4DR2K 1EAYC 3W1YC 3KLEA 4O0NA 3OTOK 4H4OB 1RLCL 1DQAA 3FSYA 4FNIA 3VF4A 3KUEA 2HQGA 4IXCA 2ACYA 5L1LA 1FFGB 1BQMB 4KH6A 2A6OA 3HHLC 2FZCB 2NSBA 4CZLA 3JS9A 5T7LB 1RT1B 2ADBA 4A61A 5C0YA 3BSAA 2WVCA 2ZH1A 1OPZA 1U1OA 1V6HA 2YX7A 4WTYA 2V67A 2M88A 1X4GA 3D2FB 3G82B 3AO5A 2ZVIA 4C0OC 3NF9A 2KXNB 3LDSA 1IN0A 1FTRA 3V6JA 3VGKA 3CG7A 3CXCM 2G0IA 3MF5A 2PFUA 4M42A 2QLFB 2R2SA 1NG9A 1SV5A 3OL9A 2V7YA 3OS0A 5EY4A 4BE2A 2A6MA 1U04A 4JKAA 2FVQA 3FZBA 3K5NA 4CJUA 2YNFA 1X9MA 4ZPAA 4XH5A 4M5MA 3HHNB 4ZJLA 2O1PA 4CJEA 1VQKS 2E1YA 4C8ZA 3R7NB 2A1SA 3DJCA 1FXXA 3IC1A 4A2AA 1K73O 4K50A 3MX5A 1S1XA 2LA4A 2N3LA 4IDKB 4ID1A 1Y64A 4IEIA 4EO6A 4X4UA 3UVJA 4CFDA 1OYDA 4M41A 3Q2SC 1GQEA 2LCWA 4ZKAA 3QT7A 2HFSA 3B82A 4UY8T 4NZ7A 2O4GA 3HM9A 2RRBA 2X1BA 3S8SA 3QEXA 2IA0A 4ILLA 3SV4A 2OCEA 3WHIA 3I5BA 4LF5K 5D4NA 2GEMA 4ATNA 2MKJA 3M1VA 1XI1A 4Y65A 4R8UB 1U6BA 5KG1A 2HK2A 4Z2XA 4AUKA 1U7LA 2UVVA 2HNYA 3RMCA 1RTHB 1X5TA 5L8RC 2WW4A 2L08A 4M5IA 1JLFB 2C2ZB 3RB4A 4B9UA 1G7CB 3ID8A 1GLCG 2A3JA 4GV6A 1RYSA 5DETA 5A6PA 3MM7A 4ZHRB 3F56A 3M30A 1J5EK 4FWOA 3OR1B 4EGLA 1S1VB 5KQ8A 3UE5A 5BN9A 2KRBA 3ENHA 3AY9A 5CYMB 1HR0K 3SCLE 3QT8A 5D78A 3QGHA 2D9PA 2HSTA 3R1XA 2B8PA 2DNKA 4PG8A 3I56N 3WXMB 1BISA 3HHLB 4DTMA 3TTDA 3E51A 3MOJB 3PIOQ 3DFEA 3FEYB 1FKPB 1SBRA 3HSJA 3J7YP 4DR6K 2QFJA 4ZPDA 3Q8UA 2AYBA 1WNEA 2FBVA 4CT9A 4UZCA 1SVDA 5I9EB 4DR1K 3MMAA 5LL6Z 3WNEA 2WRMA 3NS7B 2XCAA 1HKCA 2DNQA 3MUVP 2X78A 4FK2A 4IH7A 4DI6A 5FPDA 1BMQB 4DR2F 2FPHX 4JBCA 4Q43A 2CXEA 3P5JA 3QJJA 1M90T 4WIIA 1FFSB 1R8PA 3SUNA 3EE3A 4OJ1A 4ZLPA 3A5NC 1KVAA 4JKGB 2LQ5A 4Y34A 3TWZA 3LDLA 2JEJA 2JEFA 4Z4EA 1HNIB 4OJHA 1ZZNA 1YWXA 2FSKA 1CZBA 1DTQA 3BQ2A 4O23A 3C19A 4K4YA 5DZ7A 2FHMA 4FWLA 4LH4A 4E7JA 5AQIA 2R8KA 1GLDG 5KG3A 4CIEA 5CCMA 4A46A 4Z0UA 3EX7B 5HN0A 2B56A 3UD5A 4P2XA 2JH3A 4X4NA 2OH2A 1KQFB 5CHCB 2Q31A 2FBYA 4NYFA 3IN5A 2B9EA 2MQPA 1IBCB 4IRCA 5HL7L 3RBEA 3VGMA 4AQYK 1KVJA 1HX1A 3NCQA 3MR2A 2E5IA 3K0JA 4YEAA 3S41A 5KG0A 2E2QA 3HPHA 4ZVUB 3AJ2A 2KO1A 3G25A 2Z1IA 4FF1A 3CD7A 2Y0SD 3J7ZO 4OYXA 2D9OA 3AFGA 1RT3B 4JI8K 4DSFA 5I4MA 3OVBA 3H2UB 2XEXA 4LUBA 5D4LA 2FZGB 2AT1B 1K8AT 1XK8A 1S5ZA 4ZP7A 2EW9A 2NLXA 3GLJA 1VQ8S 1AA1B 3DI6A 2BKNA 4JS4A 3O9RA 4Z4IA 4KI6A 4E0DA 3OYIA 1S9FA 2LU1A 3SBTA 1YI2N 1XMBA 1BL3A 1WD6A 4JRQA 1NOYA 3KUHA 2DIVA 2CQ1A 1NU4A 4L72B 1D5AA 1RT7A 2WB1D 2KT5A 2HRUA 3G8SA 1EO1A 1FF2A 3NXZA 2CADA 2ZJPQ 3AOBA 2YPZA 3DXKA 2OPRB 3OYMA 1PSDA 3VF0B 3P4IA 1OJ4A 1D9AA 1N5TA 4QWDA 3H8YA 5AQMA 2Z1HA 3O8MA 2O4IA 2B5JA 3HVTB 2CPYA 3VQ6A 3M30B 4Q45A 1A5XA 4HKQA 4BDZA 5HMZA 4IOXA 3LWMA 3L2RA 4PWDA 3M7VA 4KH1B 4BQZA 2IIHA 3KJQB 2F8EX 1U1KA 4OHVA 2V7ZA 1KAZA 2GHWA 2NRHA 2B7CB 4CK2A 2UUBK 4TU8A 3KHHA 2A2CA 4F4YA 3M4XA 2C1EB 5EX0A 3ET6B 3OYEA 3CCJN 3LZJA 1RTZA 4F36A 3F9KA 3FLCO 4CGDA 1V3RA 4YOEA 1FO1A 5LOQA 4PL7A 4RO0A 5A2QY 3BGOP 1JLQB 4KTZA 2R8JA 3OR2B 2L48A 4LBHA 4MKAA 4CJSA 4OZ0A 2Z8QA 1GX6A 2DEIA 1RGVA 2DPJA 1HKBA 1X5PA 2LYVA 1RYRA 8ATCB 4OZ5A 2EG1A 5C15A 1GXUA 4AH9A 3LGMA 3OA9A 1VHXA 2IAJA 3J7A1 4QR1A 1P9YA 4ZVRB 4PRFA 3FBBA 2HVEA 2XMAA 3A5LC 3ETOA 2XLKA 4DTNA 1Q8BA 3T1YF 2QTWA 1UVJA 5IWAJ 3D66A 3MEEB 2C3UA 2JNJA 2QL9B 4A5AA 2OPSB 4NLTA 3N5FA 5K20B 4Z4HA 3IXQA 4KSEB 3BGLA 3MCMA 5E3CA 5I42A 5G0RA 3HL8A 3CJ1A 3U3YA 4WYWA 4OPAA 4ED6A 3MI7X 2KJWA 4ECWA 3GG4A 2W7OA 4PXBA 3LH2S 4KJIA 3QZ8A 1VHIA 5IS2A 1TL7B 4BR2A 2RSQA 4FJ9A 4C4WA 2L9DA 2CH6A 3V1QA 4AXJA 1REVB 1TYQB 1NB2A 4RUHA 2M70A 4MK8A 1VQ5S 1NM1A 3SMPA 4BC5A 1RTIA 1SIZA 2HF3A 1U25A 4B3RK 5J2NB 2E5LF 1KVCA 4JKBA 3S7RA 2QK9A 4KH4A 2KRRA 3GE9A 1XC3A 3SQ0A 1NO8A 3V6DB 3P96A 4IO9Q 2BV3A 1NCLA 4OX9K 4W90B 1RHUB 2X1AA 1Q18A 2NRXA 2HBLA 1AFJA 2E1PA 3L2UA 4BY9C 5JVGL 1RXOB 4JV2A 1RZMA 4EBEA 1LWEA 4USWA 1DT9A 3LAMA 3US5A 2HNDB 3A4TA 1U09A 2MY7A 1U1NA 2CJQA 3CW2C 4FWNA 3U6FA 1T02A 5I3UB 4LMZA 4OMFG 2DHGA 1HWUA 3MECA 2HBKA 4M63C 1YJ9N 1T05A 3MD3A 4RUAA 3EGNA 3WIUA 3MAAA 4CEDA 1YJ7A 1YJNS 1Q9YA 3NOGA 1JL1A 5K8OA 4U95A 2HBJA 4MFBA 1ZXOA 1IKVB 4U9RA 3BBCA 2OSRA 2E4LA 3E66A 1VDHA 3AA9A 3AO3A 4ZVSB 3HKZD 3NGDA 2J7WA 3HVTA 4MDAA 4F2RA 1NKBA 2V2VA 3PYFA 1CBKA 2W2MP 3M3ZA 2N4DA 4EBDA 1HI1A 3H5XA 5ETMA 4HT5A 4NASA 4CBWA 5H1SV 4QCLA 1FRJA 4WFNQ 4FZYA 2R7WA 2J5AA 3I0RA 2VJUA 3CD6N 4LBIA 3PYGA 4DZDA 4J9QA 1U1PA 1K44A 3QIDA 1HPZA 2ATQA 4B1WB 3W5ZA 4RW9B 4JUZA 2OFHX 1LW0B 3P5TL 1TP7A 4QYRA 5F41A 5ELZA 3I8BA 2IVOA 1UVIA 1E6VB 1Q82T 5F2RA 5HP1A 1QM9A 2ZQBA 3C14A 3Q7CA 5E41A 3WEEB 4EU0A 2UUCK 4ED2A 3TAFA 5AQYA 4UT4A 3HOTA 4KHNA 2IVFB 3DLGA 2XZWA 2G2ZA 4HR2A 4KAZA 1RU1A 1C4CA 1SCJB 3PHEA 4LFAF 3BKFA 4CHZA 3WNGA 3QRPA 1B4SA 2HNZB 2P9PA 3KOAA 4Q2MA 2XBPA 2NUBA 1YBTA 3VAJA 1RDBA 1HD0A 3SI6A 4F7VA 1JLBA 3GV8B 2ZITA 1FTCA 3F41A 2BE2B 1QZ5A 2KN4A 1J27A 3NGTA 2MKIA 3V6KA 5KFSA 2W41A 3WQTA 2B9YA 2E7XA 3JAMY 2BUNA 3G87A 4ZVHA 2OPQA 2XZTB 1RI7A 3ILOA 3I55S 3NVKA 1FESA 3DLLQ 3BV8A 1N5SA 3CC4S 3G86A 2GX9A 3PLAA 3PNIA 1H2UX 2YWGA 1WSGA 3MMVA 1SQEA 2KHDA 1NSPA 1ZBHA 4G1PA 5F8MA 1N88A 3DYAA 5HO4A 4K4VA 3Q83A 4S0MA 2MQNA 4F04B 3OL8A 5FROA 1F6TA 2YNHA 3W5YA 4K4SA 2IA6A 2GMHA 4CJVA 3MZIA 3OLBA 2B4PA 1OMSA 3BN7A 3MMAB 3PEJA 1YJRA 2EFOA 4AF1A 2UUCJ 3D6TB 4FJ5A 3DRRA 2G13A 4CWBA 3AB4B 1DBDA 3KHYA 2BDPA 5CYQA 2P6SA 2QC3A 3HHEA 1ULRA 1X4AA 1HNVB 3NS6A 2YWHA 4PQAA 3ENVA 3IM9A 4NLVA 1WBBA 5LMNF 3QFUA 2X3GA 4PKGA 2J4RA 3IG1A 1HW9A 3BPSP 1DTQB 2NPIA 3D3CJ 3R3LA 1U2RA 2IY5B 5A8WA 3I87A 5ETQA 5CABA 1XIQA 3HZ6A 3NNCA 3MAAB 1RHMB 4WK1A 1Y97A 5AXLA 3BPDA 3H5YA 2G1HA 5H9EK 4ZPCA 1QD1A 1BXNA 2YY3A 3BUZB 5C2DA 3OYFA 1VSJA 4ZVQB 2ILZA 1GH8A 2HQ3A 4JV1A 4U7UD 5KFYA 3DDIA 3IBFB 4JN4A 1FXLA 3CJQA 1QVFR 1MWYA 4EFAC 4CM0A 5EX5A 2GJFA 3W2VA 4IZ9A 1GFWB 4KGZB 4NYZA 1NH7A 2QA1A 2OJ3A 2K7JA 3ZZYA 3VA0A 1VQMN 1Y10A 1R0AA 3KKSA 1WSJA 1CJKA 1FFWB 4PWUA 1HNXK 3C46A 3M2UB 3S01A 4R0EA 3U8XA 2H51B 2UVUA 3MPUB 4J9LA 5CZ1A 1S10A 4J9UE 3VGTA 5DM6Q 1TK8A 2HMPA 1RQ0A 3KJNB 4DUYF 2JGUA 1K9MT 1VQYA 2VQFK 3ZT3A 4FLTA 1YBUA 1Q4RA 3OQ2A 4CNYA 2QYCA 2D69A 4LRAA 1IBKJ 4HUFA 1MG7A 3QEWA 2FJBB 3VQQA 4GO7X 5JS2A 4CJ3A 3DOMA 3PO4A 4WP8A 1VC0A 4IO9L 4GKKJ 3IUCA 3KLGA 1H3DA 1O1WA 2ALYB 1HKGA 2VASA 4RNMA 4CJTA 1FVQA 4ZVEA 4OO1J 2GQ2A 2O8EA 1YRXA 3MOZA 2GWKA 1JXLA 3ZTSA 3QJPA 1GLEG 5IT0A 3CMAS 1KRPA 3O2IA 4CEQA 4JHDB 2F8HA 1DARA 4Z4GA 3JQKA 4QWBA 1FEHA 3KUGA 3MMCB 4LF8K 2LP4A 1NGDA 1W0HA 4CZIA 1S48A 4GKJK 2NSCA 4OLAA 1N33F 4B9MA 3MN9A 4NLWA 1VOMA 2EX3A 2RF2B 2E6MA 4FDFA 2EKNA 3I82A 2PAVA 4H0VB 2NZ4A 1LFWA 3PW5A 3JXUA 2VG5B 1E6YA 2VWKA 3RJMB 2LEBA 2R7SA 4A57A 4JI2F 3KG0A 4PZVA 3PIOL 4CD3A 1G2EA 1YZ7A 1Q81T 2W42A 4U8YA 2ZM6F 1VQ4S 3G6VA 2GUIA 3TR8A 1KLMA 1UW9A 4CZJA 2HFNA 3GB0A 4W5NA 4TU9A 2IJFA 3CNQP 2ZH5A 4I2PB 3CJKB 5U47A 5B0FA 4DPXA 4OYOA 5F9LA 5KFFA 2KFNA 5D4PA 1NHVA 4OX7A 1HNZJ 3L4BC 5KPZA 4DKWA 5A2QU 2WVDA 1HNWK 1ZS6A 1REGX 1T9WA 4Y2IA 2W9CA 1NGBA 4WFAL 2KI2A 3ADAC 2D3OR 4LSNB 4X64J 3RRGA 4DUTA 1RTDB 3EN9A 4EO8A 1R8CA 3DLKA 5GMKa 4WE1B 2YKQA 2VC1A 3PFOA 3IDHA 1BDGA 3CQYA 4HH0A 1S6QB 1S1TB 4CHNA 1S1WA 1RDRA 1XTZA 1WHWA 4ANEA 2MY8A 3TVZA 5CA5A 2K3KA 3A8KA 1E4GT 2JWLA 2F8TA 1PO6A 4J9KA 4ERDA 4NYNA 1S9GA 1PBUA 1N52B 1SC1B 1VIXA 2MQMA 4UF4A 3AA3A 2DGOA 4DV3K 3T1HJ 4LT6A 3D2WA 3PVXA 2DBBA 3R9LA 2F96A 2QLJB 2DHAA 1S4EA 4J90A 4XAKA 1SKWA 3HD2A 2BANB 3T5KA 2G1DA 5JICA 4FWMA 4NXMK 3J8AA 2DT9A 2DY4A 3MXJA 2YKMA 1CQMA 2P9IA 2W4PA 2HVDA 2HQDA 2BJ1A 2Y3YA 4KFBA 2HBYB 4YOUA 6FDRA 2AGOA 2YHAA 3NVMA 1RT2A 1K1SA 4OYPA 1M5OC 4QWCA 4CLTA 5I3UA 3IS9B 2QWNA 4ELVA 1T05B 3C3LA 3DU5A 1YHQS 3U3GA 2DYAA 4LF5F 2JVRA 1FKOA 4DV1F 3A0IX 1RT3A 3BGRA 4LF4K 3QNNA 3CCVS 1MLAA 3DRRB 3EZUA 3PSIA 1QAYA 1KNZA 2AV5A 3B54A 4CEAA 4ECUA 4A48A 1QSYA 4QJVA 3MMCA 1RGIA 3OYKA 1BI4A 2V4JA 4QPTA 4AHTA 3OSPA 1BU6O 5GAEI 1XHXA 3CT9A 3VZIA 2HHPA 4CLLA 1U48A 1TL3A 2CQGA 2PMWA 3D2EA 4JI4F 2QTDA 2SXLA 5L1JA 3AB2B 3FC9A 3C95A 5DJBA 3OFGA 3W9JA 1MWZA 5HP1B 3TX0A 5T41A 4CJRA 2XHWA 2Q0UA 3SSRA 2IM1A 4YDUC 1MROA 1HUXA 1SZ2A 1HMVB 5KFCA 2WAQD 5TKWA 3PKMA 3C15B 3TJAA 4FWQA 3EVOA 3MEDB 4EEYA 5D0GA 3HSCA 1B0VA 3UKRA 3ILJA 4DR4K 4NZ6A 4Z7YA 5RUBA 4FBTA 2UXDF 3EVWA 2WSCC 2ZOFA 2Z56B 1HQEB 2FHJD 2X6SA 1DHMA 1JLEA 3ZSWA 4HCBA 1S9EB 2MTLA 1YVUA 1S72S 4O0JA 3R8YA 1IUJA 4J9MA 3BR9A 3D7EO 1NGEA 2AJ0A 4M3RA 4CZMA 4EP4A 1APSA 4O4RA 5B08A 4ID8A 1EIYB 1FJ7A 2GAHC 3CETA 3QAEA 3DXMA 3D1HA 2XY8A 2XCPA 3O5BA 3U1NA 1S0NA 4FJMA 3MCOA 2IDOA 2FVRA 4N56A 1JWWA 2RQKA 2VFSA 4DPWA 2V68A 2CPIA 3JAMU 5HMWA 3CDAA 3OTOJ 4IR1A 4ZLJA 1X4EA 2FLNA 4MIAA 1U47A 1NU0A 1UZHA 4RNNA 2H4WB 3CCUS 3R2DJ 1U2FA 5KPRA 3AAWB 1SKSA 4JEPA 4BR0A 3A1YG 1OY8A 2DD8S 3CPWR 2VCPA 4MT1A 4B1VA 3RRHA 4FCYA 2GZOA 4KKOB 5KFXA 4FM0A 2RH3A 5DM6L 1H7WA 1DFDA 1PJ6A 1GEHA 1VQ9S 1NDLA 3B8AX 1BWEA 5ETOA 3I9V9 1EKRA 4MIWA 1NK0A 1K0TA 2NNWA 3KWMA 3QWUA 1QQCA 4DSIA 1NGJA 1RABB 4C11A 4I4BA 2UUAF 1I3OB 1I94K 2QWOA 2AGPA 1PCAA 3GG1A 3MM5A 1TKDA 1HHTP 5J2NA 3PRDA 4QIVA 2AJQA 3HF5A 4PQUB 2J9DE 5DGAA 3LDOA 4CJPA 4USIA 1S57A 2C2MB 3LTOA 2RHQB 4OHWA 1YK9A 4JI6J 4FW2A 4PYDA 1UJ4A 4OYMA 2RU3A 2MJUA 1HWIA 3OPKA 4CZCA 3G6ES 1HQUB 1EQMA 1FRXA 5E0OA 4NXNK 1LK7A 5EGYA 5C42A 2W9BB 1YUWA 2RRNA 3QEVA 3VQDA 1KC8O 4ZIWA 3D1QA 1RBTA 2HYIB 2FIUA 3LM9A 1RTJB 3AD7C 1RJJA 1QVGM 3NGKA 1UVLA 2ZWOA 1N5QA 3EY1A 1NK5A 1HBNB 2ZHAA 2BRLA 3RW7A 4YOYA 4MFBB 3DCAA 3GIKA 3VQEA 2ZDOA 1FCAA 4CE9A 1YTAA 3EE8A 1F3FA 2QWLA 4ZVPB 3TEHB 1SL0A 3FBFA 3CJRA 4TQRA 1FDDA 3LP1B 2OZSA 4TY9A 2MSSA 3QQCD 4NLXA 3NOCA 5I3PA 1NGAA 1U1RA 5HMYA 2CJAA 2VQEK 1PG5B 5T7LA 4BBYA 2VKRA 2BXJA 3OFEA 3NAHA 1VLOA 4AM6A 3MN5A 2EFVA 3O4WA 3FFIB 2V50A 3EGWB 5DQIA 3H90A 7FDRA 2C2RA 1JJ2M 4QW8A 1UETA 3VAMA 2HHHF 2E2PA 3IFEA 1R27B 2RUSA 3OJUA 2UXCK 2MHEA 3W65A 5CE3A 1EHWA 1NMDA 2P5OA 3TA1A 1PAEX 3RG6A 3BGUA 4OZ2A 7FD1A 4M5DB 3AVFA 1S77D 3AAQA 4CHQA 5MAOA 2DFEA 3K89A 2MDAA 1NWKA 4IR9A 3VENA 3TX8A 2VA3A 3FFKB 3AO2A 1IBKK 4OFZA 2JWNA 3MM6B