3V4IA

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 151
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v4iA05
4KHNA 5DG8A 5EU7A 4KI6A 2Y1IA 2Z1GA 5K14A 2OPPB 3UDLA 4LH5A 5D3GA 5KFMA 3KLEB 1RDAA 3IS9A 4NLTA 4WYLA 1IKWA 5KFJA 2ILYA 4CJFA 3QGHA 4CEEA 1CZ9A 2QE5A 1KFSA 3KLHA 1N5YB 2W9AA 1W0HA 5F8JA 2DFEA 1NJWA 4GC7A 3PX4A 5L1JA 2YV0X 2OZMA 3D28A 1TL3B 5DG9A 2D3ZA 4DL5A 4Q0BB 4CK1A 4FM2A 4FJXA 4YR2A 1WSHA 3AVJA 4NLRA 1N6QB 3OL6A 4F50A 2UVVA 1C1CA 4KFBB 4ECVA 5KFDA 1DTQA 1RBUA 1BIZA 3CQ8A 3KLGA 1WAJA 4DTOA 3KLFB 2RDJA 3GV8B 2V4QA 3OYFA 3DLKB 4KHSA 4CJQA 2IM3A 2W9BB 2UUTA 4URSA 4ECZA 5CYQB 4FBTA 3SFUA 3UPFA 1K6YA 3FQKA 3VQPA 4OLBA 3RB3A 4E1NA 3LPTA 4B9MA 3PHEA 4E7HA 2Z1IA 2IDOA 3QYYA 3EZUA 4KPYA 3V1OA 4KSEB 4BDYA 3V6DA 3SQ1A 4WFXA 4R0EA 4M45A 1OS5A 1HNIB 3NH0A 1F21A 4MKBA 3NGZA 2ASJA 3NFAA 4B9LA 3BSCA 4KV8B 4LQ3A 5KFLA 3BSNA 4QWCA 4ED6A 1IKYB 3OL8A 1BI4A 1QAJA 4CHPA 4WE1B 4ECXA 1RBTA 5E41A 4XIUA 4NYFA 4NYNA 1BCMA 5HP1A 3O3GA 4DTXA 2VA3A 4KI4A 2FVCA 4KHYA 1LWCA 4CGDA 1VSHA 4K4VA 1N4LA 2WRMA 2YNGB 4AH9A 3KKRA 4B9UA 1EKEA 3DYAA 3ZSYA 3V1QA 2CKWA 3TR8A 2QXFA 4HUFA 5HLFB 4HTUA 2Q3SA 3C6UA 3VQ9A 1SL0A 1C1BA 4CHZA 4KREA 1FKPB 4Z4GA 5KFCA 3C95A 3PR5B 1QSYA 4CGHA 4EYIB 3QIPB 1B9DA 3LP1B 4QWDA 1HYSA 3KK1A 1U04A 4JLHA 3L2RA 4M94A 1CXQA 4LY7A 1ZBFA 4J9SA 2HWHA 4E3SA 4K4UA 5J2NB 1NK5A 3QZ8A 5KG6A 4ZTFA 2PYJA 3F73A 4Q44A 5FDLB 3CM5A 5L1LA 3KMSA 3OJUA 3HVTB 3G6XA 2BQRA 5EUHA 3L3VA 4KB0A 4K4TA 4ZVEA 1WSIA 4DTNA 4FJ9A 1XR5A 3OJSA 4I9LA 1L5UA 5I42B 3KD1E 4H4MB 4Z4CA 4CJUA 3OL9A 5C24A 3UQSA 4OLAA 1EP4A 4IR9A 2XCPA 3OLAA 1XC9A 1RT2B 1NJYA 4ELUA 2DTUA 1JLEB 3HVRA 5DQIA 4LSLB 3V9UA 2HNYB 4Z4IA 2IM1A 1U09A 2HMIA 3ZSZA 4O3NA 4NRUA 4B9NA 4TY9A 1W25A 4CHQA 3AVGA 4JS4A 1KLMB 2WOMB 2VA2A 3VQ6A 1IO2A 1A5WA 2ZE2A 5F8GA 4M3RA 2BDPA 2AWZA 3GIMA 3OYCA 1HQUA 3KK3A 2VWJA 2X74A 3LP2B 3QO9B 4KAIA 2O4IA 3TI0A 1S1WB 3NE6A 3PZPA 4ED8A 4KHUA 4URQU 2BGGA 4H8KA 3GV7B 4KKOB 4NLDA 2IJFA 3AA4A 3ZT1A 4RNMA 4KTZA 1TL1B 2IAJB 3BQ2A 4DQIA 1SUQA 1R0AB 3H08A 5DQHA 4N47A 3AO5A 1DTTA 1VSIA 3OSNA 4NLOA 3ZSXA 1RNHA 1JXLA 4NLUA 4M95A 3ZT0A 3LP0A 5I3UA 3V4IA 3SYZA 4RU9A 4CGJA 2O4GA 3BSOA 2XO7A 3PX6A 3SUQA 1TP7A 3DLEB 5EWGA 4BE0A 2YKNA 1KVBA 2BRLA 3OYLA 4HKQA 3DRRB 2PYLA 4AHUA 4FJ8A 4DS4A 1RDRA 4DTRA 4F2SA 1IKXB 3MEEB 3TAEA 2D0AA 2R2SA 1C6VA 5JXSA 3BGRA 3ISND 2AJQA 2FBVA 1TQLA 4LQ9A 3AVFA 3CIZA 3OYMA 1ASVA 2IM0A 5KFUA 3WNHA 4FLVA 4ICLA 1JLBB 5KG5A 1JXEA 2HW3A 4QAGA 2HHVA 3PW7A 3KTQA 1X9MA 2DFFA 1HPZA 1FK9A 2F8EX 3AA3A 1TV6B 4IH7A 2R8IA 1S1UB 1SL2A 1LWFB 1XHXA 4RNFA 3OL7A 4EO6A 4DFMA 1O1WA 2F96A 1REVA 3CDUA 2ATQA 2VWKA 2GV9A 3CVKA 3S9HA 1C1AA 3DM2A 1HYZA 4ZP8A 3L8BA 2HNZB 3IN5A 4KB7A 1BIUA 4MFBA 4WFZA 1LAVA 1JL1A 5J2PA 3LPUA 4ECRA 4Q8FA 5T7BA 3H5XA 4Y2CA 2QKBA 4JV2A 3IAYA 1K1SA 2P5OA 3RTVA 3NL0A 4DSFA 3HO1A 1ZBIA 3L2UA 4CF9A 3CDEA 5KFWA 4PWDB 4CF0A 1JL2A 3LALA 3T19A 1S4FA 4CFBA 1SV5A 3SV4A 4OVLA 2GC8A 1ZBLA 1NK9A 3I0SB 3K58A 1NHUA 1J53A 3HT3A 3L3UA 3TQ1A 3CYMA 4PUOA 3KIOA 1RT6B 1T03B 3DOKB 1X1PA 4ZPAA 3IGNA 4LSNA 1ITGA 1EETA 4C8KA 5KFPA 1RCHA 1T94A 3CJ0A 1RA7A 5F8NA 4QOZB 1J5OB 3NAHA 2XCAA 3HK2A 2XWYA 1S1TA 4DQQA 4DL2A 1S9EA 4J9PA 1NOZA 1KFDA 3VA3A 1IKVB 5KGXA 2RN2A 2QKKA 4FLTA 3KLIA 1NKCA 3AVNA 2W7OA 1FKOA 4TY8B 3O3HA 2B6AB 3K5LA 3RR8A 1YVUA 1D9FA 4ID5A 3SUOA 5KFKA 5KFTA 4H54A 4RW9B 4XPEA 3NDKA 1N56A 2WONB 3KJVB 2ASLA 4O44B 3AVIA 4RUAA 1LAWA 5FRNA 3PW5A 4CGFA 5C42A 4RW4B 3SUPA 4RW6B 5KT2A 4QWBA 4IQXA 5KFGA 4FJIA 4FJGA 3GIIA 1KSPA 3H4BA 2RF2B 4FK4A 1JLGA 3ZSWA 3KD5E 4O3SA 2VG7B 3LZJA 3TANA 3BR9A 5JS2A 2OPRB 4NCGB 3M8QA 3VQEA 4FJJA 4TXSA 3U3GA 3G6YA 3D45A 1T8EA 3LP3A 2WHOA 1VSLA 4FW2A 1NNDA 1YVFA 3H59A 2VG5B 4KO0B 1LW0A 4B9VA 4ZPBA 4DFJA 3UR0A 2R2RA 1VSFA 4J2AA 2IMWP 4CIEA 3MXMA 2W8KA 1LWEA 4J9LA 1QS4A 4I2QA 2XGPA 1TKZA 1MU2A 4J9OA 3JSMB 3CJ5A 1Q9YA 1Z4UA 3NBPB 4B3OA 3ITHA 4R8UB 3V1RA 1JLAB 1X9SA 2AX0A 5L1IA 5KG2A 2OPPA 1LW2B 4MIAA 1RT7B 3KLEA 4W5TA 3RWUA 2XY5A 4AILC 4K4WA 2AQ4A 1I39A 4CHNA 1EX4A 3AV9A 1L3TA 1HRHA 1N5YA 3V6KA 1JLFB 3LANA 3VA0A 3AVLA 1TL3A 2BQUA 5SWMA 4IRDA 1RDDA 4CJWA 1YT3A 4Q0BA 3VQQA 4RZRA 4BWJA 5F8MA 4DSLA 1S1VB 2AGOA 1UA0A 3OLBA 4AHSA 3JYTB 3PR4A 1Q8IA 3GQCA 4K4YA 1RYRA 4CJ4A 4DU1A 4DL6A 1A5XA 2EX3A 4PA1A 4U7CA 3MR3A 4HUEA 1KVAA 3KLFA 3SV3A 4Y1CA 3MEGB 3DLKA 5KTQA 4YR0A 3DLBA 4NRTA 3MEDB 4FLUA 2W9BA 5EWEA 5CYQA 3T5HA 2RKIB 3HP6A 3DLGB 3HL8A 3HPGA 4ED7A 2YKMB 3PW2A 1VSKA 1RBRA 3QESA 1VRUB 3RRGA 1QE1B 3U3YA 1JKHB 1RT5B 3Q8PB 2BR0A 2VG6B 3QLHB 1RT1B 4FYDA 2FJWA 1JLQA 1BGXT 2P5GA 3M9OB 1HNIA 4DSKA 3PUFA 3Q8RB 4FCYA 1VSDA 3CJ4A 3QEWA 5DGBA 4KV8A 4CHOA 1RTIA 4ZPCA 3D5MA 3ZT4A 5HRSA 4CK3A 2X6NA 3PV8A 1IKYA 1NJZA 4OL8A 1WSEA 3L2WA 4YQWA 2J6SA 3KMQA 1S5JA 2FLLA 1IKWB 1BQNB 4WE1A 2ZKUA 3PW0A 1T7PA 4C8OA 4YNQA 4Z4FA 4I2PB 2GUIA 1SKWA 4G1QB 2EHGA 1TK8A 3U6FA 3ZCMA 4IG3A 3C94A 4RG8A 1ZBHA 4KBIA 2YNGA 4K8ZA 2G8IA 5HLFA 3B6OA 4FJHA 1YTAA 3E51A 1IM4A 5J2MB 4O3PA 3GIJA 4B9TA 4LD0A 3VQ7A 4WXWA 1BQMB 4Y2AA 4M41A 1GOBA 1RTHB 1S1XB 4E19A 3QIPA 3PW4A 3LP1A 3TAMB 3AVHA 2XI3A 4ZVFA 4ZVGA 4EBCA 3NGDA 4E7LA 3OY9A 1TKTA 4LH4A 2W42A 2KTQA 4MIBA 4RNOA 3FFIB 5KRTA 1UAXA 1BISA 4E7JA 2KZZA 3KK2B 2KQ2A 4FK2A 3I8DA 2XHBA 5J2NA 1S0OA 3HPHA 2V4RA 3RBEA 4DU4A 1IH7A 4CEOA 3NF8A 5FDLA 4HCCA 3CO9A 4O4GB 3HVTA 3QGIA 4M3TA 3EY1A 3P1GA 4JV1A 3KHRA 4CEDA 3HPOA 4B8AB 1C0UB 4DS5A 3IG1B 3V9ZA 3DMJB 4FBUA 5I42A 2B43A 2WTFA 4EEYA 3HSTB 1QSLA 4H4MA 1L3SA 2BRKA 4Y3CA 4QW8A 2HB5A 1S9FA 4DSEA 2I5JB 3ICLA 4CECA 5KFBA 1RT2A 1VSJA 1JLEA 2C28A 4HYKA 1XI1A 5KT3A 4LSLA 1QTMA 2HNYA 4IDKB 5CZ1A 3WNEA 4CEFA 5KT4A 5KFAA 3SQ4A 4WZQA 4NYZA 2HHXA 1CSJA 4N76A 4CEZA 4CGIA 4K4ZA 4EZ9A 1KLMA 5KG4A 3FSIA 2W7PA 4CFAA 2WOMA 5KG1A 3AO2A 3E01B 3LWLA 4ZP7A 3OYEA 1HNVB 3HVWA 4AHTA 5F9NA 2R8JA 4IFYB 1HQEB 2HVHA 4DG1B 4CJ3A 4CF2A 1W9HA 4Z4EA 4GC6A 2NUBA 3NH1A 4FJKA 3DRSB 4FZYA 3LP2A 3QO9A 2BQ3A 1UWBB 1SL1A 4ZP6A 3K5OA 3P5JA 4NLPA 2HHSA 1S1WA 4BACA 4J9NA 4J9RA 3NF7A 1EXQA 5J2QB 2RDIA 3QZ7A 1TL1A 1TVRB 2IAJA 5EWFA 4WFYA 4FJMA 1R0AA 3QNOA 3F9KA 2BANB 2R2UA 5KFIA 1VRTB 2DY4A 3MXJA 5KFYA 2C2RA 3PO5A 3CJ2A 3SQ2A 3IGVA 1U4BA 1GX6A 5EDWA 4KAZA 4OGCA 1SKRA 4E0DA 2E4LA 2R8KA 2B5JB 1DLOA 3DLEA 3RMBA 2XGQA 4URGA 1T3NA 4OJRA 4B08A 3TARA 2HNDB 1RAJA 2YHBA 5JUMA 2E6MA 4OPJA 3T5LA 2R7YA 4K8XA 1G15A 4ELTA 3OYHA 4FJ7A 5F8HA 5HRNA 1IKXA 3MEEA 1K1QA 3SPZA 3BQ1A 2ETJA 4QW9A 4HHTA 5HBMB 1D1UA 4Q45A 1BHLA 1JLBA 2F8TA 1WSFA 1ZTTA 3VQ4A 4Z0UA 2G8UA 3RB4A 3OS1A 3K5NA 1FXXA 4CJKA 1TV6A 5HRPA 2YNHB 4BE2A 3ULDA 1S1UA 5KT7A 1LWFA 3BQ0A 4DFPA 3FDSA 5CY4A 2ZD1B 3MTKA 4CEAA 4M3YA 4IG0B 2IM2A 3P83D 4DL7A 2FVSA 3C6TB 3V6HA 3L2VA 3G10A 4JRQA 2HNZA 4RW8B 2GBZA 3DLRA 1RDCA 3TAQA 4CERA 4PY5A 4N56A 3TAGA 3H98A 5J1EB 1T05B 1NHVA 3VQ5A 3MF5A 4NLYA 1I6JA 3FQLA 4RUCA 1BCOA 3O3FA 2C2DA 2XRIA 2IJNA 4PQUB 4PWDA 2YHAA 1S9GB 2V9WA 4BWMA 4X2BA 4IH5A 4QPXA 2QK9A 4O3RA 4H4OB 4FLWA 1A5VA 4FM1A 3I0SA 4Q8EA 4KHWA 1TKXB 4AHCA 5CYMA 2G8VA 3DOLB 3ASMA 4ZHRB 1ZETA 4NLQA 3WNGA 4J9QA 4IKFA 1RT6A 1T03A 3DOKA 4DWIA 4HCBA 4CF1A 5DMRA 2IC3B 3HVAA 1J5OA 5L9XA 1RYSA 1ASUA 1MMLA 4ED1A 3OSPA 4N41A 1IKVA 4CIFA 1NKEA 1WSJA 2DPIA 3K2PA 4M42A 4TY8A 2E9ZA 2B6AA 1HJRA 2WK4A 1SH2A 1HMVB 1VSEA 3LAMA 4M3WA 3CWJA 3T3FA 4DEZA 5KFFA 5DGAA 3KNAA 4RW9A 2WONA 3KJVA 4O44A 3N6MA 4CK2A 4NLSA 2F8SA 4ECQA 4RW4A 4NLVA 3LZIA 4EO8A 4CHYA 1JLCB 3OS2A 3LWMA 3MFIA 3UIQA 3CJ3A 3OYKA 2RF2A 4O0JA 5KGWA 2UVWA 3AA5X 4FZXC 2VG7A 3V6JA 2OPRA 4NCGA 4IH6A 1RTDB 4E7KA 1KRPA 4Q43A 1WN7A 1RILA 2AX1A 3SFGA 2ATLA 2YNFB 3N6NA 5KFEA 3V81B 2HHQA 4OGEA 2VG5A 4KO0A 4AHRA 4CJ5A 3PX0A 3ZT3A 4WZMA 3M8RA 4RNHA 3KHGA 4F4XA 4NLGA 3Q8QB 5C25B 2HHTA 3MR6A 2GIRA 3JSMA 4ED0A 3RB0A 3NBPA 3QINA 4R8UA 4DL4A 3OHBA 1D5AA 4ZTJA 1GOAA 4C8MA 2C2EA 4YR3A 3DI6B 5CZ2A 1LW2A 4DFKA 4N5SA 2G8FA 3OYGA 4NCAA 4QCLA 2KFNA 3EPGA 2BE2B 3S3NA 3QEPA 1S6PB 3MR2A 3Q8SB 3IRXB 3I5BA 1TK5A 3O4QA 3M8PB 3AO1A 4KTWA 3ISNC 2GIQA 4F8RA 2D41A 1JLFA 2OPSB 1HARA 4IFVB 4DF4A 1S48A 5DG7A 1QHTA 3MECB 1RBSA 4O3QA 5HROB 1TKDA 3LDSA 3OYBA 3SJJA 3SZ2A 4BDPA 4DQSA 4DTSA 3AVAA 1RT4B 1S1VA 1XHZA 5KG7A 3N6LA 4OPKA 3ZSRA 3K59A 3G6VA 4CCHA 4CEBA 3I5CA 2W9CB 4DTPA 4FXDA 3JYTA 4DL3A 5KG3A 3THVA 1NK7A 4FZZA 5DK5A 3DRPB 2OPQB 5DLGA 1GX5A 3MEGA 2JC0A 4CFDA 2J6UA 3K57A 3I0RB 3MEDA 4KRFA 2RKIA 4JS5A 2UVRA 3DLGA 2YKMA 1WAFA 4F2RA 1VRUA 2FJXA 5F8LA 2YNIB 1QE1A 1JKHA 1RT5A 5KFZA 2XC9A 4DU3A 2VG6A 1C2PA 3QLHA 2JC1A 1C0TB 1N6QA 4YFUA 1RT1A 4DTMA 1SH3A 2IOCA 4KFBA 4R5PB 3RAQA 1S6QB 3OYAA 2XY8A 4I7FB 1RT3B 4CJPA 4IKAA 2D0BA 3ZSVA 4K4XA 5FRMA 4DLGA 3AVKA 1ZTWA 3TWHA 4RW7B 3H4DA 4EZ6A 3GIKA 3OHAA 4ECYA 4DQPA 3TAFA 5KFQA 4FS1A 1BQNA 3HYFA 4TYAA 3O4NA 4FJLA 1CLQA 3ALYA 1Z25A 5KFHA 4E7IA 4I2PA 3NHGA 1L3VA 4G1QA 4ELVA 2OYQA 1RTJB 2WB4A 3MR5A 2G8KA 1KHVA 2P51A 4CEQA 4FS2A 4O55A 5K14B 5D3GB 3VQSA 4TQRA 3OYJA 5J2MA 4KHRA 3IS9B 4ECUA 3AA2A 1BQMA 4U6PA 2PY5A 1RTHA 1S1XA 3BREA 2X6SA 1QSSA 3TAMA 3VN5A 4XO0A 5KFXA 3KLHB 3RMCA 3VQBA 5JS1A 1S97A 3KHLA 3FFIA 3WNFA 3KK2A 3H2LA 4MK7A 3H40A 5KFOA 3RRHA 4KE5A 4EYHB 3AVBA 4Q5VA 2D0CA 1S0MA 3B6PA 3V9SA 1X9WA 2E9TA 1C1CB 1FKPA 4DMNA 2UUWA 2P1JA 1JLQB 3PO4A 1DTQB 2JEIA 1KLNA 3KLGB 4EBDA 3BSAA 4DTUA 2FVPA 4O4GA 3V9WA 3RMDA 2IA6A 2OA8A 1RDBA 1JX4A 3AVMA 2HAIA 3QEIA 1C0UA 1ZYQA 4RNNA 3IG1A 1RTIB 3DMJA 3LAKA 4GW6A 4ECWA 4Y34A 1LV5A 5L1KA 4FJNA 4GVMA 4IOBA 3TABA 4O3OA 2I5JA 4W5RA 1TK0A 3HHKA 2FBXA 1NK0A 3V6DB 2A1RA 1SKSA 1QUVA 3SNNA 4IDKA 1B9FA 3RR7A 4AHVA 2R2TA 3GV5B 4IG3B 2IGIA 1Q9XA 4IBNA 4HVJA 4B8CA 2Y1JA 1HYVA 4KTQA 3M8SA 4CJVA 4J9MA 4KHQA 1XR7A 3E01A 2FC0A 2JEFA 2IS3A 2AGQA 1NK8A 3SPYA 1HNVA 1BI4B 1QQCA 4IFYA 1HQEA 4DG1A 1XWLA 3M9MB 3L2QA 1J54A 3I5AA 3DRSA 4ZVHA 4MQ3A 4J2DA 2E6LA 1UWBA 1BL3A 2KW4A 1TKTB 5HP1B 5F8IA 4WXOA 2DFHA 1LWCB 1YTUA 3BDPA 4DSIA 3DYAB 2ILZA 2J6TA 4TSXA 5J2QA 5KT5A 4J9KA 1NKBA 1TVRA 3C6UB 1C1BB 4FVMA 4ZMMA 2PZSA 2BANA 4I9QA 1VRTA 4FLZA 1JIHA 5T14A 4OKEA 4Y1DA 5KRSA 4FW1A 1HYSB 3HM9A 3KK1B 5KT6A 4MK9A 3ZT2A 3NCIA 4BE1A 4MH8A 1WNSA 2B5JA 4DSJA 3MXIA 2FVRA 4L8RB 1Y97A 2LSNA 3VQAA 4G3IA 2HNDA 4KKOA 3QNNA 3VQ8A 1C0MA 4DLEA 4Z4HA 3KHHA 1WNEA 4OKKA 3G0ZA 4CESA 3DDKA 4ED2A 4YP3A 5KG0A 5HRRA 1KTQA 1D0EA 4IRKA 3QEVA 5HBMA 2G8HA 3TVKA 4O0IA 1KHWA 3PJXA 4C8LA 2RPIA 3CFRA 1WSGA 3RB6A 1S10A 4E1MA 3VQCA 1IG9A 3NH2A 5C24B 1EP4B 2YNHA 3DRRA 3MFHA 2Z1HA 4J2BA 3NMAA 4CJRA 4M3XA 5KFRA 2ZD1A 4CFCA 4FJ5A 1S49A 2UVUA 4IG0A 2HMIB 4CGGA 5DQGA 3C6TA 4E89A 2HVIA 4RW8A 3RBDA 2OZSA 2D5RA 2O5DA 4ECTA 2ZE2B 5J1EA 1T05A 3NKYA 4ID1A 3FRZA 1NK6A 1CXUA 2IBKA 3OYDA 1HQUB 3H5SA 3KK3B 4B9SA 4PQUA 4QWAA 4O5BA 1S9GA 2FVQA 1DLOB 4H4OA 3GYNA 2KFZA 4F3OA 2EC0A 1TKXA 3NAIA 1B92A 4HUGA 3DOLA 4ZHRA 1SUQB 2FBYA 4C8NA 2FJVA 3TAPA 1NJXA 1ASWA 3QIOA 4EBEA 2A1SA 2Z1JA 1DTTB 2IC3A 4F4ZA 2ZQBA 1QAIA 1N48A 3GILA 4CF8A 2FLNA 3H5UA 3CM6A 1ZBUA 1Z26A 3LP0B 3AO4A 5I3UB 4MK8A 3V4IB 5KFSA 4GMJB 2R8GA 4J2EA 4WYWA 4W5NA 3QETA 2YKNB 3ZSOA 2HHWA 3PJWA 1HMVA 2D7SA 2FLPA 4NLWA 4TYBA 1UOCA 3CDWA 2ALZA 3NGYA 3MAQA 4KHMA 2FBTA 2C22A 3BGRB 1J9AA 1JLCA 4F3TA 4ECSA 4TLRA 3RAXA 4ICLB 2QV6A 4NZ0A 1UA1A 5FROA 4M3UA 1RTDA 3CG7A 1TAQA 2AGPA 3EYZA 1D8YA 4JV0A 1HPZB 3AO3A 1JXBA 1FK9B 3AVCA 2YNFA 3V81A 4ZPDA 4CE9A 1U45A 5C5JA 2B4JA 3ZSQA 1S0NA 4F4WA 3OYNA 4K50A 1RA6A 3HKWA 4DF8A 1U48A 4RW6A 2AU0A 1REVB 2JEJA 3SUNA 2OH2A 1WLJA 4DTJA 2XI2A 3EZ5A 3DM2B 1KCFA 5C25A 1TAUA 5CYMB 3HP9A 4O4RA 2CJQA 3HXMA 4TN2A 2D3UA 4MFBB 5J2PB 2JLEA 3DLHA 2HHUA 4YMEA 3DI6A 3S3MA 3OS0A 1RBVA 5DLFA 4W5OA 4KB1A 3QEXA 3QIDA 3NAEA 3M9NB 2JEGA 3VQDA 2BE2A 3V9XA 4JUZA 1S6PA 1SV5B 1D9DA 3IRXA 2KZMA 4CIGA 3KLVA 2I1RA 1CZBA 3M8PA 1GOCA 2XY6A 1NK4A 3SI8A 3KOAA 2OPSA 2W8LA 4IFVA 2WCXA 2DPJA 3OVNA 4PUOB 4BDZA 3MECA 1I3AA 1JLAA 5HROA 1XR6A 4CJLA 4W5QA 3NF9A 4CJTA 4LSNB 1EETB 1RT4A 3EPIA 4XPCA 3RMAA 4CJSA 4QWEA 3A2FA 1RT7A 2W9CA 3KKSA 3SI6A 3HJFA 1S1TB 2HWIA 3G86A 1S9EB 2R8HA 2E9RX 3DRPA 4EP4A 4FM0A 3KLIB 2OPQA 4NCBA 3T5JA 1VSMA 1FKOB 4JRPA 4OKJA 4F4YA 4F4KA 3I0RA 2JGUA 3BJYA 4ID5B 3QERA 1KVCA 5KI6A 3D0PA 5F9LA 3CFOA 1U47A 5SZTA 4UQGA 3SQ0A 2X78A 1SH0A 1VK0A 5KFNA 5C42B 2YNIA 4IRCA 4ZP9A 4FLXA 1C0TA 4R5PA 1JLGB 4EP5A 1S6QA 2XY7A 4I7FA 1RT3A 4NLXA 3H5YA 3PVXA 3M8QB 1L3UA 3K5MA 1TGOA 3SCXA 2ITGA 4MKAA 4FK0A 3S3OA 4RW7A 1U49A 3PY8A 3T1AA 2ASDA 4K4SA 2V0NA 4ED3A 1NOYA 1LW0B 4M3ZA 3QGGA 4IR1A 3CFPA 3NF6A 5KFVA 4TQSA 4DQRA 1LWEB 3NGIA 3OYIA 4FLYA 4I2QB 3T5KA 1TKZB 1MU2B 4CJEA 1RTJA 4B3OB 3ITHB 2G8WA
chains in the Genus database with same CATH superfamily
2Q31A 5HVGA 3MUMP 2Z2MA 4FVCA 4C3LA 4X64J 5D3GA 1F9EB 3I33A 5HL7L 4IO9Q 3UN2A 1IKWA 2A2DA 3KLHA 2ZJQL 2AT1B 2DFEA 1NJWA 1HA1A 3PX4A 5T7LA 3D28A 1TL3B 2GGPB 2DGXA 1B4SA 3OVAA 4G1PA 1Q53A 4FJXA 1Q8BA 1EAYC 2DPNA 1U2FA 1DQ8A 5DM6Q 4EIAA 3OL6A 4F50A 5C15A 2JVOA 3P49B 3ZX0A 1WAJA 3FZLA 3A3OB 1RQ0A 3MAAB 4GKKF 3GV8B 1K0VA 3C65A 4R79A 3R6GB 2O8CB 1HNWF 4FWMA 2B8PA 4URSA 5CYQB 4RO0A 2QA4S 3RBXA 1YTYA 3VGUA 3VEOA 3I8BA 1Q16B 1YG0A 1NSPA 1VQMS 3QYYA 5C2GA 3V6DA 1HKBA 2P9IB 2RQCA 2QTDA 1HNIB 4MKBA 4LFAJ 1UVLA 3BEXA 3NFAA 2QO3A 3GG0A 1KDNA 3H0PA 3K8WA 1F1BB 1UFKA 2DD8S 3OL8A 3CCRS 4CHPA 4BR2A 4WE1B 4ECXA 1RBTA 3O6WA 1YI2S 2COLA 3DCAA 2BOPA 4L75A 4XIUA 4NYNA 5HP1A 1SBRA 1VSHA 1N4LA 1OJ4A 2WRMA 2UXDJ 4AH9A 2CPJA 3DYAA 2VHGA 1Q18A 1NDLA 4DR2F 5HLFB 1HNXF 2DGSA 3MD3A 1RISA 4CYUA 1C1BA 4ZCMA 3LF0A 2K2PA 2WVBA 5H9FK 5ADXA 3CF5Q 3WHIA 2UU9J 3SK3A 3LP1B 4IOXA 4ETZA 1VC5A 2F9WA 1XMQF 3O1BA 4EUVA 5CH7B 4K41A 4E3SA 2UUCK 1NK5A 2PMZD 3QZ8A 3A3NB 5KG6A 2VOPA 1I94K 5CD4H 5F2RA 3F73A 1ACMB 3ULHA 4Q44A 5FDLB 3IWLA 4QIEA 1Q5VA 1WTBA 5KAKA 1RHKB 3CCSS 1NUEA 4F0HA 2HSTA 1ZBTA 4ZVEA 3SLCA 4LRBA 2CYYA 4FJ9A 3TUJC 4I9LA 5JVHQ 3IMQJ 1FO1A 3OTOF 3ZFVA 5C24A 1XNQF 2OKQA 4X65K 4OLAA 4IR9A 2XCPA 1NJYA 4ELUA 2QLJB 3THYA 4Z4IA 2IM1A 4V1Ak 4Z7CA 2HQIA 1Q4RA 4X4RA 4O3NA 1VFJA 4B9NA 2V8VA 1FXLA 4CHQA 4CZMA 1ZS6A 3VQ6A 1IO2A 2HS4A 3EDQB 4WFNL 2KYZA 1RGVA 4M3RA 2AWZA 5IM0B 2VDHA 3EMTA 2XMAA 4GVBB 2MKIA 1NMDA 4BRGA 3QO9B 3THPA 1O0PA 1XIQA 1S1WB 2RUSA 1EQYA 3NE6A 1R7IA 4QS9A 4HH1A 4URQU 4FYVB 2MY7A 1XTZA 2BGGA 2DNYA 4JK8A 2Z30B 2IJFA 1S6OA 4DQIA 1SUQA 3FLCO 5DQHA 4N47A 4S0MA 1VSIA 3ZZUA 3O80A 4NLOA 1WC1A 1RNHA 1YX2A 2VQEF 3VTHA 1JXLA 1WEXA 3V4IA 4X4VA 1KTVA 1TP7A 2YKNA 2BJ8A 1S7IA 3BF3A 4FPBA 4AM6A 3CC7N 5F3ZA 2ZWHA 4HHHA 1JK9B 3M05A 4F2SA 1IKXB 4IOAQ 2R2SA 2P9EA 1C6VA 4BR9A 2I2YA 3BGRA 2C2ZB 4Z37A 5CE3A 3NGTA 3C66A 3CIZA 1ASVA 4AXIA 2CA9A 3L4BC 3R5GA 3M4XA 5KG5A 3UO0A 4JHDA 4YB6A 5G4DA 4QAGA 3PW7A 7FDRA 1PYOB 1FJ7A 2OJ3A 3KTQA 4OJ1A 1FK9A 4WWSA 1YBAA 1S1UB 3THXA 1PBUA 4RNFA 4P2SA 2FHOB 1O1WA 4DR3J 2F96A 3CDUA 2Z57B 3NWRA 2VWKA 3TW0A 5A0YA 4ZP8A 2VU5A 1VQ5S 3TJAA 1EKSA 3ATUA 3BPSP 1BIUA 3I55S 2BH1A 1JL1A 1LAVA 4ECRA 5ETRA 2DYAA 4JV2A 3IAYA 3CNQP 2HFNA 2GV1A 4DSFA 2HBKA 2EEYA 3PRDA 2H5IB 4PWDB 4KH5A 4CF0A 4QYZK 4JKGB 4CFBA 5E7OB 4QIFA 2GC8A 2O8FA 3M2VB 3I0SB 3C15B 3K58A 1NHUA 4LF5K 2GELA 3L3UA 2ACYA 5GAGP 1E6VB 3I6PA 2MQOA 5GMEA 3KIOA 1RT6B 1T03B 1X1PA 1HNZK 3IGNA 2Z2YB 4DMZA 2G0CA 4RLEA 1RCHA 1R31A 1YAGA 1J5OB 2XCAA 1X4EA 1LEOA 2AJ2A 2XWYA 1DARA 4HTLA 1UAWA 1NOZA 4UT4A 1NBWA 3FR0A 5KGXA 3KLIA 1OYEA 2QA1A 4TY8B 3RR8A 2B6AB 3O3HA 4C0BA 2DHAA 4ID5A 3MTJA 5KFKA 1ZA2B 4H54A 5T41A 5KFTA 4O44B 1Y00A 3SUPA 5KT2A 4A8SA 1RP5A 3FBBA 3U1MA 3H4BA 2X1BA 1VQYA 1WOPA 2HPUA 4FK4A 5E0OA 2MSSA 3DKDA 1IBMF 4YOXA 5JS2A 2FYXA 1NGEA 1MA9B 3M8QA 5AT1B 2EWSA 2CZ4A 4TXSA 2AZ1A 5LMNF 1TYQB 1B99A 2Q66A 1VHFA 2QA4N 1DQAA 3LP3A 1KQSR 4JI6K 2RAQA 1QDUB 1NNDA 2JH3A 2VG5B 1X5OA 3NVKA 4CIEA 3K5PA 4B3MK 3VESA 1ZOTA 1MU2A 3HFZB 3KWMA 4OIXA 5ETPA 2V8HA 1Q9YA 1Z4UA 1JLAB 5L1IA 4CI0B 4OPAA 3QWPA 1EWQA 1LW2B 1RT7B 4OI6A 4RCHA 2I7PA 3VZIA 3CCRN 1NCLA 1H0HB 2LXIA 2M88A 4PAAA 5CZVA 1QUPA 3VGSA 1YI2N 3D67A 3R1HA 2CDQA 2AQ4A 3FGUA 1TMMA 4JI0K 4DR1F 4IRDA 3OVSA 3W5YA 1YT3A 4Q0BA 3L6QA 3RJMB 3VQQA 4UTGA 1S1VB 4WF9Q 1N36K 4RWXA 4WFBL 3PR4A 2VD3A 3GQCA 4K4YA 1RYRA 4DL6A 1A5XA 2CJ9A 3L09A 2J9CA 4HUEA 1UL3A 1UEVA 2E5GA 4Y1CA 1M5OC 3MEGB 3UVJA 3DLBA 2BJ1A 3HP6A 1SQKA 3HPGA 2YKMB 3CXCM 3DXBA 3TA1A 4UOFA 3EZWA 2MSTA 4LSZB 1HHTP 3QLHB 2FPHX 2DY1A 1RLDA 4Q2LA 3BS9A 4GO5X 4A46A 4DSKA 5KOXA 3CCSN 1KP6A 3Q8RB 2NZTA 4FCYA 3CJ4A 5DGBA 4YY3J 4CK3A 4ILJA 4OL8A 1WSEA 2FLLA 2B9XA 1BQNB 3PW0A 4YOWA 4YNQA 4I2PB 2NRWA 1NMNA 1SKWA 2E44A 2DNKA 1NH8A 2QFJA 1O6XA 4QYRA 3H7HB 3L7UA 1CEZA 4FJHA 3WBZA 5ADXH 1UVMA 5J2MB 2HG4A 4JD2A 3AA9A 2EG2A 4B9TA 4LD0A 2BZ2A 4DN0A 1RU2A 3FCWA 2FSJA 2C2MB 1RTHB 4D3GA 4E19A 2DITA 1NLKL 3TAMB 1TL5A 2GVZB 1V3SA 2ASPA 4ZVGA 2UXCJ 4I4BA 4AF1A 4LH4A 5AQXA 3PIOQ 3V5RA 4E7JA 1AXQA 2KQ2A 3KJNB 1S0OA 3NGKA 2QLFB 2XSJA 4FNHA 3UE2A 2Y1LB 2IYIA 2X7IA 3HVTA 4FSVA 1XMOK 2ZH5A 3P1GA 3LH2S 3EY1A 1T6CA 1FW6A 4XAKA 2FJEB 3HPOA 2WSEC 3WC0A 4B8AB 1C0UB 1N5TA 4DS5A 3PSIA 3ULEA 3IG1B 5I42A 5GAHI 2WTFA 4H4MA 3DLLL 2GQQA 4G65A 1EQMA 1MG7A 1IBLJ 1RAFB 1JQGA 3I9ZA 3W8GA 4G9ZA 1JLEA 2C28A 3MMAA 2BKNA 4LSLA 1WC4A 2RSQA 5CZ1A 2KXHA 2CJYB 5KT4A 5KFAA 3SQ4A 1WACA 4NYZA 2PEHA 4K0KF 2P9KB 4XK8C 4EZ9A 3GSDA 4CFAA 4V19X 1RWKB 3LWLA 2B3TB 2UUAK 1HNVB 3K89A 2W2MP 4BRQA 3TVZA 1NSAA 4IFYB 1HQEB 4DG1B 2DGVA 4WU3A 4HWIA 3NH1A 2HZAA 2FY8A 2VGNA 5IC6B 3HHEA 4ZP6A 4IO9L 1FWLA 4HDHA 2QMWA 3NF7A 4NXNF 3BY5A 3I55N 4A8QA 2IAJA 4DPOA 2DR5A 1Z1ZA 4IOCQ 1TFWA 1FXDA 3F9KA 2R2UA 3M1FA 3A8YA 1VRTB 1NM2A 5KFYA 3MCMA 1CJUB 1RDUA 4CM0A 1GX6A 1EX8A 4KAZA 2J0WA 5IT4A 1PSDA 2CPEA 2QLWA 3LM2A 2E4LA 2QWOA 5DM6L 3KG4A 3D9BA 3DLEA 2NXCA 2PDAA 4ZS6A 2CQ4A 1VAZA 1RAJA 2JZ5A 4NMLA 3M8YA 2GHVC 2R7YA 1VYAA 3GBTA 5JJBA 1SVDA 2C2OB 3OYHA 1VJWA 4OX9K 4I6AA 4AE5A 3CJKA 1RWXB 1FESA 4OYPA 3U4LA 3I4HX 4J7CA 1RWOB 4HHTA 4Q45A 2GNKA 1AYEA 1BHLA 4C8YA 2E7WA 1ZTTA 3VQ4A 8ATCB 2N7YA 4HVZA 4Z0UA 1KVKA 3RB4A 3ZNJ1 2V2KA 3OS1A 3K5NA 2PFFB 1FXXA 3LL3A 3CE8A 2X3DA 1M5SA 3S8SA 2EFNA 5KT7A 5DZ7A 1V4TA 2P9NA 4CEAA 4M3YA 5CXTA 4I0WA 2IM2A 3CPWR 1U8WA 1T3OA 3S1TA 1APSA 3P83D 4N7TA 3GJTB 3V6HA 1YJWS 1U1OA 1CULB 4FPIA 3DLRA 4UY85 3Q8VA 3R97A 1U24A 1B0PA 3N28A 5J1EB 4B3TJ 1RHJB 4P6QA 2YKOA 4X64F 1I6JA 1MROA 1TZ0A 2GW8A 3VAKA 2C2DA 1T9TA 3FEYB 4CDIA 3Q24A 4FF1A 4DB3A 3D2FB 2OANA 2GQ2A 2QK9A 4O3RA 4H4OB 4FLWA 3CF5L 4KHWA 1TKXB 5CYMA 2ZHOA 2CPHA 2B0GA 4J9QA 4IKFA 1F2GA 3MEKA 5IQ6A 1OH5A 4DWIA 4ILHA 4CF1A 2E29A 1RWNB 2UYTA 4LR8A 1GTEA 2CG4A 4HLBA 4FYYB 1HNWK 3OSPA 4N41A 1IKVA 4KGMA 3MMBB 2NLXA 1NKEA 2QWRA 3C7NB 4M42A 1S72S 1HJRA 1SH2A 4C11B 4KBOA 3CWJA 5MLCQ 2PO4A 3GFHA 3CD7A 4MDAA 3JTPA 1NPKA 2VGMA 1WSRA 2G2OA 5JVHL 2F8SA 4EO8A 3OS2A 3LDQA 3KFWX 3MFIA 5CQGA 4WKRA 3UIQA 4JV5J 2RF2A 2MQMA 2R9LA 2UVWA 2ITMA 4FZXC 3M2UA 2BTFA 1U0HA 2ZH8A 4NCGA 2NXNA 1RTDB 4IH6A 4DPYA 2IY5B 1SI9A 1KRPA 1YSJA 3MURP 2DHHA 1FFGB 2AX1A 3SQGA 2RQMA 5KFEA 3FNNA 5LMUJ 3C0BA 2W7AA 2HHQA 5M2PA 4KO0A 4BRFA 3FBEA 1HKGA 4F4XA 1KVJA 3Q8QB 5HMYA 2L08A 4JI7J 1NG9A 1HNXK 3JSMA 2I6WA 2MXYA 1JXVA 2A40A 1WHWA 1CQNA 3T41A 3VVUA 4ZTJA 4C8MA 2UXDF 5LJ3Y 5EOYA 5EXWA 3AGRA 4F36A 4U7UD 3HOTA 3UKUA 4N5SA 3ZETA 1OKJA 2G8FA 3OYGA 4JKCA 2HQDA 1LFPA 1XMQK 2KO1A 3QEPA 3RBZA 3D3CJ 2DJWA 3NCPA 2FF3B 5GAEI 2MY8A 2HOEA 2UU9F 4KTWA 3ISNC 2GIQA 4ZVRB 2OPSB 2A10A 1I3OB 2Q6BA 4PQAA 4OZ3A 1RBSA 1W2BM 4I56A 3W62A 1WTFA 5HROB 2ADCA 4BRPA 3ZSRA 3K59A 4CLFA 3Q2TC 1BLUA 3I5CA 3TRGA 3W5XA 5H9EJ 3LPEA 1CZAN 4GO7X 5KG3A 1PAEX 1VQLS 3DRPB 3QJJA 4IOAL 1UZDA 5DLGA 1GX5A 3OTOK 1RSCA 5E33A 3K57A 3I0RB 2GUPA 1XNQK 1Q7YO 1ATSA 3CCUS 1K8AO 3DWLA 1GMWD 6FD1A 2JJ4D 1VRUA 3EICA 4ZVUB 2FJXA 5F8LA 2P2CB 3WX4A 2YNIB 1QE1A 1JKHA 1RT5A 5CHCB 2CPZA 4OZ5A 2VG6A 1X4DA 1RT1A 3JSRA 1Z6RA 3RAQA 3CJ8A 3OYAA 4CLUA 1NGCA 2XY8A 4I7FB 1RT3B 4I6WA 4CJPA 1UFWA 5F3TA 1QY7A 3ZSVA 3SBTA 5B0EA 1JB0C 4ES2A 4DLGA 5M1QA 5L39A 2BM0A 1Q8LA 4C8ZA 4RW7B 3GIKA 3CCTA 3ELHA 3SMZA 1BWVA 2E1RA 4DR5K 3LOUA 2J0QD 4FS1A 5LJWA 2ADBA 3O4NA 4FJLA 1NGGA 1CLQA 2M3DA 2HQFA 2G2ZA 4E7IA 3NHGA 1L3VA 4G1QA 3M8WA 2FZGB 2OYQA 1CPZA 3MR5A 3KJFB 2YWWA 2VBZA 1N0UA 1Q7YT 4CEQA 4FS2A 1K8AT 3OBWA 1XEZA 3VQSA 2JDJA 2FC9A 1F3FA 2M5YA 1D8ZA 2FJBB 2U1AA 4U6PA 2PY5A 1S1XA 2KJWA 2X6SA 2XEXA 4XO0A 4YB7A 3VQBA 3TX0A 3KHLA 2YWEA 3FFIA 3SBMA 2JSXA 4NZ6A 4UZBA 2AA4A 3MM6A 4U9RA 4MK7A 3H40A 4KE5A 3IWXA 4MIWA 3HJVA 4MKYA 3B6PA 3DJCA 2E9TA 1IBKK 2YHYA 2UUWA 1HL6A 2JEIA 1R8AA 4E2FB 1UPPA 1KLNA 1KXPA 2WW8A 3BSAA 4LRDA 4O4GA 3DXKB 3V9WA 2LYVA 1RDBA 2O1PA 3NNCA 2HAIA 5HOOA 1JCEA 5LL6d 1ZYQA 1BE4A 3DMJA 5C7PA 3T9NA 1WORA 3JSYA 4Y34A 5L1KA 4L76A 1M1GA 4FJNA 1FX4A 4KHPF 1PCAA 4X65J 4GKJK 2OI2A 2ZOFA 5HVFA 3ENQA 3I4PA 2FBXA 1NK0A 4BRCA 3LGNA 1QUVA 4YOTA 4IDKA 1B9FA 3SNNA 3RR7A 4GMKA 4CBWA 3OHRA 2LU2A 1TUVA 4HVJA 5BPNA 2OMLA 1XQSC 1XC3A 4CJVA 4KHQA 4JI8J 1PBAA 1RAGB 3IKMA 1BI4B 1QQCA 4HACA 3L2QA 1ELOA 4CRJA 3C6HA 5AQJA 4BRIA 1IWGA 2H5JB 4OI0A 3UCUP 5F8IA 3G82A 3UDVA 3Q22A 1VLYA 1YJWN 2DXDA 2HK3A 3FVYA 2J6TA 5J2QA 4FF3A 4J9KA 1NKBA 5K9FA 2FJDB 4PZVA 2ZH9A 4OQJA 4JKAA 4OKEA 5KRSA 2MYFA 1D09B 1SXLA 3G71N 2QGFB 4WF9L 1HYSB 3ZT2A 1O5JA 4ZLJA 3FZFA 4MH8A 1WNSA 2B5JA 4Y0WA 3J81U 1MSWD 2EFVA 2RMLA 1HI8A 4ALZA 4IDHA 2HRUA 1Q1KA 2LSNA 3VQAA 4ANEA 3CJ7A 3KHHA 1WNEA 1FVQA 3DDKA 3VF0B 4ED2A 1ZPVA 1IBMK 2K8GA 1F9HA 4ID8A 4TLQA 3AARA 3PYEA 4BRMA 1KOOA 4IRKA 4OHYA 2XS2A 4H0OA 3LA0A 5LMNK 2DR7A 3TVKA 4JI5K 2GCFA 2CIMA 2RRAA 2XSFA 2CQ2A 3HBTA 3OT9A 3JAMU 1S72N 2VB6A 2CQPA 2AYGA 4E1MA 1ZAVA 3PLAA 2F1FA 2YPYA 4M3XA 3OA9A 3C14A 3MM7B 5AQFA 2ZD1A 1RAIB 3ZX2A 4CFCA 2B56A 3E1YA 3B82A 1N34J 5DDOC 1ZH5A 5AXMA 4A4JA 5E3CA 4MYTA 2QSWA 4DCOB 4ECTA 3R3LA 2O8BA 3W1YC 5AQUA 4ID1A 1WDDA 3FRZA 3CC2S 3PTWA 4A61A 1NK6A 1CXUA 1HQUB 1RAHB 4B9SA 4QYZJ 2E2PA 5LJVA 4PQUA 4O5BA 1S9GA 1LCUA 4DR1K 4OYMA 2I38A 2ZUAA 4M5NA 3GYNA 4RWTA 1XUPO 2J9DA 2BJDA 2AP6A 3NAIA 4DPUA 1VQPS 4YB5A 2NRTA 4C8NA 3TAPA 1HNZJ 3QIOA 4EBEA 2F5GA 2EWHA 2GZOA 1R59O 6AT1B 3EWGA 3HLUA 3PIOL 2ZM6J 3D6RA 2ZQBA 3TZZA 4PYDA 2ZH7A 5A2QU 3CM6A 1NRKA 5KFSA 2R8GA 4J2EA 3QRPA 1V3RA 2HEKA 1VQNS 1WOOA 2DEJA 2HHWA 2O8DA 3O9TA 3ZZTA 5AE3A 2D1CA 4TYBA 2NQPA 1N88A 4TU9A 4ZOSA 2W2NP 4ZLNA 4WP3A 4DKWA 4C98A 4ISFA 3OW2M 2GJIA 1WC6A 4GV9A 2FBTA 5A8WA 3GR1A 3EGNA 2DRDA 2YTCA 2NXUA 2MMYA 4ECSA 4WFAQ 1Q81O 4NZ0A 1VQLN 4M3UA 3F41A 2RE2A 3CCUN 1BUPA 3V81A 3VEXA 4YY3F 1UETA 4LBHA 4ZPDA 3AGKA 2BYCA 3P4UB 5C5JA 2YI1A 2V2VA 2E2NA 1U48A 2AJ0A 2MZQA 2IVFB 5ADZA 2ATCB 2CPXA 1SKUB 2W40A 1IXKA 1KCFA 3L95X 3H20A 2P6TA 2OEMA 3HP9A 4WK3A 2FJAB 4ZN3A 4X62F 1QZ5A 4MFBB 3R9PA 3IRWP 1TYQA 3ONQA 1RBVA 2IFXA 3G8SA 2XZTB 3M9NB 3M30A 2N3LA 6FDRA 3VQDA 3ZNUA 4MKVA 3V9XA 1S6PA 4IOCL 1SV5B 4WQ5C 3KLVA 2WAQD 2XY6A 1GOCA 1Q81T 3W64A 2XYPB 3SI8A 3KOAA 2W8LA 2HRTA 4GVLA 2UXCF 3OVNA 3D1OA 3HZ6A 2BUNA 1RK8A 1JLAA 3EE3A 3F56A 5GADI 4CJTA 4LSNB 2BV3A 1EETB 3EPIA 4XPCA 3GFXA 4CJSA 1RT7A 2JNJA 1S1TB 5DJBA 1S9EB 2K1RB 1H74A 1R8BA 4EP4A 5IV4A 1UEUA 1DAXA 2V69A 2J8SA 1IQZA 3T5JA 4JRPA 4OKJA 3QFHA 3W0LA 1ZPWX 1H3DA 3QERA 2CDRB 4U8YA 1BY9A 3D0PA 3DOMA 3CFOA 4J8FA 3J81O 3AD8C 5HQ8A 1IBLF 4BRHA 1Q5YA 1C0TA 1OVYA 4K0KK 4R5PA 1N5VA 2XY7A 4NLXA 3TTFA 3LGHA 1V5IB 3AB4B 3VF2A 3HI9A 2E66A 5AQTA 4DX8H 4MKAA 4FK0A 2JVRA 3MUTP 2RS2A 9RUBA 3CIMA 3PY8A 2MDAA 4K4SA 2P6SA 3N4WA 3SSSA 4IR1A 3CFPA 3NF6A 3KWIA 5GAEP 3MWBA 4LIWA 3T5KA 1TKZB 2NCKL 3OTEA 4YDXA 4CJEA 5FPNA 1AT1B 4JYAK 3ITHB 4F67A 4OJGA 2G8WA 1V9OA 3WQTA 5EU7A 5KPTA 4KI6A 2Y1IA 4G1IA 2KKZA 3PYGA 3NY0A 3UDLA 3KLEB 3IS9A 4EHTA 3NRBA 4OV1A 5AQQA 2Z56B 5KFJA 2ILYA 4QIGA 3QGHA 4CEEA 1CZ9A 3DHWC 1CJVA 1N5YB 2W9AA 1W0HA 3VMFB 5F8JA 5L1JA 2PFDA 2OZMA 5DG9A 3U9DA 2O67A 2HLTA 4H0VB 2JOQA 1SJQA 1WSHA 2GVDA 5A6PA 1N6QB 3FEZA 2UVVA 1C1CA 2QTWA 1BIZA 1GLEG 4BC3A 2YX1A 4DR6F 3CD5A 4CO2A 4DV3F 4CJQA 5AE2A 2UUTA 1OSCA 2J8AA 5A2QO 3UPFA 3MMCB 1S6UA 1K6YA 3MM5A 5A6WA 3FQKA 4E1NA 3QFUA 2DXEA 4B9MA 2Z1IA 2BM1A 3CULA 4Y6IA 4GRSA 5B0BA 4FOIA 1VBXA 3UN5A 4BDYA 4A8WA 2MLZA 5THWA 4NYPA 4DCJB 3AY0A 3RRKA 1QZ6A 1W2IA 4PCQA 4AL6A 5BRFA 3NGZA 1KC8O 5HMZA 4DV4J 3BSCA 3MWTA 4KV8B 4X64K 2AV5A 3FFKB 5KFLA 2VONA 1WKKA 3BSNA 4QWCA 3P31A 1QAJA 1M5PC 3O9UA 4LRFA 2R7QA 5ETKA 5E41A 3D6HB 5EY4A 4GY2B 2M9KA 1BCMA 4KHYA 3U9ZA 1LWCA 2KH9A 4CGDA 1VI7A 3A4TA 4B9UA 2YNGB 3KKRA 3ZSYA 3QATA 2CKWA 3TR8A 4HTUA 3DU6A 1SL0A 3RZAA 4Z4GA 2CPIA 1A7GE 3QBWA 5JMVA 4KH4A 3CC2N 3QBCA 2Z2LA 1VGYA 2ZBPA 3QIPB 2L48A 2YH0A 3CJTA 3KK1A 4JLHA 2R7WA 1FRIA 2IDEA 3CMES 4A62A 3IM9A 3UN3A 4CLYA 4TNOA 1CXQA 2P9LA 1HBOB 1KC8T 4LY7A 3WXMB 3G2XA 4LF8F 4J9UE 4O0NA 1VQPN 2UV8A 1QLNA 1T9WA 4B1YB 2F3JA 2MLXA 4DOZA 2IIHA 3RYLA 2YXLA 2HSEB 5AZJA 5BRDA 3NS7B 3VEVA 2WB1D 3U1NA 4DV0F 3OJUA 1FD8A 3POTB 2BQRA 1UP1A 2W6LA 1WBDA 3ZZYA 2WTUA 4CLZA 2HFZA 1L5UA 1VQNN 3KD1E 4PHTX 3AA8A 1CJKA 3OL9A 4H5VA 5AQGA 2YWFA 1EP4A 2DTUA 3HVRA 4IWVA 2HNYB 4XTTA 2MB0B 3H46O 1NH7A 4NRUA 2UXDK 1Y0HA 4OZNA 4TY9A 3K7RA 3OVBA 3R5JB 2WOMB 1A5WA 5BXIA 1GLJO 2VASA 2V7ZA 4KQZA 4PKGA 3GIMA 4NEYA 3BM7A 2UU9K 3P4IA 1N0VC 4OHVA 1SC4B 4KAIA 2QZ8A 3VTIA 3ET6A 4AQYJ 4LVNP 3ZTQA 5BYSA 2YPZA 4NLDA 3OR1A 3ZT1A 4RNMA 4DV6F 2VPYB 4KTZA 3VEYA 5KPZA 1R0AB 2NYIA 3H08A 2NSCA 4OV6A 2QJ3A 3AO5A 3NG8A 1YIJS 1DTTA 4FVUA 3OSNA 4GKKJ 3ZSXA 1HNWJ 3ZT0A 4O8UA 5I3UA 1IJFB 3BYRA 2O4GA 2MZTA 4GNIA 1HI1A 2XO7A 1M5HA 3NS5A 2BRLA 1YXQA 2MEWA 3OYLA 5D0GA 4BG8A 1GK8A 4HKQA 2PYLA 4AHUA 2XMWA 4DUYJ 1J27A 2D0AA 2LLZA 4YDDB 3ISND 3FZMA 2FBVA 2CQ1A 4LQ9A 1U0SA 3OYMA 4ICLA 1JLBB 2IVYA 2NREA 2B51A 4ZKAA 1ZC6A 3RVCA 4BLGA 3M2RA 1G7CB 1PC4A 1HPZA 2F8EX 3F2KA 3ENAA 3ZXWA 2NRHA 2R8IA 1GLFO 1SL2A 2DT9A 2F65A 4PXCA 1IJJA 2EBGA 3DDNA 3LTOA 2CQ3A 4U67Q 4A8MP 2XMKA 3DM2A 4UUXA 2QEXS 1PG5B 4DR2J 4X4OA 3IN5A 2RDDA 5DDRC 5HL7Q 4WFZA 4DV5F 5J2PA 2E1AA 5IQQA 3H5XA 4Y2CA 3RGIA 2QKBA 2P5OA 2ZH2A 3R1XA 2KXFA 4LVOP 3D66A 3HO1A 1XMQJ 1JL2A 4BCAA 1SIWB 3SV4A 1HFEL 4K2XA 4EHUA 5AQRA 2V8GA 4ZVSB 4KC5A 4PUOA 4BQZA 2HHHF 1FRJA 3TZYA 4C8KA 5KFPA 1U1RA 2KG0A 3NAHA 3HK2A 3AQPA 4LF1A 2Y0SD 4X4NA 3N79A 2CWXA 1Z05A 4J9PA 1IN0A 1B64A 2PSZA 2DHXA 1DKGD 4FLTA 2MHEA 5E26A 5E3PA 1NKCA 2LXUA 4BC9A 3AVNA 1HUXA 2W7OA 1FKOA 2F7TA 1NSQA 3K5LA 1Q8KA 4KHPK 5AFUA 1H2VZ 3ADAC 2YH1A 3QBXA 3SUOA 1HR0F 4BC7A 1N56A 2ASLA 5AZIA 4CGFA 1RGIA 4DR3K 4OI3A 4O3SA 2VG7B 3H1QA 2ROPA 3HHNB 3LZJA 2OPRB 3CSKA 3TUIC 4FJJA 1NGFA 3LPYA 3NXZA 1FDBA 1SS6A 3G6YA 1AB8A 2RD5C 1T8EA 2WHOA 5B0DA 1PIEA 1YVFA 3W2VB 1NGJA 1LW0A 4OLOA 4ZA1A 2W25A 1QAYA 5FLXU 4ZPBA 2BEFA 4FWRA 2R2RA 3NWGA 3MXMA 4WQ4C 3PM9A 4I2QA 3VETA 2XGPA 1WC3A 4IEEA 4C0HA 3NBPB 5AR0A 5LSLA 2IRYA 1CQMA 2ZZNA 3O1LA 2OPPA 4OYBA 2VQEJ 4CD1A 4B1ZA 4ES1A 4Z7YA 4W5TA 2OTJS 3VGVA 1R6VA 2XY5A 1C0GA 3HT0A 4FDFA 3AY9A 1I39A 3PYFA 1JJ2R 1L3TA 3V6KA 1JLFB 3KUHA 3VA0A 1TU0B 3AVLA 2BOAA 5DS7A 2BQUA 2FF6A 4EFHA 2HFSA 1CS4A 3C19A 3SSQA 3A5LC 3N0VA 4RR5A 2HBZB 1VR6A 4AHSA 3JYTB 2VZ9A 5MLCV 3DXMB 2I0XA 2MQPA 3RW7A 2CZ9A 1KVAA 3KLFA 1R43A 2MGZA 3SV3A 1OY9A 3FCHA 3DLKA 5KTQA 1YZ7A 4ZIVA 2W9BA 5EWEA 3CMEN 2RKIB 3W2WB 2W6KA 2R7OA 3QESA 1RBRA 4CO4A 3FBCA 2HURA 2FD2A 2KXNB 4CZGA 1S0VA 1H7XA 2C3MA 2FJWA 3W65A 1RADB 3M1VA 2J7KA 3M9OB 4RBUA 4QU7A 3WUHA 2HMPA 3PUFA 1N34F 4OYAA 4FF4A 1FRLA 3GJRB 4A2AA 4CO5A 2DO4A 2QX0A 5SUHA 4ZPCA 1PO6A 2XLKA 3ZT4A 4FL9A 3ILLA 1IKYA 2J6SA 3KMQA 5K5MA 5HSPA 1SQGA 2ZKUA 1WOSA 1T7PA 3VZHA 4ZVOB 2GUIA 8AT1B 2EHGA 4ZPVR 1TK8A 2W41A 4Y28C 3ZCMA 4CP5A 4B17A 3QDKA 2YVSA 4KBIA 4CJ7A 3T6BA 4ISEA 1HPMA 4ITSA 2E7XA 2PE8A 2DIVA 3J80Y 3B6OA 3SCIE 4H5RA 4O3PA 2E1ZA 1BQMB 4JI3F 4Y2AA 4QU6A 2C1EB 2ZM6F 2ZBRA 4IYQA 3AVHA 4ZVFA 4EBCA 1DEJA 4QZVB 2VFSA 3OY9A 4WTOB 2KTQA 4MIBA 4CLSA 4C1NI 2A6MA 3G8TA 1UAXA 4K7QA 2J4RA 3KK2B 2Q1LA 2OAUA 3I8DA 5J2NA 1V3ZA 2XZWA 1WWHA 4ZJOA 3WZ0A 3F5TA 1FJCA 2DR6A 3CMAS 1MN7A 3RBEA 1FX2A 1IBMJ 4DU4A 4CEOA 1YIJN 1NLVA 4A47A 3G25A 3R1LA 3MM9B 4LF9F 5ETVA 5GAHU 4CEDA 1EZZB 3QGPA 1G99A 2K3IA 3BZKA 4YY3K 3THWA 2Y0BB 2B43A 4EEYA 1LXJA 2Q6CA 4Y3CA 2HB5A 4AL7A 4J9VA 4CECA 2ZHBA 1RT2A 3VWSA 1VSJA 3LDOA 4HYKA 3MK6A 5HI7A 2DNOA 1QTMA 2Q97A 1UFLA 4CEFA 1KD1O 4N76A 4CEZA 1Y10A 4CI6A 4C7QA 1KLMA 4MJKA 2CPYA 2W7PA 1NGHA 5DDPC 3AO2A 4P2XA 2HVEA 1VC0A 3HVWA 2AEJA 2W4PA 1H6KX 3DAWA 1W9HA 4FOEA 3FKBA 3FZKA 4FJKA 1TUYA 2NRVA 4DR1J 3LP2A 1UWBB 2UXCK 4BBYA 2ASYA 3P5JA 4NLPA 3EO3A 2P9CA 2QSFA 3B8HA 2DGUA 2QEXN 1BO5O 4ZJLA 5FLXO 3D0HE 4JI4F 5C12A 4KH1B 1TL1A 1TVRB 3IR5B 4WFYA 4FJMA 1ITPA 2BANB 2M2BA 1RCOB 2DY9A 3D6MB 3PO5A 4M63A 2N4DA 3GONA 3IGVA 2QRRA 5EDWA 4NXMF 2MQNA 2XBPA 3RMBA 4EAHD 1KD1T 1H2UX 1WF1A 4URGA 2XGQA 1T3NA 4OJRA 1FNMA 2HNDB 2F63A 2HRYA 1IBLK 3K0JA 2E6MA 4PG8A 2NNWA 2XS5A 4M8LA 2BMBA 4FJ7A 2G13A 3MEEA 1X3MA 2HIYA 4PWWA 2ETJA 3ZEUA 1NXIA 3D7SB 3IR6B 2O8EA 2F8TA 1SC1B 1P27B 2V94A 3V4MA 1YVNA 1AZSA 2CNOB 2V51B 2GO9A 3KZBA 4CJKA 3AOAA 4L3QA 2IRUA 2F8MA 2XLJA 1VQSA 4ILGB 1TV6A 5HRPA 2YNHB 3DGPB 1LWFA 1LK7A 2L9NA 2EXUA 4PKDB 3SBGA 3IBWA 1XQIA 1X8DA 2VODA 1WB9A 3A8JA 1VQ9S 3OUYB 2D0PA 3JTOA 2RB7A 3R2DJ 4JRQA 2HNZA 2GBZA 2QLBB 1CVJA 1RDCA 1RWVB 4PY5A 5LXRA 2QL5B 3TAGA 1T05B 2O66A 1EQ0A 2ZVSA 2ZVIA 4LT6A 5AQYA 1BCOA 2IJNA 2YHAA 2V9WA 3D2EA 4QPXA 2EK1A 4ZVPB 3QJLA 4YHHJ 4FM1A 4LJMA 1HWLA 5GAGI 4AHCA 3TA0A 3DOLB 2G1HA 4USVA 3ASMA 5E5NA 4ZHRB 1ZETA 3PKYA 3WNGA 5FPDA 2V4JB 3DOKA 1S5ZA 1B70B 3J8AA 5DMRA 4I6MA 1HBNA 4DR6K 1RYSA 4DV3K 4X66F 1YITS 1MMLA 4ED1A 2CQDA 2HWTA 4CIFA 5AFUH 2RHKA 1JJCB 3TZWA 1BWFO 3IUCA 3K2PA 2P9SA 3GJSB 5I3PA 2WK4A 1FDAA 3IWNC 2R7UA 4DEZA 1SQEA 4OZ2A 4RW9A 2WONA 3KJVA 1IQTA 3N6MA 1U1QA 3PSFA 1YJUA 4NLSA 4RW4A 4NLVA 4EWTA 1JLCB 4K0KJ 2GHWA 3OYKA 3AA5X 3I56S 3H25A 2XQCA 3GSIA 5HK4A 1MWMA 5CABA 4F7VA 5AJ3F 5HJYA 4NI2B 3ZC4A 1RILA 4DV4F 2ATLA 3N6NA 5AQPA 3BO3A 4AHRA 2XMJA 4HI2A 2D3OR 3M8RA 4A57A 1B7YB 3MD1A 3WIUA 4NXNJ 3Q8UA 5C25B 4P72A 2GIRA 2V5HG 3D0IE 3GJQB 2EFPA 2AW0A 4ED0A 4R8UA 4AXJA 4DL4A 3WC2A 4WQ5A 5EX0A 2C2EA 5ETLA 4YR3A 2R4FA 4IXCA 5CZ2A 4EMDA 1RJJA 5ETTA 2GHPA 3M32B 4NCAA 4QCLA 2I7NA 3KYLA 3EPGA 2BE2B 3AHPA 5IT9U 2XNQA 4UOGA 1DBDA 3MR2A 2OD6A 1H2TZ 3O4QA 4F8RA 1N54B 2KT3A 1TL7A 4LF8K 3CJSA 3TR5A 4IFVB 4DF4A 2M8HA 5HJXA 2RHSB 3PNIA 4O3QA 3OYBA 2WC9A 4BDPA 4DTSA 5HANA 1XHZA 4DV0K 5KG7A 1HD1A 3N6LA 3G6VA 4FXDA 3HRGA 4JV5K 1LWXA 3FCVA 3THVA 2YCHA 1FE4A 4JOUA 1A6LA 2QN6B 2OPQB 5F0XA 1A9NB 2LDYA 4CFDA 4G6VB 3MEDA 1X5SA 3A5MC 4JS5A 2J0XA 3S6EA 2UVRA 3DLGA 3BZQA 2GA7A 4ZJQA 5LMUK 4F2RA 4CIOA 3LDLA 4LF6F 3GZ7A 2KI2A 5KFZA 3MM8B 2AJFE 3O4WA 3CMAN 2D74B 4YFUA 1N6QA 4DTMA 1SH3A 3LO3A 4JI7K 1XERA 4C3KA 3WX8A 5G0RB 3JAMY 2W2PP 5LJ5Y 2N4CA 1QJHA 5IS2A 2N7CA 1T9XA 3HDSA 4U67L 3AVKA 3ENBA 2JFKA 2QWNA 2YBVA 3H4DA 1KN6A 4EZ6A 3OHAA 2VFVA 3MMCA 3THTA 2Y8WA 2VFTA 3HI0A 3R3TA 3TAFA 5KFQA 3TSPA 2ZNZA 3BH7B 4TYAA 2ASMA 1HBMB 2P5VA 3BO2A 5CZXA 4F0MA 4FP9A 4KRWA 2EW9A 4PR6A 3GE1A 2OHDA 4XH4A 1BD6A 4AQYF 4FWLA 4USMA 3TYTA 1RU1A 5D3GB 2D0OA 2BX6A 2KB2A 4ECUA 1RXOB 2NRZA 5H9EK 1UJ6A 2QT7A 2AKWB 2E88A 3VVTA 1QSSA 3KLHB 2L3MA 2EKYA 3AAPA 5T7LB 3LW5C 3CHWA 1HQ2A 4HT7A 5F0WA 3CQYA 2U2FA 1RI7A 5A2QY 3UWTA 3JXUA 4DUYF 1S79A 3EVWA 5M2UA 1J6ZA 4BR4A 2NXJA 3U1LA 2KL8A 1WC0A 2VL1A 1RKJA 2PAVA 4U7UK 2OA8A 1VQ6S 1K47A 2YKAA 5I3QA 2NPFA 3QEIA 4CO3A 4XH1A 4A48A 1NDPA 4N77A 3OV7A 3KHYA 1HBOA 1NPRA 4WP9A 1Q82O 4B3RF 2I5JA 4W5RA 3MDFA 3OR2A 3K8VA 4RX6A 3V6DB 2A1RA 1S59A 4OYOA 3R5DA 4DV5K 4IG3B 3D1HA 2DKOB 2IGIA 5GMDA 2MQQA 2Y1JA 4B8CA 3ZTRA 4KTQA 3PFEA 3M8SA 4J9MA 4FN5A 1HW8A 2H3EB 2BA9A 3E01A 2FC0A 4CT8A 4CTAA 2HYIB 2GMJA 5JVGQ 3SPYA 1HWIA 4PXDA 3J7Z5 4RUHA 1XWLA 3UFCX 3M9MB 1J54A 3MR7A 3I5AA 3DRSA 4USIA 4NL5A 4MQ3A 5AQHA 4J2DA 4EU0A 1F5CA 2QMUB 3C16A 1BL3A 2C42A 3LM9A 5HP1B 4LBPA 2PI5A 1VQ9N 3PJ9A 4WXOA 3GCWP 4B02A 2DFHA 2HHHK 3BDPA 4DSIA 3CJ1A 2ZH3A 3DYAB 2V67A 2ZHAA 4RL1A 3O9QA 2LFVA 5ETOA 2KKHA 3MN6A 3VAHA 4CYUB 2AYEA 1C1BB 4FVMA 4P7TA 2MZRA 4I9QA 4FLZA 2GX8A 5T14A 4DZ6A 3ENHA 4Y1DA 1T0TV 2V2ZA 3SCJE 4FW1A 2JFDA 1BA1A 3A5NC 4V19S 4FWNA 5BREA 1LXNA 4JEPA 4EI2A 3CB4A 5A8RA 3BKUA 2ZWOA 5IT9O 4G3IA 1M5KC 3QNNA 3DRXA 1X9JA 3R27A 3CCLS 3UKRA 3OFGA 1GAOA 2Z4PA 1D0EA 3ZZZA 2VYPA 1VLOA 2LECA 5HBMA 1VC6A 5JICA 1FI4A 4DQ8A 1YITN 1RACB 3TP2A 1WD6A 3D6TB 4USTA 5D8HB 3CDBA 3CD6S 4JI8K 3GDQA 1NNEA 3RB6A 1S10A 2ROGA 2P9UA 1IG9A 5C24B 3F44A 1UWAA 1SJFA 1N52B 4BRKA 2LA6A 2Z1HA 3MFHA 7FD1A 4UUWA 1HHSA 1S49A 2UVUA 3UD5A 4IG0A 3D4JA 4Q7AA 3C6TA 2DTJA 2HBLA 1HHQA 3I56N 3LDPA 1GXLA 2VPWB 2HVIA 2PA3A 4RW8A 4QJVA 3D1QA 2OZSA 2BW2A 4P75A 2D5RA 4GVEA 4UOHA 3NKYA 1QTNB 4I67A 2GJFA 1D4XA 1ULRA 2GWKA 2FVQA 5DZ6A 4ZCKA 1DLOB 5AQVA 4UW2A 3HF5A 2GQCA 5LSOA 3MZIA 4J90A 2E2OA 3K9KA 4X4PA 4Q2MA 2AD9A 4RTFD 1X4FA 3ENOA 1SUQB 3O6QA 1ASWA 3VAMA 3Q7CA 5IWAF 1L3KA 1P8GA 2IC3A 1OQ6A 2I8EA 3CCQS 1N48A 3GILA 4CWBA 2YJFA 4CF8A 1KS2A 5FPMA 1ZBSA 1ZBUA 2J0SD 1G6BA 5IV3A 3AO4A 3VOVA 1O13A 4BC5A 3V4IB 4GMJB 2YKQA 4WYWA 3L0QA 1VJQA 3QETA 4MTPA 2YKNB 3ZSOA 4KHPJ 1K44A 1HMVA 3CIPA 2D7SA 2FLPA 3TEGA 4NB4A 3AB2B 3UCZP 4OX8A 5BYQA 4FKYA 3AAQA 2ALZA 1I51B 2C22A 3BGRB 2IVMA 4HT5A 4F3TA 3QFWA 1N34K 4TLRA 2Z8QA 2QV6A 2XTJP 2VFRA 3CG7A 4JHDB 2AGPA 3EYZA 4JV0A 3AO3A 1FK9B 2CJKA 5CHIA 4CW7B 3GYGA 2YNFA 2CRLA 3THXB 4CE9A 2VC1A 5AQIA 1FFSB 3ZSQA 3O9SA 4C48A 1LK5A 2AU0A 2B4OA 3SUNA 2UUCF 3G4SS 1NM1A 2W2QP 1TUUA 5A0YB 1TAUA 2EC2A 2CJQA 2Q0RA 3P38A 5E3QA 2JWKA 1VIOA 3BGUA 4YMEA 4JI3K 3OXFA 4I64A 3DI6A 3OS0A 2ZM6K 4W5OA 4KB1A 4X4UA 1VQKS 1NMEB 1MMDA 5C2DA 2HFVA 3QWUA 4M5GA 1KVIA 3IRXA 3GE9A 1U02A 2KZMA 4BR7A 2O8FB 2I1RA 3M8PA 1H38A 2CG8A 3BDEA 2ZH6A 2WCXA 5GADU 4OHZA 2AJ4A 2DPJA 3VPZA 3MECA 1I3AA 2WW4A 2WVFA 4BRAA 2R3VA 4A8OA 1XR6A 4CJLA 4W5QA 3NF9A 1KKHA 1RT4A 4TVAB 4Y00A 3KVGA 3UD3P 4ZCIA 1EB0A 3A2FA 3NOCA 2BJ9A 2W9CA 3UE5A 4LF9K 3KKSA 3JS9A 3G86A 3HHLA 3PFOA 2E9RX 3W66A 4FM0A 3KLIB 2A1BA 3AODA 5CAAA 2W4DA 3MGJA 4DUZJ 1S76D 3RSEA 4F4YA 2LQBA 2LQ9A 2JGUA 4ID5B 2RT3A 1KVCA 5F9LA 3QRRA 4CLTA 1U47A 3JB9k 5SZTA 1SH0A 1VK0A 1VQMN 4ZP9A 1TTHB 3KDOA 5BYRA 4W92B 4DPTA 2VC0A 3CD0A 4EP5A 1S6QA 3U02A 3PVXA 3NMRA 3M8QB 1VQ6N 1L3UA 4O23A 3W61A 3K5MA 1TGOA 3MXHP 4WQ4A 3S3OA 1T6DA 3FSXA 2V0NA 1NOYA 1DQ9A 4FPAA 1WG1A 2ASOA 4HL9A 5KFVA 3ZZOA 4DQRA 3NGIA 2GX9A 3OYIA 4JI4K 3HSZA 1MU2B 1MWYA 3NOGA 3X1LB 1RTJA 2E1MC 3EGZA 2DNPA 5B0FA 1P1LA 1TELA 2F9JA 2DB1A 5DG8A 2Z1GA 4BGBA 5K14A 4M7XA 2BXJA 4LH5A 5KFMA 2HS0A 2NXEA 1RDAA 2MJUA 2YQ3A 3IBCB 2QIFA 4WYLA 3J7YU 1FVSA 3T9ZA 2FZKB 4JKEA 4KGKA 2QE5A 3PHTA 1DY3A 2BE9B 1ZM9A 2YV0X 1PAUB 4IZ9A 4KYZA 2GS8A 3J7AN 4Q0BB 4CK1A 1EIYB 2AF6A 4FM2A 4YR2A 3OTBA 1KBRA 4RUBA 2OSRA 5J1NA 4B1UB 4H0XB 1DTQA 1UTAA 1YJVA 3CQ8A 3AQOA 3EL2A 3KLGA 4DTOA 2IA0A 5F1XA 3EXCX 2CQGA 2E7VA 3MPYA 2BW7A 3UVJB 3OYFA 2H4WB 4M5DA 4FBTA 2XULA 2ZDOA 2OP5A 3FK4A 4NYOA 3VQPA 4OLBA 3LPTA 4M5KA 3PHEA 4P52A 4E7HA 2VPZB 3CCLN 2FHKA 1UCNA 3V1OA 1N33F 1CJTA 1YHQS 3SQ1A 4OX6A 4X62J 4WFXA 3DN9A 2MQLA 2CJBA 3T6JA 2RRNA 4KR0B 1YK9A 4UF4A 5EHHA 2ASJA 3N4QA 1NHKL 2XO6A 1MNEA 3K2YA 3CD6N 4JKBA 3N01A 3SDEA 2Z0GA 2QW9A 2KVQE 2HHPA 3FSYA 3AAWB 2B7BB 4NYFA 1Z2ZA 5AXNA 4DTXA 1WC5A 1N32F 2VA3A 2FVCA 4NZ7A 2WBRA 4K4VA 4YHHF 1PKUA 3P39A 3UCGA 4L3NA 3TVYA 1S22A 4HUFA 1WEZA 1HKAA 2PN6A 4WJBA 3C6UA 1IJEB 4CHZA 2A2CA 4JD2B 4KREA 1FKPB 5BPMA 5KFCA 2DEIA 5EVZA 1YRXA 1QSYA 1SC6A 4H0TB 3TQEA 2AP1A 2AEFA 1U04A 4OMFG 3L2RA 3D68A 4NEZA 2XMTA 1Y5NB 1E6YA 4M94A 1GMVA 1WI8A 4B3MF 3JSBA 1X3NA 2WVCA 2XSJB 1VDHA 4ZVQB 4ZTFA 4FPRA 1LNQA 3EKUA 5L1LA 3KMSA 3CCQN 3HVTB 4HR2A 5AJ3K 1QD1A 3G6XA 3L3VA 1Y3KA 3WXIA 4KB0A 4DV4K 4DTNA 2HZCA 4LR7A 3ULEB 1IR0A 3TWZA 5I42B 3A0IX 1LOUA 4H4MB 4Z4CA 2IRXA 2QC3A 3CGIA 3UQSA 4XH5A 3OLAA 1JLEB 5DQIA 4LSLB 3US5A 4J91A 3C2PA 1FF2A 1N36F 3DC2A 2HMIA 3ZSZA 2ZH4A 2W24A 2CJAA 1WG5A 1RHUB 1VQ5N 1BMQB 1BUXA 1W25A 2ZJRQ 2EFGA 2ZE2A 4USUA 2BDPA 2OGUA 4IUFA 4KT0C 3WDOA 2HBMA 4JK9A 3DHXA 3OYCA 2P9GA 1NZ8A 3KK3A 2VWJA 2KM8C 2X74A 4N8NA 4RBTA 2AJ1A 5DM7Q 2LMIA 3TI0A 3G4SN 4P7VA 3MCNA 2ZEJA 4ED8A 4KHUA 3GV7B 3G8QA 2XHCA 1R8CA 1FDDA 2JLFA 2IAJB 3Q0AA 3BQ2A 2MJNA 2A6OA 4WKYA 2C3PA 4JAXA 2G9OA 2K7KA 3CTRA 3TJ9A 3M3ZA 4DR6J 1VQKN 4DV3J 1EJ7L 2R7VA 4ILMA 4NLUA 2QYCA 4LRCA 3LP0A 3UD4P 3SYZA 1GTHA 4QS7A 4YORA 4ZPWR 3DLEB 5EWGA 4BE0A 1KVBA 2XMVA 1P9YA 2YQ0A 1FERA 4FJ8A 4DS4A 2H48B 1RDRA 4DTRA 4JI2F 3TAEA 2LXFA 2PI4A 1TQLA 1NDCA 3BN7A 4HH0A 4GV6A 1VQ8S 3G96A 1AA1B 3P8BB 5DRKA 1RCXB 1CBKA 2DR9A 2HHVA 1X9MA 4NWBA 1LKZA 1SAZA 1FJGJ 4U95A 4QR1A 2YWGA 3BBCA 3VEWA 3OL7A 4DFMA 3T7ZA 2P9NB 3W9HA 1REVA 1W97L 2DNGA 5JVGL 1D3WA 2RH3A 4AQYK 3CVKA 4DDFA 3S9HA 1HYZA 3VV2B 3G6ES 3L8BA 1IM6A 2LQJA 2MQ8A 2QA2A 1XMBA 3WEEA 4R25A 3LPUA 2ZDPA 5AQSA 5T7BA 3ENVA 1VS3A 1K1SA 1YQHA 1VQ4S 4Y2MA 4PG4A 1MROB 4GKKK 1BHNA 4MYUA 4BREA 3CCZA 1ZBIA 3DLJA 3CDEA 1SJ1A 2CVIA 3KXDA 4KIAA 1U1NA 3BO4A 1EKRA 1VQ7S 3SQOP 5L9NA 4OVLA 3W3SA 3ILOA 1KQFB 2UP1A 3GWCA 4JNEA 1ZBLA 1EARA 2G0JA 3GB0A 4LF8J 2V7YA 3L7PA 1GLCG 4A8YA 2F4VJ 4H5WA 4DBQA 4DUYK 4ZLLA 1YBTA 4ZPAA 1K8KA 3Q89A 4DV0J 1ITGA 3PACA 4WP8A 1T94A 3CJ0A 3NGSA 1WOQA 2UUBF 2CNLB 2L9WA 2IMOA 4DQQA 1Y64A 1KFDA 1IKVB 2RN2A 2QKKA 1D9FA 4IO1A 4OO1J 2CZVC 4MMOA 3AVIA 1LAWA 5FRNA 3PW5A 5C42A 4RW6B 1EHWA 4QWBA 2DGWA 2Z58B 1UPMB 1DRZA 4FJIA 5IFMA 5D6GA 2F7VA 2RF2B 1VOMA 1JLGA 3ZX3A 3M2UB 4DR2K 3KD5E 1RKIA 1U0HB 3MN7A 2PBDA 3TANA 3BR9A 1W7AA 4NCGB 1RHQB 3EXYA 4BRNA 1S7HA 3OXLA 4K8RA 3QFPA 3U3GA 1LQ9A 2DNMA 3SQGB 2H1YA 1XJWB 1HBUA 4FW2A 4QIVA 3H59A 2DHSA 2DNZA 4KO0B 4LF4F 4W98A 4B9VA 1U2VA 4DFJA 3UR0A 1QVFR 4J2AA 2IMWP 3TTCA 1YHQN 1WSVA 3NLCA 1LWEA 2W8KA 4J9LA 4OX9F 4DV6J 4J9OA 3JSMB 4UY8O 1N8RO 2CGLA 1ROFA 5A8KA 2V63A 4B3OA 1FRMA 1X9SA 4N8OA 5KG2A 1KQKA 2IVOA 4IEIA 4A2BA 4MIAA 1FJEB 3UKUB 1J5EF 3RWUA 2YKPA 1AFIA 2IDLA 5BR9A 2YJEA 4K4WA 1R89A 1EX4A 1HRHA 3P5BP 2RHQB 4BC4A 3CDAA 3ZLJA 5HO4A 1TL3A 4EGLA 5SWMA 2YY3A 2GGPA 2OFGX 1RDDA 4CJWA 5BJRA 5K8MA 4RZRA 1VISA 5F8MA 4DSLA 4LUBA 3X3UA 1H72C 1ZM2A 2GMHA 4J5OA 3I82A 4JK7A 1X0FA 2XMMA 2OO4A 2CH5A 3TNVA 3HMJG 2EX3A 4PA1A 4U7CA 4H5TA 2XB2D 2VOOA 3A5OC 1FWPA 3MAAA 1VBKA 4ATNA 2O8CA 4YR0A 3H42A 4NRTA 4UY8T 1N8RT 5CYQA 3T5HA 4DV7J 2GAHC 2J9DE 1VSKA 1VRUB 3PEJA 1TL4A 1BOTO 3ZTPA 1RWMB 1QE1B 3U3YA 1JKHB 1RT5B 1RAEB 2VG6B 2CQHA 1RT1B 4FYDA 4ISGA 1Y4ZB 5ETNA 2P9IA 3OFEA 2C2NA 4FKXA 4ZCLA 4CT9A 5CA5A 4DV5J 3MCAB 3BUZB 1HNIA 3AOBA 1VSDA 2QWPA 4I69A 3D0GE 2X1FA 5GMKa 3MI7X 4CHOA 2VBXA 2VQEK 3FGVA 3T1YJ 5IZHA 4YOUA 2N3OA 3C46A 2NYHA 5BR8J 5HRSA 3GTYX 2X6NA 1BC6A 2LEPA 1NJZA 2EPIA 1T9UA 2UXBJ 2DNQA 4WE1A 2NRXA 3LUYA 1QQMA 3CQXA 3PYDA 2B4PA 2V50A 2DH7A 4Z4FA 3FMBA 4G1QB 2YX7A 1XNRF 4IG3A 4RG8A 2HHHJ 2DGOA 2GIFA 3NS6A 5IWAK 5HLFA 3E51A 2BE7D 2E8AA 4WXWA 1R0CB 3N5FA 3VGTA 3FRYA 1GOBA 5RUBA 1S1XB 4DX7A 3LP1A 2CQCA 3OXGA 4KGXB 1HR0J 4PXEA 3NGDA 4E7LA 3SIPB 1DJ0A 5K8NA 3FFIB 3L7OA 4JB8B 1BISA 4BGAA 1KQSM 2KZZA 3MM6B 2ZOMA 2VQFJ 1U7LA 1FDNA 2Q2RA 2LQ5A 3UNYA 2SXLA 3HPHA 2V4RA 4K59A 3RU0A 2G2YA 1YUWA 1ATNA 3NF8A 5FDLA 4MLEA 4HCCA 1F5BA 4O4GB 1FNOA 3QGIA 4JV1A 3RW6A 3KHRA 4USWA 3EGWB 3IO1A 2XS7A 3VCDA 3DMJB 3ZZPA 4F4AA 2LVWA 1L3SA 2BRKA 1PILA 5MAOA 1S9FA 3CCES 1Y11A 3ICLA 4DSEA 4OZJA 5KFBA 4XEIA 1OH6A 5GVQA 4IDKB 3WNEA 1Q95G 1BG3A 4WZQA 1VQ8N 4CGIA 4K4ZA 3A8IA 3EE8A 2P9PB 5KG4A 1U2CA 3TUZC 5KG1A 3BEGB 5F0UA 4ZP7A 1A0OB 3OYEA 1C0FA 2E1YA 3IFRA 4HACB 5IM0A 2R8JA 2HVHA 3ID8A 4GVBA 2R42A 1C4AA 1T3VA 3Q8YA 4FZYA 3FBFA 3QO9A 1SL1A 1V5VA 1S1WA 1CC7A 3G82B 4WPAA 4M63C 4J9RA 2M4MA 5ELZA 1G4CA 3G6EN 5J2QB 3NCQA 2H51B 2ZJPQ 2RDIA 3QZ7A 5KPRA 1G3OA 2H65B 3QNOA 5KFIA 4X4TA 5IT9Y 3MXJA 1VQ4N 5HMXA 1SKRA 4E0DA 2VJVA 3GP9A 2A6AA 1VQ7N 2B5JB 1DLOA 4DR5F 4KJIA 3ZYYX 3PRBA 4BVOA 4H4KC 4OPHA 4LIRA 4B08A 1NZAA 4DUZF 4DV1J 3R7BB 3T5LA 1G15A 4ELTA 3E9OA 1RWUA 1YJTA 5HRNA 1IKXA 3OBIA 2E1PA 4M5HA 1JJHA 3SPZA 3CC4S 5L8RC 1Q86O 5L46A 4QW9A 1GXTA 3QT5A 1WHVA 1WSFA 3WQUA 2G8UA 1PYTA 5BN8A 1W2BR 3M6WA 1QVGR 2OLWA 2L41A 3TUPA 5FD1A 4BE2A 3ULDA 1S1UA 2E5JA 3HTVA 5M1OA 2LU1A 2JWLA 3C14B 5CY4A 5HN0A 2ZD1B 3MTKA 3M7VA 2PIIA 2NPIA 2HGLA 1DT9A 2AIRB 3CJQA 3MCOA 1AFJA 1IBKF 2WUSA 2I9SA 3G10A 2ZF5O 1R8PA 2RU9A 2WBNA 3HZEA 5B09A 3H3OB 1T44A 4DHYA 2O8BB 4JI3J 2CGKA 4DCHA 3H98A 2VBWA 3VF4A 1NHVA 2GO8A 3MF5A 1TMJA 4NLYA 2W1BA 4K43A 3SAGA 2M0GB 4ZLPA 2C3UA 2XRIA 4PQUB 4PWDA 4JKGA 3BPDA 1S9GB 1RHMB 4BWMA 5E3RA 4X2BA 4IH5A 4U7BA 5GAGU 1Q86T 1IG8A 3PIPQ 4GKJF 1A5VA 2XG8A 3M2VA 1VHIA 3HM8A 3I0SA 3C15A 2QYGA 2PGCA 2OMOA 3WXJA 1E6VA 2C2KB 1RT6A 1T03A 1H7WA 1X4CA 1VMBA 4B9QA 4HCBA 3DRYA 4FWPA 3HFVA 3QT8A 5JLHA 4LF9J 1J5OA 5L9XA 1ASUA 1NSKL 1YJ7A 2AYBA 3D7EO 2FGOA 1VQOS 3R2CJ 2DPIA 1MMNA 4TY8A