3DI6A

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
molecule tags Transferase
total genus 157
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3di6A05
4CHYA 1RT7A 3PW7A 5K14A 2X78A 2O4IA 3KK3A 2FBYA 4K4ZA 3MXMA 1WAFA 1C0TB 2XHBA 3AVAA 4CJ3A 4DTNA 1JLCB 4CJEA 3SI8A 2XY7A 5EWFA 1WNEA 2RDJA 3BQ1A 4KV8B 1S1VA 4DQSA 1S1UB 3FQKA 4AH9A 1T05B 5DMRA 2OYQA 5KFFA 4F2RA 3TAMA 1C0UB 2CKWA 2YNGA 4FJIA 4E89A 4BDZA 2OPRB 1RA7A 2UUWA 3ZSZA 3NKYA 4DL5A 4B9TA 3M8QA 4NLOA 1X1PA 3OS0A 4ID1A 1NK4A 1CLQA 1X9MA 5J2MA 4MK9A 1EP4A 3HPHA 3TABA 1KRPA 3T5LA 4OGEA 3RB0A 4Z4GA 1ASVA 1YVUA 5KFAA 2B4JA 5JS2A 1KCFA 2O4GA 4F2SA 1CSJA 4U7CA 3KHGA 4CJSA 3V6DA 4MK7A 1XHXA 3SCXA 2D7SA 5CY4A 4CFDA 4WFYA 4ZPBA 3NH0A 1KLMB 4RW4B 1U48A 3OYNA 2BE2B 4CEQA 1WLJA 2G8KA 3K58A 4KPYA 2X6NA 2WTFA 3E51A 5L1IA 4JV1A 1RT3A 3LP1A 2D0CA 3K5NA 3QLHA 4FJLA 2R7YA 4DTXA 4ZP7A 3V9WA 5L1LA 2G8HA 3Q8SB 3AA4A 3SPYA 4TYBA 3IS9A 1TL1A 3AVNA 2RF2A 4KO0A 4URQU 4FYDA 2OZSA 1DTQA 4J2EA 4FK2A 2AX0A 1WSFA 2A1RA 4OPJA 4QAGA 4F4KA 2R2UA 4K50A 1GOAA 4O3PA 1OS5A 4G1QA 5L9XA 4WXWA 4IRCA 3ZSRA 2QKBA 3TAGA 3OYEA 3NBPA 1T7PA 4F3TA 4DTOA 3DLEA 1RTJA 4WE1B 3Q8QB 3VQEA 5DQHA 4ZTFA 1SH2A 2YNFB 1N6QB 5CYMA 4EYHB 4IFYB 2IC3A 1HQUB 4URSA 5KFUA 3CQ8A 4DL4A 4ZVHA 1XR7A 5DG9A 1BCMA 1EX4A 3HT3A 3HKWA 1J5OB 4JRPA 1RBVA 1TKXA 2VWJA 1ZTTA 2QE5A 2AJQA 2IAJB 3TARA 1HRHA 4J9OA 3KJVB 3OY9A 2YKNB 4MFBA 3AVHA 4E7KA 4FS1A 2HWIA 4O44A 1NOZA 1NKCA 1Q9YA 1NK7A 3ISNC 2G8IA 1B9DA 1IKXA 4KHMA 3OSPA 2J6TA 3PW2A 4K8ZA 1DTTA 1JLGA 2HNZB 4ED0A 4FLZA 2OA8A 5DG8A 3WNHA 4RW7B 4O0IA 1D1UA 1IKWA 5KG1A 4RW6A 3T19A 4E3SA 4BWMA 5DGBA 2PYLA 1FK9A 4ECQA 4NLYA 5J1EB 1CZBA 1UA1A 1JLEB 4KHSA 4DMNA 2BANB 4CEOA 4GC6A 4LY7A 4O5BA 3C6UB 3QZ7A 5C24B 3CWJA 5CZ2A 4W5RA 1S1TB 2E6LA 2AX1A 4O3SA 4GVMA 3UIQA 1O1WA 1LWFB 3V81A 4ED7A 4W5NA 3AA2A 1BIUA 4CEEA 3QZ8A 5I3UB 5C42A 4FM1A 4O3RA 4Q8EA 4DEZA 4IQXA 2XCPA 3O3HA 1ZBUA 2HHTA 4E7IA 1NNDA 4NLSA 1S0MA 1G15A 1WSGA 3RB3A 5J2PA 4URGA 4NZ0A 4H54A 1RT5B 1N56A 2QKKA 1LAVA 4DU3A 4ID5A 1EXQA 4RNMA 4TXSA 4CJFA 1HJRA 1TAUA 4IR1A 1WAJA 1HNVA 3QO9B 4DG1A 3AVFA 3FSIA 3OS2A 3DRPA 4N56A 3SQ2A 1UWBA 2VG6B 4CFCA 2FVCA 3DI6A 1C1BA 3KLHA 4CJVA 4I2QA 3I5AA 4CGJA 3IN5A 1U45A 4KFBA 2WK4A 1LV5A 1SKSA 3MXJA 1IKVA 2KFNA 3QIPB 3CFRA 2ASLA 4KKOA 1BISA 3NFAA 1HYSB 4FLUA 2GIQA 5EDWA 5KRTA 1VRUA 4ELVA 4F4XA 1GOBA 5C25B 1D0EA 2KW4A 2IBKA 3SZ2A 1BIZA 3DRSB 3LWMA 3KLIA 3NL0A 2YNIB 1S6QA 1J54A 3KHRA 2YHBA 3KKSA 3WNGA 1Q8IA 3HPOA 1NKEA 4K4TA 2Z1JA 1NJYA 4DSFA 1LW2B 4EYIB 4M41A 1NK0A 2FLPA 3ZSWA 3OYCA 1KVBA 1Z25A 3PUFA 2BDPA 3DLKA 1JIHA 3AVCA 1C1AA 4B3OA 2XY5A 4RNNA 5HLFB 1NHUA 1T3NA 3OYLA 1RYSA 2WONA 2B6AB 3EPGA 1HQEB 4TQSA 2ATQA 3KK2A 5F8IA 3KTQA 2W9CA 5KT3A 3H59A 3ZT1A 3E01B 3RR8A 4QOZB 3HVWA 5HBMB 4DSJA 1ASUA 3QNOA 3CDEA 1RT4B 3CJ4A 4RU9A 4F4YA 4KB1A 3HO1A 2E6MA 4CESA 4M3UA 2X6SA 1BQMA 1VRTA 3CYMA 5HRRA 1FKOB 4I2PA 2VWKA 2JC0A 2PZSA 3GIJA 4HUFA 3V6JA 2OPQA 4M3YA 3DYAA 2OPPA 4GW6A 4Z4EA 1GX6A 1D5AA 3HL8A 3SV4A 3SV3A 4ECYA 3OJSA 4ICLA 1SKWA 3MEEA 2IA6A 3H5XA 4BE1A 5KFKA 2NUBA 2X74A 4LSNA 5HROB 2W8KA 5HRSA 2HMIB 4QPXA 2ZD1A 5KFZA 4IFVA 4CGDA 1HARA 5KFNA 3RMBA 5J2NA 3PR4A 3ZSVA 2FVRA 3ULDA 3N6MA 3VQ8A 4ZP9A 4FW2A 1SKRA 4K4YA 3O3GA 3F9KA 3PJXA 2XGQA 5C5JA 4MKAA 4DFJA 2VG7B 1IKYA 1IM4A 3DLGB 5HRPA 2OH2A 4E1MA 1JXLA 2ZQBA 3G6YA 1TKTA 1FKPA 2FBXA 1X9WA 1DLOB 2GUIA 3KNAA 5T7BA 4FXDA 3NE6A 4YR0A 3ZSOA 4CJPA 1S6PA 2EX3A 4FW1A 1RTDA 4B8CA 3T5KA 5FDLA 3NF9A 4CJWA 1D8YA 2VA3A 2PY5A 3K5OA 1TKZA 3MR3A 4NLRA 2LSNA 3CDWA 4BE2A 4ZP8A 4ECZA 4JV0A 1K1QA 2G8VA 3QESA 1NJZA 2V9WA 4M45A 4ED3A 4BWJA 3ZT3A 4EP5A 4I9LA 2FLLA 3KK1B 4XO0A 5F8LA 3QERA 3DM2A 5KFEA 4ZPDA 3I0RA 4Y34A 2JEFA 3G0ZA 4M3WA 3FFIB 2R8JA 1HYVA 4M95A 2FBTA 1TL3B 3LP2B 2FVPA 2W9AA 3RBEA 4OJRA 3DMJB 3VA0A 3TVKA 2YNHA 4FM2A 4KI6A 4Q0BA 2QV6A 4AHCA 3DOKB 3PX0A 5KG6A 5F8MA 4O4GB 4NYFA 4DL7A 4J9MA 1TVRB 3NGYA 3D28A 3N6NA 5F8GA 2DTUA 4JUZA 2AQ4A 1JLBB 4PWDB 4DU4A 2KFZA 3H08A 4DFPA 3P5JA 3MEDA 2PYJA 4TLRA 1VSFA 2ILZA 4ECSA 2IDOA 1L3UA 1SH3A 2YHAA 2BGGA 4CJQA 5KG4A 2ASJA 1REVB 2F8EX 5KFBA 2D0BA 3Q8RB 4DF8A 5DQGA 3MTKA 2BQUA 4Z0UA 2A1SA 1S49A 4ZPCA 3C95A 1NJWA 4FBTA 2HNDB 4CGFA 2WRMA 1QE1A 1S9GA 4KHWA 3IGNA 4Z4HA 1S9EB 4O3NA 3S3MA 1IH7A 1WNSA 4DLEA 5HP1A 4QWBA 1SL1A 1MU2B 5KFHA 4R0EA 3BDPA 3OYMA 1C1CB 2KQ2A 4J9RA 1JLAB 1TP7A 4CFAA 4BDYA 2R8IA 5J2QA 4NLGA 4IRDA 1VSHA 2W9BB 4FK4A 4CE9A 3MEGB 4WXOA 3KOAA 3DOLA 3OHAA 2JEIA 4NLWA 5KFYA 3B6OA 4Q8FA 3SNNA 2UVVA 3AVBA 3DRRA 1HPZB 3UDLA 1VSJA 1QAIA 3V6HA 4H4OB 5DK5A 5D3GA 1J53A 1W0HA 3OYHA 4B9SA 3NAEA 4C8OA 3GIIA 1QQCA 4LH4A 2HNYA 3CFOA 1XR6A 3I0SA 5E41A 2IS3A 1RT7B 2FBVA 4QWDA 5K14B 3NCIA 3KK3B 1TV6A 4EZ9A 1RTIA 3V4IA 2AGPA 4HVJA 1KFSA 5KI6A 1S1WA 3LP3A 4CHOA 4IH5A 4CERA 3SQ1A 4O0JA 1W9HA 4E7JA 4I9QA 2W7PA 2ZE2A 3LPTA 3TAMB 4FVMA 2YNGB 2XC9A 1NK8A 4B9VA 1ZYQA 2HW3A 3RTVA 4KB0A 3ALYA 4CJUA 4NLDA 4M3XA 3L2UA 4RZRA 1HQUA 5CZ1A 2BQ3A 5KFGA 3M8QB 4ECTA 3KIOA 3LZJA 3OYKA 1IG9A 4LSLA 3ZT2A 4KHYA 4CECA 5J2MB 2RDIA 1EP4B 4CF2A 1TKDA 3QNNA 3SUPA 4Z4FA 1YTUA 3NH1A 1RT6A 3PW5A 2HHVA 1K1SA 4OPKA 3OLBA 3V6DB 1VSEA 4TN2A 3AVJA 5KG2A 3AVLA 1RTHA 3K59A 3K2PA 4CEFA 4YP3A 4CF1A 1TQLA 1ZBLA 4FLXA 2WOMA 4R5PA 1VSKA 3NGZA 1NKBA 3FQLA 2XGPA 1RT2A 2Q3SA 1HYZA 1WSEA 3SJJA 1RT3B 3LP1B 3L8BA 4F50A 3QLHB 3SPZA 4NYNA 4ZHRA 4L8RB 1KVCA 3QEWA 3H5SA 3KHLA 3BQ0A 2YV0X 4Q44A 3SUQA 4FJXA 4CJ5A 4CJKA 4E0DA 2B5JA 5EU7A 2XCAA 5KFMA 1S1TA 5KT2A 3IS9B 4J2DA 1TL1B 2RF2B 4KO0B 1S0NA 3RMCA 1TK8A 1QSSA 4ED6A 4WZMA 4QWAA 1DTQB 4J9PA 5KFOA 3OVNA 1N5YA 1T8EA 4DWIA 4DS5A 5F8HA 3UQSA 3PR5B 2O5DA 3H40A 4RUAA 4G1QB 4KRFA 4PUOA 4FJ8A 3SFGA 3NBPB 4ECRA 3V1QA 3ITHA 1K6YA 3VQDA 3DLEB 1RTJB 4GC7A 4IKFA 4NCBA 4CIFA 3KLGA 4IOBA 2YKMA 4IG3A 1BQNA 1NJXA 3NMAA 1TK0A 5CYMB 4RG8A 2ETJA 3CJ3A 1RAJA 1EETA 2IC3B 4ECXA 4K4WA 1BI4A 4EBDA 4B9LA 3NF8A 1SL2A 4QCLA 1C2PA 3OSNA 5KFIA 1QTMA 1TKXB 2HWHA 3T3FA 3HVRA 5FROA 1SH0A 4PQUA 1A5VA 1NK5A 3KHHA 4MFBB 1JXBA 3PY8A 3M8RA 2ILYA 4X2BA 1A5WA 4O44B 3ZT0A 4KE5A 4M42A 4FBUA 4OLAA 1IKXB 1TAQA 4DTSA 3NDKA 2E9TA 2ITGA 1DTTB 3QIDA 4O4RA 3HP6A 1RDAA 3JYTA 4OKJA 1BCOA 5JUMA 5EUHA 1JX4A 4RW6B 4AHRA 1CXUA 3OHBA 1FK9B 3DRSA 4DTPA 4CCHA 4HCBA 3PV8A 4RW8A 4Z4CA 4FCYA 1HNIA 2G8FA 5I42A 1RA6A 2WCXA 3SUOA 3LP0A 3WNEA 3V9ZA 3PVXA 4EZ6A 1JLQA 1JKHA 4E7HA 2FJWA 3L3VA 2IM2A 2VG5A 4DS4A 2UVUA 2ATLA 4JV2A 2F96A 3NH2A 4DTRA 3C6TA 4RW9A 3JSMB 2VA2A 5KRSA 2IOCA 3KMQA 2IM1A 4LQ9A 5C42B 4DFKA 4FK0A 3LPUA 3LWLA 4TY8A 5J2PB 2P5OA 2E4LA 3D5MA 3ZCMA 3SQ4A 2R2RA 3BSAA 2QXFA 2FVQA 2R2SA 3O4NA 3SFUA 5F9NA 4ZMMA 3HSTB 4ID5B 4XPEA 4MIAA 4OVLA 2C2EA 1HNVB 4DG1B 1S10A 2EC0A 5DLFA 2RKIA 4AHTA 2GBZA 4HTUA 3DRPB 4PA1A 1UWBB 1S4FA 1LWCA 1S1XA 3AA5X 3A2FA 3DI6B 3BGRB 1C1BB 3KLHB 4CK3A 4I2QB 3G6XA 3QEIA 1VSDA 4NLQA 4CJRA 4KFBB 4LQ3A 3L2WA 4DTUA 3BREA 2I5JA 1SV5A 4N47A 5KT7A 1IKVB 4DQPA 3IGVA 4JS5A 4KKOB 3TAEA 4CGGA 4G3IA 1B9FA 4YFUA 2BRLA 5CYQA 2Z1IA 2FC0A 5KT5A 4FJJA 1TGOA 1VRUB 4Q5VA 3KLFA 3KLEA 1T03A 3AVMA 4OGCA 4FZYA 4IDKA 3FRZA 4EO8A 4KB7A 3LALA 2KZZA 4IG0A 3CVKA 3AVKA 3IG1A 3KLIB 3SQ0A 1RT1A 1S6QB 4CHNA 3IRXA 1XI1A 4CJ4A 3G86A 3QEPA 3CJ5A 2GIRA 3DLBA 4EP4A 2VG7A 4CF9A 2XRIA 1X9SA 3S9HA 3DLKB 4NCGA 1HMVA 1D9FA 4B9MA 1LWEA 4B3OB 4CHQA 3BR9A 4CEBA 1VSIA 2WONB 1R0AA 1NHVA 3AVIA 5L1KA 2C2RA 4NLPA 3KK2B 2F8SA 3P1GA 3GILA 5KFJA 3TAFA 3OYIA 2W9CB 5JXSA 4M3ZA 4QW8A 3T5HA 3D0PA 1KHWA 1BQMB 4KTZA 4F4WA 4FS2A 1VRTB 2J6SA 4FJ9A 4E19A 4I2PB 2C28A 2OPQB 1S48A 3S3OA 3QEVA 3NAIA 3BSNA 3DYAB 2OPPB 4R8UA 4Q45A 4HUGA 4WYLA 5FRNA 1RILA 4C8MA 1WSIA 4N5SA 3C94A 4CJLA 3QIOA 5KFPA 1L3SA 1JLFA 4ICLB 4MH8A 1Q9XA 4FJGA 3MEEB 3MECA 4NCAA 3HM9A 4LSNB 4KAZA 4CEZA 4CEAA 2ZD1B 1QAJA 3MXIA 4IFVB 3D45A 1RYRA 3HVTA 2OPSA 3DMJA 4MKBA 5KT4A 5J2NB 4I7FA 3Q8PB 1KLNA 4PY5A 3TANA 3CJ2A 3RB4A 4W5OA 4KI4A 2Z1GA 4QWEA 3P83D 4J9LA 2D3UA 4YR3A 1JLBA 4ECWA 1SUQA 4H4MA 4ECVA 1RDRA 3HVAA 1LW0B 3M8PA 1IKYB 1KSPA 4KAIA 4CIGA 4N76A 4RNHA 4J9NA 1TKTB 1FKPB 3LZIA 4XPCA 3OLAA 3RRGA 2HHQA 2E9ZA 1QHTA 2IJFA 4Z4IA 1S6PB 1C0TA 1QUVA 1RTDB 4F4ZA 3CFPA 5FDLB 1JLCA 4AHUA 3KLVA 2V4QA 4KV8A 3AO2A 5KFLA 4YQWA 3OYDA 3G6VA 2E9RX 1S5JA 4ZP6A 1S1UA 1T94A 3PW0A 4CHPA 1TKZB 2D5RA 3B6PA 4FZZA 3AO4A 1T05A 3ISND 4O3QA 4EBEA 2XY8A 2JGUA 3V6KA 1C0UA 1CXQA 2IM3A 1RDDA 2HVIA 2DPJA 2OPRA 3AA3A 3U3GA 2JEGA 4DL2A 4HUEA 2CJQA 3DM2B 4HKQA 3N6LA 2V4RA 3I0RB 3GQCA 3PHEA 4AHVA 3O4QA 3GV8B 2KZMA 3LAKA 3LAMA 4NYZA 3AO1A 5KT6A 3I8DA 1ZBHA 4WFXA 3MR2A 1MMLA 4FLWA 2RN2A 4W5QA 4AILC 4NLUA 3U6FA 2YNHB 3BSCA 3T5JA 4CIEA 3GIMA 4Q0BB 4DLGA 3KD5E 3RMDA 2JC1A 2WHOA 4OLBA 5SWMA 4DL3A 1KLMA 4RW4A 2C2DA 2HHXA 2BE2A 3PO4A 4N41A 2FLNA 3VQ9A 4YNQA 1ZTWA 1ITGA 3MEDB 1B92A 4EEYA 1RCHA 3CIZA 3HK2A 1XWLA 3HYFA 1NK9A 3NAHA 1I6JA 4MQ3A 1L5UA 1JL2A 2WB4A 4QW9A 2DFHA 3VN5A 2D0AA 2P51A 1LAWA 3RWUA 4J2BA 4CHZA 3OYJA 4DQQA 2R8HA 1GOCA 3VQCA 1U09A 2JLEA 1U4BA 1QE1B 1S9GB 2BR0A 4XIUA 1S1VB 5HP1B 4K8XA 3PJWA 2XWYA 4NLTA 2AU0A 2UVWA 3VQ6A 4B08A 3OYAA 1JXEA 5J2QB 1N48A 3BQ2A 4QWCA 4FJMA 1Z4UA 4WE1A 4OL8A 4J9QA 3DOLB 4CFBA 4BDPA 3QGGA 3CDUA 2YNFA 3ICLA 1ASWA 1N6QA 5L1JA 4IFYA 3NHGA 3L3UA 3DRRB 3ZT4A 4DTMA 1XR5A 5KFXA 3I5BA 1WSJA 5KFSA 4DU1A 4OKEA 4K4UA 3VA3A 1J5OA 5D3GB 4DSEA 4K4SA 1RDBA 3L2QA 2IAJA 2HNYB 4ZTJA 4TYAA 3I0SB 5F8JA 3U3YA 3MR5A 3ZSYA 3KJVA 1WN7A 3THVA 3T1AA 2YKNA 3MR6A 2AGQA 3OL6A 1TV6B 4DQRA 2Z1HA 3MFIA 1RTIB 3V4IB 3MAQA 2V0NA 3AV9A 1L3VA 3CJ0A 4DTJA 5KG0A 2IM0A 2OZMA 3OYFA 2B43A 5EWGA 4E1NA 1S1WB 3TR8A 5KGWA 2HNZA 3K5LA 2C22A 1S9FA 4KHQA 5F8NA 3BSOA 2D41A 3MF5A 3M9NB 2P5GA 4RW7A 4DL6A 2RPIA 4B9NA 5KG5A 3CO9A 1I39A 2HAIA 2ZE2B 4AHSA 3VQPA 5J1EA 2P1JA 1JLEA 2DY4A 4KTQA 2BANA 3ZSQA 3HHKA 3SYZA 3C6UA 4JRQA 5C24A 3QGHA 4CJTA 3TWHA 4M3TA 3V9UA 4LSLB 4JLHA 1LWFA 1YTAA 4ZPAA 3RR7A 3L2RA 5KFQA 5I3UA 3LANA 4GMJB 2W7OA 4DF4A 3QGIA 4KSEB 4RNFA 1RT6B 4LH5A 4ED2A 3H2LA 3SUNA 3V1RA 2KTQA 3CM5A 4WYWA 1SL0A 4NRTA 1RT5A 4IKAA 1RTHB 1VK0A 3VQ5A 1NK6A 2Y1IA 4DQIA 2HHSA 2WOMB 4R5PB 2W8LA 1Z26A 3S3NA 4DSLA 3RAXA 2D3ZA 1RT2B 3WNFA 3V9XA 3QO9A 3VQAA 3TI0A 1NOYA 4RNOA 1S0OA 4U6PA 4ZHRB 5KFDA 4FJKA 1WSHA 1QSYA 2XO7A 1UAXA 5FRMA 2VG6A 4H8KA 4F3OA 4ELTA 2HB5A 4B9UA 2B5JB 3PZPA 1U49A 2HHWA 3OS1A 3JSMA 4C8NA 5KG3A 2GV9A 3HJFA 3QIPA 4O3OA 1N5YB 2QK9A 2I1RA 2XI3A 1VSMA 3UR0A 1HYSA 1JLGB 4CK2A 4YR2A 4LD0A 5T14A 4CK1A 4BACA 3V9SA 4PUOB 1L3TA 1KFDA 1RDCA 3IAYA 1IKWB 5C25A 3ITHB 2IMWP 3KLGB 4FLVA 3RBDA 2YKMB 3QINA 4IG3B 1EKEA 1BQNB 2YNIA 3PX6A 4KREA 3G10A 1EETB 3RAQA 1LW2A 4J2AA 1BI4B 3OYBA 4WFZA 3VQ4A 3TQ1A 3V1OA 5KFRA 2ALZA 4F8RA 3V81B 5HLFA 4PQUB 4CEDA 3NGIA 2B6AA 3FDSA 1HQEA 3GV7B 4E7LA 3BGRA 4FJNA 4ZVEA 3BJYA 2R8GA 1XHZA 3K57A 1FXXA 1A5XA 3KKRA 3E01A 5DGAA 5HBMA 2G8WA 4EBCA 1RT4A 3QETA 2EHGA 3NGDA 4NLXA 1U04A 1ZETA 2ASDA 1FKOA 4ELUA 5JS1A 4C8KA 3JYTB 2XI2A 3L2VA 5F9LA 4RW8B 4J9KA 2DFEA 4Q43A 3OYGA 4JS4A 1HNIB 3PX4A 5I42B 5HRNA 3LP0B 3CG7A 1JLQB 4DSIA 1JKHB 3VQ7A 5KG7A 2VG5B 3F73A 1F21A 4UQGA 3K5MA 1XC9A 3HXMA 1TK5A 3C6TB 4RW9B 3M9MB 5HROA 4C8LA 1N4LA 3EYZA 4YMEA 2HMIA 1U47A 3SI6A 1GX5A 1RBRA 3CM6A 4FJ5A 1Y97A 1S97A 4K4VA 3VQSA 4K4XA 3M8SA 4TY8B 3ASMA 3DLRA 1QSLA 2FVSA 3GV5B 2UUTA 1UA0A 3VQQA 4HYKA 5EWEA 2DFFA 5DG7A 1YT3A 3VQBA 3H5UA 3OL7A 4ECUA 3H98A 3OJUA 4NLVA 3DLGA 3HPGA 4CF0A 4FJ7A 1BHLA 4IBNA 1DLOA 2RKIB 3EPIA 2J6UA 3DLHA 3H4DA 4KTWA 1LWCB 4IR9A 1S1XB 3NF7A 4TY9A 4B8AB 3H4BA 1RNHA 3H5YA 2AGOA 4ZVGA 4Y1DA 3PW4A 5SZTA 3QYYA 2I5JB 1SV5B 4ED1A 1KHVA 4O55A 3RRHA 1QS4A 1RBSA 4NRUA 4CGHA 3AVGA 1I3AA 5CYQB 4DFMA 4M3RA 1RBTA 3O3FA 1UOCA 2FJXA 3KLFB 3HP9A 3KLEB 1T03B 2JEJA 4IDKB 4FZXC 2BQRA 3KK1A 4IG0B 3IG1B 1RT1B 3IRXB 4KBIA 4OKKA 1LW0A 2R2TA 1JL1A 3FFIA 3PO5A 4IH7A 3MFHA 4NCGB 1HMVB 4FM0A 1TL3A 3LP2A 1LWEB 4KHUA 4ZVFA 4IH6A 1R0AB 4Y2CA 5KFCA 3RB6A 1IO2A 2F8TA 1KVAA 1YVFA 2HHUA 1C6VA 3DOKA 4ED8A 4O4GA 2FJVA 5DQIA 4J9SA 4FJHA 3NF6A 2DPIA 2R8KA 1TVRA 5KFVA 4DSKA 1BGXT 3LDSA 3M9OB 3EZUA 4PWDA 1D9DA 4TSXA 3UPFA 2W42A 3GIKA 4MK8A 4HCCA 4BE0A 4CGIA 4WZQA 1RBUA 4KHNA 3KMSA 2XY6A 1REVA 4R8UB 3KD1E 2AWZA 3AO3A 3EY1A 3I5CA 1JLFB 1W25A 4FLTA 5DLGA 3EZ5A 2HNDA 4Y2AA 3OL9A 5KGXA 4EO6A 3MECB 1VSLA 4TQRA 3ZSXA 2HVHA 1S9EA 3DDKA 4Y3CA 4IRKA 1CZ9A 1J9AA 3RMAA 4M94A 4MIBA 1MU2A 4RUCA 5KFWA 1C1CA 4Y1CA 1JLAA 3HVTB 3TAQA 2OPSB 2W9BA 5KFTA 3MEGA 1ZBFA 4I7FB 4KHRA 1KTQA 2GC8A 3AO5A 2ZKUA 2BRKA 1BL3A 4FLYA 1C0MA 5KTQA 2Y1JA 2UVRA 4W5TA 3TAPA 4HHTA 2IGIA 1HPZA 1ZBIA 2G8UA 4H4OA 1SUQB 4H4MB 4CF8A 3OL8A 3GYNA 3QEXA 3M8PB 2IJNA
chains in the Genus database with same CATH superfamily
3D6RA 3C7NB 1WF1A 2NS1B 3VMFB 3THWA 1TR0A 1PYTA 4RL1A 2FBYA 1QAYA 2LCWA 1EZZB 1WAFA 2PMWA 4PCQA 1EQ0A 2BYCA 3SIPB 1KC8T 3BQ1A 3U8XA 3FEZA 1S1VA 3MD1A 2X51A 3EJMA 1MDUB 2MY8A 4F2RA 1P27B 3MMAA 2CQ3A 2YNGA 3H2VE 3PRBA 4P72A 4E89A 1H0HB 2ZHOA 1IBKJ 3KZBA 1N36K 1B70B 4YB6A 4LIWA 3QSYB 1WHWA 3JB9k 2LA6A 1HKGA 1DEJA 1X1PA 2HQ3A 4ID1A 4L3KA 1KRPA 3TABA 3QB0A 4OGEA 3TPQA 1ASVA 1FEHA 5JS2A 1I94K 4PG5A 2K3KA 5AFUA 2KHCA 2EW9A 5JVGL 5K8MA 4U7CA 2E5GA 2MZRA 3V6DA 2NNWA 2F4VJ 4F26A 3T1HK 4FOEA 1GK8A 2B9EA 2W2OP 4QU7A 3NH0A 4ZPTR 1N5SA 1SQEA 5BYSA 4YY3J 1WLJA 3SK3A 4CI6A 3SBGA 2D0PA 2UXBF 1RT3A 3LP1A 2H3EB 3K5NA 1HR0F 2RQCA 4ISFA 6FD1A 4ZP7A 3V9WA 5L1LA 3Q8SB 1QQOA 4NYPA 1HBNA 1NSKL 4CO0A 3SPYA 3G6ES 4OI1A 2JFKA 4X65F 1TL5A 3AVNA 4KO0A 2ERRA 1BLUA 2O8CA 2O8BB 2D9OA 1NSPA 4FYDA 1SC1B 5BJRA 1VIXA 4HTIA 4FK2A 2B3TB 2A1RA 4OPJA 3CD6N 1E4GT 4F4KA 3BYPA 2I7NA 5FLXY 4WXWA 1U1NA 4CLSA 2DD8S 2AEMA 4M5LA 3TAGA 2QKBA 2HZAA 2PN6A 3DLEA 2F5GA 3Q8QB 2GUPA 5DQHA 2DJWA 1SH2A 3QDKA 3OT9A 2YNFB 2HFZA 1UL3A 1TYQB 3LPYA 2JFDA 1BMQB 3CQ8A 2WSFC 3HTVA 1EX4A 1NHKL 3FC9A 2VPZB 1J5OB 1RWWB 1U24A 2HHPA 4LBPA 2AJ2A 2IAJB 4YDDB 1RHJB 3TARA 2W1BA 1ZM9A 4NEYA 1DHMA 1OYDA 1F0XA 4U9RA 3SSSA 1FRXA 1VHXA 1TELA 1Q4RA 3AVHA 1M0SA 2HWIA 1NOZA 1NKCA 3BKUA 4R79A 2GGPB 1B3TA 2JH3A 2IDEA 1DTTA 1JLGA 4JAXA 2HNZB 1UFKA 1W2BM 4LF1A 1WC6A 2R7WA 3HI9A 1MMNA 5DG8A 3PM9A 3WNHA 4O0IA 3THXB 1D1UA 5KG1A 4NA3A 4XH1A 5KAKA 4W4MA 4BWMA 5DGBA 2PYLA 1AFIA 1Q8KA 3Q7CA 1IBKF 4NLYA 2BW2A 4CEOA 2B8QA 4O5BA 3CWJA 5CZVA 3IR6B 3UIQA 2X1BA 3AARA 3TOQA 2MQPA 1LWFB 1WTBA 3MM9B 1FRIA 3AA2A 1HFEL 5C42A 2HF4A 3D2FB 4BBYA 4AXJA 3WXLA 4IQXA 1MN7A 2J9EA 1ZBUA 2HHTA 2QA4S 4E7IA 1N88A 1NGAA 2F4VF 2PGCA 1M1HA 1MN9A 2XSFA 2GVDA 5AJ3J 1Z05A 4NZ0A 4C8ZA 4H54A 1N56A 4NPOA 4YY3F 2K7JA 1YVNA 2F3JA 4BRQA 3Q89A 1F2GA 1ATRA 4MIWA 4OJHA 4IR1A 3TSQA 1WAJA 3R2DJ 3OS2A 2WBRA 4DCJB 3CCUN 3G4SN 1UWBA 3TYTA 3LTOA 2R42A 1YLXA 3BBBA 5CABA 1SBRA 2FVCA 1Y64A 4DX6A 3DI6A 1WSRA 1C1BA 3KLHA 2DR8A 4CJVA 4J90A 1HBUA 2EWHA 3H8YA 4C98A 3MHYA 1U45A 5A8RB 3QQCD 1V3SA 4LR9A 2AEJA 2YKPA 1IKVA 1RWXB 2ASLA 3CXCM 3HD2A 4A8FA 3A12A 3CJQA 2CADA 1HYSB 3CD0A 2GIQA 5EDWA 1VRUA 4ELVA 4F4XA 2KW4A 1Q7LB 1BIZA 3DRSB 4NO7A 3R6MA 5H9EJ 5GAEU 3BPDA 1NKEA 2NXEA 1LW2B 4DN9A 2VOPA 2MKHA 5D77A 4Z2XA 4DPTA 4M8LA 3GG0A 1K47A 1C1AA 4B3OA 4KH4A 5HLFB 4CQ1A 1B7YB 3G9CA 1RYSA 2B6AB 2V2QA 4F04B 5F8IA 3KTQA 3LM2A 2OLWA 1G4CA 2LQ5A 5B0CA 1ASUA 4KB1A 2O1PA 1GXTA 2CNKB 3C14A 1U2FA 2QGFB 4UW2A 1VRTA 3A5LC 3CYMA 4I2PA 1YAGA 2PZSA 2MEWA 3AAPA 4M3YA 3J80O 3CCMS 1VQPS 4CZHA 1ZPWX 2CNOB 3J7AP 1SKWA 1KP6A 4USHA 1IBLJ 2BKOA 3MEEA 2VFRA 4TU7A 2V4JB 2DEIA 2W8KA 4I4BA 2Q0RA 3SSRA 2HMIB 2BUNA 5F1XA 4H03B 3VEVA 2JWLA 3V2UC 4MYUA 3ZO7A 1ZZFA 3SEOA 5AJ3F 3FMWA 3N6MA 3C66A 1P90A 3VQ8A 1SKRA 1KXPA 3F9KA 2QSFA 4P2FA 5C5JA 4DR2K 2GEMA 2E5HA 3O80A 1IM4A 3DLGB 4N8OA 5HRPA 2ZQBA 4M63C 2EI5A 3G6YA 1YX2A 1FKPA 1XNRK 1WWHA 2EKNA 2GUIA 4FXDA 3NE6A 1WDTA 2ZJPL 3M32A 3L95X 3NCRA 2EX3A 2O8EB 3MMCB 3NF9A 2LQ8A 4CJWA 2QWRA 2PY5A 4PG7A 2P9NB 1SKUB 2F8HA 2LSNA 2V8GA 2A0FB 4ZP8A 4ECZA 1K1QA 1W7WA 3QESA 4M45A 4EP5A 2UUAK 3CT9A 1U1OA 2G4BA 1R31A 2FLLA 1IR0A 3CPWM 1CJVB 4OYPA 2LXUA 2FSKA 2XEXA 1WORA 5F8LA 3BM7A 3QERA 3MPUB 2R7OA 1BOTO 1HW9A 3I0RA 4R25A 2JEFA 2XYGB 5GMDA 2A2CA 1WEXA 2RSQA 2RT3A 2FBTA 2PO4A 1TL3B 2V52B 3LP2B 2FVPA 3RBEA 1NNEA 3QT8A 4OJRA 2ZBQA 3UDEA 2YNHA 4ALZA 4FM2A 2FQQB 2PI5A 4KR0B 2YJEA 4AHCA 5KG6A 3FK4A 4O4GB 4GV3A 4NYFA 3O9UA 3DLLQ 3CF5L 1CJTA 3D28A 3N6NA 4NL5A 1V6HA 3ETOA 2AQ4A 3SDEA 4ER8A 5BR8K 4HVZA 3H08A 5E7OB 1OO0B 3DGPA 4HACB 1L3UA 4PEOA 4ZJOA 3OR2B 4CJQA 5KG4A 1CULA 2ASJA 1REVB 1IBLF 3MTKA 2BQUA 4JI1K 4FPRA 3ENAA 4CRJA 1YI2N 1S49A 4B3MK 1VQ5S 2WRMA 1QE1A 4CO2A 2FY1A 1S9EB 2ZNYA 1IH7A 1WNSA 5HP1A 1SL1A 3G8QA 4X62J 4JHDB 4NYOA 4EHTA 3FBCA 4J9RA 1JLAB 1TP7A 3R5CA 1FE4A 4FK4A 5LM7E 4RBVA 2APOA 5IC4B 4WXOA 4B3SJ 3IR7B 2JEIA 5EGYA 4Y0FA 3AVBA 1RP5A 3PYDA 5DK5A 2CPJA 4B9SA 5IS2A 4C1NK 4C8OA 4I64A 2HNYA 4NASA 1M5HA 3CFOA 5E41A 2DKOB 2FBVA 3C46A 3THWB 2XMMA 3NCIA 3LDOA 3V4IA 3LOUA 2P8IA 2DGTA 2E1CA 3O1WA 2KU7A 5HVGA 1KFSA 2NSBA 1OWXA 3CJCA 1YITN 2UYTA 3WT0A 3LP3A 2PDAA 1IM6A 2VU5A 1W9HA 4JI4K 1VQ4N 4NLBA 2YTCA 4BR0A 2HIYA 2W7PA 4JI8K 3MMAB 4FVMA 2YNGB 3M3ZA 1NK8A 1QAXA 5M1NA 4B9VA 3DXKA 3RTVA 1N36J 2E1MC 3ALYA 4CJUA 1F5AA 1H3DA 1SS6A 3OXGA 3CW2C 2BQ3A 5KFGA 3EL2A 5KQDA 2CPHA 1NCLA 1F5BA 3KJQB 4QIWD 3JAMY 3O9RA 2DRAA 3OYKA 4LSLA 4DR5K 1CG2A 4CF2A 1TKDA 1QHAA 1I94J 4FYYB 3G8SA 2HHVA 1KVIA 4JD2A 1QVGM 1YHQS 3OLBA 3SCKE 1FXDA 3Q8UA 2DB1A 3V6DB 3R27A 3K59A 2H9ZA 4YP3A 4R5PA 4IXCA 2E1ZA 2AHOB 5EX0A 2Q3SA 3THPA 1HYZA 1NGHA 1RT3B 3LP1B 3MMBA 4LFAK 4L8RB 2MZQA 1F1BB 2RQ4A 2RRNA 4FJXA 1HBNB 2BV3A 4KGMA 4JOUA 2MQMA 2W01A 2XCAA 1EX8A 2HSTA 4KO0B 2FHMA 2NZCA 2O8CB 3I8BA 3C16A 3H20A 4I1TA 1WC1A 5KFOA 3OVNA 3OXLA 3CQXA 1T8EA 3MPVA 4X62F 3GJQB 4K0KJ 5C2GA 4KRFA 4PUOA 3CC7S 4WQ5A 3M6WA 3TWZA 4B3SF 2F65A 3SFGA 1KOHA 3DLEB 1QTNB 3ZLJA 4IG3A 1BQNA 3NMAA 1U1RA 2ETJA 4U67Q 2Z8QA 1EETA 4H5VA 5AQUA 2FYXA 1BI4A 4EBDA 2O3DA 1QTMA 3T3FA 2HG4A 4PQUA 3ADAC 1SVDA 5FLXO 3VPZA 4A57A 4EGLA 1NK5A 1JXBA 1UP1A 5EOYA 3PY8A 4BR2A 1A5WA 4BRIA 3ZT0A 1LQ9A 4A8MP 4M42A 5JVHQ 3H1VX 2Z2MA 2DRBA 1TAQA 3E3XA 3KUGA 2WSCC 1Q86T 1DTTB 9RUBA 2BOPA 3CC4N 2DVIA 4OKJA 3CJTA 3J7YI 3C19A 5AQWA 3NEKA 1JX4A 4QYRA 1GLBG 1VR6A 4AHRA 3OHBA 1N36F 4DTPA 4Z4CA 4ZVRB 4RX6A 1EARA 2G8FA 5I42A 2DK2A 4FXVA 2ADBA 1JKHA 4E7HA 2AYEA 3L3VA 2IM2A 2C2NA 3NH2A 1HWUA 4RW9A 1I94F 2L48A 2PAVA 2IOCA 1ULRA 5LL6d 5AE2A 4B3RK 2NPIA 5TKYA 3QJLA 5C42B 3AJ2A 1TUVA 2KHDA 2M9KA 3CD5A 4TY8A 2GVDB 2GO8A 4C0HA 4AF1A 2OFHX 3I6PA 4P75A 3ZCMA 2R2RA 4L76A 1TFYA 1Q18A 4WFAL 2OKQA 1HNXK 2DGXA 2Y3YA 3J81O 2W6LA 1S10A 1IV0A 1U8SA 4HTUA 1UWBB 1LWCA 2Q0UA 4WQ4A 3DI6B 3BGRB 1C1BB 1M5VC 3KLHB 1HBUB 1MMDA 4NLQA 1NH8A 4F0KA 3OR1B 2I5JA 2VYPA 1SV5A 4PXDA 5KT7A 4FN5A 1IKVB 4K0KF 4ANDA 4DUZK 4TU8A 4CGGA 5AQVA 3RSEA 2OAUA 2N7CA 2HRTA 3EICA 2FC0A 1VRUB 2JSXA 4Q5VA 4FZYA 1Y3KA 4KB7A 3LALA 2ADCA 4ZLLA 3AVKA 3IG1A 4CHNA 2NZTA 3IRXA 2SXLA 1EWRA 1XI1A 1GLJO 3DLBA 2VG7A 1NUEA 4CF9A 1PC5A 4WIIA 2ZJRQ 1X9SA 4B9MA 1HMVA 1IVZA 5JICA 2XSJA 2FHJD 3NOCA 4B3OB 2V8HA 3BR9A 4A8OA 1R0AA 1HLWA 4EUVA 4RUBA 4FWOA 4CZMA 1DARA 1BA1A 3DJCA 3OYIA 4QW8A 1B0PA 2DY9A 1NLVA 1YK9A 2HK2A 3QGPA 3AOCA 3QBCA 3T5HA 3D0PA 3E1YA 5IV3A 3C14B 2J7KA 4I6WA 1VRTB 2W2NP 3GIRA 1L3KA 4E19A 4I2PB 2OP5A 2C28A 8AT1B 1RU1A 5I4MA 1QZ6A 5FLXU 3JTNA 1J6ZA 3NAIA 4CM0A 3BSNA 1Q86O 4FWNA 4DV3K 4BRPA 1T9TA 4N5SA 2X1FA 1R59O 2WAQD 2LEBA 4MH8A 2OMLA 3VEXA 1Q9XA 4FJGA 3MEEB 2HBJA 3KKFA 3HHNB 4KAZA 4BRMA 3VEOA 2OPSA 3DMJA 4KT0C 3CJBA 4H0YB 3F5TA 4I7FA 1KLNA 5I9EB 5GMEA 4JI5J 3RB4A 2HS4A 2HVDA 2Z1GA 1SI9A 3O5BA 4QWEA 5CA5A 2O66A 4X4VA 2VC1A 1JLBA 4DR2J 1SUQA 4H4MA 3NP5A 4FWLA 3HVAA 3WC0A 1GLAG 4ZKAA 4BCAA 1KSPA 1RHRB 4KAIA 4CIGA 1XNRJ 3FKBA 3OQ2A 3O3LA 4RNHA 1FKPB 1JNRB 2BMBA 4XPCA 3BF3A 2M52A 4ISGA 3M32B 3CJSA 3ID6A 1M5OC 2IJFA 1FD8A 1O5JA 2FPHX 1QUVA 5DM6Q 1S0VA 3CFPA 1JLCA 1TU0B 4AHUA 4OI6A 4KV8A 2KRBA 5BXIA 4YQWA 3OYDA 1OY8A 3UWTA 1T94A 1QY7A 2Y0SD 4D3GA 2D5RA 4CZGA 1K73O 3J81U 4BRLA 1R7IA 2KL8A 4XDCA 2HVIA 4DR7K 2UUAJ 5IXUA 1WF0A 1YWXA 3U3GA 1VQKN 5CD4A 4DL2A 4OX6A 4HUEA 2CJQA 3V4MA 3ZXWA 4B1YB 2AZ1A 3I0RB 5CHCB 3GQCA 3DHXA 4OI0A 3TSPA 4AHVA 5CE3A 2W4PA 4GVBA 3VAGA 2ZZTA 1P9QC 1OKJA 4WFXA 3BH6B 4M5JA 1SC4B 3JTOA 1A6LA 4AILC 2E5JA 1W2BR 2YNHB 1VQLN 3C8YA 4CIEA 3GIMA 5RUBA 2ZKTA 1VQ8N 3SSQA 3CD6S 1M5PC 2A18A 3CCLS 1CJTB 1Q5VA 3FUYA 4WFNQ 5BR8J 3MWTA 4L74A 4PXEA 3SDEB 2FLNA 3VQ9A 4YNQA 4UQTA 1O6XA 1ITGA 4C3LA 3DGPB 2YWWA 2NRVA 2L08A 1NK9A 2W4DA 3HYFA 2MZ1A 3A8KA 1I6JA 4MQ3A 1CULB 4BRNA 1X5PA 4JI1J 4H0TB 3O6WA 2P51A 4B3MJ 1LAWA 3BY5A 4J2BA 1U2RA 4IDHA 4CHZA 3OYJA 1GOCA 3SQGA 2JLEA 3CCRS 1QE1B 3R5AA 3GDQA 2G2YA 4XIUA 5HP1B 2QJ3A 4K8XA 4NLTA 2UVWA 3VQ6A 4RU2A 4FXWA 3ILLA 1F9HA 4JI5F 4CLUA 4WE1A 3FVYA 4ZVOB 4LSZB 3IBWA 1KDNA 3ETMA 4ZLPA 1N6QA 1ASWA 2ZF5O 3ZNUA 5DM7Q 3NHGA 5FPNA 4DR2F 1YQHA 3OW2M 2YX6A 2DNLA 4A47A 2EG1A 5KFSA 4IOCL 2J0QD 4FOIA 2KJWA 1XNRF 2HQFA 2FUG9 3W5YA 1RDBA 1U25A 3MI7X 2HNYB 1D09B 3U3YA 5IT9Y 5F0UA 2CQPA 3U1LA 2YKNA 2QI2A 2KLAA 3D2WA 3V4IB 1HWLA 3VVUA 2PEBA 2OZMA 2QM1A 5ETVA 3HFKA 2K06A 4F02A 2KXHA 1I1GA 4UY8O 2E2OA 3GJTB 1S9FA 3N4QA 4KHQA 2MPUA 5F8NA 3BSOA 4JI8J 3VESA 2UUAF 3CO9A 2KKZA 3VQPA 1ZM2A 3DXKB 2DY4A 1HI0P 2RH3A 3ZSQA 3SYZA 3DWLA 4YDUC 2VB6A 3D7SB 2DGWA 2VQEJ 4M3TA 1VC5A 4DR5J 2ASMA 4O8KA 4DOZA 1S12A 4LSLB 4FYXB 2EC2A 5A2QY 2M4MA 1YTAA 1GLCG 3NVKA 1G2EA 5I3UA 3LANA 3HRGA 4KSEB 2XULA 3L3CA 4JD2B 4ED2A 3GLJA 3V1RA 1IR1A 2D0OA 2VICA 4WYWA 5M1QA 2UV8G 2BJ8A 2DGQA 4NRTA 4CLLA 5M1KA 4IKAA 1NK6A 3FZFA 2QC3A 5ETTA 5GAEI 3AY0A 4R5PB 2DNYA 2IRYA 3MUTP 3LUYA 5BR8F 2DEJA 2FHKA 4LFAJ 2HGNA 2J0XA 3MMBB 3TJ8A 1S0OA 1YBUA 1WSHA 1TL7A 2IPOB 2R7XA 5BRHA 3GONA 4JI1F 4B3MF 3DU5A 3FZ2A 4QU6A 2HHWA 3JSMA 3EVOA 3MWBA 3HJFA 3C16B 3QIPA 3M6XA 2I1RA 2GA7A 2G0IA 2FGCA 4DPWA 3UR0A 3UN3A 2QEXN 4LD0A 4CK1A 4BACA 4PUOB 2RNEA 2HZCA 4Y2IA 1N8RT 5C25A 5E3AA 1RABB 1WACA 3TJ9A 5AE3A 2XZDB 4WQ4C 4IG3B 1BQNB 2A6AA 3WX8A 3OBYA 4DV7K 3G10A 1EETB 2OI2A 4LR7A 1BI4B 2Q3PA 1UJ4A 4L3QA 4WP9A 5KFRA 5K8PA 3HOTA 5B0BA 5L46A 2UXDK 4RR5A 3HHLD 4Y00A 1PCAA 4PQUB 2Q79A 3FDSA 3J7Z5 4AM6A 1XIQA 2R8GA 1YZ7A 1NGGA 1A5XA 5ADXA 1NB7A 4ED4A 2RQKA 4EBCA 1RT4A 3MGJA 2EKYA 2J9CA 3NGDA 3CPWR 2AW0A 3IWLA 1U04A 3CCQN 1ZETA 2GW8A 1FKOA 4JI8F 1X4CA 4JN4A 1VJWA 1GFWB 2V68A 5D8HB 5H1SV 4Q43A 2DFEA 1FWPA 5I42B 1G7CB 1NLKL 3CG7A 2VQEF 4DSIA 3C3LA 1JKHB 4DR5F 5KG7A 2CDQA 3OVAA 1YJRA 2V7YA 3K5MA 1XC9A 2DNNA 4RW9B 5HROA 4B3RJ 4YMEA 3IMXA 2E88A 1RK8A 3CM6A 4WTOB 1Y97A 1VI7A 3H7HB 5F0XA 1S97A 8RUCA 4CZKA 2BJEA 3VQSA 4K4XA 3M8SA 4TY8B 4C48A 4DQ8A 3F0NA 5EWEA 2DFFA 4A5BA 5B09A 1HNXJ 3H5UA 2K7KA 4LFAF 4LREA 2FC8A 3HPGA 3R97A 3CE8A 3TSUA 1BHLA 4IBNA 3EE8A 3F56A 3H42A 1DLOA 1UAWA 2J6UA 3I56N 3GZ7A 1UVJA 3DXBA 2GELA 1LWCB 4IR9A 4TY9A 3SMSA 4N8NA 4CYUA 3ZEUA 2VPWB 1MG7A 2GO9A 4KH5A 2ZWHA 1RAEB 1VQMS 2I5JB 1SV5B 4O55A 3JAMU 4X84A 4DUZJ 3TUJC 3ZZ0A 3RRHA 1RBSA 4NRUA 3ZTQA 1FTCA 2HGMA 3RSEB 1Z1ZA 4A8WA 1X0PA 1Z2ZA 1K0TA 1SQKA 3MCAB 1RBTA 2QLWA 3FZKA 3TJAA 3FZLA 3IG1B 3IRXB 2GHPA 4OKKA 1P1LA 1JL1A 2M88A 4A8SA 4X4QA 4BRDA 2KM8B 3MFHA 1HMVB 2XSJB 2XB2D 2BA9A 2DNQA 3P49B 4IH6A 1R0AB 1V3RA 4Y2CA 3CIPA 4NLCA 1XNQK 2H51B 1C6VA 1WOPA 1FNMA 3DOKA 4JI2K 5DQIA 1DZ5A 3D6TB 1UVKA 3LDSA 4NXNJ 3M9OB 4M7YA 3CD7A 1WOSA 1D9DA 4TSXA 3UPFA 3IWXA 3QATA 3GIKA 2A5XA 3KG4A 4HCCA 3D6MB 2VOOA 4JI6K 4J5OA 4DV3J 4M5DA 3TZYA 4HWIA 2DHHA 3M1VA 1UPPA 4Y2KA 5JLHA 1W25A 4U67L 2O67A 5DLGA 3RAMA 2HNDA 3OL9A 1HPMA 4B3RF 4FNHA 3DRYA 4IRKA 3DDKA 1Y0HA 2A6OA 1CC8A 3T1YK 3RMAA 4MIBA 1C1CA 1VIOA 2OPSB 2W9BA 3KXDA 3MEGA 1ZBFA 4HL9A 4I7FB 3MEKA 4YORA 2GC8A 3Q83A 1BL3A 4FLYA 4EAHD 3W61A 5DRKA 5EX5A 3M2UA 2R7VA 4HHTA 1DQAA 1HPZA 1HNXF 2G8UA 5BRFA 4H4OA 4WKRA 4F3QA 1SUQB 4H4MB 4BREA 2N4CA 4CBXA 4ZCLA 2NRZA 4FVCA 3O4WA 2OANA 2RHSB 1O0PA 1FI4A 1VHIA 5K14A 3C15A 2O4IA 4ZJLA 3FCWA 4C4WA 3W9HA 3MXMA 3VAFA 4PKGA 4DTNA 1JLCB 2HHHK 3SI8A 1KTVA 1WNEA 4BY9C 2ATCB 4KV8B 4DUZF 3R1HA 3H1QA 4JK8A 3ENBA 4AH9A 3VQTA 3MN7A 4DR7J 4PL8A 3ILIA 4CH0S 2CKWA 4OYBA 3ZETB 4PRFA 1RA7A 4WCEQ 2LA4A 5HMZA 2HQDA 1RU2A 3M8QA 3W62A 1NK4A 3X3UA 4H0PA 3KK7A 1X9MA 4MK9A 3MUVP 3HPHA 2RVJA 4GVBB 1YVUA 1KCFA 5C2DA 4XTTA 4CLPA 1UZDA 4HT5A 4AUKA 3PSIA 1FRKA 2O4GA 1CSJA 1HX1A 5LL6Z 4MK7A 2FF3B 2G13A 4X4SA 2Y0BB 3SCXA 4A4JA 2D7SA 3SMPA 3L7OA 3B54A 4WFYA 2QFIA 4BVOA 2QL5B 1K0VA 4NXNF 1WG1A 2YVSA 3RW6A 4CEQA 2G8KA 2E29A 3K58A 4FPIA 4KPYA 2X6NA 4QIFA 3P4UB 4OX7A 2LKZA 2LEPA 2R7YA 2FIUA 4DTXA 1BUPA 1G6BA 4DV3F 2G8HA 2DITA 3AA4A 1NPRA 2IJRA 2V2KA 2JL9A 3GFZA 5LMUJ 3IS9A 2RF2A 1X4GA 4ZCKA 3KYLA 5E84A 4URQU 3K8VA 4J2EA 4P2SA 4BHQA 3I82A 1WSFA 3SQGB 4QAGA 1GOAA 4O3PA 4KGZB 3ELHA 3ZSRA 1NEEA 5L38A 5GIOA 4DTOA 4IFEA 4WE1B 4ZTFA 1D8ZA 1N6QB 2AT1B 3DGVA 4EYHB 2RHKA 4H0OA 2ROPA 2IC3A 1HQUB 4DDFA 1WG5A 1KQSM 5KFUA 4X4UA 1BCMA 2PFDA 1OVQA 2NRRA 4GKKK 3F9MA 1NGEA 3DAWA 3GSDA 2WVEA 4DCHA 2VWJA 1IBCB 2QLXA 2RUSA 3IC1A 4H5RA 2OTLN 3OY9A 3R7BB 2YKNB 4MFBA 4E7KA 1G99A 4QIGA 4O44A 1FFSB 5LT5A 4IQMA 4OZLA 3ISNC 2G8IA 3CNQP 3OSPA 4MO4A 1KN6A 3G25A 1X0FA 3J81j 5EVZA 4ED0A 4FLZA 4DR7F 3HSCA 4RBUA 4U8VA 1IKWA 3MOJB 4WP8A 4I67A 3D1HA 1FK9A 3VGLA 1PC4A 1RJJA 4O8UA 4QIEA 2A2DA 1YRXA 1FJEB 2Z2ZA 4E8UA 4DMNA 2PFUA 2F4FA 3W8PA 4LY7A 4OYMA 4GVLA 2E2PA 3MDFA 1HBOA 4CVNE 1ZH5A 3NNHA 2J8AA 4GVMA 2HRUA 2XLIA 3FEYB 5I3UB 1QD1A 2E2QA 1T9XA 4DEZA 3O3HA 3JXOA 1S0MA 3D66A 3RB3A 2CQ0A 1VQOS 5ETKA 5BPNA 1JJCB 2NRWA 1DURA 2QKKA 2BJ7A 3QT7A 3P5TL 3MM6A 4DU3A 1EXQA 4TXSA 1CBKA 1HNVA 2DNPA 2O8FA 3AVFA 3S41A 3FNNA 1NSQA 3WX4A 4N56A 2VJVA 3SQ2A 1REGX 1TL7B 4NA2A 2DCLA 5LMUF 3I5AA 1H38A 4CGJA 4KFBA 3A4TA 1LV5A 2HBYB 5F41A 2KFNA 3QIPB 5AQSA 3D54A 4FLUA 1S7IA 2XHWA 1R8BA 5IWAK 4LF6K 5KRTA 2RIJA 4GO7X 4I6MA 4NI2A 5C25B 2ZOGA 4OZJA 2GMJA 1S6QA 2YHBA 4DV7J 3WNGA 2ZHBA 4K4TA 1NJYA 2XS7A 2Z1JA 4LF9K 4UOHA 4FWKA 1NK0A 2FLPA 4A2BA 2HFOA 1EWQA 1KVBA 1BO5O 1AW0A 1RWNB 2BDPA 1RWPB 2UXDJ 3VAKA 2MB0B 4WFBL 2HFUA 4RNNA 1DT9A 1NHUA 1VQ7S 1T3NA 2WONA 3ZTRA 1AXQA 4TQSA 2ATQA 4Q2MA 4ZLNA 2LECA 4I56A 3NWGA 5KT3A 2W9CA 3FZMA 4I0WA 2YKQA 3ZT1A 1SC6A 4QOZB 3HVWA 4IYQA 4YOVA 3KG1A 3MX5A 1RT4B 4F4YA 4BR4A 2E6MA 4CESA 3IWNC 4L6V3 3CHWA 1FKOB 4LF8K 5B0EA 4HUFA 3V6JA 4QR0A 4UOFA 3TVZA 2OJ3A 4GW6A 2J4RA 2FF6A 3SCIE 1EB0A 1D5AA 1CJUA 2AA4A 2YWHA 4ECYA 3WBZA 3OJSA 3CSKA 1R0CB 2MDAA 1Y4ZB 2OSQA 5KFKA 1UVNA 4LSNA 1M90T 5HROB 3ZZPA 2VL1A 3QAEA 5HRSA 4IO9L 3N5BA 5GADP 2M8DB 2IFXA 5KFZA 4IFVA 3MN5A 3TZWA 4EK2A 4JKHA 5KFNA 2FVRA 5IT9U 4FW2A 5AZJA 2PSZA 5E26A 3PHTA 3PJXA 1XMOK 2QYCA 2XGQA 3X1LB 3MM8A 4DFJA 1IKYA 3IUCA 3HD1A 4XK8C 5MLCV 2JWNA 5CAAA 4E1MA 1TKTA 1DLOB 1IG8A 4X4TA 3QRQA 4P7TA 3QRPA 3LA0A 2QA2A 4CJPA 1KS2A 4CYUB 3ZEUB 2B8PA 2G1DA 5ETPA 4ZA1A 2VA3A 3IO1A 1RE1B 4LVOP 3CCVN 3EX7B 4NEZA 2MKYA 3OW2R 4ZIWA 3R8EA 1OQ6A 1NJZA 5D78A 4BWJA 1QQMA 2WZ1A 4DV6K 1VK8A 4HDGA 5AQHA 4DV7F 2MZJA 4C0BA 5DETA 3DM2A 4OYAA 5K20B 4Y34A 3G0ZA 2QLJB 2GHWA 4M3WA 3H3NO 1E6YA 1KWMA 4M95A 4ES2A 5C12A 3DN9A 3HI0A 1ZAWA 5KPTA 2W2MP 1XNQJ 4BC5A 4KI6A 4EWTA 4JI2J 3DOKB 5F8MA 4HH1A 1H1VA 4J9MA 3PIPQ 1FJCA 3PTWA 3NGYA 4P2XA 4A59A 1LOTB 2P6TA 4DU4A 4DFPA 2FB0A 3P5JA 3MEDA 3OVSA 2PYJA 3GFYA 3VR1A 2ZJQQ 4ECSA 4JI6J 1SH3A 5A8WA 2XYHB 3AODA 3OTOK 1RACB 1JB0C 2QIFA 1IBKK 5CXTA 4M5DB 3C6AA 1T6CA 2F8EX 5KFBA 4DF8A 5DQGA 3M1VB 4IOAL 3VGUA 3KFWX 1OH8A 4FBTA 3NGUA 2HNDB 3RJMB 1S9GA 4MDAA 3T1YJ 3KWMA 3IGNA 4Z4HA 4O3NA 1NSAA 3S3MA 3MTJA 2Z57B 1QDUB 1C1CB 3H3OB 2OEMA 4CH7A 5J2QA 4IRDA 1VSHA 2W9BB 5EY4A 3MEGB 1Z2LA 1M90O 2MJNA 3DOLA 1LCUA 4YEAA 2G9OA 1CQNA 5A0YA 4OZ0A 1RAFB 1VISA 3FMBA 1NH7A 5KFYA 3B6OA 4BGBA 1FRHA 2XMJA 4E2FB 4DV1K 3M2UB 2UVVA 3NMUA 3BGFA 4S0MA 1HPZB 1NBWA 3UDLA 4H4OB 3C0BA 5JJBA 4JNEA 5D3GA 3OYHA 3E9OA 2E20A 4LH4A 1XR6A 2IS3A 4TLQA 5K14B 3C15B 4F7VA 1TV6A 4Y65A 4GNIA 2ZH3A 3ZZZA 5IT4A 2HHHJ 1OMSA 2NRTA 3BO4A 1VLOA 4ES1A 4XAKA 1N34K 1UJ6A 2DRDA 1S1WA 2CQ4A 1DRZA 1PG5B 4O0JA 3CCES 4LFBJ 4I9QA 2BOAA 2LQJA 2DXEA 3LPTA 4G6VB 2DGSA 2XC9A 2UV8A 1ZYQA 3AD9C 1KOOA 4HEA9 4RZRA 2MTLA 5CZXA 3RZAA 5CZ1A 2Q31A 3M8QB 4ECTA 2K2PA 3KIOA 2I9SA 1OPZA 3ENWA 3LDQA 2RDIA 2EK1A 3D2EA 1V4TA 2W41A 1RT6A 1K1SA 2VZ9A 1S72N 3EZOA 1XNQF 4DB3A 3OTBA 4JI2F 3AVLA 1X9JA 5FPEA 1IJEB 2ROGA 2HLTA 2ROEA 2PEHA 5B8HA 4CLWA 3BN7A 1VSKA 2IVPA 4GV6A 4DR6K 2QRRA 5GAHP 1WBBA 1NO8A 1WSEA 4CW7B 4BRGA 3SJJA 4JI6F 3L8BA 4F50A 5EHHA 2CWXA 3H5SA 4OZ2A 3BQ0A 5LXYA 4Q44A 3SUQA 4DX5A 2V7ZA 1QUPA 3L09A 4CJKA 4F0HA 3I33A 5C10A 3IS9B 2RF2B 3TZXA 1SJ4P 4WZMA 4QWAA 4WP3A 1YRUA 2MLZA 4DUTA 2Q6CA 1N5YA 2B51A 1UEKA 5F8HA 3UQSA 3PR5B 3H40A 3MX2A 2KG1A 2M7SA 2KJVA 4ECRA 3V1QA 3BR8A 3ITHA 3VQDA 3N4WA 4NCBA 2QWPA 2CQ2A 2FY8A 4K59A 4IOBA 4YOEA 2GAHC 3AT1B 3CJ3A 2IC3B 3AY9A 4B9LA 1FKAF 4GKKJ 2D69A 3GCXP 4DCOB 1C2PA 3OSNA 3BEGB 2LDIA 4FYWB 1S79A 3HVRA 5FROA 1SH0A 1ATSA 3KHHA 4MFBB 5AQKA 2HHHF 4X2BA 4O44B 3KG0A 5E33A 4FBUA 2VUGA 4DPXA 4DTSA 3NDKA 4BS2A 4LFBF 3C65A 3ENQA 4C9DA 3JYTA 4DU8A 1YGYA 5JUMA 3OFHA 2QZ8A 1FK9B 3DRSA 4CI0B 3PV8A 4RW8A 2CH5A 4WWSA 2Z58B 4OLPA 2WCXA 5H9EK 2HF3A 3V9ZA 3PVXA 3CJ1A 3QBXA 2DNRA 4DS4A 1HBOB 2UVUA 4JV2A 1S4EA 2ZH8A 2VGNA 4O0NA 5HJXA 1ZAVA 3I55S 3J80Y 3ZTOA 1X5SA 2J0WA 2H1YA 5D0HA 3CMQA 3GFHA 2GWKA 5B7WA 4HLBA 1CLFA 1HNZK 4FK0A 1LXJA 1XC3A 2FLOA 4QR1A 2P5OA 1SXLA 2M0GB 2PA3A 2DNKA 2WBNA 1QQNA 3BSAA 3R6GB 2FVQA 2P9GA 1LOUA 3M30A 3MM6B 5F9NA 2CJAA 3HLUA 3HSTB 3TUPA 4XPEA 4MIAA 4OHWA 4OVLA 1HNVB 2O8FB 3RU0A 2Z30B 2EC0A 5DLFA 2RKIA 2WVDA 2GBZA 3HHDA 2P9PA 1UVMA 3DXMA 3UNYA 3G6XA 2OIHA 3QEIA 3ENOA 3D6HB 4KFBB 1YJ9N 1WD6A 4N47A 3AJ1A 1JNZB 1GLDG 3LDNA 5AQRA 4JS5A 4EFAC 1R8CA 3GR1A 1F60B 4ZLJA 4YOWA 3TAEA 4LF5K 1B9FA 4YFUA 3R7SB 5CYQA 5IWAJ 3BEXA 1YG0A 3QWUA 5C0YA 2JOQA 3JQJA 1N0UA 1F9EB 4C6AA 1GT8A 3KLEA 4NI2B 1FDBA 4IDKA 3FRZA 2CZVC 4CP5A 2MKIA 4YOTA 1U1KA 5EN1A 1BY9A 2EBEA 1FJ7A 1S6QB 4LF9J 1NGFA 4CJ4A 1H7WA 4GKKF 1TUUA 2GIRA 2E44A 1VQYA 4CBUA 2Q66A 4E1JA 2MSTA 2E2NA 4NCGA 2FZKB 4BC9A 4AL6A 4CHQA 4L3NA 2WONB 1NHVA 2YH0A 6FDRA 1PKUA 3P1GA 3A1YG 3GILA 3TAFA 2CNLB 2W9CB 2CQHA 5JXSA 4M3ZA 4W92B 3R8YA 4X64K 4ETZA 3NMRA 4RO0A 3GPAA 4KTZA 4F4WA 2XLKA 3CC2N 4LF8J 1FXLA 1T44A 2QL7B 3RG6A 3QEVA 1M5SA 4P71A 1T9WA 2NPFA 4Q45A 4HUGA 1CJUB 1RILA 1WSIA 3C94A 4CJLA 2MHEA 2Y9HA 1JLFA 2IVMA 3ET6A 3TP2A 4QQBA 3EXCX 4I6AA 4DZ6A 1J2VA 4LSNB 3POTA 1FWKA 3JSRA 5HSPA 3MXIA 4IFVB 3D45A 1RYRA 5KT4A 4NB4A 3WXJA 2HBZB 3C2PA 1YJUA 2V51B 4WU2A 4QS9A 4W5OA 4C7QA 3M8YA 5MLCQ 5AZJB 5HATA 1XMOJ 1M5KC 4OHXA 4J9LA 3M6UA 3SBTA 2D3UA 4P74A 4CWBA 4YR3A 4ECVA 1R8AA 1LW0B 3M8PA 3MM8B 3K17A 5THWA 1IKYB 1NZ8A 4V19S 3M2RA 1IJFB 1S5ZA 4J9NA 1TKTB 3W2WA 4DCPB 2HHQA 1HNWF 2E9ZA 4Z4IA 2V8PA 1C0TA 2DO4A 4K2JA 1P6TA 2K8GA 1RDUA 2E1AA 3VAMA 4F4AA 4BROA 5IWAF 2IVOA 5KOXA 4X62K 1T05A 1XQSC 2BABA 1WHXA 3V6KA 1C0UA 2B7CB 2IM3A 2DPJA 4DV6J 2OPRA 2OEKA 5F2RA 2F1FA 2JEGA 3UFCX 2BXJA 4LF9F 3VZHA 1KAXA 2ALYB 3DM2B 4HKQA 1SQFA 3N6LA 5AXLA 2V4RA 1Y5IB 2HFNA 1WF2A 1UVLA 3QFWA 2AJ4A 3O4QA 4DR1F 3HKZD 3W0LA 5BYQA 1E6YB 3LAMA 4NYZA 1RDWX 2BE7D 5HK4A 5IV4A 3I8DA 1YJNN 1ZBHA 1D4XA 2RN2A 2W40A 1VC0A 4BC7A 1P8ZA 3F41A 1H6KX 1VQ9N 2H48B 3BSCA 3GTYX 2F9DA 4BVPA 2FSJA 2JC1A 2WHOA 4KHPJ 3JS9A 2DGOA 1KLMA 2RAQA 3VF6A 4H0XB 1D3WA 1R6VA 1UEUA 2LMIA 4LMZA 2Z56B 4LF8F 1HWKA 4RCHA 3UCZP 1ZTWA 1HHQA 5J1NA 2IYIA 1RWMB 2QG9B 1NU4A 3MEDB 1WOQA 5AR0A 1MW7A 3CIZA 3ZZYA 5DDQC 3M6GA 1XWLA 5A8WB 1FNXH 3OTOJ 4LFCK 3TR5A 2A42A 2WW4A 5AE1A 2XBPA 1L5UA 1JL2A 3WDOA 2WB4A 4QW9A 2DFHA 4FZVA 3PIOQ 2XMTA 1FVQA 3VQCA 4A46A 1N5TA 1S9GB 2VBWA 4QJVA 3F44A 4BRFA 4Y2MA 2YI1A 4B08A 1KEKA 3A5NC 5KOWA 5J2QB 1N48A 4OL8A 3DOLB 3QGGA 3CDUA 4EI2A 5A0YB 1XMOF 2YX1A 4DV1J 2QWQA 4IFYA 5HN0A 4X4OA 2Q2RA 4HT7A 4DTMA 2ASYA 1WSJA 1RWOB 4OKEA 4K4UA 5D3GB 4DSEA 1NJIT 1JMTA 2CPFA 3PCOB 4ZTJA 4Q7AA 1OSDA 1PAUB 3KJVA 2A1BA 3T1AA 3THVA 3MR6A 4ZPWR 1TV6B 3LL3A 4BC4A 4DQRA 4CTAA 3MFIA 3MAQA 2FHJA 1H2VZ 1L3VA 4KRWA 3CJ0A 4DTJA 1N34J 2M5YA 1Q78A 4E1NA 5BYRA 1S1WB 1BU6O 5KGWA 2JWKA 4K0KK 3CCWA 2D41A 3MF5A 3ENHA 2P5GA 1NU0A 1X5OA 4DL6A 2L3MA 4DV6F 4AHSA 2VD3A 2P1JA 1BA0A 1MROA 1X5TA 4KJIA 3C6UA 4JRQA 2XZTB 2CQGA 4WIQA 2OD6A 4NXMK 2GX9A 1NGIA 2P9EA 2C3UA 1WSVA 2DBBA 2GZOA 2E8AA 3D2EB 4NZ6A 4GMJB 1LNQA 1RT6B 4LH5A 3H2LA 4USKA 5CQGA 5HL7Q 2M70A 2J76E 1SL0A 1RT5A 1VK0A 4KHPF 4H5NA 2KN4A 2Y1IA 5D4OA 4DR6J 1Z26A 4DSLA 3PEHA 3G6EN 3IP0A 1LXNA 3WNFA 2DT9A 3QO9A 1X4BA 1NOYA 1KC8O 4RNOA 4UZCA 1SC3B 3OTOF 2NCKL 3A13A 2XMKA 2NR0A 2VG6A 1VQ6S 2IIRA 3VV2B 2HB5A 4B1ZA 1YIJS 3S01A 3PZPA 3TA2A 1C0GA 2Y1LB 4ZK7M 2HFSA 3W60A 2H4YB 3ILOA 3MM7A 3W1YC 4W98A 3J81Y 4DR3K 1PYOB 1N5YB 1ACMB 1H98A 1O8BA 1WKLA 3O5TB 2QK9A 1WC4A 3RBXA 4CK2A 3BZKA 4X4PA 2C3OA 2QWLA 1RDCA 3IAYA 1VOMA 3QBWA 3ITHB 4LRAA 4FF3A 4DV1F 2EFOA 3RBDA 3LF0A 2YNIA 5IFMA 2YH1A 4F36A 3V1OA 2V69A 2ALZA 2E5LJ 4F8RA 3OFGA 3V81B 3BGLA 1MWMA 1QVFR 2RB7A 3NGIA 1HQEA 3RUBL 3BGRA 4KBOA 3O8WA 1OVYA 3QT5A 3K57A 3E01A 5DGAA 2WVCA 1N34F 3OR1A 2Y8WA 5HBMA 2C3PA 3FBFA 2B4VA 5E2QA 3JYTB 2XI2A 3L2VA 5JVGQ 3CMAS 4RW8B 3OYGA 5FIIA 3VF0B 1FRJA 5E3CA 5GADU 1NGDA 2QA4N 3VWSA 2IRXA 5HOOA 3F73A 3GJSB 4NWBA 1SJ3P 1TK5A 3HXMA 3Q0AA 2ZOMA 2KDOA 2MKKA 1U47A 2E7WA 1Q81T 2MJUA 4WKYA 1BE4A 1RBRA 3W64A 2QA1A 5LSOA 1HNZJ 2Z0GA 2L9NA 4OYIA 4K42A 1GMWA 4EU0A 3T9ZA 3QFHA 1S22A 3ASMA 4FF4A 4DR6F 3GV5B 1UA0A 3VQQA 1TFWA 1K8AT 5DG7A 1V5IB 3M30B 3QMLA 1YBAA 3UCGA 1WUUA 2KI2A 3EVMA 2DGUA 4CF0A 1VRQC 4P2MA 1T3OA 2N82B 2RKIB 3EPIA 4LF2A 3H4DA 5EX3A 4KTWA 1B4SA 3NF7A 2P9PB 3DXMB 1UETA 3MM5A 3H5YA 2PI4A 3DLJA 4ZVGA 4ZN3A 5SZTA 3PW4A 3QYYA 3GJRB 2IRUA 2BUPA 3NGTA 3RW7A 1Q53A 2XMVA 4CD3A 2XTJP 1KHVA 5ETNA 4R0JA 4LF5J 1K9MT 1QS4A 1WB9A 3AVGA 3QSIA 5L8RC 5CYQB 2W2PP 2MZTA 1UW9A 3DKDA 1UOCA 3TEGA 3PYFA 5AQPA 3KLEB 3EMTA 1ILYA 1S3XA 4IDKB 4JI5K 3KK1A 3S1TA 3HDSA 4A8QA 3ZC4A 3NGRA 1OJ4A 2YKOA 3VGMA 2E5LF 2CJ9A 3FFIA 4ZPVR 2X7IA 4NCGB 2DO0A 4USWA 2CVEA 2ZGYA 1N0VC 5LJ3Y 2KXFA 1T9UA 4A48A 2F8TA 1KVAA 2HHUA 2R9LA 2CH6A 4ED8A 4BR5A 3SAGA 4X64J 3CCMN 3NF6A 1VQPN 2NZ4A 2DPIA 1TVRA 4OMFG 3IAM9 5HJYA 5M1FA 3J7ZT 3EZUA 4PWDA 5M2UA 2C2ZB 2W42A 2VJUA 1A7GE 2HRYA 2HBQB 4CGIA 4WZQA 2KKHA 3FZHA 1BD6A 1RBUA 4DV5J 2QYGA 2RD5C 3MDQA 4DL0C 3MMVA 2D3O1 1MA9B 2AWZA 3AO3A 3I5CA 1X4HA 5B08A 1JLFB 3ET6B 2FJAB 3EZ5A 3P8BB 5ETMA 1KKHA 5U47A 5LJVA 4TQRA 1P9YA 3POTB 1KR4A 1MU2A 2I7PA 2QTDA 1HNZF 4NMXA 2YQ3A 3MOZA 3N01A 3G82A 4KHRA 3SBMA 2YJFA 2GQQA 2HKEA 4C2MA 2UVRA 4W5TA 2CZ4A 1X4EA 1JJHA 3G71S 4B1WB 3HMJG 2ZBIA 5HQ8A 4BRHA 5IQQA 3M8PB 3M2RB 3CDAA 1TMMA 4CHYA 1FNOA 5AQLA 1K8AO 1RT7A 2Q36A 3PW7A 4PPZA 3W2WB 3KK3A 2CG8A 2AF6A 3RGIA 2V6AA 4USIA 5H9FK 3HHLA 2ZVIA 4CLYA 1C0TB 2XHBA 4N7TA 2HAFA 2XY7A 2RDJA 2VKZG 2RMLA 3JSYA 4LF5F 1NPPA 4FDFA 2ZNZA 3EGZA 3GB0A 4K2XA 1T05B 3J80U 1WI6A 1C0UB 1FD2A 3BKFA 2OPRB 1K9MO 3IBFB 1U6FA 2UUWA 4A8XA 2HWTA 4DL5A 4B9TA 2QL9B 3OS0A 1FX4A 4A5AA 4MAKA 1F3FA 5A6WA 1CLQA 5J2MA 4Z4GA 1EP4A 1K44A 3M6VA 3RB0A 3ISZA 2R3VA 2B4JA 2F8MA 5D0RA 4F25A 2QX0A 1U1LA 2UZAA 3KHGA 3PRDA 2D3OR 4CJSA 4CNZA 3W3DA 1XHXA 3IM9A 5GAHU 4X64F 5CY4A 2F9JA 4QR2A 3MURP 4ZVUB 4FPAA 3R3LA 1ITPA 1V5VA 2VIHA 1KLMB 4X4RA 4CZIA 1OY9A 1PIEA 7FD1A 2WTFA 3E51A 3PYGA 3KJFB 3QLHA 2XMUA 1VQ5N 3VZIA 4DV5F 2NQPA 5AQNA 1XEZA 1HD1A 4LFCJ 2NXUA 4EFHA 4PKIA 3J7ZO 3NCPA 4F3MA 2Y1RI 2QSWA 2VQEK 1YDLA 2ZWOA 4O23A 1DTQA 3CTRA 2WBMA 4D3HA 4YUDA 5AQZA 4OHZA 3U9DA 2MXYA 4G1QA 1BWEA 5L9XA 1T7PA 1A9NB 5IC6B 4F3TA 1RTJA 2XNRA 3EN9A 2P6SA 3VQEA 2ZJPQ 5B0AA 5CYMA 3I9ZA 4OJ1A 4IFYB 1XK8A 2QW9A 5AT1B 5C2FA 4BC2A 2R7SA 3CCSS 1FF2A 3HT3A 5HVFA 2HS3A 1WKKA 1RBVA 1TKXA 3R9LA 2QE5A 2AJQA 1HRHA 4J9OA 4USTA 1VBYA 3KJVB 2ZGZA 3VGVA 4CTAB 1B64A 2CQIA 2VHGA 3EGWB 1B9DA 4RBTA 4KHMA 3H0PA 3PLAA 1Y00A 2CG4A 2QO3A 5I3QA 2DHSA 4OFZA 2OA8A 2Z2YB 3CMES 2ZVSA 3T19A 1DGKN 5C2CA 4ECQA 1CZBA 2ZBRA 4KHSA 1MROB 1R8PA 2FXUA 3WIUA 3MWPA 2ITMA 1YHQN 3C6UB 1U6ZA 3FEXB 3R3TA 4YN3B 4NXMJ 1S1TB 2E6LA 1W7AA 1UPMB 5DZ7A 3IKMA 1I51B 2JJ4D 1BIUA 3QZ8A 1E6VA 4GMKA 1EKSA 4O3RA 1IUJA 2V50A 5LXRA 2XCPA 2XMWA 1Q7YT 3EEQA 4NLSA 1WSGA 2HVZA 2XHCA 4GVEA 4URGA 2Q43A 1RT5B 3UD4P 1HI1A 1NM2A 4KIAA 1LAVA 3BKTA 4ID5A 2YWKA 4RNMA 3A5OC 1TAUA 1NXIA 1HJRA 3QO9B 4DG1A 2DCUB 4LFCF 4XH4A 2HYIB 4K8RA 2IDLA 3DRPA 2VG6B 4CFCA 2MYFA 3BDEA 5ADZA 3H6EA 2RILA 2QFJA 1U0SA 5FPDA 3O9SA 3CC7N 2CJBA 1NMEB 3Q2SC 2WK4A 1OIAA 4DR3J 3MM7B 3MXJA 1ZXOA 3THYA 1FFGB 3N4PA 3AA8A 3NCQA 4X4NA 4LF7K 2QWOA 3G8TA 1HJOA 1QLNA 5IOLA 1FO1A 1GOBA 1Y10A 5LOQA 3IFRA 3SZ2A 3WQUA 3LWMA 1FDAA 2YNIB 1J54A 3KHRA 3KKSA 1Q8IA 3LDLA 3OBIA 2VPXB 4EYIB 3R6LB 2PIIA 2VV5A 2MSSA 2LYVA 1BWFO 3PUFA 3DLKA 4BR9A 3FSYA 4DR4K 2E66A 3SQOP 2HBMA 1HQEB 1UFLA 4FKYA 4P52A 2YQ1A 4WU3A 5LSLA 4YB1P 3E01B 5HBMB 2OMOA 4OZNA 1SJFA 4JEPA 3QNOA 3HO1A 2LDYA 4M3UA 1FESA 2ZEJA 2X6SA 4IO1A 3BBFA 5HRRA 4DXLA 2N3OA 2VWKA 2JC0A 2UXCK 3GIJA 3O8MA 1BWVA 2OPQA 4MKVA 2OPPA 4Z4EA 1GX6A 3O9QA 1SJQA 3SV4A 5HQMA 3SV3A 1SZ2A 4NXMF 2RU9A 3HZ6A 3ZX0A 1AT1B 4BE1A 2NUBA 2X74A 2R7UA 3CCJN 1HKBA 1T0TV 1DQ8A 4QPXA 4J9VA 2ZD1A 4FWSA 4CGDA 4TU9A 1HARA 2PE8A 3RMBA 5J2NA 3PR4A 1WHVA 3EDQB 1XTZA 2EEYA 2GAGC 4ZP9A 1FT8A 3VAJA 4F9OA 4K4YA 1GNKA 4PG6A 1Q7YO 2JLFA 2N3LA 4NXNK 2DIVA 2V9KA 3UVJA 4MKAA 1PILA 2RS2A 1JXLA 5BR9A 1X9WA 2FBXA 2IVFB 4JKBA 4YR0A 3ZSOA 4A8KA 1UZHA 3MM5B 4FW1A 4B8CA 3BPSP 5FDLA 4DR3F 2HK3A 4LBIA 2KT3A 1FJGF 1D8YA 2FZCB 1YSJA 4OV1A 3RYLA 2ZM6K 1RISA 1TKZA 1R6YA 3N0VA 3MR3A 3UN5A 4NLRA 4BE2A 1VQ9S 1KBRA 2G8VA 3ZX2A 2IVYA 5HMXA 3ZT3A 4ED3A 4I9LA 2FZGB 4KH0B 1VBZA 3WC2A 2BBEA 4HHJA 3KK1B 3B8HA 4FVUA 2ZWPA 4BRCA 2GTDA 2M2BA 4XO0A 3GE9A 2AJ1A 3PFEA 2KHOA 1BHNA 4MTPA 4L73A 1UJ5A 3FFIB 2R8JA 1KAYA 1U2VA 1HBMA 3BF4A 3KWIA 3MCPA 2W9AA 3V5RA 1HKAA 3FCHA 4P9SA 3VA0A 3TVKA 3G87A 3VETA 4XH5A 2OTJN 2F9TA 4Q0BA 2QV6A 3PX0A 1UKUA 3A3OB 4M5IA 5AQMA 4DL7A 4ZVPB 1NGBA 1TVRB 4OJ3A 4H5WA 4C8YA 2OEJA 3K0JA 4G65A 1O13A 4JUZA 4PWDB 4V19X 5C15A 2KFZA 1FFWB 1RSCA 1NPKA 4TLRA 4IEIA 3CULA 2IDOA 3KUEA 2YHAA 1GLEG 3ZETA 2HZVA 2BGGA 2XYPB 2D0BA 3JQMA 4ZOSA 2ZC3A 3Q8RB 4Z0UA 4WJBA 2A1SA 4OI2A 2ASOA 4ZPCA 5CCLA 3WHIA 1Y3JA 3VGKA 3ATVA 1OH5A 4WFAQ 4DLEA 4UZBA 2CGKA 4QWBA 1MU2B 3BDPA 4USVA 3OYMA 2KQ2A 1CVJA 1XMQK 4CFAA 4BDYA 2R8IA 3U27A 3HSZA 2Q1NA 7FDRA 2VPYB 3G82B 2GMHA 2A40A 3KOAA 4NZ7A 3OHAA 2NUHA 3R1XA 4GY2B 1U26A 2GNKA 2MY7A 1C4CA 2EPIA 3S7RA 1VSJA 3J8AA 3WQTA 1FXRA 1EKRA 2HS0A 1J53A 1W0HA 3NAEA 3GIIA 5D4NA 3W3SA 4O5FA 3UKRA 4CM2A 1RT7B 2CJYB 3BB5A 3CIMA 3ZZOA 4QWDA 2AD9A 1NMDA 3KK3B 3DXSX 3R9PA 5LMUK 4EZ9A 3N79A 5H9FJ 1RTIA 2AGPA 3HHLB 4HVJA 4TNOA 3T41A 2OGUA 2LVWA 5GVQA 1FE0A 1GMWD 2E1RA 3QPIA 4CERA 4JBCA 4E7JA 3AB2B 4OQJA 2ZE2A 3VGTA 4HI1A 3F2KA 4ISEA 2HW3A 2FSNA 5FJ4A 4M3XA 3GWCA 4CO4A 1PJ6A 1PJ5A 4Z94A 1HQUA 3GOIA 1KD1T 2QLBB 5E0OA 2DHGA 4H0VB 1IG9A 4KHYA 2HQIA 1EIYB 5J2MB 1EP4B 3SUPA 1YTUA 4ITSA 3PW5A 3CCLN 2QWMA 3CXCR 4WQ5C 4OPKA 2XLJA 3MK6A 4IEEA 4QYZK 1VSEA 4TN2A 3AVJA 4GRSA 5KG2A 1Y11A 3K2PA 1OQ3A 1IJJA 4LIRA 4CEFA 1KQFB 4WF9Q 3LGMA 1ZBLA 3B78A 3K89A 3FQLA 5GMKa 5EXWA 4BQLA 1LFPA 3QLHB 4NYNA 2CVIA 4ZHRA 1KVCA 1Y9OA 3ZTPA 2YV0X 2CGJA 3CCRN 4ZVTB 2V94A 2GX8A 1IBMK 4G1IA 3OFEA 1I5OB 1ROFA 4CJ5A 2VDHA 2DYAA 2B5JA 3SMZA 5EU7A 5KFMA 3DU6A 2QWNA 3QJJA 2CFXA 1DKGD 1RI7A 3CCUS 2B9WA 1DTQB 4J9PA 3G4SS 3IR5B 4LJMA 4DS5A 1F2HA 2O5DA 4RUAA 4G1QB 2VBZA 3AD7C 3AQPA 4FNIA 1XUPO 1VC6A 2HBRB 1QM9A 5AQJA 1K6YA 2NRHA 4GC7A 1RTJB 4ETXA 4IKFA 1TMJA 2DNOA 3KLGA 4CIFA 1U0HA 3TU5A 4CLTA 1RQ0A 4CZFA 1TK0A 5CYMB 3MXHP 2WUSA 4LUBA 5GADI 3L7PA 4K4WA 4PL7A 3Q8YA 5GAGP 3D1OA 3NY0A 3HHEA 4LRDA 2VASA 5KFIA 3CCTA 5HQLA 1TKXB 2HWHA 2ZH4A 4FWQA 4ENOA 2YHYA 2H5IB 1Z6RA 2XMAA 3G2XA 2VBYA 3I32A 2XZWA 4OYZA 3M8RA 2ILYA 3FBEA 1B0VA 5DDOC 3UR3C 4Q2LA 2ITGA 2YCHA 5AQXA 3EUNA 3HP6A 3D0HE 1ZBTA 2DH9A 3CGIA 1RDAA 3O9TA 3NS6A 3FE1A 1Q5YA 4JV5J 5C7PA 2EFPA 4FCYA 2VH7A 3EM1A 2MLYA 5KQ8A 4G9ZA 3SUOA 1C4AA 3LP0A 3WNEA 3W66A 3DLLL 2FJWA 3IRWP 2ATLA 2F96A 4DTRA 4CJ7A 3DFEA 1FERA 1RB0A 3KMQA 3D6FB 4LQ9A 1E6VB 1KD1O 1U1MA 2E7XA 5T41A 1S57A 3FR0A 4ES3A 4HTJA 4PR6A 1HD0A 1CQMA 3LWLA 3LPUA 1RKJA 4OHYA 2E4LA 1SIZA 1T02A 3BZQA 2ZITA 1JQGA 2CPZA 1RBOB 3O4NA 3SFUA 2P9CA 3NOGA 3NRBA 4ID5B 2C2EA 4AYBD 2KM8C 4DG1B 1HIYA 2PMZD 3PDNA 3DRPB 3MCMA 4PA1A 1RAGB 4IJAA 1S4FA 2K1RA 1PBUA 3A2FA 2YWGA 1VSDA 4FO0A 5IT0A 3BREA 3THYB 1U1PA 1GEHA 1O51A 4HH0A 2CGLA 4Y6IA 4IOCQ 4LF7J 4G3IA 2BRLA 4OYWA 3UW1A 5KT5A 4V1Ak 4FJJA 2WB1D 3KLFA 3ZX3A 1WELA 2QA4G 2KZZA 4IG0A 3CVKA 1JWWA 2GWJA 3ZFVA 1H2UX 3SQ0A 1RT1A 3KDNA 2VKRA 2U2FA 4MDBA 3G86A 4JKGA 4JKFA 4BC3A 1WBDA 2RUGA 1CC7A 4RPFA 1WJ9A 3GU0A 1WEYA 3BO2A 3S9HA 1XQIA