3DI6A

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
total genus 157
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3di6A05
2JEGA 3SI8A 3T5KA 1HYSA 1LWFA 4PWDB 4K4ZA 5C25A 5KFCA 3ZT4A 4EYIB 3QO9B 2ASJA 4FJKA 1RTIB 5KG2A 3H40A 1WN7A 4CIGA 3NF8A 1ASVA 1YVFA 4RU9A 5F8MA 1JKHA 3G6YA 4FM1A 2UVUA 3KMQA 3KK1A 2G8VA 2FVQA 3T5HA 2J6UA 3HK2A 2HVIA 1S0MA 4F3TA 2UUTA 1FXXA 3F73A 4BDPA 3QO9A 4MK7A 3BSNA 5L1JA 3O4QA 2G8UA 2E4LA 5L1KA 1RTIA 3OSNA 2W7PA 2VWJA 4IBNA 4JS4A 3KLEB 3K58A 2DFFA 2HW3A 3AVGA 4Q8FA 2EHGA 2X6SA 1BQNB 1S0OA 5J2NB 4OGEA 4G3IA 3CDWA 3AVAA 3SV3A 1WAJA 3KJVB 2XI3A 2OPSB 1MMLA 4AHSA 2WK4A 1HJRA 1DLOA 2GV9A 1C0TB 3LP0B 1N4LA 4CEFA 5DQGA 4KI6A 2ETJA 5SWMA 3KLEA 5T7BA 2D5RA 1NJZA 4CHOA 5JS2A 1JXBA 1BQNA 3GIIA 4L8RB 4CERA 5J2NA 5CYMB 3I0SB 2XY8A 2O5DA 4KHYA 2WHOA 3KHRA 3KJVA 4RW9B 2OPSA 4FLVA 1NK8A 1U04A 2OYQA 4YR2A 5HRRA 4TSXA 2JGUA 4N47A 4TY8B 1RTHB 3OL8A 3LP0A 1C0TA 2AX0A 4DTPA 3U3GA 5KFAA 1JXEA 4WXOA 4FM0A 5CYMA 3I0SA 4EYHB 3H4DA 1I3AA 4RW9A 1ITGA 4PUOA 4CJTA 4W5RA 3PVXA 4B8CA 4TY8A 5DLFA 4XPCA 3V6HA 1VRTB 3CDEA 3I5AA 1SKRA 4J2BA 3V6JA 4GW6A 1S1VB 2QKKA 3CQ8A 1C6VA 2IM3A 3G10A 3QIOA 4K8ZA 4ZVHA 5KFXA 1RDBA 4K4YA 3D0PA 3I8DA 3VQPA 4FJIA 1B9FA 5CZ1A 2E6LA 4O3PA 1VRTA 4CHPA 3IRXB 3HPOA 4QW8A 1S1VA 3TAMB 1U48A 3S9HA 4M3UA 3RMCA 3F9KA 3TANA 1NJYA 4CF9A 3TAQA 3ZSYA 2GC8A 3HL8A 3DRPB 4QWEA 2IM1A 4DL5A 4JLHA 4DS4A 4ZTJA 3IRXA 3KD1E 3CFOA 4CJFA 5HROB 4YQWA 2HWIA 2YNGA 3L3VA 2BR0A 4WFYA 3TAMA 5K14A 3CM6A 3SPZA 3V6DB 2LSNA 2X78A 4ZHRB 3EYZA 4F4YA 3MAQA 3DRPA 5J2MB 3CG7A 3P1GA 1BI4B 4HUFA 4I2QB 3HYFA 3OL9A 4FLTA 4CF0A 3QGIA 1L3VA 4TQSA 4MQ3A 5HROA 2F96A 3TAPA 4QCLA 1XR5A 1HYZA 4M3RA 3SPYA 3V6DA 2GIRA 3RR8A 4NLRA 3CM5A 4ZHRA 3KLVA 4QAGA 2HNYB 2AX1A 3V9SA 1U09A 5J2MA 2UVRA 4CGJA 3AO4A 5KT3A 3WNFA 3V4IB 4NLGA 3DRSB 4CK2A 4CJPA 4I2QA 2PZSA 4JS5A 4MK8A 4URQU 3Q8SB 4IQXA 5DGBA 2JEFA 3KOAA 4FS1A 3OYEA 1TVRB 4CJQA 1UWBB 3PHEA 2D3UA 3CJ5A 4F4ZA 4Z4FA 3L2UA 2HNYA 4HUGA 1VSKA 3SQ4A 1A5XA 1UA0A 1TP7A 2PYLA 2IOCA 3LDSA 3V4IA 3H5YA 4FVMA 4QPXA 1RBSA 1A5VA 3MECB 3OS2A 4F2RA 3ZSWA 3ZSZA 2D0CA 1HQUB 1S97A 5DLGA 1BISA 4F50A 1D0EA 3NAIA 3E01B 1TVRA 1NKBA 3N6NA 5EU7A 4B9LA 1UWBA 4KSEB 4IG0B 4M42A 5F9NA 4CHYA 4B9TA 4DSIA 1HNIB 1RDCA 4RW8B 5KT7A 4J2AA 4FZZA 1S5JA 4ZPCA 3H2LA 1RDRA 4KFBA 3V9ZA 3PR5B 4BDYA 2CJQA 4ECZA 3QEVA 2VWKA 1X1PA 1HQUA 4DSFA 3ICLA 4IOBA 3QNNA 2FBXA 1L5UA 3E01A 4CEAA 2X74A 4IG0A 5D3GB 1RT3B 5KT2A 1HNIA 4O3RA 4RW7A 3KTQA 4RW8A 2D0AA 3CYMA 2KZZA 2YNIB 2WOMB 4NCGB 3H08A 3DLEB 2BQRA 4RW4B 3K59A 2B43A 2JC1A 4EBDA 2R8GA 4ECUA 3VQBA 4DTRA 4KHUA 3SFUA 2BQ3A 4DFPA 2C2RA 4RW6B 4KB0A 5D3GA 1KLMB 1SL2A 1RBTA 1RT3A 5KG4A 3VA0A 2FVRA 3AVBA 3H59A 3RWUA 5HP1A 3CJ2A 2YNIA 2WOMA 4NCGA 1Z4UA 3DLEA 4MKAA 3VA3A 4RW4A 2DY4A 2XWYA 2G8FA 3B6OA 3GV5B 2QKBA 4NLUA 4KHMA 1RAJA 5J1EB 4H8KA 4ID1A 1KLMA 2IBKA 3BSCA 4XPEA 3UPFA 3ZSOA 1RYSA 4YR0A 3DM2B 2D7SA 3K2PA 3AVJA 1NK6A 3BGRB 2HWHA 2DPJA 3RMDA 2G8HA 1OS5A 4IKFA 1WNSA 4CFBA 2YKMB 3AA2A 2AJQA 3L8BA 1VSHA 1CSJA 4O44A 2OZSA 1C1BB 5HBMB 4CEBA 1I6JA 4M94A 4DMNA 2AGOA 4ED1A 4AH9A 3BSOA 1NNDA 3SFGA 4WFXA 3OS1A 1HNVB 3H5SA 4DS5A 4KHWA 3DM2A 4NYZA 3OYMA 3GIJA 1KHVA 4DSJA 4IFVB 3BGRA 1IKXB 3WNEA 2IC3B 1T3NA 2F8TA 1REVB 2YKMA 1EETB 1JLAA 3LPUA 1U4BA 3QEXA 5KI6A 2ILYA 1C1BA 4DTNA 5HBMA 4OKJA 1SH0A 5KFPA 1TK8A 3Q8RB 2R7YA 5KGXA 2RDJA 3TR8A 3PW7A 1HNVA 2ZE2B 4IR9A 4TQRA 2E9ZA 5EWEA 4J2EA 3LAMA 1BCMA 1RTDB 1VSIA 4GVMA 2IC3A 4Y1CA 1REVA 4KB1A 1ZETA 3RR7A 1IG9A 3NF7A 3QETA 4K4UA 4PY5A 3SUPA 5KFEA 2JEIA 1KFDA 3OY9A 2ZE2A 2XY5A 4CEEA 2W9BB 1RTDA 4DQIA 4KTQA 1NK5A 4YNQA 1ASUA 3DLHA 3K5NA 1J54A 2OPRB 1RT2B 5KFZA 1QQCA 4M45A 3FFIB 4LD0A 1RT7B 4TYAA 3DMJB 4DSEA 4IG3B 4IH5A 1KFSA 3KD5E 1IKWB 2QE5A 4OGCA 4O3NA 3I5BA 4LSNB 1IM4A 4ECVA 4DTXA 3NAHA 4Y34A 2EX3A 5KGWA 3VN5A 1JLEB 2OPRA 1RT2A 2X6NA 3FFIA 4O3SA 2R2TA 3PJXA 1RT7A 3DMJA 5KT5A 1BL3A 1IKWA 1CXQA 4BACA 3KKRA 3UDLA 3P5JA 2AU0A 3IGNA 2O4GA 5KRTA 4LSNA 5KG7A 4F3OA 2GBZA 1VSDA 4CGIA 3KLFB 1JLEA 3OYCA 4K8XA 1TAUA 4ED0A 4E7HA 4CJRA 5KFRA 4OPKA 2ILZA 4DLEA 3M8SA 2B5JB 1G15A 2UVWA 3UR0A 2BQUA 5KFNA 4KKOB 2FBVA 1S1TB 4NLXA 3KLFA 1JX4A 3PW5A 3TAGA 2VA3A 5KFSA 3PW0A 4O3QA 4NLPA 3VQ9A 2RKIB 3V81B 1W0HA 4JRPA 1FK9B 3NF9A 3ZSRA 2OPPB 5KG6A 2AGPA 1KVAA 3OJSA 2B5JA 1EX4A 2UVVA 4WZMA 2P1JA 2I1RA 2RPIA 4AILC 3MFHA 1T05B 4KKOA 1S1TA 3T5LA 1WSJA 3OYLA 1DLOB 1N48A 4J2DA 3NGYA 5C5JA 1LV5A 4NYFA 3KIOA 2RKIA 3V81A 4GC6A 2IGIA 1FK9A 1S1WB 4E3SA 3EPGA 2OPPA 5KFYA 3T1AA 2PY5A 3OYGA 2RN2A 2DFEA 2WONB 3L2VA 1WAFA 2C2DA 3LAKA 3DOKB 1T05A 3VQSA 4CCHA 3D45A 3HXMA 4DEZA 3IAYA 1ZTTA 1IKVB 3AA3A 4HCBA 4RNMA 3PUFA 4K50A 4K4TA 3ASMA 1NK7A 1S1WA 3HP9A 4DTSA 3KLGB 4I7FB 3PW4A 3QGGA 4DL4A 4JV1A 2WONA 3LP2A 4NRTA 2HHVA 3AO2A 5L1IA 3DOKA 4PUOB 4ECQA 3CDUA 1VSEA 1IKVA 4IR1A 3KK3B 4IDKB 1RBUA 3C95A 2D0BA 1L3UA 3KLGA 4I7FA 1NOYA 3IGVA 4C8MA 1RT4B 5L1LA 1RT1B 1JIHA 1ZBUA 2Z1JA 3NH2A 4CJSA 2R2SA 4B9NA 3AVCA 1NK0A 4CGFA 1MU2A 3ZT1A 2W7OA 3HKWA 5EWFA 1ZTWA 2IM0A 4E1NA 2C22A 3BR9A 4ED3A 5CY4A 1T7PA 3IN5A 3MR6A 3KK3A 4IDKA 4KRFA 3S3NA 2R2RA 1NK4A 2FC0A 2XGPA 1RT4A 1RT1A 4Z4CA 1CLQA 2V4RA 2IJNA 2YKNB 1S48A 3LZJA 4PQUB 4W5QA 4J9MA 1C1AA 4OJRA 1QS4A 4RNFA 4DTMA 2Z1GA 4ELTA 3C94A 4WYWA 4Q45A 1SUQB 4CJ4A 2ALZA 3QYYA 1QUVA 2VG7B 2YNGB 3QIDA 4J9QA 4CHQA 3HVWA 1B92A 3ZT2A 4BWJA 5K14B 2YKNA 3BQ0A 1D5AA 2WRMA 4PQUA 2Y1IA 1SKSA 4W5NA 1S6QB 5JXSA 4DG1A 2QK9A 3HT3A 2CKWA 2HNZB 1SUQA 3G6VA 3PO5A 2Z1IA 4ZP7A 3OLAA 1VRUB 2C2EA 2VG7A 4J9SA 3OYJA 3RB6A 1B9DA 1X9SA 4QWDA 1NHVA 5F8GA 4W5OA 3AA4A 1S6QA 4FZYA 4HVJA 5KFBA 1NHUA 2HNZA 5L9XA 2Z1HA 4O0JA 1VRUA 3GIMA 1RA6A 1SV5B 3GILA 4CJLA 3GIKA 3QZ8A 4J9NA 1BHLA 4IKAA 1TKTB 1VSLA 1SH3A 1S0NA 4LH5A 4O3OA 2R8HA 2FLPA 1VSFA 3MFIA 4GMJB 4KO0B 3NH1A 3VQ4A 1RNHA 1LWCB 3OYKA 3OYBA 1SV5A 3E51A 3M9NB 2YNHB 1BCOA 4MH8A 3IS9B 3JYTA 4CJ3A 3T19A 1TKTA 3QLHB 1KSPA 3MF5A 1NKEA 1KLNA 2J6SA 3OYFA 4KO0A 2NUBA 4EEYA 2XI2A 1LWCA 3H98A 3RB4A 4KFBB 4BE0A 1LAVA 4LH4A 1GX5A 4B9MA 1ZBLA 4ECTA 2YNHA 1NK9A 4DF8A 4FLUA 1QTMA 3IS9A 3HM9A 2V9WA 3QLHA 3PR4A 3SI6A 3OYAA 2HMIB 3LP3A 1VSMA 4NLQA 4KTZA 4RW7B 4OVLA 1W9HA 4TY9A 3O3FA 2EC0A 3LZIA 2I5JB 2FBYA 2J6TA 1XWLA 2YHBA 4KHQA 3HJFA 4QOZB 4ZPAA 3O3HA 3SCXA 4ED2A 1YTAA 2HMIA 4ZMMA 1WLJA 1GOCA 2WB4A 4HTUA 3MR5A 2HVHA 4FJXA 3G0ZA 4MKBA 1UOCA 5KT4A 5HP1B 3ZSQA 1K1SA 2FVPA 1YTUA 2I5JA 3THVA 5HRNA 3TI0A 3OS0A 4CJKA 4IRCA 2ASLA 4AHCA 4F8RA 4ZP8A 3ISNC 3NHGA 4F4XA 3RB0A 2XCPA 4E7KA 4R8UB 4CE9A 4RUAA 1HPZB 5FDLB 3SYZA 4DQPA 3LP1B 5DGAA 4FK2A 3RAQA 4U6PA 1QAJA 1QSYA 3DLKB 4TXSA 4FLZA 3KHGA 4R5PB 4N5SA 3DLRA 5HLFB 4Q8EA 4B8AB 1DTTB 2P5OA 4B08A 1JLGB 3SQ2A 3CVKA 4FBUA 4O44B 3GV7B 3ZSXA 3EY1A 1WSHA 4R8UA 1HPZA 5FDLA 5EUHA 2E9RX 4ED8A 3VQ8A 4YFUA 3HP6A 1S1XB 3LP1A 5CYQA 5KFQA 1K1QA 2XY6A 5KFFA 1RBRA 5C24B 4DQQA 2A1SA 2E6MA 3DLKA 3FQKA 4R5PA 5HLFA 3AVNA 3OYDA 1DTTA 1IH7A 4EP4A 4DFKA 1JLAB 3DYAB 1JLGA 3NL0A 1RILA 2FJXA 4DFJA 1D9FA 5KG3A 3QNOA 1KVBA 4TLRA 4CESA 4ECRA 4FZXC 1S1XA 1UA1A 5JS1A 1F21A 3T3FA 3MEGB 1TKXB 4FM2A 3QZ7A 5DK5A 1LW0A 5C24A 4M3ZA 1WSFA 3SUNA 2VA2A 3DOLB 5KFKA 5FROA 3EZ5A 2BE2B 4YR3A 5J2QB 2BDPA 3UIQA 4NCBA 4C8NA 4C8LA 3V9XA 3OHAA 4KTWA 3DYAA 3LWLA 4EBCA 3NDKA 4G1QA 1WSEA 3QESA 1TL1B 4DTJA 4I2PB 4URSA 3TVKA 4FCYA 3NBPB 4C8KA 3MEGA 4NLVA 1TKXA 3DI6B 1DTQB 3IG1B 4ED6A 2OH2A 4KI4A 3DOLA 3OL6A 5KFTA 2F8EX 3C6TB 2BE2A 5J2QA 4J9OA 1QAIA 2KFNA 2XO7A 3SNNA 1EP4B 4M3TA 3LWMA 1TL1A 4CJVA 3L2QA 4I2PA 4N76A 4FLWA 5T14A 3L3UA 2KFZA 1S9EB 3RBDA 2R8JA 4DLGA 4ZPDA 1SH2A 3NBPA 3DI6A 4URGA 1DTQA 3IG1A 3BREA 4FJMA 3NAEA 4FK0A 2V4QA 5I3UB 3N6LA 3C6TA 4EZ9A 2ZQBA 4U7CA 4EP5A 2WTFA 1RT6B 4DQSA 5C42A 1D1UA 4DFMA 1EP4A 3H5XA 4IRKA 4JV2A 1SL1A 2GIQA 1S9EA 1XR7A 4FJNA 1L3SA 4LSLB 4B9VA 2HB5A 5I3UA 4ZVGA 1RCHA 4M95A 3HHKA 4O55A 4CF2A 1D8YA 3TABA 5KFMA 3V6KA 3KLHB 1RT6A 1T03B 4CFAA 1LWEB 4H4MB 4Z4IA 1HRHA 4CIFA 1NJWA 2PYJA 3JSMB 5KT6A 4Q43A 4N41A 2O4IA 3RMAA 5KFOA 4QWAA 4BE1A 4LSLA 4DSLA 4O4GB 1KRPA 1N5YB 2GUIA 1XC9A 4ED7A 2OPQB 3KLHA 4DTOA 1T03A 2JEJA 3VQQA 4OLAA 1JL1A 1LWEA 4H4MA 3SQ1A 2R2UA 2VG6B 4CIEA 3DDKA 1ZBFA 2OA8A 1C0MA 4DL7A 3JSMA 4E19A 3NMAA 3SJJA 4BE2A 4R0EA 1GOAA 3ALYA 3Q8PB 2FVCA 3D5MA 4O4GA 1QSSA 4B9SA 1N5YA 3RRHA 1HYVA 4BDZA 2OPQA 2KZMA 4CEZA 5JUMA 4KB7A 3PY8A 3QIPB 3ULDA 3KKSA 1TQLA 4M3XA 4ECWA 3P83D 1U47A 3ZSVA 2VG6A 1FKOB 1WSGA 3KK2B 2WCXA 1J9AA 3PX0A 4LQ9A 4ZVFA 5EDWA 3VQEA 4RG8A 4Y3CA 3CJ3A 4NLYA 3KHLA 4FJ5A 4TYBA 3ITHB 4CJ5A 2DPIA 4ELVA 3C6UB 4FYDA 2YNFB 4RNOA 1A5WA 2P5GA 5KTQA 3QIPA 4ZVEA 2W42A 4I9QA 3PW2A 1FKOA 3NGIA 3KK2A 3I5CA 1KTQA 3AO1A 4PWDA 2ZKUA 1BIZA 3K5LA 4HUEA 1WNEA 4NLSA 2IS3A 1JLCB 5DQIA 2HHQA 4NLDA 2FLNA 1TL3B 5HRSA 3LP2B 3AVFA 4X2BA 3NFAA 3ITHA 3C6UA 2FJWA 3VQCA 2YNFA 3HVRA 1KVCA 1HARA 5HRPA 3GQCA 3PZPA 1GOBA 4RUCA 3OYIA 1XI1A 3H5UA 5DQHA 1JLCA 3KNAA 1TL3A 1MU2B 3VQDA 5J2PB 4DU1A 3HPHA 4FJ8A 3U3YA 2XCAA 3NGDA 3RB3A 4KHSA 3T5JA 4JUZA 3H4BA 3CO9A 4KE5A 4FJ9A 4OPJA 3OYHA 3MEDB 5SZTA 2KTQA 1Y97A 5J2PA 3ZT3A 2HHUA 5KFJA 3KHHA 3MXJA 4JV0A 3LALA 1T8EA 2XGQA 1N56A 1IO2A 4NZ0A 3HVAA 1BQMB 4DL2A 4FJ7A 2IM2A 3S3MA 1WSIA 1QE1B 4DSKA 4RNHA 2G8KA 3NH0A 3D28A 1RTJB 4ECSA 3MEDA 4NYNA 4KBIA 3LPTA 1IKYB 1KHWA 1RTHA 4DG1B 4FJGA 1RT5B 2R8IA 3K5OA 3M8PB 1BQMA 4E7JA 4ECYA 1QE1A 2W8KA 4CJWA 4KV8B 1XR6A 1KCFA 1FKPB 1RTJA 3O3GA 3AVLA 4F4KA 3L2RA 3QINA 1BGXT 4RNNA 1IKYA 4ZP9A 4CK3A 2F8SA 1TV6B 3GYNA 4TN2A 3M9MB 1RT5A 2A1RA 2IDOA 3LANA 2W8LA 3VQAA 2KQ2A 3M8PA 3NF6A 4EZ6A 5KRSA 5FRNA 1D9DA 3BQ1A 1UAXA 3V9WA 3TWHA 2BGGA 3I0RB 2YV0X 4KV8A 2P51A 1FKPA 5KFUA 2FVSA 4OLBA 4FW2A 1LAWA 3M8RA 3V1QA 1VK0A 4ZPBA 1RA7A 4FW1A 4I9LA 1TV6A 1JLFB 3B6PA 3M9OB 5KFIA 4O4RA 2IMWP 3CIZA 3QEPA 5KG0A 4LQ3A 5EWGA 1TKDA 1X9MA 1RDAA 3PX4A 3I0RA 4AHTA 4IFYB 3JYTB 1ASWA 2ZD1B 5F8HA 3MXIA 2ATQA 1QSLA 4WYLA 4CECA 5DG9A 4K4XA 1JLFA 3KLIB 4M41A 2IAJB 2DTUA 1JLQB 2YHAA 2BANB 5KFHA 4IFYA 3PO4A 4FXDA 2OZMA 3CFRA 2E9TA 2ZD1A 3WNHA 1CXUA 3AV9A 1S1UB 2D41A 2W9AA 3NCIA 1BI4A 1BIUA 4Q44A 3OJUA 3KLIA 4E89A 1YT3A 4XIUA 3QEIA 2IAJA 4Y2AA 1JLQA 1O1WA 2HHSA 2FLLA 4PA1A 2BANA 3MEEB 1QHTA 2Q3SA 1K6YA 3OHBA 1LW2B 1XHXA 4KREA 1S1UA 3SUOA 3DRSA 2HHWA 3MXMA 3OL7A 5E41A 3OSPA 3AVIA 4XO0A 3RMBA 2HNDB 4K4WA 4CEOA 3FRZA 4ECXA 4CFDA 4FJJA 2XRIA 5KFWA 5KG1A 1XHZA 3MEEA 4KPYA 3NGZA 4B3OB 4ZP6A 4CF1A 2JLEA 1LW2A 5CZ2A 3TAEA 3VQ6A 1C0UB 3G86A 4HYKA 4DL3A 1I39A 2Y1JA 4J9PA 3N6MA 4J9LA 3MECA 1W25A 1RDDA 3K57A 3CJ0A 2HNDA 4Y2CA 5F8LA 4OL8A 2JC0A 4WE1B 4OKKA 2G8WA 4B3OA 3MR2A 4IH6A 5KFDA 1NOZA 3GV8B 1C0UA 3QEWA 3ZT0A 4CGGA 3BJYA 4NLOA 3SUQA 3RRGA 4M3WA 5CYQB 2DFHA 1U45A 4FJHA 2IA6A 4HHTA 1CZ9A 3BSAA 1R0AB 1L3TA 3CFPA 1SKWA 2FBTA 4WE1A 4CFCA 4FLXA 3UQSA 4J9RA 4IRDA 3RTVA 3M8QB 2BRKA 4NLTA 2W9CB 3DLBA 3SV4A 4QW9A 4EBEA 3A2FA 1S9FA 4DU4A 5F9LA 1GX6A 3AO5A 3SQ0A 3ZCMA 1X9WA 4FLYA 2AWZA 1LW0B 4CEDA 1N6QB 4J9KA 1R0AA 5DG7A 1S10A 3OLBA 4Z4GA 2C28A 3EPIA 4FJLA 3SZ2A 1RBVA 4Z4HA 3AVKA 3M8QA 4RW6A 4G1QB 2W9CA 3Q8QB 4YMEA 4DF4A 3ISND 4W5TA 2BRLA 2AQ4A 4CHNA 4Q5VA 3FDSA 3V1OA 4EO8A 5KFVA 2HHTA 1VSJA 4CF8A 3QERA 4C8OA 1N6QA 1ZYQA 5DMRA 1ZBIA 1EKEA 4WXWA 3NE6A 3BQ2A 4F2SA 1S9GB 3DRRB 2XY7A 3HVTB 3DLGB 2QV6A 3BDPA 5J1EA 1TKZB 4E1MA 3MTKA 4DTUA 4FS2A 5F8NA 4AHVA 1S6PB 3K5MA 4JRQA 3CWJA 5DG8A 4KAZA 5F8IA 4NCAA 2RF2B 4MFBB 1TGOA 3RBEA 1NKCA 4BWMA 3S3OA 1S9GA 3DRRA 4E0DA 3QGHA 3TAFA 4F4WA 2HAIA 4Y1DA 4ID5B 3HVTA 2VG5B 3DLGA 5C42B 4O5BA 3WNGA 2ASDA 1YVUA 1Z26A 1TKZA 4MIBA 4CJEA 3RAXA 4GC7A 3O4NA 1RYRA 1C1CB 5FRMA 3TARA 4E7LA 3FQLA 1S6PA 4ZTFA 1TAQA 4AHUA 1NJXA 4EO6A 4CEQA 4IFVA 1ZBHA 1IKXA 1S4FA 2XHBA 2XC9A 2RF2A 4MFBA 4WZQA 1Q8IA 1EETA 1SL0A 5KFGA 2IJFA 4DU3A 2UUWA 4ID5A 1JL2A 2VG5A 4OKEA 3L2WA 1EXQA 3V9UA 4CGDA 4H4OB 1T94A 4MK9A 4KAIA 1J53A 4FK4A 4CJUA 1TK5A 1JXLA 3VQ7A 1C1CA 3MR3A 3U6FA 3AO3A 4RZRA 4DWIA 1Z25A 4DQRA 4ELUA 4KHRA 3PJWA 3NKYA 4AHRA 4WFZA 4E7IA 1HQEB 3FSIA 3CJ4A 3HPGA 2QXFA 2B6AB 3EZUA 4DL6A 4HCCA 4H4OA 3PX6A 4CK1A 4UQGA 3HSTB 1Q9YA 2RDIA 4ICLB 5I42B 4B9UA 4K4VA 1U49A 2KW4A 2W9BA 3OVNA 3AVMA 4NRUA 1JLBB 3V1RA 3G6XA 1HQEA 4Z0UA 4CGHA 2D3ZA 2V0NA 5KFLA 2B6AA 4YP3A 3OYNA 1C2PA 1TK0A 3HO1A 1J5OB 4Q0BB 5F8JA 3VQ5A 1HMVB 2B4JA 4IG3A 2AGQA 2HHXA 3PV8A 1Q9XA 4ICLA 4M3YA 5I42A 4K4SA 1HYSB 2R8KA 4NLWA 4CHZA 1LWFB 5KG5A 2G8IA 3TQ1A 5C25B 4O0IA 2FJVA 4Z4EA 1JLBA 3AA5X 4QWBA 1S49A 4N56A 4MIAA 4LY7A 3KMSA 4FBTA 4QWCA 2ITGA 4KHNA 4IH7A 3AVHA 1JKHB 1J5OA 4Q0BA 2ATLA 4HKQA 1CZBA 1HMVA 3KK1B 4H54A
chains in the Genus database with same CATH superfamily
5CD4A 3ZLJA 4PXBA 5LMNK 1LWFA 4K4ZA 3Q7BA 2DH8A 3LW5C 1KDNA 1YJWS 2MJUA 1ZZFA 3NF8A 1ROFA 4G1PA 3P4IA 4YOYA 4KH0B 5F8MA 4FN5A 1JKHA 3OR1B 4EAHD 4M5IA 4QIFA 3X3UA 2HURA 3KMQA 2NRXA 2G8VA 2F4VF 1CG2A 3JTNA 5D0EA 3HK2A 2HVIA 2UUTA 4QS8A 2VJVA 2CPJA 4MK7A 5L1JA 3BSNA 2U1AA 3OSNA 4NI2B 4NXNF 2FJDB 3CE8A 2CNOB 3OR1A 4WYBA 1OY9A 1ZH5A 2EHGA 1NDCA 5D15A 5AQLA 4OGEA 1JQGA 4U95A 1O5JA 2MEWA 2LA6A 2RUGA 4JI7F 4JNEA 1MMLA 4Z94A 3UN5A 1I94J 3ENHA 3TJAA 3D9BA 1C0TB 4NI2A 4OJHA 3BO3A 2DPNA 4FPBA 4FWNA 4KI6A 5SWMA 2HEKA 2V8PA 2G0IA 2D5RA 1NJZA 5D78A 4CHOA 5JS2A 4L8RB 2KJVA 3I0SB 2YWHA 2XY8A 2DXDA 3NMUA 2E7VA 3AGRA 1YJTA 2WHOA 1J5EK 4NMLA 2AJFE 2YH1A 4RW9B 4FLVA 1NK8A 2OYQA 3CMES 4YR2A 5HRRA 3ULEB 5L39A 4QYZJ 1S6UA 1YBTA 1C0TA 2FC9A 2AX0A 3CMAS 5C12A 3CF5Q 2VC0A 3U3GA 5KFAA 4X65K 4WXOA 2ADBA 3I0SA 3H4DA 2VKZG 4IYQA 4RW9A 3BP8A 2Y0SD 4H5VA 3R1LA 4FYVB 4L3NA 3ID6A 5IV4A 4USHA 4J2BA 3OT9A 1UAWA 4WFBQ 3V6JA 2UUBF 4GW6A 4J9VA 2CYYA 4ZDNA 2D9PA 3JQMA 2HFOA 2MHNA 1C6VA 2IM3A 2LYVA 2ZJRQ 3M5RA 3G10A 4BR5A 1UWAA 1ZPVA 5KFXA 4CDIA 2DGSA 4G1IA 2VFTA 3I8DA 2VFSA 5B0DA 3QB0A 3UDCA 1DAXA 4FJIA 3JQJA 1B9FA 1X4AA 3SXLA 1EX8A 4DV1F 3OBWA 3IAM9 1V6HA 4QS7A 2OMLA 4FF1A 1CQNA 2ACYA 3ZSYA 3DRPB 3FKBA 3LA0A 4X4NA 2DNKA 4DR3J 4ZTJA 3CFOA 4GKJK 2EG2A 1WHYA 1VHFA 2HWIA 2GHWA 3MPVA 3L3VA 2VQFK 5K14A 2DO0A 4LFBK 3OXFA 3V6DB 3C6HA 3ZZTA 3S8SA 3DRPA 5J2MB 3CG7A 3P1GA 3IBFB 1DT9A 1FI4A 4F04B 1SB6A 3OL9A 3ZTQA 1Y5LB 5A2QY 4M1KA 4DR1K 4DKWA 1L3VA 4XEIA 4B3MF 2MZJA 3DAWA 2QMWA 4H4KC 2KJWA 3V6DA 1NSPA 3CCUN 1IBKF 5CCLA 5EX3A 2JWKA 2Z58B 1YRUA 3W66A 2HNYB 2AX1A 2V94A 3GU0A 3V9SA 2UVRA 5J2MA 3OVAA 4DZ6A 5KT3A 3AO4A 2LQ8A 2QSWA 3V4IB 5CXTA 4CJPA 4FYYB 4MK8A 4DUYF 2BJ1A 4CLUA 3M1FA 4V19J 5FIIA 2Y1LB 4KGMA 3VGSA 4FS1A 2HQ3A 4CZEA 3MWTA 4AL7A 4CJQA 4LF4J 3VEYA 2R4FA 2D3UA 3HOTA 1HD1A 3L2UA 2GVDB 5GADU 3C3LA 2HNYA 3H46O 2D69A 2DRDA 1UA0A 2Z2LA 2PYLA 2IOCA 3V4IA 2JDJA 4QPXA 1TL5A 2W1BA 4F02A 2FJAB 4F67A 3GR0A 4LRCA 5DLGA 2XHWA 3VV2B 3TA1A 2P6SA 3H45C 3N6NA 4DCHA 4CHYA 3CJSA 2GVDA 1UFWA 1XMOJ 1S3XA 4RW8B 4L6V3 2PI4A 2DT9A 1C4AA 4YB7A 2CWKA 2I38A 2CJQA 4DCPB 3HULA 3VPZA 1LFWA 4F7VA 3AD7C 4I69A 4U7BA 2DHSA 4C48A 1P1TA 1OYEA 3M6GA 5KAKA 1T6CA 2KI2A 4YN3B 3RSEB 3B8AX 4RW8A 2BE7D 1B4SA 4NCGB 2GUPA 4CM0A 4DR6K 1MWQA 1N32F 4BRPA 2QLXA 2RRAA 2R8GA 1KVKA 2BQ3A 2UXDJ 4DFPA 4KB0A 2O1PA 5LMNJ 3CCLS 1BY9A 3VAKA 1RBTA 3VA0A 3RSEA 1M1KO 3RWUA 3N0VA 2X7IA 4NCGA 3VA3A 1H74A 2DY4A 3BPDA 4QOTA 1H98A 4YDUC 4KHMA 1RAJA 3HJVA 3DXBA 4H5WA 3LO3A 2Q1NA 4U96A 2X1FA 2QTWA 4QBUA 3R6GB 4YR0A 2Y8YA 1R0CB 3BGFA 4KH4A 3BF3A 2G8HA 3L8BA 2PI5A 4JI8K 4M5HA 2MQOA 4O44A 1C1BB 5BPMA 2YPYA 3J7YI 4ED1A 4AH9A 2H5JB 1RWUA 2G1DA 1HNVB 2AIRB 4KHWA 1KHVA 4DSJA 3O1BA 3WNEA 1WEZA 2IC3B 1MWZA 3L3CA 2O8DB 2F8TA 1H7XA 1JLAA 1U4BA 4AXJA 2MMYA 1YITS 2ILYA 1C1BA 4HEA9 2GFFA 4OKJA 4ZLPA 2F9DA 2M5YA 4JI5K 2RDJA 2K3KA 3TR8A 4LRBA 3OUYB 2Y3YA 1J5EJ 1HNVA 3GCXP 4IR9A 4J2EA 5D8HB 1BCMA 1QQMA 2IC3A 1R27B 1DEJA 2O8DA 1ZETA 1IG9A 1SJFA 3NF7A 4DV3K 4K4UA 3UDVA 4X65J 2HVZA 2BMBA 2KRRA 5KFEA 4LR9A 3OUYA 4BS2A 1XNQF 5D4NA 4DQIA 3AD8C 2QWQA 1OQ3A 1FRJA 5D4OA 3UD5A 4CZJA 5IOLA 1QQCA 3FFIB 4WTOB 3HFVA 5FPEA 4TYAA 2D1CA 4ZOSA 1S72N 3KD5E 5F41A 3WXMB 1X5PA 4ZLJA 1RWXB 1SJ4P 1HI0P 3EE9A 4LSNB 3RRKA 5H9FK 5KGWA 3VN5A 4BRFA 3FFIA 2LQ9A 1G99A 3VGMA 1VQ7N 2VHGA 4BROA 4P6QA 4NA3A 1BL3A 3Q8UA 4A8XA 2HG4A 4KC5A 3NNCA 4YY3F 3P5JA 4LSNA 1P8ZA 4DPUA 3QSYB 1SJ3P 2BV3A 3KLFB 1JJ2M 4GKJJ 1TTHB 3VHQA 1YBAA 4X62F 1QVGM 2VQFJ 1E6VB 4USVA 3UDEA 1G15A 2UUAF 2UVWA 1F0XA 3N01A 3VF0B 1OSCA 1VIOA 5IQQA 3MMVA 4IUFA 4KKOB 3DGPB 3KLFA 2R7WA 4EFAC 2VA3A 2M8DB 2YXLA 5KFSA 3PW0A 1HLUA 2K7KA 1E6VA 2DHGA 3ZSRA 1WC5A 3CULA 3W9HA 1U2CA 1UETA 1EX4A 4AILC 8ATCB 1RAOA 2A2DA 3MFHA 3VOVA 4U67L 4FZVA 1P9YA 4KKOA 2EEYA 3DGPA 2AF6A 3T5LA 4BQZA 1DLOB 1N48A 3AFGA 2ZHOA 3JS9A 4Y65A 4NYFA 1HHSA 2RNEA 1YJ9N 1FEEA 1FFSB 5AQIA 2UU9K 1NXIA 2GQCA 3DOMB 2PY5A 2Z2MA 1S22A 1SC3B 3BV8A 5CH7B 3L2VA 4CW7B 4OYXA 2C2DA 3DOKB 3D45A 2W7AA 3B78A 4C23A 4QR0A 5HMZA 1HKAA 1B0PA 1FJEB 5MLCQ 4ZCKA 1VQNS 1PJ7A 4RCHA 3KLGB 1GH8A 3I31A 3DOMA 3QGGA 3FE1A 5M1FA 2JZ5A 3AO2A 1MMDA 5L1IA 3DOKA 1XMBA 1WD6A 1BMQB 2EKYA 5B0EA 4BGBA 1YIJN 3CDUA 4NZ7A 4NL5A 4P2XA 4IDKB 3C95A 3LF0A 2Z56B 4U7UD 2ABYA 1L3UA 9RUBA 3KLGA 4ERDA 4DV7K 1G4CA 3IGVA 1MU2A 4HHUA 4MIWA 3P4UB 4WP8A 2W7OA 3F0NA 4W92B 2C22A 2AA4A 1FERA 1FTRA 1VQON 4YOTA 4UZCA 4DR6J 4ED3A 5CY4A 1T7PA 4V1Ak 1Q81T 1ZM3A 4IDKA 2ZJPL 2M9KA 3BO4A 1X0PA 2CPHA 4A8WA 3H2VE 3LZJA 4PQUB 4W5QA 1WEYA 3CCTA 1SQKA 3O1WA 1Q8BA 1APSA 3O08A 2O8FB 3CCVS 2AEFA 1UKUA 1NPKA 4WYWA 4YDDB 3C94A 1HUXA 3R8YA 4ZS6A 2ALZA 2YNGB 4CHQA 1B92A 1EQYA 4TKTA 5B09A 3BQ0A 1QUPA 4PQUA 2O8FA 5JXSA 4DG1A 2QK9A 1WOSA 3MUMP 4A8QA 2CGKA 3G6VA 3N4PA 2RMLA 4ZP7A 4JI8J 3EJMA 2FGCA 3LDQA 3NGSA 2AEJA 3D1HA 3I33A 4UOHA 1IWAA 2DR6A 3T1YK 3FCWA 3FZHA 5E3RA 4W5OA 4RJVA 1WC4A 4A8YA 2UUCK 3RGIA 2JLFA 5KFBA 5L9XA 1AUSL 2GMJA 2AHOB 1CC8A 1UVJA 3WQUA 3GIMA 1SV5B 1O51A 4JI5J 3QJLA 1OSDA 3I55S 4FPRA 1WWHA 2JOQA 2R8HA 1HR0F 3NH1A 2OJ3A 3MMBB 4H0OA 1B7FA 4PL7A 5GAEU 4JKBA 4DV3J 3OXLA 1SV5A 3QMLA 5AFUH 1BCOA 2RE1A 1U6ZA 2XSJB 4JKHA 3AD9C 5KQ8A 4CJ3A 4GMKA 2WFBA 2D1KA 3QLHB 1WF1A 2J6SA 3O44A 5GADP 2NUBA 4EEYA 1KD1T 2XI2A 2MQPA 1KTVA 3DLLL 5AJ3K 3MMBA 4KFBB 2YBVA 4BE0A 2HHHF 2VJUA 2HRUA 2FSJA 1IM6A 1ZBLA 1QTMA 2XSJA 3VGTA 3HM9A 3QLHA 3SI6A 5LJWA 2HMIB 1VSMA 2O8CB 2XM3A 4KTZA 4RW7B 4LVOP 1HWLA 2I5JB 4ZVQB 5H9FJ 1XWLA 2Q0RA 3SCIE 2YHBA 1YWXA 4KHQA 1Y4ZB 1U6FA 2DGUA 3SCXA 4IJAA 2ZKTA 2BOPA 4YHHF 2DXEA 1HX1A 1TELA 3KWMA 2LVWA 2HMIA 2GIFA 1GOCA 1YSJA 1YG0A 3L95X 2O8CA 2HVHA 4WPAA 2AYEA 5HP1B 3ZSQA 1Q78A 5BR8F 2XBPA 2FVPA 2I5JA 3D4JA 2MLZA 5F0XA 1X3MA 3OS0A 4KHPK 1A6LA 2AP6A 2XMMA 4CQ1A 1RWMB 2VDIA 4ZP8A 5CR4A 1NGEA 2B56A 4R8UB 1HPZB 3E3XA 3TW0A 3LP1B 5DGAA 4FK2A 2E5LK 1Q79A 4U6PA 2V2ZA 3E8OA 4P10A 4TXSA 5E26A 3CJ1A 1NDPA 1JLGB 2ZC3A 3SQ2A 3CVKA 4QPTA 4FBUA 1VBYA 4R8UA 3BKUA 2VQEF 1HPZA 3WQPA 3IBWA 2E9RX 3R97A 3QDKA 4JD2B 5LL6d 4ZLLA 3HP6A 1UL3A 3LP1A 1K1QA 1YJRA 4OJGA 5M1QA 2H5EA 4CD3A 3CEDA 1CULB 1FX2A 3O8WA 1FW6A 2UXCF 1IN0A 1JLGA 4AFFA 5IZHA 2R7TA 5BREA 3ZZOA 2UU9J 3O9QA 5BRFA 2F4FA 3I8BA 4JD2A 3QBCA 2AT1B 5LMUJ 3MCOA 5KFKA 1CULA 4F0KA 3BR8A 2CAJA 4E98A 3RUBL 4NCBA 4C8NA 3G6ES 1VQ6S 3UE5A 4LF5F 2FY8A 4I67A 3ZZYA 4BR4A 1VHXA 3F56A 3A8YA 3EZWA 4XH4A 1FVQA 4UF4A 4LBPA 2DNRA 3IM9A 4C8KA 2CZ4A 3IG1B 2EG1A 4UUWA 2OH2A 4KI4A 3OL6A 2NPIA 2XMWA 1HNXF 2FC8A 4OYAA 2O3DA 1GLCG 3SNNA 3VMFB 4CJVA 4PYDA 2F40A 4N76A 4JK9A 4DV7J 1M90O 3L3UA 2R8JA 4RKUC 5T7LB 3IG1A 4FJMA 1WI6A 4FK0A 2V4QA 5I3UB 2GO8A 2ZQBA 4ZVPB 2C3OA 4U7CA 4NXNK 1D1UA 4UOCA 4YB6A 3VAFA 3THYA 4BCAA 4DPXA 3W61A 3W2VB 1YHQS 4JV2A 2C2KB 1SL1A 1XR7A 3HFZB 1RLCL 5T7LA 2P6TA 4LSLB 4LR8A 1AZSB 2HB5A 5I3UA 4ZVGA 2Z4PA 2LU1A 1HD0A 1VQ5S 4M95A 3LDOA 3HCXA 5H9EK 1D8YA 3TABA 5KFMA 3KLHB 4ES1A 5BR9A 1HW9A 1LWEB 4C8YA 3W2VA 3JSMB 3PFOA 2HBYB 2OO4A 3RMAA 3BO2A 4LSLA 1PIEA 1IJEB 4DSLA 1AZSA 1RB0A 1N5YB 1Q53A 4USUA 4ED7A 2OPQB 1RAFB 3KLHA 4UT4A 5RUBA 4DTOA 4GVEA 3CJCA 3P3DA 1LWEA 4X4OA 2I6WA 1VRQC 3CCJS 4BRQA 1FWPA 3JSMA 4E19A 1I51B 4R0EA 1GOAA 3Q8PB 2FVCA 3D5MA 3T1YJ 4Y00A 3K5PA 1QSSA 1N5YA 4CWBA 2OPQA 2FUG9 1TQLA 1Q86T 3ZSVA 5FLXO 3TVZA 3M3ZA 3UR3C 2VC1A 2V63A 4X66F 2DYAA 3PX0A 1J9AA 3CCMS 4RG8A 4Y3CA 6FD1A 3KKFA 3CCQN 1RHUB 3QSIA 1V4TA 4I6YA 1I3OB 2CQHA 1ATNA 4CJ5A 3UI3A 4ELVA 4OZ1A 1PC4A 4NLBA 4RNOA 2XLIA 5AZJB 2P5GA 1SXLA 4ZVEA 2W42A 4Z2XA 2O8EA 1XERA 1KTQA 3H42A 4PWDA 2P9CA 3UN3A 2ZKUA 2M52A 1BIZA 3K5LA 4HUEA 4LRAA 2IS3A 2Q1LA 3GMGA 2HF4A 2W4CA 3AQPA 2GS8A 3NFAA 5AJ3J 2FJWA 3WHIA 3CJAA 4CZGA 4G9ZA 4LIRA 5G0RB 1U26A 3GQCA 4CO0A 2QYGA 4BLGA 1GOBA 4RUCA 2FYXA 5B7WA 2HFUA 5BN8A 2NXUA 3OYIA 3G8QA 4OHXA 5J2PB 3MPDA 2U2FA 2NYIA 4Q7AA 5G0RA 3KFWX 2DKOB 1HNWK 5AFUA 5IWAK 3BDEA 3ZTRA 3GE1A 1R89A 2KXFA 3OA9A 4MLEA 3CO9A 2OD4A 4KE5A 3A8EA 5HQLA 2NCKL 4ISEA 3CCEN 4X64F 1PCAA 5J1PA 3MEDB 2H3GX 2KTQA 1Y97A 5J2PA 2HHUA 4FPIA 1NUEA 2CADA 3LALA 2M4MA 4DUYK 2XHCA 3ISZA 2CRLA 4OX6A 4H5NA 3MAAB 2M8HA 1T11A 1QE1B 2HGMA 2KRBA 5E3CA 4WKYA 3QQCD 3BZQA 2VGMA 3D28A 1JCGA 3MN5A 4OZ2A 2N4DA 1RTJB 1WTFA 1IR0A 5L46A 3MEDA 4NYNA 2F3JA 4KBIA 4BY9C 2YKPA 2CPZA 4FJGA 4WFNQ 2R8IA 1PILA 2YY3A 1L3KA 2RU3A 3R5JB 3MAAA 3C2PA 1CZAN 3R6MA 1QE1A 2W8KA 3P39A 4KV8B 3JTPA 1XR6A 4EK2A 1RTJA 4EI2A 1IBMF 3IM8A 3QINA 2YKOA 4FYWB 1BGXT 4A8SA 1KN6A 3JAMY 4CO2A 3VQAA 3NF6A 3QFWA 2L9WA 3BQ1A 4AL6A 2W40A 1FT8A 3QAEA 3CCSS 3GE9A 3I0RB 4KV8A 5HVGA 2FVSA 4EGLA 1S12A 1U02A 2GHVC 4FVCA 3THPA 2B9EA 1RUSA 3M8RA 3QRPA 2ZM6K 2WVEA 1IXKA 2DY1A 3B6PA 1N32K 5KFIA 4WKRA 3W0LA 3CIZA 1R59O 4K2JA 1RISA 3MM7B 4V19X 3I0RA 1JMTA 1FXLA 4FNHA 1U0SA 4OYBA 1ZXOA 5DG9A 3HHLB 3J7YU 4K4XA 1T9WA 1K73O 1S57A 4CZCA 3AA9A 3QT5A 2DTUA 3MM7A 5GAEP 3D0GE 2HIYA 4KYZA 3US5A 3TTDA 3A4TA 1S1UB 2W9AA 1DRZA 2E1RA 1BI4A 3HM8A 5HMWA 4KRWA 2V34A 3HHLA 3OJUA 3S01A 3D67A 4FP9A 2B8PA 1YT3A 4NXNJ 2FJBB 3CD6N 1SS6A 4Y2AA 1GLEG 4C0BA 2A5XA 2V67A 2FLLA 4PA1A 3SBMA 3MEEB 5E3QA 2VFUA 4OPAA 1S1UA 2LMIA 3SK3A 2CQ2A 2JWNA 1VQMN 3SUOA 1PKUA 1YZ6A 3MXMA 1T6DA 3OL7A 5E41A 1ICEB 4XO0A 2H48B 3RMBA 5H9EJ 2HNDB 2A3JA 1EIYB 3C66A 3FRZA 4KH1B 4CFDA 4FJJA 5CCMA 5KG1A 1XHZA 5LSOA 3MEEA 4B3OB 4ZP6A 3VQ6A 1C0UB 4HI1A 4HYKA 3HTVA 2PIIA 2WSEC 5DRKA 1DJ0A 1SQGA 3MWBA 1RK8A 4J9LA 1GMWD 5HJXA 2HNDA 2QO3A 4C8ZA 4N8NA 5F8LA 5H1SQ 4N7TA 4B3RF 4WE1B 2J0XA 1U0HB 2AJ2A 3DCAA 1QLNA 2BZ2A 5LXYA 3NGKA 5LM7E 1FRHA 2ASYA 4B3OA 3MR2A 2QZ8A 1BWEA 1NOZA 2GEMA 4JEPA 1C0UA 3BJYA 4M3WA 2EXUA 4FJHA 4HHTA 3BSAA 2YWFA 2UXBK 3MMCB 1RAEB 1SKWA 2FBTA 4C1NI 4WE1A 1U0HA 3UQSA 2CZVC 5A8RB 2N4CA 3M8QB 4NLTA 2W9CB 3EKSA 3J7ZO 2VV5A 3A2FA 2P9PA 1GX6A 3D6FB 5DETA 1W2BM 4FLYA 1ELOA 3SCJE 3OLBA 4Z4GA 3T41A 5A8RA 4Z4HA 3M8QA 2W9CA 4ATNA 3EWGA 3ISND 4Q5VA 2FZCB 2YHWA 3V1OA 4EO8A 2CVEA 2HHTA 5M2RA 2E2QA 2Q79A 4OZ0A 5DMRA 1EKEA 2B4PA 3NE6A 4F2SA 1YVNA 1UVIA 3DRRB 2XY7A 3CETA 2EFVA 1NH7A 3VEVA 3CHWA 4G6VB 2P5VA 2QWLA 1WG4A 4F4AA 2NUHA 1VFJA 1RKJA 2PFDA 2UUAK 4AHVA 1I94F 2ATCB 3NGTA 4CYUB 5GVQA 5K8NA 5E84A 2M70A 3DRRA 3NWRA 3CCRS 3TAFA 1GAOA 2GZOA 2HAIA 4ZVOB 1HNWJ 3WNGA 2OTLS 5IWAJ 1YVUA 2Y8WA 1WUUA 4CJEA 1VLYA 4GC7A 3O8MA 1TAQA 4AHUA 2BKPA 5EOYA 2CQIA 4IFVA 1ULRA 2JNJA 2RT3A 1ZAVA 1IKXA 5AE2A 1VC6A 2JJ4D 4OX8A 2AP1A 4CYUA 2FF6A 4JP8A 4WZQA 1WDTA 1EETA 1SL0A 2IJFA 4DUYJ 4DU3A 1JL2A 4OKEA 3QPIA 4H4OB 4MK9A 2HQFA 4NYOA 4NPOA 4Y28C 1GMVA 5AQRA 3F5TA 4WP3A 4KHRA 3TA0A 3CSKA 4E7IA 1GXTA 3CJ4A 2HBRB 3HPGA 3IP0A 1LXNA 4H4OA 4DV2J 4CK1A 1FE4A 3HSTB 1Q9YA 1OVQA 4B9UA 3NCQA 2LXIA 2W9BA 3TUPA 1RWWB 1EWRA 3G6XA 2VDHA 5ADXH 2D3ZA 4PHTX 5I9EB 4LSZB 3OYNA 2PFUA 3VQ5A 4LBIA 4WQ5A 3P8BB 4IG3A 2HHXA 3PV8A 5T41A 4C6AA 3N4QA 4CHZA 4QR2A 2CJ9A 2HLUA 1TZ0A 1FDNA 1X4DA 1T02A 2IIRA 2HBMA 1KEKA 2ZM6J 4J9UE 3CTRA 2DIUA 2Z2YB 1T44A 4DR3F 5DM7L 1S49A 4N56A 4LY7A 3KMSA 3HSJA 4OHYA 3ZTSA 1BO5O 4HKQA 2CNKB 4USKA 3KK1B 4RWTA 3T5KA 1CQMA 2D0OA 3ZT4A 1N5QA 1NGHA 4JI0J 1JJHA 3UE2A 1W7AA 4FJKA 4XDDA 1NO8A 5KG2A 3MUTP 3H40A 4GV6A 2CH5A 4NB4A 2J76E 3FR0A 2PA3A 2GGPB 3KK1A 3T5HA 1HPMA 1HBNB 4DX6A 2J6UA 3EMTA 3O1LA 2ZDPA 1FXXA 5DJBA 3O4QA 2G8UA 1GMUA 4C98A 2W7PA 2H5IB 3W1YC 2CNNB 4LF9J 2IY5B 4RPFA 2KM8B 1FJ7A 2HW3A 1U1PA 2DFFA 1S5ZA 3AVGA 3E9OA 2GGPA 4Q8FA 4LF4F 1BQNB 1JNRB 5J2NB 5E2QA 1HBNA 3CDWA 3SV3A 1WAJA 2XI3A 2NRVA 2WK4A 2I9SA 1OPIA 4USIA 2GV9A 1SQEA 4USMA 4RBUA 3RU0A 2HQGA 1Q82T 1Y7PA 5T7BA 3HI9A 1UJ5A 3A3PB 2EK1A 1JXBA 1BQNA 1Q5YA 5J2NA 4IOAQ 3KHRA 1Q8LA 1XMOF 3KHYA 1MWMA 3K0SA 3AOCA 4DTPA 2E5GA 1H2TZ 2RQ4A 1WUAA 1JXEA 3ZX0A 1IJJA 4DMZA 3AARA 4EYHB 1P6TA 1HNZJ 4CJTA 2WW4A 3MPUB 3PVXA 1YI2N 3G4SN 1VRTB 2I8EA 3CDEA 2UXBJ 4IO1A 3UKRB 1RHMB 1S1VB 4PR6A 2UXDF 2QL9B 4FNIA 4IOCL 5LMNF 1JJ2R 4K8ZA 3OTBA 1RDBA 3D0PA 2YWEA 4MO5A 3LPEA 3TJ8A 2P9KB 4CNYA 2RRBA 4XTTA 5CZ1A 2E6LA 1VRTA 3CCUS 4CHPA 3IRXB 3ID8A 3UKRA 2PC6A 4CH7A 2O8BB 2DGOA 4P73A 1S1VA 1F5CA 2MXYA 1UMJA 3TAMB 1U48A 1GTHA 2WSCC 4M3UA 3RMCA 2LEAA 3FEYB 2GVZB 4CF9A 3MD1A 2GV1A 2GC8A 4DCJB 4KPCA 2IM1A 2CPXA 2P9KA 3M6WA 4CZLA 1V9OA 3IRXA 3UCGA 3BS9A 2O8BA 4UOFA 3MM6B 2BR0A 3TAMA 3SPZA 2F9JA 2GVZA 3KDOA 2UUAJ 1FXRA 2X3DA 2QN6B 4HUFA 3J7YP 3QGIA 2IVPA 2KL8A 3BEXA 1XR5A 3MM6A 5GINA 4M3RA 3JSRA 1S59A 1G3OA 2HBJA 3OTEA 2GIRA 3RR8A 2F7TA 3KLVA 1BWVA 1J5EF 5HSPA 2HFVA 2VICA 2JVRA 3WNFA 4JI4K 4RUBA 5AQHA 4NLGA 3DRSB 2PZSA 2VBZA 4DV6K 4NOHA 3Q8SB 4IQXA 2UXCK 2EFOA 3VVUA 4JI3K 2W2PP 4X65F 1GTEA 3KOAA 3M2RB 3ENBA 1E3MA 1OQ6A 1UWBB 3PHEA 4GV3A 4DPWA 2HZVA 4Z4FA 2QIFA 5BYQA 1NG9A 3KG0A 4LREA 1TP7A 3LPYA 2P9EA 1JK9B 3U9ZA 3LDSA 2VBYA 3H5YA 1NMEB 1HQ2A 3E2EA 3OFGA 3MECB 3ZTPA 3OS2A 1IV0A 4RTFD 4JV5J 4LF5K 4YORA 3M2RA 3NAIA 3P31A 5EU7A 2V8VA 4B9LA 1UWBA 4M42A 3QATA 5GIPA 2W6LA 1FRMA 1IWGA 1S5JA 2E44A 1RDRA 3TX8A 2IFXA 3ZXWA 1VQLS 3IRWP 5ETKA 1MSWD 2HQCA 3QEVA 4WQ4C 1HNXK 2VWKA 2Q0UA 3O9UA 1YRTA 3J81j 5GMEA 2YWGA 3ICLA 4IOBA 1S6OA 3QNNA 2FBXA 1L5UA 3HX9A 1PO6A 1UFLA 4CEAA 5HVFA 2IRYA 3O3LA 2VODA 1DKGD 2B9YA 2DCLA 5KT2A 4O3RA 3ENVA 1BC6A 2P8IA 3EN9A 4H0TB 1UEVA 2WOMB 4DR2K 2KVIA 3MEKA 2BQRA 4RW4B 5CABA 4GKJF 3CF5L 3IR6B 5AE1A 2B43A 3R27A 1RWNB 4DTRA 4KHUA 3G25A 3HSCA 1VDHA 3OTCA 2WUSA 1BA0A 1NGIA 1KLMB 1SL2A 5CHIA 2MQNA 1YKWA 2RHKA 2FVRA 3GZ7A 3AVBA 3H59A 3BYPA 2WOMA 4AUKA 4EFHA 4RW4A 4DX7A 2IHR1 2CUYA 4NXMK 3B6OA 3BGOP 4NLUA 1PYSB 2PFFB 2BJEA 2BABA 1KLMA 1U2RA 2MQ8A 3BSCA 1HJOA 3RYLA 4W4MA 3K2PA 1YJUA 3K8VA 1PYTA 2HWHA 2DPJA 3RMDA 2FJEB 5JVHQ 4RL1A 1CSJA 4WK3A 2C2ZB 3L6QA 2P9GA 4CEBA 4OZ5A 4M94A 4BRHA 2J5AA 4ZPTR 1B3TA 2AGOA 3BSOA 4M7XA 3PIPL 4DS5A 4NYZA 1ZAXA 7FD1A 4KH6A 4N77A 1AYEA 2J0SD 1T3NA 2VASA 3P49B 2QWPA 5LY3A 1EQ0A 4C0OC 3R9PA 5KI6A 3IWNC 4DTNA 2WBNA 5DZ6A 3Q8RB 2A6AA 2IVNA 2YI1A 1MN7A 1N88A 2JH3A 1N36J 4TQRA 3ZC4A 4RO0A 2E9ZA 1UVNA 5CZVA 4I68A 4MO4A 2E20A 4QS9A 3WZ0A 4AYBD 3O9SA 3RR7A 1UZDA 3MM9B 3WXKA 4PY5A 2CQ4A 1WORA 3W7BA 1H0HB 1U1MA 3SUPA 3BH7B 1NH8A 2I0XA 2XULA 4MDAA 1FA0A 3QWPA 4JK7A 4XDCA 1VISA 2OGUA 1OH6A 1NK5A 4DR6F 3AJDA 1YX2A 2LXFA 1J54A 4ANDA 2R7RA 2NLWA 4M45A 4PQAA 1H2UX 1WHWA 3CIMA 5D0HA 5KPZA 3J81O 7AT1B 1QY7A 5K9FA 5F3ZA 2E1PA 2PSZA 3W2WB 1CBKA 3AT1B 2CQPA 5C0YA 2HRTA 4QIGA 3UD3P 1Q7YO 3MOJB 3MCSA 4FXVA 3NAHA 1JLEB 2X6NA 3FZKA 4IEIA 2YTCA 3PJXA 2FQQB 5HI7A 3GCWP 1CXQA 2IPOB 3R3TA 3W2WA 2AYMA 1WG1A 3IGNA 3E1YA 4F3OA 4BC7A 2GBZA 1VSDA 4FF3A 3CC4N 1JLEA 3OYCA 1FWKA 1XTZA 4WCEQ 1W97L 1VQPS 4ED0A 3ZZPA 5TKWA 1Y64A 4CJRA 4OPKA 3VAIA 2ILZA 2KKZA 1RHRB 1X60A 3DRXA 2B5JB 2QM1A 4OV1A 2BQUA 4OYOA 1OO0B 3VTHA 2FBVA 1S1TB 3VGLA 2ZOMA 1SJQA 4NLXA 5JICA 1JX4A 4H0VB 1FD8A 4NLPA 3DU5A 3PG9A 1YIJS 1W0HA 1FK9B 1IBLJ 4C3KA 3SCKE 3AODA 4JI5F 1WOOA 3D6RA 4BRNA 5KG6A 3ET6B 2AGPA 1EJ7L 2B5JA 2UVVA 2I1RA 4JI4J 1T05B 4DR7J 1ZM4A 4AQYK 3GP9A 1E6YB 1S1TA 3IMXA 1WSJA 4DV6J 2NUUG 3BF1A 5GAHI 4DV3F 2GNKA 4JI3J 4GC6A 2IGIA 1FK9A 5E3PA 1VQOS 1KC8O 3IO1A 5KFYA 3T1AA 2XMKA 1DQ8A 3OYGA 2ZH5A 2RN2A 2WONB 4J90A 2PN6A 1T05A 4ILMA 1E6YA 1F3FA 4RNMA 1TL4A 2MZ1A 3R7SB 4H5TA 3FGUA 1VQ8N 3GFZA 1EKRA 4I7FB 4KT0C 2UV8G 4DL4A 2JX2A 4NA2A 3O6WA 2WONA 2YQ3A 2QLJB 1G2EA 2HHVA 2XSFA 4PUOB 5H1SV 4ECQA 2EFQA 2PGCA 4EHTA 2J8AA 1YZ7A 1OYDA 4IR1A 2G0JA 1QVFM 4F0MA 1RBUA 1FJGJ 1RACB 4I7FA 1ESVA 3FBEA 1NOYA 1RT4B 1JIHA 2Z1JA 2R2SA 3AVCA 3HRGA 4CGFA 3L4QA 4NYPA 3HKWA 5EWFA 3CC2S 2IM0A 3U1MA 3IWLA 2VB6A 4ZLNA 4X4QA 4DR2J 3ZTOA 3DFEA 1B99A 3LGNA 3S3NA 3WUHA 2GW8A 1P9QC 2POKA 1GQEA 4ZPWR 3K17A 1RT4A 1CLQA 2HBKA 5AQXA 1A0OB 1IVZA 4J9MA 1BUXA 1P8GA 5D0GA 4RUHA 1C1AA 3CJKB 2Z1GA 4GV9A 3R1HA 1SUQB 3BUZB 3B4MA 4NXMJ 2C2OB 4K25A 3ZYYX 3R1XA 1QUVA 2VG7B 2RRNA 4FWLA 4J9QA 2NRZA 4BWJA 3C6AA 2VPXB 2K06A 2L48A 2WRMA 2VONA 5FPDA 2ZH1A 2Y1IA 2CQGA 5AQJA 2QA4G 3CJKA 5FLXY 1SUQA 3PO5A 3BGLA 3OLAA 4WK1A 3TX0A 2C2EA 2VG7A 4J9SA 2UU9F 3OYJA 3RB6A 4M7YA 4NEZA 2LQBA 4EMDA 2XO6A 4FWKA 3DC2A 4QWDA 3AA4A 5LMUF 2XNQA 4BGAA 5HMYA 5M2UA 2MKCA 1RCOB 4O0JA 3DNCA 4KIAA 4MKVA 5DDRC 2F7VA 4OIXA 3QZ8A 2XLJA 2DNGA 1TKTB 2IBOA 5BPLA 1SH3A 4IOXA 2OEJA 3MI7X 4JKAA 4NA1A 4CLSA 1RNHA 1YBUA 3C7NB 2YWKA 1FKAF 4ED5A 3OYKA 2E1ZA 4DV7F 1GLDG 5AQGA 1TYQB 1S99A 3IS9B 3JYTA 1RWPB 1TKTA 2B51A 1D8ZA 3D66A 1KSPA 1NKEA 1ZA2B 1KLNA 3K9KA 1IJFB 3OYFA 2G1HA 3EVMA 3C7NA 2HS3A 3H98A 4HI2A 3NS7B 2GELA 1LAVA 3AQOA 3ILIA 2ZGZA 1NK9A 1XN9A 1O6XA 1TYQA 3IS9A 3KXDA 3PR4A 2QC3A 4Z37A 3W9IA 1RU1A 2E1MC 2IRUA 1ITPA 4OVLA 2B7BB 1W9HA 2RILA 5FJ4A 3HJFA 2KU7A 4QOZB 1BXNA 2E7XA 2RE2A 1KQSM 4ED2A 1WKLA 1YTAA 2WZ1A 4HTUA 4MKBA 1HI8A 5KT4A 3CB4A 4OYZA 1H72C 1YTUA 1RCXB 5HRNA 2EI5A 4L76A 3TTFA 2XG8A 2ASLA 1X7VA 4AHCA 1U1NA 4BVPA 2DD8S 2YJFA 3NHGA 2FHOB 4RUAA 3Q83A 3SYZA 3T1YF 4JYAK 2KHCA 3H1QA 2CQCA 3TEHB 3KHGA 4R5PB 4B8AB 2ZHAA 3JQKA 1DTTB 2P5OA 5AQVA 2HVEA 3ILLA 2GWJA 3ZSXA 2BW2A 2HRYA 3EY1A 1WSHA 4OZNA 4ED8A 3VF2A 4X4TA 2XY6A 2Z0GA 3D3CJ 3FZFA 1RBRA 4DQQA 1K8AO 4AQYJ 2E6MA 1XUPO 3A8KA 4ZIVA 4UTGA 5C10A 1LK7A 4R5PA 1DTTA 1IH7A 1QHAA 4DFKA 4EP4A 4F9OA 4FOIA 4MTPA 4DFJA 1D9FA 3QNOA 5AQQA 4TLRA 3D2EB 2V7ZA 4ECRA 1UA1A 4N8OA 3MEGB 3T1HJ 4FM2A 3QZ7A 1LW0A 4B3TJ 4M3ZA 4DR3K 3SUNA 5AJ3F 1XNRK 1MG7A 4JKEA 2BDPA 1NGJA 5J2QB 2LLZA 2AJ1A 1HBUB 3CCLN 4DPTA 1MLAA 3OHAA 4LRFA 3LWLA 2I7NA 3NDKA 4G1QA 2LA4A 3EGVA 1WSEA 3THTA 3QESA 3SEOA 1TL1B 2A1BA 3JAMU 3TVKA 4FCYA 3D2EA 1AUDA 3IDHA 2QMXA 2YJEA 2J8SA 3WIVA 3NBPB 3MEGA 4NLVA 4GRSA 1DTQB 1WKJA 3C6TB 3O80A 5J2QA 2J7UA 2KFNA 4DL0C 2XS5A 3V5RA 1TL1A 1NHKL 3JXOA 3K9JA 3N5FA 3SDEA 2QG9B 2C3UA 1PAUB 1M5PC 4DLGA 1RWOB 3NBPA 1SH2A 4WQ4A 3BY5A 1DTQA 3N6LA 3ZETB 3C6TA 3VR1A 4EP5A 2WTFA 3PFEA 5C42A 1N54B 4ZJOA 1LWXA 1WBBA 3HT0A 4IOCQ 2CG4A 2P9UB 2KYXA 3ZETA 3L7OA 1RCHA 3HHKA 3V6KA 1T03B 3CCQS 1GK8A 4BR0A 4CFAA 2FDNA 3FSYA 4H4MB 4Z4IA 1HRHA 2DNLA 3BGUA 1NJWA 4JI1K 4OI1A 1I1GA 2O4IA 2YVSA 4GKKK 4ER8A 2P9UA 4R0JA 3AJ1A 5E5NA 1XC9A 2GUIA 2DCUB 4A5AA 2XMJA 2NS1B 4CLTA 1T03A 2GA7A 4CH1A 2JEJA 3LL3A 1W2BR 3T9NA 1JL1A 4H4MA 3G96A 2R2UA 1CJVA 3DDKA 2BKNA 3HSDA 2J9DE 2ZEJA 3DDIA 4BREA 2GQ2A 4DU8A 3HHNB 4BE2A 3TA2A 2CNLB 5B8HA 3BKTA 2NZTA 4CO1A 1PBAA 4D3HA 5AQKA 3JSYA 1UP1A 4HTLA 1CJKB 1CJUB 1IUJA 1LXJA 1DZ5A 1WSGA 1AROP 2HVDA 3THXB 2FHJD 2HFNA 3QT6A 2WCXA 3T6JA 3AOAA 2NSCA 4LQ9A 3VVTA 3CJ3A 1BQXA 2VF3A 3KHLA 5ETNA 2YWWA 3W5YA 2YNFB 3AAWB 3NVKA 3CCES 1A5WA 5KTQA 4I9QA 2P9LB 2DH9A 1CJKA 1CJUA 2IIHA 5A2QO 4NLSA 3MTJA 3KYLA 5DQIA 4NLDA 4PXEA 3LP2B 3NNAA 4L72B 3PXGa 3CQYA 2C3PA 3EGZA 2YNFA 1KVCA 5HRPA 5I4MA 2XMUA 2P9LA 4OI2A 4FL9A 3PZPA 1KD1O 1UEKA 3M7VA 1XI1A 1B7YB 5AQTA 3H8YA 2LU2A 3JTOA 3VQDA 2V69A 4IZ9A 3QBXA 5ITHA 3G71N 1M90T 4FVUA 2H3EB 3EUNA 5THWA 4CM2A 1U8SA 3H4BA 3CT9A 1VS3A 3OYHA 2HFSA 4KQZA 3TZZA 1YQHA 4TVAB 4I6WA 3M2UB 2CPIA 1RWVB 2MJNA 3QGPA 2YQ0A 3HVAA 3RZAA 1CS4B 4MLHA 2IM2A 2OLWA 1WSIA 4DSKA 2MQLA 5M2PA 4RNHA 4AE5A 1RTZA 3MK6A 4KGZB 2I2YA 2ZHBA 2L9NA 4JYAJ 3ULEA 4FWSA 3M2UA 3EVWA 3LPTA 1AW0A 1VQNN 4CBUA 4B9QA 3MX5A 2YX7A 3K5OA 1YJNS 1EAYC 2HK2A 1CS4A 1VJWA 4ECYA 5M1OA 3PYFA 2CG8A 1KAYA 2V51B 2J7WA 4A48A 2PA8D 2MKJA 4ZCIA 3O3GA 2N3OA 4WP9A 3C0BA 3AVLA 2Q2RA 3OD2A 2PO4A 4B17A 2XZDB 3HZ6A 3JS6A 5EX0A 4RNNA 4ZP9A 2MY8A 2QJ3A 3NXZA 2QL7B 1TV6B 3GYNA 3M9MB 2AYBA 2A1RA 4M5JA 2W8LA 4EZ6A 3SAGA 5FRNA 1D9DA 1UAXA 3S6EA 3BF4A 1Y11A 3PIPQ 4H0XB 1VK0A 4FW1A 4I9LA 3Q7CA 1K9MT 1BG3A 1XNRJ 1TV6A 3H1VX 2RU9A 3SSSA 1F2HA 3RG6A 3EM1A 2G2YA 1NGCA 2KHDA 2IMWP 4LQ3A 3PX4A 4ES3A 3WXJA 3IR7B 2ZD1B 1ASWA 5F8HA 5CYJA 3MXIA 1NMNA 2RQKA 2N82B 1QSLA 2DGTA 4PKHA 3MR7A 4CP5A 1UZHA 4M41A 4I6AA 1HNWF 5IWAF 4LF8K 2YHAA 1RBOB 4F3QA 3ATUA 3PO4A 4XH1A 4PYAA 2ZD1A 1CXUA 2JVOA 4M5LA 4H03B 1P90A 2QA4N 1M1GA 2ACMA 3FC9A 1YTYA 5IS2A 4WBFA 3QEIA 1O1WA 3NS6A 4GO5X 1QHTA 5CAAA 4QJVA 3OHBA 1XHXA 1X9JA 3I96A 1AXQA 4HL9A 2HHWA 2YX4A 4YB1P 2C1EB 1N33K 1GXLA 3SIPB 1Q95G 4PG5A 4ECXA 2OIHA 2XRIA 5HVHA 2C2NA 3NWGA 4DV2F 4DUTA 3U9DA 4JI1J 4CF1A 5CZ2A 3TAEA 2WW8A 4AT1B 2QLWA 4GKKJ 1I39A 3N28A 2LEPA 3WC2A 5HANA 3K57A 4Y2CA 4OL8A 3T9ZA 1V4SA 2ZUGA 2JHEA 2W41A 2CJBA 1WC3A 4CGGA 2VH7A 3RRGA 2DNZA 1X4FA 2IDLA 5CYQB 2ZM6F 2MYFA 1WF2A 3ENOA 1L3TA 3TJ9A 3CFPA 3N79A 1R8HA 3B4DA 4CFCA 4J9RA 3L4IA 4IRDA 3RTVA 2BRKA 5HQ8A 4QW9A 2AD9A 4KGKA 5F9LA 2XEXA 4PWUA 3SQ0A 1HWJA 2ZJQL 1X9WA 4JI0F 2ERRA 4J9KA 5DG7A 4WFNL 1F60B 4QIWD 2ZDOA 3CXCR 2W2QP 3IBCB 4OZ3A 4YMEA 4ED4A 5KOXA 1X5TA 2BRLA 5L8RC 2EBEA 1XMQJ 5KFVA 3IXQA 3QERA 4BRKA 3U7JA 3HSZA 3O6QA 3FZBA 1S9GB 4LF9F 2NZ4A 2DR5A 1MMNA 3HKZD 2J0QD 3HVTB 2F1FA 2O01C 4DV0K 4DTUA 2DGVA 4FS2A 5F8NA 3DDNA 1S6PB 1K73T 2A42A 4JRQA 3HDSA 3CWJA 3SAHA 1MROB 1QZ6A 4FSVA 4LBHA 4JKDA 5DDQC 4MFBB 1KBRA 1S9GA 3QGHA 4F4WA 3HVTA 1XIQA 2VG5B 4F3MA 3I56S 1RGIA 3ENAA 3RAXA 4ENOA 3O4NA 5B0AA 1RYRA 3BZKA 4E7LA 2EBGA 1S6PA 2V2VA 2CH6A 4EO6A 1MROA 3UNYA 1S4FA 5BN9A 4MFBA 5F1XA 1Q8IA 5KFGA 1F9FA 3CDBA 1ZBSA 2OI2A 2VG5A 5D77A 3FRYA 1VQ4N 2DTJA 1TUVA 4FK4A 3AB2B 5LJVA 2MZQA 3MR3A 4CNZA 1HNZF 4DWIA 4DQRA 1XEZA 4WIIA 3PJWA 1HQEB 4HHJA 2UXBF 3FSIA 3GL1A 3X1LB 2OELA 1U2VB 3QJPA 2QXFA 3GPAA 4L3QA 2B6AB 4QU7A 1WSRA 1PG5B 1E4FT 1FVSA 5LL6Z 2RDIA 4CZFA 1U49A 2FPHX 3F2KA 2VYPA 2CJAA 3AVMA 3J80Y 3NOCA 1NM1A 3V1RA 1HQEA 4Z0UA 4CGHA 2QL5B 2DITA 1U2VA 2B6AA 4YP3A 2XZWA 1NZAA 3VAMA 4B1XB 3K0JA 5E7OB 2AGQA 3MCPA 4M3YA 1HYSB 3GSDA 4FF4A 2HS4A 1Z6RA 2G8IA 4PL8A 2RDDA 1ZAWA 1BDGA 1Q7LB 2FJVA 2CQ0A 4MIAA 4ZA1A 3J7ZT 1LOTB 4KHNA 1K8KB 4JK8A 5JLFA 3AVHA 2ATLA 1CZBA 4FO0A 1HI1A 2JL9A 2JEGA 1HYSA 4ZVUB 3UD4P 1VQ5N 1OPZA 2DHHA 2XYHB 1ZA1B 5ETTA 3I87A 5KFCA 2WVFA 3A5MC 4EYIB 4BR9A 3M1VB 3QO9B 2ASJA 1UW4A 2E7WA 1WN7A 4CIGA 3KJNB 2R7QA 3TZWA 4ZVRB 1ASVA 1YVFA 1K8KA 4RU9A 2CIMA 3QRQA 2FTRA 3G6YA 2CXEA 4LF8J 5BRDA 1UTAA 4O23A 4FM1A 1LEOA 2UVUA 5J1NA 2FVQA 1ZBTA 4BRLA 1F2GA 3MM8B 1NNEA 4F3TA 4DOZA 3M1VA 1RAHB 3QO9A 2E4LA 5L1KA 1Q0NA 3DU6A 3LQVA 2VWJA 2ZH3A 2CFXA 2MGZB 4IBNA 4JS4A 3BBFA 4M8LA 2X6SA 1YI2S 3SJHA 1S0OA 3G4SS 5DO2A 1KQKA 4WFAQ 3MM8A 4G3IA 2RHSB 2DR7A 2OPSB 1SIWB 3EE3A 4AHSA 1C4CA 5LMUK 2NXEA 1HWIA 3FZMA 1HJRA 4BR2A 1DLOA 3MX2A 1YAGA 1N33J 2HIQA 4L3KA 1QDUB 3LP0B 3NCRA 3UW1A 1N4LA 4CEFA 2MGZA 4JV5F 3CCMN 4PG6A 5D4LA 4KJIA 1IQTA 3MDFA 2CGJA 4OPHA 1R8BA 2DISA 4CERA 4WWSA 3OBIA 3A3OB 2O5DA 1YJVA 4J91A 2OPSA 4TSXA 2JGUA 3UKUB 4N47A 2RQCA 1RTHB 3OL8A 3LP0A 1CC7A 3EVOA 3T7ZA 3OR2B 3HHLC 1FXDA 4NZ6A 3OFHA 2E2NA 4FM0A 4LJMA 2HSTA 3CJQA 3CJ9A 4MKYA 2ZWHA 1I3AA 5IFMA 1XQIA 1EB0A 1T9YA 3CMQA 2XZTB 2NYHA 1R3NA 3MXHP 4DQ8A 3UKUA 2VFVA 3H2UB 5DLFA 3V6HA 1SKRA 3I5AA 3LDLA 2F9TA 3OR2A 4U9RA 4PCQA 2QFJA 1T3VA 2M0GB 2QKKA 5AXKA 3MDQA 4LFCK 3OHRA 5CD4H 3BZCA 3BEGB 3HHEA 4DXLA 3E66A 2MSTA 1Y9OA 3VQPA 2ALYB 2K3IA 2APOA 4F25A 2UYTA 4QW8A 3OVSA 4ITSA 2D9OA 2BOAA 3TANA 1NJYA 2HQIA 2NPFA 1NJIT 3B6BA 4DUZJ 4C7QA 1T3OA 3WC0A 2PD1A 4DL5A 3W3DA 4DS4A 5BRHA 4LFAK 1PJ5A 3TR5A 3ETMA 4L75A 1N34F 4CJFA 2V52B 4R25A 5HROB 2BJDA 3ZO7A 2YNGA 5HN0A 4U8YA 4WIQA 3M8YA 1WC1A 3RVCA 4DV0J 2LSNA 4LIWA 4F4YA 3MAQA 1WF0A 3GJTB 4I6MB 2KH9A 4I2QB 3EO3A 4CF0A 2DGQA 2R7UA 4MQ3A 5HROA 1W2IA 3TAPA 2E5JA 4LVNP 1HYZA 2XLKA 3POTB 3SPYA 1J2VA 1OMSA 4NLRA 3UCUP 4LC9B 4QAGA 3BN7A 1N36F 3W8PA 4DV5J 3W63A 3KWGA 4I6MA 3M6UA 5G4DA 2QFIA 3VGKA 3CPWM 4I2QA 4JS5A 1TL7B 3CCSN 2CQBA 1ZM9A 5DGBA 3POTA 1JNZB 1TVRB 1W26A 5A76A 5C15A 3CJ5A 4F4ZA 2D74B 2OAUA 1HBOB 4UY8O 1NCLA 1QVFR 3P96A 3SQ4A 2VU5A 2KLAA 3OFEA 2X1GA 2RHQB 1RBSA 1TL7A 1A5VA 3ZNJ1 1RFQA 1W7WA 3ZSZA 1BISA 4F50A 1D0EA 1S77D 4OHWA 1TVRA 2QWNA 4M5GA 1NB2A 5F9NA 1WOPA 4LF7J 4B9TA 1HBOA 2A40A 5AZIB 2MPUA 1X4CA 5KT7A 4FZZA 3B54A 4ZPCA 3H2LA 4KFBA 3V9ZA 1OY6A 3W9JA 4OX9K 1MN9A 3JB9k 2LDYA 4IQMA 3TSQA 2GWKA 2A2CA 2HKEA 3L7PA 3PYEA 2X74A 3B8HA 2G9OA 4IOAL 1KAZA 5D3GB 3H7HB 1RT3B 1RZMA 5AZIA 4RW7A 3UWTA 3KTQA 3CYMA 2BW7A 3H08A 3DLEB 2WVBA 3K59A 4OI4A 2OTJN 3SFUA 3TYTA 4RW6B 5D3GA 2E1YA 1RXOB 6AT1B 1RT3A 3E9LA 5HP1A 3D2FB 1Z4UA 3DLEA 4MKAA 4A47A 4JN4A 1VCTA 3ZZ0A 2BH1A 2MKHA 1IBLF 4I0WA 5J1EB 4W90B 2VOOA 4NWBA 2IBKA 2AJ4A 4WQ5C 4XPEA 5AR0A 4JI4F 4R79A 1RYSA 4DR7F 4D3GA 3AVJA 1VQKN 1NK6A 3D2FA 3BGRB 4DV6F 4B1ZA 4I56A 2NNWA 2AJQA 1FWLA 3AA2A 1FRKA 4ILLA 4P75A 4JI3F 4KR0B 5IT9O 5HBMB 5B0BA 3O5TB 4Y0FA 3C46A 2CJKA 4K0KJ 4WFXA 1JCEA 3LGHA 3H5SA 3GIJA 3N5BA 1QAXA 3BGRA 2P9NB 2V8DA 1KXPA 1REVB 3LPUA 1EKSA 1Q1KA 3KG1A 5HBMA 5FLXU 1TK8A 4P71A 2ASPA 1KWMA 4A2AA 5KGXA 1H1VA 3PW7A 1EWQA 1KQFB 4A8KA 3OV7A 3HD1A 3PSFA 5EWEA 1RTDB 5ETRA 1VSIA 2P9NA 3R9LA 4Y1CA 1REVA 4E2FB 2X1AA 3SSRA 1KKHA 1FJGF 3QETA 2FZGB 1ZZNA 2V50A 2JEIA 3OY9A 4DR5J 2XY5A 2BACA 2J4RA 3H3OB 1KP6A 1RTDA 2X51A 4KTQA 3MN6A 4DR2F 3UN2A 1KQSR 2IRXA 2EC2A 3QT8A 2OPRB 1RT2B 4C0HA 2HFZA 4LD0A 4JBCA 4IXCA 4LFCJ 2KM8C 4B1YB 5HQMA 2CPEA 2QE5A 3CCRN 4O3NA 2V2QA 4K8RA 4A4JA 3A5LC 4DTXA 1AA1B 4B3SJ 4O8KA 4NXMF 2EX3A 1FTCA 2OPRA 1RT2A 2VFRA 2R2TA 1CJTB 6FDRA 4YDXA 2Y9HA 4HH0A 3KKRA 3UDLA 1IR2A 2NRWA 2AU0A 2O4GA 5KRTA 4LFAJ 4CGIA 3GG1A 7FDRA 2OFGX 2XTJP 4K8XA 1WSVA 2KT3A 4USWA 3J7Z5 1KVJA 1CJTA 5KFRA 1X4GA 4DLEA 3M8SA 3CC7N 4B02A 1KOOA 1VQ8S 3CCZA 1HKGA 5KFNA 4IO8A 2GMLA 2DIVA 3PW5A 2RUSA 2F63A 3VQ9A 2RKIB 3V81B 4JRPA 2YCHA 1KVAA 1SC4B 2RPIA 3EICA 3SMPA 4JI2F 1U1RA 3TUZC 3DXKB 1SJRA 2Z30B 2FXUA 2HF3A 2BE9B 1LV5A 3GG0A 3KIOA 2RKIA 3V81A 2L3MA 2QLBB 3LH2S 1S7HA 3D6TB 4PKGA 3EPGA 5TKYA 1URRA 3WT0A 3KUHA 3M4XA 2P9SB 1WAFA 3LAKA 4CCHA 4MYTA 3DXKA 1B70B 2J9DA 5FD1A 5AZJA 3AA3A 2J9EA 5JVHL 3I4HX 4K50A 4CO3A 4K4TA 3PUFA 3FLCO 1NK7A 2COLA 5B0CA 3BBBA 3HP9A 5KQDA 2M3DA 1CPZA 4DTSA 4ILHA 2MKIA 2V5HG 2C3YA 4JV1A 4DB3A 1NU0A 2P9SA 3TUIC 4NRTA 4CT8A 1N5SA 5A6WA 1KONA 1X4HA 2PEBA 2KXHA 4M63A 1NSAA 4OX9J 3D7EO 3CJTA 2ZH4A 3WXLA 3NLCA 1HWUA 4C8MA 1ZBUA 4PXDA 4OV6A 3NH2A 1RKIA 4CJSA 4B9NA 3MMJA 4E1NA 1XK8A 1T95A 3BR9A 4HR2A 3VGUA 3LUYA 3MR6A 2ZZTA 1OH7A 2W24A 4OI6A 3TNVA 2LQ5A 2XGPA 1Q7YT 2GJFA 2QWOA 4K5SA 2V4RA 2IJNA 2YKNB 1S48A 2R42A 2ZJQQ 2CQDA 3OXGA 3QAUA 3ZNUA 3I9V9 1V3SA 4DV2K 3R5GA 3QYYA 3MCAB 3HVWA 3ZT2A 3GG4A 5K14B 3PNIA 2YKNA 1D5AA 3I82A 3AAPA 4AQYF 2VGNA 1S6QB 1Q16B 3AJ2A 1ZOTA 3UFCX 2CKWA 3U1LA 4IJNA 1QJHA 1N0VC 5HL7Q 3J8AA 3EKUA 3FBCA 3GYGA 3Q0AA 2B4UA 1RHQB 1R8PA 2VPWB 4AF1A 3T1HF 2E1AA 3HD2A 1NHVA 1U2FA 4B3TF 4UQTA 4DV4K 1S6QA 3DJCA 1VQ9N 4HVJA 1VGYA 1AFJA 2XQCA 3W60A 2Z1HA 1T9UA 2H9ZA 4WCEL 3Q86A 1VC5A 3I32A 1RQ0A 1QTNB 1R7IA 1GLJO 3KNGA 4J9NA 1FFGB 2DB1A 1JB0C 4TNOA 1UJ4A 1VSLA 4LH5A 1S0NA 1BHNA 4O3OA 3W62A 1F3VA 2FLPA 4JI0K 1VSFA 1YRXA 3MFIA 4KO0B 3VQ4A 1YF5L 3HZGA 1KC8T 1LWCB 5AQMA 4AL5A 5ETLA 5JVGQ 2NRHA 4TU8A 2ROGA 3E51A 5D6GA 1SKUB 3M9NB 2YNHB 5CQGA 4RLEA 1T9VA 1FFWB 2G2OA 5F0UA 4JHDB 4KO0A 2ZH9A 3ZFVA 2E8AA 2WVDA 1LWCA 3RB4A 4LF9K 3W65A 2DGXA 1D4XA 1SPBP 4B9MA 4ECTA 2YNHA 4DF8A 3NP5A 1VK3A 2XYGB 3MHYA 2V9WA 2BUNA 2QSFA 5GAGI 4HLBA 2BJ9A 4JHDA 1OJ4A 2BM0A 4BVOA 2RAQA 2F9WA 4HDGA 2FBYA 2J6TA 2NSBA 4HTJA 1QZ5A 3PRBA 8RUCA 3SMZA 1ZC6A 3O3HA 3WBZA 1D09B 1GLLO 5IQ6A 4K59A 4ZMMA 2WB4A 3MR5A 4FJXA 3MOZA 2JRSA 1K1SA 4BG9A 3TI0A 4L74A 4PRFA 4F8RA 4KH5A 3ISNC 2P2CB 4F4XA 3RB0A 5DS7A 5IXUA 2XCPA 2VL1A 3CDAA 4E7KA 1WG5A 3BH6B 3VGVA 1HNZK 2NQPA 2HZCA 2GO9A 4PKDB 2VIHA 3RAQA 1QAJA 1IG8A 1QSYA 3S7RA 1F5AA 3IUCA 1CVJA 3G2XA 3DLKB 1R8AA 4N5SA 2JFDA 3E9PA 3DLRA 3ZZRA 5HLFB 4Q8EA 3NGRA 1U1KA 4OMFG 4B08A 2ZOFA 5M1NA 3WX8A 4O44B 3MZIA 3HF5A 2ROPA 2MKYA 1VQLN 4YFUA 1S1XB 5KFQA 2A1SA 3DLKA 3FQKA 3MMCA 3M2VB 5HLFA 3AVNA 3OYDA 3CQXA 1JLAB 3DYAB 1WJ9A 4YUDA 3NL0A 1RILA 4CI6A 4KGVB 2FJXA 1KOHA 5KG3A 1N52B 2HZAA 4DU7A 2HYIB 1V5IB 3A5NC 1S1XA 4FZXC 1SCJB 5JS1A 4WF9Q 1WSFA 3DOLB 4JKCA 5FROA 2CDRB 3M2VA 3EZ5A 1YGYA 2W4DA 3V9XA 4KTWA 3DYAA 2OD6A 4EBCA 4FKYA 1RBAA 4RBVA 2A3ZA 4P9SA 1RHJB 2KG0A 1YJ7A 1O13A 1U25A 3DI6B 3JSBA 2RD5C 1QAYA 3DOLA 3C16B 2F8EX 3KDNA 2EPIA 3VTIA 2H65B 3SQOP 1EP4B 3K7RA 3LWMA 1OIAA 1AT1B 1SJ1A 3RBDA 4ZPDA 2MQQA 3DI6A 2K2PA 2HS0A 3C16A 1U7LA 1EO1A