3DI6A

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 157
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3di6A05
2IA6A 3QZ7A 3PZPA 3IAYA 3NBPA 3IG1B 3OJSA 4U6PA 4ED3A 1XHXA 2IMWP 5FDLA 3OLAA 4FJGA 3MFHA 3I8DA 1WNSA 3RBEA 4CEEA 4Y1DA 2HMIB 4N41A 2YNIB 1S1WA 4E89A 1IKVB 1FK9A 1ZBLA 4B8AB 4HUFA 1VRTA 2JGUA 4K4XA 1HQUA 5KFMA 4DL2A 4DU4A 3Q8SB 4C8MA 4DL7A 4CFCA 3V4IA 3MFIA 5HBMB 4NZ0A 4OKJA 1LV5A 3DOLB 5D3GA 1RBUA 2A1SA 4FVMA 4MK8A 5EU7A 3M8QB 1HQUB 3QYYA 4H4MA 2FLNA 1S0MA 2Y1IA 5KGWA 2XGQA 1RT3A 4NLSA 2AU0A 2W9CA 3HKWA 1RBTA 3ZSXA 3PHEA 2XGPA 5DQGA 3DRRA 3N6MA 3HHKA 2JC0A 3HXMA 2G8FA 3SV3A 3ICLA 3BGRA 2D0AA 3L8BA 1S97A 3MR5A 2HHUA 1RAJA 3A2FA 4ELTA 4O0IA 3H2LA 4HUEA 3BGRB 3MEGB 4C8NA 3RMBA 2QKKA 4MK7A 4TSXA 3NGIA 4F8RA 4JUZA 1RT4B 1LWEB 1HYZA 1LW0B 1DLOB 4KPYA 3TAMA 2E6LA 2WRMA 1QHTA 3KLGA 1CSJA 1B9DA 1D9FA 4FLZA 1JLBB 4DG1B 1N5YB 4ED2A 3OS2A 5C25A 4IQXA 3I5CA 4FW2A 3D0PA 4CGJA 3NHGA 3AA2A 3AVAA 1ZYQA 3OHAA 4M94A 1DTQB 4RW7A 2CKWA 4N5SA 4K4TA 4FZZA 3L2RA 4O44A 4BE0A 5F9NA 1FKOA 1S49A 2W42A 2OPPA 2IBKA 2B4JA 4N76A 4R0EA 1JLFA 1C1CA 3OL8A 3ZT4A 4CFBA 3QINA 5C24A 5KFOA 4K4SA 2D3ZA 3OYBA 3I0RA 3C6TA 1BQNB 3DYAA 4J9QA 4OVLA 3C6UA 4DTMA 2HHQA 3OYLA 1JLEA 5JUMA 3OVNA 3SQ0A 1W9HA 3RAQA 1VSMA 3K5MA 1S1XA 3H40A 2F8TA 1RILA 5J2NB 2OH2A 4ZPAA 4ECVA 2O5DA 4ECUA 4WFZA 3PV8A 4RW6A 4W5OA 4K4WA 2X6SA 1J53A 4KFBB 4R5PA 4FJ5A 4CF0A 1J5OB 3NDKA 3MR6A 2OPRB 3GIIA 1JXLA 4LSNA 2R8IA 3OYDA 3KLVA 4DTXA 3VQDA 5DQHA 4RW6B 3FSIA 5F8GA 1SKWA 4FLXA 3WNFA 1RBRA 2ITGA 4KFBA 2ZD1A 2W7OA 3RMCA 1S1TB 4DQQA 3V1QA 3P83D 3ZT3A 4CGDA 3V9WA 1TL3B 4B9TA 4U7CA 2XI2A 2FJVA 1XR7A 1NNDA 1FKPB 3PX4A 1TKZA 4Q45A 1VSHA 5KGXA 2QK9A 2JEIA 2E6MA 4GC7A 3T3FA 4QW9A 2AGQA 1TV6A 2HWIA 5C42A 4FJXA 5KFDA 1EETB 2E4LA 1WN7A 3LP2A 3T19A 1QSSA 5KFEA 4K50A 1VSLA 2VA3A 2R7YA 4L8RB 3PW7A 2BANA 4Y3CA 3PW2A 1GOCA 1LWCB 5K14A 1TV6B 3AVKA 2ALZA 5KG3A 1SUQA 3DLKB 3NKYA 3EY1A 4M3TA 5KFIA 1XHZA 3BQ0A 3K5NA 2BGGA 4K4VA 3HP6A 2WOMA 3F73A 4IRKA 4LD0A 2PYLA 4NCGA 1NK5A 5JXSA 2DFFA 2BDPA 4EYIB 4PY5A 1L3TA 1LWCA 1RT1B 4XIUA 3AA4A 4Z4HA 2FVRA 4HVJA 3N6NA 4RZRA 4E1MA 4GMJB 2F8SA 2WOMB 4AHTA 4FW1A 3QEPA 4DSIA 4Z4FA 1ZTWA 4KAZA 4EZ9A 4ED1A 3JSMA 3JYTA 3VQSA 3NFAA 4C8OA 1IH7A 4KAIA 4CHQA 4CGFA 1WSGA 3FDSA 5KG7A 1U49A 4E0DA 4E7KA 1T3NA 2DFHA 1S48A 3DRPB 2IDOA 4B9NA 3LAMA 4ZMMA 1C1BA 4URGA 4H4MB 2IM1A 5KT4A 2R8KA 1TGOA 4NYFA 4DTPA 1EP4A 1EXQA 3VQ9A 1RCHA 4FJ9A 3KMQA 1Z4UA 4KKOA 1DTTB 2I5JB 4GVMA 1U47A 1A5XA 4MK9A 1RT6A 5T7BA 1ZETA 2AJQA 3VQCA 1NK6A 4O3SA 4DFJA 4GC6A 3MXIA 4CJTA 4E3SA 4W5QA 2XY5A 3LP1A 3V6JA 2JEJA 4M3RA 3CJ3A 4M3WA 2YKNB 1WSJA 4J9RA 5CYMB 4EO8A 4FM0A 3DLGA 3V1OA 3CJ2A 1RDDA 4OJRA 3SZ2A 5D3GB 3NF8A 3DLEA 4YFUA 3KTQA 4FS2A 4DL3A 5SWMA 4C8LA 2KFNA 2I1RA 3OYEA 1RTHA 1RT7A 5CYMA 1N5YA 2C22A 1RT3B 4IG3A 3IRXA 3VQ7A 2Z1IA 1N56A 5KFZA 2JC1A 1K1SA 4IH6A 3KJVA 4RNOA 1SH2A 4KHYA 4M42A 2ZKUA 2UUTA 4WYWA 1RT7B 5L9XA 1TAQA 4KI4A 2FC0A 4RW9B 4F4KA 3T1AA 1FKOB 4HTUA 3SQ1A 3SQ2A 3MEEA 2YV0X 4F3OA 2R8GA 1BQMB 4IG0B 1W25A 4FS1A 4ID1A 4DFKA 3VQ4A 1RDAA 1C0TB 3NAEA 3AO2A 4ZTJA 3C6UB 4AILC 1S6QB 4CEAA 5DG9A 4FM1A 4B9MA 2AWZA 4DTSA 3SI8A 4ZTFA 4M95A 2RDIA 1RDCA 1Q9XA 4ECSA 3S3MA 3NF7A 5HRSA 1RTIB 4E1NA 2C2EA 5KG5A 2HW3A 1S6QA 2UVVA 2P5OA 3M8PB 2HNZA 1NHVA 2BR0A 3OYKA 4JLHA 1X9SA 2XY7A 4PWDA 4O55A 1TK0A 4F4XA 4ZVEA 3L3VA 3PO4A 4O3OA 3QZ8A 2RF2A 4K4UA 2F96A 3AVHA 4CJUA 3S3NA 2FBVA 4LSLA 3LZIA 1SKRA 1S1VB 3EPGA 2WONA 3V9XA 4B9VA 1RNHA 3BSNA 1WSHA 4KB7A 4CECA 1S1UA 1Z25A 1LW2B 5FRNA 3BSAA 4FBTA 5KFXA 1U45A 1TKZB 1BISA 1RTJB 4AHSA 1XI1A 1S1XB 3MECB 2W9AA 5J2NA 4CHOA 3KD5E 4FLYA 4PQUA 3KKRA 4PUOA 2GIRA 3GYNA 3KK3B 1S9GA 4IFVB 4TY8B 1SV5B 4DEZA 2YNGB 3AO4A 4CJ4A 2ETJA 4FJIA 3K58A 5HP1B 1Y97A 1BI4A 3ALYA 4O3NA 3U3GA 3ZSQA 2R2UA 1VSJA 4FM2A 3AVIA 4OLBA 3NH0A 3IG1A 4URSA 4Z4EA 1TKTA 4RW8A 4ZP7A 4CJQA 4ZPCA 3T5KA 1KLMB 4ZHRA 5HRNA 3PUFA 5F8MA 2HMIA 3CQ8A 3CVKA 1S4FA 4Y34A 1FKPA 2B6AA 2J6UA 2XHBA 1C0MA 4DSFA 4OGCA 1BGXT 3E01B 4F4ZA 4W5TA 1HYSB 4WXWA 4C8KA 4K8XA 3QO9B 4CJ5A 3TAEA 4BDYA 4O4GB 5KRSA 2G8IA 4JV1A 3MEDA 4CJSA 4B9SA 1WLJA 3ZT1A 4NYZA 3PVXA 3G10A 1DTTA 4KV8B 3WNEA 5HROA 2V4RA 4CEQA 1NJZA 1T7PA 4FJNA 3EZ5A 3QNNA 1XR5A 1UWBB 3KLHA 4DTNA 4AHUA 5KFPA 3RAXA 4FJJA 1QAJA 4K4YA 1T05A 1X9WA 5CY4A 3PJWA 1N6QB 2ZE2A 4KO0A 5KFWA 4I7FB 4CE9A 3QETA 4DU1A 2B5JB 3K59A 5HROB 3OL9A 4I9LA 1ASWA 4ICLA 3RMAA 2YKMA 2WB4A 3NMAA 3KLIA 5KFJA 4DF8A 1GX5A 3ZT0A 1T03B 1REVB 4F4WA 4QWAA 3L3UA 1TAUA 2P51A 4J9KA 2IC3B 3H98A 4CJPA 1RTHB 4ICLB 5KG1A 3CM6A 1L5UA 4X2BA 4NLVA 1BIUA 2ATQA 5J1EA 1IKXA 2XI3A 4DSEA 4RUCA 2Z1GA 2BQ3A 2BE2B 4E7JA 3DM2B 3M9NB 2X6NA 1HRHA 2I5JA 4CESA 3KLGB 2IC3A 4DSKA 2YNHB 1TL1A 3HVWA 1NK8A 4NLPA 1U04A 1JLBA 4OL8A 4J9MA 1JXEA 4M3ZA 3UR0A 4K4ZA 2FJXA 4ZPBA 3B6OA 5DQIA 2V4QA 5KTQA 4DQPA 4ELUA 1DTQA 2Q3SA 3DLRA 1KFDA 1BQMA 4J9SA 1HNIB 4HYKA 2IM2A 5HRRA 5KG6A 1G15A 1KHVA 2W8LA 1GOAA 3AV9A 1L3SA 1Q8IA 2G8WA 4LH4A 1VRTB 3VA0A 1JL1A 2HAIA 3DLEB 3T5JA 5F8JA 3RRHA 1A5VA 2JEGA 3RB6A 2HNYB 5J2PB 2ASJA 4UQGA 2HB5A 1N4LA 3AVGA 1RT2B 4YP3A 1KLNA 5F8LA 3RB0A 1XWLA 3IS9A 3RR7A 1KRPA 2OPQA 2HHWA 4ZP9A 4JS5A 4G1QA 3OYNA 1NKCA 5KRTA 3GQCA 4FJMA 5KFUA 2D5RA 3F9KA 5J2MA 1CLQA 1HARA 4HHTA 3OYMA 4DTRA 1C0UA 5F8IA 3LANA 3P1GA 4O3QA 1WSFA 4XPEA 3OYIA 4KI6A 3HM9A 4DL5A 5SZTA 3RWUA 2IJNA 3NL0A 2W9BB 1RBSA 1NOZA 1IG9A 1CZ9A 1T94A 3ZCMA 3CWJA 4Q5VA 4URQU 4PWDB 2PY5A 1KCFA 4IH7A 2YHAA 1KVAA 3VQ6A 4MQ3A 3SFGA 1WSIA 3EPIA 1KVBA 5J2QB 4KTWA 1IO2A 1WSEA 4ID5B 3HVRA 2RF2B 5KT2A 3AVLA 4EBCA 2RKIA 2UUWA 1CXUA 4KHWA 5HLFB 2B43A 2ILYA 2FLPA 4QWDA 3SFUA 3KD1E 3QGHA 1QSLA 3SYZA 1VRUB 1IKWA 4IBNA 1LAWA 2EX3A 3PX0A 4RNHA 4DTJA 3AVNA 3H4BA 3OYHA 3V6HA 4KRFA 3HT3A 1TL3A 1XC9A 3AVCA 3D28A 2J6TA 2DPIA 1L3VA 3JSMB 3SUQA 4FZYA 4YR2A 1RDBA 3DOKB 3BDPA 1VSKA 2FBTA 3UDLA 3ULDA 1YTUA 3CM5A 3MXMA 1BIZA 3CJ5A 1R0AA 4JRQA 2OPSB 1KTQA 4ECWA 3NGZA 3BR9A 3H08A 3ITHB 4MFBA 1S6PA 3NE6A 1MMLA 3DMJB 3KNAA 5KG0A 3LPTA 2R2TA 2XO7A 2HNDA 3SPYA 5HBMA 4CJLA 4DS4A 5KFQA 2VWJA 4WE1A 4YR3A 2EC0A 1SH3A 3H59A 1KVCA 4TN2A 4FLVA 4J9OA 4KHMA 2ASDA 3D45A 2VG5B 4H8KA 1HYSA 4ECXA 3NF6A 1K1QA 3GV7B 1I39A 4EZ6A 4BWJA 4QW8A 3V9ZA 1Z26A 5EWFA 2XWYA 3CJ0A 2AX1A 1OS5A 4CERA 1KHWA 4NLUA 3PR4A 4M41A 4HKQA 4W5RA 2LSNA 4B9UA 4FJ7A 1QE1B 4I9QA 1SL2A 3TAGA 1D0EA 3TVKA 5HRPA 2YNHA 2YNFB 4KBIA 3ZSZA 4NLRA 3OS0A 1BCOA 1U48A 2KW4A 3PO5A 3NAIA 4LQ9A 3L2WA 3LP0B 2OYQA 1EX4A 5EWEA 4QWEA 3VQQA 3KLHB 3KJVB 4H4OB 5I3UA 1N6QA 4RUAA 3TAMB 3PW4A 4TY9A 3HVAA 1NJXA 3M8QA 4DU3A 4DTUA 4DG1A 3HL8A 4CF2A 3CIZA 4FJLA 3HJFA 4RW7B 4Q0BB 3DRSB 3KIOA 4FK2A 1F21A 3QEVA 3G6YA 3PY8A 3BSOA 3FQLA 2VG7A 2IAJB 4QCLA 1NJYA 4OPJA 1IKVA 1HMVB 2OPPB 3HPGA 3OSNA 3SUNA 3HVTA 4I2QA 4CF9A 3KLFB 3KLEB 3I0SA 1EP4B 4HCCA 1JLEB 4IR1A 4DQIA 4KHRA 3L2VA 4JV0A 4B3OB 2QE5A 4YR0A 4FLTA 2XRIA 3HVTB 4ED8A 3FRZA 4QAGA 4CJ3A 2BQUA 2VWKA 3MR2A 3NBPB 2W9CB 2AQ4A 4DL4A 1C0UB 4O5BA 4Q8FA 1KFSA 1BL3A 4TQRA 3LZJA 3BQ1A 1X9MA 4NLTA 5F8NA 5KFFA 2YNIA 2P1JA 5F9LA 4ZVFA 4ZP8A 3BREA 3VQEA 4BDZA 2A1RA 1ZBHA 5T14A 3O3HA 2FVQA 3UPFA 3CDUA 2HHVA 4RG8A 2NUBA 4TXSA 4CHYA 1GX6A 2FVCA 1RTJA 1JLAB 3KHGA 4IFYA 4CJEA 3MECA 3LWLA 2C2DA 4RU9A 2OPQB 4O4RA 4CFDA 4N47A 3DOLA 1CZBA 3RR8A 4I2PB 3KHRA 1NKBA 2YNGA 1HPZA 1VSEA 4M45A 4RW9A 1HYVA 4CJVA 1IM4A 5KG2A 3HYFA 3MEEB 2PYJA 2XCPA 3GIKA 1VRUA 4RNMA 5KFRA 3T5LA 4I2PA 1UOCA 1IKYA 3I5AA 2JEFA 3G6VA 1J5OA 3V81A 4O44B 4N56A 2OPRA 4QWBA 2W9BA 4ZVGA 2D0BA 2WHOA 1RA7A 3H5UA 2FBYA 3AVBA 1SH0A 3V1RA 2G8VA 4CF1A 3T5HA 4CIGA 4DFMA 2G8UA 5KI6A 2C28A 1R0AB 4HUGA 3C6TB 2OPSA 4F50A 2IGIA 1RT4A 4PQUB 1D1UA 1JX4A 4MH8A 4YNQA 4CGGA 3ASMA 3OL7A 2D7SA 4DS5A 5HLFA 2BRLA 5HP1A 2QKBA 5C25B 4NRTA 3OYCA 1RT5B 2DPJA 4AHVA 4Q43A 1ZTTA 3GIMA 4CEBA 4ED6A 1QTMA 3KK2A 1S1VA 3SUPA 4EBEA 2R8HA 1HJRA 1C2PA 3ZSOA 1YT3A 3LALA 3TAFA 2ZE2B 3QIPA 4JV2A 1QUVA 4Z4IA 1RT5A 2E9TA 4K8ZA 5EDWA 1RT6B 3BSCA 3V9UA 3DDKA 2B6AB 1BCMA 3TAPA 3KLIB 3MR3A 4NCBA 2QV6A 1REVA 2E9ZA 3AO3A 1RA6A 1QE1A 3G86A 2DFEA 3OYGA 3QO9A 3CFRA 5KFYA 1T8EA 4WYLA 1VK0A 3UQSA 3D5MA 3HSTB 5KFHA 1VSIA 2HNDB 1NK9A 4NLOA 1S10A 4FJKA 4WE1B 5C42B 1U09A 4CJKA 4DWIA 3LP2B 1TKXA 3FFIA 2KFZA 4F2RA 3TAQA 3QEWA 3OYAA 4FJ8A 4ECZA 1TQLA 1RBVA 3DLBA 3RRGA 2KZZA 5DLFA 3AA5X 4MKBA 4CEOA 2Z1HA 4R5PB 5K14B 3LP3A 4RW8B 3DLHA 3M8SA 1C1AA 4E19A 2XC9A 3DLKA 4KKOB 1T05B 4EP4A 1GOBA 3DI6A 4JRPA 4OKEA 4LSNB 1UAXA 3M9MB 1S9EB 4KHUA 4Y1CA 4BWMA 4KTQA 3KMSA 1BHLA 5DMRA 4DQRA 3DRRB 2HVHA 1NK0A 2IJFA 3CFOA 1HNVA 4DTOA 4DSJA 3LWMA 3DI6B 3SJJA 1QQCA 4NLDA 2G8HA 1TP7A 2BQRA 3PW0A 1JLCB 2IS3A 1S1WB 3ISND 3LP0A 2J6SA 4O3RA 3OLBA 3WNHA 2CJQA 3THVA 2WTFA 4R8UB 3PJXA 1EETA 3DM2A 1RT2A 2VG6B 3RBDA 3RTVA 1WAJA 4KREA 5I42B 3QIDA 1JLCA 4CIFA 5KFLA 4TYAA 3NF9A 4IG3B 3PW5A 4ZVHA 3IGNA 5KG4A 1LW0A 3C95A 4CGHA 3MXJA 2V9WA 2BRKA 4QOZB 5CZ2A 2X74A 2VG7B 2FLLA 2PZSA 3AA3A 1YVFA 3MAQA 1HMVA 3UIQA 1T03A 3KHLA 2VA2A 2W7PA 3CDEA 3RB3A 1JLAA 4CIEA 1W0HA 3KLFA 3Q8PB 3KLEA 1K6YA 3K57A 4J2BA 4BE1A 1IKXB 4ECRA 1S5JA 1UA0A 2R2SA 1TL1B 1D8YA 4EEYA 3VQBA 4KB0A 1EKEA 3M8RA 1C1BB 1HPZB 2C2RA 3IGVA 1FXXA 3S9HA 4IR9A 1DLOA 4WZMA 4J9LA 3HP9A 4OKKA 1S9GB 1VSFA 4IKFA 4OGEA 4IH5A 4M3XA 4NLXA 4Z0UA 4CFAA 4ZP6A 1JLQB 5KFNA 1JKHA 1NJWA 2DY4A 2RPIA 3LP1B 4IOBA 4DF4A 3OHBA 2RN2A 5DG7A 1C6VA 3QNOA 4CEDA 3KK1A 4NLYA 3NCIA 4Y2AA 2O4GA 1RTDB 3VN5A 1C1CB 2RDJA 4J9NA 1JLGA 2HHXA 3HO1A 4NLGA 4KE5A 5C5JA 3MEGA 3E01A 4AHRA 4IDKA 2ZQBA 4DLEA 4XPCA 4E7IA 1WNEA 4J2EA 4KHQA 3CDWA 3HPOA 4FZXC 4G1QB 3PX6A 4ID5A 4IRCA 5L1KA 1LAVA 4PUOB 2OA8A 4F4YA 4FYDA 2KQ2A 1B92A 3QGIA 1IKYB 4FLUA 3V81B 2ATLA 4O0JA 5DK5A 3GILA 1JL2A 3QEXA 1SKSA 3O4NA 4O3PA 3ZSYA 2BANB 5FRMA 4M3UA 2F8EX 4QPXA 2D41A 4TLRA 1KLMA 5DGAA 4NCGB 3P5JA 2YKMB 1JLFB 1LW2A 4JS4A 1TKDA 4W5NA 2ASLA 1A5WA 3CG7A 4ECTA 4QWCA 2ZD1B 4CJWA 3L2QA 3C94A 4BDPA 2E9RX 1I3AA 1BQNA 4CK1A 4KTZA 3OL6A 3ISNC 4EYHB 3FFIB 5DGBA 3B6PA 5J2QA 4WZQA 3OJUA 2HWHA 2HNZB 4Z4CA 1S0NA 3MEDB 3Q8RB 4NLWA 3L2UA 1NKEA 3KKSA 3RMDA 3QIPB 3U6FA 5KFBA 1JIHA 4LQ3A 5CYQA 2WK4A 2IOCA 3Q8QB 1TVRB 1NK4A 4FLWA 1NHUA 4BE2A 4H54A 2AGPA 1JXBA 4TYBA 3AO5A 2Y1JA 4I7FA 4MIBA 4J9PA 3CO9A 1TK5A 5F8HA 3G6XA 3OYFA 3BJYA 5JS1A 5KT7A 4NLQA 4CGIA 1ZBIA 3TI0A 1CXQA 4B8CA 3IN5A 2GC8A 2UVRA 3SPZA 1D9DA 3G0ZA 3VA3A 4FJHA 5KFSA 4CEFA 3AVJA 1TKXB 3FQKA 4I2QB 3ITHA 4MFBB 5I42A 3HK2A 4DL6A 2EHGA 3TWHA 3NAHA 3JYTB 3CFPA 1ASUA 2GV9A 1FK9B 3QLHB 3DLGB 4CHPA 3QGGA 3TR8A 3O3GA 2OZSA 1ASVA 3KHHA 5FROA 5KFKA 1BI4B 4M3YA 2QXFA 4NYNA 1SL0A 1S9EA 3KOAA 4FK0A 3V4IB 3TABA 3N6LA 2YHBA 1LWFB 4B08A 1YVUA 3LDSA 2VG5A 3QEIA 2XY8A 4TQSA 1HNVB 4KO0B 3DRSA 2GIQA 3H4DA 2GBZA 1HNIA 3H5YA 5JS2A 3K2PA 1VSDA 4LH5A 4BACA 2IM0A 4CHZA 4CJRA 2HHTA 4FCYA 1N48A 1LWFA 4OPKA 3QIOA 2FJWA 3EZUA 3AVMA 3K5LA 4KHSA 4XO0A 2VG6A 3TQ1A 1Q9YA 4MIAA 1J9AA 2YNFA 5EWGA 2FBXA 2P5GA 4IG0A 4RW4A 2YKNA 2D0CA 5J2PA 1I6JA 3O4QA 2GUIA 4CHNA 3ZSWA 4PA1A 3GIJA 3V6KA 4GW6A 4RNFA 2BE2A 4H4OA 4Y2CA 1TK8A 4Z4GA 4ED0A 4HCBA 1O1WA 2XY6A 4RW4B 3TARA 3S3OA 3O3FA 1RTIA 2W8KA 4KB1A 4F3TA 3IS9B 1JLQA 3IRXB 3VQAA 1JKHB 4DQSA 5KFAA 1LWEA 4J2AA 1UWBA 4ECYA 4CF8A 2G8KA 2KTQA 1XR6A 3NH2A 2B5JA 3OSPA 4ELVA 3M9OB 2FVSA 5E41A 1YTAA 4Q8EA 1RTDA 2Z1JA 1IKWB 3K5OA 4EP5A 4LY7A 1C0TA 4AH9A 3QESA 4CCHA 3VQPA 4CEZA 3V9SA 4ED7A 1S1UB 2AX0A 3WNGA 5KT6A 4EBDA 1X1PA 4DSLA 3PR5B 4Q44A 5C24B 5KT5A 4KSEB 5L1JA 5L1IA 4CJFA 3I5BA 3I0RB 1B9FA 3DYAB 4WFXA 2DTUA 4E7LA 1U4BA 3OS1A 3M8PA 1S0OA 3TANA 2HHSA 5KT3A 3OYJA 3NH1A 3LPUA 3MF5A 3VQ5A 3KK3A 4TY8A 3ZSRA 5CZ1A 3U3YA 2UVUA 1RYSA 3SI6A 4E7HA 3SUOA 3ZSVA 2ILZA 2O4IA 3KK1B 4WFYA 3HPHA 3GV8B 4IRDA 1JLGB 4LSLB 2R2RA 4NRUA 1J54A 2WCXA 3OY9A 2WONB 3CYMA 1S9FA 1TKTB 5DLGA 4IFYB 2HNYA 2FVPA 4IDKB 3QERA 4DLGA 1QSYA 4FBUA 3BQ2A 3H5XA 2IM3A 5DG8A 3RB4A 4B9LA 2AGOA 3GV5B 3NGYA 4EO6A 4MKAA 1HQEB 5KFCA 1S6PB 2X78A 3LAKA 4F2SA 4WXOA 5L1LA 1MU2A 3SNNA 2D3UA 2XCAA 1SV5A 3SQ4A 4DFPA 5KFVA 5J2MB 2OZMA 4ZPDA 1HQEA 2R8JA 4RNNA 1QS4A 2V0NA 1ITGA 1MU2B 1ZBUA 2JLEA 3H5SA 3AO1A 3V6DB 1SUQB 1KSPA 4KHNA 4Q0BA 1L3UA 4CK3A 1NK7A 3CJ4A 3SCXA 2UVWA 3SV4A 4ZHRB 3AVFA 4G3IA 3ZT2A 1ZBFA 4OLAA 4CK2A 2IAJA 3DOKA 4DMNA 4J2DA 4ECQA 3QLHA 2HVIA 3V6DA 1RT1A 4IKAA 1RDRA 3EYZA 1S1TA 3VQ8A 1UA1A 4R8UA 4FK4A 5EUHA 1D5AA 4NCAA 5KFGA 5CYQB 4O4GA 3DMJA 1SL1A 1QAIA 3I0SB 1TVRA 2RKIB 3KK2B 1WAFA 4AHCA 4IFVA 5J1EB 1NOYA 4FXDA 3NGDA 4B3OA 5FDLB 5I3UB 2KZMA 5KFTA 1RYRA 4YMEA 3E51A 4KV8A 4YQWA 3DRPA 3MTKA
chains in the Genus database with same CATH superfamily
3QZ7A 5ADXH 4WFBQ 1R6VA 2QA1A 4U6PA 4ED3A 3Q8UA 3UFCX 5HMYA 3OLAA 3HZEA 3I8DA 4DCJB 1WNSA 3RBEA 4B3MK 3ETMA 2HMIB 4MO4A 4B8AB 2OTLS 1D9AA 3WQUA 1TUGB 3P5BP 3THXB 5ETSA 4WQ4A 2DY9A 2XYHB 3GYGA 2F4FA 1N36K 5M1KA 3I4PA 2YQ1A 3KWMA 3R3TA 4CYUA 4DL7A 4CFCA 1K73O 3V4IA 3UN2A 3MFIA 2U1AA 4CM0A 1K9MO 4BVPA 1LV5A 4OKJA 1VYAA 1IM6A 3PXGa 3MXHP 2HHHJ 2HIYA 2CQHA 3QYYA 2FLNA 1J6ZA 5KGWA 2Y1LB 1RT3A 4NLSA 2AU0A 2W9CA 5B08A 3HKWA 4H03B 3PHEA 3N6MA 5M1NA 2JC0A 3D2EB 2HK3A 5M2PA 2GWJA 1Q16B 2G8FA 1CLFA 5MLCV 2IVNA 2Z30B 5EX5A 3BDEA 4JK9A 3KVGA 4Z2XA 2GVDB 1VQ6S 1RAJA 4DV4K 1SJRA 3H2LA 2PDAA 1HNZK 1CJUA 3QAEA 3MEGB 1PJ7A 3TTDA 4C3MA 2ZBPA 4JI2K 2HMPA 2HQFA 2RU3A 2M4MA 1LW0B 4PZVA 4QPTA 4OHZA 3TAMA 2UYTA 3KLGA 4JK8A 1JLBB 3CMAN 2EC2A 4PWUA 2ZJPL 4QIGA 8ATCB 5BJRA 3I5CA 4FW2A 1SCJB 3D0PA 2RUSA 4CGJA 3NHGA 5HQ8A 1XMQK 4M94A 4RW7A 4K4TA 2NXJA 4I64A 2R3VA 5F9NA 1S49A 3FZLA 3OT9A 2W42A 3R9PA 5HVGA 2QRRA 4N76A 2XYPB 2LA4A 2UU9K 1IG8A 1JLFA 3ZZZA 2VC1A 2POKA 4PL8A 4YHHJ 3BEGB 5ELZA 1BQNB 4OVLA 1XBWA 3CDAA 2PC6A 5B0FA 5JUMA 4KH1B 3SQ0A 1FJGK 2UXCF 1K8AT 2DD8S 3H40A 2XLIA 4FXWA 1ZAWA 3DCAA 2OH2A 4ECUA 4W5OA 4A8QA 5GAGP 1FJCA 2FIUA 5LMUF 4R5PA 1FKAF 1W2BM 2DNOA 3NDKA 4DV7J 4IDHA 5CZVA 3AOAA 2JZ5A 2QMXA 4WPAA 2PFUA 1K8KA 2AYMA 4RW6B 4IOAQ 2ACMA 5IWAF 1PIEA 4WKRA 1NUEA 4DQQA 1F5BA 4FPAA 4CGDA 3DGPA 1J5EK 5ETLA 4B9TA 2G0IA 4DV2F 4H5VA 4PKDB 1X4DA 4Q45A 3BP8A 4JI3J 2JEIA 3KNGA 4GC7A 3P45B 1MSWD 4QW9A 3BPSP 3WQPA 5M2RA 3UE2A 1QSSA 4FVCA 3BO4A 1XIQA 4K50A 1UEKA 3PW7A 2V2KA 1N32F 1SVDA 5K14A 4YOVA 3DLKB 5KFIA 4QS7A 3K5NA 4K4VA 4OHVA 1EKRA 3QFUA 3O1WA 2WOMA 3F73A 4LD0A 2PYLA 1NK5A 3IR6B 3I56S 2BDPA 4JI7J 4CBUA 3AA8A 2H51B 4PY5A 1LWCA 4DUYJ 2VL1A 4HACA 4E1MA 4FW1A 2H5JB 2EK6A 3JYTA 5CD4A 1IBKF 4JI3K 2P9LB 4C8OA 4FVUA 1IH7A 4KAIA 4CHQA 2VBZA 3FDSA 3VOVA 3GFXA 4E0DA 4E7KA 2IDOA 1XNRK 2VBXA 4URGA 1TGOA 1PYTA 1RCHA 3RAMA 4DPOA 4KKOA 3EKSA 1S4EA 4J7CA 3TU5A 5LXYA 1A5XA 2E2NA 4MK9A 2VQEF 3CJSA 4ATNA 5MAOA 3CCQS 3G4SS 4DDFA 2HOEA 4LF7K 3IA0A 5B0EA 4O3SA 4DFJA 3K0SA 1FWLA 3ZC4A 3FSYA 4M3RA 3CJ3A 3NVKA 3R5GA 5BRFA 3BH7B 2YKNB 2M70A 5CYMB 2IYGA 3DC2A 3DLGA 4OJ1A 3C8YA 3CJ2A 3FZKA 3HI9A 1U1MA 4GV9A 4WCEQ 3KTQA 4BS2A 2KFNA 1RTHA 1NM1A 3D2FA 3R6LB 2C22A 4JEPA 3IRXA 1UJ6A 5KFZA 2WBNA 2GX8A 2W01A 3W1YC 4RNOA 1F2HA 4G1IA 4D3HA 2ZKUA 1MNEA 2UUTA 3GTYX 4A8SA 3RBZA 2FC8A 4WYWA 4KI4A 4RW9B 3LW5C 4Z7CA 3SQ1A 4IO9Q 3A5MC 1LWXA 4WU3A 2R8GA 1PJ6A 2DNGA 2O8DB 1C0TB 2YWKA 4B3RJ 4CEAA 1GMVA 4B9MA 4P7TA 4NYPA 2BJ1A 2FYXA 2RDIA 1YBTA 1RDCA 3CPWM 1NM2A 4ECSA 5IS2A 3A4TA 4B3TJ 2XMWA 2NXUA 2Z4PA 2C2EA 5KG5A 2ZVSA 2HNZA 4I6WA 1W2BR 1KVKA 3HX9A 2XY7A 4PWDA 1X3MA 4HL9A 4YORA 4G6VB 5LJ5Y 2QWPA 4ZVEA 4P10A 1WSRA 3J81O 3W5YA 5BPNA 4TU8A 2V34A 1LCUA 3AVHA 3S3NA 4XTTA 3LZIA 1SKRA 1HLWA 1LXJA 4B9VA 2YCHA 3CULA 5LJ3Y 4FWMA 3BSNA 4KB7A 3W8GA 1S1UA 3ULEB 1Z25A 4FWRA 5FRNA 1BISA 1REGX 1O13A 1ZZNA 3DOMA 3MECB 2DNZA 3WEEA 3I82A 3R3LA 4OYOA 4CHOA 3KKRA 3R1LA 4NXNF 3NY0A 4X4NA 3CQYA 4HHJA 1XNRF 4DEZA 2YNGB 4CJ4A 3OXFA 1BI4A 4O3NA 3U3GA 1SC6A 2OAUA 4X4PA 1VSJA 3T1HJ 4FM2A 4ZA1A 2UUBK 2YH0A 2P9NB 4KC5A 3Q89A 3V5RA 3T7ZA 4URSA 4Z4EA 3TTCA 4KYZA 4ZPCA 3HM8A 2XMUA 3WIVA 3T5KA 5HRNA 2QLXA 1VQKN 3R5CA 3CQ8A 1S4FA 2B6AA 4A8WA 1C0MA 5M2UA 4ZIVA 4RBUA 1YIJN 1JCGA 2K7JA 2C3YA 2B7BB 4U67L 1ZAVA 5HATA 4WQ4C 3M05A 2CWXA 4JV1A 2HWTA 2FXUA 2VKRA 2WVFA 1WLJA 3MEKA 1HKCA 3G10A 1NBWA 1H74A 2G13A 1DZ5A 3KUHA 3WNEA 4UY85 4EFAC 1U1KA 2QWLA 2EG2A 4YN3B 2V4RA 2MKSA 2V8PA 3DRYA 4CEQA 1AXQA 3VPZA 4RX6A 1JK9B 1UWBB 4ZPWR 4DTNA 2CPDA 2MDAA 2DNQA 3GG4A 5KFWA 4CE9A 4DPWA 3KWIA 1YVNA 2UXBJ 3W62A 2F9WA 4AL5A 2XMMA 3KLIA 1QM9A 2O01C 3ETOA 5IZHA 1WC0A 2HFOA 2IC3B 1RTHB 5FJ4A 3J7ZT 4WQ5A 3D2FB 1L5UA 3CM6A 1UP1A 3RU0A 1HKGA 3SCLE 5CR4A 1BHNA 2EFOA 1BU6O 2CQ3A 1B64A 3TJAA 2GQ2A 3R5BA 4CESA 3HD2A 1NK8A 1U04A 1MROA 4FF3A 4UT4A 3UR0A 2LECA 4ZPBA 4P74A 4ZJQA 4BC2A 5DQIA 4DQPA 4ELUA 1KFDA 2ZKTA 3CF5Q 3U8XA 1HNIB 1AROP 1S59A 2J76E 6FDRA 5HRRA 2I7PA 5FPEA 2GJFA 1KHVA 3AV9A 3VVUA 1E3MA 2J5AA 2EWHA 3MGJA 3T5JA 1P8ZA 3NS5A 4LVOP 4DR3F 1KONA 1A5VA 2ASJA 4GMKA 2E7XA 2HB5A 3D0IE 5F41A 2PFFB 4DR1K 3BS9A 2CQCA 1IQTA 2F8MA 3ID8A 2YQ3A 3GONA 2DRAA 1WKJA 1FE0A 3IUCA 1UL3A 1XWLA 4LIWA 3IS9A 1KRPA 1PC5A 1ZA1B 2MB0B 1YLXA 4USWA 1NKCA 1KR4A 5KRTA 1H2TZ 2V2VA 3W64A 3JAMY 4FJMA 1K9MT 5FPMA 2M0GB 2D5RA 3PRDA 5IOLA 4DX7A 1SB6A 1CJKA 5A8RB 2NCKL 3GJSB 4DTRA 2V5HG 3W65A 1C0UA 3QGPA 3M30B 4BRQA 5DDRC 1KTVA 2J0XA 1VAZA 4O3QA 2EFVA 4DV6J 1YJ9S 2YJEA 3HM9A 4DL5A 2MSTA 3NL0A 4DR1J 2B4UA 2UUAJ 1IG9A 2DO0A 3ZCMA 4OJ3A 2LDYA 2QO3A 2DXDA 1GQEA 4I6MA 4Q5VA 3LDOA 3CE8A 2PY5A 1H2UX 2PEBA 1I94K 4LFCF 1AZSA 3D7SB 5E3QA 4BVOA 5D4PA 3MCMA 3SFGA 4DHYA 1XMOJ 2LU1A 2QXLA 4CO4A 2QGFB 3ENWA 4Y6IA 1IO2A 2CPEA 3HVRA 5CCMA 4IJAA 1GTHA 4UOCA 3UKRB 2QSWA 3C15B 4KHPJ 1UVLA 3SFUA 3BM7A 1D3WA 3QGHA 4IBNA 1JMTA 2CYYA 2EX3A 3UB5A 1UETA 4B3SJ 4ILGB 1UVIA 4DTJA 2J0QD 3D67A 3AVNA 5EVZA 4Z94A 3AVCA 2J6TA 1RAGB 3N5BA 2IVYA 5C10A 4PKGA 4BRAA 5FIIA 4KHPF 3MXMA 4JRQA 3H2VE 3ISZA 3NGZA 1NDLA 3BR9A 2ZH8A 4WF9Q 5DO2A 3CD6S 1MMLA 1GMWA 3M2UA 3LPTA 5E84A 2R2TA 2XO7A 2D69A 3SSQA 5KFQA 3B8AX 4A8XA 2VFTA 1KAZA 4LT6A 3HTVA 2MTLA 5T41A 4B3RF 3J81Y 2ZWOA 1A7GE 1H7WA 4J9OA 3D1HA 4RWWA 2ASDA 3D45A 2VG5B 1B7YB 1HYSA 1X0FA 3NF6A 3GV7B 4CT9A 2OD6A 3CCVS 4EZ6A 1YAGA 1HKBA 4OMFG 3DDNA 4R79A 2QYCA 4NLUA 3PR4A 3GR1A 4HKQA 4M41A 2JFKA 1CQNA 2XMTA 3AAWB 1SL2A 1U48A 4RLEA 2AJ0A 3L2WA 5AQGA 1HI0P 3E2EA 2D0OA 2OYQA 3EE3A 3KZBA 3KJVB 5I3UA 1N6QA 4JKDA 3PW4A 2WVBA 2YX6A 5I4MA 3AY0A 3GZ7A 3Q8VA 1FVQA 3CIZA 2DEIA 3KDOA 3HJFA 4JP8A 3LOUA 4ID8A 2D4WA 2QEXN 1C4CA 3I9V9 3G6YA 3BSOA 2I38A 2VG7A 2IAJB 4QR0A 2UXDK 2B4PA 2OPPB 1Y64A 2H9ZA 2BM1A 1FX4A 1UW4A 2A6OA 2O3DA 1ZPVA 4PG6A 2BJ3A 3OA9A 1EP4B 1LKZA 2RDDA 4HCCA 1JLEB 2MKHA 1VK3A 2VHGA 3L2VA 4ANDA 4JV0A 1RHKB 3BN4A 4YR0A 3LM9A 5HVFA 2G2ZA 3VQTA 4ED8A 3FRZA 1Y10A 5HK4A 4HHHA 1B99A 4LFBF 2DR5A 4ZN1A 2W9CB 2MMYA 4DL4A 1BMQB 1C0UB 4O5BA 5GADU 1KFSA 3LUYA 4UF4A 1BL3A 3NVMA 3CCTA 3WC0A 1HHTP 2HF3A 2WW8A 3SQOP 3MWPA 2EFPA 1X8DA 1YHQN 1PILA 3BREA 4TLQA 3B4DA 2VJVA 1FTRA 4X4RA 3CSKA 2P9SA 3G71S 1TYQA 2EWSA 3KG4A 2D9PA 4WTYA 1RTJA 1JLAB 2HS0A 3KHGA 4CJEA 3LWLA 2XYGB 1AZSB 2F7TA 2LYVA 4AXIA 4O4RA 1CJVA 3DOLA 1JB0C 1YJ7A 2DJWA 3RR8A 1HWJA 3UD4P 4FZVA 3GG0A 3GG1A 2OFGX 1HPZA 1VSEA 4CH7A 4M45A 4K2XA 5KG2A 2PYJA 2XCPA 4C4WA 4ZN3A 3SAGA 2OTJN 2W6KA 4BGAA 3MOJB 4EMDA 2JEFA 3G6VA 3V81A 2JLGA 1X5OA 4N56A 4LBHA 3HKZD 2WHOA 3K7RA 2HVEA 2Y0BB 3AVBA 2G8VA 1JQGA 3H46O 4DPXA 2DGOA 5KI6A 2C28A 4HUGA 1X5TA 3BKFA 3RUBL 2ZBRA 2IVFB 1HD1A 2IGIA 1NG9A 1RT4A 1NSPA 1JX4A 3WBZA 1IQZA 4YNQA 3FK4A 4P75A 4OHXA 2PAVA 3SAHA 4ZIWA 3HRGA 5DZ7A 5C25B 5MLCQ 2DIVA 1RAFB 2HRTA 1GLLO 3TZZA 4BRFA 1R8PA 4DR7J 2A41A 3CC7N 1QTMA 2DRDA 3KK2A 1S1VA 2A18A 1NGGA 4EBEA 3UNYA 4K43A 2CJ9A 1RU1A 3GE9A 2ZE2B 1AFIA 1RT5A 2E9TA 1MW7A 5EDWA 4CNYA 1BQXA 3QDKA 3V9UA 2CZ9A 3TAPA 3W66A 3QICA 2FZKB 2KT2A 2CWKA 1FRHA 2ZOMA 4E2FB 1RA6A 3DGPB 4C0BA 3CFRA 5B0DA 4Y2IA 2Q6CA 2DTJA 4CH1A 1VK0A 1NHKL 2ADBA 2HNDB 2DNNA 1HWLA 1FHTA 4NLOA 2PO4A 1ZH5A 4FJKA 3R6MA 4WE1B 2E2PA 1U09A 4CZMA 4CJKA 4DWIA 1HI8A 3Q86A 1EZZB 3M2VA 3R97A 2HSEB 3QEWA 1RBVA 2KZZA 3PNIA 3AA5X 3T69A 3VAJA 2Z1HA 1VQ8N 2HQIA 5K14B 2YKPA 5E3AA 2UXDJ 4P2SA 3DLHA 2VU5A 3G8SA 3DLKA 3THYA 2J7WA 3VETA 5JLFA 1GOBA 4JRPA 4OKEA 4LSNB 3AJDA 1UAXA 4Y1CA 3R9LA 2DHHA 4YY3F 1EAYC 4KTQA 1GLBG 1BHLA 5KQ8A 2HVHA 2D9OA 4YB5A 2E20A 4RTFD 5GADI 5H9FK 2RAQA 3DRXA 2G8HA 5IFMA 2P9LA 2GJ2A 1LQ9A 2RRNA 2CJQA 3THVA 3ZEUB 4B1ZA 4OX9F 1EETA 1FDDA 1OSCA 2K06A 1WAJA 1U26A 4PR6A 5C2FA 3HCXA 1SJ3P 4XEIA 1JLCA 4IG3B 4QQBA 3W5ZA 3PW5A 2MYFA 4ZVHA 1LW0A 3T9ZA 2PIIA 2IDLA 2ZZMA 2BRKA 4QOZB 3MM7B 3ZZUA 1SBRA 4DMZA 1Q5YA 2J7UA 3IRWP 4J90A 3UIQA 2KKHA 4OYXA 4LRAA 1TYQB 2VA2A 2W7PA 1R31A 3CDEA 3RB3A 1JLAA 3CERA 4DL0C 2KG1A 1EARA 2Z2LA 4HWIA 2ZZTA 1UA0A 1YJNS 1D8YA 1Q95G 1EKEA 2CNOB 3M8RA 1FEHA 5E26A 1HPZB 2C2RA 1XERA 2NS1B 3VGKA 2GAHC 1KOHA 3UKUA 3QWPA 4CT8A 4DV7K 2ROGA 4DX6A 4IR9A 1WC6A 5C2DA 1GXUA 2HK2A 4OKKA 1M5SA 1U8WA 2XMJA 1VSFA 2NRTA 4C2MA 4OGEA 3W7BA 4NLXA 4Z0UA 2F7VA 2K3IA 4ZDNA 1JKHA 1VS3A 1T6DA 3ZX2A 2ZH5A 3OHBA 2RN2A 1WHWA 4HEA9 4F02A 2Q1LA 2O8DA 3FZHA 4NLYA 1DARA 2UUAF 3NCIA 3VN5A 4WWSA 1JNZB 2HHXA 3L3CA 4PKIA 3VMFB 1FFWB 2JDJA 4P7VA 5AE1A 3HPOA 4PPZA 3DGVA 4B17A 1Y11A 4DV1J 1KD1T 4U7UK 1KS2A 3JQJA 1B92A 2R7VA 4FLUA 4CLSA 3CC2N 1T6CA 4GKKK 3UDEA 1ZZFA 2ATLA 2XO6A 1ELOA 1E6VB 4OQJA 3QEXA 3BGUA 1SKSA 4OO1J 1FNOA 3O4NA 4O3PA 3CETA 4KH0B 4M1KA 1U6BA 4DV7F 5BYRA 1SXLA 2F8EX 4K7QA 4TLRA 3IM9A 4W98A 1UEUA 5DGAA 2V6AA 2YKMB 3IWNC 4JS4A 4W5NA 3O44A 1A5WA 2Y9HA 1S72N 4QWCA 4ANEA 3L2QA 1WHVA 4HACB 1I3AA 3K5PA 4KTZA 1U1QA 3AT1B 4DQ8A 3TUZC 3OJUA 1VQON 2IPOB 4CRJA 4B3TF 1UVNA 1RKJA 6FD1A 3MEDB 1DURA 3O1BA 3L2UA 2CJYB 3QIPB 1X7VA 4LQ3A 5RUBA 3Q2SC 2E5LK 2IOCA 3HMJG 5E7OB 1NHUA 5LOQA 4BC5A 4BRGA 2VPYB 3KKFA 4W4MA 1V3ZA 3AO5A 2Y1JA 4YB7A 4MIBA 1IVZA 3CO9A 3R1XA 3OYFA 2I6WA 3BJYA 5KT7A 1ZBIA 3P49B 4P2MA 3S7RA 3PYGA 2GC8A 2IVMA 4XH4A 3ZEUA 1ITPA 2BH1A 4FJHA 5KFSA 4C9DA 3UI3A 3AVJA 3FQKA 4I2QB 3ITHA 4DL6A 3AAPA 2EHGA 3SMPA 3U1MA 3DLGB 3TR8A 2ZBCA 2Y8WA 3O3GA 3I4HX 4JYAJ 3K8WA 1ASVA 2OZSA 2Y1RI 3KHHA 1E6YA 3CMQA 4F0MA 2UUBF 2PT0A 1EIYB 4FK0A 2J9CA 2YHBA 2ZH1A 3LDSA 1YVUA 5GAHP 3HHLB 3JSBA 1LXNA 1F2GA 4TQSA 1KVIA 2GIQA 4O5FA 2N4CA 3A8JA 4PXCA 2IM0A 2PA3A 3B6BA 4FCYA 1LWFA 3PCOB 3EZUA 2EXUA 3I96A 3K5LA 4OZ5A 4KHSA 4XO0A 4NI2B 5LL6Z 4MIAA 2YNFA 5EWGA 3CCES 4RW4A 3TUJC 1I6JA 3CEDA 4L3KA 3GIJA 2Z0GA 4JHDB 4GW6A 4RNFA 4NWBA 4H4OA 1TK8A 4Z4GA 2HFVA 1O1WA 1NSAA 3QSIA 2IA0A 2ZM6K 1JKHB 4MLHA 4ED4A 1IXKA 4F04B 4ECYA 2EBEA 4F4AA 2LQBA 4C3LA 1OY6A 2P9KB 1XR6A 1NU4A 1PGZA 3IXQA 2VBYA 2O8BB 1SJ1A 3M9OB 4YDDB 3D6TB 1FJEB 4OI2A 1Q81T 1Q82T 2FVSA 4HI2A 1AT1B 5BYQA 3BGLA 2RILA 2W2QP 1KQSM 2EI5A 2DCLA 2IYIA 4CCHA 2E2QA 2GGPB 2LXFA 3V9SA 1S1UB 4GKKF 3ULEA 4JI1K 4DSLA 4PHTX 1V3SA 5C24B 4KSEB 2K2PA 3R7BB 3I5BA 1Q18A 2ZGZA 4H4KA 3MD3A 1U4BA 4OX7A 4J37A 1N36J 1ULRA 1FNXH 5AQZA 5KT3A 3OYJA 3LPUA 1HBUB 3HSJA 2JL9A 1UZDA 5CZ1A 1RYSA 4DR6K 4ZCMA 3ZSVA 3VZHA 1UKUA 2O4IA 2ZUGA 1NSKL 3HPHA 1WELA 5F3TA 3OTOF 3GV8B 4IRDA 1MWMA 2R2RA 3OY9A 2WCXA 2C2ZB 1RWPB 3CYMA 2NPFA 3CC2S 5L9NA 2HNYA 2NUHA 4YUDA 1HBNA 1M1KT 3N4PA 1P27B 2IM3A 2CJKA 2F9DA 1S99A 1Q86T 2H65B 4M63A 4OJHA 3DNCA 1CEZA 1Q0NA 3NGYA 4NOHA 3LAKA 4WXOA 2XSJA 5L1LA 1J2VA 5FPNA 4OIXA 3QRRA 1VQ8S 3VERA 3LA0A 4RNNA 1GXLA 3R5JB 2PMHA 3WC2A 5F0WA 1NDCA 4NXMK 3AO1A 1RU2A 4LF4F 2LEPA 4NLCA 2RHSB 4KHNA 2MPUA 2G2YA 4WP3A 2UVWA 4ZHRB 5AQRA 3ZT2A 1ZBFA 2AZ1A 3UCUP 3F2KA 4OLAA 4U9RA 4CK2A 5A76A 3CB4A 2MKIA 2HVIA 3OBWA 5GAEP 1WHYA 2W2OP 3AHPA 3CJAA 1TMMA 1S1TA 1WEXA 4ZS6A 1UA1A 1HBOB 5EUHA 1HNZJ 2BACA 5AXNA 1N8RT 1D5AA 3H3OB 4F0KA 1HNXK 3DXMA 1TVRA 1JJHA 4AHCA 4BR9A 4FXDA 3NGDA 4B3OA 2GHPA 3W2WB 4DKWA 1WF1A 3E51A 2L9NA 1YITS 2D1KA 3MTKA 4QYZJ 3NBPA 3I55S 3IG1B 5KQDA 2VCPA 3R8EA 5HJYA 3MFHA 4DV3F 1A6LA 3DDIA 2YNIB 2GMLA 1IKVB 1J5EF 1S6UA 1JWWA 4LRDA 1ZBLA 2NREA 5GMDA 2JGUA 1U25A 3BZQA 4AF1A 2LQ5A 2P9CA 4K4XA 5LSOA 3OTBA 5KFMA 2CFXA 2MKJA 4C8MA 2IVOA 3TZXA 2WZ1A 5HBMB 5D3GA 2ALYB 5BPLA 2V67A 2P9KA 1XUPO 2ZH9A 1WUUA 3MMAB 3OUYA 2IIRA 4LF6J 4J9VA 1LFWA 4FYYB 2QTDA 1S0MA 4OLOA 4CYUB 3CCUN 2Q66A 1RBTA 2XGPA 4X4UA 5DQGA 3WXKA 4CZLA 1F1BB 2WUSA 4IOCQ 4OZLA 3BGRA 4Y2MA 1DY3A 3QT7A 1VQNS 3L8BA 1VC6A 4IO1A 2VASA 2GW8A 2ZH4A 1JJ2M 2GFFA 1WEZA 1ZC6A 3C0BA 2QMUB 4C8NA 5THWA 3ZYYX 2QKKA 3U7JA 3NGIA 2KVQE 4LMZA 1LWEB 1HYZA 1HBUA 5B7WA 5IWAJ 2VZ9A 4JI1J 1B9DA 4FLZA 4WU2A 3P4IA 5A8KA 2VONA 1HUXA 5HI7A 3NWRA 3AA2A 3AVAA 3OHAA 2MZSA 1ZM2A 3K9KA 4JN4A 2CKWA 1ACMB 4FZZA 4X64K 4O44A 3D6FB 4Y0WA 1S3XA 3M6GA 3GCXP 2IBKA 2CVIA 1HW8A 1N5SA 2CH6A 1C1CA 2VUGA 3ENAA 3ZT4A 2VKZG 4CFBA 1U1OA 4K4SA 3HOSA 2X1BA 3OTOK 3J7YU 2JWNA 2QA4S 3I0RA 3Q0AA 3NMRA 3DYAA 2QWRA 4M63C 2EK1A 2VDIA 4DTMA 2CGKA 3OVNA 4CIOA 1TELA 3K5MA 2HQGA 3BKTA 2F8TA 5J2NB 2B9WA 4UY8O 3CGIA 3MWBA 2O5DA 4WFZA 2VD3A 3PV8A 1IBKJ 1ATRA 3WX8A 1PYOB 3R5AA 4K4WA 1VISA 4ES3A 2X6SA 4H0XB 1J53A 4KFBB 4WFNL 4FJ5A 2AEJA 4G65A 1NLKL 3CPWR 4K0KJ 3MR6A 1YJWN 3GIIA 1JXLA 3A8YA 2R8IA 4BROA 3OYDA 4DTXA 3VQDA 1VHXA 5ETRA 3W9JA 3FSIA 2AA4A 1XN9A 2ZD1A 3C14B 1S1TB 1VIOA 1EQ0A 2VBWA 3T1HF 3V9WA 3QMQA 1TL3B 1U2VB 1K8KB 2FJVA 1BLUA 1FWPA 4CLUA 1NNDA 5IC6B 1TKZA 1GEHA 1VSHA 5KGXA 2QK9A 3T3FA 1TV6A 3HF5A 2A6MA 5KFDA 3T19A 3FMBA 3UNGC 1C4AA 2KDOA 1HNWK 2Q3PA 3IR5B 3W61A 2R7YA 5L38A 3L7OA 3PW2A 2HBQB 2BJ8A 4EI2A 2ALZA 5KG3A 5BXIA 1SUQA 3NKYA 1NU0A 4USIA 3EY1A 1X3NA 1XHZA 2X7IA 3BQ0A 4FWQA 1Q7LB 4NCGA 1Y3KA 2DFFA 2J9DA 2M7SA 2NQPA 3ZTQA 1KAYA 1NGCA 2FVRA 4FYXB 3N6NA 4RZRA 1NZ8A 4YB1P 4J9UE 1RGIA 2F8SA 2WOMB 4Z4FA 4KAZA 4EZ9A 2GQCA 5J1PA 3VQSA 1NH7A 3ZX3A 3NFAA 1FFGB 4R0JA 3FCVA 3P8BB 4U8YA 3BYPA 1H1VA 4CGFA 3VF4A 3DJCA 4FKXA 3CQXA 3CD5A 1S48A 3DRPB 3NG8A 1DQ9A 1C1BA 2FF3B 3R8YA 4DTPA 1EP4A 2HQ3A 4CJ7A 1VQ4S 2DR8A 4FJ9A 1N34K 2FHJA 1YJ9N 3JTNA 1Z4UA 2BA9A 1BG3A 5EXWA 2I5JB 3GFHA 2MLYA 3KUGA 5T7BA 1ZETA 2ZDPA 3ENOA 2KXNB 2KHDA 2L48A 2OKQA 1FJGJ 4CJTA 4E3SA 4W5QA 3V6JA 3THTA 4M3WA 4J9RA 2FDNA 4FM0A 4PEOA 2P9SB 3NF8A 2DGWA 1WACA 3DLEA 4YFUA 4FS2A 2CPJA 4TU7A 2GJIA 1RT7A 5CYMA 1RWMB 1RT3B 1RB0A 4IG3A 1N56A 1K1SA 4IH6A 4X64F 3H8YA 5K8PA 4M42A 1T9UA 3NMUA 2QN6B 4CD1A 2FC0A 2JOQA 4DV5K 4OYBA 1FXDA 2CA9A 4F3OA 4CD3A 1QQMA 4UOGA 2OD4A 1B0VA 4FS1A 4DFKA 5LXRA 4L74A 5CA5A 3BBFA 4AILC 1K0TA 1S6QB 5DG9A 2FB0A 4LF5J 1KQKA 4JKCA 2XNQA 2AWZA 4LF8F 4ZTFA 1LEOA 2ZBQA 3E1YA 1BDGA 1Q9XA 3S3MA 2I8EA 3NF7A 1FVSA 3N01A 4E1NA 4QR2A 3C16A 5AXKA 4C98A 2CXEA 2P5OA 3M8PB 1TZ0A 5HMZA 1NHVA 3TW0A 4PYDA 1X9SA 2E1ZA 1BWFO 3M8ZA 4F4XA 4DR1F 2F9JA 3SK3A 2KYXA 3EWGA 3K17A 4K5SA 3PO4A 2NZCA 3QBXA 2VH7A 3BPDA 2QLWA 3QZ8A 4K4UA 2F96A 4DHVA 4CJUA 4LSLA 1LFPA 1SIZA 4ZKAA 5D4LA 2X1GA 3E9PA 1S1VB 2WONA 5D0HA 2DNHA 2ZM6F 4X65J 3SCJE 3CHWA 1NPPA 2AEMA 4CECA 1FRIA 1V5IB 2UUCK 4IO9L 9RUBA 3OHRA 5KFXA 1TKZB 4HI1A 2J8SA 2CH5A 2RQ4A 1FRLA 4BC4A 4FLYA 4PQUA 4J5OA 1MDUB 2W2PP 5D4NA 2MQOA 1SV5B 3A5LC 3AO4A 2ETJA 3NS6A 3K58A 4ZVPB 3PSIA 2W25A 2K7KA 5E3CA 4OPAA 5H9FJ 3AVIA 1N32K 3DLJA 2EBGA 1TKTA 4P52A 4ZP7A 2IVPA 2P2CB 4QIEA 2UU9J 3W0LA 2X51A 3W8PA 2HMIA 1HNXJ 1RSCA 2GO9A 4Y34A 2J6UA 2DHGA 2OEKA 5IV4A 3E01B 4F4ZA 4W5TA 4WXWA 4C8KA 2N3OA 3QO9B 4WK3A 4IEEA 4O4GB 2KKZA 3MEDA 4JI1F 1UJ4A 1EQYA 3OFFA 3PVXA 3O2IA 2YWGA 4HR2A 1R43A 5HROA 2EG1A 2HFNA 3ENBA 3CXCM 3QNNA 1XR5A 3M32B 2HSTA 3GSDA 2AD9A 2Z8QA 1QAJA 1N34J 1T05A 4FJJA 2W1BA 5CY4A 3PJWA 3DU5A 1RGVA 2B5JB 3K59A 1SC4B 3RMAA 2GS8A 5D78A 2WB4A 1BA0A 3V2UC 3IFRA 2BJEA 3NMAA 4QU6A 4AYBD 5KFJA 4DF8A 1GX5A 1J5EJ 1REVB 4F4WA 3L3UA 4A4JA 2DRBA 1TAUA 3K0JA 3FSXA 4CJPA 1WJ9A 3HHEA 1CJUB 1T9VA 4FNIA 2HFZA 2J7KA 3I87A 3TNVA 2BJ7A 2ATQA 5J1EA 1MMNA 4RUCA 4YOEA 3T41A 4H0OA 1MA9B 1HRHA 4QIWD 4CO2A 3KLGB 2IC3A 3NNHA 3HVWA 4NLPA 1JLBA 2ZOGA 4OZ2A 4PKHA 4M3ZA 4DUTA 2FZCB 5GAHI 2FJXA 3HHLA 1K44A 2KN4A 5KTQA 2HVZA 3DLRA 1IBMJ 2IM2A 4IZ9A 2JWLA 3KJQB 1G15A 5I9EB 1GOAA 2XULA 4LH4A 3VA0A 1JL1A 2HAIA 1IJEB 3ZZRA 3TSPA 5F8JA 4PRFA 2JEGA 2C1EB 1T9YA 4MLEA 1S77D 1U1PA 4GKJF 1VQ9S 1RUSA 3SQGA 2QWMA 3UVJB 4OI0A 5D0RA 4PXEA 5F8LA 4B3MF 3U02A 2X1FA 3UWTA 3RB0A 2B3TB 2YWWA 2OPQA 4IYQA 5EHHA 1HFEL 2DITA 4JS5A 5AXMA 4UZCA 1NB2A 2YBVA 2RS2A 5KFUA 4BRNA 2M9KA 3F9KA 3VGSA 2CAJA 1HARA 5D8HB 3WUHA 3LL3A 2R7QA 3QJJA 1WC3A 1YJWS 3P1GA 1WSFA 1YUWA 3OYIA 4KI6A 2GVZB 5SZTA 3ZZPA 2IJNA 5A8RA 1HD0A 2W9BB 2KM8C 1NOZA 2AW0A 3FCHA 2OO4A 2N82B 3IP0A 4NA2A 4PWDB 2HS4A 2YHAA 3D6RA 5CCLA 3MMJA 1A0OB 2HEKA 1KVBA 3J81U 4DV1F 2MQPA 2JX2A 4KTWA 3TJ9A 4ID5B 4I1TA 2O67A 2MHEA 4LIRA 1CXUA 3QBWA 3QNWB 4KHWA 4NYOA 4LBPA 5HLFB 3B78A 3I6PA 1AUDA 2DNYA 2VIHA 2AF6A 3W60A 3SYZA 1PBUA 2PMZD 1IKWA 4J8FA 1LAWA 3CPEA 2Z2MA 4HVZA 1WC5A 4PXDA 3WZ0A 3VEZA 2XZDB 2QL5B 2H3EB 4PCQA 3V6HA 3LDNA 3HT3A 1BD6A 2AV5A 1XC9A 4F7VA 4YR2A 3CCSS 5C2GA 5AQUA 3AQPA 2GX9A 3CJ5A 4BGBA 1R0AA 2R7SA 3WXLA 1KBRA 1FCAA 4ECWA 3TVZA 2DHAA 3ITHB 3CD0A 4PG8A 4DR3K 1YBUA 1KC8O 2FLOA 2FD2A 2L9WA 5D15A 4YR3A 1VBXA 3QMLA 2O8EB 2FJAB 2DHXA 3D1QA 3H59A 1KVCA 3J7AN 5B0AA 1NJIO 3VGVA 2GA7A 1R8BA 4GKJK 4H8KA 1UCNA 5ETVA 5AQNA 1I39A 3LF0A 4QW8A 4Y65A 4CI0B 4MKYA 3JAMO 4KR0B 3V9ZA 2XWYA 3A3OB 4P2FA 3C46A 4CERA 1VQ4N 2OMOA 1RFQA 3O8MA 4FJ7A 1QE1B 4I9QA 3MD1A 3TAGA 1D0EA 1OWXA 2PSZA 3TVKA 5HRPA 2YNFB 3NLCA 4KBIA 3C3LA 1HKAA 4NLRA 3OS0A 1BCOA 1GLJO 2KW4A 3AB2B 4LQ9A 4WTOB 1PSDA 1EX4A 1BUPA 4QWEA 3MN9A 1WC1A 2M8DB 1APSA 1BC6A 4H4OB 4RO0A 4TY9A 1NJXA 1NDPA 4DU3A 4WF9L 4DG1A 3F44A 2QX0A 1A9NB 4OX9J 4DI6A 2U2FA 4U95A 4YY3K 3AODA 4LUBA 4FJLA 2YHWA 3Q7CA 4W92B 4LC9B 4I56A 1ATNA 4FK2A 4LF4J 2VOOA 2A5XA 4WJBA 1F21A 3CJRA 2ZC3A 4G1PA 2ZF5O 4QCLA 3MM6B 1IKVA 1HMVB 2LXIA 3FBBA 4H4KC 1OKJA 3HPGA 1XNRJ 3BH6B 3FBFA 4LF1A 1ZAXA 1WOSA 1QZ6A 3M1FA 2RH3A 3W2VB 3KLFB 3KLEB 3J7Z5 1WOQA 3EVMA 2HS3A 2MZQA 4FPIA 4OYZA 4FLTA 2UXCK 1P90A 2BQUA 5IT0A 1IBKK 1YRUA 5GINA 1O5JA 4ZJLA 2LDIA 2ZH7A 3QT8A 1T02A 3HD1A 4TQRA 5FLXO 3LZJA 1X9MA 4MDAA 4OZJA 3N4QA 2OUGA 1UVJA 3MUVP 2P1JA 5F9LA 4ZVFA 2PBDA 1FDNA 3O3HA 3UPFA 2RSQA 4HDGA 3NCPA 4C0OC 4DV3J 3QRQA 1JCEA 4L73A 4M5JA 3O80A 3MECA 4PL7A 1IBCB 5EX0A 8RUCA 1XNQF 3TSQA 5CZXA 5D0EA 4N47A 2UXCJ 1W26A 3MDFA 4I2PB 1G4CA 1IWAA 2YNGA 2ZJRQ 2MZJA 3PG9A 2MJNA 3CJBA 3MEEB 5I3QA 3QT5A 1N34F 2XSJB 5JMNA 1IKYA 3I5AA 1J5OA 4O44B 2R4FA 1NO8A 4QWBA 5KPZA 4ZVGA 1RI7A 2FBYA 4ISEA 1S12A 5F3ZA 3U4LA 1TFYA 3OV7A 1T44A 4CF1A 4CIGA 3TEHB 3E3XA 1WC4A 2G8UA 2FY8A 1KKHA 1R0AB 1NGBA 1OYDA 3HJVA 5FPDA 3OFHA 4DV5F 4HT5A 4MH8A 3CC7S 4WP9A 2DGSA 4MMOA 5DRKA 3A8KA 3PJ9A 4RPFA 4DS5A 2HIQA 4X65K 1SI9A 5HP1A 3NWGA 4NRTA 3DU6A 1LK5A 5A6WA 4AHVA 1D8ZA 4Q43A 2A40A 3GIMA 2GNKA 2AJ1A 4BRKA 4DR3J 3ZTSA 1HJRA 2QW9A 3LALA 3C66A 3FEZA 1HWUA 1RT6B 2CJAA 3MCPA 2JWKA 3IAS9 3KLIB 5LL6d 2E1AA 4FF2A 2KHOA 3CJ9A 1U0HA 1QE1A 3G86A 4NA3A 2MKCA 4CDIA 5KFHA 5AJ3F 1ZXOA 1NMDA 1U2CA 4LRBA 1VMBA 2AJ4A 1E4GT 1S10A 4DCHA 2JNJA 2V8DA 4MYUA 4ZK7M 2KFZA 2B9YA 3TAQA 1FF2A 3C6HA 1N52B 3VWSA 4ALZA 4WIIA 4FJ8A 4LVNP 3UE5A 3DLBA 3H42A 2E2OA 3H6EA 1NGFA 3H1QA 4R5PB 2AP1A 4CLTA 4RW8B 3M8SA 4TNOA 4EP4A 3L7UA 2B8PA 4JKBA 3M9MB 1S9EB 4K0KF 5AXLA 3JAMU 4IOXA 2IJRA 3CCJS 3T1YF 1NK0A 1I1GA 3V4MA 2UUBJ 1HNVA 3CFOA 2UV8G 5HQMA 3LWMA 3SJJA 2DVIA 1R89A 4KIAA 2EW9A 3PW0A 4ZCKA 2IS3A 3ISND 2KLAA 2E5JA 3OTCA 2CPFA 1M1GA 3DM2A 2VG6B 4KREA 4H0PA 4CIFA 5KFLA 4TYAA 4I67A 1VQKS 4CZFA 5KG4A 3E9OA 1H2VZ 1FT8A 2V9WA 2HBKA 3I55N 4LREA 2VG7B 3HSCA 5BREA 1WEYA 3AA3A 3AXMA 3M30A 4M5GA 4QS9A 2H4YB 2YX7A 3KHLA 1H72C 1WTFA 1M5PC 4DUZK 4FN5A 1W0HA 2EVZA 3CCUS 4H5WA 5K8MA 3Q8PB 5DS7A 4X4QA 1NMNA 4J2BA 3CJKB 1IKXB 3VEVA 1S5JA 4E1JA 2ZWHA 4MO5A 1OVYA 2R2SA 5AQHA 3VQBA 4ENOA 4IFEA 3J7A1 2A1BA 4USMA 3HT0A 2Q0RA 1HNWF 1UPPA 3CUNA 2C3UA 3VGUA 4J9LA 3SCKE 1R3NA 1S9GB 2KVIA 4YHHK 3GBTA 3PIOQ 3UKRA 3POTA 4CFAA 1QQOA 4ZP6A 1D4XA 4C11A 1NJWA 4FWOA 3KYLA 3R7NB 1DQ8A 4IOBA 2E7VA 3BF1A 3CMEN 4NZ6A 1M90O 3MM9B 4ETZA 3FBCA 4LFBK 5DM7L 3WX4A 2GIFA 2L3MA 1XMQJ 3CCMN 2CVEA 1CJVB 4Y2AA 1NGJA 5HOOA 1RTDB 1KAXA 1F9FA 4J9NA 2VJUA 2J4RA 3U9DA 5JVGQ 1GMUA 3C7NA 2CZ4A 3QRPA 2IBOA 4IDKA 4DLEA 4XPCA 5IT9O 4YDUC 2VQFK 3W3DA 3QJPA 4ZLPA 3PX6A 3THWA 4IRCA 1HQ2A 1LAVA 2OA8A 2KQ2A 3QGIA 1HBMA 3V81B 2PN6A 3GILA 1OY9A 3CXCR 5F0XA 1ROFA 1X60A 3A12A 3IBCB 1V6HA 4QPXA 2D41A 4BCAA 1RJJA 3ENHA 2V7YA 4JI0F 4NCGB 2QA4N 2LQ8A 4CO3A 2ASLA 3CG7A 1BXNA 4ECTA 4CJWA 3N79A 3H2UB 1QVGM 3H25A 2E1RA 4LF8J 3FCWA 4WZQA 3AJ2A 4WFBL 2HWHA 2HNZB 3BY5A 2QL9B 4FL9A 3GDQA 5K8OA 1U1RA 5B0GA 1ATSA 2UUAK 4M5NA 1NKEA 3KKSA 4RJVA 2IDEA 5A8WA 3RMDA 3SDEA 4BG8A 5KFBA 5DDPC 1JIHA 3HSGA 5CYQA 2WK4A 1VQ6N 4BE2A 3S01A 2A0FB 2AGPA 1NMEB 2V9KA 4TYBA 3TA1A 3ELHA 1PBAA 2VICA 4JYAF 1TK5A 5F8HA 4CLWA 1YQHA 3F5TA 1CXQA 4RWTA 4L6V3 3OBIA 2LEBA 4A61A 3BBBA 1OVQA 2BW2A 1D9DA 5BYSA 4OHWA 4H0YB 2DCUB 4MFBB 4X66F 4BR7A 3TWHA 1KN6A 3M1VB 5CQGA 3JYTB 3NAHA 3CCLN 4ILMA 2CG8A 1FK9B 1RCXB 1Q53A 3MMCA 5IM0B 1RHJB 5KFKA 1HR0J 1BI4B 4FO0A 3NEKA 4NYNA 1UVKA 3M8YA 1HHQA 1UJ5A 3GSIA 1FRMA 2Q79A 4LR9A 3BO2A 2ABYA 3KJFB 3N6LA 3GWCA 3CIMA 4Y28C 1U0SA 2F8HA 3G6ES 3RJMB 1VIXA 3HBTA 3D7EO 4F3QA 3DRSA 2GBZA 3CCSN 2YJFA 4KQZA 5JS2A 3RSEB 4DCOB 2V94A 1VSDA 1QVGR 2K1RA 2UXBF 2XZTB 4CHZA 1RHQB 1WG1A 1LNQA 3PFOA 3ULHA 3K89A 3M6UA 3P39A 4F36A 1FO1A 4LF6F 2KXHA 4NXMJ 3TQ1A 2FBXA 2VFVA 2YKNA 2D0CA 4O8KA 3PIPQ 3O4QA 3TSUA 2JSXA 4PA1A 3ZLJA 2GMJA 2OELA 3V6KA 2MQ8A 4Y2CA 2MJUA 1RBOB 4HCBA 1XQIA 4LRFA 4RW4B 1Q79A 1YGYA 3POTB 1X4CA 1R0BG 4KB1A 2IRUA 4F3TA 3SMSA 5HANA 3IRXB 3EGNA 4DQSA 5KFAA 4J2AA 1UWBA 4QR1A 4CF8A 2RE2A 2VB6A 3MURP 1L3KA 5KAKA 1OQ6A 4OYPA 3OSPA 4ELVA 4X84A 1KDNA 3C2PA 4C1NI 4DR5F 3ENVA 2V2QA 1RTDA 5IT4A 2R7OA 3C7NB 2BJDA 2XZWA 1C0TA 1NGEA 2BE9B 3THWB 1AW0A 3WNGA 5KT6A 3IBWA 3LM2A 4ZPTR 4CJFA 3QJLA 4ES1A 2BABA 2ZBIA 1TUYA 1NZAA 3OS1A 2JJ4D 4WP8A 1NNEA 3TANA 2GV1A 4I4BA 3MF5A 3OTDA 5HMWA 3VQ5A 2MKKA 2XLKA 3ZSRA 2Z57B 4JI0K 3U3YA 1JJ2R 3M2RA 3SI6A 5BR9A 4OX8A 3CT9A 3BZKA 3BKUA 4I0WA 2AHOB 3A0IX 3LDQA 3C19A 3MN5A 1TKTB 1BY9A 5DLGA 4NXNK 1VQ9N 2FVPA 3PACA 2H5EA 4YEAA 5LMUJ 3KDNA 3K2YA 2I9SA 3GV5B 3BYRA 2QL7B 2BOPA 5KOXA 1PYSB 4EO6A 4MKAA 4FNHA 5KFCA 1S6PB 2MHNA 4F2SA 1BA1A 5BN9A 3LTOA 4A5AA 1MU2A 3SNNA 1K73T 4JBCA 3TWZA 5FLXU 4DFPA 4NA1A 3ENQA 1P6TA 4RR5A 4ZPDA 3OR1A 4DN9A 4LFAJ 3JQMA 3V6DB 2FSNA 5IWAK 2UU9F 2KJWA 1KSPA 1X4EA 3Q7BA 4Q0BA 2Z2ZA 1Z05A 3T1HK 4CK3A 3SCXA 1MWYA 4OHYA 3AVFA 2GZOA 3CCZA 3RG6A 2Q0UA 4DMNA 4J2DA 4ECQA 4BQLA 2LLZA 4L3QA 4M5LA 1RT1A 4IKAA 4PPDA 2FY1A 3CO0P 3SSSA 4KGKA 2QC3A 2OTJS 4OYIA 4CH0S 4XH5A 1VQLS 2BE7D 4WIQA 3I0SB 1TL5A 4LF9J 4IFVA 5J1EB 1NOYA 3DLLQ 5C7PA 4C1NK 3VGMA 5FDLB 2KZMA 1G2EA 3G25A 3MN6A 1VDHA 2NXCA 2E5GA 4A59A 4K5RA 5BRHA 1XHXA 3QAUA 1Q81O 7FDRA 3W2WA 1HW9A 4CBWA 4DR7K 4K2JA 4FSVA 4Y1DA 2XLJA 2HBLA 1S1WA 3LGNA 4A46A 4E89A 4HUFA 2P9GA 2E7WA 2DK2A 2NYIA 5K9FA 1KOOA 2KO1A 4NO7A 2UXBK 2NRWA 1MWQA 4HLBA 2PEHA 1HQUA 1IR1A 3DXKA 4DL2A 3Q8SB 1VQSA 3FZBA 4NZ0A 2MLZA 5HJXA 1RISA 1RBUA 3X3UA 4DN0A 3QPIA 5AZJB 2YTCA 3VTHA 1GLAG 2Y1IA 2YKQA 4UW2A 1AB8A 3MAHA 4LF2A 2IY5B 1B3TA 3CCVN 3W3SA 2OANA 3JS6A 2LVWA 3HHKA 3HSDA 2LQ9A 2F63A 1RK8A 2RT3A 3SV3A 3ICLA 4PG4A 1MWKA 1H73A 3KWGA 3A3PB 3MM6A 3IBFB 2F4VK 2HGNA 2HHUA 3A2FA 2MGZA 3U9ZA 3ZETB 3BGRB 3W2VA 2HRYA 4MK7A 1J27A 4FWNA 1NCLA 1DLOB 4JI5J 4KPYA 4QJVA 4CNZA 4WFAL 1QHTA 5IXUA 1D9FA 1QZ5A 3FLCO 4KGXB 4IQXA 3EXCX 4ZVOB 1U2RA 5FD1A 4M5DA 3EZWA 1ZYQA 2HLTA 1DTQB 4NMLA 3L2RA 3AARA 4N8OA 4BE0A 1S76D 1FKOA 1XMOK 1P9QC 2OPPA 1SQEA 3NGUA 1YJVA 2W2MP 4CZEA 4R0EA 4F67A 1KQFB 3OL8A 2LXUA 2DNMA 1X4AA 3EDRB 5C24A 3VESA 1FNMA 3G6EN 4Y2KA 1I94F 4J9QA 1F3FA 1P9YA 1VHFA 2CG4A 2JFDA 1OH6A 2HHQA 3OYLA 1JLEA 2CQIA 4DR2K 5BRDA 1VSMA 4RUBA 5ETQA 4GO5X 4CO1A 4QYZK 3BB5A 1S1XA 1OYEA 3U1NA 1CG2A 3DHWC 4JKHA 1RILA 1M1KO 2P6SA 4ECVA 4FWPA 1X4HA 3OQ2A 3FFKB 4N8NA 4USTA 4Y00A 4RWXA 1J5OB 4FDFA 2MY7A 3ZNJ1 3KLVA 2G1HA 5DQHA 2QIFA 2Q6BA 4DR6J 5CXTA 4FLXA 4OYAA 1GXTA 3WNFA 1RBRA 4A2BA 4KFBA 3TZYA 4LF9K 1GK8A 4Q2MA 3CJ1A 2VDHA 3V1QA 3P83D 1S79A 4U7CA 3GJTB 2XI2A 4L75A 4AE5A 1XR7A 1FKPB 2FHKA 3PX4A 4NLBA 2FZGB 2E6MA 2AGQA 3QQCD 3D9BA 3AJ1A 2CNLB 4P73A 2A42A 2XTJP 5IV3A 4BR0A 1RDUA 5K8NA 3KHYA 3J80Y 4P71A 5KFEA 2DYAA 1W97L 1VSLA 4L8RB 2BANA 1GOCA 1TV6B 1SJFA 3AVKA 2VV5A 5DDOC 2FGCA 2QLBB 4M3TA 4S0MA 2V8GA 2BGGA 2PD1A 2RE1A 2YWFA 4IRKA 3Q22A 1IR0A 5JXSA 4CBXA 2PI4A 4XIUA 1B0TA 3AA4A 4Z4HA 2RRBA 2VFUA 1U0HB 2RHKA 1Y00A 1HBOA 4GMJB 3NXZA 2J0SD 4MT1A 4AHTA 1VR6A 3QEPA 3EKUA 1ZTWA 1CC8A 3JSMA 1S22A 1G6BA 5EGYA 1M1HA 3LGHA 2FC9A 4AFFA 5KG7A 1U49A 5TKYA 2DFHA 2IRYA 4B9NA 2QT7A 2BX6A 3LAMA 5AZIB 4ZMMA 1E4FT 2IM1A 2QSFA 1OJ4A 4YDUA 1FX2A 5AT1B 3KMQA 1DTTB 3T6BA 1O6XA 4DPYA 4EUVA 1RAHB 2AJQA 3CDBA 3VQCA 4ILHA 1NK6A 3MXIA 4KRWA 3LP1A 2JEJA 2P9UA 5AQYA 1WSJA 4K41A 4EO8A 1K47A 1N32J 4ZPVR 1RDDA 2CADA 1URRA 5D3GB 3FZMA 4XDCA 4C8LA 5SWMA 2XMAA 4JI6K 3OYEA 3R2DJ 2BKNA 5IC4B 3OTEA 2M2BA 5ETNA 4BC9A 4DX8H 5IQQA 2Z1IA 4DV4F 2JC1A 3N9UC 1ESVA 4V19J 5M1FA 2VPXB 4YOYA 1SH2A 4TVAB 2ZJQQ 4LFAF 3CCJN 1RT7B 1TAQA 2HBZB 1TU0B 3VEXA 2CDRB 3T1AA 1FKOB 2ZVIA 1FRKA 3MEEA 2QEXS 1N88A 1RHRB 3TUPA 2XHCA 2YV0X 1BQMB 2F65A 3SAFA 1WHXA 4A47A 4MJKA 4IG0B 1W25A 1M90T 3GB0A 3VQ4A 2G4BA 1R7IA 2DH7A 3NAEA 4ZTJA 4FXVA 3LPYA 4A8OA 5G4DA 4FM1A 4MAKA 4DTSA 4N7TA 2P9PB 4M95A 2XS5A 3J7ZO 3A3NB 1YXQA 2RRAA 4ZVSB 1XNQJ 5LJVA 2HW3A 2EKYA 1S6QA 2KH9A 2UVVA 2R7WA 4NE9C 3G71N 2R7TA 2BR0A 3OYKA 4BRHA 4TKTA 3HZ6A 1YDLA 2X3DA 4O55A 2C2KB 1RAIB 8AT1B 1RWOB 3H45C 4BHQA 5H9EK 1RHUB 3L3VA 4O3OA 3TJ8A 2RF2A 1EX8A 2DGVA 1QUPA 2FBVA 4EIAA 2YY3A 1PJ5A 4KJIA 3S6EA 3QWUA 1RNHA 4CLKA 2XQCA 3OW2M 2M52A 5BR8F 2KT5A 2OGUA 1LW2B 4RU2A 4FBTA 2I7NA 4AHSA 1BWVA 1XI1A 5J2NA 1FWKA 9ATCB 4X4OA 3KD5E 2HYIB 3MMVA 3BV8A 2GIRA 3GYNA 2E5IA 3KK3B 5AQLA 1N0UA 4FJIA 3AA9A 1I5OB 3ZSQA 4CLFA 1HHSA 2MXYA 4AQYF 1EQMA 1WOPA 3IG1A 1OQ3A 4RW8A 2XG8A 1XMBA 4CJQA 4JI3F 2OMLA 5HAOA 4GVEA 5AQMA 3EMTA 3PUFA 3NGKA 3ILJA 3CVKA 1LK7A 1VBKA 2XHBA 3OBYA 3KJNB 3BF3A 2OP5A 1BGXT 4K8XA 3ZZTA 4CJ5A 1VGYA 3TAEA 3HHDA 2D1CA 4LFAK 3ILOA 1UFLA 5TKWA 4CJSA 4B9SA 4JI8J 4GY2B 5JVHQ 4NYZA 3FMWA 1WB9A 3ZFVA 3O4WA 4LF7J 1DTTA 4KV8B 2LQJA 2P9IB 5AQKA 2CPZA 1I51B 5KPRA 2B51A 1T7PA 4FJNA 2E8AA 4LF4K 2LP4A 2MQNA 1K8AO 2OTLN 2PFDA 3KLHA 3D6MB 2DO4A 3RAXA 5KFPA 1X9WA 2E5HA 3J81j 3THYB 3AGKA 3NP5A 4KO0A 3JS9A 3IO1A 5HROB 2LA6A 2Z58B 3OL9A 4ICLA 2YKMA 3ZT0A 1WKLA 4KGVB 4ILJA 4QWAA 3H98A 1W2IA 1YZ6A 4DZDA 5KG1A 1EWRA 4OZ3A 3MX2A 5ETMA 1FD8A 4X2BA 3J7YP 4NLVA 5T7LA 3BUZB 5IM0A 5EN1A 3IAM9 2K3KA 1IKXA 2XI3A 3AOCA 2HBJA 2BQ3A 4LBIA 4E7JA 3M9NB 4JAXA 2NRZA 2I5JA 4DSKA 1Q8BA 1Y9OA 2YNHB 2VQFF 3CCMS 5CYJA 3S1TA 3EICA 5IT9U 4JV5K 2QYGA 3CC4N 2HKEA 3EL2A 4J9MA 4O23A 2WB1D 2KHCA 2ZGYA 4K4ZA 1VC5A 2Q3SA 4RKUC 1BQMA 3MM7A 4HYKA 4DV3K 3UN3A 3BO3A 1NDKA 4DR6F 4DB3A 1RLDA 5KOWA 1L3SA 1Q8IA 3H0PA 2G8WA 1VRTB 1KQGB 1FRJA 3DLEB 3RRHA 3RB6A 2HZVA 4UQGA 3Q8YA 2Q43A 3AD7C 4B3RK 3AVGA 1RT2B 1E6YB 4YP3A 2GWKA 2EFGA 3RR7A 1Q7YT 4BR5A 4ZP9A 3N0VA 3OYNA 1OPZA 4C7QA 1SIWB 3GMGA 4AXJA 3OVAA 5J2MA 2NYHA 1CLQA 2CQPA 4HHTA 3AB4B 3P6YC 5K20B 3OYMA 3CCEN 1WF0A 5B09A 4BREA 3PDNA 4XPEA 4JKGB 1VBYA 3CJQA 2QWNA 2Z2YB 2AIRB 3RWUA 3C16B 4EWTA 1CZ9A 1T94A 1F6TA 4ANCA 3CWJA 1Z6RA 4USKA 2FHMA 4IH7A 2P8IA 4LF5K 2DT9A 1KVAA 3VQ6A 2FF6A 3CCRN 1ZBSA 4M7YA 2Q97A 1WSEA 1GAOA 3FEXB 4LF8K 1UTAA 5KT2A 2RS8A 2A2DA 4EBCA 4PYAA 3VENA 2RKIA 2R7RA 2UUWA 2CQ4A 4DV5J 3M2RB 1D09B 2B43A 3E8OA 1QTNB 3WDOA 1QSLA 1VRUB 1W7AA 3MM5B 4M5MA 3PX0A 3D3BJ 2NRXA 1Y3JA 3SIPB 3FZ2A 2HHPA 4KRFA 2XWXA 3RW7A 3D28A 4DZ6A 3THPA 2DPIA 1L3VA 1ZPWX 4FZYA 2P5VA 1V4SA 3VCDA 2FBTA 3CM5A 1XEZA 3OFEA 1RWWB 1NRKA 5A2QY 3H08A 4MFBA 1S6PA 2P9IA 3NE6A 3KNAA 3DMJB 4FYWB 3PYFA 5ETTA 3FZFA 3T9NA 3SPYA 4CJLA 4HTIA 3DXSX 4PABA 1S7HA 1VI7A 2EC0A 3HHLD 4DU8A 1NXIA 1SH3A 4WK1A 2FPHX 4TN2A 3CD6N 1RLCL 1DBDA 1NB7A 3VAGA 2WBMA 5AR0A 4B1YB 4ECXA 3UW1A 1K1QA 1XMOF 1IN0A 2G2OA 1Z2LA 2XEXA 1Z26A 5DJBA 4V1Ak 1XTZA 2AX1A 1OS5A 1KHWA 4YOTA 4K42A 4I6AA 2LSNA 2DGXA 1RCOB 4NZ7A 3A5OC 4B9UA 1OO0B 4A57A 1NGIA 1XJWB 2YNHA 3NAIA 1KC8T 3LP0B 2QM1A 2GHVC 3VQQA 1HR0F 3PTWA 3TYTA 1ZM9A 2MSSA 2MQQA 3TAMB 3HVAA 4NPOA 3M8QA 1GMWD 5CHIA 4DTUA 2LKZA 3HL8A 1NGHA 2RIJA 2DIUA 1WKKA 3CD7A 2LMIA 4DUZJ 2LU2A 5GVQA 2FHJD 4RW7B 1YITN 2MEWA 2DBBA 1M5OC 3R5DA 3FQLA 3FE1A 2HGLA 1Q1KA 5CD4H 3OSNA 1PG5B 1QJHA 4ZVUB 4IWVA 1Q8KA 3HVTA 3M7VA 1QQNA 2ZITA 3E66A 4IR1A 4DQIA 4JHDA 4KHRA 4USJC 4B3OB 3NNAA 1VFJA 4QAGA 2AYGA 5AJ3K 5E3PA 2JLFA 1TUWA 3NBPB 2B7CB 4F25A 1WDTA 2BM0A 1SJQA 1ZM3A 1QHAA 4Q8FA 2E1CA 4BRIA 5LMUK 3BQ1A 2R42A 4M7XA 4NLTA 1RZMA 2YNIA 2QA2A 1HLUA 3HHLC 4ZP8A 4H5NA 3VQEA 4X4SA 4B1UB 4HTLA