3DI6A

Hiv-1 rt with pyridazinone non-nucleoside inhibitor
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
555
structure length
551
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery and optimization of pyridazinone non-nucleoside inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (hxb2 isolate)
molecule tags Transferase
total genus 157
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3di6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3di6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3di6A05
4QPXA 2D0CA 1CLQA 2GUIA 1EXQA 4CJTA 4B9MA 3OYBA 3QZ7A 2JLEA 3SCXA 1S9EB 5DLFA 5KFQA 2ZE2B 4ED3A 1CXUA 1N48A 4MFBA 3NF7A 3NH2A 3OYMA 3RWUA 2OPPA 3CJ2A 4HHTA 2WB4A 2DPIA 2P5OA 3VQ5A 1RDAA 4MIBA 3NAHA 1HMVA 3RAQA 4KTWA 3NCIA 5KFTA 2W7OA 4QWCA 2BRLA 4DFPA 1WNSA 1EETB 1DTTB 2IC3A 4QAGA 1YT3A 1XI1A 2OZMA 4RW7A 4KSEB 4FW1A 4CFCA 2BANA 3G10A 4MFBB 3Q8QB 1RDRA 3S3NA 2OPPB 3H5SA 5JUMA 2ASDA 4Q0BB 3FRZA 1QSLA 2EHGA 5KG6A 5F8LA 1KRPA 4RW9A 3K2PA 3SZ2A 1HMVB 4E0DA 4FW2A 4WYLA 3V9SA 3QERA 3FDSA 2IC3B 3QIOA 4H4OA 3KLFB 3HP9A 4RW7B 1I39A 2FBYA 3K5OA 4M3YA 4DS4A 3VQ4A 3H4DA 4RW9B 1JLGA 1GOCA 3PW2A 5KT3A 3ZT2A 3MTKA 4E89A 3DLHA 3V6HA 1NOZA 2RKIA 4DL5A 5KFKA 4H4OB 4M3UA 3SYZA 2PYLA 3DRSA 3LP3A 1N56A 4GC6A 2WK4A 3KLEA 2X78A 2Z1HA 4CERA 4DQQA 4CFAA 4AHCA 3KD1E 3KLHA 3IRXA 5KT7A 1JLGB 3RMDA 3MXIA 3KKSA 4IG0A 4DL4A 1GX6A 3EY1A 4CHQA 3VQPA 4URSA 4O3NA 4FLZA 1YTAA 4ELUA 2FVPA 1NKCA 4I9LA 2RKIB 2B5JA 1JLQA 1S1XA 3GQCA 3DRSB 3U3YA 4HCBA 4PQUA 3EPGA 4NLXA 5DQIA 3KLEB 3LP0A 3SQ1A 4ED0A 3IRXB 4CGGA 3M8QA 3ZSXA 1RTHA 4G3IA 4IG0B 4DSEA 4DTRA 4RW8A 2E6LA 2R8JA 4W5RA 4CGDA 3ZSVA 1TV6A 1CSJA 3KD5E 3MR3A 2B5JB 4BE2A 3CO9A 2VWKA 2CJQA 1JLQB 1EP4A 1S1XB 1IO2A 1KVAA 2ATLA 3LP1A 4PQUB 4FCYA 4IOBA 4KPYA 2FBXA 3DRPA 2AX1A 4DU1A 3LP0B 3L2RA 3AVCA 5L1JA 1RTHB 4DWIA 3EZUA 4RW8B 1RCHA 3AA4A 1JXBA 5KG1A 2JC1A 2A1SA 4F4YA 1WAJA 3MR2A 4RW6A 1GOAA 1TV6B 5KFCA 4M3TA 2PZSA 3QEPA 1ASUA 1LW0A 4IRDA 4CJ3A 4ZHRA 3SPYA 4IFVA 3LP1B 4CF2A 3SUQA 3DRPB 3GYNA 4TLRA 2IAJA 3AVBA 2WHOA 4H54A 2ILZA 4CESA 4F3TA 2F8TA 4KRFA 4RW6B 2XY8A 3HM9A 2I1RA 4FJLA 5KFYA 3BSOA 1LW0B 4O3SA 1IKYA 4CK3A 5FRNA 4WXOA 4BWJA 4M94A 1TAUA 4CEAA 4ZHRB 1QHTA 4CGHA 4CJ5A 3G6VA 4JS4A 5CZ1A 3IGNA 1BHLA 4ED2A 2IAJB 3JYTA 4CK2A 3I5CA 1S6PA 3HVTA 5L1IA 4DSIA 5KG5A 4ED1A 2HVIA 4ED8A 3OYEA 4DQPA 4FVMA 4EEYA 4DTPA 3PW4A 3V9UA 4EP5A 1VSJA 2YHBA 1WSIA 1IKYB 4J2BA 1LAWA 2R2SA 5F9LA 3KHGA 4J2EA 3I0SA 4I7FA 3SJJA 3HK2A 4IG3A 3EYZA 3JYTB 3ZSZA 2ILYA 3D5MA 2W9AA 1C1BA 1S6PB 3HVTB 3T1AA 2J6SA 4RNNA 4FK4A 4DL2A 1MU2A 1C1CA 2KZMA 5L1LA 3TAPA 1YVFA 4ELVA 4O5BA 3V9XA 3QETA 3SFUA 3I0SB 4MK9A 2C2EA 4FZXC 4LH4A 3K59A 4IG3B 1VSKA 4M45A 3KJVA 1HRHA 5KFVA 4FS2A 2HHQA 3CM6A 4FJJA 1C1BB 3T5JA 4YR2A 3NF8A 1U45A 4DQRA 5JS2A 4CEFA 1MU2B 1C1CB 5F8JA 4FYDA 2B4JA 2Q3SA 2IM3A 5F8NA 1A5VA 3T5KA 4KREA 4J9OA 4ZVHA 2BQUA 1NK4A 3CG7A 4ZTJA 1ZBFA 1MMLA 4FJGA 2F8EX 4KBIA 3KJVB 5J2PA 4UQGA 2HVHA 4DLGA 4HYKA 3OYFA 3ISND 1C0TB 4O0IA 4M95A 2C28A 1KHWA 1BCMA 4K4XA 2R8IA 1L3SA 2HNDB 4DF4A 3UR0A 2AU0A 4WFXA 1B9FA 1TL1A 5HLFA 3GV7B 4DTNA 4Y34A 2QKBA 1T3NA 3AVMA 4J9SA 5EWGA 2JEJA 2J6UA 5J2PB 4Z4FA 1SL1A 5KFZA 4O55A 3GIKA 3HL8A 3NHGA 1L3UA 1RT2A 4M3RA 3VQAA 4KAIA 1TL1B 5HLFB 3RMCA 1SH0A 3OHBA 3F9KA 1L3TA 4K4SA 1WLJA 4F4KA 1BQNB 3WNFA 4LY7A 3QIPA 3C6UA 3HPOA 2V4QA 1T05A 2AX0A 4FBTA 3SUOA 1RT2B 3TAQA 2OA8A 4DF8A 5J2MA 1JLFA 1Z4UA 1NJZA 4J9PA 1U49A 1ZETA 4TQRA 4J9MA 2Y1IA 1QAIA 3OS0A 4YMEA 2JEIA 4AHVA 4E3SA 3QIPB 3C6UB 4L8RB 4DEZA 2OYQA 3VA0A 5DGAA 3KOAA 1T05B 3QZ8A 3QNNA 1ZYQA 4CF9A 4R5PB 3K5NA 3N6LA 4CEZA 4XIUA 4J9KA 1NJYA 1UA0A 3OL8A 2VA3A 3WNHA 4YFUA 2R2TA 2YV0X 4EYIB 3PY8A 4CJEA 5I3UA 3QGIA 3PW5A 3NAIA 3VQQA 3RMBA 3V4IA 2B43A 4MKBA 4DU3A 4OPKA 4ID1A 3LZIA 2OH2A 2ATQA 5K14A 1XWLA 4FLVA 1XHXA 3CYMA 3ZT1A 1T7PA 5KFUA 5T14A 4N76A 4O3QA 3MXJA 2C22A 1LWFA 2FVRA 5EWFA 2XGQA 5I3UB 3S3MA 4CHNA 4HCCA 1WSGA 2G8HA 3V4IB 3CDEA 4NLWA 5L1KA 4CECA 2YNHA 3B6PA 3B6OA 1RTJA 5K14B 3HHKA 4NLDA 5DQHA 4IR1A 3O3FA 5C5JA 3TR8A 4JV0A 5C24B 4JLHA 1UA1A 4LSNA 2ZQBA 3OL9A 5CYMA 4RZRA 3NL0A 1TL3A 2D3ZA 4NCGB 2D5RA 1LWFB 3OYAA 3QYYA 3F73A 5J2QA 1HYSA 2EX3A 3OYCA 4MK7A 1B9DA 3DLRA 5KFEA 4CJRA 5L9XA 2QXFA 3VQBA 3PZPA 1W0HA 3C6TA 4OJRA 4KAZA 4KKOA 5EU7A 3OJUA 4DSJA 2UVVA 4PWDA 3ZSYA 4FK2A 1SKRA 4LSNB 4IRKA 2VG7A 3ZSWA 5CYMB 1TL3B 3CJ3A 3KMSA 4E7IA 4B3OA 5J2QB 1HYSB 4Z0UA 3D0PA 3M8PA 5KG3A 2FLLA 2KFNA 3H2LA 3I8DA 3GILA 3OYJA 4K4WA 3KK3A 1CZ9A 4FJKA 4KKOB 1RDDA 1HNVA 3RB0A 4HKQA 3AA3A 1NOYA 2IJNA 2VG7B 1QTMA 1HQUA 5KFRA 3LZJA 5EDWA 4TYBA 5KT4A 4B9UA 3AO2A 3MEEB 3HT3A 4NYNA 4B3OB 4AHTA 4RUCA 3OYLA 2XGPA 3O4QA 1Q9XA 3DLBA 4DTXA 3OYIA 3KK3B 3KLGA 2Z1GA 3NF6A 1HNVB 4E1NA 4XPCA 1ZBHA 4ECRA 4NLPA 3AVJA 2WOMA 1U48A 3I5AA 2GC8A 4Q0BA 1HQUB 2UVRA 1HQEA 4AHUA 2RF2A 1HYVA 2R8KA 4C8NA 5SWMA 4I9QA 4FJ9A 3CJ0A 4OVLA 2DFFA 3KLFA 4C8LA 3KLGB 3T3FA 5FROA 2UVUA 4ICLA 1BISA 4CIFA 1J54A 4ZP8A 3AO3A 5D3GB 1K1QA 4KI6A 4FJMA 2WOMB 4Z4EA 1BIUA 1HQEB 3BDPA 3BSCA 2RF2B 2HHUA 4QCLA 3TANA 3SQ0A 4M41A 3ZSRA 2WONA 3K5LA 4E7JA 2LSNA 2IDOA 4ICLB 2FVQA 3MF5A 4MQ3A 3MEDA 4YQWA 5KT5A 4FJIA 3DOKA 1SH2A 3M8SA 3DLKA 5KFXA 4CCHA 1IM4A 2RDIA 4Q45A 1DTQA 4ZPBA 2GBZA 1VK0A 4C8OA 2VA2A 1J9AA 2WONB 3AVHA 4DQIA 5CYQA 5EWEA 1VRUA 4JRPA 2G8IA 3CDWA 4EZ6A 2YKMA 5KGXA 3MEDB 4TY9A 3P1GA 4EYHB 3DOKB 3DLKB 2R2RA 2FJVA 1YVUA 3BJYA 4W5NA 1T03A 1RBVA 1DTQB 2XC9A 3LDSA 5HRSA 1NK8A 1S1UA 5KFAA 3OHAA 3MFHA 3LWMA 4FJ8A 3AVGA 5CYQB 4IR9A 4KO0B 1VRUB 1NJWA 3GIJA 4ECTA 2R8GA 4ZPDA 2YKMB 4O4GA 1K6YA 4CF0A 1FK9A 3IS9A 1ASVA 3RAXA 3I5BA 3UIQA 1FXXA 3ICLA 1Z25A 1T03B 2IS3A 1KLNA 3P5JA 4DFMA 5J1EA 1S1UB 1TQLA 3OYDA 4WFYA 5KG4A 5KFPA 1RBUA 2Y1JA 3DYAB 2HWHA 4O4RA 2FLNA 4J9LA 4RNFA 4O4GB 4OKEA 4OLAA 1FK9B 3IS9B 1S97A 1JX4A 1S1TA 2RPIA 4LD0A 2QE5A 4J9RA 2ETJA 4E1MA 5J1EB 2W8LA 1N5YA 3ZSQA 5FRMA 2JGUA 1Q8IA 3KK2A 4YP3A 3AA5X 2WTFA 1J53A 5F9NA 3G6YA 2XWYA 3RRHA 2RN2A 4E19A 1ZBIA 2F96A 1D1UA 5KFGA 1S6QA 4O3PA 4CGJA 1S1TB 1KSPA 1BQMA 2QV6A 2V0NA 4Y3CA 4QW9A 1HJRA 3ASMA 5F8GA 3GV8B 1N5YB 3RBEA 1S9FA 3AVKA 4MKAA 4W5OA 4BDYA 3KK2B 3C94A 3QO9A 3LPUA 5KFNA 2XY5A 3RR8A 3PHEA 2AGOA 1N4LA 3L2VA 3G0ZA 2HMIA 1XR7A 2XHBA 1IG9A 1DLOA 3V1OA 1S6QB 1GX5A 1NHVA 1D0EA 4NYFA 1BQMB 4CEDA 2KZZA 4ZVGA 2X6NA 5KFHA 3GV5B 3SV4A 4E7LA 3GIIA 2IM0A 4FJ7A 4DTMA 2R2UA 2XI2A 4FLYA 4EBDA 3QO9B 1QE1A 2HHTA 1D8YA 3HO1A 2HMIB 4W5QA 1DLOB 3V1RA 4KTQA 4CJLA 2E4LA 3UPFA 3KLVA 1RTIA 1IKXA 1CXQA 2F8SA 3QEIA 4KI4A 1KHVA 1JL2A 1EX4A 5F8HA 2P5GA 3AVAA 1JLBA 2O4IA 2FBTA 2FJXA 1QE1B 4CGFA 2FLPA 3L2WA 4M3XA 5DQGA 1I3AA 3TAGA 1I6JA 3G86A 1RDCA 3H5XA 3C95A 1RTIB 1IKXB 5T7BA 5FDLA 4ED6A 4DMNA 3NF9A 4CJVA 4FJ5A 3HVRA 1C0TA 4KV8A 1TP7A 1WSHA 2HNDA 4IKAA 1JLBB 3RR7A 4Y2CA 1YTUA 3V81A 4NLGA 3KK1A 1G15A 4Z4CA 2IBKA 4CF8A 4B9LA 5FDLB 4O3OA 3FQKA 4QW8A 1JKHA 1KVBA 4KV8B 4WE1B 1S9GA 4B9TA 4KB0A 3KNAA 3PW7A 5KRTA 1RT7A 3ZT4A 4RG8A 2XY6A 3HPGA 3RB6A 3OY9A 4R0EA 3SFGA 3V81B 4TXSA 3SPZA 3KK1B 4FS1A 3K5MA 3SI8A 2FVCA 4B08A 3NH0A 4B9SA 4LQ9A 4K4YA 1BQNA 4FJNA 4EBEA 3SNNA 1WNEA 3OYHA 1R0AA 1JKHB 4Z4IA 2X6SA 1S9GB 3IGVA 5DGBA 1HNIA 3HYFA 2UUWA 3LPTA 3MEGB 1TVRA 4AHRA 3CJ5A 1RT7B 4ECYA 3AO4A 4CEQA 2BQRA 3NKYA 1L5UA 4Q5VA 4ZP6A 5C25A 4WXWA 4KHYA 3PR4A 4K4TA 2D3UA 4FLUA 3BREA 4ZTFA 4RNHA 3VN5A 4DTJA 4FLXA 1SV5A 2G8UA 1JLCB 1R0AB 1S49A 3LWLA 1VSEA 2IM2A 4CJSA 3CJ4A 1HNIB 4RNMA 1LW2A 1NKEA 1TVRB 4ECUA 3DMJA 3U3GA 1XR6A 2IJFA 4DLEA 4C8MA 1Q9YA 4R5PA 3L8BA 5C25B 3T5LA 4NLUA 4ELTA 3TI0A 3PVXA 1S5JA 3RTVA 4ECXA 1WSEA 5KFDA 3HSTB 4ZPAA 1SV5B 2BQ3A 2YKNA 3PO5A 2HWIA 2D7SA 3OL6A 1LW2B 1QSSA 2I5JA 3DMJB 4IFYA 3VQ9A 5JXSA 4M3WA 3LAKA 4HUEA 2IOCA 4FZZA 1RT1A 2CKWA 1WN7A 2HNZA 2OPQB 3DLEB 1TK5A 4NLSA 1TKTB 5EUHA 2YKNB 4HUFA 5DK5A 4WYWA 4K4VA 2P51A 2J6TA 2I5JB 3LALA 4BDPA 5DMRA 3KHLA 1ZBUA 4IFYB 3V9WA 2BE2A 4IH6A 2EC0A 4Z4HA 4ZMMA 1RT5B 3V6KA 3OLAA 4BDZA 2YNGA 4O0JA 2QK9A 1RT1B 3BQ1A 4K4UA 4WZQA 2HNZB 5C24A 3NGIA 1SKWA 1U04A 4B9NA 2GV9A 4E7HA 4NCGA 1JIHA 4CJFA 4ZVEA 1LWCA 4NLOA 4DTOA 3ZCMA 3O3GA 3BSAA 1FKPA 2BE2B 3L3UA 3L2QA 4IRCA 4AH9A 2IM1A 1C0UB 1ITGA 2ZD1A 4I2PA 2YNGB 3V1QA 3VQ6A 1T8EA 4ECWA 3NGZA 1XR5A 4ECQA 4WZMA 3D45A 2DFEA 3KLIA 3RB4A 1D9FA 1OS5A 4Q8EA 3NE6A 3UQSA 1LWCB 3PW0A 4HVJA 3M9NB 3M9OB 4OGCA 1NK6A 3VQSA 4W5TA 1FKPB 2YHAA 4ECVA 3PO4A 4PUOA 3E51A 2WCXA 5KG7A 4Q43A 2ZD1B 4I2PB 4XPEA 3H4BA 4QWDA 5HRRA 4IH7A 3QLHA 4TSXA 3N6MA 4DSLA 3V9ZA 2GIRA 3KLIB 3QNOA 4RNOA 4HTUA 3MEEA 4TYAA 3IAYA 1RTDA 3FFIA 4Y1CA 4HUGA 3TARA 4PUOB 5E41A 3LP2A 2Z1IA 4URQU 1S0NA 4F3OA 4PA1A 2DY4A 4N5SA 3QLHB 1SKSA 1B92A 4MH8A 4DFJA 3NGDA 3G6XA 1RTDB 3FFIB 4CFDA 3UDLA 5HP1A 1C0MA 1KTQA 3KKRA 4YR0A 3LP2B 4DU4A 2W9CA 5CZ2A 3M8RA 3MAQA 4CGIA 2JC0A 3QINA 5D3GA 4NLQA 4EO6A 3E01A 3NMAA 3QEWA 2ASLA 4EO8A 4K50A 4TY8A 3H08A 1JLEA 1C2PA 3QIDA 5HP1B 1LWEA 1KVCA 3DRRA 3MFIA 2W9CB 4ZVFA 4R8UB 3KHHA 1HPZA 3CWJA 4DFKA 3QESA 1U09A 2XCPA 5KFBA 3H5YA 1BIZA 5DG7A 1D9DA 4NCAA 5CY4A 3E01B 4FJXA 3BQ0A 5J2NA 4Z4GA 3ISNC 4TY8B 1JLEB 4O44A 4J9NA 1UAXA 1LWEB 2Z1JA 3DRRB 4JS5A 1BGXT 5I42A 1VSMA 1GOBA 1N6QA 1KFSA 3HPHA 3QGGA 1TGOA 4OKKA 4FM2A 1HPZB 1TK8A 5JS1A 1BCOA 5DG9A 3MR5A 5KFSA 1TKZA 3WNEA 4FLTA 5HROA 3LANA 5J2NB 1C6VA 3VQEA 2AGPA 4O44B 2VG5A 2JEGA 5KG2A 2C2RA 2BANB 5I42B 4CHYA 2VG6A 4KO0A 4IBNA 4CJPA 4FK0A 4N41A 1N6QB 2ITGA 1D5AA 1S1WA 4NLVA 2B6AA 3I0RA 1VRTA 1TKZB 1S0MA 4Y1DA 2E9ZA 1NKBA 5HROB 1ZTWA 2OZSA 1X9SA 1X9MA 2VG5B 5KG0A 2P1JA 3MXMA 3EZ5A 2G8FA 2HNYA 4CE9A 4RU9A 3OSPA 2VG6B 4EBCA 3HVWA 3HP6A 3SV3A 3DYAA 2E9TA 4ECSA 3AVNA 2XRIA 1S1WB 3T5HA 3HKWA 2B6AB 3BQ2A 3I0RB 1VRTB 2G8KA 2FJWA 5KTQA 3TAMA 1QUVA 4J9QA 3NH1A 2HHXA 4QOZB 2DPJA 4I2QA 2HNYB 1F21A 1ASWA 3NGYA 3CFRA 3U6FA 2ASJA 4KHRA 4OPJA 3KLHB 4H8KA 5KI6A 4DSFA 3P83D 2IA6A 3TVKA 1RYRA 3O3HA 1TKDA 3N6NA 1QS4A 3DDKA 3TAMB 1VSDA 4CJWA 2YNIA 3VA3A 2KQ2A 1CZBA 4MK8A 3OYNA 4I2QB 2HHVA 1XC9A 1U47A 1XHZA 3CVKA 4CHZA 3M8QB 2AWZA 4B8AB 2XO7A 3EPIA 1KLMA 3MR6A 3PX0A 4KHQA 2HB5A 3DOLA 1S1VA 3HVAA 2YNIB 1NK7A 1VSFA 1NK9A 5KFJA 1EP4B 4U6PA 1RT4A 3CDUA 3QEVA 4E7KA 4DL6A 4CJKA 4KTZA 3PV8A 4NRTA 2BR0A 2FC0A 3RMAA 4FZYA 4KB7A 1BI4A 3M9MB 1QAJA 1KLMB 3RRGA 3VQ7A 4K8XA 3H98A 3DOLB 3T19A 4OLBA 3TAFA 1S1VB 1VSIA 1RT3A 1X9WA 4CHPA 4U7CA 2V4RA 1RYSA 4DTSA 3SUPA 1RT4B 4QWAA 4IFVB 3JSMA 2WRMA 4GW6A 1NHUA 5DLGA 1LAVA 3ZSOA 5KT6A 4ZP9A 1BI4B 3L2UA 3PX4A 5KT2A 1A5WA 4OGEA 3DLGA 2W7PA 3KIOA 4F4ZA 3OVNA 3K57A 4LH5A 4NLTA 1RT3B 1S4FA 4BE0A 4MIAA 1S48A 5KFWA 3ZT0A 1HYZA 4CK1A 4CIGA 1K1SA 3VQDA 3IG1A 4NZ0A 3JSMB 3LAMA 1KCFA 3QGHA 3GIMA 1S10A 3CFOA 4YNQA 1WSFA 4KHNA 3DLGB 4BACA 2KW4A 3AO5A 2ZKUA 2IGIA 5SZTA 2W8KA 3KTQA 4WE1A 4F50A 1RILA 3IG1B 2R7YA 2W9BA 3CIZA 4KE5A 2VWJA 3BGRA 4I7FB 1S0OA 4CEEA 1NJXA 4WFZA 4F2SA 4N47A 1IH7A 4BE1A 1EKEA 1X1PA 2C2DA 3KMQA 4Q8FA 2AQ4A 1A5XA 2AGQA 2O4GA 4AILC 4URGA 3MEGA 2ALZA 4XO0A 4NRUA 1O1WA 5DG8A 1IKWA 2W9BB 5KFOA 2YNFA 1NNDA 2XCAA 2D0BA 3BGRB 1SH3A 4YR3A 1T94A 4CJUA 3K58A 4JV1A 4LQ3A 2E6MA 1RBTA 4KHWA 2BRKA 4J2DA 4DQSA 1JLCA 5KFMA 3RBDA 3S9HA 5HBMA 5F8IA 1NK5A 4KFBA 5KFFA 4PY5A 1SL0A 1TKXA 4AHSA 3CFPA 2W42A 3Q8PB 1IKWB 4CEOA 2YNFB 4KHSA 1RT6A 3TABA 4IH5A 4DL3A 3A2FA 5F8MA 3HXMA 5HRNA 2DTUA 1UOCA 1RBSA 2UUTA 4FM1A 1BL3A 4M42A 4F2RA 2D0AA 3OYGA 4ED7A 2OPRA 2NUBA 5HBMB 2QKKA 2FVSA 4ID5A 4KFBB 4ZPCA 1TKXB 3TWHA 3NAEA 3AVFA 4LSLA 4OKJA 4CFBA 4FBUA 2PYJA 4RW4A 1RAJA 1RT6B 1JLAA 2IMWP 4NCBA 1NK0A 2X74A 4K4ZA 1KFDA 3VQCA 4KB1A 3BSNA 2OPQA 3DLEA 2OPRB 4G1QA 4F4XA 3CM5A 1TKTA 4IDKA 4ID5B 5KRSA 2XY7A 2KFZA 4F8RA 4LSLB 4RW4B 1JLAB 1REVA 4CHOA 1WSJA 2XI3A 1VSHA 1W9HA 1RBRA 3O4NA 1RT5A 3THVA 4Q44A 3SQ2A 1UWBA 3AV9A 3FSIA 4G1QB 3NBPA 4FM0A 3KHRA 3AVIA 1RDBA 4IDKB 2HHSA 5J2MB 1SUQA 1C1AA 4M3ZA 1RA7A 3OYKA 1JLFB 1TK0A 4KHUA 3HJFA 5KGWA 2V9WA 4B9VA 4BWMA 4FXDA 1REVB 1Z26A 3TAEA 4CJ4A 1QQCA 1C0UA 4DG1A 4TN2A 4GC7A 2RDJA 1UWBB 4EP4A 4ECZA 4J2AA 4F4WA 3NBPB 3V6JA 1Y97A 3D28A 3OL7A 1SUQB 3ULDA 3DM2A 3SQ4A 2KTQA 3OLBA 1JXEA 2JEFA 1J5OA 2E9RX 3WNGA 2HW3A 3FQLA 2OPSA 4FLWA 4DG1B 2D41A 3OS1A 2HHWA 4CEBA 4DTUA 3ZT3A 2BDPA 3TQ1A 4C8KA 4EZ9A 3H5UA 4H4MA 4TQSA 3PX6A 3ALYA 4IQXA 3PJXA 4JRQA 2GIQA 3NFAA 3DM2B 3PUFA 3OSNA 1J5OB 4GMJB 3BR9A 2G8VA 4GVMA 4X2BA 3ITHA 1JL1A 4FJHA 4KHMA 3CQ8A 5KFLA 1JXLA 2R8HA 4DSKA 2OPSB 4DL7A 1FKOA 4QWEA 3SUNA 1RA6A 1VSLA 2G8WA 3AVLA 4ZP7A 3SI6A 2FBVA 4H4MB 4QWBA 1RNHA 3RB3A 3VQ8A 1L3VA 4DS5A 3QEXA 4IKFA 2AJQA 3MECA 3DI6A 4NYZA 3Q8SB 1W25A 4B8CA 3V6DA 4CF1A 3ITHB 3L3VA 2YNHB 4O3RA 3PJWA 1RTJB 1LV5A 4JV2A 4OL8A 3OJSA 1ZBLA 1HARA 4JUZA 1FKOB 2PY5A 1IKVA 5C42A 3PR5B 4CJQA 3AA2A 2O5DA 3NDKA 1TAQA 4K8ZA 3OS2A 5KFIA 4N56A 2BGGA 3Q8RB 1WAFA 2UVWA 3MECB 3DI6B 3H40A 5HRPA 3IN5A 1SL2A 1ZTTA 3V6DB 2HAIA 3C6TB 1S9EA 2ZE2A 1U4BA 4PWDB 4R8UA 1IKVB 5C42B 3S3OA 1QSYA 4RUAA 2DFHA 4NLYA 3M8PB 4NLRA 4Y2AA 3AO1A 2A1RA 1EETA 1DTTA 3H59A 4CIEA
chains in the Genus database with same CATH superfamily
2GUIA 4B9MA 3OYBA 2VQEK 3SCXA 1S9EB 1DURA 2A5XA 2G4BA 3NF7A 1YZ6A 4HHTA 2CJYB 2VBYA 1ZH5A 1OY9A 1RDAA 1NCLA 1HMVA 3RAQA 3D4JA 1CC7A 4QWCA 4DFPA 3M2VA 4JKHA 1WNSA 1EETB 1DTTB 3I96A 1OJ4A 1XI1A 4RW7A 4MFBB 3Q8YA 3Q8QB 4H0PA 4GV9A 2ASDA 4JN4A 5KG6A 4JI4J 1KRPA 4RW9A 3BYRA 2D0OA 3K2PA 4QIVA 2W41A 3NNCA 3VGKA 3FEYB 2QIFA 2HBLA 3FDSA 1RWWB 3QIOA 4LF5K 2BJ7A 4QIFA 1I39A 1AB8A 2DGXA 5B0BA 3VR1A 1GXLA 2XYGB 4DS4A 3H4DA 2Q31A 1KDNA 3MM7A 1TFWA 4X65J 4C0HA 5KT3A 1NGAA 2EWSA 4JK7A 3UD4P 4E89A 3V6HA 2FTRA 2RKIA 4DL5A 2PYLA 2PI5A 2E2PA 4KHPK 2AJ2A 2Z1HA 3TQEA 2G0CA 1SVDA 3E1YA 3P31A 4AHCA 4DV2J 3MXIA 4IG0A 4DL4A 1GX6A 3EY1A 4CO1A 4O3NA 4FLZA 4P75A 4BLGA 2CPXA 1HLUA 1REGX 1UJ5A 2CUYA 2FVPA 4WK1A 1NKCA 2G0IA 2LFVA 4YB6A 2B4VA 3DRSB 3NGTA 3EPGA 1ZOTA 4NLXA 2V8GA 3SQ1A 1WOPA 4ILMA 4CGGA 4P2MA 2DNKA 5GMEA 2DGOA 3QMLA 4W5RA 3KWMA 1T9YA 2AJFE 1FVQA 1F9EB 1GLBG 4ZJLA 2B5JB 5LL6Z 2QA4G 1XNQK 1EP4A 1IO2A 3WXMB 1KVAA 1VJWA 4FCYA 3ZZ0A 4KPYA 2XNQA 2FBXA 2AX1A 2C2OB 1RE1B 3SCJE 4HWIA 1J5EF 5B0DA 3PTWA 3EZUA 2PT0A 3CMAS 1JXBA 3TVYA 2D0PA 2R7WA 1ASUA 5IOLA 3KVGA 4JK9A 1NUEA 3NCPA 2KVIA 3CQYA 2J7KA 4IFVA 4I56A 4CF2A 4CH7A 3DRPB 4JI6F 3Q22A 1ESVA 3J8AA 2DBBA 3AVBA 2ATCB 2ILZA 3LM2A 3VEZA 4AQYK 1QUPA 2HZVA 1HR0J 3TJ9A 5IQQA 4RW6B 3ID8A 2I1RA 2GEMA 5KFYA 3BSOA 1IKYA 2HS4A 3R6LB 2P6SA 4WXOA 5LMNJ 2XZTB 3ZZPA 4B3MF 4CJ5A 4IOAQ 4JS4A 2P9KA 5AXLA 3UVJB 1LK7A 4ED2A 1HI1A 2IAJB 4X64K 1FRHA 4FKYA 3FZHA 1CJUA 4ED1A 4DQPA 1VSJA 2HEKA 1LAWA 1Q5VA 4ZK7M 4P72A 1U6FA 2AV5A 4X66K 3HK2A 4IG3A 1BQXA 2CQ4A 3H8YA 2W9AA 2B4OA 1S6PB 3HVTB 3NG8A 4RNNA 1VQ7S 1WEXA 2M9KA 3VVTA 4F02A 2HZAA 2VPYB 4CLPA 4IOAL 2C2MB 2RMLA 3FKBA 3MM6A 4A46A 3SLCA 4DV4J 1YF5L 4CZFA 3THWB 1C1BB 4EAHD 2MHEA 5ETLA 2H9ZA 5CHCB 4DR5J 2HVDA 2BVZA 4JI2F 5F8JA 1GLCG 1RJJA 1PAUB 5LJVA 1UJ6A 2BQUA 4OI2A 5GAGI 2XHCA 4CZJA 2KHOA 4YDUA 4FJGA 3SBTA 2F8EX 2VU5A 4B1YB 3KJVB 1R8PA 1HX1A 2Z2LA 3OYFA 1C0TB 4O0IA 4M95A 1Y7PA 1TFYA 4QU7A 3TPQA 2UXCK 4D3HA 1N34F 2LQ8A 3UR0A 4WFXA 1TL1A 4DTNA 1URRA 3TA0A 1YZ7A 1OH5A 4J9SA 2ZF5O 2XMVA 2OIHA 2QMWA 3GIKA 1RADB 3HL8A 4PG8A 4PXEA 4YY3F 2OJ3A 4OX8A 3NHGA 2EG1A 4FYVB 4NMXA 3L95X 4QYZK 2VGMA 3M32B 1SH0A 4OV6A 2B9WA 2ZVIA 1VQOS 3B8HA 4HI1A 1WLJA 1BQNB 1QHAA 1LKZA 3C6UA 1OIAA 3HPOA 2HQFA 1T05A 2CWXA 4FWQA 1NBWA 4DR2F 3BDEA 5I3QA 1H3DA 3VENA 4TQRA 4C8ZA 3N4WA 2EFNA 3OT9A 2F4VF 1RBOB 2Y1IA 2EBEA 2JEIA 4L8RB 3QIPB 4TLQA 4DEZA 1IBKF 2YVSA 1N5QA 2VQEF 5I3PA 3KOAA 4FO0A 4H5RA 1RHMB 4B3SJ 2RH3A 4M7XA 4OX9K 1HBUA 4TKTA 2XS7A 2OAUA 4UOGA 4X4PA 3NGRA 2EFPA 3CDAA 4XIUA 3R5DA 3MXHP 1NJIO 2ADBA 1VI7A 3G4SS 3TUJC 4YFUA 4YOXA 4EYIB 3PY8A 5AQPA 2U2FA 4KGZB 2MQLA 3RMBA 3ZNUA 3V4IA 4MKBA 2N3LA 1X5PA 4JI3J 3LZIA 2ATQA 2MZJA 1XWLA 1XHXA 3QAUA 4F25A 3T7ZA 3IR7B 3MN7A 3EGVA 1XMBA 3H90A 5EWFA 3BM7A 3S3MA 1YHQN 4CHNA 3ET6B 3GJQB 4WKRA 1EAYC 3JS6A 4CZCA 3EX7B 4RWTA 3B6PA 1Q8KA 5K14B 2EFOA 3HHKA 2R7VA 2LEAA 3O3FA 5C5JA 1YK9A 1UA1A 1KTVA 5JICA 4LFBJ 5E5NA 2D3ZA 1E4GT 5AFUA 4B3RK 2E1CA 4RPFA 3MI7X 5J2QA 2MJUA 4CIOA 3D2FB 2V69A 5HI7A 1YJUA 3BEXA 1B9DA 3CC7S 1HIYA 5L9XA 1HNXJ 2QXFA 4GV3A 4JKGA 3VQBA 4BY9C 4CZIA 3C6TA 4OJRA 4KKOA 1RWUA 3W1YC 3FBCA 5DDOC 4LSNB 5GMDA 1LFPA 1TL3B 3UD3P 4OI4A 5THWA 2HBYB 2A2DA 3H2LA 2I6WA 3I8DA 3M6XA 1RAOA 3KK3A 3WX4A 1RDDA 3U1MA 2ZITA 3RB0A 3AA3A 2DRDA 2IJNA 4ID8A 1XNQF 2VG7B 3LZJA 2VYPA 3AO2A 4O5FA 3HT3A 1TTHB 4UY85 3OYLA 2PEHA 3GDQA 3KZBA 3O4QA 2EFQA 1Q9XA 1DQ8A 4DTXA 4F3QA 3OYIA 1HKAA 3H46O 3EVOA 1ZXOA 6FDRA 1EB0A 4WFAQ 2WVCA 2ZBRA 1ZBHA 2ZGZA 2GC8A 2DNHA 1HQEA 2LQBA 5JMVA 2KRBA 5JLFA 5SWMA 4I9QA 4FJ9A 3SMPA 4USTA 3A3PB 4NEYA 4KH6A 1HBMA 1IQTA 1NSAA 1HA1A 3T3FA 2VJVA 3DLJA 4HDGA 2UVUA 4ICLA 1BISA 3FNNA 1K1QA 4ZDNA 5AQUA 4LF1A 5MLCQ 1Z2ZA 1WACA 2OKQA 2HHUA 3TANA 1YRTA 1T44A 4M41A 2E7XA 3Q24A 2V8DA 2F9JA 2CJXB 2GHPA 5BYQA 4E7JA 2FVQA 4B02A 4MQ3A 4WFAL 2V4JB 5KT5A 4HHJA 4ZVSB 5KFXA 4BRKA 4YDXA 3CMAN 3CCVN 2RRAA 2F40A 2GBZA 2V2ZA 2FF6A 5L8RC 2MTLA 1AFIA 3AVHA 2XS2A 4DQIA 2UXBJ 3B82A 3GB0A 5BYSA 1ITPA 3WEEA 2ZGYA 4EZ6A 5KGXA 3MEDB 1NGJA 1NGGA 3P1GA 1XTZA 4ZVTB 2PDAA 2R2RA 2FJVA 2VV5A 4WFBQ 2DNQA 1D8ZA 4PXBA 2QMXA 2EFGA 3IFRA 1RHUB 2DNOA 3DN9A 3T6BA 3MFHA 3LWMA 2VQFK 1LEOA 3AVGA 1VRUB 4RO0A 1NJWA 3GIJA 2X1AA 4ECTA 2YKMB 2E5JA 1FRJA 1FK9A 3IS9A 2OI2A 2GA7A 1VQMS 1GLJO 3MCSA 4ATNA 3RAXA 3I5BA 4KR0B 3ICLA 1T03B 4IYQA 4F0KA 3D0IE 1K9MT 2IS3A 3P5JA 5M2PA 3E9OA 5H1SV 1HWIA 5KFPA 1QTNB 5DM6Q 2Y1JA 1O6XA 1FD2A 4J9LA 1LXJA 4O4GB 2UXCF 2RU9A 1JX4A 1KVIA 2QE5A 3HJVA 4BC2A 1VQ7N 2PI4A 4WFBL 4JI8K 4BC7A 1RLDA 3ZTSA 2OELA 3KK2A 5E3AA 2ALYB 4Z2XA 4CYUB 1U2FA 1D1UA 1O5JA 4BRDA 5T7LB 4O3PA 1KSPA 3N0VA 1U26A 2GO8A 4FYWB 3MM5A 3M2UA 4V19S 1GMVA 3US5A 3W2WB 4FPIA 5AQGA 2J5AA 1S9FA 1H7WA 4L73A 4ZA1A 4W5OA 4BDYA 4WQ5C 4IJAA 2XY5A 4LR9A 3MMCA 2ZH6A 2WVEA 5DM6L 1FE0A 3MEKA 3ZTQA 4DV1J 2XHBA 3V1OA 4ALZA 1S6QB 4NYFA 1BQMB 2QG9B 1VHIA 1I94J 2KZZA 2X6NA 1T9XA 3SV4A 1O51A 2F8HA 2EK6A 4DTMA 1IBCB 4FLYA 3HSCA 4GKJJ 5E3QA 1TYQB 1QE1A 2IRUA 3HO1A 1S6OA 1DLOB 4CZGA 3KLVA 4JKEA 1KHVA 3ZETB 3EM1A 5D15A 4PXDA 4IEIA 2DISA 2P5GA 1DQAA 2FJBB 1JLBA 3TZYA 3GU0A 1VQON 4CLKA 4CGFA 2MKSA 4H0XB 3TAGA 3DLLQ 1WBBA 3QJLA 3THXA 2QYCA 1Q81T 4ED6A 1X8DA 1JWWA 4FJ5A 1U02A 1BLUA 1C0TA 4F0MA 1TP7A 1U1OA 2OTLS 2RHKA 1WSHA 4IKAA 3RR7A 2X3GA 1RXOB 4LFAF 3NEKA 3V81A 2BJ9A 4NLGA 1G15A 3FGVA 4DV5K 4A8KA 3MAAB 4JYAK 3FQKA 4A57A 4IJNA 4WBFA 1JKHA 3D66A 4KV8B 2JWKA 2LA6A 4AD6A 5M1QA 4KB0A 1S7IA 1RT7A 3EVWA 3OY9A 1Y64A 4LRFA 3M32A 2HS3A 3KK1B 2FVCA 5AQJA 1U6ZA 3OFHA 1TELA 3DLLL 1BQNA 3H1QA 1IBMK 4FJNA 1WNEA 2BKNA 3O9SA 4DZ6A 2X6SA 2PMWA 3IGVA 1HNIA 3IM8A 3LPTA 4DCOB 4ECYA 5T41A 1UEVA 2CGJA 4QBUA 4Q5VA 1N54B 4ZVRB 3O80A 5C25A 3PR4A 4K4TA 1HWLA 4ZCIA 1U1QA 4USKA 3C2PA 5CZVA 1UMJA 3AJ1A 1S49A 3J7YI 8ATCB 1VSEA 3H0PA 4NXNK 4QR0A 5D0RA 3BKFA 2NRXA 1LW2A 3W3SA 2QXLA 4MO4A 4BGBA 2K3IA 2HRYA 4LRDA 1FKAF 1XMQF 3THTA 2IJFA 2B0GA 4C8MA 1JCEA 3P49B 1K73O 4ISEA 4USVA 5AE2A 2IVOA 4YB5A 3E66A 3PVXA 3MX5A 1SPBP 4DPOA 5E3RA 4M5GA 1YSJA 5CCLA 3CC7N 9ATCB 4IFYA 4LR7A 2UUAJ 2QA2A 4M3WA 3FBBA 3CXCM 4X4SA 1WN7A 3MCNA 4NEZA 1HW8A 1RAEB 4NLSA 2J9DA 1TKTB 1RWNB 5EUHA 3EL2A 1GLLO 3MCMA 5A2QU 3EUNA 5DK5A 5IWAK 5DMRA 3ET6A 3KHLA 2VHGA 3V9WA 5F1XA 5ETKA 3OLAA 2YNGA 4O0JA 1N8RO 2HNZB 3NGIA 1SKWA 3R5BA 1Y5NB 4B9NA 1U04A 3SSSA 2RT3A 4ZVEA 2YWEA 4DTOA 2M2BA 3KDOA 3CJRA 3N4QA 3CTRA 2WSFC 2LQ5A 3L2QA 5G4DA 2IM1A 1E6VB 4ER8A 3DXBA 1WSRA 2O66A 3HT0A 1JCGA 4ECWA 3NGZA 3L3CA 1KR4A 4DV3F 2MDAA 4WZMA 4U9RA 3RB4A 1OS5A 3NE6A 4DR3J 1IBLJ 2G2ZA 4ZLNA 1LWCB 3PW0A 2ZWHA 4CTAB 1Z05A 5EGYA 3HOTA 2I7NA 3M9NB 3M9OB 1NK6A 2DJWA 3CXCR 3VQSA 1JJ2M 1FKPB 4Y0WA 4ECVA 3M1VB 4JI4K 1Q0NA 4MYUA 4ZIWA 1V3ZA 5E3PA 2F7VA 3TUPA 2KT5A 5KG7A 2A3ZA 3MX2A 5HRRA 4DSLA 2VBWA 5HOOA 4KT0C 3V9ZA 2GIRA 3H45C 2VFTA 4FF1A 2XZDB 1H2UX 2GO9A 2ZH5A 4Y1CA 3TARA 3LA0A 3CJ1A 3WQUA 2AJ0A 2DEIA 1S0NA 4ANEA 4X65K 4GKKF 4FDFA 2BE7D 4LUBA 2DHSA 3A1YG 3QLHB 3CJQA 3CIPA 2Y8WA 3CPEA 3TU5A 3OTOJ 4CNYA 5HP1A 4DV2K 3MMJA 2FXUA 5JVHQ 3Q83A 3BBCA 4QR2A 5FPDA 1YITS 4DU4A 2ZC4A 2KM8C 4JI8F 2EVZA 4PL7A 4LF8K 2QN6B 4BBYA 2N4DA 3W2VA 3R2CJ 4LRBA 1JJ2R 3M5RA 4EO8A 5DDRC 4W4MA 3PSIA 3H08A 1JLEA 5U47A 3LUYA 2L9NA 1LWEA 5HL7Q 2QTWA 2W9CB 1XNRK 1EJ7L 2DO0A 2OD6A 5KFBA 1BIZA 3OVBA 4JD2A 2WBRA 3EXCX 4NCAA 2HURA 4CM0A 3BQ0A 3C8YA 2QL9B 3IKMA 4L3NA 3I82A 4Z4GA 4TY8B 2XO6A 1MNEA 2JH3A 3VAJA 3DRRB 4DR6J 5JVHL 2HVEA 4LIRA 1BGXT 5I42A 1VSMA 5M1KA 1KFSA 2IRYA 5ADZA 1HPZB 1TK8A 2CQ3A 4LF2A 1BCOA 3T1YJ 1KAXA 2DGVA 4DV6J 2ZZMA 2GIFA 1TKZA 3VQEA 2LKZA 2GJFA 2OUGA 1RHJB 2VG5A 2JEGA 5HL7L 5KG2A 4BC3A 2H5JB 3FVYA 4IBNA 4N41A 4FK0A 2ITGA 4LF7K 4DX6A 1HR0K 3SQGB 3QFWA 1S1WA 2B6AA 5LMNK 1VRTA 3MGJA 4FSVA 2NXJA 4A59A 1ZTWA 1BA0A 4CE9A 4CD1A 2Q36A 4ECSA 3L7OA 1LFWA 3T5HA 4NZ7A 3BQ2A 3I0RB 3HKZD 2G8KA 3EVMA 4IOCQ 5KTQA 3TAMA 1OH7A 3NH1A 1V3RA 2ZZTA 2DPJA 2CWKA 1F9FA 4YOUA 3RZAA 2ZOFA 1YTYA 3U6FA 2QWPA 4OPJA 4H8KA 4CIEA 2E44A 3SBMA 3TVKA 1N36K 4O8UA 2HZCA 4DJBA 3DDKA 1VSDA 2FJEB 3B4DA 2RHSB 3OYNA 3R9LA 1SXLA 3LTOA 3HMJG 1U47A 1SJ3P 3CVKA 3LDPA 3GG0A 4B8AB 3TEHB 4A8FA 2OO4A 2I2YA 4EU0A 3R5CA 4KHQA 3E9PA 2XSJA 5AQZA 4IOCL 3AHPA 1BD6A 1NK9A 5AQIA 3QEVA 2QRRA 4CJKA 2ZOMA 3PV8A 1TYQA 2Y8YA 4NRTA 1Z1ZA 3RMAA 2EXUA 2PFDA 2HVZA 3JAMU 1DGKN 3RRGA 4JEPA 3VEOA 4W90B 4OLBA 1VSIA 2PFUA 4QOTA 3EE9A 2BX6A 1RT4B 2JWLA 3N28A 4GW6A 5DLGA 2G0JA 1MDUB 3GIRA 4I1TA 2HFOA 4ZP9A 3L2UA 3O8MA 2BW7A 3ENAA 2DNGA 4ETZA 3I87A 3KIOA 1P9QC 4XAKA 3ZXWA 3IAM9 1FFWB 1RT3B 2U1AA 4CLYA 4DX5A 4MIAA 2R4FA 1S48A 5KFWA 4CK1A 2CQIA 3IG1A 1B4SA 1DZ5A 3ILOA 4DR7J 3UKUB 1X4DA 1LNQA 1KCFA 4U7BA 1S10A 1KXPA 4PG4A 2MKJA 2BM1A 4KHNA 4BACA 3PXGa 1G4CA 3MAAA 1AUDA 4B1UB 1QQNA 3D1OA 2ZBQA 2W8KA 3OBIA 3ENQA 3J7YU 2R7YA 2CQGA 1BY9A 2O8BA 1ZZNA 4I7FB 2VIHA 3W62A 3TSUA 1R8AA 1WD6A 2K06A 4BQLA 3BGUA 1HBNB 2GQQA 4V19J 2ADCA 5FPEA 1NJIT 3AT1B 3FBFA 1A5XA 4DUYJ 3TNVA 3EN9A 1GK8A 2RILA 1SQFA 4A4JA 3VOVA 4NRUA 3K5PA 2W9BB 5KFOA 2Y0BB 1NNDA 2FHMA 5A6WA 1SH3A 1WORA 3T6JA 4OJ3A 3CCUS 4JV1A 2IY5B 3RSEA 4KHWA 2BRKA 4J2DA 4JI4F 4ED5A 4BC9A 2FZCB 3D54A 4LREA 2QA4S 4YOVA 1SL0A 1E3MA 3GBTA 1NGFA 1XN9A 2W42A 4K2XA 1IKWB 1WC1A 2ASPA 2Q3PA 1Q16B 3A2FA 3HXMA 4C11A 4ZLLA 1RBSA 2UUTA 2FPHX 3ENVA 1BL3A 3Q23A 4Q2MA 2D0AA 1TUUA 4ED7A 2OPRA 1YJ7A 2NUBA 3ZZTA 4TU8A 2FVSA 4X65F 4ID5A 4KFBB 3TWHA 3Q8UA 3AVFA 2RAQA 1DEJA 3QJPA 4OKJA 2PYJA 4RW4A 1RAJA 1RT6B 5B0FA 3W61A 4FWLA 3NNHA 4LFBK 1NK0A 4B3TJ 3F44A 2R9LA 2X74A 5AQMA 4DPUA 1FHTA 2QLBB 3KK7A 2OHDA 1RISA 3UD5A 4DMZA 4DPYA 1KFDA 3KJNB 3SBGA 1RCXB 1HNXK 1TKTA 2IDEA 2ZKTA 2CPYA 5KRSA 2XY7A 4F8RA 2DHHA 2HQGA 1JLAB 3MN5A 1JMTA 1Q8LA 1HI0P 2LMIA 2J0WA 1GEHA 2CPEA 4Q44A 2ZH9A 2A42A 5J1NA 3AV9A 1KNZA 1EZZB 2ZH1A 2UU9J 1SJRA 4WQ5A 5J2MB 2E7VA 5HN0A 4KHUA 2LYVA 1URNA 5KGWA 4B9VA 4FXDA 1REVB 1Q5YA 1Z26A 3TAEA 2NXCA 3OTDA 1QQCA 3PDNA 4OZNA 2RDJA 1UWBB 3FZFA 4ECZA 4J2AA 2B51A 4F4WA 3NBPB 4YORA 3M6WA 3TTFA 2GVZB 4A61A 4RLEA 3DM2A 5ETRA 4R0JA 4PL8A 1JXEA 2JEFA 2E9RX 2WSCC 3A5OC 5GINA 3CCRN 5E26A 3FQLA 1N5SA 2DK2A 2HHWA 3MPWA 4M5MA 3ZT3A 2BM0A 4DV7J 2UUBJ 4KYZA 3HHLC 3PX6A 4JRQA 1HWKA 1HR0F 2Q1LA 2GIQA 2O8DB 1U0SA 4BRAA 3CCZA 3PUFA 2DNLA 2V50A 4GVMA 1JL1A 1P1LA 2B7BB 5LMNF 1K8KB 2FSKA 4WP3A 1RA6A 2HPUA 1VSLA 4YOTA 2G8WA 2VC0A 4QWBA 1GXTA 4RR5A 2AJQA 4NYZA 2GMHA 1VQ8N 3ONQA 3L3VA 1RTJB 1RAGB 3PYEA 4JV2A 1U0HB 4OL8A 1ZBLA 1LQ9A 1NLKL 4JUZA 3AA2A 2O5DA 3DGPB 1JJ4A 3OS2A 2GS8A 3GR1A 2MSSA 3R6GB 4N56A 3Q8RB 4FWSA 5HRPA 3IN5A 3VTHA 2C3YA 1VYAA 4Z7YA 1DKGD 1EKRA 2AJ1A 1BO5O 2R7TA 3OXFA 4PWDB 2DHXA 3H7HB 3CJKB 1X0PA 1QSYA 4DV4F 3D2WA 3AJ2A 1XBWA 4KY3A 2KU7A 4DR5F 3CJ9A 3N5BA 2D0CA 1HI8A 1WOSA 1H2VZ 2VDIA 2Z2ZA 4FYYB 3QZ7A 2JLEA 5KFQA 2ZE2B 5LJWA 1CXUA 1N48A 3NH2A 3OYMA 3RWUA 4I64A 4Z37A 3NAHA 1XC3A 4DN9A 3VAHA 3NCIA 2IJRA 2W7OA 1FX2A 1C0FA 4BS2A 2BOAA 2Q1NA 4CFCA 4JKAA 5CE3A 3G10A 4EGLA 3S3NA 2OPPB 1RI7A 4H0TB 1QQMA 4BCAA 3AD7C 3H5SA 5JUMA 4A2AA 1QSLA 2VICA 2P9PB 1RACB 3I4HX 4FW2A 1EX8A 2VFVA 4WYLA 1KKHA 3V9SA 1ICEB 4M5KA 4CI6A 3Q7CA 2CGKA 2IC3B 1QZ5A 4IFEA 4H4OA 2R7RA 3VQ4A 3O3LA 2XHWA 1NGHA 1WG5A 1I51B 5HQMA 3KXDA 1VBYA 1ZZFA 1PAEX 1NNEA 4HTJA 2CG4A 3MR7A 2XS5A 2HLTA 3M8YA 5C0YA 5DZ6A 2WVBA 3DLHA 3K8VA 4K2JA 4DV1K 5KFKA 4M3UA 1FRIA 1GAOA 3LP3A 1CQNA 5BXIA 4GC6A 4AM6A 1I94K 3KLEA 4CERA 3BF3A 3N5FA 4CFAA 3KD1E 3IRXA 2PBDA 1JLGB 3RMDA 1FEEA 3KKSA 4GKJK 4CHQA 3VQPA 1FF2A 1OSCA 1YTAA 4B3SF 3NCQA 2NSCA 4L74A 3V5RA 2J0XA 3KUGA 1JLQA 2DH7A 3J7Z5 4PQUA 3OTCA 5DQIA 3O6QA 4A8OA 4ED0A 3JSRA 5AQFA 1RTHA 1A9NB 4PKGA 2R8JA 1BG3A 4DHYA 1SQKA 4CGDA 4V1Ak 4J9VA 1TV6A 1CSJA 3KD5E 2EFVA 2ZH4A 2QTDA 1S72S 5KAKA 1S1XB 2O8FA 3M30A 3MWBA 4RWWA 2DGQA 4GV6A 4JI3F 1FJGK 4DU1A 3VGSA 3LP0B 2E29A 3AQOA 4OJGA 5L1JA 4BR7A 3W5YA 4DWIA 4OPAA 4RW8B 2VOPA 2PGCA 2QYGA 1GMWA 1WAJA 2CH5A 1FNMA 5KFCA 3QICA 4M3TA 1RBLA 3IDHA 1LW0A 4IRDA 4ZHRA 3SPYA 3LP1B 5CHIA 4UY8O 3NS6A 1BXNA 2K8GA 4OYIA 4LF5J 2CNOB 2HAFA 2G2YA 2IYGA 2BJ1A 5AQRA 3H3OB 4LFBF 1RBAA 4WP8A 1GNKA 2AYMA 4IUFA 4CBWA 4O3SA 4CK3A 2E88A 4HHHA 3WIUA 4CEAA 1OQ3A 4CGHA 1DARA 5FLXY 1YLXA 3G6VA 1SIZA 1HNXF 1T6DA 5IXUA 5CZ1A 3TRGA 3G96A 1UEUA 2YKPA 5BREA 3I5CA 3MOZA 4KHPJ 4DSIA 5L1IA 2CJKA 1FE4A 2FLOA 3OYEA 5AFUH 2KHCA 3PW4A 3MCAB 4OFZA 1NGDA 2DYAA 3DDIA 2DXEA 2C42A 3TX0A 2R2SA 3POTA 4J2EA 4I7FA 1K73T 3EYZA 2YHXA 3JYTB 3D5MA 1HBNA 1OPZA 3NVKA 2ZZNA 4LSZB 1MU2A 4DKWA 2AEJA 1C1CA 5L1LA 3TAPA 1HWJA 2E20A 1YVFA 3R5AA 5AR0A 1TU0B 1VDHA 3W60A 1KQKA 4HACB 3I0SB 2C2EA 2D3OR 4FZXC 3K59A 3E3XA 3JTOA 1VQKS 1VSKA 1NPKA 5KFVA 4FS2A 2MB0B 2NREA 3CM6A 4ZVOB 3MUTP 2YPZA 2ZM6F 1U45A 4EK2A 1DBDA 4DQRA 5JS2A 2UUAK 2UXDF 2B4JA 2Q3SA 5F8NA 1A5VA 2E2OA 3T5KA 4KREA 3TTCA 3V2UC 2CPZA 4ZTJA 4PKIA 4C4WA 3C14A 1ZBFA 4NL5A 1MMLA 1EHWA 1ATRA 4KBIA 3NWRA 2F9DA 5J2PA 2JFDA 2HVHA 3UDVA 4HYKA 5GAGP 1N8RT 1FTCA 2C28A 3IBFB 1KHWA 1N32J 1L3SA 2HNDB 4U67Q 4AQYJ 5HLFA 2YWWA 1AZSB 4DR1J 1T3NA 1OY6A 4OZ3A 1SL1A 5AQYA 1LWXA 2G13A 3JTNA 3LDOA 2P9EA 2BBEA 3QSIA 1RT2A 5MAOA 3RMCA 1ULRA 1Z6RA 3FCWA 2UXBF 1R89A 1HWUA 1SQGA 4N7TA 1S99A 4DR3K 3I33A 2BYCA 5F0WA 4X66J 3VF6A 2FHJA 2AX0A 4M5NA 1CJTA 3TAQA 5J2MA 4A47A 4DU8A 4G6VB 4U67L 3LQVA 2P9NB 1Z4UA 1NJZA 1U49A 1TR0A 1ZETA 4L6V3 4YOYA 4JI7J 1RDUA 4HH1A 2E2QA 5DGAA 2HBMA 5B09A 5ETPA 4F3MA 5A8WB 2H3EB 1FT8A 4HL9A 2GVZA 1U2RA 1EQYA 4CNZA 5AQQA 2H54B 4WU2A 2CG8A 4J9KA 3KJQB 1B0TA 1NB2A 3OL8A 2J7WA 3OTOK 3GONA 3WNHA 3EGNA 3VALA 3CCMS 5A8KB 4Y65A 3VHQA 1PYSB 2R2TA 1E6YA 4CJEA 3TR5A 3PW5A 2O8DA 2HYIB 2B43A 2HHPA 3JSYA 3ZEUA 4FLVA 1T7PA 5KFUA 3I31A 4N76A 1R0BG 3MXJA 2QEXS 4O8KA 2C22A 1LWFA 2XGQA 4M1KA 5I3UB 1T02A 3UE2A 3AA9A 3D0HE 1WSGA 2G8HA 1MROA 4GNIA 3MURP 3VZHA 4LVNP 5DJBA 2ZFHA 1RTJA 3PEHA 5DQHA 3WX8A 2V67A 2OTJS 4JLHA 2CJ9A 4DV1F 3TJ8A 2ZQBA 5HVHA 3NL0A 4Q7AA 4DR6K 1I94F 5H9FJ 5F0UA 1NXIA 1G6BA 1VFJA 3QYYA 1HYSA 3ZTPA 5EVZA 3MCOA 2RB7A 2ERRA 4DOZA 1R0CB 5IT9Y 3O9UA 4I6MA 4I4BA 4KAZA 5EU7A 1UJ4A 2UVVA 4NYOA 3MUVP 2MKIA 4PWDA 1FW6A 2RD5C 3ZSYA 5JJBA 1SKRA 4IRKA 3CI5A 3ZSWA 5CYMB 3OHRA 3VGMA 1FRLA 3CJ3A 3KMSA 4B3OA 4Z0UA 1S57A 3FE1A 2FLLA 2QL7B 4WFNQ 3W8PA 4OX9J 3CCJS 1HNVA 2W40A 3CDBA 2CVIA 3M05A 4RBTA 2GVDB 1HQUA 4CM2A 5KFRA 5EDWA 4TYBA 5KT4A 3MEEB 4NYNA 2EK1A 3IAS9 4AHTA 1IJJA 1D09B 2XGPA 3FSYA 3FJ2A 1MN9A 3DLBA 3LGMA 1SJFA 1D4XA 3Q89A 3WBZA 4L72B 1NG9A 1XMOJ 5AQKA 1F2HA 4ECRA 1NGCA 4K42A 2WOMA 4AL5A 1U48A 5CA5A 2Z4PA 4DHVA 4AHUA 4CI0B 2RE2A 1AXQA 2QFJA 1HYVA 4YHHK 4OI0A 1TL7B 1LOUA 1F2GA 2MZ1A 3CJ0A 1R8CA 4C97A 4JI1J 4BRCA 3LF0A 5A76A 4WFNL 3SCKE 2DFFA 3F41A 4LC9B 1YDLA 3KLGB 3MUMP 2HOEA 1NWKA 1M5KC 5D3GB 5KOXA 4FJMA 3A4TA 5LL6d 1BIUA 3WZ0A 3J81U 3GLJA 3MPUB 1UPPA 3FEXB 2RF2B 1WC3A 3SQ0A 4B3RJ 2NRTA 3FFKB 2YWGA 1WI8A 2MZRA 4DR4J 2LSNA 2IDOA 3MF5A 3W0LA 4K43A 5D4OA 4FWOA 4FJIA 1AA1B 1SH2A 3DLKA 1ZBSA 4Q45A 4HTIA 3PYGA 1WC0A 1YIJN 1CQMA 4KBOA 4C8OA 1M1GA 1J9AA 2WONB 1RP5A 5AZJB 1UPMB 5EWEA 4JHDA 3EDRB 3CDWA 3EICA 2QX0A 2KJWA 2NPFA 2E5GA 3DOKB 5GIOA 5LT5A 3TWZA 1YVUA 1FD8A 3BJYA 1RBVA 1DTQB 3CD0A 2XC9A 3LDSA 3LGHA 2FYXA 4WP9A 3OHAA 3JQMA 3G2XA 3CC2S 1RAIB 5CYQB 4ZPDA 3OR1B 3KKFA 3NGUA 1Q7YO 2UUAF 3NLCA 1ASVA 4E1JA 3HHLA 1HW9A 3CO0P 1YJTA 1YRUA 3MDFA 4CZEA 1ZAXA 2HQCA 1B3TA 4NZ6A 5J1EA 1S1UB 4QZVB 1TQLA 1ILYA 3R3LA 3TJAA 1P90A 2G1DA 5KG4A 4OYXA 2ZBPA 3ULEB 2HWHA 2ZOGA 4O4RA 5AXNA 2FLNA 4RNFA 4OKEA 4OLAA 1S97A 4NA2A 3N4PA 4LBPA 2RPIA 5DM7Q 4J9RA 1WB9A 3G82A 3ZSQA 2PMZD 3O9TA 2JGUA 1RHKB 4QIGA 4B17A 1T9VA 2QWLA 2L48A 2XWYA 3RRHA 1Q7LB 5HMZA 4E19A 1VQKN 5FLXO 4RTFD 1S1TB 4QW9A 1UETA 4ED4A 5SUHA 4J91A 1VBKA 1QVGM 2WTUA 4YN3B 1N5YB 3B4MA 3U1LA 4L3QA 4DR3F 4C98A 1IBLF 2A2CA 3O9RA 3RR8A 3D1HA 1N4LA 1NSQA 2JOQA 3CCEN 4NA3A 1DAXA 1NRKA 1IG9A 1WUAA 4FWPA 5EOYA 1GX5A 1D0EA 3A5NC 4CEDA 5DM7L 3GIIA 2IM0A 1AUSL 4OYBA 3DXMB 2E8AA 4EBDA 4R79A 3QO9B 1CJVB 3R97A 2P6TA 4P2XA 2HMIB 2MJNA 1GTEA 3V1RA 2M4MA 4CJLA 2WFBA 1RTIA 1F5BA 4RU2A 2F8SA 1PYOB 4KI4A 3MPYA 4B3TK 4G1IA 3DU5A 3HD2A 2B8QA 2WZ1A 3OTOF 2Z2MA 5K8MA 3L2WA 5DQGA 3MK6A 2DR7A 3AXKA 1K9MO 2YX1A 3C46A 5GVQA 3H5XA 3C95A 1IKXB 4DMNA 3NF9A 4WTOB 5BPLA 5CQGA 3SCLE 1DT9A 2P5VA 2HNDA 3K9KA 2CZ9A 3AQPA 3HULA 2MGZB 3W64A 4Z4CA 2UU9K 4CF8A 4CD3A 3L9ZA 2ZUAA 2HGLA 5FDLB 3AODA 3D6HB 4QW8A 3OV7A 1VQ4N 1JJCB 2HBRB 1R8BA 4CZMA 3PW7A 3ENBA 3ZT4A 4EWTA 2XY6A 3HPGA 3VEVA 3FCVA 2VFSA 4R0EA 5FPMA 3UKRA 4DR6F 2NZCA 5E33A 3SNNA 4WQ4C 1CJKA 2AMCB 2A10A 3AAWB 2FJDB 3T1YF 4P52A 4BR9A 4DV6F 1S9GB 5L46A 3MEGB 2J0QD 4KQZA 1TVRA 3RRKA 4CEQA 2C3OA 4C6AA 2BQRA 2CA9A 3NKYA 2P9NA 4DV7K 4RCHA 2A6MA 3C6AA 4ZVPB 1HBOA 4ZTFA 4RNHA 3CMQA 3RVCA 4DTJA 4FLXA 1SV5A 2XMUA 1JLCB 1R0AB 3UE5A 2R7OA 3LWLA 4ZN3A 2QEXN 4CJSA 3P4IA 1VBZA 2DH8A 4WKYA 1M0SA 3A3OB 1NKEA 2J0SD 3RW6A 3DMJA 1BWVA 2CADA 1VMBA 5BYRA 2CQPA 4DLEA 5BR8J 4W98A 5BJRA 5BN8A 4LBIA 3C66A 3T1HK 2NZ4A 4ECXA 1WSEA 1QQOA 4ZPAA 2QWQA 2MZQA 1H98A 5HJYA 2I5JA 1VK3A 4J5OA 4WK3A 5KPTA 4OPHA 4JI5J 1S22A 2IOCA 3DXKA 3BKUA 3HCXA 4PG6A 4FZZA 1RT1A 2CKWA 1TK5A 3BN7A 2KN4A 1VIOA 2YKNB 4DV5J 4HUFA 3RU0A 4JYAJ 1BDGA 3LALA 3WT0A 2M3DA 1FFGB 4IH6A 2JNJA 1NEEA 3CCJN 2MMYA 4Z4HA 1VQYA 4ZMMA 2NRVA 2IRXA 3V6KA 3IWXA 3DNCA 1UL3A 3BQ1A 4FOEA 3VPZA 4CLFA 1S59A 3J7AN 2Y0SD 1JIHA 1IBMJ 2P9IA 4NLOA 2DPNA 1HL6A 4H4KC 3O3GA 3VAIA 2BE2B 1CLFA 5C12A 5IT9O 2LQ9A 4Z7CA 4JI6J 4AH9A 1C0UB 5K20B 2DHAA 3CJCA 2GMJA 3VQ6A 3DRXA 1BUPA 1F1BB 4LF4F 1FERA 2ACYA 2BABA 3KLIA 5ETMA 4Q8EA 1VQSA 3AH6A 1Q53A 2KFYA 2ZH8A 1H38A 1YX2A 2RNEA 4HVJA 4OGCA 2V2QA 2YHAA 3PO4A 3Q7BA 4Q43A 2ZD1B 2PIIA 4I2PB 4G9ZA 4TVAB 4XPEA 4QWDA 2EPIA 1B70B 2POKA 4IH7A 2KI2A 3QNOA 4RNOA 4UOFA 3MEEA 5DDPC 4PHTX 3FFIA 4BRMA 2LCWA 4FF3A 1OO0B 4PUOB 1OQ6A 1CULA 2Z1IA 4DR7F 3TSPA 2BXJA 4F3OA 3THYB 3J80O 3FZ2A 2WVDA 5D4LA 3MMBB 1SKSA 4MH8A 4DXLA 3QPIA 4DFJA 3BF4A 4PG5A 4USMA 1SC4B 3NGDA 1RTDB 1VQNS 1C0MA 1NHKL 5IM0B 1QD1A 1Z2LA 1W2IA 1MWMA 5IWAJ 3LP2B 3W5XA 2EI5A 2JC0A 4NLCA 3QINA 5D3GA 1NH7A 4A8YA 2XBPA 1GTHA 4EO6A 4C48A 3NMAA 3S6EA 2ASLA 3QT6A 4QQBA 4K50A 2PO4A 4ZCKA 4DUYF 4A2BA 1UCNA 3CC2N 1QVFM 1NDPA 2BMBA 2RS2A 1C4AA 4UF4A 3UNGC 1VBXA 4R8UB 2H1YA 1OYEA 5TKWA 1RHRB 1RWPB 3H5YA 5DG7A 3E01B 2ZJQQ 1U1MA 3ISNC 2V52B 4AFFA 5D0HA 1RU1A 1HHTP 2Z1JA 3QRQA 7AT1B 2I7PA 4HHUA 3CF5Q 2HFNA 1WG1A 3HPHA 1KQGB 1OPIA 2W2QP 1S4EA 4UY8T 2JFKA 1VC5A 4NWBA 5DG9A 1RSCA 3QRPA 5HROA 5J2NB 1C6VA 3JQKA 4O44B 1VR6A 1W7AA 2F4FA 2BANB 2VG6A 1N6QB 1APSA 3I8BA 3OR1A 1LOTB 2M52A 5EXWA 4CLWA 1SZ2A 1VGYA 5LM7E 1S0MA 1NKBA 2E9ZA 4Y1DA 2EKNA 3M6UA 2ZJQL 2E1YA 1U1LA 1X9SA 2F9TA 2AW0A 3HDSA 5KG0A 2G8FA 2FD2A 2GELA 1A0OB 3CF5L 1W2BM 3SV3A 3L4QA 4ZPTR 2E9TA 2C3MA 1IBKJ 3HKWA 1VLOA 4XDCA 1U2VA 4EFHA 2FJWA 4LF8J 4MMOA 1Q82O 3AXMA 2UU9F 1Y00A 2HHXA 4Y00A 4ENOA 4I2QA 2HNYB 1NMEB 1VQ5S 3CFRA 2AZ3A 2I0XA 2ASJA 4KHRA 1PC5A 4CBXA 3HSGA 3KLHB 2HG4A 2ASMA 1RCOB 4DSFA 3A0IX 4CO3A 3P83D 4A62A 3O2IA 3GE9A 1XNRJ 2QJ3A 2KQ2A 3E8OA 4A8XA 3ZX3A 3MZIA 1FRXA 4K0KK 1XC9A 2HIQA 1QDUB 3O1LA 1PIEA 2BUNA 3M8WA 3M8QB 3EPIA 1KLMA 3TOQA 3MR6A 1U8SA 2HB5A 2OANA 2GGPB 2FJAB 1S1VA 1IUJA 3C16A 4DV7F 2UUBF 3D3CJ 2YNIB 1UFWA 2NRRA 3CJAA 1H7XA 2V2VA 4JV5J 4KTZA 1V6HA 3Q86A 2IIRA 1N32K 4BC4A 1BI4A 4OZJA 1HNZF 2LDIA 3H98A 1M1KO 5LY3A 3DOLB 4LF7J 8AT1B 4DR1K 4DI6A 1X9WA 3UW1A 5E3CA 2NZTA 3BGFA 2V4RA 1RYSA 1GLDG 3RJMB 4H5WA 4QWAA 3H3NO 2HRTA 3JSMA 5LMUK 3A13A 4KH0B 1LAVA 1LCUA 5KT6A 4BC5A 2BA9A 3D2EB 3QSYB 1A5WA 3DLGA 2W7PA 1AYEA 4FZVA 2FZKB 2L9WA 3K17A 2VKRA 1U25A 1S4FA 3OA9A 3MMAA 3GFXA 2FGCA 3DU6A 2CZVC 3FZKA 3IXQA 3PACA 2KXFA 3AD8C 2CPDA 4JKDA 1X5OA 2MHNA 2X1GA 3GJSB 1EWRA 3AO5A 1ZM4A 2ZKUA 3OXLA 5ELZA 2O8CA 1NU4A 4MLHA 4UQTA 1N36J 3ZNJ1 4JI7K 3B54A 2RUSA 1RILA 4ILRA 5A8RB 3CC4S 4IWVA 4KE5A 2VWJA 3BGRA 3QMQA 1S0OA 4CEEA 1NJXA 2DR9A 3HFVA 1P6TA 3C15A 3K7RA 4F2SA 4P6QA 4KH4A 3SDEA 1IH7A 2HRUA 1EKEA 1TUWA 2O8EB 4CT9A 2Q79A 3GTYX 1YBAA 3MHYA 4Q8FA 2AQ4A 2O4GA 2P9SB 2W2NP 3MEGA 2HBQB 3MM9A 3EE3A 2YNFA 1T94A 2QSFA 1KAZA 3DHWC 3LW5C 3J7ZO 2X51A 2GAGC 2E6MA 1RBTA 1HUXA 2VPZB 1JLCA 2CJAA 5A0YB 3PKMA 3S9HA 5HBMA 1TKXA 2KG1A 3TX8A 4GO7X 5IQ6A 1RAFB 4RUHA 4DL3A 2AA4A 2BJ3A 1UOCA 3R1LA 1NZ8A 1DJ0A 5AXMA 3G71N 2AIRB 3D6MB 3TEGA 1Q1KA 1X5SA 1M5HA 1SCJB 1YJVA 4M5HA 4ZPCA 3NAEA 1FESA 2Q0RA 2WUSA 4CFBA 4FBUA 2PE8A 4X4OA 1O0PA 1X7VA 1Q18A 1SS6A 1CC8A 3LM9A 5H9FK 2QLJB 4ANDA 1KP6A 5G0RB 3NGKA 4YOWA 4QYRA 3UCUP 4G1QA 2ZNYA 5KPRA 2EW9A 2Z2YB 5IV3A 1UWAA 2KFZA 4LSLB 3WHIA 1NH8A 2ABYA 5M1FA 3PIOL 5EN1A 5DRKA 4CHOA 1N52B 2N4CA 5GADI 2DNYA 2XI3A 3M2RB 3HZ6A 2XM3A 1FDNA 1A7GE 5HAOA 3SQ2A 1UVMA 1YWXA 5BPMA 2E1AA 3KHRA 5KOWA 4IDKB 3DKDA 4OZ5A 1SUQA 1C1AA 2NPIA 4M3ZA 1RA7A 3OYKA 1TK0A 3HJFA 4BR5A 4DX8H 2HIYA 2ZUGA 1CEZA 3C7NB 1C0UA 4DG1A 2XMMA 2C3UA 4K8RA 4TN2A 4GC7A 2O3DA 3AFGA 3VGVA 4EUVA 5IFMA 2JVRA 2V8PA 3V6JA 3WXIA 5IS2A 2RQKA 1XMOK 2KTQA 1VOMA 3W9IA 2M5YA 4LBHA 4DUTA 4PPZA 3GL1A 1G3OA 4IO8A 2HFVA 4FLWA 4CEBA 4DTUA 4B9QA 1VCTA 4LF5F 3TQ1A 4JI1K 1WKJA 1F60B 3H5UA 4H4MA 3PJXA 4P71A 1FVSA 3Q2TC 2W01A 4LF6K 3MM8B 2YQ1A 3OUYB 2P9GA 1J5OB 2M8HA 3BR9A 1V3SA 2GX8A 4KHMA 2XYHB 5DDQC 1JXLA 2OPSB 4HEA9 3SUNA 3NRBA 2LQJA 4IO1A 3MPVA 4KHPF 1RU2A 1L3VA 3AAPA 4DS5A 3QEXA 2YY3A 3RYLA 3OR2B 4DR4K 1JXVA 3MECA 4DB3A 3CJTA 1XQSC 4CF1A 3ITHB 2YNHB 4O3RA 3PJWA 2E5HA 2Z8QA 2GQCA 2XYPB 1HARA 2PMHA 1FKOB 1FA0A 2PY5A 1IKVA 5C42A 3EGZA 2GV1A 1R31A 1SAZA 2KRRA 2HBZB 3JTPA 2DTJA 5KFIA 3GCXP 1WAFA 1T9WA 2UVWA 3DI6B 1RABB 1S77D 1SL2A 2HAIA 3V6DB 2IVPA 1RAHB 1S9EA 4GVLA 2NQPA 5AJ3K 2VFRA 4WQ4A 3S7RA 1KC8O 5I4MA 2FHKA 4R8UA 3S3OA 1MSWD 3HX9A 1Q7YT 3UN2A 3PRDA 2YWKA 2P9UB 1IWGA 4NLRA 3AO1A 2DGTA 4UOHA 2A1RA 1EETA 3PG9A 1DTTA 3CJ7A 2YI1A 1EXQA 4CJTA 5DLFA 3UB5A 1XK8A 3CULA 4MFBA 5AQTA 4XH1A 1WOOA 1S3XA 2DPIA 4KPCA 2P5OA 4EI2A 3VQ5A 2KKZA 1B7YB 4V19X 3TO8A 4EIAA 5KFTA 1N32F 1MWZA 3WQPA 3DOMB 4G65A 4AQYF 2DO4A 1RGVA 2BANA 4DR1F 4RBVA 4BR4A 3OFFA 2MQPA 2EHGA 3F9MA 5F8LA 5GMKa 2PA8D 1WDTA 1HMVB 2NXUA 3HHDA 4CO4A 3CMES 5BRFA 5LOQA 3M2VB 4F9OA 2HGNA 4X64F 3HTVA 1WKKA 3NNAA 4RW7B 1YQHA 2LXIA 1RWVB 4DCPB 4OI6A 3BH6B 3J80U 5BR9A 4RW9B 3BPDA 3U7JA 3QBWA 4X66F 3PW2A 2LDYA 3MTKA 3CCQS 2V34A 4WPAA 1U24A 3SYZA 3P38A 3DRSA 1N56A 1WUUA 2X78A 1YJ9S 5EX5A 4MTPA 3KLHA 4JI7F 4Y2KA 1Y3KA 3IWNC 1IJFB 3MM7B 4H4KA 4BRLA 5F3TA 2RKIB 2B5JA 5CD4H 2E1MC 3GWCA 2RE1A 3GQCA 1MMDA 1OY8A 4HCBA 1UP1A 4CVNE 2BH1A 3M8QA 3ZSXA 4G3IA 2MKHA 3HHEA 4USHA 4IG0B 4DSEA 2NLWA 2E6LA 2AJ4A 2AEMA 3ZSVA 4WF9Q 4J8FA 4BE2A 2W2OP 2VWKA 2CJQA 2AYBA 4IDHA 2ATLA 2OMOA 9RUBA 1BHNA 4IOBA 3DRPA 1H2TZ 1NSPA 3LH2S 3MD1A 2KJVA 1KD1T 1B0PA 2O01C 1RCHA 1K8AO 4NX9A 2A1SA 2GJIA 3WXJA 4RW6A 1EWQA 3FLCO 2ROPA 3QEPA 3HFKA 1Y4ZB 1NAQA 1X4HA 3U1NA 3ID6A 4CJ3A 3D7SB 2D1CA 1ZPWX 1PO6A 1WF0A 5HVGA 3SCIE 3UVJA 4TLRA 1WHVA 2IAJA 2ZDPA 4OYMA 5HMXA 4BGAA 1ZC6A 4KRFA 2OEKA 3F56A 3VAMA 2XY8A 3HM9A 4WF9L 1IG8A 2DR5A 4M94A 1TAUA 2B9EA 4FPAA 4JNEA 3K2YA 1BHLA 4CK2A 3ENOA 1ZPVA 4QIWD 1S6PA 3HVTA 5KG5A 3PNIA 2HVIA 3BEGB 3CNQP 2HQIA 3ENWA 2NXEA 1VAZA 4FVMA 1GMWD 1M5VC 1NDCA 4EEYA 4DTPA 4EP5A 2YHBA 1WSIA 1IKYB 2IMOA 2LVWA 5HMWA 2ZEJA 3U27A 5F9LA 3KHGA 4OX9F 3SJJA 3GFYA 4LT6A 5DO2A 5H1SQ 3THWA 2O8EA 3U9DA 1C1BA 5D4NA 3G6ES 1CJUB 5CAAA 3M6GA 4FK4A 5BR8K 4RL1A 2KZMA 2P9SA 2LECA 4OV1A 2VONA 3W3DA 2ZWOA 4RX6A 4JKCA 3SFUA 2CIMA 3VAFA 1UW4A 5M2RA 4IG3B 3BBFA 3KJVA 2RDDA 3FK4A 1HRHA 2HHQA 2F7TA 4FJJA 1QZ6A 2YWHA 2KDOA 4YR2A 1FJGJ 5B0GA 4JI5K 4CEFA 2V68A 4FYDA 2VBXA 3CPWM 2AKWB 4ZVHA 4HDHA 1FX4A 2VC1A 2W25A 4F4AA 1NK4A 4PRFA 4G1PA 4PYAA 3MM6B 3KWIA 5EX0A 5GADU 4DLGA 3IRWP 2HBJA 3GR0A 1BCMA 4K4XA 4K25A 1YJRA 2R8IA 4DF4A 1S6UA 3TZZA 3BGLA 2JWNA 1YVNA 1J5EK 3GV7B 2YQ3A 4Y34A 3MN9A 2QKBA 5EHHA 4B3RF 1VQLS 3AVMA 4W92B 1K47A 1B7FA 5EWGA 2JEJA 4DR4F 4UT4A 5KFZA 3CD5A 3H2VE 4O55A 3G4SN 5A2QY 2KYZA 1L3UA 4JI6K 2FY8A 4M3RA 1TL1B 4OHZA 2WAQD 3OHBA 2YWFA 3F9KA 4KGVB 4K4SA 4F4KA 3WNFA 2VGNA 4LY7A 1C0GA 2HGMA 3QIPA 4F36A 1FTRA 4YUDA 3CPWR 2V4QA 2OA8A 1X9JA 1NB7A 2I8EA 1T3VA 1QAIA 3OS0A 4YMEA 3V4MA 4OHVA 2X1BA 3C6UB 2OYQA 1IN0A 2CPJA 3VA0A 5C7PA 1R6VA 2HFUA 1T05B 3QZ8A 3QNNA 4CF9A 4R5PB 1P8ZA 2MQ8A 5AQWA 4CEZA 2L41A 1YAGA 1UA0A 2VA3A 3GP9A 4FOIA 1YBTA 3WUHA 2FHJD 1N0UA 2VUGA 2DY9A 3EKSA 4ANCA 3DFEA 2DCLA 3QGIA 1HBUB 5ETTA 2GWKA 3VQQA 5HO4A 2ZHAA 4DU3A 4OPKA 3K89A 3QNWB 3QRRA 5B7WA 2ZHOA 1BU6O 5K14A 4JI2K 3ZT1A 1Q95G 2G2OA 5B08A 2LXUA 5T14A 2P8IA 2E5LJ 4O3QA 2PSZA 4BVOA 1UVKA 2AYGA 2AF6A 4LFCJ 3K0JA 2YH0A 2EEYA 3D2FA 1M5OC 3V4IB 3CDEA 4NLWA 5L1KA 4CECA 2YNHA 3WC2A 3QDKA 4NLDA 4IR1A 3A5MC 1N34K 5HJXA 2CQ2A 4LSNA 3OL9A 2APOA 4RZRA 1M5PC 1TL3A 2BV3A 1FI4A 2MPUA 3EKUA 2J4RA 2HQ3A 4MK7A 3IO1A 4CJRA 4DCJB 3PZPA 2WC9A 1W0HA 3IUCA 4YY3K 5AQVA 3QWPA 4DSJA 3SEOA 2ZBCA 5JMNA 4LRCA 4FK2A 3ZTOA 2VQFF 1NM1A 4JAXA 2EBGA 2VG7A 2QW9A 4OI3A 3EWGA 3QJJA 3CMEN 4E7IA 5J2QB 3D0PA 1W97L 2CPHA 2AHOB 2KFNA 2VASA 4K4WA 2NUUG 4JKGB 4TU9A 4KKOB 4UTGA 3P8BB 3KDNA 2YH1A 1NOYA 5AQLA 2QT7A 3L6QA 5EY4A 1Q86O 4B9UA 1ROFA 1K0TA 4LF9J 3DCAA 1FRKA 3CCQN 4FPBA 3H42A 1IJEB 4M5JA 1Q82T 2ZJRQ 1IBKK 3DOMA 3KK3B 2CJBA 2Z1GA 3NF6A 3EZWA 1FWLA 4E1NA 1YJ9N 2DNRA 4NLPA 3I5AA 1V4TA 1PILA 4AF1A 2UVRA 2XLIA 3T9NA 1Q8BA 3NY0A 2RIJA 2CNKB 3QT5A 4OVLA 3EXYA 2ZDOA 2V7YA 1VISA 4CQ1A 2BEFA 3R8YA 1GLEG 3PM9A 5FROA 3D3BJ 5K9FA 4USWA 1VQMN 4KI6A 3H6EA 2V4JA 2VJUA 2EC2A 4Z4EA 1P27B 2B4PA 5AQXA 1HQEB 2YKQA 5B0EA 3BSCA 4X84A 4QCLA 3LDQA 3QT7A 5E7OB 4QIEA 2R7SA 4J37A 4ERDA 1HBMB 3K5LA 2ZJRL 4Y6IA 2DGSA 4AL7A 4ICLB 1FDAA 3MEDA 2QLFB 3HD1A 3TSQA 1RHQB 2RQMA 4BR2A 3M8SA 3OBYA 2MZSA 4CCHA 5AT1B 4ZPBA 4JV5K 3NCRA 1AROP 1M1KT 1F5AA 1VK0A 1H73A 2DXDA 3ZLJA 1VRUA 4JRPA 4ZVUB 1UTAA 5BR8F 3CGIA 2YKMA 2YQ0A 2MKKA 3RGIA 3W9HA 1D3WA 4EYHB 2EG2A 2GQ2A 4W5NA 1T03A 1YJNS 5HRSA 1NK8A 3HRGA 4FN5A 4PCQA 2I38A 2LU1A 2PEBA 7FDRA 4ISGA 4TU7A 4IR9A 1SC6A 3WEEB 4FPRA 1S76D 2R8GA 4JI5F 4O4GA 3JAMY 3O4WA 4ILJA 4M5LA 3UIQA 1FXXA 4KIAA 4U95A 1BC6A 1KLNA 4DV5F 3OYDA 4JYAF 4ZCMA 4WFYA 4YHHJ 1RBUA 4CYUA 3DYAB 5ETQA 1BE4A 2L9DA 4M8LA 1FK9B 3IS9B 5T7LA 3JB9k 4LD0A 3G6EN 2JSXA 3W2WA 5D4PA 2J8AA 3CCVS 2M7SA 4OZLA 2BJ8A 3IFEA 2W8LA 3SIPB 1IBMF 1WDDA 1WEYA 2F8MA 4YP3A 3AA5X 1HHSA 3G6YA 3QBXA 4NASA 3HHLD 5KFGA 1S6QA 4CGJA 5HSPA 4USIA 5FD1A 1BQMA 2QV6A 2V0NA 4Y3CA 1HJRA 3ASMA 1F3FA 1YUWA 4RJVA 2V63A 3J7ZT 3CUNA 2OTLN 4C9DA 3PCOB 1MWQA 2RS8A 4U7UK 4OHXA 3KK2B 3C94A 1FDBA 5KFNA 2KVQE 4NXNF 3PHEA 2AGOA 4NOHA 1DLOA 1NHVA 3N01A 2QFIA 5LSLA 2VCPA 1WOQA 3MM5B 3M2UB 4ZIVA 3DGVA 5KFHA 3GV5B 4C3KA 3ZETA 1N0VC 5HQ8A 1VJQA 4FJ7A 2CQ0A 2R2UA 2XI2A 3I56S 3AB2B 2CDRB 3P3DA 4IQMA 2MKCA 2LEBA 3P96A 2HHTA 1VQLN 1GFWB 1OSDA 3MMCB 2H4YB 2KT2A 4BVPA 4AYBD 3VQTA 4W5QA 2FC9A 4KTQA 1WHXA 1DFDA 4OX7A 3PFEA 2E4LA 3QEIA 1DQ9A 2QWNA 3W8GA 3EEQA 5F8HA 2AT1B 3AVAA 2O4IA 1QE1B 3LO3A 3L7UA 2CAJA 2NNWA 3UR3C 4M3XA 1I3AA 3UNYA 5IWAF 5T7BA 5D8HB 4BREA 4CJVA 3HVRA 2FHOB 4QJVA 4JKFA 4KV8A 4UZCA 4KC5A 1VQ6S 4CLZA 1JLBB 2P9LB 1XEZA 1CBKA 3AGRA 3QWUA 1WI6A 2VB6A 3KK1A 3M7VA 3BBBA 2IBKA 2DB1A 1J2VA 4UUXA 2ACMA 3THXB 4B9LA 1HLWA 3PRBA 1F5CA 1MWKA 1KVBA 4OO1J 5L39A 1UVIA 5A2QO 4EHUA 4B9TA 3C6HA 5KRTA 3KG4A 2ROGA 3RB6A 4CLUA 3V81B 2DNZA 4TXSA 3SPZA 2DKOB 2KL8A 3CHWA 4FS1A 3SI8A 2BKPA 4B9SA 2WBMA 1JQGA 3OYHA 3DDNA 4Y28C 2YBVA 1JKHB 4Z4IA 1KN6A 3ZZOA 3HYFA 4AHRA 1RT7B 1X5TA 3AO4A 3AY0A 3NWGA 2W6KA 4NE9C 3RW7A 2B8PA 4P2SA 1YBUA 1KS2A 4WIQA 2G8UA 2QSWA 3IP0A 2VF3A 4BHQA 2HSTA 4FWNA 3CJ4A 1HNIB 2B56A 4RNMA 4K7QA 3BO2A 3SSRA 1XR6A 4RWXA 4NO7A 1Q9YA 4R5PA 3L8BA 5C25B 4ELTA 3TI0A 2NRWA 1RWMB 1IVZA 4DV2F 4H0YB 3SQOP 5KFDA 2NYHA 1Y5LB 3CJ8A 3PO5A 2B9YA 3K9JA 2HWIA 2D7SA 3I55S 1LW2B 1QSSA 3MOJB 4LF8F 2GJ2A 2R3VA 1CS4B 2X7IA 1D9AA 4KGXB 2XMTA 1RZMA 4USUA 4DUZJ 2BTFA 3ETOA 2HNZA 3DLEB 1KC8T 1ATSA 2OGUA 3ATUA 1XNRF 2P51A 2K2PA 1S5ZA 2J6TA 4I0WA 3EMTA 4BDPA 2VL1A 1BMQB 3FZLA 1GH8A