3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
4JRPA 4CJKA 3SUQA 1NJXA 1KTQA 1TKZA 3IS9A 1CXQA 3VA0A 4CIFA 4FJJA 1RTDA 1TVRA 4CHQA 5KGXA 3RTVA 4O0JA 4KB0A 1IKVA 4BDYA 3AO4A 1RBTA 3CFRA 2Z1IA 2OPSA 3KK1A 4E19A 1VSKA 4CIGA 4KAZA 1WSIA 1GOCA 3DI6A 4KTQA 3QLHA 1KCFA 4CJWA 1QTMA 1JL2A 4FM2A 1QSLA 2E6LA 1SKWA 2OPPA 3V81A 1JKHA 1VSHA 2VG6A 5KGWA 3HL8A 3NH1A 4KHQA 3HSTB 4CEQA 1KLNA 3PX4A 3VQQA 4OGEA 2HNYA 3LZIA 1CXUA 1L3SA 4IKFA 4OLAA 1RBRA 1VRUA 1X1PA 3CM6A 3KK2A 3QNOA 1X9WA 1LWFA 5CZ2A 4F2SA 3C6TA 3SJJA 1B92A 4W5QA 2DFHA 4CHOA 4GVMA 1HYSA 3HYFA 2EHGA 3U3YA 4AHRA 2G8WA 2GBZA 4CFBA 4AHUA 1L3VA 4I9QA 2PYLA 4PUOA 4FLVA 1L3TA 5FROA 1S9EA 1TK8A 1KSPA 4AHTA 2Q3SA 3NH2A 4Q5VA 3O3HA 1S1WA 4AH9A 4ZTFA 4TSXA 4FW2A 1D9DA 3SQ4A 4Z4FA 3SI6A 4F2RA 4KRFA 2Z1JA 3VQPA 2IAJA 3KLEA 3D0PA 1WLJA 4PQUA 4EZ6A 1IKYA 4FJGA 4KTZA 1HRHA 1ITGA 5J2MA 4RW6A 3DLBA 3V1RA 4DSIA 5CY4A 4UQGA 4CESA 1C1AA 5KTQA 3QEIA 3ZSYA 4FLXA 1QE1A 4CF0A 1WAJA 1T05A 4OKKA 1L5UA 3L2UA 3MEDA 3KLHA 1IKWA 1JLAA 4C8KA 2RF2A 1MU2A 3DRSA 3QIOA 2DY4A 5JS1A 1JXEA 3WNFA 5HRNA 3SCXA 3M8QA 1U4BA 3HPHA 4M3UA 4KKOA 4IG0A 3CQ8A 2BANA 4B9NA 4M42A 3RMDA 4LSNA 3SQ0A 1LWCA 3IRXA 4J2AA 2Y1IA 1BCMA 4E1MA 3ZT2A 4ZTJA 3LP0A 4DTUA 1U49A 3OYAA 2YHAA 1IKXA 3ULDA 2YNFA 1U48A 3BDPA 1Y97A 3WNGA 1QSYA 2D0AA 2D5RA 1NK9A 3MEEA 3SUOA 1ZYQA 1DTQA 4AHCA 1S1VA 2Y1JA 2EX3A 1BHLA 1RDBA 3ZSRA 2G8HA 2HMIA 4CEFA 3VQCA 1RTIA 5SWMA 3TWHA 3QESA 3EYZA 1LW0A 4ID1A 1WAFA 1WSFA 1RT6A 3MXJA 4CFDA 4FJLA 1Z25A 3O4NA 2FBXA 1RNHA 4CHZA 1NJYA 2RN2A 1TK5A 1YT3A 2HVIA 4LY7A 4CEDA 3V1QA 3LPUA 2HNZA 1S1UA 3I0RA 4DLGA 3L2WA 3HVRA 4IG3A 4IDKA 1TL3A 4KHWA 3KD1E 4BE2A 4DTOA 2OA8A 4DMNA 3LAKA 3H08A 1D5AA 4B9UA 4O55A 5HP1A 2P5OA 3VQEA 3NHGA 3SUNA 1NKEA 3U6FA 3RMAA 1QS4A 1JLQA 3OS1A 4B08A 4DF8A 3S9HA 4F8RA 3PO4A 3AVLA 3BGRA 1KRPA 1KFDA 3LP2A 3AVCA 5HRRA 1XHXA 4GW6A 4RW9A 3MAQA 2VG5A 4DU3A 3PV8A 1J53A 4E0DA 2IGIA 4FJ5A 2QXFA 4FK2A 1UWBA 4CJ3A 3F9KA 3K57A 1C0TA 4CF2A 1IG9A 2YNGA 2G8IA 4PY5A 4RW8A 3NDKA 3VQ4A 1TGOA 3MECA 5FDLA 5J2NA 5SZTA 3MXMA 1NK6A 4J2EA 1T7PA 2KZZA 4C8NA 4DWIA 3AA2A 4O44A 4OKJA 4HUFA 1UA1A 2QK9A 3EZ5A 4DQQA 1S1TA 4ELUA 1I3AA 1LW2A 2NUBA 4LH4A 3VQBA 1S6QA 4CK1A 1SKSA 3NH0A 5KRTA 3RR8A 4CEZA 1TL1A 2OZSA 4Z4EA 1VRTA 4M45A 1LAWA 1X9SA 1NJWA 3AO5A 1EKEA 1C6VA 2Z1HA 3UIQA 3DMJA 3NF9A 2F8SA 5DK5A 2WOMA 3G0ZA 4DTMA 2JLEA 2ZQBA 4CHYA 4KHUA 1TAQA 5I42A 1KLMA 1JL1A 3AVMA 5HBMA 3ZT0A 3HPOA 4B9VA 4K8XA 1ZBIA 4OVLA 4M3XA 1EETA 3OYKA 3KLGA 3ZT3A 3AO3A 4BDZA 4CJFA 4CCHA 1BIZA 3SV4A 4E89A 4I2PA 3RRHA 3LPTA 1WSEA 1VK0A 4DFKA 4FJMA 4FLYA 1EX4A 1ASVA 1RILA 3DOKA 4CJPA 3AVBA 3SYZA 3V9ZA 1SKRA 1D8YA 4CE9A 2IOCA 3SNNA 4C8MA 4AHVA 3NCIA 2FC0A 4Y1DA 1KVCA 3TABA 4FJ7A 3P83D 3EY1A 4J2BA 1O1WA 1YVUA 3AO1A 2BDPA 1N5YA 3FFIA 4CGJA 3NF7A 2KQ2A 3RRGA 2XY7A 1NOYA 1J54A 4GMJB 4NCBA 2RPIA 2G8FA 2O4IA 1GOBA 3NAEA 3HXMA 3PX0A 3T3FA 1HYZA 5HROA 4DTJA 3ZSZA 2OPQA 4CFAA 3G10A 3HP6A 3F73A 4KV8A 4HTUA 1WNSA 3V9XA 3ALYA 4B8CA 1EP4A 1U47A 2G8VA 1Z26A 2E4LA 4CGFA 4YNQA 3K58A 3OYEA 1WSGA 3IG1A 4CGGA 2W42A 3ITHA 4CJSA 1L3UA 4AHSA 2Z1GA 4FJHA 4CF1A 3LANA 1VSDA 4J2DA 1HPZA 4CJQA 3K5MA 1Q9YA 4ZHRA 4MQ3A 1ASUA 4KREA 1RT5A 3CG7A 4BWJA 3OYLA 1RT1A 3S3OA 4OLBA 4N47A 4CJUA 3S3NA 1XHZA 1HNIA 4OPJA 3OYFA 1Q8IA 2VWKA 5CYMA 4CIEA 3M8PA 1WN7A 2ZE2A 3ZSQA 2YV0X 3V4IA 4Z4IA 2HNDA 2AJQA 2ZD1A 2HB5A 1TKTA 4O4GA 4B8AB 4E7KA 1VSLA 4DSFA 4CJEA 3SUPA 3AVNA 4KTWA 4H4OA 3NFAA 3AA5X 2O4GA 4OKEA 4PA1A 4ELTA 4HCBA 4FXDA 3LZJA 4DQIA 3DYAA 3A2FA 1TV6A 5J1EA 3O3FA 3VQ9A 3RWUA 4DFMA 4LD0A 3SQ1A 3AA3A 1KVAA 3V6DA 4E3SA 1LAVA 4I9LA 3RR7A 3M8SA 1SL1A 3VQ6A 2A1RA 4YFUA 3SZ2A 2A1SA 1JLCA 5EU7A 1XC9A 1LV5A 2OYQA 4I7FA 4FJ8A 4M3YA 2HHXA 3LAMA 1NK8A 3V1OA 3WNEA 3TR8A 4HVJA 4JS5A 3AVAA 4NCAA 4B3OA 1ZBUA 4DTNA 4CJTA 1NK4A 2I5JA 4IBNA 4B9MA 2FBYA 4EP4A 2ETJA 3VQ8A 2XO7A 2XHBA 4JRQA 4FJKA 1QQCA 3V9UA 4W5NA 3VQAA 4KI6A 4KHYA 1HNVA 1UAXA 4N5SA 4C8OA 3OYIA 3OJUA 2B5JA 3OJSA 4K8ZA 1B9FA 3T19A 4CJ5A 3L3UA 1LWEA 4FM0A 4AILC 4CJLA 3TAFA 3SPYA 3PY8A 2PY5A 3NF8A 2DTUA 4BDPA 4QAGA 4FLUA 4OJRA 3VQ5A 1JLFA 4CK3A 4H8KA 4N41A 1RCHA 4F4KA 1S6PA 1BGXT 4R5PA 1FKOA 1RT3A 3DOLA 2FBVA 1REVA 2D0BA 4E7HA 3HPGA 3HO1A 4QCLA 4E1NA 1RDAA 1ZBLA 3HK2A 1TKXA 3TANA 4BWMA 3L2RA 1WSHA 4FYDA 3TAMA 4CGHA 3AV9A 2VG7A 3CFOA 4F3TA 4FJXA 1RDCA 1KVBA 4CJVA 3DRPA 3OYJA 3E01A 2PYJA 3NGZA 4W5OA 1QHTA 3K5OA 4DS5A 4Z4GA 3SQ2A 4XIUA 3TAQA 1VSMA 4L8RB 4FM1A 2BGGA 4KPYA 1BI4A 1QSSA 1A5XA 4E7JA 4FZXC 3AVGA 3PX6A 1RT2A 5CZ1A 3OS0A 4DU4A 4MFBA 1BI4B 1C0UA 3ZSWA 1HMVA 1UA0A 4FZYA 5C42A 4DU1A 2YHBA 3SPZA 2XY8A 1WSJA 3IAYA 2D0CA 4CK2A 4DTPA 1NKCA 3NGIA 5KRSA 4F3OA 1UOCA 4DFJA 3QIPA 1BIUA 3KLFA 3OYCA 2HHWA 1S5JA 4DLEA 2ATQA 3DRRA 1I39A 1NOZA 3ZT1A 1JLBA 3C95A 4CFCA 3HJFA 1DLOA 4DTRA 2XY6A 1W0HA 4LSLA 2YNHA 1NK7A 4M3ZA 1CLQA 3L8BA 1VSIA 4Z4CA 4EZ9A 2F96A 3HT3A 1XWLA 1HQUA 4B9TA 1C1BA 4OGCA 2P1JA 3LP3A 3VQDA 3OYNA 4M41A 2YKMA 3ASMA 3NGYA 4CF9A 1GOAA 4DG1A 4Y1CA 3ZT4A 4IFVA 5I3UA 1XI1A 3VN5A 3KIOA 4ELVA 4HHTA 2HHQA 1U45A 3U3GA 1TKDA 4HCCA 4CECA 4HUEA 4N76A 3B6PA 3ZSXA 1A5VA 2P51A 2R7YA 5FRMA 4PWDA 3K5NA 2HHTA 3QINA 4W5RA 3QNNA 4CHPA 4DFPA 1A5WA 1RTHA 1VSEA 3ISNC 4Z0UA 4FLTA 1RBVA 1BCOA 3OYMA 3VQ7A 3SV3A 4DTSA 4CHNA 4FLZA 4NYNA 4FLWA 3I8DA 4FJ9A 1YTUA 1IH7A 4KFBA 5CYQA 2HW3A 1T8EA 4FK4A 2IS3A 3KJVA 5D3GA 3DM2A 2X78A 3OYGA 1BQMA 1FKPA 3TAGA 4QOZB 2OZMA 1C0MA 3LWMA 3C6UA 1RTJA 3D45A 3I0SA 1HQEA 1J9AA 3DLHA 3TI0A 4FVMA 1JXBA 3QEPA 4DQPA 4DSKA 3NE6A 3RMCA 1BQNA 3O3GA 3MEGA 2RKIA 4IFYA 3V9WA 2X6SA 4NCGA 4EP5A 2PZSA 4M3TA 4KHSA 3QEWA 2FBTA 2KTQA 2KW4A 3OYBA 1NK0A 1NKBA 2F8TA 2XY5A 3OYDA 1C1CA 3QEVA 2B6AA 3OYHA 3TAPA 4CERA 1K6YA 3DLEA 1FK9A 4M3WA 1W9HA 5T7BA 3AVFA 4G1QA 4BE0A 2XRIA 4H4MA 4FJNA 2GV9A 1J5OA 1RT7A 4KI4A 4RW4A 4ICLA 3S3MA 4KO0A 3TAEA 1VSFA 2QKKA 4BACA 3P5JA 3QEXA 1G15A 3HVTA 3JYTA 3HM9A 1RBUA 1DTTA 4KHNA 3CFPA 3M8RA 3K2PA 4O0IA 4CGDA 1U04A 4RW7A 4N56A 3P1GA 4DSEA 4ID5A 4FK0A 2G8KA 2HHVA 2E6MA 1CZBA 3QERA 4KB1A 1YTAA 1SL2A 4W5TA 1N6QA 4FJIA 3T1AA 5HRSA 4FW1A 2IDOA 3QO9A 1ZBFA 2OPRA 4DF4A 1KFSA 3AVIA 3ZSOA 2KZMA 1JLGA 1HJRA 2ITGA 4DQRA 2P5GA 1RT4A 2VWJA 4LH5A 5C25A 5FRNA 3THVA 1B9DA 4I2QA 3WNHA 4E7LA 4DS4A 5HLFA 3JSMA 2G8UA 2QKBA 3AVJA 5C24A 4CJRA 3K5LA 4CEBA 3VA3A 1JLEA 3KKSA 1TAUA 4DSLA 4CEAA 4B9SA 2BE2A 3QETA 2HHSA 3O4QA 1HYVA 1SL0A 4O5BA 3DLGA 2KFZA 2DFFA 3AVHA 1S9GA 4BE1A 3LDSA 3OS2A 5K14A 1R0AA 1RBSA 3MXIA 1ZBHA 1EXQA 1BL3A 1D9FA 2YKNA 4CGIA 1IO2A 3AO2A 2HVHA 3CYMA 3V9SA 1TK0A 4B9LA 3OVNA 1VSJA 3RMBA 4Q0BA 3AA4A 4M3RA 2X74A 4DTXA 4C8LA 4DSJA 3LALA 4CEOA 3B6OA 4DQSA 3KTQA 3ZCMA 4CEEA 1RDDA 2IC3A 2HHUA 2B4JA 3LP1A 2YNIA 3L2QA 3KKRA 4CF8A 3C94A 4E7IA 3KK3A 3PUFA 5HRPA 2GUIA 3AVKA 3DLKA 3ZSVA 4JLHA 4JS4A 2X6NA 2DFEA 5DMRA 5KI6A 3DLRA 4Z4HA 5JS2A 1F21A 4OPKA 3L2VA 2KFNA 1BISA 5E41A 3OY9A 3HP9A 1SV5A 3KLIA 1NJZA 3CM5A 1S1XA 3PO5A 2JGUA 2WONA 1T03A 4FCYA 3K59A 1SUQA 2LSNA 3NF6A 3KD5E 4HUGA 3TARA 3L3VA 4NYFA 4FZZA 1ASWA 5J2PA 1NK5A 3NBPA 1Q9XA 5J2QA 3LWLA 1FXXA 4WE1A 4CJ4A 1X9MA 4RG8A 1CZ9A
chains in the Genus database with same CATH superfamily
4CJKA 1BA1A 4BVOA 4WFBL 1NJXA 3VA0A 4FJJA 1RFQA 5AQJA 1WBDA 3UB5A 5KGXA 4YHHK 3RTVA 3IDHA 3KK1A 4E19A 4CIGA 4KTQA 1K8AO 3T1HK 1JL2A 4DHYA 3OW2M 1VSHA 3NH1A 4UY8O 3PX4A 3VQQA 4OGEA 3LZIA 1L3SA 4OLAA 1RBRA 5JVGL 3P4IA 2QWQA 4CZLA 3NVKA 5CZ2A 4F2SA 3C6TA 1HKBA 4W5QA 3GL1A 2O8CB 2A3ZA 2YHXA 2G8WA 3ENOA 1L3VA 4PUOA 1P8ZA 2P9PA 1L3TA 5FROA 1TK8A 1KSPA 1J5EK 4AHTA 3NH2A 1S1WA 4AH9A 2P9KA 1KAZA 4F2RA 3N4QA 1WLJA 1IKYA 3J7YP 2V7ZA 4UQGA 4CF0A 3L2UA 3MEDA 5AR0A 3EZWA 1IKWA 3D2EB 2UYTA 1C0FA 1JXEA 4IEIA 3M8QA 4JKCA 3EN9A 4M7YA 4K25A 4JI3K 4BG8A 2O8CA 1JCEA 1W2BM 2Y1IA 4E1MA 3LP0A 4DTUA 2ZGYA 3ULDA 2YNFA 3BDPA 2UXCK 3CC7N 5BN8A 1R59O 2D0AA 4YDUC 1NK9A 5LL6Z 3EE9A 3SUOA 5M1PA 2EX3A 1BHLA 3ZSRA 2G8HA 2HMIA 3VQCA 4FWQA 2E2QA 1D4XA 2P9LA 4CFDA 3FZKA 1NJYA 1RNHA 1VQLN 1YT3A 4LFAK 4LY7A 4CEDA 5HL7L 4IDKA 3KD1E 2OA8A 3NHGA 2E1YA 4B08A 4F8RA 1DGKN 3PO4A 1KRPA 4BRAA 4RW9A 3VEZA 4KH6A 3H3NO 2IGIA 3FZMA 3F9KA 3WXJA 2PAVA 4RW8A 3NDKA 3EL2A 1TGOA 5FDLA 3VQ4A 3MXMA 1NK6A 2KZZA 4B1UB 1VQ9N 4E1JA 4O44A 1UA1A 2QK9A 1U2VA 4DQQA 1S1TA 1S72N 3RR8A 2NUBA 5GAGP 2A41A 1VRTA 1NJWA 1LAWA 2P9NB 2NRHA 1ESVA 3AY9A 1EKEA 1ZBSA 4CHYA 3F5TA 3H1VX 1RDUA 4B9VA 3HPOA 1KQSM 4K8XA 1ZBIA 4FWPA 4OVLA 3O80A 1VQ4N 3AO3A 4BDZA 4CJFA 4EFHA 3SV4A 3IMXA 5JLHA 1WSEA 3QFPA 4DFKA 4JI8K 2GEMA 2PBDA 3CJ7A 4CE9A 3SNNA 4AHVA 1EWQA 4Y1DA 1HJOA 3P83D 4J2BA 3VOVA 3AO1A 5GADP 1N5YA 3FFIA 4WQ4A 1EO1A 5AQOA 1NOYA 4NCBA 3HXMA 3O6WA 5AJ3K 3T3FA 2OPQA 2V51B 3HP6A 2E2OA 3F73A 4KV8A 4B3MK 2QWRA 4WFAL 3CCSN 3ALYA 1U47A 3OYEA 4CBXA 4JNEA 4FJHA 1BOTO 2Z1GA 4J2DA 4CJQA 4NO7A 3K5MA 1JCFA 4U7BA 4BWJA 3Q7CA 4YOXA 1Q8IA 2NRRA 3ZSQA 4BRQA 2YV0X 3H46O 2HB5A 4DSFA 3U9DA 4JKDA 4LC9B 5GIOA 4KTWA 3LM2A 3AA5X 3D2EA 4FXDA 4QS8A 5J1EA 3VQ9A 1IJJA 5E26A 3SQ1A 4E3SA 3RR7A 2P9LB 1BO5O 3M8SA 4H0YB 5HOOA 3FFKB 3MWPA 4YFUA 1XC9A 4FJ8A 4I7FA 4M3YA 3LAMA 1NK8A 3V1OA 4B3OA 2I5JA 4IBNA 4EP4A 2ETJA 3CMAN 4JRQA 5MLCQ 4GV6A 5FPNA 4KI6A 4M7XA 2HBLA 1Y64A 4PKGA 1ATRA 3OHRA 1B9FA 4AILC 3SPYA 4H0PA 4ILJA 3NF8A 5AQSA 2ASOA 4OJRA 4N41A 3FZFA 3LDPA 1BGXT 2PFUA 3O1BA 4BGAA 3HO1A 4YOYA 3TANA 4BWMA 4JK8A 3CI5A 1RDCA 5JICA 1KVBA 3LDQA 3NGZA 1XQSC 2HSTA 3MN6A 3SQ2A 3L4QA 4MDBA 4C1NI 3WXLA 4AM7A 4KPYA 1QSSA 1A5XA 4H0VB 4MFBA 3ZSWA 2DPNA 4CI6A 1UA0A 3CPEA 4DU1A 2YHBA 4WCEL 5TKWA 5C15A 5KRSA 5M1KA 4F3OA 2ZM6K 1BIUA 1ATSA 3TPQA 5AFUH 1DLOA 3SBGA 3U9ZA 5EX5A 2YNHA 2F96A 2GWJA 1HQUA 4B9TA 3LP3A 5IWAK 4IFVA 3KIOA 3PSIA 2HHQA 3ZSXA 4FWNA 3K5NA 2HHTA 1QQOA 1VQKN 2GWKA 4W5RA 4B1XB 1A5WA 4LFBK 1RBVA 1BCOA 4NLCA 3OYMA 3T7ZA 4FLZA 3I8DA 2D1KA 4JI0K 4FK4A 1FKPA 4DR1K 3C6UA 3S41A 2Q36A 4BRCA 1BQNA 3R6MA 4MO4A 4X62K 3OYBA 3AARA 1HNXK 1NK0A 1S22A 2I7PA 5KPZA 1K6YA 2CGKA 4JYAK 3AVFA 4DQ8A 2GV9A 4KI4A 4ICLA 5AQUA 2QKKA 3HVTA 2V52B 1DTTA 2A5XA 3CFPA 1QVGM 3M8RA 4ID5A 4CD3A 2G8KA 1IV0A 1SL2A 2QM1A 2KKZA 4DF4A 1ZBFA 3FGUA 3AVIA 1HJRA 2ITGA 5C25A 5FRNA 3N4PA 4E7LA 2RE2A 4KH5A 3KKSA 1VQ8N 4DSLA 4B9SA 3QETA 3GOIA 3MX5A 1SL0A 4O5BA 3DLGA 1S9GA 3LDSA 5K14A 3MXIA 1EXQA 4AM6A 3RVCA 1LCUA 3KVGA 1VSJA 4M3RA 4JEPA 4B9QA 3LALA 5BPMA 3B6OA 4DQSA 4CEEA 3LP1A 2YNIA 3L2QA 3KKRA 4CF8A 5GAEP 5AQRA 5HRPA 4V19S 2RHKA 5KI6A 4H0XB 5AQQA 1BG3A 2E88A 1RGIA 1X3NA 5E41A 1SV5A 3KLIA 1S1XA 1NG9A 2WONA 3VF4A 1T03A 4JD2B 2LSNA 3VF2A 3KD5E 3L3VA 1NGAA 1IBMK 4CJ4A 1HPMA 4G9ZA 1NGCA 4JI1K 3SUQA 3VGKA 1KTQA 1TKZA 2ZGZA 4CIFA 1WB9A 1TVRA 4CHQA 3AO4A 3CFRA 2OPSA 1VSKA 3K9JA 1KCFA 1QSLA 3HL8A 1MWMA 2KHOA 3ID6A 2HNYA 3KK2A 1X9WA 3QNOA 3PSFA 1LWFA 4OPHA 3SJJA 3MK6A 2Q97A 3HYFA 2QEXN 4DB3A 2YHYA 4AHRA 2GBZA 4CFBA 4I9QA 1GLDG 2PYLA 4FLVA 4DR2K 1S9EA 4K0KK 5AZIB 5B8HA 4Q5VA 4ZTFA 4TSXA 3K0SA 3SQ4A 3TSUA 4YY3K 4KRFA 2Z1JA 3TSPA 3VQPA 3T69A 3HTVA 1HRHA 1ITGA 5J2MA 3TU5A 2HF3A 4RW6A 3V1RA 5CY4A 4CESA 1C1AA 5KTQA 5AQVA 4FLXA 3DXKA 2QA4N 4C8KA 2QWOA 3EEQA 3WNFA 1T6DA 4GNIA 1U4BA 4KKOA 2BANA 4C1NK 4LSNA 4WQ5A 1LWCA 3SQ0A 4FPBA 2O8EA 4J2AA 1BCMA 1MWKA 4ZTJA 2AA4A 3C7NA 2V7YA 1DKGD 1SZ2A 3OYAA 3ZETA 4CZFA 1U49A 3DXKB 5ADXA 1U48A 1Y97A 5AQPA 3MEEA 3FZHA 3PIOL 1DTQA 2F7TA 4AHCA 1ZYQA 1X9JA 1QZ5A 5SWMA 3HBTA 3TWHA 3DAWA 3EYZA 5M1NA 3MXJA 4BR7A 4PL7A 2FBXA 1TK5A 1GLLO 3DJCA 1WOQA 3V1QA 3LPUA 3I0RA 2GUPA 4EHUA 5BPNA 2Q1NA 3AAQA 4DTOA 2BUPA 5AQLA 2P5OA 3C0BA 5AQMA 3SUNA 1QS4A 4DF8A 3BGRA 2O8FA 1XHXA 4DU3A 4FJ5A 4E0DA 4Y0WA 2QXFA 2WTUA 5AQWA 4CJ3A 1IG9A 2YNGA 2G8IA 1ZXOA 3O08A 2GTDA 5J2NA 4C8NA 4A2BA 3EZ5A 4ISFA 4LH4A 3VQBA 2OZSA 3VEOA 1N34K 1NJIO 1ILYA 1BDGA 1OH5A 3WEEA 5KPRA 3DMJA 2F8SA 2WOMA 3G0ZA 3CJ1A 4NB4A 3VMFB 2E2NA 4JD2A 3AVMA 3FLCO 3ZT0A 1U6ZA 3U8XA 2GELA 4CCHA 2Q2RA 1BIZA 4E89A 1WBBA 4H5NA 4XEIA 1QQMA 3DOKA 1RILA 1D8YA 1SKRA 1QVFM 4BRHA 2IOCA 1I94K 1WUAA 3NCIA 5F0XA 3TABA 4FJ7A 3M1FA 3EY1A 2WBNA 5AQNA 3THXB 4CGJA 2CGLA 1J54A 4JKBA 1GOBA 3NAEA 4J8FA 5HROA 3ZSZA 3J7AP 3WXKA 4O5FA 4PKIA 5LMUK 1VQ7N 4WQ5C 4XH5A 2HOEA 1Z26A 4CGFA 1WSGA 3HRGA 4CGGA 2W42A 3ITHA 4CJSA 4AHSA 4KBOA 4YOTA 1VSDA 1Q9YA 4JN4A 4ZHRA 1E4FT 4KREA 2W6KA 3A5OC 5AQXA 4N47A 3S3NA 1XHZA 3OYFA 2VWKA 3P31A 3M8PA 1WN7A 3BZKA 3V4IA 4MLHA 4A59A 4O4GA 4B8AB 4YOVA 1Z05A 1LOTB 5LJVA 3CQXA 4OKEA 4H5RA 4PA1A 2H3GX 3R8EA 2W41A 3O3FA 3RWUA 4LD0A 4PHTX 5H1SQ 3V6DA 2F9TA 1YUWA 4DR7K 2A1SA 3BZCA 5EU7A 3I55N 1NU0A 4JS5A 4HVJA 3DWLA 3AVAA 2FBYA 2XHBA 2XO7A 1QQCA 4H5TA 1J6ZA 1HNVA 5ADXH 4BRKA 3AGKA 4CZMA 2B5JA 3L3UA 1LWEA 3D2FB 3SMPA 4BDPA 4QAGA 1K8KA 1JLFA 4H8KA 1RCHA 4ILHA 4F4KA 1M90O 1FKOA 2W40A 2FBVA 3GBTA 3THWB 4DR5K 4E1NA 3QICA 4CGHA 2VG7A 4F3TA 4I6MA 3J81O 4CJVA 3DRPA 3QBXA 3OYJA 3CCMN 4W5OA 1QHTA 3K5OA 3SAHA 2BGGA 4E7JA 4FZXC 3AVGA 3LM9A 5CZ1A 3OS0A 4BC3A 1C0UA 3DXMB 3CJ9A 4BY9C 3PIPL 4CK2A 2UXDK 3KLFA 2ZF5O 3OYCA 2NZTA 5BPLA 4DLEA 1I39A 3I33A 1K9MO 4QS7A 4LSLA 5DM7L 2UXBK 1VSIA 3HOTA 1W7AA 3ZEUB 4BR0A 1C1BA 3G25A 3ENBA 1TUYA 3MX2A 4EIAA 3VTIA 4BR4A 3CJCA 4Y1CA 3ZT4A 4ELVA 3VN5A 2O8DA 4BQLA 3VF6A 4HCCA 4HUEA 1OVQA 2E2PA 2R7YA 1NWKA 3M6GA 3QINA 4DFPA 4AQYK 1VQMN 1RTHA 3HSCA 4B1WB 4GV9A 4CHNA 2YJFA 4FJ9A 3B8AX 1IH7A 4RWTA 3ZLJA 3JAMO 3KHYA 3DM2A 3IFRA 1BQMA 4NXMK 1C0MA 3I0SA 1J9AA 3TI0A 4FVMA 2FXUA 1JXBA 4FOIA 5KQDA 2ZJQL 1YHQN 4DQPA 4DSKA 4BRMA 1BWFO 4NCGA 4M3TA 3JXUA 3QEWA 2FBTA 3D7EO 3OYDA 1NNEA 4AF1A 4DR6K 2XRIA 4FJNA 1J5OA 4FWSA 3CJBA 4KO0A 4WQ4C 3JYTA 3HM9A 4KHPK 4BR2A 2HF4A 3K2PA 1U04A 4N56A 4DSEA 3OA9A 4KB1A 1N6QA 4W5TA 3T1AA 5F2RA 5HRSA 2OPRA 5BRFA 3SJHA 2Q31A 4CZGA 3ZSOA 2O8EB 2EWSA 5C2DA 3THVA 3WNHA 4B1VA 4DS4A 4MO5A 1VQPN 1ZC6A 3CETA 5C24A 3HM8A 4CEBA 1TAUA 1JLEA 4O8UA 3O4QA 1HYVA 2VYPA 3I8BA 2DFFA 1XMQK 1XNRK 3OS2A 1R0AA 1ZBHA 4JAXA 3O8MA 1IO2A 3AO2A 4M63C 2YHWA 4JI4K 1TK0A 4B9LA 2F9WA 1DEJA 3SAGA 2UUAK 3QB0A 4B3TK 4B1YB 4C8LA 2W6LA 1G99A 2ITMA 4DSJA 3MN9A 3KTQA 2IC3A 4YOWA 2B4JA 3VESA 1E3MA 4BRDA 1XNQK 3OTOK 3PUFA 5E84A 3AVKA 2P9NA 1T05A 2PZSA 2X6NA 1OH7A 4JK9A 4FPAA 5JS2A 3ULEA 5BREA 3I56N 2YJEA 4JI6K 1NJZA 3HP9A 3ID8A 3CM5A 3PO5A 4JK7A 2JGUA 4FCYA 3QDKA 4NYFA 4FZZA 4H5VA 5J2QA 4WE1A 4CK1A 3BEXA 4JRPA 4HWIA 3MN5A 4O0JA 4FWOA 4FWKA 4KB0A 3ZEUA 1RBTA 1OH6A 4CVNE 4KAZA 3DI6A 3AGRA 4BRNA 4CJWA 1QTMA 3ZX3A 4FM2A 2GX9A 2VGMA 2OPPA 5LMNK 1GLEG 1JKHA 4LF4K 5KGWA 1S3XA 1GLAG 4CEQA 3O9SA 4BG9A 2ZJRL 1VRUA 3CM6A 4X64K 4FOEA 1B92A 4CHOA 1HYSA 5ELZA 2EHGA 2IIRA 2HHHK 5LY3A 2OCEA 4IXCA 4QS9A 2Q3SA 4JKGB 5AZJA 3O3HA 1VQ6N 3KWGA 4Z4FA 4FW2A 1D9DA 3SI6A 3KLEA 4PQUA 4DKWA 4EZ6A 3C7NB 4KTZA 4FJGA 2NRXA 2NRZA 2QW9A 3ZSYA 4LF6K 1QE1A 1WAJA 4JKGA 4OKKA 1L5UA 2DY4A 1JLAA 1MU2A 5JS1A 5HRNA 1HNWK 3SCXA 4M3UA 3FE1A 4FWLA 4LFCK 4I6MB 3ZT2A 3VEXA 2D0PA 1IKXA 3L6QA 2AP1A 4BRLA 3CD6N 3UKRA 2D5RA 3FR0A 1S1VA 4DCHA 2Y1JA 1RDBA 3BF1A 1RTIA 3QESA 3Q7BA 1VAZA 1LW0A 5BR9A 1WSFA 4FJLA 3HOSA 1Z25A 1XC3A 3QFUA 4BC5A 4CHZA 2HVIA 1HKGA 1S1UA 3ATUA 4DLGA 1VQ5N 3MN7A 1TL3A 2WC9A 4A2AA 1D5AA 5HP1A 2CH5A 3VQEA 2E5LK 1NKEA 3O9TA 4YDUA 1JLQA 2QWPA 4C23A 4OX9K 1HLUA 3AVLA 3D6RA 1NLVA 1KFDA 3AVCA 5HRRA 4GW6A 3MAQA 4FVUA 3PV8A 1J53A 1VQNN 4BR5A 1C0TA 4CF2A 4DR4K 4PY5A 3MECA 1T7PA 1YITN 4DWIA 4OKJA 2FSNA 5BN9A 4HUFA 4A57A 1XMOK 1OVYA 1K73O 3CJAA 1LW2A 1SKSA 4CBWA 3WEEB 1TL1A 4CEZA 4Z4EA 1Z6RA 3K9KA 3H1QA 4M45A 1X9SA 3AO5A 2HBMA 3UIQA 3NF9A 1KAYA 4IOXA 4DTMA 2JLEA 2ZQBA 4KHUA 3G6EN 3G71N 1Q81O 1TAQA 5I42A 5BR8K 1NGEA 1JL1A 3A5NC 4M3XA 3O9RA 3OYKA 3KLGA 3ZT3A 2ASPA 2FF6A 4BR9A 5C10A 3CC2N 3LPTA 4K42A 4FLYA 1ASVA 3SYZA 4CJPA 3AVBA 4C8MA 3C65A 3TTCA 1NGJA 1QQNA 1YVUA 3RRGA 3GDQA 2KQ2A 2P9IB 4GMJB 2F4VK 2G8FA 3PX0A 1HYZA 4DTJA 3U4LA 4CZEA 4FO0A 4HTUA 1WNSA 4YORA 2G8VA 4B8CA 3UKRB 1H1VA 3VGLA 2IVPA 1L3UA 1HPZA 1GLCG 4GY2B 1BA0A 1YF5L 1KXPA 1ASUA 4H0OA 1NGBA 3DXMA 4FSVA 3CG7A 1RT1A 3J80O 4OLBA 4CJUA 4CW7B 1HNIA 4OPJA 1MDUB 5CYMA 4CIEA 1YXQA 2AJQA 2ZE2A 2WFBA 3AAPA 4Z4IA 3CPWM 2HNDA 4E7KA 3CMEN 3SUPA 2CH6A 4K41A 2O4GA 1TV6A 4DFMA 3AA3A 4JHDA 1KVAA 1LAVA 4I9LA 1SL1A 3SZ2A 1LV5A 5C12A 3TR8A 4NCAA 1ZBUA 1NK4A 4CJTA 1HR0K 3O9UA 4B9MA 4FJKA 1NGDA 3VQ8A 3CQYA 3ZX0A 2OANA 1QZ6A 3VQAA 4KH4A 2Q0UA 4C8OA 3OYIA 1RDWX 3OJUA 3JS6A 4JV5K 5BRDA 3SK3A 3OJSA 4K8ZA 4XH4A 2PY5A 4FLUA 1OH8A 1SQKA 5AQYA 2FF3B 5M1QA 3DOLA 2D0BA 1M1KO 4FWMA 1NGFA 4YOUA 5TKYA 4E7HA 3HPGA 4QCLA 1YJ9N 4BRIA 1RDAA 1WSHA 4FYDA 2P9PB 3TAMA 3AV9A 1IBLK 5A2QO 2P9KB 3E01A 3CF5L 2PYJA 3EKSA 4DS5A 3CHWA 5AZIA 2P9IA 3IUCA 4XIUA 1VSMA 4L8RB 4FM1A 3E9LA 4BREA 4A5AA 3WT0A 3LDNA 1RT2A 4DU4A 3PX6A 1BI4B 5AQZA 1T44A 5C42A 1NGHA 1HNZK 3SPZA 2XY8A 2YCHA 1WSJA 2ZJPL 2D0CA 3MMVA 4IFEA 1NKCA 1IG8A 2QWNA 4DFJA 3C6HA 5AFUA 1S5JA 3IKMA 2ATQA 3DRRA 5I9EB 3ZT1A 1JLBA 3C95A 4CFCA 3HJFA 4DTRA 4ILGB 5JMVA 5IT9O 2XY6A 1W0HA 1NK7A 1CLQA 4H5WA 4EZ9A 3HT3A 1XWLA 4LF7K 3E66A 3CCRN 2P1JA 3VQDA 3ASMA 2NRVA 4BC4A 4DG1A 1V4SA 3L4IA 5I3UA 1XI1A 2P9UB 3FZLA 3SMSA 3MDQA 4N76A 3B6PA 1A5VA 2P51A 4CD1A 4BGBA 3QNNA 1VSEA 4Z0UA 1P90A 3ISNC 3WQUA 1N32K 3SV3A 3E9OA 3A5MC 4FLWA 2HW3A 5CYQA 2IVNA 1T8EA 2IS3A 1Q86O 3RSEA 4QOZB 2OZMA 3LWMA 4JKFA 3NE6A 3RMCA 3O3GA 2RKIA 3VERA 4EP5A 2KW4A 2NRWA 3CXCM 2F8TA 2XY5A 4CJ7A 1C1CA 2B6AA 4M3WA 1W9HA 4DV6K 3ATVA 5AQGA 3VPZA 1RT7A 4IO9L 1SAZA 1TYQA 5EXWA 3S3MA 4BACA 3P5JA 1G15A 3KWIA 1RBUA 1NMDA 2O8BB 4O0IA 3P1GA 4FK0A 5AZJB 3A5LC 2E8AA 2HHVA 2E6MA 1YTAA 4PL8A 4DV7K 2E20A 2IDOA 1ATNA 3QO9A 4CZIA 1KFSA 4ISGA 1JLGA 4DQRA 4NLBA 2WUSA 5KPTA 2VWJA 1E4GT 4LH5A 5KQ8A 2UU9K 1B9DA 4I2QA 5HLFA 3JSMA 2QKBA 2UUCK 1N8RO 3EE8A 4CJRA 3K5LA 3CIPA 2HHSA 2HBJA 3AVHA 1W97L 4JI2K 1RBSA 3ULEB 1BL3A 2YKNA 5EOYA 4CGIA 4IJAA 2HVHA 3CYMA 5FLXO 1Q7YO 3RMBA 2ZWHA 4CZKA 4Q0BA 2HBKA 2X74A 3J8AA 4EAHD 1TUUA 4CEOA 3GG4A 3ZCMA 1RDDA 2HHUA 3O9QA 3C94A 3HI0A 4JS4A 3ZSVA 2D4WA 3WUHA 3MCPA 3R1XA 5DMRA 3BF3A 4IOAL 2VGNA 4Z4HA 1N36K 4OPKA 1BISA 3OBYA 3LDOA 5M1FA 3H3OB 4BROA 1C0GA 3R3LA 1ASWA 3W3DA 1NK5A 2O8FB 3NBPA 1Q9XA 3LWLA 1FXXA 1X9MA 2KLAA 4RG8A 1NM1A 4IJNA 1Q18A 3IS9A 1CXQA 1RTDA 1HKCA 4FL9A 1IKVA 4BDYA 2Z1IA 2P9SA 2YX6A 1WSIA 1GOCA 3O1WA 3O5BA 3QLHA 3RSEB 3T1YK 2E6LA 1SKWA 4JI7K 4DR3K 3V81A 1MA9B 2VG6A 4KHQA 3HSTB 4L3QA 4XH1A 1KLNA 1CXUA 4IKFA 3D2FA 1X1PA 1NGIA 4BRPA 4O8KA 2DFHA 3CERA 4GVMA 1QHAA 2ASMA 5FPMA 4GKJK 3U3YA 5EVZA 4AHUA 4X65K 2O8BA 3ZYYX 3D0PA 2IAJA 3A0IX 4H03B 4HTLA 3EO3A 3TTDA 3VEYA 3DLBA 4DSIA 3QEIA 1JJ2M 4LF9K 3VEWA 1V4TA 3KLHA 2RF2A 3E9PA 3DRSA 3QIOA 2D0OA 4Z94A 3HPHA 4M42A 4IG0A 3CQ8A 4B3SK 3H45C 4B9NA 3RMDA 3IRXA 4U67L 4K43A 5F1XA 4IOCL 2YHAA 3CCVN 3WNGA 1QSYA 3SLCA 4F9OA 1YJWN 1FJGK 4CEFA 4BC2A 5CR4A 4ID1A 1WAFA 1RT6A 3O4NA 3R9PA 2RN2A 5EY4A 2HNZA 1NBWA 3L2WA 3HVRA 4IG3A 4KHWA 4BE2A 4B9UA 4DMNA 3LAKA 3H08A 4O55A 2P9UA 3U6FA 3THYA 5AQKA 3OS1A 4DV5K 3RMAA 3S9HA 3LP2A 2VG5A 4FK2A 2QXLA 1UWBA 3K57A 3EKUA 4J2EA 3ZETB 5SZTA 1YIJN 5FPEA 3AA2A 1KAXA 4ELUA 1I3AA 3KK7A 1S6QA 3NH0A 5KRTA 4LF8K 1C6VA 2Z1HA 3DLLL 5DK5A 4WFNL 3WXIA 3CCUN 4DV0K 5AQTA 2O8DB 2QWMA 1KLMA 5HBMA 3QBWA 5GINA 5CE3A 4BVPA 1EETA 4DV3K 3VGMA 4JI5K 3QMLA 4I2PA 3RRHA 1VK0A 1VHXA 4FJMA 1EX4A 3V9ZA 4DV2K 4H0TB 4R79A 2FC0A 1KVCA 4IDHA 4DUZK 2QI2A 3BUZB 1O1WA 2BDPA 3NF7A 2XY7A 3J7ZO 4IEEA 5GAHP 2RPIA 2O4IA 4CFAA 2QTDA 1HUXA 3G10A 4WF9L 1XUPO 3BP8A 2QWLA 5JVHL 3V9XA 3UKUA 1EP4A 3GE1A 2E4LA 4YNQA 3K58A 3IG1A 3L0QA 4CF1A 3LANA 3NMUA 4MQ3A 4JHDB 1RT5A 3CC4N 4ISEA 2VCPA 3OYLA 3MWTA 3S3OA 3A8YA 3HZ6A 1K8KB 4RCHA 4DV1K 1KD1O 3SAFA 1BU6O 2ZD1A 1TKTA 3LDLA 2A6AA 1VSLA 2NNWA 4CJEA 1N33K 3AVNA 4H4OA 3THXA 3NFAA 4ELTA 4HCBA 4IWVA 3LZJA 4DQIA 3DYAA 3A2FA 4CZHA 2NRTA 4FWRA 3VQ6A 2A1RA 1JLCA 2OYQA 2HHXA 4CZJA 3WNEA 4DTNA 4IO8A 2VWBA 4JKHA 3V9UA 4W5NA 4KHYA 1UAXA 4N5SA 1CZAN 2JWLA 3T19A 4CJ5A 3SBTA 4FM0A 3PY8A 4CJLA 3F9MA 3TAFA 2DTUA 2Q0RA 3VQ5A 4CK3A 3M3ZA 4B3RK 1S6PA 3NVMA 4R5PA 1RT3A 3MCAB 1REVA 4JKEA 4OO1J 3G4SN 4DV4K 1ZBLA 3HK2A 1TKXA 3L2RA 3CFOA 2BTFA 4FJXA 3ZX2A 2UUBK 5BRHA 2OTJN 2CGJA 4Z4GA 3P39A 3TAQA 2P9SB 1T6CA 1BI4A 1YAGA 2FSJA 4B1ZA 4EHTA 1HMVA 4FZYA 4NXNK 5AQFA 3IAYA 3M5RA 4DTPA 3NGIA 1UOCA 3OBWA 4A61A 3QIPA 1JCGA 1GLFO 3O4WA 2HHWA 5LJWA 3CCQN 1BUPA 2J4RA 1NOZA 4RTFD 4M3ZA 1DT9A 3L8BA 1OKJA 4Z4CA 3THWA 2FLOA 4GKKK 5GIPA 4OGCA 3OYNA 4M41A 2YKMA 3NGYA 4BRFA 4CF9A 1GOAA 4JKAA 3C6AA 3CCJN 4HHTA 1U45A 3U3GA 1TKDA 5C0YA 4GVEA 4CECA 2YI1A 4X66K 5FRMA 4PWDA 3ENHA 4CHPA 4PKHA 4FLTA 1T3VA 3VQ7A 5DM6L 4DTSA 3CCLN 4NYNA 1YTUA 3CCEN 4KFBA 3KJVA 2VQEK 5D3GA 2X78A 3OYGA 3BY5A 3TAGA 3PLAA 5AQHA 1FW6A 1RTJA 3D45A 1NMNA 1HQEA 1VQON 3DLHA 4LF5K 4MDAA 3QEPA 3V9WA 3MEGA 4IFYA 3TSQA 2X6SA 4KHSA 2KTQA 2FSKA 1NKBA 1EWRA 4A5BA 2I7NA 3QEVA 3TAPA 3E1YA 3OYHA 4CERA 3DLEA 1FK9A 5T7BA 4G1QA 4BE0A 4H4MA 4MLEA 1TYQB 4RW4A 2BH1A 3TAEA 1VSFA 2A40A 4BRGA 3QEXA 4A62A 4KHNA 3THYB 4CGDA 5JLFA 4RW7A 3H6EA 1CZBA 3QERA 4FJIA 1GLBG 4FW1A 2OTLN 3VETA 2KZMA 3WQTA 1YI2N 3TTFA 3UE5A 2P5GA 1RT4A 1KC8O 1NGGA 2G8UA 3F2KA 3AVJA 3KZBA 3VA3A 4OPAA 3VEVA 4CEAA 4DUYK 5CHIA 2BE2A 2VQFK 1HX1A 2NLXA 4WYBA 2HMPA 2KFZA 4BE1A 1IBKK 2JWKA 1GLJO 1D9FA 3V9SA 3VENA 3OVNA 1SS6A 3AA4A 2A42A 4DTXA 1X3MA 2E1ZA 5M1OA 4GV3A 2IVOA 4CBUA 4E7IA 3KK3A 1Q82O 2GUIA 3DLKA 4JLHA 1YJNN 2DFEA 3P38A 1YVNA 3DLRA 1U2VB 4BQZA 1F21A 3L2VA 2KFNA 1EQYA 3OY9A 3UKUB 5AQIA 5C2FA 3WXMB 4IZ9A 3K59A 1SUQA 3NF6A 3W0LA 4HUGA 3TARA 1O13A 5FPDA 5J2PA 3VTHA 3LL3A 1CZ9A
chains in the Genus database with same CATH topology
4JRPA 4CJKA 3SUQA 1NJXA 1KTQA 1TKZA 3IS9A 1CXQA 3VA0A 4CIFA 4FJJA 1RTDA 1TVRA 4CHQA 5KGXA 3RTVA 4O0JA 4KB0A 1IKVA 4BDYA 3AO4A 1RBTA 3CFRA 2Z1IA 2OPSA 3KK1A 4E19A 1VSKA 4CIGA 4KAZA 1WSIA 1GOCA 3DI6A 4KTQA 3QLHA 1KCFA 4CJWA 1QTMA 1JL2A 4FM2A 1QSLA 2E6LA 1SKWA 2OPPA 3V81A 1JKHA 1VSHA 2VG6A 5KGWA 3HL8A 3NH1A 4KHQA 3HSTB 4CEQA 1KLNA 3PX4A 3VQQA 4OGEA 2HNYA 3LZIA 1CXUA 1L3SA 4IKFA 4OLAA 1RBRA 1VRUA 1X1PA 3CM6A 3KK2A 3QNOA 1X9WA 1LWFA 5CZ2A 4F2SA 3C6TA 3SJJA 1B92A 4W5QA 2DFHA 4CHOA 4GVMA 1HYSA 3HYFA 2EHGA 3U3YA 4AHRA 2G8WA 2GBZA 4CFBA 4AHUA 1L3VA 4I9QA 2PYLA 4PUOA 4FLVA 1L3TA 5FROA 1S9EA 1TK8A 1KSPA 4AHTA 2Q3SA 3NH2A 4Q5VA 3O3HA 1S1WA 4AH9A 4ZTFA 4TSXA 4FW2A 1D9DA 3SQ4A 4Z4FA 3SI6A 4F2RA 4KRFA 2Z1JA 3VQPA 2IAJA 3KLEA 3D0PA 1WLJA 4PQUA 4EZ6A 1IKYA 4FJGA 4KTZA 1HRHA 1ITGA 5J2MA 4RW6A 3DLBA 3V1RA 4DSIA 5CY4A 4UQGA 4CESA 1C1AA 5KTQA 3QEIA 3ZSYA 4FLXA 1QE1A 4CF0A 1WAJA 1T05A 4OKKA 1L5UA 3L2UA 3MEDA 3KLHA 1IKWA 1JLAA 4C8KA 2RF2A 1MU2A 3DRSA 3QIOA 2DY4A 5JS1A 1JXEA 3WNFA 5HRNA 3SCXA 3M8QA 1U4BA 3HPHA 4M3UA 4KKOA 4IG0A 3CQ8A 2BANA 4B9NA 4M42A 3RMDA 4LSNA 3SQ0A 1LWCA 3IRXA 4J2AA 2Y1IA 1BCMA 4E1MA 3ZT2A 4ZTJA 3LP0A 4DTUA 1U49A 3OYAA 2YHAA 1IKXA 3ULDA 2YNFA 1U48A 3BDPA 1Y97A 3WNGA 1QSYA 2D0AA 2D5RA 1NK9A 3MEEA 3SUOA 1ZYQA 1DTQA 4AHCA 1S1VA 2Y1JA 2EX3A 1BHLA 1RDBA 3ZSRA 2G8HA 2HMIA 4CEFA 3VQCA 1RTIA 5SWMA 3TWHA 3QESA 3EYZA 1LW0A 4ID1A 1WAFA 1WSFA 1RT6A 3MXJA 4CFDA 4FJLA 1Z25A 3O4NA 2FBXA 1RNHA 4CHZA 1NJYA 2RN2A 1TK5A 1YT3A 2HVIA 4LY7A 4CEDA 3V1QA 3LPUA 2HNZA 1S1UA 3I0RA 4DLGA 3L2WA 3HVRA 4IG3A 4IDKA 1TL3A 4KHWA 3KD1E 4BE2A 4DTOA 2OA8A 4DMNA 3LAKA 3H08A 1D5AA 4B9UA 4O55A 5HP1A 2P5OA 3VQEA 3NHGA 3SUNA 1NKEA 3U6FA 3RMAA 1QS4A 1JLQA 3OS1A 4B08A 4DF8A 3S9HA 4F8RA 3PO4A 3AVLA 3BGRA 1KRPA 1KFDA 3LP2A 3AVCA 5HRRA 1XHXA 4GW6A 4RW9A 3MAQA 2VG5A 4DU3A 3PV8A 1J53A 4E0DA 2IGIA 4FJ5A 2QXFA 4FK2A 1UWBA 4CJ3A 3F9KA 3K57A 1C0TA 4CF2A 1IG9A 2YNGA 2G8IA 4PY5A 4RW8A 3NDKA 3VQ4A 1TGOA 3MECA 5FDLA 5J2NA 5SZTA 3MXMA 1NK6A 4J2EA 1T7PA 2KZZA 4C8NA 4DWIA 3AA2A 4O44A 4OKJA 4HUFA 1UA1A 2QK9A 3EZ5A 4DQQA 1S1TA 4ELUA 1I3AA 1LW2A 2NUBA 4LH4A 3VQBA 1S6QA 4CK1A 1SKSA 3NH0A 5KRTA 3RR8A 4CEZA 1TL1A 2OZSA 4Z4EA 1VRTA 4M45A 1LAWA 1X9SA 1NJWA 3AO5A 1EKEA 1C6VA 2Z1HA 3UIQA 3DMJA 3NF9A 2F8SA 5DK5A 2WOMA 3G0ZA 4DTMA 2JLEA 2ZQBA 4CHYA 4KHUA 1TAQA 5I42A 1KLMA 1JL1A 3AVMA 5HBMA 3ZT0A 3HPOA 4B9VA 4K8XA 1ZBIA 4OVLA 4M3XA 1EETA 3OYKA 3KLGA 3ZT3A 3AO3A 4BDZA 4CJFA 4CCHA 1BIZA 3SV4A 4E89A 4I2PA 3RRHA 3LPTA 1WSEA 1VK0A 4DFKA 4FJMA 4FLYA 1EX4A 1ASVA 1RILA 3DOKA 4CJPA 3AVBA 3SYZA 3V9ZA 1SKRA 1D8YA 4CE9A 2IOCA 3SNNA 4C8MA 4AHVA 3NCIA 2FC0A 4Y1DA 1KVCA 3TABA 4FJ7A 3P83D 3EY1A 4J2BA 1O1WA 1YVUA 3AO1A 2BDPA 1N5YA 3FFIA 4CGJA 3NF7A 2KQ2A 3RRGA 2XY7A 1NOYA 1J54A 4GMJB 4NCBA 2RPIA 2G8FA 2O4IA 1GOBA 3NAEA 3HXMA 3PX0A 3T3FA 1HYZA 5HROA 4DTJA 3ZSZA 2OPQA 4CFAA 3G10A 3HP6A 3F73A 4KV8A 4HTUA 1WNSA 3V9XA 3ALYA 4B8CA 1EP4A 1U47A 2G8VA 1Z26A 2E4LA 4CGFA 4YNQA 3K58A 3OYEA 1WSGA 3IG1A 4CGGA 2W42A 3ITHA 4CJSA 1L3UA 4AHSA 2Z1GA 4FJHA 4CF1A 3LANA 1VSDA 4J2DA 1HPZA 4CJQA 3K5MA 1Q9YA 4ZHRA 4MQ3A 1ASUA 4KREA 1RT5A 3CG7A 4BWJA 3OYLA 1RT1A 3S3OA 4OLBA 4N47A 4CJUA 3S3NA 1XHZA 1HNIA 4OPJA 3OYFA 1Q8IA 2VWKA 5CYMA 4CIEA 3M8PA 1WN7A 2ZE2A 3ZSQA 2YV0X 3V4IA 4Z4IA 2HNDA 2AJQA 2ZD1A 2HB5A 1TKTA 4O4GA 4B8AB 4E7KA 1VSLA 4DSFA 4CJEA 3SUPA 3AVNA 4KTWA 4H4OA 3NFAA 3AA5X 2O4GA 4OKEA 4PA1A 4ELTA 4HCBA 4FXDA 3LZJA 4DQIA 3DYAA 3A2FA 1TV6A 5J1EA 3O3FA 3VQ9A 3RWUA 4DFMA 4LD0A 3SQ1A 3AA3A 1KVAA 3V6DA 4E3SA 1LAVA 4I9LA 3RR7A 3M8SA 1SL1A 3VQ6A 2A1RA 4YFUA 3SZ2A 2A1SA 1JLCA 5EU7A 1XC9A 1LV5A 2OYQA 4I7FA 4FJ8A 4M3YA 2HHXA 3LAMA 1NK8A 3V1OA 3WNEA 3TR8A 4HVJA 4JS5A 3AVAA 4NCAA 4B3OA 1ZBUA 4DTNA 4CJTA 1NK4A 2I5JA 4IBNA 4B9MA 2FBYA 4EP4A 2ETJA 3VQ8A 2XO7A 2XHBA 4JRQA 4FJKA 1QQCA 3V9UA 4W5NA 3VQAA 4KI6A 4KHYA 1HNVA 1UAXA 4N5SA 4C8OA 3OYIA 3OJUA 2B5JA 3OJSA 4K8ZA 1B9FA 3T19A 4CJ5A 3L3UA 1LWEA 4FM0A 4AILC 4CJLA 3TAFA 3SPYA 3PY8A 2PY5A 3NF8A 2DTUA 4BDPA 4QAGA 4FLUA 4OJRA 3VQ5A 1JLFA 4CK3A 4H8KA 4N41A 1RCHA 4F4KA 1S6PA 1BGXT 4R5PA 1FKOA 1RT3A 3DOLA 2FBVA 1REVA 2D0BA 4E7HA 3HPGA 3HO1A 4QCLA 4E1NA 1RDAA 1ZBLA 3HK2A 1TKXA 3TANA 4BWMA 3L2RA 1WSHA 4FYDA 3TAMA 4CGHA 3AV9A 2VG7A 3CFOA 4F3TA 4FJXA 1RDCA 1KVBA 4CJVA 3DRPA 3OYJA 3E01A 2PYJA 3NGZA 4W5OA 1QHTA 3K5OA 4DS5A 4Z4GA 3SQ2A 4XIUA 3TAQA 1VSMA 4L8RB 4FM1A 2BGGA 4KPYA 1BI4A 1QSSA 1A5XA 4E7JA 4FZXC 3AVGA 3PX6A 1RT2A 5CZ1A 3OS0A 4DU4A 4MFBA 1BI4B 1C0UA 3ZSWA 1HMVA 1UA0A 4FZYA 5C42A 4DU1A 2YHBA 3SPZA 2XY8A 1WSJA 3IAYA 2D0CA 4CK2A 4DTPA 1NKCA 3NGIA 5KRSA 4F3OA 1UOCA 4DFJA 3QIPA 1BIUA 3KLFA 3OYCA 2HHWA 1S5JA 4DLEA 2ATQA 3DRRA 1I39A 1NOZA 3ZT1A 1JLBA 3C95A 4CFCA 3HJFA 1DLOA 4DTRA 2XY6A 1W0HA 4LSLA 2YNHA 1NK7A 4M3ZA 1CLQA 3L8BA 1VSIA 4Z4CA 4EZ9A 2F96A 3HT3A 1XWLA 1HQUA 4B9TA 1C1BA 4OGCA 2P1JA 3LP3A 3VQDA 3OYNA 4M41A 2YKMA 3ASMA 3NGYA 4CF9A 1GOAA 4DG1A 4Y1CA 3ZT4A 4IFVA 5I3UA 1XI1A 3VN5A 3KIOA 4ELVA 4HHTA 2HHQA 1U45A 3U3GA 1TKDA 4HCCA 4CECA 4HUEA 4N76A 3B6PA 3ZSXA 1A5VA 2P51A 2R7YA 5FRMA 4PWDA 3K5NA 2HHTA 3QINA 4W5RA 3QNNA 4CHPA 4DFPA 1A5WA 1RTHA 1VSEA 3ISNC 4Z0UA 4FLTA 1RBVA 1BCOA 3OYMA 3VQ7A 3SV3A 4DTSA 4CHNA 4FLZA 4NYNA 4FLWA 3I8DA 4FJ9A 1YTUA 1IH7A 4KFBA 5CYQA 2HW3A 1T8EA 4FK4A 2IS3A 3KJVA 5D3GA 3DM2A 2X78A 3OYGA 1BQMA 1FKPA 3TAGA 4QOZB 2OZMA 1C0MA 3LWMA 3C6UA 1RTJA 3D45A 3I0SA 1HQEA 1J9AA 3DLHA 3TI0A 4FVMA 1JXBA 3QEPA 4DQPA 4DSKA 3NE6A 3RMCA 1BQNA 3O3GA 3MEGA 2RKIA 4IFYA 3V9WA 2X6SA 4NCGA 4EP5A 2PZSA 4M3TA 4KHSA 3QEWA 2FBTA 2KTQA 2KW4A 3OYBA 1NK0A 1NKBA 2F8TA 2XY5A 3OYDA 1C1CA 3QEVA 2B6AA 3OYHA 3TAPA 4CERA 1K6YA 3DLEA 1FK9A 4M3WA 1W9HA 5T7BA 3AVFA 4G1QA 4BE0A 2XRIA 4H4MA 4FJNA 2GV9A 1J5OA 1RT7A 4KI4A 4RW4A 4ICLA 3S3MA 4KO0A 3TAEA 1VSFA 2QKKA 4BACA 3P5JA 3QEXA 1G15A 3HVTA 3JYTA 3HM9A 1RBUA 1DTTA 4KHNA 3CFPA 3M8RA 3K2PA 4O0IA 4CGDA 1U04A 4RW7A 4N56A 3P1GA 4DSEA 4ID5A 4FK0A 2G8KA 2HHVA 2E6MA 1CZBA 3QERA 4KB1A 1YTAA 1SL2A 4W5TA 1N6QA 4FJIA 3T1AA 5HRSA 4FW1A 2IDOA 3QO9A 1ZBFA 2OPRA 4DF4A 1KFSA 3AVIA 3ZSOA 2KZMA 1JLGA 1HJRA 2ITGA 4DQRA 2P5GA 1RT4A 2VWJA 4LH5A 5C25A 5FRNA 3THVA 1B9DA 4I2QA 3WNHA 4E7LA 4DS4A 5HLFA 3JSMA 2G8UA 2QKBA 3AVJA 5C24A 4CJRA 3K5LA 4CEBA 3VA3A 1JLEA 3KKSA 1TAUA 4DSLA 4CEAA 4B9SA 2BE2A 3QETA 2HHSA 3O4QA 1HYVA 1SL0A 4O5BA 3DLGA 2KFZA 2DFFA 3AVHA 1S9GA 4BE1A 3LDSA 3OS2A 5K14A 1R0AA 1RBSA 3MXIA 1ZBHA 1EXQA 1BL3A 1D9FA 2YKNA 4CGIA 1IO2A 3AO2A 2HVHA 3CYMA 3V9SA 1TK0A 4B9LA 3OVNA 1VSJA 3RMBA 4Q0BA 3AA4A 4M3RA 2X74A 4DTXA 4C8LA 4DSJA 3LALA 4CEOA 3B6OA 4DQSA 3KTQA 3ZCMA 4CEEA 1RDDA 2IC3A 2HHUA 2B4JA 3LP1A 2YNIA 3L2QA 3KKRA 4CF8A 3C94A 4E7IA 3KK3A 3PUFA 5HRPA 2GUIA 3AVKA 3DLKA 3ZSVA 4JLHA 4JS4A 2X6NA 2DFEA 5DMRA 5KI6A 3DLRA 4Z4HA 5JS2A 1F21A 4OPKA 3L2VA 2KFNA 1BISA 5E41A 3OY9A 3HP9A 1SV5A 3KLIA 1NJZA 3CM5A 1S1XA 3PO5A 2JGUA 2WONA 1T03A 4FCYA 3K59A 1SUQA 2LSNA 3NF6A 3KD5E 4HUGA 3TARA 3L3VA 4NYFA 4FZZA 1ASWA 5J2PA 1NK5A 3NBPA 1Q9XA 5J2QA 3LWLA 1FXXA 4WE1A 4CJ4A 1X9MA 4RG8A 1CZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRP A;  4CJK A;  3SUQ A;  1NJX A;  1KTQ A;  1TKZ A;  3IS9 A;  1CXQ A;  3VA0 A;  4CIF A;  4FJJ A;  1RTD A;  1TVR A;  4CHQ A;  5KGX A;  3RTV A;  4O0J A;  4KB0 A;  1IKV A;  4BDY A;  3AO4 A;  1RBT A;  3CFR A;  2Z1I A;  2OPS A;  3KK1 A;  4E19 A;  1VSK A;  4CIG A;  4KAZ A;  1WSI A;  1GOC A;  3DI6 A;  4KTQ A;  3QLH A;  1KCF A;  4CJW A;  1QTM A;  1JL2 A;  4FM2 A;  1QSL A;  2E6L A;  1SKW A;  2OPP A;  3V81 A;  1JKH A;  1VSH A;  2VG6 A;  5KGW A;  3HL8 A;  3NH1 A;  4KHQ A;  3HST B;  4CEQ A;  1KLN A;  3PX4 A;  3VQQ A;  4OGE A;  2HNY A;  3LZI A;  1CXU A;  1L3S A;  4IKF A;  4OLA A;  1RBR A;  1VRU A;  1X1P A;  3CM6 A;  3KK2 A;  3QNO A;  1X9W A;  1LWF A;  5CZ2 A;  4F2S A;  3C6T A;  3SJJ A;  1B92 A;  4W5Q A;  2DFH A;  4CHO A;  4GVM A;  1HYS A;  3HYF A;  2EHG A;  3U3Y A;  4AHR A;  2G8W A;  2GBZ A;  4CFB A;  4AHU A;  1L3V A;  4I9Q A;  2PYL A;  4PUO A;  4FLV A;  1L3T A;  5FRO A;  1S9E A;  1TK8 A;  1KSP A;  4AHT A;  2Q3S A;  3NH2 A;  4Q5V A;  3O3H A;  1S1W A;  4AH9 A;  4ZTF A;  4TSX A;  4FW2 A;  1D9D A;  3SQ4 A;  4Z4F A;  3SI6 A;  4F2R A;  4KRF A;  2Z1J A;  3VQP A;  2IAJ A;  3KLE A;  3D0P A;  1WLJ A;  4PQU A;  4EZ6 A;  1IKY A;  4FJG A;  4KTZ A;  1HRH A;  1ITG A;  5J2M A;  4RW6 A;  3DLB A;  3V1R A;  4DSI A;  5CY4 A;  4UQG A;  4CES A;  1C1A A;  5KTQ A;  3QEI A;  3ZSY A;  4FLX A;  1QE1 A;  4CF0 A;  1WAJ A;  1T05 A;  4OKK A;  1L5U A;  3L2U A;  3MED A;  3KLH A;  1IKW A;  1JLA A;  4C8K A;  2RF2 A;  1MU2 A;  3DRS A;  3QIO A;  2DY4 A;  5JS1 A;  1JXE A;  3WNF A;  5HRN A;  3SCX A;  3M8Q A;  1U4B A;  3HPH A;  4M3U A;  4KKO A;  4IG0 A;  3CQ8 A;  2BAN A;  4B9N A;  4M42 A;  3RMD A;  4LSN A;  3SQ0 A;  1LWC A;  3IRX A;  4J2A A;  2Y1I A;  1BCM A;  4E1M A;  3ZT2 A;  4ZTJ A;  3LP0 A;  4DTU A;  1U49 A;  3OYA A;  2YHA A;  1IKX A;  3ULD A;  2YNF A;  1U48 A;  3BDP A;  1Y97 A;  3WNG A;  1QSY A;  2D0A A;  2D5R A;  1NK9 A;  3MEE A;  3SUO A;  1ZYQ A;  1DTQ A;  4AHC A;  1S1V A;  2Y1J A;  2EX3 A;  1BHL A;  1RDB A;  3ZSR A;  2G8H A;  2HMI A;  4CEF A;  3VQC A;  1RTI A;  5SWM A;  3TWH A;  3QES A;  3EYZ A;  1LW0 A;  4ID1 A;  1WAF A;  1WSF A;  1RT6 A;  3MXJ A;  4CFD A;  4FJL A;  1Z25 A;  3O4N A;  2FBX A;  1RNH A;  4CHZ A;  1NJY A;  2RN2 A;  1TK5 A;  1YT3 A;  2HVI A;  4LY7 A;  4CED A;  3V1Q A;  3LPU A;  2HNZ A;  1S1U A;  3I0R A;  4DLG A;  3L2W A;  3HVR A;  4IG3 A;  4IDK A;  1TL3 A;  4KHW A;  3KD1 E;  4BE2 A;  4DTO A;  2OA8 A;  4DMN A;  3LAK A;  3H08 A;  1D5A A;  4B9U A;  4O55 A;  5HP1 A;  2P5O A;  3VQE A;  3NHG A;  3SUN A;  1NKE A;  3U6F A;  3RMA A;  1QS4 A;  1JLQ A;  3OS1 A;  4B08 A;  4DF8 A;  3S9H A;  4F8R A;  3PO4 A;  3AVL A;  3BGR A;  1KRP A;  1KFD A;  3LP2 A;  3AVC A;  5HRR A;  1XHX A;  4GW6 A;  4RW9 A;  3MAQ A;  2VG5 A;  4DU3 A;  3PV8 A;  1J53 A;  4E0D A;  2IGI A;  4FJ5 A;  2QXF A;  4FK2 A;  1UWB A;  4CJ3 A;  3F9K A;  3K57 A;  1C0T A;  4CF2 A;  1IG9 A;  2YNG A;  2G8I A;  4PY5 A;  4RW8 A;  3NDK A;  3VQ4 A;  1TGO A;  3MEC A;  5FDL A;  5J2N A;  5SZT A;  3MXM A;  1NK6 A;  4J2E A;  1T7P A;  2KZZ A;  4C8N A;  4DWI A;  3AA2 A;  4O44 A;  4OKJ A;  4HUF A;  1UA1 A;  2QK9 A;  3EZ5 A;  4DQQ A;  1S1T A;  4ELU A;  1I3A A;  1LW2 A;  2NUB A;  4LH4 A;  3VQB A;  1S6Q A;  4CK1 A;  1SKS A;  3NH0 A;  5KRT A;  3RR8 A;  4CEZ A;  1TL1 A;  2OZS A;  4Z4E A;  1VRT A;  4M45 A;  1LAW A;  1X9S A;  1NJW A;  3AO5 A;  1EKE A;  1C6V A;  2Z1H A;  3UIQ A;  3DMJ A;  3NF9 A;  2F8S A;  5DK5 A;  2WOM A;  3G0Z A;  4DTM A;  2JLE A;  2ZQB A;  4CHY A;  4KHU A;  1TAQ A;  5I42 A;  1KLM A;  1JL1 A;  3AVM A;  5HBM A;  3ZT0 A;  3HPO A;  4B9V A;  4K8X A;  1ZBI A;  4OVL A;  4M3X A;  1EET A;  3OYK A;  3KLG A;  3ZT3 A;  3AO3 A;  4BDZ A;  4CJF A;  4CCH A;  1BIZ A;  3SV4 A;  4E89 A;  4I2P A;  3RRH A;  3LPT A;  1WSE A;  1VK0 A;  4DFK A;  4FJM A;  4FLY A;  1EX4 A;  1ASV A;  1RIL A;  3DOK A;  4CJP A;  3AVB A;  3SYZ A;  3V9Z A;  1SKR A;  1D8Y A;  4CE9 A;  2IOC A;  3SNN A;  4C8M A;  4AHV A;  3NCI A;  2FC0 A;  4Y1D A;  1KVC A;  3TAB A;  4FJ7 A;  3P83 D;  3EY1 A;  4J2B A;  1O1W A;  1YVU A;  3AO1 A;  2BDP A;  1N5Y A;  3FFI A;  4CGJ A;  3NF7 A;  2KQ2 A;  3RRG A;  2XY7 A;  1NOY A;  1J54 A;  4GMJ B;  4NCB A;  2RPI A;  2G8F A;  2O4I A;  1GOB A;  3NAE A;  3HXM A;  3PX0 A;  3T3F A;  1HYZ A;  5HRO A;  4DTJ A;  3ZSZ A;  2OPQ A;  4CFA A;  3G10 A;  3HP6 A;  3F73 A;  4KV8 A;  4HTU A;  1WNS A;  3V9X A;  3ALY A;  4B8C A;  1EP4 A;  1U47 A;  2G8V A;  1Z26 A;  2E4L A;  4CGF A;  4YNQ A;  3K58 A;  3OYE A;  1WSG A;  3IG1 A;  4CGG A;  2W42 A;  3ITH A;  4CJS A;  1L3U A;  4AHS A;  2Z1G A;  4FJH A;  4CF1 A;  3LAN A;  1VSD A;  4J2D A;  1HPZ A;  4CJQ A;  3K5M A;  1Q9Y A;  4ZHR A;  4MQ3 A;  1ASU A;  4KRE A;  1RT5 A;  3CG7 A;  4BWJ A;  3OYL A;  1RT1 A;  3S3O A;  4OLB A;  4N47 A;  4CJU A;  3S3N A;  1XHZ A;  1HNI A;  4OPJ A;  3OYF A;  1Q8I A;  2VWK A;  5CYM A;  4CIE A;  3M8P A;  1WN7 A;  2ZE2 A;  3ZSQ A;  2YV0 X;  3V4I A;  4Z4I A;  2HND A;  2AJQ A;  2ZD1 A;  2HB5 A;  1TKT A;  4O4G A;  4B8A B;  4E7K A;  1VSL A;  4DSF A;  4CJE A;  3SUP A;  3AVN A;  4KTW A;  4H4O A;  3NFA A;  3AA5 X;  2O4G A;  4OKE A;  4PA1 A;  4ELT A;  4HCB A;  4FXD A;  3LZJ A;  4DQI A;  3DYA A;  3A2F A;  1TV6 A;  5J1E A;  3O3F A;  3VQ9 A;  3RWU A;  4DFM A;  4LD0 A;  3SQ1 A;  3AA3 A;  1KVA A;  3V6D A;  4E3S A;  1LAV A;  4I9L A;  3RR7 A;  3M8S A;  1SL1 A;  3VQ6 A;  2A1R A;  4YFU A;  3SZ2 A;  2A1S A;  1JLC A;  5EU7 A;  1XC9 A;  1LV5 A;  2OYQ A;  4I7F A;  4FJ8 A;  4M3Y A;  2HHX A;  3LAM A;  1NK8 A;  3V1O A;  3WNE A;  3TR8 A;  4HVJ A;  4JS5 A;  3AVA A;  4NCA A;  4B3O A;  1ZBU A;  4DTN A;  4CJT A;  1NK4 A;  2I5J A;  4IBN A;  4B9M A;  2FBY A;  4EP4 A;  2ETJ A;  3VQ8 A;  2XO7 A;  2XHB A;  4JRQ A;  4FJK A;  1QQC A;  3V9U A;  4W5N A;  3VQA A;  4KI6 A;  4KHY A;  1HNV A;  1UAX A;  4N5S A;  4C8O A;  3OYI A;  3OJU A;  2B5J A;  3OJS A;  4K8Z A;  1B9F A;  3T19 A;  4CJ5 A;  3L3U A;  1LWE A;  4FM0 A;  4AIL C;  4CJL A;  3TAF A;  3SPY A;  3PY8 A;  2PY5 A;  3NF8 A;  2DTU A;  4BDP A;  4QAG A;  4FLU A;  4OJR A;  3VQ5 A;  1JLF A;  4CK3 A;  4H8K A;  4N41 A;  1RCH A;  4F4K A;  1S6P A;  1BGX T;  4R5P A;  1FKO A;  1RT3 A;  3DOL A;  2FBV A;  1REV A;  2D0B A;  4E7H A;  3HPG A;  3HO1 A;  4QCL A;  4E1N A;  1RDA A;  1ZBL A;  3HK2 A;  1TKX A;  3TAN A;  4BWM A;  3L2R A;  1WSH A;  4FYD A;  3TAM A;  4CGH A;  3AV9 A;  2VG7 A;  3CFO A;  4F3T A;  4FJX A;  1RDC A;  1KVB A;  4CJV A;  3DRP A;  3OYJ A;  3E01 A;  2PYJ A;  3NGZ A;  4W5O A;  1QHT A;  3K5O A;  4DS5 A;  4Z4G A;  3SQ2 A;  4XIU A;  3TAQ A;  1VSM A;  4L8R B;  4FM1 A;  2BGG A;  4KPY A;  1BI4 A;  1QSS A;  1A5X A;  4E7J A;  4FZX C;  3AVG A;  3PX6 A;  1RT2 A;  5CZ1 A;  3OS0 A;  4DU4 A;  4MFB A;  1BI4 B;  1C0U A;  3ZSW A;  1HMV A;  1UA0 A;  4FZY A;  5C42 A;  4DU1 A;  2YHB A;  3SPZ A;  2XY8 A;  1WSJ A;  3IAY A;  2D0C A;  4CK2 A;  4DTP A;  1NKC A;  3NGI A;  5KRS A;  4F3O A;  1UOC A;  4DFJ A;  3QIP A;  1BIU A;  3KLF A;  3OYC A;  2HHW A;  1S5J A;  4DLE A;  2ATQ A;  3DRR A;  1I39 A;  1NOZ A;  3ZT1 A;  1JLB A;  3C95 A;  4CFC A;  3HJF A;  1DLO A;  4DTR A;  2XY6 A;  1W0H A;  4LSL A;  2YNH A;  1NK7 A;  4M3Z A;  1CLQ A;  3L8B A;  1VSI A;  4Z4C A;  4EZ9 A;  2F96 A;  3HT3 A;  1XWL A;  1HQU A;  4B9T A;  1C1B A;  4OGC A;  2P1J A;  3LP3 A;  3VQD A;  3OYN A;  4M41 A;  2YKM A;  3ASM A;  3NGY A;  4CF9 A;  1GOA A;  4DG1 A;  4Y1C A;  3ZT4 A;  4IFV A;  5I3U A;  1XI1 A;  3VN5 A;  3KIO A;  4ELV A;  4HHT A;  2HHQ A;  1U45 A;  3U3G A;  1TKD A;  4HCC A;  4CEC A;  4HUE A;  4N76 A;  3B6P A;  3ZSX A;  1A5V A;  2P51 A;  2R7Y A;  5FRM A;  4PWD A;  3K5N A;  2HHT A;  3QIN A;  4W5R A;  3QNN A;  4CHP A;  4DFP A;  1A5W A;  1RTH A;  1VSE A;  3ISN C;  4Z0U A;  4FLT A;  1RBV A;  1BCO A;  3OYM A;  3VQ7 A;  3SV3 A;  4DTS A;  4CHN A;  4FLZ A;  4NYN A;  4FLW A;  3I8D A;  4FJ9 A;  1YTU A;  1IH7 A;  4KFB A;  5CYQ A;  2HW3 A;  1T8E A;  4FK4 A;  2IS3 A;  3KJV A;  5D3G A;  3DM2 A;  2X78 A;  3OYG A;  1BQM A;  1FKP A;  3TAG A;  4QOZ B;  2OZM A;  1C0M A;  3LWM A;  3C6U A;  1RTJ A;  3D45 A;  3I0S A;  1HQE A;  1J9A A;  3DLH A;  3TI0 A;  4FVM A;  1JXB A;  3QEP A;  4DQP A;  4DSK A;  3NE6 A;  3RMC A;  1BQN A;  3O3G A;  3MEG A;  2RKI A;  4IFY A;  3V9W A;  2X6S A;  4NCG A;  4EP5 A;  2PZS A;  4M3T A;  4KHS A;  3QEW A;  2FBT A;  2KTQ A;  2KW4 A;  3OYB A;  1NK0 A;  1NKB A;  2F8T A;  2XY5 A;  3OYD A;  1C1C A;  3QEV A;  2B6A A;  3OYH A;  3TAP A;  4CER A;  1K6Y A;  3DLE A;  1FK9 A;  4M3W A;  1W9H A;  5T7B A;  3AVF A;  4G1Q A;  4BE0 A;  2XRI A;  4H4M A;  4FJN A;  2GV9 A;  1J5O A;  1RT7 A;  4KI4 A;  4RW4 A;  4ICL A;  3S3M A;  4KO0 A;  3TAE A;  1VSF A;  2QKK A;  4BAC A;  3P5J A;  3QEX A;  1G15 A;  3HVT A;  3JYT A;  3HM9 A;  1RBU A;  1DTT A;  4KHN A;  3CFP A;  3M8R A;  3K2P A;  4O0I A;  4CGD A;  1U04 A;  4RW7 A;  4N56 A;  3P1G A;  4DSE A;  4ID5 A;  4FK0 A;  2G8K A;  2HHV A;  2E6M A;  1CZB A;  3QER A;  4KB1 A;  1YTA A;  1SL2 A;  4W5T A;  1N6Q A;  4FJI A;  3T1A A;  5HRS A;  4FW1 A;  2IDO A;  3QO9 A;  1ZBF A;  2OPR A;  4DF4 A;  1KFS A;  3AVI A;  3ZSO A;  2KZM A;  1JLG A;  1HJR A;  2ITG A;  4DQR A;  2P5G A;  1RT4 A;  2VWJ A;  4LH5 A;  5C25 A;  5FRN A;  3THV A;  1B9D A;  4I2Q A;  3WNH A;  4E7L A;  4DS4 A;  5HLF A;  3JSM A;  2G8U A;  2QKB A;  3AVJ A;  5C24 A;  4CJR A;  3K5L A;  4CEB A;  3VA3 A;  1JLE A;  3KKS A;  1TAU A;  4DSL A;  4CEA A;  4B9S A;  2BE2 A;  3QET A;  2HHS A;  3O4Q A;  1HYV A;  1SL0 A;  4O5B A;  3DLG A;  2KFZ A;  2DFF A;  3AVH A;  1S9G A;  4BE1 A;  3LDS A;  3OS2 A;  5K14 A;  1R0A A;  1RBS A;  3MXI A;  1ZBH A;  1EXQ A;  1BL3 A;  1D9F A;  2YKN A;  4CGI A;  1IO2 A;  3AO2 A;  2HVH A;  3CYM A;  3V9S A;  1TK0 A;  4B9L A;  3OVN A;  1VSJ A;  3RMB A;  4Q0B A;  3AA4 A;  4M3R A;  2X74 A;  4DTX A;  4C8L A;  4DSJ A;  3LAL A;  4CEO A;  3B6O A;  4DQS A;  3KTQ A;  3ZCM A;  4CEE A;  1RDD A;  2IC3 A;  2HHU A;  2B4J A;  3LP1 A;  2YNI A;  3L2Q A;  3KKR A;  4CF8 A;  3C94 A;  4E7I A;  3KK3 A;  3PUF A;  5HRP A;  2GUI A;  3AVK A;  3DLK A;  3ZSV A;  4JLH A;  4JS4 A;  2X6N A;  2DFE A;  5DMR A;  5KI6 A;  3DLR A;  4Z4H A;  5JS2 A;  1F21 A;  4OPK A;  3L2V A;  2KFN A;  1BIS A;  5E41 A;  3OY9 A;  3HP9 A;  1SV5 A;  3KLI A;  1NJZ A;  3CM5 A;  1S1X A;  3PO5 A;  2JGU A;  2WON A;  1T03 A;  4FCY A;  3K59 A;  1SUQ A;  2LSN A;  3NF6 A;  3KD5 E;  4HUG A;  3TAR A;  3L3V A;  4NYF A;  4FZZ A;  1ASW A;  5J2P A;  1NK5 A;  3NBP A;  1Q9X A;  5J2Q A;  3LWL A;  1FXX A;  4WE1 A;  4CJ4 A;  1X9M A;  4RG8 A;  1CZ9 A; 
#chains in the Genus database with same CATH topology
 4CJK A;  1BA1 A;  4BVO A;  4WFB L;  1NJX A;  3VA0 A;  4FJJ A;  1RFQ A;  5AQJ A;  1WBD A;  3UB5 A;  5KGX A;  4YHH K;  3RTV A;  3IDH A;  3KK1 A;  4E19 A;  4CIG A;  4KTQ A;  1K8A O;  3T1H K;  1JL2 A;  4DHY A;  3OW2 M;  1VSH A;  3NH1 A;  4UY8 O;  3PX4 A;  3VQQ A;  4OGE A;  3LZI A;  1L3S A;  4OLA A;  1RBR A;  5JVG L;  3P4I A;  2QWQ A;  4CZL A;  3NVK A;  5CZ2 A;  4F2S A;  3C6T A;  1HKB A;  4W5Q A;  3GL1 A;  2O8C B;  2A3Z A;  2YHX A;  2G8W A;  3ENO A;  1L3V A;  4PUO A;  1P8Z A;  2P9P A;  1L3T A;  5FRO A;  1TK8 A;  1KSP A;  1J5E K;  4AHT A;  3NH2 A;  1S1W A;  4AH9 A;  2P9K A;  1KAZ A;  4F2R A;  3N4Q A;  1WLJ A;  1IKY A;  3J7Y P;  2V7Z A;  4UQG A;  4CF0 A;  3L2U A;  3MED A;  5AR0 A;  3EZW A;  1IKW A;  3D2E B;  2UYT A;  1C0F A;  1JXE A;  4IEI A;  3M8Q A;  4JKC A;  3EN9 A;  4M7Y A;  4K25 A;  4JI3 K;  4BG8 A;  2O8C A;  1JCE A;  1W2B M;  2Y1I A;  4E1M A;  3LP0 A;  4DTU A;  2ZGY A;  3ULD A;  2YNF A;  3BDP A;  2UXC K;  3CC7 N;  5BN8 A;  1R59 O;  2D0A A;  4YDU C;  1NK9 A;  5LL6 Z;  3EE9 A;  3SUO A;  5M1P A;  2EX3 A;  1BHL A;  3ZSR A;  2G8H A;  2HMI A;  3VQC A;  4FWQ A;  2E2Q A;  1D4X A;  2P9L A;  4CFD A;  3FZK A;  1NJY A;  1RNH A;  1VQL N;  1YT3 A;  4LFA K;  4LY7 A;  4CED A;  5HL7 L;  4IDK A;  3KD1 E;  2OA8 A;  3NHG A;  2E1Y A;  4B08 A;  4F8R A;  1DGK N;  3PO4 A;  1KRP A;  4BRA A;  4RW9 A;  3VEZ A;  4KH6 A;  3H3N O;  2IGI A;  3FZM A;  3F9K A;  3WXJ A;  2PAV A;  4RW8 A;  3NDK A;  3EL2 A;  1TGO A;  5FDL A;  3VQ4 A;  3MXM A;  1NK6 A;  2KZZ A;  4B1U B;  1VQ9 N;  4E1J A;  4O44 A;  1UA1 A;  2QK9 A;  1U2V A;  4DQQ A;  1S1T A;  1S72 N;  3RR8 A;  2NUB A;  5GAG P;  2A41 A;  1VRT A;  1NJW A;  1LAW A;  2P9N B;  2NRH A;  1ESV A;  3AY9 A;  1EKE A;  1ZBS A;  4CHY A;  3F5T A;  3H1V X;  1RDU A;  4B9V A;  3HPO A;  1KQS M;  4K8X A;  1ZBI A;  4FWP A;  4OVL A;  3O80 A;  1VQ4 N;  3AO3 A;  4BDZ A;  4CJF A;  4EFH A;  3SV4 A;  3IMX A;  5JLH A;  1WSE A;  3QFP A;  4DFK A;  4JI8 K;  2GEM A;  2PBD A;  3CJ7 A;  4CE9 A;  3SNN A;  4AHV A;  1EWQ A;  4Y1D A;  1HJO A;  3P83 D;  4J2B A;  3VOV A;  3AO1 A;  5GAD P;  1N5Y A;  3FFI A;  4WQ4 A;  1EO1 A;  5AQO A;  1NOY A;  4NCB A;  3HXM A;  3O6W A;  5AJ3 K;  3T3F A;  2OPQ A;  2V51 B;  3HP6 A;  2E2O A;  3F73 A;  4KV8 A;  4B3M K;  2QWR A;  4WFA L;  3CCS N;  3ALY A;  1U47 A;  3OYE A;  4CBX A;  4JNE A;  4FJH A;  1BOT O;  2Z1G A;  4J2D A;  4CJQ A;  4NO7 A;  3K5M A;  1JCF A;  4U7B A;  4BWJ A;  3Q7C A;  4YOX A;  1Q8I A;  2NRR A;  3ZSQ A;  4BRQ A;  2YV0 X;  3H46 O;  2HB5 A;  4DSF A;  3U9D A;  4JKD A;  4LC9 B;  5GIO A;  4KTW A;  3LM2 A;  3AA5 X;  3D2E A;  4FXD A;  4QS8 A;  5J1E A;  3VQ9 A;  1IJJ A;  5E26 A;  3SQ1 A;  4E3S A;  3RR7 A;  2P9L B;  1BO5 O;  3M8S A;  4H0Y B;  5HOO A;  3FFK B;  3MWP A;  4YFU A;  1XC9 A;  4FJ8 A;  4I7F A;  4M3Y A;  3LAM A;  1NK8 A;  3V1O A;  4B3O A;  2I5J A;  4IBN A;  4EP4 A;  2ETJ A;  3CMA N;  4JRQ A;  5MLC Q;  4GV6 A;  5FPN A;  4KI6 A;  4M7X A;  2HBL A;  1Y64 A;  4PKG A;  1ATR A;  3OHR A;  1B9F A;  4AIL C;  3SPY A;  4H0P A;  4ILJ A;  3NF8 A;  5AQS A;  2ASO A;  4OJR A;  4N41 A;  3FZF A;  3LDP A;  1BGX T;  2PFU A;  3O1B A;  4BGA A;  3HO1 A;  4YOY A;  3TAN A;  4BWM A;  4JK8 A;  3CI5 A;  1RDC A;  5JIC A;  1KVB A;  3LDQ A;  3NGZ A;  1XQS C;  2HST A;  3MN6 A;  3SQ2 A;  3L4Q A;  4MDB A;  4C1N I;  3WXL A;  4AM7 A;  4KPY A;  1QSS A;  1A5X A;  4H0V B;  4MFB A;  3ZSW A;  2DPN A;  4CI6 A;  1UA0 A;  3CPE A;  4DU1 A;  2YHB A;  4WCE L;  5TKW A;  5C15 A;  5KRS A;  5M1K A;  4F3O A;  2ZM6 K;  1BIU A;  1ATS A;  3TPQ A;  5AFU H;  1DLO A;  3SBG A;  3U9Z A;  5EX5 A;  2YNH A;  2F96 A;  2GWJ A;  1HQU A;  4B9T A;  3LP3 A;  5IWA K;  4IFV A;  3KIO A;  3PSI A;  2HHQ A;  3ZSX A;  4FWN A;  3K5N A;  2HHT A;  1QQO A;  1VQK N;  2GWK A;  4W5R A;  4B1X B;  1A5W A;  4LFB K;  1RBV A;  1BCO A;  4NLC A;  3OYM A;  3T7Z A;  4FLZ A;  3I8D A;  2D1K A;  4JI0 K;  4FK4 A;  1FKP A;  4DR1 K;  3C6U A;  3S41 A;  2Q36 A;  4BRC A;  1BQN A;  3R6M A;  4MO4 A;  4X62 K;  3OYB A;  3AAR A;  1HNX K;  1NK0 A;  1S22 A;  2I7P A;  5KPZ A;  1K6Y A;  2CGK A;  4JYA K;  3AVF A;  4DQ8 A;  2GV9 A;  4KI4 A;  4ICL A;  5AQU A;  2QKK A;  3HVT A;  2V52 B;  1DTT A;  2A5X A;  3CFP A;  1QVG M;  3M8R A;  4ID5 A;  4CD3 A;  2G8K A;  1IV0 A;  1SL2 A;  2QM1 A;  2KKZ A;  4DF4 A;  1ZBF A;  3FGU A;  3AVI A;  1HJR A;  2ITG A;  5C25 A;  5FRN A;  3N4P A;  4E7L A;  2RE2 A;  4KH5 A;  3KKS A;  1VQ8 N;  4DSL A;  4B9S A;  3QET A;  3GOI A;  3MX5 A;  1SL0 A;  4O5B A;  3DLG A;  1S9G A;  3LDS A;  5K14 A;  3MXI A;  1EXQ A;  4AM6 A;  3RVC A;  1LCU A;  3KVG A;  1VSJ A;  4M3R A;  4JEP A;  4B9Q A;  3LAL A;  5BPM A;  3B6O A;  4DQS A;  4CEE A;  3LP1 A;  2YNI A;  3L2Q A;  3KKR A;  4CF8 A;  5GAE P;  5AQR A;  5HRP A;  4V19 S;  2RHK A;  5KI6 A;  4H0X B;  5AQQ A;  1BG3 A;  2E88 A;  1RGI A;  1X3N A;  5E41 A;  1SV5 A;  3KLI A;  1S1X A;  1NG9 A;  2WON A;  3VF4 A;  1T03 A;  4JD2 B;  2LSN A;  3VF2 A;  3KD5 E;  3L3V A;  1NGA A;  1IBM K;  4CJ4 A;  1HPM A;  4G9Z A;  1NGC A;  4JI1 K;  3SUQ A;  3VGK A;  1KTQ A;  1TKZ A;  2ZGZ A;  4CIF A;  1WB9 A;  1TVR A;  4CHQ A;  3AO4 A;  3CFR A;  2OPS A;  1VSK A;  3K9J A;  1KCF A;  1QSL A;  3HL8 A;  1MWM A;  2KHO A;  3ID6 A;  2HNY A;  3KK2 A;  1X9W A;  3QNO A;  3PSF A;  1LWF A;  4OPH A;  3SJJ A;  3MK6 A;  2Q97 A;  3HYF A;  2QEX N;  4DB3 A;  2YHY A;  4AHR A;  2GBZ A;  4CFB A;  4I9Q A;  1GLD G;  2PYL A;  4FLV A;  4DR2 K;  1S9E A;  4K0K K;  5AZI B;  5B8H A;  4Q5V A;  4ZTF A;  4TSX A;  3K0S A;  3SQ4 A;  3TSU A;  4YY3 K;  4KRF A;  2Z1J A;  3TSP A;  3VQP A;  3T69 A;  3HTV A;  1HRH A;  1ITG A;  5J2M A;  3TU5 A;  2HF3 A;  4RW6 A;  3V1R A;  5CY4 A;  4CES A;  1C1A A;  5KTQ A;  5AQV A;  4FLX A;  3DXK A;  2QA4 N;  4C8K A;  2QWO A;  3EEQ A;  3WNF A;  1T6D A;  4GNI A;  1U4B A;  4KKO A;  2BAN A;  4C1N K;  4LSN A;  4WQ5 A;  1LWC A;  3SQ0 A;  4FPB A;  2O8E A;  4J2A A;  1BCM A;  1MWK A;  4ZTJ A;  2AA4 A;  3C7N A;  2V7Y A;  1DKG D;  1SZ2 A;  3OYA A;  3ZET A;  4CZF A;  1U49 A;  3DXK B;  5ADX A;  1U48 A;  1Y97 A;  5AQP A;  3MEE A;  3FZH A;  3PIO L;  1DTQ A;  2F7T A;  4AHC A;  1ZYQ A;  1X9J A;  1QZ5 A;  5SWM A;  3HBT A;  3TWH A;  3DAW A;  3EYZ A;  5M1N A;  3MXJ A;  4BR7 A;  4PL7 A;  2FBX A;  1TK5 A;  1GLL O;  3DJC A;  1WOQ A;  3V1Q A;  3LPU A;  3I0R A;  2GUP A;  4EHU A;  5BPN A;  2Q1N A;  3AAQ A;  4DTO A;  2BUP A;  5AQL A;  2P5O A;  3C0B A;  5AQM A;  3SUN A;  1QS4 A;  4DF8 A;  3BGR A;  2O8F A;  1XHX A;  4DU3 A;  4FJ5 A;  4E0D A;  4Y0W A;  2QXF A;  2WTU A;  5AQW A;  4CJ3 A;  1IG9 A;  2YNG A;  2G8I A;  1ZXO A;  3O08 A;  2GTD A;  5J2N A;  4C8N A;  4A2B A;  3EZ5 A;  4ISF A;  4LH4 A;  3VQB A;  2OZS A;  3VEO A;  1N34 K;  1NJI O;  1ILY A;  1BDG A;  1OH5 A;  3WEE A;  5KPR A;  3DMJ A;  2F8S A;  2WOM A;  3G0Z A;  3CJ1 A;  4NB4 A;  3VMF B;  2E2N A;  4JD2 A;  3AVM A;  3FLC O;  3ZT0 A;  1U6Z A;  3U8X A;  2GEL A;  4CCH A;  2Q2R A;  1BIZ A;  4E89 A;  1WBB A;  4H5N A;  4XEI A;  1QQM A;  3DOK A;  1RIL A;  1D8Y A;  1SKR A;  1QVF M;  4BRH A;  2IOC A;  1I94 K;  1WUA A;  3NCI A;  5F0X A;  3TAB A;  4FJ7 A;  3M1F A;  3EY1 A;  2WBN A;  5AQN A;  3THX B;  4CGJ A;  2CGL A;  1J54 A;  4JKB A;  1GOB A;  3NAE A;  4J8F A;  5HRO A;  3ZSZ A;  3J7A P;  3WXK A;  4O5F A;  4PKI A;  5LMU K;  1VQ7 N;  4WQ5 C;  4XH5 A;  2HOE A;  1Z26 A;  4CGF A;  1WSG A;  3HRG A;  4CGG A;  2W42 A;  3ITH A;  4CJS A;  4AHS A;  4KBO A;  4YOT A;  1VSD A;  1Q9Y A;  4JN4 A;  4ZHR A;  1E4F T;  4KRE A;  2W6K A;  3A5O C;  5AQX A;  4N47 A;  3S3N A;  1XHZ A;  3OYF A;  2VWK A;  3P31 A;  3M8P A;  1WN7 A;  3BZK A;  3V4I A;  4MLH A;  4A59 A;  4O4G A;  4B8A B;  4YOV A;  1Z05 A;  1LOT B;  5LJV A;  3CQX A;  4OKE A;  4H5R A;  4PA1 A;  2H3G X;  3R8E A;  2W41 A;  3O3F A;  3RWU A;  4LD0 A;  4PHT X;  5H1S Q;  3V6D A;  2F9T A;  1YUW A;  4DR7 K;  2A1S A;  3BZC A;  5EU7 A;  3I55 N;  1NU0 A;  4JS5 A;  4HVJ A;  3DWL A;  3AVA A;  2FBY A;  2XHB A;  2XO7 A;  1QQC A;  4H5T A;  1J6Z A;  1HNV A;  5ADX H;  4BRK A;  3AGK A;  4CZM A;  2B5J A;  3L3U A;  1LWE A;  3D2F B;  3SMP A;  4BDP A;  4QAG A;  1K8K A;  1JLF A;  4H8K A;  1RCH A;  4ILH A;  4F4K A;  1M90 O;  1FKO A;  2W40 A;  2FBV A;  3GBT A;  3THW B;  4DR5 K;  4E1N A;  3QIC A;  4CGH A;  2VG7 A;  4F3T A;  4I6M A;  3J81 O;  4CJV A;  3DRP A;  3QBX A;  3OYJ A;  3CCM N;  4W5O A;  1QHT A;  3K5O A;  3SAH A;  2BGG A;  4E7J A;  4FZX C;  3AVG A;  3LM9 A;  5CZ1 A;  3OS0 A;  4BC3 A;  1C0U A;  3DXM B;  3CJ9 A;  4BY9 C;  3PIP L;  4CK2 A;  2UXD K;  3KLF A;  2ZF5 O;  3OYC A;  2NZT A;  5BPL A;  4DLE A;  1I39 A;  3I33 A;  1K9M O;  4QS7 A;  4LSL A;  5DM7 L;  2UXB K;  1VSI A;  3HOT A;  1W7A A;  3ZEU B;  4BR0 A;  1C1B A;  3G25 A;  3ENB A;  1TUY A;  3MX2 A;  4EIA A;  3VTI A;  4BR4 A;  3CJC A;  4Y1C A;  3ZT4 A;  4ELV A;  3VN5 A;  2O8D A;  4BQL A;  3VF6 A;  4HCC A;  4HUE A;  1OVQ A;  2E2P A;  2R7Y A;  1NWK A;  3M6G A;  3QIN A;  4DFP A;  4AQY K;  1VQM N;  1RTH A;  3HSC A;  4B1W B;  4GV9 A;  4CHN A;  2YJF A;  4FJ9 A;  3B8A X;  1IH7 A;  4RWT A;  3ZLJ A;  3JAM O;  3KHY A;  3DM2 A;  3IFR A;  1BQM A;  4NXM K;  1C0M A;  3I0S A;  1J9A A;  3TI0 A;  4FVM A;  2FXU A;  1JXB A;  4FOI A;  5KQD A;  2ZJQ L;  1YHQ N;  4DQP A;  4DSK A;  4BRM A;  1BWF O;  4NCG A;  4M3T A;  3JXU A;  3QEW A;  2FBT A;  3D7E O;  3OYD A;  1NNE A;  4AF1 A;  4DR6 K;  2XRI A;  4FJN A;  1J5O A;  4FWS A;  3CJB A;  4KO0 A;  4WQ4 C;  3JYT A;  3HM9 A;  4KHP K;  4BR2 A;  2HF4 A;  3K2P A;  1U04 A;  4N56 A;  4DSE A;  3OA9 A;  4KB1 A;  1N6Q A;  4W5T A;  3T1A A;  5F2R A;  5HRS A;  2OPR A;  5BRF A;  3SJH A;  2Q31 A;  4CZG A;  3ZSO A;  2O8E B;  2EWS A;  5C2D A;  3THV A;  3WNH A;  4B1V A;  4DS4 A;  4MO5 A;  1VQP N;  1ZC6 A;  3CET A;  5C24 A;  3HM8 A;  4CEB A;  1TAU A;  1JLE A;  4O8U A;  3O4Q A;  1HYV A;  2VYP A;  3I8B A;  2DFF A;  1XMQ K;  1XNR K;  3OS2 A;  1R0A A;  1ZBH A;  4JAX A;  3O8M A;  1IO2 A;  3AO2 A;  4M63 C;  2YHW A;  4JI4 K;  1TK0 A;  4B9L A;  2F9W A;  1DEJ A;  3SAG A;  2UUA K;  3QB0 A;  4B3T K;  4B1Y B;  4C8L A;  2W6L A;  1G99 A;  2ITM A;  4DSJ A;  3MN9 A;  3KTQ A;  2IC3 A;  4YOW A;  2B4J A;  3VES A;  1E3M A;  4BRD A;  1XNQ K;  3OTO K;  3PUF A;  5E84 A;  3AVK A;  2P9N A;  1T05 A;  2PZS A;  2X6N A;  1OH7 A;  4JK9 A;  4FPA A;  5JS2 A;  3ULE A;  5BRE A;  3I56 N;  2YJE A;  4JI6 K;  1NJZ A;  3HP9 A;  3ID8 A;  3CM5 A;  3PO5 A;  4JK7 A;  2JGU A;  4FCY A;  3QDK A;  4NYF A;  4FZZ A;  4H5V A;  5J2Q A;  4WE1 A;  4CK1 A;  3BEX A;  4JRP A;  4HWI A;  3MN5 A;  4O0J A;  4FWO A;  4FWK A;  4KB0 A;  3ZEU A;  1RBT A;  1OH6 A;  4CVN E;  4KAZ A;  3DI6 A;  3AGR A;  4BRN A;  4CJW A;  1QTM A;  3ZX3 A;  4FM2 A;  2GX9 A;  2VGM A;  2OPP A;  5LMN K;  1GLE G;  1JKH A;  4LF4 K;  5KGW A;  1S3X A;  1GLA G;  4CEQ A;  3O9S A;  4BG9 A;  2ZJR L;  1VRU A;  3CM6 A;  4X64 K;  4FOE A;  1B92 A;  4CHO A;  1HYS A;  5ELZ A;  2EHG A;  2IIR A;  2HHH K;  5LY3 A;  2OCE A;  4IXC A;  4QS9 A;  2Q3S A;  4JKG B;  5AZJ A;  3O3H A;  1VQ6 N;  3KWG A;  4Z4F A;  4FW2 A;  1D9D A;  3SI6 A;  3KLE A;  4PQU A;  4DKW A;  4EZ6 A;  3C7N B;  4KTZ A;  4FJG A;  2NRX A;  2NRZ A;  2QW9 A;  3ZSY A;  4LF6 K;  1QE1 A;  1WAJ A;  4JKG A;  4OKK A;  1L5U A;  2DY4 A;  1JLA A;  1MU2 A;  5JS1 A;  5HRN A;  1HNW K;  3SCX A;  4M3U A;  3FE1 A;  4FWL A;  4LFC K;  4I6M B;  3ZT2 A;  3VEX A;  2D0P A;  1IKX A;  3L6Q A;  2AP1 A;  4BRL A;  3CD6 N;  3UKR A;  2D5R A;  3FR0 A;  1S1V A;  4DCH A;  2Y1J A;  1RDB A;  3BF1 A;  1RTI A;  3QES A;  3Q7B A;  1VAZ A;  1LW0 A;  5BR9 A;  1WSF A;  4FJL A;  3HOS A;  1Z25 A;  1XC3 A;  3QFU A;  4BC5 A;  4CHZ A;  2HVI A;  1HKG A;  1S1U A;  3ATU A;  4DLG A;  1VQ5 N;  3MN7 A;  1TL3 A;  2WC9 A;  4A2A A;  1D5A A;  5HP1 A;  2CH5 A;  3VQE A;  2E5L K;  1NKE A;  3O9T A;  4YDU A;  1JLQ A;  2QWP A;  4C23 A;  4OX9 K;  1HLU A;  3AVL A;  3D6R A;  1NLV A;  1KFD A;  3AVC A;  5HRR A;  4GW6 A;  3MAQ A;  4FVU A;  3PV8 A;  1J53 A;  1VQN N;  4BR5 A;  1C0T A;  4CF2 A;  4DR4 K;  4PY5 A;  3MEC A;  1T7P A;  1YIT N;  4DWI A;  4OKJ A;  2FSN A;  5BN9 A;  4HUF A;  4A57 A;  1XMO K;  1OVY A;  1K73 O;  3CJA A;  1LW2 A;  1SKS A;  4CBW A;  3WEE B;  1TL1 A;  4CEZ A;  4Z4E A;  1Z6R A;  3K9K A;  3H1Q A;  4M45 A;  1X9S A;  3AO5 A;  2HBM A;  3UIQ A;  3NF9 A;  1KAY A;  4IOX A;  4DTM A;  2JLE A;  2ZQB A;  4KHU A;  3G6E N;  3G71 N;  1Q81 O;  1TAQ A;  5I42 A;  5BR8 K;  1NGE A;  1JL1 A;  3A5N C;  4M3X A;  3O9R A;  3OYK A;  3KLG A;  3ZT3 A;  2ASP A;  2FF6 A;  4BR9 A;  5C10 A;  3CC2 N;  3LPT A;  4K42 A;  4FLY A;  1ASV A;  3SYZ A;  4CJP A;  3AVB A;  4C8M A;  3C65 A;  3TTC A;  1NGJ A;  1QQN A;  1YVU A;  3RRG A;  3GDQ A;  2KQ2 A;  2P9I B;  4GMJ B;  2F4V K;  2G8F A;  3PX0 A;  1HYZ A;  4DTJ A;  3U4L A;  4CZE A;  4FO0 A;  4HTU A;  1WNS A;  4YOR A;  2G8V A;  4B8C A;  3UKR B;  1H1V A;  3VGL A;  2IVP A;  1L3U A;  1HPZ A;  1GLC G;  4GY2 B;  1BA0 A;  1YF5 L;  1KXP A;  1ASU A;  4H0O A;  1NGB A;  3DXM A;  4FSV A;  3CG7 A;  1RT1 A;  3J80 O;  4OLB A;  4CJU A;  4CW7 B;  1HNI A;  4OPJ A;  1MDU B;  5CYM A;  4CIE A;  1YXQ A;  2AJQ A;  2ZE2 A;  2WFB A;  3AAP A;  4Z4I A;  3CPW M;  2HND A;  4E7K A;  3CME N;  3SUP A;  2CH6 A;  4K41 A;  2O4G A;  1TV6 A;  4DFM A;  3AA3 A;  4JHD A;  1KVA A;  1LAV A;  4I9L A;  1SL1 A;  3SZ2 A;  1LV5 A;  5C12 A;  3TR8 A;  4NCA A;  1ZBU A;  1NK4 A;  4CJT A;  1HR0 K;  3O9U A;  4B9M A;  4FJK A;  1NGD A;  3VQ8 A;  3CQY A;  3ZX0 A;  2OAN A;  1QZ6 A;  3VQA A;  4KH4 A;  2Q0U A;  4C8O A;  3OYI A;  1RDW X;  3OJU A;  3JS6 A;  4JV5 K;  5BRD A;  3SK3 A;  3OJS A;  4K8Z A;  4XH4 A;  2PY5 A;  4FLU A;  1OH8 A;  1SQK A;  5AQY A;  2FF3 B;  5M1Q A;  3DOL A;  2D0B A;  1M1K O;  4FWM A;  1NGF A;  4YOU A;  5TKY A;  4E7H A;  3HPG A;  4QCL A;  1YJ9 N;  4BRI A;  1RDA A;  1WSH A;  4FYD A;  2P9P B;  3TAM A;  3AV9 A;  1IBL K;  5A2Q O;  2P9K B;  3E01 A;  3CF5 L;  2PYJ A;  3EKS A;  4DS5 A;  3CHW A;  5AZI A;  2P9I A;  3IUC A;  4XIU A;  1VSM A;  4L8R B;  4FM1 A;  3E9L A;  4BRE A;  4A5A A;  3WT0 A;  3LDN A;  1RT2 A;  4DU4 A;  3PX6 A;  1BI4 B;  5AQZ A;  1T44 A;  5C42 A;  1NGH A;  1HNZ K;  3SPZ A;  2XY8 A;  2YCH A;  1WSJ A;  2ZJP L;  2D0C A;  3MMV A;  4IFE A;  1NKC A;  1IG8 A;  2QWN A;  4DFJ A;  3C6H A;  5AFU A;  1S5J A;  3IKM A;  2ATQ A;  3DRR A;  5I9E B;  3ZT1 A;  1JLB A;  3C95 A;  4CFC A;  3HJF A;  4DTR A;  4ILG B;  5JMV A;  5IT9 O;  2XY6 A;  1W0H A;  1NK7 A;  1CLQ A;  4H5W A;  4EZ9 A;  3HT3 A;  1XWL A;  4LF7 K;  3E66 A;  3CCR N;  2P1J A;  3VQD A;  3ASM A;  2NRV A;  4BC4 A;  4DG1 A;  1V4S A;  3L4I A;  5I3U A;  1XI1 A;  2P9U B;  3FZL A;  3SMS A;  3MDQ A;  4N76 A;  3B6P A;  1A5V A;  2P51 A;  4CD1 A;  4BGB A;  3QNN A;  1VSE A;  4Z0U A;  1P90 A;  3ISN C;  3WQU A;  1N32 K;  3SV3 A;  3E9O A;  3A5M C;  4FLW A;  2HW3 A;  5CYQ A;  2IVN A;  1T8E A;  2IS3 A;  1Q86 O;  3RSE A;  4QOZ B;  2OZM A;  3LWM A;  4JKF A;  3NE6 A;  3RMC A;  3O3G A;  2RKI A;  3VER A;  4EP5 A;  2KW4 A;  2NRW A;  3CXC M;  2F8T A;  2XY5 A;  4CJ7 A;  1C1C A;  2B6A A;  4M3W A;  1W9H A;  4DV6 K;  3ATV A;  5AQG A;  3VPZ A;  1RT7 A;  4IO9 L;  1SAZ A;  1TYQ A;  5EXW A;  3S3M A;  4BAC A;  3P5J A;  1G15 A;  3KWI A;  1RBU A;  1NMD A;  2O8B B;  4O0I A;  3P1G A;  4FK0 A;  5AZJ B;  3A5L C;  2E8A A;  2HHV A;  2E6M A;  1YTA A;  4PL8 A;  4DV7 K;  2E20 A;  2IDO A;  1ATN A;  3QO9 A;  4CZI A;  1KFS A;  4ISG A;  1JLG A;  4DQR A;  4NLB A;  2WUS A;  5KPT A;  2VWJ A;  1E4G T;  4LH5 A;  5KQ8 A;  2UU9 K;  1B9D A;  4I2Q A;  5HLF A;  3JSM A;  2QKB A;  2UUC K;  1N8R O;  3EE8 A;  4CJR A;  3K5L A;  3CIP A;  2HHS A;  2HBJ A;  3AVH A;  1W97 L;  4JI2 K;  1RBS A;  3ULE B;  1BL3 A;  2YKN A;  5EOY A;  4CGI A;  4IJA A;  2HVH A;  3CYM A;  5FLX O;  1Q7Y O;  3RMB A;  2ZWH A;  4CZK A;  4Q0B A;  2HBK A;  2X74 A;  3J8A A;  4EAH D;  1TUU A;  4CEO A;  3GG4 A;  3ZCM A;  1RDD A;  2HHU A;  3O9Q A;  3C94 A;  3HI0 A;  4JS4 A;  3ZSV A;  2D4W A;  3WUH A;  3MCP A;  3R1X A;  5DMR A;  3BF3 A;  4IOA L;  2VGN A;  4Z4H A;  1N36 K;  4OPK A;  1BIS A;  3OBY A;  3LDO A;  5M1F A;  3H3O B;  4BRO A;  1C0G A;  3R3L A;  1ASW A;  3W3D A;  1NK5 A;  2O8F B;  3NBP A;  1Q9X A;  3LWL A;  1FXX A;  1X9M A;  2KLA A;  4RG8 A;  1NM1 A;  4IJN A;  1Q18 A;  3IS9 A;  1CXQ A;  1RTD A;  1HKC A;  4FL9 A;  1IKV A;  4BDY A;  2Z1I A;  2P9S A;  2YX6 A;  1WSI A;  1GOC A;  3O1W A;  3O5B A;  3QLH A;  3RSE B;  3T1Y K;  2E6L A;  1SKW A;  4JI7 K;  4DR3 K;  3V81 A;  1MA9 B;  2VG6 A;  4KHQ A;  3HST B;  4L3Q A;  4XH1 A;  1KLN A;  1CXU A;  4IKF A;  3D2F A;  1X1P A;  1NGI A;  4BRP A;  4O8K A;  2DFH A;  3CER A;  4GVM A;  1QHA A;  2ASM A;  5FPM A;  4GKJ K;  3U3Y A;  5EVZ A;  4AHU A;  4X65 K;  2O8B A;  3ZYY X;  3D0P A;  2IAJ A;  3A0I X;  4H03 B;  4HTL A;  3EO3 A;  3TTD A;  3VEY A;  3DLB A;  4DSI A;  3QEI A;  1JJ2 M;  4LF9 K;  3VEW A;  1V4T A;  3KLH A;  2RF2 A;  3E9P A;  3DRS A;  3QIO A;  2D0O A;  4Z94 A;  3HPH A;  4M42 A;  4IG0 A;  3CQ8 A;  4B3S K;  3H45 C;  4B9N A;  3RMD A;  3IRX A;  4U67 L;  4K43 A;  5F1X A;  4IOC L;  2YHA A;  3CCV N;  3WNG A;  1QSY A;  3SLC A;  4F9O A;  1YJW N;  1FJG K;  4CEF A;  4BC2 A;  5CR4 A;  4ID1 A;  1WAF A;  1RT6 A;  3O4N A;  3R9P A;  2RN2 A;  5EY4 A;  2HNZ A;  1NBW A;  3L2W A;  3HVR A;  4IG3 A;  4KHW A;  4BE2 A;  4B9U A;  4DMN A;  3LAK A;  3H08 A;  4O55 A;  2P9U A;  3U6F A;  3THY A;  5AQK A;  3OS1 A;  4DV5 K;  3RMA A;  3S9H A;  3LP2 A;  2VG5 A;  4FK2 A;  2QXL A;  1UWB A;  3K57 A;  3EKU A;  4J2E A;  3ZET B;  5SZT A;  1YIJ N;  5FPE A;  3AA2 A;  1KAX A;  4ELU A;  1I3A A;  3KK7 A;  1S6Q A;  3NH0 A;  5KRT A;  4LF8 K;  1C6V A;  2Z1H A;  3DLL L;  5DK5 A;  4WFN L;  3WXI A;  3CCU N;  4DV0 K;  5AQT A;  2O8D B;  2QWM A;  1KLM A;  5HBM A;  3QBW A;  5GIN A;  5CE3 A;  4BVP A;  1EET A;  4DV3 K;  3VGM A;  4JI5 K;  3QML A;  4I2P A;  3RRH A;  1VK0 A;  1VHX A;  4FJM A;  1EX4 A;  3V9Z A;  4DV2 K;  4H0T B;  4R79 A;  2FC0 A;  1KVC A;  4IDH A;  4DUZ K;  2QI2 A;  3BUZ B;  1O1W A;  2BDP A;  3NF7 A;  2XY7 A;  3J7Z O;  4IEE A;  5GAH P;  2RPI A;  2O4I A;  4CFA A;  2QTD A;  1HUX A;  3G10 A;  4WF9 L;  1XUP O;  3BP8 A;  2QWL A;  5JVH L;  3V9X A;  3UKU A;  1EP4 A;  3GE1 A;  2E4L A;  4YNQ A;  3K58 A;  3IG1 A;  3L0Q A;  4CF1 A;  3LAN A;  3NMU A;  4MQ3 A;  4JHD B;  1RT5 A;  3CC4 N;  4ISE A;  2VCP A;  3OYL A;  3MWT A;  3S3O A;  3A8Y A;  3HZ6 A;  1K8K B;  4RCH A;  4DV1 K;  1KD1 O;  3SAF A;  1BU6 O;  2ZD1 A;  1TKT A;  3LDL A;  2A6A A;  1VSL A;  2NNW A;  4CJE A;  1N33 K;  3AVN A;  4H4O A;  3THX A;  3NFA A;  4ELT A;  4HCB A;  4IWV A;  3LZJ A;  4DQI A;  3DYA A;  3A2F A;  4CZH A;  2NRT A;  4FWR A;  3VQ6 A;  2A1R A;  1JLC A;  2OYQ A;  2HHX A;  4CZJ A;  3WNE A;  4DTN A;  4IO8 A;  2VWB A;  4JKH A;  3V9U A;  4W5N A;  4KHY A;  1UAX A;  4N5S A;  1CZA N;  2JWL A;  3T19 A;  4CJ5 A;  3SBT A;  4FM0 A;  3PY8 A;  4CJL A;  3F9M A;  3TAF A;  2DTU A;  2Q0R A;  3VQ5 A;  4CK3 A;  3M3Z A;  4B3R K;  1S6P A;  3NVM A;  4R5P A;  1RT3 A;  3MCA B;  1REV A;  4JKE A;  4OO1 J;  3G4S N;  4DV4 K;  1ZBL A;  3HK2 A;  1TKX A;  3L2R A;  3CFO A;  2BTF A;  4FJX A;  3ZX2 A;  2UUB K;  5BRH A;  2OTJ N;  2CGJ A;  4Z4G A;  3P39 A;  3TAQ A;  2P9S B;  1T6C A;  1BI4 A;  1YAG A;  2FSJ A;  4B1Z A;  4EHT A;  1HMV A;  4FZY A;  4NXN K;  5AQF A;  3IAY A;  3M5R A;  4DTP A;  3NGI A;  1UOC A;  3OBW A;  4A61 A;  3QIP A;  1JCG A;  1GLF O;  3O4W A;  2HHW A;  5LJW A;  3CCQ N;  1BUP A;  2J4R A;  1NOZ A;  4RTF D;  4M3Z A;  1DT9 A;  3L8B A;  1OKJ A;  4Z4C A;  3THW A;  2FLO A;  4GKK K;  5GIP A;  4OGC A;  3OYN A;  4M41 A;  2YKM A;  3NGY A;  4BRF A;  4CF9 A;  1GOA A;  4JKA A;  3C6A A;  3CCJ N;  4HHT A;  1U45 A;  3U3G A;  1TKD A;  5C0Y A;  4GVE A;  4CEC A;  2YI1 A;  4X66 K;  5FRM A;  4PWD A;  3ENH A;  4CHP A;  4PKH A;  4FLT A;  1T3V A;  3VQ7 A;  5DM6 L;  4DTS A;  3CCL N;  4NYN A;  1YTU A;  3CCE N;  4KFB A;  3KJV A;  2VQE K;  5D3G A;  2X78 A;  3OYG A;  3BY5 A;  3TAG A;  3PLA A;  5AQH A;  1FW6 A;  1RTJ A;  3D45 A;  1NMN A;  1HQE A;  1VQO N;  3DLH A;  4LF5 K;  4MDA A;  3QEP A;  3V9W A;  3MEG A;  4IFY A;  3TSQ A;  2X6S A;  4KHS A;  2KTQ A;  2FSK A;  1NKB A;  1EWR A;  4A5B A;  2I7N A;  3QEV A;  3TAP A;  3E1Y A;  3OYH A;  4CER A;  3DLE A;  1FK9 A;  5T7B A;  4G1Q A;  4BE0 A;  4H4M A;  4MLE A;  1TYQ B;  4RW4 A;  2BH1 A;  3TAE A;  1VSF A;  2A40 A;  4BRG A;  3QEX A;  4A62 A;  4KHN A;  3THY B;  4CGD A;  5JLF A;  4RW7 A;  3H6E A;  1CZB A;  3QER A;  4FJI A;  1GLB G;  4FW1 A;  2OTL N;  3VET A;  2KZM A;  3WQT A;  1YI2 N;  3TTF A;  3UE5 A;  2P5G A;  1RT4 A;  1KC8 O;  1NGG A;  2G8U A;  3F2K A;  3AVJ A;  3KZB A;  3VA3 A;  4OPA A;  3VEV A;  4CEA A;  4DUY K;  5CHI A;  2BE2 A;  2VQF K;  1HX1 A;  2NLX A;  4WYB A;  2HMP A;  2KFZ A;  4BE1 A;  1IBK K;  2JWK A;  1GLJ O;  1D9F A;  3V9S A;  3VEN A;  3OVN A;  1SS6 A;  3AA4 A;  2A42 A;  4DTX A;  1X3M A;  2E1Z A;  5M1O A;  4GV3 A;  2IVO A;  4CBU A;  4E7I A;  3KK3 A;  1Q82 O;  2GUI A;  3DLK A;  4JLH A;  1YJN N;  2DFE A;  3P38 A;  1YVN A;  3DLR A;  1U2V B;  4BQZ A;  1F21 A;  3L2V A;  2KFN A;  1EQY A;  3OY9 A;  3UKU B;  5AQI A;  5C2F A;  3WXM B;  4IZ9 A;  3K59 A;  1SUQ A;  3NF6 A;  3W0L A;  4HUG A;  3TAR A;  1O13 A;  5FPD A;  5J2P A;  3VTH A;  3LL3 A;  1CZ9 A; 
#chains in the Genus database with same CATH homology
 4JRP A;  4CJK A;  3SUQ A;  1NJX A;  1KTQ A;  1TKZ A;  3IS9 A;  1CXQ A;  3VA0 A;  4CIF A;  4FJJ A;  1RTD A;  1TVR A;  4CHQ A;  5KGX A;  3RTV A;  4O0J A;  4KB0 A;  1IKV A;  4BDY A;  3AO4 A;  1RBT A;  3CFR A;  2Z1I A;  2OPS A;  3KK1 A;  4E19 A;  1VSK A;  4CIG A;  4KAZ A;  1WSI A;  1GOC A;  3DI6 A;  4KTQ A;  3QLH A;  1KCF A;  4CJW A;  1QTM A;  1JL2 A;  4FM2 A;  1QSL A;  2E6L A;  1SKW A;  2OPP A;  3V81 A;  1JKH A;  1VSH A;  2VG6 A;  5KGW A;  3HL8 A;  3NH1 A;  4KHQ A;  3HST B;  4CEQ A;  1KLN A;  3PX4 A;  3VQQ A;  4OGE A;  2HNY A;  3LZI A;  1CXU A;  1L3S A;  4IKF A;  4OLA A;  1RBR A;  1VRU A;  1X1P A;  3CM6 A;  3KK2 A;  3QNO A;  1X9W A;  1LWF A;  5CZ2 A;  4F2S A;  3C6T A;  3SJJ A;  1B92 A;  4W5Q A;  2DFH A;  4CHO A;  4GVM A;  1HYS A;  3HYF A;  2EHG A;  3U3Y A;  4AHR A;  2G8W A;  2GBZ A;  4CFB A;  4AHU A;  1L3V A;  4I9Q A;  2PYL A;  4PUO A;  4FLV A;  1L3T A;  5FRO A;  1S9E A;  1TK8 A;  1KSP A;  4AHT A;  2Q3S A;  3NH2 A;  4Q5V A;  3O3H A;  1S1W A;  4AH9 A;  4ZTF A;  4TSX A;  4FW2 A;  1D9D A;  3SQ4 A;  4Z4F A;  3SI6 A;  4F2R A;  4KRF A;  2Z1J A;  3VQP A;  2IAJ A;  3KLE A;  3D0P A;  1WLJ A;  4PQU A;  4EZ6 A;  1IKY A;  4FJG A;  4KTZ A;  1HRH A;  1ITG A;  5J2M A;  4RW6 A;  3DLB A;  3V1R A;  4DSI A;  5CY4 A;  4UQG A;  4CES A;  1C1A A;  5KTQ A;  3QEI A;  3ZSY A;  4FLX A;  1QE1 A;  4CF0 A;  1WAJ A;  1T05 A;  4OKK A;  1L5U A;  3L2U A;  3MED A;  3KLH A;  1IKW A;  1JLA A;  4C8K A;  2RF2 A;  1MU2 A;  3DRS A;  3QIO A;  2DY4 A;  5JS1 A;  1JXE A;  3WNF A;  5HRN A;  3SCX A;  3M8Q A;  1U4B A;  3HPH A;  4M3U A;  4KKO A;  4IG0 A;  3CQ8 A;  2BAN A;  4B9N A;  4M42 A;  3RMD A;  4LSN A;  3SQ0 A;  1LWC A;  3IRX A;  4J2A A;  2Y1I A;  1BCM A;  4E1M A;  3ZT2 A;  4ZTJ A;  3LP0 A;  4DTU A;  1U49 A;  3OYA A;  2YHA A;  1IKX A;  3ULD A;  2YNF A;  1U48 A;  3BDP A;  1Y97 A;  3WNG A;  1QSY A;  2D0A A;  2D5R A;  1NK9 A;  3MEE A;  3SUO A;  1ZYQ A;  1DTQ A;  4AHC A;  1S1V A;  2Y1J A;  2EX3 A;  1BHL A;  1RDB A;  3ZSR A;  2G8H A;  2HMI A;  4CEF A;  3VQC A;  1RTI A;  5SWM A;  3TWH A;  3QES A;  3EYZ A;  1LW0 A;  4ID1 A;  1WAF A;  1WSF A;  1RT6 A;  3MXJ A;  4CFD A;  4FJL A;  1Z25 A;  3O4N A;  2FBX A;  1RNH A;  4CHZ A;  1NJY A;  2RN2 A;  1TK5 A;  1YT3 A;  2HVI A;  4LY7 A;  4CED A;  3V1Q A;  3LPU A;  2HNZ A;  1S1U A;  3I0R A;  4DLG A;  3L2W A;  3HVR A;  4IG3 A;  4IDK A;  1TL3 A;  4KHW A;  3KD1 E;  4BE2 A;  4DTO A;  2OA8 A;  4DMN A;  3LAK A;  3H08 A;  1D5A A;  4B9U A;  4O55 A;  5HP1 A;  2P5O A;  3VQE A;  3NHG A;  3SUN A;  1NKE A;  3U6F A;  3RMA A;  1QS4 A;  1JLQ A;  3OS1 A;  4B08 A;  4DF8 A;  3S9H A;  4F8R A;  3PO4 A;  3AVL A;  3BGR A;  1KRP A;  1KFD A;  3LP2 A;  3AVC A;  5HRR A;  1XHX A;  4GW6 A;  4RW9 A;  3MAQ A;  2VG5 A;  4DU3 A;  3PV8 A;  1J53 A;  4E0D A;  2IGI A;  4FJ5 A;  2QXF A;  4FK2 A;  1UWB A;  4CJ3 A;  3F9K A;  3K57 A;  1C0T A;  4CF2 A;  1IG9 A;  2YNG A;  2G8I A;  4PY5 A;  4RW8 A;  3NDK A;  3VQ4 A;  1TGO A;  3MEC A;  5FDL A;  5J2N A;  5SZT A;  3MXM A;  1NK6 A;  4J2E A;  1T7P A;  2KZZ A;  4C8N A;  4DWI A;  3AA2 A;  4O44 A;  4OKJ A;  4HUF A;  1UA1 A;  2QK9 A;  3EZ5 A;  4DQQ A;  1S1T A;  4ELU A;  1I3A A;  1LW2 A;  2NUB A;  4LH4 A;  3VQB A;  1S6Q A;  4CK1 A;  1SKS A;  3NH0 A;  5KRT A;  3RR8 A;  4CEZ A;  1TL1 A;  2OZS A;  4Z4E A;  1VRT A;  4M45 A;  1LAW A;  1X9S A;  1NJW A;  3AO5 A;  1EKE A;  1C6V A;  2Z1H A;  3UIQ A;  3DMJ A;  3NF9 A;  2F8S A;  5DK5 A;  2WOM A;  3G0Z A;  4DTM A;  2JLE A;  2ZQB A;  4CHY A;  4KHU A;  1TAQ A;  5I42 A;  1KLM A;  1JL1 A;  3AVM A;  5HBM A;  3ZT0 A;  3HPO A;  4B9V A;  4K8X A;  1ZBI A;  4OVL A;  4M3X A;  1EET A;  3OYK A;  3KLG A;  3ZT3 A;  3AO3 A;  4BDZ A;  4CJF A;  4CCH A;  1BIZ A;  3SV4 A;  4E89 A;  4I2P A;  3RRH A;  3LPT A;  1WSE A;  1VK0 A;  4DFK A;  4FJM A;  4FLY A;  1EX4 A;  1ASV A;  1RIL A;  3DOK A;  4CJP A;  3AVB A;  3SYZ A;  3V9Z A;  1SKR A;  1D8Y A;  4CE9 A;  2IOC A;  3SNN A;  4C8M A;  4AHV A;  3NCI A;  2FC0 A;  4Y1D A;  1KVC A;  3TAB A;  4FJ7 A;  3P83 D;  3EY1 A;  4J2B A;  1O1W A;  1YVU A;  3AO1 A;  2BDP A;  1N5Y A;  3FFI A;  4CGJ A;  3NF7 A;  2KQ2 A;  3RRG A;  2XY7 A;  1NOY A;  1J54 A;  4GMJ B;  4NCB A;  2RPI A;  2G8F A;  2O4I A;  1GOB A;  3NAE A;  3HXM A;  3PX0 A;  3T3F A;  1HYZ A;  5HRO A;  4DTJ A;  3ZSZ A;  2OPQ A;  4CFA A;  3G10 A;  3HP6 A;  3F73 A;  4KV8 A;  4HTU A;  1WNS A;  3V9X A;  3ALY A;  4B8C A;  1EP4 A;  1U47 A;  2G8V A;  1Z26 A;  2E4L A;  4CGF A;  4YNQ A;  3K58 A;  3OYE A;  1WSG A;  3IG1 A;  4CGG A;  2W42 A;  3ITH A;  4CJS A;  1L3U A;  4AHS A;  2Z1G A;  4FJH A;  4CF1 A;  3LAN A;  1VSD A;  4J2D A;  1HPZ A;  4CJQ A;  3K5M A;  1Q9Y A;  4ZHR A;  4MQ3 A;  1ASU A;  4KRE A;  1RT5 A;  3CG7 A;  4BWJ A;  3OYL A;  1RT1 A;  3S3O A;  4OLB A;  4N47 A;  4CJU A;  3S3N A;  1XHZ A;  1HNI A;  4OPJ A;  3OYF A;  1Q8I A;  2VWK A;  5CYM A;  4CIE A;  3M8P A;  1WN7 A;  2ZE2 A;  3ZSQ A;  2YV0 X;  3V4I A;  4Z4I A;  2HND A;  2AJQ A;  2ZD1 A;  2HB5 A;  1TKT A;  4O4G A;  4B8A B;  4E7K A;  1VSL A;  4DSF A;  4CJE A;  3SUP A;  3AVN A;  4KTW A;  4H4O A;  3NFA A;  3AA5 X;  2O4G A;  4OKE A;  4PA1 A;  4ELT A;  4HCB A;  4FXD A;  3LZJ A;  4DQI A;  3DYA A;  3A2F A;  1TV6 A;  5J1E A;  3O3F A;  3VQ9 A;  3RWU A;  4DFM A;  4LD0 A;  3SQ1 A;  3AA3 A;  1KVA A;  3V6D A;  4E3S A;  1LAV A;  4I9L A;  3RR7 A;  3M8S A;  1SL1 A;  3VQ6 A;  2A1R A;  4YFU A;  3SZ2 A;  2A1S A;  1JLC A;  5EU7 A;  1XC9 A;  1LV5 A;  2OYQ A;  4I7F A;  4FJ8 A;  4M3Y A;  2HHX A;  3LAM A;  1NK8 A;  3V1O A;  3WNE A;  3TR8 A;  4HVJ A;  4JS5 A;  3AVA A;  4NCA A;  4B3O A;  1ZBU A;  4DTN A;  4CJT A;  1NK4 A;  2I5J A;  4IBN A;  4B9M A;  2FBY A;  4EP4 A;  2ETJ A;  3VQ8 A;  2XO7 A;  2XHB A;  4JRQ A;  4FJK A;  1QQC A;  3V9U A;  4W5N A;  3VQA A;  4KI6 A;  4KHY A;  1HNV A;  1UAX A;  4N5S A;  4C8O A;  3OYI A;  3OJU A;  2B5J A;  3OJS A;  4K8Z A;  1B9F A;  3T19 A;  4CJ5 A;  3L3U A;  1LWE A;  4FM0 A;  4AIL C;  4CJL A;  3TAF A;  3SPY A;  3PY8 A;  2PY5 A;  3NF8 A;  2DTU A;  4BDP A;  4QAG A;  4FLU A;  4OJR A;  3VQ5 A;  1JLF A;  4CK3 A;  4H8K A;  4N41 A;  1RCH A;  4F4K A;  1S6P A;  1BGX T;  4R5P A;  1FKO A;  1RT3 A;  3DOL A;  2FBV A;  1REV A;  2D0B A;  4E7H A;  3HPG A;  3HO1 A;  4QCL A;  4E1N A;  1RDA A;  1ZBL A;  3HK2 A;  1TKX A;  3TAN A;  4BWM A;  3L2R A;  1WSH A;  4FYD A;  3TAM A;  4CGH A;  3AV9 A;  2VG7 A;  3CFO A;  4F3T A;  4FJX A;  1RDC A;  1KVB A;  4CJV A;  3DRP A;  3OYJ A;  3E01 A;  2PYJ A;  3NGZ A;  4W5O A;  1QHT A;  3K5O A;  4DS5 A;  4Z4G A;  3SQ2 A;  4XIU A;  3TAQ A;  1VSM A;  4L8R B;  4FM1 A;  2BGG A;  4KPY A;  1BI4 A;  1QSS A;  1A5X A;  4E7J A;  4FZX C;  3AVG A;  3PX6 A;  1RT2 A;  5CZ1 A;  3OS0 A;  4DU4 A;  4MFB A;  1BI4 B;  1C0U A;  3ZSW A;  1HMV A;  1UA0 A;  4FZY A;  5C42 A;  4DU1 A;  2YHB A;  3SPZ A;  2XY8 A;  1WSJ A;  3IAY A;  2D0C A;  4CK2 A;  4DTP A;  1NKC A;  3NGI A;  5KRS A;  4F3O A;  1UOC A;  4DFJ A;  3QIP A;  1BIU A;  3KLF A;  3OYC A;  2HHW A;  1S5J A;  4DLE A;  2ATQ A;  3DRR A;  1I39 A;  1NOZ A;  3ZT1 A;  1JLB A;  3C95 A;  4CFC A;  3HJF A;  1DLO A;  4DTR A;  2XY6 A;  1W0H A;  4LSL A;  2YNH A;  1NK7 A;  4M3Z A;  1CLQ A;  3L8B A;  1VSI A;  4Z4C A;  4EZ9 A;  2F96 A;  3HT3 A;  1XWL A;  1HQU A;  4B9T A;  1C1B A;  4OGC A;  2P1J A;  3LP3 A;  3VQD A;  3OYN A;  4M41 A;  2YKM A;  3ASM A;  3NGY A;  4CF9 A;  1GOA A;  4DG1 A;  4Y1C A;  3ZT4 A;  4IFV A;  5I3U A;  1XI1 A;  3VN5 A;  3KIO A;  4ELV A;  4HHT A;  2HHQ A;  1U45 A;  3U3G A;  1TKD A;  4HCC A;  4CEC A;  4HUE A;  4N76 A;  3B6P A;  3ZSX A;  1A5V A;  2P51 A;  2R7Y A;  5FRM A;  4PWD A;  3K5N A;  2HHT A;  3QIN A;  4W5R A;  3QNN A;  4CHP A;  4DFP A;  1A5W A;  1RTH A;  1VSE A;  3ISN C;  4Z0U A;  4FLT A;  1RBV A;  1BCO A;  3OYM A;  3VQ7 A;  3SV3 A;  4DTS A;  4CHN A;  4FLZ A;  4NYN A;  4FLW A;  3I8D A;  4FJ9 A;  1YTU A;  1IH7 A;  4KFB A;  5CYQ A;  2HW3 A;  1T8E A;  4FK4 A;  2IS3 A;  3KJV A;  5D3G A;  3DM2 A;  2X78 A;  3OYG A;  1BQM A;  1FKP A;  3TAG A;  4QOZ B;  2OZM A;  1C0M A;  3LWM A;  3C6U A;  1RTJ A;  3D45 A;  3I0S A;  1HQE A;  1J9A A;  3DLH A;  3TI0 A;  4FVM A;  1JXB A;  3QEP A;  4DQP A;  4DSK A;  3NE6 A;  3RMC A;  1BQN A;  3O3G A;  3MEG A;  2RKI A;  4IFY A;  3V9W A;  2X6S A;  4NCG A;  4EP5 A;  2PZS A;  4M3T A;  4KHS A;  3QEW A;  2FBT A;  2KTQ A;  2KW4 A;  3OYB A;  1NK0 A;  1NKB A;  2F8T A;  2XY5 A;  3OYD A;  1C1C A;  3QEV A;  2B6A A;  3OYH A;  3TAP A;  4CER A;  1K6Y A;  3DLE A;  1FK9 A;  4M3W A;  1W9H A;  5T7B A;  3AVF A;  4G1Q A;  4BE0 A;  2XRI A;  4H4M A;  4FJN A;  2GV9 A;  1J5O A;  1RT7 A;  4KI4 A;  4RW4 A;  4ICL A;  3S3M A;  4KO0 A;  3TAE A;  1VSF A;  2QKK A;  4BAC A;  3P5J A;  3QEX A;  1G15 A;  3HVT A;  3JYT A;  3HM9 A;  1RBU A;  1DTT A;  4KHN A;  3CFP A;  3M8R A;  3K2P A;  4O0I A;  4CGD A;  1U04 A;  4RW7 A;  4N56 A;  3P1G A;  4DSE A;  4ID5 A;  4FK0 A;  2G8K A;  2HHV A;  2E6M A;  1CZB A;  3QER A;  4KB1 A;  1YTA A;  1SL2 A;  4W5T A;  1N6Q A;  4FJI A;  3T1A A;  5HRS A;  4FW1 A;  2IDO A;  3QO9 A;  1ZBF A;  2OPR A;  4DF4 A;  1KFS A;  3AVI A;  3ZSO A;  2KZM A;  1JLG A;  1HJR A;  2ITG A;  4DQR A;  2P5G A;  1RT4 A;  2VWJ A;  4LH5 A;  5C25 A;  5FRN A;  3THV A;  1B9D A;  4I2Q A;  3WNH A;  4E7L A;  4DS4 A;  5HLF A;  3JSM A;  2G8U A;  2QKB A;  3AVJ A;  5C24 A;  4CJR A;  3K5L A;  4CEB A;  3VA3 A;  1JLE A;  3KKS A;  1TAU A;  4DSL A;  4CEA A;  4B9S A;  2BE2 A;  3QET A;  2HHS A;  3O4Q A;  1HYV A;  1SL0 A;  4O5B A;  3DLG A;  2KFZ A;  2DFF A;  3AVH A;  1S9G A;  4BE1 A;  3LDS A;  3OS2 A;  5K14 A;  1R0A A;  1RBS A;  3MXI A;  1ZBH A;  1EXQ A;  1BL3 A;  1D9F A;  2YKN A;  4CGI A;  1IO2 A;  3AO2 A;  2HVH A;  3CYM A;  3V9S A;  1TK0 A;  4B9L A;  3OVN A;  1VSJ A;  3RMB A;  4Q0B A;  3AA4 A;  4M3R A;  2X74 A;  4DTX A;  4C8L A;  4DSJ A;  3LAL A;  4CEO A;  3B6O A;  4DQS A;  3KTQ A;  3ZCM A;  4CEE A;  1RDD A;  2IC3 A;  2HHU A;  2B4J A;  3LP1 A;  2YNI A;  3L2Q A;  3KKR A;  4CF8 A;  3C94 A;  4E7I A;  3KK3 A;  3PUF A;  5HRP A;  2GUI A;  3AVK A;  3DLK A;  3ZSV A;  4JLH A;  4JS4 A;  2X6N A;  2DFE A;  5DMR A;  5KI6 A;  3DLR A;  4Z4H A;  5JS2 A;  1F21 A;  4OPK A;  3L2V A;  2KFN A;  1BIS A;  5E41 A;  3OY9 A;  3HP9 A;  1SV5 A;  3KLI A;  1NJZ A;  3CM5 A;  1S1X A;  3PO5 A;  2JGU A;  2WON A;  1T03 A;  4FCY A;  3K59 A;  1SUQ A;  2LSN A;  3NF6 A;  3KD5 E;  4HUG A;  3TAR A;  3L3V A;  4NYF A;  4FZZ A;  1ASW A;  5J2P A;  1NK5 A;  3NBP A;  1Q9X A;  5J2Q A;  3LWL A;  1FXX A;  4WE1 A;  4CJ4 A;  1X9M A;  4RG8 A;  1CZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...