3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
2QXFA 1NK0A 1D5AA 1VSHA 1L5UA 1RT1A 4DQQA 4DSLA 3KKRA 2ETJA 2HNZA 4H4MA 3K5NA 2EHGA 1JXEA 2XY5A 3U3YA 4TSXA 4N76A 3L2RA 3AO3A 3B6OA 1UOCA 3SPZA 4M3ZA 2OPSA 1F21A 2G8UA 3PO5A 4FJJA 1VSFA 1W9HA 1NK4A 1QSSA 3TI0A 2P5GA 4KAZA 4CJTA 3LZIA 3VA3A 3NF6A 1BGXT 1TL1A 1KLNA 3LAKA 2HHSA 3RMDA 1SKWA 3OYKA 3AVAA 3OYEA 2DTUA 1WSHA 3DLRA 3HL8A 3WNFA 3TARA 3RMCA 4DS4A 1VK0A 1GOCA 4CHPA 1X1PA 2FBVA 4CK2A 5I42A 3QEIA 1HQEA 4OPJA 3OS2A 3HP6A 4Z4GA 4BWJA 3KLFA 3HJFA 3ZT1A 5HRNA 1ASVA 3AVBA 4CEQA 4H4OA 1C1BA 2NUBA 2G8IA 3TAMA 3VQBA 3K5LA 1HQUA 4OLAA 3AA3A 4I7FA 4E19A 3VQQA 4CF0A 2VWJA 1KFSA 5J2MA 5KGWA 1KSPA 1RT5A 3KK1A 1JLEA 1VSLA 3KJVA 2D0CA 3ZSXA 3M8RA 1ZBIA 4DFPA 3K58A 2BDPA 4B9NA 1RBVA 4CHNA 4XIUA 1WLJA 2ZE2A 3V1QA 1GOAA 4CF8A 1QTMA 2IGIA 4B9LA 4R5PA 3HK2A 1ZBUA 2YNGA 2DFHA 4AHUA 1JLFA 3OYFA 1JKHA 1QQCA 4FLZA 2XY6A 4I2PA 4CE9A 1RT3A 2YKMA 4C8LA 4J2BA 1VRUA 1T8EA 4PA1A 1DTQA 1XWLA 2OPRA 3WNHA 3LWLA 3AVHA 1IG9A 1BL3A 1S1XA 2YHBA 4LSNA 3V9SA 4KTQA 3LAMA 1D8YA 4Q5VA 4BDYA 3ITHA 4AHRA 4RW7A 4FLXA 3OYBA 3OJSA 1SKRA 1WN7A 3JYTA 3V1OA 1ASWA 2GBZA 4CJRA 3NH2A 3K2PA 4GMJB 5DK5A 3AO1A 4IFVA 3VQ5A 2RPIA 1S5JA 1CXQA 4CJQA 3NDKA 4CCHA 1EXQA 1DTTA 2KW4A 1RDCA 4KRFA 4AILC 3SUQA 2FBTA 4C8OA 3MEGA 2KZMA 4FJHA 4PY5A 4DG1A 3CQ8A 3QERA 1HYZA 2F96A 3TABA 1N5YA 3SV3A 4KI6A 4I2QA 4DWIA 1QE1A 4FJ8A 3NAEA 3NH1A 5KGXA 3AO5A 4DTXA 3HVRA 2A1RA 4KB1A 4DQRA 3LPUA 4DSEA 4DU1A 3AVLA 4FLVA 3S3NA 1YT3A 3DI6A 5EU7A 4NCGA 3HM9A 4I9QA 1WSGA 1KVCA 3ZSZA 3OS0A 2Z1GA 3OYNA 1JLQA 2XY7A 1RTJA 5JS1A 1JL1A 4HHTA 1GOBA 2B6AA 3ZSYA 4OJRA 1C1AA 4FJ5A 4DTPA 3TAPA 4M3XA 1C0MA 1CLQA 3O3GA 1FXXA 1TVRA 4CIEA 4DF4A 4M42A 2OPQA 1VRTA 2LSNA 3ZSVA 5KRSA 1T05A 4Z4EA 3TAQA 4ELTA 1VSDA 3ZT0A 3KLHA 1HNVA 4C8MA 4DTSA 1IKXA 2VG6A 1TAUA 3C6UA 4O55A 3ISNC 1UA1A 2HHQA 4J2DA 3VQ7A 3CYMA 3I0RA 2HHUA 2E6LA 4Y1DA 4NYNA 1JLBA 3TWHA 3OYAA 4F3TA 3T3FA 3AVIA 4DSIA 2RKIA 1LAVA 1HNIA 4CEOA 4C8NA 3AO4A 3QETA 2X6NA 3SJJA 5KI6A 3VQ6A 3AVMA 4ICLA 3ALYA 3TR8A 2HNYA 5SZTA 3E01A 5CYQA 4FK0A 1KVAA 4PQUA 4IKFA 3DOKA 3TAEA 3OS1A 4HCCA 1SL1A 3LP3A 1EETA 1Q9YA 5CY4A 1S1UA 4M41A 3VQPA 3NGZA 5C25A 1KFDA 2O4IA 1QSYA 1NJWA 1VSJA 4HTUA 2AJQA 3OYGA 2KTQA 2RN2A 4DFJA 4EZ6A 1KVBA 4CHOA 1KTQA 4AHSA 3H08A 1RBUA 3QIOA 4EP4A 4JS4A 1ZBFA 2YHAA 3OYMA 3CM6A 1TK8A 3KK3A 4BE2A 3G10A 4CECA 1LWFA 4O44A 3PX4A 4FJXA 3AVGA 3UIQA 3VQCA 4RW6A 2HVHA 3C94A 4JLHA 4FCYA 4FZYA 3HO1A 1YTAA 3P83D 4DU4A 3NF7A 3KD5E 3PV8A 4N41A 4OLBA 3O3HA 4N56A 4JRQA 1QS4A 1SUQA 3I8DA 2D0BA 3NFAA 4DFMA 4DQSA 4M3YA 2BGGA 3KKSA 3OYLA 5HROA 4KHYA 3LALA 3S9HA 1BCOA 1JXBA 3NE6A 3SPYA 2XO7A 3S3OA 4CJ4A 1RDDA 3OYJA 4NYFA 3DRSA 1ZBLA 2HMIA 2X74A 1HPZA 1NOZA 2OPPA 3AVCA 4KHWA 1HYSA 1REVA 2YNFA 3VQEA 4CK1A 3NCIA 5K14A 4ID1A 4LD0A 4M3RA 4FM1A 4W5RA 3AA2A 2FBYA 2PY5A 1KCFA 2IS3A 2G8HA 3HYFA 2P5OA 3DYAA 4DQIA 1LWEA 4KTZA 1A5WA 4CEAA 3T19A 4DTMA 2IDOA 4LH5A 4B3OA 1J5OA 3SUNA 3WNEA 5KTQA 1JLCA 3NH0A 4OKKA 4CERA 1IKYA 4O5BA 5HLFA 1JL2A 1T03A 3NBPA 1S9EA 1WAJA 1IH7A 2D0AA 4CF9A 3AV9A 4DS5A 1NK6A 1SL2A 1B9FA 3PX0A 4FLWA 3OYDA 5FROA 3CG7A 3PO4A 4CIFA 4B9SA 3OYCA 2VG5A 4ZHRA 3L2VA 4KHNA 1RT2A 4FM0A 2EX3A 4Q0BA 1NKEA 3EY1A 4QAGA 4CJVA 1LAWA 3DRRA 3LWMA 4E1NA 4W5OA 5HP1A 3TANA 2OZMA 3LANA 4IBNA 4B9TA 3PUFA 4DLGA 3WNGA 2G8VA 3DOLA 3ZSOA 4CF1A 4N5SA 4DTNA 1X9SA 4MQ3A 1C0UA 3KD1E 3L2WA 3ZT2A 1I3AA 4FJMA 1TKZA 2FBXA 1FKOA 4B9VA 2HW3A 2Y1JA 4J2AA 3JSMA 3A2FA 4FVMA 4CGFA 4CJ5A 4E1MA 3KK2A 1TAQA 1QSLA 4M3WA 4RG8A 5E41A 4DTOA 3NGYA 4HUFA 4E7HA 2DFFA 4FJLA 4LH4A 3EYZA 1LWCA 1S6PA 2XHBA 3RR7A 4OGCA 2Y1IA 1TKXA 2E6MA 4BWMA 3LP1A 3VN5A 1XHXA 4M3TA 3QEWA 4DSFA 4E0DA 1RT4A 4KTWA 4CJEA 3VA0A 3MAQA 4ID5A 3VQ9A 3V4IA 4CGJA 3TAFA 2G8WA 3P1GA 4Z4IA 4KPYA 5CZ2A 2F8TA 1FK9A 1NJYA 4EP5A 2PYLA 1RDAA 4AHCA 3AA4A 1BI4B 2YNHA 3ASMA 3CFPA 1NJZA 1NK9A 3DM2A 4UQGA 1EP4A 4K8XA 1RBRA 3DLKA 2A1SA 1VSIA 2I5JA 5HBMA 4CJWA 3PY8A 1N6QA 3CFRA 1HYVA 1KRPA 1WSEA 3O4QA 3RTVA 4W5TA 2BE2A 4RW9A 1CXUA 4CHZA 1L3VA 1IKVA 1U48A 1CZBA 1Z25A 5T7BA 4O0IA 3QEXA 1U4BA 1C0TA 4HUEA 4ZTFA 1RDBA 4DLEA 3U3GA 4FLTA 1BIUA 1U45A 1L3SA 4FJKA 4OGEA 4MFBA 3DLBA 3O3FA 3OJUA 1RTIA 4FJNA 4NCBA 1WSJA 2P51A 4OPKA 3LZJA 1YVUA 2HNDA 1D9DA 4Y1CA 4YFUA 5I3UA 1R0AA 3D45A 4JRPA 1FKPA 3NHGA 1BI4A 3LPTA 3SI6A 3V9ZA 3P5JA 3S3MA 1S1TA 1UWBA 2Z1HA 3SUPA 3KLGA 1SV5A 1RTDA 2GUIA 3T1AA 3AVNA 3L8BA 4CFCA 4FW2A 1S6QA 4M45A 1YTUA 4FK2A 3SV4A 3V6DA 4FW1A 3B6PA 5SWMA 3NF8A 4CJ3A 3V9XA 3HPOA 1LV5A 5D3GA 2Q3SA 3HVTA 4AH9A 4KV8A 5CYMA 4CHQA 4IG3A 2R7YA 1TGOA 3M8SA 3RRHA 4FK4A 4QOZB 1EX4A 4DQPA 1U49A 2KFZA 3AO2A 3SQ1A 1T7PA 2WONA 4CIGA 4AHTA 4E7JA 3IRXA 3ZSRA 4O4GA 4FLUA 1LW2A 4WE1A 4B9MA 5FDLA 4IFYA 4Z4FA 3RMBA 4FXDA 1IO2A 4KHUA 3V9UA 3NF9A 4CEZA 1C1CA 4GVMA 4KI4A 1VSMA 5C42A 3QO9A 4CJKA 4E7IA 4CEDA 1XHZA 2IAJA 4FZZA 4DFKA 1VSKA 3OYHA 1Y97A 3SQ4A 3VQDA 1S9GA 4GW6A 4CGIA 1WSFA 4CJFA 2OZSA 1UAXA 4CESA 3BDPA 2DY4A 3TAGA 4QCLA 3K5OA 4FYDA 4CFDA 4F8RA 4DSKA 2HHVA 4CJLA 4KB0A 1RBSA 1RBTA 3MEEA 4BACA 1J9AA 4CJUA 3FFIA 1TL3A 4CGDA 1TK0A 2Z1JA 3HPGA 2ZQBA 1XC9A 2D5RA 2G8KA 3KTQA 4PUOA 2KZZA 4ZTJA 2RF2A 5KRTA 4NCAA 3CFOA 1B9DA 5HRSA 4HCBA 3V9WA 3DLGA 4E7LA 5J2PA 1L3UA 4OKEA 1Q8IA 2YV0X 4FJIA 4KHSA 2F8SA 4KREA 1HJRA 4B8CA 1NKBA 1RNHA 1TKDA 5FRNA 1NK7A 2YNIA 3LP2A 3LP0A 3QESA 4BDPA 1RTHA 2XRIA 1LW0A 4CEBA 1ZYQA 2QKBA 4AHVA 3HXMA 2ITGA 4HUGA 3HT3A 3RMAA 2IC3A 3KIOA 4PWDA 3DLEA 3F9KA 4LY7A 1NOYA 5DMRA 3NGIA 4FJ7A 4OVLA 3ULDA 2PZSA 4W5NA 3U6FA 2HHTA 2W42A 3G0ZA 1D9FA 1Q9XA 1QHTA 1TKTA 5HRPA 5FRMA 1B92A 1BQNA 1S1VA 4HVJA 1NK8A 1WNSA 4BE0A 2B4JA 4B9UA 4KFBA 4CK3A 4DU3A 3CM5A 2VG7A 2X6SA 3OYIA 5J2NA 3K59A 2E4LA 3VQ8A 3DRPA 3KLIA 4F4KA 1IKWA 3ZT3A 4B08A 1ASUA 3MXJA 4DMNA 4DF8A 3V81A 2OYQA 5J1EA 4L8RB 1CZ9A 3L3UA 2ZD1A 4CGHA 2HVIA 1X9WA 1NKCA 3ZT4A 1BIZA 3SZ2A 4Z4HA 1SL0A 3AVJA 1EKEA 1JLGA 1JLAA 4FJ9A 3QEPA 3SUOA 3I0SA 2WOMA 3DMJA 4I9LA 4C8KA 3L2UA 1WSIA 3M8PA 4FJGA 2KFNA 2B5JA 4RW8A 5JS2A 3QNNA 5C24A 3OVNA 3VQAA 4FLYA 3PX6A 3D0PA 4CJPA 3SNNA 3MXIA 1RCHA 4J2EA 1W0HA 4DTRA 4E89A 3MECA 3SQ0A 1ITGA 1BCMA 4CFAA 2X78A 4CEFA 1SKSA 5HRRA 1J53A 3C95A 1TK5A 1NK5A 1DLOA 4BE1A 1L3TA 4BDZA 3QNOA 4Z4CA 4EZ9A 3V1RA 3ZSWA 5CZ1A 1MU2A 3IG1A 2YKNA 3RRGA 2KQ2A 2JGUA 3EZ5A 4G1QA 3ZCMA 1RILA 4CEEA 3MXMA 2P1JA 2XY8A 1U47A 4KO0A 2VWKA 1Z26A 2HB5A 4IDKA 3KLEA 4CHYA 2G8FA 3BGRA 3HPHA 1A5VA 3QIPA 4CF2A 3AVKA 3QEVA 1XI1A 4B8AB 3SYZA 1UA0A 4M3UA 3F73A 1X9MA 1K6YA 3THVA 1S1WA 4ELUA 4FZXC 1NJXA 3QINA 4Z0UA 1O1WA 4CGGA 3L2QA 2DFEA 2GV9A 3AVFA 4OKJA 4KKOA 1RT7A 4W5QA 2HHXA 4FM2A 1G15A 3IAYA 4DSJA 3AA5X 4LSLA 3ZSQA 1I39A 2O4GA 4E7KA 4F2RA 4H8KA 2FC0A 1TV6A 1BISA 3HP9A 5J2QA 1HMVA 2QKKA 4JS5A 4K8ZA 2QK9A 1BQMA 3O4NA 2IOCA 3MEDA 3SCXA 4F2SA 4IG0A 3L3VA 4RW4A 4DTUA 1U04A 2JLEA 3OY9A 4O0JA 1HRHA 3RWUA 1A5XA 3LDSA 3C6TA 2OA8A 3HSTB 3SQ2A 1BHLA 4KHQA 1J54A 1VSEA 4ELVA 3QLHA 1ZBHA 3RR8A 2ATQA 3K57A 4F3OA 2Z1IA 2PYJA 1WAFA 1C6VA 3M8QA 4DTJA 3DLHA 1RT6A 1KLMA 4CJSA 4E3SA 2HHWA 4YNQA 3IS9A 4CFBA 2BANA 3K5MA 4N47A 3VQ4A
chains in the Genus database with same CATH superfamily
1NK0A 1D5AA 1RT1A 4DQQA 4DSLA 3CMEN 4CZKA 3KKRA 3AAPA 3VETA 2ZF5O 1JCGA 2ETJA 2EHGA 1JXEA 2XY5A 4N76A 2W41A 1KC8O 2E5LK 4M3ZA 2GUPA 3MN6A 3FZHA 4FJJA 1QSSA 2PBDA 2IIRA 4IFEA 2ZJRL 4GY2B 5BPMA 1TL1A 2YI1A 3IFRA 4BR5A 5AQVA 5E26A 4OX9K 2E1ZA 4LF9K 1HQEA 4OPJA 4YOYA 1SQKA 4F9OA 3KLFA 3O9QA 2VQFK 2G8IA 3TAMA 1HQUA 1YUWA 4U67L 3VTIA 3D2EA 3G25A 3KK1A 1VSLA 2P9NA 1ZBIA 4M7YA 2FXUA 4H5RA 3V1QA 1GOAA 3ZX3A 2IGIA 3C65A 5B8HA 4AHUA 1JKHA 2XY6A 3IKMA 1RT3A 2YKMA 4M7XA 3RSEB 1VRUA 1OVYA 2DPNA 4PA1A 4X66K 2OPRA 3LWLA 2QWLA 2YX6A 4Q5VA 4BDYA 4RW7A 4FLXA 3OYBA 2NRVA 4A5AA 1ASWA 4BY9C 4FWOA 4CJRA 3IMXA 5DK5A 4IFVA 3VQ5A 4C1NK 1HNZK 1RDCA 4KRFA 4AILC 1ZC6A 4DHYA 4DG1A 3CQ8A 2OTJN 3TABA 4FPBA 5AQPA 5KGXA 4DTXA 1XMOK 5CR4A 5JLFA 5BR8K 2A1RA 3JXUA 4DU1A 1NGIA 4DSEA 3F9MA 4AM6A 1U2VB 3DI6A 4JI4K 2QWPA 3HM9A 4I9QA 1KVCA 4JV5K 1GOBA 3ZSYA 1MWMA 4FJ5A 1C0MA 3PLAA 3EKSA 3ZETB 3CC2N 1T05A 1VRTA 2LSNA 3ZSVA 4M63C 1HNVA 4C8MA 4O8UA 1WB9A 3VQ7A 2HHUA 2GWKA 3CJCA 2E6LA 4H0VB 4NYNA 5BR9A 2RKIA 1LAVA 2E2QA 3AO4A 3QETA 4BRPA 3VQ6A 4ICLA 3TR8A 1I94K 4GV3A 5EXWA 2KKZA 3DOKA 3BEXA 3FR0A 3MCPA 1S1UA 3NGZA 1KFDA 4JK7A 1VSJA 2AJQA 2QWRA 2KTQA 4DFJA 1KVBA 3PIOL 4EP4A 3I33A 3SK3A 3WXLA 3CM6A 3KK3A 2P9NB 3AVGA 3VQCA 4JEPA 3KD5E 1HKBA 3PV8A 4DQSA 3OYLA 5HROA 4KHYA 2CH5A 1JXBA 3NE6A 2Q0UA 3SPYA 1NGJA 3QFPA 1DKGD 3SAGA 3VTHA 2HMIA 1GLDG 5AQZA 1NOZA 2O8CA 3MX2A 4QS9A 2HF3A 3NCIA 4CK1A 4LD0A 3M5RA 4FM1A 3ENBA 2FBYA 4YHHK 2IS3A 3T1HK 4DQIA 4DTMA 2IDOA 4LH5A 1TUYA 2NRZA 4B3OA 1J5OA 4Y0WA 3WNEA 2GEMA 4OKKA 2ZM6K 3NBPA 3UKRB 1B9FA 5GAGP 3H3OB 4ZHRA 3CXCM 1NKEA 4KHPK 3EY1A 4QAGA 2E1YA 1LAWA 3ENOA 5AR0A 4W5OA 5HP1A 3VEWA 5IT9O 4B9TA 3PUFA 4JNEA 3EO3A 3WT0A 4DV2K 3KD1E 3O4WA 1I3AA 1N36K 1TKZA 1FKOA 1TYQB 3MDQA 2UXBK 3JSMA 3A2FA 4CGFA 3FZKA 4E1MA 3KK2A 3LDNA 5E41A 3NGYA 4HUFA 3CF5L 4LH4A 3EYZA 3RR7A 4FWKA 3CJ1A 4KTWA 5AQTA 4QS7A 2F8TA 1SZ2A 1NJYA 1RDAA 3AA4A 3C6AA 2A1SA 4BG8A 3O8MA 4CBUA 3PY8A 1N6QA 3RTVA 3NMUA 4RW9A 1L3VA 1IKVA 2WC9A 4FSVA 1DEJA 3U9DA 3WQTA 4ZTFA 4CVNE 4FJKA 4OGEA 4FPAA 1Q86O 1RTIA 4OPKA 3LZJA 3TSUA 2F7TA 1W7AA 5C0YA 1FKPA 3NHGA 1BI4A 4GV6A 3V9ZA 2ZGZA 3WQUA 1VQNN 1NMDA 3KLGA 1SV5A 1RTDA 3WEEB 4CFCA 1QZ5A 3NF8A 1XNRK 5AQLA 3SBTA 2Q3SA 4AH9A 1K8KB 4KV8A 4MLEA 5CYMA 4IG3A 3H6EA 2R7YA 3O08A 4FK4A 2FLOA 3SQ1A 2OTLN 2WONA 2F4VK 1YJ9N 4FLUA 5FDLA 4FXDA 1NGDA 1NMNA 3V9UA 1T6CA 4WQ4C 4CEZA 1XNQK 4KI4A 1VSMA 4FZZA 1XHZA 2IAJA 4A57A 5AQIA 4UY8O 5AQUA 3R9PA 3OYHA 4GW6A 1WSFA 2OZSA 3TAGA 3WXMB 4QCLA 3K5OA 4F8RA 4DSKA 2HHVA 3CPWM 3NVKA 1RBSA 4LF4K 1TK0A 1NGCA 3HPGA 2ZQBA 1XC9A 3Q7CA 2G8KA 5HRSA 3DLGA 3EL2A 2YV0X 3ENHA 3CETA 4YOXA 4KHSA 4KREA 4JI0K 4A5BA 3LDOA 3LP0A 3IDHA 3MWPA 3QESA 3TSPA 4CEBA 4WF9L 4AHVA 2ITGA 4HUGA 4DV4K 4FOEA 4PWDA 4IXCA 5DMRA 4FJ7A 3ULDA 1QHTA 5FRMA 4BC5A 1WNSA 1Y64A 2NRRA 2HMPA 4FWRA 2Q31A 3VQ8A 4B1ZA 2P9LA 4B08A 3MXJA 4L8RB 3LDQA 4JKCA 3ID8A 4CGHA 2P9PA 1X9WA 5AQJA 1NG9A 4FJ9A 3QEPA 3I0SA 3P38A 3DMJA 2WUSA 5AQSA 2YCHA 1WSIA 4FWNA 3AARA 3M8PA 4FJGA 3QNNA 5C24A 3VQAA 4FLYA 4BRNA 3D0PA 3SNNA 3VGKA 3MXIA 1RCHA 3C6HA 4J2EA 4DTRA 5JVHL 2PFUA 3SQ0A 4CEFA 1TK5A 1NK5A 3UKUA 2E8AA 1WBDA 3ZSWA 5CZ1A 3IG1A 1QQMA 2KQ2A 4CEEA 3QBWA 1CLQA 2D1KA 4KO0A 1YI2N 3F2KA 1Z26A 2P9KB 4IJAA 2QA4N 4IDKA 4CHYA 4X65K 2G8FA 3BGRA 3HPHA 1OVQA 3QEVA 3PIPL 4B8AB 1X9MA 3THVA 1NJXA 1C0FA 3FZFA 3MCAB 1O1WA 4A2BA 4CGGA 2DFEA 3G4SN 3VERA 1RT7A 3GDQA 4DSJA 4LSLA 3ZSQA 1K8AO 5AZIA 4F2RA 2P9SB 1HMVA 3O6WA 5FPEA 4K8ZA 3OY9A 1HRHA 3C6TA 1WBBA 4ISEA 5C2FA 1VSEA 4JKFA 3QLHA 4NLBA 4U7BA 4GVEA 3EN9A 4K25A 3M8QA 1KAZA 1RT6A 3CCEN 4E3SA 4YNQA 3MK6A 2Q1NA 3CQYA 2NRXA 3K5MA 3HTVA 4AQYK 1L5UA 3SMPA 1VQMN 4YORA 3ATUA 2IVPA 3N4PA 3L6QA 1VQON 3L2RA 3B6OA 3VEVA 1UOCA 4JK8A 4GV9A 1FW6A 2G8UA 3PO5A 4BVPA 1VSFA 1W9HA 3DWLA 4CI6A 1NK4A 2P5GA 4KAZA 3VA3A 3NF6A 1KLNA 4JKBA 3RMDA 2DTUA 4WQ5A 4CZHA 3HL8A 3WNFA 3TARA 2NRWA 3VOVA 5BREA 2QTDA 5FPMA 4CHPA 1X1PA 4K43A 4IOXA 3CCLN 5F2RA 2V7ZA 1IV0A 3OS2A 3KWGA 4Z4GA 4IEIA 3WXIA 3HJFA 3AVBA 4BRGA 4CEQA 4PKGA 4H4OA 1C1BA 2NUBA 4CZLA 3K5LA 4J8FA 1QQOA 4I7FA 1OH8A 2VWJA 4ILHA 5J2MA 3L0QA 1JLEA 4YDUC 3KJVA 4JI8K 3M8RA 2BDPA 3CHWA 2F9WA 1WLJA 2ZE2A 2QWQA 3HK2A 1ZBUA 2DFHA 1JLFA 1QQCA 4J2BA 4C8LA 1BOTO 1G99A 3LAMA 1D8YA 3ITHA 4AHRA 3OJSA 4I6MB 1V4SA 1SKRA 1NGBA 5GADP 4BRMA 4GMJB 3AO1A 4FWLA 5HOOA 1S5JA 1EXQA 2KW4A 3SUQA 3H45C 2FBTA 4C8OA 2EWSA 3HM8A 3FGUA 2KZMA 4FJHA 2YHWA 4PY5A 1HYZA 2F96A 4JAXA 3RSEA 3SV3A 4V19S 3EE9A 3A8YA 3NH1A 1E4GT 4KB1A 3AAQA 3LPUA 3MMVA 1YT3A 5EU7A 3OHRA 4NCGA 3OYNA 1JLQA 1JL1A 2FSKA 3K9JA 3TAPA 1HX1A 3O3GA 2QW9A 1WUAA 1YXQA 3CJBA 1VHXA 3L4QA 4JI7K 3OA9A 4GNIA 5KRSA 3CCUN 4Z4EA 4LF8K 4JD2B 4DTSA 3CYMA 3I0RA 2W40A 1D4XA 1JLBA 4F3TA 3AGRA 5FPNA 5F1XA 4DSIA 1U2VA 3U4LA 5JMVA 1GLAG 5BRHA 4C8NA 3GOIA 3SJJA 3AVMA 4BG9A 2WBNA 2HNYA 1KVAA 3ZETA 3OS1A 2D0PA 4EHTA 3QB0A 3LP3A 1EETA 4JYAK 4BQLA 5CY4A 4M41A 3M6GA 4H5TA 3VQPA 2O4IA 1QSYA 1NJWA 3DXKB 3OYGA 4AM7A 2RN2A 2YJEA 3CC4N 4EZ6A 5F0XA 1HPMA 3QIOA 4JS4A 2P9IB 3BZCA 2YHAA 1TK8A 3ZX2A 1HNWK 2NNWA 4CECA 3PX4A 4FJXA 2HVHA 4JI6K 4FZYA 1YTAA 3P83D 4OLBA 4N56A 2D0BA 3NFAA 3LALA 3J7ZO 4JN4A 3C7NB 1YHQN 1ZBLA 2X74A 2OPPA 3KVGA 1X3MA 4ID1A 3S41A 3CCMN 4W5RA 3AA2A 4FO0A 2PY5A 2P5OA 5C15A 4CEAA 4BRIA 5LJVA 3VF2A 2GWJA 2D0AA 3PX0A 3FFKB 4B1XB 3CG7A 4CIFA 1SS6A 2VG5A 1RT2A 4B1VA 4Q0BA 2UUBK 2HOEA 4BRHA 4E1NA 4IBNA 4DLGA 3WNGA 2G8VA 1X9SA 3WUHA 4N5SA 4DTNA 4B3MK 4MQ3A 1C0UA 2KHOA 4OO1J 3NVMA 4J2AA 2E88A 3HI0A 1QSLA 4M3WA 3UKRA 1EQYA 2XHBA 4JI2K 4OGCA 5KPRA 3SBGA 1XHXA 4BRLA 1RT4A 4MO5A 4CBXA 3THWB 3MAQA 3TAFA 2ZJPL 4Z4IA 1FK9A 5AQXA 4XH1A 4AHCA 1NK9A 1EP4A 1TYQA 1W2BM 5DM7L 1HYVA 5LMUK 3JAMO 1CXUA 4XH5A 3I55N 1CZBA 1Z25A 3QEXA 1OH6A 1U4BA 4HUEA 5AQYA 1BIUA 1BA1A 1U45A 4BRQA 3LL3A 1L3SA 4MFBA 3DLBA 1RGIA 4FJNA 3HOTA 3VEYA 1WSJA 2P51A 3P4IA 3IUCA 4Y1CA 4MDAA 4YFUA 4JRPA 3SI6A 3CJ7A 1T44A 2H3GX 3H1QA 5TKWA 5AQWA 3CCVN 4ILGB 2QI2A 5BPLA 3B6PA 3QICA 1GLCG 4CJ3A 3V9XA 3HPOA 4BGAA 3WXKA 2GTDA 2QEXN 5MLCQ 2YJFA 2CGKA 3RRHA 1EX4A 4DQPA 2KFZA 3F5TA 1HKCA 3E9PA 1GLFO 1ZBSA 3IRXA 4PL7A 4WE1A 4BRKA 4B9MA 4IFYA 4Z4FA 4BC2A 1IO2A 3NF9A 4ISFA 2A3ZA 4GVMA 3WEEA 5C42A 3QO9A 4CEDA 4DFKA 1YIJN 4FWQA 1IG8A 4CGIA 3H3NO 3O9RA 1UAXA 1K8KA 1ESVA 2HF4A 2DY4A 4FYDA 4O8KA 3MEEA 4BACA 1J9AA 4CJUA 4LF5K 4PUOA 2D5RA 5KPTA 4ZTJA 2VCPA 5KRTA 4NCAA 3T1YK 4E7LA 1L3UA 4NXNK 2QWNA 1BUPA 3AGKA 2O8DB 1NKBA 4BRDA 1RNHA 2WTUA 3KZBA 2YNIA 1RTHA 3FZMA 1ZYQA 3BP8A 3KIOA 3DLEA 3FZLA 5EY4A 3VEZA 4EHUA 3U6FA 2HHHK 2W42A 3D2FB 1D9FA 3MN9A 1S1VA 1NK8A 4B9UA 5BN9A 4BR2A 4BR0A 2BTFA 3MX5A 4EIAA 2X6SA 3OYIA 5J2NA 3LM9A 2RHKA 3DRPA 1IKWA 2V7YA 3AY9A 4DF8A 2ZD1A 3TSQA 5A2QO 5JICA 4IJNA 1LOTB 4Z4HA 3AVJA 1YF5L 1JLAA 3SUOA 2WOMA 3VENA 3G71N 4EFHA 3PX6A 2HSTA 4LF7K 5M1QA 4FVUA 3T69A 2X78A 4IEEA 4FWPA 1J53A 1JCFA 3GBTA 3HZ6A 4JI3K 1NJIO 4Z4CA 1MU2A 2YKNA 5KQ8A 3EZ5A 5E84A 3ZCMA 1RILA 1IBLK 2VWKA 2VYPA 1QVFM 3CC7N 4BR4A 3QIPA 4FWMA 1XI1A 3AVKA 4DCHA 3SYZA 1K6YA 4XEIA 4ELUA 3THXB 5AQFA 4FZXC 3QINA 3ULEB 3G6EN 3L2QA 1ZXOA 2IVOA 3E9OA 4IWVA 4KKOA 1G15A 1JJ2M 1CZAN 2O4GA 4E7KA 1TV6A 3HBTA 2QK9A 3SCXA 4F2SA 3L3VA 2ITMA 2JLEA 4O0JA 3RWUA 1S22A 1A5XA 5AZJB 2P9KA 3HSTB 3J7AP 1HLUA 4ELVA 1ZBHA 2ATQA 4H5VA 3K57A 1C6VA 4LC9B 2D4WA 2HHWA 3K9KA 3ZYYX 3BZKA 4EAHD 3VQ4A 2QXFA 1RDWX 3SAFA 1IBKK 4B1UB 5AQHA 2P9SA 2V52B 2HNZA 4H4MA 4YY3K 3K5NA 3U3YA 3O9TA 2A6AA 1NGAA 1F21A 4CD1A 3TI0A 3CMAN 1VQ4N 3LZIA 5AQNA 1BGXT 3UE5A 3SAHA 3LAKA 2HHSA 3OYEA 2P9UB 1WSHA 3DLRA 3H46O 4DV5K 4KH5A 3RMCA 1P8ZA 3B8AX 3KHYA 4LFCK 1VK0A 1GOCA 1Q81O 4CK2A 1Q7YO 3QEIA 3TPQA 3QMLA 4C23A 3HP6A 4NB4A 3E1YA 4DR6K 4JHDB 3VQBA 4CZGA 4K0KK 4GKJK 4WFBL 1XUPO 3AA3A 3LDPA 4ILJA 4CF0A 2CGLA 5KGWA 1KSPA 3ZSXA 4DFPA 3K58A 4CJ7A 3GG4A 1RBVA 2Q97A 1MWKA 1S3XA 1QTMA 4B9LA 4R5PA 3J80O 2YNGA 3OYFA 1IBMK 1NGFA 4KH4A 3AVHA 1IG9A 1BL3A 1S1XA 2YHBA 3N4QA 4LSNA 3V9SA 4KTQA 1RFQA 4CZFA 3JYTA 3V1OA 2GBZA 5JVGL 2FF3B 4A59A 3K2PA 4DWIA 2UXCK 2RPIA 4CJQA 4CCHA 2NZTA 1DTTA 1NU0A 1J5EK 1K9MO 4DR4K 1N5YA 4I2QA 1QE1A 4FJ8A 4WFNL 3AO5A 1OH5A 5JLHA 3I56N 4KBOA 3AVLA 4I6MA 3CCRN 1WSGA 1KXPA 3OS0A 5JS1A 1RTJA 1VQ7N 4HHTA 2B6AA 4MLHA 4OJRA 1C1AA 5FLXO 4DTPA 4M3XA 4IO9L 1FXXA 1TVRA 4CIEA 4DF4A 4FOIA 1BDGA 5M1OA 3TAQA 3ZEUB 4ELTA 3DLLL 1RDUA 1IKXA 1TAUA 3C6UA 4BROA 3J8AA 3QFUA 2PAVA 3TWHA 4H0PA 3OYAA 1JCEA 4JI1K 3AVIA 3T3FA 1ATNA 1HNIA 5HL7L 4H5NA 2O8BB 1T6DA 3I8BA 5LMNK 5SZTA 5CYQA 4IOCL 5GINA 3DXMB 3TAEA 1ATSA 4HCCA 1NM1A 1SL1A 1WOQA 4JD2A 4FL9A 4HTUA 3A5LC 1KTQA 3ID6A 1RBUA 4NLCA 4NO7A 2ASPA 3G10A 1LWFA 4H5WA 3UIQA 2IVNA 5DM6L 4DU4A 1KAYA 1VQ6N 3O3HA 4JKGB 1QS4A 1SUQA 2YHXA 3SLCA 3I8DA 3S9HA 1BCOA 3S3OA 4CJ4A 1QZ6A 1RDDA 1N33K 3DRSA 3DXKA 3M3ZA 3AVCA 4KHWA 1HYSA 1REVA 3VQEA 4MDBA 4M3RA 5C10A 2P9IA 1KCFA 2G8HA 1LWEA 3R6MA 1A5WA 4KTZA 4BC4A 4WQ4A 3SUNA 1VQKN 4BC3A 1ATRA 3NH0A 4CERA 1IKYA 2QM1A 4O5BA 5HLFA 1S9EA 1WAJA 4DS5A 3EE8A 3OYDA 2V51B 4JKAA 3C7NA 3L2VA 4KHNA 2EX3A 4LFAK 3DRRA 3ZX0A 3LWMA 5CHIA 1LCUA 3CI5A 3TANA 3LANA 3PSFA 3SJHA 3DOLA 3ZSOA 4FJMA 3ZT2A 2FBXA 2HW3A 2Y1JA 4FVMA 4CJ5A 4WYBA 2CGJA 4XH4A 4RG8A 1HNXK 4DTOA 3O9SA 4E7HA 4FJLA 2ZGYA 1S6PA 3VF4A 4IOAL 2Y1IA 2E6MA 4BWMA 3VN5A 4E0DA 4CJEA 2G8WA 3VA0A 3FLCO 3VQ9A 4DKWA 5LY3A 4MO4A 2PYLA 3ASMA 3CFPA 4K8XA 1RBRA 3DLKA 2OCEA 2I5JA 5HBMA 4CJWA 3CFRA 1WSEA 3P31A 5AFUA 4CHZA 4DV0K 4O0IA 2NLXA 1C0TA 4DLEA 3U3GA 4FLTA 3Q7BA 3O3FA 3OJUA 3THWA 1YVUA 2QXLA 1D9DA 4IZ9A 3D45A 2O8FB 3LPTA 4IDHA 3P5JA 3KWIA 3MWTA 1S1TA 2Z1HA 3S3MA 3O5BA 4R79A 3T1AA 3L8BA 4FK2A 3SV4A 2YHYA 4BRAA 3V6DA 4A62A 5SWMA 4A2AA 1LV5A 2JWLA 3CCSN 2KLAA 4CHQA 4BVOA 4BRCA 1TGOA 3M8SA 1U49A 3LDLA 4ISGA 3E9LA 4CIGA 4JI5K 4DR7K 4E7JA 3ZSRA 4O4GA 1LW2A 4YOWA 3RMBA 4KHUA 4DQ8A 5ADXH 3D6RA 1C1CA 1T3VA 4E7IA 5IWAK 5BN8A 5AQMA 1VSKA 1Y97A 3SQ4A 4CZIA 1S9GA 4H03B 3BDPA 3U8XA 2O8EB 1C0GA 3QBXA 4CFDA 4CJLA 1NGHA 4KB0A 3EKUA 1RBTA 3FFIA 4CGDA 5I9EB 2FSNA 1NNEA 3OTOK 5BRDA 1P90A 3CFOA 4BR9A 3V9WA 5J2PA 3R1XA 2A42A 2F8SA 3VGMA 4B8CA 1MDUB 4BDPA 1LW0A 5EOYA 3HT3A 3RMAA 4LY7A 5C12A 3NGIA 4OVLA 2PZSA 2HBJA 2HHTA 1QVGM 3G0ZA 4B1WB 2JWKA 1TKTA 5HRPA 1B92A 4HVJA 1YITN 4WCEL 4BE0A 2B4JA 4KFBA 4CK3A 4DU3A 2HBLA 3VMFB 3A0IX 4NXMK 3K59A 3DJCA 4F4KA 2O8DA 1DGKN 2FF6A 4H0OA 3V81A 5TKYA 1HKGA 3CJ9A 5AQGA 3ZT4A 5AQKA 1X3NA 4JKEA 3TTFA 3CIPA 1SL0A 4CZJA 1EKEA 4C8KA 3D2FA 3L2UA 2ZWHA 1HR0K 2A5XA 2KFNA 4RW8A 3OVNA 4L3QA 1BWFO 2HBKA 3QDKA 4KH6A 1M90O 1W0HA 4YDUA 4E89A 1GLLO 1ITGA 1BCMA 2E2PA 1K73O 3C95A 1DLOA 4BE1A 1YJWN 4O5FA 2E20A 3QNOA 4EZ9A 1E3MA 3V1RA 3MXMA 1VAZA 2P1JA 1EWQA 4YOUA 1XC3A 2HB5A 3K0SA 3O1BA 3KLEA 3VESA 1A5VA 3F73A 3THYB 1S1WA 2E2NA 1VQ8N 5LJWA 2GV9A 3AVFA 1YAGA 3VEXA 5CE3A 4FM2A 3CD6N 3AA5X 4BQZA 4H8KA 2FC0A 5J2QA 2QKKA 1BQMA 3MEDA 4DTUA 4RW4A 1U04A 1TUUA 3LDSA 2OA8A 1ILYA 5C2DA 2ASOA 4H0XB 1BG3A 5BRFA 3T7ZA 1DT9A 2PYJA 1WAFA 3THXA 3OBYA 4DTJA 3ULEA 1N34K 4CJSA 3VGLA 3IS9A 4Z94A 4PHTX 1VSHA 4RCHA 3BF1A 2QWOA 3MN7A 4E1JA 3CCJN 4DUZK 4TSXA 3EEQA 3AO3A 5AZJA 5GAEP 3SPZA 2OPSA 4CJTA 3D2EB 1SKWA 3OYKA 3AVAA 4AF1A 1HJOA 1SAZA 4DS4A 3CJAA 2A40A 2FBVA 5I42A 3SMSA 4BWJA 3J81O 3ZT1A 1XMQK 5HRNA 1ASVA 3RVCA 1YJNN 3L4IA 3BUZB 4OLAA 3ZLJA 2Q0RA 4WFAL 4E19A 3MN5A 3VQQA 5ADXA 1KFSA 1RT5A 2VGMA 2D0CA 2P9UA 4B9NA 3CPEA 4CHNA 4XIUA 2UYTA 4CF8A 5AQOA 4FLZA 3J7YP 4I2PA 4CE9A 1T8EA 5AQRA 1DTQA 1XWLA 3WNHA 4JHDA 2UXDK 1WN7A 5FPDA 4CZMA 1XQSC 3NH2A 3NDKA 4FWSA 1CXQA 4PKHA 1BU6O 3MEGA 3CERA 3QERA 1KAXA 5AJ3K 4KI6A 2E2OA 3NAEA 1FJGK 3A5MC 3HVRA 4DQRA 3TTCA 1Q82O 3S3NA 4CD3A 4FLVA 3ZSZA 2Z1GA 2XY7A 5EX5A 4M42A 2OPQA 1VSDA 3ZT0A 3KLHA 4B3RK 5ELZA 2VG6A 2HBMA 3O9UA 1Z6RA 4O55A 3ISNC 1UA1A 2HHQA 4J2DA 1O13A 5M1FA 4X62K 4Y1DA 4CBWA 1Q18A 4GKKK 4CEOA 4WQ5C 2X6NA 5KI6A 1MA9B 2A41A 2W6LA 3ALYA 3UB5A 3E01A 2UUCK 4FK0A 1QQNA 4PQUA 4IKFA 4DR3K 4H0YB 3ZEUA 4QS8A 1VQLN 1BA0A 2VGNA 1Q9YA 5C25A 5M1NA 4OPAA 2UU9K 2O8CB 4DR1K 4OPHA 2AP1A 4DR5K 4CHOA 1GLBG 2O8BA 4AHSA 3H08A 1NBWA 1ZBFA 3CCQN 3OYMA 4BE2A 4O44A 4RW6A 4DR2K 3DXMA 4RWTA 3C94A 4JLHA 4FCYA 3HO1A 3NF7A 4N41A 4JRQA 4DFMA 4M3YA 2BGGA 3KKSA 4YOVA 2XO7A 3OYJA 1R59O 4NYFA 1NWKA 1HPZA 3JS6A 3U9ZA 4RTFD 2YNFA 5K14A 1QHAA 4BRFA 3VPZA 3HYFA 1YVNA 3DYAA 4B3TK 3T19A 4HTLA 4BR7A 3D7EO 2AA4A 1JLCA 5KTQA 4B9QA 4JKGA 1T03A 1JL2A 1N8RO 1SL2A 1IH7A 3ATVA 4CF9A 3AV9A 1NK6A 4FLWA 5AFUH 5FROA 2J4RA 3PO4A 5KPZA 4B9SA 4JK9A 3OYCA 4FM0A 3VEOA 4CJVA 2OZMA 3W0LA 1KQSM 1GLJO 1Z05A 4CF1A 4DB3A 3L2WA 2Q2RA 4PL8A 4DV1K 1W97L 1M1KO 2FSJA 3HOSA 1TAQA 2DFFA 1LWCA 2OANA 1TKXA 4LF6K 4M3TA 3LP1A 3QEWA 4DSFA 3V4IA 4K42A 4ID5A 1V4TA 3HRGA 4CGJA 3P1GA 4KPYA 5CZ2A 3R3LA 4EP5A 1BI4B 2YNHA 1NJZA 3DM2A 4UQGA 1OKJA 1VSIA 4YOTA 1KRPA 3O4QA 4W5TA 2BE2A 1U48A 2NRHA 3M1FA 5T7BA 1RDBA 4LFBK 4BREA 4G9ZA 1OH7A 2BUPA 1BO5O 4B1YB 4NCBA 1N32K 2HNDA 5I3UA 1R0AA 3BY5A 4X64K 1UWBA 3SUPA 2GUIA 2GELA 3AVNA 4JKHA 4FW2A 1S6QA 4M45A 1YTUA 4FW1A 4A61A 5D3GA 3HVTA 2F9TA 1X9JA 4DUYK 2RE2A 4QOZB 2UUAK 1NLVA 3AO2A 4K41A 1T7PA 2O8FA 4AHTA 1EWRA 3HSCA 4DV3K 3GL1A 1EO1A 5M1PA 3C0BA 4CJKA 3H1VX 3VQDA 4CJFA 4CESA 4BGBA 2GX9A 3WXJA 4CW7B 1HUXA 1TL3A 4CZEA 3KK7A 2Z1JA 2KZZA 3KTQA 3A5OC 4C1NI 2RF2A 5GIPA 1B9DA 4HCBA 3TU5A 1NGGA 4OKEA 2NRTA 1Q8IA 4FJIA 3P39A 1E4FT 2W6KA 1HJRA 1TKDA 5BPNA 5FRNA 2P9LB 1NK7A 3LP2A 2XRIA 2QKBA 3HXMA 2P9PB 2O8EA 2IC3A 2ASMA 3F9KA 3OW2M 1NOYA 4W5NA 5M1KA 1Q9XA 1GLEG 3R8EA 3CQXA 3E66A 1IJJA 1BQNA 2I7NA 4IO8A 1J6ZA 3TTDA 2D0OA 3CM5A 2VG7A 2I7PA 2E4LA 3DAWA 3KLIA 5AQQA 5GAHP 3ZT3A 4DMNA 1ASUA 5H1SQ 2OYQA 3BF3A 5J1EA 3UKUB 1CZ9A 3VF6A 3L3UA 2HVIA 1NKCA 2WFBA 1BIZA 3SZ2A 3OBWA 1U6ZA 1JLGA 4I9LA 2VWBA 2ZJQL 3GE1A 2B5JA 5JS2A 2VQEK 4HWIA 4CJPA 1VQ9N 3MECA 3LM2A 4CFAA 1SKSA 5HRRA 1L3TA 1KD1O 4BDZA 3FE1A 4H0TB 5AZIB 3RRGA 2JGUA 4G1QA 1U47A 2XY8A 3O80A 5KQDA 5LL6Z 4PKIA 5EVZA 3W3DA 4CF2A 3EZWA 1UA0A 4M3UA 4Z0UA 4JKDA 4OKJA 2CH6A 2HHXA 4W5QA 3IAYA 1S72N 1I39A 4B3SK 2QWMA 3HP9A 1BISA 4JS5A 3A5NC 3O4NA 2IOCA 2Q36A 3PSIA 4IG0A 4DV6K 3SQ2A 1BHLA 4KHQA 1J54A 3RR8A 1H1VA 1VQPN 4F3OA 3THYA 2Z1IA 4DV7K 1VQ5N 3DLHA 3O1WA 1KLMA 5GIOA 2BH1A 4CFBA 2BANA 4B9VA 4N47A 1NGEA
chains in the Genus database with same CATH topology
2QXFA 1NK0A 1D5AA 1VSHA 1L5UA 1RT1A 4DQQA 4DSLA 3KKRA 2ETJA 2HNZA 4H4MA 3K5NA 2EHGA 1JXEA 2XY5A 3U3YA 4TSXA 4N76A 3L2RA 3AO3A 3B6OA 1UOCA 3SPZA 4M3ZA 2OPSA 1F21A 2G8UA 3PO5A 4FJJA 1VSFA 1W9HA 1NK4A 1QSSA 3TI0A 2P5GA 4KAZA 4CJTA 3LZIA 3VA3A 3NF6A 1BGXT 1TL1A 1KLNA 3LAKA 2HHSA 3RMDA 1SKWA 3OYKA 3AVAA 3OYEA 2DTUA 1WSHA 3DLRA 3HL8A 3WNFA 3TARA 3RMCA 4DS4A 1VK0A 1GOCA 4CHPA 1X1PA 2FBVA 4CK2A 5I42A 3QEIA 1HQEA 4OPJA 3OS2A 3HP6A 4Z4GA 4BWJA 3KLFA 3HJFA 3ZT1A 5HRNA 1ASVA 3AVBA 4CEQA 4H4OA 1C1BA 2NUBA 2G8IA 3TAMA 3VQBA 3K5LA 1HQUA 4OLAA 3AA3A 4I7FA 4E19A 3VQQA 4CF0A 2VWJA 1KFSA 5J2MA 5KGWA 1KSPA 1RT5A 3KK1A 1JLEA 1VSLA 3KJVA 2D0CA 3ZSXA 3M8RA 1ZBIA 4DFPA 3K58A 2BDPA 4B9NA 1RBVA 4CHNA 4XIUA 1WLJA 2ZE2A 3V1QA 1GOAA 4CF8A 1QTMA 2IGIA 4B9LA 4R5PA 3HK2A 1ZBUA 2YNGA 2DFHA 4AHUA 1JLFA 3OYFA 1JKHA 1QQCA 4FLZA 2XY6A 4I2PA 4CE9A 1RT3A 2YKMA 4C8LA 4J2BA 1VRUA 1T8EA 4PA1A 1DTQA 1XWLA 2OPRA 3WNHA 3LWLA 3AVHA 1IG9A 1BL3A 1S1XA 2YHBA 4LSNA 3V9SA 4KTQA 3LAMA 1D8YA 4Q5VA 4BDYA 3ITHA 4AHRA 4RW7A 4FLXA 3OYBA 3OJSA 1SKRA 1WN7A 3JYTA 3V1OA 1ASWA 2GBZA 4CJRA 3NH2A 3K2PA 4GMJB 5DK5A 3AO1A 4IFVA 3VQ5A 2RPIA 1S5JA 1CXQA 4CJQA 3NDKA 4CCHA 1EXQA 1DTTA 2KW4A 1RDCA 4KRFA 4AILC 3SUQA 2FBTA 4C8OA 3MEGA 2KZMA 4FJHA 4PY5A 4DG1A 3CQ8A 3QERA 1HYZA 2F96A 3TABA 1N5YA 3SV3A 4KI6A 4I2QA 4DWIA 1QE1A 4FJ8A 3NAEA 3NH1A 5KGXA 3AO5A 4DTXA 3HVRA 2A1RA 4KB1A 4DQRA 3LPUA 4DSEA 4DU1A 3AVLA 4FLVA 3S3NA 1YT3A 3DI6A 5EU7A 4NCGA 3HM9A 4I9QA 1WSGA 1KVCA 3ZSZA 3OS0A 2Z1GA 3OYNA 1JLQA 2XY7A 1RTJA 5JS1A 1JL1A 4HHTA 1GOBA 2B6AA 3ZSYA 4OJRA 1C1AA 4FJ5A 4DTPA 3TAPA 4M3XA 1C0MA 1CLQA 3O3GA 1FXXA 1TVRA 4CIEA 4DF4A 4M42A 2OPQA 1VRTA 2LSNA 3ZSVA 5KRSA 1T05A 4Z4EA 3TAQA 4ELTA 1VSDA 3ZT0A 3KLHA 1HNVA 4C8MA 4DTSA 1IKXA 2VG6A 1TAUA 3C6UA 4O55A 3ISNC 1UA1A 2HHQA 4J2DA 3VQ7A 3CYMA 3I0RA 2HHUA 2E6LA 4Y1DA 4NYNA 1JLBA 3TWHA 3OYAA 4F3TA 3T3FA 3AVIA 4DSIA 2RKIA 1LAVA 1HNIA 4CEOA 4C8NA 3AO4A 3QETA 2X6NA 3SJJA 5KI6A 3VQ6A 3AVMA 4ICLA 3ALYA 3TR8A 2HNYA 5SZTA 3E01A 5CYQA 4FK0A 1KVAA 4PQUA 4IKFA 3DOKA 3TAEA 3OS1A 4HCCA 1SL1A 3LP3A 1EETA 1Q9YA 5CY4A 1S1UA 4M41A 3VQPA 3NGZA 5C25A 1KFDA 2O4IA 1QSYA 1NJWA 1VSJA 4HTUA 2AJQA 3OYGA 2KTQA 2RN2A 4DFJA 4EZ6A 1KVBA 4CHOA 1KTQA 4AHSA 3H08A 1RBUA 3QIOA 4EP4A 4JS4A 1ZBFA 2YHAA 3OYMA 3CM6A 1TK8A 3KK3A 4BE2A 3G10A 4CECA 1LWFA 4O44A 3PX4A 4FJXA 3AVGA 3UIQA 3VQCA 4RW6A 2HVHA 3C94A 4JLHA 4FCYA 4FZYA 3HO1A 1YTAA 3P83D 4DU4A 3NF7A 3KD5E 3PV8A 4N41A 4OLBA 3O3HA 4N56A 4JRQA 1QS4A 1SUQA 3I8DA 2D0BA 3NFAA 4DFMA 4DQSA 4M3YA 2BGGA 3KKSA 3OYLA 5HROA 4KHYA 3LALA 3S9HA 1BCOA 1JXBA 3NE6A 3SPYA 2XO7A 3S3OA 4CJ4A 1RDDA 3OYJA 4NYFA 3DRSA 1ZBLA 2HMIA 2X74A 1HPZA 1NOZA 2OPPA 3AVCA 4KHWA 1HYSA 1REVA 2YNFA 3VQEA 4CK1A 3NCIA 5K14A 4ID1A 4LD0A 4M3RA 4FM1A 4W5RA 3AA2A 2FBYA 2PY5A 1KCFA 2IS3A 2G8HA 3HYFA 2P5OA 3DYAA 4DQIA 1LWEA 4KTZA 1A5WA 4CEAA 3T19A 4DTMA 2IDOA 4LH5A 4B3OA 1J5OA 3SUNA 3WNEA 5KTQA 1JLCA 3NH0A 4OKKA 4CERA 1IKYA 4O5BA 5HLFA 1JL2A 1T03A 3NBPA 1S9EA 1WAJA 1IH7A 2D0AA 4CF9A 3AV9A 4DS5A 1NK6A 1SL2A 1B9FA 3PX0A 4FLWA 3OYDA 5FROA 3CG7A 3PO4A 4CIFA 4B9SA 3OYCA 2VG5A 4ZHRA 3L2VA 4KHNA 1RT2A 4FM0A 2EX3A 4Q0BA 1NKEA 3EY1A 4QAGA 4CJVA 1LAWA 3DRRA 3LWMA 4E1NA 4W5OA 5HP1A 3TANA 2OZMA 3LANA 4IBNA 4B9TA 3PUFA 4DLGA 3WNGA 2G8VA 3DOLA 3ZSOA 4CF1A 4N5SA 4DTNA 1X9SA 4MQ3A 1C0UA 3KD1E 3L2WA 3ZT2A 1I3AA 4FJMA 1TKZA 2FBXA 1FKOA 4B9VA 2HW3A 2Y1JA 4J2AA 3JSMA 3A2FA 4FVMA 4CGFA 4CJ5A 4E1MA 3KK2A 1TAQA 1QSLA 4M3WA 4RG8A 5E41A 4DTOA 3NGYA 4HUFA 4E7HA 2DFFA 4FJLA 4LH4A 3EYZA 1LWCA 1S6PA 2XHBA 3RR7A 4OGCA 2Y1IA 1TKXA 2E6MA 4BWMA 3LP1A 3VN5A 1XHXA 4M3TA 3QEWA 4DSFA 4E0DA 1RT4A 4KTWA 4CJEA 3VA0A 3MAQA 4ID5A 3VQ9A 3V4IA 4CGJA 3TAFA 2G8WA 3P1GA 4Z4IA 4KPYA 5CZ2A 2F8TA 1FK9A 1NJYA 4EP5A 2PYLA 1RDAA 4AHCA 3AA4A 1BI4B 2YNHA 3ASMA 3CFPA 1NJZA 1NK9A 3DM2A 4UQGA 1EP4A 4K8XA 1RBRA 3DLKA 2A1SA 1VSIA 2I5JA 5HBMA 4CJWA 3PY8A 1N6QA 3CFRA 1HYVA 1KRPA 1WSEA 3O4QA 3RTVA 4W5TA 2BE2A 4RW9A 1CXUA 4CHZA 1L3VA 1IKVA 1U48A 1CZBA 1Z25A 5T7BA 4O0IA 3QEXA 1U4BA 1C0TA 4HUEA 4ZTFA 1RDBA 4DLEA 3U3GA 4FLTA 1BIUA 1U45A 1L3SA 4FJKA 4OGEA 4MFBA 3DLBA 3O3FA 3OJUA 1RTIA 4FJNA 4NCBA 1WSJA 2P51A 4OPKA 3LZJA 1YVUA 2HNDA 1D9DA 4Y1CA 4YFUA 5I3UA 1R0AA 3D45A 4JRPA 1FKPA 3NHGA 1BI4A 3LPTA 3SI6A 3V9ZA 3P5JA 3S3MA 1S1TA 1UWBA 2Z1HA 3SUPA 3KLGA 1SV5A 1RTDA 2GUIA 3T1AA 3AVNA 3L8BA 4CFCA 4FW2A 1S6QA 4M45A 1YTUA 4FK2A 3SV4A 3V6DA 4FW1A 3B6PA 5SWMA 3NF8A 4CJ3A 3V9XA 3HPOA 1LV5A 5D3GA 2Q3SA 3HVTA 4AH9A 4KV8A 5CYMA 4CHQA 4IG3A 2R7YA 1TGOA 3M8SA 3RRHA 4FK4A 4QOZB 1EX4A 4DQPA 1U49A 2KFZA 3AO2A 3SQ1A 1T7PA 2WONA 4CIGA 4AHTA 4E7JA 3IRXA 3ZSRA 4O4GA 4FLUA 1LW2A 4WE1A 4B9MA 5FDLA 4IFYA 4Z4FA 3RMBA 4FXDA 1IO2A 4KHUA 3V9UA 3NF9A 4CEZA 1C1CA 4GVMA 4KI4A 1VSMA 5C42A 3QO9A 4CJKA 4E7IA 4CEDA 1XHZA 2IAJA 4FZZA 4DFKA 1VSKA 3OYHA 1Y97A 3SQ4A 3VQDA 1S9GA 4GW6A 4CGIA 1WSFA 4CJFA 2OZSA 1UAXA 4CESA 3BDPA 2DY4A 3TAGA 4QCLA 3K5OA 4FYDA 4CFDA 4F8RA 4DSKA 2HHVA 4CJLA 4KB0A 1RBSA 1RBTA 3MEEA 4BACA 1J9AA 4CJUA 3FFIA 1TL3A 4CGDA 1TK0A 2Z1JA 3HPGA 2ZQBA 1XC9A 2D5RA 2G8KA 3KTQA 4PUOA 2KZZA 4ZTJA 2RF2A 5KRTA 4NCAA 3CFOA 1B9DA 5HRSA 4HCBA 3V9WA 3DLGA 4E7LA 5J2PA 1L3UA 4OKEA 1Q8IA 2YV0X 4FJIA 4KHSA 2F8SA 4KREA 1HJRA 4B8CA 1NKBA 1RNHA 1TKDA 5FRNA 1NK7A 2YNIA 3LP2A 3LP0A 3QESA 4BDPA 1RTHA 2XRIA 1LW0A 4CEBA 1ZYQA 2QKBA 4AHVA 3HXMA 2ITGA 4HUGA 3HT3A 3RMAA 2IC3A 3KIOA 4PWDA 3DLEA 3F9KA 4LY7A 1NOYA 5DMRA 3NGIA 4FJ7A 4OVLA 3ULDA 2PZSA 4W5NA 3U6FA 2HHTA 2W42A 3G0ZA 1D9FA 1Q9XA 1QHTA 1TKTA 5HRPA 5FRMA 1B92A 1BQNA 1S1VA 4HVJA 1NK8A 1WNSA 4BE0A 2B4JA 4B9UA 4KFBA 4CK3A 4DU3A 3CM5A 2VG7A 2X6SA 3OYIA 5J2NA 3K59A 2E4LA 3VQ8A 3DRPA 3KLIA 4F4KA 1IKWA 3ZT3A 4B08A 1ASUA 3MXJA 4DMNA 4DF8A 3V81A 2OYQA 5J1EA 4L8RB 1CZ9A 3L3UA 2ZD1A 4CGHA 2HVIA 1X9WA 1NKCA 3ZT4A 1BIZA 3SZ2A 4Z4HA 1SL0A 3AVJA 1EKEA 1JLGA 1JLAA 4FJ9A 3QEPA 3SUOA 3I0SA 2WOMA 3DMJA 4I9LA 4C8KA 3L2UA 1WSIA 3M8PA 4FJGA 2KFNA 2B5JA 4RW8A 5JS2A 3QNNA 5C24A 3OVNA 3VQAA 4FLYA 3PX6A 3D0PA 4CJPA 3SNNA 3MXIA 1RCHA 4J2EA 1W0HA 4DTRA 4E89A 3MECA 3SQ0A 1ITGA 1BCMA 4CFAA 2X78A 4CEFA 1SKSA 5HRRA 1J53A 3C95A 1TK5A 1NK5A 1DLOA 4BE1A 1L3TA 4BDZA 3QNOA 4Z4CA 4EZ9A 3V1RA 3ZSWA 5CZ1A 1MU2A 3IG1A 2YKNA 3RRGA 2KQ2A 2JGUA 3EZ5A 4G1QA 3ZCMA 1RILA 4CEEA 3MXMA 2P1JA 2XY8A 1U47A 4KO0A 2VWKA 1Z26A 2HB5A 4IDKA 3KLEA 4CHYA 2G8FA 3BGRA 3HPHA 1A5VA 3QIPA 4CF2A 3AVKA 3QEVA 1XI1A 4B8AB 3SYZA 1UA0A 4M3UA 3F73A 1X9MA 1K6YA 3THVA 1S1WA 4ELUA 4FZXC 1NJXA 3QINA 4Z0UA 1O1WA 4CGGA 3L2QA 2DFEA 2GV9A 3AVFA 4OKJA 4KKOA 1RT7A 4W5QA 2HHXA 4FM2A 1G15A 3IAYA 4DSJA 3AA5X 4LSLA 3ZSQA 1I39A 2O4GA 4E7KA 4F2RA 4H8KA 2FC0A 1TV6A 1BISA 3HP9A 5J2QA 1HMVA 2QKKA 4JS5A 4K8ZA 2QK9A 1BQMA 3O4NA 2IOCA 3MEDA 3SCXA 4F2SA 4IG0A 3L3VA 4RW4A 4DTUA 1U04A 2JLEA 3OY9A 4O0JA 1HRHA 3RWUA 1A5XA 3LDSA 3C6TA 2OA8A 3HSTB 3SQ2A 1BHLA 4KHQA 1J54A 1VSEA 4ELVA 3QLHA 1ZBHA 3RR8A 2ATQA 3K57A 4F3OA 2Z1IA 2PYJA 1WAFA 1C6VA 3M8QA 4DTJA 3DLHA 1RT6A 1KLMA 4CJSA 4E3SA 2HHWA 4YNQA 3IS9A 4CFBA 2BANA 3K5MA 4N47A 3VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QXF A;  1NK0 A;  1D5A A;  1VSH A;  1L5U A;  1RT1 A;  4DQQ A;  4DSL A;  3KKR A;  2ETJ A;  2HNZ A;  4H4M A;  3K5N A;  2EHG A;  1JXE A;  2XY5 A;  3U3Y A;  4TSX A;  4N76 A;  3L2R A;  3AO3 A;  3B6O A;  1UOC A;  3SPZ A;  4M3Z A;  2OPS A;  1F21 A;  2G8U A;  3PO5 A;  4FJJ A;  1VSF A;  1W9H A;  1NK4 A;  1QSS A;  3TI0 A;  2P5G A;  4KAZ A;  4CJT A;  3LZI A;  3VA3 A;  3NF6 A;  1BGX T;  1TL1 A;  1KLN A;  3LAK A;  2HHS A;  3RMD A;  1SKW A;  3OYK A;  3AVA A;  3OYE A;  2DTU A;  1WSH A;  3DLR A;  3HL8 A;  3WNF A;  3TAR A;  3RMC A;  4DS4 A;  1VK0 A;  1GOC A;  4CHP A;  1X1P A;  2FBV A;  4CK2 A;  5I42 A;  3QEI A;  1HQE A;  4OPJ A;  3OS2 A;  3HP6 A;  4Z4G A;  4BWJ A;  3KLF A;  3HJF A;  3ZT1 A;  5HRN A;  1ASV A;  3AVB A;  4CEQ A;  4H4O A;  1C1B A;  2NUB A;  2G8I A;  3TAM A;  3VQB A;  3K5L A;  1HQU A;  4OLA A;  3AA3 A;  4I7F A;  4E19 A;  3VQQ A;  4CF0 A;  2VWJ A;  1KFS A;  5J2M A;  5KGW A;  1KSP A;  1RT5 A;  3KK1 A;  1JLE A;  1VSL A;  3KJV A;  2D0C A;  3ZSX A;  3M8R A;  1ZBI A;  4DFP A;  3K58 A;  2BDP A;  4B9N A;  1RBV A;  4CHN A;  4XIU A;  1WLJ A;  2ZE2 A;  3V1Q A;  1GOA A;  4CF8 A;  1QTM A;  2IGI A;  4B9L A;  4R5P A;  3HK2 A;  1ZBU A;  2YNG A;  2DFH A;  4AHU A;  1JLF A;  3OYF A;  1JKH A;  1QQC A;  4FLZ A;  2XY6 A;  4I2P A;  4CE9 A;  1RT3 A;  2YKM A;  4C8L A;  4J2B A;  1VRU A;  1T8E A;  4PA1 A;  1DTQ A;  1XWL A;  2OPR A;  3WNH A;  3LWL A;  3AVH A;  1IG9 A;  1BL3 A;  1S1X A;  2YHB A;  4LSN A;  3V9S A;  4KTQ A;  3LAM A;  1D8Y A;  4Q5V A;  4BDY A;  3ITH A;  4AHR A;  4RW7 A;  4FLX A;  3OYB A;  3OJS A;  1SKR A;  1WN7 A;  3JYT A;  3V1O A;  1ASW A;  2GBZ A;  4CJR A;  3NH2 A;  3K2P A;  4GMJ B;  5DK5 A;  3AO1 A;  4IFV A;  3VQ5 A;  2RPI A;  1S5J A;  1CXQ A;  4CJQ A;  3NDK A;  4CCH A;  1EXQ A;  1DTT A;  2KW4 A;  1RDC A;  4KRF A;  4AIL C;  3SUQ A;  2FBT A;  4C8O A;  3MEG A;  2KZM A;  4FJH A;  4PY5 A;  4DG1 A;  3CQ8 A;  3QER A;  1HYZ A;  2F96 A;  3TAB A;  1N5Y A;  3SV3 A;  4KI6 A;  4I2Q A;  4DWI A;  1QE1 A;  4FJ8 A;  3NAE A;  3NH1 A;  5KGX A;  3AO5 A;  4DTX A;  3HVR A;  2A1R A;  4KB1 A;  4DQR A;  3LPU A;  4DSE A;  4DU1 A;  3AVL A;  4FLV A;  3S3N A;  1YT3 A;  3DI6 A;  5EU7 A;  4NCG A;  3HM9 A;  4I9Q A;  1WSG A;  1KVC A;  3ZSZ A;  3OS0 A;  2Z1G A;  3OYN A;  1JLQ A;  2XY7 A;  1RTJ A;  5JS1 A;  1JL1 A;  4HHT A;  1GOB A;  2B6A A;  3ZSY A;  4OJR A;  1C1A A;  4FJ5 A;  4DTP A;  3TAP A;  4M3X A;  1C0M A;  1CLQ A;  3O3G A;  1FXX A;  1TVR A;  4CIE A;  4DF4 A;  4M42 A;  2OPQ A;  1VRT A;  2LSN A;  3ZSV A;  5KRS A;  1T05 A;  4Z4E A;  3TAQ A;  4ELT A;  1VSD A;  3ZT0 A;  3KLH A;  1HNV A;  4C8M A;  4DTS A;  1IKX A;  2VG6 A;  1TAU A;  3C6U A;  4O55 A;  3ISN C;  1UA1 A;  2HHQ A;  4J2D A;  3VQ7 A;  3CYM A;  3I0R A;  2HHU A;  2E6L A;  4Y1D A;  4NYN A;  1JLB A;  3TWH A;  3OYA A;  4F3T A;  3T3F A;  3AVI A;  4DSI A;  2RKI A;  1LAV A;  1HNI A;  4CEO A;  4C8N A;  3AO4 A;  3QET A;  2X6N A;  3SJJ A;  5KI6 A;  3VQ6 A;  3AVM A;  4ICL A;  3ALY A;  3TR8 A;  2HNY A;  5SZT A;  3E01 A;  5CYQ A;  4FK0 A;  1KVA A;  4PQU A;  4IKF A;  3DOK A;  3TAE A;  3OS1 A;  4HCC A;  1SL1 A;  3LP3 A;  1EET A;  1Q9Y A;  5CY4 A;  1S1U A;  4M41 A;  3VQP A;  3NGZ A;  5C25 A;  1KFD A;  2O4I A;  1QSY A;  1NJW A;  1VSJ A;  4HTU A;  2AJQ A;  3OYG A;  2KTQ A;  2RN2 A;  4DFJ A;  4EZ6 A;  1KVB A;  4CHO A;  1KTQ A;  4AHS A;  3H08 A;  1RBU A;  3QIO A;  4EP4 A;  4JS4 A;  1ZBF A;  2YHA A;  3OYM A;  3CM6 A;  1TK8 A;  3KK3 A;  4BE2 A;  3G10 A;  4CEC A;  1LWF A;  4O44 A;  3PX4 A;  4FJX A;  3AVG A;  3UIQ A;  3VQC A;  4RW6 A;  2HVH A;  3C94 A;  4JLH A;  4FCY A;  4FZY A;  3HO1 A;  1YTA A;  3P83 D;  4DU4 A;  3NF7 A;  3KD5 E;  3PV8 A;  4N41 A;  4OLB A;  3O3H A;  4N56 A;  4JRQ A;  1QS4 A;  1SUQ A;  3I8D A;  2D0B A;  3NFA A;  4DFM A;  4DQS A;  4M3Y A;  2BGG A;  3KKS A;  3OYL A;  5HRO A;  4KHY A;  3LAL A;  3S9H A;  1BCO A;  1JXB A;  3NE6 A;  3SPY A;  2XO7 A;  3S3O A;  4CJ4 A;  1RDD A;  3OYJ A;  4NYF A;  3DRS A;  1ZBL A;  2HMI A;  2X74 A;  1HPZ A;  1NOZ A;  2OPP A;  3AVC A;  4KHW A;  1HYS A;  1REV A;  2YNF A;  3VQE A;  4CK1 A;  3NCI A;  5K14 A;  4ID1 A;  4LD0 A;  4M3R A;  4FM1 A;  4W5R A;  3AA2 A;  2FBY A;  2PY5 A;  1KCF A;  2IS3 A;  2G8H A;  3HYF A;  2P5O A;  3DYA A;  4DQI A;  1LWE A;  4KTZ A;  1A5W A;  4CEA A;  3T19 A;  4DTM A;  2IDO A;  4LH5 A;  4B3O A;  1J5O A;  3SUN A;  3WNE A;  5KTQ A;  1JLC A;  3NH0 A;  4OKK A;  4CER A;  1IKY A;  4O5B A;  5HLF A;  1JL2 A;  1T03 A;  3NBP A;  1S9E A;  1WAJ A;  1IH7 A;  2D0A A;  4CF9 A;  3AV9 A;  4DS5 A;  1NK6 A;  1SL2 A;  1B9F A;  3PX0 A;  4FLW A;  3OYD A;  5FRO A;  3CG7 A;  3PO4 A;  4CIF A;  4B9S A;  3OYC A;  2VG5 A;  4ZHR A;  3L2V A;  4KHN A;  1RT2 A;  4FM0 A;  2EX3 A;  4Q0B A;  1NKE A;  3EY1 A;  4QAG A;  4CJV A;  1LAW A;  3DRR A;  3LWM A;  4E1N A;  4W5O A;  5HP1 A;  3TAN A;  2OZM A;  3LAN A;  4IBN A;  4B9T A;  3PUF A;  4DLG A;  3WNG A;  2G8V A;  3DOL A;  3ZSO A;  4CF1 A;  4N5S A;  4DTN A;  1X9S A;  4MQ3 A;  1C0U A;  3KD1 E;  3L2W A;  3ZT2 A;  1I3A A;  4FJM A;  1TKZ A;  2FBX A;  1FKO A;  4B9V A;  2HW3 A;  2Y1J A;  4J2A A;  3JSM A;  3A2F A;  4FVM A;  4CGF A;  4CJ5 A;  4E1M A;  3KK2 A;  1TAQ A;  1QSL A;  4M3W A;  4RG8 A;  5E41 A;  4DTO A;  3NGY A;  4HUF A;  4E7H A;  2DFF A;  4FJL A;  4LH4 A;  3EYZ A;  1LWC A;  1S6P A;  2XHB A;  3RR7 A;  4OGC A;  2Y1I A;  1TKX A;  2E6M A;  4BWM A;  3LP1 A;  3VN5 A;  1XHX A;  4M3T A;  3QEW A;  4DSF A;  4E0D A;  1RT4 A;  4KTW A;  4CJE A;  3VA0 A;  3MAQ A;  4ID5 A;  3VQ9 A;  3V4I A;  4CGJ A;  3TAF A;  2G8W A;  3P1G A;  4Z4I A;  4KPY A;  5CZ2 A;  2F8T A;  1FK9 A;  1NJY A;  4EP5 A;  2PYL A;  1RDA A;  4AHC A;  3AA4 A;  1BI4 B;  2YNH A;  3ASM A;  3CFP A;  1NJZ A;  1NK9 A;  3DM2 A;  4UQG A;  1EP4 A;  4K8X A;  1RBR A;  3DLK A;  2A1S A;  1VSI A;  2I5J A;  5HBM A;  4CJW A;  3PY8 A;  1N6Q A;  3CFR A;  1HYV A;  1KRP A;  1WSE A;  3O4Q A;  3RTV A;  4W5T A;  2BE2 A;  4RW9 A;  1CXU A;  4CHZ A;  1L3V A;  1IKV A;  1U48 A;  1CZB A;  1Z25 A;  5T7B A;  4O0I A;  3QEX A;  1U4B A;  1C0T A;  4HUE A;  4ZTF A;  1RDB A;  4DLE A;  3U3G A;  4FLT A;  1BIU A;  1U45 A;  1L3S A;  4FJK A;  4OGE A;  4MFB A;  3DLB A;  3O3F A;  3OJU A;  1RTI A;  4FJN A;  4NCB A;  1WSJ A;  2P51 A;  4OPK A;  3LZJ A;  1YVU A;  2HND A;  1D9D A;  4Y1C A;  4YFU A;  5I3U A;  1R0A A;  3D45 A;  4JRP A;  1FKP A;  3NHG A;  1BI4 A;  3LPT A;  3SI6 A;  3V9Z A;  3P5J A;  3S3M A;  1S1T A;  1UWB A;  2Z1H A;  3SUP A;  3KLG A;  1SV5 A;  1RTD A;  2GUI A;  3T1A A;  3AVN A;  3L8B A;  4CFC A;  4FW2 A;  1S6Q A;  4M45 A;  1YTU A;  4FK2 A;  3SV4 A;  3V6D A;  4FW1 A;  3B6P A;  5SWM A;  3NF8 A;  4CJ3 A;  3V9X A;  3HPO A;  1LV5 A;  5D3G A;  2Q3S A;  3HVT A;  4AH9 A;  4KV8 A;  5CYM A;  4CHQ A;  4IG3 A;  2R7Y A;  1TGO A;  3M8S A;  3RRH A;  4FK4 A;  4QOZ B;  1EX4 A;  4DQP A;  1U49 A;  2KFZ A;  3AO2 A;  3SQ1 A;  1T7P A;  2WON A;  4CIG A;  4AHT A;  4E7J A;  3IRX A;  3ZSR A;  4O4G A;  4FLU A;  1LW2 A;  4WE1 A;  4B9M A;  5FDL A;  4IFY A;  4Z4F A;  3RMB A;  4FXD A;  1IO2 A;  4KHU A;  3V9U A;  3NF9 A;  4CEZ A;  1C1C A;  4GVM A;  4KI4 A;  1VSM A;  5C42 A;  3QO9 A;  4CJK A;  4E7I A;  4CED A;  1XHZ A;  2IAJ A;  4FZZ A;  4DFK A;  1VSK A;  3OYH A;  1Y97 A;  3SQ4 A;  3VQD A;  1S9G A;  4GW6 A;  4CGI A;  1WSF A;  4CJF A;  2OZS A;  1UAX A;  4CES A;  3BDP A;  2DY4 A;  3TAG A;  4QCL A;  3K5O A;  4FYD A;  4CFD A;  4F8R A;  4DSK A;  2HHV A;  4CJL A;  4KB0 A;  1RBS A;  1RBT A;  3MEE A;  4BAC A;  1J9A A;  4CJU A;  3FFI A;  1TL3 A;  4CGD A;  1TK0 A;  2Z1J A;  3HPG A;  2ZQB A;  1XC9 A;  2D5R A;  2G8K A;  3KTQ A;  4PUO A;  2KZZ A;  4ZTJ A;  2RF2 A;  5KRT A;  4NCA A;  3CFO A;  1B9D A;  5HRS A;  4HCB A;  3V9W A;  3DLG A;  4E7L A;  5J2P A;  1L3U A;  4OKE A;  1Q8I A;  2YV0 X;  4FJI A;  4KHS A;  2F8S A;  4KRE A;  1HJR A;  4B8C A;  1NKB A;  1RNH A;  1TKD A;  5FRN A;  1NK7 A;  2YNI A;  3LP2 A;  3LP0 A;  3QES A;  4BDP A;  1RTH A;  2XRI A;  1LW0 A;  4CEB A;  1ZYQ A;  2QKB A;  4AHV A;  3HXM A;  2ITG A;  4HUG A;  3HT3 A;  3RMA A;  2IC3 A;  3KIO A;  4PWD A;  3DLE A;  3F9K A;  4LY7 A;  1NOY A;  5DMR A;  3NGI A;  4FJ7 A;  4OVL A;  3ULD A;  2PZS A;  4W5N A;  3U6F A;  2HHT A;  2W42 A;  3G0Z A;  1D9F A;  1Q9X A;  1QHT A;  1TKT A;  5HRP A;  5FRM A;  1B92 A;  1BQN A;  1S1V A;  4HVJ A;  1NK8 A;  1WNS A;  4BE0 A;  2B4J A;  4B9U A;  4KFB A;  4CK3 A;  4DU3 A;  3CM5 A;  2VG7 A;  2X6S A;  3OYI A;  5J2N A;  3K59 A;  2E4L A;  3VQ8 A;  3DRP A;  3KLI A;  4F4K A;  1IKW A;  3ZT3 A;  4B08 A;  1ASU A;  3MXJ A;  4DMN A;  4DF8 A;  3V81 A;  2OYQ A;  5J1E A;  4L8R B;  1CZ9 A;  3L3U A;  2ZD1 A;  4CGH A;  2HVI A;  1X9W A;  1NKC A;  3ZT4 A;  1BIZ A;  3SZ2 A;  4Z4H A;  1SL0 A;  3AVJ A;  1EKE A;  1JLG A;  1JLA A;  4FJ9 A;  3QEP A;  3SUO A;  3I0S A;  2WOM A;  3DMJ A;  4I9L A;  4C8K A;  3L2U A;  1WSI A;  3M8P A;  4FJG A;  2KFN A;  2B5J A;  4RW8 A;  5JS2 A;  3QNN A;  5C24 A;  3OVN A;  3VQA A;  4FLY A;  3PX6 A;  3D0P A;  4CJP A;  3SNN A;  3MXI A;  1RCH A;  4J2E A;  1W0H A;  4DTR A;  4E89 A;  3MEC A;  3SQ0 A;  1ITG A;  1BCM A;  4CFA A;  2X78 A;  4CEF A;  1SKS A;  5HRR A;  1J53 A;  3C95 A;  1TK5 A;  1NK5 A;  1DLO A;  4BE1 A;  1L3T A;  4BDZ A;  3QNO A;  4Z4C A;  4EZ9 A;  3V1R A;  3ZSW A;  5CZ1 A;  1MU2 A;  3IG1 A;  2YKN A;  3RRG A;  2KQ2 A;  2JGU A;  3EZ5 A;  4G1Q A;  3ZCM A;  1RIL A;  4CEE A;  3MXM A;  2P1J A;  2XY8 A;  1U47 A;  4KO0 A;  2VWK A;  1Z26 A;  2HB5 A;  4IDK A;  3KLE A;  4CHY A;  2G8F A;  3BGR A;  3HPH A;  1A5V A;  3QIP A;  4CF2 A;  3AVK A;  3QEV A;  1XI1 A;  4B8A B;  3SYZ A;  1UA0 A;  4M3U A;  3F73 A;  1X9M A;  1K6Y A;  3THV A;  1S1W A;  4ELU A;  4FZX C;  1NJX A;  3QIN A;  4Z0U A;  1O1W A;  4CGG A;  3L2Q A;  2DFE A;  2GV9 A;  3AVF A;  4OKJ A;  4KKO A;  1RT7 A;  4W5Q A;  2HHX A;  4FM2 A;  1G15 A;  3IAY A;  4DSJ A;  3AA5 X;  4LSL A;  3ZSQ A;  1I39 A;  2O4G A;  4E7K A;  4F2R A;  4H8K A;  2FC0 A;  1TV6 A;  1BIS A;  3HP9 A;  5J2Q A;  1HMV A;  2QKK A;  4JS5 A;  4K8Z A;  2QK9 A;  1BQM A;  3O4N A;  2IOC A;  3MED A;  3SCX A;  4F2S A;  4IG0 A;  3L3V A;  4RW4 A;  4DTU A;  1U04 A;  2JLE A;  3OY9 A;  4O0J A;  1HRH A;  3RWU A;  1A5X A;  3LDS A;  3C6T A;  2OA8 A;  3HST B;  3SQ2 A;  1BHL A;  4KHQ A;  1J54 A;  1VSE A;  4ELV A;  3QLH A;  1ZBH A;  3RR8 A;  2ATQ A;  3K57 A;  4F3O A;  2Z1I A;  2PYJ A;  1WAF A;  1C6V A;  3M8Q A;  4DTJ A;  3DLH A;  1RT6 A;  1KLM A;  4CJS A;  4E3S A;  2HHW A;  4YNQ A;  3IS9 A;  4CFB A;  2BAN A;  3K5M A;  4N47 A;  3VQ4 A; 
#chains in the Genus database with same CATH topology
 1NK0 A;  1D5A A;  1RT1 A;  4DQQ A;  4DSL A;  3CME N;  4CZK A;  3KKR A;  3AAP A;  3VET A;  2ZF5 O;  1JCG A;  2ETJ A;  2EHG A;  1JXE A;  2XY5 A;  4N76 A;  2W41 A;  1KC8 O;  2E5L K;  4M3Z A;  2GUP A;  3MN6 A;  3FZH A;  4FJJ A;  1QSS A;  2PBD A;  2IIR A;  4IFE A;  2ZJR L;  4GY2 B;  5BPM A;  1TL1 A;  2YI1 A;  3IFR A;  4BR5 A;  5AQV A;  5E26 A;  4OX9 K;  2E1Z A;  4LF9 K;  1HQE A;  4OPJ A;  4YOY A;  1SQK A;  4F9O A;  3KLF A;  3O9Q A;  2VQF K;  2G8I A;  3TAM A;  1HQU A;  1YUW A;  4U67 L;  3VTI A;  3D2E A;  3G25 A;  3KK1 A;  1VSL A;  2P9N A;  1ZBI A;  4M7Y A;  2FXU A;  4H5R A;  3V1Q A;  1GOA A;  3ZX3 A;  2IGI A;  3C65 A;  5B8H A;  4AHU A;  1JKH A;  2XY6 A;  3IKM A;  1RT3 A;  2YKM A;  4M7X A;  3RSE B;  1VRU A;  1OVY A;  2DPN A;  4PA1 A;  4X66 K;  2OPR A;  3LWL A;  2QWL A;  2YX6 A;  4Q5V A;  4BDY A;  4RW7 A;  4FLX A;  3OYB A;  2NRV A;  4A5A A;  1ASW A;  4BY9 C;  4FWO A;  4CJR A;  3IMX A;  5DK5 A;  4IFV A;  3VQ5 A;  4C1N K;  1HNZ K;  1RDC A;  4KRF A;  4AIL C;  1ZC6 A;  4DHY A;  4DG1 A;  3CQ8 A;  2OTJ N;  3TAB A;  4FPB A;  5AQP A;  5KGX A;  4DTX A;  1XMO K;  5CR4 A;  5JLF A;  5BR8 K;  2A1R A;  3JXU A;  4DU1 A;  1NGI A;  4DSE A;  3F9M A;  4AM6 A;  1U2V B;  3DI6 A;  4JI4 K;  2QWP A;  3HM9 A;  4I9Q A;  1KVC A;  4JV5 K;  1GOB A;  3ZSY A;  1MWM A;  4FJ5 A;  1C0M A;  3PLA A;  3EKS A;  3ZET B;  3CC2 N;  1T05 A;  1VRT A;  2LSN A;  3ZSV A;  4M63 C;  1HNV A;  4C8M A;  4O8U A;  1WB9 A;  3VQ7 A;  2HHU A;  2GWK A;  3CJC A;  2E6L A;  4H0V B;  4NYN A;  5BR9 A;  2RKI A;  1LAV A;  2E2Q A;  3AO4 A;  3QET A;  4BRP A;  3VQ6 A;  4ICL A;  3TR8 A;  1I94 K;  4GV3 A;  5EXW A;  2KKZ A;  3DOK A;  3BEX A;  3FR0 A;  3MCP A;  1S1U A;  3NGZ A;  1KFD A;  4JK7 A;  1VSJ A;  2AJQ A;  2QWR A;  2KTQ A;  4DFJ A;  1KVB A;  3PIO L;  4EP4 A;  3I33 A;  3SK3 A;  3WXL A;  3CM6 A;  3KK3 A;  2P9N B;  3AVG A;  3VQC A;  4JEP A;  3KD5 E;  1HKB A;  3PV8 A;  4DQS A;  3OYL A;  5HRO A;  4KHY A;  2CH5 A;  1JXB A;  3NE6 A;  2Q0U A;  3SPY A;  1NGJ A;  3QFP A;  1DKG D;  3SAG A;  3VTH A;  2HMI A;  1GLD G;  5AQZ A;  1NOZ A;  2O8C A;  3MX2 A;  4QS9 A;  2HF3 A;  3NCI A;  4CK1 A;  4LD0 A;  3M5R A;  4FM1 A;  3ENB A;  2FBY A;  4YHH K;  2IS3 A;  3T1H K;  4DQI A;  4DTM A;  2IDO A;  4LH5 A;  1TUY A;  2NRZ A;  4B3O A;  1J5O A;  4Y0W A;  3WNE A;  2GEM A;  4OKK A;  2ZM6 K;  3NBP A;  3UKR B;  1B9F A;  5GAG P;  3H3O B;  4ZHR A;  3CXC M;  1NKE A;  4KHP K;  3EY1 A;  4QAG A;  2E1Y A;  1LAW A;  3ENO A;  5AR0 A;  4W5O A;  5HP1 A;  3VEW A;  5IT9 O;  4B9T A;  3PUF A;  4JNE A;  3EO3 A;  3WT0 A;  4DV2 K;  3KD1 E;  3O4W A;  1I3A A;  1N36 K;  1TKZ A;  1FKO A;  1TYQ B;  3MDQ A;  2UXB K;  3JSM A;  3A2F A;  4CGF A;  3FZK A;  4E1M A;  3KK2 A;  3LDN A;  5E41 A;  3NGY A;  4HUF A;  3CF5 L;  4LH4 A;  3EYZ A;  3RR7 A;  4FWK A;  3CJ1 A;  4KTW A;  5AQT A;  4QS7 A;  2F8T A;  1SZ2 A;  1NJY A;  1RDA A;  3AA4 A;  3C6A A;  2A1S A;  4BG8 A;  3O8M A;  4CBU A;  3PY8 A;  1N6Q A;  3RTV A;  3NMU A;  4RW9 A;  1L3V A;  1IKV A;  2WC9 A;  4FSV A;  1DEJ A;  3U9D A;  3WQT A;  4ZTF A;  4CVN E;  4FJK A;  4OGE A;  4FPA A;  1Q86 O;  1RTI A;  4OPK A;  3LZJ A;  3TSU A;  2F7T A;  1W7A A;  5C0Y A;  1FKP A;  3NHG A;  1BI4 A;  4GV6 A;  3V9Z A;  2ZGZ A;  3WQU A;  1VQN N;  1NMD A;  3KLG A;  1SV5 A;  1RTD A;  3WEE B;  4CFC A;  1QZ5 A;  3NF8 A;  1XNR K;  5AQL A;  3SBT A;  2Q3S A;  4AH9 A;  1K8K B;  4KV8 A;  4MLE A;  5CYM A;  4IG3 A;  3H6E A;  2R7Y A;  3O08 A;  4FK4 A;  2FLO A;  3SQ1 A;  2OTL N;  2WON A;  2F4V K;  1YJ9 N;  4FLU A;  5FDL A;  4FXD A;  1NGD A;  1NMN A;  3V9U A;  1T6C A;  4WQ4 C;  4CEZ A;  1XNQ K;  4KI4 A;  1VSM A;  4FZZ A;  1XHZ A;  2IAJ A;  4A57 A;  5AQI A;  4UY8 O;  5AQU A;  3R9P A;  3OYH A;  4GW6 A;  1WSF A;  2OZS A;  3TAG A;  3WXM B;  4QCL A;  3K5O A;  4F8R A;  4DSK A;  2HHV A;  3CPW M;  3NVK A;  1RBS A;  4LF4 K;  1TK0 A;  1NGC A;  3HPG A;  2ZQB A;  1XC9 A;  3Q7C A;  2G8K A;  5HRS A;  3DLG A;  3EL2 A;  2YV0 X;  3ENH A;  3CET A;  4YOX A;  4KHS A;  4KRE A;  4JI0 K;  4A5B A;  3LDO A;  3LP0 A;  3IDH A;  3MWP A;  3QES A;  3TSP A;  4CEB A;  4WF9 L;  4AHV A;  2ITG A;  4HUG A;  4DV4 K;  4FOE A;  4PWD A;  4IXC A;  5DMR A;  4FJ7 A;  3ULD A;  1QHT A;  5FRM A;  4BC5 A;  1WNS A;  1Y64 A;  2NRR A;  2HMP A;  4FWR A;  2Q31 A;  3VQ8 A;  4B1Z A;  2P9L A;  4B08 A;  3MXJ A;  4L8R B;  3LDQ A;  4JKC A;  3ID8 A;  4CGH A;  2P9P A;  1X9W A;  5AQJ A;  1NG9 A;  4FJ9 A;  3QEP A;  3I0S A;  3P38 A;  3DMJ A;  2WUS A;  5AQS A;  2YCH A;  1WSI A;  4FWN A;  3AAR A;  3M8P A;  4FJG A;  3QNN A;  5C24 A;  3VQA A;  4FLY A;  4BRN A;  3D0P A;  3SNN A;  3VGK A;  3MXI A;  1RCH A;  3C6H A;  4J2E A;  4DTR A;  5JVH L;  2PFU A;  3SQ0 A;  4CEF A;  1TK5 A;  1NK5 A;  3UKU A;  2E8A A;  1WBD A;  3ZSW A;  5CZ1 A;  3IG1 A;  1QQM A;  2KQ2 A;  4CEE A;  3QBW A;  1CLQ A;  2D1K A;  4KO0 A;  1YI2 N;  3F2K A;  1Z26 A;  2P9K B;  4IJA A;  2QA4 N;  4IDK A;  4CHY A;  4X65 K;  2G8F A;  3BGR A;  3HPH A;  1OVQ A;  3QEV A;  3PIP L;  4B8A B;  1X9M A;  3THV A;  1NJX A;  1C0F A;  3FZF A;  3MCA B;  1O1W A;  4A2B A;  4CGG A;  2DFE A;  3G4S N;  3VER A;  1RT7 A;  3GDQ A;  4DSJ A;  4LSL A;  3ZSQ A;  1K8A O;  5AZI A;  4F2R A;  2P9S B;  1HMV A;  3O6W A;  5FPE A;  4K8Z A;  3OY9 A;  1HRH A;  3C6T A;  1WBB A;  4ISE A;  5C2F A;  1VSE A;  4JKF A;  3QLH A;  4NLB A;  4U7B A;  4GVE A;  3EN9 A;  4K25 A;  3M8Q A;  1KAZ A;  1RT6 A;  3CCE N;  4E3S A;  4YNQ A;  3MK6 A;  2Q1N A;  3CQY A;  2NRX A;  3K5M A;  3HTV A;  4AQY K;  1L5U A;  3SMP A;  1VQM N;  4YOR A;  3ATU A;  2IVP A;  3N4P A;  3L6Q A;  1VQO N;  3L2R A;  3B6O A;  3VEV A;  1UOC A;  4JK8 A;  4GV9 A;  1FW6 A;  2G8U A;  3PO5 A;  4BVP A;  1VSF A;  1W9H A;  3DWL A;  4CI6 A;  1NK4 A;  2P5G A;  4KAZ A;  3VA3 A;  3NF6 A;  1KLN A;  4JKB A;  3RMD A;  2DTU A;  4WQ5 A;  4CZH A;  3HL8 A;  3WNF A;  3TAR A;  2NRW A;  3VOV A;  5BRE A;  2QTD A;  5FPM A;  4CHP A;  1X1P A;  4K43 A;  4IOX A;  3CCL N;  5F2R A;  2V7Z A;  1IV0 A;  3OS2 A;  3KWG A;  4Z4G A;  4IEI A;  3WXI A;  3HJF A;  3AVB A;  4BRG A;  4CEQ A;  4PKG A;  4H4O A;  1C1B A;  2NUB A;  4CZL A;  3K5L A;  4J8F A;  1QQO A;  4I7F A;  1OH8 A;  2VWJ A;  4ILH A;  5J2M A;  3L0Q A;  1JLE A;  4YDU C;  3KJV A;  4JI8 K;  3M8R A;  2BDP A;  3CHW A;  2F9W A;  1WLJ A;  2ZE2 A;  2QWQ A;  3HK2 A;  1ZBU A;  2DFH A;  1JLF A;  1QQC A;  4J2B A;  4C8L A;  1BOT O;  1G99 A;  3LAM A;  1D8Y A;  3ITH A;  4AHR A;  3OJS A;  4I6M B;  1V4S A;  1SKR A;  1NGB A;  5GAD P;  4BRM A;  4GMJ B;  3AO1 A;  4FWL A;  5HOO A;  1S5J A;  1EXQ A;  2KW4 A;  3SUQ A;  3H45 C;  2FBT A;  4C8O A;  2EWS A;  3HM8 A;  3FGU A;  2KZM A;  4FJH A;  2YHW A;  4PY5 A;  1HYZ A;  2F96 A;  4JAX A;  3RSE A;  3SV3 A;  4V19 S;  3EE9 A;  3A8Y A;  3NH1 A;  1E4G T;  4KB1 A;  3AAQ A;  3LPU A;  3MMV A;  1YT3 A;  5EU7 A;  3OHR A;  4NCG A;  3OYN A;  1JLQ A;  1JL1 A;  2FSK A;  3K9J A;  3TAP A;  1HX1 A;  3O3G A;  2QW9 A;  1WUA A;  1YXQ A;  3CJB A;  1VHX A;  3L4Q A;  4JI7 K;  3OA9 A;  4GNI A;  5KRS A;  3CCU N;  4Z4E A;  4LF8 K;  4JD2 B;  4DTS A;  3CYM A;  3I0R A;  2W40 A;  1D4X A;  1JLB A;  4F3T A;  3AGR A;  5FPN A;  5F1X A;  4DSI A;  1U2V A;  3U4L A;  5JMV A;  1GLA G;  5BRH A;  4C8N A;  3GOI A;  3SJJ A;  3AVM A;  4BG9 A;  2WBN A;  2HNY A;  1KVA A;  3ZET A;  3OS1 A;  2D0P A;  4EHT A;  3QB0 A;  3LP3 A;  1EET A;  4JYA K;  4BQL A;  5CY4 A;  4M41 A;  3M6G A;  4H5T A;  3VQP A;  2O4I A;  1QSY A;  1NJW A;  3DXK B;  3OYG A;  4AM7 A;  2RN2 A;  2YJE A;  3CC4 N;  4EZ6 A;  5F0X A;  1HPM A;  3QIO A;  4JS4 A;  2P9I B;  3BZC A;  2YHA A;  1TK8 A;  3ZX2 A;  1HNW K;  2NNW A;  4CEC A;  3PX4 A;  4FJX A;  2HVH A;  4JI6 K;  4FZY A;  1YTA A;  3P83 D;  4OLB A;  4N56 A;  2D0B A;  3NFA A;  3LAL A;  3J7Z O;  4JN4 A;  3C7N B;  1YHQ N;  1ZBL A;  2X74 A;  2OPP A;  3KVG A;  1X3M A;  4ID1 A;  3S41 A;  3CCM N;  4W5R A;  3AA2 A;  4FO0 A;  2PY5 A;  2P5O A;  5C15 A;  4CEA A;  4BRI A;  5LJV A;  3VF2 A;  2GWJ A;  2D0A A;  3PX0 A;  3FFK B;  4B1X B;  3CG7 A;  4CIF A;  1SS6 A;  2VG5 A;  1RT2 A;  4B1V A;  4Q0B A;  2UUB K;  2HOE A;  4BRH A;  4E1N A;  4IBN A;  4DLG A;  3WNG A;  2G8V A;  1X9S A;  3WUH A;  4N5S A;  4DTN A;  4B3M K;  4MQ3 A;  1C0U A;  2KHO A;  4OO1 J;  3NVM A;  4J2A A;  2E88 A;  3HI0 A;  1QSL A;  4M3W A;  3UKR A;  1EQY A;  2XHB A;  4JI2 K;  4OGC A;  5KPR A;  3SBG A;  1XHX A;  4BRL A;  1RT4 A;  4MO5 A;  4CBX A;  3THW B;  3MAQ A;  3TAF A;  2ZJP L;  4Z4I A;  1FK9 A;  5AQX A;  4XH1 A;  4AHC A;  1NK9 A;  1EP4 A;  1TYQ A;  1W2B M;  5DM7 L;  1HYV A;  5LMU K;  3JAM O;  1CXU A;  4XH5 A;  3I55 N;  1CZB A;  1Z25 A;  3QEX A;  1OH6 A;  1U4B A;  4HUE A;  5AQY A;  1BIU A;  1BA1 A;  1U45 A;  4BRQ A;  3LL3 A;  1L3S A;  4MFB A;  3DLB A;  1RGI A;  4FJN A;  3HOT A;  3VEY A;  1WSJ A;  2P51 A;  3P4I A;  3IUC A;  4Y1C A;  4MDA A;  4YFU A;  4JRP A;  3SI6 A;  3CJ7 A;  1T44 A;  2H3G X;  3H1Q A;  5TKW A;  5AQW A;  3CCV N;  4ILG B;  2QI2 A;  5BPL A;  3B6P A;  3QIC A;  1GLC G;  4CJ3 A;  3V9X A;  3HPO A;  4BGA A;  3WXK A;  2GTD A;  2QEX N;  5MLC Q;  2YJF A;  2CGK A;  3RRH A;  1EX4 A;  4DQP A;  2KFZ A;  3F5T A;  1HKC A;  3E9P A;  1GLF O;  1ZBS A;  3IRX A;  4PL7 A;  4WE1 A;  4BRK A;  4B9M A;  4IFY A;  4Z4F A;  4BC2 A;  1IO2 A;  3NF9 A;  4ISF A;  2A3Z A;  4GVM A;  3WEE A;  5C42 A;  3QO9 A;  4CED A;  4DFK A;  1YIJ N;  4FWQ A;  1IG8 A;  4CGI A;  3H3N O;  3O9R A;  1UAX A;  1K8K A;  1ESV A;  2HF4 A;  2DY4 A;  4FYD A;  4O8K A;  3MEE A;  4BAC A;  1J9A A;  4CJU A;  4LF5 K;  4PUO A;  2D5R A;  5KPT A;  4ZTJ A;  2VCP A;  5KRT A;  4NCA A;  3T1Y K;  4E7L A;  1L3U A;  4NXN K;  2QWN A;  1BUP A;  3AGK A;  2O8D B;  1NKB A;  4BRD A;  1RNH A;  2WTU A;  3KZB A;  2YNI A;  1RTH A;  3FZM A;  1ZYQ A;  3BP8 A;  3KIO A;  3DLE A;  3FZL A;  5EY4 A;  3VEZ A;  4EHU A;  3U6F A;  2HHH K;  2W42 A;  3D2F B;  1D9F A;  3MN9 A;  1S1V A;  1NK8 A;  4B9U A;  5BN9 A;  4BR2 A;  4BR0 A;  2BTF A;  3MX5 A;  4EIA A;  2X6S A;  3OYI A;  5J2N A;  3LM9 A;  2RHK A;  3DRP A;  1IKW A;  2V7Y A;  3AY9 A;  4DF8 A;  2ZD1 A;  3TSQ A;  5A2Q O;  5JIC A;  4IJN A;  1LOT B;  4Z4H A;  3AVJ A;  1YF5 L;  1JLA A;  3SUO A;  2WOM A;  3VEN A;  3G71 N;  4EFH A;  3PX6 A;  2HST A;  4LF7 K;  5M1Q A;  4FVU A;  3T69 A;  2X78 A;  4IEE A;  4FWP A;  1J53 A;  1JCF A;  3GBT A;  3HZ6 A;  4JI3 K;  1NJI O;  4Z4C A;  1MU2 A;  2YKN A;  5KQ8 A;  3EZ5 A;  5E84 A;  3ZCM A;  1RIL A;  1IBL K;  2VWK A;  2VYP A;  1QVF M;  3CC7 N;  4BR4 A;  3QIP A;  4FWM A;  1XI1 A;  3AVK A;  4DCH A;  3SYZ A;  1K6Y A;  4XEI A;  4ELU A;  3THX B;  5AQF A;  4FZX C;  3QIN A;  3ULE B;  3G6E N;  3L2Q A;  1ZXO A;  2IVO A;  3E9O A;  4IWV A;  4KKO A;  1G15 A;  1JJ2 M;  1CZA N;  2O4G A;  4E7K A;  1TV6 A;  3HBT A;  2QK9 A;  3SCX A;  4F2S A;  3L3V A;  2ITM A;  2JLE A;  4O0J A;  3RWU A;  1S22 A;  1A5X A;  5AZJ B;  2P9K A;  3HST B;  3J7A P;  1HLU A;  4ELV A;  1ZBH A;  2ATQ A;  4H5V A;  3K57 A;  1C6V A;  4LC9 B;  2D4W A;  2HHW A;  3K9K A;  3ZYY X;  3BZK A;  4EAH D;  3VQ4 A;  2QXF A;  1RDW X;  3SAF A;  1IBK K;  4B1U B;  5AQH A;  2P9S A;  2V52 B;  2HNZ A;  4H4M A;  4YY3 K;  3K5N A;  3U3Y A;  3O9T A;  2A6A A;  1NGA A;  1F21 A;  4CD1 A;  3TI0 A;  3CMA N;  1VQ4 N;  3LZI A;  5AQN A;  1BGX T;  3UE5 A;  3SAH A;  3LAK A;  2HHS A;  3OYE A;  2P9U B;  1WSH A;  3DLR A;  3H46 O;  4DV5 K;  4KH5 A;  3RMC A;  1P8Z A;  3B8A X;  3KHY A;  4LFC K;  1VK0 A;  1GOC A;  1Q81 O;  4CK2 A;  1Q7Y O;  3QEI A;  3TPQ A;  3QML A;  4C23 A;  3HP6 A;  4NB4 A;  3E1Y A;  4DR6 K;  4JHD B;  3VQB A;  4CZG A;  4K0K K;  4GKJ K;  4WFB L;  1XUP O;  3AA3 A;  3LDP A;  4ILJ A;  4CF0 A;  2CGL A;  5KGW A;  1KSP A;  3ZSX A;  4DFP A;  3K58 A;  4CJ7 A;  3GG4 A;  1RBV A;  2Q97 A;  1MWK A;  1S3X A;  1QTM A;  4B9L A;  4R5P A;  3J80 O;  2YNG A;  3OYF A;  1IBM K;  1NGF A;  4KH4 A;  3AVH A;  1IG9 A;  1BL3 A;  1S1X A;  2YHB A;  3N4Q A;  4LSN A;  3V9S A;  4KTQ A;  1RFQ A;  4CZF A;  3JYT A;  3V1O A;  2GBZ A;  5JVG L;  2FF3 B;  4A59 A;  3K2P A;  4DWI A;  2UXC K;  2RPI A;  4CJQ A;  4CCH A;  2NZT A;  1DTT A;  1NU0 A;  1J5E K;  1K9M O;  4DR4 K;  1N5Y A;  4I2Q A;  1QE1 A;  4FJ8 A;  4WFN L;  3AO5 A;  1OH5 A;  5JLH A;  3I56 N;  4KBO A;  3AVL A;  4I6M A;  3CCR N;  1WSG A;  1KXP A;  3OS0 A;  5JS1 A;  1RTJ A;  1VQ7 N;  4HHT A;  2B6A A;  4MLH A;  4OJR A;  1C1A A;  5FLX O;  4DTP A;  4M3X A;  4IO9 L;  1FXX A;  1TVR A;  4CIE A;  4DF4 A;  4FOI A;  1BDG A;  5M1O A;  3TAQ A;  3ZEU B;  4ELT A;  3DLL L;  1RDU A;  1IKX A;  1TAU A;  3C6U A;  4BRO A;  3J8A A;  3QFU A;  2PAV A;  3TWH A;  4H0P A;  3OYA A;  1JCE A;  4JI1 K;  3AVI A;  3T3F A;  1ATN A;  1HNI A;  5HL7 L;  4H5N A;  2O8B B;  1T6D A;  3I8B A;  5LMN K;  5SZT A;  5CYQ A;  4IOC L;  5GIN A;  3DXM B;  3TAE A;  1ATS A;  4HCC A;  1NM1 A;  1SL1 A;  1WOQ A;  4JD2 A;  4FL9 A;  4HTU A;  3A5L C;  1KTQ A;  3ID6 A;  1RBU A;  4NLC A;  4NO7 A;  2ASP A;  3G10 A;  1LWF A;  4H5W A;  3UIQ A;  2IVN A;  5DM6 L;  4DU4 A;  1KAY A;  1VQ6 N;  3O3H A;  4JKG B;  1QS4 A;  1SUQ A;  2YHX A;  3SLC A;  3I8D A;  3S9H A;  1BCO A;  3S3O A;  4CJ4 A;  1QZ6 A;  1RDD A;  1N33 K;  3DRS A;  3DXK A;  3M3Z A;  3AVC A;  4KHW A;  1HYS A;  1REV A;  3VQE A;  4MDB A;  4M3R A;  5C10 A;  2P9I A;  1KCF A;  2G8H A;  1LWE A;  3R6M A;  1A5W A;  4KTZ A;  4BC4 A;  4WQ4 A;  3SUN A;  1VQK N;  4BC3 A;  1ATR A;  3NH0 A;  4CER A;  1IKY A;  2QM1 A;  4O5B A;  5HLF A;  1S9E A;  1WAJ A;  4DS5 A;  3EE8 A;  3OYD A;  2V51 B;  4JKA A;  3C7N A;  3L2V A;  4KHN A;  2EX3 A;  4LFA K;  3DRR A;  3ZX0 A;  3LWM A;  5CHI A;  1LCU A;  3CI5 A;  3TAN A;  3LAN A;  3PSF A;  3SJH A;  3DOL A;  3ZSO A;  4FJM A;  3ZT2 A;  2FBX A;  2HW3 A;  2Y1J A;  4FVM A;  4CJ5 A;  4WYB A;  2CGJ A;  4XH4 A;  4RG8 A;  1HNX K;  4DTO A;  3O9S A;  4E7H A;  4FJL A;  2ZGY A;  1S6P A;  3VF4 A;  4IOA L;  2Y1I A;  2E6M A;  4BWM A;  3VN5 A;  4E0D A;  4CJE A;  2G8W A;  3VA0 A;  3FLC O;  3VQ9 A;  4DKW A;  5LY3 A;  4MO4 A;  2PYL A;  3ASM A;  3CFP A;  4K8X A;  1RBR A;  3DLK A;  2OCE A;  2I5J A;  5HBM A;  4CJW A;  3CFR A;  1WSE A;  3P31 A;  5AFU A;  4CHZ A;  4DV0 K;  4O0I A;  2NLX A;  1C0T A;  4DLE A;  3U3G A;  4FLT A;  3Q7B A;  3O3F A;  3OJU A;  3THW A;  1YVU A;  2QXL A;  1D9D A;  4IZ9 A;  3D45 A;  2O8F B;  3LPT A;  4IDH A;  3P5J A;  3KWI A;  3MWT A;  1S1T A;  2Z1H A;  3S3M A;  3O5B A;  4R79 A;  3T1A A;  3L8B A;  4FK2 A;  3SV4 A;  2YHY A;  4BRA A;  3V6D A;  4A62 A;  5SWM A;  4A2A A;  1LV5 A;  2JWL A;  3CCS N;  2KLA A;  4CHQ A;  4BVO A;  4BRC A;  1TGO A;  3M8S A;  1U49 A;  3LDL A;  4ISG A;  3E9L A;  4CIG A;  4JI5 K;  4DR7 K;  4E7J A;  3ZSR A;  4O4G A;  1LW2 A;  4YOW A;  3RMB A;  4KHU A;  4DQ8 A;  5ADX H;  3D6R A;  1C1C A;  1T3V A;  4E7I A;  5IWA K;  5BN8 A;  5AQM A;  1VSK A;  1Y97 A;  3SQ4 A;  4CZI A;  1S9G A;  4H03 B;  3BDP A;  3U8X A;  2O8E B;  1C0G A;  3QBX A;  4CFD A;  4CJL A;  1NGH A;  4KB0 A;  3EKU A;  1RBT A;  3FFI A;  4CGD A;  5I9E B;  2FSN A;  1NNE A;  3OTO K;  5BRD A;  1P90 A;  3CFO A;  4BR9 A;  3V9W A;  5J2P A;  3R1X A;  2A42 A;  2F8S A;  3VGM A;  4B8C A;  1MDU B;  4BDP A;  1LW0 A;  5EOY A;  3HT3 A;  3RMA A;  4LY7 A;  5C12 A;  3NGI A;  4OVL A;  2PZS A;  2HBJ A;  2HHT A;  1QVG M;  3G0Z A;  4B1W B;  2JWK A;  1TKT A;  5HRP A;  1B92 A;  4HVJ A;  1YIT N;  4WCE L;  4BE0 A;  2B4J A;  4KFB A;  4CK3 A;  4DU3 A;  2HBL A;  3VMF B;  3A0I X;  4NXM K;  3K59 A;  3DJC A;  4F4K A;  2O8D A;  1DGK N;  2FF6 A;  4H0O A;  3V81 A;  5TKY A;  1HKG A;  3CJ9 A;  5AQG A;  3ZT4 A;  5AQK A;  1X3N A;  4JKE A;  3TTF A;  3CIP A;  1SL0 A;  4CZJ A;  1EKE A;  4C8K A;  3D2F A;  3L2U A;  2ZWH A;  1HR0 K;  2A5X A;  2KFN A;  4RW8 A;  3OVN A;  4L3Q A;  1BWF O;  2HBK A;  3QDK A;  4KH6 A;  1M90 O;  1W0H A;  4YDU A;  4E89 A;  1GLL O;  1ITG A;  1BCM A;  2E2P A;  1K73 O;  3C95 A;  1DLO A;  4BE1 A;  1YJW N;  4O5F A;  2E20 A;  3QNO A;  4EZ9 A;  1E3M A;  3V1R A;  3MXM A;  1VAZ A;  2P1J A;  1EWQ A;  4YOU A;  1XC3 A;  2HB5 A;  3K0S A;  3O1B A;  3KLE A;  3VES A;  1A5V A;  3F73 A;  3THY B;  1S1W A;  2E2N A;  1VQ8 N;  5LJW A;  2GV9 A;  3AVF A;  1YAG A;  3VEX A;  5CE3 A;  4FM2 A;  3CD6 N;  3AA5 X;  4BQZ A;  4H8K A;  2FC0 A;  5J2Q A;  2QKK A;  1BQM A;  3MED A;  4DTU A;  4RW4 A;  1U04 A;  1TUU A;  3LDS A;  2OA8 A;  1ILY A;  5C2D A;  2ASO A;  4H0X B;  1BG3 A;  5BRF A;  3T7Z A;  1DT9 A;  2PYJ A;  1WAF A;  3THX A;  3OBY A;  4DTJ A;  3ULE A;  1N34 K;  4CJS A;  3VGL A;  3IS9 A;  4Z94 A;  4PHT X;  1VSH A;  4RCH A;  3BF1 A;  2QWO A;  3MN7 A;  4E1J A;  3CCJ N;  4DUZ K;  4TSX A;  3EEQ A;  3AO3 A;  5AZJ A;  5GAE P;  3SPZ A;  2OPS A;  4CJT A;  3D2E B;  1SKW A;  3OYK A;  3AVA A;  4AF1 A;  1HJO A;  1SAZ A;  4DS4 A;  3CJA A;  2A40 A;  2FBV A;  5I42 A;  3SMS A;  4BWJ A;  3J81 O;  3ZT1 A;  1XMQ K;  5HRN A;  1ASV A;  3RVC A;  1YJN N;  3L4I A;  3BUZ B;  4OLA A;  3ZLJ A;  2Q0R A;  4WFA L;  4E19 A;  3MN5 A;  3VQQ A;  5ADX A;  1KFS A;  1RT5 A;  2VGM A;  2D0C A;  2P9U A;  4B9N A;  3CPE A;  4CHN A;  4XIU A;  2UYT A;  4CF8 A;  5AQO A;  4FLZ A;  3J7Y P;  4I2P A;  4CE9 A;  1T8E A;  5AQR A;  1DTQ A;  1XWL A;  3WNH A;  4JHD A;  2UXD K;  1WN7 A;  5FPD A;  4CZM A;  1XQS C;  3NH2 A;  3NDK A;  4FWS A;  1CXQ A;  4PKH A;  1BU6 O;  3MEG A;  3CER A;  3QER A;  1KAX A;  5AJ3 K;  4KI6 A;  2E2O A;  3NAE A;  1FJG K;  3A5M C;  3HVR A;  4DQR A;  3TTC A;  1Q82 O;  3S3N A;  4CD3 A;  4FLV A;  3ZSZ A;  2Z1G A;  2XY7 A;  5EX5 A;  4M42 A;  2OPQ A;  1VSD A;  3ZT0 A;  3KLH A;  4B3R K;  5ELZ A;  2VG6 A;  2HBM A;  3O9U A;  1Z6R A;  4O55 A;  3ISN C;  1UA1 A;  2HHQ A;  4J2D A;  1O13 A;  5M1F A;  4X62 K;  4Y1D A;  4CBW A;  1Q18 A;  4GKK K;  4CEO A;  4WQ5 C;  2X6N A;  5KI6 A;  1MA9 B;  2A41 A;  2W6L A;  3ALY A;  3UB5 A;  3E01 A;  2UUC K;  4FK0 A;  1QQN A;  4PQU A;  4IKF A;  4DR3 K;  4H0Y B;  3ZEU A;  4QS8 A;  1VQL N;  1BA0 A;  2VGN A;  1Q9Y A;  5C25 A;  5M1N A;  4OPA A;  2UU9 K;  2O8C B;  4DR1 K;  4OPH A;  2AP1 A;  4DR5 K;  4CHO A;  1GLB G;  2O8B A;  4AHS A;  3H08 A;  1NBW A;  1ZBF A;  3CCQ N;  3OYM A;  4BE2 A;  4O44 A;  4RW6 A;  4DR2 K;  3DXM A;  4RWT A;  3C94 A;  4JLH A;  4FCY A;  3HO1 A;  3NF7 A;  4N41 A;  4JRQ A;  4DFM A;  4M3Y A;  2BGG A;  3KKS A;  4YOV A;  2XO7 A;  3OYJ A;  1R59 O;  4NYF A;  1NWK A;  1HPZ A;  3JS6 A;  3U9Z A;  4RTF D;  2YNF A;  5K14 A;  1QHA A;  4BRF A;  3VPZ A;  3HYF A;  1YVN A;  3DYA A;  4B3T K;  3T19 A;  4HTL A;  4BR7 A;  3D7E O;  2AA4 A;  1JLC A;  5KTQ A;  4B9Q A;  4JKG A;  1T03 A;  1JL2 A;  1N8R O;  1SL2 A;  1IH7 A;  3ATV A;  4CF9 A;  3AV9 A;  1NK6 A;  4FLW A;  5AFU H;  5FRO A;  2J4R A;  3PO4 A;  5KPZ A;  4B9S A;  4JK9 A;  3OYC A;  4FM0 A;  3VEO A;  4CJV A;  2OZM A;  3W0L A;  1KQS M;  1GLJ O;  1Z05 A;  4CF1 A;  4DB3 A;  3L2W A;  2Q2R A;  4PL8 A;  4DV1 K;  1W97 L;  1M1K O;  2FSJ A;  3HOS A;  1TAQ A;  2DFF A;  1LWC A;  2OAN A;  1TKX A;  4LF6 K;  4M3T A;  3LP1 A;  3QEW A;  4DSF A;  3V4I A;  4K42 A;  4ID5 A;  1V4T A;  3HRG A;  4CGJ A;  3P1G A;  4KPY A;  5CZ2 A;  3R3L A;  4EP5 A;  1BI4 B;  2YNH A;  1NJZ A;  3DM2 A;  4UQG A;  1OKJ A;  1VSI A;  4YOT A;  1KRP A;  3O4Q A;  4W5T A;  2BE2 A;  1U48 A;  2NRH A;  3M1F A;  5T7B A;  1RDB A;  4LFB K;  4BRE A;  4G9Z A;  1OH7 A;  2BUP A;  1BO5 O;  4B1Y B;  4NCB A;  1N32 K;  2HND A;  5I3U A;  1R0A A;  3BY5 A;  4X64 K;  1UWB A;  3SUP A;  2GUI A;  2GEL A;  3AVN A;  4JKH A;  4FW2 A;  1S6Q A;  4M45 A;  1YTU A;  4FW1 A;  4A61 A;  5D3G A;  3HVT A;  2F9T A;  1X9J A;  4DUY K;  2RE2 A;  4QOZ B;  2UUA K;  1NLV A;  3AO2 A;  4K41 A;  1T7P A;  2O8F A;  4AHT A;  1EWR A;  3HSC A;  4DV3 K;  3GL1 A;  1EO1 A;  5M1P A;  3C0B A;  4CJK A;  3H1V X;  3VQD A;  4CJF A;  4CES A;  4BGB A;  2GX9 A;  3WXJ A;  4CW7 B;  1HUX A;  1TL3 A;  4CZE A;  3KK7 A;  2Z1J A;  2KZZ A;  3KTQ A;  3A5O C;  4C1N I;  2RF2 A;  5GIP A;  1B9D A;  4HCB A;  3TU5 A;  1NGG A;  4OKE A;  2NRT A;  1Q8I A;  4FJI A;  3P39 A;  1E4F T;  2W6K A;  1HJR A;  1TKD A;  5BPN A;  5FRN A;  2P9L B;  1NK7 A;  3LP2 A;  2XRI A;  2QKB A;  3HXM A;  2P9P B;  2O8E A;  2IC3 A;  2ASM A;  3F9K A;  3OW2 M;  1NOY A;  4W5N A;  5M1K A;  1Q9X A;  1GLE G;  3R8E A;  3CQX A;  3E66 A;  1IJJ A;  1BQN A;  2I7N A;  4IO8 A;  1J6Z A;  3TTD A;  2D0O A;  3CM5 A;  2VG7 A;  2I7P A;  2E4L A;  3DAW A;  3KLI A;  5AQQ A;  5GAH P;  3ZT3 A;  4DMN A;  1ASU A;  5H1S Q;  2OYQ A;  3BF3 A;  5J1E A;  3UKU B;  1CZ9 A;  3VF6 A;  3L3U A;  2HVI A;  1NKC A;  2WFB A;  1BIZ A;  3SZ2 A;  3OBW A;  1U6Z A;  1JLG A;  4I9L A;  2VWB A;  2ZJQ L;  3GE1 A;  2B5J A;  5JS2 A;  2VQE K;  4HWI A;  4CJP A;  1VQ9 N;  3MEC A;  3LM2 A;  4CFA A;  1SKS A;  5HRR A;  1L3T A;  1KD1 O;  4BDZ A;  3FE1 A;  4H0T B;  5AZI B;  3RRG A;  2JGU A;  4G1Q A;  1U47 A;  2XY8 A;  3O80 A;  5KQD A;  5LL6 Z;  4PKI A;  5EVZ A;  3W3D A;  4CF2 A;  3EZW A;  1UA0 A;  4M3U A;  4Z0U A;  4JKD A;  4OKJ A;  2CH6 A;  2HHX A;  4W5Q A;  3IAY A;  1S72 N;  1I39 A;  4B3S K;  2QWM A;  3HP9 A;  1BIS A;  4JS5 A;  3A5N C;  3O4N A;  2IOC A;  2Q36 A;  3PSI A;  4IG0 A;  4DV6 K;  3SQ2 A;  1BHL A;  4KHQ A;  1J54 A;  3RR8 A;  1H1V A;  1VQP N;  4F3O A;  3THY A;  2Z1I A;  4DV7 K;  1VQ5 N;  3DLH A;  3O1W A;  1KLM A;  5GIO A;  2BH1 A;  4CFB A;  2BAN A;  4B9V A;  4N47 A;  1NGE A; 
#chains in the Genus database with same CATH homology
 2QXF A;  1NK0 A;  1D5A A;  1VSH A;  1L5U A;  1RT1 A;  4DQQ A;  4DSL A;  3KKR A;  2ETJ A;  2HNZ A;  4H4M A;  3K5N A;  2EHG A;  1JXE A;  2XY5 A;  3U3Y A;  4TSX A;  4N76 A;  3L2R A;  3AO3 A;  3B6O A;  1UOC A;  3SPZ A;  4M3Z A;  2OPS A;  1F21 A;  2G8U A;  3PO5 A;  4FJJ A;  1VSF A;  1W9H A;  1NK4 A;  1QSS A;  3TI0 A;  2P5G A;  4KAZ A;  4CJT A;  3LZI A;  3VA3 A;  3NF6 A;  1BGX T;  1TL1 A;  1KLN A;  3LAK A;  2HHS A;  3RMD A;  1SKW A;  3OYK A;  3AVA A;  3OYE A;  2DTU A;  1WSH A;  3DLR A;  3HL8 A;  3WNF A;  3TAR A;  3RMC A;  4DS4 A;  1VK0 A;  1GOC A;  4CHP A;  1X1P A;  2FBV A;  4CK2 A;  5I42 A;  3QEI A;  1HQE A;  4OPJ A;  3OS2 A;  3HP6 A;  4Z4G A;  4BWJ A;  3KLF A;  3HJF A;  3ZT1 A;  5HRN A;  1ASV A;  3AVB A;  4CEQ A;  4H4O A;  1C1B A;  2NUB A;  2G8I A;  3TAM A;  3VQB A;  3K5L A;  1HQU A;  4OLA A;  3AA3 A;  4I7F A;  4E19 A;  3VQQ A;  4CF0 A;  2VWJ A;  1KFS A;  5J2M A;  5KGW A;  1KSP A;  1RT5 A;  3KK1 A;  1JLE A;  1VSL A;  3KJV A;  2D0C A;  3ZSX A;  3M8R A;  1ZBI A;  4DFP A;  3K58 A;  2BDP A;  4B9N A;  1RBV A;  4CHN A;  4XIU A;  1WLJ A;  2ZE2 A;  3V1Q A;  1GOA A;  4CF8 A;  1QTM A;  2IGI A;  4B9L A;  4R5P A;  3HK2 A;  1ZBU A;  2YNG A;  2DFH A;  4AHU A;  1JLF A;  3OYF A;  1JKH A;  1QQC A;  4FLZ A;  2XY6 A;  4I2P A;  4CE9 A;  1RT3 A;  2YKM A;  4C8L A;  4J2B A;  1VRU A;  1T8E A;  4PA1 A;  1DTQ A;  1XWL A;  2OPR A;  3WNH A;  3LWL A;  3AVH A;  1IG9 A;  1BL3 A;  1S1X A;  2YHB A;  4LSN A;  3V9S A;  4KTQ A;  3LAM A;  1D8Y A;  4Q5V A;  4BDY A;  3ITH A;  4AHR A;  4RW7 A;  4FLX A;  3OYB A;  3OJS A;  1SKR A;  1WN7 A;  3JYT A;  3V1O A;  1ASW A;  2GBZ A;  4CJR A;  3NH2 A;  3K2P A;  4GMJ B;  5DK5 A;  3AO1 A;  4IFV A;  3VQ5 A;  2RPI A;  1S5J A;  1CXQ A;  4CJQ A;  3NDK A;  4CCH A;  1EXQ A;  1DTT A;  2KW4 A;  1RDC A;  4KRF A;  4AIL C;  3SUQ A;  2FBT A;  4C8O A;  3MEG A;  2KZM A;  4FJH A;  4PY5 A;  4DG1 A;  3CQ8 A;  3QER A;  1HYZ A;  2F96 A;  3TAB A;  1N5Y A;  3SV3 A;  4KI6 A;  4I2Q A;  4DWI A;  1QE1 A;  4FJ8 A;  3NAE A;  3NH1 A;  5KGX A;  3AO5 A;  4DTX A;  3HVR A;  2A1R A;  4KB1 A;  4DQR A;  3LPU A;  4DSE A;  4DU1 A;  3AVL A;  4FLV A;  3S3N A;  1YT3 A;  3DI6 A;  5EU7 A;  4NCG A;  3HM9 A;  4I9Q A;  1WSG A;  1KVC A;  3ZSZ A;  3OS0 A;  2Z1G A;  3OYN A;  1JLQ A;  2XY7 A;  1RTJ A;  5JS1 A;  1JL1 A;  4HHT A;  1GOB A;  2B6A A;  3ZSY A;  4OJR A;  1C1A A;  4FJ5 A;  4DTP A;  3TAP A;  4M3X A;  1C0M A;  1CLQ A;  3O3G A;  1FXX A;  1TVR A;  4CIE A;  4DF4 A;  4M42 A;  2OPQ A;  1VRT A;  2LSN A;  3ZSV A;  5KRS A;  1T05 A;  4Z4E A;  3TAQ A;  4ELT A;  1VSD A;  3ZT0 A;  3KLH A;  1HNV A;  4C8M A;  4DTS A;  1IKX A;  2VG6 A;  1TAU A;  3C6U A;  4O55 A;  3ISN C;  1UA1 A;  2HHQ A;  4J2D A;  3VQ7 A;  3CYM A;  3I0R A;  2HHU A;  2E6L A;  4Y1D A;  4NYN A;  1JLB A;  3TWH A;  3OYA A;  4F3T A;  3T3F A;  3AVI A;  4DSI A;  2RKI A;  1LAV A;  1HNI A;  4CEO A;  4C8N A;  3AO4 A;  3QET A;  2X6N A;  3SJJ A;  5KI6 A;  3VQ6 A;  3AVM A;  4ICL A;  3ALY A;  3TR8 A;  2HNY A;  5SZT A;  3E01 A;  5CYQ A;  4FK0 A;  1KVA A;  4PQU A;  4IKF A;  3DOK A;  3TAE A;  3OS1 A;  4HCC A;  1SL1 A;  3LP3 A;  1EET A;  1Q9Y A;  5CY4 A;  1S1U A;  4M41 A;  3VQP A;  3NGZ A;  5C25 A;  1KFD A;  2O4I A;  1QSY A;  1NJW A;  1VSJ A;  4HTU A;  2AJQ A;  3OYG A;  2KTQ A;  2RN2 A;  4DFJ A;  4EZ6 A;  1KVB A;  4CHO A;  1KTQ A;  4AHS A;  3H08 A;  1RBU A;  3QIO A;  4EP4 A;  4JS4 A;  1ZBF A;  2YHA A;  3OYM A;  3CM6 A;  1TK8 A;  3KK3 A;  4BE2 A;  3G10 A;  4CEC A;  1LWF A;  4O44 A;  3PX4 A;  4FJX A;  3AVG A;  3UIQ A;  3VQC A;  4RW6 A;  2HVH A;  3C94 A;  4JLH A;  4FCY A;  4FZY A;  3HO1 A;  1YTA A;  3P83 D;  4DU4 A;  3NF7 A;  3KD5 E;  3PV8 A;  4N41 A;  4OLB A;  3O3H A;  4N56 A;  4JRQ A;  1QS4 A;  1SUQ A;  3I8D A;  2D0B A;  3NFA A;  4DFM A;  4DQS A;  4M3Y A;  2BGG A;  3KKS A;  3OYL A;  5HRO A;  4KHY A;  3LAL A;  3S9H A;  1BCO A;  1JXB A;  3NE6 A;  3SPY A;  2XO7 A;  3S3O A;  4CJ4 A;  1RDD A;  3OYJ A;  4NYF A;  3DRS A;  1ZBL A;  2HMI A;  2X74 A;  1HPZ A;  1NOZ A;  2OPP A;  3AVC A;  4KHW A;  1HYS A;  1REV A;  2YNF A;  3VQE A;  4CK1 A;  3NCI A;  5K14 A;  4ID1 A;  4LD0 A;  4M3R A;  4FM1 A;  4W5R A;  3AA2 A;  2FBY A;  2PY5 A;  1KCF A;  2IS3 A;  2G8H A;  3HYF A;  2P5O A;  3DYA A;  4DQI A;  1LWE A;  4KTZ A;  1A5W A;  4CEA A;  3T19 A;  4DTM A;  2IDO A;  4LH5 A;  4B3O A;  1J5O A;  3SUN A;  3WNE A;  5KTQ A;  1JLC A;  3NH0 A;  4OKK A;  4CER A;  1IKY A;  4O5B A;  5HLF A;  1JL2 A;  1T03 A;  3NBP A;  1S9E A;  1WAJ A;  1IH7 A;  2D0A A;  4CF9 A;  3AV9 A;  4DS5 A;  1NK6 A;  1SL2 A;  1B9F A;  3PX0 A;  4FLW A;  3OYD A;  5FRO A;  3CG7 A;  3PO4 A;  4CIF A;  4B9S A;  3OYC A;  2VG5 A;  4ZHR A;  3L2V A;  4KHN A;  1RT2 A;  4FM0 A;  2EX3 A;  4Q0B A;  1NKE A;  3EY1 A;  4QAG A;  4CJV A;  1LAW A;  3DRR A;  3LWM A;  4E1N A;  4W5O A;  5HP1 A;  3TAN A;  2OZM A;  3LAN A;  4IBN A;  4B9T A;  3PUF A;  4DLG A;  3WNG A;  2G8V A;  3DOL A;  3ZSO A;  4CF1 A;  4N5S A;  4DTN A;  1X9S A;  4MQ3 A;  1C0U A;  3KD1 E;  3L2W A;  3ZT2 A;  1I3A A;  4FJM A;  1TKZ A;  2FBX A;  1FKO A;  4B9V A;  2HW3 A;  2Y1J A;  4J2A A;  3JSM A;  3A2F A;  4FVM A;  4CGF A;  4CJ5 A;  4E1M A;  3KK2 A;  1TAQ A;  1QSL A;  4M3W A;  4RG8 A;  5E41 A;  4DTO A;  3NGY A;  4HUF A;  4E7H A;  2DFF A;  4FJL A;  4LH4 A;  3EYZ A;  1LWC A;  1S6P A;  2XHB A;  3RR7 A;  4OGC A;  2Y1I A;  1TKX A;  2E6M A;  4BWM A;  3LP1 A;  3VN5 A;  1XHX A;  4M3T A;  3QEW A;  4DSF A;  4E0D A;  1RT4 A;  4KTW A;  4CJE A;  3VA0 A;  3MAQ A;  4ID5 A;  3VQ9 A;  3V4I A;  4CGJ A;  3TAF A;  2G8W A;  3P1G A;  4Z4I A;  4KPY A;  5CZ2 A;  2F8T A;  1FK9 A;  1NJY A;  4EP5 A;  2PYL A;  1RDA A;  4AHC A;  3AA4 A;  1BI4 B;  2YNH A;  3ASM A;  3CFP A;  1NJZ A;  1NK9 A;  3DM2 A;  4UQG A;  1EP4 A;  4K8X A;  1RBR A;  3DLK A;  2A1S A;  1VSI A;  2I5J A;  5HBM A;  4CJW A;  3PY8 A;  1N6Q A;  3CFR A;  1HYV A;  1KRP A;  1WSE A;  3O4Q A;  3RTV A;  4W5T A;  2BE2 A;  4RW9 A;  1CXU A;  4CHZ A;  1L3V A;  1IKV A;  1U48 A;  1CZB A;  1Z25 A;  5T7B A;  4O0I A;  3QEX A;  1U4B A;  1C0T A;  4HUE A;  4ZTF A;  1RDB A;  4DLE A;  3U3G A;  4FLT A;  1BIU A;  1U45 A;  1L3S A;  4FJK A;  4OGE A;  4MFB A;  3DLB A;  3O3F A;  3OJU A;  1RTI A;  4FJN A;  4NCB A;  1WSJ A;  2P51 A;  4OPK A;  3LZJ A;  1YVU A;  2HND A;  1D9D A;  4Y1C A;  4YFU A;  5I3U A;  1R0A A;  3D45 A;  4JRP A;  1FKP A;  3NHG A;  1BI4 A;  3LPT A;  3SI6 A;  3V9Z A;  3P5J A;  3S3M A;  1S1T A;  1UWB A;  2Z1H A;  3SUP A;  3KLG A;  1SV5 A;  1RTD A;  2GUI A;  3T1A A;  3AVN A;  3L8B A;  4CFC A;  4FW2 A;  1S6Q A;  4M45 A;  1YTU A;  4FK2 A;  3SV4 A;  3V6D A;  4FW1 A;  3B6P A;  5SWM A;  3NF8 A;  4CJ3 A;  3V9X A;  3HPO A;  1LV5 A;  5D3G A;  2Q3S A;  3HVT A;  4AH9 A;  4KV8 A;  5CYM A;  4CHQ A;  4IG3 A;  2R7Y A;  1TGO A;  3M8S A;  3RRH A;  4FK4 A;  4QOZ B;  1EX4 A;  4DQP A;  1U49 A;  2KFZ A;  3AO2 A;  3SQ1 A;  1T7P A;  2WON A;  4CIG A;  4AHT A;  4E7J A;  3IRX A;  3ZSR A;  4O4G A;  4FLU A;  1LW2 A;  4WE1 A;  4B9M A;  5FDL A;  4IFY A;  4Z4F A;  3RMB A;  4FXD A;  1IO2 A;  4KHU A;  3V9U A;  3NF9 A;  4CEZ A;  1C1C A;  4GVM A;  4KI4 A;  1VSM A;  5C42 A;  3QO9 A;  4CJK A;  4E7I A;  4CED A;  1XHZ A;  2IAJ A;  4FZZ A;  4DFK A;  1VSK A;  3OYH A;  1Y97 A;  3SQ4 A;  3VQD A;  1S9G A;  4GW6 A;  4CGI A;  1WSF A;  4CJF A;  2OZS A;  1UAX A;  4CES A;  3BDP A;  2DY4 A;  3TAG A;  4QCL A;  3K5O A;  4FYD A;  4CFD A;  4F8R A;  4DSK A;  2HHV A;  4CJL A;  4KB0 A;  1RBS A;  1RBT A;  3MEE A;  4BAC A;  1J9A A;  4CJU A;  3FFI A;  1TL3 A;  4CGD A;  1TK0 A;  2Z1J A;  3HPG A;  2ZQB A;  1XC9 A;  2D5R A;  2G8K A;  3KTQ A;  4PUO A;  2KZZ A;  4ZTJ A;  2RF2 A;  5KRT A;  4NCA A;  3CFO A;  1B9D A;  5HRS A;  4HCB A;  3V9W A;  3DLG A;  4E7L A;  5J2P A;  1L3U A;  4OKE A;  1Q8I A;  2YV0 X;  4FJI A;  4KHS A;  2F8S A;  4KRE A;  1HJR A;  4B8C A;  1NKB A;  1RNH A;  1TKD A;  5FRN A;  1NK7 A;  2YNI A;  3LP2 A;  3LP0 A;  3QES A;  4BDP A;  1RTH A;  2XRI A;  1LW0 A;  4CEB A;  1ZYQ A;  2QKB A;  4AHV A;  3HXM A;  2ITG A;  4HUG A;  3HT3 A;  3RMA A;  2IC3 A;  3KIO A;  4PWD A;  3DLE A;  3F9K A;  4LY7 A;  1NOY A;  5DMR A;  3NGI A;  4FJ7 A;  4OVL A;  3ULD A;  2PZS A;  4W5N A;  3U6F A;  2HHT A;  2W42 A;  3G0Z A;  1D9F A;  1Q9X A;  1QHT A;  1TKT A;  5HRP A;  5FRM A;  1B92 A;  1BQN A;  1S1V A;  4HVJ A;  1NK8 A;  1WNS A;  4BE0 A;  2B4J A;  4B9U A;  4KFB A;  4CK3 A;  4DU3 A;  3CM5 A;  2VG7 A;  2X6S A;  3OYI A;  5J2N A;  3K59 A;  2E4L A;  3VQ8 A;  3DRP A;  3KLI A;  4F4K A;  1IKW A;  3ZT3 A;  4B08 A;  1ASU A;  3MXJ A;  4DMN A;  4DF8 A;  3V81 A;  2OYQ A;  5J1E A;  4L8R B;  1CZ9 A;  3L3U A;  2ZD1 A;  4CGH A;  2HVI A;  1X9W A;  1NKC A;  3ZT4 A;  1BIZ A;  3SZ2 A;  4Z4H A;  1SL0 A;  3AVJ A;  1EKE A;  1JLG A;  1JLA A;  4FJ9 A;  3QEP A;  3SUO A;  3I0S A;  2WOM A;  3DMJ A;  4I9L A;  4C8K A;  3L2U A;  1WSI A;  3M8P A;  4FJG A;  2KFN A;  2B5J A;  4RW8 A;  5JS2 A;  3QNN A;  5C24 A;  3OVN A;  3VQA A;  4FLY A;  3PX6 A;  3D0P A;  4CJP A;  3SNN A;  3MXI A;  1RCH A;  4J2E A;  1W0H A;  4DTR A;  4E89 A;  3MEC A;  3SQ0 A;  1ITG A;  1BCM A;  4CFA A;  2X78 A;  4CEF A;  1SKS A;  5HRR A;  1J53 A;  3C95 A;  1TK5 A;  1NK5 A;  1DLO A;  4BE1 A;  1L3T A;  4BDZ A;  3QNO A;  4Z4C A;  4EZ9 A;  3V1R A;  3ZSW A;  5CZ1 A;  1MU2 A;  3IG1 A;  2YKN A;  3RRG A;  2KQ2 A;  2JGU A;  3EZ5 A;  4G1Q A;  3ZCM A;  1RIL A;  4CEE A;  3MXM A;  2P1J A;  2XY8 A;  1U47 A;  4KO0 A;  2VWK A;  1Z26 A;  2HB5 A;  4IDK A;  3KLE A;  4CHY A;  2G8F A;  3BGR A;  3HPH A;  1A5V A;  3QIP A;  4CF2 A;  3AVK A;  3QEV A;  1XI1 A;  4B8A B;  3SYZ A;  1UA0 A;  4M3U A;  3F73 A;  1X9M A;  1K6Y A;  3THV A;  1S1W A;  4ELU A;  4FZX C;  1NJX A;  3QIN A;  4Z0U A;  1O1W A;  4CGG A;  3L2Q A;  2DFE A;  2GV9 A;  3AVF A;  4OKJ A;  4KKO A;  1RT7 A;  4W5Q A;  2HHX A;  4FM2 A;  1G15 A;  3IAY A;  4DSJ A;  3AA5 X;  4LSL A;  3ZSQ A;  1I39 A;  2O4G A;  4E7K A;  4F2R A;  4H8K A;  2FC0 A;  1TV6 A;  1BIS A;  3HP9 A;  5J2Q A;  1HMV A;  2QKK A;  4JS5 A;  4K8Z A;  2QK9 A;  1BQM A;  3O4N A;  2IOC A;  3MED A;  3SCX A;  4F2S A;  4IG0 A;  3L3V A;  4RW4 A;  4DTU A;  1U04 A;  2JLE A;  3OY9 A;  4O0J A;  1HRH A;  3RWU A;  1A5X A;  3LDS A;  3C6T A;  2OA8 A;  3HST B;  3SQ2 A;  1BHL A;  4KHQ A;  1J54 A;  1VSE A;  4ELV A;  3QLH A;  1ZBH A;  3RR8 A;  2ATQ A;  3K57 A;  4F3O A;  2Z1I A;  2PYJ A;  1WAF A;  1C6V A;  3M8Q A;  4DTJ A;  3DLH A;  1RT6 A;  1KLM A;  4CJS A;  4E3S A;  2HHW A;  4YNQ A;  3IS9 A;  4CFB A;  2BAN A;  3K5M A;  4N47 A;  3VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...