3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
3I0SA 2OA8A 3SUPA 4F2SA 1FKOA 4FJ7A 3K2PA 4NYFA 2ATQA 2OZSA 1VSFA 4M45A 4CEDA 1FK9A 2VG7A 3D45A 4UQGA 4Z4EA 3CQ8A 4G1QA 4CJUA 4H8KA 3ZT2A 5SZTA 1JLGA 4AHCA 3K58A 1NJZA 2HMIA 1YT3A 1HMVA 3ZT4A 5C25A 4Z4GA 3OYEA 4HHTA 1LAVA 3IS9A 4FJ9A 4DS5A 4ICLA 3LDSA 3K5MA 1RT1A 4DFJA 2KTQA 1RDBA 4KI4A 4AHRA 4I7FA 1FKPA 2KQ2A 3P83D 3CG7A 4I2QA 1S6PA 1VSEA 4O0JA 1L3SA 2DTUA 3LP3A 2W42A 2XHBA 2KZZA 3ZSVA 1ZBFA 2IOCA 1RTDA 3ZSXA 4CFCA 1A5VA 2IGIA 3CM6A 3WNFA 4CF1A 4CJRA 2PZSA 2PYJA 4DTNA 4ZTJA 4AHSA 2B6AA 5I3UA 3DLKA 1SL1A 3MEDA 3V6DA 3AVMA 1HQEA 4M3RA 4CF2A 3NGIA 1GOAA 3MEEA 4CEAA 1C1CA 3LZJA 1D9DA 2PY5A 1IKVA 3FFIA 4I9LA 4CGGA 3L3VA 5HROA 3CFOA 4HCCA 3IRXA 3SV4A 4CJLA 4KTQA 4DG1A 1TL1A 2YNHA 3DLGA 3HVTA 4N56A 4FM0A 3NBPA 3L8BA 1BI4A 2D5RA 3OYNA 1J5OA 4E19A 2QKKA 3HJFA 1RTJA 1LAWA 1WSIA 5KRTA 5C24A 3AVAA 1KVCA 1S9EA 3ASMA 3K5OA 4OVLA 1QSYA 3SUOA 3C95A 3E01A 3OS0A 4OGEA 2HHTA 3V9ZA 1JXEA 1IH7A 1XWLA 5HRNA 2XY7A 4OJRA 3S3OA 5DK5A 3AA5X 3OYCA 1TVRA 2XY8A 2YHAA 3HT3A 3V9SA 2HVHA 2RKIA 2HNZA 3MAQA 1BGXT 4GW6A 3OYMA 3NE6A 4KFBA 4WE1A 3ZSQA 3VQ9A 3LWLA 3O3GA 4FLZA 3DLBA 4J2BA 1QS4A 1TKDA 4DSLA 3NHGA 2P5OA 4Q5VA 5CZ1A 3OS2A 1ASVA 2ITGA 2P1JA 4FLWA 4DQSA 2P5GA 3M8RA 4DSJA 3NH0A 4DTJA 2I5JA 4FZZA 3AO1A 3ULDA 1CXQA 3ZT0A 5J2PA 2X6SA 5CY4A 1BISA 4ID1A 4PQUA 5E41A 3PO4A 4CJTA 4DLEA 1BHLA 3AA2A 3M8QA 1QSSA 4C8MA 4B9SA 1I39A 4F4KA 1BIZA 5CYMA 2KFNA 4IBNA 4DS4A 1JLQA 3CFPA 1XC9A 4B08A 1WSEA 1TAUA 3G10A 3EY1A 3C6TA 1X1PA 3QINA 4JS4A 1JLAA 4B8AB 4Y1DA 1NK4A 4C8LA 2OZMA 2HB5A 4LSNA 1TK0A 1NK6A 1BIUA 3ZT3A 4K8XA 1LW2A 3HSTB 3L2WA 4RW6A 1U48A 4DF4A 3AO3A 3KKSA 1LV5A 1RT7A 2G8IA 2A1SA 3IG1A 3G0ZA 4FJGA 2EX3A 2IC3A 2G8UA 1UWBA 4PA1A 4QCLA 1CXUA 1BI4B 1IKWA 1SUQA 1RBRA 1NK5A 1NJWA 2JLEA 3OYBA 4C8KA 1GOCA 4ZHRA 1ZBLA 4MFBA 3RMDA 4Q0BA 5KGWA 3VN5A 1S5JA 2D0BA 1Q9YA 4FLXA 4BWMA 4FLUA 4E7LA 4FZYA 4M3ZA 1VSHA 3NCIA 3NF9A 1Y97A 1TKTA 4CHPA 3HPOA 3MXJA 3ZT1A 3EZ5A 4DFMA 1S1VA 1YTAA 5HBMA 1X9WA 1JXBA 1BQNA 2FBTA 2WONA 1HRHA 4GVMA 2HNDA 4CJVA 4E7KA 3QNOA 3SUNA 4LH5A 1U4BA 1KRPA 4KI6A 5C42A 4CK1A 3V4IA 1SV5A 4EZ6A 3NAEA 1QTMA 2P51A 3VQCA 3OYAA 5EU7A 4KHNA 3AVKA 1NK0A 4B9LA 2F8TA 4DFPA 5KTQA 3NH2A 4DTOA 4FJ8A 3VQPA 2QK9A 3VQBA 3KJVA 4DTMA 3SUQA 3VQ8A 4CHNA 3WNHA 3NFAA 1S9GA 1WSFA 2DFHA 3WNEA 3SQ2A 4JLHA 4DTSA 3DLEA 5J1EA 3HYFA 4R5PA 2YNGA 2XRIA 2YHBA 3HK2A 3WNGA 5HRRA 2KFZA 3NF8A 3NF6A 1RDAA 4RW9A 4Y1CA 1NOZA 1K6YA 2YV0X 1WLJA 4E7JA 3V9UA 3LAMA 4RW4A 2A1RA 4NCGA 4F3TA 2GV9A 1C0TA 3OYDA 1RBVA 1RTIA 1JL1A 1NK8A 2HHQA 4NCBA 2DFFA 3AVGA 3KIOA 3OVNA 1C0MA 3TAMA 2Z1IA 4CEOA 2NUBA 1RT2A 1WSJA 4FW2A 4IG3A 3F73A 4DLGA 5J2MA 4DWIA 4CGFA 1RT5A 4YFUA 3U6FA 1SL2A 3DMJA 1U04A 3L2UA 2GBZA 4B9NA 3AVNA 1RNHA 4FW1A 4CJFA 3LWMA 4CF9A 3LANA 3U3GA 1RILA 4FJXA 2X6NA 4LY7A 1XI1A 4KHWA 1QE1A 3SV3A 1L3TA 3VA3A 2Z1HA 1EKEA 3O3FA 1L5UA 4DSIA 3L3UA 1ASWA 4CJ3A 4IFVA 3M8SA 2B4JA 4ELTA 3ZSYA 3TARA 1XHXA 3NH1A 1YTUA 5J2NA 1LWCA 3RR7A 1VSJA 3PUFA 4FJJA 2D0CA 1C6VA 4OKEA 3DYAA 2HHWA 3QEWA 3V9XA 1UAXA 1HYZA 4ID5A 4M3UA 1D5AA 4I2PA 1CZBA 3S3NA 3KLIA 5HRPA 3OYGA 3KLGA 3SJJA 3O3HA 4ELVA 1NKCA 3DRRA 3IAYA 1EX4A 3HP6A 3CYMA 2VWJA 1D9FA 2BE2A 1VK0A 4CECA 4CIFA 3B6PA 3HM9A 1LWFA 3VQDA 4W5NA 1RTHA 4N47A 1WN7A 3MECA 1BCOA 3DOLA 3ZSWA 1EP4A 3TI0A 1T7PA 3NDKA 4CJPA 1ZYQA 4CF0A 3TAPA 4KO0A 1Q9XA 5CZ2A 4FJIA 1J9AA 5JS1A 4BE0A 1TL3A 3C94A 3AVIA 3DOKA 3QEIA 3OJSA 4M3YA 2QKBA 4M3XA 3AVFA 3V1RA 3OYLA 3V1OA 4NCAA 4KHSA 4CGDA 3QIOA 4CEQA 1REVA 4EZ9A 1IO2A 1ASUA 4H4MA 4KHQA 4FVMA 2Q3SA 3AA4A 4ZTFA 1NKBA 4J2EA 1KLMA 2Z1GA 4ELUA 4E89A 1U49A 2FBYA 4CF8A 3TAGA 1UA0A 1JLCA 2DFEA 3K5LA 2Y1IA 3SQ1A 4FJKA 4N41A 4NYNA 2RF2A 3ALYA 4O0IA 2OPPA 4CHOA 2OPSA 3TAEA 4IKFA 4CK3A 1ITGA 1S6QA 4CJSA 3QLHA 4FJNA 4CEBA 3HPHA 3HVRA 1S1WA 2RPIA 4W5RA 4KHUA 1QQCA 3KK2A 2E6MA 4RW8A 4CJEA 4DFKA 1WNSA 5HRSA 4KAZA 3O4NA 4OGCA 1NJXA 3VQ5A 3TWHA 3SQ4A 4MQ3A 1A5WA 1KVAA 4B9MA 3KD5E 1SKSA 1G15A 4BDYA 4KKOA 1F21A 3AO2A 4FLVA 3HO1A 3O4QA 3HP9A 2HVIA 4IG0A 3RR8A 3B6OA 4KRFA 3C6UA 3AVJA 3DLHA 4F8RA 1JLFA 3KK1A 3LALA 3K59A 1HNIA 4DQQA 1EETA 4OPJA 2ZD1A 3V1QA 3VQ4A 2G8WA 4KPYA 1HYSA 3DM2A 3QNNA 3LP2A 1WAFA 2IDOA 2E6LA 3OS1A 2G8KA 1SL0A 4K8ZA 3VQ7A 1TGOA 3F9KA 4CHYA 4BE1A 1RT4A 5KI6A 1KVBA 3SPZA 3S3MA 3AVHA 2HHUA 1BQMA 1VSIA 3HXMA 2X74A 4TSXA 3RTVA 4FLYA 4Z4FA 1JLBA 1EXQA 2LSNA 4GMJB 2F8SA 4FJ5A 3PO5A 3OYIA 4O55A 4OLAA 4CJQA 3T19A 1LWEA 2HNYA 1RBTA 3KKRA 3KLFA 1L3VA 1O1WA 1QSLA 4CK2A 2B5JA 3DLRA 4CFBA 1NK7A 1B9DA 4CJWA 1HYVA 1TV6A 2E4LA 3RMBA 2OPRA 1NKEA 4CEFA 1X9MA 3V9WA 4HUGA 3QEVA 1DTTA 4E7IA 4FJHA 3D0PA 1FXXA 2WOMA 4B9TA 1HJRA 1NJYA 3P5JA 1WSHA 3AA3A 3A2FA 3MXIA 3PX6A 4I9QA 2EHGA 1C1BA 3SI6A 1SKWA 1U47A 3KD1E 5K14A 4CFAA 3ITHA 2XO7A 3KK3A 4L8RB 4M42A 3DRPA 4KV8A 4B8CA 4DTRA 1XHZA 2OYQA 1JKHA 1RDCA 3NGYA 4FLTA 1KSPA 4B9UA 3AVCA 2VG5A 1BL3A 4BE2A 3CM5A 4DQPA 4CGJA 4M3WA 3I0RA 1S1UA 3PY8A 3H08A 3EYZA 4DSKA 2YNFA 4O4GA 1IKXA 3LP1A 4FJMA 4DQRA 1DTQA 4CJ4A 3LAKA 1IG9A 3QO9A 3RMAA 2G8VA 3TAFA 4HUEA 4PWDA 3BGRA 1TKXA 2RN2A 1J54A 2IAJA 4DTUA 3V81A 3QIPA 4B9VA 5D3GA 2IS3A 4BACA 4PY5A 4CGIA 1JL2A 3K57A 4KREA 4Z0UA 4YNQA 3ISNC 3ZSOA 2BDPA 1VRTA 5FRMA 5FROA 2HHVA 2ZE2A 3OYFA 3JYTA 3T3FA 4FK4A 3ZCMA 4AHTA 1MU2A 1UOCA 5I42A 4HUFA 4J2DA 1SKRA 1ZBIA 1X9SA 3SQ0A 3VQEA 1KTQA 3QETA 2YKNA 4FK0A 4CJKA 4M3TA 2ZQBA 3MEGA 2HW3A 2D0AA 1RDDA 3I8DA 4F2RA 4W5QA 3QEPA 1HPZA 3M8PA 4OKKA 3PX0A 4FXDA 4HVJA 2BANA 1VSMA 3DI6A 4JRPA 2XY5A 5KRSA 1UA1A 4E0DA 4DF8A 1VSDA 4QOZB 4KTWA 3QESA 4Z4CA 4N76A 1Q8IA 1YVUA 1Z26A 4DTXA 5SWMA 1T05A 1U45A 4CFDA 2O4GA 3BDPA 2KZMA 3OYKA 4KB0A 3NF7A 3L2RA 3AO4A 4FM2A 1QHTA 2JGUA 4OKJA 5JS2A 2QXFA 3SPYA 2HHXA 4AH9A 1RBUA 4FCYA 2VG6A 1LW0A 5HP1A 3TAQA 2PYLA 4DQIA 4KHYA 3SCXA 4CCHA 4O44A 4CE9A 2O4IA 3TANA 4CEEA 3OY9A 4DSFA 4HCBA 4F3OA 3U3YA 3RWUA 1N5YA 4DSEA 1W9HA 2X78A 4W5OA 3VQQA 2KW4A 2BGGA 3KLEA 1C1AA 4FK2A 1B92A 4J2AA 1TK5A 3P1GA 1Z25A 3S9HA 4IFYA 1BCMA 4BDPA 1JLEA 3AVLA 5DMRA 4OLBA 4Z4HA 4BDZA 4AILC 1KLNA 4FJLA 4IDKA 4E3SA 1CLQA 1VRUA 3SZ2A 4DU1A 3QEXA 4B3OA 1TAQA 4QAGA 4FYDA 3SYZA 3ZSRA 4E7HA 4CEZA 2VWKA 4RW7A 1I3AA 4BWJA 4CERA 4EP4A 3AV9A 4AHUA 3L2VA 1CZ9A 3RMCA 1D8YA 1S1TA 2FBXA 1HNVA 1C0UA 4CIEA 3LZIA 4DTPA 4KB1A 2F96A 4RG8A 1TK8A 1VSKA 3LPTA 4H4OA 3QERA 1KCFA 4FM1A 4JS5A 4DU3A 2Y1JA 1TKZA 3LP0A 4LH4A 4E1MA 2YKMA 1VSLA 2AJQA 3KTQA 3L2QA 2GUIA 4XIUA 3TABA 3AVBA 4HTUA 2R7YA 3MXMA 1W0HA 1T8EA 1NOYA 3PX4A 4CGHA 1RT3A 1R0AA 3AO5A 4DU4A 1B9FA 3SNNA 2DY4A 4LD0A 4OPKA 1KFSA 2OPQA 3NGZA 3OJUA 4M41A 4FZXC 2G8HA 1J53A 4CJ5A 1WAJA 3T1AA 1HQUA 4EP5A 3RRHA 4LSLA 2XY6A 5KGXA 4E1NA 3JSMA 4C8OA 4AHVA 5FDLA 4CESA 2Z1JA 1DLOA 1T03A 2HHSA 3VQAA 2FC0A 4DMNA 2YNIA 2FBVA 3LPUA 4CIGA 4Z4IA 1RT6A 1A5XA 3THVA 2ETJA 3HPGA 5HLFA 3UIQA 1NK9A 3KLHA 4CHQA 4C8NA 3PV8A 1ZBUA 4N5SA 5CYQA 4JRQA 1ZBHA 3DRSA 4KTZA 3HL8A 5T7BA 4O5BA 1WSGA 5FRNA 4CHZA 3OYJA 3ZSZA 3CFRA 3VA0A 1RCHA 1KFDA 1N6QA 2G8FA 5J2QA 3RRGA 4PUOA 3K5NA 1GOBA 1RBSA 1L3UA 1IKYA 4W5TA 1S1XA 3VQ6A 3OYHA 3TR8A
chains in the Genus database with same CATH superfamily
4A2AA 1P8ZA 4JD2B 2VYPA 1VSFA 5B8HA 3PSIA 1H1VA 4CJUA 5SZTA 4CZEA 3K58A 1NJZA 2HMIA 4Z4GA 1YUWA 1HMVA 4QS9A 4HHTA 1LAVA 4FJ9A 3K5MA 2KTQA 3ATUA 4AHRA 1JCEA 4DV0K 3P83D 3VETA 3VGMA 5EY4A 1VSEA 4BQLA 4RTFD 2XHBA 2KZZA 3ZSVA 1ZBFA 1RTDA 4CFCA 2IGIA 2PYJA 4F9OA 2PZSA 2B6AA 4JKFA 5I3UA 1SL1A 5AFUA 3ZX3A 1GOAA 3CCSN 1YF5L 3QFPA 3RVCA 1IKVA 2YHYA 4O5FA 3CFOA 2ITMA 3IRXA 4HCCA 5BR9A 4H0OA 3HVTA 4DV6K 2P9IA 3NBPA 2V7YA 1EQYA 1J5OA 5BPLA 4E19A 2QM1A 1LAWA 5C24A 5E84A 1KVCA 3K5OA 1QSYA 3SUOA 1NMNA 4FPBA 1NJIO 2YHAA 4LF7K 3V9SA 2HVHA 1Z6RA 2QWRA 5AQRA 4KFBA 3NE6A 3GG4A 5AQYA 3VQ9A 3LWLA 2D1KA 5JICA 1QS4A 3DLBA 2HHHK 4CZJA 4JI2K 3OS2A 5CZ1A 1ASVA 2ITGA 5BPNA 4FLWA 5A2QO 3NH0A 3ULDA 4LC9B 4BR7A 4CJTA 3PO4A 5AZJB 3UKUB 3AA2A 1QSSA 5KPRA 4IBNA 2FF6A 4PKGA 2YHXA 4B08A 4JV5K 1WSEA 3QINA 3VERA 4PHTX 3K0SA 3FZFA 2FSKA 1T6CA 1TK0A 1BIUA 1LW2A 5FPNA 1K8KB 3L4QA 3H6EA 3IG1A 4FJGA 2W40A 2EX3A 2OTJN 4BROA 1NJWA 1GOCA 4H0YB 1VQPN 4NO7A 5LJWA 3D2FA 4JI1K 1VSHA 4BVOA 3UB5A 3IDHA 3ID8A 3EZ5A 2F7TA 3U9DA 1BU6O 1X9WA 1HKBA 4GVMA 3SUNA 2HNDA 4CJVA 4LH5A 3T1HK 4H5TA 5C42A 4EZ6A 2ZJRL 5M1OA 4B9QA 4WFBL 3NH2A 4ISGA 3VQBA 3KJVA 4CHNA 2QWMA 4B1UB 1S9GA 2NRWA 5AQUA 4JLHA 4DTSA 2YNGA 2YHBA 3WNGA 1NGFA 4UY8O 2KFZA 3NF8A 4ILHA 3N4PA 1NOZA 3WXIA 1WLJA 3V9UA 4F3TA 2GV9A 2HHQA 4K41A 4AM7A 1X9MA 2WFBA 2NUBA 4FW2A 4DWIA 1VQLN 4MLEA 1SL2A 1U04A 4BGBA 4YOWA 3U3GA 4NB4A 2X6NA 4GVEA 4KHWA 4DV2K 1SZ2A 3SAFA 2Z1HA 3D2FB 2I7PA 4ELTA 4GKKK 3ZSYA 5JVGL 1C6VA 1HYZA 4ID5A 1OH7A 3DXMB 4CBWA 1CZBA 3S3NA 5HRPA 3OYGA 4WF9L 4H0PA 3DRRA 1EX4A 2QWOA 3O9QA 3HI0A 3C65A 1T3VA 1IBMK 3VQDA 4N47A 4K43A 2O8CB 1BCOA 3TI0A 5F2RA 3I8BA 3NDKA 4CJPA 3NVMA 3RSEA 1OH5A 4CD1A 3C0BA 4H0TB 3C94A 3ZX2A 4M3YA 2QKBA 4KHSA 3V1OA 5CR4A 2F9TA 3CCEN 4BRKA 4EZ9A 4H5NA 4FVMA 3W0LA 2QWQA 4J2EA 1NBWA 2DPNA 3ZLJA 4N41A 4FJKA 3ALYA 1QQOA 4O0IA 4DR3K 1HR0K 5AR0A 3TAEA 1U2VB 4IZ9A 4FWKA 4FJNA 4CEBA 3MWTA 4YDUC 4CJEA 4KAZA 4FWLA 4A57A 4BRLA 3J8AA 3LDQA 2JWKA 4FWOA 1BUPA 4BR0A 3O80A 3HO1A 3O4QA 1Y64A 3RR8A 3P4IA 3TTFA 4KRFA 3C6UA 4ISEA 4BC5A 1JLFA 4OX9K 2ZD1A 3DM2A 4B3SK 3LP2A 2IDOA 1BOTO 3OS1A 3O08A 3VQ7A 3F9KA 1KVBA 3AVHA 3HXMA 1JLBA 2LSNA 4KH4A 3PO5A 4OLAA 3A5NC 1EO1A 1LWEA 2HNYA 4MDBA 1L3VA 4JN4A 1W97L 1BWFO 4CFBA 1VQ9N 1B9DA 3JAMO 4CEFA 4E7IA 4FJHA 3D0PA 1HJRA 3P5JA 3A2FA 3MXIA 1E3MA 1MWKA 4BRGA 1SKWA 5KQDA 3ITHA 3CD6N 3J7YP 3DRPA 4FLTA 3ZETA 4ISFA 5CHIA 4A61A 3TPQA 4CGJA 3O6WA 1IKXA 4DQRA 3IFRA 1I94K 3QO9A 3M5RA 4HUEA 1VQ6N 4PWDA 4FL9A 3THYA 2IAJA 3V81A 4CGIA 4Z0UA 4YNQA 5FRMA 2QWNA 3JYTA 5M1PA 3CI5A 4DHYA 3KWGA 3TSUA 3VQEA 3QETA 4FK0A 4CJ7A 4B3MK 4DR4K 2ZQBA 3MEGA 2D0AA 5JLFA 1RDDA 4W5QA 4JKAA 1HPZA 3M8PA 3PX0A 2NNWA 5KRSA 1VSDA 2W6KA 4QOZB 3E9OA 3PLAA 1V4SA 4WYBA 4WFAL 3N4QA 4DTXA 2P9LA 1GLBG 2O4GA 5AQIA 4BRCA 4CFDA 3BDPA 2KZMA 2FLOA 2UUAK 4FVUA 2JGUA 4NLCA 4AH9A 4RWTA 4FCYA 2VG6A 5HP1A 2PYLA 4DQIA 4CCHA 5AQGA 3ZETB 3CF5L 4HCBA 4F3OA 3O9RA 2BGGA 3VQQA 4JI5K 3KLEA 2QA4N 1TK5A 4X62K 3S9HA 5GAEP 4KHPK 3AVLA 4Z4HA 4AILC 3THXB 4X66K 1CLQA 1OH6A 4B3OA 2EWSA 3MN5A 1I3AA 5AJ3K 3SAHA 4DTPA 1C0UA 4KB1A 4DU3A 4YHHK 1TKZA 4CZKA 3LP0A 4LH4A 4E1MA 3FZMA 1VQKN 2GUIA 3TABA 1WBDA 4HTUA 1NOYA 1R0AA 4DU4A 4AM6A 1B9FA 2H3GX 1NGBA 4LD0A 3NGZA 3OJUA 2G8HA 4CJ5A 1WAJA 2NLXA 4AHVA 2P9SA 2YNIA 3LPUA 4M7YA 1RT6A 5GAHP 5AQNA 4PL8A 3CJAA 3HPGA 3WT0A 3KLHA 3VEYA 4C8NA 3PV8A 1ZBUA 4JRQA 4DV7K 3DRSA 3FE1A 3OBYA 1KAYA 5FRNA 3VA0A 1N6QA 2UUBK 2ZJQL 3RRGA 4PUOA 5J2QA 1RBSA 5C10A 3CXCM 1S1XA 5BN8A 3C6AA 4LF8K 3TR8A 3I0SA 2OA8A 3WQTA 4IJAA 4FJ7A 3K2PA 3VTIA 1QHAA 4M45A 1Q7YO 3CQ8A 1JCGA 1YT3A 3TTDA 3IS9A 4DS5A 3CETA 4KBOA 4DFJA 3WQUA 4I7FA 4DCHA 1V4TA 3CG7A 5AQLA 1S6PA 5BPMA 1L3SA 2QEXN 3ZSXA 5AQQA 3WNFA 4DTNA 1SQKA 2WBNA 3DLKA 3MEDA 3AVMA 4J8FA 3NGIA 1ZC6A 5AQPA 1GLDG 3CJ1A 4DG1A 3DLGA 3J81O 4N56A 3EN9A 2GELA 2RHKA 1RTJA 3THWB 1TYQA 4OVLA 3C95A 3OS0A 2HF3A 2A40A 1KC8O 3V9ZA 2XY7A 2ZGYA 3S3OA 3AA5X 1TVRA 3HT3A 2I7NA 3MAQA 3ULEA 3OYMA 5AZIA 3O3GA 4FLZA 5I9EB 4DSLA 2P5OA 1RGIA 3ZEUA 3BZCA 4DSJA 4DTJA 2X6SA 4ILGB 1BISA 2O8DB 4JD2A 4PQUA 4DLEA 1X3NA 1BHLA 2ASOA 2IIRA 4YOYA 1BIZA 5CYMA 3T7ZA 1JLQA 3WXLA 4U7BA 3EY1A 2WC9A 4NLBA 1IJJA 1JLAA 3WXKA 4B8AB 4LSNA 1NK6A 4K8XA 3M1FA 2P9NA 3MN9A 4DF4A 1LV5A 1UWBA 4BRDA 3A8YA 1SUQA 1RBRA 2JLEA 4ZHRA 1ZBLA 1S22A 5GINA 4MFBA 2Q36A 1S5JA 5JMVA 4BWMA 3D7EO 4L3QA 1RDUA 1XMQK 1J5EK 4C23A 1TKTA 3LDNA 3LM9A 4DFMA 1S1VA 3O1WA 2WONA 2FBTA 5TKWA 4BC4A 4B1WB 5BRHA 1U4BA 2HF4A 2ASMA 1KRPA 3FLCO 3R3LA 3NAEA 3CERA 5EU7A 3ZEUB 1XQSC 4WQ4C 4Y0WA 4DFPA 3H45C 5AQVA 3M6GA 2KKZA 3J80O 2YJFA 4R5PA 3HK2A 4RW9A 2BH1A 3L0QA 3MMVA 3TTCA 3LAMA 3WXJA 4JKBA 1C0TA 3ENBA 3A0IX 1JL1A 5GAGP 3AVGA 3OVNA 3TAMA 1C0MA 4BRHA 3AGKA 1WSJA 4DLGA 5J2MA 4CGFA 4WFNL 2P9NB 1N8RO 4WQ5A 5AZJA 3UKUA 3L2UA 4LF4K 4CJFA 2KHOA 2E2NA 1GLFO 2GEMA 3D2EA 3UE5A 1XI1A 2QWLA 4QS7A 1W2BM 5C2DA 1EKEA 1L5UA 4DSIA 3L3UA 4IFVA 2B4JA 1K8KA 4YDUA 1XHXA 2O8FA 3RR7A 3PUFA 2D0CA 1D4XA 1QZ6A 4LFAK 2O8BB 4PKHA 3O3HA 2VWJA 2BE2A 1VK0A 4CIFA 5F0XA 2CGJA 4A2BA 3R9PA 1N33K 5CE3A 1Q81O 4ILJA 3DOLA 1SAZA 3P38A 4CF0A 3H46O 4KO0A 5CZ2A 5JS1A 3OJSA 4BR4A 1EWQA 3QIOA 4BRIA 4CBXA 1REVA 3MX2A 1ASUA 2Q3SA 3CQYA 4ZTFA 4YOUA 2Z1GA 2A5XA 4CF8A 1JLCA 4C1NK 4IOXA 2Y1IA 3D2EB 3VF2A 4JK9A 2D4WA 2QTDA 1S1WA 2O8FB 3GE1A 4RW8A 1JJ2M 1WNSA 2YX6A 4H0VB 4OGCA 3VQ5A 3TWHA 4MQ3A 1A5WA 3KD5E 4BDYA 1Z05A 2NRVA 1OVQA 3HP9A 4IG0A 3NMUA 3B6OA 3AVJA 3K59A 3LALA 4OPJA 3VQ4A 4AQYK 2E6LA 3DXMA 3MWPA 3VF6A 4K8ZA 2AA4A 3JS6A 4CHYA 4BE1A 5KI6A 1BQMA 3RTVA 4JI3K 4Z4FA 3B8AX 2ASPA 4FJ5A 3OYIA 4O55A 1EWRA 3T19A 2O8CA 3KLFA 5JLHA 3IKMA 2B5JA 1YIJN 1XMOK 2PFUA 1TV6A 2E4LA 3KVGA 1DTTA 3CCLN 1FXXA 1WSHA 2CGKA 3PX6A 4JK8A 2ZF5O 4I9QA 2UU9K 1C1BA 5K14A 1YVNA 5C15A 4KV8A 2WTUA 1NWKA 3HM8A 4B8CA 1O13A 4B9UA 3AVCA 4BRPA 2WUSA 3I0RA 3H08A 1U2VA 3E66A 1DTQA 3RMAA 4CZFA 3G25A 2G8VA 2JWLA 1TKXA 1J54A 2IS3A 3CCJN 4GY2B 3K57A 3U9ZA 3VTHA 1VRTA 2P9UA 4BG8A 2ZE2A 1XC3A 3T3FA 4DV3K 3VESA 4FK4A 1MU2A 5I42A 1SKRA 3EL2A 3SQ0A 5AFUH 4JKGB 3K9KA 1BG3A 2HW3A 1MDUB 3F5TA 3J7AP 4F2RA 3QEPA 2P9PA 4OKKA 3VPZA 2BANA 1XNRK 1VSMA 2XY5A 3CCQN 4CD3A 4BRNA 4KTWA 3QESA 1Q86O 3VEXA 1T05A 1NGEA 4EHUA 3AO4A 4FM2A 3BEXA 3O9SA 4OKJA 2QXFA 5JS2A 4WQ5C 4KHYA 4CE9A 2E2OA 3TANA 1NM1A 3ENHA 5F1XA 3HBTA 3U3YA 1W9HA 2KW4A 1C1AA 4IFYA 1BCMA 3EZWA 4XEIA 3MX5A 5DMRA 1E4FT 5IT9O 4DU1A 3QEXA 4QAGA 4BR5A 3ZSRA 4CEZA 2VWKA 2P9UB 1VQNN 4PY5A 3AV9A 3L2VA 3RMCA 1D8YA 3Q7CA 2YJEA 2P9KB 1KCFA 3EKUA 4JS5A 3CPWM 3FZLA 2Q97A 3Q7BA 2AJQA 3CC4N 1HNXK 3AVBA 3PX4A 2P9PB 1RT3A 2W41A 5BRDA 3SNNA 1LCUA 2OPQA 3LL3A 1Q82O 4V19S 4JKEA 5KGXA 3JSMA 4C8OA 4JHDB 5FDLA 2HHSA 4GV6A 4DR1K 3EKSA 2FBVA 4CIGA 4Z4IA 2A6AA 2ETJA 4FPAA 1VQ5N 1MWMA 1T6DA 5CYQA 1ZBHA 4A5BA 4KTZA 1BA0A 4CHZA 3OYJA 3QDKA 1KFDA 3WUHA 1GOBA 2E8AA 1IKYA 4DKWA 3OYHA 3VQ6A 3QFUA 3VF4A 5AQZA 3SUPA 3OW2M 1FKOA 2ATQA 1P90A 4CEDA 1FK9A 4JKDA 2ZJPL 4Z4EA 4G1QA 4H8KA 3ZT2A 1JLGA 3U8XA 3ZT4A 3MN7A 3R1XA 2BUPA 3OYEA 3MN6A 4ICLA 5EX5A 1RDBA 4KI4A 1NNEA 4YY3K 2KQ2A 4I2QA 4O0JA 3SAGA 3THXA 2HBMA 1BDGA 1A5VA 3CM6A 4CF1A 4DR5K 4AHSA 3V6DA 3TSQA 1S3XA 4M3RA 3BUZB 3GL1A 5FLXO 3MEEA 4CEAA 1C1CA 3TU5A 4NXMK 4B3TK 3C7NB 3LZJA 3GOIA 1XNQK 3VGLA 3ENOA 4CVNE 1X9JA 3L3VA 3CCRN 3WXMB 3SV4A 1VQMN 5H1SQ 1TL1A 3L8BA 2D5RA 3OYNA 2QKKA 1WSIA 4BGAA 2OTLN 1IV0A 4JEPA 4XH4A 2HHTA 4OGEA 2VGMA 1IH7A 1XWLA 5HRNA 4KH5A 5DK5A 1TUUA 3CJ7A 5LJVA 3FZHA 1BGXT 4GW6A 4DUYK 3BF1A 4WQ4A 3QMLA 3O8MA 2V52B 3SMPA 5GIOA 5EOYA 4OPHA 3BF3A 4DQSA 2P5GA 4JYAK 3M8RA 1ESVA 3CJBA 4FZZA 2I5JA 4DV1K 5J2PA 5CY4A 5EXWA 5AQOA 3DAWA 2HOEA 3M8QA 3I56N 4C8MA 3ZX0A 4F4KA 4CI6A 5AQXA 4DS4A 2YI1A 3SJHA 1WOQA 3G10A 3C6TA 4JS4A 1NK4A 4C8LA 2HB5A 3ZT3A 3HSTB 3L2WA 4RW6A 1HKCA 5FPEA 3KKSA 2A1SA 4EFHA 4JI7K 4HWIA 4QCLA 1IKWA 5AQHA 1NK5A 3G6EN 3OYBA 4C8KA 1RFQA 2D0BA 3VN5A 1Q9YA 4EAHD 4FLUA 5LL6Z 4FZYA 3CHWA 3ZT1A 3CQXA 1BQNA 4E7KA 3QNOA 2V7ZA 3UKRB 1DKGD 3V4IA 1SV5A 3THWA 2P51A 3OYAA 4KHNA 3CJCA 3AVKA 4BRFA 1NK0A 1IBLK 2F8TA 5ELZA 5KPTA 1G99A 4DTOA 4FJ8A 5FPMA 3SUQA 2DFHA 3WNEA 3SQ2A 5J1EA 2XRIA 1HKGA 5ADXH 1RDAA 1K6YA 2A1RA 4RW4A 4NCGA 4IEEA 3OYDA 1RTIA 1NK8A 4NCBA 3P31A 2DFFA 4CEOA 3W3DA 2Z1IA 3DXKB 2O8DA 4IG3A 3SMSA 1RT5A 4YFUA 2IVPA 3U6FA 3DMJA 2GBZA 3HSCA 3TSPA 3AVNA 1RNHA 3LWMA 4CF9A 3E9LA 3DLLL 4LF5K 1ATSA 3SV3A 1L3TA 3QBXA 2RE2A 4CJ3A 4HTLA 2Q0UA 4FWSA 4B1YB 4IO8A 3BP8A 4IEIA 5J2NA 1LWCA 1VSJA 4OKEA 2HHWA 4DR6K 1UAXA 4I2PA 4CZIA 3KLIA 4ELVA 1NKCA 3PIOL 3ATVA 3HP6A 3CYMA 1D9FA 4BG9A 3SBTA 1LWFA 4W5NA 4FWMA 1RTHA 4DB3A 1WN7A 5KQ8A 1VQ7N 3AAQA 4FWNA 1EP4A 3VOVA 4A5AA 4O8UA 1Q9XA 4FJIA 1J9AA 1TL3A 3DOKA 3AVIA 3QEIA 4H5VA 3V1RA 4CZLA 4NCAA 1W7AA 3A5OC 3E1YA 3SLCA 1IO2A 4KHQA 1GLJO 1KLMA 1NG9A 4ELUA 4E89A 5BR8K 5IWAK 3TAGA 1UA0A 3K5LA 1OKJA 2OPPA 1J6ZA 2NRXA 3QLHA 1TUYA 1NGJA 4JKCA 4KHUA 4W5RA 1OVYA 1QQCA 3KK2A 2E6MA 3AY9A 4DFKA 1NJXA 3SQ4A 5M1NA 4B9MA 1YI2N 1G15A 2VCPA 4M63C 1FW6A 5E26A 4CZHA 4BRMA 3DLHA 4F8RA 1ATRA 3FFKB 3PSFA 4E1JA 2G8WA 1HYSA 3QNNA 2O8BA 3D6RA 1TGOA 3SPZA 3S3MA 4BC2A 2HHUA 3A5LC 1VSIA 4TSXA 2F8SA 2F9WA 3H1VX 3J7ZO 2E2PA 3KKRA 1QSLA 1O1WA 2Q31A 1HJOA 4DQ8A 1NK7A 1VQ4N 1HYVA 3RMBA 3EE9A 4EHTA 3V9WA 3QEVA 2QW9A 2WOMA 3LDLA 4GKJK 1YJNN 2EHGA 3KD1E 2XO7A 2D0OA 4L8RB 1YJWN 1XHZA 3ZYYX 2VG5A 1BL3A 4BE2A 4M3WA 3FR0A 4IDHA 2YNFA 4O4GA 2UXDK 5LMUK 1NLVA 3I55N 3VEWA 4FO0A 2NRZA 2FXUA 3BGRA 4DTUA 5AQSA 1JL2A 1NMDA 3ISNC 3ZSOA 2BDPA 3BZKA 4KH6A 5FROA 2PAVA 5AQJA 1K73O 2IVOA 2O8EA 2E20A 4AHTA 3H3NO 1UOCA 5AQFA 4HUFA 4J2DA 1X9SA 5GIPA 2YKNA 4MO5A 4CJKA 4XH1A 4YOVA 4BY9C 1DT9A 4FXDA 2NRRA 4HVJA 1KXPA 4JRPA 1UA1A 3OA9A 1YVUA 5C2FA 4FWRA 3QICA 5SWMA 2A42A 1QQMA 1OH8A 3OYKA 3L2RA 3SPYA 1QHTA 2HHXA 3TAQA 4O44A 4CEEA 3OY9A 4AF1A 4DSFA 4GV9A 4MLHA 1HUXA 4JI6K 3M3ZA 4FK2A 1JLEA 1NGGA 4E3SA 1WBBA 1VRUA 4FYDA 3OBWA 4X65K 3FZKA 4RW7A 4BWJA 4BQZA 1CZ9A 3LZIA 1HNVA 2O8EB 4CIEA 2F96A 4RG8A 3LM2A 2CGLA 4H4OA 2Y1JA 4FM1A 4CZGA 1C0FA 1S72N 2E5LK 4DR2K 1W0HA 1T8EA 5AQWA 2P9IB 3AO5A 2DY4A 1KQSM 4YOXA 4M41A 2VGNA 4FZXC 4EP5A 3T1AA 3RRHA 4LSLA 3OTOK 4E1NA 4JKGA 3O9UA 4OO1J 4CESA 4CW7B 3VQAA 2FC0A 1FJGK 1A5XA 4A59A 2VQEK 3THVA 5MLCQ 4BRAA 3UIQA 1NK9A 1ATNA 4N5SA 1RDWX 5T7BA 4O5BA 2G8FA 1RCHA 3KWIA 1L3UA 2NRTA 2HBLA 2E88A 4F2SA 4NYFA 2OZSA 4UQGA 2VG7A 3D45A 1HNZK 3VEOA 4AHCA 5C25A 3S41A 3CCVN 3LDSA 1RT1A 2FF3B 3MCAB 4DV4K 3L6QA 1FKPA 2OANA 4XH5A 2DTUA 5C0YA 3LP3A 2W42A 4H0XB 1YJ9N 2IOCA 4G9ZA 2QI2A 4CJRA 4ZTJA 5DM6L 4FSVA 2P9KA 1HQEA 4CF2A 1E4GT 1U6ZA 3IMXA 2ZWHA 1D9DA 2YHWA 2PY5A 3FFIA 4I9LA 4YORA 4CGGA 5HROA 5KPZA 4KTQA 4CJLA 2YNHA 2UUCK 4FM0A 1BI4A 2V51B 3HJFA 5KRTA 3NVKA 3AVAA 1S9EA 3ASMA 3E01A 1JXEA 4OJRA 3OYCA 4FWPA 2XY8A 3C6HA 4JHDA 2RKIA 2HNZA 4WE1A 3ZSQA 5TKYA 1K8AO 4BRQA 3O1BA 4J2BA 1TKDA 4BVPA 3NHGA 4Q5VA 4PL7A 4X64K 2P1JA 2E1YA 3AO1A 1N34K 1CXQA 3ZT0A 3O5BA 4ID1A 5E41A 1Q18A 3GDQA 4B9SA 1I39A 2KFNA 2UYTA 3CFPA 1YITN 1XC9A 3GBTA 3DJCA 1TAUA 1X1PA 2Q0RA 4Y1DA 2OZMA 5M1KA 1U48A 2UXCK 1C0GA 1VAZA 3AO3A 1RT7A 2G8IA 3G0ZA 3VEZA 2IC3A 4DUZK 2G8UA 4PA1A 1CXUA 1BI4B 4JI0K 4DR7K 3RMDA 4Q0BA 1GLLO 2FSNA 5KGWA 4FLXA 4M3ZA 4E7LA 3JXUA 3C7NA 3NCIA 4LF9K 1N32K 3NF9A 1Y97A 4IOCL 4CHPA 3HPOA 3MXJA 1YTAA 2BTFA 5HBMA 1JXBA 5BREA 2GWJA 4K0KK 1HRHA 2VWBA 4KI6A 3FGUA 4CK1A 2GX9A 3RSEB 4FOEA 1QTMA 3VQCA 4B9LA 1HNWK 5KTQA 3HZ6A 3VQPA 2QK9A 4DTMA 3VQ8A 3WNHA 3NFAA 1WSFA 3U4LA 3CC2N 1SS6A 5ADXA 3DLEA 4LF6K 3HYFA 2GTDA 3CPEA 5HRRA 3NF6A 4Y1CA 2YV0X 4E7JA 5DM7L 3KK7A 1QQNA 1BA1A 1VQ8N 1RBVA 3KIOA 4B3RK 3F73A 1RT2A 4QS8A 2OCEA 4JK7A 4Z94A 4B9NA 3G71N 4FW1A 5HL7L 3LANA 1RILA 4FJXA 3E9PA 4LY7A 1BO5O 1QE1A 1VHXA 4LFCK 3A5MC 5GADP 3VA3A 4H5RA 3O3FA 2F4VK 1ASWA 3M8SA 2E2QA 3TARA 1WUAA 3NH1A 4CZMA 1YTUA 3O4WA 3CCUN 4FJJA 2A3ZA 3DYAA 4JAXA 1IG8A 4K42A 3QEWA 1GLAG 3IUCA 3VENA 3V9XA 4A62A 4M3UA 1D5AA 2Q1NA 4B1VA 3KLGA 3AAPA 4JKHA 1ZXOA 3SJJA 1HPMA 3IAYA 4K25A 2VQFK 4B1ZA 4CECA 3B6PA 3HM9A 2GUPA 3MECA 3UKRA 3ZSWA 1IBKK 1T7PA 1ZYQA 3TAPA 4JI4K 5M1FA 4BE0A 1K9MO 4OPAA 4M3XA 3LDOA 3AVFA 1XUPO 3OYLA 3SBGA 3DWLA 4CGDA 4CEQA 3MCPA 2ZM6K 3T69A 4FWQA 2CH5A 3ID6A 4H4MA 3AA4A 1NKBA 3CMEN 1U49A 2FBYA 1QVFM 2DFEA 3VGKA 3SQ1A 5AQTA 4NYNA 2RF2A 1MA9B 2YCHA 4EIAA 4CHOA 2OPSA 4IKFA 4CK3A 3CC7N 3DXKA 1ITGA 1S6QA 1KAZA 4CJSA 3HPHA 1NU0A 4BR2A 3HVRA 2RPIA 5LY3A 3THYB 4IOAL 5HRSA 1ILYA 3O4NA 1YAGA 3WEEA 1KVAA 1SKSA 5EVZA 4KKOA 1F21A 3AO2A 4FLVA 4JI8K 2HVIA 1NGCA 2HMPA 1HX1A 1N36K 4LFBK 3KK1A 4DQQA 1HNIA 2FSJA 1EETA 2QXLA 4FOIA 1YXQA 3V1QA 4KPYA 3VEVA 2HBJA 1WAFA 2G8KA 1SL0A 5C12A 4R79A 1RT4A 4BREA 1WB9A 2X74A 2A41A 4C1NI 4FLYA 1EXQA 4NXNK 4GMJB 3P39A 4CJQA 1R59O 1RBTA 2P9LB 4CK2A 3DLRA 3H1QA 3OHRA 1T44A 1GLEG 4CJWA 1NKEA 2OPRA 1NGIA 4HUGA 4B9TA 1M90O 4IWVA 3R8EA 5BRFA 1NJYA 3AA3A 2Q2RA 4DV5K 2IVNA 3SI6A 1U47A 4CFAA 3KK3A 4MDAA 4M42A 3EEQA 4DTRA 3EO3A 1JKHA 1RDCA 3EE8A 3NGYA 3WEEB 1KSPA 4H5WA 2OYQA 1X3MA 3CM5A 3QB0A 1S1UA 3PY8A 4DSKA 3EYZA 4FJMA 3LP1A 4GV3A 1DEJA 4BC3A 4CJ4A 2J4RA 3LAKA 3MDQA 1IG9A 3CMAN 2UXBK 3TAFA 2HSTA 3CIPA 4B9VA 3L4IA 2RN2A 2NRHA 3QIPA 5D3GA 1VQON 4BACA 3HOTA 4KREA 3KHYA 2HHVA 2E1ZA 3OYFA 3ZCMA 4RCHA 1ZBIA 1KTQA 1GLCG 3CJ9A 2P9SB 4M3TA 4WCEL 1DGKN 1LOTB 2NZTA 3I8DA 4GNIA 3MK6A 3T1YK 1JCFA 3DI6A 3AARA 4E0DA 3LDPA 1QZ5A 3K9JA 4DF8A 4Z4CA 4N76A 2CH6A 1Q8IA 1Z26A 3VMFB 3HOSA 1U45A 1CZAN 3NF7A 4KB0A 1HLUA 1RBUA 1LW0A 3F2KA 4PKIA 3SCXA 2O4IA 3R6MA 4I6MA 3RWUA 1N5YA 4DSEA 2X78A 4W5OA 1KD1O 2KLAA 1B92A 4J2AA 3HTVA 4U67L 3P1GA 1Z25A 4BDPA 4B1XB 2QWPA 4JNEA 4OLBA 4O8KA 4BDZA 1KLNA 1NGHA 2PBDA 4FJLA 4IDKA 3HRGA 3SZ2A 5FPDA 1TAQA 3SYZA 3PIPL 3H3OB 4E7HA 2W6LA 4IFEA 4CERA 4EP4A 1M1KO 4AHUA 3CCMN 1S1TA 2FBXA 2HBKA 1KAXA 5JVHL 1NGDA 3G4SN 1YHQN 1TK8A 1VSKA 3LPTA 5AQKA 4CBUA 3QERA 5HOOA 2YKMA 4IJNA 1VSLA 3KTQA 3L2QA 3I33A 4XIUA 4H03B 2R7YA 3MXMA 5LMNK 4CGHA 3O9TA 5M1QA 4M7XA 4OPKA 1KFSA 1TYQB 2AP1A 4DQPA 1J53A 3F9MA 1HQUA 4YOTA 2XY6A 4IO9L 1T03A 2Z1JA 1DLOA 5BN9A 4DMNA 4BR9A 2D0PA 3ULEB 5AZIB 5HLFA 4IXCA 4CHQA 1QVGM 1NGAA 5AQMA 3AGRA 3KZBA 3HL8A 2ZGZA 1WSGA 4I6MB 3CFRA 2GWKA 3SK3A 3QBWA 3ZSZA 3K5NA 4W5TA 3BY5A 4MO4A 1ZBSA
chains in the Genus database with same CATH topology
3I0SA 2OA8A 3SUPA 4F2SA 1FKOA 4FJ7A 3K2PA 4NYFA 2ATQA 2OZSA 1VSFA 4M45A 4CEDA 1FK9A 2VG7A 3D45A 4UQGA 4Z4EA 3CQ8A 4G1QA 4CJUA 4H8KA 3ZT2A 5SZTA 1JLGA 4AHCA 3K58A 1NJZA 2HMIA 1YT3A 1HMVA 3ZT4A 5C25A 4Z4GA 3OYEA 4HHTA 1LAVA 3IS9A 4FJ9A 4DS5A 4ICLA 3LDSA 3K5MA 1RT1A 4DFJA 2KTQA 1RDBA 4KI4A 4AHRA 4I7FA 1FKPA 2KQ2A 3P83D 3CG7A 4I2QA 1S6PA 1VSEA 4O0JA 1L3SA 2DTUA 3LP3A 2W42A 2XHBA 2KZZA 3ZSVA 1ZBFA 2IOCA 1RTDA 3ZSXA 4CFCA 1A5VA 2IGIA 3CM6A 3WNFA 4CF1A 4CJRA 2PZSA 2PYJA 4DTNA 4ZTJA 4AHSA 2B6AA 5I3UA 3DLKA 1SL1A 3MEDA 3V6DA 3AVMA 1HQEA 4M3RA 4CF2A 3NGIA 1GOAA 3MEEA 4CEAA 1C1CA 3LZJA 1D9DA 2PY5A 1IKVA 3FFIA 4I9LA 4CGGA 3L3VA 5HROA 3CFOA 4HCCA 3IRXA 3SV4A 4CJLA 4KTQA 4DG1A 1TL1A 2YNHA 3DLGA 3HVTA 4N56A 4FM0A 3NBPA 3L8BA 1BI4A 2D5RA 3OYNA 1J5OA 4E19A 2QKKA 3HJFA 1RTJA 1LAWA 1WSIA 5KRTA 5C24A 3AVAA 1KVCA 1S9EA 3ASMA 3K5OA 4OVLA 1QSYA 3SUOA 3C95A 3E01A 3OS0A 4OGEA 2HHTA 3V9ZA 1JXEA 1IH7A 1XWLA 5HRNA 2XY7A 4OJRA 3S3OA 5DK5A 3AA5X 3OYCA 1TVRA 2XY8A 2YHAA 3HT3A 3V9SA 2HVHA 2RKIA 2HNZA 3MAQA 1BGXT 4GW6A 3OYMA 3NE6A 4KFBA 4WE1A 3ZSQA 3VQ9A 3LWLA 3O3GA 4FLZA 3DLBA 4J2BA 1QS4A 1TKDA 4DSLA 3NHGA 2P5OA 4Q5VA 5CZ1A 3OS2A 1ASVA 2ITGA 2P1JA 4FLWA 4DQSA 2P5GA 3M8RA 4DSJA 3NH0A 4DTJA 2I5JA 4FZZA 3AO1A 3ULDA 1CXQA 3ZT0A 5J2PA 2X6SA 5CY4A 1BISA 4ID1A 4PQUA 5E41A 3PO4A 4CJTA 4DLEA 1BHLA 3AA2A 3M8QA 1QSSA 4C8MA 4B9SA 1I39A 4F4KA 1BIZA 5CYMA 2KFNA 4IBNA 4DS4A 1JLQA 3CFPA 1XC9A 4B08A 1WSEA 1TAUA 3G10A 3EY1A 3C6TA 1X1PA 3QINA 4JS4A 1JLAA 4B8AB 4Y1DA 1NK4A 4C8LA 2OZMA 2HB5A 4LSNA 1TK0A 1NK6A 1BIUA 3ZT3A 4K8XA 1LW2A 3HSTB 3L2WA 4RW6A 1U48A 4DF4A 3AO3A 3KKSA 1LV5A 1RT7A 2G8IA 2A1SA 3IG1A 3G0ZA 4FJGA 2EX3A 2IC3A 2G8UA 1UWBA 4PA1A 4QCLA 1CXUA 1BI4B 1IKWA 1SUQA 1RBRA 1NK5A 1NJWA 2JLEA 3OYBA 4C8KA 1GOCA 4ZHRA 1ZBLA 4MFBA 3RMDA 4Q0BA 5KGWA 3VN5A 1S5JA 2D0BA 1Q9YA 4FLXA 4BWMA 4FLUA 4E7LA 4FZYA 4M3ZA 1VSHA 3NCIA 3NF9A 1Y97A 1TKTA 4CHPA 3HPOA 3MXJA 3ZT1A 3EZ5A 4DFMA 1S1VA 1YTAA 5HBMA 1X9WA 1JXBA 1BQNA 2FBTA 2WONA 1HRHA 4GVMA 2HNDA 4CJVA 4E7KA 3QNOA 3SUNA 4LH5A 1U4BA 1KRPA 4KI6A 5C42A 4CK1A 3V4IA 1SV5A 4EZ6A 3NAEA 1QTMA 2P51A 3VQCA 3OYAA 5EU7A 4KHNA 3AVKA 1NK0A 4B9LA 2F8TA 4DFPA 5KTQA 3NH2A 4DTOA 4FJ8A 3VQPA 2QK9A 3VQBA 3KJVA 4DTMA 3SUQA 3VQ8A 4CHNA 3WNHA 3NFAA 1S9GA 1WSFA 2DFHA 3WNEA 3SQ2A 4JLHA 4DTSA 3DLEA 5J1EA 3HYFA 4R5PA 2YNGA 2XRIA 2YHBA 3HK2A 3WNGA 5HRRA 2KFZA 3NF8A 3NF6A 1RDAA 4RW9A 4Y1CA 1NOZA 1K6YA 2YV0X 1WLJA 4E7JA 3V9UA 3LAMA 4RW4A 2A1RA 4NCGA 4F3TA 2GV9A 1C0TA 3OYDA 1RBVA 1RTIA 1JL1A 1NK8A 2HHQA 4NCBA 2DFFA 3AVGA 3KIOA 3OVNA 1C0MA 3TAMA 2Z1IA 4CEOA 2NUBA 1RT2A 1WSJA 4FW2A 4IG3A 3F73A 4DLGA 5J2MA 4DWIA 4CGFA 1RT5A 4YFUA 3U6FA 1SL2A 3DMJA 1U04A 3L2UA 2GBZA 4B9NA 3AVNA 1RNHA 4FW1A 4CJFA 3LWMA 4CF9A 3LANA 3U3GA 1RILA 4FJXA 2X6NA 4LY7A 1XI1A 4KHWA 1QE1A 3SV3A 1L3TA 3VA3A 2Z1HA 1EKEA 3O3FA 1L5UA 4DSIA 3L3UA 1ASWA 4CJ3A 4IFVA 3M8SA 2B4JA 4ELTA 3ZSYA 3TARA 1XHXA 3NH1A 1YTUA 5J2NA 1LWCA 3RR7A 1VSJA 3PUFA 4FJJA 2D0CA 1C6VA 4OKEA 3DYAA 2HHWA 3QEWA 3V9XA 1UAXA 1HYZA 4ID5A 4M3UA 1D5AA 4I2PA 1CZBA 3S3NA 3KLIA 5HRPA 3OYGA 3KLGA 3SJJA 3O3HA 4ELVA 1NKCA 3DRRA 3IAYA 1EX4A 3HP6A 3CYMA 2VWJA 1D9FA 2BE2A 1VK0A 4CECA 4CIFA 3B6PA 3HM9A 1LWFA 3VQDA 4W5NA 1RTHA 4N47A 1WN7A 3MECA 1BCOA 3DOLA 3ZSWA 1EP4A 3TI0A 1T7PA 3NDKA 4CJPA 1ZYQA 4CF0A 3TAPA 4KO0A 1Q9XA 5CZ2A 4FJIA 1J9AA 5JS1A 4BE0A 1TL3A 3C94A 3AVIA 3DOKA 3QEIA 3OJSA 4M3YA 2QKBA 4M3XA 3AVFA 3V1RA 3OYLA 3V1OA 4NCAA 4KHSA 4CGDA 3QIOA 4CEQA 1REVA 4EZ9A 1IO2A 1ASUA 4H4MA 4KHQA 4FVMA 2Q3SA 3AA4A 4ZTFA 1NKBA 4J2EA 1KLMA 2Z1GA 4ELUA 4E89A 1U49A 2FBYA 4CF8A 3TAGA 1UA0A 1JLCA 2DFEA 3K5LA 2Y1IA 3SQ1A 4FJKA 4N41A 4NYNA 2RF2A 3ALYA 4O0IA 2OPPA 4CHOA 2OPSA 3TAEA 4IKFA 4CK3A 1ITGA 1S6QA 4CJSA 3QLHA 4FJNA 4CEBA 3HPHA 3HVRA 1S1WA 2RPIA 4W5RA 4KHUA 1QQCA 3KK2A 2E6MA 4RW8A 4CJEA 4DFKA 1WNSA 5HRSA 4KAZA 3O4NA 4OGCA 1NJXA 3VQ5A 3TWHA 3SQ4A 4MQ3A 1A5WA 1KVAA 4B9MA 3KD5E 1SKSA 1G15A 4BDYA 4KKOA 1F21A 3AO2A 4FLVA 3HO1A 3O4QA 3HP9A 2HVIA 4IG0A 3RR8A 3B6OA 4KRFA 3C6UA 3AVJA 3DLHA 4F8RA 1JLFA 3KK1A 3LALA 3K59A 1HNIA 4DQQA 1EETA 4OPJA 2ZD1A 3V1QA 3VQ4A 2G8WA 4KPYA 1HYSA 3DM2A 3QNNA 3LP2A 1WAFA 2IDOA 2E6LA 3OS1A 2G8KA 1SL0A 4K8ZA 3VQ7A 1TGOA 3F9KA 4CHYA 4BE1A 1RT4A 5KI6A 1KVBA 3SPZA 3S3MA 3AVHA 2HHUA 1BQMA 1VSIA 3HXMA 2X74A 4TSXA 3RTVA 4FLYA 4Z4FA 1JLBA 1EXQA 2LSNA 4GMJB 2F8SA 4FJ5A 3PO5A 3OYIA 4O55A 4OLAA 4CJQA 3T19A 1LWEA 2HNYA 1RBTA 3KKRA 3KLFA 1L3VA 1O1WA 1QSLA 4CK2A 2B5JA 3DLRA 4CFBA 1NK7A 1B9DA 4CJWA 1HYVA 1TV6A 2E4LA 3RMBA 2OPRA 1NKEA 4CEFA 1X9MA 3V9WA 4HUGA 3QEVA 1DTTA 4E7IA 4FJHA 3D0PA 1FXXA 2WOMA 4B9TA 1HJRA 1NJYA 3P5JA 1WSHA 3AA3A 3A2FA 3MXIA 3PX6A 4I9QA 2EHGA 1C1BA 3SI6A 1SKWA 1U47A 3KD1E 5K14A 4CFAA 3ITHA 2XO7A 3KK3A 4L8RB 4M42A 3DRPA 4KV8A 4B8CA 4DTRA 1XHZA 2OYQA 1JKHA 1RDCA 3NGYA 4FLTA 1KSPA 4B9UA 3AVCA 2VG5A 1BL3A 4BE2A 3CM5A 4DQPA 4CGJA 4M3WA 3I0RA 1S1UA 3PY8A 3H08A 3EYZA 4DSKA 2YNFA 4O4GA 1IKXA 3LP1A 4FJMA 4DQRA 1DTQA 4CJ4A 3LAKA 1IG9A 3QO9A 3RMAA 2G8VA 3TAFA 4HUEA 4PWDA 3BGRA 1TKXA 2RN2A 1J54A 2IAJA 4DTUA 3V81A 3QIPA 4B9VA 5D3GA 2IS3A 4BACA 4PY5A 4CGIA 1JL2A 3K57A 4KREA 4Z0UA 4YNQA 3ISNC 3ZSOA 2BDPA 1VRTA 5FRMA 5FROA 2HHVA 2ZE2A 3OYFA 3JYTA 3T3FA 4FK4A 3ZCMA 4AHTA 1MU2A 1UOCA 5I42A 4HUFA 4J2DA 1SKRA 1ZBIA 1X9SA 3SQ0A 3VQEA 1KTQA 3QETA 2YKNA 4FK0A 4CJKA 4M3TA 2ZQBA 3MEGA 2HW3A 2D0AA 1RDDA 3I8DA 4F2RA 4W5QA 3QEPA 1HPZA 3M8PA 4OKKA 3PX0A 4FXDA 4HVJA 2BANA 1VSMA 3DI6A 4JRPA 2XY5A 5KRSA 1UA1A 4E0DA 4DF8A 1VSDA 4QOZB 4KTWA 3QESA 4Z4CA 4N76A 1Q8IA 1YVUA 1Z26A 4DTXA 5SWMA 1T05A 1U45A 4CFDA 2O4GA 3BDPA 2KZMA 3OYKA 4KB0A 3NF7A 3L2RA 3AO4A 4FM2A 1QHTA 2JGUA 4OKJA 5JS2A 2QXFA 3SPYA 2HHXA 4AH9A 1RBUA 4FCYA 2VG6A 1LW0A 5HP1A 3TAQA 2PYLA 4DQIA 4KHYA 3SCXA 4CCHA 4O44A 4CE9A 2O4IA 3TANA 4CEEA 3OY9A 4DSFA 4HCBA 4F3OA 3U3YA 3RWUA 1N5YA 4DSEA 1W9HA 2X78A 4W5OA 3VQQA 2KW4A 2BGGA 3KLEA 1C1AA 4FK2A 1B92A 4J2AA 1TK5A 3P1GA 1Z25A 3S9HA 4IFYA 1BCMA 4BDPA 1JLEA 3AVLA 5DMRA 4OLBA 4Z4HA 4BDZA 4AILC 1KLNA 4FJLA 4IDKA 4E3SA 1CLQA 1VRUA 3SZ2A 4DU1A 3QEXA 4B3OA 1TAQA 4QAGA 4FYDA 3SYZA 3ZSRA 4E7HA 4CEZA 2VWKA 4RW7A 1I3AA 4BWJA 4CERA 4EP4A 3AV9A 4AHUA 3L2VA 1CZ9A 3RMCA 1D8YA 1S1TA 2FBXA 1HNVA 1C0UA 4CIEA 3LZIA 4DTPA 4KB1A 2F96A 4RG8A 1TK8A 1VSKA 3LPTA 4H4OA 3QERA 1KCFA 4FM1A 4JS5A 4DU3A 2Y1JA 1TKZA 3LP0A 4LH4A 4E1MA 2YKMA 1VSLA 2AJQA 3KTQA 3L2QA 2GUIA 4XIUA 3TABA 3AVBA 4HTUA 2R7YA 3MXMA 1W0HA 1T8EA 1NOYA 3PX4A 4CGHA 1RT3A 1R0AA 3AO5A 4DU4A 1B9FA 3SNNA 2DY4A 4LD0A 4OPKA 1KFSA 2OPQA 3NGZA 3OJUA 4M41A 4FZXC 2G8HA 1J53A 4CJ5A 1WAJA 3T1AA 1HQUA 4EP5A 3RRHA 4LSLA 2XY6A 5KGXA 4E1NA 3JSMA 4C8OA 4AHVA 5FDLA 4CESA 2Z1JA 1DLOA 1T03A 2HHSA 3VQAA 2FC0A 4DMNA 2YNIA 2FBVA 3LPUA 4CIGA 4Z4IA 1RT6A 1A5XA 3THVA 2ETJA 3HPGA 5HLFA 3UIQA 1NK9A 3KLHA 4CHQA 4C8NA 3PV8A 1ZBUA 4N5SA 5CYQA 4JRQA 1ZBHA 3DRSA 4KTZA 3HL8A 5T7BA 4O5BA 1WSGA 5FRNA 4CHZA 3OYJA 3ZSZA 3CFRA 3VA0A 1RCHA 1KFDA 1N6QA 2G8FA 5J2QA 3RRGA 4PUOA 3K5NA 1GOBA 1RBSA 1L3UA 1IKYA 4W5TA 1S1XA 3VQ6A 3OYHA 3TR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0S A;  2OA8 A;  3SUP A;  4F2S A;  1FKO A;  4FJ7 A;  3K2P A;  4NYF A;  2ATQ A;  2OZS A;  1VSF A;  4M45 A;  4CED A;  1FK9 A;  2VG7 A;  3D45 A;  4UQG A;  4Z4E A;  3CQ8 A;  4G1Q A;  4CJU A;  4H8K A;  3ZT2 A;  5SZT A;  1JLG A;  4AHC A;  3K58 A;  1NJZ A;  2HMI A;  1YT3 A;  1HMV A;  3ZT4 A;  5C25 A;  4Z4G A;  3OYE A;  4HHT A;  1LAV A;  3IS9 A;  4FJ9 A;  4DS5 A;  4ICL A;  3LDS A;  3K5M A;  1RT1 A;  4DFJ A;  2KTQ A;  1RDB A;  4KI4 A;  4AHR A;  4I7F A;  1FKP A;  2KQ2 A;  3P83 D;  3CG7 A;  4I2Q A;  1S6P A;  1VSE A;  4O0J A;  1L3S A;  2DTU A;  3LP3 A;  2W42 A;  2XHB A;  2KZZ A;  3ZSV A;  1ZBF A;  2IOC A;  1RTD A;  3ZSX A;  4CFC A;  1A5V A;  2IGI A;  3CM6 A;  3WNF A;  4CF1 A;  4CJR A;  2PZS A;  2PYJ A;  4DTN A;  4ZTJ A;  4AHS A;  2B6A A;  5I3U A;  3DLK A;  1SL1 A;  3MED A;  3V6D A;  3AVM A;  1HQE A;  4M3R A;  4CF2 A;  3NGI A;  1GOA A;  3MEE A;  4CEA A;  1C1C A;  3LZJ A;  1D9D A;  2PY5 A;  1IKV A;  3FFI A;  4I9L A;  4CGG A;  3L3V A;  5HRO A;  3CFO A;  4HCC A;  3IRX A;  3SV4 A;  4CJL A;  4KTQ A;  4DG1 A;  1TL1 A;  2YNH A;  3DLG A;  3HVT A;  4N56 A;  4FM0 A;  3NBP A;  3L8B A;  1BI4 A;  2D5R A;  3OYN A;  1J5O A;  4E19 A;  2QKK A;  3HJF A;  1RTJ A;  1LAW A;  1WSI A;  5KRT A;  5C24 A;  3AVA A;  1KVC A;  1S9E A;  3ASM A;  3K5O A;  4OVL A;  1QSY A;  3SUO A;  3C95 A;  3E01 A;  3OS0 A;  4OGE A;  2HHT A;  3V9Z A;  1JXE A;  1IH7 A;  1XWL A;  5HRN A;  2XY7 A;  4OJR A;  3S3O A;  5DK5 A;  3AA5 X;  3OYC A;  1TVR A;  2XY8 A;  2YHA A;  3HT3 A;  3V9S A;  2HVH A;  2RKI A;  2HNZ A;  3MAQ A;  1BGX T;  4GW6 A;  3OYM A;  3NE6 A;  4KFB A;  4WE1 A;  3ZSQ A;  3VQ9 A;  3LWL A;  3O3G A;  4FLZ A;  3DLB A;  4J2B A;  1QS4 A;  1TKD A;  4DSL A;  3NHG A;  2P5O A;  4Q5V A;  5CZ1 A;  3OS2 A;  1ASV A;  2ITG A;  2P1J A;  4FLW A;  4DQS A;  2P5G A;  3M8R A;  4DSJ A;  3NH0 A;  4DTJ A;  2I5J A;  4FZZ A;  3AO1 A;  3ULD A;  1CXQ A;  3ZT0 A;  5J2P A;  2X6S A;  5CY4 A;  1BIS A;  4ID1 A;  4PQU A;  5E41 A;  3PO4 A;  4CJT A;  4DLE A;  1BHL A;  3AA2 A;  3M8Q A;  1QSS A;  4C8M A;  4B9S A;  1I39 A;  4F4K A;  1BIZ A;  5CYM A;  2KFN A;  4IBN A;  4DS4 A;  1JLQ A;  3CFP A;  1XC9 A;  4B08 A;  1WSE A;  1TAU A;  3G10 A;  3EY1 A;  3C6T A;  1X1P A;  3QIN A;  4JS4 A;  1JLA A;  4B8A B;  4Y1D A;  1NK4 A;  4C8L A;  2OZM A;  2HB5 A;  4LSN A;  1TK0 A;  1NK6 A;  1BIU A;  3ZT3 A;  4K8X A;  1LW2 A;  3HST B;  3L2W A;  4RW6 A;  1U48 A;  4DF4 A;  3AO3 A;  3KKS A;  1LV5 A;  1RT7 A;  2G8I A;  2A1S A;  3IG1 A;  3G0Z A;  4FJG A;  2EX3 A;  2IC3 A;  2G8U A;  1UWB A;  4PA1 A;  4QCL A;  1CXU A;  1BI4 B;  1IKW A;  1SUQ A;  1RBR A;  1NK5 A;  1NJW A;  2JLE A;  3OYB A;  4C8K A;  1GOC A;  4ZHR A;  1ZBL A;  4MFB A;  3RMD A;  4Q0B A;  5KGW A;  3VN5 A;  1S5J A;  2D0B A;  1Q9Y A;  4FLX A;  4BWM A;  4FLU A;  4E7L A;  4FZY A;  4M3Z A;  1VSH A;  3NCI A;  3NF9 A;  1Y97 A;  1TKT A;  4CHP A;  3HPO A;  3MXJ A;  3ZT1 A;  3EZ5 A;  4DFM A;  1S1V A;  1YTA A;  5HBM A;  1X9W A;  1JXB A;  1BQN A;  2FBT A;  2WON A;  1HRH A;  4GVM A;  2HND A;  4CJV A;  4E7K A;  3QNO A;  3SUN A;  4LH5 A;  1U4B A;  1KRP A;  4KI6 A;  5C42 A;  4CK1 A;  3V4I A;  1SV5 A;  4EZ6 A;  3NAE A;  1QTM A;  2P51 A;  3VQC A;  3OYA A;  5EU7 A;  4KHN A;  3AVK A;  1NK0 A;  4B9L A;  2F8T A;  4DFP A;  5KTQ A;  3NH2 A;  4DTO A;  4FJ8 A;  3VQP A;  2QK9 A;  3VQB A;  3KJV A;  4DTM A;  3SUQ A;  3VQ8 A;  4CHN A;  3WNH A;  3NFA A;  1S9G A;  1WSF A;  2DFH A;  3WNE A;  3SQ2 A;  4JLH A;  4DTS A;  3DLE A;  5J1E A;  3HYF A;  4R5P A;  2YNG A;  2XRI A;  2YHB A;  3HK2 A;  3WNG A;  5HRR A;  2KFZ A;  3NF8 A;  3NF6 A;  1RDA A;  4RW9 A;  4Y1C A;  1NOZ A;  1K6Y A;  2YV0 X;  1WLJ A;  4E7J A;  3V9U A;  3LAM A;  4RW4 A;  2A1R A;  4NCG A;  4F3T A;  2GV9 A;  1C0T A;  3OYD A;  1RBV A;  1RTI A;  1JL1 A;  1NK8 A;  2HHQ A;  4NCB A;  2DFF A;  3AVG A;  3KIO A;  3OVN A;  1C0M A;  3TAM A;  2Z1I A;  4CEO A;  2NUB A;  1RT2 A;  1WSJ A;  4FW2 A;  4IG3 A;  3F73 A;  4DLG A;  5J2M A;  4DWI A;  4CGF A;  1RT5 A;  4YFU A;  3U6F A;  1SL2 A;  3DMJ A;  1U04 A;  3L2U A;  2GBZ A;  4B9N A;  3AVN A;  1RNH A;  4FW1 A;  4CJF A;  3LWM A;  4CF9 A;  3LAN A;  3U3G A;  1RIL A;  4FJX A;  2X6N A;  4LY7 A;  1XI1 A;  4KHW A;  1QE1 A;  3SV3 A;  1L3T A;  3VA3 A;  2Z1H A;  1EKE A;  3O3F A;  1L5U A;  4DSI A;  3L3U A;  1ASW A;  4CJ3 A;  4IFV A;  3M8S A;  2B4J A;  4ELT A;  3ZSY A;  3TAR A;  1XHX A;  3NH1 A;  1YTU A;  5J2N A;  1LWC A;  3RR7 A;  1VSJ A;  3PUF A;  4FJJ A;  2D0C A;  1C6V A;  4OKE A;  3DYA A;  2HHW A;  3QEW A;  3V9X A;  1UAX A;  1HYZ A;  4ID5 A;  4M3U A;  1D5A A;  4I2P A;  1CZB A;  3S3N A;  3KLI A;  5HRP A;  3OYG A;  3KLG A;  3SJJ A;  3O3H A;  4ELV A;  1NKC A;  3DRR A;  3IAY A;  1EX4 A;  3HP6 A;  3CYM A;  2VWJ A;  1D9F A;  2BE2 A;  1VK0 A;  4CEC A;  4CIF A;  3B6P A;  3HM9 A;  1LWF A;  3VQD A;  4W5N A;  1RTH A;  4N47 A;  1WN7 A;  3MEC A;  1BCO A;  3DOL A;  3ZSW A;  1EP4 A;  3TI0 A;  1T7P A;  3NDK A;  4CJP A;  1ZYQ A;  4CF0 A;  3TAP A;  4KO0 A;  1Q9X A;  5CZ2 A;  4FJI A;  1J9A A;  5JS1 A;  4BE0 A;  1TL3 A;  3C94 A;  3AVI A;  3DOK A;  3QEI A;  3OJS A;  4M3Y A;  2QKB A;  4M3X A;  3AVF A;  3V1R A;  3OYL A;  3V1O A;  4NCA A;  4KHS A;  4CGD A;  3QIO A;  4CEQ A;  1REV A;  4EZ9 A;  1IO2 A;  1ASU A;  4H4M A;  4KHQ A;  4FVM A;  2Q3S A;  3AA4 A;  4ZTF A;  1NKB A;  4J2E A;  1KLM A;  2Z1G A;  4ELU A;  4E89 A;  1U49 A;  2FBY A;  4CF8 A;  3TAG A;  1UA0 A;  1JLC A;  2DFE A;  3K5L A;  2Y1I A;  3SQ1 A;  4FJK A;  4N41 A;  4NYN A;  2RF2 A;  3ALY A;  4O0I A;  2OPP A;  4CHO A;  2OPS A;  3TAE A;  4IKF A;  4CK3 A;  1ITG A;  1S6Q A;  4CJS A;  3QLH A;  4FJN A;  4CEB A;  3HPH A;  3HVR A;  1S1W A;  2RPI A;  4W5R A;  4KHU A;  1QQC A;  3KK2 A;  2E6M A;  4RW8 A;  4CJE A;  4DFK A;  1WNS A;  5HRS A;  4KAZ A;  3O4N A;  4OGC A;  1NJX A;  3VQ5 A;  3TWH A;  3SQ4 A;  4MQ3 A;  1A5W A;  1KVA A;  4B9M A;  3KD5 E;  1SKS A;  1G15 A;  4BDY A;  4KKO A;  1F21 A;  3AO2 A;  4FLV A;  3HO1 A;  3O4Q A;  3HP9 A;  2HVI A;  4IG0 A;  3RR8 A;  3B6O A;  4KRF A;  3C6U A;  3AVJ A;  3DLH A;  4F8R A;  1JLF A;  3KK1 A;  3LAL A;  3K59 A;  1HNI A;  4DQQ A;  1EET A;  4OPJ A;  2ZD1 A;  3V1Q A;  3VQ4 A;  2G8W A;  4KPY A;  1HYS A;  3DM2 A;  3QNN A;  3LP2 A;  1WAF A;  2IDO A;  2E6L A;  3OS1 A;  2G8K A;  1SL0 A;  4K8Z A;  3VQ7 A;  1TGO A;  3F9K A;  4CHY A;  4BE1 A;  1RT4 A;  5KI6 A;  1KVB A;  3SPZ A;  3S3M A;  3AVH A;  2HHU A;  1BQM A;  1VSI A;  3HXM A;  2X74 A;  4TSX A;  3RTV A;  4FLY A;  4Z4F A;  1JLB A;  1EXQ A;  2LSN A;  4GMJ B;  2F8S A;  4FJ5 A;  3PO5 A;  3OYI A;  4O55 A;  4OLA A;  4CJQ A;  3T19 A;  1LWE A;  2HNY A;  1RBT A;  3KKR A;  3KLF A;  1L3V A;  1O1W A;  1QSL A;  4CK2 A;  2B5J A;  3DLR A;  4CFB A;  1NK7 A;  1B9D A;  4CJW A;  1HYV A;  1TV6 A;  2E4L A;  3RMB A;  2OPR A;  1NKE A;  4CEF A;  1X9M A;  3V9W A;  4HUG A;  3QEV A;  1DTT A;  4E7I A;  4FJH A;  3D0P A;  1FXX A;  2WOM A;  4B9T A;  1HJR A;  1NJY A;  3P5J A;  1WSH A;  3AA3 A;  3A2F A;  3MXI A;  3PX6 A;  4I9Q A;  2EHG A;  1C1B A;  3SI6 A;  1SKW A;  1U47 A;  3KD1 E;  5K14 A;  4CFA A;  3ITH A;  2XO7 A;  3KK3 A;  4L8R B;  4M42 A;  3DRP A;  4KV8 A;  4B8C A;  4DTR A;  1XHZ A;  2OYQ A;  1JKH A;  1RDC A;  3NGY A;  4FLT A;  1KSP A;  4B9U A;  3AVC A;  2VG5 A;  1BL3 A;  4BE2 A;  3CM5 A;  4DQP A;  4CGJ A;  4M3W A;  3I0R A;  1S1U A;  3PY8 A;  3H08 A;  3EYZ A;  4DSK A;  2YNF A;  4O4G A;  1IKX A;  3LP1 A;  4FJM A;  4DQR A;  1DTQ A;  4CJ4 A;  3LAK A;  1IG9 A;  3QO9 A;  3RMA A;  2G8V A;  3TAF A;  4HUE A;  4PWD A;  3BGR A;  1TKX A;  2RN2 A;  1J54 A;  2IAJ A;  4DTU A;  3V81 A;  3QIP A;  4B9V A;  5D3G A;  2IS3 A;  4BAC A;  4PY5 A;  4CGI A;  1JL2 A;  3K57 A;  4KRE A;  4Z0U A;  4YNQ A;  3ISN C;  3ZSO A;  2BDP A;  1VRT A;  5FRM A;  5FRO A;  2HHV A;  2ZE2 A;  3OYF A;  3JYT A;  3T3F A;  4FK4 A;  3ZCM A;  4AHT A;  1MU2 A;  1UOC A;  5I42 A;  4HUF A;  4J2D A;  1SKR A;  1ZBI A;  1X9S A;  3SQ0 A;  3VQE A;  1KTQ A;  3QET A;  2YKN A;  4FK0 A;  4CJK A;  4M3T A;  2ZQB A;  3MEG A;  2HW3 A;  2D0A A;  1RDD A;  3I8D A;  4F2R A;  4W5Q A;  3QEP A;  1HPZ A;  3M8P A;  4OKK A;  3PX0 A;  4FXD A;  4HVJ A;  2BAN A;  1VSM A;  3DI6 A;  4JRP A;  2XY5 A;  5KRS A;  1UA1 A;  4E0D A;  4DF8 A;  1VSD A;  4QOZ B;  4KTW A;  3QES A;  4Z4C A;  4N76 A;  1Q8I A;  1YVU A;  1Z26 A;  4DTX A;  5SWM A;  1T05 A;  1U45 A;  4CFD A;  2O4G A;  3BDP A;  2KZM A;  3OYK A;  4KB0 A;  3NF7 A;  3L2R A;  3AO4 A;  4FM2 A;  1QHT A;  2JGU A;  4OKJ A;  5JS2 A;  2QXF A;  3SPY A;  2HHX A;  4AH9 A;  1RBU A;  4FCY A;  2VG6 A;  1LW0 A;  5HP1 A;  3TAQ A;  2PYL A;  4DQI A;  4KHY A;  3SCX A;  4CCH A;  4O44 A;  4CE9 A;  2O4I A;  3TAN A;  4CEE A;  3OY9 A;  4DSF A;  4HCB A;  4F3O A;  3U3Y A;  3RWU A;  1N5Y A;  4DSE A;  1W9H A;  2X78 A;  4W5O A;  3VQQ A;  2KW4 A;  2BGG A;  3KLE A;  1C1A A;  4FK2 A;  1B92 A;  4J2A A;  1TK5 A;  3P1G A;  1Z25 A;  3S9H A;  4IFY A;  1BCM A;  4BDP A;  1JLE A;  3AVL A;  5DMR A;  4OLB A;  4Z4H A;  4BDZ A;  4AIL C;  1KLN A;  4FJL A;  4IDK A;  4E3S A;  1CLQ A;  1VRU A;  3SZ2 A;  4DU1 A;  3QEX A;  4B3O A;  1TAQ A;  4QAG A;  4FYD A;  3SYZ A;  3ZSR A;  4E7H A;  4CEZ A;  2VWK A;  4RW7 A;  1I3A A;  4BWJ A;  4CER A;  4EP4 A;  3AV9 A;  4AHU A;  3L2V A;  1CZ9 A;  3RMC A;  1D8Y A;  1S1T A;  2FBX A;  1HNV A;  1C0U A;  4CIE A;  3LZI A;  4DTP A;  4KB1 A;  2F96 A;  4RG8 A;  1TK8 A;  1VSK A;  3LPT A;  4H4O A;  3QER A;  1KCF A;  4FM1 A;  4JS5 A;  4DU3 A;  2Y1J A;  1TKZ A;  3LP0 A;  4LH4 A;  4E1M A;  2YKM A;  1VSL A;  2AJQ A;  3KTQ A;  3L2Q A;  2GUI A;  4XIU A;  3TAB A;  3AVB A;  4HTU A;  2R7Y A;  3MXM A;  1W0H A;  1T8E A;  1NOY A;  3PX4 A;  4CGH A;  1RT3 A;  1R0A A;  3AO5 A;  4DU4 A;  1B9F A;  3SNN A;  2DY4 A;  4LD0 A;  4OPK A;  1KFS A;  2OPQ A;  3NGZ A;  3OJU A;  4M41 A;  4FZX C;  2G8H A;  1J53 A;  4CJ5 A;  1WAJ A;  3T1A A;  1HQU A;  4EP5 A;  3RRH A;  4LSL A;  2XY6 A;  5KGX A;  4E1N A;  3JSM A;  4C8O A;  4AHV A;  5FDL A;  4CES A;  2Z1J A;  1DLO A;  1T03 A;  2HHS A;  3VQA A;  2FC0 A;  4DMN A;  2YNI A;  2FBV A;  3LPU A;  4CIG A;  4Z4I A;  1RT6 A;  1A5X A;  3THV A;  2ETJ A;  3HPG A;  5HLF A;  3UIQ A;  1NK9 A;  3KLH A;  4CHQ A;  4C8N A;  3PV8 A;  1ZBU A;  4N5S A;  5CYQ A;  4JRQ A;  1ZBH A;  3DRS A;  4KTZ A;  3HL8 A;  5T7B A;  4O5B A;  1WSG A;  5FRN A;  4CHZ A;  3OYJ A;  3ZSZ A;  3CFR A;  3VA0 A;  1RCH A;  1KFD A;  1N6Q A;  2G8F A;  5J2Q A;  3RRG A;  4PUO A;  3K5N A;  1GOB A;  1RBS A;  1L3U A;  1IKY A;  4W5T A;  1S1X A;  3VQ6 A;  3OYH A;  3TR8 A; 
#chains in the Genus database with same CATH topology
 4A2A A;  1P8Z A;  4JD2 B;  2VYP A;  1VSF A;  5B8H A;  3PSI A;  1H1V A;  4CJU A;  5SZT A;  4CZE A;  3K58 A;  1NJZ A;  2HMI A;  4Z4G A;  1YUW A;  1HMV A;  4QS9 A;  4HHT A;  1LAV A;  4FJ9 A;  3K5M A;  2KTQ A;  3ATU A;  4AHR A;  1JCE A;  4DV0 K;  3P83 D;  3VET A;  3VGM A;  5EY4 A;  1VSE A;  4BQL A;  4RTF D;  2XHB A;  2KZZ A;  3ZSV A;  1ZBF A;  1RTD A;  4CFC A;  2IGI A;  2PYJ A;  4F9O A;  2PZS A;  2B6A A;  4JKF A;  5I3U A;  1SL1 A;  5AFU A;  3ZX3 A;  1GOA A;  3CCS N;  1YF5 L;  3QFP A;  3RVC A;  1IKV A;  2YHY A;  4O5F A;  3CFO A;  2ITM A;  3IRX A;  4HCC A;  5BR9 A;  4H0O A;  3HVT A;  4DV6 K;  2P9I A;  3NBP A;  2V7Y A;  1EQY A;  1J5O A;  5BPL A;  4E19 A;  2QM1 A;  1LAW A;  5C24 A;  5E84 A;  1KVC A;  3K5O A;  1QSY A;  3SUO A;  1NMN A;  4FPB A;  1NJI O;  2YHA A;  4LF7 K;  3V9S A;  2HVH A;  1Z6R A;  2QWR A;  5AQR A;  4KFB A;  3NE6 A;  3GG4 A;  5AQY A;  3VQ9 A;  3LWL A;  2D1K A;  5JIC A;  1QS4 A;  3DLB A;  2HHH K;  4CZJ A;  4JI2 K;  3OS2 A;  5CZ1 A;  1ASV A;  2ITG A;  5BPN A;  4FLW A;  5A2Q O;  3NH0 A;  3ULD A;  4LC9 B;  4BR7 A;  4CJT A;  3PO4 A;  5AZJ B;  3UKU B;  3AA2 A;  1QSS A;  5KPR A;  4IBN A;  2FF6 A;  4PKG A;  2YHX A;  4B08 A;  4JV5 K;  1WSE A;  3QIN A;  3VER A;  4PHT X;  3K0S A;  3FZF A;  2FSK A;  1T6C A;  1TK0 A;  1BIU A;  1LW2 A;  5FPN A;  1K8K B;  3L4Q A;  3H6E A;  3IG1 A;  4FJG A;  2W40 A;  2EX3 A;  2OTJ N;  4BRO A;  1NJW A;  1GOC A;  4H0Y B;  1VQP N;  4NO7 A;  5LJW A;  3D2F A;  4JI1 K;  1VSH A;  4BVO A;  3UB5 A;  3IDH A;  3ID8 A;  3EZ5 A;  2F7T A;  3U9D A;  1BU6 O;  1X9W A;  1HKB A;  4GVM A;  3SUN A;  2HND A;  4CJV A;  4LH5 A;  3T1H K;  4H5T A;  5C42 A;  4EZ6 A;  2ZJR L;  5M1O A;  4B9Q A;  4WFB L;  3NH2 A;  4ISG A;  3VQB A;  3KJV A;  4CHN A;  2QWM A;  4B1U B;  1S9G A;  2NRW A;  5AQU A;  4JLH A;  4DTS A;  2YNG A;  2YHB A;  3WNG A;  1NGF A;  4UY8 O;  2KFZ A;  3NF8 A;  4ILH A;  3N4P A;  1NOZ A;  3WXI A;  1WLJ A;  3V9U A;  4F3T A;  2GV9 A;  2HHQ A;  4K41 A;  4AM7 A;  1X9M A;  2WFB A;  2NUB A;  4FW2 A;  4DWI A;  1VQL N;  4MLE A;  1SL2 A;  1U04 A;  4BGB A;  4YOW A;  3U3G A;  4NB4 A;  2X6N A;  4GVE A;  4KHW A;  4DV2 K;  1SZ2 A;  3SAF A;  2Z1H A;  3D2F B;  2I7P A;  4ELT A;  4GKK K;  3ZSY A;  5JVG L;  1C6V A;  1HYZ A;  4ID5 A;  1OH7 A;  3DXM B;  4CBW A;  1CZB A;  3S3N A;  5HRP A;  3OYG A;  4WF9 L;  4H0P A;  3DRR A;  1EX4 A;  2QWO A;  3O9Q A;  3HI0 A;  3C65 A;  1T3V A;  1IBM K;  3VQD A;  4N47 A;  4K43 A;  2O8C B;  1BCO A;  3TI0 A;  5F2R A;  3I8B A;  3NDK A;  4CJP A;  3NVM A;  3RSE A;  1OH5 A;  4CD1 A;  3C0B A;  4H0T B;  3C94 A;  3ZX2 A;  4M3Y A;  2QKB A;  4KHS A;  3V1O A;  5CR4 A;  2F9T A;  3CCE N;  4BRK A;  4EZ9 A;  4H5N A;  4FVM A;  3W0L A;  2QWQ A;  4J2E A;  1NBW A;  2DPN A;  3ZLJ A;  4N41 A;  4FJK A;  3ALY A;  1QQO A;  4O0I A;  4DR3 K;  1HR0 K;  5AR0 A;  3TAE A;  1U2V B;  4IZ9 A;  4FWK A;  4FJN A;  4CEB A;  3MWT A;  4YDU C;  4CJE A;  4KAZ A;  4FWL A;  4A57 A;  4BRL A;  3J8A A;  3LDQ A;  2JWK A;  4FWO A;  1BUP A;  4BR0 A;  3O80 A;  3HO1 A;  3O4Q A;  1Y64 A;  3RR8 A;  3P4I A;  3TTF A;  4KRF A;  3C6U A;  4ISE A;  4BC5 A;  1JLF A;  4OX9 K;  2ZD1 A;  3DM2 A;  4B3S K;  3LP2 A;  2IDO A;  1BOT O;  3OS1 A;  3O08 A;  3VQ7 A;  3F9K A;  1KVB A;  3AVH A;  3HXM A;  1JLB A;  2LSN A;  4KH4 A;  3PO5 A;  4OLA A;  3A5N C;  1EO1 A;  1LWE A;  2HNY A;  4MDB A;  1L3V A;  4JN4 A;  1W97 L;  1BWF O;  4CFB A;  1VQ9 N;  1B9D A;  3JAM O;  4CEF A;  4E7I A;  4FJH A;  3D0P A;  1HJR A;  3P5J A;  3A2F A;  3MXI A;  1E3M A;  1MWK A;  4BRG A;  1SKW A;  5KQD A;  3ITH A;  3CD6 N;  3J7Y P;  3DRP A;  4FLT A;  3ZET A;  4ISF A;  5CHI A;  4A61 A;  3TPQ A;  4CGJ A;  3O6W A;  1IKX A;  4DQR A;  3IFR A;  1I94 K;  3QO9 A;  3M5R A;  4HUE A;  1VQ6 N;  4PWD A;  4FL9 A;  3THY A;  2IAJ A;  3V81 A;  4CGI A;  4Z0U A;  4YNQ A;  5FRM A;  2QWN A;  3JYT A;  5M1P A;  3CI5 A;  4DHY A;  3KWG A;  3TSU A;  3VQE A;  3QET A;  4FK0 A;  4CJ7 A;  4B3M K;  4DR4 K;  2ZQB A;  3MEG A;  2D0A A;  5JLF A;  1RDD A;  4W5Q A;  4JKA A;  1HPZ A;  3M8P A;  3PX0 A;  2NNW A;  5KRS A;  1VSD A;  2W6K A;  4QOZ B;  3E9O A;  3PLA A;  1V4S A;  4WYB A;  4WFA L;  3N4Q A;  4DTX A;  2P9L A;  1GLB G;  2O4G A;  5AQI A;  4BRC A;  4CFD A;  3BDP A;  2KZM A;  2FLO A;  2UUA K;  4FVU A;  2JGU A;  4NLC A;  4AH9 A;  4RWT A;  4FCY A;  2VG6 A;  5HP1 A;  2PYL A;  4DQI A;  4CCH A;  5AQG A;  3ZET B;  3CF5 L;  4HCB A;  4F3O A;  3O9R A;  2BGG A;  3VQQ A;  4JI5 K;  3KLE A;  2QA4 N;  1TK5 A;  4X62 K;  3S9H A;  5GAE P;  4KHP K;  3AVL A;  4Z4H A;  4AIL C;  3THX B;  4X66 K;  1CLQ A;  1OH6 A;  4B3O A;  2EWS A;  3MN5 A;  1I3A A;  5AJ3 K;  3SAH A;  4DTP A;  1C0U A;  4KB1 A;  4DU3 A;  4YHH K;  1TKZ A;  4CZK A;  3LP0 A;  4LH4 A;  4E1M A;  3FZM A;  1VQK N;  2GUI A;  3TAB A;  1WBD A;  4HTU A;  1NOY A;  1R0A A;  4DU4 A;  4AM6 A;  1B9F A;  2H3G X;  1NGB A;  4LD0 A;  3NGZ A;  3OJU A;  2G8H A;  4CJ5 A;  1WAJ A;  2NLX A;  4AHV A;  2P9S A;  2YNI A;  3LPU A;  4M7Y A;  1RT6 A;  5GAH P;  5AQN A;  4PL8 A;  3CJA A;  3HPG A;  3WT0 A;  3KLH A;  3VEY A;  4C8N A;  3PV8 A;  1ZBU A;  4JRQ A;  4DV7 K;  3DRS A;  3FE1 A;  3OBY A;  1KAY A;  5FRN A;  3VA0 A;  1N6Q A;  2UUB K;  2ZJQ L;  3RRG A;  4PUO A;  5J2Q A;  1RBS A;  5C10 A;  3CXC M;  1S1X A;  5BN8 A;  3C6A A;  4LF8 K;  3TR8 A;  3I0S A;  2OA8 A;  3WQT A;  4IJA A;  4FJ7 A;  3K2P A;  3VTI A;  1QHA A;  4M45 A;  1Q7Y O;  3CQ8 A;  1JCG A;  1YT3 A;  3TTD A;  3IS9 A;  4DS5 A;  3CET A;  4KBO A;  4DFJ A;  3WQU A;  4I7F A;  4DCH A;  1V4T A;  3CG7 A;  5AQL A;  1S6P A;  5BPM A;  1L3S A;  2QEX N;  3ZSX A;  5AQQ A;  3WNF A;  4DTN A;  1SQK A;  2WBN A;  3DLK A;  3MED A;  3AVM A;  4J8F A;  3NGI A;  1ZC6 A;  5AQP A;  1GLD G;  3CJ1 A;  4DG1 A;  3DLG A;  3J81 O;  4N56 A;  3EN9 A;  2GEL A;  2RHK A;  1RTJ A;  3THW B;  1TYQ A;  4OVL A;  3C95 A;  3OS0 A;  2HF3 A;  2A40 A;  1KC8 O;  3V9Z A;  2XY7 A;  2ZGY A;  3S3O A;  3AA5 X;  1TVR A;  3HT3 A;  2I7N A;  3MAQ A;  3ULE A;  3OYM A;  5AZI A;  3O3G A;  4FLZ A;  5I9E B;  4DSL A;  2P5O A;  1RGI A;  3ZEU A;  3BZC A;  4DSJ A;  4DTJ A;  2X6S A;  4ILG B;  1BIS A;  2O8D B;  4JD2 A;  4PQU A;  4DLE A;  1X3N A;  1BHL A;  2ASO A;  2IIR A;  4YOY A;  1BIZ A;  5CYM A;  3T7Z A;  1JLQ A;  3WXL A;  4U7B A;  3EY1 A;  2WC9 A;  4NLB A;  1IJJ A;  1JLA A;  3WXK A;  4B8A B;  4LSN A;  1NK6 A;  4K8X A;  3M1F A;  2P9N A;  3MN9 A;  4DF4 A;  1LV5 A;  1UWB A;  4BRD A;  3A8Y A;  1SUQ A;  1RBR A;  2JLE A;  4ZHR A;  1ZBL A;  1S22 A;  5GIN A;  4MFB A;  2Q36 A;  1S5J A;  5JMV A;  4BWM A;  3D7E O;  4L3Q A;  1RDU A;  1XMQ K;  1J5E K;  4C23 A;  1TKT A;  3LDN A;  3LM9 A;  4DFM A;  1S1V A;  3O1W A;  2WON A;  2FBT A;  5TKW A;  4BC4 A;  4B1W B;  5BRH A;  1U4B A;  2HF4 A;  2ASM A;  1KRP A;  3FLC O;  3R3L A;  3NAE A;  3CER A;  5EU7 A;  3ZEU B;  1XQS C;  4WQ4 C;  4Y0W A;  4DFP A;  3H45 C;  5AQV A;  3M6G A;  2KKZ A;  3J80 O;  2YJF A;  4R5P A;  3HK2 A;  4RW9 A;  2BH1 A;  3L0Q A;  3MMV A;  3TTC A;  3LAM A;  3WXJ A;  4JKB A;  1C0T A;  3ENB A;  3A0I X;  1JL1 A;  5GAG P;  3AVG A;  3OVN A;  3TAM A;  1C0M A;  4BRH A;  3AGK A;  1WSJ A;  4DLG A;  5J2M A;  4CGF A;  4WFN L;  2P9N B;  1N8R O;  4WQ5 A;  5AZJ A;  3UKU A;  3L2U A;  4LF4 K;  4CJF A;  2KHO A;  2E2N A;  1GLF O;  2GEM A;  3D2E A;  3UE5 A;  1XI1 A;  2QWL A;  4QS7 A;  1W2B M;  5C2D A;  1EKE A;  1L5U A;  4DSI A;  3L3U A;  4IFV A;  2B4J A;  1K8K A;  4YDU A;  1XHX A;  2O8F A;  3RR7 A;  3PUF A;  2D0C A;  1D4X A;  1QZ6 A;  4LFA K;  2O8B B;  4PKH A;  3O3H A;  2VWJ A;  2BE2 A;  1VK0 A;  4CIF A;  5F0X A;  2CGJ A;  4A2B A;  3R9P A;  1N33 K;  5CE3 A;  1Q81 O;  4ILJ A;  3DOL A;  1SAZ A;  3P38 A;  4CF0 A;  3H46 O;  4KO0 A;  5CZ2 A;  5JS1 A;  3OJS A;  4BR4 A;  1EWQ A;  3QIO A;  4BRI A;  4CBX A;  1REV A;  3MX2 A;  1ASU A;  2Q3S A;  3CQY A;  4ZTF A;  4YOU A;  2Z1G A;  2A5X A;  4CF8 A;  1JLC A;  4C1N K;  4IOX A;  2Y1I A;  3D2E B;  3VF2 A;  4JK9 A;  2D4W A;  2QTD A;  1S1W A;  2O8F B;  3GE1 A;  4RW8 A;  1JJ2 M;  1WNS A;  2YX6 A;  4H0V B;  4OGC A;  3VQ5 A;  3TWH A;  4MQ3 A;  1A5W A;  3KD5 E;  4BDY A;  1Z05 A;  2NRV A;  1OVQ A;  3HP9 A;  4IG0 A;  3NMU A;  3B6O A;  3AVJ A;  3K59 A;  3LAL A;  4OPJ A;  3VQ4 A;  4AQY K;  2E6L A;  3DXM A;  3MWP A;  3VF6 A;  4K8Z A;  2AA4 A;  3JS6 A;  4CHY A;  4BE1 A;  5KI6 A;  1BQM A;  3RTV A;  4JI3 K;  4Z4F A;  3B8A X;  2ASP A;  4FJ5 A;  3OYI A;  4O55 A;  1EWR A;  3T19 A;  2O8C A;  3KLF A;  5JLH A;  3IKM A;  2B5J A;  1YIJ N;  1XMO K;  2PFU A;  1TV6 A;  2E4L A;  3KVG A;  1DTT A;  3CCL N;  1FXX A;  1WSH A;  2CGK A;  3PX6 A;  4JK8 A;  2ZF5 O;  4I9Q A;  2UU9 K;  1C1B A;  5K14 A;  1YVN A;  5C15 A;  4KV8 A;  2WTU A;  1NWK A;  3HM8 A;  4B8C A;  1O13 A;  4B9U A;  3AVC A;  4BRP A;  2WUS A;  3I0R A;  3H08 A;  1U2V A;  3E66 A;  1DTQ A;  3RMA A;  4CZF A;  3G25 A;  2G8V A;  2JWL A;  1TKX A;  1J54 A;  2IS3 A;  3CCJ N;  4GY2 B;  3K57 A;  3U9Z A;  3VTH A;  1VRT A;  2P9U A;  4BG8 A;  2ZE2 A;  1XC3 A;  3T3F A;  4DV3 K;  3VES A;  4FK4 A;  1MU2 A;  5I42 A;  1SKR A;  3EL2 A;  3SQ0 A;  5AFU H;  4JKG B;  3K9K A;  1BG3 A;  2HW3 A;  1MDU B;  3F5T A;  3J7A P;  4F2R A;  3QEP A;  2P9P A;  4OKK A;  3VPZ A;  2BAN A;  1XNR K;  1VSM A;  2XY5 A;  3CCQ N;  4CD3 A;  4BRN A;  4KTW A;  3QES A;  1Q86 O;  3VEX A;  1T05 A;  1NGE A;  4EHU A;  3AO4 A;  4FM2 A;  3BEX A;  3O9S A;  4OKJ A;  2QXF A;  5JS2 A;  4WQ5 C;  4KHY A;  4CE9 A;  2E2O A;  3TAN A;  1NM1 A;  3ENH A;  5F1X A;  3HBT A;  3U3Y A;  1W9H A;  2KW4 A;  1C1A A;  4IFY A;  1BCM A;  3EZW A;  4XEI A;  3MX5 A;  5DMR A;  1E4F T;  5IT9 O;  4DU1 A;  3QEX A;  4QAG A;  4BR5 A;  3ZSR A;  4CEZ A;  2VWK A;  2P9U B;  1VQN N;  4PY5 A;  3AV9 A;  3L2V A;  3RMC A;  1D8Y A;  3Q7C A;  2YJE A;  2P9K B;  1KCF A;  3EKU A;  4JS5 A;  3CPW M;  3FZL A;  2Q97 A;  3Q7B A;  2AJQ A;  3CC4 N;  1HNX K;  3AVB A;  3PX4 A;  2P9P B;  1RT3 A;  2W41 A;  5BRD A;  3SNN A;  1LCU A;  2OPQ A;  3LL3 A;  1Q82 O;  4V19 S;  4JKE A;  5KGX A;  3JSM A;  4C8O A;  4JHD B;  5FDL A;  2HHS A;  4GV6 A;  4DR1 K;  3EKS A;  2FBV A;  4CIG A;  4Z4I A;  2A6A A;  2ETJ A;  4FPA A;  1VQ5 N;  1MWM A;  1T6D A;  5CYQ A;  1ZBH A;  4A5B A;  4KTZ A;  1BA0 A;  4CHZ A;  3OYJ A;  3QDK A;  1KFD A;  3WUH A;  1GOB A;  2E8A A;  1IKY A;  4DKW A;  3OYH A;  3VQ6 A;  3QFU A;  3VF4 A;  5AQZ A;  3SUP A;  3OW2 M;  1FKO A;  2ATQ A;  1P90 A;  4CED A;  1FK9 A;  4JKD A;  2ZJP L;  4Z4E A;  4G1Q A;  4H8K A;  3ZT2 A;  1JLG A;  3U8X A;  3ZT4 A;  3MN7 A;  3R1X A;  2BUP A;  3OYE A;  3MN6 A;  4ICL A;  5EX5 A;  1RDB A;  4KI4 A;  1NNE A;  4YY3 K;  2KQ2 A;  4I2Q A;  4O0J A;  3SAG A;  3THX A;  2HBM A;  1BDG A;  1A5V A;  3CM6 A;  4CF1 A;  4DR5 K;  4AHS A;  3V6D A;  3TSQ A;  1S3X A;  4M3R A;  3BUZ B;  3GL1 A;  5FLX O;  3MEE A;  4CEA A;  1C1C A;  3TU5 A;  4NXM K;  4B3T K;  3C7N B;  3LZJ A;  3GOI A;  1XNQ K;  3VGL A;  3ENO A;  4CVN E;  1X9J A;  3L3V A;  3CCR N;  3WXM B;  3SV4 A;  1VQM N;  5H1S Q;  1TL1 A;  3L8B A;  2D5R A;  3OYN A;  2QKK A;  1WSI A;  4BGA A;  2OTL N;  1IV0 A;  4JEP A;  4XH4 A;  2HHT A;  4OGE A;  2VGM A;  1IH7 A;  1XWL A;  5HRN A;  4KH5 A;  5DK5 A;  1TUU A;  3CJ7 A;  5LJV A;  3FZH A;  1BGX T;  4GW6 A;  4DUY K;  3BF1 A;  4WQ4 A;  3QML A;  3O8M A;  2V52 B;  3SMP A;  5GIO A;  5EOY A;  4OPH A;  3BF3 A;  4DQS A;  2P5G A;  4JYA K;  3M8R A;  1ESV A;  3CJB A;  4FZZ A;  2I5J A;  4DV1 K;  5J2P A;  5CY4 A;  5EXW A;  5AQO A;  3DAW A;  2HOE A;  3M8Q A;  3I56 N;  4C8M A;  3ZX0 A;  4F4K A;  4CI6 A;  5AQX A;  4DS4 A;  2YI1 A;  3SJH A;  1WOQ A;  3G10 A;  3C6T A;  4JS4 A;  1NK4 A;  4C8L A;  2HB5 A;  3ZT3 A;  3HST B;  3L2W A;  4RW6 A;  1HKC A;  5FPE A;  3KKS A;  2A1S A;  4EFH A;  4JI7 K;  4HWI A;  4QCL A;  1IKW A;  5AQH A;  1NK5 A;  3G6E N;  3OYB A;  4C8K A;  1RFQ A;  2D0B A;  3VN5 A;  1Q9Y A;  4EAH D;  4FLU A;  5LL6 Z;  4FZY A;  3CHW A;  3ZT1 A;  3CQX A;  1BQN A;  4E7K A;  3QNO A;  2V7Z A;  3UKR B;  1DKG D;  3V4I A;  1SV5 A;  3THW A;  2P51 A;  3OYA A;  4KHN A;  3CJC A;  3AVK A;  4BRF A;  1NK0 A;  1IBL K;  2F8T A;  5ELZ A;  5KPT A;  1G99 A;  4DTO A;  4FJ8 A;  5FPM A;  3SUQ A;  2DFH A;  3WNE A;  3SQ2 A;  5J1E A;  2XRI A;  1HKG A;  5ADX H;  1RDA A;  1K6Y A;  2A1R A;  4RW4 A;  4NCG A;  4IEE A;  3OYD A;  1RTI A;  1NK8 A;  4NCB A;  3P31 A;  2DFF A;  4CEO A;  3W3D A;  2Z1I A;  3DXK B;  2O8D A;  4IG3 A;  3SMS A;  1RT5 A;  4YFU A;  2IVP A;  3U6F A;  3DMJ A;  2GBZ A;  3HSC A;  3TSP A;  3AVN A;  1RNH A;  3LWM A;  4CF9 A;  3E9L A;  3DLL L;  4LF5 K;  1ATS A;  3SV3 A;  1L3T A;  3QBX A;  2RE2 A;  4CJ3 A;  4HTL A;  2Q0U A;  4FWS A;  4B1Y B;  4IO8 A;  3BP8 A;  4IEI A;  5J2N A;  1LWC A;  1VSJ A;  4OKE A;  2HHW A;  4DR6 K;  1UAX A;  4I2P A;  4CZI A;  3KLI A;  4ELV A;  1NKC A;  3PIO L;  3ATV A;  3HP6 A;  3CYM A;  1D9F A;  4BG9 A;  3SBT A;  1LWF A;  4W5N A;  4FWM A;  1RTH A;  4DB3 A;  1WN7 A;  5KQ8 A;  1VQ7 N;  3AAQ A;  4FWN A;  1EP4 A;  3VOV A;  4A5A A;  4O8U A;  1Q9X A;  4FJI A;  1J9A A;  1TL3 A;  3DOK A;  3AVI A;  3QEI A;  4H5V A;  3V1R A;  4CZL A;  4NCA A;  1W7A A;  3A5O C;  3E1Y A;  3SLC A;  1IO2 A;  4KHQ A;  1GLJ O;  1KLM A;  1NG9 A;  4ELU A;  4E89 A;  5BR8 K;  5IWA K;  3TAG A;  1UA0 A;  3K5L A;  1OKJ A;  2OPP A;  1J6Z A;  2NRX A;  3QLH A;  1TUY A;  1NGJ A;  4JKC A;  4KHU A;  4W5R A;  1OVY A;  1QQC A;  3KK2 A;  2E6M A;  3AY9 A;  4DFK A;  1NJX A;  3SQ4 A;  5M1N A;  4B9M A;  1YI2 N;  1G15 A;  2VCP A;  4M63 C;  1FW6 A;  5E26 A;  4CZH A;  4BRM A;  3DLH A;  4F8R A;  1ATR A;  3FFK B;  3PSF A;  4E1J A;  2G8W A;  1HYS A;  3QNN A;  2O8B A;  3D6R A;  1TGO A;  3SPZ A;  3S3M A;  4BC2 A;  2HHU A;  3A5L C;  1VSI A;  4TSX A;  2F8S A;  2F9W A;  3H1V X;  3J7Z O;  2E2P A;  3KKR A;  1QSL A;  1O1W A;  2Q31 A;  1HJO A;  4DQ8 A;  1NK7 A;  1VQ4 N;  1HYV A;  3RMB A;  3EE9 A;  4EHT A;  3V9W A;  3QEV A;  2QW9 A;  2WOM A;  3LDL A;  4GKJ K;  1YJN N;  2EHG A;  3KD1 E;  2XO7 A;  2D0O A;  4L8R B;  1YJW N;  1XHZ A;  3ZYY X;  2VG5 A;  1BL3 A;  4BE2 A;  4M3W A;  3FR0 A;  4IDH A;  2YNF A;  4O4G A;  2UXD K;  5LMU K;  1NLV A;  3I55 N;  3VEW A;  4FO0 A;  2NRZ A;  2FXU A;  3BGR A;  4DTU A;  5AQS A;  1JL2 A;  1NMD A;  3ISN C;  3ZSO A;  2BDP A;  3BZK A;  4KH6 A;  5FRO A;  2PAV A;  5AQJ A;  1K73 O;  2IVO A;  2O8E A;  2E20 A;  4AHT A;  3H3N O;  1UOC A;  5AQF A;  4HUF A;  4J2D A;  1X9S A;  5GIP A;  2YKN A;  4MO5 A;  4CJK A;  4XH1 A;  4YOV A;  4BY9 C;  1DT9 A;  4FXD A;  2NRR A;  4HVJ A;  1KXP A;  4JRP A;  1UA1 A;  3OA9 A;  1YVU A;  5C2F A;  4FWR A;  3QIC A;  5SWM A;  2A42 A;  1QQM A;  1OH8 A;  3OYK A;  3L2R A;  3SPY A;  1QHT A;  2HHX A;  3TAQ A;  4O44 A;  4CEE A;  3OY9 A;  4AF1 A;  4DSF A;  4GV9 A;  4MLH A;  1HUX A;  4JI6 K;  3M3Z A;  4FK2 A;  1JLE A;  1NGG A;  4E3S A;  1WBB A;  1VRU A;  4FYD A;  3OBW A;  4X65 K;  3FZK A;  4RW7 A;  4BWJ A;  4BQZ A;  1CZ9 A;  3LZI A;  1HNV A;  2O8E B;  4CIE A;  2F96 A;  4RG8 A;  3LM2 A;  2CGL A;  4H4O A;  2Y1J A;  4FM1 A;  4CZG A;  1C0F A;  1S72 N;  2E5L K;  4DR2 K;  1W0H A;  1T8E A;  5AQW A;  2P9I B;  3AO5 A;  2DY4 A;  1KQS M;  4YOX A;  4M41 A;  2VGN A;  4FZX C;  4EP5 A;  3T1A A;  3RRH A;  4LSL A;  3OTO K;  4E1N A;  4JKG A;  3O9U A;  4OO1 J;  4CES A;  4CW7 B;  3VQA A;  2FC0 A;  1FJG K;  1A5X A;  4A59 A;  2VQE K;  3THV A;  5MLC Q;  4BRA A;  3UIQ A;  1NK9 A;  1ATN A;  4N5S A;  1RDW X;  5T7B A;  4O5B A;  2G8F A;  1RCH A;  3KWI A;  1L3U A;  2NRT A;  2HBL A;  2E88 A;  4F2S A;  4NYF A;  2OZS A;  4UQG A;  2VG7 A;  3D45 A;  1HNZ K;  3VEO A;  4AHC A;  5C25 A;  3S41 A;  3CCV N;  3LDS A;  1RT1 A;  2FF3 B;  3MCA B;  4DV4 K;  3L6Q A;  1FKP A;  2OAN A;  4XH5 A;  2DTU A;  5C0Y A;  3LP3 A;  2W42 A;  4H0X B;  1YJ9 N;  2IOC A;  4G9Z A;  2QI2 A;  4CJR A;  4ZTJ A;  5DM6 L;  4FSV A;  2P9K A;  1HQE A;  4CF2 A;  1E4G T;  1U6Z A;  3IMX A;  2ZWH A;  1D9D A;  2YHW A;  2PY5 A;  3FFI A;  4I9L A;  4YOR A;  4CGG A;  5HRO A;  5KPZ A;  4KTQ A;  4CJL A;  2YNH A;  2UUC K;  4FM0 A;  1BI4 A;  2V51 B;  3HJF A;  5KRT A;  3NVK A;  3AVA A;  1S9E A;  3ASM A;  3E01 A;  1JXE A;  4OJR A;  3OYC A;  4FWP A;  2XY8 A;  3C6H A;  4JHD A;  2RKI A;  2HNZ A;  4WE1 A;  3ZSQ A;  5TKY A;  1K8A O;  4BRQ A;  3O1B A;  4J2B A;  1TKD A;  4BVP A;  3NHG A;  4Q5V A;  4PL7 A;  4X64 K;  2P1J A;  2E1Y A;  3AO1 A;  1N34 K;  1CXQ A;  3ZT0 A;  3O5B A;  4ID1 A;  5E41 A;  1Q18 A;  3GDQ A;  4B9S A;  1I39 A;  2KFN A;  2UYT A;  3CFP A;  1YIT N;  1XC9 A;  3GBT A;  3DJC A;  1TAU A;  1X1P A;  2Q0R A;  4Y1D A;  2OZM A;  5M1K A;  1U48 A;  2UXC K;  1C0G A;  1VAZ A;  3AO3 A;  1RT7 A;  2G8I A;  3G0Z A;  3VEZ A;  2IC3 A;  4DUZ K;  2G8U A;  4PA1 A;  1CXU A;  1BI4 B;  4JI0 K;  4DR7 K;  3RMD A;  4Q0B A;  1GLL O;  2FSN A;  5KGW A;  4FLX A;  4M3Z A;  4E7L A;  3JXU A;  3C7N A;  3NCI A;  4LF9 K;  1N32 K;  3NF9 A;  1Y97 A;  4IOC L;  4CHP A;  3HPO A;  3MXJ A;  1YTA A;  2BTF A;  5HBM A;  1JXB A;  5BRE A;  2GWJ A;  4K0K K;  1HRH A;  2VWB A;  4KI6 A;  3FGU A;  4CK1 A;  2GX9 A;  3RSE B;  4FOE A;  1QTM A;  3VQC A;  4B9L A;  1HNW K;  5KTQ A;  3HZ6 A;  3VQP A;  2QK9 A;  4DTM A;  3VQ8 A;  3WNH A;  3NFA A;  1WSF A;  3U4L A;  3CC2 N;  1SS6 A;  5ADX A;  3DLE A;  4LF6 K;  3HYF A;  2GTD A;  3CPE A;  5HRR A;  3NF6 A;  4Y1C A;  2YV0 X;  4E7J A;  5DM7 L;  3KK7 A;  1QQN A;  1BA1 A;  1VQ8 N;  1RBV A;  3KIO A;  4B3R K;  3F73 A;  1RT2 A;  4QS8 A;  2OCE A;  4JK7 A;  4Z94 A;  4B9N A;  3G71 N;  4FW1 A;  5HL7 L;  3LAN A;  1RIL A;  4FJX A;  3E9P A;  4LY7 A;  1BO5 O;  1QE1 A;  1VHX A;  4LFC K;  3A5M C;  5GAD P;  3VA3 A;  4H5R A;  3O3F A;  2F4V K;  1ASW A;  3M8S A;  2E2Q A;  3TAR A;  1WUA A;  3NH1 A;  4CZM A;  1YTU A;  3O4W A;  3CCU N;  4FJJ A;  2A3Z A;  3DYA A;  4JAX A;  1IG8 A;  4K42 A;  3QEW A;  1GLA G;  3IUC A;  3VEN A;  3V9X A;  4A62 A;  4M3U A;  1D5A A;  2Q1N A;  4B1V A;  3KLG A;  3AAP A;  4JKH A;  1ZXO A;  3SJJ A;  1HPM A;  3IAY A;  4K25 A;  2VQF K;  4B1Z A;  4CEC A;  3B6P A;  3HM9 A;  2GUP A;  3MEC A;  3UKR A;  3ZSW A;  1IBK K;  1T7P A;  1ZYQ A;  3TAP A;  4JI4 K;  5M1F A;  4BE0 A;  1K9M O;  4OPA A;  4M3X A;  3LDO A;  3AVF A;  1XUP O;  3OYL A;  3SBG A;  3DWL A;  4CGD A;  4CEQ A;  3MCP A;  2ZM6 K;  3T69 A;  4FWQ A;  2CH5 A;  3ID6 A;  4H4M A;  3AA4 A;  1NKB A;  3CME N;  1U49 A;  2FBY A;  1QVF M;  2DFE A;  3VGK A;  3SQ1 A;  5AQT A;  4NYN A;  2RF2 A;  1MA9 B;  2YCH A;  4EIA A;  4CHO A;  2OPS A;  4IKF A;  4CK3 A;  3CC7 N;  3DXK A;  1ITG A;  1S6Q A;  1KAZ A;  4CJS A;  3HPH A;  1NU0 A;  4BR2 A;  3HVR A;  2RPI A;  5LY3 A;  3THY B;  4IOA L;  5HRS A;  1ILY A;  3O4N A;  1YAG A;  3WEE A;  1KVA A;  1SKS A;  5EVZ A;  4KKO A;  1F21 A;  3AO2 A;  4FLV A;  4JI8 K;  2HVI A;  1NGC A;  2HMP A;  1HX1 A;  1N36 K;  4LFB K;  3KK1 A;  4DQQ A;  1HNI A;  2FSJ A;  1EET A;  2QXL A;  4FOI A;  1YXQ A;  3V1Q A;  4KPY A;  3VEV A;  2HBJ A;  1WAF A;  2G8K A;  1SL0 A;  5C12 A;  4R79 A;  1RT4 A;  4BRE A;  1WB9 A;  2X74 A;  2A41 A;  4C1N I;  4FLY A;  1EXQ A;  4NXN K;  4GMJ B;  3P39 A;  4CJQ A;  1R59 O;  1RBT A;  2P9L B;  4CK2 A;  3DLR A;  3H1Q A;  3OHR A;  1T44 A;  1GLE G;  4CJW A;  1NKE A;  2OPR A;  1NGI A;  4HUG A;  4B9T A;  1M90 O;  4IWV A;  3R8E A;  5BRF A;  1NJY A;  3AA3 A;  2Q2R A;  4DV5 K;  2IVN A;  3SI6 A;  1U47 A;  4CFA A;  3KK3 A;  4MDA A;  4M42 A;  3EEQ A;  4DTR A;  3EO3 A;  1JKH A;  1RDC A;  3EE8 A;  3NGY A;  3WEE B;  1KSP A;  4H5W A;  2OYQ A;  1X3M A;  3CM5 A;  3QB0 A;  1S1U A;  3PY8 A;  4DSK A;  3EYZ A;  4FJM A;  3LP1 A;  4GV3 A;  1DEJ A;  4BC3 A;  4CJ4 A;  2J4R A;  3LAK A;  3MDQ A;  1IG9 A;  3CMA N;  2UXB K;  3TAF A;  2HST A;  3CIP A;  4B9V A;  3L4I A;  2RN2 A;  2NRH A;  3QIP A;  5D3G A;  1VQO N;  4BAC A;  3HOT A;  4KRE A;  3KHY A;  2HHV A;  2E1Z A;  3OYF A;  3ZCM A;  4RCH A;  1ZBI A;  1KTQ A;  1GLC G;  3CJ9 A;  2P9S B;  4M3T A;  4WCE L;  1DGK N;  1LOT B;  2NZT A;  3I8D A;  4GNI A;  3MK6 A;  3T1Y K;  1JCF A;  3DI6 A;  3AAR A;  4E0D A;  3LDP A;  1QZ5 A;  3K9J A;  4DF8 A;  4Z4C A;  4N76 A;  2CH6 A;  1Q8I A;  1Z26 A;  3VMF B;  3HOS A;  1U45 A;  1CZA N;  3NF7 A;  4KB0 A;  1HLU A;  1RBU A;  1LW0 A;  3F2K A;  4PKI A;  3SCX A;  2O4I A;  3R6M A;  4I6M A;  3RWU A;  1N5Y A;  4DSE A;  2X78 A;  4W5O A;  1KD1 O;  2KLA A;  1B92 A;  4J2A A;  3HTV A;  4U67 L;  3P1G A;  1Z25 A;  4BDP A;  4B1X B;  2QWP A;  4JNE A;  4OLB A;  4O8K A;  4BDZ A;  1KLN A;  1NGH A;  2PBD A;  4FJL A;  4IDK A;  3HRG A;  3SZ2 A;  5FPD A;  1TAQ A;  3SYZ A;  3PIP L;  3H3O B;  4E7H A;  2W6L A;  4IFE A;  4CER A;  4EP4 A;  1M1K O;  4AHU A;  3CCM N;  1S1T A;  2FBX A;  2HBK A;  1KAX A;  5JVH L;  1NGD A;  3G4S N;  1YHQ N;  1TK8 A;  1VSK A;  3LPT A;  5AQK A;  4CBU A;  3QER A;  5HOO A;  2YKM A;  4IJN A;  1VSL A;  3KTQ A;  3L2Q A;  3I33 A;  4XIU A;  4H03 B;  2R7Y A;  3MXM A;  5LMN K;  4CGH A;  3O9T A;  5M1Q A;  4M7X A;  4OPK A;  1KFS A;  1TYQ B;  2AP1 A;  4DQP A;  1J53 A;  3F9M A;  1HQU A;  4YOT A;  2XY6 A;  4IO9 L;  1T03 A;  2Z1J A;  1DLO A;  5BN9 A;  4DMN A;  4BR9 A;  2D0P A;  3ULE B;  5AZI B;  5HLF A;  4IXC A;  4CHQ A;  1QVG M;  1NGA A;  5AQM A;  3AGR A;  3KZB A;  3HL8 A;  2ZGZ A;  1WSG A;  4I6M B;  3CFR A;  2GWK A;  3SK3 A;  3QBW A;  3ZSZ A;  3K5N A;  4W5T A;  3BY5 A;  4MO4 A;  1ZBS A; 
#chains in the Genus database with same CATH homology
 3I0S A;  2OA8 A;  3SUP A;  4F2S A;  1FKO A;  4FJ7 A;  3K2P A;  4NYF A;  2ATQ A;  2OZS A;  1VSF A;  4M45 A;  4CED A;  1FK9 A;  2VG7 A;  3D45 A;  4UQG A;  4Z4E A;  3CQ8 A;  4G1Q A;  4CJU A;  4H8K A;  3ZT2 A;  5SZT A;  1JLG A;  4AHC A;  3K58 A;  1NJZ A;  2HMI A;  1YT3 A;  1HMV A;  3ZT4 A;  5C25 A;  4Z4G A;  3OYE A;  4HHT A;  1LAV A;  3IS9 A;  4FJ9 A;  4DS5 A;  4ICL A;  3LDS A;  3K5M A;  1RT1 A;  4DFJ A;  2KTQ A;  1RDB A;  4KI4 A;  4AHR A;  4I7F A;  1FKP A;  2KQ2 A;  3P83 D;  3CG7 A;  4I2Q A;  1S6P A;  1VSE A;  4O0J A;  1L3S A;  2DTU A;  3LP3 A;  2W42 A;  2XHB A;  2KZZ A;  3ZSV A;  1ZBF A;  2IOC A;  1RTD A;  3ZSX A;  4CFC A;  1A5V A;  2IGI A;  3CM6 A;  3WNF A;  4CF1 A;  4CJR A;  2PZS A;  2PYJ A;  4DTN A;  4ZTJ A;  4AHS A;  2B6A A;  5I3U A;  3DLK A;  1SL1 A;  3MED A;  3V6D A;  3AVM A;  1HQE A;  4M3R A;  4CF2 A;  3NGI A;  1GOA A;  3MEE A;  4CEA A;  1C1C A;  3LZJ A;  1D9D A;  2PY5 A;  1IKV A;  3FFI A;  4I9L A;  4CGG A;  3L3V A;  5HRO A;  3CFO A;  4HCC A;  3IRX A;  3SV4 A;  4CJL A;  4KTQ A;  4DG1 A;  1TL1 A;  2YNH A;  3DLG A;  3HVT A;  4N56 A;  4FM0 A;  3NBP A;  3L8B A;  1BI4 A;  2D5R A;  3OYN A;  1J5O A;  4E19 A;  2QKK A;  3HJF A;  1RTJ A;  1LAW A;  1WSI A;  5KRT A;  5C24 A;  3AVA A;  1KVC A;  1S9E A;  3ASM A;  3K5O A;  4OVL A;  1QSY A;  3SUO A;  3C95 A;  3E01 A;  3OS0 A;  4OGE A;  2HHT A;  3V9Z A;  1JXE A;  1IH7 A;  1XWL A;  5HRN A;  2XY7 A;  4OJR A;  3S3O A;  5DK5 A;  3AA5 X;  3OYC A;  1TVR A;  2XY8 A;  2YHA A;  3HT3 A;  3V9S A;  2HVH A;  2RKI A;  2HNZ A;  3MAQ A;  1BGX T;  4GW6 A;  3OYM A;  3NE6 A;  4KFB A;  4WE1 A;  3ZSQ A;  3VQ9 A;  3LWL A;  3O3G A;  4FLZ A;  3DLB A;  4J2B A;  1QS4 A;  1TKD A;  4DSL A;  3NHG A;  2P5O A;  4Q5V A;  5CZ1 A;  3OS2 A;  1ASV A;  2ITG A;  2P1J A;  4FLW A;  4DQS A;  2P5G A;  3M8R A;  4DSJ A;  3NH0 A;  4DTJ A;  2I5J A;  4FZZ A;  3AO1 A;  3ULD A;  1CXQ A;  3ZT0 A;  5J2P A;  2X6S A;  5CY4 A;  1BIS A;  4ID1 A;  4PQU A;  5E41 A;  3PO4 A;  4CJT A;  4DLE A;  1BHL A;  3AA2 A;  3M8Q A;  1QSS A;  4C8M A;  4B9S A;  1I39 A;  4F4K A;  1BIZ A;  5CYM A;  2KFN A;  4IBN A;  4DS4 A;  1JLQ A;  3CFP A;  1XC9 A;  4B08 A;  1WSE A;  1TAU A;  3G10 A;  3EY1 A;  3C6T A;  1X1P A;  3QIN A;  4JS4 A;  1JLA A;  4B8A B;  4Y1D A;  1NK4 A;  4C8L A;  2OZM A;  2HB5 A;  4LSN A;  1TK0 A;  1NK6 A;  1BIU A;  3ZT3 A;  4K8X A;  1LW2 A;  3HST B;  3L2W A;  4RW6 A;  1U48 A;  4DF4 A;  3AO3 A;  3KKS A;  1LV5 A;  1RT7 A;  2G8I A;  2A1S A;  3IG1 A;  3G0Z A;  4FJG A;  2EX3 A;  2IC3 A;  2G8U A;  1UWB A;  4PA1 A;  4QCL A;  1CXU A;  1BI4 B;  1IKW A;  1SUQ A;  1RBR A;  1NK5 A;  1NJW A;  2JLE A;  3OYB A;  4C8K A;  1GOC A;  4ZHR A;  1ZBL A;  4MFB A;  3RMD A;  4Q0B A;  5KGW A;  3VN5 A;  1S5J A;  2D0B A;  1Q9Y A;  4FLX A;  4BWM A;  4FLU A;  4E7L A;  4FZY A;  4M3Z A;  1VSH A;  3NCI A;  3NF9 A;  1Y97 A;  1TKT A;  4CHP A;  3HPO A;  3MXJ A;  3ZT1 A;  3EZ5 A;  4DFM A;  1S1V A;  1YTA A;  5HBM A;  1X9W A;  1JXB A;  1BQN A;  2FBT A;  2WON A;  1HRH A;  4GVM A;  2HND A;  4CJV A;  4E7K A;  3QNO A;  3SUN A;  4LH5 A;  1U4B A;  1KRP A;  4KI6 A;  5C42 A;  4CK1 A;  3V4I A;  1SV5 A;  4EZ6 A;  3NAE A;  1QTM A;  2P51 A;  3VQC A;  3OYA A;  5EU7 A;  4KHN A;  3AVK A;  1NK0 A;  4B9L A;  2F8T A;  4DFP A;  5KTQ A;  3NH2 A;  4DTO A;  4FJ8 A;  3VQP A;  2QK9 A;  3VQB A;  3KJV A;  4DTM A;  3SUQ A;  3VQ8 A;  4CHN A;  3WNH A;  3NFA A;  1S9G A;  1WSF A;  2DFH A;  3WNE A;  3SQ2 A;  4JLH A;  4DTS A;  3DLE A;  5J1E A;  3HYF A;  4R5P A;  2YNG A;  2XRI A;  2YHB A;  3HK2 A;  3WNG A;  5HRR A;  2KFZ A;  3NF8 A;  3NF6 A;  1RDA A;  4RW9 A;  4Y1C A;  1NOZ A;  1K6Y A;  2YV0 X;  1WLJ A;  4E7J A;  3V9U A;  3LAM A;  4RW4 A;  2A1R A;  4NCG A;  4F3T A;  2GV9 A;  1C0T A;  3OYD A;  1RBV A;  1RTI A;  1JL1 A;  1NK8 A;  2HHQ A;  4NCB A;  2DFF A;  3AVG A;  3KIO A;  3OVN A;  1C0M A;  3TAM A;  2Z1I A;  4CEO A;  2NUB A;  1RT2 A;  1WSJ A;  4FW2 A;  4IG3 A;  3F73 A;  4DLG A;  5J2M A;  4DWI A;  4CGF A;  1RT5 A;  4YFU A;  3U6F A;  1SL2 A;  3DMJ A;  1U04 A;  3L2U A;  2GBZ A;  4B9N A;  3AVN A;  1RNH A;  4FW1 A;  4CJF A;  3LWM A;  4CF9 A;  3LAN A;  3U3G A;  1RIL A;  4FJX A;  2X6N A;  4LY7 A;  1XI1 A;  4KHW A;  1QE1 A;  3SV3 A;  1L3T A;  3VA3 A;  2Z1H A;  1EKE A;  3O3F A;  1L5U A;  4DSI A;  3L3U A;  1ASW A;  4CJ3 A;  4IFV A;  3M8S A;  2B4J A;  4ELT A;  3ZSY A;  3TAR A;  1XHX A;  3NH1 A;  1YTU A;  5J2N A;  1LWC A;  3RR7 A;  1VSJ A;  3PUF A;  4FJJ A;  2D0C A;  1C6V A;  4OKE A;  3DYA A;  2HHW A;  3QEW A;  3V9X A;  1UAX A;  1HYZ A;  4ID5 A;  4M3U A;  1D5A A;  4I2P A;  1CZB A;  3S3N A;  3KLI A;  5HRP A;  3OYG A;  3KLG A;  3SJJ A;  3O3H A;  4ELV A;  1NKC A;  3DRR A;  3IAY A;  1EX4 A;  3HP6 A;  3CYM A;  2VWJ A;  1D9F A;  2BE2 A;  1VK0 A;  4CEC A;  4CIF A;  3B6P A;  3HM9 A;  1LWF A;  3VQD A;  4W5N A;  1RTH A;  4N47 A;  1WN7 A;  3MEC A;  1BCO A;  3DOL A;  3ZSW A;  1EP4 A;  3TI0 A;  1T7P A;  3NDK A;  4CJP A;  1ZYQ A;  4CF0 A;  3TAP A;  4KO0 A;  1Q9X A;  5CZ2 A;  4FJI A;  1J9A A;  5JS1 A;  4BE0 A;  1TL3 A;  3C94 A;  3AVI A;  3DOK A;  3QEI A;  3OJS A;  4M3Y A;  2QKB A;  4M3X A;  3AVF A;  3V1R A;  3OYL A;  3V1O A;  4NCA A;  4KHS A;  4CGD A;  3QIO A;  4CEQ A;  1REV A;  4EZ9 A;  1IO2 A;  1ASU A;  4H4M A;  4KHQ A;  4FVM A;  2Q3S A;  3AA4 A;  4ZTF A;  1NKB A;  4J2E A;  1KLM A;  2Z1G A;  4ELU A;  4E89 A;  1U49 A;  2FBY A;  4CF8 A;  3TAG A;  1UA0 A;  1JLC A;  2DFE A;  3K5L A;  2Y1I A;  3SQ1 A;  4FJK A;  4N41 A;  4NYN A;  2RF2 A;  3ALY A;  4O0I A;  2OPP A;  4CHO A;  2OPS A;  3TAE A;  4IKF A;  4CK3 A;  1ITG A;  1S6Q A;  4CJS A;  3QLH A;  4FJN A;  4CEB A;  3HPH A;  3HVR A;  1S1W A;  2RPI A;  4W5R A;  4KHU A;  1QQC A;  3KK2 A;  2E6M A;  4RW8 A;  4CJE A;  4DFK A;  1WNS A;  5HRS A;  4KAZ A;  3O4N A;  4OGC A;  1NJX A;  3VQ5 A;  3TWH A;  3SQ4 A;  4MQ3 A;  1A5W A;  1KVA A;  4B9M A;  3KD5 E;  1SKS A;  1G15 A;  4BDY A;  4KKO A;  1F21 A;  3AO2 A;  4FLV A;  3HO1 A;  3O4Q A;  3HP9 A;  2HVI A;  4IG0 A;  3RR8 A;  3B6O A;  4KRF A;  3C6U A;  3AVJ A;  3DLH A;  4F8R A;  1JLF A;  3KK1 A;  3LAL A;  3K59 A;  1HNI A;  4DQQ A;  1EET A;  4OPJ A;  2ZD1 A;  3V1Q A;  3VQ4 A;  2G8W A;  4KPY A;  1HYS A;  3DM2 A;  3QNN A;  3LP2 A;  1WAF A;  2IDO A;  2E6L A;  3OS1 A;  2G8K A;  1SL0 A;  4K8Z A;  3VQ7 A;  1TGO A;  3F9K A;  4CHY A;  4BE1 A;  1RT4 A;  5KI6 A;  1KVB A;  3SPZ A;  3S3M A;  3AVH A;  2HHU A;  1BQM A;  1VSI A;  3HXM A;  2X74 A;  4TSX A;  3RTV A;  4FLY A;  4Z4F A;  1JLB A;  1EXQ A;  2LSN A;  4GMJ B;  2F8S A;  4FJ5 A;  3PO5 A;  3OYI A;  4O55 A;  4OLA A;  4CJQ A;  3T19 A;  1LWE A;  2HNY A;  1RBT A;  3KKR A;  3KLF A;  1L3V A;  1O1W A;  1QSL A;  4CK2 A;  2B5J A;  3DLR A;  4CFB A;  1NK7 A;  1B9D A;  4CJW A;  1HYV A;  1TV6 A;  2E4L A;  3RMB A;  2OPR A;  1NKE A;  4CEF A;  1X9M A;  3V9W A;  4HUG A;  3QEV A;  1DTT A;  4E7I A;  4FJH A;  3D0P A;  1FXX A;  2WOM A;  4B9T A;  1HJR A;  1NJY A;  3P5J A;  1WSH A;  3AA3 A;  3A2F A;  3MXI A;  3PX6 A;  4I9Q A;  2EHG A;  1C1B A;  3SI6 A;  1SKW A;  1U47 A;  3KD1 E;  5K14 A;  4CFA A;  3ITH A;  2XO7 A;  3KK3 A;  4L8R B;  4M42 A;  3DRP A;  4KV8 A;  4B8C A;  4DTR A;  1XHZ A;  2OYQ A;  1JKH A;  1RDC A;  3NGY A;  4FLT A;  1KSP A;  4B9U A;  3AVC A;  2VG5 A;  1BL3 A;  4BE2 A;  3CM5 A;  4DQP A;  4CGJ A;  4M3W A;  3I0R A;  1S1U A;  3PY8 A;  3H08 A;  3EYZ A;  4DSK A;  2YNF A;  4O4G A;  1IKX A;  3LP1 A;  4FJM A;  4DQR A;  1DTQ A;  4CJ4 A;  3LAK A;  1IG9 A;  3QO9 A;  3RMA A;  2G8V A;  3TAF A;  4HUE A;  4PWD A;  3BGR A;  1TKX A;  2RN2 A;  1J54 A;  2IAJ A;  4DTU A;  3V81 A;  3QIP A;  4B9V A;  5D3G A;  2IS3 A;  4BAC A;  4PY5 A;  4CGI A;  1JL2 A;  3K57 A;  4KRE A;  4Z0U A;  4YNQ A;  3ISN C;  3ZSO A;  2BDP A;  1VRT A;  5FRM A;  5FRO A;  2HHV A;  2ZE2 A;  3OYF A;  3JYT A;  3T3F A;  4FK4 A;  3ZCM A;  4AHT A;  1MU2 A;  1UOC A;  5I42 A;  4HUF A;  4J2D A;  1SKR A;  1ZBI A;  1X9S A;  3SQ0 A;  3VQE A;  1KTQ A;  3QET A;  2YKN A;  4FK0 A;  4CJK A;  4M3T A;  2ZQB A;  3MEG A;  2HW3 A;  2D0A A;  1RDD A;  3I8D A;  4F2R A;  4W5Q A;  3QEP A;  1HPZ A;  3M8P A;  4OKK A;  3PX0 A;  4FXD A;  4HVJ A;  2BAN A;  1VSM A;  3DI6 A;  4JRP A;  2XY5 A;  5KRS A;  1UA1 A;  4E0D A;  4DF8 A;  1VSD A;  4QOZ B;  4KTW A;  3QES A;  4Z4C A;  4N76 A;  1Q8I A;  1YVU A;  1Z26 A;  4DTX A;  5SWM A;  1T05 A;  1U45 A;  4CFD A;  2O4G A;  3BDP A;  2KZM A;  3OYK A;  4KB0 A;  3NF7 A;  3L2R A;  3AO4 A;  4FM2 A;  1QHT A;  2JGU A;  4OKJ A;  5JS2 A;  2QXF A;  3SPY A;  2HHX A;  4AH9 A;  1RBU A;  4FCY A;  2VG6 A;  1LW0 A;  5HP1 A;  3TAQ A;  2PYL A;  4DQI A;  4KHY A;  3SCX A;  4CCH A;  4O44 A;  4CE9 A;  2O4I A;  3TAN A;  4CEE A;  3OY9 A;  4DSF A;  4HCB A;  4F3O A;  3U3Y A;  3RWU A;  1N5Y A;  4DSE A;  1W9H A;  2X78 A;  4W5O A;  3VQQ A;  2KW4 A;  2BGG A;  3KLE A;  1C1A A;  4FK2 A;  1B92 A;  4J2A A;  1TK5 A;  3P1G A;  1Z25 A;  3S9H A;  4IFY A;  1BCM A;  4BDP A;  1JLE A;  3AVL A;  5DMR A;  4OLB A;  4Z4H A;  4BDZ A;  4AIL C;  1KLN A;  4FJL A;  4IDK A;  4E3S A;  1CLQ A;  1VRU A;  3SZ2 A;  4DU1 A;  3QEX A;  4B3O A;  1TAQ A;  4QAG A;  4FYD A;  3SYZ A;  3ZSR A;  4E7H A;  4CEZ A;  2VWK A;  4RW7 A;  1I3A A;  4BWJ A;  4CER A;  4EP4 A;  3AV9 A;  4AHU A;  3L2V A;  1CZ9 A;  3RMC A;  1D8Y A;  1S1T A;  2FBX A;  1HNV A;  1C0U A;  4CIE A;  3LZI A;  4DTP A;  4KB1 A;  2F96 A;  4RG8 A;  1TK8 A;  1VSK A;  3LPT A;  4H4O A;  3QER A;  1KCF A;  4FM1 A;  4JS5 A;  4DU3 A;  2Y1J A;  1TKZ A;  3LP0 A;  4LH4 A;  4E1M A;  2YKM A;  1VSL A;  2AJQ A;  3KTQ A;  3L2Q A;  2GUI A;  4XIU A;  3TAB A;  3AVB A;  4HTU A;  2R7Y A;  3MXM A;  1W0H A;  1T8E A;  1NOY A;  3PX4 A;  4CGH A;  1RT3 A;  1R0A A;  3AO5 A;  4DU4 A;  1B9F A;  3SNN A;  2DY4 A;  4LD0 A;  4OPK A;  1KFS A;  2OPQ A;  3NGZ A;  3OJU A;  4M41 A;  4FZX C;  2G8H A;  1J53 A;  4CJ5 A;  1WAJ A;  3T1A A;  1HQU A;  4EP5 A;  3RRH A;  4LSL A;  2XY6 A;  5KGX A;  4E1N A;  3JSM A;  4C8O A;  4AHV A;  5FDL A;  4CES A;  2Z1J A;  1DLO A;  1T03 A;  2HHS A;  3VQA A;  2FC0 A;  4DMN A;  2YNI A;  2FBV A;  3LPU A;  4CIG A;  4Z4I A;  1RT6 A;  1A5X A;  3THV A;  2ETJ A;  3HPG A;  5HLF A;  3UIQ A;  1NK9 A;  3KLH A;  4CHQ A;  4C8N A;  3PV8 A;  1ZBU A;  4N5S A;  5CYQ A;  4JRQ A;  1ZBH A;  3DRS A;  4KTZ A;  3HL8 A;  5T7B A;  4O5B A;  1WSG A;  5FRN A;  4CHZ A;  3OYJ A;  3ZSZ A;  3CFR A;  3VA0 A;  1RCH A;  1KFD A;  1N6Q A;  2G8F A;  5J2Q A;  3RRG A;  4PUO A;  3K5N A;  1GOB A;  1RBS A;  1L3U A;  1IKY A;  4W5T A;  1S1X A;  3VQ6 A;  3OYH A;  3TR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...