3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
1TKXA 4RW4A 1LV5A 2HNZA 3G0ZA 1IH7A 4CEFA 1F21A 1Q8IA 2F96A 3JYTA 3AO1A 3HPHA 3OYMA 3EZ5A 3OYCA 1T8EA 3BGRA 3AVCA 3TAEA 4CEEA 3V9UA 4CGHA 1J54A 1NKCA 4CERA 3OYBA 3HK2A 3V9XA 1W9HA 3NBPA 2A1RA 4N47A 3HP6A 4KTQA 3MXIA 1KVBA 1X9SA 2QK9A 1C0MA 1JL2A 3A2FA 3AVNA 4CJQA 3M8SA 3EYZA 1WSHA 4HHTA 2FBYA 1XHZA 3K59A 3DLHA 1TAUA 4FJXA 1CZBA 1HJRA 3RRGA 3ZSOA 4DQQA 4M3WA 3TABA 4CJRA 3AVJA 1JXBA 2EX3A 2NUBA 2BE2A 5SZTA 3AVAA 4ELUA 1RBRA 1T05A 2QKBA 4CIGA 3OYNA 4BE2A 2IDOA 3SYZA 2WOMA 1O1WA 1VSDA 3S9HA 2HMIA 4FM0A 3K5LA 1BI4B 3KK3A 4FJJA 3PX4A 3F73A 1NJWA 1RTDA 3LPUA 4CJ5A 4DTPA 3SUOA 1RTIA 2BDPA 4FK0A 4CFDA 3AV9A 4O44A 4EP4A 5FROA 1RTJA 3SPYA 2G8HA 3QEPA 1TKTA 5T7BA 4DMNA 3K5MA 5FRNA 3BDPA 1EETA 4O0JA 3QEIA 1EXQA 4M41A 3DRRA 4Z4IA 4RW7A 3VQEA 4KB0A 4CJWA 1JLAA 4ELTA 3KK1A 1S6QA 3NFAA 3F9KA 1NK9A 2IC3A 2IS3A 4FJLA 3ZT0A 3AO4A 4N76A 3L2WA 1IKVA 3QEXA 3NF8A 3DOLA 3V6DA 4CGGA 4KRFA 2HHSA 4HUFA 1T03A 1DTQA 4HCBA 3LANA 3U3YA 3RMCA 1WAJA 4CJLA 3AVHA 1REVA 3PUFA 1X1PA 4IG3A 4W5TA 1TKDA 2PZSA 4FJ5A 4CJUA 1CLQA 2GUIA 4C8LA 5C24A 1KCFA 2X6NA 3QESA 1C0UA 3DI6A 4B9UA 3UIQA 2LSNA 2HNDA 3VQAA 2YNFA 4KB1A 5FDLA 3FFIA 1VSJA 4DLEA 4J2DA 5HRSA 5E41A 3SI6A 1RDCA 2OPQA 4JS4A 3AA4A 5HRPA 1T7PA 5D3GA 1S1VA 1JLQA 4B08A 4PA1A 4FVMA 4CEBA 1C0TA 4N56A 4FJKA 2YNHA 4KHWA 3HP9A 3MEDA 3DRSA 2YKNA 3L3VA 4I7FA 3QEWA 1RDAA 3HXMA 4DTMA 3AVLA 4CIEA 3SNNA 1D5AA 3NH1A 1L5UA 4CE9A 1ZBLA 4FZZA 4CECA 3VQBA 1RT6A 2OPRA 2HB5A 1LAWA 3DOKA 1HRHA 3G10A 1CZ9A 1VSFA 1WN7A 1VRUA 3K2PA 3QEVA 4NCBA 4R5PA 2KW4A 3ZSZA 2X78A 4Z0UA 4CFBA 3LDSA 3V9WA 4DTXA 4KI6A 3SV3A 4OKJA 4CJTA 4DTSA 1NK4A 3VN5A 3NH0A 1L3TA 2HHUA 2DY4A 4QOZB 3LPTA 4KO0A 4B8CA 4Y1DA 3TARA 4CGFA 1RDBA 1KRPA 1BGXT 3KLHA 1SUQA 3CQ8A 1K6YA 3P1GA 1UWBA 4AHSA 5CY4A 4CFCA 2D0BA 4CHPA 3E01A 3VA3A 5KGXA 4O5BA 1KLMA 4I2QA 2WONA 5I3UA 3NCIA 4BDZA 4J2EA 4F2SA 2HHQA 1B9DA 5EU7A 3ASMA 1UA0A 4F3OA 2VG5A 1WSJA 1BCMA 1SKRA 3WNHA 1CXUA 3K5OA 4IFVA 4O0IA 2KZMA 2OPPA 3KD1E 1LAVA 3WNGA 1NOZA 1S9EA 3IS9A 3NGZA 4KPYA 3AO3A 1FXXA 4DQRA 3PX0A 4FZYA 3O4NA 4DTNA 1UA1A 3LP3A 3OYHA 4W5RA 4KREA 3LZIA 1HNIA 1GOAA 1U48A 1C1BA 3OYLA 4NCGA 2Z1JA 1UAXA 1WNSA 3LWMA 1ZYQA 4DQIA 2B5JA 4EZ6A 1RT3A 4OGCA 3DYAA 3DLRA 1JKHA 2EHGA 1HYZA 1W0HA 3B6PA 3SPZA 4I9QA 1IO2A 4CK3A 3ULDA 3I8DA 4QAGA 1QQCA 4Q5VA 1TK0A 4KI4A 4FYDA 3M8QA 4DSEA 1QTMA 1I3AA 2YV0X 4MQ3A 4CF1A 4B9VA 3AA3A 4CGIA 3LZJA 3O3HA 5DMRA 3CG7A 4BE0A 5SWMA 4JLHA 1Y97A 3SUNA 2XY6A 1J9AA 3L3UA 4IBNA 4ID1A 5HRNA 2G8WA 1HYSA 3RRHA 1IKYA 4DU3A 3KLGA 3ISNC 3IAYA 1TK8A 1BIZA 3H08A 2HHVA 3VA0A 1NJZA 4G1QA 4W5OA 5FRMA 3ZSRA 4LH4A 1WSFA 3MXMA 3AVGA 1ZBIA 2AJQA 1CXQA 3AVMA 5J2NA 5J2MA 3SQ1A 3B6OA 3OYDA 4BDPA 4PY5A 1DLOA 3NGYA 5HLFA 2P5OA 3PX6A 3ZSWA 4E19A 4E1NA 3THVA 2OZMA 1IG9A 4DSJA 1VSMA 1EKEA 1ZBFA 2RKIA 3OYFA 3V4IA 3LP0A 4J2BA 3KD5E 4KKOA 3NHGA 4CJ3A 2D5RA 3S3NA 3MEGA 4FLUA 1X9MA 4GMJB 1HQEA 4DWIA 4BE1A 4OLAA 1JLBA 3ZT3A 4HTUA 2F8SA 4M45A 4B9SA 4WE1A 3WNFA 2F8TA 4AH9A 1DTTA 4KFBA 4AHCA 1NKBA 4CCHA 3C6TA 4LD0A 3SQ4A 3RMAA 4DF8A 3HPGA 5I42A 3AVKA 4LSLA 1IKWA 1MU2A 4FLWA 4CF0A 5CYQA 3V1QA 1SL0A 1KTQA 1A5WA 3ZT1A 4DFPA 1J53A 3P83D 3QNNA 4DQPA 4QCLA 1KLNA 4Q0BA 4OJRA 5K14A 1RNHA 1NJXA 2DTUA 2HVIA 1RBSA 2XO7A 1RTHA 1YVUA 4DU1A 4DTOA 4DTJA 1QE1A 1LW0A 2BANA 1WAFA 2VWKA 1HQUA 2QXFA 2RF2A 3L2RA 4JS5A 1TL3A 1VSKA 3ITHA 4FJHA 3ALYA 2YNIA 4OKKA 4K8XA 4DF4A 5C25A 4M3RA 4FJNA 1L3UA 2XY7A 4DTUA 3OYEA 4K8ZA 1QS4A 3TR8A 4E1MA 3ZSQA 4FJ8A 2ZQBA 3CM5A 3MEEA 3S3OA 1NK5A 1TK5A 4BWJA 3VQQA 4CF8A 4CJKA 3QLHA 1N5YA 2HHWA 3WNEA 3OJSA 4N41A 3AA5X 1JLGA 3AO5A 4CEOA 4Y1CA 2P51A 2VG6A 2X6SA 3ZCMA 3KLEA 3SCXA 4F2RA 4FLVA 2XRIA 1D9FA 1JLEA 1NJYA 3QERA 2P1JA 4NCAA 1QSSA 4KHUA 1NKEA 3OYIA 4N5SA 3HVRA 1Z25A 2DFHA 2E4LA 3C6UA 5J1EA 4CIFA 2PY5A 4BACA 4CJPA 3AVBA 4UQGA 2OZSA 4KHNA 5HP1A 4KTWA 4AHVA 1RCHA 3KKSA 2FBVA 5HRRA 3CYMA 4NYFA 3IRXA 2W42A 4KHSA 3KJVA 1LWFA 4HVJA 3K58A 2GV9A 5JS1A 2Z1HA 4E3SA 3RWUA 4M3YA 3C95A 4DSLA 2A1SA 3JSMA 4FK4A 1S1XA 4DG1A 2QKKA 4Z4GA 3NAEA 3TAQA 4W5NA 3OS0A 4JRPA 2DFEA 4F4KA 3ZSVA 1VSEA 1KFDA 1SKWA 3U6FA 4E7IA 1VSHA 4E7JA 4FJGA 4IFYA 1QSYA 2YHAA 1TV6A 1RT5A 1RBTA 3LALA 1I39A 1TVRA 2OPSA 4JRQA 3QNOA 3V81A 5CZ2A 1N6QA 1KSPA 3PO5A 4Z4EA 3OS2A 3HPOA 3M8RA 4OVLA 1B92A 1ASVA 1S1UA 4ICLA 3SJJA 1D8YA 2XY5A 1EP4A 1C1CA 4YNQA 4E89A 1G15A 3L2VA 1RILA 2B4JA 4Z4HA 2G8UA 4F3TA 4J2AA 2DFFA 1XHXA 2VWJA 2ETJA 4B8AB 2ATQA 1Q9XA 1UOCA 1IKXA 3O3FA 1VK0A 4OPKA 4CK2A 2ITGA 4XIUA 3V9SA 1BHLA 4B9LA 4CEQA 4CFAA 1QSLA 4DS4A 1FKPA 4OGEA 4CHZA 2PYLA 5KTQA 4GW6A 4M3UA 3SZ2A 5C42A 3VQ6A 4OLBA 5HROA 1JXEA 1RT4A 3NF7A 2D0CA 2G8KA 3RR8A 2HHXA 3SV4A 2YNGA 3PV8A 3TANA 4IG0A 1C1AA 3KTQA 1S1WA 5CZ1A 4DFJA 1JLCA 3SUQA 1B9FA 3HO1A 4M3TA 4LH5A 1RT7A 3KLFA 1A5VA 3NDKA 2G8IA 2Y1JA 3D0PA 2Y1IA 4C8OA 1JLFA 3NGIA 1XC9A 2YHBA 3HYFA 1NK7A 1J5OA 4C8KA 4FW1A 3DLKA 1KVAA 4EZ9A 2JGUA 3HL8A 2I5JA 4CHYA 3M8PA 4C8NA 4H4MA 2HW3A 1YTUA 1SL2A 4LSNA 2E6LA 1LW2A 1U45A 4AHRA 1S5JA 1D9DA 3TAPA 4FLZA 1TL1A 3U3GA 4IDKA 3HM9A 4IKFA 5J2QA 1HNVA 2R7YA 3C94A 1A5XA 3SQ2A 4E7HA 1ASWA 2Q3SA 4ZTJA 3IG1A 4H8KA 2Z1IA 1LWCA 3V9ZA 1WSIA 1VSLA 1HMVA 2O4GA 4MFBA 4FW2A 4DFMA 3OY9A 4RG8A 3VQ7A 1BCOA 3RMDA 3OYKA 3KKRA 1EX4A 3V1RA 3OJUA 2E6MA 2X74A 3T1AA 1BIUA 4TSXA 3OYGA 3CM6A 1RT1A 3LAMA 4CJFA 3TI0A 3HJFA 2RN2A 2KQ2A 2FBXA 3OVNA 1Z26A 5KRTA 4FLYA 3NE6A 3QETA 1SKSA 1FK9A 3VQ8A 3PO4A 4CEDA 1X9WA 4I9LA 2Z1GA 4ZTFA 3DMJA 4BWMA 4AHUA 1U47A 2ZD1A 3NF9A 1VSIA 3VQCA 3HT3A 3EY1A 4DU4A 4H4OA 4HCCA 3QIPA 1BL3A 5DK5A 3QINA 3ZT4A 1XWLA 4NYNA 2XY8A 3VQDA 3L2UA 3DLBA 4Z4CA 4DS5A 4DSIA 4CHQA 2IOCA 1TKZA 3I0RA 2RPIA 1HPZA 4M42A 1VRTA 2FBTA 4RW8A 3O3GA 1S6PA 4AHTA 1Q9YA 1WLJA 4EP5A 1YT3A 2O4IA 3VQ4A 3QIOA 3LP2A 5KGWA 2KTQA 2IAJA 3DLGA 2VG7A 3LWLA 1NK8A 2BGGA 3T3FA 2OA8A 3AA2A 3V1OA 1TGOA 3VQ5A 5JS2A 4KHQA 4FXDA 1C6VA 1LWEA 4CK1A 4YFUA 4RW9A 4M3XA 4KTZA 3DLEA 3NF6A 4ZHRA 2G8FA 3S3MA 1RBVA 1XI1A 1S1TA 3AVIA 3TWHA 1NK0A 1U49A 3PY8A 3KIOA 4KAZA 2HHTA 4Z4FA 1BI4A 4DLGA 3KLIA 4FM2A 2HNYA 2PYJA 4CHOA 2KFNA 1S9GA 4FM1A 4CJVA 1BISA 4BDYA 3QO9A 2D0AA 4FLTA 4CF9A 4PWDA 3L2QA 4CGDA 3TAGA 4HUGA 4F8RA 5KRSA 5KI6A 3ZT2A 4DTRA 3O4QA 1RDDA 3RTVA 3ZSYA 1QHTA 1RBUA 4CF2A 3SUPA 4AILC 2YKMA 5J2PA 3D45A 2IGIA 2HVHA 5HBMA 4PQUA 3OYAA 4FJ9A 3LAKA 4I2PA 4DSKA 3CFRA 4FJ7A 1GOBA 4E7KA 1YTAA 4ID5A 4CEZA 4DSFA 1L3SA 2OYQA 3K57A 1KVCA 4W5QA 3P5JA 3TAFA 2XHBA 3OS1A 1WSGA 4OKEA 4FCYA 4B9MA 3T19A 3MAQA 4FJMA 4E7LA 4O55A 4B9NA 3LP1A 4CEAA 1R0AA 4DFKA 4E0DA 3MXJA 3DM2A 4C8MA 1TAQA 3VQ9A 2P5GA 3SQ0A 4CJSA 3VQPA 2ZE2A 3K5NA 1NK6A 3AO2A 2B6AA 4O4GA 4L8RB 2KZZA 4DQSA 3ZSXA 3RMBA 4CJ4A 4B3OA 1GOCA 4CGJA 4HUEA 1SV5A 4OPJA 4CHNA 1ITGA 1U4BA 1SL1A 4FZXC 1BQNA 1WSEA 3CFPA 3TAMA 3DRPA 1FKOA 4CESA 3NH2A 1L3VA 3RR7A 4M3ZA 1HYVA 2GBZA 4LY7A 4FJIA 1NOYA 2JLEA 1U04A 1ZBHA 1RT2A 1ZBUA 1ASUA 2FC0A 4GVMA 4CJEA 3KK2A 4B9TA 4ELVA 4KV8A 2G8VA 3AVFA 5CYMA 1JL1A 3HVTA 3MECA 3CFOA 1KFSA 4FK2A 3OYJA 4PUOA 2KFZA 1BQMA 4FLXA 3L8BA 3HSTB 4KHYA 4RW6A 3I0SA
chains in the Genus database with same CATH superfamily
1TKXA 5FLXO 2VGNA 2QI2A 3I55N 3CC4N 2VQFK 4CEFA 3JYTA 3C7NA 3FGUA 3AVCA 4YDUA 4X62K 2VYPA 4NLCA 4N47A 5TKWA 3AVNA 1JL2A 2OTLN 4CJQA 3M8SA 5AQTA 2FBYA 2UUAK 3K59A 3ZETA 2QXLA 4YOTA 3D6RA 1TAUA 1HJRA 4K25A 3J80O 4DQQA 2W6LA 3TABA 1JXBA 5C12A 2D4WA 5AQIA 3SYZA 2WOMA 1O1WA 2HMIA 4FM0A 5LMUK 4KBOA 3KK3A 4FJJA 1RTDA 1IV0A 2KKZA 1RTIA 3CC2N 2KHOA 5F1XA 3SPYA 3EE8A 2G8HA 3QEPA 4O8UA 4PHTX 1EETA 1MA9B 2CH6A 4O0JA 3QEIA 4BRAA 1N33K 4RW7A 3CF5L 1JLAA 4ELTA 4BGBA 4CD1A 3F9KA 1NK9A 2IC3A 5AQUA 4CZHA 3GBTA 1IKVA 1BWFO 3NF8A 4AF1A 2NLXA 4KRFA 4HUFA 3RMCA 3ZX2A 3PUFA 3QFUA 1X1PA 4WYBA 1Q18A 3ZEUA 2PZSA 2W40A 5AZIB 3A8YA 2X6NA 3QESA 3DI6A 3HTVA 4B9UA 2HNDA 2YNFA 4WFNL 3FFIA 3VTIA 3SMPA 4CBWA 1U2VA 4BR2A 2NRHA 2HBLA 2E2PA 2YNHA 4CZJA 4MLHA 4I7FA 5C2DA 2P9PB 4CJ7A 4DTMA 3L0QA 1L5UA 4JK8A 1ZBLA 1MWMA 1LAWA 4NCBA 4A57A 3CJCA 3ZSZA 2QWMA 3V9WA 1NM1A 3L6QA 2ASPA 3VEYA 1GLBG 3VN5A 3NH0A 2DY4A 3WT0A 2PBDA 3TSUA 1BGXT 1SUQA 3CQ8A 4EHUA 3CXCM 4JI3K 1UWBA 3AGRA 3VA3A 4JI5K 5KGXA 2NZTA 5GAHP 5I3UA 3NCIA 4A59A 2IIRA 1ATRA 2JWLA 4JEPA 5AJ3K 1VQ9N 1CXUA 3KD1E 2OTJN 3IDHA 2WBNA 1S9EA 1YVNA 3NGZA 4H5NA 4KPYA 3IKMA 1IBKK 4FZYA 4DTNA 3LZIA 1HNIA 1C1BA 1ZYQA 1RT3A 5ADXH 4LF7K 4BRMA 3SPZA 4I9QA 5BRDA 4KI4A 4Q5VA 3M8QA 3GL1A 1W7AA 1QHAA 5AR0A 3CG7A 1NMNA 3SUNA 1MWKA 4JI0K 4IBNA 3L3UA 4PL8A 5HRNA 3RRHA 3CMEN 4DU3A 2QWNA 1BIZA 4CZIA 1NJZA 4W5OA 4FWRA 4JKBA 1OKJA 2Q31A 4IO9L 2QWOA 1IG8A 3ULEA 3SQ1A 5J2MA 4PY5A 2E2NA 3B6OA 1DLOA 3NGYA 3ZSWA 3THXA 3CCLN 3P39A 3KD5E 3I8BA 5AZJB 4DWIA 4FLUA 4GMJB 4WQ5C 4HTUA 4H5RA 4M45A 1LCUA 2DPNA 4B9SA 4AH9A 1DTTA 4LD0A 3OBWA 3EL2A 4JK9A 4DV0K 5CYQA 1GLCG 1J53A 1HJOA 2FXUA 1XC3A 1Y64A 2DTUA 2HVIA 1RBSA 4DU1A 1OVYA 4IZ9A 1LW0A 1O13A 1HQUA 3HOSA 5GAGP 3SAHA 2A6AA 3LDOA 3HZ6A 4JKGA 5C25A 3M6GA 1BG3A 2J4RA 4DTUA 3C65A 3CIPA 3K0SA 3TR8A 1ILYA 1BU6O 2ZQBA 2NRWA 3MEEA 5M1QA 3U9ZA 1KXPA 1BOTO 1GLJO 3O4WA 4BWJA 3VQQA 4CF8A 2HHWA 1JLGA 1E4FT 1Q86O 2P51A 4BVPA 4BC2A 4B3SK 1E3MA 2XRIA 1D9FA 3QERA 4Z94A 4KHUA 3BF1A 3MMVA 5AFUA 2DFHA 2P9SB 3C6UA 5J1EA 4AM7A 3AVBA 4KHNA 3W0LA 4AHVA 3IRXA 1XNQK 4HVJA 3K58A 5AQZA 5JS1A 4E3SA 2A42A 3SK3A 3O9RA 1KAXA 4DSLA 2A1SA 3JSMA 1S1XA 1YHQN 5LMNK 5JVHL 3OS0A 4JRPA 1KFDA 3U6FA 1VSHA 4E7JA 1XNRK 5CE3A 4FJGA 4IFYA 1RT5A 3ENBA 2OPSA 3QNOA 3PO5A 3FZFA 3M8RA 3JAMO 4X64K 4LF9K 4EIAA 1C1CA 5BPLA 4BRDA 4O5FA 3PLAA 1J5EK 1NGGA 4BY9C 2E1ZA 3N4QA 3TSPA 1DEJA 4CK2A 2ITGA 4B9LA 1EWRA 3UKRB 4CFAA 4JI6K 1YAGA 4DS4A 3FLCO 2NRZA 4OGEA 4CHZA 1MDUB 4M3UA 3CCRN 3VQ6A 3NF7A 3SMSA 4FWNA 2HHXA 3SV4A 3U4LA 1EQYA 2YHYA 3F5TA 1ESVA 5CZ1A 1JLCA 1VQPN 3HO1A 3KLFA 3ZX0A 3WXIA 3NGIA 4H5WA 1XC9A 2YHBA 1NK7A 1P8ZA 4H5TA 4BC3A 4DV6K 2HW3A 3FFKB 2E6LA 1D9DA 3TAPA 1NBWA 4H0VB 3MWPA 3MK6A 3WEEB 4IKFA 3O9SA 1HNVA 2R7YA 3C94A 4E7HA 2P9KB 1YIJN 4H8KA 3V9ZA 1WSIA 2YI1A 3KKRA 3V1RA 3LAMA 2FSJA 5KRTA 4JKDA 3JXUA 4ZTFA 2Z1GA 3AGKA 2I7NA 3VEXA 2ZD1A 1K9MO 3VQCA 4YOWA 3ZT4A 4YOVA 5LY3A 3CPEA 4FOIA 3VQDA 4H0PA 2IOCA 3KK7A 5KPZA 4X66K 4M42A 1VRTA 4RW8A 3O3GA 1WLJA 4EP5A 2JWKA 2OA8A 4BRQA 3DLEA 3NF6A 2CGJA 5JLHA 1XI1A 1S1TA 3PY8A 3KIOA 4CZLA 2HHTA 4Z4FA 4FM2A 2HNYA 4CHOA 2KFNA 3WXKA 2E20A 4FM1A 1BISA 3MWTA 2F7TA 3CMAN 4CF9A 4F8RA 4HUGA 3RTVA 2KLAA 1RGIA 1QHTA 1RBUA 3SUPA 3VTHA 4DR7K 3FZKA 2AP1A 2IGIA 2HVHA 4WFAL 2P9NA 2RE2A 4FVUA 1GOBA 3H45C 1YTAA 1NGJA 1L3SA 3HI0A 3K57A 4PKIA 4JKAA 3P5JA 1WSGA 4FCYA 4O55A 4CEAA 4BQZA 4BG8A 4C8MA 4CJSA 2ZWHA 1NK6A 3AO2A 1G99A 4DQSA 4X65K 3FE1A 3FR0A 4CJ4A 2GWJA 1GOCA 4B3OA 2Q97A 5AQMA 4CGJA 2YCHA 1SV5A 4HUEA 4CHNA 1ITGA 4FZXC 1BQNA 3TAMA 2E8AA 4CESA 2JLEA 1U04A 1RT2A 4B9TA 1ASUA 3AVFA 5CYMA 3MECA 4FK2A 2KFZA 2P9UB 1BQMA 4FLXA 3L8BA 3THXB 4RW4A 2HNZA 1IH7A 1Q8IA 3HPHA 3OYMA 2GELA 4C23A 3GE1A 4CERA 1QQNA 5EY4A 1XQSC 3V9XA 1W9HA 2A1RA 3WXJA 4KTQA 3HP6A 4BC4A 1KVBA 3MXIA 1NWKA 3A2FA 1XHZA 2P9LA 4H0OA 5GAEP 1NU0A 3VGKA 4GNIA 3C6HA 4IEEA 5BPMA 4CJRA 3AVJA 5EXWA 5FPDA 3OBYA 1HPMA 2BE2A 1CZAN 2AJQA 4CIGA 3OYNA 3S9HA 4G9ZA 4LFBK 4JV5K 4A5BA 3C7NB 4CJ5A 3PSIA 4CFDA 3AV9A 3CETA 5FROA 3MN6A 2FLOA 4DMNA 3K5MA 5FRNA 4WQ4A 2Q0UA 4B1YB 2D1KA 1EXQA 3DRRA 3U9DA 4DR5K 3KK1A 3O08A 3ZT0A 3DOLA 2UXCK 4FWSA 4CGGA 1OH5A 4HCBA 1DTQA 3G6EN 1N8RO 1REVA 1CLQA 4CJUA 3UKUA 1QQMA 2GUIA 4L3QA 1NGDA 4CZGA 1V4SA 3LL3A 2LSNA 1X9JA 2YJFA 2D0OA 4O8KA 2O8EB 4J2DA 3SI6A 1RDCA 2OPQA 4JS4A 3AA4A 1XMOK 1T7PA 3R1XA 4I6MA 1C0TA 2HBMA 2V7ZA 3AAQA 4UY8O 4KHWA 3HP9A 3B8AX 3ATUA 3HXMA 2P9PA 3SNNA 1VQ8N 1D5AA 3NH1A 2UU9K 4CE9A 2EWSA 4CW7B 4JI4K 3VQBA 1QTMA 2HB5A 3DOKA 1JCFA 1WN7A 3LDSA 4Z0UA 3A5LC 1HKBA 1HUXA 3SV3A 3ZX3A 4CBUA 5AQKA 4AM6A 4DTSA 3PIOL 1L3TA 3FZHA 3RSEA 4QS9A 4CGFA 1RDBA 2WTUA 1KRPA 4AHSA 1M1KO 4CFCA 5FPNA 4GKKK 1KLMA 3J7YP 4F2SA 2GX9A 3ASMA 1YJWN 3SBTA 1SKRA 3WNHA 2QTDA 1HR0K 4O0IA 2OPPA 1LAVA 3IS9A 3AO3A 1FXXA 4LF4K 2GEMA 4W5RA 2YHXA 1X3NA 3VMFB 4DQIA 3EN9A 4OGCA 4NXNK 4GV3A 3B6PA 3EKSA 4U67L 4CK3A 3CCVN 3I8DA 1QQCA 4BR9A 4DSEA 1QVGM 3LZJA 3ID8A 4BE0A 5SWMA 4JLHA 4WCEL 2XY6A 1J9AA 2G8WA 1IBMK 4IO8A 4BRFA 2O8BA 5M1FA 1YJ9N 3CCEN 3VA0A 4G1QA 4LH4A 2O8FB 1WSFA 3MXMA 1ZBIA 1CXQA 3OYDA 4DR3K 3EKUA 3R6MA 1GLDG 2Q1NA 5HLFA 2P5OA 2V52B 5M1PA 3THVA 1VSMA 1EKEA 2RKIA 4YDUC 3V4IA 4PKGA 2V51B 4CJ3A 3MEGA 1HQEA 1QQOA 4BE1A 4NB4A 4WE1A 3WNFA 5B8HA 1NKBA 3C6TA 4JI2K 4DF8A 5DM6L 4FLWA 4CF0A 3V1QA 3ZT1A 4DFPA 3QNNA 4Q0BA 4OJRA 3Q7BA 5K14A 3MX5A 1T6CA 2E88A 2HMPA 1YVUA 1VQ6N 3SAFA 1QE1A 2BANA 3DWLA 4FJHA 3L2RA 3H1QA 4OKKA 4WQ4C 3G71N 4M3RA 4MO4A 4FJNA 1SS6A 5AQNA 1QS4A 2IVNA 3D7EO 3CM5A 1Z6RA 3WNEA 2O8CA 2VG6A 3ZCMA 4IJAA 1NJYA 2P1JA 1QSSA 3VGMA 4N5SA 3HVRA 2PFUA 4DV2K 4UQGA 4BRPA 2VWBA 1TUYA 1K8AO 1RCHA 5HRRA 3FZMA 1N36K 1LWFA 2ZGZA 3THWA 4M3YA 3P38A 2WUSA 3NAEA 3TAQA 3K9JA 5KPRA 4ISGA 5JVGL 4E7IA 1GLFO 4FWLA 3EZWA 2YHAA 3LALA 4IJNA 3CCJN 3V81A 1TVRA 1D4XA 4DUZK 1Q7YO 4ICLA 4ISFA 4EFHA 4E89A 1G15A 3UKRA 2GUPA 4F3TA 2A40A 2ETJA 3CERA 4B8AB 1UOCA 1IKXA 4XIUA 3V9SA 1QSLA 1FKPA 4FPBA 4DCHA 2ZM6K 5M1NA 5KTQA 2PYLA 2RHKA 4OLBA 1JXEA 1RT4A 5AFUH 2D0CA 3RR8A 4YY3K 2QWPA 3TANA 4IG0A 1S1WA 1B9FA 5AQRA 4M3TA 2Y1JA 3D0PA 1JLFA 3M5RA 3HYFA 2Q36A 1J5OA 3DLKA 3M8PA 5MLCQ 4DV7K 4KH6A 4AHRA 1HNXK 2O8FA 4GKJK 1NGFA 3DXKB 1ASWA 3AY9A 2Q3SA 5F2RA 3IG1A 5AQGA 1NJIO 1Z05A 5AQVA 3CCMN 4MFBA 1N34K 3VQ7A 3RMDA 3OYKA 1S22A 3GOIA 1T44A 5AQQA 1EX4A 3OJUA 4BR0A 3T1AA 4BQLA 2QWLA 3CM6A 1RT1A 2FBXA 1TYQA 3ENHA 5ELZA 3VEZA 3VF6A 4RCHA 2UYTA 1SKSA 1FK9A 4I9LA 3CHWA 4XH5A 4BWMA 3J7ZO 3EY1A 4DU4A 5AQXA 1SZ2A 3L2UA 4DSIA 5AQWA 4Z4CA 1TKZA 4DUYK 4MDBA 1HPZA 1S6PA 4BREA 4CZEA 1K8KA 3VQ4A 3LP2A 3CJ7A 1IBLK 3DLGA 1TGOA 4FXDA 1LWEA 4YFUA 3THWB 4M3XA 3CQYA 4ZHRA 3ULEB 2QWRA 4R79A 3LM9A 4OX9K 4BRNA 4BDYA 3AAPA 1JJ2M 2D0AA 4B9QA 4FLTA 3CI5A 3BEXA 3TAGA 5TKYA 3EEQA 3ZT2A 3O1BA 3ZSYA 3D2EA 2YKMA 3LDLA 4DR2K 3OYAA 2V7YA 2WC9A 5I9EB 4ID5A 2FSKA 4ILHA 4FOEA 1KVCA 4A5AA 4W5QA 3VEOA 3TAFA 4CD3A 3OS1A 4B9MA 3MAQA 3MXJA 1TAQA 3VQ9A 2P5GA 3NVKA 2ZE2A 2B6AA 3HRGA 4O4GA 4L8RB 3RMBA 3QB0A 4A62A 1U4BA 1SL1A 4Y0WA 5A2QO 1FKOA 3NH2A 4PL7A 1HYVA 2GBZA 4JI1K 3MCPA 3H3OB 3KK2A 3IFRA 2G8VA 1JL1A 1QVFM 4PUOA 3OYJA 4F9OA 2KZMA 3HSTB 5GADP 3TTFA 1F21A 2F96A 1T8EA 4RWTA 5AQSA 4LFAK 4CEEA 3EO3A 1J54A 5CR4A 1NKCA 4A2BA 2F9TA 3NBPA 4H0XB 5AQYA 2QK9A 1NGBA 2Q2RA 3EYZA 1WSHA 3MN5A 3QBWA 2P9LB 3VOVA 2EX3A 1S3XA 3OA9A 4JKEA 1RDUA 3LM2A 3PIPL 1RBRA 1T05A 4BE2A 2IDOA 4DHYA 3K5LA 1WB9A 1TUUA 3PX4A 3F73A 3LPUA 3SUOA 2BDPA 2BTFA 1X3MA 2IVOA 5T7BA 1NGHA 3BDPA 4DB3A 4Z4IA 3VQEA 4KB0A 1BA0A 4CZFA 3NFAA 2IS3A 1YF5L 3E66A 4IEIA 2E2OA 4HTLA 4DR6K 1DKGD 4FWQA 1BDGA 3FZLA 3LANA 3U3YA 1WAJA 4W5TA 4IG3A 4FJ5A 2ZGYA 2CGKA 3BUZB 4C8LA 3G4SN 5C24A 1KCFA 3VQAA 4KB1A 4B3RK 2ASMA 5FDLA 1VSJA 4DLEA 3LDPA 5HRSA 4DV4K 4BGAA 1S1VA 4WF9L 4PA1A 4CEBA 5BN8A 4N56A 2P9NB 4DV1K 3E9LA 3CCQN 3ZLJA 3L3VA 2YKNA 1RDAA 3AVLA 4CIEA 1BA1A 4JNEA 1HRHA 3G10A 3K2PA 1H1VA 1VRUA 3HM8A 3DXKA 2X78A 4DTXA 5IT9O 4KI6A 4QS8A 4OKJA 4K43A 2NRTA 3H3NO 2O8EA 3TU5A 3VERA 4DR1K 3LPTA 4KO0A 4B1ZA 4Y1DA 4E1JA 4RTFD 1FJGK 2ZJPL 1K6YA 3P1GA 5CY4A 4DR4K 2D0BA 4CHPA 3E01A 4BVOA 4IFEA 4I2QA 4BDZA 1WSJA 3SLCA 1GLEG 3K5OA 3VF4A 3WNGA 3WXMB 4IOAL 4DQRA 1HNZK 3CC7N 1UA1A 2A41A 3LP3A 4KREA 3R9PA 1U48A 5BR9A 4NCGA 4B3TK 1UAXA 4JI7K 4EZ6A 1WUAA 4BRCA 3DYAA 1W0HA 1IO2A 3ULDA 1ZXOA 5GIPA 5FPEA 4QAGA 3NVMA 4FYDA 1I3AA 4B9VA 4CGIA 2HF4A 3O3HA 4FWKA 1Y97A 4C1NK 4FWPA 2P9KA 4MO5A 2NRRA 1T6DA 3ISNC 1TK8A 3H08A 1KAZA 5FRMA 3ZSRA 4BRKA 1VQLN 3IUCA 5J2NA 4BDPA 3C0BA 1M90O 4E19A 1IG9A 3OYFA 2P9UA 4IWVA 4A2AA 4BR5A 3CCUN 4KHPK 3NHGA 4YOUA 2D5RA 1VAZA 1X9MA 5AQFA 4OLAA 1JLBA 2O8CB 5EX5A 4CCHA 5AQOA 2BH1A 3SQ4A 5I42A 3HPGA 3AVKA 4LSLA 1IKWA 1SL0A 4BRHA 1KTQA 1A5WA 4QCLA 5EVZA 1NJXA 1HLUA 1SQKA 2ZJRL 3BZCA 1RTHA 4DTOA 2UXBK 3BY5A 1WAFA 4JS5A 2QXFA 1TYQB 1VSKA 3ITHA 4K8XA 2IVPA 4NXMK 4K41A 1LOTB 2XY7A 3OYEA 2I7PA 2BUPA 4IDHA 4FJ8A 1VQMN 4GV6A 3A0IX 1NK5A 1TK5A 1N5YA 4N41A 3AA5X 1ATNA 5ADXA 3KLEA 3SCXA 4F2RA 4FLVA 3CPWM 1U6ZA 2O8DB 4B1WB 1Z25A 4CJPA 3J7AP 2OZSA 5HP1A 4FL9A 3G25A 2W42A 3CYMA 4NYFA 3KJVA 1JCGA 2P9SA 3RWUA 1KQSM 4M7XA 3BF3A 3C95A 4FK4A 2QKKA 4Z4GA 5LJVA 4W5NA 3D2FA 3L4QA 4F4KA 1OH8A 1VSEA 1SKWA 2A5XA 1QSYA 1TV6A 4JRQA 1RBTA 1I39A 1N6QA 5KQDA 2VCPA 4Z4EA 1NLVA 3OS2A 3C6AA 3HPOA 3VESA 4CZKA 1ASVA 3SJJA 1D8YA 1FW6A 2XY5A 4YNQA 3Q7CA 4JD2B 5E84A 5KQ8A 3L2VA 4Z4HA 5F0XA 4DQ8A 1XHXA 2VWJA 1W97L 1YUWA 1VK0A 4OPKA 4JKHA 1BHLA 2GWKA 3I56N 2WFBA 4DV3K 4EAHD 3T1YK 3MN9A 3SZ2A 4FSVA 5C42A 5HROA 2G8KA 2YNGA 3KTQA 3WXLA 3SUQA 2H3GX 2FSNA 4LH5A 1A5VA 2G8IA 2Y1IA 4C8OA 3CQXA 4BRGA 4C8KA 4FW1A 1KVAA 4EZ9A 3HL8A 2I5JA 4H4MA 1YTUA 1U45A 3J81O 4FLZA 1TL1A 5FPMA 3U3GA 3HM9A 4BRIA 2Q0RA 4ZTJA 2Z1IA 1LWCA 1HMVA 2O4GA 4FW2A 4DFMA 4IOCL 3H1VX 2VQEK 2E6MA 2UUCK 1EO1A 4CJFA 3TI0A 4ILGB 3HJFA 2RN2A 3OVNA 3CD6N 4XEIA 3NE6A 3QETA 3L4IA 1KD1O 3PO4A 4CEDA 1X9WA 3DMJA 4AHUA 1U47A 3KHYA 1VSIA 4YOXA 3HT3A 4H4OA 3UKUB 1BL3A 3QINA 3A5MC 1XWLA 4PKHA 2AA4A 4NYNA 3DLBA 4DS5A 4IOXA 3I0RA 2RPIA 1YT3A 1P90A 2O4IA 3QIOA 3D2FB 3CJ9A 2ZJQL 2IAJA 2BGGA 3LWLA 3T3FA 3AA2A 3M1FA 3V1OA 4CI6A 3VQ5A 4CK1A 4J8FA 4RW9A 2G8FA 3S3MA 1RBVA 1ZBSA 3TWHA 3A5NC 1U49A 4KAZA 1BI4A 4DLGA 3KLIA 5M1OA 1S9GA 4CJVA 3E1YA 4PWDA 3L2QA 5KRSA 4DTRA 1RDDA 5C15A 4CF2A 4AILC 2HF3A 4DSKA 4E7KA 4CEZA 1RFQA 3CJBA 3THYB 3O9UA 2OYQA 2OANA 2YHWA 1EWQA 2QWQA 4FJMA 4B9NA 3F2KA 1R0AA 3WUHA 3DM2A 4OPHA 2CH5A 3SQ0A 3EE9A 4DV5K 4FPAA 2ITMA 3ZEUB 3ZSXA 3HBTA 3QFPA 4C1NI 4OPJA 2YX6A 4FO0A 1NNEA 3RR7A 1L3VA 4LY7A 3TTDA 1NOYA 1ZBHA 2FC0A 4GVMA 4ELVA 4CJEA 5AZJA 4KV8A 2F4VK 3HVTA 1KFSA 4A61A 4KHYA 1SAZA 1LV5A 3RSEB 3G0ZA 4IXCA 3EZ5A 3AO1A 3CCSN 3OYCA 1VQNN 3BGRA 1NGCA 3TAEA 3V9UA 4CGHA 3THYA 3OYBA 3HK2A 1X9SA 1C0MA 4HHTA 3DLHA 1E4GT 4V19S 4FJXA 1CZBA 3ZETB 3RRGA 3ZSOA 1VQKN 4M3WA 1KC8O 3NMUA 2NUBA 3H46O 5SZTA 1Q81O 3AVAA 3LDNA 4B1XB 4ELUA 2QKBA 3QMLA 1VSDA 1BI4B 1HKGA 5HL7L 4NLBA 1NGAA 1NJWA 4DTPA 4FK0A 4EP4A 4O44A 4KH5A 1RTJA 3IMXA 1TKTA 3E9PA 1VHXA 4M41A 1NMDA 3M3ZA 4CJWA 1Q82O 1DGKN 1S6QA 4FJLA 4N76A 3AO4A 3L2WA 3QEXA 4LF8K 3V6DA 2HHSA 1T03A 4CJLA 3AVHA 3DAWA 1TKDA 3O80A 1C0UA 3UIQA 1OH6A 3MN7A 2NNWA 3U8XA 3TPQA 2E1YA 5E41A 4XH1A 5HRPA 5D3GA 2CGLA 1JLQA 4B08A 3J8AA 4FVMA 4M7YA 4M63C 1IJJA 2QA4N 4WFBL 2QEXN 4FJKA 3MEDA 3DRSA 3QEWA 2W6KA 3D2EB 1YXQA 1OH7A 4LF6K 4FZZA 4CECA 1RT6A 2OPRA 3OHRA 4FJ9A 3DLLL 1CZ9A 1VSFA 3QEVA 3AARA 4FWOA 2P9IA 2KW4A 3UE5A 4R5PA 1R59O 4CFBA 3DXMB 5JICA 5HOOA 2VGMA 4CJTA 1NK4A 2HHUA 4JN4A 4QOZB 2F9WA 4B8CA 5BRHA 1WBDA 3TARA 2ZF5O 3O1WA 3VEVA 3KLHA 1ATSA 5AQPA 3BZKA 4O5BA 5E26A 2WONA 4J2EA 2HHQA 1B9DA 5EU7A 1UA0A 4F3OA 4EHTA 2VG5A 1BCMA 4CVNE 2NRVA 4IFVA 1GLAG 3N4PA 1S72N 1NOZA 3PX0A 3O4NA 1XUPO 3OYHA 1GOAA 3ZYYX 4B1VA 3OYLA 2Z1JA 1WNSA 3LWMA 2B5JA 1BO5O 3DLRA 1JKHA 2EHGA 1HYZA 4BROA 5LJWA 4AQYK 3VENA 1NG9A 1TK0A 3HOTA 4B3MK 3MDQA 2YV0X 4MQ3A 4CF1A 4H5VA 3AA3A 5DMRA 4BRLA 3BP8A 4ID1A 1HYSA 5BRFA 1IKYA 3KLGA 3IAYA 5EOYA 1OVQA 3AVGA 1DT9A 4YHHK 3AVMA 3O8MA 1K73O 3PX6A 1JCEA 4E1NA 2OZMA 3JS6A 1ZBFA 4DSJA 3LP0A 3O9QA 4J2BA 4KKOA 4WQ5A 3S3NA 4LF5K 4BC5A 3ZT3A 2F8SA 3S41A 3A5OC 2F8TA 4KFBA 4AHCA 3RMAA 1MU2A 4GVEA 2HBKA 4JHDB 4YOYA 1VQ5N 3P83D 4DQPA 1QZ6A 1KLNA 3VPZA 4K42A 1RNHA 4JKGB 3KVGA 3GG4A 2XO7A 5CHIA 3LDQA 3I33A 2ASOA 4DTJA 2VWKA 4BR4A 2RF2A 4J2AA 2HHVA 1TL3A 2YNIA 3ALYA 5AQJA 4DF4A 1L3UA 4LFCK 3VEWA 4K8ZA 4E1MA 3ZSQA 3KWIA 3S3OA 2E2QA 4CJKA 1YI2N 3QLHA 3OJSA 3AO5A 4ILJA 4CEOA 4OPAA 4Y1CA 2X6SA 3K9KA 3F9MA 1JLEA 4NCAA 3WEEA 3R3LA 1NKEA 3OYIA 2W41A 2E4LA 4CIFA 2YJEA 3VF2A 5GIOA 1YITN 2PY5A 4BACA 3QBXA 4KTWA 3KKSA 3O9TA 2FBVA 3DJCA 4KHSA 5LL6Z 2GV9A 1BUPA 2Z1HA 4B1UB 3ENOA 3QDKA 2FF3B 5C0YA 4DG1A 5IWAK 4XH4A 1K8KB 2DFEA 4JKCA 3ZSVA 4K0KK 3P31A 4H0TB 2NRXA 4OO1J 2HBJA 1KSPA 5DM7L 5CZ2A 1J6ZA 1HNWK 1YJNN 3T1HK 4OVLA 1B92A 1S1UA 4JYAK 3WQTA 1EP4A 1RILA 2B4JA 4FWMA 4CZMA 2G8UA 2DFFA 2FF6A 1Q9XA 2ATQA 4GV9A 3O3FA 3P4IA 3PSFA 3T7ZA 4CEQA 3O6WA 4JD2A 5AQLA 4BG9A 4GW6A 4JI8K 3CJAA 4JHDA 3SAGA 1XMQK 3OW2M 3PV8A 1C1AA 1GLLO 3W3DA 5GINA 4DFJA 1RT7A 3SJHA 3NDKA 1KAYA 1VQON 2E5LK 5BN9A 2JGUA 4CHYA 4NO7A 4C8NA 3MX2A 5AQHA 1SL2A 4LSNA 1LW2A 1S5JA 3ATVA 4CBXA 2O8DA 4IDKA 5BPNA 5J2QA 3SQ2A 1A5XA 5JMVA 4U7BA 2O8BB 3R8EA 4H0YB 1VSLA 3OTOK 3OY9A 4RG8A 1BCOA 5KPTA 5H1SQ 2X74A 3ID6A 3QICA 4YORA 3SBGA 1VQ4N 1BIUA 4TSXA 3OYGA 1U2VB 5M1KA 1NGIA 3E9OA 2KQ2A 1Z26A 4FLYA 2HOEA 3VQ8A 3H6EA 5C10A 1QZ5A 2PAVA 3NF9A 3TSQA 4HCCA 5AZIA 3QIPA 5DK5A 4DKWA 1HX1A 2XY8A 4MDAA 1C0GA 5BREA 4CHQA 4GY2B 2QM1A 2FBTA 2HHHK 4AHTA 1Q9YA 3HSCA 5KGWA 2KTQA 2VG7A 3KWGA 1NK8A 1W2BM 3T69A 1I94K 5JS2A 4KHQA 1C6VA 4KTZA 3WQUA 5JLFA 1V4TA 2HSTA 1WOQA 3AVIA 1NK0A 2PYJA 3RVCA 3MCAB 5BR8K 3DXMA 2OCEA 2UUBK 2P9IB 3VGLA 3QO9A 4CGDA 5KI6A 3O4QA 1N32K 3O5BA 3VETA 2A3ZA 3D45A 5J2PA 1WBBA 2QW9A 5HBMA 4PQUA 3UB5A 3LAKA 4I2PA 4I6MB 3CFRA 4FJ7A 1C0FA 4JAXA 4DSFA 2GTDA 4ISEA 1NGEA 2XHBA 4JK7A 4OKEA 4LC9B 3T19A 1RDWX 5C2FA 4JKFA 4E7LA 4E0DA 3LP1A 1T3VA 4DFKA 4HWIA 1HKCA 3VQPA 3K5NA 2KZZA 2UXDK 3KZBA 3CJ1A 1WSEA 3CFPA 1VQ7N 1ZC6A 3DRPA 4M3ZA 4H03B 4FJIA 4MLEA 1ZBUA 4QS7A 2D0PA 3TTCA 4BR7A 3GDQA 3CFOA 4KH4A 4RW6A 3I0SA
chains in the Genus database with same CATH topology
1TKXA 4RW4A 1LV5A 2HNZA 3G0ZA 1IH7A 4CEFA 1F21A 1Q8IA 2F96A 3JYTA 3AO1A 3HPHA 3OYMA 3EZ5A 3OYCA 1T8EA 3BGRA 3AVCA 3TAEA 4CEEA 3V9UA 4CGHA 1J54A 1NKCA 4CERA 3OYBA 3HK2A 3V9XA 1W9HA 3NBPA 2A1RA 4N47A 3HP6A 4KTQA 3MXIA 1KVBA 1X9SA 2QK9A 1C0MA 1JL2A 3A2FA 3AVNA 4CJQA 3M8SA 3EYZA 1WSHA 4HHTA 2FBYA 1XHZA 3K59A 3DLHA 1TAUA 4FJXA 1CZBA 1HJRA 3RRGA 3ZSOA 4DQQA 4M3WA 3TABA 4CJRA 3AVJA 1JXBA 2EX3A 2NUBA 2BE2A 5SZTA 3AVAA 4ELUA 1RBRA 1T05A 2QKBA 4CIGA 3OYNA 4BE2A 2IDOA 3SYZA 2WOMA 1O1WA 1VSDA 3S9HA 2HMIA 4FM0A 3K5LA 1BI4B 3KK3A 4FJJA 3PX4A 3F73A 1NJWA 1RTDA 3LPUA 4CJ5A 4DTPA 3SUOA 1RTIA 2BDPA 4FK0A 4CFDA 3AV9A 4O44A 4EP4A 5FROA 1RTJA 3SPYA 2G8HA 3QEPA 1TKTA 5T7BA 4DMNA 3K5MA 5FRNA 3BDPA 1EETA 4O0JA 3QEIA 1EXQA 4M41A 3DRRA 4Z4IA 4RW7A 3VQEA 4KB0A 4CJWA 1JLAA 4ELTA 3KK1A 1S6QA 3NFAA 3F9KA 1NK9A 2IC3A 2IS3A 4FJLA 3ZT0A 3AO4A 4N76A 3L2WA 1IKVA 3QEXA 3NF8A 3DOLA 3V6DA 4CGGA 4KRFA 2HHSA 4HUFA 1T03A 1DTQA 4HCBA 3LANA 3U3YA 3RMCA 1WAJA 4CJLA 3AVHA 1REVA 3PUFA 1X1PA 4IG3A 4W5TA 1TKDA 2PZSA 4FJ5A 4CJUA 1CLQA 2GUIA 4C8LA 5C24A 1KCFA 2X6NA 3QESA 1C0UA 3DI6A 4B9UA 3UIQA 2LSNA 2HNDA 3VQAA 2YNFA 4KB1A 5FDLA 3FFIA 1VSJA 4DLEA 4J2DA 5HRSA 5E41A 3SI6A 1RDCA 2OPQA 4JS4A 3AA4A 5HRPA 1T7PA 5D3GA 1S1VA 1JLQA 4B08A 4PA1A 4FVMA 4CEBA 1C0TA 4N56A 4FJKA 2YNHA 4KHWA 3HP9A 3MEDA 3DRSA 2YKNA 3L3VA 4I7FA 3QEWA 1RDAA 3HXMA 4DTMA 3AVLA 4CIEA 3SNNA 1D5AA 3NH1A 1L5UA 4CE9A 1ZBLA 4FZZA 4CECA 3VQBA 1RT6A 2OPRA 2HB5A 1LAWA 3DOKA 1HRHA 3G10A 1CZ9A 1VSFA 1WN7A 1VRUA 3K2PA 3QEVA 4NCBA 4R5PA 2KW4A 3ZSZA 2X78A 4Z0UA 4CFBA 3LDSA 3V9WA 4DTXA 4KI6A 3SV3A 4OKJA 4CJTA 4DTSA 1NK4A 3VN5A 3NH0A 1L3TA 2HHUA 2DY4A 4QOZB 3LPTA 4KO0A 4B8CA 4Y1DA 3TARA 4CGFA 1RDBA 1KRPA 1BGXT 3KLHA 1SUQA 3CQ8A 1K6YA 3P1GA 1UWBA 4AHSA 5CY4A 4CFCA 2D0BA 4CHPA 3E01A 3VA3A 5KGXA 4O5BA 1KLMA 4I2QA 2WONA 5I3UA 3NCIA 4BDZA 4J2EA 4F2SA 2HHQA 1B9DA 5EU7A 3ASMA 1UA0A 4F3OA 2VG5A 1WSJA 1BCMA 1SKRA 3WNHA 1CXUA 3K5OA 4IFVA 4O0IA 2KZMA 2OPPA 3KD1E 1LAVA 3WNGA 1NOZA 1S9EA 3IS9A 3NGZA 4KPYA 3AO3A 1FXXA 4DQRA 3PX0A 4FZYA 3O4NA 4DTNA 1UA1A 3LP3A 3OYHA 4W5RA 4KREA 3LZIA 1HNIA 1GOAA 1U48A 1C1BA 3OYLA 4NCGA 2Z1JA 1UAXA 1WNSA 3LWMA 1ZYQA 4DQIA 2B5JA 4EZ6A 1RT3A 4OGCA 3DYAA 3DLRA 1JKHA 2EHGA 1HYZA 1W0HA 3B6PA 3SPZA 4I9QA 1IO2A 4CK3A 3ULDA 3I8DA 4QAGA 1QQCA 4Q5VA 1TK0A 4KI4A 4FYDA 3M8QA 4DSEA 1QTMA 1I3AA 2YV0X 4MQ3A 4CF1A 4B9VA 3AA3A 4CGIA 3LZJA 3O3HA 5DMRA 3CG7A 4BE0A 5SWMA 4JLHA 1Y97A 3SUNA 2XY6A 1J9AA 3L3UA 4IBNA 4ID1A 5HRNA 2G8WA 1HYSA 3RRHA 1IKYA 4DU3A 3KLGA 3ISNC 3IAYA 1TK8A 1BIZA 3H08A 2HHVA 3VA0A 1NJZA 4G1QA 4W5OA 5FRMA 3ZSRA 4LH4A 1WSFA 3MXMA 3AVGA 1ZBIA 2AJQA 1CXQA 3AVMA 5J2NA 5J2MA 3SQ1A 3B6OA 3OYDA 4BDPA 4PY5A 1DLOA 3NGYA 5HLFA 2P5OA 3PX6A 3ZSWA 4E19A 4E1NA 3THVA 2OZMA 1IG9A 4DSJA 1VSMA 1EKEA 1ZBFA 2RKIA 3OYFA 3V4IA 3LP0A 4J2BA 3KD5E 4KKOA 3NHGA 4CJ3A 2D5RA 3S3NA 3MEGA 4FLUA 1X9MA 4GMJB 1HQEA 4DWIA 4BE1A 4OLAA 1JLBA 3ZT3A 4HTUA 2F8SA 4M45A 4B9SA 4WE1A 3WNFA 2F8TA 4AH9A 1DTTA 4KFBA 4AHCA 1NKBA 4CCHA 3C6TA 4LD0A 3SQ4A 3RMAA 4DF8A 3HPGA 5I42A 3AVKA 4LSLA 1IKWA 1MU2A 4FLWA 4CF0A 5CYQA 3V1QA 1SL0A 1KTQA 1A5WA 3ZT1A 4DFPA 1J53A 3P83D 3QNNA 4DQPA 4QCLA 1KLNA 4Q0BA 4OJRA 5K14A 1RNHA 1NJXA 2DTUA 2HVIA 1RBSA 2XO7A 1RTHA 1YVUA 4DU1A 4DTOA 4DTJA 1QE1A 1LW0A 2BANA 1WAFA 2VWKA 1HQUA 2QXFA 2RF2A 3L2RA 4JS5A 1TL3A 1VSKA 3ITHA 4FJHA 3ALYA 2YNIA 4OKKA 4K8XA 4DF4A 5C25A 4M3RA 4FJNA 1L3UA 2XY7A 4DTUA 3OYEA 4K8ZA 1QS4A 3TR8A 4E1MA 3ZSQA 4FJ8A 2ZQBA 3CM5A 3MEEA 3S3OA 1NK5A 1TK5A 4BWJA 3VQQA 4CF8A 4CJKA 3QLHA 1N5YA 2HHWA 3WNEA 3OJSA 4N41A 3AA5X 1JLGA 3AO5A 4CEOA 4Y1CA 2P51A 2VG6A 2X6SA 3ZCMA 3KLEA 3SCXA 4F2RA 4FLVA 2XRIA 1D9FA 1JLEA 1NJYA 3QERA 2P1JA 4NCAA 1QSSA 4KHUA 1NKEA 3OYIA 4N5SA 3HVRA 1Z25A 2DFHA 2E4LA 3C6UA 5J1EA 4CIFA 2PY5A 4BACA 4CJPA 3AVBA 4UQGA 2OZSA 4KHNA 5HP1A 4KTWA 4AHVA 1RCHA 3KKSA 2FBVA 5HRRA 3CYMA 4NYFA 3IRXA 2W42A 4KHSA 3KJVA 1LWFA 4HVJA 3K58A 2GV9A 5JS1A 2Z1HA 4E3SA 3RWUA 4M3YA 3C95A 4DSLA 2A1SA 3JSMA 4FK4A 1S1XA 4DG1A 2QKKA 4Z4GA 3NAEA 3TAQA 4W5NA 3OS0A 4JRPA 2DFEA 4F4KA 3ZSVA 1VSEA 1KFDA 1SKWA 3U6FA 4E7IA 1VSHA 4E7JA 4FJGA 4IFYA 1QSYA 2YHAA 1TV6A 1RT5A 1RBTA 3LALA 1I39A 1TVRA 2OPSA 4JRQA 3QNOA 3V81A 5CZ2A 1N6QA 1KSPA 3PO5A 4Z4EA 3OS2A 3HPOA 3M8RA 4OVLA 1B92A 1ASVA 1S1UA 4ICLA 3SJJA 1D8YA 2XY5A 1EP4A 1C1CA 4YNQA 4E89A 1G15A 3L2VA 1RILA 2B4JA 4Z4HA 2G8UA 4F3TA 4J2AA 2DFFA 1XHXA 2VWJA 2ETJA 4B8AB 2ATQA 1Q9XA 1UOCA 1IKXA 3O3FA 1VK0A 4OPKA 4CK2A 2ITGA 4XIUA 3V9SA 1BHLA 4B9LA 4CEQA 4CFAA 1QSLA 4DS4A 1FKPA 4OGEA 4CHZA 2PYLA 5KTQA 4GW6A 4M3UA 3SZ2A 5C42A 3VQ6A 4OLBA 5HROA 1JXEA 1RT4A 3NF7A 2D0CA 2G8KA 3RR8A 2HHXA 3SV4A 2YNGA 3PV8A 3TANA 4IG0A 1C1AA 3KTQA 1S1WA 5CZ1A 4DFJA 1JLCA 3SUQA 1B9FA 3HO1A 4M3TA 4LH5A 1RT7A 3KLFA 1A5VA 3NDKA 2G8IA 2Y1JA 3D0PA 2Y1IA 4C8OA 1JLFA 3NGIA 1XC9A 2YHBA 3HYFA 1NK7A 1J5OA 4C8KA 4FW1A 3DLKA 1KVAA 4EZ9A 2JGUA 3HL8A 2I5JA 4CHYA 3M8PA 4C8NA 4H4MA 2HW3A 1YTUA 1SL2A 4LSNA 2E6LA 1LW2A 1U45A 4AHRA 1S5JA 1D9DA 3TAPA 4FLZA 1TL1A 3U3GA 4IDKA 3HM9A 4IKFA 5J2QA 1HNVA 2R7YA 3C94A 1A5XA 3SQ2A 4E7HA 1ASWA 2Q3SA 4ZTJA 3IG1A 4H8KA 2Z1IA 1LWCA 3V9ZA 1WSIA 1VSLA 1HMVA 2O4GA 4MFBA 4FW2A 4DFMA 3OY9A 4RG8A 3VQ7A 1BCOA 3RMDA 3OYKA 3KKRA 1EX4A 3V1RA 3OJUA 2E6MA 2X74A 3T1AA 1BIUA 4TSXA 3OYGA 3CM6A 1RT1A 3LAMA 4CJFA 3TI0A 3HJFA 2RN2A 2KQ2A 2FBXA 3OVNA 1Z26A 5KRTA 4FLYA 3NE6A 3QETA 1SKSA 1FK9A 3VQ8A 3PO4A 4CEDA 1X9WA 4I9LA 2Z1GA 4ZTFA 3DMJA 4BWMA 4AHUA 1U47A 2ZD1A 3NF9A 1VSIA 3VQCA 3HT3A 3EY1A 4DU4A 4H4OA 4HCCA 3QIPA 1BL3A 5DK5A 3QINA 3ZT4A 1XWLA 4NYNA 2XY8A 3VQDA 3L2UA 3DLBA 4Z4CA 4DS5A 4DSIA 4CHQA 2IOCA 1TKZA 3I0RA 2RPIA 1HPZA 4M42A 1VRTA 2FBTA 4RW8A 3O3GA 1S6PA 4AHTA 1Q9YA 1WLJA 4EP5A 1YT3A 2O4IA 3VQ4A 3QIOA 3LP2A 5KGWA 2KTQA 2IAJA 3DLGA 2VG7A 3LWLA 1NK8A 2BGGA 3T3FA 2OA8A 3AA2A 3V1OA 1TGOA 3VQ5A 5JS2A 4KHQA 4FXDA 1C6VA 1LWEA 4CK1A 4YFUA 4RW9A 4M3XA 4KTZA 3DLEA 3NF6A 4ZHRA 2G8FA 3S3MA 1RBVA 1XI1A 1S1TA 3AVIA 3TWHA 1NK0A 1U49A 3PY8A 3KIOA 4KAZA 2HHTA 4Z4FA 1BI4A 4DLGA 3KLIA 4FM2A 2HNYA 2PYJA 4CHOA 2KFNA 1S9GA 4FM1A 4CJVA 1BISA 4BDYA 3QO9A 2D0AA 4FLTA 4CF9A 4PWDA 3L2QA 4CGDA 3TAGA 4HUGA 4F8RA 5KRSA 5KI6A 3ZT2A 4DTRA 3O4QA 1RDDA 3RTVA 3ZSYA 1QHTA 1RBUA 4CF2A 3SUPA 4AILC 2YKMA 5J2PA 3D45A 2IGIA 2HVHA 5HBMA 4PQUA 3OYAA 4FJ9A 3LAKA 4I2PA 4DSKA 3CFRA 4FJ7A 1GOBA 4E7KA 1YTAA 4ID5A 4CEZA 4DSFA 1L3SA 2OYQA 3K57A 1KVCA 4W5QA 3P5JA 3TAFA 2XHBA 3OS1A 1WSGA 4OKEA 4FCYA 4B9MA 3T19A 3MAQA 4FJMA 4E7LA 4O55A 4B9NA 3LP1A 4CEAA 1R0AA 4DFKA 4E0DA 3MXJA 3DM2A 4C8MA 1TAQA 3VQ9A 2P5GA 3SQ0A 4CJSA 3VQPA 2ZE2A 3K5NA 1NK6A 3AO2A 2B6AA 4O4GA 4L8RB 2KZZA 4DQSA 3ZSXA 3RMBA 4CJ4A 4B3OA 1GOCA 4CGJA 4HUEA 1SV5A 4OPJA 4CHNA 1ITGA 1U4BA 1SL1A 4FZXC 1BQNA 1WSEA 3CFPA 3TAMA 3DRPA 1FKOA 4CESA 3NH2A 1L3VA 3RR7A 4M3ZA 1HYVA 2GBZA 4LY7A 4FJIA 1NOYA 2JLEA 1U04A 1ZBHA 1RT2A 1ZBUA 1ASUA 2FC0A 4GVMA 4CJEA 3KK2A 4B9TA 4ELVA 4KV8A 2G8VA 3AVFA 5CYMA 1JL1A 3HVTA 3MECA 3CFOA 1KFSA 4FK2A 3OYJA 4PUOA 2KFZA 1BQMA 4FLXA 3L8BA 3HSTB 4KHYA 4RW6A 3I0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKX A;  4RW4 A;  1LV5 A;  2HNZ A;  3G0Z A;  1IH7 A;  4CEF A;  1F21 A;  1Q8I A;  2F96 A;  3JYT A;  3AO1 A;  3HPH A;  3OYM A;  3EZ5 A;  3OYC A;  1T8E A;  3BGR A;  3AVC A;  3TAE A;  4CEE A;  3V9U A;  4CGH A;  1J54 A;  1NKC A;  4CER A;  3OYB A;  3HK2 A;  3V9X A;  1W9H A;  3NBP A;  2A1R A;  4N47 A;  3HP6 A;  4KTQ A;  3MXI A;  1KVB A;  1X9S A;  2QK9 A;  1C0M A;  1JL2 A;  3A2F A;  3AVN A;  4CJQ A;  3M8S A;  3EYZ A;  1WSH A;  4HHT A;  2FBY A;  1XHZ A;  3K59 A;  3DLH A;  1TAU A;  4FJX A;  1CZB A;  1HJR A;  3RRG A;  3ZSO A;  4DQQ A;  4M3W A;  3TAB A;  4CJR A;  3AVJ A;  1JXB A;  2EX3 A;  2NUB A;  2BE2 A;  5SZT A;  3AVA A;  4ELU A;  1RBR A;  1T05 A;  2QKB A;  4CIG A;  3OYN A;  4BE2 A;  2IDO A;  3SYZ A;  2WOM A;  1O1W A;  1VSD A;  3S9H A;  2HMI A;  4FM0 A;  3K5L A;  1BI4 B;  3KK3 A;  4FJJ A;  3PX4 A;  3F73 A;  1NJW A;  1RTD A;  3LPU A;  4CJ5 A;  4DTP A;  3SUO A;  1RTI A;  2BDP A;  4FK0 A;  4CFD A;  3AV9 A;  4O44 A;  4EP4 A;  5FRO A;  1RTJ A;  3SPY A;  2G8H A;  3QEP A;  1TKT A;  5T7B A;  4DMN A;  3K5M A;  5FRN A;  3BDP A;  1EET A;  4O0J A;  3QEI A;  1EXQ A;  4M41 A;  3DRR A;  4Z4I A;  4RW7 A;  3VQE A;  4KB0 A;  4CJW A;  1JLA A;  4ELT A;  3KK1 A;  1S6Q A;  3NFA A;  3F9K A;  1NK9 A;  2IC3 A;  2IS3 A;  4FJL A;  3ZT0 A;  3AO4 A;  4N76 A;  3L2W A;  1IKV A;  3QEX A;  3NF8 A;  3DOL A;  3V6D A;  4CGG A;  4KRF A;  2HHS A;  4HUF A;  1T03 A;  1DTQ A;  4HCB A;  3LAN A;  3U3Y A;  3RMC A;  1WAJ A;  4CJL A;  3AVH A;  1REV A;  3PUF A;  1X1P A;  4IG3 A;  4W5T A;  1TKD A;  2PZS A;  4FJ5 A;  4CJU A;  1CLQ A;  2GUI A;  4C8L A;  5C24 A;  1KCF A;  2X6N A;  3QES A;  1C0U A;  3DI6 A;  4B9U A;  3UIQ A;  2LSN A;  2HND A;  3VQA A;  2YNF A;  4KB1 A;  5FDL A;  3FFI A;  1VSJ A;  4DLE A;  4J2D A;  5HRS A;  5E41 A;  3SI6 A;  1RDC A;  2OPQ A;  4JS4 A;  3AA4 A;  5HRP A;  1T7P A;  5D3G A;  1S1V A;  1JLQ A;  4B08 A;  4PA1 A;  4FVM A;  4CEB A;  1C0T A;  4N56 A;  4FJK A;  2YNH A;  4KHW A;  3HP9 A;  3MED A;  3DRS A;  2YKN A;  3L3V A;  4I7F A;  3QEW A;  1RDA A;  3HXM A;  4DTM A;  3AVL A;  4CIE A;  3SNN A;  1D5A A;  3NH1 A;  1L5U A;  4CE9 A;  1ZBL A;  4FZZ A;  4CEC A;  3VQB A;  1RT6 A;  2OPR A;  2HB5 A;  1LAW A;  3DOK A;  1HRH A;  3G10 A;  1CZ9 A;  1VSF A;  1WN7 A;  1VRU A;  3K2P A;  3QEV A;  4NCB A;  4R5P A;  2KW4 A;  3ZSZ A;  2X78 A;  4Z0U A;  4CFB A;  3LDS A;  3V9W A;  4DTX A;  4KI6 A;  3SV3 A;  4OKJ A;  4CJT A;  4DTS A;  1NK4 A;  3VN5 A;  3NH0 A;  1L3T A;  2HHU A;  2DY4 A;  4QOZ B;  3LPT A;  4KO0 A;  4B8C A;  4Y1D A;  3TAR A;  4CGF A;  1RDB A;  1KRP A;  1BGX T;  3KLH A;  1SUQ A;  3CQ8 A;  1K6Y A;  3P1G A;  1UWB A;  4AHS A;  5CY4 A;  4CFC A;  2D0B A;  4CHP A;  3E01 A;  3VA3 A;  5KGX A;  4O5B A;  1KLM A;  4I2Q A;  2WON A;  5I3U A;  3NCI A;  4BDZ A;  4J2E A;  4F2S A;  2HHQ A;  1B9D A;  5EU7 A;  3ASM A;  1UA0 A;  4F3O A;  2VG5 A;  1WSJ A;  1BCM A;  1SKR A;  3WNH A;  1CXU A;  3K5O A;  4IFV A;  4O0I A;  2KZM A;  2OPP A;  3KD1 E;  1LAV A;  3WNG A;  1NOZ A;  1S9E A;  3IS9 A;  3NGZ A;  4KPY A;  3AO3 A;  1FXX A;  4DQR A;  3PX0 A;  4FZY A;  3O4N A;  4DTN A;  1UA1 A;  3LP3 A;  3OYH A;  4W5R A;  4KRE A;  3LZI A;  1HNI A;  1GOA A;  1U48 A;  1C1B A;  3OYL A;  4NCG A;  2Z1J A;  1UAX A;  1WNS A;  3LWM A;  1ZYQ A;  4DQI A;  2B5J A;  4EZ6 A;  1RT3 A;  4OGC A;  3DYA A;  3DLR A;  1JKH A;  2EHG A;  1HYZ A;  1W0H A;  3B6P A;  3SPZ A;  4I9Q A;  1IO2 A;  4CK3 A;  3ULD A;  3I8D A;  4QAG A;  1QQC A;  4Q5V A;  1TK0 A;  4KI4 A;  4FYD A;  3M8Q A;  4DSE A;  1QTM A;  1I3A A;  2YV0 X;  4MQ3 A;  4CF1 A;  4B9V A;  3AA3 A;  4CGI A;  3LZJ A;  3O3H A;  5DMR A;  3CG7 A;  4BE0 A;  5SWM A;  4JLH A;  1Y97 A;  3SUN A;  2XY6 A;  1J9A A;  3L3U A;  4IBN A;  4ID1 A;  5HRN A;  2G8W A;  1HYS A;  3RRH A;  1IKY A;  4DU3 A;  3KLG A;  3ISN C;  3IAY A;  1TK8 A;  1BIZ A;  3H08 A;  2HHV A;  3VA0 A;  1NJZ A;  4G1Q A;  4W5O A;  5FRM A;  3ZSR A;  4LH4 A;  1WSF A;  3MXM A;  3AVG A;  1ZBI A;  2AJQ A;  1CXQ A;  3AVM A;  5J2N A;  5J2M A;  3SQ1 A;  3B6O A;  3OYD A;  4BDP A;  4PY5 A;  1DLO A;  3NGY A;  5HLF A;  2P5O A;  3PX6 A;  3ZSW A;  4E19 A;  4E1N A;  3THV A;  2OZM A;  1IG9 A;  4DSJ A;  1VSM A;  1EKE A;  1ZBF A;  2RKI A;  3OYF A;  3V4I A;  3LP0 A;  4J2B A;  3KD5 E;  4KKO A;  3NHG A;  4CJ3 A;  2D5R A;  3S3N A;  3MEG A;  4FLU A;  1X9M A;  4GMJ B;  1HQE A;  4DWI A;  4BE1 A;  4OLA A;  1JLB A;  3ZT3 A;  4HTU A;  2F8S A;  4M45 A;  4B9S A;  4WE1 A;  3WNF A;  2F8T A;  4AH9 A;  1DTT A;  4KFB A;  4AHC A;  1NKB A;  4CCH A;  3C6T A;  4LD0 A;  3SQ4 A;  3RMA A;  4DF8 A;  3HPG A;  5I42 A;  3AVK A;  4LSL A;  1IKW A;  1MU2 A;  4FLW A;  4CF0 A;  5CYQ A;  3V1Q A;  1SL0 A;  1KTQ A;  1A5W A;  3ZT1 A;  4DFP A;  1J53 A;  3P83 D;  3QNN A;  4DQP A;  4QCL A;  1KLN A;  4Q0B A;  4OJR A;  5K14 A;  1RNH A;  1NJX A;  2DTU A;  2HVI A;  1RBS A;  2XO7 A;  1RTH A;  1YVU A;  4DU1 A;  4DTO A;  4DTJ A;  1QE1 A;  1LW0 A;  2BAN A;  1WAF A;  2VWK A;  1HQU A;  2QXF A;  2RF2 A;  3L2R A;  4JS5 A;  1TL3 A;  1VSK A;  3ITH A;  4FJH A;  3ALY A;  2YNI A;  4OKK A;  4K8X A;  4DF4 A;  5C25 A;  4M3R A;  4FJN A;  1L3U A;  2XY7 A;  4DTU A;  3OYE A;  4K8Z A;  1QS4 A;  3TR8 A;  4E1M A;  3ZSQ A;  4FJ8 A;  2ZQB A;  3CM5 A;  3MEE A;  3S3O A;  1NK5 A;  1TK5 A;  4BWJ A;  3VQQ A;  4CF8 A;  4CJK A;  3QLH A;  1N5Y A;  2HHW A;  3WNE A;  3OJS A;  4N41 A;  3AA5 X;  1JLG A;  3AO5 A;  4CEO A;  4Y1C A;  2P51 A;  2VG6 A;  2X6S A;  3ZCM A;  3KLE A;  3SCX A;  4F2R A;  4FLV A;  2XRI A;  1D9F A;  1JLE A;  1NJY A;  3QER A;  2P1J A;  4NCA A;  1QSS A;  4KHU A;  1NKE A;  3OYI A;  4N5S A;  3HVR A;  1Z25 A;  2DFH A;  2E4L A;  3C6U A;  5J1E A;  4CIF A;  2PY5 A;  4BAC A;  4CJP A;  3AVB A;  4UQG A;  2OZS A;  4KHN A;  5HP1 A;  4KTW A;  4AHV A;  1RCH A;  3KKS A;  2FBV A;  5HRR A;  3CYM A;  4NYF A;  3IRX A;  2W42 A;  4KHS A;  3KJV A;  1LWF A;  4HVJ A;  3K58 A;  2GV9 A;  5JS1 A;  2Z1H A;  4E3S A;  3RWU A;  4M3Y A;  3C95 A;  4DSL A;  2A1S A;  3JSM A;  4FK4 A;  1S1X A;  4DG1 A;  2QKK A;  4Z4G A;  3NAE A;  3TAQ A;  4W5N A;  3OS0 A;  4JRP A;  2DFE A;  4F4K A;  3ZSV A;  1VSE A;  1KFD A;  1SKW A;  3U6F A;  4E7I A;  1VSH A;  4E7J A;  4FJG A;  4IFY A;  1QSY A;  2YHA A;  1TV6 A;  1RT5 A;  1RBT A;  3LAL A;  1I39 A;  1TVR A;  2OPS A;  4JRQ A;  3QNO A;  3V81 A;  5CZ2 A;  1N6Q A;  1KSP A;  3PO5 A;  4Z4E A;  3OS2 A;  3HPO A;  3M8R A;  4OVL A;  1B92 A;  1ASV A;  1S1U A;  4ICL A;  3SJJ A;  1D8Y A;  2XY5 A;  1EP4 A;  1C1C A;  4YNQ A;  4E89 A;  1G15 A;  3L2V A;  1RIL A;  2B4J A;  4Z4H A;  2G8U A;  4F3T A;  4J2A A;  2DFF A;  1XHX A;  2VWJ A;  2ETJ A;  4B8A B;  2ATQ A;  1Q9X A;  1UOC A;  1IKX A;  3O3F A;  1VK0 A;  4OPK A;  4CK2 A;  2ITG A;  4XIU A;  3V9S A;  1BHL A;  4B9L A;  4CEQ A;  4CFA A;  1QSL A;  4DS4 A;  1FKP A;  4OGE A;  4CHZ A;  2PYL A;  5KTQ A;  4GW6 A;  4M3U A;  3SZ2 A;  5C42 A;  3VQ6 A;  4OLB A;  5HRO A;  1JXE A;  1RT4 A;  3NF7 A;  2D0C A;  2G8K A;  3RR8 A;  2HHX A;  3SV4 A;  2YNG A;  3PV8 A;  3TAN A;  4IG0 A;  1C1A A;  3KTQ A;  1S1W A;  5CZ1 A;  4DFJ A;  1JLC A;  3SUQ A;  1B9F A;  3HO1 A;  4M3T A;  4LH5 A;  1RT7 A;  3KLF A;  1A5V A;  3NDK A;  2G8I A;  2Y1J A;  3D0P A;  2Y1I A;  4C8O A;  1JLF A;  3NGI A;  1XC9 A;  2YHB A;  3HYF A;  1NK7 A;  1J5O A;  4C8K A;  4FW1 A;  3DLK A;  1KVA A;  4EZ9 A;  2JGU A;  3HL8 A;  2I5J A;  4CHY A;  3M8P A;  4C8N A;  4H4M A;  2HW3 A;  1YTU A;  1SL2 A;  4LSN A;  2E6L A;  1LW2 A;  1U45 A;  4AHR A;  1S5J A;  1D9D A;  3TAP A;  4FLZ A;  1TL1 A;  3U3G A;  4IDK A;  3HM9 A;  4IKF A;  5J2Q A;  1HNV A;  2R7Y A;  3C94 A;  1A5X A;  3SQ2 A;  4E7H A;  1ASW A;  2Q3S A;  4ZTJ A;  3IG1 A;  4H8K A;  2Z1I A;  1LWC A;  3V9Z A;  1WSI A;  1VSL A;  1HMV A;  2O4G A;  4MFB A;  4FW2 A;  4DFM A;  3OY9 A;  4RG8 A;  3VQ7 A;  1BCO A;  3RMD A;  3OYK A;  3KKR A;  1EX4 A;  3V1R A;  3OJU A;  2E6M A;  2X74 A;  3T1A A;  1BIU A;  4TSX A;  3OYG A;  3CM6 A;  1RT1 A;  3LAM A;  4CJF A;  3TI0 A;  3HJF A;  2RN2 A;  2KQ2 A;  2FBX A;  3OVN A;  1Z26 A;  5KRT A;  4FLY A;  3NE6 A;  3QET A;  1SKS A;  1FK9 A;  3VQ8 A;  3PO4 A;  4CED A;  1X9W A;  4I9L A;  2Z1G A;  4ZTF A;  3DMJ A;  4BWM A;  4AHU A;  1U47 A;  2ZD1 A;  3NF9 A;  1VSI A;  3VQC A;  3HT3 A;  3EY1 A;  4DU4 A;  4H4O A;  4HCC A;  3QIP A;  1BL3 A;  5DK5 A;  3QIN A;  3ZT4 A;  1XWL A;  4NYN A;  2XY8 A;  3VQD A;  3L2U A;  3DLB A;  4Z4C A;  4DS5 A;  4DSI A;  4CHQ A;  2IOC A;  1TKZ A;  3I0R A;  2RPI A;  1HPZ A;  4M42 A;  1VRT A;  2FBT A;  4RW8 A;  3O3G A;  1S6P A;  4AHT A;  1Q9Y A;  1WLJ A;  4EP5 A;  1YT3 A;  2O4I A;  3VQ4 A;  3QIO A;  3LP2 A;  5KGW A;  2KTQ A;  2IAJ A;  3DLG A;  2VG7 A;  3LWL A;  1NK8 A;  2BGG A;  3T3F A;  2OA8 A;  3AA2 A;  3V1O A;  1TGO A;  3VQ5 A;  5JS2 A;  4KHQ A;  4FXD A;  1C6V A;  1LWE A;  4CK1 A;  4YFU A;  4RW9 A;  4M3X A;  4KTZ A;  3DLE A;  3NF6 A;  4ZHR A;  2G8F A;  3S3M A;  1RBV A;  1XI1 A;  1S1T A;  3AVI A;  3TWH A;  1NK0 A;  1U49 A;  3PY8 A;  3KIO A;  4KAZ A;  2HHT A;  4Z4F A;  1BI4 A;  4DLG A;  3KLI A;  4FM2 A;  2HNY A;  2PYJ A;  4CHO A;  2KFN A;  1S9G A;  4FM1 A;  4CJV A;  1BIS A;  4BDY A;  3QO9 A;  2D0A A;  4FLT A;  4CF9 A;  4PWD A;  3L2Q A;  4CGD A;  3TAG A;  4HUG A;  4F8R A;  5KRS A;  5KI6 A;  3ZT2 A;  4DTR A;  3O4Q A;  1RDD A;  3RTV A;  3ZSY A;  1QHT A;  1RBU A;  4CF2 A;  3SUP A;  4AIL C;  2YKM A;  5J2P A;  3D45 A;  2IGI A;  2HVH A;  5HBM A;  4PQU A;  3OYA A;  4FJ9 A;  3LAK A;  4I2P A;  4DSK A;  3CFR A;  4FJ7 A;  1GOB A;  4E7K A;  1YTA A;  4ID5 A;  4CEZ A;  4DSF A;  1L3S A;  2OYQ A;  3K57 A;  1KVC A;  4W5Q A;  3P5J A;  3TAF A;  2XHB A;  3OS1 A;  1WSG A;  4OKE A;  4FCY A;  4B9M A;  3T19 A;  3MAQ A;  4FJM A;  4E7L A;  4O55 A;  4B9N A;  3LP1 A;  4CEA A;  1R0A A;  4DFK A;  4E0D A;  3MXJ A;  3DM2 A;  4C8M A;  1TAQ A;  3VQ9 A;  2P5G A;  3SQ0 A;  4CJS A;  3VQP A;  2ZE2 A;  3K5N A;  1NK6 A;  3AO2 A;  2B6A A;  4O4G A;  4L8R B;  2KZZ A;  4DQS A;  3ZSX A;  3RMB A;  4CJ4 A;  4B3O A;  1GOC A;  4CGJ A;  4HUE A;  1SV5 A;  4OPJ A;  4CHN A;  1ITG A;  1U4B A;  1SL1 A;  4FZX C;  1BQN A;  1WSE A;  3CFP A;  3TAM A;  3DRP A;  1FKO A;  4CES A;  3NH2 A;  1L3V A;  3RR7 A;  4M3Z A;  1HYV A;  2GBZ A;  4LY7 A;  4FJI A;  1NOY A;  2JLE A;  1U04 A;  1ZBH A;  1RT2 A;  1ZBU A;  1ASU A;  2FC0 A;  4GVM A;  4CJE A;  3KK2 A;  4B9T A;  4ELV A;  4KV8 A;  2G8V A;  3AVF A;  5CYM A;  1JL1 A;  3HVT A;  3MEC A;  3CFO A;  1KFS A;  4FK2 A;  3OYJ A;  4PUO A;  2KFZ A;  1BQM A;  4FLX A;  3L8B A;  3HST B;  4KHY A;  4RW6 A;  3I0S A; 
#chains in the Genus database with same CATH topology
 1TKX A;  5FLX O;  2VGN A;  2QI2 A;  3I55 N;  3CC4 N;  2VQF K;  4CEF A;  3JYT A;  3C7N A;  3FGU A;  3AVC A;  4YDU A;  4X62 K;  2VYP A;  4NLC A;  4N47 A;  5TKW A;  3AVN A;  1JL2 A;  2OTL N;  4CJQ A;  3M8S A;  5AQT A;  2FBY A;  2UUA K;  3K59 A;  3ZET A;  2QXL A;  4YOT A;  3D6R A;  1TAU A;  1HJR A;  4K25 A;  3J80 O;  4DQQ A;  2W6L A;  3TAB A;  1JXB A;  5C12 A;  2D4W A;  5AQI A;  3SYZ A;  2WOM A;  1O1W A;  2HMI A;  4FM0 A;  5LMU K;  4KBO A;  3KK3 A;  4FJJ A;  1RTD A;  1IV0 A;  2KKZ A;  1RTI A;  3CC2 N;  2KHO A;  5F1X A;  3SPY A;  3EE8 A;  2G8H A;  3QEP A;  4O8U A;  4PHT X;  1EET A;  1MA9 B;  2CH6 A;  4O0J A;  3QEI A;  4BRA A;  1N33 K;  4RW7 A;  3CF5 L;  1JLA A;  4ELT A;  4BGB A;  4CD1 A;  3F9K A;  1NK9 A;  2IC3 A;  5AQU A;  4CZH A;  3GBT A;  1IKV A;  1BWF O;  3NF8 A;  4AF1 A;  2NLX A;  4KRF A;  4HUF A;  3RMC A;  3ZX2 A;  3PUF A;  3QFU A;  1X1P A;  4WYB A;  1Q18 A;  3ZEU A;  2PZS A;  2W40 A;  5AZI B;  3A8Y A;  2X6N A;  3QES A;  3DI6 A;  3HTV A;  4B9U A;  2HND A;  2YNF A;  4WFN L;  3FFI A;  3VTI A;  3SMP A;  4CBW A;  1U2V A;  4BR2 A;  2NRH A;  2HBL A;  2E2P A;  2YNH A;  4CZJ A;  4MLH A;  4I7F A;  5C2D A;  2P9P B;  4CJ7 A;  4DTM A;  3L0Q A;  1L5U A;  4JK8 A;  1ZBL A;  1MWM A;  1LAW A;  4NCB A;  4A57 A;  3CJC A;  3ZSZ A;  2QWM A;  3V9W A;  1NM1 A;  3L6Q A;  2ASP A;  3VEY A;  1GLB G;  3VN5 A;  3NH0 A;  2DY4 A;  3WT0 A;  2PBD A;  3TSU A;  1BGX T;  1SUQ A;  3CQ8 A;  4EHU A;  3CXC M;  4JI3 K;  1UWB A;  3AGR A;  3VA3 A;  4JI5 K;  5KGX A;  2NZT A;  5GAH P;  5I3U A;  3NCI A;  4A59 A;  2IIR A;  1ATR A;  2JWL A;  4JEP A;  5AJ3 K;  1VQ9 N;  1CXU A;  3KD1 E;  2OTJ N;  3IDH A;  2WBN A;  1S9E A;  1YVN A;  3NGZ A;  4H5N A;  4KPY A;  3IKM A;  1IBK K;  4FZY A;  4DTN A;  3LZI A;  1HNI A;  1C1B A;  1ZYQ A;  1RT3 A;  5ADX H;  4LF7 K;  4BRM A;  3SPZ A;  4I9Q A;  5BRD A;  4KI4 A;  4Q5V A;  3M8Q A;  3GL1 A;  1W7A A;  1QHA A;  5AR0 A;  3CG7 A;  1NMN A;  3SUN A;  1MWK A;  4JI0 K;  4IBN A;  3L3U A;  4PL8 A;  5HRN A;  3RRH A;  3CME N;  4DU3 A;  2QWN A;  1BIZ A;  4CZI A;  1NJZ A;  4W5O A;  4FWR A;  4JKB A;  1OKJ A;  2Q31 A;  4IO9 L;  2QWO A;  1IG8 A;  3ULE A;  3SQ1 A;  5J2M A;  4PY5 A;  2E2N A;  3B6O A;  1DLO A;  3NGY A;  3ZSW A;  3THX A;  3CCL N;  3P39 A;  3KD5 E;  3I8B A;  5AZJ B;  4DWI A;  4FLU A;  4GMJ B;  4WQ5 C;  4HTU A;  4H5R A;  4M45 A;  1LCU A;  2DPN A;  4B9S A;  4AH9 A;  1DTT A;  4LD0 A;  3OBW A;  3EL2 A;  4JK9 A;  4DV0 K;  5CYQ A;  1GLC G;  1J53 A;  1HJO A;  2FXU A;  1XC3 A;  1Y64 A;  2DTU A;  2HVI A;  1RBS A;  4DU1 A;  1OVY A;  4IZ9 A;  1LW0 A;  1O13 A;  1HQU A;  3HOS A;  5GAG P;  3SAH A;  2A6A A;  3LDO A;  3HZ6 A;  4JKG A;  5C25 A;  3M6G A;  1BG3 A;  2J4R A;  4DTU A;  3C65 A;  3CIP A;  3K0S A;  3TR8 A;  1ILY A;  1BU6 O;  2ZQB A;  2NRW A;  3MEE A;  5M1Q A;  3U9Z A;  1KXP A;  1BOT O;  1GLJ O;  3O4W A;  4BWJ A;  3VQQ A;  4CF8 A;  2HHW A;  1JLG A;  1E4F T;  1Q86 O;  2P51 A;  4BVP A;  4BC2 A;  4B3S K;  1E3M A;  2XRI A;  1D9F A;  3QER A;  4Z94 A;  4KHU A;  3BF1 A;  3MMV A;  5AFU A;  2DFH A;  2P9S B;  3C6U A;  5J1E A;  4AM7 A;  3AVB A;  4KHN A;  3W0L A;  4AHV A;  3IRX A;  1XNQ K;  4HVJ A;  3K58 A;  5AQZ A;  5JS1 A;  4E3S A;  2A42 A;  3SK3 A;  3O9R A;  1KAX A;  4DSL A;  2A1S A;  3JSM A;  1S1X A;  1YHQ N;  5LMN K;  5JVH L;  3OS0 A;  4JRP A;  1KFD A;  3U6F A;  1VSH A;  4E7J A;  1XNR K;  5CE3 A;  4FJG A;  4IFY A;  1RT5 A;  3ENB A;  2OPS A;  3QNO A;  3PO5 A;  3FZF A;  3M8R A;  3JAM O;  4X64 K;  4LF9 K;  4EIA A;  1C1C A;  5BPL A;  4BRD A;  4O5F A;  3PLA A;  1J5E K;  1NGG A;  4BY9 C;  2E1Z A;  3N4Q A;  3TSP A;  1DEJ A;  4CK2 A;  2ITG A;  4B9L A;  1EWR A;  3UKR B;  4CFA A;  4JI6 K;  1YAG A;  4DS4 A;  3FLC O;  2NRZ A;  4OGE A;  4CHZ A;  1MDU B;  4M3U A;  3CCR N;  3VQ6 A;  3NF7 A;  3SMS A;  4FWN A;  2HHX A;  3SV4 A;  3U4L A;  1EQY A;  2YHY A;  3F5T A;  1ESV A;  5CZ1 A;  1JLC A;  1VQP N;  3HO1 A;  3KLF A;  3ZX0 A;  3WXI A;  3NGI A;  4H5W A;  1XC9 A;  2YHB A;  1NK7 A;  1P8Z A;  4H5T A;  4BC3 A;  4DV6 K;  2HW3 A;  3FFK B;  2E6L A;  1D9D A;  3TAP A;  1NBW A;  4H0V B;  3MWP A;  3MK6 A;  3WEE B;  4IKF A;  3O9S A;  1HNV A;  2R7Y A;  3C94 A;  4E7H A;  2P9K B;  1YIJ N;  4H8K A;  3V9Z A;  1WSI A;  2YI1 A;  3KKR A;  3V1R A;  3LAM A;  2FSJ A;  5KRT A;  4JKD A;  3JXU A;  4ZTF A;  2Z1G A;  3AGK A;  2I7N A;  3VEX A;  2ZD1 A;  1K9M O;  3VQC A;  4YOW A;  3ZT4 A;  4YOV A;  5LY3 A;  3CPE A;  4FOI A;  3VQD A;  4H0P A;  2IOC A;  3KK7 A;  5KPZ A;  4X66 K;  4M42 A;  1VRT A;  4RW8 A;  3O3G A;  1WLJ A;  4EP5 A;  2JWK A;  2OA8 A;  4BRQ A;  3DLE A;  3NF6 A;  2CGJ A;  5JLH A;  1XI1 A;  1S1T A;  3PY8 A;  3KIO A;  4CZL A;  2HHT A;  4Z4F A;  4FM2 A;  2HNY A;  4CHO A;  2KFN A;  3WXK A;  2E20 A;  4FM1 A;  1BIS A;  3MWT A;  2F7T A;  3CMA N;  4CF9 A;  4F8R A;  4HUG A;  3RTV A;  2KLA A;  1RGI A;  1QHT A;  1RBU A;  3SUP A;  3VTH A;  4DR7 K;  3FZK A;  2AP1 A;  2IGI A;  2HVH A;  4WFA L;  2P9N A;  2RE2 A;  4FVU A;  1GOB A;  3H45 C;  1YTA A;  1NGJ A;  1L3S A;  3HI0 A;  3K57 A;  4PKI A;  4JKA A;  3P5J A;  1WSG A;  4FCY A;  4O55 A;  4CEA A;  4BQZ A;  4BG8 A;  4C8M A;  4CJS A;  2ZWH A;  1NK6 A;  3AO2 A;  1G99 A;  4DQS A;  4X65 K;  3FE1 A;  3FR0 A;  4CJ4 A;  2GWJ A;  1GOC A;  4B3O A;  2Q97 A;  5AQM A;  4CGJ A;  2YCH A;  1SV5 A;  4HUE A;  4CHN A;  1ITG A;  4FZX C;  1BQN A;  3TAM A;  2E8A A;  4CES A;  2JLE A;  1U04 A;  1RT2 A;  4B9T A;  1ASU A;  3AVF A;  5CYM A;  3MEC A;  4FK2 A;  2KFZ A;  2P9U B;  1BQM A;  4FLX A;  3L8B A;  3THX B;  4RW4 A;  2HNZ A;  1IH7 A;  1Q8I A;  3HPH A;  3OYM A;  2GEL A;  4C23 A;  3GE1 A;  4CER A;  1QQN A;  5EY4 A;  1XQS C;  3V9X A;  1W9H A;  2A1R A;  3WXJ A;  4KTQ A;  3HP6 A;  4BC4 A;  1KVB A;  3MXI A;  1NWK A;  3A2F A;  1XHZ A;  2P9L A;  4H0O A;  5GAE P;  1NU0 A;  3VGK A;  4GNI A;  3C6H A;  4IEE A;  5BPM A;  4CJR A;  3AVJ A;  5EXW A;  5FPD A;  3OBY A;  1HPM A;  2BE2 A;  1CZA N;  2AJQ A;  4CIG A;  3OYN A;  3S9H A;  4G9Z A;  4LFB K;  4JV5 K;  4A5B A;  3C7N B;  4CJ5 A;  3PSI A;  4CFD A;  3AV9 A;  3CET A;  5FRO A;  3MN6 A;  2FLO A;  4DMN A;  3K5M A;  5FRN A;  4WQ4 A;  2Q0U A;  4B1Y B;  2D1K A;  1EXQ A;  3DRR A;  3U9D A;  4DR5 K;  3KK1 A;  3O08 A;  3ZT0 A;  3DOL A;  2UXC K;  4FWS A;  4CGG A;  1OH5 A;  4HCB A;  1DTQ A;  3G6E N;  1N8R O;  1REV A;  1CLQ A;  4CJU A;  3UKU A;  1QQM A;  2GUI A;  4L3Q A;  1NGD A;  4CZG A;  1V4S A;  3LL3 A;  2LSN A;  1X9J A;  2YJF A;  2D0O A;  4O8K A;  2O8E B;  4J2D A;  3SI6 A;  1RDC A;  2OPQ A;  4JS4 A;  3AA4 A;  1XMO K;  1T7P A;  3R1X A;  4I6M A;  1C0T A;  2HBM A;  2V7Z A;  3AAQ A;  4UY8 O;  4KHW A;  3HP9 A;  3B8A X;  3ATU A;  3HXM A;  2P9P A;  3SNN A;  1VQ8 N;  1D5A A;  3NH1 A;  2UU9 K;  4CE9 A;  2EWS A;  4CW7 B;  4JI4 K;  3VQB A;  1QTM A;  2HB5 A;  3DOK A;  1JCF A;  1WN7 A;  3LDS A;  4Z0U A;  3A5L C;  1HKB A;  1HUX A;  3SV3 A;  3ZX3 A;  4CBU A;  5AQK A;  4AM6 A;  4DTS A;  3PIO L;  1L3T A;  3FZH A;  3RSE A;  4QS9 A;  4CGF A;  1RDB A;  2WTU A;  1KRP A;  4AHS A;  1M1K O;  4CFC A;  5FPN A;  4GKK K;  1KLM A;  3J7Y P;  4F2S A;  2GX9 A;  3ASM A;  1YJW N;  3SBT A;  1SKR A;  3WNH A;  2QTD A;  1HR0 K;  4O0I A;  2OPP A;  1LAV A;  3IS9 A;  3AO3 A;  1FXX A;  4LF4 K;  2GEM A;  4W5R A;  2YHX A;  1X3N A;  3VMF B;  4DQI A;  3EN9 A;  4OGC A;  4NXN K;  4GV3 A;  3B6P A;  3EKS A;  4U67 L;  4CK3 A;  3CCV N;  3I8D A;  1QQC A;  4BR9 A;  4DSE A;  1QVG M;  3LZJ A;  3ID8 A;  4BE0 A;  5SWM A;  4JLH A;  4WCE L;  2XY6 A;  1J9A A;  2G8W A;  1IBM K;  4IO8 A;  4BRF A;  2O8B A;  5M1F A;  1YJ9 N;  3CCE N;  3VA0 A;  4G1Q A;  4LH4 A;  2O8F B;  1WSF A;  3MXM A;  1ZBI A;  1CXQ A;  3OYD A;  4DR3 K;  3EKU A;  3R6M A;  1GLD G;  2Q1N A;  5HLF A;  2P5O A;  2V52 B;  5M1P A;  3THV A;  1VSM A;  1EKE A;  2RKI A;  4YDU C;  3V4I A;  4PKG A;  2V51 B;  4CJ3 A;  3MEG A;  1HQE A;  1QQO A;  4BE1 A;  4NB4 A;  4WE1 A;  3WNF A;  5B8H A;  1NKB A;  3C6T A;  4JI2 K;  4DF8 A;  5DM6 L;  4FLW A;  4CF0 A;  3V1Q A;  3ZT1 A;  4DFP A;  3QNN A;  4Q0B A;  4OJR A;  3Q7B A;  5K14 A;  3MX5 A;  1T6C A;  2E88 A;  2HMP A;  1YVU A;  1VQ6 N;  3SAF A;  1QE1 A;  2BAN A;  3DWL A;  4FJH A;  3L2R A;  3H1Q A;  4OKK A;  4WQ4 C;  3G71 N;  4M3R A;  4MO4 A;  4FJN A;  1SS6 A;  5AQN A;  1QS4 A;  2IVN A;  3D7E O;  3CM5 A;  1Z6R A;  3WNE A;  2O8C A;  2VG6 A;  3ZCM A;  4IJA A;  1NJY A;  2P1J A;  1QSS A;  3VGM A;  4N5S A;  3HVR A;  2PFU A;  4DV2 K;  4UQG A;  4BRP A;  2VWB A;  1TUY A;  1K8A O;  1RCH A;  5HRR A;  3FZM A;  1N36 K;  1LWF A;  2ZGZ A;  3THW A;  4M3Y A;  3P38 A;  2WUS A;  3NAE A;  3TAQ A;  3K9J A;  5KPR A;  4ISG A;  5JVG L;  4E7I A;  1GLF O;  4FWL A;  3EZW A;  2YHA A;  3LAL A;  4IJN A;  3CCJ N;  3V81 A;  1TVR A;  1D4X A;  4DUZ K;  1Q7Y O;  4ICL A;  4ISF A;  4EFH A;  4E89 A;  1G15 A;  3UKR A;  2GUP A;  4F3T A;  2A40 A;  2ETJ A;  3CER A;  4B8A B;  1UOC A;  1IKX A;  4XIU A;  3V9S A;  1QSL A;  1FKP A;  4FPB A;  4DCH A;  2ZM6 K;  5M1N A;  5KTQ A;  2PYL A;  2RHK A;  4OLB A;  1JXE A;  1RT4 A;  5AFU H;  2D0C A;  3RR8 A;  4YY3 K;  2QWP A;  3TAN A;  4IG0 A;  1S1W A;  1B9F A;  5AQR A;  4M3T A;  2Y1J A;  3D0P A;  1JLF A;  3M5R A;  3HYF A;  2Q36 A;  1J5O A;  3DLK A;  3M8P A;  5MLC Q;  4DV7 K;  4KH6 A;  4AHR A;  1HNX K;  2O8F A;  4GKJ K;  1NGF A;  3DXK B;  1ASW A;  3AY9 A;  2Q3S A;  5F2R A;  3IG1 A;  5AQG A;  1NJI O;  1Z05 A;  5AQV A;  3CCM N;  4MFB A;  1N34 K;  3VQ7 A;  3RMD A;  3OYK A;  1S22 A;  3GOI A;  1T44 A;  5AQQ A;  1EX4 A;  3OJU A;  4BR0 A;  3T1A A;  4BQL A;  2QWL A;  3CM6 A;  1RT1 A;  2FBX A;  1TYQ A;  3ENH A;  5ELZ A;  3VEZ A;  3VF6 A;  4RCH A;  2UYT A;  1SKS A;  1FK9 A;  4I9L A;  3CHW A;  4XH5 A;  4BWM A;  3J7Z O;  3EY1 A;  4DU4 A;  5AQX A;  1SZ2 A;  3L2U A;  4DSI A;  5AQW A;  4Z4C A;  1TKZ A;  4DUY K;  4MDB A;  1HPZ A;  1S6P A;  4BRE A;  4CZE A;  1K8K A;  3VQ4 A;  3LP2 A;  3CJ7 A;  1IBL K;  3DLG A;  1TGO A;  4FXD A;  1LWE A;  4YFU A;  3THW B;  4M3X A;  3CQY A;  4ZHR A;  3ULE B;  2QWR A;  4R79 A;  3LM9 A;  4OX9 K;  4BRN A;  4BDY A;  3AAP A;  1JJ2 M;  2D0A A;  4B9Q A;  4FLT A;  3CI5 A;  3BEX A;  3TAG A;  5TKY A;  3EEQ A;  3ZT2 A;  3O1B A;  3ZSY A;  3D2E A;  2YKM A;  3LDL A;  4DR2 K;  3OYA A;  2V7Y A;  2WC9 A;  5I9E B;  4ID5 A;  2FSK A;  4ILH A;  4FOE A;  1KVC A;  4A5A A;  4W5Q A;  3VEO A;  3TAF A;  4CD3 A;  3OS1 A;  4B9M A;  3MAQ A;  3MXJ A;  1TAQ A;  3VQ9 A;  2P5G A;  3NVK A;  2ZE2 A;  2B6A A;  3HRG A;  4O4G A;  4L8R B;  3RMB A;  3QB0 A;  4A62 A;  1U4B A;  1SL1 A;  4Y0W A;  5A2Q O;  1FKO A;  3NH2 A;  4PL7 A;  1HYV A;  2GBZ A;  4JI1 K;  3MCP A;  3H3O B;  3KK2 A;  3IFR A;  2G8V A;  1JL1 A;  1QVF M;  4PUO A;  3OYJ A;  4F9O A;  2KZM A;  3HST B;  5GAD P;  3TTF A;  1F21 A;  2F96 A;  1T8E A;  4RWT A;  5AQS A;  4LFA K;  4CEE A;  3EO3 A;  1J54 A;  5CR4 A;  1NKC A;  4A2B A;  2F9T A;  3NBP A;  4H0X B;  5AQY A;  2QK9 A;  1NGB A;  2Q2R A;  3EYZ A;  1WSH A;  3MN5 A;  3QBW A;  2P9L B;  3VOV A;  2EX3 A;  1S3X A;  3OA9 A;  4JKE A;  1RDU A;  3LM2 A;  3PIP L;  1RBR A;  1T05 A;  4BE2 A;  2IDO A;  4DHY A;  3K5L A;  1WB9 A;  1TUU A;  3PX4 A;  3F73 A;  3LPU A;  3SUO A;  2BDP A;  2BTF A;  1X3M A;  2IVO A;  5T7B A;  1NGH A;  3BDP A;  4DB3 A;  4Z4I A;  3VQE A;  4KB0 A;  1BA0 A;  4CZF A;  3NFA A;  2IS3 A;  1YF5 L;  3E66 A;  4IEI A;  2E2O A;  4HTL A;  4DR6 K;  1DKG D;  4FWQ A;  1BDG A;  3FZL A;  3LAN A;  3U3Y A;  1WAJ A;  4W5T A;  4IG3 A;  4FJ5 A;  2ZGY A;  2CGK A;  3BUZ B;  4C8L A;  3G4S N;  5C24 A;  1KCF A;  3VQA A;  4KB1 A;  4B3R K;  2ASM A;  5FDL A;  1VSJ A;  4DLE A;  3LDP A;  5HRS A;  4DV4 K;  4BGA A;  1S1V A;  4WF9 L;  4PA1 A;  4CEB A;  5BN8 A;  4N56 A;  2P9N B;  4DV1 K;  3E9L A;  3CCQ N;  3ZLJ A;  3L3V A;  2YKN A;  1RDA A;  3AVL A;  4CIE A;  1BA1 A;  4JNE A;  1HRH A;  3G10 A;  3K2P A;  1H1V A;  1VRU A;  3HM8 A;  3DXK A;  2X78 A;  4DTX A;  5IT9 O;  4KI6 A;  4QS8 A;  4OKJ A;  4K43 A;  2NRT A;  3H3N O;  2O8E A;  3TU5 A;  3VER A;  4DR1 K;  3LPT A;  4KO0 A;  4B1Z A;  4Y1D A;  4E1J A;  4RTF D;  1FJG K;  2ZJP L;  1K6Y A;  3P1G A;  5CY4 A;  4DR4 K;  2D0B A;  4CHP A;  3E01 A;  4BVO A;  4IFE A;  4I2Q A;  4BDZ A;  1WSJ A;  3SLC A;  1GLE G;  3K5O A;  3VF4 A;  3WNG A;  3WXM B;  4IOA L;  4DQR A;  1HNZ K;  3CC7 N;  1UA1 A;  2A41 A;  3LP3 A;  4KRE A;  3R9P A;  1U48 A;  5BR9 A;  4NCG A;  4B3T K;  1UAX A;  4JI7 K;  4EZ6 A;  1WUA A;  4BRC A;  3DYA A;  1W0H A;  1IO2 A;  3ULD A;  1ZXO A;  5GIP A;  5FPE A;  4QAG A;  3NVM A;  4FYD A;  1I3A A;  4B9V A;  4CGI A;  2HF4 A;  3O3H A;  4FWK A;  1Y97 A;  4C1N K;  4FWP A;  2P9K A;  4MO5 A;  2NRR A;  1T6D A;  3ISN C;  1TK8 A;  3H08 A;  1KAZ A;  5FRM A;  3ZSR A;  4BRK A;  1VQL N;  3IUC A;  5J2N A;  4BDP A;  3C0B A;  1M90 O;  4E19 A;  1IG9 A;  3OYF A;  2P9U A;  4IWV A;  4A2A A;  4BR5 A;  3CCU N;  4KHP K;  3NHG A;  4YOU A;  2D5R A;  1VAZ A;  1X9M A;  5AQF A;  4OLA A;  1JLB A;  2O8C B;  5EX5 A;  4CCH A;  5AQO A;  2BH1 A;  3SQ4 A;  5I42 A;  3HPG A;  3AVK A;  4LSL A;  1IKW A;  1SL0 A;  4BRH A;  1KTQ A;  1A5W A;  4QCL A;  5EVZ A;  1NJX A;  1HLU A;  1SQK A;  2ZJR L;  3BZC A;  1RTH A;  4DTO A;  2UXB K;  3BY5 A;  1WAF A;  4JS5 A;  2QXF A;  1TYQ B;  1VSK A;  3ITH A;  4K8X A;  2IVP A;  4NXM K;  4K41 A;  1LOT B;  2XY7 A;  3OYE A;  2I7P A;  2BUP A;  4IDH A;  4FJ8 A;  1VQM N;  4GV6 A;  3A0I X;  1NK5 A;  1TK5 A;  1N5Y A;  4N41 A;  3AA5 X;  1ATN A;  5ADX A;  3KLE A;  3SCX A;  4F2R A;  4FLV A;  3CPW M;  1U6Z A;  2O8D B;  4B1W B;  1Z25 A;  4CJP A;  3J7A P;  2OZS A;  5HP1 A;  4FL9 A;  3G25 A;  2W42 A;  3CYM A;  4NYF A;  3KJV A;  1JCG A;  2P9S A;  3RWU A;  1KQS M;  4M7X A;  3BF3 A;  3C95 A;  4FK4 A;  2QKK A;  4Z4G A;  5LJV A;  4W5N A;  3D2F A;  3L4Q A;  4F4K A;  1OH8 A;  1VSE A;  1SKW A;  2A5X A;  1QSY A;  1TV6 A;  4JRQ A;  1RBT A;  1I39 A;  1N6Q A;  5KQD A;  2VCP A;  4Z4E A;  1NLV A;  3OS2 A;  3C6A A;  3HPO A;  3VES A;  4CZK A;  1ASV A;  3SJJ A;  1D8Y A;  1FW6 A;  2XY5 A;  4YNQ A;  3Q7C A;  4JD2 B;  5E84 A;  5KQ8 A;  3L2V A;  4Z4H A;  5F0X A;  4DQ8 A;  1XHX A;  2VWJ A;  1W97 L;  1YUW A;  1VK0 A;  4OPK A;  4JKH A;  1BHL A;  2GWK A;  3I56 N;  2WFB A;  4DV3 K;  4EAH D;  3T1Y K;  3MN9 A;  3SZ2 A;  4FSV A;  5C42 A;  5HRO A;  2G8K A;  2YNG A;  3KTQ A;  3WXL A;  3SUQ A;  2H3G X;  2FSN A;  4LH5 A;  1A5V A;  2G8I A;  2Y1I A;  4C8O A;  3CQX A;  4BRG A;  4C8K A;  4FW1 A;  1KVA A;  4EZ9 A;  3HL8 A;  2I5J A;  4H4M A;  1YTU A;  1U45 A;  3J81 O;  4FLZ A;  1TL1 A;  5FPM A;  3U3G A;  3HM9 A;  4BRI A;  2Q0R A;  4ZTJ A;  2Z1I A;  1LWC A;  1HMV A;  2O4G A;  4FW2 A;  4DFM A;  4IOC L;  3H1V X;  2VQE K;  2E6M A;  2UUC K;  1EO1 A;  4CJF A;  3TI0 A;  4ILG B;  3HJF A;  2RN2 A;  3OVN A;  3CD6 N;  4XEI A;  3NE6 A;  3QET A;  3L4I A;  1KD1 O;  3PO4 A;  4CED A;  1X9W A;  3DMJ A;  4AHU A;  1U47 A;  3KHY A;  1VSI A;  4YOX A;  3HT3 A;  4H4O A;  3UKU B;  1BL3 A;  3QIN A;  3A5M C;  1XWL A;  4PKH A;  2AA4 A;  4NYN A;  3DLB A;  4DS5 A;  4IOX A;  3I0R A;  2RPI A;  1YT3 A;  1P90 A;  2O4I A;  3QIO A;  3D2F B;  3CJ9 A;  2ZJQ L;  2IAJ A;  2BGG A;  3LWL A;  3T3F A;  3AA2 A;  3M1F A;  3V1O A;  4CI6 A;  3VQ5 A;  4CK1 A;  4J8F A;  4RW9 A;  2G8F A;  3S3M A;  1RBV A;  1ZBS A;  3TWH A;  3A5N C;  1U49 A;  4KAZ A;  1BI4 A;  4DLG A;  3KLI A;  5M1O A;  1S9G A;  4CJV A;  3E1Y A;  4PWD A;  3L2Q A;  5KRS A;  4DTR A;  1RDD A;  5C15 A;  4CF2 A;  4AIL C;  2HF3 A;  4DSK A;  4E7K A;  4CEZ A;  1RFQ A;  3CJB A;  3THY B;  3O9U A;  2OYQ A;  2OAN A;  2YHW A;  1EWQ A;  2QWQ A;  4FJM A;  4B9N A;  3F2K A;  1R0A A;  3WUH A;  3DM2 A;  4OPH A;  2CH5 A;  3SQ0 A;  3EE9 A;  4DV5 K;  4FPA A;  2ITM A;  3ZEU B;  3ZSX A;  3HBT A;  3QFP A;  4C1N I;  4OPJ A;  2YX6 A;  4FO0 A;  1NNE A;  3RR7 A;  1L3V A;  4LY7 A;  3TTD A;  1NOY A;  1ZBH A;  2FC0 A;  4GVM A;  4ELV A;  4CJE A;  5AZJ A;  4KV8 A;  2F4V K;  3HVT A;  1KFS A;  4A61 A;  4KHY A;  1SAZ A;  1LV5 A;  3RSE B;  3G0Z A;  4IXC A;  3EZ5 A;  3AO1 A;  3CCS N;  3OYC A;  1VQN N;  3BGR A;  1NGC A;  3TAE A;  3V9U A;  4CGH A;  3THY A;  3OYB A;  3HK2 A;  1X9S A;  1C0M A;  4HHT A;  3DLH A;  1E4G T;  4V19 S;  4FJX A;  1CZB A;  3ZET B;  3RRG A;  3ZSO A;  1VQK N;  4M3W A;  1KC8 O;  3NMU A;  2NUB A;  3H46 O;  5SZT A;  1Q81 O;  3AVA A;  3LDN A;  4B1X B;  4ELU A;  2QKB A;  3QML A;  1VSD A;  1BI4 B;  1HKG A;  5HL7 L;  4NLB A;  1NGA A;  1NJW A;  4DTP A;  4FK0 A;  4EP4 A;  4O44 A;  4KH5 A;  1RTJ A;  3IMX A;  1TKT A;  3E9P A;  1VHX A;  4M41 A;  1NMD A;  3M3Z A;  4CJW A;  1Q82 O;  1DGK N;  1S6Q A;  4FJL A;  4N76 A;  3AO4 A;  3L2W A;  3QEX A;  4LF8 K;  3V6D A;  2HHS A;  1T03 A;  4CJL A;  3AVH A;  3DAW A;  1TKD A;  3O80 A;  1C0U A;  3UIQ A;  1OH6 A;  3MN7 A;  2NNW A;  3U8X A;  3TPQ A;  2E1Y A;  5E41 A;  4XH1 A;  5HRP A;  5D3G A;  2CGL A;  1JLQ A;  4B08 A;  3J8A A;  4FVM A;  4M7Y A;  4M63 C;  1IJJ A;  2QA4 N;  4WFB L;  2QEX N;  4FJK A;  3MED A;  3DRS A;  3QEW A;  2W6K A;  3D2E B;  1YXQ A;  1OH7 A;  4LF6 K;  4FZZ A;  4CEC A;  1RT6 A;  2OPR A;  3OHR A;  4FJ9 A;  3DLL L;  1CZ9 A;  1VSF A;  3QEV A;  3AAR A;  4FWO A;  2P9I A;  2KW4 A;  3UE5 A;  4R5P A;  1R59 O;  4CFB A;  3DXM B;  5JIC A;  5HOO A;  2VGM A;  4CJT A;  1NK4 A;  2HHU A;  4JN4 A;  4QOZ B;  2F9W A;  4B8C A;  5BRH A;  1WBD A;  3TAR A;  2ZF5 O;  3O1W A;  3VEV A;  3KLH A;  1ATS A;  5AQP A;  3BZK A;  4O5B A;  5E26 A;  2WON A;  4J2E A;  2HHQ A;  1B9D A;  5EU7 A;  1UA0 A;  4F3O A;  4EHT A;  2VG5 A;  1BCM A;  4CVN E;  2NRV A;  4IFV A;  1GLA G;  3N4P A;  1S72 N;  1NOZ A;  3PX0 A;  3O4N A;  1XUP O;  3OYH A;  1GOA A;  3ZYY X;  4B1V A;  3OYL A;  2Z1J A;  1WNS A;  3LWM A;  2B5J A;  1BO5 O;  3DLR A;  1JKH A;  2EHG A;  1HYZ A;  4BRO A;  5LJW A;  4AQY K;  3VEN A;  1NG9 A;  1TK0 A;  3HOT A;  4B3M K;  3MDQ A;  2YV0 X;  4MQ3 A;  4CF1 A;  4H5V A;  3AA3 A;  5DMR A;  4BRL A;  3BP8 A;  4ID1 A;  1HYS A;  5BRF A;  1IKY A;  3KLG A;  3IAY A;  5EOY A;  1OVQ A;  3AVG A;  1DT9 A;  4YHH K;  3AVM A;  3O8M A;  1K73 O;  3PX6 A;  1JCE A;  4E1N A;  2OZM A;  3JS6 A;  1ZBF A;  4DSJ A;  3LP0 A;  3O9Q A;  4J2B A;  4KKO A;  4WQ5 A;  3S3N A;  4LF5 K;  4BC5 A;  3ZT3 A;  2F8S A;  3S41 A;  3A5O C;  2F8T A;  4KFB A;  4AHC A;  3RMA A;  1MU2 A;  4GVE A;  2HBK A;  4JHD B;  4YOY A;  1VQ5 N;  3P83 D;  4DQP A;  1QZ6 A;  1KLN A;  3VPZ A;  4K42 A;  1RNH A;  4JKG B;  3KVG A;  3GG4 A;  2XO7 A;  5CHI A;  3LDQ A;  3I33 A;  2ASO A;  4DTJ A;  2VWK A;  4BR4 A;  2RF2 A;  4J2A A;  2HHV A;  1TL3 A;  2YNI A;  3ALY A;  5AQJ A;  4DF4 A;  1L3U A;  4LFC K;  3VEW A;  4K8Z A;  4E1M A;  3ZSQ A;  3KWI A;  3S3O A;  2E2Q A;  4CJK A;  1YI2 N;  3QLH A;  3OJS A;  3AO5 A;  4ILJ A;  4CEO A;  4OPA A;  4Y1C A;  2X6S A;  3K9K A;  3F9M A;  1JLE A;  4NCA A;  3WEE A;  3R3L A;  1NKE A;  3OYI A;  2W41 A;  2E4L A;  4CIF A;  2YJE A;  3VF2 A;  5GIO A;  1YIT N;  2PY5 A;  4BAC A;  3QBX A;  4KTW A;  3KKS A;  3O9T A;  2FBV A;  3DJC A;  4KHS A;  5LL6 Z;  2GV9 A;  1BUP A;  2Z1H A;  4B1U B;  3ENO A;  3QDK A;  2FF3 B;  5C0Y A;  4DG1 A;  5IWA K;  4XH4 A;  1K8K B;  2DFE A;  4JKC A;  3ZSV A;  4K0K K;  3P31 A;  4H0T B;  2NRX A;  4OO1 J;  2HBJ A;  1KSP A;  5DM7 L;  5CZ2 A;  1J6Z A;  1HNW K;  1YJN N;  3T1H K;  4OVL A;  1B92 A;  1S1U A;  4JYA K;  3WQT A;  1EP4 A;  1RIL A;  2B4J A;  4FWM A;  4CZM A;  2G8U A;  2DFF A;  2FF6 A;  1Q9X A;  2ATQ A;  4GV9 A;  3O3F A;  3P4I A;  3PSF A;  3T7Z A;  4CEQ A;  3O6W A;  4JD2 A;  5AQL A;  4BG9 A;  4GW6 A;  4JI8 K;  3CJA A;  4JHD A;  3SAG A;  1XMQ K;  3OW2 M;  3PV8 A;  1C1A A;  1GLL O;  3W3D A;  5GIN A;  4DFJ A;  1RT7 A;  3SJH A;  3NDK A;  1KAY A;  1VQO N;  2E5L K;  5BN9 A;  2JGU A;  4CHY A;  4NO7 A;  4C8N A;  3MX2 A;  5AQH A;  1SL2 A;  4LSN A;  1LW2 A;  1S5J A;  3ATV A;  4CBX A;  2O8D A;  4IDK A;  5BPN A;  5J2Q A;  3SQ2 A;  1A5X A;  5JMV A;  4U7B A;  2O8B B;  3R8E A;  4H0Y B;  1VSL A;  3OTO K;  3OY9 A;  4RG8 A;  1BCO A;  5KPT A;  5H1S Q;  2X74 A;  3ID6 A;  3QIC A;  4YOR A;  3SBG A;  1VQ4 N;  1BIU A;  4TSX A;  3OYG A;  1U2V B;  5M1K A;  1NGI A;  3E9O A;  2KQ2 A;  1Z26 A;  4FLY A;  2HOE A;  3VQ8 A;  3H6E A;  5C10 A;  1QZ5 A;  2PAV A;  3NF9 A;  3TSQ A;  4HCC A;  5AZI A;  3QIP A;  5DK5 A;  4DKW A;  1HX1 A;  2XY8 A;  4MDA A;  1C0G A;  5BRE A;  4CHQ A;  4GY2 B;  2QM1 A;  2FBT A;  2HHH K;  4AHT A;  1Q9Y A;  3HSC A;  5KGW A;  2KTQ A;  2VG7 A;  3KWG A;  1NK8 A;  1W2B M;  3T69 A;  1I94 K;  5JS2 A;  4KHQ A;  1C6V A;  4KTZ A;  3WQU A;  5JLF A;  1V4T A;  2HST A;  1WOQ A;  3AVI A;  1NK0 A;  2PYJ A;  3RVC A;  3MCA B;  5BR8 K;  3DXM A;  2OCE A;  2UUB K;  2P9I B;  3VGL A;  3QO9 A;  4CGD A;  5KI6 A;  3O4Q A;  1N32 K;  3O5B A;  3VET A;  2A3Z A;  3D45 A;  5J2P A;  1WBB A;  2QW9 A;  5HBM A;  4PQU A;  3UB5 A;  3LAK A;  4I2P A;  4I6M B;  3CFR A;  4FJ7 A;  1C0F A;  4JAX A;  4DSF A;  2GTD A;  4ISE A;  1NGE A;  2XHB A;  4JK7 A;  4OKE A;  4LC9 B;  3T19 A;  1RDW X;  5C2F A;  4JKF A;  4E7L A;  4E0D A;  3LP1 A;  1T3V A;  4DFK A;  4HWI A;  1HKC A;  3VQP A;  3K5N A;  2KZZ A;  2UXD K;  3KZB A;  3CJ1 A;  1WSE A;  3CFP A;  1VQ7 N;  1ZC6 A;  3DRP A;  4M3Z A;  4H03 B;  4FJI A;  4MLE A;  1ZBU A;  4QS7 A;  2D0P A;  3TTC A;  4BR7 A;  3GDQ A;  3CFO A;  4KH4 A;  4RW6 A;  3I0S A; 
#chains in the Genus database with same CATH homology
 1TKX A;  4RW4 A;  1LV5 A;  2HNZ A;  3G0Z A;  1IH7 A;  4CEF A;  1F21 A;  1Q8I A;  2F96 A;  3JYT A;  3AO1 A;  3HPH A;  3OYM A;  3EZ5 A;  3OYC A;  1T8E A;  3BGR A;  3AVC A;  3TAE A;  4CEE A;  3V9U A;  4CGH A;  1J54 A;  1NKC A;  4CER A;  3OYB A;  3HK2 A;  3V9X A;  1W9H A;  3NBP A;  2A1R A;  4N47 A;  3HP6 A;  4KTQ A;  3MXI A;  1KVB A;  1X9S A;  2QK9 A;  1C0M A;  1JL2 A;  3A2F A;  3AVN A;  4CJQ A;  3M8S A;  3EYZ A;  1WSH A;  4HHT A;  2FBY A;  1XHZ A;  3K59 A;  3DLH A;  1TAU A;  4FJX A;  1CZB A;  1HJR A;  3RRG A;  3ZSO A;  4DQQ A;  4M3W A;  3TAB A;  4CJR A;  3AVJ A;  1JXB A;  2EX3 A;  2NUB A;  2BE2 A;  5SZT A;  3AVA A;  4ELU A;  1RBR A;  1T05 A;  2QKB A;  4CIG A;  3OYN A;  4BE2 A;  2IDO A;  3SYZ A;  2WOM A;  1O1W A;  1VSD A;  3S9H A;  2HMI A;  4FM0 A;  3K5L A;  1BI4 B;  3KK3 A;  4FJJ A;  3PX4 A;  3F73 A;  1NJW A;  1RTD A;  3LPU A;  4CJ5 A;  4DTP A;  3SUO A;  1RTI A;  2BDP A;  4FK0 A;  4CFD A;  3AV9 A;  4O44 A;  4EP4 A;  5FRO A;  1RTJ A;  3SPY A;  2G8H A;  3QEP A;  1TKT A;  5T7B A;  4DMN A;  3K5M A;  5FRN A;  3BDP A;  1EET A;  4O0J A;  3QEI A;  1EXQ A;  4M41 A;  3DRR A;  4Z4I A;  4RW7 A;  3VQE A;  4KB0 A;  4CJW A;  1JLA A;  4ELT A;  3KK1 A;  1S6Q A;  3NFA A;  3F9K A;  1NK9 A;  2IC3 A;  2IS3 A;  4FJL A;  3ZT0 A;  3AO4 A;  4N76 A;  3L2W A;  1IKV A;  3QEX A;  3NF8 A;  3DOL A;  3V6D A;  4CGG A;  4KRF A;  2HHS A;  4HUF A;  1T03 A;  1DTQ A;  4HCB A;  3LAN A;  3U3Y A;  3RMC A;  1WAJ A;  4CJL A;  3AVH A;  1REV A;  3PUF A;  1X1P A;  4IG3 A;  4W5T A;  1TKD A;  2PZS A;  4FJ5 A;  4CJU A;  1CLQ A;  2GUI A;  4C8L A;  5C24 A;  1KCF A;  2X6N A;  3QES A;  1C0U A;  3DI6 A;  4B9U A;  3UIQ A;  2LSN A;  2HND A;  3VQA A;  2YNF A;  4KB1 A;  5FDL A;  3FFI A;  1VSJ A;  4DLE A;  4J2D A;  5HRS A;  5E41 A;  3SI6 A;  1RDC A;  2OPQ A;  4JS4 A;  3AA4 A;  5HRP A;  1T7P A;  5D3G A;  1S1V A;  1JLQ A;  4B08 A;  4PA1 A;  4FVM A;  4CEB A;  1C0T A;  4N56 A;  4FJK A;  2YNH A;  4KHW A;  3HP9 A;  3MED A;  3DRS A;  2YKN A;  3L3V A;  4I7F A;  3QEW A;  1RDA A;  3HXM A;  4DTM A;  3AVL A;  4CIE A;  3SNN A;  1D5A A;  3NH1 A;  1L5U A;  4CE9 A;  1ZBL A;  4FZZ A;  4CEC A;  3VQB A;  1RT6 A;  2OPR A;  2HB5 A;  1LAW A;  3DOK A;  1HRH A;  3G10 A;  1CZ9 A;  1VSF A;  1WN7 A;  1VRU A;  3K2P A;  3QEV A;  4NCB A;  4R5P A;  2KW4 A;  3ZSZ A;  2X78 A;  4Z0U A;  4CFB A;  3LDS A;  3V9W A;  4DTX A;  4KI6 A;  3SV3 A;  4OKJ A;  4CJT A;  4DTS A;  1NK4 A;  3VN5 A;  3NH0 A;  1L3T A;  2HHU A;  2DY4 A;  4QOZ B;  3LPT A;  4KO0 A;  4B8C A;  4Y1D A;  3TAR A;  4CGF A;  1RDB A;  1KRP A;  1BGX T;  3KLH A;  1SUQ A;  3CQ8 A;  1K6Y A;  3P1G A;  1UWB A;  4AHS A;  5CY4 A;  4CFC A;  2D0B A;  4CHP A;  3E01 A;  3VA3 A;  5KGX A;  4O5B A;  1KLM A;  4I2Q A;  2WON A;  5I3U A;  3NCI A;  4BDZ A;  4J2E A;  4F2S A;  2HHQ A;  1B9D A;  5EU7 A;  3ASM A;  1UA0 A;  4F3O A;  2VG5 A;  1WSJ A;  1BCM A;  1SKR A;  3WNH A;  1CXU A;  3K5O A;  4IFV A;  4O0I A;  2KZM A;  2OPP A;  3KD1 E;  1LAV A;  3WNG A;  1NOZ A;  1S9E A;  3IS9 A;  3NGZ A;  4KPY A;  3AO3 A;  1FXX A;  4DQR A;  3PX0 A;  4FZY A;  3O4N A;  4DTN A;  1UA1 A;  3LP3 A;  3OYH A;  4W5R A;  4KRE A;  3LZI A;  1HNI A;  1GOA A;  1U48 A;  1C1B A;  3OYL A;  4NCG A;  2Z1J A;  1UAX A;  1WNS A;  3LWM A;  1ZYQ A;  4DQI A;  2B5J A;  4EZ6 A;  1RT3 A;  4OGC A;  3DYA A;  3DLR A;  1JKH A;  2EHG A;  1HYZ A;  1W0H A;  3B6P A;  3SPZ A;  4I9Q A;  1IO2 A;  4CK3 A;  3ULD A;  3I8D A;  4QAG A;  1QQC A;  4Q5V A;  1TK0 A;  4KI4 A;  4FYD A;  3M8Q A;  4DSE A;  1QTM A;  1I3A A;  2YV0 X;  4MQ3 A;  4CF1 A;  4B9V A;  3AA3 A;  4CGI A;  3LZJ A;  3O3H A;  5DMR A;  3CG7 A;  4BE0 A;  5SWM A;  4JLH A;  1Y97 A;  3SUN A;  2XY6 A;  1J9A A;  3L3U A;  4IBN A;  4ID1 A;  5HRN A;  2G8W A;  1HYS A;  3RRH A;  1IKY A;  4DU3 A;  3KLG A;  3ISN C;  3IAY A;  1TK8 A;  1BIZ A;  3H08 A;  2HHV A;  3VA0 A;  1NJZ A;  4G1Q A;  4W5O A;  5FRM A;  3ZSR A;  4LH4 A;  1WSF A;  3MXM A;  3AVG A;  1ZBI A;  2AJQ A;  1CXQ A;  3AVM A;  5J2N A;  5J2M A;  3SQ1 A;  3B6O A;  3OYD A;  4BDP A;  4PY5 A;  1DLO A;  3NGY A;  5HLF A;  2P5O A;  3PX6 A;  3ZSW A;  4E19 A;  4E1N A;  3THV A;  2OZM A;  1IG9 A;  4DSJ A;  1VSM A;  1EKE A;  1ZBF A;  2RKI A;  3OYF A;  3V4I A;  3LP0 A;  4J2B A;  3KD5 E;  4KKO A;  3NHG A;  4CJ3 A;  2D5R A;  3S3N A;  3MEG A;  4FLU A;  1X9M A;  4GMJ B;  1HQE A;  4DWI A;  4BE1 A;  4OLA A;  1JLB A;  3ZT3 A;  4HTU A;  2F8S A;  4M45 A;  4B9S A;  4WE1 A;  3WNF A;  2F8T A;  4AH9 A;  1DTT A;  4KFB A;  4AHC A;  1NKB A;  4CCH A;  3C6T A;  4LD0 A;  3SQ4 A;  3RMA A;  4DF8 A;  3HPG A;  5I42 A;  3AVK A;  4LSL A;  1IKW A;  1MU2 A;  4FLW A;  4CF0 A;  5CYQ A;  3V1Q A;  1SL0 A;  1KTQ A;  1A5W A;  3ZT1 A;  4DFP A;  1J53 A;  3P83 D;  3QNN A;  4DQP A;  4QCL A;  1KLN A;  4Q0B A;  4OJR A;  5K14 A;  1RNH A;  1NJX A;  2DTU A;  2HVI A;  1RBS A;  2XO7 A;  1RTH A;  1YVU A;  4DU1 A;  4DTO A;  4DTJ A;  1QE1 A;  1LW0 A;  2BAN A;  1WAF A;  2VWK A;  1HQU A;  2QXF A;  2RF2 A;  3L2R A;  4JS5 A;  1TL3 A;  1VSK A;  3ITH A;  4FJH A;  3ALY A;  2YNI A;  4OKK A;  4K8X A;  4DF4 A;  5C25 A;  4M3R A;  4FJN A;  1L3U A;  2XY7 A;  4DTU A;  3OYE A;  4K8Z A;  1QS4 A;  3TR8 A;  4E1M A;  3ZSQ A;  4FJ8 A;  2ZQB A;  3CM5 A;  3MEE A;  3S3O A;  1NK5 A;  1TK5 A;  4BWJ A;  3VQQ A;  4CF8 A;  4CJK A;  3QLH A;  1N5Y A;  2HHW A;  3WNE A;  3OJS A;  4N41 A;  3AA5 X;  1JLG A;  3AO5 A;  4CEO A;  4Y1C A;  2P51 A;  2VG6 A;  2X6S A;  3ZCM A;  3KLE A;  3SCX A;  4F2R A;  4FLV A;  2XRI A;  1D9F A;  1JLE A;  1NJY A;  3QER A;  2P1J A;  4NCA A;  1QSS A;  4KHU A;  1NKE A;  3OYI A;  4N5S A;  3HVR A;  1Z25 A;  2DFH A;  2E4L A;  3C6U A;  5J1E A;  4CIF A;  2PY5 A;  4BAC A;  4CJP A;  3AVB A;  4UQG A;  2OZS A;  4KHN A;  5HP1 A;  4KTW A;  4AHV A;  1RCH A;  3KKS A;  2FBV A;  5HRR A;  3CYM A;  4NYF A;  3IRX A;  2W42 A;  4KHS A;  3KJV A;  1LWF A;  4HVJ A;  3K58 A;  2GV9 A;  5JS1 A;  2Z1H A;  4E3S A;  3RWU A;  4M3Y A;  3C95 A;  4DSL A;  2A1S A;  3JSM A;  4FK4 A;  1S1X A;  4DG1 A;  2QKK A;  4Z4G A;  3NAE A;  3TAQ A;  4W5N A;  3OS0 A;  4JRP A;  2DFE A;  4F4K A;  3ZSV A;  1VSE A;  1KFD A;  1SKW A;  3U6F A;  4E7I A;  1VSH A;  4E7J A;  4FJG A;  4IFY A;  1QSY A;  2YHA A;  1TV6 A;  1RT5 A;  1RBT A;  3LAL A;  1I39 A;  1TVR A;  2OPS A;  4JRQ A;  3QNO A;  3V81 A;  5CZ2 A;  1N6Q A;  1KSP A;  3PO5 A;  4Z4E A;  3OS2 A;  3HPO A;  3M8R A;  4OVL A;  1B92 A;  1ASV A;  1S1U A;  4ICL A;  3SJJ A;  1D8Y A;  2XY5 A;  1EP4 A;  1C1C A;  4YNQ A;  4E89 A;  1G15 A;  3L2V A;  1RIL A;  2B4J A;  4Z4H A;  2G8U A;  4F3T A;  4J2A A;  2DFF A;  1XHX A;  2VWJ A;  2ETJ A;  4B8A B;  2ATQ A;  1Q9X A;  1UOC A;  1IKX A;  3O3F A;  1VK0 A;  4OPK A;  4CK2 A;  2ITG A;  4XIU A;  3V9S A;  1BHL A;  4B9L A;  4CEQ A;  4CFA A;  1QSL A;  4DS4 A;  1FKP A;  4OGE A;  4CHZ A;  2PYL A;  5KTQ A;  4GW6 A;  4M3U A;  3SZ2 A;  5C42 A;  3VQ6 A;  4OLB A;  5HRO A;  1JXE A;  1RT4 A;  3NF7 A;  2D0C A;  2G8K A;  3RR8 A;  2HHX A;  3SV4 A;  2YNG A;  3PV8 A;  3TAN A;  4IG0 A;  1C1A A;  3KTQ A;  1S1W A;  5CZ1 A;  4DFJ A;  1JLC A;  3SUQ A;  1B9F A;  3HO1 A;  4M3T A;  4LH5 A;  1RT7 A;  3KLF A;  1A5V A;  3NDK A;  2G8I A;  2Y1J A;  3D0P A;  2Y1I A;  4C8O A;  1JLF A;  3NGI A;  1XC9 A;  2YHB A;  3HYF A;  1NK7 A;  1J5O A;  4C8K A;  4FW1 A;  3DLK A;  1KVA A;  4EZ9 A;  2JGU A;  3HL8 A;  2I5J A;  4CHY A;  3M8P A;  4C8N A;  4H4M A;  2HW3 A;  1YTU A;  1SL2 A;  4LSN A;  2E6L A;  1LW2 A;  1U45 A;  4AHR A;  1S5J A;  1D9D A;  3TAP A;  4FLZ A;  1TL1 A;  3U3G A;  4IDK A;  3HM9 A;  4IKF A;  5J2Q A;  1HNV A;  2R7Y A;  3C94 A;  1A5X A;  3SQ2 A;  4E7H A;  1ASW A;  2Q3S A;  4ZTJ A;  3IG1 A;  4H8K A;  2Z1I A;  1LWC A;  3V9Z A;  1WSI A;  1VSL A;  1HMV A;  2O4G A;  4MFB A;  4FW2 A;  4DFM A;  3OY9 A;  4RG8 A;  3VQ7 A;  1BCO A;  3RMD A;  3OYK A;  3KKR A;  1EX4 A;  3V1R A;  3OJU A;  2E6M A;  2X74 A;  3T1A A;  1BIU A;  4TSX A;  3OYG A;  3CM6 A;  1RT1 A;  3LAM A;  4CJF A;  3TI0 A;  3HJF A;  2RN2 A;  2KQ2 A;  2FBX A;  3OVN A;  1Z26 A;  5KRT A;  4FLY A;  3NE6 A;  3QET A;  1SKS A;  1FK9 A;  3VQ8 A;  3PO4 A;  4CED A;  1X9W A;  4I9L A;  2Z1G A;  4ZTF A;  3DMJ A;  4BWM A;  4AHU A;  1U47 A;  2ZD1 A;  3NF9 A;  1VSI A;  3VQC A;  3HT3 A;  3EY1 A;  4DU4 A;  4H4O A;  4HCC A;  3QIP A;  1BL3 A;  5DK5 A;  3QIN A;  3ZT4 A;  1XWL A;  4NYN A;  2XY8 A;  3VQD A;  3L2U A;  3DLB A;  4Z4C A;  4DS5 A;  4DSI A;  4CHQ A;  2IOC A;  1TKZ A;  3I0R A;  2RPI A;  1HPZ A;  4M42 A;  1VRT A;  2FBT A;  4RW8 A;  3O3G A;  1S6P A;  4AHT A;  1Q9Y A;  1WLJ A;  4EP5 A;  1YT3 A;  2O4I A;  3VQ4 A;  3QIO A;  3LP2 A;  5KGW A;  2KTQ A;  2IAJ A;  3DLG A;  2VG7 A;  3LWL A;  1NK8 A;  2BGG A;  3T3F A;  2OA8 A;  3AA2 A;  3V1O A;  1TGO A;  3VQ5 A;  5JS2 A;  4KHQ A;  4FXD A;  1C6V A;  1LWE A;  4CK1 A;  4YFU A;  4RW9 A;  4M3X A;  4KTZ A;  3DLE A;  3NF6 A;  4ZHR A;  2G8F A;  3S3M A;  1RBV A;  1XI1 A;  1S1T A;  3AVI A;  3TWH A;  1NK0 A;  1U49 A;  3PY8 A;  3KIO A;  4KAZ A;  2HHT A;  4Z4F A;  1BI4 A;  4DLG A;  3KLI A;  4FM2 A;  2HNY A;  2PYJ A;  4CHO A;  2KFN A;  1S9G A;  4FM1 A;  4CJV A;  1BIS A;  4BDY A;  3QO9 A;  2D0A A;  4FLT A;  4CF9 A;  4PWD A;  3L2Q A;  4CGD A;  3TAG A;  4HUG A;  4F8R A;  5KRS A;  5KI6 A;  3ZT2 A;  4DTR A;  3O4Q A;  1RDD A;  3RTV A;  3ZSY A;  1QHT A;  1RBU A;  4CF2 A;  3SUP A;  4AIL C;  2YKM A;  5J2P A;  3D45 A;  2IGI A;  2HVH A;  5HBM A;  4PQU A;  3OYA A;  4FJ9 A;  3LAK A;  4I2P A;  4DSK A;  3CFR A;  4FJ7 A;  1GOB A;  4E7K A;  1YTA A;  4ID5 A;  4CEZ A;  4DSF A;  1L3S A;  2OYQ A;  3K57 A;  1KVC A;  4W5Q A;  3P5J A;  3TAF A;  2XHB A;  3OS1 A;  1WSG A;  4OKE A;  4FCY A;  4B9M A;  3T19 A;  3MAQ A;  4FJM A;  4E7L A;  4O55 A;  4B9N A;  3LP1 A;  4CEA A;  1R0A A;  4DFK A;  4E0D A;  3MXJ A;  3DM2 A;  4C8M A;  1TAQ A;  3VQ9 A;  2P5G A;  3SQ0 A;  4CJS A;  3VQP A;  2ZE2 A;  3K5N A;  1NK6 A;  3AO2 A;  2B6A A;  4O4G A;  4L8R B;  2KZZ A;  4DQS A;  3ZSX A;  3RMB A;  4CJ4 A;  4B3O A;  1GOC A;  4CGJ A;  4HUE A;  1SV5 A;  4OPJ A;  4CHN A;  1ITG A;  1U4B A;  1SL1 A;  4FZX C;  1BQN A;  1WSE A;  3CFP A;  3TAM A;  3DRP A;  1FKO A;  4CES A;  3NH2 A;  1L3V A;  3RR7 A;  4M3Z A;  1HYV A;  2GBZ A;  4LY7 A;  4FJI A;  1NOY A;  2JLE A;  1U04 A;  1ZBH A;  1RT2 A;  1ZBU A;  1ASU A;  2FC0 A;  4GVM A;  4CJE A;  3KK2 A;  4B9T A;  4ELV A;  4KV8 A;  2G8V A;  3AVF A;  5CYM A;  1JL1 A;  3HVT A;  3MEC A;  3CFO A;  1KFS A;  4FK2 A;  3OYJ A;  4PUO A;  2KFZ A;  1BQM A;  4FLX A;  3L8B A;  3HST B;  4KHY A;  4RW6 A;  3I0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...