3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
1TL3A 1S6PA 4O5BA 1WSGA 1S6QA 2JLEA 4CECA 3KK2A 3ZSYA 3CFRA 4CEFA 3ZT4A 2HVIA 1U04A 1KFDA 4E7IA 4PY5A 2DY4A 4BE1A 3SV4A 4RW7A 1IO2A 1JL2A 4FW2A 3O3FA 2BANA 1U47A 1VSMA 1EETA 4AHCA 2VG6A 1JXEA 4FJMA 3SJJA 4KREA 4CEAA 3QIOA 4W5OA 4KV8A 4CEZA 4JS4A 3KLFA 3AVIA 1RCHA 2HNZA 2P1JA 4Y1CA 2ZE2A 1BL3A 3KTQA 1W9HA 3VQ4A 4QOZB 4DTOA 1T03A 4C8OA 1UA1A 4E1NA 3KLIA 3K58A 1NK8A 4OGEA 4IBNA 1IKWA 1BIZA 4CJPA 4CFAA 3HM9A 5I3UA 1TK0A 2HB5A 4CK3A 1U48A 4N76A 1C0TA 3WNHA 1RDAA 1YTUA 1HQUA 1NK4A 5T7BA 2IAJA 1BHLA 1Z26A 3AA4A 1A5XA 3ZSWA 4FM2A 3PX4A 2KZZA 4BWMA 1TK5A 2XO7A 3MEEA 5KGWA 4H4OA 5J1EA 3SUNA 1CZ9A 1D8YA 1KVCA 2OPPA 2O4GA 4WE1A 2XY5A 1RT1A 3AA2A 2G8UA 4FM0A 4YFUA 4M3WA 2ATQA 3U3GA 2DTUA 3L2UA 3PX0A 4KB0A 4RW9A 1JXBA 2YHBA 4FJ9A 2D0CA 3AV9A 3WNEA 4ID5A 3LPUA 1TGOA 1C6VA 4FJLA 1HMVA 3AO2A 3K57A 1TAUA 1WSFA 3SQ4A 3RMAA 4J2AA 1NJYA 4B3OA 3AVGA 2XY6A 1S1XA 1RTDA 4DQPA 4FJ8A 4CHQA 1WAFA 1YT3A 5DK5A 5KRSA 4JLHA 1JL1A 1RT7A 4KRFA 4FLVA 1X9SA 1XI1A 3OYKA 3PO5A 4Z4FA 4EP4A 2FBYA 4C8KA 3ASMA 4TSXA 4CF8A 5CYQA 3ZCMA 4IKFA 3O4NA 2QK9A 4JRPA 1RT3A 2D0BA 1S1TA 2I5JA 2X78A 1BCMA 4OJRA 3B6OA 3P5JA 4AHUA 3NH0A 1L3SA 1O1WA 1NOYA 3RMBA 2KFNA 1VRTA 4N56A 4E7JA 2D0AA 3SNNA 2EX3A 4FLYA 2KZMA 4B9TA 4H4MA 4J2EA 4DTNA 2P51A 3LANA 5KGXA 4JRQA 1QTMA 1RNHA 4DFKA 4O55A 2HNDA 4M3RA 4DG1A 3OYDA 4F3OA 1RTHA 4ZHRA 1GOCA 4FZYA 4OKEA 4NCGA 4ICLA 1NOZA 2QKBA 3SCXA 4FJKA 1FKPA 4B9UA 3O3GA 3DLGA 3KLHA 2LSNA 3MEDA 3AO4A 2IGIA 1UWBA 1QSSA 3KD5E 5HRPA 1BQNA 4KHQA 2Z1IA 4B08A 3ZSZA 1JLFA 2E6MA 3KKSA 1TK8A 4RG8A 4F2SA 3K2PA 4CJ5A 4LH4A 1XC9A 3HP6A 1X1PA 1HPZA 2IC3A 3RRGA 1ASWA 4FJ7A 2O4IA 1WSEA 3CFOA 3L2WA 3M8PA 4CGHA 2FBVA 3QEPA 4ELVA 4CHNA 4KTZA 4AHRA 3LAMA 4BDZA 1FK9A 4AILC 2R7YA 3LWLA 1YTAA 3AO3A 4IG3A 3RMCA 5SWMA 3L2QA 4FZXC 4PUOA 3ZSRA 4NCAA 4FLXA 1S1VA 2E6LA 3VQ8A 4CGJA 3NHGA 2DFHA 2HHXA 4J2DA 2DFEA 1IG9A 3C6TA 1NJWA 1RT4A 3C6UA 3ZSQA 4CF0A 2WOMA 3TARA 4JS5A 1QHTA 3OYFA 1DTTA 3TWHA 4DS4A 2HHTA 4KHSA 4DTRA 1KFSA 1S9GA 3EY1A 3LP2A 3ITHA 4DQSA 3PY8A 4B8AB 1T8EA 3F73A 1HNVA 3DLRA 3VQAA 2ZD1A 3V9WA 5KI6A 3C94A 2ZQBA 1JLGA 3HPOA 4DFJA 4N41A 2IOCA 5J2PA 1BGXT 3I8DA 4NYFA 1RBRA 3MXMA 3CM5A 4M3ZA 4LD0A 4K8ZA 3LPTA 4DLEA 3LP3A 3M8RA 3HSTB 4KKOA 4DFMA 1RDBA 5HRNA 4FLTA 1NK5A 4W5QA 1Z25A 3VA0A 1DLOA 4H8KA 3RTVA 3RR8A 4KI6A 2OPSA 5C24A 1BISA 4E7KA 3MEGA 4CJSA 2HHVA 4CK2A 4E0DA 3NF8A 2PZSA 4M3UA 2PY5A 1NKBA 1C1BA 2IS3A 3D0PA 1ZBHA 2GV9A 3LP1A 3QEWA 4FW1A 4DMNA 1RBUA 2JGUA 4Z4EA 1HYZA 3SUPA 3V9XA 2RN2A 3TAQA 1CXUA 1RT2A 3KIOA 3KD1E 2XHBA 4NYNA 3DM2A 3DRRA 4OGCA 3T1AA 3ZT0A 4CJKA 4BACA 4DSEA 2Z1HA 1S5JA 4Z0UA 4FZZA 1LWCA 1Q8IA 3M8QA 4FJ5A 1RTJA 2D5RA 4W5RA 1CXQA 4W5NA 1T05A 3O4QA 3DI6A 1WNSA 4CJQA 3DLEA 4OPKA 3VQ9A 4B9LA 2KFZA 3QESA 1WSIA 3AVBA 3VQPA 4E3SA 1REVA 2G8VA 3QLHA 2QXFA 4DQQA 2P5GA 1QS4A 1LWFA 1L5UA 5EU7A 5FRNA 3IAYA 3JSMA 1NK9A 4OPJA 3K5OA 1X9MA 1G15A 2YNHA 5KRTA 4RW6A 1GOBA 4E19A 4HVJA 1LAWA 4FK2A 5SZTA 2NUBA 4BE2A 1ZBIA 3VQDA 4IDKA 2VG5A 4FM1A 4FJNA 1KTQA 5J2NA 1VK0A 3A2FA 2VWKA 4L8RB 1C0UA 3RMDA 3MXIA 4CHYA 1KLMA 4XIUA 2OPRA 4GMJB 5JS2A 4CJVA 3OS1A 4KTQA 2YNFA 3SV3A 4PQUA 1VSDA 4CFCA 4HCBA 4KHUA 4Z4HA 4HHTA 3TABA 4CIFA 4FJGA 3OYMA 3DLBA 2HW3A 4ID1A 4OVLA 4DSLA 3OYJA 4M3TA 3DRPA 4CJFA 2ITGA 5CZ2A 3ZT3A 3HVRA 4IG0A 3TR8A 1SUQA 3NAEA 2Q3SA 1KVAA 1C0MA 3AVHA 4C8MA 4B8CA 4QCLA 3OYBA 3KKRA 4GW6A 1A5VA 4O0JA 4KHNA 4MQ3A 3NE6A 1IH7A 3SZ2A 3ALYA 4DLGA 3I0SA 2VG7A 1LW0A 4I2PA 3S3MA 1GOAA 1XHZA 4FLWA 3SPYA 1KLNA 4QAGA 1TAQA 3DLHA 4B9VA 1NKEA 1UAXA 3JYTA 4DSIA 3CQ8A 1ZBFA 4DQIA 1CLQA 4FLUA 3HT3A 5FROA 3SI6A 3OYHA 4CK1A 1ASVA 3CG7A 2HHUA 2YV0X 4DTXA 4HUFA 4FJIA 4HUEA 4OKJA 3OYEA 2OZMA 4RW8A 4F2RA 3ZSXA 4CGGA 4O0IA 4FLZA 1JLAA 3SUOA 3HL8A 4G1QA 4CF1A 3KLGA 4K8XA 3U3YA 3V4IA 2G8WA 5FDLA 4J2BA 4B9SA 3HK2A 1XWLA 4F3TA 4CEDA 4N47A 1HNIA 4I2QA 3QEIA 3QETA 1UA0A 3LZIA 3ZSVA 3SQ2A 1U45A 2OA8A 1UOCA 1VRUA 3OS0A 1SKRA 3PO4A 1S1WA 5CZ1A 3K5NA 4DTJA 4PWDA 4DF4A 1LW2A 1QSLA 1A5WA 3ZT1A 4CHPA 1JLCA 2HNYA 2KW4A 4LH5A 4R5PA 2RF2A 4I9LA 4CGIA 3OYLA 2G8HA 4KB1A 2DFFA 3K5LA 4AHTA 2WONA 4Z4IA 4CIGA 1RILA 2G8FA 3AVFA 2P5OA 3LP0A 5JS1A 4FVMA 3EYZA 4BE0A 3TAGA 1TKTA 3NF6A 4CF9A 2OZSA 4DSFA 3NDKA 1Q9YA 2GBZA 1N6QA 1KSPA 1RT6A 3DOLA 2FBTA 2YHAA 4FK4A 1NJZA 1CZBA 1RDDA 3QEVA 1S1UA 3PUFA 3OYAA 4CGDA 3AVKA 2PYJA 3S3OA 1F21A 3OYGA 1R0AA 3VQEA 1J5OA 3OJSA 1DTQA 3DLKA 1XHXA 2Z1JA 1N5YA 1J9AA 4DSKA 1X9WA 1ASUA 4M42A 3V1QA 3NH1A 1SL2A 4GVMA 4DTMA 1ZYQA 4ZTFA 4BWJA 3HPGA 4CEBA 5HROA 1K6YA 2Z1GA 1Y97A 2B6AA 3VQ7A 3T3FA 1BI4B 1SKWA 4I7FA 3QIPA 3MAQA 3L8BA 1SL1A 3NH2A 4LSLA 5J2MA 3U6FA 3QERA 2G8KA 4C8NA 4CCHA 1NKCA 1J53A 2YKNA 1KVBA 3LALA 5DMRA 4CJUA 4CJRA 3SYZA 3P1GA 4HUGA 4M3XA 3NGIA 3NGZA 3THVA 3VQ6A 4DSJA 1VSHA 1TV6A 3V1OA 3VA3A 4EZ9A 3OY9A 3TANA 4I9QA 1WSJA 1TVRA 4B9NA 4M45A 4IFYA 1RBTA 1TKZA 4HCCA 5FRMA 1HJRA 4Q5VA 3L2RA 4KI4A 3TAFA 4CEEA 1C1AA 1JLEA 2RPIA 2FC0A 5C25A 3KK3A 3PX6A 3S3NA 1D9DA 1VSLA 4CHOA 1NK7A 4F4KA 2ETJA 2VWJA 1VSFA 2F8SA 1EP4A 3V9ZA 4CJ3A 2XY8A 3C95A 3ULDA 3MXJA 1ZBLA 3AVNA 4M41A 3HXMA 2Y1JA 5J2QA 5I42A 3HJFA 5CY4A 3LAKA 5HBMA 4OKKA 3NF9A 2KQ2A 2YNIA 3G0ZA 3NBPA 1L3TA 4Z4CA 4M3YA 4O44A 2A1RA 1U4BA 4LY7A 1EXQA 4CFBA 3T19A 3HYFA 3NFAA 4KO0A 1TKDA 1TKXA 4EP5A 3FFIA 4E7HA 3CYMA 2X6SA 5HRSA 1EKEA 4RW4A 3LDSA 3V9UA 3BDPA 4YNQA 3SQ0A 3V81A 2A1SA 1IKVA 5C42A 2RKIA 1D5AA 1W0HA 3CM6A 3QINA 5D3GA 3VQQA 1SV5A 4BDYA 3TAEA 4ELTA 3IS9A 4BDPA 3ZSOA 3VQCA 3H08A 3P83D 4CJ4A 1NK6A 3AA5X 1NK0A 1ITGA 3TAMA 2XY7A 3SPZA 3E01A 4CGFA 1LAVA 4DU4A 3RWUA 4ZTJA 1T7PA 4N5SA 3EZ5A 2HHWA 4DTUA 4MFBA 4CEOA 1SL0A 4AH9A 2QKKA 3AA3A 1SKSA 4B9MA 1BQMA 1HQEA 4UQGA 1KCFA 4Q0BA 2GUIA 4PA1A 4DU1A 1BIUA 5KTQA 1VSKA 1KRPA 5E41A 2OYQA 3MECA 5HP1A 1Q9XA 1VSIA 4FK0A 3L3VA 3HVTA 1JLBA 4CERA 3DYAA 3L2VA 4O4GA 2YKMA 3QNNA 4F8RA 3IRXA 1WLJA 2G8IA 4FXDA 1WSHA 4CJTA 4C8LA 3KJVA 1YVUA 3WNGA 2F8TA 1QE1A 4DTPA 2F96A 4E1MA 3SUQA 2X6NA 3NGYA 3HO1A 2KTQA 2E4LA 1B9FA 1S9EA 3AVCA 4CE9A 3OVNA 1FXXA 2B4JA 4DWIA 1TL1A 4KFBA 4KAZA 4FYDA 5K14A 4CHZA 1RBVA 4CF2A 1MU2A 2X74A 3NCIA 4DS5A 1L3VA 3KK1A 1IKYA 2PYLA 1HYSA 3OJUA 3TAPA 3V9SA 3O3HA 3L3UA 3DMJA 3F9KA 4AHSA 1VSJA 1IKXA 2FBXA 3QNOA 3PV8A 3DRSA 3BGRA 3SQ1A 4OLBA 4DQRA 4CJWA 3ISNC 1I3AA 4Z4GA 4FJHA 4E7LA 3KLEA 5HLFA 3OYIA 1RDCA 4DTSA 3WNFA 3CFPA 5CYMA 3AVMA 1WN7A 4IFVA 3OYCA 3G10A 4KTWA 3B6PA 3QEXA 3I0RA 2Y1IA 2BGGA 2HVHA 3AVAA 1QSYA 4CFDA 2BE2A 4AHVA 3RR7A 4ELUA 1QQCA 4CJLA 3K5MA 2EHGA 1BCOA 3NF7A 3LWMA 1JKHA 4FCYA 1WAJA 3LZJA 4LSNA 1EX4A 3S9HA 2HMIA 1B92A 1BI4A 2XRIA 3DOKA 4FJJA 2BDPA 1I39A 1ZBUA 2HHSA 2HHQA 5HRRA 4Y1DA 3K59A 4E89A 3UIQA 3M8SA 4NCBA 3V1RA 4DF8A 3VQBA 3AO5A 1U49A 1LWEA 4CESA 2YNGA 1C1CA 4W5TA 3QO9A 1JLQA 4FJXA 4KHWA 4CEQA 1RT5A 3IG1A 4KHYA 1L3UA 3HPHA 3ZT2A 4DU3A 1D9FA 1LV5A 4DFPA 3V6DA 1RBSA 1HYVA 3AVJA 3OYNA 1J54A 4HTUA 2OPQA 4EZ6A 2W42A 2AJQA 3VQ5A 4OLAA 1B9DA 3D45A 3RRHA 2IDOA 4CIEA 3AO1A 1HRHA 1RTIA 3AVLA 4KPYA 1NJXA 3VN5A 3HP9A 3TI0A 1FKOA 1VSEA 3OS2A 4CJEA 2B5JA
chains in the Genus database with same CATH superfamily
1S6PA 2ZJRL 4CECA 4FWOA 4CEFA 1MWKA 2HVIA 4E7IA 4PY5A 2DY4A 4BE1A 1IO2A 4FW2A 1U47A 3O3FA 5AFUA 1VSMA 5LMNK 1JXEA 1ILYA 2P9KB 4W5OA 4JI0K 4OO1J 3BUZB 3HOSA 4CBWA 1HLUA 2ZE2A 5F2RA 3KTQA 3VQ4A 4QOZB 5GADP 4E1NA 3KLIA 4M7XA 4OGEA 3HM9A 3FZFA 4CFAA 4N76A 3N4PA 2HB5A 1C0TA 1RDAA 2O8DB 1NK4A 5AQQA 4FM2A 1Z26A 5JVHL 4BWMA 1D8YA 2OPPA 2O4GA 2XY5A 4M7YA 1K9MO 4FM0A 4BR5A 1Y64A 4JKHA 1TYQB 3D2EA 4YOUA 4KB0A 1JCEA 4FJ9A 2D0CA 5BRHA 4ID5A 3EE9A 1C6VA 4FJLA 1HMVA 4DB3A 3O9SA 4B3OA 2XY6A 1RTDA 2KKZA 4CHQA 4QS8A 5KRSA 4GV6A 1JL1A 1SS6A 1JCFA 3TTCA 4EP4A 4TSXA 5CYQA 3ZCMA 4JI4K 4JRPA 4FL9A 4ILHA 2D0BA 4OLAA 2QTDA 3OTOK 3P5JA 4BC4A 1L3SA 2KFNA 4C1NI 4BVPA 3LDOA 4N56A 3CCMN 2D0AA 4B9TA 3CCUN 4J2EA 1VQNN 4M3RA 2HNDA 3OYDA 2NRZA 1XMOK 4ICLA 4FJKA 3MMVA 4B9UA 3O3GA 5F1XA 1QSSA 4KHQA 4B08A 3ZSZA 2E6MA 5BN8A 1TK8A 5C2DA 3K2PA 3J7YP 1ASWA 2GX9A 3QEPA 3VENA 4AHRA 4H5VA 3AY9A 3R6MA 1U2VA 4FWPA 4JEPA 3VGMA 4BY9C 4EHTA 4FLXA 5AQSA 3VQ8A 3NHGA 1HNZK 1NJWA 4ISFA 3GBTA 3C6UA 3TARA 3L6QA 3OYFA 4DS4A 3EY1A 3ITHA 4O5FA 4B8AB 1T8EA 4JI6K 1JLGA 4DFJA 2E1ZA 4IEIA 2V7ZA 4M3ZA 4K8ZA 4DLEA 5AQYA 3TSUA 2NRVA 2V51B 2IVOA 3VA0A 3RR8A 3OBWA 3FZLA 4X64K 2OPSA 3A0IX 1OH6A 3MEGA 2ASOA 4CJSA 1HR0K 2BH1A 2PY5A 5JLHA 3D0PA 2GV9A 3QEWA 1Q7YO 4AF1A 2RN2A 1CXUA 3CXCM 4BACA 1K73O 4DSEA 1S5JA 3HI0A 4CD1A 4W5NA 3E9PA 3DAWA 3DI6A 4CJQA 2P9NA 3DLEA 4WQ5C 3AVBA 5BPNA 1XUPO 4DQQA 2P5GA 3I56N 3IAYA 1X9MA 1G15A 5KRTA 5HOOA 4LFBK 1TUUA 3TSQA 3QICA 2P9KA 1HJOA 3BF3A 2VWKA 1OH7A 5JMVA 3RMDA 2YCHA 4CHYA 4XIUA 2OPRA 5JS2A 4CJVA 3SV3A 1VSDA 2GEMA 4FJGA 2HW3A 3AGKA 4ID1A 1KD1O 4DSLA 5I9EB 3OYJA 3O1WA 4L3QA 3DRPA 4H5WA 2ITGA 5CZ2A 5AQOA 3TR8A 4DUZK 2WUSA 5FPDA 5EOYA 1N33K 4H0PA 3FFKB 4B8CA 3AVHA 2V52B 4K43A 4WQ4C 2UXDK 5M1FA 2QWMA 2WC9A 1ATSA 5DM6L 3SZ2A 3ALYA 2VG7A 1LW0A 3CJ9A 3CQXA 3VGKA 4GKKK 4CZFA 1NG9A 3SAFA 4DQIA 4H0XB 1CLQA 4CK1A 2HHUA 2YV0X 4OKJA 3PSIA 4F2RA 5KQ8A 4FLZA 1XQSC 3BF1A 3G25A 5AQJA 2G8WA 4B9SA 5BPLA 3M3ZA 4XH4A 3QETA 4C23A 3SQ2A 5AQZA 3CQYA 1S1WA 4DTJA 3SAGA 1EWQA 1QSLA 4PL8A 3LM9A 1JLCA 2KW4A 3DJCA 3MN7A 5BR8K 4I9LA 4KB1A 4CGIA 5M1KA 3VF4A 2HF4A 2FSNA 3AVFA 3EYZA 4BE0A 4H5NA 3TAGA 1YXQA 3WQUA 2OZSA 4DSFA 3NDKA 4BRNA 4FVUA 1GLAG 1RDDA 4FWLA 1ATNA 3CERA 4B1VA 2PYJA 1R0AA 3VQEA 1J5OA 1DTQA 3CC7N 2Z1JA 1N5YA 1X9WA 4DR2K 1ASUA 4FO0A 1SL2A 4QS9A 5MLCQ 2WFBA 3THWB 4CEBA 4K25A 1SKWA 2QWRA 3EZWA 5J2MA 2G8KA 4C8NA 3SK3A 4CJRA 1I94K 4JD2A 4YDUA 3THVA 3P4IA 1QQNA 4BRPA 1TV6A 3V1OA 3VA3A 4GKJK 1WSJA 4B9NA 4IFYA 1TKZA 5FRMA 5FLXO 3L2RA 4JYAK 3TAFA 2HF3A 3PX6A 3D7EO 4IOCL 2F8SA 1EP4A 1QZ5A 3UB5A 4CJ3A 4KHPK 4H5TA 2YJEA 4FWRA 1VHXA 3HXMA 2Y1JA 5J2QA 5I42A 3LAKA 5HBMA 4JKCA 1BOTO 2KQ2A 2YNIA 1L3TA 3CPWM 4M3YA 4BR2A 4DQ8A 4AQYK 2P9UA 4EP5A 3FFIA 3J80O 4G9ZA 3ZETB 3VOVA 1IV0A 1NJIO 4YNQA 5C42A 1EO1A 3U8XA 3TAEA 4C1NK 5M1QA 1VQKN 4JNEA 3ENBA 1M1KO 1BU6O 2FXUA 3ZSOA 3CCLN 3H08A 3P83D 3VMFB 1NK0A 3E01A 4CGFA 5AR0A 4DU4A 1BA1A 1T7PA 3EZ5A 4AH9A 1BQMA 1HQEA 2HHHK 1BIUA 2ITMA 3C7NA 3HZ6A 1KRPA 2OYQA 3MECA 3THXA 4FK0A 4B1YB 3HVTA 4CERA 1V4SA 2YKMA 1MA9B 1NGFA 1WLJA 4CJTA 1CZAN 4C8LA 1JCGA 1YVUA 4DTPA 3HO1A 2X6NA 3NGYA 4Y0WA 2E4LA 4K41A 1S9EA 5BRFA 1FXXA 1NGGA 4CHZA 4CF2A 2X74A 2PYLA 3KK1A 2ZM6K 3V9SA 3TAPA 2FBXA 2HBJA 3UE5A 4UY8O 3MN6A 3DRSA 3SQ1A 1I3AA 4FJHA 4E7LA 3KLEA 3A5MC 1S22A 4B3RK 5CYMA 3OYCA 3PLAA 4CZHA 2Q97A 3AAQA 4AHVA 4BQLA 3K5MA 3NF7A 4BGBA 3S9HA 5FPMA 4A5BA 4FJJA 5E84A 2Q36A 3GL1A 1VQLN 4Y1DA 2UYTA 3UIQA 3O8MA 3V1RA 1U49A 2A42A 1YAGA 3MX2A 4JV5K 4BG9A 1JLQA 4JK7A 1Q18A 2E2QA 3CD6N 4CD3A 3G4SN 1L3UA 4DU3A 2FSJA 3DXMB 3V6DA 1RBSA 3JS6A 1HYVA 4AM6A 3OYNA 3VQ5A 1GLFO 3D45A 3FGUA 5A2QO 3H3NO 1RFQA 3VN5A 1FKOA 1U2VB 2B5JA 5GINA 1TL3A 1QQOA 1WSGA 3O9TA 4JK8A 3H45C 1YITN 3ZSYA 3CFRA 2FSKA 1N32K 3THWA 3ZEUB 1W7AA 3CJ1A 4RW7A 4OX9K 4MLEA 3G71N 3OHRA 1EETA 2P9IB 2VG6A 1ATRA 3SJJA 4KREA 3A5OC 3KZBA 4CEZA 3AVIA 2HNZA 1BL3A 2ZJQL 1W9HA 1NGDA 1P90A 4C8OA 1UA1A 3K58A 3W3DA 4IBNA 3F2KA 5M1NA 1TK0A 1ESVA 3C65A 4RCHA 1YTUA 3PIPL 1HQUA 3CCSN 1A5XA 3SUNA 3DXKB 1CZ9A 1KVCA 2G8UA 3ULEB 2JWLA 3PX0A 3WNEA 3LPUA 5AQTA 4DV6K 4BR9A 2QI2A 3ZYYX 3AVGA 1M90O 4FJ8A 1YT3A 3MX5A 5DK5A 4FPAA 4DHYA 4YOVA 1YJ9N 2FF3B 4FLVA 3T1YK 3WXKA 3OYKA 1XI1A 1NGHA 4C8KA 2FBYA 4YOTA 2P9NB 1RT3A 2JWKA 3O9UA 2X78A 1S1TA 2I5JA 4ILJA 4ELTA 4IKFA 1NOYA 2PBDA 1O1WA 1VRTA 2HOEA 4FLYA 3LANA 5KGXA 4JRQA 4FOEA 4ZHRA 3ENHA 4NCGA 4KH6A 4JKFA 2A41A 3DLGA 4BRCA 2LSNA 3AO4A 3MK6A 4YORA 3ATUA 5HRPA 3KD5E 4F2SA 4LH4A 3HP6A 1X1PA 3IKMA 2O4IA 3M8PA 2NRRA 4ELVA 4JKGB 2WBNA 1FK9A 2R7YA 1YTAA 4A61A 2A40A 3RMCA 5SWMA 4FZXC 3ZSRA 1LOTB 4CGJA 2YHYA 2DFHA 3WXMB 3CC2N 1RT4A 4PL7A 1IBMK 2WOMA 4JS5A 1QHTA 1DTTA 3TWHA 4JI5K 4KHSA 4DTRA 1KFSA 3KVGA 3FR0A 4DQSA 3PY8A 2UU9K 3F73A 3BY5A 1HNVA 3DLRA 3V9WA 4JI8K 5CHIA 3C94A 4CZEA 3I8DA 4NYFA 2UXBK 1G99A 2GELA 4LD0A 1VQMN 3M8RA 5CE3A 4DFMA 4RTFD 1YUWA 3UKUA 5AQKA 4W5QA 3FZHA 4B9QA 5GAHP 4NB4A 4H8KA 3RTVA 4WCEL 2HBLA 3P38A 4CZKA 3LDLA 5C24A 5HL7L 4M3UA 2PZSA 4FW1A 1FJGK 3EL2A 4DMNA 3OA9A 3V9XA 5AQMA 3QDKA 3DM2A 3DRRA 4CJKA 4FWQA 4Z0UA 4GNIA 1Q8IA 4IDHA 1CXQA 1T05A 4EHUA 3AARA 2KHOA 3VQPA 4E3SA 2QXFA 1LWFA 2ZF5O 4DR3K 5FRNA 1IJJA 1P8ZA 3OW2M 3ZEUA 3R9PA 4RW6A 1LAWA 5SZTA 3VQDA 3PIOL 2W6LA 4IDKA 4JAXA 4FM1A 4FJNA 1KTQA 5J2NA 3A2FA 4H0VB 4KH4A 3MXIA 1X9JA 4KTQA 4PQUA 4CFCA 4CIFA 1GLDG 3CI5A 4DR4K 4M3TA 3HVRA 4IG0A 1BO5O 1SUQA 3HBTA 3HRGA 1KVAA 1IG8A 4QCLA 3CJAA 3OYBA 4GW6A 1A5VA 2P9LA 4O0JA 4I2PA 2ZGYA 1GOAA 2P9UB 1KLNA 3SPYA 4B9VA 1NKEA 4CJ7A 1UAXA 2O8BA 4DSIA 3CQ8A 1ZBFA 4Z94A 3HTVA 3HT3A 4CW7B 3SI6A 3CG7A 4DR5K 3OYEA 2Q2RA 3F5TA 4RW8A 2D4WA 4O0IA 2O8CB 1XNQK 4K8XA 4J2BA 3HK2A 5AQXA 4CEDA 4CBUA 2NRTA 3J81O 3QEIA 1UA0A 1U45A 5JICA 3KK7A 1VRUA 1SKRA 3M5RA 3K5NA 4DF4A 4CHPA 2HNYA 4LH5A 3VESA 2G8HA 2DFFA 3K5LA 3TSPA 2P5OA 2G8FA 5JS1A 3THXB 3W0LA 1TKTA 3NF6A 2GBZA 1RT6A 2FBTA 4EIAA 1CZBA 3SBTA 3QEVA 2D0PA 5JLFA 3AAPA 3ATVA 3AVKA 3S3OA 1F21A 3OJSA 1XHXA 1XC3A 3V1QA 5GAEP 3S41A 3Q7BA 4CI6A 4BWJA 3O4WA 1K6YA 3D2FA 2B6AA 3L0QA 1YJWN 2E88A 3T3FA 1BI4B 4BC5A 3MAQA 1SL1A 4LSLA 3MDQA 3O1BA 1J53A 3LALA 4CJUA 3SYZA 4M3XA 3NGZA 3TPQA 2OANA 4DSJA 1VSHA 4LF5K 4EZ9A 3HOTA 4I9QA 4JI7K 1X3MA 1RBTA 2VCPA 4HCCA 4CEEA 3KK3A 1JLEA 3A5NC 4BRMA 3S3NA 1NK7A 4F4KA 2ETJA 1VSFA 3V9ZA 3C95A 3ULDA 1ZBLA 3AVNA 3HJFA 2YX6A 1KAYA 1KC8O 3T1HK 4E7HA 1D4XA 2X6SA 4CZIA 1ZC6A 2D0OA 1BDGA 3LDSA 3BDPA 3V81A 2A1SA 4JI3K 4LFAK 2ASMA 3BP8A 1SV5A 5C2FA 4BDPA 5FPEA 1NK6A 5CR4A 3AA5X 5AQPA 4B1XB 1XNRK 3CHWA 5AZIA 3SPZA 1LAVA 3VERA 1KXPA 3SAHA 5LJWA 3AA3A 3JAMO 3KHYA 2AP1A 1SKSA 4UQGA 1KCFA 2KLAA 2UUBK 4BRAA 2E2NA 3ZX3A 1Q9XA 3GG4A 2YHXA 3DYAA 3I8BA 4I6MA 3WEEB 4JD2B 3IUCA 4NXNK 3EN9A 1KAXA 1S72N 4E1MA 4R79A 3SUQA 3VEZA 1BA0A 4CE9A 2B4JA 1TL1A 4KFBA 4WFNL 3O6WA 4KAZA 5K14A 3NCIA 1GLBG 2O8EA 3O3HA 1OKJA 5C10A 3DMJA 3F9KA 3K9JA 4JHDA 3QNOA 3BGRA 4OLBA 4DQRA 4CJWA 4Z4GA 1BG3A 5HLFA 4X66K 1HX1A 3JXUA 3G10A 4KTWA 3ID6A 3QEXA 3I0RA 2Y1IA 5EVZA 1SAZA 4NLBA 1SZ2A 1Q86O 3IMXA 2HVHA 4X62K 4MDBA 2VGNA 5AQFA 5AZJA 4CFDA 3NVKA 4CJLA 2EHGA 3WQTA 4FCYA 1JKHA 1GLLO 4LSNA 1EX4A 3UKRA 4DR7K 5KPRA 1VQON 1N8RO 2CGKA 3NVMA 1ZBUA 2HHSA 3UKRB 3K59A 4NCBA 4DF8A 2ASPA 3AO5A 1C1CA 4W5TA 4FJXA 4KHWA 4CEQA 3IG1A 4KHYA 3ZT2A 1D9FA 3LDPA 3AVJA 2W42A 5LL6Z 1RTIA 1WBBA 5LY3A 4KPYA 1NJXA 1VSEA 3OS2A 4B9MA 2JLEA 2VYPA 3ZT4A 2IVNA 1U04A 3WXLA 1JL2A 2BANA 5C15A 3B8AX 3C6AA 4IJNA 4BC3A 4FJMA 4JS4A 3H46O 5M1PA 1RDUA 3GDQA 1T03A 1IKWA 4CJPA 5I3UA 4CK3A 1U48A 2W40A 5T7BA 3AA4A 1J6ZA 1TK5A 5B8HA 3MEEA 5KGWA 5J1EA 1U6ZA 2XO7A 1KQSM 4B3SK 1Z05A 4ISEA 4BGAA 1NGAA 1RT1A 3AA2A 4YFUA 4M3WA 2ATQA 3U3GA 3CJBA 1TGOA 4A59A 3AO2A 4J2AA 3D6RA 1NJYA 1S1XA 4DQPA 3MCAB 1WAFA 3QFUA 3FE1A 3DLLL 3ID8A 1C0FA 4RWTA 1RT7A 1R59O 3LDQA 5GIOA 1YI2N 3PO5A 4Z4FA 4CF8A 3OBYA 3O4NA 1FW6A 1T6CA 1BCMA 4OJRA 4F3OA 4WQ4A 3RMBA 5JVGL 2EX3A 3VETA 4DTNA 2P51A 1QTMA 2HBKA 4O55A 4DG1A 2P9SA 1OH5A 1RTHA 1GOCA 4DR1K 4OKEA 2Q1NA 2QKBA 3E1YA 1FKPA 3KLHA 2IGIA 1NGJA 3T7ZA 1YHQN 1BQNA 4DUYK 4RG8A 2HMPA 4CJ5A 4LFCK 3WEEA 1HPZA 2IC3A 4IWVA 2QWPA 3CFOA 4CGHA 2FBVA 4KTZA 4AILC 3AO3A 1NMNA 4H0TB 3QFPA 4IZ9A 3R3LA 1S1VA 2E6LA 4J2DA 4IO9L 3C6TA 3O5BA 2I7NA 2RHKA 3ZSQA 4CF0A 2HHTA 4JKAA 3VPZA 2NNWA 3LP2A 4FOIA 2F9TA 2ZD1A 1K8KB 3HPOA 2ZQBA 4N41A 2IOCA 5J2PA 1RBRA 2HBMA 4LF4K 5ELZA 1IBKK 1K8KA 4KKOA 1TUYA 5HRNA 3EKSA 1RGIA 1ZBSA 2YJFA 1VQ9N 4MDAA 2HHVA 4U67L 4GV3A 3NF8A 1H1VA 1NGCA 1NKBA 4WQ5A 2IS3A 1ZBHA 3LP1A 4JK9A 5H1SQ 1RBUA 4Z4EA 4PKIA 2F4VK 3SUPA 4H0YB 1RT2A 2XHBA 4NYNA 3T1AA 3ZT0A 1LWCA 2D5RA 3MN5A 4CZJA 1WNSA 4AM7A 2D1KA 3QB0A 2NLXA 2KFZA 4BRLA 3E66A 1WSIA 2G8VA 1REVA 3L4IA 1QS4A 1L5UA 5EU7A 1QVFM 4EAHD 1K8AO 4OPJA 3K5OA 5TKYA 1GOBA 3IDHA 2NUBA 4BE2A 5AQUA 1VK0A 3SMSA 4CZMA 4WYBA 3CIPA 2QW9A 1KAZA 1KLMA 4BRKA 3OS1A 2YNFA 1HPMA 3LM2A 1NM1A 1NLVA 4KHUA 4HHTA 3TABA 3FZMA 4OVLA 2E1YA 1GLJO 3F9MA 3WXJA 5GAGP 1C0MA 1RDWX 3RSEB 5ADXA 4IO8A 1IH7A 3ENOA 4NO7A 3RSEA 1XHZA 4FLWA 4BG8A 2NRHA 1NGBA 3DXMA 3C7NB 1ASVA 4OPAA 4DTXA 4FJIA 3C0BA 3EE8A 4HUEA 2O8DA 4LF6K 3MWTA 4FWNA 2H3GX 3I33A 1JLAA 3HL8A 4G1QA 4CF1A 3U3YA 3V4IA 5FDLA 1NGIA 1XWLA 4I2QA 3CF5L 4JN4A 2OA8A 4BC2A 3OS0A 3D2EB 1BWFO 3SLCA 3PO4A 5EXWA 4PWDA 4WFBL 1LW2A 1A5WA 2O8FA 3IFRA 2RF2A 4Z4IA 2I7PA 3SMPA 4BR4A 5AJ3K 1DEJA 5EY4A 2CGJA 2ZGZA 4CF9A 1QHAA 1N6QA 5BRDA 3DOLA 4FK4A 1NJZA 3CCVN 3H1VX 3M1FA 1S1UA 4CGDA 4HWIA 3DLKA 3GOIA 4DSKA 3FZKA 2HSTA 4DTMA 4PHTX 2P9PB 4DR6K 3R1XA 3SJHA 4A57A 4ILGB 4ZTFA 3HPGA 1Y97A 2PAVA 3QIPA 3NH2A 3U6FA 2YKNA 5DMRA 3CJ7A 3L4QA 3P1GA 3J7ZO 3WUHA 3VQ6A 5LMUK 4HTLA 3BZKA 2O8CA 1HKGA 4ISGA 2O8BB 4A2BA 1NMDA 1HNXK 3U9DA 4BRGA 1HJRA 3E9OA 3QMLA 4KI4A 4JKEA 1NNEA 5C12A 4CHOA 4JI1K 2XY8A 3MXJA 4M41A 4FPBA 3LL3A 5CY4A 4B3MK 3NF9A 3NBPA 3G0ZA 3R8EA 1SQKA 2A5XA 4BRIA 4LY7A 4CFBA 4IXCA 4MO4A 1TKDA 5IT9O 2DPNA 3LDNA 1HNWK 3V9UA 4JKBA 1IKVA 1E4GT 2RKIA 2Q0RA 1W0HA 3CM6A 3E9LA 3VEYA 4CZLA 3IS9A 3VQCA 4CJ4A 3FLCO 3TAMA 2W6KA 1DGKN 4ZTJA 3RWUA 4N5SA 1SL0A 2QKKA 3D2FB 2GUIA 2NRWA 4PA1A 2UUCK 5E41A 2ZWHA 2FLOA 4BRQA 4FXDA 3ZETA 2QWQA 2F8TA 1QE1A 4KBOA 1YF5L 2KTQA 1B9FA 2GWKA 3AGRA 3AVCA 3OVNA 4FYDA 1HKBA 1L3VA 1RBVA 5M1OA 1MU2A 4DS5A 2EWSA 3WT0A 3L3UA 2OTJN 4AHSA 4CZGA 1VSJA 1IKXA 3RVCA 1VAZA 2WTUA 4BVOA 3PV8A 5AQRA 5BPMA 3VEWA 4WFAL 3WNFA 3AVMA 4IFVA 3B6PA 4BQZA 2QWLA 2IIRA 1NWKA 1QSYA 2BE2A 3RR7A 4H03B 4ELUA 5KQDA 1QQCA 1VQ5N 3LWMA 1WAJA 3N4QA 3LZJA 2HMIA 2GTDA 2XRIA 1OH8A 1OVQA 1I39A 2BDPA 2HHQA 4E89A 2QA4N 1LWEA 4CESA 2RE2A 2YNGA 5GIPA 3U9ZA 5AQIA 4MO5A 3HPHA 1LV5A 4DFPA 4YDUC 4DV3K 4DV4K 5F0XA 4K0KK 4EZ6A 2IDOA 3TTFA 4CIEA 1E3MA 5AQNA 2A6AA 3TI0A 4WF9L 1YIJN 3QBXA 2O8EB 4CJEA 4O5BA 1S6QA 3KK2A 3VGLA 3BEXA 1KFDA 4B1UB 4XEIA 3SV4A 4AHCA 3ZX2A 3VEOA 2QXLA 4CEAA 3QIOA 4KV8A 3KLFA 4JHDB 3KWGA 3QBWA 1RCHA 2P1JA 4Y1CA 5AZJB 4DTOA 1X3NA 4DV5K 3VEXA 1NK8A 1BIZA 3T69A 1NGEA 1QQMA 3WNHA 2IAJA 3I55N 1BHLA 3MWPA 3ZSWA 3P31A 3CMAN 3PX4A 2KZZA 1N36K 4H4OA 2E20A 3CMEN 1XMQK 4WE1A 5TKWA 2BUPA 2DTUA 4JKDA 3L2UA 2F7TA 4RW9A 1JXBA 2YHBA 3AV9A 4DV7K 1TAUA 3K57A 4V19S 2A3ZA 1WSFA 5LJVA 3SQ4A 3RMAA 4YOYA 2W41A 1T3VA 1QVGM 4JLHA 4X65K 4KRFA 4GY2B 3U4LA 1X9SA 1EQYA 3O9RA 3EO3A 1T6DA 3ASMA 1VQ7N 4JKGA 2QK9A 5IWAK 1QZ6A 3ZX0A 4AHUA 3B6OA 3NH0A 3TU5A 5KPZA 4E7JA 3SNNA 2KZMA 2F9WA 4H4MA 2VQFK 1RNHA 4DFKA 3K0SA 4FZYA 1NOZA 2VWBA 3SCXA 3MEDA 1NU0A 1BUPA 1UWBA 2QWOA 2Z1IA 4BRHA 1JLFA 3KKSA 1XC9A 2CGLA 4FJ7A 3RRGA 1WSEA 5AQVA 3L2WA 4CHNA 3LAMA 4BDZA 3LWLA 4A5AA 4IG3A 3L2QA 4PUOA 3Q7CA 4NCAA 1WBDA 2NZTA 3HM8A 2HHXA 2DFEA 4K42A 1IG9A 5EX5A 4E1JA 3A5LC 1W2BM 4IJAA 4DV0K 1S9GA 4GV9A 2VQEK 3VQAA 4CBXA 5KI6A 3CCEN 4XH1A 4NXMK 1BGXT 3MXMA 2V7YA 3CM5A 3LPTA 4YOXA 3BZCA 3LP3A 5E26A 3HSTB 3CETA 1RDBA 3O9QA 2YI1A 4FLTA 2P9SB 1NK5A 1Z25A 3CPEA 1DLOA 2P9IA 4KI6A 1BISA 4E7KA 4CK2A 4E0DA 1MDUB 4YY3K 1C1BA 5AQWA 2JGUA 1HYZA 3KWIA 3TAQA 3KD1E 3KIOA 4OGCA 1VQ6N 4B3TK 5BN9A 3EKUA 2Z1HA 4I6MB 4FZZA 3VF6A 5ADXH 3M8QA 4FJ5A 1RTJA 2AA4A 4W5RA 3O4QA 1S3XA 2E2PA 3VQ9A 4OPKA 4B9LA 3QESA 4BRDA 3QLHA 1N34K 1YJNN 3GE1A 1MWMA 3JSMA 5KPTA 1NK9A 2J4RA 1VQPN 2YNHA 4FWSA 4E19A 4HVJA 4FK2A 1ZBIA 3MCPA 2VG5A 5AQLA 2NRXA 4L8RB 1C0UA 4GMJB 4HCBA 4Z4HA 3OYMA 3DLBA 4CVNE 3EEQA 4CJFA 3O08A 3ZT3A 4H0OA 1NBWA 3NAEA 2Q3SA 4C8MA 5BR9A 3KKRA 1IBLK 4LF8K 4LC9B 3HSCA 4KHNA 4MQ3A 3NE6A 1Q81O 4DLGA 1DKGD 3I0SA 3S3MA 3TTDA 4BR0A 4OPHA 1TAQA 4QAGA 3DLHA 3VEVA 3K9KA 3JYTA 2IVPA 4FLUA 5FROA 4FSVA 3OYHA 4HUFA 2OZMA 1ZXOA 3J8AA 3ZSXA 4CGGA 3SUOA 2GUPA 3KLGA 3DXKA 2QM1A 4F3TA 3PSFA 4N47A 1HNIA 2E5LK 3LZIA 3ZSVA 4M63C 1UOCA 3C6HA 5CZ1A 4F9OA 1J5EK 3ZT1A 3CCRN 4R5PA 4NLCA 3OYLA 4PKGA 4AHTA 2WONA 4CIGA 1RILA 4BROA 3LP0A 1LCUA 3WXIA 4FVMA 1E4FT 4FWKA 4XH5A 1W97L 3DWLA 1KSPA 1Q9YA 3THYA 2YHAA 3VTIA 4IOAL 3PUFA 3UKUB 3OYAA 2QEXN 3OYGA 4JI2K 4H5RA 1J9AA 4M42A 3NH1A 4GVMA 1ZYQA 5HROA 2Z1GA 5AFUH 3VQ7A 3O80A 4I7FA 4BR7A 1Q82O 3L8BA 3QERA 4CCHA 1WB9A 1NKCA 3M6GA 1KVBA 4A62A 4HUGA 3NGIA 2BTFA 3NMUA 4DKWA 3OY9A 4BREA 3TANA 4EFHA 4YHHK 1TVRA 4M45A 2E8AA 2PFUA 4Q5VA 2E2OA 2FF6A 1C1AA 2RPIA 5C25A 2FC0A 2Q31A 1D9DA 1VSLA 2O8FB 2VWJA 4U7BA 1TYQA 1HUXA 3CCQN 3H6EA 5AQHA 4OKKA 2OCEA 1JJ2M 4Z4CA 1O13A 4O44A 3CCJN 2A1RA 1U4BA 1EXQA 4GVEA 3T19A 3HYFA 4YOWA 3NFAA 4IFEA 4KO0A 1TKXA 3CYMA 5HRSA 1EKEA 4RW4A 2QWNA 3SQ0A 1D5AA 3QINA 5D3GA 3VQQA 4BDYA 1VQ8N 3A8YA 3H1QA 1C0GA 2GWJA 2P9LB 1ITGA 2XY7A 1OVYA 3P39A 3H3OB 1WOQA 2P9PA 2HHWA 4DTUA 4MFBA 4CEOA 3ZLJA 5DM7L 5BREA 4Q0BA 4DU1A 2CH5A 5KTQA 1VSKA 5HP1A 1VSIA 3L3VA 1JLBA 3L2VA 4O4GA 3QNNA 4F8RA 3IRXA 2G8IA 1WSHA 3KJVA 3WNGA 1HKCA 2F96A 1DT9A 4DV2K 4LF7K 2CH6A 4IOXA 4DWIA 3VF2A 4LF9K 4B1ZA 1HYSA 1IKYA 3OJUA 5AZIB 4BRFA 4DCHA 1T44A 4IEEA 1EWRA 2VGMA 3ISNC 1VQ4N 4J8FA 1RDCA 3OYIA 4DTSA 3CFPA 1WN7A 3CC4N 2BGGA 3AVAA 4PKHA 4KH5A 1BCOA 2OTLN 2Q0UA 1B92A 1BI4A 3DOKA 4B1WB 4O8UA 3CJCA 5AQGA 5HRRA 3M8SA 3J7AP 3VQBA 3ULEA 4QS7A 1WUAA 3QO9A 5FPNA 2ZJPL 1RT5A 4DV1K 1Z6RA 2YHWA 3MN9A 5C0YA 1J54A 4HTUA 2OPQA 3SBGA 1GLCG 3THYB 2AJQA 1YVNA 2UXCK 3VTHA 2UUAK 1B9DA 4O8KA 3RRHA 3AO1A 1HRHA 3AVLA 3G6EN 4A2AA 3HP9A 4MLHA 4FWMA 1GLEG 1V4TA
chains in the Genus database with same CATH topology
1TL3A 1S6PA 4O5BA 1WSGA 1S6QA 2JLEA 4CECA 3KK2A 3ZSYA 3CFRA 4CEFA 3ZT4A 2HVIA 1U04A 1KFDA 4E7IA 4PY5A 2DY4A 4BE1A 3SV4A 4RW7A 1IO2A 1JL2A 4FW2A 3O3FA 2BANA 1U47A 1VSMA 1EETA 4AHCA 2VG6A 1JXEA 4FJMA 3SJJA 4KREA 4CEAA 3QIOA 4W5OA 4KV8A 4CEZA 4JS4A 3KLFA 3AVIA 1RCHA 2HNZA 2P1JA 4Y1CA 2ZE2A 1BL3A 3KTQA 1W9HA 3VQ4A 4QOZB 4DTOA 1T03A 4C8OA 1UA1A 4E1NA 3KLIA 3K58A 1NK8A 4OGEA 4IBNA 1IKWA 1BIZA 4CJPA 4CFAA 3HM9A 5I3UA 1TK0A 2HB5A 4CK3A 1U48A 4N76A 1C0TA 3WNHA 1RDAA 1YTUA 1HQUA 1NK4A 5T7BA 2IAJA 1BHLA 1Z26A 3AA4A 1A5XA 3ZSWA 4FM2A 3PX4A 2KZZA 4BWMA 1TK5A 2XO7A 3MEEA 5KGWA 4H4OA 5J1EA 3SUNA 1CZ9A 1D8YA 1KVCA 2OPPA 2O4GA 4WE1A 2XY5A 1RT1A 3AA2A 2G8UA 4FM0A 4YFUA 4M3WA 2ATQA 3U3GA 2DTUA 3L2UA 3PX0A 4KB0A 4RW9A 1JXBA 2YHBA 4FJ9A 2D0CA 3AV9A 3WNEA 4ID5A 3LPUA 1TGOA 1C6VA 4FJLA 1HMVA 3AO2A 3K57A 1TAUA 1WSFA 3SQ4A 3RMAA 4J2AA 1NJYA 4B3OA 3AVGA 2XY6A 1S1XA 1RTDA 4DQPA 4FJ8A 4CHQA 1WAFA 1YT3A 5DK5A 5KRSA 4JLHA 1JL1A 1RT7A 4KRFA 4FLVA 1X9SA 1XI1A 3OYKA 3PO5A 4Z4FA 4EP4A 2FBYA 4C8KA 3ASMA 4TSXA 4CF8A 5CYQA 3ZCMA 4IKFA 3O4NA 2QK9A 4JRPA 1RT3A 2D0BA 1S1TA 2I5JA 2X78A 1BCMA 4OJRA 3B6OA 3P5JA 4AHUA 3NH0A 1L3SA 1O1WA 1NOYA 3RMBA 2KFNA 1VRTA 4N56A 4E7JA 2D0AA 3SNNA 2EX3A 4FLYA 2KZMA 4B9TA 4H4MA 4J2EA 4DTNA 2P51A 3LANA 5KGXA 4JRQA 1QTMA 1RNHA 4DFKA 4O55A 2HNDA 4M3RA 4DG1A 3OYDA 4F3OA 1RTHA 4ZHRA 1GOCA 4FZYA 4OKEA 4NCGA 4ICLA 1NOZA 2QKBA 3SCXA 4FJKA 1FKPA 4B9UA 3O3GA 3DLGA 3KLHA 2LSNA 3MEDA 3AO4A 2IGIA 1UWBA 1QSSA 3KD5E 5HRPA 1BQNA 4KHQA 2Z1IA 4B08A 3ZSZA 1JLFA 2E6MA 3KKSA 1TK8A 4RG8A 4F2SA 3K2PA 4CJ5A 4LH4A 1XC9A 3HP6A 1X1PA 1HPZA 2IC3A 3RRGA 1ASWA 4FJ7A 2O4IA 1WSEA 3CFOA 3L2WA 3M8PA 4CGHA 2FBVA 3QEPA 4ELVA 4CHNA 4KTZA 4AHRA 3LAMA 4BDZA 1FK9A 4AILC 2R7YA 3LWLA 1YTAA 3AO3A 4IG3A 3RMCA 5SWMA 3L2QA 4FZXC 4PUOA 3ZSRA 4NCAA 4FLXA 1S1VA 2E6LA 3VQ8A 4CGJA 3NHGA 2DFHA 2HHXA 4J2DA 2DFEA 1IG9A 3C6TA 1NJWA 1RT4A 3C6UA 3ZSQA 4CF0A 2WOMA 3TARA 4JS5A 1QHTA 3OYFA 1DTTA 3TWHA 4DS4A 2HHTA 4KHSA 4DTRA 1KFSA 1S9GA 3EY1A 3LP2A 3ITHA 4DQSA 3PY8A 4B8AB 1T8EA 3F73A 1HNVA 3DLRA 3VQAA 2ZD1A 3V9WA 5KI6A 3C94A 2ZQBA 1JLGA 3HPOA 4DFJA 4N41A 2IOCA 5J2PA 1BGXT 3I8DA 4NYFA 1RBRA 3MXMA 3CM5A 4M3ZA 4LD0A 4K8ZA 3LPTA 4DLEA 3LP3A 3M8RA 3HSTB 4KKOA 4DFMA 1RDBA 5HRNA 4FLTA 1NK5A 4W5QA 1Z25A 3VA0A 1DLOA 4H8KA 3RTVA 3RR8A 4KI6A 2OPSA 5C24A 1BISA 4E7KA 3MEGA 4CJSA 2HHVA 4CK2A 4E0DA 3NF8A 2PZSA 4M3UA 2PY5A 1NKBA 1C1BA 2IS3A 3D0PA 1ZBHA 2GV9A 3LP1A 3QEWA 4FW1A 4DMNA 1RBUA 2JGUA 4Z4EA 1HYZA 3SUPA 3V9XA 2RN2A 3TAQA 1CXUA 1RT2A 3KIOA 3KD1E 2XHBA 4NYNA 3DM2A 3DRRA 4OGCA 3T1AA 3ZT0A 4CJKA 4BACA 4DSEA 2Z1HA 1S5JA 4Z0UA 4FZZA 1LWCA 1Q8IA 3M8QA 4FJ5A 1RTJA 2D5RA 4W5RA 1CXQA 4W5NA 1T05A 3O4QA 3DI6A 1WNSA 4CJQA 3DLEA 4OPKA 3VQ9A 4B9LA 2KFZA 3QESA 1WSIA 3AVBA 3VQPA 4E3SA 1REVA 2G8VA 3QLHA 2QXFA 4DQQA 2P5GA 1QS4A 1LWFA 1L5UA 5EU7A 5FRNA 3IAYA 3JSMA 1NK9A 4OPJA 3K5OA 1X9MA 1G15A 2YNHA 5KRTA 4RW6A 1GOBA 4E19A 4HVJA 1LAWA 4FK2A 5SZTA 2NUBA 4BE2A 1ZBIA 3VQDA 4IDKA 2VG5A 4FM1A 4FJNA 1KTQA 5J2NA 1VK0A 3A2FA 2VWKA 4L8RB 1C0UA 3RMDA 3MXIA 4CHYA 1KLMA 4XIUA 2OPRA 4GMJB 5JS2A 4CJVA 3OS1A 4KTQA 2YNFA 3SV3A 4PQUA 1VSDA 4CFCA 4HCBA 4KHUA 4Z4HA 4HHTA 3TABA 4CIFA 4FJGA 3OYMA 3DLBA 2HW3A 4ID1A 4OVLA 4DSLA 3OYJA 4M3TA 3DRPA 4CJFA 2ITGA 5CZ2A 3ZT3A 3HVRA 4IG0A 3TR8A 1SUQA 3NAEA 2Q3SA 1KVAA 1C0MA 3AVHA 4C8MA 4B8CA 4QCLA 3OYBA 3KKRA 4GW6A 1A5VA 4O0JA 4KHNA 4MQ3A 3NE6A 1IH7A 3SZ2A 3ALYA 4DLGA 3I0SA 2VG7A 1LW0A 4I2PA 3S3MA 1GOAA 1XHZA 4FLWA 3SPYA 1KLNA 4QAGA 1TAQA 3DLHA 4B9VA 1NKEA 1UAXA 3JYTA 4DSIA 3CQ8A 1ZBFA 4DQIA 1CLQA 4FLUA 3HT3A 5FROA 3SI6A 3OYHA 4CK1A 1ASVA 3CG7A 2HHUA 2YV0X 4DTXA 4HUFA 4FJIA 4HUEA 4OKJA 3OYEA 2OZMA 4RW8A 4F2RA 3ZSXA 4CGGA 4O0IA 4FLZA 1JLAA 3SUOA 3HL8A 4G1QA 4CF1A 3KLGA 4K8XA 3U3YA 3V4IA 2G8WA 5FDLA 4J2BA 4B9SA 3HK2A 1XWLA 4F3TA 4CEDA 4N47A 1HNIA 4I2QA 3QEIA 3QETA 1UA0A 3LZIA 3ZSVA 3SQ2A 1U45A 2OA8A 1UOCA 1VRUA 3OS0A 1SKRA 3PO4A 1S1WA 5CZ1A 3K5NA 4DTJA 4PWDA 4DF4A 1LW2A 1QSLA 1A5WA 3ZT1A 4CHPA 1JLCA 2HNYA 2KW4A 4LH5A 4R5PA 2RF2A 4I9LA 4CGIA 3OYLA 2G8HA 4KB1A 2DFFA 3K5LA 4AHTA 2WONA 4Z4IA 4CIGA 1RILA 2G8FA 3AVFA 2P5OA 3LP0A 5JS1A 4FVMA 3EYZA 4BE0A 3TAGA 1TKTA 3NF6A 4CF9A 2OZSA 4DSFA 3NDKA 1Q9YA 2GBZA 1N6QA 1KSPA 1RT6A 3DOLA 2FBTA 2YHAA 4FK4A 1NJZA 1CZBA 1RDDA 3QEVA 1S1UA 3PUFA 3OYAA 4CGDA 3AVKA 2PYJA 3S3OA 1F21A 3OYGA 1R0AA 3VQEA 1J5OA 3OJSA 1DTQA 3DLKA 1XHXA 2Z1JA 1N5YA 1J9AA 4DSKA 1X9WA 1ASUA 4M42A 3V1QA 3NH1A 1SL2A 4GVMA 4DTMA 1ZYQA 4ZTFA 4BWJA 3HPGA 4CEBA 5HROA 1K6YA 2Z1GA 1Y97A 2B6AA 3VQ7A 3T3FA 1BI4B 1SKWA 4I7FA 3QIPA 3MAQA 3L8BA 1SL1A 3NH2A 4LSLA 5J2MA 3U6FA 3QERA 2G8KA 4C8NA 4CCHA 1NKCA 1J53A 2YKNA 1KVBA 3LALA 5DMRA 4CJUA 4CJRA 3SYZA 3P1GA 4HUGA 4M3XA 3NGIA 3NGZA 3THVA 3VQ6A 4DSJA 1VSHA 1TV6A 3V1OA 3VA3A 4EZ9A 3OY9A 3TANA 4I9QA 1WSJA 1TVRA 4B9NA 4M45A 4IFYA 1RBTA 1TKZA 4HCCA 5FRMA 1HJRA 4Q5VA 3L2RA 4KI4A 3TAFA 4CEEA 1C1AA 1JLEA 2RPIA 2FC0A 5C25A 3KK3A 3PX6A 3S3NA 1D9DA 1VSLA 4CHOA 1NK7A 4F4KA 2ETJA 2VWJA 1VSFA 2F8SA 1EP4A 3V9ZA 4CJ3A 2XY8A 3C95A 3ULDA 3MXJA 1ZBLA 3AVNA 4M41A 3HXMA 2Y1JA 5J2QA 5I42A 3HJFA 5CY4A 3LAKA 5HBMA 4OKKA 3NF9A 2KQ2A 2YNIA 3G0ZA 3NBPA 1L3TA 4Z4CA 4M3YA 4O44A 2A1RA 1U4BA 4LY7A 1EXQA 4CFBA 3T19A 3HYFA 3NFAA 4KO0A 1TKDA 1TKXA 4EP5A 3FFIA 4E7HA 3CYMA 2X6SA 5HRSA 1EKEA 4RW4A 3LDSA 3V9UA 3BDPA 4YNQA 3SQ0A 3V81A 2A1SA 1IKVA 5C42A 2RKIA 1D5AA 1W0HA 3CM6A 3QINA 5D3GA 3VQQA 1SV5A 4BDYA 3TAEA 4ELTA 3IS9A 4BDPA 3ZSOA 3VQCA 3H08A 3P83D 4CJ4A 1NK6A 3AA5X 1NK0A 1ITGA 3TAMA 2XY7A 3SPZA 3E01A 4CGFA 1LAVA 4DU4A 3RWUA 4ZTJA 1T7PA 4N5SA 3EZ5A 2HHWA 4DTUA 4MFBA 4CEOA 1SL0A 4AH9A 2QKKA 3AA3A 1SKSA 4B9MA 1BQMA 1HQEA 4UQGA 1KCFA 4Q0BA 2GUIA 4PA1A 4DU1A 1BIUA 5KTQA 1VSKA 1KRPA 5E41A 2OYQA 3MECA 5HP1A 1Q9XA 1VSIA 4FK0A 3L3VA 3HVTA 1JLBA 4CERA 3DYAA 3L2VA 4O4GA 2YKMA 3QNNA 4F8RA 3IRXA 1WLJA 2G8IA 4FXDA 1WSHA 4CJTA 4C8LA 3KJVA 1YVUA 3WNGA 2F8TA 1QE1A 4DTPA 2F96A 4E1MA 3SUQA 2X6NA 3NGYA 3HO1A 2KTQA 2E4LA 1B9FA 1S9EA 3AVCA 4CE9A 3OVNA 1FXXA 2B4JA 4DWIA 1TL1A 4KFBA 4KAZA 4FYDA 5K14A 4CHZA 1RBVA 4CF2A 1MU2A 2X74A 3NCIA 4DS5A 1L3VA 3KK1A 1IKYA 2PYLA 1HYSA 3OJUA 3TAPA 3V9SA 3O3HA 3L3UA 3DMJA 3F9KA 4AHSA 1VSJA 1IKXA 2FBXA 3QNOA 3PV8A 3DRSA 3BGRA 3SQ1A 4OLBA 4DQRA 4CJWA 3ISNC 1I3AA 4Z4GA 4FJHA 4E7LA 3KLEA 5HLFA 3OYIA 1RDCA 4DTSA 3WNFA 3CFPA 5CYMA 3AVMA 1WN7A 4IFVA 3OYCA 3G10A 4KTWA 3B6PA 3QEXA 3I0RA 2Y1IA 2BGGA 2HVHA 3AVAA 1QSYA 4CFDA 2BE2A 4AHVA 3RR7A 4ELUA 1QQCA 4CJLA 3K5MA 2EHGA 1BCOA 3NF7A 3LWMA 1JKHA 4FCYA 1WAJA 3LZJA 4LSNA 1EX4A 3S9HA 2HMIA 1B92A 1BI4A 2XRIA 3DOKA 4FJJA 2BDPA 1I39A 1ZBUA 2HHSA 2HHQA 5HRRA 4Y1DA 3K59A 4E89A 3UIQA 3M8SA 4NCBA 3V1RA 4DF8A 3VQBA 3AO5A 1U49A 1LWEA 4CESA 2YNGA 1C1CA 4W5TA 3QO9A 1JLQA 4FJXA 4KHWA 4CEQA 1RT5A 3IG1A 4KHYA 1L3UA 3HPHA 3ZT2A 4DU3A 1D9FA 1LV5A 4DFPA 3V6DA 1RBSA 1HYVA 3AVJA 3OYNA 1J54A 4HTUA 2OPQA 4EZ6A 2W42A 2AJQA 3VQ5A 4OLAA 1B9DA 3D45A 3RRHA 2IDOA 4CIEA 3AO1A 1HRHA 1RTIA 3AVLA 4KPYA 1NJXA 3VN5A 3HP9A 3TI0A 1FKOA 1VSEA 3OS2A 4CJEA 2B5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL3 A;  1S6P A;  4O5B A;  1WSG A;  1S6Q A;  2JLE A;  4CEC A;  3KK2 A;  3ZSY A;  3CFR A;  4CEF A;  3ZT4 A;  2HVI A;  1U04 A;  1KFD A;  4E7I A;  4PY5 A;  2DY4 A;  4BE1 A;  3SV4 A;  4RW7 A;  1IO2 A;  1JL2 A;  4FW2 A;  3O3F A;  2BAN A;  1U47 A;  1VSM A;  1EET A;  4AHC A;  2VG6 A;  1JXE A;  4FJM A;  3SJJ A;  4KRE A;  4CEA A;  3QIO A;  4W5O A;  4KV8 A;  4CEZ A;  4JS4 A;  3KLF A;  3AVI A;  1RCH A;  2HNZ A;  2P1J A;  4Y1C A;  2ZE2 A;  1BL3 A;  3KTQ A;  1W9H A;  3VQ4 A;  4QOZ B;  4DTO A;  1T03 A;  4C8O A;  1UA1 A;  4E1N A;  3KLI A;  3K58 A;  1NK8 A;  4OGE A;  4IBN A;  1IKW A;  1BIZ A;  4CJP A;  4CFA A;  3HM9 A;  5I3U A;  1TK0 A;  2HB5 A;  4CK3 A;  1U48 A;  4N76 A;  1C0T A;  3WNH A;  1RDA A;  1YTU A;  1HQU A;  1NK4 A;  5T7B A;  2IAJ A;  1BHL A;  1Z26 A;  3AA4 A;  1A5X A;  3ZSW A;  4FM2 A;  3PX4 A;  2KZZ A;  4BWM A;  1TK5 A;  2XO7 A;  3MEE A;  5KGW A;  4H4O A;  5J1E A;  3SUN A;  1CZ9 A;  1D8Y A;  1KVC A;  2OPP A;  2O4G A;  4WE1 A;  2XY5 A;  1RT1 A;  3AA2 A;  2G8U A;  4FM0 A;  4YFU A;  4M3W A;  2ATQ A;  3U3G A;  2DTU A;  3L2U A;  3PX0 A;  4KB0 A;  4RW9 A;  1JXB A;  2YHB A;  4FJ9 A;  2D0C A;  3AV9 A;  3WNE A;  4ID5 A;  3LPU A;  1TGO A;  1C6V A;  4FJL A;  1HMV A;  3AO2 A;  3K57 A;  1TAU A;  1WSF A;  3SQ4 A;  3RMA A;  4J2A A;  1NJY A;  4B3O A;  3AVG A;  2XY6 A;  1S1X A;  1RTD A;  4DQP A;  4FJ8 A;  4CHQ A;  1WAF A;  1YT3 A;  5DK5 A;  5KRS A;  4JLH A;  1JL1 A;  1RT7 A;  4KRF A;  4FLV A;  1X9S A;  1XI1 A;  3OYK A;  3PO5 A;  4Z4F A;  4EP4 A;  2FBY A;  4C8K A;  3ASM A;  4TSX A;  4CF8 A;  5CYQ A;  3ZCM A;  4IKF A;  3O4N A;  2QK9 A;  4JRP A;  1RT3 A;  2D0B A;  1S1T A;  2I5J A;  2X78 A;  1BCM A;  4OJR A;  3B6O A;  3P5J A;  4AHU A;  3NH0 A;  1L3S A;  1O1W A;  1NOY A;  3RMB A;  2KFN A;  1VRT A;  4N56 A;  4E7J A;  2D0A A;  3SNN A;  2EX3 A;  4FLY A;  2KZM A;  4B9T A;  4H4M A;  4J2E A;  4DTN A;  2P51 A;  3LAN A;  5KGX A;  4JRQ A;  1QTM A;  1RNH A;  4DFK A;  4O55 A;  2HND A;  4M3R A;  4DG1 A;  3OYD A;  4F3O A;  1RTH A;  4ZHR A;  1GOC A;  4FZY A;  4OKE A;  4NCG A;  4ICL A;  1NOZ A;  2QKB A;  3SCX A;  4FJK A;  1FKP A;  4B9U A;  3O3G A;  3DLG A;  3KLH A;  2LSN A;  3MED A;  3AO4 A;  2IGI A;  1UWB A;  1QSS A;  3KD5 E;  5HRP A;  1BQN A;  4KHQ A;  2Z1I A;  4B08 A;  3ZSZ A;  1JLF A;  2E6M A;  3KKS A;  1TK8 A;  4RG8 A;  4F2S A;  3K2P A;  4CJ5 A;  4LH4 A;  1XC9 A;  3HP6 A;  1X1P A;  1HPZ A;  2IC3 A;  3RRG A;  1ASW A;  4FJ7 A;  2O4I A;  1WSE A;  3CFO A;  3L2W A;  3M8P A;  4CGH A;  2FBV A;  3QEP A;  4ELV A;  4CHN A;  4KTZ A;  4AHR A;  3LAM A;  4BDZ A;  1FK9 A;  4AIL C;  2R7Y A;  3LWL A;  1YTA A;  3AO3 A;  4IG3 A;  3RMC A;  5SWM A;  3L2Q A;  4FZX C;  4PUO A;  3ZSR A;  4NCA A;  4FLX A;  1S1V A;  2E6L A;  3VQ8 A;  4CGJ A;  3NHG A;  2DFH A;  2HHX A;  4J2D A;  2DFE A;  1IG9 A;  3C6T A;  1NJW A;  1RT4 A;  3C6U A;  3ZSQ A;  4CF0 A;  2WOM A;  3TAR A;  4JS5 A;  1QHT A;  3OYF A;  1DTT A;  3TWH A;  4DS4 A;  2HHT A;  4KHS A;  4DTR A;  1KFS A;  1S9G A;  3EY1 A;  3LP2 A;  3ITH A;  4DQS A;  3PY8 A;  4B8A B;  1T8E A;  3F73 A;  1HNV A;  3DLR A;  3VQA A;  2ZD1 A;  3V9W A;  5KI6 A;  3C94 A;  2ZQB A;  1JLG A;  3HPO A;  4DFJ A;  4N41 A;  2IOC A;  5J2P A;  1BGX T;  3I8D A;  4NYF A;  1RBR A;  3MXM A;  3CM5 A;  4M3Z A;  4LD0 A;  4K8Z A;  3LPT A;  4DLE A;  3LP3 A;  3M8R A;  3HST B;  4KKO A;  4DFM A;  1RDB A;  5HRN A;  4FLT A;  1NK5 A;  4W5Q A;  1Z25 A;  3VA0 A;  1DLO A;  4H8K A;  3RTV A;  3RR8 A;  4KI6 A;  2OPS A;  5C24 A;  1BIS A;  4E7K A;  3MEG A;  4CJS A;  2HHV A;  4CK2 A;  4E0D A;  3NF8 A;  2PZS A;  4M3U A;  2PY5 A;  1NKB A;  1C1B A;  2IS3 A;  3D0P A;  1ZBH A;  2GV9 A;  3LP1 A;  3QEW A;  4FW1 A;  4DMN A;  1RBU A;  2JGU A;  4Z4E A;  1HYZ A;  3SUP A;  3V9X A;  2RN2 A;  3TAQ A;  1CXU A;  1RT2 A;  3KIO A;  3KD1 E;  2XHB A;  4NYN A;  3DM2 A;  3DRR A;  4OGC A;  3T1A A;  3ZT0 A;  4CJK A;  4BAC A;  4DSE A;  2Z1H A;  1S5J A;  4Z0U A;  4FZZ A;  1LWC A;  1Q8I A;  3M8Q A;  4FJ5 A;  1RTJ A;  2D5R A;  4W5R A;  1CXQ A;  4W5N A;  1T05 A;  3O4Q A;  3DI6 A;  1WNS A;  4CJQ A;  3DLE A;  4OPK A;  3VQ9 A;  4B9L A;  2KFZ A;  3QES A;  1WSI A;  3AVB A;  3VQP A;  4E3S A;  1REV A;  2G8V A;  3QLH A;  2QXF A;  4DQQ A;  2P5G A;  1QS4 A;  1LWF A;  1L5U A;  5EU7 A;  5FRN A;  3IAY A;  3JSM A;  1NK9 A;  4OPJ A;  3K5O A;  1X9M A;  1G15 A;  2YNH A;  5KRT A;  4RW6 A;  1GOB A;  4E19 A;  4HVJ A;  1LAW A;  4FK2 A;  5SZT A;  2NUB A;  4BE2 A;  1ZBI A;  3VQD A;  4IDK A;  2VG5 A;  4FM1 A;  4FJN A;  1KTQ A;  5J2N A;  1VK0 A;  3A2F A;  2VWK A;  4L8R B;  1C0U A;  3RMD A;  3MXI A;  4CHY A;  1KLM A;  4XIU A;  2OPR A;  4GMJ B;  5JS2 A;  4CJV A;  3OS1 A;  4KTQ A;  2YNF A;  3SV3 A;  4PQU A;  1VSD A;  4CFC A;  4HCB A;  4KHU A;  4Z4H A;  4HHT A;  3TAB A;  4CIF A;  4FJG A;  3OYM A;  3DLB A;  2HW3 A;  4ID1 A;  4OVL A;  4DSL A;  3OYJ A;  4M3T A;  3DRP A;  4CJF A;  2ITG A;  5CZ2 A;  3ZT3 A;  3HVR A;  4IG0 A;  3TR8 A;  1SUQ A;  3NAE A;  2Q3S A;  1KVA A;  1C0M A;  3AVH A;  4C8M A;  4B8C A;  4QCL A;  3OYB A;  3KKR A;  4GW6 A;  1A5V A;  4O0J A;  4KHN A;  4MQ3 A;  3NE6 A;  1IH7 A;  3SZ2 A;  3ALY A;  4DLG A;  3I0S A;  2VG7 A;  1LW0 A;  4I2P A;  3S3M A;  1GOA A;  1XHZ A;  4FLW A;  3SPY A;  1KLN A;  4QAG A;  1TAQ A;  3DLH A;  4B9V A;  1NKE A;  1UAX A;  3JYT A;  4DSI A;  3CQ8 A;  1ZBF A;  4DQI A;  1CLQ A;  4FLU A;  3HT3 A;  5FRO A;  3SI6 A;  3OYH A;  4CK1 A;  1ASV A;  3CG7 A;  2HHU A;  2YV0 X;  4DTX A;  4HUF A;  4FJI A;  4HUE A;  4OKJ A;  3OYE A;  2OZM A;  4RW8 A;  4F2R A;  3ZSX A;  4CGG A;  4O0I A;  4FLZ A;  1JLA A;  3SUO A;  3HL8 A;  4G1Q A;  4CF1 A;  3KLG A;  4K8X A;  3U3Y A;  3V4I A;  2G8W A;  5FDL A;  4J2B A;  4B9S A;  3HK2 A;  1XWL A;  4F3T A;  4CED A;  4N47 A;  1HNI A;  4I2Q A;  3QEI A;  3QET A;  1UA0 A;  3LZI A;  3ZSV A;  3SQ2 A;  1U45 A;  2OA8 A;  1UOC A;  1VRU A;  3OS0 A;  1SKR A;  3PO4 A;  1S1W A;  5CZ1 A;  3K5N A;  4DTJ A;  4PWD A;  4DF4 A;  1LW2 A;  1QSL A;  1A5W A;  3ZT1 A;  4CHP A;  1JLC A;  2HNY A;  2KW4 A;  4LH5 A;  4R5P A;  2RF2 A;  4I9L A;  4CGI A;  3OYL A;  2G8H A;  4KB1 A;  2DFF A;  3K5L A;  4AHT A;  2WON A;  4Z4I A;  4CIG A;  1RIL A;  2G8F A;  3AVF A;  2P5O A;  3LP0 A;  5JS1 A;  4FVM A;  3EYZ A;  4BE0 A;  3TAG A;  1TKT A;  3NF6 A;  4CF9 A;  2OZS A;  4DSF A;  3NDK A;  1Q9Y A;  2GBZ A;  1N6Q A;  1KSP A;  1RT6 A;  3DOL A;  2FBT A;  2YHA A;  4FK4 A;  1NJZ A;  1CZB A;  1RDD A;  3QEV A;  1S1U A;  3PUF A;  3OYA A;  4CGD A;  3AVK A;  2PYJ A;  3S3O A;  1F21 A;  3OYG A;  1R0A A;  3VQE A;  1J5O A;  3OJS A;  1DTQ A;  3DLK A;  1XHX A;  2Z1J A;  1N5Y A;  1J9A A;  4DSK A;  1X9W A;  1ASU A;  4M42 A;  3V1Q A;  3NH1 A;  1SL2 A;  4GVM A;  4DTM A;  1ZYQ A;  4ZTF A;  4BWJ A;  3HPG A;  4CEB A;  5HRO A;  1K6Y A;  2Z1G A;  1Y97 A;  2B6A A;  3VQ7 A;  3T3F A;  1BI4 B;  1SKW A;  4I7F A;  3QIP A;  3MAQ A;  3L8B A;  1SL1 A;  3NH2 A;  4LSL A;  5J2M A;  3U6F A;  3QER A;  2G8K A;  4C8N A;  4CCH A;  1NKC A;  1J53 A;  2YKN A;  1KVB A;  3LAL A;  5DMR A;  4CJU A;  4CJR A;  3SYZ A;  3P1G A;  4HUG A;  4M3X A;  3NGI A;  3NGZ A;  3THV A;  3VQ6 A;  4DSJ A;  1VSH A;  1TV6 A;  3V1O A;  3VA3 A;  4EZ9 A;  3OY9 A;  3TAN A;  4I9Q A;  1WSJ A;  1TVR A;  4B9N A;  4M45 A;  4IFY A;  1RBT A;  1TKZ A;  4HCC A;  5FRM A;  1HJR A;  4Q5V A;  3L2R A;  4KI4 A;  3TAF A;  4CEE A;  1C1A A;  1JLE A;  2RPI A;  2FC0 A;  5C25 A;  3KK3 A;  3PX6 A;  3S3N A;  1D9D A;  1VSL A;  4CHO A;  1NK7 A;  4F4K A;  2ETJ A;  2VWJ A;  1VSF A;  2F8S A;  1EP4 A;  3V9Z A;  4CJ3 A;  2XY8 A;  3C95 A;  3ULD A;  3MXJ A;  1ZBL A;  3AVN A;  4M41 A;  3HXM A;  2Y1J A;  5J2Q A;  5I42 A;  3HJF A;  5CY4 A;  3LAK A;  5HBM A;  4OKK A;  3NF9 A;  2KQ2 A;  2YNI A;  3G0Z A;  3NBP A;  1L3T A;  4Z4C A;  4M3Y A;  4O44 A;  2A1R A;  1U4B A;  4LY7 A;  1EXQ A;  4CFB A;  3T19 A;  3HYF A;  3NFA A;  4KO0 A;  1TKD A;  1TKX A;  4EP5 A;  3FFI A;  4E7H A;  3CYM A;  2X6S A;  5HRS A;  1EKE A;  4RW4 A;  3LDS A;  3V9U A;  3BDP A;  4YNQ A;  3SQ0 A;  3V81 A;  2A1S A;  1IKV A;  5C42 A;  2RKI A;  1D5A A;  1W0H A;  3CM6 A;  3QIN A;  5D3G A;  3VQQ A;  1SV5 A;  4BDY A;  3TAE A;  4ELT A;  3IS9 A;  4BDP A;  3ZSO A;  3VQC A;  3H08 A;  3P83 D;  4CJ4 A;  1NK6 A;  3AA5 X;  1NK0 A;  1ITG A;  3TAM A;  2XY7 A;  3SPZ A;  3E01 A;  4CGF A;  1LAV A;  4DU4 A;  3RWU A;  4ZTJ A;  1T7P A;  4N5S A;  3EZ5 A;  2HHW A;  4DTU A;  4MFB A;  4CEO A;  1SL0 A;  4AH9 A;  2QKK A;  3AA3 A;  1SKS A;  4B9M A;  1BQM A;  1HQE A;  4UQG A;  1KCF A;  4Q0B A;  2GUI A;  4PA1 A;  4DU1 A;  1BIU A;  5KTQ A;  1VSK A;  1KRP A;  5E41 A;  2OYQ A;  3MEC A;  5HP1 A;  1Q9X A;  1VSI A;  4FK0 A;  3L3V A;  3HVT A;  1JLB A;  4CER A;  3DYA A;  3L2V A;  4O4G A;  2YKM A;  3QNN A;  4F8R A;  3IRX A;  1WLJ A;  2G8I A;  4FXD A;  1WSH A;  4CJT A;  4C8L A;  3KJV A;  1YVU A;  3WNG A;  2F8T A;  1QE1 A;  4DTP A;  2F96 A;  4E1M A;  3SUQ A;  2X6N A;  3NGY A;  3HO1 A;  2KTQ A;  2E4L A;  1B9F A;  1S9E A;  3AVC A;  4CE9 A;  3OVN A;  1FXX A;  2B4J A;  4DWI A;  1TL1 A;  4KFB A;  4KAZ A;  4FYD A;  5K14 A;  4CHZ A;  1RBV A;  4CF2 A;  1MU2 A;  2X74 A;  3NCI A;  4DS5 A;  1L3V A;  3KK1 A;  1IKY A;  2PYL A;  1HYS A;  3OJU A;  3TAP A;  3V9S A;  3O3H A;  3L3U A;  3DMJ A;  3F9K A;  4AHS A;  1VSJ A;  1IKX A;  2FBX A;  3QNO A;  3PV8 A;  3DRS A;  3BGR A;  3SQ1 A;  4OLB A;  4DQR A;  4CJW A;  3ISN C;  1I3A A;  4Z4G A;  4FJH A;  4E7L A;  3KLE A;  5HLF A;  3OYI A;  1RDC A;  4DTS A;  3WNF A;  3CFP A;  5CYM A;  3AVM A;  1WN7 A;  4IFV A;  3OYC A;  3G10 A;  4KTW A;  3B6P A;  3QEX A;  3I0R A;  2Y1I A;  2BGG A;  2HVH A;  3AVA A;  1QSY A;  4CFD A;  2BE2 A;  4AHV A;  3RR7 A;  4ELU A;  1QQC A;  4CJL A;  3K5M A;  2EHG A;  1BCO A;  3NF7 A;  3LWM A;  1JKH A;  4FCY A;  1WAJ A;  3LZJ A;  4LSN A;  1EX4 A;  3S9H A;  2HMI A;  1B92 A;  1BI4 A;  2XRI A;  3DOK A;  4FJJ A;  2BDP A;  1I39 A;  1ZBU A;  2HHS A;  2HHQ A;  5HRR A;  4Y1D A;  3K59 A;  4E89 A;  3UIQ A;  3M8S A;  4NCB A;  3V1R A;  4DF8 A;  3VQB A;  3AO5 A;  1U49 A;  1LWE A;  4CES A;  2YNG A;  1C1C A;  4W5T A;  3QO9 A;  1JLQ A;  4FJX A;  4KHW A;  4CEQ A;  1RT5 A;  3IG1 A;  4KHY A;  1L3U A;  3HPH A;  3ZT2 A;  4DU3 A;  1D9F A;  1LV5 A;  4DFP A;  3V6D A;  1RBS A;  1HYV A;  3AVJ A;  3OYN A;  1J54 A;  4HTU A;  2OPQ A;  4EZ6 A;  2W42 A;  2AJQ A;  3VQ5 A;  4OLA A;  1B9D A;  3D45 A;  3RRH A;  2IDO A;  4CIE A;  3AO1 A;  1HRH A;  1RTI A;  3AVL A;  4KPY A;  1NJX A;  3VN5 A;  3HP9 A;  3TI0 A;  1FKO A;  1VSE A;  3OS2 A;  4CJE A;  2B5J A; 
#chains in the Genus database with same CATH topology
 1S6P A;  2ZJR L;  4CEC A;  4FWO A;  4CEF A;  1MWK A;  2HVI A;  4E7I A;  4PY5 A;  2DY4 A;  4BE1 A;  1IO2 A;  4FW2 A;  1U47 A;  3O3F A;  5AFU A;  1VSM A;  5LMN K;  1JXE A;  1ILY A;  2P9K B;  4W5O A;  4JI0 K;  4OO1 J;  3BUZ B;  3HOS A;  4CBW A;  1HLU A;  2ZE2 A;  5F2R A;  3KTQ A;  3VQ4 A;  4QOZ B;  5GAD P;  4E1N A;  3KLI A;  4M7X A;  4OGE A;  3HM9 A;  3FZF A;  4CFA A;  4N76 A;  3N4P A;  2HB5 A;  1C0T A;  1RDA A;  2O8D B;  1NK4 A;  5AQQ A;  4FM2 A;  1Z26 A;  5JVH L;  4BWM A;  1D8Y A;  2OPP A;  2O4G A;  2XY5 A;  4M7Y A;  1K9M O;  4FM0 A;  4BR5 A;  1Y64 A;  4JKH A;  1TYQ B;  3D2E A;  4YOU A;  4KB0 A;  1JCE A;  4FJ9 A;  2D0C A;  5BRH A;  4ID5 A;  3EE9 A;  1C6V A;  4FJL A;  1HMV A;  4DB3 A;  3O9S A;  4B3O A;  2XY6 A;  1RTD A;  2KKZ A;  4CHQ A;  4QS8 A;  5KRS A;  4GV6 A;  1JL1 A;  1SS6 A;  1JCF A;  3TTC A;  4EP4 A;  4TSX A;  5CYQ A;  3ZCM A;  4JI4 K;  4JRP A;  4FL9 A;  4ILH A;  2D0B A;  4OLA A;  2QTD A;  3OTO K;  3P5J A;  4BC4 A;  1L3S A;  2KFN A;  4C1N I;  4BVP A;  3LDO A;  4N56 A;  3CCM N;  2D0A A;  4B9T A;  3CCU N;  4J2E A;  1VQN N;  4M3R A;  2HND A;  3OYD A;  2NRZ A;  1XMO K;  4ICL A;  4FJK A;  3MMV A;  4B9U A;  3O3G A;  5F1X A;  1QSS A;  4KHQ A;  4B08 A;  3ZSZ A;  2E6M A;  5BN8 A;  1TK8 A;  5C2D A;  3K2P A;  3J7Y P;  1ASW A;  2GX9 A;  3QEP A;  3VEN A;  4AHR A;  4H5V A;  3AY9 A;  3R6M A;  1U2V A;  4FWP A;  4JEP A;  3VGM A;  4BY9 C;  4EHT A;  4FLX A;  5AQS A;  3VQ8 A;  3NHG A;  1HNZ K;  1NJW A;  4ISF A;  3GBT A;  3C6U A;  3TAR A;  3L6Q A;  3OYF A;  4DS4 A;  3EY1 A;  3ITH A;  4O5F A;  4B8A B;  1T8E A;  4JI6 K;  1JLG A;  4DFJ A;  2E1Z A;  4IEI A;  2V7Z A;  4M3Z A;  4K8Z A;  4DLE A;  5AQY A;  3TSU A;  2NRV A;  2V51 B;  2IVO A;  3VA0 A;  3RR8 A;  3OBW A;  3FZL A;  4X64 K;  2OPS A;  3A0I X;  1OH6 A;  3MEG A;  2ASO A;  4CJS A;  1HR0 K;  2BH1 A;  2PY5 A;  5JLH A;  3D0P A;  2GV9 A;  3QEW A;  1Q7Y O;  4AF1 A;  2RN2 A;  1CXU A;  3CXC M;  4BAC A;  1K73 O;  4DSE A;  1S5J A;  3HI0 A;  4CD1 A;  4W5N A;  3E9P A;  3DAW A;  3DI6 A;  4CJQ A;  2P9N A;  3DLE A;  4WQ5 C;  3AVB A;  5BPN A;  1XUP O;  4DQQ A;  2P5G A;  3I56 N;  3IAY A;  1X9M A;  1G15 A;  5KRT A;  5HOO A;  4LFB K;  1TUU A;  3TSQ A;  3QIC A;  2P9K A;  1HJO A;  3BF3 A;  2VWK A;  1OH7 A;  5JMV A;  3RMD A;  2YCH A;  4CHY A;  4XIU A;  2OPR A;  5JS2 A;  4CJV A;  3SV3 A;  1VSD A;  2GEM A;  4FJG A;  2HW3 A;  3AGK A;  4ID1 A;  1KD1 O;  4DSL A;  5I9E B;  3OYJ A;  3O1W A;  4L3Q A;  3DRP A;  4H5W A;  2ITG A;  5CZ2 A;  5AQO A;  3TR8 A;  4DUZ K;  2WUS A;  5FPD A;  5EOY A;  1N33 K;  4H0P A;  3FFK B;  4B8C A;  3AVH A;  2V52 B;  4K43 A;  4WQ4 C;  2UXD K;  5M1F A;  2QWM A;  2WC9 A;  1ATS A;  5DM6 L;  3SZ2 A;  3ALY A;  2VG7 A;  1LW0 A;  3CJ9 A;  3CQX A;  3VGK A;  4GKK K;  4CZF A;  1NG9 A;  3SAF A;  4DQI A;  4H0X B;  1CLQ A;  4CK1 A;  2HHU A;  2YV0 X;  4OKJ A;  3PSI A;  4F2R A;  5KQ8 A;  4FLZ A;  1XQS C;  3BF1 A;  3G25 A;  5AQJ A;  2G8W A;  4B9S A;  5BPL A;  3M3Z A;  4XH4 A;  3QET A;  4C23 A;  3SQ2 A;  5AQZ A;  3CQY A;  1S1W A;  4DTJ A;  3SAG A;  1EWQ A;  1QSL A;  4PL8 A;  3LM9 A;  1JLC A;  2KW4 A;  3DJC A;  3MN7 A;  5BR8 K;  4I9L A;  4KB1 A;  4CGI A;  5M1K A;  3VF4 A;  2HF4 A;  2FSN A;  3AVF A;  3EYZ A;  4BE0 A;  4H5N A;  3TAG A;  1YXQ A;  3WQU A;  2OZS A;  4DSF A;  3NDK A;  4BRN A;  4FVU A;  1GLA G;  1RDD A;  4FWL A;  1ATN A;  3CER A;  4B1V A;  2PYJ A;  1R0A A;  3VQE A;  1J5O A;  1DTQ A;  3CC7 N;  2Z1J A;  1N5Y A;  1X9W A;  4DR2 K;  1ASU A;  4FO0 A;  1SL2 A;  4QS9 A;  5MLC Q;  2WFB A;  3THW B;  4CEB A;  4K25 A;  1SKW A;  2QWR A;  3EZW A;  5J2M A;  2G8K A;  4C8N A;  3SK3 A;  4CJR A;  1I94 K;  4JD2 A;  4YDU A;  3THV A;  3P4I A;  1QQN A;  4BRP A;  1TV6 A;  3V1O A;  3VA3 A;  4GKJ K;  1WSJ A;  4B9N A;  4IFY A;  1TKZ A;  5FRM A;  5FLX O;  3L2R A;  4JYA K;  3TAF A;  2HF3 A;  3PX6 A;  3D7E O;  4IOC L;  2F8S A;  1EP4 A;  1QZ5 A;  3UB5 A;  4CJ3 A;  4KHP K;  4H5T A;  2YJE A;  4FWR A;  1VHX A;  3HXM A;  2Y1J A;  5J2Q A;  5I42 A;  3LAK A;  5HBM A;  4JKC A;  1BOT O;  2KQ2 A;  2YNI A;  1L3T A;  3CPW M;  4M3Y A;  4BR2 A;  4DQ8 A;  4AQY K;  2P9U A;  4EP5 A;  3FFI A;  3J80 O;  4G9Z A;  3ZET B;  3VOV A;  1IV0 A;  1NJI O;  4YNQ A;  5C42 A;  1EO1 A;  3U8X A;  3TAE A;  4C1N K;  5M1Q A;  1VQK N;  4JNE A;  3ENB A;  1M1K O;  1BU6 O;  2FXU A;  3ZSO A;  3CCL N;  3H08 A;  3P83 D;  3VMF B;  1NK0 A;  3E01 A;  4CGF A;  5AR0 A;  4DU4 A;  1BA1 A;  1T7P A;  3EZ5 A;  4AH9 A;  1BQM A;  1HQE A;  2HHH K;  1BIU A;  2ITM A;  3C7N A;  3HZ6 A;  1KRP A;  2OYQ A;  3MEC A;  3THX A;  4FK0 A;  4B1Y B;  3HVT A;  4CER A;  1V4S A;  2YKM A;  1MA9 B;  1NGF A;  1WLJ A;  4CJT A;  1CZA N;  4C8L A;  1JCG A;  1YVU A;  4DTP A;  3HO1 A;  2X6N A;  3NGY A;  4Y0W A;  2E4L A;  4K41 A;  1S9E A;  5BRF A;  1FXX A;  1NGG A;  4CHZ A;  4CF2 A;  2X74 A;  2PYL A;  3KK1 A;  2ZM6 K;  3V9S A;  3TAP A;  2FBX A;  2HBJ A;  3UE5 A;  4UY8 O;  3MN6 A;  3DRS A;  3SQ1 A;  1I3A A;  4FJH A;  4E7L A;  3KLE A;  3A5M C;  1S22 A;  4B3R K;  5CYM A;  3OYC A;  3PLA A;  4CZH A;  2Q97 A;  3AAQ A;  4AHV A;  4BQL A;  3K5M A;  3NF7 A;  4BGB A;  3S9H A;  5FPM A;  4A5B A;  4FJJ A;  5E84 A;  2Q36 A;  3GL1 A;  1VQL N;  4Y1D A;  2UYT A;  3UIQ A;  3O8M A;  3V1R A;  1U49 A;  2A42 A;  1YAG A;  3MX2 A;  4JV5 K;  4BG9 A;  1JLQ A;  4JK7 A;  1Q18 A;  2E2Q A;  3CD6 N;  4CD3 A;  3G4S N;  1L3U A;  4DU3 A;  2FSJ A;  3DXM B;  3V6D A;  1RBS A;  3JS6 A;  1HYV A;  4AM6 A;  3OYN A;  3VQ5 A;  1GLF O;  3D45 A;  3FGU A;  5A2Q O;  3H3N O;  1RFQ A;  3VN5 A;  1FKO A;  1U2V B;  2B5J A;  5GIN A;  1TL3 A;  1QQO A;  1WSG A;  3O9T A;  4JK8 A;  3H45 C;  1YIT N;  3ZSY A;  3CFR A;  2FSK A;  1N32 K;  3THW A;  3ZEU B;  1W7A A;  3CJ1 A;  4RW7 A;  4OX9 K;  4MLE A;  3G71 N;  3OHR A;  1EET A;  2P9I B;  2VG6 A;  1ATR A;  3SJJ A;  4KRE A;  3A5O C;  3KZB A;  4CEZ A;  3AVI A;  2HNZ A;  1BL3 A;  2ZJQ L;  1W9H A;  1NGD A;  1P90 A;  4C8O A;  1UA1 A;  3K58 A;  3W3D A;  4IBN A;  3F2K A;  5M1N A;  1TK0 A;  1ESV A;  3C65 A;  4RCH A;  1YTU A;  3PIP L;  1HQU A;  3CCS N;  1A5X A;  3SUN A;  3DXK B;  1CZ9 A;  1KVC A;  2G8U A;  3ULE B;  2JWL A;  3PX0 A;  3WNE A;  3LPU A;  5AQT A;  4DV6 K;  4BR9 A;  2QI2 A;  3ZYY X;  3AVG A;  1M90 O;  4FJ8 A;  1YT3 A;  3MX5 A;  5DK5 A;  4FPA A;  4DHY A;  4YOV A;  1YJ9 N;  2FF3 B;  4FLV A;  3T1Y K;  3WXK A;  3OYK A;  1XI1 A;  1NGH A;  4C8K A;  2FBY A;  4YOT A;  2P9N B;  1RT3 A;  2JWK A;  3O9U A;  2X78 A;  1S1T A;  2I5J A;  4ILJ A;  4ELT A;  4IKF A;  1NOY A;  2PBD A;  1O1W A;  1VRT A;  2HOE A;  4FLY A;  3LAN A;  5KGX A;  4JRQ A;  4FOE A;  4ZHR A;  3ENH A;  4NCG A;  4KH6 A;  4JKF A;  2A41 A;  3DLG A;  4BRC A;  2LSN A;  3AO4 A;  3MK6 A;  4YOR A;  3ATU A;  5HRP A;  3KD5 E;  4F2S A;  4LH4 A;  3HP6 A;  1X1P A;  3IKM A;  2O4I A;  3M8P A;  2NRR A;  4ELV A;  4JKG B;  2WBN A;  1FK9 A;  2R7Y A;  1YTA A;  4A61 A;  2A40 A;  3RMC A;  5SWM A;  4FZX C;  3ZSR A;  1LOT B;  4CGJ A;  2YHY A;  2DFH A;  3WXM B;  3CC2 N;  1RT4 A;  4PL7 A;  1IBM K;  2WOM A;  4JS5 A;  1QHT A;  1DTT A;  3TWH A;  4JI5 K;  4KHS A;  4DTR A;  1KFS A;  3KVG A;  3FR0 A;  4DQS A;  3PY8 A;  2UU9 K;  3F73 A;  3BY5 A;  1HNV A;  3DLR A;  3V9W A;  4JI8 K;  5CHI A;  3C94 A;  4CZE A;  3I8D A;  4NYF A;  2UXB K;  1G99 A;  2GEL A;  4LD0 A;  1VQM N;  3M8R A;  5CE3 A;  4DFM A;  4RTF D;  1YUW A;  3UKU A;  5AQK A;  4W5Q A;  3FZH A;  4B9Q A;  5GAH P;  4NB4 A;  4H8K A;  3RTV A;  4WCE L;  2HBL A;  3P38 A;  4CZK A;  3LDL A;  5C24 A;  5HL7 L;  4M3U A;  2PZS A;  4FW1 A;  1FJG K;  3EL2 A;  4DMN A;  3OA9 A;  3V9X A;  5AQM A;  3QDK A;  3DM2 A;  3DRR A;  4CJK A;  4FWQ A;  4Z0U A;  4GNI A;  1Q8I A;  4IDH A;  1CXQ A;  1T05 A;  4EHU A;  3AAR A;  2KHO A;  3VQP A;  4E3S A;  2QXF A;  1LWF A;  2ZF5 O;  4DR3 K;  5FRN A;  1IJJ A;  1P8Z A;  3OW2 M;  3ZEU A;  3R9P A;  4RW6 A;  1LAW A;  5SZT A;  3VQD A;  3PIO L;  2W6L A;  4IDK A;  4JAX A;  4FM1 A;  4FJN A;  1KTQ A;  5J2N A;  3A2F A;  4H0V B;  4KH4 A;  3MXI A;  1X9J A;  4KTQ A;  4PQU A;  4CFC A;  4CIF A;  1GLD G;  3CI5 A;  4DR4 K;  4M3T A;  3HVR A;  4IG0 A;  1BO5 O;  1SUQ A;  3HBT A;  3HRG A;  1KVA A;  1IG8 A;  4QCL A;  3CJA A;  3OYB A;  4GW6 A;  1A5V A;  2P9L A;  4O0J A;  4I2P A;  2ZGY A;  1GOA A;  2P9U B;  1KLN A;  3SPY A;  4B9V A;  1NKE A;  4CJ7 A;  1UAX A;  2O8B A;  4DSI A;  3CQ8 A;  1ZBF A;  4Z94 A;  3HTV A;  3HT3 A;  4CW7 B;  3SI6 A;  3CG7 A;  4DR5 K;  3OYE A;  2Q2R A;  3F5T A;  4RW8 A;  2D4W A;  4O0I A;  2O8C B;  1XNQ K;  4K8X A;  4J2B A;  3HK2 A;  5AQX A;  4CED A;  4CBU A;  2NRT A;  3J81 O;  3QEI A;  1UA0 A;  1U45 A;  5JIC A;  3KK7 A;  1VRU A;  1SKR A;  3M5R A;  3K5N A;  4DF4 A;  4CHP A;  2HNY A;  4LH5 A;  3VES A;  2G8H A;  2DFF A;  3K5L A;  3TSP A;  2P5O A;  2G8F A;  5JS1 A;  3THX B;  3W0L A;  1TKT A;  3NF6 A;  2GBZ A;  1RT6 A;  2FBT A;  4EIA A;  1CZB A;  3SBT A;  3QEV A;  2D0P A;  5JLF A;  3AAP A;  3ATV A;  3AVK A;  3S3O A;  1F21 A;  3OJS A;  1XHX A;  1XC3 A;  3V1Q A;  5GAE P;  3S41 A;  3Q7B A;  4CI6 A;  4BWJ A;  3O4W A;  1K6Y A;  3D2F A;  2B6A A;  3L0Q A;  1YJW N;  2E88 A;  3T3F A;  1BI4 B;  4BC5 A;  3MAQ A;  1SL1 A;  4LSL A;  3MDQ A;  3O1B A;  1J53 A;  3LAL A;  4CJU A;  3SYZ A;  4M3X A;  3NGZ A;  3TPQ A;  2OAN A;  4DSJ A;  1VSH A;  4LF5 K;  4EZ9 A;  3HOT A;  4I9Q A;  4JI7 K;  1X3M A;  1RBT A;  2VCP A;  4HCC A;  4CEE A;  3KK3 A;  1JLE A;  3A5N C;  4BRM A;  3S3N A;  1NK7 A;  4F4K A;  2ETJ A;  1VSF A;  3V9Z A;  3C95 A;  3ULD A;  1ZBL A;  3AVN A;  3HJF A;  2YX6 A;  1KAY A;  1KC8 O;  3T1H K;  4E7H A;  1D4X A;  2X6S A;  4CZI A;  1ZC6 A;  2D0O A;  1BDG A;  3LDS A;  3BDP A;  3V81 A;  2A1S A;  4JI3 K;  4LFA K;  2ASM A;  3BP8 A;  1SV5 A;  5C2F A;  4BDP A;  5FPE A;  1NK6 A;  5CR4 A;  3AA5 X;  5AQP A;  4B1X B;  1XNR K;  3CHW A;  5AZI A;  3SPZ A;  1LAV A;  3VER A;  1KXP A;  3SAH A;  5LJW A;  3AA3 A;  3JAM O;  3KHY A;  2AP1 A;  1SKS A;  4UQG A;  1KCF A;  2KLA A;  2UUB K;  4BRA A;  2E2N A;  3ZX3 A;  1Q9X A;  3GG4 A;  2YHX A;  3DYA A;  3I8B A;  4I6M A;  3WEE B;  4JD2 B;  3IUC A;  4NXN K;  3EN9 A;  1KAX A;  1S72 N;  4E1M A;  4R79 A;  3SUQ A;  3VEZ A;  1BA0 A;  4CE9 A;  2B4J A;  1TL1 A;  4KFB A;  4WFN L;  3O6W A;  4KAZ A;  5K14 A;  3NCI A;  1GLB G;  2O8E A;  3O3H A;  1OKJ A;  5C10 A;  3DMJ A;  3F9K A;  3K9J A;  4JHD A;  3QNO A;  3BGR A;  4OLB A;  4DQR A;  4CJW A;  4Z4G A;  1BG3 A;  5HLF A;  4X66 K;  1HX1 A;  3JXU A;  3G10 A;  4KTW A;  3ID6 A;  3QEX A;  3I0R A;  2Y1I A;  5EVZ A;  1SAZ A;  4NLB A;  1SZ2 A;  1Q86 O;  3IMX A;  2HVH A;  4X62 K;  4MDB A;  2VGN A;  5AQF A;  5AZJ A;  4CFD A;  3NVK A;  4CJL A;  2EHG A;  3WQT A;  4FCY A;  1JKH A;  1GLL O;  4LSN A;  1EX4 A;  3UKR A;  4DR7 K;  5KPR A;  1VQO N;  1N8R O;  2CGK A;  3NVM A;  1ZBU A;  2HHS A;  3UKR B;  3K59 A;  4NCB A;  4DF8 A;  2ASP A;  3AO5 A;  1C1C A;  4W5T A;  4FJX A;  4KHW A;  4CEQ A;  3IG1 A;  4KHY A;  3ZT2 A;  1D9F A;  3LDP A;  3AVJ A;  2W42 A;  5LL6 Z;  1RTI A;  1WBB A;  5LY3 A;  4KPY A;  1NJX A;  1VSE A;  3OS2 A;  4B9M A;  2JLE A;  2VYP A;  3ZT4 A;  2IVN A;  1U04 A;  3WXL A;  1JL2 A;  2BAN A;  5C15 A;  3B8A X;  3C6A A;  4IJN A;  4BC3 A;  4FJM A;  4JS4 A;  3H46 O;  5M1P A;  1RDU A;  3GDQ A;  1T03 A;  1IKW A;  4CJP A;  5I3U A;  4CK3 A;  1U48 A;  2W40 A;  5T7B A;  3AA4 A;  1J6Z A;  1TK5 A;  5B8H A;  3MEE A;  5KGW A;  5J1E A;  1U6Z A;  2XO7 A;  1KQS M;  4B3S K;  1Z05 A;  4ISE A;  4BGA A;  1NGA A;  1RT1 A;  3AA2 A;  4YFU A;  4M3W A;  2ATQ A;  3U3G A;  3CJB A;  1TGO A;  4A59 A;  3AO2 A;  4J2A A;  3D6R A;  1NJY A;  1S1X A;  4DQP A;  3MCA B;  1WAF A;  3QFU A;  3FE1 A;  3DLL L;  3ID8 A;  1C0F A;  4RWT A;  1RT7 A;  1R59 O;  3LDQ A;  5GIO A;  1YI2 N;  3PO5 A;  4Z4F A;  4CF8 A;  3OBY A;  3O4N A;  1FW6 A;  1T6C A;  1BCM A;  4OJR A;  4F3O A;  4WQ4 A;  3RMB A;  5JVG L;  2EX3 A;  3VET A;  4DTN A;  2P51 A;  1QTM A;  2HBK A;  4O55 A;  4DG1 A;  2P9S A;  1OH5 A;  1RTH A;  1GOC A;  4DR1 K;  4OKE A;  2Q1N A;  2QKB A;  3E1Y A;  1FKP A;  3KLH A;  2IGI A;  1NGJ A;  3T7Z A;  1YHQ N;  1BQN A;  4DUY K;  4RG8 A;  2HMP A;  4CJ5 A;  4LFC K;  3WEE A;  1HPZ A;  2IC3 A;  4IWV A;  2QWP A;  3CFO A;  4CGH A;  2FBV A;  4KTZ A;  4AIL C;  3AO3 A;  1NMN A;  4H0T B;  3QFP A;  4IZ9 A;  3R3L A;  1S1V A;  2E6L A;  4J2D A;  4IO9 L;  3C6T A;  3O5B A;  2I7N A;  2RHK A;  3ZSQ A;  4CF0 A;  2HHT A;  4JKA A;  3VPZ A;  2NNW A;  3LP2 A;  4FOI A;  2F9T A;  2ZD1 A;  1K8K B;  3HPO A;  2ZQB A;  4N41 A;  2IOC A;  5J2P A;  1RBR A;  2HBM A;  4LF4 K;  5ELZ A;  1IBK K;  1K8K A;  4KKO A;  1TUY A;  5HRN A;  3EKS A;  1RGI A;  1ZBS A;  2YJF A;  1VQ9 N;  4MDA A;  2HHV A;  4U67 L;  4GV3 A;  3NF8 A;  1H1V A;  1NGC A;  1NKB A;  4WQ5 A;  2IS3 A;  1ZBH A;  3LP1 A;  4JK9 A;  5H1S Q;  1RBU A;  4Z4E A;  4PKI A;  2F4V K;  3SUP A;  4H0Y B;  1RT2 A;  2XHB A;  4NYN A;  3T1A A;  3ZT0 A;  1LWC A;  2D5R A;  3MN5 A;  4CZJ A;  1WNS A;  4AM7 A;  2D1K A;  3QB0 A;  2NLX A;  2KFZ A;  4BRL A;  3E66 A;  1WSI A;  2G8V A;  1REV A;  3L4I A;  1QS4 A;  1L5U A;  5EU7 A;  1QVF M;  4EAH D;  1K8A O;  4OPJ A;  3K5O A;  5TKY A;  1GOB A;  3IDH A;  2NUB A;  4BE2 A;  5AQU A;  1VK0 A;  3SMS A;  4CZM A;  4WYB A;  3CIP A;  2QW9 A;  1KAZ A;  1KLM A;  4BRK A;  3OS1 A;  2YNF A;  1HPM A;  3LM2 A;  1NM1 A;  1NLV A;  4KHU A;  4HHT A;  3TAB A;  3FZM A;  4OVL A;  2E1Y A;  1GLJ O;  3F9M A;  3WXJ A;  5GAG P;  1C0M A;  1RDW X;  3RSE B;  5ADX A;  4IO8 A;  1IH7 A;  3ENO A;  4NO7 A;  3RSE A;  1XHZ A;  4FLW A;  4BG8 A;  2NRH A;  1NGB A;  3DXM A;  3C7N B;  1ASV A;  4OPA A;  4DTX A;  4FJI A;  3C0B A;  3EE8 A;  4HUE A;  2O8D A;  4LF6 K;  3MWT A;  4FWN A;  2H3G X;  3I33 A;  1JLA A;  3HL8 A;  4G1Q A;  4CF1 A;  3U3Y A;  3V4I A;  5FDL A;  1NGI A;  1XWL A;  4I2Q A;  3CF5 L;  4JN4 A;  2OA8 A;  4BC2 A;  3OS0 A;  3D2E B;  1BWF O;  3SLC A;  3PO4 A;  5EXW A;  4PWD A;  4WFB L;  1LW2 A;  1A5W A;  2O8F A;  3IFR A;  2RF2 A;  4Z4I A;  2I7P A;  3SMP A;  4BR4 A;  5AJ3 K;  1DEJ A;  5EY4 A;  2CGJ A;  2ZGZ A;  4CF9 A;  1QHA A;  1N6Q A;  5BRD A;  3DOL A;  4FK4 A;  1NJZ A;  3CCV N;  3H1V X;  3M1F A;  1S1U A;  4CGD A;  4HWI A;  3DLK A;  3GOI A;  4DSK A;  3FZK A;  2HST A;  4DTM A;  4PHT X;  2P9P B;  4DR6 K;  3R1X A;  3SJH A;  4A57 A;  4ILG B;  4ZTF A;  3HPG A;  1Y97 A;  2PAV A;  3QIP A;  3NH2 A;  3U6F A;  2YKN A;  5DMR A;  3CJ7 A;  3L4Q A;  3P1G A;  3J7Z O;  3WUH A;  3VQ6 A;  5LMU K;  4HTL A;  3BZK A;  2O8C A;  1HKG A;  4ISG A;  2O8B B;  4A2B A;  1NMD A;  1HNX K;  3U9D A;  4BRG A;  1HJR A;  3E9O A;  3QML A;  4KI4 A;  4JKE A;  1NNE A;  5C12 A;  4CHO A;  4JI1 K;  2XY8 A;  3MXJ A;  4M41 A;  4FPB A;  3LL3 A;  5CY4 A;  4B3M K;  3NF9 A;  3NBP A;  3G0Z A;  3R8E A;  1SQK A;  2A5X A;  4BRI A;  4LY7 A;  4CFB A;  4IXC A;  4MO4 A;  1TKD A;  5IT9 O;  2DPN A;  3LDN A;  1HNW K;  3V9U A;  4JKB A;  1IKV A;  1E4G T;  2RKI A;  2Q0R A;  1W0H A;  3CM6 A;  3E9L A;  3VEY A;  4CZL A;  3IS9 A;  3VQC A;  4CJ4 A;  3FLC O;  3TAM A;  2W6K A;  1DGK N;  4ZTJ A;  3RWU A;  4N5S A;  1SL0 A;  2QKK A;  3D2F B;  2GUI A;  2NRW A;  4PA1 A;  2UUC K;  5E41 A;  2ZWH A;  2FLO A;  4BRQ A;  4FXD A;  3ZET A;  2QWQ A;  2F8T A;  1QE1 A;  4KBO A;  1YF5 L;  2KTQ A;  1B9F A;  2GWK A;  3AGR A;  3AVC A;  3OVN A;  4FYD A;  1HKB A;  1L3V A;  1RBV A;  5M1O A;  1MU2 A;  4DS5 A;  2EWS A;  3WT0 A;  3L3U A;  2OTJ N;  4AHS A;  4CZG A;  1VSJ A;  1IKX A;  3RVC A;  1VAZ A;  2WTU A;  4BVO A;  3PV8 A;  5AQR A;  5BPM A;  3VEW A;  4WFA L;  3WNF A;  3AVM A;  4IFV A;  3B6P A;  4BQZ A;  2QWL A;  2IIR A;  1NWK A;  1QSY A;  2BE2 A;  3RR7 A;  4H03 B;  4ELU A;  5KQD A;  1QQC A;  1VQ5 N;  3LWM A;  1WAJ A;  3N4Q A;  3LZJ A;  2HMI A;  2GTD A;  2XRI A;  1OH8 A;  1OVQ A;  1I39 A;  2BDP A;  2HHQ A;  4E89 A;  2QA4 N;  1LWE A;  4CES A;  2RE2 A;  2YNG A;  5GIP A;  3U9Z A;  5AQI A;  4MO5 A;  3HPH A;  1LV5 A;  4DFP A;  4YDU C;  4DV3 K;  4DV4 K;  5F0X A;  4K0K K;  4EZ6 A;  2IDO A;  3TTF A;  4CIE A;  1E3M A;  5AQN A;  2A6A A;  3TI0 A;  4WF9 L;  1YIJ N;  3QBX A;  2O8E B;  4CJE A;  4O5B A;  1S6Q A;  3KK2 A;  3VGL A;  3BEX A;  1KFD A;  4B1U B;  4XEI A;  3SV4 A;  4AHC A;  3ZX2 A;  3VEO A;  2QXL A;  4CEA A;  3QIO A;  4KV8 A;  3KLF A;  4JHD B;  3KWG A;  3QBW A;  1RCH A;  2P1J A;  4Y1C A;  5AZJ B;  4DTO A;  1X3N A;  4DV5 K;  3VEX A;  1NK8 A;  1BIZ A;  3T69 A;  1NGE A;  1QQM A;  3WNH A;  2IAJ A;  3I55 N;  1BHL A;  3MWP A;  3ZSW A;  3P31 A;  3CMA N;  3PX4 A;  2KZZ A;  1N36 K;  4H4O A;  2E20 A;  3CME N;  1XMQ K;  4WE1 A;  5TKW A;  2BUP A;  2DTU A;  4JKD A;  3L2U A;  2F7T A;  4RW9 A;  1JXB A;  2YHB A;  3AV9 A;  4DV7 K;  1TAU A;  3K57 A;  4V19 S;  2A3Z A;  1WSF A;  5LJV A;  3SQ4 A;  3RMA A;  4YOY A;  2W41 A;  1T3V A;  1QVG M;  4JLH A;  4X65 K;  4KRF A;  4GY2 B;  3U4L A;  1X9S A;  1EQY A;  3O9R A;  3EO3 A;  1T6D A;  3ASM A;  1VQ7 N;  4JKG A;  2QK9 A;  5IWA K;  1QZ6 A;  3ZX0 A;  4AHU A;  3B6O A;  3NH0 A;  3TU5 A;  5KPZ A;  4E7J A;  3SNN A;  2KZM A;  2F9W A;  4H4M A;  2VQF K;  1RNH A;  4DFK A;  3K0S A;  4FZY A;  1NOZ A;  2VWB A;  3SCX A;  3MED A;  1NU0 A;  1BUP A;  1UWB A;  2QWO A;  2Z1I A;  4BRH A;  1JLF A;  3KKS A;  1XC9 A;  2CGL A;  4FJ7 A;  3RRG A;  1WSE A;  5AQV A;  3L2W A;  4CHN A;  3LAM A;  4BDZ A;  3LWL A;  4A5A A;  4IG3 A;  3L2Q A;  4PUO A;  3Q7C A;  4NCA A;  1WBD A;  2NZT A;  3HM8 A;  2HHX A;  2DFE A;  4K42 A;  1IG9 A;  5EX5 A;  4E1J A;  3A5L C;  1W2B M;  4IJA A;  4DV0 K;  1S9G A;  4GV9 A;  2VQE K;  3VQA A;  4CBX A;  5KI6 A;  3CCE N;  4XH1 A;  4NXM K;  1BGX T;  3MXM A;  2V7Y A;  3CM5 A;  3LPT A;  4YOX A;  3BZC A;  3LP3 A;  5E26 A;  3HST B;  3CET A;  1RDB A;  3O9Q A;  2YI1 A;  4FLT A;  2P9S B;  1NK5 A;  1Z25 A;  3CPE A;  1DLO A;  2P9I A;  4KI6 A;  1BIS A;  4E7K A;  4CK2 A;  4E0D A;  1MDU B;  4YY3 K;  1C1B A;  5AQW A;  2JGU A;  1HYZ A;  3KWI A;  3TAQ A;  3KD1 E;  3KIO A;  4OGC A;  1VQ6 N;  4B3T K;  5BN9 A;  3EKU A;  2Z1H A;  4I6M B;  4FZZ A;  3VF6 A;  5ADX H;  3M8Q A;  4FJ5 A;  1RTJ A;  2AA4 A;  4W5R A;  3O4Q A;  1S3X A;  2E2P A;  3VQ9 A;  4OPK A;  4B9L A;  3QES A;  4BRD A;  3QLH A;  1N34 K;  1YJN N;  3GE1 A;  1MWM A;  3JSM A;  5KPT A;  1NK9 A;  2J4R A;  1VQP N;  2YNH A;  4FWS A;  4E19 A;  4HVJ A;  4FK2 A;  1ZBI A;  3MCP A;  2VG5 A;  5AQL A;  2NRX A;  4L8R B;  1C0U A;  4GMJ B;  4HCB A;  4Z4H A;  3OYM A;  3DLB A;  4CVN E;  3EEQ A;  4CJF A;  3O08 A;  3ZT3 A;  4H0O A;  1NBW A;  3NAE A;  2Q3S A;  4C8M A;  5BR9 A;  3KKR A;  1IBL K;  4LF8 K;  4LC9 B;  3HSC A;  4KHN A;  4MQ3 A;  3NE6 A;  1Q81 O;  4DLG A;  1DKG D;  3I0S A;  3S3M A;  3TTD A;  4BR0 A;  4OPH A;  1TAQ A;  4QAG A;  3DLH A;  3VEV A;  3K9K A;  3JYT A;  2IVP A;  4FLU A;  5FRO A;  4FSV A;  3OYH A;  4HUF A;  2OZM A;  1ZXO A;  3J8A A;  3ZSX A;  4CGG A;  3SUO A;  2GUP A;  3KLG A;  3DXK A;  2QM1 A;  4F3T A;  3PSF A;  4N47 A;  1HNI A;  2E5L K;  3LZI A;  3ZSV A;  4M63 C;  1UOC A;  3C6H A;  5CZ1 A;  4F9O A;  1J5E K;  3ZT1 A;  3CCR N;  4R5P A;  4NLC A;  3OYL A;  4PKG A;  4AHT A;  2WON A;  4CIG A;  1RIL A;  4BRO A;  3LP0 A;  1LCU A;  3WXI A;  4FVM A;  1E4F T;  4FWK A;  4XH5 A;  1W97 L;  3DWL A;  1KSP A;  1Q9Y A;  3THY A;  2YHA A;  3VTI A;  4IOA L;  3PUF A;  3UKU B;  3OYA A;  2QEX N;  3OYG A;  4JI2 K;  4H5R A;  1J9A A;  4M42 A;  3NH1 A;  4GVM A;  1ZYQ A;  5HRO A;  2Z1G A;  5AFU H;  3VQ7 A;  3O80 A;  4I7F A;  4BR7 A;  1Q82 O;  3L8B A;  3QER A;  4CCH A;  1WB9 A;  1NKC A;  3M6G A;  1KVB A;  4A62 A;  4HUG A;  3NGI A;  2BTF A;  3NMU A;  4DKW A;  3OY9 A;  4BRE A;  3TAN A;  4EFH A;  4YHH K;  1TVR A;  4M45 A;  2E8A A;  2PFU A;  4Q5V A;  2E2O A;  2FF6 A;  1C1A A;  2RPI A;  5C25 A;  2FC0 A;  2Q31 A;  1D9D A;  1VSL A;  2O8F B;  2VWJ A;  4U7B A;  1TYQ A;  1HUX A;  3CCQ N;  3H6E A;  5AQH A;  4OKK A;  2OCE A;  1JJ2 M;  4Z4C A;  1O13 A;  4O44 A;  3CCJ N;  2A1R A;  1U4B A;  1EXQ A;  4GVE A;  3T19 A;  3HYF A;  4YOW A;  3NFA A;  4IFE A;  4KO0 A;  1TKX A;  3CYM A;  5HRS A;  1EKE A;  4RW4 A;  2QWN A;  3SQ0 A;  1D5A A;  3QIN A;  5D3G A;  3VQQ A;  4BDY A;  1VQ8 N;  3A8Y A;  3H1Q A;  1C0G A;  2GWJ A;  2P9L B;  1ITG A;  2XY7 A;  1OVY A;  3P39 A;  3H3O B;  1WOQ A;  2P9P A;  2HHW A;  4DTU A;  4MFB A;  4CEO A;  3ZLJ A;  5DM7 L;  5BRE A;  4Q0B A;  4DU1 A;  2CH5 A;  5KTQ A;  1VSK A;  5HP1 A;  1VSI A;  3L3V A;  1JLB A;  3L2V A;  4O4G A;  3QNN A;  4F8R A;  3IRX A;  2G8I A;  1WSH A;  3KJV A;  3WNG A;  1HKC A;  2F96 A;  1DT9 A;  4DV2 K;  4LF7 K;  2CH6 A;  4IOX A;  4DWI A;  3VF2 A;  4LF9 K;  4B1Z A;  1HYS A;  1IKY A;  3OJU A;  5AZI B;  4BRF A;  4DCH A;  1T44 A;  4IEE A;  1EWR A;  2VGM A;  3ISN C;  1VQ4 N;  4J8F A;  1RDC A;  3OYI A;  4DTS A;  3CFP A;  1WN7 A;  3CC4 N;  2BGG A;  3AVA A;  4PKH A;  4KH5 A;  1BCO A;  2OTL N;  2Q0U A;  1B92 A;  1BI4 A;  3DOK A;  4B1W B;  4O8U A;  3CJC A;  5AQG A;  5HRR A;  3M8S A;  3J7A P;  3VQB A;  3ULE A;  4QS7 A;  1WUA A;  3QO9 A;  5FPN A;  2ZJP L;  1RT5 A;  4DV1 K;  1Z6R A;  2YHW A;  3MN9 A;  5C0Y A;  1J54 A;  4HTU A;  2OPQ A;  3SBG A;  1GLC G;  3THY B;  2AJQ A;  1YVN A;  2UXC K;  3VTH A;  2UUA K;  1B9D A;  4O8K A;  3RRH A;  3AO1 A;  1HRH A;  3AVL A;  3G6E N;  4A2A A;  3HP9 A;  4MLH A;  4FWM A;  1GLE G;  1V4T A; 
#chains in the Genus database with same CATH homology
 1TL3 A;  1S6P A;  4O5B A;  1WSG A;  1S6Q A;  2JLE A;  4CEC A;  3KK2 A;  3ZSY A;  3CFR A;  4CEF A;  3ZT4 A;  2HVI A;  1U04 A;  1KFD A;  4E7I A;  4PY5 A;  2DY4 A;  4BE1 A;  3SV4 A;  4RW7 A;  1IO2 A;  1JL2 A;  4FW2 A;  3O3F A;  2BAN A;  1U47 A;  1VSM A;  1EET A;  4AHC A;  2VG6 A;  1JXE A;  4FJM A;  3SJJ A;  4KRE A;  4CEA A;  3QIO A;  4W5O A;  4KV8 A;  4CEZ A;  4JS4 A;  3KLF A;  3AVI A;  1RCH A;  2HNZ A;  2P1J A;  4Y1C A;  2ZE2 A;  1BL3 A;  3KTQ A;  1W9H A;  3VQ4 A;  4QOZ B;  4DTO A;  1T03 A;  4C8O A;  1UA1 A;  4E1N A;  3KLI A;  3K58 A;  1NK8 A;  4OGE A;  4IBN A;  1IKW A;  1BIZ A;  4CJP A;  4CFA A;  3HM9 A;  5I3U A;  1TK0 A;  2HB5 A;  4CK3 A;  1U48 A;  4N76 A;  1C0T A;  3WNH A;  1RDA A;  1YTU A;  1HQU A;  1NK4 A;  5T7B A;  2IAJ A;  1BHL A;  1Z26 A;  3AA4 A;  1A5X A;  3ZSW A;  4FM2 A;  3PX4 A;  2KZZ A;  4BWM A;  1TK5 A;  2XO7 A;  3MEE A;  5KGW A;  4H4O A;  5J1E A;  3SUN A;  1CZ9 A;  1D8Y A;  1KVC A;  2OPP A;  2O4G A;  4WE1 A;  2XY5 A;  1RT1 A;  3AA2 A;  2G8U A;  4FM0 A;  4YFU A;  4M3W A;  2ATQ A;  3U3G A;  2DTU A;  3L2U A;  3PX0 A;  4KB0 A;  4RW9 A;  1JXB A;  2YHB A;  4FJ9 A;  2D0C A;  3AV9 A;  3WNE A;  4ID5 A;  3LPU A;  1TGO A;  1C6V A;  4FJL A;  1HMV A;  3AO2 A;  3K57 A;  1TAU A;  1WSF A;  3SQ4 A;  3RMA A;  4J2A A;  1NJY A;  4B3O A;  3AVG A;  2XY6 A;  1S1X A;  1RTD A;  4DQP A;  4FJ8 A;  4CHQ A;  1WAF A;  1YT3 A;  5DK5 A;  5KRS A;  4JLH A;  1JL1 A;  1RT7 A;  4KRF A;  4FLV A;  1X9S A;  1XI1 A;  3OYK A;  3PO5 A;  4Z4F A;  4EP4 A;  2FBY A;  4C8K A;  3ASM A;  4TSX A;  4CF8 A;  5CYQ A;  3ZCM A;  4IKF A;  3O4N A;  2QK9 A;  4JRP A;  1RT3 A;  2D0B A;  1S1T A;  2I5J A;  2X78 A;  1BCM A;  4OJR A;  3B6O A;  3P5J A;  4AHU A;  3NH0 A;  1L3S A;  1O1W A;  1NOY A;  3RMB A;  2KFN A;  1VRT A;  4N56 A;  4E7J A;  2D0A A;  3SNN A;  2EX3 A;  4FLY A;  2KZM A;  4B9T A;  4H4M A;  4J2E A;  4DTN A;  2P51 A;  3LAN A;  5KGX A;  4JRQ A;  1QTM A;  1RNH A;  4DFK A;  4O55 A;  2HND A;  4M3R A;  4DG1 A;  3OYD A;  4F3O A;  1RTH A;  4ZHR A;  1GOC A;  4FZY A;  4OKE A;  4NCG A;  4ICL A;  1NOZ A;  2QKB A;  3SCX A;  4FJK A;  1FKP A;  4B9U A;  3O3G A;  3DLG A;  3KLH A;  2LSN A;  3MED A;  3AO4 A;  2IGI A;  1UWB A;  1QSS A;  3KD5 E;  5HRP A;  1BQN A;  4KHQ A;  2Z1I A;  4B08 A;  3ZSZ A;  1JLF A;  2E6M A;  3KKS A;  1TK8 A;  4RG8 A;  4F2S A;  3K2P A;  4CJ5 A;  4LH4 A;  1XC9 A;  3HP6 A;  1X1P A;  1HPZ A;  2IC3 A;  3RRG A;  1ASW A;  4FJ7 A;  2O4I A;  1WSE A;  3CFO A;  3L2W A;  3M8P A;  4CGH A;  2FBV A;  3QEP A;  4ELV A;  4CHN A;  4KTZ A;  4AHR A;  3LAM A;  4BDZ A;  1FK9 A;  4AIL C;  2R7Y A;  3LWL A;  1YTA A;  3AO3 A;  4IG3 A;  3RMC A;  5SWM A;  3L2Q A;  4FZX C;  4PUO A;  3ZSR A;  4NCA A;  4FLX A;  1S1V A;  2E6L A;  3VQ8 A;  4CGJ A;  3NHG A;  2DFH A;  2HHX A;  4J2D A;  2DFE A;  1IG9 A;  3C6T A;  1NJW A;  1RT4 A;  3C6U A;  3ZSQ A;  4CF0 A;  2WOM A;  3TAR A;  4JS5 A;  1QHT A;  3OYF A;  1DTT A;  3TWH A;  4DS4 A;  2HHT A;  4KHS A;  4DTR A;  1KFS A;  1S9G A;  3EY1 A;  3LP2 A;  3ITH A;  4DQS A;  3PY8 A;  4B8A B;  1T8E A;  3F73 A;  1HNV A;  3DLR A;  3VQA A;  2ZD1 A;  3V9W A;  5KI6 A;  3C94 A;  2ZQB A;  1JLG A;  3HPO A;  4DFJ A;  4N41 A;  2IOC A;  5J2P A;  1BGX T;  3I8D A;  4NYF A;  1RBR A;  3MXM A;  3CM5 A;  4M3Z A;  4LD0 A;  4K8Z A;  3LPT A;  4DLE A;  3LP3 A;  3M8R A;  3HST B;  4KKO A;  4DFM A;  1RDB A;  5HRN A;  4FLT A;  1NK5 A;  4W5Q A;  1Z25 A;  3VA0 A;  1DLO A;  4H8K A;  3RTV A;  3RR8 A;  4KI6 A;  2OPS A;  5C24 A;  1BIS A;  4E7K A;  3MEG A;  4CJS A;  2HHV A;  4CK2 A;  4E0D A;  3NF8 A;  2PZS A;  4M3U A;  2PY5 A;  1NKB A;  1C1B A;  2IS3 A;  3D0P A;  1ZBH A;  2GV9 A;  3LP1 A;  3QEW A;  4FW1 A;  4DMN A;  1RBU A;  2JGU A;  4Z4E A;  1HYZ A;  3SUP A;  3V9X A;  2RN2 A;  3TAQ A;  1CXU A;  1RT2 A;  3KIO A;  3KD1 E;  2XHB A;  4NYN A;  3DM2 A;  3DRR A;  4OGC A;  3T1A A;  3ZT0 A;  4CJK A;  4BAC A;  4DSE A;  2Z1H A;  1S5J A;  4Z0U A;  4FZZ A;  1LWC A;  1Q8I A;  3M8Q A;  4FJ5 A;  1RTJ A;  2D5R A;  4W5R A;  1CXQ A;  4W5N A;  1T05 A;  3O4Q A;  3DI6 A;  1WNS A;  4CJQ A;  3DLE A;  4OPK A;  3VQ9 A;  4B9L A;  2KFZ A;  3QES A;  1WSI A;  3AVB A;  3VQP A;  4E3S A;  1REV A;  2G8V A;  3QLH A;  2QXF A;  4DQQ A;  2P5G A;  1QS4 A;  1LWF A;  1L5U A;  5EU7 A;  5FRN A;  3IAY A;  3JSM A;  1NK9 A;  4OPJ A;  3K5O A;  1X9M A;  1G15 A;  2YNH A;  5KRT A;  4RW6 A;  1GOB A;  4E19 A;  4HVJ A;  1LAW A;  4FK2 A;  5SZT A;  2NUB A;  4BE2 A;  1ZBI A;  3VQD A;  4IDK A;  2VG5 A;  4FM1 A;  4FJN A;  1KTQ A;  5J2N A;  1VK0 A;  3A2F A;  2VWK A;  4L8R B;  1C0U A;  3RMD A;  3MXI A;  4CHY A;  1KLM A;  4XIU A;  2OPR A;  4GMJ B;  5JS2 A;  4CJV A;  3OS1 A;  4KTQ A;  2YNF A;  3SV3 A;  4PQU A;  1VSD A;  4CFC A;  4HCB A;  4KHU A;  4Z4H A;  4HHT A;  3TAB A;  4CIF A;  4FJG A;  3OYM A;  3DLB A;  2HW3 A;  4ID1 A;  4OVL A;  4DSL A;  3OYJ A;  4M3T A;  3DRP A;  4CJF A;  2ITG A;  5CZ2 A;  3ZT3 A;  3HVR A;  4IG0 A;  3TR8 A;  1SUQ A;  3NAE A;  2Q3S A;  1KVA A;  1C0M A;  3AVH A;  4C8M A;  4B8C A;  4QCL A;  3OYB A;  3KKR A;  4GW6 A;  1A5V A;  4O0J A;  4KHN A;  4MQ3 A;  3NE6 A;  1IH7 A;  3SZ2 A;  3ALY A;  4DLG A;  3I0S A;  2VG7 A;  1LW0 A;  4I2P A;  3S3M A;  1GOA A;  1XHZ A;  4FLW A;  3SPY A;  1KLN A;  4QAG A;  1TAQ A;  3DLH A;  4B9V A;  1NKE A;  1UAX A;  3JYT A;  4DSI A;  3CQ8 A;  1ZBF A;  4DQI A;  1CLQ A;  4FLU A;  3HT3 A;  5FRO A;  3SI6 A;  3OYH A;  4CK1 A;  1ASV A;  3CG7 A;  2HHU A;  2YV0 X;  4DTX A;  4HUF A;  4FJI A;  4HUE A;  4OKJ A;  3OYE A;  2OZM A;  4RW8 A;  4F2R A;  3ZSX A;  4CGG A;  4O0I A;  4FLZ A;  1JLA A;  3SUO A;  3HL8 A;  4G1Q A;  4CF1 A;  3KLG A;  4K8X A;  3U3Y A;  3V4I A;  2G8W A;  5FDL A;  4J2B A;  4B9S A;  3HK2 A;  1XWL A;  4F3T A;  4CED A;  4N47 A;  1HNI A;  4I2Q A;  3QEI A;  3QET A;  1UA0 A;  3LZI A;  3ZSV A;  3SQ2 A;  1U45 A;  2OA8 A;  1UOC A;  1VRU A;  3OS0 A;  1SKR A;  3PO4 A;  1S1W A;  5CZ1 A;  3K5N A;  4DTJ A;  4PWD A;  4DF4 A;  1LW2 A;  1QSL A;  1A5W A;  3ZT1 A;  4CHP A;  1JLC A;  2HNY A;  2KW4 A;  4LH5 A;  4R5P A;  2RF2 A;  4I9L A;  4CGI A;  3OYL A;  2G8H A;  4KB1 A;  2DFF A;  3K5L A;  4AHT A;  2WON A;  4Z4I A;  4CIG A;  1RIL A;  2G8F A;  3AVF A;  2P5O A;  3LP0 A;  5JS1 A;  4FVM A;  3EYZ A;  4BE0 A;  3TAG A;  1TKT A;  3NF6 A;  4CF9 A;  2OZS A;  4DSF A;  3NDK A;  1Q9Y A;  2GBZ A;  1N6Q A;  1KSP A;  1RT6 A;  3DOL A;  2FBT A;  2YHA A;  4FK4 A;  1NJZ A;  1CZB A;  1RDD A;  3QEV A;  1S1U A;  3PUF A;  3OYA A;  4CGD A;  3AVK A;  2PYJ A;  3S3O A;  1F21 A;  3OYG A;  1R0A A;  3VQE A;  1J5O A;  3OJS A;  1DTQ A;  3DLK A;  1XHX A;  2Z1J A;  1N5Y A;  1J9A A;  4DSK A;  1X9W A;  1ASU A;  4M42 A;  3V1Q A;  3NH1 A;  1SL2 A;  4GVM A;  4DTM A;  1ZYQ A;  4ZTF A;  4BWJ A;  3HPG A;  4CEB A;  5HRO A;  1K6Y A;  2Z1G A;  1Y97 A;  2B6A A;  3VQ7 A;  3T3F A;  1BI4 B;  1SKW A;  4I7F A;  3QIP A;  3MAQ A;  3L8B A;  1SL1 A;  3NH2 A;  4LSL A;  5J2M A;  3U6F A;  3QER A;  2G8K A;  4C8N A;  4CCH A;  1NKC A;  1J53 A;  2YKN A;  1KVB A;  3LAL A;  5DMR A;  4CJU A;  4CJR A;  3SYZ A;  3P1G A;  4HUG A;  4M3X A;  3NGI A;  3NGZ A;  3THV A;  3VQ6 A;  4DSJ A;  1VSH A;  1TV6 A;  3V1O A;  3VA3 A;  4EZ9 A;  3OY9 A;  3TAN A;  4I9Q A;  1WSJ A;  1TVR A;  4B9N A;  4M45 A;  4IFY A;  1RBT A;  1TKZ A;  4HCC A;  5FRM A;  1HJR A;  4Q5V A;  3L2R A;  4KI4 A;  3TAF A;  4CEE A;  1C1A A;  1JLE A;  2RPI A;  2FC0 A;  5C25 A;  3KK3 A;  3PX6 A;  3S3N A;  1D9D A;  1VSL A;  4CHO A;  1NK7 A;  4F4K A;  2ETJ A;  2VWJ A;  1VSF A;  2F8S A;  1EP4 A;  3V9Z A;  4CJ3 A;  2XY8 A;  3C95 A;  3ULD A;  3MXJ A;  1ZBL A;  3AVN A;  4M41 A;  3HXM A;  2Y1J A;  5J2Q A;  5I42 A;  3HJF A;  5CY4 A;  3LAK A;  5HBM A;  4OKK A;  3NF9 A;  2KQ2 A;  2YNI A;  3G0Z A;  3NBP A;  1L3T A;  4Z4C A;  4M3Y A;  4O44 A;  2A1R A;  1U4B A;  4LY7 A;  1EXQ A;  4CFB A;  3T19 A;  3HYF A;  3NFA A;  4KO0 A;  1TKD A;  1TKX A;  4EP5 A;  3FFI A;  4E7H A;  3CYM A;  2X6S A;  5HRS A;  1EKE A;  4RW4 A;  3LDS A;  3V9U A;  3BDP A;  4YNQ A;  3SQ0 A;  3V81 A;  2A1S A;  1IKV A;  5C42 A;  2RKI A;  1D5A A;  1W0H A;  3CM6 A;  3QIN A;  5D3G A;  3VQQ A;  1SV5 A;  4BDY A;  3TAE A;  4ELT A;  3IS9 A;  4BDP A;  3ZSO A;  3VQC A;  3H08 A;  3P83 D;  4CJ4 A;  1NK6 A;  3AA5 X;  1NK0 A;  1ITG A;  3TAM A;  2XY7 A;  3SPZ A;  3E01 A;  4CGF A;  1LAV A;  4DU4 A;  3RWU A;  4ZTJ A;  1T7P A;  4N5S A;  3EZ5 A;  2HHW A;  4DTU A;  4MFB A;  4CEO A;  1SL0 A;  4AH9 A;  2QKK A;  3AA3 A;  1SKS A;  4B9M A;  1BQM A;  1HQE A;  4UQG A;  1KCF A;  4Q0B A;  2GUI A;  4PA1 A;  4DU1 A;  1BIU A;  5KTQ A;  1VSK A;  1KRP A;  5E41 A;  2OYQ A;  3MEC A;  5HP1 A;  1Q9X A;  1VSI A;  4FK0 A;  3L3V A;  3HVT A;  1JLB A;  4CER A;  3DYA A;  3L2V A;  4O4G A;  2YKM A;  3QNN A;  4F8R A;  3IRX A;  1WLJ A;  2G8I A;  4FXD A;  1WSH A;  4CJT A;  4C8L A;  3KJV A;  1YVU A;  3WNG A;  2F8T A;  1QE1 A;  4DTP A;  2F96 A;  4E1M A;  3SUQ A;  2X6N A;  3NGY A;  3HO1 A;  2KTQ A;  2E4L A;  1B9F A;  1S9E A;  3AVC A;  4CE9 A;  3OVN A;  1FXX A;  2B4J A;  4DWI A;  1TL1 A;  4KFB A;  4KAZ A;  4FYD A;  5K14 A;  4CHZ A;  1RBV A;  4CF2 A;  1MU2 A;  2X74 A;  3NCI A;  4DS5 A;  1L3V A;  3KK1 A;  1IKY A;  2PYL A;  1HYS A;  3OJU A;  3TAP A;  3V9S A;  3O3H A;  3L3U A;  3DMJ A;  3F9K A;  4AHS A;  1VSJ A;  1IKX A;  2FBX A;  3QNO A;  3PV8 A;  3DRS A;  3BGR A;  3SQ1 A;  4OLB A;  4DQR A;  4CJW A;  3ISN C;  1I3A A;  4Z4G A;  4FJH A;  4E7L A;  3KLE A;  5HLF A;  3OYI A;  1RDC A;  4DTS A;  3WNF A;  3CFP A;  5CYM A;  3AVM A;  1WN7 A;  4IFV A;  3OYC A;  3G10 A;  4KTW A;  3B6P A;  3QEX A;  3I0R A;  2Y1I A;  2BGG A;  2HVH A;  3AVA A;  1QSY A;  4CFD A;  2BE2 A;  4AHV A;  3RR7 A;  4ELU A;  1QQC A;  4CJL A;  3K5M A;  2EHG A;  1BCO A;  3NF7 A;  3LWM A;  1JKH A;  4FCY A;  1WAJ A;  3LZJ A;  4LSN A;  1EX4 A;  3S9H A;  2HMI A;  1B92 A;  1BI4 A;  2XRI A;  3DOK A;  4FJJ A;  2BDP A;  1I39 A;  1ZBU A;  2HHS A;  2HHQ A;  5HRR A;  4Y1D A;  3K59 A;  4E89 A;  3UIQ A;  3M8S A;  4NCB A;  3V1R A;  4DF8 A;  3VQB A;  3AO5 A;  1U49 A;  1LWE A;  4CES A;  2YNG A;  1C1C A;  4W5T A;  3QO9 A;  1JLQ A;  4FJX A;  4KHW A;  4CEQ A;  1RT5 A;  3IG1 A;  4KHY A;  1L3U A;  3HPH A;  3ZT2 A;  4DU3 A;  1D9F A;  1LV5 A;  4DFP A;  3V6D A;  1RBS A;  1HYV A;  3AVJ A;  3OYN A;  1J54 A;  4HTU A;  2OPQ A;  4EZ6 A;  2W42 A;  2AJQ A;  3VQ5 A;  4OLA A;  1B9D A;  3D45 A;  3RRH A;  2IDO A;  4CIE A;  3AO1 A;  1HRH A;  1RTI A;  3AVL A;  4KPY A;  1NJX A;  3VN5 A;  3HP9 A;  3TI0 A;  1FKO A;  1VSE A;  3OS2 A;  4CJE A;  2B5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...