3ZT3A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt3A00
3HPOA 4F3OA 2Z1GA 4CHQA 1QSLA 5SWMA 3AA5X 3UIQA 4M3RA 4HUEA 3RMBA 4FJ8A 3RR7A 4FJHA 4MQ3A 1T8EA 4DTMA 1C0TA 1ZBHA 1WSIA 4FLWA 2P1JA 3AVFA 4B8AB 3ZSZA 4FM2A 1B9FA 3SUNA 4FLZA 4E7HA 3AA4A 3K58A 2FBTA 1IKYA 4MFBA 3PO5A 4DWIA 4KI6A 5T7BA 4LSNA 4B9SA 4F8RA 1QS4A 1HNVA 3OYFA 3OYHA 1O1WA 4RG8A 3PO4A 4DSLA 4DQRA 3VQQA 5CYQA 2HMIA 1BCMA 4CIFA 1ASUA 4OJRA 4HUFA 3HT3A 4E7LA 2ZQBA 1RT3A 1I39A 4AHUA 3TAPA 4XIUA 1N6QA 4DF8A 3DMJA 3HPGA 3OYDA 2YKMA 1JLQA 1RTHA 3K57A 1IKVA 2RPIA 3V9WA 2PYLA 3LANA 4FJGA 4E7KA 3HK2A 3L2WA 4B3OA 1IG9A 4CJPA 1BHLA 4CK1A 3OYNA 4KTQA 4HVJA 1WAJA 5FRNA 3HP9A 4ID5A 5HP1A 3K5LA 1RT6A 4C8MA 1EKEA 4C8KA 1MU2A 4DSIA 3DLBA 3OS1A 4RW9A 1JLAA 4CGGA 1UAXA 4CF2A 4DS4A 1HYZA 2DFEA 2IS3A 2A1SA 2YNHA 1XHXA 4NCGA 4IG3A 4TSXA 4M3XA 3C6TA 3M8RA 2FBYA 3SQ1A 4O4GA 4DG1A 2KQ2A 4H4MA 4FJKA 2VWKA 4DTNA 2OA8A 2G8FA 3QETA 5EU7A 3ITHA 1TK5A 4C8NA 4W5TA 3AVMA 4LH4A 3QIPA 4KV8A 3VQ4A 2DFHA 1VSIA 4B9NA 5KRTA 3ZSWA 1IKXA 4FJMA 1B9DA 3TAFA 3ZSYA 4EP5A 3PX4A 1JXEA 4OKJA 4FXDA 1WSHA 1ASWA 2B6AA 4M45A 2Z1JA 4FVMA 4LD0A 3DLKA 1C0UA 3PY8A 1J9AA 1JL2A 1S1TA 1C6VA 3KD1E 4WE1A 3CG7A 3T19A 4E1MA 3ZSOA 3VA3A 3KKRA 3QESA 3NF9A 4BE2A 5I3UA 2BE2A 5SZTA 1SKWA 4CJEA 3V9SA 1WLJA 3AVCA 1NK4A 4M42A 4CJSA 3VQ8A 1WN7A 3O3GA 1WSFA 1GOCA 3DYAA 3MECA 1U4BA 2E6MA 2HHQA 3OYJA 1D9DA 1RCHA 1LAWA 2YNGA 1BCOA 1CZ9A 1RILA 3O4QA 4GMJB 4DMNA 3SQ0A 3RRGA 4FJJA 4FK2A 4Z4IA 1TK0A 2NUBA 4OKEA 3ZSVA 1D8YA 4CEBA 4DU4A 3AVKA 4OLAA 3IG1A 1JLBA 1RNHA 3L2VA 3F73A 1C0MA 2HHXA 1NJWA 4CK3A 3H08A 2QKBA 2HHUA 5C25A 1U49A 2DTUA 2OZSA 2X6NA 3LALA 3HO1A 4CEOA 4N56A 4DSFA 4KHSA 1VRUA 4G1QA 1RT4A 4N5SA 2KFZA 3KIOA 4KPYA 3QERA 3V6DA 2P5OA 4DLGA 5HRPA 3KLEA 1X9WA 2O4GA 3IAYA 2Z1HA 4CIGA 4KB0A 3O4NA 3MXJA 4JLHA 4DLEA 1UOCA 4KI4A 4AHTA 3NF6A 3MXIA 5KTQA 1T03A 4DTPA 4E19A 1L3VA 5HLFA 4CJWA 3OYEA 3VQAA 4QCLA 2QXFA 4OPKA 3TARA 5CZ1A 5HROA 1TKZA 3NFAA 4CECA 1VSEA 3QINA 4FJ9A 4DS5A 3MEGA 4CJQA 4HCCA 4OLBA 3QIOA 1VSFA 1KVBA 4IKFA 1HQEA 4Z4FA 4IBNA 3WNEA 2PZSA 1L3UA 3DM2A 3ASMA 3AO5A 4CGDA 3HPHA 1ZYQA 1N5YA 1KFSA 4W5NA 4CJFA 3SI6A 2F8TA 4EZ9A 3RMCA 4OGCA 3FFIA 2IC3A 4JRPA 4Z4CA 3NGYA 3BGRA 3KK1A 3EY1A 3VQ5A 4O0IA 1T7PA 2HNZA 4CGFA 4PQUA 2HVIA 1XC9A 3AVIA 2KFNA 3P1GA 1RT1A 5FRMA 1VSLA 5CYMA 3TAEA 3TANA 3ZT0A 2D5RA 1RDBA 1RTJA 3JYTA 3SYZA 4CJLA 1RT2A 2GV9A 3ISNC 2HW3A 1RDCA 3AVLA 4CHPA 4NYFA 4L8RB 5KRSA 1XI1A 1S6QA 1S1XA 3NGIA 1QTMA 1QSSA 4M3WA 2EHGA 3AO2A 3TI0A 4KHYA 3NAEA 4J2EA 3TABA 3O3HA 5C24A 1VRTA 2BDPA 1LWEA 4KO0A 4FK4A 3NF7A 1C1CA 1X9SA 1HYVA 4B8CA 3LAKA 3TAGA 1I3AA 2GUIA 4CF9A 3DLHA 1S9EA 1LW2A 3E01A 3LP0A 1TGOA 3AV9A 1QQCA 2VWJA 4F2SA 4KKOA 4DQPA 2HHTA 4RW8A 3KK3A 4CEQA 5HRNA 1HPZA 1QHTA 3V9ZA 5I42A 3IS9A 5C42A 3VQ7A 4B9TA 2JLEA 3I0RA 4YNQA 3HM9A 4FK0A 3NH1A 3VQDA 3PX6A 4ELVA 4C8OA 4I9LA 4FLUA 4C8LA 4DFPA 1KTQA 2HNYA 4HCBA 1BI4B 4DQSA 5J2PA 3BDPA 4CF1A 2XRIA 3SV3A 2B4JA 4E3SA 3SNNA 2BGGA 2B5JA 3ZCMA 5DK5A 3K5NA 4LH5A 3AVAA 3LP2A 3WNFA 4PWDA 4QAGA 1A5XA 4B9LA 3DRPA 3LZIA 3K59A 3OJSA 4AILC 4IG0A 3LP1A 2VG6A 1BQMA 3L8BA 4DFKA 2A1RA 1GOAA 3HP6A 4FJLA 2Z1IA 3VQ6A 3QNOA 4M41A 2KTQA 3P83D 4ELTA 2D0BA 4DSJA 1WAFA 1U47A 5J2NA 4ELUA 1NOZA 4CJRA 1S5JA 1JLGA 3VQEA 1J5OA 1JXBA 4CEFA 5JS1A 4E7IA 2YNIA 2PY5A 4NYNA 4DTOA 2X74A 1EXQA 3VQCA 4FJ7A 2KW4A 4IDKA 5DMRA 3JSMA 3CQ8A 4DTUA 4DFMA 1LWCA 3U3GA 1RDDA 3TAMA 2ZE2A 3NF8A 4B08A 1DTTA 3SV4A 1Q9YA 5J1EA 4W5QA 3OJUA 3ZSXA 3M8PA 2IDOA 1KVCA 1TL1A 1WSEA 4CJKA 4W5OA 3LPUA 4DF4A 1L3SA 2P5GA 4DQIA 2EX3A 4UQGA 4OVLA 2IAJA 2G8WA 1NK0A 1FXXA 3OYKA 3NBPA 1RBSA 4M3ZA 2X6SA 4CHOA 4O44A 1JL1A 4Z4EA 4DU3A 4O0JA 2QKKA 4FZYA 3L3UA 4ZTFA 4DTRA 3V81A 1TV6A 3RMDA 2Y1JA 1ZBLA 2BANA 3EZ5A 3ZSRA 1T05A 4B9UA 3K5OA 3DLEA 5KGXA 3LZJA 1L3TA 3AA2A 4M3YA 3V1QA 2KZMA 3MEEA 1HRHA 4CEEA 1WSJA 3S9HA 1W0HA 1TKDA 4FZXC 4H8KA 4Z0UA 4CGJA 4JS4A 3ALYA 1J54A 3OVNA 3AO4A 3O3FA 2PYJA 1S6PA 3CYMA 3DLRA 3AVHA 3S3NA 3OYAA 1L5UA 4Q5VA 1S1WA 3MXMA 3HVRA 1DLOA 3F9KA 5KI6A 3CM5A 1BIZA 1ITGA 1FKPA 1ZBUA 3C94A 4IFYA 1IO2A 2OPSA 4CFCA 1BL3A 4CF8A 2ITGA 3KK2A 3SJJA 4CF0A 1K6YA 1BI4A 3ZT3A 3KKSA 2I5JA 3AVNA 3DOLA 3VQPA 4FJ5A 1BISA 1VSMA 3PX0A 3KTQA 1SL2A 3THVA 4K8XA 1Z26A 1WNSA 1IH7A 3NDKA 3I8DA 4BDPA 2DY4A 4FW2A 2X78A 2OPQA 1VSKA 3RMAA 4KAZA 1RT7A 3C95A 3T1AA 1RBUA 2ETJA 4O55A 5HBMA 3AA3A 1C1BA 3PUFA 4QOZB 1X9MA 1DTQA 4BE1A 1QSYA 1JLEA 1GOBA 2D0AA 3V1OA 4JRQA 4F3TA 1BQNA 4CIEA 4I2PA 4DTSA 1SKRA 2HHWA 4FLVA 1RTDA 4OPJA 3L3VA 1Y97A 3IRXA 3I0SA 1LW0A 2HB5A 2G8UA 1TVRA 1YTAA 1S9GA 3S3OA 1QE1A 4GVMA 1C1AA 3DRSA 4ICLA 4CFAA 4PUOA 1IKWA 4EP4A 1TL3A 4ID1A 4CE9A 4HTUA 2XY7A 3SCXA 2E6LA 4NCBA 1REVA 1WSGA 2IGIA 4CJ3A 1TKTA 4E7JA 3LPTA 4CEAA 3QEIA 3CM6A 4BWJA 2GBZA 4JS5A 2VG5A 2ATQA 2YKNA 3VQ9A 2HHSA 4YFUA 3AVBA 1XHZA 4LSLA 3TR8A 2F96A 3QEWA 3U3YA 1NOYA 4KHNA 1ZBFA 1UWBA 5HRSA 4BACA 5J2MA 3QO9A 3QEXA 4CEDA 3KLFA 4CGHA 1JLFA 3OS0A 4ZHRA 4KRFA 5K14A 4F4KA 2HVHA 4B9MA 3OYCA 4DSKA 1RBTA 1ZBIA 4CERA 4AHRA 1Q9XA 4KHQA 2YHBA 3QEVA 3S3MA 3AVGA 3HSTB 1VK0A 4RW4A 4BWMA 2XY5A 2IOCA 1KFDA 1NKCA 4KHWA 4CGIA 3HJFA 1EETA 3NHGA 1S1VA 1RBRA 1LV5A 1KRPA 1SUQA 3DOKA 3CFRA 4FLXA 4E1NA 1D9FA 1BIUA 4CJ5A 2XO7A 1JKHA 5FDLA 1VSDA 5JS2A 4CK2A 4CFBA 4J2BA 2QK9A 2WOMA 1NK6A 4N47A 5FROA 2FBXA 5D3GA 4AHSA 2LSNA 3SQ2A 2E4LA 1HYSA 3CFOA 1NK7A 4FM1A 4FLTA 4B9VA 1KSPA 2AJQA 1KLNA 1NK5A 1SV5A 2F8SA 1NKEA 4IFVA 3HL8A 4R5PA 2G8VA 3SPZA 3RR8A 4AH9A 4CHYA 3KLIA 3G0ZA 4EZ6A 1KVAA 3HYFA 4CEZA 3K2PA 3VQBA 4KTZA 4CESA 5E41A 3LAMA 4AHVA 4KFBA 1YT3A 2VG7A 2YV0X 4GW6A 4DQQA 3SUPA 2XY6A 1CXQA 1Q8IA 5CZ2A 4BE0A 3ZSQA 1KLMA 2G8IA 2P51A 3NH2A 3SQ4A 3NE6A 5J2QA 4CHNA 4FLYA 3A2FA 1JLCA 3VN5A 3HVTA 3L2QA 1LWFA 3OYBA 2W42A 5HRRA 4KTWA 1A5WA 2Q3SA 4N76A 4NCAA 1TKXA 1YVUA 1YTUA 1S1UA 3M8QA 4FM0A 3DLGA 1XWLA 4E89A 2OPRA 4HHTA 2XHBA 4FJIA 1X1PA 1RT5A 3TAQA 3QNNA 1UA1A 4J2DA 3C6UA 3L2RA 4DFJA 4K8ZA 1TAQA 3KLGA 1F21A 3D45A 3P5JA 3MEDA 2G8KA 3AVJA 3KD5E 1EP4A 3LWMA 3CFPA 4Y1CA 1NJYA 3L2UA 4DTXA 3V9XA 2DFFA 4RW7A 1CXUA 4AHCA 2WONA 3LDSA 4CHZA 5CY4A 2YHAA 3ULDA 3PV8A 3ZT4A 3ZT2A 3SUQA 1UA0A 4HUGA 1SKSA 1KCFA 4I2QA 4FYDA 1U48A 3RWUA 4N41A 3AO1A 3RTVA 3WNHA 3OYIA 1B92A 4E0DA 3DI6A 2KZZA 3KLHA 4Z4GA 3K5MA 4ZTJA 3NCIA 1CLQA 4BDZA 3QLHA 3TWHA 3ZT1A 1SL0A 3VA0A 1RBVA 2HHVA 5KGWA 3NGZA 2R7YA 2JGUA 3LWLA 4PA1A 1W9HA 3OYGA 1BGXT 1HNIA 2D0CA 2FBVA 4RW6A 3U6FA 4FJXA 3V1RA 1G15A 4CJUA 3OS2A 3D0PA 1EX4A 3KJVA 2OPPA 3LP3A 3T3FA 1RTIA 1HJRA 1NJZA 1TK8A 1NJXA 1VSJA 4M3UA 4BDYA 1HQUA 1D5AA 3M8SA 1HMVA 3EYZA 4KHUA 3SPYA 4DU1A 4KREA 1SL1A 1U04A 3OYLA 3RRHA 4LY7A 1ASVA 1NK9A 4F2RA 4Q0BA 2O4IA 2RF2A 4DSEA 4PY5A 4DTJA 4I9QA 3V4IA 1A5VA 2YNFA 3QEPA 2XY8A 3WNGA 3DRRA 4I7FA 4Y1DA 3B6PA 4OGEA 4CJTA 4CFDA 3OYMA 3NH0A 2G8HA 4O5BA 3SUOA 3AO3A 1LAVA 1U45A 3V9UA 1J53A 2RKIA 4Z4HA 1NK8A 3OY9A 4H4OA 3B6OA 3MAQA 1RDAA 2FC0A 1TAUA 4OKKA 4CCHA 4CJVA 4FJNA 4FZZA 1FKOA 2ZD1A 4CJ4A 3HXMA 4J2AA 4FW1A 3SZ2A 4W5RA 2OZMA 1R0AA 2OYQA 4M3TA 2RN2A 3G10A 1VSHA 2Y1IA 4KB1A 4FCYA 1NKBA 1Z25A 2HNDA 1FK9A 1CZBA
chains in the Genus database with same CATH superfamily
3HPOA 4BG9A 4CZEA 3WQTA 1Q86O 4HUEA 3CCQN 1C0GA 3RMBA 4DTMA 1C0TA 4DR3K 5TKYA 3AVFA 3CC2N 4X64K 4B1VA 4ISFA 4BRFA 1B9FA 2A41A 4FLZA 4E7HA 2FBTA 4MFBA 2BTFA 3PO5A 5IWAK 4KI6A 5T7BA 3OYHA 3MK6A 4DQRA 3VQQA 1BCMA 4CIFA 4OJRA 1RT3A 2O8EB 2YKMA 2PYLA 3V9WA 1IKVA 4IZ9A 3LANA 4E7KA 1ZBSA 3D2FA 4NXMK 1TYQA 4U7BA 4CK1A 5M1FA 4CZMA 1EWRA 1RGIA 1EKEA 1MU2A 1GLJO 2IS3A 4TSXA 4M3XA 3C6TA 2FBYA 1VQPN 4CVNE 3SQ1A 4JI8K 5C2DA 2KQ2A 2VWKA 5LJWA 1YJWN 3QETA 2Q31A 1TK5A 3GBTA 4C8NA 2O8CA 4JKFA 5KQDA 3VQ4A 3ZSWA 1B9DA 1C0FA 1HJOA 4FXDA 4M45A 4FVMA 3PY8A 1JL2A 2PAVA 3H1QA 1S1TA 3TU5A 4R79A 5EX5A 1U6ZA 3CG7A 5BRDA 2O8BB 4M63C 3VA3A 1QQMA 2VWBA 3QESA 5AFUH 1SKWA 1WLJA 1NGCA 2IIRA 3VQ8A 1GOCA 3SMPA 1RCHA 4DQIA 1RILA 4FJJA 3G25A 4HTLA 4A2BA 2QI2A 4CEBA 4RWTA 3AVKA 2BH1A 3E1YA 1RNHA 3L2VA 4JV5K 3O9UA 4DUYK 2HHUA 3HO1A 2KFZA 1RT4A 4M7XA 1SAZA 3LM9A 3V6DA 4EFHA 5HRPA 4EIAA 4PHTX 3HSCA 4YDUA 4JLHA 3MXJA 4DLEA 1UOCA 4KI4A 1BA1A 4JHDB 3NF6A 4LFBK 5KTQA 4BY9C 3HTVA 4BC5A 4CJWA 4OPKA 5HROA 4JN4A 1VSEA 3JS6A 4DR2K 3LDLA 3MEGA 1V4SA 1KAXA 3QIOA 1KVBA 3THXA 1N5YA 4W5NA 4NO7A 1OH7A 3QFUA 5JVGL 3RMCA 3FFIA 3BGRA 4CGFA 1QQOA 3AVIA 1RT1A 5FRMA 3TAEA 3ZT0A 1RTJA 4CJLA 1QVGM 3FZLA 4LF6K 2GV9A 4IO9L 3AVLA 4CHPA 3LM2A 1QSSA 5FPNA 3J7ZO 1QTMA 3E9LA 5C24A 2BDPA 2VGNA 3ATVA 3NF7A 4H0VB 5JICA 1HYVA 4B8CA 3TAGA 2F9WA 1M90O 3PIOL 4YHHK 3M5RA 3VETA 2VYPA 2VWJA 4KKOA 3CJBA 3KK3A 1XC3A 1HPZA 1QHTA 5C42A 2JLEA 4BR5A 5AZJA 4C8OA 3HI0A 4DFPA 4H0XB 4CF1A 3ENOA 2QWLA 4JEPA 2QWOA 4WQ5A 3LP2A 4JKCA 4B9LA 3DRPA 3LZIA 3DLLL 3L8BA 3HP6A 1NGBA 3CERA 1IV0A 3A5MC 4CBXA 4ELTA 2D0BA 3ATUA 4JAXA 4ELUA 4JNEA 3O5BA 4JKGB 4BQZA 5F0XA 5JS1A 2PY5A 1GLDG 4NYNA 1QZ6A 4PKIA 3O08A 4DTOA 1EXQA 4FJ7A 4DTUA 4DFMA 4FWMA 3QBXA 2D0PA 5AQOA 3WXMB 3TAMA 3NF8A 4DR6K 3BF3A 1SZ2A 4B1XB 3ZSXA 5AJ3K 3M8PA 1HKGA 4H0PA 4G9ZA 1L3SA 2E2OA 2EX3A 3OYKA 1RBSA 1IJJA 4WFNL 4O0JA 2QKKA 4FZYA 4JI4K 2P9LB 4IOCL 1Y64A 5AQZA 1NGIA 3B8AX 4QS7A 1EWQA 3AA2A 2WBNA 1NGGA 3PIPL 4FZXC 4H8KA 4Z0UA 2Q1NA 1J54A 3ALYA 3OVNA 3UKRB 1S6PA 2O8EA 1S1WA 3MXMA 3HVRA 5KI6A 1HNXK 1T3VA 1ITGA 3A5NC 1FKPA 4CFCA 3SJJA 3LDQA 2ITGA 1DEJA 4CF0A 1JCFA 3KKSA 5BN9A 3VQPA 2NRWA 1YITN 3EKSA 3CIPA 3O6WA 4KBOA 4K8XA 1WNSA 1KQSM 4DCHA 4CZJA 3C95A 3VEWA 3L0QA 1S22A 3WT0A 4IWVA 4QOZB 1X9MA 1GOBA 2P9PB 4JRQA 2ZJPL 2HHWA 3G4SN 4K42A 1RTDA 3GL1A 4MDAA 1Y97A 2HB5A 1Q82O 4YORA 3S3OA 1YUWA 2CH6A 4GVMA 4BRKA 1SS6A 4PUOA 2O8BA 4HTUA 1XQSC 1HNZK 2IGIA 3QMLA 4O8KA 1N36K 4GV6A 3QEIA 4JS5A 4JI1K 2ATQA 2YKNA 3C6AA 4U67L 3H3OB 4DR7K 3AVBA 1XHZA 4LSLA 3QEWA 1UWBA 4BACA 4CEDA 5BR9A 1BDGA 1YVNA 3M3ZA 5K14A 4BRNA 2HVHA 4B9MA 1RBTA 3AGKA 1ZBIA 5AQQA 2YHBA 1X3NA 3AVGA 2P9NB 3HJFA 2IOCA 1GLAG 1E3MA 1RDUA 2NRXA 3QICA 3CFRA 5CR4A 4JHDA 5FDLA 3U9ZA 4CFBA 5JS2A 4CZHA 2NRTA 5C2FA 3DJCA 3SQ2A 2P9UB 2PBDA 1NK7A 2VQFK 4FM1A 1KSPA 4PKGA 1BA0A 4KHQA 5EY4A 3KLIA 1KD1O 4KTZA 5E41A 3E9PA 3CCRN 2VG7A 4DQQA 1CXQA 1Q8IA 3ZSQA 1KLMA 4BGBA 1EO1A 2GEMA 3NE6A 3HVTA 3L2QA 3THYB 1LWFA 3C6HA 2W42A 4NCAA 3CXCM 4JI6K 5KPTA 1XWLA 4E89A 4FJIA 1O13A 3TAQA 3QNNA 1DGKN 3VEZA 2WC9A 3MEDA 3LWMA 3IDHA 4CBWA 3L2UA 5KQ8A 4EAHD 4AHCA 3S41A 3SUQA 4FYDA 3CCSN 1U48A 3T1YK 3RTVA 3WNHA 3OYIA 2NRZA 2E2NA 4BDZA 3QLHA 4Y0WA 5AQKA 3ZT1A 3TWHA 2JGUA 4PA1A 2RHKA 3A5LC 4RW6A 3U6FA 2A6AA 4FJXA 4EHUA 3D0PA 2WTUA 1TK8A 1VSJA 4WQ4A 3HOSA 3HRGA 4BDYA 1HMVA 4DU1A 4E1JA 4KREA 4F2RA 1U04A 4LY7A 5AR0A 4FO0A 3MN5A 1HLUA 4IFEA 3E66A 2I7NA 4Y1DA 4I7FA 4JKGA 3NH0A 1NGEA 4B3TK 1XNQK 1NK8A 4L3QA 3OY9A 1R59O 2FC0A 3CCJN 4OKKA 4CCHA 3W0LA 4A5BA 4FJNA 4J2AA 4FW1A 3SZ2A 4W5RA 3FR0A 1W7AA 2OYQA 3ZX3A 2Y1IA 4KB1A 4FCYA 1FK9A 1CZBA 4FWQA 2D0OA 3AAPA 5SWMA 4FJHA 1ZBHA 1WSIA 4FLWA 3U8XA 2P1JA 4JKDA 4RTFD 2P9LA 5BPNA 4JD2B 1IKYA 5M1NA 4B9SA 2V51B 1HNVA 5ELZA 4RG8A 3TTDA 3PO4A 3UKRA 5CYQA 3G6EN 4E7LA 3DMJA 2E5LK 1RTHA 3K57A 2RPIA 4FJGA 4B3OA 5FPDA 5FRNA 4ID5A 1RT6A 2UUCK 1GLCG 5BR8K 4XH1A 4RW9A 4CF2A 1UAXA 5LJVA 1XHXA 3CCEN 4IG3A 1ATRA 3DXMB 4DG1A 4H4MA 2GUPA 4DTNA 2G8FA 1ZC6A 4LF5K 3IKMA 1NLVA 3CPWM 4PL8A 3ITHA 5EVZA 3ZX2A 4W5TA 2P9PA 1QZ5A 2DFHA 1VSIA 2QWMA 4B9NA 5AQPA 4ILJA 1QVFM 3ZSYA 2QXLA 3PX4A 2B6AA 3DLKA 5FPMA 2HBJA 1C6VA 3KD1E 3LDOA 1T6CA 3NF9A 3SMSA 2BE2A 5SZTA 2HBLA 4DHYA 3AVCA 3SBTA 1WN7A 1WSFA 4YOUA 1D9DA 1LAWA 2YNGA 4IJAA 3SQ0A 3PSFA 1TK0A 1D8YA 4OKEA 3ZSVA 4LF7K 4DU4A 3IG1A 3F73A 1C0MA 4CK3A 4LF8K 5C25A 2H3GX 4DSFA 2P9NA 4JI3K 3BZCA 4KPYA 3QERA 3MCAB 2P5OA 4DLGA 2O4GA 4H5WA 1GLLO 3OW2M 4AHTA 4DTPA 2P9UA 1L3VA 3WQUA 3OYEA 2QXFA 3TARA 5CZ1A 3CJ7A 5JMVA 2QTDA 1CZAN 4Z4FA 3GDQA 4IBNA 3WNEA 3KWGA 3DM2A 3ASMA 3AO5A 1ZYQA 3SI6A 2F8TA 4Z4CA 5M1OA 2P9IB 3THYA 3VQ5A 2HVIA 3TANA 1RDBA 2YHXA 2HW3A 4NYFA 1S6QA 3TI0A 3NAEA 3TABA 5BREA 3VENA 1NG9A 1LWEA 2HHHK 3OTOK 1C1CA 1X9SA 3IUCA 3LAKA 4JKEA 4GNIA 5F1XA 3DLHA 2YCHA 3E01A 1LW2A 4YOYA 1RDWX 1W97L 3AV9A 1XMOK 4DQPA 3FFKB 3H45C 4RW8A 2HHTA 2KLAA 4CEQA 1NWKA 1IBMK 3IS9A 4YNQA 4DV5K 3VQDA 3PX6A 1Z6RA 1U2VB 3KVGA 5GAEP 2HF3A 1KTQA 4WQ4C 4DQSA 2XRIA 3J8AA 3SNNA 4YOVA 3K5NA 2UYTA 3AVAA 3WNFA 4I6MB 4PWDA 3DWLA 4QAGA 3K59A 3LP1A 2A1RA 4PKHA 3VQ6A 4IEIA 4M41A 1H1VA 1P8ZA 2UXBK 1WAFA 1K8AO 1NOZA 3WXKA 3VQEA 1J5OA 3O9RA 3MWTA 2VQEK 2YNIA 3CQXA 1WOQA 5EOYA 4CZIA 4B1ZA 1LWCA 3U3GA 1RDDA 1NGJA 2ZE2A 4BRLA 1KAYA 4W5QA 4BRPA 1TL1A 1WSEA 3O4WA 2P5GA 4UQGA 4OVLA 2NRHA 5AQUA 1NK0A 2G8WA 4UY8O 2X6SA 1NMNA 3C0BA 4Z4EA 4JD2A 4FPBA 5M1PA 4K41A 2Y1JA 4BR0A 2BANA 4CD3A 3EZ5A 4B9UA 3I33A 1MWKA 2CH5A 3LZJA 4M3YA 3V1QA 2KZMA 3S9HA 1TKDA 1Q81O 3D7EO 4FOEA 4CGJA 3MN7A 4BRGA 3DLRA 3S3NA 3VGKA 3OYAA 1L5UA 3BF1A 2YI1A 3C94A 4IFYA 1RFQA 1IO2A 4NLBA 2OA8A 1BL3A 2RE2A 3KK2A 4B3MK 1K6YA 1BI4A 2ZGYA 4AF1A 3ZT3A 3AVNA 5C12A 3PX0A 1VSMA 3THVA 1HX1A 1Z26A 3T69A 1IH7A 4FVUA 3DXMA 1GLBG 5C0YA 3NDKA 3I8DA 4BDPA 2DY4A 4FW2A 2X78A 3L6QA 3RMAA 3JAMO 4KAZA 4F9OA 1RBUA 4O55A 5HBMA 3R6MA 3DAWA 2GX9A 5GINA 1DTQA 2W41A 3OHRA 3EL2A 4JK7A 1JLEA 4BGAA 2D0AA 1T44A 2HOEA 3FZHA 2OANA 4CIEA 4I2PA 2FSNA 4FLVA 3IRXA 2G8UA 4NLCA 1S9GA 3CD6N 1QE1A 4H0TB 1C1AA 2XY7A 3SCXA 3BZKA 4NCBA 1REVA 1WSGA 4E7JA 3LPTA 3VQ9A 2HHSA 4LFAK 4XEIA 3CF5L 3U3YA 2OCEA 3SJHA 4KHPK 1VQNN 4CGHA 2NRRA 4H5TA 3AY9A 1ATNA 4KRFA 4F4KA 3P31A 2NZTA 3OYCA 3BUZB 2CGLA 1Q9XA 4FWRA 3HSTB 4RW4A 4BWMA 1NKCA 1KFDA 3KHYA 4FLXA 3CQYA 1IBKK 1DKGD 3H1VX 4CK2A 1J6ZA 3J81O 1HPMA 2FBXA 4GV3A 2O8DB 3G71N 4OO1J 3F5TA 1NK5A 1SV5A 1J5EK 1NKEA 2G8VA 3HL8A 3QDKA 4F3TA 3SPZA 3HYFA 4CEZA 1VQ8N 3K2PA 4BR7A 4AHVA 1YT3A 4GW6A 3SUPA 5CZ2A 4OX9K 4BE0A 2P9IA 3NH2A 3CMAN 4QS8A 5J2QA 4ILGB 4CHNA 1WB9A 3A2FA 1JLCA 4A61A 2W6LA 3UE5A 3OYBA 2Q36A 5HRRA 3IMXA 1VQ6N 2Q0RA 5LMNK 1RT5A 3VGMA 4DFJA 3N4QA 2G8KA 3AVJA 4DTXA 2V7ZA 1CXUA 4JK9A 2WONA 3VEOA 4CHZA 2W40A 3TSPA 3ULDA 5M1KA 3ZT4A 3ZT2A 2GTDA 3PV8A 1UA0A 3KK7A 1WBDA 3ENBA 3LL3A 1B92A 3DI6A 3K5MA 3NCIA 2V7YA 1SL0A 1U2VA 2R7YA 3RSEB 1W9HA 1GLFO 3SLCA 3OYGA 2D0CA 2FBVA 1G15A 4DV4K 3OS2A 4FWNA 5AQMA 1EX4A 3KJVA 3T3FA 1NJZA 1NJXA 4JI2K 4I6MA 1HQUA 3M8SA 3E9OA 2FSJA 1SL1A 3RRHA 4Q0BA 4I9QA 3V4IA 3QEPA 2ASPA 3WNGA 4OGEA 4CFDA 3QFPA 2E8AA 4O5BA 3AO3A 3CMEN 1J53A 5AQFA 4Z4HA 3NMUA 3MAQA 1TAUA 4FZZA 1FKOA 4BG8A 4JKBA 4M3TA 1VSHA 3TPQA 4F3OA 2Z1GA 2AA4A 3P4IA 2ZJQL 3RR7A 4MQ3A 3ZX0A 1VQ4N 2KHOA 2WUSA 3SK3A 3ZSZA 4LFCK 4FM2A 5KPRA 2UU9K 4CJ7A 4DV0K 1NJIO 3AA4A 3K58A 3A5OC 2QWNA 4DWIA 4LSNA 4F8RA 1QS4A 4GY2B 3OYFA 1O1WA 4BC4A 4DQ8A 4YDUC 3I8BA 2HMIA 1TUYA 2A40A 5AFUA 5JVHL 4GKJK 1I39A 5IT9O 3TAPA 4XIUA 2GELA 5AZIB 1N6QA 4DF8A 3HPGA 3OYDA 4MLEA 4BR9A 3HK2A 4KH4A 3L2WA 4O8UA 3OYNA 3EZWA 4HVJA 1WAJA 3HP9A 3K5LA 2WFBA 4DSIA 3OS1A 4CGGA 4DS4A 1VQ7N 1HYZA 4JI7K 2A1SA 2YNHA 1QQNA 1HKBA 2O8FB 3NVMA 4IOAL 2YHWA 5BRHA 3MN6A 3AVMA 2QW9A 4FJMA 1IKXA 3VOVA 2ZGZA 1N32K 1Q18A 3TAFA 1BUPA 1JXEA 4OKJA 3CCUN 2BUPA 1WSHA 1ASWA 5AQHA 3ZEUB 1J9AA 3PSIA 3THWB 2GWJA 3T19A 4E1MA 2ASMA 3ZSOA 3F9MA 5GIOA 5I3UA 1JJ2M 4DUZK 3O9QA 4CJSA 3O3GA 3DYAA 1U4BA 2E6MA 3D2EB 3OYJA 1BCOA 3RRGA 4DMNA 4Z4IA 3K9KA 4FWOA 2NUBA 3J7AP 4OLAA 2ZJRL 1MWMA 1JLBA 2V52B 2HHXA 1BWFO 1NJWA 3H08A 1KAZA 3FZFA 4Z94A 4N56A 4WQ5C 4KHSA 4G1QA 4N5SA 1DT9A 3LDPA 4H03B 2UUAK 5FPEA 1X9WA 3MN9A 2Z1HA 3FGUA 4YOXA 4KB0A 3O4NA 2O8DA 1NM1A 1T03A 4BREA 3T1HK 3C65A 3VQAA 3BEXA 1NNEA 1VSFA 4BRQA 4BR4A 1KFSA 4EZ9A 5AQJA 3EN9A 4OGCA 2IC3A 3ID8A 3D6RA 3KK1A 3EY1A 4O0IA 3C7NB 4PQUA 1XC9A 2KFNA 3P1GA 3MCPA 1VSLA 3Q7CA 1OVYA 1RT2A 5KRSA 2CGJA 1S1XA 4CI6A 4M3WA 4J2EA 3QB0A 2VCPA 3CHWA 1VQON 1OH5A 5LY3A 2NLXA 2GUIA 1KXPA 3VGLA 1BU6O 1NGFA 3H6EA 4H0OA 1QQCA 4F2SA 5BPLA 2E20A 5C10A 3V9ZA 5I42A 5EXWA 3I0RA 3HM9A 2PFUA 4B9TA 3RSEA 4FK0A 4FSVA 3MDQA 2HSTA 4FLUA 4C8LA 4AM7A 2NRVA 1BI4B 5J2PA 3BDPA 3SAGA 2BGGA 5FLXO 4FWKA 5TKWA 3ZCMA 2KKZA 4BRDA 1BO5O 4YOTA 4AILC 1NBWA 4B1WB 1BQMA 4DFKA 3O9SA 3TTFA 3CI5A 2KTQA 3P83D 4DB3A 2F7TA 5AQTA 1S5JA 2GWKA 1JLGA 1JXBA 2ZWHA 4DV6K 1YIJN 4JKHA 4CZGA 5AQNA 2X74A 2KW4A 2P9KB 1ZXOA 4IDKA 3JSMA 2A42A 4WFAL 4GVEA 4X62K 3VTIA 3SV4A 4C1NI 5J1EA 3OJUA 4DV3K 1KVCA 4CJKA 3R3LA 5KPZA 3TSQA 2IAJA 1FXXA 3NBPA 4M3ZA 4CHOA 1JL1A 4DU3A 3EE8A 3L4IA 4DTRA 1YF5L 2I7PA 1TV6A 3RMDA 3F2KA 4FL9A 3ZSRA 3DLEA 1L3TA 3MEEA 1HRHA 4CEEA 1WSJA 1W0HA 4NXNK 1HR0K 4JS4A 1OH8A 2PYJA 3CYMA 5AZIA 1VQLN 3CJ9A 4B3RK 3HOTA 1DLOA 1YAGA 1BIZA 2IVOA 2OTJN 3VF2A 3AARA 2OPSA 2I5JA 2FXUA 5GADP 3OA9A 4FJ5A 3KTQA 3WXLA 3U4LA 3CJCA 3MMVA 2O8FA 5ADXA 2ETJA 3AA3A 3PUFA 5AQYA 4BVOA 4BE1A 1LCUA 3VERA 3V1OA 4DTSA 5DM7L 1YXQA 4OPJA 3I0SA 1LW0A 1YTAA 3MX2A 3ZEUA 3THWA 4BQLA 3DRSA 2FF6A 3ENHA 4ILHA 1IKWA 4ICLA 4CFAA 4EP4A 4CE9A 2E6LA 4CJ3A 4BRAA 1TKTA 5AQGA 3CM6A 2VG5A 3D2EA 4DV2K 1NOYA 5J2MA 4DR5K 3J7YP 3O1WA 4DSKA 4A5AA 3JXUA 3CJAA 4CERA 4FWPA 3QEVA 4WYBA 1VK0A 3MWPA 2XY5A 4BVPA 2QM1A 1VHXA 5AQLA 1EETA 3NHGA 1S1VA 4K0KK 1KRPA 1SUQA 3DOKA 3EEQA 1D9FA 1BIUA 1Z05A 4CJ5A 4J2BA 2QK9A 1XMQK 2WOMA 4N47A 5FROA 3ULEB 5D3GA 5HOOA 2LSNA 2E4LA 4DR1K 1HYSA 3CFOA 4FLTA 3CCLN 3RR8A 4IFVA 4R5PA 2QWPA 4KH5A 4AH9A 4EZ6A 3G0ZA 5JLFA 1KVAA 2F4VK 4CESA 1OVQA 3LAMA 3LDNA 4BRCA 2OTLN 4V19S 2XY6A 2P51A 3DXKB 3C7NA 4FLYA 3VN5A 1JCGA 5GAHP 5LL6Z 1TKXA 1YVUA 2VGMA 4FM0A 3DLGA 4H5VA 1FJGK 1W2BM 3C6UA 3L2RA 4K8ZA 1TAQA 3KLGA 3D45A 3EE9A 3CFPA 4Y1CA 1NJYA 5I9EB 3PLAA 3V9XA 4RW7A 2YHAA 1SKSA 4BC3A 3K0SA 4HUGA 1KCFA 4YOWA 2KZZA 4E0DA 3WXJA 4X66K 4ISGA 2D1KA 3L4QA 3VA0A 1RBVA 5KGWA 3ZETB 4BRHA 3CETA 1HNIA 2HBKA 3MX5A 3R1XA 3V1RA 4DV7K 1QHAA 2E2PA 3KZBA 3LP3A 3K9JA 1RTIA 1VQMN 1HJRA 1MA9B 5CHIA 4B1YB 3EYZA 3SPYA 2O4IA 2A3ZA 1NK9A 3H46O 2A5XA 2F9TA 2RF2A 4DSEA 1A5VA 3DRRA 3OYMA 3AGRA 3B6PA 3OBWA 4CJTA 3W3DA 1I94K 2QWQA 2G8HA 1K73O 1GLEG 3SUOA 3EKUA 1YI2N 1U45A 2RKIA 4H4OA 2E88A 2P9KA 4B9QA 2YX6A 4CJ4A 2EWSA 2HMPA 5AQXA 2OZMA 3FLCO 2RN2A 3G10A 1NKBA 2HNDA 2W6KA 2IVPA 4CHQA 1QSLA 2YJEA 4DR4K 3AA5X 3UIQA 4M3RA 2NNWA 4FJ8A 1T8EA 4O5FA 1WBBA 4B8AB 4MLHA 1IG8A 1HUXA 3SUNA 1VQKN 3ZLJA 1SQKA 1N8RO 3P39A 2E2QA 3RVCA 5AQIA 4DSLA 2IVNA 1ASUA 4HUFA 3HT3A 2ZQBA 4AHUA 5F2RA 5CE3A 4WCEL 3BP8A 1JLQA 1IG9A 4CJPA 1BHLA 4KTQA 4JKAA 3GE1A 5HP1A 4MDBA 4C8MA 3GOIA 4C8KA 3DLBA 4DV1K 1JLAA 4JYAK 2DFEA 4OPAA 5B8HA 4NCGA 3M8RA 4IXCA 3CCMN 5E84A 4O4GA 4FJKA 3T7ZA 4H5NA 5EU7A 1P90A 2D4WA 4LH4A 3QIPA 4KV8A 4X65K 5KRTA 4FWSA 4XH5A 4EP5A 2Z1JA 4LD0A 3VMFB 1C0UA 3FE1A 1NU0A 4WE1A 3KKRA 3WEEB 4BE2A 3O80A 4CJEA 3V9SA 3EO3A 1NK4A 4M42A 3UKUB 3R9PA 3MECA 2HHQA 3O9TA 3O4QA 4GMJB 1CZ9A 4FK2A 3I55N 1YHQN 2QWRA 1BOTO 1EQYA 2QKBA 1YJNN 1U49A 2DTUA 2OZSA 2X6NA 3LALA 4CEOA 4QS9A 1VRUA 4LC9B 4IEEA 3KIOA 4M7YA 5A2QO 3VPZA 3KLEA 1K9MO 3IAYA 4CIGA 1NGDA 3VEVA 3ULEA 4IOXA 4IDHA 5AQRA 3MXIA 4E19A 5HLFA 4QCLA 3I56N 1NGHA 1TKZA 3NFAA 4CECA 3QINA 4FJ9A 4DS5A 1FW6A 4CJQA 4HCCA 4OLBA 1N33K 4IKFA 1HQEA 2PZSA 1L3UA 3SAFA 4CGDA 3HPHA 4CJFA 1T6DA 3DXKA 4JRPA 3NGYA 4CD1A 4FPAA 4FWLA 1T7PA 3CJ1A 2HNZA 2UXCK 1VQ5N 5CYMA 2D5RA 3JYTA 3SYZA 2FLOA 3ISNC 1RDCA 4L8RB 1XI1A 3NGIA 4KHYA 2EHGA 3AO2A 3HZ6A 2E1YA 3AAQA 2E1ZA 3O3HA 2ITMA 1VRTA 4MO4A 4FK4A 4KO0A 1I3AA 3O1BA 4CF9A 5M1QA 3A8YA 1S9EA 3FZKA 4IO8A 3LP0A 4BROA 1TGOA 3M1FA 5HRNA 5AQVA 3TSUA 4JK8A 3VESA 2ZF5O 3VQ7A 3ZETA 2YHYA 2FF3B 2QA4N 4CZFA 3NH1A 4ELVA 4I9LA 2HNYA 2Q0UA 3TTCA 3J80O 4HCBA 1X3MA 3SV3A 4E3SA 2B4JA 5ADXH 2B5JA 5DK5A 4LH5A 2P9SB 1K8KB 1A5XA 4CW7B 3OJSA 4EHTA 4IG0A 2VG6A 1GOAA 4FJLA 2Z1IA 3CC7N 3QNOA 4DSJA 3VEXA 5MLCQ 1U47A 5J2NA 4XH4A 4CJRA 4CEFA 4E7IA 1KC8O 3VQCA 2AP1A 4CBUA 3CQ8A 1M1KO 4YY3K 4K25A 4LF4K 4B08A 1DTTA 1Q9YA 2IDOA 2FSKA 4C23A 4W5OA 2Q2RA 3LPUA 4DF4A 1XNRK 3A0IX 4GV9A 5BRFA 3VF6A 4O44A 1HNWK 3L3UA 2HBMA 4ZTFA 3BY5A 3SBGA 3V81A 1ZBLA 1T05A 3K5OA 5KGXA 5E26A 5AQSA 3UB5A 2ZM6K 3R8EA 3AO4A 5DM6L 3O3FA 3AVHA 4Q5VA 1E4FT 3F9KA 3CM5A 1BG3A 3FZMA 1ZBUA 3D2FB 1TUUA 1TYQB 5H1SQ 1WUAA 4CF8A 4FOIA 2J4RA 2CGKA 3ID6A 3SAHA 3DOLA 4H5RA 4JI0K 2UUBK 4GKKK 1BISA 3VEYA 4KH6A 1SL2A 4H0YB 5HL7L 4AQYK 3U9DA 2OPQA 1VSKA 2JWLA 1OH6A 1RT7A 1E4GT 3T1AA 4BR2A 1MDUB 4BRMA 1C1BA 1QSYA 2QEXN 2O8CB 4WF9L 1BQNA 1SKRA 3L3VA 5LMUK 1TVRA 4WFBL 4C1NK 3NVKA 4BRIA 1TL3A 4ID1A 1XUPO 3WEEA 1Q7YO 1OKJA 3GG4A 4B1UB 4MO5A 1V4TA 2DPNA 3UKUA 4CEAA 4BWJA 2GBZA 1JCEA 3O8MA 4YFUA 4A2AA 3TR8A 2F96A 4KHNA 3CC4N 1ZBFA 5HRSA 4CZKA 3QO9A 3QEXA 3KLFA 5GIPA 1JLFA 3OS0A 4ZHRA 2UXDK 1YJ9N 4AHRA 1ESVA 4A62A 3S3MA 4KHWA 4CGIA 1RBRA 1LV5A 4E1NA 3KWIA 2XO7A 1JKHA 1VSDA 4A59A 1NK6A 4AHSA 3ZYYX 3Q7BA 4B9VA 4BC2A 4A57A 2AJQA 1KLNA 2F8SA 4CHYA 3THXB 3VQBA 2JWKA 4KFBA 1S72N 2YV0X 2G8IA 3QBWA 3SQ4A 3H3NO 3HM8A 4KTWA 1A5WA 2Q3SA 4N76A 2YJFA 1G99A 1YTUA 1S1UA 3M8QA 3WUHA 1HKCA 4JI5K 2OPRA 4HHTA 2XHBA 1X1PA 3HBTA 3CPEA 4NB4A 1UA1A 4J2DA 3OBYA 1F21A 4CZLA 3P5JA 3KD5E 3M6GA 1EP4A 2DFFA 3LDSA 1ATSA 4PL7A 5CY4A 3VTHA 1S3XA 1ILYA 5C15A 4I2QA 4HWIA 2ASOA 3RWUA 3IFRA 4N41A 4LF9K 3AO1A 3KLHA 4Z4GA 2Q97A 4ZTJA 1IBLK 1CLQA 3VF4A 3CCVN 2HHVA 2HF4A 1VQ9N 4RCHA 4AM6A 3NGZA 5AZJB 3LWLA 4K43A 1N34K 1BGXT 1X9JA 4CJUA 4J8FA 5BPMA 2OPPA 5GAGP 4M3UA 4ISEA 2P9SA 1K8KA 1D5AA 4KHUA 3OYLA 1ASVA 4OPHA 4B3SK 4PY5A 3WXIA 4DTJA 1NMDA 2YNFA 5JLHA 4IJNA 2XY8A 1NGAA 5BN8A 1D4XA 3P38A 1LAVA 3V9UA 4DKWA 3B6OA 1LOTB 1RDAA 4CJVA 1VAZA 2ZD1A 3N4PA 3HXMA 1R0AA 5AQWA 1Z25A 5DMRA
chains in the Genus database with same CATH topology
3HPOA 4F3OA 2Z1GA 4CHQA 1QSLA 5SWMA 3AA5X 3UIQA 4M3RA 4HUEA 3RMBA 4FJ8A 3RR7A 4FJHA 4MQ3A 1T8EA 4DTMA 1C0TA 1ZBHA 1WSIA 4FLWA 2P1JA 3AVFA 4B8AB 3ZSZA 4FM2A 1B9FA 3SUNA 4FLZA 4E7HA 3AA4A 3K58A 2FBTA 1IKYA 4MFBA 3PO5A 4DWIA 4KI6A 5T7BA 4LSNA 4B9SA 4F8RA 1QS4A 1HNVA 3OYFA 3OYHA 1O1WA 4RG8A 3PO4A 4DSLA 4DQRA 3VQQA 5CYQA 2HMIA 1BCMA 4CIFA 1ASUA 4OJRA 4HUFA 3HT3A 4E7LA 2ZQBA 1RT3A 1I39A 4AHUA 3TAPA 4XIUA 1N6QA 4DF8A 3DMJA 3HPGA 3OYDA 2YKMA 1JLQA 1RTHA 3K57A 1IKVA 2RPIA 3V9WA 2PYLA 3LANA 4FJGA 4E7KA 3HK2A 3L2WA 4B3OA 1IG9A 4CJPA 1BHLA 4CK1A 3OYNA 4KTQA 4HVJA 1WAJA 5FRNA 3HP9A 4ID5A 5HP1A 3K5LA 1RT6A 4C8MA 1EKEA 4C8KA 1MU2A 4DSIA 3DLBA 3OS1A 4RW9A 1JLAA 4CGGA 1UAXA 4CF2A 4DS4A 1HYZA 2DFEA 2IS3A 2A1SA 2YNHA 1XHXA 4NCGA 4IG3A 4TSXA 4M3XA 3C6TA 3M8RA 2FBYA 3SQ1A 4O4GA 4DG1A 2KQ2A 4H4MA 4FJKA 2VWKA 4DTNA 2OA8A 2G8FA 3QETA 5EU7A 3ITHA 1TK5A 4C8NA 4W5TA 3AVMA 4LH4A 3QIPA 4KV8A 3VQ4A 2DFHA 1VSIA 4B9NA 5KRTA 3ZSWA 1IKXA 4FJMA 1B9DA 3TAFA 3ZSYA 4EP5A 3PX4A 1JXEA 4OKJA 4FXDA 1WSHA 1ASWA 2B6AA 4M45A 2Z1JA 4FVMA 4LD0A 3DLKA 1C0UA 3PY8A 1J9AA 1JL2A 1S1TA 1C6VA 3KD1E 4WE1A 3CG7A 3T19A 4E1MA 3ZSOA 3VA3A 3KKRA 3QESA 3NF9A 4BE2A 5I3UA 2BE2A 5SZTA 1SKWA 4CJEA 3V9SA 1WLJA 3AVCA 1NK4A 4M42A 4CJSA 3VQ8A 1WN7A 3O3GA 1WSFA 1GOCA 3DYAA 3MECA 1U4BA 2E6MA 2HHQA 3OYJA 1D9DA 1RCHA 1LAWA 2YNGA 1BCOA 1CZ9A 1RILA 3O4QA 4GMJB 4DMNA 3SQ0A 3RRGA 4FJJA 4FK2A 4Z4IA 1TK0A 2NUBA 4OKEA 3ZSVA 1D8YA 4CEBA 4DU4A 3AVKA 4OLAA 3IG1A 1JLBA 1RNHA 3L2VA 3F73A 1C0MA 2HHXA 1NJWA 4CK3A 3H08A 2QKBA 2HHUA 5C25A 1U49A 2DTUA 2OZSA 2X6NA 3LALA 3HO1A 4CEOA 4N56A 4DSFA 4KHSA 1VRUA 4G1QA 1RT4A 4N5SA 2KFZA 3KIOA 4KPYA 3QERA 3V6DA 2P5OA 4DLGA 5HRPA 3KLEA 1X9WA 2O4GA 3IAYA 2Z1HA 4CIGA 4KB0A 3O4NA 3MXJA 4JLHA 4DLEA 1UOCA 4KI4A 4AHTA 3NF6A 3MXIA 5KTQA 1T03A 4DTPA 4E19A 1L3VA 5HLFA 4CJWA 3OYEA 3VQAA 4QCLA 2QXFA 4OPKA 3TARA 5CZ1A 5HROA 1TKZA 3NFAA 4CECA 1VSEA 3QINA 4FJ9A 4DS5A 3MEGA 4CJQA 4HCCA 4OLBA 3QIOA 1VSFA 1KVBA 4IKFA 1HQEA 4Z4FA 4IBNA 3WNEA 2PZSA 1L3UA 3DM2A 3ASMA 3AO5A 4CGDA 3HPHA 1ZYQA 1N5YA 1KFSA 4W5NA 4CJFA 3SI6A 2F8TA 4EZ9A 3RMCA 4OGCA 3FFIA 2IC3A 4JRPA 4Z4CA 3NGYA 3BGRA 3KK1A 3EY1A 3VQ5A 4O0IA 1T7PA 2HNZA 4CGFA 4PQUA 2HVIA 1XC9A 3AVIA 2KFNA 3P1GA 1RT1A 5FRMA 1VSLA 5CYMA 3TAEA 3TANA 3ZT0A 2D5RA 1RDBA 1RTJA 3JYTA 3SYZA 4CJLA 1RT2A 2GV9A 3ISNC 2HW3A 1RDCA 3AVLA 4CHPA 4NYFA 4L8RB 5KRSA 1XI1A 1S6QA 1S1XA 3NGIA 1QTMA 1QSSA 4M3WA 2EHGA 3AO2A 3TI0A 4KHYA 3NAEA 4J2EA 3TABA 3O3HA 5C24A 1VRTA 2BDPA 1LWEA 4KO0A 4FK4A 3NF7A 1C1CA 1X9SA 1HYVA 4B8CA 3LAKA 3TAGA 1I3AA 2GUIA 4CF9A 3DLHA 1S9EA 1LW2A 3E01A 3LP0A 1TGOA 3AV9A 1QQCA 2VWJA 4F2SA 4KKOA 4DQPA 2HHTA 4RW8A 3KK3A 4CEQA 5HRNA 1HPZA 1QHTA 3V9ZA 5I42A 3IS9A 5C42A 3VQ7A 4B9TA 2JLEA 3I0RA 4YNQA 3HM9A 4FK0A 3NH1A 3VQDA 3PX6A 4ELVA 4C8OA 4I9LA 4FLUA 4C8LA 4DFPA 1KTQA 2HNYA 4HCBA 1BI4B 4DQSA 5J2PA 3BDPA 4CF1A 2XRIA 3SV3A 2B4JA 4E3SA 3SNNA 2BGGA 2B5JA 3ZCMA 5DK5A 3K5NA 4LH5A 3AVAA 3LP2A 3WNFA 4PWDA 4QAGA 1A5XA 4B9LA 3DRPA 3LZIA 3K59A 3OJSA 4AILC 4IG0A 3LP1A 2VG6A 1BQMA 3L8BA 4DFKA 2A1RA 1GOAA 3HP6A 4FJLA 2Z1IA 3VQ6A 3QNOA 4M41A 2KTQA 3P83D 4ELTA 2D0BA 4DSJA 1WAFA 1U47A 5J2NA 4ELUA 1NOZA 4CJRA 1S5JA 1JLGA 3VQEA 1J5OA 1JXBA 4CEFA 5JS1A 4E7IA 2YNIA 2PY5A 4NYNA 4DTOA 2X74A 1EXQA 3VQCA 4FJ7A 2KW4A 4IDKA 5DMRA 3JSMA 3CQ8A 4DTUA 4DFMA 1LWCA 3U3GA 1RDDA 3TAMA 2ZE2A 3NF8A 4B08A 1DTTA 3SV4A 1Q9YA 5J1EA 4W5QA 3OJUA 3ZSXA 3M8PA 2IDOA 1KVCA 1TL1A 1WSEA 4CJKA 4W5OA 3LPUA 4DF4A 1L3SA 2P5GA 4DQIA 2EX3A 4UQGA 4OVLA 2IAJA 2G8WA 1NK0A 1FXXA 3OYKA 3NBPA 1RBSA 4M3ZA 2X6SA 4CHOA 4O44A 1JL1A 4Z4EA 4DU3A 4O0JA 2QKKA 4FZYA 3L3UA 4ZTFA 4DTRA 3V81A 1TV6A 3RMDA 2Y1JA 1ZBLA 2BANA 3EZ5A 3ZSRA 1T05A 4B9UA 3K5OA 3DLEA 5KGXA 3LZJA 1L3TA 3AA2A 4M3YA 3V1QA 2KZMA 3MEEA 1HRHA 4CEEA 1WSJA 3S9HA 1W0HA 1TKDA 4FZXC 4H8KA 4Z0UA 4CGJA 4JS4A 3ALYA 1J54A 3OVNA 3AO4A 3O3FA 2PYJA 1S6PA 3CYMA 3DLRA 3AVHA 3S3NA 3OYAA 1L5UA 4Q5VA 1S1WA 3MXMA 3HVRA 1DLOA 3F9KA 5KI6A 3CM5A 1BIZA 1ITGA 1FKPA 1ZBUA 3C94A 4IFYA 1IO2A 2OPSA 4CFCA 1BL3A 4CF8A 2ITGA 3KK2A 3SJJA 4CF0A 1K6YA 1BI4A 3ZT3A 3KKSA 2I5JA 3AVNA 3DOLA 3VQPA 4FJ5A 1BISA 1VSMA 3PX0A 3KTQA 1SL2A 3THVA 4K8XA 1Z26A 1WNSA 1IH7A 3NDKA 3I8DA 4BDPA 2DY4A 4FW2A 2X78A 2OPQA 1VSKA 3RMAA 4KAZA 1RT7A 3C95A 3T1AA 1RBUA 2ETJA 4O55A 5HBMA 3AA3A 1C1BA 3PUFA 4QOZB 1X9MA 1DTQA 4BE1A 1QSYA 1JLEA 1GOBA 2D0AA 3V1OA 4JRQA 4F3TA 1BQNA 4CIEA 4I2PA 4DTSA 1SKRA 2HHWA 4FLVA 1RTDA 4OPJA 3L3VA 1Y97A 3IRXA 3I0SA 1LW0A 2HB5A 2G8UA 1TVRA 1YTAA 1S9GA 3S3OA 1QE1A 4GVMA 1C1AA 3DRSA 4ICLA 4CFAA 4PUOA 1IKWA 4EP4A 1TL3A 4ID1A 4CE9A 4HTUA 2XY7A 3SCXA 2E6LA 4NCBA 1REVA 1WSGA 2IGIA 4CJ3A 1TKTA 4E7JA 3LPTA 4CEAA 3QEIA 3CM6A 4BWJA 2GBZA 4JS5A 2VG5A 2ATQA 2YKNA 3VQ9A 2HHSA 4YFUA 3AVBA 1XHZA 4LSLA 3TR8A 2F96A 3QEWA 3U3YA 1NOYA 4KHNA 1ZBFA 1UWBA 5HRSA 4BACA 5J2MA 3QO9A 3QEXA 4CEDA 3KLFA 4CGHA 1JLFA 3OS0A 4ZHRA 4KRFA 5K14A 4F4KA 2HVHA 4B9MA 3OYCA 4DSKA 1RBTA 1ZBIA 4CERA 4AHRA 1Q9XA 4KHQA 2YHBA 3QEVA 3S3MA 3AVGA 3HSTB 1VK0A 4RW4A 4BWMA 2XY5A 2IOCA 1KFDA 1NKCA 4KHWA 4CGIA 3HJFA 1EETA 3NHGA 1S1VA 1RBRA 1LV5A 1KRPA 1SUQA 3DOKA 3CFRA 4FLXA 4E1NA 1D9FA 1BIUA 4CJ5A 2XO7A 1JKHA 5FDLA 1VSDA 5JS2A 4CK2A 4CFBA 4J2BA 2QK9A 2WOMA 1NK6A 4N47A 5FROA 2FBXA 5D3GA 4AHSA 2LSNA 3SQ2A 2E4LA 1HYSA 3CFOA 1NK7A 4FM1A 4FLTA 4B9VA 1KSPA 2AJQA 1KLNA 1NK5A 1SV5A 2F8SA 1NKEA 4IFVA 3HL8A 4R5PA 2G8VA 3SPZA 3RR8A 4AH9A 4CHYA 3KLIA 3G0ZA 4EZ6A 1KVAA 3HYFA 4CEZA 3K2PA 3VQBA 4KTZA 4CESA 5E41A 3LAMA 4AHVA 4KFBA 1YT3A 2VG7A 2YV0X 4GW6A 4DQQA 3SUPA 2XY6A 1CXQA 1Q8IA 5CZ2A 4BE0A 3ZSQA 1KLMA 2G8IA 2P51A 3NH2A 3SQ4A 3NE6A 5J2QA 4CHNA 4FLYA 3A2FA 1JLCA 3VN5A 3HVTA 3L2QA 1LWFA 3OYBA 2W42A 5HRRA 4KTWA 1A5WA 2Q3SA 4N76A 4NCAA 1TKXA 1YVUA 1YTUA 1S1UA 3M8QA 4FM0A 3DLGA 1XWLA 4E89A 2OPRA 4HHTA 2XHBA 4FJIA 1X1PA 1RT5A 3TAQA 3QNNA 1UA1A 4J2DA 3C6UA 3L2RA 4DFJA 4K8ZA 1TAQA 3KLGA 1F21A 3D45A 3P5JA 3MEDA 2G8KA 3AVJA 3KD5E 1EP4A 3LWMA 3CFPA 4Y1CA 1NJYA 3L2UA 4DTXA 3V9XA 2DFFA 4RW7A 1CXUA 4AHCA 2WONA 3LDSA 4CHZA 5CY4A 2YHAA 3ULDA 3PV8A 3ZT4A 3ZT2A 3SUQA 1UA0A 4HUGA 1SKSA 1KCFA 4I2QA 4FYDA 1U48A 3RWUA 4N41A 3AO1A 3RTVA 3WNHA 3OYIA 1B92A 4E0DA 3DI6A 2KZZA 3KLHA 4Z4GA 3K5MA 4ZTJA 3NCIA 1CLQA 4BDZA 3QLHA 3TWHA 3ZT1A 1SL0A 3VA0A 1RBVA 2HHVA 5KGWA 3NGZA 2R7YA 2JGUA 3LWLA 4PA1A 1W9HA 3OYGA 1BGXT 1HNIA 2D0CA 2FBVA 4RW6A 3U6FA 4FJXA 3V1RA 1G15A 4CJUA 3OS2A 3D0PA 1EX4A 3KJVA 2OPPA 3LP3A 3T3FA 1RTIA 1HJRA 1NJZA 1TK8A 1NJXA 1VSJA 4M3UA 4BDYA 1HQUA 1D5AA 3M8SA 1HMVA 3EYZA 4KHUA 3SPYA 4DU1A 4KREA 1SL1A 1U04A 3OYLA 3RRHA 4LY7A 1ASVA 1NK9A 4F2RA 4Q0BA 2O4IA 2RF2A 4DSEA 4PY5A 4DTJA 4I9QA 3V4IA 1A5VA 2YNFA 3QEPA 2XY8A 3WNGA 3DRRA 4I7FA 4Y1DA 3B6PA 4OGEA 4CJTA 4CFDA 3OYMA 3NH0A 2G8HA 4O5BA 3SUOA 3AO3A 1LAVA 1U45A 3V9UA 1J53A 2RKIA 4Z4HA 1NK8A 3OY9A 4H4OA 3B6OA 3MAQA 1RDAA 2FC0A 1TAUA 4OKKA 4CCHA 4CJVA 4FJNA 4FZZA 1FKOA 2ZD1A 4CJ4A 3HXMA 4J2AA 4FW1A 3SZ2A 4W5RA 2OZMA 1R0AA 2OYQA 4M3TA 2RN2A 3G10A 1VSHA 2Y1IA 4KB1A 4FCYA 1NKBA 1Z25A 2HNDA 1FK9A 1CZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPO A;  4F3O A;  2Z1G A;  4CHQ A;  1QSL A;  5SWM A;  3AA5 X;  3UIQ A;  4M3R A;  4HUE A;  3RMB A;  4FJ8 A;  3RR7 A;  4FJH A;  4MQ3 A;  1T8E A;  4DTM A;  1C0T A;  1ZBH A;  1WSI A;  4FLW A;  2P1J A;  3AVF A;  4B8A B;  3ZSZ A;  4FM2 A;  1B9F A;  3SUN A;  4FLZ A;  4E7H A;  3AA4 A;  3K58 A;  2FBT A;  1IKY A;  4MFB A;  3PO5 A;  4DWI A;  4KI6 A;  5T7B A;  4LSN A;  4B9S A;  4F8R A;  1QS4 A;  1HNV A;  3OYF A;  3OYH A;  1O1W A;  4RG8 A;  3PO4 A;  4DSL A;  4DQR A;  3VQQ A;  5CYQ A;  2HMI A;  1BCM A;  4CIF A;  1ASU A;  4OJR A;  4HUF A;  3HT3 A;  4E7L A;  2ZQB A;  1RT3 A;  1I39 A;  4AHU A;  3TAP A;  4XIU A;  1N6Q A;  4DF8 A;  3DMJ A;  3HPG A;  3OYD A;  2YKM A;  1JLQ A;  1RTH A;  3K57 A;  1IKV A;  2RPI A;  3V9W A;  2PYL A;  3LAN A;  4FJG A;  4E7K A;  3HK2 A;  3L2W A;  4B3O A;  1IG9 A;  4CJP A;  1BHL A;  4CK1 A;  3OYN A;  4KTQ A;  4HVJ A;  1WAJ A;  5FRN A;  3HP9 A;  4ID5 A;  5HP1 A;  3K5L A;  1RT6 A;  4C8M A;  1EKE A;  4C8K A;  1MU2 A;  4DSI A;  3DLB A;  3OS1 A;  4RW9 A;  1JLA A;  4CGG A;  1UAX A;  4CF2 A;  4DS4 A;  1HYZ A;  2DFE A;  2IS3 A;  2A1S A;  2YNH A;  1XHX A;  4NCG A;  4IG3 A;  4TSX A;  4M3X A;  3C6T A;  3M8R A;  2FBY A;  3SQ1 A;  4O4G A;  4DG1 A;  2KQ2 A;  4H4M A;  4FJK A;  2VWK A;  4DTN A;  2OA8 A;  2G8F A;  3QET A;  5EU7 A;  3ITH A;  1TK5 A;  4C8N A;  4W5T A;  3AVM A;  4LH4 A;  3QIP A;  4KV8 A;  3VQ4 A;  2DFH A;  1VSI A;  4B9N A;  5KRT A;  3ZSW A;  1IKX A;  4FJM A;  1B9D A;  3TAF A;  3ZSY A;  4EP5 A;  3PX4 A;  1JXE A;  4OKJ A;  4FXD A;  1WSH A;  1ASW A;  2B6A A;  4M45 A;  2Z1J A;  4FVM A;  4LD0 A;  3DLK A;  1C0U A;  3PY8 A;  1J9A A;  1JL2 A;  1S1T A;  1C6V A;  3KD1 E;  4WE1 A;  3CG7 A;  3T19 A;  4E1M A;  3ZSO A;  3VA3 A;  3KKR A;  3QES A;  3NF9 A;  4BE2 A;  5I3U A;  2BE2 A;  5SZT A;  1SKW A;  4CJE A;  3V9S A;  1WLJ A;  3AVC A;  1NK4 A;  4M42 A;  4CJS A;  3VQ8 A;  1WN7 A;  3O3G A;  1WSF A;  1GOC A;  3DYA A;  3MEC A;  1U4B A;  2E6M A;  2HHQ A;  3OYJ A;  1D9D A;  1RCH A;  1LAW A;  2YNG A;  1BCO A;  1CZ9 A;  1RIL A;  3O4Q A;  4GMJ B;  4DMN A;  3SQ0 A;  3RRG A;  4FJJ A;  4FK2 A;  4Z4I A;  1TK0 A;  2NUB A;  4OKE A;  3ZSV A;  1D8Y A;  4CEB A;  4DU4 A;  3AVK A;  4OLA A;  3IG1 A;  1JLB A;  1RNH A;  3L2V A;  3F73 A;  1C0M A;  2HHX A;  1NJW A;  4CK3 A;  3H08 A;  2QKB A;  2HHU A;  5C25 A;  1U49 A;  2DTU A;  2OZS A;  2X6N A;  3LAL A;  3HO1 A;  4CEO A;  4N56 A;  4DSF A;  4KHS A;  1VRU A;  4G1Q A;  1RT4 A;  4N5S A;  2KFZ A;  3KIO A;  4KPY A;  3QER A;  3V6D A;  2P5O A;  4DLG A;  5HRP A;  3KLE A;  1X9W A;  2O4G A;  3IAY A;  2Z1H A;  4CIG A;  4KB0 A;  3O4N A;  3MXJ A;  4JLH A;  4DLE A;  1UOC A;  4KI4 A;  4AHT A;  3NF6 A;  3MXI A;  5KTQ A;  1T03 A;  4DTP A;  4E19 A;  1L3V A;  5HLF A;  4CJW A;  3OYE A;  3VQA A;  4QCL A;  2QXF A;  4OPK A;  3TAR A;  5CZ1 A;  5HRO A;  1TKZ A;  3NFA A;  4CEC A;  1VSE A;  3QIN A;  4FJ9 A;  4DS5 A;  3MEG A;  4CJQ A;  4HCC A;  4OLB A;  3QIO A;  1VSF A;  1KVB A;  4IKF A;  1HQE A;  4Z4F A;  4IBN A;  3WNE A;  2PZS A;  1L3U A;  3DM2 A;  3ASM A;  3AO5 A;  4CGD A;  3HPH A;  1ZYQ A;  1N5Y A;  1KFS A;  4W5N A;  4CJF A;  3SI6 A;  2F8T A;  4EZ9 A;  3RMC A;  4OGC A;  3FFI A;  2IC3 A;  4JRP A;  4Z4C A;  3NGY A;  3BGR A;  3KK1 A;  3EY1 A;  3VQ5 A;  4O0I A;  1T7P A;  2HNZ A;  4CGF A;  4PQU A;  2HVI A;  1XC9 A;  3AVI A;  2KFN A;  3P1G A;  1RT1 A;  5FRM A;  1VSL A;  5CYM A;  3TAE A;  3TAN A;  3ZT0 A;  2D5R A;  1RDB A;  1RTJ A;  3JYT A;  3SYZ A;  4CJL A;  1RT2 A;  2GV9 A;  3ISN C;  2HW3 A;  1RDC A;  3AVL A;  4CHP A;  4NYF A;  4L8R B;  5KRS A;  1XI1 A;  1S6Q A;  1S1X A;  3NGI A;  1QTM A;  1QSS A;  4M3W A;  2EHG A;  3AO2 A;  3TI0 A;  4KHY A;  3NAE A;  4J2E A;  3TAB A;  3O3H A;  5C24 A;  1VRT A;  2BDP A;  1LWE A;  4KO0 A;  4FK4 A;  3NF7 A;  1C1C A;  1X9S A;  1HYV A;  4B8C A;  3LAK A;  3TAG A;  1I3A A;  2GUI A;  4CF9 A;  3DLH A;  1S9E A;  1LW2 A;  3E01 A;  3LP0 A;  1TGO A;  3AV9 A;  1QQC A;  2VWJ A;  4F2S A;  4KKO A;  4DQP A;  2HHT A;  4RW8 A;  3KK3 A;  4CEQ A;  5HRN A;  1HPZ A;  1QHT A;  3V9Z A;  5I42 A;  3IS9 A;  5C42 A;  3VQ7 A;  4B9T A;  2JLE A;  3I0R A;  4YNQ A;  3HM9 A;  4FK0 A;  3NH1 A;  3VQD A;  3PX6 A;  4ELV A;  4C8O A;  4I9L A;  4FLU A;  4C8L A;  4DFP A;  1KTQ A;  2HNY A;  4HCB A;  1BI4 B;  4DQS A;  5J2P A;  3BDP A;  4CF1 A;  2XRI A;  3SV3 A;  2B4J A;  4E3S A;  3SNN A;  2BGG A;  2B5J A;  3ZCM A;  5DK5 A;  3K5N A;  4LH5 A;  3AVA A;  3LP2 A;  3WNF A;  4PWD A;  4QAG A;  1A5X A;  4B9L A;  3DRP A;  3LZI A;  3K59 A;  3OJS A;  4AIL C;  4IG0 A;  3LP1 A;  2VG6 A;  1BQM A;  3L8B A;  4DFK A;  2A1R A;  1GOA A;  3HP6 A;  4FJL A;  2Z1I A;  3VQ6 A;  3QNO A;  4M41 A;  2KTQ A;  3P83 D;  4ELT A;  2D0B A;  4DSJ A;  1WAF A;  1U47 A;  5J2N A;  4ELU A;  1NOZ A;  4CJR A;  1S5J A;  1JLG A;  3VQE A;  1J5O A;  1JXB A;  4CEF A;  5JS1 A;  4E7I A;  2YNI A;  2PY5 A;  4NYN A;  4DTO A;  2X74 A;  1EXQ A;  3VQC A;  4FJ7 A;  2KW4 A;  4IDK A;  5DMR A;  3JSM A;  3CQ8 A;  4DTU A;  4DFM A;  1LWC A;  3U3G A;  1RDD A;  3TAM A;  2ZE2 A;  3NF8 A;  4B08 A;  1DTT A;  3SV4 A;  1Q9Y A;  5J1E A;  4W5Q A;  3OJU A;  3ZSX A;  3M8P A;  2IDO A;  1KVC A;  1TL1 A;  1WSE A;  4CJK A;  4W5O A;  3LPU A;  4DF4 A;  1L3S A;  2P5G A;  4DQI A;  2EX3 A;  4UQG A;  4OVL A;  2IAJ A;  2G8W A;  1NK0 A;  1FXX A;  3OYK A;  3NBP A;  1RBS A;  4M3Z A;  2X6S A;  4CHO A;  4O44 A;  1JL1 A;  4Z4E A;  4DU3 A;  4O0J A;  2QKK A;  4FZY A;  3L3U A;  4ZTF A;  4DTR A;  3V81 A;  1TV6 A;  3RMD A;  2Y1J A;  1ZBL A;  2BAN A;  3EZ5 A;  3ZSR A;  1T05 A;  4B9U A;  3K5O A;  3DLE A;  5KGX A;  3LZJ A;  1L3T A;  3AA2 A;  4M3Y A;  3V1Q A;  2KZM A;  3MEE A;  1HRH A;  4CEE A;  1WSJ A;  3S9H A;  1W0H A;  1TKD A;  4FZX C;  4H8K A;  4Z0U A;  4CGJ A;  4JS4 A;  3ALY A;  1J54 A;  3OVN A;  3AO4 A;  3O3F A;  2PYJ A;  1S6P A;  3CYM A;  3DLR A;  3AVH A;  3S3N A;  3OYA A;  1L5U A;  4Q5V A;  1S1W A;  3MXM A;  3HVR A;  1DLO A;  3F9K A;  5KI6 A;  3CM5 A;  1BIZ A;  1ITG A;  1FKP A;  1ZBU A;  3C94 A;  4IFY A;  1IO2 A;  2OPS A;  4CFC A;  1BL3 A;  4CF8 A;  2ITG A;  3KK2 A;  3SJJ A;  4CF0 A;  1K6Y A;  1BI4 A;  3ZT3 A;  3KKS A;  2I5J A;  3AVN A;  3DOL A;  3VQP A;  4FJ5 A;  1BIS A;  1VSM A;  3PX0 A;  3KTQ A;  1SL2 A;  3THV A;  4K8X A;  1Z26 A;  1WNS A;  1IH7 A;  3NDK A;  3I8D A;  4BDP A;  2DY4 A;  4FW2 A;  2X78 A;  2OPQ A;  1VSK A;  3RMA A;  4KAZ A;  1RT7 A;  3C95 A;  3T1A A;  1RBU A;  2ETJ A;  4O55 A;  5HBM A;  3AA3 A;  1C1B A;  3PUF A;  4QOZ B;  1X9M A;  1DTQ A;  4BE1 A;  1QSY A;  1JLE A;  1GOB A;  2D0A A;  3V1O A;  4JRQ A;  4F3T A;  1BQN A;  4CIE A;  4I2P A;  4DTS A;  1SKR A;  2HHW A;  4FLV A;  1RTD A;  4OPJ A;  3L3V A;  1Y97 A;  3IRX A;  3I0S A;  1LW0 A;  2HB5 A;  2G8U A;  1TVR A;  1YTA A;  1S9G A;  3S3O A;  1QE1 A;  4GVM A;  1C1A A;  3DRS A;  4ICL A;  4CFA A;  4PUO A;  1IKW A;  4EP4 A;  1TL3 A;  4ID1 A;  4CE9 A;  4HTU A;  2XY7 A;  3SCX A;  2E6L A;  4NCB A;  1REV A;  1WSG A;  2IGI A;  4CJ3 A;  1TKT A;  4E7J A;  3LPT A;  4CEA A;  3QEI A;  3CM6 A;  4BWJ A;  2GBZ A;  4JS5 A;  2VG5 A;  2ATQ A;  2YKN A;  3VQ9 A;  2HHS A;  4YFU A;  3AVB A;  1XHZ A;  4LSL A;  3TR8 A;  2F96 A;  3QEW A;  3U3Y A;  1NOY A;  4KHN A;  1ZBF A;  1UWB A;  5HRS A;  4BAC A;  5J2M A;  3QO9 A;  3QEX A;  4CED A;  3KLF A;  4CGH A;  1JLF A;  3OS0 A;  4ZHR A;  4KRF A;  5K14 A;  4F4K A;  2HVH A;  4B9M A;  3OYC A;  4DSK A;  1RBT A;  1ZBI A;  4CER A;  4AHR A;  1Q9X A;  4KHQ A;  2YHB A;  3QEV A;  3S3M A;  3AVG A;  3HST B;  1VK0 A;  4RW4 A;  4BWM A;  2XY5 A;  2IOC A;  1KFD A;  1NKC A;  4KHW A;  4CGI A;  3HJF A;  1EET A;  3NHG A;  1S1V A;  1RBR A;  1LV5 A;  1KRP A;  1SUQ A;  3DOK A;  3CFR A;  4FLX A;  4E1N A;  1D9F A;  1BIU A;  4CJ5 A;  2XO7 A;  1JKH A;  5FDL A;  1VSD A;  5JS2 A;  4CK2 A;  4CFB A;  4J2B A;  2QK9 A;  2WOM A;  1NK6 A;  4N47 A;  5FRO A;  2FBX A;  5D3G A;  4AHS A;  2LSN A;  3SQ2 A;  2E4L A;  1HYS A;  3CFO A;  1NK7 A;  4FM1 A;  4FLT A;  4B9V A;  1KSP A;  2AJQ A;  1KLN A;  1NK5 A;  1SV5 A;  2F8S A;  1NKE A;  4IFV A;  3HL8 A;  4R5P A;  2G8V A;  3SPZ A;  3RR8 A;  4AH9 A;  4CHY A;  3KLI A;  3G0Z A;  4EZ6 A;  1KVA A;  3HYF A;  4CEZ A;  3K2P A;  3VQB A;  4KTZ A;  4CES A;  5E41 A;  3LAM A;  4AHV A;  4KFB A;  1YT3 A;  2VG7 A;  2YV0 X;  4GW6 A;  4DQQ A;  3SUP A;  2XY6 A;  1CXQ A;  1Q8I A;  5CZ2 A;  4BE0 A;  3ZSQ A;  1KLM A;  2G8I A;  2P51 A;  3NH2 A;  3SQ4 A;  3NE6 A;  5J2Q A;  4CHN A;  4FLY A;  3A2F A;  1JLC A;  3VN5 A;  3HVT A;  3L2Q A;  1LWF A;  3OYB A;  2W42 A;  5HRR A;  4KTW A;  1A5W A;  2Q3S A;  4N76 A;  4NCA A;  1TKX A;  1YVU A;  1YTU A;  1S1U A;  3M8Q A;  4FM0 A;  3DLG A;  1XWL A;  4E89 A;  2OPR A;  4HHT A;  2XHB A;  4FJI A;  1X1P A;  1RT5 A;  3TAQ A;  3QNN A;  1UA1 A;  4J2D A;  3C6U A;  3L2R A;  4DFJ A;  4K8Z A;  1TAQ A;  3KLG A;  1F21 A;  3D45 A;  3P5J A;  3MED A;  2G8K A;  3AVJ A;  3KD5 E;  1EP4 A;  3LWM A;  3CFP A;  4Y1C A;  1NJY A;  3L2U A;  4DTX A;  3V9X A;  2DFF A;  4RW7 A;  1CXU A;  4AHC A;  2WON A;  3LDS A;  4CHZ A;  5CY4 A;  2YHA A;  3ULD A;  3PV8 A;  3ZT4 A;  3ZT2 A;  3SUQ A;  1UA0 A;  4HUG A;  1SKS A;  1KCF A;  4I2Q A;  4FYD A;  1U48 A;  3RWU A;  4N41 A;  3AO1 A;  3RTV A;  3WNH A;  3OYI A;  1B92 A;  4E0D A;  3DI6 A;  2KZZ A;  3KLH A;  4Z4G A;  3K5M A;  4ZTJ A;  3NCI A;  1CLQ A;  4BDZ A;  3QLH A;  3TWH A;  3ZT1 A;  1SL0 A;  3VA0 A;  1RBV A;  2HHV A;  5KGW A;  3NGZ A;  2R7Y A;  2JGU A;  3LWL A;  4PA1 A;  1W9H A;  3OYG A;  1BGX T;  1HNI A;  2D0C A;  2FBV A;  4RW6 A;  3U6F A;  4FJX A;  3V1R A;  1G15 A;  4CJU A;  3OS2 A;  3D0P A;  1EX4 A;  3KJV A;  2OPP A;  3LP3 A;  3T3F A;  1RTI A;  1HJR A;  1NJZ A;  1TK8 A;  1NJX A;  1VSJ A;  4M3U A;  4BDY A;  1HQU A;  1D5A A;  3M8S A;  1HMV A;  3EYZ A;  4KHU A;  3SPY A;  4DU1 A;  4KRE A;  1SL1 A;  1U04 A;  3OYL A;  3RRH A;  4LY7 A;  1ASV A;  1NK9 A;  4F2R A;  4Q0B A;  2O4I A;  2RF2 A;  4DSE A;  4PY5 A;  4DTJ A;  4I9Q A;  3V4I A;  1A5V A;  2YNF A;  3QEP A;  2XY8 A;  3WNG A;  3DRR A;  4I7F A;  4Y1D A;  3B6P A;  4OGE A;  4CJT A;  4CFD A;  3OYM A;  3NH0 A;  2G8H A;  4O5B A;  3SUO A;  3AO3 A;  1LAV A;  1U45 A;  3V9U A;  1J53 A;  2RKI A;  4Z4H A;  1NK8 A;  3OY9 A;  4H4O A;  3B6O A;  3MAQ A;  1RDA A;  2FC0 A;  1TAU A;  4OKK A;  4CCH A;  4CJV A;  4FJN A;  4FZZ A;  1FKO A;  2ZD1 A;  4CJ4 A;  3HXM A;  4J2A A;  4FW1 A;  3SZ2 A;  4W5R A;  2OZM A;  1R0A A;  2OYQ A;  4M3T A;  2RN2 A;  3G10 A;  1VSH A;  2Y1I A;  4KB1 A;  4FCY A;  1NKB A;  1Z25 A;  2HND A;  1FK9 A;  1CZB A; 
#chains in the Genus database with same CATH topology
 3HPO A;  4BG9 A;  4CZE A;  3WQT A;  1Q86 O;  4HUE A;  3CCQ N;  1C0G A;  3RMB A;  4DTM A;  1C0T A;  4DR3 K;  5TKY A;  3AVF A;  3CC2 N;  4X64 K;  4B1V A;  4ISF A;  4BRF A;  1B9F A;  2A41 A;  4FLZ A;  4E7H A;  2FBT A;  4MFB A;  2BTF A;  3PO5 A;  5IWA K;  4KI6 A;  5T7B A;  3OYH A;  3MK6 A;  4DQR A;  3VQQ A;  1BCM A;  4CIF A;  4OJR A;  1RT3 A;  2O8E B;  2YKM A;  2PYL A;  3V9W A;  1IKV A;  4IZ9 A;  3LAN A;  4E7K A;  1ZBS A;  3D2F A;  4NXM K;  1TYQ A;  4U7B A;  4CK1 A;  5M1F A;  4CZM A;  1EWR A;  1RGI A;  1EKE A;  1MU2 A;  1GLJ O;  2IS3 A;  4TSX A;  4M3X A;  3C6T A;  2FBY A;  1VQP N;  4CVN E;  3SQ1 A;  4JI8 K;  5C2D A;  2KQ2 A;  2VWK A;  5LJW A;  1YJW N;  3QET A;  2Q31 A;  1TK5 A;  3GBT A;  4C8N A;  2O8C A;  4JKF A;  5KQD A;  3VQ4 A;  3ZSW A;  1B9D A;  1C0F A;  1HJO A;  4FXD A;  4M45 A;  4FVM A;  3PY8 A;  1JL2 A;  2PAV A;  3H1Q A;  1S1T A;  3TU5 A;  4R79 A;  5EX5 A;  1U6Z A;  3CG7 A;  5BRD A;  2O8B B;  4M63 C;  3VA3 A;  1QQM A;  2VWB A;  3QES A;  5AFU H;  1SKW A;  1WLJ A;  1NGC A;  2IIR A;  3VQ8 A;  1GOC A;  3SMP A;  1RCH A;  4DQI A;  1RIL A;  4FJJ A;  3G25 A;  4HTL A;  4A2B A;  2QI2 A;  4CEB A;  4RWT A;  3AVK A;  2BH1 A;  3E1Y A;  1RNH A;  3L2V A;  4JV5 K;  3O9U A;  4DUY K;  2HHU A;  3HO1 A;  2KFZ A;  1RT4 A;  4M7X A;  1SAZ A;  3LM9 A;  3V6D A;  4EFH A;  5HRP A;  4EIA A;  4PHT X;  3HSC A;  4YDU A;  4JLH A;  3MXJ A;  4DLE A;  1UOC A;  4KI4 A;  1BA1 A;  4JHD B;  3NF6 A;  4LFB K;  5KTQ A;  4BY9 C;  3HTV A;  4BC5 A;  4CJW A;  4OPK A;  5HRO A;  4JN4 A;  1VSE A;  3JS6 A;  4DR2 K;  3LDL A;  3MEG A;  1V4S A;  1KAX A;  3QIO A;  1KVB A;  3THX A;  1N5Y A;  4W5N A;  4NO7 A;  1OH7 A;  3QFU A;  5JVG L;  3RMC A;  3FFI A;  3BGR A;  4CGF A;  1QQO A;  3AVI A;  1RT1 A;  5FRM A;  3TAE A;  3ZT0 A;  1RTJ A;  4CJL A;  1QVG M;  3FZL A;  4LF6 K;  2GV9 A;  4IO9 L;  3AVL A;  4CHP A;  3LM2 A;  1QSS A;  5FPN A;  3J7Z O;  1QTM A;  3E9L A;  5C24 A;  2BDP A;  2VGN A;  3ATV A;  3NF7 A;  4H0V B;  5JIC A;  1HYV A;  4B8C A;  3TAG A;  2F9W A;  1M90 O;  3PIO L;  4YHH K;  3M5R A;  3VET A;  2VYP A;  2VWJ A;  4KKO A;  3CJB A;  3KK3 A;  1XC3 A;  1HPZ A;  1QHT A;  5C42 A;  2JLE A;  4BR5 A;  5AZJ A;  4C8O A;  3HI0 A;  4DFP A;  4H0X B;  4CF1 A;  3ENO A;  2QWL A;  4JEP A;  2QWO A;  4WQ5 A;  3LP2 A;  4JKC A;  4B9L A;  3DRP A;  3LZI A;  3DLL L;  3L8B A;  3HP6 A;  1NGB A;  3CER A;  1IV0 A;  3A5M C;  4CBX A;  4ELT A;  2D0B A;  3ATU A;  4JAX A;  4ELU A;  4JNE A;  3O5B A;  4JKG B;  4BQZ A;  5F0X A;  5JS1 A;  2PY5 A;  1GLD G;  4NYN A;  1QZ6 A;  4PKI A;  3O08 A;  4DTO A;  1EXQ A;  4FJ7 A;  4DTU A;  4DFM A;  4FWM A;  3QBX A;  2D0P A;  5AQO A;  3WXM B;  3TAM A;  3NF8 A;  4DR6 K;  3BF3 A;  1SZ2 A;  4B1X B;  3ZSX A;  5AJ3 K;  3M8P A;  1HKG A;  4H0P A;  4G9Z A;  1L3S A;  2E2O A;  2EX3 A;  3OYK A;  1RBS A;  1IJJ A;  4WFN L;  4O0J A;  2QKK A;  4FZY A;  4JI4 K;  2P9L B;  4IOC L;  1Y64 A;  5AQZ A;  1NGI A;  3B8A X;  4QS7 A;  1EWQ A;  3AA2 A;  2WBN A;  1NGG A;  3PIP L;  4FZX C;  4H8K A;  4Z0U A;  2Q1N A;  1J54 A;  3ALY A;  3OVN A;  3UKR B;  1S6P A;  2O8E A;  1S1W A;  3MXM A;  3HVR A;  5KI6 A;  1HNX K;  1T3V A;  1ITG A;  3A5N C;  1FKP A;  4CFC A;  3SJJ A;  3LDQ A;  2ITG A;  1DEJ A;  4CF0 A;  1JCF A;  3KKS A;  5BN9 A;  3VQP A;  2NRW A;  1YIT N;  3EKS A;  3CIP A;  3O6W A;  4KBO A;  4K8X A;  1WNS A;  1KQS M;  4DCH A;  4CZJ A;  3C95 A;  3VEW A;  3L0Q A;  1S22 A;  3WT0 A;  4IWV A;  4QOZ B;  1X9M A;  1GOB A;  2P9P B;  4JRQ A;  2ZJP L;  2HHW A;  3G4S N;  4K42 A;  1RTD A;  3GL1 A;  4MDA A;  1Y97 A;  2HB5 A;  1Q82 O;  4YOR A;  3S3O A;  1YUW A;  2CH6 A;  4GVM A;  4BRK A;  1SS6 A;  4PUO A;  2O8B A;  4HTU A;  1XQS C;  1HNZ K;  2IGI A;  3QML A;  4O8K A;  1N36 K;  4GV6 A;  3QEI A;  4JS5 A;  4JI1 K;  2ATQ A;  2YKN A;  3C6A A;  4U67 L;  3H3O B;  4DR7 K;  3AVB A;  1XHZ A;  4LSL A;  3QEW A;  1UWB A;  4BAC A;  4CED A;  5BR9 A;  1BDG A;  1YVN A;  3M3Z A;  5K14 A;  4BRN A;  2HVH A;  4B9M A;  1RBT A;  3AGK A;  1ZBI A;  5AQQ A;  2YHB A;  1X3N A;  3AVG A;  2P9N B;  3HJF A;  2IOC A;  1GLA G;  1E3M A;  1RDU A;  2NRX A;  3QIC A;  3CFR A;  5CR4 A;  4JHD A;  5FDL A;  3U9Z A;  4CFB A;  5JS2 A;  4CZH A;  2NRT A;  5C2F A;  3DJC A;  3SQ2 A;  2P9U B;  2PBD A;  1NK7 A;  2VQF K;  4FM1 A;  1KSP A;  4PKG A;  1BA0 A;  4KHQ A;  5EY4 A;  3KLI A;  1KD1 O;  4KTZ A;  5E41 A;  3E9P A;  3CCR N;  2VG7 A;  4DQQ A;  1CXQ A;  1Q8I A;  3ZSQ A;  1KLM A;  4BGB A;  1EO1 A;  2GEM A;  3NE6 A;  3HVT A;  3L2Q A;  3THY B;  1LWF A;  3C6H A;  2W42 A;  4NCA A;  3CXC M;  4JI6 K;  5KPT A;  1XWL A;  4E89 A;  4FJI A;  1O13 A;  3TAQ A;  3QNN A;  1DGK N;  3VEZ A;  2WC9 A;  3MED A;  3LWM A;  3IDH A;  4CBW A;  3L2U A;  5KQ8 A;  4EAH D;  4AHC A;  3S41 A;  3SUQ A;  4FYD A;  3CCS N;  1U48 A;  3T1Y K;  3RTV A;  3WNH A;  3OYI A;  2NRZ A;  2E2N A;  4BDZ A;  3QLH A;  4Y0W A;  5AQK A;  3ZT1 A;  3TWH A;  2JGU A;  4PA1 A;  2RHK A;  3A5L C;  4RW6 A;  3U6F A;  2A6A A;  4FJX A;  4EHU A;  3D0P A;  2WTU A;  1TK8 A;  1VSJ A;  4WQ4 A;  3HOS A;  3HRG A;  4BDY A;  1HMV A;  4DU1 A;  4E1J A;  4KRE A;  4F2R A;  1U04 A;  4LY7 A;  5AR0 A;  4FO0 A;  3MN5 A;  1HLU A;  4IFE A;  3E66 A;  2I7N A;  4Y1D A;  4I7F A;  4JKG A;  3NH0 A;  1NGE A;  4B3T K;  1XNQ K;  1NK8 A;  4L3Q A;  3OY9 A;  1R59 O;  2FC0 A;  3CCJ N;  4OKK A;  4CCH A;  3W0L A;  4A5B A;  4FJN A;  4J2A A;  4FW1 A;  3SZ2 A;  4W5R A;  3FR0 A;  1W7A A;  2OYQ A;  3ZX3 A;  2Y1I A;  4KB1 A;  4FCY A;  1FK9 A;  1CZB A;  4FWQ A;  2D0O A;  3AAP A;  5SWM A;  4FJH A;  1ZBH A;  1WSI A;  4FLW A;  3U8X A;  2P1J A;  4JKD A;  4RTF D;  2P9L A;  5BPN A;  4JD2 B;  1IKY A;  5M1N A;  4B9S A;  2V51 B;  1HNV A;  5ELZ A;  4RG8 A;  3TTD A;  3PO4 A;  3UKR A;  5CYQ A;  3G6E N;  4E7L A;  3DMJ A;  2E5L K;  1RTH A;  3K57 A;  2RPI A;  4FJG A;  4B3O A;  5FPD A;  5FRN A;  4ID5 A;  1RT6 A;  2UUC K;  1GLC G;  5BR8 K;  4XH1 A;  4RW9 A;  4CF2 A;  1UAX A;  5LJV A;  1XHX A;  3CCE N;  4IG3 A;  1ATR A;  3DXM B;  4DG1 A;  4H4M A;  2GUP A;  4DTN A;  2G8F A;  1ZC6 A;  4LF5 K;  3IKM A;  1NLV A;  3CPW M;  4PL8 A;  3ITH A;  5EVZ A;  3ZX2 A;  4W5T A;  2P9P A;  1QZ5 A;  2DFH A;  1VSI A;  2QWM A;  4B9N A;  5AQP A;  4ILJ A;  1QVF M;  3ZSY A;  2QXL A;  3PX4 A;  2B6A A;  3DLK A;  5FPM A;  2HBJ A;  1C6V A;  3KD1 E;  3LDO A;  1T6C A;  3NF9 A;  3SMS A;  2BE2 A;  5SZT A;  2HBL A;  4DHY A;  3AVC A;  3SBT A;  1WN7 A;  1WSF A;  4YOU A;  1D9D A;  1LAW A;  2YNG A;  4IJA A;  3SQ0 A;  3PSF A;  1TK0 A;  1D8Y A;  4OKE A;  3ZSV A;  4LF7 K;  4DU4 A;  3IG1 A;  3F73 A;  1C0M A;  4CK3 A;  4LF8 K;  5C25 A;  2H3G X;  4DSF A;  2P9N A;  4JI3 K;  3BZC A;  4KPY A;  3QER A;  3MCA B;  2P5O A;  4DLG A;  2O4G A;  4H5W A;  1GLL O;  3OW2 M;  4AHT A;  4DTP A;  2P9U A;  1L3V A;  3WQU A;  3OYE A;  2QXF A;  3TAR A;  5CZ1 A;  3CJ7 A;  5JMV A;  2QTD A;  1CZA N;  4Z4F A;  3GDQ A;  4IBN A;  3WNE A;  3KWG A;  3DM2 A;  3ASM A;  3AO5 A;  1ZYQ A;  3SI6 A;  2F8T A;  4Z4C A;  5M1O A;  2P9I B;  3THY A;  3VQ5 A;  2HVI A;  3TAN A;  1RDB A;  2YHX A;  2HW3 A;  4NYF A;  1S6Q A;  3TI0 A;  3NAE A;  3TAB A;  5BRE A;  3VEN A;  1NG9 A;  1LWE A;  2HHH K;  3OTO K;  1C1C A;  1X9S A;  3IUC A;  3LAK A;  4JKE A;  4GNI A;  5F1X A;  3DLH A;  2YCH A;  3E01 A;  1LW2 A;  4YOY A;  1RDW X;  1W97 L;  3AV9 A;  1XMO K;  4DQP A;  3FFK B;  3H45 C;  4RW8 A;  2HHT A;  2KLA A;  4CEQ A;  1NWK A;  1IBM K;  3IS9 A;  4YNQ A;  4DV5 K;  3VQD A;  3PX6 A;  1Z6R A;  1U2V B;  3KVG A;  5GAE P;  2HF3 A;  1KTQ A;  4WQ4 C;  4DQS A;  2XRI A;  3J8A A;  3SNN A;  4YOV A;  3K5N A;  2UYT A;  3AVA A;  3WNF A;  4I6M B;  4PWD A;  3DWL A;  4QAG A;  3K59 A;  3LP1 A;  2A1R A;  4PKH A;  3VQ6 A;  4IEI A;  4M41 A;  1H1V A;  1P8Z A;  2UXB K;  1WAF A;  1K8A O;  1NOZ A;  3WXK A;  3VQE A;  1J5O A;  3O9R A;  3MWT A;  2VQE K;  2YNI A;  3CQX A;  1WOQ A;  5EOY A;  4CZI A;  4B1Z A;  1LWC A;  3U3G A;  1RDD A;  1NGJ A;  2ZE2 A;  4BRL A;  1KAY A;  4W5Q A;  4BRP A;  1TL1 A;  1WSE A;  3O4W A;  2P5G A;  4UQG A;  4OVL A;  2NRH A;  5AQU A;  1NK0 A;  2G8W A;  4UY8 O;  2X6S A;  1NMN A;  3C0B A;  4Z4E A;  4JD2 A;  4FPB A;  5M1P A;  4K41 A;  2Y1J A;  4BR0 A;  2BAN A;  4CD3 A;  3EZ5 A;  4B9U A;  3I33 A;  1MWK A;  2CH5 A;  3LZJ A;  4M3Y A;  3V1Q A;  2KZM A;  3S9H A;  1TKD A;  1Q81 O;  3D7E O;  4FOE A;  4CGJ A;  3MN7 A;  4BRG A;  3DLR A;  3S3N A;  3VGK A;  3OYA A;  1L5U A;  3BF1 A;  2YI1 A;  3C94 A;  4IFY A;  1RFQ A;  1IO2 A;  4NLB A;  2OA8 A;  1BL3 A;  2RE2 A;  3KK2 A;  4B3M K;  1K6Y A;  1BI4 A;  2ZGY A;  4AF1 A;  3ZT3 A;  3AVN A;  5C12 A;  3PX0 A;  1VSM A;  3THV A;  1HX1 A;  1Z26 A;  3T69 A;  1IH7 A;  4FVU A;  3DXM A;  1GLB G;  5C0Y A;  3NDK A;  3I8D A;  4BDP A;  2DY4 A;  4FW2 A;  2X78 A;  3L6Q A;  3RMA A;  3JAM O;  4KAZ A;  4F9O A;  1RBU A;  4O55 A;  5HBM A;  3R6M A;  3DAW A;  2GX9 A;  5GIN A;  1DTQ A;  2W41 A;  3OHR A;  3EL2 A;  4JK7 A;  1JLE A;  4BGA A;  2D0A A;  1T44 A;  2HOE A;  3FZH A;  2OAN A;  4CIE A;  4I2P A;  2FSN A;  4FLV A;  3IRX A;  2G8U A;  4NLC A;  1S9G A;  3CD6 N;  1QE1 A;  4H0T B;  1C1A A;  2XY7 A;  3SCX A;  3BZK A;  4NCB A;  1REV A;  1WSG A;  4E7J A;  3LPT A;  3VQ9 A;  2HHS A;  4LFA K;  4XEI A;  3CF5 L;  3U3Y A;  2OCE A;  3SJH A;  4KHP K;  1VQN N;  4CGH A;  2NRR A;  4H5T A;  3AY9 A;  1ATN A;  4KRF A;  4F4K A;  3P31 A;  2NZT A;  3OYC A;  3BUZ B;  2CGL A;  1Q9X A;  4FWR A;  3HST B;  4RW4 A;  4BWM A;  1NKC A;  1KFD A;  3KHY A;  4FLX A;  3CQY A;  1IBK K;  1DKG D;  3H1V X;  4CK2 A;  1J6Z A;  3J81 O;  1HPM A;  2FBX A;  4GV3 A;  2O8D B;  3G71 N;  4OO1 J;  3F5T A;  1NK5 A;  1SV5 A;  1J5E K;  1NKE A;  2G8V A;  3HL8 A;  3QDK A;  4F3T A;  3SPZ A;  3HYF A;  4CEZ A;  1VQ8 N;  3K2P A;  4BR7 A;  4AHV A;  1YT3 A;  4GW6 A;  3SUP A;  5CZ2 A;  4OX9 K;  4BE0 A;  2P9I A;  3NH2 A;  3CMA N;  4QS8 A;  5J2Q A;  4ILG B;  4CHN A;  1WB9 A;  3A2F A;  1JLC A;  4A61 A;  2W6L A;  3UE5 A;  3OYB A;  2Q36 A;  5HRR A;  3IMX A;  1VQ6 N;  2Q0R A;  5LMN K;  1RT5 A;  3VGM A;  4DFJ A;  3N4Q A;  2G8K A;  3AVJ A;  4DTX A;  2V7Z A;  1CXU A;  4JK9 A;  2WON A;  3VEO A;  4CHZ A;  2W40 A;  3TSP A;  3ULD A;  5M1K A;  3ZT4 A;  3ZT2 A;  2GTD A;  3PV8 A;  1UA0 A;  3KK7 A;  1WBD A;  3ENB A;  3LL3 A;  1B92 A;  3DI6 A;  3K5M A;  3NCI A;  2V7Y A;  1SL0 A;  1U2V A;  2R7Y A;  3RSE B;  1W9H A;  1GLF O;  3SLC A;  3OYG A;  2D0C A;  2FBV A;  1G15 A;  4DV4 K;  3OS2 A;  4FWN A;  5AQM A;  1EX4 A;  3KJV A;  3T3F A;  1NJZ A;  1NJX A;  4JI2 K;  4I6M A;  1HQU A;  3M8S A;  3E9O A;  2FSJ A;  1SL1 A;  3RRH A;  4Q0B A;  4I9Q A;  3V4I A;  3QEP A;  2ASP A;  3WNG A;  4OGE A;  4CFD A;  3QFP A;  2E8A A;  4O5B A;  3AO3 A;  3CME N;  1J53 A;  5AQF A;  4Z4H A;  3NMU A;  3MAQ A;  1TAU A;  4FZZ A;  1FKO A;  4BG8 A;  4JKB A;  4M3T A;  1VSH A;  3TPQ A;  4F3O A;  2Z1G A;  2AA4 A;  3P4I A;  2ZJQ L;  3RR7 A;  4MQ3 A;  3ZX0 A;  1VQ4 N;  2KHO A;  2WUS A;  3SK3 A;  3ZSZ A;  4LFC K;  4FM2 A;  5KPR A;  2UU9 K;  4CJ7 A;  4DV0 K;  1NJI O;  3AA4 A;  3K58 A;  3A5O C;  2QWN A;  4DWI A;  4LSN A;  4F8R A;  1QS4 A;  4GY2 B;  3OYF A;  1O1W A;  4BC4 A;  4DQ8 A;  4YDU C;  3I8B A;  2HMI A;  1TUY A;  2A40 A;  5AFU A;  5JVH L;  4GKJ K;  1I39 A;  5IT9 O;  3TAP A;  4XIU A;  2GEL A;  5AZI B;  1N6Q A;  4DF8 A;  3HPG A;  3OYD A;  4MLE A;  4BR9 A;  3HK2 A;  4KH4 A;  3L2W A;  4O8U A;  3OYN A;  3EZW A;  4HVJ A;  1WAJ A;  3HP9 A;  3K5L A;  2WFB A;  4DSI A;  3OS1 A;  4CGG A;  4DS4 A;  1VQ7 N;  1HYZ A;  4JI7 K;  2A1S A;  2YNH A;  1QQN A;  1HKB A;  2O8F B;  3NVM A;  4IOA L;  2YHW A;  5BRH A;  3MN6 A;  3AVM A;  2QW9 A;  4FJM A;  1IKX A;  3VOV A;  2ZGZ A;  1N32 K;  1Q18 A;  3TAF A;  1BUP A;  1JXE A;  4OKJ A;  3CCU N;  2BUP A;  1WSH A;  1ASW A;  5AQH A;  3ZEU B;  1J9A A;  3PSI A;  3THW B;  2GWJ A;  3T19 A;  4E1M A;  2ASM A;  3ZSO A;  3F9M A;  5GIO A;  5I3U A;  1JJ2 M;  4DUZ K;  3O9Q A;  4CJS A;  3O3G A;  3DYA A;  1U4B A;  2E6M A;  3D2E B;  3OYJ A;  1BCO A;  3RRG A;  4DMN A;  4Z4I A;  3K9K A;  4FWO A;  2NUB A;  3J7A P;  4OLA A;  2ZJR L;  1MWM A;  1JLB A;  2V52 B;  2HHX A;  1BWF O;  1NJW A;  3H08 A;  1KAZ A;  3FZF A;  4Z94 A;  4N56 A;  4WQ5 C;  4KHS A;  4G1Q A;  4N5S A;  1DT9 A;  3LDP A;  4H03 B;  2UUA K;  5FPE A;  1X9W A;  3MN9 A;  2Z1H A;  3FGU A;  4YOX A;  4KB0 A;  3O4N A;  2O8D A;  1NM1 A;  1T03 A;  4BRE A;  3T1H K;  3C65 A;  3VQA A;  3BEX A;  1NNE A;  1VSF A;  4BRQ A;  4BR4 A;  1KFS A;  4EZ9 A;  5AQJ A;  3EN9 A;  4OGC A;  2IC3 A;  3ID8 A;  3D6R A;  3KK1 A;  3EY1 A;  4O0I A;  3C7N B;  4PQU A;  1XC9 A;  2KFN A;  3P1G A;  3MCP A;  1VSL A;  3Q7C A;  1OVY A;  1RT2 A;  5KRS A;  2CGJ A;  1S1X A;  4CI6 A;  4M3W A;  4J2E A;  3QB0 A;  2VCP A;  3CHW A;  1VQO N;  1OH5 A;  5LY3 A;  2NLX A;  2GUI A;  1KXP A;  3VGL A;  1BU6 O;  1NGF A;  3H6E A;  4H0O A;  1QQC A;  4F2S A;  5BPL A;  2E20 A;  5C10 A;  3V9Z A;  5I42 A;  5EXW A;  3I0R A;  3HM9 A;  2PFU A;  4B9T A;  3RSE A;  4FK0 A;  4FSV A;  3MDQ A;  2HST A;  4FLU A;  4C8L A;  4AM7 A;  2NRV A;  1BI4 B;  5J2P A;  3BDP A;  3SAG A;  2BGG A;  5FLX O;  4FWK A;  5TKW A;  3ZCM A;  2KKZ A;  4BRD A;  1BO5 O;  4YOT A;  4AIL C;  1NBW A;  4B1W B;  1BQM A;  4DFK A;  3O9S A;  3TTF A;  3CI5 A;  2KTQ A;  3P83 D;  4DB3 A;  2F7T A;  5AQT A;  1S5J A;  2GWK A;  1JLG A;  1JXB A;  2ZWH A;  4DV6 K;  1YIJ N;  4JKH A;  4CZG A;  5AQN A;  2X74 A;  2KW4 A;  2P9K B;  1ZXO A;  4IDK A;  3JSM A;  2A42 A;  4WFA L;  4GVE A;  4X62 K;  3VTI A;  3SV4 A;  4C1N I;  5J1E A;  3OJU A;  4DV3 K;  1KVC A;  4CJK A;  3R3L A;  5KPZ A;  3TSQ A;  2IAJ A;  1FXX A;  3NBP A;  4M3Z A;  4CHO A;  1JL1 A;  4DU3 A;  3EE8 A;  3L4I A;  4DTR A;  1YF5 L;  2I7P A;  1TV6 A;  3RMD A;  3F2K A;  4FL9 A;  3ZSR A;  3DLE A;  1L3T A;  3MEE A;  1HRH A;  4CEE A;  1WSJ A;  1W0H A;  4NXN K;  1HR0 K;  4JS4 A;  1OH8 A;  2PYJ A;  3CYM A;  5AZI A;  1VQL N;  3CJ9 A;  4B3R K;  3HOT A;  1DLO A;  1YAG A;  1BIZ A;  2IVO A;  2OTJ N;  3VF2 A;  3AAR A;  2OPS A;  2I5J A;  2FXU A;  5GAD P;  3OA9 A;  4FJ5 A;  3KTQ A;  3WXL A;  3U4L A;  3CJC A;  3MMV A;  2O8F A;  5ADX A;  2ETJ A;  3AA3 A;  3PUF A;  5AQY A;  4BVO A;  4BE1 A;  1LCU A;  3VER A;  3V1O A;  4DTS A;  5DM7 L;  1YXQ A;  4OPJ A;  3I0S A;  1LW0 A;  1YTA A;  3MX2 A;  3ZEU A;  3THW A;  4BQL A;  3DRS A;  2FF6 A;  3ENH A;  4ILH A;  1IKW A;  4ICL A;  4CFA A;  4EP4 A;  4CE9 A;  2E6L A;  4CJ3 A;  4BRA A;  1TKT A;  5AQG A;  3CM6 A;  2VG5 A;  3D2E A;  4DV2 K;  1NOY A;  5J2M A;  4DR5 K;  3J7Y P;  3O1W A;  4DSK A;  4A5A A;  3JXU A;  3CJA A;  4CER A;  4FWP A;  3QEV A;  4WYB A;  1VK0 A;  3MWP A;  2XY5 A;  4BVP A;  2QM1 A;  1VHX A;  5AQL A;  1EET A;  3NHG A;  1S1V A;  4K0K K;  1KRP A;  1SUQ A;  3DOK A;  3EEQ A;  1D9F A;  1BIU A;  1Z05 A;  4CJ5 A;  4J2B A;  2QK9 A;  1XMQ K;  2WOM A;  4N47 A;  5FRO A;  3ULE B;  5D3G A;  5HOO A;  2LSN A;  2E4L A;  4DR1 K;  1HYS A;  3CFO A;  4FLT A;  3CCL N;  3RR8 A;  4IFV A;  4R5P A;  2QWP A;  4KH5 A;  4AH9 A;  4EZ6 A;  3G0Z A;  5JLF A;  1KVA A;  2F4V K;  4CES A;  1OVQ A;  3LAM A;  3LDN A;  4BRC A;  2OTL N;  4V19 S;  2XY6 A;  2P51 A;  3DXK B;  3C7N A;  4FLY A;  3VN5 A;  1JCG A;  5GAH P;  5LL6 Z;  1TKX A;  1YVU A;  2VGM A;  4FM0 A;  3DLG A;  4H5V A;  1FJG K;  1W2B M;  3C6U A;  3L2R A;  4K8Z A;  1TAQ A;  3KLG A;  3D45 A;  3EE9 A;  3CFP A;  4Y1C A;  1NJY A;  5I9E B;  3PLA A;  3V9X A;  4RW7 A;  2YHA A;  1SKS A;  4BC3 A;  3K0S A;  4HUG A;  1KCF A;  4YOW A;  2KZZ A;  4E0D A;  3WXJ A;  4X66 K;  4ISG A;  2D1K A;  3L4Q A;  3VA0 A;  1RBV A;  5KGW A;  3ZET B;  4BRH A;  3CET A;  1HNI A;  2HBK A;  3MX5 A;  3R1X A;  3V1R A;  4DV7 K;  1QHA A;  2E2P A;  3KZB A;  3LP3 A;  3K9J A;  1RTI A;  1VQM N;  1HJR A;  1MA9 B;  5CHI A;  4B1Y B;  3EYZ A;  3SPY A;  2O4I A;  2A3Z A;  1NK9 A;  3H46 O;  2A5X A;  2F9T A;  2RF2 A;  4DSE A;  1A5V A;  3DRR A;  3OYM A;  3AGR A;  3B6P A;  3OBW A;  4CJT A;  3W3D A;  1I94 K;  2QWQ A;  2G8H A;  1K73 O;  1GLE G;  3SUO A;  3EKU A;  1YI2 N;  1U45 A;  2RKI A;  4H4O A;  2E88 A;  2P9K A;  4B9Q A;  2YX6 A;  4CJ4 A;  2EWS A;  2HMP A;  5AQX A;  2OZM A;  3FLC O;  2RN2 A;  3G10 A;  1NKB A;  2HND A;  2W6K A;  2IVP A;  4CHQ A;  1QSL A;  2YJE A;  4DR4 K;  3AA5 X;  3UIQ A;  4M3R A;  2NNW A;  4FJ8 A;  1T8E A;  4O5F A;  1WBB A;  4B8A B;  4MLH A;  1IG8 A;  1HUX A;  3SUN A;  1VQK N;  3ZLJ A;  1SQK A;  1N8R O;  3P39 A;  2E2Q A;  3RVC A;  5AQI A;  4DSL A;  2IVN A;  1ASU A;  4HUF A;  3HT3 A;  2ZQB A;  4AHU A;  5F2R A;  5CE3 A;  4WCE L;  3BP8 A;  1JLQ A;  1IG9 A;  4CJP A;  1BHL A;  4KTQ A;  4JKA A;  3GE1 A;  5HP1 A;  4MDB A;  4C8M A;  3GOI A;  4C8K A;  3DLB A;  4DV1 K;  1JLA A;  4JYA K;  2DFE A;  4OPA A;  5B8H A;  4NCG A;  3M8R A;  4IXC A;  3CCM N;  5E84 A;  4O4G A;  4FJK A;  3T7Z A;  4H5N A;  5EU7 A;  1P90 A;  2D4W A;  4LH4 A;  3QIP A;  4KV8 A;  4X65 K;  5KRT A;  4FWS A;  4XH5 A;  4EP5 A;  2Z1J A;  4LD0 A;  3VMF B;  1C0U A;  3FE1 A;  1NU0 A;  4WE1 A;  3KKR A;  3WEE B;  4BE2 A;  3O80 A;  4CJE A;  3V9S A;  3EO3 A;  1NK4 A;  4M42 A;  3UKU B;  3R9P A;  3MEC A;  2HHQ A;  3O9T A;  3O4Q A;  4GMJ B;  1CZ9 A;  4FK2 A;  3I55 N;  1YHQ N;  2QWR A;  1BOT O;  1EQY A;  2QKB A;  1YJN N;  1U49 A;  2DTU A;  2OZS A;  2X6N A;  3LAL A;  4CEO A;  4QS9 A;  1VRU A;  4LC9 B;  4IEE A;  3KIO A;  4M7Y A;  5A2Q O;  3VPZ A;  3KLE A;  1K9M O;  3IAY A;  4CIG A;  1NGD A;  3VEV A;  3ULE A;  4IOX A;  4IDH A;  5AQR A;  3MXI A;  4E19 A;  5HLF A;  4QCL A;  3I56 N;  1NGH A;  1TKZ A;  3NFA A;  4CEC A;  3QIN A;  4FJ9 A;  4DS5 A;  1FW6 A;  4CJQ A;  4HCC A;  4OLB A;  1N33 K;  4IKF A;  1HQE A;  2PZS A;  1L3U A;  3SAF A;  4CGD A;  3HPH A;  4CJF A;  1T6D A;  3DXK A;  4JRP A;  3NGY A;  4CD1 A;  4FPA A;  4FWL A;  1T7P A;  3CJ1 A;  2HNZ A;  2UXC K;  1VQ5 N;  5CYM A;  2D5R A;  3JYT A;  3SYZ A;  2FLO A;  3ISN C;  1RDC A;  4L8R B;  1XI1 A;  3NGI A;  4KHY A;  2EHG A;  3AO2 A;  3HZ6 A;  2E1Y A;  3AAQ A;  2E1Z A;  3O3H A;  2ITM A;  1VRT A;  4MO4 A;  4FK4 A;  4KO0 A;  1I3A A;  3O1B A;  4CF9 A;  5M1Q A;  3A8Y A;  1S9E A;  3FZK A;  4IO8 A;  3LP0 A;  4BRO A;  1TGO A;  3M1F A;  5HRN A;  5AQV A;  3TSU A;  4JK8 A;  3VES A;  2ZF5 O;  3VQ7 A;  3ZET A;  2YHY A;  2FF3 B;  2QA4 N;  4CZF A;  3NH1 A;  4ELV A;  4I9L A;  2HNY A;  2Q0U A;  3TTC A;  3J80 O;  4HCB A;  1X3M A;  3SV3 A;  4E3S A;  2B4J A;  5ADX H;  2B5J A;  5DK5 A;  4LH5 A;  2P9S B;  1K8K B;  1A5X A;  4CW7 B;  3OJS A;  4EHT A;  4IG0 A;  2VG6 A;  1GOA A;  4FJL A;  2Z1I A;  3CC7 N;  3QNO A;  4DSJ A;  3VEX A;  5MLC Q;  1U47 A;  5J2N A;  4XH4 A;  4CJR A;  4CEF A;  4E7I A;  1KC8 O;  3VQC A;  2AP1 A;  4CBU A;  3CQ8 A;  1M1K O;  4YY3 K;  4K25 A;  4LF4 K;  4B08 A;  1DTT A;  1Q9Y A;  2IDO A;  2FSK A;  4C23 A;  4W5O A;  2Q2R A;  3LPU A;  4DF4 A;  1XNR K;  3A0I X;  4GV9 A;  5BRF A;  3VF6 A;  4O44 A;  1HNW K;  3L3U A;  2HBM A;  4ZTF A;  3BY5 A;  3SBG A;  3V81 A;  1ZBL A;  1T05 A;  3K5O A;  5KGX A;  5E26 A;  5AQS A;  3UB5 A;  2ZM6 K;  3R8E A;  3AO4 A;  5DM6 L;  3O3F A;  3AVH A;  4Q5V A;  1E4F T;  3F9K A;  3CM5 A;  1BG3 A;  3FZM A;  1ZBU A;  3D2F B;  1TUU A;  1TYQ B;  5H1S Q;  1WUA A;  4CF8 A;  4FOI A;  2J4R A;  2CGK A;  3ID6 A;  3SAH A;  3DOL A;  4H5R A;  4JI0 K;  2UUB K;  4GKK K;  1BIS A;  3VEY A;  4KH6 A;  1SL2 A;  4H0Y B;  5HL7 L;  4AQY K;  3U9D A;  2OPQ A;  1VSK A;  2JWL A;  1OH6 A;  1RT7 A;  1E4G T;  3T1A A;  4BR2 A;  1MDU B;  4BRM A;  1C1B A;  1QSY A;  2QEX N;  2O8C B;  4WF9 L;  1BQN A;  1SKR A;  3L3V A;  5LMU K;  1TVR A;  4WFB L;  4C1N K;  3NVK A;  4BRI A;  1TL3 A;  4ID1 A;  1XUP O;  3WEE A;  1Q7Y O;  1OKJ A;  3GG4 A;  4B1U B;  4MO5 A;  1V4T A;  2DPN A;  3UKU A;  4CEA A;  4BWJ A;  2GBZ A;  1JCE A;  3O8M A;  4YFU A;  4A2A A;  3TR8 A;  2F96 A;  4KHN A;  3CC4 N;  1ZBF A;  5HRS A;  4CZK A;  3QO9 A;  3QEX A;  3KLF A;  5GIP A;  1JLF A;  3OS0 A;  4ZHR A;  2UXD K;  1YJ9 N;  4AHR A;  1ESV A;  4A62 A;  3S3M A;  4KHW A;  4CGI A;  1RBR A;  1LV5 A;  4E1N A;  3KWI A;  2XO7 A;  1JKH A;  1VSD A;  4A59 A;  1NK6 A;  4AHS A;  3ZYY X;  3Q7B A;  4B9V A;  4BC2 A;  4A57 A;  2AJQ A;  1KLN A;  2F8S A;  4CHY A;  3THX B;  3VQB A;  2JWK A;  4KFB A;  1S72 N;  2YV0 X;  2G8I A;  3QBW A;  3SQ4 A;  3H3N O;  3HM8 A;  4KTW A;  1A5W A;  2Q3S A;  4N76 A;  2YJF A;  1G99 A;  1YTU A;  1S1U A;  3M8Q A;  3WUH A;  1HKC A;  4JI5 K;  2OPR A;  4HHT A;  2XHB A;  1X1P A;  3HBT A;  3CPE A;  4NB4 A;  1UA1 A;  4J2D A;  3OBY A;  1F21 A;  4CZL A;  3P5J A;  3KD5 E;  3M6G A;  1EP4 A;  2DFF A;  3LDS A;  1ATS A;  4PL7 A;  5CY4 A;  3VTH A;  1S3X A;  1ILY A;  5C15 A;  4I2Q A;  4HWI A;  2ASO A;  3RWU A;  3IFR A;  4N41 A;  4LF9 K;  3AO1 A;  3KLH A;  4Z4G A;  2Q97 A;  4ZTJ A;  1IBL K;  1CLQ A;  3VF4 A;  3CCV N;  2HHV A;  2HF4 A;  1VQ9 N;  4RCH A;  4AM6 A;  3NGZ A;  5AZJ B;  3LWL A;  4K43 A;  1N34 K;  1BGX T;  1X9J A;  4CJU A;  4J8F A;  5BPM A;  2OPP A;  5GAG P;  4M3U A;  4ISE A;  2P9S A;  1K8K A;  1D5A A;  4KHU A;  3OYL A;  1ASV A;  4OPH A;  4B3S K;  4PY5 A;  3WXI A;  4DTJ A;  1NMD A;  2YNF A;  5JLH A;  4IJN A;  2XY8 A;  1NGA A;  5BN8 A;  1D4X A;  3P38 A;  1LAV A;  3V9U A;  4DKW A;  3B6O A;  1LOT B;  1RDA A;  4CJV A;  1VAZ A;  2ZD1 A;  3N4P A;  3HXM A;  1R0A A;  5AQW A;  1Z25 A;  5DMR A; 
#chains in the Genus database with same CATH homology
 3HPO A;  4F3O A;  2Z1G A;  4CHQ A;  1QSL A;  5SWM A;  3AA5 X;  3UIQ A;  4M3R A;  4HUE A;  3RMB A;  4FJ8 A;  3RR7 A;  4FJH A;  4MQ3 A;  1T8E A;  4DTM A;  1C0T A;  1ZBH A;  1WSI A;  4FLW A;  2P1J A;  3AVF A;  4B8A B;  3ZSZ A;  4FM2 A;  1B9F A;  3SUN A;  4FLZ A;  4E7H A;  3AA4 A;  3K58 A;  2FBT A;  1IKY A;  4MFB A;  3PO5 A;  4DWI A;  4KI6 A;  5T7B A;  4LSN A;  4B9S A;  4F8R A;  1QS4 A;  1HNV A;  3OYF A;  3OYH A;  1O1W A;  4RG8 A;  3PO4 A;  4DSL A;  4DQR A;  3VQQ A;  5CYQ A;  2HMI A;  1BCM A;  4CIF A;  1ASU A;  4OJR A;  4HUF A;  3HT3 A;  4E7L A;  2ZQB A;  1RT3 A;  1I39 A;  4AHU A;  3TAP A;  4XIU A;  1N6Q A;  4DF8 A;  3DMJ A;  3HPG A;  3OYD A;  2YKM A;  1JLQ A;  1RTH A;  3K57 A;  1IKV A;  2RPI A;  3V9W A;  2PYL A;  3LAN A;  4FJG A;  4E7K A;  3HK2 A;  3L2W A;  4B3O A;  1IG9 A;  4CJP A;  1BHL A;  4CK1 A;  3OYN A;  4KTQ A;  4HVJ A;  1WAJ A;  5FRN A;  3HP9 A;  4ID5 A;  5HP1 A;  3K5L A;  1RT6 A;  4C8M A;  1EKE A;  4C8K A;  1MU2 A;  4DSI A;  3DLB A;  3OS1 A;  4RW9 A;  1JLA A;  4CGG A;  1UAX A;  4CF2 A;  4DS4 A;  1HYZ A;  2DFE A;  2IS3 A;  2A1S A;  2YNH A;  1XHX A;  4NCG A;  4IG3 A;  4TSX A;  4M3X A;  3C6T A;  3M8R A;  2FBY A;  3SQ1 A;  4O4G A;  4DG1 A;  2KQ2 A;  4H4M A;  4FJK A;  2VWK A;  4DTN A;  2OA8 A;  2G8F A;  3QET A;  5EU7 A;  3ITH A;  1TK5 A;  4C8N A;  4W5T A;  3AVM A;  4LH4 A;  3QIP A;  4KV8 A;  3VQ4 A;  2DFH A;  1VSI A;  4B9N A;  5KRT A;  3ZSW A;  1IKX A;  4FJM A;  1B9D A;  3TAF A;  3ZSY A;  4EP5 A;  3PX4 A;  1JXE A;  4OKJ A;  4FXD A;  1WSH A;  1ASW A;  2B6A A;  4M45 A;  2Z1J A;  4FVM A;  4LD0 A;  3DLK A;  1C0U A;  3PY8 A;  1J9A A;  1JL2 A;  1S1T A;  1C6V A;  3KD1 E;  4WE1 A;  3CG7 A;  3T19 A;  4E1M A;  3ZSO A;  3VA3 A;  3KKR A;  3QES A;  3NF9 A;  4BE2 A;  5I3U A;  2BE2 A;  5SZT A;  1SKW A;  4CJE A;  3V9S A;  1WLJ A;  3AVC A;  1NK4 A;  4M42 A;  4CJS A;  3VQ8 A;  1WN7 A;  3O3G A;  1WSF A;  1GOC A;  3DYA A;  3MEC A;  1U4B A;  2E6M A;  2HHQ A;  3OYJ A;  1D9D A;  1RCH A;  1LAW A;  2YNG A;  1BCO A;  1CZ9 A;  1RIL A;  3O4Q A;  4GMJ B;  4DMN A;  3SQ0 A;  3RRG A;  4FJJ A;  4FK2 A;  4Z4I A;  1TK0 A;  2NUB A;  4OKE A;  3ZSV A;  1D8Y A;  4CEB A;  4DU4 A;  3AVK A;  4OLA A;  3IG1 A;  1JLB A;  1RNH A;  3L2V A;  3F73 A;  1C0M A;  2HHX A;  1NJW A;  4CK3 A;  3H08 A;  2QKB A;  2HHU A;  5C25 A;  1U49 A;  2DTU A;  2OZS A;  2X6N A;  3LAL A;  3HO1 A;  4CEO A;  4N56 A;  4DSF A;  4KHS A;  1VRU A;  4G1Q A;  1RT4 A;  4N5S A;  2KFZ A;  3KIO A;  4KPY A;  3QER A;  3V6D A;  2P5O A;  4DLG A;  5HRP A;  3KLE A;  1X9W A;  2O4G A;  3IAY A;  2Z1H A;  4CIG A;  4KB0 A;  3O4N A;  3MXJ A;  4JLH A;  4DLE A;  1UOC A;  4KI4 A;  4AHT A;  3NF6 A;  3MXI A;  5KTQ A;  1T03 A;  4DTP A;  4E19 A;  1L3V A;  5HLF A;  4CJW A;  3OYE A;  3VQA A;  4QCL A;  2QXF A;  4OPK A;  3TAR A;  5CZ1 A;  5HRO A;  1TKZ A;  3NFA A;  4CEC A;  1VSE A;  3QIN A;  4FJ9 A;  4DS5 A;  3MEG A;  4CJQ A;  4HCC A;  4OLB A;  3QIO A;  1VSF A;  1KVB A;  4IKF A;  1HQE A;  4Z4F A;  4IBN A;  3WNE A;  2PZS A;  1L3U A;  3DM2 A;  3ASM A;  3AO5 A;  4CGD A;  3HPH A;  1ZYQ A;  1N5Y A;  1KFS A;  4W5N A;  4CJF A;  3SI6 A;  2F8T A;  4EZ9 A;  3RMC A;  4OGC A;  3FFI A;  2IC3 A;  4JRP A;  4Z4C A;  3NGY A;  3BGR A;  3KK1 A;  3EY1 A;  3VQ5 A;  4O0I A;  1T7P A;  2HNZ A;  4CGF A;  4PQU A;  2HVI A;  1XC9 A;  3AVI A;  2KFN A;  3P1G A;  1RT1 A;  5FRM A;  1VSL A;  5CYM A;  3TAE A;  3TAN A;  3ZT0 A;  2D5R A;  1RDB A;  1RTJ A;  3JYT A;  3SYZ A;  4CJL A;  1RT2 A;  2GV9 A;  3ISN C;  2HW3 A;  1RDC A;  3AVL A;  4CHP A;  4NYF A;  4L8R B;  5KRS A;  1XI1 A;  1S6Q A;  1S1X A;  3NGI A;  1QTM A;  1QSS A;  4M3W A;  2EHG A;  3AO2 A;  3TI0 A;  4KHY A;  3NAE A;  4J2E A;  3TAB A;  3O3H A;  5C24 A;  1VRT A;  2BDP A;  1LWE A;  4KO0 A;  4FK4 A;  3NF7 A;  1C1C A;  1X9S A;  1HYV A;  4B8C A;  3LAK A;  3TAG A;  1I3A A;  2GUI A;  4CF9 A;  3DLH A;  1S9E A;  1LW2 A;  3E01 A;  3LP0 A;  1TGO A;  3AV9 A;  1QQC A;  2VWJ A;  4F2S A;  4KKO A;  4DQP A;  2HHT A;  4RW8 A;  3KK3 A;  4CEQ A;  5HRN A;  1HPZ A;  1QHT A;  3V9Z A;  5I42 A;  3IS9 A;  5C42 A;  3VQ7 A;  4B9T A;  2JLE A;  3I0R A;  4YNQ A;  3HM9 A;  4FK0 A;  3NH1 A;  3VQD A;  3PX6 A;  4ELV A;  4C8O A;  4I9L A;  4FLU A;  4C8L A;  4DFP A;  1KTQ A;  2HNY A;  4HCB A;  1BI4 B;  4DQS A;  5J2P A;  3BDP A;  4CF1 A;  2XRI A;  3SV3 A;  2B4J A;  4E3S A;  3SNN A;  2BGG A;  2B5J A;  3ZCM A;  5DK5 A;  3K5N A;  4LH5 A;  3AVA A;  3LP2 A;  3WNF A;  4PWD A;  4QAG A;  1A5X A;  4B9L A;  3DRP A;  3LZI A;  3K59 A;  3OJS A;  4AIL C;  4IG0 A;  3LP1 A;  2VG6 A;  1BQM A;  3L8B A;  4DFK A;  2A1R A;  1GOA A;  3HP6 A;  4FJL A;  2Z1I A;  3VQ6 A;  3QNO A;  4M41 A;  2KTQ A;  3P83 D;  4ELT A;  2D0B A;  4DSJ A;  1WAF A;  1U47 A;  5J2N A;  4ELU A;  1NOZ A;  4CJR A;  1S5J A;  1JLG A;  3VQE A;  1J5O A;  1JXB A;  4CEF A;  5JS1 A;  4E7I A;  2YNI A;  2PY5 A;  4NYN A;  4DTO A;  2X74 A;  1EXQ A;  3VQC A;  4FJ7 A;  2KW4 A;  4IDK A;  5DMR A;  3JSM A;  3CQ8 A;  4DTU A;  4DFM A;  1LWC A;  3U3G A;  1RDD A;  3TAM A;  2ZE2 A;  3NF8 A;  4B08 A;  1DTT A;  3SV4 A;  1Q9Y A;  5J1E A;  4W5Q A;  3OJU A;  3ZSX A;  3M8P A;  2IDO A;  1KVC A;  1TL1 A;  1WSE A;  4CJK A;  4W5O A;  3LPU A;  4DF4 A;  1L3S A;  2P5G A;  4DQI A;  2EX3 A;  4UQG A;  4OVL A;  2IAJ A;  2G8W A;  1NK0 A;  1FXX A;  3OYK A;  3NBP A;  1RBS A;  4M3Z A;  2X6S A;  4CHO A;  4O44 A;  1JL1 A;  4Z4E A;  4DU3 A;  4O0J A;  2QKK A;  4FZY A;  3L3U A;  4ZTF A;  4DTR A;  3V81 A;  1TV6 A;  3RMD A;  2Y1J A;  1ZBL A;  2BAN A;  3EZ5 A;  3ZSR A;  1T05 A;  4B9U A;  3K5O A;  3DLE A;  5KGX A;  3LZJ A;  1L3T A;  3AA2 A;  4M3Y A;  3V1Q A;  2KZM A;  3MEE A;  1HRH A;  4CEE A;  1WSJ A;  3S9H A;  1W0H A;  1TKD A;  4FZX C;  4H8K A;  4Z0U A;  4CGJ A;  4JS4 A;  3ALY A;  1J54 A;  3OVN A;  3AO4 A;  3O3F A;  2PYJ A;  1S6P A;  3CYM A;  3DLR A;  3AVH A;  3S3N A;  3OYA A;  1L5U A;  4Q5V A;  1S1W A;  3MXM A;  3HVR A;  1DLO A;  3F9K A;  5KI6 A;  3CM5 A;  1BIZ A;  1ITG A;  1FKP A;  1ZBU A;  3C94 A;  4IFY A;  1IO2 A;  2OPS A;  4CFC A;  1BL3 A;  4CF8 A;  2ITG A;  3KK2 A;  3SJJ A;  4CF0 A;  1K6Y A;  1BI4 A;  3ZT3 A;  3KKS A;  2I5J A;  3AVN A;  3DOL A;  3VQP A;  4FJ5 A;  1BIS A;  1VSM A;  3PX0 A;  3KTQ A;  1SL2 A;  3THV A;  4K8X A;  1Z26 A;  1WNS A;  1IH7 A;  3NDK A;  3I8D A;  4BDP A;  2DY4 A;  4FW2 A;  2X78 A;  2OPQ A;  1VSK A;  3RMA A;  4KAZ A;  1RT7 A;  3C95 A;  3T1A A;  1RBU A;  2ETJ A;  4O55 A;  5HBM A;  3AA3 A;  1C1B A;  3PUF A;  4QOZ B;  1X9M A;  1DTQ A;  4BE1 A;  1QSY A;  1JLE A;  1GOB A;  2D0A A;  3V1O A;  4JRQ A;  4F3T A;  1BQN A;  4CIE A;  4I2P A;  4DTS A;  1SKR A;  2HHW A;  4FLV A;  1RTD A;  4OPJ A;  3L3V A;  1Y97 A;  3IRX A;  3I0S A;  1LW0 A;  2HB5 A;  2G8U A;  1TVR A;  1YTA A;  1S9G A;  3S3O A;  1QE1 A;  4GVM A;  1C1A A;  3DRS A;  4ICL A;  4CFA A;  4PUO A;  1IKW A;  4EP4 A;  1TL3 A;  4ID1 A;  4CE9 A;  4HTU A;  2XY7 A;  3SCX A;  2E6L A;  4NCB A;  1REV A;  1WSG A;  2IGI A;  4CJ3 A;  1TKT A;  4E7J A;  3LPT A;  4CEA A;  3QEI A;  3CM6 A;  4BWJ A;  2GBZ A;  4JS5 A;  2VG5 A;  2ATQ A;  2YKN A;  3VQ9 A;  2HHS A;  4YFU A;  3AVB A;  1XHZ A;  4LSL A;  3TR8 A;  2F96 A;  3QEW A;  3U3Y A;  1NOY A;  4KHN A;  1ZBF A;  1UWB A;  5HRS A;  4BAC A;  5J2M A;  3QO9 A;  3QEX A;  4CED A;  3KLF A;  4CGH A;  1JLF A;  3OS0 A;  4ZHR A;  4KRF A;  5K14 A;  4F4K A;  2HVH A;  4B9M A;  3OYC A;  4DSK A;  1RBT A;  1ZBI A;  4CER A;  4AHR A;  1Q9X A;  4KHQ A;  2YHB A;  3QEV A;  3S3M A;  3AVG A;  3HST B;  1VK0 A;  4RW4 A;  4BWM A;  2XY5 A;  2IOC A;  1KFD A;  1NKC A;  4KHW A;  4CGI A;  3HJF A;  1EET A;  3NHG A;  1S1V A;  1RBR A;  1LV5 A;  1KRP A;  1SUQ A;  3DOK A;  3CFR A;  4FLX A;  4E1N A;  1D9F A;  1BIU A;  4CJ5 A;  2XO7 A;  1JKH A;  5FDL A;  1VSD A;  5JS2 A;  4CK2 A;  4CFB A;  4J2B A;  2QK9 A;  2WOM A;  1NK6 A;  4N47 A;  5FRO A;  2FBX A;  5D3G A;  4AHS A;  2LSN A;  3SQ2 A;  2E4L A;  1HYS A;  3CFO A;  1NK7 A;  4FM1 A;  4FLT A;  4B9V A;  1KSP A;  2AJQ A;  1KLN A;  1NK5 A;  1SV5 A;  2F8S A;  1NKE A;  4IFV A;  3HL8 A;  4R5P A;  2G8V A;  3SPZ A;  3RR8 A;  4AH9 A;  4CHY A;  3KLI A;  3G0Z A;  4EZ6 A;  1KVA A;  3HYF A;  4CEZ A;  3K2P A;  3VQB A;  4KTZ A;  4CES A;  5E41 A;  3LAM A;  4AHV A;  4KFB A;  1YT3 A;  2VG7 A;  2YV0 X;  4GW6 A;  4DQQ A;  3SUP A;  2XY6 A;  1CXQ A;  1Q8I A;  5CZ2 A;  4BE0 A;  3ZSQ A;  1KLM A;  2G8I A;  2P51 A;  3NH2 A;  3SQ4 A;  3NE6 A;  5J2Q A;  4CHN A;  4FLY A;  3A2F A;  1JLC A;  3VN5 A;  3HVT A;  3L2Q A;  1LWF A;  3OYB A;  2W42 A;  5HRR A;  4KTW A;  1A5W A;  2Q3S A;  4N76 A;  4NCA A;  1TKX A;  1YVU A;  1YTU A;  1S1U A;  3M8Q A;  4FM0 A;  3DLG A;  1XWL A;  4E89 A;  2OPR A;  4HHT A;  2XHB A;  4FJI A;  1X1P A;  1RT5 A;  3TAQ A;  3QNN A;  1UA1 A;  4J2D A;  3C6U A;  3L2R A;  4DFJ A;  4K8Z A;  1TAQ A;  3KLG A;  1F21 A;  3D45 A;  3P5J A;  3MED A;  2G8K A;  3AVJ A;  3KD5 E;  1EP4 A;  3LWM A;  3CFP A;  4Y1C A;  1NJY A;  3L2U A;  4DTX A;  3V9X A;  2DFF A;  4RW7 A;  1CXU A;  4AHC A;  2WON A;  3LDS A;  4CHZ A;  5CY4 A;  2YHA A;  3ULD A;  3PV8 A;  3ZT4 A;  3ZT2 A;  3SUQ A;  1UA0 A;  4HUG A;  1SKS A;  1KCF A;  4I2Q A;  4FYD A;  1U48 A;  3RWU A;  4N41 A;  3AO1 A;  3RTV A;  3WNH A;  3OYI A;  1B92 A;  4E0D A;  3DI6 A;  2KZZ A;  3KLH A;  4Z4G A;  3K5M A;  4ZTJ A;  3NCI A;  1CLQ A;  4BDZ A;  3QLH A;  3TWH A;  3ZT1 A;  1SL0 A;  3VA0 A;  1RBV A;  2HHV A;  5KGW A;  3NGZ A;  2R7Y A;  2JGU A;  3LWL A;  4PA1 A;  1W9H A;  3OYG A;  1BGX T;  1HNI A;  2D0C A;  2FBV A;  4RW6 A;  3U6F A;  4FJX A;  3V1R A;  1G15 A;  4CJU A;  3OS2 A;  3D0P A;  1EX4 A;  3KJV A;  2OPP A;  3LP3 A;  3T3F A;  1RTI A;  1HJR A;  1NJZ A;  1TK8 A;  1NJX A;  1VSJ A;  4M3U A;  4BDY A;  1HQU A;  1D5A A;  3M8S A;  1HMV A;  3EYZ A;  4KHU A;  3SPY A;  4DU1 A;  4KRE A;  1SL1 A;  1U04 A;  3OYL A;  3RRH A;  4LY7 A;  1ASV A;  1NK9 A;  4F2R A;  4Q0B A;  2O4I A;  2RF2 A;  4DSE A;  4PY5 A;  4DTJ A;  4I9Q A;  3V4I A;  1A5V A;  2YNF A;  3QEP A;  2XY8 A;  3WNG A;  3DRR A;  4I7F A;  4Y1D A;  3B6P A;  4OGE A;  4CJT A;  4CFD A;  3OYM A;  3NH0 A;  2G8H A;  4O5B A;  3SUO A;  3AO3 A;  1LAV A;  1U45 A;  3V9U A;  1J53 A;  2RKI A;  4Z4H A;  1NK8 A;  3OY9 A;  4H4O A;  3B6O A;  3MAQ A;  1RDA A;  2FC0 A;  1TAU A;  4OKK A;  4CCH A;  4CJV A;  4FJN A;  4FZZ A;  1FKO A;  2ZD1 A;  4CJ4 A;  3HXM A;  4J2A A;  4FW1 A;  3SZ2 A;  4W5R A;  2OZM A;  1R0A A;  2OYQ A;  4M3T A;  2RN2 A;  3G10 A;  1VSH A;  2Y1I A;  4KB1 A;  4FCY A;  1NKB A;  1Z25 A;  2HND A;  1FK9 A;  1CZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...