4CIFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cifA00
4DG1A 2HNDA 5JS2A 1KRPA 1IKVA 4CEEA 3V81A 4ELTA 4KB0A 4FJLA 2BGGA 3VQ5A 3PY8A 2D5RA 2XY8A 3AO1A 3DYAA 3LDSA 1NK8A 1VSHA 1KSPA 3OS2A 3KK1A 4BACA 1S9GA 1KCFA 1WNSA 3DRRA 2G8KA 4B08A 4HCBA 4I9QA 1T7PA 4BE1A 2OPQA 1BCMA 3O4NA 4ICLA 4DFMA 4FJKA 4N56A 1ASUA 4RW4A 3PX0A 4KI4A 4DTRA 2XY7A 4WE1A 2FC0A 3V1RA 3JYTA 4J2DA 4DTJA 3ZSZA 4E1MA 4GMJB 4DSIA 1RBVA 4CJ4A 4Y1DA 3RR8A 3ISNC 4UQGA 1RDDA 2D0CA 2GUIA 3TANA 2KZMA 1VSFA 3VQ9A 3TABA 3CYMA 4B9TA 3ZCMA 4CFCA 3KLGA 2Y1IA 1WSGA 1SUQA 1D8YA 1BISA 5DK5A 4CFBA 3RMBA 4FZZA 3CM6A 3SV3A 2D0AA 4F2SA 1BI4A 1QS4A 4IG3A 4OPJA 2F8SA 2G8UA 1YT3A 1CXQA 4J2EA 1RT1A 4FW1A 3P83D 2XRIA 2KQ2A 2XY6A 4B8AB 5CYMA 4CESA 2X74A 1SL0A 2G8HA 4B9UA 4F2RA 3ZSWA 2HHTA 1CZBA 4GVMA 4NYNA 3KJVA 5CYQA 3LZIA 2P5OA 4F3TA 4CJTA 4F3OA 5E41A 4CEFA 4CHZA 4KI6A 4Z4EA 3NFAA 4DQSA 2PY5A 3HPGA 4CJPA 1SL1A 1YTAA 5FRNA 4CHNA 4DF4A 1RCHA 5C42A 4NCGA 4O0JA 3WNEA 4CIFA 1VRUA 1WSFA 4CECA 4CFAA 3OJUA 4E7LA 4LSNA 2ATQA 5DMRA 4DQIA 1KVBA 1TV6A 3AVFA 3MECA 3NH2A 4N5SA 1TK8A 5FRMA 4HUGA 2HHXA 4AHSA 4DQQA 3HL8A 1JLFA 2WOMA 3LP3A 5CZ2A 3AVGA 2XY5A 4QOZB 2PYJA 4Z4GA 1NKBA 5KRSA 3AVHA 1EX4A 4C8OA 1HYVA 3HPHA 4KKOA 3OYNA 3D0PA 3TWHA 1RNHA 3S3OA 1Q9YA 1DLOA 2OPPA 3MEEA 3ZT3A 2E6LA 4KTQA 4B3OA 1X9WA 3SQ1A 1Q8IA 1SV5A 4CK2A 3KK2A 3LZJA 2HMIA 1VSEA 1A5XA 3G0ZA 2FBXA 4BWMA 4RW8A 4F8RA 4RW6A 3DLBA 3I0RA 4LH4A 3NH0A 2YV0X 4FLTA 4N47A 3OYLA 4DTOA 2W42A 3AO3A 4KB1A 1BI4B 4Z4FA 1BQMA 3B6OA 4EP4A 1J5OA 1SKSA 1QSYA 2RPIA 3QEWA 3V6DA 3KKSA 4DTXA 2E6MA 3DOLA 4IDKA 4KV8A 4FK0A 3HVTA 2Z1GA 4OJRA 4FM1A 1WAJA 1XWLA 3QESA 2FBYA 2YNFA 4BE2A 4CHPA 4BDZA 1WSEA 2Z1IA 3QINA 4I2QA 1ITGA 4CEOA 1LV5A 5KRTA 4DFKA 1NOYA 5FROA 4CJKA 4E0DA 4FYDA 1Z25A 3OYIA 4CF0A 4AHCA 4CJQA 2PYLA 1Y97A 3L8BA 2I5JA 1JLCA 1DTTA 2VWJA 1ZBHA 1BGXT 1EKEA 2IOCA 4OKEA 3ZSVA 4E3SA 2HHVA 3U3GA 1RTHA 2KFZA 2G8VA 1S5JA 4DTPA 2YKNA 5J2MA 3DRPA 3PO4A 3TAEA 4LY7A 4W5NA 4DLGA 2E4LA 3T19A 1LWFA 4DWIA 3HP9A 2YNGA 4DQRA 2HHQA 1FXXA 4KO0A 1BHLA 1JL2A 5HRSA 2KFNA 4H8KA 3QEXA 1G15A 3LANA 1HRHA 1BQNA 3OJSA 1RBTA 4MFBA 3D45A 3T1AA 4Z4HA 3FFIA 2VWKA 4CJVA 3TI0A 4FZXC 1HYSA 2HVHA 4PQUA 1MU2A 1VSJA 1TK0A 1R0AA 4CF1A 4CJWA 3L3VA 1B92A 4FLZA 1I39A 1TAQA 3MXJA 3ZSYA 4C8KA 2X78A 4AHVA 3VQEA 4N76A 5K14A 4HUEA 3S3NA 4FJJA 3L3UA 3V9ZA 3SV4A 1QSSA 3ZSOA 4CGJA 3F73A 3PV8A 3C95A 4H4OA 4IKFA 4KHQA 4CCHA 4N41A 1VK0A 4W5RA 3CFPA 3RRGA 4Q0BA 4CF9A 1TKZA 4AHRA 4B9VA 4DTMA 4IFYA 3NHGA 1HNVA 1CLQA 4QAGA 2YNIA 4O4GA 3K2PA 3TAQA 3V9XA 3ZT1A 4NYFA 1RT2A 4FJ8A 1JLGA 1EETA 1KVCA 1RTIA 2Z1JA 5HRNA 2RN2A 1NK4A 2JLEA 1UWBA 1T05A 5J2NA 3HXMA 5HBMA 1IKXA 4FW2A 1LW0A 3V9SA 2YNHA 3NF7A 3AO4A 2HW3A 2OPRA 5I3UA 1ASWA 1U48A 4FVMA 3LAKA 3NDKA 4CGIA 3KLEA 4EZ9A 2F8TA 3OVNA 4CF2A 1QTMA 1VSDA 4CEDA 4DS5A 2ZE2A 3IRXA 5D3GA 3OYFA 2EHGA 4JRPA 1U4BA 4BWJA 3V1OA 1CZ9A 2XHBA 2VG5A 3RTVA 1IKWA 4LSLA 4B9LA 5HLFA 4TSXA 3TAFA 2X6SA 1S1WA 1S1UA 3VQDA 1L3VA 3SUNA 2VG6A 3QNNA 3VQ4A 2HNZA 1NOZA 3SYZA 1X9MA 2BANA 3H08A 1K6YA 2FBVA 1U04A 1BIZA 4LD0A 3OYAA 3NF9A 4I9LA 3KLFA 3M8RA 4FLYA 4DSFA 1WAFA 4KRFA 5HRRA 3PX6A 3L2UA 4C8NA 3HSTB 2ZQBA 1HQEA 3OYEA 4B9SA 4DSJA 1NKCA 4W5TA 2QKKA 4CJLA 1WSIA 4DS4A 4MQ3A 3VA3A 5CZ1A 3OYJA 4K8ZA 4CHOA 2HHSA 3T3FA 2OZMA 3TARA 1NK9A 1HNIA 4CIGA 3AA5X 2KZZA 5JS1A 1U49A 2ETJA 3RWUA 3SUPA 4FM0A 4DSEA 4Y1CA 2B6AA 4EZ6A 3KLIA 1C1AA 1SL2A 1IH7A 5CY4A 4CF8A 3O3FA 1D9DA 4CEQA 3WNFA 3HO1A 3NCIA 1S1TA 3CFOA 4M42A 4Z4IA 4AILC 4M3UA 3OYBA 4FJ7A 3OYMA 2VG7A 1L5UA 4FJNA 2OA8A 4DSLA 3C6UA 3ZSXA 1ZBLA 1S1XA 2D0BA 4HVJA 4B9NA 3BDPA 4IG0A 4R5PA 1I3AA 3EYZA 1HQUA 1QSLA 1TL3A 2Q3SA 4E1NA 3MEDA 4OVLA 4RW9A 3DLGA 1FKPA 3AVCA 4CGDA 3O3HA 4JRQA 2G8WA 4FZYA 3SI6A 2DFHA 3LWMA 1N6QA 4Z4CA 1RILA 3OYKA 1W0HA 2P51A 2NUBA 4KTZA 4DMNA 1QE1A 3JSMA 3VQ8A 3OS0A 4DFJA 3SUQA 3RMAA 2HVIA 4YFUA 3L2VA 3WNHA 3V4IA 2B4JA 3ZT2A 4BDYA 5KGWA 1NJZA 1UOCA 3P5JA 4M3ZA 1JLQA 1LAVA 3DMJA 1JLEA 4CERA 4M41A 3LAMA 4M3TA 5KGXA 4DF8A 4PA1A 1NJYA 1SKWA 3HVRA 4QCLA 3AA2A 1IG9A 4ZHRA 1TGOA 4OGEA 2OYQA 3NAEA 3HK2A 3TAMA 1NK5A 1HYZA 1A5WA 1YTUA 4O44A 1X1PA 3NGIA 4CK3A 1Q9XA 2QKBA 2IAJA 4FJ5A 3CM5A 3VQAA 1B9FA 1RBSA 4KAZA 3PX4A 4G1QA 1X9SA 1FKOA 3EZ5A 5J1EA 1RTJA 4IFVA 1TKTA 3AVMA 1HJRA 2RKIA 3AVKA 3LWLA 4RG8A 4DQPA 4CJ3A 4FCYA 1L3SA 2F96A 2JGUA 3QLHA 3MEGA 4KTWA 3K57A 3RMCA 3CFRA 1GOAA 4AHTA 2HNYA 1C1CA 3VQQA 4KFBA 1CXUA 4FK2A 4FM2A 3SUOA 4NCBA 4IBNA 4O55A 2RF2A 3IG1A 3KK3A 3AVAA 3G10A 2XO7A 1GOCA 4KHYA 4HTUA 3KIOA 5HRPA 1RBRA 3DRSA 3VN5A 1XHZA 1KVAA 1WSHA 3HPOA 2DTUA 3AVIA 2HB5A 4E7IA 4FLXA 1A5VA 3RMDA 4CFDA 3A2FA 4C8MA 4Q5VA 3K5NA 4E7HA 4E19A 4FLUA 2PZSA 2HHWA 1XHXA 3MXIA 3K58A 1ZBUA 3SNNA 1LWEA 4FJ9A 3P1GA 1Z26A 3V1QA 3QETA 3SPYA 3VQ7A 4XIUA 2BE2A 3ALYA 2DY4A 3HJFA 4Z0UA 1T03A 1VSMA 2IS3A 4E89A 5C24A 1ZBFA 3U6FA 1WSJA 4YNQA 1NJWA 1SKRA 3S9HA 4ZTFA 1RT4A 3KKRA 4PWDA 5SZTA 1JKHA 2OPSA 4LH5A 3VQPA 5HP1A 4FLVA 1KTQA 4ELUA 5KI6A 4CIEA 4KHWA 3SPZA 1IKYA 1HMVA 3LPUA 4BE0A 4F4KA 3M8SA 3K5MA 3V9WA 4DFPA 3SQ4A 1RTDA 3IAYA 1KLNA 4JS5A 1JXEA 4W5QA 4J2BA 3QERA 1RDBA 3LP2A 4ELVA 2YHBA 1RT3A 1VSKA 3K5OA 3OYGA 4DU3A 3KD5E 4CJ5A 1S9EA 5J2QA 1EP4A 4KHNA 3TAGA 2OZSA 3DM2A 4CE9A 4KHUA 4DU4A 3M8QA 1VRTA 1D9FA 4FJXA 3OYCA 3B6PA 2IC3A 1REVA 3NH1A 3SJJA 4FJHA 1BL3A 3OYHA 1UA1A 3O3GA 4DU1A 3IS9A 3TR8A 1LW2A 4M3XA 1RDCA 4M3WA 3CQ8A 1O1WA 3AVLA 3ZT0A 3K59A 3L2WA 1NK0A 4FJMA 3ZSRA 3KLHA 3SQ0A 4K8XA 3VQCA 4ZTJA 4I2PA 1TAUA 5KTQA 1RT7A 3AVBA 4ID1A 3QIOA 1XI1A 3AA4A 4OKKA 1QHTA 1C1BA 3KTQA 1VSIA 3DLRA 4DLEA 1XC9A 3OYDA 4PY5A 3I0SA 1UAXA 1LAWA 1TVRA 4M45A 4CGGA 3UIQA 2O4IA 1TKXA 1NK7A 3MXMA 3F9KA 4KPYA 2KTQA 4CEAA 3VQ6A 3HP6A 4AH9A 1EXQA 1UA0A 4FLWA 1S6PA 3SQ2A 4ID5A 1ZBIA 3LP1A 1WN7A 3AA3A 2R7YA 2G8FA 1T8EA 4OGCA 1W9HA 3ZSQA 3WNGA 4JLHA 4AHUA 3LP0A 5SWMA 3OS1A 5HROA 1L3TA 1C0UA 3DLHA 3HM9A 4CHYA 4B9MA 3QEIA 1NJXA 3SCXA 1IO2A 3AO5A 3C94A 3NF6A 3OY9A 4HUFA 1TL1A 3U3YA 2ITGA 2DFFA 4DSKA 1B9DA 2LSNA 3PO5A 4CJUA 3BGRA 1C0TA 4O0IA 2BDPA 4CEZA 1HPZA 4H4MA 3L2RA 4FJIA 1NK6A 2QXFA 1S1VA 1ZYQA 1F21A 1J54A 4CK1A 2P1JA 1D5AA 2YKMA 3QNOA 1L3UA 3ITHA 5EU7A 4JS4A 3O4QA 1N5YA 2FBTA 1RDAA 3DLEA 3KD1E 4M3YA 4B8CA 1C0MA 4DTNA 2IDOA 4FXDA 3M8PA 3RR7A 3DLKA 1JLBA 4OLBA 4CJFA 4I7FA 4E7KA 2A1RA 4OKJA 1U47A 4CJEA 1TK5A 2EX3A 4OLAA 3ULDA 2A1SA 3EY1A 5FDLA 3VA0A 5I42A 3QO9A 3AO2A 2IGIA 2G8IA 3NF8A 3QEPA 2DFEA 1ASVA 4DTUA 4EP5A 1S6QA 1J53A 3VQBA 4BDPA 3QEVA 1NKEA 3C6TA 3L2QA 4NCAA 3E01A 3PUFA 4CEBA 1C6VA 5C25A 3NGYA 1J9AA 1QQCA 2WONA 3CG7A 1BCOA 4O5BA 2Y1JA 1GOBA 3DOKA 4CGFA 4KHSA 1FK9A 1RT6A 4C8LA 4CJSA 3AV9A 5J2PA 4OPKA 1RBUA 4GW6A 4CHQA 3ZT4A 1TKDA 3LALA 1RT5A 3SZ2A 4CJRA 3HYFA 2KW4A 1BIUA 4M3RA 3I8DA 2AJQA 1LWCA 2HHUA 4E7JA 3K5LA 4PUOA 2ZD1A 2QK9A 2GBZA 2X6NA 3LPTA 3MAQA 1U45A 4L8RB 4FK4A 3NBPA 4HCCA 3NGZA 4FJGA 2GV9A 3AVNA 1YVUA 3S3MA 3V9UA 1KFSA 4J2AA 3THVA 4HHTA 3TAPA 1JLAA 1KLMA 3RRHA 1VSLA 3NE6A 1KFDA 1WLJA 2B5JA 2Z1HA 4KREA 1DTQA 2O4GA 5T7BA 4RW7A 3DI6A 1JL1A 1JXBA 3QIPA 4DTSA 3AVJA 3HT3A 4CGHA 4W5OA 2P5GA 3ASMA 2YHAA
chains in the Genus database with same CATH superfamily
3JXUA 5JS2A 4RTFD 1IKVA 4CEEA 1HUXA 4IOAL 3BUZB 5AZIA 4K0KK 1NK8A 1VSHA 3DRRA 3QDKA 2NRVA 3MK6A 3O6WA 2NRWA 2P9NB 4I9QA 4CZJA 4BE1A 3MWPA 4DFMA 1ASUA 3PX0A 3R8EA 1IBKK 1ZC6A 4E1MA 2Q0RA 4GMJB 4K41A 5HOOA 3RR8A 3ISNC 1RDDA 2D0CA 2GUIA 3D7EO 1X3MA 2D0PA 3ZCMA 3KLGA 1BISA 2WUSA 2FLOA 4BQLA 2D0AA 4GVEA 4IO8A 1HJOA 4J2EA 5MLCQ 4BR4A 4CESA 5F1XA 2X74A 4F2RA 3ZSWA 3KJVA 3LZIA 2YHYA 4DQSA 3VEYA 3PIOL 3WNEA 3WQTA 4IOXA 1Y64A 4CECA 4CFAA 1WBDA 3THYB 4DCHA 4HUGA 1IBLK 3F5TA 3HL8A 1JLFA 1T3VA 5ELZA 4QOZB 4Z4GA 1NKBA 3CC7N 3O9TA 4K42A 3D0PA 3TWHA 3S3OA 4FSVA 3TTDA 3HM8A 3MEEA 3CERA 3CCVN 3KK2A 4O8UA 4BWMA 4RW8A 4F8RA 1KAYA 3DLBA 3I0RA 3NH0A 2QWNA 2W42A 2F9TA 4KB1A 1BI4B 3CJ9A 1BQMA 3B6OA 2UU9K 1J5OA 1QSYA 4GV9A 3QEWA 4FK0A 4FO0A 2UXBK 4B3OA 4OJRA 2Z1GA 1GLDG 2FBYA 2ITMA 4CHPA 1LV5A 1GLAG 4CJKA 4FYDA 3OA9A 3L8BA 3SJHA 4W5NA 4LY7A 2A3ZA 5M1KA 1NGGA 3HZ6A 2YNGA 1JL2A 4H8KA 3LANA 1ATSA 2FSKA 3P31A 3T1AA 3FFIA 1NM1A 3VPZA 3CJ7A 4A62A 1YJNN 4PQUA 3S41A 4U67L 4YY3K 4CJWA 5BRFA 4O8KA 3ZSYA 4JI2K 5AQLA 5K14A 3ENOA 1Z6RA 1QSSA 3QICA 3ZETA 3PV8A 4H4OA 4KHQA 3DXMA 4CCHA 4N41A 1EWRA 3C65A 3RRGA 4BC4A 4AHRA 4B9VA 3SK3A 3ZT1A 4NYFA 1RTIA 1NK4A 3E66A 4NB4A 1LW0A 1K8KB 2V7ZA 2OPRA 5I3UA 5EY4A 4BG8A 4LF6K 4FVMA 4WQ4C 3NDKA 4EZ9A 1S3XA 2ZE2A 3IRXA 2HBMA 1QZ6A 4YDUA 3V1OA 3FR0A 1NMDA 2X6SA 3CCJN 1S1WA 1S1UA 3VQDA 1EQYA 1XUPO 4FWNA 3SUNA 3QNNA 5FPNA 2HNZA 1NOZA 3CCLN 2BANA 3H08A 3J7ZO 2PAVA 3OYAA 2F4VK 3M8RA 4FLYA 1WAFA 4KRFA 5HRRA 4C8NA 3OYEA 4B9SA 4IO9L 4KH4A 4MQ3A 3VA3A 4LFAK 4K8ZA 4CHOA 1NK9A 3AA5X 1BDGA 3RWUA 4DSEA 2OTJN 2IVOA 1C1AA 3KLIA 3E9PA 5AQNA 4A5BA 2P9LB 3VF6A 3KHYA 3NCIA 4GKJK 4A59A 3OYBA 4DSLA 3CQXA 3ZSXA 1S1XA 3DXKA 2OANA 5KPRA 3IUCA 2NZTA 3A8YA 3BDPA 4IG0A 4DV5K 1C0FA 1QSLA 3O3HA 4JRQA 4OVLA 4CGDA 1FKPA 4FZYA 5BRHA 3VGKA 2NRXA 4KTZA 2QM1A 3SUQA 4DFJA 4J8FA 3CETA 1VQLN 3ZT2A 3R1XA 1NJZA 4DR3K 1HR0K 1UOCA 2YHXA 3U8XA 1LAVA 3DMJA 4I6MA 4PA1A 2P9PA 3L0QA 3O08A 4QCLA 1IG9A 4ZHRA 1TGOA 4OGEA 2OYQA 4GY2B 2QKBA 1X1PA 1BO5O 2IAJA 4FJ5A 4JD2A 3J8AA 1RBSA 4IFVA 4NXMK 1HJRA 2RKIA 2Q1NA 4ISFA 2D1KA 2A5XA 1NGFA 3C7NA 3SUOA 3QFUA 3KK3A 3ENBA 2VQFK 2XO7A 5AQZA 2HMPA 1D4XA 2RHKA 3AVIA 2Q31A 5EVZA 4C8MA 4Q5VA 3K5NA 3A5NC 1QZ5A 3TSPA 3MXIA 3SNNA 2BH1A 2A41A 3SPYA 4FWPA 2BE2A 4XIUA 3HJFA 4Z0UA 2VWBA 1CZAN 1ZBFA 1T6DA 3KWGA 4FWOA 4NXNK 4BR9A 4ZTFA 4PWDA 5SZTA 2OPSA 3OHRA 4DR5K 3E9LA 3DJCA 1HMVA 4BE0A 3M8SA 3V9WA 4DFPA 4JS5A 5C15A 4W5QA 3FE1A 3EKSA 5LJWA 3JS6A 3CI5A 5J2QA 4BRLA 4JK8A 4KHNA 2OZSA 4KHUA 3ATUA 4DU4A 4B3RK 2E2NA 1VRTA 1NGIA 1D9FA 3GL1A 2QTDA 4FJXA 1REVA 2WFBA 4Y0WA 3O3GA 4DU1A 1LW2A 4FWLA 4LF9K 1X3NA 1O1WA 3K59A 3A0IX 3ZSRA 3QIOA 4OKKA 3K0SA 3ZETB 3KTQA 4B9QA 2O8CA 1VSIA 3D2FA 4DV1K 3MXMA 3F9KA 1UA0A 1S6PA 3UKUB 2O8DB 3M3ZA 3AA3A 2R7YA 5JMVA 1W9HA 3AGRA 3O9RA 1EO1A 1G99A 4CHYA 4B9MA 1NJXA 3UKRA 3C94A 5FPEA 2DFFA 1RGIA 4DSKA 3K9JA 3WXJA 1B9DA 4CEZA 1HPZA 1NK6A 2QWOA 1D5AA 3KD5E 3KD1E 4B8CA 1C0MA 4DTNA 2IDOA 1U47A 4OLAA 5AQWA 2A1SA 2AP1A 3OBYA 5JICA 3QO9A 3VTIA 3QEPA 4DUZK 1S6QA 3VQBA 5BR9A 2P9NA 3C6TA 3E01A 1YAGA 3FZLA 3NGYA 3CMEN 1BCOA 4LF5K 4O5BA 3DOKA 4KHSA 1RT6A 4JKEA 4CJSA 4DHYA 4A57A 4OPKA 3T1YK 4CHQA 3ZT4A 2VYPA 3LALA 5C12A 4DV0K 4M3RA 3O9SA 3DXKB 4XEIA 3K5LA 3FFKB 2VGMA 4J2AA 2FSNA 4HHTA 1JLAA 4DB3A 2QI2A 3RRHA 4CZGA 4FWSA 4KREA 3TSUA 3QIPA 3HT3A 4CGHA 5H1SQ 5AQPA 3IFRA 3ASMA 1EWQA 1N8RO 4DG1A 1KRPA 4ELTA 3H1VX 3PY8A 2XY8A 3LDSA 4IOCL 3THYA 3SMPA 3W0LA 1Z05A 1VAZA 4JHDB 2ASMA 3D6RA 4ICLA 4DQ8A 3CCUN 3SAHA 4KI4A 4WE1A 2FC0A 3V1RA 1XNQK 3O80A 4DSIA 3C6HA 4H0OA 3TANA 3BY5A 4CZLA 2Y1IA 1SUQA 1IBMK 1V4TA 5E26A 3RMBA 4B3MK 3CM6A 5DM7L 3KZBA 3SV3A 1VQMN 1BI4A 2HHHK 1SL0A 1MWMA 4JKHA 4YOXA 4LFCK 1CZBA 4FWKA 4GVMA 5CYQA 4CHZA 3NFAA 3VOVA 3N4PA 4DF4A 5AQHA 4Z4EA 5C2FA 4CIFA 1VRUA 3A5MC 4LSNA 1QQOA 2ATQA 1Q86O 4DQIA 1TV6A 4N5SA 4AHSA 3IDHA 1QQNA 2WOMA 1VQKN 3AVGA 3AVHA 2F7TA 4LC9B 4C8OA 3O8MA 3HPHA 4KKOA 3EE8A 4GV6A 2W41A 1DLOA 2OPPA 3ZT3A 2V7YA 2NRHA 5LJVA 1SV5A 5BN9A 3G0ZA 2FBXA 4CBWA 4RW6A 1ATNA 2YV0X 3AY9A 1XC3A 4N47A 2UUCK 4DTOA 2ASPA 5FPDA 3AO3A 1Q7YO 4A2BA 4JI3K 1ESVA 5FPMA 4DTXA 4FM1A 1N34K 1WAJA 3EEQA 4U7BA 4BDZA 1WSEA 4CEOA 4I2QA 1K8KA 3A5LC 4BQZA 1SS6A 1HNXK 3QBWA 3OYIA 3H45C 4AHCA 4CJQA 3TTCA 1ZBHA 1DTTA 1EKEA 1ZBSA 2IOCA 4E3SA 1RTHA 5J2MA 4WCEL 3PO4A 3MN7A 3TAEA 3T19A 1LWFA 4DWIA 1U6ZA 4DQRA 4CD1A 3BP8A 4H0TB 4WFAL 3OJSA 1RBTA 4MFBA 4CD3A 1HYSA 2HVHA 1MU2A 1VSJA 2DPNA 3DAWA 3FZMA 1J5EK 1I39A 4C8KA 3UB5A 2E88A 3L6QA 3VQEA 4N76A 4HUEA 5LMUK 3V9ZA 4EHTA 3E1YA 4CGJA 2IIRA 4W5RA 3CFPA 3LDQA 3PSIA 5BN8A 4FOEA 3O4WA 4IFYA 5LY3A 1HNVA 1CLQA 4QAGA 2YNIA 2P9LA 3K2PA 1Q81O 3TAQA 1EETA 1KVCA 3HXMA 5KQ8A 3GE1A 5AQXA 3V9SA 3NF7A 4H5VA 3AO4A 4JKFA 1ASWA 2GWKA 2O8EA 4CGIA 3U4LA 3CJ1A 3CD6N 2F8TA 1QTMA 3CCRN 4CEDA 2ZM6K 3G6EN 3OYFA 2EHGA 1CZ9A 2XHBA 1IKWA 1VQ4N 5HLFA 2NNWA 4JI1K 3VQ4A 3G25A 3CCSN 1K6YA 4JKDA 4LD0A 3WXIA 3VEOA 3PIPL 2CGLA 1HQEA 1QHAA 4CJLA 4CVNE 3T3FA 2KZZA 1HNIA 5JS1A 3RSEB 5JVGL 4EZ6A 4Y1CA 5AZJB 4DV3K 1SL2A 1IH7A 4JKGB 4CF8A 1D9DA 4CEQA 3WNFA 3CFOA 4C1NI 5CHIA 3LDPA 3OYMA 4DR1K 3M6GA 3C6UA 4IXCA 3GOIA 1ZBLA 4HVJA 4DR7K 2P9UB 4R5PA 1I3AA 3PLAA 2CGJA 2OCEA 1BU6O 4E1NA 3MCPA 3MEDA 1SZ2A 2DFHA 1K8AO 1W0HA 4DMNA 3OS0A 1O13A 5AQJA 3VF4A 4BDYA 1VQON 4H5WA 3G4SN 4MO4A 4M3ZA 4WQ5C 4B1WB 4QS7A 5AQMA 1NJYA 1RDUA 1SKWA 5AQGA 3LM2A 2BTFA 3CCEN 1HYZA 1A5WA 3R6MA 3NGIA 3I56N 1S72N 5F2RA 3CM5A 3VQAA 1B9FA 4KAZA 3NVKA 2HBLA 4BRAA 3EZ5A 1RTJA 1TKTA 3LWLA 4G9ZA 1TYQB 2F96A 3QLHA 3MEGA 3DLLL 3AAQA 4BRFA 2HNYA 3VQQA 1I94K 4KFBA 5GADP 4NCBA 4IBNA 4O55A 3IG1A 5GAHP 3G10A 1GOCA 3KIOA 3DRSA 1VQPN 4FWQA 2HB5A 4E7IA 2Q0UA 3THWB 4CFDA 4FLUA 3K58A 2PFUA 3P1GA 3QETA 3CJCA 1VSMA 2Q97A 3UKUA 2O8DA 2HF3A 2WC9A 4YNQA 1NJWA 3ZEUB 4BY9C 3P39A 1HPMA 3O9UA 4FLVA 4CIEA 4JK9A 1IV0A 4E1JA 1NJIO 3IAYA 1RDBA 3LP2A 1RT3A 1VSKA 1YXQA 4CZIA 1E3MA 4CJ5A 3C0BA 1EP4A 4GKKK 4LF4K 1KXPA 1NNEA 1VQ7N 5AQRA 3B6PA 4FJHA 4H0XB 2FF3B 3M5RA 1NBWA 4JI4K 2E1ZA 3TR8A 4JYAK 4BR0A 4M3WA 3CQ8A 5C0YA 3ULEB 4FJMA 1TAUA 2GX9A 4BRKA 3IKMA 3AA4A 1TVRA 3MDQA 3J81O 1TKXA 4H5NA 3WT0A 2KTQA 3HTVA 4AH9A 1EXQA 3SQ2A 1ZBIA 3ZSQA 4JLHA 4AHUA 1L3TA 3OS1A 3DLHA 2GWJA 3VEWA 3KK7A 2O8EB 3NF6A 3O1BA 3SAFA 2FSJA 2ITGA 3PO5A 1BUPA 1C0TA 4O0IA 3CC4N 2BDPA 3E9OA 4H4MA 3L2RA 4FJIA 3FZFA 3WXLA 1S1VA 1ZYQA 1L3UA 4JS4A 3KWIA 3LDOA 2BUPA 3M8PA 3RR7A 1K73O 4I7FA 4E7KA 4OKJA 3ULDA 1NGHA 2IVPA 5FDLA 5I42A 3AO2A 2IGIA 3NF8A 3R3LA 1ASVA 5AR0A 5ADXH 3T1HK 1M90O 2F9WA 5EXWA 4JHDA 1BOTO 3PUFA 2E2OA 1H1VA 2Q36A 3MX2A 1JCFA 4C8LA 5J2PA 2QWLA 1TKDA 3HYFA 2KW4A 1BIUA 3I8DA 1OH5A 2HHUA 4E7JA 2QK9A 3LPTA 2FXUA 3MAQA 4FJGA 1KFSA 1VQ9N 5B8HA 2Z1HA 3J7AP 3Q7CA 5F0XA 4WQ4A 4DTSA 5BR8K 2KKZA 4KHPK 4W5OA 2P5GA 1N36K 3VQ5A 2VQEK 3DYAA 2QWQA 3OS2A 4BACA 1S9GA 5AJ3K 1WNSA 1YI2N 4JKAA 4BROA 1T7PA 2OPQA 1BCMA 1YJ9N 4FJKA 4JNEA 4DTRA 2XY7A 2WTUA 4B1YB 4CJ4A 2VGNA 3OW2M 3TABA 3HOSA 3CYMA 4CFCA 3HSCA 3SAGA 1D8YA 5DK5A 4CFBA 4FZZA 1GLJO 4IG3A 2F8SA 2G8UA 3MCAB 1YT3A 1CXQA 4BC2A 4YHHK 1RT1A 4FW1A 2XRIA 4PKHA 2KQ2A 2XY6A 3VESA 4B8AB 1HX1A 1HNZK 4IFEA 4NYNA 4F3TA 1NGAA 4CJTA 5E41A 4KI6A 1SL1A 1YTAA 4BVOA 4OX9K 4BRCA 5C42A 2O8FB 4B1XB 4O0JA 4E7LA 3OJUA 1GLBG 4CJ7A 3AVFA 3MECA 1TK8A 5FRMA 3VENA 2WBNA 3LP3A 5CZ2A 2XY5A 5KRSA 3I8BA 3P38A 4BGBA 4M63C 4KTQA 1X9WA 3SQ1A 1Q8IA 3LZJA 2KHOA 1A5XA 4HWIA 4PL8A 2JWLA 4BR7A 3TU5A 4LH4A 1V4SA 2A40A 4FLTA 1QVGM 3K9KA 3NVMA 3N4QA 4JI5K 4IDKA 5AQVA 3IMXA 4DFKA 4H5TA 5FROA 4CF0A 2PYLA 1Y97A 2I5JA 1JLCA 2VWJA 1VQ5N 2IVNA 4GV3A 1J6ZA 2HHVA 1S5JA 2YKNA 2P9IB 3DRPA 3U9DA 4DUYK 3HP9A 2HHQA 3QEXA 1VQNN 4O5FA 5TKYA 3EKUA 3D45A 4Z4HA 2VWKA 4CJVA 4ISEA 3TI0A 5JVHL 4QS9A 4CZKA 3P4IA 4JI6K 1TK0A 1R0AA 5AQSA 4FLZA 1TAQA 3MXJA 3S3NA 4FJJA 4FWMA 2P9KB 1HLUA 4IKFA 3RSEA 1S22A 1VK0A 1WOQA 5AZJA 5AQOA 4JKGA 2GTDA 3V9XA 1RT2A 3HOTA 2Z1JA 2RN2A 3M1FA 5HBMA 1NGJA 2P9UA 2EWSA 4JAXA 2HW3A 2ZJPL 3BF3A 3LM9A 1U48A 3KLEA 1KQSM 2YI1A 3OVNA 4CF2A 4DS5A 3SMSA 5D3GA 1TUYA 4JRPA 1U4BA 4BWJA 3RTVA 1MA9B 4B9LA 2ZF5O 4TSXA 3R9PA 2PBDA 3O9QA 4IJAA 4K43A 4B3TK 4X62K 5CR4A 2O8BB 3SYZA 4EIAA 1X9MA 3EE9A 2FBVA 1BIZA 4I9LA 3VEZA 5BRDA 4DSFA 3TSQA 1GLEG 4BRHA 3L2UA 4DSJA 2FF6A 4YOWA 3LL3A 5EOYA 4JEPA 4W5TA 2QKKA 4LF7K 3J80O 3H3OB 1BWFO 4DR4K 3OYJA 2HHSA 3LDNA 1U49A 3SUPA 5AFUA 4FM0A 2B6AA 4BVPA 2QWRA 1TYQA 5C10A 5CY4A 1YF5L 3O3FA 3HO1A 1S1TA 4IEEA 4Z4IA 4AILC 4M3UA 4FJ7A 2VG7A 1L5UA 2GELA 4FJNA 2OA8A 3A5OC 4CZEA 4YOYA 4EHUA 3THWA 1HQUA 1TL3A 2Q3SA 3ZX3A 4CZHA 4BG9A 3SI6A 4Z4CA 3OYKA 3JSMA 3RMAA 2HVIA 3L2VA 3WNHA 3VEVA 3V4IA 2UUBK 3I55N 3P5JA 1LCUA 1ILYA 3ZEUA 1JLEA 4CI6A 4CERA 4M41A 1P90A 1VQ8N 3HK2A 5EX5A 4O44A 4H0VB 1DKGD 1KD1O 1X9SA 5AQTA 1W2BM 4UY8O 2NRTA 3RVCA 4CJ3A 2A6AA 1L3SA 2ZGYA 3RMCA 4BRPA 1XMOK 1GOAA 3EL2A 4DV4K 4FK2A 2HBKA 2E2PA 1SAZA 2YHWA 2RF2A 2AA4A 4JI0K 1HKBA 4BC5A 3ULEA 1RBRA 3VN5A 3MN9A 1WSHA 2DTUA 2CGKA 4FLXA 4AM7A 3RMDA 3A2FA 2PZSA 2HHWA 3EN9A 1XHXA 1LWEA 5AFUH 1YIJN 3ALYA 2DY4A 4PHTX 1T03A 4E89A 4IWVA 3U6FA 1WSJA 2Q2RA 3SBTA 3AGKA 3S9HA 1RT4A 4QS8A 1JKHA 3FGUA 2YCHA 4ELUA 5GAEP 1IKYA 3ENHA 4F4KA 1HNWK 3K5MA 3QBXA 1JXEA 1YHQN 3QERA 4ELVA 4X64K 2YHBA 3W3DA 3OYGA 4DU3A 4MLHA 4CE9A 5AQIA 3OBWA 2W6KA 3OYCA 3VERA 5BPLA 1W97L 3SJJA 1YUWA 4IZ9A 2E8AA 1BL3A 3ATVA 1UA1A 3IS9A 5AQQA 3VMFB 4M3XA 4MDBA 1HKGA 3ZT0A 5GINA 3L2WA 4JV5K 1NK0A 4YOVA 4OPAA 3SQ0A 3VQCA 4ZTJA 4I2PA 3AVBA 4ID1A 4NLBA 1MDUB 3MX5A 1C1BA 3DLRA 1XC9A 4PY5A 1U2VB 1UAXA 1LAWA 4CGGA 2O4IA 1NK7A 4MO5A 4YDUC 4CEAA 3VQ6A 3HP6A 4ID5A 3LP1A 4AM6A 4FPAA 1RDWX 2UYTA 1T8EA 3WNGA 3H46O 3LP0A 2W6LA 5HROA 1C0UA 1DEJA 3QEIA 4JI8K 3SCXA 3VGMA 4EAHD 4HUFA 2NLXA 1TL1A 3H6EA 5M1OA 4CJUA 2QXFA 1F21A 1J54A 2ZWHA 4CK1A 3QNOA 2YKMA 3OTOK 3ITHA 5EU7A 5BPMA 3O4QA 2FBTA 1RDAA 1Q18A 3DLKA 5GIPA 4CZMA 5BPNA 1TK5A 3NMUA 2EX3A 3EY1A 3VA0A 3ZYYX 3MWTA 3Q7BA 4K25A 4EP5A 1J53A 3WEEB 3GBTA 2HSTA 1NKEA 4BREA 3L2QA 1C6VA 5C25A 1QQCA 3CG7A 4AQYK 2Y1JA 5KQDA 1GOBA 5M1PA 4CGFA 1FK9A 3AV9A 2E1YA 3D2EB 4GW6A 4H5RA 3MN5A 3U9ZA 3SZ2A 3WQUA 4H03B 3J7YP 1OVQA 1VHXA 4MLEA 2AJQA 1LWCA 4B1VA 4OO1J 4AF1A 2GBZA 4L8RB 1U45A 2KLAA 3NBPA 2OTLN 4HCCA 3NGZA 2GV9A 1YVUA 3S3MA 3V9UA 1KLMA 1VSLA 1JCGA 1KFDA 2B5JA 5T7BA 3DI6A 4F9OA 1JXBA 3AVJA 2YHAA 2UUAK 2HNDA 3V81A 3UE5A 4KB0A 4FJLA 4OPHA 2BGGA 3QMLA 2O8FA 2D5RA 3AO1A 3F2KA 1KSPA 4B1UB 3KK1A 1KCFA 4H0YB 5ADXA 2G8KA 2NRRA 4MDAA 4B08A 4HCBA 4RCHA 2P9SB 4M7YA 3O4NA 3ID6A 4N56A 4RW4A 3JYTA 3CXCM 4J2DA 4DTJA 3ZSZA 3H1QA 1WBBA 2UXDK 5LL6Z 3F9MA 1RBVA 4GNIA 3C6AA 4Y1DA 4IEIA 4FL9A 4UQGA 2KZMA 1VSFA 3VQ9A 4LFBK 3T69A 4B9TA 1WSGA 1KAXA 4F2SA 1QS4A 4OPJA 3FLCO 3THXB 3LDLA 4FWRA 3P83D 2A42A 1NWKA 5CYMA 4B3SK 2G8HA 4B9UA 2HHTA 4PKGA 4LF8K 2P5OA 4F3OA 4CEFA 5AQFA 2PY5A 3HPGA 4CJPA 5FRNA 4CHNA 4XH4A 1RCHA 4NCGA 5AZIB 1WSFA 2P9IA 4C23A 1QVFM 2QXLA 4BRMA 5DMRA 1KVBA 2J4RA 1FW6A 4WQ5A 2HHXA 3NH2A 4BGAA 3CQYA 4CW7B 4YOTA 4DQQA 4ISGA 4BRIA 2QW9A 3I33A 1IG8A 4KH6A 2PYJA 1EX4A 1HYVA 1GLCG 3OYNA 1RNHA 1Q9YA 3CJAA 4A2AA 2E6LA 3GDQA 4M7XA 4CK2A 4EFHA 5CE3A 1KAZA 2ASOA 1VSEA 1NGBA 3T7ZA 2HMIA 2P9KA 1YJWN 4WF9L 3PSFA 5AQYA 4YORA 3CIPA 3OYLA 4Z4FA 4BRQA 4EP4A 4KH5A 1SKSA 5IWAK 2RPIA 3V6DA 3KKSA 2E6MA 3DOLA 4KV8A 3HVTA 3QESA 1XWLA 3QB0A 2YNFA 3G71N 4BE2A 1M1KO 3QINA 2Z1IA 1ITGA 5KRTA 1NOYA 3O5BA 1NU0A 4E0DA 1LOTB 1Z25A 3CC2N 1BGXT 1NGCA 4OKEA 3ZSVA 3U3GA 2KFZA 2G8VA 4DTPA 3ZLJA 4DLGA 2E4LA 3EZWA 1FXXA 4KO0A 1BHLA 1HKCA 4C1NK 5HRSA 5LMNK 2KFNA 1WB9A 1G15A 2O8BA 1HRHA 1BQNA 4CBXA 4FZXC 5KPTA 4HTLA 4CF1A 3L3VA 1B92A 2HF4A 2X78A 3CCQN 3JAMO 4AHVA 2W40A 3L3UA 3SV4A 2D0OA 3ZSOA 3F73A 3C95A 4Q0BA 3CHWA 1TKZA 4CF9A 4DTMA 3NHGA 4O4GA 1TUUA 3VTHA 5TKWA 1OKJA 4FJ8A 1JLGA 5HRNA 2JLEA 1UWBA 2E2QA 1T05A 5J2NA 1IKXA 4FW2A 2YNHA 4ILHA 3LAKA 2GUPA 3SLCA 3HBTA 1VSDA 1OH8A 1JCEA 4RWTA 2I7PA 2VG5A 4LSLA 4B1ZA 3SBGA 4NLCA 3TAFA 2YJFA 1L3VA 1YVNA 1KC8O 4BRGA 2VG6A 4CZFA 1N33K 1U04A 4A5AA 3NF9A 3KLFA 1OH7A 1OH6A 4FOIA 3PX6A 2QWMA 2ZQBA 3HSTB 3MN6A 1NKCA 1NG9A 2HBJA 1T6CA 4DS4A 1WSIA 2ZGZA 5CZ1A 2V52B 2OZMA 3TARA 4CIGA 1JJ2M 1QQMA 3DXMB 4DV2K 2ETJA 4JKCA 2RE2A 1RFQA 4M42A 4IDHA 2NRZA 4WFBL 3HRGA 2D0BA 4B9NA 1C0GA 3H3NO 4JN4A 3EYZA 5GIOA 4RW9A 2G8WA 3DLGA 3AVCA 4L3QA 1OVYA 1T44A 3LWMA 1N6QA 1RILA 2YJEA 3DWLA 2P51A 2NUBA 2VCPA 1QE1A 4DV7K 3VQ8A 3B8AX 2GEMA 4X65K 4YFUA 4PKIA 2B4JA 5KGWA 4ILJA 1JLQA 3LAMA 4M3TA 5IT9O 3CJBA 5KGXA 4DF8A 1DT9A 3HVRA 3AA2A 4XH5A 3NAEA 3ZX2A 3TAMA 5DM6L 1NK5A 2E5LK 1YTUA 3KVGA 1Q9XA 4CK3A 1DGKN 2I7NA 3AARA 3PX4A 4G1QA 3BF1A 1N32K 1FKOA 5J1EA 3AVMA 1WUAA 3AVKA 4RG8A 4DQPA 3BEXA 4FCYA 3BZCA 2JGUA 4KTWA 3K57A 3HI0A 5M1QA 4BR5A 3CFRA 1XMQK 4AHTA 5JLFA 1C1CA 4YOUA 2ZJRL 1CXUA 3AAPA 4FM2A 3FZKA 3AVAA 1GLFO 1BA1A 1GLLO 3MMVA 4HTUA 4KHYA 5HRPA 1XHZA 1KVAA 3HPOA 4FPBA 1A5VA 4E7HA 4E19A 2E20A 1NLVA 1ZBUA 4JI7K 3VGLA 4FJ9A 2QWPA 3V1QA 1Z26A 1U2VA 3VQ7A 3GG4A 4KBOA 2IS3A 1IJJA 5C24A 1SKRA 4PL7A 2CH6A 3KKRA 1NMNA 4I6MB 3VQPA 4LH5A 5AQUA 1E4GT 5HP1A 2P9PB 1KTQA 4KHWA 5KI6A 1VQ6N 3EO3A 3SPZA 3LPUA 4R79A 2QA4N 3SQ4A 5M1NA 1RTDA 1KLNA 4IJNA 4J2BA 2QEXN 3CMAN 4JD2B 3K5OA 1S9EA 3WXKA 3TAGA 3DM2A 5AQKA 3CF5L 5HL7L 4NO7A 3M8QA 4FVUA 3L4QA 4JK7A 5KPZA 2IC3A 3NH1A 3OYHA 3C7NB 2JWKA 3L4IA 1RDCA 3AVLA 3VETA 3WEEA 4DR6K 4JKBA 4A61A 2V51B 3KLHA 4K8XA 1SQKA 1RT7A 5KTQA 1XI1A 4CBUA 3TPQA 1K9MO 1QHTA 2UXCK 5E84A 4DLEA 3OYDA 3WUHA 1MWKA 3I0SA 3UIQA 4M45A 4BRDA 3D2EA 3VEXA 4BC3A 4KPYA 1NGEA 4FLWA 4BRNA 1WN7A 2G8FA 3QFPA 3VF2A 3O1WA 4OGCA 1ZXOA 5SWMA 3HM9A 5BREA 1E4FT 1IO2A 3AO5A 3OY9A 5JLHA 3CPWM 2HOEA 3U3YA 4BR2A 2LSNA 3BGRA 1XNRK 5C2DA 1W7AA 2P1JA 4M3YA 1N5YA 3DLEA 4X66K 4FXDA 4OLBA 1JLBA 4CJFA 2A1RA 1XQSC 5M1FA 4CJEA 1P8ZA 5GAGP 1NGDA 4WYBA 1Q82O 2G8IA 2DFEA 4DTUA 5I9EB 4BDPA 3QEVA 4NCAA 2P9SA 4DKWA 4CEBA 4H0PA 4V19S 3TTFA 1J9AA 2WONA 3CPEA 2O8CB 3D2FB 4WFNL 1RBUA 3FZHA 2H3GX 5A2QO 1RT5A 2ZJQL 1BG3A 3BZKA 4CJRA 1YITN 1R59O 1X9JA 2CH5A 4XH1A 3CCMN 4PUOA 2ZD1A 2X6NA 4FK4A 5FLXO 3ID8A 3AVNA 3WXMB 3UKRB 1ATRA 3THVA 2YX6A 3THXA 4Z94A 4DV6K 3TAPA 3NE6A 1WLJA 1DTQA 2O4GA 1BA0A 1FJGK 4RW7A 1JL1A 4DR2K 4ILGB 2D4WA 3ZX0A
chains in the Genus database with same CATH topology
4DG1A 2HNDA 5JS2A 1KRPA 1IKVA 4CEEA 3V81A 4ELTA 4KB0A 4FJLA 2BGGA 3VQ5A 3PY8A 2D5RA 2XY8A 3AO1A 3DYAA 3LDSA 1NK8A 1VSHA 1KSPA 3OS2A 3KK1A 4BACA 1S9GA 1KCFA 1WNSA 3DRRA 2G8KA 4B08A 4HCBA 4I9QA 1T7PA 4BE1A 2OPQA 1BCMA 3O4NA 4ICLA 4DFMA 4FJKA 4N56A 1ASUA 4RW4A 3PX0A 4KI4A 4DTRA 2XY7A 4WE1A 2FC0A 3V1RA 3JYTA 4J2DA 4DTJA 3ZSZA 4E1MA 4GMJB 4DSIA 1RBVA 4CJ4A 4Y1DA 3RR8A 3ISNC 4UQGA 1RDDA 2D0CA 2GUIA 3TANA 2KZMA 1VSFA 3VQ9A 3TABA 3CYMA 4B9TA 3ZCMA 4CFCA 3KLGA 2Y1IA 1WSGA 1SUQA 1D8YA 1BISA 5DK5A 4CFBA 3RMBA 4FZZA 3CM6A 3SV3A 2D0AA 4F2SA 1BI4A 1QS4A 4IG3A 4OPJA 2F8SA 2G8UA 1YT3A 1CXQA 4J2EA 1RT1A 4FW1A 3P83D 2XRIA 2KQ2A 2XY6A 4B8AB 5CYMA 4CESA 2X74A 1SL0A 2G8HA 4B9UA 4F2RA 3ZSWA 2HHTA 1CZBA 4GVMA 4NYNA 3KJVA 5CYQA 3LZIA 2P5OA 4F3TA 4CJTA 4F3OA 5E41A 4CEFA 4CHZA 4KI6A 4Z4EA 3NFAA 4DQSA 2PY5A 3HPGA 4CJPA 1SL1A 1YTAA 5FRNA 4CHNA 4DF4A 1RCHA 5C42A 4NCGA 4O0JA 3WNEA 4CIFA 1VRUA 1WSFA 4CECA 4CFAA 3OJUA 4E7LA 4LSNA 2ATQA 5DMRA 4DQIA 1KVBA 1TV6A 3AVFA 3MECA 3NH2A 4N5SA 1TK8A 5FRMA 4HUGA 2HHXA 4AHSA 4DQQA 3HL8A 1JLFA 2WOMA 3LP3A 5CZ2A 3AVGA 2XY5A 4QOZB 2PYJA 4Z4GA 1NKBA 5KRSA 3AVHA 1EX4A 4C8OA 1HYVA 3HPHA 4KKOA 3OYNA 3D0PA 3TWHA 1RNHA 3S3OA 1Q9YA 1DLOA 2OPPA 3MEEA 3ZT3A 2E6LA 4KTQA 4B3OA 1X9WA 3SQ1A 1Q8IA 1SV5A 4CK2A 3KK2A 3LZJA 2HMIA 1VSEA 1A5XA 3G0ZA 2FBXA 4BWMA 4RW8A 4F8RA 4RW6A 3DLBA 3I0RA 4LH4A 3NH0A 2YV0X 4FLTA 4N47A 3OYLA 4DTOA 2W42A 3AO3A 4KB1A 1BI4B 4Z4FA 1BQMA 3B6OA 4EP4A 1J5OA 1SKSA 1QSYA 2RPIA 3QEWA 3V6DA 3KKSA 4DTXA 2E6MA 3DOLA 4IDKA 4KV8A 4FK0A 3HVTA 2Z1GA 4OJRA 4FM1A 1WAJA 1XWLA 3QESA 2FBYA 2YNFA 4BE2A 4CHPA 4BDZA 1WSEA 2Z1IA 3QINA 4I2QA 1ITGA 4CEOA 1LV5A 5KRTA 4DFKA 1NOYA 5FROA 4CJKA 4E0DA 4FYDA 1Z25A 3OYIA 4CF0A 4AHCA 4CJQA 2PYLA 1Y97A 3L8BA 2I5JA 1JLCA 1DTTA 2VWJA 1ZBHA 1BGXT 1EKEA 2IOCA 4OKEA 3ZSVA 4E3SA 2HHVA 3U3GA 1RTHA 2KFZA 2G8VA 1S5JA 4DTPA 2YKNA 5J2MA 3DRPA 3PO4A 3TAEA 4LY7A 4W5NA 4DLGA 2E4LA 3T19A 1LWFA 4DWIA 3HP9A 2YNGA 4DQRA 2HHQA 1FXXA 4KO0A 1BHLA 1JL2A 5HRSA 2KFNA 4H8KA 3QEXA 1G15A 3LANA 1HRHA 1BQNA 3OJSA 1RBTA 4MFBA 3D45A 3T1AA 4Z4HA 3FFIA 2VWKA 4CJVA 3TI0A 4FZXC 1HYSA 2HVHA 4PQUA 1MU2A 1VSJA 1TK0A 1R0AA 4CF1A 4CJWA 3L3VA 1B92A 4FLZA 1I39A 1TAQA 3MXJA 3ZSYA 4C8KA 2X78A 4AHVA 3VQEA 4N76A 5K14A 4HUEA 3S3NA 4FJJA 3L3UA 3V9ZA 3SV4A 1QSSA 3ZSOA 4CGJA 3F73A 3PV8A 3C95A 4H4OA 4IKFA 4KHQA 4CCHA 4N41A 1VK0A 4W5RA 3CFPA 3RRGA 4Q0BA 4CF9A 1TKZA 4AHRA 4B9VA 4DTMA 4IFYA 3NHGA 1HNVA 1CLQA 4QAGA 2YNIA 4O4GA 3K2PA 3TAQA 3V9XA 3ZT1A 4NYFA 1RT2A 4FJ8A 1JLGA 1EETA 1KVCA 1RTIA 2Z1JA 5HRNA 2RN2A 1NK4A 2JLEA 1UWBA 1T05A 5J2NA 3HXMA 5HBMA 1IKXA 4FW2A 1LW0A 3V9SA 2YNHA 3NF7A 3AO4A 2HW3A 2OPRA 5I3UA 1ASWA 1U48A 4FVMA 3LAKA 3NDKA 4CGIA 3KLEA 4EZ9A 2F8TA 3OVNA 4CF2A 1QTMA 1VSDA 4CEDA 4DS5A 2ZE2A 3IRXA 5D3GA 3OYFA 2EHGA 4JRPA 1U4BA 4BWJA 3V1OA 1CZ9A 2XHBA 2VG5A 3RTVA 1IKWA 4LSLA 4B9LA 5HLFA 4TSXA 3TAFA 2X6SA 1S1WA 1S1UA 3VQDA 1L3VA 3SUNA 2VG6A 3QNNA 3VQ4A 2HNZA 1NOZA 3SYZA 1X9MA 2BANA 3H08A 1K6YA 2FBVA 1U04A 1BIZA 4LD0A 3OYAA 3NF9A 4I9LA 3KLFA 3M8RA 4FLYA 4DSFA 1WAFA 4KRFA 5HRRA 3PX6A 3L2UA 4C8NA 3HSTB 2ZQBA 1HQEA 3OYEA 4B9SA 4DSJA 1NKCA 4W5TA 2QKKA 4CJLA 1WSIA 4DS4A 4MQ3A 3VA3A 5CZ1A 3OYJA 4K8ZA 4CHOA 2HHSA 3T3FA 2OZMA 3TARA 1NK9A 1HNIA 4CIGA 3AA5X 2KZZA 5JS1A 1U49A 2ETJA 3RWUA 3SUPA 4FM0A 4DSEA 4Y1CA 2B6AA 4EZ6A 3KLIA 1C1AA 1SL2A 1IH7A 5CY4A 4CF8A 3O3FA 1D9DA 4CEQA 3WNFA 3HO1A 3NCIA 1S1TA 3CFOA 4M42A 4Z4IA 4AILC 4M3UA 3OYBA 4FJ7A 3OYMA 2VG7A 1L5UA 4FJNA 2OA8A 4DSLA 3C6UA 3ZSXA 1ZBLA 1S1XA 2D0BA 4HVJA 4B9NA 3BDPA 4IG0A 4R5PA 1I3AA 3EYZA 1HQUA 1QSLA 1TL3A 2Q3SA 4E1NA 3MEDA 4OVLA 4RW9A 3DLGA 1FKPA 3AVCA 4CGDA 3O3HA 4JRQA 2G8WA 4FZYA 3SI6A 2DFHA 3LWMA 1N6QA 4Z4CA 1RILA 3OYKA 1W0HA 2P51A 2NUBA 4KTZA 4DMNA 1QE1A 3JSMA 3VQ8A 3OS0A 4DFJA 3SUQA 3RMAA 2HVIA 4YFUA 3L2VA 3WNHA 3V4IA 2B4JA 3ZT2A 4BDYA 5KGWA 1NJZA 1UOCA 3P5JA 4M3ZA 1JLQA 1LAVA 3DMJA 1JLEA 4CERA 4M41A 3LAMA 4M3TA 5KGXA 4DF8A 4PA1A 1NJYA 1SKWA 3HVRA 4QCLA 3AA2A 1IG9A 4ZHRA 1TGOA 4OGEA 2OYQA 3NAEA 3HK2A 3TAMA 1NK5A 1HYZA 1A5WA 1YTUA 4O44A 1X1PA 3NGIA 4CK3A 1Q9XA 2QKBA 2IAJA 4FJ5A 3CM5A 3VQAA 1B9FA 1RBSA 4KAZA 3PX4A 4G1QA 1X9SA 1FKOA 3EZ5A 5J1EA 1RTJA 4IFVA 1TKTA 3AVMA 1HJRA 2RKIA 3AVKA 3LWLA 4RG8A 4DQPA 4CJ3A 4FCYA 1L3SA 2F96A 2JGUA 3QLHA 3MEGA 4KTWA 3K57A 3RMCA 3CFRA 1GOAA 4AHTA 2HNYA 1C1CA 3VQQA 4KFBA 1CXUA 4FK2A 4FM2A 3SUOA 4NCBA 4IBNA 4O55A 2RF2A 3IG1A 3KK3A 3AVAA 3G10A 2XO7A 1GOCA 4KHYA 4HTUA 3KIOA 5HRPA 1RBRA 3DRSA 3VN5A 1XHZA 1KVAA 1WSHA 3HPOA 2DTUA 3AVIA 2HB5A 4E7IA 4FLXA 1A5VA 3RMDA 4CFDA 3A2FA 4C8MA 4Q5VA 3K5NA 4E7HA 4E19A 4FLUA 2PZSA 2HHWA 1XHXA 3MXIA 3K58A 1ZBUA 3SNNA 1LWEA 4FJ9A 3P1GA 1Z26A 3V1QA 3QETA 3SPYA 3VQ7A 4XIUA 2BE2A 3ALYA 2DY4A 3HJFA 4Z0UA 1T03A 1VSMA 2IS3A 4E89A 5C24A 1ZBFA 3U6FA 1WSJA 4YNQA 1NJWA 1SKRA 3S9HA 4ZTFA 1RT4A 3KKRA 4PWDA 5SZTA 1JKHA 2OPSA 4LH5A 3VQPA 5HP1A 4FLVA 1KTQA 4ELUA 5KI6A 4CIEA 4KHWA 3SPZA 1IKYA 1HMVA 3LPUA 4BE0A 4F4KA 3M8SA 3K5MA 3V9WA 4DFPA 3SQ4A 1RTDA 3IAYA 1KLNA 4JS5A 1JXEA 4W5QA 4J2BA 3QERA 1RDBA 3LP2A 4ELVA 2YHBA 1RT3A 1VSKA 3K5OA 3OYGA 4DU3A 3KD5E 4CJ5A 1S9EA 5J2QA 1EP4A 4KHNA 3TAGA 2OZSA 3DM2A 4CE9A 4KHUA 4DU4A 3M8QA 1VRTA 1D9FA 4FJXA 3OYCA 3B6PA 2IC3A 1REVA 3NH1A 3SJJA 4FJHA 1BL3A 3OYHA 1UA1A 3O3GA 4DU1A 3IS9A 3TR8A 1LW2A 4M3XA 1RDCA 4M3WA 3CQ8A 1O1WA 3AVLA 3ZT0A 3K59A 3L2WA 1NK0A 4FJMA 3ZSRA 3KLHA 3SQ0A 4K8XA 3VQCA 4ZTJA 4I2PA 1TAUA 5KTQA 1RT7A 3AVBA 4ID1A 3QIOA 1XI1A 3AA4A 4OKKA 1QHTA 1C1BA 3KTQA 1VSIA 3DLRA 4DLEA 1XC9A 3OYDA 4PY5A 3I0SA 1UAXA 1LAWA 1TVRA 4M45A 4CGGA 3UIQA 2O4IA 1TKXA 1NK7A 3MXMA 3F9KA 4KPYA 2KTQA 4CEAA 3VQ6A 3HP6A 4AH9A 1EXQA 1UA0A 4FLWA 1S6PA 3SQ2A 4ID5A 1ZBIA 3LP1A 1WN7A 3AA3A 2R7YA 2G8FA 1T8EA 4OGCA 1W9HA 3ZSQA 3WNGA 4JLHA 4AHUA 3LP0A 5SWMA 3OS1A 5HROA 1L3TA 1C0UA 3DLHA 3HM9A 4CHYA 4B9MA 3QEIA 1NJXA 3SCXA 1IO2A 3AO5A 3C94A 3NF6A 3OY9A 4HUFA 1TL1A 3U3YA 2ITGA 2DFFA 4DSKA 1B9DA 2LSNA 3PO5A 4CJUA 3BGRA 1C0TA 4O0IA 2BDPA 4CEZA 1HPZA 4H4MA 3L2RA 4FJIA 1NK6A 2QXFA 1S1VA 1ZYQA 1F21A 1J54A 4CK1A 2P1JA 1D5AA 2YKMA 3QNOA 1L3UA 3ITHA 5EU7A 4JS4A 3O4QA 1N5YA 2FBTA 1RDAA 3DLEA 3KD1E 4M3YA 4B8CA 1C0MA 4DTNA 2IDOA 4FXDA 3M8PA 3RR7A 3DLKA 1JLBA 4OLBA 4CJFA 4I7FA 4E7KA 2A1RA 4OKJA 1U47A 4CJEA 1TK5A 2EX3A 4OLAA 3ULDA 2A1SA 3EY1A 5FDLA 3VA0A 5I42A 3QO9A 3AO2A 2IGIA 2G8IA 3NF8A 3QEPA 2DFEA 1ASVA 4DTUA 4EP5A 1S6QA 1J53A 3VQBA 4BDPA 3QEVA 1NKEA 3C6TA 3L2QA 4NCAA 3E01A 3PUFA 4CEBA 1C6VA 5C25A 3NGYA 1J9AA 1QQCA 2WONA 3CG7A 1BCOA 4O5BA 2Y1JA 1GOBA 3DOKA 4CGFA 4KHSA 1FK9A 1RT6A 4C8LA 4CJSA 3AV9A 5J2PA 4OPKA 1RBUA 4GW6A 4CHQA 3ZT4A 1TKDA 3LALA 1RT5A 3SZ2A 4CJRA 3HYFA 2KW4A 1BIUA 4M3RA 3I8DA 2AJQA 1LWCA 2HHUA 4E7JA 3K5LA 4PUOA 2ZD1A 2QK9A 2GBZA 2X6NA 3LPTA 3MAQA 1U45A 4L8RB 4FK4A 3NBPA 4HCCA 3NGZA 4FJGA 2GV9A 3AVNA 1YVUA 3S3MA 3V9UA 1KFSA 4J2AA 3THVA 4HHTA 3TAPA 1JLAA 1KLMA 3RRHA 1VSLA 3NE6A 1KFDA 1WLJA 2B5JA 2Z1HA 4KREA 1DTQA 2O4GA 5T7BA 4RW7A 3DI6A 1JL1A 1JXBA 3QIPA 4DTSA 3AVJA 3HT3A 4CGHA 4W5OA 2P5GA 3ASMA 2YHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DG1 A;  2HND A;  5JS2 A;  1KRP A;  1IKV A;  4CEE A;  3V81 A;  4ELT A;  4KB0 A;  4FJL A;  2BGG A;  3VQ5 A;  3PY8 A;  2D5R A;  2XY8 A;  3AO1 A;  3DYA A;  3LDS A;  1NK8 A;  1VSH A;  1KSP A;  3OS2 A;  3KK1 A;  4BAC A;  1S9G A;  1KCF A;  1WNS A;  3DRR A;  2G8K A;  4B08 A;  4HCB A;  4I9Q A;  1T7P A;  4BE1 A;  2OPQ A;  1BCM A;  3O4N A;  4ICL A;  4DFM A;  4FJK A;  4N56 A;  1ASU A;  4RW4 A;  3PX0 A;  4KI4 A;  4DTR A;  2XY7 A;  4WE1 A;  2FC0 A;  3V1R A;  3JYT A;  4J2D A;  4DTJ A;  3ZSZ A;  4E1M A;  4GMJ B;  4DSI A;  1RBV A;  4CJ4 A;  4Y1D A;  3RR8 A;  3ISN C;  4UQG A;  1RDD A;  2D0C A;  2GUI A;  3TAN A;  2KZM A;  1VSF A;  3VQ9 A;  3TAB A;  3CYM A;  4B9T A;  3ZCM A;  4CFC A;  3KLG A;  2Y1I A;  1WSG A;  1SUQ A;  1D8Y A;  1BIS A;  5DK5 A;  4CFB A;  3RMB A;  4FZZ A;  3CM6 A;  3SV3 A;  2D0A A;  4F2S A;  1BI4 A;  1QS4 A;  4IG3 A;  4OPJ A;  2F8S A;  2G8U A;  1YT3 A;  1CXQ A;  4J2E A;  1RT1 A;  4FW1 A;  3P83 D;  2XRI A;  2KQ2 A;  2XY6 A;  4B8A B;  5CYM A;  4CES A;  2X74 A;  1SL0 A;  2G8H A;  4B9U A;  4F2R A;  3ZSW A;  2HHT A;  1CZB A;  4GVM A;  4NYN A;  3KJV A;  5CYQ A;  3LZI A;  2P5O A;  4F3T A;  4CJT A;  4F3O A;  5E41 A;  4CEF A;  4CHZ A;  4KI6 A;  4Z4E A;  3NFA A;  4DQS A;  2PY5 A;  3HPG A;  4CJP A;  1SL1 A;  1YTA A;  5FRN A;  4CHN A;  4DF4 A;  1RCH A;  5C42 A;  4NCG A;  4O0J A;  3WNE A;  4CIF A;  1VRU A;  1WSF A;  4CEC A;  4CFA A;  3OJU A;  4E7L A;  4LSN A;  2ATQ A;  5DMR A;  4DQI A;  1KVB A;  1TV6 A;  3AVF A;  3MEC A;  3NH2 A;  4N5S A;  1TK8 A;  5FRM A;  4HUG A;  2HHX A;  4AHS A;  4DQQ A;  3HL8 A;  1JLF A;  2WOM A;  3LP3 A;  5CZ2 A;  3AVG A;  2XY5 A;  4QOZ B;  2PYJ A;  4Z4G A;  1NKB A;  5KRS A;  3AVH A;  1EX4 A;  4C8O A;  1HYV A;  3HPH A;  4KKO A;  3OYN A;  3D0P A;  3TWH A;  1RNH A;  3S3O A;  1Q9Y A;  1DLO A;  2OPP A;  3MEE A;  3ZT3 A;  2E6L A;  4KTQ A;  4B3O A;  1X9W A;  3SQ1 A;  1Q8I A;  1SV5 A;  4CK2 A;  3KK2 A;  3LZJ A;  2HMI A;  1VSE A;  1A5X A;  3G0Z A;  2FBX A;  4BWM A;  4RW8 A;  4F8R A;  4RW6 A;  3DLB A;  3I0R A;  4LH4 A;  3NH0 A;  2YV0 X;  4FLT A;  4N47 A;  3OYL A;  4DTO A;  2W42 A;  3AO3 A;  4KB1 A;  1BI4 B;  4Z4F A;  1BQM A;  3B6O A;  4EP4 A;  1J5O A;  1SKS A;  1QSY A;  2RPI A;  3QEW A;  3V6D A;  3KKS A;  4DTX A;  2E6M A;  3DOL A;  4IDK A;  4KV8 A;  4FK0 A;  3HVT A;  2Z1G A;  4OJR A;  4FM1 A;  1WAJ A;  1XWL A;  3QES A;  2FBY A;  2YNF A;  4BE2 A;  4CHP A;  4BDZ A;  1WSE A;  2Z1I A;  3QIN A;  4I2Q A;  1ITG A;  4CEO A;  1LV5 A;  5KRT A;  4DFK A;  1NOY A;  5FRO A;  4CJK A;  4E0D A;  4FYD A;  1Z25 A;  3OYI A;  4CF0 A;  4AHC A;  4CJQ A;  2PYL A;  1Y97 A;  3L8B A;  2I5J A;  1JLC A;  1DTT A;  2VWJ A;  1ZBH A;  1BGX T;  1EKE A;  2IOC A;  4OKE A;  3ZSV A;  4E3S A;  2HHV A;  3U3G A;  1RTH A;  2KFZ A;  2G8V A;  1S5J A;  4DTP A;  2YKN A;  5J2M A;  3DRP A;  3PO4 A;  3TAE A;  4LY7 A;  4W5N A;  4DLG A;  2E4L A;  3T19 A;  1LWF A;  4DWI A;  3HP9 A;  2YNG A;  4DQR A;  2HHQ A;  1FXX A;  4KO0 A;  1BHL A;  1JL2 A;  5HRS A;  2KFN A;  4H8K A;  3QEX A;  1G15 A;  3LAN A;  1HRH A;  1BQN A;  3OJS A;  1RBT A;  4MFB A;  3D45 A;  3T1A A;  4Z4H A;  3FFI A;  2VWK A;  4CJV A;  3TI0 A;  4FZX C;  1HYS A;  2HVH A;  4PQU A;  1MU2 A;  1VSJ A;  1TK0 A;  1R0A A;  4CF1 A;  4CJW A;  3L3V A;  1B92 A;  4FLZ A;  1I39 A;  1TAQ A;  3MXJ A;  3ZSY A;  4C8K A;  2X78 A;  4AHV A;  3VQE A;  4N76 A;  5K14 A;  4HUE A;  3S3N A;  4FJJ A;  3L3U A;  3V9Z A;  3SV4 A;  1QSS A;  3ZSO A;  4CGJ A;  3F73 A;  3PV8 A;  3C95 A;  4H4O A;  4IKF A;  4KHQ A;  4CCH A;  4N41 A;  1VK0 A;  4W5R A;  3CFP A;  3RRG A;  4Q0B A;  4CF9 A;  1TKZ A;  4AHR A;  4B9V A;  4DTM A;  4IFY A;  3NHG A;  1HNV A;  1CLQ A;  4QAG A;  2YNI A;  4O4G A;  3K2P A;  3TAQ A;  3V9X A;  3ZT1 A;  4NYF A;  1RT2 A;  4FJ8 A;  1JLG A;  1EET A;  1KVC A;  1RTI A;  2Z1J A;  5HRN A;  2RN2 A;  1NK4 A;  2JLE A;  1UWB A;  1T05 A;  5J2N A;  3HXM A;  5HBM A;  1IKX A;  4FW2 A;  1LW0 A;  3V9S A;  2YNH A;  3NF7 A;  3AO4 A;  2HW3 A;  2OPR A;  5I3U A;  1ASW A;  1U48 A;  4FVM A;  3LAK A;  3NDK A;  4CGI A;  3KLE A;  4EZ9 A;  2F8T A;  3OVN A;  4CF2 A;  1QTM A;  1VSD A;  4CED A;  4DS5 A;  2ZE2 A;  3IRX A;  5D3G A;  3OYF A;  2EHG A;  4JRP A;  1U4B A;  4BWJ A;  3V1O A;  1CZ9 A;  2XHB A;  2VG5 A;  3RTV A;  1IKW A;  4LSL A;  4B9L A;  5HLF A;  4TSX A;  3TAF A;  2X6S A;  1S1W A;  1S1U A;  3VQD A;  1L3V A;  3SUN A;  2VG6 A;  3QNN A;  3VQ4 A;  2HNZ A;  1NOZ A;  3SYZ A;  1X9M A;  2BAN A;  3H08 A;  1K6Y A;  2FBV A;  1U04 A;  1BIZ A;  4LD0 A;  3OYA A;  3NF9 A;  4I9L A;  3KLF A;  3M8R A;  4FLY A;  4DSF A;  1WAF A;  4KRF A;  5HRR A;  3PX6 A;  3L2U A;  4C8N A;  3HST B;  2ZQB A;  1HQE A;  3OYE A;  4B9S A;  4DSJ A;  1NKC A;  4W5T A;  2QKK A;  4CJL A;  1WSI A;  4DS4 A;  4MQ3 A;  3VA3 A;  5CZ1 A;  3OYJ A;  4K8Z A;  4CHO A;  2HHS A;  3T3F A;  2OZM A;  3TAR A;  1NK9 A;  1HNI A;  4CIG A;  3AA5 X;  2KZZ A;  5JS1 A;  1U49 A;  2ETJ A;  3RWU A;  3SUP A;  4FM0 A;  4DSE A;  4Y1C A;  2B6A A;  4EZ6 A;  3KLI A;  1C1A A;  1SL2 A;  1IH7 A;  5CY4 A;  4CF8 A;  3O3F A;  1D9D A;  4CEQ A;  3WNF A;  3HO1 A;  3NCI A;  1S1T A;  3CFO A;  4M42 A;  4Z4I A;  4AIL C;  4M3U A;  3OYB A;  4FJ7 A;  3OYM A;  2VG7 A;  1L5U A;  4FJN A;  2OA8 A;  4DSL A;  3C6U A;  3ZSX A;  1ZBL A;  1S1X A;  2D0B A;  4HVJ A;  4B9N A;  3BDP A;  4IG0 A;  4R5P A;  1I3A A;  3EYZ A;  1HQU A;  1QSL A;  1TL3 A;  2Q3S A;  4E1N A;  3MED A;  4OVL A;  4RW9 A;  3DLG A;  1FKP A;  3AVC A;  4CGD A;  3O3H A;  4JRQ A;  2G8W A;  4FZY A;  3SI6 A;  2DFH A;  3LWM A;  1N6Q A;  4Z4C A;  1RIL A;  3OYK A;  1W0H A;  2P51 A;  2NUB A;  4KTZ A;  4DMN A;  1QE1 A;  3JSM A;  3VQ8 A;  3OS0 A;  4DFJ A;  3SUQ A;  3RMA A;  2HVI A;  4YFU A;  3L2V A;  3WNH A;  3V4I A;  2B4J A;  3ZT2 A;  4BDY A;  5KGW A;  1NJZ A;  1UOC A;  3P5J A;  4M3Z A;  1JLQ A;  1LAV A;  3DMJ A;  1JLE A;  4CER A;  4M41 A;  3LAM A;  4M3T A;  5KGX A;  4DF8 A;  4PA1 A;  1NJY A;  1SKW A;  3HVR A;  4QCL A;  3AA2 A;  1IG9 A;  4ZHR A;  1TGO A;  4OGE A;  2OYQ A;  3NAE A;  3HK2 A;  3TAM A;  1NK5 A;  1HYZ A;  1A5W A;  1YTU A;  4O44 A;  1X1P A;  3NGI A;  4CK3 A;  1Q9X A;  2QKB A;  2IAJ A;  4FJ5 A;  3CM5 A;  3VQA A;  1B9F A;  1RBS A;  4KAZ A;  3PX4 A;  4G1Q A;  1X9S A;  1FKO A;  3EZ5 A;  5J1E A;  1RTJ A;  4IFV A;  1TKT A;  3AVM A;  1HJR A;  2RKI A;  3AVK A;  3LWL A;  4RG8 A;  4DQP A;  4CJ3 A;  4FCY A;  1L3S A;  2F96 A;  2JGU A;  3QLH A;  3MEG A;  4KTW A;  3K57 A;  3RMC A;  3CFR A;  1GOA A;  4AHT A;  2HNY A;  1C1C A;  3VQQ A;  4KFB A;  1CXU A;  4FK2 A;  4FM2 A;  3SUO A;  4NCB A;  4IBN A;  4O55 A;  2RF2 A;  3IG1 A;  3KK3 A;  3AVA A;  3G10 A;  2XO7 A;  1GOC A;  4KHY A;  4HTU A;  3KIO A;  5HRP A;  1RBR A;  3DRS A;  3VN5 A;  1XHZ A;  1KVA A;  1WSH A;  3HPO A;  2DTU A;  3AVI A;  2HB5 A;  4E7I A;  4FLX A;  1A5V A;  3RMD A;  4CFD A;  3A2F A;  4C8M A;  4Q5V A;  3K5N A;  4E7H A;  4E19 A;  4FLU A;  2PZS A;  2HHW A;  1XHX A;  3MXI A;  3K58 A;  1ZBU A;  3SNN A;  1LWE A;  4FJ9 A;  3P1G A;  1Z26 A;  3V1Q A;  3QET A;  3SPY A;  3VQ7 A;  4XIU A;  2BE2 A;  3ALY A;  2DY4 A;  3HJF A;  4Z0U A;  1T03 A;  1VSM A;  2IS3 A;  4E89 A;  5C24 A;  1ZBF A;  3U6F A;  1WSJ A;  4YNQ A;  1NJW A;  1SKR A;  3S9H A;  4ZTF A;  1RT4 A;  3KKR A;  4PWD A;  5SZT A;  1JKH A;  2OPS A;  4LH5 A;  3VQP A;  5HP1 A;  4FLV A;  1KTQ A;  4ELU A;  5KI6 A;  4CIE A;  4KHW A;  3SPZ A;  1IKY A;  1HMV A;  3LPU A;  4BE0 A;  4F4K A;  3M8S A;  3K5M A;  3V9W A;  4DFP A;  3SQ4 A;  1RTD A;  3IAY A;  1KLN A;  4JS5 A;  1JXE A;  4W5Q A;  4J2B A;  3QER A;  1RDB A;  3LP2 A;  4ELV A;  2YHB A;  1RT3 A;  1VSK A;  3K5O A;  3OYG A;  4DU3 A;  3KD5 E;  4CJ5 A;  1S9E A;  5J2Q A;  1EP4 A;  4KHN A;  3TAG A;  2OZS A;  3DM2 A;  4CE9 A;  4KHU A;  4DU4 A;  3M8Q A;  1VRT A;  1D9F A;  4FJX A;  3OYC A;  3B6P A;  2IC3 A;  1REV A;  3NH1 A;  3SJJ A;  4FJH A;  1BL3 A;  3OYH A;  1UA1 A;  3O3G A;  4DU1 A;  3IS9 A;  3TR8 A;  1LW2 A;  4M3X A;  1RDC A;  4M3W A;  3CQ8 A;  1O1W A;  3AVL A;  3ZT0 A;  3K59 A;  3L2W A;  1NK0 A;  4FJM A;  3ZSR A;  3KLH A;  3SQ0 A;  4K8X A;  3VQC A;  4ZTJ A;  4I2P A;  1TAU A;  5KTQ A;  1RT7 A;  3AVB A;  4ID1 A;  3QIO A;  1XI1 A;  3AA4 A;  4OKK A;  1QHT A;  1C1B A;  3KTQ A;  1VSI A;  3DLR A;  4DLE A;  1XC9 A;  3OYD A;  4PY5 A;  3I0S A;  1UAX A;  1LAW A;  1TVR A;  4M45 A;  4CGG A;  3UIQ A;  2O4I A;  1TKX A;  1NK7 A;  3MXM A;  3F9K A;  4KPY A;  2KTQ A;  4CEA A;  3VQ6 A;  3HP6 A;  4AH9 A;  1EXQ A;  1UA0 A;  4FLW A;  1S6P A;  3SQ2 A;  4ID5 A;  1ZBI A;  3LP1 A;  1WN7 A;  3AA3 A;  2R7Y A;  2G8F A;  1T8E A;  4OGC A;  1W9H A;  3ZSQ A;  3WNG A;  4JLH A;  4AHU A;  3LP0 A;  5SWM A;  3OS1 A;  5HRO A;  1L3T A;  1C0U A;  3DLH A;  3HM9 A;  4CHY A;  4B9M A;  3QEI A;  1NJX A;  3SCX A;  1IO2 A;  3AO5 A;  3C94 A;  3NF6 A;  3OY9 A;  4HUF A;  1TL1 A;  3U3Y A;  2ITG A;  2DFF A;  4DSK A;  1B9D A;  2LSN A;  3PO5 A;  4CJU A;  3BGR A;  1C0T A;  4O0I A;  2BDP A;  4CEZ A;  1HPZ A;  4H4M A;  3L2R A;  4FJI A;  1NK6 A;  2QXF A;  1S1V A;  1ZYQ A;  1F21 A;  1J54 A;  4CK1 A;  2P1J A;  1D5A A;  2YKM A;  3QNO A;  1L3U A;  3ITH A;  5EU7 A;  4JS4 A;  3O4Q A;  1N5Y A;  2FBT A;  1RDA A;  3DLE A;  3KD1 E;  4M3Y A;  4B8C A;  1C0M A;  4DTN A;  2IDO A;  4FXD A;  3M8P A;  3RR7 A;  3DLK A;  1JLB A;  4OLB A;  4CJF A;  4I7F A;  4E7K A;  2A1R A;  4OKJ A;  1U47 A;  4CJE A;  1TK5 A;  2EX3 A;  4OLA A;  3ULD A;  2A1S A;  3EY1 A;  5FDL A;  3VA0 A;  5I42 A;  3QO9 A;  3AO2 A;  2IGI A;  2G8I A;  3NF8 A;  3QEP A;  2DFE A;  1ASV A;  4DTU A;  4EP5 A;  1S6Q A;  1J53 A;  3VQB A;  4BDP A;  3QEV A;  1NKE A;  3C6T A;  3L2Q A;  4NCA A;  3E01 A;  3PUF A;  4CEB A;  1C6V A;  5C25 A;  3NGY A;  1J9A A;  1QQC A;  2WON A;  3CG7 A;  1BCO A;  4O5B A;  2Y1J A;  1GOB A;  3DOK A;  4CGF A;  4KHS A;  1FK9 A;  1RT6 A;  4C8L A;  4CJS A;  3AV9 A;  5J2P A;  4OPK A;  1RBU A;  4GW6 A;  4CHQ A;  3ZT4 A;  1TKD A;  3LAL A;  1RT5 A;  3SZ2 A;  4CJR A;  3HYF A;  2KW4 A;  1BIU A;  4M3R A;  3I8D A;  2AJQ A;  1LWC A;  2HHU A;  4E7J A;  3K5L A;  4PUO A;  2ZD1 A;  2QK9 A;  2GBZ A;  2X6N A;  3LPT A;  3MAQ A;  1U45 A;  4L8R B;  4FK4 A;  3NBP A;  4HCC A;  3NGZ A;  4FJG A;  2GV9 A;  3AVN A;  1YVU A;  3S3M A;  3V9U A;  1KFS A;  4J2A A;  3THV A;  4HHT A;  3TAP A;  1JLA A;  1KLM A;  3RRH A;  1VSL A;  3NE6 A;  1KFD A;  1WLJ A;  2B5J A;  2Z1H A;  4KRE A;  1DTQ A;  2O4G A;  5T7B A;  4RW7 A;  3DI6 A;  1JL1 A;  1JXB A;  3QIP A;  4DTS A;  3AVJ A;  3HT3 A;  4CGH A;  4W5O A;  2P5G A;  3ASM A;  2YHA A; 
#chains in the Genus database with same CATH topology
 3JXU A;  5JS2 A;  4RTF D;  1IKV A;  4CEE A;  1HUX A;  4IOA L;  3BUZ B;  5AZI A;  4K0K K;  1NK8 A;  1VSH A;  3DRR A;  3QDK A;  2NRV A;  3MK6 A;  3O6W A;  2NRW A;  2P9N B;  4I9Q A;  4CZJ A;  4BE1 A;  3MWP A;  4DFM A;  1ASU A;  3PX0 A;  3R8E A;  1IBK K;  1ZC6 A;  4E1M A;  2Q0R A;  4GMJ B;  4K41 A;  5HOO A;  3RR8 A;  3ISN C;  1RDD A;  2D0C A;  2GUI A;  3D7E O;  1X3M A;  2D0P A;  3ZCM A;  3KLG A;  1BIS A;  2WUS A;  2FLO A;  4BQL A;  2D0A A;  4GVE A;  4IO8 A;  1HJO A;  4J2E A;  5MLC Q;  4BR4 A;  4CES A;  5F1X A;  2X74 A;  4F2R A;  3ZSW A;  3KJV A;  3LZI A;  2YHY A;  4DQS A;  3VEY A;  3PIO L;  3WNE A;  3WQT A;  4IOX A;  1Y64 A;  4CEC A;  4CFA A;  1WBD A;  3THY B;  4DCH A;  4HUG A;  1IBL K;  3F5T A;  3HL8 A;  1JLF A;  1T3V A;  5ELZ A;  4QOZ B;  4Z4G A;  1NKB A;  3CC7 N;  3O9T A;  4K42 A;  3D0P A;  3TWH A;  3S3O A;  4FSV A;  3TTD A;  3HM8 A;  3MEE A;  3CER A;  3CCV N;  3KK2 A;  4O8U A;  4BWM A;  4RW8 A;  4F8R A;  1KAY A;  3DLB A;  3I0R A;  3NH0 A;  2QWN A;  2W42 A;  2F9T A;  4KB1 A;  1BI4 B;  3CJ9 A;  1BQM A;  3B6O A;  2UU9 K;  1J5O A;  1QSY A;  4GV9 A;  3QEW A;  4FK0 A;  4FO0 A;  2UXB K;  4B3O A;  4OJR A;  2Z1G A;  1GLD G;  2FBY A;  2ITM A;  4CHP A;  1LV5 A;  1GLA G;  4CJK A;  4FYD A;  3OA9 A;  3L8B A;  3SJH A;  4W5N A;  4LY7 A;  2A3Z A;  5M1K A;  1NGG A;  3HZ6 A;  2YNG A;  1JL2 A;  4H8K A;  3LAN A;  1ATS A;  2FSK A;  3P31 A;  3T1A A;  3FFI A;  1NM1 A;  3VPZ A;  3CJ7 A;  4A62 A;  1YJN N;  4PQU A;  3S41 A;  4U67 L;  4YY3 K;  4CJW A;  5BRF A;  4O8K A;  3ZSY A;  4JI2 K;  5AQL A;  5K14 A;  3ENO A;  1Z6R A;  1QSS A;  3QIC A;  3ZET A;  3PV8 A;  4H4O A;  4KHQ A;  3DXM A;  4CCH A;  4N41 A;  1EWR A;  3C65 A;  3RRG A;  4BC4 A;  4AHR A;  4B9V A;  3SK3 A;  3ZT1 A;  4NYF A;  1RTI A;  1NK4 A;  3E66 A;  4NB4 A;  1LW0 A;  1K8K B;  2V7Z A;  2OPR A;  5I3U A;  5EY4 A;  4BG8 A;  4LF6 K;  4FVM A;  4WQ4 C;  3NDK A;  4EZ9 A;  1S3X A;  2ZE2 A;  3IRX A;  2HBM A;  1QZ6 A;  4YDU A;  3V1O A;  3FR0 A;  1NMD A;  2X6S A;  3CCJ N;  1S1W A;  1S1U A;  3VQD A;  1EQY A;  1XUP O;  4FWN A;  3SUN A;  3QNN A;  5FPN A;  2HNZ A;  1NOZ A;  3CCL N;  2BAN A;  3H08 A;  3J7Z O;  2PAV A;  3OYA A;  2F4V K;  3M8R A;  4FLY A;  1WAF A;  4KRF A;  5HRR A;  4C8N A;  3OYE A;  4B9S A;  4IO9 L;  4KH4 A;  4MQ3 A;  3VA3 A;  4LFA K;  4K8Z A;  4CHO A;  1NK9 A;  3AA5 X;  1BDG A;  3RWU A;  4DSE A;  2OTJ N;  2IVO A;  1C1A A;  3KLI A;  3E9P A;  5AQN A;  4A5B A;  2P9L B;  3VF6 A;  3KHY A;  3NCI A;  4GKJ K;  4A59 A;  3OYB A;  4DSL A;  3CQX A;  3ZSX A;  1S1X A;  3DXK A;  2OAN A;  5KPR A;  3IUC A;  2NZT A;  3A8Y A;  3BDP A;  4IG0 A;  4DV5 K;  1C0F A;  1QSL A;  3O3H A;  4JRQ A;  4OVL A;  4CGD A;  1FKP A;  4FZY A;  5BRH A;  3VGK A;  2NRX A;  4KTZ A;  2QM1 A;  3SUQ A;  4DFJ A;  4J8F A;  3CET A;  1VQL N;  3ZT2 A;  3R1X A;  1NJZ A;  4DR3 K;  1HR0 K;  1UOC A;  2YHX A;  3U8X A;  1LAV A;  3DMJ A;  4I6M A;  4PA1 A;  2P9P A;  3L0Q A;  3O08 A;  4QCL A;  1IG9 A;  4ZHR A;  1TGO A;  4OGE A;  2OYQ A;  4GY2 B;  2QKB A;  1X1P A;  1BO5 O;  2IAJ A;  4FJ5 A;  4JD2 A;  3J8A A;  1RBS A;  4IFV A;  4NXM K;  1HJR A;  2RKI A;  2Q1N A;  4ISF A;  2D1K A;  2A5X A;  1NGF A;  3C7N A;  3SUO A;  3QFU A;  3KK3 A;  3ENB A;  2VQF K;  2XO7 A;  5AQZ A;  2HMP A;  1D4X A;  2RHK A;  3AVI A;  2Q31 A;  5EVZ A;  4C8M A;  4Q5V A;  3K5N A;  3A5N C;  1QZ5 A;  3TSP A;  3MXI A;  3SNN A;  2BH1 A;  2A41 A;  3SPY A;  4FWP A;  2BE2 A;  4XIU A;  3HJF A;  4Z0U A;  2VWB A;  1CZA N;  1ZBF A;  1T6D A;  3KWG A;  4FWO A;  4NXN K;  4BR9 A;  4ZTF A;  4PWD A;  5SZT A;  2OPS A;  3OHR A;  4DR5 K;  3E9L A;  3DJC A;  1HMV A;  4BE0 A;  3M8S A;  3V9W A;  4DFP A;  4JS5 A;  5C15 A;  4W5Q A;  3FE1 A;  3EKS A;  5LJW A;  3JS6 A;  3CI5 A;  5J2Q A;  4BRL A;  4JK8 A;  4KHN A;  2OZS A;  4KHU A;  3ATU A;  4DU4 A;  4B3R K;  2E2N A;  1VRT A;  1NGI A;  1D9F A;  3GL1 A;  2QTD A;  4FJX A;  1REV A;  2WFB A;  4Y0W A;  3O3G A;  4DU1 A;  1LW2 A;  4FWL A;  4LF9 K;  1X3N A;  1O1W A;  3K59 A;  3A0I X;  3ZSR A;  3QIO A;  4OKK A;  3K0S A;  3ZET B;  3KTQ A;  4B9Q A;  2O8C A;  1VSI A;  3D2F A;  4DV1 K;  3MXM A;  3F9K A;  1UA0 A;  1S6P A;  3UKU B;  2O8D B;  3M3Z A;  3AA3 A;  2R7Y A;  5JMV A;  1W9H A;  3AGR A;  3O9R A;  1EO1 A;  1G99 A;  4CHY A;  4B9M A;  1NJX A;  3UKR A;  3C94 A;  5FPE A;  2DFF A;  1RGI A;  4DSK A;  3K9J A;  3WXJ A;  1B9D A;  4CEZ A;  1HPZ A;  1NK6 A;  2QWO A;  1D5A A;  3KD5 E;  3KD1 E;  4B8C A;  1C0M A;  4DTN A;  2IDO A;  1U47 A;  4OLA A;  5AQW A;  2A1S A;  2AP1 A;  3OBY A;  5JIC A;  3QO9 A;  3VTI A;  3QEP A;  4DUZ K;  1S6Q A;  3VQB A;  5BR9 A;  2P9N A;  3C6T A;  3E01 A;  1YAG A;  3FZL A;  3NGY A;  3CME N;  1BCO A;  4LF5 K;  4O5B A;  3DOK A;  4KHS A;  1RT6 A;  4JKE A;  4CJS A;  4DHY A;  4A57 A;  4OPK A;  3T1Y K;  4CHQ A;  3ZT4 A;  2VYP A;  3LAL A;  5C12 A;  4DV0 K;  4M3R A;  3O9S A;  3DXK B;  4XEI A;  3K5L A;  3FFK B;  2VGM A;  4J2A A;  2FSN A;  4HHT A;  1JLA A;  4DB3 A;  2QI2 A;  3RRH A;  4CZG A;  4FWS A;  4KRE A;  3TSU A;  3QIP A;  3HT3 A;  4CGH A;  5H1S Q;  5AQP A;  3IFR A;  3ASM A;  1EWQ A;  1N8R O;  4DG1 A;  1KRP A;  4ELT A;  3H1V X;  3PY8 A;  2XY8 A;  3LDS A;  4IOC L;  3THY A;  3SMP A;  3W0L A;  1Z05 A;  1VAZ A;  4JHD B;  2ASM A;  3D6R A;  4ICL A;  4DQ8 A;  3CCU N;  3SAH A;  4KI4 A;  4WE1 A;  2FC0 A;  3V1R A;  1XNQ K;  3O80 A;  4DSI A;  3C6H A;  4H0O A;  3TAN A;  3BY5 A;  4CZL A;  2Y1I A;  1SUQ A;  1IBM K;  1V4T A;  5E26 A;  3RMB A;  4B3M K;  3CM6 A;  5DM7 L;  3KZB A;  3SV3 A;  1VQM N;  1BI4 A;  2HHH K;  1SL0 A;  1MWM A;  4JKH A;  4YOX A;  4LFC K;  1CZB A;  4FWK A;  4GVM A;  5CYQ A;  4CHZ A;  3NFA A;  3VOV A;  3N4P A;  4DF4 A;  5AQH A;  4Z4E A;  5C2F A;  4CIF A;  1VRU A;  3A5M C;  4LSN A;  1QQO A;  2ATQ A;  1Q86 O;  4DQI A;  1TV6 A;  4N5S A;  4AHS A;  3IDH A;  1QQN A;  2WOM A;  1VQK N;  3AVG A;  3AVH A;  2F7T A;  4LC9 B;  4C8O A;  3O8M A;  3HPH A;  4KKO A;  3EE8 A;  4GV6 A;  2W41 A;  1DLO A;  2OPP A;  3ZT3 A;  2V7Y A;  2NRH A;  5LJV A;  1SV5 A;  5BN9 A;  3G0Z A;  2FBX A;  4CBW A;  4RW6 A;  1ATN A;  2YV0 X;  3AY9 A;  1XC3 A;  4N47 A;  2UUC K;  4DTO A;  2ASP A;  5FPD A;  3AO3 A;  1Q7Y O;  4A2B A;  4JI3 K;  1ESV A;  5FPM A;  4DTX A;  4FM1 A;  1N34 K;  1WAJ A;  3EEQ A;  4U7B A;  4BDZ A;  1WSE A;  4CEO A;  4I2Q A;  1K8K A;  3A5L C;  4BQZ A;  1SS6 A;  1HNX K;  3QBW A;  3OYI A;  3H45 C;  4AHC A;  4CJQ A;  3TTC A;  1ZBH A;  1DTT A;  1EKE A;  1ZBS A;  2IOC A;  4E3S A;  1RTH A;  5J2M A;  4WCE L;  3PO4 A;  3MN7 A;  3TAE A;  3T19 A;  1LWF A;  4DWI A;  1U6Z A;  4DQR A;  4CD1 A;  3BP8 A;  4H0T B;  4WFA L;  3OJS A;  1RBT A;  4MFB A;  4CD3 A;  1HYS A;  2HVH A;  1MU2 A;  1VSJ A;  2DPN A;  3DAW A;  3FZM A;  1J5E K;  1I39 A;  4C8K A;  3UB5 A;  2E88 A;  3L6Q A;  3VQE A;  4N76 A;  4HUE A;  5LMU K;  3V9Z A;  4EHT A;  3E1Y A;  4CGJ A;  2IIR A;  4W5R A;  3CFP A;  3LDQ A;  3PSI A;  5BN8 A;  4FOE A;  3O4W A;  4IFY A;  5LY3 A;  1HNV A;  1CLQ A;  4QAG A;  2YNI A;  2P9L A;  3K2P A;  1Q81 O;  3TAQ A;  1EET A;  1KVC A;  3HXM A;  5KQ8 A;  3GE1 A;  5AQX A;  3V9S A;  3NF7 A;  4H5V A;  3AO4 A;  4JKF A;  1ASW A;  2GWK A;  2O8E A;  4CGI A;  3U4L A;  3CJ1 A;  3CD6 N;  2F8T A;  1QTM A;  3CCR N;  4CED A;  2ZM6 K;  3G6E N;  3OYF A;  2EHG A;  1CZ9 A;  2XHB A;  1IKW A;  1VQ4 N;  5HLF A;  2NNW A;  4JI1 K;  3VQ4 A;  3G25 A;  3CCS N;  1K6Y A;  4JKD A;  4LD0 A;  3WXI A;  3VEO A;  3PIP L;  2CGL A;  1HQE A;  1QHA A;  4CJL A;  4CVN E;  3T3F A;  2KZZ A;  1HNI A;  5JS1 A;  3RSE B;  5JVG L;  4EZ6 A;  4Y1C A;  5AZJ B;  4DV3 K;  1SL2 A;  1IH7 A;  4JKG B;  4CF8 A;  1D9D A;  4CEQ A;  3WNF A;  3CFO A;  4C1N I;  5CHI A;  3LDP A;  3OYM A;  4DR1 K;  3M6G A;  3C6U A;  4IXC A;  3GOI A;  1ZBL A;  4HVJ A;  4DR7 K;  2P9U B;  4R5P A;  1I3A A;  3PLA A;  2CGJ A;  2OCE A;  1BU6 O;  4E1N A;  3MCP A;  3MED A;  1SZ2 A;  2DFH A;  1K8A O;  1W0H A;  4DMN A;  3OS0 A;  1O13 A;  5AQJ A;  3VF4 A;  4BDY A;  1VQO N;  4H5W A;  3G4S N;  4MO4 A;  4M3Z A;  4WQ5 C;  4B1W B;  4QS7 A;  5AQM A;  1NJY A;  1RDU A;  1SKW A;  5AQG A;  3LM2 A;  2BTF A;  3CCE N;  1HYZ A;  1A5W A;  3R6M A;  3NGI A;  3I56 N;  1S72 N;  5F2R A;  3CM5 A;  3VQA A;  1B9F A;  4KAZ A;  3NVK A;  2HBL A;  4BRA A;  3EZ5 A;  1RTJ A;  1TKT A;  3LWL A;  4G9Z A;  1TYQ B;  2F96 A;  3QLH A;  3MEG A;  3DLL L;  3AAQ A;  4BRF A;  2HNY A;  3VQQ A;  1I94 K;  4KFB A;  5GAD P;  4NCB A;  4IBN A;  4O55 A;  3IG1 A;  5GAH P;  3G10 A;  1GOC A;  3KIO A;  3DRS A;  1VQP N;  4FWQ A;  2HB5 A;  4E7I A;  2Q0U A;  3THW B;  4CFD A;  4FLU A;  3K58 A;  2PFU A;  3P1G A;  3QET A;  3CJC A;  1VSM A;  2Q97 A;  3UKU A;  2O8D A;  2HF3 A;  2WC9 A;  4YNQ A;  1NJW A;  3ZEU B;  4BY9 C;  3P39 A;  1HPM A;  3O9U A;  4FLV A;  4CIE A;  4JK9 A;  1IV0 A;  4E1J A;  1NJI O;  3IAY A;  1RDB A;  3LP2 A;  1RT3 A;  1VSK A;  1YXQ A;  4CZI A;  1E3M A;  4CJ5 A;  3C0B A;  1EP4 A;  4GKK K;  4LF4 K;  1KXP A;  1NNE A;  1VQ7 N;  5AQR A;  3B6P A;  4FJH A;  4H0X B;  2FF3 B;  3M5R A;  1NBW A;  4JI4 K;  2E1Z A;  3TR8 A;  4JYA K;  4BR0 A;  4M3W A;  3CQ8 A;  5C0Y A;  3ULE B;  4FJM A;  1TAU A;  2GX9 A;  4BRK A;  3IKM A;  3AA4 A;  1TVR A;  3MDQ A;  3J81 O;  1TKX A;  4H5N A;  3WT0 A;  2KTQ A;  3HTV A;  4AH9 A;  1EXQ A;  3SQ2 A;  1ZBI A;  3ZSQ A;  4JLH A;  4AHU A;  1L3T A;  3OS1 A;  3DLH A;  2GWJ A;  3VEW A;  3KK7 A;  2O8E B;  3NF6 A;  3O1B A;  3SAF A;  2FSJ A;  2ITG A;  3PO5 A;  1BUP A;  1C0T A;  4O0I A;  3CC4 N;  2BDP A;  3E9O A;  4H4M A;  3L2R A;  4FJI A;  3FZF A;  3WXL A;  1S1V A;  1ZYQ A;  1L3U A;  4JS4 A;  3KWI A;  3LDO A;  2BUP A;  3M8P A;  3RR7 A;  1K73 O;  4I7F A;  4E7K A;  4OKJ A;  3ULD A;  1NGH A;  2IVP A;  5FDL A;  5I42 A;  3AO2 A;  2IGI A;  3NF8 A;  3R3L A;  1ASV A;  5AR0 A;  5ADX H;  3T1H K;  1M90 O;  2F9W A;  5EXW A;  4JHD A;  1BOT O;  3PUF A;  2E2O A;  1H1V A;  2Q36 A;  3MX2 A;  1JCF A;  4C8L A;  5J2P A;  2QWL A;  1TKD A;  3HYF A;  2KW4 A;  1BIU A;  3I8D A;  1OH5 A;  2HHU A;  4E7J A;  2QK9 A;  3LPT A;  2FXU A;  3MAQ A;  4FJG A;  1KFS A;  1VQ9 N;  5B8H A;  2Z1H A;  3J7A P;  3Q7C A;  5F0X A;  4WQ4 A;  4DTS A;  5BR8 K;  2KKZ A;  4KHP K;  4W5O A;  2P5G A;  1N36 K;  3VQ5 A;  2VQE K;  3DYA A;  2QWQ A;  3OS2 A;  4BAC A;  1S9G A;  5AJ3 K;  1WNS A;  1YI2 N;  4JKA A;  4BRO A;  1T7P A;  2OPQ A;  1BCM A;  1YJ9 N;  4FJK A;  4JNE A;  4DTR A;  2XY7 A;  2WTU A;  4B1Y B;  4CJ4 A;  2VGN A;  3OW2 M;  3TAB A;  3HOS A;  3CYM A;  4CFC A;  3HSC A;  3SAG A;  1D8Y A;  5DK5 A;  4CFB A;  4FZZ A;  1GLJ O;  4IG3 A;  2F8S A;  2G8U A;  3MCA B;  1YT3 A;  1CXQ A;  4BC2 A;  4YHH K;  1RT1 A;  4FW1 A;  2XRI A;  4PKH A;  2KQ2 A;  2XY6 A;  3VES A;  4B8A B;  1HX1 A;  1HNZ K;  4IFE A;  4NYN A;  4F3T A;  1NGA A;  4CJT A;  5E41 A;  4KI6 A;  1SL1 A;  1YTA A;  4BVO A;  4OX9 K;  4BRC A;  5C42 A;  2O8F B;  4B1X B;  4O0J A;  4E7L A;  3OJU A;  1GLB G;  4CJ7 A;  3AVF A;  3MEC A;  1TK8 A;  5FRM A;  3VEN A;  2WBN A;  3LP3 A;  5CZ2 A;  2XY5 A;  5KRS A;  3I8B A;  3P38 A;  4BGB A;  4M63 C;  4KTQ A;  1X9W A;  3SQ1 A;  1Q8I A;  3LZJ A;  2KHO A;  1A5X A;  4HWI A;  4PL8 A;  2JWL A;  4BR7 A;  3TU5 A;  4LH4 A;  1V4S A;  2A40 A;  4FLT A;  1QVG M;  3K9K A;  3NVM A;  3N4Q A;  4JI5 K;  4IDK A;  5AQV A;  3IMX A;  4DFK A;  4H5T A;  5FRO A;  4CF0 A;  2PYL A;  1Y97 A;  2I5J A;  1JLC A;  2VWJ A;  1VQ5 N;  2IVN A;  4GV3 A;  1J6Z A;  2HHV A;  1S5J A;  2YKN A;  2P9I B;  3DRP A;  3U9D A;  4DUY K;  3HP9 A;  2HHQ A;  3QEX A;  1VQN N;  4O5F A;  5TKY A;  3EKU A;  3D45 A;  4Z4H A;  2VWK A;  4CJV A;  4ISE A;  3TI0 A;  5JVH L;  4QS9 A;  4CZK A;  3P4I A;  4JI6 K;  1TK0 A;  1R0A A;  5AQS A;  4FLZ A;  1TAQ A;  3MXJ A;  3S3N A;  4FJJ A;  4FWM A;  2P9K B;  1HLU A;  4IKF A;  3RSE A;  1S22 A;  1VK0 A;  1WOQ A;  5AZJ A;  5AQO A;  4JKG A;  2GTD A;  3V9X A;  1RT2 A;  3HOT A;  2Z1J A;  2RN2 A;  3M1F A;  5HBM A;  1NGJ A;  2P9U A;  2EWS A;  4JAX A;  2HW3 A;  2ZJP L;  3BF3 A;  3LM9 A;  1U48 A;  3KLE A;  1KQS M;  2YI1 A;  3OVN A;  4CF2 A;  4DS5 A;  3SMS A;  5D3G A;  1TUY A;  4JRP A;  1U4B A;  4BWJ A;  3RTV A;  1MA9 B;  4B9L A;  2ZF5 O;  4TSX A;  3R9P A;  2PBD A;  3O9Q A;  4IJA A;  4K43 A;  4B3T K;  4X62 K;  5CR4 A;  2O8B B;  3SYZ A;  4EIA A;  1X9M A;  3EE9 A;  2FBV A;  1BIZ A;  4I9L A;  3VEZ A;  5BRD A;  4DSF A;  3TSQ A;  1GLE G;  4BRH A;  3L2U A;  4DSJ A;  2FF6 A;  4YOW A;  3LL3 A;  5EOY A;  4JEP A;  4W5T A;  2QKK A;  4LF7 K;  3J80 O;  3H3O B;  1BWF O;  4DR4 K;  3OYJ A;  2HHS A;  3LDN A;  1U49 A;  3SUP A;  5AFU A;  4FM0 A;  2B6A A;  4BVP A;  2QWR A;  1TYQ A;  5C10 A;  5CY4 A;  1YF5 L;  3O3F A;  3HO1 A;  1S1T A;  4IEE A;  4Z4I A;  4AIL C;  4M3U A;  4FJ7 A;  2VG7 A;  1L5U A;  2GEL A;  4FJN A;  2OA8 A;  3A5O C;  4CZE A;  4YOY A;  4EHU A;  3THW A;  1HQU A;  1TL3 A;  2Q3S A;  3ZX3 A;  4CZH A;  4BG9 A;  3SI6 A;  4Z4C A;  3OYK A;  3JSM A;  3RMA A;  2HVI A;  3L2V A;  3WNH A;  3VEV A;  3V4I A;  2UUB K;  3I55 N;  3P5J A;  1LCU A;  1ILY A;  3ZEU A;  1JLE A;  4CI6 A;  4CER A;  4M41 A;  1P90 A;  1VQ8 N;  3HK2 A;  5EX5 A;  4O44 A;  4H0V B;  1DKG D;  1KD1 O;  1X9S A;  5AQT A;  1W2B M;  4UY8 O;  2NRT A;  3RVC A;  4CJ3 A;  2A6A A;  1L3S A;  2ZGY A;  3RMC A;  4BRP A;  1XMO K;  1GOA A;  3EL2 A;  4DV4 K;  4FK2 A;  2HBK A;  2E2P A;  1SAZ A;  2YHW A;  2RF2 A;  2AA4 A;  4JI0 K;  1HKB A;  4BC5 A;  3ULE A;  1RBR A;  3VN5 A;  3MN9 A;  1WSH A;  2DTU A;  2CGK A;  4FLX A;  4AM7 A;  3RMD A;  3A2F A;  2PZS A;  2HHW A;  3EN9 A;  1XHX A;  1LWE A;  5AFU H;  1YIJ N;  3ALY A;  2DY4 A;  4PHT X;  1T03 A;  4E89 A;  4IWV A;  3U6F A;  1WSJ A;  2Q2R A;  3SBT A;  3AGK A;  3S9H A;  1RT4 A;  4QS8 A;  1JKH A;  3FGU A;  2YCH A;  4ELU A;  5GAE P;  1IKY A;  3ENH A;  4F4K A;  1HNW K;  3K5M A;  3QBX A;  1JXE A;  1YHQ N;  3QER A;  4ELV A;  4X64 K;  2YHB A;  3W3D A;  3OYG A;  4DU3 A;  4MLH A;  4CE9 A;  5AQI A;  3OBW A;  2W6K A;  3OYC A;  3VER A;  5BPL A;  1W97 L;  3SJJ A;  1YUW A;  4IZ9 A;  2E8A A;  1BL3 A;  3ATV A;  1UA1 A;  3IS9 A;  5AQQ A;  3VMF B;  4M3X A;  4MDB A;  1HKG A;  3ZT0 A;  5GIN A;  3L2W A;  4JV5 K;  1NK0 A;  4YOV A;  4OPA A;  3SQ0 A;  3VQC A;  4ZTJ A;  4I2P A;  3AVB A;  4ID1 A;  4NLB A;  1MDU B;  3MX5 A;  1C1B A;  3DLR A;  1XC9 A;  4PY5 A;  1U2V B;  1UAX A;  1LAW A;  4CGG A;  2O4I A;  1NK7 A;  4MO5 A;  4YDU C;  4CEA A;  3VQ6 A;  3HP6 A;  4ID5 A;  3LP1 A;  4AM6 A;  4FPA A;  1RDW X;  2UYT A;  1T8E A;  3WNG A;  3H46 O;  3LP0 A;  2W6L A;  5HRO A;  1C0U A;  1DEJ A;  3QEI A;  4JI8 K;  3SCX A;  3VGM A;  4EAH D;  4HUF A;  2NLX A;  1TL1 A;  3H6E A;  5M1O A;  4CJU A;  2QXF A;  1F21 A;  1J54 A;  2ZWH A;  4CK1 A;  3QNO A;  2YKM A;  3OTO K;  3ITH A;  5EU7 A;  5BPM A;  3O4Q A;  2FBT A;  1RDA A;  1Q18 A;  3DLK A;  5GIP A;  4CZM A;  5BPN A;  1TK5 A;  3NMU A;  2EX3 A;  3EY1 A;  3VA0 A;  3ZYY X;  3MWT A;  3Q7B A;  4K25 A;  4EP5 A;  1J53 A;  3WEE B;  3GBT A;  2HST A;  1NKE A;  4BRE A;  3L2Q A;  1C6V A;  5C25 A;  1QQC A;  3CG7 A;  4AQY K;  2Y1J A;  5KQD A;  1GOB A;  5M1P A;  4CGF A;  1FK9 A;  3AV9 A;  2E1Y A;  3D2E B;  4GW6 A;  4H5R A;  3MN5 A;  3U9Z A;  3SZ2 A;  3WQU A;  4H03 B;  3J7Y P;  1OVQ A;  1VHX A;  4MLE A;  2AJQ A;  1LWC A;  4B1V A;  4OO1 J;  4AF1 A;  2GBZ A;  4L8R B;  1U45 A;  2KLA A;  3NBP A;  2OTL N;  4HCC A;  3NGZ A;  2GV9 A;  1YVU A;  3S3M A;  3V9U A;  1KLM A;  1VSL A;  1JCG A;  1KFD A;  2B5J A;  5T7B A;  3DI6 A;  4F9O A;  1JXB A;  3AVJ A;  2YHA A;  2UUA K;  2HND A;  3V81 A;  3UE5 A;  4KB0 A;  4FJL A;  4OPH A;  2BGG A;  3QML A;  2O8F A;  2D5R A;  3AO1 A;  3F2K A;  1KSP A;  4B1U B;  3KK1 A;  1KCF A;  4H0Y B;  5ADX A;  2G8K A;  2NRR A;  4MDA A;  4B08 A;  4HCB A;  4RCH A;  2P9S B;  4M7Y A;  3O4N A;  3ID6 A;  4N56 A;  4RW4 A;  3JYT A;  3CXC M;  4J2D A;  4DTJ A;  3ZSZ A;  3H1Q A;  1WBB A;  2UXD K;  5LL6 Z;  3F9M A;  1RBV A;  4GNI A;  3C6A A;  4Y1D A;  4IEI A;  4FL9 A;  4UQG A;  2KZM A;  1VSF A;  3VQ9 A;  4LFB K;  3T69 A;  4B9T A;  1WSG A;  1KAX A;  4F2S A;  1QS4 A;  4OPJ A;  3FLC O;  3THX B;  3LDL A;  4FWR A;  3P83 D;  2A42 A;  1NWK A;  5CYM A;  4B3S K;  2G8H A;  4B9U A;  2HHT A;  4PKG A;  4LF8 K;  2P5O A;  4F3O A;  4CEF A;  5AQF A;  2PY5 A;  3HPG A;  4CJP A;  5FRN A;  4CHN A;  4XH4 A;  1RCH A;  4NCG A;  5AZI B;  1WSF A;  2P9I A;  4C23 A;  1QVF M;  2QXL A;  4BRM A;  5DMR A;  1KVB A;  2J4R A;  1FW6 A;  4WQ5 A;  2HHX A;  3NH2 A;  4BGA A;  3CQY A;  4CW7 B;  4YOT A;  4DQQ A;  4ISG A;  4BRI A;  2QW9 A;  3I33 A;  1IG8 A;  4KH6 A;  2PYJ A;  1EX4 A;  1HYV A;  1GLC G;  3OYN A;  1RNH A;  1Q9Y A;  3CJA A;  4A2A A;  2E6L A;  3GDQ A;  4M7X A;  4CK2 A;  4EFH A;  5CE3 A;  1KAZ A;  2ASO A;  1VSE A;  1NGB A;  3T7Z A;  2HMI A;  2P9K A;  1YJW N;  4WF9 L;  3PSF A;  5AQY A;  4YOR A;  3CIP A;  3OYL A;  4Z4F A;  4BRQ A;  4EP4 A;  4KH5 A;  1SKS A;  5IWA K;  2RPI A;  3V6D A;  3KKS A;  2E6M A;  3DOL A;  4KV8 A;  3HVT A;  3QES A;  1XWL A;  3QB0 A;  2YNF A;  3G71 N;  4BE2 A;  1M1K O;  3QIN A;  2Z1I A;  1ITG A;  5KRT A;  1NOY A;  3O5B A;  1NU0 A;  4E0D A;  1LOT B;  1Z25 A;  3CC2 N;  1BGX T;  1NGC A;  4OKE A;  3ZSV A;  3U3G A;  2KFZ A;  2G8V A;  4DTP A;  3ZLJ A;  4DLG A;  2E4L A;  3EZW A;  1FXX A;  4KO0 A;  1BHL A;  1HKC A;  4C1N K;  5HRS A;  5LMN K;  2KFN A;  1WB9 A;  1G15 A;  2O8B A;  1HRH A;  1BQN A;  4CBX A;  4FZX C;  5KPT A;  4HTL A;  4CF1 A;  3L3V A;  1B92 A;  2HF4 A;  2X78 A;  3CCQ N;  3JAM O;  4AHV A;  2W40 A;  3L3U A;  3SV4 A;  2D0O A;  3ZSO A;  3F73 A;  3C95 A;  4Q0B A;  3CHW A;  1TKZ A;  4CF9 A;  4DTM A;  3NHG A;  4O4G A;  1TUU A;  3VTH A;  5TKW A;  1OKJ A;  4FJ8 A;  1JLG A;  5HRN A;  2JLE A;  1UWB A;  2E2Q A;  1T05 A;  5J2N A;  1IKX A;  4FW2 A;  2YNH A;  4ILH A;  3LAK A;  2GUP A;  3SLC A;  3HBT A;  1VSD A;  1OH8 A;  1JCE A;  4RWT A;  2I7P A;  2VG5 A;  4LSL A;  4B1Z A;  3SBG A;  4NLC A;  3TAF A;  2YJF A;  1L3V A;  1YVN A;  1KC8 O;  4BRG A;  2VG6 A;  4CZF A;  1N33 K;  1U04 A;  4A5A A;  3NF9 A;  3KLF A;  1OH7 A;  1OH6 A;  4FOI A;  3PX6 A;  2QWM A;  2ZQB A;  3HST B;  3MN6 A;  1NKC A;  1NG9 A;  2HBJ A;  1T6C A;  4DS4 A;  1WSI A;  2ZGZ A;  5CZ1 A;  2V52 B;  2OZM A;  3TAR A;  4CIG A;  1JJ2 M;  1QQM A;  3DXM B;  4DV2 K;  2ETJ A;  4JKC A;  2RE2 A;  1RFQ A;  4M42 A;  4IDH A;  2NRZ A;  4WFB L;  3HRG A;  2D0B A;  4B9N A;  1C0G A;  3H3N O;  4JN4 A;  3EYZ A;  5GIO A;  4RW9 A;  2G8W A;  3DLG A;  3AVC A;  4L3Q A;  1OVY A;  1T44 A;  3LWM A;  1N6Q A;  1RIL A;  2YJE A;  3DWL A;  2P51 A;  2NUB A;  2VCP A;  1QE1 A;  4DV7 K;  3VQ8 A;  3B8A X;  2GEM A;  4X65 K;  4YFU A;  4PKI A;  2B4J A;  5KGW A;  4ILJ A;  1JLQ A;  3LAM A;  4M3T A;  5IT9 O;  3CJB A;  5KGX A;  4DF8 A;  1DT9 A;  3HVR A;  3AA2 A;  4XH5 A;  3NAE A;  3ZX2 A;  3TAM A;  5DM6 L;  1NK5 A;  2E5L K;  1YTU A;  3KVG A;  1Q9X A;  4CK3 A;  1DGK N;  2I7N A;  3AAR A;  3PX4 A;  4G1Q A;  3BF1 A;  1N32 K;  1FKO A;  5J1E A;  3AVM A;  1WUA A;  3AVK A;  4RG8 A;  4DQP A;  3BEX A;  4FCY A;  3BZC A;  2JGU A;  4KTW A;  3K57 A;  3HI0 A;  5M1Q A;  4BR5 A;  3CFR A;  1XMQ K;  4AHT A;  5JLF A;  1C1C A;  4YOU A;  2ZJR L;  1CXU A;  3AAP A;  4FM2 A;  3FZK A;  3AVA A;  1GLF O;  1BA1 A;  1GLL O;  3MMV A;  4HTU A;  4KHY A;  5HRP A;  1XHZ A;  1KVA A;  3HPO A;  4FPB A;  1A5V A;  4E7H A;  4E19 A;  2E20 A;  1NLV A;  1ZBU A;  4JI7 K;  3VGL A;  4FJ9 A;  2QWP A;  3V1Q A;  1Z26 A;  1U2V A;  3VQ7 A;  3GG4 A;  4KBO A;  2IS3 A;  1IJJ A;  5C24 A;  1SKR A;  4PL7 A;  2CH6 A;  3KKR A;  1NMN A;  4I6M B;  3VQP A;  4LH5 A;  5AQU A;  1E4G T;  5HP1 A;  2P9P B;  1KTQ A;  4KHW A;  5KI6 A;  1VQ6 N;  3EO3 A;  3SPZ A;  3LPU A;  4R79 A;  2QA4 N;  3SQ4 A;  5M1N A;  1RTD A;  1KLN A;  4IJN A;  4J2B A;  2QEX N;  3CMA N;  4JD2 B;  3K5O A;  1S9E A;  3WXK A;  3TAG A;  3DM2 A;  5AQK A;  3CF5 L;  5HL7 L;  4NO7 A;  3M8Q A;  4FVU A;  3L4Q A;  4JK7 A;  5KPZ A;  2IC3 A;  3NH1 A;  3OYH A;  3C7N B;  2JWK A;  3L4I A;  1RDC A;  3AVL A;  3VET A;  3WEE A;  4DR6 K;  4JKB A;  4A61 A;  2V51 B;  3KLH A;  4K8X A;  1SQK A;  1RT7 A;  5KTQ A;  1XI1 A;  4CBU A;  3TPQ A;  1K9M O;  1QHT A;  2UXC K;  5E84 A;  4DLE A;  3OYD A;  3WUH A;  1MWK A;  3I0S A;  3UIQ A;  4M45 A;  4BRD A;  3D2E A;  3VEX A;  4BC3 A;  4KPY A;  1NGE A;  4FLW A;  4BRN A;  1WN7 A;  2G8F A;  3QFP A;  3VF2 A;  3O1W A;  4OGC A;  1ZXO A;  5SWM A;  3HM9 A;  5BRE A;  1E4F T;  1IO2 A;  3AO5 A;  3OY9 A;  5JLH A;  3CPW M;  2HOE A;  3U3Y A;  4BR2 A;  2LSN A;  3BGR A;  1XNR K;  5C2D A;  1W7A A;  2P1J A;  4M3Y A;  1N5Y A;  3DLE A;  4X66 K;  4FXD A;  4OLB A;  1JLB A;  4CJF A;  2A1R A;  1XQS C;  5M1F A;  4CJE A;  1P8Z A;  5GAG P;  1NGD A;  4WYB A;  1Q82 O;  2G8I A;  2DFE A;  4DTU A;  5I9E B;  4BDP A;  3QEV A;  4NCA A;  2P9S A;  4DKW A;  4CEB A;  4H0P A;  4V19 S;  3TTF A;  1J9A A;  2WON A;  3CPE A;  2O8C B;  3D2F B;  4WFN L;  1RBU A;  3FZH A;  2H3G X;  5A2Q O;  1RT5 A;  2ZJQ L;  1BG3 A;  3BZK A;  4CJR A;  1YIT N;  1R59 O;  1X9J A;  2CH5 A;  4XH1 A;  3CCM N;  4PUO A;  2ZD1 A;  2X6N A;  4FK4 A;  5FLX O;  3ID8 A;  3AVN A;  3WXM B;  3UKR B;  1ATR A;  3THV A;  2YX6 A;  3THX A;  4Z94 A;  4DV6 K;  3TAP A;  3NE6 A;  1WLJ A;  1DTQ A;  2O4G A;  1BA0 A;  1FJG K;  4RW7 A;  1JL1 A;  4DR2 K;  4ILG B;  2D4W A;  3ZX0 A; 
#chains in the Genus database with same CATH homology
 4DG1 A;  2HND A;  5JS2 A;  1KRP A;  1IKV A;  4CEE A;  3V81 A;  4ELT A;  4KB0 A;  4FJL A;  2BGG A;  3VQ5 A;  3PY8 A;  2D5R A;  2XY8 A;  3AO1 A;  3DYA A;  3LDS A;  1NK8 A;  1VSH A;  1KSP A;  3OS2 A;  3KK1 A;  4BAC A;  1S9G A;  1KCF A;  1WNS A;  3DRR A;  2G8K A;  4B08 A;  4HCB A;  4I9Q A;  1T7P A;  4BE1 A;  2OPQ A;  1BCM A;  3O4N A;  4ICL A;  4DFM A;  4FJK A;  4N56 A;  1ASU A;  4RW4 A;  3PX0 A;  4KI4 A;  4DTR A;  2XY7 A;  4WE1 A;  2FC0 A;  3V1R A;  3JYT A;  4J2D A;  4DTJ A;  3ZSZ A;  4E1M A;  4GMJ B;  4DSI A;  1RBV A;  4CJ4 A;  4Y1D A;  3RR8 A;  3ISN C;  4UQG A;  1RDD A;  2D0C A;  2GUI A;  3TAN A;  2KZM A;  1VSF A;  3VQ9 A;  3TAB A;  3CYM A;  4B9T A;  3ZCM A;  4CFC A;  3KLG A;  2Y1I A;  1WSG A;  1SUQ A;  1D8Y A;  1BIS A;  5DK5 A;  4CFB A;  3RMB A;  4FZZ A;  3CM6 A;  3SV3 A;  2D0A A;  4F2S A;  1BI4 A;  1QS4 A;  4IG3 A;  4OPJ A;  2F8S A;  2G8U A;  1YT3 A;  1CXQ A;  4J2E A;  1RT1 A;  4FW1 A;  3P83 D;  2XRI A;  2KQ2 A;  2XY6 A;  4B8A B;  5CYM A;  4CES A;  2X74 A;  1SL0 A;  2G8H A;  4B9U A;  4F2R A;  3ZSW A;  2HHT A;  1CZB A;  4GVM A;  4NYN A;  3KJV A;  5CYQ A;  3LZI A;  2P5O A;  4F3T A;  4CJT A;  4F3O A;  5E41 A;  4CEF A;  4CHZ A;  4KI6 A;  4Z4E A;  3NFA A;  4DQS A;  2PY5 A;  3HPG A;  4CJP A;  1SL1 A;  1YTA A;  5FRN A;  4CHN A;  4DF4 A;  1RCH A;  5C42 A;  4NCG A;  4O0J A;  3WNE A;  4CIF A;  1VRU A;  1WSF A;  4CEC A;  4CFA A;  3OJU A;  4E7L A;  4LSN A;  2ATQ A;  5DMR A;  4DQI A;  1KVB A;  1TV6 A;  3AVF A;  3MEC A;  3NH2 A;  4N5S A;  1TK8 A;  5FRM A;  4HUG A;  2HHX A;  4AHS A;  4DQQ A;  3HL8 A;  1JLF A;  2WOM A;  3LP3 A;  5CZ2 A;  3AVG A;  2XY5 A;  4QOZ B;  2PYJ A;  4Z4G A;  1NKB A;  5KRS A;  3AVH A;  1EX4 A;  4C8O A;  1HYV A;  3HPH A;  4KKO A;  3OYN A;  3D0P A;  3TWH A;  1RNH A;  3S3O A;  1Q9Y A;  1DLO A;  2OPP A;  3MEE A;  3ZT3 A;  2E6L A;  4KTQ A;  4B3O A;  1X9W A;  3SQ1 A;  1Q8I A;  1SV5 A;  4CK2 A;  3KK2 A;  3LZJ A;  2HMI A;  1VSE A;  1A5X A;  3G0Z A;  2FBX A;  4BWM A;  4RW8 A;  4F8R A;  4RW6 A;  3DLB A;  3I0R A;  4LH4 A;  3NH0 A;  2YV0 X;  4FLT A;  4N47 A;  3OYL A;  4DTO A;  2W42 A;  3AO3 A;  4KB1 A;  1BI4 B;  4Z4F A;  1BQM A;  3B6O A;  4EP4 A;  1J5O A;  1SKS A;  1QSY A;  2RPI A;  3QEW A;  3V6D A;  3KKS A;  4DTX A;  2E6M A;  3DOL A;  4IDK A;  4KV8 A;  4FK0 A;  3HVT A;  2Z1G A;  4OJR A;  4FM1 A;  1WAJ A;  1XWL A;  3QES A;  2FBY A;  2YNF A;  4BE2 A;  4CHP A;  4BDZ A;  1WSE A;  2Z1I A;  3QIN A;  4I2Q A;  1ITG A;  4CEO A;  1LV5 A;  5KRT A;  4DFK A;  1NOY A;  5FRO A;  4CJK A;  4E0D A;  4FYD A;  1Z25 A;  3OYI A;  4CF0 A;  4AHC A;  4CJQ A;  2PYL A;  1Y97 A;  3L8B A;  2I5J A;  1JLC A;  1DTT A;  2VWJ A;  1ZBH A;  1BGX T;  1EKE A;  2IOC A;  4OKE A;  3ZSV A;  4E3S A;  2HHV A;  3U3G A;  1RTH A;  2KFZ A;  2G8V A;  1S5J A;  4DTP A;  2YKN A;  5J2M A;  3DRP A;  3PO4 A;  3TAE A;  4LY7 A;  4W5N A;  4DLG A;  2E4L A;  3T19 A;  1LWF A;  4DWI A;  3HP9 A;  2YNG A;  4DQR A;  2HHQ A;  1FXX A;  4KO0 A;  1BHL A;  1JL2 A;  5HRS A;  2KFN A;  4H8K A;  3QEX A;  1G15 A;  3LAN A;  1HRH A;  1BQN A;  3OJS A;  1RBT A;  4MFB A;  3D45 A;  3T1A A;  4Z4H A;  3FFI A;  2VWK A;  4CJV A;  3TI0 A;  4FZX C;  1HYS A;  2HVH A;  4PQU A;  1MU2 A;  1VSJ A;  1TK0 A;  1R0A A;  4CF1 A;  4CJW A;  3L3V A;  1B92 A;  4FLZ A;  1I39 A;  1TAQ A;  3MXJ A;  3ZSY A;  4C8K A;  2X78 A;  4AHV A;  3VQE A;  4N76 A;  5K14 A;  4HUE A;  3S3N A;  4FJJ A;  3L3U A;  3V9Z A;  3SV4 A;  1QSS A;  3ZSO A;  4CGJ A;  3F73 A;  3PV8 A;  3C95 A;  4H4O A;  4IKF A;  4KHQ A;  4CCH A;  4N41 A;  1VK0 A;  4W5R A;  3CFP A;  3RRG A;  4Q0B A;  4CF9 A;  1TKZ A;  4AHR A;  4B9V A;  4DTM A;  4IFY A;  3NHG A;  1HNV A;  1CLQ A;  4QAG A;  2YNI A;  4O4G A;  3K2P A;  3TAQ A;  3V9X A;  3ZT1 A;  4NYF A;  1RT2 A;  4FJ8 A;  1JLG A;  1EET A;  1KVC A;  1RTI A;  2Z1J A;  5HRN A;  2RN2 A;  1NK4 A;  2JLE A;  1UWB A;  1T05 A;  5J2N A;  3HXM A;  5HBM A;  1IKX A;  4FW2 A;  1LW0 A;  3V9S A;  2YNH A;  3NF7 A;  3AO4 A;  2HW3 A;  2OPR A;  5I3U A;  1ASW A;  1U48 A;  4FVM A;  3LAK A;  3NDK A;  4CGI A;  3KLE A;  4EZ9 A;  2F8T A;  3OVN A;  4CF2 A;  1QTM A;  1VSD A;  4CED A;  4DS5 A;  2ZE2 A;  3IRX A;  5D3G A;  3OYF A;  2EHG A;  4JRP A;  1U4B A;  4BWJ A;  3V1O A;  1CZ9 A;  2XHB A;  2VG5 A;  3RTV A;  1IKW A;  4LSL A;  4B9L A;  5HLF A;  4TSX A;  3TAF A;  2X6S A;  1S1W A;  1S1U A;  3VQD A;  1L3V A;  3SUN A;  2VG6 A;  3QNN A;  3VQ4 A;  2HNZ A;  1NOZ A;  3SYZ A;  1X9M A;  2BAN A;  3H08 A;  1K6Y A;  2FBV A;  1U04 A;  1BIZ A;  4LD0 A;  3OYA A;  3NF9 A;  4I9L A;  3KLF A;  3M8R A;  4FLY A;  4DSF A;  1WAF A;  4KRF A;  5HRR A;  3PX6 A;  3L2U A;  4C8N A;  3HST B;  2ZQB A;  1HQE A;  3OYE A;  4B9S A;  4DSJ A;  1NKC A;  4W5T A;  2QKK A;  4CJL A;  1WSI A;  4DS4 A;  4MQ3 A;  3VA3 A;  5CZ1 A;  3OYJ A;  4K8Z A;  4CHO A;  2HHS A;  3T3F A;  2OZM A;  3TAR A;  1NK9 A;  1HNI A;  4CIG A;  3AA5 X;  2KZZ A;  5JS1 A;  1U49 A;  2ETJ A;  3RWU A;  3SUP A;  4FM0 A;  4DSE A;  4Y1C A;  2B6A A;  4EZ6 A;  3KLI A;  1C1A A;  1SL2 A;  1IH7 A;  5CY4 A;  4CF8 A;  3O3F A;  1D9D A;  4CEQ A;  3WNF A;  3HO1 A;  3NCI A;  1S1T A;  3CFO A;  4M42 A;  4Z4I A;  4AIL C;  4M3U A;  3OYB A;  4FJ7 A;  3OYM A;  2VG7 A;  1L5U A;  4FJN A;  2OA8 A;  4DSL A;  3C6U A;  3ZSX A;  1ZBL A;  1S1X A;  2D0B A;  4HVJ A;  4B9N A;  3BDP A;  4IG0 A;  4R5P A;  1I3A A;  3EYZ A;  1HQU A;  1QSL A;  1TL3 A;  2Q3S A;  4E1N A;  3MED A;  4OVL A;  4RW9 A;  3DLG A;  1FKP A;  3AVC A;  4CGD A;  3O3H A;  4JRQ A;  2G8W A;  4FZY A;  3SI6 A;  2DFH A;  3LWM A;  1N6Q A;  4Z4C A;  1RIL A;  3OYK A;  1W0H A;  2P51 A;  2NUB A;  4KTZ A;  4DMN A;  1QE1 A;  3JSM A;  3VQ8 A;  3OS0 A;  4DFJ A;  3SUQ A;  3RMA A;  2HVI A;  4YFU A;  3L2V A;  3WNH A;  3V4I A;  2B4J A;  3ZT2 A;  4BDY A;  5KGW A;  1NJZ A;  1UOC A;  3P5J A;  4M3Z A;  1JLQ A;  1LAV A;  3DMJ A;  1JLE A;  4CER A;  4M41 A;  3LAM A;  4M3T A;  5KGX A;  4DF8 A;  4PA1 A;  1NJY A;  1SKW A;  3HVR A;  4QCL A;  3AA2 A;  1IG9 A;  4ZHR A;  1TGO A;  4OGE A;  2OYQ A;  3NAE A;  3HK2 A;  3TAM A;  1NK5 A;  1HYZ A;  1A5W A;  1YTU A;  4O44 A;  1X1P A;  3NGI A;  4CK3 A;  1Q9X A;  2QKB A;  2IAJ A;  4FJ5 A;  3CM5 A;  3VQA A;  1B9F A;  1RBS A;  4KAZ A;  3PX4 A;  4G1Q A;  1X9S A;  1FKO A;  3EZ5 A;  5J1E A;  1RTJ A;  4IFV A;  1TKT A;  3AVM A;  1HJR A;  2RKI A;  3AVK A;  3LWL A;  4RG8 A;  4DQP A;  4CJ3 A;  4FCY A;  1L3S A;  2F96 A;  2JGU A;  3QLH A;  3MEG A;  4KTW A;  3K57 A;  3RMC A;  3CFR A;  1GOA A;  4AHT A;  2HNY A;  1C1C A;  3VQQ A;  4KFB A;  1CXU A;  4FK2 A;  4FM2 A;  3SUO A;  4NCB A;  4IBN A;  4O55 A;  2RF2 A;  3IG1 A;  3KK3 A;  3AVA A;  3G10 A;  2XO7 A;  1GOC A;  4KHY A;  4HTU A;  3KIO A;  5HRP A;  1RBR A;  3DRS A;  3VN5 A;  1XHZ A;  1KVA A;  1WSH A;  3HPO A;  2DTU A;  3AVI A;  2HB5 A;  4E7I A;  4FLX A;  1A5V A;  3RMD A;  4CFD A;  3A2F A;  4C8M A;  4Q5V A;  3K5N A;  4E7H A;  4E19 A;  4FLU A;  2PZS A;  2HHW A;  1XHX A;  3MXI A;  3K58 A;  1ZBU A;  3SNN A;  1LWE A;  4FJ9 A;  3P1G A;  1Z26 A;  3V1Q A;  3QET A;  3SPY A;  3VQ7 A;  4XIU A;  2BE2 A;  3ALY A;  2DY4 A;  3HJF A;  4Z0U A;  1T03 A;  1VSM A;  2IS3 A;  4E89 A;  5C24 A;  1ZBF A;  3U6F A;  1WSJ A;  4YNQ A;  1NJW A;  1SKR A;  3S9H A;  4ZTF A;  1RT4 A;  3KKR A;  4PWD A;  5SZT A;  1JKH A;  2OPS A;  4LH5 A;  3VQP A;  5HP1 A;  4FLV A;  1KTQ A;  4ELU A;  5KI6 A;  4CIE A;  4KHW A;  3SPZ A;  1IKY A;  1HMV A;  3LPU A;  4BE0 A;  4F4K A;  3M8S A;  3K5M A;  3V9W A;  4DFP A;  3SQ4 A;  1RTD A;  3IAY A;  1KLN A;  4JS5 A;  1JXE A;  4W5Q A;  4J2B A;  3QER A;  1RDB A;  3LP2 A;  4ELV A;  2YHB A;  1RT3 A;  1VSK A;  3K5O A;  3OYG A;  4DU3 A;  3KD5 E;  4CJ5 A;  1S9E A;  5J2Q A;  1EP4 A;  4KHN A;  3TAG A;  2OZS A;  3DM2 A;  4CE9 A;  4KHU A;  4DU4 A;  3M8Q A;  1VRT A;  1D9F A;  4FJX A;  3OYC A;  3B6P A;  2IC3 A;  1REV A;  3NH1 A;  3SJJ A;  4FJH A;  1BL3 A;  3OYH A;  1UA1 A;  3O3G A;  4DU1 A;  3IS9 A;  3TR8 A;  1LW2 A;  4M3X A;  1RDC A;  4M3W A;  3CQ8 A;  1O1W A;  3AVL A;  3ZT0 A;  3K59 A;  3L2W A;  1NK0 A;  4FJM A;  3ZSR A;  3KLH A;  3SQ0 A;  4K8X A;  3VQC A;  4ZTJ A;  4I2P A;  1TAU A;  5KTQ A;  1RT7 A;  3AVB A;  4ID1 A;  3QIO A;  1XI1 A;  3AA4 A;  4OKK A;  1QHT A;  1C1B A;  3KTQ A;  1VSI A;  3DLR A;  4DLE A;  1XC9 A;  3OYD A;  4PY5 A;  3I0S A;  1UAX A;  1LAW A;  1TVR A;  4M45 A;  4CGG A;  3UIQ A;  2O4I A;  1TKX A;  1NK7 A;  3MXM A;  3F9K A;  4KPY A;  2KTQ A;  4CEA A;  3VQ6 A;  3HP6 A;  4AH9 A;  1EXQ A;  1UA0 A;  4FLW A;  1S6P A;  3SQ2 A;  4ID5 A;  1ZBI A;  3LP1 A;  1WN7 A;  3AA3 A;  2R7Y A;  2G8F A;  1T8E A;  4OGC A;  1W9H A;  3ZSQ A;  3WNG A;  4JLH A;  4AHU A;  3LP0 A;  5SWM A;  3OS1 A;  5HRO A;  1L3T A;  1C0U A;  3DLH A;  3HM9 A;  4CHY A;  4B9M A;  3QEI A;  1NJX A;  3SCX A;  1IO2 A;  3AO5 A;  3C94 A;  3NF6 A;  3OY9 A;  4HUF A;  1TL1 A;  3U3Y A;  2ITG A;  2DFF A;  4DSK A;  1B9D A;  2LSN A;  3PO5 A;  4CJU A;  3BGR A;  1C0T A;  4O0I A;  2BDP A;  4CEZ A;  1HPZ A;  4H4M A;  3L2R A;  4FJI A;  1NK6 A;  2QXF A;  1S1V A;  1ZYQ A;  1F21 A;  1J54 A;  4CK1 A;  2P1J A;  1D5A A;  2YKM A;  3QNO A;  1L3U A;  3ITH A;  5EU7 A;  4JS4 A;  3O4Q A;  1N5Y A;  2FBT A;  1RDA A;  3DLE A;  3KD1 E;  4M3Y A;  4B8C A;  1C0M A;  4DTN A;  2IDO A;  4FXD A;  3M8P A;  3RR7 A;  3DLK A;  1JLB A;  4OLB A;  4CJF A;  4I7F A;  4E7K A;  2A1R A;  4OKJ A;  1U47 A;  4CJE A;  1TK5 A;  2EX3 A;  4OLA A;  3ULD A;  2A1S A;  3EY1 A;  5FDL A;  3VA0 A;  5I42 A;  3QO9 A;  3AO2 A;  2IGI A;  2G8I A;  3NF8 A;  3QEP A;  2DFE A;  1ASV A;  4DTU A;  4EP5 A;  1S6Q A;  1J53 A;  3VQB A;  4BDP A;  3QEV A;  1NKE A;  3C6T A;  3L2Q A;  4NCA A;  3E01 A;  3PUF A;  4CEB A;  1C6V A;  5C25 A;  3NGY A;  1J9A A;  1QQC A;  2WON A;  3CG7 A;  1BCO A;  4O5B A;  2Y1J A;  1GOB A;  3DOK A;  4CGF A;  4KHS A;  1FK9 A;  1RT6 A;  4C8L A;  4CJS A;  3AV9 A;  5J2P A;  4OPK A;  1RBU A;  4GW6 A;  4CHQ A;  3ZT4 A;  1TKD A;  3LAL A;  1RT5 A;  3SZ2 A;  4CJR A;  3HYF A;  2KW4 A;  1BIU A;  4M3R A;  3I8D A;  2AJQ A;  1LWC A;  2HHU A;  4E7J A;  3K5L A;  4PUO A;  2ZD1 A;  2QK9 A;  2GBZ A;  2X6N A;  3LPT A;  3MAQ A;  1U45 A;  4L8R B;  4FK4 A;  3NBP A;  4HCC A;  3NGZ A;  4FJG A;  2GV9 A;  3AVN A;  1YVU A;  3S3M A;  3V9U A;  1KFS A;  4J2A A;  3THV A;  4HHT A;  3TAP A;  1JLA A;  1KLM A;  3RRH A;  1VSL A;  3NE6 A;  1KFD A;  1WLJ A;  2B5J A;  2Z1H A;  4KRE A;  1DTQ A;  2O4G A;  5T7B A;  4RW7 A;  3DI6 A;  1JL1 A;  1JXB A;  3QIP A;  4DTS A;  3AVJ A;  3HT3 A;  4CGH A;  4W5O A;  2P5G A;  3ASM A;  2YHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...