4CIFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cifA00
1A5VA 1YT3A 1NOYA 1TAQA 2OPSA 4RW4A 3NCIA 3QNNA 3TAEA 1KVAA 4CEZA 3P5JA 1Q9YA 3IS9A 4HTUA 4DTMA 3PY8A 5T7BA 3DOKA 1RILA 4NYFA 4O5BA 1YTUA 2VWKA 3SYZA 1RTIA 3DYAA 2YV0X 5HLFA 1XHZA 3LANA 2KFZA 4RW7A 3L2WA 3M8SA 3EY1A 3NDKA 1NK6A 4LSLA 4E89A 2Z1HA 2D0AA 2BDPA 1S5JA 4M42A 3L2VA 4O44A 4FZYA 1JLEA 4GMJB 3LZIA 1D8YA 4CJEA 4M3YA 3M8PA 3SCXA 1S9EA 1XHXA 2AJQA 3LP3A 3CQ8A 3WNGA 1C1CA 1BIZA 1ITGA 2FBVA 2P51A 4KHUA 4XIUA 4NYNA 2Z1GA 2O4GA 4Q5VA 1C6VA 1WLJA 4PA1A 3QIOA 1SKSA 3V9WA 1J5OA 4N47A 4CIFA 4DTUA 2DY4A 4OKJA 1QHTA 2X6SA 1HRHA 4W5OA 3PX4A 1RTHA 1NKCA 3DLHA 3HO1A 3ZCMA 2X6NA 1W0HA 1RBRA 3QLHA 3T19A 4J2DA 3D45A 3SZ2A 4OGEA 4B9NA 4DLEA 3IAYA 2OZMA 3DLGA 4IFVA 2YNIA 2P1JA 3V9SA 1ZBUA 3QERA 2Y1JA 4M3UA 1J53A 2XHBA 4QAGA 2HVIA 1TK8A 4HUGA 3SPYA 3NH2A 1VSHA 4DQRA 1FKOA 3HPOA 4FJ7A 4DFMA 2ZD1A 2GV9A 3NBPA 3NH1A 4OLBA 4E7LA 4QCLA 3OYBA 4CF1A 1BHLA 4PWDA 3LP2A 4CJPA 3K5NA 3LAKA 3NF6A 4CEOA 4KPYA 3M8QA 4AHCA 4ELTA 1KLMA 4F2SA 1XI1A 4FM0A 1ZYQA 1LW2A 3NH0A 4E0DA 1QS4A 4KO0A 5FDLA 4GW6A 4ID1A 3O4QA 2G8HA 3SUNA 4ELVA 4DTJA 4DSEA 1LAWA 2YKMA 1WSJA 1BI4A 4CJQA 4W5QA 4DSLA 2E6MA 2XO7A 1WNSA 4CHQA 3TAQA 1L3UA 1W9HA 4HUEA 3MXIA 1RNHA 1RT6A 2D5RA 1S6QA 4KV8A 4W5RA 3NAEA 4KHYA 3NFAA 4FLXA 1B9DA 4JRPA 1HYVA 3ZT3A 3OJSA 3OYJA 4BWJA 1U45A 4C8OA 2YNHA 4DSKA 2HHWA 5KTQA 2HNYA 4IKFA 1BCMA 2O4IA 4ZHRA 3OY9A 5CYQA 2HVHA 4DTNA 3V1QA 1YTAA 4CFCA 5J2QA 4CJWA 1RBUA 1RDAA 5SWMA 3F9KA 3ZSWA 4I9QA 3HSTB 1TKZA 4BDZA 3ZT2A 2A1SA 4B8CA 3BGRA 1S1WA 1RBTA 3HYFA 3PX6A 4I7FA 1QSYA 4AILC 1C1AA 2HHQA 1EX4A 1L3VA 5HP1A 4CESA 1BISA 3T3FA 1GOCA 1NJXA 1LAVA 4DS4A 1HQUA 4ELUA 2HB5A 3K5LA 3VQPA 1FXXA 3U6FA 1KFSA 3TAMA 1NJYA 3PO4A 1EP4A 4W5NA 4B08A 3HP9A 4CJUA 4DF4A 3QEIA 3MXMA 1CXUA 2G8UA 3HK2A 3U3YA 4J2EA 4CGGA 3MEGA 4IDKA 4TSXA 3OYIA 3RMBA 2B4JA 4HVJA 4L8RB 4LSNA 1ZBLA 1D9FA 3B6OA 1WSEA 2HNDA 5KGWA 3KLFA 4HHTA 1VSKA 2HMIA 4O55A 1IKYA 2KQ2A 2YNFA 4OGCA 2HHXA 3LWLA 1RDDA 3ZSZA 3RTVA 1WN7A 1VSDA 4BACA 4YNQA 4OPJA 5CZ1A 3TARA 2BANA 1U47A 4FJIA 3CM5A 1ZBFA 4CGIA 3VQ8A 5HBMA 4CJ5A 3VQ5A 4CEAA 4BE1A 2WOMA 2DFEA 1MU2A 2FBYA 3G0ZA 5CY4A 4DTSA 3I0RA 1UWBA 3DRSA 3ZSVA 2HW3A 1U49A 3I0SA 3AVCA 1KVBA 1RT7A 5KGXA 2DFFA 1T05A 2QKBA 4F3TA 2RN2A 3LPTA 4KREA 3P1GA 3NE6A 2G8IA 4ZTJA 3ASMA 3DRPA 1SUQA 1TK5A 4DU1A 2HNZA 1BQMA 3L8BA 4CFBA 3OYEA 2QXFA 1NK4A 1NK5A 1TV6A 4AHTA 4Q0BA 4Y1CA 2GUIA 1S1XA 4DS5A 2JLEA 2G8VA 4Z4IA 2IAJA 2IS3A 4DLGA 4JS5A 2Z1IA 4OJRA 4Z0UA 4E7KA 1D9DA 3KK3A 4ICLA 3TANA 5SZTA 3V6DA 1NK0A 2FBTA 1IG9A 1REVA 5C42A 4BDPA 5HROA 1LWCA 1JLCA 1C1BA 3OYAA 1CZ9A 4DU3A 3ULDA 4B9UA 4EZ9A 4RG8A 1HQEA 2OPPA 3L2QA 1TL3A 3VQBA 3B6PA 4DQSA 4DFPA 1S9GA 1ASUA 3AA4A 4LH5A 4I9LA 5FROA 3S3NA 4AHVA 1JLBA 4MQ3A 2W42A 4MFBA 1IKXA 4AH9A 2XY7A 3NGIA 3AA2A 4FJ5A 1GOAA 1LWFA 2G8WA 3DMJA 2F96A 4E19A 3LP0A 3ZT0A 4CEFA 5K14A 1KRPA 4DTOA 3AVFA 3TAGA 2VG7A 1C0TA 2GBZA 2YHAA 3HL8A 3KKSA 4FM1A 1D5AA 1JXEA 1EETA 1RT5A 3JYTA 3LWMA 4CEEA 3QEXA 4M41A 1Q8IA 4NCBA 4N76A 4JLHA 2HHTA 4LY7A 1VRUA 1T7PA 3NF9A 3I8DA 1Z25A 4C8LA 4DSJA 1S1TA 1ASVA 3E01A 3IRXA 4J2AA 4IFYA 3OYNA 1SL2A 1RBVA 4CEDA 4CF0A 3HT3A 1L3SA 3TR8A 1DTTA 1S1VA 3DM2A 4R5PA 3ZSRA 2YKNA 3OYHA 4H4MA 4HUFA 2F8TA 4F2RA 3SV4A 4B9SA 4KB1A 3VA0A 2Y1IA 4PUOA 1VRTA 3UIQA 4CF8A 1DLOA 1EKEA 4YFUA 1VSFA 2VWJA 3AVMA 4KKOA 4F4KA 3KLHA 3ZSYA 4N5SA 2BE2A 5CZ2A 2XY5A 4FW2A 1BQNA 4CGDA 1UOCA 2E6LA 1F21A 5J1EA 3BDPA 3OVNA 4Z4FA 4WE1A 4KAZA 3AVKA 2EX3A 3O3FA 2X74A 3RWUA 4NCGA 2RPIA 4KHWA 4Z4GA 4JRQA 1BL3A 4FJJA 4DMNA 3AVNA 1S1UA 4CE9A 3K59A 2IGIA 1VK0A 4OKEA 5FRNA 3KJVA 2ATQA 1CXQA 1JL1A 4KI4A 4LD0A 1U48A 1K6YA 1RT3A 4KTWA 4FJGA 1A5WA 1XWLA 1FK9A 3CM6A 2PZSA 2OA8A 3A2FA 1JLFA 3CFOA 2ZE2A 3DI6A 2I5JA 3EYZA 1L3TA 1HMVA 3RRHA 4KB0A 3H08A 4FM2A 5FRMA 2RF2A 3SNNA 3EZ5A 3CFPA 1J54A 4F8RA 1WAJA 3L2RA 4CJKA 1KLNA 1VSEA 3HJFA 4F3OA 1TAUA 1LWEA 1NJZA 3L3UA 3NF7A 4BE0A 3JSMA 1N6QA 4B9MA 1S6PA 1VSJA 3QO9A 4N56A 3RMCA 3HPHA 2D0CA 4E1NA 3WNHA 4Z4HA 3L2UA 4FLWA 3QETA 4E1MA 3SQ2A 3MXJA 4K8ZA 2OYQA 4C8NA 1L5UA 3AA3A 1HPZA 3DLRA 1SKWA 4H8KA 4CJRA 3MECA 1JL2A 2KZMA 2OZSA 1VSLA 4CGJA 3C6UA 1RCHA 3AO3A 3AVLA 3QINA 5JS2A 4CJFA 3AVIA 1WSIA 3TWHA 2NUBA 5EU7A 3LDSA 3VQ4A 4DFJA 1N5YA 2FC0A 3PUFA 3IG1A 4Z4EA 1QTMA 3KLGA 3OYGA 5J2MA 3VQQA 4FLUA 4CHZA 1KSPA 3VQ7A 3AV9A 3K58A 4B9TA 4Y1DA 4M3ZA 3VQ9A 3ZT4A 4PY5A 5KRSA 3AVGA 3HVRA 3ISNC 1QQCA 4DG1A 4CERA 5HRSA 2YHBA 3SUQA 1FKPA 4IBNA 3ZSOA 3KK1A 5I42A 2G8KA 1ASWA 4ID5A 4UQGA 4DU4A 1JLQA 1HJRA 4E7IA 4BWMA 1UA0A 2HHSA 5HRRA 4BE2A 3LZJA 4RW6A 4CIGA 3OYMA 3PO5A 2QKKA 4CHNA 4RW9A 3KK2A 4B9VA 4KHSA 4FYDA 2IOCA 3AVHA 2YNGA 4DSFA 5I3UA 4GVMA 3L3VA 3M8RA 4HCBA 4CFDA 4FZXC 3OS0A 3SUOA 1C0MA 3P83D 3HP6A 1TVRA 4O4GA 3NGZA 1Q9XA 1IKVA 3PX0A 5E41A 4ZTFA 4M3RA 2P5GA 4QOZB 4EP4A 1LW0A 5C24A 4E7JA 3F73A 2P5OA 2RKIA 4C8MA 3VQAA 2D0BA 3KLEA 1KCFA 4CGFA 5C25A 4CFAA 1NKBA 4G1QA 5KI6A 5KRTA 3DLKA 3HPGA 4DTRA 2LSNA 3KKRA 1X1PA 3T1AA 3VQDA 4CEBA 3QESA 1LV5A 4IG0A 3S3OA 3KTQA 1TGOA 2VG6A 3DLBA 4KI6A 5HRPA 4KTZA 4AHUA 1TKXA 3TAFA 3V9ZA 3LP1A 3V1OA 4BDYA 1B9FA 4FCYA 4DQQA 4H4OA 3RR7A 3O3HA 4DTXA 3K5MA 4E7HA 1Z26A 3VA3A 1TL1A 3WNFA 1SL1A 2WONA 4FLTA 3SQ1A 1QE1A 3D0PA 3SJJA 1NOZA 4KHNA 1SKRA 1X9WA 2F8SA 1O1WA 3AO4A 4CCHA 4DFKA 5D3GA 1CZBA 3QEVA 3OS1A 3V4IA 4RW8A 1NKEA 1UAXA 4Z4CA 4M3TA 4FJLA 1TK0A 3V81A 1HNVA 3HVTA 2JGUA 4FJ8A 4PQUA 3K2PA 4B9LA 4FK4A 5DK5A 3DLEA 4CF2A 1R0AA 1ZBIA 2IC3A 3LALA 3OYKA 4JS4A 4W5TA 3AA5X 1EXQA 3TI0A 2DTUA 4OKKA 3HXMA 1UA1A 4IG3A 3LAMA 4DWIA 3K57A 1IKWA 4FVMA 4HCCA 1A5XA 2KTQA 1HNIA 4C8KA 1RDBA 4B8AB 2PY5A 3CFRA 1WSFA 4DQPA 1IH7A 1GOBA 2X78A 1SV5A 1C0UA 5J2NA 3SPZA 3ZSQA 1RDCA 5J2PA 1T8EA 3VQEA 3AO2A 2G8FA 3VQCA 2ZQBA 1BI4B 3OYLA 3SQ0A 3KIOA 1BIUA 3VQ6A 3SUPA 5JS1A 3ALYA 3DRRA 1G15A 3V1RA 3AVBA 4CGHA 3THVA 4FXDA 3ZT1A 1WAFA 3C95A 1NJWA 4FJHA 4KHQA 3ITHA 3NHGA 1RTDA 3KD5E 2IDOA 3U3GA 4CK3A 5CYMA 3SI6A 2ITGA 3DOLA 5HRNA 4O0IA 3NF8A 1JLAA 4CHOA 4CEQA 2HHUA 3TAPA 1Y97A 3V9UA 2VG5A 1T03A 3KLIA 1RT1A 4FK2A 4FJ9A 1QSLA 2B5JA 1BGXT 4I2QA 3RMAA 4FJNA 4FJXA 4M3XA 4CK2A 3KD1E 3O4NA 2R7YA 1RTJA 3S3MA 1JLGA 2ETJA 2XY8A 3ZSXA 2BGGA 3V9XA 4DTPA 1HYZA 4FK0A 2HHVA 1KTQA 1JXBA 1KVCA 3MEDA 3AVAA 3LPUA 1JKHA 2PYJA 4AHSA 3OJUA 1RBSA 1X9SA 4FZZA 3VN5A 3MAQA 4CJ3A 3QEPA 4I2PA 3C6TA 1NK8A 1I39A 4FLVA 2QK9A 3FFIA 1DTQA 3NGYA 4K8XA 1NK7A 3OYDA 1RT2A 4FJKA 2B6AA 1CLQA 4EP5A 4CK1A 4CF9A 4CJVA 4CIEA 4DF8A 3WNEA 4CJ4A 3SQ4A 1ZBHA 4LH4A 4E3SA 2XY6A 3HM9A 4O0JA 4KFBA 4OVLA 3QNOA 3RMDA 4KRFA 1J9AA 1KFDA 4M3WA 3CYMA 3O3GA 2FBXA 3SV3A 4FLZA 1U4BA 4KTQA 1VSMA 3K5OA 1U04A 3OYFA 3RRGA 2PYLA 3RR8A 4FJMA 1SL0A 3AVJA 1NK9A 1WSHA 3G10A 4AHRA 2OPRA 4DSIA 4EZ6A 1WSGA 3OYCA 1TKDA 4CHPA 2KFNA 3C94A 3OS2A 2DFHA 4J2BA 5DMRA 1VSIA 2Q3SA 4CHYA 2KW4A 3PV8A 4DQIA 3TABA 4CECA 4OLAA 1BCOA 4CJSA 2KZZA 1RT4A 2OPQA 3AO1A 1I3AA 2XRIA 3QEWA 3AO5A 2A1RA 1HYSA 3CG7A 4N41A 4M45A 4FW1A 4FLYA 1XC9A 3MEEA 1YVUA 4NCAA 4CJTA 3S9HA 1B92A 4B3OA 1IO2A 1QSSA 2EHGA 2Z1JA 4CJLA 2E4LA 1X9MA 4OPKA 1TKTA 3QIPA
chains in the Genus database with same CATH superfamily
1YT3A 1TAQA 4FPAA 3FLCO 1KVAA 3IS9A 4DTMA 3DOKA 1RILA 4O5BA 5M1FA 1WOQA 4V19S 3LANA 1VQ4N 5LMUK 2UYTA 4K42A 3EY1A 4LSLA 4E89A 1S5JA 2ZF5O 3L2VA 1VQNN 3MMVA 3E9LA 1XHXA 3ZETA 3LP3A 3CQ8A 3CCQN 3G25A 4BVPA 1BIZA 1ITGA 2FBVA 3P31A 4XIUA 1GLCG 4LF6K 1BA0A 4X64K 3V9WA 1J5OA 1GLEG 4OKJA 2NRZA 2X6SA 3I33A 4B9NA 4OGEA 3VMFB 3IAYA 2QEXN 3DLGA 1NGBA 2Y1JA 2P1JA 3QMLA 1ZBUA 4M3UA 2GX9A 4HUGA 5JICA 1FKOA 2FF3B 4DFMA 2F4VK 2GV9A 4E7LA 3CJBA 3OYBA 4CZMA 4MDAA 4CJPA 3LAKA 4CZKA 4Y0WA 1XI1A 4FM0A 5FDLA 3UKRA 4ID1A 4EHUA 2G8HA 2YX6A 3HRGA 3CCLN 1WNSA 3TAQA 3MXIA 2Q31A 4KV8A 3NFAA 3EEQA 1HYVA 3ZT3A 3FE1A 4BRKA 4BR7A 4C8OA 3VERA 1RFQA 3ENBA 3D2EB 2A5XA 1YJ9N 1YTAA 4CFCA 4A62A 1OH7A 1RBUA 3F9KA 1NNEA 4BDZA 4O5FA 3BGRA 3HYFA 3PX6A 3LDLA 3T3FA 1BISA 1NJXA 1ZBSA 5C10A 4DS4A 4GKKK 3K5LA 3TAMA 4B1VA 3PO4A 3MN7A 3J80O 3MXMA 3HK2A 1CXUA 4IO8A 4ILJA 3MEGA 3RVCA 4B3SK 3R9PA 1D9FA 3B6OA 1WSEA 2HMIA 3AY9A 1RDDA 4B1YB 5CZ1A 2BANA 4BRLA 4YOYA 2OTLN 1ATNA 4U67L 2WOMA 2DFEA 5CY4A 4DTSA 3S41A 1UWBA 3THYB 5TKWA 2RN2A 3LM2A 3K0SA 1SUQA 3H6EA 1WUAA 4PKHA 3L8BA 2PBDA 3OYEA 4H0VB 1NK5A 5GIOA 2NRTA 5AQPA 4I6MA 4Z4IA 2QWOA 4YOUA 4YOWA 3TANA 3CI5A 4CZEA 2FBTA 1REVA 5HROA 1JLCA 3OYAA 1NLVA 3TPQA 4LH5A 4RWTA 4F3TA 4MQ3A 4BGAA 3C6HA 3LDPA 1GOAA 1LWFA 4R79A 2F96A 3O9SA 3ZT0A 3SAHA 1T3VA 4DTOA 2VG7A 4WQ5C 2UUAK 4M41A 1IBKK 1P8ZA 1WBDA 3NF9A 2J4RA 5ADXH 1Z25A 1S1TA 1ASVA 2E5LK 4IFYA 4J2AA 5EOYA 1RBVA 4CEDA 4CF0A 3CQXA 3TR8A 3DM2A 3C7NA 3ZSRA 4WFNL 2UU9K 2CH6A 2HSTA 1DKGD 5AZIB 4FOIA 4B9SA 2O8BA 4KB1A 4FPBA 1YAGA 3Q7CA 1VRTA 1DLOA 4DR6K 1EKEA 2FXUA 3AVMA 2D0OA 1TUUA 5LJVA 5BN8A 2E6LA 1BO5O 3GDQA 4KAZA 2EX3A 2I7PA 5FPNA 3O3FA 3RWUA 4Z4GA 4JRQA 1X9JA 2QWNA 4FWMA 1BL3A 1XNQK 2BH1A 5FRNA 1YUWA 3KJVA 4CZFA 1JL1A 4KI4A 4KHPK 4W5NA 5AQOA 1ILYA 2OA8A 1NM1A 1L3TA 1HMVA 4KB0A 2KLAA 1J54A 1KLNA 4JI0K 1VSEA 5BRFA 3HJFA 3VTHA 1LWEA 1NJZA 1VSJA 3QO9A 4E1NA 4FLWA 2Q1NA 1HNXK 1T6DA 1W97L 3H45C 1HPZA 4CJRA 2KZMA 1RCHA 3AO3A 3AVLA 3QINA 5AQTA 2NUBA 5AZJB 3VQQA 4CZJA 4JI8K 5M1NA 1RGIA 3KHYA 4JN4A 2E2NA 4B1UB 4DG1A 5HRSA 2YJFA 5M1PA 2YHBA 3SUQA 2G8KA 1HLUA 4UQGA 3N4QA 1HJRA 5BR8K 1UA0A 3M5RA 5HRRA 4BE2A 3LZJA 2HHSA 5GAGP 4CHNA 2YNGA 5BN9A 4DSFA 4GVMA 5I3UA 3ZX2A 4EHTA 4HCBA 2H3GX 1Q9XA 3BF3A 5E41A 2P5GA 3NVKA 4EP4A 5C24A 2IVOA 3VEWA 3RSEA 4CFAA 3ULEA 4G1QA 4PKGA 5KRTA 1NJIO 1X1PA 4CEBA 3H1QA 3QESA 4IG0A 3KTQA 2E1ZA 3KVGA 2VG6A 5HRPA 2QA4N 3TAFA 3BZCA 3LP1A 4FCYA 3K5MA 4JK8A 2FLOA 1X9WA 2F8SA 1O1WA 2DPNA 5KQ8A 4PL8A 1XNRK 4CZLA 4GV3A 2UUCK 4FJ8A 2JGUA 4B9LA 5DK5A 4Z94A 3T1YK 3MWPA 1ZBIA 4BC4A 3PIOL 4JS4A 5FPDA 2DTUA 1UA1A 3LAMA 2GTDA 3K57A 3P39A 4FWQA 1A5XA 4X62K 1HNIA 4IXCA 4JD2A 2PY5A 1CZAN 1IH7A 2X78A 1N32K 3ZSQA 5AZJA 2G8FA 2ZQBA 2GWJA 1BI4B 3SQ0A 3CCEN 3KIOA 1KAXA 3VQ6A 4K0KK 3DRRA 1G15A 3THVA 3CPWM 4CGHA 1ESVA 1OH8A 3ZT1A 1WAFA 3C95A 3ITHA 3NHGA 1RTDA 3KD5E 3VETA 5JVGL 3DOLA 3J7AP 3NF8A 3BY5A 3QFPA 4CEQA 4DKWA 1KC8O 2WTUA 2ASOA 4FK2A 1QSLA 4M3XA 1QQNA 4CK2A 5B8HA 1NGEA 3O4NA 1JLGA 4FK0A 3WEEA 3L6QA 4BQLA 3MEDA 3LPUA 2PYJA 3SAFA 2YHWA 1RBSA 4FZZA 2P9NA 3QFUA 3TU5A 1HKBA 4ISEA 1NK7A 1RT2A 5AQHA 1CLQA 3WNEA 4LH4A 4E3SA 2XY6A 3HM9A 4OVLA 4KRFA 3O3GA 2FBXA 3RR8A 4FJMA 2HBMA 3T7ZA 1NK9A 1WSHA 4AHRA 1WSGA 3CJ9A 3C94A 3OS2A 1JJ2M 2W41A 3SAGA 2KW4A 5EY4A 3CF5L 3TABA 2KZZA 4CJSA 4DR5K 1YF5L 3AO1A 4OO1J 3AO5A 4QS9A 4FW1A 1WBBA 3MEEA 1YVUA 1IJJA 3FR0A 1IO2A 2EHGA 2Z1JA 4BC3A 4MO5A 4DV6K 2NRHA 1XC3A 3P5JA 4C1NK 3MN5A 3U9ZA 5EXWA 4NYFA 2VWKA 1VQKN 1RTIA 1XHZA 3L2WA 2O8FB 3ZETB 3NDKA 4BRAA 1JCGA 2Z1HA 3DXMB 2D0AA 5BPLA 2BDPA 4M42A 1JLEA 3CETA 4FWOA 3VGLA 3LZIA 4GV9A 4LFAK 2ZGYA 3WNGA 1K73O 1VAZA 4KHUA 1Q7YO 2O4GA 4MDBA 3BEXA 4CIFA 2DY4A 1NMNA 4BROA 4CBUA 3HO1A 3AARA 4JKAA 3U8XA 3T19A 4IJAA 4J2DA 1N33K 2CH5A 5HL7L 2XHBA 5F0XA 2RHKA 2HVIA 2ZWHA 2FSKA 2E2PA 3K9JA 1GLAG 3NH1A 4H0OA 4QCLA 3HBTA 4CF1A 3LP2A 3K5NA 3NF6A 1OVQA 4CD1A 2GWKA 3ID8A 2NRWA 1HKGA 4GW6A 4KO0A 4DTJA 4XEIA 1WSJA 1BI4A 4CHQA 3CJAA 1YI2N 1L3UA 2D4WA 4HUEA 2F9TA 3D2FA 2P9IA 4KHYA 3NMUA 3C0BA 3TTDA 4BWJA 2YNHA 3UE5A 4DSKA 4H5RA 2HVHA 4ZHRA 5CYQA 4DTNA 2QWMA 1SQKA 3LM9A 2F9WA 1U2VA 3ZT2A 1IG8A 1S1WA 4I7FA 1QSYA 4AILC 3O8MA 4FWPA 4CESA 5FLXO 3FZHA 1HQUA 3WXLA 2HB5A 1FXXA 5GADP 1VQ8N 1NGDA 4B08A 4CJUA 2G8UA 3A5OC 3QEIA 3U3YA 1OVYA 4J2EA 4IDKA 2B4JA 4EIAA 1ZBLA 1J5EK 1WB9A 4M7XA 5BPMA 2QXLA 4OGCA 1IKYA 5JVHL 1DEJA 3LWLA 3ZSZA 2AA4A 1VSDA 4OPJA 3TARA 4BE1A 3VQ5A 4DUZK 1KXPA 2IVPA 3G0ZA 2HW3A 3I0RA 3ZSVA 5H1SQ 1U49A 3I0SA 1T05A 1KVBA 5KGXA 2QKBA 4GVEA 2KKZA 3ASMA 1TK5A 2V7YA 1BQMA 3O1BA 4Q0BA 2YCHA 1NMDA 3VEOA 4Y1CA 4A61A 4YOXA 2JLEA 4BC2A 5BPNA 4JS5A 3RSEB 3C7NB 3PIPL 1NU0A 3DLLL 5C42A 4BDPA 2NNWA 4B9UA 2QW9A 4EZ9A 2YHYA 1HQEA 2OPPA 4DQSA 3ATVA 4WFBL 4LF9K 4BREA 5AQFA 4K41A 5FROA 2W42A 3S3NA 4MFBA 2WBNA 2O8DA 4FJ5A 2G8WA 2NRRA 4CEFA 3KKSA 4X65K 1EETA 3WXKA 1BU6O 3LWMA 4CEEA 3AAPA 2P9NB 3QEXA 2HBLA 5GAEP 1MWMA 4JLHA 2HHTA 4DSJA 3E01A 3IRXA 3OYNA 1SL2A 4R5PA 2F8TA 4H4MA 3SV4A 4KH4A 1T6CA 2Y1IA 1NGAA 2E2QA 4J8FA 4BRPA 2VWJA 4BR0A 4KKOA 3F9MA 4BG9A 1MWKA 3ZSYA 5CZ2A 1IBMK 1LOTB 2QWPA 4BQZA 1VQMN 4Z4FA 2AP1A 3OVNA 4BRFA 4WE1A 1N36K 4DV7K 1NGIA 3TSQA 4KHWA 4DMNA 1S1UA 3K59A 3HZ6A 2IGIA 1VK0A 1CXQA 3THXA 4LF8K 1U48A 3J7ZO 1YHQN 1JLFA 3OTOK 4FM2A 2E2OA 4CJKA 3MX2A 1EO1A 3MCPA 3H46O 3L3UA 3NF7A 4WF9L 1N34K 4B9MA 1S6PA 1JCFA 4N56A 3RMCA 3ENHA 3CERA 3HPHA 4E1MA 3SQ2A 3MXJA 1L5UA 4GV6A 3ATUA 1SKWA 3SBTA 4H8KA 4CBXA 3MECA 4OPAA 2OZSA 4CGJA 3C6UA 4FJNA 4CJFA 5JS2A 1HNZK 1WSIA 4DV0K 2FC0A 3IG1A 1NBWA 1HKCA 4FLUA 1U6ZA 2O8BB 4B9TA 4C23A 4PY5A 4BR4A 4LF5K 3AVGA 3ISNC 1QQCA 4CERA 4ID5A 4DU4A 2A41A 4KH6A 4FOEA 4BWMA 5I9EB 4CIGA 4BR5A 3PO5A 3KK2A 4DR4K 4FYDA 4IEEA 4OPHA 3AVHA 3K9KA 4NXNK 3J8AA 3ZYYX 3M8RA 2ITMA 3OS0A 1C0MA 5E84A 3HP6A 4JI3K 1TVRA 3L4QA 3CMEN 3FZMA 2A42A 4A5AA 3CCJN 2D0BA 4YY3K 1YXQA 2P9LA 4IZ9A 5AQJA 5KI6A 1EQYA 3KKRA 1LV5A 1Z6RA 3J81O 4KTZA 4AHUA 5AFUA 3VEVA 4LFCK 3V9ZA 4BDYA 1B9FA 3RR7A 3O3HA 1Z26A 4DR7K 1SL1A 4WQ4A 1O13A 3D0PA 1NOZA 1VQLN 1SKRA 3KWGA 2WC9A 4NLCA 1N8RO 3SK3A 1Y64A 4FWRA 2NRVA 4JI7K 4RW8A 5GINA 4Z4CA 4M3TA 2O8CB 1TK0A 3HVTA 5AQUA 4CW7B 3DLEA 4CF2A 1R0AA 3VF2A 3TI0A 4IG3A 1IKWA 3IMXA 3CCVN 2VGNA 1RDBA 1G99A 4B8AB 2P9SA 3TSUA 3CFRA 1GOBA 1SV5A 1T8EA 5BRHA 3VTIA 2E8AA 3ALYA 2A6AA 3KK7A 4HTLA 1DGKN 3D2FB 2P9LB 3WUHA 3THWB 4CK3A 5CYMA 3SI6A 2ITGA 3FGUA 1JLAA 2HHUA 4YDUC 1Y97A 3V9UA 1T03A 4FJXA 3RMAA 3G4SN 3VOVA 3S3MA 1YVNA 2ETJA 2XY8A 3O9RA 1HYZA 1TUYA 4DTPA 1JXBA 1KVCA 3AVAA 4AHSA 1TYQA 4I2PA 1NK8A 2P9UA 1I39A 2QK9A 3NGYA 4FWSA 4EP5A 4CK1A 4E1JA 4H0YB 4CJVA 4CIEA 1R59O 3QNOA 4KFBA 4H5WA 3WT0A 3SV3A 3R3LA 1U4BA 5AQYA 3IDHA 4WFAL 3OYFA 4H5TA 3AVJA 4IOAL 4OX9K 5KPZA 4MLHA 1XMQK 2DFHA 4YORA 3PV8A 4DQIA 4CECA 2OPQA 4LFBK 1I3AA 4QS8A 3QEWA 1HYSA 3OW2M 1E3MA 1XC9A 3EL2A 2P9KA 4CJTA 3S9HA 1B92A 4B3OA 5C12A 2E20A 1A5VA 1V4TA 2HF4A 3BP8A 1NOYA 2OPSA 3TAEA 4CEZA 3FZFA 4HTUA 3M1FA 1YTUA 3SYZA 3NVMA 4RW7A 4JHDA 4GNIA 5GAHP 3M8SA 1QQOA 1NK6A 5DM6L 4O44A 4KH5A 1D8YA 4CJEA 4DV1K 3M8PA 3CMAN 1RDWX 1GLLO 4BRDA 2P51A 4Q5VA 5ADXA 1C6VA 4PA1A 4JKHA 2NRXA 4N47A 4DTUA 1OH5A 5AQZA 3H3NO 3DLHA 1HRHA 5AQLA 3PX4A 1RTHA 3BUZB 2X6NA 1IV0A 3O1WA 1RBRA 3SMSA 3D45A 2NZTA 4DLEA 1VQON 2OZMA 4B1XB 2YNIA 3QERA 3V9SA 3QICA 2VYPA 1J53A 3SPYA 1BUPA 3NH2A 1VSHA 3CJCA 4FJ7A 2ZD1A 2UXCK 2VCPA 5EVZA 4IO9L 1BHLA 4PWDA 3M8QA 1NGGA 1LW2A 3NH0A 3MCAB 1H1VA 1QS4A 3I8BA 3O4QA 4DV4K 1QZ6A 1LAWA 4BR2A 2YKMA 2CGLA 3VENA 2GEMA 5AZIA 1RNHA 2D5RA 4W5RA 3NAEA 2O8FA 4FLXA 4JK9A 3OYJA 4JNEA 3CJ1A 1YJWN 5KTQA 4EAHD 2HNYA 1BCMA 1EWQA 1VHXA 2P9PB 5J2QA 3LDQA 4IDHA 1X3MA 3ZSWA 1TKZA 3UKUB 4B8CA 3QDKA 2HHQA 1EX4A 5HP1A 3FFKB 4XH4A 2O8EA 1LAVA 5FPEA 1HX1A 3CQYA 3VQPA 1KFSA 4JKGB 3HP9A 4B3TK 4FWNA 4CGGA 4TSXA 2P9KB 4XH5A 4JK7A 4L8RB 5IWAK 4DR1K 3KLFA 1VSKA 3CJ7A 2KQ2A 3O9TA 2HHXA 4BRGA 3RTVA 1WN7A 4BACA 4YOTA 4JKDA 2ASMA 1ZBFA 4CJ5A 3VQ8A 4K25A 5HBMA 4ILHA 3MN6A 3DAWA 1RT7A 2DFFA 3U9DA 3NE6A 2G8IA 4ZTJA 3LDNA 5AQWA 3EKUA 2HNZA 4CFBA 3B8AX 3HOTA 1NK4A 4AHTA 4IWVA 4CZHA 2IAJA 2IS3A 4DLGA 2Z1IA 4OJRA 4Z0UA 5F2RA 1YITN 4ICLA 5A2QO 5KQDA 1TYQB 5SZTA 3V6DA 4JI1K 1IG9A 1C1BA 1Q82O 1CZ9A 3UB5A 3B6PA 4DFPA 1ASUA 3AA4A 1M1KO 2W40A 4AHVA 1JLBA 1IKXA 4AH9A 3NGIA 3AA2A 1GLJO 3A0IX 3DMJA 1OH6A 4E19A 3LP0A 3AVFA 3TAGA 1C0TA 2YHAA 3HL8A 4FM1A 1D5AA 3LL3A 1VQ6N 4B3RK 4N76A 4LY7A 1VRUA 1T7PA 2D0PA 3HT3A 3MDQA 3OYHA 1S1VA 2YKNA 3VEYA 4F2RA 3T1HK 4ILGB 4X66K 3VA0A 4PUOA 1S22A 2HMPA 3L4IA 1VSFA 4BRCA 1NGJA 3ZX3A 5BREA 4N5SA 2XY5A 5C2FA 4FW2A 4CGDA 1BQNA 1UOCA 5J1EA 3BDPA 2O8CA 3AVKA 4NCGA 1EWRA 4FJJA 1RDUA 2HF3A 3O08A 4OKEA 5MLCQ 3R8EA 3A5LC 2ATQA 4LD0A 1K6YA 1RT3A 4FJGA 1A5WA 1FK9A 3CM6A 2I7NA 3CCRN 3ZX0A 1QVGM 2CGKA 2I5JA 4HWIA 3EYZA 3RRHA 3P4IA 3H08A 3SNNA 2P9UB 4JEPA 4F3OA 1TAUA 4BE0A 3JSMA 1E4FT 4NLBA 3WNHA 4Z4HA 2E88A 2NLXA 2Q36A 4K8ZA 4BGBA 4H5NA 4C8NA 5C15A 4IJNA 3TWHA 4FJKA 5AFUH 3AVIA 1N5YA 3VGMA 4CHZA 3VQ7A 3AV9A 3K58A 2BTFA 3OHRA 4Y1DA 4M3ZA 1VQ5N 4MO4A 3ZT4A 4GY2B 1MDUB 3HVRA 4BRMA 3KK1A 3ZSOA 5I42A 3SLCA 5JMVA 4E7IA 2W6LA 2OCEA 3QB0A 3FZLA 2QKKA 1XMOK 2VQEK 2IOCA 3WEEB 3C6AA 4O8UA 3SBGA 1BWFO 1Q18A 1HPMA 5AQKA 4FZXC 3NGZA 4O4GA 1IKVA 1HUXA 4RTFD 3WQUA 4ZTFA 1LW0A 4E7JA 2RKIA 4C8MA 1OKJA 2OTJN 3VQAA 3DLKA 4DTRA 3T1AA 3VQDA 1TGOA 3GBTA 3DLBA 1QHAA 4IOXA 1TKXA 5JLFA 1YIJN 1NGHA 4DQQA 4H0XB 4PHTX 4E7HA 1Q81O 1IBLK 3CCSN 1TL1A 3WNFA 2WONA 3OBWA 1QE1A 4KHNA 3AO4A 2BUPA 2E1YA 4DFKA 3QEVA 3OS1A 4XH1A 3V4IA 4UY8O 4FJLA 4PQUA 3V81A 1HNVA 4DV5K 4JKFA 3K2PA 1XUPO 4JI2K 5AQVA 3CIPA 3AA5X 1EXQA 1BDGA 3G6EN 3HXMA 4DWIA 2O8DB 3JXUA 4FVMA 4NB4A 4JI4K 2KTQA 1WSFA 3N4PA 3PLAA 3SPZA 1C0UA 2EWSA 4BG8A 3JAMO 1RDCA 5J2PA 4FO0A 3AO2A 3D2EA 3OYLA 1BIUA 3O5BA 3SUPA 5EX5A 5BR9A 5JS1A 3AVBA 2YHXA 4BRHA 3CCMN 1NJWA 1SZ2A 2IDOA 5GIPA 5HRNA 4CBWA 4CHOA 3TAPA 4K43A 2VG5A 1ATSA 3KLIA 4I2QA 3U4LA 4I6MB 2P9PA 5ELZA 3E9PA 2R7YA 1GLBG 3T69A 2BGGA 2HHVA 3ZSXA 5BRDA 1K9MO 1KTQA 3I56N 4C1NI 2VQFK 3AAQA 4GKJK 1X9SA 3VN5A 4JKBA 3MAQA 4CJ3A 3QEPA 4JV5K 4DB3A 4CVNE 4FLVA 4K8XA 2B6AA 4JKGA 4IOCL 3SQ4A 4DF8A 3DWLA 2HHHK 2Q0RA 5CE3A 1S3XA 3AGRA 1J9AA 4M3WA 4KTQA 2W6KA 1U04A 2VGMA 3G10A 2QM1A 2OPRA 4H0TB 5LJWA 3MN9A 1NGCA 2P9SB 1QVFM 4J2BA 4RCHA 4CHYA 1VSIA 2Q3SA 3JS6A 4OLAA 4M7YA 1RT4A 3THYA 4LF7K 4JAXA 2A1RA 3CC2N 3CG7A 4M45A 1J6ZA 4BR9A 3L0QA 1KQSM 3THWA 3F5TA 4CJLA 2OYQA 1X9MA 1TKTA 3QIPA 1VQPN 4RW4A 3NCIA 3QNNA 3PSIA 2OANA 1Q9YA 4CD3A 3PY8A 4MLEA 5T7BA 3EKSA 3DYAA 5HLFA 2YV0X 2KFZA 4NXMK 1P90A 4FL9A 4FZYA 4GMJB 4M3YA 3O9UA 3SCXA 1D4XA 1S9EA 3THXB 4A57A 2AJQA 4G9ZA 1C1CA 3E66A 3KZBA 3UKRB 4NYNA 2Z1GA 3D7EO 1WLJA 3LDOA 3QIOA 4ISGA 1SKSA 4FWLA 1QHTA 4W5OA 1NKCA 5AQIA 3ZCMA 2JWKA 1W0HA 3QLHA 3SZ2A 3QBXA 4IFVA 4QAGA 4B3MK 3E1YA 3E9OA 4M63C 5AQRA 1TK8A 3ZEUB 1YJNN 4DQRA 1K8KB 3HPOA 3NBPA 4OLBA 3OBYA 5AQNA 4ISFA 1MA9B 4CEOA 4KPYA 3DXMA 3R6MA 4AHCA 4ELTA 1KLMA 4F2SA 1ZYQA 3I55N 1HNWK 1FJGK 4CZGA 4YDUA 4WQ5A 4E0DA 2FSNA 4DV3K 3SUNA 4ELVA 4QS7A 3M6GA 4CZIA 4A2AA 4DSEA 1GLFO 2VWBA 4CJQA 4W5QA 4DSLA 2E6MA 2XO7A 3GOIA 2A3ZA 1W9HA 4FSVA 5AR0A 3J7YP 1RT6A 1S6QA 4DV2K 1B9DA 4JRPA 3OJSA 1U45A 2ZJQL 2HHWA 3A5MC 4LF4K 4IKFA 2O4IA 3OY9A 3V1QA 4PL7A 4CJWA 1RDAA 3TTFA 5SWMA 3P38A 3HSTB 4I9QA 2D1KA 2A1SA 1RBTA 5C2DA 1C1AA 2RE2A 1L3VA 3TSPA 5AJ3K 1GOCA 1SS6A 4FVUA 4NO7A 3O80A 4ELUA 1V4SA 1QZ5A 3U6FA 2V7ZA 1HJOA 1NJYA 1EP4A 3CC4N 3ZLJA 1NWKA 4DF4A 3UKUA 1QQMA 5LY3A 3RMBA 2PFUA 3OYIA 3A8YA 2YI1A 4HVJA 3CD6N 4A59A 3F2KA 4LSNA 5LMNK 4F9OA 3PSFA 5KGWA 2HNDA 4HHTA 2GUPA 4O55A 2YNFA 4JKEA 4YNQA 3C65A 2ZJRL 1U47A 4FJIA 3CM5A 4CGIA 4CEAA 5DM7L 1MU2A 2FBYA 3DRSA 3VGKA 3AVCA 4KREA 3LPTA 3P1GA 2UXBK 3DRPA 4JI6K 4DU1A 1BOTO 2ZGZA 1I94K 2QXFA 1TV6A 5FPMA 3HSCA 5AQSA 2GUIA 1S1XA 4H03B 4DS5A 2G8VA 1D9DA 5F1XA 1BA1A 4E7KA 3KK3A 1NK0A 1LWCA 2GELA 4DU3A 3ULDA 4RG8A 4JHDB 4BRIA 3L2QA 1TL3A 3VQBA 1S9GA 4DHYA 4I9LA 2XY7A 2UUBK 1KRPA 5K14A 2GBZA 2ZM6K 1JXEA 3H3OB 1RT5A 3JYTA 3GG4A 3CC7N 4AM7A 1Q8IA 3CXCM 4NCBA 2Q0UA 3I8DA 2V51B 4C8LA 4BRNA 4O8KA 5TKYA 4B1ZA 5KPTA 1L3SA 1DTTA 2Q2RA 4HUFA 1BG3A 2QWQA 2Q97A 1K8AO 5KPRA 3UIQA 4CF8A 4WYBA 1NG9A 4YFUA 4BVOA 3CPEA 4F4KA 3KLHA 3VEXA 3O4WA 2BE2A 4DR3K 1F21A 1ZXOA 4PKIA 4B1WB 1KAZA 2X74A 2RPIA 3FZKA 1LCUA 5AQXA 1XQSC 3W0LA 3AVNA 4CE9A 3ZEUA 3OA9A 3EN9A 3HI0A 4KTWA 1XWLA 2PZSA 3A2FA 3CFOA 2FF6A 2ZE2A 3DI6A 3SMPA 3VEZA 1S72N 2QTDA 5FRMA 2RF2A 4F8RA 3EZ5A 3CFPA 1WAJA 3L2RA 3HOSA 1N6QA 3MWTA 3L2UA 2D0CA 3QETA 3GE1A 2QWLA 3AA3A 3DLRA 2P9IB 1T44A 1JL2A 2CGJA 1VSLA 4WCEL 2FSJA 5AQGA 4DFJA 4CJ7A 5EU7A 3LDSA 4H5VA 3VQ4A 1KD1O 3PUFA 4Z4EA 1QTMA 3KLGA 3OYGA 5J2MA 1KSPA 3G71N 3VQ9A 1HR0K 1U2VB 1JCEA 5KRSA 3EZWA 3DXKA 1GLDG 3A5NC 3QBWA 1FKPA 4IBNA 4U7BA 4AQYK 1VQ9N 1ASWA 4DR2K 3BZKA 3Q7BA 1JLQA 4B9QA 3H1VX 2IIRA 2ASPA 3DJCA 4IEIA 4RW6A 3OYMA 3MK6A 1C0FA 1C0GA 1E4GT 4RW9A 4B9VA 4KHSA 4DQ8A 3R1XA 1M90O 3L3VA 4CFDA 4CI6A 3SUOA 3HTVA 3P83D 4IFEA 3PX0A 4M3RA 4QOZB 3KWIA 2P5OA 3F73A 5M1QA 2PAVA 5LL6Z 4CGFA 1KCFA 5C25A 3KLEA 1NKBA 2QI2A 2F7TA 3HPGA 2LSNA 3O6WA 2HBJA 2ZJPL 5E26A 3S3OA 2YJEA 2HOEA 4KI6A 3DXKB 3AGKA 3V1OA 1SAZA 4H4OA 5AQQA 4DTXA 3VA3A 3TTCA 4BY9C 4DCHA 4FLTA 3SQ1A 2KHOA 3SJJA 4CCHA 1W2BM 5C0YA 5D3GA 2QWRA 1CZBA 5IT9O 3ENOA 4A5BA 5M1OA 2UXDK 1NKEA 1UAXA 4FK4A 3EO3A 3O9QA 4AF1A 4L3QA 2IC3A 3LALA 3OYKA 4W5TA 3IFRA 4OKKA 1Q86O 3WXMB 4BC5A 4HCCA 3IKMA 4C8KA 3ULEB 1Z05A 5AQMA 4DQPA 5J2NA 4JI5K 3ID6A 3VQEA 4DUYK 3VQCA 4AM6A 3BF1A 4WQ4C 1DT9A 1NGFA 3V1RA 2HBKA 2O8EB 4FXDA 4FWKA 4FJHA 4KHQA 3W3DA 3SJHA 1FW6A 3U3GA 2V52B 4O0IA 1X3NA 2JWLA 1RT1A 4YOVA 2B5JA 1BGXT 3KD1E 4BRQA 1RTJA 3MX5A 2IVNA 3V9XA 5M1KA 1JKHA 3IUCA 3VPZA 3OJUA 3EE8A 3CCUN 3C6TA 3FFIA 1DTQA 1KAYA 1K8KA 3OYDA 4JYAK 3VF4A 3WQTA 4CF9A 4CJ4A 1ZBHA 3M3ZA 1ATRA 5CR4A 3VF6A 4YHHK 4O0JA 3RMDA 2A40A 1KFDA 4EFHA 3CYMA 4FLZA 1VSMA 3K5OA 4A2BA 3D6RA 3RRGA 2PYLA 1SL0A 5HOOA 4JKCA 4DSIA 4LC9B 4EZ6A 3OYCA 1TKDA 3WXJA 4CHPA 3GL1A 2KFNA 3EE9A 3CHWA 4H0PA 4JD2B 2WUSA 1W7AA 5DMRA 1BCOA 1ZC6A 2XRIA 1VQ7N 4N41A 4FLYA 4KBOA 5CHIA 2WFBA 4NCAA 5JLHA 3WXIA 3HM8A 1QSSA 3VESA 2E4LA 4FJ9A 4OPKA
chains in the Genus database with same CATH topology
1A5VA 1YT3A 1NOYA 1TAQA 2OPSA 4RW4A 3NCIA 3QNNA 3TAEA 1KVAA 4CEZA 3P5JA 1Q9YA 3IS9A 4HTUA 4DTMA 3PY8A 5T7BA 3DOKA 1RILA 4NYFA 4O5BA 1YTUA 2VWKA 3SYZA 1RTIA 3DYAA 2YV0X 5HLFA 1XHZA 3LANA 2KFZA 4RW7A 3L2WA 3M8SA 3EY1A 3NDKA 1NK6A 4LSLA 4E89A 2Z1HA 2D0AA 2BDPA 1S5JA 4M42A 3L2VA 4O44A 4FZYA 1JLEA 4GMJB 3LZIA 1D8YA 4CJEA 4M3YA 3M8PA 3SCXA 1S9EA 1XHXA 2AJQA 3LP3A 3CQ8A 3WNGA 1C1CA 1BIZA 1ITGA 2FBVA 2P51A 4KHUA 4XIUA 4NYNA 2Z1GA 2O4GA 4Q5VA 1C6VA 1WLJA 4PA1A 3QIOA 1SKSA 3V9WA 1J5OA 4N47A 4CIFA 4DTUA 2DY4A 4OKJA 1QHTA 2X6SA 1HRHA 4W5OA 3PX4A 1RTHA 1NKCA 3DLHA 3HO1A 3ZCMA 2X6NA 1W0HA 1RBRA 3QLHA 3T19A 4J2DA 3D45A 3SZ2A 4OGEA 4B9NA 4DLEA 3IAYA 2OZMA 3DLGA 4IFVA 2YNIA 2P1JA 3V9SA 1ZBUA 3QERA 2Y1JA 4M3UA 1J53A 2XHBA 4QAGA 2HVIA 1TK8A 4HUGA 3SPYA 3NH2A 1VSHA 4DQRA 1FKOA 3HPOA 4FJ7A 4DFMA 2ZD1A 2GV9A 3NBPA 3NH1A 4OLBA 4E7LA 4QCLA 3OYBA 4CF1A 1BHLA 4PWDA 3LP2A 4CJPA 3K5NA 3LAKA 3NF6A 4CEOA 4KPYA 3M8QA 4AHCA 4ELTA 1KLMA 4F2SA 1XI1A 4FM0A 1ZYQA 1LW2A 3NH0A 4E0DA 1QS4A 4KO0A 5FDLA 4GW6A 4ID1A 3O4QA 2G8HA 3SUNA 4ELVA 4DTJA 4DSEA 1LAWA 2YKMA 1WSJA 1BI4A 4CJQA 4W5QA 4DSLA 2E6MA 2XO7A 1WNSA 4CHQA 3TAQA 1L3UA 1W9HA 4HUEA 3MXIA 1RNHA 1RT6A 2D5RA 1S6QA 4KV8A 4W5RA 3NAEA 4KHYA 3NFAA 4FLXA 1B9DA 4JRPA 1HYVA 3ZT3A 3OJSA 3OYJA 4BWJA 1U45A 4C8OA 2YNHA 4DSKA 2HHWA 5KTQA 2HNYA 4IKFA 1BCMA 2O4IA 4ZHRA 3OY9A 5CYQA 2HVHA 4DTNA 3V1QA 1YTAA 4CFCA 5J2QA 4CJWA 1RBUA 1RDAA 5SWMA 3F9KA 3ZSWA 4I9QA 3HSTB 1TKZA 4BDZA 3ZT2A 2A1SA 4B8CA 3BGRA 1S1WA 1RBTA 3HYFA 3PX6A 4I7FA 1QSYA 4AILC 1C1AA 2HHQA 1EX4A 1L3VA 5HP1A 4CESA 1BISA 3T3FA 1GOCA 1NJXA 1LAVA 4DS4A 1HQUA 4ELUA 2HB5A 3K5LA 3VQPA 1FXXA 3U6FA 1KFSA 3TAMA 1NJYA 3PO4A 1EP4A 4W5NA 4B08A 3HP9A 4CJUA 4DF4A 3QEIA 3MXMA 1CXUA 2G8UA 3HK2A 3U3YA 4J2EA 4CGGA 3MEGA 4IDKA 4TSXA 3OYIA 3RMBA 2B4JA 4HVJA 4L8RB 4LSNA 1ZBLA 1D9FA 3B6OA 1WSEA 2HNDA 5KGWA 3KLFA 4HHTA 1VSKA 2HMIA 4O55A 1IKYA 2KQ2A 2YNFA 4OGCA 2HHXA 3LWLA 1RDDA 3ZSZA 3RTVA 1WN7A 1VSDA 4BACA 4YNQA 4OPJA 5CZ1A 3TARA 2BANA 1U47A 4FJIA 3CM5A 1ZBFA 4CGIA 3VQ8A 5HBMA 4CJ5A 3VQ5A 4CEAA 4BE1A 2WOMA 2DFEA 1MU2A 2FBYA 3G0ZA 5CY4A 4DTSA 3I0RA 1UWBA 3DRSA 3ZSVA 2HW3A 1U49A 3I0SA 3AVCA 1KVBA 1RT7A 5KGXA 2DFFA 1T05A 2QKBA 4F3TA 2RN2A 3LPTA 4KREA 3P1GA 3NE6A 2G8IA 4ZTJA 3ASMA 3DRPA 1SUQA 1TK5A 4DU1A 2HNZA 1BQMA 3L8BA 4CFBA 3OYEA 2QXFA 1NK4A 1NK5A 1TV6A 4AHTA 4Q0BA 4Y1CA 2GUIA 1S1XA 4DS5A 2JLEA 2G8VA 4Z4IA 2IAJA 2IS3A 4DLGA 4JS5A 2Z1IA 4OJRA 4Z0UA 4E7KA 1D9DA 3KK3A 4ICLA 3TANA 5SZTA 3V6DA 1NK0A 2FBTA 1IG9A 1REVA 5C42A 4BDPA 5HROA 1LWCA 1JLCA 1C1BA 3OYAA 1CZ9A 4DU3A 3ULDA 4B9UA 4EZ9A 4RG8A 1HQEA 2OPPA 3L2QA 1TL3A 3VQBA 3B6PA 4DQSA 4DFPA 1S9GA 1ASUA 3AA4A 4LH5A 4I9LA 5FROA 3S3NA 4AHVA 1JLBA 4MQ3A 2W42A 4MFBA 1IKXA 4AH9A 2XY7A 3NGIA 3AA2A 4FJ5A 1GOAA 1LWFA 2G8WA 3DMJA 2F96A 4E19A 3LP0A 3ZT0A 4CEFA 5K14A 1KRPA 4DTOA 3AVFA 3TAGA 2VG7A 1C0TA 2GBZA 2YHAA 3HL8A 3KKSA 4FM1A 1D5AA 1JXEA 1EETA 1RT5A 3JYTA 3LWMA 4CEEA 3QEXA 4M41A 1Q8IA 4NCBA 4N76A 4JLHA 2HHTA 4LY7A 1VRUA 1T7PA 3NF9A 3I8DA 1Z25A 4C8LA 4DSJA 1S1TA 1ASVA 3E01A 3IRXA 4J2AA 4IFYA 3OYNA 1SL2A 1RBVA 4CEDA 4CF0A 3HT3A 1L3SA 3TR8A 1DTTA 1S1VA 3DM2A 4R5PA 3ZSRA 2YKNA 3OYHA 4H4MA 4HUFA 2F8TA 4F2RA 3SV4A 4B9SA 4KB1A 3VA0A 2Y1IA 4PUOA 1VRTA 3UIQA 4CF8A 1DLOA 1EKEA 4YFUA 1VSFA 2VWJA 3AVMA 4KKOA 4F4KA 3KLHA 3ZSYA 4N5SA 2BE2A 5CZ2A 2XY5A 4FW2A 1BQNA 4CGDA 1UOCA 2E6LA 1F21A 5J1EA 3BDPA 3OVNA 4Z4FA 4WE1A 4KAZA 3AVKA 2EX3A 3O3FA 2X74A 3RWUA 4NCGA 2RPIA 4KHWA 4Z4GA 4JRQA 1BL3A 4FJJA 4DMNA 3AVNA 1S1UA 4CE9A 3K59A 2IGIA 1VK0A 4OKEA 5FRNA 3KJVA 2ATQA 1CXQA 1JL1A 4KI4A 4LD0A 1U48A 1K6YA 1RT3A 4KTWA 4FJGA 1A5WA 1XWLA 1FK9A 3CM6A 2PZSA 2OA8A 3A2FA 1JLFA 3CFOA 2ZE2A 3DI6A 2I5JA 3EYZA 1L3TA 1HMVA 3RRHA 4KB0A 3H08A 4FM2A 5FRMA 2RF2A 3SNNA 3EZ5A 3CFPA 1J54A 4F8RA 1WAJA 3L2RA 4CJKA 1KLNA 1VSEA 3HJFA 4F3OA 1TAUA 1LWEA 1NJZA 3L3UA 3NF7A 4BE0A 3JSMA 1N6QA 4B9MA 1S6PA 1VSJA 3QO9A 4N56A 3RMCA 3HPHA 2D0CA 4E1NA 3WNHA 4Z4HA 3L2UA 4FLWA 3QETA 4E1MA 3SQ2A 3MXJA 4K8ZA 2OYQA 4C8NA 1L5UA 3AA3A 1HPZA 3DLRA 1SKWA 4H8KA 4CJRA 3MECA 1JL2A 2KZMA 2OZSA 1VSLA 4CGJA 3C6UA 1RCHA 3AO3A 3AVLA 3QINA 5JS2A 4CJFA 3AVIA 1WSIA 3TWHA 2NUBA 5EU7A 3LDSA 3VQ4A 4DFJA 1N5YA 2FC0A 3PUFA 3IG1A 4Z4EA 1QTMA 3KLGA 3OYGA 5J2MA 3VQQA 4FLUA 4CHZA 1KSPA 3VQ7A 3AV9A 3K58A 4B9TA 4Y1DA 4M3ZA 3VQ9A 3ZT4A 4PY5A 5KRSA 3AVGA 3HVRA 3ISNC 1QQCA 4DG1A 4CERA 5HRSA 2YHBA 3SUQA 1FKPA 4IBNA 3ZSOA 3KK1A 5I42A 2G8KA 1ASWA 4ID5A 4UQGA 4DU4A 1JLQA 1HJRA 4E7IA 4BWMA 1UA0A 2HHSA 5HRRA 4BE2A 3LZJA 4RW6A 4CIGA 3OYMA 3PO5A 2QKKA 4CHNA 4RW9A 3KK2A 4B9VA 4KHSA 4FYDA 2IOCA 3AVHA 2YNGA 4DSFA 5I3UA 4GVMA 3L3VA 3M8RA 4HCBA 4CFDA 4FZXC 3OS0A 3SUOA 1C0MA 3P83D 3HP6A 1TVRA 4O4GA 3NGZA 1Q9XA 1IKVA 3PX0A 5E41A 4ZTFA 4M3RA 2P5GA 4QOZB 4EP4A 1LW0A 5C24A 4E7JA 3F73A 2P5OA 2RKIA 4C8MA 3VQAA 2D0BA 3KLEA 1KCFA 4CGFA 5C25A 4CFAA 1NKBA 4G1QA 5KI6A 5KRTA 3DLKA 3HPGA 4DTRA 2LSNA 3KKRA 1X1PA 3T1AA 3VQDA 4CEBA 3QESA 1LV5A 4IG0A 3S3OA 3KTQA 1TGOA 2VG6A 3DLBA 4KI6A 5HRPA 4KTZA 4AHUA 1TKXA 3TAFA 3V9ZA 3LP1A 3V1OA 4BDYA 1B9FA 4FCYA 4DQQA 4H4OA 3RR7A 3O3HA 4DTXA 3K5MA 4E7HA 1Z26A 3VA3A 1TL1A 3WNFA 1SL1A 2WONA 4FLTA 3SQ1A 1QE1A 3D0PA 3SJJA 1NOZA 4KHNA 1SKRA 1X9WA 2F8SA 1O1WA 3AO4A 4CCHA 4DFKA 5D3GA 1CZBA 3QEVA 3OS1A 3V4IA 4RW8A 1NKEA 1UAXA 4Z4CA 4M3TA 4FJLA 1TK0A 3V81A 1HNVA 3HVTA 2JGUA 4FJ8A 4PQUA 3K2PA 4B9LA 4FK4A 5DK5A 3DLEA 4CF2A 1R0AA 1ZBIA 2IC3A 3LALA 3OYKA 4JS4A 4W5TA 3AA5X 1EXQA 3TI0A 2DTUA 4OKKA 3HXMA 1UA1A 4IG3A 3LAMA 4DWIA 3K57A 1IKWA 4FVMA 4HCCA 1A5XA 2KTQA 1HNIA 4C8KA 1RDBA 4B8AB 2PY5A 3CFRA 1WSFA 4DQPA 1IH7A 1GOBA 2X78A 1SV5A 1C0UA 5J2NA 3SPZA 3ZSQA 1RDCA 5J2PA 1T8EA 3VQEA 3AO2A 2G8FA 3VQCA 2ZQBA 1BI4B 3OYLA 3SQ0A 3KIOA 1BIUA 3VQ6A 3SUPA 5JS1A 3ALYA 3DRRA 1G15A 3V1RA 3AVBA 4CGHA 3THVA 4FXDA 3ZT1A 1WAFA 3C95A 1NJWA 4FJHA 4KHQA 3ITHA 3NHGA 1RTDA 3KD5E 2IDOA 3U3GA 4CK3A 5CYMA 3SI6A 2ITGA 3DOLA 5HRNA 4O0IA 3NF8A 1JLAA 4CHOA 4CEQA 2HHUA 3TAPA 1Y97A 3V9UA 2VG5A 1T03A 3KLIA 1RT1A 4FK2A 4FJ9A 1QSLA 2B5JA 1BGXT 4I2QA 3RMAA 4FJNA 4FJXA 4M3XA 4CK2A 3KD1E 3O4NA 2R7YA 1RTJA 3S3MA 1JLGA 2ETJA 2XY8A 3ZSXA 2BGGA 3V9XA 4DTPA 1HYZA 4FK0A 2HHVA 1KTQA 1JXBA 1KVCA 3MEDA 3AVAA 3LPUA 1JKHA 2PYJA 4AHSA 3OJUA 1RBSA 1X9SA 4FZZA 3VN5A 3MAQA 4CJ3A 3QEPA 4I2PA 3C6TA 1NK8A 1I39A 4FLVA 2QK9A 3FFIA 1DTQA 3NGYA 4K8XA 1NK7A 3OYDA 1RT2A 4FJKA 2B6AA 1CLQA 4EP5A 4CK1A 4CF9A 4CJVA 4CIEA 4DF8A 3WNEA 4CJ4A 3SQ4A 1ZBHA 4LH4A 4E3SA 2XY6A 3HM9A 4O0JA 4KFBA 4OVLA 3QNOA 3RMDA 4KRFA 1J9AA 1KFDA 4M3WA 3CYMA 3O3GA 2FBXA 3SV3A 4FLZA 1U4BA 4KTQA 1VSMA 3K5OA 1U04A 3OYFA 3RRGA 2PYLA 3RR8A 4FJMA 1SL0A 3AVJA 1NK9A 1WSHA 3G10A 4AHRA 2OPRA 4DSIA 4EZ6A 1WSGA 3OYCA 1TKDA 4CHPA 2KFNA 3C94A 3OS2A 2DFHA 4J2BA 5DMRA 1VSIA 2Q3SA 4CHYA 2KW4A 3PV8A 4DQIA 3TABA 4CECA 4OLAA 1BCOA 4CJSA 2KZZA 1RT4A 2OPQA 3AO1A 1I3AA 2XRIA 3QEWA 3AO5A 2A1RA 1HYSA 3CG7A 4N41A 4M45A 4FW1A 4FLYA 1XC9A 3MEEA 1YVUA 4NCAA 4CJTA 3S9HA 1B92A 4B3OA 1IO2A 1QSSA 2EHGA 2Z1JA 4CJLA 2E4LA 1X9MA 4OPKA 1TKTA 3QIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5V A;  1YT3 A;  1NOY A;  1TAQ A;  2OPS A;  4RW4 A;  3NCI A;  3QNN A;  3TAE A;  1KVA A;  4CEZ A;  3P5J A;  1Q9Y A;  3IS9 A;  4HTU A;  4DTM A;  3PY8 A;  5T7B A;  3DOK A;  1RIL A;  4NYF A;  4O5B A;  1YTU A;  2VWK A;  3SYZ A;  1RTI A;  3DYA A;  2YV0 X;  5HLF A;  1XHZ A;  3LAN A;  2KFZ A;  4RW7 A;  3L2W A;  3M8S A;  3EY1 A;  3NDK A;  1NK6 A;  4LSL A;  4E89 A;  2Z1H A;  2D0A A;  2BDP A;  1S5J A;  4M42 A;  3L2V A;  4O44 A;  4FZY A;  1JLE A;  4GMJ B;  3LZI A;  1D8Y A;  4CJE A;  4M3Y A;  3M8P A;  3SCX A;  1S9E A;  1XHX A;  2AJQ A;  3LP3 A;  3CQ8 A;  3WNG A;  1C1C A;  1BIZ A;  1ITG A;  2FBV A;  2P51 A;  4KHU A;  4XIU A;  4NYN A;  2Z1G A;  2O4G A;  4Q5V A;  1C6V A;  1WLJ A;  4PA1 A;  3QIO A;  1SKS A;  3V9W A;  1J5O A;  4N47 A;  4CIF A;  4DTU A;  2DY4 A;  4OKJ A;  1QHT A;  2X6S A;  1HRH A;  4W5O A;  3PX4 A;  1RTH A;  1NKC A;  3DLH A;  3HO1 A;  3ZCM A;  2X6N A;  1W0H A;  1RBR A;  3QLH A;  3T19 A;  4J2D A;  3D45 A;  3SZ2 A;  4OGE A;  4B9N A;  4DLE A;  3IAY A;  2OZM A;  3DLG A;  4IFV A;  2YNI A;  2P1J A;  3V9S A;  1ZBU A;  3QER A;  2Y1J A;  4M3U A;  1J53 A;  2XHB A;  4QAG A;  2HVI A;  1TK8 A;  4HUG A;  3SPY A;  3NH2 A;  1VSH A;  4DQR A;  1FKO A;  3HPO A;  4FJ7 A;  4DFM A;  2ZD1 A;  2GV9 A;  3NBP A;  3NH1 A;  4OLB A;  4E7L A;  4QCL A;  3OYB A;  4CF1 A;  1BHL A;  4PWD A;  3LP2 A;  4CJP A;  3K5N A;  3LAK A;  3NF6 A;  4CEO A;  4KPY A;  3M8Q A;  4AHC A;  4ELT A;  1KLM A;  4F2S A;  1XI1 A;  4FM0 A;  1ZYQ A;  1LW2 A;  3NH0 A;  4E0D A;  1QS4 A;  4KO0 A;  5FDL A;  4GW6 A;  4ID1 A;  3O4Q A;  2G8H A;  3SUN A;  4ELV A;  4DTJ A;  4DSE A;  1LAW A;  2YKM A;  1WSJ A;  1BI4 A;  4CJQ A;  4W5Q A;  4DSL A;  2E6M A;  2XO7 A;  1WNS A;  4CHQ A;  3TAQ A;  1L3U A;  1W9H A;  4HUE A;  3MXI A;  1RNH A;  1RT6 A;  2D5R A;  1S6Q A;  4KV8 A;  4W5R A;  3NAE A;  4KHY A;  3NFA A;  4FLX A;  1B9D A;  4JRP A;  1HYV A;  3ZT3 A;  3OJS A;  3OYJ A;  4BWJ A;  1U45 A;  4C8O A;  2YNH A;  4DSK A;  2HHW A;  5KTQ A;  2HNY A;  4IKF A;  1BCM A;  2O4I A;  4ZHR A;  3OY9 A;  5CYQ A;  2HVH A;  4DTN A;  3V1Q A;  1YTA A;  4CFC A;  5J2Q A;  4CJW A;  1RBU A;  1RDA A;  5SWM A;  3F9K A;  3ZSW A;  4I9Q A;  3HST B;  1TKZ A;  4BDZ A;  3ZT2 A;  2A1S A;  4B8C A;  3BGR A;  1S1W A;  1RBT A;  3HYF A;  3PX6 A;  4I7F A;  1QSY A;  4AIL C;  1C1A A;  2HHQ A;  1EX4 A;  1L3V A;  5HP1 A;  4CES A;  1BIS A;  3T3F A;  1GOC A;  1NJX A;  1LAV A;  4DS4 A;  1HQU A;  4ELU A;  2HB5 A;  3K5L A;  3VQP A;  1FXX A;  3U6F A;  1KFS A;  3TAM A;  1NJY A;  3PO4 A;  1EP4 A;  4W5N A;  4B08 A;  3HP9 A;  4CJU A;  4DF4 A;  3QEI A;  3MXM A;  1CXU A;  2G8U A;  3HK2 A;  3U3Y A;  4J2E A;  4CGG A;  3MEG A;  4IDK A;  4TSX A;  3OYI A;  3RMB A;  2B4J A;  4HVJ A;  4L8R B;  4LSN A;  1ZBL A;  1D9F A;  3B6O A;  1WSE A;  2HND A;  5KGW A;  3KLF A;  4HHT A;  1VSK A;  2HMI A;  4O55 A;  1IKY A;  2KQ2 A;  2YNF A;  4OGC A;  2HHX A;  3LWL A;  1RDD A;  3ZSZ A;  3RTV A;  1WN7 A;  1VSD A;  4BAC A;  4YNQ A;  4OPJ A;  5CZ1 A;  3TAR A;  2BAN A;  1U47 A;  4FJI A;  3CM5 A;  1ZBF A;  4CGI A;  3VQ8 A;  5HBM A;  4CJ5 A;  3VQ5 A;  4CEA A;  4BE1 A;  2WOM A;  2DFE A;  1MU2 A;  2FBY A;  3G0Z A;  5CY4 A;  4DTS A;  3I0R A;  1UWB A;  3DRS A;  3ZSV A;  2HW3 A;  1U49 A;  3I0S A;  3AVC A;  1KVB A;  1RT7 A;  5KGX A;  2DFF A;  1T05 A;  2QKB A;  4F3T A;  2RN2 A;  3LPT A;  4KRE A;  3P1G A;  3NE6 A;  2G8I A;  4ZTJ A;  3ASM A;  3DRP A;  1SUQ A;  1TK5 A;  4DU1 A;  2HNZ A;  1BQM A;  3L8B A;  4CFB A;  3OYE A;  2QXF A;  1NK4 A;  1NK5 A;  1TV6 A;  4AHT A;  4Q0B A;  4Y1C A;  2GUI A;  1S1X A;  4DS5 A;  2JLE A;  2G8V A;  4Z4I A;  2IAJ A;  2IS3 A;  4DLG A;  4JS5 A;  2Z1I A;  4OJR A;  4Z0U A;  4E7K A;  1D9D A;  3KK3 A;  4ICL A;  3TAN A;  5SZT A;  3V6D A;  1NK0 A;  2FBT A;  1IG9 A;  1REV A;  5C42 A;  4BDP A;  5HRO A;  1LWC A;  1JLC A;  1C1B A;  3OYA A;  1CZ9 A;  4DU3 A;  3ULD A;  4B9U A;  4EZ9 A;  4RG8 A;  1HQE A;  2OPP A;  3L2Q A;  1TL3 A;  3VQB A;  3B6P A;  4DQS A;  4DFP A;  1S9G A;  1ASU A;  3AA4 A;  4LH5 A;  4I9L A;  5FRO A;  3S3N A;  4AHV A;  1JLB A;  4MQ3 A;  2W42 A;  4MFB A;  1IKX A;  4AH9 A;  2XY7 A;  3NGI A;  3AA2 A;  4FJ5 A;  1GOA A;  1LWF A;  2G8W A;  3DMJ A;  2F96 A;  4E19 A;  3LP0 A;  3ZT0 A;  4CEF A;  5K14 A;  1KRP A;  4DTO A;  3AVF A;  3TAG A;  2VG7 A;  1C0T A;  2GBZ A;  2YHA A;  3HL8 A;  3KKS A;  4FM1 A;  1D5A A;  1JXE A;  1EET A;  1RT5 A;  3JYT A;  3LWM A;  4CEE A;  3QEX A;  4M41 A;  1Q8I A;  4NCB A;  4N76 A;  4JLH A;  2HHT A;  4LY7 A;  1VRU A;  1T7P A;  3NF9 A;  3I8D A;  1Z25 A;  4C8L A;  4DSJ A;  1S1T A;  1ASV A;  3E01 A;  3IRX A;  4J2A A;  4IFY A;  3OYN A;  1SL2 A;  1RBV A;  4CED A;  4CF0 A;  3HT3 A;  1L3S A;  3TR8 A;  1DTT A;  1S1V A;  3DM2 A;  4R5P A;  3ZSR A;  2YKN A;  3OYH A;  4H4M A;  4HUF A;  2F8T A;  4F2R A;  3SV4 A;  4B9S A;  4KB1 A;  3VA0 A;  2Y1I A;  4PUO A;  1VRT A;  3UIQ A;  4CF8 A;  1DLO A;  1EKE A;  4YFU A;  1VSF A;  2VWJ A;  3AVM A;  4KKO A;  4F4K A;  3KLH A;  3ZSY A;  4N5S A;  2BE2 A;  5CZ2 A;  2XY5 A;  4FW2 A;  1BQN A;  4CGD A;  1UOC A;  2E6L A;  1F21 A;  5J1E A;  3BDP A;  3OVN A;  4Z4F A;  4WE1 A;  4KAZ A;  3AVK A;  2EX3 A;  3O3F A;  2X74 A;  3RWU A;  4NCG A;  2RPI A;  4KHW A;  4Z4G A;  4JRQ A;  1BL3 A;  4FJJ A;  4DMN A;  3AVN A;  1S1U A;  4CE9 A;  3K59 A;  2IGI A;  1VK0 A;  4OKE A;  5FRN A;  3KJV A;  2ATQ A;  1CXQ A;  1JL1 A;  4KI4 A;  4LD0 A;  1U48 A;  1K6Y A;  1RT3 A;  4KTW A;  4FJG A;  1A5W A;  1XWL A;  1FK9 A;  3CM6 A;  2PZS A;  2OA8 A;  3A2F A;  1JLF A;  3CFO A;  2ZE2 A;  3DI6 A;  2I5J A;  3EYZ A;  1L3T A;  1HMV A;  3RRH A;  4KB0 A;  3H08 A;  4FM2 A;  5FRM A;  2RF2 A;  3SNN A;  3EZ5 A;  3CFP A;  1J54 A;  4F8R A;  1WAJ A;  3L2R A;  4CJK A;  1KLN A;  1VSE A;  3HJF A;  4F3O A;  1TAU A;  1LWE A;  1NJZ A;  3L3U A;  3NF7 A;  4BE0 A;  3JSM A;  1N6Q A;  4B9M A;  1S6P A;  1VSJ A;  3QO9 A;  4N56 A;  3RMC A;  3HPH A;  2D0C A;  4E1N A;  3WNH A;  4Z4H A;  3L2U A;  4FLW A;  3QET A;  4E1M A;  3SQ2 A;  3MXJ A;  4K8Z A;  2OYQ A;  4C8N A;  1L5U A;  3AA3 A;  1HPZ A;  3DLR A;  1SKW A;  4H8K A;  4CJR A;  3MEC A;  1JL2 A;  2KZM A;  2OZS A;  1VSL A;  4CGJ A;  3C6U A;  1RCH A;  3AO3 A;  3AVL A;  3QIN A;  5JS2 A;  4CJF A;  3AVI A;  1WSI A;  3TWH A;  2NUB A;  5EU7 A;  3LDS A;  3VQ4 A;  4DFJ A;  1N5Y A;  2FC0 A;  3PUF A;  3IG1 A;  4Z4E A;  1QTM A;  3KLG A;  3OYG A;  5J2M A;  3VQQ A;  4FLU A;  4CHZ A;  1KSP A;  3VQ7 A;  3AV9 A;  3K58 A;  4B9T A;  4Y1D A;  4M3Z A;  3VQ9 A;  3ZT4 A;  4PY5 A;  5KRS A;  3AVG A;  3HVR A;  3ISN C;  1QQC A;  4DG1 A;  4CER A;  5HRS A;  2YHB A;  3SUQ A;  1FKP A;  4IBN A;  3ZSO A;  3KK1 A;  5I42 A;  2G8K A;  1ASW A;  4ID5 A;  4UQG A;  4DU4 A;  1JLQ A;  1HJR A;  4E7I A;  4BWM A;  1UA0 A;  2HHS A;  5HRR A;  4BE2 A;  3LZJ A;  4RW6 A;  4CIG A;  3OYM A;  3PO5 A;  2QKK A;  4CHN A;  4RW9 A;  3KK2 A;  4B9V A;  4KHS A;  4FYD A;  2IOC A;  3AVH A;  2YNG A;  4DSF A;  5I3U A;  4GVM A;  3L3V A;  3M8R A;  4HCB A;  4CFD A;  4FZX C;  3OS0 A;  3SUO A;  1C0M A;  3P83 D;  3HP6 A;  1TVR A;  4O4G A;  3NGZ A;  1Q9X A;  1IKV A;  3PX0 A;  5E41 A;  4ZTF A;  4M3R A;  2P5G A;  4QOZ B;  4EP4 A;  1LW0 A;  5C24 A;  4E7J A;  3F73 A;  2P5O A;  2RKI A;  4C8M A;  3VQA A;  2D0B A;  3KLE A;  1KCF A;  4CGF A;  5C25 A;  4CFA A;  1NKB A;  4G1Q A;  5KI6 A;  5KRT A;  3DLK A;  3HPG A;  4DTR A;  2LSN A;  3KKR A;  1X1P A;  3T1A A;  3VQD A;  4CEB A;  3QES A;  1LV5 A;  4IG0 A;  3S3O A;  3KTQ A;  1TGO A;  2VG6 A;  3DLB A;  4KI6 A;  5HRP A;  4KTZ A;  4AHU A;  1TKX A;  3TAF A;  3V9Z A;  3LP1 A;  3V1O A;  4BDY A;  1B9F A;  4FCY A;  4DQQ A;  4H4O A;  3RR7 A;  3O3H A;  4DTX A;  3K5M A;  4E7H A;  1Z26 A;  3VA3 A;  1TL1 A;  3WNF A;  1SL1 A;  2WON A;  4FLT A;  3SQ1 A;  1QE1 A;  3D0P A;  3SJJ A;  1NOZ A;  4KHN A;  1SKR A;  1X9W A;  2F8S A;  1O1W A;  3AO4 A;  4CCH A;  4DFK A;  5D3G A;  1CZB A;  3QEV A;  3OS1 A;  3V4I A;  4RW8 A;  1NKE A;  1UAX A;  4Z4C A;  4M3T A;  4FJL A;  1TK0 A;  3V81 A;  1HNV A;  3HVT A;  2JGU A;  4FJ8 A;  4PQU A;  3K2P A;  4B9L A;  4FK4 A;  5DK5 A;  3DLE A;  4CF2 A;  1R0A A;  1ZBI A;  2IC3 A;  3LAL A;  3OYK A;  4JS4 A;  4W5T A;  3AA5 X;  1EXQ A;  3TI0 A;  2DTU A;  4OKK A;  3HXM A;  1UA1 A;  4IG3 A;  3LAM A;  4DWI A;  3K57 A;  1IKW A;  4FVM A;  4HCC A;  1A5X A;  2KTQ A;  1HNI A;  4C8K A;  1RDB A;  4B8A B;  2PY5 A;  3CFR A;  1WSF A;  4DQP A;  1IH7 A;  1GOB A;  2X78 A;  1SV5 A;  1C0U A;  5J2N A;  3SPZ A;  3ZSQ A;  1RDC A;  5J2P A;  1T8E A;  3VQE A;  3AO2 A;  2G8F A;  3VQC A;  2ZQB A;  1BI4 B;  3OYL A;  3SQ0 A;  3KIO A;  1BIU A;  3VQ6 A;  3SUP A;  5JS1 A;  3ALY A;  3DRR A;  1G15 A;  3V1R A;  3AVB A;  4CGH A;  3THV A;  4FXD A;  3ZT1 A;  1WAF A;  3C95 A;  1NJW A;  4FJH A;  4KHQ A;  3ITH A;  3NHG A;  1RTD A;  3KD5 E;  2IDO A;  3U3G A;  4CK3 A;  5CYM A;  3SI6 A;  2ITG A;  3DOL A;  5HRN A;  4O0I A;  3NF8 A;  1JLA A;  4CHO A;  4CEQ A;  2HHU A;  3TAP A;  1Y97 A;  3V9U A;  2VG5 A;  1T03 A;  3KLI A;  1RT1 A;  4FK2 A;  4FJ9 A;  1QSL A;  2B5J A;  1BGX T;  4I2Q A;  3RMA A;  4FJN A;  4FJX A;  4M3X A;  4CK2 A;  3KD1 E;  3O4N A;  2R7Y A;  1RTJ A;  3S3M A;  1JLG A;  2ETJ A;  2XY8 A;  3ZSX A;  2BGG A;  3V9X A;  4DTP A;  1HYZ A;  4FK0 A;  2HHV A;  1KTQ A;  1JXB A;  1KVC A;  3MED A;  3AVA A;  3LPU A;  1JKH A;  2PYJ A;  4AHS A;  3OJU A;  1RBS A;  1X9S A;  4FZZ A;  3VN5 A;  3MAQ A;  4CJ3 A;  3QEP A;  4I2P A;  3C6T A;  1NK8 A;  1I39 A;  4FLV A;  2QK9 A;  3FFI A;  1DTQ A;  3NGY A;  4K8X A;  1NK7 A;  3OYD A;  1RT2 A;  4FJK A;  2B6A A;  1CLQ A;  4EP5 A;  4CK1 A;  4CF9 A;  4CJV A;  4CIE A;  4DF8 A;  3WNE A;  4CJ4 A;  3SQ4 A;  1ZBH A;  4LH4 A;  4E3S A;  2XY6 A;  3HM9 A;  4O0J A;  4KFB A;  4OVL A;  3QNO A;  3RMD A;  4KRF A;  1J9A A;  1KFD A;  4M3W A;  3CYM A;  3O3G A;  2FBX A;  3SV3 A;  4FLZ A;  1U4B A;  4KTQ A;  1VSM A;  3K5O A;  1U04 A;  3OYF A;  3RRG A;  2PYL A;  3RR8 A;  4FJM A;  1SL0 A;  3AVJ A;  1NK9 A;  1WSH A;  3G10 A;  4AHR A;  2OPR A;  4DSI A;  4EZ6 A;  1WSG A;  3OYC A;  1TKD A;  4CHP A;  2KFN A;  3C94 A;  3OS2 A;  2DFH A;  4J2B A;  5DMR A;  1VSI A;  2Q3S A;  4CHY A;  2KW4 A;  3PV8 A;  4DQI A;  3TAB A;  4CEC A;  4OLA A;  1BCO A;  4CJS A;  2KZZ A;  1RT4 A;  2OPQ A;  3AO1 A;  1I3A A;  2XRI A;  3QEW A;  3AO5 A;  2A1R A;  1HYS A;  3CG7 A;  4N41 A;  4M45 A;  4FW1 A;  4FLY A;  1XC9 A;  3MEE A;  1YVU A;  4NCA A;  4CJT A;  3S9H A;  1B92 A;  4B3O A;  1IO2 A;  1QSS A;  2EHG A;  2Z1J A;  4CJL A;  2E4L A;  1X9M A;  4OPK A;  1TKT A;  3QIP A; 
#chains in the Genus database with same CATH topology
 1YT3 A;  1TAQ A;  4FPA A;  3FLC O;  1KVA A;  3IS9 A;  4DTM A;  3DOK A;  1RIL A;  4O5B A;  5M1F A;  1WOQ A;  4V19 S;  3LAN A;  1VQ4 N;  5LMU K;  2UYT A;  4K42 A;  3EY1 A;  4LSL A;  4E89 A;  1S5J A;  2ZF5 O;  3L2V A;  1VQN N;  3MMV A;  3E9L A;  1XHX A;  3ZET A;  3LP3 A;  3CQ8 A;  3CCQ N;  3G25 A;  4BVP A;  1BIZ A;  1ITG A;  2FBV A;  3P31 A;  4XIU A;  1GLC G;  4LF6 K;  1BA0 A;  4X64 K;  3V9W A;  1J5O A;  1GLE G;  4OKJ A;  2NRZ A;  2X6S A;  3I33 A;  4B9N A;  4OGE A;  3VMF B;  3IAY A;  2QEX N;  3DLG A;  1NGB A;  2Y1J A;  2P1J A;  3QML A;  1ZBU A;  4M3U A;  2GX9 A;  4HUG A;  5JIC A;  1FKO A;  2FF3 B;  4DFM A;  2F4V K;  2GV9 A;  4E7L A;  3CJB A;  3OYB A;  4CZM A;  4MDA A;  4CJP A;  3LAK A;  4CZK A;  4Y0W A;  1XI1 A;  4FM0 A;  5FDL A;  3UKR A;  4ID1 A;  4EHU A;  2G8H A;  2YX6 A;  3HRG A;  3CCL N;  1WNS A;  3TAQ A;  3MXI A;  2Q31 A;  4KV8 A;  3NFA A;  3EEQ A;  1HYV A;  3ZT3 A;  3FE1 A;  4BRK A;  4BR7 A;  4C8O A;  3VER A;  1RFQ A;  3ENB A;  3D2E B;  2A5X A;  1YJ9 N;  1YTA A;  4CFC A;  4A62 A;  1OH7 A;  1RBU A;  3F9K A;  1NNE A;  4BDZ A;  4O5F A;  3BGR A;  3HYF A;  3PX6 A;  3LDL A;  3T3F A;  1BIS A;  1NJX A;  1ZBS A;  5C10 A;  4DS4 A;  4GKK K;  3K5L A;  3TAM A;  4B1V A;  3PO4 A;  3MN7 A;  3J80 O;  3MXM A;  3HK2 A;  1CXU A;  4IO8 A;  4ILJ A;  3MEG A;  3RVC A;  4B3S K;  3R9P A;  1D9F A;  3B6O A;  1WSE A;  2HMI A;  3AY9 A;  1RDD A;  4B1Y B;  5CZ1 A;  2BAN A;  4BRL A;  4YOY A;  2OTL N;  1ATN A;  4U67 L;  2WOM A;  2DFE A;  5CY4 A;  4DTS A;  3S41 A;  1UWB A;  3THY B;  5TKW A;  2RN2 A;  3LM2 A;  3K0S A;  1SUQ A;  3H6E A;  1WUA A;  4PKH A;  3L8B A;  2PBD A;  3OYE A;  4H0V B;  1NK5 A;  5GIO A;  2NRT A;  5AQP A;  4I6M A;  4Z4I A;  2QWO A;  4YOU A;  4YOW A;  3TAN A;  3CI5 A;  4CZE A;  2FBT A;  1REV A;  5HRO A;  1JLC A;  3OYA A;  1NLV A;  3TPQ A;  4LH5 A;  4RWT A;  4F3T A;  4MQ3 A;  4BGA A;  3C6H A;  3LDP A;  1GOA A;  1LWF A;  4R79 A;  2F96 A;  3O9S A;  3ZT0 A;  3SAH A;  1T3V A;  4DTO A;  2VG7 A;  4WQ5 C;  2UUA K;  4M41 A;  1IBK K;  1P8Z A;  1WBD A;  3NF9 A;  2J4R A;  5ADX H;  1Z25 A;  1S1T A;  1ASV A;  2E5L K;  4IFY A;  4J2A A;  5EOY A;  1RBV A;  4CED A;  4CF0 A;  3CQX A;  3TR8 A;  3DM2 A;  3C7N A;  3ZSR A;  4WFN L;  2UU9 K;  2CH6 A;  2HST A;  1DKG D;  5AZI B;  4FOI A;  4B9S A;  2O8B A;  4KB1 A;  4FPB A;  1YAG A;  3Q7C A;  1VRT A;  1DLO A;  4DR6 K;  1EKE A;  2FXU A;  3AVM A;  2D0O A;  1TUU A;  5LJV A;  5BN8 A;  2E6L A;  1BO5 O;  3GDQ A;  4KAZ A;  2EX3 A;  2I7P A;  5FPN A;  3O3F A;  3RWU A;  4Z4G A;  4JRQ A;  1X9J A;  2QWN A;  4FWM A;  1BL3 A;  1XNQ K;  2BH1 A;  5FRN A;  1YUW A;  3KJV A;  4CZF A;  1JL1 A;  4KI4 A;  4KHP K;  4W5N A;  5AQO A;  1ILY A;  2OA8 A;  1NM1 A;  1L3T A;  1HMV A;  4KB0 A;  2KLA A;  1J54 A;  1KLN A;  4JI0 K;  1VSE A;  5BRF A;  3HJF A;  3VTH A;  1LWE A;  1NJZ A;  1VSJ A;  3QO9 A;  4E1N A;  4FLW A;  2Q1N A;  1HNX K;  1T6D A;  1W97 L;  3H45 C;  1HPZ A;  4CJR A;  2KZM A;  1RCH A;  3AO3 A;  3AVL A;  3QIN A;  5AQT A;  2NUB A;  5AZJ B;  3VQQ A;  4CZJ A;  4JI8 K;  5M1N A;  1RGI A;  3KHY A;  4JN4 A;  2E2N A;  4B1U B;  4DG1 A;  5HRS A;  2YJF A;  5M1P A;  2YHB A;  3SUQ A;  2G8K A;  1HLU A;  4UQG A;  3N4Q A;  1HJR A;  5BR8 K;  1UA0 A;  3M5R A;  5HRR A;  4BE2 A;  3LZJ A;  2HHS A;  5GAG P;  4CHN A;  2YNG A;  5BN9 A;  4DSF A;  4GVM A;  5I3U A;  3ZX2 A;  4EHT A;  4HCB A;  2H3G X;  1Q9X A;  3BF3 A;  5E41 A;  2P5G A;  3NVK A;  4EP4 A;  5C24 A;  2IVO A;  3VEW A;  3RSE A;  4CFA A;  3ULE A;  4G1Q A;  4PKG A;  5KRT A;  1NJI O;  1X1P A;  4CEB A;  3H1Q A;  3QES A;  4IG0 A;  3KTQ A;  2E1Z A;  3KVG A;  2VG6 A;  5HRP A;  2QA4 N;  3TAF A;  3BZC A;  3LP1 A;  4FCY A;  3K5M A;  4JK8 A;  2FLO A;  1X9W A;  2F8S A;  1O1W A;  2DPN A;  5KQ8 A;  4PL8 A;  1XNR K;  4CZL A;  4GV3 A;  2UUC K;  4FJ8 A;  2JGU A;  4B9L A;  5DK5 A;  4Z94 A;  3T1Y K;  3MWP A;  1ZBI A;  4BC4 A;  3PIO L;  4JS4 A;  5FPD A;  2DTU A;  1UA1 A;  3LAM A;  2GTD A;  3K57 A;  3P39 A;  4FWQ A;  1A5X A;  4X62 K;  1HNI A;  4IXC A;  4JD2 A;  2PY5 A;  1CZA N;  1IH7 A;  2X78 A;  1N32 K;  3ZSQ A;  5AZJ A;  2G8F A;  2ZQB A;  2GWJ A;  1BI4 B;  3SQ0 A;  3CCE N;  3KIO A;  1KAX A;  3VQ6 A;  4K0K K;  3DRR A;  1G15 A;  3THV A;  3CPW M;  4CGH A;  1ESV A;  1OH8 A;  3ZT1 A;  1WAF A;  3C95 A;  3ITH A;  3NHG A;  1RTD A;  3KD5 E;  3VET A;  5JVG L;  3DOL A;  3J7A P;  3NF8 A;  3BY5 A;  3QFP A;  4CEQ A;  4DKW A;  1KC8 O;  2WTU A;  2ASO A;  4FK2 A;  1QSL A;  4M3X A;  1QQN A;  4CK2 A;  5B8H A;  1NGE A;  3O4N A;  1JLG A;  4FK0 A;  3WEE A;  3L6Q A;  4BQL A;  3MED A;  3LPU A;  2PYJ A;  3SAF A;  2YHW A;  1RBS A;  4FZZ A;  2P9N A;  3QFU A;  3TU5 A;  1HKB A;  4ISE A;  1NK7 A;  1RT2 A;  5AQH A;  1CLQ A;  3WNE A;  4LH4 A;  4E3S A;  2XY6 A;  3HM9 A;  4OVL A;  4KRF A;  3O3G A;  2FBX A;  3RR8 A;  4FJM A;  2HBM A;  3T7Z A;  1NK9 A;  1WSH A;  4AHR A;  1WSG A;  3CJ9 A;  3C94 A;  3OS2 A;  1JJ2 M;  2W41 A;  3SAG A;  2KW4 A;  5EY4 A;  3CF5 L;  3TAB A;  2KZZ A;  4CJS A;  4DR5 K;  1YF5 L;  3AO1 A;  4OO1 J;  3AO5 A;  4QS9 A;  4FW1 A;  1WBB A;  3MEE A;  1YVU A;  1IJJ A;  3FR0 A;  1IO2 A;  2EHG A;  2Z1J A;  4BC3 A;  4MO5 A;  4DV6 K;  2NRH A;  1XC3 A;  3P5J A;  4C1N K;  3MN5 A;  3U9Z A;  5EXW A;  4NYF A;  2VWK A;  1VQK N;  1RTI A;  1XHZ A;  3L2W A;  2O8F B;  3ZET B;  3NDK A;  4BRA A;  1JCG A;  2Z1H A;  3DXM B;  2D0A A;  5BPL A;  2BDP A;  4M42 A;  1JLE A;  3CET A;  4FWO A;  3VGL A;  3LZI A;  4GV9 A;  4LFA K;  2ZGY A;  3WNG A;  1K73 O;  1VAZ A;  4KHU A;  1Q7Y O;  2O4G A;  4MDB A;  3BEX A;  4CIF A;  2DY4 A;  1NMN A;  4BRO A;  4CBU A;  3HO1 A;  3AAR A;  4JKA A;  3U8X A;  3T19 A;  4IJA A;  4J2D A;  1N33 K;  2CH5 A;  5HL7 L;  2XHB A;  5F0X A;  2RHK A;  2HVI A;  2ZWH A;  2FSK A;  2E2P A;  3K9J A;  1GLA G;  3NH1 A;  4H0O A;  4QCL A;  3HBT A;  4CF1 A;  3LP2 A;  3K5N A;  3NF6 A;  1OVQ A;  4CD1 A;  2GWK A;  3ID8 A;  2NRW A;  1HKG A;  4GW6 A;  4KO0 A;  4DTJ A;  4XEI A;  1WSJ A;  1BI4 A;  4CHQ A;  3CJA A;  1YI2 N;  1L3U A;  2D4W A;  4HUE A;  2F9T A;  3D2F A;  2P9I A;  4KHY A;  3NMU A;  3C0B A;  3TTD A;  4BWJ A;  2YNH A;  3UE5 A;  4DSK A;  4H5R A;  2HVH A;  4ZHR A;  5CYQ A;  4DTN A;  2QWM A;  1SQK A;  3LM9 A;  2F9W A;  1U2V A;  3ZT2 A;  1IG8 A;  1S1W A;  4I7F A;  1QSY A;  4AIL C;  3O8M A;  4FWP A;  4CES A;  5FLX O;  3FZH A;  1HQU A;  3WXL A;  2HB5 A;  1FXX A;  5GAD P;  1VQ8 N;  1NGD A;  4B08 A;  4CJU A;  2G8U A;  3A5O C;  3QEI A;  3U3Y A;  1OVY A;  4J2E A;  4IDK A;  2B4J A;  4EIA A;  1ZBL A;  1J5E K;  1WB9 A;  4M7X A;  5BPM A;  2QXL A;  4OGC A;  1IKY A;  5JVH L;  1DEJ A;  3LWL A;  3ZSZ A;  2AA4 A;  1VSD A;  4OPJ A;  3TAR A;  4BE1 A;  3VQ5 A;  4DUZ K;  1KXP A;  2IVP A;  3G0Z A;  2HW3 A;  3I0R A;  3ZSV A;  5H1S Q;  1U49 A;  3I0S A;  1T05 A;  1KVB A;  5KGX A;  2QKB A;  4GVE A;  2KKZ A;  3ASM A;  1TK5 A;  2V7Y A;  1BQM A;  3O1B A;  4Q0B A;  2YCH A;  1NMD A;  3VEO A;  4Y1C A;  4A61 A;  4YOX A;  2JLE A;  4BC2 A;  5BPN A;  4JS5 A;  3RSE B;  3C7N B;  3PIP L;  1NU0 A;  3DLL L;  5C42 A;  4BDP A;  2NNW A;  4B9U A;  2QW9 A;  4EZ9 A;  2YHY A;  1HQE A;  2OPP A;  4DQS A;  3ATV A;  4WFB L;  4LF9 K;  4BRE A;  5AQF A;  4K41 A;  5FRO A;  2W42 A;  3S3N A;  4MFB A;  2WBN A;  2O8D A;  4FJ5 A;  2G8W A;  2NRR A;  4CEF A;  3KKS A;  4X65 K;  1EET A;  3WXK A;  1BU6 O;  3LWM A;  4CEE A;  3AAP A;  2P9N B;  3QEX A;  2HBL A;  5GAE P;  1MWM A;  4JLH A;  2HHT A;  4DSJ A;  3E01 A;  3IRX A;  3OYN A;  1SL2 A;  4R5P A;  2F8T A;  4H4M A;  3SV4 A;  4KH4 A;  1T6C A;  2Y1I A;  1NGA A;  2E2Q A;  4J8F A;  4BRP A;  2VWJ A;  4BR0 A;  4KKO A;  3F9M A;  4BG9 A;  1MWK A;  3ZSY A;  5CZ2 A;  1IBM K;  1LOT B;  2QWP A;  4BQZ A;  1VQM N;  4Z4F A;  2AP1 A;  3OVN A;  4BRF A;  4WE1 A;  1N36 K;  4DV7 K;  1NGI A;  3TSQ A;  4KHW A;  4DMN A;  1S1U A;  3K59 A;  3HZ6 A;  2IGI A;  1VK0 A;  1CXQ A;  3THX A;  4LF8 K;  1U48 A;  3J7Z O;  1YHQ N;  1JLF A;  3OTO K;  4FM2 A;  2E2O A;  4CJK A;  3MX2 A;  1EO1 A;  3MCP A;  3H46 O;  3L3U A;  3NF7 A;  4WF9 L;  1N34 K;  4B9M A;  1S6P A;  1JCF A;  4N56 A;  3RMC A;  3ENH A;  3CER A;  3HPH A;  4E1M A;  3SQ2 A;  3MXJ A;  1L5U A;  4GV6 A;  3ATU A;  1SKW A;  3SBT A;  4H8K A;  4CBX A;  3MEC A;  4OPA A;  2OZS A;  4CGJ A;  3C6U A;  4FJN A;  4CJF A;  5JS2 A;  1HNZ K;  1WSI A;  4DV0 K;  2FC0 A;  3IG1 A;  1NBW A;  1HKC A;  4FLU A;  1U6Z A;  2O8B B;  4B9T A;  4C23 A;  4PY5 A;  4BR4 A;  4LF5 K;  3AVG A;  3ISN C;  1QQC A;  4CER A;  4ID5 A;  4DU4 A;  2A41 A;  4KH6 A;  4FOE A;  4BWM A;  5I9E B;  4CIG A;  4BR5 A;  3PO5 A;  3KK2 A;  4DR4 K;  4FYD A;  4IEE A;  4OPH A;  3AVH A;  3K9K A;  4NXN K;  3J8A A;  3ZYY X;  3M8R A;  2ITM A;  3OS0 A;  1C0M A;  5E84 A;  3HP6 A;  4JI3 K;  1TVR A;  3L4Q A;  3CME N;  3FZM A;  2A42 A;  4A5A A;  3CCJ N;  2D0B A;  4YY3 K;  1YXQ A;  2P9L A;  4IZ9 A;  5AQJ A;  5KI6 A;  1EQY A;  3KKR A;  1LV5 A;  1Z6R A;  3J81 O;  4KTZ A;  4AHU A;  5AFU A;  3VEV A;  4LFC K;  3V9Z A;  4BDY A;  1B9F A;  3RR7 A;  3O3H A;  1Z26 A;  4DR7 K;  1SL1 A;  4WQ4 A;  1O13 A;  3D0P A;  1NOZ A;  1VQL N;  1SKR A;  3KWG A;  2WC9 A;  4NLC A;  1N8R O;  3SK3 A;  1Y64 A;  4FWR A;  2NRV A;  4JI7 K;  4RW8 A;  5GIN A;  4Z4C A;  4M3T A;  2O8C B;  1TK0 A;  3HVT A;  5AQU A;  4CW7 B;  3DLE A;  4CF2 A;  1R0A A;  3VF2 A;  3TI0 A;  4IG3 A;  1IKW A;  3IMX A;  3CCV N;  2VGN A;  1RDB A;  1G99 A;  4B8A B;  2P9S A;  3TSU A;  3CFR A;  1GOB A;  1SV5 A;  1T8E A;  5BRH A;  3VTI A;  2E8A A;  3ALY A;  2A6A A;  3KK7 A;  4HTL A;  1DGK N;  3D2F B;  2P9L B;  3WUH A;  3THW B;  4CK3 A;  5CYM A;  3SI6 A;  2ITG A;  3FGU A;  1JLA A;  2HHU A;  4YDU C;  1Y97 A;  3V9U A;  1T03 A;  4FJX A;  3RMA A;  3G4S N;  3VOV A;  3S3M A;  1YVN A;  2ETJ A;  2XY8 A;  3O9R A;  1HYZ A;  1TUY A;  4DTP A;  1JXB A;  1KVC A;  3AVA A;  4AHS A;  1TYQ A;  4I2P A;  1NK8 A;  2P9U A;  1I39 A;  2QK9 A;  3NGY A;  4FWS A;  4EP5 A;  4CK1 A;  4E1J A;  4H0Y B;  4CJV A;  4CIE A;  1R59 O;  3QNO A;  4KFB A;  4H5W A;  3WT0 A;  3SV3 A;  3R3L A;  1U4B A;  5AQY A;  3IDH A;  4WFA L;  3OYF A;  4H5T A;  3AVJ A;  4IOA L;  4OX9 K;  5KPZ A;  4MLH A;  1XMQ K;  2DFH A;  4YOR A;  3PV8 A;  4DQI A;  4CEC A;  2OPQ A;  4LFB K;  1I3A A;  4QS8 A;  3QEW A;  1HYS A;  3OW2 M;  1E3M A;  1XC9 A;  3EL2 A;  2P9K A;  4CJT A;  3S9H A;  1B92 A;  4B3O A;  5C12 A;  2E20 A;  1A5V A;  1V4T A;  2HF4 A;  3BP8 A;  1NOY A;  2OPS A;  3TAE A;  4CEZ A;  3FZF A;  4HTU A;  3M1F A;  1YTU A;  3SYZ A;  3NVM A;  4RW7 A;  4JHD A;  4GNI A;  5GAH P;  3M8S A;  1QQO A;  1NK6 A;  5DM6 L;  4O44 A;  4KH5 A;  1D8Y A;  4CJE A;  4DV1 K;  3M8P A;  3CMA N;  1RDW X;  1GLL O;  4BRD A;  2P51 A;  4Q5V A;  5ADX A;  1C6V A;  4PA1 A;  4JKH A;  2NRX A;  4N47 A;  4DTU A;  1OH5 A;  5AQZ A;  3H3N O;  3DLH A;  1HRH A;  5AQL A;  3PX4 A;  1RTH A;  3BUZ B;  2X6N A;  1IV0 A;  3O1W A;  1RBR A;  3SMS A;  3D45 A;  2NZT A;  4DLE A;  1VQO N;  2OZM A;  4B1X B;  2YNI A;  3QER A;  3V9S A;  3QIC A;  2VYP A;  1J53 A;  3SPY A;  1BUP A;  3NH2 A;  1VSH A;  3CJC A;  4FJ7 A;  2ZD1 A;  2UXC K;  2VCP A;  5EVZ A;  4IO9 L;  1BHL A;  4PWD A;  3M8Q A;  1NGG A;  1LW2 A;  3NH0 A;  3MCA B;  1H1V A;  1QS4 A;  3I8B A;  3O4Q A;  4DV4 K;  1QZ6 A;  1LAW A;  4BR2 A;  2YKM A;  2CGL A;  3VEN A;  2GEM A;  5AZI A;  1RNH A;  2D5R A;  4W5R A;  3NAE A;  2O8F A;  4FLX A;  4JK9 A;  3OYJ A;  4JNE A;  3CJ1 A;  1YJW N;  5KTQ A;  4EAH D;  2HNY A;  1BCM A;  1EWQ A;  1VHX A;  2P9P B;  5J2Q A;  3LDQ A;  4IDH A;  1X3M A;  3ZSW A;  1TKZ A;  3UKU B;  4B8C A;  3QDK A;  2HHQ A;  1EX4 A;  5HP1 A;  3FFK B;  4XH4 A;  2O8E A;  1LAV A;  5FPE A;  1HX1 A;  3CQY A;  3VQP A;  1KFS A;  4JKG B;  3HP9 A;  4B3T K;  4FWN A;  4CGG A;  4TSX A;  2P9K B;  4XH5 A;  4JK7 A;  4L8R B;  5IWA K;  4DR1 K;  3KLF A;  1VSK A;  3CJ7 A;  2KQ2 A;  3O9T A;  2HHX A;  4BRG A;  3RTV A;  1WN7 A;  4BAC A;  4YOT A;  4JKD A;  2ASM A;  1ZBF A;  4CJ5 A;  3VQ8 A;  4K25 A;  5HBM A;  4ILH A;  3MN6 A;  3DAW A;  1RT7 A;  2DFF A;  3U9D A;  3NE6 A;  2G8I A;  4ZTJ A;  3LDN A;  5AQW A;  3EKU A;  2HNZ A;  4CFB A;  3B8A X;  3HOT A;  1NK4 A;  4AHT A;  4IWV A;  4CZH A;  2IAJ A;  2IS3 A;  4DLG A;  2Z1I A;  4OJR A;  4Z0U A;  5F2R A;  1YIT N;  4ICL A;  5A2Q O;  5KQD A;  1TYQ B;  5SZT A;  3V6D A;  4JI1 K;  1IG9 A;  1C1B A;  1Q82 O;  1CZ9 A;  3UB5 A;  3B6P A;  4DFP A;  1ASU A;  3AA4 A;  1M1K O;  2W40 A;  4AHV A;  1JLB A;  1IKX A;  4AH9 A;  3NGI A;  3AA2 A;  1GLJ O;  3A0I X;  3DMJ A;  1OH6 A;  4E19 A;  3LP0 A;  3AVF A;  3TAG A;  1C0T A;  2YHA A;  3HL8 A;  4FM1 A;  1D5A A;  3LL3 A;  1VQ6 N;  4B3R K;  4N76 A;  4LY7 A;  1VRU A;  1T7P A;  2D0P A;  3HT3 A;  3MDQ A;  3OYH A;  1S1V A;  2YKN A;  3VEY A;  4F2R A;  3T1H K;  4ILG B;  4X66 K;  3VA0 A;  4PUO A;  1S22 A;  2HMP A;  3L4I A;  1VSF A;  4BRC A;  1NGJ A;  3ZX3 A;  5BRE A;  4N5S A;  2XY5 A;  5C2F A;  4FW2 A;  4CGD A;  1BQN A;  1UOC A;  5J1E A;  3BDP A;  2O8C A;  3AVK A;  4NCG A;  1EWR A;  4FJJ A;  1RDU A;  2HF3 A;  3O08 A;  4OKE A;  5MLC Q;  3R8E A;  3A5L C;  2ATQ A;  4LD0 A;  1K6Y A;  1RT3 A;  4FJG A;  1A5W A;  1FK9 A;  3CM6 A;  2I7N A;  3CCR N;  3ZX0 A;  1QVG M;  2CGK A;  2I5J A;  4HWI A;  3EYZ A;  3RRH A;  3P4I A;  3H08 A;  3SNN A;  2P9U B;  4JEP A;  4F3O A;  1TAU A;  4BE0 A;  3JSM A;  1E4F T;  4NLB A;  3WNH A;  4Z4H A;  2E88 A;  2NLX A;  2Q36 A;  4K8Z A;  4BGB A;  4H5N A;  4C8N A;  5C15 A;  4IJN A;  3TWH A;  4FJK A;  5AFU H;  3AVI A;  1N5Y A;  3VGM A;  4CHZ A;  3VQ7 A;  3AV9 A;  3K58 A;  2BTF A;  3OHR A;  4Y1D A;  4M3Z A;  1VQ5 N;  4MO4 A;  3ZT4 A;  4GY2 B;  1MDU B;  3HVR A;  4BRM A;  3KK1 A;  3ZSO A;  5I42 A;  3SLC A;  5JMV A;  4E7I A;  2W6L A;  2OCE A;  3QB0 A;  3FZL A;  2QKK A;  1XMO K;  2VQE K;  2IOC A;  3WEE B;  3C6A A;  4O8U A;  3SBG A;  1BWF O;  1Q18 A;  1HPM A;  5AQK A;  4FZX C;  3NGZ A;  4O4G A;  1IKV A;  1HUX A;  4RTF D;  3WQU A;  4ZTF A;  1LW0 A;  4E7J A;  2RKI A;  4C8M A;  1OKJ A;  2OTJ N;  3VQA A;  3DLK A;  4DTR A;  3T1A A;  3VQD A;  1TGO A;  3GBT A;  3DLB A;  1QHA A;  4IOX A;  1TKX A;  5JLF A;  1YIJ N;  1NGH A;  4DQQ A;  4H0X B;  4PHT X;  4E7H A;  1Q81 O;  1IBL K;  3CCS N;  1TL1 A;  3WNF A;  2WON A;  3OBW A;  1QE1 A;  4KHN A;  3AO4 A;  2BUP A;  2E1Y A;  4DFK A;  3QEV A;  3OS1 A;  4XH1 A;  3V4I A;  4UY8 O;  4FJL A;  4PQU A;  3V81 A;  1HNV A;  4DV5 K;  4JKF A;  3K2P A;  1XUP O;  4JI2 K;  5AQV A;  3CIP A;  3AA5 X;  1EXQ A;  1BDG A;  3G6E N;  3HXM A;  4DWI A;  2O8D B;  3JXU A;  4FVM A;  4NB4 A;  4JI4 K;  2KTQ A;  1WSF A;  3N4P A;  3PLA A;  3SPZ A;  1C0U A;  2EWS A;  4BG8 A;  3JAM O;  1RDC A;  5J2P A;  4FO0 A;  3AO2 A;  3D2E A;  3OYL A;  1BIU A;  3O5B A;  3SUP A;  5EX5 A;  5BR9 A;  5JS1 A;  3AVB A;  2YHX A;  4BRH A;  3CCM N;  1NJW A;  1SZ2 A;  2IDO A;  5GIP A;  5HRN A;  4CBW A;  4CHO A;  3TAP A;  4K43 A;  2VG5 A;  1ATS A;  3KLI A;  4I2Q A;  3U4L A;  4I6M B;  2P9P A;  5ELZ A;  3E9P A;  2R7Y A;  1GLB G;  3T69 A;  2BGG A;  2HHV A;  3ZSX A;  5BRD A;  1K9M O;  1KTQ A;  3I56 N;  4C1N I;  2VQF K;  3AAQ A;  4GKJ K;  1X9S A;  3VN5 A;  4JKB A;  3MAQ A;  4CJ3 A;  3QEP A;  4JV5 K;  4DB3 A;  4CVN E;  4FLV A;  4K8X A;  2B6A A;  4JKG A;  4IOC L;  3SQ4 A;  4DF8 A;  3DWL A;  2HHH K;  2Q0R A;  5CE3 A;  1S3X A;  3AGR A;  1J9A A;  4M3W A;  4KTQ A;  2W6K A;  1U04 A;  2VGM A;  3G10 A;  2QM1 A;  2OPR A;  4H0T B;  5LJW A;  3MN9 A;  1NGC A;  2P9S B;  1QVF M;  4J2B A;  4RCH A;  4CHY A;  1VSI A;  2Q3S A;  3JS6 A;  4OLA A;  4M7Y A;  1RT4 A;  3THY A;  4LF7 K;  4JAX A;  2A1R A;  3CC2 N;  3CG7 A;  4M45 A;  1J6Z A;  4BR9 A;  3L0Q A;  1KQS M;  3THW A;  3F5T A;  4CJL A;  2OYQ A;  1X9M A;  1TKT A;  3QIP A;  1VQP N;  4RW4 A;  3NCI A;  3QNN A;  3PSI A;  2OAN A;  1Q9Y A;  4CD3 A;  3PY8 A;  4MLE A;  5T7B A;  3EKS A;  3DYA A;  5HLF A;  2YV0 X;  2KFZ A;  4NXM K;  1P90 A;  4FL9 A;  4FZY A;  4GMJ B;  4M3Y A;  3O9U A;  3SCX A;  1D4X A;  1S9E A;  3THX B;  4A57 A;  2AJQ A;  4G9Z A;  1C1C A;  3E66 A;  3KZB A;  3UKR B;  4NYN A;  2Z1G A;  3D7E O;  1WLJ A;  3LDO A;  3QIO A;  4ISG A;  1SKS A;  4FWL A;  1QHT A;  4W5O A;  1NKC A;  5AQI A;  3ZCM A;  2JWK A;  1W0H A;  3QLH A;  3SZ2 A;  3QBX A;  4IFV A;  4QAG A;  4B3M K;  3E1Y A;  3E9O A;  4M63 C;  5AQR A;  1TK8 A;  3ZEU B;  1YJN N;  4DQR A;  1K8K B;  3HPO A;  3NBP A;  4OLB A;  3OBY A;  5AQN A;  4ISF A;  1MA9 B;  4CEO A;  4KPY A;  3DXM A;  3R6M A;  4AHC A;  4ELT A;  1KLM A;  4F2S A;  1ZYQ A;  3I55 N;  1HNW K;  1FJG K;  4CZG A;  4YDU A;  4WQ5 A;  4E0D A;  2FSN A;  4DV3 K;  3SUN A;  4ELV A;  4QS7 A;  3M6G A;  4CZI A;  4A2A A;  4DSE A;  1GLF O;  2VWB A;  4CJQ A;  4W5Q A;  4DSL A;  2E6M A;  2XO7 A;  3GOI A;  2A3Z A;  1W9H A;  4FSV A;  5AR0 A;  3J7Y P;  1RT6 A;  1S6Q A;  4DV2 K;  1B9D A;  4JRP A;  3OJS A;  1U45 A;  2ZJQ L;  2HHW A;  3A5M C;  4LF4 K;  4IKF A;  2O4I A;  3OY9 A;  3V1Q A;  4PL7 A;  4CJW A;  1RDA A;  3TTF A;  5SWM A;  3P38 A;  3HST B;  4I9Q A;  2D1K A;  2A1S A;  1RBT A;  5C2D A;  1C1A A;  2RE2 A;  1L3V A;  3TSP A;  5AJ3 K;  1GOC A;  1SS6 A;  4FVU A;  4NO7 A;  3O80 A;  4ELU A;  1V4S A;  1QZ5 A;  3U6F A;  2V7Z A;  1HJO A;  1NJY A;  1EP4 A;  3CC4 N;  3ZLJ A;  1NWK A;  4DF4 A;  3UKU A;  1QQM A;  5LY3 A;  3RMB A;  2PFU A;  3OYI A;  3A8Y A;  2YI1 A;  4HVJ A;  3CD6 N;  4A59 A;  3F2K A;  4LSN A;  5LMN K;  4F9O A;  3PSF A;  5KGW A;  2HND A;  4HHT A;  2GUP A;  4O55 A;  2YNF A;  4JKE A;  4YNQ A;  3C65 A;  2ZJR L;  1U47 A;  4FJI A;  3CM5 A;  4CGI A;  4CEA A;  5DM7 L;  1MU2 A;  2FBY A;  3DRS A;  3VGK A;  3AVC A;  4KRE A;  3LPT A;  3P1G A;  2UXB K;  3DRP A;  4JI6 K;  4DU1 A;  1BOT O;  2ZGZ A;  1I94 K;  2QXF A;  1TV6 A;  5FPM A;  3HSC A;  5AQS A;  2GUI A;  1S1X A;  4H03 B;  4DS5 A;  2G8V A;  1D9D A;  5F1X A;  1BA1 A;  4E7K A;  3KK3 A;  1NK0 A;  1LWC A;  2GEL A;  4DU3 A;  3ULD A;  4RG8 A;  4JHD B;  4BRI A;  3L2Q A;  1TL3 A;  3VQB A;  1S9G A;  4DHY A;  4I9L A;  2XY7 A;  2UUB K;  1KRP A;  5K14 A;  2GBZ A;  2ZM6 K;  1JXE A;  3H3O B;  1RT5 A;  3JYT A;  3GG4 A;  3CC7 N;  4AM7 A;  1Q8I A;  3CXC M;  4NCB A;  2Q0U A;  3I8D A;  2V51 B;  4C8L A;  4BRN A;  4O8K A;  5TKY A;  4B1Z A;  5KPT A;  1L3S A;  1DTT A;  2Q2R A;  4HUF A;  1BG3 A;  2QWQ A;  2Q97 A;  1K8A O;  5KPR A;  3UIQ A;  4CF8 A;  4WYB A;  1NG9 A;  4YFU A;  4BVO A;  3CPE A;  4F4K A;  3KLH A;  3VEX A;  3O4W A;  2BE2 A;  4DR3 K;  1F21 A;  1ZXO A;  4PKI A;  4B1W B;  1KAZ A;  2X74 A;  2RPI A;  3FZK A;  1LCU A;  5AQX A;  1XQS C;  3W0L A;  3AVN A;  4CE9 A;  3ZEU A;  3OA9 A;  3EN9 A;  3HI0 A;  4KTW A;  1XWL A;  2PZS A;  3A2F A;  3CFO A;  2FF6 A;  2ZE2 A;  3DI6 A;  3SMP A;  3VEZ A;  1S72 N;  2QTD A;  5FRM A;  2RF2 A;  4F8R A;  3EZ5 A;  3CFP A;  1WAJ A;  3L2R A;  3HOS A;  1N6Q A;  3MWT A;  3L2U A;  2D0C A;  3QET A;  3GE1 A;  2QWL A;  3AA3 A;  3DLR A;  2P9I B;  1T44 A;  1JL2 A;  2CGJ A;  1VSL A;  4WCE L;  2FSJ A;  5AQG A;  4DFJ A;  4CJ7 A;  5EU7 A;  3LDS A;  4H5V A;  3VQ4 A;  1KD1 O;  3PUF A;  4Z4E A;  1QTM A;  3KLG A;  3OYG A;  5J2M A;  1KSP A;  3G71 N;  3VQ9 A;  1HR0 K;  1U2V B;  1JCE A;  5KRS A;  3EZW A;  3DXK A;  1GLD G;  3A5N C;  3QBW A;  1FKP A;  4IBN A;  4U7B A;  4AQY K;  1VQ9 N;  1ASW A;  4DR2 K;  3BZK A;  3Q7B A;  1JLQ A;  4B9Q A;  3H1V X;  2IIR A;  2ASP A;  3DJC A;  4IEI A;  4RW6 A;  3OYM A;  3MK6 A;  1C0F A;  1C0G A;  1E4G T;  4RW9 A;  4B9V A;  4KHS A;  4DQ8 A;  3R1X A;  1M90 O;  3L3V A;  4CFD A;  4CI6 A;  3SUO A;  3HTV A;  3P83 D;  4IFE A;  3PX0 A;  4M3R A;  4QOZ B;  3KWI A;  2P5O A;  3F73 A;  5M1Q A;  2PAV A;  5LL6 Z;  4CGF A;  1KCF A;  5C25 A;  3KLE A;  1NKB A;  2QI2 A;  2F7T A;  3HPG A;  2LSN A;  3O6W A;  2HBJ A;  2ZJP L;  5E26 A;  3S3O A;  2YJE A;  2HOE A;  4KI6 A;  3DXK B;  3AGK A;  3V1O A;  1SAZ A;  4H4O A;  5AQQ A;  4DTX A;  3VA3 A;  3TTC A;  4BY9 C;  4DCH A;  4FLT A;  3SQ1 A;  2KHO A;  3SJJ A;  4CCH A;  1W2B M;  5C0Y A;  5D3G A;  2QWR A;  1CZB A;  5IT9 O;  3ENO A;  4A5B A;  5M1O A;  2UXD K;  1NKE A;  1UAX A;  4FK4 A;  3EO3 A;  3O9Q A;  4AF1 A;  4L3Q A;  2IC3 A;  3LAL A;  3OYK A;  4W5T A;  3IFR A;  4OKK A;  1Q86 O;  3WXM B;  4BC5 A;  4HCC A;  3IKM A;  4C8K A;  3ULE B;  1Z05 A;  5AQM A;  4DQP A;  5J2N A;  4JI5 K;  3ID6 A;  3VQE A;  4DUY K;  3VQC A;  4AM6 A;  3BF1 A;  4WQ4 C;  1DT9 A;  1NGF A;  3V1R A;  2HBK A;  2O8E B;  4FXD A;  4FWK A;  4FJH A;  4KHQ A;  3W3D A;  3SJH A;  1FW6 A;  3U3G A;  2V52 B;  4O0I A;  1X3N A;  2JWL A;  1RT1 A;  4YOV A;  2B5J A;  1BGX T;  3KD1 E;  4BRQ A;  1RTJ A;  3MX5 A;  2IVN A;  3V9X A;  5M1K A;  1JKH A;  3IUC A;  3VPZ A;  3OJU A;  3EE8 A;  3CCU N;  3C6T A;  3FFI A;  1DTQ A;  1KAY A;  1K8K A;  3OYD A;  4JYA K;  3VF4 A;  3WQT A;  4CF9 A;  4CJ4 A;  1ZBH A;  3M3Z A;  1ATR A;  5CR4 A;  3VF6 A;  4YHH K;  4O0J A;  3RMD A;  2A40 A;  1KFD A;  4EFH A;  3CYM A;  4FLZ A;  1VSM A;  3K5O A;  4A2B A;  3D6R A;  3RRG A;  2PYL A;  1SL0 A;  5HOO A;  4JKC A;  4DSI A;  4LC9 B;  4EZ6 A;  3OYC A;  1TKD A;  3WXJ A;  4CHP A;  3GL1 A;  2KFN A;  3EE9 A;  3CHW A;  4H0P A;  4JD2 B;  2WUS A;  1W7A A;  5DMR A;  1BCO A;  1ZC6 A;  2XRI A;  1VQ7 N;  4N41 A;  4FLY A;  4KBO A;  5CHI A;  2WFB A;  4NCA A;  5JLH A;  3WXI A;  3HM8 A;  1QSS A;  3VES A;  2E4L A;  4FJ9 A;  4OPK A; 
#chains in the Genus database with same CATH homology
 1A5V A;  1YT3 A;  1NOY A;  1TAQ A;  2OPS A;  4RW4 A;  3NCI A;  3QNN A;  3TAE A;  1KVA A;  4CEZ A;  3P5J A;  1Q9Y A;  3IS9 A;  4HTU A;  4DTM A;  3PY8 A;  5T7B A;  3DOK A;  1RIL A;  4NYF A;  4O5B A;  1YTU A;  2VWK A;  3SYZ A;  1RTI A;  3DYA A;  2YV0 X;  5HLF A;  1XHZ A;  3LAN A;  2KFZ A;  4RW7 A;  3L2W A;  3M8S A;  3EY1 A;  3NDK A;  1NK6 A;  4LSL A;  4E89 A;  2Z1H A;  2D0A A;  2BDP A;  1S5J A;  4M42 A;  3L2V A;  4O44 A;  4FZY A;  1JLE A;  4GMJ B;  3LZI A;  1D8Y A;  4CJE A;  4M3Y A;  3M8P A;  3SCX A;  1S9E A;  1XHX A;  2AJQ A;  3LP3 A;  3CQ8 A;  3WNG A;  1C1C A;  1BIZ A;  1ITG A;  2FBV A;  2P51 A;  4KHU A;  4XIU A;  4NYN A;  2Z1G A;  2O4G A;  4Q5V A;  1C6V A;  1WLJ A;  4PA1 A;  3QIO A;  1SKS A;  3V9W A;  1J5O A;  4N47 A;  4CIF A;  4DTU A;  2DY4 A;  4OKJ A;  1QHT A;  2X6S A;  1HRH A;  4W5O A;  3PX4 A;  1RTH A;  1NKC A;  3DLH A;  3HO1 A;  3ZCM A;  2X6N A;  1W0H A;  1RBR A;  3QLH A;  3T19 A;  4J2D A;  3D45 A;  3SZ2 A;  4OGE A;  4B9N A;  4DLE A;  3IAY A;  2OZM A;  3DLG A;  4IFV A;  2YNI A;  2P1J A;  3V9S A;  1ZBU A;  3QER A;  2Y1J A;  4M3U A;  1J53 A;  2XHB A;  4QAG A;  2HVI A;  1TK8 A;  4HUG A;  3SPY A;  3NH2 A;  1VSH A;  4DQR A;  1FKO A;  3HPO A;  4FJ7 A;  4DFM A;  2ZD1 A;  2GV9 A;  3NBP A;  3NH1 A;  4OLB A;  4E7L A;  4QCL A;  3OYB A;  4CF1 A;  1BHL A;  4PWD A;  3LP2 A;  4CJP A;  3K5N A;  3LAK A;  3NF6 A;  4CEO A;  4KPY A;  3M8Q A;  4AHC A;  4ELT A;  1KLM A;  4F2S A;  1XI1 A;  4FM0 A;  1ZYQ A;  1LW2 A;  3NH0 A;  4E0D A;  1QS4 A;  4KO0 A;  5FDL A;  4GW6 A;  4ID1 A;  3O4Q A;  2G8H A;  3SUN A;  4ELV A;  4DTJ A;  4DSE A;  1LAW A;  2YKM A;  1WSJ A;  1BI4 A;  4CJQ A;  4W5Q A;  4DSL A;  2E6M A;  2XO7 A;  1WNS A;  4CHQ A;  3TAQ A;  1L3U A;  1W9H A;  4HUE A;  3MXI A;  1RNH A;  1RT6 A;  2D5R A;  1S6Q A;  4KV8 A;  4W5R A;  3NAE A;  4KHY A;  3NFA A;  4FLX A;  1B9D A;  4JRP A;  1HYV A;  3ZT3 A;  3OJS A;  3OYJ A;  4BWJ A;  1U45 A;  4C8O A;  2YNH A;  4DSK A;  2HHW A;  5KTQ A;  2HNY A;  4IKF A;  1BCM A;  2O4I A;  4ZHR A;  3OY9 A;  5CYQ A;  2HVH A;  4DTN A;  3V1Q A;  1YTA A;  4CFC A;  5J2Q A;  4CJW A;  1RBU A;  1RDA A;  5SWM A;  3F9K A;  3ZSW A;  4I9Q A;  3HST B;  1TKZ A;  4BDZ A;  3ZT2 A;  2A1S A;  4B8C A;  3BGR A;  1S1W A;  1RBT A;  3HYF A;  3PX6 A;  4I7F A;  1QSY A;  4AIL C;  1C1A A;  2HHQ A;  1EX4 A;  1L3V A;  5HP1 A;  4CES A;  1BIS A;  3T3F A;  1GOC A;  1NJX A;  1LAV A;  4DS4 A;  1HQU A;  4ELU A;  2HB5 A;  3K5L A;  3VQP A;  1FXX A;  3U6F A;  1KFS A;  3TAM A;  1NJY A;  3PO4 A;  1EP4 A;  4W5N A;  4B08 A;  3HP9 A;  4CJU A;  4DF4 A;  3QEI A;  3MXM A;  1CXU A;  2G8U A;  3HK2 A;  3U3Y A;  4J2E A;  4CGG A;  3MEG A;  4IDK A;  4TSX A;  3OYI A;  3RMB A;  2B4J A;  4HVJ A;  4L8R B;  4LSN A;  1ZBL A;  1D9F A;  3B6O A;  1WSE A;  2HND A;  5KGW A;  3KLF A;  4HHT A;  1VSK A;  2HMI A;  4O55 A;  1IKY A;  2KQ2 A;  2YNF A;  4OGC A;  2HHX A;  3LWL A;  1RDD A;  3ZSZ A;  3RTV A;  1WN7 A;  1VSD A;  4BAC A;  4YNQ A;  4OPJ A;  5CZ1 A;  3TAR A;  2BAN A;  1U47 A;  4FJI A;  3CM5 A;  1ZBF A;  4CGI A;  3VQ8 A;  5HBM A;  4CJ5 A;  3VQ5 A;  4CEA A;  4BE1 A;  2WOM A;  2DFE A;  1MU2 A;  2FBY A;  3G0Z A;  5CY4 A;  4DTS A;  3I0R A;  1UWB A;  3DRS A;  3ZSV A;  2HW3 A;  1U49 A;  3I0S A;  3AVC A;  1KVB A;  1RT7 A;  5KGX A;  2DFF A;  1T05 A;  2QKB A;  4F3T A;  2RN2 A;  3LPT A;  4KRE A;  3P1G A;  3NE6 A;  2G8I A;  4ZTJ A;  3ASM A;  3DRP A;  1SUQ A;  1TK5 A;  4DU1 A;  2HNZ A;  1BQM A;  3L8B A;  4CFB A;  3OYE A;  2QXF A;  1NK4 A;  1NK5 A;  1TV6 A;  4AHT A;  4Q0B A;  4Y1C A;  2GUI A;  1S1X A;  4DS5 A;  2JLE A;  2G8V A;  4Z4I A;  2IAJ A;  2IS3 A;  4DLG A;  4JS5 A;  2Z1I A;  4OJR A;  4Z0U A;  4E7K A;  1D9D A;  3KK3 A;  4ICL A;  3TAN A;  5SZT A;  3V6D A;  1NK0 A;  2FBT A;  1IG9 A;  1REV A;  5C42 A;  4BDP A;  5HRO A;  1LWC A;  1JLC A;  1C1B A;  3OYA A;  1CZ9 A;  4DU3 A;  3ULD A;  4B9U A;  4EZ9 A;  4RG8 A;  1HQE A;  2OPP A;  3L2Q A;  1TL3 A;  3VQB A;  3B6P A;  4DQS A;  4DFP A;  1S9G A;  1ASU A;  3AA4 A;  4LH5 A;  4I9L A;  5FRO A;  3S3N A;  4AHV A;  1JLB A;  4MQ3 A;  2W42 A;  4MFB A;  1IKX A;  4AH9 A;  2XY7 A;  3NGI A;  3AA2 A;  4FJ5 A;  1GOA A;  1LWF A;  2G8W A;  3DMJ A;  2F96 A;  4E19 A;  3LP0 A;  3ZT0 A;  4CEF A;  5K14 A;  1KRP A;  4DTO A;  3AVF A;  3TAG A;  2VG7 A;  1C0T A;  2GBZ A;  2YHA A;  3HL8 A;  3KKS A;  4FM1 A;  1D5A A;  1JXE A;  1EET A;  1RT5 A;  3JYT A;  3LWM A;  4CEE A;  3QEX A;  4M41 A;  1Q8I A;  4NCB A;  4N76 A;  4JLH A;  2HHT A;  4LY7 A;  1VRU A;  1T7P A;  3NF9 A;  3I8D A;  1Z25 A;  4C8L A;  4DSJ A;  1S1T A;  1ASV A;  3E01 A;  3IRX A;  4J2A A;  4IFY A;  3OYN A;  1SL2 A;  1RBV A;  4CED A;  4CF0 A;  3HT3 A;  1L3S A;  3TR8 A;  1DTT A;  1S1V A;  3DM2 A;  4R5P A;  3ZSR A;  2YKN A;  3OYH A;  4H4M A;  4HUF A;  2F8T A;  4F2R A;  3SV4 A;  4B9S A;  4KB1 A;  3VA0 A;  2Y1I A;  4PUO A;  1VRT A;  3UIQ A;  4CF8 A;  1DLO A;  1EKE A;  4YFU A;  1VSF A;  2VWJ A;  3AVM A;  4KKO A;  4F4K A;  3KLH A;  3ZSY A;  4N5S A;  2BE2 A;  5CZ2 A;  2XY5 A;  4FW2 A;  1BQN A;  4CGD A;  1UOC A;  2E6L A;  1F21 A;  5J1E A;  3BDP A;  3OVN A;  4Z4F A;  4WE1 A;  4KAZ A;  3AVK A;  2EX3 A;  3O3F A;  2X74 A;  3RWU A;  4NCG A;  2RPI A;  4KHW A;  4Z4G A;  4JRQ A;  1BL3 A;  4FJJ A;  4DMN A;  3AVN A;  1S1U A;  4CE9 A;  3K59 A;  2IGI A;  1VK0 A;  4OKE A;  5FRN A;  3KJV A;  2ATQ A;  1CXQ A;  1JL1 A;  4KI4 A;  4LD0 A;  1U48 A;  1K6Y A;  1RT3 A;  4KTW A;  4FJG A;  1A5W A;  1XWL A;  1FK9 A;  3CM6 A;  2PZS A;  2OA8 A;  3A2F A;  1JLF A;  3CFO A;  2ZE2 A;  3DI6 A;  2I5J A;  3EYZ A;  1L3T A;  1HMV A;  3RRH A;  4KB0 A;  3H08 A;  4FM2 A;  5FRM A;  2RF2 A;  3SNN A;  3EZ5 A;  3CFP A;  1J54 A;  4F8R A;  1WAJ A;  3L2R A;  4CJK A;  1KLN A;  1VSE A;  3HJF A;  4F3O A;  1TAU A;  1LWE A;  1NJZ A;  3L3U A;  3NF7 A;  4BE0 A;  3JSM A;  1N6Q A;  4B9M A;  1S6P A;  1VSJ A;  3QO9 A;  4N56 A;  3RMC A;  3HPH A;  2D0C A;  4E1N A;  3WNH A;  4Z4H A;  3L2U A;  4FLW A;  3QET A;  4E1M A;  3SQ2 A;  3MXJ A;  4K8Z A;  2OYQ A;  4C8N A;  1L5U A;  3AA3 A;  1HPZ A;  3DLR A;  1SKW A;  4H8K A;  4CJR A;  3MEC A;  1JL2 A;  2KZM A;  2OZS A;  1VSL A;  4CGJ A;  3C6U A;  1RCH A;  3AO3 A;  3AVL A;  3QIN A;  5JS2 A;  4CJF A;  3AVI A;  1WSI A;  3TWH A;  2NUB A;  5EU7 A;  3LDS A;  3VQ4 A;  4DFJ A;  1N5Y A;  2FC0 A;  3PUF A;  3IG1 A;  4Z4E A;  1QTM A;  3KLG A;  3OYG A;  5J2M A;  3VQQ A;  4FLU A;  4CHZ A;  1KSP A;  3VQ7 A;  3AV9 A;  3K58 A;  4B9T A;  4Y1D A;  4M3Z A;  3VQ9 A;  3ZT4 A;  4PY5 A;  5KRS A;  3AVG A;  3HVR A;  3ISN C;  1QQC A;  4DG1 A;  4CER A;  5HRS A;  2YHB A;  3SUQ A;  1FKP A;  4IBN A;  3ZSO A;  3KK1 A;  5I42 A;  2G8K A;  1ASW A;  4ID5 A;  4UQG A;  4DU4 A;  1JLQ A;  1HJR A;  4E7I A;  4BWM A;  1UA0 A;  2HHS A;  5HRR A;  4BE2 A;  3LZJ A;  4RW6 A;  4CIG A;  3OYM A;  3PO5 A;  2QKK A;  4CHN A;  4RW9 A;  3KK2 A;  4B9V A;  4KHS A;  4FYD A;  2IOC A;  3AVH A;  2YNG A;  4DSF A;  5I3U A;  4GVM A;  3L3V A;  3M8R A;  4HCB A;  4CFD A;  4FZX C;  3OS0 A;  3SUO A;  1C0M A;  3P83 D;  3HP6 A;  1TVR A;  4O4G A;  3NGZ A;  1Q9X A;  1IKV A;  3PX0 A;  5E41 A;  4ZTF A;  4M3R A;  2P5G A;  4QOZ B;  4EP4 A;  1LW0 A;  5C24 A;  4E7J A;  3F73 A;  2P5O A;  2RKI A;  4C8M A;  3VQA A;  2D0B A;  3KLE A;  1KCF A;  4CGF A;  5C25 A;  4CFA A;  1NKB A;  4G1Q A;  5KI6 A;  5KRT A;  3DLK A;  3HPG A;  4DTR A;  2LSN A;  3KKR A;  1X1P A;  3T1A A;  3VQD A;  4CEB A;  3QES A;  1LV5 A;  4IG0 A;  3S3O A;  3KTQ A;  1TGO A;  2VG6 A;  3DLB A;  4KI6 A;  5HRP A;  4KTZ A;  4AHU A;  1TKX A;  3TAF A;  3V9Z A;  3LP1 A;  3V1O A;  4BDY A;  1B9F A;  4FCY A;  4DQQ A;  4H4O A;  3RR7 A;  3O3H A;  4DTX A;  3K5M A;  4E7H A;  1Z26 A;  3VA3 A;  1TL1 A;  3WNF A;  1SL1 A;  2WON A;  4FLT A;  3SQ1 A;  1QE1 A;  3D0P A;  3SJJ A;  1NOZ A;  4KHN A;  1SKR A;  1X9W A;  2F8S A;  1O1W A;  3AO4 A;  4CCH A;  4DFK A;  5D3G A;  1CZB A;  3QEV A;  3OS1 A;  3V4I A;  4RW8 A;  1NKE A;  1UAX A;  4Z4C A;  4M3T A;  4FJL A;  1TK0 A;  3V81 A;  1HNV A;  3HVT A;  2JGU A;  4FJ8 A;  4PQU A;  3K2P A;  4B9L A;  4FK4 A;  5DK5 A;  3DLE A;  4CF2 A;  1R0A A;  1ZBI A;  2IC3 A;  3LAL A;  3OYK A;  4JS4 A;  4W5T A;  3AA5 X;  1EXQ A;  3TI0 A;  2DTU A;  4OKK A;  3HXM A;  1UA1 A;  4IG3 A;  3LAM A;  4DWI A;  3K57 A;  1IKW A;  4FVM A;  4HCC A;  1A5X A;  2KTQ A;  1HNI A;  4C8K A;  1RDB A;  4B8A B;  2PY5 A;  3CFR A;  1WSF A;  4DQP A;  1IH7 A;  1GOB A;  2X78 A;  1SV5 A;  1C0U A;  5J2N A;  3SPZ A;  3ZSQ A;  1RDC A;  5J2P A;  1T8E A;  3VQE A;  3AO2 A;  2G8F A;  3VQC A;  2ZQB A;  1BI4 B;  3OYL A;  3SQ0 A;  3KIO A;  1BIU A;  3VQ6 A;  3SUP A;  5JS1 A;  3ALY A;  3DRR A;  1G15 A;  3V1R A;  3AVB A;  4CGH A;  3THV A;  4FXD A;  3ZT1 A;  1WAF A;  3C95 A;  1NJW A;  4FJH A;  4KHQ A;  3ITH A;  3NHG A;  1RTD A;  3KD5 E;  2IDO A;  3U3G A;  4CK3 A;  5CYM A;  3SI6 A;  2ITG A;  3DOL A;  5HRN A;  4O0I A;  3NF8 A;  1JLA A;  4CHO A;  4CEQ A;  2HHU A;  3TAP A;  1Y97 A;  3V9U A;  2VG5 A;  1T03 A;  3KLI A;  1RT1 A;  4FK2 A;  4FJ9 A;  1QSL A;  2B5J A;  1BGX T;  4I2Q A;  3RMA A;  4FJN A;  4FJX A;  4M3X A;  4CK2 A;  3KD1 E;  3O4N A;  2R7Y A;  1RTJ A;  3S3M A;  1JLG A;  2ETJ A;  2XY8 A;  3ZSX A;  2BGG A;  3V9X A;  4DTP A;  1HYZ A;  4FK0 A;  2HHV A;  1KTQ A;  1JXB A;  1KVC A;  3MED A;  3AVA A;  3LPU A;  1JKH A;  2PYJ A;  4AHS A;  3OJU A;  1RBS A;  1X9S A;  4FZZ A;  3VN5 A;  3MAQ A;  4CJ3 A;  3QEP A;  4I2P A;  3C6T A;  1NK8 A;  1I39 A;  4FLV A;  2QK9 A;  3FFI A;  1DTQ A;  3NGY A;  4K8X A;  1NK7 A;  3OYD A;  1RT2 A;  4FJK A;  2B6A A;  1CLQ A;  4EP5 A;  4CK1 A;  4CF9 A;  4CJV A;  4CIE A;  4DF8 A;  3WNE A;  4CJ4 A;  3SQ4 A;  1ZBH A;  4LH4 A;  4E3S A;  2XY6 A;  3HM9 A;  4O0J A;  4KFB A;  4OVL A;  3QNO A;  3RMD A;  4KRF A;  1J9A A;  1KFD A;  4M3W A;  3CYM A;  3O3G A;  2FBX A;  3SV3 A;  4FLZ A;  1U4B A;  4KTQ A;  1VSM A;  3K5O A;  1U04 A;  3OYF A;  3RRG A;  2PYL A;  3RR8 A;  4FJM A;  1SL0 A;  3AVJ A;  1NK9 A;  1WSH A;  3G10 A;  4AHR A;  2OPR A;  4DSI A;  4EZ6 A;  1WSG A;  3OYC A;  1TKD A;  4CHP A;  2KFN A;  3C94 A;  3OS2 A;  2DFH A;  4J2B A;  5DMR A;  1VSI A;  2Q3S A;  4CHY A;  2KW4 A;  3PV8 A;  4DQI A;  3TAB A;  4CEC A;  4OLA A;  1BCO A;  4CJS A;  2KZZ A;  1RT4 A;  2OPQ A;  3AO1 A;  1I3A A;  2XRI A;  3QEW A;  3AO5 A;  2A1R A;  1HYS A;  3CG7 A;  4N41 A;  4M45 A;  4FW1 A;  4FLY A;  1XC9 A;  3MEE A;  1YVU A;  4NCA A;  4CJT A;  3S9H A;  1B92 A;  4B3O A;  1IO2 A;  1QSS A;  2EHG A;  2Z1J A;  4CJL A;  2E4L A;  1X9M A;  4OPK A;  1TKT A;  3QIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...