4CIFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cifA00
2E6MA 4FJJA 3DRSA 3AVNA 3OJUA 5K14A 4GW6A 3D45A 4W5QA 1LAWA 3T3FA 4FK4A 4PY5A 3QERA 3PX0A 3SCXA 4UQGA 4KHSA 4RW8A 1WSHA 3QIOA 3OYAA 3H08A 3M8SA 2XY5A 3G10A 1EETA 3ULDA 4JS4A 1RBSA 4CGJA 1SL2A 1U4BA 3V9ZA 4EP5A 4KI4A 3PY8A 4G1QA 3SV3A 1RTHA 1ZBFA 4HHTA 1XC9A 5FROA 3OY9A 4CJWA 1RT7A 5HBMA 3RWUA 3BGRA 4CEFA 3VQBA 4E7HA 1JLCA 1UOCA 3ZSYA 5DMRA 4C8NA 2YNHA 4MFBA 3HP6A 4I9QA 3DLKA 4F3TA 3L2RA 3AVLA 1O1WA 3ZT0A 5JS2A 2OZMA 3TAPA 1WNSA 1VSDA 3QETA 4J2DA 4NCGA 3AO1A 4M42A 4CEZA 3V9WA 4QCLA 3VQDA 5E41A 4K8ZA 2QKKA 4DTUA 4DTSA 5J2MA 1T7PA 4K8XA 2JLEA 3NGYA 3OS1A 3HL8A 4FLXA 4FJ7A 1BIZA 4OJRA 4CJUA 1X1PA 3SYZA 1QSSA 4J2AA 2YKMA 3TI0A 3AVFA 4BACA 1GOCA 2FBXA 2IS3A 1Q8IA 3V9SA 4HCCA 3DOLA 3MEDA 3AVJA 3HPOA 1LV5A 4DTJA 1Z26A 4HUFA 2PYJA 3P5JA 3B6PA 2JGUA 4IDKA 3RMDA 4XIUA 1IH7A 1J9AA 4W5RA 3NHGA 4DS5A 1B92A 4DSJA 4E3SA 3LP0A 4CIEA 3CFPA 1REVA 2OA8A 1TV6A 3TAGA 1XWLA 3ALYA 3K57A 1ZBHA 3OS0A 4KAZA 4N47A 3L2QA 4OGEA 4CF1A 3D0PA 3WNGA 3DLHA 2KZZA 1KSPA 2XY6A 1T03A 2OZSA 2DY4A 5FDLA 1HYZA 3T1AA 4KHWA 4FCYA 2RKIA 3ITHA 3NAEA 4CJRA 1JLGA 1RCHA 3VA0A 4YFUA 4CHPA 4CERA 3RR8A 4CGHA 3V1OA 1TKXA 2PY5A 3WNEA 4BWMA 4BDZA 3K2PA 1UA0A 4DFJA 5HLFA 4F8RA 5I3UA 3OYCA 3QNOA 3V81A 4DF8A 1S6QA 4FJXA 2ZE2A 5J1EA 2HNDA 2PZSA 1QTMA 1TL1A 1HYVA 1TL3A 2NUBA 4DS4A 3SQ1A 1A5WA 1BI4B 4DSFA 3KD5E 1NK6A 2X6NA 3WNFA 1BL3A 3OYFA 2X78A 4FJNA 3OYBA 3KKSA 3AO3A 4KB0A 2B4JA 1UA1A 4DQIA 4DSLA 1RT2A 4BDPA 4FW2A 5D3GA 1C1AA 4N76A 1EKEA 4RW7A 1NK9A 4KFBA 1TK0A 4DFPA 1RT1A 1BCMA 3IG1A 1CXQA 1Y97A 1BQMA 3OYHA 3O3HA 1SKRA 3CFOA 4DSKA 1JLAA 4FJGA 2YNFA 1RT5A 3LWLA 4B8AB 3AV9A 3IRXA 3C6UA 3HK2A 5KGWA 3HXMA 3KLHA 4B9UA 3AO5A 4QOZB 2KQ2A 2E4LA 2B5JA 4W5TA 3V9UA 3QEXA 1EX4A 2WOMA 4RW4A 3VQPA 4CHQA 4CF9A 3L2UA 3V6DA 4O5BA 3QEWA 3ISNC 1XHZA 1IO2A 4FJ8A 1HMVA 4O55A 4M3ZA 3EY1A 4QAGA 4FJIA 1S1WA 1VSIA 2G8IA 4FM2A 3RTVA 4DFKA 4HUEA 3DLGA 4B9SA 3CFRA 2YV0X 1NJXA 4PUOA 3U3GA 1HQUA 3P1GA 1R0AA 1X9WA 2G8HA 2YKNA 1J54A 3QINA 1FK9A 2FBVA 5J2NA 3VQCA 3HJFA 4PQUA 4H4MA 4Z4EA 4JS5A 4FLWA 4JRPA 4ELVA 3SUQA 4CGGA 4O0IA 1RT4A 2QXFA 1YT3A 4CF2A 1UWBA 5HRNA 4DU1A 3S3MA 4FJHA 1BGXT 4Z0UA 1VSEA 1ZBIA 3AVMA 1C1BA 3CYMA 5CZ1A 3TANA 4ZTJA 1RT6A 4FK2A 4DQSA 2HHUA 1YTUA 2ETJA 2ZD1A 1IKYA 4CJTA 4DG1A 3HO1A 4BE2A 4FLVA 2OPPA 4CJQA 4ICLA 3F9KA 4AHCA 1RBUA 4DTPA 2GUIA 1TVRA 3SUNA 1C6VA 4BWJA 4CK1A 3QEVA 3DLEA 4B9NA 4HCBA 4Z4CA 3OS2A 1JXBA 3KLGA 4KB1A 4B9MA 3ZT4A 3CM5A 1HRHA 4HTUA 2HHSA 1VSLA 3SQ2A 1KCFA 1G15A 3MXJA 4M3RA 4M3XA 4ELTA 5KI6A 1HQEA 3LWMA 2YNIA 4GMJB 1NK5A 1JLEA 1U49A 4CCHA 4N56A 3KLEA 2HVHA 1ITGA 3K58A 1VRUA 1NK7A 4AILC 1B9FA 1EP4A 4AHVA 4CJEA 4B9TA 3K5MA 3VQEA 4FXDA 1NJYA 2HHQA 2X6SA 1TK5A 5C25A 3MAQA 4RG8A 4CFBA 1FKOA 3AO2A 1N6QA 3RR7A 4IKFA 2KFZA 1D9FA 4FJKA 4KHNA 3DOKA 3V1QA 4I2QA 3TR8A 3K5NA 3JSMA 5HRPA 1CZ9A 3BDPA 4B9VA 2KZMA 1SV5A 4Y1CA 3DLRA 3RMCA 2XY8A 1ZBUA 1CXUA 2RN2A 2AJQA 3I0SA 4YNQA 4CGFA 3QIPA 1JL2A 5KRTA 4AHTA 3KTQA 4OLAA 3CQ8A 1WLJA 1KVBA 1WSJA 2KFNA 1FXXA 5HROA 2HNZA 1C0MA 4CJSA 3L8BA 4IFYA 5FRMA 2P5OA 2OPSA 2BANA 5SWMA 4I7FA 1VRTA 4I2PA 2A1SA 3HYFA 3O3GA 1SL0A 4OKKA 2G8UA 3LPTA 1KVCA 1JKHA 3AVCA 1RBVA 4O44A 3ZT1A 3UIQA 4Y1DA 1ASWA 1LWFA 1F21A 2VG6A 4N41A 1NJZA 3KIOA 4IG0A 1TAUA 3JYTA 4M41A 4OKEA 4CJ4A 4F2SA 4CHNA 2D0AA 3DRRA 3SUPA 3AA2A 3RMAA 3M8PA 3KJVA 4DMNA 2RF2A 3SNNA 3SPYA 1WAFA 3LALA 4LD0A 2QK9A 3AO4A 1NOZA 1J5OA 3NCIA 1NJWA 4LH4A 4Q0BA 3ZSOA 2A1RA 1SL1A 3OYIA 2XO7A 4DTXA 4B3OA 1ASVA 4OPKA 1SUQA 2DFHA 3LDSA 1S9GA 1LWEA 1ASUA 4CF8A 2P1JA 4NYNA 4LSNA 2KW4A 3HPHA 4CHZA 4FM0A 1XHXA 3OYNA 3S3NA 1QSYA 4OLBA 2IAJA 3WNHA 3VQ4A 1LAVA 1VSHA 3NF6A 4CFDA 4E7KA 2P5GA 3NFAA 1TAQA 1QS4A 4DFMA 4HUGA 3QO9A 4ID1A 2KTQA 1ZBLA 1MU2A 4CF0A 1Q9YA 4FLYA 2XY7A 2P51A 1U04A 4C8MA 2F8TA 3HPGA 3L3VA 3OYDA 3ZSQA 1NKEA 2HB5A 1S9EA 4AHSA 1RDDA 5CYQA 4FVMA 4HVJA 4ZTFA 1XI1A 4IBNA 3G0ZA 1RTJA 4IFVA 5J2PA 1RNHA 3VN5A 1KVAA 1S1VA 4JRQA 3V9XA 4EP4A 4FLTA 3LZJA 1NK0A 3VA3A 3A2FA 3F73A 3I0RA 1UAXA 2I5JA 3OVNA 5I42A 1WAJA 3L2WA 3U3YA 1L3SA 4DSIA 3DI6A 3HVTA 3NF8A 4DQRA 2XHBA 2X74A 3E01A 3K5OA 4H8KA 4DF4A 1HJRA 4FZZA 1KFDA 5KGXA 1C1CA 3O3FA 4DTRA 2G8VA 4CGIA 2ATQA 1NKCA 3VQAA 4EZ6A 1VK0A 1SKSA 5HRSA 4M3TA 4W5OA 2BGGA 3M8QA 3KK2A 1JL1A 2D0CA 4DLEA 4E7IA 3SPZA 1TK8A 4NCAA 4MQ3A 4F4KA 2IC3A 2R7YA 1VSKA 1KTQA 1A5VA 1JLFA 4CJKA 4OPJA 2Z1HA 3OYJA 4FW1A 4CJ5A 4DTOA 4KPYA 4CJVA 1RDCA 1VSMA 4JLHA 4DTNA 3O4NA 2ITGA 3NE6A 1LW0A 4CHOA 1N5YA 3QNNA 2Q3SA 5HP1A 3OJSA 5HRRA 4KTQA 1TGOA 4Z4HA 3NH2A 2HMIA 1U48A 1Q9XA 1WSIA 1WN7A 1DTQA 2YHBA 3VQQA 4BE0A 5C24A 1EXQA 4KHUA 2FBTA 3DYAA 4ID5A 2DFEA 4B08A 4PA1A 3B6OA 4FLZA 1L3UA 1RILA 2YNGA 4KI6A 4B9LA 1RDAA 1A5XA 4CEBA 1DTTA 2EX3A 4L8RB 2RPIA 4AH9A 4R5PA 3TAMA 1D8YA 2F8SA 1JLQA 2FBYA 1L5UA 1GOAA 1RDBA 5J2QA 4ZHRA 3PX4A 3NF7A 2DTUA 5JS1A 3OYKA 4KO0A 1S1TA 4CJ3A 3HVRA 4CK2A 4CE9A 1T8EA 2PYLA 3PO4A 1VSFA 3AA5X 1W0HA 1IG9A 1KRPA 3C95A 2OYQA 1VSJA 4WE1A 3TWHA 2O4IA 2D5RA 4AHUA 3NH1A 4B8CA 3V4IA 3AVKA 1BHLA 1HNIA 4RW9A 4CEDA 2VWJA 1B9DA 1J53A 4CIFA 3DMJA 1C0UA 4NCBA 1K6YA 1IKVA 1HNVA 3AVGA 3PV8A 3KLIA 3ZSWA 2HW3A 1QHTA 4E1NA 4KTWA 4CEQA 3LPUA 1RBTA 3QEIA 3K5LA 3AVAA 2VWKA 1L3TA 4ELUA 4OKJA 1QSLA 4M3YA 4PWDA 3ZSVA 3NF9A 4DLGA 4E7LA 4FJMA 2GV9A 4E7JA 4DU3A 3ZSRA 2Y1IA 4E89A 2G8KA 3MEEA 3SQ4A 4AHRA 1QE1A 3OYGA 3OYMA 3KK3A 3PUFA 4CK3A 3HM9A 3NDKA 4C8KA 2Z1JA 2HHVA 3NBPA 1JLBA 1S6PA 1GOBA 2B6AA 5DK5A 4RW6A 2HHXA 1RBRA 4CHYA 1C0TA 1KLMA 3SV4A 1S1XA 1BIUA 2W42A 1D5AA 3KD1E 4N5SA 3C6TA 1BQNA 3NH0A 4O4GA 3T19A 3AVIA 3RRHA 1RTDA 1KLNA 1I39A 1CLQA 3AVBA 2IOCA 1IKXA 1T05A 4E1MA 2VG7A 1HYSA 3VQ5A 3QLHA 3K59A 3S3OA 3MEGA 2VG5A 4FZXC 4KHYA 4DTMA 3AA3A 3VQ9A 4TSXA 1D9DA 2OPQA 4KKOA 3THVA 4NYFA 3KK1A 1SKWA 3RRGA 4FLUA 5CY4A 4FK0A 4FJ9A 4J2EA 3NGZA 2DFFA 4E0DA 3MECA 2Y1JA 1TKTA 3TAQA 4W5NA 3L3UA 3DRPA 4OVLA 4CECA 3SZ2A 4DU4A 3TAFA 1WSEA 1X9SA 2G8WA 4CFCA 4CEAA 4KRFA 2HHTA 1BCOA 3RMBA 3CG7A 1BI4A 1WSFA 3IS9A 1HPZA 4F3OA 4CIGA 2D0BA 3KLFA 1LW2A 1L3VA 3MXMA 1FKPA 5SZTA 4CEEA 3VQ7A 4DSEA 3TAEA 4FJLA 4KV8A 3LANA 4O0JA 3TARA 3P83D 2FC0A 4DQPA 1S5JA 3O4QA 1ZYQA 2GBZA 2WONA 3ZT2A 1IKWA 4LH5A 4IG3A 4LSLA 4CEOA 3ASMA 3PO5A 2HHWA 3LAMA 4Z4IA 3CM6A 3ZSXA 4F2RA 1NOYA 3OYLA 2BDPA 3AA4A 4CJLA 3IAYA 3ZSZA 3V1RA 2XRIA 3S9HA 3SJJA 1X9MA 1QQCA 1CZBA 1TKDA 2OPRA 4Z4FA 3SQ0A 1NKBA 2F96A 1DLOA 3AVHA 3LP2A 4M45A 3SI6A 1YVUA 1RT3A 2YHAA 4M3UA 3M8RA 2ZQBA 4GVMA 1NK4A 5EU7A 2Z1GA 3KKRA 1S1UA 3DM2A 3LAKA 3NGIA 4I9LA 3MXIA 3SUOA 3EYZA 2IGIA 5KRSA 4C8OA 3TABA 1W9HA 3FFIA 2O4GA 2G8FA 4C8LA 4EZ9A 1RTIA 4Q5VA 3QESA 1TKZA 4BE1A 1NK8A 5KTQA 3HP9A 5FRNA 3DLBA 3HSTB 2EHGA 4CJPA 3L2VA 3U6FA 1BISA 5T7BA 2E6LA 5C42A 1U47A 2QKBA 3HT3A 3OYEA 3PX6A 2LSNA 5CYMA 4FZYA 3C94A 3VQ6A 1Z25A 4CFAA 4KREA 1KFSA 3QEPA 1I3AA 2HNYA 2IDOA 4Z4GA 1YTAA 3ZCMA 1WSGA 2HVIA 3LP1A 4CGDA 4E19A 4KHQA 5CZ2A 4LY7A 3LP3A 4H4OA 3LZIA 3ZT3A 4J2BA 1LWCA 3VQ8A 4FM1A 3I8DA 2BE2A 4BDYA 4DQQA 3EZ5A 1JXEA 4CJFA 4DWIA 4CESA 1U45A 4FJ5A 2Z1IA 4M3WA 4KTZA 4FYDA 4OGCA
chains in the Genus database with same CATH superfamily
3VENA 1QZ6A 3AVNA 3OJUA 5K14A 4GW6A 2ZJQL 3UKRB 4PY5A 4UQGA 3OYAA 3LDPA 3M8SA 1EQYA 4JS4A 4KI4A 4G1QA 4HHTA 4AF1A 3GDQA 3OY9A 1RT7A 2NRVA 3ENOA 3VQBA 4DR7K 2Q1NA 4MFBA 2YJFA 3HP6A 3U8XA 4F3TA 3I8BA 3AO1A 4M42A 4DQ8A 3V9WA 3VQDA 4K8ZA 2QKKA 5J2MA 3O9UA 3ULEB 4K8XA 2QWLA 2JLEA 3OS1A 4CZMA 3HL8A 3LM2A 1BIZA 4OJRA 4CJUA 1DT9A 3SYZA 2YKMA 3AVFA 4JKDA 4BACA 4ILJA 2PYJA 2JGUA 2O8FB 4W5RA 4DSJA 3LP0A 3GE1A 1NLVA 4CIEA 2OA8A 2Q0UA 1XWLA 2D0PA 3ALYA 3K57A 4CJ7A 2E2OA 4JI3K 2P9UA 3OS0A 3OHRA 4EFHA 3D0PA 3DLHA 2KZZA 2OZSA 1SQKA 5FDLA 4KHWA 2ZGYA 3NAEA 3JS6A 4YFUA 2IVNA 3V1OA 1VQ4N 5AJ3K 3K2PA 1I94K 3O08A 3V81A 1S6QA 2ZE2A 5AQKA 1S22A 1TL1A 1HYVA 4BR5A 2X6NA 1Q81O 4NLCA 3WNFA 4YOVA 4BY9C 4BR0A 1FW6A 2Q2RA 3KKSA 4DQIA 4DSLA 4CZLA 4N76A 1EKEA 4RW7A 1DKGD 3R9PA 5C12A 4GV3A 4YDUA 1BCMA 3BF1A 3O3HA 4JI4K 1SKRA 4DSKA 2ASMA 1BDGA 4B8AB 3G71N 4DR1K 3IRXA 3C6UA 3M1FA 5KGWA 4U67L 3J80O 4W5TA 4DCHA 4CF9A 1XHZA 3ISNC 5M1KA 3EY1A 3ZEUA 4FM2A 3RTVA 4DFKA 4HUEA 1E3MA 5C2FA 2E1ZA 4RWTA 1X9WA 2G8HA 3QINA 1HKCA 3GG4A 4H4MA 4FLWA 4JRPA 3PO4A 2QXFA 4CF2A 4E1JA 3T69A 1VSEA 3QBXA 3AVMA 3CCLN 3RSEB 1HKBA 2O8CB 4BE2A 1NG9A 2OPPA 4CJQA 3SUNA 1TVRA 4CZIA 4C23A 3OS2A 1YF5L 4JKAA 3KLGA 4EHUA 3ZT4A 3CM5A 3CJ1A 1KCFA 1G15A 3OA9A 4M3RA 2FF6A 3MDQA 1NK7A 4AHVA 4B9TA 3K5MA 3VQEA 2HHQA 3ZX0A 1ATSA 2YI1A 3MAQA 4CFBA 1FKOA 3KK7A 5KPZA 4YOUA 3TR8A 4EHTA 3JSMA 1NGBA 1CZ9A 3BDPA 3FFKB 3RMCA 3I0SA 4CGFA 1JL2A 5TKYA 3VOVA 3KTQA 4B1VA 3IDHA 3CQ8A 4BC2A 2A3ZA 5CR4A 4CJSA 3KWGA 4BQLA 2P5OA 3BEXA 4FPAA 3VGKA 4I7FA 3HTVA 3HYFA 4KH6A 4OKKA 4O44A 4FWSA 4Y1DA 4NXMK 3QB0A 3THYA 3AGKA 3JYTA 2D0AA 3DRRA 3SUPA 3RMAA 3M8PA 4DMNA 2QXLA 4IWVA 3CCEN 3SPYA 2QK9A 3AO4A 3QFUA 1J5OA 3NCIA 3E1YA 3ZSOA 5AQZA 1ASVA 4OPKA 4WFNL 3LDSA 4CF8A 2P1JA 3HPHA 4CHZA 4JI1K 3CJCA 3WNHA 3VQ4A 4AM6A 5BRHA 4CFDA 4CD3A 1QZ5A 1QS4A 4HUGA 3QO9A 1SAZA 1MU2A 4CD1A 4FLYA 2P51A 1U04A 3OYDA 2ZJRL 3ZSQA 5CYQA 3BUZB 2ZF5O 3G0ZA 4IFVA 1RNHA 1S1VA 3V9XA 2P9KA 4EP4A 3R1XA 3F73A 2W6LA 4FO0A 2QWOA 3DI6A 5LJVA 4H8KA 4EIAA 5KGXA 3FZHA 2G8VA 4DR4K 1U2VA 5HRSA 3M8QA 1JL1A 4F4KA 1YITN 2IC3A 1XNQK 2QWQA 1RDUA 4FW1A 2YHWA 4CJVA 2V52B 5KPTA 1TUYA 3WEEB 3QNNA 3C6AA 3UKRA 5HRRA 4Z4HA 3NH2A 2GWJA 4FSVA 1U48A 1WN7A 2YHBA 1DTQA 4BE0A 4KHUA 1WUAA 3DYAA 4F9OA 1O13A 2JWLA 4B08A 5LJWA 1VQMN 3CCRN 1RILA 2YNGA 4H0XB 4B9LA 4CEBA 4U7BA 1DTTA 2RPIA 1D8YA 3ATVA 1JLQA 1RDBA 2DTUA 2E8AA 4O5FA 5AQXA 3WXIA 3AA5X 1W0HA 1KRPA 2YJEA 4B8CA 2QI2A 4BRIA 5AFUH 4RW9A 1HNIA 1B9DA 1J53A 1K6YA 1JCGA 1NGJA 2W41A 3O9RA 1Q82O 5AQMA 3H3OB 4ELUA 4OKJA 4BR2A 1YI2N 3NF9A 1GLLO 2GV9A 4FWRA 2E2QA 3CC2N 2O8FA 3SQ4A 2YX6A 1VQNN 4OPHA 2Z1JA 2HHVA 1QVFM 2B6AA 5BPNA 1GOBA 3FE1A 1VQ9N 4HTLA 1KLMA 3SV4A 3MN5A 4DV2K 4IXCA 4N5SA 3RRHA 3MCAB 3KVGA 2VG7A 4MLEA 5AQTA 3DXKA 4NO7A 3VQ9A 3RRGA 4FJ9A 3KK1A 3O5BA 1DEJA 1NM1A 4C1NI 5LY3A 3MECA 2Y1JA 3DRPA 4OVLA 3SZ2A 4CFCA 4CEAA 5ADXA 4MO5A 3RMBA 4ISGA 4FOIA 1S3XA 1KAYA 3MWPA 2D0BA 2Q31A 3T7ZA 3MXMA 3LM9A 1LCUA 3TPQA 4O0JA 3P83D 3K0SA 4DQPA 4LH5A 3ASMA 4LFCK 4F2RA 1NOYA 2BDPA 2BUPA 3VEYA 3ZSZA 1VQ8N 1NGHA 4M7YA 2XRIA 3V1RA 3S9HA 3SJJA 1X9MA 1VQKN 2F96A 3AVHA 3LP2A 4BG8A 1VQON 3SI6A 4JKGA 3M8RA 3FZLA 1NK4A 3VF4A 1RDWX 3LAKA 4I9LA 3EYZA 3TABA 4H0OA 4C8LA 5HL7L 2G8FA 5A2QO 3QESA 5AQYA 4BE1A 3VEWA 3CHWA 3J7YP 3HP9A 3AARA 4CJPA 3U6FA 4KH4A 5C42A 4JKCA 4YOTA 5CYMA 4OO1J 3C94A 3ZCMA 3WUHA 3LP1A 3RSEA 4Y0WA 4CGDA 2O8CA 4H4OA 4LF6K 3ZT3A 5IWAK 5I9EB 1KXPA 4FJ5A 2Z1IA 5AQSA 2E6MA 1X9JA 2AA4A 2NRHA 3T3FA 3QERA 3SCXA 1OH8A 4RW8A 2KLAA 3C65A 4IJNA 5FLXO 3ULDA 1RBSA 5F2RA 3V9ZA 5DM7L 1ILYA 1RTHA 1ZBFA 3HOTA 3LDLA 3RWUA 4CEFA 1JLCA 1MWKA 3ZSYA 3VEXA 3AAQA 4I9QA 3NMUA 3AVLA 4NCGA 2ASOA 5E41A 1W7AA 2V51B 2UUCK 3TTCA 4YOWA 1K8KA 1W97L 4FJ7A 2HF3A 1X1PA 4J2AA 4WQ5C 1GOCA 2FBXA 2IS3A 1Q8IA 3V9SA 1N8RO 3MEDA 3AVJA 3HPOA 1LV5A 5BREA 1Z26A 4BR9A 2QEXN 3TU5A 2W40A 4IDKA 3RMDA 2CH6A 1B92A 4BGAA 1QQOA 2O8DB 1HUXA 3C6HA 5ELZA 4FWMA 2NRRA 3CFPA 5E26A 1TV6A 1ZBHA 3EKUA 4GV9A 3K9KA 3A5OC 2P9PB 3L2QA 4OGEA 3WNGA 4FCYA 5C0YA 2RKIA 3ITHA 1JLGA 1RCHA 1NGEA 3VA0A 5EOYA 2DPNA 3SLCA 2PY5A 3W0LA 2HBMA 4DFJA 3MK6A 5AR0A 5I3UA 1GLAG 4FJXA 5J1EA 3PSIA 3AY9A 3SQ1A 1A5WA 1BI4B 2QTDA 5JMVA 1E4FT 1TUUA 4BVOA 3QDKA 3OYBA 1YIJN 2B4JA 2P9IB 1RT2A 4BDPA 5D3GA 1C1AA 3CJ9A 1N34K 1RT1A 3IG1A 3CMAN 1CXQA 1Y97A 1JCFA 4A2AA 3CCSN 4PKGA 3AV9A 3HXMA 3KLHA 3MX5A 1WBBA 3A5MC 4M3UA 1IO2A 1C0FA 3ID6A 3D6RA 2G8IA 3DLGA 3TSQA 1K9MO 1HR0K 1FK9A 2FBVA 3HJFA 4PQUA 5C15A 1GLBG 4LC9B 1OH6A 4ELVA 2Q36A 5GINA 3SUQA 4HCBA 4O0IA 1UWBA 5HOOA 4WQ5A 1BGXT 4MDAA 3IAYA 4Z0UA 2FF3B 1XQSC 1C1BA 3TANA 4DQSA 1YTUA 2ETJA 4CJTA 1IKYA 4FLVA 4BC3A 4AHCA 1RBUA 4DTPA 4YDUC 4DUZK 1C6VA 3QEVA 3DLEA 4I6MA 3IUCA 4XH1A 1N33K 1G99A 4H5NA 3I33A 1VSLA 1P8ZA 3SQ2A 4ELTA 4GY2B 1JLEA 3GBTA 3KLEA 3DAWA 3DXMA 1B9FA 1EP4A 4CJEA 4FXDA 2I7PA 1J6ZA 5C25A 3PIOL 4RG8A 3AO2A 2P9LB 1N6QA 2A42A 2KFZA 4FJKA 4KHNA 3DOKA 3V1QA 4I2QA 5BR9A 1Q18A 1JCEA 2Q97A 2NRTA 5JVHL 2RN2A 3L6QA 3QIPA 5JVGL 4IEEA 2QWNA 1KVBA 2KFNA 1FXXA 5HROA 1NGDA 1C0MA 2UUBK 2WUSA 3L8BA 4IFYA 3CMEN 5AZIB 2OPSA 3VPZA 4LF9K 2BANA 1SL0A 3VESA 3O3GA 4K43A 4BQZA 1GLEG 1JKHA 4DV6K 3UIQA 3ZT1A 4BVPA 1ASWA 1LWFA 2FXUA 2VG6A 1NJZA 2VYPA 3KIOA 1TAUA 1BA1A 4A2BA 4CJ4A 5AQQA 2WFBA 3RVCA 3AA2A 3LL3A 1VQPN 3ENHA 2KHOA 1NJWA 3VGMA 1NBWA 3JAMO 3OYIA 3CI5A 5AQJA 2XO7A 4DTXA 1YVNA 1SUQA 1S9GA 1LWEA 1ASUA 2A5XA 4LSNA 3E9LA 1VQ6N 4FM0A 3VEOA 3UE5A 3S3NA 4MDBA 2VCPA 1QSYA 2PFUA 1VSHA 3CCVN 1TAQA 4DFMA 5BPMA 4ID1A 2KTQA 3O9QA 3K9JA 3HPGA 1NKEA 3CERA 1S9EA 4AHSA 1RDDA 4HVJA 3THWA 4ZTFA 5GIPA 4IBNA 3DLLL 2UUAK 4LF8K 3VN5A 1KVAA 3DJCA 4WQ4A 4FLTA 4MO4A 5C2DA 1K8AO 3VA3A 3A2FA 5I42A 1WAJA 1L3SA 1VQ5N 3HVTA 2XHBA 2X74A 3E01A 1LOTB 3G6EN 2D0OA 4DTRA 4JAXA 4CGIA 1NKCA 4EZ6A 3C7NB 4ILHA 4W5OA 5CHIA 2BGGA 3KK2A 2D0CA 5ADXH 4DLEA 4B9QA 2R7YA 1KTQA 2YHYA 2EWSA 1Z6RA 1QVGM 5JLHA 3NE6A 1N5YA 5HP1A 2Q3SA 4C1NK 1TGOA 4YOYA 1Q9XA 5AQHA 4FWNA 5C24A 1EXQA 2OANA 2DFEA 1BG3A 3B6OA 4FLZA 1IG8A 5KQ8A 4AH9A 4R5PA 2F8SA 1K73O 2FBYA 4BG9A 1L5UA 5J2QA 4ZHRA 5JS1A 3OYKA 4KO0A 1S1TA 3HVRA 3CETA 4WFAL 1WB9A 2A6AA 3A5NC 2UXDK 1IG9A 3C95A 4WE1A 3UB5A 4B1XB 3NH1A 3LDQA 1BU6O 3AVKA 4CEDA 2VWJA 4CIFA 1C0UA 5M1PA 1IKVA 2ZWHA 4DR6K 1QHTA 2ZGZA 4CEQA 2QWPA 3QEIA 3AVAA 2NRZA 3THXA 3SAHA 3CJBA 2OTLN 4M3YA 4X66K 4FJMA 4JKHA 3EZWA 3ZSRA 4JI0K 4E89A 3MEEA 3OYGA 3OYMA 3KK3A 3PUFA 2O8DA 4CK3A 2NRWA 3VGLA 2H3GX 5DK5A 1SS6A 4RW6A 3JXUA 1S1XA 1BIUA 2P9PA 3NVMA 3R3LA 4DR3K 1BQNA 3NH0A 1JJ2M 3MN6A 1I39A 3AVBA 2IOCA 3PLAA 3HZ6A 3EL2A 3VQ5A 3K59A 3S3OA 3MEGA 3CD6N 4FZXC 5BRFA 3AA3A 1D9DA 1SKWA 4M63C 4FLUA 1YJWN 3TAQA 1ZBIA 4JI8K 3TAFA 4CECA 1WSEA 2G8WA 4KRFA 3D2EB 1BCOA 1BI4A 1WSFA 3IS9A 1HPZA 4CIGA 5B8HA 4LF4K 4CZEA 1HKGA 3EE8A 5SZTA 4DSEA 4FWOA 1XC3A 4KV8A 2UXBK 1S5JA 3U9ZA 3CPWM 2WONA 3ZT2A 4DV4K 3QMLA 4LSLA 1HX1A 3LAMA 3ZSXA 5AZJB 3OYLA 4CJLA 1EWRA 3O6WA 1WOQA 1QQCA 1NKBA 1YVUA 3J8AA 3QICA 3S41A 3KKRA 4BRQA 3SUOA 4C8OA 2O8BB 4BGBA 5KRSA 3CCUN 4EZ9A 1KQSM 1TKZA 1NK8A 4CZJA 4FWPA 3ID8A 3O9SA 3CIPA 1BISA 3H3NO 2QKBA 3HI0A 1ZBSA 1U6ZA 1NWKA 4FZYA 3VQ6A 1Q7YO 2IDOA 2RE2A 2HVIA 1IBMK 5CZ2A 4DB3A 3LP3A 5EVZA 1V4TA 2P9NB 2HOEA 3FZMA 1LWCA 4B1WB 2IIRA 4CZFA 4FM1A 1JXEA 4DWIA 4J8FA 4OPAA 4KTZA 1TYQB 4FJJA 3OBYA 3D45A 3DWLA 4W5QA 4FK4A 4KHSA 3D2FB 3SAGA 1WSHA 4O8KA 3H08A 3BF3A 3G10A 4CGJA 3ZETB 1SL2A 4EP5A 4O8UA 3J7ZO 3U9DA 3ULEA 5FROA 3T1YK 1T3VA 4JI7K 3BGRA 1UOCA 2RHKA 2PBDA 4C8NA 2YNHA 1X3NA 4JK9A 3ZT0A 5JS2A 3TAPA 4IO8A 1VSDA 4QCLA 3IKMA 3L4IA 5AQRA 4JEPA 4DTUA 4DTSA 4JKFA 4RTFD 4FLXA 3C0BA 5FPNA 4HCCA 4DTJA 4XH5A 4HUFA 3P5JA 3B6PA 3BY5A 4QS8A 4JI5K 4DS5A 4E3SA 4BR7A 3TAGA 3O80A 4JN4A 3TSPA 3T1HK 4N47A 1KSPA 3T1AA 1HYZA 3O9TA 3CJAA 4B3SK 4CHPA 4CERA 4BWMA 2PAVA 1GLFO 1YUWA 1D4XA 1GLCG 3ZX2A 1TL3A 2NUBA 4DSFA 1NK6A 4X62K 3OYFA 4FJNA 4KB0A 1UA1A 3SBTA 4YY3K 3H45C 2FSNA 1NK9A 1X3MA 4KFBA 1TK0A 4DFPA 5AQWA 3OYHA 5F0XA 3CFOA 2FSJA 4FJGA 4NXNK 2YNFA 3MCPA 3NVKA 2P9SB 3HK2A 3H6EA 1ATRA 4QOZB 2KQ2A 2B5JA 3V9UA 3RR8A 2WOMA 3L2UA 4CHQA 3V6DA 4O5BA 3QEWA 2O8EB 1HMVA 3Q7CA 1S1WA 1VSIA 3N4QA 4BRDA 1XMQK 2YV0X 1T6CA 3U3GA 3P1GA 3LDOA 1R0AA 1J54A 3VQCA 3VETA 4Z4EA 4JS5A 2D4WA 4DU1A 4FJHA 1KD1O 1Q86O 4JK8A 1XMOK 3I55N 2UU9K 5CZ1A 4JHDB 2HHUA 1M90O 2ZD1A 3HO1A 2NZTA 1ESVA 5FPMA 4DG1A 3F9KA 3WXMB 3MN9A 4KB1A 5IT9O 4HTUA 2HHSA 4A57A 1NMDA 4BR4A 4DR5K 5KI6A 1HQEA 3LWMA 5BPLA 1NK5A 3MMVA 1U49A 4CCHA 1QHAA 4N56A 3VF6A 2HVHA 1ITGA 3LDNA 1VRUA 3K58A 4AILC 2X6SA 4DHYA 1TK5A 5AQNA 3EE9A 3RR7A 4IKFA 1D9FA 3K5NA 2KZMA 4BRGA 1GLJO 1ZBUA 1CXUA 2AJQA 3HM8A 4YNQA 2WBNA 4AHTA 3GOIA 1WLJA 2E1YA 1WSJA 3TTFA 4BRAA 4WCEL 3SAFA 5FRMA 1YXQA 1IJJA 3H46O 5SWMA 3AVCA 4AQYK 1NJIO 4IDHA 3J7AP 4OKEA 4X64K 4CHNA 4A59A 1ATNA 2RF2A 3LALA 4LD0A 1NOZA 4BC4A 2HBKA 2WC9A 2A1RA 4M7XA 4JD2B 4B3OA 2DFHA 5AZJA 3SMPA 2KW4A 4B1UB 3OYNA 5GIOA 4OLBA 2IAJA 5LL6Z 1LAVA 3CC4N 2E20A 2GWKA 4CF0A 4C8MA 2O8BA 3L3VA 3E9PA 4FVMA 1XI1A 1QQMA 4JRQA 2CGLA 3J81O 4EAHD 2I5JA 3OVNA 3U4LA 3CCQN 3ZYYX 1NGCA 3WEEA 2HF4A 4JNEA 4B1ZA 4H03B 1KFDA 2E5LK 3QFPA 1C1CA 4KBOA 2QWMA 3VQAA 4GKKK 3SPZA 4E7IA 1TK8A 4MQ3A 1VSKA 4DV5K 1JLFA 4CJKA 3CPEA 3FGUA 2Z1HA 3OYJA 4CJ5A 4DTOA 4DTNA 3O4NA 2ITGA 4CHOA 5C10A 3OJSA 3O1BA 3D2FA 2HMIA 2V7ZA 3VQQA 1E4GT 2FBTA 1IBKK 1NGAA 4PA1A 5AQOA 4KI6A 3ZETA 4FWLA 1RDAA 1A5XA 4WQ4C 1BA0A 4L8RB 2ITMA 3TAMA 5KQDA 3CF5L 5LMUK 4CK2A 4CE9A 1T8EA 2PYLA 2GUPA 1OKJA 1VSJA 3F5TA 4CBUA 3V4IA 4L3QA 4ILGB 2VQEK 3DMJA 4NCBA 1NGGA 1QQNA 3AVGA 3PV8A 3KLIA 3HRGA 2HW3A 2GX9A 1RBTA 3VTHA 1L3TA 2VWKA 1QSLA 1FJGK 4DU3A 3PSFA 2G8KA 4AHRA 4H5WA 4A62A 3NDKA 4C8KA 1S6PA 1T44A 2E88A 1HPMA 1RBRA 4K42A 2W42A 4IOCL 1OVYA 1KLNA 2NLXA 1IKXA 2F9WA 1T05A 3SK3A 1HYSA 4DV1K 5M1NA 2HBLA 5AQFA 2VG5A 4CW7B 3CQYA 2OPQA 4KKOA 3THVA 4NYFA 5CY4A 5GAEP 2HHHK 1TKTA 4BRLA 1VQLN 4DU4A 1X9SA 4G9ZA 4PKIA 4WF9L 1YAGA 5CE3A 3CCMN 3IMXA 3KLFA 4K41A 5M1OA 1L3VA 3VEZA 4JKBA 3VQ7A 4FJLA 3TAEA 3I56N 3LANA 2GTDA 2ASPA 5GAHP 3DXKB 2GBZA 4IG3A 3PO5A 2HHWA 3CM6A 3OTOK 2V7YA 3E66A 2VQFK 2UYTA 1HNZK 3EN9A 3HSCA 1MDUB 4AM7A 1CZBA 2OPRA 2P9SA 4YOXA 4B1YB 3L4QA 4GVMA 5EU7A 1S1UA 3DM2A 4ISFA 3NGIA 2O8EA 2IGIA 1W9HA 3FFIA 3CXCM 5JICA 3ENBA 3DLBA 3HSTB 2EHGA 3L2VA 4WFBL 5T7BA 3PX6A 2LSNA 2GEMA 4JKGB 4KREA 4FPBA 1KFSA 3QEPA 2HNYA 4H5TA 1YTAA 4JHDA 2NRXA 3WXJA 4E19A 4CZKA 1W2BM 4KHQA 4LY7A 4K0KK 4H5VA 4YHHK 4Z94A 4J2BA 4GV6A 2VGMA 4PL8A 4CJFA 1U45A 3P4IA 3O4WA 3G25A 4M3WA 3UKUB 3DRSA 5EXWA 5AQLA 1LAWA 3F9MA 4B3TK 3PX0A 1T6DA 3QIOA 3L0QA 2QM1A 2XY5A 1EETA 5H1SQ 3IFRA 2A40A 1U4BA 4BC5A 3AGRA 4QS7A 3PY8A 4B3MK 3SV3A 4H0YB 1XC9A 4CJWA 4BRKA 5HBMA 3B8AX 3TTDA 4FWQA 4E7HA 2IVOA 5DMRA 3DLKA 3L2RA 1O1WA 2FSKA 1BO5O 5KPRA 2OZMA 1WNSA 3QETA 4J2DA 4CEZA 4R79A 1OH5A 3GL1A 3Q7BA 5AQPA 1T7PA 4FVUA 3NGYA 4GVEA 1QSSA 4ISEA 4DKWA 3TI0A 3DOLA 4FL9A 3VEVA 1DGKN 1NGFA 2OTJN 4XIUA 1HLUA 1IH7A 1J9AA 3NHGA 1REVA 4JD2A 1K8KB 5TKWA 4KAZA 2D1KA 4CF1A 1M1KO 4DUYK 2GELA 4LFAK 2XY6A 1T03A 2DY4A 4DR2K 4CJRA 5E84A 4BRNA 4CGHA 2P9IA 1TKXA 3WNEA 2QA4N 4BDZA 1UA0A 3OBWA 3AAPA 5HLFA 3P38A 3H1QA 4F8RA 1YJ9N 4KH5A 3OYCA 3QNOA 3D7EO 4DF8A 2J4RA 2HNDA 1S72N 2PZSA 1QTMA 4LFBK 4CZGA 4DS4A 3O1WA 3KD5E 4KHPK 4GKJK 4CI6A 4BRFA 1YJNN 1BL3A 5LMNK 1N32K 2X78A 3CJ7A 3AO3A 3CQXA 1Z05A 4FW2A 5FPEA 4JV5K 1BQMA 4UY8O 4PKHA 1JLAA 1J5EK 1RT5A 3LWLA 4B9UA 3AO5A 3EEQA 2E4LA 2HHTA 3QEXA 1EX4A 4RW4A 3VQPA 4FJ8A 4M3ZA 4O55A 4FJIA 4QAGA 4WYBA 2BTFA 1VHXA 4B9SA 2NNWA 2E2PA 3CFRA 1NJXA 4PUOA 5M1QA 1HQUA 4IEIA 3TSUA 1KC8O 4A5BA 2YKNA 3R6MA 5J2NA 1R59O 1RFQA 3F2KA 4CGGA 1RT4A 5HRNA 1YT3A 3S3MA 5M1FA 3CYMA 4ZTJA 2ZJPL 4FK2A 1RT6A 4XEIA 1NGIA 1IBLK 4ICLA 3CC7N 2GUIA 2P9LA 4BWJA 4CK1A 4B9NA 4Z4CA 1JXBA 5DM6L 4B9MA 1CZAN 4XH4A 3VERA 1HRHA 3MXJA 3PIPL 4M3XA 5GADP 2YNIA 4GMJB 2FLOA 1EWQA 1NJYA 4V19S 4CVNE 1VAZA 5AZIA 3KHYA 4I6MB 5BN9A 5HRPA 4B9VA 3KZBA 1SV5A 4Y1CA 3DLRA 2XY8A 5AQGA 3FR0A 5KRTA 4OLAA 5AQUA 3DXMB 3MN7A 2HNZA 2QWRA 3M3ZA 4HWIA 3M5RA 4LF7K 1HJOA 1H1VA 1VRTA 1KAZA 2A1SA 2Q0RA 4I2PA 2G8UA 3LPTA 1KVCA 1RBVA 1F21A 4N41A 4IG0A 4M41A 4F2SA 3KJVA 3SNNA 2CGJA 1WAFA 4H0PA 3A8YA 3KWIA 1HNWK 1Y64A 4LH4A 4Q0BA 1SL1A 1N36K 2P9UB 4IZ9A 1IV0A 4NYNA 1XHXA 3P31A 4PL7A 3SMSA 4JYAK 2HBJA 3NF6A 4E7KA 2OCEA 2P5GA 1RGIA 3NFAA 5F1XA 3N4PA 3G4SN 3BZKA 1ZBLA 1Q9YA 2JWKA 2XY7A 2F8TA 3C7NA 2HB5A 3HBTA 2QW9A 3HOSA 1SZ2A 1RTJA 5J2PA 4IJAA 3WT0A 2F9TA 1VQ7N 3LZJA 1NK0A 3I0RA 1UAXA 5BRDA 3L2WA 3U3YA 4DSIA 3WXLA 4BRMA 1BOTO 4H0TB 3NF8A 2CH5A 1ZXOA 4DQRA 3K5OA 2HSTA 4DF4A 1HJRA 4FZZA 1MA9B 4IOAL 3O3FA 3WQTA 2ATQA 1VK0A 2YCHA 1SKSA 5FPDA 4M3TA 4CZHA 3THWB 4NCAA 5GAGP 3MWTA 1A5VA 4OPJA 4H0VB 4KPYA 1RDCA 1VSMA 1ZC6A 4JLHA 3UKUA 1LW0A 4RCHA 4X65K 4KTQA 4IOXA 4Z4GA 1WSIA 4QS9A 1GLDG 3ZEUB 1EO1A 4ID5A 2CGKA 3M6GA 1BUPA 1L3UA 4FWKA 3R8EA 2EX3A 4DV0K 1GOAA 4IO9L 3WQUA 4DV7K 3PX4A 3NF7A 4CJ3A 1OH7A 1VSFA 4JI2K 4LF5K 2O4IA 1KAXA 1V4SA 2E2NA 2BH1A 3TWHA 2WTUA 2OYQA 2D5RA 4AHUA 5AQIA 1BHLA 5MLCQ 1NU0A 4K25A 1HNVA 3ZSWA 4E1NA 4KTWA 3LPUA 1HNXK 3BZCA 3K5LA 2HMPA 4PWDA 3ZSVA 4DLGA 4E7LA 3SBGA 4E7JA 1YHQN 3FZKA 3H1VX 2Y1IA 1QE1A 4BROA 3HM9A 4H5RA 4JK7A 3NBPA 3ZX3A 1JLBA 2HHXA 4CHYA 1C0TA 5JLFA 3KD1E 1D5AA 3D2EA 3C6TA 4BRPA 1XNRK 4O4GA 3T19A 4CBXA 3AVIA 3E9OA 3THXB 1RTDA 3FZFA 4BREA 2UXCK 1CLQA 3MX2A 4E1MA 3OW2M 3QLHA 4FOEA 3EKSA 3FLCO 3QBWA 4KHYA 4DTMA 4TSXA 4FK0A 5BN8A 3NGZA 4J2EA 4OX9K 2DFFA 4E0DA 4W5NA 4BRHA 1P90A 3L3UA 2YHXA 3ZLJA 3ATUA 3CG7A 4A61A 4NB4A 4F3OA 2KKZA 3THYB 4BRCA 1WBDA 3CCJN 1LW2A 2VWBA 1FKPA 4CEEA 3BP8A 4PHTX 4B3RK 3TARA 2FC0A 3VTIA 3O4QA 1ZYQA 1IKWA 4NLBA 4CEOA 2VGNA 4Z4IA 1XUPO 3VMFB 3AA4A 1TKDA 4Z4FA 3SQ0A 3O8MA 1C0GA 1DLOA 4M45A 1RT3A 2YHAA 2ZQBA 3P39A 5AQVA 2F7TA 2Z1GA 3MXIA 4YORA 2O4GA 1RTIA 4Q5VA 2P9NA 2A41A 5EY4A 3VF2A 2ZM6K 3EO3A 4JI6K 5KTQA 1NNEA 5FRNA 2P9KB 2I7NA 1OVQA 5AFUA 2E6LA 1U47A 4IFEA 2W6KA 1BWFO 3HT3A 5EX5A 3OYEA 4DV3K 1TYQA 3WXKA 1Z25A 3A5LC 4CFAA 1I3AA 2F4VK 4GNIA 4A5AA 3SJHA 1WSGA 2IVPA 4JKEA 1U2VB 5BR8K 1MWMA 3LZIA 3VQ8A 4CBWA 4MLHA 3I8DA 2AP1A 2BE2A 4BDYA 3EZ5A 4DQQA 4CESA 3W3DA 4FYDA 4OGCA 1NMNA 3A0IX
chains in the Genus database with same CATH topology
2E6MA 4FJJA 3DRSA 3AVNA 3OJUA 5K14A 4GW6A 3D45A 4W5QA 1LAWA 3T3FA 4FK4A 4PY5A 3QERA 3PX0A 3SCXA 4UQGA 4KHSA 4RW8A 1WSHA 3QIOA 3OYAA 3H08A 3M8SA 2XY5A 3G10A 1EETA 3ULDA 4JS4A 1RBSA 4CGJA 1SL2A 1U4BA 3V9ZA 4EP5A 4KI4A 3PY8A 4G1QA 3SV3A 1RTHA 1ZBFA 4HHTA 1XC9A 5FROA 3OY9A 4CJWA 1RT7A 5HBMA 3RWUA 3BGRA 4CEFA 3VQBA 4E7HA 1JLCA 1UOCA 3ZSYA 5DMRA 4C8NA 2YNHA 4MFBA 3HP6A 4I9QA 3DLKA 4F3TA 3L2RA 3AVLA 1O1WA 3ZT0A 5JS2A 2OZMA 3TAPA 1WNSA 1VSDA 3QETA 4J2DA 4NCGA 3AO1A 4M42A 4CEZA 3V9WA 4QCLA 3VQDA 5E41A 4K8ZA 2QKKA 4DTUA 4DTSA 5J2MA 1T7PA 4K8XA 2JLEA 3NGYA 3OS1A 3HL8A 4FLXA 4FJ7A 1BIZA 4OJRA 4CJUA 1X1PA 3SYZA 1QSSA 4J2AA 2YKMA 3TI0A 3AVFA 4BACA 1GOCA 2FBXA 2IS3A 1Q8IA 3V9SA 4HCCA 3DOLA 3MEDA 3AVJA 3HPOA 1LV5A 4DTJA 1Z26A 4HUFA 2PYJA 3P5JA 3B6PA 2JGUA 4IDKA 3RMDA 4XIUA 1IH7A 1J9AA 4W5RA 3NHGA 4DS5A 1B92A 4DSJA 4E3SA 3LP0A 4CIEA 3CFPA 1REVA 2OA8A 1TV6A 3TAGA 1XWLA 3ALYA 3K57A 1ZBHA 3OS0A 4KAZA 4N47A 3L2QA 4OGEA 4CF1A 3D0PA 3WNGA 3DLHA 2KZZA 1KSPA 2XY6A 1T03A 2OZSA 2DY4A 5FDLA 1HYZA 3T1AA 4KHWA 4FCYA 2RKIA 3ITHA 3NAEA 4CJRA 1JLGA 1RCHA 3VA0A 4YFUA 4CHPA 4CERA 3RR8A 4CGHA 3V1OA 1TKXA 2PY5A 3WNEA 4BWMA 4BDZA 3K2PA 1UA0A 4DFJA 5HLFA 4F8RA 5I3UA 3OYCA 3QNOA 3V81A 4DF8A 1S6QA 4FJXA 2ZE2A 5J1EA 2HNDA 2PZSA 1QTMA 1TL1A 1HYVA 1TL3A 2NUBA 4DS4A 3SQ1A 1A5WA 1BI4B 4DSFA 3KD5E 1NK6A 2X6NA 3WNFA 1BL3A 3OYFA 2X78A 4FJNA 3OYBA 3KKSA 3AO3A 4KB0A 2B4JA 1UA1A 4DQIA 4DSLA 1RT2A 4BDPA 4FW2A 5D3GA 1C1AA 4N76A 1EKEA 4RW7A 1NK9A 4KFBA 1TK0A 4DFPA 1RT1A 1BCMA 3IG1A 1CXQA 1Y97A 1BQMA 3OYHA 3O3HA 1SKRA 3CFOA 4DSKA 1JLAA 4FJGA 2YNFA 1RT5A 3LWLA 4B8AB 3AV9A 3IRXA 3C6UA 3HK2A 5KGWA 3HXMA 3KLHA 4B9UA 3AO5A 4QOZB 2KQ2A 2E4LA 2B5JA 4W5TA 3V9UA 3QEXA 1EX4A 2WOMA 4RW4A 3VQPA 4CHQA 4CF9A 3L2UA 3V6DA 4O5BA 3QEWA 3ISNC 1XHZA 1IO2A 4FJ8A 1HMVA 4O55A 4M3ZA 3EY1A 4QAGA 4FJIA 1S1WA 1VSIA 2G8IA 4FM2A 3RTVA 4DFKA 4HUEA 3DLGA 4B9SA 3CFRA 2YV0X 1NJXA 4PUOA 3U3GA 1HQUA 3P1GA 1R0AA 1X9WA 2G8HA 2YKNA 1J54A 3QINA 1FK9A 2FBVA 5J2NA 3VQCA 3HJFA 4PQUA 4H4MA 4Z4EA 4JS5A 4FLWA 4JRPA 4ELVA 3SUQA 4CGGA 4O0IA 1RT4A 2QXFA 1YT3A 4CF2A 1UWBA 5HRNA 4DU1A 3S3MA 4FJHA 1BGXT 4Z0UA 1VSEA 1ZBIA 3AVMA 1C1BA 3CYMA 5CZ1A 3TANA 4ZTJA 1RT6A 4FK2A 4DQSA 2HHUA 1YTUA 2ETJA 2ZD1A 1IKYA 4CJTA 4DG1A 3HO1A 4BE2A 4FLVA 2OPPA 4CJQA 4ICLA 3F9KA 4AHCA 1RBUA 4DTPA 2GUIA 1TVRA 3SUNA 1C6VA 4BWJA 4CK1A 3QEVA 3DLEA 4B9NA 4HCBA 4Z4CA 3OS2A 1JXBA 3KLGA 4KB1A 4B9MA 3ZT4A 3CM5A 1HRHA 4HTUA 2HHSA 1VSLA 3SQ2A 1KCFA 1G15A 3MXJA 4M3RA 4M3XA 4ELTA 5KI6A 1HQEA 3LWMA 2YNIA 4GMJB 1NK5A 1JLEA 1U49A 4CCHA 4N56A 3KLEA 2HVHA 1ITGA 3K58A 1VRUA 1NK7A 4AILC 1B9FA 1EP4A 4AHVA 4CJEA 4B9TA 3K5MA 3VQEA 4FXDA 1NJYA 2HHQA 2X6SA 1TK5A 5C25A 3MAQA 4RG8A 4CFBA 1FKOA 3AO2A 1N6QA 3RR7A 4IKFA 2KFZA 1D9FA 4FJKA 4KHNA 3DOKA 3V1QA 4I2QA 3TR8A 3K5NA 3JSMA 5HRPA 1CZ9A 3BDPA 4B9VA 2KZMA 1SV5A 4Y1CA 3DLRA 3RMCA 2XY8A 1ZBUA 1CXUA 2RN2A 2AJQA 3I0SA 4YNQA 4CGFA 3QIPA 1JL2A 5KRTA 4AHTA 3KTQA 4OLAA 3CQ8A 1WLJA 1KVBA 1WSJA 2KFNA 1FXXA 5HROA 2HNZA 1C0MA 4CJSA 3L8BA 4IFYA 5FRMA 2P5OA 2OPSA 2BANA 5SWMA 4I7FA 1VRTA 4I2PA 2A1SA 3HYFA 3O3GA 1SL0A 4OKKA 2G8UA 3LPTA 1KVCA 1JKHA 3AVCA 1RBVA 4O44A 3ZT1A 3UIQA 4Y1DA 1ASWA 1LWFA 1F21A 2VG6A 4N41A 1NJZA 3KIOA 4IG0A 1TAUA 3JYTA 4M41A 4OKEA 4CJ4A 4F2SA 4CHNA 2D0AA 3DRRA 3SUPA 3AA2A 3RMAA 3M8PA 3KJVA 4DMNA 2RF2A 3SNNA 3SPYA 1WAFA 3LALA 4LD0A 2QK9A 3AO4A 1NOZA 1J5OA 3NCIA 1NJWA 4LH4A 4Q0BA 3ZSOA 2A1RA 1SL1A 3OYIA 2XO7A 4DTXA 4B3OA 1ASVA 4OPKA 1SUQA 2DFHA 3LDSA 1S9GA 1LWEA 1ASUA 4CF8A 2P1JA 4NYNA 4LSNA 2KW4A 3HPHA 4CHZA 4FM0A 1XHXA 3OYNA 3S3NA 1QSYA 4OLBA 2IAJA 3WNHA 3VQ4A 1LAVA 1VSHA 3NF6A 4CFDA 4E7KA 2P5GA 3NFAA 1TAQA 1QS4A 4DFMA 4HUGA 3QO9A 4ID1A 2KTQA 1ZBLA 1MU2A 4CF0A 1Q9YA 4FLYA 2XY7A 2P51A 1U04A 4C8MA 2F8TA 3HPGA 3L3VA 3OYDA 3ZSQA 1NKEA 2HB5A 1S9EA 4AHSA 1RDDA 5CYQA 4FVMA 4HVJA 4ZTFA 1XI1A 4IBNA 3G0ZA 1RTJA 4IFVA 5J2PA 1RNHA 3VN5A 1KVAA 1S1VA 4JRQA 3V9XA 4EP4A 4FLTA 3LZJA 1NK0A 3VA3A 3A2FA 3F73A 3I0RA 1UAXA 2I5JA 3OVNA 5I42A 1WAJA 3L2WA 3U3YA 1L3SA 4DSIA 3DI6A 3HVTA 3NF8A 4DQRA 2XHBA 2X74A 3E01A 3K5OA 4H8KA 4DF4A 1HJRA 4FZZA 1KFDA 5KGXA 1C1CA 3O3FA 4DTRA 2G8VA 4CGIA 2ATQA 1NKCA 3VQAA 4EZ6A 1VK0A 1SKSA 5HRSA 4M3TA 4W5OA 2BGGA 3M8QA 3KK2A 1JL1A 2D0CA 4DLEA 4E7IA 3SPZA 1TK8A 4NCAA 4MQ3A 4F4KA 2IC3A 2R7YA 1VSKA 1KTQA 1A5VA 1JLFA 4CJKA 4OPJA 2Z1HA 3OYJA 4FW1A 4CJ5A 4DTOA 4KPYA 4CJVA 1RDCA 1VSMA 4JLHA 4DTNA 3O4NA 2ITGA 3NE6A 1LW0A 4CHOA 1N5YA 3QNNA 2Q3SA 5HP1A 3OJSA 5HRRA 4KTQA 1TGOA 4Z4HA 3NH2A 2HMIA 1U48A 1Q9XA 1WSIA 1WN7A 1DTQA 2YHBA 3VQQA 4BE0A 5C24A 1EXQA 4KHUA 2FBTA 3DYAA 4ID5A 2DFEA 4B08A 4PA1A 3B6OA 4FLZA 1L3UA 1RILA 2YNGA 4KI6A 4B9LA 1RDAA 1A5XA 4CEBA 1DTTA 2EX3A 4L8RB 2RPIA 4AH9A 4R5PA 3TAMA 1D8YA 2F8SA 1JLQA 2FBYA 1L5UA 1GOAA 1RDBA 5J2QA 4ZHRA 3PX4A 3NF7A 2DTUA 5JS1A 3OYKA 4KO0A 1S1TA 4CJ3A 3HVRA 4CK2A 4CE9A 1T8EA 2PYLA 3PO4A 1VSFA 3AA5X 1W0HA 1IG9A 1KRPA 3C95A 2OYQA 1VSJA 4WE1A 3TWHA 2O4IA 2D5RA 4AHUA 3NH1A 4B8CA 3V4IA 3AVKA 1BHLA 1HNIA 4RW9A 4CEDA 2VWJA 1B9DA 1J53A 4CIFA 3DMJA 1C0UA 4NCBA 1K6YA 1IKVA 1HNVA 3AVGA 3PV8A 3KLIA 3ZSWA 2HW3A 1QHTA 4E1NA 4KTWA 4CEQA 3LPUA 1RBTA 3QEIA 3K5LA 3AVAA 2VWKA 1L3TA 4ELUA 4OKJA 1QSLA 4M3YA 4PWDA 3ZSVA 3NF9A 4DLGA 4E7LA 4FJMA 2GV9A 4E7JA 4DU3A 3ZSRA 2Y1IA 4E89A 2G8KA 3MEEA 3SQ4A 4AHRA 1QE1A 3OYGA 3OYMA 3KK3A 3PUFA 4CK3A 3HM9A 3NDKA 4C8KA 2Z1JA 2HHVA 3NBPA 1JLBA 1S6PA 1GOBA 2B6AA 5DK5A 4RW6A 2HHXA 1RBRA 4CHYA 1C0TA 1KLMA 3SV4A 1S1XA 1BIUA 2W42A 1D5AA 3KD1E 4N5SA 3C6TA 1BQNA 3NH0A 4O4GA 3T19A 3AVIA 3RRHA 1RTDA 1KLNA 1I39A 1CLQA 3AVBA 2IOCA 1IKXA 1T05A 4E1MA 2VG7A 1HYSA 3VQ5A 3QLHA 3K59A 3S3OA 3MEGA 2VG5A 4FZXC 4KHYA 4DTMA 3AA3A 3VQ9A 4TSXA 1D9DA 2OPQA 4KKOA 3THVA 4NYFA 3KK1A 1SKWA 3RRGA 4FLUA 5CY4A 4FK0A 4FJ9A 4J2EA 3NGZA 2DFFA 4E0DA 3MECA 2Y1JA 1TKTA 3TAQA 4W5NA 3L3UA 3DRPA 4OVLA 4CECA 3SZ2A 4DU4A 3TAFA 1WSEA 1X9SA 2G8WA 4CFCA 4CEAA 4KRFA 2HHTA 1BCOA 3RMBA 3CG7A 1BI4A 1WSFA 3IS9A 1HPZA 4F3OA 4CIGA 2D0BA 3KLFA 1LW2A 1L3VA 3MXMA 1FKPA 5SZTA 4CEEA 3VQ7A 4DSEA 3TAEA 4FJLA 4KV8A 3LANA 4O0JA 3TARA 3P83D 2FC0A 4DQPA 1S5JA 3O4QA 1ZYQA 2GBZA 2WONA 3ZT2A 1IKWA 4LH5A 4IG3A 4LSLA 4CEOA 3ASMA 3PO5A 2HHWA 3LAMA 4Z4IA 3CM6A 3ZSXA 4F2RA 1NOYA 3OYLA 2BDPA 3AA4A 4CJLA 3IAYA 3ZSZA 3V1RA 2XRIA 3S9HA 3SJJA 1X9MA 1QQCA 1CZBA 1TKDA 2OPRA 4Z4FA 3SQ0A 1NKBA 2F96A 1DLOA 3AVHA 3LP2A 4M45A 3SI6A 1YVUA 1RT3A 2YHAA 4M3UA 3M8RA 2ZQBA 4GVMA 1NK4A 5EU7A 2Z1GA 3KKRA 1S1UA 3DM2A 3LAKA 3NGIA 4I9LA 3MXIA 3SUOA 3EYZA 2IGIA 5KRSA 4C8OA 3TABA 1W9HA 3FFIA 2O4GA 2G8FA 4C8LA 4EZ9A 1RTIA 4Q5VA 3QESA 1TKZA 4BE1A 1NK8A 5KTQA 3HP9A 5FRNA 3DLBA 3HSTB 2EHGA 4CJPA 3L2VA 3U6FA 1BISA 5T7BA 2E6LA 5C42A 1U47A 2QKBA 3HT3A 3OYEA 3PX6A 2LSNA 5CYMA 4FZYA 3C94A 3VQ6A 1Z25A 4CFAA 4KREA 1KFSA 3QEPA 1I3AA 2HNYA 2IDOA 4Z4GA 1YTAA 3ZCMA 1WSGA 2HVIA 3LP1A 4CGDA 4E19A 4KHQA 5CZ2A 4LY7A 3LP3A 4H4OA 3LZIA 3ZT3A 4J2BA 1LWCA 3VQ8A 4FM1A 3I8DA 2BE2A 4BDYA 4DQQA 3EZ5A 1JXEA 4CJFA 4DWIA 4CESA 1U45A 4FJ5A 2Z1IA 4M3WA 4KTZA 4FYDA 4OGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6M A;  4FJJ A;  3DRS A;  3AVN A;  3OJU A;  5K14 A;  4GW6 A;  3D45 A;  4W5Q A;  1LAW A;  3T3F A;  4FK4 A;  4PY5 A;  3QER A;  3PX0 A;  3SCX A;  4UQG A;  4KHS A;  4RW8 A;  1WSH A;  3QIO A;  3OYA A;  3H08 A;  3M8S A;  2XY5 A;  3G10 A;  1EET A;  3ULD A;  4JS4 A;  1RBS A;  4CGJ A;  1SL2 A;  1U4B A;  3V9Z A;  4EP5 A;  4KI4 A;  3PY8 A;  4G1Q A;  3SV3 A;  1RTH A;  1ZBF A;  4HHT A;  1XC9 A;  5FRO A;  3OY9 A;  4CJW A;  1RT7 A;  5HBM A;  3RWU A;  3BGR A;  4CEF A;  3VQB A;  4E7H A;  1JLC A;  1UOC A;  3ZSY A;  5DMR A;  4C8N A;  2YNH A;  4MFB A;  3HP6 A;  4I9Q A;  3DLK A;  4F3T A;  3L2R A;  3AVL A;  1O1W A;  3ZT0 A;  5JS2 A;  2OZM A;  3TAP A;  1WNS A;  1VSD A;  3QET A;  4J2D A;  4NCG A;  3AO1 A;  4M42 A;  4CEZ A;  3V9W A;  4QCL A;  3VQD A;  5E41 A;  4K8Z A;  2QKK A;  4DTU A;  4DTS A;  5J2M A;  1T7P A;  4K8X A;  2JLE A;  3NGY A;  3OS1 A;  3HL8 A;  4FLX A;  4FJ7 A;  1BIZ A;  4OJR A;  4CJU A;  1X1P A;  3SYZ A;  1QSS A;  4J2A A;  2YKM A;  3TI0 A;  3AVF A;  4BAC A;  1GOC A;  2FBX A;  2IS3 A;  1Q8I A;  3V9S A;  4HCC A;  3DOL A;  3MED A;  3AVJ A;  3HPO A;  1LV5 A;  4DTJ A;  1Z26 A;  4HUF A;  2PYJ A;  3P5J A;  3B6P A;  2JGU A;  4IDK A;  3RMD A;  4XIU A;  1IH7 A;  1J9A A;  4W5R A;  3NHG A;  4DS5 A;  1B92 A;  4DSJ A;  4E3S A;  3LP0 A;  4CIE A;  3CFP A;  1REV A;  2OA8 A;  1TV6 A;  3TAG A;  1XWL A;  3ALY A;  3K57 A;  1ZBH A;  3OS0 A;  4KAZ A;  4N47 A;  3L2Q A;  4OGE A;  4CF1 A;  3D0P A;  3WNG A;  3DLH A;  2KZZ A;  1KSP A;  2XY6 A;  1T03 A;  2OZS A;  2DY4 A;  5FDL A;  1HYZ A;  3T1A A;  4KHW A;  4FCY A;  2RKI A;  3ITH A;  3NAE A;  4CJR A;  1JLG A;  1RCH A;  3VA0 A;  4YFU A;  4CHP A;  4CER A;  3RR8 A;  4CGH A;  3V1O A;  1TKX A;  2PY5 A;  3WNE A;  4BWM A;  4BDZ A;  3K2P A;  1UA0 A;  4DFJ A;  5HLF A;  4F8R A;  5I3U A;  3OYC A;  3QNO A;  3V81 A;  4DF8 A;  1S6Q A;  4FJX A;  2ZE2 A;  5J1E A;  2HND A;  2PZS A;  1QTM A;  1TL1 A;  1HYV A;  1TL3 A;  2NUB A;  4DS4 A;  3SQ1 A;  1A5W A;  1BI4 B;  4DSF A;  3KD5 E;  1NK6 A;  2X6N A;  3WNF A;  1BL3 A;  3OYF A;  2X78 A;  4FJN A;  3OYB A;  3KKS A;  3AO3 A;  4KB0 A;  2B4J A;  1UA1 A;  4DQI A;  4DSL A;  1RT2 A;  4BDP A;  4FW2 A;  5D3G A;  1C1A A;  4N76 A;  1EKE A;  4RW7 A;  1NK9 A;  4KFB A;  1TK0 A;  4DFP A;  1RT1 A;  1BCM A;  3IG1 A;  1CXQ A;  1Y97 A;  1BQM A;  3OYH A;  3O3H A;  1SKR A;  3CFO A;  4DSK A;  1JLA A;  4FJG A;  2YNF A;  1RT5 A;  3LWL A;  4B8A B;  3AV9 A;  3IRX A;  3C6U A;  3HK2 A;  5KGW A;  3HXM A;  3KLH A;  4B9U A;  3AO5 A;  4QOZ B;  2KQ2 A;  2E4L A;  2B5J A;  4W5T A;  3V9U A;  3QEX A;  1EX4 A;  2WOM A;  4RW4 A;  3VQP A;  4CHQ A;  4CF9 A;  3L2U A;  3V6D A;  4O5B A;  3QEW A;  3ISN C;  1XHZ A;  1IO2 A;  4FJ8 A;  1HMV A;  4O55 A;  4M3Z A;  3EY1 A;  4QAG A;  4FJI A;  1S1W A;  1VSI A;  2G8I A;  4FM2 A;  3RTV A;  4DFK A;  4HUE A;  3DLG A;  4B9S A;  3CFR A;  2YV0 X;  1NJX A;  4PUO A;  3U3G A;  1HQU A;  3P1G A;  1R0A A;  1X9W A;  2G8H A;  2YKN A;  1J54 A;  3QIN A;  1FK9 A;  2FBV A;  5J2N A;  3VQC A;  3HJF A;  4PQU A;  4H4M A;  4Z4E A;  4JS5 A;  4FLW A;  4JRP A;  4ELV A;  3SUQ A;  4CGG A;  4O0I A;  1RT4 A;  2QXF A;  1YT3 A;  4CF2 A;  1UWB A;  5HRN A;  4DU1 A;  3S3M A;  4FJH A;  1BGX T;  4Z0U A;  1VSE A;  1ZBI A;  3AVM A;  1C1B A;  3CYM A;  5CZ1 A;  3TAN A;  4ZTJ A;  1RT6 A;  4FK2 A;  4DQS A;  2HHU A;  1YTU A;  2ETJ A;  2ZD1 A;  1IKY A;  4CJT A;  4DG1 A;  3HO1 A;  4BE2 A;  4FLV A;  2OPP A;  4CJQ A;  4ICL A;  3F9K A;  4AHC A;  1RBU A;  4DTP A;  2GUI A;  1TVR A;  3SUN A;  1C6V A;  4BWJ A;  4CK1 A;  3QEV A;  3DLE A;  4B9N A;  4HCB A;  4Z4C A;  3OS2 A;  1JXB A;  3KLG A;  4KB1 A;  4B9M A;  3ZT4 A;  3CM5 A;  1HRH A;  4HTU A;  2HHS A;  1VSL A;  3SQ2 A;  1KCF A;  1G15 A;  3MXJ A;  4M3R A;  4M3X A;  4ELT A;  5KI6 A;  1HQE A;  3LWM A;  2YNI A;  4GMJ B;  1NK5 A;  1JLE A;  1U49 A;  4CCH A;  4N56 A;  3KLE A;  2HVH A;  1ITG A;  3K58 A;  1VRU A;  1NK7 A;  4AIL C;  1B9F A;  1EP4 A;  4AHV A;  4CJE A;  4B9T A;  3K5M A;  3VQE A;  4FXD A;  1NJY A;  2HHQ A;  2X6S A;  1TK5 A;  5C25 A;  3MAQ A;  4RG8 A;  4CFB A;  1FKO A;  3AO2 A;  1N6Q A;  3RR7 A;  4IKF A;  2KFZ A;  1D9F A;  4FJK A;  4KHN A;  3DOK A;  3V1Q A;  4I2Q A;  3TR8 A;  3K5N A;  3JSM A;  5HRP A;  1CZ9 A;  3BDP A;  4B9V A;  2KZM A;  1SV5 A;  4Y1C A;  3DLR A;  3RMC A;  2XY8 A;  1ZBU A;  1CXU A;  2RN2 A;  2AJQ A;  3I0S A;  4YNQ A;  4CGF A;  3QIP A;  1JL2 A;  5KRT A;  4AHT A;  3KTQ A;  4OLA A;  3CQ8 A;  1WLJ A;  1KVB A;  1WSJ A;  2KFN A;  1FXX A;  5HRO A;  2HNZ A;  1C0M A;  4CJS A;  3L8B A;  4IFY A;  5FRM A;  2P5O A;  2OPS A;  2BAN A;  5SWM A;  4I7F A;  1VRT A;  4I2P A;  2A1S A;  3HYF A;  3O3G A;  1SL0 A;  4OKK A;  2G8U A;  3LPT A;  1KVC A;  1JKH A;  3AVC A;  1RBV A;  4O44 A;  3ZT1 A;  3UIQ A;  4Y1D A;  1ASW A;  1LWF A;  1F21 A;  2VG6 A;  4N41 A;  1NJZ A;  3KIO A;  4IG0 A;  1TAU A;  3JYT A;  4M41 A;  4OKE A;  4CJ4 A;  4F2S A;  4CHN A;  2D0A A;  3DRR A;  3SUP A;  3AA2 A;  3RMA A;  3M8P A;  3KJV A;  4DMN A;  2RF2 A;  3SNN A;  3SPY A;  1WAF A;  3LAL A;  4LD0 A;  2QK9 A;  3AO4 A;  1NOZ A;  1J5O A;  3NCI A;  1NJW A;  4LH4 A;  4Q0B A;  3ZSO A;  2A1R A;  1SL1 A;  3OYI A;  2XO7 A;  4DTX A;  4B3O A;  1ASV A;  4OPK A;  1SUQ A;  2DFH A;  3LDS A;  1S9G A;  1LWE A;  1ASU A;  4CF8 A;  2P1J A;  4NYN A;  4LSN A;  2KW4 A;  3HPH A;  4CHZ A;  4FM0 A;  1XHX A;  3OYN A;  3S3N A;  1QSY A;  4OLB A;  2IAJ A;  3WNH A;  3VQ4 A;  1LAV A;  1VSH A;  3NF6 A;  4CFD A;  4E7K A;  2P5G A;  3NFA A;  1TAQ A;  1QS4 A;  4DFM A;  4HUG A;  3QO9 A;  4ID1 A;  2KTQ A;  1ZBL A;  1MU2 A;  4CF0 A;  1Q9Y A;  4FLY A;  2XY7 A;  2P51 A;  1U04 A;  4C8M A;  2F8T A;  3HPG A;  3L3V A;  3OYD A;  3ZSQ A;  1NKE A;  2HB5 A;  1S9E A;  4AHS A;  1RDD A;  5CYQ A;  4FVM A;  4HVJ A;  4ZTF A;  1XI1 A;  4IBN A;  3G0Z A;  1RTJ A;  4IFV A;  5J2P A;  1RNH A;  3VN5 A;  1KVA A;  1S1V A;  4JRQ A;  3V9X A;  4EP4 A;  4FLT A;  3LZJ A;  1NK0 A;  3VA3 A;  3A2F A;  3F73 A;  3I0R A;  1UAX A;  2I5J A;  3OVN A;  5I42 A;  1WAJ A;  3L2W A;  3U3Y A;  1L3S A;  4DSI A;  3DI6 A;  3HVT A;  3NF8 A;  4DQR A;  2XHB A;  2X74 A;  3E01 A;  3K5O A;  4H8K A;  4DF4 A;  1HJR A;  4FZZ A;  1KFD A;  5KGX A;  1C1C A;  3O3F A;  4DTR A;  2G8V A;  4CGI A;  2ATQ A;  1NKC A;  3VQA A;  4EZ6 A;  1VK0 A;  1SKS A;  5HRS A;  4M3T A;  4W5O A;  2BGG A;  3M8Q A;  3KK2 A;  1JL1 A;  2D0C A;  4DLE A;  4E7I A;  3SPZ A;  1TK8 A;  4NCA A;  4MQ3 A;  4F4K A;  2IC3 A;  2R7Y A;  1VSK A;  1KTQ A;  1A5V A;  1JLF A;  4CJK A;  4OPJ A;  2Z1H A;  3OYJ A;  4FW1 A;  4CJ5 A;  4DTO A;  4KPY A;  4CJV A;  1RDC A;  1VSM A;  4JLH A;  4DTN A;  3O4N A;  2ITG A;  3NE6 A;  1LW0 A;  4CHO A;  1N5Y A;  3QNN A;  2Q3S A;  5HP1 A;  3OJS A;  5HRR A;  4KTQ A;  1TGO A;  4Z4H A;  3NH2 A;  2HMI A;  1U48 A;  1Q9X A;  1WSI A;  1WN7 A;  1DTQ A;  2YHB A;  3VQQ A;  4BE0 A;  5C24 A;  1EXQ A;  4KHU A;  2FBT A;  3DYA A;  4ID5 A;  2DFE A;  4B08 A;  4PA1 A;  3B6O A;  4FLZ A;  1L3U A;  1RIL A;  2YNG A;  4KI6 A;  4B9L A;  1RDA A;  1A5X A;  4CEB A;  1DTT A;  2EX3 A;  4L8R B;  2RPI A;  4AH9 A;  4R5P A;  3TAM A;  1D8Y A;  2F8S A;  1JLQ A;  2FBY A;  1L5U A;  1GOA A;  1RDB A;  5J2Q A;  4ZHR A;  3PX4 A;  3NF7 A;  2DTU A;  5JS1 A;  3OYK A;  4KO0 A;  1S1T A;  4CJ3 A;  3HVR A;  4CK2 A;  4CE9 A;  1T8E A;  2PYL A;  3PO4 A;  1VSF A;  3AA5 X;  1W0H A;  1IG9 A;  1KRP A;  3C95 A;  2OYQ A;  1VSJ A;  4WE1 A;  3TWH A;  2O4I A;  2D5R A;  4AHU A;  3NH1 A;  4B8C A;  3V4I A;  3AVK A;  1BHL A;  1HNI A;  4RW9 A;  4CED A;  2VWJ A;  1B9D A;  1J53 A;  4CIF A;  3DMJ A;  1C0U A;  4NCB A;  1K6Y A;  1IKV A;  1HNV A;  3AVG A;  3PV8 A;  3KLI A;  3ZSW A;  2HW3 A;  1QHT A;  4E1N A;  4KTW A;  4CEQ A;  3LPU A;  1RBT A;  3QEI A;  3K5L A;  3AVA A;  2VWK A;  1L3T A;  4ELU A;  4OKJ A;  1QSL A;  4M3Y A;  4PWD A;  3ZSV A;  3NF9 A;  4DLG A;  4E7L A;  4FJM A;  2GV9 A;  4E7J A;  4DU3 A;  3ZSR A;  2Y1I A;  4E89 A;  2G8K A;  3MEE A;  3SQ4 A;  4AHR A;  1QE1 A;  3OYG A;  3OYM A;  3KK3 A;  3PUF A;  4CK3 A;  3HM9 A;  3NDK A;  4C8K A;  2Z1J A;  2HHV A;  3NBP A;  1JLB A;  1S6P A;  1GOB A;  2B6A A;  5DK5 A;  4RW6 A;  2HHX A;  1RBR A;  4CHY A;  1C0T A;  1KLM A;  3SV4 A;  1S1X A;  1BIU A;  2W42 A;  1D5A A;  3KD1 E;  4N5S A;  3C6T A;  1BQN A;  3NH0 A;  4O4G A;  3T19 A;  3AVI A;  3RRH A;  1RTD A;  1KLN A;  1I39 A;  1CLQ A;  3AVB A;  2IOC A;  1IKX A;  1T05 A;  4E1M A;  2VG7 A;  1HYS A;  3VQ5 A;  3QLH A;  3K59 A;  3S3O A;  3MEG A;  2VG5 A;  4FZX C;  4KHY A;  4DTM A;  3AA3 A;  3VQ9 A;  4TSX A;  1D9D A;  2OPQ A;  4KKO A;  3THV A;  4NYF A;  3KK1 A;  1SKW A;  3RRG A;  4FLU A;  5CY4 A;  4FK0 A;  4FJ9 A;  4J2E A;  3NGZ A;  2DFF A;  4E0D A;  3MEC A;  2Y1J A;  1TKT A;  3TAQ A;  4W5N A;  3L3U A;  3DRP A;  4OVL A;  4CEC A;  3SZ2 A;  4DU4 A;  3TAF A;  1WSE A;  1X9S A;  2G8W A;  4CFC A;  4CEA A;  4KRF A;  2HHT A;  1BCO A;  3RMB A;  3CG7 A;  1BI4 A;  1WSF A;  3IS9 A;  1HPZ A;  4F3O A;  4CIG A;  2D0B A;  3KLF A;  1LW2 A;  1L3V A;  3MXM A;  1FKP A;  5SZT A;  4CEE A;  3VQ7 A;  4DSE A;  3TAE A;  4FJL A;  4KV8 A;  3LAN A;  4O0J A;  3TAR A;  3P83 D;  2FC0 A;  4DQP A;  1S5J A;  3O4Q A;  1ZYQ A;  2GBZ A;  2WON A;  3ZT2 A;  1IKW A;  4LH5 A;  4IG3 A;  4LSL A;  4CEO A;  3ASM A;  3PO5 A;  2HHW A;  3LAM A;  4Z4I A;  3CM6 A;  3ZSX A;  4F2R A;  1NOY A;  3OYL A;  2BDP A;  3AA4 A;  4CJL A;  3IAY A;  3ZSZ A;  3V1R A;  2XRI A;  3S9H A;  3SJJ A;  1X9M A;  1QQC A;  1CZB A;  1TKD A;  2OPR A;  4Z4F A;  3SQ0 A;  1NKB A;  2F96 A;  1DLO A;  3AVH A;  3LP2 A;  4M45 A;  3SI6 A;  1YVU A;  1RT3 A;  2YHA A;  4M3U A;  3M8R A;  2ZQB A;  4GVM A;  1NK4 A;  5EU7 A;  2Z1G A;  3KKR A;  1S1U A;  3DM2 A;  3LAK A;  3NGI A;  4I9L A;  3MXI A;  3SUO A;  3EYZ A;  2IGI A;  5KRS A;  4C8O A;  3TAB A;  1W9H A;  3FFI A;  2O4G A;  2G8F A;  4C8L A;  4EZ9 A;  1RTI A;  4Q5V A;  3QES A;  1TKZ A;  4BE1 A;  1NK8 A;  5KTQ A;  3HP9 A;  5FRN A;  3DLB A;  3HST B;  2EHG A;  4CJP A;  3L2V A;  3U6F A;  1BIS A;  5T7B A;  2E6L A;  5C42 A;  1U47 A;  2QKB A;  3HT3 A;  3OYE A;  3PX6 A;  2LSN A;  5CYM A;  4FZY A;  3C94 A;  3VQ6 A;  1Z25 A;  4CFA A;  4KRE A;  1KFS A;  3QEP A;  1I3A A;  2HNY A;  2IDO A;  4Z4G A;  1YTA A;  3ZCM A;  1WSG A;  2HVI A;  3LP1 A;  4CGD A;  4E19 A;  4KHQ A;  5CZ2 A;  4LY7 A;  3LP3 A;  4H4O A;  3LZI A;  3ZT3 A;  4J2B A;  1LWC A;  3VQ8 A;  4FM1 A;  3I8D A;  2BE2 A;  4BDY A;  4DQQ A;  3EZ5 A;  1JXE A;  4CJF A;  4DWI A;  4CES A;  1U45 A;  4FJ5 A;  2Z1I A;  4M3W A;  4KTZ A;  4FYD A;  4OGC A; 
#chains in the Genus database with same CATH topology
 3VEN A;  1QZ6 A;  3AVN A;  3OJU A;  5K14 A;  4GW6 A;  2ZJQ L;  3UKR B;  4PY5 A;  4UQG A;  3OYA A;  3LDP A;  3M8S A;  1EQY A;  4JS4 A;  4KI4 A;  4G1Q A;  4HHT A;  4AF1 A;  3GDQ A;  3OY9 A;  1RT7 A;  2NRV A;  3ENO A;  3VQB A;  4DR7 K;  2Q1N A;  4MFB A;  2YJF A;  3HP6 A;  3U8X A;  4F3T A;  3I8B A;  3AO1 A;  4M42 A;  4DQ8 A;  3V9W A;  3VQD A;  4K8Z A;  2QKK A;  5J2M A;  3O9U A;  3ULE B;  4K8X A;  2QWL A;  2JLE A;  3OS1 A;  4CZM A;  3HL8 A;  3LM2 A;  1BIZ A;  4OJR A;  4CJU A;  1DT9 A;  3SYZ A;  2YKM A;  3AVF A;  4JKD A;  4BAC A;  4ILJ A;  2PYJ A;  2JGU A;  2O8F B;  4W5R A;  4DSJ A;  3LP0 A;  3GE1 A;  1NLV A;  4CIE A;  2OA8 A;  2Q0U A;  1XWL A;  2D0P A;  3ALY A;  3K57 A;  4CJ7 A;  2E2O A;  4JI3 K;  2P9U A;  3OS0 A;  3OHR A;  4EFH A;  3D0P A;  3DLH A;  2KZZ A;  2OZS A;  1SQK A;  5FDL A;  4KHW A;  2ZGY A;  3NAE A;  3JS6 A;  4YFU A;  2IVN A;  3V1O A;  1VQ4 N;  5AJ3 K;  3K2P A;  1I94 K;  3O08 A;  3V81 A;  1S6Q A;  2ZE2 A;  5AQK A;  1S22 A;  1TL1 A;  1HYV A;  4BR5 A;  2X6N A;  1Q81 O;  4NLC A;  3WNF A;  4YOV A;  4BY9 C;  4BR0 A;  1FW6 A;  2Q2R A;  3KKS A;  4DQI A;  4DSL A;  4CZL A;  4N76 A;  1EKE A;  4RW7 A;  1DKG D;  3R9P A;  5C12 A;  4GV3 A;  4YDU A;  1BCM A;  3BF1 A;  3O3H A;  4JI4 K;  1SKR A;  4DSK A;  2ASM A;  1BDG A;  4B8A B;  3G71 N;  4DR1 K;  3IRX A;  3C6U A;  3M1F A;  5KGW A;  4U67 L;  3J80 O;  4W5T A;  4DCH A;  4CF9 A;  1XHZ A;  3ISN C;  5M1K A;  3EY1 A;  3ZEU A;  4FM2 A;  3RTV A;  4DFK A;  4HUE A;  1E3M A;  5C2F A;  2E1Z A;  4RWT A;  1X9W A;  2G8H A;  3QIN A;  1HKC A;  3GG4 A;  4H4M A;  4FLW A;  4JRP A;  3PO4 A;  2QXF A;  4CF2 A;  4E1J A;  3T69 A;  1VSE A;  3QBX A;  3AVM A;  3CCL N;  3RSE B;  1HKB A;  2O8C B;  4BE2 A;  1NG9 A;  2OPP A;  4CJQ A;  3SUN A;  1TVR A;  4CZI A;  4C23 A;  3OS2 A;  1YF5 L;  4JKA A;  3KLG A;  4EHU A;  3ZT4 A;  3CM5 A;  3CJ1 A;  1KCF A;  1G15 A;  3OA9 A;  4M3R A;  2FF6 A;  3MDQ A;  1NK7 A;  4AHV A;  4B9T A;  3K5M A;  3VQE A;  2HHQ A;  3ZX0 A;  1ATS A;  2YI1 A;  3MAQ A;  4CFB A;  1FKO A;  3KK7 A;  5KPZ A;  4YOU A;  3TR8 A;  4EHT A;  3JSM A;  1NGB A;  1CZ9 A;  3BDP A;  3FFK B;  3RMC A;  3I0S A;  4CGF A;  1JL2 A;  5TKY A;  3VOV A;  3KTQ A;  4B1V A;  3IDH A;  3CQ8 A;  4BC2 A;  2A3Z A;  5CR4 A;  4CJS A;  3KWG A;  4BQL A;  2P5O A;  3BEX A;  4FPA A;  3VGK A;  4I7F A;  3HTV A;  3HYF A;  4KH6 A;  4OKK A;  4O44 A;  4FWS A;  4Y1D A;  4NXM K;  3QB0 A;  3THY A;  3AGK A;  3JYT A;  2D0A A;  3DRR A;  3SUP A;  3RMA A;  3M8P A;  4DMN A;  2QXL A;  4IWV A;  3CCE N;  3SPY A;  2QK9 A;  3AO4 A;  3QFU A;  1J5O A;  3NCI A;  3E1Y A;  3ZSO A;  5AQZ A;  1ASV A;  4OPK A;  4WFN L;  3LDS A;  4CF8 A;  2P1J A;  3HPH A;  4CHZ A;  4JI1 K;  3CJC A;  3WNH A;  3VQ4 A;  4AM6 A;  5BRH A;  4CFD A;  4CD3 A;  1QZ5 A;  1QS4 A;  4HUG A;  3QO9 A;  1SAZ A;  1MU2 A;  4CD1 A;  4FLY A;  2P51 A;  1U04 A;  3OYD A;  2ZJR L;  3ZSQ A;  5CYQ A;  3BUZ B;  2ZF5 O;  3G0Z A;  4IFV A;  1RNH A;  1S1V A;  3V9X A;  2P9K A;  4EP4 A;  3R1X A;  3F73 A;  2W6L A;  4FO0 A;  2QWO A;  3DI6 A;  5LJV A;  4H8K A;  4EIA A;  5KGX A;  3FZH A;  2G8V A;  4DR4 K;  1U2V A;  5HRS A;  3M8Q A;  1JL1 A;  4F4K A;  1YIT N;  2IC3 A;  1XNQ K;  2QWQ A;  1RDU A;  4FW1 A;  2YHW A;  4CJV A;  2V52 B;  5KPT A;  1TUY A;  3WEE B;  3QNN A;  3C6A A;  3UKR A;  5HRR A;  4Z4H A;  3NH2 A;  2GWJ A;  4FSV A;  1U48 A;  1WN7 A;  2YHB A;  1DTQ A;  4BE0 A;  4KHU A;  1WUA A;  3DYA A;  4F9O A;  1O13 A;  2JWL A;  4B08 A;  5LJW A;  1VQM N;  3CCR N;  1RIL A;  2YNG A;  4H0X B;  4B9L A;  4CEB A;  4U7B A;  1DTT A;  2RPI A;  1D8Y A;  3ATV A;  1JLQ A;  1RDB A;  2DTU A;  2E8A A;  4O5F A;  5AQX A;  3WXI A;  3AA5 X;  1W0H A;  1KRP A;  2YJE A;  4B8C A;  2QI2 A;  4BRI A;  5AFU H;  4RW9 A;  1HNI A;  1B9D A;  1J53 A;  1K6Y A;  1JCG A;  1NGJ A;  2W41 A;  3O9R A;  1Q82 O;  5AQM A;  3H3O B;  4ELU A;  4OKJ A;  4BR2 A;  1YI2 N;  3NF9 A;  1GLL O;  2GV9 A;  4FWR A;  2E2Q A;  3CC2 N;  2O8F A;  3SQ4 A;  2YX6 A;  1VQN N;  4OPH A;  2Z1J A;  2HHV A;  1QVF M;  2B6A A;  5BPN A;  1GOB A;  3FE1 A;  1VQ9 N;  4HTL A;  1KLM A;  3SV4 A;  3MN5 A;  4DV2 K;  4IXC A;  4N5S A;  3RRH A;  3MCA B;  3KVG A;  2VG7 A;  4MLE A;  5AQT A;  3DXK A;  4NO7 A;  3VQ9 A;  3RRG A;  4FJ9 A;  3KK1 A;  3O5B A;  1DEJ A;  1NM1 A;  4C1N I;  5LY3 A;  3MEC A;  2Y1J A;  3DRP A;  4OVL A;  3SZ2 A;  4CFC A;  4CEA A;  5ADX A;  4MO5 A;  3RMB A;  4ISG A;  4FOI A;  1S3X A;  1KAY A;  3MWP A;  2D0B A;  2Q31 A;  3T7Z A;  3MXM A;  3LM9 A;  1LCU A;  3TPQ A;  4O0J A;  3P83 D;  3K0S A;  4DQP A;  4LH5 A;  3ASM A;  4LFC K;  4F2R A;  1NOY A;  2BDP A;  2BUP A;  3VEY A;  3ZSZ A;  1VQ8 N;  1NGH A;  4M7Y A;  2XRI A;  3V1R A;  3S9H A;  3SJJ A;  1X9M A;  1VQK N;  2F96 A;  3AVH A;  3LP2 A;  4BG8 A;  1VQO N;  3SI6 A;  4JKG A;  3M8R A;  3FZL A;  1NK4 A;  3VF4 A;  1RDW X;  3LAK A;  4I9L A;  3EYZ A;  3TAB A;  4H0O A;  4C8L A;  5HL7 L;  2G8F A;  5A2Q O;  3QES A;  5AQY A;  4BE1 A;  3VEW A;  3CHW A;  3J7Y P;  3HP9 A;  3AAR A;  4CJP A;  3U6F A;  4KH4 A;  5C42 A;  4JKC A;  4YOT A;  5CYM A;  4OO1 J;  3C94 A;  3ZCM A;  3WUH A;  3LP1 A;  3RSE A;  4Y0W A;  4CGD A;  2O8C A;  4H4O A;  4LF6 K;  3ZT3 A;  5IWA K;  5I9E B;  1KXP A;  4FJ5 A;  2Z1I A;  5AQS A;  2E6M A;  1X9J A;  2AA4 A;  2NRH A;  3T3F A;  3QER A;  3SCX A;  1OH8 A;  4RW8 A;  2KLA A;  3C65 A;  4IJN A;  5FLX O;  3ULD A;  1RBS A;  5F2R A;  3V9Z A;  5DM7 L;  1ILY A;  1RTH A;  1ZBF A;  3HOT A;  3LDL A;  3RWU A;  4CEF A;  1JLC A;  1MWK A;  3ZSY A;  3VEX A;  3AAQ A;  4I9Q A;  3NMU A;  3AVL A;  4NCG A;  2ASO A;  5E41 A;  1W7A A;  2V51 B;  2UUC K;  3TTC A;  4YOW A;  1K8K A;  1W97 L;  4FJ7 A;  2HF3 A;  1X1P A;  4J2A A;  4WQ5 C;  1GOC A;  2FBX A;  2IS3 A;  1Q8I A;  3V9S A;  1N8R O;  3MED A;  3AVJ A;  3HPO A;  1LV5 A;  5BRE A;  1Z26 A;  4BR9 A;  2QEX N;  3TU5 A;  2W40 A;  4IDK A;  3RMD A;  2CH6 A;  1B92 A;  4BGA A;  1QQO A;  2O8D B;  1HUX A;  3C6H A;  5ELZ A;  4FWM A;  2NRR A;  3CFP A;  5E26 A;  1TV6 A;  1ZBH A;  3EKU A;  4GV9 A;  3K9K A;  3A5O C;  2P9P B;  3L2Q A;  4OGE A;  3WNG A;  4FCY A;  5C0Y A;  2RKI A;  3ITH A;  1JLG A;  1RCH A;  1NGE A;  3VA0 A;  5EOY A;  2DPN A;  3SLC A;  2PY5 A;  3W0L A;  2HBM A;  4DFJ A;  3MK6 A;  5AR0 A;  5I3U A;  1GLA G;  4FJX A;  5J1E A;  3PSI A;  3AY9 A;  3SQ1 A;  1A5W A;  1BI4 B;  2QTD A;  5JMV A;  1E4F T;  1TUU A;  4BVO A;  3QDK A;  3OYB A;  1YIJ N;  2B4J A;  2P9I B;  1RT2 A;  4BDP A;  5D3G A;  1C1A A;  3CJ9 A;  1N34 K;  1RT1 A;  3IG1 A;  3CMA N;  1CXQ A;  1Y97 A;  1JCF A;  4A2A A;  3CCS N;  4PKG A;  3AV9 A;  3HXM A;  3KLH A;  3MX5 A;  1WBB A;  3A5M C;  4M3U A;  1IO2 A;  1C0F A;  3ID6 A;  3D6R A;  2G8I A;  3DLG A;  3TSQ A;  1K9M O;  1HR0 K;  1FK9 A;  2FBV A;  3HJF A;  4PQU A;  5C15 A;  1GLB G;  4LC9 B;  1OH6 A;  4ELV A;  2Q36 A;  5GIN A;  3SUQ A;  4HCB A;  4O0I A;  1UWB A;  5HOO A;  4WQ5 A;  1BGX T;  4MDA A;  3IAY A;  4Z0U A;  2FF3 B;  1XQS C;  1C1B A;  3TAN A;  4DQS A;  1YTU A;  2ETJ A;  4CJT A;  1IKY A;  4FLV A;  4BC3 A;  4AHC A;  1RBU A;  4DTP A;  4YDU C;  4DUZ K;  1C6V A;  3QEV A;  3DLE A;  4I6M A;  3IUC A;  4XH1 A;  1N33 K;  1G99 A;  4H5N A;  3I33 A;  1VSL A;  1P8Z A;  3SQ2 A;  4ELT A;  4GY2 B;  1JLE A;  3GBT A;  3KLE A;  3DAW A;  3DXM A;  1B9F A;  1EP4 A;  4CJE A;  4FXD A;  2I7P A;  1J6Z A;  5C25 A;  3PIO L;  4RG8 A;  3AO2 A;  2P9L B;  1N6Q A;  2A42 A;  2KFZ A;  4FJK A;  4KHN A;  3DOK A;  3V1Q A;  4I2Q A;  5BR9 A;  1Q18 A;  1JCE A;  2Q97 A;  2NRT A;  5JVH L;  2RN2 A;  3L6Q A;  3QIP A;  5JVG L;  4IEE A;  2QWN A;  1KVB A;  2KFN A;  1FXX A;  5HRO A;  1NGD A;  1C0M A;  2UUB K;  2WUS A;  3L8B A;  4IFY A;  3CME N;  5AZI B;  2OPS A;  3VPZ A;  4LF9 K;  2BAN A;  1SL0 A;  3VES A;  3O3G A;  4K43 A;  4BQZ A;  1GLE G;  1JKH A;  4DV6 K;  3UIQ A;  3ZT1 A;  4BVP A;  1ASW A;  1LWF A;  2FXU A;  2VG6 A;  1NJZ A;  2VYP A;  3KIO A;  1TAU A;  1BA1 A;  4A2B A;  4CJ4 A;  5AQQ A;  2WFB A;  3RVC A;  3AA2 A;  3LL3 A;  1VQP N;  3ENH A;  2KHO A;  1NJW A;  3VGM A;  1NBW A;  3JAM O;  3OYI A;  3CI5 A;  5AQJ A;  2XO7 A;  4DTX A;  1YVN A;  1SUQ A;  1S9G A;  1LWE A;  1ASU A;  2A5X A;  4LSN A;  3E9L A;  1VQ6 N;  4FM0 A;  3VEO A;  3UE5 A;  3S3N A;  4MDB A;  2VCP A;  1QSY A;  2PFU A;  1VSH A;  3CCV N;  1TAQ A;  4DFM A;  5BPM A;  4ID1 A;  2KTQ A;  3O9Q A;  3K9J A;  3HPG A;  1NKE A;  3CER A;  1S9E A;  4AHS A;  1RDD A;  4HVJ A;  3THW A;  4ZTF A;  5GIP A;  4IBN A;  3DLL L;  2UUA K;  4LF8 K;  3VN5 A;  1KVA A;  3DJC A;  4WQ4 A;  4FLT A;  4MO4 A;  5C2D A;  1K8A O;  3VA3 A;  3A2F A;  5I42 A;  1WAJ A;  1L3S A;  1VQ5 N;  3HVT A;  2XHB A;  2X74 A;  3E01 A;  1LOT B;  3G6E N;  2D0O A;  4DTR A;  4JAX A;  4CGI A;  1NKC A;  4EZ6 A;  3C7N B;  4ILH A;  4W5O A;  5CHI A;  2BGG A;  3KK2 A;  2D0C A;  5ADX H;  4DLE A;  4B9Q A;  2R7Y A;  1KTQ A;  2YHY A;  2EWS A;  1Z6R A;  1QVG M;  5JLH A;  3NE6 A;  1N5Y A;  5HP1 A;  2Q3S A;  4C1N K;  1TGO A;  4YOY A;  1Q9X A;  5AQH A;  4FWN A;  5C24 A;  1EXQ A;  2OAN A;  2DFE A;  1BG3 A;  3B6O A;  4FLZ A;  1IG8 A;  5KQ8 A;  4AH9 A;  4R5P A;  2F8S A;  1K73 O;  2FBY A;  4BG9 A;  1L5U A;  5J2Q A;  4ZHR A;  5JS1 A;  3OYK A;  4KO0 A;  1S1T A;  3HVR A;  3CET A;  4WFA L;  1WB9 A;  2A6A A;  3A5N C;  2UXD K;  1IG9 A;  3C95 A;  4WE1 A;  3UB5 A;  4B1X B;  3NH1 A;  3LDQ A;  1BU6 O;  3AVK A;  4CED A;  2VWJ A;  4CIF A;  1C0U A;  5M1P A;  1IKV A;  2ZWH A;  4DR6 K;  1QHT A;  2ZGZ A;  4CEQ A;  2QWP A;  3QEI A;  3AVA A;  2NRZ A;  3THX A;  3SAH A;  3CJB A;  2OTL N;  4M3Y A;  4X66 K;  4FJM A;  4JKH A;  3EZW A;  3ZSR A;  4JI0 K;  4E89 A;  3MEE A;  3OYG A;  3OYM A;  3KK3 A;  3PUF A;  2O8D A;  4CK3 A;  2NRW A;  3VGL A;  2H3G X;  5DK5 A;  1SS6 A;  4RW6 A;  3JXU A;  1S1X A;  1BIU A;  2P9P A;  3NVM A;  3R3L A;  4DR3 K;  1BQN A;  3NH0 A;  1JJ2 M;  3MN6 A;  1I39 A;  3AVB A;  2IOC A;  3PLA A;  3HZ6 A;  3EL2 A;  3VQ5 A;  3K59 A;  3S3O A;  3MEG A;  3CD6 N;  4FZX C;  5BRF A;  3AA3 A;  1D9D A;  1SKW A;  4M63 C;  4FLU A;  1YJW N;  3TAQ A;  1ZBI A;  4JI8 K;  3TAF A;  4CEC A;  1WSE A;  2G8W A;  4KRF A;  3D2E B;  1BCO A;  1BI4 A;  1WSF A;  3IS9 A;  1HPZ A;  4CIG A;  5B8H A;  4LF4 K;  4CZE A;  1HKG A;  3EE8 A;  5SZT A;  4DSE A;  4FWO A;  1XC3 A;  4KV8 A;  2UXB K;  1S5J A;  3U9Z A;  3CPW M;  2WON A;  3ZT2 A;  4DV4 K;  3QML A;  4LSL A;  1HX1 A;  3LAM A;  3ZSX A;  5AZJ B;  3OYL A;  4CJL A;  1EWR A;  3O6W A;  1WOQ A;  1QQC A;  1NKB A;  1YVU A;  3J8A A;  3QIC A;  3S41 A;  3KKR A;  4BRQ A;  3SUO A;  4C8O A;  2O8B B;  4BGB A;  5KRS A;  3CCU N;  4EZ9 A;  1KQS M;  1TKZ A;  1NK8 A;  4CZJ A;  4FWP A;  3ID8 A;  3O9S A;  3CIP A;  1BIS A;  3H3N O;  2QKB A;  3HI0 A;  1ZBS A;  1U6Z A;  1NWK A;  4FZY A;  3VQ6 A;  1Q7Y O;  2IDO A;  2RE2 A;  2HVI A;  1IBM K;  5CZ2 A;  4DB3 A;  3LP3 A;  5EVZ A;  1V4T A;  2P9N B;  2HOE A;  3FZM A;  1LWC A;  4B1W B;  2IIR A;  4CZF A;  4FM1 A;  1JXE A;  4DWI A;  4J8F A;  4OPA A;  4KTZ A;  1TYQ B;  4FJJ A;  3OBY A;  3D45 A;  3DWL A;  4W5Q A;  4FK4 A;  4KHS A;  3D2F B;  3SAG A;  1WSH A;  4O8K A;  3H08 A;  3BF3 A;  3G10 A;  4CGJ A;  3ZET B;  1SL2 A;  4EP5 A;  4O8U A;  3J7Z O;  3U9D A;  3ULE A;  5FRO A;  3T1Y K;  1T3V A;  4JI7 K;  3BGR A;  1UOC A;  2RHK A;  2PBD A;  4C8N A;  2YNH A;  1X3N A;  4JK9 A;  3ZT0 A;  5JS2 A;  3TAP A;  4IO8 A;  1VSD A;  4QCL A;  3IKM A;  3L4I A;  5AQR A;  4JEP A;  4DTU A;  4DTS A;  4JKF A;  4RTF D;  4FLX A;  3C0B A;  5FPN A;  4HCC A;  4DTJ A;  4XH5 A;  4HUF A;  3P5J A;  3B6P A;  3BY5 A;  4QS8 A;  4JI5 K;  4DS5 A;  4E3S A;  4BR7 A;  3TAG A;  3O80 A;  4JN4 A;  3TSP A;  3T1H K;  4N47 A;  1KSP A;  3T1A A;  1HYZ A;  3O9T A;  3CJA A;  4B3S K;  4CHP A;  4CER A;  4BWM A;  2PAV A;  1GLF O;  1YUW A;  1D4X A;  1GLC G;  3ZX2 A;  1TL3 A;  2NUB A;  4DSF A;  1NK6 A;  4X62 K;  3OYF A;  4FJN A;  4KB0 A;  1UA1 A;  3SBT A;  4YY3 K;  3H45 C;  2FSN A;  1NK9 A;  1X3M A;  4KFB A;  1TK0 A;  4DFP A;  5AQW A;  3OYH A;  5F0X A;  3CFO A;  2FSJ A;  4FJG A;  4NXN K;  2YNF A;  3MCP A;  3NVK A;  2P9S B;  3HK2 A;  3H6E A;  1ATR A;  4QOZ B;  2KQ2 A;  2B5J A;  3V9U A;  3RR8 A;  2WOM A;  3L2U A;  4CHQ A;  3V6D A;  4O5B A;  3QEW A;  2O8E B;  1HMV A;  3Q7C A;  1S1W A;  1VSI A;  3N4Q A;  4BRD A;  1XMQ K;  2YV0 X;  1T6C A;  3U3G A;  3P1G A;  3LDO A;  1R0A A;  1J54 A;  3VQC A;  3VET A;  4Z4E A;  4JS5 A;  2D4W A;  4DU1 A;  4FJH A;  1KD1 O;  1Q86 O;  4JK8 A;  1XMO K;  3I55 N;  2UU9 K;  5CZ1 A;  4JHD B;  2HHU A;  1M90 O;  2ZD1 A;  3HO1 A;  2NZT A;  1ESV A;  5FPM A;  4DG1 A;  3F9K A;  3WXM B;  3MN9 A;  4KB1 A;  5IT9 O;  4HTU A;  2HHS A;  4A57 A;  1NMD A;  4BR4 A;  4DR5 K;  5KI6 A;  1HQE A;  3LWM A;  5BPL A;  1NK5 A;  3MMV A;  1U49 A;  4CCH A;  1QHA A;  4N56 A;  3VF6 A;  2HVH A;  1ITG A;  3LDN A;  1VRU A;  3K58 A;  4AIL C;  2X6S A;  4DHY A;  1TK5 A;  5AQN A;  3EE9 A;  3RR7 A;  4IKF A;  1D9F A;  3K5N A;  2KZM A;  4BRG A;  1GLJ O;  1ZBU A;  1CXU A;  2AJQ A;  3HM8 A;  4YNQ A;  2WBN A;  4AHT A;  3GOI A;  1WLJ A;  2E1Y A;  1WSJ A;  3TTF A;  4BRA A;  4WCE L;  3SAF A;  5FRM A;  1YXQ A;  1IJJ A;  3H46 O;  5SWM A;  3AVC A;  4AQY K;  1NJI O;  4IDH A;  3J7A P;  4OKE A;  4X64 K;  4CHN A;  4A59 A;  1ATN A;  2RF2 A;  3LAL A;  4LD0 A;  1NOZ A;  4BC4 A;  2HBK A;  2WC9 A;  2A1R A;  4M7X A;  4JD2 B;  4B3O A;  2DFH A;  5AZJ A;  3SMP A;  2KW4 A;  4B1U B;  3OYN A;  5GIO A;  4OLB A;  2IAJ A;  5LL6 Z;  1LAV A;  3CC4 N;  2E20 A;  2GWK A;  4CF0 A;  4C8M A;  2O8B A;  3L3V A;  3E9P A;  4FVM A;  1XI1 A;  1QQM A;  4JRQ A;  2CGL A;  3J81 O;  4EAH D;  2I5J A;  3OVN A;  3U4L A;  3CCQ N;  3ZYY X;  1NGC A;  3WEE A;  2HF4 A;  4JNE A;  4B1Z A;  4H03 B;  1KFD A;  2E5L K;  3QFP A;  1C1C A;  4KBO A;  2QWM A;  3VQA A;  4GKK K;  3SPZ A;  4E7I A;  1TK8 A;  4MQ3 A;  1VSK A;  4DV5 K;  1JLF A;  4CJK A;  3CPE A;  3FGU A;  2Z1H A;  3OYJ A;  4CJ5 A;  4DTO A;  4DTN A;  3O4N A;  2ITG A;  4CHO A;  5C10 A;  3OJS A;  3O1B A;  3D2F A;  2HMI A;  2V7Z A;  3VQQ A;  1E4G T;  2FBT A;  1IBK K;  1NGA A;  4PA1 A;  5AQO A;  4KI6 A;  3ZET A;  4FWL A;  1RDA A;  1A5X A;  4WQ4 C;  1BA0 A;  4L8R B;  2ITM A;  3TAM A;  5KQD A;  3CF5 L;  5LMU K;  4CK2 A;  4CE9 A;  1T8E A;  2PYL A;  2GUP A;  1OKJ A;  1VSJ A;  3F5T A;  4CBU A;  3V4I A;  4L3Q A;  4ILG B;  2VQE K;  3DMJ A;  4NCB A;  1NGG A;  1QQN A;  3AVG A;  3PV8 A;  3KLI A;  3HRG A;  2HW3 A;  2GX9 A;  1RBT A;  3VTH A;  1L3T A;  2VWK A;  1QSL A;  1FJG K;  4DU3 A;  3PSF A;  2G8K A;  4AHR A;  4H5W A;  4A62 A;  3NDK A;  4C8K A;  1S6P A;  1T44 A;  2E88 A;  1HPM A;  1RBR A;  4K42 A;  2W42 A;  4IOC L;  1OVY A;  1KLN A;  2NLX A;  1IKX A;  2F9W A;  1T05 A;  3SK3 A;  1HYS A;  4DV1 K;  5M1N A;  2HBL A;  5AQF A;  2VG5 A;  4CW7 B;  3CQY A;  2OPQ A;  4KKO A;  3THV A;  4NYF A;  5CY4 A;  5GAE P;  2HHH K;  1TKT A;  4BRL A;  1VQL N;  4DU4 A;  1X9S A;  4G9Z A;  4PKI A;  4WF9 L;  1YAG A;  5CE3 A;  3CCM N;  3IMX A;  3KLF A;  4K41 A;  5M1O A;  1L3V A;  3VEZ A;  4JKB A;  3VQ7 A;  4FJL A;  3TAE A;  3I56 N;  3LAN A;  2GTD A;  2ASP A;  5GAH P;  3DXK B;  2GBZ A;  4IG3 A;  3PO5 A;  2HHW A;  3CM6 A;  3OTO K;  2V7Y A;  3E66 A;  2VQF K;  2UYT A;  1HNZ K;  3EN9 A;  3HSC A;  1MDU B;  4AM7 A;  1CZB A;  2OPR A;  2P9S A;  4YOX A;  4B1Y B;  3L4Q A;  4GVM A;  5EU7 A;  1S1U A;  3DM2 A;  4ISF A;  3NGI A;  2O8E A;  2IGI A;  1W9H A;  3FFI A;  3CXC M;  5JIC A;  3ENB A;  3DLB A;  3HST B;  2EHG A;  3L2V A;  4WFB L;  5T7B A;  3PX6 A;  2LSN A;  2GEM A;  4JKG B;  4KRE A;  4FPB A;  1KFS A;  3QEP A;  2HNY A;  4H5T A;  1YTA A;  4JHD A;  2NRX A;  3WXJ A;  4E19 A;  4CZK A;  1W2B M;  4KHQ A;  4LY7 A;  4K0K K;  4H5V A;  4YHH K;  4Z94 A;  4J2B A;  4GV6 A;  2VGM A;  4PL8 A;  4CJF A;  1U45 A;  3P4I A;  3O4W A;  3G25 A;  4M3W A;  3UKU B;  3DRS A;  5EXW A;  5AQL A;  1LAW A;  3F9M A;  4B3T K;  3PX0 A;  1T6D A;  3QIO A;  3L0Q A;  2QM1 A;  2XY5 A;  1EET A;  5H1S Q;  3IFR A;  2A40 A;  1U4B A;  4BC5 A;  3AGR A;  4QS7 A;  3PY8 A;  4B3M K;  3SV3 A;  4H0Y B;  1XC9 A;  4CJW A;  4BRK A;  5HBM A;  3B8A X;  3TTD A;  4FWQ A;  4E7H A;  2IVO A;  5DMR A;  3DLK A;  3L2R A;  1O1W A;  2FSK A;  1BO5 O;  5KPR A;  2OZM A;  1WNS A;  3QET A;  4J2D A;  4CEZ A;  4R79 A;  1OH5 A;  3GL1 A;  3Q7B A;  5AQP A;  1T7P A;  4FVU A;  3NGY A;  4GVE A;  1QSS A;  4ISE A;  4DKW A;  3TI0 A;  3DOL A;  4FL9 A;  3VEV A;  1DGK N;  1NGF A;  2OTJ N;  4XIU A;  1HLU A;  1IH7 A;  1J9A A;  3NHG A;  1REV A;  4JD2 A;  1K8K B;  5TKW A;  4KAZ A;  2D1K A;  4CF1 A;  1M1K O;  4DUY K;  2GEL A;  4LFA K;  2XY6 A;  1T03 A;  2DY4 A;  4DR2 K;  4CJR A;  5E84 A;  4BRN A;  4CGH A;  2P9I A;  1TKX A;  3WNE A;  2QA4 N;  4BDZ A;  1UA0 A;  3OBW A;  3AAP A;  5HLF A;  3P38 A;  3H1Q A;  4F8R A;  1YJ9 N;  4KH5 A;  3OYC A;  3QNO A;  3D7E O;  4DF8 A;  2J4R A;  2HND A;  1S72 N;  2PZS A;  1QTM A;  4LFB K;  4CZG A;  4DS4 A;  3O1W A;  3KD5 E;  4KHP K;  4GKJ K;  4CI6 A;  4BRF A;  1YJN N;  1BL3 A;  5LMN K;  1N32 K;  2X78 A;  3CJ7 A;  3AO3 A;  3CQX A;  1Z05 A;  4FW2 A;  5FPE A;  4JV5 K;  1BQM A;  4UY8 O;  4PKH A;  1JLA A;  1J5E K;  1RT5 A;  3LWL A;  4B9U A;  3AO5 A;  3EEQ A;  2E4L A;  2HHT A;  3QEX A;  1EX4 A;  4RW4 A;  3VQP A;  4FJ8 A;  4M3Z A;  4O55 A;  4FJI A;  4QAG A;  4WYB A;  2BTF A;  1VHX A;  4B9S A;  2NNW A;  2E2P A;  3CFR A;  1NJX A;  4PUO A;  5M1Q A;  1HQU A;  4IEI A;  3TSU A;  1KC8 O;  4A5B A;  2YKN A;  3R6M A;  5J2N A;  1R59 O;  1RFQ A;  3F2K A;  4CGG A;  1RT4 A;  5HRN A;  1YT3 A;  3S3M A;  5M1F A;  3CYM A;  4ZTJ A;  2ZJP L;  4FK2 A;  1RT6 A;  4XEI A;  1NGI A;  1IBL K;  4ICL A;  3CC7 N;  2GUI A;  2P9L A;  4BWJ A;  4CK1 A;  4B9N A;  4Z4C A;  1JXB A;  5DM6 L;  4B9M A;  1CZA N;  4XH4 A;  3VER A;  1HRH A;  3MXJ A;  3PIP L;  4M3X A;  5GAD P;  2YNI A;  4GMJ B;  2FLO A;  1EWQ A;  1NJY A;  4V19 S;  4CVN E;  1VAZ A;  5AZI A;  3KHY A;  4I6M B;  5BN9 A;  5HRP A;  4B9V A;  3KZB A;  1SV5 A;  4Y1C A;  3DLR A;  2XY8 A;  5AQG A;  3FR0 A;  5KRT A;  4OLA A;  5AQU A;  3DXM B;  3MN7 A;  2HNZ A;  2QWR A;  3M3Z A;  4HWI A;  3M5R A;  4LF7 K;  1HJO A;  1H1V A;  1VRT A;  1KAZ A;  2A1S A;  2Q0R A;  4I2P A;  2G8U A;  3LPT A;  1KVC A;  1RBV A;  1F21 A;  4N41 A;  4IG0 A;  4M41 A;  4F2S A;  3KJV A;  3SNN A;  2CGJ A;  1WAF A;  4H0P A;  3A8Y A;  3KWI A;  1HNW K;  1Y64 A;  4LH4 A;  4Q0B A;  1SL1 A;  1N36 K;  2P9U B;  4IZ9 A;  1IV0 A;  4NYN A;  1XHX A;  3P31 A;  4PL7 A;  3SMS A;  4JYA K;  2HBJ A;  3NF6 A;  4E7K A;  2OCE A;  2P5G A;  1RGI A;  3NFA A;  5F1X A;  3N4P A;  3G4S N;  3BZK A;  1ZBL A;  1Q9Y A;  2JWK A;  2XY7 A;  2F8T A;  3C7N A;  2HB5 A;  3HBT A;  2QW9 A;  3HOS A;  1SZ2 A;  1RTJ A;  5J2P A;  4IJA A;  3WT0 A;  2F9T A;  1VQ7 N;  3LZJ A;  1NK0 A;  3I0R A;  1UAX A;  5BRD A;  3L2W A;  3U3Y A;  4DSI A;  3WXL A;  4BRM A;  1BOT O;  4H0T B;  3NF8 A;  2CH5 A;  1ZXO A;  4DQR A;  3K5O A;  2HST A;  4DF4 A;  1HJR A;  4FZZ A;  1MA9 B;  4IOA L;  3O3F A;  3WQT A;  2ATQ A;  1VK0 A;  2YCH A;  1SKS A;  5FPD A;  4M3T A;  4CZH A;  3THW B;  4NCA A;  5GAG P;  3MWT A;  1A5V A;  4OPJ A;  4H0V B;  4KPY A;  1RDC A;  1VSM A;  1ZC6 A;  4JLH A;  3UKU A;  1LW0 A;  4RCH A;  4X65 K;  4KTQ A;  4IOX A;  4Z4G A;  1WSI A;  4QS9 A;  1GLD G;  3ZEU B;  1EO1 A;  4ID5 A;  2CGK A;  3M6G A;  1BUP A;  1L3U A;  4FWK A;  3R8E A;  2EX3 A;  4DV0 K;  1GOA A;  4IO9 L;  3WQU A;  4DV7 K;  3PX4 A;  3NF7 A;  4CJ3 A;  1OH7 A;  1VSF A;  4JI2 K;  4LF5 K;  2O4I A;  1KAX A;  1V4S A;  2E2N A;  2BH1 A;  3TWH A;  2WTU A;  2OYQ A;  2D5R A;  4AHU A;  5AQI A;  1BHL A;  5MLC Q;  1NU0 A;  4K25 A;  1HNV A;  3ZSW A;  4E1N A;  4KTW A;  3LPU A;  1HNX K;  3BZC A;  3K5L A;  2HMP A;  4PWD A;  3ZSV A;  4DLG A;  4E7L A;  3SBG A;  4E7J A;  1YHQ N;  3FZK A;  3H1V X;  2Y1I A;  1QE1 A;  4BRO A;  3HM9 A;  4H5R A;  4JK7 A;  3NBP A;  3ZX3 A;  1JLB A;  2HHX A;  4CHY A;  1C0T A;  5JLF A;  3KD1 E;  1D5A A;  3D2E A;  3C6T A;  4BRP A;  1XNR K;  4O4G A;  3T19 A;  4CBX A;  3AVI A;  3E9O A;  3THX B;  1RTD A;  3FZF A;  4BRE A;  2UXC K;  1CLQ A;  3MX2 A;  4E1M A;  3OW2 M;  3QLH A;  4FOE A;  3EKS A;  3FLC O;  3QBW A;  4KHY A;  4DTM A;  4TSX A;  4FK0 A;  5BN8 A;  3NGZ A;  4J2E A;  4OX9 K;  2DFF A;  4E0D A;  4W5N A;  4BRH A;  1P90 A;  3L3U A;  2YHX A;  3ZLJ A;  3ATU A;  3CG7 A;  4A61 A;  4NB4 A;  4F3O A;  2KKZ A;  3THY B;  4BRC A;  1WBD A;  3CCJ N;  1LW2 A;  2VWB A;  1FKP A;  4CEE A;  3BP8 A;  4PHT X;  4B3R K;  3TAR A;  2FC0 A;  3VTI A;  3O4Q A;  1ZYQ A;  1IKW A;  4NLB A;  4CEO A;  2VGN A;  4Z4I A;  1XUP O;  3VMF B;  3AA4 A;  1TKD A;  4Z4F A;  3SQ0 A;  3O8M A;  1C0G A;  1DLO A;  4M45 A;  1RT3 A;  2YHA A;  2ZQB A;  3P39 A;  5AQV A;  2F7T A;  2Z1G A;  3MXI A;  4YOR A;  2O4G A;  1RTI A;  4Q5V A;  2P9N A;  2A41 A;  5EY4 A;  3VF2 A;  2ZM6 K;  3EO3 A;  4JI6 K;  5KTQ A;  1NNE A;  5FRN A;  2P9K B;  2I7N A;  1OVQ A;  5AFU A;  2E6L A;  1U47 A;  4IFE A;  2W6K A;  1BWF O;  3HT3 A;  5EX5 A;  3OYE A;  4DV3 K;  1TYQ A;  3WXK A;  1Z25 A;  3A5L C;  4CFA A;  1I3A A;  2F4V K;  4GNI A;  4A5A A;  3SJH A;  1WSG A;  2IVP A;  4JKE A;  1U2V B;  5BR8 K;  1MWM A;  3LZI A;  3VQ8 A;  4CBW A;  4MLH A;  3I8D A;  2AP1 A;  2BE2 A;  4BDY A;  3EZ5 A;  4DQQ A;  4CES A;  3W3D A;  4FYD A;  4OGC A;  1NMN A;  3A0I X; 
#chains in the Genus database with same CATH homology
 2E6M A;  4FJJ A;  3DRS A;  3AVN A;  3OJU A;  5K14 A;  4GW6 A;  3D45 A;  4W5Q A;  1LAW A;  3T3F A;  4FK4 A;  4PY5 A;  3QER A;  3PX0 A;  3SCX A;  4UQG A;  4KHS A;  4RW8 A;  1WSH A;  3QIO A;  3OYA A;  3H08 A;  3M8S A;  2XY5 A;  3G10 A;  1EET A;  3ULD A;  4JS4 A;  1RBS A;  4CGJ A;  1SL2 A;  1U4B A;  3V9Z A;  4EP5 A;  4KI4 A;  3PY8 A;  4G1Q A;  3SV3 A;  1RTH A;  1ZBF A;  4HHT A;  1XC9 A;  5FRO A;  3OY9 A;  4CJW A;  1RT7 A;  5HBM A;  3RWU A;  3BGR A;  4CEF A;  3VQB A;  4E7H A;  1JLC A;  1UOC A;  3ZSY A;  5DMR A;  4C8N A;  2YNH A;  4MFB A;  3HP6 A;  4I9Q A;  3DLK A;  4F3T A;  3L2R A;  3AVL A;  1O1W A;  3ZT0 A;  5JS2 A;  2OZM A;  3TAP A;  1WNS A;  1VSD A;  3QET A;  4J2D A;  4NCG A;  3AO1 A;  4M42 A;  4CEZ A;  3V9W A;  4QCL A;  3VQD A;  5E41 A;  4K8Z A;  2QKK A;  4DTU A;  4DTS A;  5J2M A;  1T7P A;  4K8X A;  2JLE A;  3NGY A;  3OS1 A;  3HL8 A;  4FLX A;  4FJ7 A;  1BIZ A;  4OJR A;  4CJU A;  1X1P A;  3SYZ A;  1QSS A;  4J2A A;  2YKM A;  3TI0 A;  3AVF A;  4BAC A;  1GOC A;  2FBX A;  2IS3 A;  1Q8I A;  3V9S A;  4HCC A;  3DOL A;  3MED A;  3AVJ A;  3HPO A;  1LV5 A;  4DTJ A;  1Z26 A;  4HUF A;  2PYJ A;  3P5J A;  3B6P A;  2JGU A;  4IDK A;  3RMD A;  4XIU A;  1IH7 A;  1J9A A;  4W5R A;  3NHG A;  4DS5 A;  1B92 A;  4DSJ A;  4E3S A;  3LP0 A;  4CIE A;  3CFP A;  1REV A;  2OA8 A;  1TV6 A;  3TAG A;  1XWL A;  3ALY A;  3K57 A;  1ZBH A;  3OS0 A;  4KAZ A;  4N47 A;  3L2Q A;  4OGE A;  4CF1 A;  3D0P A;  3WNG A;  3DLH A;  2KZZ A;  1KSP A;  2XY6 A;  1T03 A;  2OZS A;  2DY4 A;  5FDL A;  1HYZ A;  3T1A A;  4KHW A;  4FCY A;  2RKI A;  3ITH A;  3NAE A;  4CJR A;  1JLG A;  1RCH A;  3VA0 A;  4YFU A;  4CHP A;  4CER A;  3RR8 A;  4CGH A;  3V1O A;  1TKX A;  2PY5 A;  3WNE A;  4BWM A;  4BDZ A;  3K2P A;  1UA0 A;  4DFJ A;  5HLF A;  4F8R A;  5I3U A;  3OYC A;  3QNO A;  3V81 A;  4DF8 A;  1S6Q A;  4FJX A;  2ZE2 A;  5J1E A;  2HND A;  2PZS A;  1QTM A;  1TL1 A;  1HYV A;  1TL3 A;  2NUB A;  4DS4 A;  3SQ1 A;  1A5W A;  1BI4 B;  4DSF A;  3KD5 E;  1NK6 A;  2X6N A;  3WNF A;  1BL3 A;  3OYF A;  2X78 A;  4FJN A;  3OYB A;  3KKS A;  3AO3 A;  4KB0 A;  2B4J A;  1UA1 A;  4DQI A;  4DSL A;  1RT2 A;  4BDP A;  4FW2 A;  5D3G A;  1C1A A;  4N76 A;  1EKE A;  4RW7 A;  1NK9 A;  4KFB A;  1TK0 A;  4DFP A;  1RT1 A;  1BCM A;  3IG1 A;  1CXQ A;  1Y97 A;  1BQM A;  3OYH A;  3O3H A;  1SKR A;  3CFO A;  4DSK A;  1JLA A;  4FJG A;  2YNF A;  1RT5 A;  3LWL A;  4B8A B;  3AV9 A;  3IRX A;  3C6U A;  3HK2 A;  5KGW A;  3HXM A;  3KLH A;  4B9U A;  3AO5 A;  4QOZ B;  2KQ2 A;  2E4L A;  2B5J A;  4W5T A;  3V9U A;  3QEX A;  1EX4 A;  2WOM A;  4RW4 A;  3VQP A;  4CHQ A;  4CF9 A;  3L2U A;  3V6D A;  4O5B A;  3QEW A;  3ISN C;  1XHZ A;  1IO2 A;  4FJ8 A;  1HMV A;  4O55 A;  4M3Z A;  3EY1 A;  4QAG A;  4FJI A;  1S1W A;  1VSI A;  2G8I A;  4FM2 A;  3RTV A;  4DFK A;  4HUE A;  3DLG A;  4B9S A;  3CFR A;  2YV0 X;  1NJX A;  4PUO A;  3U3G A;  1HQU A;  3P1G A;  1R0A A;  1X9W A;  2G8H A;  2YKN A;  1J54 A;  3QIN A;  1FK9 A;  2FBV A;  5J2N A;  3VQC A;  3HJF A;  4PQU A;  4H4M A;  4Z4E A;  4JS5 A;  4FLW A;  4JRP A;  4ELV A;  3SUQ A;  4CGG A;  4O0I A;  1RT4 A;  2QXF A;  1YT3 A;  4CF2 A;  1UWB A;  5HRN A;  4DU1 A;  3S3M A;  4FJH A;  1BGX T;  4Z0U A;  1VSE A;  1ZBI A;  3AVM A;  1C1B A;  3CYM A;  5CZ1 A;  3TAN A;  4ZTJ A;  1RT6 A;  4FK2 A;  4DQS A;  2HHU A;  1YTU A;  2ETJ A;  2ZD1 A;  1IKY A;  4CJT A;  4DG1 A;  3HO1 A;  4BE2 A;  4FLV A;  2OPP A;  4CJQ A;  4ICL A;  3F9K A;  4AHC A;  1RBU A;  4DTP A;  2GUI A;  1TVR A;  3SUN A;  1C6V A;  4BWJ A;  4CK1 A;  3QEV A;  3DLE A;  4B9N A;  4HCB A;  4Z4C A;  3OS2 A;  1JXB A;  3KLG A;  4KB1 A;  4B9M A;  3ZT4 A;  3CM5 A;  1HRH A;  4HTU A;  2HHS A;  1VSL A;  3SQ2 A;  1KCF A;  1G15 A;  3MXJ A;  4M3R A;  4M3X A;  4ELT A;  5KI6 A;  1HQE A;  3LWM A;  2YNI A;  4GMJ B;  1NK5 A;  1JLE A;  1U49 A;  4CCH A;  4N56 A;  3KLE A;  2HVH A;  1ITG A;  3K58 A;  1VRU A;  1NK7 A;  4AIL C;  1B9F A;  1EP4 A;  4AHV A;  4CJE A;  4B9T A;  3K5M A;  3VQE A;  4FXD A;  1NJY A;  2HHQ A;  2X6S A;  1TK5 A;  5C25 A;  3MAQ A;  4RG8 A;  4CFB A;  1FKO A;  3AO2 A;  1N6Q A;  3RR7 A;  4IKF A;  2KFZ A;  1D9F A;  4FJK A;  4KHN A;  3DOK A;  3V1Q A;  4I2Q A;  3TR8 A;  3K5N A;  3JSM A;  5HRP A;  1CZ9 A;  3BDP A;  4B9V A;  2KZM A;  1SV5 A;  4Y1C A;  3DLR A;  3RMC A;  2XY8 A;  1ZBU A;  1CXU A;  2RN2 A;  2AJQ A;  3I0S A;  4YNQ A;  4CGF A;  3QIP A;  1JL2 A;  5KRT A;  4AHT A;  3KTQ A;  4OLA A;  3CQ8 A;  1WLJ A;  1KVB A;  1WSJ A;  2KFN A;  1FXX A;  5HRO A;  2HNZ A;  1C0M A;  4CJS A;  3L8B A;  4IFY A;  5FRM A;  2P5O A;  2OPS A;  2BAN A;  5SWM A;  4I7F A;  1VRT A;  4I2P A;  2A1S A;  3HYF A;  3O3G A;  1SL0 A;  4OKK A;  2G8U A;  3LPT A;  1KVC A;  1JKH A;  3AVC A;  1RBV A;  4O44 A;  3ZT1 A;  3UIQ A;  4Y1D A;  1ASW A;  1LWF A;  1F21 A;  2VG6 A;  4N41 A;  1NJZ A;  3KIO A;  4IG0 A;  1TAU A;  3JYT A;  4M41 A;  4OKE A;  4CJ4 A;  4F2S A;  4CHN A;  2D0A A;  3DRR A;  3SUP A;  3AA2 A;  3RMA A;  3M8P A;  3KJV A;  4DMN A;  2RF2 A;  3SNN A;  3SPY A;  1WAF A;  3LAL A;  4LD0 A;  2QK9 A;  3AO4 A;  1NOZ A;  1J5O A;  3NCI A;  1NJW A;  4LH4 A;  4Q0B A;  3ZSO A;  2A1R A;  1SL1 A;  3OYI A;  2XO7 A;  4DTX A;  4B3O A;  1ASV A;  4OPK A;  1SUQ A;  2DFH A;  3LDS A;  1S9G A;  1LWE A;  1ASU A;  4CF8 A;  2P1J A;  4NYN A;  4LSN A;  2KW4 A;  3HPH A;  4CHZ A;  4FM0 A;  1XHX A;  3OYN A;  3S3N A;  1QSY A;  4OLB A;  2IAJ A;  3WNH A;  3VQ4 A;  1LAV A;  1VSH A;  3NF6 A;  4CFD A;  4E7K A;  2P5G A;  3NFA A;  1TAQ A;  1QS4 A;  4DFM A;  4HUG A;  3QO9 A;  4ID1 A;  2KTQ A;  1ZBL A;  1MU2 A;  4CF0 A;  1Q9Y A;  4FLY A;  2XY7 A;  2P51 A;  1U04 A;  4C8M A;  2F8T A;  3HPG A;  3L3V A;  3OYD A;  3ZSQ A;  1NKE A;  2HB5 A;  1S9E A;  4AHS A;  1RDD A;  5CYQ A;  4FVM A;  4HVJ A;  4ZTF A;  1XI1 A;  4IBN A;  3G0Z A;  1RTJ A;  4IFV A;  5J2P A;  1RNH A;  3VN5 A;  1KVA A;  1S1V A;  4JRQ A;  3V9X A;  4EP4 A;  4FLT A;  3LZJ A;  1NK0 A;  3VA3 A;  3A2F A;  3F73 A;  3I0R A;  1UAX A;  2I5J A;  3OVN A;  5I42 A;  1WAJ A;  3L2W A;  3U3Y A;  1L3S A;  4DSI A;  3DI6 A;  3HVT A;  3NF8 A;  4DQR A;  2XHB A;  2X74 A;  3E01 A;  3K5O A;  4H8K A;  4DF4 A;  1HJR A;  4FZZ A;  1KFD A;  5KGX A;  1C1C A;  3O3F A;  4DTR A;  2G8V A;  4CGI A;  2ATQ A;  1NKC A;  3VQA A;  4EZ6 A;  1VK0 A;  1SKS A;  5HRS A;  4M3T A;  4W5O A;  2BGG A;  3M8Q A;  3KK2 A;  1JL1 A;  2D0C A;  4DLE A;  4E7I A;  3SPZ A;  1TK8 A;  4NCA A;  4MQ3 A;  4F4K A;  2IC3 A;  2R7Y A;  1VSK A;  1KTQ A;  1A5V A;  1JLF A;  4CJK A;  4OPJ A;  2Z1H A;  3OYJ A;  4FW1 A;  4CJ5 A;  4DTO A;  4KPY A;  4CJV A;  1RDC A;  1VSM A;  4JLH A;  4DTN A;  3O4N A;  2ITG A;  3NE6 A;  1LW0 A;  4CHO A;  1N5Y A;  3QNN A;  2Q3S A;  5HP1 A;  3OJS A;  5HRR A;  4KTQ A;  1TGO A;  4Z4H A;  3NH2 A;  2HMI A;  1U48 A;  1Q9X A;  1WSI A;  1WN7 A;  1DTQ A;  2YHB A;  3VQQ A;  4BE0 A;  5C24 A;  1EXQ A;  4KHU A;  2FBT A;  3DYA A;  4ID5 A;  2DFE A;  4B08 A;  4PA1 A;  3B6O A;  4FLZ A;  1L3U A;  1RIL A;  2YNG A;  4KI6 A;  4B9L A;  1RDA A;  1A5X A;  4CEB A;  1DTT A;  2EX3 A;  4L8R B;  2RPI A;  4AH9 A;  4R5P A;  3TAM A;  1D8Y A;  2F8S A;  1JLQ A;  2FBY A;  1L5U A;  1GOA A;  1RDB A;  5J2Q A;  4ZHR A;  3PX4 A;  3NF7 A;  2DTU A;  5JS1 A;  3OYK A;  4KO0 A;  1S1T A;  4CJ3 A;  3HVR A;  4CK2 A;  4CE9 A;  1T8E A;  2PYL A;  3PO4 A;  1VSF A;  3AA5 X;  1W0H A;  1IG9 A;  1KRP A;  3C95 A;  2OYQ A;  1VSJ A;  4WE1 A;  3TWH A;  2O4I A;  2D5R A;  4AHU A;  3NH1 A;  4B8C A;  3V4I A;  3AVK A;  1BHL A;  1HNI A;  4RW9 A;  4CED A;  2VWJ A;  1B9D A;  1J53 A;  4CIF A;  3DMJ A;  1C0U A;  4NCB A;  1K6Y A;  1IKV A;  1HNV A;  3AVG A;  3PV8 A;  3KLI A;  3ZSW A;  2HW3 A;  1QHT A;  4E1N A;  4KTW A;  4CEQ A;  3LPU A;  1RBT A;  3QEI A;  3K5L A;  3AVA A;  2VWK A;  1L3T A;  4ELU A;  4OKJ A;  1QSL A;  4M3Y A;  4PWD A;  3ZSV A;  3NF9 A;  4DLG A;  4E7L A;  4FJM A;  2GV9 A;  4E7J A;  4DU3 A;  3ZSR A;  2Y1I A;  4E89 A;  2G8K A;  3MEE A;  3SQ4 A;  4AHR A;  1QE1 A;  3OYG A;  3OYM A;  3KK3 A;  3PUF A;  4CK3 A;  3HM9 A;  3NDK A;  4C8K A;  2Z1J A;  2HHV A;  3NBP A;  1JLB A;  1S6P A;  1GOB A;  2B6A A;  5DK5 A;  4RW6 A;  2HHX A;  1RBR A;  4CHY A;  1C0T A;  1KLM A;  3SV4 A;  1S1X A;  1BIU A;  2W42 A;  1D5A A;  3KD1 E;  4N5S A;  3C6T A;  1BQN A;  3NH0 A;  4O4G A;  3T19 A;  3AVI A;  3RRH A;  1RTD A;  1KLN A;  1I39 A;  1CLQ A;  3AVB A;  2IOC A;  1IKX A;  1T05 A;  4E1M A;  2VG7 A;  1HYS A;  3VQ5 A;  3QLH A;  3K59 A;  3S3O A;  3MEG A;  2VG5 A;  4FZX C;  4KHY A;  4DTM A;  3AA3 A;  3VQ9 A;  4TSX A;  1D9D A;  2OPQ A;  4KKO A;  3THV A;  4NYF A;  3KK1 A;  1SKW A;  3RRG A;  4FLU A;  5CY4 A;  4FK0 A;  4FJ9 A;  4J2E A;  3NGZ A;  2DFF A;  4E0D A;  3MEC A;  2Y1J A;  1TKT A;  3TAQ A;  4W5N A;  3L3U A;  3DRP A;  4OVL A;  4CEC A;  3SZ2 A;  4DU4 A;  3TAF A;  1WSE A;  1X9S A;  2G8W A;  4CFC A;  4CEA A;  4KRF A;  2HHT A;  1BCO A;  3RMB A;  3CG7 A;  1BI4 A;  1WSF A;  3IS9 A;  1HPZ A;  4F3O A;  4CIG A;  2D0B A;  3KLF A;  1LW2 A;  1L3V A;  3MXM A;  1FKP A;  5SZT A;  4CEE A;  3VQ7 A;  4DSE A;  3TAE A;  4FJL A;  4KV8 A;  3LAN A;  4O0J A;  3TAR A;  3P83 D;  2FC0 A;  4DQP A;  1S5J A;  3O4Q A;  1ZYQ A;  2GBZ A;  2WON A;  3ZT2 A;  1IKW A;  4LH5 A;  4IG3 A;  4LSL A;  4CEO A;  3ASM A;  3PO5 A;  2HHW A;  3LAM A;  4Z4I A;  3CM6 A;  3ZSX A;  4F2R A;  1NOY A;  3OYL A;  2BDP A;  3AA4 A;  4CJL A;  3IAY A;  3ZSZ A;  3V1R A;  2XRI A;  3S9H A;  3SJJ A;  1X9M A;  1QQC A;  1CZB A;  1TKD A;  2OPR A;  4Z4F A;  3SQ0 A;  1NKB A;  2F96 A;  1DLO A;  3AVH A;  3LP2 A;  4M45 A;  3SI6 A;  1YVU A;  1RT3 A;  2YHA A;  4M3U A;  3M8R A;  2ZQB A;  4GVM A;  1NK4 A;  5EU7 A;  2Z1G A;  3KKR A;  1S1U A;  3DM2 A;  3LAK A;  3NGI A;  4I9L A;  3MXI A;  3SUO A;  3EYZ A;  2IGI A;  5KRS A;  4C8O A;  3TAB A;  1W9H A;  3FFI A;  2O4G A;  2G8F A;  4C8L A;  4EZ9 A;  1RTI A;  4Q5V A;  3QES A;  1TKZ A;  4BE1 A;  1NK8 A;  5KTQ A;  3HP9 A;  5FRN A;  3DLB A;  3HST B;  2EHG A;  4CJP A;  3L2V A;  3U6F A;  1BIS A;  5T7B A;  2E6L A;  5C42 A;  1U47 A;  2QKB A;  3HT3 A;  3OYE A;  3PX6 A;  2LSN A;  5CYM A;  4FZY A;  3C94 A;  3VQ6 A;  1Z25 A;  4CFA A;  4KRE A;  1KFS A;  3QEP A;  1I3A A;  2HNY A;  2IDO A;  4Z4G A;  1YTA A;  3ZCM A;  1WSG A;  2HVI A;  3LP1 A;  4CGD A;  4E19 A;  4KHQ A;  5CZ2 A;  4LY7 A;  3LP3 A;  4H4O A;  3LZI A;  3ZT3 A;  4J2B A;  1LWC A;  3VQ8 A;  4FM1 A;  3I8D A;  2BE2 A;  4BDY A;  4DQQ A;  3EZ5 A;  1JXE A;  4CJF A;  4DWI A;  4CES A;  1U45 A;  4FJ5 A;  2Z1I A;  4M3W A;  4KTZ A;  4FYD A;  4OGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...