4CIFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cifA00
3HPGA 4GW6A 2KZZA 4CEEA 3OYLA 4OKEA 3SYZA 1JLGA 5HROA 3IG1A 3VQPA 4C8OA 1VSJA 3QEWA 1S9GA 3KLEA 4DTPA 4DG1A 3S9HA 1U45A 4CCHA 4FZYA 4E7JA 1HJRA 4JRPA 3CFOA 4I9LA 3QNNA 2FBVA 1S1VA 2YKMA 3HSTB 3ZSVA 4CJRA 4N76A 4FZZA 2ITGA 3NF8A 3NHGA 4AILC 3SQ0A 1DLOA 4CFAA 3SPYA 2QXFA 2IS3A 4CJFA 3H08A 4YFUA 4UQGA 4CEFA 4Z4IA 3OYAA 2E6LA 4CE9A 5FRNA 3S3OA 4CEDA 3U3GA 2OPPA 1C0MA 3VQDA 4FK0A 4Z4GA 3QLHA 4RW4A 4JRQA 3MEEA 4B9TA 4J2BA 3T19A 3CFPA 4CECA 4CJKA 2WOMA 3MEDA 1VSLA 3AVMA 3T3FA 3RMDA 3PX4A 1NK6A 1UOCA 3HO1A 1NK7A 3VQ6A 4J2DA 2HHSA 2HMIA 4E1NA 1ITGA 3AO5A 1QS4A 1TKDA 3ZSXA 4CEZA 3OYJA 4FLUA 3SQ2A 2P5GA 1CXQA 4DLGA 1S6PA 4QOZB 5KGXA 2DFEA 4DQIA 1K6YA 1WSEA 4O4GA 4BE0A 4DTOA 3ZSWA 5HBMA 2HHVA 4W5NA 1RDCA 4O5BA 1BIUA 3PO5A 4KPYA 1YTUA 4EP4A 4LH4A 1D8YA 1WSIA 2HB5A 3RTVA 4M3XA 2RPIA 1RTHA 3K5NA 1WAJA 4CHOA 4DSJA 3OYGA 3KIOA 3LP2A 4CGDA 3TAGA 3MXMA 4KB1A 1A5WA 3KLFA 5EU7A 5HLFA 1S5JA 1VK0A 4KB0A 4FJIA 3C6UA 4TSXA 5J2PA 3RR7A 1XHXA 2P5OA 1JLEA 1RT2A 4KTZA 4DU4A 2YNFA 2GUIA 1NJYA 1KVCA 3K5OA 1CXUA 4O0JA 1NJWA 4FW1A 1QSLA 4OLAA 4FLVA 4PQUA 4BDZA 4CFCA 4CJVA 3MEGA 1EETA 4E89A 4BE2A 3QEVA 4HCBA 2KTQA 1DTTA 3P5JA 1QQCA 3QIPA 1DTQA 3AVBA 3VQ4A 5JS1A 1HRHA 4Z0UA 4W5OA 3NF7A 3K58A 4CJUA 3DRSA 2KW4A 3VQ5A 2Q3SA 3CM5A 1X9SA 4DFJA 3M8QA 4MFBA 1NK0A 1KRPA 1C0UA 2GBZA 3AO4A 4XIUA 4H8KA 1D5AA 3SQ1A 4JLHA 3AA5X 4EZ9A 1RDBA 1FXXA 3B6PA 1XI1A 1TKTA 4ZHRA 4N5SA 1Q9XA 4AH9A 5DK5A 3D45A 5SZTA 4CJWA 1T03A 2GV9A 4E1MA 4ID1A 1HNVA 4FJKA 1VSIA 1ASWA 4KHYA 3TR8A 4AHRA 2DY4A 1HQUA 2JGUA 1L3SA 4CGGA 2AJQA 3V81A 3A2FA 3AA3A 3VQQA 4DSFA 3UIQA 3JYTA 2X74A 1RT4A 4BWMA 1RBRA 3QINA 4IKFA 3SCXA 4ZTFA 3HPOA 3L2RA 1BGXT 1VRUA 5CZ1A 2FBXA 1IG9A 2HHTA 3DRRA 3NH1A 5C24A 4BE1A 3TARA 4KI4A 1WSGA 3ZT0A 3AVNA 3PX6A 3VQEA 4CGJA 1Q8IA 1ASUA 3D0PA 4H4OA 3SI6A 3AA2A 2HNYA 3I8DA 1NK8A 1TGOA 2QKBA 3QO9A 5KI6A 4K8XA 1I3AA 5HRRA 1Z26A 3B6OA 1SL0A 4FJGA 3QEXA 3LP0A 4CF2A 1VSEA 2YNIA 3V9UA 2BE2A 4E0DA 2PYJA 4AHUA 1HQEA 4OGEA 2Z1JA 4FJMA 4KO0A 1JLFA 4B8CA 1X9MA 3OYEA 1LWCA 4E3SA 4FLYA 3RR8A 2HNZA 1QSSA 1IKYA 3V6DA 1UA1A 4HTUA 3LZIA 4HCCA 1X1PA 4DF4A 1WAFA 2G8FA 2OYQA 2OPQA 3QESA 4Z4CA 1ZBIA 2JLEA 4PUOA 1A5XA 3DYAA 4CFDA 2FC0A 2YNGA 3V1RA 3KK1A 3RMBA 3S3NA 4Q0BA 3T1AA 4DQQA 4CESA 3WNFA 1YTAA 3LANA 4FJ8A 1XC9A 2XHBA 1HPZA 5FRMA 4CEAA 1HYSA 1L3VA 4DS4A 3CM6A 5T7BA 3RWUA 4CEQA 1WNSA 1LW0A 1U47A 3L2UA 1UWBA 3AVAA 4LSLA 3L2WA 1RBUA 2B5JA 1ZBHA 2IC3A 3HP6A 4M3TA 4NYFA 3AVCA 2WONA 1B9FA 4FJJA 4FK4A 1L3TA 1IKWA 1O1WA 5KRSA 3HK2A 3TI0A 2X78A 1LWFA 4CHQA 3OS1A 3VQ8A 4F3TA 3DMJA 4CF0A 4HUEA 3NF9A 1EX4A 1RTDA 3PUFA 1QE1A 1VRTA 4FJ7A 1KCFA 1RDDA 2ZQBA 3P1GA 2XO7A 4NCGA 3ALYA 1B9DA 3V9SA 1CLQA 3NGYA 4CJLA 4NCAA 2HVHA 3PO4A 1C1BA 1U48A 1CZ9A 4PY5A 2P51A 4KHQA 1A5VA 1HYZA 4CF8A 2YHBA 1TL1A 5SWMA 3NFAA 3TWHA 2KQ2A 4CK1A 3TANA 4Z4EA 2HHWA 2Z1HA 4C8MA 4F2SA 4OPJA 2EHGA 3MECA 3RRGA 4ICLA 1WSJA 2XY5A 1S1XA 3V1OA 1NJZA 3P83D 3SUQA 3ZT1A 1ZBFA 1WN7A 3K5MA 3NDKA 4FJLA 1IH7A 3AO1A 1NOZA 3AV9A 1D9FA 3AVJA 2KZMA 1RBTA 3VQBA 4LSNA 4HHTA 3QNOA 4CJPA 2R7YA 3NH2A 1LAVA 3ULDA 1JXBA 3LAKA 4O55A 3V9XA 3KK2A 2XY8A 1N5YA 1KVBA 3PV8A 4KHUA 3AO2A 4FM2A 1L5UA 1RTIA 4RW8A 5E41A 1RBSA 4DTNA 4DSIA 4KAZA 1RT5A 4W5TA 4L8RB 4CGFA 3G10A 3L2VA 4O0IA 5CYMA 1Q9YA 4G1QA 2YHAA 4RG8A 3ISNC 1BI4B 4IDKA 4M45A 3L2QA 2ETJA 4KKOA 1NK9A 3HPHA 1JLBA 3TAMA 5C25A 3AVGA 3HYFA 1SKWA 4B9LA 2EX3A 2I5JA 4IG0A 2BDPA 1C1CA 3QEIA 2G8VA 3LALA 5J2QA 4CHNA 4QAGA 1VSMA 5J2NA 3LWLA 1RT6A 1VSKA 4DMNA 4IFVA 3V9ZA 3NGZA 1L3UA 3K2PA 4Z4FA 1U49A 3DLRA 2ZE2A 1BL3A 4CFBA 1RBVA 4RW6A 3WNGA 1HMVA 3OS2A 1GOBA 1S1TA 1U04A 1BCOA 4I2QA 2ZD1A 4E19A 4DF8A 3DLGA 4FJNA 2O4GA 1QHTA 3O3FA 4I9QA 1C1AA 4C8NA 4DSKA 2YNHA 3EYZA 1KSPA 3OYFA 3L3UA 2LSNA 3AA4A 1IKXA 1TV6A 3BGRA 4CJTA 4FM1A 4KI6A 3HL8A 2OZMA 3KLGA 3MXJA 5KGWA 1FK9A 2D0BA 4CGIA 4F4KA 2D5RA 3O4NA 4OJRA 3OYIA 1TL3A 1JLAA 2YKNA 4FLWA 3C95A 1NK5A 2DTUA 1YT3A 3HJFA 2A1SA 3V4IA 3SPZA 1EP4A 3U3YA 3NF6A 4N56A 2NUBA 4HUGA 2A1RA 3M8RA 4B9NA 3DOKA 1RT3A 3RRHA 1WLJA 4CEOA 1T7PA 3DM2A 1TVRA 3QETA 5HRSA 2XRIA 1SKRA 1C0TA 1QTMA 1KTQA 4DFKA 4ELVA 1WSHA 1UA0A 3HVTA 4DQSA 3ZSRA 3VA0A 3DI6A 4KTWA 1SL2A 4RW9A 2DFFA 5I3UA 1TK0A 1TK8A 4FZXC 4J2AA 4ELUA 3TABA 4DQPA 4FJ5A 2F8SA 4B3OA 4FVMA 4KFBA 2D0AA 4CJSA 1RILA 2PZSA 1JLQA 4FLTA 4FXDA 3K59A 3LP3A 2HVIA 3PY8A 3TAFA 4LH5A 3DLBA 2HNDA 3TAQA 2IGIA 1EKEA 2X6SA 3DLEA 3M8SA 4DTSA 1Z25A 3ZSYA 2BANA 2XY7A 3HT3A 4DSLA 1Y97A 3ZT3A 1NKBA 3BDPA 1X9WA 4B9MA 2DFHA 1J54A 4ELTA 2XY6A 4QCLA 4HUFA 3LDSA 4N41A 4EP5A 4IBNA 1W9HA 3AVFA 1TAQA 2G8IA 4DU1A 3VQAA 3ZT2A 2B6AA 4BDPA 2VG5A 2X6NA 4MQ3A 3S3MA 4FJXA 1S1WA 3SZ2A 3SNNA 1BI4A 4C8LA 2Z1GA 4KHWA 1KVAA 4RW7A 4W5QA 4Y1CA 1RDAA 4KHSA 4CIGA 5J2MA 1U4BA 3V1QA 1T05A 2G8WA 1RT1A 1W0HA 3O3HA 4Z4HA 2RKIA 3QEPA 3LPUA 4C8KA 3SQ4A 1RCHA 3MAQA 3AO3A 2D0CA 1C6VA 3NGIA 3CQ8A 4CF9A 3EZ5A 4IG3A 1S9EA 4CIEA 5DMRA 1ZBUA 3AVIA 4CF1A 4M41A 5HRNA 1S6QA 4BACA 1R0AA 4EZ6A 4YNQA 1RT7A 2F96A 3JSMA 2PYLA 3OYMA 3THVA 2RN2A 4J2EA 2IOCA 2E6MA 4BDYA 1VSHA 3I0RA 1SV5A 3DRPA 3SUOA 4B9UA 1F21A 1J5OA 3E01A 3U6FA 1TKXA 2FBTA 3OYBA 2BGGA 2OPRA 4M3WA 1KLMA 4NYNA 1BQNA 3G0ZA 4CJ4A 4DFPA 2HHXA 4W5RA 2IAJA 3HM9A 1BQMA 3O3GA 1VSDA 4AHTA 5D3GA 3V9WA 4I7FA 4E7IA 4E7KA 3VA3A 4NCBA 4F2RA 3LAMA 2FBYA 5CYQA 1REVA 1JKHA 4WE1A 1YVUA 3OYKA 5FROA 3CG7A 2E4LA 3DLKA 4JS5A 4JS4A 3ASMA 3KLHA 1UAXA 1HYVA 1JL2A 1LAWA 1IO2A 3I0SA 4HVJA 3OYDA 4N47A 3F9KA 4DQRA 1NJXA 3KK3A 3KLIA 3AVKA 2OA8A 2G8HA 3O4QA 4CIFA 3LWMA 4F3OA 4KHNA 2HHQA 2RF2A 4OKKA 3K5LA 4DTJA 3QIOA 3SV4A 3L3VA 4CJQA 3HXMA 1JLCA 4CJEA 3OS0A 4CHPA 1NK4A 3HP9A 3AVLA 3CYMA 3NAEA 3IS9A 3RMCA 2F8TA 2KFZA 1IKVA 3ZCMA 2Z1IA 1JXEA 3VQCA 3OVNA 3OYHA 1LV5A 1NOYA 3FFIA 1BISA 4FW2A 4H4MA 5FDLA 4CHYA 4OPKA 3KJVA 1QSYA 3ZSQA 3NBPA 3VQ9A 2VG6A 3KKRA 5HP1A 1ASVA 4B9VA 4KRFA 4I2PA 1G15A 1VSFA 4R5PA 4PA1A 4ZTJA 2G8UA 4PWDA 4FLZA 5CZ2A 1SKSA 4FLXA 2IDOA 1J9AA 1S1UA 4K8ZA 4M3YA 1I39A 1GOAA 3MXIA 1MU2A 5C42A 5K14A 3WNHA 3OYCA 1N6QA 1RNHA 4LY7A 4OVLA 3SUNA 2B4JA 3KD5E 5KTQA 1ZYQA 4ID5A 1XWLA 2OPSA 4FCYA 3SV3A 1XHZA 3ZSZA 2G8KA 2O4IA 1GOCA 1WSFA 3WNEA 3KTQA 3K57A 1TK5A 4FK2A 1LWEA 4DTUA 3DOLA 4IFYA 4Y1DA 1KLNA 3OJUA 4DSEA 3EY1A 1D9DA 1TAUA 4B8AB 3LP1A 1ZBLA 2Y1IA 3LPTA 4CHZA 2VWJA 1HNIA 4E7HA 1T8EA 4E7LA 4FYDA 4CERA 3IAYA 4FJHA 3TAEA 4GMJB 3OJSA 3SJJA 1BCMA 3NE6A 4FM0A 1FKOA 3PX0A 2VG7A 5HRPA 2P1JA 3HVRA 2W42A 3F73A 2QK9A 3M8PA 1RTJA 5JS2A 4CK2A 4CEBA 1SL1A 1KFDA 1SUQA 4B08A 4DLEA 4M3UA 3KKSA 3CFRA 1EXQA 4KV8A 4M3RA 4DTXA 2Y1JA 4DWIA 3ZSOA 4BWJA 3C6TA 5I42A 4AHSA 4OGCA 3OYNA 3KD1E 3ZT4A 4DFMA 4B9SA 3DLHA 1KFSA 3QERA 2QKKA 1BHLA 2PY5A 2OZSA 4LD0A 4KREA 3OY9A 2HHUA 4OKJA 4AHCA 3ITHA 3AVHA 2VWKA 3IRXA 4DS5A 1FKPA 4DU3A 3SUPA 4F8RA 4KTQA 4OLBA 3L8BA 1NKEA 3NCIA 1BIZA 1CZBA 3NH0A 4CJ5A 1TKZA 3VQ7A 4AHVA 3LZJA 5J1EA 3TAPA 4DTMA 3RMAA 1NKCA 4DTRA 2HW3A 1J53A 2YV0X 1JL1A 4CJ3A 1B92A 5KRTA 4Q5VA 4FJ9A 2KFNA 4M42A 4CK3A 4GVMA 5CY4A 4M3ZA 3VN5A 2ATQA 1LW2A 3C94A 4O44A 4CGHA
chains in the Genus database with same CATH superfamily
4YOXA 4FWQA 1JLGA 2QEXN 3IG1A 4DV6K 1QQNA 3S9HA 5AQVA 4CBWA 4E7JA 3HRGA 2FBVA 2HOEA 3Q7BA 3NHGA 4AILC 2E88A 3SPYA 2QXFA 2IS3A 1EWQA 3M6GA 3VGMA 5JMVA 3S3OA 3VQDA 5KPTA 4JK7A 3QLHA 3MEEA 4JI5K 4CECA 5KQDA 2V7ZA 3MEDA 1NK7A 4J2DA 4JYAK 1QS4A 2QM1A 4FLUA 1SAZA 3A8YA 4DQIA 1K6YA 5GAHP 4GV9A 3CCMN 4O5BA 3ULEB 1HPMA 2A5XA 5E26A 5CE3A 4LH4A 2QWOA 3RTVA 4M3XA 1RTHA 4WF9L 3TAGA 4KB1A 3SMSA 3LDLA 5ADXA 3D2EB 1A5WA 2A6AA 5AQSA 1VK0A 4FJIA 3UKRA 1XHXA 1JLEA 1RT2A 3LM2A 1NGAA 4HWIA 2YNFA 1CXUA 2EWSA 4FW1A 1QSLA 4CFCA 5JVHL 3IMXA 4HCBA 2VYPA 3NMUA 2YJEA 2KTQA 1DTQA 4W5OA 3NF7A 1HKCA 3OBYA 3MX5A 4CJUA 2P9SB 4K25A 3C65A 2FSJA 1Z05A 2NZTA 3M3ZA 4YY3K 1XUPO 4YHHK 1GLFO 1FXXA 1XI1A 1NMDA 4ZHRA 4N5SA 4AH9A 5SZTA 4CJWA 4E1MA 4FJKA 2DY4A 1VSIA 1ASWA 2GWJA 4EHUA 1W7AA 1L3SA 2AJQA 4BRQA 5LJWA 4JI8K 3A2FA 3AA3A 3VQQA 1RT4A 3OBWA 4FPAA 3SCXA 3HPOA 3DRRA 4JK9A 4BE1A 3VEVA 3TARA 1KD1O 2YHWA 1VQ4N 4H0OA 3D0PA 1ZC6A 2H3GX 2QKBA 4FJGA 3LP0A 4CF2A 1VSEA 2YNIA 2BE2A 4E0DA 4OGEA 4A5AA 3J80O 2A40A 5AQPA 2HBLA 4B8CA 1NGDA 4E3SA 4FLYA 3V6DA 4DV2K 1UA1A 4NLCA 2Q1NA 1X1PA 1BOTO 1ZBIA 3LDNA 3DYAA 4CFDA 2FC0A 3S3NA 3LL3A 4WFBL 4JI3K 3T1AA 4DQQA 4IOCL 2VWBA 3EKUA 3LANA 5M1OA 1HPZA 4B3MK 5T7BA 1LW0A 4DQ8A 1UWBA 3THWB 2B5JA 3HP6A 4BC3A 1QVGM 2RE2A 3O4WA 1B9FA 4DR4K 1RDWX 1J6ZA 1RGIA 5KRSA 1T6CA 2D0PA 4CHQA 2A41A 4CF0A 1GLEG 3CJ7A 1EX4A 3E66A 3PUFA 3WXIA 4FJ7A 3P1GA 4NCGA 2HVHA 5LJVA 3F9MA 2YHBA 2KQ2A 2HHWA 2O8FA 2AA4A 2Z1HA 1WB9A 3RRGA 3V1OA 2O8BB 3P83D 4FWMA 1WN7A 3K5MA 3NDKA 3R3LA 3AO1A 1NOZA 3AV9A 1D9FA 4JEPA 1S22A 4BC4A 4CJPA 2R7YA 2OTLN 3O08A 3LAKA 3V9XA 5I9EB 4KHUA 4FM2A 2QA4N 3VF2A 1RT5A 4O0IA 1Q9YA 2YHAA 3HPHA 3KWIA 5FPMA 2EX3A 4I6MA 3QEIA 1VSMA 5J2NA 3LWLA 1QZ6A 2ASMA 3AY9A 5F2RA 1L3UA 2GWKA 3K2PA 3G4SN 3BP8A 1GOBA 4OX9K 3DLGA 3O3FA 1I94K 4C8NA 4MLHA 4BR5A 3EYZA 3IDHA 3OYFA 2QWQA 3L3UA 4FM1A 4JHDA 3ZX2A 3WXMB 4CGIA 4WFAL 2UUBK 4OJRA 3OYIA 3C95A 3L0QA 5AQZA 1YT3A 2A1SA 3QICA 5AFUA 2NUBA 5AQYA 1VQNN 3GBTA 4BC5A 5AFUH 3Q7CA 4B9NA 1NU0A 3DOKA 3RRHA 1WLJA 4CEOA 3HZ6A 1BO5O 5AQNA 1KTQA 4DFKA 3THXB 4ELVA 2CGLA 5B8HA 3ZSRA 4RW9A 2DFFA 3L4QA 3D2FA 4FJ5A 1U2VA 3C0BA 4FVMA 4CJSA 2P9IA 3U9ZA 3BUZB 3K59A 2HVIA 4DV0K 5KPRA 2X6SA 5FPNA 1Z25A 2XY7A 4PKHA 4G9ZA 4H0PA 2DFHA 1OVQA 3TTFA 2WFBA 4BGAA 2O8CB 4EP5A 3FGUA 1V4TA 4BDPA 3KWGA 1S1WA 2YCHA 3SNNA 1KXPA 4KHWA 1KVAA 4RW7A 3LM9A 4Y1CA 4WFNL 4H5VA 4CZJA 1RT1A 4CVNE 4X65K 5GAEP 1LOTB 4LC9B 2ZWHA 3NGIA 3ZX0A 4JD2A 4KI4A 5M1PA 5HRNA 3AGRA 1C0GA 3DXMA 4FWLA 3UKUA 4BR9A 3JSMA 3TTDA 2RN2A 2ASPA 5AQQA 4LF9K 4B9UA 1J5OA 3E01A 3ATVA 4CZGA 2OPRA 1KLMA 5ELZA 4B1VA 1BQNA 3CJ1A 2IAJA 5M1NA 3ZYYX 2QWNA 4DV1K 4E7KA 1YUWA 2I7PA 1IG8A 2YHXA 3CG7A 3DLKA 4JKBA 3KLHA 4NXMK 1NJXA 1IO2A 4N76A 3F9KA 4DQRA 2OA8A 4JKAA 3LWMA 1EQYA 4OKKA 4KH6A 2P9NB 3CMEN 4BROA 4DV3K 4YOWA 3CCQN 3ZCMA 2O8BA 1G99A 1LV5A 3FFIA 4FW2A 4RWTA 4OPKA 1QSYA 3WEEB 3DJCA 4B9VA 4KRFA 3IKMA 1D4XA 1G15A 5KQ8A 4ISGA 1VSFA 4JI0K 3QDKA 5CZ2A 2FF6A 4CJ7A 1S1UA 3MWTA 5AQRA 3MXIA 5C42A 5K14A 1N6QA 1RNHA 4LY7A 4OVLA 3KD5E 3PIPL 4XH4A 4A2AA 4X62K 2W41A 4Y1DA 4K41A 2IVOA 4FWOA 3LPTA 3H1QA 3VESA 1VQ6N 4IWVA 3CC2N 3IAYA 3TAEA 3OJSA 4FM0A 1VQPN 1FKOA 4YOTA 2VG7A 3PX0A 3HVRA 4LF5K 1RTJA 4CK2A 1KFDA 4JN4A 2YX6A 4DWIA 3C6TA 5I42A 5CHIA 4AHSA 3D2FB 4OGCA 3U4LA 4EFHA 1XMQK 3C7NA 3VEOA 2HHUA 3AVHA 2VWKA 3R8EA 1ESVA 4CZLA 3I55N 5AQIA 4DU3A 4OLBA 3NH0A 4CJ5A 3CJCA 2YJFA 1NKCA 2HW3A 2YV0X 5KRTA 2KFNA 1B92A 3CMAN 4M42A 4CK3A 4GVMA 3C94A 4O44A 2OTJN 3LDSA 3NVMA 5IT9O 3EN9A 4GW6A 1YF5L 4CEEA 5AZJA 1GLBG 1S9GA 4IOXA 4CCHA 3CFOA 3GOIA 2QTDA 1U2VB 3HSTB 4CJRA 3SQ0A 4CFAA 4CJFA 4UQGA 4CEFA 1Q81O 5AJ3K 3HTVA 5C10A 4CE9A 4FK0A 1YHQN 2W40A 2QWRA 4CBUA 4B9TA 2UXCK 4FPBA 3T19A 3CFPA 2V7YA 1K73O 3AVMA 3CF5L 3RMDA 1ITGA 3S41A 1XC3A 3SQ2A 3OYJA 2P5GA 1CXQA 1S6PA 5KGXA 1GLLO 1WSEA 5HBMA 2HHVA 4W5NA 1YXQA 1BIUA 1YTUA 4EP4A 3O1BA 1D8YA 1NBWA 4GY2B 3K5NA 4DSJA 3OYGA 3CJBA 2NRWA 5HLFA 1ATNA 1NWKA 5J2PA 1P90A 4KTZA 4DU4A 2PAVA 5LMNK 1OH6A 1KVCA 3VENA 4GV6A 1NJWA 5BRFA 1NNEA 2FSKA 3MX2A 4PQUA 4R79A 3A5LC 4BE2A 1EETA 1T6DA 1QZ5A 4H0VB 3P5JA 5AZIA 2E2QA 3QIPA 3VQ4A 3AVBA 2F4VK 3CI5A 3E9LA 3DRSA 2KW4A 2Q3SA 3CM5A 1X9SA 3M8QA 4MFBA 1KRPA 3QB0A 3AO4A 1JCGA 4H8KA 3P38A 1D5AA 4AF1A 3SQ1A 3AA5X 4EZ9A 3ENHA 4B1UB 5AR0A 3B6PA 2V52B 2NRVA 2GV9A 4ID1A 4KHYA 1HQUA 2OCEA 4BRKA 2JGUA 3WQUA 1N8RO 4DSFA 4BWMA 3EEQA 4ZTFA 1VRUA 1IG9A 3PX6A 1Q8IA 3SI6A 1S72N 1TGOA 3QO9A 5H1SQ 4K8XA 3GDQA 2O8EA 1Z26A 1DEJA 1NMNA 3O1WA 4FWRA 3V9UA 5GADP 2PYJA 2HF3A 2Z1JA 5JLFA 1X9MA 5EX5A 1Y64A 3RR8A 2RHKA 1IKYA 4O8KA 3LZIA 1WAFA 2G8FA 3KK7A 4B9QA 4PUOA 2YNGA 3ULEA 3V1RA 3VF6A 3RMBA 2NNWA 4CESA 2P9KA 4M7XA 2F9WA 3RWUA 4V19S 4CEQA 3L2WA 2E1ZA 2IC3A 2P9LB 2WONA 1YAGA 3G6EN 4OPAA 4FJJA 4DR7K 1IKWA 3MN6A 3HK2A 4LFBK 3VEYA 3P39A 3VQ8A 3TSQA 3CCJN 3DMJA 3FZHA 1X9JA 5BPLA 1RFQA 2XO7A 1CLQA 1VQON 1U48A 4KHQA 4QS9A 1Q86O 3TWHA 3TANA 4Z4EA 4C8MA 1R59O 3MECA 3CJAA 3UKRB 1WSJA 1S1XA 3SUQA 3CERA 4H0XB 4FJLA 4K0KK 2KZMA 3RVCA 3NH2A 3ULDA 1JXBA 4JD2B 4PKGA 2QXLA 1KVBA 5E41A 4KH4A 1NGJA 4W5TA 3L2VA 3DAWA 3O8MA 4H0TB 4RG8A 2E2PA 1NK9A 3MCPA 2FLOA 1VQKN 1NGIA 5C25A 5AQMA 4CZFA 1OH8A 3BF3A 4H0YB 2G8VA 3LALA 5J2QA 2UXDK 4CHNA 1RT6A 1VSKA 4EHTA 3V9ZA 4BR2A 3T1YK 4M63C 3CPEA 1U49A 4RW6A 3WNGA 4BC2A 2P9UA 3VF4A 3OS2A 4E19A 1S1TA 2PFUA 4K42A 2YNHA 1FW6A 3AA4A 3FFKB 3M5RA 3HL8A 2OZMA 3N4PA 2D5RA 4O8UA 5C2FA 3J81O 4FLWA 2E8AA 3V4IA 1E3MA 3SPZA 3U3YA 3NF6A 5LL6Z 4N56A 1XNQK 3ZEUB 3M8RA 3FE1A 1T7PA 3ID8A 4JKHA 3R9PA 3QETA 1WBBA 1SKRA 1C0TA 1TYQA 1QHAA 1UA0A 4DQSA 3SMPA 1TK8A 4ELUA 3EO3A 3GG4A 4B3OA 1Q82O 3SAGA 4KFBA 2E5LK 1GLAG 4NXNK 4FLTA 3H3OB 4A61A 1ZBSA 3R6MA 4JI1K 3TAQA 2IGIA 1EKEA 4DSLA 2HF4A 5JICA 3AARA 1Y97A 3HT3A 3BDPA 2UU9K 1J54A 4ELTA 1TYQB 2XY6A 3PLAA 4HUFA 2OANA 5BN8A 3TTCA 3MCAB 3OTOK 4DU1A 3VQAA 3ZT2A 4MQ3A 2X6NA 2KHOA 3S3MA 4FJXA 3QMLA 1BI4A 2E2NA 5FLXO 3B8AX 5AQJA 4CIGA 5BR8K 3V1QA 2G8WA 4FOEA 2RKIA 3BZCA 3MN7A 3VETA 4C8KA 5CR4A 2HBMA 4BRHA 4UY8O 4H03B 1R0AA 3VTHA 3WXLA 2GX9A 5M1FA 3IUCA 2ZJQL 3SLCA 2NRZA 3F5TA 2P9UB 3CXCM 3I0RA 4DV7K 4BDYA 3DRPA 5BRHA 3SUOA 4IJAA 1N34K 2IIRA 2QWPA 2FBTA 3OYBA 2HHXA 2PBDA 3CETA 1H1VA 3JS6A 1VSDA 1BU6O 3V9WA 4LFCK 3VGKA 4NCBA 3LAMA 2FBYA 5CYQA 1REVA 3PSIA 1YVUA 3OYKA 4DV4K 2E4LA 4JS5A 3ASMA 4Y0WA 2Q0RA 1LAWA 4JNEA 4N47A 3KLIA 3AVKA 3O4QA 4F3OA 4OPHA 2RF2A 3K5LA 3HXMA 4CJEA 4BRGA 3OS0A 3HP9A 3AVLA 5AQWA 1YJNN 3IS9A 1FJGK 3VQCA 4CZEA 3WT0A 1HX1A 1BISA 4H4MA 4CHYA 5FDLA 3KJVA 4K43A 3E9PA 3KKRA 3U8XA 1ASVA 1KAXA 3GE1A 3BF1A 4PA1A 4ZTJA 1SKSA 2UXBK 4FLXA 1K8KA 3VEZA 4M3YA 3WNHA 3THXA 2B4JA 5GIOA 5KTQA 5M1QA 1XWLA 2OPSA 3SV3A 2O4IA 3WNEA 4FK2A 3K57A 5AQHA 4HTLA 2W6LA 4DTUA 4IFYA 1NLVA 2CH5A 3O80A 3WXKA 1D9DA 4B8AB 1VQLN 3LP1A 4E7LA 4DV5K 4GVEA 4NB4A 4BRMA 3ZETB 3NE6A 5A2QO 5HRPA 4JAXA 3MN9A 2P9KB 1SL1A 3T7ZA 4JKDA 4DUYK 1EXQA 4KV8A 4DTXA 1KAYA 5BPNA 4BWJA 5BREA 1T3VA 4M7YA 1J5EK 4WQ4A 4CZHA 1NM1A 3OYNA 3KD1E 3TU5A 3O9SA 4H5TA 2VQEK 2QKKA 4WQ5C 3W3DA 2NRTA 4AM6A 2OZSA 1NGHA 4LD0A 4U67L 3T69A 3SUPA 1NKEA 4I6MB 2WBNA 3VQ7A 5J1EA 2QWMA 3C7NB 4JKEA 4DTMA 3CHWA 3RMAA 4FSVA 4Q5VA 1BA1A 4BVPA 5CY4A 4CGHA 2IVPA 3UE5A 1C0FA 3HPGA 2KZZA 3LDOA 3OYLA 3SYZA 5HROA 3VQPA 4C8OA 3QEWA 3KLEA 1U45A 2P9PB 3SBGA 4JRPA 4DR2K 3QNNA 3HBTA 3LDPA 2YKMA 5C0YA 2ITGA 3FZLA 3NF8A 4ILJA 4BRDA 4LF4K 4CI6A 2O8DA 1IV0A 1NGBA 3A5NC 4YFUA 3H08A 2BTFA 3RSEA 2E6LA 3ZLJA 5HOOA 4CEDA 3U3GA 3MDQA 1WOQA 5AZIB 4JRQA 1Q7YO 4J2BA 4A57A 1VSLA 3HO1A 3PX4A 3VQ6A 3HOSA 1WUAA 3AO5A 3ZSXA 3WEEA 2ZJPL 2DFEA 3I56N 3LDQA 1RDCA 3PO5A 1HLUA 1WSIA 5DM6L 1WAJA 3KIOA 3LP2A 3K9JA 4CGDA 3KLFA 5EU7A 4KB0A 1S5JA 5AQTA 5MLCQ 3WXJA 3C6UA 4TSXA 5C2DA 3P4IA 3RR7A 3MMVA 4DB3A 2GUIA 4FLVA 4ILHA 4E89A 1MWMA 3QEVA 2UUCK 1DTTA 1QQCA 2ITMA 3EZWA 1HRHA 4Z0UA 2QI2A 2D4WA 4BREA 3A0IX 3L6QA 3K58A 2Q36A 3R1XA 4BQLA 4DFJA 1NK0A 1C0UA 3G71N 1RDBA 1TKTA 3DXMB 4XH5A 1Q9XA 3D45A 4AM7A 1QQMA 1T03A 1HNVA 2I7NA 3TR8A 2NRRA 4CGGA 3V81A 1EO1A 3OA9A 3JYTA 2X74A 3CC7N 2P9NA 4IKFA 1JCEA 4BG9A 3L2RA 5CZ1A 2HHTA 4CBXA 3NH1A 4PKIA 1WSGA 3AVNA 4MO5A 4CGJA 1ASUA 1NK8A 2HBJA 2HNYA 3I8DA 2JWLA 5KI6A 1I3AA 5HRRA 3B6OA 1SL0A 1N32K 4AHUA 4FL9A 4FJMA 4X64K 3OYEA 2NRXA 1K8KB 2HNZA 4L3QA 4HCCA 2HSTA 4DF4A 2OPQA 3QESA 2JLEA 1A5XA 3DLLL 3KK1A 3WNFA 4WYBA 4BGBA 2Q0UA 2Q97A 1NGGA 2XHBA 4DHYA 3QFPA 1GLDG 4WQ4C 2BH1A 1HKBA 4DS4A 1L3VA 1U47A 3O9QA 1GLCG 1RBUA 1ZBHA 4KBOA 3CIPA 4M3TA 3AVCA 4BQZA 1E4FT 4MLEA 4GV3A 2FSNA 3N4QA 1OKJA 3K9KA 1L3TA 4FK4A 1O1WA 3E9OA 2X78A 1LWFA 4O5FA 3DWLA 4F3TA 4HUEA 1RTDA 3TSUA 1VRTA 1KCFA 2ZQBA 3GL1A 3ALYA 5C12A 3NGYA 4NCAA 3PO4A 2P9LA 1A5VA 4CF8A 2O8CA 2ZGYA 1MWKA 4CK1A 4C1NK 4CW7B 4OPJA 2EHGA 1M90O 1NGEA 3ZX3A 3ZT1A 4KHPK 1ZBFA 5EY4A 3VQBA 4LSNA 3QNOA 3SBTA 4FO0A 3ENOA 3TSPA 2XY8A 1N5YA 3AO2A 4LF7K 1X3NA 4JKGA 4DSIA 3IFRA 5AQLA 4L8RB 3G10A 1ATRA 2F9TA 5CYMA 1VQ9N 4G1QA 1K8AO 3ISNC 1BI4B 2ETJA 4KKOA 1JLBA 4B9LA 1SKWA 3AVGA 5M1KA 2KKZA 4IJNA 2I5JA 4IG0A 5GAGP 3CD6N 1C1CA 1BDGA 4C1NI 2CGJA 1VQ5N 4DMNA 3NGZA 4JHDB 4WCEL 4Z4FA 3DLRA 2ZE2A 1RBVA 3JAMO 1U04A 4IOAL 4DF8A 2O4GA 1QHTA 4I9QA 3UKUB 1E4GT 5DM7L 2HHHK 2LSNA 4Z94A 1IKXA 4CJTA 5ADXH 3MXJA 1VHXA 4DR1K 3CC4N 1BA0A 3O5BA 1TL3A 1JLAA 2YKNA 1NK5A 1NG9A 1M1KO 3HJFA 2D0OA 4IEIA 3J8AA 3T1HK 1RT3A 4YDUC 3DM2A 1TVRA 4JKFA 5HRSA 2XRIA 1QTMA 4A2BA 1WSHA 3AAQA 1JJ2M 3DI6A 4JI2K 3KZBA 5I3UA 4FZXC 4DCHA 4DQPA 2F8SA 3H3NO 2D0AA 1JLQA 2GUPA 3PY8A 3TAFA 4H5WA 3DLBA 3HI0A 4RTFD 4DTSA 3ZSYA 2BANA 3K0SA 3ZT3A 1NKBA 4YOYA 3VGLA 1X9WA 2VQFK 4QCLA 4IBNA 3CJ9A 3AVFA 1TAQA 4DKWA 2ZM6K 2VG5A 3VPZA 4C8LA 1HNWK 1W2BM 4ISEA 1T05A 1QQOA 1W0HA 2O8DB 4Z4HA 3QEPA 1YI2N 2W6KA 3D7EO 2YHYA 3SJHA 4IG3A 1S9EA 1YVNA 1ZBUA 4B1WB 2QW9A 2PYLA 3CQXA 1OH5A 2IVNA 5E84A 3SAHA 1F21A 4IO8A 4NO7A 2J4RA 3D6RA 2BGGA 4M3WA 4NYNA 3G0ZA 4CJ4A 4DFPA 1RDUA 4U7BA 4C23A 4AHTA 4I7FA 4E7IA 4BRAA 1DT9A 4B3RK 2HMPA 3C6AA 3G25A 1UAXA 3QBXA 1HYVA 3HM8A 3KK3A 4GKJK 2G8HA 4CIFA 4KHNA 2HHQA 2WUSA 3QIOA 3SV4A 4CJQA 5AQKA 3CYMA 1SZ2A 1IJJA 3RMCA 2Z1IA 3OVNA 1NOYA 2ASOA 1WBDA 5EXWA 2YI1A 5JLHA 3CCEN 3VQ9A 5HP1A 5FPEA 2O8FB 4PWDA 2G8UA 2FF3B 4B1YB 3WUHA 1J9AA 3P31A 3MN5A 3H46O 1W97L 4ID5A 4FCYA 4BRIA 3PIOL 4IO9L 1XHZA 3ZSZA 2G8KA 3KTQA 1TK5A 1LWEA 3A5OC 1KLNA 4BRLA 3O9TA 4CHZA 4E7HA 2UUAK 3O9RA 4JKCA 4CERA 2WC9A 3HSCA 3THWA 4GMJB 3SJJA 1BCMA 3EE9A 1BUPA 2P1JA 3F73A 2W42A 2AP1A 1SS6A 1SUQA 4B08A 4CZIA 3CFRA 2Y1JA 4DR6K 1XQSC 1P8ZA 3O6WA 3UB5A 3ZT4A 1KFSA 2PY5A 4DR5K 4KREA 3OY9A 3ITHA 1Z6RA 4DS5A 5TKYA 1VQ7N 4KTQA 3OHRA 4BR0A 2VGNA 4H5RA 1BIZA 1CZBA 5F0XA 3CCUN 1HUXA 1T44A 1XNRK 4DTRA 1J53A 1JL1A 4B3TK 5AQXA 3BZKA 5BPMA 5BR9A 1BWFO 4JV5K 4OKEA 4J8FA 4BRCA 1VSJA 3ATUA 4DTPA 4DG1A 4FZYA 1HJRA 4I9LA 3J7ZO 5AQOA 1S1VA 3C6HA 3ZSVA 4PHTX 4FZZA 4RCHA 1HNZK 1VQMN 1DLOA 4Z4IA 2WTUA 3OYAA 5FRNA 1QVFM 2OPPA 1C0MA 2GEMA 4Z4GA 4A62A 4KH5A 4RW4A 5GINA 4IFEA 3FZKA 3WQTA 4CJKA 1NJIO 2WOMA 2JWKA 3I33A 3T3FA 1NK6A 1UOCA 2HHSA 5FPDA 2ZGZA 4E1NA 2HMIA 4WQ5A 2GTDA 1TKDA 4CEZA 3OW2M 1GLJO 3E1YA 4DLGA 2ZF5O 4QOZB 4O4GA 4BE0A 3EKSA 4DTOA 3ZSWA 3VTIA 3D2EA 1CZAN 4KPYA 2HB5A 4JI6K 2RPIA 4CHOA 3FLCO 3MXMA 5AZJB 1XMOK 4NLBA 2P5OA 4BY9C 3CCSN 1YJ9N 1NJYA 3AAPA 3K5OA 4O0JA 3H6EA 4OLAA 4FWPA 3ID6A 2E1YA 4BDZA 4YOUA 4CJVA 3MEGA 3FZFA 5F1XA 3O9UA 1X3MA 1DGKN 5JS1A 4MDAA 3VQ5A 4H5NA 1NGCA 3CQYA 4MDBA 4YDUA 5AQUA 3VMFB 3VERA 2GBZA 4XIUA 4F9OA 4JLHA 4BVOA 1YIJN 4LF6K 1DKGD 4BRFA 4PL7A 5DK5A 4QS7A 4AHRA 5AQFA 3UIQA 1SQKA 3TPQA 1RBRA 3QINA 1BGXT 4QS8A 2FBXA 5C24A 3ZT0A 3VQEA 4GKKK 4CD3A 4H4OA 3AA2A 3THYB 3QEXA 2CGKA 5LMUK 1LCUA 1HQEA 3BEXA 4KO0A 1JLFA 1OVYA 3H45C 1LWCA 1QSSA 3A5MC 4HTUA 4EAHD 5EOYA 4IEEA 2OYQA 1HJOA 4Z4CA 4Q0BA 2CH6A 1N36K 1N33K 2DPNA 1NGFA 1YTAA 4FJ8A 1XC9A 5FRMA 4CEAA 1HYSA 3CM6A 3ZETA 3VEWA 1WNSA 3L2UA 4LSLA 2P9IB 1MA9B 3AVAA 4FWNA 4NYFA 5C15A 1HR0K 2QWLA 4OO1J 3KHYA 1S3XA 4E1JA 4IZ9A 3TI0A 3OS1A 1KC8O 3VEXA 1HNXK 3NF9A 1QE1A 1RDDA 5BRDA 3V9SA 1B9DA 4CJLA 1C1BA 1CZ9A 1K9MO 4PY5A 2P51A 1HYZA 1OH7A 4BRPA 2V51B 1TL1A 5SWMA 3NFAA 3CPWM 4F2SA 3FR0A 4ICLA 4BR4A 2XY5A 4YORA 1NJZA 4IDHA 3EL2A 4XEIA 1IH7A 3AVJA 1RBTA 4HHTA 1LAVA 5BN9A 2NRHA 4O55A 3KK2A 3PV8A 1IBKK 1L5UA 1RTIA 4RW8A 1RBSA 2KLAA 4DTNA 4KAZA 1O13A 3MK6A 2FXUA 4CGFA 1V4SA 4IDKA 4M45A 3L2QA 2O8EB 3TAMA 3HYFA 3HOTA 2BDPA 4B1ZA 4QAGA 4A59A 4FVUA 3RSEB 4IFVA 4CZKA 4FOIA 1BL3A 4CFBA 1HMVA 3MWPA 1BCOA 4I2QA 2ZD1A 4FJNA 1C1AA 4BRNA 4ISFA 3PSFA 4DSKA 1U6ZA 1KSPA 3W0LA 2Q2RA 1TV6A 2E20A 3BGRA 4KI6A 3KLGA 5KGWA 2ZJRL 1FK9A 2D0BA 4F4KA 3O4NA 1JCFA 1EWRA 2DTUA 4FWSA 1EP4A 4EIAA 4LFAK 4HUGA 2A1RA 3KVGA 1VAZA 2GELA 1ILYA 3ENBA 4JI4K 5EVZA 3HVTA 3VA0A 4KTWA 1SL2A 1TK0A 4J2AA 3TABA 2E2OA 1RILA 2PZSA 2P9PA 4FXDA 3LP3A 4LH5A 2HNDA 3DLEA 3M8SA 5GIPA 4B9MA 1BG3A 2A3ZA 4N41A 3M1FA 1W9HA 4JK8A 2G8IA 2B6AA 3J7AP 3F2KA 4DR3K 3SZ2A 3NVKA 2Z1GA 4W5QA 5JVGL 1RDAA 3SK3A 4LF8K 4KHSA 3QFUA 3AGKA 5J2MA 1U4BA 3O3HA 3LPUA 2Q31A 3SQ4A 1RCHA 3MAQA 3AO3A 2D0CA 1C6VA 3CQ8A 4CF9A 3EZ5A 4CIEA 5DMRA 4CF1A 3AVIA 3J7YP 4M41A 4BACA 1S6QA 4EZ6A 4YNQA 3L4IA 1RT7A 2F96A 3OYMA 3THVA 4J2EA 2IOCA 2NLXA 2E6MA 5HL7L 1VSHA 1SV5A 3U6FA 1TKXA 2VCPA 4W5RA 1MDUB 3HM9A 2HBKA 1BQMA 3O3GA 4B3SK 5D3GA 3VA3A 3U9DA 2P9SA 3BY5A 4IXCA 3SAFA 4F2RA 4FWKA 1JKHA 4WE1A 5FROA 3THYA 3DXKA 4JS4A 1YJWN 4A5BA 1JL2A 1TUYA 3I0SA 4HVJA 3OYDA 1IBLK 4X66K 4CD1A 4DTJA 3L3VA 1JLCA 4CHPA 1NK4A 3NAEA 2F8TA 2KFZA 1IKVA 1Q18A 1JXEA 5LY3A 3OYHA 2BUPA 3CCVN 2UYTA 5IWAK 3ZSQA 3NBPA 2VG6A 1KQSM 5TKWA 4I2PA 4R5PA 4BR7A 4FLZA 2IDOA 4K8ZA 3ZEUA 1I39A 3I8BA 1GOAA 1HKGA 1MU2A 5KPZA 3OYCA 3SUNA 1VQ8N 1ZYQA 3CCLN 1ATSA 1GOCA 1WSFA 4JKGB 3DOLA 3OJUA 4DSEA 4B1XB 3EY1A 1TAUA 1ZBLA 2Y1IA 1IBMK 2VWJA 1HNIA 1T8EA 4FYDA 4XH1A 1TUUA 4FJHA 3VOVA 2QK9A 3M8PA 5JS2A 4CEBA 4DLEA 4M3UA 1ZXOA 3KKSA 3CCRN 4M3RA 3ZSOA 2F7TA 4B9SA 1KAZA 4DFMA 3DLHA 3QERA 3JXUA 1BHLA 4GNIA 3FZMA 4AQYK 3DXKB 4OKJA 4AHCA 5AQGA 4MO4A 3IRXA 1FKPA 4JI7K 4F8RA 3L8BA 3EE8A 3NCIA 4BG8A 4PL8A 1TKZA 4ILGB 4DUZK 4AHVA 3LZJA 2A42A 3TAPA 4YOVA 4CZMA 4FJ9A 4CJ3A 2D1KA 2VGMA 1YITN 4M3ZA 3H1VX 3VN5A 2ATQA 3QBWA 1LW2A
chains in the Genus database with same CATH topology
3HPGA 4GW6A 2KZZA 4CEEA 3OYLA 4OKEA 3SYZA 1JLGA 5HROA 3IG1A 3VQPA 4C8OA 1VSJA 3QEWA 1S9GA 3KLEA 4DTPA 4DG1A 3S9HA 1U45A 4CCHA 4FZYA 4E7JA 1HJRA 4JRPA 3CFOA 4I9LA 3QNNA 2FBVA 1S1VA 2YKMA 3HSTB 3ZSVA 4CJRA 4N76A 4FZZA 2ITGA 3NF8A 3NHGA 4AILC 3SQ0A 1DLOA 4CFAA 3SPYA 2QXFA 2IS3A 4CJFA 3H08A 4YFUA 4UQGA 4CEFA 4Z4IA 3OYAA 2E6LA 4CE9A 5FRNA 3S3OA 4CEDA 3U3GA 2OPPA 1C0MA 3VQDA 4FK0A 4Z4GA 3QLHA 4RW4A 4JRQA 3MEEA 4B9TA 4J2BA 3T19A 3CFPA 4CECA 4CJKA 2WOMA 3MEDA 1VSLA 3AVMA 3T3FA 3RMDA 3PX4A 1NK6A 1UOCA 3HO1A 1NK7A 3VQ6A 4J2DA 2HHSA 2HMIA 4E1NA 1ITGA 3AO5A 1QS4A 1TKDA 3ZSXA 4CEZA 3OYJA 4FLUA 3SQ2A 2P5GA 1CXQA 4DLGA 1S6PA 4QOZB 5KGXA 2DFEA 4DQIA 1K6YA 1WSEA 4O4GA 4BE0A 4DTOA 3ZSWA 5HBMA 2HHVA 4W5NA 1RDCA 4O5BA 1BIUA 3PO5A 4KPYA 1YTUA 4EP4A 4LH4A 1D8YA 1WSIA 2HB5A 3RTVA 4M3XA 2RPIA 1RTHA 3K5NA 1WAJA 4CHOA 4DSJA 3OYGA 3KIOA 3LP2A 4CGDA 3TAGA 3MXMA 4KB1A 1A5WA 3KLFA 5EU7A 5HLFA 1S5JA 1VK0A 4KB0A 4FJIA 3C6UA 4TSXA 5J2PA 3RR7A 1XHXA 2P5OA 1JLEA 1RT2A 4KTZA 4DU4A 2YNFA 2GUIA 1NJYA 1KVCA 3K5OA 1CXUA 4O0JA 1NJWA 4FW1A 1QSLA 4OLAA 4FLVA 4PQUA 4BDZA 4CFCA 4CJVA 3MEGA 1EETA 4E89A 4BE2A 3QEVA 4HCBA 2KTQA 1DTTA 3P5JA 1QQCA 3QIPA 1DTQA 3AVBA 3VQ4A 5JS1A 1HRHA 4Z0UA 4W5OA 3NF7A 3K58A 4CJUA 3DRSA 2KW4A 3VQ5A 2Q3SA 3CM5A 1X9SA 4DFJA 3M8QA 4MFBA 1NK0A 1KRPA 1C0UA 2GBZA 3AO4A 4XIUA 4H8KA 1D5AA 3SQ1A 4JLHA 3AA5X 4EZ9A 1RDBA 1FXXA 3B6PA 1XI1A 1TKTA 4ZHRA 4N5SA 1Q9XA 4AH9A 5DK5A 3D45A 5SZTA 4CJWA 1T03A 2GV9A 4E1MA 4ID1A 1HNVA 4FJKA 1VSIA 1ASWA 4KHYA 3TR8A 4AHRA 2DY4A 1HQUA 2JGUA 1L3SA 4CGGA 2AJQA 3V81A 3A2FA 3AA3A 3VQQA 4DSFA 3UIQA 3JYTA 2X74A 1RT4A 4BWMA 1RBRA 3QINA 4IKFA 3SCXA 4ZTFA 3HPOA 3L2RA 1BGXT 1VRUA 5CZ1A 2FBXA 1IG9A 2HHTA 3DRRA 3NH1A 5C24A 4BE1A 3TARA 4KI4A 1WSGA 3ZT0A 3AVNA 3PX6A 3VQEA 4CGJA 1Q8IA 1ASUA 3D0PA 4H4OA 3SI6A 3AA2A 2HNYA 3I8DA 1NK8A 1TGOA 2QKBA 3QO9A 5KI6A 4K8XA 1I3AA 5HRRA 1Z26A 3B6OA 1SL0A 4FJGA 3QEXA 3LP0A 4CF2A 1VSEA 2YNIA 3V9UA 2BE2A 4E0DA 2PYJA 4AHUA 1HQEA 4OGEA 2Z1JA 4FJMA 4KO0A 1JLFA 4B8CA 1X9MA 3OYEA 1LWCA 4E3SA 4FLYA 3RR8A 2HNZA 1QSSA 1IKYA 3V6DA 1UA1A 4HTUA 3LZIA 4HCCA 1X1PA 4DF4A 1WAFA 2G8FA 2OYQA 2OPQA 3QESA 4Z4CA 1ZBIA 2JLEA 4PUOA 1A5XA 3DYAA 4CFDA 2FC0A 2YNGA 3V1RA 3KK1A 3RMBA 3S3NA 4Q0BA 3T1AA 4DQQA 4CESA 3WNFA 1YTAA 3LANA 4FJ8A 1XC9A 2XHBA 1HPZA 5FRMA 4CEAA 1HYSA 1L3VA 4DS4A 3CM6A 5T7BA 3RWUA 4CEQA 1WNSA 1LW0A 1U47A 3L2UA 1UWBA 3AVAA 4LSLA 3L2WA 1RBUA 2B5JA 1ZBHA 2IC3A 3HP6A 4M3TA 4NYFA 3AVCA 2WONA 1B9FA 4FJJA 4FK4A 1L3TA 1IKWA 1O1WA 5KRSA 3HK2A 3TI0A 2X78A 1LWFA 4CHQA 3OS1A 3VQ8A 4F3TA 3DMJA 4CF0A 4HUEA 3NF9A 1EX4A 1RTDA 3PUFA 1QE1A 1VRTA 4FJ7A 1KCFA 1RDDA 2ZQBA 3P1GA 2XO7A 4NCGA 3ALYA 1B9DA 3V9SA 1CLQA 3NGYA 4CJLA 4NCAA 2HVHA 3PO4A 1C1BA 1U48A 1CZ9A 4PY5A 2P51A 4KHQA 1A5VA 1HYZA 4CF8A 2YHBA 1TL1A 5SWMA 3NFAA 3TWHA 2KQ2A 4CK1A 3TANA 4Z4EA 2HHWA 2Z1HA 4C8MA 4F2SA 4OPJA 2EHGA 3MECA 3RRGA 4ICLA 1WSJA 2XY5A 1S1XA 3V1OA 1NJZA 3P83D 3SUQA 3ZT1A 1ZBFA 1WN7A 3K5MA 3NDKA 4FJLA 1IH7A 3AO1A 1NOZA 3AV9A 1D9FA 3AVJA 2KZMA 1RBTA 3VQBA 4LSNA 4HHTA 3QNOA 4CJPA 2R7YA 3NH2A 1LAVA 3ULDA 1JXBA 3LAKA 4O55A 3V9XA 3KK2A 2XY8A 1N5YA 1KVBA 3PV8A 4KHUA 3AO2A 4FM2A 1L5UA 1RTIA 4RW8A 5E41A 1RBSA 4DTNA 4DSIA 4KAZA 1RT5A 4W5TA 4L8RB 4CGFA 3G10A 3L2VA 4O0IA 5CYMA 1Q9YA 4G1QA 2YHAA 4RG8A 3ISNC 1BI4B 4IDKA 4M45A 3L2QA 2ETJA 4KKOA 1NK9A 3HPHA 1JLBA 3TAMA 5C25A 3AVGA 3HYFA 1SKWA 4B9LA 2EX3A 2I5JA 4IG0A 2BDPA 1C1CA 3QEIA 2G8VA 3LALA 5J2QA 4CHNA 4QAGA 1VSMA 5J2NA 3LWLA 1RT6A 1VSKA 4DMNA 4IFVA 3V9ZA 3NGZA 1L3UA 3K2PA 4Z4FA 1U49A 3DLRA 2ZE2A 1BL3A 4CFBA 1RBVA 4RW6A 3WNGA 1HMVA 3OS2A 1GOBA 1S1TA 1U04A 1BCOA 4I2QA 2ZD1A 4E19A 4DF8A 3DLGA 4FJNA 2O4GA 1QHTA 3O3FA 4I9QA 1C1AA 4C8NA 4DSKA 2YNHA 3EYZA 1KSPA 3OYFA 3L3UA 2LSNA 3AA4A 1IKXA 1TV6A 3BGRA 4CJTA 4FM1A 4KI6A 3HL8A 2OZMA 3KLGA 3MXJA 5KGWA 1FK9A 2D0BA 4CGIA 4F4KA 2D5RA 3O4NA 4OJRA 3OYIA 1TL3A 1JLAA 2YKNA 4FLWA 3C95A 1NK5A 2DTUA 1YT3A 3HJFA 2A1SA 3V4IA 3SPZA 1EP4A 3U3YA 3NF6A 4N56A 2NUBA 4HUGA 2A1RA 3M8RA 4B9NA 3DOKA 1RT3A 3RRHA 1WLJA 4CEOA 1T7PA 3DM2A 1TVRA 3QETA 5HRSA 2XRIA 1SKRA 1C0TA 1QTMA 1KTQA 4DFKA 4ELVA 1WSHA 1UA0A 3HVTA 4DQSA 3ZSRA 3VA0A 3DI6A 4KTWA 1SL2A 4RW9A 2DFFA 5I3UA 1TK0A 1TK8A 4FZXC 4J2AA 4ELUA 3TABA 4DQPA 4FJ5A 2F8SA 4B3OA 4FVMA 4KFBA 2D0AA 4CJSA 1RILA 2PZSA 1JLQA 4FLTA 4FXDA 3K59A 3LP3A 2HVIA 3PY8A 3TAFA 4LH5A 3DLBA 2HNDA 3TAQA 2IGIA 1EKEA 2X6SA 3DLEA 3M8SA 4DTSA 1Z25A 3ZSYA 2BANA 2XY7A 3HT3A 4DSLA 1Y97A 3ZT3A 1NKBA 3BDPA 1X9WA 4B9MA 2DFHA 1J54A 4ELTA 2XY6A 4QCLA 4HUFA 3LDSA 4N41A 4EP5A 4IBNA 1W9HA 3AVFA 1TAQA 2G8IA 4DU1A 3VQAA 3ZT2A 2B6AA 4BDPA 2VG5A 2X6NA 4MQ3A 3S3MA 4FJXA 1S1WA 3SZ2A 3SNNA 1BI4A 4C8LA 2Z1GA 4KHWA 1KVAA 4RW7A 4W5QA 4Y1CA 1RDAA 4KHSA 4CIGA 5J2MA 1U4BA 3V1QA 1T05A 2G8WA 1RT1A 1W0HA 3O3HA 4Z4HA 2RKIA 3QEPA 3LPUA 4C8KA 3SQ4A 1RCHA 3MAQA 3AO3A 2D0CA 1C6VA 3NGIA 3CQ8A 4CF9A 3EZ5A 4IG3A 1S9EA 4CIEA 5DMRA 1ZBUA 3AVIA 4CF1A 4M41A 5HRNA 1S6QA 4BACA 1R0AA 4EZ6A 4YNQA 1RT7A 2F96A 3JSMA 2PYLA 3OYMA 3THVA 2RN2A 4J2EA 2IOCA 2E6MA 4BDYA 1VSHA 3I0RA 1SV5A 3DRPA 3SUOA 4B9UA 1F21A 1J5OA 3E01A 3U6FA 1TKXA 2FBTA 3OYBA 2BGGA 2OPRA 4M3WA 1KLMA 4NYNA 1BQNA 3G0ZA 4CJ4A 4DFPA 2HHXA 4W5RA 2IAJA 3HM9A 1BQMA 3O3GA 1VSDA 4AHTA 5D3GA 3V9WA 4I7FA 4E7IA 4E7KA 3VA3A 4NCBA 4F2RA 3LAMA 2FBYA 5CYQA 1REVA 1JKHA 4WE1A 1YVUA 3OYKA 5FROA 3CG7A 2E4LA 3DLKA 4JS5A 4JS4A 3ASMA 3KLHA 1UAXA 1HYVA 1JL2A 1LAWA 1IO2A 3I0SA 4HVJA 3OYDA 4N47A 3F9KA 4DQRA 1NJXA 3KK3A 3KLIA 3AVKA 2OA8A 2G8HA 3O4QA 4CIFA 3LWMA 4F3OA 4KHNA 2HHQA 2RF2A 4OKKA 3K5LA 4DTJA 3QIOA 3SV4A 3L3VA 4CJQA 3HXMA 1JLCA 4CJEA 3OS0A 4CHPA 1NK4A 3HP9A 3AVLA 3CYMA 3NAEA 3IS9A 3RMCA 2F8TA 2KFZA 1IKVA 3ZCMA 2Z1IA 1JXEA 3VQCA 3OVNA 3OYHA 1LV5A 1NOYA 3FFIA 1BISA 4FW2A 4H4MA 5FDLA 4CHYA 4OPKA 3KJVA 1QSYA 3ZSQA 3NBPA 3VQ9A 2VG6A 3KKRA 5HP1A 1ASVA 4B9VA 4KRFA 4I2PA 1G15A 1VSFA 4R5PA 4PA1A 4ZTJA 2G8UA 4PWDA 4FLZA 5CZ2A 1SKSA 4FLXA 2IDOA 1J9AA 1S1UA 4K8ZA 4M3YA 1I39A 1GOAA 3MXIA 1MU2A 5C42A 5K14A 3WNHA 3OYCA 1N6QA 1RNHA 4LY7A 4OVLA 3SUNA 2B4JA 3KD5E 5KTQA 1ZYQA 4ID5A 1XWLA 2OPSA 4FCYA 3SV3A 1XHZA 3ZSZA 2G8KA 2O4IA 1GOCA 1WSFA 3WNEA 3KTQA 3K57A 1TK5A 4FK2A 1LWEA 4DTUA 3DOLA 4IFYA 4Y1DA 1KLNA 3OJUA 4DSEA 3EY1A 1D9DA 1TAUA 4B8AB 3LP1A 1ZBLA 2Y1IA 3LPTA 4CHZA 2VWJA 1HNIA 4E7HA 1T8EA 4E7LA 4FYDA 4CERA 3IAYA 4FJHA 3TAEA 4GMJB 3OJSA 3SJJA 1BCMA 3NE6A 4FM0A 1FKOA 3PX0A 2VG7A 5HRPA 2P1JA 3HVRA 2W42A 3F73A 2QK9A 3M8PA 1RTJA 5JS2A 4CK2A 4CEBA 1SL1A 1KFDA 1SUQA 4B08A 4DLEA 4M3UA 3KKSA 3CFRA 1EXQA 4KV8A 4M3RA 4DTXA 2Y1JA 4DWIA 3ZSOA 4BWJA 3C6TA 5I42A 4AHSA 4OGCA 3OYNA 3KD1E 3ZT4A 4DFMA 4B9SA 3DLHA 1KFSA 3QERA 2QKKA 1BHLA 2PY5A 2OZSA 4LD0A 4KREA 3OY9A 2HHUA 4OKJA 4AHCA 3ITHA 3AVHA 2VWKA 3IRXA 4DS5A 1FKPA 4DU3A 3SUPA 4F8RA 4KTQA 4OLBA 3L8BA 1NKEA 3NCIA 1BIZA 1CZBA 3NH0A 4CJ5A 1TKZA 3VQ7A 4AHVA 3LZJA 5J1EA 3TAPA 4DTMA 3RMAA 1NKCA 4DTRA 2HW3A 1J53A 2YV0X 1JL1A 4CJ3A 1B92A 5KRTA 4Q5VA 4FJ9A 2KFNA 4M42A 4CK3A 4GVMA 5CY4A 4M3ZA 3VN5A 2ATQA 1LW2A 3C94A 4O44A 4CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG A;  4GW6 A;  2KZZ A;  4CEE A;  3OYL A;  4OKE A;  3SYZ A;  1JLG A;  5HRO A;  3IG1 A;  3VQP A;  4C8O A;  1VSJ A;  3QEW A;  1S9G A;  3KLE A;  4DTP A;  4DG1 A;  3S9H A;  1U45 A;  4CCH A;  4FZY A;  4E7J A;  1HJR A;  4JRP A;  3CFO A;  4I9L A;  3QNN A;  2FBV A;  1S1V A;  2YKM A;  3HST B;  3ZSV A;  4CJR A;  4N76 A;  4FZZ A;  2ITG A;  3NF8 A;  3NHG A;  4AIL C;  3SQ0 A;  1DLO A;  4CFA A;  3SPY A;  2QXF A;  2IS3 A;  4CJF A;  3H08 A;  4YFU A;  4UQG A;  4CEF A;  4Z4I A;  3OYA A;  2E6L A;  4CE9 A;  5FRN A;  3S3O A;  4CED A;  3U3G A;  2OPP A;  1C0M A;  3VQD A;  4FK0 A;  4Z4G A;  3QLH A;  4RW4 A;  4JRQ A;  3MEE A;  4B9T A;  4J2B A;  3T19 A;  3CFP A;  4CEC A;  4CJK A;  2WOM A;  3MED A;  1VSL A;  3AVM A;  3T3F A;  3RMD A;  3PX4 A;  1NK6 A;  1UOC A;  3HO1 A;  1NK7 A;  3VQ6 A;  4J2D A;  2HHS A;  2HMI A;  4E1N A;  1ITG A;  3AO5 A;  1QS4 A;  1TKD A;  3ZSX A;  4CEZ A;  3OYJ A;  4FLU A;  3SQ2 A;  2P5G A;  1CXQ A;  4DLG A;  1S6P A;  4QOZ B;  5KGX A;  2DFE A;  4DQI A;  1K6Y A;  1WSE A;  4O4G A;  4BE0 A;  4DTO A;  3ZSW A;  5HBM A;  2HHV A;  4W5N A;  1RDC A;  4O5B A;  1BIU A;  3PO5 A;  4KPY A;  1YTU A;  4EP4 A;  4LH4 A;  1D8Y A;  1WSI A;  2HB5 A;  3RTV A;  4M3X A;  2RPI A;  1RTH A;  3K5N A;  1WAJ A;  4CHO A;  4DSJ A;  3OYG A;  3KIO A;  3LP2 A;  4CGD A;  3TAG A;  3MXM A;  4KB1 A;  1A5W A;  3KLF A;  5EU7 A;  5HLF A;  1S5J A;  1VK0 A;  4KB0 A;  4FJI A;  3C6U A;  4TSX A;  5J2P A;  3RR7 A;  1XHX A;  2P5O A;  1JLE A;  1RT2 A;  4KTZ A;  4DU4 A;  2YNF A;  2GUI A;  1NJY A;  1KVC A;  3K5O A;  1CXU A;  4O0J A;  1NJW A;  4FW1 A;  1QSL A;  4OLA A;  4FLV A;  4PQU A;  4BDZ A;  4CFC A;  4CJV A;  3MEG A;  1EET A;  4E89 A;  4BE2 A;  3QEV A;  4HCB A;  2KTQ A;  1DTT A;  3P5J A;  1QQC A;  3QIP A;  1DTQ A;  3AVB A;  3VQ4 A;  5JS1 A;  1HRH A;  4Z0U A;  4W5O A;  3NF7 A;  3K58 A;  4CJU A;  3DRS A;  2KW4 A;  3VQ5 A;  2Q3S A;  3CM5 A;  1X9S A;  4DFJ A;  3M8Q A;  4MFB A;  1NK0 A;  1KRP A;  1C0U A;  2GBZ A;  3AO4 A;  4XIU A;  4H8K A;  1D5A A;  3SQ1 A;  4JLH A;  3AA5 X;  4EZ9 A;  1RDB A;  1FXX A;  3B6P A;  1XI1 A;  1TKT A;  4ZHR A;  4N5S A;  1Q9X A;  4AH9 A;  5DK5 A;  3D45 A;  5SZT A;  4CJW A;  1T03 A;  2GV9 A;  4E1M A;  4ID1 A;  1HNV A;  4FJK A;  1VSI A;  1ASW A;  4KHY A;  3TR8 A;  4AHR A;  2DY4 A;  1HQU A;  2JGU A;  1L3S A;  4CGG A;  2AJQ A;  3V81 A;  3A2F A;  3AA3 A;  3VQQ A;  4DSF A;  3UIQ A;  3JYT A;  2X74 A;  1RT4 A;  4BWM A;  1RBR A;  3QIN A;  4IKF A;  3SCX A;  4ZTF A;  3HPO A;  3L2R A;  1BGX T;  1VRU A;  5CZ1 A;  2FBX A;  1IG9 A;  2HHT A;  3DRR A;  3NH1 A;  5C24 A;  4BE1 A;  3TAR A;  4KI4 A;  1WSG A;  3ZT0 A;  3AVN A;  3PX6 A;  3VQE A;  4CGJ A;  1Q8I A;  1ASU A;  3D0P A;  4H4O A;  3SI6 A;  3AA2 A;  2HNY A;  3I8D A;  1NK8 A;  1TGO A;  2QKB A;  3QO9 A;  5KI6 A;  4K8X A;  1I3A A;  5HRR A;  1Z26 A;  3B6O A;  1SL0 A;  4FJG A;  3QEX A;  3LP0 A;  4CF2 A;  1VSE A;  2YNI A;  3V9U A;  2BE2 A;  4E0D A;  2PYJ A;  4AHU A;  1HQE A;  4OGE A;  2Z1J A;  4FJM A;  4KO0 A;  1JLF A;  4B8C A;  1X9M A;  3OYE A;  1LWC A;  4E3S A;  4FLY A;  3RR8 A;  2HNZ A;  1QSS A;  1IKY A;  3V6D A;  1UA1 A;  4HTU A;  3LZI A;  4HCC A;  1X1P A;  4DF4 A;  1WAF A;  2G8F A;  2OYQ A;  2OPQ A;  3QES A;  4Z4C A;  1ZBI A;  2JLE A;  4PUO A;  1A5X A;  3DYA A;  4CFD A;  2FC0 A;  2YNG A;  3V1R A;  3KK1 A;  3RMB A;  3S3N A;  4Q0B A;  3T1A A;  4DQQ A;  4CES A;  3WNF A;  1YTA A;  3LAN A;  4FJ8 A;  1XC9 A;  2XHB A;  1HPZ A;  5FRM A;  4CEA A;  1HYS A;  1L3V A;  4DS4 A;  3CM6 A;  5T7B A;  3RWU A;  4CEQ A;  1WNS A;  1LW0 A;  1U47 A;  3L2U A;  1UWB A;  3AVA A;  4LSL A;  3L2W A;  1RBU A;  2B5J A;  1ZBH A;  2IC3 A;  3HP6 A;  4M3T A;  4NYF A;  3AVC A;  2WON A;  1B9F A;  4FJJ A;  4FK4 A;  1L3T A;  1IKW A;  1O1W A;  5KRS A;  3HK2 A;  3TI0 A;  2X78 A;  1LWF A;  4CHQ A;  3OS1 A;  3VQ8 A;  4F3T A;  3DMJ A;  4CF0 A;  4HUE A;  3NF9 A;  1EX4 A;  1RTD A;  3PUF A;  1QE1 A;  1VRT A;  4FJ7 A;  1KCF A;  1RDD A;  2ZQB A;  3P1G A;  2XO7 A;  4NCG A;  3ALY A;  1B9D A;  3V9S A;  1CLQ A;  3NGY A;  4CJL A;  4NCA A;  2HVH A;  3PO4 A;  1C1B A;  1U48 A;  1CZ9 A;  4PY5 A;  2P51 A;  4KHQ A;  1A5V A;  1HYZ A;  4CF8 A;  2YHB A;  1TL1 A;  5SWM A;  3NFA A;  3TWH A;  2KQ2 A;  4CK1 A;  3TAN A;  4Z4E A;  2HHW A;  2Z1H A;  4C8M A;  4F2S A;  4OPJ A;  2EHG A;  3MEC A;  3RRG A;  4ICL A;  1WSJ A;  2XY5 A;  1S1X A;  3V1O A;  1NJZ A;  3P83 D;  3SUQ A;  3ZT1 A;  1ZBF A;  1WN7 A;  3K5M A;  3NDK A;  4FJL A;  1IH7 A;  3AO1 A;  1NOZ A;  3AV9 A;  1D9F A;  3AVJ A;  2KZM A;  1RBT A;  3VQB A;  4LSN A;  4HHT A;  3QNO A;  4CJP A;  2R7Y A;  3NH2 A;  1LAV A;  3ULD A;  1JXB A;  3LAK A;  4O55 A;  3V9X A;  3KK2 A;  2XY8 A;  1N5Y A;  1KVB A;  3PV8 A;  4KHU A;  3AO2 A;  4FM2 A;  1L5U A;  1RTI A;  4RW8 A;  5E41 A;  1RBS A;  4DTN A;  4DSI A;  4KAZ A;  1RT5 A;  4W5T A;  4L8R B;  4CGF A;  3G10 A;  3L2V A;  4O0I A;  5CYM A;  1Q9Y A;  4G1Q A;  2YHA A;  4RG8 A;  3ISN C;  1BI4 B;  4IDK A;  4M45 A;  3L2Q A;  2ETJ A;  4KKO A;  1NK9 A;  3HPH A;  1JLB A;  3TAM A;  5C25 A;  3AVG A;  3HYF A;  1SKW A;  4B9L A;  2EX3 A;  2I5J A;  4IG0 A;  2BDP A;  1C1C A;  3QEI A;  2G8V A;  3LAL A;  5J2Q A;  4CHN A;  4QAG A;  1VSM A;  5J2N A;  3LWL A;  1RT6 A;  1VSK A;  4DMN A;  4IFV A;  3V9Z A;  3NGZ A;  1L3U A;  3K2P A;  4Z4F A;  1U49 A;  3DLR A;  2ZE2 A;  1BL3 A;  4CFB A;  1RBV A;  4RW6 A;  3WNG A;  1HMV A;  3OS2 A;  1GOB A;  1S1T A;  1U04 A;  1BCO A;  4I2Q A;  2ZD1 A;  4E19 A;  4DF8 A;  3DLG A;  4FJN A;  2O4G A;  1QHT A;  3O3F A;  4I9Q A;  1C1A A;  4C8N A;  4DSK A;  2YNH A;  3EYZ A;  1KSP A;  3OYF A;  3L3U A;  2LSN A;  3AA4 A;  1IKX A;  1TV6 A;  3BGR A;  4CJT A;  4FM1 A;  4KI6 A;  3HL8 A;  2OZM A;  3KLG A;  3MXJ A;  5KGW A;  1FK9 A;  2D0B A;  4CGI A;  4F4K A;  2D5R A;  3O4N A;  4OJR A;  3OYI A;  1TL3 A;  1JLA A;  2YKN A;  4FLW A;  3C95 A;  1NK5 A;  2DTU A;  1YT3 A;  3HJF A;  2A1S A;  3V4I A;  3SPZ A;  1EP4 A;  3U3Y A;  3NF6 A;  4N56 A;  2NUB A;  4HUG A;  2A1R A;  3M8R A;  4B9N A;  3DOK A;  1RT3 A;  3RRH A;  1WLJ A;  4CEO A;  1T7P A;  3DM2 A;  1TVR A;  3QET A;  5HRS A;  2XRI A;  1SKR A;  1C0T A;  1QTM A;  1KTQ A;  4DFK A;  4ELV A;  1WSH A;  1UA0 A;  3HVT A;  4DQS A;  3ZSR A;  3VA0 A;  3DI6 A;  4KTW A;  1SL2 A;  4RW9 A;  2DFF A;  5I3U A;  1TK0 A;  1TK8 A;  4FZX C;  4J2A A;  4ELU A;  3TAB A;  4DQP A;  4FJ5 A;  2F8S A;  4B3O A;  4FVM A;  4KFB A;  2D0A A;  4CJS A;  1RIL A;  2PZS A;  1JLQ A;  4FLT A;  4FXD A;  3K59 A;  3LP3 A;  2HVI A;  3PY8 A;  3TAF A;  4LH5 A;  3DLB A;  2HND A;  3TAQ A;  2IGI A;  1EKE A;  2X6S A;  3DLE A;  3M8S A;  4DTS A;  1Z25 A;  3ZSY A;  2BAN A;  2XY7 A;  3HT3 A;  4DSL A;  1Y97 A;  3ZT3 A;  1NKB A;  3BDP A;  1X9W A;  4B9M A;  2DFH A;  1J54 A;  4ELT A;  2XY6 A;  4QCL A;  4HUF A;  3LDS A;  4N41 A;  4EP5 A;  4IBN A;  1W9H A;  3AVF A;  1TAQ A;  2G8I A;  4DU1 A;  3VQA A;  3ZT2 A;  2B6A A;  4BDP A;  2VG5 A;  2X6N A;  4MQ3 A;  3S3M A;  4FJX A;  1S1W A;  3SZ2 A;  3SNN A;  1BI4 A;  4C8L A;  2Z1G A;  4KHW A;  1KVA A;  4RW7 A;  4W5Q A;  4Y1C A;  1RDA A;  4KHS A;  4CIG A;  5J2M A;  1U4B A;  3V1Q A;  1T05 A;  2G8W A;  1RT1 A;  1W0H A;  3O3H A;  4Z4H A;  2RKI A;  3QEP A;  3LPU A;  4C8K A;  3SQ4 A;  1RCH A;  3MAQ A;  3AO3 A;  2D0C A;  1C6V A;  3NGI A;  3CQ8 A;  4CF9 A;  3EZ5 A;  4IG3 A;  1S9E A;  4CIE A;  5DMR A;  1ZBU A;  3AVI A;  4CF1 A;  4M41 A;  5HRN A;  1S6Q A;  4BAC A;  1R0A A;  4EZ6 A;  4YNQ A;  1RT7 A;  2F96 A;  3JSM A;  2PYL A;  3OYM A;  3THV A;  2RN2 A;  4J2E A;  2IOC A;  2E6M A;  4BDY A;  1VSH A;  3I0R A;  1SV5 A;  3DRP A;  3SUO A;  4B9U A;  1F21 A;  1J5O A;  3E01 A;  3U6F A;  1TKX A;  2FBT A;  3OYB A;  2BGG A;  2OPR A;  4M3W A;  1KLM A;  4NYN A;  1BQN A;  3G0Z A;  4CJ4 A;  4DFP A;  2HHX A;  4W5R A;  2IAJ A;  3HM9 A;  1BQM A;  3O3G A;  1VSD A;  4AHT A;  5D3G A;  3V9W A;  4I7F A;  4E7I A;  4E7K A;  3VA3 A;  4NCB A;  4F2R A;  3LAM A;  2FBY A;  5CYQ A;  1REV A;  1JKH A;  4WE1 A;  1YVU A;  3OYK A;  5FRO A;  3CG7 A;  2E4L A;  3DLK A;  4JS5 A;  4JS4 A;  3ASM A;  3KLH A;  1UAX A;  1HYV A;  1JL2 A;  1LAW A;  1IO2 A;  3I0S A;  4HVJ A;  3OYD A;  4N47 A;  3F9K A;  4DQR A;  1NJX A;  3KK3 A;  3KLI A;  3AVK A;  2OA8 A;  2G8H A;  3O4Q A;  4CIF A;  3LWM A;  4F3O A;  4KHN A;  2HHQ A;  2RF2 A;  4OKK A;  3K5L A;  4DTJ A;  3QIO A;  3SV4 A;  3L3V A;  4CJQ A;  3HXM A;  1JLC A;  4CJE A;  3OS0 A;  4CHP A;  1NK4 A;  3HP9 A;  3AVL A;  3CYM A;  3NAE A;  3IS9 A;  3RMC A;  2F8T A;  2KFZ A;  1IKV A;  3ZCM A;  2Z1I A;  1JXE A;  3VQC A;  3OVN A;  3OYH A;  1LV5 A;  1NOY A;  3FFI A;  1BIS A;  4FW2 A;  4H4M A;  5FDL A;  4CHY A;  4OPK A;  3KJV A;  1QSY A;  3ZSQ A;  3NBP A;  3VQ9 A;  2VG6 A;  3KKR A;  5HP1 A;  1ASV A;  4B9V A;  4KRF A;  4I2P A;  1G15 A;  1VSF A;  4R5P A;  4PA1 A;  4ZTJ A;  2G8U A;  4PWD A;  4FLZ A;  5CZ2 A;  1SKS A;  4FLX A;  2IDO A;  1J9A A;  1S1U A;  4K8Z A;  4M3Y A;  1I39 A;  1GOA A;  3MXI A;  1MU2 A;  5C42 A;  5K14 A;  3WNH A;  3OYC A;  1N6Q A;  1RNH A;  4LY7 A;  4OVL A;  3SUN A;  2B4J A;  3KD5 E;  5KTQ A;  1ZYQ A;  4ID5 A;  1XWL A;  2OPS A;  4FCY A;  3SV3 A;  1XHZ A;  3ZSZ A;  2G8K A;  2O4I A;  1GOC A;  1WSF A;  3WNE A;  3KTQ A;  3K57 A;  1TK5 A;  4FK2 A;  1LWE A;  4DTU A;  3DOL A;  4IFY A;  4Y1D A;  1KLN A;  3OJU A;  4DSE A;  3EY1 A;  1D9D A;  1TAU A;  4B8A B;  3LP1 A;  1ZBL A;  2Y1I A;  3LPT A;  4CHZ A;  2VWJ A;  1HNI A;  4E7H A;  1T8E A;  4E7L A;  4FYD A;  4CER A;  3IAY A;  4FJH A;  3TAE A;  4GMJ B;  3OJS A;  3SJJ A;  1BCM A;  3NE6 A;  4FM0 A;  1FKO A;  3PX0 A;  2VG7 A;  5HRP A;  2P1J A;  3HVR A;  2W42 A;  3F73 A;  2QK9 A;  3M8P A;  1RTJ A;  5JS2 A;  4CK2 A;  4CEB A;  1SL1 A;  1KFD A;  1SUQ A;  4B08 A;  4DLE A;  4M3U A;  3KKS A;  3CFR A;  1EXQ A;  4KV8 A;  4M3R A;  4DTX A;  2Y1J A;  4DWI A;  3ZSO A;  4BWJ A;  3C6T A;  5I42 A;  4AHS A;  4OGC A;  3OYN A;  3KD1 E;  3ZT4 A;  4DFM A;  4B9S A;  3DLH A;  1KFS A;  3QER A;  2QKK A;  1BHL A;  2PY5 A;  2OZS A;  4LD0 A;  4KRE A;  3OY9 A;  2HHU A;  4OKJ A;  4AHC A;  3ITH A;  3AVH A;  2VWK A;  3IRX A;  4DS5 A;  1FKP A;  4DU3 A;  3SUP A;  4F8R A;  4KTQ A;  4OLB A;  3L8B A;  1NKE A;  3NCI A;  1BIZ A;  1CZB A;  3NH0 A;  4CJ5 A;  1TKZ A;  3VQ7 A;  4AHV A;  3LZJ A;  5J1E A;  3TAP A;  4DTM A;  3RMA A;  1NKC A;  4DTR A;  2HW3 A;  1J53 A;  2YV0 X;  1JL1 A;  4CJ3 A;  1B92 A;  5KRT A;  4Q5V A;  4FJ9 A;  2KFN A;  4M42 A;  4CK3 A;  4GVM A;  5CY4 A;  4M3Z A;  3VN5 A;  2ATQ A;  1LW2 A;  3C94 A;  4O44 A;  4CGH A; 
#chains in the Genus database with same CATH topology
 4YOX A;  4FWQ A;  1JLG A;  2QEX N;  3IG1 A;  4DV6 K;  1QQN A;  3S9H A;  5AQV A;  4CBW A;  4E7J A;  3HRG A;  2FBV A;  2HOE A;  3Q7B A;  3NHG A;  4AIL C;  2E88 A;  3SPY A;  2QXF A;  2IS3 A;  1EWQ A;  3M6G A;  3VGM A;  5JMV A;  3S3O A;  3VQD A;  5KPT A;  4JK7 A;  3QLH A;  3MEE A;  4JI5 K;  4CEC A;  5KQD A;  2V7Z A;  3MED A;  1NK7 A;  4J2D A;  4JYA K;  1QS4 A;  2QM1 A;  4FLU A;  1SAZ A;  3A8Y A;  4DQI A;  1K6Y A;  5GAH P;  4GV9 A;  3CCM N;  4O5B A;  3ULE B;  1HPM A;  2A5X A;  5E26 A;  5CE3 A;  4LH4 A;  2QWO A;  3RTV A;  4M3X A;  1RTH A;  4WF9 L;  3TAG A;  4KB1 A;  3SMS A;  3LDL A;  5ADX A;  3D2E B;  1A5W A;  2A6A A;  5AQS A;  1VK0 A;  4FJI A;  3UKR A;  1XHX A;  1JLE A;  1RT2 A;  3LM2 A;  1NGA A;  4HWI A;  2YNF A;  1CXU A;  2EWS A;  4FW1 A;  1QSL A;  4CFC A;  5JVH L;  3IMX A;  4HCB A;  2VYP A;  3NMU A;  2YJE A;  2KTQ A;  1DTQ A;  4W5O A;  3NF7 A;  1HKC A;  3OBY A;  3MX5 A;  4CJU A;  2P9S B;  4K25 A;  3C65 A;  2FSJ A;  1Z05 A;  2NZT A;  3M3Z A;  4YY3 K;  1XUP O;  4YHH K;  1GLF O;  1FXX A;  1XI1 A;  1NMD A;  4ZHR A;  4N5S A;  4AH9 A;  5SZT A;  4CJW A;  4E1M A;  4FJK A;  2DY4 A;  1VSI A;  1ASW A;  2GWJ A;  4EHU A;  1W7A A;  1L3S A;  2AJQ A;  4BRQ A;  5LJW A;  4JI8 K;  3A2F A;  3AA3 A;  3VQQ A;  1RT4 A;  3OBW A;  4FPA A;  3SCX A;  3HPO A;  3DRR A;  4JK9 A;  4BE1 A;  3VEV A;  3TAR A;  1KD1 O;  2YHW A;  1VQ4 N;  4H0O A;  3D0P A;  1ZC6 A;  2H3G X;  2QKB A;  4FJG A;  3LP0 A;  4CF2 A;  1VSE A;  2YNI A;  2BE2 A;  4E0D A;  4OGE A;  4A5A A;  3J80 O;  2A40 A;  5AQP A;  2HBL A;  4B8C A;  1NGD A;  4E3S A;  4FLY A;  3V6D A;  4DV2 K;  1UA1 A;  4NLC A;  2Q1N A;  1X1P A;  1BOT O;  1ZBI A;  3LDN A;  3DYA A;  4CFD A;  2FC0 A;  3S3N A;  3LL3 A;  4WFB L;  4JI3 K;  3T1A A;  4DQQ A;  4IOC L;  2VWB A;  3EKU A;  3LAN A;  5M1O A;  1HPZ A;  4B3M K;  5T7B A;  1LW0 A;  4DQ8 A;  1UWB A;  3THW B;  2B5J A;  3HP6 A;  4BC3 A;  1QVG M;  2RE2 A;  3O4W A;  1B9F A;  4DR4 K;  1RDW X;  1J6Z A;  1RGI A;  5KRS A;  1T6C A;  2D0P A;  4CHQ A;  2A41 A;  4CF0 A;  1GLE G;  3CJ7 A;  1EX4 A;  3E66 A;  3PUF A;  3WXI A;  4FJ7 A;  3P1G A;  4NCG A;  2HVH A;  5LJV A;  3F9M A;  2YHB A;  2KQ2 A;  2HHW A;  2O8F A;  2AA4 A;  2Z1H A;  1WB9 A;  3RRG A;  3V1O A;  2O8B B;  3P83 D;  4FWM A;  1WN7 A;  3K5M A;  3NDK A;  3R3L A;  3AO1 A;  1NOZ A;  3AV9 A;  1D9F A;  4JEP A;  1S22 A;  4BC4 A;  4CJP A;  2R7Y A;  2OTL N;  3O08 A;  3LAK A;  3V9X A;  5I9E B;  4KHU A;  4FM2 A;  2QA4 N;  3VF2 A;  1RT5 A;  4O0I A;  1Q9Y A;  2YHA A;  3HPH A;  3KWI A;  5FPM A;  2EX3 A;  4I6M A;  3QEI A;  1VSM A;  5J2N A;  3LWL A;  1QZ6 A;  2ASM A;  3AY9 A;  5F2R A;  1L3U A;  2GWK A;  3K2P A;  3G4S N;  3BP8 A;  1GOB A;  4OX9 K;  3DLG A;  3O3F A;  1I94 K;  4C8N A;  4MLH A;  4BR5 A;  3EYZ A;  3IDH A;  3OYF A;  2QWQ A;  3L3U A;  4FM1 A;  4JHD A;  3ZX2 A;  3WXM B;  4CGI A;  4WFA L;  2UUB K;  4OJR A;  3OYI A;  3C95 A;  3L0Q A;  5AQZ A;  1YT3 A;  2A1S A;  3QIC A;  5AFU A;  2NUB A;  5AQY A;  1VQN N;  3GBT A;  4BC5 A;  5AFU H;  3Q7C A;  4B9N A;  1NU0 A;  3DOK A;  3RRH A;  1WLJ A;  4CEO A;  3HZ6 A;  1BO5 O;  5AQN A;  1KTQ A;  4DFK A;  3THX B;  4ELV A;  2CGL A;  5B8H A;  3ZSR A;  4RW9 A;  2DFF A;  3L4Q A;  3D2F A;  4FJ5 A;  1U2V A;  3C0B A;  4FVM A;  4CJS A;  2P9I A;  3U9Z A;  3BUZ B;  3K59 A;  2HVI A;  4DV0 K;  5KPR A;  2X6S A;  5FPN A;  1Z25 A;  2XY7 A;  4PKH A;  4G9Z A;  4H0P A;  2DFH A;  1OVQ A;  3TTF A;  2WFB A;  4BGA A;  2O8C B;  4EP5 A;  3FGU A;  1V4T A;  4BDP A;  3KWG A;  1S1W A;  2YCH A;  3SNN A;  1KXP A;  4KHW A;  1KVA A;  4RW7 A;  3LM9 A;  4Y1C A;  4WFN L;  4H5V A;  4CZJ A;  1RT1 A;  4CVN E;  4X65 K;  5GAE P;  1LOT B;  4LC9 B;  2ZWH A;  3NGI A;  3ZX0 A;  4JD2 A;  4KI4 A;  5M1P A;  5HRN A;  3AGR A;  1C0G A;  3DXM A;  4FWL A;  3UKU A;  4BR9 A;  3JSM A;  3TTD A;  2RN2 A;  2ASP A;  5AQQ A;  4LF9 K;  4B9U A;  1J5O A;  3E01 A;  3ATV A;  4CZG A;  2OPR A;  1KLM A;  5ELZ A;  4B1V A;  1BQN A;  3CJ1 A;  2IAJ A;  5M1N A;  3ZYY X;  2QWN A;  4DV1 K;  4E7K A;  1YUW A;  2I7P A;  1IG8 A;  2YHX A;  3CG7 A;  3DLK A;  4JKB A;  3KLH A;  4NXM K;  1NJX A;  1IO2 A;  4N76 A;  3F9K A;  4DQR A;  2OA8 A;  4JKA A;  3LWM A;  1EQY A;  4OKK A;  4KH6 A;  2P9N B;  3CME N;  4BRO A;  4DV3 K;  4YOW A;  3CCQ N;  3ZCM A;  2O8B A;  1G99 A;  1LV5 A;  3FFI A;  4FW2 A;  4RWT A;  4OPK A;  1QSY A;  3WEE B;  3DJC A;  4B9V A;  4KRF A;  3IKM A;  1D4X A;  1G15 A;  5KQ8 A;  4ISG A;  1VSF A;  4JI0 K;  3QDK A;  5CZ2 A;  2FF6 A;  4CJ7 A;  1S1U A;  3MWT A;  5AQR A;  3MXI A;  5C42 A;  5K14 A;  1N6Q A;  1RNH A;  4LY7 A;  4OVL A;  3KD5 E;  3PIP L;  4XH4 A;  4A2A A;  4X62 K;  2W41 A;  4Y1D A;  4K41 A;  2IVO A;  4FWO A;  3LPT A;  3H1Q A;  3VES A;  1VQ6 N;  4IWV A;  3CC2 N;  3IAY A;  3TAE A;  3OJS A;  4FM0 A;  1VQP N;  1FKO A;  4YOT A;  2VG7 A;  3PX0 A;  3HVR A;  4LF5 K;  1RTJ A;  4CK2 A;  1KFD A;  4JN4 A;  2YX6 A;  4DWI A;  3C6T A;  5I42 A;  5CHI A;  4AHS A;  3D2F B;  4OGC A;  3U4L A;  4EFH A;  1XMQ K;  3C7N A;  3VEO A;  2HHU A;  3AVH A;  2VWK A;  3R8E A;  1ESV A;  4CZL A;  3I55 N;  5AQI A;  4DU3 A;  4OLB A;  3NH0 A;  4CJ5 A;  3CJC A;  2YJF A;  1NKC A;  2HW3 A;  2YV0 X;  5KRT A;  2KFN A;  1B92 A;  3CMA N;  4M42 A;  4CK3 A;  4GVM A;  3C94 A;  4O44 A;  2OTJ N;  3LDS A;  3NVM A;  5IT9 O;  3EN9 A;  4GW6 A;  1YF5 L;  4CEE A;  5AZJ A;  1GLB G;  1S9G A;  4IOX A;  4CCH A;  3CFO A;  3GOI A;  2QTD A;  1U2V B;  3HST B;  4CJR A;  3SQ0 A;  4CFA A;  4CJF A;  4UQG A;  4CEF A;  1Q81 O;  5AJ3 K;  3HTV A;  5C10 A;  4CE9 A;  4FK0 A;  1YHQ N;  2W40 A;  2QWR A;  4CBU A;  4B9T A;  2UXC K;  4FPB A;  3T19 A;  3CFP A;  2V7Y A;  1K73 O;  3AVM A;  3CF5 L;  3RMD A;  1ITG A;  3S41 A;  1XC3 A;  3SQ2 A;  3OYJ A;  2P5G A;  1CXQ A;  1S6P A;  5KGX A;  1GLL O;  1WSE A;  5HBM A;  2HHV A;  4W5N A;  1YXQ A;  1BIU A;  1YTU A;  4EP4 A;  3O1B A;  1D8Y A;  1NBW A;  4GY2 B;  3K5N A;  4DSJ A;  3OYG A;  3CJB A;  2NRW A;  5HLF A;  1ATN A;  1NWK A;  5J2P A;  1P90 A;  4KTZ A;  4DU4 A;  2PAV A;  5LMN K;  1OH6 A;  1KVC A;  3VEN A;  4GV6 A;  1NJW A;  5BRF A;  1NNE A;  2FSK A;  3MX2 A;  4PQU A;  4R79 A;  3A5L C;  4BE2 A;  1EET A;  1T6D A;  1QZ5 A;  4H0V B;  3P5J A;  5AZI A;  2E2Q A;  3QIP A;  3VQ4 A;  3AVB A;  2F4V K;  3CI5 A;  3E9L A;  3DRS A;  2KW4 A;  2Q3S A;  3CM5 A;  1X9S A;  3M8Q A;  4MFB A;  1KRP A;  3QB0 A;  3AO4 A;  1JCG A;  4H8K A;  3P38 A;  1D5A A;  4AF1 A;  3SQ1 A;  3AA5 X;  4EZ9 A;  3ENH A;  4B1U B;  5AR0 A;  3B6P A;  2V52 B;  2NRV A;  2GV9 A;  4ID1 A;  4KHY A;  1HQU A;  2OCE A;  4BRK A;  2JGU A;  3WQU A;  1N8R O;  4DSF A;  4BWM A;  3EEQ A;  4ZTF A;  1VRU A;  1IG9 A;  3PX6 A;  1Q8I A;  3SI6 A;  1S72 N;  1TGO A;  3QO9 A;  5H1S Q;  4K8X A;  3GDQ A;  2O8E A;  1Z26 A;  1DEJ A;  1NMN A;  3O1W A;  4FWR A;  3V9U A;  5GAD P;  2PYJ A;  2HF3 A;  2Z1J A;  5JLF A;  1X9M A;  5EX5 A;  1Y64 A;  3RR8 A;  2RHK A;  1IKY A;  4O8K A;  3LZI A;  1WAF A;  2G8F A;  3KK7 A;  4B9Q A;  4PUO A;  2YNG A;  3ULE A;  3V1R A;  3VF6 A;  3RMB A;  2NNW A;  4CES A;  2P9K A;  4M7X A;  2F9W A;  3RWU A;  4V19 S;  4CEQ A;  3L2W A;  2E1Z A;  2IC3 A;  2P9L B;  2WON A;  1YAG A;  3G6E N;  4OPA A;  4FJJ A;  4DR7 K;  1IKW A;  3MN6 A;  3HK2 A;  4LFB K;  3VEY A;  3P39 A;  3VQ8 A;  3TSQ A;  3CCJ N;  3DMJ A;  3FZH A;  1X9J A;  5BPL A;  1RFQ A;  2XO7 A;  1CLQ A;  1VQO N;  1U48 A;  4KHQ A;  4QS9 A;  1Q86 O;  3TWH A;  3TAN A;  4Z4E A;  4C8M A;  1R59 O;  3MEC A;  3CJA A;  3UKR B;  1WSJ A;  1S1X A;  3SUQ A;  3CER A;  4H0X B;  4FJL A;  4K0K K;  2KZM A;  3RVC A;  3NH2 A;  3ULD A;  1JXB A;  4JD2 B;  4PKG A;  2QXL A;  1KVB A;  5E41 A;  4KH4 A;  1NGJ A;  4W5T A;  3L2V A;  3DAW A;  3O8M A;  4H0T B;  4RG8 A;  2E2P A;  1NK9 A;  3MCP A;  2FLO A;  1VQK N;  1NGI A;  5C25 A;  5AQM A;  4CZF A;  1OH8 A;  3BF3 A;  4H0Y B;  2G8V A;  3LAL A;  5J2Q A;  2UXD K;  4CHN A;  1RT6 A;  1VSK A;  4EHT A;  3V9Z A;  4BR2 A;  3T1Y K;  4M63 C;  3CPE A;  1U49 A;  4RW6 A;  3WNG A;  4BC2 A;  2P9U A;  3VF4 A;  3OS2 A;  4E19 A;  1S1T A;  2PFU A;  4K42 A;  2YNH A;  1FW6 A;  3AA4 A;  3FFK B;  3M5R A;  3HL8 A;  2OZM A;  3N4P A;  2D5R A;  4O8U A;  5C2F A;  3J81 O;  4FLW A;  2E8A A;  3V4I A;  1E3M A;  3SPZ A;  3U3Y A;  3NF6 A;  5LL6 Z;  4N56 A;  1XNQ K;  3ZEU B;  3M8R A;  3FE1 A;  1T7P A;  3ID8 A;  4JKH A;  3R9P A;  3QET A;  1WBB A;  1SKR A;  1C0T A;  1TYQ A;  1QHA A;  1UA0 A;  4DQS A;  3SMP A;  1TK8 A;  4ELU A;  3EO3 A;  3GG4 A;  4B3O A;  1Q82 O;  3SAG A;  4KFB A;  2E5L K;  1GLA G;  4NXN K;  4FLT A;  3H3O B;  4A61 A;  1ZBS A;  3R6M A;  4JI1 K;  3TAQ A;  2IGI A;  1EKE A;  4DSL A;  2HF4 A;  5JIC A;  3AAR A;  1Y97 A;  3HT3 A;  3BDP A;  2UU9 K;  1J54 A;  4ELT A;  1TYQ B;  2XY6 A;  3PLA A;  4HUF A;  2OAN A;  5BN8 A;  3TTC A;  3MCA B;  3OTO K;  4DU1 A;  3VQA A;  3ZT2 A;  4MQ3 A;  2X6N A;  2KHO A;  3S3M A;  4FJX A;  3QML A;  1BI4 A;  2E2N A;  5FLX O;  3B8A X;  5AQJ A;  4CIG A;  5BR8 K;  3V1Q A;  2G8W A;  4FOE A;  2RKI A;  3BZC A;  3MN7 A;  3VET A;  4C8K A;  5CR4 A;  2HBM A;  4BRH A;  4UY8 O;  4H03 B;  1R0A A;  3VTH A;  3WXL A;  2GX9 A;  5M1F A;  3IUC A;  2ZJQ L;  3SLC A;  2NRZ A;  3F5T A;  2P9U B;  3CXC M;  3I0R A;  4DV7 K;  4BDY A;  3DRP A;  5BRH A;  3SUO A;  4IJA A;  1N34 K;  2IIR A;  2QWP A;  2FBT A;  3OYB A;  2HHX A;  2PBD A;  3CET A;  1H1V A;  3JS6 A;  1VSD A;  1BU6 O;  3V9W A;  4LFC K;  3VGK A;  4NCB A;  3LAM A;  2FBY A;  5CYQ A;  1REV A;  3PSI A;  1YVU A;  3OYK A;  4DV4 K;  2E4L A;  4JS5 A;  3ASM A;  4Y0W A;  2Q0R A;  1LAW A;  4JNE A;  4N47 A;  3KLI A;  3AVK A;  3O4Q A;  4F3O A;  4OPH A;  2RF2 A;  3K5L A;  3HXM A;  4CJE A;  4BRG A;  3OS0 A;  3HP9 A;  3AVL A;  5AQW A;  1YJN N;  3IS9 A;  1FJG K;  3VQC A;  4CZE A;  3WT0 A;  1HX1 A;  1BIS A;  4H4M A;  4CHY A;  5FDL A;  3KJV A;  4K43 A;  3E9P A;  3KKR A;  3U8X A;  1ASV A;  1KAX A;  3GE1 A;  3BF1 A;  4PA1 A;  4ZTJ A;  1SKS A;  2UXB K;  4FLX A;  1K8K A;  3VEZ A;  4M3Y A;  3WNH A;  3THX A;  2B4J A;  5GIO A;  5KTQ A;  5M1Q A;  1XWL A;  2OPS A;  3SV3 A;  2O4I A;  3WNE A;  4FK2 A;  3K57 A;  5AQH A;  4HTL A;  2W6L A;  4DTU A;  4IFY A;  1NLV A;  2CH5 A;  3O80 A;  3WXK A;  1D9D A;  4B8A B;  1VQL N;  3LP1 A;  4E7L A;  4DV5 K;  4GVE A;  4NB4 A;  4BRM A;  3ZET B;  3NE6 A;  5A2Q O;  5HRP A;  4JAX A;  3MN9 A;  2P9K B;  1SL1 A;  3T7Z A;  4JKD A;  4DUY K;  1EXQ A;  4KV8 A;  4DTX A;  1KAY A;  5BPN A;  4BWJ A;  5BRE A;  1T3V A;  4M7Y A;  1J5E K;  4WQ4 A;  4CZH A;  1NM1 A;  3OYN A;  3KD1 E;  3TU5 A;  3O9S A;  4H5T A;  2VQE K;  2QKK A;  4WQ5 C;  3W3D A;  2NRT A;  4AM6 A;  2OZS A;  1NGH A;  4LD0 A;  4U67 L;  3T69 A;  3SUP A;  1NKE A;  4I6M B;  2WBN A;  3VQ7 A;  5J1E A;  2QWM A;  3C7N B;  4JKE A;  4DTM A;  3CHW A;  3RMA A;  4FSV A;  4Q5V A;  1BA1 A;  4BVP A;  5CY4 A;  4CGH A;  2IVP A;  3UE5 A;  1C0F A;  3HPG A;  2KZZ A;  3LDO A;  3OYL A;  3SYZ A;  5HRO A;  3VQP A;  4C8O A;  3QEW A;  3KLE A;  1U45 A;  2P9P B;  3SBG A;  4JRP A;  4DR2 K;  3QNN A;  3HBT A;  3LDP A;  2YKM A;  5C0Y A;  2ITG A;  3FZL A;  3NF8 A;  4ILJ A;  4BRD A;  4LF4 K;  4CI6 A;  2O8D A;  1IV0 A;  1NGB A;  3A5N C;  4YFU A;  3H08 A;  2BTF A;  3RSE A;  2E6L A;  3ZLJ A;  5HOO A;  4CED A;  3U3G A;  3MDQ A;  1WOQ A;  5AZI B;  4JRQ A;  1Q7Y O;  4J2B A;  4A57 A;  1VSL A;  3HO1 A;  3PX4 A;  3VQ6 A;  3HOS A;  1WUA A;  3AO5 A;  3ZSX A;  3WEE A;  2ZJP L;  2DFE A;  3I56 N;  3LDQ A;  1RDC A;  3PO5 A;  1HLU A;  1WSI A;  5DM6 L;  1WAJ A;  3KIO A;  3LP2 A;  3K9J A;  4CGD A;  3KLF A;  5EU7 A;  4KB0 A;  1S5J A;  5AQT A;  5MLC Q;  3WXJ A;  3C6U A;  4TSX A;  5C2D A;  3P4I A;  3RR7 A;  3MMV A;  4DB3 A;  2GUI A;  4FLV A;  4ILH A;  4E89 A;  1MWM A;  3QEV A;  2UUC K;  1DTT A;  1QQC A;  2ITM A;  3EZW A;  1HRH A;  4Z0U A;  2QI2 A;  2D4W A;  4BRE A;  3A0I X;  3L6Q A;  3K58 A;  2Q36 A;  3R1X A;  4BQL A;  4DFJ A;  1NK0 A;  1C0U A;  3G71 N;  1RDB A;  1TKT A;  3DXM B;  4XH5 A;  1Q9X A;  3D45 A;  4AM7 A;  1QQM A;  1T03 A;  1HNV A;  2I7N A;  3TR8 A;  2NRR A;  4CGG A;  3V81 A;  1EO1 A;  3OA9 A;  3JYT A;  2X74 A;  3CC7 N;  2P9N A;  4IKF A;  1JCE A;  4BG9 A;  3L2R A;  5CZ1 A;  2HHT A;  4CBX A;  3NH1 A;  4PKI A;  1WSG A;  3AVN A;  4MO5 A;  4CGJ A;  1ASU A;  1NK8 A;  2HBJ A;  2HNY A;  3I8D A;  2JWL A;  5KI6 A;  1I3A A;  5HRR A;  3B6O A;  1SL0 A;  1N32 K;  4AHU A;  4FL9 A;  4FJM A;  4X64 K;  3OYE A;  2NRX A;  1K8K B;  2HNZ A;  4L3Q A;  4HCC A;  2HST A;  4DF4 A;  2OPQ A;  3QES A;  2JLE A;  1A5X A;  3DLL L;  3KK1 A;  3WNF A;  4WYB A;  4BGB A;  2Q0U A;  2Q97 A;  1NGG A;  2XHB A;  4DHY A;  3QFP A;  1GLD G;  4WQ4 C;  2BH1 A;  1HKB A;  4DS4 A;  1L3V A;  1U47 A;  3O9Q A;  1GLC G;  1RBU A;  1ZBH A;  4KBO A;  3CIP A;  4M3T A;  3AVC A;  4BQZ A;  1E4F T;  4MLE A;  4GV3 A;  2FSN A;  3N4Q A;  1OKJ A;  3K9K A;  1L3T A;  4FK4 A;  1O1W A;  3E9O A;  2X78 A;  1LWF A;  4O5F A;  3DWL A;  4F3T A;  4HUE A;  1RTD A;  3TSU A;  1VRT A;  1KCF A;  2ZQB A;  3GL1 A;  3ALY A;  5C12 A;  3NGY A;  4NCA A;  3PO4 A;  2P9L A;  1A5V A;  4CF8 A;  2O8C A;  2ZGY A;  1MWK A;  4CK1 A;  4C1N K;  4CW7 B;  4OPJ A;  2EHG A;  1M90 O;  1NGE A;  3ZX3 A;  3ZT1 A;  4KHP K;  1ZBF A;  5EY4 A;  3VQB A;  4LSN A;  3QNO A;  3SBT A;  4FO0 A;  3ENO A;  3TSP A;  2XY8 A;  1N5Y A;  3AO2 A;  4LF7 K;  1X3N A;  4JKG A;  4DSI A;  3IFR A;  5AQL A;  4L8R B;  3G10 A;  1ATR A;  2F9T A;  5CYM A;  1VQ9 N;  4G1Q A;  1K8A O;  3ISN C;  1BI4 B;  2ETJ A;  4KKO A;  1JLB A;  4B9L A;  1SKW A;  3AVG A;  5M1K A;  2KKZ A;  4IJN A;  2I5J A;  4IG0 A;  5GAG P;  3CD6 N;  1C1C A;  1BDG A;  4C1N I;  2CGJ A;  1VQ5 N;  4DMN A;  3NGZ A;  4JHD B;  4WCE L;  4Z4F A;  3DLR A;  2ZE2 A;  1RBV A;  3JAM O;  1U04 A;  4IOA L;  4DF8 A;  2O4G A;  1QHT A;  4I9Q A;  3UKU B;  1E4G T;  5DM7 L;  2HHH K;  2LSN A;  4Z94 A;  1IKX A;  4CJT A;  5ADX H;  3MXJ A;  1VHX A;  4DR1 K;  3CC4 N;  1BA0 A;  3O5B A;  1TL3 A;  1JLA A;  2YKN A;  1NK5 A;  1NG9 A;  1M1K O;  3HJF A;  2D0O A;  4IEI A;  3J8A A;  3T1H K;  1RT3 A;  4YDU C;  3DM2 A;  1TVR A;  4JKF A;  5HRS A;  2XRI A;  1QTM A;  4A2B A;  1WSH A;  3AAQ A;  1JJ2 M;  3DI6 A;  4JI2 K;  3KZB A;  5I3U A;  4FZX C;  4DCH A;  4DQP A;  2F8S A;  3H3N O;  2D0A A;  1JLQ A;  2GUP A;  3PY8 A;  3TAF A;  4H5W A;  3DLB A;  3HI0 A;  4RTF D;  4DTS A;  3ZSY A;  2BAN A;  3K0S A;  3ZT3 A;  1NKB A;  4YOY A;  3VGL A;  1X9W A;  2VQF K;  4QCL A;  4IBN A;  3CJ9 A;  3AVF A;  1TAQ A;  4DKW A;  2ZM6 K;  2VG5 A;  3VPZ A;  4C8L A;  1HNW K;  1W2B M;  4ISE A;  1T05 A;  1QQO A;  1W0H A;  2O8D B;  4Z4H A;  3QEP A;  1YI2 N;  2W6K A;  3D7E O;  2YHY A;  3SJH A;  4IG3 A;  1S9E A;  1YVN A;  1ZBU A;  4B1W B;  2QW9 A;  2PYL A;  3CQX A;  1OH5 A;  2IVN A;  5E84 A;  3SAH A;  1F21 A;  4IO8 A;  4NO7 A;  2J4R A;  3D6R A;  2BGG A;  4M3W A;  4NYN A;  3G0Z A;  4CJ4 A;  4DFP A;  1RDU A;  4U7B A;  4C23 A;  4AHT A;  4I7F A;  4E7I A;  4BRA A;  1DT9 A;  4B3R K;  2HMP A;  3C6A A;  3G25 A;  1UAX A;  3QBX A;  1HYV A;  3HM8 A;  3KK3 A;  4GKJ K;  2G8H A;  4CIF A;  4KHN A;  2HHQ A;  2WUS A;  3QIO A;  3SV4 A;  4CJQ A;  5AQK A;  3CYM A;  1SZ2 A;  1IJJ A;  3RMC A;  2Z1I A;  3OVN A;  1NOY A;  2ASO A;  1WBD A;  5EXW A;  2YI1 A;  5JLH A;  3CCE N;  3VQ9 A;  5HP1 A;  5FPE A;  2O8F B;  4PWD A;  2G8U A;  2FF3 B;  4B1Y B;  3WUH A;  1J9A A;  3P31 A;  3MN5 A;  3H46 O;  1W97 L;  4ID5 A;  4FCY A;  4BRI A;  3PIO L;  4IO9 L;  1XHZ A;  3ZSZ A;  2G8K A;  3KTQ A;  1TK5 A;  1LWE A;  3A5O C;  1KLN A;  4BRL A;  3O9T A;  4CHZ A;  4E7H A;  2UUA K;  3O9R A;  4JKC A;  4CER A;  2WC9 A;  3HSC A;  3THW A;  4GMJ B;  3SJJ A;  1BCM A;  3EE9 A;  1BUP A;  2P1J A;  3F73 A;  2W42 A;  2AP1 A;  1SS6 A;  1SUQ A;  4B08 A;  4CZI A;  3CFR A;  2Y1J A;  4DR6 K;  1XQS C;  1P8Z A;  3O6W A;  3UB5 A;  3ZT4 A;  1KFS A;  2PY5 A;  4DR5 K;  4KRE A;  3OY9 A;  3ITH A;  1Z6R A;  4DS5 A;  5TKY A;  1VQ7 N;  4KTQ A;  3OHR A;  4BR0 A;  2VGN A;  4H5R A;  1BIZ A;  1CZB A;  5F0X A;  3CCU N;  1HUX A;  1T44 A;  1XNR K;  4DTR A;  1J53 A;  1JL1 A;  4B3T K;  5AQX A;  3BZK A;  5BPM A;  5BR9 A;  1BWF O;  4JV5 K;  4OKE A;  4J8F A;  4BRC A;  1VSJ A;  3ATU A;  4DTP A;  4DG1 A;  4FZY A;  1HJR A;  4I9L A;  3J7Z O;  5AQO A;  1S1V A;  3C6H A;  3ZSV A;  4PHT X;  4FZZ A;  4RCH A;  1HNZ K;  1VQM N;  1DLO A;  4Z4I A;  2WTU A;  3OYA A;  5FRN A;  1QVF M;  2OPP A;  1C0M A;  2GEM A;  4Z4G A;  4A62 A;  4KH5 A;  4RW4 A;  5GIN A;  4IFE A;  3FZK A;  3WQT A;  4CJK A;  1NJI O;  2WOM A;  2JWK A;  3I33 A;  3T3F A;  1NK6 A;  1UOC A;  2HHS A;  5FPD A;  2ZGZ A;  4E1N A;  2HMI A;  4WQ5 A;  2GTD A;  1TKD A;  4CEZ A;  3OW2 M;  1GLJ O;  3E1Y A;  4DLG A;  2ZF5 O;  4QOZ B;  4O4G A;  4BE0 A;  3EKS A;  4DTO A;  3ZSW A;  3VTI A;  3D2E A;  1CZA N;  4KPY A;  2HB5 A;  4JI6 K;  2RPI A;  4CHO A;  3FLC O;  3MXM A;  5AZJ B;  1XMO K;  4NLB A;  2P5O A;  4BY9 C;  3CCS N;  1YJ9 N;  1NJY A;  3AAP A;  3K5O A;  4O0J A;  3H6E A;  4OLA A;  4FWP A;  3ID6 A;  2E1Y A;  4BDZ A;  4YOU A;  4CJV A;  3MEG A;  3FZF A;  5F1X A;  3O9U A;  1X3M A;  1DGK N;  5JS1 A;  4MDA A;  3VQ5 A;  4H5N A;  1NGC A;  3CQY A;  4MDB A;  4YDU A;  5AQU A;  3VMF B;  3VER A;  2GBZ A;  4XIU A;  4F9O A;  4JLH A;  4BVO A;  1YIJ N;  4LF6 K;  1DKG D;  4BRF A;  4PL7 A;  5DK5 A;  4QS7 A;  4AHR A;  5AQF A;  3UIQ A;  1SQK A;  3TPQ A;  1RBR A;  3QIN A;  1BGX T;  4QS8 A;  2FBX A;  5C24 A;  3ZT0 A;  3VQE A;  4GKK K;  4CD3 A;  4H4O A;  3AA2 A;  3THY B;  3QEX A;  2CGK A;  5LMU K;  1LCU A;  1HQE A;  3BEX A;  4KO0 A;  1JLF A;  1OVY A;  3H45 C;  1LWC A;  1QSS A;  3A5M C;  4HTU A;  4EAH D;  5EOY A;  4IEE A;  2OYQ A;  1HJO A;  4Z4C A;  4Q0B A;  2CH6 A;  1N36 K;  1N33 K;  2DPN A;  1NGF A;  1YTA A;  4FJ8 A;  1XC9 A;  5FRM A;  4CEA A;  1HYS A;  3CM6 A;  3ZET A;  3VEW A;  1WNS A;  3L2U A;  4LSL A;  2P9I B;  1MA9 B;  3AVA A;  4FWN A;  4NYF A;  5C15 A;  1HR0 K;  2QWL A;  4OO1 J;  3KHY A;  1S3X A;  4E1J A;  4IZ9 A;  3TI0 A;  3OS1 A;  1KC8 O;  3VEX A;  1HNX K;  3NF9 A;  1QE1 A;  1RDD A;  5BRD A;  3V9S A;  1B9D A;  4CJL A;  1C1B A;  1CZ9 A;  1K9M O;  4PY5 A;  2P51 A;  1HYZ A;  1OH7 A;  4BRP A;  2V51 B;  1TL1 A;  5SWM A;  3NFA A;  3CPW M;  4F2S A;  3FR0 A;  4ICL A;  4BR4 A;  2XY5 A;  4YOR A;  1NJZ A;  4IDH A;  3EL2 A;  4XEI A;  1IH7 A;  3AVJ A;  1RBT A;  4HHT A;  1LAV A;  5BN9 A;  2NRH A;  4O55 A;  3KK2 A;  3PV8 A;  1IBK K;  1L5U A;  1RTI A;  4RW8 A;  1RBS A;  2KLA A;  4DTN A;  4KAZ A;  1O13 A;  3MK6 A;  2FXU A;  4CGF A;  1V4S A;  4IDK A;  4M45 A;  3L2Q A;  2O8E B;  3TAM A;  3HYF A;  3HOT A;  2BDP A;  4B1Z A;  4QAG A;  4A59 A;  4FVU A;  3RSE B;  4IFV A;  4CZK A;  4FOI A;  1BL3 A;  4CFB A;  1HMV A;  3MWP A;  1BCO A;  4I2Q A;  2ZD1 A;  4FJN A;  1C1A A;  4BRN A;  4ISF A;  3PSF A;  4DSK A;  1U6Z A;  1KSP A;  3W0L A;  2Q2R A;  1TV6 A;  2E20 A;  3BGR A;  4KI6 A;  3KLG A;  5KGW A;  2ZJR L;  1FK9 A;  2D0B A;  4F4K A;  3O4N A;  1JCF A;  1EWR A;  2DTU A;  4FWS A;  1EP4 A;  4EIA A;  4LFA K;  4HUG A;  2A1R A;  3KVG A;  1VAZ A;  2GEL A;  1ILY A;  3ENB A;  4JI4 K;  5EVZ A;  3HVT A;  3VA0 A;  4KTW A;  1SL2 A;  1TK0 A;  4J2A A;  3TAB A;  2E2O A;  1RIL A;  2PZS A;  2P9P A;  4FXD A;  3LP3 A;  4LH5 A;  2HND A;  3DLE A;  3M8S A;  5GIP A;  4B9M A;  1BG3 A;  2A3Z A;  4N41 A;  3M1F A;  1W9H A;  4JK8 A;  2G8I A;  2B6A A;  3J7A P;  3F2K A;  4DR3 K;  3SZ2 A;  3NVK A;  2Z1G A;  4W5Q A;  5JVG L;  1RDA A;  3SK3 A;  4LF8 K;  4KHS A;  3QFU A;  3AGK A;  5J2M A;  1U4B A;  3O3H A;  3LPU A;  2Q31 A;  3SQ4 A;  1RCH A;  3MAQ A;  3AO3 A;  2D0C A;  1C6V A;  3CQ8 A;  4CF9 A;  3EZ5 A;  4CIE A;  5DMR A;  4CF1 A;  3AVI A;  3J7Y P;  4M41 A;  4BAC A;  1S6Q A;  4EZ6 A;  4YNQ A;  3L4I A;  1RT7 A;  2F96 A;  3OYM A;  3THV A;  4J2E A;  2IOC A;  2NLX A;  2E6M A;  5HL7 L;  1VSH A;  1SV5 A;  3U6F A;  1TKX A;  2VCP A;  4W5R A;  1MDU B;  3HM9 A;  2HBK A;  1BQM A;  3O3G A;  4B3S K;  5D3G A;  3VA3 A;  3U9D A;  2P9S A;  3BY5 A;  4IXC A;  3SAF A;  4F2R A;  4FWK A;  1JKH A;  4WE1 A;  5FRO A;  3THY A;  3DXK A;  4JS4 A;  1YJW N;  4A5B A;  1JL2 A;  1TUY A;  3I0S A;  4HVJ A;  3OYD A;  1IBL K;  4X66 K;  4CD1 A;  4DTJ A;  3L3V A;  1JLC A;  4CHP A;  1NK4 A;  3NAE A;  2F8T A;  2KFZ A;  1IKV A;  1Q18 A;  1JXE A;  5LY3 A;  3OYH A;  2BUP A;  3CCV N;  2UYT A;  5IWA K;  3ZSQ A;  3NBP A;  2VG6 A;  1KQS M;  5TKW A;  4I2P A;  4R5P A;  4BR7 A;  4FLZ A;  2IDO A;  4K8Z A;  3ZEU A;  1I39 A;  3I8B A;  1GOA A;  1HKG A;  1MU2 A;  5KPZ A;  3OYC A;  3SUN A;  1VQ8 N;  1ZYQ A;  3CCL N;  1ATS A;  1GOC A;  1WSF A;  4JKG B;  3DOL A;  3OJU A;  4DSE A;  4B1X B;  3EY1 A;  1TAU A;  1ZBL A;  2Y1I A;  1IBM K;  2VWJ A;  1HNI A;  1T8E A;  4FYD A;  4XH1 A;  1TUU A;  4FJH A;  3VOV A;  2QK9 A;  3M8P A;  5JS2 A;  4CEB A;  4DLE A;  4M3U A;  1ZXO A;  3KKS A;  3CCR N;  4M3R A;  3ZSO A;  2F7T A;  4B9S A;  1KAZ A;  4DFM A;  3DLH A;  3QER A;  3JXU A;  1BHL A;  4GNI A;  3FZM A;  4AQY K;  3DXK B;  4OKJ A;  4AHC A;  5AQG A;  4MO4 A;  3IRX A;  1FKP A;  4JI7 K;  4F8R A;  3L8B A;  3EE8 A;  3NCI A;  4BG8 A;  4PL8 A;  1TKZ A;  4ILG B;  4DUZ K;  4AHV A;  3LZJ A;  2A42 A;  3TAP A;  4YOV A;  4CZM A;  4FJ9 A;  4CJ3 A;  2D1K A;  2VGM A;  1YIT N;  4M3Z A;  3H1V X;  3VN5 A;  2ATQ A;  3QBW A;  1LW2 A; 
#chains in the Genus database with same CATH homology
 3HPG A;  4GW6 A;  2KZZ A;  4CEE A;  3OYL A;  4OKE A;  3SYZ A;  1JLG A;  5HRO A;  3IG1 A;  3VQP A;  4C8O A;  1VSJ A;  3QEW A;  1S9G A;  3KLE A;  4DTP A;  4DG1 A;  3S9H A;  1U45 A;  4CCH A;  4FZY A;  4E7J A;  1HJR A;  4JRP A;  3CFO A;  4I9L A;  3QNN A;  2FBV A;  1S1V A;  2YKM A;  3HST B;  3ZSV A;  4CJR A;  4N76 A;  4FZZ A;  2ITG A;  3NF8 A;  3NHG A;  4AIL C;  3SQ0 A;  1DLO A;  4CFA A;  3SPY A;  2QXF A;  2IS3 A;  4CJF A;  3H08 A;  4YFU A;  4UQG A;  4CEF A;  4Z4I A;  3OYA A;  2E6L A;  4CE9 A;  5FRN A;  3S3O A;  4CED A;  3U3G A;  2OPP A;  1C0M A;  3VQD A;  4FK0 A;  4Z4G A;  3QLH A;  4RW4 A;  4JRQ A;  3MEE A;  4B9T A;  4J2B A;  3T19 A;  3CFP A;  4CEC A;  4CJK A;  2WOM A;  3MED A;  1VSL A;  3AVM A;  3T3F A;  3RMD A;  3PX4 A;  1NK6 A;  1UOC A;  3HO1 A;  1NK7 A;  3VQ6 A;  4J2D A;  2HHS A;  2HMI A;  4E1N A;  1ITG A;  3AO5 A;  1QS4 A;  1TKD A;  3ZSX A;  4CEZ A;  3OYJ A;  4FLU A;  3SQ2 A;  2P5G A;  1CXQ A;  4DLG A;  1S6P A;  4QOZ B;  5KGX A;  2DFE A;  4DQI A;  1K6Y A;  1WSE A;  4O4G A;  4BE0 A;  4DTO A;  3ZSW A;  5HBM A;  2HHV A;  4W5N A;  1RDC A;  4O5B A;  1BIU A;  3PO5 A;  4KPY A;  1YTU A;  4EP4 A;  4LH4 A;  1D8Y A;  1WSI A;  2HB5 A;  3RTV A;  4M3X A;  2RPI A;  1RTH A;  3K5N A;  1WAJ A;  4CHO A;  4DSJ A;  3OYG A;  3KIO A;  3LP2 A;  4CGD A;  3TAG A;  3MXM A;  4KB1 A;  1A5W A;  3KLF A;  5EU7 A;  5HLF A;  1S5J A;  1VK0 A;  4KB0 A;  4FJI A;  3C6U A;  4TSX A;  5J2P A;  3RR7 A;  1XHX A;  2P5O A;  1JLE A;  1RT2 A;  4KTZ A;  4DU4 A;  2YNF A;  2GUI A;  1NJY A;  1KVC A;  3K5O A;  1CXU A;  4O0J A;  1NJW A;  4FW1 A;  1QSL A;  4OLA A;  4FLV A;  4PQU A;  4BDZ A;  4CFC A;  4CJV A;  3MEG A;  1EET A;  4E89 A;  4BE2 A;  3QEV A;  4HCB A;  2KTQ A;  1DTT A;  3P5J A;  1QQC A;  3QIP A;  1DTQ A;  3AVB A;  3VQ4 A;  5JS1 A;  1HRH A;  4Z0U A;  4W5O A;  3NF7 A;  3K58 A;  4CJU A;  3DRS A;  2KW4 A;  3VQ5 A;  2Q3S A;  3CM5 A;  1X9S A;  4DFJ A;  3M8Q A;  4MFB A;  1NK0 A;  1KRP A;  1C0U A;  2GBZ A;  3AO4 A;  4XIU A;  4H8K A;  1D5A A;  3SQ1 A;  4JLH A;  3AA5 X;  4EZ9 A;  1RDB A;  1FXX A;  3B6P A;  1XI1 A;  1TKT A;  4ZHR A;  4N5S A;  1Q9X A;  4AH9 A;  5DK5 A;  3D45 A;  5SZT A;  4CJW A;  1T03 A;  2GV9 A;  4E1M A;  4ID1 A;  1HNV A;  4FJK A;  1VSI A;  1ASW A;  4KHY A;  3TR8 A;  4AHR A;  2DY4 A;  1HQU A;  2JGU A;  1L3S A;  4CGG A;  2AJQ A;  3V81 A;  3A2F A;  3AA3 A;  3VQQ A;  4DSF A;  3UIQ A;  3JYT A;  2X74 A;  1RT4 A;  4BWM A;  1RBR A;  3QIN A;  4IKF A;  3SCX A;  4ZTF A;  3HPO A;  3L2R A;  1BGX T;  1VRU A;  5CZ1 A;  2FBX A;  1IG9 A;  2HHT A;  3DRR A;  3NH1 A;  5C24 A;  4BE1 A;  3TAR A;  4KI4 A;  1WSG A;  3ZT0 A;  3AVN A;  3PX6 A;  3VQE A;  4CGJ A;  1Q8I A;  1ASU A;  3D0P A;  4H4O A;  3SI6 A;  3AA2 A;  2HNY A;  3I8D A;  1NK8 A;  1TGO A;  2QKB A;  3QO9 A;  5KI6 A;  4K8X A;  1I3A A;  5HRR A;  1Z26 A;  3B6O A;  1SL0 A;  4FJG A;  3QEX A;  3LP0 A;  4CF2 A;  1VSE A;  2YNI A;  3V9U A;  2BE2 A;  4E0D A;  2PYJ A;  4AHU A;  1HQE A;  4OGE A;  2Z1J A;  4FJM A;  4KO0 A;  1JLF A;  4B8C A;  1X9M A;  3OYE A;  1LWC A;  4E3S A;  4FLY A;  3RR8 A;  2HNZ A;  1QSS A;  1IKY A;  3V6D A;  1UA1 A;  4HTU A;  3LZI A;  4HCC A;  1X1P A;  4DF4 A;  1WAF A;  2G8F A;  2OYQ A;  2OPQ A;  3QES A;  4Z4C A;  1ZBI A;  2JLE A;  4PUO A;  1A5X A;  3DYA A;  4CFD A;  2FC0 A;  2YNG A;  3V1R A;  3KK1 A;  3RMB A;  3S3N A;  4Q0B A;  3T1A A;  4DQQ A;  4CES A;  3WNF A;  1YTA A;  3LAN A;  4FJ8 A;  1XC9 A;  2XHB A;  1HPZ A;  5FRM A;  4CEA A;  1HYS A;  1L3V A;  4DS4 A;  3CM6 A;  5T7B A;  3RWU A;  4CEQ A;  1WNS A;  1LW0 A;  1U47 A;  3L2U A;  1UWB A;  3AVA A;  4LSL A;  3L2W A;  1RBU A;  2B5J A;  1ZBH A;  2IC3 A;  3HP6 A;  4M3T A;  4NYF A;  3AVC A;  2WON A;  1B9F A;  4FJJ A;  4FK4 A;  1L3T A;  1IKW A;  1O1W A;  5KRS A;  3HK2 A;  3TI0 A;  2X78 A;  1LWF A;  4CHQ A;  3OS1 A;  3VQ8 A;  4F3T A;  3DMJ A;  4CF0 A;  4HUE A;  3NF9 A;  1EX4 A;  1RTD A;  3PUF A;  1QE1 A;  1VRT A;  4FJ7 A;  1KCF A;  1RDD A;  2ZQB A;  3P1G A;  2XO7 A;  4NCG A;  3ALY A;  1B9D A;  3V9S A;  1CLQ A;  3NGY A;  4CJL A;  4NCA A;  2HVH A;  3PO4 A;  1C1B A;  1U48 A;  1CZ9 A;  4PY5 A;  2P51 A;  4KHQ A;  1A5V A;  1HYZ A;  4CF8 A;  2YHB A;  1TL1 A;  5SWM A;  3NFA A;  3TWH A;  2KQ2 A;  4CK1 A;  3TAN A;  4Z4E A;  2HHW A;  2Z1H A;  4C8M A;  4F2S A;  4OPJ A;  2EHG A;  3MEC A;  3RRG A;  4ICL A;  1WSJ A;  2XY5 A;  1S1X A;  3V1O A;  1NJZ A;  3P83 D;  3SUQ A;  3ZT1 A;  1ZBF A;  1WN7 A;  3K5M A;  3NDK A;  4FJL A;  1IH7 A;  3AO1 A;  1NOZ A;  3AV9 A;  1D9F A;  3AVJ A;  2KZM A;  1RBT A;  3VQB A;  4LSN A;  4HHT A;  3QNO A;  4CJP A;  2R7Y A;  3NH2 A;  1LAV A;  3ULD A;  1JXB A;  3LAK A;  4O55 A;  3V9X A;  3KK2 A;  2XY8 A;  1N5Y A;  1KVB A;  3PV8 A;  4KHU A;  3AO2 A;  4FM2 A;  1L5U A;  1RTI A;  4RW8 A;  5E41 A;  1RBS A;  4DTN A;  4DSI A;  4KAZ A;  1RT5 A;  4W5T A;  4L8R B;  4CGF A;  3G10 A;  3L2V A;  4O0I A;  5CYM A;  1Q9Y A;  4G1Q A;  2YHA A;  4RG8 A;  3ISN C;  1BI4 B;  4IDK A;  4M45 A;  3L2Q A;  2ETJ A;  4KKO A;  1NK9 A;  3HPH A;  1JLB A;  3TAM A;  5C25 A;  3AVG A;  3HYF A;  1SKW A;  4B9L A;  2EX3 A;  2I5J A;  4IG0 A;  2BDP A;  1C1C A;  3QEI A;  2G8V A;  3LAL A;  5J2Q A;  4CHN A;  4QAG A;  1VSM A;  5J2N A;  3LWL A;  1RT6 A;  1VSK A;  4DMN A;  4IFV A;  3V9Z A;  3NGZ A;  1L3U A;  3K2P A;  4Z4F A;  1U49 A;  3DLR A;  2ZE2 A;  1BL3 A;  4CFB A;  1RBV A;  4RW6 A;  3WNG A;  1HMV A;  3OS2 A;  1GOB A;  1S1T A;  1U04 A;  1BCO A;  4I2Q A;  2ZD1 A;  4E19 A;  4DF8 A;  3DLG A;  4FJN A;  2O4G A;  1QHT A;  3O3F A;  4I9Q A;  1C1A A;  4C8N A;  4DSK A;  2YNH A;  3EYZ A;  1KSP A;  3OYF A;  3L3U A;  2LSN A;  3AA4 A;  1IKX A;  1TV6 A;  3BGR A;  4CJT A;  4FM1 A;  4KI6 A;  3HL8 A;  2OZM A;  3KLG A;  3MXJ A;  5KGW A;  1FK9 A;  2D0B A;  4CGI A;  4F4K A;  2D5R A;  3O4N A;  4OJR A;  3OYI A;  1TL3 A;  1JLA A;  2YKN A;  4FLW A;  3C95 A;  1NK5 A;  2DTU A;  1YT3 A;  3HJF A;  2A1S A;  3V4I A;  3SPZ A;  1EP4 A;  3U3Y A;  3NF6 A;  4N56 A;  2NUB A;  4HUG A;  2A1R A;  3M8R A;  4B9N A;  3DOK A;  1RT3 A;  3RRH A;  1WLJ A;  4CEO A;  1T7P A;  3DM2 A;  1TVR A;  3QET A;  5HRS A;  2XRI A;  1SKR A;  1C0T A;  1QTM A;  1KTQ A;  4DFK A;  4ELV A;  1WSH A;  1UA0 A;  3HVT A;  4DQS A;  3ZSR A;  3VA0 A;  3DI6 A;  4KTW A;  1SL2 A;  4RW9 A;  2DFF A;  5I3U A;  1TK0 A;  1TK8 A;  4FZX C;  4J2A A;  4ELU A;  3TAB A;  4DQP A;  4FJ5 A;  2F8S A;  4B3O A;  4FVM A;  4KFB A;  2D0A A;  4CJS A;  1RIL A;  2PZS A;  1JLQ A;  4FLT A;  4FXD A;  3K59 A;  3LP3 A;  2HVI A;  3PY8 A;  3TAF A;  4LH5 A;  3DLB A;  2HND A;  3TAQ A;  2IGI A;  1EKE A;  2X6S A;  3DLE A;  3M8S A;  4DTS A;  1Z25 A;  3ZSY A;  2BAN A;  2XY7 A;  3HT3 A;  4DSL A;  1Y97 A;  3ZT3 A;  1NKB A;  3BDP A;  1X9W A;  4B9M A;  2DFH A;  1J54 A;  4ELT A;  2XY6 A;  4QCL A;  4HUF A;  3LDS A;  4N41 A;  4EP5 A;  4IBN A;  1W9H A;  3AVF A;  1TAQ A;  2G8I A;  4DU1 A;  3VQA A;  3ZT2 A;  2B6A A;  4BDP A;  2VG5 A;  2X6N A;  4MQ3 A;  3S3M A;  4FJX A;  1S1W A;  3SZ2 A;  3SNN A;  1BI4 A;  4C8L A;  2Z1G A;  4KHW A;  1KVA A;  4RW7 A;  4W5Q A;  4Y1C A;  1RDA A;  4KHS A;  4CIG A;  5J2M A;  1U4B A;  3V1Q A;  1T05 A;  2G8W A;  1RT1 A;  1W0H A;  3O3H A;  4Z4H A;  2RKI A;  3QEP A;  3LPU A;  4C8K A;  3SQ4 A;  1RCH A;  3MAQ A;  3AO3 A;  2D0C A;  1C6V A;  3NGI A;  3CQ8 A;  4CF9 A;  3EZ5 A;  4IG3 A;  1S9E A;  4CIE A;  5DMR A;  1ZBU A;  3AVI A;  4CF1 A;  4M41 A;  5HRN A;  1S6Q A;  4BAC A;  1R0A A;  4EZ6 A;  4YNQ A;  1RT7 A;  2F96 A;  3JSM A;  2PYL A;  3OYM A;  3THV A;  2RN2 A;  4J2E A;  2IOC A;  2E6M A;  4BDY A;  1VSH A;  3I0R A;  1SV5 A;  3DRP A;  3SUO A;  4B9U A;  1F21 A;  1J5O A;  3E01 A;  3U6F A;  1TKX A;  2FBT A;  3OYB A;  2BGG A;  2OPR A;  4M3W A;  1KLM A;  4NYN A;  1BQN A;  3G0Z A;  4CJ4 A;  4DFP A;  2HHX A;  4W5R A;  2IAJ A;  3HM9 A;  1BQM A;  3O3G A;  1VSD A;  4AHT A;  5D3G A;  3V9W A;  4I7F A;  4E7I A;  4E7K A;  3VA3 A;  4NCB A;  4F2R A;  3LAM A;  2FBY A;  5CYQ A;  1REV A;  1JKH A;  4WE1 A;  1YVU A;  3OYK A;  5FRO A;  3CG7 A;  2E4L A;  3DLK A;  4JS5 A;  4JS4 A;  3ASM A;  3KLH A;  1UAX A;  1HYV A;  1JL2 A;  1LAW A;  1IO2 A;  3I0S A;  4HVJ A;  3OYD A;  4N47 A;  3F9K A;  4DQR A;  1NJX A;  3KK3 A;  3KLI A;  3AVK A;  2OA8 A;  2G8H A;  3O4Q A;  4CIF A;  3LWM A;  4F3O A;  4KHN A;  2HHQ A;  2RF2 A;  4OKK A;  3K5L A;  4DTJ A;  3QIO A;  3SV4 A;  3L3V A;  4CJQ A;  3HXM A;  1JLC A;  4CJE A;  3OS0 A;  4CHP A;  1NK4 A;  3HP9 A;  3AVL A;  3CYM A;  3NAE A;  3IS9 A;  3RMC A;  2F8T A;  2KFZ A;  1IKV A;  3ZCM A;  2Z1I A;  1JXE A;  3VQC A;  3OVN A;  3OYH A;  1LV5 A;  1NOY A;  3FFI A;  1BIS A;  4FW2 A;  4H4M A;  5FDL A;  4CHY A;  4OPK A;  3KJV A;  1QSY A;  3ZSQ A;  3NBP A;  3VQ9 A;  2VG6 A;  3KKR A;  5HP1 A;  1ASV A;  4B9V A;  4KRF A;  4I2P A;  1G15 A;  1VSF A;  4R5P A;  4PA1 A;  4ZTJ A;  2G8U A;  4PWD A;  4FLZ A;  5CZ2 A;  1SKS A;  4FLX A;  2IDO A;  1J9A A;  1S1U A;  4K8Z A;  4M3Y A;  1I39 A;  1GOA A;  3MXI A;  1MU2 A;  5C42 A;  5K14 A;  3WNH A;  3OYC A;  1N6Q A;  1RNH A;  4LY7 A;  4OVL A;  3SUN A;  2B4J A;  3KD5 E;  5KTQ A;  1ZYQ A;  4ID5 A;  1XWL A;  2OPS A;  4FCY A;  3SV3 A;  1XHZ A;  3ZSZ A;  2G8K A;  2O4I A;  1GOC A;  1WSF A;  3WNE A;  3KTQ A;  3K57 A;  1TK5 A;  4FK2 A;  1LWE A;  4DTU A;  3DOL A;  4IFY A;  4Y1D A;  1KLN A;  3OJU A;  4DSE A;  3EY1 A;  1D9D A;  1TAU A;  4B8A B;  3LP1 A;  1ZBL A;  2Y1I A;  3LPT A;  4CHZ A;  2VWJ A;  1HNI A;  4E7H A;  1T8E A;  4E7L A;  4FYD A;  4CER A;  3IAY A;  4FJH A;  3TAE A;  4GMJ B;  3OJS A;  3SJJ A;  1BCM A;  3NE6 A;  4FM0 A;  1FKO A;  3PX0 A;  2VG7 A;  5HRP A;  2P1J A;  3HVR A;  2W42 A;  3F73 A;  2QK9 A;  3M8P A;  1RTJ A;  5JS2 A;  4CK2 A;  4CEB A;  1SL1 A;  1KFD A;  1SUQ A;  4B08 A;  4DLE A;  4M3U A;  3KKS A;  3CFR A;  1EXQ A;  4KV8 A;  4M3R A;  4DTX A;  2Y1J A;  4DWI A;  3ZSO A;  4BWJ A;  3C6T A;  5I42 A;  4AHS A;  4OGC A;  3OYN A;  3KD1 E;  3ZT4 A;  4DFM A;  4B9S A;  3DLH A;  1KFS A;  3QER A;  2QKK A;  1BHL A;  2PY5 A;  2OZS A;  4LD0 A;  4KRE A;  3OY9 A;  2HHU A;  4OKJ A;  4AHC A;  3ITH A;  3AVH A;  2VWK A;  3IRX A;  4DS5 A;  1FKP A;  4DU3 A;  3SUP A;  4F8R A;  4KTQ A;  4OLB A;  3L8B A;  1NKE A;  3NCI A;  1BIZ A;  1CZB A;  3NH0 A;  4CJ5 A;  1TKZ A;  3VQ7 A;  4AHV A;  3LZJ A;  5J1E A;  3TAP A;  4DTM A;  3RMA A;  1NKC A;  4DTR A;  2HW3 A;  1J53 A;  2YV0 X;  1JL1 A;  4CJ3 A;  1B92 A;  5KRT A;  4Q5V A;  4FJ9 A;  2KFN A;  4M42 A;  4CK3 A;  4GVM A;  5CY4 A;  4M3Z A;  3VN5 A;  2ATQ A;  1LW2 A;  3C94 A;  4O44 A;  4CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...