3ISNC

Crystal structure of hiv-1 rt bound to a 6-vinylpyrimidine inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase, hydrolase
total genus 141
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00075 RNase_H RNase H
C PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
C PF06815 RVT_connect Reverse transcriptase connection domain
C PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3isnC01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3isnC05
1TQLA 4ELVA 3KIOA 2YKNB 3LWMA 2G8WA 2KFZA 5EDWA 3NGYA 1JL2A 4FS2A 2PYJA 1VRTA 4NRUA 3HKWA 3OHBA 3MAQA 3KKRA 4GC6A 4DL3A 3PJWA 4NCAA 4ECVA 3OYHA 4KHSA 5DK5A 1A5WA 1KSPA 2FVSA 4NLDA 4TYAA 2B43A 4FJ8A 3OYNA 4O44B 4CF0A 3DMJA 3DOLB 3LZJA 3HJFA 1C0MA 3GV7B 2LSNA 4MKBA 4DQIA 2HAIA 3MR3A 1RTDB 1TKXA 3NF9A 4XO0A 4MK8A 4E3SA 2YKMA 4Y1CA 2D0AA 3KK2B 4E1NA 4CEOA 3OYCA 2EX3A 4BE1A 3TI0A 1VSDA 5KFOA 5HRPA 1NKEA 3KJVB 4B9MA 4CJTA 1SUQB 3OY9A 2E9TA 3HL8A 3KMSA 3IG1B 4F4KA 4ZVGA 4ZPCA 3O3FA 1IKYB 2ZD1A 3PO4A 2VG7B 4CJ3A 4EP5A 4XIUA 5KFLA 4FW2A 3H4BA 2YNFB 2HVHA 2HWHA 1RBSA 2UUTA 1TV6A 4E0DA 4IOBA 3K2PA 1C0TA 1HYSA 4M45A 3ITHA 1C2PA 4DTSA 4CECA 3H08A 3M8RA 2QKBA 1U48A 3MEGA 1ZTTA 5DLGA 4Z4GA 1JXBA 3EPIA 5EWEA 3L8BA 4Q43A 4E19A 3H4DA 4BDZA 3LP0A 3MF5A 4ID5B 3KD5E 3CJ0A 3U6FA 2VA2A 4J9MA 2JEGA 5DLFA 1L3TA 3OJSA 1IO2A 2FJWA 4BE2A 3H5SA 4JS5A 4DFMA 1CXUA 3VQ8A 4EYHB 3KLIB 1TP7A 1B9FA 4DG1B 1QTMA 3PR5B 3NAEA 2Z1IA 1XC9A 3KLEA 4ZTJA 3TARA 3UIQA 1LWEB 4IRCA 3QEVA 4G1QA 1RT6A 3BQ0A 4DLEA 1C0UB 2OH2A 4I2QA 3DLGB 3G6VA 3DYAB 3PY8A 1S1UA 4M3TA 4M94A 2YNGA 5KFEA 2R8JA 4EO8A 1RT4B 2W7PA 1ZETA 4FLTA 3CJ2A 4FLXA 1QE1A 4JV2A 2PZSA 5HROB 3OL9A 4CFBA 2OPQA 2ILZA 3JYTB 2D0CA 2VG6B 3Q8SB 4DTXA 5FRNA 5CZ2A 4J2AA 3GIMA 5I42A 4LY7A 2BRLA 4F4XA 4GVMA 4O55A 4AHVA 3LZIA 4KPYA 1SH2A 2YV0X 1NOYA 4ZPAA 1D8YA 2IM3A 3KK1B 2WRMA 4F8RA 3ISND 2DPJA 1ZBFA 5FROA 1DTTA 4Z0UA 1LV5A 2CKWA 2IGIA 3L2UA 3DLHA 3T19A 3GILA 1WSEA 4WYLA 1JXEA 3S3MA 1LWFA 1RA6A 2R2SA 2C22A 4CJQA 1RT1B 3P1GA 2WOMA 1J5OB 3OHAA 1LWCA 3CYMA 1J53A 4CEQA 1R0AA 4YR3A 1RBRA 4W5NA 1KLMB 3I5BA 2BDPA 1NKBA 3PX6A 4FJ9A 4PWDA 3CQ8A 3PUFA 5T7BA 5C24B 4QW8A 2AQ4A 2RDIA 4TSXA 4Z4CA 3BSCA 4DL7A 4NCBA 3MECA 3BREA 2WHOA 1S1VA 2VG5A 4U6PA 2R8IA 1Z25A 5D3GB 2WK4A 3IGNA 4K4SA 3AO5A 3AO2A 4NLSA 1TL3A 3JSMA 3FFIB 4RNMA 3OLAA 4KHYA 3V6DB 1S6QA 4J9NA 4CF1A 1NK8A 2IA6A 4FJJA 3O4QA 3BQ2A 2A1SA 1WSHA 4O4GB 3G86A 4ZHRB 3ZSQA 4RU9A 3CJ4A 1W0HA 3L3VA 1S6PB 1UWBB 2UVRA 1WAFA 3MXMA 3TVKA 2FLLA 3PVXA 4FM1A 1S1XB 2B4JA 1W25A 1F21A 2ALZA 4Y1DA 4ECUA 1HPZB 3RAXA 4CJ5A 5L1KA 1HMVA 4K4TA 3KLHB 4CJLA 1TVRA 4Q0BA 3C6TA 5KFTA 2HVIA 1RTHB 3SQ2A 1IKVB 5EWGA 2W7OA 3LALA 4FJNA 3K57A 3CM5A 3QIPA 1FKPA 4RNNA 3AVMA 1JLFA 5FDLB 2OZSA 2F8SA 5KT6A 1L3SA 3V6KA 4LH4A 1T03A 1S1TA 2JEJA 3ICLA 3OSNA 3OS0A 1FXXA 1GOCA 4QW9A 4NLPA 4ECXA 4F4YA 4C8NA 1TK0A 3S3OA 1IH7A 1LW2B 3F9KA 3O3HA 4YR0A 5F8MA 2ASLA 2YKNA 1RNHA 3E01B 4Y2AA 2GC8A 4QOZB 2D41A 4FM2A 4L8RB 4K4XA 3QO9B 4OJRA 2HHUA 4DWIA 4LSNB 5F9LA 4M3XA 3K5OA 3NF8A 4O44A 4J9PA 4E1MA 3DOLA 3U3GA 5KFKA 3OYMA 3SI6A 4O4RA 2IM1A 1WSFA 1RTDA 5KFBA 4PY5A 1RT3B 2WONB 2X78A 3DLKB 3L2RA 4R5PB 1RDBA 3KK2A 4CIEA 4FXDA 2XO7A 3KNAA 3VA3A 4KAZA 1JL1A 3KJVA 2G8KA 5KT7A 3A2FA 4OKJA 4CEEA 4J9KA 3BDPA 4ZVFA 3P5JA 4CJSA 1SUQA 4O3SA 4GW6A 4CJPA 3IG1A 1HRHA 1N5YB 3AVIA 1Q9XA 5DQIA 1X1PA 4CERA 1IKYA 1ZBUA 2DPIA 2G8FA 3BSOA 2VG7A 3HO1A 4B9LA 1UA1A 1X9MA 1LWFB 2XCAA 2YNFA 3RB3A 5DGAA 4CE9A 2KZMA 2CJQA 3HYFA 3DM2B 4NLQA 4RW4B 3KK3B 1WAJA 3KHGA 4B8CA 3OL8A 5DMRA 1XHXA 3G6YA 1YVUA 3RWUA 3QIDA 5KFXA 3NKYA 4CHOA 4LQ9A 4ID5A 5L1IA 4CK1A 2FJXA 4EO6A 1C1AA 3RMAA 3OYGA 1CSJA 4DTUA 5C5JA 4W5QA 3KLIA 2DFHA 1YT3A 4FK2A 3M9NB 4AH9A 4TXSA 2OZMA 4DG1A 4O3RA 4DL4A 4AHRA 2ZE2B 4KTWA 5EU7A 2FVPA 3MR5A 1LWEA 3V6HA 2HMIA 3EZ5A 4HKQA 2P1JA 4M42A 3OYBA 4CJKA 1RT2B 3D28A 4B08A 1T94A 1C0UA 3QNNA 1VSFA 3DLGA 3DYAA 4NLYA 4CK3A 1RT4A 3HPOA 4QWCA 3DLBA 3AA3A 3I0SB 3F73A 4HYKA 5HROA 4KO0B 1RAJA 3CM6A 2R2UA 4DL2A 2IMWP 4OLBA 5KTQA 3JYTA 4CHQA 2VG6A 2AGQA 4DTOA 3OYLA 4CIFA 4RNOA 1BI4B 4EYIB 3C95A 4O0IA 1I3AA 4KTZA 1LW0B 5C25B 1A5VA 3KK1A 2IAJB 1TAQA 5KRTA 3PHEA 4CJWA 2I5JB 2G8VA 4RNHA 2EHGA 2IDOA 4TQRA 4FLVA 1C1BB 3NBPB 2FBXA 4N5SA 4KKOB 4FJMA 3KLFB 1S48A 1NK9A 5KGWA 3K5LA 3TABA 4IG3B 2FC0A 5KFHA 3CWJA 5DQHA 4QWEA 1RT1A 4E7JA 2OPSB 3SNNA 3V1OA 4NLVA 4LD0A 1J5OA 1QUVA 3OYDA 1U09A 3MEEB 4NLTA 3LAMA 4NLRA 4MH8A 3PX0A 4M41A 1A5XA 4CF8A 4DTNA 3ALYA 1BCMA 1XR5A 1KLMA 4FJKA 5K14B 4ECTA 3DLEB 4F2RA 2IC3B 5C24A 3QEIA 4FBUA 3QYYA 4CGGA 3QLHB 2HNZB 4FBTA 3VQ9A 3NMAA 2IJFA 3PW4A 2BR0A 4B3OB 3LAKA 3BSAA 5D3GA 1RDRA 1EP4B 5JUMA 3LDSA 3AVKA 3QETA 1REVB 3FFIA 3V6DA 2V9WA 3KHRA 4IKFA 3M8SA 2C2DA 3HPHA 2HNYB 2HHXA 1BQNB 3KKSA 3C6UB 3D45A 2F96A 4N47A 4URSA 4ZP9A 4O4GA 5JS2A 4EBEA 4ZHRA 3OS2A 3VN5A 5KG3A 3CG7A 4DU4A 4CGIA 1S6PA 1UWBA 3CVKA 1S1XA 1HJRA 1VSJA 4ELTA 1U45A 2Z1HA 1BQMB 5KGXA 1HPZA 3MXIA 3AA4A 2B6AB 4HHTA 4FJGA 1VSMA 4BDYA 1T3NA 1XI1A 3KLHA 3ISNC 3VQ4A 2R7YA 1S5JA 2RPIA 1BL3A 4E7LA 3AO1A 2XHBA 1RTHA 1IKVA 4PQUB 2YNHB 1JLEB 3TAMB 3LP2B 4WYWA 5KFQA 2HHSA 1UAXA 5FDLA 2WCXA 4Z4FA 3KLVA 4KREA 2P5OA 1DTQB 3IS9B 4DU3A 2KFNA 2XGQA 5CYQB 2C28A 4BWMA 3DRPB 4E7IA 1LAWA 5J2NB 3ZT2A 2VA3A 4QPXA 3SZ2A 4B9VA 5EUHA 4G3IA 4HUEA 1LW2A 1K1QA 5F8NA 4M3UA 3V1QA 3E01A 1ZBIA 4DSKA 3EZUA 3AVBA 4FLWA 3B6PA 3OYFA 4RW7B 1IKXB 1RYRA 2HMIB 4XPCA 3QO9A 4CHZA 4IRDA 1G15A 4KHWA 4ZTFA 3HK2A 4LSNA 2XCPA 4HTUA 3T5KA 1I39A 1JX4A 4MQ3A 4RUCA 1NJYA 2W8KA 4ID1A 3RR7A 5KFAA 1S97A 1JLAB 4YNQA 2YNIB 1VSIA 1RYSA 2D3ZA 3RB0A 4CGHA 1RT3A 1EX4A 2WONA 3DLKA 4R5PA 1NHVA 3H40A 3HVWA 2AWZA 2V0NA 3RMCA 3LP1B 3ZSYA 4NYZA 4OLAA 2BQUA 2ZKUA 2HHVA 2XY5A 3UQSA 4DLGA 3GIKA 2DTUA 1C1CB 2W9BB 4FLZA 3L2VA 4ZP8A 4ZP7A 3KLGB 3HP9A 1N5YA 4WZMA 2KW4A 3TAFA 3V9UA 3V9ZA 2KZZA 2Z1GA 2HWIA 3EPGA 2BQRA 1VSKA 4C8MA 3CJ5A 3VQ6A 2W9CB 5I3UB 4HVJA 5J2QB 5CY4A 2ASJA 3DM2A 4RW4A 5J2PB 1KFDA 3BR9A 3T5JA 3KK3A 4FW1A 3WNHA 1JIHA 3ZT3A 2QV6A 5SWMA 4JUZA 4QCLA 3HM9A 2XC9A 4IQXA 1JXLA 2QK9A 4KAIA 5KG5A 4MFBB 1QHTA 3O4NA 4LH5A 4OGEA 1B9DA 4H54A 4IR9A 4TLRA 4IFVB 3BJYA 2OPPB 3M8QB 2AX0A 3PO5A 4KV8B 3HVAA 4B9SA 4KBIA 4H4MB 1L5UA 2NUBA 1VSLA 3SFUA 3HXMA 2B5JB 2AGOA 4ECSA 4CEDA 2ZE2A 2HNDB 3NE6A 4E89A 5KFPA 4J2DA 3ASMA 2VWJA 1NJWA 4F50A 2JEIA 1KFSA 1UOCA 3AVAA 4DTJA 1DLOB 1HNIB 1NK4A 3IN5A 4DU1A 4MIAA 1RT2A 4CF9A 4BDPA 1IM4A 1T8EA 4IH7A 4FJ7A 4AILC 3FSIA 4RW6B 3G0ZA 4DF8A 5KFGA 1RT5B 3I0SA 3QGIA 2YHBA 3DRSB 4BE0A 4FZZA 1YTUA 4KO0A 4Z4EA 2GIQA 1NK6A 3FDSA 3WNGA 4IH5A 4HCCA 3K58A 2J6SA 3M9MB 1IG9A 4ED3A 4NLOA 1BI4A 2ASDA 4OGCA 1BIUA 4RUAA 3Q8RB 3HHKA 4KHNA 3V81B 1S0NA 2W8LA 1QSYA 3ZSXA 3NF6A 1HNVB 1VK0A 3NHGA 5F8LA 1LW0A 5C25A 2IAJA 4K8XA 3K5MA 3G10A 3UR0A 2I5JA 2XGPA 1N4LA 2W9AA 2E4LA 4JS4A 3K5NA 3S9HA 1C1BA 1RTJB 3NBPA 4WE1B 4KKOA 3KLFA 2EC0A 3ULDA 3RB6A 1CLQA 4IG3A 4JRQA 1RDCA 1QAJA 1N6QB 4DF4A 1Y97A 3HVTB 4XPEA 2OPSA 4IDKB 2R2TA 1X9WA 3QZ8A 4ED8A 2FVQA 3MEEA 1JLCB 3DRRB 2E6MA 4F2SA 4QWAA 1KVCA 3C94A 2BE2B 3B6OA 3RMDA 5K14A 1HQEB 3MFHA 4B9TA 3DLEA 1TGOA 4B8AB 2HHQA 2IC3A 5HP1B 4O3QA 3QLHA 3LPTA 2HNZA 3OJUA 4K4ZA 3QERA 5KFRA 4PUOB 3OYEA 3ZSZA 4J9SA 4B3OA 1GX6A 2FBVA 3VQ5A 3BGRB 1TKZB 1RDDA 4M3ZA 1KLNA 1HQUB 1EP4A 3K59A 3CFPA 1I6JA 4I7FB 3SFGA 1MU2B 4EZ6A 2JGUA 2OPRB 4GC7A 4DL5A 5F8IA 1RBVA 1REVA 1LAVA 1GX5A 4C8LA 3Q8PB 5KFYA 2HNYA 1BQNA 3C6UA 3H98A 4BACA 1VRUB 3NH0A 3RR8A 3QESA 2JC1A 2GV9A 1S49A 5L9XA 3NGDA 3T5LA 1N56A 4FJXA 1B92A 2XRIA 1K6YA 1BQMA 3BSNA 1SV5B 3KOAA 2DFFA 2B6AA 4W5OA 5DQGA 5FRMA 3VQEA 1JLQB 2I1RA 1T05B 2G8HA 4ZMMA 4TY9A 3H2LA 1SL2A 1TKTB 1XR7A 4ED1A 4IR1A 4PQUA 2YNHA 1QQCA 1FK9B 1JLEA 3TAMA 3V4IB 3LP2A 1TL1B 1WNEA 2XY6A 4EBCA 1GOBA 3QNOA 3L3UA 3I5AA 2Y1JA 1VSEA 4YMEA 2Z1JA 3SUNA 1DTQA 3IS9A 3DOKB 5F9NA 5KG6A 4DQPA 5CYQA 3DRPA 4CJ4A 4IG0B 3THVA 5J2NA 5KFMA 3IAYA 2FBYA 3SI8A 5KG0A 2RN2A 1QSSA 1JLGB 1TAUA 1BISA 4DQSA 4I9LA 4IKAA 5KFNA 1IKWB 4CHYA 4F4ZA 2FBTA 1UA0A 2V4RA 4ECWA 4CEZA 2JC0A 5KFZA 1TK5A 3SUQA 1RTIB 4C8KA 2E6LA 3TAEA 4RW7A 3FRZA 1IKXA 3EY1A 5C42B 4K50A 1KCFA 2FVCA 3AV9A 3NGZA 4RW8B 5KFIA 3DI6B 4CHPA 4CESA 4KHRA 4K4WA 4QAGA 4KHUA 1SH0A 1KHVA 3V1RA 3VQAA 1JLAA 2D5RA 4JV1A 2YNIA 4WFYA 4TY8B 1HYZA 4NYFA 4IFYB 4OKKA 2RF2B 4B9UA 4KSEB 1NJXA 4DSEA 4M3WA 3AVCA 3LP1A 1EETB 3OL7A 4ICLB 1C1CA 2W9BA 4DL6A 4RW9B 4DMNA 2DFEA 3AVJA 3KLGA 3LANA 3M8PB 3TAPA 4KFBB 1KHWA 4N76A 4ZP6A 2UVUA 1S9FA 1S9EB 4N56A 3OS1A 4DTRA 3UDLA 3QZ7A 2W9CA 5I3UA 3MTKA 3KHLA 5J2QA 3V6JA 3E51A 2OYQA 4FJLA 3KHHA 4CGJA 5J2PA 1X9SA 4AHCA 2X6SA 1ASVA 3T1AA 1QSLA 1Q8IA 1RBTA 4WZQA 3AVGA 5J2MB 1XR6A 1S4FA 3HVRA 3IGVA 4R8UB 1ASUA 4YFUA 4MFBA 3SUPA 2C2EA 1FKOB 4CEAA 2RDJA 4IFVA 4FS1A 4DFKA 3MEDB 4YQWA 4K4YA 2OPPA 3M8QA 3VQBA 1NJZA 2WTFA 2R8KA 4KV8A 4AHSA 4H4MA 2RKIB 3ZSOA 3TWHA 3PX4A 3ZT0A 3ZT4A 3ZSVA 3NH2A 2B5JA 1RA7A 3TANA 1WN7A 4NLGA 4ED6A 3V9XA 2HNDA 1JKHB 4BWJA 3LWLA 3D0PA 3LPUA 3WNEA 4CF2A 4CIGA 2P5GA 1DLOA 1HNIA 3AA2A 4HUFA 3TAQA 4NLWA 1D9DA 4Z4IA 3WNFA 4KB7A 3PW7A 4OVLA 4KHQA 1L3VA 2QKKA 2F8TA 1W9HA 2IBKA 4RW6A 2OA8A 1Z4UA 2R2RA 3CO9A 2G8UA 1RT5A 4F3OA 4M3YA 4Q45A 2XY7A 3DRSA 1ZTWA 3OVNA 2Y1IA 1J54A 1RT7B 5KT4A 3QEXA 4FLYA 5HLFB 3VA0A 4AHTA 3TQ1A 3NGIA 1RCHA 2AU0A 3ZT1A 1U49A 4QWBA 4ECRA 1C6VA 5DG7A 3OYAA 4NLUA 1S1WB 2R8GA 4WXWA 3V81A 4TQSA 4CGFA 2FVRA 3RB4A 2X74A 1HNVA 4CK2A 3PW5A 3ZCMA 2KTQA 5F8JA 4CEBA 4FZXC 3MR6A 1S9GB 3I0RB 2JEFA 4GMJB 4DTMA 2ITGA 1RTJA 4WE1A 2FLNA 1CZBA 4JRPA 4FJHA 4CGDA 1OS5A 2XWYA 1NKCA 1N6QA 3MXJA 3HVTA 4FYDA 4IDKA 2E9RX 3AVHA 4CEFA 4CFCA 3HP6A 3M9OB 3MR2A 5L1LA 4EZ9A 1JLCA 3DRRA 5KT2A 5KFDA 1D5AA 4Y3CA 2BE2A 4FJ5A 2ETJA 4J9RA 1ITGA 5KG4A 1HQEA 4DTPA 4NYNA 2P51A 2D3UA 5HBMB 4H4OB 1WSIA 5HP1A 2IOCA 2J6TA 4FLUA 4CJEA 4ED2A 4K4UA 2UUWA 2BANB 4PUOA 5DG9A 5CYMB 3OYIA 3IRXB 3BGRA 1TKZA 2BGGA 2GIRA 1HQUA 5HRNA 4I7FA 3AA5X 1MU2A 4RG8A 4KHMA 2OPRA 1NNDA 5HRRA 1JLBB 5EWFA 5KI6A 3CJ3A 3CDEA 3CFRA 3N6NA 4WFXA 2WB4A 1VRUA 4O3PA 3S3NA 4EEYA 4E7KA 2PY5A 3NH1A 1S0OA 2UVVA 3H59A 4URQU 5KRSA 3NAIA 5KG1A 2IM0A 4YR2A 4MIBA 1SV5A 4MK7A 1JLQA 2G8IA 3SQ0A 4Q44A 1T05A 1TK8A 4ZVHA 1TKTA 4YP3A 4I2PB 4O5BA 5SZTA 1T7PA 4LSLB 1Z26A 1SKRA 2ZQBA 2HW3A 3GIJA 4B9NA 1FK9A 3V4IA 2ATQA 1YTAA 4IBNA 1TL1A 4NCGB 3KTQA 4CCHA 1KVBA 5J1EB 4KB0A 4OPJA 5DG8A 3DOKA 2IJNA 2V4QA 3SUOA 3SV4A 4IG0A 5T14A 1TKDA 4WFZA 3GYNA 1VSHA 4ZVEA 1VRTB 3VQPA 1JLGA 2X6NA 3HT3A 1GOAA 1IKWA 4Z4HA 3CFOA 1CXQA 3SV3A 1RBUA 1ASWA 3QEPA 1KTQA 1RTIA 2IS3A 3AVNA 3AO3A 3PR4A 4CJFA 3DMJB 4Y2CA 3PJXA 2HHWA 3RMBA 1NK0A 4J2EA 5C42A 2FLPA 3QEWA 4NZ0A 4CJUA 3HSTB 3PZPA 3GV8B 1D0EA 4RW8A 1TKXB 1SKSA 3DI6A 4EBDA 2YKMB 4FM0A 3VQSA 4OL8A 5KG2A 2E9ZA 3RBDA 3KMQA 4FCYA 2O4IA 2JLEA 3AVFA 3N6MA 4TY8A 2XI2A 4IRKA 3NCIA 4IFYA 3OL6A 4H8KA 1ZBLA 2RF2A 3BQ1A 5KT3A 3H5YA 4DS4A 1EETA 4ED7A 1RILA 4CHNA 4ICLA 4KE5A 2ZD1B 4RW9A 4R0EA 4J9LA 3PW0A 4FJIA 2FJVA 1S0MA 4HUGA 3M8PA 1CZ9A 3LP3A 5KFFA 2AGPA 2D0BA 4KFBA 2AJQA 1TV6B 4DQQA 2QE5A 1C0TB 1HYSB 3ITHB 1WSGA 3QINA 1S9EA 3OLBA 2XY8A 3GIIA 3GV5B 4ECYA 3MEGB 3TR8A 4Q8EA 1U04A 2O4GA 5KFUA 1QS4A 3RRGA 2DY4A 1RDAA 2VWKA 4K8ZA 3LP0B 2KQ2A 4RZRA 4O3OA 1NHUA 1U4BA 1ZBHA 3MFIA 4KI6A 4NLXA 5J2MA 5DGBA 4DSIA 4ED0A 4F4WA 3HPGA 4KTQA 4KI4A 4R8UA 4KRFA 4FVMA 4O0JA 2XI3A 5KFWA 1FKOA 2A1RA 3L2QA 3MEDA 1SL1A 1MMLA 5KFSA 5L1JA 3TAGA 3KLEB 4MK9A 2RKIA 4G1QB 3U3YA 2HB5A 4FZYA 3NFAA 4Q5VA 1RT6B 2IM2A 4W5RA 1BIZA 4I2QB 3SPYA 1JKHA 4J9OA 1S1UB 2YNGB 1KVAA 4M3RA 2W42A 1N48A 1SL0A 1WNSA 5F8GA 4U7CA 1QE1B 1O1WA 4F3TA 4URGA 1XHZA 3GQCA 2ATLA 3DDKA 4CFAA 3OYKA 4DEZA 4UQGA 2OPQB 4O3NA 2QXFA 4ELUA 4RNFA 5KG7A 5I42B 3KD1E 3QIOA 1WSJA 4I9QA 3SCXA 1RT7A 3T5HA 3H5XA 2YHAA 5HLFA 3RTVA 4X2BA 1D9FA 3EYZA 3PV8A 4TYBA 3SQ1A 4WXOA 1EXQA 1DTTB 4OKEA 3Q8QB 4CJVA 1SH3A 5KFVA 1XWLA 1S1WA 3P83D 2J6UA 4W5TA 3QGGA 1QAIA 3VQCA 4DSFA 5KFJA 2PYLA 4DFPA 2HHTA 4KB1A 4FK4A 4JLHA 1S9GA 3I0RA 3VQQA 3V9SA 3I5CA 3PW2A 3FQKA 3NDKA 2F8EX 3RRHA 2WOMB 4J9QA 1LWCB 2BRKA 3NAHA 3ZSRA 1R0AB 1SKWA 4K4VA 3G6XA 5JS1A 2GBZA 3V9WA 4LQ3A 4ZPBA 3NF7A 4M95A 4NRTA 5E41A 5HRSA 4ECZA 3OYJA 4PWDB 2AX1A 4PA1A 4DSJA 4CJRA 4DFJA 4MKAA 3MECB 1NK5A 1J9AA 3AO4A 1HARA 1HYVA 4CFDA 1S1VB 2VG5B 5HBMA 4H4OA 3RBEA 3H5UA 4DQRA 3ZSWA 3CDWA 4DS5A 1TL3B 3JSMB 3O3GA 2BANA 5KT5A 1S6QB 1YVFA 5CYMA 2D7SA 3IRXA 2UVWA 3CDUA 4Y34A 3SQ4A 3SJJA 2R8HA 4ZPDA 1BCOA 3D5MA 4E7HA 4IH6A 4EP4A 1Q9YA 4QWDA 1KRPA 1JLBA 3VQ7A 4JV0A 4OPKA 3SYZA 5JXSA 2GUIA 4HCBA 3CIZA 3FQLA 3RAQA 5F8HA 4DSLA 4FK0A 3T3FA 5KFCA 1WLJA 4C8OA 3I8DA 1HMVB 3L2WA 2O5DA 1TVRB 4Q0BB 3NL0A 3UPFA 3C6TB 2C2RA 2ILYA 1EKEA 5CZ1A 1NK7A 3SPZA 2Q3SA 3QIPB 1FKPB 1JLFB 1ZYQA 1BGXT 4I2PA 4J2BA 4TN2A 3VQDA 3OSPA 4LSLA 1BHLA 3DLRA 1T03B 1S1TB 4ECQA 1NOZA 4N41A 4NCGA 2BQ3A 1S10A 3N6LA 3QGHA 3AVLA 4AHUA 1L3UA 4Q8FA 1K1SA 1U47A 5J1EA 1D1UA
chains in the Genus database with same CATH superfamily
3VEYA 1TUGB 2XMAA 3O1WA 1PKUA 2FTRA 3KIOA 3US5A 3TP2A 5EDWA 2WVBA 1OPIA 1JL2A 1ULRA 1FF2A 3WXLA 4Y0FA 3PYEA 4ITSA 2IRUA 2RE1A 5JMNA 1TL7A 3OYHA 1KSPA 4X4VA 2FVSA 3V5RA 2H1YA 4TYAA 2B43A 1YBUA 4YS2A 3HJFA 1LWXA 1C0MA 2O8BB 4P2XA 3GV7B 3G4SS 1NSPA 4DQIA 3OTDA 1NXIA 4P2SA 3CCSS 1IBKK 4MK8A 4E3SA 3PG9A 1FRHA 2YKMA 4B3MF 1QD1A 2EX3A 4K25A 4BE1A 3TI0A 3ILOA 2Z4PA 1VSDA 5HRPA 5IWAK 4GMKA 3O3LA 3KJVB 3QFUA 2VJUA 4CJTA 4FF3A 4NYPA 4JKGA 4K0KJ 3OY9A 4JKEA 5D0HA 1RCXB 2VODA 1FXDA 4ZVSB 2MLZA 3FBEA 3B82A 4ZPCA 3W8GA 4EUVA 3CMEN 4CJ3A 3V4MA 3S1TA 1FX2A 4QOTA 4XIUA 1V4TA 3H4BA 3MM8B 1KVJA 1RBSA 3B8AX 4K41A 1U0SA 1V3RA 3BUZB 2VGNA 1QJHA 4M45A 3ITHA 2DEIA 1XQSC 4QS9A 5FIIA 4X4OA 2QKBA 2AJFE 1N33F 3I56S 5DLGA 3OPKA 3R27A 5A8RB 4ISEA 2ACMA 1QTNB 1WC5A 3LP0A 4CW7B 3BKFA 2KU7A 1F3FA 2VA2A 4JHDB 4ZS6A 1NGGA 1OYDA 2DGVA 3R2DJ 1IM6A 2FJWA 2LFVA 4EYHB 3ETOA 1FT8A 1Q8BA 3R9PA 1SB6A 4BQZA 1CBKA 4IRCA 3VVUA 1SC3B 4JV5J 5ETVA 1N0UA 5AQLA 3BQ0A 1NPRA 1C0UB 2OH2A 2NRVA 2V34A 2GMJA 2YNGA 4JI2J 1GMWD 1YI2N 1ZETA 3D68A 2ZWPA 3CJ2A 3FC9A 1QE1A 2F7TA 5CZVA 2U1AA 4CLLA 3OL9A 1FDNA 3OBWA 3VVTA 1Y10A 2KJVA 5HJYA 2CH6A 3G4SN 4LFAJ 4H0XB 4WQ5A 3GWCA 4LY7A 2FGOA 3CCSN 4F4XA 3A13A 3ZETA 1C0FA 1ROFA 4IOCQ 2XZTB 4F8RA 3ISND 3I33A 1ZBFA 1DTTA 3IM8A 4L75A 1T6DA 2D3O1 4LJMA 2J0SD 1FE0A 4MDBA 3CC2S 1J5EJ 3L2UA 1NG9A 3T19A 3EVOA 1ZBSA 1CG2A 4WYLA 3OXGA 4H5RA 5IZHA 2R2SA 1YGYA 1FRIA 4ILJA 1FX4A 2NRZA 4UZCA 4JB8B 4CJQA 4DR3J 3QDKA 3MDFA 1GLJO 1J5OB 3E9OA 1J53A 4N8NA 2ADCA 2RH3A 1UVMA 1RBRA 2G1DA 3D2EA 3I5BA 4FYWB 3TSQA 4UW2A 1PJ5A 2DTJA 1X3NA 4FJ9A 4PWDA 5HMXA 3PUFA 2XMTA 3FZMA 5C24B 4F0HA 3Q89A 2M8HA 2A5XA 2JL9A 3SIPB 2CJBA 4QR1A 3CCVS 2WHOA 1S1VA 2R8IA 5GAEU 1Z25A 4KBOA 3AO2A 2LLZA 3OLAA 1JNRB 4A2BA 5H1SV 2WSEC 3C14B 1S6QA 3W60A 4J9NA 3KJNB 3ZTPA 2L41A 2IA6A 4NWBA 1NLKL 4HDHA 2NRXA 4JK7A 4RBTA 3J81j 3ZSQA 4BRAA 1NGEA 2MYFA 1UWBB 1WAFA 1S1XB 5FLXY 1VK8A 1F21A 2B7CB 3GLJA 3RAXA 2O8EB 3CPEA 4M5LA 4HDGA 3KLHB 1TVRA 3C6TA 2ZOFA 5CE3A 3SQ2A 3LALA 1P1TA 1HHTP 1CJVA 1FKPA 2R7OA 1BUPA 3G8TA 3VGLA 5KT6A 5K8NA 3PJ9A 2FJBB 2JEJA 1FXXA 1CEZA 1GOCA 4QW9A 4NLPA 4ECXA 4ED5A 5EHHA 3NGSA 1NGCA 4ZLNA 3UKRA 2NUUG 4DPTA 5F8MA 1IJJA 3ID6A 2HQ3A 5K8MA 3VTIA 4QOZB 4DU7A 2D41A 1YK9A 2AZ1A 4JI5J 3HMJG 2UUAF 3EDRB 4YOEA 4DWIA 4LSNB 4DOZA 1WTBA 2DR8A 1A9NB 2I7PA 3E66A 5KFKA 3AAQA 3SI6A 4ZPTR 3MWTA 3EKSA 1QHAA 4EIAA 3W9JA 5KFBA 4PY5A 1X3MA 2X78A 4NO7A 3K17A 3POTB 2VHGA 3W62A 4Y65A 2OO4A 3SSRA 4BRPA 1JL1A 4CO5A 5LXRA 1S6OA 4CLUA 3KWIA 3N01A 1SUQA 4X4NA 3JS9A 4OPHA 1U1RA 4CJPA 3S6EA 2VQFJ 1HRHA 4BC3A 2ZZNA 3A8JA 1IKYA 1HWIA 3EE3A 1DKGD 2VG7A 3HO1A 2CPFA 5M1FA 3O9RA 5F41A 1LWFB 2XCAA 1NGJA 2ZDOA 2KZMA 2CJQA 2CPIA 1CJTA 4NLQA 2PAVA 3DOMA 3CDBA 1Z2ZA 3KHGA 4ILGB 5GAHP 1FFGB 3OL8A 1XHXA 2PC6A 3FBCA 1Y11A 1FDAA 2MLXA 5AZJB 1MMDA 5IM0A 3NKYA 1UVNA 5AQHA 4LQ9A 2HBRB 4ID5A 1F9FA 5L1IA 4NMXA 4CK1A 4EO6A 1C1AA 3J7YU 1G3OA 3I55N 3VAFA 3THXA 1GT8A 3QFPA 2JZ5A 2CWXA 1RWPB 3A3OB 3M9NB 2OZMA 4U96A 4PWWA 2A42A 4AHRA 4KTWA 2FSJA 1LWEA 3PRBA 1NGBA 1FI4A 1OQ6A 4HKQA 2BM1A 3EZ5A 2P1JA 3ENOA 3Q8YA 4FPBA 1GK8A 3CJSA 3W2WA 5GIOA 4RR5A 5HOOA 5ELZA 3DYAA 4NLYA 4JKHA 3N4QA 3PEJA 3SMPA 4QWCA 4M5MA 3AA3A 3I0SB 1C4AA 3F73A 4CLSA 1DT9A 3CM6A 4OLBA 1UWAA 4GKJF 5HVGA 1Q95G 2AGQA 3CMAN 4OO1J 4CIFA 1BI4B 2P9PA 1V9OA 2MQNA 3C3LA 2HQFA 1I3AA 1BWFO 5A8KB 1TMMA 4HEA9 2NPFA 2B51A 1C1BB 4KKOB 3KLFB 3GMGA 1NK9A 2RU3A 4LF6K 1HX1A 3K5LA 2DY1A 4IG3B 3FZFA 5KFHA 3BO4A 1J2VA 1S6UA 4E7JA 3V1OA 4NLVA 1QUVA 1U2VA 3MEEB 3CCQS 4OX7A 2IVYA 4BLGA 4CF8A 4DTNA 1XR5A 3EE8A 2IVNA 2OEKA 1NPKA 2FZGB 5K14B 3AQOA 2AA4A 2QWMA 2GAHC 3WEEB 2HNZB 4F3MA 2UU9F 4OYXA 1E6YA 3BSAA 5D3GA 3DCAA 4IDHA 1VYAA 3EWGA 2RIJA 2VD3A 1Q7LB 3M8SA 2V51B 3OTCA 4LFCK 2D69A 4CO4A 4JNEA 3KKSA 3D45A 3EZOA 2F96A 2GHVC 4N47A 4O4GA 3H45C 2DGOA 5KG3A 1KS2A 4DU4A 4CGIA 1LXNA 2UXDJ 1HJRA 2CIMA 3QBXA 3GBTA 1HPZA 2GCFA 3MK6A 4BGAA 1AB8A 4HHTA 4FJGA 1LOTB 5EY4A 1VSMA 2CNLB 3AY0A 4ZVQB 4DV3J 4H5WA 1RTHA 1IKVA 2Z30B 3HOSA 2M88A 4DV5J 2P6TA 3QBWA 3FSXA 2CQHA 2HHSA 4BR7A 2LA6A 4DV7F 4XDDA 2P5OA 4DU3A 1EJ7L 1P8GA 1T95A 2M52A 2C28A 3THWA 2SXLA 1RAFB 3ZFVA 1BUXA 5J2NB 4X65K 5H1SQ 2E2PA 3HF5A 1Q7YT 1OKJA 4QPXA 2Y3YA 2P9CA 4Q7AA 1K1QA 3L4BC 5J1NA 3V1QA 4QIFA 3E01A 1FKAF 3BBCA 2IDLA 1URNA 3AVBA 5HMZA 3B6PA 3OYFA 4OX9K 2FSKA 4CHZA 1G15A 4KHWA 5HQ8A 1FFSB 3CCQN 2GW8A 2EPIA 3C7NB 3R7NB 1WBBA 1I39A 1U2RA 1BD6A 3RW6A 5I3PA 2ZC3A 2WBRA 2W8KA 2ZJPQ 1Y5LB 3IBWA 1VQ6S 5CR4A 3RR7A 4DR7F 2MY7A 3RB0A 3M6GA 3FLCO 4ANEA 4R5PA 3R97A 3QPIA 2H54B 4PCQA 2V0NA 1IBLK 3CB4A 3ENBA 3LP1B 2VB6A 4OQJA 4LIWA 2XY5A 2HIYA 3AAPA 3GIKA 2DTUA 1UW4A 4ZP8A 1RAIB 3V9UA 4LFBK 2VQEF 4EWTA 2KZZA 2HWIA 3EPGA 3GYGA 1VSKA 4X4UA 1S3XA 1ZAWA 5C2DA 4P2FA 2LXFA 3H90A 5D4OA 5J2QB 4GO7X 3EGVA 4LBIA 2K7JA 1KFDA 5J2PB 3BGUA 3BR9A 1OPZA 2BKNA 2QV6A 3SAGA 5LMUJ 4LIRA 1UJ6A 1IN0A 4LF9F 1QM9A 2QK9A 1TELA 1U6ZA 4FPRA 1B9DA 4IR9A 4TLRA 4IFVB 3JS6A 3M8YA 1H72C 2QSWA 3C65A 2WBMA 4KV8B 1A6LA 3ZO7A 3GG4A 4CD1A 1H73A 3X1LB 1NUEA 3ASMA 3AVAA 1NSKL 1SS6A 1HNIB 1NK4A 3HHDA 2EWSA 5IV4A 3CJ1A 4JI4K 5GINA 1QAXA 3TX8A 5JJBA 4RW6B 5C2GA 4DF8A 4WBFA 4C0BA 4F04B 1RTZA 1U02A 1HW8A 2BJ8A 2CA9A 1NK6A 3FDSA 5AJ3J 2EFVA 4NXMK 2HKEA 4HCCA 2VCPA 4OPAA 1T9XA 1CS4B 2CQ4A 3CCUS 2P9SB 4Y2KA 1IG9A 2GVDA 3TUZC 2QI2A 1BIUA 4RUAA 4Z7CA 2ASOA 3UE5A 3V81B 2OFGX 2JRSA 2ERRA 3A5LC 1ZZFA 4KGVB 2E8AA 1LW0A 2QT7A 5C25A 3FGVA 3SCIE 2Z0GA 3M6VA 1W26A 3B54A 4P52A 4ENOA 2B7BB 2R9LA 5HSPA 3PFEA 3ZX3A 4FKYA 4ZK7M 1WHWA 3RB6A 1I1GA 2B4PA 3VAGA 1N6QB 4XPEA 3MM6A 3KDNA 3AA9A 4ILMA 1NPPA 4ED8A 1KAZA 2GVZA 3FCVA 3Q0AA 5JMVA 1QAYA 2QMWA 2QEXS 2DGSA 2LA4A 4HI1A 3TR5A 4MKYA 5BYQA 3LPEA 1FFWB 3DLJA 2HHQA 3DC2A 5HP1B 5ETKA 2QW9A 3LPTA 1R3NA 2ZHAA 4PUOB 3ZSZA 3TQEA 1MN7A 4RUHA 3BGRB 1HQUB 2IVPA 3CFPA 3CJKA 4I7FB 4ZVOB 3IWNC 3CIPA 2HSEB 4WK3A 3QNWB 4I1TA 3Q8PB 3VQTA 4I0WA 3I87A 2GEMA 2MHEA 2JC1A 1S76D 2D0PA 1DZ5A 2G0IA 3VAIA 5JICA 1IBMJ 2XRIA 3KOAA 2FJAB 3I4PA 4W5OA 2YKOA 1PC5A 2RJZA 2I1RA 4A8XA 2G8HA 1SL2A 2YNHA 3TAMA 3E1YA 4D3GA 2DHGA 1O13A 4WU2A 2GUPA 3I5AA 3EE9A 3G25A 3OXLA 3NVMA 2ZGYA 5A0YA 3DRPA 4DR5J 5KQDA 2F3JA 3THVA 4YY3F 5KFMA 2D9PA 3SI8A 3EGZA 2IYIA 3C16B 2HBMA 1JLGB 3C2PA 3ZX0A 4PPZA 2CJXB 1R89A 1CC7A 1IKWB 1RP5A 1UVLA 2JC0A 2AEMA 1JWWA 1TK5A 3VZHA 4C8KA 2E6LA 3TAEA 4B3TJ 3R3TA 3H6EA 3EY1A 2AKWB 4CNZA 1SJ1A 2ZNYA 5D4NA 4RW8B 2XS2A 4CHPA 4J9UE 2A10A 5GAEP 1MWMA 4USMA 5FD1A 2R7TA 1KHVA 3VQAA 2D5RA 3ZZ0A 2YNIA 5HL7Q 1KOOA 3QAUA 2KVIA 5A8WB 3JQJA 3MM7B 4NYFA 1QVGR 2F4VF 2RF2B 1NJXA 3MOJB 1NDKA 3M6WA 3D0IE 1RQ0A 4PQAA 1C1CA 1P9QC 3NXZA 4DR3K 3BPDA 4DMNA 2DFEA 1WF2A 3SEOA 5GAGI 3KLGA 4XEIA 3W7BA 2EWHA 3M8PB 2Z8QA 2NRWA 3BBFA 3TAPA 4KFBB 1KHWA 3FCWA 3GZ7A 3KG1A 2V7ZA 1N36J 4ZIWA 1FHTA 3W3DA 4DTRA 4EHTA 5I3UA 1WELA 3V6JA 3CCTA 2UYTA 2Q0RA 1W2IA 4AHCA 1N54B 1ASVA 4WTYA 4M63A 1Y3KA 3R3LA 1VQOS 1HNXJ 3IGVA 1N34J 4JKFA 4P75A 3HHLA 4MFBA 4IO1A 3JTPA 5AQUA 3D6TB 1FKOB 4Y6IA 5BRHA 4FYYB 2K3IA 1BLUA 3M8QA 3R1HA 2WTFA 4JK9A 2R8KA 4DPWA 1XNRJ 2H3EB 4BR2A 4DX6A 4LT6A 2B5JA 3EVWA 2ZJQQ 1DEJA 4CYUB 2JJ4D 4CH1A 3D0PA 5B0BA 1Q18A 4CF2A 5FPMA 1DLOA 4GKKF 3HZGA 4HUFA 2FSNA 3IMQJ 2ZBPA 1D9DA 1K73T 3SMSA 3PW7A 4LF4K 1RWXB 2QKKA 1W9HA 4I6WA 2IBKA 3BBBA 4JI8J 1RT5A 1PYTA 2GS8A 4OX8A 3BEXA 1J54A 2A18A 5KT4A 4W90B 3I31A 9ATCB 5HATA 3MPWA 3ZC4A 1OH8A 4CLYA 1FD8A 3WT0A 3TQ1A 2XS7A 1H3DA 2LEPA 4QWBA 1XQIA 3CC4S 1S1WB 3E3XA 4CGFA 4TQSA 4ES3A 2PD1A 2FVRA 2V8HA 4FVUA 3EMTA 3HOTA 3ZCMA 4HHJA 5HI7A 3MR6A 1M1KT 1S9GB 1RTJA 2XBPA 1DFDA 2D3OR 5IT0A 1X9JA 1CZBA 3IP0A 4JBCA 1VBXA 1QY7A 3KHYA 4CGDA 1OS5A 1NKCA 1S72S 4RWWA 2YHWA 3MXJA 3BO3A 2HQGA 2EBEA 5ADZA 5J1PA 4IDKA 5E3RA 2RU9A 1M5VC 1FEHA 4GVLA 3HP6A 4NMLA 3MR2A 2VPZB 2QA4S 3MEKA 1D5AA 4EGLA 2Q6CA 1WOOA 4Y3CA 4BR5A 2QA2A 3J7YP 1ZPVA 1RJJA 5LSLA 5KG4A 4DTPA 1WC3A 3TU5A 3GJSB 1CULA 1H74A 3W5ZA 3WXKA 2J6TA 2YJEA 4FLUA 2XEXA 5B8HA 1ILYA 4KGKA 2BANB 2V8DA 2XYPB 3QBCA 3IRXB 4AYBD 2GIRA 5HRNA 2UXCJ 4CLKA 1MU2A 3FZBA 4AUKA 3ATVA 1R0CB 5EWFA 1OMSA 2Q3PA 1JJ2R 3M2VA 4OMFG 3CFRA 4JN4A 5F0UA 4A8MP 5AQYA 5AXKA 3M3ZA 1VRUA 4OI6A 4DBQA 1N88A 3NH1A 3I4HX 3LDNA 4ZJOA 1RCOB 1YJNN 5ETLA 4RX6A 1UZHA 3OA9A 1SV5A 3ZZPA 3KG0A 3O08A 2G8IA 1H38A 4Q44A 3AOAA 1TKTA 5SZTA 1VQLS 1X4EA 3BN4A 4LSLB 1Z26A 1FCAA 5IT9O 1RI7A 2ATQA 4QYRA 1TL1A 1CJUA 4CCHA 4C8ZA 3R6LB 3CC4N 2W2QP 5HMWA 3K8WA 1XMOF 5DG8A 1BG3A 4OPJA 4OIXA 4X64F 4JI0F 1HBMA 4A8WA 3SUOA 4IG0A 3MM5A 4FWRA 4PHTX 3O4WA 1VSHA 3VQPA 1N5QA 4RBUA 4USVA 4KR0B 4LF8J 1WI6A 3F44A 1CXQA 1E6VA 1RBUA 2YWWA 4XTTA 1TL7B 1RTIA 4AQYK 2O8CA 2F8MA 1AXQA 4M5NA 4Y2CA 4DUTA 3RMBA 2A40A 4PKDB 3HSTB 4EFAC 1HBOA 2ZH5A 2QA4N 4HT7A 3R7BB 2MSSA 4CO1A 3DI6A 3BYRA 1PSDA 2FJDB 2YKMB 1WOQA 4YHHK 1OSCA 4FM0A 4OL8A 4DZDA 5KG2A 3MUTP 1IR0A 1EHWA 4HH0A 1S4EA 2VZ9A 3AFGA 3IC1A 3T1YK 4IFYA 3OL6A 4JKGB 4H8KA 4AF1A 4NA3A 4I6YA 1B4SA 2ZUGA 4BHQA 4DS4A 1HR0J 5JLFA 1M1HA 1IVZA 2HS3A 1CPZA 1RILA 3GTYX 2VH7A 1FA0A 3QWPA 4R0EA 3DDNA 4FJIA 2LDIA 4B3SJ 4HUGA 1R31A 4B1WB 4KY3A 4JI6K 1VQNS 2NRHA 2DR7A 1F5CA 2M4MA 4DQQA 3IA0A 3ITHB 3QINA 3GSIA 2IMOA 3GIIA 3ADAC 3WQTA 2CQIA 5AXLA 2GZOA 1S7IA 2V9KA 2O4GA 5BRDA 2DY4A 1X4CA 3LP0B 2P9LA 4V1Ak 4DV2F 3CF5L 2BJ7A 5J2MA 3BGLA 3FFKB 4ED0A 4F4WA 3Q2TC 1SQKA 2X7IA 2XI3A 3SXLA 5KFWA 4DUZJ 4DV0K 3JQMA 3SDEA 4PL7A 2A1RA 3L2QA 1JJ4A 1MMLA 1KC8T 3TAGA 2GNKA 2JNJA 2HZCA 3U3YA 3CJRA 3NFAA 2H9ZA 1NGIA 2UXDK 2BVZA 2Z58B 1H98A 3SPYA 1JKHA 5HQMA 5LL6d 4LF5K 2YNGB 1XK8A 4M3RA 2DR9A 4C48A 1WNSA 1QE1B 1SCJB 5AQRA 2GWKA 3IKMA 3PSIA 2HG4A 3DDKA 4UQGA 4XH5A 1VQPN 4ELUA 1BWVA 1IBCB 3ZZUA 2E66A 3QIOA 1WSJA 1RT7A 1Q8LA 3H5XA 3RTVA 3ZETB 3CW2C 5GMEA 2U2FA 2HRUA 1EWRA 2B8QA 4QYZJ 1BDGA 1DTTB 4OKEA 3Q8QB 2ZBQA 4CJVA 3RW7A 1SH3A 2OP5A 1GLAG 4KHPK 4U9RA 5E26A 3CJ8A 2CJYB 4NZ7A 2B9YA 4XAKA 4KB1A 2KG1A 4L3KA 3I5CA 2QJ3A 4P72A 4X62J 2RS2A 1VQYA 2YWKA 2H4WB 4Y2IA 5K20B 3ZSRA 4ER8A 2Q6BA 3KZBA 3W9HA 4DV1K 4DR6J 3D2EB 3M4XA 4M95A 5E41A 2I7NA 1PGZA 4PWDB 2YCHA 2WAQD 4NX9A 4JI1K 3GJTB 2N3OA 2VASA 1NK5A 3S7RA 1HYVA 4CFDA 1S1VB 4OZ3A 2MY8A 2YKPA 1V6HA 1QVGM 5KAKA 4DQRA 2UUCF 3ZSWA 3CDWA 2W6LA 1KEKA 2HBZB 3FNNA 4XDCA 2KJWA 5KT5A 1S6QB 2KHDA 2M3DA 1FJ7A 1PYOB 1P27B 2DNGA 5D15A 3CQYA 1BOTO 1MROA 2IHR1 4E7HA 1QUPA 4IH6A 3BZKA 4EP4A 1Q9YA 4DPXA 3SYZA 3VQ7A 4JV0A 1KTVA 1SI9A 4DSLA 3T3FA 4BRHA 2CNKB 1I94J 3MUMP 2N7YA 1TVRB 3NL0A 3C6TB 3MMBA 2C2RA 1EKEA 1X4HA 5CZ1A 4FWSA 1CJVB 1VISA 1FKPB 3K0SA 3QT5A 4TN2A 2N7CA 2E29A 1TTHB 4WF9L 2LYVA 2EFNA 3I9ZA 2CG8A 1S10A 4IWVA 5BPMA 3H3OB 3AVLA 2VDHA 4AHUA 4IOAL 1U47A 1WI8A 4DV4J 2D4WA 3UKRB 1KR4A 3LWMA 1N52B 2HBQB 2KFZA 3MPUB 4USKA 1NBWA 2PYJA 2V67A 3VF4A 3RBZA 2OSQA 3HKWA 4G6VB 3MAQA 4LR9A 1KD1O 4DL3A 1PIEA 4NCAA 2PSZA 4KHSA 2QRRA 1F2HA 3PHTA 1ZXOA 2BZ2A 1X5PA 4FOEA 5GAGU 4OJ3A 3L4IA 4MKBA 4IO9L 2HAIA 3MCNA 3WHIA 2CRLA 2RB7A 1RABB 1XTZA 1HA1A 2AZ3A 4JI4F 4CEOA 4DR2J 1FNMA 1VC0A 1SUQB 1SJQA 2NUHA 1D8ZA 4NXMF 3OTOK 4JI3F 4ZVGA 5BR8K 1IKYB 1SXLA 2ZD1A 2VG7B 3BZCA 2P2CB 1M5OC 5EOYA 5KFLA 3AB2B 2NCKL 2HWHA 1X0PA 1VQ5S 2MTLA 1CJTB 1C0TA 3DOMB 1C2PA 2HVZA 1U48A 1QZ6A 1Z2LA 3MEGA 1ZTTA 4Z4GA 1JXBA 1M90T 5IM0B 4CIOA 3O2IA 5EWEA 3L8BA 4KYZA 2GQCA 4BDZA 2K3KA 5DM6L 4ID5B 5B0FA 2NS1B 3S41A 3IM9A 3VEZA 2CQ1A 3CCMS 4YORA 5DLFA 4NZ6A 5GADI 1IO2A 4BE2A 3THXB 4DFMA 3KDOA 2FB0A 3VQ8A 3SCKE 3J7ZO 5ETMA 2HHHK 1O8BA 2UV8G 3NAEA 2HFVA 1VHIA 3TARA 2YH1A 1LWEB 1JJ2M 5C15A 3QEVA 4G1QA 2QLWA 1YIJN 2XS5A 4K0KF 3W2WB 3CQXA 4NXNJ 1IBMK 1X60A 3G6VA 2OANA 3DYAB 3PY8A 1UW9A 1GMVA 4EO8A 1OY9A 2NSCA 2OSRA 4EI2A 1UVJA 1ATSA 3UD3P 3QJPA 4CFBA 2LDYA 1RISA 2ILZA 4A5BA 3E8OA 5FRNA 2G9OA 3H25A 4J2AA 5I42A 1W7AA 4G65A 2BRLA 4FL9A 2P9PB 3CCLN 5BYSA 4O55A 1HW9A 1SH2A 4PAAA 1ZBTA 2WRMA 2QM1A 1LEOA 1RWMB 2CKWA 3PYFA 4YB5A 3J7ZT 5LJWA 2VOPA 3BKUA 1HNWJ 4FWLA 2MJUA 2IRXA 1LWFA 2CZVC 4HI2A 1RA6A 4CQ1A 3S3MA 4DV6K 4K7QA 5C10A 5DZ6A 4B3TK 5CQGA 3P1GA 5I3QA 4BRNA 3VEWA 4Z2XA 1U2VB 3OHAA 1PAEX 1VQ5N 3OFGA 1R0AA 4YR3A 3F41A 1R6YA 4JV5F 2CQGA 3TSUA 4AD6A 5H9EK 2BDPA 5CD4A 5A6PA 3CQ8A 4JI2F 5T7BA 1SZ2A 2AQ4A 2FZKB 5M1PA 2RDIA 4Z4CA 4YEAA 3GIRA 4QU7A 4NCBA 1RSCA 2HWTA 1S57A 5M1OA 1E6YB 2PA8D 4MT1A 4U6PA 1YDLA 5D3GB 2WK4A 1VQ7N 4K4SA 4AXJA 4OYWA 2XLJA 3O9UA 3DNCA 4KHYA 1DRZA 2XG8A 4CF1A 4B3MK 1Q81T 2EVZA 2DNOA 4O4GB 1NHKL 1BA0A 4BC7A 4RU9A 2OTJN 1J5EF 1W0HA 2FLLA 3PVXA 3P4UB 2XLKA 9RUBA 2ALZA 4DQ8A 3Q2SC 3D2WA 4ECUA 2HAFA 3TTCA 1HPZB 1Q5YA 2FHJA 3CJBA 5L1KA 4LSZB 4DR1J 4OYAA 4DR3F 1GEHA 2C2MB 2FPHX 2HVIA 3ZXWA 3EO3A 1RTHB 3SQGA 1IKVB 3RUBL 2CPYA 2YPYA 2VFSA 4FJNA 3K57A 3QIPA 4RNNA 2UV8A 4L72B 2XO6A 2AF6A 2F8SA 2CG4A 2YQ3A 5AR0A 3V6KA 4V19X 4LH4A 1EKRA 3THWB 1T03A 4RWTA 2F7VA 1N33K 3ICLA 3D7EO 5JVGQ 1T6CA 3AJ1A 3UCGA 2VPWB 3S3OA 2PMHA 5E3CA 2PIIA 3M5RA 3E01B 5F0XA 1ZAVA 2E44A 3GFXA 3SCJE 3QT6A 3O44A 2WC9A 4BCAA 4K4XA 2P9NA 1S99A 1B7FA 2YXLA 3C19A 4CLTA 3ZZZA 4M3XA 4B1VA 2E2QA 1Q4RA 2R3VA 2NZTA 3U3GA 1GLFO 3MX5A 1BA1A 4IJNA 2JVOA 1RTDA 1U26A 6AT1B 1ZAXA 3K5PA 1REGX 4R5PB 2Q43A 3OUYA 3J7AP 3KK2A 4CIEA 5L9NA 4PYAA 3MMAA 2XO7A 3VA3A 4YDDB 1YJWS 2N82B 2G8KA 5MAOA 2CQCA 3A2FA 4M7XA 2XMUA 1XMQJ 1Q16B 3IG1A 2XMJA 3SJHA 2DPIA 2E5LJ 2G8FA 1DAXA 1DHMA 2QTDA 3QQCD 4F7VA 2YNFA 3OW2R 5A2QO 5DGAA 4CE9A 1K8KA 2W4DA 2LXUA 1WAJA 4BG9A 4JI5F 4M7YA 3MN6A 5KFXA 2Q1LA 1PC4A 2BEFA 3G82A 1YJRA 3PXGa 4HWIA 1UJ4A 1IV0A 3UCZP 1T11A 4UOGA 2NSBA 3NOCA 5CCMA 2WVFA 4DG1A 2GX9A 2COLA 3R5BA 4X4PA 3MR5A 3V6HA 3PACA 4M42A 1NDCA 2DRDA 3IWLA 2AEJA 3GE9A 1H7WA 2PN6A 2VQFF 3QNNA 1VSFA 3RG6A 1YZ6A 2QL5B 3W5XA 5B08A 2HS4A 3HPOA 3DLBA 4JKBA 2DH8A 4QU6A 1FO1A 7FD1A 3UDCA 2R2UA 4DL2A 2IMWP 3RGIA 3EDQB 4DX5A 5KTQA 2VG6A 3OYLA 3CJTA 1XUPO 2GVDB 4EYIB 4ZDNA 5LXYA 1UTAA 3IO1A 4O0IA 4WFBL 2ACYA 5E7OB 4KH1B 4DL0C 1LW0B 3NGUA 2O66A 5C25B 1CJKA 3KK1A 1TAQA 3L7PA 1YJWN 5IT9U 5KRTA 4YB6A 3PHEA 4FNHA 4RNHA 4JYAJ 1AW0A 2FBXA 4FJMA 4DPYA 2H5EA 2NREA 2XSFA 5KGWA 2NLWA 2FC0A 5DS7A 2Y9HA 2KG0A 3CWJA 4OYPA 4I4BA 5DQHA 3MM6B 2C3UA 4PABA 2QLBB 3OYDA 2GVZB 5LL6Z 4MH8A 3PX0A 4M41A 2PO4A 4X4TA 3ALYA 3W0LA 2FY8A 1ZA1B 5AQOA 1KLMA 1GXLA 3NMRA 2NXCA 3QEIA 2V8PA 2HBJA 2KKZA 1YZ7A 5BR9A 2UUAK 5TKYA 1IJEB 5DDQC 3U9ZA 5HQLA 2BR0A 2Q0UA 2NYHA 1FJCA 4F0MA 2AEFA 1RKIA 3MR7A 1RHKB 4FYXB 4KIAA 1RDRA 3CJKB 3LDSA 3AVKA 5BXIA 4H5NA 3QAEA 3FFIA 5CH7B 3LGHA 2PBDA 2V9WA 5LOQA 3HPHA 5EX5A 5DDRC 2WVDA 1FWLA 1UETA 4HH1A 5EX0A 3VN5A 1S6PA 4PG8A 3CVKA 3QT8A 3L95X 4LF7J 1Y0HA 3ZZRA 4UY8O 5LMNJ 1G1XA 1X4AA 3BKTA 5IS2A 3MXIA 2VU5A 1T3NA 1XI1A 3ISNC 2R7YA 2K7KA 2RPIA 1BL3A 3VENA 4E7LA 2VPYB 3AO1A 2XHBA 2YNHB 4X66J 3TAMB 3O9SA 3MI7X 4M5HA 2IPOB 5FDLA 2L08A 1JCFA 4BWMA 5A0YB 3HBTA 3DRPB 2GELA 1LAWA 4JKAA 3D0HE 4BRCA 2AJ4A 3SZ2A 4B9VA 3UKUA 3FUYA 1LW2A 3TEGA 5F8NA 1FNOA 2QX0A 1RWUA 1ZBIA 2KVQE 3U27A 1BU6O 4B3RJ 3FBBA 3LO3A 2HPUA 4FLWA 4WK1A 3JXUA 1W2BR 3VERA 4IRDA 4UY8T 3HK2A 1AROP 3FBFA 2XCPA 3THTA 4HTUA 3A3NB 2UXDF 4NA1A 4BC2A 3T5KA 2ALYB 3O1LA 4MQ3A 1QQOA 4RUCA 1NJYA 1GXUA 1T44A 4J90A 3ZLJA 2DXDA 4ID1A 1ZH5A 2DBBA 4YNQA 3U8XA 2YNIB 3HLUA 1VSIA 1RYSA 4LRCA 1RT3A 1MN9A 3DLKA 2V7YA 3C66A 3H40A 3HVWA 2AWZA 4DUYJ 4DV3F 3RMCA 5DRKA 2R42A 2BQUA 2HHVA 4DV5F 4GKJK 1C1CB 2J0QD 3M32A 3UDVA 4FWPA 3MPYA 4ZP7A 3KLGB 1MWZA 1NGAA 2KW4A 2CUYA 1FRKA 4OJ1A 1RAGB 3T9NA 3IRWP 4RBVA 4DR6K 4ZOSA 1HWKA 1MW7A 2DY9A 3B4DA 3GL1A 5I3UB 4HVJA 4LUBA 2DK2A 5LSRA 3N4WA 2ASJA 3DM2A 1KWMA 4RW4A 3D1HA 3KK3A 1RADB 3WNHA 2P8IA 1RGVA 3FCHA 3CMQA 2CDQA 3HM9A 2OKQA 1AUSL 3HHLB 2E20A 4KAIA 4GV9A 4MFBB 1QHTA 2BM0A 3O4NA 4ETZA 5SUHA 5E33A 3VAMA 2HLTA 4H0TB 2PFDA 3BJYA 2CZ4A 3M8QB 3CD6N 4GV3A 2BKPA 3AOCA 1I5OB 2HQDA 2F8HA 2NUBA 3CCES 1VSLA 2ASYA 2DNQA 4J9VA 3HXMA 2B5JB 2X51A 3ENWA 4ECSA 2XHCA 5KOXA 1EKSA 2CGJA 2DNYA 3NE6A 4E1JA 1NJWA 2VWJA 4YOWA 2B0GA 5AQXA 2XSJA 3RVCA 2JEIA 2DNLA 1UOCA 4DTJA 1OVQA 1DLOB 4ILLA 2QLJB 3VAJA 3RBXA 1RT2A 1TL4A 3W65A 2NZCA 1BC6A 1T8EA 5GAGP 3G0ZA 1WB9A 3ZNUA 3MCPA 5KFGA 1RT5B 3W61A 1H7XA 1NBEB 2BOPA 4BE0A 3LW5C 1YTUA 4KO0A 3CIMA 3NNHA 4LMZA 4IH5A 3BN7A 2RHKA 3T41A 2MGZA 4ED3A 2ZF5O 3CC7S 1OJ4A 4OV1A 5LJ3Y 5LMUF 3HHKA 4KHNA 5BN9A 2VC1A 2W8LA 3NMUA 1FD2A 3RYLA 2C1EB 4IYQA 1K0VA 3K5MA 2I5JA 1N4LA 2W9AA 3N4PA 3K5NA 1RTJB 3NBPA 2QSFA 2EC0A 2DH7A 4DV7K 2MKYA 4F4AA 3D1QA 2ZJRL 3OXFA 2OEMA 3CCWA 2XZDB 1QAJA 4OYIA 2OPSA 4IDKB 2R2TA 2CQDA 2F63A 5G4DA 2FVQA 2BOAA 3NGRA 5D4PA 1VC5A 1KVCA 3C94A 3C15A 2EG2A 3B6OA 3RMDA 4OZLA 2IFXA 1FVQA 4B9TA 1TGOA 1CULB 1NNEA 4A62A 4DR2K 4O3QA 4OHVA 1BXNA 3LGNA 3OJUA 4K4ZA 3QERA 1P8ZA 1GLCG 4J9SA 4B3OA 1GX6A 2FBVA 3VQ5A 2X1BA 4RJVA 1VQ9S 1KLNA 2ZH7A 1EP4A 1MU2B 1RBVA 3CCEN 1REVA 1FRMA 3F0NA 3M2VB 4C8LA 3JXOA 4DR7K 3EICA 1WSRA 3VF6A 2HNYA 1E3MA 3B8HA 5FPDA 4M5DA 3G6EN 4DU8A 4BACA 1VRUB 4KH6A 2JOQA 1VS3A 3AAWB 2GV9A 2RAQA 3OW2M 2PA3A 3AH6A 5BREA 1S49A 5FPEA 1B92A 4A8YA 4TKTA 1SV5B 3PIPL 2NPIA 5DQGA 3VQEA 3UD4P 4ZVRB 1N5SA 2VQEK 3H2LA 3WX4A 1TKTB 4ED1A 2E5HA 4MIWA 4PQUA 1JLEA 2Y1RI 1TL1B 1CJUB 2XY6A 1WNEA 4BROA 2O3DA 4EBCA 3HSJA 3LDOA 1ZC6A 4RL1A 3RAMA 1HBMB 2QWOA 5CYQA 3I6PA 4IG0B 3MM5B 2EG1A 3DFEA 4DX7A 3TTDA 4LF9K 4U95A 3THYA 1KAYA 1BISA 3SSSA 1K9MO 3DLLQ 1KQGB 2FBTA 1E6VB 5JVHL 1YJ7A 3VZIA 2V4RA 1VMBA 2J0XA 4BC5A 5KFZA 1RTIB 4RW7A 2VL1A 2UXBJ 1U1OA 2HBKA 2VDIA 3R6GB 2H65B 3Q8VA 2GIFA 3MN5A 3BF3A 4K50A 1HBOB 2MQMA 3DU6A 2FVCA 1SJ3P 5M1QA 3R8EA 3DI6B 3LTOA 3WXIA 2AMCB 1IBMF 1OVYA 4KHRA 4QAGA 4KHUA 3W8PA 1JLAA 2CQ3A 4WFYA 1B3TA 4IFYB 3MN9A 4OKKA 1EO1A 3A12A 4KSEB 2GMHA 1GNKA 3AD8C 2BJEA 3BS9A 5LJ5Y 4WQ4A 1LNQA 1UL3A 1RKJA 5JVHQ 3AVJA 2YHXA 3QICA 4K42A 3SMZA 3DRXA 1FTRA 3QMLA 3LANA 4DR5F 4AXIA 2VBWA 4IO8A 4TU7A 5IT9Y 4N76A 4ZP6A 5L8RC 2UVUA 1WF0A 2GJIA 2M0GB 3H8YA 4N56A 1Q1KA 2RRNA 3UDLA 3QZ7A 2W9CA 5DZ7A 3MTKA 2LU2A 3E51A 4JK8A 2QWPA 2OYQA 4FJLA 3KHHA 4CGJA 1X9SA 2P9LB 3T1AA 2M8DB 4B3TF 4W92B 3H2UB 1RBTA 3AVGA 5J2MB 1XR6A 3AXKA 3PKMA 2NZ4A 3C6HA 3DN9A 4G1IA 2DPNA 1URRA 4ANCA 2HF3A 4YFUA 4N8OA 2HMPA 2DVIA 4C9DA 2RNEA 5EGYA 4CEAA 3SDEB 3VPZA 4DFKA 1IQZA 5M2UA 4AHSA 4U7BA 1HI8A 4H4MA 2HOEA 1VK3A 1YJVA 3TWHA 1FJGJ 3ZT4A 4BRQA 3OFEA 2OTLN 4OJHA 2QL7B 5RUBA 3NH2A 1RA7A 1WN7A 2GHWA 3K8VA 2QWQA 5LSOA 2HNDA 1JKHB 2JDJA 2UUBJ 3LWLA 1O0PA 2ATCB 1HWUA 3KXDA 3WNEA 2P5GA 3ILIA 1RWKB 3HSDA 4EU0A 4GVEA 4Z4IA 4OVLA 2ZH8A 4KHQA 4LC9B 1HI1A 2VFVA 4Z7YA 3ENHA 4B1XB 2X3DA 3BYPA 3CO9A 1K44A 3HSGA 4Q45A 1N36F 3DRSA 4BVOA 5E5NA 3CDAA 3O5TB 1RT7B 4HTLA 3QEXA 4FLYA 2Z57B 3H0PA 3O9QA 3NGIA 1RCHA 1U49A 3R5GA 3I9V9 4R79A 3HHNB 1JB0C 4WXWA 1U1QA 1F9EB 3AB4B 1HNXF 4RKUC 2X74A 1N34F 1HNVA 1KQFB 3M1VA 1UAWA 5ADXA 4A8QA 4CEBA 4ATNA 4FZXC 2ZH2A 3PRDA 4GMJB 4WE1A 4AFFA 3F9MA 4JKDA 4JRPA 1XNRF 1P90A 4OI4A 3ZTQA 1W2BM 5HMYA 2JLFA 1WDTA 2ZWOA 3TUIC 3SBTA 3HVTA 1YRUA 4FYDA 4YY3K 3AVHA 4CFCA 2WW8A 4CZGA 2J9DA 5GAHI 1U8WA 4IOXA 1J6ZA 1YVNA 2PFUA 4ZCIA 2WVEA 4C97A 5KFDA 3KJFB 2MDAA 2KFYA 6FDRA 3O5BA 4F67A 3WXJA 2XZWA 2BUNA 1YAGA 3CJ7A 3ZTRA 4JI8F 1HQEA 3OFFA 2P51A 4IOCL 4ANDA 1KONA 2XULA 2EI5A 1AZSA 4HHHA 1RHMB 1WC0A 5DG9A 2B56A 2CH5A 3OYIA 3NCPA 1MROB 3CULA 2OPRA 2V2VA 1VI7A 3WX8A 3MWPA 5KI6A 1FWKA 3CDEA 2DO0A 2F4VK 4DPUA 4YOUA 2WB4A 3ENAA 4E7KA 1DQ8A 1IR2A 2UVVA 5KRSA 4ZLPA 3L6QA 5KG1A 2DB1A 3MMBB 3WIVA 2KT3A 2QWNA 4MIBA 5A2QU 3CJAA 4WFNQ 3OVSA 4RU2A 1JLQA 5TKWA 2E88A 2YH0A 1T05A 4YP3A 4AL6A 5AQVA 4OX6A 1YKWA 2QL9B 2HW3A 1HI0P 1FK9A 2RILA 4WYBA 4AE5A 4A8SA 3KTQA 1SQGA 2DJWA 4AL5A 3UVJA 2VFTA 3G8QA 2HVEA 2V4QA 3ZZTA 5D4LA 1HNZJ 2K1RA 3GYNA 4RCHA 3M8WA 1PO6A 4ZVEA 1XNQJ 3HT3A 2R7WA 4Z4HA 4OHZA 3SV3A 3NEKA 8RUCA 2V6AA 3I56N 1B0TA 3AVNA 2A6MA 3T1HJ 5JLHA 1R8PA 3DXKB 3PJXA 2QWLA 3UNGC 1H2TZ 2FLPA 4QQBA 4NZ0A 5AXNA 3PZPA 3LQVA 4QIGA 3GV8B 1D0EA 1D3WA 4HVZA 4DI6A 3AGKA 3WBZA 4GKKK 3GE1A 2HZAA 3MHYA 1NH7A 4FCYA 2O4IA 2JLEA 4QBUA 4IRKA 4NI2B 1ZBLA 2DGTA 3BQ1A 3H5YA 3WZ0A 2V2KA 4FZVA 5B7WA 1WHXA 4ICLA 1IBKJ 1NGFA 2ZD1B 3A5OC 1SC1B 3D6FB 3W1YC 2DRAA 4KJIA 5AQFA 3R7SB 5IWAJ 1CZ9A 2IVOA 5KFFA 2J8SA 2D0BA 1X4FA 1C0TB 1MWYA 1V4SA 5AQWA 4Y28C 3GV5B 2HS0A 4ECYA 3MEGB 3TR8A 4LF8F 1U04A 3EM1A 4H0VB 2EFQA 1UVKA 3LDPA 3RRGA 1L3KA 4M5JA 5CZXA 1UCNA 1UZDA 3P8BB 1EQ0A 5IT4A 4O3OA 3K89A 4QIVA 4PXBA 5AFUA 4OI3A 2C3YA 3BGFA 4KTQA 3HPGA 3CC2N 4KRFA 2QN6B 4FVMA 4O0JA 3NP5A 3WDOA 2HSTA 3IBFB 3SAHA 4MK9A 2RKIA 5EX3A 4G1QB 2HB5A 4FZYA 4Q5VA 4W5RA 3R5DA 3FJ2A 1HR0F 1CC8A 5L38A 1MLAA 2MKHA 1YITS 3VEVA 4YDXA 1N48A 4FWMA 1SL0A 3CXCR 5F8GA 2E5GA 4U7CA 5U47A 2YX7A 1GLLO 3UB5A 2ZBRA 4URGA 2ATLA 2KRBA 3ZYYX 4L3NA 4O3NA 1AUDA 2WW4A 3CCVN 4RNFA 4HT5A 5I42B 4DHYA 2F9WA 3ENQA 1Q86O 4USTA 3T5HA 3LM9A 2YHAA 5HLFA 1D9FA 4X2BA 4L3QA 2CQ0A 3D6HB 1VAZA 3CUNA 5CYJA 5D0EA 3SQ1A 2OJ3A 2VBYA 2J6UA 3SBGA 1G4CA 2BJ3A 2YY3A 4BGBA 1Q78A 2XQCA 3L9ZA 4WFAQ 2GO9A 3U02A 1XERA 4DUZF 3I0RA 3VQQA 3P45B 3V9SA 2ROEA 5EN1A 3K7RA 2BRKA 1XMOK 1NEEA 4X64K 4JI0K 1R0AB 2YWHA 1SKUB 1FWPA 4ZPBA 2QXLA 3O8MA 1DY3A 3OYJA 2BABA 5HAOA 2CVEA 4Q2LA 4CJRA 3GJRB 5FJ4A 1Q86T 4OFZA 3C6AA 3AO4A 1GH8A 3ATUA 5HBMA 4H4OA 3RBEA 4USUA 3H5UA 3R5JB 3EKUA 3O3GA 4A61A 2HFSA 3CDUA 4Y34A 3SQ4A 4FXWA 1CQMA 2R8HA 5HVFA 1T9UA 1IR1A 1KRPA 5JXSA 4HCBA 3V2UC 3FQLA 4FK0A 3UE2A 2ZWHA 5KFCA 4X62F 5E84A 1U2FA 3IXQA 3UPFA 5KPTA 5AQJA 1PCAA 3SQGB 3SPZA 4A46A 1S0VA 1X4GA 3QIPB 4DR6F 1VQ4S 4N77A 1BGXT 3CCZA 3LDLA 1BHLA 3DLRA 1NSAA 1T03B 3JAMO 3OV7A 4N41A 4B1ZA 4NCGA 1CLFA 2QYGA 1H0HB 1K1SA 4Q8FA 1M1GA 5KQ8A 2MHNA 4ELVA 1M5HA 4UOCA 4DV2K 3Q23A 2XMMA 4H03B 3M6XA 3OHBA 3LPYA 2HF4A 2P9NB 4GC6A 4RLEA 2FF3B 4NLDA 4ALZA 3OYNA 1YX2A 3H3NO 2Z2LA 3MR3A 2R7XA 2OEJA 1RTDB 4FNIA 3A5MC 1SQEA 4Z94A 2DYAA 1I94F 2HGNA 2GFFA 4YOYA 1KXPA 3OUYB 2D0AA 3KK2B 1Q7YO 3MMAB 2FYXA 4FVCA 3T9ZA 5KFOA 1NKEA 2B3TB 4B9MA 2EC2A 1LK7A 2QA4G 4OV6A 3PNIA 1RWNB 2E9TA 2BA9A 3HL8A 1YLXA 3IG1B 3TUPA 2ZKTA 1HKAA 2F9TA 4F4KA 3Q22A 2A1BA 5HANA 3PO4A 1OIAA 1GLDG 4DV4F 4K8RA 4EP5A 4FW2A 4CZEA 2YNFB 1VQMS 1XIQA 2UUTA 3RJMB 3DWLA 1K8KB 2AP1A 5AQPA 2YQ0A 1TV6A 4U67Q 4IOBA 3K2PA 1HYSA 4DTSA 4ZPVR 3M8RA 4M5GA 3SBMA 4CTAA 2ZJPL 2JFKA 5ETTA 4ZVPB 1NZAA 4E19A 4JKCA 4UUXA 3KD5E 3CJ0A 3QFWA 1VLYA 1VQ4N 3G87A 3G82B 4P9SA 4J9MA 3HD2A 1HLUA 3WQUA 3OJSA 1ZPWX 3H5SA 2BUPA 1WDDA 4JS5A 2FLOA 1CXUA 5F2RA 4DG1B 4OYZA 3PR5B 2XLIA 3KLEA 1TMJA 2ZH4A 2RQ4A 1VHFA 4ZTJA 4DR2F 3UIQA 1HJOA 1RT6A 2UUCK 4FWQA 2W41A 4I2QA 3TNVA 4CZHA 2V4JA 1NSQA 2HIQA 1S1UA 4M94A 2EFGA 2R8JA 2N3LA 4FLTA 2PZSA 5HO4A 3J81O 1VGYA 3N28A 4K2XA 2CPZA 3GR0A 2OPQA 3Q8SB 2D0CA 2VG6B 4PRFA 4PG5A 4ERDA 4L76A 1LOUA 3LZIA 5A2QY 4BRLA 2R4FA 3ZTSA 4ZPAA 1CJKB 2IM3A 2ZH9A 3KK1B 1UEKA 2DPJA 5FROA 4C1NI 1LV5A 2IGIA 1VQKS 2MEWA 4CBXA 3GILA 4P74A 4C1NK 3CSKA 3MWBA 3KUHA 1E4GT 1WOPA 3VGVA 2DNMA 4PG6A 2ZM6J 3NG8A 2AD9A 2H4YB 4HR2A 2Y0BB 4DR4J 1LWCA 3CYMA 4A59A 2DNPA 2KO1A 1WACA 1LK5A 3AOBA 5E3QA 3ONQA 3G71S 2QYCA 4NXNF 1KLMB 4LF6J 4BVPA 1KBRA 2GX8A 5AQZA 2FDNA 1NKBA 3PX6A 3A8EA 3VR1A 4QW8A 3J7A1 1U0HA 5DM7Q 4TSXA 5AQGA 1RK8A 4DL7A 4DMZA 1WJ9A 3MECA 2BXJA 1J27A 2EXUA 2B4VA 3AGRA 2RUSA 3UCUP 2VG5A 1UFKA 3IGNA 3AO5A 5AE2A 3NVKA 1T3OA 3JSMA 3FFIB 1JJHA 4RNMA 3DGPA 4NL5A 2GJ2A 4MMOA 1FW6A 2FHOB 3MMJA 4K5RA 3CJ4A 4MO4A 3QRRA 3UW1A 5H9FK 1S6PB 5B09A 3C8YA 2B4JA 1HNWF 1W25A 1X5TA 2HGLA 3CNQP 1DQAA 1QVFR 2Q79A 2BH1A 1FEEA 4CZKA 1R27B 4LFCJ 1VQ6N 2CGLA 4JI3K 4CJLA 4Q0BA 5MLCV 5KFTA 5ETSA 4PZVA 2DHXA 2YWFA 2QGFB 2W7OA 3KFWX 3TEHB 3CM5A 2LQ9A 3AVMA 2FXUA 3TX0A 1JLFA 5FDLB 1HWJA 2FF6A 5ETPA 2ZGZA 3U9DA 1L3SA 3B78A 3J7AN 2OCEA 2DCLA 1VRQC 3M2UA 4K5SA 4USWA 3OS0A 3EZWA 3FVYA 1R8BA 3SCLE 1TK0A 3UD5A 3UKUB 1IUJA 1IH7A 1LW2B 3F9KA 3O3HA 2YKNA 4CBWA 1RNHA 4CZMA 4G1PA 1YRXA 4MDAA 1Q82T 1YHQS 4L8RB 2CZ9A 3CXCM 1Q53A 4PXCA 2PMZD 4ZCKA 4X65J 2RE2A 2RHQB 3MCSA 3EGNA 2PFFB 2O67A 1DURA 2ZH3A 3NF8A 4O44A 3DOLA 1O5JA 3OYMA 4K0KK 4MLEA 3S8SA 1WSFA 2PI4A 4OX9J 4DR1F 1NM1A 1RT3B 3DLKB 4ES2A 3L2RA 1RDBA 1R6VA 4FXDA 3LF0A 4BS2A 4BBYA 2EBGA 4CLWA 1SQFA 1RBLA 3QJJA 4ISGA 4O8UA 3OHRA 4ZVFA 3P5JA 3M32B 4CJSA 4O3SA 4DCOB 1IQTA 4GW6A 2CNOB 1BQXA 4B1YB 1F0XA 1PJ7A 1Q9XA 1PG5B 5DQIA 5BPNA 3TZXA 5F1XA 1IBLJ 3IR7B 2V69A 3R5AA 4B9LA 1UA1A 1KQKA 1X9MA 5BYRA 3GFYA 2QC3A 3RB3A 3HYFA 3DM2B 4KC5A 3X3UA 4RW4B 3KK3B 2V8GA 4B8CA 5DMRA 3CCUN 3G6YA 3GU0A 2O8DA 1YVUA 4LFBJ 4FYVB 2QMXA 1NMEB 2ZHBA 3E9LA 3D2FA 5HL7L 3PTWA 1WG5A 2FJXA 3KJQB 4CJ7A 4GNIA 4JV5K 2KN4A 3KWMA 2W24A 2EFOA 2ZBCA 4W5QA 3KLIA 2DFHA 2BJ1A 1YT3A 4JI2K 3HSZA 1JMTA 3R9LA 1LCUA 4TXSA 2VUGA 4DL4A 3VMFB 3EVMA 3AARA 5EU7A 4O8KA 1KOHA 2XSJB 1HHQA 2E1MC 3L0QA 4LFAK 4CJKA 1RT2B 1XMQF 1T94A 4OZNA 3QRQA 5F3ZA 2DNRA 2QEXN 3DLGA 3U4LA 3CMES 2E5LF 1RT4A 4BC4A 3MPDA 2Z2ZA 4M5IA 2AJ2A 4CRJA 4F26A 4OZ1A 5HROA 3QSYB 4KO0B 1RAJA 2AV5A 1J5EK 2CPDA 3CPWR 3JYTA 4CHQA 4DTOA 2MGZB 3ZZYA 4DB3A 1UEVA 3QFHA 1GXTA 3VWSA 2QZ8A 1DJ0A 2NXEA 4KTZA 1EB0A 1A5VA 1ZOTA 4WP8A 1X4BA 1YBAA 1GQEA 2G8VA 2I5JB 2IDOA 2ZJQL 3NBPB 4ZJQA 3JTNA 1K73O 3AT1B 1Y5IB 3P4IA 3TABA 1WKJA 1NDPA 3ILLA 3T1HK 4WCEL 1VBYA 2VF3A 1RT1A 2OPSB 2H5IB 1U09A 1NWKA 3UN2A 1A7GE 4NLTA 4BC9A 1ZS6A 5C2CA 1A5XA 4PKGA 3W63A 4LRBA 4WTOB 1M5PC 3A4TA 3C15B 4Q2MA 1YI2S 4ECTA 3HI9A 4F2RA 3L7UA 4Y00A 3QYYA 4FBTA 3GYXB 4N7TA 2GO8A 4DKWA 1M1KO 3PW4A 4B3OB 4QS7A 3T6JA 3LAKA 5DO2A 3FZ2A 4YDUC 2WFBA 1SBRA 1EP4B 4PKIA 2AJ1A 2HFUA 1C4CA 1REVB 2RRBA 2AYMA 2F65A 2JH3A 1NAQA 3V6DA 2BE7D 4IKFA 2C2DA 4WCEQ 2HNYB 4M5DB 2CPHA 4ZP9A 3MM9A 3HDSA 2ZH1A 4JYAF 4ZHRA 3OS2A 3T7ZA 3FK4A 2Z1HA 5KGXA 2X1AA 3AA4A 1CZAN 3H1VX 2QIFA 4BRKA 4PPDA 1GMWA 3HHLD 2AYGA 1S5JA 1GAOA 2ZOMA 3R1XA 4PL8A 4PQUB 1JLEB 3NWRA 5F3TA 2MZJA 4WYWA 5KFQA 1UAXA 4GVBA 2B8PA 2WCXA 3CD7A 4LR8A 2CADA 3HRGA 4ISFA 5CYQB 4JI5K 1N32J 4E7IA 3ZT2A 2LQJA 3NCRA 4BREA 2VA3A 1RE1B 3THYB 3GPAA 4TVAB 2MQLA 2ROGA 5THWA 1IG8A 3FZKA 3EZUA 2M9KA 1CQNA 3BM7A 3Q7CA 5AQIA 4PYDA 4RW7B 4OZ2A 1RYRA 2HMIB 3QO9A 4M8LA 4QS8A 1VQON 3TW0A 1BY9A 1WUUA 1MWQA 2HVDA 5MLCQ 3LOUA 2W6KA 3GG0A 4TU8A 4LF7F 1P1LA 3M05A 3ZNJ1 2N4DA 5LMNF 3B6BA 1RHUB 2VQFK 3OBIA 5KFAA 4NLCA 1JLAB 4PEOA 2WONA 1EX4A 1NHVA 4OZJA 4YOXA 2P5VA 4X66F 3PSFA 3H1QA 3PM9A 5GVQA 2J5AA 2D0OA 2CJKA 5ITHA 3DJCA 3DU5A 5HK4A 3L2VA 4FLZA 2YHYA 3CCJS 3HP9A 3AXMA 1N5YA 3ZX2A 2VOOA 3V9ZA 2G1HA 2CYYA 2Z1GA 2ROPA 2VC0A 3PYGA 4QIWD 2JFDA 1PAUB 4C8MA 5B0DA 3VQ6A 1VIXA 2G2YA 2W9CB 3A8YA 1B70B 4KH0B 1JNZB 5CY4A 4AM7A 1S5ZA 4B3RF 1M5SA 1NM2A 1RLDA 1JIHA 3ZT3A 1MMNA 4JUZA 4QCLA 4RUBA 2ZEJA 3T6BA 5D6GA 3BEGB 2J76E 2M70A 5KG5A 4WKRA 3ULHA 2ZH6A 4LH5A 4H54A 1YJTA 2EFPA 4ZVUB 1HL6A 4ID8A 7AT1B 5K5MA 2O01C 3TO8A 4B9SA 1L5UA 4H4MB 1VFJA 4P7TA 3H42A 3SFUA 2AGOA 1U2CA 4DUYF 4CEDA 2ZE2A 3TA1A 2HNDB 1S72N 4E89A 4J2DA 3HX9A 4OJGA 2JLGA 3E9PA 2YI1A 2Q1NA 2V50A 2L3MA 2QTWA 1QVFM 1LFPA 3RU0A 2E7VA 1FERA 2RT3A 2GHPA 4BRGA 2BV3A 3FEXB 1WOSA 3QGIA 3UWTA 3DRSB 1W7WA 4USJC 4FF1A 4KRWA 2GIQA 3TPQA 2X1GA 3WNGA 3P96A 3ZEUA 2J7KA 2J6SA 3VAKA 1KC8O 4NLOA 4OGCA 4LF4J 4KH5A 4C11A 4LRFA 2WUSA 2XMVA 4DDFA 2DNHA 1H2UX 1HNVB 1VK0A 3M1VB 5F8LA 2F1FA 1RWOB 2IAJA 4I56A 4K8XA 3G10A 3UR0A 3JAMU 4G9ZA 4L6V3 3P31A 3N0VA 4JS4A 3S9HA 3I55S 4WE1B 3L7OA 3CCJN 4NEZA 4NYOA 3P39A 4JRQA 1RDCA 1NU0A 4DF4A 1UJ5A 1Y97A 3HVTB 4WP3A 4CI0B 3TUJC 1X9WA 5AQKA 2G2ZA 2HFNA 2MZTA 2E6MA 1VQLN 2F5GA 4QWAA 2C3OA 1AYEA 1NRKA 1HQEB 3MFHA 3DLEA 1JQGA 2IC3A 5AQQA 2WBNA 1U1NA 3QLHA 1AZSB 2XB2D 2VPXB 4S0MA 2IIHA 2QLFB 3CMAS 1ITPA 1HIYA 2OLWA 4JD2A 1RDDA 5D0GA 2YX1A 3K59A 2C2ZB 2OPRB 4DL5A 2RQMA 4FF2A 2XYGB 1UMJA 3HULA 2JWLA 1LAVA 5C2FA 1GX5A 4UZBA 5AQSA 3JTOA 5KFYA 1RU2A 1BQNA 3QJLA 3C6UA 1HBUA 3QSIA 2KLAA 4DV3K 3NH0A 2KDOA 3QESA 4KGMA 2RVJA 3RSEA 4DV5K 3OT9A 3MMCA 2EK6A 2FHKA 3NGDA 5IFMA 1K6YA 1BQMA 2DFFA 2B6AA 5FRMA 1JLQB 3BR8A 2JSXA 3GFHA 1T05B 1N8RO 4WP9A 4ZMMA 4TY9A 4PR6A 2EK1A 2CQBA 1BO5O 3N5BA 1FK9B 3LP2A 4C8YA 1Q0NA 3A8IA 1GOBA 2DHSA 1DTQA 3IS9A 2F4FA 4A4JA 2FHMA 3UVJB 5KG6A 3FR0A 3R2CJ