3ISNC

Crystal structure of hiv-1 rt bound to a 6-vinylpyrimidine inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 141
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00075 RNase_H RNase H
C PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
C PF06815 RVT_connect Reverse transcriptase connection domain
C PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3isnC01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3isnC05
2C28A 4G1QA 4RG8A 3AO5A 4JLHA 3AVMA 4MIAA 2R2SA 4B3OA 1JLFA 3SV3A 1T05B 1TL1B 2P1JA 4K4WA 4CGDA 3QEXA 4YQWA 2Y1JA 2LSNA 1A5WA 4FJ7A 4BE2A 1RTHB 1LWCA 5KG5A 3DMJA 2ITGA 1KCFA 4FCYA 2WK4A 1WAFA 4CEBA 3OYAA 2WRMA 3DLGB 3UR0A 2RPIA 3E01A 4K50A 4FLYA 5KFZA 1ITGA 3L2WA 1RT7B 5KFQA 4YR3A 4OKJA 5DLFA 4FBTA 4XIUA 2OZMA 4C8OA 5JUMA 3OVNA 5KGXA 3AVLA 2YNGB 3RAXA 3FFIA 1KVBA 2IC3A 1TK8A 1TP7A 4RUAA 3KMSA 4J9NA 4C8LA 4FJLA 4NLRA 2HMIA 4ZTJA 3V9XA 3EYZA 3PW5A 1TAUA 4R5PB 1SV5A 4NLOA 4Z4HA 4DTSA 3OS1A 3ZCMA 4FLXA 3MEGB 4O4GB 2OPRA 2GV9A 3NDKA 5KFPA 3HK2A 3DLEB 3PUFA 4CESA 2ZD1A 5CZ1A 4MQ3A 2IJNA 4M3UA 2XY7A 4OPKA 2JEJA 3B6OA 1XR5A 2B5JB 3SFUA 4BWJA 1RTIB 1IKXA 2J6TA 5DMRA 1S6QB 3HYFA 5HRPA 3AVKA 4QW8A 4FJMA 3V6DA 5KG3A 3NAHA 4KREA 2D7SA 4ED7A 4TY8A 3NCIA 1C6VA 4O3NA 3WNGA 4DTJA 1C1BA 3KJVA 2HNZA 2IM0A 2X78A 4M3RA 2GUIA 4EP5A 1L3VA 2XWYA 3HL8A 3L2RA 1KHWA 5L1JA 2FBVA 2WOMB 4H4OB 4DTOA 3G86A 4Y3CA 4JRPA 3ULDA 3N6MA 5KFNA 2JLEA 4FLWA 2D0AA 3T5JA 2IMWP 3BJYA 3OHBA 2OYQA 4NCAA 4FJHA 1TAQA 3SQ0A 1JLGA 3QZ7A 5KFGA 4E19A 1FK9B 4DU3A 2ILZA 1Q9YA 1I6JA 4LH4A 2O5DA 4FW1A 4N47A 4JUZA 2FVRA 1YTUA 3QNNA 3LZJA 1HYSB 4HCBA 3LPTA 2BGGA 1LWFA 3VN5A 1RBRA 3C6UA 1RA7A 3CJ4A 4EYHB 4CF0A 3T19A 3PJWA 4FLUA 1NOYA 2DTUA 1NKEA 3QGIA 4NCGA 1S1VA 4CJQA 4CEOA 5KRTA 1KSPA 2R2UA 4B8CA 2XCPA 2Q3SA 3BDPA 1U09A 4NLWA 1REVB 2FLLA 4DEZA 3DRRA 5J2NB 3V6JA 3RBEA 2EHGA 3D45A 1QSYA 4KHSA 3DMJB 1C2PA 4YP3A 3SPZA 1J54A 3ICLA 3GYNA 1D0EA 3PO5A 1RT3B 3DLKA 2FLNA 3LPUA 4CFAA 4DTPA 1HNVA 4NLGA 4TYAA 1LW0A 4PQUA 5KFDA 1U48A 2BQRA 1O1WA 1I39A 3PR5B 5I3UA 3MXIA 3MR6A 1RT1B 3H40A 2XY6A 4O5BA 1KVAA 1XR7A 3V6KA 2B6AA 2I5JA 3NH2A 3MR2A 3I0RA 1ASUA 2KTQA 1VSKA 4DG1A 1JXLA 4URGA 4CK2A 2VWJA 3OY9A 3PHEA 4L8RB 4BACA 4Y2AA 1ASWA 2JGUA 3KIOA 3CM5A 5CYQB 1JLEA 2G8HA 5CYMB 3V81A 1S1WB 3C6TA 4CGIA 4KAIA 3M8QB 5F8NA 3PW4A 4HHTA 5HRSA 1CXUA 2HVIA 4ID5B 2VG5B 3AVAA 3E51A 5KFRA 1VRUA 3IRXA 4YR2A 4U7CA 5KFHA 1C0UB 3CFRA 2WCXA 4KV8A 1C0TA 4EBDA 3MFIA 1MU2A 3KD1E 3DRPA 4ECYA 4ECZA 4DS5A 1HPZA 4RNNA 3KNAA 2IAJB 4DSEA 3VA3A 4K4UA 3AV9A 4FM2A 2XC9A 5HP1A 3SCXA 4CJPA 2ETJA 5J2QB 3O4NA 3ZT2A 3QETA 2Z1GA 1IM4A 4O3SA 4CJKA 1TV6A 4OPJA 1RDBA 2VG7A 1U49A 4O3OA 4O3PA 4DTNA 3QEVA 4MFBA 4URSA 3H5XA 5F8GA 2AGPA 2FLPA 1UOCA 3U3GA 4CCHA 4LH5A 3M9NB 4IRDA 1N5YA 1RAJA 1ZBUA 1NJWA 1B92A 1S0NA 5DQGA 4WE1B 2FBYA 3VQ5A 2FVPA 2XCAA 3CWJA 1HJRA 2ZKUA 2OPPA 2YKNB 2OPSA 2RDIA 1VSIA 4O0JA 4R0EA 3NAIA 4URQU 5KG4A 4O55A 1HQEA 2WHOA 1S6PB 2HHUA 4IG3B 3RAQA 4QW9A 4FM0A 4RW4A 4ZHRB 1D5AA 1WSJA 1HMVB 1DTTA 4M41A 2B43A 4TLRA 4ED1A 4NLTA 1BHLA 5FDLB 1RT6A 2OPQA 3ZSVA 3KK1A 2BANB 2PZSA 4IOBA 4TQSA 4FJGA 3RTVA 1NK8A 2O4IA 4MK9A 3CJ2A 1RILA 3QO9B 3DRRB 4EEYA 3CJ5A 1RTDA 1RYRA 2ZE2A 4ZMMA 5KFEA 4KHUA 2JEFA 4ZP7A 1HYVA 3AA3A 4AHSA 3HSTB 3HVTB 4DL3A 2VG6B 1S9GB 2XGPA 4KE5A 4ICLA 2G8UA 3JSMA 4BDZA 3KLEB 5CZ2A 2KZMA 1S1XB 3K58A 4ID1A 3OYFA 1JLCB 3S3OA 1TKZB 4E1MA 4N56A 4EO8A 4J9RA 4ZPCA 5F8JA 1C1AA 4DTXA 5KFTA 1WN7A 3KLVA 1WLJA 2C2RA 4LSNB 4RW9A 4W5TA 3CG7A 4CJSA 1HARA 2I5JB 1RTJA 3GIJA 3N6LA 1T05A 4DG1B 4Y2CA 1T3NA 4DQIA 1WSEA 3KLFA 4DLGA 2GIRA 3L3VA 3DLHA 1RTHA 4E7LA 3UPFA 4FZZA 4FLVA 3F73A 4Z0UA 3C6TB 4M3XA 4ECVA 3DLGA 3KTQA 4NLVA 3KHGA 3P1GA 3OJSA 1TKDA 3QEWA 1RT7A 3SUPA 2AGOA 3L8BA 3OLAA 5C5JA 5KI6A 1FKPB 4M45A 1C0TB 3ZT3A 2FJWA 3CDUA 4Q8EA 2YNGA 5DLGA 1RYSA 1A5VA 2FVSA 5KFJA 3ISNC 4Y1CA 3TAFA 4DFKA 1ZBIA 4CK1A 3AVFA 4R5PA 1SH2A 3V9UA 3H08A 4OGCA 4AHUA 1TV6B 3MEGA 5J2MB 2OH2A 2FJVA 4O4GA 3LAKA 4MFBB 4ECWA 3DLEA 5KG6A 4F8RA 3MTKA 4WFXA 2AGQA 5I42B 2XY8A 2B5JA 4ECTA 4KPYA 4BE1A 3QEPA 4MIBA 2RF2B 2OPPB 1S6QA 4LD0A 3SUQA 1TQLA 3Q8SB 3GILA 4CF1A 3BGRA 1IG9A 3KK3A 3GIKA 2YKMB 3NGIA 3AA2A 4AHRA 5HRNA 2RDJA 1T03A 3TAGA 4ZPBA 3PR4A 3L2VA 3G6XA 3QESA 3D0PA 2HHVA 1D9DA 2X74A 1NHUA 3EPIA 2W9AA 1RT6B 4Q43A 5F9LA 4CF9A 1L3UA 4QWDA 2QKKA 2YHBA 1JLQB 3V1OA 3H5YA 3TR8A 2XRIA 3LP1B 4ELTA 3NF7A 2PYJA 4H4OA 2R8GA 4FBUA 1TK5A 1CSJA 5KFOA 3O3HA 4H4MA 4FJIA 4CEQA 2KFNA 4DSIA 5DQIA 2E9ZA 4ECXA 2IGIA 2G8VA 3DOKB 4EZ6A 1Z4UA 2KFZA 5C25B 4CJVA 4BDPA 1KFDA 4NYFA 4W5QA 3OYIA 3ZT4A 4ECUA 4X2BA 1NHVA 5KT3A 3JSMB 1S48A 4RZRA 4KHWA 3SNNA 1JL2A 3HJFA 1HYSA 5C42B 4DQPA 4F4ZA 3GIIA 1XHXA 3NFAA 4CHOA 3M8SA 2VWKA 5J1EB 1KTQA 3KHLA 3LZIA 1K1SA 1RTJB 1NNDA 3AO1A 4MH8A 5J2PB 4TQRA 1REVA 5EU7A 5J2NA 3KLFB 4CGJA 3K59A 3RMDA 4ZPDA 4CHNA 4B9VA 4K4TA 3AO4A 1WAJA 4Z4IA 3M9MB 2HHTA 4RNFA 3F9KA 4CEDA 4J9OA 3L2QA 4ECSA 1HRHA 4DS4A 2JC1A 1DLOB 1RT3A 4CEEA 4ED2A 3OYBA 3QYYA 2DPIA 5F9NA 2KQ2A 1T8EA 4DSKA 2QE5A 1RT4A 1CLQA 1S97A 2BDPA 1RT1A 5JXSA 4O4RA 3I0SB 3GQCA 2DFFA 1Z26A 4NCBA 2ASLA 4E3SA 2D0CA 4CFDA 1CZBA 5DG8A 4K8XA 4ZVHA 3CDEA 3OYDA 4DQSA 3AVIA 4NYNA 1IO2A 1D8YA 3TWHA 3NHGA 1RBVA 4DFMA 4O44B 2HVHA 5CYQA 4W5NA 3RB6A 4IDKA 5CYMA 2DPJA 4J9LA 3RRHA 3G10A 1S1WA 3OL8A 3K5OA 3M8QA 4DQRA 4HTUA 4OKKA 3VQQA 3IAYA 4CIFA 2R8IA 2IBKA 3D5MA 4ID5A 2VG5A 4DWIA 3BGRB 3KK3B 3DYAB 1T03B 3BSOA 5HLFB 1C0UA 5HBMB 4CJLA 3HP9A 4ECRA 5EUHA 4CEFA 4KFBB 1G15A 3AVHA 2IAJA 3RR7A 3CVKA 4E7KA 3QIDA 2FBTA 3O3GA 3CYMA 4K4XA 4DMNA 3TARA 3N6NA 5J2QA 3V9ZA 4YNQA 1T7PA 3PVXA 1RT2A 4H4MB 4GVMA 2BRLA 3QGGA 4FXDA 3HO1A 4F4WA 2IM2A 4IKFA 2B4JA 4TYBA 2YNFB 3WNHA 4FLZA 4WE1A 3NL0A 3PZPA 4KTZA 4EBCA 2YKNA 2E9TA 4EBEA 4DTRA 2E9RX 3CIZA 4QOZB 4O0IA 3M8RA 3BR9A 3QGHA 1XC9A 3AA5X 5DQHA 2HAIA 3V4IB 1S6PA 4IG3A 3HPHA 3GV5B 2ASJA 4ZHRA 1HMVA 2DFEA 4CJUA 5FDLA 3GV7B 2BANA 3OYNA 3S3MA 3KD5E 1IKYB 4NLXA 3WNFA 1KLNA 4QWCA 3ZSZA 1VK0A 4ZP6A 3QO9A 3JYTB 1ZTTA 3VQBA 1C1CB 1L3TA 2D3UA 4CECA 5EWFA 2QK9A 4XPCA 3RB3A 3BSAA 2GIQA 4ED0A 3AVGA 3HVTA 3GV8B 1HYZA 4OJRA 1S49A 2VG6A 1I3AA 1S9GA 4IBNA 2YHAA 4FK4A 4IFYB 4FJ5A 4KTQA 3L3UA 2R2TA 1BGXT 2CJQA 5F8HA 4JRQA 3I5CA 4IG0B 2J6SA 2YNIB 1EETB 3KLEA 4E89A 5JS1A 1S1XA 3ZSXA 1JLCA 2UUTA 1TKZA 3LP2B 1U04A 3SUOA 2BE2B 2BR0A 1RT4B 3VQCA 1GOBA 3BREA 4ZPAA 3KLIB 3O3FA 5T7BA 4LSNA 2YNHA 2R8JA 4Y1DA 1ZYQA 1TVRB 3HHKA 4FK0A 1TKTB 1TL3B 4MKAA 3I8DA 4Y34A 4IDKB 4DL6A 2FVQA 1N6QB 1VSFA 1D1UA 4FZXC 1BCOA 3D28A 1VRTB 1VSDA 4W5RA 4OKEA 1DTQB 3KHRA 2JEGA 4I2QB 4CJRA 4TY9A 2FVCA 1FKPA 4CJFA 3THVA 4WYWA 5KFMA 3QLHA 4DTUA 4CERA 2ATLA 1GOAA 4HYKA 1QSLA 4Q8FA 1ASVA 3T5HA 2BRKA 4MKBA 4KHNA 4MK7A 4NRUA 4WXWA 1QE1B 4J2BA 4IH7A 2Z1JA 1S10A 3ZSRA 5J2MA 1RT2B 2PY5A 4DL2A 3TAEA 3HPGA 1BL3A 3AO2A 3OHAA 1QHTA 2Z1IA 5I42A 5KG2A 5D3GB 1LAVA 2ASDA 2HWIA 4J9KA 2G8IA 3KLGB 1SKSA 1S1TB 1SL1A 1RBTA 2RF2A 1HNIB 3V9SA 4FJKA 3NGZA 4KI4A 1BI4B 3LWLA 3VQ4A 2XO7A 1GX5A 3BQ1A 2YKMA 3FSIA 4F3OA 2BQUA 3K5NA 2HHXA 5SWMA 2JEIA 1RBSA 5DG9A 2NUBA 3TANA 3CFOA 3H4DA 5T14A 2A1SA 3OYMA 3OYLA 4CEAA 3TAMB 4DSFA 2V4QA 1JKHA 4I9LA 1JLQA 3RB4A 3VQSA 3UQSA 3NKYA 3LP1A 1KHVA 4JV2A 2W9CB 5K14B 5DG7A 3QIPB 1R0AB 2AWZA 3PO4A 3HVAA 2DY4A 1SH0A 4ED8A 3BQ2A 4H54A 3AVBA 3DOKA 2E6MA 3CDWA 1EP4B 3O4QA 3T3FA 2UVWA 5C25A 4HUEA 1Q9XA 4ED6A 2D5RA 3U3YA 3PX0A 1LW2B 1BISA 4E7IA 4NRTA 1SUQB 4AHVA 1KFSA 1J53A 1WNSA 4WZMA 3H5SA 4K4SA 1K1QA 1N48A 5C42A 4IR9A 4IRKA 1LWEB 4CJTA 1WSIA 3I5AA 4EP4A 3SFGA 3QEIA 1ZETA 4M95A 3B6PA 2YNHB 5J1EA 5EDWA 3ZT1A 2GBZA 5J2PA 4NZ0A 4ZVFA 3TAQA 4N76A 2W8LA 4M3WA 3LP0B 3OSPA 4CJ3A 2IM1A 3OYJA 2F8TA 4JS4A 4ECQA 1W0HA 3OYGA 1IKVB 3H2LA 3NF9A 3IS9B 4LQ9A 3HT3A 3HKWA 4M94A 2XGQA 2ATQA 4ZVGA 3DRSB 1JLBB 3T5KA 3MXMA 1DLOA 4CHPA 4RW7B 2HNDB 5EWEA 4RU9A 3SI8A 3HVRA 3QLHB 4AHTA 4CIGA 5F8MA 2OA8A 2ALZA 3MEDB 3UDLA 3C94A 5KFBA 1SL0A 2PYLA 2IA6A 3I0SA 4WYLA 3S3NA 3CJ3A 4J9SA 1S9EB 3PX4A 2AX0A 1XI1A 1KRPA 1RDRA 2W9BB 4KKOA 4NLQA 4O44A 1S0MA 1BIUA 5KT4A 4R8UA 1L5UA 3H59A 2V9WA 4QAGA 1A5XA 3HXMA 3Q8RB 4Q0BB 3PX6A 1WSFA 3DYAA 4CGFA 4ED3A 4ZP9A 3ISND 3AVCA 4KI6A 3G6YA 5HLFA 5HBMA 4U6PA 4B9NA 4KFBA 5HROB 1QUVA 3MEEB 4ELUA 1QSSA 3EZUA 3MR5A 1L3SA 4C8MA 1JKHB 4G3IA 3EY1A 4FYDA 3OJUA 2IM3A 3P5JA 1XR6A 3NF6A 4FJ8A 2P5OA 4I2PA 4DLEA 2W8KA 5L1LA 1QQCA 3HVWA 5DGAA 4C8NA 2F96A 2D3ZA 2YNFA 4KO0B 2F8SA 4KB7A 4QCLA 1QAIA 3QNOA 1X9MA 1QTMA 5KTQA 4B8AB 5L1IA 4PY5A 2WONB 1W9HA 4I7FB 1ZBFA 1NKBA 1SKWA 3SQ4A 2EX3A 3K57A 4J2DA 3SV4A 3LDSA 3V4IA 1Z25A 2J6UA 5KRSA 3RMBA 3SYZA 4E0DA 4KHQA 4RW6B 3OL9A 1OS5A 3RB0A 4Q45A 1IKYA 2XHBA 5KFYA 3JYTA 1X9SA 4IFVB 1C1CA 2R8KA 4GMJB 5KFVA 2AQ4A 4AILC 4O3RA 2W42A 4B9UA 2XI3A 4GC6A 5KFXA 3NBPB 4LY7A 2R7YA 3OYKA 3OS2A 4IFYA 1F21A 2V4RA 1HQUA 3AA4A 4IG0A 3U6FA 2YNIA 1EETA 4WFZA 3ASMA 1KLMB 3LP2A 3QINA 4DF8A 2BE2A 4RW8B 1NJZA 4PA1A 3OLBA 1BQNB 1BQMB 1S1UB 5KT5A 4WFYA 3KLIA 2RKIA 4CE9A 3PW2A 4WXOA 4HKQA 4RNMA 3WNEA 3H98A 2XY5A 1TVRA 3MECB 3NH1A 1UWBB 2AX1A 1TKTA 4ZTFA 4KKOB 3KLHB 2HNYB 3DOLB 3IG1B 1TL3A 3AO3A 1SH3A 1YVUA 4AH9A 1N6QA 2X6SA 4R8UB 4OLBA 5KT6A 3AVNA 3DM2B 1VRTA 1DTQA 1JXBA 4IQXA 4PWDA 3P83D 2G8FA 4I2QA 4CF2A 1CXQA 4DFPA 2G8WA 1YT3A 4ELVA 3BSCA 5KFFA 3OYEA 3K5LA 1X9WA 4J9MA 1YTAA 4K8ZA 4KRFA 1NK4A 5DGBA 3H4BA 1JXEA 4EYIB 2VA3A 2Y1IA 4CHQA 3ZSYA 1UA1A 4DTMA 4Z4FA 3M9OB 3SJJA 5FRNA 1QE1A 5EWGA 3GIMA 4M3ZA 4I2PB 4UQGA 3SUNA 2ZQBA 4RNHA 4M42A 1VSEA 1QAJA 3LANA 2X6NA 3M8PB 3HPOA 3Q8PB 3MAQA 4NLDA 5D3GA 2UVRA 3QZ8A 4DL4A 4LQ3A 3KLGA 1S1TA 4JV0A 2P51A 1HNIA 3DI6B 4PUOB 1BI4A 1SKRA 4Q5VA 3C95A 1TKXB 2XI2A 1IKWA 2FBXA 2AJQA 3S9HA 1EXQA 3TQ1A 1UAXA 4F4XA 1JLAB 4OL8A 4DL5A 1RT5B 2QKBA 1NK7A 4NLYA 4DSJA 3PY8A 4IKAA 3CFPA 4J2EA 3V6HA 3TAMA 4KHMA 4NLSA 1GX6A 5F8LA 1J5OB 3A2FA 3KK2B 1RDAA 4FJNA 3ZSOA 1RA6A 3VQDA 2W9CA 5K14A 4GW6A 3QIPA 1R0AA 3OYCA 4CJ5A 2UVUA 4CF8A 2BQ3A 1WNEA 5E41A 1TGOA 4K4YA 5C24B 3SPYA 4G1QB 1EP4A 4KBIA 3LP3A 5KFSA 4B3OB 1JLFB 1LAWA 3NGYA 4DQQA 2UVVA 1LW2A 4B9LA 4HUGA 1N4LA 3FQKA 1HQUB 1SUQA 4QPXA 4IRCA 2IS3A 1LWCB 4CIEA 1NK6A 1S9FA 3SQ2A 3PV8A 3MFHA 5CY4A 4K4VA 3NH0A 1LWEA 2D41A 3IN5A 4TXSA 3G0ZA 4IH5A 4FZYA 4BWMA 3E01B 4FS1A 2OZSA 4XO0A 3OL6A 3G6VA 3EZ5A 4B9SA 2RKIB 1SL2A 4OGEA 4EO6A 2YV0X 4BE0A 3FRZA 2UUWA 4FS2A 4FJ9A 4QWAA 5L9XA 4CK3A 3RWUA 3ITHA 3LP0A 3FFIB 2IC3B 3NMAA 1J9AA 3TABA 1WSGA 2HMIB 4KB0A 1T94A 3PJXA 1IKVA 1SV5B 3IS9A 4RUCA 3DRSA 4PWDB 1JLBA 3CQ8A 2OPRB 1FXXA 4FW2A 3OSNA 1XWLA 3DDKA 2ZD1B 4RW7A 2HNDA 1NK9A 5KG0A 1EKEA 4FK2A 3MR3A 4CHYA 1QS4A 1CZ9A 1NK0A 3MEDA 3BQ0A 1IKXB 4Z4GA 5KGWA 5FROA 4I9QA 1TK0A 1RDDA 4LSLA 3KOAA 1B9DA 1XHZA 3V6DB 4CGHA 3V9WA 4K4ZA 2Z1HA 1S9EA 3LALA 4TY8B 4F2RA 1C1BB 3KJVB 2W9BA 1YVFA 3VQ9A 2HNZB 3FQLA 1GOCA 2RN2A 5KFLA 4CJWA 4CJEA 3QIOA 5KFIA 3OS0A 4NLPA 2IOCA 4CJ4A 4Q0BA 1S5JA 1IKWB 1JL1A 5L1KA 4E1NA 4KB1A 5KG1A 2JC0A 4QWEA 1JLGB 4CGGA 5HROA 4Q44A 1IH7A 3MEEA 2R8HA 2VA2A 3MF5A 3I5BA 3ZT0A 4FM1A 4CEZA 4FLTA 1UA0A 1RCHA 3MXJA 3EPGA 3KKSA 3ALYA 4XPEA 1ZBHA 5FRMA 1K6YA 1RNHA 1LWFB 3L2UA 3TI0A 4HUFA 3C6UB 4YFUA 2A1RA 2W7PA 1NK5A 5KFUA 5F8IA 4DFJA 2AU0A 4NCGB 1S1VB 2E4LA 3PW0A 4KO0A 2HWHA 3VQAA 4HVJA 2C2DA 4J9QA 3RR8A 5KFWA 2WONA 4ZP8A 1X1PA 4BDYA 4I7FA 2HHSA 1JX4A 3V1RA 3CO9A 4W5OA 1U47A 4DU4A 2ILYA 4E7JA 3RRGA 3UIQA 3AVJA 1FKOA 3ZSQA 3NGDA 4RW6A 5KFAA 5HRRA 3DLKB 5DK5A 4NYZA 2QV6A 1HNVB 5KFCA 4KHRA 1NKCA 1LW0B 4PQUB 2WTFA 2CKWA 2DFHA 1EX4A 2HHQA 4ZVEA 4N41A 3ITHB 3SI6A 4B9TA 4IFVA 2HW3A 3VQEA 5I3UB 4OVLA 4DF4A 3RMCA 4QWBA 4KSEB 4M3TA 2QXFA 4YR0A 1ZTWA 3CJ0A 4EZ9A 2B6AB 3NBPA 3I0RB 1LV5A 4DSLA 1B9FA 1RBUA 4B08A 1TL1A 3OL7A 4KHYA 4IH6A 4DL7A 1NJYA 5KG7A 4TSXA 5KT2A 3DLBA 4DU1A 1JLEB 4AHCA 1KLMA 4JV1A 3V81B 4RW8A 1BQNA 1BQMA 3VQ6A 3T1AA 2KW4A 1S1UA 1BIZA 4O3QA 3PW7A 4LSLB 4KAZA 1VRUB 3IRXB 3SZ2A 4OLAA 3TAPA 2HB5A 3HM9A 2P5GA 4KV8B 3MECA 1MU2B 3DRPB 1NJXA 1UWBA 1VSLA 2EC0A 1HPZB 4F2SA 3KLHA 2HNYA 3DOLA 3IG1A 1VSMA 2O4GA 1JIHA 4Z4EA 3BSNA 5HP1B 2C22A 1N56A 3KHHA 4JS5A 1U45A 3DM2A 1Y97A 2VG7B 3VQ7A 4NLUA 4FJXA 2D0BA 3V1QA 4F4KA 1D9FA 1ZBLA 1N5YB 4F50A 1S0OA 2KZZA 2E6LA 3LWMA 3VQ8A 5KT7A 2V0NA 3DLRA 1RTIA 4WZQA 2OPSB 3ZSWA 3NE6A 3KKRA 2HHWA 2IJFA 3OYHA 1Q8IA 4TN2A 4YMEA 1HQEB 4GC7A 4RW4B 3SQ1A 2F8EX 4CFBA 3K2PA 1VSHA 1DTTB 1NOZA 3NF8A 4CHZA 5JS2A 3M8PA 2OPQB 4H8KA 4B9MA 3KK1B 4FJJA 4RNOA 4N5SA 1C0MA 4M3YA 2WOMA 3RMAA 1VSJA 4E7HA 4HCCA 3Q8QB 2WB4A 3RBDA 3DI6A 2C2EA 1KVCA 3T5LA 4PUOA 1RTDB 1RDCA 3CM6A 2R2RA 2ZE2B 1TKXA 1U4BA 4F3TA 2FJXA 2IDOA 1JLAA 4KTWA 3KMQA 1FKOB 3VQPA 1RT5A 3QERA 5KFKA 1MMLA 4FVMA 3K5MA 5SZTA 1FK9A 3NAEA 3IGNA 1S4FA 2FC0A 3VA0A 3LAMA 3FDSA 4ICLB 4CFCA 4IR1A 1J5OA 4Z4CA 4J2AA 3IGVA 3H5UA 3KK2A 4MK8A 3HP6A 1BCMA 3TVKA 2W7OA 4C8KA 2GC8A 2I1RA 2G8KA 4F4YA 1W25A 1WSHA 4J9PA 5C24A 4RW9B
chains in the Genus database with same CATH superfamily
2FQQB 4DCJB 2RQKA 4LFAF 4RG8A 3POTB 2R2SA 2DNYA 2V7YA 2QLJB 3MPWA 4YQWA 3CMAN 4FJ7A 3HM8A 4HHUA 4BE2A 1RTHB 3DMJA 4JK9A 2NQPA 4DV5K 2RQCA 2J0XA 2WRMA 5M1NA 3DLGB 2UXDJ 2RPIA 5T7LB 4CIOA 4YR3A 4OHYA 4FBTA 2VZ9A 4XIUA 2UUCK 4C8OA 1R6YA 3DOMB 5JUMA 1EZZB 2QM1A 5KGXA 3RAXA 3RSEB 2FZGB 1IBLK 1HKAA 2IC3A 5IOLA 3JAMU 4FJLA 2HMIA 1OYEA 3D4JA 2ZH3A 3V9XA 4P73A 3PW5A 1TAUA 3JAMO 1LFWA 1SV5A 4NLOA 4Z2XA 4Z4HA 3OS1A 1NU0A 5M1FA 2UP1A 2QA2A 2ZD1A 2ZWHA 3SK3A 4IOCQ 4IOAQ 3B6OA 3D1QA 4CZFA 3SFUA 3BH7B 4BWJA 3WEEB 2J6TA 5DMRA 3AGRA 4ES2A 5HRPA 2B4VA 4QW8A 3NAHA 1Q53A 3IP0A 4DUYJ 3NCIA 3WNGA 2UU9K 4ZCMA 5I4MA 1IJEB 4IEIA 1R8CA 2W2PP 4FNHA 4UOHA 3BUZB 2N3OA 2GUIA 3HL8A 3N5FA 1VQLS 5L1JA 3S8SA 2FBVA 4H4OB 4Y3CA 4JRPA 3ULDA 4K59A 2RIJA 3T5JA 1NEEA 4DV5F 3FBBA 1ITPA 4NCAA 2OYQA 2MXYA 2VIHA 1TAQA 2WUSA 2G0CA 4IZ9A 2EFVA 3E8OA 1G3OA 1BWFO 4WKRA 2KU7A 1SI9A 2UUCF 4N47A 3NNCA 4JK8A 1YTUA 3QNNA 2N4DA 3LZJA 3GOIA 3LPTA 4CM2A 1XN9A 2IVNA 3VN5A 1RBRA 3C6UA 1GNKA 4USMA 4CZJA 4EYHB 3C19A 3PIOL 4NEYA 3BH6B 2V2QA 2VF3A 5KRTA 2MZQA 4CZEA 3VGSA 4B8CA 4CH0S 2Q3SA 3BDPA 1VBXA 2OSQA 5M2UA 1WORA 3DRRA 2EHGA 4PXEA 5G0RA 1QSYA 1WF2A 1NDCA 4JN4A 2G2ZA 1S5ZA 3ZEUA 1HBMB 4A8FA 1UVMA 3SPZA 1X3NA 1YF5L 1CJVA 1VGYA 1UCNA 1KD1T 3TA1A 2XEXA 3DLKA 2AT1B 1X31C 2QO3A 3TP2A 2UU9F 5A0YB 4NLGA 4TYAA 4YOXA 4JI3K 5KFDA 2BQRA 1I39A 3SQGB 4AQYF 3M2RA 4DPOA 3MXIA 3MAHA 3H40A 1F6TA 2IVPA 3ID8A 4FKXA 1WOOA 3B54A 1KVAA 5D78A 3A5LC 4ZPVR 1NXIA 1HR0J 2HGLA 3MR2A 3O6QA 3MM9A 1VSKA 1JXLA 3PHEA 2E5LJ 1UJ6A 3GJRB 3KIOA 3CM5A 4QR0A 1U2RA 3EO3A 2G8HA 3V81A 1S1WB 3PIPL 2HEKA 3TUJC 3M8QB 5D4NA 3AXMA 4ID5B 3AVAA 1VRUA 4U7CA 3MWBA 2R9LA 1B0PA 1AXQA 2PDAA 3MFIA 4ECZA 2V2ZA 1HPZA 2CPDA 3U9ZA 4FM2A 4CO0A 3SCXA 1A6LA 3PIOQ 3ZT2A 1ZM4A 3IFRA 2Z1GA 4O3SA 1TV6A 1OVYA 4DTNA 2E2NA 3U3GA 4LH5A 3M9NB 3R97A 1UKUA 2FJDB 2KXNB 3ENOA 5DQGA 2FBYA 1VS3A 2ATCB 3VQ5A 2L9NA 3OXGA 2XCAA 2ZKUA 4G1PA 1S6UA 3MTJA 1Q86O 2LEPA 2LXFA 3NAIA 3G2XA 2W2MP 3A5NC 5KG4A 5DO2A 2D0PA 1S6PB 2KN4A 4IG3B 3KYLA 4QW9A 4ZHRB 3S01A 4DUZK 3M3ZA 4USKA 1DTTA 1H98A 3QAUA 4NLTA 5L39A 1RT6A 2OGUA 4N77A 3ILJA 1Y3KA 2PZSA 4IOBA 2NRVA 3D68A 4FJGA 4GKKJ 3VF6A 4B1WB 1ZPWX 1M5PC 2JFDA 2O4IA 5AQRA 3CJ2A 3QO9B 4DV7J 2JEFA 3AA3A 4AHSA 3E9OA 2QSWA 2ZHOA 2VG6B 3F0NA 1S9GB 2J9EA 2XGPA 4BQZA 2E7VA 4CBXA 4KE5A 1P90A 2XYHB 5DZ7A 4RBVA 3PIPQ 5FPEA 4KGMA 2G8UA 3JSMA 2YX1A 4BDZA 3NWRA 4A48A 1Q82T 3CJ9A 1FX2A 4X64J 4EO8A 4DV6J 4RU2A 2LECA 4ZVQB 5M2RA 3HHNB 2DRBA 1A7GE 3SCLE 2X51A 1HARA 5D0GA 2GX9A 3L4QA 3H3OB 4DB3A 2CPEA 1UAWA 3FEXB 3N6LA 1N5VA 5GAGP 2A3ZA 3PRDA 3KLFA 3FZLA 1Y4ZB 4B1XB 2W7AA 3ZZYA 4E7LA 4L6V3 2HBLA 2DR6A 5CYJA 3C6TB 3CCQN 4LF8K 3AODA 3ID6A 2DXEA 3KTQA 4NLVA 5HI7A 1F9HA 3VALA 3R2CJ 3P1GA 4DKWA 1RT7A 1XMBA 2AGOA 2QA4S 4E1JA 3OLAA 5C5JA 5KPZA 1FKPB 1VQSA 2NXCA 4Q8EA 2YNGA 5DLGA 2CQ2A 3ZTRA 2H3EB 1FJGF 2MQLA 2FVSA 1Q8KA 4Y1CA 1NCLA 4DFKA 2YHYA 3CC4S 1SH2A 1TYQA 2NRXA 4OX9F 2RRAA 3H08A 4CZGA 5J2MB 3G82A 2OH2A 2P9NB 4O4GA 4MFBB 2ASOA 3EVWA 5KG6A 4F8RA 2IBOA 4DX6A 2AGQA 2I38A 4ECTA 3J7A1 4LD0A 4FF2A 4DJBA 3GILA 4EFAC 2YKMB 5HRNA 4F7VA 3PR4A 4P71A 3LO3A 2HHVA 3EGVA 1NHUA 4Z94A 2MLZA 4CF9A 4QWDA 3TR8A 3LP1B 2QL7B 4Q2LA 4QS7A 1TK5A 5KFOA 4CEQA 3FLCO 4PRFA 5DQIA 3A8YA 2DHHA 1UVLA 4DR3F 4EZ6A 4LF8F 1Z4UA 4C0OC 3H42A 3BGFA 2UUAJ 5AQYA 2P9CA 4M5HA 4B3MJ 4BDPA 3GG0A 3ZT4A 3PJ9A 1WG4A 3M6VA 2MY7A 1H2VZ 3EGWB 1Y7PA 1YBTA 2HQ3A 2QWOA 3SCIE 2Z2YB 3GR0A 3SNNA 4ATNA 2NRRA 1HYSA 5C42B 1XMOJ 4DQPA 4U7BA 1XNRK 2QLWA 3GIIA 1XHXA 2YH0A 3UCZP 4DCHA 3W66A 3JQJA 4K0KJ 1Q8LA 3CCSS 1CS4A 2O01C 4W98A 1KTQA 5F41A 2DGOA 4CTAB 4TQRA 1REVA 1CC7A 5BPNA 4ZPDA 4B9VA 1DJ0A 1WAJA 4Z4IA 3M9MB 5E3PA 3TJ8A 1RWOB 2F1FA 3PM9A 1S7HA 1X4CA 1Z6RA 2UXDF 2O8DB 2VU5A 1D3WA 3OYBA 4DSKA 3DN9A 2QE5A 1JJ2R 1RT4A 1HI8A 3CPEA 4Q2MA 1CLQA 1OPZA 1WG5A 1RT1A 4NA2A 2M8HA 2DNMA 2KT3A 3VAJA 4F0MA 2Z57B 4E3SA 1V6HA 3L7UA 1SQGA 2D0CA 3I55S 1NGDA 4V19J 2ZH4A 3BF3A 3R3TA 1IO2A 1YRXA 1F1BB 1D8YA 4O44B 5CYQA 4W5NA 3RRHA 3D2EA 3W2WA 1TFYA 4X84A 1UVIA 2BE9B 3CQYA 1T9YA 1RP5A 2R8IA 4DWIA 3A13A 3BGRB 3DYAB 1RE1B 1T03B 3BSOA 1XNRF 4ZK7M 3HP9A 1OKJA 5EUHA 2RUSA 4A8OA 4MO5A 3PFEA 4F3MA 4KFBB 4E98A 2M3DA 3IWLA 3SAGA 1RWMB 3N6NA 2BOPA 1VQKN 3RYLA 1QUPA 1N36K 3GIRA 3QGGA 3I87A 1YK9A 5CD4H 3HO1A 4ETXA 3N0VA 2V34A 2YTCA 4BRHA 4TYBA 3ELHA 5HJYA 1QVFM 3E9PA 3NGTA 3G6ES 3PZPA 1FD8A 3M30B 1M1KT 3B82A 4DTRA 1HQ2A 4CLKA 2ZDPA 4QOZB 2ZFHA 2VICA 2GGPB 3EZWA 3PLAA 5DQHA 2PI5A 2C2ZB 2B8QA 1MWZA 1FE4A 2QWQA 4CLLA 4NMXA 2DO0A 1I94K 4QU7A 3K17A 2DFEA 3CPWM 3EVOA 3CJKA 4CJUA 1PILA 2BANA 4JHDB 2BEFA 2J0WA 3OYNA 2QMUB 1N5SA 1RK8A 3WNFA 2MDAA 3IRWP 1VK0A 4ZP6A 2GUPA 3JYTB 1PC5A 1QQMA 1L3TA 3OFHA 4CECA 2WVBA 3BSAA 3DRXA 2QFJA 1HYZA 5CE3A 1CJTA 1S49A 4IBNA 4BR5A 4IFYB 3L3UA 3LDPA 1HUXA 3WXIA 2VBWA 1PG5B 2KJVA 2DR8A 3DHWC 1S1XA 4NI2B 1NMNA 3JS6A 4CBUA 5KPRA 3SUOA 4WF9L 1FEEA 1Z2ZA 2ZZTA 3O3FA 5T7BA 4LSNA 4J90A 4UOGA 2R8JA 3NVMA 2GVDB 2O8BA 2H65B 4DR6K 3HHKA 3KUEA 2VQEJ 1M1GA 2ZITA 2HS4A 4CO2A 4JI0J 5JLHA 1TL3B 1HR0F 3T1HK 4L3KA 4MKAA 2DGSA 4Y34A 5EX5A 4IDKB 1NGFA 2E5LF 3C16B 1VSDA 4LF7K 2GX8A 5AE2A 3MOJB 1FDNA 2Z8QA 3FK4A 1GLFO 4CJRA 3MOZA 3FSYA 1FFSB 3HFZB 3ATUA 4WQ4A 2Q1NA 3THVA 4C0BA 4LT6A 1RAGB 3ENAA 3CCVN 4Q8FA 5AT1B 1ASVA 2C3OA 5LT5A 1WF1A 2JLGA 4JKEA 3D9BA 2XTJP 1WJ9A 2FTRA 2AJ1A 4LBIA 2D4WA 4MT1A 1SJFA 5CCLA 1Z05A 4DR5J 5H1SQ 4DPYA 4NXNK 1S0VA 4CVNE 2OCEA 1XBWA 3AO2A 1QHTA 1SIZA 3MCPA 3F41A 1PGZA 1DEJA 4Y65A 1LAVA 2PI4A 2ASDA 2GZOA 1OH5A 1F9FA 3L95X 1RBTA 2RF2A 3R5CA 1B0TA 4F0HA 1HNIB 4KI4A 3VENA 5AE1A 1N32K 3BQ1A 2VH7A 4F3OA 1HLWA 2HHXA 2JEIA 3TWZA 3FCHA 3BF4A 5LY3A 3TANA 1S6OA 3CFOA 4WF9Q 3OYMA 3F9MA 2RRBA 4JV2A 1R0AB 3T1HF 1WSRA 2JNJA 1SH0A 4GKKF 2F8MA 3AVBA 1SKUB 3U27A 3T3FA 4DV7F 3DFEA 2UVWA 1IM6A 4ED6A 3TW0A 1VBKA 2E2QA 5C2DA 3OW2R 3MCSA 5LOQA 1SUQB 3AB2B 2QA1A 5BRDA 4JI5J 3O44A 4K4SA 3IC1A 4CLUA 3BEGB 4IR9A 1JB0C 4IRKA 1N0VC 1FI4A 4CYUA 5AR0A 2E7XA 1WSIA 3SFGA 1DQ9A 3G4SN 2OEMA 4X64F 5EDWA 1RHMB 4PWWA 4DV6F 4C0HA 2F5GA 5DRKA 2JOQA 2A40A 2X7IA 3TAQA 2J9DE 3TPQA 2W8LA 4FXVA 3LP0B 3KVGA 3M8ZA 3OYJA 3THXA 1VQ9N 1W0HA 2MEWA 3H2LA 3P31A 1HNXK 3CJBA 5D6GA 2EKNA 2NRWA 1N32F 5H9EK 1DLOA 8RUCA 5D8HB 5IWAJ 2DNRA 4DV3K 2HNDB 2VDHA 2B4UA 3HVRA 2H9ZA 3QLHB 1RAEB 1NSQA 1GT8A 3AARA 4AHTA 1HNZJ 4LUBA 4JK7A 1EHWA 1SC4B 2UYTA 3UDLA 3C94A 4I6MA 1SL0A 4AF1A 1OH7A 1SS6A 3AHPA 3I0SA 1ZA1B 1WF0A 3S3NA 3GMGA 2AX0A 4LF4J 3PYFA 4H5TA 1NLKL 2ZHAA 3ENVA 1HPMA 3RZAA 4R8UA 4GMKA 2E1AA 4CLSA 1KC8T 1A5XA 5D0EA 3LTOA 4KGXB 4USWA 4JD2B 4CZKA 5BYRA 3PX6A 4UF4A 4BRAA 5LMUK 5CHCB 4CGFA 2D74B 1ELOA 5HBMA 1K0VA 3RW6A 4YDXA 5THWA 3NOCA 2MY8A 2B8PA 1JKHB 1YZ7A 3OJUA 2WC9A 1MWQA 4ES1A 2G1DA 3NF6A 4I2PA 1FTCA 1SVDA 4HACA 2V2KA 4FDFA 3UW1A 1HNXF 3M1VA 1JJCB 1WEYA 2D3ZA 3M6GA 2WFBA 1QAIA 1X9MA 1IWAA 3I4HX 1HD0A 5KTQA 2CJBA 2UUAF 1YJ7A 4B3MF 3JQMA 4LVNP 1QD1A 3DNCA 1DHMA 2CPHA 3SV4A 1N5TA 1HWJA 4WCEL 5F0XA 4E2FB 3IMXA 1XMOF 2FY8A 4XDCA 2I7NA 2OEJA 4BY9C 1IKYA 1RWXB 1ZOTA 5AQPA 2RILA 2XHBA 1VQ4S 5KAKA 4K0KF 4KHPJ 3T6BA 9ATCB 1WUAA 2R8KA 3W64A 2DKOB 4O3RA 2W42A 2E88A 2GO9A 2MLYA 1I51B 5KFXA 1NHKL 3KFWX 3NBPB 1UVNA 3OYKA 1HKCA 4DHVA 2V4RA 2L08A 2HFVA 1EETA 4ZJLA 3K8WA 5MLCQ 3QINA 3MXHP 3OLBA 2CQ1A 1S1UB 3DLJA 3KLIA 2OO4A 2J0SD 1CULB 2XHWA 3SXLA 4HKQA 1E4GT 2DH9A 3D2WA 1CJUB 1SPBP 3H98A 3UKUB 1F3FA 5BR8J 1TKTA 3A8IA 1N0UA 3VF0B 4JEPA 1ATSA 2HNYB 2F63A 2ZC4A 1YVUA 4LR8A 2X6SA 4MDAA 1NSAA 2CPYA 4OI3A 4OLBA 1S76D 3TOQA 4LRFA 4QIEA 1YJUA 1NSPA 3I4PA 3AVNA 3DM2B 5AXKA 5EGYA 1VRTA 2DXFA 5A2QU 1UPPA 4CF2A 5EN1A 1CXQA 1VHFA 2E5HA 4QYZJ 5A2QO 4YUDA 2HBYB 4DZ6A 2EC2A 4HDGA 3BSCA 5KFFA 1OMSA 2VC1A 2IRYA 1YTAA 4LRBA 2ZUAA 3ZO7A 3ZSYA 4DTMA 1WSVA 3M9OB 4WCEQ 2J7UA 3BN4A 5FIIA 2BJDA 1T9XA 4Y0WA 3SAFA 2V4JB 3SUNA 2ZQBA 3WBZA 3LANA 1XERA 3HPOA 3Q8PB 5BREA 3MAQA 3W60A 2UVRA 3KLGA 2AIRB 4HI1A 5ETMA 3ZFVA 4E8UA 5A8KB 2LMIA 2VFSA 3LQVA 2P51A 3MM5A 3GYGA 2L48A 3N28A 1SKRA 3C95A 3CI5A 2XI2A 2ZJRQ 2FBXA 2R7OA 4OX6A 4BREA 3TQ1A 1JLAB 4I64A 2OANA 3MURP 5HL7L 4DSJA 3PY8A 1W2BM 3TAMA 4YB1P 2MQPA 1J5OB 4X66K 3A2FA 1KVIA 3GR1A 3QIPA 3OYCA 4CJ5A 2UVUA 4WK1A 4DPUA 4JI7K 3SPYA 2O1PA 3ENQA 1X4BA 4KBIA 2H1YA 4B3OB 1LAWA 3BN7A 1NUEA 1LW2A 1EIYB 2O3DA 2Q36A 2CG4A 2OI2A 4IO8A 4HDHA 4O23A 2NS1B 1ROFA 1LWCB 4CIEA 3SQ2A 3ILIA 3MFHA 3EX7B 3GZ7A 3G0ZA 4BWMA 4XO0A 4D3HA 3LGMA 2FSNA 2CPZA 2YV0X 4BE0A 3HSJA 1LK7A 1ZM9A 4QWAA 5L9XA 3ITHA 5M2PA 1B64A 3LDOA 5HJXA 2RUGA 4KB0A 3G87A 1T94A 2Y0SD 2PO4A 3R3LA 2NRTA 1EKSA 3VAFA 3W5YA 3IS9A 3G8TA 4JI0F 1NDLA 4CZCA 1FNMA 2B56A 1FJ7A 3KJQB 2WSEC 3SDEA 1N33J 3VEXA 3CQ8A 2LKZA 3IFEA 1C4AA 3BPDA 4WQ5A 1P8GA 1IJFB 1NK9A 3P6YC 1NZAA 5BN8A 2W2QP 2R7RA 2AKWB 1NK0A 1CZ9A 1NMDA 2LEAA 1IKXB 4H5NA 4I9QA 2VFVA 3KOAA 2H5EA 3V9WA 5HL7Q 2Z1HA 1S9EA 1Y5IB 3AAQA 4TY8B 4J5OA 4KBOA 2HFOA 4X62K 2WSFC 4MDBA 4JI7F 5B0CA 1ZM2A 1DQ8A 3KJVB 3GG1A 1GOCA 2RN2A 4U96A 5E3CA 3TZZA 5KFLA 4XH1A 1GMUA 5F3ZA 2I2YA 2JH3A 4DR2J 2RHQB 1URNA 4BRLA 5KFIA 3WC2A 1S5JA 9RUBA 3RRKA 1IKWB 1X7VA 4CT9A 2JDJA 4DR4K 3PSIA 2GJIA 1YITN 3A4TA 4KGVB 4LFCK 1M90T 3AD7C 3QB0A 3X1LB 2MHEA 1JLGB 5HROA 1IH7A 2XWXA 3MEEA 3O9TA 3K0SA 1QVGM 4FPIA 4JI8K 2XMMA 4FLTA 1ZAXA 3JAMY 1RCHA 3KKSA 3VESA 5IC4B 1JQGA 1RNHA 4HUFA 4GV9A 1Q81O 4CZHA 4FKYA 1UZHA 1NK5A 1MG7A 5KFUA 1K8AO 3UCUP 5AQIA 3M2VA 1SCJB 4NCGB 1S1VB 3PCOB 4DX8H 3PW0A 1KKHA 4KO0A 2KYZA 4HVJA 4ETZA 3R5GA 2VB6A 4KQZA 5HK4A 3PXGa 4CZLA 2XSFA 3THWA 1X1PA 4BDYA 4I7FA 3EKUA 3MAAB 4KH6A 4PZVA 4M5NA 3ULEA 1MDUB 2QLXA 3V1RA 3NS7B 2DNPA 4ID8A 4FOEA 4IJAA 2ILYA 1R59O 4KPCA 4DU4A 3GCWP 2QC3A 3ONQA 2IHR1 1VJWA 4A2AA 3ZSQA 3U1LA 2VASA 2KHOA 5HRRA 5DK5A 4NYZA 3DWLA 1HNVB 5LMNJ 5KFCA 5AXMA 1WKJA 1K73O 1NKCA 1LW0B 1EX4A 5AQKA 3O5TB 2F9WA 3SI6A 2R3VA 3FCVA 4IFVA 1SJ3P 2BM1A 4OVLA 5T41A 2B51A 2BABA 3RMCA 3NGKA 4YR0A 1VJQA 3VVUA 5JVGL 2XMKA 1LV5A 1IBMK 3DDIA 4CDIA 4B08A 1RBUA 1TL1A 3O8WA 4IH6A 5KT2A 3J80U 3WDOA 3DLBA 5DM6L 4FPRA 3SMZA 3MMCB 1JK9B 3EN9A 1J27A 3VQ6A 5D4OA 5IWAF 3T1AA 2DHGA 3D6HB 5AQHA 2HZAA 3OFGA 3CMEN 3QJPA 1UW4A 1RHRB 1HNZF 1FT8A 3K0JA 3QBWA 3UN5A 2F4VJ 2BKOA 3HM9A 5DS7A 2PA8D 3MECA 1MU2B 4A59A 4RWTA 1NJXA 2DEIA 1VSLA 2EC0A 3IG1A 1H6KX 4LF4F 1VSMA 4Z4EA 1U45A 3E2EA 2FZKB 4FJXA 1VISA 4F4KA 1ZBLA 5IV3A 1OO0B 1S0OA 2G0JA 2AYGA 1VYAA 3LWMA 3UN2A 3VQ8A 5KT7A 3DLRA 3UN3A 3CXCR 2OPSB 2IJFA 2W25A 5JVHL 4L72B 4XH5A 4PG8A 2YBVA 3RVCA 3D0IE 4RW4B 3SQ1A 3LM9A 3NF8A 4JI6J 2AEJA 4S0MA 1KAXA 1IBMF 2FGOA 3Q8QB 5JVGQ 2PEBA 3WHIA 3CM6A 2R2RA 2ZE2B 3EE3A 3BO3A 1TKXA 4LIWA 4G9ZA 5GAHI 5CZXA 1WC0A 4PXDA 3SQOP 4FPAA 4M63A 1YJNN 1LFPA 1FK9A 3OTDA 1S4FA 2RE2A 2Y9HA 3VA0A 3LAMA 1F60B 3Q83A 4CFCA 1Q5VA 3M32A 2XNQA 3IGVA 3EDRB 3HP6A 2CADA 1BCMA 2I1RA 3SSQA 2ZZMA 2ZJQL 2G8KA 2MSSA 1WSHA 4BC2A 3L4BC 3C6HA 4FWKA 4L3QA 4RW9B 5K5MA 4M5KA 2KH9A 4KHPF 4G1QA 1AZSB 2CJAA 4AL6A 2FF6A 3VTIA 1T05B 2BW2A 3V4MA 4KGZB 3R27A 4LIRA 3VWSA 3CIPA 1KCFA 4FCYA 2IMOA 3E01A 1ZAWA 1FDDA 2G4BA 3KWIA 2VL1A 5KFZA 1PCAA 3L2WA 3G71N 5JICA 2OZMA 3BGUA 1GLDG 2XSJA 5GINA 3AVLA 1KD1O 4HH0A 1IUJA 3OTBA 1TP7A 4NLRA 2DH8A 1HNWJ 5BR8F 3EYZA 2RVJA 4R5PB 3ZZPA 3A3PB 3ZCMA 1J2VA 1NDPA 1HIYA 2GV9A 4ILLA 3NDKA 2JWKA 3HK2A 4CESA 3MWTA 3SBGA 4OPKA 3NY0A 3ZX3A 1RTIB 2KRBA 4FNIA 3P4UB 2RU3A 4BRFA 1E6VA 4P74A 3V6DA 5KG3A 1KTVA 1B7FA 2D7SA 4ED7A 4DR7K 1P1TA 1U2FA 4O3NA 3D0GE 1C1BA 3HI0A 1PYTA 2YQ3A 2HNZA 4C9DA 5LL6d 1ILYA 2IM0A 4UY8T 2UXBJ 2ZJQQ 1BWEA 1RAOA 1REGX 2CA9A 4DPXA 2WOMB 2ZBQA 4JKFA 3CC7S 4FLWA 2JLEA 1HWKA 2CFXA 1QDUB 3SEOA 4LF5J 1DFDA 3AY0A 3IBCB 4BGAA 4FJHA 3QSYB 3SQ0A 4X4VA 4E19A 2QW9A 1Q9YA 1FXRA 2IPOB 5D0RA 4LH4A 2O5DA 4ZLNA 2FVRA 1NGAA 3C66A 4OLOA 3T69A 2DEJA 3UVJB 2G1HA 2V69A 1RA7A 4TVAB 3MM8B 1U1RA 2H4YB 4AXIA 3T19A 3PJWA 2DTUA 5ETPA 1G2EA 1F9EB 1F0XA 1DURA 4CJQA 1KSPA 4MLEA 2QYGA 2XCPA 2P9PA 2CQ4A 3BDEA 3HHEA 5AFUA 3V6JA 5J2NB 3RBEA 3ILLA 4ZITA 4KHSA 4BS2A 1U1LA 3DMJB 5F3TA 5I3PA 5FLXU 4F02A 4FF1A 3HX9A 3WIVA 4YY3K 5FLXO 3OV7A 3F2KA 1S3XA 1RT3B 4AUKA 4CFAA 5K8NA 4DTPA 4OLPA 1MA9B 2POKA 3PR5B 4CLZA 1Q82O 4J91A 1S72S 2WTUA 3HHLA 3CCRS 2A42A 3NH2A 2I5JA 2VJVA 2CVIA 3I0RA 1ASUA 1MROA 4CK2A 4GVBB 2VWJA 1HD1A 1AA1B 3W9HA 3U1MA 3KDOA 3TSUA 4V19X 1ASWA 2JGUA 1VQ5N 4BR7A 1JLEA 3GWCA 5CYMB 1N33F 1UW9A 2HFUA 3NS5A 2XS5A 2XG8A 3IWNC 4KAIA 1CXUA 2VG5B 2GVZB 4PAAA 4DR1K 3UNGC 2KM8C 4KV8A 4JI4J 3DRPA 2A41A 2XYGB 2IAJB 3VA3A 2RH3A 3SAHA 4QJVA 2XC9A 5HP1A 2GEMA 1H3DA 2B9WA 2RU9A 1ZS6A 4JI2K 4CJPA 2ETJA 3O4NA 4V19S 3R6GB 2Z30B 5HQ8A 1IM4A 4OPJA 1RDBA 2VG7A 3BR8A 1U49A 4YOTA 4DR2F 2FLPA 4CCHA 3D2FA 3GG4A 1E3MA 2BJ7A 1GK8A 1N5YA 1RAJA 3R9LA 2ASMA 4YY3F 3BKTA 4WE1B 5I9EB 2OJ3A 2FVPA 4BLGA 1KQSR 1MN9A 2XZTB 1PJ7A 3UR3C 4U9RA 3JS9A 3AJDA 2UUBJ 3I31A 1WSJA 1HMVB 4B3RJ 3FUYA 3ZXWA 2GMLA 3RGIA 2B43A 2V7ZA 1VLYA 4P9SA 5FDLB 2PSZA 2OPQA 5BRFA 4C2MA 3CETA 4BC3A 5HQLA 3OVAA 4WPAA 3QBCA 3DRRB 3C14A 1RTDA 2CAJA 2HBZB 3BBBA 1U1PA 3UB5A 2G13A 2GNKA 1HYVA 3HVTB 4DL3A 2RD5C 2O8EB 5TKWA 4X62J 4BRPA 2MZ1A 4A8XA 4ENOA 2R7QA 1FD2A 5CZ2A 3TX8A 4A57A 4ID1A 5AZJB 3HF5A 1TKZB 3PG9A 4KGKA 3A1YG 4ZPCA 5F8JA 4K5RA 4ZLJA 3M2RB 1VQNN 5DJBA 2V50A 4USTA 5HATA 3FJ2A 5LMNF 4JI2F 2OMOA 1VQMS 3MX5A 3FFKB 3GFYA 4JKBA 2E44A 3CCUS 1RTJA 2QTWA 1T3NA 4DQIA 4U67L 2BBEA 1RTHA 3KZBA 1QHAA 2E1ZA 1NAQA 3UPFA 4J8FA 1CG2A 4FLVA 2ADBA 2YWHA 2FF3B 4KH4A 1Y11A 2A0FB 3F73A 5AQFA 3EMTA 4CO3A 4ECVA 3DLGA 2DNHA 5T7LA 3W8GA 1RKJA 3KHGA 1TKDA 2GMJA 1AW0A 2E20A 1FJCA 2EK1A 3EEQA 4M45A 3DOMA 4Y2KA 3ZT3A 3RSEA 2CQ3A 2J0QD 2F4VF 1YZ6A 1S59A 1A5VA 3VZIA 4TU8A 2YWWA 2FHOB 3TAFA 5E0OA 3MUVP 3AVFA 3FR0A 1N34K 4HT5A 2IVMA 1TV6B 3LAKA 2YKAA 3HFKA 3D66A 5M1KA 2UXCJ 3QT7A 3MMAA 3UD5A 4DMZA 1GLCG 1LKZA 2B9EA 3MD1A 2DNLA 1Y64A 4NLBA 3WEEA 4BE1A 4MIBA 4CF1A 1IG9A 3KK3A 3GIKA 3MPDA 1QZ6A 4AHRA 1UTAA 5B0DA 2DNZA 3NOGA 1RBAA 1LXJA 1HHQA 2LA4A 3IR5B 3G6XA 1V5VA 2WBMA 1LEOA 1D9DA 2X74A 5LJ5Y 2M2BA 4RLEA 4X4PA 2VDIA 3TSQA 2GHPA 4C3KA 2Y8WA 2W9AA 1RT6B 4OHXA 1HI0P 1J6ZA 1UL3A 2CQ0A 3V1OA 4H5VA 2R8GA 4H4OA 3LGNA 4BR0A 4JI6F 2RNEA 1LNQA 3S6EA 3O3HA 2FHJA 2MQMA 4F3QA 4RBTA 4DSIA 3SSRA 3K2YA 4H0PA 2IGIA 4U67Q 1VQ5S 1IBKJ 2KFZA 1VQON 5C25B 4W5QA 3OYIA 2BOAA 4LF6K 4ECUA 1NHVA 4ITSA 3OXFA 1RISA 3JSMB 2ZOGA 4KHWA 5IFMA 2F40A 3P96A 2XLIA 2DH7A 1M1KO 4C11B 3BPSP 5DDRC 4C4WA 4F4ZA 5KQDA 5KPTA 3NFAA 1UVJA 3ZZOA 3M8SA 2HQFA 2JWLA 1IXKA 1N34F 2OTLS 1FRHA 5J1EB 3LZIA 1K1SA 2MJNA 3T6JA 1NNDA 1TR0A 4MH8A 5J2PB 1URRA 4A5AA 1CBKA 2EPIA 3KLFB 3K59A 4JOUA 4DV0J 3CJ7A 1HW8A 4R25A 2EBGA 2K1RA 1KBRA 1BWVA 2HKEA 3BKUA 1HBMA 4CEDA 3L2QA 4ECSA 3TRGA 1HRHA 1SZ2A 3A5OC 4DS4A 1NM2A 5A0YA 4ED2A 5F9NA 2EI5A 2Q79A 5B0GA 4OYAA 1N5QA 1G1XA 2WAQD 3CCJS 1TUGB 3VF2A 4OYMA 3I32A 5JXSA 3I56N 3WX8A 3W5XA 1XNQJ 3RJMB 1HNWF 5DG8A 3FZBA 2DTJA 5AQNA 3DAWA 1RLCL 3TWHA 3NHGA 1BLUA 5F0UA 4LF6F 3S7RA 3G10A 1S1WA 1Q78A 3M8QA 1SQFA 3NMRA 2FC9A 4OKKA 3VQQA 1N8RO 2IBKA 3D5MA 4ID5A 5BRHA 5HLFB 3GONA 1RABB 4ECRA 1OIAA 4LF1A 4CEFA 4ZKAA 4WTYA 4FWMA 4FYVB 1VQNS 3RR7A 3L4IA 4E7KA 3QIDA 4GKJJ 3RUBL 3OTEA 5DZ6A 4CLTA 4DMNA 1KDNA 3TARA 2W41A 1YG0A 2J7KA 2QGFB 3KWMA 3HSDA 2UXBF 3PVXA 4RBUA 1KOHA 2NLXA 2BRLA 1U1MA 3M8YA 2RS2A 4H0VB 2YNFB 3IBWA 4XEIA 3HFVA 4LF5F 3EGNA 2BJ1A 5GMKa 3CIZA 3H1VX 3RG6A 2CGJA 1XC9A 2HAIA 1SJ1A 3V4IB 1S6PA 1U2VA 1I3OB 4L75A 4IG3A 3GV5B 2ASJA 4ZHRA 2OLWA 1FA0A 2DIVA 2DNGA 4CW7B 3AOAA 3Q23A 1XMQK 3S3MA 3KD5E 4IUFA 4NLXA 1R27B 2I0XA 4CO4A 4NA3A 3QO9A 1ZTTA 2HG4A 4UTGA 3VQBA 4Z37A 3R6LB 5EWFA 2GIQA 3CCMS 2D0OA 1HBNB 3AVGA 4ZLPA 3GV8B 4B3SK 2VG6A 1S9GA 2K8GA 2YHAA 4FK4A 2LCWA 5ADXA 1NM1A 2GCFA 4A47A 3VAHA 4F9OA 2HVDA 2CNLB 3R2DJ 4JRQA 3HHLC 4IG0B 4M5GA 4XDDA 2PEHA 3CCLS 3ZSXA 4A61A 2IRXA 4XAKA 1U04A 1FRIA 3LP2B 2BR0A 1RT4B 3AA8A 2MQOA 3C7NB 3JQKA 3M2UB 2D9PA 2LQJA 3BREA 2DRAA 3TJAA 4B3TK 4DPTA 1BO5O 2YNHA 4LF9K 1WD6A 4UOCA 2Z56B 1JXVA 3D1OA 4AL7A 4YN3B 1MW7A 1S7IA 1A0OB 2ZNYA 1N6QB 1VSFA 4KH0B 1D1UA 2ZUGA 1SQKA 2YKOA 4F67A 1BCOA 4OYXA 3BP8A 4OO1J 1RCOB 4OKEA 1DTQB 5GAGI 2JEGA 4TY9A 5E7OB 5IT9U 2FVCA 1YI2N 3SSSA 1FKPA 3W2VB 4WYWA 5KFMA 2V8PA 4DTUA 2R7XA 1K8KB 1JCGA 4HYKA 1QSLA 3JTOA 1XMQF 4FWRA 4WK3A 1OH6A 4OX8A 2YJFA 1GLAG 4JI4F 4KHNA 4MK7A 1GLLO 4WXWA 3D6TB 3C0BA 2W40A 1R8PA 2Z1JA 3IM8A 4WTOB 1BD6A 1S10A 5J2MA 2P9NA 2PY5A 1WEXA 3TAEA 5FD1A 4B3SF 3OHAA 4JKAA 5KG2A 3G96A 1YHQS 4J9KA 1SKSA 1S1TB 2HHHK 3CT9A 3NGZA 1BI4B 3B4MA 2XO7A 2YKMA 2N7CA 4BRMA 1KC8O 4K7QA 1RBSA 5DG9A 1CQNA 4B3TF 1OWXA 1T9TA 3R5DA 4PG5A 3AOCA 4DV4K 5T14A 3CJKB 3I6PA 2UUBF 5GADP 5LXRA 2DNQA 1T44A 4DN0A 2RAQA 2XLKA 3NKYA 3LP1A 1AYEA 2W9CB 3M6UA 3D1HA 3MCMA 2AWZA 3Q2SC 3FZFA 2VBYA 3HVAA 2DY4A 4DV2K 5JMVA 1KQKA 2HGMA 4ED8A 1ATRA 4H54A 5A2QY 2E6MA 2AMCB 3O4QA 3P38A 5E3QA 4NZ6A 4HUEA 1Q9XA 2D5RA 2MTLA 5CQGA 2OFHX 4NRTA 2GV1A 2EFQA 3CDBA 1KFSA 1J53A 3W5ZA 4WZMA 2LLZA 2XNRA 1K1QA 5C42A 4DV1J 4OZ1A 3HD1A 1LWEB 4IDHA 4P75A 2W4CA 4QIGA 1W26A 1X5PA 4KYZA 3HI9A 1VIOA 3TZYA 1FXLA 5L9NA 4HR2A 1QJHA 4CTAA 3G9CA 2IM1A 3FSXA 4WKYA 4ZVTB 2YWGA 2ALYB 4JS4A 2BA9A 3OYGA 3NF9A 3HT3A 1VQLN 4Y0FA 2MKIA 3DRSB 2DBBA 1JLBB 2I6WA 1H2TZ 4CRJA 2ZKTA 2O8DA 2CPFA 3T1YK 2E5IA 2OA8A 3B4DA 1S77D 2ALZA 1CJKB 2LYVA 8ATCB 5F2RA 3QAEA 1T3VA 5KFBA 2NUUG 3X3UA 1FO1A 5GAEP 1T9VA 3EE9A 3CJ3A 5HMWA 3FC9A 1KRPA 3VGVA 2H4WB 2W9BB 3Q89A 2X3DA 4KKOA 4O44A 4QQBA 2CQIA 2NCKL 4B02A 2E1RA 1ZXOA 4WJBA 1L5UA 2O8CA 3H59A 3M7VA 4QAGA 2UXCF 2DR9A 1RAHB 4Q0BB 4OHZA 3EKSA 3K5PA 3CD5A 5AE3A 1WSFA 3DYAA 4ED3A 4ZP9A 3ISND 3AVCA 2CQCA 4A8QA 4NEZA 2VKRA 3H20A 4YDUA 1NH7A 1FX4A 5AQGA 2L9DA 3S1TA 3MUTP 3AB4B 4KFBA 1QUVA 2RT3A 5C15A 3I8BA 4JKHA 1QSSA 4C8MA 3C65A 3EY1A 2V8GA 2IM3A 1E4FT 4ZJQA 1NGHA 4X4RA 3P5JA 3FBCA 1NJIT 3B8HA 4L73A 3K89A 1QQCA 4HTIA 4CWBA 3HVWA 3WQTA 1Y9OA 5DGAA 1VDHA 1Y00A 4QR2A 5IV4A 1RADB 2F8SA 4KB7A 4QCLA 1QTMA 4B1ZA 1HW9A 3M30A 5HVFA 4PY5A 1MWKA 4IOCL 2WONB 1IBKF 1ZBFA 1SKWA 4YHHJ 4ANDA 2XHCA 3K57A 4J2DA 1V3ZA 2ZM6J 3TZWA 2VOPA 4KHQA 1VHIA 2KJWA 3OL9A 1OS5A 1KONA 4JHDA 2XMWA 4OI0A 1RU1A 4WIQA 2NZCA 1F5CA 2P9KB 4PYAA 3JYTA 4NX9A 4GMJB 5KFVA 2DD8S 3THXB 4HTLA 4CD1A 5AFUH 2DGQA 4NZ7A 2HGNA 1XJWB 4LY7A 2R7YA 3OS2A 4IFYA 1DARA 4WP3A 3DU6A 4I4BA 3VF4A 3N4PA 3M6XA 4BR2A 2ZH2A 3U6FA 3CF5Q 1DAXA 5AQWA 3UE2A 4BHQA 4DF8A 2WVFA 4RW8B 2PBDA 4I6MB 4WFYA 4M7XA 2RKIA 3PW2A 4WXOA 1SC3B 5I3QA 3N4QA 4MTPA 2X3GA 3WNEA 2MYFA 2GVDA 4DX5A 2XY5A 4BG9A 1VC5A 2WW8A 5AQJA 3SBTA 1NB7A 1UWBB 2AX1A 3OR1B 3FGUA 1XNQF 1TL3A 1H74A 1SH3A 2C3YA 5CH7B 4UT4A 4R8UB 4FOIA 4O8UA 1N88A 4PR6A 5B0EA 3C16A 2V52B 2A2CA 1ZZFA 3IBFB 3S41A 1HI1A 3KG0A 2RHKA 1FRKA 4C97A 4Q7AA 2A5XA 2G8WA 1YT3A 3L7PA 4L76A 1X9WA 4K8ZA 3CCZA 1NK4A 3H4BA 1JXEA 3NNHA 5D4PA 3L0QA 3VAKA 5HMXA 2VGMA 2ZGYA 2JX2A 3SJJA 5FRNA 2C2OB 2VBZA 3WZ0A 5EWGA 1BC6A 4M3ZA 4GKJF 4I2PB 2DHXA 4M42A 5C2CA 1VSEA 1QAJA 3M8PB 2OAUA 4AQYK 2EFNA 1Q8BA 4LFBJ 1PC4A 3QZ8A 1X8DA 4RWWA 3J80Y 4JV0A 2LQ9A 1HNIA 4PUOB 3C2PA 5GAHU 4DHYA 1EXQA 3DXKB 3UKRB 4F4XA 1DRZA 5DDOC 1NK7A 4M8LA 3R6MA 3CFPA 3V6HA 2QA4N 2DJWA 1M90O 1GX6A 2KHCA 4PQAA 3WT0A 1RDAA 3HLUA 3ZSOA 3FZ2A 2HSEB 1HX1A 4GW6A 1R0AA 4EFHA 3VR1A 5C24B 3CC4N 2DGXA 2XS2A 3SJHA 2W1BA 3HCXA 3CQXA 3VV2B 1JLFB 3U7JA 3NGYA 2UVVA 1TTHB 4B9LA 4HUGA 1N4LA 1SUQA 3QPIA 4QPXA 1EO1A 4JYAJ 1NK6A 2CRLA 3CNQP 3PV8A 3TEHB 3R1LA 3IN5A 4JI1K 4IH5A 1U1QA 2OZSA 2OSRA 1FFWB 4B9SA 2MJUA 1U02A 4OGEA 1YJ9S 4QZVB 1PBAA 1NGBA 1BQXA 2CZVC 3RWUA 3Q0AA 3LP0A 3FFIB 4H4KC 1QQNA 3AOBA 2HBRB 2PAVA 2F3JA 3QGPA 2QG9B 3EZOA 2VPWB 3VGKA 1EJ7L 1H2UX 3PJXA 4AYBD 4RUCA 2OPRB 1W7AA 4BRGA 2KT2A 2ZZNA 2HNDA 2NYHA 1Q0NA 2EWHA 2QYCA 4FK2A 2Q3PA 1QS4A 2CJKA 1FHTA 5KGWA 5FROA 4JKGB 1RWVB 1TK0A 5IZHA 1B9DA 1R6VA 2DR5A 3LUYA 3BEXA 2UV8A 2GHVC 3KNGA 4OQJA 1YVFA 2CH6A 2X1GA 3P39A 3CCSN 3BKFA 3CW2C 4CJWA 2HBQB 4CJEA 2AV5A 3QT6A 3OS0A 4JD2A 2P9LB 2IOCA 4ZS6A 4TLQA 3ZLJA 4TU7A 5L1KA 2BXJA 5KG1A 3MMBB 1XUPO 5AJ3J 4JI1F 2DRDA 2YQ0A 4P7VA 4QWEA 1X5SA 2YWEA 4DUTA 2HZVA 1J5EJ 3A8JA 2R8HA 1UMJA 3MF5A 3ZT0A 3NWGA 1G6BA 3MXJA 5HMZA 3C46A 3ALYA 1D4XA 1EWQA 4XPEA 1OY9A 1LWFB 3NNAA 4YFUA 4KC5A 4BR9A 4M5MA 2IIRA 1FJGK 2KYXA 5GADU 1U2CA 3H3NO 2E4LA 3JXUA 1KVKA 3MMVA 1X60A 3I55N 3NCQA 4J9QA 3RR8A 1QM9A 3DC2A 3GYXB 4OX9K 2QX0A 4ZP8A 2QSFA 2HHSA 2AP1A 4W5OA 1P8ZA 4TKTA 2H5JB 3HT0A 1U6FA 2PN6A 3G8SA 4PL8A 1FRXA 3NGDA 4DV1F 5KFAA 5EXWA 5IT4A 4PQUB 1JMTA 2DFHA 1Q5YA 1QTNB 4ZVEA 4KT0C 4N41A 3ITHB 2NSCA 1MMDA 3VQEA 5I3UB 1VIXA 4H0YB 2ZH9A 4JBCA 4P2MA 5LJVA 3THPA 1WDDA 4BRCA 4KSEB 3Q8UA 4P2FA 2QXFA 2HVZA 2B6AB 2NUHA 3NBPA 4GV6A 4DSLA 1VQYA 4UW2A 2YI1A 4L74A 2VWBA 1HWUA 3FVYA 2W24A 4WFAL 5F1XA 2LQBA 5KG7A 2EWSA 3OTOJ 5A6WA 4HEA9 4AHCA 2XZDB 3WX4A 3J7AN 4DR3K 5DM7L 3RU0A 2JVRA 3G6EN 4QS9A 5CAAA 1S1UA 1BIZA 1EWRA 3ZC4A 5H9FK 3IRXB 1CULA 1VLOA 1CJUA 3UKUA 2KRRA 3Q8VA 2ZBIA 3J7ZT 4F2SA 3MM6B 4NLCA 2HNYA 1WTFA 1YJWS 2O4GA 1YSJA 1UJ5A 5GAEU 2KXFA 4M5DB 4YDUC 3CCES 5B8HA 4ILGB 4JS5A 4ISGA 5AQLA 2KM8B 3DM2A 2VQFJ 5FLXY 4NLUA 1B70B 4QPTA 2GFFA 4JV5J 2LXUA 3V1QA 3AY9A 4PXCA 2QLFB 4A8WA 2M5YA 2F9DA 2I8EA 2E6LA 2V0NA 4H5WA 1RAFB 3CGIA 3NE6A 2KVQE 3FEZA 1Z2LA 2LFVA 4U95A 1HQEB 2L3MA 4I67A 4ZIWA 2UXDK 4GC7A 2V4JA 2F8EX 4CFBA 4EMDA 4CHZA 5IC6B 2KHDA 3KK1B 2E5JA 3MGJA 4AD6A 5GMDA 4N5SA 4UY8O 5A8KA 3RMAA 1VSJA 2FD2A 1T11A 3T5LA 1VQ8S 3VERA 2CNOB 5LXYA 3ULEB 3R5JB 2GHWA 2DITA 5MAOA 2IDOA 1G7CB 1JLAA 4KTWA 2MKHA 1X9JA 3JB9k 3VQPA 4NXMJ 4WFAQ 1FWKA 3MWPA 4DQ8A 5A76A 4YHHF 1MMLA 5SZTA 3R5AA 3IGNA 2EFGA 2YPZA 5DM7Q 3FDSA 4ICLB 3H2VE 2Y1LB 4M5LA 1J5OA 3JSRA 3VEWA 4LFAJ 5BYSA 4BVPA 3FCWA 4F4YA 5K20B 4FYYB 2B9YA 3M6WA 2K7KA 2C28A 3PEJA 4JLHA 3AVMA 4DUYK 1Q7LB 4MIAA 1HBUA 4B3OA 4FYWB 3SV3A 3D6MB 4GRSA 1TL1B 2Q43A 4CGDA 4GY2B 3QEXA 2Y1JA 2LSNA 4BRNA 1A5WA 1R43A 5ADXH 3SLCA 5GIOA 2P6TA 1LWCA 3M5RA 3IR6B 3BYRA 4X65J 1WAFA 4CEBA 3UR0A 4A46A 3O6WA 3DU5A 1TFWA 4FLYA 4QIVA 2Q6BA 3IO1A 2E7WA 5LJ3Y 1VFJA 4F25A 2D1KA 4OV1A 4J9UE 1IBCB 3OVNA 3H8YA 2IDLA 1KVBA 1TK8A 4C8LA 3KMSA 3OVBA 2RSQA 1JWWA 1RXOB 4LBHA 5DETA 3DXMB 3ZZ0A 5J1PA 4ZLLA 3MCAB 3MEGB 4USHA 1FERA 3DLEB 2W4DA 1DKGD 4MQ3A 4M3UA 2XY7A 2LU1A 2YHWA 1VRQC 2HYIB 1XR5A 2B5JB 2QIFA 4Y28C 3HMJG 1IKXA 1YRUA 1S6QB 3HYFA 3SMSA 5BJRA 3AVKA 1FEHA 1Y10A 2C3MA 3TA0A 4FJMA 4KREA 1I5OB 4TY8A 1VCTA 3GPAA 1C6VA 1RAAB 4USVA 3KJVA 2DNKA 2QEXS 4DUYF 3E1YA 1L3VA 2BJ8A 3HZEA 3TUIC 2DGVA 1KHWA 4DV5J 4EWTA 4DTOA 3N6MA 5KFNA 1CEZA 2D0AA 4LFBF 1KS2A 3EDQB 1IQZA 2IMWP 3OHBA 4CZIA 2D69A 2UUCJ 1HR0K 4C23A 1JLGA 2MKKA 1B99A 1FK9B 4DU3A 4I6AA 1IBLJ 2E5LK 2V67A 1IR1A 3QT8A 4H5RA 3THTA 4BG8A 3WQUA 3OUYB 4HCBA 2OMLA 2BE7D 1NPRA 2BGGA 1GXLA 4YOUA 2FHMA 3CJ4A 3QGIA 4NCGA 1S1VA 3D7SB 1TUYA 2R2UA 1RZMA 3HSCA 3IAM9 1U09A 2PMWA 1YKWA 1IVZA 4I0WA 3MAAA 3AAPA 2DNOA 2P9IB 3U4LA 1WHYA 2WW4A 2Q6CA 3QNWB 3GJQB 2LU2A 1WBBA 2UU9J 4JYAF 1J54A 3ICLA 3GYNA 1D0EA 2OIHA 3VGTA 3QSIA 3PO5A 2CNNB 3N5BA 4USIA 2FLNA 4GV3A 1HNVA 2F8HA 1LW0A 1U48A 1OH8A 5JJBA 3UFCX 2BM0A 1WI6A 4DCOB 3MR6A 3CJ1A 4DPWA 3RW7A 1U25A 2CQDA 2BMBA 1DGKN 2V63A 4O5BA 4BRDA 3V6KA 4OJGA 1FDAA 2CQHA 3HSGA 2RRNA 2KTQA 4DG1A 2VUGA 3M8WA 3OY9A 2K3KA 1I1GA 4L8RB 3RAMA 4BACA 2PMHA 4Y2AA 3J7YP 2FHKA 1B0VA 1N8RT 4GKKK 3MMCA 3HOTA 4CGIA 5F8NA 4B17A 1ZZNA 4DV7K 5GVQA 2HVIA 1E6VB 2GMHA 5KFRA 5KFHA 1NWKA 1UWAA 1C0UB 3CFRA 3LH2S 6FD1A 5FPMA 2WCXA 1C0TA 4EBDA 4IJNA 1MU2A 3E9LA 3KD1E 1IV0A 3CE8A 1XQIA 3T41A 4M5JA 1PKUA 3AV9A 1HJOA 2B9XA 7FDRA 3P8BB 3A8KA 5J2QB 4X64K 1VQ4N 1UEUA 3UWTA 3QETA 2C42A 4DV6K 3R7NB 5FJ4A 4CJKA 3FEYB 4USUA 4O3OA 3ZZRA 4PYDA 3QEVA 1RHKB 4URSA 3HKZD 5F8GA 3CSKA 4UY85 4IRDA 1ZBUA 1JJ4A 1B92A 1PAEX 1HBOB 4JI3J 3CWJA 1QQOA 2OPPA 2YKNB 2OPSA 2RDIA 1JJ2M 2J76E 4R0EA 3NGRA 3JXOA 2P9GA 4O55A 2HHUA 3GFHA 3RAQA 4RW4A 2P8IA 3IDHA 2CPXA 2CIMA 3Q86A 4LJMA 1Y5LB 3D6RA 4TQSA 3RTVA 5IQ6A 4JAXA 1RWKB 4HHJA 2ABYA 1T0TV 2EVZA 4MK9A 5AQUA 1RILA 4EEYA 2NREA 1RYRA 1FFGB 2ZE2A 4ZMMA 2ROGA 2ZBPA 5KFEA 2L9WA 3C15A 3HSTB 1D09B 3CJ8A 3VEVA 1HWLA 3NCRA 4NWBA 5FPDA 2RE1A 2VFTA 2O8FB 1WC3A 3KLEB 3MMJA 3I82A 2AHOB 3MZIA 2YXLA 2QI2A 2KZMA 2MGZB 5IM0B 3K58A 3OYFA 1JLCB 1YRTA 4E1MA 4J9RA 3T7ZA 4OI6A 4DTXA 5KFTA 3KLVA 1WLJA 2C2RA 4RW9A 2MSTA 2F65A 1JJHA 3HHLB 4CJSA 1AZSA 1M5KC 4X4UA 2I5JB 3GIJA 3CD6S 1T05A 3Q7BA 1ICEB 1GTEA 2M52A 1WSEA 3DLHA 2GIRA 3L3VA 1NGIA 3OBYA 4MYTA 5HMYA 5AXNA 2Z2ZA 4Z0UA 2DVIA 2M8DB 2DY9A 1NSKL 4M3XA 3DHXA 2R4FA 3IUCA 4DUZJ 3OTOF 5GAGU 1JNZB 4ILRA 3OJSA 3SUPA 4BR4A 1U0HB 2R42A 2UUAK 4HI2A 4B3MK 3AFGA 4Y00A 1U1OA 1RYSA 4WFNL 4RPFA 4BBYA 5KFJA 2CGKA 3AGKA 3PHTA 1ZBIA 4CK1A 4PKIA 4R5PA 5B0AA 2G2OA 1XMOK 3V9UA 4OGCA 2MZJA 4AHUA 2H51B 2HQGA 2HK2A 4ECWA 4K0KK 3ZX2A 3MTKA 4WFXA 2VQFF 4PKDB 1BDGA 5I42B 1VQ7S 3AJ2A 2IYGA 2IYIA 4JV5F 3F5TA 4MKVA 3GSDA 1TQLA 3AA2A 2RDJA 1NGEA 3CCWA 4PG6A 3L2VA 4WIIA 2DYAA 3D0PA 3GE1A 1APSA 4J7CA 3CDAA 1R31A 2R7VA 4Q43A 5F9LA 1OQ3A 5CZVA 1L3UA 2YHBA 1JLQB 3H5YA 2XRIA 2PC6A 3NF7A 2PYJA 4LF8J 1VQPS 4FBUA 4YB5A 1ZH5A 1CSJA 4K5SA 4H4MA 4FJIA 4UZCA 2KFNA 4ECXA 2AJ4A 2H5IB 3DOKB 2KKZA 3CD7A 2D9OA 2JFKA 5IT9Y 2PFUA 2WBRA 3N79A 2ACYA 3HD2A 4NXMF 4RZRA 1JL2A 2RJZA 1RU2A 3UVJA 2XMVA 2H54B 3MM8A 3UDVA 3W3DA 2MZRA 4PKHA 1TL7A 5B7WA 3K8VA 4WFNQ 3THYB 1RTJB 3GB0A 2QL5B 4F4AA 5J2NA 4CGJA 2YCHA 1XEZA 3MDFA 2M0GB 2PD1A 4OZ0A 2Q66A 2AA4A 4CHNA 5HO4A 2P9SB 4FWNA 2HHTA 1A9NB 4P52A 4J9OA 2ZJRL 4OYWA 4PEOA 2JC1A 1OY8A 3W9IA 1RT3A 4X65F 1JCFA 4NOHA 1IR2A 2EG2A 2ITMA 3QYYA 2DPIA 3J7AP 1T8EA 2MZSA 1FESA 2LXIA 2BDPA 4ERDA 4O4RA 2DFFA 1Z26A 4AM7A 1CQMA 3ZETA 2ASLA 2OD4A 3BYPA 1CZBA 2J9DA 3ZZTA 4ZVHA 4K8XA 4DQSA 4GVBA 3QDKA 3OYDA 3O08A 5AZIA 2ZOMA 1P6TA 4DFMA 3MMAB 1RBVA 3OW2M 3FZKA 3RB6A 1Q95G 5CYMA 3QFPA 1FRMA 3JTPA 3K5OA 1K9MT 1XNRJ 2V6AA 4CIFA 2VG5A 2GVZA 3KK3B 4IWVA 1O6XA 3R7BB 4A4JA 1NO8A 3EICA 3UDCA 3AVHA 2IAJA 3CVKA 4KIAA 4EU0A 2FBTA 4Y2MA 1KQFB 3V9ZA 1YTYA 3CJAA 4WFBL 1RT2A 4GVMA 1X5OA 2GQQA 3SBMA 1V5IB 4F4WA 2P9UB 3H90A 2IM2A 4LR7A 3WUHA 2HIYA 2ZH8A 4I68A 4HWIA 4WE1A 1IJJA 3TU5A 2D3OR 4EBCA 2VQEK 1U6BA 2E9TA 4JI0K 2GWJA 4FWOA 3MPVA 1UFKA 2BJEA 3OFFA 4CP5A 3AAWB 3BR9A 3M8RA 2R7WA 2A1BA 2FJAB 1IBLF 3AA5X 2HS3A 2WVDA 5HQMA 1HMVA 2CQPA 2FGCA 2XS7A 5FDLA 3GV7B 1WC6A 2HOEA 1OYDA 2HQCA 3CD0A 4QWCA 3ZSZA 2V94A 1KAZA 3EL2A 5EY4A 1C1CB 2D3UA 1SJQA 2AJFE 1NRKA 3O1WA 2ZH6A 2K1RB 3HVTA 2O8EA 4DR5K 3CHWA 1I3AA 1WC5A 3MN6A 2R2TA 1BGXT 2CJQA 5F8HA 3CIMA 3I5CA 4I6WA 2YNIB 5JS1A 2QMWA 2XMJA 1ULRA 5AZJA 1TKZA 1VK3A 2BE2B 2CWKA 1Y0HA 3VQCA 4YOYA 1N36J 4KJIA 3JSYA 3W62A 3AJ1A 1GOBA 2Q97A 2HRUA 1P9YA 4ZPAA 2CDQA 1D8ZA 2C3UA 1RWWB 4Y1DA 3SCKE 1TVRB 3GBTA 5B09A 4FK0A 3F44A 1WOQA 4A2BA 3CJSA 2J8AA 3BO2A 1FF2A 1VC6A 4WFBQ 4WQ4C 3KDNA 2FVQA 3GTYX 2OTJN 1K47A 2VQEF 3D28A 4W5RA 3DXBA 2EW9A 3KHRA 4I2QB 1NGCA 1I94J 5BYQA 3FKBA 3MDQA 1KVJA 3J7YU 4CJFA 1PIEA 3UNYA 4CERA 2ATLA 2MZTA 1WBDA 2ZDOA 3OD2A 3T5HA 2GQCA 2BRKA 4JI5K 1PO6A 4CQ1A 4NRUA 5D77A 1QE1B 4J2BA 4IH7A 2U1AA 1KN6A 3ZSRA 2VFRA 2HBKA 4DL2A 1UEKA 1H1VA 3CMAS 1YIJN 3PDNA 2Z1IA 4DR5F 1YJTA 1H7XA 5D3GB 2HWIA 4JB8B 1ACMB 2G8IA 1ZM3A 1SL1A 4FJKA 2J4RA 3LWLA 4K2XA 4K8RA 1E6YB 2AJ0A 1LOTB 2C2MB 4JI3F 3FE1A 4QIFA 4HH1A 5E3RA 5E26A 3K5NA 5SWMA 1U2VB 1ATNA 4DR6J 3O80A 3FBFA 1FRJA 2A1SA 5IWAK 3OYLA 3Q24A 3T1HJ 4CEAA 4DSFA 4I9LA 1UVKA 2EG1A 4PABA 2E1YA 2DR7A 3BZCA 3VEOA 4H0OA 1HNZK 3US5A 5K14B 2KDOA 4WU2A 1V4SA 1SC1B 5E2QA 5BPMA 4LF7J 3PO4A 2K7JA 4QS8A 1JCEA 1G4CA 3BQ2A 3WXLA 1RHJB 3TTCA 5BN9A 4BRIA 1NJIO 1EP4B 4LF4K 5LSRA 1EKRA 5C25A 5J1NA 4ZA1A 4M7YA 3PX0A 1LK5A 3B6BA 5AQSA 2CH5A 1BISA 2YX6A 3NP5A 4E7IA 1DY3A 4OZNA 4AHVA 3H5SA 1M0SA 4CH1A 1N48A 1N54B 4C11A 2QMXA 3Q2TC 4B1YB 3QRRA 2K06A 2XYPB 4CJTA 3I5AA 4NXNJ 3GU0A 3KJNB 4JI5F 3QEIA 4K41A 5E84A 4M95A 2LQ8A 3B6PA 2YNHB 5J1EA 3ZT1A 3K7RA 3BGOP 2GBZA 5J2PA 4NZ0A 4M1KA 3BF1A 2KB2A 4M3WA 3OSPA 2YH1A 2G0IA 2HZCA 4EI2A 1N32J 2JVOA 3I33