3ISNC

Crystal structure of hiv-1 rt bound to a 6-vinylpyrimidine inhibitor
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
556
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase, hydrolase
source organism Human immunodeficiency virus
publication title Crystal Structure of HIV-1 Reverse Transcriptase Bound to a Non-Nucleoside Inhibitor with a Novel Mechanism of Action
pubmed doi rcsb
total genus 141
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00075 RNase_H RNase H
C PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
C PF06815 RVT_connect Reverse transcriptase connection domain
C PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3isnC01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3isnC02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3isnC05
3ZT0A 3MR3A 4MIBA 1RYRA 2YKMA 4DL5A 1JLFB 1O1WA 4OPJA 1SUQA 5HLFB 3TI0A 1KHVA 4KI6A 4XO0A 1A5WA 3KK1B 3HPHA 4O0JA 2UVVA 2GBZA 2JEIA 5EU7A 2IS3A 3G0ZA 4RW7B 2V4QA 4IDKB 4FM0A 1TGOA 3AVHA 3V1QA 3I5AA 5KFIA 4BE1A 1NKCA 1XR7A 3IRXB 5F8HA 3V9ZA 3KHRA 1NJXA 4NCGB 4HCBA 3CJ2A 3KLIB 4I2QB 5DGBA 5DLFA 5KRSA 4FM2A 4CHZA 4RG8A 3H40A 1LWEA 4MH8A 3MECA 5KG0A 3RMDA 1JLBB 1S1XB 3KLEB 3RWUA 1ASWA 1FK9B 3V1RA 2B6AA 3SV4A 3M8PA 1S0OA 4QWAA 3FQKA 3K5MA 4AHRA 3DLGB 4KO0B 1KVAA 3SQ1A 1MU2B 2J6TA 4O3NA 5J2QB 2FJVA 2AQ4A 4NLSA 4XPEA 3QGIA 2KQ2A 4Z4HA 3KLGB 4IH6A 3V4IA 4ZMMA 1JLFA 3RAQA 2XY5A 3LP3A 1B92A 1S5JA 3O3GA 3AA4A 2RDIA 3ZSWA 1TKXA 4W5OA 2WONA 4O44A 4OL8A 1X9MA 1UWBB 3U3YA 3E01B 2C28A 3TAEA 3V9XA 5L1IA 3MEEA 4O3RA 4M41A 3KTQA 1FKPB 1SV5B 1EKEA 5KFPA 2FBYA 4F4XA 4NYZA 4B9TA 3A2FA 4MFBB 3NF9A 5KFBA 4FLXA 1XWLA 4I9LA 4CJ4A 1RBSA 4LSNB 3E51A 1D0EA 5KFWA 1HNIB 4KKOB 5DMRA 3ZT1A 2D5RA 5J2PB 3LDSA 1HQUB 2BGGA 1HYVA 5KFHA 2XY7A 4LSLB 4M3WA 2Z1JA 3CM6A 3IN5A 3ITHB 5KFRA 4CJLA 2WK4A 4NCAA 3DM2B 2D7SA 3HYFA 4EEYA 4M3YA 2B43A 1RDCA 4BDYA 4KI4A 3CIZA 3HK2A 3OSPA 2W8LA 3O3HA 2XI2A 5DQHA 1RCHA 2GIQA 4QW8A 4W5NA 3HT3A 1HMVB 3WNHA 2FVRA 1BIUA 2XO7A 1VSHA 3NCIA 3LWMA 1HPZA 2BQUA 2W9AA 3VQSA 4N41A 4B9SA 4NLTA 2BE2A 3KLHB 3NFAA 1GX5A 3G6YA 3HVTB 4IR1A 3JSMA 4QAGA 1BQMA 2D41A 4CK1A 1DTQA 1X9WA 5KFJA 5F8NA 1QAIA 4O3OA 2EHGA 1S0NA 2DPIA 2G8KA 4CGFA 4OKEA 4YNQA 1WAJA 4QWEA 1S1UB 4CFDA 2R8JA 4F4WA 2V4RA 4H54A 4Y2AA 4Y3CA 4GC7A 1JLEB 4C8OA 5DGAA 5HP1B 1NHUA 4CIGA 1A5VA 4CEOA 4WE1B 3IRXA 4QW9A 3QO9B 2FBVA 2R2RA 1S10A 2DFEA 3FRZA 1C1CA 3OYBA 2ASDA 5KG1A 1JXBA 5KFFA 4JV1A 4IRDA 2D0AA 2XCAA 4DU1A 3OHBA 3NGDA 2ZE2A 1QHTA 3ZT2A 1TKDA 4TY8A 4GC6A 4H4MB 3PW7A 3MR6A 4NLGA 1LWFB 5DQGA 4IH5A 4H8KA 4FYDA 3V6KA 5JUMA 1IKYA 4F2RA 2E4LA 4EO6A 4Q44A 4AHUA 2Z1HA 3VA0A 4IBNA 3CJ3A 1KFSA 3FSIA 3M8QA 2WOMB 5HRRA 4C8LA 4RU9A 4ICLB 4DS4A 4CCHA 3DOKA 3VQ9A 1TL3B 4DQPA 4KFBA 1IH7A 4F8RA 1L3SA 2R2UA 3K5NA 5KT7A 1S1TB 3QZ7A 4K8XA 3SUQA 3AVBA 1HMVA 1SKSA 1NOYA 3MEDB 3TAMB 1XR6A 1WSIA 3K58A 3BJYA 4FJKA 2HNDA 2IM2A 4CEDA 1NK7A 4DFPA 2QK9A 4CEAA 2ZQBA 2B5JA 3GIIA 4CERA 1HYZA 1IKVA 5KFAA 1CSJA 4NLPA 4TQSA 3KMQA 1TKTB 5C42B 4F2SA 1T05B 4KRFA 1JIHA 4LSNA 4OPKA 4KHUA 1RT5B 1N6QB 4FLWA 2AU0A 3AVLA 4ZVFA 4ZPAA 3V9UA 4I7FA 2HMIB 3SQ0A 4OKKA 1UA1A 2CKWA 1TL3A 3O3FA 3I0RB 2W9BB 4TN2A 3DRPA 2KFZA 3EZ5A 3OJSA 3C6TA 4PA1A 3SUOA 1B9FA 1YTAA 4ECUA 2FC0A 3GYNA 1LW2A 3QESA 4CF1A 1S1WB 3SYZA 3MEGB 2FVSA 1Z26A 4J9KA 2P5OA 4DSFA 4M95A 2R8HA 2IC3A 3QLHA 4G3IA 3V6DA 3BGRA 1LW0B 3OVNA 1WN7A 1TAUA 3EYZA 4RW6B 4IOBA 2HHVA 4TY8B 2JEFA 5KFZA 2BQ3A 3NDKA 5F9NA 2F8TA 5KT3A 3DLEA 3HHKA 4Y1DA 1EP4B 3ZSYA 2G8IA 4R5PA 3PW5A 3HL8A 4WFYA 1N5YA 5F8GA 1SH3A 4ECSA 4IFVB 1HYSB 4KHSA 3KK2B 4FM1A 3D0PA 4FLTA 5DG7A 1JKHB 3TAGA 1ZBIA 1F21A 3KLEA 4KTQA 4FW2A 2JGUA 4CESA 1TK0A 2LSNA 3WNFA 3VQ8A 2YNGB 5HBMB 2E9ZA 3H5SA 4CEFA 3SFGA 3VQ7A 4IKFA 1CLQA 4CJPA 3OLAA 1WSGA 1SUQB 5EDWA 3HM9A 2HB5A 2IDOA 3HVWA 3NE6A 4F4ZA 3GQCA 3OYDA 2DY4A 3NGYA 2AGOA 4DTOA 3LP1B 3CFOA 4B9UA 4IH7A 4NLDA 1S1XA 1RTJB 3KLFA 4NLWA 3IS9A 4RNOA 1ZYQA 2HHWA 3C6TB 4DLGA 3BDPA 1HNVA 3BSNA 4BWMA 5FDLA 2ILYA 4J9LA 1D8YA 2I5JB 3V81B 5KFXA 1T03B 3TANA 4DL7A 4BWJA 1RT3B 4R8UA 3CJ0A 5C25A 1T94A 5CZ1A 4NYNA 2WCXA 3MECB 4RW9B 3L2WA 1R0AB 1NK6A 5C24A 2A1SA 3LAKA 1W25A 4J9PA 3T5KA 5KFCA 1RDBA 3CFPA 1D5AA 3QEXA 4OVLA 1I39A 1TKTA 5C42A 4K4VA 2IA6A 3BSCA 3OSNA 3KLIA 1ASVA 4Y34A 2W7PA 4CFBA 3GV8B 4FJ8A 3DI6A 1S1VB 3PW4A 3NMAA 5KFVA 2PY5A 3S9HA 2OH2A 5F8IA 4IKAA 2J6SA 3NAHA 5KG4A 5KFMA 3ASMA 4CHPA 1HNIA 4JRQA 3T1AA 2ATLA 1TV6B 3BQ2A 4IRCA 2XGQA 4W5QA 1L5UA 1NK9A 1OS5A 4JV0A 1IKWB 3DMJA 3CO9A 3OS2A 3RBDA 4Q8FA 4M3UA 4CHYA 4MK8A 3V6HA 4K8ZA 3P1GA 5DK5A 2HHUA 1QTMA 1J9AA 1DTTA 3SCXA 3MR2A 4KV8A 5K14B 4FK0A 1WSJA 4ECWA 3KOAA 5HRPA 3NH2A 3GILA 1XHXA 3HSTB 1ASUA 4MQ3A 4C8KA 3D45A 2AJQA 3MEEB 4FJMA 1U47A 3V6DB 4ED8A 1SV5A 4K4WA 3M8RA 1ZBFA 1VSDA 4CF2A 1U49A 1TVRA 4TSXA 1D1UA 1EP4A 5JS1A 4NZ0A 4YR2A 1RDRA 4ZPDA 4NLOA 2WB4A 5FROA 1NK0A 4QWDA 1JLCB 4DFKA 2HVHA 4HCCA 4FLVA 1U48A 1RTJA 1XR5A 4RNHA 2X6SA 3NKYA 4RUCA 3QETA 5HP1A 3TWHA 2KTQA 2P51A 2CJQA 3HVTA 4HUGA 4KREA 1WAFA 4Q0BB 3CWJA 4EZ6A 1TK5A 5KG6A 2RPIA 4XPCA 4PUOB 3PW2A 3ZSRA 5KFSA 3D5MA 1VSLA 4DLEA 3IGVA 4PQUB 3SFUA 4ICLA 4I2PA 2YNFA 3O4NA 4O4GB 4ZTFA 4MIAA 3ISND 3QNNA 3AO2A 4HHTA 2HNYA 5KI6A 2IAJA 3TR8A 2KFNA 2UUWA 3KHLA 2DFFA 4CJTA 3OS0A 4KPYA 3C6UB 2BANB 3RTVA 3PX4A 4CGDA 2OA8A 1DLOA 4CEZA 4FZXC 1GOAA 3SI8A 2OPRB 4BDZA 5DQIA 2FVCA 2R8GA 3IGNA 2UUTA 4JS5A 4NRTA 2OPPB 4KHMA 3GIKA 4E89A 3GV7B 4N5SA 3AA3A 4FCYA 1HRHA 1RBTA 5DLGA 3L8BA 4DFMA 3QGGA 4U6PA 3PR4A 5KGWA 2X78A 1RTIB 3RB4A 4X2BA 2W9BA 3RMBA 1KSPA 1JLQA 2O4IA 4RW4B 2OPQB 5KFQA 1RAJA 1QSYA 4K4SA 1S48A 4FVMA 1BGXT 2FBTA 4YQWA 3NL0A 4DTSA 2YKNA 3QZ8A 3DLKA 3S3OA 4KE5A 3KLGA 5KFKA 4N47A 4AHVA 4CIFA 1T8EA 4MFBA 2R8IA 1VRTA 3AO1A 3AVIA 1GOCA 3VQ6A 4K4UA 3KKSA 4EP4A 4B3OB 4FXDA 4HVJA 3OYGA 4ECTA 1LAWA 4KFBB 4K4XA 3ZSXA 1S1WA 3OYAA 4FJ7A 4CGGA 3DLGA 4URGA 3IG1B 4JS4A 4I7FB 4CJFA 2YHAA 3RR7A 1KLMB 1RT4B 2ATQA 5KG7A 3ZSQA 5DG9A 4ED3A 3NF6A 5E41A 5EWFA 4O4GA 5KFNA 1UOCA 1Q9XA 3OYFA 1JLAB 1MMLA 3PX0A 1TK8A 3LP2A 2A1RA 4TXSA 4DSLA 2HNYB 3KD1E 4KB1A 4GW6A 3B6OA 1S9EA 3V9WA 2E9TA 3AVFA 1VSFA 5KFUA 2YV0X 5KGXA 2W8KA 3SI6A 2IGIA 4CJRA 3EPGA 2W42A 3C95A 5CYMA 1CZ9A 4NLXA 4DTJA 5L1LA 1I3AA 3CFRA 1XHZA 4DG1A 3JYTA 5CY4A 1NKBA 3OYMA 3QIPB 4DSKA 3HPOA 3QERA 4Q0BA 4E0DA 4E3SA 2Q3SA 5KT2A 4BE2A 4HUEA 4RW9A 4KBIA 1NJWA 3KLFB 3WNEA 2QKKA 3M9OB 1ZBHA 2IC3B 4ZPBA 3BSOA 3K2PA 4I2PB 3TARA 4ZTJA 4MK9A 2FJXA 1WNSA 1RBUA 3BQ0A 4WE1A 4IQXA 4E7IA 3RMCA 4RNFA 3CJ4A 2DFHA 4DQQA 4C8MA 4DTXA 4EZ9A 1L3UA 1LWCA 4ELUA 5CYMB 4ECQA 2UVUA 3QIOA 3KNAA 3UPFA 4K50A 4FLYA 3LALA 4DG1B 3IS9B 3AVGA 2HHXA 4K4TA 4DQIA 4YP3A 2B4JA 4M3XA 1EXQA 3CDUA 2F8EX 4TYBA 2PYJA 1Z25A 2NUBA 1IKWA 4URQU 5I42A 2AGQA 1BISA 3P5JA 4L8RB 1ZTWA 2F8SA 1SL1A 1S1VA 4QPXA 4LSLA 1R0AA 3SNNA 4ZHRA 2KW4A 2YNHB 1VRTB 3QIPA 4FZZA 3QIDA 3PJWA 4KV8B 4F3OA 3KJVB 1GX6A 3DYAA 4RNNA 3JSMB 2O5DA 1BCOA 2JC1A 3OYJA 2D3UA 2XGPA 2VWJA 3I5BA 2ZD1B 3OL7A 4RW8B 3L3UA 3OJUA 2FVPA 5L1KA 1C2PA 1QSSA 3GIJA 1BI4A 5KFDA 2JEJA 3T5LA 3ZT4A 5KFEA 3TVKA 3OLBA 1HPZB 3LZJA 4W5TA 1LV5A 4ZP6A 1IKXA 3HVAA 1WLJA 1TL1A 2E6LA 5KT6A 2G8UA 5I42B 4WYWA 1JL1A 4J9OA 1RT1B 1DTQB 3F73A 1LWEB 1J5OA 3TQ1A 4CJWA 2RDJA 3QEPA 4ED2A 4KTWA 1VK0A 2HNZA 3EPIA 3I0RA 3D28A 5I3UB 4CE9A 1W0HA 4B08A 5J2MB 2ZE2B 1C1BB 3LP0B 1JLEA 2FLNA 2R7YA 4CIEA 3GV5B 4Q5VA 1UAXA 1QQCA 4ECZA 1IKYB 4ID5A 1W9HA 4FS2A 1RA7A 2FBXA 2HVIA 1ZETA 4KHQA 1NK8A 4PWDB 4E7KA 4ID1A 4QOZB 2IAJB 1N5YB 1S49A 4CJUA 2Y1IA 1D9FA 4B9LA 4O4RA 4O3SA 4LH4A 4KSEB 3ULDA 3Q8QB 1LW0A 3P83D 4DTNA 4ZHRB 2YNGA 1C1BA 4FJIA 3G6XA 1NK5A 1RT6A 1Y97A 2JEGA 1S0MA 3SQ4A 2FLPA 5F8MA 2Z1GA 4H4OB 4AHSA 1T05A 3ZT3A 4PY5A 1TAQA 3VQCA 1VRUA 4RW8A 1KVBA 4QCLA 4IG3A 3H5XA 3T5JA 3CYMA 2C2RA 4URSA 1C0UA 4FS1A 1U09A 1EETB 3OL6A 5J1EB 4EYHB 2O4GA 3G6VA 2I5JA 3V81A 3UIQA 3KMSA 1I6JA 3OYEA 3UR0A 1REVA 1VSKA 3RBEA 1RBRA 4KHYA 4KKOA 3FDSA 5KFLA 3TAFA 1ZBLA 2G8VA 3L2UA 5FRMA 2VG6B 4C8NA 3H59A 3DDKA 4WYLA 3L2RA 1DLOB 3PUFA 4KO0A 4J2AA 2YHBA 4DL6A 3AA2A 4DTRA 3DRSB 1JL2A 4CF9A 4PQUA 2ILZA 3OYNA 2EC0A 4W5RA 4BE0A 4M3TA 4KAZA 1BQMB 3FFIA 4RNMA 4ELVA 4CEQA 4G1QB 5T7BA 3KJVA 4WFXA 3SUPA 5J2PA 4CHNA 4E7HA 1ITGA 4CGJA 1KCFA 4EP5A 2GV9A 4ZPCA 4F4YA 3PO4A 3HPGA 2BR0A 4CJQA 5DG8A 3BGRB 3OL9A 2VG5B 4MKBA 4F50A 4H4OA 4ED1A 4N56A 1IO2A 2XRIA 3HVRA 2XY6A 2OZSA 1BIZA 1NHVA 3RRHA 4R8UB 4ID5B 4ED6A 3K5LA 3DI6B 3KK2A 2YKNB 4CECA 1KTQA 2C2DA 4ECXA 3RRGA 4IR9A 3GIMA 4JRPA 1S6QB 3ITHA 2G8HA 4ED0A 1JLAA 4TY9A 1BQNB 1NNDA 1WNEA 4B3OA 3AVMA 2OZMA 1Q8IA 4CEEA 4ECYA 4DMNA 3IG1A 4NLYA 4M3ZA 5D3GA 4Z4IA 2WHOA 1FXXA 1S1UA 4TLRA 3M8SA 1FKOB 1N48A 5C24B 5JXSA 3LPUA 1QUVA 3FFIB 4PWDA 3L3VA 3NAEA 1HARA 1VSEA 1HNVB 1SL0A 4AH9A 3TAPA 2VG6A 4DTPA 2ALZA 4WZQA 1L3TA 3QO9A 2XY8A 4E7JA 4JLHA 4FJXA 1NJZA 5CYQA 3SJJA 3H4DA 1SH2A 1S9FA 4GMJB 4FZYA 1RTHB 2OPSB 4Z4EA 3PX6A 1C0MA 4EO8A 3L2QA 3PZPA 3G86A 3EY1A 1RT6B 3AVCA 4KTZA 4B8AB 1KLNA 4HUFA 5KFOA 1Z4UA 1TP7A 1KVCA 5SZTA 4EBCA 3Q8RB 1HQEA 4NLVA 4DSJA 3DOLB 1FK9A 1K1QA 2HHQA 3VQPA 1KFDA 4NYFA 3SPZA 3QGHA 2VG7A 4CHQA 4BDPA 3VQQA 3BQ1A 1RA6A 3I5CA 4TYAA 3RAXA 2HWIA 3NAIA 1WSHA 4PUOA 3PHEA 1REVB 4TQRA 4B9MA 2X74A 1L3VA 4N76A 4IG0B 2P5GA 4K4ZA 4Y2CA 4DQSA 1S9GA 5F8LA 2X6NA 1C1AA 1GOBA 1TQLA 3SZ2A 3C94A 1QE1B 4KHWA 4DTMA 2KZMA 4MK7A 1TL1B 4DS5A 3U6FA 5HRSA 4J9RA 4LQ9A 4DL3A 4IFVA 2QE5A 2ZKUA 5KG2A 4GVMA 3OYIA 4Z0UA 2VWKA 1S4FA 3SQ2A 4NLUA 2HMIA 3OY9A 3MFIA 1FKOA 4UQGA 3DLRA 3KIOA 2RF2A 3IAYA 4OLBA 4OLAA 5J2NB 4NCBA 4HTUA 3ALYA 2ZD1A 4Q45A 2AX0A 3MXJA 3VQEA 3BSAA 4IRKA 3VQAA 4WXWA 2PZSA 5KG5A 3KLHA 4F3TA 3RB0A 3H5UA 3H4BA 2VG7B 4CK2A 4LH5A 4KHNA 4YR3A 2YNFB 3LP0A 4DSIA 1N56A 3V1OA 1T03A 3DRPB 3AV9A 4R5PB 4IG0A 2QKBA 4ZP9A 3PW0A 2E9RX 4CJEA 1YT3A 4J2EA 3DLKB 1VSJA 1IG9A 3MEGA 4MKAA 4KHRA 2OPRA 2P1JA 4CJKA 3ZCMA 3AVKA 2HNZB 2YNIA 5KRTA 5KT4A 3H98A 4QWCA 1FKPA 1N4LA 5HROB 3O4QA 1RDDA 5J2MA 4RW6A 4DL2A 2BRKA 1JXLA 2KZZA 3AO4A 1RT2A 1JX4A 4WZMA 3DLEB 3FQLA 1KRPA 3PV8A 4OGEA 4KB7A 2XC9A 4J9NA 1TKZA 5KFGA 3H5YA 3JYTB 3DLBA 3NF8A 3DOLA 4CJ3A 2HW3A 4J2BA 2UVWA 3QEWA 1LWFA 3KLVA 3HJFA 4FK2A 3TAQA 1RT3A 1S9EB 1T3NA 2RKIB 3WNGA 4FJ9A 4JUZA 4WFZA 3Q8PB 4ZP7A 3QINA 3H08A 3BREA 2V9WA 3DRRB 4DFJA 5J1EA 4CJSA 4ECRA 2YKMB 4HKQA 2BE2B 5L9XA 4Q8EA 3LP2B 4FJNA 4YMEA 1TV6A 4CEBA 2WRMA 3TABA 2XWYA 2IMWP 1C1CB 1BHLA 3NF7A 2WOMA 1EETA 1S9GB 4O3PA 1IM4A 3NHGA 4M94A 3RB6A 3F9KA 3I8DA 3L2VA 2WTFA 2UVRA 3KKRA 4FBUA 1CZBA 4CHOA 5EWEA 4FJHA 4I2QA 2QXFA 3PR5B 4CGIA 4Z4CA 3QEVA 4Z4FA 3OYLA 1RNHA 3NH1A 1VRUB 4M3RA 3MR5A 5KFTA 3MAQA 2HNDB 4DTUA 1C0TA 3BR9A 5EUHA 4J9SA 2YNIB 1JLGA 1X1PA 3CJ5A 4E1MA 1RBVA 2D3ZA 5T14A 3PJXA 2FVQA 3PVXA 2R2SA 2BQRA 3VQBA 3H2LA 3MXIA 5K14A 4E1NA 4CFAA 5J2NA 1RDAA 3NBPB 3K5OA 4FK4A 5SWMA 5D3GB 3T19A 4EYIB 2XHBA 2G8FA 3DRRA 3KD5E 5CZ2A 3N6NA 2YNHA 4M45A 3SV3A 4DF8A 4IFYA 4DL4A 3DRSA 3LAMA 2D0CA 4KB0A 4ECVA 4OKJA 1K1SA 4B8CA 1TVRB 3E01A 2BANA 2AX1A 1A5XA 3U3GA 2G8WA 4FJGA 3DLHA 2J6UA 4B9VA 4E7LA 5I3UA 2GIRA 1X9SA 4RW7A 1EX4A 2R2TA 5HBMA 1ZTTA 4CK3A 4YR0A 3M8QB 3ZSVA 4RZRA 4DU3A 4RUAA 5C5JA 5FRNA 3VN5A 4ED7A 1YVUA 1UWBA 1D9DA 1VSIA 4ZVHA 5CYQB 5J2QA 3MEDA 3TAMA 1JLGB 4EBEA 1BI4B 3ISNC 2DPJA 3V4IB 3K59A 1TKZB 1QS4A 1U4BA 4J2DA 4QWBA 4O3QA 2HWHA 4DWIA 3I0SA 3B6PA 3UDLA 4OJRA 3M8PB 4NRUA 2WONB 2VA2A 3V6JA 1SKWA 1HYSA 3AVNA 2XCPA 1RYSA 1YTUA 1BCMA 4JV2A 2C2EA 1MU2A 1C0TB 2IM0A 3LWLA 2ASJA 1CXQA 4ZVEA 1HJRA 4J9MA 3ZSOA 1JLQB 3SPYA 4Q43A 1YVFA 3SUNA 1NK4A 5F9LA 4I9QA 4F4KA 2ITGA 1HQUA 5C25B 2E6MA 3EZUA 3LP1A 1RT4A 3C6UA 1B9DA 3RMAA 2EX3A 1JKHA 3LANA 3Q8SB 3OYHA 3CM5A 1XC9A 4J9QA 4IFYB 3K57A 4FBTA 3PO5A 2C22A 1QE1A 4BACA 3MF5A 3RB3A 1RTDB 3OL8A 2JC0A 4CJ5A 3OHAA 2HAIA 3THVA 2OPQA 4NLQA 3ICLA 4CJVA 3N6MA 1U04A 3M9MB 3AVJA 2Y1JA 4CGHA 4LY7A 3HP6A 3HKWA 1RT7A 1RILA 2QV6A 4AHTA 4XIUA 1KHWA 3MFHA 2PYLA 3MXMA 4ZVGA 1C6VA 3CG7A 3CDEA 4G1QA 3KK3A 3HP9A 4RW4A 2OYQA 3MTKA 4AILC 2HHSA 3UQSA 2Z1IA 5EWGA 2DTUA 2JLEA 1LAVA 5KTQA 1J54A 1Q9YA 1CXUA 4FJLA 1C0UB 1XI1A 3PY8A 4NLRA 4E19A 4DQRA 1S97A 3KHGA 2R8KA 4FLUA 4CF0A 4DSEA 1RT2B 4CF8A 5L1JA 5HLFA 5FDLB 2HHTA 2IJFA 3VQ5A 4LD0A 1SKRA 3DMJB 4K4YA 4IDKA 3VA3A 1KLMA 3HO1A 2B6AB 4ELTA 3S3MA 1BQNA 5HROA 1G15A 4DEZA 2ETJA 2VG5A 4FW1A 2RF2B 3V9SA 3LZIA 3I0SB 4NCGA 1N6QA 4FLZA 1JXEA 3KK1A 2BDPA 4OGCA 4DU4A 3QYYA 1S6PA 2FLLA 2V0NA 1JLBA 4IG3B 4WXOA 4YFUA 1J53A 2IM3A 3NH0A 2I1RA 3NGZA 1RTDA 2AGPA 3S3NA 3DOKB 2GUIA 1WSFA 4ZP8A 1LW2B 4H4MA 4AHCA 1QSLA 1WSEA 1U45A 2RN2A 3ZSZA 2W9CB 1S1TA 3T5HA 4Y1CA 2VA3A 4R0EA 4B9NA 3OS1A 4EBDA 1LWCB 4LQ3A 3CQ8A 3QLHB 2F96A 4DF4A 3M9NB 1NOZA 4O5BA 1VSMA 3KHHA 1S6QA 2BRLA 1UA0A 1QAJA 2W7OA 2FJWA 3OYKA 2B5JB 4M42A 2IM1A 2IOCA 3CDWA 5HRNA 4HYKA 4O44B 1DTTB 2AWZA 1J5OB 4FJ5A 3G10A 4Z4GA 3T3FA 1BL3A 3OYCA 2RKIA 3VQ4A 4O55A 4KAIA 1JLCA 3AO3A 1RT7B 5KFYA 1RTHA 2OPSA 2ASLA 5KG3A 3AVAA 3RR8A 1K6YA 5F8JA 3QNOA 2D0BA 2OPPA 1SH0A 3N6LA 1T7PA 2XI3A 1IKXB 3QEIA 2W9CA 3KK3B 2IJNA 2IBKA 3DYAB 3CVKA 2GC8A 4CFCA 1TKXB 1IKVB 5JS2A 1SL2A 3NBPA 4U7CA 1RT1A 5KT5A 1S6PB 3HXMA 1RT5A 1NKEA 3LPTA 3VQDA 4FJJA 4O0IA 1RTIA 1HQEB 1ZBUA 3NGIA 1NJYA 3AO5A 3AA5X 3DM2A
chains in the Genus database with same CATH superfamily
3DXSX 2DISA 4HH0A 4FNIA 1T11A 1VQ5S 1FESA 3MMJA 2XTJP 3TI0A 8AT1B 4KI6A 4XO0A 3KJQB 2C3MA 2HURA 3N4WA 3KK1B 3C6AA 4O0JA 2CQ2A 2UVVA 4B17A 1HI1A 5EU7A 3N01A 3HZGA 5L9NA 3I96A 4IDKB 2D3OR 4FM0A 1TGOA 2PA3A 1SZ2A 2BJ1A 4X84A 1NKCA 1BLUA 1XR7A 2HIYA 5F8HA 3M30B 2XG8A 3CJ2A 1HKGA 5K8OA 3KLIB 1PSDA 1QDUB 1WG5A 3HCXA 5DGBA 2K06A 5E3AA 4DV2J 2OMOA 4C4WA 3MAHA 3RWUA 2PC6A 2H4WB 4LFBK 3SV4A 3W66A 1URNA 1ATSA 3EXYA 3CD7A 3U4LA 4AHRA 1U7LA 5SUHA 2J6TA 2FJVA 4I56A 4NLSA 2KQ2A 1SJQA 1JLFA 1DQ8A 2I6WA 4ES3A 3EGNA 1U25A 1DJ0A 2M3DA 3E01B 1TUWA 4C97A 4ID8A 1FJCA 3QPIA 1SJRA 4O3RA 4M41A 3HBTA 3IFEA 1FKPB 3DDNA 3HKZD 3O3LA 2CQPA 4F4XA 4NYZA 4R25A 3NF9A 4ZS6A 3M32B 2E1AA 4FLXA 1XWLA 3CCVN 4LSNB 5C2GA 4KKOB 5J2PB 3LDSA 1XMOK 1HYVA 2XY7A 1LFPA 2Q79A 3MM7A 2KLAA 5IM0A 3VV2B 3VZIA 1BOTO 2R7SA 4BRAA 1KOOA 5AQFA 4QU6A 3CM6A 2DNZA 2WK4A 3CDAA 3MPUB 3QWPA 3J7Z5 4FYWB 1RDCA 4KI4A 3CIZA 3O3HA 2P9PB 4E2FB 2GIQA 4QW8A 2CQDA 4LRCA 2KM8B 1IBMK 2FVRA 2XO7A 3T1YF 3LWMA 2LEBA 1W2IA 2V34A 2BQUA 2LLZA 4NLTA 2BE2A 3G6YA 2A6AA 4C11A 3HVTB 4LF7J 2V2QA 3JSMA 3GCWP 1NSPA 2D41A 1CJVA 1X9WA 5F8NA 1R89A 3D9BA 4O3OA 4CW7B 2M8HA 2D9OA 1FWPA 4CGFA 4FYXB 1VDHA 4OKEA 4YNQA 3VQTA 3MN5A 4RO0A 2B0GA 4I64A 4F4WA 4Y2AA 3CJQA 1VQ8S 2DXFA 3TTCA 4BR7A 2DNQA 1A5VA 4CEOA 3BPSP 3EEQA 2P9GA 1YJNS 3IRXA 4ZLNA 2DKOB 2FBVA 2KYZA 2J8SA 4Z37A 1FHTA 5JVGL 1XMQF 2E5LJ 3OHBA 2ZE2A 1QVFR 4H0PA 3VVTA 4GC6A 1N52B 5IQ6A 3RAMA 2I2YA 1LCUA 4IH5A 2G4BA 4H8KA 5ADZA 1JWWA 4B3RK 4UQTA 3QFPA 4DUZJ 1NU4A 5HSPA 4F2RA 3M2VB 3A3NB 2NPIA 2VCPA 4P10A 4FWQA 1KFSA 1MWZA 3DRYA 1PKUA 5HRRA 4NXMJ 1X4BA 4ICLB 3IBWA 1XNQF 3DOKA 2R7RA 4FPBA 2R2UA 1S1TB 1JK9B 2L9WA 1FXLA 4QR2A 3AVBA 2E88A 1SKSA 3MEDB 4B3RJ 1XR6A 3BO4A 3BJYA 3CJ7A 2ZC3A 1NK7A 4DFPA 1TZ0A 4NI2A 3BH7B 2ZQBA 5DM6L 1HWKA 3I32A 4CERA 4ERDA 1CSJA 4MYTA 4NLPA 5C42B 4F2SA 1U0HB 1RT5B 3GP9A 2Q2RA 4ZPAA 2NXEA 4WPAA 3GZ7A 4OKKA 1NHKL 2VPXB 2W9BB 4TN2A 1HA1A 1CULA 3QRRA 2IIRA 3WZ0A 1P9YA 3GYNA 3QESA 2CDQA 3VETA 1GXTA 3SYZA 3MEGB 1LK7A 1Z26A 4DR5K 1QUPA 4WK3A 4J9KA 3GPAA 4YOTA 2R8HA 2IC3A 4LFBF 2D0PA 1SC6A 3BGRA 2E1MC 4JI3K 1I3OB 1FNXH 2EBGA 3UN3A 2VIHA 1ZAXA 5F9NA 1TL7A 2YH1A 2CWXA 2G8IA 1FNOA 4PXDA 3PW5A 4M7YA 2P9SA 3ETMA 1SH3A 4IFVB 1HYSB 3D0PA 1VQKS 4FLTA 3TAGA 3IUCA 4NO7A 3KLEA 1S7HA 2R7QA 4F25A 3T1YK 4NXNK 4KTQA 2BZ2A 1M5OC 4LREA 1YF5L 5FPMA 2DRDA 2RMLA 4X4TA 2RILA 3PRBA 3EDRB 1ZC6A 1TUVA 5D78A 1URRA 5AE1A 1LXJA 3HM9A 2IYGA 2HB5A 3NE6A 4F4ZA 2G2ZA 4ZN1A 3PCOB 3CFOA 1FFGB 4KH0B 4B9UA 4NLDA 3LGHA 1RTJB 2W41A 2VBYA 1X0PA 1JJHA 5LM7E 2AF6A 4BGBA 2DCUB 4OZJA 2CXEA 3A5MC 4DLGA 1VBKA 2ZJPQ 5FDLA 5KFXA 1YKWA 1R8HA 2O01C 4BLGA 1OH5A 4DL7A 3Q8VA 2RS8A 3MWPA 1ACMB 5IV3A 5E26A 1OQ3A 1HUXA 2C3YA 3E66A 1NK6A 2K7JA 4P2XA 2B7CB 1RDBA 3WDOA 5T7LB 1D5AA 4EUVA 4K4VA 1ASVA 1W7AA 1ZPVA 4CP5A 4CFBA 3SAHA 3CXCR 3DI6A 1QVGM 2HRYA 3T1HK 4WBFA 5KFVA 5A2QU 2OH2A 2OHDA 1YITN 4P2FA 1OKJA 2VHGA 5KG4A 3ASMA 4BRNA 1ZM4A 2AZ1A 1VI7A 2PI5A 2ATLA 1TV6B 5BR8J 2YCHA 2V51B 1IKWB 3OT9A 2OO4A 3DMJA 3I87A 1RU1A 3RBDA 4BRMA 2ZM6K 4M3UA 2VASA 1AZSA 3P1GA 2RIJA 4B1UB 4Z7YA 3SCXA 3IKMA 1KOHA 3H0PA 1T02A 4KV8A 2N4CA 3VGMA 2CQCA 5K14B 4FK0A 3F44A 3S1TA 4AE5A 4ECWA 2UUBF 2HYIB 4U67L 2V6AA 3GILA 4OX9K 5H9FJ 2LDIA 2G1DA 3GU0A 5HVFA 1HD0A 4FJMA 3T9NA 1H2TZ 3M8RA 3NG8A 4FL9A 4CF2A 1FDNA 1VRQC 1U8WA 1TVRA 2QA2A 2P9PA 4EMDA 4YR2A 1RDRA 4NLOA 5M2RA 1U6ZA 4QWDA 4LVNP 1KEKA 1UPMB 3D2EA 1SC4B 2YI1A 2ZUGA 4CO1A 2LA6A 4RUCA 4IJNA 5HP1A 3NS6A 1RHJB 1IBMF 3TWHA 2CJQA 3HVTA 3BKFA 1WAFA 2E1CA 4A5AA 5KG6A 3PW2A 4PUOB 2XO6A 3GSIA 3BBBA 4CLTA 1VC5A 1H72C 4CT8A 1CBKA 1NGEA 4DV2K 4ZVSB 2UXDK 3R9PA 1BG3A 2YNFA 3FCWA 1JNRB 1M0SA 2FXUA 1HQ2A 3W1YC 3Q24A 1R6VA 5KPTA 1EWQA 4LF5J 2UUWA 1VCTA 4NASA 4CJTA 3OS0A 1TL4A 3C6UB 2BANB 3RTVA 2IFXA 1DLOA 4CEZA 3D2EB 5DQIA 3VAMA 3VHQA 2CPHA 3IGNA 3MI7X 1V6HA 3D3CJ 2POKA 3GIKA 4N5SA 5AXNA 5FJ4A 3B6BA 2XSJA 4FP9A 5K9FA 1JJ4A 2DNGA 5DLGA 4DFMA 4DUYF 2IVFB 2AYEA 1I1GA 3PG9A 2W9BA 2QWOA 2E7XA 3KNGA 3RMBA 2QA4G 4LF6K 2CQ4A 4FOIA 4RW4B 5L8RC 2JSXA 1LXNA 2HSTA 4YQWA 3MXHP 1KD1T 3S3OA 1UTAA 2CQBA 3BYPA 3QZ8A 1DY3A 2OJ3A 1DGKN 5KFKA 4Y28C 2HLTA 3D66A 2R8IA 1NDLA 1WHWA 4QIWD 1X4DA 4EP4A 1NGFA 2QGFB 3EM1A 1I94F 1LOTB 1X3NA 3PYDA 3OYGA 4ECTA 2MZRA 1KC8O 4KFBB 5IC6B 4K4XA 2ZGZA 3T69A 4E8UA 1S1WA 3M5RA 3DLGA 2LMIA 2WVBA 3CD6N 3IG1B 4ALZA 4YORA 2YHAA 4C1NK 2RNEA 2ZGYA 5KG7A 5DG9A 3VAKA 1PYOB 2Q6BA 3OVAA 1MMLA 2B9EA 4DR4J 3LP2A 4DUZK 4B3MF 2HNYB 3QATA 1RKIA 3LOUA 4CD1A 3V9WA 5KGXA 2W8KA 3SI6A 2IGIA 2BH1A 2W42A 3FLCO 3QMQA 2BJ3A 3C95A 4W92B 2XYPB 1CZ9A 4DX8H 3CMEN 2Z2MA 3D68A 3CFRA 4DG1A 3JYTA 2BM1A 3OYMA 1KQSM 3QIPB 3CJRA 2VQEK 2NXJA 3QERA 2GO9A 3DXMB 4E3SA 3O9UA 3C16A 2CDRB 2AKWB 1SXLA 4HUEA 2JJ4D 3FMBA 3BSOA 2LQJA 3R2DJ 4ZCMA 4ZTJA 1XK8A 1WNSA 3BQ0A 4WE1A 2E5IA 4E7IA 3RMCA 1IBLK 4C8MA 2XYHB 2DGOA 3TSQA 4DCPB 3OTCA 5BPMA 1L3UA 4ECQA 1FFSB 2UVUA 3H1VX 2WAQD 2XM3A 3L7PA 4K50A 3X1LB 4DV2F 2DR9A 4OJHA 2VKZG 4DG1B 3JS6A 3AVGA 4K4TA 4GVBB 3KDOA 4QJVA 3J7YU 3CDUA 3CJ9A 2PYJA 4JI5K 2NUBA 4NLBA 4EGLA 1IKWA 2NREA 4URQU 2AGQA 4A59A 4L8RB 1NU0A 2F8SA 4RU2A 3RSEB 4QPXA 4WFNL 4ZHRA 3I56S 3RYLA 4DPWA 5F2RA 1EARA 5M2UA 2RS2A 4BRCA 3QIDA 4KV8B 2O5DA 4WIIA 1FVQA 3OYJA 1VMBA 1J5EK 4GV9A 2V68A 2EVZA 3OJUA 2FVPA 5L1KA 2KRRA 2UXCJ 3OLBA 4UZCA 3CMQA 1YVNA 4W5TA 5HAOA 4ZP6A 2P9UB 4G1PA 1X8DA 3HVAA 1WLJA 1TL1A 2BUPA 5B0AA 4EK2A 1RAEB 2JLGA 4J9OA 1WSRA 3DLLL 2XMVA 4ZJLA 3C7NB 3UW1A 3K9KA 3EPIA 3I82A 1JB0C 3AAQA 5I3UB 1XMOF 4A2BA 3J81U 4QPTA 5L38A 1WBBA 2JWKA 5I3PA 5EY4A 2MKKA 3B8HA 2R7YA 1SB6A 5E2QA 4ECZA 1IKYB 2MZSA 1E4GT 1U8SA 1GLFO 4OHVA 2UXCF 3OBWA 2HVIA 3ID6A 4DPYA 1UETA 4H0VB 4FVCA 3RW6A 4DR3F 2UU9J 4DV6K 3PIPQ 2ROPA 5GINA 3T1YJ 4BRQA 4E7KA 4QOZB 4MJKA 1XNRJ 3QBWA 2BV3A 4KH1B 4BY9C 3ULDA 3CC4N 2CPDA 3Q8QB 3PKMA 1FDBA 1X60A 4CLSA 3P83D 4ZHRB 4OYIA 3MM9B 4FJIA 2ZH4A 2NRTA 1N34F 4MDBA 4PPDA 3BGUA 2FLPA 3VWSA 5F8MA 2Z1GA 1A9NB 4AHSA 1XNRK 3P38A 3VQCA 4CNZA 4PHTX 3WXMB 2FTRA 4QCLA 4IG3A 3T5JA 4ILGB 3CC7S 3JAMY 2C2RA 4URSA 4FS1A 2UV8G 4Z7CA 1EETB 3UFCX 2PMHA 2FC9A 1R0CB 1S77D 3NS5A 3VEVA 4OHZA 4PR6A 3G6VA 1UVJA 3CCLN 2EK6A 1SIZA 1HNXJ 1WF2A 3UR0A 3RBEA 1RBRA 2ACYA 3K0JA 3TTFA 2G8VA 1RDWX 4C8NA 3DDKA 2RHKA 4KT0C 4F9OA 4KO0A 3TA0A 4DL6A 3MM9A 4KBOA 2ITMA 3TTDA 5FLXU 2O8BA 5EHHA 2G0JA 4IOXA 5JICA 4KAZA 2JNJA 4YDUA 1BQMB 3FFIA 3ZX3A 5LXYA 3CUNA 4CEQA 1YRXA 4DJBA 2F8HA 2BACA 1YX2A 2QEXN 5AT1B 3O5TB 5AXLA 2RU3A 5J2PA 5BR8K 3AD7C 2XHCA 2HHHF 3HZ6A 3DOMB 4HEA9 2BR0A 4CJQA 3BGRB 4QYZJ 1WC5A 3D54A 3Q89A 1JMTA 2YKPA 2H5EA 1IR0A 4H4OA 1Y10A 4N56A 4ED1A 3BBCA 4RBTA 2CH5A 3G96A 1R8CA 3R5AA 1N32K 2Z0GA 3IBFB 2LEAA 4L75A 4JKBA 3KK2A 4C23A 1KTQA 4OX9J 3CCTA 4ECXA 1YJTA 4ED0A 3ATVA 4CJ7A 1JLAA 4KHPK 2IRYA 2X1GA 2W24A 3IP0A 3AVMA 4G1IA 2QWNA 6FD1A 1T3VA 4NMXA 4RUHA 5EX5A 1U24A 3ULEA 4ECYA 1S72N 2CPJA 1PYTA 5CAAA 4TLRA 3KJNB 1FKOB 1Z05A 4FF1A 1P8ZA 3SBGA 5C2DA 1NM2A 3RBZA 4JI3F 4P73A 4IWVA 2JLFA 2P6SA 2ALZA 2F4VF 1NMNA 1L3TA 3QO9A 2XY8A 5CHIA 3PXGa 3OQ2A 3E3XA 1NJZA 3SJJA 1WEZA 4HDGA 1S9FA 1NJIT 1BWEA 4DR3K 1C0MA 4F0KA 4LF8F 1SAZA 3PZPA 1J5EF 3EY1A 4DL0C 4JI4K 4JV5J 3PLAA 3CW2C 4UUXA 1KVCA 5SZTA 4C6AA 4EBCA 4WF9Q 4A61A 5CE3A 1YI2N 3BEXA 4Y2KA 4L3QA 2B8PA 1K1QA 2HHQA 3VQPA 3C46A 4NYFA 3A8KA 4DCOB 3QGHA 1FXDA 4PAAA 1W2BM 1GMVA 4BDPA 3I5CA 4GVEA 3U7JA 3PHEA 3JAMU 1FKAF 2DH7A 4IG0B 3TEHB 4DQSA 4MIWA 2DNRA 4FWLA 3W63A 4CQ1A 4HWIA 4H5NA 2X6NA 4LF8J 1C1AA 2FHMA 3SZ2A 4B3SJ 3C94A 1QE1B 5M1FA 1TL1B 4NE9C 5BYQA 2FF6A 3AOBA 3U6FA 1V3ZA 3SMPA 2UP1A 2DHXA 1K8AO 4GVMA 1CPZA 3OYIA 1XUPO 2MGZB 3KK7A 1ZZFA 3CCUS 4YB1P 3AA8A 3ZTOA 2UUAJ 2QTWA 4ED5A 4OLBA 2A3ZA 4LF7K 3G8TA 2WVEA 3VQEA 3W9IA 2Q0RA 3BSAA 2P9KB 1AW0A 4YHHF 2E2QA 3KLHA 2V50A 3RB0A 1Q1KA 2B51A 1Z2ZA 3H45C 3CT9A 3A4TA 4GKJF 3LP0A 1A7GE 5BRHA 1CS4B 1FEHA 3DRPB 1EIYB 2CNOB 2DNPA 3CCLS 1OJ4A 2QKBA 2PSZA 3CD5A 5AZIA 3DLKB 1VSJA 4KHRA 4P7VA 2MKSA 2AEFA 3MX2A 2HFZA 4JK9A 5KT4A 5KRTA 3O4QA 1RDDA 2E1YA 4U67Q 4RW6A 1F2GA 2QMXA 2NPFA 3G71N 1TMMA 2VBWA 2Q66A 2OI2A 2HQGA 1FNMA 3JYTB 5DZ6A 3NF8A 4AL6A 4AYBD 1KWMA 5B7WA 4J2BA 4ISFA 2QT7A 2CQ0A 4WFAQ 5AXMA 3K2YA 4FK2A 3OUYB 3J80U 3AD9C 2YHWA 3QWUA 4JUZA 2CG4A 1YZ7A 3PACA 2VQFF 1B70B 2E2OA 4CJSA 4HKQA 3BZCA 5G0RB 2CH6A 3LP2B 2GX8A 3LGNA 4P7TA 4JI4F 2OKQA 3DOMA 2FIUA 2DH8A 2Q6CA 5D4OA 1EETA 1IM4A 3MCPA 3I8DA 2KHCA 2PEHA 2WTFA 4F67A 2UVRA 3B4MA 3C66A 3OTBA 4CHOA 3LL3A 5EWEA 4FJHA 4I2QA 3PR5B 3SCKE 4CGIA 4Z4CA 4Z4FA 5KPRA 1VRUB 4HTIA 1RISA 2UU9K 2IVPA 2HNDB 1C4AA 1GMUA 3PSFA 5HOOA 3BR9A 1ZH5A 1NUEA 3K17A 1JLGA 3I4HX 3CJ5A 2CYYA 2IBOA 4E1MA 2UUBJ 2D3ZA 2FVQA 3QAEA 3EGZA 3CC2S 3PVXA 2BQRA 3PEHA 5J2NA 1Y5LB 4LF6F 4FK4A 4EYIB 4JHDB 3D1HA 1H74A 1RI7A 3E8OA 1WELA 4HL9A 3SV3A 1HX1A 2VFTA 4CO0A 2ADCA 3DRSA 3LAMA 4R0JA 3JQMA 5AQHA 2YKOA 2YWFA 2K1RA 4ECVA 2UUBK 4I69A 1U1KA 3E01A 1Q0NA 2BANA 5A76A 2EFOA 3R5BA 1EQYA 5IWAF 4C0OC 2OELA 2IYIA 2ASOA 5I3UA 2COLA 4DR6F 3CQXA 4RW7A 1EX4A 1ZTTA 3UCZP 5C7PA 3ZSVA 4DX5A 2ABYA 4DU3A 5C5JA 2GAGC 3VN5A 3L7UA 3LQVA 4RR5A 3GB0A 4PL8A 2HQDA 3H20A 3BP8A 3Q2TC 2O8CA 2DPJA 3CSKA 3V4IB 1TKZB 4J2DA 3R6GB 4CWBA 2AHOB 3I0SA 3AY9A 2AIRB 4OJRA 2MB0B 3N9UC 5DJBA 1HYSA 4LF4K 1RYSA 4LUBA 2B4UA 2CQ1A 1BCMA 5LMNK 1HNWJ 2UXDF 2Y9HA 1HNZJ 3BUZB 4LFAK 2XNRA 3OPKA 3RSEA 1ZAVA 1HJRA 5AZJB 3WEEB 3CJ8A 3HHLB 4OV1A 2LKZA 1PO6A 1CULB 4DV3J 3NP5A 4I9QA 5BXIA 1VISA 2ITGA 5C25B 3QNWB 2E6MA 3SLCA 2M4MA 5EXWA 3Q8SB 3OYHA 2ZH2A 3DAWA 2BXJA 4KHPJ 4J9QA 4QQBA 2C22A 3TUJC 5GAHP 2YQ3A 4O23A 2HAIA 2VFRA 3ICLA 4DPXA 3I9V9 1YBAA 3FZ2A 3HKWA 5C2FA 2HHHJ 1RE1B 3DN9A 2CAJA 1VQOS 3HSJA 3HHLA 2C42A 1KHWA 4Q2LA 2DRBA 4ZVGA 3AXKA 4G1QA 1PIEA 4CZJA 1OYEA 2DPNA 4E98A 2EG2A 4AILC 3GFXA 2DTUA 4ZPVR 5IT4A 1LAVA 2VWBA 2C2OB 1CXUA 3W64A 4J91A 1QM9A 3PY8A 3J81Y 1B3TA 5LSRA 1BMQB 2XULA 2VONA 5AQNA 4IFEA 2HHTA 2NCKL 1O51A 4QYRA 2IJFA 5U47A 4LD0A 2GGPA 3MPWA 1SKRA 2NLWA 2YX4A 4ZCKA 4ZK7M 4DBQA 5CHCB 1KLMA 4ELTA 4NXMF 4M5KA 3S3MA 3P5BP 2OANA 5HROA 4USVA 1HI8A 1RWXB 2RF2B 2CQIA 3O9SA 4DMZA 4C48A 3W65A 4NCGA 3GFHA 4OX7A 3RG6A 1VQPN 1OO0B 4GY2B 2ALYB 1JLBA 3TWZA 2JWLA 3MWTA 4IG3B 3QJPA 2IM3A 4OJGA 3U8XA 4WQ4C 3MM5A 1RFQA 3BKUA 2RB7A 1UVNA 2GTDA 5HMWA 2DNKA 2IIHA 1Q81O 3WT0A 5GADI 4H4MA 2HQCA 3EZOA 3CQYA 2A6MA 2W9CB 1S1TA 4I0WA 4DX6A 3T5HA 1KKHA 1TELA 4R0EA 4B9NA 2RHSB 4KGVB 3ZZTA 1EKRA 4DF4A 1XMOJ 2CNKB 2XWXA 1HBUA 2Z2ZA 2Y0SD 4KPCA 2H3GX 2BRLA 2Z58B 4Y2MA 1QAJA 2W7OA 4FDFA 4ZN3A 5TKYA 4BRKA 1TUYA 4P71A 4CZFA 5HRNA 1YTYA 2J76E 3TOQA 1J5OB 3T3FA 1BL3A 3KUEA 1FI4A 4ZITA 3F9MA 3MM6B 4LFAF 1S79A 2OPSA 2ASLA 3C8YA 3W61A 3US5A 3C19A 2DR8A 2OPPA 2F3JA 2YTCA 1T7PA 1IKXB 5A8WB 2W9CA 2IJNA 2IBKA 2GC8A 2DGWA 5HVGA 2H5IB 1IKVB 4V19J 4P2SA 5AQOA 1SL2A 4CLPA 5AQQA 3DHXA 2A2DA 4DV4F 4PG8A 2R42A 5KT5A 5LSOA 4DR7F 2OUGA 1NKEA 3G2XA 1RTIA 1WJ9A 1ZBUA 3NGIA 2M8DB 2QA1A 2F9TA 1FJGF 1NPPA 3DM2A 4W5QA 3ZT0A 3OD2A 2KYXA 3CJAA 1HNZF 1RYRA 1NGHA 3CC4S 2YKMA 2QM1A 2ZZNA 1O1WA 1GLEG 3THWB 1VQ6S 4IOCQ 4DV7J 2B4VA 5HLFB 4DR4K 3NGUA 3WHIA 1Q4RA 2UYTA 4WWSA 1EO1A 2IS3A 5ETKA 3G0ZA 4RW7B 2ZWOA 4M5JA 1YHQN 2QC3A 3I5AA 2YQ0A 2X1AA 1VQNS 4K5RA 3IRXB 1NJXA 3ZX2A 4ZVTB 4HCBA 2VUGA 1RAOA 1X7VA 4FM2A 3MOZA 4MH8A 4DR6J 3LPYA 1HBUB 1SJFA 4M5MA 4DV5J 2CQHA 1DBDA 3V1RA 1R59O 1UEUA 5ELZA 1H6KX 5BR9A 2VH7A 1CJVB 3D0HE 3NWGA 4BCAA 3EKSA 1YJRA 3W2VB 5AZIB 4F26A 3DLGB 3SQ1A 1MU2B 4O3NA 2FY1A 3M05A 4XPEA 3QGIA 2QA4S 5D4LA 3RRKA 1VAZA 3KLGB 3RAQA 2XY5A 4BS2A 3LP3A 3AA4A 4EIAA 3M6VA 4TU8A 2RDIA 3ZSWA 1TKXA 4LBIA 3PNIA 4O44A 1O5JA 4K5SA 2ZHAA 2Q0UA 2CPFA 5L1IA 3CMAS 2CGJA 2Z4PA 1HHQA 1X4HA 1EKEA 1WF0A 4ISGA 1R8AA 4MFBB 3A2FA 5KFBA 3LW5C 4CJ4A 3VGKA 1D0EA 5KFWA 1NPKA 4YDUC 4HT7A 2CPYA 1HQUB 4PEOA 4QIEA 2BGGA 3M2VA 2A1BA 2OTJN 3IM8A 4WYBA 3ITHB 4HR2A 1XC3A 2GVDB 1VJQA 1SKUB 2XS5A 3HK2A 2XI2A 3OW2R 1WOOA 3ZZYA 3HT3A 3J81O 3A1YG 3WNHA 3IRWP 1Q7YT 1BIUA 1VSHA 4WFBL 4PKGA 2W9AA 4B9SA 3KLHB 2W2OP 4EFHA 4KC5A 4Z94A 4IR1A 2WBMA 5LL6d 4CK1A 5KFJA 2F4FA 1ATNA 1QAIA 3VOVA 3E9PA 2G8KA 3E9LA 3SXLA 1WAJA 4CFDA 4ZJOA 2R8JA 1YIJS 1G2EA 2V4RA 4Y3CA 3G71S 4NEZA 3T6BA 4DR1F 5DGAA 5HP1B 5CD4A 1WKLA 3JS9A 2WVCA 4WE1B 2KB2A 4LF5F 1RABB 4QW9A 2R2RA 2DRAA 3THYA 2E5JA 2DFEA 1C1CA 1FX4A 3OYBA 2A0FB 2HGLA 5KG1A 3HD1A 3SCJE 2NNWA 5DDQC 3F5TA 4DU1A 2MQQA 3D6TB 3FR0A 4JI1K 1QHTA 3ATUA 3SMZA 3PW7A 3MR6A 4NLGA 3OR1A 4CH0S 4JI8F 4FYDA 4X66J 3U1MA 5CXTA 2F63A 2E4LA 2ZJQL 2Z1HA 3V2UC 2QJ3A 3DJCA 1M90O 3CJ3A 5HMYA 3FSIA 1NSKL 1SQGA 5LXRA 3UWTA 3TZXA 3A0IX 1K8KA 4C11B 4RU9A 1Q82O 3I4PA 3VQ9A 4IYQA 1TL3B 4MO5A 4K41A 1N5TA 1IH7A 1PC4A 5KT7A 2KM8C 4K8XA 3SUQA 1SC3B 1F60B 3MN7A 5LJVA 2MQOA 2LU2A 1WSIA 2RHQB 3IWXA 1RSCA 2IM2A 3GOIA 3UD4P 2QSFA 1HYZA 1IKVA 3GR1A 1RHMB 5JJBA 2ZJPL 1TKTB 4KRFA 1T05B 2R9LA 1RHUB 3CETA 2X3GA 1T0TV 2AU0A 3TP2A 1K44A 3ENQA 3H3OB 1U1PA 3V9UA 4B1XB 4I7FA 3MMAA 1VQ8N 4ILLA 2JH3A 1UA1A 2CKWA 1TL3A 5E84A 5H9FK 3O3FA 4PA1A 4NEYA 3FSXA 4CZLA 4CF1A 4LR7A 1FXRA 1YJWS 4K0KK 2FVSA 4UOCA 2P5OA 4ZPTR 1S6OA 4LF2A 2NZTA 3QLHA 4CZEA 4YB6A 1TUUA 2W7AA 3GR0A 3KJFB 2CA9A 4LRAA 4IOBA 2EFPA 5KFZA 4AL7A 3NDKA 4JKHA 2CJ9A 1W26A 3HHKA 3LUYA 4Y1DA 2VC0A 1Z6RA 3FBEA 4DPOA 2RRNA 5AJ3K 1N5YA 1REGX 3KK2B 2NRZA 2QL5B 4BR0A 1ZBIA 2JGUA 1IQTA 4CESA 4DV4K 4ED4A 2YWGA 1TK0A 1SC1B 1VQ6N 2X3DA 2E9ZA 3EGVA 4IKFA 3OR2A 3IR5B 1CLQA 3QJJA 5EDWA 2C3UA 4PXCA 4J7CA 3IR7B 1S1XA 3UR3C 4NLWA 4K2JA 4ES2A 2OTJS 3C6TB 2KXHA 2I5JB 1T03B 4L74A 3TANA 1H2UX 3FEZA 4Y65A 1RT3B 1ZOTA 4R8UA 2BW2A 4BR5A 3CJ0A 1S6UA 4NYNA 1ZBSA 3ZC4A 3L0QA 3WXJA 1HW8A 2NZ4A 2ATCB 3MN6A 3LAKA 3WXKA 5ETMA 2O8BB 1TU0B 3CFPA 2MHNA 3QEXA 4QS7A 4CYUB 1CJTB 5C42A 1ZM9A 4M7XA 3BSCA 2W2PP 4M5DA 3UN5A 4Y34A 1WTFA 1B7FA 2WSFC 4NOHA 2KN4A 3D6FB 2A2CA 2YX6A 2ZNYA 4ETZA 3LO3A 1S1VB 3PW4A 3QDKA 1VOMA 2MQPA 1YJWN 4JOUA 3G82A 4IKAA 4DV7K 3SQOP 3J7YI 3NAHA 4CHPA 4OJ1A 1HNIA 3SEOA 3BQ2A 4H5TA 5C0YA 1HBNB 1R8BA 2XLJA 1OS5A 2ZWPA 4JV0A 3CO9A 3OS2A 2FHJA 5FIIA 1RTZA 1KAXA 4CHYA 4MK8A 4DR2F 3V6HA 1YGYA 2HHUA 4DOZA 4CZMA 2IRUA 2QW9A 4RJVA 2DR6A 2A41A 2UUAK 1WSJA 4LF9J 2EWHA 3JTNA 5A6WA 2C2ZB 2CIMA 3HSTB 4JI1F 2HFUA 3BV8A 3D45A 4MQ3A 3MEEB 1WC4A 2FJEB 3AQPA 4YOUA 1SV5A 5CCLA 4K4WA 3VGVA 1RAAB 1RLCL 4JD2B 1D1UA 3GONA 1ILYA 1M5PC 3VF4A 4NZ0A 2XMMA 4KGZB 5FROA 1Q86O 4DFKA 2HVHA 4HCCA 1RHRB 2F9JA 3GYGA 4RNHA 2E29A 3NKYA 2RT3A 2F65A 3QETA 2P9IA 4HUGA 4KREA 5D15A 4PG4A 2LFVA 3W7BA 4X62J 3CWJA 1KD1O 4CZIA 1TK5A 4OFZA 4UOHA 4C98A 5BRDA 4XPCA 1J27A 4IO1A 1IN0A 3FZBA 5KFSA 3B8AX 3D5MA 3M8YA 1HBOB 2D3O1 3IGVA 1U1OA 1U6FA 1XNQK 4PQUB 2AJ1A 3THXA 4ICLA 2ZOFA 3A5LC 4O4GB 4D3GA 3ISND 4ATNA 3R2CJ 5AQLA 2HNYA 1XQSC 5KI6A 1FD8A 4AXJA 3PX4A 3VAIA 4CGDA 3E9OA 5HATA 3SI8A 2OPRB 4YOWA 1K9MT 2FVCA 3TEGA 1U1QA 3M1VB 2J8AA 2DHHA 4CM2A 5GAEI 4ZLPA 5AXKA 2CFXA 4CH1A 1OPIA 1HRHA 2HZAA 2VU5A 4QU7A 4PG5A 2HKEA 5ETTA 1DT9A 1MWQA 2QWLA 1TUGB 3PR4A 5KGWA 2X78A 2E1ZA 4IOAQ 2CGLA 1CZAN 2CNNB 4QBUA 1G99A 4YN3B 5ETNA 4F4AA 5AJ3F 1U1MA 3J81j 2OPQB 2YKQA 4QR0A 1RAJA 1QSYA 2BUNA 3DXBA 4L72B 4JI5F 2YY3A 4CVNE 2FGOA 4LSZB 4HLBA 1ZPWX 1HBNA 4USMA 2WSCC 2CJXB 4KE5A 3ET6A 1BE4A 3L6QA 1T8EA 4MFBA 1VRTA 6AT1B 1HR0F 3VQ6A 1K0VA 4LMZA 4B3OB 4HH1A 2VGNA 1FO1A 4LC9B 4BRHA 2E1RA 1VS3A 4A8XA 1AT1B 1WC3A 4URGA 3KVGA 4BR9A 4I7FB 1MNEA 3RR7A 1RT4B 3QBXA 4NA2A 5E41A 2HOEA 5EWFA 4P6QA 4O4GA 3M2UB 1UOCA 3VGSA 1JLAB 1WOPA 1RWUA 2Y8YA 2A1RA 1VQMN 1R0BG 3WBZA 4N7TA 4GW6A 4DB3A 1VQLN 3QFUA 4FKYA 1S9EA 3ET6B 1DHMA 2W40A 2WUSA 4CJRA 2GIFA 5CYMA 1RWMB 4JI2K 4CBXA 1RAIB 4NLXA 1XHZA 3W8PA 3UO0A 5DDPC 5DM7L 1HL6A 4RX6A 4Q0BA 4OX8A 4F0HA 4F02A 2Q3SA 1VFJA 2RE1A 5KT2A 2H48B 4BE2A 4KBIA 3KLFB 3WNEA 2QKKA 3AAPA 2GEMA 3M9OB 3OXGA 3BF4A 4DCJB 1F0XA 4MK9A 2LDYA 3TX0A 1RBUA 4IQXA 3BZKA 4RNFA 3CJ4A 9RUBA 1T9TA 4EZ9A 3MZIA 1U6BA 3IMQJ 2VPZB 5KOWA 1LWCA 5CYMB 3QIOA 4A8OA 5BN9A 4MDAA 5M1PA 3KNAA 3OTOK 3JTPA 3UPFA 4WKYA 4OYPA 1XMQK 4L3NA 3N5BA 1OQ6A 3LALA 1RQ0A 2DGTA 3GIRA 2CADA 1T9XA 1GH8A 2O8FA 2W4CA 3MGJA 4FWRA 1NGIA 1N34K 4B3RF 3A8YA 4M3XA 3OVSA 1EXQA 3MMCA 3MWBA 1UFKA 3L3CA 5C10A 1SIWB 3P5JA 2KW4A 2YNHB 2HS4A 3C15A 2VZ9A 2HBQB 4FZZA 3R5JB 3DXKA 3KJVB 1M5HA 1XEZA 2JC1A 2D3UA 3I6PA 3UCUP 2ZD1B 4Q2MA 4UY8O 2DNYA 2BBEA 4DN9A 1OMSA 3ZNJ1 4DR3J 4RKUC 3AA9A 3LM9A 2VODA 5KFDA 3T5LA 1RBLA 5KFEA 3CC2N 1DQ9A 3N28A 4I6AA 1IKXA 4LFBJ 3TJAA 5KT6A 4WYWA 5K8NA 2V5HG 3F73A 3CF5L 4CJWA 3PEJA 2P9KA 2XBPA 3VAHA 1JCGA 1W0HA 4P52A 5J2MB 2EKNA 2ZE2B 2DH9A 3R8YA 1RGVA 3GV5B 3CI5A 4IXCA 2HQFA 2HVDA 3SCLE 5CABA 1GTEA 4ID5A 5LMUJ 1KVKA 4FS2A 5AQGA 2FBXA 3ZEUB 2UXBF 5B0BA 1I5OB 4IO9L 1N5YB 1YWXA 4M5IA 1MDUB 1BC6A 2F1FA 4XTTA 3S6EA 4CJUA 2LYVA 3SMSA 2WB1D 1OVYA 4O3SA 5HQ8A 1H38A 2NRVA 1DZ5A 1FDDA 1LW0A 4X65K 1VQ5N 4LIRA 2LP4A 3T1HF 1C1BA 2KJVA 3G6XA 2L9DA 2OD6A 3JAMO 3SQ4A 3AJ2A 4DUYK 4X4UA 5B0EA 4PY5A 2BABA 3W2VA 1VRUA 1KVBA 5H9EK 3CO0P 4HT5A 5C2CA 5K8PA 3CYMA 3PM9A 2E5LK 2IDEA 2O8DB 3MN9A 4FOEA 1KR4A 1NB7A 4EYHB 4LJMA 4PKDB 5B0DA 2L08A 4AFFA 2VQEJ 2W1BA 2I5JA 2MKHA 2NQPA 1MN7A 4B3SK 4KHYA 2ZH9A 5KFLA 1F5CA 2U1AA 3GG0A 2XZTB 3FRYA 5LJ3Y 2MQNA 4IQMA 3H59A 3L2RA 2MJNA 4RTFD 3HI0A 1DLOB 4J2AA 2YHBA 5LL6Z 2M7SA 2ZHBA 2NUUG 4DTRA 1JL2A 2PFUA 2HBYB 4W5RA 2NXCA 4RNMA 1JQGA 4G1QB 4W98A 5T7BA 3KJVA 3PKYA 4WFXA 1WACA 2CUYA 4O8UA 5TKWA 2ZFHA 4CHNA 1IV0A 2DVIA 2GV9A 4L73A 3ZEUA 1HHTP 4WFNQ 5AQZA 2AMCB 2GQCA 4F50A 2QX0A 1JJCB 1IO2A 4B3MJ 2GCFA 1NHVA 3U9ZA 3RRHA 4R8UB 2V63A 3B78A 5H1SQ 5KQ8A 4IR9A 1MSWD 1S6QB 3TW0A 2IA0A 5E3PA 1NNDA 3PIOQ 5CYJA 3F56A 5KOXA 2A42A 1Q8IA 4M5DB 4OYZA 4DMNA 3IG1A 3N79A 4Z4IA 4C8ZA 3MK6A 3QRPA 2IVOA 4JYAF 1VQ7S 5IT9O 4BR2A 1OPZA 5C24B 2BMBA 5JXSA 1QUVA 4GKJK 3FFIB 4PWDA 3NAEA 4DV5K 5DETA 1VQ9S 4EHUA 3ZZZA 3WQUA 1SL0A 1UVMA 2I7NA 3DFEA 1RXOB 4WQ5A 2BM0A 4FJXA 4A4JA 1SH2A 3PIOL 2VDIA 1RTHB 4IEEA 3PX6A 5AQKA 2ZH5A 3L2QA 4OO1J 3HMJG 1EAYC 3AVCA 4KTZA 4GV6A 5BPNA 3O8MA 3CPEA 2KO1A 4QIGA 5KFOA 1Z4UA 3QQCD 3O80A 2XMUA 2J9DA 2ZVIA 4DU7A 2GW8A 2O8EB 1HQEA 3OV7A 1ZAWA 4DSJA 3FBCA 1FK9A 1KFDA 3NGSA 5G0RA 3Q23A 3TJ9A 4JKEA 4CHQA 2MKYA 3BH6B 3BQ1A 3WIVA 1X5SA 3H25A 3RAXA 4PUOA 4TQRA 4YEAA 5RUBA 4BC4A 4K4ZA 1YJVA 3RW7A 1IWAA 3AT1B 5F8LA 1VHFA 1RGIA 5HN0A 3G87A 4KHWA 4MK7A 4ZPWR 2HG4A 4DS5A 2ZBIA 4ZVUB 4J9RA 4C8YA 4DL3A 4IFVA 4H5WA 3HHEA 1RBAA 1UFWA 4USUA 3CJKA 3CCSN 2A6OA 5HANA 3SQ2A 1VQKN 2UXBK 2P9CA 4NLUA 3MMAB 2FZGB 3EVMA 3B82A 4UQGA 2GVDA 2HRUA 4ENOA 3DLRA 2BA9A 3BBFA 3DWLA 2GUPA 2ADBA 5DDRC 2MQLA 5J2NB 5AE3A 3NLCA 3ALYA 3UI3A 3VQAA 2I8EA 4YB7A 3F41A 5D8HB 4C3LA 3S7RA 4IO8A 5IS2A 1R6YA 2PFFB 4QS8A 3V4MA 1NSAA 1T44A 2OD4A 2DJWA 5GMKa 4KHNA 2HK3A 2YNFB 4DSIA 1N56A 1VQ7N 5HMZA 1T03A 3AV9A 1RWVB 3Q7BA 1WEYA 4YOEA 3PW0A 2E9RX 1XMQJ 3Q0AA 2JFDA 2E5LF 4JKGB 4J2EA 4WJBA 2ACMA 4PYAA 1IG9A 4MKAA 2J0QD 2GAHC 3DGPB 4CJKA 2MY8A 1AFIA 2W2NP 3H98A 4QWCA 3NVMA 5HROB 2EFNA 5AQIA 2BRKA 1NH8A 1JX4A 4AF1A 1RWPB 1CQMA 2MGZA 3D0GE 3EL2A 3FQLA 1KRPA 3TZWA 4OGEA 4KB7A 2VPWB 3CJSA 1BHNA 1X31C 2HK2A 3VR1A 5FD1A 1TKZA 3DLBA 3FGUA 2I9SA 1LWFA 4NA1A 3HJFA 5I9EB 2N4DA 4B1VA 3TAQA 1X4CA 1NLKL 2OEJA 3AB4B 1BA1A 2RKIB 4FJ9A 4WFZA 4MKVA 3QINA 5EGYA 3H08A 2V9WA 3DRRB 2R7TA 5J1EA 1EJ7L 3FC9A 4ECRA 4DV3F 3CMAN 2LXIA 3AGKA 2BE2B 5L9XA 2J9CA 3H7HB 4Q8EA 1WEXA 4FJNA 3RGIA 4YMEA 3P49B 4CEBA 4QYZK 4RUBA 4QOTA 4FF2A 1TL5A 4JI7F 2MKCA 4CZCA 4OI4A 2IMWP 1C1CB 1BHLA 1D9AA 2O8FB 2WOMA 2PMWA 2O8DA 1S9GB 1K0TA 1GLAG 2OAUA 3LTOA 4OPAA 3NHGA 1X5OA 3IDHA 3L2VA 3BKTA 1EKSA 3KKRA 1CZBA 5A8WA 2QWRA 3VAFA 3QEVA 3OYLA 2DXEA 3C2PA 4M3RA 5KFTA 1RBOB 1YJ9N 2MZQA 1ESVA 3FNNA 4U95A 2V8VA 3R7SB 3PFOA 5T14A 1T9UA 2KT5A 3UN2A 4FWNA 5EOYA 1BUXA 2AJ2A 4X4NA 4CTAB 5T41A 2R2SA 3VQBA 3KG4A 5K14A 4E1NA 3NBPB 3C14A 1G6BA 1VIOA 2G8FA 2J0XA 4B1ZA 3THXB 2ZUAA 2CG8A 1GLDG 1RB0A 3A3OB 4FWSA 1SJ3P 3N6NA 1FRIA 4M45A 3MCNA 4AQYF 2D0CA 1S0VA 1YLXA 4OKJA 1K1SA 2HFOA 1X3MA 2VL1A 1TVRB 5CH7B 2RH3A 1BA0A 1A5XA 3U3GA 2G8WA 2AW0A 4B9VA 4J8FA 1FFWB 2W2MP 2GIRA 5E7OB 2R2TA 3CCEN 4CK3A 5DDOC 2HWTA 2BE9B 1QAXA 3NGTA 2HF3A 3CJCA 5FRNA 2FSKA 1WI8A 2ZBCA 1UWBA 4ZVHA 1LFWA 5CYQB 4X4RA 2OSRA 1VHIA 1JLGB 1Y5NB 5ETRA 1HR0J 3GCXP 2JOQA 1QS4A 4JN4A 1U4BA 1WB9A 3UDLA 2XCPA 1Q8LA 1HKBA 4XEIA 1M5SA 1NDKA 1ZM2A 2IM0A 2HPUA 2ZH1A 3LWLA 1JLQB 3SPYA 2BTFA 5EX3A 4Q43A 1Y3JA 3SSSA 3EICA 3MAAB 1TL7B 2H4YB 2KT2A 1VQ4N 1D09B 1BUPA 3MM8B 2FJDB 3FGVA 3EZUA 1NO8A 3LP1A 1RT4A 4J5OA 3QFHA 2EX3A 1JKHA 3LANA 3TSUA 5FPEA 2KXNB 3CM5A 3JB9k 3PO5A 2P9NA 2V8GA 4BACA 5EX0A 3OL8A 4I6YA 1IBKJ 3OHAA 3BYRA 1G7CB 4NXNJ 1GMWA 2IHR1 3AVJA 2Y1JA 4CGHA 3X3UA 1RT7A 1IJJA 1RILA 4A8SA 1N5QA 1LOUA 2PYLA 3R3LA 2VB6A 1UVKA 2OYQA 2HHSA 3UQSA 5EWGA 3ENVA 5THWA 2JLEA 4BC2A 1F3FA 2KH9A 5IOLA 1X0FA 1J54A 2WFBA 4X62F 4EWTA 2H65B 3ENWA 3CCRS 4E19A 4OI3A 4DQRA 1S97A 1P6TA 3IXQA 2HVZA 1WC1A 4DSEA 1QY7A 2E66A 2E2NA 4AUKA 2BKNA 3CPWM 1QQOA 3NNHA 3TA1A 2UUAF 1VBXA 4K4YA 3UKRB 4IDKA 2AJFE 3L09A 2I0XA 5K8MA 3HFZB 4EFAC 5KAKA 3V9SA 5H1SV 3GG4A 4CD3A 4U8VA 3J7ZT 3KFWX 4NZ6A 4X64F 1JXEA 4DU4A 1S6PA 5F1XA 3E2EA 2V0NA 5JMVA 2OP5A 1VLOA 4RLEA 3AGRA 2ROGA 3Q86A 2AGPA 3S3NA 3DOKB 1D3WA 3G82B 2GUIA 2PAVA 1QSLA 4AHCA 2F4VK 3W60A 3ZSZA 2Q3PA 3M6GA 2YH0A 1SBRA 2QYCA 5AFUA 2AP6A 3OS1A 1LWCB 1K73O 2F96A 3VF6A 3M9NB 2XMJA 4O5BA 4A8MP 4KR0B 2QI2A 3SQGA 4NX9A 1S6QA 1ZM3A 2FJWA 3UDCA 3OYKA 2IM1A 3CDWA 4C3KA 3W9HA 5DZ7A 2ZOGA 3DHWC 1Y5IB 3CCES 5G4DA 4FJ5A 4OYAA 4Z4GA 3H3NO 3OTOF 3M8ZA 2RKIA 3VQ4A 4O55A 2BJ7A 5KFYA 3ID8A 1GMWD 1UJ6A 3RR8A 3CIPA 4JV5F 1AB8A 2XI3A 4YDXA 3QEIA 3KK3B 2XSJB 4A48A 1TKXB 5JS2A 2ZH8A 1RT1A 1OIAA 4JD2A 3HXMA 3CEDA 3M4XA 2HVEA 3LPTA 3VQDA 4FJJA 4O0IA 4M8LA 4JK7A 3AO5A 3R6LB 1OY9A 3GTYX 5I4MA 1JLFB 2Z8QA 4ZVRB 3H2VE 4RWTA 4OPJA 1SUQA 1P9QC 5E0OA 4WCEL 4BRIA 2Y1LB 4OZ2A 2V4QA 3R1LA 1HKCA 2DGUA 4A47A 4Y0WA 2FZKB 2ZNZA 4KY3A 1LQ9A 5KFIA 3VF0B 1CQNA 4JI1J 3V9ZA 3KHRA 4FYVB 2HF4A 4NCGB 3QT5A 1EWRA 2WBNA 5DLFA 1XMBA 3SBTA 5FLXY 2AEJA 4RG8A 5HL7L 2O8CB 3MECA 3RMDA 1WOSA 1K8AT 3D2FB 1BD6A 3KG1A 4P75A 5D0EA 5JVHL 3D6HB 1ASWA 1PYSB 1IUJA 3OTEA 4ILHA 1HLWA 3FE1A 2B9YA 1S0OA 1ZZNA 2YPYA 3QT6A 2M70A 3FQKA 3NCRA 3NGKA 1UW9A 4IJAA 1Y64A 1FRLA 4OZNA 2YQ1A 4KO0B 3AODA 1KVAA 3VPZA 5J2QB 2AQ4A 3R6MA 3TPQA 5FLXO 4Z4HA 1J2VA 2AT1B 4IH6A 3LGMA 3KKFA 8RUCA 4ZMMA 3HHLD 2GV1A 1B92A 3O3GA 3FSYA 4W5OA 2WONA 4OL8A 2J7UA 1X9MA 1UWBB 3U3YA 2OTLS 1MWYA 1TYQB 2XMTA 1PAUB 3V9XA 1N0VC 3MEEA 3KTQA 3UDEA 3GYXB 1C0FA 3R97A 2ZBQA 4WTYA 1JNZB 2FBYA 2MHEA 1VBYA 2EW9A 3BS9A 1Y00A 1RBSA 3E51A 5DMRA 1B0TA 2D5RA 1W7WA 3ELHA 1R3NA 5KFHA 1X9JA 5KPZA 4M3WA 2Z1JA 1RKJA 5M1QA 4OZ1A 2N7YA 4CJLA 3ZZOA 2V8HA 1X4FA 2DR5A 4NCAA 1E6YB 4JI7J 4OJ3A 4OMFG 2D7SA 4HI1A 2ZH3A 2B43A 2VFVA 3M2UA 3OSPA 2W8LA 5DQHA 1RCHA 1UAWA 4H0XB 2NYIA 5AJ3J 4AD6A 2MQ8A 3NOGA 4FSVA 4OX6A 4MLHA 3D2FA 1HPZA 3E1YA 3VQSA 4N41A 3OVBA 1MA9B 5A6PA 3NFAA 1GX5A 4DR7J 3VGUA 2DR7A 4FF4A 2AD9A 4BRLA 3DDIA 1DTQA 4QZVB 3JSRA 2OEMA 2EHGA 4X4VA 2UUCF 2UU9F 2K2PA 3DCAA 3CTRA 5M1KA 4GVLA 4QWEA 1S1UB 3G4SS 1Q7YO 4FZVA 4H54A 1HPMA 1NHUA 3N5FA 3DXKB 7AT1B 1WG1A 3WQTA 1MG7A 1APSA 5ADXH 4P72A 1FF2A 4DR5F 1S10A 4WFAL 3FRZA 4U9RA 1Q5YA 1JXBA 3A8IA 4JV1A 2VOOA 1QAYA 3NGDA 3ZT2A 4X65J 4H4MB 1ELOA 2DHGA 2E8AA 2B4PA 4GO5X 1LWFB 5DQGA 5GADU 3BGFA 4O8KA 4YB5A 1IKYA 4B3TK 4Q44A 2VFUA 2F9DA 4QR1A 3M8QA 3TUPA 4KH4A 3K0SA 4C8LA 4YHHJ 4DS4A 4CCHA 4DQPA 4KFBA 1L3SA 1QD1A 3QZ7A 3CCMN 2CJKA 3C0BA 1HMVA 1CEZA 4KYZA 3H6EA 3K58A 2XMWA 3PYEA 2HNDA 1Q78A 2LXUA 3NEKA 1NAQA 5GAEU 2B5JA 3O08A 3GIIA 5D0RA 4PZVA 5KFAA 3KMQA 4KHUA 1KQSR 1E6VB 1N6QB 2R7OA 3HSGA 5LMUF 4FLWA 4ZVFA 2FB0A 2KDOA 1RCXB 3G9CA 1Y9OA 2DY1A 3CB4A 2HSEB 3EXCX 3BDEA 5B08A 4M63A 3DRPA 3O6QA 2YJEA 3OJSA 3SUOA 1B9FA 2CJBA 4ECUA 4OQJA 1RU2A 4I4BA 2YX7A 5AFUH 5AQYA 1VQON 4NXNF 1CVJA 1S1WB 3MOJB 4OZLA 4OHXA 4DSFA 3AY0A 3V6DA 3TX8A 3WEEA 2DK2A 1W97L 4J90A 4RW6B 2BQ3A 5KT3A 2IVMA 3ZSYA 4R5PA 3VALA 1K47A 4KHSA 3NNCA 2XMKA 1F21A 5GAHI 2RUGA 4FW2A 5E3CA 1RWKB 2Z2YB 2W01A 3I8BA 3WNFA 3VEOA 3VQ8A 2F4VJ 3SBMA 1BO5O 1FTRA 3H5SA 1FJEB 4CEFA 4MMOA 1HWLA 3VQ7A 2WBRA 3MUMP 2KFYA 3HVWA 2ZF5O 1CJTA 2CQGA 4DTOA 3LP1B 3D4JA 2RQMA 3D6RA 2V94A 5IQQA 1M5KC 2Y1RI 3IS9A 1ZYQA 2Q43A 2HHWA 1FJGJ 1QVFM 2ZKTA 3BSNA 5I3QA 1D8YA 4ZKAA 3JQJA 5IFMA 2DITA 4N8NA 2NSCA 1MLAA 3DRXA 2LQBA 5C25A 1K73T 4RW9B 3L2WA 3Q8UA 3GLJA 1FT8A 2KRBA 3M6UA 4OVLA 1I39A 1TKTA 1YG0A 3R7NB 2G9OA 2G13A 2IA6A 4ISEA 3OSNA 1DRZA 3KLIA 2WW4A 2W7PA 2QTDA 2XZWA 3GV8B 3K89A 4FJ8A 1IXKA 4H4KA 3VZHA 4CNYA 3OTDA 3ZO7A 5A8KB 2PY5A 2QLBB 3BF1A 4A5BA 5F8IA 2VJVA 2J6SA 5KFMA 1N32J 4DU8A 1FD2A 4IRCA 3C14B 4OI0A 2WSEC 1L5UA 2NRRA 1GLCG 3VEWA 1PCAA 1V5IB 3MDQA 4Q8FA 3HDSA 1F1BB 4ANEA 4K8ZA 1GLLO 1QTMA 3NMRA 3N4PA 1ITPA 1U1LA 3H42A 4UW2A 2ERRA 4BC7A 4PL7A 5E3QA 3NH2A 2R7VA 1RADB 1ASUA 2LQ5A 2O3DA 2AJQA 2HBLA 1RAFB 1GLBG 2CNLB 1U47A 1VK8A 3V6DB 3TUIC 4ED8A 1N34J 2V52B 5CZXA 4C9DA 3AB2B 2DGXA 5DO2A 1ZBFA 4MO4A 2AP1A 3T1HJ 2ZM6F 4TSXA 1EP4A 3THYB 1TFYA 2WB4A 1JLCB 5AQUA 2EFVA 4FLVA 5IM0B 1DKGD 1U48A 1RTJA 1HFEL 1XR5A 3SAGA 3UD3P 2X6SA 2K3IA 2KTQA 2P51A 4U7UD 4DV1K 1SCJB 1I94K 2MLYA 2RQKA 5K20B 4Q0BB 2JWNA 2ZM6J 5CA5A 4EZ6A 3PFEA 3EX7B 3I56N 2RPIA 4CLWA 3ZSRA 1WF1A 4IEIA 5AQPA 4F7VA 4DLEA 1VSLA 4DR2J 4AQYK 1LKZA 4TNOA 5AZJA 1GFWB 2C2NA 2DNOA 4KH5A 3O4NA 4ZTFA 3GWCA 3P96A 3QNNA 3HOSA 4ZVOB 4H03B 2BEFA 2IAJA 4IUFA 2KFNA 2DFFA 5EN1A 3GMGA 3BEGB 3TA2A 3IAM9 2NYHA 1WG4A 2N3LA 2OA8A 3MMBB 1Q18A 3P5TL 1GOAA 3G25A 3SDEA 4BDZA 4B02A 4NMLA 4FXVA 2R8GA 2GMLA 2NXNA 5A2QO 2UUTA 2ZJRL 4KHMA 4E89A 3GV7B 4GMKA 2UUCJ 3AA3A 3W3DA 4GV3A 4K43A 4FCYA 2DNNA 1J6ZA 1RBTA 2QLXA 1IBKF 3LDQA 3QGGA 3SCIE 4A8KA 1FEEA 4XDDA 1AROP 1RTIB 3BPDA 3MD3A 4OLOA 3QRQA 1JLQA 1ZBTA 2VYPA 4BC9A 1FE4A 2D69A 1H7WA 2UXDJ 1CS4A 3TR5A 1NGBA 3NCQA 4K4SA 2R4FA 3WX4A 1BGXT 2FBTA 3LDNA 2YKNA 1IBMJ 1YBUA 1AA1B 3KLGA 4N47A 3N4QA 4AHVA 2CWKA 1R8PA 2DNMA 3AO1A 1GOCA 2ZWHA 4K4UA 4FXDA 4I6WA 2NZCA 1LAWA 4PXBA 2D74B 2RDDA 4ER8A 3NGRA 3ZSXA 4BREA 1BQXA 4CGGA 2H51B 1P1TA 4UUWA 4ITSA 3HHLC 4CJFA 1KLMB 1PC5A 4DN0A 4H0OA 1NSQA 3ZSQA 2NRWA 3NF6A 3CCZA 5IWAK 3OYFA 3H2UB 2GJFA 3KD1E 2VDHA 3T9ZA 4KB1A 3TRGA 2E9TA 1VSFA 1RHQB 5ETVA 2QA4N 3K7RA 2HHPA 3POTB 2Q1NA 5GMEA 4JI0J 3W5YA 4DTJA 5L1LA 1QZ6A 4TLQA 1HD1A 3LDPA 5CY4A 5ETQA 1NWKA 2H9ZA 4DSKA 4U7BA 3JXOA 3MMCB 3IAS9 2C3PA 3VCDA 1SVDA 1JCEA 2IC3B 3D67A 4ZPBA 5H9EJ 4EHTA 4YY3J 1UFLA 3S01A 2FSJA 3TARA 4DV1F 2FJXA 4U8YA 5BN8A 2DFHA 3O4WA 5HVHA 5LSLA 4CBUA 4DTXA 4DDFA 2PO4A 1SQKA 4DV0F 2C2KB 4X4OA 3K9JA 2VQEF 2XYGB 3PRVA 4JI3J 2UXCK 4ELUA 2MKIA 3Q7CA 2MPUA 1MWKA 4FKXA 3LF0A 4FLYA 1WBDA 3IS9B 2HHXA 5BPLA 3R1HA 5GAGU 4YP3A 2ZC4A 1WDDA 1N8RT 2F8EX 4LBHA 1F9EB 4XDCA 3GBTA 3ENAA 1M90T 2VV5A 1LK5A 1Q7LB 5JVHQ 1BISA 1XNQJ 1KC8T 1X5TA 1SL1A 2LQ8A 4J9VA 2PIIA 5AQJA 1VRTB 4I6MA 1OH7A 1WKJA 3QIPA 2PFDA 3PJWA 4F3OA 1GX6A 3DYAA 4RNNA 3JSMB 4J37A 3OFHA 4DUZF 5HQLA 1NNEA 2VWJA 1IBKK 2GQ2A 2EBEA 4CTAA 4RW8B 1NBEB 1VGYA 3HZEA 4JKAA 2DYAA 1WI6A 1C2PA 1QSSA 3GIJA 1BI4A 5IZHA 3EVWA 2Q1LA 2JEJA 2IVNA 1YITS 1D8ZA 3TVKA 1WC6A 1HPZB 2MTLA 3LZJA 1LV5A 1V4TA 1YJ9S 4RPFA 3BGOP 2G8UA 5I42B 3FZKA 1DTQB 2FPHX 4DR1K 3AFGA 3TQ1A 3QEPA 2GO8A 4PWUA 4ED2A 4KTWA 2KT3A 3S8SA 1VK0A 1M1HA 4I6MB 1QTNB 3C3LA 2RSQA 4B08A 1VK3A 1XN9A 1C1BB 3LP0B 1RACB 5JLHA 1JLEA 4R79A 4ZLLA 2FLNA 4CIEA 3HSCA 1N36J 4K0KF 3ILLA 4Q5VA 3VTHA 1GQEA 2MQMA 2ZJRQ 3J7AP 2Q31A 4CLKA 1W9HA 3ZTSA 1RA7A 3HX9A 2GJIA 3A5NC 1NK8A 4PWDB 4PYDA 2ZBRA 4USHA 2IAJB 4CO2A 2KVIA 5LY3A 2H5JB 1S49A 2NUHA 3J80O 3EUNA 4OZ5A 1LEOA 3WX8A 1D9FA 4B9LA 4O4RA 1MROA 4CLYA 3CC7N 2VFSA 1NMEB 1JCFA 2QLWA 2YNGA 4X64J 2JEGA 2OEKA 1N5SA 1SJ1A 4H4OB 3OUYA 2GWJA 4RW8A 2GFFA 2FJBB 1VQPS 4JI2J 2L41A 1C0UA 1U09A 1VQNN 3GFZA 5J1EB 1NZ8A 1YRUA 2O4GA 3K5PA 2RUSA 2M5YA 2MZTA 1EX8A 3D0IE 4HTLA 3OYEA 1REVA 1VSKA 4UT4A 4KKOA 3FDSA 1ZBLA 3L2UA