3AVJA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avjA00
2E4LA 2WONA 3RWUA 1Q9XA 4CF1A 1RTHA 3OYMA 1SL0A 4OKJA 1RCHA 3QNOA 4CJLA 1RBVA 3LP0A 3MEEA 4BACA 1Y97A 1LAVA 4CFAA 4FZXC 2O4GA 3WNHA 3OYBA 1HRHA 4ID5A 4C8MA 4FLZA 1U45A 1QSSA 4B9LA 2D5RA 3HPOA 3F9KA 4O55A 3KK2A 3EY1A 3I8DA 3OYKA 1X9MA 2B6AA 1LV5A 4HTUA 4Q0BA 3RMDA 4AHTA 1WN7A 4IBNA 1U47A 2X74A 3M8PA 2HB5A 1NKCA 4KAZA 4FLUA 3DYAA 4LY7A 2VWJA 3AVGA 4HVJA 1YTAA 5C42A 3HXMA 4F3TA 1S1UA 4FM2A 3LAMA 4HUFA 3TANA 3TAEA 4CK1A 3K5NA 4DSKA 1A5VA 4RW8A 3C6UA 2JLEA 4CF0A 3VA0A 1C0MA 4CJ4A 3KK3A 1T8EA 3SV4A 2G8IA 3MXMA 3TWHA 1S1XA 5J2MA 4KPYA 4CHOA 4AILC 4FJ5A 2F96A 4FJ7A 1EXQA 1VSDA 4O4GA 4DTXA 1SL1A 2G8KA 3QIPA 1C1AA 4UQGA 2YNHA 2IS3A 1VSFA 3MECA 3ZT3A 4CFDA 2IDOA 3AA4A 4ELTA 3K57A 4F2SA 3AVKA 3QINA 3G10A 4DFMA 2OYQA 1KRPA 3AA3A 4FJGA 1TL1A 1JLCA 4FW1A 3TR8A 2XHBA 4QOZB 1S6QA 2ZE2A 2HNYA 2HVIA 4ICLA 3AVMA 4FZYA 4KHSA 1DTQA 1S1TA 3AVIA 4KV8A 3SPZA 2KZZA 1QQCA 4BDZA 5HLFA 1LW2A 4Z4CA 4Q5VA 3SPYA 1EKEA 2Z1GA 4AHUA 3L2WA 3DOLA 3CQ8A 3NH0A 4HUEA 3O4NA 4E7LA 4B8AB 1SUQA 3NF6A 3KIOA 5CYQA 4JRQA 3LPUA 3RMAA 3DLHA 4CGGA 1D8YA 3KTQA 4CJVA 2DFEA 3HYFA 3AVLA 2ZD1A 3B6PA 3VQQA 4B8CA 4CHPA 2GV9A 4KO0A 5DMRA 4ELVA 2HHXA 4CGJA 4FVMA 4M3YA 3HP9A 3FFIA 3MXJA 3HL8A 1NK9A 2LSNA 3AV9A 2VWKA 4B08A 3SJJA 3WNFA 1B92A 1VSKA 2DY4A 2A1SA 1NK0A 1YVUA 2E6LA 4FJ8A 4AHSA 4E7JA 1RDBA 4IFYA 4IG3A 4CFCA 4Z4HA 2YNIA 4C8OA 2FBVA 4E7KA 2X78A 3PO5A 3KLEA 4N76A 1C6VA 3HPHA 3C6TA 3HVRA 3RR8A 4BWMA 1FXXA 4ZHRA 3WNGA 2P51A 3RR7A 5I42A 4K8ZA 2Y1JA 4KHUA 4HHTA 3QO9A 1WSHA 2YV0X 3QEPA 3VA3A 3IS9A 3V9XA 1TK8A 4B9UA 3CFOA 4N5SA 1ZBUA 2G8FA 1BQMA 1RTIA 1IKXA 4LD0A 4FJMA 3DLEA 1EP4A 4CEQA 1BCOA 2QKKA 1Q9YA 3OYEA 2RPIA 3SCXA 4BDPA 4JLHA 4M3UA 4CEAA 3DOKA 5JS2A 1FKPA 4LSLA 1BGXT 3KLFA 1U4BA 4O44A 2HHVA 3V1QA 1TGOA 4XIUA 3K5OA 4OGCA 3WNEA 1C0TA 3AO1A 3AO5A 3KKRA 4DFPA 4M42A 2RF2A 3U6FA 4ZTFA 4MQ3A 4KTWA 1U49A 5HRSA 1NK7A 4GVMA 3KLIA 3VQBA 4CF2A 3M8QA 3NF8A 4AH9A 4N56A 3KJVA 4DTUA 4DTPA 1NK6A 2G8VA 1BIUA 4OPJA 3KLGA 1U48A 3AVNA 3V4IA 1VSIA 1IO2A 4FK4A 1RBTA 3T1AA 2G8WA 1SV5A 1JL1A 1ASUA 3AA2A 4JS4A 1S9GA 2XY6A 3L3UA 3SUNA 5CY4A 1L3TA 4EZ6A 4CJUA 4E1MA 1LWCA 4RW9A 3OYGA 2XO7A 4AHCA 4E7IA 3PX0A 2BDPA 4W5OA 1VSLA 2VG5A 3T19A 1CXUA 2FBXA 1EX4A 4M3TA 4FLXA 5HRPA 4R5PA 3A2FA 2O4IA 2XY8A 1I3AA 4CF9A 3V9UA 1HYVA 4FM0A 1HMVA 3OYJA 3OJSA 4Y1DA 1IH7A 1UA1A 4KHWA 3C94A 4CJ5A 1ZYQA 5FRMA 4CJPA 4CHYA 3NGZA 1N6QA 2QK9A 1NOZA 2HHSA 4LH5A 1X9WA 4CJQA 3TAMA 3QEXA 1FKOA 1ASVA 3V1RA 3DMJA 1NJXA 1MU2A 3AVFA 3SV3A 4QAGA 1CLQA 4HCCA 3DRSA 3O4QA 1IKYA 2X6SA 3IAYA 3LAKA 2R7YA 3V9WA 4KB1A 2HVHA 3DLRA 4PQUA 3L3VA 4DQRA 1T03A 4AHRA 3PO4A 3V9SA 1JLFA 2FBYA 3O3GA 3ZT2A 1UAXA 3TARA 4PY5A 4I2QA 3V6DA 3HO1A 2KFNA 4FLWA 3I0SA 3D0PA 5KGXA 3AVJA 1RT3A 5KRSA 2WOMA 1BCMA 1S1WA 1RBRA 1RT2A 3NGIA 4B9TA 4EZ9A 3HM9A 1HQEA 2RKIA 1XI1A 4DFKA 4OGEA 4E7HA 1HPZA 1LW0A 1YTUA 3JSMA 4FJKA 4M3WA 1G15A 4TSXA 1T7PA 3L8BA 2AJQA 3OS2A 1HNIA 1REVA 1JLEA 1VRUA 3OYNA 1A5WA 1ASWA 4E1NA 3TI0A 1Z26A 3OYIA 4ZTJA 1X1PA 4HUGA 3PY8A 3HJFA 1QSLA 2G8HA 2ETJA 3OVNA 4CGFA 3MEGA 3U3GA 3TAFA 2F8TA 4CK3A 3SQ0A 4G1QA 5FDLA 3OYCA 4KI6A 1LWEA 2RN2A 5HROA 4KI4A 2IOCA 1S5JA 5FROA 3S3OA 2QXFA 1D9DA 2HHTA 1QE1A 4CIGA 4KHYA 4E3SA 2YKNA 4BWJA 4KHQA 5CZ1A 3VQAA 3V9ZA 3SUOA 3AVAA 3AVHA 4DU3A 4RG8A 4DMNA 4BE0A 3RRHA 3F73A 4H4OA 2KFZA 4BE2A 2A1RA 4I2PA 3EZ5A 3BGRA 4DU4A 3V81A 2YKMA 4DSEA 1KSPA 1BI4A 3LANA 4DQPA 4FJIA 4PUOA 2QKBA 2EX3A 1BL3A 1C1BA 5JS1A 3OS0A 5FRNA 4M45A 1C1CA 3ASMA 4JS5A 4DS5A 1NJZA 4N41A 1RDDA 4CGHA 4M3ZA 1Z25A 2GBZA 5J1EA 3LWMA 1EETA 1VSHA 2KQ2A 2W42A 4FM1A 2IAJA 2OPSA 1R0AA 3D45A 4OKEA 3U3YA 4IG0A 2HMIA 4J2AA 3UIQA 3CFPA 1L3UA 1YT3A 3ULDA 4E89A 1U04A 4O5BA 1JLQA 1UOCA 4RW6A 2OPRA 1QSYA 4B9MA 3QNNA 4AHVA 2Y1IA 1ZBHA 2HHQA 2JGUA 3LALA 2OA8A 3SYZA 3IRXA 1HQUA 3ZSOA 1RT7A 4O0JA 1TL3A 1ITGA 2Z1JA 3NH2A 3LZJA 3ZSXA 5K14A 1JLAA 3PX6A 3DLBA 1QHTA 2VG7A 1NJYA 1KVBA 2IC3A 2X6NA 1D9FA 1BISA 3OYDA 3KKSA 2OPPA 3VQEA 4KB0A 4QCLA 2VG6A 5KGWA 1XHZA 5J2QA 4LH4A 3TAGA 4KREA 1WSIA 3VQ4A 1QS4A 1JL2A 1VK0A 2KW4A 4OKKA 4CK2A 4CCHA 3VQ9A 3ZCMA 4FLVA 4W5TA 1WAFA 3VQ7A 4W5RA 3NE6A 3DI6A 3ITHA 4F8RA 4Y1CA 1LAWA 2ZQBA 3KD5E 4Z4EA 1TKZA 4CHZA 4IDKA 1JLGA 1BQNA 4CEFA 3G0ZA 1RBUA 4W5QA 4CJWA 4CJRA 4EP4A 3OYAA 4FLTA 3SQ4A 4LSNA 4FK0A 2BANA 4GMJB 4CHNA 2PZSA 4B9VA 1RDAA 1WSEA 3MEDA 3HK2A 1BI4B 4DLEA 2G8UA 2XY5A 3LP1A 4F2RA 3BDPA 3CM6A 4RW4A 3VQ8A 1WSJA 1IKVA 1F21A 2Z1IA 4PA1A 4FJXA 3E01A 4FLYA 2XRIA 2Z1HA 4FW2A 4NYFA 3DLGA 3RMCA 3THVA 4F4KA 2BE2A 4HCBA 4NCBA 2BGGA 4DQIA 1TKDA 1VSEA 1GOCA 2B4JA 4DQQA 3NF7A 3QIOA 1C0UA 4CIFA 1WSGA 3RMBA 1B9DA 4CEBA 2OZMA 3ZT0A 4L8RB 1TKTA 3QEWA 3S3NA 5KI6A 3OY9A 3P1GA 1DLOA 4I9QA 2D0BA 3HVTA 1RILA 1SL2A 3K2PA 1KFDA 4KFBA 3ZSZA 1HYZA 1RNHA 4FK2A 1RTJA 1KFSA 2HNDA 4B3OA 1CXQA 1NK4A 4CJFA 3HT3A 1ZBFA 3SUQA 3OS1A 1IG9A 4I7FA 1CZ9A 4DF8A 3DLKA 4DQSA 1QTMA 3P5JA 1KLMA 3NF9A 3AO2A 5DK5A 3ZSQA 3QESA 2E6MA 2P1JA 4BE1A 2PYJA 3IG1A 3ALYA 1L3VA 1TK5A 2D0AA 4C8KA 1ZBIA 4DSIA 5J2NA 1J54A 3KK1A 3LP3A 1W0HA 1A5XA 1W9HA 2KZMA 4E0DA 4FCYA 4DLGA 3AVCA 3OYHA 1TAQA 3DM2A 4DSJA 3L2QA 4J2BA 3VQ6A 4KTQA 1RBSA 2P5GA 3NDKA 3T3FA 3CG7A 1ZBLA 4DTSA 1SKRA 4FXDA 5SWMA 1JLBA 3VQPA 4CE9A 3CYMA 3ISNC 3RRGA 3SNNA 3I0RA 3M8SA 5T7BA 1TK0A 1DTTA 2DFHA 4Z4GA 2D0CA 4GW6A 3HSTB 4EP5A 3TAQA 2HW3A 4IKFA 4W5NA 3SQ2A 1O1WA 4O0IA 3AVBA 5HBMA 3PX4A 2ATQA 3HPGA 2I5JA 4C8LA 3TAPA 3AO3A 3OYFA 1FK9A 1WAJA 4CESA 4CEOA 4B9SA 1JKHA 4CJEA 5HRNA 3LWLA 1TVRA 3O3FA 1JXBA 2XY7A 1HJRA 3S3MA 4I9LA 1BIZA 3AA5X 3CFRA 4CEEA 3MAQA 3HP6A 3JYTA 1IKWA 1KTQA 3VQ5A 1S6PA 3C95A 3M8RA 1TKXA 3QETA 3QEVA 1RTDA 1NKEA 1GOAA 1J53A 3L2VA 1UWBA 4MFBA 4ELUA 5C25A 2OZSA 1HYSA 3L2RA 1S9EA 2DFFA 3P83D 1Q8IA 3ZSYA 3L2UA 3EYZA 3LZIA 4DTOA 3NCIA 3MXIA 3RTVA 3OYLA 2NUBA 1RDCA 3NHGA 4OLAA 2Q3SA 2DTUA 2KTQA 5CYMA 2YHBA 1B9FA 4DTRA 5KTQA 2OPQA 4ID1A 4CHQA 4JRPA 4M3RA 4FJNA 3ZT4A 1L3SA 1K6YA 4KKOA 1N5YA 4C8NA 4Z4FA 3DRRA 3NFAA 4CJKA 2PYLA 1KVCA 3AO4A 1VSMA 2FBTA 1TAUA 2YHAA 4KTZA 3NBPA 4OVLA 5HP1A 4K8XA 1UA0A 4FJ9A 1NJWA 2YNFA 1CZBA 1JXEA 4H8KA 3LP2A 3ZSRA 1SKSA 4FJJA 5I3UA 4CEZA 3TABA 4DTJA 5D3GA 3K58A 4H4MA 2IGIA 1KCFA 4N47A 4DSLA 1NKBA 4PWDA 3VN5A 3QERA 3KLHA 4J2DA 3S9HA 1HNVA 4Z0UA 4DFJA 3SI6A 4J2EA 5HRRA 5J2PA 3SQ1A 3OJUA 4FJLA 3O3HA 3K59A 3PV8A 3K5LA 1SKWA 4CJSA 4CEDA 4CGDA 4DS4A 4FZZA 5KRTA 4KHNA 1LWFA 3ZSWA 1NK5A 1BHLA 3VQDA 4RW7A 1L5UA 3NH1A 4FJHA 3B6OA 1VSJA 4CJ3A 4BDYA 4CF8A 4NYNA 5EU7A 4OJRA 2YNGA 1I39A 3CM5A 1RT6A 4DF4A 1J5OA 4YNQA 4B9NA 1VRTA 4OLBA 4M41A 3LDSA 4KRFA 1GOBA 3LPTA 4FYDA 2PY5A 1WNSA 1RT5A 2HNZA 1S1VA 1X9SA 3H08A 4CIEA 4OPKA 2B5JA 3K5MA 1KLNA 4M3XA 1WSFA 5E41A 2P5OA 2HHUA 4DWIA 3V1OA 3QEIA 4YFUA 4CGIA 1XWLA 1D5AA 1NK8A 5SZTA 3VQCA 4IFVA 4DTNA 3ZSVA 3SZ2A 4E19A 1WLJA 2EHGA 1XC9A 2F8SA 1KVAA 3NAEA 4WE1A 3SUPA 5CZ2A 5C24A 3ZT1A 4NCAA 4DSFA 3KD1E 4NCGA 1TV6A 4DG1A 2ITGA 3DRPA 4CJTA 1J9AA 2FC0A 4DU1A 2HHWA 4CECA 4CFBA 4DTMA 1RT1A 2GUIA 3QLHA 1XHXA 1T05A 3NGYA 4F3OA 3PUFA 1NOYA 4CERA 4Z4IA 1RT4A
chains in the Genus database with same CATH superfamily
2WBNA 1T6CA 3J7YP 1SL0A 2YHYA 3QNOA 3MEEA 1YI2N 3OYBA 4ID5A 4O55A 3I8DA 1X9MA 4Q0BA 5BRHA 2HB5A 2YJEA 1DKGD 2E1ZA 1WBBA 4FLUA 3GE1A 2CGJA 2FLOA 4RCHA 1YTAA 4F3TA 3TU5A 2JLEA 2QWRA 1C0MA 1FJGK 3MXMA 3IMXA 4AILC 4FJ5A 2F96A 1K8KA 2HHHK 1EXQA 4X65K 3QIPA 1S72N 3ZLJA 4FPAA 4CZLA 4ELTA 3K57A 4FPBA 3H45C 3G4SN 1KRPA 5EXWA 2HBJA 3SK3A 2ZE2A 4ICLA 4IWVA 3D2FB 4JKGA 2UXCK 1S1TA 3SPZA 3MX2A 3NH0A 3JXUA 4B8AB 1SUQA 3KIOA 4WFAL 3LPUA 3DLHA 4CGGA 2ZD1A 3VQQA 4CHPA 2P9IB 3UKUA 5BREA 3HL8A 2LSNA 4DV6K 2P9UB 3WNFA 3ZEUA 1YVUA 4DR4K 4H0VB 3O1WA 4IFYA 4GNIA 3UB5A 2QWQA 1W2BM 4Z4HA 4C8OA 2X78A 3PO5A 1C6VA 3HPHA 3RR8A 4BWMA 4IOAL 1FXXA 4A5AA 4BRIA 5I42A 1Q81O 1VQON 2CH5A 1RTIA 3L0QA 3MDQA 4FJMA 3DLEA 3L4IA 4JNEA 1BCOA 2RPIA 3EE8A 4BRNA 4LSLA 3V1QA 3WNEA 3JS6A 1N36K 4M42A 2RF2A 3U6FA 3E9PA 3CCSN 4GVMA 3KLIA 4DTUA 4CF2A 4N56A 3KJVA 3AY9A 1NK6A 2G8VA 1BIUA 4M63C 3V4IA 1IO2A 4FK4A 2OTJN 1JL1A 3Q7BA 1L3TA 5BPLA 1S9GA 2HSTA 4E1MA 3NVMA 3PX0A 3SMSA 3T19A 2FBXA 4IOXA 4M3TA 1OH6A 1QVFM 2O4IA 4H0YB 3G6EN 3A5LC 1I94K 4DV4K 1BG3A 2O8CA 3WEEB 4LH5A 3TAMA 1FKOA 1NJXA 4CZKA 3SV3A 3G25A 4FSVA 2R7YA 5GIOA 4KB1A 3DLRA 4PQUA 3L3VA 4DQRA 1VQ8N 4AHRA 1VQKN 3PO4A 5CR4A 2FBYA 3ZT2A 1UAXA 3WXMB 4LF5K 3PIPL 3I0SA 3AVJA 2GTDA 1S1WA 4EZ9A 1RT2A 4GV3A 5IWAK 4E7HA 1HPZA 1LW0A 4M3WA 2AJQA 3L8BA 2D0PA 1QZ5A 1VRUA 1SKSA 3CJBA 1A5WA 1Z26A 3AAPA 1X1PA 4HUGA 1OH7A 5AQNA 4BRDA 3U3GA 4CK3A 3SQ0A 4G1QA 3O1BA 4X62K 4KI4A 3DAWA 1S5JA 4BVOA 4WF9L 1QE1A 4FO0A 4E3SA 2YKNA 5CZ1A 4NXMK 3AVAA 2VQEK 1BUPA 4H4OA 4B1VA 1NGGA 1QQOA 4H5RA 4CZGA 4DQPA 2QKBA 1C1BA 4GKKK 5FRNA 2O8FB 3ASMA 5AZIA 4JS5A 3DJCA 5J1EA 4DR7K 1EETA 1VSHA 2W42A 4FM1A 2D0OA 2OPSA 4IDHA 2UU9K 5AQQA 4J2AA 3KHYA 1YT3A 2H3GX 2F9TA 4WQ5C 2YX6A 1VQ6N 4RW6A 1QSYA 3SJHA 3LALA 3SYZA 1RT7A 4O0JA 1TL3A 2O8DB 2Z1JA 5AZJA 1HLUA 3PX6A 3DLBA 1TUUA 2VG7A 2IC3A 5AQPA 1D9FA 1N32K 2ZJRL 4DUYK 4QCLA 5KGWA 5J2QA 4LH4A 3TAGA 1OVQA 4DR3K 1WSIA 3VQ4A 5LY3A 4CK2A 3VQ9A 1NU0A 2A6AA 5GAEP 3ZCMA 3BEXA 1VQNN 2ZQBA 4Z4EA 5EY4A 3THXB 5C2FA 4CHZA 4IDKA 4W5QA 4G9ZA 1YJWN 1RDAA 2HF3A 4YOYA 4A2AA 4WQ4C 3HK2A 2QWMA 2XY5A 3CM6A 3E9OA 4EHTA 2Z1IA 1IJJA 4FJXA 3OBWA 1V4TA 2NRHA 3U9ZA 2XRIA 4FW2A 4NCBA 3THVA 3ENBA 4M7XA 4DV1K 1VSEA 1GOCA 2B4JA 1KC8O 4JAXA 1C0UA 1LCUA 4FVUA 5KI6A 5JICA 3QDKA 3OY9A 3QFUA 1OVYA 1RILA 3K2PA 1RNHA 3E1YA 2NRTA 1NK4A 4CJFA 4JHDA 1IG9A 1CZ9A 1QTMA 3DLKA 3O80A 4B3MK 3ZSQA 1Q82O 5F2RA 2E6MA 2P1JA 4BE1A 2PYJA 1EWQA 3BUZB 1HX1A 1RFQA 1EO1A 3PLAA 1GLLO 1W9HA 3J7ZO 5KPRA 2KZMA 4H0PA 4FCYA 3VQ6A 3SLCA 3T3FA 4DTSA 1SKRA 5SWMA 3M6GA 3RRGA 3A5NC 5LMUK 5T7BA 4Z4GA 4GW6A 4CD3A 3HSTB 4EP5A 3TAQA 4W5NA 3SQ2A 2E2NA 3HPGA 2I5JA 4MDBA 1JCGA 4IXCA 3VEOA 3I33A 4CJEA 3LWLA 2XY7A 2W40A 3T69A 4FK2A 1T6DA 4RWTA 3VF4A 3O9TA 1K8AO 3WXLA 3WQTA 4KHPK 1RTDA 1S6PA 3M8RA 4CBWA 1J53A 1UWBA 4ELUA 3GBTA 3KVGA 3P83D 4FWPA 3ZSYA 3L2UA 2HHUA 3CQXA 4L3QA 2F4VK 2ZGYA 4MLHA 5AQUA 5CYMA 2QTDA 4DTRA 4I6MB 1IBMK 3ZETA 1L3SA 1K6YA 4KKOA 4Z4FA 1QHAA 4OVLA 2ASMA 4FJ9A 3TTFA 1S3XA 3R8EA 5I3UA 2BTFA 3N4QA 1O13A 3D7EO 5KQ8A 1VQPN 3O4WA 2VYPA 4OPAA 5JVHL 1KCFA 4DSLA 1NKBA 3QERA 4JKCA 5J2PA 3GG4A 1WOQA 1HUXA 5KQDA 4DS4A 4KHNA 3ZSWA 1NK5A 3CJ1A 1YITN 4CJ3A 4WFNL 1J5OA 1RT6A 1VRTA 1BA1A 4M41A 3LDSA 5ADXH 3LPTA 4FYDA 1WNSA 2V52B 2JWKA 4BG9A 1EQYA 3SBTA 4DWIA 1RGIA 1NK8A 2PFUA 5AQFA 2QM1A 2VCPA 4B1UB 2F8SA 1M1KO 5C24A 3KD1E 4NCGA 3QB0A 4DG1A 3QICA 1XC3A 4DTMA 2GUIA 3C6AA 3UKRB 3NGYA 4F3OA 4JI6K 4CERA 2A5XA 3CD6N 3Q7CA 1Q9XA 4CF1A 3VGLA 1Y97A 1LAVA 2O4GA 1G99A 4FLZA 1Q7YO 3EY1A 2A3ZA 3CCQN 4HTUA 3RMDA 2KKZA 2PBDA 3O5BA 1YHQN 3DYAA 4LY7A 4HVJA 3HXMA 2O8EA 4FM2A 3LAMA 4CK1A 3IUCA 3ZX2A 4RW8A 3C6UA 4J8FA 2OANA 3VA0A 1T8EA 3SV4A 2G8IA 3L6QA 5AQZA 3VTIA 4FJ7A 3SAHA 1VSDA 3EKUA 4MO5A 5HOOA 1C1AA 4UQGA 2IS3A 4BVPA 4F2SA 3QINA 2W41A 2Q0RA 2CH6A 3I56N 3HSCA 2OYQA 4FW1A 2HNYA 4OX9K 3AVMA 4H03B 4JV5K 2W6KA 1MWKA 5CE3A 4BDZA 1NGJA 4Q5VA 3OA9A 1EKEA 4AHUA 3VEWA 3CQ8A 5AQKA 3K9KA 4JKHA 3HZ6A 3F5TA 4DR6K 3HYFA 2GV9A 3BP8A 2HHXA 5DM6L 4FVMA 4M3YA 3HP9A 4BGAA 3FFIA 3MXJA 1NK9A 4B08A 3TSQA 1YUWA 3H1QA 4IFEA 5BR9A 4BR5A 2YNIA 3KLEA 2ZGZA 4N76A 3WNGA 3VPZA 2P51A 2Y1JA 4HHTA 3QEPA 4H0OA 3CJ7A 2G8FA 1ZBUA 5AQLA 1IKXA 4LD0A 3CC7N 1EP4A 4CEQA 2UXBK 4PKIA 3VEXA 4CEAA 5GAGP 3IDHA 3CCUN 5JS2A 3KLFA 1MWMA 3P4IA 4JKGB 1TGOA 3K5OA 4OGCA 1SZ2A 4KTWA 5EX5A 1U49A 4ILGB 4QS9A 4K25A 3VQBA 3NF8A 2KHOA 5BRFA 3M5RA 1NGCA 3H46O 3TSUA 4DV0K 2QA4N 1RBTA 3BF1A 4JK8A 1SV5A 2NRZA 3AA2A 3SUNA 4EZ6A 4CJUA 3UKUB 4QS8A 2XO7A 4AHCA 4A2BA 5BRDA 4R79A 2BDPA 2FF3B 2NRXA 2Q0UA 1GLDG 1EX4A 5HRPA 3FZHA 3ZEUB 2XY8A 1I3AA 3V9UA 1BU6O 4BR9A 3ZYYX 4BREA 3QBXA 4JK9A 4A62A 5GAHP 4KHWA 1ZYQA 2F9WA 3ATUA 1X9WA 4CJQA 1ASVA 3DMJA 1CLQA 2QWOA 1IKYA 4YHHK 3LAKA 3V9WA 1T03A 5TKWA 3V9SA 4PY5A 3TARA 3V6DA 3HO1A 2KFNA 2ASPA 3AARA 5KGXA 5KRSA 3AGRA 2WOMA 1BCMA 4B9TA 3HM9A 4BRMA 1HJOA 1YTUA 5KPZA 4IJAA 4TSXA 2ZJQL 1HNIA 4LFAK 4MLEA 2UXDK 1ASWA 5AFUH 4E1NA 2UYTA 2VWBA 3HJFA 4BRCA 4JEPA 2G8HA 4CGFA 3MEGA 3C0BA 4FWOA 3MWPA 3JAMO 5HROA 1U6ZA 2IOCA 3S3OA 1IBLK 3OHRA 4CIGA 4XH4A 4KHYA 5JLHA 3VQAA 3TTDA 1QQMA 2ZF5O 2KFZA 3F73A 4BE2A 2A1RA 4I2PA 4DU4A 1BI4A 4FJIA 4PUOA 2O8CB 3R9PA 1LOTB 5M1FA 4FOIA 2NRWA 4KH5A 4DS5A 1NJZA 1VQ7N 4N41A 1Z25A 2GBZA 1R0AA 1Q86O 1T44A 1YF5L 4IG0A 4WFBL 4KBOA 1U04A 3A0IX 4O5BA 3BF3A 4NXNK 4AHVA 1Z6RA 1HQUA 3IRXA 4BR4A 4XH5A 1ITGA 3ZSXA 4LFBK 1QHTA 3EO3A 1BISA 1NGBA 2OPPA 3VQEA 4KB0A 2VG6A 1E4FT 1XHZA 4KREA 4JKDA 2GUPA 4OKKA 1VK0A 1XUPO 3SAFA 5ELZA 1GLFO 5M1NA 3FR0A 4JKEA 5AQGA 3HM8A 4YY3K 3DI6A 3ITHA 3VEYA 2UUCK 2P9LA 4F8RA 4DV7K 4Y1CA 3KD5E 1JLGA 1BQNA 3LDPA 1HKGA 4CJWA 4FK0A 2ZJPL 2BANA 3QBWA 4GMJB 4B9VA 4ILHA 4RW4A 3AAQA 4GKJK 1IKVA 1F21A 1DEJA 5AZIB 4NYFA 3DLGA 3RMCA 2BE2A 1TKDA 4DQQA 3NF7A 2NNWA 3GL1A 1TKTA 3QEWA 3S3NA 3P1GA 5GADP 4CZFA 3HVTA 4NLBA 2E2OA 4B1YB 1RTJA 2HNDA 4B3OA 1CXQA 4AM6A 5AZJB 4DF8A 3QESA 3NMUA 3P39A 4ISEA 1L3VA 2EWSA 1ZBIA 3CIPA 1W0HA 3CQYA 5LJWA 4CJ7A 1QZ6A 4BRQA 4DLGA 3AVCA 3DM2A 2P5GA 4FXDA 1J5EK 4CE9A 3ISNC 4JI1K 3FGUA 1TK0A 2DFHA 2D0CA 2HW3A 4O0IA 3PX4A 5BN8A 1P8ZA 3TAPA 3AO3A 1WAJA 3FZKA 4CESA 3S3MA 4H5NA 1TVRA 2E2PA 3O3FA 3AA5X 1GLJO 4JKAA 4FL9A 4CEEA 5H1SQ 2I7PA 1IKWA 1KTQA 3VQ5A 3C95A 3CPEA 3QETA 1TKXA 3QEVA 1NKEA 2AA4A 4MFBA 5C25A 1BA0A 3LZIA 2P9SA 1Q8IA 3EYZA 4DTOA 3NCIA 3OYLA 2NUBA 1HPMA 4A61A 1OH8A 3MWTA 4OLAA 3PSFA 1NGIA 5KTQA 4JHDB 4CHQA 1YJNN 3O9UA 1ATSA 4C8NA 3DRRA 5AQOA 3NFAA 3L4QA 4FWLA 2PYLA 4BRKA 1TAUA 3CERA 1JCEA 1WB9A 3NBPA 1WUAA 3ULEA 3ZSRA 3HOTA 5B8HA 4EFHA 1U2VB 4DTJA 2IGIA 3BZCA 3D2EA 4N47A 3SBGA 4PWDA 1HKCA 3DWLA 4F9OA 3S9HA 1HNVA 1TYQA 5BR8K 3OJUA 3O3HA 3PV8A 1SKWA 2J4RA 4CEDA 4CGDA 3CF5L 4DQ8A 5KRTA 1BHLA 3CCRN 1HNXK 1NGAA 4FJHA 1VSJA 3DXMA 4YOVA 4CF8A 4NYNA 5EU7A 1IV0A 2E1YA 5C2DA 4JI8K 1GOBA 3ID8A 4OPKA 1N34K 2B5JA 3K5MA 3MN5A 3QEIA 1XWLA 3TSPA 1D5AA 4IFVA 4JI3K 2P9KA 2EHGA 5BN9A 3E9LA 5JVGL 4AM7A 1GLCG 4GV6A 4X66K 3ZT1A 3ZETB 1BWFO 1TV6A 2E20A 1XNQK 3DRPA 1J9AA 4IEIA 4DU1A 2HHWA 5FLXO 1RT1A 1GLBG 1XHXA 1T05A 2FSJA 4NB4A 3PUFA 1VQ4N 1RT4A 2E4LA 4LF7K 4U7BA 3P31A 2E2QA 4OKJA 3MN6A 1X3NA 3LP0A 3KWIA 4FZXC 1QSSA 1LV5A 1J6ZA 3KK2A 3T1YK 3LDQA 3VESA 4AHTA 1U47A 3M8PA 1U2VA 3AVGA 3SMPA 3VF2A 3TANA 3TAEA 2V7ZA 3K5NA 3FLCO 4DSKA 1A5VA 4CZJA 2DPNA 4CF0A 4CJ4A 1BOTO 1S1XA 4LFCK 4CHOA 2HOEA 5F0XA 2HBLA 3BZKA 4O4GA 1NGDA 2G8KA 1OKJA 3ZT3A 4CFDA 1E4GT 2FSKA 3EKSA 1KXPA 4DFMA 3G10A 1E3MA 4FJGA 1TL1A 3TR8A 1JLCA 5AQYA 1S6QA 1FW6A 5ADXA 3R6MA 3ENOA 4DR5K 2KZZA 1LW2A 4BRLA 3CXCM 2Z1GA 4FWNA 3L2WA 5AR0A 4HUEA 4E7LA 3EE9A 1W97L 4FOEA 4JRQA 3RMAA 4XEIA 1VQ5N 1D8YA 3KTQA 5A2QO 4DHYA 4B8CA 2F7TA 4XH1A 4KO0A 5DMRA 2FXUA 5EOYA 4CGJA 4O8KA 4BRGA 4JN4A 4CD1A 3AV9A 1NGHA 4JYAK 1B92A 2A1SA 1NK0A 2E6LA 4FJ8A 3OBYA 4AHSA 2O8EB 3VERA 4AQYK 2E8AA 2V51B 2IVNA 3C6TA 3HVRA 3CC2N 4ZHRA 1NMNA 3RR7A 1WSHA 2YV0X 5C10A 1TK8A 4B9UA 2GWKA 4N5SA 1BQMA 5M1QA 3O9SA 2ZM6K 3GDQA 4H0TB 1Q9YA 2HBKA 3DOKA 3CJAA 1FKPA 3CCVN 1N33K 1NWKA 4K42A 3N4PA 1C0TA 3AO1A 4DFPA 4YDUA 4ZTFA 5HRSA 5BPNA 3FE1A 4AH9A 4DTPA 3KLGA 5AQXA 2QXLA 3AVNA 4FWSA 1VSIA 4BC3A 4V19S 2G8WA 3D6RA 4JS4A 5FPMA 1X9JA 4AF1A 1LWCA 4RW9A 2D4WA 4W5OA 1VSLA 2VG5A 3FZLA 1CXUA 1K9MO 3KZBA 4R5PA 3A2FA 4C23A 3HBTA 1HMVA 3OJSA 1UA1A 3C94A 5FRMA 1TUYA 2WUSA 1NOZA 5DM7L 3QEXA 1HNWK 3CI5A 1MU2A 3CJCA 3AVFA 4QAGA 4HCCA 3O4QA 3IAYA 2X6SA 4CI6A 3MX5A 1DT9A 3C65A 1JLFA 4I2QA 1RT3A 3FZMA 3B8AX 4DCHA 2RKIA 2VGMA 4DFKA 4K0KK 2KLAA 4FJKA 3OS2A 4A59A 1REVA 3S41A 4ZTJA 5LJVA 3OYIA 3TI0A 4HTLA 3WXJA 1IBKK 2OCEA 2ETJA 3TAFA 4IO8A 3OYCA 3CCMN 1LWEA 1VHXA 2RN2A 5M1OA 2ASOA 1D9DA 2QXFA 4JD2B 5AQRA 3PSIA 4WYBA 3AVHA 3VOVA 3BY5A 4BE0A 3RRHA 4YORA 2Q97A 3RSEA 3BGRA 3J7AP 2YKMA 1NBWA 3W3DA 1KSPA 2EX3A 2VGNA 1MDUB 1BL3A 5JS1A 4CW7B 1XMQK 5I9EB 4M45A 1C1CA 4CGHA 4M3ZA 1SS6A 3O9RA 2KQ2A 2HBMA 1IG8A 1D4XA 3D45A 4OKEA 3U3YA 1NNEA 3UIQA 2IIRA 3CFPA 2WC9A 4DR2K 3ULDA 4GV9A 4E89A 4CZHA 2NLXA 1JLQA 3NVKA 2OPRA 4JK7A 2Y1IA 2HHQA 2NZTA 2JGUA 3SAGA 4MO4A 3ZSOA 1YAGA 4BRAA 3LDLA 4BQZA 3LZJA 5K14A 1JLAA 3CC4N 1KVBA 2X6NA 3OYDA 4HWIA 3KKSA 4YOXA 1JL2A 1S22A 2KW4A 4IJNA 4CZIA 4CCHA 4K43A 3THYA 1WAFA 4W5RA 4KH4A 4BG8A 1LAWA 4JKBA 5TKYA 4JKFA 1TKZA 4LF6K 4CEFA 1RBUA 5KPTA 1KAYA 3VMFB 3C7NA 2PZSA 3THWA 1WSEA 4JD2A 1BI4B 4BRPA 3LP1A 4F2RA 3BDPA 1GLEG 3E01A 3F9MA 4F4KA 1YIJN 2P9NA 4DQIA 3RMBA 4LF9K 1WSGA 4CEBA 4PHTX 3VEZA 2UUBK 1DLOA 4I9QA 2D0BA 1KFDA 3ZX0A 3MN7A 1HYZA 1C0GA 3SUQA 4YOWA 4I7FA 4DQSA 3P5JA 1KLMA 3NF9A 3AO2A 2HF4A 5DK5A 4O5FA 4CBUA 5HL7L 3ALYA 4EIAA 4DSIA 1BO5O 5J2NA 1A5XA 3HRGA 1NGFA 1NGEA 3CCJN 3W0LA 3OYHA 3FZFA 1TAQA 4YOUA 2P9LB 4DSJA 3L2QA 4J2BA 5C12A 1Z05A 3CG7A 1JLBA 4O8UA 3U8XA 2UUAK 3SNNA 3I0RA 3M8SA 1DTTA 4IKFA 4UY8O 1YJ9N 3OYFA 4E1JA 4CEOA 4B9SA 1JKHA 4DV2K 1JXBA 2YHWA 1BIZA 4FWKA 3MAQA 3JYTA 5FPDA 1GOAA 4ISFA 1S9EA 3MXIA 4Z94A 3ID6A 3DLLL 1DGKN 4BR7A 4H5VA 3I55N 2DTUA 2YHBA 1B9FA 1ZXOA 4ID1A 3ZX3A 4FJNA 3ZT4A 4B3TK 3QMLA 3KK7A 3MCAB 4CJKA 1KVCA 3AO4A 2YHAA 4KTZA 1NOYA 4H0XB 4MDAA 4K8XA 1Y64A 1UA0A 2Q2RA 3O8MA 2YNFA 1CZBA 1JXEA 4H8KA 3LP2A 3TABA 3K58A 3CJ9A 3VGMA 2IVOA 3VGKA 2E5LK 2A40A 3VN5A 2GX9A 4J2DA 3SI6A 5HRRA 5LL6Z 3SQ1A 1RDWX 3K59A 4CJSA 4FZZA 1LWFA 3VQDA 3NH1A 3TTCA 2YNGA 3CM5A 3H1VX 4YNQA 4OLBA 3R1XA 4KRFA 3EEQA 3H3OB 1RT5A 2HNZA 3H08A 4BQLA 4CIEA 1JCFA 1KLNA 4M3XA 2P5OA 4QS7A 2P9SB 2QWPA 3ZSVA 3SZ2A 4E19A 1WLJA 4IZ9A 2VQFK 1KVAA 4IEEA 4WE1A 1RDUA 2QWLA 4NCAA 4M7YA 4U67L 3D2FA 4ISGA 3QLHA 1OH5A 1W7AA 4B1WB 4C1NK 1VQ9N 3GOIA 1KD1O 4BROA 4Z4IA 3ULEB 3WUHA 2WONA 1RTHA 3WXKA 3OYMA 2WTUA 1RCHA 4Y0WA 4CJLA 1RBVA 4BACA 4CFAA 3WNHA 1HRHA 1U45A 4C8MA 4B9LA 2D5RA 3C6HA 2P9IA 3D2EB 3F9KA 3HPOA 3OYKA 2B6AA 1WN7A 1TYQB 4IBNA 2P9UA 2X74A 1NKCA 2V7YA 4KAZA 2VWJA 3AGKA 2I7NA 2Q1NA 5C42A 1S1UA 4HUFA 2P9PB 3DXMB 2GWJA 5GINA 1K73O 3KK3A 3A5MC 4GY2B 1MA9B 4PKHA 4KH6A 3TWHA 2NRVA 4BC5A 4JI5K 5J2MA 3ENHA 4KPYA 3QFPA 4DTXA 1SL1A 3J80O 2YNHA 5C15A 1EWRA 1VSFA 3H3NO 3MECA 2P9KB 2IDOA 5M1PA 1ILYA 3AA4A 3VENA 3AVKA 3AA3A 4QOZB 2HVIA 2XHBA 3LDOA 4FZYA 5EVZA 4KHSA 2PAVA 2ITMA 1DTQA 5MLCQ 4KV8A 3AVIA 1QVGM 1QQCA 5HLFA 4Z4CA 3SPYA 3DOLA 1VAZA 3O4NA 3NF6A 4FWMA 5CYQA 1SQKA 3HOSA 1XNRK 1P90A 4CJVA 2DFEA 4C1NI 3AVLA 3B6PA 1YVNA 4ELVA 4WQ5A 3J8AA 2VWKA 3SJJA 1VSKA 5AQHA 2DY4A 4H5TA 1HNZK 3EZWA 4X64K 4E7JA 1RDBA 2QWNA 1JJ2M 3WXIA 4IG3A 4CFCA 1ZBSA 2FBVA 4E7KA 5FPNA 3WEEA 5JLFA 4K8ZA 4BGBA 4KHUA 4DUZK 3QO9A 2YHXA 2YCHA 3CMAN 3VA3A 2Q36A 2A42A 3A5OC 3IS9A 3V9XA 3CFOA 2P9PA 5AJ3K 2QKKA 3EN9A 3OYEA 3SCXA 4BDPA 4JLHA 3MMVA 4M3UA 3PIOL 2D1KA 3T1HK 1BGXT 1U4BA 4O44A 2HHVA 4XIUA 3AO5A 4WQ4A 3KKRA 3H6EA 4MQ3A 2CGLA 3ATVA 4NLCA 2HMPA 1NK7A 3M8QA 5FPEA 4OPJA 1U48A 3T1AA 3VTHA 1ASUA 2XY6A 3L3UA 5CY4A 3U4LA 3I8BA 4EAHD 1HR0K 1GLAG 3OYGA 4E7IA 5JMVA 4FLXA 4CF9A 1HYVA 4FM0A 3HI0A 3OYJA 4Y1DA 1IH7A 2AP1A 3J81O 3VEVA 4CJ5A 3CMEN 3RVCA 4CJPA 4CHYA 3NGZA 1N6QA 2QK9A 1QQNA 2HHSA 1XMOK 2O8FA 3O6WA 3V1RA 2OTLN 3DRSA 4BR2A 2HVHA 3M1FA 3O3GA 3O9QA 4FLWA 3D0PA 2O8DA 1RBRA 3NGIA 1HQEA 1XI1A 4OGEA 3JSMA 1G15A 1T7PA 3CHWA 1JLEA 2BUPA 4FWQA 3OYNA 3PY8A 1NLVA 1QSLA 3OVNA 4JI2K 3IKMA 2F8TA 5FDLA 4KI6A 3CCLN 3IFRA 5AQIA 5FROA 3M3ZA 4DKWA 2HHTA 3UE5A 3THXA 1VQMN 4BWJA 4KHQA 3V9ZA 3SUOA 4BRHA 4BC4A 4IO9L 4DU3A 4RG8A 4DMNA 4LF4K 3EZ5A 3V81A 3MCPA 4DSEA 1NJIO 3LANA 2QEXN 3OS0A 5AQVA 3K9JA 3LDNA 4B1XB 4DV5K 4K41A 1RDDA 1CZAN 3LWMA 2IAJA 2HMIA 1R59O 4LC9B 1L3UA 2FF6A 1BDGA 1NMDA 1Q18A 3K0SA 4B3RK 1UOCA 4BY9C 5AQTA 4B9MA 4B1ZA 3QNNA 1ZBHA 2A41A 2OA8A 1WBDA 3NH2A 2QW9A 4PL7A 1NJYA 4JI0K 2Q31A 5CHIA 4FWRA 2NRRA 1QS4A 3E66A 3G71N 4FLVA 4W5TA 3CETA 2FSNA 3VQ7A 5M1KA 5GIPA 3NE6A 2W6LA 1SAZA 3G0ZA 4CJRA 3OYAA 4EP4A 4FLTA 3SQ4A 4LSNA 3LM9A 4CHNA 3RSEB 1HKBA 4DV3K 3MEDA 4DLEA 4PL8A 2G8UA 4YOTA 4YDUC 3VQ8A 1WSJA 4BRFA 3WT0A 4PA1A 4FLYA 2Z1HA 1C0FA 3EL2A 4JI7K 2BGGA 1YXQA 2OZMA 3O08A 3QIOA 5LMNK 4CIFA 5AQMA 3RWUA 1B9DA 2WFBA 4L8RB 3ZT0A 1ATNA 3VF6A 4B9QA 4BR0A 4A5BA 1SL2A 3R3LA 4KFBA 3ZSZA 1KFSA 4DR1K 4A57A 3HT3A 1ZBFA 4I6MA 3OS1A 3OTOK 3IG1A 4DB3A 4CBXA 1TK5A 2D0AA 3DXKB 1ESVA 4C8KA 4IOCL 1J54A 3KK1A 1ATRA 3LP3A 3HTVA 2RHKA 4OPHA 4CZEA 4GVEA 1KAXA 2O8BB 3THYB 4E0DA 3U9DA 4EHUA 1M90O 1NM1A 4CVNE 4KTQA 1RBSA 3NDKA 5F1XA 1ZBLA 4RTFD 3LM2A 5C0YA 3VETA 3VQPA 3CYMA 4NO7A 3MK6A 4LF8K 3C7NB 3THWB 1O1WA 3AVBA 5HBMA 2ATQA 1N8RO 4C8LA 1FK9A 1V4SA 4HCBA 5HRNA 1H1VA 1HJRA 4I9LA 2P9NB 3CFRA 1VQLN 3HP6A 4ILJA 2JWLA 3L2VA 2OZSA 1X3MA 3L2RA 2DFFA 1HYSA 3RTVA 1RDCA 3NHGA 2Q3SA 3A8YA 2KTQA 2OPQA 3KWGA 4PKGA 4JRPA 1XQSC 4M3RA 4WCEL 1N5YA 4BC2A 3FFKB 3UKRA 2CGKA 1VSMA 2FBTA 1KQSM 2E88A 1T3VA 5HP1A 5IT9O 1NJWA 2ZWHA 4H5WA 4FJJA 4CEZA 5D3GA 3DXKA 4H4MA 3OW2M 2RE2A 3KLHA 2GEMA 5AQWA 4Z0UA 4DFJA 4J2EA 3CCEN 4FJLA 2O8BA 3K5LA 2GELA 1L5UA 1K8KB 4RW7A 3TPQA 3B6OA 4CZMA 4BDYA 4DF4A 4OJRA 3CPWM 1I39A 4B9NA 5AFUA 4B3SK 2PY5A 4OO1J 3MN9A 1S1VA 5AQJA 1X9SA 3P38A 3WQUA 3LL3A 1WSFA 5E41A 3V1OA 4YFUA 4CGIA 5AQSA 3T7ZA 5SZTA 3VQCA 4DTNA 5BPMA 1XC9A 5E84A 2BH1A 2IVPA 3F2KA 2YI1A 3NAEA 3SUPA 5CZ2A 4DSFA 2ITGA 5E26A 2FC0A 4JI4K 4CJTA 1KAZA 4CECA 4CFBA 1NG9A 1ZC6A 2YJFA 2QI2A
chains in the Genus database with same CATH topology
2E4LA 2WONA 3RWUA 1Q9XA 4CF1A 1RTHA 3OYMA 1SL0A 4OKJA 1RCHA 3QNOA 4CJLA 1RBVA 3LP0A 3MEEA 4BACA 1Y97A 1LAVA 4CFAA 4FZXC 2O4GA 3WNHA 3OYBA 1HRHA 4ID5A 4C8MA 4FLZA 1U45A 1QSSA 4B9LA 2D5RA 3HPOA 3F9KA 4O55A 3KK2A 3EY1A 3I8DA 3OYKA 1X9MA 2B6AA 1LV5A 4HTUA 4Q0BA 3RMDA 4AHTA 1WN7A 4IBNA 1U47A 2X74A 3M8PA 2HB5A 1NKCA 4KAZA 4FLUA 3DYAA 4LY7A 2VWJA 3AVGA 4HVJA 1YTAA 5C42A 3HXMA 4F3TA 1S1UA 4FM2A 3LAMA 4HUFA 3TANA 3TAEA 4CK1A 3K5NA 4DSKA 1A5VA 4RW8A 3C6UA 2JLEA 4CF0A 3VA0A 1C0MA 4CJ4A 3KK3A 1T8EA 3SV4A 2G8IA 3MXMA 3TWHA 1S1XA 5J2MA 4KPYA 4CHOA 4AILC 4FJ5A 2F96A 4FJ7A 1EXQA 1VSDA 4O4GA 4DTXA 1SL1A 2G8KA 3QIPA 1C1AA 4UQGA 2YNHA 2IS3A 1VSFA 3MECA 3ZT3A 4CFDA 2IDOA 3AA4A 4ELTA 3K57A 4F2SA 3AVKA 3QINA 3G10A 4DFMA 2OYQA 1KRPA 3AA3A 4FJGA 1TL1A 1JLCA 4FW1A 3TR8A 2XHBA 4QOZB 1S6QA 2ZE2A 2HNYA 2HVIA 4ICLA 3AVMA 4FZYA 4KHSA 1DTQA 1S1TA 3AVIA 4KV8A 3SPZA 2KZZA 1QQCA 4BDZA 5HLFA 1LW2A 4Z4CA 4Q5VA 3SPYA 1EKEA 2Z1GA 4AHUA 3L2WA 3DOLA 3CQ8A 3NH0A 4HUEA 3O4NA 4E7LA 4B8AB 1SUQA 3NF6A 3KIOA 5CYQA 4JRQA 3LPUA 3RMAA 3DLHA 4CGGA 1D8YA 3KTQA 4CJVA 2DFEA 3HYFA 3AVLA 2ZD1A 3B6PA 3VQQA 4B8CA 4CHPA 2GV9A 4KO0A 5DMRA 4ELVA 2HHXA 4CGJA 4FVMA 4M3YA 3HP9A 3FFIA 3MXJA 3HL8A 1NK9A 2LSNA 3AV9A 2VWKA 4B08A 3SJJA 3WNFA 1B92A 1VSKA 2DY4A 2A1SA 1NK0A 1YVUA 2E6LA 4FJ8A 4AHSA 4E7JA 1RDBA 4IFYA 4IG3A 4CFCA 4Z4HA 2YNIA 4C8OA 2FBVA 4E7KA 2X78A 3PO5A 3KLEA 4N76A 1C6VA 3HPHA 3C6TA 3HVRA 3RR8A 4BWMA 1FXXA 4ZHRA 3WNGA 2P51A 3RR7A 5I42A 4K8ZA 2Y1JA 4KHUA 4HHTA 3QO9A 1WSHA 2YV0X 3QEPA 3VA3A 3IS9A 3V9XA 1TK8A 4B9UA 3CFOA 4N5SA 1ZBUA 2G8FA 1BQMA 1RTIA 1IKXA 4LD0A 4FJMA 3DLEA 1EP4A 4CEQA 1BCOA 2QKKA 1Q9YA 3OYEA 2RPIA 3SCXA 4BDPA 4JLHA 4M3UA 4CEAA 3DOKA 5JS2A 1FKPA 4LSLA 1BGXT 3KLFA 1U4BA 4O44A 2HHVA 3V1QA 1TGOA 4XIUA 3K5OA 4OGCA 3WNEA 1C0TA 3AO1A 3AO5A 3KKRA 4DFPA 4M42A 2RF2A 3U6FA 4ZTFA 4MQ3A 4KTWA 1U49A 5HRSA 1NK7A 4GVMA 3KLIA 3VQBA 4CF2A 3M8QA 3NF8A 4AH9A 4N56A 3KJVA 4DTUA 4DTPA 1NK6A 2G8VA 1BIUA 4OPJA 3KLGA 1U48A 3AVNA 3V4IA 1VSIA 1IO2A 4FK4A 1RBTA 3T1AA 2G8WA 1SV5A 1JL1A 1ASUA 3AA2A 4JS4A 1S9GA 2XY6A 3L3UA 3SUNA 5CY4A 1L3TA 4EZ6A 4CJUA 4E1MA 1LWCA 4RW9A 3OYGA 2XO7A 4AHCA 4E7IA 3PX0A 2BDPA 4W5OA 1VSLA 2VG5A 3T19A 1CXUA 2FBXA 1EX4A 4M3TA 4FLXA 5HRPA 4R5PA 3A2FA 2O4IA 2XY8A 1I3AA 4CF9A 3V9UA 1HYVA 4FM0A 1HMVA 3OYJA 3OJSA 4Y1DA 1IH7A 1UA1A 4KHWA 3C94A 4CJ5A 1ZYQA 5FRMA 4CJPA 4CHYA 3NGZA 1N6QA 2QK9A 1NOZA 2HHSA 4LH5A 1X9WA 4CJQA 3TAMA 3QEXA 1FKOA 1ASVA 3V1RA 3DMJA 1NJXA 1MU2A 3AVFA 3SV3A 4QAGA 1CLQA 4HCCA 3DRSA 3O4QA 1IKYA 2X6SA 3IAYA 3LAKA 2R7YA 3V9WA 4KB1A 2HVHA 3DLRA 4PQUA 3L3VA 4DQRA 1T03A 4AHRA 3PO4A 3V9SA 1JLFA 2FBYA 3O3GA 3ZT2A 1UAXA 3TARA 4PY5A 4I2QA 3V6DA 3HO1A 2KFNA 4FLWA 3I0SA 3D0PA 5KGXA 3AVJA 1RT3A 5KRSA 2WOMA 1BCMA 1S1WA 1RBRA 1RT2A 3NGIA 4B9TA 4EZ9A 3HM9A 1HQEA 2RKIA 1XI1A 4DFKA 4OGEA 4E7HA 1HPZA 1LW0A 1YTUA 3JSMA 4FJKA 4M3WA 1G15A 4TSXA 1T7PA 3L8BA 2AJQA 3OS2A 1HNIA 1REVA 1JLEA 1VRUA 3OYNA 1A5WA 1ASWA 4E1NA 3TI0A 1Z26A 3OYIA 4ZTJA 1X1PA 4HUGA 3PY8A 3HJFA 1QSLA 2G8HA 2ETJA 3OVNA 4CGFA 3MEGA 3U3GA 3TAFA 2F8TA 4CK3A 3SQ0A 4G1QA 5FDLA 3OYCA 4KI6A 1LWEA 2RN2A 5HROA 4KI4A 2IOCA 1S5JA 5FROA 3S3OA 2QXFA 1D9DA 2HHTA 1QE1A 4CIGA 4KHYA 4E3SA 2YKNA 4BWJA 4KHQA 5CZ1A 3VQAA 3V9ZA 3SUOA 3AVAA 3AVHA 4DU3A 4RG8A 4DMNA 4BE0A 3RRHA 3F73A 4H4OA 2KFZA 4BE2A 2A1RA 4I2PA 3EZ5A 3BGRA 4DU4A 3V81A 2YKMA 4DSEA 1KSPA 1BI4A 3LANA 4DQPA 4FJIA 4PUOA 2QKBA 2EX3A 1BL3A 1C1BA 5JS1A 3OS0A 5FRNA 4M45A 1C1CA 3ASMA 4JS5A 4DS5A 1NJZA 4N41A 1RDDA 4CGHA 4M3ZA 1Z25A 2GBZA 5J1EA 3LWMA 1EETA 1VSHA 2KQ2A 2W42A 4FM1A 2IAJA 2OPSA 1R0AA 3D45A 4OKEA 3U3YA 4IG0A 2HMIA 4J2AA 3UIQA 3CFPA 1L3UA 1YT3A 3ULDA 4E89A 1U04A 4O5BA 1JLQA 1UOCA 4RW6A 2OPRA 1QSYA 4B9MA 3QNNA 4AHVA 2Y1IA 1ZBHA 2HHQA 2JGUA 3LALA 2OA8A 3SYZA 3IRXA 1HQUA 3ZSOA 1RT7A 4O0JA 1TL3A 1ITGA 2Z1JA 3NH2A 3LZJA 3ZSXA 5K14A 1JLAA 3PX6A 3DLBA 1QHTA 2VG7A 1NJYA 1KVBA 2IC3A 2X6NA 1D9FA 1BISA 3OYDA 3KKSA 2OPPA 3VQEA 4KB0A 4QCLA 2VG6A 5KGWA 1XHZA 5J2QA 4LH4A 3TAGA 4KREA 1WSIA 3VQ4A 1QS4A 1JL2A 1VK0A 2KW4A 4OKKA 4CK2A 4CCHA 3VQ9A 3ZCMA 4FLVA 4W5TA 1WAFA 3VQ7A 4W5RA 3NE6A 3DI6A 3ITHA 4F8RA 4Y1CA 1LAWA 2ZQBA 3KD5E 4Z4EA 1TKZA 4CHZA 4IDKA 1JLGA 1BQNA 4CEFA 3G0ZA 1RBUA 4W5QA 4CJWA 4CJRA 4EP4A 3OYAA 4FLTA 3SQ4A 4LSNA 4FK0A 2BANA 4GMJB 4CHNA 2PZSA 4B9VA 1RDAA 1WSEA 3MEDA 3HK2A 1BI4B 4DLEA 2G8UA 2XY5A 3LP1A 4F2RA 3BDPA 3CM6A 4RW4A 3VQ8A 1WSJA 1IKVA 1F21A 2Z1IA 4PA1A 4FJXA 3E01A 4FLYA 2XRIA 2Z1HA 4FW2A 4NYFA 3DLGA 3RMCA 3THVA 4F4KA 2BE2A 4HCBA 4NCBA 2BGGA 4DQIA 1TKDA 1VSEA 1GOCA 2B4JA 4DQQA 3NF7A 3QIOA 1C0UA 4CIFA 1WSGA 3RMBA 1B9DA 4CEBA 2OZMA 3ZT0A 4L8RB 1TKTA 3QEWA 3S3NA 5KI6A 3OY9A 3P1GA 1DLOA 4I9QA 2D0BA 3HVTA 1RILA 1SL2A 3K2PA 1KFDA 4KFBA 3ZSZA 1HYZA 1RNHA 4FK2A 1RTJA 1KFSA 2HNDA 4B3OA 1CXQA 1NK4A 4CJFA 3HT3A 1ZBFA 3SUQA 3OS1A 1IG9A 4I7FA 1CZ9A 4DF8A 3DLKA 4DQSA 1QTMA 3P5JA 1KLMA 3NF9A 3AO2A 5DK5A 3ZSQA 3QESA 2E6MA 2P1JA 4BE1A 2PYJA 3IG1A 3ALYA 1L3VA 1TK5A 2D0AA 4C8KA 1ZBIA 4DSIA 5J2NA 1J54A 3KK1A 3LP3A 1W0HA 1A5XA 1W9HA 2KZMA 4E0DA 4FCYA 4DLGA 3AVCA 3OYHA 1TAQA 3DM2A 4DSJA 3L2QA 4J2BA 3VQ6A 4KTQA 1RBSA 2P5GA 3NDKA 3T3FA 3CG7A 1ZBLA 4DTSA 1SKRA 4FXDA 5SWMA 1JLBA 3VQPA 4CE9A 3CYMA 3ISNC 3RRGA 3SNNA 3I0RA 3M8SA 5T7BA 1TK0A 1DTTA 2DFHA 4Z4GA 2D0CA 4GW6A 3HSTB 4EP5A 3TAQA 2HW3A 4IKFA 4W5NA 3SQ2A 1O1WA 4O0IA 3AVBA 5HBMA 3PX4A 2ATQA 3HPGA 2I5JA 4C8LA 3TAPA 3AO3A 3OYFA 1FK9A 1WAJA 4CESA 4CEOA 4B9SA 1JKHA 4CJEA 5HRNA 3LWLA 1TVRA 3O3FA 1JXBA 2XY7A 1HJRA 3S3MA 4I9LA 1BIZA 3AA5X 3CFRA 4CEEA 3MAQA 3HP6A 3JYTA 1IKWA 1KTQA 3VQ5A 1S6PA 3C95A 3M8RA 1TKXA 3QETA 3QEVA 1RTDA 1NKEA 1GOAA 1J53A 3L2VA 1UWBA 4MFBA 4ELUA 5C25A 2OZSA 1HYSA 3L2RA 1S9EA 2DFFA 3P83D 1Q8IA 3ZSYA 3L2UA 3EYZA 3LZIA 4DTOA 3NCIA 3MXIA 3RTVA 3OYLA 2NUBA 1RDCA 3NHGA 4OLAA 2Q3SA 2DTUA 2KTQA 5CYMA 2YHBA 1B9FA 4DTRA 5KTQA 2OPQA 4ID1A 4CHQA 4JRPA 4M3RA 4FJNA 3ZT4A 1L3SA 1K6YA 4KKOA 1N5YA 4C8NA 4Z4FA 3DRRA 3NFAA 4CJKA 2PYLA 1KVCA 3AO4A 1VSMA 2FBTA 1TAUA 2YHAA 4KTZA 3NBPA 4OVLA 5HP1A 4K8XA 1UA0A 4FJ9A 1NJWA 2YNFA 1CZBA 1JXEA 4H8KA 3LP2A 3ZSRA 1SKSA 4FJJA 5I3UA 4CEZA 3TABA 4DTJA 5D3GA 3K58A 4H4MA 2IGIA 1KCFA 4N47A 4DSLA 1NKBA 4PWDA 3VN5A 3QERA 3KLHA 4J2DA 3S9HA 1HNVA 4Z0UA 4DFJA 3SI6A 4J2EA 5HRRA 5J2PA 3SQ1A 3OJUA 4FJLA 3O3HA 3K59A 3PV8A 3K5LA 1SKWA 4CJSA 4CEDA 4CGDA 4DS4A 4FZZA 5KRTA 4KHNA 1LWFA 3ZSWA 1NK5A 1BHLA 3VQDA 4RW7A 1L5UA 3NH1A 4FJHA 3B6OA 1VSJA 4CJ3A 4BDYA 4CF8A 4NYNA 5EU7A 4OJRA 2YNGA 1I39A 3CM5A 1RT6A 4DF4A 1J5OA 4YNQA 4B9NA 1VRTA 4OLBA 4M41A 3LDSA 4KRFA 1GOBA 3LPTA 4FYDA 2PY5A 1WNSA 1RT5A 2HNZA 1S1VA 1X9SA 3H08A 4CIEA 4OPKA 2B5JA 3K5MA 1KLNA 4M3XA 1WSFA 5E41A 2P5OA 2HHUA 4DWIA 3V1OA 3QEIA 4YFUA 4CGIA 1XWLA 1D5AA 1NK8A 5SZTA 3VQCA 4IFVA 4DTNA 3ZSVA 3SZ2A 4E19A 1WLJA 2EHGA 1XC9A 2F8SA 1KVAA 3NAEA 4WE1A 3SUPA 5CZ2A 5C24A 3ZT1A 4NCAA 4DSFA 3KD1E 4NCGA 1TV6A 4DG1A 2ITGA 3DRPA 4CJTA 1J9AA 2FC0A 4DU1A 2HHWA 4CECA 4CFBA 4DTMA 1RT1A 2GUIA 3QLHA 1XHXA 1T05A 3NGYA 4F3OA 3PUFA 1NOYA 4CERA 4Z4IA 1RT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4L A;  2WON A;  3RWU A;  1Q9X A;  4CF1 A;  1RTH A;  3OYM A;  1SL0 A;  4OKJ A;  1RCH A;  3QNO A;  4CJL A;  1RBV A;  3LP0 A;  3MEE A;  4BAC A;  1Y97 A;  1LAV A;  4CFA A;  4FZX C;  2O4G A;  3WNH A;  3OYB A;  1HRH A;  4ID5 A;  4C8M A;  4FLZ A;  1U45 A;  1QSS A;  4B9L A;  2D5R A;  3HPO A;  3F9K A;  4O55 A;  3KK2 A;  3EY1 A;  3I8D A;  3OYK A;  1X9M A;  2B6A A;  1LV5 A;  4HTU A;  4Q0B A;  3RMD A;  4AHT A;  1WN7 A;  4IBN A;  1U47 A;  2X74 A;  3M8P A;  2HB5 A;  1NKC A;  4KAZ A;  4FLU A;  3DYA A;  4LY7 A;  2VWJ A;  3AVG A;  4HVJ A;  1YTA A;  5C42 A;  3HXM A;  4F3T A;  1S1U A;  4FM2 A;  3LAM A;  4HUF A;  3TAN A;  3TAE A;  4CK1 A;  3K5N A;  4DSK A;  1A5V A;  4RW8 A;  3C6U A;  2JLE A;  4CF0 A;  3VA0 A;  1C0M A;  4CJ4 A;  3KK3 A;  1T8E A;  3SV4 A;  2G8I A;  3MXM A;  3TWH A;  1S1X A;  5J2M A;  4KPY A;  4CHO A;  4AIL C;  4FJ5 A;  2F96 A;  4FJ7 A;  1EXQ A;  1VSD A;  4O4G A;  4DTX A;  1SL1 A;  2G8K A;  3QIP A;  1C1A A;  4UQG A;  2YNH A;  2IS3 A;  1VSF A;  3MEC A;  3ZT3 A;  4CFD A;  2IDO A;  3AA4 A;  4ELT A;  3K57 A;  4F2S A;  3AVK A;  3QIN A;  3G10 A;  4DFM A;  2OYQ A;  1KRP A;  3AA3 A;  4FJG A;  1TL1 A;  1JLC A;  4FW1 A;  3TR8 A;  2XHB A;  4QOZ B;  1S6Q A;  2ZE2 A;  2HNY A;  2HVI A;  4ICL A;  3AVM A;  4FZY A;  4KHS A;  1DTQ A;  1S1T A;  3AVI A;  4KV8 A;  3SPZ A;  2KZZ A;  1QQC A;  4BDZ A;  5HLF A;  1LW2 A;  4Z4C A;  4Q5V A;  3SPY A;  1EKE A;  2Z1G A;  4AHU A;  3L2W A;  3DOL A;  3CQ8 A;  3NH0 A;  4HUE A;  3O4N A;  4E7L A;  4B8A B;  1SUQ A;  3NF6 A;  3KIO A;  5CYQ A;  4JRQ A;  3LPU A;  3RMA A;  3DLH A;  4CGG A;  1D8Y A;  3KTQ A;  4CJV A;  2DFE A;  3HYF A;  3AVL A;  2ZD1 A;  3B6P A;  3VQQ A;  4B8C A;  4CHP A;  2GV9 A;  4KO0 A;  5DMR A;  4ELV A;  2HHX A;  4CGJ A;  4FVM A;  4M3Y A;  3HP9 A;  3FFI A;  3MXJ A;  3HL8 A;  1NK9 A;  2LSN A;  3AV9 A;  2VWK A;  4B08 A;  3SJJ A;  3WNF A;  1B92 A;  1VSK A;  2DY4 A;  2A1S A;  1NK0 A;  1YVU A;  2E6L A;  4FJ8 A;  4AHS A;  4E7J A;  1RDB A;  4IFY A;  4IG3 A;  4CFC A;  4Z4H A;  2YNI A;  4C8O A;  2FBV A;  4E7K A;  2X78 A;  3PO5 A;  3KLE A;  4N76 A;  1C6V A;  3HPH A;  3C6T A;  3HVR A;  3RR8 A;  4BWM A;  1FXX A;  4ZHR A;  3WNG A;  2P51 A;  3RR7 A;  5I42 A;  4K8Z A;  2Y1J A;  4KHU A;  4HHT A;  3QO9 A;  1WSH A;  2YV0 X;  3QEP A;  3VA3 A;  3IS9 A;  3V9X A;  1TK8 A;  4B9U A;  3CFO A;  4N5S A;  1ZBU A;  2G8F A;  1BQM A;  1RTI A;  1IKX A;  4LD0 A;  4FJM A;  3DLE A;  1EP4 A;  4CEQ A;  1BCO A;  2QKK A;  1Q9Y A;  3OYE A;  2RPI A;  3SCX A;  4BDP A;  4JLH A;  4M3U A;  4CEA A;  3DOK A;  5JS2 A;  1FKP A;  4LSL A;  1BGX T;  3KLF A;  1U4B A;  4O44 A;  2HHV A;  3V1Q A;  1TGO A;  4XIU A;  3K5O A;  4OGC A;  3WNE A;  1C0T A;  3AO1 A;  3AO5 A;  3KKR A;  4DFP A;  4M42 A;  2RF2 A;  3U6F A;  4ZTF A;  4MQ3 A;  4KTW A;  1U49 A;  5HRS A;  1NK7 A;  4GVM A;  3KLI A;  3VQB A;  4CF2 A;  3M8Q A;  3NF8 A;  4AH9 A;  4N56 A;  3KJV A;  4DTU A;  4DTP A;  1NK6 A;  2G8V A;  1BIU A;  4OPJ A;  3KLG A;  1U48 A;  3AVN A;  3V4I A;  1VSI A;  1IO2 A;  4FK4 A;  1RBT A;  3T1A A;  2G8W A;  1SV5 A;  1JL1 A;  1ASU A;  3AA2 A;  4JS4 A;  1S9G A;  2XY6 A;  3L3U A;  3SUN A;  5CY4 A;  1L3T A;  4EZ6 A;  4CJU A;  4E1M A;  1LWC A;  4RW9 A;  3OYG A;  2XO7 A;  4AHC A;  4E7I A;  3PX0 A;  2BDP A;  4W5O A;  1VSL A;  2VG5 A;  3T19 A;  1CXU A;  2FBX A;  1EX4 A;  4M3T A;  4FLX A;  5HRP A;  4R5P A;  3A2F A;  2O4I A;  2XY8 A;  1I3A A;  4CF9 A;  3V9U A;  1HYV A;  4FM0 A;  1HMV A;  3OYJ A;  3OJS A;  4Y1D A;  1IH7 A;  1UA1 A;  4KHW A;  3C94 A;  4CJ5 A;  1ZYQ A;  5FRM A;  4CJP A;  4CHY A;  3NGZ A;  1N6Q A;  2QK9 A;  1NOZ A;  2HHS A;  4LH5 A;  1X9W A;  4CJQ A;  3TAM A;  3QEX A;  1FKO A;  1ASV A;  3V1R A;  3DMJ A;  1NJX A;  1MU2 A;  3AVF A;  3SV3 A;  4QAG A;  1CLQ A;  4HCC A;  3DRS A;  3O4Q A;  1IKY A;  2X6S A;  3IAY A;  3LAK A;  2R7Y A;  3V9W A;  4KB1 A;  2HVH A;  3DLR A;  4PQU A;  3L3V A;  4DQR A;  1T03 A;  4AHR A;  3PO4 A;  3V9S A;  1JLF A;  2FBY A;  3O3G A;  3ZT2 A;  1UAX A;  3TAR A;  4PY5 A;  4I2Q A;  3V6D A;  3HO1 A;  2KFN A;  4FLW A;  3I0S A;  3D0P A;  5KGX A;  3AVJ A;  1RT3 A;  5KRS A;  2WOM A;  1BCM A;  1S1W A;  1RBR A;  1RT2 A;  3NGI A;  4B9T A;  4EZ9 A;  3HM9 A;  1HQE A;  2RKI A;  1XI1 A;  4DFK A;  4OGE A;  4E7H A;  1HPZ A;  1LW0 A;  1YTU A;  3JSM A;  4FJK A;  4M3W A;  1G15 A;  4TSX A;  1T7P A;  3L8B A;  2AJQ A;  3OS2 A;  1HNI A;  1REV A;  1JLE A;  1VRU A;  3OYN A;  1A5W A;  1ASW A;  4E1N A;  3TI0 A;  1Z26 A;  3OYI A;  4ZTJ A;  1X1P A;  4HUG A;  3PY8 A;  3HJF A;  1QSL A;  2G8H A;  2ETJ A;  3OVN A;  4CGF A;  3MEG A;  3U3G A;  3TAF A;  2F8T A;  4CK3 A;  3SQ0 A;  4G1Q A;  5FDL A;  3OYC A;  4KI6 A;  1LWE A;  2RN2 A;  5HRO A;  4KI4 A;  2IOC A;  1S5J A;  5FRO A;  3S3O A;  2QXF A;  1D9D A;  2HHT A;  1QE1 A;  4CIG A;  4KHY A;  4E3S A;  2YKN A;  4BWJ A;  4KHQ A;  5CZ1 A;  3VQA A;  3V9Z A;  3SUO A;  3AVA A;  3AVH A;  4DU3 A;  4RG8 A;  4DMN A;  4BE0 A;  3RRH A;  3F73 A;  4H4O A;  2KFZ A;  4BE2 A;  2A1R A;  4I2P A;  3EZ5 A;  3BGR A;  4DU4 A;  3V81 A;  2YKM A;  4DSE A;  1KSP A;  1BI4 A;  3LAN A;  4DQP A;  4FJI A;  4PUO A;  2QKB A;  2EX3 A;  1BL3 A;  1C1B A;  5JS1 A;  3OS0 A;  5FRN A;  4M45 A;  1C1C A;  3ASM A;  4JS5 A;  4DS5 A;  1NJZ A;  4N41 A;  1RDD A;  4CGH A;  4M3Z A;  1Z25 A;  2GBZ A;  5J1E A;  3LWM A;  1EET A;  1VSH A;  2KQ2 A;  2W42 A;  4FM1 A;  2IAJ A;  2OPS A;  1R0A A;  3D45 A;  4OKE A;  3U3Y A;  4IG0 A;  2HMI A;  4J2A A;  3UIQ A;  3CFP A;  1L3U A;  1YT3 A;  3ULD A;  4E89 A;  1U04 A;  4O5B A;  1JLQ A;  1UOC A;  4RW6 A;  2OPR A;  1QSY A;  4B9M A;  3QNN A;  4AHV A;  2Y1I A;  1ZBH A;  2HHQ A;  2JGU A;  3LAL A;  2OA8 A;  3SYZ A;  3IRX A;  1HQU A;  3ZSO A;  1RT7 A;  4O0J A;  1TL3 A;  1ITG A;  2Z1J A;  3NH2 A;  3LZJ A;  3ZSX A;  5K14 A;  1JLA A;  3PX6 A;  3DLB A;  1QHT A;  2VG7 A;  1NJY A;  1KVB A;  2IC3 A;  2X6N A;  1D9F A;  1BIS A;  3OYD A;  3KKS A;  2OPP A;  3VQE A;  4KB0 A;  4QCL A;  2VG6 A;  5KGW A;  1XHZ A;  5J2Q A;  4LH4 A;  3TAG A;  4KRE A;  1WSI A;  3VQ4 A;  1QS4 A;  1JL2 A;  1VK0 A;  2KW4 A;  4OKK A;  4CK2 A;  4CCH A;  3VQ9 A;  3ZCM A;  4FLV A;  4W5T A;  1WAF A;  3VQ7 A;  4W5R A;  3NE6 A;  3DI6 A;  3ITH A;  4F8R A;  4Y1C A;  1LAW A;  2ZQB A;  3KD5 E;  4Z4E A;  1TKZ A;  4CHZ A;  4IDK A;  1JLG A;  1BQN A;  4CEF A;  3G0Z A;  1RBU A;  4W5Q A;  4CJW A;  4CJR A;  4EP4 A;  3OYA A;  4FLT A;  3SQ4 A;  4LSN A;  4FK0 A;  2BAN A;  4GMJ B;  4CHN A;  2PZS A;  4B9V A;  1RDA A;  1WSE A;  3MED A;  3HK2 A;  1BI4 B;  4DLE A;  2G8U A;  2XY5 A;  3LP1 A;  4F2R A;  3BDP A;  3CM6 A;  4RW4 A;  3VQ8 A;  1WSJ A;  1IKV A;  1F21 A;  2Z1I A;  4PA1 A;  4FJX A;  3E01 A;  4FLY A;  2XRI A;  2Z1H A;  4FW2 A;  4NYF A;  3DLG A;  3RMC A;  3THV A;  4F4K A;  2BE2 A;  4HCB A;  4NCB A;  2BGG A;  4DQI A;  1TKD A;  1VSE A;  1GOC A;  2B4J A;  4DQQ A;  3NF7 A;  3QIO A;  1C0U A;  4CIF A;  1WSG A;  3RMB A;  1B9D A;  4CEB A;  2OZM A;  3ZT0 A;  4L8R B;  1TKT A;  3QEW A;  3S3N A;  5KI6 A;  3OY9 A;  3P1G A;  1DLO A;  4I9Q A;  2D0B A;  3HVT A;  1RIL A;  1SL2 A;  3K2P A;  1KFD A;  4KFB A;  3ZSZ A;  1HYZ A;  1RNH A;  4FK2 A;  1RTJ A;  1KFS A;  2HND A;  4B3O A;  1CXQ A;  1NK4 A;  4CJF A;  3HT3 A;  1ZBF A;  3SUQ A;  3OS1 A;  1IG9 A;  4I7F A;  1CZ9 A;  4DF8 A;  3DLK A;  4DQS A;  1QTM A;  3P5J A;  1KLM A;  3NF9 A;  3AO2 A;  5DK5 A;  3ZSQ A;  3QES A;  2E6M A;  2P1J A;  4BE1 A;  2PYJ A;  3IG1 A;  3ALY A;  1L3V A;  1TK5 A;  2D0A A;  4C8K A;  1ZBI A;  4DSI A;  5J2N A;  1J54 A;  3KK1 A;  3LP3 A;  1W0H A;  1A5X A;  1W9H A;  2KZM A;  4E0D A;  4FCY A;  4DLG A;  3AVC A;  3OYH A;  1TAQ A;  3DM2 A;  4DSJ A;  3L2Q A;  4J2B A;  3VQ6 A;  4KTQ A;  1RBS A;  2P5G A;  3NDK A;  3T3F A;  3CG7 A;  1ZBL A;  4DTS A;  1SKR A;  4FXD A;  5SWM A;  1JLB A;  3VQP A;  4CE9 A;  3CYM A;  3ISN C;  3RRG A;  3SNN A;  3I0R A;  3M8S A;  5T7B A;  1TK0 A;  1DTT A;  2DFH A;  4Z4G A;  2D0C A;  4GW6 A;  3HST B;  4EP5 A;  3TAQ A;  2HW3 A;  4IKF A;  4W5N A;  3SQ2 A;  1O1W A;  4O0I A;  3AVB A;  5HBM A;  3PX4 A;  2ATQ A;  3HPG A;  2I5J A;  4C8L A;  3TAP A;  3AO3 A;  3OYF A;  1FK9 A;  1WAJ A;  4CES A;  4CEO A;  4B9S A;  1JKH A;  4CJE A;  5HRN A;  3LWL A;  1TVR A;  3O3F A;  1JXB A;  2XY7 A;  1HJR A;  3S3M A;  4I9L A;  1BIZ A;  3AA5 X;  3CFR A;  4CEE A;  3MAQ A;  3HP6 A;  3JYT A;  1IKW A;  1KTQ A;  3VQ5 A;  1S6P A;  3C95 A;  3M8R A;  1TKX A;  3QET A;  3QEV A;  1RTD A;  1NKE A;  1GOA A;  1J53 A;  3L2V A;  1UWB A;  4MFB A;  4ELU A;  5C25 A;  2OZS A;  1HYS A;  3L2R A;  1S9E A;  2DFF A;  3P83 D;  1Q8I A;  3ZSY A;  3L2U A;  3EYZ A;  3LZI A;  4DTO A;  3NCI A;  3MXI A;  3RTV A;  3OYL A;  2NUB A;  1RDC A;  3NHG A;  4OLA A;  2Q3S A;  2DTU A;  2KTQ A;  5CYM A;  2YHB A;  1B9F A;  4DTR A;  5KTQ A;  2OPQ A;  4ID1 A;  4CHQ A;  4JRP A;  4M3R A;  4FJN A;  3ZT4 A;  1L3S A;  1K6Y A;  4KKO A;  1N5Y A;  4C8N A;  4Z4F A;  3DRR A;  3NFA A;  4CJK A;  2PYL A;  1KVC A;  3AO4 A;  1VSM A;  2FBT A;  1TAU A;  2YHA A;  4KTZ A;  3NBP A;  4OVL A;  5HP1 A;  4K8X A;  1UA0 A;  4FJ9 A;  1NJW A;  2YNF A;  1CZB A;  1JXE A;  4H8K A;  3LP2 A;  3ZSR A;  1SKS A;  4FJJ A;  5I3U A;  4CEZ A;  3TAB A;  4DTJ A;  5D3G A;  3K58 A;  4H4M A;  2IGI A;  1KCF A;  4N47 A;  4DSL A;  1NKB A;  4PWD A;  3VN5 A;  3QER A;  3KLH A;  4J2D A;  3S9H A;  1HNV A;  4Z0U A;  4DFJ A;  3SI6 A;  4J2E A;  5HRR A;  5J2P A;  3SQ1 A;  3OJU A;  4FJL A;  3O3H A;  3K59 A;  3PV8 A;  3K5L A;  1SKW A;  4CJS A;  4CED A;  4CGD A;  4DS4 A;  4FZZ A;  5KRT A;  4KHN A;  1LWF A;  3ZSW A;  1NK5 A;  1BHL A;  3VQD A;  4RW7 A;  1L5U A;  3NH1 A;  4FJH A;  3B6O A;  1VSJ A;  4CJ3 A;  4BDY A;  4CF8 A;  4NYN A;  5EU7 A;  4OJR A;  2YNG A;  1I39 A;  3CM5 A;  1RT6 A;  4DF4 A;  1J5O A;  4YNQ A;  4B9N A;  1VRT A;  4OLB A;  4M41 A;  3LDS A;  4KRF A;  1GOB A;  3LPT A;  4FYD A;  2PY5 A;  1WNS A;  1RT5 A;  2HNZ A;  1S1V A;  1X9S A;  3H08 A;  4CIE A;  4OPK A;  2B5J A;  3K5M A;  1KLN A;  4M3X A;  1WSF A;  5E41 A;  2P5O A;  2HHU A;  4DWI A;  3V1O A;  3QEI A;  4YFU A;  4CGI A;  1XWL A;  1D5A A;  1NK8 A;  5SZT A;  3VQC A;  4IFV A;  4DTN A;  3ZSV A;  3SZ2 A;  4E19 A;  1WLJ A;  2EHG A;  1XC9 A;  2F8S A;  1KVA A;  3NAE A;  4WE1 A;  3SUP A;  5CZ2 A;  5C24 A;  3ZT1 A;  4NCA A;  4DSF A;  3KD1 E;  4NCG A;  1TV6 A;  4DG1 A;  2ITG A;  3DRP A;  4CJT A;  1J9A A;  2FC0 A;  4DU1 A;  2HHW A;  4CEC A;  4CFB A;  4DTM A;  1RT1 A;  2GUI A;  3QLH A;  1XHX A;  1T05 A;  3NGY A;  4F3O A;  3PUF A;  1NOY A;  4CER A;  4Z4I A;  1RT4 A; 
#chains in the Genus database with same CATH topology
 2WBN A;  1T6C A;  3J7Y P;  1SL0 A;  2YHY A;  3QNO A;  3MEE A;  1YI2 N;  3OYB A;  4ID5 A;  4O55 A;  3I8D A;  1X9M A;  4Q0B A;  5BRH A;  2HB5 A;  2YJE A;  1DKG D;  2E1Z A;  1WBB A;  4FLU A;  3GE1 A;  2CGJ A;  2FLO A;  4RCH A;  1YTA A;  4F3T A;  3TU5 A;  2JLE A;  2QWR A;  1C0M A;  1FJG K;  3MXM A;  3IMX A;  4AIL C;  4FJ5 A;  2F96 A;  1K8K A;  2HHH K;  1EXQ A;  4X65 K;  3QIP A;  1S72 N;  3ZLJ A;  4FPA A;  4CZL A;  4ELT A;  3K57 A;  4FPB A;  3H45 C;  3G4S N;  1KRP A;  5EXW A;  2HBJ A;  3SK3 A;  2ZE2 A;  4ICL A;  4IWV A;  3D2F B;  4JKG A;  2UXC K;  1S1T A;  3SPZ A;  3MX2 A;  3NH0 A;  3JXU A;  4B8A B;  1SUQ A;  3KIO A;  4WFA L;  3LPU A;  3DLH A;  4CGG A;  2ZD1 A;  3VQQ A;  4CHP A;  2P9I B;  3UKU A;  5BRE A;  3HL8 A;  2LSN A;  4DV6 K;  2P9U B;  3WNF A;  3ZEU A;  1YVU A;  4DR4 K;  4H0V B;  3O1W A;  4IFY A;  4GNI A;  3UB5 A;  2QWQ A;  1W2B M;  4Z4H A;  4C8O A;  2X78 A;  3PO5 A;  1C6V A;  3HPH A;  3RR8 A;  4BWM A;  4IOA L;  1FXX A;  4A5A A;  4BRI A;  5I42 A;  1Q81 O;  1VQO N;  2CH5 A;  1RTI A;  3L0Q A;  3MDQ A;  4FJM A;  3DLE A;  3L4I A;  4JNE A;  1BCO A;  2RPI A;  3EE8 A;  4BRN A;  4LSL A;  3V1Q A;  3WNE A;  3JS6 A;  1N36 K;  4M42 A;  2RF2 A;  3U6F A;  3E9P A;  3CCS N;  4GVM A;  3KLI A;  4DTU A;  4CF2 A;  4N56 A;  3KJV A;  3AY9 A;  1NK6 A;  2G8V A;  1BIU A;  4M63 C;  3V4I A;  1IO2 A;  4FK4 A;  2OTJ N;  1JL1 A;  3Q7B A;  1L3T A;  5BPL A;  1S9G A;  2HST A;  4E1M A;  3NVM A;  3PX0 A;  3SMS A;  3T19 A;  2FBX A;  4IOX A;  4M3T A;  1OH6 A;  1QVF M;  2O4I A;  4H0Y B;  3G6E N;  3A5L C;  1I94 K;  4DV4 K;  1BG3 A;  2O8C A;  3WEE B;  4LH5 A;  3TAM A;  1FKO A;  1NJX A;  4CZK A;  3SV3 A;  3G25 A;  4FSV A;  2R7Y A;  5GIO A;  4KB1 A;  3DLR A;  4PQU A;  3L3V A;  4DQR A;  1VQ8 N;  4AHR A;  1VQK N;  3PO4 A;  5CR4 A;  2FBY A;  3ZT2 A;  1UAX A;  3WXM B;  4LF5 K;  3PIP L;  3I0S A;  3AVJ A;  2GTD A;  1S1W A;  4EZ9 A;  1RT2 A;  4GV3 A;  5IWA K;  4E7H A;  1HPZ A;  1LW0 A;  4M3W A;  2AJQ A;  3L8B A;  2D0P A;  1QZ5 A;  1VRU A;  1SKS A;  3CJB A;  1A5W A;  1Z26 A;  3AAP A;  1X1P A;  4HUG A;  1OH7 A;  5AQN A;  4BRD A;  3U3G A;  4CK3 A;  3SQ0 A;  4G1Q A;  3O1B A;  4X62 K;  4KI4 A;  3DAW A;  1S5J A;  4BVO A;  4WF9 L;  1QE1 A;  4FO0 A;  4E3S A;  2YKN A;  5CZ1 A;  4NXM K;  3AVA A;  2VQE K;  1BUP A;  4H4O A;  4B1V A;  1NGG A;  1QQO A;  4H5R A;  4CZG A;  4DQP A;  2QKB A;  1C1B A;  4GKK K;  5FRN A;  2O8F B;  3ASM A;  5AZI A;  4JS5 A;  3DJC A;  5J1E A;  4DR7 K;  1EET A;  1VSH A;  2W42 A;  4FM1 A;  2D0O A;  2OPS A;  4IDH A;  2UU9 K;  5AQQ A;  4J2A A;  3KHY A;  1YT3 A;  2H3G X;  2F9T A;  4WQ5 C;  2YX6 A;  1VQ6 N;  4RW6 A;  1QSY A;  3SJH A;  3LAL A;  3SYZ A;  1RT7 A;  4O0J A;  1TL3 A;  2O8D B;  2Z1J A;  5AZJ A;  1HLU A;  3PX6 A;  3DLB A;  1TUU A;  2VG7 A;  2IC3 A;  5AQP A;  1D9F A;  1N32 K;  2ZJR L;  4DUY K;  4QCL A;  5KGW A;  5J2Q A;  4LH4 A;  3TAG A;  1OVQ A;  4DR3 K;  1WSI A;  3VQ4 A;  5LY3 A;  4CK2 A;  3VQ9 A;  1NU0 A;  2A6A A;  5GAE P;  3ZCM A;  3BEX A;  1VQN N;  2ZQB A;  4Z4E A;  5EY4 A;  3THX B;  5C2F A;  4CHZ A;  4IDK A;  4W5Q A;  4G9Z A;  1YJW N;  1RDA A;  2HF3 A;  4YOY A;  4A2A A;  4WQ4 C;  3HK2 A;  2QWM A;  2XY5 A;  3CM6 A;  3E9O A;  4EHT A;  2Z1I A;  1IJJ A;  4FJX A;  3OBW A;  1V4T A;  2NRH A;  3U9Z A;  2XRI A;  4FW2 A;  4NCB A;  3THV A;  3ENB A;  4M7X A;  4DV1 K;  1VSE A;  1GOC A;  2B4J A;  1KC8 O;  4JAX A;  1C0U A;  1LCU A;  4FVU A;  5KI6 A;  5JIC A;  3QDK A;  3OY9 A;  3QFU A;  1OVY A;  1RIL A;  3K2P A;  1RNH A;  3E1Y A;  2NRT A;  1NK4 A;  4CJF A;  4JHD A;  1IG9 A;  1CZ9 A;  1QTM A;  3DLK A;  3O80 A;  4B3M K;  3ZSQ A;  1Q82 O;  5F2R A;  2E6M A;  2P1J A;  4BE1 A;  2PYJ A;  1EWQ A;  3BUZ B;  1HX1 A;  1RFQ A;  1EO1 A;  3PLA A;  1GLL O;  1W9H A;  3J7Z O;  5KPR A;  2KZM A;  4H0P A;  4FCY A;  3VQ6 A;  3SLC A;  3T3F A;  4DTS A;  1SKR A;  5SWM A;  3M6G A;  3RRG A;  3A5N C;  5LMU K;  5T7B A;  4Z4G A;  4GW6 A;  4CD3 A;  3HST B;  4EP5 A;  3TAQ A;  4W5N A;  3SQ2 A;  2E2N A;  3HPG A;  2I5J A;  4MDB A;  1JCG A;  4IXC A;  3VEO A;  3I33 A;  4CJE A;  3LWL A;  2XY7 A;  2W40 A;  3T69 A;  4FK2 A;  1T6D A;  4RWT A;  3VF4 A;  3O9T A;  1K8A O;  3WXL A;  3WQT A;  4KHP K;  1RTD A;  1S6P A;  3M8R A;  4CBW A;  1J53 A;  1UWB A;  4ELU A;  3GBT A;  3KVG A;  3P83 D;  4FWP A;  3ZSY A;  3L2U A;  2HHU A;  3CQX A;  4L3Q A;  2F4V K;  2ZGY A;  4MLH A;  5AQU A;  5CYM A;  2QTD A;  4DTR A;  4I6M B;  1IBM K;  3ZET A;  1L3S A;  1K6Y A;  4KKO A;  4Z4F A;  1QHA A;  4OVL A;  2ASM A;  4FJ9 A;  3TTF A;  1S3X A;  3R8E A;  5I3U A;  2BTF A;  3N4Q A;  1O13 A;  3D7E O;  5KQ8 A;  1VQP N;  3O4W A;  2VYP A;  4OPA A;  5JVH L;  1KCF A;  4DSL A;  1NKB A;  3QER A;  4JKC A;  5J2P A;  3GG4 A;  1WOQ A;  1HUX A;  5KQD A;  4DS4 A;  4KHN A;  3ZSW A;  1NK5 A;  3CJ1 A;  1YIT N;  4CJ3 A;  4WFN L;  1J5O A;  1RT6 A;  1VRT A;  1BA1 A;  4M41 A;  3LDS A;  5ADX H;  3LPT A;  4FYD A;  1WNS A;  2V52 B;  2JWK A;  4BG9 A;  1EQY A;  3SBT A;  4DWI A;  1RGI A;  1NK8 A;  2PFU A;  5AQF A;  2QM1 A;  2VCP A;  4B1U B;  2F8S A;  1M1K O;  5C24 A;  3KD1 E;  4NCG A;  3QB0 A;  4DG1 A;  3QIC A;  1XC3 A;  4DTM A;  2GUI A;  3C6A A;  3UKR B;  3NGY A;  4F3O A;  4JI6 K;  4CER A;  2A5X A;  3CD6 N;  3Q7C A;  1Q9X A;  4CF1 A;  3VGL A;  1Y97 A;  1LAV A;  2O4G A;  1G99 A;  4FLZ A;  1Q7Y O;  3EY1 A;  2A3Z A;  3CCQ N;  4HTU A;  3RMD A;  2KKZ A;  2PBD A;  3O5B A;  1YHQ N;  3DYA A;  4LY7 A;  4HVJ A;  3HXM A;  2O8E A;  4FM2 A;  3LAM A;  4CK1 A;  3IUC A;  3ZX2 A;  4RW8 A;  3C6U A;  4J8F A;  2OAN A;  3VA0 A;  1T8E A;  3SV4 A;  2G8I A;  3L6Q A;  5AQZ A;  3VTI A;  4FJ7 A;  3SAH A;  1VSD A;  3EKU A;  4MO5 A;  5HOO A;  1C1A A;  4UQG A;  2IS3 A;  4BVP A;  4F2S A;  3QIN A;  2W41 A;  2Q0R A;  2CH6 A;  3I56 N;  3HSC A;  2OYQ A;  4FW1 A;  2HNY A;  4OX9 K;  3AVM A;  4H03 B;  4JV5 K;  2W6K A;  1MWK A;  5CE3 A;  4BDZ A;  1NGJ A;  4Q5V A;  3OA9 A;  1EKE A;  4AHU A;  3VEW A;  3CQ8 A;  5AQK A;  3K9K A;  4JKH A;  3HZ6 A;  3F5T A;  4DR6 K;  3HYF A;  2GV9 A;  3BP8 A;  2HHX A;  5DM6 L;  4FVM A;  4M3Y A;  3HP9 A;  4BGA A;  3FFI A;  3MXJ A;  1NK9 A;  4B08 A;  3TSQ A;  1YUW A;  3H1Q A;  4IFE A;  5BR9 A;  4BR5 A;  2YNI A;  3KLE A;  2ZGZ A;  4N76 A;  3WNG A;  3VPZ A;  2P51 A;  2Y1J A;  4HHT A;  3QEP A;  4H0O A;  3CJ7 A;  2G8F A;  1ZBU A;  5AQL A;  1IKX A;  4LD0 A;  3CC7 N;  1EP4 A;  4CEQ A;  2UXB K;  4PKI A;  3VEX A;  4CEA A;  5GAG P;  3IDH A;  3CCU N;  5JS2 A;  3KLF A;  1MWM A;  3P4I A;  4JKG B;  1TGO A;  3K5O A;  4OGC A;  1SZ2 A;  4KTW A;  5EX5 A;  1U49 A;  4ILG B;  4QS9 A;  4K25 A;  3VQB A;  3NF8 A;  2KHO A;  5BRF A;  3M5R A;  1NGC A;  3H46 O;  3TSU A;  4DV0 K;  2QA4 N;  1RBT A;  3BF1 A;  4JK8 A;  1SV5 A;  2NRZ A;  3AA2 A;  3SUN A;  4EZ6 A;  4CJU A;  3UKU B;  4QS8 A;  2XO7 A;  4AHC A;  4A2B A;  5BRD A;  4R79 A;  2BDP A;  2FF3 B;  2NRX A;  2Q0U A;  1GLD G;  1EX4 A;  5HRP A;  3FZH A;  3ZEU B;  2XY8 A;  1I3A A;  3V9U A;  1BU6 O;  4BR9 A;  3ZYY X;  4BRE A;  3QBX A;  4JK9 A;  4A62 A;  5GAH P;  4KHW A;  1ZYQ A;  2F9W A;  3ATU A;  1X9W A;  4CJQ A;  1ASV A;  3DMJ A;  1CLQ A;  2QWO A;  1IKY A;  4YHH K;  3LAK A;  3V9W A;  1T03 A;  5TKW A;  3V9S A;  4PY5 A;  3TAR A;  3V6D A;  3HO1 A;  2KFN A;  2ASP A;  3AAR A;  5KGX A;  5KRS A;  3AGR A;  2WOM A;  1BCM A;  4B9T A;  3HM9 A;  4BRM A;  1HJO A;  1YTU A;  5KPZ A;  4IJA A;  4TSX A;  2ZJQ L;  1HNI A;  4LFA K;  4MLE A;  2UXD K;  1ASW A;  5AFU H;  4E1N A;  2UYT A;  2VWB A;  3HJF A;  4BRC A;  4JEP A;  2G8H A;  4CGF A;  3MEG A;  3C0B A;  4FWO A;  3MWP A;  3JAM O;  5HRO A;  1U6Z A;  2IOC A;  3S3O A;  1IBL K;  3OHR A;  4CIG A;  4XH4 A;  4KHY A;  5JLH A;  3VQA A;  3TTD A;  1QQM A;  2ZF5 O;  2KFZ A;  3F73 A;  4BE2 A;  2A1R A;  4I2P A;  4DU4 A;  1BI4 A;  4FJI A;  4PUO A;  2O8C B;  3R9P A;  1LOT B;  5M1F A;  4FOI A;  2NRW A;  4KH5 A;  4DS5 A;  1NJZ A;  1VQ7 N;  4N41 A;  1Z25 A;  2GBZ A;  1R0A A;  1Q86 O;  1T44 A;  1YF5 L;  4IG0 A;  4WFB L;  4KBO A;  1U04 A;  3A0I X;  4O5B A;  3BF3 A;  4NXN K;  4AHV A;  1Z6R A;  1HQU A;  3IRX A;  4BR4 A;  4XH5 A;  1ITG A;  3ZSX A;  4LFB K;  1QHT A;  3EO3 A;  1BIS A;  1NGB A;  2OPP A;  3VQE A;  4KB0 A;  2VG6 A;  1E4F T;  1XHZ A;  4KRE A;  4JKD A;  2GUP A;  4OKK A;  1VK0 A;  1XUP O;  3SAF A;  5ELZ A;  1GLF O;  5M1N A;  3FR0 A;  4JKE A;  5AQG A;  3HM8 A;  4YY3 K;  3DI6 A;  3ITH A;  3VEY A;  2UUC K;  2P9L A;  4F8R A;  4DV7 K;  4Y1C A;  3KD5 E;  1JLG A;  1BQN A;  3LDP A;  1HKG A;  4CJW A;  4FK0 A;  2ZJP L;  2BAN A;  3QBW A;  4GMJ B;  4B9V A;  4ILH A;  4RW4 A;  3AAQ A;  4GKJ K;  1IKV A;  1F21 A;  1DEJ A;  5AZI B;  4NYF A;  3DLG A;  3RMC A;  2BE2 A;  1TKD A;  4DQQ A;  3NF7 A;  2NNW A;  3GL1 A;  1TKT A;  3QEW A;  3S3N A;  3P1G A;  5GAD P;  4CZF A;  3HVT A;  4NLB A;  2E2O A;  4B1Y B;  1RTJ A;  2HND A;  4B3O A;  1CXQ A;  4AM6 A;  5AZJ B;  4DF8 A;  3QES A;  3NMU A;  3P39 A;  4ISE A;  1L3V A;  2EWS A;  1ZBI A;  3CIP A;  1W0H A;  3CQY A;  5LJW A;  4CJ7 A;  1QZ6 A;  4BRQ A;  4DLG A;  3AVC A;  3DM2 A;  2P5G A;  4FXD A;  1J5E K;  4CE9 A;  3ISN C;  4JI1 K;  3FGU A;  1TK0 A;  2DFH A;  2D0C A;  2HW3 A;  4O0I A;  3PX4 A;  5BN8 A;  1P8Z A;  3TAP A;  3AO3 A;  1WAJ A;  3FZK A;  4CES A;  3S3M A;  4H5N A;  1TVR A;  2E2P A;  3O3F A;  3AA5 X;  1GLJ O;  4JKA A;  4FL9 A;  4CEE A;  5H1S Q;  2I7P A;  1IKW A;  1KTQ A;  3VQ5 A;  3C95 A;  3CPE A;  3QET A;  1TKX A;  3QEV A;  1NKE A;  2AA4 A;  4MFB A;  5C25 A;  1BA0 A;  3LZI A;  2P9S A;  1Q8I A;  3EYZ A;  4DTO A;  3NCI A;  3OYL A;  2NUB A;  1HPM A;  4A61 A;  1OH8 A;  3MWT A;  4OLA A;  3PSF A;  1NGI A;  5KTQ A;  4JHD B;  4CHQ A;  1YJN N;  3O9U A;  1ATS A;  4C8N A;  3DRR A;  5AQO A;  3NFA A;  3L4Q A;  4FWL A;  2PYL A;  4BRK A;  1TAU A;  3CER A;  1JCE A;  1WB9 A;  3NBP A;  1WUA A;  3ULE A;  3ZSR A;  3HOT A;  5B8H A;  4EFH A;  1U2V B;  4DTJ A;  2IGI A;  3BZC A;  3D2E A;  4N47 A;  3SBG A;  4PWD A;  1HKC A;  3DWL A;  4F9O A;  3S9H A;  1HNV A;  1TYQ A;  5BR8 K;  3OJU A;  3O3H A;  3PV8 A;  1SKW A;  2J4R A;  4CED A;  4CGD A;  3CF5 L;  4DQ8 A;  5KRT A;  1BHL A;  3CCR N;  1HNX K;  1NGA A;  4FJH A;  1VSJ A;  3DXM A;  4YOV A;  4CF8 A;  4NYN A;  5EU7 A;  1IV0 A;  2E1Y A;  5C2D A;  4JI8 K;  1GOB A;  3ID8 A;  4OPK A;  1N34 K;  2B5J A;  3K5M A;  3MN5 A;  3QEI A;  1XWL A;  3TSP A;  1D5A A;  4IFV A;  4JI3 K;  2P9K A;  2EHG A;  5BN9 A;  3E9L A;  5JVG L;  4AM7 A;  1GLC G;  4GV6 A;  4X66 K;  3ZT1 A;  3ZET B;  1BWF O;  1TV6 A;  2E20 A;  1XNQ K;  3DRP A;  1J9A A;  4IEI A;  4DU1 A;  2HHW A;  5FLX O;  1RT1 A;  1GLB G;  1XHX A;  1T05 A;  2FSJ A;  4NB4 A;  3PUF A;  1VQ4 N;  1RT4 A;  2E4L A;  4LF7 K;  4U7B A;  3P31 A;  2E2Q A;  4OKJ A;  3MN6 A;  1X3N A;  3LP0 A;  3KWI A;  4FZX C;  1QSS A;  1LV5 A;  1J6Z A;  3KK2 A;  3T1Y K;  3LDQ A;  3VES A;  4AHT A;  1U47 A;  3M8P A;  1U2V A;  3AVG A;  3SMP A;  3VF2 A;  3TAN A;  3TAE A;  2V7Z A;  3K5N A;  3FLC O;  4DSK A;  1A5V A;  4CZJ A;  2DPN A;  4CF0 A;  4CJ4 A;  1BOT O;  1S1X A;  4LFC K;  4CHO A;  2HOE A;  5F0X A;  2HBL A;  3BZK A;  4O4G A;  1NGD A;  2G8K A;  1OKJ A;  3ZT3 A;  4CFD A;  1E4G T;  2FSK A;  3EKS A;  1KXP A;  4DFM A;  3G10 A;  1E3M A;  4FJG A;  1TL1 A;  3TR8 A;  1JLC A;  5AQY A;  1S6Q A;  1FW6 A;  5ADX A;  3R6M A;  3ENO A;  4DR5 K;  2KZZ A;  1LW2 A;  4BRL A;  3CXC M;  2Z1G A;  4FWN A;  3L2W A;  5AR0 A;  4HUE A;  4E7L A;  3EE9 A;  1W97 L;  4FOE A;  4JRQ A;  3RMA A;  4XEI A;  1VQ5 N;  1D8Y A;  3KTQ A;  5A2Q O;  4DHY A;  4B8C A;  2F7T A;  4XH1 A;  4KO0 A;  5DMR A;  2FXU A;  5EOY A;  4CGJ A;  4O8K A;  4BRG A;  4JN4 A;  4CD1 A;  3AV9 A;  1NGH A;  4JYA K;  1B92 A;  2A1S A;  1NK0 A;  2E6L A;  4FJ8 A;  3OBY A;  4AHS A;  2O8E B;  3VER A;  4AQY K;  2E8A A;  2V51 B;  2IVN A;  3C6T A;  3HVR A;  3CC2 N;  4ZHR A;  1NMN A;  3RR7 A;  1WSH A;  2YV0 X;  5C10 A;  1TK8 A;  4B9U A;  2GWK A;  4N5S A;  1BQM A;  5M1Q A;  3O9S A;  2ZM6 K;  3GDQ A;  4H0T B;  1Q9Y A;  2HBK A;  3DOK A;  3CJA A;  1FKP A;  3CCV N;  1N33 K;  1NWK A;  4K42 A;  3N4P A;  1C0T A;  3AO1 A;  4DFP A;  4YDU A;  4ZTF A;  5HRS A;  5BPN A;  3FE1 A;  4AH9 A;  4DTP A;  3KLG A;  5AQX A;  2QXL A;  3AVN A;  4FWS A;  1VSI A;  4BC3 A;  4V19 S;  2G8W A;  3D6R A;  4JS4 A;  5FPM A;  1X9J A;  4AF1 A;  1LWC A;  4RW9 A;  2D4W A;  4W5O A;  1VSL A;  2VG5 A;  3FZL A;  1CXU A;  1K9M O;  3KZB A;  4R5P A;  3A2F A;  4C23 A;  3HBT A;  1HMV A;  3OJS A;  1UA1 A;  3C94 A;  5FRM A;  1TUY A;  2WUS A;  1NOZ A;  5DM7 L;  3QEX A;  1HNW K;  3CI5 A;  1MU2 A;  3CJC A;  3AVF A;  4QAG A;  4HCC A;  3O4Q A;  3IAY A;  2X6S A;  4CI6 A;  3MX5 A;  1DT9 A;  3C65 A;  1JLF A;  4I2Q A;  1RT3 A;  3FZM A;  3B8A X;  4DCH A;  2RKI A;  2VGM A;  4DFK A;  4K0K K;  2KLA A;  4FJK A;  3OS2 A;  4A59 A;  1REV A;  3S41 A;  4ZTJ A;  5LJV A;  3OYI A;  3TI0 A;  4HTL A;  3WXJ A;  1IBK K;  2OCE A;  2ETJ A;  3TAF A;  4IO8 A;  3OYC A;  3CCM N;  1LWE A;  1VHX A;  2RN2 A;  5M1O A;  2ASO A;  1D9D A;  2QXF A;  4JD2 B;  5AQR A;  3PSI A;  4WYB A;  3AVH A;  3VOV A;  3BY5 A;  4BE0 A;  3RRH A;  4YOR A;  2Q97 A;  3RSE A;  3BGR A;  3J7A P;  2YKM A;  1NBW A;  3W3D A;  1KSP A;  2EX3 A;  2VGN A;  1MDU B;  1BL3 A;  5JS1 A;  4CW7 B;  1XMQ K;  5I9E B;  4M45 A;  1C1C A;  4CGH A;  4M3Z A;  1SS6 A;  3O9R A;  2KQ2 A;  2HBM A;  1IG8 A;  1D4X A;  3D45 A;  4OKE A;  3U3Y A;  1NNE A;  3UIQ A;  2IIR A;  3CFP A;  2WC9 A;  4DR2 K;  3ULD A;  4GV9 A;  4E89 A;  4CZH A;  2NLX A;  1JLQ A;  3NVK A;  2OPR A;  4JK7 A;  2Y1I A;  2HHQ A;  2NZT A;  2JGU A;  3SAG A;  4MO4 A;  3ZSO A;  1YAG A;  4BRA A;  3LDL A;  4BQZ A;  3LZJ A;  5K14 A;  1JLA A;  3CC4 N;  1KVB A;  2X6N A;  3OYD A;  4HWI A;  3KKS A;  4YOX A;  1JL2 A;  1S22 A;  2KW4 A;  4IJN A;  4CZI A;  4CCH A;  4K43 A;  3THY A;  1WAF A;  4W5R A;  4KH4 A;  4BG8 A;  1LAW A;  4JKB A;  5TKY A;  4JKF A;  1TKZ A;  4LF6 K;  4CEF A;  1RBU A;  5KPT A;  1KAY A;  3VMF B;  3C7N A;  2PZS A;  3THW A;  1WSE A;  4JD2 A;  1BI4 B;  4BRP A;  3LP1 A;  4F2R A;  3BDP A;  1GLE G;  3E01 A;  3F9M A;  4F4K A;  1YIJ N;  2P9N A;  4DQI A;  3RMB A;  4LF9 K;  1WSG A;  4CEB A;  4PHT X;  3VEZ A;  2UUB K;  1DLO A;  4I9Q A;  2D0B A;  1KFD A;  3ZX0 A;  3MN7 A;  1HYZ A;  1C0G A;  3SUQ A;  4YOW A;  4I7F A;  4DQS A;  3P5J A;  1KLM A;  3NF9 A;  3AO2 A;  2HF4 A;  5DK5 A;  4O5F A;  4CBU A;  5HL7 L;  3ALY A;  4EIA A;  4DSI A;  1BO5 O;  5J2N A;  1A5X A;  3HRG A;  1NGF A;  1NGE A;  3CCJ N;  3W0L A;  3OYH A;  3FZF A;  1TAQ A;  4YOU A;  2P9L B;  4DSJ A;  3L2Q A;  4J2B A;  5C12 A;  1Z05 A;  3CG7 A;  1JLB A;  4O8U A;  3U8X A;  2UUA K;  3SNN A;  3I0R A;  3M8S A;  1DTT A;  4IKF A;  4UY8 O;  1YJ9 N;  3OYF A;  4E1J A;  4CEO A;  4B9S A;  1JKH A;  4DV2 K;  1JXB A;  2YHW A;  1BIZ A;  4FWK A;  3MAQ A;  3JYT A;  5FPD A;  1GOA A;  4ISF A;  1S9E A;  3MXI A;  4Z94 A;  3ID6 A;  3DLL L;  1DGK N;  4BR7 A;  4H5V A;  3I55 N;  2DTU A;  2YHB A;  1B9F A;  1ZXO A;  4ID1 A;  3ZX3 A;  4FJN A;  3ZT4 A;  4B3T K;  3QML A;  3KK7 A;  3MCA B;  4CJK A;  1KVC A;  3AO4 A;  2YHA A;  4KTZ A;  1NOY A;  4H0X B;  4MDA A;  4K8X A;  1Y64 A;  1UA0 A;  2Q2R A;  3O8M A;  2YNF A;  1CZB A;  1JXE A;  4H8K A;  3LP2 A;  3TAB A;  3K58 A;  3CJ9 A;  3VGM A;  2IVO A;  3VGK A;  2E5L K;  2A40 A;  3VN5 A;  2GX9 A;  4J2D A;  3SI6 A;  5HRR A;  5LL6 Z;  3SQ1 A;  1RDW X;  3K59 A;  4CJS A;  4FZZ A;  1LWF A;  3VQD A;  3NH1 A;  3TTC A;  2YNG A;  3CM5 A;  3H1V X;  4YNQ A;  4OLB A;  3R1X A;  4KRF A;  3EEQ A;  3H3O B;  1RT5 A;  2HNZ A;  3H08 A;  4BQL A;  4CIE A;  1JCF A;  1KLN A;  4M3X A;  2P5O A;  4QS7 A;  2P9S B;  2QWP A;  3ZSV A;  3SZ2 A;  4E19 A;  1WLJ A;  4IZ9 A;  2VQF K;  1KVA A;  4IEE A;  4WE1 A;  1RDU A;  2QWL A;  4NCA A;  4M7Y A;  4U67 L;  3D2F A;  4ISG A;  3QLH A;  1OH5 A;  1W7A A;  4B1W B;  4C1N K;  1VQ9 N;  3GOI A;  1KD1 O;  4BRO A;  4Z4I A;  3ULE B;  3WUH A;  2WON A;  1RTH A;  3WXK A;  3OYM A;  2WTU A;  1RCH A;  4Y0W A;  4CJL A;  1RBV A;  4BAC A;  4CFA A;  3WNH A;  1HRH A;  1U45 A;  4C8M A;  4B9L A;  2D5R A;  3C6H A;  2P9I A;  3D2E B;  3F9K A;  3HPO A;  3OYK A;  2B6A A;  1WN7 A;  1TYQ B;  4IBN A;  2P9U A;  2X74 A;  1NKC A;  2V7Y A;  4KAZ A;  2VWJ A;  3AGK A;  2I7N A;  2Q1N A;  5C42 A;  1S1U A;  4HUF A;  2P9P B;  3DXM B;  2GWJ A;  5GIN A;  1K73 O;  3KK3 A;  3A5M C;  4GY2 B;  1MA9 B;  4PKH A;  4KH6 A;  3TWH A;  2NRV A;  4BC5 A;  4JI5 K;  5J2M A;  3ENH A;  4KPY A;  3QFP A;  4DTX A;  1SL1 A;  3J80 O;  2YNH A;  5C15 A;  1EWR A;  1VSF A;  3H3N O;  3MEC A;  2P9K B;  2IDO A;  5M1P A;  1ILY A;  3AA4 A;  3VEN A;  3AVK A;  3AA3 A;  4QOZ B;  2HVI A;  2XHB A;  3LDO A;  4FZY A;  5EVZ A;  4KHS A;  2PAV A;  2ITM A;  1DTQ A;  5MLC Q;  4KV8 A;  3AVI A;  1QVG M;  1QQC A;  5HLF A;  4Z4C A;  3SPY A;  3DOL A;  1VAZ A;  3O4N A;  3NF6 A;  4FWM A;  5CYQ A;  1SQK A;  3HOS A;  1XNR K;  1P90 A;  4CJV A;  2DFE A;  4C1N I;  3AVL A;  3B6P A;  1YVN A;  4ELV A;  4WQ5 A;  3J8A A;  2VWK A;  3SJJ A;  1VSK A;  5AQH A;  2DY4 A;  4H5T A;  1HNZ K;  3EZW A;  4X64 K;  4E7J A;  1RDB A;  2QWN A;  1JJ2 M;  3WXI A;  4IG3 A;  4CFC A;  1ZBS A;  2FBV A;  4E7K A;  5FPN A;  3WEE A;  5JLF A;  4K8Z A;  4BGB A;  4KHU A;  4DUZ K;  3QO9 A;  2YHX A;  2YCH A;  3CMA N;  3VA3 A;  2Q36 A;  2A42 A;  3A5O C;  3IS9 A;  3V9X A;  3CFO A;  2P9P A;  5AJ3 K;  2QKK A;  3EN9 A;  3OYE A;  3SCX A;  4BDP A;  4JLH A;  3MMV A;  4M3U A;  3PIO L;  2D1K A;  3T1H K;  1BGX T;  1U4B A;  4O44 A;  2HHV A;  4XIU A;  3AO5 A;  4WQ4 A;  3KKR A;  3H6E A;  4MQ3 A;  2CGL A;  3ATV A;  4NLC A;  2HMP A;  1NK7 A;  3M8Q A;  5FPE A;  4OPJ A;  1U48 A;  3T1A A;  3VTH A;  1ASU A;  2XY6 A;  3L3U A;  5CY4 A;  3U4L A;  3I8B A;  4EAH D;  1HR0 K;  1GLA G;  3OYG A;  4E7I A;  5JMV A;  4FLX A;  4CF9 A;  1HYV A;  4FM0 A;  3HI0 A;  3OYJ A;  4Y1D A;  1IH7 A;  2AP1 A;  3J81 O;  3VEV A;  4CJ5 A;  3CME N;  3RVC A;  4CJP A;  4CHY A;  3NGZ A;  1N6Q A;  2QK9 A;  1QQN A;  2HHS A;  1XMO K;  2O8F A;  3O6W A;  3V1R A;  2OTL N;  3DRS A;  4BR2 A;  2HVH A;  3M1F A;  3O3G A;  3O9Q A;  4FLW A;  3D0P A;  2O8D A;  1RBR A;  3NGI A;  1HQE A;  1XI1 A;  4OGE A;  3JSM A;  1G15 A;  1T7P A;  3CHW A;  1JLE A;  2BUP A;  4FWQ A;  3OYN A;  3PY8 A;  1NLV A;  1QSL A;  3OVN A;  4JI2 K;  3IKM A;  2F8T A;  5FDL A;  4KI6 A;  3CCL N;  3IFR A;  5AQI A;  5FRO A;  3M3Z A;  4DKW A;  2HHT A;  3UE5 A;  3THX A;  1VQM N;  4BWJ A;  4KHQ A;  3V9Z A;  3SUO A;  4BRH A;  4BC4 A;  4IO9 L;  4DU3 A;  4RG8 A;  4DMN A;  4LF4 K;  3EZ5 A;  3V81 A;  3MCP A;  4DSE A;  1NJI O;  3LAN A;  2QEX N;  3OS0 A;  5AQV A;  3K9J A;  3LDN A;  4B1X B;  4DV5 K;  4K41 A;  1RDD A;  1CZA N;  3LWM A;  2IAJ A;  2HMI A;  1R59 O;  4LC9 B;  1L3U A;  2FF6 A;  1BDG A;  1NMD A;  1Q18 A;  3K0S A;  4B3R K;  1UOC A;  4BY9 C;  5AQT A;  4B9M A;  4B1Z A;  3QNN A;  1ZBH A;  2A41 A;  2OA8 A;  1WBD A;  3NH2 A;  2QW9 A;  4PL7 A;  1NJY A;  4JI0 K;  2Q31 A;  5CHI A;  4FWR A;  2NRR A;  1QS4 A;  3E66 A;  3G71 N;  4FLV A;  4W5T A;  3CET A;  2FSN A;  3VQ7 A;  5M1K A;  5GIP A;  3NE6 A;  2W6L A;  1SAZ A;  3G0Z A;  4CJR A;  3OYA A;  4EP4 A;  4FLT A;  3SQ4 A;  4LSN A;  3LM9 A;  4CHN A;  3RSE B;  1HKB A;  4DV3 K;  3MED A;  4DLE A;  4PL8 A;  2G8U A;  4YOT A;  4YDU C;  3VQ8 A;  1WSJ A;  4BRF A;  3WT0 A;  4PA1 A;  4FLY A;  2Z1H A;  1C0F A;  3EL2 A;  4JI7 K;  2BGG A;  1YXQ A;  2OZM A;  3O08 A;  3QIO A;  5LMN K;  4CIF A;  5AQM A;  3RWU A;  1B9D A;  2WFB A;  4L8R B;  3ZT0 A;  1ATN A;  3VF6 A;  4B9Q A;  4BR0 A;  4A5B A;  1SL2 A;  3R3L A;  4KFB A;  3ZSZ A;  1KFS A;  4DR1 K;  4A57 A;  3HT3 A;  1ZBF A;  4I6M A;  3OS1 A;  3OTO K;  3IG1 A;  4DB3 A;  4CBX A;  1TK5 A;  2D0A A;  3DXK B;  1ESV A;  4C8K A;  4IOC L;  1J54 A;  3KK1 A;  1ATR A;  3LP3 A;  3HTV A;  2RHK A;  4OPH A;  4CZE A;  4GVE A;  1KAX A;  2O8B B;  3THY B;  4E0D A;  3U9D A;  4EHU A;  1M90 O;  1NM1 A;  4CVN E;  4KTQ A;  1RBS A;  3NDK A;  5F1X A;  1ZBL A;  4RTF D;  3LM2 A;  5C0Y A;  3VET A;  3VQP A;  3CYM A;  4NO7 A;  3MK6 A;  4LF8 K;  3C7N B;  3THW B;  1O1W A;  3AVB A;  5HBM A;  2ATQ A;  1N8R O;  4C8L A;  1FK9 A;  1V4S A;  4HCB A;  5HRN A;  1H1V A;  1HJR A;  4I9L A;  2P9N B;  3CFR A;  1VQL N;  3HP6 A;  4ILJ A;  2JWL A;  3L2V A;  2OZS A;  1X3M A;  3L2R A;  2DFF A;  1HYS A;  3RTV A;  1RDC A;  3NHG A;  2Q3S A;  3A8Y A;  2KTQ A;  2OPQ A;  3KWG A;  4PKG A;  4JRP A;  1XQS C;  4M3R A;  4WCE L;  1N5Y A;  4BC2 A;  3FFK B;  3UKR A;  2CGK A;  1VSM A;  2FBT A;  1KQS M;  2E88 A;  1T3V A;  5HP1 A;  5IT9 O;  1NJW A;  2ZWH A;  4H5W A;  4FJJ A;  4CEZ A;  5D3G A;  3DXK A;  4H4M A;  3OW2 M;  2RE2 A;  3KLH A;  2GEM A;  5AQW A;  4Z0U A;  4DFJ A;  4J2E A;  3CCE N;  4FJL A;  2O8B A;  3K5L A;  2GEL A;  1L5U A;  1K8K B;  4RW7 A;  3TPQ A;  3B6O A;  4CZM A;  4BDY A;  4DF4 A;  4OJR A;  3CPW M;  1I39 A;  4B9N A;  5AFU A;  4B3S K;  2PY5 A;  4OO1 J;  3MN9 A;  1S1V A;  5AQJ A;  1X9S A;  3P38 A;  3WQU A;  3LL3 A;  1WSF A;  5E41 A;  3V1O A;  4YFU A;  4CGI A;  5AQS A;  3T7Z A;  5SZT A;  3VQC A;  4DTN A;  5BPM A;  1XC9 A;  5E84 A;  2BH1 A;  2IVP A;  3F2K A;  2YI1 A;  3NAE A;  3SUP A;  5CZ2 A;  4DSF A;  2ITG A;  5E26 A;  2FC0 A;  4JI4 K;  4CJT A;  1KAZ A;  4CEC A;  4CFB A;  1NG9 A;  1ZC6 A;  2YJF A;  2QI2 A; 
#chains in the Genus database with same CATH homology
 2E4L A;  2WON A;  3RWU A;  1Q9X A;  4CF1 A;  1RTH A;  3OYM A;  1SL0 A;  4OKJ A;  1RCH A;  3QNO A;  4CJL A;  1RBV A;  3LP0 A;  3MEE A;  4BAC A;  1Y97 A;  1LAV A;  4CFA A;  4FZX C;  2O4G A;  3WNH A;  3OYB A;  1HRH A;  4ID5 A;  4C8M A;  4FLZ A;  1U45 A;  1QSS A;  4B9L A;  2D5R A;  3HPO A;  3F9K A;  4O55 A;  3KK2 A;  3EY1 A;  3I8D A;  3OYK A;  1X9M A;  2B6A A;  1LV5 A;  4HTU A;  4Q0B A;  3RMD A;  4AHT A;  1WN7 A;  4IBN A;  1U47 A;  2X74 A;  3M8P A;  2HB5 A;  1NKC A;  4KAZ A;  4FLU A;  3DYA A;  4LY7 A;  2VWJ A;  3AVG A;  4HVJ A;  1YTA A;  5C42 A;  3HXM A;  4F3T A;  1S1U A;  4FM2 A;  3LAM A;  4HUF A;  3TAN A;  3TAE A;  4CK1 A;  3K5N A;  4DSK A;  1A5V A;  4RW8 A;  3C6U A;  2JLE A;  4CF0 A;  3VA0 A;  1C0M A;  4CJ4 A;  3KK3 A;  1T8E A;  3SV4 A;  2G8I A;  3MXM A;  3TWH A;  1S1X A;  5J2M A;  4KPY A;  4CHO A;  4AIL C;  4FJ5 A;  2F96 A;  4FJ7 A;  1EXQ A;  1VSD A;  4O4G A;  4DTX A;  1SL1 A;  2G8K A;  3QIP A;  1C1A A;  4UQG A;  2YNH A;  2IS3 A;  1VSF A;  3MEC A;  3ZT3 A;  4CFD A;  2IDO A;  3AA4 A;  4ELT A;  3K57 A;  4F2S A;  3AVK A;  3QIN A;  3G10 A;  4DFM A;  2OYQ A;  1KRP A;  3AA3 A;  4FJG A;  1TL1 A;  1JLC A;  4FW1 A;  3TR8 A;  2XHB A;  4QOZ B;  1S6Q A;  2ZE2 A;  2HNY A;  2HVI A;  4ICL A;  3AVM A;  4FZY A;  4KHS A;  1DTQ A;  1S1T A;  3AVI A;  4KV8 A;  3SPZ A;  2KZZ A;  1QQC A;  4BDZ A;  5HLF A;  1LW2 A;  4Z4C A;  4Q5V A;  3SPY A;  1EKE A;  2Z1G A;  4AHU A;  3L2W A;  3DOL A;  3CQ8 A;  3NH0 A;  4HUE A;  3O4N A;  4E7L A;  4B8A B;  1SUQ A;  3NF6 A;  3KIO A;  5CYQ A;  4JRQ A;  3LPU A;  3RMA A;  3DLH A;  4CGG A;  1D8Y A;  3KTQ A;  4CJV A;  2DFE A;  3HYF A;  3AVL A;  2ZD1 A;  3B6P A;  3VQQ A;  4B8C A;  4CHP A;  2GV9 A;  4KO0 A;  5DMR A;  4ELV A;  2HHX A;  4CGJ A;  4FVM A;  4M3Y A;  3HP9 A;  3FFI A;  3MXJ A;  3HL8 A;  1NK9 A;  2LSN A;  3AV9 A;  2VWK A;  4B08 A;  3SJJ A;  3WNF A;  1B92 A;  1VSK A;  2DY4 A;  2A1S A;  1NK0 A;  1YVU A;  2E6L A;  4FJ8 A;  4AHS A;  4E7J A;  1RDB A;  4IFY A;  4IG3 A;  4CFC A;  4Z4H A;  2YNI A;  4C8O A;  2FBV A;  4E7K A;  2X78 A;  3PO5 A;  3KLE A;  4N76 A;  1C6V A;  3HPH A;  3C6T A;  3HVR A;  3RR8 A;  4BWM A;  1FXX A;  4ZHR A;  3WNG A;  2P51 A;  3RR7 A;  5I42 A;  4K8Z A;  2Y1J A;  4KHU A;  4HHT A;  3QO9 A;  1WSH A;  2YV0 X;  3QEP A;  3VA3 A;  3IS9 A;  3V9X A;  1TK8 A;  4B9U A;  3CFO A;  4N5S A;  1ZBU A;  2G8F A;  1BQM A;  1RTI A;  1IKX A;  4LD0 A;  4FJM A;  3DLE A;  1EP4 A;  4CEQ A;  1BCO A;  2QKK A;  1Q9Y A;  3OYE A;  2RPI A;  3SCX A;  4BDP A;  4JLH A;  4M3U A;  4CEA A;  3DOK A;  5JS2 A;  1FKP A;  4LSL A;  1BGX T;  3KLF A;  1U4B A;  4O44 A;  2HHV A;  3V1Q A;  1TGO A;  4XIU A;  3K5O A;  4OGC A;  3WNE A;  1C0T A;  3AO1 A;  3AO5 A;  3KKR A;  4DFP A;  4M42 A;  2RF2 A;  3U6F A;  4ZTF A;  4MQ3 A;  4KTW A;  1U49 A;  5HRS A;  1NK7 A;  4GVM A;  3KLI A;  3VQB A;  4CF2 A;  3M8Q A;  3NF8 A;  4AH9 A;  4N56 A;  3KJV A;  4DTU A;  4DTP A;  1NK6 A;  2G8V A;  1BIU A;  4OPJ A;  3KLG A;  1U48 A;  3AVN A;  3V4I A;  1VSI A;  1IO2 A;  4FK4 A;  1RBT A;  3T1A A;  2G8W A;  1SV5 A;  1JL1 A;  1ASU A;  3AA2 A;  4JS4 A;  1S9G A;  2XY6 A;  3L3U A;  3SUN A;  5CY4 A;  1L3T A;  4EZ6 A;  4CJU A;  4E1M A;  1LWC A;  4RW9 A;  3OYG A;  2XO7 A;  4AHC A;  4E7I A;  3PX0 A;  2BDP A;  4W5O A;  1VSL A;  2VG5 A;  3T19 A;  1CXU A;  2FBX A;  1EX4 A;  4M3T A;  4FLX A;  5HRP A;  4R5P A;  3A2F A;  2O4I A;  2XY8 A;  1I3A A;  4CF9 A;  3V9U A;  1HYV A;  4FM0 A;  1HMV A;  3OYJ A;  3OJS A;  4Y1D A;  1IH7 A;  1UA1 A;  4KHW A;  3C94 A;  4CJ5 A;  1ZYQ A;  5FRM A;  4CJP A;  4CHY A;  3NGZ A;  1N6Q A;  2QK9 A;  1NOZ A;  2HHS A;  4LH5 A;  1X9W A;  4CJQ A;  3TAM A;  3QEX A;  1FKO A;  1ASV A;  3V1R A;  3DMJ A;  1NJX A;  1MU2 A;  3AVF A;  3SV3 A;  4QAG A;  1CLQ A;  4HCC A;  3DRS A;  3O4Q A;  1IKY A;  2X6S A;  3IAY A;  3LAK A;  2R7Y A;  3V9W A;  4KB1 A;  2HVH A;  3DLR A;  4PQU A;  3L3V A;  4DQR A;  1T03 A;  4AHR A;  3PO4 A;  3V9S A;  1JLF A;  2FBY A;  3O3G A;  3ZT2 A;  1UAX A;  3TAR A;  4PY5 A;  4I2Q A;  3V6D A;  3HO1 A;  2KFN A;  4FLW A;  3I0S A;  3D0P A;  5KGX A;  3AVJ A;  1RT3 A;  5KRS A;  2WOM A;  1BCM A;  1S1W A;  1RBR A;  1RT2 A;  3NGI A;  4B9T A;  4EZ9 A;  3HM9 A;  1HQE A;  2RKI A;  1XI1 A;  4DFK A;  4OGE A;  4E7H A;  1HPZ A;  1LW0 A;  1YTU A;  3JSM A;  4FJK A;  4M3W A;  1G15 A;  4TSX A;  1T7P A;  3L8B A;  2AJQ A;  3OS2 A;  1HNI A;  1REV A;  1JLE A;  1VRU A;  3OYN A;  1A5W A;  1ASW A;  4E1N A;  3TI0 A;  1Z26 A;  3OYI A;  4ZTJ A;  1X1P A;  4HUG A;  3PY8 A;  3HJF A;  1QSL A;  2G8H A;  2ETJ A;  3OVN A;  4CGF A;  3MEG A;  3U3G A;  3TAF A;  2F8T A;  4CK3 A;  3SQ0 A;  4G1Q A;  5FDL A;  3OYC A;  4KI6 A;  1LWE A;  2RN2 A;  5HRO A;  4KI4 A;  2IOC A;  1S5J A;  5FRO A;  3S3O A;  2QXF A;  1D9D A;  2HHT A;  1QE1 A;  4CIG A;  4KHY A;  4E3S A;  2YKN A;  4BWJ A;  4KHQ A;  5CZ1 A;  3VQA A;  3V9Z A;  3SUO A;  3AVA A;  3AVH A;  4DU3 A;  4RG8 A;  4DMN A;  4BE0 A;  3RRH A;  3F73 A;  4H4O A;  2KFZ A;  4BE2 A;  2A1R A;  4I2P A;  3EZ5 A;  3BGR A;  4DU4 A;  3V81 A;  2YKM A;  4DSE A;  1KSP A;  1BI4 A;  3LAN A;  4DQP A;  4FJI A;  4PUO A;  2QKB A;  2EX3 A;  1BL3 A;  1C1B A;  5JS1 A;  3OS0 A;  5FRN A;  4M45 A;  1C1C A;  3ASM A;  4JS5 A;  4DS5 A;  1NJZ A;  4N41 A;  1RDD A;  4CGH A;  4M3Z A;  1Z25 A;  2GBZ A;  5J1E A;  3LWM A;  1EET A;  1VSH A;  2KQ2 A;  2W42 A;  4FM1 A;  2IAJ A;  2OPS A;  1R0A A;  3D45 A;  4OKE A;  3U3Y A;  4IG0 A;  2HMI A;  4J2A A;  3UIQ A;  3CFP A;  1L3U A;  1YT3 A;  3ULD A;  4E89 A;  1U04 A;  4O5B A;  1JLQ A;  1UOC A;  4RW6 A;  2OPR A;  1QSY A;  4B9M A;  3QNN A;  4AHV A;  2Y1I A;  1ZBH A;  2HHQ A;  2JGU A;  3LAL A;  2OA8 A;  3SYZ A;  3IRX A;  1HQU A;  3ZSO A;  1RT7 A;  4O0J A;  1TL3 A;  1ITG A;  2Z1J A;  3NH2 A;  3LZJ A;  3ZSX A;  5K14 A;  1JLA A;  3PX6 A;  3DLB A;  1QHT A;  2VG7 A;  1NJY A;  1KVB A;  2IC3 A;  2X6N A;  1D9F A;  1BIS A;  3OYD A;  3KKS A;  2OPP A;  3VQE A;  4KB0 A;  4QCL A;  2VG6 A;  5KGW A;  1XHZ A;  5J2Q A;  4LH4 A;  3TAG A;  4KRE A;  1WSI A;  3VQ4 A;  1QS4 A;  1JL2 A;  1VK0 A;  2KW4 A;  4OKK A;  4CK2 A;  4CCH A;  3VQ9 A;  3ZCM A;  4FLV A;  4W5T A;  1WAF A;  3VQ7 A;  4W5R A;  3NE6 A;  3DI6 A;  3ITH A;  4F8R A;  4Y1C A;  1LAW A;  2ZQB A;  3KD5 E;  4Z4E A;  1TKZ A;  4CHZ A;  4IDK A;  1JLG A;  1BQN A;  4CEF A;  3G0Z A;  1RBU A;  4W5Q A;  4CJW A;  4CJR A;  4EP4 A;  3OYA A;  4FLT A;  3SQ4 A;  4LSN A;  4FK0 A;  2BAN A;  4GMJ B;  4CHN A;  2PZS A;  4B9V A;  1RDA A;  1WSE A;  3MED A;  3HK2 A;  1BI4 B;  4DLE A;  2G8U A;  2XY5 A;  3LP1 A;  4F2R A;  3BDP A;  3CM6 A;  4RW4 A;  3VQ8 A;  1WSJ A;  1IKV A;  1F21 A;  2Z1I A;  4PA1 A;  4FJX A;  3E01 A;  4FLY A;  2XRI A;  2Z1H A;  4FW2 A;  4NYF A;  3DLG A;  3RMC A;  3THV A;  4F4K A;  2BE2 A;  4HCB A;  4NCB A;  2BGG A;  4DQI A;  1TKD A;  1VSE A;  1GOC A;  2B4J A;  4DQQ A;  3NF7 A;  3QIO A;  1C0U A;  4CIF A;  1WSG A;  3RMB A;  1B9D A;  4CEB A;  2OZM A;  3ZT0 A;  4L8R B;  1TKT A;  3QEW A;  3S3N A;  5KI6 A;  3OY9 A;  3P1G A;  1DLO A;  4I9Q A;  2D0B A;  3HVT A;  1RIL A;  1SL2 A;  3K2P A;  1KFD A;  4KFB A;  3ZSZ A;  1HYZ A;  1RNH A;  4FK2 A;  1RTJ A;  1KFS A;  2HND A;  4B3O A;  1CXQ A;  1NK4 A;  4CJF A;  3HT3 A;  1ZBF A;  3SUQ A;  3OS1 A;  1IG9 A;  4I7F A;  1CZ9 A;  4DF8 A;  3DLK A;  4DQS A;  1QTM A;  3P5J A;  1KLM A;  3NF9 A;  3AO2 A;  5DK5 A;  3ZSQ A;  3QES A;  2E6M A;  2P1J A;  4BE1 A;  2PYJ A;  3IG1 A;  3ALY A;  1L3V A;  1TK5 A;  2D0A A;  4C8K A;  1ZBI A;  4DSI A;  5J2N A;  1J54 A;  3KK1 A;  3LP3 A;  1W0H A;  1A5X A;  1W9H A;  2KZM A;  4E0D A;  4FCY A;  4DLG A;  3AVC A;  3OYH A;  1TAQ A;  3DM2 A;  4DSJ A;  3L2Q A;  4J2B A;  3VQ6 A;  4KTQ A;  1RBS A;  2P5G A;  3NDK A;  3T3F A;  3CG7 A;  1ZBL A;  4DTS A;  1SKR A;  4FXD A;  5SWM A;  1JLB A;  3VQP A;  4CE9 A;  3CYM A;  3ISN C;  3RRG A;  3SNN A;  3I0R A;  3M8S A;  5T7B A;  1TK0 A;  1DTT A;  2DFH A;  4Z4G A;  2D0C A;  4GW6 A;  3HST B;  4EP5 A;  3TAQ A;  2HW3 A;  4IKF A;  4W5N A;  3SQ2 A;  1O1W A;  4O0I A;  3AVB A;  5HBM A;  3PX4 A;  2ATQ A;  3HPG A;  2I5J A;  4C8L A;  3TAP A;  3AO3 A;  3OYF A;  1FK9 A;  1WAJ A;  4CES A;  4CEO A;  4B9S A;  1JKH A;  4CJE A;  5HRN A;  3LWL A;  1TVR A;  3O3F A;  1JXB A;  2XY7 A;  1HJR A;  3S3M A;  4I9L A;  1BIZ A;  3AA5 X;  3CFR A;  4CEE A;  3MAQ A;  3HP6 A;  3JYT A;  1IKW A;  1KTQ A;  3VQ5 A;  1S6P A;  3C95 A;  3M8R A;  1TKX A;  3QET A;  3QEV A;  1RTD A;  1NKE A;  1GOA A;  1J53 A;  3L2V A;  1UWB A;  4MFB A;  4ELU A;  5C25 A;  2OZS A;  1HYS A;  3L2R A;  1S9E A;  2DFF A;  3P83 D;  1Q8I A;  3ZSY A;  3L2U A;  3EYZ A;  3LZI A;  4DTO A;  3NCI A;  3MXI A;  3RTV A;  3OYL A;  2NUB A;  1RDC A;  3NHG A;  4OLA A;  2Q3S A;  2DTU A;  2KTQ A;  5CYM A;  2YHB A;  1B9F A;  4DTR A;  5KTQ A;  2OPQ A;  4ID1 A;  4CHQ A;  4JRP A;  4M3R A;  4FJN A;  3ZT4 A;  1L3S A;  1K6Y A;  4KKO A;  1N5Y A;  4C8N A;  4Z4F A;  3DRR A;  3NFA A;  4CJK A;  2PYL A;  1KVC A;  3AO4 A;  1VSM A;  2FBT A;  1TAU A;  2YHA A;  4KTZ A;  3NBP A;  4OVL A;  5HP1 A;  4K8X A;  1UA0 A;  4FJ9 A;  1NJW A;  2YNF A;  1CZB A;  1JXE A;  4H8K A;  3LP2 A;  3ZSR A;  1SKS A;  4FJJ A;  5I3U A;  4CEZ A;  3TAB A;  4DTJ A;  5D3G A;  3K58 A;  4H4M A;  2IGI A;  1KCF A;  4N47 A;  4DSL A;  1NKB A;  4PWD A;  3VN5 A;  3QER A;  3KLH A;  4J2D A;  3S9H A;  1HNV A;  4Z0U A;  4DFJ A;  3SI6 A;  4J2E A;  5HRR A;  5J2P A;  3SQ1 A;  3OJU A;  4FJL A;  3O3H A;  3K59 A;  3PV8 A;  3K5L A;  1SKW A;  4CJS A;  4CED A;  4CGD A;  4DS4 A;  4FZZ A;  5KRT A;  4KHN A;  1LWF A;  3ZSW A;  1NK5 A;  1BHL A;  3VQD A;  4RW7 A;  1L5U A;  3NH1 A;  4FJH A;  3B6O A;  1VSJ A;  4CJ3 A;  4BDY A;  4CF8 A;  4NYN A;  5EU7 A;  4OJR A;  2YNG A;  1I39 A;  3CM5 A;  1RT6 A;  4DF4 A;  1J5O A;  4YNQ A;  4B9N A;  1VRT A;  4OLB A;  4M41 A;  3LDS A;  4KRF A;  1GOB A;  3LPT A;  4FYD A;  2PY5 A;  1WNS A;  1RT5 A;  2HNZ A;  1S1V A;  1X9S A;  3H08 A;  4CIE A;  4OPK A;  2B5J A;  3K5M A;  1KLN A;  4M3X A;  1WSF A;  5E41 A;  2P5O A;  2HHU A;  4DWI A;  3V1O A;  3QEI A;  4YFU A;  4CGI A;  1XWL A;  1D5A A;  1NK8 A;  5SZT A;  3VQC A;  4IFV A;  4DTN A;  3ZSV A;  3SZ2 A;  4E19 A;  1WLJ A;  2EHG A;  1XC9 A;  2F8S A;  1KVA A;  3NAE A;  4WE1 A;  3SUP A;  5CZ2 A;  5C24 A;  3ZT1 A;  4NCA A;  4DSF A;  3KD1 E;  4NCG A;  1TV6 A;  4DG1 A;  2ITG A;  3DRP A;  4CJT A;  1J9A A;  2FC0 A;  4DU1 A;  2HHW A;  4CEC A;  4CFB A;  4DTM A;  1RT1 A;  2GUI A;  3QLH A;  1XHX A;  1T05 A;  3NGY A;  4F3O A;  3PUF A;  1NOY A;  4CER A;  4Z4I A;  1RT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...