3AVJA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avjA00
1EXQA 5T7BA 3PX0A 4CF9A 3OYNA 1NK0A 4NCBA 4CFBA 4FCYA 4FJIA 2RF2A 1KVCA 1FKOA 2G8HA 2B5JA 2GBZA 3LANA 4H4MA 2QXFA 4H4OA 2B4JA 2PZSA 4AHSA 2Z1GA 4LD0A 3SNNA 1B9DA 3C6UA 4O0JA 5HBMA 3HP6A 1UOCA 2A1SA 4DLGA 4DFKA 1NOYA 4ICLA 3RR7A 1B92A 1VSLA 1VSHA 3ISNC 4CGFA 2Z1IA 4NYFA 4CIGA 4DMNA 1L5UA 1D8YA 3TAMA 2Z1HA 4CECA 3HVRA 3PV8A 4F8RA 4OLAA 3QEVA 1T05A 1WLJA 1WSEA 4B08A 3ZSVA 1Q9YA 4OPJA 1EP4A 3OJSA 3CFRA 3H08A 4Z4EA 3DM2A 4B8AB 4N76A 2IAJA 3U3GA 1DTTA 2VG6A 4J2DA 2XY7A 1YTUA 3VA3A 1BCMA 3P1GA 3WNGA 4F2RA 4DQRA 1XWLA 1D9DA 4N41A 3TAPA 1BIUA 3WNHA 2IGIA 3QINA 1S6PA 2VWJA 1QS4A 1XC9A 1L3UA 3MEDA 2HHQA 4CGHA 4E1NA 4I9QA 4ID5A 4ID1A 1Q9XA 1TK5A 4RW9A 3DOKA 1QTMA 4Z0UA 2AJQA 3AO2A 5HRSA 5CZ2A 4PQUA 4FXDA 1HRHA 4E1MA 1HJRA 5CYQA 3V9WA 3KLGA 1QE1A 4Z4GA 2XY5A 3KTQA 2G8WA 1QHTA 5I3UA 1ASWA 1RBSA 1L3VA 4DQIA 4CHNA 3IS9A 4G1QA 3G0ZA 1RT7A 1WAFA 3L3UA 3K57A 3ZSYA 2FBVA 4HVJA 3RRHA 5KRTA 3SQ4A 1BQNA 2DFFA 2P5GA 3SV4A 3LPTA 5HRPA 1RT6A 3K2PA 5CY4A 4I9LA 3O3GA 2QK9A 2RKIA 4FW2A 3ZT3A 2R7YA 4DSIA 4F4KA 4FJHA 1RDDA 2DTUA 1Z26A 4DSJA 2BDPA 1RT5A 2YNIA 4N56A 1VSEA 2D0BA 4F3TA 1LW2A 1VRTA 4OKKA 4M45A 3DRPA 4BACA 2HHSA 1HNVA 1J54A 1GOCA 2ATQA 3C6TA 3VQ6A 2DFHA 5J2PA 3SUOA 3RRGA 1VSJA 4O55A 3DMJA 4DS5A 4E7HA 4DTRA 5CYMA 3CM6A 4FM0A 4C8OA 4O0IA 4DS4A 4O5BA 2F8SA 3NH0A 1KTQA 4KI6A 2BE2A 3AVBA 3OYHA 1YTAA 4DU3A 1S9GA 3RWUA 4M3UA 2HHUA 3D0PA 1TAUA 4CEQA 3DRSA 2O4GA 3KK2A 2G8VA 3TAQA 4C8LA 4KREA 3TAEA 1VSIA 4FJJA 3OYLA 4KHWA 1RBTA 1YVUA 4RW6A 4W5RA 2OZSA 2VG7A 1ZBHA 3CFPA 3AVAA 1U48A 3B6PA 4IBNA 1T7PA 4CESA 4E19A 1NJWA 1QSLA 4JS4A 1RTIA 1RBUA 2YHBA 3CQ8A 4CJKA 3S3NA 3NGYA 4DFPA 1BISA 1HNIA 3P5JA 2DY4A 4CHPA 4HHTA 3DLEA 3ITHA 3V1RA 2ETJA 3OYFA 3I8DA 2B6AA 4KV8A 1S1XA 3MXIA 3NF7A 4OVLA 3L3VA 3SUPA 1JLQA 1XHXA 2WONA 1U4BA 1I3AA 1D5AA 4EZ6A 2KZZA 2Y1JA 2HNDA 5I42A 4IFYA 4KFBA 1GOBA 3TAGA 1JXEA 4FLXA 4FM2A 4FYDA 1JL1A 3ZSOA 3U6FA 2Q3SA 3KJVA 4TSXA 1FXXA 3T19A 5J2QA 4C8MA 1NK5A 1BI4A 1EKEA 1CXQA 2YKMA 4AILC 5HROA 1ASUA 4DTXA 4OPKA 1UWBA 5SZTA 5KRSA 4DLEA 4DTJA 1Z25A 3HXMA 1ZBLA 4BDPA 3PO5A 4B8CA 3VQAA 2HHXA 4KI4A 1NK4A 1S1UA 3C94A 4DTPA 3IG1A 1HYVA 2DFEA 3T1AA 5FROA 1R0AA 2ZQBA 4M3RA 3V1QA 2OPRA 4JS5A 4CHYA 2PYJA 3DLGA 3V6DA 1IO2A 3QESA 1S5JA 1TL1A 2FC0A 2FBXA 4FW1A 3RTVA 2HMIA 3MECA 3VQEA 3RMDA 2HNYA 2OA8A 1REVA 1CLQA 2NUBA 3AO5A 4CIEA 4CJVA 1L3SA 3G10A 5CZ1A 1TVRA 2D0CA 3PX4A 3IRXA 4DF8A 1KLMA 1NJXA 3HPHA 1SL0A 1IG9A 1JLFA 1T8EA 3M8RA 3LDSA 4F2SA 4FLVA 3VQBA 2YNGA 2HNZA 1RT3A 1QSSA 3V9XA 3BDPA 1YT3A 1ZBUA 4DTOA 5HP1A 4C8NA 3HM9A 3ZT2A 5J2MA 1X9MA 1KCFA 1TKXA 2OZMA 3OYAA 4F3OA 4DWIA 1RDBA 1KFDA 4M3TA 4EP5A 4CEEA 1Y97A 4O44A 1RT2A 2E6MA 1U47A 4FJ8A 4O4GA 3F73A 3SYZA 4KHYA 2HW3A 4I2QA 3AO3A 3V81A 3OYIA 1JLEA 4CGIA 3K58A 2KW4A 1JLGA 5DK5A 4CF2A 4N5SA 4FLYA 3SJJA 2WOMA 3OYGA 5J1EA 1CXUA 4CJSA 4KB0A 3ZSRA 2OYQA 1NKCA 1SV5A 3IAYA 4DQSA 3VQCA 1RBVA 1XHZA 1J5OA 1TKTA 3ZSZA 3AVNA 3S3OA 3CM5A 4JRQA 3AO1A 3KK1A 3QEIA 4CHZA 4MFBA 5HRNA 3K5OA 3EZ5A 1C0TA 5SWMA 4YNQA 3EYZA 4FLWA 4PY5A 1U45A 1BL3A 3HJFA 2KFNA 4CJPA 4FM1A 1RCHA 3CG7A 3K5NA 1BIZA 1IKWA 3LP1A 3LP3A 5C25A 2IC3A 4QAGA 4M41A 3B6OA 4CEAA 3NGIA 3SUQA 1BHLA 2EX3A 2JGUA 3OYEA 4PUOA 2VWKA 3L2VA 4AH9A 3A2FA 2XRIA 5C24A 2E6LA 4CIFA 1UA1A 3KD5E 1FKPA 1C0UA 4FZYA 4YFUA 1UA0A 1ZBFA 2QKKA 3QLHA 4CJQA 3SUNA 4W5NA 1RT1A 1HYSA 4R5PA 3AVGA 1KLNA 4CJTA 3S3MA 4Z4IA 3AVLA 4NCGA 3WNFA 3RR8A 3KK3A 2I5JA 4CJLA 5C42A 1HQUA 4HUEA 2GUIA 4KO0A 2OPQA 3M8SA 1IKVA 1BCOA 3ZSXA 3LP0A 3K5LA 3NDKA 1LWEA 2HHVA 4FJLA 4KPYA 4W5TA 1TKDA 4Y1DA 2P51A 3KLEA 3AVKA 3P83D 1SKRA 1C1AA 1IH7A 2A1RA 3L2RA 4KTQA 4FJ9A 3VQPA 4I2PA 4EZ9A 3BGRA 3SPYA 1TAQA 4RW4A 3FFIA 2KFZA 3AVJA 3K59A 3NBPA 4IFVA 5HRRA 1VK0A 1C1CA 3DLHA 3PX6A 3OJUA 3I0SA 3LP2A 1IKYA 4LY7A 2Y1IA 3OYCA 3SQ1A 2FBYA 3AO4A 1B9FA 4DTMA 3MAQA 1S9EA 3QEXA 4PWDA 3TI0A 1BI4B 1UAXA 3MXMA 3HP9A 4DTSA 1SL2A 3U3YA 1VSKA 2IOCA 3OY9A 1KRPA 4Z4CA 2F8TA 4E0DA 1BQMA 1LWCA 3AVHA 4CJ3A 3NF6A 4LSLA 1LAVA 1DTQA 1W9HA 4PA1A 1NKEA 3OS2A 4FJMA 3L2QA 2W42A 4UQGA 3TARA 2RPIA 1NKBA 5KTQA 4B9LA 4ZHRA 3QERA 3TABA 4B9VA 1XI1A 3O3HA 2BANA 4GVMA 2XY6A 1HPZA 4CHOA 4KRFA 3NH2A 2PYLA 3KIOA 3KLIA 4Z4HA 4FLZA 4FJ5A 1X1PA 2PY5A 4HCBA 3ZT0A 4B9TA 4CFCA 3I0RA 1RDAA 1LV5A 4EP4A 1A5XA 2Z1JA 4RW8A 3F9KA 3TWHA 4FZXC 1C1BA 1I39A 2EHGA 3O3FA 4BE0A 4DSFA 2G8UA 4B9UA 1X9SA 3UIQA 1VSFA 3HYFA 4FJNA 1VRUA 1F21A 3CFOA 4CFAA 4CEZA 4HTUA 4CJWA 2ZD1A 1VSDA 3RMBA 3LAMA 5FRMA 2G8IA 2LSNA 3KLFA 2XHBA 3HL8A 5KGXA 1IKXA 4RW7A 2HVHA 4CK3A 4DSEA 1CZBA 1TV6A 2X6SA 3LALA 3PO4A 4FK4A 3CYMA 3SQ2A 3ZSWA 3LWLA 2D0AA 1TGOA 2FBTA 2IS3A 3SZ2A 1NJYA 4LH5A 1ITGA 3ASMA 3AA3A 3QO9A 4IG0A 4XIUA 4BE1A 2JLEA 3VQ8A 3QIOA 3OYKA 4KHSA 4FJXA 5JS2A 1JXBA 3O4QA 4JLHA 3VQQA 1QSYA 3SQ0A 3AVMA 1HYZA 1WN7A 4DU1A 3V9UA 3QEWA 1RTDA 1HQEA 1NK6A 4W5OA 3OVNA 4LH4A 2P5OA 1LWFA 4E89A 4FZZA 4AHCA 4CERA 3HT3A 1BGXT 4BWJA 1K6YA 4KHQA 1X9WA 1ASVA 3QEPA 4M3ZA 3TANA 1JLCA 2P1JA 3OYBA 3ZSQA 4CEBA 4M3YA 4CHQA 3V9ZA 4KHNA 2RN2A 4IG3A 4QOZB 4AHUA 4B9SA 4FJ7A 4KTZA 4FK0A 3HPGA 1NJZA 2E4LA 1RT4A 2X6NA 4WE1A 3DOLA 3SI6A 3NF9A 4ZTJA 4BDZA 4DSKA 3OS1A 3WNEA 4W5QA 3S9HA 1EX4A 2D5RA 3V4IA 1TK8A 4M3XA 4Z4FA 2HHWA 3E01A 1NOZA 1DLOA 3DRRA 1W0HA 4JRPA 1N6QA 3ZT1A 3KKSA 4DG1A 3TR8A 2X78A 3NFAA 4CE9A 4CJEA 1U04A 3ALYA 3VQ4A 1L3TA 4FJKA 4HCCA 4CEDA 1FK9A 4C8KA 3MEGA 1Q8IA 1S1TA 4DU4A 4DQPA 3DYAA 1TKZA 4IDKA 4E7IA 3AVCA 4E7JA 3AVIA 1GOAA 3DLKA 3HO1A 1S1WA 2YV0X 3LPUA 1J9AA 3VQ5A 1WAJA 4CJFA 1WNSA 4N47A 3LZJA 4AHTA 3PUFA 4DFMA 3QNNA 4HUGA 3KKRA 4AHVA 1HMVA 1A5WA 4OGCA 2OPPA 3JSMA 3M8PA 2KTQA 1SL1A 2HB5A 3KD1E 1KVBA 2F96A 3VQDA 3QNOA 3O4NA 2HHTA 4FLUA 2XY8A 2ZE2A 3ULDA 3LZIA 4CGDA 4FK2A 3VN5A 3EY1A 1D9FA 3HVTA 1SKWA 4K8ZA 1LAWA 4GW6A 4QCLA 3C95A 3HSTB 3SV3A 1NK9A 4J2BA 4M3WA 4CJRA 3KLHA 3AV9A 3NHGA 1KFSA 4M42A 5K14A 2YKNA 2YNHA 4ELVA 2BGGA 3AA2A 1TK0A 3THVA 3ZCMA 4CFDA 1NK7A 4DFJA 1JLBA 4KKOA 4CJ5A 4CJUA 4BE2A 1SKSA 5FDLA 2G8KA 3LWMA 4AHRA 4ELTA 2KZMA 4KAZA 3D45A 4OKJA 3TAFA 1T03A 4KHUA 1NK8A 1N5YA 3LAKA 4K8XA 4J2AA 1J53A 4BWMA 1MU2A 1QQCA 1WSIA 3QETA 4CF0A 4LSNA 2GV9A 3HK2A 3MXJA 5JS1A 4MQ3A 3OYJA 3T3FA 3RMCA 3AVFA 4OKEA 4CK1A 1VSMA 5EU7A 1JKHA 4OLBA 3NH1A 1WSHA 3QIPA 4NYNA 4CEOA 4CJ4A 4DQQA 2YNFA 1WSFA 5E41A 1G15A 3NAEA 4CGGA 1A5VA 4OGEA 3NCIA 3PY8A 1TL3A 3AA4A 4ZTFA 1S6QA 5J2NA 3DLBA 4B9NA 4B3OA 3L8BA 1S1VA 4CCHA 1EETA 4HUFA 2KQ2A 2G8FA 4DF4A 3SPZA 1RTHA 3RMAA 3V1OA 1WSJA 3OS0A 3L2WA 2YHAA 3L2UA 1U49A 3OYMA 3VA0A 4CGJA 3M8QA 2XO7A 2QKBA 4DTNA 1RDCA 1CZ9A 4OJRA 4CF8A 3OYDA 2O4IA 4Q0BA 3JYTA 1C0MA 2IDOA 4Q5VA 4FVMA 4E7KA 1JL2A 4FLTA 4DSLA 5D3GA 1ZYQA 2HVIA 4GMJB 3NGZA 2VG5A 1RTJA 1LW0A 3SCXA 4H8KA 1O1WA 3MEEA 4Y1CA 3DLRA 3VQ9A 4FJGA 4J2EA 4CK2A 1KVAA 3V9SA 3VQ7A 3ZT4A 1SUQA 2X74A 3DI6A 5DMRA 5HLFA 1RILA 2OPSA 4BDYA 4L8RB 1JLAA 4E7LA 1KSPA 4CEFA 1C6VA 3NF8A 3HPOA 4E3SA 3K5MA 4IKFA 4KB1A 5FRNA 3NE6A 4NCAA 1RNHA 5KGWA 1WSGA 4KTWA 4CF1A 4DTUA 4ELUA 3AA5X 4I7FA 1ZBIA 4RG8A 5KI6A 4B9MA 1RBRA 2ITGA
chains in the Genus database with same CATH superfamily
3IDHA 4CF9A 4BRLA 1NK0A 4CFBA 4H4OA 4H4MA 5AZJA 2PZSA 2B4JA 4AQYK 1UOCA 4DLGA 4DFKA 4ICLA 1B92A 1L5UA 3TAMA 4CECA 3HVRA 3QEVA 1N34K 1X3NA 1WLJA 2P9LB 4DB3A 5GADP 3OJSA 3BZCA 3H3NO 2IAJA 4QS7A 1DTTA 3P1GA 3WNGA 4N41A 3J8AA 3G6EN 4BY9C 1IV0A 2VWJA 1QS4A 1XC9A 3J7ZO 1RFQA 1V4SA 3CJAA 4ID5A 4ID1A 5AZIA 3CIPA 4M7XA 2HOEA 4Z0UA 5CZ2A 3GBTA 3KLGA 4LF7K 5AQPA 1S72N 5AQFA 3KTQA 2G8WA 3H3OB 1L3VA 4CHNA 3IS9A 3HZ6A 1RT7A 4XH1A 3L3UA 5LMUK 2VGMA 5KRTA 2BUPA 4I9LA 5EVZA 4F4KA 3NVMA 2DTUA 1BUPA 3PLAA 5F2RA 1RT5A 2BDPA 1VSEA 3TSUA 3CCLN 5E84A 4M45A 4FL9A 3BZKA 1HNVA 1J54A 2ATQA 3SUOA 2DFHA 3K9KA 5FPDA 4LC9B 4C8OA 5CYMA 3NH0A 1KTQA 4KI6A 3TU5A 3AVBA 1S9GA 3RWUA 3O9RA 2HHUA 3D0PA 4XEIA 4H5NA 3WXLA 1VSIA 3OYLA 2VG7A 4UY8O 1U48A 3B6PA 1RTIA 1RBUA 2YHBA 4MO4A 5AQMA 4WYBA 3I8DA 3GE1A 4KV8A 4BC2A 5GAEP 1W97L 2D0OA 1JLQA 2WONA 4NLCA 1I3AA 1EQYA 2HNDA 3MK6A 1GOBA 1JXEA 4FM2A 4FYDA 1C0FA 2Q3SA 3U9DA 1XQSC 1NK5A 3BEXA 4AILC 2UXBK 1ASUA 4Y0WA 1UWBA 4OPKA 4BC3A 5KRSA 1IJJA 5AQQA 3PO5A 3VQAA 2HHXA 4KI4A 1NK4A 2Q0RA 4BC5A 2DFEA 5AQUA 3T1AA 1N32K 3V1QA 2OPRA 2PYJA 3V6DA 4BGBA 2QTDA 2FC0A 4FW1A 2HMIA 5FPMA 3PSIA 1GLEG 4BR7A 1REVA 4CIEA 3A5LC 5EY4A 3G10A 5CZ1A 2E2QA 2GWKA 3L4QA 3O9SA 1NJXA 1KLMA 1QQNA 3HPHA 1SL0A 4YOTA 1T8EA 3LDSA 1NGGA 3B8AX 3VQBA 1RT3A 1J6ZA 3V9XA 1ZBUA 3KHYA 1Z05A 4DTOA 5HP1A 4C8NA 2OZMA 5J2MA 1MDUB 2O8DB 1TKXA 3WT0A 1JCGA 4DWIA 1FJGK 4A61A 1WB9A 1Y97A 4O44A 4KHYA 1U47A 4FJ8A 1SQKA 2NLXA 2HW3A 4I2QA 3AO3A 2O8BB 3OYIA 4CGIA 1JLGA 3NVKA 2WOMA 2W6LA 5J1EA 4KB0A 4JI2K 1NKCA 1SV5A 1RBVA 4H03B 3F2KA 2O8EB 3S3OA 3CM5A 3AO1A 4M7YA 3QEIA 1W7AA 3HOSA 5CR4A 4YNQA 5SWMA 4PY5A 3FZKA 4CZIA 3CG7A 3LP3A 5AQSA 5C25A 1BDGA 3SUQA 4DHYA 4IJAA 3WXKA 5C12A 3OYEA 3A2FA 2BTFA 2XRIA 1N33K 4YFUA 1ZBFA 3SUNA 3AVGA 4CJTA 3S3MA 3UKRA 3H1QA 3RR8A 2W40A 4KH6A 4B3MK 4HUEA 4KO0A 3MX5A 1TKDA 1NJIO 2EWSA 4A5BA 3AVKA 3P83D 5B8HA 2A1RA 3EKSA 1T6DA 3OA9A 3VTHA 3DAWA 3FFIA 3THYB 5HRRA 1VK0A 5BR8K 3PX6A 3I0SA 1IKYA 3OYCA 5AQVA 1B9FA 1IBKK 4IZ9A 4YDUC 1VQMN 4PWDA 3D2EA 1KRPA 1BQMA 3AVHA 1QTMA 1LAVA 1T3VA 1GLDG 3OS2A 4UQGA 2QWPA 2RPIA 2PFUA 3CJ1A 4ZHRA 2E2NA 4WFAL 3QERA 3FFKB 3ZEUB 2OCEA 1HPZA 4CHOA 5F0XA 4KRFA 3AARA 2PY5A 3I0RA 1RDAA 2DPNA 1A5XA 4RW8A 4FZXC 4Z94A 4B9UA 1VSFA 1VRUA 1F21A 3J80O 2LSNA 3HL8A 5ADXH 5KGXA 1IKXA 1YITN 2HVHA 3MWTA 3TTFA 2P9SB 3LALA 3VESA 4AM6A 1GLJO 1ATSA 4H5RA 1NJYA 3ZYYX 3FZFA 2GX9A 3QIOA 3OYKA 4JLHA 3CJCA 3ZETA 3OTOK 1ZXOA 3ZX2A 1HYZA 1WN7A 4DU1A 1J5EK 3MWPA 3R3LA 4GV9A 4JI7K 2P5OA 1LWFA 4YOUA 4E89A 1R59O 1VQ9N 3SAFA 2A6AA 2IVNA 4CHQA 2RN2A 4AHUA 2OTLN 4FJ7A 4KTZA 5LY3A 4BR9A 3DOLA 1K8AO 3EE8A 4DSKA 3WNEA 1EX4A 4Z4FA 3KKSA 3FE1A 1U6ZA 4B1VA 2P9LA 1ILYA 3N4PA 4LF6K 4HCCA 3LDOA 5AQTA 1FK9A 1S1TA 4DQPA 4X66K 5AQXA 4E7IA 1TKZA 4IDKA 3AVCA 1GOAA 3WQTA 3O08A 3CC7N 3PUFA 1A5WA 4IOAL 2OPPA 2E1ZA 2KTQA 1TYQB 3KD1E 4FOIA 1LOTB 4CZFA 5C10A 2HHTA 2XY8A 4DR1K 2YHYA 3FR0A 3HVTA 4K8ZA 2HBMA 4CBXA 3NHGA 4GV6A 1M90O 5KQDA 1YJ9N 1TK0A 3W3DA 3ZCMA 4CFDA 4CJUA 3LWMA 4AHRA 1VQLN 4ELTA 1N5YA 4K8XA 3QETA 4CF0A 4LSNA 5AQWA 5JS1A 3OYJA 3T3FA 3AVFA 4JI8K 4OKEA 4CK1A 4DR2K 4OLBA 5GIOA 2YNFA 3HBTA 3QICA 4H0VB 1NGJA 5GINA 4MLHA 1K73O 1S6QA 3BP8A 4B9NA 3L8BA 1S1VA 4JKHA 2KQ2A 3MN9A 1VQ7N 3MCAB 5BRDA 2A3ZA 2FSNA 4CGJA 4DTNA 4CF8A 3AGRA 4H0PA 1DT9A 3ENOA 3JYTA 3CERA 1C0MA 1RDUA 4E7KA 4FVMA 4MDBA 4YOXA 3SCXA 3IFRA 2P9PB 3ZT4A 3DI6A 4ILHA 4BDYA 1JLAA 3ENHA 3NF8A 2UUCK 4IKFA 2W6KA 5KGWA 1WSGA 4CF1A 4DUZK 4DTUA 1YJWN 1KQSM 3WXIA 4AF1A 4JKFA 3ZX0A 5T7BA 2GELA 3BY5A 4FJIA 2RF2A 1VQ8N 1IG8A 1BWFO 1Q18A 3OBWA 2B5JA 2GBZA 3ATUA 4AHSA 4LD0A 3SNNA 5HBMA 3C6UA 4O0JA 1NOYA 3MN7A 4KHSA 1VSHA 1VSLA 3ISNC 4DMNA 4NYFA 4OLAA 1T05A 1WSEA 4B08A 3ZSVA 4YORA 3CFRA 3DM2A 4CBWA 1YTUA 3QB0A 2FF3B 4F2RA 5MLCQ 1XWLA 3TAPA 4KBOA 4JI4K 2O8DA 3QINA 3MEDA 2HHQA 3F5TA 4CGHA 4I9QA 4J8FA 1N8RO 3DOKA 2O8BA 1HJRA 2QWOA 1KAZA 4Z4GA 2XY5A 4FWOA 4G1QA 3G0ZA 5IWAK 2O8EA 4DV0K 3ZSYA 1SAZA 1BA0A 2DFFA 3CC4N 3LPTA 4JI0K 3GL1A 1RT6A 5CY4A 1W2BM 4DSIA 3ZT3A 2R7YA 1Z26A 1OH8A 4N56A 2D0BA 3PIPL 1VRTA 1QQOA 2Q36A 2HHSA 3R8EA 4JNEA 1GOCA 4DV4K 2YI1A 4O0IA 4CZEA 2BE2A 2CGKA 1YTAA 1WBBA 1TAUA 5TKYA 3TAQA 4KREA 1YVUA 4K42A 1ZC6A 3CFPA 1NU0A 4BC4A 4K41A 4E19A 3THXB 1QSLA 4JS4A 3NGYA 3P5JA 4K25A 4HHTA 3CHWA 3UKUB 1S1XA 4OVLA 3C0BA 3NF7A 1EWQA 1U4BA 4BGAA 3ZX3A 1BG3A 1D5AA 4CZLA 3THYA 4IFYA 4KFBA 2RHKA 4X62K 4FLXA 4JKEA 4IEIA 5J2QA 1HKBA 1CXQA 2YKMA 2E88A 1HUXA 4DR5K 4CI6A 2FSKA 3K9JA 4B8CA 5FROA 1R0AA 4M3RA 3ZEUA 4WQ5C 3QESA 1S5JA 3G25A 3RTVA 4BR0A 2NUBA 3AO5A 5M1OA 3U4LA 4FVUA 5TKWA 1TVRA 3Q7BA 3WXMB 3PX4A 3IRXA 4DF8A 3M8RA 2QEXN 4FLVA 2E5LK 2YNGA 3CI5A 1QSSA 3BDPA 4YOVA 3A5MC 4OX9K 2BH1A 3P31A 3ZT2A 3EEQA 2P9KB 4LF8K 1RDBA 3G4SN 4GKJK 3RVCA 2P9SA 1RT2A 2E6MA 1GLAG 3F73A 3SYZA 3OBYA 3JXUA 3V81A 3SJJA 2CGJA 5KPTA 3A5NC 3IAYA 3LM9A 4WF9L 5FLXO 2NZTA 1TKTA 1FW6A 2VCPA 3KK1A 5HRNA 4FWSA 3U9ZA 4FLWA 3H1VX 4CJPA 1YI2N 3VPZA 3K5NA 1IKWA 3LP1A 3AAQA 4CW7B 5BR9A 3B6OA 3J81O 1BHLA 2EX3A 2QM1A 4JK8A 3GDQA 2WTUA 1C0UA 3O5BA 1UA0A 2QKKA 3QLHA 4CJQA 2F4VK 1Q86O 1HYSA 4JI6K 3OHRA 2GTDA 4CJLA 5LJWA 2ZM6K 5C42A 4WQ4A 1HQUA 3E1YA 2GUIA 2OPQA 3M8SA 3DJCA 3ZSXA 4XH4A 4KPYA 3AGKA 4Y1DA 2P51A 3M1FA 3IMXA 3DXMB 1C1AA 3J7YP 1JJ2M 4FJ9A 2CGLA 1TAQA 1TYQA 4RW4A 2KFZA 3K59A 3DLHA 4LY7A 3LP2A 2FBYA 3AO4A 1KAXA 3QFPA 4QS8A 4DTMA 4FWNA 1DGKN 3QEXA 1MA9B 2J4RA 4X64K 1BI4B 3MXMA 3HP9A 3R9PA 3U3YA 4Z4CA 4GY2B 3NF6A 4PA1A 4A2AA 1DTQA 4G9ZA 4ILGB 3TARA 3TABA 2FSJA 4B9VA 1GLCG 3TPQA 1XI1A 3CCJN 2BANA 4WCEL 4GVMA 4H0XB 1P90A 3KIOA 4HCBA 1X1PA 4IDHA 1QHAA 3ZT0A 1YAGA 3L0QA 2HBJA 4X65K 1LV5A 4EP4A 2A40A 3F9KA 3MX2A 3SLCA 1C1BA 4DSFA 4BE0A 4CEZA 3WUHA 1VSDA 5FRMA 3LAMA 2G8IA 4CJ7A 1NGBA 1KAYA 4H0YB 4LF5K 2X6SA 1NMNA 5BPLA 4IOCL 2Q31A 2D4WA 3CJ9A 2FBTA 3SZ2A 3QO9A 3AA3A 3C7NB 5E26A 5HL7L 3VEYA 3O9QA 1NG9A 5JS2A 1JXBA 4FWLA 1XC3A 3VQQA 1QSYA 2P9PA 2QI2A 3QEWA 3V9UA 5GAHP 3OVNA 4JI5K 3T1YK 4LH4A 2NRVA 4BRGA 3CJBA 4CERA 1GLBG 3QEPA 4K0KK 3TANA 2P1JA 5M1KA 4M3YA 1NMDA 4FWQA 4KHNA 4B1ZA 3VGLA 4B9SA 4FK0A 2WBNA 3VF2A 1NJZA 3A0IX 3TTCA 3OS1A 2E1YA 3S9HA 1TK8A 3H45C 1HKCA 2PAVA 3DRRA 1W0HA 1N6QA 3ZT1A 4ISGA 3SBGA 4DG1A 4OPAA 2X78A 4JYAK 2UUAK 3EL2A 3ALYA 1L3TA 4FJKA 2GUPA 4I6MB 4CEDA 1Q8IA 4O8UA 3DYAA 1BOTO 3AVIA 3DLKA 3FZLA 2YV0X 3CCVN 1WAJA 1WNSA 1OH7A 3A8YA 3L4IA 4CBUA 1KVBA 3VQDA 3QNOA 3LZIA 4FK2A 3EY1A 1SKWA 4GW6A 4QCLA 1NK9A 4M3WA 4CJRA 3KLHA 3AV9A 1KFSA 5K14A 1BO5O 1S3XA 3AA2A 3THVA 1NK7A 3VEZA 4BE2A 1KC8O 2KZMA 2KKZA 1J53A 4BWMA 1VQON 3QBWA 3HK2A 2GV9A 2P9UB 5CE3A 4MQ3A 3RMCA 1V4TA 1WSHA 4NYNA 4CVNE 5E41A 1G15A 4MLEA 1A5VA 2A42A 1GLFO 1TL3A 3AA4A 4ZTFA 5J2NA 1VQKN 4CCHA 2JWLA 4HUFA 2G8FA 4DF4A 1ATRA 3THXA 4H0TB 3RMAA 3OS0A 4GV3A 2HBKA 2YHAA 4FWPA 3OYMA 2WC9A 2XO7A 2D0PA 2QWRA 1RDCA 3UKUA 2AA4A 2NRXA 5D3GA 1GLLO 4DSLA 3O1WA 1ZYQA 1Q82O 3NGZA 1RTJA 1LW0A 3C6HA 4H8KA 1O1WA 3MEEA 4FJGA 4J2EA 1QZ6A 5EXWA 5HLFA 1HJOA 1RILA 2OPSA 2V52B 1C6VA 3HPOA 4E3SA 4KB1A 4LFBK 3NE6A 2ASMA 4JKDA 4E1JA 2QXLA 4ELUA 3VETA 1ZBIA 4B9MA 2ITGA 4BVOA 3OYNA 4FCYA 3CCSN 3LANA 2QXFA 2Z1GA 3O9UA 4Z4EA 3QBXA 3HP6A 3RR7A 2Z1IA 4CIGA 1RDWX 1D8YA 2NNWA 3PV8A 1Q9YA 2QA4N 4C1NK 4OPJA 4DV6K 5HOOA 2VG6A 2ZF5O 3O6WA 3EKUA 3VA3A 1BCMA 1BIUA 2IGIA 2P9KA 1K8KA 1QVGM 1L3UA 2YHWA 4RW9A 1YF5L 4OPHA 3AO2A 1TUYA 4E1MA 4CZGA 5CYQA 4JI1K 3V9WA 2KLAA 1QE1A 4CZMA 4PKGA 1QHTA 5I3UA 1ASWA 3U8XA 1WAFA 3K57A 4HVJA 3RRHA 2P5GA 3SQ4A 3SV4A 4IO9L 3VEVA 3K2PA 1XNQK 2E2PA 2QK9A 4DSJA 2YNIA 4OKKA 3DRPA 4BACA 5AR0A 3VQ6A 5A2QO 4BRPA 5J2PA 2E20A 4JV5K 2OTJN 3RRGA 1VSJA 4O55A 4DS5A 4E7HA 4O5BA 2F8SA 3LDNA 5C15A 2ZJPL 2Q0UA 2H3GX 5EOYA 2YX6A 3OYHA 4DU3A 1DEJA 3DRSA 4C8LA 5AQLA 3KK2A 1HPMA 1RBTA 2OZSA 4RW6A 4FPAA 1ZBHA 1VQ6N 3AVAA 4XH5A 4IBNA 1X9JA 4CESA 3VGKA 1NJWA 3PIOL 3S3NA 4FO0A 1BISA 2DY4A 3DXMA 3EN9A 3DLEA 3V1RA 2ETJA 2B6AA 4IFEA 3MXIA 3L3VA 1XHXA 4EZ6A 3H46O 5I42A 3TAGA 3TTDA 1JL1A 4BREA 3ZSOA 3U6FA 1Y64A 5AQYA 4HTLA 1FXXA 3SMPA 4IWVA 2V7ZA 1NGFA 1BI4A 4B3TK 5AQRA 1Z25A 3HXMA 1ZBLA 1S1UA 5AQKA 4CD3A 2NRZA 3ID6A 3IG1A 1HYVA 3L6QA 2ZQBA 2O8FB 4JS5A 4FOEA 5EX5A 3DLGA 1YHQN 3E9LA 1TL1A 3MECA 3VQEA 1CLQA 1L3SA 5BRHA 2YCHA 2D0CA 1NLVA 4QS9A 5BN9A 1IG9A 4F2SA 4JKGB 3VF4A 2OANA 2IVPA 4DV7K 5C2FA 1YT3A 4BG9A 2P9IB 2UUBK 1X9MA 3OYAA 4GVEA 1LCUA 4M3TA 3P38A 4CEEA 4O4GA 3VEXA 2PBDA 3UB5A 3K58A 3C7NA 4FLYA 3HSCA 1CXUA 5BPMA 2NRHA 3F9MA 3VQCA 4O8KA 1XHZA 4RTFD 1J5OA 3ZSZA 5FPNA 3D2FB 2O8CB 4MFBA 3EZ5A 1QVFM 1C0TA 5M1PA 3HJFA 1Q7YO 4NXMK 3EO3A 2KFNA 1RCHA 1BIZA 2QWMA 5M1QA 2IC3A 4QAGA 1VQNN 1ATNA 4PKIA 4B3SK 4B3RK 4PUOA 1KXPA 3L2VA 3MN6A 5C24A 3KD5E 2A5XA 1FKPA 4IXCA 3SBTA 3KK7A 4WFBL 1RT1A 1KLNA 1IBLK 2HHHK 3AVLA 1HLUA 3MN5A 2I5JA 3I8BA 4I6MA 1IKVA 1BCOA 3S41A 3K5LA 2HHVA 4FJLA 4W5TA 3ZLJA 5H1SQ 3I33A 5AQNA 5C0YA 3L2RA 4KTQA 4A57A 4MDAA 1JCEA 3VQPA 4EZ9A 3BGRA 2GWJA 3SPYA 4IFVA 1C1CA 3OJUA 1E4GT 5AQHA 2Y1IA 3SQ1A 3ATVA 3O8MA 3BUZB 3MAQA 3CC2N 3CCMN 1Z6RA 3I56N 1UAXA 5GAGP 1OKJA 1VSKA 1YVNA 3OY9A 4E0DA 3KZBA 4LSLA 4FJMA 1NKBA 4B9LA 3O3HA 4KH5A 2P9UA 4BR4A 4NB4A 3UE5A 4CZKA 2PYLA 1JCFA 4U7BA 2NRRA 3N4QA 4FJ5A 3R6MA 4JK7A 4WFNL 5AQGA 4CFCA 2Z1JA 3Q7CA 5ADXA 1I39A 2EHGA 4JHDB 3NMUA 1X9SA 3TSQA 3UIQA 3HYFA 4CJWA 2ZD1A 3RMBA 4PL7A 4RW7A 1QQMA 3H6EA 1CZBA 1TV6A 4FK4A 3PO4A 2P9NB 3CYMA 3SMSA 3LWLA 2D0AA 1ITGA 1G99A 4BE1A 4AM7A 4C23A 1K8KB 3O4QA 4GKKK 3AVMA 1MWMA 1VQPN 3CCEN 4B1XB 3EE9A 4HWIA 4FZZA 4KHQA 1K6YA 1BU6O 4DQ8A 3ZSQA 4CEBA 3V9ZA 3CD6N 4IG3A 4QOZB 2F9TA 2ASPA 3HPGA 2D1KA 3IKMA 3DLLL 3O4WA 2E4LA 2X6NA 3SI6A 4B1YB 3NF9A 4BDZA 2D5RA 3VGMA 2HHWA 3CPEA 3AAPA 4FWKA 3M3ZA 1DLOA 2YHXA 4JRPA 2AP1A 5CHIA 3NFAA 4CJEA 3WXJA 1NBWA 1U04A 3VQ4A 5JVHL 3R1XA 1P8ZA 2E2OA 2V51B 4DV3K 1HKGA 2FXUA 4K43A 1S1WA 3LPUA 1WBDA 5JVGL 4N47A 3LZJA 4DFMA 3W0LA 4C1NI 3QNNA 3T1HK 3IUCA 4AHVA 3M5RA 4OGCA 1QZ5A 2QWNA 2HB5A 2I7NA 2ZWHA 3O4NA 4FLUA 2ZE2A 4JN4A 5KQ8A 3ULDA 3VN5A 2VWBA 5M1NA 1LAWA 3HSTB 3SV3A 4J2BA 4EHUA 2YNHA 2BGGA 4ELVA 1D4XA 4DFJA 1JLBA 4KKOA 4CJ5A 2G8KA 3FZMA 5FDLA 5ELZA 2JWKA 4DR6K 1TUUA 3D45A 4KHUA 4BRCA 1NK8A 3LAKA 4JD2B 4RCHA 4J2AA 1MU2A 3VENA 2HBLA 1WSIA 3MXJA 3KWGA 4IJNA 1Q81O 4BRFA 4B1WB 1VSMA 3NH1A 4DR7K 3QIPA 4CEOA 4DQQA 2YJEA 3NAEA 2UU9K 3VEOA 3DLBA 4B3OA 4U67L 4EFHA 1EETA 3T69A 3SPZA 5AQOA 3CQYA 1OH6A 3SAHA 3L2UA 1U49A 3VA0A 3M8QA 5C2DA 2HF3A 1HR0K 3SJHA 1CZ9A 3OYDA 3RSEB 1VHXA 2E8AA 2IDOA 4Q5VA 4IO8A 1JL2A 4FLTA 3TSPA 1HNXK 2VG5A 4L3QA 4JKAA 3MMVA 4CK2A 1KVAA 3V9SA 1SUQA 2X74A 3CCRN 4L8RB 4KHPK 3CPWM 4NCAA 2ASOA 3CCUN 4RG8A 5KI6A 1T44A 2UXDK 3QFUA 1YJNN 1MWKA 5DM6L 1EXQA 3PX0A 2O8FA 4NCBA 3HRGA 4YDUA 1KVCA 4FWMA 1FKOA 2G8HA 4WQ4C 1O13A 1NGIA 3J7AP 1B9DA 2QWQA 2A1SA 5FRNA 4CGFA 5I9EB 4F8RA 1S22A 3E9PA 2Z1HA 3LDQA 5AFUH 1YIJN 1EP4A 3H08A 4B8AB 4N76A 3U3GA 3CETA 4JKGA 3VEWA 2XY7A 4J2DA 2VYPA 3THWB 4DQRA 1D9DA 2NRTA 3WNHA 2P9IA 5FPEA 1S6PA 4CD1A 1I94K 5AQIA 3CCQN 4PHTX 4E1NA 5JLHA 1Q9XA 1TK5A 4PL8A 2AJQA 5HRSA 4PQUA 4FXDA 1HRHA 4M63C 3CF5L 4OO1J 2I7PA 3FGUA 1RBSA 4DQIA 2UYTA 4B1UB 2FBVA 1BQNA 5F1XA 3D2FA 5HRPA 2O8CA 4BROA 3O3GA 5GIPA 2RKIA 4FW2A 4H5TA 4FJHA 1NGHA 3T7ZA 1RDDA 1ZBSA 4F3TA 4BRMA 3OW2M 1LW2A 3ULEB 3HOTA 4BRNA 4KH4A 3C6TA 3DMJA 4DTRA 3CM6A 4FM0A 4DS4A 4YY3K 3O80A 4DR4K 1NGCA 2CH6A 4M3UA 4CEQA 2O4GA 2G8VA 2FLOA 3TAEA 4FJJA 1U2VB 1NGAA 4KHWA 4W5RA 2F9WA 4ILJA 1T7PA 4BQLA 1K9MO 3CQ8A 4CJKA 4DFPA 1XUPO 1HNIA 4CHPA 4FWRA 3ITHA 4CZJA 3WEEB 3OYFA 1H1VA 1SS6A 3SUPA 2KZZA 2Y1JA 1DKGD 3KJVA 4TSXA 5BN8A 3T19A 5DM7L 1X3MA 4C8MA 3HTVA 3BF3A 4EIAA 1EKEA 5HROA 1YXQA 4DTXA 4DTJA 5SZTA 4DLEA 4BDPA 4ISEA 4B9QA 3DXKB 4BVPA 3C94A 4DTPA 2HSTA 1M1KO 5BPNA 4BR5A 4CHYA 1IO2A 1WUAA 2FBXA 1N36K 5AZJB 4YOYA 2HNYA 2ZGYA 3E9OA 3RMDA 2OA8A 4CJVA 1BA1A 3CXCM 4JHDA 1JLFA 2HNZA 3GG4A 1YUWA 2IVOA 4BRDA 1NWKA 2QWLA 1XMQK 3HM9A 1KCFA 4JK9A 5BRFA 3MDQA 1NGEA 3SAGA 2VQFK 4F3OA 1KFDA 4EP5A 5AZIB 2P9NA 1SZ2A 2Q97A 3VOVA 4DCHA 1KD1O 1JLEA 2KW4A 5DK5A 4CF2A 3EZWA 4N5SA 3FZHA 4IEEA 1E4FT 3OYGA 4CJSA 4LFAK 3ZSRA 2OYQA 4DQSA 1OVYA 3AVNA 3LM2A 4H5VA 4JRQA 3JAMO 4CHZA 3K5OA 3P39A 4LFCK 2KHOA 3EYZA 3KWIA 1U45A 1BL3A 4NO7A 4FM1A 2VQEK 1HNZK 3LDPA 3CMAN 4M41A 4CEAA 3NGIA 4ISFA 1VAZA 4IOXA 2JGUA 4DV2K 2VWKA 1UA1A 4AH9A 3MCPA 2E6LA 3SK3A 4CIFA 1NGDA 4FZYA 4MO5A 4W5NA 3HM8A 4R5PA 5LJVA 4JAXA 4Z4IA 4NCGA 4DUYK 3WNFA 3KK3A 1T6CA 3LP0A 3NDKA 1LWEA 2ITMA 3KLEA 5JICA 4RWTA 1NM1A 2YJFA 1SKRA 1IH7A 2ZJRL 1XMOK 4FPBA 2Q1NA 4I2PA 4BRQA 1XNRK 3AVJA 3BF1A 3NBPA 2VGNA 4BG8A 1CZAN 4YHHK 2GEMA 1S9EA 1EO1A 3TI0A 5KPRA 4DTSA 1SL2A 2IOCA 3FLCO 2F8TA 5BREA 1LWCA 4CJ3A 4DKWA 1NKEA 1W9HA 3L2QA 2W42A 3A5OC 5KTQA 4JD2A 2FF6A 1OVQA 1IBMK 2XY6A 4YOWA 3NH2A 3KLIA 4Z4HA 4FLZA 3ID8A 3P4IA 3CQXA 3TWHA 2WUSA 2NRWA 5M1FA 3O3FA 2G8UA 3I55N 4R79A 4FJNA 3CFOA 4CFAA 4HTUA 3KLFA 2XHBA 4BRKA 2IIRA 1OH5A 3QMLA 2V7YA 3QDKA 4CK3A 4DSEA 3SQ2A 3ZSWA 3D7EO 3RSEA 1TGOA 2IS3A 3VERA 4LH5A 5AQJA 3ASMA 4IG0A 4XIUA 2JLEA 1ESVA 3VQ8A 1HX1A 3C6AA 4H5WA 4FJXA 2W41A 3SQ0A 5LMNK 1RTDA 3JS6A 1HQEA 1NK6A 4W5OA 3WQUA 3PSFA 3CMEN 4AHCA 5AFUA 3HT3A 1BGXT 4BWJA 4BRHA 4BRAA 1X9WA 4EAHD 1ASVA 5LL6Z 4O5FA 4M3ZA 2F7TA 1JLCA 3OYBA 1E3MA 4JEPA 4LF4K 4JKCA 1RGIA 2WFBA 1NNEA 5JMVA 3C65A 1HNWK 1RT4A 4WE1A 4ZTJA 3KVGA 3CJ7A 4W5QA 4M3XA 3V4IA 4BQZA 3E01A 1NOZA 4GNIA 3TR8A 3UKRB 4CE9A 2QW9A 4WQ5A 3K0SA 3THWA 4C8KA 3MEGA 4DU4A 3E66A 5AQZA 4E7JA 3HO1A 3VQ5A 1J9AA 4CJFA 4AHTA 1C0GA 4NLBA 4HUGA 3KKRA 1HMVA 2Q2RA 4LF9K 3JSMA 3M8PA 5AJ3K 1SL1A 3VTIA 2F96A 4JKBA 4A59A 3O1BA 4A62A 4CGDA 1D9FA 2ZJQL 3C95A 2ZGZA 3HI0A 2HMPA 4M42A 2YKNA 3D2EB 2UXCK 4B9TA 1SKSA 4KAZA 4OKJA 3TAFA 1T03A 3G71N 3ULEA 4EHTA 3GOIA 1QQCA 2RE2A 5EU7A 1JKHA 1VQ5N 4CJ4A 4CZHA 1WSFA 3AY9A 1WOQA 4CGGA 2CH5A 4OGEA 4DV1K 3O9TA 3ENBA 1U2VA 3NCIA 3PY8A 4F9OA 5KPZA 4FSVA 1EWRA 4BRIA 1RTHA 3V1OA 1WSJA 3L2WA 4A2BA 2QKBA 4NXNK 4JI3K 4A5AA 3LL3A 4H0OA 3M6GA 4OJRA 3WEEA 2O4IA 4Q0BA 2HVIA 4DR3K 3D6RA 4GMJB 5JLFA 4V19S 5IT9O 3LDLA 4Y1CA 3VQ9A 3DLRA 3VF6A 4DV5K 3ZETB 3VMFB 4BR2A 3VQ7A 5DMRA 3DWLA 4E7LA 1KSPA 4CEFA 3K5MA 4PKHA 1RNHA 4KTWA 3AA5X 4I7FA 2HF4A 3DXKA 2A41A 1RBRA 1VQ4N
chains in the Genus database with same CATH topology
1EXQA 5T7BA 3PX0A 4CF9A 3OYNA 1NK0A 4NCBA 4CFBA 4FCYA 4FJIA 2RF2A 1KVCA 1FKOA 2G8HA 2B5JA 2GBZA 3LANA 4H4MA 2QXFA 4H4OA 2B4JA 2PZSA 4AHSA 2Z1GA 4LD0A 3SNNA 1B9DA 3C6UA 4O0JA 5HBMA 3HP6A 1UOCA 2A1SA 4DLGA 4DFKA 1NOYA 4ICLA 3RR7A 1B92A 1VSLA 1VSHA 3ISNC 4CGFA 2Z1IA 4NYFA 4CIGA 4DMNA 1L5UA 1D8YA 3TAMA 2Z1HA 4CECA 3HVRA 3PV8A 4F8RA 4OLAA 3QEVA 1T05A 1WLJA 1WSEA 4B08A 3ZSVA 1Q9YA 4OPJA 1EP4A 3OJSA 3CFRA 3H08A 4Z4EA 3DM2A 4B8AB 4N76A 2IAJA 3U3GA 1DTTA 2VG6A 4J2DA 2XY7A 1YTUA 3VA3A 1BCMA 3P1GA 3WNGA 4F2RA 4DQRA 1XWLA 1D9DA 4N41A 3TAPA 1BIUA 3WNHA 2IGIA 3QINA 1S6PA 2VWJA 1QS4A 1XC9A 1L3UA 3MEDA 2HHQA 4CGHA 4E1NA 4I9QA 4ID5A 4ID1A 1Q9XA 1TK5A 4RW9A 3DOKA 1QTMA 4Z0UA 2AJQA 3AO2A 5HRSA 5CZ2A 4PQUA 4FXDA 1HRHA 4E1MA 1HJRA 5CYQA 3V9WA 3KLGA 1QE1A 4Z4GA 2XY5A 3KTQA 2G8WA 1QHTA 5I3UA 1ASWA 1RBSA 1L3VA 4DQIA 4CHNA 3IS9A 4G1QA 3G0ZA 1RT7A 1WAFA 3L3UA 3K57A 3ZSYA 2FBVA 4HVJA 3RRHA 5KRTA 3SQ4A 1BQNA 2DFFA 2P5GA 3SV4A 3LPTA 5HRPA 1RT6A 3K2PA 5CY4A 4I9LA 3O3GA 2QK9A 2RKIA 4FW2A 3ZT3A 2R7YA 4DSIA 4F4KA 4FJHA 1RDDA 2DTUA 1Z26A 4DSJA 2BDPA 1RT5A 2YNIA 4N56A 1VSEA 2D0BA 4F3TA 1LW2A 1VRTA 4OKKA 4M45A 3DRPA 4BACA 2HHSA 1HNVA 1J54A 1GOCA 2ATQA 3C6TA 3VQ6A 2DFHA 5J2PA 3SUOA 3RRGA 1VSJA 4O55A 3DMJA 4DS5A 4E7HA 4DTRA 5CYMA 3CM6A 4FM0A 4C8OA 4O0IA 4DS4A 4O5BA 2F8SA 3NH0A 1KTQA 4KI6A 2BE2A 3AVBA 3OYHA 1YTAA 4DU3A 1S9GA 3RWUA 4M3UA 2HHUA 3D0PA 1TAUA 4CEQA 3DRSA 2O4GA 3KK2A 2G8VA 3TAQA 4C8LA 4KREA 3TAEA 1VSIA 4FJJA 3OYLA 4KHWA 1RBTA 1YVUA 4RW6A 4W5RA 2OZSA 2VG7A 1ZBHA 3CFPA 3AVAA 1U48A 3B6PA 4IBNA 1T7PA 4CESA 4E19A 1NJWA 1QSLA 4JS4A 1RTIA 1RBUA 2YHBA 3CQ8A 4CJKA 3S3NA 3NGYA 4DFPA 1BISA 1HNIA 3P5JA 2DY4A 4CHPA 4HHTA 3DLEA 3ITHA 3V1RA 2ETJA 3OYFA 3I8DA 2B6AA 4KV8A 1S1XA 3MXIA 3NF7A 4OVLA 3L3VA 3SUPA 1JLQA 1XHXA 2WONA 1U4BA 1I3AA 1D5AA 4EZ6A 2KZZA 2Y1JA 2HNDA 5I42A 4IFYA 4KFBA 1GOBA 3TAGA 1JXEA 4FLXA 4FM2A 4FYDA 1JL1A 3ZSOA 3U6FA 2Q3SA 3KJVA 4TSXA 1FXXA 3T19A 5J2QA 4C8MA 1NK5A 1BI4A 1EKEA 1CXQA 2YKMA 4AILC 5HROA 1ASUA 4DTXA 4OPKA 1UWBA 5SZTA 5KRSA 4DLEA 4DTJA 1Z25A 3HXMA 1ZBLA 4BDPA 3PO5A 4B8CA 3VQAA 2HHXA 4KI4A 1NK4A 1S1UA 3C94A 4DTPA 3IG1A 1HYVA 2DFEA 3T1AA 5FROA 1R0AA 2ZQBA 4M3RA 3V1QA 2OPRA 4JS5A 4CHYA 2PYJA 3DLGA 3V6DA 1IO2A 3QESA 1S5JA 1TL1A 2FC0A 2FBXA 4FW1A 3RTVA 2HMIA 3MECA 3VQEA 3RMDA 2HNYA 2OA8A 1REVA 1CLQA 2NUBA 3AO5A 4CIEA 4CJVA 1L3SA 3G10A 5CZ1A 1TVRA 2D0CA 3PX4A 3IRXA 4DF8A 1KLMA 1NJXA 3HPHA 1SL0A 1IG9A 1JLFA 1T8EA 3M8RA 3LDSA 4F2SA 4FLVA 3VQBA 2YNGA 2HNZA 1RT3A 1QSSA 3V9XA 3BDPA 1YT3A 1ZBUA 4DTOA 5HP1A 4C8NA 3HM9A 3ZT2A 5J2MA 1X9MA 1KCFA 1TKXA 2OZMA 3OYAA 4F3OA 4DWIA 1RDBA 1KFDA 4M3TA 4EP5A 4CEEA 1Y97A 4O44A 1RT2A 2E6MA 1U47A 4FJ8A 4O4GA 3F73A 3SYZA 4KHYA 2HW3A 4I2QA 3AO3A 3V81A 3OYIA 1JLEA 4CGIA 3K58A 2KW4A 1JLGA 5DK5A 4CF2A 4N5SA 4FLYA 3SJJA 2WOMA 3OYGA 5J1EA 1CXUA 4CJSA 4KB0A 3ZSRA 2OYQA 1NKCA 1SV5A 3IAYA 4DQSA 3VQCA 1RBVA 1XHZA 1J5OA 1TKTA 3ZSZA 3AVNA 3S3OA 3CM5A 4JRQA 3AO1A 3KK1A 3QEIA 4CHZA 4MFBA 5HRNA 3K5OA 3EZ5A 1C0TA 5SWMA 4YNQA 3EYZA 4FLWA 4PY5A 1U45A 1BL3A 3HJFA 2KFNA 4CJPA 4FM1A 1RCHA 3CG7A 3K5NA 1BIZA 1IKWA 3LP1A 3LP3A 5C25A 2IC3A 4QAGA 4M41A 3B6OA 4CEAA 3NGIA 3SUQA 1BHLA 2EX3A 2JGUA 3OYEA 4PUOA 2VWKA 3L2VA 4AH9A 3A2FA 2XRIA 5C24A 2E6LA 4CIFA 1UA1A 3KD5E 1FKPA 1C0UA 4FZYA 4YFUA 1UA0A 1ZBFA 2QKKA 3QLHA 4CJQA 3SUNA 4W5NA 1RT1A 1HYSA 4R5PA 3AVGA 1KLNA 4CJTA 3S3MA 4Z4IA 3AVLA 4NCGA 3WNFA 3RR8A 3KK3A 2I5JA 4CJLA 5C42A 1HQUA 4HUEA 2GUIA 4KO0A 2OPQA 3M8SA 1IKVA 1BCOA 3ZSXA 3LP0A 3K5LA 3NDKA 1LWEA 2HHVA 4FJLA 4KPYA 4W5TA 1TKDA 4Y1DA 2P51A 3KLEA 3AVKA 3P83D 1SKRA 1C1AA 1IH7A 2A1RA 3L2RA 4KTQA 4FJ9A 3VQPA 4I2PA 4EZ9A 3BGRA 3SPYA 1TAQA 4RW4A 3FFIA 2KFZA 3AVJA 3K59A 3NBPA 4IFVA 5HRRA 1VK0A 1C1CA 3DLHA 3PX6A 3OJUA 3I0SA 3LP2A 1IKYA 4LY7A 2Y1IA 3OYCA 3SQ1A 2FBYA 3AO4A 1B9FA 4DTMA 3MAQA 1S9EA 3QEXA 4PWDA 3TI0A 1BI4B 1UAXA 3MXMA 3HP9A 4DTSA 1SL2A 3U3YA 1VSKA 2IOCA 3OY9A 1KRPA 4Z4CA 2F8TA 4E0DA 1BQMA 1LWCA 3AVHA 4CJ3A 3NF6A 4LSLA 1LAVA 1DTQA 1W9HA 4PA1A 1NKEA 3OS2A 4FJMA 3L2QA 2W42A 4UQGA 3TARA 2RPIA 1NKBA 5KTQA 4B9LA 4ZHRA 3QERA 3TABA 4B9VA 1XI1A 3O3HA 2BANA 4GVMA 2XY6A 1HPZA 4CHOA 4KRFA 3NH2A 2PYLA 3KIOA 3KLIA 4Z4HA 4FLZA 4FJ5A 1X1PA 2PY5A 4HCBA 3ZT0A 4B9TA 4CFCA 3I0RA 1RDAA 1LV5A 4EP4A 1A5XA 2Z1JA 4RW8A 3F9KA 3TWHA 4FZXC 1C1BA 1I39A 2EHGA 3O3FA 4BE0A 4DSFA 2G8UA 4B9UA 1X9SA 3UIQA 1VSFA 3HYFA 4FJNA 1VRUA 1F21A 3CFOA 4CFAA 4CEZA 4HTUA 4CJWA 2ZD1A 1VSDA 3RMBA 3LAMA 5FRMA 2G8IA 2LSNA 3KLFA 2XHBA 3HL8A 5KGXA 1IKXA 4RW7A 2HVHA 4CK3A 4DSEA 1CZBA 1TV6A 2X6SA 3LALA 3PO4A 4FK4A 3CYMA 3SQ2A 3ZSWA 3LWLA 2D0AA 1TGOA 2FBTA 2IS3A 3SZ2A 1NJYA 4LH5A 1ITGA 3ASMA 3AA3A 3QO9A 4IG0A 4XIUA 4BE1A 2JLEA 3VQ8A 3QIOA 3OYKA 4KHSA 4FJXA 5JS2A 1JXBA 3O4QA 4JLHA 3VQQA 1QSYA 3SQ0A 3AVMA 1HYZA 1WN7A 4DU1A 3V9UA 3QEWA 1RTDA 1HQEA 1NK6A 4W5OA 3OVNA 4LH4A 2P5OA 1LWFA 4E89A 4FZZA 4AHCA 4CERA 3HT3A 1BGXT 4BWJA 1K6YA 4KHQA 1X9WA 1ASVA 3QEPA 4M3ZA 3TANA 1JLCA 2P1JA 3OYBA 3ZSQA 4CEBA 4M3YA 4CHQA 3V9ZA 4KHNA 2RN2A 4IG3A 4QOZB 4AHUA 4B9SA 4FJ7A 4KTZA 4FK0A 3HPGA 1NJZA 2E4LA 1RT4A 2X6NA 4WE1A 3DOLA 3SI6A 3NF9A 4ZTJA 4BDZA 4DSKA 3OS1A 3WNEA 4W5QA 3S9HA 1EX4A 2D5RA 3V4IA 1TK8A 4M3XA 4Z4FA 2HHWA 3E01A 1NOZA 1DLOA 3DRRA 1W0HA 4JRPA 1N6QA 3ZT1A 3KKSA 4DG1A 3TR8A 2X78A 3NFAA 4CE9A 4CJEA 1U04A 3ALYA 3VQ4A 1L3TA 4FJKA 4HCCA 4CEDA 1FK9A 4C8KA 3MEGA 1Q8IA 1S1TA 4DU4A 4DQPA 3DYAA 1TKZA 4IDKA 4E7IA 3AVCA 4E7JA 3AVIA 1GOAA 3DLKA 3HO1A 1S1WA 2YV0X 3LPUA 1J9AA 3VQ5A 1WAJA 4CJFA 1WNSA 4N47A 3LZJA 4AHTA 3PUFA 4DFMA 3QNNA 4HUGA 3KKRA 4AHVA 1HMVA 1A5WA 4OGCA 2OPPA 3JSMA 3M8PA 2KTQA 1SL1A 2HB5A 3KD1E 1KVBA 2F96A 3VQDA 3QNOA 3O4NA 2HHTA 4FLUA 2XY8A 2ZE2A 3ULDA 3LZIA 4CGDA 4FK2A 3VN5A 3EY1A 1D9FA 3HVTA 1SKWA 4K8ZA 1LAWA 4GW6A 4QCLA 3C95A 3HSTB 3SV3A 1NK9A 4J2BA 4M3WA 4CJRA 3KLHA 3AV9A 3NHGA 1KFSA 4M42A 5K14A 2YKNA 2YNHA 4ELVA 2BGGA 3AA2A 1TK0A 3THVA 3ZCMA 4CFDA 1NK7A 4DFJA 1JLBA 4KKOA 4CJ5A 4CJUA 4BE2A 1SKSA 5FDLA 2G8KA 3LWMA 4AHRA 4ELTA 2KZMA 4KAZA 3D45A 4OKJA 3TAFA 1T03A 4KHUA 1NK8A 1N5YA 3LAKA 4K8XA 4J2AA 1J53A 4BWMA 1MU2A 1QQCA 1WSIA 3QETA 4CF0A 4LSNA 2GV9A 3HK2A 3MXJA 5JS1A 4MQ3A 3OYJA 3T3FA 3RMCA 3AVFA 4OKEA 4CK1A 1VSMA 5EU7A 1JKHA 4OLBA 3NH1A 1WSHA 3QIPA 4NYNA 4CEOA 4CJ4A 4DQQA 2YNFA 1WSFA 5E41A 1G15A 3NAEA 4CGGA 1A5VA 4OGEA 3NCIA 3PY8A 1TL3A 3AA4A 4ZTFA 1S6QA 5J2NA 3DLBA 4B9NA 4B3OA 3L8BA 1S1VA 4CCHA 1EETA 4HUFA 2KQ2A 2G8FA 4DF4A 3SPZA 1RTHA 3RMAA 3V1OA 1WSJA 3OS0A 3L2WA 2YHAA 3L2UA 1U49A 3OYMA 3VA0A 4CGJA 3M8QA 2XO7A 2QKBA 4DTNA 1RDCA 1CZ9A 4OJRA 4CF8A 3OYDA 2O4IA 4Q0BA 3JYTA 1C0MA 2IDOA 4Q5VA 4FVMA 4E7KA 1JL2A 4FLTA 4DSLA 5D3GA 1ZYQA 2HVIA 4GMJB 3NGZA 2VG5A 1RTJA 1LW0A 3SCXA 4H8KA 1O1WA 3MEEA 4Y1CA 3DLRA 3VQ9A 4FJGA 4J2EA 4CK2A 1KVAA 3V9SA 3VQ7A 3ZT4A 1SUQA 2X74A 3DI6A 5DMRA 5HLFA 1RILA 2OPSA 4BDYA 4L8RB 1JLAA 4E7LA 1KSPA 4CEFA 1C6VA 3NF8A 3HPOA 4E3SA 3K5MA 4IKFA 4KB1A 5FRNA 3NE6A 4NCAA 1RNHA 5KGWA 1WSGA 4KTWA 4CF1A 4DTUA 4ELUA 3AA5X 4I7FA 1ZBIA 4RG8A 5KI6A 4B9MA 1RBRA 2ITGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXQ A;  5T7B A;  3PX0 A;  4CF9 A;  3OYN A;  1NK0 A;  4NCB A;  4CFB A;  4FCY A;  4FJI A;  2RF2 A;  1KVC A;  1FKO A;  2G8H A;  2B5J A;  2GBZ A;  3LAN A;  4H4M A;  2QXF A;  4H4O A;  2B4J A;  2PZS A;  4AHS A;  2Z1G A;  4LD0 A;  3SNN A;  1B9D A;  3C6U A;  4O0J A;  5HBM A;  3HP6 A;  1UOC A;  2A1S A;  4DLG A;  4DFK A;  1NOY A;  4ICL A;  3RR7 A;  1B92 A;  1VSL A;  1VSH A;  3ISN C;  4CGF A;  2Z1I A;  4NYF A;  4CIG A;  4DMN A;  1L5U A;  1D8Y A;  3TAM A;  2Z1H A;  4CEC A;  3HVR A;  3PV8 A;  4F8R A;  4OLA A;  3QEV A;  1T05 A;  1WLJ A;  1WSE A;  4B08 A;  3ZSV A;  1Q9Y A;  4OPJ A;  1EP4 A;  3OJS A;  3CFR A;  3H08 A;  4Z4E A;  3DM2 A;  4B8A B;  4N76 A;  2IAJ A;  3U3G A;  1DTT A;  2VG6 A;  4J2D A;  2XY7 A;  1YTU A;  3VA3 A;  1BCM A;  3P1G A;  3WNG A;  4F2R A;  4DQR A;  1XWL A;  1D9D A;  4N41 A;  3TAP A;  1BIU A;  3WNH A;  2IGI A;  3QIN A;  1S6P A;  2VWJ A;  1QS4 A;  1XC9 A;  1L3U A;  3MED A;  2HHQ A;  4CGH A;  4E1N A;  4I9Q A;  4ID5 A;  4ID1 A;  1Q9X A;  1TK5 A;  4RW9 A;  3DOK A;  1QTM A;  4Z0U A;  2AJQ A;  3AO2 A;  5HRS A;  5CZ2 A;  4PQU A;  4FXD A;  1HRH A;  4E1M A;  1HJR A;  5CYQ A;  3V9W A;  3KLG A;  1QE1 A;  4Z4G A;  2XY5 A;  3KTQ A;  2G8W A;  1QHT A;  5I3U A;  1ASW A;  1RBS A;  1L3V A;  4DQI A;  4CHN A;  3IS9 A;  4G1Q A;  3G0Z A;  1RT7 A;  1WAF A;  3L3U A;  3K57 A;  3ZSY A;  2FBV A;  4HVJ A;  3RRH A;  5KRT A;  3SQ4 A;  1BQN A;  2DFF A;  2P5G A;  3SV4 A;  3LPT A;  5HRP A;  1RT6 A;  3K2P A;  5CY4 A;  4I9L A;  3O3G A;  2QK9 A;  2RKI A;  4FW2 A;  3ZT3 A;  2R7Y A;  4DSI A;  4F4K A;  4FJH A;  1RDD A;  2DTU A;  1Z26 A;  4DSJ A;  2BDP A;  1RT5 A;  2YNI A;  4N56 A;  1VSE A;  2D0B A;  4F3T A;  1LW2 A;  1VRT A;  4OKK A;  4M45 A;  3DRP A;  4BAC A;  2HHS A;  1HNV A;  1J54 A;  1GOC A;  2ATQ A;  3C6T A;  3VQ6 A;  2DFH A;  5J2P A;  3SUO A;  3RRG A;  1VSJ A;  4O55 A;  3DMJ A;  4DS5 A;  4E7H A;  4DTR A;  5CYM A;  3CM6 A;  4FM0 A;  4C8O A;  4O0I A;  4DS4 A;  4O5B A;  2F8S A;  3NH0 A;  1KTQ A;  4KI6 A;  2BE2 A;  3AVB A;  3OYH A;  1YTA A;  4DU3 A;  1S9G A;  3RWU A;  4M3U A;  2HHU A;  3D0P A;  1TAU A;  4CEQ A;  3DRS A;  2O4G A;  3KK2 A;  2G8V A;  3TAQ A;  4C8L A;  4KRE A;  3TAE A;  1VSI A;  4FJJ A;  3OYL A;  4KHW A;  1RBT A;  1YVU A;  4RW6 A;  4W5R A;  2OZS A;  2VG7 A;  1ZBH A;  3CFP A;  3AVA A;  1U48 A;  3B6P A;  4IBN A;  1T7P A;  4CES A;  4E19 A;  1NJW A;  1QSL A;  4JS4 A;  1RTI A;  1RBU A;  2YHB A;  3CQ8 A;  4CJK A;  3S3N A;  3NGY A;  4DFP A;  1BIS A;  1HNI A;  3P5J A;  2DY4 A;  4CHP A;  4HHT A;  3DLE A;  3ITH A;  3V1R A;  2ETJ A;  3OYF A;  3I8D A;  2B6A A;  4KV8 A;  1S1X A;  3MXI A;  3NF7 A;  4OVL A;  3L3V A;  3SUP A;  1JLQ A;  1XHX A;  2WON A;  1U4B A;  1I3A A;  1D5A A;  4EZ6 A;  2KZZ A;  2Y1J A;  2HND A;  5I42 A;  4IFY A;  4KFB A;  1GOB A;  3TAG A;  1JXE A;  4FLX A;  4FM2 A;  4FYD A;  1JL1 A;  3ZSO A;  3U6F A;  2Q3S A;  3KJV A;  4TSX A;  1FXX A;  3T19 A;  5J2Q A;  4C8M A;  1NK5 A;  1BI4 A;  1EKE A;  1CXQ A;  2YKM A;  4AIL C;  5HRO A;  1ASU A;  4DTX A;  4OPK A;  1UWB A;  5SZT A;  5KRS A;  4DLE A;  4DTJ A;  1Z25 A;  3HXM A;  1ZBL A;  4BDP A;  3PO5 A;  4B8C A;  3VQA A;  2HHX A;  4KI4 A;  1NK4 A;  1S1U A;  3C94 A;  4DTP A;  3IG1 A;  1HYV A;  2DFE A;  3T1A A;  5FRO A;  1R0A A;  2ZQB A;  4M3R A;  3V1Q A;  2OPR A;  4JS5 A;  4CHY A;  2PYJ A;  3DLG A;  3V6D A;  1IO2 A;  3QES A;  1S5J A;  1TL1 A;  2FC0 A;  2FBX A;  4FW1 A;  3RTV A;  2HMI A;  3MEC A;  3VQE A;  3RMD A;  2HNY A;  2OA8 A;  1REV A;  1CLQ A;  2NUB A;  3AO5 A;  4CIE A;  4CJV A;  1L3S A;  3G10 A;  5CZ1 A;  1TVR A;  2D0C A;  3PX4 A;  3IRX A;  4DF8 A;  1KLM A;  1NJX A;  3HPH A;  1SL0 A;  1IG9 A;  1JLF A;  1T8E A;  3M8R A;  3LDS A;  4F2S A;  4FLV A;  3VQB A;  2YNG A;  2HNZ A;  1RT3 A;  1QSS A;  3V9X A;  3BDP A;  1YT3 A;  1ZBU A;  4DTO A;  5HP1 A;  4C8N A;  3HM9 A;  3ZT2 A;  5J2M A;  1X9M A;  1KCF A;  1TKX A;  2OZM A;  3OYA A;  4F3O A;  4DWI A;  1RDB A;  1KFD A;  4M3T A;  4EP5 A;  4CEE A;  1Y97 A;  4O44 A;  1RT2 A;  2E6M A;  1U47 A;  4FJ8 A;  4O4G A;  3F73 A;  3SYZ A;  4KHY A;  2HW3 A;  4I2Q A;  3AO3 A;  3V81 A;  3OYI A;  1JLE A;  4CGI A;  3K58 A;  2KW4 A;  1JLG A;  5DK5 A;  4CF2 A;  4N5S A;  4FLY A;  3SJJ A;  2WOM A;  3OYG A;  5J1E A;  1CXU A;  4CJS A;  4KB0 A;  3ZSR A;  2OYQ A;  1NKC A;  1SV5 A;  3IAY A;  4DQS A;  3VQC A;  1RBV A;  1XHZ A;  1J5O A;  1TKT A;  3ZSZ A;  3AVN A;  3S3O A;  3CM5 A;  4JRQ A;  3AO1 A;  3KK1 A;  3QEI A;  4CHZ A;  4MFB A;  5HRN A;  3K5O A;  3EZ5 A;  1C0T A;  5SWM A;  4YNQ A;  3EYZ A;  4FLW A;  4PY5 A;  1U45 A;  1BL3 A;  3HJF A;  2KFN A;  4CJP A;  4FM1 A;  1RCH A;  3CG7 A;  3K5N A;  1BIZ A;  1IKW A;  3LP1 A;  3LP3 A;  5C25 A;  2IC3 A;  4QAG A;  4M41 A;  3B6O A;  4CEA A;  3NGI A;  3SUQ A;  1BHL A;  2EX3 A;  2JGU A;  3OYE A;  4PUO A;  2VWK A;  3L2V A;  4AH9 A;  3A2F A;  2XRI A;  5C24 A;  2E6L A;  4CIF A;  1UA1 A;  3KD5 E;  1FKP A;  1C0U A;  4FZY A;  4YFU A;  1UA0 A;  1ZBF A;  2QKK A;  3QLH A;  4CJQ A;  3SUN A;  4W5N A;  1RT1 A;  1HYS A;  4R5P A;  3AVG A;  1KLN A;  4CJT A;  3S3M A;  4Z4I A;  3AVL A;  4NCG A;  3WNF A;  3RR8 A;  3KK3 A;  2I5J A;  4CJL A;  5C42 A;  1HQU A;  4HUE A;  2GUI A;  4KO0 A;  2OPQ A;  3M8S A;  1IKV A;  1BCO A;  3ZSX A;  3LP0 A;  3K5L A;  3NDK A;  1LWE A;  2HHV A;  4FJL A;  4KPY A;  4W5T A;  1TKD A;  4Y1D A;  2P51 A;  3KLE A;  3AVK A;  3P83 D;  1SKR A;  1C1A A;  1IH7 A;  2A1R A;  3L2R A;  4KTQ A;  4FJ9 A;  3VQP A;  4I2P A;  4EZ9 A;  3BGR A;  3SPY A;  1TAQ A;  4RW4 A;  3FFI A;  2KFZ A;  3AVJ A;  3K59 A;  3NBP A;  4IFV A;  5HRR A;  1VK0 A;  1C1C A;  3DLH A;  3PX6 A;  3OJU A;  3I0S A;  3LP2 A;  1IKY A;  4LY7 A;  2Y1I A;  3OYC A;  3SQ1 A;  2FBY A;  3AO4 A;  1B9F A;  4DTM A;  3MAQ A;  1S9E A;  3QEX A;  4PWD A;  3TI0 A;  1BI4 B;  1UAX A;  3MXM A;  3HP9 A;  4DTS A;  1SL2 A;  3U3Y A;  1VSK A;  2IOC A;  3OY9 A;  1KRP A;  4Z4C A;  2F8T A;  4E0D A;  1BQM A;  1LWC A;  3AVH A;  4CJ3 A;  3NF6 A;  4LSL A;  1LAV A;  1DTQ A;  1W9H A;  4PA1 A;  1NKE A;  3OS2 A;  4FJM A;  3L2Q A;  2W42 A;  4UQG A;  3TAR A;  2RPI A;  1NKB A;  5KTQ A;  4B9L A;  4ZHR A;  3QER A;  3TAB A;  4B9V A;  1XI1 A;  3O3H A;  2BAN A;  4GVM A;  2XY6 A;  1HPZ A;  4CHO A;  4KRF A;  3NH2 A;  2PYL A;  3KIO A;  3KLI A;  4Z4H A;  4FLZ A;  4FJ5 A;  1X1P A;  2PY5 A;  4HCB A;  3ZT0 A;  4B9T A;  4CFC A;  3I0R A;  1RDA A;  1LV5 A;  4EP4 A;  1A5X A;  2Z1J A;  4RW8 A;  3F9K A;  3TWH A;  4FZX C;  1C1B A;  1I39 A;  2EHG A;  3O3F A;  4BE0 A;  4DSF A;  2G8U A;  4B9U A;  1X9S A;  3UIQ A;  1VSF A;  3HYF A;  4FJN A;  1VRU A;  1F21 A;  3CFO A;  4CFA A;  4CEZ A;  4HTU A;  4CJW A;  2ZD1 A;  1VSD A;  3RMB A;  3LAM A;  5FRM A;  2G8I A;  2LSN A;  3KLF A;  2XHB A;  3HL8 A;  5KGX A;  1IKX A;  4RW7 A;  2HVH A;  4CK3 A;  4DSE A;  1CZB A;  1TV6 A;  2X6S A;  3LAL A;  3PO4 A;  4FK4 A;  3CYM A;  3SQ2 A;  3ZSW A;  3LWL A;  2D0A A;  1TGO A;  2FBT A;  2IS3 A;  3SZ2 A;  1NJY A;  4LH5 A;  1ITG A;  3ASM A;  3AA3 A;  3QO9 A;  4IG0 A;  4XIU A;  4BE1 A;  2JLE A;  3VQ8 A;  3QIO A;  3OYK A;  4KHS A;  4FJX A;  5JS2 A;  1JXB A;  3O4Q A;  4JLH A;  3VQQ A;  1QSY A;  3SQ0 A;  3AVM A;  1HYZ A;  1WN7 A;  4DU1 A;  3V9U A;  3QEW A;  1RTD A;  1HQE A;  1NK6 A;  4W5O A;  3OVN A;  4LH4 A;  2P5O A;  1LWF A;  4E89 A;  4FZZ A;  4AHC A;  4CER A;  3HT3 A;  1BGX T;  4BWJ A;  1K6Y A;  4KHQ A;  1X9W A;  1ASV A;  3QEP A;  4M3Z A;  3TAN A;  1JLC A;  2P1J A;  3OYB A;  3ZSQ A;  4CEB A;  4M3Y A;  4CHQ A;  3V9Z A;  4KHN A;  2RN2 A;  4IG3 A;  4QOZ B;  4AHU A;  4B9S A;  4FJ7 A;  4KTZ A;  4FK0 A;  3HPG A;  1NJZ A;  2E4L A;  1RT4 A;  2X6N A;  4WE1 A;  3DOL A;  3SI6 A;  3NF9 A;  4ZTJ A;  4BDZ A;  4DSK A;  3OS1 A;  3WNE A;  4W5Q A;  3S9H A;  1EX4 A;  2D5R A;  3V4I A;  1TK8 A;  4M3X A;  4Z4F A;  2HHW A;  3E01 A;  1NOZ A;  1DLO A;  3DRR A;  1W0H A;  4JRP A;  1N6Q A;  3ZT1 A;  3KKS A;  4DG1 A;  3TR8 A;  2X78 A;  3NFA A;  4CE9 A;  4CJE A;  1U04 A;  3ALY A;  3VQ4 A;  1L3T A;  4FJK A;  4HCC A;  4CED A;  1FK9 A;  4C8K A;  3MEG A;  1Q8I A;  1S1T A;  4DU4 A;  4DQP A;  3DYA A;  1TKZ A;  4IDK A;  4E7I A;  3AVC A;  4E7J A;  3AVI A;  1GOA A;  3DLK A;  3HO1 A;  1S1W A;  2YV0 X;  3LPU A;  1J9A A;  3VQ5 A;  1WAJ A;  4CJF A;  1WNS A;  4N47 A;  3LZJ A;  4AHT A;  3PUF A;  4DFM A;  3QNN A;  4HUG A;  3KKR A;  4AHV A;  1HMV A;  1A5W A;  4OGC A;  2OPP A;  3JSM A;  3M8P A;  2KTQ A;  1SL1 A;  2HB5 A;  3KD1 E;  1KVB A;  2F96 A;  3VQD A;  3QNO A;  3O4N A;  2HHT A;  4FLU A;  2XY8 A;  2ZE2 A;  3ULD A;  3LZI A;  4CGD A;  4FK2 A;  3VN5 A;  3EY1 A;  1D9F A;  3HVT A;  1SKW A;  4K8Z A;  1LAW A;  4GW6 A;  4QCL A;  3C95 A;  3HST B;  3SV3 A;  1NK9 A;  4J2B A;  4M3W A;  4CJR A;  3KLH A;  3AV9 A;  3NHG A;  1KFS A;  4M42 A;  5K14 A;  2YKN A;  2YNH A;  4ELV A;  2BGG A;  3AA2 A;  1TK0 A;  3THV A;  3ZCM A;  4CFD A;  1NK7 A;  4DFJ A;  1JLB A;  4KKO A;  4CJ5 A;  4CJU A;  4BE2 A;  1SKS A;  5FDL A;  2G8K A;  3LWM A;  4AHR A;  4ELT A;  2KZM A;  4KAZ A;  3D45 A;  4OKJ A;  3TAF A;  1T03 A;  4KHU A;  1NK8 A;  1N5Y A;  3LAK A;  4K8X A;  4J2A A;  1J53 A;  4BWM A;  1MU2 A;  1QQC A;  1WSI A;  3QET A;  4CF0 A;  4LSN A;  2GV9 A;  3HK2 A;  3MXJ A;  5JS1 A;  4MQ3 A;  3OYJ A;  3T3F A;  3RMC A;  3AVF A;  4OKE A;  4CK1 A;  1VSM A;  5EU7 A;  1JKH A;  4OLB A;  3NH1 A;  1WSH A;  3QIP A;  4NYN A;  4CEO A;  4CJ4 A;  4DQQ A;  2YNF A;  1WSF A;  5E41 A;  1G15 A;  3NAE A;  4CGG A;  1A5V A;  4OGE A;  3NCI A;  3PY8 A;  1TL3 A;  3AA4 A;  4ZTF A;  1S6Q A;  5J2N A;  3DLB A;  4B9N A;  4B3O A;  3L8B A;  1S1V A;  4CCH A;  1EET A;  4HUF A;  2KQ2 A;  2G8F A;  4DF4 A;  3SPZ A;  1RTH A;  3RMA A;  3V1O A;  1WSJ A;  3OS0 A;  3L2W A;  2YHA A;  3L2U A;  1U49 A;  3OYM A;  3VA0 A;  4CGJ A;  3M8Q A;  2XO7 A;  2QKB A;  4DTN A;  1RDC A;  1CZ9 A;  4OJR A;  4CF8 A;  3OYD A;  2O4I A;  4Q0B A;  3JYT A;  1C0M A;  2IDO A;  4Q5V A;  4FVM A;  4E7K A;  1JL2 A;  4FLT A;  4DSL A;  5D3G A;  1ZYQ A;  2HVI A;  4GMJ B;  3NGZ A;  2VG5 A;  1RTJ A;  1LW0 A;  3SCX A;  4H8K A;  1O1W A;  3MEE A;  4Y1C A;  3DLR A;  3VQ9 A;  4FJG A;  4J2E A;  4CK2 A;  1KVA A;  3V9S A;  3VQ7 A;  3ZT4 A;  1SUQ A;  2X74 A;  3DI6 A;  5DMR A;  5HLF A;  1RIL A;  2OPS A;  4BDY A;  4L8R B;  1JLA A;  4E7L A;  1KSP A;  4CEF A;  1C6V A;  3NF8 A;  3HPO A;  4E3S A;  3K5M A;  4IKF A;  4KB1 A;  5FRN A;  3NE6 A;  4NCA A;  1RNH A;  5KGW A;  1WSG A;  4KTW A;  4CF1 A;  4DTU A;  4ELU A;  3AA5 X;  4I7F A;  1ZBI A;  4RG8 A;  5KI6 A;  4B9M A;  1RBR A;  2ITG A; 
#chains in the Genus database with same CATH topology
 3IDH A;  4CF9 A;  4BRL A;  1NK0 A;  4CFB A;  4H4O A;  4H4M A;  5AZJ A;  2PZS A;  2B4J A;  4AQY K;  1UOC A;  4DLG A;  4DFK A;  4ICL A;  1B92 A;  1L5U A;  3TAM A;  4CEC A;  3HVR A;  3QEV A;  1N34 K;  1X3N A;  1WLJ A;  2P9L B;  4DB3 A;  5GAD P;  3OJS A;  3BZC A;  3H3N O;  2IAJ A;  4QS7 A;  1DTT A;  3P1G A;  3WNG A;  4N41 A;  3J8A A;  3G6E N;  4BY9 C;  1IV0 A;  2VWJ A;  1QS4 A;  1XC9 A;  3J7Z O;  1RFQ A;  1V4S A;  3CJA A;  4ID5 A;  4ID1 A;  5AZI A;  3CIP A;  4M7X A;  2HOE A;  4Z0U A;  5CZ2 A;  3GBT A;  3KLG A;  4LF7 K;  5AQP A;  1S72 N;  5AQF A;  3KTQ A;  2G8W A;  3H3O B;  1L3V A;  4CHN A;  3IS9 A;  3HZ6 A;  1RT7 A;  4XH1 A;  3L3U A;  5LMU K;  2VGM A;  5KRT A;  2BUP A;  4I9L A;  5EVZ A;  4F4K A;  3NVM A;  2DTU A;  1BUP A;  3PLA A;  5F2R A;  1RT5 A;  2BDP A;  1VSE A;  3TSU A;  3CCL N;  5E84 A;  4M45 A;  4FL9 A;  3BZK A;  1HNV A;  1J54 A;  2ATQ A;  3SUO A;  2DFH A;  3K9K A;  5FPD A;  4LC9 B;  4C8O A;  5CYM A;  3NH0 A;  1KTQ A;  4KI6 A;  3TU5 A;  3AVB A;  1S9G A;  3RWU A;  3O9R A;  2HHU A;  3D0P A;  4XEI A;  4H5N A;  3WXL A;  1VSI A;  3OYL A;  2VG7 A;  4UY8 O;  1U48 A;  3B6P A;  1RTI A;  1RBU A;  2YHB A;  4MO4 A;  5AQM A;  4WYB A;  3I8D A;  3GE1 A;  4KV8 A;  4BC2 A;  5GAE P;  1W97 L;  2D0O A;  1JLQ A;  2WON A;  4NLC A;  1I3A A;  1EQY A;  2HND A;  3MK6 A;  1GOB A;  1JXE A;  4FM2 A;  4FYD A;  1C0F A;  2Q3S A;  3U9D A;  1XQS C;  1NK5 A;  3BEX A;  4AIL C;  2UXB K;  1ASU A;  4Y0W A;  1UWB A;  4OPK A;  4BC3 A;  5KRS A;  1IJJ A;  5AQQ A;  3PO5 A;  3VQA A;  2HHX A;  4KI4 A;  1NK4 A;  2Q0R A;  4BC5 A;  2DFE A;  5AQU A;  3T1A A;  1N32 K;  3V1Q A;  2OPR A;  2PYJ A;  3V6D A;  4BGB A;  2QTD A;  2FC0 A;  4FW1 A;  2HMI A;  5FPM A;  3PSI A;  1GLE G;  4BR7 A;  1REV A;  4CIE A;  3A5L C;  5EY4 A;  3G10 A;  5CZ1 A;  2E2Q A;  2GWK A;  3L4Q A;  3O9S A;  1NJX A;  1KLM A;  1QQN A;  3HPH A;  1SL0 A;  4YOT A;  1T8E A;  3LDS A;  1NGG A;  3B8A X;  3VQB A;  1RT3 A;  1J6Z A;  3V9X A;  1ZBU A;  3KHY A;  1Z05 A;  4DTO A;  5HP1 A;  4C8N A;  2OZM A;  5J2M A;  1MDU B;  2O8D B;  1TKX A;  3WT0 A;  1JCG A;  4DWI A;  1FJG K;  4A61 A;  1WB9 A;  1Y97 A;  4O44 A;  4KHY A;  1U47 A;  4FJ8 A;  1SQK A;  2NLX A;  2HW3 A;  4I2Q A;  3AO3 A;  2O8B B;  3OYI A;  4CGI A;  1JLG A;  3NVK A;  2WOM A;  2W6L A;  5J1E A;  4KB0 A;  4JI2 K;  1NKC A;  1SV5 A;  1RBV A;  4H03 B;  3F2K A;  2O8E B;  3S3O A;  3CM5 A;  3AO1 A;  4M7Y A;  3QEI A;  1W7A A;  3HOS A;  5CR4 A;  4YNQ A;  5SWM A;  4PY5 A;  3FZK A;  4CZI A;  3CG7 A;  3LP3 A;  5AQS A;  5C25 A;  1BDG A;  3SUQ A;  4DHY A;  4IJA A;  3WXK A;  5C12 A;  3OYE A;  3A2F A;  2BTF A;  2XRI A;  1N33 K;  4YFU A;  1ZBF A;  3SUN A;  3AVG A;  4CJT A;  3S3M A;  3UKR A;  3H1Q A;  3RR8 A;  2W40 A;  4KH6 A;  4B3M K;  4HUE A;  4KO0 A;  3MX5 A;  1TKD A;  1NJI O;  2EWS A;  4A5B A;  3AVK A;  3P83 D;  5B8H A;  2A1R A;  3EKS A;  1T6D A;  3OA9 A;  3VTH A;  3DAW A;  3FFI A;  3THY B;  5HRR A;  1VK0 A;  5BR8 K;  3PX6 A;  3I0S A;  1IKY A;  3OYC A;  5AQV A;  1B9F A;  1IBK K;  4IZ9 A;  4YDU C;  1VQM N;  4PWD A;  3D2E A;  1KRP A;  1BQM A;  3AVH A;  1QTM A;  1LAV A;  1T3V A;  1GLD G;  3OS2 A;  4UQG A;  2QWP A;  2RPI A;  2PFU A;  3CJ1 A;  4ZHR A;  2E2N A;  4WFA L;  3QER A;  3FFK B;  3ZEU B;  2OCE A;  1HPZ A;  4CHO A;  5F0X A;  4KRF A;  3AAR A;  2PY5 A;  3I0R A;  1RDA A;  2DPN A;  1A5X A;  4RW8 A;  4FZX C;  4Z94 A;  4B9U A;  1VSF A;  1VRU A;  1F21 A;  3J80 O;  2LSN A;  3HL8 A;  5ADX H;  5KGX A;  1IKX A;  1YIT N;  2HVH A;  3MWT A;  3TTF A;  2P9S B;  3LAL A;  3VES A;  4AM6 A;  1GLJ O;  1ATS A;  4H5R A;  1NJY A;  3ZYY X;  3FZF A;  2GX9 A;  3QIO A;  3OYK A;  4JLH A;  3CJC A;  3ZET A;  3OTO K;  1ZXO A;  3ZX2 A;  1HYZ A;  1WN7 A;  4DU1 A;  1J5E K;  3MWP A;  3R3L A;  4GV9 A;  4JI7 K;  2P5O A;  1LWF A;  4YOU A;  4E89 A;  1R59 O;  1VQ9 N;  3SAF A;  2A6A A;  2IVN A;  4CHQ A;  2RN2 A;  4AHU A;  2OTL N;  4FJ7 A;  4KTZ A;  5LY3 A;  4BR9 A;  3DOL A;  1K8A O;  3EE8 A;  4DSK A;  3WNE A;  1EX4 A;  4Z4F A;  3KKS A;  3FE1 A;  1U6Z A;  4B1V A;  2P9L A;  1ILY A;  3N4P A;  4LF6 K;  4HCC A;  3LDO A;  5AQT A;  1FK9 A;  1S1T A;  4DQP A;  4X66 K;  5AQX A;  4E7I A;  1TKZ A;  4IDK A;  3AVC A;  1GOA A;  3WQT A;  3O08 A;  3CC7 N;  3PUF A;  1A5W A;  4IOA L;  2OPP A;  2E1Z A;  2KTQ A;  1TYQ B;  3KD1 E;  4FOI A;  1LOT B;  4CZF A;  5C10 A;  2HHT A;  2XY8 A;  4DR1 K;  2YHY A;  3FR0 A;  3HVT A;  4K8Z A;  2HBM A;  4CBX A;  3NHG A;  4GV6 A;  1M90 O;  5KQD A;  1YJ9 N;  1TK0 A;  3W3D A;  3ZCM A;  4CFD A;  4CJU A;  3LWM A;  4AHR A;  1VQL N;  4ELT A;  1N5Y A;  4K8X A;  3QET A;  4CF0 A;  4LSN A;  5AQW A;  5JS1 A;  3OYJ A;  3T3F A;  3AVF A;  4JI8 K;  4OKE A;  4CK1 A;  4DR2 K;  4OLB A;  5GIO A;  2YNF A;  3HBT A;  3QIC A;  4H0V B;  1NGJ A;  5GIN A;  4MLH A;  1K73 O;  1S6Q A;  3BP8 A;  4B9N A;  3L8B A;  1S1V A;  4JKH A;  2KQ2 A;  3MN9 A;  1VQ7 N;  3MCA B;  5BRD A;  2A3Z A;  2FSN A;  4CGJ A;  4DTN A;  4CF8 A;  3AGR A;  4H0P A;  1DT9 A;  3ENO A;  3JYT A;  3CER A;  1C0M A;  1RDU A;  4E7K A;  4FVM A;  4MDB A;  4YOX A;  3SCX A;  3IFR A;  2P9P B;  3ZT4 A;  3DI6 A;  4ILH A;  4BDY A;  1JLA A;  3ENH A;  3NF8 A;  2UUC K;  4IKF A;  2W6K A;  5KGW A;  1WSG A;  4CF1 A;  4DUZ K;  4DTU A;  1YJW N;  1KQS M;  3WXI A;  4AF1 A;  4JKF A;  3ZX0 A;  5T7B A;  2GEL A;  3BY5 A;  4FJI A;  2RF2 A;  1VQ8 N;  1IG8 A;  1BWF O;  1Q18 A;  3OBW A;  2B5J A;  2GBZ A;  3ATU A;  4AHS A;  4LD0 A;  3SNN A;  5HBM A;  3C6U A;  4O0J A;  1NOY A;  3MN7 A;  4KHS A;  1VSH A;  1VSL A;  3ISN C;  4DMN A;  4NYF A;  4OLA A;  1T05 A;  1WSE A;  4B08 A;  3ZSV A;  4YOR A;  3CFR A;  3DM2 A;  4CBW A;  1YTU A;  3QB0 A;  2FF3 B;  4F2R A;  5MLC Q;  1XWL A;  3TAP A;  4KBO A;  4JI4 K;  2O8D A;  3QIN A;  3MED A;  2HHQ A;  3F5T A;  4CGH A;  4I9Q A;  4J8F A;  1N8R O;  3DOK A;  2O8B A;  1HJR A;  2QWO A;  1KAZ A;  4Z4G A;  2XY5 A;  4FWO A;  4G1Q A;  3G0Z A;  5IWA K;  2O8E A;  4DV0 K;  3ZSY A;  1SAZ A;  1BA0 A;  2DFF A;  3CC4 N;  3LPT A;  4JI0 K;  3GL1 A;  1RT6 A;  5CY4 A;  1W2B M;  4DSI A;  3ZT3 A;  2R7Y A;  1Z26 A;  1OH8 A;  4N56 A;  2D0B A;  3PIP L;  1VRT A;  1QQO A;  2Q36 A;  2HHS A;  3R8E A;  4JNE A;  1GOC A;  4DV4 K;  2YI1 A;  4O0I A;  4CZE A;  2BE2 A;  2CGK A;  1YTA A;  1WBB A;  1TAU A;  5TKY A;  3TAQ A;  4KRE A;  1YVU A;  4K42 A;  1ZC6 A;  3CFP A;  1NU0 A;  4BC4 A;  4K41 A;  4E19 A;  3THX B;  1QSL A;  4JS4 A;  3NGY A;  3P5J A;  4K25 A;  4HHT A;  3CHW A;  3UKU B;  1S1X A;  4OVL A;  3C0B A;  3NF7 A;  1EWQ A;  1U4B A;  4BGA A;  3ZX3 A;  1BG3 A;  1D5A A;  4CZL A;  3THY A;  4IFY A;  4KFB A;  2RHK A;  4X62 K;  4FLX A;  4JKE A;  4IEI A;  5J2Q A;  1HKB A;  1CXQ A;  2YKM A;  2E88 A;  1HUX A;  4DR5 K;  4CI6 A;  2FSK A;  3K9J A;  4B8C A;  5FRO A;  1R0A A;  4M3R A;  3ZEU A;  4WQ5 C;  3QES A;  1S5J A;  3G25 A;  3RTV A;  4BR0 A;  2NUB A;  3AO5 A;  5M1O A;  3U4L A;  4FVU A;  5TKW A;  1TVR A;  3Q7B A;  3WXM B;  3PX4 A;  3IRX A;  4DF8 A;  3M8R A;  2QEX N;  4FLV A;  2E5L K;  2YNG A;  3CI5 A;  1QSS A;  3BDP A;  4YOV A;  3A5M C;  4OX9 K;  2BH1 A;  3P31 A;  3ZT2 A;  3EEQ A;  2P9K B;  4LF8 K;  1RDB A;  3G4S N;  4GKJ K;  3RVC A;  2P9S A;  1RT2 A;  2E6M A;  1GLA G;  3F73 A;  3SYZ A;  3OBY A;  3JXU A;  3V81 A;  3SJJ A;  2CGJ A;  5KPT A;  3A5N C;  3IAY A;  3LM9 A;  4WF9 L;  5FLX O;  2NZT A;  1TKT A;  1FW6 A;  2VCP A;  3KK1 A;  5HRN A;  4FWS A;  3U9Z A;  4FLW A;  3H1V X;  4CJP A;  1YI2 N;  3VPZ A;  3K5N A;  1IKW A;  3LP1 A;  3AAQ A;  4CW7 B;  5BR9 A;  3B6O A;  3J81 O;  1BHL A;  2EX3 A;  2QM1 A;  4JK8 A;  3GDQ A;  2WTU A;  1C0U A;  3O5B A;  1UA0 A;  2QKK A;  3QLH A;  4CJQ A;  2F4V K;  1Q86 O;  1HYS A;  4JI6 K;  3OHR A;  2GTD A;  4CJL A;  5LJW A;  2ZM6 K;  5C42 A;  4WQ4 A;  1HQU A;  3E1Y A;  2GUI A;  2OPQ A;  3M8S A;  3DJC A;  3ZSX A;  4XH4 A;  4KPY A;  3AGK A;  4Y1D A;  2P51 A;  3M1F A;  3IMX A;  3DXM B;  1C1A A;  3J7Y P;  1JJ2 M;  4FJ9 A;  2CGL A;  1TAQ A;  1TYQ A;  4RW4 A;  2KFZ A;  3K59 A;  3DLH A;  4LY7 A;  3LP2 A;  2FBY A;  3AO4 A;  1KAX A;  3QFP A;  4QS8 A;  4DTM A;  4FWN A;  1DGK N;  3QEX A;  1MA9 B;  2J4R A;  4X64 K;  1BI4 B;  3MXM A;  3HP9 A;  3R9P A;  3U3Y A;  4Z4C A;  4GY2 B;  3NF6 A;  4PA1 A;  4A2A A;  1DTQ A;  4G9Z A;  4ILG B;  3TAR A;  3TAB A;  2FSJ A;  4B9V A;  1GLC G;  3TPQ A;  1XI1 A;  3CCJ N;  2BAN A;  4WCE L;  4GVM A;  4H0X B;  1P90 A;  3KIO A;  4HCB A;  1X1P A;  4IDH A;  1QHA A;  3ZT0 A;  1YAG A;  3L0Q A;  2HBJ A;  4X65 K;  1LV5 A;  4EP4 A;  2A40 A;  3F9K A;  3MX2 A;  3SLC A;  1C1B A;  4DSF A;  4BE0 A;  4CEZ A;  3WUH A;  1VSD A;  5FRM A;  3LAM A;  2G8I A;  4CJ7 A;  1NGB A;  1KAY A;  4H0Y B;  4LF5 K;  2X6S A;  1NMN A;  5BPL A;  4IOC L;  2Q31 A;  2D4W A;  3CJ9 A;  2FBT A;  3SZ2 A;  3QO9 A;  3AA3 A;  3C7N B;  5E26 A;  5HL7 L;  3VEY A;  3O9Q A;  1NG9 A;  5JS2 A;  1JXB A;  4FWL A;  1XC3 A;  3VQQ A;  1QSY A;  2P9P A;  2QI2 A;  3QEW A;  3V9U A;  5GAH P;  3OVN A;  4JI5 K;  3T1Y K;  4LH4 A;  2NRV A;  4BRG A;  3CJB A;  4CER A;  1GLB G;  3QEP A;  4K0K K;  3TAN A;  2P1J A;  5M1K A;  4M3Y A;  1NMD A;  4FWQ A;  4KHN A;  4B1Z A;  3VGL A;  4B9S A;  4FK0 A;  2WBN A;  3VF2 A;  1NJZ A;  3A0I X;  3TTC A;  3OS1 A;  2E1Y A;  3S9H A;  1TK8 A;  3H45 C;  1HKC A;  2PAV A;  3DRR A;  1W0H A;  1N6Q A;  3ZT1 A;  4ISG A;  3SBG A;  4DG1 A;  4OPA A;  2X78 A;  4JYA K;  2UUA K;  3EL2 A;  3ALY A;  1L3T A;  4FJK A;  2GUP A;  4I6M B;  4CED A;  1Q8I A;  4O8U A;  3DYA A;  1BOT O;  3AVI A;  3DLK A;  3FZL A;  2YV0 X;  3CCV N;  1WAJ A;  1WNS A;  1OH7 A;  3A8Y A;  3L4I A;  4CBU A;  1KVB A;  3VQD A;  3QNO A;  3LZI A;  4FK2 A;  3EY1 A;  1SKW A;  4GW6 A;  4QCL A;  1NK9 A;  4M3W A;  4CJR A;  3KLH A;  3AV9 A;  1KFS A;  5K14 A;  1BO5 O;  1S3X A;  3AA2 A;  3THV A;  1NK7 A;  3VEZ A;  4BE2 A;  1KC8 O;  2KZM A;  2KKZ A;  1J53 A;  4BWM A;  1VQO N;  3QBW A;  3HK2 A;  2GV9 A;  2P9U B;  5CE3 A;  4MQ3 A;  3RMC A;  1V4T A;  1WSH A;  4NYN A;  4CVN E;  5E41 A;  1G15 A;  4MLE A;  1A5V A;  2A42 A;  1GLF O;  1TL3 A;  3AA4 A;  4ZTF A;  5J2N A;  1VQK N;  4CCH A;  2JWL A;  4HUF A;  2G8F A;  4DF4 A;  1ATR A;  3THX A;  4H0T B;  3RMA A;  3OS0 A;  4GV3 A;  2HBK A;  2YHA A;  4FWP A;  3OYM A;  2WC9 A;  2XO7 A;  2D0P A;  2QWR A;  1RDC A;  3UKU A;  2AA4 A;  2NRX A;  5D3G A;  1GLL O;  4DSL A;  3O1W A;  1ZYQ A;  1Q82 O;  3NGZ A;  1RTJ A;  1LW0 A;  3C6H A;  4H8K A;  1O1W A;  3MEE A;  4FJG A;  4J2E A;  1QZ6 A;  5EXW A;  5HLF A;  1HJO A;  1RIL A;  2OPS A;  2V52 B;  1C6V A;  3HPO A;  4E3S A;  4KB1 A;  4LFB K;  3NE6 A;  2ASM A;  4JKD A;  4E1J A;  2QXL A;  4ELU A;  3VET A;  1ZBI A;  4B9M A;  2ITG A;  4BVO A;  3OYN A;  4FCY A;  3CCS N;  3LAN A;  2QXF A;  2Z1G A;  3O9U A;  4Z4E A;  3QBX A;  3HP6 A;  3RR7 A;  2Z1I A;  4CIG A;  1RDW X;  1D8Y A;  2NNW A;  3PV8 A;  1Q9Y A;  2QA4 N;  4C1N K;  4OPJ A;  4DV6 K;  5HOO A;  2VG6 A;  2ZF5 O;  3O6W A;  3EKU A;  3VA3 A;  1BCM A;  1BIU A;  2IGI A;  2P9K A;  1K8K A;  1QVG M;  1L3U A;  2YHW A;  4RW9 A;  1YF5 L;  4OPH A;  3AO2 A;  1TUY A;  4E1M A;  4CZG A;  5CYQ A;  4JI1 K;  3V9W A;  2KLA A;  1QE1 A;  4CZM A;  4PKG A;  1QHT A;  5I3U A;  1ASW A;  3U8X A;  1WAF A;  3K57 A;  4HVJ A;  3RRH A;  2P5G A;  3SQ4 A;  3SV4 A;  4IO9 L;  3VEV A;  3K2P A;  1XNQ K;  2E2P A;  2QK9 A;  4DSJ A;  2YNI A;  4OKK A;  3DRP A;  4BAC A;  5AR0 A;  3VQ6 A;  5A2Q O;  4BRP A;  5J2P A;  2E20 A;  4JV5 K;  2OTJ N;  3RRG A;  1VSJ A;  4O55 A;  4DS5 A;  4E7H A;  4O5B A;  2F8S A;  3LDN A;  5C15 A;  2ZJP L;  2Q0U A;  2H3G X;  5EOY A;  2YX6 A;  3OYH A;  4DU3 A;  1DEJ A;  3DRS A;  4C8L A;  5AQL A;  3KK2 A;  1HPM A;  1RBT A;  2OZS A;  4RW6 A;  4FPA A;  1ZBH A;  1VQ6 N;  3AVA A;  4XH5 A;  4IBN A;  1X9J A;  4CES A;  3VGK A;  1NJW A;  3PIO L;  3S3N A;  4FO0 A;  1BIS A;  2DY4 A;  3DXM A;  3EN9 A;  3DLE A;  3V1R A;  2ETJ A;  2B6A A;  4IFE A;  3MXI A;  3L3V A;  1XHX A;  4EZ6 A;  3H46 O;  5I42 A;  3TAG A;  3TTD A;  1JL1 A;  4BRE A;  3ZSO A;  3U6F A;  1Y64 A;  5AQY A;  4HTL A;  1FXX A;  3SMP A;  4IWV A;  2V7Z A;  1NGF A;  1BI4 A;  4B3T K;  5AQR A;  1Z25 A;  3HXM A;  1ZBL A;  1S1U A;  5AQK A;  4CD3 A;  2NRZ A;  3ID6 A;  3IG1 A;  1HYV A;  3L6Q A;  2ZQB A;  2O8F B;  4JS5 A;  4FOE A;  5EX5 A;  3DLG A;  1YHQ N;  3E9L A;  1TL1 A;  3MEC A;  3VQE A;  1CLQ A;  1L3S A;  5BRH A;  2YCH A;  2D0C A;  1NLV A;  4QS9 A;  5BN9 A;  1IG9 A;  4F2S A;  4JKG B;  3VF4 A;  2OAN A;  2IVP A;  4DV7 K;  5C2F A;  1YT3 A;  4BG9 A;  2P9I B;  2UUB K;  1X9M A;  3OYA A;  4GVE A;  1LCU A;  4M3T A;  3P38 A;  4CEE A;  4O4G A;  3VEX A;  2PBD A;  3UB5 A;  3K58 A;  3C7N A;  4FLY A;  3HSC A;  1CXU A;  5BPM A;  2NRH A;  3F9M A;  3VQC A;  4O8K A;  1XHZ A;  4RTF D;  1J5O A;  3ZSZ A;  5FPN A;  3D2F B;  2O8C B;  4MFB A;  3EZ5 A;  1QVF M;  1C0T A;  5M1P A;  3HJF A;  1Q7Y O;  4NXM K;  3EO3 A;  2KFN A;  1RCH A;  1BIZ A;  2QWM A;  5M1Q A;  2IC3 A;  4QAG A;  1VQN N;  1ATN A;  4PKI A;  4B3S K;  4B3R K;  4PUO A;  1KXP A;  3L2V A;  3MN6 A;  5C24 A;  3KD5 E;  2A5X A;  1FKP A;  4IXC A;  3SBT A;  3KK7 A;  4WFB L;  1RT1 A;  1KLN A;  1IBL K;  2HHH K;  3AVL A;  1HLU A;  3MN5 A;  2I5J A;  3I8B A;  4I6M A;  1IKV A;  1BCO A;  3S41 A;  3K5L A;  2HHV A;  4FJL A;  4W5T A;  3ZLJ A;  5H1S Q;  3I33 A;  5AQN A;  5C0Y A;  3L2R A;  4KTQ A;  4A57 A;  4MDA A;  1JCE A;  3VQP A;  4EZ9 A;  3BGR A;  2GWJ A;  3SPY A;  4IFV A;  1C1C A;  3OJU A;  1E4G T;  5AQH A;  2Y1I A;  3SQ1 A;  3ATV A;  3O8M A;  3BUZ B;  3MAQ A;  3CC2 N;  3CCM N;  1Z6R A;  3I56 N;  1UAX A;  5GAG P;  1OKJ A;  1VSK A;  1YVN A;  3OY9 A;  4E0D A;  3KZB A;  4LSL A;  4FJM A;  1NKB A;  4B9L A;  3O3H A;  4KH5 A;  2P9U A;  4BR4 A;  4NB4 A;  3UE5 A;  4CZK A;  2PYL A;  1JCF A;  4U7B A;  2NRR A;  3N4Q A;  4FJ5 A;  3R6M A;  4JK7 A;  4WFN L;  5AQG A;  4CFC A;  2Z1J A;  3Q7C A;  5ADX A;  1I39 A;  2EHG A;  4JHD B;  3NMU A;  1X9S A;  3TSQ A;  3UIQ A;  3HYF A;  4CJW A;  2ZD1 A;  3RMB A;  4PL7 A;  4RW7 A;  1QQM A;  3H6E A;  1CZB A;  1TV6 A;  4FK4 A;  3PO4 A;  2P9N B;  3CYM A;  3SMS A;  3LWL A;  2D0A A;  1ITG A;  1G99 A;  4BE1 A;  4AM7 A;  4C23 A;  1K8K B;  3O4Q A;  4GKK K;  3AVM A;  1MWM A;  1VQP N;  3CCE N;  4B1X B;  3EE9 A;  4HWI A;  4FZZ A;  4KHQ A;  1K6Y A;  1BU6 O;  4DQ8 A;  3ZSQ A;  4CEB A;  3V9Z A;  3CD6 N;  4IG3 A;  4QOZ B;  2F9T A;  2ASP A;  3HPG A;  2D1K A;  3IKM A;  3DLL L;  3O4W A;  2E4L A;  2X6N A;  3SI6 A;  4B1Y B;  3NF9 A;  4BDZ A;  2D5R A;  3VGM A;  2HHW A;  3CPE A;  3AAP A;  4FWK A;  3M3Z A;  1DLO A;  2YHX A;  4JRP A;  2AP1 A;  5CHI A;  3NFA A;  4CJE A;  3WXJ A;  1NBW A;  1U04 A;  3VQ4 A;  5JVH L;  3R1X A;  1P8Z A;  2E2O A;  2V51 B;  4DV3 K;  1HKG A;  2FXU A;  4K43 A;  1S1W A;  3LPU A;  1WBD A;  5JVG L;  4N47 A;  3LZJ A;  4DFM A;  3W0L A;  4C1N I;  3QNN A;  3T1H K;  3IUC A;  4AHV A;  3M5R A;  4OGC A;  1QZ5 A;  2QWN A;  2HB5 A;  2I7N A;  2ZWH A;  3O4N A;  4FLU A;  2ZE2 A;  4JN4 A;  5KQ8 A;  3ULD A;  3VN5 A;  2VWB A;  5M1N A;  1LAW A;  3HST B;  3SV3 A;  4J2B A;  4EHU A;  2YNH A;  2BGG A;  4ELV A;  1D4X A;  4DFJ A;  1JLB A;  4KKO A;  4CJ5 A;  2G8K A;  3FZM A;  5FDL A;  5ELZ A;  2JWK A;  4DR6 K;  1TUU A;  3D45 A;  4KHU A;  4BRC A;  1NK8 A;  3LAK A;  4JD2 B;  4RCH A;  4J2A A;  1MU2 A;  3VEN A;  2HBL A;  1WSI A;  3MXJ A;  3KWG A;  4IJN A;  1Q81 O;  4BRF A;  4B1W B;  1VSM A;  3NH1 A;  4DR7 K;  3QIP A;  4CEO A;  4DQQ A;  2YJE A;  3NAE A;  2UU9 K;  3VEO A;  3DLB A;  4B3O A;  4U67 L;  4EFH A;  1EET A;  3T69 A;  3SPZ A;  5AQO A;  3CQY A;  1OH6 A;  3SAH A;  3L2U A;  1U49 A;  3VA0 A;  3M8Q A;  5C2D A;  2HF3 A;  1HR0 K;  3SJH A;  1CZ9 A;  3OYD A;  3RSE B;  1VHX A;  2E8A A;  2IDO A;  4Q5V A;  4IO8 A;  1JL2 A;  4FLT A;  3TSP A;  1HNX K;  2VG5 A;  4L3Q A;  4JKA A;  3MMV A;  4CK2 A;  1KVA A;  3V9S A;  1SUQ A;  2X74 A;  3CCR N;  4L8R B;  4KHP K;  3CPW M;  4NCA A;  2ASO A;  3CCU N;  4RG8 A;  5KI6 A;  1T44 A;  2UXD K;  3QFU A;  1YJN N;  1MWK A;  5DM6 L;  1EXQ A;  3PX0 A;  2O8F A;  4NCB A;  3HRG A;  4YDU A;  1KVC A;  4FWM A;  1FKO A;  2G8H A;  4WQ4 C;  1O13 A;  1NGI A;  3J7A P;  1B9D A;  2QWQ A;  2A1S A;  5FRN A;  4CGF A;  5I9E B;  4F8R A;  1S22 A;  3E9P A;  2Z1H A;  3LDQ A;  5AFU H;  1YIJ N;  1EP4 A;  3H08 A;  4B8A B;  4N76 A;  3U3G A;  3CET A;  4JKG A;  3VEW A;  2XY7 A;  4J2D A;  2VYP A;  3THW B;  4DQR A;  1D9D A;  2NRT A;  3WNH A;  2P9I A;  5FPE A;  1S6P A;  4CD1 A;  1I94 K;  5AQI A;  3CCQ N;  4PHT X;  4E1N A;  5JLH A;  1Q9X A;  1TK5 A;  4PL8 A;  2AJQ A;  5HRS A;  4PQU A;  4FXD A;  1HRH A;  4M63 C;  3CF5 L;  4OO1 J;  2I7P A;  3FGU A;  1RBS A;  4DQI A;  2UYT A;  4B1U B;  2FBV A;  1BQN A;  5F1X A;  3D2F A;  5HRP A;  2O8C A;  4BRO A;  3O3G A;  5GIP A;  2RKI A;  4FW2 A;  4H5T A;  4FJH A;  1NGH A;  3T7Z A;  1RDD A;  1ZBS A;  4F3T A;  4BRM A;  3OW2 M;  1LW2 A;  3ULE B;  3HOT A;  4BRN A;  4KH4 A;  3C6T A;  3DMJ A;  4DTR A;  3CM6 A;  4FM0 A;  4DS4 A;  4YY3 K;  3O80 A;  4DR4 K;  1NGC A;  2CH6 A;  4M3U A;  4CEQ A;  2O4G A;  2G8V A;  2FLO A;  3TAE A;  4FJJ A;  1U2V B;  1NGA A;  4KHW A;  4W5R A;  2F9W A;  4ILJ A;  1T7P A;  4BQL A;  1K9M O;  3CQ8 A;  4CJK A;  4DFP A;  1XUP O;  1HNI A;  4CHP A;  4FWR A;  3ITH A;  4CZJ A;  3WEE B;  3OYF A;  1H1V A;  1SS6 A;  3SUP A;  2KZZ A;  2Y1J A;  1DKG D;  3KJV A;  4TSX A;  5BN8 A;  3T19 A;  5DM7 L;  1X3M A;  4C8M A;  3HTV A;  3BF3 A;  4EIA A;  1EKE A;  5HRO A;  1YXQ A;  4DTX A;  4DTJ A;  5SZT A;  4DLE A;  4BDP A;  4ISE A;  4B9Q A;  3DXK B;  4BVP A;  3C94 A;  4DTP A;  2HST A;  1M1K O;  5BPN A;  4BR5 A;  4CHY A;  1IO2 A;  1WUA A;  2FBX A;  1N36 K;  5AZJ B;  4YOY A;  2HNY A;  2ZGY A;  3E9O A;  3RMD A;  2OA8 A;  4CJV A;  1BA1 A;  3CXC M;  4JHD A;  1JLF A;  2HNZ A;  3GG4 A;  1YUW A;  2IVO A;  4BRD A;  1NWK A;  2QWL A;  1XMQ K;  3HM9 A;  1KCF A;  4JK9 A;  5BRF A;  3MDQ A;  1NGE A;  3SAG A;  2VQF K;  4F3O A;  1KFD A;  4EP5 A;  5AZI B;  2P9N A;  1SZ2 A;  2Q97 A;  3VOV A;  4DCH A;  1KD1 O;  1JLE A;  2KW4 A;  5DK5 A;  4CF2 A;  3EZW A;  4N5S A;  3FZH A;  4IEE A;  1E4F T;  3OYG A;  4CJS A;  4LFA K;  3ZSR A;  2OYQ A;  4DQS A;  1OVY A;  3AVN A;  3LM2 A;  4H5V A;  4JRQ A;  3JAM O;  4CHZ A;  3K5O A;  3P39 A;  4LFC K;  2KHO A;  3EYZ A;  3KWI A;  1U45 A;  1BL3 A;  4NO7 A;  4FM1 A;  2VQE K;  1HNZ K;  3LDP A;  3CMA N;  4M41 A;  4CEA A;  3NGI A;  4ISF A;  1VAZ A;  4IOX A;  2JGU A;  4DV2 K;  2VWK A;  1UA1 A;  4AH9 A;  3MCP A;  2E6L A;  3SK3 A;  4CIF A;  1NGD A;  4FZY A;  4MO5 A;  4W5N A;  3HM8 A;  4R5P A;  5LJV A;  4JAX A;  4Z4I A;  4NCG A;  4DUY K;  3WNF A;  3KK3 A;  1T6C A;  3LP0 A;  3NDK A;  1LWE A;  2ITM A;  3KLE A;  5JIC A;  4RWT A;  1NM1 A;  2YJF A;  1SKR A;  1IH7 A;  2ZJR L;  1XMO K;  4FPB A;  2Q1N A;  4I2P A;  4BRQ A;  1XNR K;  3AVJ A;  3BF1 A;  3NBP A;  2VGN A;  4BG8 A;  1CZA N;  4YHH K;  2GEM A;  1S9E A;  1EO1 A;  3TI0 A;  5KPR A;  4DTS A;  1SL2 A;  2IOC A;  3FLC O;  2F8T A;  5BRE A;  1LWC A;  4CJ3 A;  4DKW A;  1NKE A;  1W9H A;  3L2Q A;  2W42 A;  3A5O C;  5KTQ A;  4JD2 A;  2FF6 A;  1OVQ A;  1IBM K;  2XY6 A;  4YOW A;  3NH2 A;  3KLI A;  4Z4H A;  4FLZ A;  3ID8 A;  3P4I A;  3CQX A;  3TWH A;  2WUS A;  2NRW A;  5M1F A;  3O3F A;  2G8U A;  3I55 N;  4R79 A;  4FJN A;  3CFO A;  4CFA A;  4HTU A;  3KLF A;  2XHB A;  4BRK A;  2IIR A;  1OH5 A;  3QML A;  2V7Y A;  3QDK A;  4CK3 A;  4DSE A;  3SQ2 A;  3ZSW A;  3D7E O;  3RSE A;  1TGO A;  2IS3 A;  3VER A;  4LH5 A;  5AQJ A;  3ASM A;  4IG0 A;  4XIU A;  2JLE A;  1ESV A;  3VQ8 A;  1HX1 A;  3C6A A;  4H5W A;  4FJX A;  2W41 A;  3SQ0 A;  5LMN K;  1RTD A;  3JS6 A;  1HQE A;  1NK6 A;  4W5O A;  3WQU A;  3PSF A;  3CME N;  4AHC A;  5AFU A;  3HT3 A;  1BGX T;  4BWJ A;  4BRH A;  4BRA A;  1X9W A;  4EAH D;  1ASV A;  5LL6 Z;  4O5F A;  4M3Z A;  2F7T A;  1JLC A;  3OYB A;  1E3M A;  4JEP A;  4LF4 K;  4JKC A;  1RGI A;  2WFB A;  1NNE A;  5JMV A;  3C65 A;  1HNW K;  1RT4 A;  4WE1 A;  4ZTJ A;  3KVG A;  3CJ7 A;  4W5Q A;  4M3X A;  3V4I A;  4BQZ A;  3E01 A;  1NOZ A;  4GNI A;  3TR8 A;  3UKR B;  4CE9 A;  2QW9 A;  4WQ5 A;  3K0S A;  3THW A;  4C8K A;  3MEG A;  4DU4 A;  3E66 A;  5AQZ A;  4E7J A;  3HO1 A;  3VQ5 A;  1J9A A;  4CJF A;  4AHT A;  1C0G A;  4NLB A;  4HUG A;  3KKR A;  1HMV A;  2Q2R A;  4LF9 K;  3JSM A;  3M8P A;  5AJ3 K;  1SL1 A;  3VTI A;  2F96 A;  4JKB A;  4A59 A;  3O1B A;  4A62 A;  4CGD A;  1D9F A;  2ZJQ L;  3C95 A;  2ZGZ A;  3HI0 A;  2HMP A;  4M42 A;  2YKN A;  3D2E B;  2UXC K;  4B9T A;  1SKS A;  4KAZ A;  4OKJ A;  3TAF A;  1T03 A;  3G71 N;  3ULE A;  4EHT A;  3GOI A;  1QQC A;  2RE2 A;  5EU7 A;  1JKH A;  1VQ5 N;  4CJ4 A;  4CZH A;  1WSF A;  3AY9 A;  1WOQ A;  4CGG A;  2CH5 A;  4OGE A;  4DV1 K;  3O9T A;  3ENB A;  1U2V A;  3NCI A;  3PY8 A;  4F9O A;  5KPZ A;  4FSV A;  1EWR A;  4BRI A;  1RTH A;  3V1O A;  1WSJ A;  3L2W A;  4A2B A;  2QKB A;  4NXN K;  4JI3 K;  4A5A A;  3LL3 A;  4H0O A;  3M6G A;  4OJR A;  3WEE A;  2O4I A;  4Q0B A;  2HVI A;  4DR3 K;  3D6R A;  4GMJ B;  5JLF A;  4V19 S;  5IT9 O;  3LDL A;  4Y1C A;  3VQ9 A;  3DLR A;  3VF6 A;  4DV5 K;  3ZET B;  3VMF B;  4BR2 A;  3VQ7 A;  5DMR A;  3DWL A;  4E7L A;  1KSP A;  4CEF A;  3K5M A;  4PKH A;  1RNH A;  4KTW A;  3AA5 X;  4I7F A;  2HF4 A;  3DXK A;  2A41 A;  1RBR A;  1VQ4 N; 
#chains in the Genus database with same CATH homology
 1EXQ A;  5T7B A;  3PX0 A;  4CF9 A;  3OYN A;  1NK0 A;  4NCB A;  4CFB A;  4FCY A;  4FJI A;  2RF2 A;  1KVC A;  1FKO A;  2G8H A;  2B5J A;  2GBZ A;  3LAN A;  4H4M A;  2QXF A;  4H4O A;  2B4J A;  2PZS A;  4AHS A;  2Z1G A;  4LD0 A;  3SNN A;  1B9D A;  3C6U A;  4O0J A;  5HBM A;  3HP6 A;  1UOC A;  2A1S A;  4DLG A;  4DFK A;  1NOY A;  4ICL A;  3RR7 A;  1B92 A;  1VSL A;  1VSH A;  3ISN C;  4CGF A;  2Z1I A;  4NYF A;  4CIG A;  4DMN A;  1L5U A;  1D8Y A;  3TAM A;  2Z1H A;  4CEC A;  3HVR A;  3PV8 A;  4F8R A;  4OLA A;  3QEV A;  1T05 A;  1WLJ A;  1WSE A;  4B08 A;  3ZSV A;  1Q9Y A;  4OPJ A;  1EP4 A;  3OJS A;  3CFR A;  3H08 A;  4Z4E A;  3DM2 A;  4B8A B;  4N76 A;  2IAJ A;  3U3G A;  1DTT A;  2VG6 A;  4J2D A;  2XY7 A;  1YTU A;  3VA3 A;  1BCM A;  3P1G A;  3WNG A;  4F2R A;  4DQR A;  1XWL A;  1D9D A;  4N41 A;  3TAP A;  1BIU A;  3WNH A;  2IGI A;  3QIN A;  1S6P A;  2VWJ A;  1QS4 A;  1XC9 A;  1L3U A;  3MED A;  2HHQ A;  4CGH A;  4E1N A;  4I9Q A;  4ID5 A;  4ID1 A;  1Q9X A;  1TK5 A;  4RW9 A;  3DOK A;  1QTM A;  4Z0U A;  2AJQ A;  3AO2 A;  5HRS A;  5CZ2 A;  4PQU A;  4FXD A;  1HRH A;  4E1M A;  1HJR A;  5CYQ A;  3V9W A;  3KLG A;  1QE1 A;  4Z4G A;  2XY5 A;  3KTQ A;  2G8W A;  1QHT A;  5I3U A;  1ASW A;  1RBS A;  1L3V A;  4DQI A;  4CHN A;  3IS9 A;  4G1Q A;  3G0Z A;  1RT7 A;  1WAF A;  3L3U A;  3K57 A;  3ZSY A;  2FBV A;  4HVJ A;  3RRH A;  5KRT A;  3SQ4 A;  1BQN A;  2DFF A;  2P5G A;  3SV4 A;  3LPT A;  5HRP A;  1RT6 A;  3K2P A;  5CY4 A;  4I9L A;  3O3G A;  2QK9 A;  2RKI A;  4FW2 A;  3ZT3 A;  2R7Y A;  4DSI A;  4F4K A;  4FJH A;  1RDD A;  2DTU A;  1Z26 A;  4DSJ A;  2BDP A;  1RT5 A;  2YNI A;  4N56 A;  1VSE A;  2D0B A;  4F3T A;  1LW2 A;  1VRT A;  4OKK A;  4M45 A;  3DRP A;  4BAC A;  2HHS A;  1HNV A;  1J54 A;  1GOC A;  2ATQ A;  3C6T A;  3VQ6 A;  2DFH A;  5J2P A;  3SUO A;  3RRG A;  1VSJ A;  4O55 A;  3DMJ A;  4DS5 A;  4E7H A;  4DTR A;  5CYM A;  3CM6 A;  4FM0 A;  4C8O A;  4O0I A;  4DS4 A;  4O5B A;  2F8S A;  3NH0 A;  1KTQ A;  4KI6 A;  2BE2 A;  3AVB A;  3OYH A;  1YTA A;  4DU3 A;  1S9G A;  3RWU A;  4M3U A;  2HHU A;  3D0P A;  1TAU A;  4CEQ A;  3DRS A;  2O4G A;  3KK2 A;  2G8V A;  3TAQ A;  4C8L A;  4KRE A;  3TAE A;  1VSI A;  4FJJ A;  3OYL A;  4KHW A;  1RBT A;  1YVU A;  4RW6 A;  4W5R A;  2OZS A;  2VG7 A;  1ZBH A;  3CFP A;  3AVA A;  1U48 A;  3B6P A;  4IBN A;  1T7P A;  4CES A;  4E19 A;  1NJW A;  1QSL A;  4JS4 A;  1RTI A;  1RBU A;  2YHB A;  3CQ8 A;  4CJK A;  3S3N A;  3NGY A;  4DFP A;  1BIS A;  1HNI A;  3P5J A;  2DY4 A;  4CHP A;  4HHT A;  3DLE A;  3ITH A;  3V1R A;  2ETJ A;  3OYF A;  3I8D A;  2B6A A;  4KV8 A;  1S1X A;  3MXI A;  3NF7 A;  4OVL A;  3L3V A;  3SUP A;  1JLQ A;  1XHX A;  2WON A;  1U4B A;  1I3A A;  1D5A A;  4EZ6 A;  2KZZ A;  2Y1J A;  2HND A;  5I42 A;  4IFY A;  4KFB A;  1GOB A;  3TAG A;  1JXE A;  4FLX A;  4FM2 A;  4FYD A;  1JL1 A;  3ZSO A;  3U6F A;  2Q3S A;  3KJV A;  4TSX A;  1FXX A;  3T19 A;  5J2Q A;  4C8M A;  1NK5 A;  1BI4 A;  1EKE A;  1CXQ A;  2YKM A;  4AIL C;  5HRO A;  1ASU A;  4DTX A;  4OPK A;  1UWB A;  5SZT A;  5KRS A;  4DLE A;  4DTJ A;  1Z25 A;  3HXM A;  1ZBL A;  4BDP A;  3PO5 A;  4B8C A;  3VQA A;  2HHX A;  4KI4 A;  1NK4 A;  1S1U A;  3C94 A;  4DTP A;  3IG1 A;  1HYV A;  2DFE A;  3T1A A;  5FRO A;  1R0A A;  2ZQB A;  4M3R A;  3V1Q A;  2OPR A;  4JS5 A;  4CHY A;  2PYJ A;  3DLG A;  3V6D A;  1IO2 A;  3QES A;  1S5J A;  1TL1 A;  2FC0 A;  2FBX A;  4FW1 A;  3RTV A;  2HMI A;  3MEC A;  3VQE A;  3RMD A;  2HNY A;  2OA8 A;  1REV A;  1CLQ A;  2NUB A;  3AO5 A;  4CIE A;  4CJV A;  1L3S A;  3G10 A;  5CZ1 A;  1TVR A;  2D0C A;  3PX4 A;  3IRX A;  4DF8 A;  1KLM A;  1NJX A;  3HPH A;  1SL0 A;  1IG9 A;  1JLF A;  1T8E A;  3M8R A;  3LDS A;  4F2S A;  4FLV A;  3VQB A;  2YNG A;  2HNZ A;  1RT3 A;  1QSS A;  3V9X A;  3BDP A;  1YT3 A;  1ZBU A;  4DTO A;  5HP1 A;  4C8N A;  3HM9 A;  3ZT2 A;  5J2M A;  1X9M A;  1KCF A;  1TKX A;  2OZM A;  3OYA A;  4F3O A;  4DWI A;  1RDB A;  1KFD A;  4M3T A;  4EP5 A;  4CEE A;  1Y97 A;  4O44 A;  1RT2 A;  2E6M A;  1U47 A;  4FJ8 A;  4O4G A;  3F73 A;  3SYZ A;  4KHY A;  2HW3 A;  4I2Q A;  3AO3 A;  3V81 A;  3OYI A;  1JLE A;  4CGI A;  3K58 A;  2KW4 A;  1JLG A;  5DK5 A;  4CF2 A;  4N5S A;  4FLY A;  3SJJ A;  2WOM A;  3OYG A;  5J1E A;  1CXU A;  4CJS A;  4KB0 A;  3ZSR A;  2OYQ A;  1NKC A;  1SV5 A;  3IAY A;  4DQS A;  3VQC A;  1RBV A;  1XHZ A;  1J5O A;  1TKT A;  3ZSZ A;  3AVN A;  3S3O A;  3CM5 A;  4JRQ A;  3AO1 A;  3KK1 A;  3QEI A;  4CHZ A;  4MFB A;  5HRN A;  3K5O A;  3EZ5 A;  1C0T A;  5SWM A;  4YNQ A;  3EYZ A;  4FLW A;  4PY5 A;  1U45 A;  1BL3 A;  3HJF A;  2KFN A;  4CJP A;  4FM1 A;  1RCH A;  3CG7 A;  3K5N A;  1BIZ A;  1IKW A;  3LP1 A;  3LP3 A;  5C25 A;  2IC3 A;  4QAG A;  4M41 A;  3B6O A;  4CEA A;  3NGI A;  3SUQ A;  1BHL A;  2EX3 A;  2JGU A;  3OYE A;  4PUO A;  2VWK A;  3L2V A;  4AH9 A;  3A2F A;  2XRI A;  5C24 A;  2E6L A;  4CIF A;  1UA1 A;  3KD5 E;  1FKP A;  1C0U A;  4FZY A;  4YFU A;  1UA0 A;  1ZBF A;  2QKK A;  3QLH A;  4CJQ A;  3SUN A;  4W5N A;  1RT1 A;  1HYS A;  4R5P A;  3AVG A;  1KLN A;  4CJT A;  3S3M A;  4Z4I A;  3AVL A;  4NCG A;  3WNF A;  3RR8 A;  3KK3 A;  2I5J A;  4CJL A;  5C42 A;  1HQU A;  4HUE A;  2GUI A;  4KO0 A;  2OPQ A;  3M8S A;  1IKV A;  1BCO A;  3ZSX A;  3LP0 A;  3K5L A;  3NDK A;  1LWE A;  2HHV A;  4FJL A;  4KPY A;  4W5T A;  1TKD A;  4Y1D A;  2P51 A;  3KLE A;  3AVK A;  3P83 D;  1SKR A;  1C1A A;  1IH7 A;  2A1R A;  3L2R A;  4KTQ A;  4FJ9 A;  3VQP A;  4I2P A;  4EZ9 A;  3BGR A;  3SPY A;  1TAQ A;  4RW4 A;  3FFI A;  2KFZ A;  3AVJ A;  3K59 A;  3NBP A;  4IFV A;  5HRR A;  1VK0 A;  1C1C A;  3DLH A;  3PX6 A;  3OJU A;  3I0S A;  3LP2 A;  1IKY A;  4LY7 A;  2Y1I A;  3OYC A;  3SQ1 A;  2FBY A;  3AO4 A;  1B9F A;  4DTM A;  3MAQ A;  1S9E A;  3QEX A;  4PWD A;  3TI0 A;  1BI4 B;  1UAX A;  3MXM A;  3HP9 A;  4DTS A;  1SL2 A;  3U3Y A;  1VSK A;  2IOC A;  3OY9 A;  1KRP A;  4Z4C A;  2F8T A;  4E0D A;  1BQM A;  1LWC A;  3AVH A;  4CJ3 A;  3NF6 A;  4LSL A;  1LAV A;  1DTQ A;  1W9H A;  4PA1 A;  1NKE A;  3OS2 A;  4FJM A;  3L2Q A;  2W42 A;  4UQG A;  3TAR A;  2RPI A;  1NKB A;  5KTQ A;  4B9L A;  4ZHR A;  3QER A;  3TAB A;  4B9V A;  1XI1 A;  3O3H A;  2BAN A;  4GVM A;  2XY6 A;  1HPZ A;  4CHO A;  4KRF A;  3NH2 A;  2PYL A;  3KIO A;  3KLI A;  4Z4H A;  4FLZ A;  4FJ5 A;  1X1P A;  2PY5 A;  4HCB A;  3ZT0 A;  4B9T A;  4CFC A;  3I0R A;  1RDA A;  1LV5 A;  4EP4 A;  1A5X A;  2Z1J A;  4RW8 A;  3F9K A;  3TWH A;  4FZX C;  1C1B A;  1I39 A;  2EHG A;  3O3F A;  4BE0 A;  4DSF A;  2G8U A;  4B9U A;  1X9S A;  3UIQ A;  1VSF A;  3HYF A;  4FJN A;  1VRU A;  1F21 A;  3CFO A;  4CFA A;  4CEZ A;  4HTU A;  4CJW A;  2ZD1 A;  1VSD A;  3RMB A;  3LAM A;  5FRM A;  2G8I A;  2LSN A;  3KLF A;  2XHB A;  3HL8 A;  5KGX A;  1IKX A;  4RW7 A;  2HVH A;  4CK3 A;  4DSE A;  1CZB A;  1TV6 A;  2X6S A;  3LAL A;  3PO4 A;  4FK4 A;  3CYM A;  3SQ2 A;  3ZSW A;  3LWL A;  2D0A A;  1TGO A;  2FBT A;  2IS3 A;  3SZ2 A;  1NJY A;  4LH5 A;  1ITG A;  3ASM A;  3AA3 A;  3QO9 A;  4IG0 A;  4XIU A;  4BE1 A;  2JLE A;  3VQ8 A;  3QIO A;  3OYK A;  4KHS A;  4FJX A;  5JS2 A;  1JXB A;  3O4Q A;  4JLH A;  3VQQ A;  1QSY A;  3SQ0 A;  3AVM A;  1HYZ A;  1WN7 A;  4DU1 A;  3V9U A;  3QEW A;  1RTD A;  1HQE A;  1NK6 A;  4W5O A;  3OVN A;  4LH4 A;  2P5O A;  1LWF A;  4E89 A;  4FZZ A;  4AHC A;  4CER A;  3HT3 A;  1BGX T;  4BWJ A;  1K6Y A;  4KHQ A;  1X9W A;  1ASV A;  3QEP A;  4M3Z A;  3TAN A;  1JLC A;  2P1J A;  3OYB A;  3ZSQ A;  4CEB A;  4M3Y A;  4CHQ A;  3V9Z A;  4KHN A;  2RN2 A;  4IG3 A;  4QOZ B;  4AHU A;  4B9S A;  4FJ7 A;  4KTZ A;  4FK0 A;  3HPG A;  1NJZ A;  2E4L A;  1RT4 A;  2X6N A;  4WE1 A;  3DOL A;  3SI6 A;  3NF9 A;  4ZTJ A;  4BDZ A;  4DSK A;  3OS1 A;  3WNE A;  4W5Q A;  3S9H A;  1EX4 A;  2D5R A;  3V4I A;  1TK8 A;  4M3X A;  4Z4F A;  2HHW A;  3E01 A;  1NOZ A;  1DLO A;  3DRR A;  1W0H A;  4JRP A;  1N6Q A;  3ZT1 A;  3KKS A;  4DG1 A;  3TR8 A;  2X78 A;  3NFA A;  4CE9 A;  4CJE A;  1U04 A;  3ALY A;  3VQ4 A;  1L3T A;  4FJK A;  4HCC A;  4CED A;  1FK9 A;  4C8K A;  3MEG A;  1Q8I A;  1S1T A;  4DU4 A;  4DQP A;  3DYA A;  1TKZ A;  4IDK A;  4E7I A;  3AVC A;  4E7J A;  3AVI A;  1GOA A;  3DLK A;  3HO1 A;  1S1W A;  2YV0 X;  3LPU A;  1J9A A;  3VQ5 A;  1WAJ A;  4CJF A;  1WNS A;  4N47 A;  3LZJ A;  4AHT A;  3PUF A;  4DFM A;  3QNN A;  4HUG A;  3KKR A;  4AHV A;  1HMV A;  1A5W A;  4OGC A;  2OPP A;  3JSM A;  3M8P A;  2KTQ A;  1SL1 A;  2HB5 A;  3KD1 E;  1KVB A;  2F96 A;  3VQD A;  3QNO A;  3O4N A;  2HHT A;  4FLU A;  2XY8 A;  2ZE2 A;  3ULD A;  3LZI A;  4CGD A;  4FK2 A;  3VN5 A;  3EY1 A;  1D9F A;  3HVT A;  1SKW A;  4K8Z A;  1LAW A;  4GW6 A;  4QCL A;  3C95 A;  3HST B;  3SV3 A;  1NK9 A;  4J2B A;  4M3W A;  4CJR A;  3KLH A;  3AV9 A;  3NHG A;  1KFS A;  4M42 A;  5K14 A;  2YKN A;  2YNH A;  4ELV A;  2BGG A;  3AA2 A;  1TK0 A;  3THV A;  3ZCM A;  4CFD A;  1NK7 A;  4DFJ A;  1JLB A;  4KKO A;  4CJ5 A;  4CJU A;  4BE2 A;  1SKS A;  5FDL A;  2G8K A;  3LWM A;  4AHR A;  4ELT A;  2KZM A;  4KAZ A;  3D45 A;  4OKJ A;  3TAF A;  1T03 A;  4KHU A;  1NK8 A;  1N5Y A;  3LAK A;  4K8X A;  4J2A A;  1J53 A;  4BWM A;  1MU2 A;  1QQC A;  1WSI A;  3QET A;  4CF0 A;  4LSN A;  2GV9 A;  3HK2 A;  3MXJ A;  5JS1 A;  4MQ3 A;  3OYJ A;  3T3F A;  3RMC A;  3AVF A;  4OKE A;  4CK1 A;  1VSM A;  5EU7 A;  1JKH A;  4OLB A;  3NH1 A;  1WSH A;  3QIP A;  4NYN A;  4CEO A;  4CJ4 A;  4DQQ A;  2YNF A;  1WSF A;  5E41 A;  1G15 A;  3NAE A;  4CGG A;  1A5V A;  4OGE A;  3NCI A;  3PY8 A;  1TL3 A;  3AA4 A;  4ZTF A;  1S6Q A;  5J2N A;  3DLB A;  4B9N A;  4B3O A;  3L8B A;  1S1V A;  4CCH A;  1EET A;  4HUF A;  2KQ2 A;  2G8F A;  4DF4 A;  3SPZ A;  1RTH A;  3RMA A;  3V1O A;  1WSJ A;  3OS0 A;  3L2W A;  2YHA A;  3L2U A;  1U49 A;  3OYM A;  3VA0 A;  4CGJ A;  3M8Q A;  2XO7 A;  2QKB A;  4DTN A;  1RDC A;  1CZ9 A;  4OJR A;  4CF8 A;  3OYD A;  2O4I A;  4Q0B A;  3JYT A;  1C0M A;  2IDO A;  4Q5V A;  4FVM A;  4E7K A;  1JL2 A;  4FLT A;  4DSL A;  5D3G A;  1ZYQ A;  2HVI A;  4GMJ B;  3NGZ A;  2VG5 A;  1RTJ A;  1LW0 A;  3SCX A;  4H8K A;  1O1W A;  3MEE A;  4Y1C A;  3DLR A;  3VQ9 A;  4FJG A;  4J2E A;  4CK2 A;  1KVA A;  3V9S A;  3VQ7 A;  3ZT4 A;  1SUQ A;  2X74 A;  3DI6 A;  5DMR A;  5HLF A;  1RIL A;  2OPS A;  4BDY A;  4L8R B;  1JLA A;  4E7L A;  1KSP A;  4CEF A;  1C6V A;  3NF8 A;  3HPO A;  4E3S A;  3K5M A;  4IKF A;  4KB1 A;  5FRN A;  3NE6 A;  4NCA A;  1RNH A;  5KGW A;  1WSG A;  4KTW A;  4CF1 A;  4DTU A;  4ELU A;  3AA5 X;  4I7F A;  1ZBI A;  4RG8 A;  5KI6 A;  4B9M A;  1RBR A;  2ITG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...