3AVJA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avjA00
1U45A 4CJWA 4FJIA 4N56A 4LH4A 1QSSA 4CF8A 3AVBA 2EX3A 4DTPA 5J2PA 5CYQA 3AVIA 4FJ9A 2PY5A 4CHYA 3ZSQA 2OA8A 4EP4A 2IS3A 4B08A 3H08A 3ZSYA 4KTQA 3KKRA 4FK4A 2DFHA 4ICLA 4DTRA 3CFPA 3AO1A 1HNVA 1TAUA 4YFUA 4CF2A 1IKXA 4KTZA 3KLGA 4FM0A 1I3AA 4DSLA 3OVNA 4KFBA 4KTWA 3SCXA 4OLBA 4E1NA 2GUIA 1EKEA 1XC9A 4CHPA 1L3SA 2W42A 3AO2A 1MU2A 3G0ZA 3VQAA 2DY4A 1S1TA 1JXBA 2RN2A 3DI6A 4Z0UA 1W9HA 3NGYA 4E7IA 2QKKA 2IC3A 1RT6A 3DLEA 4GW6A 4M41A 4DU3A 1RT3A 3LWLA 3NH0A 4CIGA 3NH2A 3SQ2A 1LWCA 4BDPA 4Z4FA 1KVAA 2Z1IA 1S1VA 4W5TA 1JLAA 5D3GA 3JYTA 3VA0A 4DFKA 4DMNA 4CHNA 3AVLA 1C0UA 1TKTA 2XY8A 1QS4A 4Y1DA 1U4BA 4LD0A 1ZBIA 1HJRA 3CYMA 4DTUA 2YKMA 1LAWA 2F8SA 2OPSA 3AA3A 2B4JA 4BE1A 2HHTA 4HUFA 3V9XA 1NOYA 3V1RA 1D5AA 3OYJA 3I0SA 4FYDA 4DQPA 3SUOA 1KFSA 4N47A 1JL2A 1ZBUA 2QXFA 1FK9A 2OZMA 3RRGA 4E19A 2D5RA 4HUGA 3NFAA 4FCYA 3RWUA 1U48A 4CFCA 3M8SA 1B92A 4M3WA 2IDOA 3CQ8A 2D0CA 4CJLA 1JLEA 1S1WA 1WSJA 1Q9YA 2KW4A 2YHBA 2DFFA 3OYHA 1G15A 3QESA 2JLEA 4J2BA 1TAQA 2DFEA 2NUBA 3TAQA 4N76A 4KHNA 3IS9A 4KHWA 3EY1A 4TSXA 4OJRA 3MXIA 3KLHA 2YNIA 4KI6A 4IG3A 4C8NA 1Q9XA 4CF1A 2KFZA 2VWJA 1Q8IA 4NYFA 3O4NA 4KI4A 4NCGA 3SPZA 1T7PA 2BGGA 2QK9A 1QQCA 1HNIA 1WAJA 2ETJA 1VSFA 1BGXT 1KVCA 1UWBA 3SQ0A 3DLBA 4LSNA 5J1EA 4KHSA 1VSIA 1WNSA 3OYNA 4CEZA 4PUOA 4C8LA 3KD5E 3ULDA 4KHUA 1HYVA 1RT5A 4OKKA 4JLHA 4DQQA 1EP4A 4UQGA 3P83D 1WSFA 3KLFA 4OKEA 4FW2A 4DU4A 4F4KA 1SL1A 4Q0BA 4M3XA 2YNGA 3OYBA 4BDYA 3VQCA 4DFMA 1TK0A 3KTQA 4AHRA 4FJLA 3L3UA 2HW3A 3HYFA 2R7YA 4B9UA 1DLOA 4MFBA 4CERA 4CIFA 5I42A 3LAKA 4AHTA 3S3NA 2EHGA 3THVA 4ELUA 4PWDA 1CXQA 3VQQA 4NCAA 4JRQA 5HROA 4PQUA 3LP0A 4BWJA 4OPKA 4BACA 4FLWA 4E7JA 4EP5A 3VQ9A 2X78A 4CJKA 3VQBA 4CEQA 5KRSA 2Y1JA 2ZQBA 2BE2A 4LH5A 4H4OA 3NHGA 1NKCA 1UA1A 3B6OA 3TAMA 4W5QA 3K5NA 1BCMA 5FDLA 1D9FA 4FJ5A 1A5XA 3OYGA 4FJHA 3ZT1A 1WN7A 1LV5A 2OPPA 1ASVA 3KK1A 1U49A 3LWMA 3RMBA 4F2RA 3ZCMA 1FKOA 1RTJA 3U3YA 3CFRA 1JL1A 1ZBFA 1NK9A 4C8KA 4AHCA 2WOMA 3RRHA 3TAFA 2G8KA 3B6PA 3MEDA 4FVMA 1REVA 2HHWA 3ZT4A 3LDSA 3HP9A 1XI1A 1JLCA 1HMVA 3UIQA 5C24A 1HYZA 2X6SA 3F73A 3RR8A 3S9HA 1BI4A 4DG1A 4FM1A 1UOCA 4O0JA 3ISNC 1NJZA 4Z4GA 3WNGA 3I8DA 3SUNA 3HVTA 2HHVA 4DQIA 1QE1A 1KRPA 3VQ8A 3OYIA 4DU1A 4CHQA 3QEIA 4GVMA 4Z4CA 4DTXA 1J5OA 4OLAA 4FK2A 4Y1CA 5CZ2A 2G8UA 1BIUA 2XY5A 2YHAA 2OZSA 2VG5A 1J9AA 2HNDA 4J2EA 1BISA 2E6LA 4DTJA 3C6UA 3KLEA 1TL1A 3RMCA 3HPOA 2FBXA 1VSMA 4B9NA 4CGGA 2G8HA 4EZ6A 1DTTA 1I39A 3DMJA 2Z1JA 4FLYA 1VK0A 4AILC 3AVNA 4FLUA 4E7KA 4G1QA 4ID5A 4K8XA 1K6YA 3DLGA 4OGEA 3T19A 1WLJA 3ZSXA 3S3MA 4F2SA 1DTQA 1BL3A 2FBVA 2KZMA 4C8MA 2HVIA 1HQUA 1ZBLA 4LSLA 3LALA 4FJJA 4DWIA 2OPQA 2RF2A 2JGUA 4CJSA 3RTVA 1EX4A 1UA0A 2ATQA 3OYFA 4CEEA 5HRNA 2B6AA 3NH1A 4HTUA 4M3RA 3VQ7A 1RILA 1SUQA 4FZXC 4M3YA 1GOCA 3AA5X 4F3OA 1C0TA 4GMJB 3G10A 4CHZA 1X1PA 3PX4A 2PYJA 4CIEA 4F8RA 1RT1A 3NGZA 4DSKA 2GBZA 2O4IA 3QEWA 3KIOA 4CGIA 4Q5VA 3LP1A 3TWHA 2YNFA 1X9MA 1RDCA 1TL3A 4OPJA 4FLXA 4DSFA 1NJXA 4RW8A 1IO2A 1ASWA 3HP6A 4ELVA 1NKBA 1TKXA 2DTUA 5FRNA 4I7FA 4CFDA 1RCHA 4CECA 4W5OA 1RDBA 3CM6A 1IKVA 3CG7A 3V9UA 3QNOA 4K8ZA 1S1UA 3V1OA 4J2DA 1BI4B 1C1BA 4ELTA 4QOZB 3PO5A 4R5PA 1B9DA 1KTQA 5DK5A 2XHBA 3QEVA 3QNNA 1HQEA 3OYKA 3KD1E 3P1GA 3NAEA 1NK5A 3ZT0A 3ASMA 3C94A 1YTAA 3T3FA 2G8VA 1C6VA 3AVHA 3K5MA 3HPGA 5HLFA 2P1JA 1HPZA 2IOCA 3I0RA 2ITGA 4PA1A 3TAGA 4FJNA 3WNEA 3OYDA 2P51A 1L3UA 3AVGA 4FLZA 4CEFA 3L2RA 4HUEA 3KK3A 2B5JA 3WNHA 1RT4A 3OY9A 1RTDA 4DF4A 4FJMA 4M3TA 3DLRA 3TR8A 4XIUA 3NGIA 4CFBA 3VA3A 1D8YA 5J2MA 4AHUA 3JSMA 1SL2A 3NF6A 1NK6A 4KHQA 3RMAA 3V9WA 1LWFA 4IDKA 2YNHA 4CCHA 3LP2A 4AHSA 5CYMA 1KLMA 1T05A 4E0DA 3MECA 1LWEA 4CFAA 3HJFA 2Z1GA 5KI6A 4CJPA 3PY8A 3NF8A 2O4GA 3AVFA 4KO0A 3OS0A 3SUQA 2VG6A 3DOLA 2KTQA 1SKWA 1XWLA 3ZT3A 4KREA 2HNYA 1TKZA 4I9LA 3OYEA 4DTSA 4KPYA 4IG0A 3VQ4A 2D0BA 3V1QA 3NF9A 4I2QA 4ID1A 4KB0A 3V4IA 4E1MA 4CJRA 1TGOA 1KVBA 1LW0A 5KGWA 4CEDA 4DFJA 4KV8A 1BQNA 4DQSA 3OYLA 1TK8A 5DMRA 2F96A 3L3VA 3SNNA 2XY7A 5CY4A 4Z4HA 2P5OA 4CF0A 1WSIA 4CJ5A 3AVJA 4M3UA 1IKYA 4O4GA 4CHOA 5SZTA 3TAEA 2KFNA 5C42A 1B9FA 4O44A 4IFYA 2BANA 4FJXA 3OJUA 4I9QA 5HRRA 3K58A 4O5BA 3DLKA 3DYAA 4DSIA 3SYZA 3U3GA 4JS5A 3SQ1A 5FRMA 1YTUA 1RBVA 1EXQA 1WAFA 1ZBHA 2E6MA 4QAGA 3VQ6A 3TAPA 1R0AA 2KZZA 3DRSA 4E89A 2RPIA 4DTNA 4N41A 3VQEA 3O3HA 4CE9A 1RDDA 2G8IA 2HHUA 1NJYA 4AHVA 3QEXA 4KAZA 4B9LA 4H4MA 3P5JA 5K14A 5J2NA 3VQ5A 2A1RA 4B9TA 4HCCA 4KRFA 3ALYA 3KJVA 4M42A 1KFDA 4CJ3A 1J53A 4E7HA 4IKFA 4L8RB 4RW6A 3AA2A 3AV9A 1WSHA 1RDAA 3DOKA 3MEGA 1SL0A 3NF7A 1GOBA 2X6NA 1RTHA 1S1XA 4DS4A 2FBYA 2HHSA 1Y97A 4JS4A 4C8OA 2HHQA 1JLQA 4NYNA 4CGFA 2RKIA 2Y1IA 1ZYQA 1JLBA 2IGIA 3AVAA 3QERA 1L5UA 1QTMA 5JS1A 2Q3SA 4DQRA 4B3OA 3OJSA 1KCFA 1JLGA 4IBNA 4N5SA 2P5GA 4J2AA 3K57A 3O3GA 2GV9A 3NE6A 1LW2A 3CFOA 4BE0A 3K2PA 1Z26A 4ZTJA 1CZBA 4BDZA 1RT2A 2G8WA 4B9MA 2HHXA 4CGJA 3HXMA 1JKHA 3LPTA 3HK2A 3AVMA 3SQ4A 2G8FA 4DF8A 2FBTA 3T1AA 3L2UA 2BDPA 4OGCA 4NCBA 4DLEA 5HRSA 4YNQA 3K59A 1XHXA 4CF9A 4FJKA 1RBTA 3AA4A 1TK5A 1SKRA 4CJVA 3MEEA 1QSLA 1CLQA 1HRHA 2WONA 1Z25A 4RG8A 4JRPA 1N5YA 4FZYA 3RR7A 3LP3A 1WSGA 3TI0A 4FJ7A 3U6FA 4CEOA 3KKSA 1VSKA 1T8EA 3ZSZA 3V9SA 5EU7A 3TANA 4CK2A 4WE1A 4W5RA 1X9SA 3CM5A 1W0HA 1NOZA 1RBRA 3DRPA 3KLIA 3O4QA 5HBMA 3ZSOA 3PX0A 3OYMA 4FZZA 3MXJA 2X74A 3MXMA 4E7LA 3HL8A 4CJFA 4CJTA 4FLTA 1J54A 4CEBA 3HT3A 1UAXA 4E3SA 3O3FA 1GOAA 2HMIA 1QHTA 4LY7A 5KGXA 1HYSA 4RW4A 4FW1A 4RW9A 4CGHA 3QINA 4FJGA 2I5JA 2D0AA 4FXDA 5SWMA 3QEPA 1KLNA 1TV6A 2HB5A 4DLGA 2PZSA 1L3VA 1YVUA 5KRTA 3D45A 1TVRA 1TKDA 4FK0A 3M8RA 1S6PA 2LSNA 1RBSA 2YV0X 4KKOA 1BHLA 2A1SA 2VG7A 2VWKA 3PUFA 4CJ4A 1U04A 1SKSA 1JLFA 1NK0A 4B8AB 3SV4A 5HRPA 3S3OA 5E41A 4KHYA 3QETA 3F9KA 1F21A 3QO9A 3SV3A 2FC0A 1VSLA 3IRXA 4Z4EA 5HP1A 1BQMA 4CJUA 1A5WA 4DFPA 4B8CA 1RT7A 3QLHA 3BGRA 4DS5A 1JXEA 1VSEA 3DM2A 3C95A 3OS1A 3NCIA 4CEAA 3PV8A 3AVCA 1NK8A 3BDPA 4AH9A 1U47A 3SJJA 1S9GA 4CK3A 1ASUA 2F8TA 1S9EA 5FROA 4OKJA 4CESA 3V6DA 3D0PA 1NKEA 1BIZA 3SUPA 5T7BA 1CXUA 1A5VA 2KQ2A 1BCOA 3M8PA 3HM9A 3V81A 3AO3A 3SPYA 4DSJA 3HO1A 4HVJA 4KB1A 3HSTB 3PX6A 3DLHA 3IG1A 4ZTFA 4H8KA 4CGDA 1VRUA 4OVLA 3L2VA 5I3UA 1NK4A 1IG9A 3HPHA 4B9SA 4FJ8A 3AO5A 3TARA 1RNHA 2ZD1A 1S6QA 1VSHA 1LAVA 4M45A 1IKWA 4HCBA 4IFVA 4B9VA 3VQDA 3SI6A 1QSYA 3K5OA 3L2WA 3WNFA 3QIPA 3IAYA 1YT3A 4ZHRA 4CJEA 1FKPA 4O55A 3MAQA 1CZ9A 3PO4A 4Z4IA 3RMDA 4DTMA 2IAJA 3LPUA 3SZ2A 1FXXA 1RBUA 3OYCA 3L2QA 4FM2A 3L8BA 1D9DA 3FFIA 2ZE2A 4DTOA 1SV5A 5JS2A 3ZSRA 1XHZA 2Z1HA 3ZT2A 3NDKA 3ZSVA 1ITGA 1IH7A 4BWMA 1N6QA 3OYAA 2OPRA 3LAMA 4PY5A 1C1CA 4RW7A 3E01A 1C1AA 3AO4A 3AVKA 3M8QA 3EZ5A 5J2QA 2XO7A 4F3TA 4CJQA 2XY6A 3LZIA 4MQ3A 3ITHA 1NK7A 1T03A 2YKNA 3DRRA 4FLVA 3EYZA 1C0MA 2AJQA 2XRIA 4I2PA 4DSEA 1WSEA 4W5NA 2QKBA 3TABA 4EZ9A 4M3ZA 4CK1A 4O0IA 5CZ1A 2HNZA 3V9ZA 1L3TA 1EETA 3ZSWA 2HVHA 3OS2A 1VSJA 1KSPA 1X9WA 1VSDA 3HVRA 3LZJA 5C25A 1NJWA 2PYLA 1O1WA 1VRTA 5KTQA 4HHTA 3VQPA 3K5LA 1S5JA 4QCLA 2E4LA 3LANA 1RTIA 3KK2A 3QIOA 4BE2A 2OYQA 3VN5A 3NBPA 3A2FA 3C6TA
chains in the Genus database with same CATH superfamily
1TYQA 4N56A 3D2FA 3ZSQA 3CJ7A 1OH7A 3H08A 4BC3A 1Z6RA 3AO1A 1HNVA 1TAUA 4YFUA 3KLGA 4KTZA 4FM0A 4DSLA 3OVNA 4KTWA 4E1NA 2GUIA 1EKEA 2GTDA 1MU2A 2A41A 1JXBA 4E7IA 3NGYA 1ATRA 4M41A 3PIOL 3TU5A 3SQ2A 3NH0A 5M1KA 2AP1A 3ENOA 4Z4FA 5D3GA 3VA0A 4OPHA 4DMNA 4CHNA 3GG4A 2XY8A 4Y1DA 4LD0A 4H0OA 1P8ZA 5B8HA 2OPSA 3VTHA 2B4JA 1YHQN 1GLEG 5E84A 3H1VX 3V9XA 2QXFA 3RRGA 4E19A 4PHTX 1FW6A 5LMNK 4JI5K 4HUGA 4CFCA 4M3WA 4CJLA 1JLEA 3MWTA 3MN6A 2UUCK 3CC2N 4TSXA 4QS8A 4K0KK 2YNIA 3EN9A 2VWJA 3O4NA 2FXUA 4QS9A 4KI4A 3O6WA 3KWIA 4H0VB 4BRHA 1QQCA 1HNIA 1VSFA 1UWBA 3DLBA 4IDHA 4YDUA 1IBLK 3OYNA 4KHUA 3O9SA 3O9RA 4JLHA 3P83D 4ILJA 4FW2A 2NRVA 3R3LA 1SL1A 3OYBA 4BDYA 4A2BA 3KTQA 3L3UA 3ZLJA 3PSIA 2HW3A 4B9UA 4MFBA 3CPWM 4CIFA 4PWDA 3M5RA 4AHTA 3O9TA 4NCAA 2FF6A 4JRQA 2O8CB 4BWJA 5BR8K 5DM7L 1ATNA 4FL9A 4NLBA 3CCMN 3J7AP 3SAGA 2BE2A 4LH5A 3H6EA 4JI0K 4H4OA 3NHGA 1NKCA 4JK9A 1BCMA 1D9FA 1Q18A 2O8BB 1ASVA 1KC8O 3RMBA 3ZCMA 2NRXA 1ZBSA 3ZYYX 4XH4A 4GKKK 3UKUA 3U3YA 1OVQA 1ZBFA 3OTOK 4AHCA 4BC2A 3TPQA 3PLAA 3EE8A 3MEDA 1V4SA 4FVMA 3J8AA 2HHWA 3W3DA 4GKJK 3F73A 1HYZA 1YF5L 1BI4A 4DG1A 4OX9K 2E2NA 4FWNA 3WNGA 3I8DA 4MDBA 3SUNA 1QE1A 3O08A 3ULEA 1KRPA 2P9KB 4CHQA 3QEIA 4DTXA 4H0PA 4OLAA 4EIAA 4DV2K 4DTJA 3C6UA 2A5XA 3HPOA 4FWPA 4H03B 4U67L 5H1SQ 3VGLA 1YI2N 4FLYA 1GLDG 4ID5A 5M1OA 3P38A 1DTQA 1BL3A 1CZAN 2KZMA 4FJJA 5F0XA 4CJSA 1YJWN 1EX4A 4A5AA 2RE2A 5AZIA 3E9OA 1RILA 1NGDA 4CJ7A 1C0TA 3PX4A 4FO0A 1RT1A 2O4IA 2YNFA 3MN9A 1Q86O 4BGAA 4FLXA 1IO2A 1ASWA 2DTUA 1DEJA 4I7FA 3WXLA 1IKVA 3CG7A 4J2DA 1S1UA 3CCQN 3HZ6A 2F9TA 4JKGA 5EOYA 1KTQA 3QNNA 2E20A 3P1GA 3NAEA 1EO1A 2QWPA 4DV7K 3IFRA 3ASMA 3KZBA 3HPGA 4B9QA 1SAZA 3CERA 1NLVA 4FWLA 4BREA 3TAGA 2E1YA 4FLZA 4HUEA 3EKUA 2B5JA 1RTDA 1RT4A 4FJMA 3F5TA 3AY9A 4CFBA 1NK6A 1NGHA 3O9UA 3RMAA 4IDKA 5CYMA 4Y0WA 4E0DA 3MECA 1LWEA 3NVMA 4CFAA 3HJFA 2Z1GA 2ZGYA 1Z05A 5KI6A 4LF7K 3QDKA 3NF8A 1T44A 2CGLA 2KTQA 1SKWA 1XWLA 2P9NB 5KQ8A 2HNYA 1H1VA 1EQYA 3OYEA 3VQ4A 3GOIA 4ID1A 3ATUA 1TGOA 3O80A 5KGWA 1LW0A 4YORA 3MCAB 3OYLA 1NGAA 1TK8A 2P5OA 4IZ9A 3A0IX 5CY4A 2O8DB 4CF0A 5F1XA 4O4GA 5SZTA 2QI2A 3VF6A 4FJXA 4DR3K 3NVKA 1JCGA 3H3NO 4O5BA 3U3GA 4K41A 4C1NK 3IMXA 1EXQA 1ZBHA 4QAGA 2RPIA 4WCEL 3IUCA 3O3HA 1V4TA 4JI1K 2G8IA 3QEXA 4KAZA 4B9LA 4H4MA 4BVOA 3VQ5A 2A1RA 4KRFA 1LCUA 4DCHA 3A8YA 3FLCO 1QQNA 4KBOA 3AA2A 3N4QA 2W41A 3JXUA 1Y97A 1GLAG 4NYNA 1QTMA 2IGIA 3QERA 3AVAA 5CE3A 2NRHA 2Q3SA 4B3OA 3JS6A 3OJSA 4IBNA 4J2AA 1LW2A 1C0GA 4ZTJA 2G8WA 2HHXA 3M3ZA 3HXMA 2ZJPL 1JKHA 3I8BA 4BRAA 3HK2A 2A40A 3TTDA 4NCBA 5AZJA 5GAHP 3K59A 1XHXA 1IBKK 3CJ1A 4AM6A 4BG8A 4CJVA 3J80O 4RG8A 1N5YA 2VYPA 4BRIA 3H1QA 1WSGA 4ILHA 4BRQA 4BR2A 1W97L 3BEXA 3T7ZA 3ZSZA 4OPAA 3RSEB 3SJHA 4W5RA 1RBRA 3O4QA 3OYMA 3FZHA 3MXJA 4E7LA 4FLTA 3O3FA 4ISEA 4FJGA 3F2KA 5SWMA 3CCSN 1TV6A 1YVUA 3M8RA 2YCHA 1T7PA 3U9ZA 2A1SA 3MWPA 3PUFA 4CJ4A 5BPNA 5BR9A 1NK0A 3CJCA 3SV4A 2QWRA 5HRPA 1Q81O 3DXMB 1Y64A 4B1VA 2E5LK 3QETA 2ZM6K 3A5MC 2HBKA 3PIPL 3N4PA 4CJUA 5HP1A 1A5WA 1RT7A 3QLHA 2XY6A 4KB0A 5EVZA 3C95A 3BDPA 3AVCA 4CK3A 1ASUA 2F8TA 4BY9C 1E3MA 1QVFM 3D0PA 3SUPA 1X9JA 4CBXA 1CXUA 2GWKA 4E1JA 2KLAA 3M8PA 3HM9A 4LF9K 4KB1A 4U7BA 3E9LA 1E4FT 4ZTFA 1BDGA 4CGDA 2P9IB 3L2VA 1IG9A 4FJ8A 1MA9B 4BRFA 2FSJA 1VSHA 1S6QA 2ZD1A 4M45A 1BU6O 5AJ3K 4YOWA 4BG9A 1T6DA 3VQDA 3THYA 3L2WA 4JKFA 2F9WA 3WNFA 4I6MA 1YT3A 4IEIA 4V19S 1FKPA 4O55A 2ZWHA 4WFNL 1VHXA 3VTIA 3SZ2A 3L2QA 4FM2A 3FFIA 1SV5A 3MX5A 5JS2A 3ZT2A 4JI7K 2P9UB 1QQOA 1S22A 2FF3B 1RFQA 3CD6N 3E01A 3AO4A 1GLLO 5J2QA 1QQMA 1VQ7N 3DRRA 4YOTA 4DUYK 1U2VA 4DHYA 4W5NA 1NG9A 4EZ9A 2BUPA 4O0IA 1VQ5N 3V9ZA 2PBDA 3QB0A 4CZGA 1HX1A 4FSVA 3W0LA 3VQPA 1S5JA 2QWQA 4BE2A 3KK2A 1ZC6A 3TR8A 2ZF5O 4CJWA 4FJIA 1QSSA 4JI3K 2EX3A 4DTPA 1Q7YO 4FJ9A 1VQ8N 1VAZA 4OO1J 4LF8K 1T6CA 2DFHA 3HSCA 4ICLA 3L4IA 3CFPA 2OTLN 3ZETA 4DR5K 1N8RO 4CF2A 1IKXA 4OLBA 1TUYA 1NGFA 3OBWA 2I7NA 4CHPA 2DY4A 5EXWA 3VQAA 5AQJA 3DI6A 4Z0UA 3DLEA 4DU3A 1RT3A 3LWLA 4BDPA 1S1VA 3JYTA 4DFKA 3AVLA 3UE5A 1C0UA 5E26A 2QA4N 3Q7CA 1ZBIA 3CYMA 1VQKN 5C2FA 4A57A 1D4XA 4HUFA 4K43A 3OYJA 4FYDA 4R79A 3UKUB 5FPEA 1JL2A 3WUHA 1IBMK 1FK9A 2OZMA 3P4IA 2D5RA 3NFAA 3BF1A 3O5BA 2KKZA 3C0BA 3M8SA 2IDOA 3CQ8A 2KW4A 2YHBA 2DFFA 4J2BA 3GBTA 1TAQA 2NUBA 3DWLA 3T1YK 3EY1A 3SAHA 1Q9XA 4CF1A 1Q8IA 5KQDA 3CC7N 2BGGA 5AQYA 3THWA 1WAJA 2HF4A 3HOTA 4BR4A 1HYVA 4OKKA 3FZLA 4DQQA 1WSFA 3KLFA 1SZ2A 3CJ9A 1BG3A 3UKRB 1W7AA 4Q0BA 4M3XA 2YNGA 3VQCA 1TK0A 2QWOA 4FJLA 4AHRA 3PSFA 3HYFA 2R7YA 1BA1A 3BZCA 1DLOA 4CERA 5I42A 4KI6A 3LAKA 3THVA 4ELUA 1CXQA 1SQKA 5AZIB 3U9DA 5HROA 3LP0A 4BACA 4E7JA 1NMDA 4EP5A 5KRSA 4AQYK 3J7YP 4FWMA 5AQSA 1UA1A 3B6OA 3TAMA 3VESA 3K5NA 4FJ5A 1HLUA 3FZMA 3OYGA 3VPZA 4FJHA 2OPPA 3FZFA 3KK1A 1MDUB 4BRKA 1U49A 3LWMA 4F2RA 4DR2K 1HPMA 3CHWA 1JL1A 4DR1K 1NK9A 4JI6K 4UY8O 2G8KA 4DV6K 1MWMA 3VOVA 3ZT4A 1JLCA 3UIQA 4FM1A 1UOCA 4O0JA 3CMEN 3ISNC 1NJZA 3HVTA 3VF2A 4DQIA 3E1YA 3D6RA 2G8UA 4WQ4A 1BIUA 3VMFB 4IO8A 2VG5A 4B3TK 4J2EA 2E6LA 2ZGZA 2YJEA 4CGGA 2G8HA 3DMJA 3AVNA 4FLUA 4E7KA 2QXLA 3DLGA 1NGEA 4OGEA 3T19A 3S3MA 4C8MA 1HQUA 1ZBLA 4LSLA 4CVNE 3RTVA 4JHDB 4CBWA 2A42A 3WXIA 1XNQK 4F3OA 4CHZA 2VGMA 2PYJA 4B1UB 4BRPA 2GBZA 2D1KA 2OANA 3QEWA 4CGIA 3LP1A 3I55N 4ILGB 4OPJA 4ELVA 4RW8A 1NKBA 5FRNA 1DGKN 1RCHA 3CM6A 3V1OA 3MN5A 2GX9A 2JWKA 5DK5A 5M1PA 4GY2B 1HQEA 5GINA 3KD1E 2IIRA 4KH6A 3T1HK 1FJGK 5HLFA 3KHYA 2IOCA 2ITGA 3CPEA 1ATSA 3OYDA 3QFPA 1L3UA 3CJAA 5KPRA 3KK3A 4M3TA 3DLRA 2E2OA 1SL2A 4YHHK 3V9WA 3ZX0A 3LP2A 4AHSA 1T05A 2EWSA 1K8AO 2P9PB 2O4GA 3VEVA 3SUQA 3OS0A 1WBDA 2J4RA 1TKZA 4I9LA 5MLCQ 4DTSA 2Q2RA 4KPYA 3V1QA 3VGMA 4BRCA 5AFUA 4MDAA 3TSUA 3V4IA 3L0QA 2RHKA 2O8EA 4CJRA 2HHHK 1KVBA 4CEDA 4DFJA 1BQNA 2NRRA 3CCUN 1K8KB 1OH8A 3SNNA 2F96A 3L3VA 4IOAL 4Z4HA 2VQFK 1WSIA 3AVJA 4M3UA 4JKHA 3ATVA 5JICA 1B9FA 2BANA 3EE9A 3K58A 3DLKA 4DSIA 3SYZA 3SQ1A 5BN8A 1YTUA 3VEOA 3K0SA 4M7YA 3ID6A 1WAFA 2NRZA 3VQ6A 3CXCM 2HBLA 3DRSA 4E89A 4DTNA 4N41A 3D2EA 4B3MK 1RDDA 3R9PA 1NJYA 4Z94A 5J2NA 3LDLA 4BR9A 3ALYA 1VQ4N 1KFDA 1J53A 4IKFA 4MLHA 4RW6A 3R1XA 4XH1A 1WSHA 1YUWA 3DOKA 3QICA 2X6NA 1RTHA 3BZKA 1QVGM 4FPBA 4CGFA 2RKIA 5JS1A 1L5UA 3Q7BA 3THXB 3NE6A 4BE0A 3K2PA 4B9MA 3LPTA 3AVMA 5F2RA 3T1AA 3L2UA 1N33K 2QM1A 4DLEA 4BQLA 3THYB 3EO3A 3AGRA 1RBTA 2V7ZA 1Z25A 3CETA 3LP3A 4FJ7A 1T8EA 1VSKA 2P9SB 5AQHA 5EU7A 5IWAK 1X9SA 3CM5A 3KLIA 3DRPA 4FZZA 2UYTA 2X74A 4CJFA 5JLHA 2HBMA 1UAXA 2YHXA 3BY5A 4H5NA 5LJVA 5KGXA 2HMIA 2ASMA 4RW4A 1J5EK 3HM8A 2F7TA 2UUAK 2I5JA 4FXDA 3QEPA 2HB5A 4DLGA 2PZSA 4JAXA 1TKDA 3O4WA 5AFUH 2LSNA 2YV0X 2VCPA 1BHLA 2BH1A 5GADP 3L6QA 4PKHA 5E41A 2ASOA 3F9KA 1F21A 3SV3A 1P90A 2FC0A 3HOSA 3IRXA 4Z4EA 4DFPA 4B8CA 3BGRA 3PV8A 1NK8A 3DM2A 3QMLA 4AH9A 4CD3A 1U47A 3SJJA 3EEQA 3ID8A 5JLFA 4OKJA 1S3XA 1NKEA 3WEEB 1BIZA 3ENBA 1BCOA 4IXCA 2CGJA 1NWKA 3HSTB 3PX6A 3O1WA 1BWFO 3DLHA 2GEMA 4H8KA 1VRUA 5AQKA 1NK4A 5I3UA 5KPZA 1LAVA 4HCBA 4B9VA 1M1KO 4JYAK 3H46O 3MAQA 4ZHRA 3PO4A 1ILYA 4Z4IA 3TTFA 2CH6A 2IAJA 4WQ4C 1RBUA 3C7NB 4MLEA 1N34K 3IKMA 4ISGA 1YJ9N 4PY5A 1C1CA 3EZ5A 1C1AA 1Q82O 4CJQA 3EYZA 2XRIA 4DSEA 2PAVA 5CZ1A 3EZWA 3ZSWA 3BUZB 1VSJA 3D7EO 2GUPA 3WXJA 1KSPA 3HVRA 2V52B 4DV1K 1NBWA 1VRTA 1NGBA 2E4LA 2OYQA 2QTDA 5AQZA 3NBPA 4FVUA 4A61A 1EWRA 1U45A 1VQON 4CF8A 4CZJA 3THWB 4JD2B 3AVIA 4GV6A 2PY5A 4CHYA 4B1ZA 4DV3K 4EP4A 2IS3A 5LJWA 3KKRA 3KVGA 3K9JA 4FK4A 4FPAA 1KD1O 3C6AA 1I3AA 3SCXA 5AR0A 1YXQA 1HNWK 1L3SA 3AO2A 3MCPA 2RN2A 1M90O 3DAWA 3DXKB 3ZEUA 3SMPA 4GW6A 2O8FB 5JVGL 3HTVA 3NH2A 4CIGA 1LWCA 1KVAA 2Z1IA 4CZIA 5KPTA 2O8CA 4X66K 1QS4A 4DTUA 1LAWA 3MMVA 2F8SA 3AA3A 4JKAA 2HHTA 4BR0A 4X65K 3LDNA 1D5AA 3H3OB 3I0SA 4DV0K 1XNRK 4DQPA 1ZBUA 4YOXA 2O8BA 1S72N 3RWUA 1SS6A 3LM9A 3SMSA 1U48A 4JV5K 1B92A 1TYQB 1Q9YA 1S1WA 2W40A 3D2FB 3OYHA 3GL1A 1E4GT 3M6GA 4N76A 4KHWA 3IS9A 1HKCA 1VQ6N 3KLHA 4IG3A 4C8NA 1C0FA 3TSPA 4NYFA 4CZKA 2GELA 3SPZA 2QK9A 2ETJA 3SQ0A 4LSNA 5J1EA 4KHSA 1VSIA 1NNEA 4YOYA 1WNSA 4CEZA 3KD5E 3ULDA 3U4LA 4UQGA 3LL3A 4DU4A 4OKEA 4DFMA 1NU0A 2V51B 3CCEN 2WBNA 3LM2A 2EHGA 2QWLA 3CCVN 4CZFA 3VQQA 4XH5A 4OPKA 4B1XB 3TSQA 3SK3A 3C6HA 2X78A 3VQ9A 3EKSA 4CJKA 4CEQA 3WXMB 2ZQBA 1VQLN 5DM6L 5ADXA 2PFUA 4CW7B 4W5QA 4BRNA 5FDLA 1A5XA 3HBTA 1XQSC 5I9EB 1WN7A 1LV5A 4X64K 2D0OA 3CIPA 4FOEA 1X3NA 1FKOA 1N36K 3CFRA 1QHAA 4C8KA 2WOMA 4C1NI 3VEXA 3RRHA 1XMQK 3WQUA 3TTCA 1REVA 4CD1A 5AQQA 3LDSA 1XI1A 4IOCL 1HMVA 5C24A 3RR8A 2IVNA 3S9HA 1JCFA 1NM1A 4Z4GA 2HHVA 3A5NC 4H5RA 3FE1A 1ZXOA 4GVMA 1KAXA 4Z4CA 1J5OA 2ZJRL 2ASPA 3ZX3A 4Y1CA 4FK2A 2XY5A 4H0XB 3FGUA 5IT9O 1OH5A 3KLEA 1TL1A 2FBXA 4RCHA 4EZ6A 4KHPK 1VQMN 3R8EA 1WLJA 3ZSXA 1GLCG 3LALA 5BREA 2OPQA 2RF2A 2ATQA 2HF3A 2B6AA 2P9NA 4M3RA 3O8MA 2YHYA 3OW2M 1SUQA 5C15A 4M3YA 1GOCA 4GV9A 4GMJB 4MO5A 1X1PA 4AM7A 3BP8A 4F8RA 2W6LA 4DSKA 1YJNN 1QZ5A 3KIOA 4Q5VA 1RDCA 1TL3A 3NMUA 3OBYA 2O8DA 2ZJQL 5FLXO 4EHTA 4CECA 4WYBA 3V9UA 4K8ZA 1BI4B 4ELTA 4QOZB 5M1QA 3PO5A 1B9DA 3QEVA 3OYKA 2UU9K 1NK5A 3SAFA 3ULEB 2NRWA 3C94A 1C6VA 4NB4A 4CZEA 3VEYA 3I0RA 4DQ8A 4K25A 4PA1A 5ADXH 4FJNA 4G9ZA 3WNHA 4JKCA 1YITN 3G71N 3NGIA 1D8YA 5J2MA 4AHUA 3QBWA 3NF6A 1LWFA 1K73O 1KAYA 1KLMA 4HTLA 1HUXA 2NRTA 1KXPA 2VG6A 3DOLA 4KREA 4KH4A 1I94K 3F9MA 4IG0A 2D0BA 3NF9A 4B1YB 2Q0UA 5HOOA 3O1BA 4E1MA 3G25A 4DQSA 3CQYA 5DMRA 3RVCA 1IKYA 4IWVA 4LC9B 4CHOA 4BRGA 4JKGB 3RSEA 4IFYA 4I9QA 4JK8A 1RBVA 4DB3A 4BC5A 3ZX2A 1VQNN 2E6MA 2A6AA 5LL6Z 1NGIA 4PL8A 2QWNA 3VQEA 4CE9A 5C0YA 1QZ6A 3FR0A 3P5JA 5K14A 4B9TA 4GNIA 3SLCA 4M42A 2Q31A 4BR7A 4CJ3A 4L8RB 2H3GX 3AARA 1RDAA 2E2PA 1IG8A 1SL0A 1WB9A 4DS4A 1S1XA 2HMPA 4JN4A 3CCJN 4JS4A 3VEZA 2HHQA 2Y1IA 2Q0RA 4WQ5C 4YOVA 1JLGA 4N5SA 2P5GA 3K57A 5A2QO 3CFOA 4CZHA 1CZBA 3E66A 4CGJA 2IVOA 3SQ4A 2G8FA 4DF8A 2FBTA 2BDPA 4OGCA 4LF6K 5EX5A 1DKGD 4A2AA 2P9IA 3AA4A 1TK5A 3G4SN 3MEEA 1CLQA 1HRHA 4JRPA 4FZYA 2VQEK 4B3SK 4L3QA 4CEOA 3KKSA 3V9SA 1OVYA 4WE1A 4RWTA 1W0HA 1XC3A 3PX0A 3HL8A 4CJTA 1J54A 4DV5K 4CEBA 3HT3A 1VQ9N 4JI8K 1WUAA 1QHTA 2P9UA 4WF9L 1HYSA 4RW9A 4BRMA 2D0AA 5ELZA 3I56N 1KLNA 4DR4K 5KRTA 2P9LA 1S6PA 4JKEA 5FPMA 1RBSA 4B8AB 2HOEA 2OCEA 1N32K 4CZLA 3S3OA 2D4WA 2FSKA 3CCRN 4KHYA 4FWQA 4IFEA 2Q1NA 4IJNA 1BUPA 1BQMA 2CH5A 4H5WA 1NOYA 4DS5A 2YHWA 1JXEA 5CR4A 5BPMA 3OS1A 4CEAA 4NLCA 1YVNA 3LDOA 2KHOA 2OTJN 1S9EA 1XMOK 2UXBK 3ENHA 3GDQA 3SPYA 4DSJA 5AZJB 1HKBA 3IG1A 3CCLN 5AQLA 4B9SA 3AO5A 3TARA 1RNHA 1YIJN 1IKWA 5AQNA 3SI6A 1QSYA 3K5OA 4B1WB 3ZEUB 3QIPA 3IAYA 1CZ9A 2BTFA 3RMDA 5GAGP 3LPUA 5BRHA 1D9DA 4FOIA 1NMNA 4DTOA 2Z1HA 3NDKA 3ZSVA 4BWMA 1N6QA 4RW7A 4YOUA 3J7ZO 3AVKA 4QS7A 3LZIA 4MQ3A 3ITHA 4BQZA 3P39A 1NK7A 1T03A 4IJAA 3LDQA 1C0MA 3AAPA 4I2PA 1WSEA 2QKBA 4CK1A 2VWBA 4A62A 3L4QA 3C65A 3HI0A 3OS2A 4H5TA 3LZJA 2PYLA 4BR5A 4CI6A 3K5LA 4QCLA 3UB5A 3VN5A 3A2FA 2XY7A 4LH4A 3KK7A 3AVBA 3QFUA 5J2PA 5CYQA 2YI1A 2OA8A 4B08A 1KQSM 4F9OA 3ZSYA 4KTQA 2UUBK 3CQXA 4DTRA 4I6MB 4KFBA 2V7YA 3WT0A 1XC9A 5BN9A 2VGNA 4CBUA 2W42A 3G0ZA 1BOTO 2NNWA 1S1TA 1W9HA 2YX6A 3UKRA 2QKKA 2IC3A 1RT6A 5LY3A 5M1NA 2I7PA 3VETA 4FWOA 4LF4K 4LF5K 3I33A 4WFAL 4DUZK 4W5TA 5GAEP 1JLAA 2WUSA 2QEXN 1HKGA 1TKTA 1G99A 1U4BA 1U2VB 1HJRA 2YKMA 4LFBK 3MDQA 4BE1A 4A5BA 3V1RA 4M7XA 3SUOA 1KFSA 4N47A 3T69A 2AA4A 4FCYA 4IEEA 1IV0A 4BRLA 2D0CA 3G6EN 3VENA 1WSJA 3QESA 1G15A 2JLEA 2DFEA 3TAQA 3EL2A 4KHNA 2YJFA 1NGGA 4OJRA 3MXIA 2KFZA 2QWMA 4C23A 4NCGA 3ZETB 1WBBA 1BGXT 1U6ZA 1KVCA 3QBXA 3FZKA 4PUOA 4C8LA 4BROA 1RT5A 1EP4A 4F4KA 5CHIA 1J6ZA 3S3NA 1K9MO 1X3MA 4PQUA 5HL7L 3HRGA 4FLWA 1BO5O 3VF4A 3VQBA 2Y1JA 4KH5A 5BPLA 4JHDA 2E1ZA 4JKBA 3ZT1A 3CF5L 1RDUA 1RDWX 4AF1A 1RTJA 3VERA 2W6KA 5AQRA 3SBTA 5AQIA 3TAFA 3B6PA 3WQTA 1HR0K 3CJBA 1T3VA 4BC4A 3HP9A 2X6SA 5AQWA 5BRFA 4NXMK 4GV3A 4BGBA 3VQ8A 3OYIA 4DU1A 3AAQA 4FWSA 4JI2K 1OKJA 2NLXA 3R6MA 2D0PA 1R59O 3AGKA 5CZ2A 4NO7A 2YHAA 2OZSA 1J9AA 2HNDA 1BISA 3CI5A 3RMCA 3O9QA 1VSMA 4RTFD 4B9NA 4FWRA 1DTTA 1I39A 2Z1JA 4AILC 1VK0A 5JVHL 4G1QA 4K8XA 1K6YA 4F2SA 3FFKB 5JMVA 2FBVA 2HVIA 4DWIA 2P9PA 3A5LC 2JGUA 1UA0A 3OYFA 4CEEA 5HRNA 3NH1A 4HTUA 3VQ7A 2E8AA 4FZXC 3LDPA 5AQPA 3VGKA 3AA5X 3G10A 1O13A 4CIEA 2WTUA 1NGJA 3NGZA 1K8KA 4YDUC 3TWHA 1X9MA 4DSFA 3B8AX 1NJXA 3HP6A 4WQ5A 1TKXA 4H0YB 3GE1A 5C2DA 4PKIA 4CFDA 4W5OA 3QNOA 1RDBA 2FLOA 3DLLL 3E9PA 1C1BA 5GIPA 4R5PA 2XHBA 3S41A 3ZT0A 1NJIO 3OHRA 4ISFA 3U8XA 3T3FA 1YTAA 1MWKA 2G8VA 3AVHA 4PKGA 3K5MA 2E88A 2P1JA 1HPZA 3WNEA 2P51A 3AVGA 3WXKA 4CEFA 3KWGA 3L2RA 2P9KA 3OY9A 3K9KA 4DF4A 4XIUA 3VA3A 3MN7A 3JSMA 4KHQA 2YNHA 1LOTB 4CCHA 4M63C 5AQFA 1TUUA 4JI4K 3PY8A 4CJPA 5AQTA 3AVFA 4KO0A 3THXA 4EHUA 3ZT3A 3M1FA 4I2QA 1GLBG 5C10A 3BF3A 4KV8A 2E2QA 1EWQA 5EY4A 4O8KA 2UXDK 5M1FA 2JWLA 3SBGA 4CJ5A 4EFHA 2P9SA 5AQOA 3TAEA 2KFNA 5C42A 1XUPO 4O44A 5FPDA 1WOQA 2DPNA 3OJUA 4DKWA 2WFBA 2F4VK 5HRRA 3DYAA 5FRMA 4JS5A 4MO4A 2P9LB 1R0AA 3TAPA 2KZZA 2HHUA 4AHVA 5GIOA 4HCCA 4GVEA 3VEWA 4NXNK 3KJVA 3JAMO 1VQPN 4E7HA 3AV9A 3MEGA 1YAGA 3NF7A 1GOBA 2FBYA 1RGIA 2HHSA 4C8OA 1JLQA 4EAHD 1ZYQA 1JLBA 4DQRA 1GLFO 5LMUK 1KCFA 3O3GA 2GV9A 3P31A 4LFAK 1Z26A 3DJCA 4BDZA 1RT2A 2WC9A 3WEEA 5TKYA 1KAZA 2O8EB 5HRSA 2QW9A 2Q36A 5TKWA 4YNQA 4CF9A 4FJKA 1SKRA 1QSLA 2WONA 3RR7A 4JEPA 3TI0A 3U6FA 3TANA 4CK2A 2GWJA 5HBMA 1NOZA 5AQGA 4B3RK 3ZSOA 5AQMA 3C7NA 3MXMA 1JCEA 4E3SA 1NGCA 1GOAA 4LY7A 2CGKA 3D2EB 2Q97A 4FW1A 4CGHA 3QINA 1HNZK 4IO9L 4XEIA 3OA9A 1L3VA 1HNXK 3CMAN 4FK0A 3D45A 1TVRA 2HSTA 3A5OC 1W2BM 4YY3K 4KKOA 1SKSA 2VG7A 3H45C 2VWKA 1U04A 1JLFA 4JNEA 5AQXA 4J8FA 2A3ZA 5BRDA 4DR7K 3QO9A 3J81O 1VSLA 3CC4N 1VSEA 3NCIA 2IVPA 1OH6A 1ESVA 4K42A 1S9GA 5FPNA 5C12A 5FROA 4CESA 3V6DA 5T7BA 1A5VA 4HWIA 2KQ2A 2HBJA 3V81A 3AO3A 3HO1A 4HVJA 4BVPA 4JD2A 4OVLA 4PL7A 3HPHA 4O8UA 4A59A 1DT9A 2FSNA 4IFVA 1JJ2M 1HJOA 3IDHA 4CJEA 4LFCK 5AQVA 4H5VA 4DTMA 4WFBL 3MX2A 1FXXA 3OYCA 3L8BA 2UXCK 2ZE2A 4O5FA 3ZSRA 1XHZA 2ITMA 1GLJO 3DXKA 4CZMA 1ITGA 1IH7A 3OYAA 2OPRA 3LAMA 4FWKA 4DR6K 2O8FA 3M8QA 1IJJA 4F3TA 2XO7A 4DV4K 2YKNA 4IOXA 4FLVA 2AJQA 4H0TB 3TABA 4M3ZA 4BRDA 2HNZA 1L3TA 1EETA 4JK7A 1BA0A 5AQUA 2HVHA 1X9WA 1VSDA 5C25A 1NJWA 1O1WA 5KTQA 4HHTA 3DXMA 3LANA 1RTIA 3MK6A 3QIOA 4X62K 4JKDA 2NZTA 3C6TA
chains in the Genus database with same CATH topology
1U45A 4CJWA 4FJIA 4N56A 4LH4A 1QSSA 4CF8A 3AVBA 2EX3A 4DTPA 5J2PA 5CYQA 3AVIA 4FJ9A 2PY5A 4CHYA 3ZSQA 2OA8A 4EP4A 2IS3A 4B08A 3H08A 3ZSYA 4KTQA 3KKRA 4FK4A 2DFHA 4ICLA 4DTRA 3CFPA 3AO1A 1HNVA 1TAUA 4YFUA 4CF2A 1IKXA 4KTZA 3KLGA 4FM0A 1I3AA 4DSLA 3OVNA 4KFBA 4KTWA 3SCXA 4OLBA 4E1NA 2GUIA 1EKEA 1XC9A 4CHPA 1L3SA 2W42A 3AO2A 1MU2A 3G0ZA 3VQAA 2DY4A 1S1TA 1JXBA 2RN2A 3DI6A 4Z0UA 1W9HA 3NGYA 4E7IA 2QKKA 2IC3A 1RT6A 3DLEA 4GW6A 4M41A 4DU3A 1RT3A 3LWLA 3NH0A 4CIGA 3NH2A 3SQ2A 1LWCA 4BDPA 4Z4FA 1KVAA 2Z1IA 1S1VA 4W5TA 1JLAA 5D3GA 3JYTA 3VA0A 4DFKA 4DMNA 4CHNA 3AVLA 1C0UA 1TKTA 2XY8A 1QS4A 4Y1DA 1U4BA 4LD0A 1ZBIA 1HJRA 3CYMA 4DTUA 2YKMA 1LAWA 2F8SA 2OPSA 3AA3A 2B4JA 4BE1A 2HHTA 4HUFA 3V9XA 1NOYA 3V1RA 1D5AA 3OYJA 3I0SA 4FYDA 4DQPA 3SUOA 1KFSA 4N47A 1JL2A 1ZBUA 2QXFA 1FK9A 2OZMA 3RRGA 4E19A 2D5RA 4HUGA 3NFAA 4FCYA 3RWUA 1U48A 4CFCA 3M8SA 1B92A 4M3WA 2IDOA 3CQ8A 2D0CA 4CJLA 1JLEA 1S1WA 1WSJA 1Q9YA 2KW4A 2YHBA 2DFFA 3OYHA 1G15A 3QESA 2JLEA 4J2BA 1TAQA 2DFEA 2NUBA 3TAQA 4N76A 4KHNA 3IS9A 4KHWA 3EY1A 4TSXA 4OJRA 3MXIA 3KLHA 2YNIA 4KI6A 4IG3A 4C8NA 1Q9XA 4CF1A 2KFZA 2VWJA 1Q8IA 4NYFA 3O4NA 4KI4A 4NCGA 3SPZA 1T7PA 2BGGA 2QK9A 1QQCA 1HNIA 1WAJA 2ETJA 1VSFA 1BGXT 1KVCA 1UWBA 3SQ0A 3DLBA 4LSNA 5J1EA 4KHSA 1VSIA 1WNSA 3OYNA 4CEZA 4PUOA 4C8LA 3KD5E 3ULDA 4KHUA 1HYVA 1RT5A 4OKKA 4JLHA 4DQQA 1EP4A 4UQGA 3P83D 1WSFA 3KLFA 4OKEA 4FW2A 4DU4A 4F4KA 1SL1A 4Q0BA 4M3XA 2YNGA 3OYBA 4BDYA 3VQCA 4DFMA 1TK0A 3KTQA 4AHRA 4FJLA 3L3UA 2HW3A 3HYFA 2R7YA 4B9UA 1DLOA 4MFBA 4CERA 4CIFA 5I42A 3LAKA 4AHTA 3S3NA 2EHGA 3THVA 4ELUA 4PWDA 1CXQA 3VQQA 4NCAA 4JRQA 5HROA 4PQUA 3LP0A 4BWJA 4OPKA 4BACA 4FLWA 4E7JA 4EP5A 3VQ9A 2X78A 4CJKA 3VQBA 4CEQA 5KRSA 2Y1JA 2ZQBA 2BE2A 4LH5A 4H4OA 3NHGA 1NKCA 1UA1A 3B6OA 3TAMA 4W5QA 3K5NA 1BCMA 5FDLA 1D9FA 4FJ5A 1A5XA 3OYGA 4FJHA 3ZT1A 1WN7A 1LV5A 2OPPA 1ASVA 3KK1A 1U49A 3LWMA 3RMBA 4F2RA 3ZCMA 1FKOA 1RTJA 3U3YA 3CFRA 1JL1A 1ZBFA 1NK9A 4C8KA 4AHCA 2WOMA 3RRHA 3TAFA 2G8KA 3B6PA 3MEDA 4FVMA 1REVA 2HHWA 3ZT4A 3LDSA 3HP9A 1XI1A 1JLCA 1HMVA 3UIQA 5C24A 1HYZA 2X6SA 3F73A 3RR8A 3S9HA 1BI4A 4DG1A 4FM1A 1UOCA 4O0JA 3ISNC 1NJZA 4Z4GA 3WNGA 3I8DA 3SUNA 3HVTA 2HHVA 4DQIA 1QE1A 1KRPA 3VQ8A 3OYIA 4DU1A 4CHQA 3QEIA 4GVMA 4Z4CA 4DTXA 1J5OA 4OLAA 4FK2A 4Y1CA 5CZ2A 2G8UA 1BIUA 2XY5A 2YHAA 2OZSA 2VG5A 1J9AA 2HNDA 4J2EA 1BISA 2E6LA 4DTJA 3C6UA 3KLEA 1TL1A 3RMCA 3HPOA 2FBXA 1VSMA 4B9NA 4CGGA 2G8HA 4EZ6A 1DTTA 1I39A 3DMJA 2Z1JA 4FLYA 1VK0A 4AILC 3AVNA 4FLUA 4E7KA 4G1QA 4ID5A 4K8XA 1K6YA 3DLGA 4OGEA 3T19A 1WLJA 3ZSXA 3S3MA 4F2SA 1DTQA 1BL3A 2FBVA 2KZMA 4C8MA 2HVIA 1HQUA 1ZBLA 4LSLA 3LALA 4FJJA 4DWIA 2OPQA 2RF2A 2JGUA 4CJSA 3RTVA 1EX4A 1UA0A 2ATQA 3OYFA 4CEEA 5HRNA 2B6AA 3NH1A 4HTUA 4M3RA 3VQ7A 1RILA 1SUQA 4FZXC 4M3YA 1GOCA 3AA5X 4F3OA 1C0TA 4GMJB 3G10A 4CHZA 1X1PA 3PX4A 2PYJA 4CIEA 4F8RA 1RT1A 3NGZA 4DSKA 2GBZA 2O4IA 3QEWA 3KIOA 4CGIA 4Q5VA 3LP1A 3TWHA 2YNFA 1X9MA 1RDCA 1TL3A 4OPJA 4FLXA 4DSFA 1NJXA 4RW8A 1IO2A 1ASWA 3HP6A 4ELVA 1NKBA 1TKXA 2DTUA 5FRNA 4I7FA 4CFDA 1RCHA 4CECA 4W5OA 1RDBA 3CM6A 1IKVA 3CG7A 3V9UA 3QNOA 4K8ZA 1S1UA 3V1OA 4J2DA 1BI4B 1C1BA 4ELTA 4QOZB 3PO5A 4R5PA 1B9DA 1KTQA 5DK5A 2XHBA 3QEVA 3QNNA 1HQEA 3OYKA 3KD1E 3P1GA 3NAEA 1NK5A 3ZT0A 3ASMA 3C94A 1YTAA 3T3FA 2G8VA 1C6VA 3AVHA 3K5MA 3HPGA 5HLFA 2P1JA 1HPZA 2IOCA 3I0RA 2ITGA 4PA1A 3TAGA 4FJNA 3WNEA 3OYDA 2P51A 1L3UA 3AVGA 4FLZA 4CEFA 3L2RA 4HUEA 3KK3A 2B5JA 3WNHA 1RT4A 3OY9A 1RTDA 4DF4A 4FJMA 4M3TA 3DLRA 3TR8A 4XIUA 3NGIA 4CFBA 3VA3A 1D8YA 5J2MA 4AHUA 3JSMA 1SL2A 3NF6A 1NK6A 4KHQA 3RMAA 3V9WA 1LWFA 4IDKA 2YNHA 4CCHA 3LP2A 4AHSA 5CYMA 1KLMA 1T05A 4E0DA 3MECA 1LWEA 4CFAA 3HJFA 2Z1GA 5KI6A 4CJPA 3PY8A 3NF8A 2O4GA 3AVFA 4KO0A 3OS0A 3SUQA 2VG6A 3DOLA 2KTQA 1SKWA 1XWLA 3ZT3A 4KREA 2HNYA 1TKZA 4I9LA 3OYEA 4DTSA 4KPYA 4IG0A 3VQ4A 2D0BA 3V1QA 3NF9A 4I2QA 4ID1A 4KB0A 3V4IA 4E1MA 4CJRA 1TGOA 1KVBA 1LW0A 5KGWA 4CEDA 4DFJA 4KV8A 1BQNA 4DQSA 3OYLA 1TK8A 5DMRA 2F96A 3L3VA 3SNNA 2XY7A 5CY4A 4Z4HA 2P5OA 4CF0A 1WSIA 4CJ5A 3AVJA 4M3UA 1IKYA 4O4GA 4CHOA 5SZTA 3TAEA 2KFNA 5C42A 1B9FA 4O44A 4IFYA 2BANA 4FJXA 3OJUA 4I9QA 5HRRA 3K58A 4O5BA 3DLKA 3DYAA 4DSIA 3SYZA 3U3GA 4JS5A 3SQ1A 5FRMA 1YTUA 1RBVA 1EXQA 1WAFA 1ZBHA 2E6MA 4QAGA 3VQ6A 3TAPA 1R0AA 2KZZA 3DRSA 4E89A 2RPIA 4DTNA 4N41A 3VQEA 3O3HA 4CE9A 1RDDA 2G8IA 2HHUA 1NJYA 4AHVA 3QEXA 4KAZA 4B9LA 4H4MA 3P5JA 5K14A 5J2NA 3VQ5A 2A1RA 4B9TA 4HCCA 4KRFA 3ALYA 3KJVA 4M42A 1KFDA 4CJ3A 1J53A 4E7HA 4IKFA 4L8RB 4RW6A 3AA2A 3AV9A 1WSHA 1RDAA 3DOKA 3MEGA 1SL0A 3NF7A 1GOBA 2X6NA 1RTHA 1S1XA 4DS4A 2FBYA 2HHSA 1Y97A 4JS4A 4C8OA 2HHQA 1JLQA 4NYNA 4CGFA 2RKIA 2Y1IA 1ZYQA 1JLBA 2IGIA 3AVAA 3QERA 1L5UA 1QTMA 5JS1A 2Q3SA 4DQRA 4B3OA 3OJSA 1KCFA 1JLGA 4IBNA 4N5SA 2P5GA 4J2AA 3K57A 3O3GA 2GV9A 3NE6A 1LW2A 3CFOA 4BE0A 3K2PA 1Z26A 4ZTJA 1CZBA 4BDZA 1RT2A 2G8WA 4B9MA 2HHXA 4CGJA 3HXMA 1JKHA 3LPTA 3HK2A 3AVMA 3SQ4A 2G8FA 4DF8A 2FBTA 3T1AA 3L2UA 2BDPA 4OGCA 4NCBA 4DLEA 5HRSA 4YNQA 3K59A 1XHXA 4CF9A 4FJKA 1RBTA 3AA4A 1TK5A 1SKRA 4CJVA 3MEEA 1QSLA 1CLQA 1HRHA 2WONA 1Z25A 4RG8A 4JRPA 1N5YA 4FZYA 3RR7A 3LP3A 1WSGA 3TI0A 4FJ7A 3U6FA 4CEOA 3KKSA 1VSKA 1T8EA 3ZSZA 3V9SA 5EU7A 3TANA 4CK2A 4WE1A 4W5RA 1X9SA 3CM5A 1W0HA 1NOZA 1RBRA 3DRPA 3KLIA 3O4QA 5HBMA 3ZSOA 3PX0A 3OYMA 4FZZA 3MXJA 2X74A 3MXMA 4E7LA 3HL8A 4CJFA 4CJTA 4FLTA 1J54A 4CEBA 3HT3A 1UAXA 4E3SA 3O3FA 1GOAA 2HMIA 1QHTA 4LY7A 5KGXA 1HYSA 4RW4A 4FW1A 4RW9A 4CGHA 3QINA 4FJGA 2I5JA 2D0AA 4FXDA 5SWMA 3QEPA 1KLNA 1TV6A 2HB5A 4DLGA 2PZSA 1L3VA 1YVUA 5KRTA 3D45A 1TVRA 1TKDA 4FK0A 3M8RA 1S6PA 2LSNA 1RBSA 2YV0X 4KKOA 1BHLA 2A1SA 2VG7A 2VWKA 3PUFA 4CJ4A 1U04A 1SKSA 1JLFA 1NK0A 4B8AB 3SV4A 5HRPA 3S3OA 5E41A 4KHYA 3QETA 3F9KA 1F21A 3QO9A 3SV3A 2FC0A 1VSLA 3IRXA 4Z4EA 5HP1A 1BQMA 4CJUA 1A5WA 4DFPA 4B8CA 1RT7A 3QLHA 3BGRA 4DS5A 1JXEA 1VSEA 3DM2A 3C95A 3OS1A 3NCIA 4CEAA 3PV8A 3AVCA 1NK8A 3BDPA 4AH9A 1U47A 3SJJA 1S9GA 4CK3A 1ASUA 2F8TA 1S9EA 5FROA 4OKJA 4CESA 3V6DA 3D0PA 1NKEA 1BIZA 3SUPA 5T7BA 1CXUA 1A5VA 2KQ2A 1BCOA 3M8PA 3HM9A 3V81A 3AO3A 3SPYA 4DSJA 3HO1A 4HVJA 4KB1A 3HSTB 3PX6A 3DLHA 3IG1A 4ZTFA 4H8KA 4CGDA 1VRUA 4OVLA 3L2VA 5I3UA 1NK4A 1IG9A 3HPHA 4B9SA 4FJ8A 3AO5A 3TARA 1RNHA 2ZD1A 1S6QA 1VSHA 1LAVA 4M45A 1IKWA 4HCBA 4IFVA 4B9VA 3VQDA 3SI6A 1QSYA 3K5OA 3L2WA 3WNFA 3QIPA 3IAYA 1YT3A 4ZHRA 4CJEA 1FKPA 4O55A 3MAQA 1CZ9A 3PO4A 4Z4IA 3RMDA 4DTMA 2IAJA 3LPUA 3SZ2A 1FXXA 1RBUA 3OYCA 3L2QA 4FM2A 3L8BA 1D9DA 3FFIA 2ZE2A 4DTOA 1SV5A 5JS2A 3ZSRA 1XHZA 2Z1HA 3ZT2A 3NDKA 3ZSVA 1ITGA 1IH7A 4BWMA 1N6QA 3OYAA 2OPRA 3LAMA 4PY5A 1C1CA 4RW7A 3E01A 1C1AA 3AO4A 3AVKA 3M8QA 3EZ5A 5J2QA 2XO7A 4F3TA 4CJQA 2XY6A 3LZIA 4MQ3A 3ITHA 1NK7A 1T03A 2YKNA 3DRRA 4FLVA 3EYZA 1C0MA 2AJQA 2XRIA 4I2PA 4DSEA 1WSEA 4W5NA 2QKBA 3TABA 4EZ9A 4M3ZA 4CK1A 4O0IA 5CZ1A 2HNZA 3V9ZA 1L3TA 1EETA 3ZSWA 2HVHA 3OS2A 1VSJA 1KSPA 1X9WA 1VSDA 3HVRA 3LZJA 5C25A 1NJWA 2PYLA 1O1WA 1VRTA 5KTQA 4HHTA 3VQPA 3K5LA 1S5JA 4QCLA 2E4LA 3LANA 1RTIA 3KK2A 3QIOA 4BE2A 2OYQA 3VN5A 3NBPA 3A2FA 3C6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U45 A;  4CJW A;  4FJI A;  4N56 A;  4LH4 A;  1QSS A;  4CF8 A;  3AVB A;  2EX3 A;  4DTP A;  5J2P A;  5CYQ A;  3AVI A;  4FJ9 A;  2PY5 A;  4CHY A;  3ZSQ A;  2OA8 A;  4EP4 A;  2IS3 A;  4B08 A;  3H08 A;  3ZSY A;  4KTQ A;  3KKR A;  4FK4 A;  2DFH A;  4ICL A;  4DTR A;  3CFP A;  3AO1 A;  1HNV A;  1TAU A;  4YFU A;  4CF2 A;  1IKX A;  4KTZ A;  3KLG A;  4FM0 A;  1I3A A;  4DSL A;  3OVN A;  4KFB A;  4KTW A;  3SCX A;  4OLB A;  4E1N A;  2GUI A;  1EKE A;  1XC9 A;  4CHP A;  1L3S A;  2W42 A;  3AO2 A;  1MU2 A;  3G0Z A;  3VQA A;  2DY4 A;  1S1T A;  1JXB A;  2RN2 A;  3DI6 A;  4Z0U A;  1W9H A;  3NGY A;  4E7I A;  2QKK A;  2IC3 A;  1RT6 A;  3DLE A;  4GW6 A;  4M41 A;  4DU3 A;  1RT3 A;  3LWL A;  3NH0 A;  4CIG A;  3NH2 A;  3SQ2 A;  1LWC A;  4BDP A;  4Z4F A;  1KVA A;  2Z1I A;  1S1V A;  4W5T A;  1JLA A;  5D3G A;  3JYT A;  3VA0 A;  4DFK A;  4DMN A;  4CHN A;  3AVL A;  1C0U A;  1TKT A;  2XY8 A;  1QS4 A;  4Y1D A;  1U4B A;  4LD0 A;  1ZBI A;  1HJR A;  3CYM A;  4DTU A;  2YKM A;  1LAW A;  2F8S A;  2OPS A;  3AA3 A;  2B4J A;  4BE1 A;  2HHT A;  4HUF A;  3V9X A;  1NOY A;  3V1R A;  1D5A A;  3OYJ A;  3I0S A;  4FYD A;  4DQP A;  3SUO A;  1KFS A;  4N47 A;  1JL2 A;  1ZBU A;  2QXF A;  1FK9 A;  2OZM A;  3RRG A;  4E19 A;  2D5R A;  4HUG A;  3NFA A;  4FCY A;  3RWU A;  1U48 A;  4CFC A;  3M8S A;  1B92 A;  4M3W A;  2IDO A;  3CQ8 A;  2D0C A;  4CJL A;  1JLE A;  1S1W A;  1WSJ A;  1Q9Y A;  2KW4 A;  2YHB A;  2DFF A;  3OYH A;  1G15 A;  3QES A;  2JLE A;  4J2B A;  1TAQ A;  2DFE A;  2NUB A;  3TAQ A;  4N76 A;  4KHN A;  3IS9 A;  4KHW A;  3EY1 A;  4TSX A;  4OJR A;  3MXI A;  3KLH A;  2YNI A;  4KI6 A;  4IG3 A;  4C8N A;  1Q9X A;  4CF1 A;  2KFZ A;  2VWJ A;  1Q8I A;  4NYF A;  3O4N A;  4KI4 A;  4NCG A;  3SPZ A;  1T7P A;  2BGG A;  2QK9 A;  1QQC A;  1HNI A;  1WAJ A;  2ETJ A;  1VSF A;  1BGX T;  1KVC A;  1UWB A;  3SQ0 A;  3DLB A;  4LSN A;  5J1E A;  4KHS A;  1VSI A;  1WNS A;  3OYN A;  4CEZ A;  4PUO A;  4C8L A;  3KD5 E;  3ULD A;  4KHU A;  1HYV A;  1RT5 A;  4OKK A;  4JLH A;  4DQQ A;  1EP4 A;  4UQG A;  3P83 D;  1WSF A;  3KLF A;  4OKE A;  4FW2 A;  4DU4 A;  4F4K A;  1SL1 A;  4Q0B A;  4M3X A;  2YNG A;  3OYB A;  4BDY A;  3VQC A;  4DFM A;  1TK0 A;  3KTQ A;  4AHR A;  4FJL A;  3L3U A;  2HW3 A;  3HYF A;  2R7Y A;  4B9U A;  1DLO A;  4MFB A;  4CER A;  4CIF A;  5I42 A;  3LAK A;  4AHT A;  3S3N A;  2EHG A;  3THV A;  4ELU A;  4PWD A;  1CXQ A;  3VQQ A;  4NCA A;  4JRQ A;  5HRO A;  4PQU A;  3LP0 A;  4BWJ A;  4OPK A;  4BAC A;  4FLW A;  4E7J A;  4EP5 A;  3VQ9 A;  2X78 A;  4CJK A;  3VQB A;  4CEQ A;  5KRS A;  2Y1J A;  2ZQB A;  2BE2 A;  4LH5 A;  4H4O A;  3NHG A;  1NKC A;  1UA1 A;  3B6O A;  3TAM A;  4W5Q A;  3K5N A;  1BCM A;  5FDL A;  1D9F A;  4FJ5 A;  1A5X A;  3OYG A;  4FJH A;  3ZT1 A;  1WN7 A;  1LV5 A;  2OPP A;  1ASV A;  3KK1 A;  1U49 A;  3LWM A;  3RMB A;  4F2R A;  3ZCM A;  1FKO A;  1RTJ A;  3U3Y A;  3CFR A;  1JL1 A;  1ZBF A;  1NK9 A;  4C8K A;  4AHC A;  2WOM A;  3RRH A;  3TAF A;  2G8K A;  3B6P A;  3MED A;  4FVM A;  1REV A;  2HHW A;  3ZT4 A;  3LDS A;  3HP9 A;  1XI1 A;  1JLC A;  1HMV A;  3UIQ A;  5C24 A;  1HYZ A;  2X6S A;  3F73 A;  3RR8 A;  3S9H A;  1BI4 A;  4DG1 A;  4FM1 A;  1UOC A;  4O0J A;  3ISN C;  1NJZ A;  4Z4G A;  3WNG A;  3I8D A;  3SUN A;  3HVT A;  2HHV A;  4DQI A;  1QE1 A;  1KRP A;  3VQ8 A;  3OYI A;  4DU1 A;  4CHQ A;  3QEI A;  4GVM A;  4Z4C A;  4DTX A;  1J5O A;  4OLA A;  4FK2 A;  4Y1C A;  5CZ2 A;  2G8U A;  1BIU A;  2XY5 A;  2YHA A;  2OZS A;  2VG5 A;  1J9A A;  2HND A;  4J2E A;  1BIS A;  2E6L A;  4DTJ A;  3C6U A;  3KLE A;  1TL1 A;  3RMC A;  3HPO A;  2FBX A;  1VSM A;  4B9N A;  4CGG A;  2G8H A;  4EZ6 A;  1DTT A;  1I39 A;  3DMJ A;  2Z1J A;  4FLY A;  1VK0 A;  4AIL C;  3AVN A;  4FLU A;  4E7K A;  4G1Q A;  4ID5 A;  4K8X A;  1K6Y A;  3DLG A;  4OGE A;  3T19 A;  1WLJ A;  3ZSX A;  3S3M A;  4F2S A;  1DTQ A;  1BL3 A;  2FBV A;  2KZM A;  4C8M A;  2HVI A;  1HQU A;  1ZBL A;  4LSL A;  3LAL A;  4FJJ A;  4DWI A;  2OPQ A;  2RF2 A;  2JGU A;  4CJS A;  3RTV A;  1EX4 A;  1UA0 A;  2ATQ A;  3OYF A;  4CEE A;  5HRN A;  2B6A A;  3NH1 A;  4HTU A;  4M3R A;  3VQ7 A;  1RIL A;  1SUQ A;  4FZX C;  4M3Y A;  1GOC A;  3AA5 X;  4F3O A;  1C0T A;  4GMJ B;  3G10 A;  4CHZ A;  1X1P A;  3PX4 A;  2PYJ A;  4CIE A;  4F8R A;  1RT1 A;  3NGZ A;  4DSK A;  2GBZ A;  2O4I A;  3QEW A;  3KIO A;  4CGI A;  4Q5V A;  3LP1 A;  3TWH A;  2YNF A;  1X9M A;  1RDC A;  1TL3 A;  4OPJ A;  4FLX A;  4DSF A;  1NJX A;  4RW8 A;  1IO2 A;  1ASW A;  3HP6 A;  4ELV A;  1NKB A;  1TKX A;  2DTU A;  5FRN A;  4I7F A;  4CFD A;  1RCH A;  4CEC A;  4W5O A;  1RDB A;  3CM6 A;  1IKV A;  3CG7 A;  3V9U A;  3QNO A;  4K8Z A;  1S1U A;  3V1O A;  4J2D A;  1BI4 B;  1C1B A;  4ELT A;  4QOZ B;  3PO5 A;  4R5P A;  1B9D A;  1KTQ A;  5DK5 A;  2XHB A;  3QEV A;  3QNN A;  1HQE A;  3OYK A;  3KD1 E;  3P1G A;  3NAE A;  1NK5 A;  3ZT0 A;  3ASM A;  3C94 A;  1YTA A;  3T3F A;  2G8V A;  1C6V A;  3AVH A;  3K5M A;  3HPG A;  5HLF A;  2P1J A;  1HPZ A;  2IOC A;  3I0R A;  2ITG A;  4PA1 A;  3TAG A;  4FJN A;  3WNE A;  3OYD A;  2P51 A;  1L3U A;  3AVG A;  4FLZ A;  4CEF A;  3L2R A;  4HUE A;  3KK3 A;  2B5J A;  3WNH A;  1RT4 A;  3OY9 A;  1RTD A;  4DF4 A;  4FJM A;  4M3T A;  3DLR A;  3TR8 A;  4XIU A;  3NGI A;  4CFB A;  3VA3 A;  1D8Y A;  5J2M A;  4AHU A;  3JSM A;  1SL2 A;  3NF6 A;  1NK6 A;  4KHQ A;  3RMA A;  3V9W A;  1LWF A;  4IDK A;  2YNH A;  4CCH A;  3LP2 A;  4AHS A;  5CYM A;  1KLM A;  1T05 A;  4E0D A;  3MEC A;  1LWE A;  4CFA A;  3HJF A;  2Z1G A;  5KI6 A;  4CJP A;  3PY8 A;  3NF8 A;  2O4G A;  3AVF A;  4KO0 A;  3OS0 A;  3SUQ A;  2VG6 A;  3DOL A;  2KTQ A;  1SKW A;  1XWL A;  3ZT3 A;  4KRE A;  2HNY A;  1TKZ A;  4I9L A;  3OYE A;  4DTS A;  4KPY A;  4IG0 A;  3VQ4 A;  2D0B A;  3V1Q A;  3NF9 A;  4I2Q A;  4ID1 A;  4KB0 A;  3V4I A;  4E1M A;  4CJR A;  1TGO A;  1KVB A;  1LW0 A;  5KGW A;  4CED A;  4DFJ A;  4KV8 A;  1BQN A;  4DQS A;  3OYL A;  1TK8 A;  5DMR A;  2F96 A;  3L3V A;  3SNN A;  2XY7 A;  5CY4 A;  4Z4H A;  2P5O A;  4CF0 A;  1WSI A;  4CJ5 A;  3AVJ A;  4M3U A;  1IKY A;  4O4G A;  4CHO A;  5SZT A;  3TAE A;  2KFN A;  5C42 A;  1B9F A;  4O44 A;  4IFY A;  2BAN A;  4FJX A;  3OJU A;  4I9Q A;  5HRR A;  3K58 A;  4O5B A;  3DLK A;  3DYA A;  4DSI A;  3SYZ A;  3U3G A;  4JS5 A;  3SQ1 A;  5FRM A;  1YTU A;  1RBV A;  1EXQ A;  1WAF A;  1ZBH A;  2E6M A;  4QAG A;  3VQ6 A;  3TAP A;  1R0A A;  2KZZ A;  3DRS A;  4E89 A;  2RPI A;  4DTN A;  4N41 A;  3VQE A;  3O3H A;  4CE9 A;  1RDD A;  2G8I A;  2HHU A;  1NJY A;  4AHV A;  3QEX A;  4KAZ A;  4B9L A;  4H4M A;  3P5J A;  5K14 A;  5J2N A;  3VQ5 A;  2A1R A;  4B9T A;  4HCC A;  4KRF A;  3ALY A;  3KJV A;  4M42 A;  1KFD A;  4CJ3 A;  1J53 A;  4E7H A;  4IKF A;  4L8R B;  4RW6 A;  3AA2 A;  3AV9 A;  1WSH A;  1RDA A;  3DOK A;  3MEG A;  1SL0 A;  3NF7 A;  1GOB A;  2X6N A;  1RTH A;  1S1X A;  4DS4 A;  2FBY A;  2HHS A;  1Y97 A;  4JS4 A;  4C8O A;  2HHQ A;  1JLQ A;  4NYN A;  4CGF A;  2RKI A;  2Y1I A;  1ZYQ A;  1JLB A;  2IGI A;  3AVA A;  3QER A;  1L5U A;  1QTM A;  5JS1 A;  2Q3S A;  4DQR A;  4B3O A;  3OJS A;  1KCF A;  1JLG A;  4IBN A;  4N5S A;  2P5G A;  4J2A A;  3K57 A;  3O3G A;  2GV9 A;  3NE6 A;  1LW2 A;  3CFO A;  4BE0 A;  3K2P A;  1Z26 A;  4ZTJ A;  1CZB A;  4BDZ A;  1RT2 A;  2G8W A;  4B9M A;  2HHX A;  4CGJ A;  3HXM A;  1JKH A;  3LPT A;  3HK2 A;  3AVM A;  3SQ4 A;  2G8F A;  4DF8 A;  2FBT A;  3T1A A;  3L2U A;  2BDP A;  4OGC A;  4NCB A;  4DLE A;  5HRS A;  4YNQ A;  3K59 A;  1XHX A;  4CF9 A;  4FJK A;  1RBT A;  3AA4 A;  1TK5 A;  1SKR A;  4CJV A;  3MEE A;  1QSL A;  1CLQ A;  1HRH A;  2WON A;  1Z25 A;  4RG8 A;  4JRP A;  1N5Y A;  4FZY A;  3RR7 A;  3LP3 A;  1WSG A;  3TI0 A;  4FJ7 A;  3U6F A;  4CEO A;  3KKS A;  1VSK A;  1T8E A;  3ZSZ A;  3V9S A;  5EU7 A;  3TAN A;  4CK2 A;  4WE1 A;  4W5R A;  1X9S A;  3CM5 A;  1W0H A;  1NOZ A;  1RBR A;  3DRP A;  3KLI A;  3O4Q A;  5HBM A;  3ZSO A;  3PX0 A;  3OYM A;  4FZZ A;  3MXJ A;  2X74 A;  3MXM A;  4E7L A;  3HL8 A;  4CJF A;  4CJT A;  4FLT A;  1J54 A;  4CEB A;  3HT3 A;  1UAX A;  4E3S A;  3O3F A;  1GOA A;  2HMI A;  1QHT A;  4LY7 A;  5KGX A;  1HYS A;  4RW4 A;  4FW1 A;  4RW9 A;  4CGH A;  3QIN A;  4FJG A;  2I5J A;  2D0A A;  4FXD A;  5SWM A;  3QEP A;  1KLN A;  1TV6 A;  2HB5 A;  4DLG A;  2PZS A;  1L3V A;  1YVU A;  5KRT A;  3D45 A;  1TVR A;  1TKD A;  4FK0 A;  3M8R A;  1S6P A;  2LSN A;  1RBS A;  2YV0 X;  4KKO A;  1BHL A;  2A1S A;  2VG7 A;  2VWK A;  3PUF A;  4CJ4 A;  1U04 A;  1SKS A;  1JLF A;  1NK0 A;  4B8A B;  3SV4 A;  5HRP A;  3S3O A;  5E41 A;  4KHY A;  3QET A;  3F9K A;  1F21 A;  3QO9 A;  3SV3 A;  2FC0 A;  1VSL A;  3IRX A;  4Z4E A;  5HP1 A;  1BQM A;  4CJU A;  1A5W A;  4DFP A;  4B8C A;  1RT7 A;  3QLH A;  3BGR A;  4DS5 A;  1JXE A;  1VSE A;  3DM2 A;  3C95 A;  3OS1 A;  3NCI A;  4CEA A;  3PV8 A;  3AVC A;  1NK8 A;  3BDP A;  4AH9 A;  1U47 A;  3SJJ A;  1S9G A;  4CK3 A;  1ASU A;  2F8T A;  1S9E A;  5FRO A;  4OKJ A;  4CES A;  3V6D A;  3D0P A;  1NKE A;  1BIZ A;  3SUP A;  5T7B A;  1CXU A;  1A5V A;  2KQ2 A;  1BCO A;  3M8P A;  3HM9 A;  3V81 A;  3AO3 A;  3SPY A;  4DSJ A;  3HO1 A;  4HVJ A;  4KB1 A;  3HST B;  3PX6 A;  3DLH A;  3IG1 A;  4ZTF A;  4H8K A;  4CGD A;  1VRU A;  4OVL A;  3L2V A;  5I3U A;  1NK4 A;  1IG9 A;  3HPH A;  4B9S A;  4FJ8 A;  3AO5 A;  3TAR A;  1RNH A;  2ZD1 A;  1S6Q A;  1VSH A;  1LAV A;  4M45 A;  1IKW A;  4HCB A;  4IFV A;  4B9V A;  3VQD A;  3SI6 A;  1QSY A;  3K5O A;  3L2W A;  3WNF A;  3QIP A;  3IAY A;  1YT3 A;  4ZHR A;  4CJE A;  1FKP A;  4O55 A;  3MAQ A;  1CZ9 A;  3PO4 A;  4Z4I A;  3RMD A;  4DTM A;  2IAJ A;  3LPU A;  3SZ2 A;  1FXX A;  1RBU A;  3OYC A;  3L2Q A;  4FM2 A;  3L8B A;  1D9D A;  3FFI A;  2ZE2 A;  4DTO A;  1SV5 A;  5JS2 A;  3ZSR A;  1XHZ A;  2Z1H A;  3ZT2 A;  3NDK A;  3ZSV A;  1ITG A;  1IH7 A;  4BWM A;  1N6Q A;  3OYA A;  2OPR A;  3LAM A;  4PY5 A;  1C1C A;  4RW7 A;  3E01 A;  1C1A A;  3AO4 A;  3AVK A;  3M8Q A;  3EZ5 A;  5J2Q A;  2XO7 A;  4F3T A;  4CJQ A;  2XY6 A;  3LZI A;  4MQ3 A;  3ITH A;  1NK7 A;  1T03 A;  2YKN A;  3DRR A;  4FLV A;  3EYZ A;  1C0M A;  2AJQ A;  2XRI A;  4I2P A;  4DSE A;  1WSE A;  4W5N A;  2QKB A;  3TAB A;  4EZ9 A;  4M3Z A;  4CK1 A;  4O0I A;  5CZ1 A;  2HNZ A;  3V9Z A;  1L3T A;  1EET A;  3ZSW A;  2HVH A;  3OS2 A;  1VSJ A;  1KSP A;  1X9W A;  1VSD A;  3HVR A;  3LZJ A;  5C25 A;  1NJW A;  2PYL A;  1O1W A;  1VRT A;  5KTQ A;  4HHT A;  3VQP A;  3K5L A;  1S5J A;  4QCL A;  2E4L A;  3LAN A;  1RTI A;  3KK2 A;  3QIO A;  4BE2 A;  2OYQ A;  3VN5 A;  3NBP A;  3A2F A;  3C6T A; 
#chains in the Genus database with same CATH topology
 1TYQ A;  4N56 A;  3D2F A;  3ZSQ A;  3CJ7 A;  1OH7 A;  3H08 A;  4BC3 A;  1Z6R A;  3AO1 A;  1HNV A;  1TAU A;  4YFU A;  3KLG A;  4KTZ A;  4FM0 A;  4DSL A;  3OVN A;  4KTW A;  4E1N A;  2GUI A;  1EKE A;  2GTD A;  1MU2 A;  2A41 A;  1JXB A;  4E7I A;  3NGY A;  1ATR A;  4M41 A;  3PIO L;  3TU5 A;  3SQ2 A;  3NH0 A;  5M1K A;  2AP1 A;  3ENO A;  4Z4F A;  5D3G A;  3VA0 A;  4OPH A;  4DMN A;  4CHN A;  3GG4 A;  2XY8 A;  4Y1D A;  4LD0 A;  4H0O A;  1P8Z A;  5B8H A;  2OPS A;  3VTH A;  2B4J A;  1YHQ N;  1GLE G;  5E84 A;  3H1V X;  3V9X A;  2QXF A;  3RRG A;  4E19 A;  4PHT X;  1FW6 A;  5LMN K;  4JI5 K;  4HUG A;  4CFC A;  4M3W A;  4CJL A;  1JLE A;  3MWT A;  3MN6 A;  2UUC K;  3CC2 N;  4TSX A;  4QS8 A;  4K0K K;  2YNI A;  3EN9 A;  2VWJ A;  3O4N A;  2FXU A;  4QS9 A;  4KI4 A;  3O6W A;  3KWI A;  4H0V B;  4BRH A;  1QQC A;  1HNI A;  1VSF A;  1UWB A;  3DLB A;  4IDH A;  4YDU A;  1IBL K;  3OYN A;  4KHU A;  3O9S A;  3O9R A;  4JLH A;  3P83 D;  4ILJ A;  4FW2 A;  2NRV A;  3R3L A;  1SL1 A;  3OYB A;  4BDY A;  4A2B A;  3KTQ A;  3L3U A;  3ZLJ A;  3PSI A;  2HW3 A;  4B9U A;  4MFB A;  3CPW M;  4CIF A;  4PWD A;  3M5R A;  4AHT A;  3O9T A;  4NCA A;  2FF6 A;  4JRQ A;  2O8C B;  4BWJ A;  5BR8 K;  5DM7 L;  1ATN A;  4FL9 A;  4NLB A;  3CCM N;  3J7A P;  3SAG A;  2BE2 A;  4LH5 A;  3H6E A;  4JI0 K;  4H4O A;  3NHG A;  1NKC A;  4JK9 A;  1BCM A;  1D9F A;  1Q18 A;  2O8B B;  1ASV A;  1KC8 O;  3RMB A;  3ZCM A;  2NRX A;  1ZBS A;  3ZYY X;  4XH4 A;  4GKK K;  3UKU A;  3U3Y A;  1OVQ A;  1ZBF A;  3OTO K;  4AHC A;  4BC2 A;  3TPQ A;  3PLA A;  3EE8 A;  3MED A;  1V4S A;  4FVM A;  3J8A A;  2HHW A;  3W3D A;  4GKJ K;  3F73 A;  1HYZ A;  1YF5 L;  1BI4 A;  4DG1 A;  4OX9 K;  2E2N A;  4FWN A;  3WNG A;  3I8D A;  4MDB A;  3SUN A;  1QE1 A;  3O08 A;  3ULE A;  1KRP A;  2P9K B;  4CHQ A;  3QEI A;  4DTX A;  4H0P A;  4OLA A;  4EIA A;  4DV2 K;  4DTJ A;  3C6U A;  2A5X A;  3HPO A;  4FWP A;  4H03 B;  4U67 L;  5H1S Q;  3VGL A;  1YI2 N;  4FLY A;  1GLD G;  4ID5 A;  5M1O A;  3P38 A;  1DTQ A;  1BL3 A;  1CZA N;  2KZM A;  4FJJ A;  5F0X A;  4CJS A;  1YJW N;  1EX4 A;  4A5A A;  2RE2 A;  5AZI A;  3E9O A;  1RIL A;  1NGD A;  4CJ7 A;  1C0T A;  3PX4 A;  4FO0 A;  1RT1 A;  2O4I A;  2YNF A;  3MN9 A;  1Q86 O;  4BGA A;  4FLX A;  1IO2 A;  1ASW A;  2DTU A;  1DEJ A;  4I7F A;  3WXL A;  1IKV A;  3CG7 A;  4J2D A;  1S1U A;  3CCQ N;  3HZ6 A;  2F9T A;  4JKG A;  5EOY A;  1KTQ A;  3QNN A;  2E20 A;  3P1G A;  3NAE A;  1EO1 A;  2QWP A;  4DV7 K;  3IFR A;  3ASM A;  3KZB A;  3HPG A;  4B9Q A;  1SAZ A;  3CER A;  1NLV A;  4FWL A;  4BRE A;  3TAG A;  2E1Y A;  4FLZ A;  4HUE A;  3EKU A;  2B5J A;  1RTD A;  1RT4 A;  4FJM A;  3F5T A;  3AY9 A;  4CFB A;  1NK6 A;  1NGH A;  3O9U A;  3RMA A;  4IDK A;  5CYM A;  4Y0W A;  4E0D A;  3MEC A;  1LWE A;  3NVM A;  4CFA A;  3HJF A;  2Z1G A;  2ZGY A;  1Z05 A;  5KI6 A;  4LF7 K;  3QDK A;  3NF8 A;  1T44 A;  2CGL A;  2KTQ A;  1SKW A;  1XWL A;  2P9N B;  5KQ8 A;  2HNY A;  1H1V A;  1EQY A;  3OYE A;  3VQ4 A;  3GOI A;  4ID1 A;  3ATU A;  1TGO A;  3O80 A;  5KGW A;  1LW0 A;  4YOR A;  3MCA B;  3OYL A;  1NGA A;  1TK8 A;  2P5O A;  4IZ9 A;  3A0I X;  5CY4 A;  2O8D B;  4CF0 A;  5F1X A;  4O4G A;  5SZT A;  2QI2 A;  3VF6 A;  4FJX A;  4DR3 K;  3NVK A;  1JCG A;  3H3N O;  4O5B A;  3U3G A;  4K41 A;  4C1N K;  3IMX A;  1EXQ A;  1ZBH A;  4QAG A;  2RPI A;  4WCE L;  3IUC A;  3O3H A;  1V4T A;  4JI1 K;  2G8I A;  3QEX A;  4KAZ A;  4B9L A;  4H4M A;  4BVO A;  3VQ5 A;  2A1R A;  4KRF A;  1LCU A;  4DCH A;  3A8Y A;  3FLC O;  1QQN A;  4KBO A;  3AA2 A;  3N4Q A;  2W41 A;  3JXU A;  1Y97 A;  1GLA G;  4NYN A;  1QTM A;  2IGI A;  3QER A;  3AVA A;  5CE3 A;  2NRH A;  2Q3S A;  4B3O A;  3JS6 A;  3OJS A;  4IBN A;  4J2A A;  1LW2 A;  1C0G A;  4ZTJ A;  2G8W A;  2HHX A;  3M3Z A;  3HXM A;  2ZJP L;  1JKH A;  3I8B A;  4BRA A;  3HK2 A;  2A40 A;  3TTD A;  4NCB A;  5AZJ A;  5GAH P;  3K59 A;  1XHX A;  1IBK K;  3CJ1 A;  4AM6 A;  4BG8 A;  4CJV A;  3J80 O;  4RG8 A;  1N5Y A;  2VYP A;  4BRI A;  3H1Q A;  1WSG A;  4ILH A;  4BRQ A;  4BR2 A;  1W97 L;  3BEX A;  3T7Z A;  3ZSZ A;  4OPA A;  3RSE B;  3SJH A;  4W5R A;  1RBR A;  3O4Q A;  3OYM A;  3FZH A;  3MXJ A;  4E7L A;  4FLT A;  3O3F A;  4ISE A;  4FJG A;  3F2K A;  5SWM A;  3CCS N;  1TV6 A;  1YVU A;  3M8R A;  2YCH A;  1T7P A;  3U9Z A;  2A1S A;  3MWP A;  3PUF A;  4CJ4 A;  5BPN A;  5BR9 A;  1NK0 A;  3CJC A;  3SV4 A;  2QWR A;  5HRP A;  1Q81 O;  3DXM B;  1Y64 A;  4B1V A;  2E5L K;  3QET A;  2ZM6 K;  3A5M C;  2HBK A;  3PIP L;  3N4P A;  4CJU A;  5HP1 A;  1A5W A;  1RT7 A;  3QLH A;  2XY6 A;  4KB0 A;  5EVZ A;  3C95 A;  3BDP A;  3AVC A;  4CK3 A;  1ASU A;  2F8T A;  4BY9 C;  1E3M A;  1QVF M;  3D0P A;  3SUP A;  1X9J A;  4CBX A;  1CXU A;  2GWK A;  4E1J A;  2KLA A;  3M8P A;  3HM9 A;  4LF9 K;  4KB1 A;  4U7B A;  3E9L A;  1E4F T;  4ZTF A;  1BDG A;  4CGD A;  2P9I B;  3L2V A;  1IG9 A;  4FJ8 A;  1MA9 B;  4BRF A;  2FSJ A;  1VSH A;  1S6Q A;  2ZD1 A;  4M45 A;  1BU6 O;  5AJ3 K;  4YOW A;  4BG9 A;  1T6D A;  3VQD A;  3THY A;  3L2W A;  4JKF A;  2F9W A;  3WNF A;  4I6M A;  1YT3 A;  4IEI A;  4V19 S;  1FKP A;  4O55 A;  2ZWH A;  4WFN L;  1VHX A;  3VTI A;  3SZ2 A;  3L2Q A;  4FM2 A;  3FFI A;  1SV5 A;  3MX5 A;  5JS2 A;  3ZT2 A;  4JI7 K;  2P9U B;  1QQO A;  1S22 A;  2FF3 B;  1RFQ A;  3CD6 N;  3E01 A;  3AO4 A;  1GLL O;  5J2Q A;  1QQM A;  1VQ7 N;  3DRR A;  4YOT A;  4DUY K;  1U2V A;  4DHY A;  4W5N A;  1NG9 A;  4EZ9 A;  2BUP A;  4O0I A;  1VQ5 N;  3V9Z A;  2PBD A;  3QB0 A;  4CZG A;  1HX1 A;  4FSV A;  3W0L A;  3VQP A;  1S5J A;  2QWQ A;  4BE2 A;  3KK2 A;  1ZC6 A;  3TR8 A;  2ZF5 O;  4CJW A;  4FJI A;  1QSS A;  4JI3 K;  2EX3 A;  4DTP A;  1Q7Y O;  4FJ9 A;  1VQ8 N;  1VAZ A;  4OO1 J;  4LF8 K;  1T6C A;  2DFH A;  3HSC A;  4ICL A;  3L4I A;  3CFP A;  2OTL N;  3ZET A;  4DR5 K;  1N8R O;  4CF2 A;  1IKX A;  4OLB A;  1TUY A;  1NGF A;  3OBW A;  2I7N A;  4CHP A;  2DY4 A;  5EXW A;  3VQA A;  5AQJ A;  3DI6 A;  4Z0U A;  3DLE A;  4DU3 A;  1RT3 A;  3LWL A;  4BDP A;  1S1V A;  3JYT A;  4DFK A;  3AVL A;  3UE5 A;  1C0U A;  5E26 A;  2QA4 N;  3Q7C A;  1ZBI A;  3CYM A;  1VQK N;  5C2F A;  4A57 A;  1D4X A;  4HUF A;  4K43 A;  3OYJ A;  4FYD A;  4R79 A;  3UKU B;  5FPE A;  1JL2 A;  3WUH A;  1IBM K;  1FK9 A;  2OZM A;  3P4I A;  2D5R A;  3NFA A;  3BF1 A;  3O5B A;  2KKZ A;  3C0B A;  3M8S A;  2IDO A;  3CQ8 A;  2KW4 A;  2YHB A;  2DFF A;  4J2B A;  3GBT A;  1TAQ A;  2NUB A;  3DWL A;  3T1Y K;  3EY1 A;  3SAH A;  1Q9X A;  4CF1 A;  1Q8I A;  5KQD A;  3CC7 N;  2BGG A;  5AQY A;  3THW A;  1WAJ A;  2HF4 A;  3HOT A;  4BR4 A;  1HYV A;  4OKK A;  3FZL A;  4DQQ A;  1WSF A;  3KLF A;  1SZ2 A;  3CJ9 A;  1BG3 A;  3UKR B;  1W7A A;  4Q0B A;  4M3X A;  2YNG A;  3VQC A;  1TK0 A;  2QWO A;  4FJL A;  4AHR A;  3PSF A;  3HYF A;  2R7Y A;  1BA1 A;  3BZC A;  1DLO A;  4CER A;  5I42 A;  4KI6 A;  3LAK A;  3THV A;  4ELU A;  1CXQ A;  1SQK A;  5AZI B;  3U9D A;  5HRO A;  3LP0 A;  4BAC A;  4E7J A;  1NMD A;  4EP5 A;  5KRS A;  4AQY K;  3J7Y P;  4FWM A;  5AQS A;  1UA1 A;  3B6O A;  3TAM A;  3VES A;  3K5N A;  4FJ5 A;  1HLU A;  3FZM A;  3OYG A;  3VPZ A;  4FJH A;  2OPP A;  3FZF A;  3KK1 A;  1MDU B;  4BRK A;  1U49 A;  3LWM A;  4F2R A;  4DR2 K;  1HPM A;  3CHW A;  1JL1 A;  4DR1 K;  1NK9 A;  4JI6 K;  4UY8 O;  2G8K A;  4DV6 K;  1MWM A;  3VOV A;  3ZT4 A;  1JLC A;  3UIQ A;  4FM1 A;  1UOC A;  4O0J A;  3CME N;  3ISN C;  1NJZ A;  3HVT A;  3VF2 A;  4DQI A;  3E1Y A;  3D6R A;  2G8U A;  4WQ4 A;  1BIU A;  3VMF B;  4IO8 A;  2VG5 A;  4B3T K;  4J2E A;  2E6L A;  2ZGZ A;  2YJE A;  4CGG A;  2G8H A;  3DMJ A;  3AVN A;  4FLU A;  4E7K A;  2QXL A;  3DLG A;  1NGE A;  4OGE A;  3T19 A;  3S3M A;  4C8M A;  1HQU A;  1ZBL A;  4LSL A;  4CVN E;  3RTV A;  4JHD B;  4CBW A;  2A42 A;  3WXI A;  1XNQ K;  4F3O A;  4CHZ A;  2VGM A;  2PYJ A;  4B1U B;  4BRP A;  2GBZ A;  2D1K A;  2OAN A;  3QEW A;  4CGI A;  3LP1 A;  3I55 N;  4ILG B;  4OPJ A;  4ELV A;  4RW8 A;  1NKB A;  5FRN A;  1DGK N;  1RCH A;  3CM6 A;  3V1O A;  3MN5 A;  2GX9 A;  2JWK A;  5DK5 A;  5M1P A;  4GY2 B;  1HQE A;  5GIN A;  3KD1 E;  2IIR A;  4KH6 A;  3T1H K;  1FJG K;  5HLF A;  3KHY A;  2IOC A;  2ITG A;  3CPE A;  1ATS A;  3OYD A;  3QFP A;  1L3U A;  3CJA A;  5KPR A;  3KK3 A;  4M3T A;  3DLR A;  2E2O A;  1SL2 A;  4YHH K;  3V9W A;  3ZX0 A;  3LP2 A;  4AHS A;  1T05 A;  2EWS A;  1K8A O;  2P9P B;  2O4G A;  3VEV A;  3SUQ A;  3OS0 A;  1WBD A;  2J4R A;  1TKZ A;  4I9L A;  5MLC Q;  4DTS A;  2Q2R A;  4KPY A;  3V1Q A;  3VGM A;  4BRC A;  5AFU A;  4MDA A;  3TSU A;  3V4I A;  3L0Q A;  2RHK A;  2O8E A;  4CJR A;  2HHH K;  1KVB A;  4CED A;  4DFJ A;  1BQN A;  2NRR A;  3CCU N;  1K8K B;  1OH8 A;  3SNN A;  2F96 A;  3L3V A;  4IOA L;  4Z4H A;  2VQF K;  1WSI A;  3AVJ A;  4M3U A;  4JKH A;  3ATV A;  5JIC A;  1B9F A;  2BAN A;  3EE9 A;  3K58 A;  3DLK A;  4DSI A;  3SYZ A;  3SQ1 A;  5BN8 A;  1YTU A;  3VEO A;  3K0S A;  4M7Y A;  3ID6 A;  1WAF A;  2NRZ A;  3VQ6 A;  3CXC M;  2HBL A;  3DRS A;  4E89 A;  4DTN A;  4N41 A;  3D2E A;  4B3M K;  1RDD A;  3R9P A;  1NJY A;  4Z94 A;  5J2N A;  3LDL A;  4BR9 A;  3ALY A;  1VQ4 N;  1KFD A;  1J53 A;  4IKF A;  4MLH A;  4RW6 A;  3R1X A;  4XH1 A;  1WSH A;  1YUW A;  3DOK A;  3QIC A;  2X6N A;  1RTH A;  3BZK A;  1QVG M;  4FPB A;  4CGF A;  2RKI A;  5JS1 A;  1L5U A;  3Q7B A;  3THX B;  3NE6 A;  4BE0 A;  3K2P A;  4B9M A;  3LPT A;  3AVM A;  5F2R A;  3T1A A;  3L2U A;  1N33 K;  2QM1 A;  4DLE A;  4BQL A;  3THY B;  3EO3 A;  3AGR A;  1RBT A;  2V7Z A;  1Z25 A;  3CET A;  3LP3 A;  4FJ7 A;  1T8E A;  1VSK A;  2P9S B;  5AQH A;  5EU7 A;  5IWA K;  1X9S A;  3CM5 A;  3KLI A;  3DRP A;  4FZZ A;  2UYT A;  2X74 A;  4CJF A;  5JLH A;  2HBM A;  1UAX A;  2YHX A;  3BY5 A;  4H5N A;  5LJV A;  5KGX A;  2HMI A;  2ASM A;  4RW4 A;  1J5E K;  3HM8 A;  2F7T A;  2UUA K;  2I5J A;  4FXD A;  3QEP A;  2HB5 A;  4DLG A;  2PZS A;  4JAX A;  1TKD A;  3O4W A;  5AFU H;  2LSN A;  2YV0 X;  2VCP A;  1BHL A;  2BH1 A;  5GAD P;  3L6Q A;  4PKH A;  5E41 A;  2ASO A;  3F9K A;  1F21 A;  3SV3 A;  1P90 A;  2FC0 A;  3HOS A;  3IRX A;  4Z4E A;  4DFP A;  4B8C A;  3BGR A;  3PV8 A;  1NK8 A;  3DM2 A;  3QML A;  4AH9 A;  4CD3 A;  1U47 A;  3SJJ A;  3EEQ A;  3ID8 A;  5JLF A;  4OKJ A;  1S3X A;  1NKE A;  3WEE B;  1BIZ A;  3ENB A;  1BCO A;  4IXC A;  2CGJ A;  1NWK A;  3HST B;  3PX6 A;  3O1W A;  1BWF O;  3DLH A;  2GEM A;  4H8K A;  1VRU A;  5AQK A;  1NK4 A;  5I3U A;  5KPZ A;  1LAV A;  4HCB A;  4B9V A;  1M1K O;  4JYA K;  3H46 O;  3MAQ A;  4ZHR A;  3PO4 A;  1ILY A;  4Z4I A;  3TTF A;  2CH6 A;  2IAJ A;  4WQ4 C;  1RBU A;  3C7N B;  4MLE A;  1N34 K;  3IKM A;  4ISG A;  1YJ9 N;  4PY5 A;  1C1C A;  3EZ5 A;  1C1A A;  1Q82 O;  4CJQ A;  3EYZ A;  2XRI A;  4DSE A;  2PAV A;  5CZ1 A;  3EZW A;  3ZSW A;  3BUZ B;  1VSJ A;  3D7E O;  2GUP A;  3WXJ A;  1KSP A;  3HVR A;  2V52 B;  4DV1 K;  1NBW A;  1VRT A;  1NGB A;  2E4L A;  2OYQ A;  2QTD A;  5AQZ A;  3NBP A;  4FVU A;  4A61 A;  1EWR A;  1U45 A;  1VQO N;  4CF8 A;  4CZJ A;  3THW B;  4JD2 B;  3AVI A;  4GV6 A;  2PY5 A;  4CHY A;  4B1Z A;  4DV3 K;  4EP4 A;  2IS3 A;  5LJW A;  3KKR A;  3KVG A;  3K9J A;  4FK4 A;  4FPA A;  1KD1 O;  3C6A A;  1I3A A;  3SCX A;  5AR0 A;  1YXQ A;  1HNW K;  1L3S A;  3AO2 A;  3MCP A;  2RN2 A;  1M90 O;  3DAW A;  3DXK B;  3ZEU A;  3SMP A;  4GW6 A;  2O8F B;  5JVG L;  3HTV A;  3NH2 A;  4CIG A;  1LWC A;  1KVA A;  2Z1I A;  4CZI A;  5KPT A;  2O8C A;  4X66 K;  1QS4 A;  4DTU A;  1LAW A;  3MMV A;  2F8S A;  3AA3 A;  4JKA A;  2HHT A;  4BR0 A;  4X65 K;  3LDN A;  1D5A A;  3H3O B;  3I0S A;  4DV0 K;  1XNR K;  4DQP A;  1ZBU A;  4YOX A;  2O8B A;  1S72 N;  3RWU A;  1SS6 A;  3LM9 A;  3SMS A;  1U48 A;  4JV5 K;  1B92 A;  1TYQ B;  1Q9Y A;  1S1W A;  2W40 A;  3D2F B;  3OYH A;  3GL1 A;  1E4G T;  3M6G A;  4N76 A;  4KHW A;  3IS9 A;  1HKC A;  1VQ6 N;  3KLH A;  4IG3 A;  4C8N A;  1C0F A;  3TSP A;  4NYF A;  4CZK A;  2GEL A;  3SPZ A;  2QK9 A;  2ETJ A;  3SQ0 A;  4LSN A;  5J1E A;  4KHS A;  1VSI A;  1NNE A;  4YOY A;  1WNS A;  4CEZ A;  3KD5 E;  3ULD A;  3U4L A;  4UQG A;  3LL3 A;  4DU4 A;  4OKE A;  4DFM A;  1NU0 A;  2V51 B;  3CCE N;  2WBN A;  3LM2 A;  2EHG A;  2QWL A;  3CCV N;  4CZF A;  3VQQ A;  4XH5 A;  4OPK A;  4B1X B;  3TSQ A;  3SK3 A;  3C6H A;  2X78 A;  3VQ9 A;  3EKS A;  4CJK A;  4CEQ A;  3WXM B;  2ZQB A;  1VQL N;  5DM6 L;  5ADX A;  2PFU A;  4CW7 B;  4W5Q A;  4BRN A;  5FDL A;  1A5X A;  3HBT A;  1XQS C;  5I9E B;  1WN7 A;  1LV5 A;  4X64 K;  2D0O A;  3CIP A;  4FOE A;  1X3N A;  1FKO A;  1N36 K;  3CFR A;  1QHA A;  4C8K A;  2WOM A;  4C1N I;  3VEX A;  3RRH A;  1XMQ K;  3WQU A;  3TTC A;  1REV A;  4CD1 A;  5AQQ A;  3LDS A;  1XI1 A;  4IOC L;  1HMV A;  5C24 A;  3RR8 A;  2IVN A;  3S9H A;  1JCF A;  1NM1 A;  4Z4G A;  2HHV A;  3A5N C;  4H5R A;  3FE1 A;  1ZXO A;  4GVM A;  1KAX A;  4Z4C A;  1J5O A;  2ZJR L;  2ASP A;  3ZX3 A;  4Y1C A;  4FK2 A;  2XY5 A;  4H0X B;  3FGU A;  5IT9 O;  1OH5 A;  3KLE A;  1TL1 A;  2FBX A;  4RCH A;  4EZ6 A;  4KHP K;  1VQM N;  3R8E A;  1WLJ A;  3ZSX A;  1GLC G;  3LAL A;  5BRE A;  2OPQ A;  2RF2 A;  2ATQ A;  2HF3 A;  2B6A A;  2P9N A;  4M3R A;  3O8M A;  2YHY A;  3OW2 M;  1SUQ A;  5C15 A;  4M3Y A;  1GOC A;  4GV9 A;  4GMJ B;  4MO5 A;  1X1P A;  4AM7 A;  3BP8 A;  4F8R A;  2W6L A;  4DSK A;  1YJN N;  1QZ5 A;  3KIO A;  4Q5V A;  1RDC A;  1TL3 A;  3NMU A;  3OBY A;  2O8D A;  2ZJQ L;  5FLX O;  4EHT A;  4CEC A;  4WYB A;  3V9U A;  4K8Z A;  1BI4 B;  4ELT A;  4QOZ B;  5M1Q A;  3PO5 A;  1B9D A;  3QEV A;  3OYK A;  2UU9 K;  1NK5 A;  3SAF A;  3ULE B;  2NRW A;  3C94 A;  1C6V A;  4NB4 A;  4CZE A;  3VEY A;  3I0R A;  4DQ8 A;  4K25 A;  4PA1 A;  5ADX H;  4FJN A;  4G9Z A;  3WNH A;  4JKC A;  1YIT N;  3G71 N;  3NGI A;  1D8Y A;  5J2M A;  4AHU A;  3QBW A;  3NF6 A;  1LWF A;  1K73 O;  1KAY A;  1KLM A;  4HTL A;  1HUX A;  2NRT A;  1KXP A;  2VG6 A;  3DOL A;  4KRE A;  4KH4 A;  1I94 K;  3F9M A;  4IG0 A;  2D0B A;  3NF9 A;  4B1Y B;  2Q0U A;  5HOO A;  3O1B A;  4E1M A;  3G25 A;  4DQS A;  3CQY A;  5DMR A;  3RVC A;  1IKY A;  4IWV A;  4LC9 B;  4CHO A;  4BRG A;  4JKG B;  3RSE A;  4IFY A;  4I9Q A;  4JK8 A;  1RBV A;  4DB3 A;  4BC5 A;  3ZX2 A;  1VQN N;  2E6M A;  2A6A A;  5LL6 Z;  1NGI A;  4PL8 A;  2QWN A;  3VQE A;  4CE9 A;  5C0Y A;  1QZ6 A;  3FR0 A;  3P5J A;  5K14 A;  4B9T A;  4GNI A;  3SLC A;  4M42 A;  2Q31 A;  4BR7 A;  4CJ3 A;  4L8R B;  2H3G X;  3AAR A;  1RDA A;  2E2P A;  1IG8 A;  1SL0 A;  1WB9 A;  4DS4 A;  1S1X A;  2HMP A;  4JN4 A;  3CCJ N;  4JS4 A;  3VEZ A;  2HHQ A;  2Y1I A;  2Q0R A;  4WQ5 C;  4YOV A;  1JLG A;  4N5S A;  2P5G A;  3K57 A;  5A2Q O;  3CFO A;  4CZH A;  1CZB A;  3E66 A;  4CGJ A;  2IVO A;  3SQ4 A;  2G8F A;  4DF8 A;  2FBT A;  2BDP A;  4OGC A;  4LF6 K;  5EX5 A;  1DKG D;  4A2A A;  2P9I A;  3AA4 A;  1TK5 A;  3G4S N;  3MEE A;  1CLQ A;  1HRH A;  4JRP A;  4FZY A;  2VQE K;  4B3S K;  4L3Q A;  4CEO A;  3KKS A;  3V9S A;  1OVY A;  4WE1 A;  4RWT A;  1W0H A;  1XC3 A;  3PX0 A;  3HL8 A;  4CJT A;  1J54 A;  4DV5 K;  4CEB A;  3HT3 A;  1VQ9 N;  4JI8 K;  1WUA A;  1QHT A;  2P9U A;  4WF9 L;  1HYS A;  4RW9 A;  4BRM A;  2D0A A;  5ELZ A;  3I56 N;  1KLN A;  4DR4 K;  5KRT A;  2P9L A;  1S6P A;  4JKE A;  5FPM A;  1RBS A;  4B8A B;  2HOE A;  2OCE A;  1N32 K;  4CZL A;  3S3O A;  2D4W A;  2FSK A;  3CCR N;  4KHY A;  4FWQ A;  4IFE A;  2Q1N A;  4IJN A;  1BUP A;  1BQM A;  2CH5 A;  4H5W A;  1NOY A;  4DS5 A;  2YHW A;  1JXE A;  5CR4 A;  5BPM A;  3OS1 A;  4CEA A;  4NLC A;  1YVN A;  3LDO A;  2KHO A;  2OTJ N;  1S9E A;  1XMO K;  2UXB K;  3ENH A;  3GDQ A;  3SPY A;  4DSJ A;  5AZJ B;  1HKB A;  3IG1 A;  3CCL N;  5AQL A;  4B9S A;  3AO5 A;  3TAR A;  1RNH A;  1YIJ N;  1IKW A;  5AQN A;  3SI6 A;  1QSY A;  3K5O A;  4B1W B;  3ZEU B;  3QIP A;  3IAY A;  1CZ9 A;  2BTF A;  3RMD A;  5GAG P;  3LPU A;  5BRH A;  1D9D A;  4FOI A;  1NMN A;  4DTO A;  2Z1H A;  3NDK A;  3ZSV A;  4BWM A;  1N6Q A;  4RW7 A;  4YOU A;  3J7Z O;  3AVK A;  4QS7 A;  3LZI A;  4MQ3 A;  3ITH A;  4BQZ A;  3P39 A;  1NK7 A;  1T03 A;  4IJA A;  3LDQ A;  1C0M A;  3AAP A;  4I2P A;  1WSE A;  2QKB A;  4CK1 A;  2VWB A;  4A62 A;  3L4Q A;  3C65 A;  3HI0 A;  3OS2 A;  4H5T A;  3LZJ A;  2PYL A;  4BR5 A;  4CI6 A;  3K5L A;  4QCL A;  3UB5 A;  3VN5 A;  3A2F A;  2XY7 A;  4LH4 A;  3KK7 A;  3AVB A;  3QFU A;  5J2P A;  5CYQ A;  2YI1 A;  2OA8 A;  4B08 A;  1KQS M;  4F9O A;  3ZSY A;  4KTQ A;  2UUB K;  3CQX A;  4DTR A;  4I6M B;  4KFB A;  2V7Y A;  3WT0 A;  1XC9 A;  5BN9 A;  2VGN A;  4CBU A;  2W42 A;  3G0Z A;  1BOT O;  2NNW A;  1S1T A;  1W9H A;  2YX6 A;  3UKR A;  2QKK A;  2IC3 A;  1RT6 A;  5LY3 A;  5M1N A;  2I7P A;  3VET A;  4FWO A;  4LF4 K;  4LF5 K;  3I33 A;  4WFA L;  4DUZ K;  4W5T A;  5GAE P;  1JLA A;  2WUS A;  2QEX N;  1HKG A;  1TKT A;  1G99 A;  1U4B A;  1U2V B;  1HJR A;  2YKM A;  4LFB K;  3MDQ A;  4BE1 A;  4A5B A;  3V1R A;  4M7X A;  3SUO A;  1KFS A;  4N47 A;  3T69 A;  2AA4 A;  4FCY A;  4IEE A;  1IV0 A;  4BRL A;  2D0C A;  3G6E N;  3VEN A;  1WSJ A;  3QES A;  1G15 A;  2JLE A;  2DFE A;  3TAQ A;  3EL2 A;  4KHN A;  2YJF A;  1NGG A;  4OJR A;  3MXI A;  2KFZ A;  2QWM A;  4C23 A;  4NCG A;  3ZET B;  1WBB A;  1BGX T;  1U6Z A;  1KVC A;  3QBX A;  3FZK A;  4PUO A;  4C8L A;  4BRO A;  1RT5 A;  1EP4 A;  4F4K A;  5CHI A;  1J6Z A;  3S3N A;  1K9M O;  1X3M A;  4PQU A;  5HL7 L;  3HRG A;  4FLW A;  1BO5 O;  3VF4 A;  3VQB A;  2Y1J A;  4KH5 A;  5BPL A;  4JHD A;  2E1Z A;  4JKB A;  3ZT1 A;  3CF5 L;  1RDU A;  1RDW X;  4AF1 A;  1RTJ A;  3VER A;  2W6K A;  5AQR A;  3SBT A;  5AQI A;  3TAF A;  3B6P A;  3WQT A;  1HR0 K;  3CJB A;  1T3V A;  4BC4 A;  3HP9 A;  2X6S A;  5AQW A;  5BRF A;  4NXM K;  4GV3 A;  4BGB A;  3VQ8 A;  3OYI A;  4DU1 A;  3AAQ A;  4FWS A;  4JI2 K;  1OKJ A;  2NLX A;  3R6M A;  2D0P A;  1R59 O;  3AGK A;  5CZ2 A;  4NO7 A;  2YHA A;  2OZS A;  1J9A A;  2HND A;  1BIS A;  3CI5 A;  3RMC A;  3O9Q A;  1VSM A;  4RTF D;  4B9N A;  4FWR A;  1DTT A;  1I39 A;  2Z1J A;  4AIL C;  1VK0 A;  5JVH L;  4G1Q A;  4K8X A;  1K6Y A;  4F2S A;  3FFK B;  5JMV A;  2FBV A;  2HVI A;  4DWI A;  2P9P A;  3A5L C;  2JGU A;  1UA0 A;  3OYF A;  4CEE A;  5HRN A;  3NH1 A;  4HTU A;  3VQ7 A;  2E8A A;  4FZX C;  3LDP A;  5AQP A;  3VGK A;  3AA5 X;  3G10 A;  1O13 A;  4CIE A;  2WTU A;  1NGJ A;  3NGZ A;  1K8K A;  4YDU C;  3TWH A;  1X9M A;  4DSF A;  3B8A X;  1NJX A;  3HP6 A;  4WQ5 A;  1TKX A;  4H0Y B;  3GE1 A;  5C2D A;  4PKI A;  4CFD A;  4W5O A;  3QNO A;  1RDB A;  2FLO A;  3DLL L;  3E9P A;  1C1B A;  5GIP A;  4R5P A;  2XHB A;  3S41 A;  3ZT0 A;  1NJI O;  3OHR A;  4ISF A;  3U8X A;  3T3F A;  1YTA A;  1MWK A;  2G8V A;  3AVH A;  4PKG A;  3K5M A;  2E88 A;  2P1J A;  1HPZ A;  3WNE A;  2P51 A;  3AVG A;  3WXK A;  4CEF A;  3KWG A;  3L2R A;  2P9K A;  3OY9 A;  3K9K A;  4DF4 A;  4XIU A;  3VA3 A;  3MN7 A;  3JSM A;  4KHQ A;  2YNH A;  1LOT B;  4CCH A;  4M63 C;  5AQF A;  1TUU A;  4JI4 K;  3PY8 A;  4CJP A;  5AQT A;  3AVF A;  4KO0 A;  3THX A;  4EHU A;  3ZT3 A;  3M1F A;  4I2Q A;  1GLB G;  5C10 A;  3BF3 A;  4KV8 A;  2E2Q A;  1EWQ A;  5EY4 A;  4O8K A;  2UXD K;  5M1F A;  2JWL A;  3SBG A;  4CJ5 A;  4EFH A;  2P9S A;  5AQO A;  3TAE A;  2KFN A;  5C42 A;  1XUP O;  4O44 A;  5FPD A;  1WOQ A;  2DPN A;  3OJU A;  4DKW A;  2WFB A;  2F4V K;  5HRR A;  3DYA A;  5FRM A;  4JS5 A;  4MO4 A;  2P9L B;  1R0A A;  3TAP A;  2KZZ A;  2HHU A;  4AHV A;  5GIO A;  4HCC A;  4GVE A;  3VEW A;  4NXN K;  3KJV A;  3JAM O;  1VQP N;  4E7H A;  3AV9 A;  3MEG A;  1YAG A;  3NF7 A;  1GOB A;  2FBY A;  1RGI A;  2HHS A;  4C8O A;  1JLQ A;  4EAH D;  1ZYQ A;  1JLB A;  4DQR A;  1GLF O;  5LMU K;  1KCF A;  3O3G A;  2GV9 A;  3P31 A;  4LFA K;  1Z26 A;  3DJC A;  4BDZ A;  1RT2 A;  2WC9 A;  3WEE A;  5TKY A;  1KAZ A;  2O8E B;  5HRS A;  2QW9 A;  2Q36 A;  5TKW A;  4YNQ A;  4CF9 A;  4FJK A;  1SKR A;  1QSL A;  2WON A;  3RR7 A;  4JEP A;  3TI0 A;  3U6F A;  3TAN A;  4CK2 A;  2GWJ A;  5HBM A;  1NOZ A;  5AQG A;  4B3R K;  3ZSO A;  5AQM A;  3C7N A;  3MXM A;  1JCE A;  4E3S A;  1NGC A;  1GOA A;  4LY7 A;  2CGK A;  3D2E B;  2Q97 A;  4FW1 A;  4CGH A;  3QIN A;  1HNZ K;  4IO9 L;  4XEI A;  3OA9 A;  1L3V A;  1HNX K;  3CMA N;  4FK0 A;  3D45 A;  1TVR A;  2HST A;  3A5O C;  1W2B M;  4YY3 K;  4KKO A;  1SKS A;  2VG7 A;  3H45 C;  2VWK A;  1U04 A;  1JLF A;  4JNE A;  5AQX A;  4J8F A;  2A3Z A;  5BRD A;  4DR7 K;  3QO9 A;  3J81 O;  1VSL A;  3CC4 N;  1VSE A;  3NCI A;  2IVP A;  1OH6 A;  1ESV A;  4K42 A;  1S9G A;  5FPN A;  5C12 A;  5FRO A;  4CES A;  3V6D A;  5T7B A;  1A5V A;  4HWI A;  2KQ2 A;  2HBJ A;  3V81 A;  3AO3 A;  3HO1 A;  4HVJ A;  4BVP A;  4JD2 A;  4OVL A;  4PL7 A;  3HPH A;  4O8U A;  4A59 A;  1DT9 A;  2FSN A;  4IFV A;  1JJ2 M;  1HJO A;  3IDH A;  4CJE A;  4LFC K;  5AQV A;  4H5V A;  4DTM A;  4WFB L;  3MX2 A;  1FXX A;  3OYC A;  3L8B A;  2UXC K;  2ZE2 A;  4O5F A;  3ZSR A;  1XHZ A;  2ITM A;  1GLJ O;  3DXK A;  4CZM A;  1ITG A;  1IH7 A;  3OYA A;  2OPR A;  3LAM A;  4FWK A;  4DR6 K;  2O8F A;  3M8Q A;  1IJJ A;  4F3T A;  2XO7 A;  4DV4 K;  2YKN A;  4IOX A;  4FLV A;  2AJQ A;  4H0T B;  3TAB A;  4M3Z A;  4BRD A;  2HNZ A;  1L3T A;  1EET A;  4JK7 A;  1BA0 A;  5AQU A;  2HVH A;  1X9W A;  1VSD A;  5C25 A;  1NJW A;  1O1W A;  5KTQ A;  4HHT A;  3DXM A;  3LAN A;  1RTI A;  3MK6 A;  3QIO A;  4X62 K;  4JKD A;  2NZT A;  3C6T A; 
#chains in the Genus database with same CATH homology
 1U45 A;  4CJW A;  4FJI A;  4N56 A;  4LH4 A;  1QSS A;  4CF8 A;  3AVB A;  2EX3 A;  4DTP A;  5J2P A;  5CYQ A;  3AVI A;  4FJ9 A;  2PY5 A;  4CHY A;  3ZSQ A;  2OA8 A;  4EP4 A;  2IS3 A;  4B08 A;  3H08 A;  3ZSY A;  4KTQ A;  3KKR A;  4FK4 A;  2DFH A;  4ICL A;  4DTR A;  3CFP A;  3AO1 A;  1HNV A;  1TAU A;  4YFU A;  4CF2 A;  1IKX A;  4KTZ A;  3KLG A;  4FM0 A;  1I3A A;  4DSL A;  3OVN A;  4KFB A;  4KTW A;  3SCX A;  4OLB A;  4E1N A;  2GUI A;  1EKE A;  1XC9 A;  4CHP A;  1L3S A;  2W42 A;  3AO2 A;  1MU2 A;  3G0Z A;  3VQA A;  2DY4 A;  1S1T A;  1JXB A;  2RN2 A;  3DI6 A;  4Z0U A;  1W9H A;  3NGY A;  4E7I A;  2QKK A;  2IC3 A;  1RT6 A;  3DLE A;  4GW6 A;  4M41 A;  4DU3 A;  1RT3 A;  3LWL A;  3NH0 A;  4CIG A;  3NH2 A;  3SQ2 A;  1LWC A;  4BDP A;  4Z4F A;  1KVA A;  2Z1I A;  1S1V A;  4W5T A;  1JLA A;  5D3G A;  3JYT A;  3VA0 A;  4DFK A;  4DMN A;  4CHN A;  3AVL A;  1C0U A;  1TKT A;  2XY8 A;  1QS4 A;  4Y1D A;  1U4B A;  4LD0 A;  1ZBI A;  1HJR A;  3CYM A;  4DTU A;  2YKM A;  1LAW A;  2F8S A;  2OPS A;  3AA3 A;  2B4J A;  4BE1 A;  2HHT A;  4HUF A;  3V9X A;  1NOY A;  3V1R A;  1D5A A;  3OYJ A;  3I0S A;  4FYD A;  4DQP A;  3SUO A;  1KFS A;  4N47 A;  1JL2 A;  1ZBU A;  2QXF A;  1FK9 A;  2OZM A;  3RRG A;  4E19 A;  2D5R A;  4HUG A;  3NFA A;  4FCY A;  3RWU A;  1U48 A;  4CFC A;  3M8S A;  1B92 A;  4M3W A;  2IDO A;  3CQ8 A;  2D0C A;  4CJL A;  1JLE A;  1S1W A;  1WSJ A;  1Q9Y A;  2KW4 A;  2YHB A;  2DFF A;  3OYH A;  1G15 A;  3QES A;  2JLE A;  4J2B A;  1TAQ A;  2DFE A;  2NUB A;  3TAQ A;  4N76 A;  4KHN A;  3IS9 A;  4KHW A;  3EY1 A;  4TSX A;  4OJR A;  3MXI A;  3KLH A;  2YNI A;  4KI6 A;  4IG3 A;  4C8N A;  1Q9X A;  4CF1 A;  2KFZ A;  2VWJ A;  1Q8I A;  4NYF A;  3O4N A;  4KI4 A;  4NCG A;  3SPZ A;  1T7P A;  2BGG A;  2QK9 A;  1QQC A;  1HNI A;  1WAJ A;  2ETJ A;  1VSF A;  1BGX T;  1KVC A;  1UWB A;  3SQ0 A;  3DLB A;  4LSN A;  5J1E A;  4KHS A;  1VSI A;  1WNS A;  3OYN A;  4CEZ A;  4PUO A;  4C8L A;  3KD5 E;  3ULD A;  4KHU A;  1HYV A;  1RT5 A;  4OKK A;  4JLH A;  4DQQ A;  1EP4 A;  4UQG A;  3P83 D;  1WSF A;  3KLF A;  4OKE A;  4FW2 A;  4DU4 A;  4F4K A;  1SL1 A;  4Q0B A;  4M3X A;  2YNG A;  3OYB A;  4BDY A;  3VQC A;  4DFM A;  1TK0 A;  3KTQ A;  4AHR A;  4FJL A;  3L3U A;  2HW3 A;  3HYF A;  2R7Y A;  4B9U A;  1DLO A;  4MFB A;  4CER A;  4CIF A;  5I42 A;  3LAK A;  4AHT A;  3S3N A;  2EHG A;  3THV A;  4ELU A;  4PWD A;  1CXQ A;  3VQQ A;  4NCA A;  4JRQ A;  5HRO A;  4PQU A;  3LP0 A;  4BWJ A;  4OPK A;  4BAC A;  4FLW A;  4E7J A;  4EP5 A;  3VQ9 A;  2X78 A;  4CJK A;  3VQB A;  4CEQ A;  5KRS A;  2Y1J A;  2ZQB A;  2BE2 A;  4LH5 A;  4H4O A;  3NHG A;  1NKC A;  1UA1 A;  3B6O A;  3TAM A;  4W5Q A;  3K5N A;  1BCM A;  5FDL A;  1D9F A;  4FJ5 A;  1A5X A;  3OYG A;  4FJH A;  3ZT1 A;  1WN7 A;  1LV5 A;  2OPP A;  1ASV A;  3KK1 A;  1U49 A;  3LWM A;  3RMB A;  4F2R A;  3ZCM A;  1FKO A;  1RTJ A;  3U3Y A;  3CFR A;  1JL1 A;  1ZBF A;  1NK9 A;  4C8K A;  4AHC A;  2WOM A;  3RRH A;  3TAF A;  2G8K A;  3B6P A;  3MED A;  4FVM A;  1REV A;  2HHW A;  3ZT4 A;  3LDS A;  3HP9 A;  1XI1 A;  1JLC A;  1HMV A;  3UIQ A;  5C24 A;  1HYZ A;  2X6S A;  3F73 A;  3RR8 A;  3S9H A;  1BI4 A;  4DG1 A;  4FM1 A;  1UOC A;  4O0J A;  3ISN C;  1NJZ A;  4Z4G A;  3WNG A;  3I8D A;  3SUN A;  3HVT A;  2HHV A;  4DQI A;  1QE1 A;  1KRP A;  3VQ8 A;  3OYI A;  4DU1 A;  4CHQ A;  3QEI A;  4GVM A;  4Z4C A;  4DTX A;  1J5O A;  4OLA A;  4FK2 A;  4Y1C A;  5CZ2 A;  2G8U A;  1BIU A;  2XY5 A;  2YHA A;  2OZS A;  2VG5 A;  1J9A A;  2HND A;  4J2E A;  1BIS A;  2E6L A;  4DTJ A;  3C6U A;  3KLE A;  1TL1 A;  3RMC A;  3HPO A;  2FBX A;  1VSM A;  4B9N A;  4CGG A;  2G8H A;  4EZ6 A;  1DTT A;  1I39 A;  3DMJ A;  2Z1J A;  4FLY A;  1VK0 A;  4AIL C;  3AVN A;  4FLU A;  4E7K A;  4G1Q A;  4ID5 A;  4K8X A;  1K6Y A;  3DLG A;  4OGE A;  3T19 A;  1WLJ A;  3ZSX A;  3S3M A;  4F2S A;  1DTQ A;  1BL3 A;  2FBV A;  2KZM A;  4C8M A;  2HVI A;  1HQU A;  1ZBL A;  4LSL A;  3LAL A;  4FJJ A;  4DWI A;  2OPQ A;  2RF2 A;  2JGU A;  4CJS A;  3RTV A;  1EX4 A;  1UA0 A;  2ATQ A;  3OYF A;  4CEE A;  5HRN A;  2B6A A;  3NH1 A;  4HTU A;  4M3R A;  3VQ7 A;  1RIL A;  1SUQ A;  4FZX C;  4M3Y A;  1GOC A;  3AA5 X;  4F3O A;  1C0T A;  4GMJ B;  3G10 A;  4CHZ A;  1X1P A;  3PX4 A;  2PYJ A;  4CIE A;  4F8R A;  1RT1 A;  3NGZ A;  4DSK A;  2GBZ A;  2O4I A;  3QEW A;  3KIO A;  4CGI A;  4Q5V A;  3LP1 A;  3TWH A;  2YNF A;  1X9M A;  1RDC A;  1TL3 A;  4OPJ A;  4FLX A;  4DSF A;  1NJX A;  4RW8 A;  1IO2 A;  1ASW A;  3HP6 A;  4ELV A;  1NKB A;  1TKX A;  2DTU A;  5FRN A;  4I7F A;  4CFD A;  1RCH A;  4CEC A;  4W5O A;  1RDB A;  3CM6 A;  1IKV A;  3CG7 A;  3V9U A;  3QNO A;  4K8Z A;  1S1U A;  3V1O A;  4J2D A;  1BI4 B;  1C1B A;  4ELT A;  4QOZ B;  3PO5 A;  4R5P A;  1B9D A;  1KTQ A;  5DK5 A;  2XHB A;  3QEV A;  3QNN A;  1HQE A;  3OYK A;  3KD1 E;  3P1G A;  3NAE A;  1NK5 A;  3ZT0 A;  3ASM A;  3C94 A;  1YTA A;  3T3F A;  2G8V A;  1C6V A;  3AVH A;  3K5M A;  3HPG A;  5HLF A;  2P1J A;  1HPZ A;  2IOC A;  3I0R A;  2ITG A;  4PA1 A;  3TAG A;  4FJN A;  3WNE A;  3OYD A;  2P51 A;  1L3U A;  3AVG A;  4FLZ A;  4CEF A;  3L2R A;  4HUE A;  3KK3 A;  2B5J A;  3WNH A;  1RT4 A;  3OY9 A;  1RTD A;  4DF4 A;  4FJM A;  4M3T A;  3DLR A;  3TR8 A;  4XIU A;  3NGI A;  4CFB A;  3VA3 A;  1D8Y A;  5J2M A;  4AHU A;  3JSM A;  1SL2 A;  3NF6 A;  1NK6 A;  4KHQ A;  3RMA A;  3V9W A;  1LWF A;  4IDK A;  2YNH A;  4CCH A;  3LP2 A;  4AHS A;  5CYM A;  1KLM A;  1T05 A;  4E0D A;  3MEC A;  1LWE A;  4CFA A;  3HJF A;  2Z1G A;  5KI6 A;  4CJP A;  3PY8 A;  3NF8 A;  2O4G A;  3AVF A;  4KO0 A;  3OS0 A;  3SUQ A;  2VG6 A;  3DOL A;  2KTQ A;  1SKW A;  1XWL A;  3ZT3 A;  4KRE A;  2HNY A;  1TKZ A;  4I9L A;  3OYE A;  4DTS A;  4KPY A;  4IG0 A;  3VQ4 A;  2D0B A;  3V1Q A;  3NF9 A;  4I2Q A;  4ID1 A;  4KB0 A;  3V4I A;  4E1M A;  4CJR A;  1TGO A;  1KVB A;  1LW0 A;  5KGW A;  4CED A;  4DFJ A;  4KV8 A;  1BQN A;  4DQS A;  3OYL A;  1TK8 A;  5DMR A;  2F96 A;  3L3V A;  3SNN A;  2XY7 A;  5CY4 A;  4Z4H A;  2P5O A;  4CF0 A;  1WSI A;  4CJ5 A;  3AVJ A;  4M3U A;  1IKY A;  4O4G A;  4CHO A;  5SZT A;  3TAE A;  2KFN A;  5C42 A;  1B9F A;  4O44 A;  4IFY A;  2BAN A;  4FJX A;  3OJU A;  4I9Q A;  5HRR A;  3K58 A;  4O5B A;  3DLK A;  3DYA A;  4DSI A;  3SYZ A;  3U3G A;  4JS5 A;  3SQ1 A;  5FRM A;  1YTU A;  1RBV A;  1EXQ A;  1WAF A;  1ZBH A;  2E6M A;  4QAG A;  3VQ6 A;  3TAP A;  1R0A A;  2KZZ A;  3DRS A;  4E89 A;  2RPI A;  4DTN A;  4N41 A;  3VQE A;  3O3H A;  4CE9 A;  1RDD A;  2G8I A;  2HHU A;  1NJY A;  4AHV A;  3QEX A;  4KAZ A;  4B9L A;  4H4M A;  3P5J A;  5K14 A;  5J2N A;  3VQ5 A;  2A1R A;  4B9T A;  4HCC A;  4KRF A;  3ALY A;  3KJV A;  4M42 A;  1KFD A;  4CJ3 A;  1J53 A;  4E7H A;  4IKF A;  4L8R B;  4RW6 A;  3AA2 A;  3AV9 A;  1WSH A;  1RDA A;  3DOK A;  3MEG A;  1SL0 A;  3NF7 A;  1GOB A;  2X6N A;  1RTH A;  1S1X A;  4DS4 A;  2FBY A;  2HHS A;  1Y97 A;  4JS4 A;  4C8O A;  2HHQ A;  1JLQ A;  4NYN A;  4CGF A;  2RKI A;  2Y1I A;  1ZYQ A;  1JLB A;  2IGI A;  3AVA A;  3QER A;  1L5U A;  1QTM A;  5JS1 A;  2Q3S A;  4DQR A;  4B3O A;  3OJS A;  1KCF A;  1JLG A;  4IBN A;  4N5S A;  2P5G A;  4J2A A;  3K57 A;  3O3G A;  2GV9 A;  3NE6 A;  1LW2 A;  3CFO A;  4BE0 A;  3K2P A;  1Z26 A;  4ZTJ A;  1CZB A;  4BDZ A;  1RT2 A;  2G8W A;  4B9M A;  2HHX A;  4CGJ A;  3HXM A;  1JKH A;  3LPT A;  3HK2 A;  3AVM A;  3SQ4 A;  2G8F A;  4DF8 A;  2FBT A;  3T1A A;  3L2U A;  2BDP A;  4OGC A;  4NCB A;  4DLE A;  5HRS A;  4YNQ A;  3K59 A;  1XHX A;  4CF9 A;  4FJK A;  1RBT A;  3AA4 A;  1TK5 A;  1SKR A;  4CJV A;  3MEE A;  1QSL A;  1CLQ A;  1HRH A;  2WON A;  1Z25 A;  4RG8 A;  4JRP A;  1N5Y A;  4FZY A;  3RR7 A;  3LP3 A;  1WSG A;  3TI0 A;  4FJ7 A;  3U6F A;  4CEO A;  3KKS A;  1VSK A;  1T8E A;  3ZSZ A;  3V9S A;  5EU7 A;  3TAN A;  4CK2 A;  4WE1 A;  4W5R A;  1X9S A;  3CM5 A;  1W0H A;  1NOZ A;  1RBR A;  3DRP A;  3KLI A;  3O4Q A;  5HBM A;  3ZSO A;  3PX0 A;  3OYM A;  4FZZ A;  3MXJ A;  2X74 A;  3MXM A;  4E7L A;  3HL8 A;  4CJF A;  4CJT A;  4FLT A;  1J54 A;  4CEB A;  3HT3 A;  1UAX A;  4E3S A;  3O3F A;  1GOA A;  2HMI A;  1QHT A;  4LY7 A;  5KGX A;  1HYS A;  4RW4 A;  4FW1 A;  4RW9 A;  4CGH A;  3QIN A;  4FJG A;  2I5J A;  2D0A A;  4FXD A;  5SWM A;  3QEP A;  1KLN A;  1TV6 A;  2HB5 A;  4DLG A;  2PZS A;  1L3V A;  1YVU A;  5KRT A;  3D45 A;  1TVR A;  1TKD A;  4FK0 A;  3M8R A;  1S6P A;  2LSN A;  1RBS A;  2YV0 X;  4KKO A;  1BHL A;  2A1S A;  2VG7 A;  2VWK A;  3PUF A;  4CJ4 A;  1U04 A;  1SKS A;  1JLF A;  1NK0 A;  4B8A B;  3SV4 A;  5HRP A;  3S3O A;  5E41 A;  4KHY A;  3QET A;  3F9K A;  1F21 A;  3QO9 A;  3SV3 A;  2FC0 A;  1VSL A;  3IRX A;  4Z4E A;  5HP1 A;  1BQM A;  4CJU A;  1A5W A;  4DFP A;  4B8C A;  1RT7 A;  3QLH A;  3BGR A;  4DS5 A;  1JXE A;  1VSE A;  3DM2 A;  3C95 A;  3OS1 A;  3NCI A;  4CEA A;  3PV8 A;  3AVC A;  1NK8 A;  3BDP A;  4AH9 A;  1U47 A;  3SJJ A;  1S9G A;  4CK3 A;  1ASU A;  2F8T A;  1S9E A;  5FRO A;  4OKJ A;  4CES A;  3V6D A;  3D0P A;  1NKE A;  1BIZ A;  3SUP A;  5T7B A;  1CXU A;  1A5V A;  2KQ2 A;  1BCO A;  3M8P A;  3HM9 A;  3V81 A;  3AO3 A;  3SPY A;  4DSJ A;  3HO1 A;  4HVJ A;  4KB1 A;  3HST B;  3PX6 A;  3DLH A;  3IG1 A;  4ZTF A;  4H8K A;  4CGD A;  1VRU A;  4OVL A;  3L2V A;  5I3U A;  1NK4 A;  1IG9 A;  3HPH A;  4B9S A;  4FJ8 A;  3AO5 A;  3TAR A;  1RNH A;  2ZD1 A;  1S6Q A;  1VSH A;  1LAV A;  4M45 A;  1IKW A;  4HCB A;  4IFV A;  4B9V A;  3VQD A;  3SI6 A;  1QSY A;  3K5O A;  3L2W A;  3WNF A;  3QIP A;  3IAY A;  1YT3 A;  4ZHR A;  4CJE A;  1FKP A;  4O55 A;  3MAQ A;  1CZ9 A;  3PO4 A;  4Z4I A;  3RMD A;  4DTM A;  2IAJ A;  3LPU A;  3SZ2 A;  1FXX A;  1RBU A;  3OYC A;  3L2Q A;  4FM2 A;  3L8B A;  1D9D A;  3FFI A;  2ZE2 A;  4DTO A;  1SV5 A;  5JS2 A;  3ZSR A;  1XHZ A;  2Z1H A;  3ZT2 A;  3NDK A;  3ZSV A;  1ITG A;  1IH7 A;  4BWM A;  1N6Q A;  3OYA A;  2OPR A;  3LAM A;  4PY5 A;  1C1C A;  4RW7 A;  3E01 A;  1C1A A;  3AO4 A;  3AVK A;  3M8Q A;  3EZ5 A;  5J2Q A;  2XO7 A;  4F3T A;  4CJQ A;  2XY6 A;  3LZI A;  4MQ3 A;  3ITH A;  1NK7 A;  1T03 A;  2YKN A;  3DRR A;  4FLV A;  3EYZ A;  1C0M A;  2AJQ A;  2XRI A;  4I2P A;  4DSE A;  1WSE A;  4W5N A;  2QKB A;  3TAB A;  4EZ9 A;  4M3Z A;  4CK1 A;  4O0I A;  5CZ1 A;  2HNZ A;  3V9Z A;  1L3T A;  1EET A;  3ZSW A;  2HVH A;  3OS2 A;  1VSJ A;  1KSP A;  1X9W A;  1VSD A;  3HVR A;  3LZJ A;  5C25 A;  1NJW A;  2PYL A;  1O1W A;  1VRT A;  5KTQ A;  4HHT A;  3VQP A;  3K5L A;  1S5J A;  4QCL A;  2E4L A;  3LAN A;  1RTI A;  3KK2 A;  3QIO A;  4BE2 A;  2OYQ A;  3VN5 A;  3NBP A;  3A2F A;  3C6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...