4BRNA

Legionella pneumophila ntpdase1 crystal form iii (closed) in complex with mg amp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
356
structure length
356
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 118
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brnA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brnA02
4I6MA 2EWSA 2Q1NA 3WXIA 4JHDB 1BA1A 2FF3B 2F9TA 1RFQA 4H0OA 4M7YA 2GWKA 3G25A 1SQKA 2PBDA 3LM2A 2YHXA 2P9LB 4DHYA 1ZC6A 1TYQA 2E2QA 3MN9A 2QXLA 5LJWA 5AQQA 3VEZA 4BR5A 4EFHA 3VPZA 4BR7A 4B1UB 2ZGYA 1K8KA 5FPNA 1MDUB 2V7ZA 2D0OA 1BO5O 4NO7A 5BRDA 1R59O 3SK3A 4BR0A 2CGKA 1GLAG 2QW9A 5B8HA 4B1XB 2E1YA 4RWTA 4GNIA 3CJ9A 5AQLA 4CZMA 5EVZA 3CJCA 5BRHA 2E2OA 2D4WA 2FLOA 2P9NA 5F0XA 2ASPA 4BREA 3VETA 4IO8A 4CZLA 3LDQA 2QWPA 3H3NO 1BG3A 3L6QA 1XUPO 5AQTA 3UKUB 3IMXA 2P9IB 4FWLA 3C7NB 2P9KA 1HKBA 3EO3A 3FLCO 3UB5A 5BN9A 1T6CA 5KPRA 3WQUA 3KZBA 3QDKA 5EOYA 3L4IA 1WUAA 3VESA 2NZTA 4FOIA 4BRPA 4CZEA 3DXKB 3IFRA 4JD2A 4WQ4C 2A40A 2V51B 3EZWA 3ZEUB 3O08A 3W0LA 5BREA 4MO5A 4BC5A 3CJ1A 4H0TB 2A42A 4B1YB 2Q0UA 1NGBA 2E1ZA 5AQZA 2OANA 1BDGA 1NGFA 3ATVA 2IVNA 3GG4A 4FOEA 5AQOA 5JLHA 4K42A 3AAQA 3H6EA 5BRFA 4XH1A 1YVNA 5JICA 1NBWA 4FL9A 3D2EB 3HTVA 3HM8A 2D1KA 1HPMA 1QQOA 3O80A 3WXLA 3A5MC 5AQJA 3O6WA 3HI0A 5BPMA 1XC3A 4BQZA 1C0FA 5AZIB 1X9JA 3WEEB 5LY3A 1C0GA 3C0BA 3CI5A 1NMDA 4PKHA 4DQ8A 2NRHA 4KBOA 3QBXA 3A8YA 2A3ZA 2DPNA 4CI6A 3LDNA 3LDOA 2E2PA 3ENOA 1HKGA 3JXUA 1LCUA 3A0IX 4IZ9A 2QWQA 3FR0A 1NLVA 4QS8A 1GLCG 2P9PB 1TUYA 2P9SA 2QWOA 4WQ4A 3ZETA 2GELA 2IVOA 3VEWA 2I7PA 3ID8A 3FZLA 3IUCA 5ADXH 1T44A 4MO4A 5FPDA 5FPMA 1Y64A 3GL1A 3ATUA 1ESVA 2QWLA 5AQVA 4F9OA 1NGJA 2GEMA 5AQRA 5AFUH 1V4SA 5LJVA 3BF1A 5AZJB 5AQWA 3VEOA 4A62A 1HUXA 4BRNA 1KXPA 2VYPA 4CZFA 1BUPA 1WOQA 3WXJA 3D2FB 3R9PA 4H5TA 4K25A 1T6DA 4PKGA 3VEYA 1X3MA 3MCPA 2HF4A 4WYBA 4FWRA 4BROA 4CBWA 1U2VB 2P9NB 3SJHA 2E2NA 1QZ6A 3ULEB 2FSNA 4A61A 2CGLA 3H1VX 2VWBA 3SLCA 4CZGA 3WQTA 4CBUA 4E1JA 3RSEB 4M63C 3O1WA 4H03B 4BRFA 4PL7A 3FZMA 1HX1A 4A2BA 4YDUC 3CJBA 4ISGA 4H0VB 3TU5A 3JS6A 4H5WA 3AY9A 3MN5A 1ZBSA 4FWOA 2YJEA 3R6MA 4A2AA 2ASOA 3UKRA 2P9UA 2GUPA 2HMPA 3BF3A 3U9ZA 1JCFA 2YHYA 1YXQA 2V7YA 4AM6A 4EAHD 3FZHA 5AQIA 5AQPA 1GLJO 4FWPA 3MN7A 4RCHA 3S41A 2H3GX 3CQXA 2IIRA 5AQGA 1RDWX 4JHDA 4BVPA 3R8EA 1GLEG 4IJNA 3VEVA 4NB4A 5BPLA 2QM1A 5F1XA 2P9LA 5EXWA 3U9DA 3GDQA 3EL2A 3CERA 1MWMA 3J8AA 3GOIA 2ZWHA 1G99A 5F2RA 3CHWA 3HBTA 4MLHA 1QQNA 4DCHA 4H5RA 1P8ZA 4O5FA 1RGIA 3A5NC 1HLUA 4IWVA 3H46O 4BRAA 1U6ZA 4YDUA 1GLDG 3CJ7A 1ATSA 1HJOA 5AQUA 3M1FA 4FWKA 1NGGA 2E88A 3EKUA 3O8MA 3CETA 2YJFA 4BGAA 3O5BA 3UE5A 2VCPA 5AQHA 1Q18A 3BP8A 3FZFA 5JLFA 3B8AX 1ZXOA 4K41A 3TPQA 3MK6A 5EY4A 3KVGA 3DXMB 3UKUA 4CZHA 3FFKB 2P9IA 3C7NA 2HF3A 2ZF5O 3GBTA 3MN6A 1Z05A 1TUUA 3GE1A 4I6MB 3BEXA 1KAYA 1BWFO 1QQMA 3W3DA 5KPZA 4LC9B 3M6GA 3A5OC 3DXKA 3QICA 4BQLA 4QS9A 3ZEUA 4CBXA 3FZKA 1TYQB 3VGKA 4BG9A 2CH5A 3U4LA 1YAGA 3H3OB 4FO0A 1CZAN 1H1VA 1JCGA 1GLFO 3SMPA 1K8KB 3FE1A 4H0YB 4CZIA 1S22A 3VF4A 3FGUA 3ZX3A 2HOEA 4QS7A 3VEXA 4FSVA 2W41A 3D2EA 4FWMA 4BVOA 1XQSC 3VOVA 5AQYA 4H5NA 4BR2A 4H0PA 2BTFA 4HWIA 4BRHA 1D4XA 3ZX0A 4WQ5A 1NGAA 2A5XA 2Q97A 4BC3A 4BRCA 3WEEA 4FPAA 3D7EO 1MWKA 5AZIA 5AQKA 1QZ5A 2E20A 3QB0A 2CH6A 2QWRA 4EHUA 4C23A 1KAXA 4CD1A 4H0XB 2GTDA 1DKGD 4Y0WA 5JMVA 4AM7A 3WUHA 2P9KB 2GWJA 3LDLA 3ENHA 5ELZA 1V4TA 4BRMA 3VGLA 5ADXA 2AA4A 4B9QA 1HKCA 2P9PA 1GLBG 4JD2B 5AFUA 3ZX2A 4EHTA 5KQDA 2NLXA 3LDPA 2Q0RA 2I7NA 5AQFA 2FXUA 1DGKN 2QWMA 1MA9B 4FWNA 2ASMA 4CZJA 4BG8A 3DJCA 3A5LC 3IDHA 5I9EB 5AZJA 5AR0A 1ATRA 1E4FT 3I8BA 2CGJA 5AQSA 5E84A 1J6ZA 1NM1A 3D2FA 3QBWA 2W40A 1SZ2A 4BR9A 5BR9A 2D0PA 3LL3A 4FPBA 4HTLA 2Q31A 1U2VA 3AARA 3ULEA 4BRQA 4BC2A 2IVPA 2FSJA 1EQYA 2ZGZA 5BPNA 3QFUA 4ISFA 4B1VA 4XH5A 5FPEA 1KAZA 2A41A 2PAVA 2YCHA 4BC4A 1LOTB 1NGEA 2YHWA 3RSEA 1NWKA 5TKYA 3MMVA 1NGDA 3H1QA 4B1WB 2AP1A 3DAWA 3O1BA 1GLLO 2E8AA 3QMLA 5CE3A 2ITMA 4PL8A 3VF6A 2KHOA 3DWLA 5AQNA 4RTFD 4B1ZA 3VENA 5EX5A 1ATNA 3KHYA 1JCEA 2P9SB 3ZETB 1S3XA 4BRDA 3HZ6A 4WQ5C 1NGHA 4IXCA 4L3QA 5KQ8A 4CZKA 4XH4A 2F9WA 3CJAA 1IG8A 3EKSA 1DEJA 4Z94A 4CJ7A 3M3ZA 4ISEA 4IJAA 4FWSA 4DB3A 2Q2RA 4FWQA 2UYTA 4BRLA 3WXKA 2FSKA 3VERA 2A6AA 4H5VA 2Q36A 3O4WA 3EN9A 4BGBA 3WT0A 2BUPA 2YI1A 1SAZA 3CIPA 5BN8A 4BRIA 5E26A 4CD3A 3BUZB 1IJJA 1X3NA 3L0QA 4BR4A 1OKJA 3VF2A 1QHAA 1NGIA 3F9MA 1BOTO 4JNEA 4GY2B 4K43A 4MLEA 5AQMA 5AQXA 1BA0A 3AAPA 4M7XA 3I33A 2WUSA 4BRKA 3CQYA 1NGCA 4JAXA 3SMSA 4EIAA 5KPTA 4JN4A 2FF6A 3OHRA 1BU6O 3UKRB 2P9UB 2QWNA 3P4IA 4J8FA 3HSCA 3H45C 2V52B 3MDQA 4PKIA 1E4GT 2J4RA 4O8KA 1YUWA 3DXMA 3LM9A 3U8XA 4BRGA 1Z6RA 3QFPA 4XEIA 3VGMA
chains in the Genus database with same CATH superfamily
4DSJA 2Q1NA 1JXEA 3WXIA 2P5GA 4JHDB 2ZE2A 3KKSA 4EZ9A 2VQEK 1RFQA 3KTQA 1MU2A 1SQKA 2UUCK 2YHXA 4UQGA 1N32K 2QXLA 3AO1A 2WONA 2DFHA 4BR5A 3VPZA 5FPNA 2WTUA 2V7ZA 4Z4EA 3QNNA 5C24A 2OZMA 4DQSA 4F4KA 1TKZA 1TK5A 3SUPA 1LAWA 3G71N 2KFZA 1HYVA 1FJGK 1IKWA 4GV9A 5BRHA 3HPGA 4NCBA 2FLOA 5F0XA 3G10A 4DR5K 1C1AA 4J2AA 3T3FA 2QWPA 4JKHA 3L6QA 1WNSA 3E9PA 4M3WA 3A2FA 4G1QA 3C65A 4JKBA 3UB5A 1T6CA 3ZT3A 5KPRA 3WQUA 3QDKA 4FOIA 4JD2A 1NKBA 2A40A 2V51B 2WFBA 3EZWA 3IS9A 4F3OA 3S3OA 3TSPA 5BREA 1CZ9A 4OKEA 3TTDA 2PFUA 4MO5A 4CESA 3OS0A 4CHNA 4JKDA 3CCJN 4W5OA 1BDGA 3ATVA 2BH1A 3GG4A 1N36K 3TR8A 5BRFA 3EZ5A 1O13A 1NBWA 3CFOA 3HTVA 4AILC 3CC7N 1RT2A 1RT6A 4FJ9A 4NLBA 4DUYK 3QERA 2HNDA 4CFBA 5AQJA 3HRGA 4KH4A 4PHTX 1CXQA 1C0GA 4FJLA 3OYNA 3VTHA 3QBXA 4CJ5A 4E1NA 2DPNA 2W6LA 3LDNA 3LDOA 3ENOA 1LCUA 4BWJA 4FJ7A 3VEWA 3ID8A 5ADXH 3I0RA 2HHUA 5FPDA 5FPMA 3HPHA 3ATUA 3KK1A 1U47A 4F9OA 2VQFK 5LJVA 3BF1A 4WF9L 5AQWA 4N47A 3DLGA 1VRUA 2VYPA 2FBXA 3MEEA 3R9PA 3VQEA 4B9VA 3CMAN 2W6KA 4PKGA 4FZYA 3MCPA 2HF4A 4J2DA 4WYBA 1IH7A 4IEEA 3VQ8A 4BROA 1A5VA 2P9NB 1VSEA 4CEEA 5HRSA 4CJRA 4DQIA 1W7AA 1ITGA 1Q7YO 2OTJN 3ZSVA 4A2BA 1VQKN 3JS6A 4GVEA 4ELVA 3NH0A 3AY9A 1IG9A 4FLVA 2YJEA 4IG3A 4B8CA 3NF9A 2KZMA 1HNIA 5HROA 3CQ8A 4FVUA 3ENBA 4F2SA 1JCFA 2YHYA 4DV7K 1M90O 3OYDA 2V7YA 1ZYQA 3TAQA 4DS5A 4U7BA 3N4PA 3MX5A 3S41A 3P39A 3AVMA 2WC9A 4E19A 5AQGA 1NJWA 3R8EA 4OKJA 2A1RA 3E01A 2B4JA 4IJNA 5CZ1A 3RMCA 2FBVA 5BPLA 5J1EA 5BR8K 3VQPA 2P9LA 1KRPA 3V1OA 3U9DA 3CERA 4DSKA 4DTJA 1G99A 4MLHA 3TAMA 2DTUA 4DCHA 2G8HA 4H5RA 1P8ZA 3OTOK 3VQDA 4ELUA 1W0HA 3H46O 1GLDG 3CJ7A 1ATSA 1HJOA 3M1FA 1LWFA 3C95A 4A57A 1JJ2M 4BGAA 5JVHL 1Q18A 3FZFA 3B8AX 3J81O 4M3RA 1SL2A 1JLEA 2RPIA 1KFSA 1NJZA 2O8EB 3IRXA 3DXMB 1VHXA 5GAEP 2P9IA 3ZT0A 2BANA 3L2WA 3DLEA 2E4LA 2XHBA 1YTUA 1T05A 4K0KK 3BEXA 3THWB 4LC9B 3O9RA 3M6GA 2OA8A 1RTDA 3MAQA 1ILYA 2PYJA 4IO9L 3EE9A 1XNRK 3FZKA 4Z4FA 4BG9A 1C1BA 2CH5A 1IBKK 1JLQA 1D5AA 1HJRA 4CF9A 4C8KA 3ISNC 4FO0A 4GKKK 4BWMA 4CIGA 3SCXA 4FJ5A 1K8KB 1A5XA 4M3YA 3QEXA 4KHYA 4CZIA 2HHTA 1S22A 1I3AA 3FGUA 3ZX3A 3LWMA 2HOEA 4CEFA 3RMBA 4HCCA 3OBWA 4YOWA 4BVOA 4YOYA 5AQYA 4BR2A 4WQ5A 1NGAA 2A5XA 4O0JA 2HHVA 5AZIA 1RDCA 4IOCL 2CH6A 3LP0A 5HRRA 4CD1A 4HUFA 4LFBK 2GTDA 3G0ZA 4LH4A 3V9ZA 3NBPA 1TAQA 3DMJA 2VWJA 2VG6A 1S5JA 4BRMA 4CGDA 2E6LA 4ID5A 2NRWA 5MLCQ 1HKCA 2KW4A 3HOSA 4X66K 5AFUA 2PZSA 5KQDA 2NLXA 2Q0RA 1I39A 5AQFA 4FM0A 2QWMA 1MA9B 4FWNA 3DJCA 3A5LC 4JS4A 3T69A 5AZJA 3HPOA 4IOAL 4CEAA 1UAXA 5M1NA 2Y1JA 1J6ZA 1NM1A 1KVCA 4CJPA 3HL8A 2ZJRL 3LL3A 1HNZK 4C1NK 5C12A 4FLXA 3ZT2A 4DTMA 5FDLA 1HNXK 3OYHA 2QA4N 3ULEA 4BC2A 4DF4A 4XH5A 5DM6L 2YCHA 4BC4A 3SBTA 4EP5A 3SJJA 5CE3A 2ITMA 1HQEA 1WAFA 3CC2N 2UUBK 1VSJA 4IFYA 3N4QA 2XY5A 3WXMB 4BRDA 1WBBA 2UXBK 5LL6Z 3HJFA 1VSIA 5KQ8A 3SZ2A 4CZKA 1C0UA 2O8CB 3CCVN 1DEJA 1K6YA 3C6UA 4DLGA 3ID6A 3QIOA 4DB3A 2UYTA 2FSKA 3D0PA 3OS2A 4PUOA 4O8UA 4KHPK 3U3GA 5C2FA 5BN8A 4RW8A 2HVIA 1QSLA 4FXDA 1IJJA 3KK3A 4BR4A 4M45A 4JKCA 3JYTA 1EKEA 1K9MO 1NGIA 1NMNA 1BOTO 4JNEA 4WFBL 3CCQN 3VQ6A 4GVMA 2WUSA 2F7TA 2OYQA 3SMSA 4JI4K 3BY5A 3V6DA 3UKRB 2P9UB 3SI6A 4J8FA 4KI6A 3MDQA 3THYA 3AVBA 4LFAK 4DG1A 2XY8A 3U8XA 3NE6A 3E9OA 3TSUA 4Z4GA 2E5LK 2O8BA 4WFNL 2EWSA 4JKGA 3LWLA 1RT7A 2F9TA 1HMVA 3SAGA 4H0OA 3V1RA 1Z25A 4WFAL 3G25A 1VQON 3LM2A 4AHCA 1TYQA 3MN9A 4M3TA 4EFHA 2P5OA 2OTLN 4FJ8A 2RHKA 2KQ2A 1MDUB 1ZBFA 3NCIA 4NYNA 4NO7A 3OYMA 4MDAA 4CK1A 3SK3A 2CGKA 1KQSM 1NOYA 1GLAG 3J80O 4B9UA 4CERA 4DV2K 4DR3K 1NK8A 5AQLA 5JS2A 5EVZA 4DMNA 4CGHA 3H08A 1TGOA 3QEWA 4BREA 4FLYA 4CJ3A 3ASMA 3LDQA 3DI6A 1XUPO 3UKUB 3OW2M 4KI4A 4B3TK 1CLQA 3EO3A 4CF1A 4YHHK 1WUAA 3SPZA 4CJQA 2NZTA 1FK9A 4WQ4C 3SQ1A 3NGZA 4CJVA 3ZEUB 3W0LA 5HRNA 3P5JA 4K8XA 4MDBA 5I3UA 1J5EK 4F3TA 3BDPA 4H0TB 4OGCA 4KHNA 4B1YB 1NGBA 4CJFA 1RBSA 3CXCM 1NGFA 2HSTA 1Z26A 3Q7CA 3M8SA 5AQOA 3RRGA 5JLHA 4K42A 3HYFA 1YVNA 4G9ZA 1NK5A 4FL9A 4DU1A 4GMJB 4BY9C 1HPMA 4QOZB 4C8LA 1QQOA 3L2RA 2IS3A 3A5MC 1Q86O 4OPJA 5BPMA 3V9UA 1C0FA 1X9JA 3TAPA 1QVGM 4ILGB 3C0BA 4PY5A 3CMEN 3AA5X 1BISA 2NRHA 4KBOA 5J2QA 4W5RA 3MXMA 1LWEA 3QEVA 1VQMN 3DLHA 4FLZA 4LH5A 3A0IX 3LP2A 3LDSA 2ZM6K 1NLVA 4CCHA 3SYZA 4QS8A 2P9PB 2QWOA 4WQ4A 3ZETA 4JKEA 4DR4K 2IVOA 4KFBA 3IUCA 1BI4A 1WSFA 2RKIA 4FJKA 1TL1A 4J2EA 1Y64A 3GL1A 1ESVA 2IAJA 3B6OA 2JWLA 2GEMA 5AQRA 3M5RA 3O3HA 4A62A 1HUXA 4BRNA 3F2KA 1HPZA 2Y1IA 1XC9A 1IV0A 1WB9A 2G8IA 5HRPA 3L2UA 3TABA 4LF8K 4K25A 2NRXA 1QHTA 2B6AA 1HYSA 3K2PA 3BZKA 2QKBA 3VQ4A 2HBLA 1UA1A 5K14A 3AO2A 3SJHA 2XO7A 4A61A 4WE1A 4N5SA 3BGRA 1YJ9N 4BDPA 2CGLA 4AHUA 3U6FA 5HLFA 4CZGA 1VQ5N 3SQ0A 3J7ZO 1WLJA 4M63C 3O1WA 4H03B 1HX1A 3CJBA 1N6QA 4R79A 3E66A 1N8RO 5HBMA 3DLKA 4CGGA 3K5MA 2RE2A 4FJIA 1KFDA 2ASOA 5J2NA 2HMPA 1RDAA 1XHXA 3BF3A 3TTCA 4DUZK 3D45A 5GINA 1YXQA 3FZHA 5AQIA 4KV8A 1QSSA 4OPKA 1G15A 3MN7A 3PV8A 3CC4N 3OYGA 3CQXA 3MEDA 3HO1A 2IIRA 4OO1J 4JHDA 4CJTA 3E1YA 5DK5A 1L3UA 3AVKA 4AHTA 3VEVA 3VN5A 2UXDK 4BE1A 5SZTA 1WN7A 4DR6K 1L3VA 3OYLA 2JWKA 1OVYA 3SBGA 1Y97A 1S6QA 4JI7K 2DFEA 2ZWHA 3HXMA 4JS5A 3CHWA 3HBTA 3AVAA 4O44A 4JI3K 1HLUA 3A5NC 4IWVA 5FRNA 4BRAA 3E9LA 4CHOA 3TANA 1YHQN 1D8YA 5C25A 4X65K 1NKCA 1JLGA 5AQHA 1OH5A 3QLHA 3TPQA 3PX6A 3KVGA 3KD5E 4CFDA 2PYLA 1VSHA 1TK0A 3MN6A 4I6MB 1Z05A 1LWCA 3Q7BA 4CJKA 1OH7A 5KPZA 4I2PA 4BQLA 1RDBA 5A2QO 4B3OA 4FM1A 3PX4A 2HHWA 3I8DA 3U4LA 3VTIA 2KTQA 4Y1CA 3O3FA 2RF2A 3HP6A 3RR8A 4KKOA 1CZAN 1H1VA 1BQMA 1JCGA 1Q8IA 2NNWA 3AA2A 1SKWA 4CJSA 4FVMA 3FE1A 1B9FA 4H0YB 3OVNA 1GOAA 5M1PA 1VSFA 1QQCA 2HW3A 2A1SA 2W41A 3VOVA 3SV3A 4H0PA 1D4XA 5M1QA 4BC3A 1T7PA 1SS6A 4Y1DA 3KJVA 1Q81O 1FXXA 5CZ2A 1U45A 4H0XB 1DT9A 1U04A 1X9MA 1DKGD 1ASUA 4Y0WA 3WUHA 2GUIA 2YKNA 2P9KB 3C6AA 3LDLA 5IWAK 1BIZA 1ZBUA 1NJXA 3I55N 3PSIA 1GLBG 1UA0A 3ZX2A 3DYAA 3NH1A 1IKVA 2QTDA 5E41A 3DLLL 1SKSA 2I7NA 2FXUA 4B3MK 3OYAA 5CYMA 5JVGL 1VSKA 3KLFA 3IDHA 3EE8A 5AR0A 1QVFM 4B3SK 1E4FT 3I8BA 2CGJA 5AQSA 5E84A 3CPEA 3OJUA 1SZ2A 1X9SA 4BDZA 4FPBA 4HTLA 1LW2A 1S1UA 4NXNK 3TAEA 1T03A 4FJHA 2Z1GA 2Q31A 1ZBHA 1EQYA 1EX4A 2ZGZA 4OJRA 5BPNA 4HUEA 4B1VA 3CCSN 1KAZA 2PAVA 1LOTB 1VQNN 2YHWA 3MMVA 1LAVA 4DS4A 1NGDA 3H1QA 4B1WB 2AP1A 4AHSA 4JKFA 5M1OA 3QMLA 3HVTA 4PL8A 1VQ8N 4E0DA 3NF6A 1X1PA 3ZSXA 2P9SB 4ELTA 3HZ6A 4WQ5C 4KTQA 1KTQA 4L3QA 4O5BA 3KKRA 4XH4A 1X9WA 1EXQA 4Z94A 4E7JA 1JKHA 3M3ZA 4ISEA 4PWDA 3EEQA 3K58A 3EY1A 3RMDA 4JK7A 4BRLA 5T7BA 1SUQA 1EP4A 3WXKA 2NUBA 4CFAA 2Q36A 1L3SA 3KLGA 3I56N 2QKKA 2BUPA 4LF5K 2HNZA 3CIPA 5C10A 5E26A 3PO5A 1X3NA 3L0QA 2XY7A 4CF8A 5D3GA 5AQMA 4MLEA 5AQXA 4CJ4A 4K43A 3K5NA 3MXIA 1YITN 3LP3A 4BRKA 4DQQA 2KKZA 2Z1JA 4EIAA 5J2PA 2PY5A 2X6NA 4CHYA 3HSCA 2V52B 1VAZA 4DQPA 2O8EA 3HOTA 3DXMA 4BRGA 3LM9A 2HB5A 1RBUA 3VQCA 3NGIA 4DV6K 2D5RA 3P38A 4DSFA 3MWPA 3THWA 4M7YA 3SUOA 3EYZA 3LPTA 3BZCA 3K59A 4DV1K 2G8UA 3QEPA 1D9FA 2E2QA 1JLFA 1EWRA 5LJWA 2ITGA 2O8FB 4BR7A 1WSIA 4IFEA 4L8RB 1K8KA 3P1GA 1Q82O 3CM6A 5BRDA 2NRRA 1R59O 2HHSA 2QW9A 1C6VA 5B8HA 3HVRA 1C0MA 3ZT1A 3OA9A 4FJXA 1FKOA 4GNIA 4Z0UA 5C0YA 4CZMA 2NRTA 3CJCA 2E2OA 2D4WA 4FK4A 4M41A 3SAFA 2ASPA 3VETA 4IO8A 2XRIA 3H3NO 1BG3A 5AQTA 3M8RA 3IMXA 4FWLA 3C7NB 1HKBA 2HHXA 4NLCA 2B5JA 5BN9A 1BCMA 2Z1HA 5EOYA 4C8MA 1UWBA 3L4IA 1N33K 4OVLA 3DXKB 3IFRA 5J2MA 4AHVA 3T19A 1IO2A 3O08A 1JLCA 3OYFA 4BC5A 3V1QA 2YNIA 3NF7A 1KD1O 1HNWK 4V19S 2ZD1A 2A42A 2NRZA 2Q0UA 1JXBA 1BCOA 3DRSA 5AQZA 4CHQA 1J5OA 4FOEA 4KHQA 4FLWA 1RCHA 3T7ZA 3AAQA 4RW6A 3KK7A 3H6EA 4XH1A 4M42A 5JICA 2QEXN 3D2EB 1YIJN 4CECA 3HM8A 2D1KA 1WSGA 3O80A 3WXLA 4NYFA 3QIPA 3G6EN 4GV6A 4LF9K 4CFCA 4KREA 2KZZA 1XC3A 4KTZA 4BQZA 3WEEB 4B9LA 4KO0A 4JKAA 3CI5A 1EWQA 4PKHA 3K5LA 4RG8A 4O55A 4FJNA 3A8YA 5I42A 2G8VA 4JKGB 2A3ZA 4CI6A 4DU3A 1HKGA 3JXUA 3OYEA 4IBNA 3FR0A 1GLCG 4JLHA 1TUYA 1OH8A 4YOTA 2I7PA 4LSLA 2D0AA 3CCUN 1T44A 4A59A 4MO4A 3ZSZA 3CF5L 2HHHK 4OLBA 5AFUH 1V4SA 2O8CA 3L8BA 4XIUA 3VEOA 4CZFA 1BUPA 1WOQA 4I9QA 3WXJA 3D2FB 1S9GA 1S72N 3I0SA 4CIEA 1T6DA 3LALA 1I94K 1W9HA 3RMAA 1X3MA 2DFFA 3MWTA 4CBWA 1U2VB 2JLEA 4H8KA 1TKXA 2E2NA 1QZ6A 4HTUA 1TAUA 2P51A 3H1VX 2VWBA 2F4VK 3WQTA 4DTPA 3ZLJA 3NHGA 4DFMA 3ZSOA 3F9KA 1VRTA 3RSEB 1NG9A 4FJGA 4LY7A 2QXFA 4BRFA 3VMFB 4PL7A 1TL3A 3FZMA 2O8DB 4AF1A 4ISGA 4H0VB 3TU5A 4DKWA 1GOBA 4H5WA 3NF8A 1NK9A 3MN5A 1TK8A 4FWOA 3R6MA 4A2AA 5GAGP 3UKRA 2P9UA 2GUPA 4U67L 3K9JA 5GIPA 1ZBIA 3AVNA 1WSEA 4EAHD 1RTIA 2XY6A 1GLJO 4FWPA 3TTFA 2H3GX 3T1AA 3OYCA 3NMUA 5CR4A 1RDWX 1BL3A 4CVNE 3T1YK 1RILA 1NJIO 1HYZA 4GW6A 1GLEG 5FROA 4NB4A 2X74A 4YOUA 4IEIA 4CEBA 2VG7A 5EXWA 4ICLA 3GDQA 1VSDA 3VQ9A 3EL2A 4FJMA 3J8AA 3GOIA 3NVMA 4C1NI 1NNEA 4CJLA 2G8WA 2KFNA 2YV0X 3ZYYX 4O5FA 2UU9K 1RGIA 3NFAA 4YOVA 3PIOL 1EO1A 5AQUA 1NGGA 4B9MA 3EKUA 3O8MA 2YJFA 4CF2A 3UE5A 2VCPA 3BP8A 2HBMA 5JLFA 1ZXOA 3MK6A 1KSPA 5EY4A 2WBNA 1S9EA 1VQ4N 3AGKA 5H1SQ 2E6MA 4KHUA 3UKUA 4CZHA 3FFKB 3RRHA 4AHRA 5KRSA 2HF3A 2ZF5O 3GBTA 3GE1A 2W42A 3RVCA 4OGEA 4A5BA 1IBLK 4DV4K 3RTVA 2HVHA 1J53A 3ZEUA 1W2BM 3R3LA 1IKYA 4FM2A 1J54A 3H3OB 4O0IA 1YJWN 2D0BA 3O9UA 1YI2N 1DTTA 3L2VA 4CHZA 4K8ZA 1SKRA 2BDPA 4YOXA 4CK3A 3VF4A 3KK2A 3CFRA 5DMRA 1JL2A 3VEXA 4FSVA 1C0TA 4X64K 4M3UA 4B9TA 1KLMA 3ZSRA 3OYJA 3JAMO 1HQUA 1P90A 4B8AB 4HWIA 1NKEA 4BRHA 3ZX0A 3AVCA 2Q97A 2OPSA 2IOCA 2QI2A 4FPAA 1MWKA 1S6PA 2VGNA 3ZSQA 4JRPA 4ILHA 2OPRA 2QWRA 4EHUA 3SNNA 1KAXA 1YF5L 3AA3A 4MQ3A 3B6PA 3QEIA 5JMVA 4AM7A 1VQ7N 2VG5A 2GWJA 2VWKA 4IOXA 3IAYA 5FRMA 4JV5K 4JYAK 5ADXA 2GX9A 2AA4A 4B9QA 2OPQA 2P9PA 1DTQA 4JD2B 4FLUA 1VSLA 3LDPA 1Q9XA 2DY4A 2HBJA 1DGKN 4RW9A 3THXA 3VQQA 3TAFA 4CEQA 2ASMA 3CM5A 4KH6A 4BG8A 5KGXA 2AJQA 1KCFA 3FFIA 5AJ3K 1ATRA 4JI5K 1L3TA 1JLBA 2OZSA 4LF6K 4ZTJA 2W40A 2G8KA 5BR9A 3NVKA 4GKJK 4C8OA 4A5AA 1VQPN 2BGGA 3AO4A 1O1WA 4CW7B 3L4QA 5LMUK 2G8FA 4BRQA 3CD6N 4CJWA 3QFUA 3F73A 4ISFA 2YNHA 4KTWA 3DM2A 3V4IA 1NWKA 3CYMA 3DAWA 2YNGA 1NK7A 3WNEA 1K8AO 2E8AA 3F5TA 2ATQA 3CCLN 4KHSA 4ILJA 5AQNA 4RTFD 4BACA 4B1ZA 3VENA 1B9DA 5EX5A 3KHYA 2IDOA 1RBVA 1S3XA 4DTOA 2ETJA 4CGJA 1NGHA 1W97L 4IDKA 4IXCA 3WNHA 1QSYA 5CYQA 2ZQBA 5C42A 3CJAA 4CJ7A 3CPWM 2Z1IA 4IJAA 4FWSA 3OYBA 1KLNA 1KVAA 3SQ4A 4JI1K 3VQ5A 1BIUA 4F2RA 4KPYA 1N34K 4OLAA 2A6AA 3TWHA 4WCEL 3EN9A 4BGBA 4DSIA 4O4GA 5GAHP 4CEZA 1F21A 4FZXC 3O3GA 4I7FA 3VQAA 4CD3A 4N76A 3BUZB 1OKJA 3QESA 1LW0A 3OYIA 1L5UA 1QHAA 4CJUA 1XMOK 4E7KA 3CG7A 3K9KA 4B08A 3I33A 1FKPA 1NGCA 1WSJA 3LANA 4YORA 2FF6A 3OHRA 1BU6O 4N56A 2Q3SA 4TSXA 4DU4A 4DR1K 4CGFA 5CHIA 2J4RA 4DFPA 5IT9O 4DSLA 1YUWA 3NAEA 1HR0K 3QFPA 4OKKA 3G4SN 4FK2A 4XEIA 3VF6A 3DOLA 4I6MA 4Z4IA 3DLBA 1BA1A 2UXCK 2FF3B 4LD0A 3SQ2A 4FCYA 5SWMA 1VQLN 4BDYA 2GWKA 2YX6A 1YJNN 1CXUA 1WBDA 2PBDA 5FLXO 4B3RK 2P9LB 4DHYA 1ZC6A 3THVA 5AQQA 4OX9K 3VEZA 3L2QA 4B1UB 2ZGYA 4E3SA 1VK0A 3R1XA 2D0OA 1BO5O 4LF7K 5TKWA 4Z4CA 1GOCA 3NDKA 4JI2K 4KB1A 3O9QA 4BR0A 5KRTA 1EETA 5C15A 1OH6A 4B1XB 2E1YA 2X78A 4RWTA 1RTHA 4Q5VA 4B9NA 3CJ9A 4JK8A 2P9NA 2F8SA 2IC3A 4CZLA 2GV9A 1VQ9N 5KGWA 2P9IB 3PUFA 3DLRA 1XNQK 2O4IA 4DLEA 2P9KA 4HCBA 1C1CA 3FLCO 1RT1A 3VA0A 3SPYA 2F8TA 2OCEA 3KZBA 1VSMA 3TI0A 1UOCA 3VESA 4BRPA 4CZEA 4UY8O 2FBTA 3AVGA 1IBMK 4EZ6A 3QINA 3KWGA 3U3YA 3CJ1A 2HMIA 3V81A 4OPAA 4I2QA 3TARA 3CCRN 1REVA 2E1ZA 2OANA 1CZBA 1U4BA 2IVNA 3SV4A 1NOZA 2FBYA 2HBKA 4CE9A 4ID1A 3J7AP 4CJEA 3JSMA 3RR7A 1S1WA 3AVLA 3L3UA 3LAMA 3HP9A 3O6WA 3HI0A 2R7YA 5AZIB 5LY3A 2ZJQL 3MX2A 1KC8O 4QCLA 1NMDA 4PQUA 3AVJA 4DQ8A 5DM7L 4F8RA 3HM9A 1BQNA 1RT4A 3AVIA 1R0AA 2E2PA 3DRPA 3OS1A 4IZ9A 3L3VA 4E7HA 2QWQA 4E7LA 4EP4A 2P9SA 4FJJA 3SUQA 2GELA 3FZLA 1RDDA 3DOKA 3KIOA 4ZTFA 3TSQA 5AQVA 2QWLA 4BE0A 1NGJA 2F96A 1RDUA 4J2BA 5AZJB 1E3MA 1KXPA 1YTAA 4JI8K 4DV0K 4H5TA 4H4MA 4MFBA 3SAHA 4DQRA 3KLIA 3MECA 4RW7A 3KLHA 4DF8A 5GADP 3O4NA 3VEYA 3SUNA 2IGIA 4KB0A 4NCGA 4FWRA 3WNFA 4AQYK 3ULEB 2FSNA 2NRVA 1QE1A 3KD1E 3SLCA 2X6SA 1BGXT 4CBUA 4E1JA 1ASVA 4M3ZA 4DWIA 5KTQA 2BE2A 4YDUC 2YKMA 4W5NA 1ZBSA 4E89A 1WSHA 3LP1A 3U9ZA 1Q9YA 4Z4HA 4AH9A 4AM6A 3LAKA 5AQPA 2KLAA 2EHGA 1DLOA 4RCHA 5M1KA 3HT3A 1RT3A 4IKFA 3VA3A 1JLAA 2YHBA 4HUGA 5HP1A 4DTXA 4N41A 3OY9A 5C2DA 4BE2A 4BVPA 4E7IA 4KHWA 4QAGA 3V9XA 2GBZA 3S3NA 3M8QA 3QNOA 1KVBA 1HNVA 1T3VA 2QM1A 5F1XA 4B9SA 4HHTA 3ZSYA 3CFPA 3PY8A 1MWMA 2O8FA 2VGMA 2JGUA 5F2RA 4CEDA 3IG1A 1QQNA 1NK0A 3WNGA 5KI6A 5HOOA 1NK6A 3P83D 1RNHA 1NJYA 1U6ZA 3K57A 4YDUA 5EU7A 2RN2A 4FWKA 3S3MA 3PO4A 2YNFA 2E88A 3AO3A 3CETA 3NGYA 3NH2A 3O5BA 3IKMA 4K41A 3THYB 4IG0A 1NK4A 4JK9A 4JI0K 3VQ7A 1SL1A 3PIPL 2O8BB 3OYKA 4DTUA 3C7NA 3AO5A 3CCMN 1TUUA 3ITHA 3VQBA 4YFUA 1KAYA 1BWFO 2HNYA 1QQMA 3W3DA 4E1MA 3ZSWA 3AGRA 4JEPA 3A5OC 3DXKA 1TVRA 3QICA 1JL1A 4QS9A 3ALYA 4CEOA 1TV6A 4LSNA 4CBXA 3S9HA 4C8NA 4DR7K 1FW6A 4FYDA 1TYQB 3VGKA 4CK2A 4GV3A 1YAGA 1OVQA 4R5PA 3D6RA 3J7YP 2EX3A 1GLFO 4FW1A 4M3XA 3SMPA 4DV3K 4OPHA 4CHPA 2I5JA 1J9AA 1XI1A 4DTSA 4QS7A 3CCEN 1XHZA 3D2EA 4FWMA 4HVJA 4DTRA 1XQSC 4KRFA 4W5QA 1HRHA 2LSNA 4H5NA 2BTFA 3M8PA 3RWUA 3C6HA 4BRCA 3ULDA 3WEEA 3D7EO 4H4OA 5AQKA 1QZ5A 2E20A 5CY4A 3QB0A 4CGIA 1XMQK 1K73O 3LPUA 4C23A 1RBRA 3AV9A 1TKDA 3ENHA 5ELZA 1V4TA 3VGLA 3ZT4A 3DRRA 3K5OA 5JS1A 4PA1A 4EHTA 1U49A 4I9LA 3AVFA 2O4GA 4CZJA 3AVHA 5GIOA 1D9DA 5I9EB 1M1KO 4FZZA 1RTJA 1U48A 5HL7L 2QK9A 3V9SA 3D2FA 3QBWA 2P1JA 3P31A 5M1FA 3V9WA 4BR9A 4IFVA 3O9SA 2D0PA 4ZHRA 4FLTA 1YVUA 1ASWA 3C94A 1NU0A 2ZJPL 4YNQA 1U2VA 3LZIA 3AARA 2IVPA 2FSJA 4IDHA 5FPEA 2A41A 2HHQA 1NGEA 1SV5A 4NCAA 3RSEA 5TKYA 1N5YA 3AA4A 3MEGA 4LFCK 1VQ6N 3O1BA 1GLLO 2O8DA 4DSEA 1QTMA 1XWLA 4W5TA 3O4QA 1QS4A 2KHOA 3DWLA 3T1HK 3QO9A 1ATNA 1JCEA 3ZETB 2WOMA 4DFKA 4CF0A 1BI4B 4DFJA 4FW2A 1A5WA 3KLEA 1S1VA 1B92A 1IKXA 3PLAA 2F9WA 1IG8A 3EKSA 3OBYA 3K0SA 3C6TA 3MCAB 4KH5A 1SL0A 2UUAK 2OPPA 2Q2RA 3PSFA 4FWQA 2YHAA 3VERA 4Q0BA 4H5VA 1BHLA 3O4WA 3O9TA 3LZJA 3WT0A 4DR2K 2YI1A 3UIQA 1SAZA 4JRQA 1WAJA 4BRIA 3HK2A 2FC0A 1S1XA 3VF2A 1S1TA 4CIFA 4YY3K 1TKTA 3PX0A 4DV5K 2D0CA 3F9MA 4GY2B 1RBTA 1ZBLA 1BA0A 3HSTB 3AAPA 4M7XA 3TAGA 4RW4A 3CQYA 4NXMK 4JAXA 5KPTA 5LMNK 4JN4A 3OJSA 3MXJA 3ZCMA 2QWNA 3P4IA 1LV5A 4X62K 3H45C 4PKIA 3THXB 4KAZA 4LF4K 1E4GT 4O8KA 4DTNA 3KWIA 4JI6K 1T8EA 1Z6RA 4FK0A 3QETA 1YT3A 1RT5A 3VGMA
chains in the Genus database with same CATH topology
4I6MA 2EWSA 4JKGA 2Q1NA 3WXIA 4JHDB 1BA1A 2FF3B 2F9TA 3P38A 3SAGA 1RFQA 3MWPA 4H0OA 1VQLN 4M7YA 4WFAL 2GWKA 2YX6A 3G25A 1SQKA 1YJNN 1VQON 2PBDA 3LM2A 2YHXA 2P9LB 4DHYA 1ZC6A 1TYQA 2E2QA 3MN9A 2QXLA 5LJWA 1QVGM 5AQQA 3VEZA 4BR5A 4EFHA 3VPZA 4BR7A 2OTLN 2RHKA 2ZGYA 4IFEA 4B1UB 1K8KA 5FPNA 1MDUB 1Q82O 3R1XA 2V7ZA 2D0OA 1BO5O 4NO7A 5BRDA 2NRRA 5TKWA 4MDAA 1R59O 3SK3A 3O9QA 4BR0A 2CGKA 1KQSM 1GLAG 2QW9A 5B8HA 5C15A 3G71N 4B1XB 2E1YA 4RWTA 3OA9A 4GNIA 5C0YA 3CJ9A 5AQLA 4CZMA 4GV9A 2NRTA 3CJCA 5EVZA 5BRHA 2E2OA 4JK8A 2D4WA 2FLOA 2P9NA 5F0XA 3SAFA 2ASPA 4BREA 3VETA 4IO8A 4CZLA 3LDQA 2QWPA 3H3NO 4JKHA 1BG3A 3L6QA 1VQ9N 1XUPO 3E9PA 5AQTA 3UKUB 3OW2M 3IMXA 2P9IB 4FWLA 3C7NB 2P9KA 1HKBA 3EO3A 4NLCA 3C65A 3FLCO 4JKBA 5BN9A 3UB5A 1T6CA 5KPRA 3WQUA 3KZBA 3QDKA 5EOYA 3L4IA 1WUAA 3VESA 2NZTA 4FOIA 4BRPA 4CZEA 3DXKB 3IFRA 4JD2A 4WQ4C 4UY8O 2A40A 2V51B 2WFBA 3EZWA 3ZEUB 3O08A 3W0LA 3TSPA 5BREA 3KWGA 4MDBA 3TTDA 2PFUA 4MO5A 4BC5A 1KD1O 3CJ1A 4H0TB 4OPAA 2A42A 2NRZA 4B1YB 2Q0UA 1NGBA 4JKDA 3CCRN 2E1ZA 3CCJN 5AQZA 2OANA 3CXCM 1BDGA 1NGFA 2HSTA 3ATVA 2IVNA 3Q7CA 2BH1A 3GG4A 4FOEA 5AQOA 3T7ZA 4K42A 3AAQA 2HBKA 5JLHA 3KK7A 3H6EA 5BRFA 4XH1A 1O13A 1YVNA 4G9ZA 5JICA 1NBWA 4FL9A 2QEXN 3D2EB 3HTVA 1YIJN 3CC7N 3HM8A 2D1KA 4BY9C 1HPMA 4NLBA 1QQOA 3O80A 3WXLA 3A5MC 1Q86O 5AQJA 3G6EN 3O6WA 4GV6A 3HI0A 5BPMA 1XC3A 3HRGA 4KH4A 1C0FA 5AZIB 1X9JA 3WEEB 4BQZA 4PHTX 4ILGB 1C0GA 3MX2A 4JKAA 3C0BA 5LY3A 2ZJQL 3CI5A 1NMDA 1KC8O 3CMEN 4PKHA 4DQ8A 2NRHA 5DM7L 4KBOA 3VTHA 3QBXA 3A8YA 1VQMN 4JKGB 2A3ZA 2DPNA 4CI6A 3LDNA 3LDOA 2E2PA 3ENOA 1HKGA 3JXUA 1LCUA 3A0IX 4IZ9A 2QWQA 3FR0A 1NLVA 4QS8A 1GLCG 2P9PB 1TUYA 2P9SA 2QWOA 4WQ4A 3ZETA 4YOTA 4JKEA 2GELA 2IVOA 3VEWA 2I7PA 3ID8A 3FZLA 3IUCA 5ADXH 3CCUN 1T44A 4A59A 4MO4A 5FPDA 3TSQA 5FPMA 1Y64A 3GL1A 3ATUA 1ESVA 2QWLA 5AQVA 3CF5L 4F9OA 2JWLA 1NGJA 2GEMA 5AQRA 5AFUH 1V4SA 5LJVA 1RDUA 3BF1A 4WF9L 3M5RA 5AZJB 5AQWA 3VEOA 4A62A 1HUXA 4BRNA 3F2KA 1KXPA 2VYPA 4CZFA 1BUPA 1WOQA 3WXJA 3D2FB 3R9PA 4H5TA 3CMAN 3SAHA 1S72N 4K25A 1T6DA 2NRXA 5GADP 4PKGA 3VEYA 1X3MA 3MCPA 2HF4A 4WYBA 4IEEA 2HBLA 3MWTA 4FWRA 4BROA 4CBWA 1U2VB 2P9NB 3SJHA 2E2NA 1QZ6A 3ULEB 2FSNA 4A61A 2NRVA 1YJ9N 2CGLA 3H1VX 2VWBA 1VQ5N 3SLCA 4CZGA 3WQTA 4CBUA 4E1JA 1Q7YO 2OTJN 3RSEB 3J7ZO 4M63C 3O1WA 4H03B 4BRFA 3VMFB 4PL7A 3FZMA 1HX1A 4A2BA 1VQKN 4YDUC 4AF1A 3CJBA 4ISGA 4R79A 3E66A 4H0VB 3JS6A 3TU5A 4GVEA 4H5WA 4DKWA 1N8RO 3AY9A 3MN5A 1ZBSA 2RE2A 4FWOA 2YJEA 3R6MA 4A2AA 5GAGP 2ASOA 3UKRA 2P9UA 2GUPA 2HMPA 3BF3A 3K9JA 3U9ZA 3TTCA 4U67L 3ENBA 5GIPA 4FVUA 1JCFA 2YHYA 5GINA 1M90O 1YXQA 2V7YA 4AM6A 4EAHD 3FZHA 5AQIA 5AQPA 2KLAA 4U7BA 1GLJO 4FWPA 3MN7A 3N4PA 4RCHA 3MX5A 3S41A 5M1KA 3TTFA 3CC4N 2H3GX 3P39A 3CQXA 2WC9A 2IIRA 5AQGA 3NMUA 4OO1J 5CR4A 1RDWX 4JHDA 5C2DA 4BVPA 1NJIO 3R8EA 3E1YA 1GLEG 4IJNA 3VEVA 4NB4A 5BPLA 1T3VA 4YOUA 4IEIA 2QM1A 5F1XA 2P9LA 5EXWA 2JWKA 1OVYA 3U9DA 3GDQA 3SBGA 3EL2A 3CERA 1MWMA 3J8AA 3GOIA 2VGMA 3NVMA 4C1NI 2ZWHA 1G99A 5F2RA 3CHWA 3HBTA 4MLHA 1QQNA 4DCHA 4H5RA 1P8ZA 3ZYYX 4O5FA 5HOOA 1RGIA 3A5NC 1HLUA 4IWVA 3H46O 4BRAA 1U6ZA 4YOVA 4YDUA 1GLDG 3PIOL 3CJ7A 1EO1A 1ATSA 1HJOA 5AQUA 3M1FA 4FWKA 4A57A 1NGGA 1JJ2M 3E9LA 2E88A 3EKUA 1YHQN 3O8MA 3CETA 2YJFA 4BGAA 3O5BA 3UE5A 5JVHL 2VCPA 5AQHA 3IKMA 1Q18A 3BP8A 2HBMA 3FZFA 5JLFA 3B8AX 1ZXOA 4K41A 3TPQA 3MK6A 5EY4A 2WBNA 3KVGA 3AGKA 3DXMB 4JK9A 1VQ4N 5H1SQ 3UKUA 4CZHA 3FFKB 2P9IA 5GAEP 3PIPL 3C7NA 2HF3A 2ZF5O 3CCMN 3GBTA 3MN6A 1Z05A 1TUUA 3GE1A 3Q7BA 4I6MB 3BEXA 1KAYA 1BWFO 3RVCA 1QQMA 3W3DA 4A5BA 5KPZA 4LC9B 3AGRA 3O9RA 3M6GA 4JEPA 3A5OC 3DXKA 3QICA 4BQLA 4QS9A 1ILYA 3ZEUA 4CBXA 4IO9L 3EE9A 1W2BM 3R3LA 3FZKA 1TYQB 3VGKA 4BG9A 2CH5A 3U4LA 3VTIA 1YAGA 3H3OB 1YJWN 4GV3A 3O9UA 3D6RA 4FO0A 1CZAN 1H1VA 1JCGA 1YI2N 2NNWA 1GLFO 3SMPA 1K8KB 3FE1A 4OPHA 4H0YB 4CZIA 4YOXA 5M1PA 1S22A 3VF4A 3FGUA 3ZX3A 2HOEA 4QS7A 3VEXA 3CCEN 3OBWA 4FSVA 4YOWA 2W41A 3D2EA 4FWMA 4BVOA 1XQSC 3VOVA 4YOYA 5AQYA 1P90A 4H5NA 4BR2A 4H0PA 2BTFA 4HWIA 4BRHA 1D4XA 3ZX0A 5M1QA 3C6HA 4WQ5A 1NGAA 2A5XA 2Q97A 4BC3A 4BRCA 2QI2A 4FPAA 3D7EO 1MWKA 5AZIA 3WEEA 1SS6A 5AQKA 1QZ5A 2E20A 2VGNA 4IOCL 3QB0A 4ILHA 2CH6A 2QWRA 4EHUA 1Q81O 1K73O 4C23A 1KAXA 1YF5L 4CD1A 4H0XB 1DT9A 2GTDA 1DKGD 4Y0WA 5JMVA 4AM7A 1VQ7N 3WUHA 2P9KB 2GWJA 3C6AA 3LDLA 4IOXA 3ENHA 5ELZA 1V4TA 4BRMA 3VGLA 5ADXA 2GX9A 2NRWA 2AA4A 3I55N 4B9QA 5MLCQ 1HKCA 2P9PA 3HOSA 1GLBG 4JD2B 5AFUA 3ZX2A 4EHTA 2QTDA 5KQDA 2NLXA 3LDPA 2Q0RA 3DLLL 2I7NA 5AQFA 2FXUA 2HBJA 1DGKN 5JVGL 2QWMA 1MA9B 4FWNA 2ASMA 4CZJA 4KH6A 4BG8A 5GIOA 3DJCA 3A5LC 3IDHA 3EE8A 3T69A 5AZJA 5AR0A 5I9EB 1M1KO 1ATRA 1QVFM 4IOAL 1E4FT 3I8BA 5M1NA 2CGJA 5AQSA 5HL7L 5E84A 1J6ZA 1NM1A 3D2FA 3QBWA 3CPEA 2W40A 3P31A 1SZ2A 5M1FA 4BR9A 5BR9A 3O9SA 2D0PA 3LL3A 2ZJRL 3NVKA 4FPBA 4A5AA 4HTLA 1VQPN 4C1NK 5C12A 2ZJPL 2Q31A 1U2VA 2QA4N 3AARA 3L4QA 3ULEA 4BRQA 4BC2A 2IVPA 3CD6N 2FSJA 1EQYA 2ZGZA 5BPNA 3QFUA 4ISFA 4IDHA 4B1VA 4XH5A 5FPEA 1KAZA 2A41A 3CCSN 2PAVA 5DM6L 2YCHA 4BC4A 1LOTB 1NGEA 2YHWA 3RSEA 1NWKA 5TKYA 3SBTA 3MMVA 1VQNN 1NGDA 3H1QA 4B1WB 2AP1A 3DAWA 3O1BA 1GLLO 1VQ6N 4JKFA 5M1OA 2E8AA 3F5TA 1K8AO 3CCLN 3QMLA 4ILJA 5CE3A 2ITMA 4PL8A 3CC2N 3VF6A 2KHOA 3DWLA 5AQNA 4RTFD 1VQ8N 4B1ZA 3VENA 5EX5A 1ATNA 3KHYA 1JCEA 2P9SB 3ZETB 3N4QA 1S3XA 3WXMB 4BRDA 3HZ6A 4WQ5C 1NGHA 1W97L 4IXCA 4L3QA 5KQ8A 4CZKA 4XH4A 2F9WA 3CJAA 3PLAA 3CCVN 1IG8A 3EKSA 1DEJA 3OBYA 4CJ7A 4Z94A 3M3ZA 4ISEA 3CPWM 4IJAA 4FWSA 3ID6A 3MCAB 4KH5A 4DB3A 4JK7A 2Q2RA 4FWQA 2UYTA 4BRLA 3WXKA 2FSKA 3VERA 2A6AA 4H5VA 2Q36A 4WCEL 3O4WA 3EN9A 3I56N 4BGBA 3O9TA 5GAHP 3WT0A 4O8UA 2BUPA 2YI1A 5C2FA 1SAZA 3CIPA 5C10A 5BN8A 4BRIA 5E26A 4CD3A 3BUZB 1IJJA 1X3NA 3L0QA 4BR4A 1OKJA 4JKCA 3VF2A 1K9MO 1QHAA 1NGIA 3F9MA 1BOTO 4JNEA 4GY2B 4K43A 4MLEA 5AQMA 5AQXA 4WFBL 3CCQN 1BA0A 3K9KA 3AAPA 1YITN 4M7XA 3I33A 2WUSA 4BRKA 2KKZA 2F7TA 3CQYA 1NGCA 4JAXA 3SMSA 4EIAA 4YORA 5KPTA 4JN4A 2FF6A 3OHRA 1BU6O 3UKRB 2P9UB 2QWNA 3P4IA 4J8FA 3HSCA 5CHIA 3H45C 2V52B 1VAZA 3MDQA 4PKIA 1E4GT 2J4RA 4O8KA 3HOTA 3KWIA 1YUWA 3DXMA 3LM9A 3U8XA 4BRGA 3E9OA 3TSUA 1Z6RA 3QFPA 3G4SN 4WFNL 4XEIA 3VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M A;  2EWS A;  2Q1N A;  3WXI A;  4JHD B;  1BA1 A;  2FF3 B;  2F9T A;  1RFQ A;  4H0O A;  4M7Y A;  2GWK A;  3G25 A;  1SQK A;  2PBD A;  3LM2 A;  2YHX A;  2P9L B;  4DHY A;  1ZC6 A;  1TYQ A;  2E2Q A;  3MN9 A;  2QXL A;  5LJW A;  5AQQ A;  3VEZ A;  4BR5 A;  4EFH A;  3VPZ A;  4BR7 A;  4B1U B;  2ZGY A;  1K8K A;  5FPN A;  1MDU B;  2V7Z A;  2D0O A;  1BO5 O;  4NO7 A;  5BRD A;  1R59 O;  3SK3 A;  4BR0 A;  2CGK A;  1GLA G;  2QW9 A;  5B8H A;  4B1X B;  2E1Y A;  4RWT A;  4GNI A;  3CJ9 A;  5AQL A;  4CZM A;  5EVZ A;  3CJC A;  5BRH A;  2E2O A;  2D4W A;  2FLO A;  2P9N A;  5F0X A;  2ASP A;  4BRE A;  3VET A;  4IO8 A;  4CZL A;  3LDQ A;  2QWP A;  3H3N O;  1BG3 A;  3L6Q A;  1XUP O;  5AQT A;  3UKU B;  3IMX A;  2P9I B;  4FWL A;  3C7N B;  2P9K A;  1HKB A;  3EO3 A;  3FLC O;  3UB5 A;  5BN9 A;  1T6C A;  5KPR A;  3WQU A;  3KZB A;  3QDK A;  5EOY A;  3L4I A;  1WUA A;  3VES A;  2NZT A;  4FOI A;  4BRP A;  4CZE A;  3DXK B;  3IFR A;  4JD2 A;  4WQ4 C;  2A40 A;  2V51 B;  3EZW A;  3ZEU B;  3O08 A;  3W0L A;  5BRE A;  4MO5 A;  4BC5 A;  3CJ1 A;  4H0T B;  2A42 A;  4B1Y B;  2Q0U A;  1NGB A;  2E1Z A;  5AQZ A;  2OAN A;  1BDG A;  1NGF A;  3ATV A;  2IVN A;  3GG4 A;  4FOE A;  5AQO A;  5JLH A;  4K42 A;  3AAQ A;  3H6E A;  5BRF A;  4XH1 A;  1YVN A;  5JIC A;  1NBW A;  4FL9 A;  3D2E B;  3HTV A;  3HM8 A;  2D1K A;  1HPM A;  1QQO A;  3O80 A;  3WXL A;  3A5M C;  5AQJ A;  3O6W A;  3HI0 A;  5BPM A;  1XC3 A;  4BQZ A;  1C0F A;  5AZI B;  1X9J A;  3WEE B;  5LY3 A;  1C0G A;  3C0B A;  3CI5 A;  1NMD A;  4PKH A;  4DQ8 A;  2NRH A;  4KBO A;  3QBX A;  3A8Y A;  2A3Z A;  2DPN A;  4CI6 A;  3LDN A;  3LDO A;  2E2P A;  3ENO A;  1HKG A;  3JXU A;  1LCU A;  3A0I X;  4IZ9 A;  2QWQ A;  3FR0 A;  1NLV A;  4QS8 A;  1GLC G;  2P9P B;  1TUY A;  2P9S A;  2QWO A;  4WQ4 A;  3ZET A;  2GEL A;  2IVO A;  3VEW A;  2I7P A;  3ID8 A;  3FZL A;  3IUC A;  5ADX H;  1T44 A;  4MO4 A;  5FPD A;  5FPM A;  1Y64 A;  3GL1 A;  3ATU A;  1ESV A;  2QWL A;  5AQV A;  4F9O A;  1NGJ A;  2GEM A;  5AQR A;  5AFU H;  1V4S A;  5LJV A;  3BF1 A;  5AZJ B;  5AQW A;  3VEO A;  4A62 A;  1HUX A;  4BRN A;  1KXP A;  2VYP A;  4CZF A;  1BUP A;  1WOQ A;  3WXJ A;  3D2F B;  3R9P A;  4H5T A;  4K25 A;  1T6D A;  4PKG A;  3VEY A;  1X3M A;  3MCP A;  2HF4 A;  4WYB A;  4FWR A;  4BRO A;  4CBW A;  1U2V B;  2P9N B;  3SJH A;  2E2N A;  1QZ6 A;  3ULE B;  2FSN A;  4A61 A;  2CGL A;  3H1V X;  2VWB A;  3SLC A;  4CZG A;  3WQT A;  4CBU A;  4E1J A;  3RSE B;  4M63 C;  3O1W A;  4H03 B;  4BRF A;  4PL7 A;  3FZM A;  1HX1 A;  4A2B A;  4YDU C;  3CJB A;  4ISG A;  4H0V B;  3TU5 A;  3JS6 A;  4H5W A;  3AY9 A;  3MN5 A;  1ZBS A;  4FWO A;  2YJE A;  3R6M A;  4A2A A;  2ASO A;  3UKR A;  2P9U A;  2GUP A;  2HMP A;  3BF3 A;  3U9Z A;  1JCF A;  2YHY A;  1YXQ A;  2V7Y A;  4AM6 A;  4EAH D;  3FZH A;  5AQI A;  5AQP A;  1GLJ O;  4FWP A;  3MN7 A;  4RCH A;  3S41 A;  2H3G X;  3CQX A;  2IIR A;  5AQG A;  1RDW X;  4JHD A;  4BVP A;  3R8E A;  1GLE G;  4IJN A;  3VEV A;  4NB4 A;  5BPL A;  2QM1 A;  5F1X A;  2P9L A;  5EXW A;  3U9D A;  3GDQ A;  3EL2 A;  3CER A;  1MWM A;  3J8A A;  3GOI A;  2ZWH A;  1G99 A;  5F2R A;  3CHW A;  3HBT A;  4MLH A;  1QQN A;  4DCH A;  4H5R A;  1P8Z A;  4O5F A;  1RGI A;  3A5N C;  1HLU A;  4IWV A;  3H46 O;  4BRA A;  1U6Z A;  4YDU A;  1GLD G;  3CJ7 A;  1ATS A;  1HJO A;  5AQU A;  3M1F A;  4FWK A;  1NGG A;  2E88 A;  3EKU A;  3O8M A;  3CET A;  2YJF A;  4BGA A;  3O5B A;  3UE5 A;  2VCP A;  5AQH A;  1Q18 A;  3BP8 A;  3FZF A;  5JLF A;  3B8A X;  1ZXO A;  4K41 A;  3TPQ A;  3MK6 A;  5EY4 A;  3KVG A;  3DXM B;  3UKU A;  4CZH A;  3FFK B;  2P9I A;  3C7N A;  2HF3 A;  2ZF5 O;  3GBT A;  3MN6 A;  1Z05 A;  1TUU A;  3GE1 A;  4I6M B;  3BEX A;  1KAY A;  1BWF O;  1QQM A;  3W3D A;  5KPZ A;  4LC9 B;  3M6G A;  3A5O C;  3DXK A;  3QIC A;  4BQL A;  4QS9 A;  3ZEU A;  4CBX A;  3FZK A;  1TYQ B;  3VGK A;  4BG9 A;  2CH5 A;  3U4L A;  1YAG A;  3H3O B;  4FO0 A;  1CZA N;  1H1V A;  1JCG A;  1GLF O;  3SMP A;  1K8K B;  3FE1 A;  4H0Y B;  4CZI A;  1S22 A;  3VF4 A;  3FGU A;  3ZX3 A;  2HOE A;  4QS7 A;  3VEX A;  4FSV A;  2W41 A;  3D2E A;  4FWM A;  4BVO A;  1XQS C;  3VOV A;  5AQY A;  4H5N A;  4BR2 A;  4H0P A;  2BTF A;  4HWI A;  4BRH A;  1D4X A;  3ZX0 A;  4WQ5 A;  1NGA A;  2A5X A;  2Q97 A;  4BC3 A;  4BRC A;  3WEE A;  4FPA A;  3D7E O;  1MWK A;  5AZI A;  5AQK A;  1QZ5 A;  2E20 A;  3QB0 A;  2CH6 A;  2QWR A;  4EHU A;  4C23 A;  1KAX A;  4CD1 A;  4H0X B;  2GTD A;  1DKG D;  4Y0W A;  5JMV A;  4AM7 A;  3WUH A;  2P9K B;  2GWJ A;  3LDL A;  3ENH A;  5ELZ A;  1V4T A;  4BRM A;  3VGL A;  5ADX A;  2AA4 A;  4B9Q A;  1HKC A;  2P9P A;  1GLB G;  4JD2 B;  5AFU A;  3ZX2 A;  4EHT A;  5KQD A;  2NLX A;  3LDP A;  2Q0R A;  2I7N A;  5AQF A;  2FXU A;  1DGK N;  2QWM A;  1MA9 B;  4FWN A;  2ASM A;  4CZJ A;  4BG8 A;  3DJC A;  3A5L C;  3IDH A;  5I9E B;  5AZJ A;  5AR0 A;  1ATR A;  1E4F T;  3I8B A;  2CGJ A;  5AQS A;  5E84 A;  1J6Z A;  1NM1 A;  3D2F A;  3QBW A;  2W40 A;  1SZ2 A;  4BR9 A;  5BR9 A;  2D0P A;  3LL3 A;  4FPB A;  4HTL A;  2Q31 A;  1U2V A;  3AAR A;  3ULE A;  4BRQ A;  4BC2 A;  2IVP A;  2FSJ A;  1EQY A;  2ZGZ A;  5BPN A;  3QFU A;  4ISF A;  4B1V A;  4XH5 A;  5FPE A;  1KAZ A;  2A41 A;  2PAV A;  2YCH A;  4BC4 A;  1LOT B;  1NGE A;  2YHW A;  3RSE A;  1NWK A;  5TKY A;  3MMV A;  1NGD A;  3H1Q A;  4B1W B;  2AP1 A;  3DAW A;  3O1B A;  1GLL O;  2E8A A;  3QML A;  5CE3 A;  2ITM A;  4PL8 A;  3VF6 A;  2KHO A;  3DWL A;  5AQN A;  4RTF D;  4B1Z A;  3VEN A;  5EX5 A;  1ATN A;  3KHY A;  1JCE A;  2P9S B;  3ZET B;  1S3X A;  4BRD A;  3HZ6 A;  4WQ5 C;  1NGH A;  4IXC A;  4L3Q A;  5KQ8 A;  4CZK A;  4XH4 A;  2F9W A;  3CJA A;  1IG8 A;  3EKS A;  1DEJ A;  4Z94 A;  4CJ7 A;  3M3Z A;  4ISE A;  4IJA A;  4FWS A;  4DB3 A;  2Q2R A;  4FWQ A;  2UYT A;  4BRL A;  3WXK A;  2FSK A;  3VER A;  2A6A A;  4H5V A;  2Q36 A;  3O4W A;  3EN9 A;  4BGB A;  3WT0 A;  2BUP A;  2YI1 A;  1SAZ A;  3CIP A;  5BN8 A;  4BRI A;  5E26 A;  4CD3 A;  3BUZ B;  1IJJ A;  1X3N A;  3L0Q A;  4BR4 A;  1OKJ A;  3VF2 A;  1QHA A;  1NGI A;  3F9M A;  1BOT O;  4JNE A;  4GY2 B;  4K43 A;  4MLE A;  5AQM A;  5AQX A;  1BA0 A;  3AAP A;  4M7X A;  3I33 A;  2WUS A;  4BRK A;  3CQY A;  1NGC A;  4JAX A;  3SMS A;  4EIA A;  5KPT A;  4JN4 A;  2FF6 A;  3OHR A;  1BU6 O;  3UKR B;  2P9U B;  2QWN A;  3P4I A;  4J8F A;  3HSC A;  3H45 C;  2V52 B;  3MDQ A;  4PKI A;  1E4G T;  2J4R A;  4O8K A;  1YUW A;  3DXM A;  3LM9 A;  3U8X A;  4BRG A;  1Z6R A;  3QFP A;  4XEI A;  3VGM A; 
#chains in the Genus database with same CATH topology
 4DSJ A;  2Q1N A;  1JXE A;  3WXI A;  2P5G A;  4JHD B;  2ZE2 A;  3KKS A;  4EZ9 A;  2VQE K;  1RFQ A;  3KTQ A;  1MU2 A;  1SQK A;  2UUC K;  2YHX A;  4UQG A;  1N32 K;  2QXL A;  3AO1 A;  2WON A;  2DFH A;  4BR5 A;  3VPZ A;  5FPN A;  2WTU A;  2V7Z A;  4Z4E A;  3QNN A;  5C24 A;  2OZM A;  4DQS A;  4F4K A;  1TKZ A;  1TK5 A;  3SUP A;  1LAW A;  3G71 N;  2KFZ A;  1HYV A;  1FJG K;  1IKW A;  4GV9 A;  5BRH A;  3HPG A;  4NCB A;  2FLO A;  5F0X A;  3G10 A;  4DR5 K;  1C1A A;  4J2A A;  3T3F A;  2QWP A;  4JKH A;  3L6Q A;  1WNS A;  3E9P A;  4M3W A;  3A2F A;  4G1Q A;  3C65 A;  4JKB A;  3UB5 A;  1T6C A;  3ZT3 A;  5KPR A;  3WQU A;  3QDK A;  4FOI A;  4JD2 A;  1NKB A;  2A40 A;  2V51 B;  2WFB A;  3EZW A;  3IS9 A;  4F3O A;  3S3O A;  3TSP A;  5BRE A;  1CZ9 A;  4OKE A;  3TTD A;  2PFU A;  4MO5 A;  4CES A;  3OS0 A;  4CHN A;  4JKD A;  3CCJ N;  4W5O A;  1BDG A;  3ATV A;  2BH1 A;  3GG4 A;  1N36 K;  3TR8 A;  5BRF A;  3EZ5 A;  1O13 A;  1NBW A;  3CFO A;  3HTV A;  4AIL C;  3CC7 N;  1RT2 A;  1RT6 A;  4FJ9 A;  4NLB A;  4DUY K;  3QER A;  2HND A;  4CFB A;  5AQJ A;  3HRG A;  4KH4 A;  4PHT X;  1CXQ A;  1C0G A;  4FJL A;  3OYN A;  3VTH A;  3QBX A;  4CJ5 A;  4E1N A;  2DPN A;  2W6L A;  3LDN A;  3LDO A;  3ENO A;  1LCU A;  4BWJ A;  4FJ7 A;  3VEW A;  3ID8 A;  5ADX H;  3I0R A;  2HHU A;  5FPD A;  5FPM A;  3HPH A;  3ATU A;  3KK1 A;  1U47 A;  4F9O A;  2VQF K;  5LJV A;  3BF1 A;  4WF9 L;  5AQW A;  4N47 A;  3DLG A;  1VRU A;  2VYP A;  2FBX A;  3MEE A;  3R9P A;  3VQE A;  4B9V A;  3CMA N;  2W6K A;  4PKG A;  4FZY A;  3MCP A;  2HF4 A;  4J2D A;  4WYB A;  1IH7 A;  4IEE A;  3VQ8 A;  4BRO A;  1A5V A;  2P9N B;  1VSE A;  4CEE A;  5HRS A;  4CJR A;  4DQI A;  1W7A A;  1ITG A;  1Q7Y O;  2OTJ N;  3ZSV A;  4A2B A;  1VQK N;  3JS6 A;  4GVE A;  4ELV A;  3NH0 A;  3AY9 A;  1IG9 A;  4FLV A;  2YJE A;  4IG3 A;  4B8C A;  3NF9 A;  2KZM A;  1HNI A;  5HRO A;  3CQ8 A;  4FVU A;  3ENB A;  4F2S A;  1JCF A;  2YHY A;  4DV7 K;  1M90 O;  3OYD A;  2V7Y A;  1ZYQ A;  3TAQ A;  4DS5 A;  4U7B A;  3N4P A;  3MX5 A;  3S41 A;  3P39 A;  3AVM A;  2WC9 A;  4E19 A;  5AQG A;  1NJW A;  3R8E A;  4OKJ A;  2A1R A;  3E01 A;  2B4J A;  4IJN A;  5CZ1 A;  3RMC A;  2FBV A;  5BPL A;  5J1E A;  5BR8 K;  3VQP A;  2P9L A;  1KRP A;  3V1O A;  3U9D A;  3CER A;  4DSK A;  4DTJ A;  1G99 A;  4MLH A;  3TAM A;  2DTU A;  4DCH A;  2G8H A;  4H5R A;  1P8Z A;  3OTO K;  3VQD A;  4ELU A;  1W0H A;  3H46 O;  1GLD G;  3CJ7 A;  1ATS A;  1HJO A;  3M1F A;  1LWF A;  3C95 A;  4A57 A;  1JJ2 M;  4BGA A;  5JVH L;  1Q18 A;  3FZF A;  3B8A X;  3J81 O;  4M3R A;  1SL2 A;  1JLE A;  2RPI A;  1KFS A;  1NJZ A;  2O8E B;  3IRX A;  3DXM B;  1VHX A;  5GAE P;  2P9I A;  3ZT0 A;  2BAN A;  3L2W A;  3DLE A;  2E4L A;  2XHB A;  1YTU A;  1T05 A;  4K0K K;  3BEX A;  3THW B;  4LC9 B;  3O9R A;  3M6G A;  2OA8 A;  1RTD A;  3MAQ A;  1ILY A;  2PYJ A;  4IO9 L;  3EE9 A;  1XNR K;  3FZK A;  4Z4F A;  4BG9 A;  1C1B A;  2CH5 A;  1IBK K;  1JLQ A;  1D5A A;  1HJR A;  4CF9 A;  4C8K A;  3ISN C;  4FO0 A;  4GKK K;  4BWM A;  4CIG A;  3SCX A;  4FJ5 A;  1K8K B;  1A5X A;  4M3Y A;  3QEX A;  4KHY A;  4CZI A;  2HHT A;  1S22 A;  1I3A A;  3FGU A;  3ZX3 A;  3LWM A;  2HOE A;  4CEF A;  3RMB A;  4HCC A;  3OBW A;  4YOW A;  4BVO A;  4YOY A;  5AQY A;  4BR2 A;  4WQ5 A;  1NGA A;  2A5X A;  4O0J A;  2HHV A;  5AZI A;  1RDC A;  4IOC L;  2CH6 A;  3LP0 A;  5HRR A;  4CD1 A;  4HUF A;  4LFB K;  2GTD A;  3G0Z A;  4LH4 A;  3V9Z A;  3NBP A;  1TAQ A;  3DMJ A;  2VWJ A;  2VG6 A;  1S5J A;  4BRM A;  4CGD A;  2E6L A;  4ID5 A;  2NRW A;  5MLC Q;  1HKC A;  2KW4 A;  3HOS A;  4X66 K;  5AFU A;  2PZS A;  5KQD A;  2NLX A;  2Q0R A;  1I39 A;  5AQF A;  4FM0 A;  2QWM A;  1MA9 B;  4FWN A;  3DJC A;  3A5L C;  4JS4 A;  3T69 A;  5AZJ A;  3HPO A;  4IOA L;  4CEA A;  1UAX A;  5M1N A;  2Y1J A;  1J6Z A;  1NM1 A;  1KVC A;  4CJP A;  3HL8 A;  2ZJR L;  3LL3 A;  1HNZ K;  4C1N K;  5C12 A;  4FLX A;  3ZT2 A;  4DTM A;  5FDL A;  1HNX K;  3OYH A;  2QA4 N;  3ULE A;  4BC2 A;  4DF4 A;  4XH5 A;  5DM6 L;  2YCH A;  4BC4 A;  3SBT A;  4EP5 A;  3SJJ A;  5CE3 A;  2ITM A;  1HQE A;  1WAF A;  3CC2 N;  2UUB K;  1VSJ A;  4IFY A;  3N4Q A;  2XY5 A;  3WXM B;  4BRD A;  1WBB A;  2UXB K;  5LL6 Z;  3HJF A;  1VSI A;  5KQ8 A;  3SZ2 A;  4CZK A;  1C0U A;  2O8C B;  3CCV N;  1DEJ A;  1K6Y A;  3C6U A;  4DLG A;  3ID6 A;  3QIO A;  4DB3 A;  2UYT A;  2FSK A;  3D0P A;  3OS2 A;  4PUO A;  4O8U A;  4KHP K;  3U3G A;  5C2F A;  5BN8 A;  4RW8 A;  2HVI A;  1QSL A;  4FXD A;  1IJJ A;  3KK3 A;  4BR4 A;  4M45 A;  4JKC A;  3JYT A;  1EKE A;  1K9M O;  1NGI A;  1NMN A;  1BOT O;  4JNE A;  4WFB L;  3CCQ N;  3VQ6 A;  4GVM A;  2WUS A;  2F7T A;  2OYQ A;  3SMS A;  4JI4 K;  3BY5 A;  3V6D A;  3UKR B;  2P9U B;  3SI6 A;  4J8F A;  4KI6 A;  3MDQ A;  3THY A;  3AVB A;  4LFA K;  4DG1 A;  2XY8 A;  3U8X A;  3NE6 A;  3E9O A;  3TSU A;  4Z4G A;  2E5L K;  2O8B A;  4WFN L;  2EWS A;  4JKG A;  3LWL A;  1RT7 A;  2F9T A;  1HMV A;  3SAG A;  4H0O A;  3V1R A;  1Z25 A;  4WFA L;  3G25 A;  1VQO N;  3LM2 A;  4AHC A;  1TYQ A;  3MN9 A;  4M3T A;  4EFH A;  2P5O A;  2OTL N;  4FJ8 A;  2RHK A;  2KQ2 A;  1MDU B;  1ZBF A;  3NCI A;  4NYN A;  4NO7 A;  3OYM A;  4MDA A;  4CK1 A;  3SK3 A;  2CGK A;  1KQS M;  1NOY A;  1GLA G;  3J80 O;  4B9U A;  4CER A;  4DV2 K;  4DR3 K;  1NK8 A;  5AQL A;  5JS2 A;  5EVZ A;  4DMN A;  4CGH A;  3H08 A;  1TGO A;  3QEW A;  4BRE A;  4FLY A;  4CJ3 A;  3ASM A;  3LDQ A;  3DI6 A;  1XUP O;  3UKU B;  3OW2 M;  4KI4 A;  4B3T K;  1CLQ A;  3EO3 A;  4CF1 A;  4YHH K;  1WUA A;  3SPZ A;  4CJQ A;  2NZT A;  1FK9 A;  4WQ4 C;  3SQ1 A;  3NGZ A;  4CJV A;  3ZEU B;  3W0L A;  5HRN A;  3P5J A;  4K8X A;  4MDB A;  5I3U A;  1J5E K;  4F3T A;  3BDP A;  4H0T B;  4OGC A;  4KHN A;  4B1Y B;  1NGB A;  4CJF A;  1RBS A;  3CXC M;  1NGF A;  2HST A;  1Z26 A;  3Q7C A;  3M8S A;  5AQO A;  3RRG A;  5JLH A;  4K42 A;  3HYF A;  1YVN A;  4G9Z A;  1NK5 A;  4FL9 A;  4DU1 A;  4GMJ B;  4BY9 C;  1HPM A;  4QOZ B;  4C8L A;  1QQO A;  3L2R A;  2IS3 A;  3A5M C;  1Q86 O;  4OPJ A;  5BPM A;  3V9U A;  1C0F A;  1X9J A;  3TAP A;  1QVG M;  4ILG B;  3C0B A;  4PY5 A;  3CME N;  3AA5 X;  1BIS A;  2NRH A;  4KBO A;  5J2Q A;  4W5R A;  3MXM A;  1LWE A;  3QEV A;  1VQM N;  3DLH A;  4FLZ A;  4LH5 A;  3A0I X;  3LP2 A;  3LDS A;  2ZM6 K;  1NLV A;  4CCH A;  3SYZ A;  4QS8 A;  2P9P B;  2QWO A;  4WQ4 A;  3ZET A;  4JKE A;  4DR4 K;  2IVO A;  4KFB A;  3IUC A;  1BI4 A;  1WSF A;  2RKI A;  4FJK A;  1TL1 A;  4J2E A;  1Y64 A;  3GL1 A;  1ESV A;  2IAJ A;  3B6O A;  2JWL A;  2GEM A;  5AQR A;  3M5R A;  3O3H A;  4A62 A;  1HUX A;  4BRN A;  3F2K A;  1HPZ A;  2Y1I A;  1XC9 A;  1IV0 A;  1WB9 A;  2G8I A;  5HRP A;  3L2U A;  3TAB A;  4LF8 K;  4K25 A;  2NRX A;  1QHT A;  2B6A A;  1HYS A;  3K2P A;  3BZK A;  2QKB A;  3VQ4 A;  2HBL A;  1UA1 A;  5K14 A;  3AO2 A;  3SJH A;  2XO7 A;  4A61 A;  4WE1 A;  4N5S A;  3BGR A;  1YJ9 N;  4BDP A;  2CGL A;  4AHU A;  3U6F A;  5HLF A;  4CZG A;  1VQ5 N;  3SQ0 A;  3J7Z O;  1WLJ A;  4M63 C;  3O1W A;  4H03 B;  1HX1 A;  3CJB A;  1N6Q A;  4R79 A;  3E66 A;  1N8R O;  5HBM A;  3DLK A;  4CGG A;  3K5M A;  2RE2 A;  4FJI A;  1KFD A;  2ASO A;  5J2N A;  2HMP A;  1RDA A;  1XHX A;  3BF3 A;  3TTC A;  4DUZ K;  3D45 A;  5GIN A;  1YXQ A;  3FZH A;  5AQI A;  4KV8 A;  1QSS A;  4OPK A;  1G15 A;  3MN7 A;  3PV8 A;  3CC4 N;  3OYG A;  3CQX A;  3MED A;  3HO1 A;  2IIR A;  4OO1 J;  4JHD A;  4CJT A;  3E1Y A;  5DK5 A;  1L3U A;  3AVK A;  4AHT A;  3VEV A;  3VN5 A;  2UXD K;  4BE1 A;  5SZT A;  1WN7 A;  4DR6 K;  1L3V A;  3OYL A;  2JWK A;  1OVY A;  3SBG A;  1Y97 A;  1S6Q A;  4JI7 K;  2DFE A;  2ZWH A;  3HXM A;  4JS5 A;  3CHW A;  3HBT A;  3AVA A;  4O44 A;  4JI3 K;  1HLU A;  3A5N C;  4IWV A;  5FRN A;  4BRA A;  3E9L A;  4CHO A;  3TAN A;  1YHQ N;  1D8Y A;  5C25 A;  4X65 K;  1NKC A;  1JLG A;  5AQH A;  1OH5 A;  3QLH A;  3TPQ A;  3PX6 A;  3KVG A;  3KD5 E;  4CFD A;  2PYL A;  1VSH A;  1TK0 A;  3MN6 A;  4I6M B;  1Z05 A;  1LWC A;  3Q7B A;  4CJK A;  1OH7 A;  5KPZ A;  4I2P A;  4BQL A;  1RDB A;  5A2Q O;  4B3O A;  4FM1 A;  3PX4 A;  2HHW A;  3I8D A;  3U4L A;  3VTI A;  2KTQ A;  4Y1C A;  3O3F A;  2RF2 A;  3HP6 A;  3RR8 A;  4KKO A;  1CZA N;  1H1V A;  1BQM A;  1JCG A;  1Q8I A;  2NNW A;  3AA2 A;  1SKW A;  4CJS A;  4FVM A;  3FE1 A;  1B9F A;  4H0Y B;  3OVN A;  1GOA A;  5M1P A;  1VSF A;  1QQC A;  2HW3 A;  2A1S A;  2W41 A;  3VOV A;  3SV3 A;  4H0P A;  1D4X A;  5M1Q A;  4BC3 A;  1T7P A;  1SS6 A;  4Y1D A;  3KJV A;  1Q81 O;  1FXX A;  5CZ2 A;  1U45 A;  4H0X B;  1DT9 A;  1U04 A;  1X9M A;  1DKG D;  1ASU A;  4Y0W A;  3WUH A;  2GUI A;  2YKN A;  2P9K B;  3C6A A;  3LDL A;  5IWA K;  1BIZ A;  1ZBU A;  1NJX A;  3I55 N;  3PSI A;  1GLB G;  1UA0 A;  3ZX2 A;  3DYA A;  3NH1 A;  1IKV A;  2QTD A;  5E41 A;  3DLL L;  1SKS A;  2I7N A;  2FXU A;  4B3M K;  3OYA A;  5CYM A;  5JVG L;  1VSK A;  3KLF A;  3IDH A;  3EE8 A;  5AR0 A;  1QVF M;  4B3S K;  1E4F T;  3I8B A;  2CGJ A;  5AQS A;  5E84 A;  3CPE A;  3OJU A;  1SZ2 A;  1X9S A;  4BDZ A;  4FPB A;  4HTL A;  1LW2 A;  1S1U A;  4NXN K;  3TAE A;  1T03 A;  4FJH A;  2Z1G A;  2Q31 A;  1ZBH A;  1EQY A;  1EX4 A;  2ZGZ A;  4OJR A;  5BPN A;  4HUE A;  4B1V A;  3CCS N;  1KAZ A;  2PAV A;  1LOT B;  1VQN N;  2YHW A;  3MMV A;  1LAV A;  4DS4 A;  1NGD A;  3H1Q A;  4B1W B;  2AP1 A;  4AHS A;  4JKF A;  5M1O A;  3QML A;  3HVT A;  4PL8 A;  1VQ8 N;  4E0D A;  3NF6 A;  1X1P A;  3ZSX A;  2P9S B;  4ELT A;  3HZ6 A;  4WQ5 C;  4KTQ A;  1KTQ A;  4L3Q A;  4O5B A;  3KKR A;  4XH4 A;  1X9W A;  1EXQ A;  4Z94 A;  4E7J A;  1JKH A;  3M3Z A;  4ISE A;  4PWD A;  3EEQ A;  3K58 A;  3EY1 A;  3RMD A;  4JK7 A;  4BRL A;  5T7B A;  1SUQ A;  1EP4 A;  3WXK A;  2NUB A;  4CFA A;  2Q36 A;  1L3S A;  3KLG A;  3I56 N;  2QKK A;  2BUP A;  4LF5 K;  2HNZ A;  3CIP A;  5C10 A;  5E26 A;  3PO5 A;  1X3N A;  3L0Q A;  2XY7 A;  4CF8 A;  5D3G A;  5AQM A;  4MLE A;  5AQX A;  4CJ4 A;  4K43 A;  3K5N A;  3MXI A;  1YIT N;  3LP3 A;  4BRK A;  4DQQ A;  2KKZ A;  2Z1J A;  4EIA A;  5J2P A;  2PY5 A;  2X6N A;  4CHY A;  3HSC A;  2V52 B;  1VAZ A;  4DQP A;  2O8E A;  3HOT A;  3DXM A;  4BRG A;  3LM9 A;  2HB5 A;  1RBU A;  3VQC A;  3NGI A;  4DV6 K;  2D5R A;  3P38 A;  4DSF A;  3MWP A;  3THW A;  4M7Y A;  3SUO A;  3EYZ A;  3LPT A;  3BZC A;  3K59 A;  4DV1 K;  2G8U A;  3QEP A;  1D9F A;  2E2Q A;  1JLF A;  1EWR A;  5LJW A;  2ITG A;  2O8F B;  4BR7 A;  1WSI A;  4IFE A;  4L8R B;  1K8K A;  3P1G A;  1Q82 O;  3CM6 A;  5BRD A;  2NRR A;  1R59 O;  2HHS A;  2QW9 A;  1C6V A;  5B8H A;  3HVR A;  1C0M A;  3ZT1 A;  3OA9 A;  4FJX A;  1FKO A;  4GNI A;  4Z0U A;  5C0Y A;  4CZM A;  2NRT A;  3CJC A;  2E2O A;  2D4W A;  4FK4 A;  4M41 A;  3SAF A;  2ASP A;  3VET A;  4IO8 A;  2XRI A;  3H3N O;  1BG3 A;  5AQT A;  3M8R A;  3IMX A;  4FWL A;  3C7N B;  1HKB A;  2HHX A;  4NLC A;  2B5J A;  5BN9 A;  1BCM A;  2Z1H A;  5EOY A;  4C8M A;  1UWB A;  3L4I A;  1N33 K;  4OVL A;  3DXK B;  3IFR A;  5J2M A;  4AHV A;  3T19 A;  1IO2 A;  3O08 A;  1JLC A;  3OYF A;  4BC5 A;  3V1Q A;  2YNI A;  3NF7 A;  1KD1 O;  1HNW K;  4V19 S;  2ZD1 A;  2A42 A;  2NRZ A;  2Q0U A;  1JXB A;  1BCO A;  3DRS A;  5AQZ A;  4CHQ A;  1J5O A;  4FOE A;  4KHQ A;  4FLW A;  1RCH A;  3T7Z A;  3AAQ A;  4RW6 A;  3KK7 A;  3H6E A;  4XH1 A;  4M42 A;  5JIC A;  2QEX N;  3D2E B;  1YIJ N;  4CEC A;  3HM8 A;  2D1K A;  1WSG A;  3O80 A;  3WXL A;  4NYF A;  3QIP A;  3G6E N;  4GV6 A;  4LF9 K;  4CFC A;  4KRE A;  2KZZ A;  1XC3 A;  4KTZ A;  4BQZ A;  3WEE B;  4B9L A;  4KO0 A;  4JKA A;  3CI5 A;  1EWQ A;  4PKH A;  3K5L A;  4RG8 A;  4O55 A;  4FJN A;  3A8Y A;  5I42 A;  2G8V A;  4JKG B;  2A3Z A;  4CI6 A;  4DU3 A;  1HKG A;  3JXU A;  3OYE A;  4IBN A;  3FR0 A;  1GLC G;  4JLH A;  1TUY A;  1OH8 A;  4YOT A;  2I7P A;  4LSL A;  2D0A A;  3CCU N;  1T44 A;  4A59 A;  4MO4 A;  3ZSZ A;  3CF5 L;  2HHH K;  4OLB A;  5AFU H;  1V4S A;  2O8C A;  3L8B A;  4XIU A;  3VEO A;  4CZF A;  1BUP A;  1WOQ A;  4I9Q A;  3WXJ A;  3D2F B;  1S9G A;  1S72 N;  3I0S A;  4CIE A;  1T6D A;  3LAL A;  1I94 K;  1W9H A;  3RMA A;  1X3M A;  2DFF A;  3MWT A;  4CBW A;  1U2V B;  2JLE A;  4H8K A;  1TKX A;  2E2N A;  1QZ6 A;  4HTU A;  1TAU A;  2P51 A;  3H1V X;  2VWB A;  2F4V K;  3WQT A;  4DTP A;  3ZLJ A;  3NHG A;  4DFM A;  3ZSO A;  3F9K A;  1VRT A;  3RSE B;  1NG9 A;  4FJG A;  4LY7 A;  2QXF A;  4BRF A;  3VMF B;  4PL7 A;  1TL3 A;  3FZM A;  2O8D B;  4AF1 A;  4ISG A;  4H0V B;  3TU5 A;  4DKW A;  1GOB A;  4H5W A;  3NF8 A;  1NK9 A;  3MN5 A;  1TK8 A;  4FWO A;  3R6M A;  4A2A A;  5GAG P;  3UKR A;  2P9U A;  2GUP A;  4U67 L;  3K9J A;  5GIP A;  1ZBI A;  3AVN A;  1WSE A;  4EAH D;  1RTI A;  2XY6 A;  1GLJ O;  4FWP A;  3TTF A;  2H3G X;  3T1A A;  3OYC A;  3NMU A;  5CR4 A;  1RDW X;  1BL3 A;  4CVN E;  3T1Y K;  1RIL A;  1NJI O;  1HYZ A;  4GW6 A;  1GLE G;  5FRO A;  4NB4 A;  2X74 A;  4YOU A;  4IEI A;  4CEB A;  2VG7 A;  5EXW A;  4ICL A;  3GDQ A;  1VSD A;  3VQ9 A;  3EL2 A;  4FJM A;  3J8A A;  3GOI A;  3NVM A;  4C1N I;  1NNE A;  4CJL A;  2G8W A;  2KFN A;  2YV0 X;  3ZYY X;  4O5F A;  2UU9 K;  1RGI A;  3NFA A;  4YOV A;  3PIO L;  1EO1 A;  5AQU A;  1NGG A;  4B9M A;  3EKU A;  3O8M A;  2YJF A;  4CF2 A;  3UE5 A;  2VCP A;  3BP8 A;  2HBM A;  5JLF A;  1ZXO A;  3MK6 A;  1KSP A;  5EY4 A;  2WBN A;  1S9E A;  1VQ4 N;  3AGK A;  5H1S Q;  2E6M A;  4KHU A;  3UKU A;  4CZH A;  3FFK B;  3RRH A;  4AHR A;  5KRS A;  2HF3 A;  2ZF5 O;  3GBT A;  3GE1 A;  2W42 A;  3RVC A;  4OGE A;  4A5B A;  1IBL K;  4DV4 K;  3RTV A;  2HVH A;  1J53 A;  3ZEU A;  1W2B M;  3R3L A;  1IKY A;  4FM2 A;  1J54 A;  3H3O B;  4O0I A;  1YJW N;  2D0B A;  3O9U A;  1YI2 N;  1DTT A;  3L2V A;  4CHZ A;  4K8Z A;  1SKR A;  2BDP A;  4YOX A;  4CK3 A;  3VF4 A;  3KK2 A;  3CFR A;  5DMR A;  1JL2 A;  3VEX A;  4FSV A;  1C0T A;  4X64 K;  4M3U A;  4B9T A;  1KLM A;  3ZSR A;  3OYJ A;  3JAM O;  1HQU A;  1P90 A;  4B8A B;  4HWI A;  1NKE A;  4BRH A;  3ZX0 A;  3AVC A;  2Q97 A;  2OPS A;  2IOC A;  2QI2 A;  4FPA A;  1MWK A;  1S6P A;  2VGN A;  3ZSQ A;  4JRP A;  4ILH A;  2OPR A;  2QWR A;  4EHU A;  3SNN A;  1KAX A;  1YF5 L;  3AA3 A;  4MQ3 A;  3B6P A;  3QEI A;  5JMV A;  4AM7 A;  1VQ7 N;  2VG5 A;  2GWJ A;  2VWK A;  4IOX A;  3IAY A;  5FRM A;  4JV5 K;  4JYA K;  5ADX A;  2GX9 A;  2AA4 A;  4B9Q A;  2OPQ A;  2P9P A;  1DTQ A;  4JD2 B;  4FLU A;  1VSL A;  3LDP A;  1Q9X A;  2DY4 A;  2HBJ A;  1DGK N;  4RW9 A;  3THX A;  3VQQ A;  3TAF A;  4CEQ A;  2ASM A;  3CM5 A;  4KH6 A;  4BG8 A;  5KGX A;  2AJQ A;  1KCF A;  3FFI A;  5AJ3 K;  1ATR A;  4JI5 K;  1L3T A;  1JLB A;  2OZS A;  4LF6 K;  4ZTJ A;  2W40 A;  2G8K A;  5BR9 A;  3NVK A;  4GKJ K;  4C8O A;  4A5A A;  1VQP N;  2BGG A;  3AO4 A;  1O1W A;  4CW7 B;  3L4Q A;  5LMU K;  2G8F A;  4BRQ A;  3CD6 N;  4CJW A;  3QFU A;  3F73 A;  4ISF A;  2YNH A;  4KTW A;  3DM2 A;  3V4I A;  1NWK A;  3CYM A;  3DAW A;  2YNG A;  1NK7 A;  3WNE A;  1K8A O;  2E8A A;  3F5T A;  2ATQ A;  3CCL N;  4KHS A;  4ILJ A;  5AQN A;  4RTF D;  4BAC A;  4B1Z A;  3VEN A;  1B9D A;  5EX5 A;  3KHY A;  2IDO A;  1RBV A;  1S3X A;  4DTO A;  2ETJ A;  4CGJ A;  1NGH A;  1W97 L;  4IDK A;  4IXC A;  3WNH A;  1QSY A;  5CYQ A;  2ZQB A;  5C42 A;  3CJA A;  4CJ7 A;  3CPW M;  2Z1I A;  4IJA A;  4FWS A;  3OYB A;  1KLN A;  1KVA A;  3SQ4 A;  4JI1 K;  3VQ5 A;  1BIU A;  4F2R A;  4KPY A;  1N34 K;  4OLA A;  2A6A A;  3TWH A;  4WCE L;  3EN9 A;  4BGB A;  4DSI A;  4O4G A;  5GAH P;  4CEZ A;  1F21 A;  4FZX C;  3O3G A;  4I7F A;  3VQA A;  4CD3 A;  4N76 A;  3BUZ B;  1OKJ A;  3QES A;  1LW0 A;  3OYI A;  1L5U A;  1QHA A;  4CJU A;  1XMO K;  4E7K A;  3CG7 A;  3K9K A;  4B08 A;  3I33 A;  1FKP A;  1NGC A;  1WSJ A;  3LAN A;  4YOR A;  2FF6 A;  3OHR A;  1BU6 O;  4N56 A;  2Q3S A;  4TSX A;  4DU4 A;  4DR1 K;  4CGF A;  5CHI A;  2J4R A;  4DFP A;  5IT9 O;  4DSL A;  1YUW A;  3NAE A;  1HR0 K;  3QFP A;  4OKK A;  3G4S N;  4FK2 A;  4XEI A;  3VF6 A;  3DOL A;  4I6M A;  4Z4I A;  3DLB A;  1BA1 A;  2UXC K;  2FF3 B;  4LD0 A;  3SQ2 A;  4FCY A;  5SWM A;  1VQL N;  4BDY A;  2GWK A;  2YX6 A;  1YJN N;  1CXU A;  1WBD A;  2PBD A;  5FLX O;  4B3R K;  2P9L B;  4DHY A;  1ZC6 A;  3THV A;  5AQQ A;  4OX9 K;  3VEZ A;  3L2Q A;  4B1U B;  2ZGY A;  4E3S A;  1VK0 A;  3R1X A;  2D0O A;  1BO5 O;  4LF7 K;  5TKW A;  4Z4C A;  1GOC A;  3NDK A;  4JI2 K;  4KB1 A;  3O9Q A;  4BR0 A;  5KRT A;  1EET A;  5C15 A;  1OH6 A;  4B1X B;  2E1Y A;  2X78 A;  4RWT A;  1RTH A;  4Q5V A;  4B9N A;  3CJ9 A;  4JK8 A;  2P9N A;  2F8S A;  2IC3 A;  4CZL A;  2GV9 A;  1VQ9 N;  5KGW A;  2P9I B;  3PUF A;  3DLR A;  1XNQ K;  2O4I A;  4DLE A;  2P9K A;  4HCB A;  1C1C A;  3FLC O;  1RT1 A;  3VA0 A;  3SPY A;  2F8T A;  2OCE A;  3KZB A;  1VSM A;  3TI0 A;  1UOC A;  3VES A;  4BRP A;  4CZE A;  4UY8 O;  2FBT A;  3AVG A;  1IBM K;  4EZ6 A;  3QIN A;  3KWG A;  3U3Y A;  3CJ1 A;  2HMI A;  3V81 A;  4OPA A;  4I2Q A;  3TAR A;  3CCR N;  1REV A;  2E1Z A;  2OAN A;  1CZB A;  1U4B A;  2IVN A;  3SV4 A;  1NOZ A;  2FBY A;  2HBK A;  4CE9 A;  4ID1 A;  3J7A P;  4CJE A;  3JSM A;  3RR7 A;  1S1W A;  3AVL A;  3L3U A;  3LAM A;  3HP9 A;  3O6W A;  3HI0 A;  2R7Y A;  5AZI B;  5LY3 A;  2ZJQ L;  3MX2 A;  1KC8 O;  4QCL A;  1NMD A;  4PQU A;  3AVJ A;  4DQ8 A;  5DM7 L;  4F8R A;  3HM9 A;  1BQN A;  1RT4 A;  3AVI A;  1R0A A;  2E2P A;  3DRP A;  3OS1 A;  4IZ9 A;  3L3V A;  4E7H A;  2QWQ A;  4E7L A;  4EP4 A;  2P9S A;  4FJJ A;  3SUQ A;  2GEL A;  3FZL A;  1RDD A;  3DOK A;  3KIO A;  4ZTF A;  3TSQ A;  5AQV A;  2QWL A;  4BE0 A;  1NGJ A;  2F96 A;  1RDU A;  4J2B A;  5AZJ B;  1E3M A;  1KXP A;  1YTA A;  4JI8 K;  4DV0 K;  4H5T A;  4H4M A;  4MFB A;  3SAH A;  4DQR A;  3KLI A;  3MEC A;  4RW7 A;  3KLH A;  4DF8 A;  5GAD P;  3O4N A;  3VEY A;  3SUN A;  2IGI A;  4KB0 A;  4NCG A;  4FWR A;  3WNF A;  4AQY K;  3ULE B;  2FSN A;  2NRV A;  1QE1 A;  3KD1 E;  3SLC A;  2X6S A;  1BGX T;  4CBU A;  4E1J A;  1ASV A;  4M3Z A;  4DWI A;  5KTQ A;  2BE2 A;  4YDU C;  2YKM A;  4W5N A;  1ZBS A;  4E89 A;  1WSH A;  3LP1 A;  3U9Z A;  1Q9Y A;  4Z4H A;  4AH9 A;  4AM6 A;  3LAK A;  5AQP A;  2KLA A;  2EHG A;  1DLO A;  4RCH A;  5M1K A;  3HT3 A;  1RT3 A;  4IKF A;  3VA3 A;  1JLA A;  2YHB A;  4HUG A;  5HP1 A;  4DTX A;  4N41 A;  3OY9 A;  5C2D A;  4BE2 A;  4BVP A;  4E7I A;  4KHW A;  4QAG A;  3V9X A;  2GBZ A;  3S3N A;  3M8Q A;  3QNO A;  1KVB A;  1HNV A;  1T3V A;  2QM1 A;  5F1X A;  4B9S A;  4HHT A;  3ZSY A;  3CFP A;  3PY8 A;  1MWM A;  2O8F A;  2VGM A;  2JGU A;  5F2R A;  4CED A;  3IG1 A;  1QQN A;  1NK0 A;  3WNG A;  5KI6 A;  5HOO A;  1NK6 A;  3P83 D;  1RNH A;  1NJY A;  1U6Z A;  3K57 A;  4YDU A;  5EU7 A;  2RN2 A;  4FWK A;  3S3M A;  3PO4 A;  2YNF A;  2E88 A;  3AO3 A;  3CET A;  3NGY A;  3NH2 A;  3O5B A;  3IKM A;  4K41 A;  3THY B;  4IG0 A;  1NK4 A;  4JK9 A;  4JI0 K;  3VQ7 A;  1SL1 A;  3PIP L;  2O8B B;  3OYK A;  4DTU A;  3C7N A;  3AO5 A;  3CCM N;  1TUU A;  3ITH A;  3VQB A;  4YFU A;  1KAY A;  1BWF O;  2HNY A;  1QQM A;  3W3D A;  4E1M A;  3ZSW A;  3AGR A;  4JEP A;  3A5O C;  3DXK A;  1TVR A;  3QIC A;  1JL1 A;  4QS9 A;  3ALY A;  4CEO A;  1TV6 A;  4LSN A;  4CBX A;  3S9H A;  4C8N A;  4DR7 K;  1FW6 A;  4FYD A;  1TYQ B;  3VGK A;  4CK2 A;  4GV3 A;  1YAG A;  1OVQ A;  4R5P A;  3D6R A;  3J7Y P;  2EX3 A;  1GLF O;  4FW1 A;  4M3X A;  3SMP A;  4DV3 K;  4OPH A;  4CHP A;  2I5J A;  1J9A A;  1XI1 A;  4DTS A;  4QS7 A;  3CCE N;  1XHZ A;  3D2E A;  4FWM A;  4HVJ A;  4DTR A;  1XQS C;  4KRF A;  4W5Q A;  1HRH A;  2LSN A;  4H5N A;  2BTF A;  3M8P A;  3RWU A;  3C6H A;  4BRC A;  3ULD A;  3WEE A;  3D7E O;  4H4O A;  5AQK A;  1QZ5 A;  2E20 A;  5CY4 A;  3QB0 A;  4CGI A;  1XMQ K;  1K73 O;  3LPU A;  4C23 A;  1RBR A;  3AV9 A;  1TKD A;  3ENH A;  5ELZ A;  1V4T A;  3VGL A;  3ZT4 A;  3DRR A;  3K5O A;  5JS1 A;  4PA1 A;  4EHT A;  1U49 A;  4I9L A;  3AVF A;  2O4G A;  4CZJ A;  3AVH A;  5GIO A;  1D9D A;  5I9E B;  1M1K O;  4FZZ A;  1RTJ A;  1U48 A;  5HL7 L;  2QK9 A;  3V9S A;  3D2F A;  3QBW A;  2P1J A;  3P31 A;  5M1F A;  3V9W A;  4BR9 A;  4IFV A;  3O9S A;  2D0P A;  4ZHR A;  4FLT A;  1YVU A;  1ASW A;  3C94 A;  1NU0 A;  2ZJP L;  4YNQ A;  1U2V A;  3LZI A;  3AAR A;  2IVP A;  2FSJ A;  4IDH A;  5FPE A;  2A41 A;  2HHQ A;  1NGE A;  1SV5 A;  4NCA A;  3RSE A;  5TKY A;  1N5Y A;  3AA4 A;  3MEG A;  4LFC K;  1VQ6 N;  3O1B A;  1GLL O;  2O8D A;  4DSE A;  1QTM A;  1XWL A;  4W5T A;  3O4Q A;  1QS4 A;  2KHO A;  3DWL A;  3T1H K;  3QO9 A;  1ATN A;  1JCE A;  3ZET B;  2WOM A;  4DFK A;  4CF0 A;  1BI4 B;  4DFJ A;  4FW2 A;  1A5W A;  3KLE A;  1S1V A;  1B92 A;  1IKX A;  3PLA A;  2F9W A;  1IG8 A;  3EKS A;  3OBY A;  3K0S A;  3C6T A;  3MCA B;  4KH5 A;  1SL0 A;  2UUA K;  2OPP A;  2Q2R A;  3PSF A;  4FWQ A;  2YHA A;  3VER A;  4Q0B A;  4H5V A;  1BHL A;  3O4W A;  3O9T A;  3LZJ A;  3WT0 A;  4DR2 K;  2YI1 A;  3UIQ A;  1SAZ A;  4JRQ A;  1WAJ A;  4BRI A;  3HK2 A;  2FC0 A;  1S1X A;  3VF2 A;  1S1T A;  4CIF A;  4YY3 K;  1TKT A;  3PX0 A;  4DV5 K;  2D0C A;  3F9M A;  4GY2 B;  1RBT A;  1ZBL A;  1BA0 A;  3HST B;  3AAP A;  4M7X A;  3TAG A;  4RW4 A;  3CQY A;  4NXM K;  4JAX A;  5KPT A;  5LMN K;  4JN4 A;  3OJS A;  3MXJ A;  3ZCM A;  2QWN A;  3P4I A;  1LV5 A;  4X62 K;  3H45 C;  4PKI A;  3THX B;  4KAZ A;  4LF4 K;  1E4G T;  4O8K A;  4DTN A;  3KWI A;  4JI6 K;  1T8E A;  1Z6R A;  4FK0 A;  3QET A;  1YT3 A;  1RT5 A;  3VGM A; 
#chains in the Genus database with same CATH homology
 4I6M A;  2EWS A;  4JKG A;  2Q1N A;  3WXI A;  4JHD B;  1BA1 A;  2FF3 B;  2F9T A;  3P38 A;  3SAG A;  1RFQ A;  3MWP A;  4H0O A;  1VQL N;  4M7Y A;  4WFA L;  2GWK A;  2YX6 A;  3G25 A;  1SQK A;  1YJN N;  1VQO N;  2PBD A;  3LM2 A;  2YHX A;  2P9L B;  4DHY A;  1ZC6 A;  1TYQ A;  2E2Q A;  3MN9 A;  2QXL A;  5LJW A;  1QVG M;  5AQQ A;  3VEZ A;  4BR5 A;  4EFH A;  3VPZ A;  4BR7 A;  2OTL N;  2RHK A;  2ZGY A;  4IFE A;  4B1U B;  1K8K A;  5FPN A;  1MDU B;  1Q82 O;  3R1X A;  2V7Z A;  2D0O A;  1BO5 O;  4NO7 A;  5BRD A;  2NRR A;  5TKW A;  4MDA A;  1R59 O;  3SK3 A;  3O9Q A;  4BR0 A;  2CGK A;  1KQS M;  1GLA G;  2QW9 A;  5B8H A;  5C15 A;  3G71 N;  4B1X B;  2E1Y A;  4RWT A;  3OA9 A;  4GNI A;  5C0Y A;  3CJ9 A;  5AQL A;  4CZM A;  4GV9 A;  2NRT A;  3CJC A;  5EVZ A;  5BRH A;  2E2O A;  4JK8 A;  2D4W A;  2FLO A;  2P9N A;  5F0X A;  3SAF A;  2ASP A;  4BRE A;  3VET A;  4IO8 A;  4CZL A;  3LDQ A;  2QWP A;  3H3N O;  4JKH A;  1BG3 A;  3L6Q A;  1VQ9 N;  1XUP O;  3E9P A;  5AQT A;  3UKU B;  3OW2 M;  3IMX A;  2P9I B;  4FWL A;  3C7N B;  2P9K A;  1HKB A;  3EO3 A;  4NLC A;  3C65 A;  3FLC O;  4JKB A;  5BN9 A;  3UB5 A;  1T6C A;  5KPR A;  3WQU A;  3KZB A;  3QDK A;  5EOY A;  3L4I A;  1WUA A;  3VES A;  2NZT A;  4FOI A;  4BRP A;  4CZE A;  3DXK B;  3IFR A;  4JD2 A;  4WQ4 C;  4UY8 O;  2A40 A;  2V51 B;  2WFB A;  3EZW A;  3ZEU B;  3O08 A;  3W0L A;  3TSP A;  5BRE A;  3KWG A;  4MDB A;  3TTD A;  2PFU A;  4MO5 A;  4BC5 A;  1KD1 O;  3CJ1 A;  4H0T B;  4OPA A;  2A42 A;  2NRZ A;  4B1Y B;  2Q0U A;  1NGB A;  4JKD A;  3CCR N;  2E1Z A;  3CCJ N;  5AQZ A;  2OAN A;  3CXC M;  1BDG A;  1NGF A;  2HST A;  3ATV A;  2IVN A;  3Q7C A;  2BH1 A;  3GG4 A;  4FOE A;  5AQO A;  3T7Z A;  4K42 A;  3AAQ A;  2HBK A;  5JLH A;  3KK7 A;  3H6E A;  5BRF A;  4XH1 A;  1O13 A;  1YVN A;  4G9Z A;  5JIC A;  1NBW A;  4FL9 A;  2QEX N;  3D2E B;  3HTV A;  1YIJ N;  3CC7 N;  3HM8 A;  2D1K A;  4BY9 C;  1HPM A;  4NLB A;  1QQO A;  3O80 A;  3WXL A;  3A5M C;  1Q86 O;  5AQJ A;  3G6E N;  3O6W A;  4GV6 A;  3HI0 A;  5BPM A;  1XC3 A;  3HRG A;  4KH4 A;  1C0F A;  5AZI B;  1X9J A;  3WEE B;  4BQZ A;  4PHT X;  4ILG B;  1C0G A;  3MX2 A;  4JKA A;  3C0B A;  5LY3 A;  2ZJQ L;  3CI5 A;  1NMD A;  1KC8 O;  3CME N;  4PKH A;  4DQ8 A;  2NRH A;  5DM7 L;  4KBO A;  3VTH A;  3QBX A;  3A8Y A;  1VQM N;  4JKG B;  2A3Z A;  2DPN A;  4CI6 A;  3LDN A;  3LDO A;  2E2P A;  3ENO A;  1HKG A;  3JXU A;  1LCU A;  3A0I X;  4IZ9 A;  2QWQ A;  3FR0 A;  1NLV A;  4QS8 A;  1GLC G;  2P9P B;  1TUY A;  2P9S A;  2QWO A;  4WQ4 A;  3ZET A;  4YOT A;  4JKE A;  2GEL A;  2IVO A;  3VEW A;  2I7P A;  3ID8 A;  3FZL A;  3IUC A;  5ADX H;  3CCU N;  1T44 A;  4A59 A;  4MO4 A;  5FPD A;  3TSQ A;  5FPM A;  1Y64 A;  3GL1 A;  3ATU A;  1ESV A;  2QWL A;  5AQV A;  3CF5 L;  4F9O A;  2JWL A;  1NGJ A;  2GEM A;  5AQR A;  5AFU H;  1V4S A;  5LJV A;  1RDU A;  3BF1 A;  4WF9 L;  3M5R A;  5AZJ B;  5AQW A;  3VEO A;  4A62 A;  1HUX A;  4BRN A;  3F2K A;  1KXP A;  2VYP A;  4CZF A;  1BUP A;  1WOQ A;  3WXJ A;  3D2F B;  3R9P A;  4H5T A;  3CMA N;  3SAH A;  1S72 N;  4K25 A;  1T6D A;  2NRX A;  5GAD P;  4PKG A;  3VEY A;  1X3M A;  3MCP A;  2HF4 A;  4WYB A;  4IEE A;  2HBL A;  3MWT A;  4FWR A;  4BRO A;  4CBW A;  1U2V B;  2P9N B;  3SJH A;  2E2N A;  1QZ6 A;  3ULE B;  2FSN A;  4A61 A;  2NRV A;  1YJ9 N;  2CGL A;  3H1V X;  2VWB A;  1VQ5 N;  3SLC A;  4CZG A;  3WQT A;  4CBU A;  4E1J A;  1Q7Y O;  2OTJ N;  3RSE B;  3J7Z O;  4M63 C;  3O1W A;  4H03 B;  4BRF A;  3VMF B;  4PL7 A;  3FZM A;  1HX1 A;  4A2B A;  1VQK N;  4YDU C;  4AF1 A;  3CJB A;  4ISG A;  4R79 A;  3E66 A;  4H0V B;  3JS6 A;  3TU5 A;  4GVE A;  4H5W A;  4DKW A;  1N8R O;  3AY9 A;  3MN5 A;  1ZBS A;  2RE2 A;  4FWO A;  2YJE A;  3R6M A;  4A2A A;  5GAG P;  2ASO A;  3UKR A;  2P9U A;  2GUP A;  2HMP A;  3BF3 A;  3K9J A;  3U9Z A;  3TTC A;  4U67 L;  3ENB A;  5GIP A;  4FVU A;  1JCF A;  2YHY A;  5GIN A;  1M90 O;  1YXQ A;  2V7Y A;  4AM6 A;  4EAH D;  3FZH A;  5AQI A;  5AQP A;  2KLA A;  4U7B A;  1GLJ O;  4FWP A;  3MN7 A;  3N4P A;  4RCH A;  3MX5 A;  3S41 A;  5M1K A;  3TTF A;  3CC4 N;  2H3G X;  3P39 A;  3CQX A;  2WC9 A;  2IIR A;  5AQG A;  3NMU A;  4OO1 J;  5CR4 A;  1RDW X;  4JHD A;  5C2D A;  4BVP A;  1NJI O;  3R8E A;  3E1Y A;  1GLE G;  4IJN A;  3VEV A;  4NB4 A;  5BPL A;  1T3V A;  4YOU A;  4IEI A;  2QM1 A;  5F1X A;  2P9L A;  5EXW A;  2JWK A;  1OVY A;  3U9D A;  3GDQ A;  3SBG A;  3EL2 A;  3CER A;  1MWM A;  3J8A A;  3GOI A;  2VGM A;  3NVM A;  4C1N I;  2ZWH A;  1G99 A;  5F2R A;  3CHW A;  3HBT A;  4MLH A;  1QQN A;  4DCH A;  4H5R A;  1P8Z A;  3ZYY X;  4O5F A;  5HOO A;  1RGI A;  3A5N C;  1HLU A;  4IWV A;  3H46 O;  4BRA A;  1U6Z A;  4YOV A;  4YDU A;  1GLD G;  3PIO L;  3CJ7 A;  1EO1 A;  1ATS A;  1HJO A;  5AQU A;  3M1F A;  4FWK A;  4A57 A;  1NGG A;  1JJ2 M;  3E9L A;  2E88 A;  3EKU A;  1YHQ N;  3O8M A;  3CET A;  2YJF A;  4BGA A;  3O5B A;  3UE5 A;  5JVH L;  2VCP A;  5AQH A;  3IKM A;  1Q18 A;  3BP8 A;  2HBM A;  3FZF A;  5JLF A;  3B8A X;  1ZXO A;  4K41 A;  3TPQ A;  3MK6 A;  5EY4 A;  2WBN A;  3KVG A;  3AGK A;  3DXM B;  4JK9 A;  1VQ4 N;  5H1S Q;  3UKU A;  4CZH A;  3FFK B;  2P9I A;  5GAE P;  3PIP L;  3C7N A;  2HF3 A;  2ZF5 O;  3CCM N;  3GBT A;  3MN6 A;  1Z05 A;  1TUU A;  3GE1 A;  3Q7B A;  4I6M B;  3BEX A;  1KAY A;  1BWF O;  3RVC A;  1QQM A;  3W3D A;  4A5B A;  5KPZ A;  4LC9 B;  3AGR A;  3O9R A;  3M6G A;  4JEP A;  3A5O C;  3DXK A;  3QIC A;  4BQL A;  4QS9 A;  1ILY A;  3ZEU A;  4CBX A;  4IO9 L;  3EE9 A;  1W2B M;  3R3L A;  3FZK A;  1TYQ B;  3VGK A;  4BG9 A;  2CH5 A;  3U4L A;  3VTI A;  1YAG A;  3H3O B;  1YJW N;  4GV3 A;  3O9U A;  3D6R A;  4FO0 A;  1CZA N;  1H1V A;  1JCG A;  1YI2 N;  2NNW A;  1GLF O;  3SMP A;  1K8K B;  3FE1 A;  4OPH A;  4H0Y B;  4CZI A;  4YOX A;  5M1P A;  1S22 A;  3VF4 A;  3FGU A;  3ZX3 A;  2HOE A;  4QS7 A;  3VEX A;  3CCE N;  3OBW A;  4FSV A;  4YOW A;  2W41 A;  3D2E A;  4FWM A;  4BVO A;  1XQS C;  3VOV A;  4YOY A;  5AQY A;  1P90 A;  4H5N A;  4BR2 A;  4H0P A;  2BTF A;  4HWI A;  4BRH A;  1D4X A;  3ZX0 A;  5M1Q A;  3C6H A;  4WQ5 A;  1NGA A;  2A5X A;  2Q97 A;  4BC3 A;  4BRC A;  2QI2 A;  4FPA A;  3D7E O;  1MWK A;  5AZI A;  3WEE A;  1SS6 A;  5AQK A;  1QZ5 A;  2E20 A;  2VGN A;  4IOC L;  3QB0 A;  4ILH A;  2CH6 A;  2QWR A;  4EHU A;  1Q81 O;  1K73 O;  4C23 A;  1KAX A;  1YF5 L;  4CD1 A;  4H0X B;  1DT9 A;  2GTD A;  1DKG D;  4Y0W A;  5JMV A;  4AM7 A;  1VQ7 N;  3WUH A;  2P9K B;  2GWJ A;  3C6A A;  3LDL A;  4IOX A;  3ENH A;  5ELZ A;  1V4T A;  4BRM A;  3VGL A;  5ADX A;  2GX9 A;  2NRW A;  2AA4 A;  3I55 N;  4B9Q A;  5MLC Q;  1HKC A;  2P9P A;  3HOS A;  1GLB G;  4JD2 B;  5AFU A;  3ZX2 A;  4EHT A;  2QTD A;  5KQD A;  2NLX A;  3LDP A;  2Q0R A;  3DLL L;  2I7N A;  5AQF A;  2FXU A;  2HBJ A;  1DGK N;  5JVG L;  2QWM A;  1MA9 B;  4FWN A;  2ASM A;  4CZJ A;  4KH6 A;  4BG8 A;  5GIO A;  3DJC A;  3A5L C;  3IDH A;  3EE8 A;  3T69 A;  5AZJ A;  5AR0 A;  5I9E B;  1M1K O;  1ATR A;  1QVF M;  4IOA L;  1E4F T;  3I8B A;  5M1N A;  2CGJ A;  5AQS A;  5HL7 L;  5E84 A;  1J6Z A;  1NM1 A;  3D2F A;  3QBW A;  3CPE A;  2W40 A;  3P31 A;  1SZ2 A;  5M1F A;  4BR9 A;  5BR9 A;  3O9S A;  2D0P A;  3LL3 A;  2ZJR L;  3NVK A;  4FPB A;  4A5A A;  4HTL A;  1VQP N;  4C1N K;  5C12 A;  2ZJP L;  2Q31 A;  1U2V A;  2QA4 N;  3AAR A;  3L4Q A;  3ULE A;  4BRQ A;  4BC2 A;  2IVP A;  3CD6 N;  2FSJ A;  1EQY A;  2ZGZ A;  5BPN A;  3QFU A;  4ISF A;  4IDH A;  4B1V A;  4XH5 A;  5FPE A;  1KAZ A;  2A41 A;  3CCS N;  2PAV A;  5DM6 L;  2YCH A;  4BC4 A;  1LOT B;  1NGE A;  2YHW A;  3RSE A;  1NWK A;  5TKY A;  3SBT A;  3MMV A;  1VQN N;  1NGD A;  3H1Q A;  4B1W B;  2AP1 A;  3DAW A;  3O1B A;  1GLL O;  1VQ6 N;  4JKF A;  5M1O A;  2E8A A;  3F5T A;  1K8A O;  3CCL N;  3QML A;  4ILJ A;  5CE3 A;  2ITM A;  4PL8 A;  3CC2 N;  3VF6 A;  2KHO A;  3DWL A;  5AQN A;  4RTF D;  1VQ8 N;  4B1Z A;  3VEN A;  5EX5 A;  1ATN A;  3KHY A;  1JCE A;  2P9S B;  3ZET B;  3N4Q A;  1S3X A;  3WXM B;  4BRD A;  3HZ6 A;  4WQ5 C;  1NGH A;  1W97 L;  4IXC A;  4L3Q A;  5KQ8 A;  4CZK A;  4XH4 A;  2F9W A;  3CJA A;  3PLA A;  3CCV N;  1IG8 A;  3EKS A;  1DEJ A;  3OBY A;  4CJ7 A;  4Z94 A;  3M3Z A;  4ISE A;  3CPW M;  4IJA A;  4FWS A;  3ID6 A;  3MCA B;  4KH5 A;  4DB3 A;  4JK7 A;  2Q2R A;  4FWQ A;  2UYT A;  4BRL A;  3WXK A;  2FSK A;  3VER A;  2A6A A;  4H5V A;  2Q36 A;  4WCE L;  3O4W A;  3EN9 A;  3I56 N;  4BGB A;  3O9T A;  5GAH P;  3WT0 A;  4O8U A;  2BUP A;  2YI1 A;  5C2F A;  1SAZ A;  3CIP A;  5C10 A;  5BN8 A;  4BRI A;  5E26 A;  4CD3 A;  3BUZ B;  1IJJ A;  1X3N A;  3L0Q A;  4BR4 A;  1OKJ A;  4JKC A;  3VF2 A;  1K9M O;  1QHA A;  1NGI A;  3F9M A;  1BOT O;  4JNE A;  4GY2 B;  4K43 A;  4MLE A;  5AQM A;  5AQX A;  4WFB L;  3CCQ N;  1BA0 A;  3K9K A;  3AAP A;  1YIT N;  4M7X A;  3I33 A;  2WUS A;  4BRK A;  2KKZ A;  2F7T A;  3CQY A;  1NGC A;  4JAX A;  3SMS A;  4EIA A;  4YOR A;  5KPT A;  4JN4 A;  2FF6 A;  3OHR A;  1BU6 O;  3UKR B;  2P9U B;  2QWN A;  3P4I A;  4J8F A;  3HSC A;  5CHI A;  3H45 C;  2V52 B;  1VAZ A;  3MDQ A;  4PKI A;  1E4G T;  2J4R A;  4O8K A;  3HOT A;  3KWI A;  1YUW A;  3DXM A;  3LM9 A;  3U8X A;  4BRG A;  3E9O A;  3TSU A;  1Z6R A;  3QFP A;  3G4S N;  4WFN L;  4XEI A;  3VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...