3DMJA

Crystal structure of hiv-1 v106a and y181c mutant reverse transcriptase in complex with gw564511.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 142
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dmjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dmjA05
2RF2B 2IOCA 3IS9A 1D5AA 5KT7A 2WB4A 3IRXB 2D41A 5KFUA 3G6XA 4DQQA 3O3HA 3MR2A 1U04A 1NHUA 3DLHA 2V9WA 2XY7A 3HXMA 3RRHA 4EO8A 1U49A 3H08A 3TR8A 4RW7A 5J2PA 3T1AA 2VG5B 1NOZA 1HRHA 5EUHA 3OJUA 4CK1A 3CM5A 1JLCA 4KAZA 3BSNA 1TKTB 4F4YA 4KAIA 5KG3A 4CJVA 1NOYA 2R8HA 5HP1B 4O3OA 2UVUA 2ATLA 2FBXA 1RDDA 1S9EA 3CDUA 4HUGA 4OKJA 3NGZA 2WONB 1EETB 1CSJA 2W7OA 3C6TB 3OYAA 1C1CB 3VQBA 4OPJA 5KT2A 2G8FA 3RWUA 2B6AB 4ECQA 3ZSXA 1S1XA 3WNHA 3CJ3A 4YMEA 1HYZA 3E01B 5I3UA 3QIDA 4RW9B 4RNNA 1RYRA 4ED0A 3QGIA 5C5JA 3H4BA 3K5LA 4CEDA 4Y1CA 1QSSA 3NF9A 4E7KA 2DFFA 1DTTB 4RNMA 3VQDA 3DLBA 4O4GA 4J9NA 4RW9A 3MFIA 4TYBA 3HVWA 1RT3A 2DFEA 5KFKA 1YTAA 1D0EA 4J9KA 1RTJA 3NH0A 3MEDA 3NCIA 4CJ4A 4FJKA 1S48A 3UQSA 3V9WA 4XO0A 1RA7A 3CDWA 2FC0A 3KLVA 2GV9A 5DK5A 4K4WA 3QEXA 2A1SA 4OGEA 4AILC 1NJXA 4TYAA 3D0PA 3M9OB 2B5JA 2W8LA 3NGYA 5KGWA 3ZSOA 4DFKA 3DLGB 3ASMA 5KFVA 4JUZA 1XWLA 4CGJA 4TY8A 5KFRA 2Z1JA 4CIFA 2Q3SA 4J9MA 4R5PB 3ZSYA 3CM6A 3V9XA 4FYDA 2P1JA 4N5SA 1QSYA 4K4SA 1QE1B 4W5TA 2E6MA 1HPZA 4ID5B 4CHQA 3MEDB 3I8DA 3TAEA 3NHGA 2HHSA 3VQAA 4CEOA 3I0SA 1S1UA 1YVFA 3ZT0A 1JLBB 4ICLA 5KFOA 3FQLA 4YP3A 3KKRA 1CXUA 3M8PA 2LSNA 4NYFA 2OH2A 4AHRA 1TL1B 3M9NB 3KIOA 5DQIA 3RR8A 5KG2A 4HUEA 4WZQA 1T05A 4PQUB 3RMDA 1ASVA 1D9DA 3GIJA 5CYQB 1GOCA 4DG1B 2BQ3A 3TARA 4K8ZA 4KHNA 4DL2A 3C6TA 4FJ5A 2BRLA 4JV1A 2KQ2A 1CLQA 4WYLA 4FLUA 3RB0A 2YNHB 3H2LA 1VRUA 4NCGA 1QAJA 3GIKA 1J5OA 3SI6A 3NH1A 2OPRA 2J6UA 4DTMA 1BQNB 4CHNA 4KPYA 3L2RA 4KRFA 5J1EB 4IKAA 1HYSA 4O4GB 3AVJA 2FJVA 3AVHA 4C8KA 3NF8A 1LW2A 1RT1B 1KFDA 3OJSA 4ECYA 2W8KA 3PO4A 4BE0A 4DMNA 3M9MB 4I2PB 3RMCA 2RF2A 3DDKA 3I0RB 5KT4A 3ZSWA 2QK9A 4FXDA 4EEYA 4O44B 3QIOA 3H4DA 3M8SA 3BR9A 4CJFA 2WONA 1NJWA 3HJFA 4IBNA 3EZUA 3OYCA 1T3NA 4WE1B 2O4GA 3TAMA 4CJSA 2BGGA 4OKKA 3KOAA 4N56A 5HRRA 3HPGA 4F4XA 1QUVA 1DLOB 3PV8A 1VSHA 3MEEB 5C25A 4B9VA 4R8UA 3RAXA 4FS1A 1X9WA 1LW0A 4NZ0A 4HHTA 5F8JA 3DLKA 3QLHB 4FZYA 2VA3A 2JEFA 1HQUA 3V4IB 1L3SA 3HP6A 5C42B 4KHUA 4OVLA 3HPHA 4NLWA 2HHUA 3K2PA 4BE1A 1HQEB 2AU0A 4FLZA 3AO3A 3OYDA 2XGPA 1S6PA 4O3QA 4ELVA 1JLAA 1EP4B 3KK3B 4ZVFA 1N6QB 3GV8B 3SPYA 3GILA 1GOBA 3JYTA 1VK0A 4DWIA 2R7YA 1LWFB 1WAFA 1NK5A 3PUFA 4I2QA 1KTQA 3KJVB 3NFAA 3GYNA 3OYJA 5KGXA 1RT6A 3RAQA 5F8NA 1S0MA 2Y1IA 4JV2A 4MFBB 4PWDA 4J9LA 4CK3A 1RT7A 3ZSRA 2ZD1A 3KJVA 5KFBA 4FM1A 5DGAA 4OJRA 1KLMB 4E1NA 3ISND 4HKQA 4W5RA 2FBTA 4FS2A 4WZMA 2HHTA 1I3AA 4NRTA 3GIIA 3P1GA 4ECSA 2BQRA 2A1RA 4TXSA 1D1UA 2ZQBA 1CXQA 4K4UA 1Y97A 2V0NA 2DPJA 4ED7A 2D0BA 5KT6A 2BANB 3MR5A 4IDKA 4CF2A 1TP7A 1TVRB 4HYKA 2OA8A 4O5BA 5KFPA 3M8PB 3PY8A 4LH5A 1VSLA 2AGQA 1SKWA 3NF7A 4NRUA 4HTUA 5DG8A 3SUNA 2GIQA 2IS3A 4TQRA 3HVTB 4AHVA 1HNVB 2IM2A 2W9BA 5T7BA 1BIZA 5E41A 1KLMA 2B4JA 3MEGA 4Y3CA 1RYSA 3LPUA 3T5HA 3HVRA 4RW6B 4DF8A 1FKPB 2I5JB 1HNVA 3MEEA 3QEVA 4URQU 4JS5A 3TVKA 4TLRA 3E51A 3V81A 3QYYA 3NBPB 2X74A 4DLGA 1RBVA 2CKWA 4QCLA 2VG5A 3BREA 3KMQA 2IM3A 3OYFA 1Z25A 5KG6A 2C22A 1RBTA 2ATQA 1TL3A 3H59A 2I1RA 1RDCA 3P5JA 3GV5B 3HYFA 1S1XB 1VSFA 4JRQA 5KG1A 4LSNA 3BGRB 4ZPDA 4IH7A 3PW5A 3V4IA 4J2AA 4CJTA 1HPZB 2WK4A 4DF4A 2YNGB 1JXLA 2AGOA 4NYNA 2ZE2B 4O3RA 1VSIA 3T5LA 4E19A 4PY5A 3M8QB 1MU2B 1RNHA 1ITGA 1NHVA 1SH2A 4TN2A 2W7PA 4NLPA 3PO5A 1W9HA 4YR3A 4GW6A 4E7IA 2HNDB 3KD5E 4ED3A 3M8QA 4CJQA 4JRPA 4EZ6A 4Q0BB 4M3UA 1TK8A 1NJZA 1JLFA 1RTDA 1LW0B 3KLHA 4EZ9A 1U48A 3TQ1A 3VQ9A 1N4LA 4O44A 5KFTA 4XPCA 2GIRA 3QNOA 2R8IA 3PW0A 4ED8A 3LP2B 3RBEA 4ELUA 3DYAA 4LSLA 4FW1A 4RNHA 1VRTB 3WNGA 3THVA 3EZ5A 3OHBA 4ZP8A 4QWBA 4DQSA 4M3XA 4F8RA 4IDKB 4TSXA 3A2FA 4DSFA 3DOLB 1HYVA 1TKXA 2IGIA 3BGRA 1NJYA 4KV8B 1TQLA 3HM9A 5KRSA 3RTVA 3FFIA 4CJRA 4CHZA 2P5GA 5L1JA 1N5YB 3CJ5A 3QO9A 3RB3A 1EETA 4O0IA 1TGOA 2OPPB 5KFSA 3KK1A 2KZZA 3VQEA 2IA6A 1JLCB 3D28A 1IO2A 4FBTA 1J5OB 2IJNA 1W0HA 1LV5A 2O4IA 3RB6A 4DSKA 1C6VA 5JXSA 4F4ZA 4AHSA 3CWJA 4RU9A 3ICLA 4FCYA 3IGNA 1KFSA 1IKWB 3B6OA 3PVXA 4FLVA 1JLBA 1GOAA 4CCHA 3CJ4A 5J2QB 4IQXA 3L8BA 1Q9YA 4Z0UA 4YFUA 3ZT1A 3DRSA 3V6DB 2J6SA 4B9TA 4LD0A 3QIPB 4PUOB 3F9KA 5I42A 2C2DA 4M3ZA 3RMAA 4BWMA 4CIGA 2OPSB 1RTIB 4FJMA 3KHLA 1RBSA 4ECZA 2IC3B 4K4YA 4CHOA 3V81B 4Q5VA 1JLQB 4NLOA 5DGBA 3AA4A 1IKYB 1WN7A 1NK7A 1JLGB 3QERA 4ZPBA 3T5KA 2HNYB 2D0AA 3DLRA 4LQ3A 1I39A 1SL1A 5HROA 3NAIA 4M42A 4KHSA 4CIEA 4CEEA 1DLOA 3OYKA 4FJHA 1C1BB 4K4TA 3CO9A 4R0EA 4OPKA 4ZVGA 1WSFA 1F21A 3KK1B 2FVSA 2ITGA 5J2NB 3LALA 2OPSA 4NLTA 1NK9A 3SV4A 1UAXA 4I9QA 3KLIB 3KLEB 1W25A 4MKAA 1RA6A 1BISA 4BACA 1QTMA 5KFNA 4KTWA 1T03A 2YNIB 4CFCA 1IKXB 4FZXC 1C1CA 1A5VA 1SV5A 1VSKA 2XY5A 5J2MA 4DQPA 2VG7B 3KLHB 4J9SA 2IM0A 2HMIB 3AA2A 3U3GA 4RW4B 1X9MA 1RT7B 3SUPA 5HRNA 1NKEA 3EY1A 3LWMA 3QZ7A 2UVRA 5HLFA 3VQ4A 4H4MA 4ECTA 1S9FA 4K8XA 1LWFA 2YNHA 1RAJA 4C8NA 3Q8RB 3SPZA 5FRMA 2IBKA 1IKYA 2W9BB 5KFAA 3OSNA 3IN5A 2C2EA 5C25B 1JL2A 4KV8A 4NLGA 4RG8A 1ZETA 4YQWA 3DLEB 4W5OA 1Q8IA 1UA0A 4IG3A 1R0AB 3NAEA 5KG5A 1K1SA 4OGCA 4FBUA 3SYZA 4QW9A 4CGIA 1LW2B 1RT1A 1LAVA 2BANA 4TY9A 2YNGA 2BQUA 3H98A 2D5RA 4XIUA 4DL4A 4CESA 4KTQA 4FJ7A 4ED2A 2G8IA 4I2PA 3HT3A 4U6PA 3AVMA 3AVCA 5CYMB 2HAIA 4RNOA 1XR5A 4ZPCA 4ID5A 4ED1A 2YNFB 4KHWA 4B08A 4CEAA 4IH6A 3U3YA 1UA1A 1OS5A 1RDAA 3RBDA 4YR0A 1S0OA 3SFUA 1JLEB 3AVFA 4C8OA 3DLGA 1T8EA 4WXWA 1KVAA 1MU2A 1TAUA 5DQHA 1XR6A 5HRPA 1RILA 3AVKA 1TK0A 2AJQA 2ZKUA 3CJ0A 4EYIB 5KFEA 1FKOB 2D3UA 5KG7A 1ZBUA 3CJ2A 3JSMA 1SUQA 4H8KA 4E1MA 2IDOA 1TV6B 3AO1A 2G8KA 5FROA 3PX0A 1T05B 5J2QA 3V6KA 4IOBA 1CZ9A 4IRKA 3SFGA 4KFBB 2RN2A 1FXXA 4RNFA 4Z4IA 3CFRA 1ASWA 3G86A 3NGDA 3BSOA 4DTOA 4MIBA 4IKFA 5J2NA 2IJFA 1ZTWA 2YKMB 1XHZA 3E01A 2X78A 3O4NA 3ITHB 5F9LA 1SL0A 1NNDA 4IRCA 3KNAA 3S3NA 2B5JB 1FKPA 3H5SA 4NCGB 4CF1A 4O4RA 4N47A 3DMJA 3NMAA 2WTFA 4CJPA 3MECB 4R8UB 3VQPA 3VN5A 2E9ZA 3HVTA 5KG0A 3ZSZA 3DI6B 5CZ2A 3LDSA 4CEBA 4KI6A 1U45A 4KB0A 4KREA 4FLXA 2JLEA 2IM1A 3HK2A 2FLNA 2AWZA 4C8MA 3LWLA 2R8KA 5F8IA 3QETA 1B9DA 1HQEA 4F2SA 3KLFA 5SZTA 3AA3A 4FZZA 3T5JA 1A5WA 1RTJB 3LP2A 3NF6A 1UWBA 2QKKA 2FBVA 1TKXB 4N76A 4N41A 3KK3A 3LANA 4FJNA 3TAGA 4QOZB 2BE2A 1QE1A 3DOKB 4CERA 4BDPA 3OL9A 5K14B 3HP9A 3NE6A 3PX4A 1S9GB 1VSEA 3ZT4A 3QEWA 4W5QA 4Q45A 4QAGA 2Z1GA 4FJJA 1S1WB 4K4ZA 4K4VA 2HVHA 1S1TA 3V9SA 1XC9A 1RT6B 3V1RA 3OLBA 3S9HA 3LPTA 3OVNA 4KB7A 1RCHA 4M3YA 3FSIA 1BQMA 4CJ3A 4QWEA 4HCCA 5DLFA 4XPEA 3AVGA 3SJJA 4FM2A 4ZVHA 2WCXA 4WXOA 5CYQA 1KHVA 4ZTJA 3MTKA 1U09A 4G1QA 4GC6A 4CFAA 4FJ8A 3TAMB 3KD1E 4CF8A 3OYHA 4IFVB 2W9CB 4DTSA 3HL8A 1GX5A 4IG0B 4BDZA 1KCFA 5I42B 2ASDA 3MAQA 2YKNA 1SV5B 2G8HA 4E0DA 2C2RA 1RT2B 4F50A 5HRSA 3I5BA 5F8LA 4URSA 2XO7A 4CJEA 5FDLA 3C6UB 3CDEA 3VQ8A 4ZP7A 1JKHB 4IR9A 4JS4A 4K50A 1ASUA 3S3MA 5C24A 4CGFA 4J2EA 1YVUA 4RUCA 4B9UA 2HHQA 2D3ZA 4EYHB 2VWJA 3H5YA 4DL5A 3TABA 4Q44A 3KK2A 1BQNA 1L3UA 4WFZA 1X1PA 4AHUA 5F8GA 2AGPA 4O3SA 4DSEA 1S1VB 3SV3A 4EO6A 2RDIA 5DG9A 3ISNC 2FJXA 1O1WA 3QIPA 3KHRA 2OPQA 3UIQA 5KFJA 4CGGA 1J54A 3MF5A 2HVIA 5DQGA 4M3WA 3VQ7A 3O3FA 4I7FB 3AO4A 4O3NA 3HVAA 3GQCA 2XCPA 2E9RX 4FK4A 1REVB 3O3GA 4OL8A 1XI1A 4JLHA 4RW8B 4H54A 3PZPA 4M95A 3DLEA 4I7FA 3DRSB 4F3OA 2OPRB 4NLVA 2O5DA 4MIAA 1WLJA 1TV6A 3TAQA 4EP5A 4ZMMA 2FBYA 5DMRA 1I6JA 4ZHRB 4RW6A 3ULDA 1VRUB 3K5NA 3VQ6A 4FW2A 4KTZA 5KRTA 3KHGA 3ZSVA 3F73A 3HKWA 1C0TA 1ZTTA 3MR3A 2JEJA 5D3GB 3OS1A 3N6NA 3ITHA 4FLTA 4IRDA 4RW4A 4H4OB 2VA2A 4RW7B 5J2PB 1TL1A 1NK6A 5SWMA 4CJLA 4FJXA 4QWAA 2XC9A 4ELTA 3FFIB 2HHVA 3BQ2A 4WFXA 4LSNB 1RT2A 2EX3A 1IG9A 3JSMB 2YKNB 2KFNA 3OL6A 2XWYA 5L1LA 2XCAA 4EP4A 1RTDB 4BWJA 4QW8A 1IKVA 4KE5A 5J1EA 2FVCA 4B9LA 5I3UB 4NLDA 1SH3A 5CY4A 3WNFA 2BRKA 1TKTA 1ZBIA 4J9RA 3HO1A 1RTHA 3VQSA 4B9MA 1S4FA 2IAJB 3DRRA 3QNNA 2WOMB 1C1AA 2I5JA 4HUFA 4CF0A 1NKCA 4GMJB 3K57A 1BQMB 3LP0A 1WSHA 4B8AB 4NCBA 1N56A 4PA1A 4MH8A 1N5YA 2WOMA 5KFLA 2IAJA 3DRRB 1NK0A 3HPOA 5KT3A 3OYNA 3AVNA 3QEPA 1N6QA 2IC3A 1S1WA 1LWEB 4CK2A 4HCBA 2AX0A 4O3PA 4GVMA 2W9AA 4KI4A 4NLUA 4WFYA 3ALYA 1RTIA 2UUTA 1ZBHA 3AVLA 4DTPA 3KLGB 1BI4B 4DLEA 3KTQA 2KFZA 4H4OA 3V6JA 5CZ1A 3SCXA 3PW4A 4ICLB 4Z4GA 1TKZA 4HVJA 2Z1HA 3UPFA 2F96A 2YNIA 1L5UA 1RT5A 3CVKA 3L2UA 3N6MA 4NLQA 3L3VA 2OPQB 4M94A 3AO5A 3QESA 1BCMA 2R2TA 4FJGA 2FLLA 1S9EB 4AHTA 3AA5X 3OL8A 1HYSB 4AH9A 4DS5A 3NAHA 1HJRA 2HW3A 4DG1A 2HNDA 4DFJA 1C0UB 3NBPA 4J9QA 3Q8SB 2RKIB 2G8WA 3B6PA 2QE5A 4QWDA 3D5MA 2FVPA 2Z1IA 3BSAA 5KFCA 4M3RA 3OSPA 5DG7A 3QEIA 2XY8A 3TI0A 1QSLA 5F9NA 4ZP9A 3T3FA 4KHYA 5EWGA 1S6QA 3QO9B 3IGVA 4NCAA 4ZHRA 2PYLA 1S0NA 1NK4A 4KFBA 1WSJA 1RDBA 2J6TA 1GX6A 2HWIA 1U4BA 3I0SB 2G8UA 3IS9B 5L1IA 1NK8A 3M8RA 3G6YA 4J9PA 4ECWA 2HHXA 1DTTA 3SUOA 4B3OB 3TAPA 3KLGA 3ZT3A 3G0ZA 3I5AA 2ALZA 2F8SA 4FK2A 3K59A 2FJWA 2XGQA 3K58A 2JC0A 3DYAB 4LSLB 5D3GA 2V4RA 5L9XA 4MFBA 1C1BA 4PWDB 2ASLA 3RRGA 3H5XA 4FJ9A 2E6LA 5C42A 3V1OA 4DTUA 1K6YA 2OPPA 3MECA 2VG6B 5F8MA 1BHLA 2PY5A 1J9AA 4FM0A 1K1QA 1TK5A 3UR0A 2ETJA 2KTQA 5F8HA 1VSJA 2HB5A 4JV0A 1HARA 3ZSQA 3KHHA 4DTXA 3PHEA 3OYGA 2R2SA 3VQCA 2P5OA 1JLAB 2GBZA 3NL0A 3PW2A 2JEGA 1WSIA 1TVRA 2FVQA 4IFVA 4EBDA 4KO0B 3DM2A 2QV6A 4KKOA 3NH2A 2ILYA 2FLPA 3K5MA 3LZJA 4B9NA 4ECVA 1QQCA 1RT4B 3MXMA 3AVBA 3L2QA 1S6PB 4M3TA 4E3SA 1BL3A 2R8JA 1T94A 4J2BA 3CFPA 2R2UA 2G8VA 5DLGA 4Q0BA 5KFQA 3LAMA 4CEFA 3SZ2A 4ED6A 4RZRA 1HMVA 1RDRA 3VA0A 2QXFA 1LWEA 1XR7A 3EPIA 2EHGA 2UVVA 3KKSA 4NLXA 2RPIA 1B92A 4OLAA 5KFXA 4O55A 3CFOA 3V9ZA 1IM4A 3D45A 3DLKB 1MMLA 1KRPA 3SQ4A 4M41A 1QAIA 4CFDA 2DPIA 4CGDA 3OYBA 3HSTB 1JKHA 1KVBA 2R2RA 2WHOA 1RT5B 2X6SA 3MXIA 4B9SA 2B43A 4NYZA 3O4QA 2PZSA 4Z4CA 1KLNA 4C8LA 2OZMA 1L3VA 4Z4FA 3OYEA 3CYMA 2UUWA 4F2RA 2ZE2A 4E7JA 1T7PA 3CIZA 1NKBA 5KFYA 3QINA 4B3OA 1JXEA 4CJWA 3N6LA 3OYLA 4E7LA 4J2DA 5KG4A 4Y1DA 4L8RB 2IMWP 4MKBA 3IRXA 3EYZA 1ZBLA 4CJKA 2PYJA 2B6AA 4KKOB 4DFPA 1S10A 3DI6A 1WSGA 2UVWA 1WNSA 1J53A 4LY7A 1IKWA 2NUBA 2Y1JA 1S97A 3KLIA 3KLEA 1Z4UA 1JL1A 5KI6A 2OYQA 3AV9A 1L3TA 5KTQA 1KVCA 1RBRA 4U7CA 4CF9A 4H4MB 3S3OA 4DU4A 3V9UA 2RKIA 4PQUA 1JX4A 4J9OA 3BDPA 1KSPA 2YKMA 5EU7A 4FLWA 4CJ5A 1VSDA 2FVRA 5C24B 1LAWA 3QGHA 4QWCA 2AX1A 1JLGA 3PJWA 1QS4A 2CJQA 4X2BA 3IG1B 5KFMA 1RT4A 4DTJA 5KFHA 4DFMA 3K5OA 2WRMA 4Q43A 3KMSA 1A5XA 3L2WA 5L1KA 4W5NA 4Y2AA 4URGA 4CEZA 3FDSA 1TKZB 4M45A 3OS2A 3C95A 1TL3B 4KO0A 2V4QA 4CFBA 3PR5B 4DU1A 4DU3A 3OLAA 3VQQA 4IG0A 4R5PA 3OYMA 2F8EX 3WNEA 4RUAA 3C94A 1QHTA 4CE9A 5EDWA 2JEIA 1WNEA 4MK7A 2EC0A 4TQSA 2JC1A 3FQKA 2W42A 4FLYA 2E4LA 2XY6A 1WAJA 1EKEA 4F4KA 1SUQB 1C0TB 3OS0A 1FK9A 4F3TA 4IFYA 1BIUA 5EWEA 3QLHA 3SQ2A 3DMJB 2XI2A 2VG6A 2D0CA 2ASJA 4DTNA 4LQ9A 1SH0A 3SI8A 1CZBA 4GC7A 5HP1A 3SNNA 4WYWA 4DSLA 1JLQA 4TY8B 3HHKA 2X6NA 2OZSA 4KHQA 2XI3A 2KW4A 1S1TB 4YR2A 4FJLA 1Q9XA 1RT3B 4DEZA 1G15A 4DSJA 2GC8A 5JS2A 3AO2A 3PW7A 4DSIA 3TANA 2ILZA 5J2MB 4ECUA 2VWKA 4FK0A 5KFDA 1SL2A 1N48A 1Z26A 3RMBA 1S1UB 5CYMA 4K4XA 4CEQA 1SKSA 4ZTFA 3TWHA 4Z4HA 3SQ1A 3IG1A 3DOLA 1FKOA 1ZYQA 1BI4A 4G3IA 2BDPA 3LP0B 1IH7A 1EXQA 2XRIA 3AVIA 4EBEA 3V6HA 4FVMA 1VRTA 3GV7B 4ECXA 3BSCA 3Q8PB 5HLFB 3TAFA 3RR7A 4CHPA 4ZP6A 4F4WA 3BJYA 5KT5A 2DFHA 1HNIB 1JIHA 2YHBA 1C0UA 1HQUB 4ID1A 3SUQA 1C2PA 4CHYA 4Q8FA 4WE1A 3G6VA 3OHAA 3LAKA 1IKVB 3LZIA 3PX6A 3RB4A 4Z4EA 4Q8EA 3VA3A 1SKRA 2R8GA 4IH5A 3GIMA 1FK9B 1D9FA 5KFGA 1IKXA 5HBMA 1TAQA 3QZ8A 3AVAA 1HMVB 2YHAA 4DTRA 3SQ0A 1S49A 3BQ1A 4MQ3A 4BDYA 2GUIA 3L3UA 3G10A 4MK9A 3BQ0A 1UOCA 3LP3A 2VG7A 2C28A 2W9CA 3H5UA 2BE2B 4PUOA 2D7SA 1U47A 2YV0X 2KZMA 1KHWA 3I0RA 4Y34A 2F8TA 1T03B 3ZCMA 5EWFA 4O0JA 1DTQB 4OLBA 3UDLA 3DM2B 3KLFB 1S5JA 4B8CA 4CECA 4NLYA 1WSEA 3MEGB 1JLFB 4KHMA 4ECRA 1C0MA 4CJUA 2JGUA 3NKYA 3NDKA 4E7HA 4KSEB 1HNIA 3MFHA 4YNQA 2HNZA 3KK2B 3H40A 5KFWA 1BGXT 4BE2A 4CGHA 4DL7A 1EX4A 5HROB 5JUMA 4DS4A 4I2QB 5T14A 2E9TA 1XHXA 3FRZA 1S9GA 5KFFA 3VQ5A 2XHBA 3QGGA 3MR6A 4DL6A 4NLSA 3DRPA 1LWCB 4IFYB 1B9FA 4FJIA 1JXBA 2QKBA 4LH4A 5JS1A 3V6DA 4KBIA 1UWBB 3MXJA 5KFIA 2P51A 2HHWA 4DQRA 2DY4A 4RW8A 1S6QB 4ZVEA 3CQ8A 4AHCA 3Q8QB 1REVA 1BCOA 3LP1A 2DTUA 2ZD1B 3T19A 4ZPAA 4G1QB 3EPGA 2HWHA 1VSMA 4NLRA 5HBMB 4Y2CA 3PR4A 1YTUA 3U6FA 4DQIA 5FRNA 4OKEA 3IAYA 5KFZA 4E89A 1LWCA 2RDJA 3DRPB 3P83D 2HNYA 3I5CA 2BR0A 4EBCA 3JYTB 4UQGA 1S1VA 4DL3A 3ZT2A 3OY9A 3C6UA 4MK8A 4IR1A 3OYIA 5FDLB 1RTHB 2HNZB 1JLEA 3PJXA 1TKDA 1ZBFA 1EP4A 4KHRA 3L2VA 4KB1A 1X9SA 2HMIA 3V1QA 3LP1B 1RBUA 3CG7A 3OL7A 5K14A 1YT3A 4QPXA 3DOKA 1D8YA 2AQ4A 2YNFA 4IG3B 1R0AA 4I9LA 3NGIA 1DTQA
chains in the Genus database with same CATH superfamily
2RF2B 2IIHA 1QUPA 3OXFA 1Q82O 2CYYA 2P9UB 4Y65A 5FLXY 4DQQA 3O3HA 1VQKN 3MR2A 1FXLA 4GV9A 1U04A 3DGVA 3DLHA 2V9WA 2AP6A 5H9EK 1DBDA 4JKCA 5BR9A 5DDOC 3FKBA 3Q0AA 1NJIO 3RRHA 4HTJA 2RU9A 4EO8A 5J2PA 1Q8KA 1VQ7N 3EX7B 3A5OC 1RFQA 5D0HA 1HX1A 2C2ZB 4KAIA 1HNXJ 3OUYB 1H2TZ 3MUMP 3I55S 3BZKA 5HP1B 1M5OC 2MKJA 1Q86T 3I6PA 3L4IA 3JXOA 2XSJB 1MSWD 1C1CB 1BY9A 3WXMB 1HHSA 3R5CA 4A8QA 1HYZA 5I3UA 3BBBA 1GAOA 4RNNA 5C2FA 1AUSL 3O9QA 3QGIA 4U67Q 3H4BA 4Y1CA 3ZX2A 2BJ1A 5IOLA 5GADU 4E7KA 1N34J 2JDJA 3VQDA 3WT0A 1DJ0A 1D0EA 3GJTB 1RTJA 2FTRA 3NH0A 3B54A 3MEDA 1VC5A 3MPWA 4MLHA 4XO0A 4K4WA 3QEXA 2N82B 5E3RA 4DR4K 1AZSB 3NGYA 2KHOA 3ZSOA 4DFKA 2KFYA 4LRDA 2GVDB 4DDFA 2M8HA 5KFRA 5ADXH 2V67A 3CD5A 1OJ4A 4I64A 5FLXO 1QE1B 2F40A 4W5TA 3AT1B 4FVCA 3IXQA 4CHQA 2Q31A 3TAEA 3MOZA 3AB4B 2NSBA 4B3MF 3WDOA 5AQPA 2PO4A 2YCHA 4ICLA 3FQLA 4CZHA 2FJBB 2OD6A 5HOOA 1WBBA 3M9NB 1OYEA 3KIOA 3M8ZA 4DV7F 5IZHA 3I56N 5KG2A 4BRIA 5ETQA 1QVGR 3G71N 3D67A 3DDNA 3RMDA 4A4JA 1RK8A 2MZTA 2VBXA 1TZ0A 5CYQB 2A2CA 4USUA 4DL2A 1KC8T 3C6TA 3MN6A 2IVMA 4FYXB 4WYLA 4FLUA 3MUVP 3H2LA 3HFZB 2VHGA 4OYWA 4F26A 2FHMA 1GLFO 2EFGA 2LQ9A 3H3NO 3NH1A 1BQNB 6AT1B 5TKYA 3U1NA 2H3GX 1VAZA 3CXCM 1GTHA 1Q4RA 5EX5A 2D1CA 3AVJA 4C8KA 4DR6F 2G2OA 2F4VK 4ECYA 1YUWA 2HFSA 4PG5A 1RBAA 3CI5A 2HBJA 2HIYA 3P45B 4MDAA 2CVEA 1PG5B 2ERRA 2HFZA 2M52A 3P4UB 4PAAA 3K0JA 2VGMA 4MO4A 2LU2A 4EEYA 4L75A 3O80A 2VKRA 4L72B 2O8FB 1NJWA 2JHEA 3A13A 5AQTA 1RHUB 3EZUA 1FWLA 3KOAA 4N56A 3CUNA 3HTVA 1F5AA 4ILLA 1VSHA 2ALYB 5EOYA 4BR5A 2NZTA 4K0KK 3RAXA 3U1MA 2AJ1A 1S72S 2MZJA 1KVJA 1X9WA 4QS9A 4NZ0A 4HHTA 5F8JA 1KAZA 1J5EK 2UV8A 3UFCX 4ZS6A 3HZ6A 3S01A 4KHUA 2N3OA 4H5RA 1HBMA 3I96A 4MKVA 3PM9A 1UJ4A 3Q22A 3K2PA 4BE1A 4NL5A 4FLZA 2G9OA 4CLLA 2Q0UA 2XGPA 5D0EA 3I9V9 9ATCB 5LJVA 4C4WA 4KRWA 3KK3B 3AJDA 2C2KB 4WK1A 1NMEB 2RQKA 1WC0A 3TP2A 3OBIA 4BCAA 3JYTA 4CTAA 4PZVA 3MM8A 4CI0B 3AFGA 1LWFB 4PEOA 3FBCA 1WAFA 3H20A 4FWNA 3VQTA 3GYNA 1VHIA 5F8NA 4CK3A 2HYIB 4CM0A 1EX8A 2QTWA 4FYYB 4TU9A 1RT7A 3KJVA 2F65A 3EKSA 4JN4A 5KFBA 4FM1A 2ZDOA 3VESA 3MM6B 3TWZA 1Y3KA 1KLMB 4E1NA 4W5RA 3BO3A 3GIIA 4ECSA 2BQRA 3P1GA 1TU0B 2WVFA 3ZTQA 2GW8A 2DPJA 3FE1A 2ZF5O 1TVRB 2V8DA 3FLCO 3M8PB 3PY8A 4WFAQ 1WSVA 2EBGA 1GLCG 3L7UA 4LR7A 3SBMA 2B9WA 3MR7A 3VF0B 2GIQA 3AOBA 1V6HA 4K2JA 3A3OB 2IM2A 1BIZA 1NEEA 2M7SA 3MEGA 2FJDB 1RYSA 3NMRA 2DIUA 4B1ZA 4EFAC 1HNVA 1NM2A 2UXBJ 2JX2A 5IV4A 2DH8A 4URQU 4JS5A 3TVKA 2GZOA 3V81A 3QPIA 4JI7J 4CO2A 3NBPB 1RBVA 4OYIA 2PEBA 1I5OB 1CG2A 5KG6A 1DFDA 1TL3A 3M2RA 2I1RA 2P9PB 3GV5B 2RT3A 1VSFA 1S1XB 4B17A 3CCJN 1CULB 1FHTA 4OZNA 4IH7A 1HPZB 5CZVA 2NNWA 3D2FA 2YNGB 4CLTA 1TYQA 1EZZB 4NYNA 3I4PA 4LFBJ 1I94J 3M8QB 2K1RA 3N4QA 2CZ9A 1EWRA 1NHVA 4H4KC 2W7PA 4NLPA 3SK3A 1W9HA 2EWHA 1S22A 1F0XA 4B1VA 2BABA 3ZTPA 4GW6A 2W2OP 3NNHA 3D6RA 4HTIA 2DNKA 2IDLA 2DYAA 1LW0B 1Q81O 4JI4K 2AA4A 3HHLA 3QNOA 1YBAA 4XAKA 4QR2A 3LP2B 4FW1A 1OVYA 4DUZK 3WC0A 1RHRB 4ZP8A 4ZVOB 4DQSA 4M3XA 4F8RA 1G2EA 4BVOA 3BUZB 1TKXA 2IGIA 3VZHA 3CCRN 2LP4A 3BGRA 4XH5A 3WUHA 3D1QA 3RTVA 4FO0A 3FFIA 1VQPN 4CJRA 4CHZA 1FRKA 5A2QU 1N5YB 4AXJA 4DR2K 4G9ZA 5AQKA 1EETA 1JJHA 2H5IB 2YWFA 2PBDA 2QM1A 2YKAA 3A8IA 1GNKA 5DDQC 5IS2A 1SBRA 4FBTA 1UVKA 5CD4H 4JI5F 1JCFA 1J5OB 1S72N 2DR5A 2EPIA 2IJNA 1M1GA 1TL7B 3RB6A 2JWKA 4C9DA 4A47A 4X64K 4RU9A 4DUYF 1XMOF 4PL8A 4IQXA 1Q9YA 4Z0UA 4YFUA 4M7XA 3QIPB 4A8MP 3F9KA 1XNQK 2OUGA 2HFOA 4X66F 4BWMA 4KBOA 4DV1F 2OPSB 4OX7A 3R97A 5HANA 2BVZA 1RBSA 4AD6A 2GVDA 2V2KA 3WQUA 4NLOA 1EQMA 3D0GE 3FBFA 2Y8WA 1DY3A 1EKSA 4JI8J 4OPHA 2CQBA 4ZPBA 2YHYA 4I56A 2F8MA 3PYGA 1HA1A 3E2EA 1SL1A 2DGXA 2J0QD 4KHSA 2BH1A 4FJHA 2FSNA 1C1BB 5F3TA 4DR3K 1PYSB 2VF3A 4R0EA 4F3MA 1MN7A 4ZVGA 2IFXA 3TJ9A 2WVEA 2NCKL 1NK9A 2NRVA 3SV4A 1UAXA 2ZUGA 4QU6A 4JI0J 2V51B 2GJFA 4KTWA 1R8HA 3CCQN 1C1CA 2VG7B 4J9SA 2ROEA 5LSLA 3TYTA 3FZKA 2HQFA 1X9MA 1E6YB 3OUYA 1LQ9A 5AQHA 2E1RA 2I9SA 3EY1A 4JKBA 3LWMA 4OX9J 3AARA 3MMJA 3VQ4A 2EBEA 4LFAF 2KN4A 4J7CA 1E4FT 2CNKB 3DAWA 2DISA 2EI5A 1VBYA 2PE8A 3ID8A 2DHXA 2DGUA 3OSNA 2NRHA 3IN5A 2VD3A 2NREA 3EXYA 2ABYA 2F1FA 4RKUC 4WU2A 4RG8A 3I33A 3DLEB 4FP9A 3AY9A 2K3KA 4QW9A 4P6QA 3DXMB 1RT1A 2YNGA 5AJ3J 2M88A 2BQUA 1P9YA 1BUPA 2ZZMA 4U6PA 4W90B 3AVCA 1UWAA 1XR5A 3IR7B 4ID5A 5M1OA 3PYEA 1RAGB 2WBNA 2CA9A 4B08A 2VQFF 1WC6A 1YSJA 2X3DA 1RWUA 2RHSB 4JI4J 1KD1O 1UA1A 2WVCA 4HHHA 3RBDA 3A8YA 2HVDA 3VF2A 4HH0A 2ZBIA 4LJMA 5BYQA 1JLEB 1NPRA 4AFFA 3R7NB 3CETA 2G1HA 1T8EA 2KRRA 4R25A 4DV4J 1MU2A 1RILA 1YX2A 4KGZB 1TK0A 4ZKAA 3CJ0A 5KFEA 3CJ2A 1BO5O 4Y28C 5H1SQ 4EMDA 4E1MA 1M1KO 4QYRA 2G8KA 2YI1A 1QHAA 4LF5F 1T05B 1Q7LB 3KG4A 1CZ9A 4IRKA 4YN3B 3SFGA 4KFBB 4CZKA 3E9LA 1FXXA 1GLBG 5FPDA 2D1KA 2CPZA 2XLJA 2RMLA 4FF3A 4CD3A 1ASWA 2GS8A 1Y00A 3NGDA 2HBRB 5J2NA 1ZTWA 3BGFA 3E01A 2Q6CA 5BR8K 2B0GA 3H42A 2BJ8A 3LO3A 1NNDA 4ILHA 3KNAA 3K17A 3O08A 4X4TA 2B5JB 2ACYA 2VASA 4GKJF 2BJEA 3CMAN 1MROB 1UAWA 3BZCA 4CJPA 1NBWA 2ASOA 1TMJA 2R4FA 1KEKA 2MKIA 2E9ZA 3SBGA 4YY3K 1KONA 3AA9A 3TUIC 4DPXA 3DI6B 1PIEA 5CZ2A 1H2UX 1CJVA 5A8RA 4KI6A 5JVHQ 2IRXA 4KB0A 4PKHA 2ZBQA 2JLEA 3VGKA 2FLNA 4IEEA 4ZN1A 4C8MA 1V3SA 3VR1A 2R8KA 1N5SA 1T02A 4U9RA 3QETA 4KH5A 4CD1A 1HQEA 3U7JA 4CO0A 1X60A 1Y0HA 2C1EB 3W64A 2C3MA 4FZZA 5U47A 3VETA 3GL1A 1U6FA 2P9IA 2LDYA 3LP2A 3NF6A 2PDAA 3PIOQ 1BA1A 2XULA 2FBVA 4N41A 4N76A 3KK3A 3LANA 4LRBA 2H4YB 5E3PA 2BE2A 2WFBA 1YJWN 2FHKA 4CERA 3FK4A 5DS7A 3VALA 2V5HG 3FGUA 3PX4A 1H7XA 4LFBF 2KVQE 3QEWA 2M5YA 1IJJA 1VQ6N 4QAGA 1R8AA 2QO3A 2HVHA 5AQGA 3EJMA 5HK4A 1RTZA 4X84A 2L9NA 3LDNA 4DR7J 1XTZA 1BQMA 2QWOA 4QWEA 5DLFA 1VGYA 4QYZK 3W63A 3AVGA 2CWKA 4WXOA 5CYQA 1JK9B 2J0XA 2HHHK 5D4LA 5AE1A 1DARA 2PT0A 3PRDA 4CFAA 4FJ8A 3CCTA 3LPEA 4CF8A 3N4WA 2A40A 3OYHA 1R43A 2R7WA 1VQSA 4YY3F 1N34F 5I42B 4I6YA 1CJKA 3SMPA 4ZCMA 1RT2B 1MWZA 1Z1ZA 3I5BA 1EB0A 1R89A 5F8LA 3L7PA 4Z2XA 3VQ8A 1JKHB 3D7EO 3MMCB 4M5IA 3ENVA 4JAXA 3CJ9A 1ASUA 3LUYA 4DCJB 4CGFA 4J2EA 2EG1A 3CC7N 3SAHA 1BQNA 4H0OA 4AHUA 4OX9F 2M8DB 2ZBPA 4YOVA 4O3SA 4ZPTR 4DSEA 1HLUA 4OV1A 2DNLA 3R8YA 2RDIA 3BH6B 2QLFB 5DG9A 1MW7A 5FLXU 3A5NC 1O1WA 2HF3A 3KHRA 3CJAA 3UIQA 5KFJA 4FL9A 4CGGA 2AJ4A 3TTDA 2F9JA 4MIWA 5DQGA 1E4GT 3T6BA 4CZMA 4O3NA 4M5GA 2XCPA 4YDDB 2CQPA 1RWKB 5L38A 5AR0A 2RRAA 4UOFA 2DNRA 4H54A 3O3LA 1N0UA 3MWPA 3G2XA 3DLEA 2IHR1 1ZM3A 3VAIA 4FKXA 2E1AA 3MAAB 4EP5A 2FBYA 4TNOA 4IDHA 5DMRA 3QAUA 1BQXA 3HFVA 4FW2A 4LFAJ 3VEYA 1WC5A 3Q8VA 3OFGA 3HKWA 1C0TA 2DNQA 3Q8UA 5G0RA 1ZTTA 2J7UA 2FF6A 4FLTA 3ITHA 5H1SV 3QFHA 4S0MA 4CJ7A 5J2PB 2DO0A 1RWMB 4JK7A 2VONA 2FZKB 1WF2A 3NP5A 1U1KA 1OPIA 3LOUA 5AQMA 5K5MA 2CPFA 4A2AA 3D6TB 1KD1T 3H45C 1U1NA 2XLKA 4OHYA 2HHVA 3BQ2A 1MMDA 4WFXA 3KDNA 2RRNA 4WIQA 4A48A 1IG9A 3DGPB 3D6MB 4QQBA 2YPYA 2ZEJA 3C2PA 1IWAA 2MTLA 1RTDB 4TKTA 3E8OA 2C3UA 4DL0C 5I3UB 1SH3A 4OI4A 3P8BB 5CY4A 1YJTA 2WBRA 2DXEA 1TKTA 1RTHA 3VQSA 4JKDA 4B9MA 1YBUA 3K8VA 2IAJB 3VAJA 3QNNA 2WOMB 2KKZA 2P9NA 2I5JA 3AH6A 3OR1B 4GKJJ 3K57A 3LP0A 5AQYA 4B8AB 4C1NK 4PWWA 4OMFG 4DR6J 4BR7A 5AQXA 5C2CA 5AQQA 1NK0A 1B0PA 2N4DA 3IDHA 3HPOA 2EEYA 2F5GA 2X7IA 1UW9A 2DT9A 3QT8A 4FF2A 2AX0A 2Y3YA 2RVJA 3UWTA 2W9AA 2XMUA 2QLBB 2E2NA 1T6CA 3KYLA 1FRMA 4H4OA 3V6JA 2DIVA 3CCES 4DV5J 1EO1A 2Z1HA 4ZVUB 4LUBA 3ZZYA 3L2UA 4NLQA 2OPQB 4M94A 3AO5A 3D4JA 3ADAC 1G6BA 1YK9A 2R2TA 4AH9A 3NAHA 1HJRA 3CCUN 1C0UB 3G8QA 3Q8SB 4YB6A 5D78A 2QE5A 3D5MA 2FVPA 3M30B 2Z1IA 4XH1A 1EWQA 3AB2B 3PRVA 4Z7CA 5D8HB 4DUZF 4PXDA 5EWGA 1N54B 2NUHA 1F60B 1IBKJ 1NK4A 4KFBA 1WSJA 4JKAA 3OVBA 4LT6A 4CYUA 2J6TA 2HWIA 2G8UA 3EDQB 3IS9B 1TMMA 5L1IA 1J5EJ 3C7NB 3H90A 3G6YA 5IT0A 2C2NA 3VENA 3SUOA 2E29A 4B3OB 4IWVA 3ZT3A 1WWHA 1LFPA 1UZHA 3K58A 4ANDA 5D3GA 4CWBA 5L9XA 1GH8A 1FEHA 3DOMA 2ASLA 2W40A 3FZLA 4OZJA 1VBKA 1NSKL 2VG6B 3HZGA 5E3CA 1RUSA 4B1UB 1GK8A 4X64F 4ED5A 3THWB 5F8HA 1VSJA 3TR5A 1YI2N 3PIPQ 3ZSQA 3CT9A 3KHHA 2P6SA 5LT5A 2MKSA 5K20B 1FD8A 2OAUA 2MKHA 3CCMN 4DV6K 1M1HA 2FVQA 3NG8A 4F0HA 3LDOA 2QV6A 1NGDA 2Q43A 1XNRJ 4B02A 2ILYA 3MXMA 3QB0A 3L2QA 2MMYA 1S6PB 1V9OA 2QA4G 3ILJA 4NXMJ 4E3SA 1H0HB 1BL3A 2QMXA 4LF4J 2R2UA 2V52B 3ZZOA 5KFQA 1JJ4A 1RDRA 3W9JA 4AM7A 3GE1A 2EHGA 1Q18A 2UVVA 3KKSA 4NLXA 1B92A 4OLAA 3QT6A 2JLGA 3FCWA 3J81Y 4IOAL 2BEFA 3SIPB 1NZAA 2JSXA 4WTYA 1MMLA 4ZA1A 3OR1A 4OHWA 1HIYA 3D9BA 1RU2A 5E0OA 2WHOA 2X6SA 3MXIA 4B9SA 1YIJN 4LVNP 3T1HK 2PZSA 4Z4CA 1TUGB 4C8LA 3J7Z5 1RKIA 2C2OB 3CYMA 2J4RA 1PBAA 2VC1A 2AV5A 3GFXA 3CIZA 4ZVSB 4J2DA 5H9FJ 4Y1DA 4IO8A 2MQQA 1XNQJ 2ZJRQ 1G3OA 2B6AA 5BYSA 4EIAA 3JS9A 2JWNA 1CJUA 2VOPA 2MXYA 3KLIA 1Z4UA 3VWSA 3IAS9 5KTQA 1S99A 1PO6A 2P6TA 4CF9A 4X4QA 4H4MB 1WC3A 4NPOA 3T9ZA 4LF9K 4PQUA 4J9OA 5A8WA 1FKAF 5HAOA 4FLWA 2LQ8A 1WF1A 1VSDA 4RBVA 3QGHA 4FPRA 4DUYJ 3FR0A 4NZ6A 2CJQA 1ROFA 2J9EA 2ACMA 4DB3A 1FJ7A 1SAZA 4H0YB 4B3SK 1G99A 4JI4F 2UXCF 4M45A 2HZCA 3JQKA 4NE9C 4CFBA 3GJRB 5KOWA 3OLAA 2BW2A 3ZEUA 3VQQA 3WNEA 4RUAA 3VGLA 3IBFB 4AM6A 1AUDA 2O67A 1FTCA 5GMKa 5HVFA 3MPDA 5DO2A 2EC0A 3FQKA 2P9GA 2XY6A 4F4KA 3CCJS 4FWQA 3ETMA 1IXKA 1BIUA 5C2GA 3GE9A 1IUJA 1S6UA 2BKPA 3DMJB 3W2WA 2PMHA 2VG6A 2Y1RI 4GC7A 4OI6A 1JJ2M 4DR2J 3W0LA 3QJJA 1JLQA 2OZSA 2XI3A 2KW4A 3TSUA 4F02A 4BR2A 2MPUA 4FF4A 1N36J 4BR4A 4KPCA 2GC8A 4U7BA 3BGLA 3AO2A 4CO1A 1R8PA 5KFDA 1N48A 2WVBA 1BG3A 3QJLA 4IXCA 3RMBA 5A76A 3NLCA 3TWHA 1WORA 3JAMO 3GBTA 2GJIA 4L3QA 3IG1A 1CJKB 3QDKA 4AUKA 1FKOA 2L9WA 5HQMA 1BI4A 4G3IA 3ZTOA 3LP0B 1FRLA 1IH7A 1W2IA 4EBEA 4JI2J 3OFFA 4FVMA 4BQZA 1YTYA 1PYTA 3BJYA 5KT5A 2DFHA 2APOA 1C0UA 2RUGA 2OSQA 1C2PA 4CHYA 4Q8FA 1VRQC 1W97L 3OHAA 3LAKA 2KYZA 3KWIA 4X62F 2Y9HA 1GFWB 1VLYA 4KH1B 4Q8EA 1HW8A 1MWQA 1VQ8S 5L8RC 3OFHA 1QM9A 1RLCL 1N34K 1X5PA 2Q66A 2YH1A 3TZZA 3I4HX 2YHAA 1GLLO 4DTRA 1NB7A 3BQ1A 3G10A 2W9CA 1U1MA 5CHCB 2BE2B 3W3DA 7FDRA 1U47A 3VEXA 1NSQA 4Y34A 4Q2MA 3ZCMA 3DNCA 2X1BA 3TA0A 1DTQB 3CCLN 3UDLA 1FESA 4B8CA 5BR8J 1YJVA 3MEGB 3TPQA 3OW2M 1C0MA 4DV1K 1F9EB 1WJ9A 2PSZA 1WOPA 1ACMB 4OX6A 3EXCX 3MFHA 2VGNA 1Y5LB 2EFNA 2PIIA 3KK2B 3H40A 3GR1A 2WSEC 4BE2A 3T1HJ 1RAFB 3LDPA 4I2QB 4ILGB 1RWPB 2ZC3A 2E1CA 3DLJA 1T9UA 3BDEA 1WDDA 4NA2A 1MLAA 2DGSA 2GO9A 5HVGA 2Q36A 1B4SA 1NDLA 4DI6A 4DQRA 4DV2K 3BR8A 4DR3F 1NGFA 4NX9A 4ZVEA 3W60A 5GAHP 2KL8A 4NEZA 4ANCA 3CTRA 1CPZA 7FD1A 2UUAK 2HWHA 3EPGA 1VSMA 2R7XA 4EK2A 3NS7B 3GWCA 5JVGQ 3M8WA 2RDJA 3P83D 4U8VA 4ZITA 3JYTB 4NI2A 3TUJC 1IVZA 3ZT2A 1EQ0A 5DETA 5ELZA 1JLEA 3T69A 1ZBFA 3L2VA 1X9SA 2DNNA 4J8FA 3CG7A 2GTDA 3B4DA 1K0TA 5I3QA 2R3VA 1CZAN 1YT3A 2B3TB 4FF1A 3C14B 3BV8A 3MDFA 1R0AA 3OW2R 1FJEB 4NOHA 3TA1A 2J8SA 2WB1D 5KT7A 2WB4A 2JVRA 3ONQA 2CJAA 1W2BM 1DEJA 1AA1B 1I94F 3M6WA 3H08A 2G2ZA 3EUNA 2YHXA 1NMDA 1HRHA 4EHUA 4CK1A 1JLCA 4TU7A 2HMPA 4KAZA 1N8RT 4F4YA 4DR5J 1CJTA 4RJVA 2A41A 1F6TA 4HUGA 3CDUA 3NGZA 4JK8A 2W7OA 3OYAA 3JTNA 2RHQB 2NXEA 3IC1A 2ZKTA 4P7VA 2G8FA 1MMNA 4A8SA 4ECQA 4YMEA 2RJZA 2VQEJ 4CEDA 2UU9K 4I68A 3JQMA 3I32A 1AB8A 3DLBA 4J9NA 3D6FB 4RW9A 3R1LA 2DD8S 3QRQA 3HVWA 1YTAA 1RWVB 1YJ9N 1HKBA 4JYAF 3NCIA 5LMNK 2H1YA 4B3TF 3CDWA 5HO4A 5LMUK 3KLVA 2A1SA 4OZ3A 4UY85 1H98A 4TYAA 4OQJA 3FEYB 3W61A 4MKYA 3M9OB 2B5JA 1RHJB 3IKMA 2HLTA 5KGWA 3NS6A 5KFVA 2UXDK 3GPAA 1FDDA 4JI5J 1J6ZA 4CGJA 4TY8A 1Y64A 4B3RF 4CIFA 5H9FK 5B0DA 3NVMA 2Q3SA 1NO8A 1UTAA 4OZLA 1WOSA 1MWKA 2R42A 3R5AA 4PR6A 3CM6A 3ZSYA 2RQ4A 4FYDA 3AJ1A 4K4SA 2E6MA 1LOTB 5GMEA 4X62K 4RLEA 3GLJA 3VQAA 2FIUA 3I0SA 1YVFA 2GNKA 1N52B 4PQAA 8RUCA 4J37A 3D68A 4RO0A 4NYFA 3O9TA 4AHRA 1TL1B 1ZOTA 2FHJA 2ROGA 5DQIA 3RR8A 2CJBA 2NXNA 3BO2A 2I38A 3CJBA 3L95X 3W5XA 4MO5A 4PQUB 3H3OB 1T9VA 4JHDB 1D9DA 4OI0A 4LF6F 3VEVA 4M5NA 1GOCA 4H0TB 2ZBCA 4FJ5A 2M0GB 5GVQA 1CLQA 2IPOB 1V3ZA 3RB0A 2VJVA 2I0XA 4PXEA 2YNHB 2QXLA 3ATVA 1VRUA 4OZ5A 1SQKA 2XM3A 1J5OA 4DR3J 2J6UA 1Y5NB 4XK8C 4KPYA 3M2UB 4LRCA 1Q86O 4KRFA 3CC7S 2ZM6J 1RT1B 1KFDA 3SQGB 3WHIA 2RUSA 1NGAA 3FMBA 3M9MB 6FD1A 1CULA 3RMCA 2N3LA 5DM7L 3DDKA 3I0RB 2QLWA 2NXCA 5KT4A 1HI8A 1B99A 2XS2A 2Q79A 5M1KA 3H4DA 1ESVA 1W26A 5TKWA 4IBNA 4GVBB 4C23A 3EGWB 4JI0K 4DUZJ 5BR8F 3CD0A 3CSKA 3HPGA 1PGZA 1QUVA 1ZAWA 2EK6A 3R6MA 1IBMK 1IBKK 1E3MA 4R8UA 5EGYA 4CO5A 4FS1A 2FUG9 4F25A 1LW0A 4NA1A 3DLKA 2ZFHA 2JEFA 3K0SA 4NYPA 1FX4A 5C42B 4OVLA 4QIEA 3HPHA 3A0IX 2H65B 2ZH5A 1U02A 2VOOA 4PYAA 1X5SA 3OTDA 1BDGA 2KKHA 3FGVA 2Q3PA 4JI3K 3JXUA 3QMLA 2MGZA 4ZVFA 3TJAA 1N6QB 3MUTP 4GVLA 4LBHA 3L7OA 3GILA 1VK0A 1T6DA 2R7YA 5B0CA 4DKWA 1Q5VA 3EE8A 4B3RJ 1X4GA 3KJVB 3NFAA 2HRUA 1RT6A 3TQEA 1TL5A 2Y1IA 1YDLA 4BC7A 4O8KA 2XMJA 4BBYA 4OJRA 3NCRA 1V5VA 3J7ZT 2EFPA 2PFFB 2FBTA 3KXDA 2HHTA 4WZMA 4NRTA 4TXSA 1D1UA 4BRLA 1CXQA 1F9FA 1Y97A 3IRWP 3D0IE 4I67A 1CC7A 2W01A 2D0BA 3UKUA 2MY8A 2UUBK 2BANB 3MR5A 2A6AA 3FZBA 1TP7A 4HYKA 2QTDA 5KFPA 1VSLA 2E2PA 2AGQA 1SKWA 3NF7A 2KM8B 4NRUA 4JI8F 4RBUA 1HI0P 3CHWA 4ETXA 1OPZA 1Y5IB 2IS3A 3N5FA 3HVTB 4AHVA 2W9BA 2J9DA 3MPVA 4MLEA 1KLMA 3GU0A 4ZLJA 2MLYA 1XMOK 2Z2YB 4EHTA 3JTOA 4UZCA 3D0HE 2YX1A 4RW6B 1X8DA 3A4TA 2N7YA 3QEVA 3DOMB 2RAQA 3AOCA 4TLRA 2A42A 5GAEP 4YEAA 2OANA 2G0JA 3CJRA 2HSTA 2CH5A 2YKOA 3OXLA 4G65A 5B08A 2IM3A 3DDIA 1Z25A 1K8AO 2JNJA 2C22A 1RBTA 4L3KA 3OTOF 3C3LA 3VEWA 2OD4A 5CZXA 2GGPA 3EICA 3UD5A 1YJ7A 2F4VJ 4LSNA 4DN9A 2YX6A 4ZPDA 1G4CA 2YX4A 2FXUA 3V4IA 4FPBA 3VGSA 5D0GA 2HPUA 5D0RA 3VZIA 2RSQA 1JXLA 3K5PA 3G82B 5CHIA 3QWUA 1VSIA 3AOAA 4E19A 4PY5A 1R6VA 1RNHA 3RG6A 5HL7Q 3E9PA 1XMQJ 3PACA 2RILA 5IQ6A 2XNQA 1OQ3A 4I4BA 2XO6A 5CE3A 1P1TA 4DHVA 2ZZNA 2RQMA 3MWTA 4ED3A 4ZDNA 3M8QA 4Q0BB 3ETOA 2J0WA 3VTIA 2Y1LB 1RTDA 2W41A 5A2QO 3KLHA 4EZ9A 1U48A 5LSRA 4EAHD 3VQ9A 4XPCA 3H2UB 4C98A 2GIRA 2R8IA 2PMZD 2CDQA 1ZC6A 1QQMA 3VPZA 1K9MO 3NCQA 2IVFB 3CCRS 3PW0A 2UUCJ 3ULHA 3RBEA 1GEHA 1RHMB 4RCHA 3DYAA 4LSLA 4RNHA 5GAGP 3W5YA 2R7SA 1F2HA 3OVAA 4ATNA 2KJVA 4IDKB 1VK8A 3VVUA 3A2FA 2MY7A 3CJ1A 3THYB 5M2UA 2AYEA 5E3AA 4DPUA 1UCNA 2UXCJ 4KV8B 2ZGZA 2LVWA 4JYAK 4TU8A 1WUAA 4DQ8A 3KKFA 4C2MA 4LF7F 1GQEA 3TX8A 1P27B 3ZZRA 1LK5A 3RB3A 3AAQA 4JI3J 3UB5A 3GFZA 3A5LC 5KFSA 2HURA 2KZZA 1B0TA 4QIVA 4D3HA 5ETLA 5LJWA 3VQEA 2IA6A 1JLCB 1IO2A 1LV5A 4DSKA 3W2WB 5HN0A 3HBTA 4F4ZA 2CIMA 3CWJA 3ICLA 2DY1A 3IGNA 1KFSA 1IKWB 1VQ9S 1JLBA 4DV3F 3NWGA 3HOTA 1GOAA 4CCHA 5J2QB 2O8EB 3OD2A 2EWSA 5A0YA 4OJ1A 1K47A 2JH3A 5EHHA 2J6SA 1YITS 4PUOB 1FXDA 3FCVA 3O4WA 1SIZA 2C2DA 4KR0B 3NGKA 3RMAA 1GLJO 5HMWA 1HWIA 3KHLA 4WYBA 1R0BG 3AA8A 4EGLA 4ECZA 3J7AN 4K4YA 4CHOA 3V81B 1P90A 4LF6J 4A46A 1MWYA 3AA4A 1IBCB 2B9EA 1WN7A 2W4PA 1HHQA 3QERA 4LVOP 4NO7A 4BG9A 3L4BC 4ILMA 2D0AA 3ILOA 2DNHA 4ZIWA 3CCUS 5HROA 3NAIA 4CIEA 1DLOA 4K4TA 4IJAA 1J5EF 4BVPA 4OPKA 4OHXA 3U9ZA 2VH7A 2E1MC 2FVSA 2PC6A 4OI1A 3T41A 5AQFA 3KLIB 1W25A 4MKAA 5AQUA 4CLYA 4JI6K 2MQNA 1BISA 5CCMA 3ULEB 2P9UA 2AIRB 1T03A 2HBKA 4BRDA 2Y0BB 4FZXC 2XY5A 3I87A 1A5VA 5AJ3K 1OO0B 2YVSA 3GIRA 4YUDA 4QR0A 3ZTRA 1OY8A 3KLHB 1VQOS 2GCFA 2E7WA 4B3SF 4JI0F 1KXPA 2HMIB 4DR4F 3FC9A 3THPA 3AA2A 2CJKA 1RT7B 2EKNA 1GLEG 2GQ2A 3QZ7A 2UVRA 3NOGA 4CLUA 2ZNYA 1CQMA 3LTOA 3IM9A 2XSJA 3EKUA 1LWFA 1GLAG 5CA5A 4C8NA 5B0BA 4WP8A 3Q8RB 3C46A 3SPZA 3CJCA 5KFAA 3CXCR 3FRYA 4I69A 5A6WA 3H1VX 3QICA 4KV8A 1SJ4P 4NLGA 1WOQA 3C8YA 3B78A 4LF2A 2GGPB 3O44A 3S8SA 3NAEA 5KG5A 3OR2A 3M1FA 1K1SA 4FBUA 3DRXA 1LAVA 1TFWA 1HBUA 1JMTA 3H98A 4FKYA 1KWMA 4XIUA 2XZTB 2ZOFA 5LMUJ 3FCHA 3HT3A 2FLOA 1UW4A 5AT1B 2D74B 2HQ3A 5CYMB 2HAIA 3LA0A 3CD7A 4RNOA 3CGIA 4JV5K 3KK7A 2E5LK 2NUUG 3HD1A 4R0JA 2UXDJ 1MROA 2Y8YA 4CEAA 3HSDA 4AL6A 3E1YA 1OS5A 1XNRF 3SFUA 1NSAA 3ILLA 3AVFA 4AT1B 4AYBD 1QY7A 3DLGA 1ZBTA 2QSFA 2IIRA 4WXWA 1XMQF 3EGZA 1XR6A 5L39A 5HRPA 3AVKA 3DRYA 2QA4N 3LL3A 1FKOB 4LF4F 1RZMA 3CERA 1SUQA 4H8KA 2FZCB 4UUWA 1TV6B 3AO1A 3PX0A 3OTOJ 2RN2A 4RNFA 2NQPA 4HT5A 2RNEA 4DTOA 2VFVA 1YHQS 2GWJA 2L9DA 1OMSA 2HWTA 1XHZA 4ED4A 2BXJA 5E5NA 2ZHAA 4QS8A 2G2YA 4X4RA 1KP6A 5LMNJ 1KQSM 4JBCA 3ZZTA 1FNXH 5GAHU 4H0VB 4O4RA 3CMEN 2AZ3A 2V8PA 3DMJA 4CIOA 2FGOA 4DV0J 1U8WA 2QYCA 1TL7A 3PDNA 2LYVA 3MECB 3VN5A 3HVTA 2VQEK 2VFRA 3LDSA 2DY9A 4DR7K 1FDNA 4KREA 4FLXA 1RDUA 3D54A 2LFVA 2IM1A 2WZ1A 3F0NA 3M5RA 1N8RO 2E1PA 1RGIA 3FVYA 3ZEUB 4OJGA 3KLFA 4LR9A 3AA3A 3T5JA 4GKJK 1YI2S 1UWBA 2O8BB 3CJ8A 4DR4J 1TKXB 3QSYB 1WELA 1QE1A 4BDPA 3CC2S 5F0UA 2DNMA 4GV6A 2OEMA 5CAAA 3NGTA 1SJQA 3R8EA 4W5QA 4OZ2A 2HQCA 4K4VA 1S1TA 2B4PA 1WACA 1XC9A 3ENQA 1RT6B 3V1RA 3LPTA 3OVNA 1RCHA 4DR6K 3RUBL 3LDQA 1DQAA 1Q79A 2G13A 2NPFA 1S7HA 1YJWS 2DR9A 3ENBA 2XS5A 3SJJA 4FM2A 2WCXA 2UUCF 1KHVA 3DXBA 3F44A 1HWJA 4OYPA 1PAUB 3BF1A 3EZOA 1N0VC 4GC6A 4O8UA 5KPZA 3T9NA 3ENHA 5LMUF 5CQGA 1YIJS 3B8HA 1NLVA 4OYAA 3UNYA 4DTSA 3HL8A 3MMAA 1HWLA 2ROPA 3W2VA 2FHOB 3U4LA 4OX9K 3MAQA 2C2RA 4F50A 4ZK7M 4URSA 4B3RK 1WG4A 4GKKJ 3C6UB 4ZP7A 5BRHA 2GVZA 4IR9A 2L41A 3S3MA 2ZH3A 5C24A 2QFJA 1NPKA 5HSPA 4DL5A 5ADZA 1L3UA 1CBKA 3IUCA 1X1PA 2DHSA 1FO1A 5F8GA 2AGPA 2DTJA 4NI2B 1IR2A 2YQ0A 2FPHX 3SV3A 2BUPA 1GXUA 4L3NA 2WSFC 1WF0A 3MAHA 5KPTA 1NLKL 1D4XA 4YB1P 1YVNA 3QIPA 4X65F 4ZVRB 1HI1A 1VQ4N 3MF5A 3ZZUA 4PWUA 3T1YJ 4AL5A 1EHWA 4M3WA 1WHWA 3MX2A 3O3FA 3AO4A 2KHDA 1VQKS 2LXIA 3HVAA 3GQCA 4EU0A 2E9RX 4WQ4C 1XMBA 2ZH7A 3W2VB 4DR2F 5M1FA 3W8PA 3O3GA 4OL8A 1URNA 1XI1A 1UEVA 1RQ0A 1C4CA 5BJRA 4WCEQ 4LFCF 3NEKA 1WUUA 3POTB 3UDVA 5GAHI 1I51B 2FF3B 3SXLA 3OVSA 4AQYK 5SUHA 1ZPVA 2DRBA 3SDEA 5MLCQ 3WQPA 1I6JA 4ZHRB 3ULDA 2HQGA 1VRUB 3RBXA 1RSCA 3OBWA 3K5NA 1X5OA 1UL3A 4KTZA 5KRTA 1PJ7A 3HHEA 3KHGA 3ZX0A 4RWTA 1UKUA 4USHA 5D3GB 2V2ZA 1NDKA 3VF4A 4QIGA 3FEXB 4IRDA 1RWNB 1PILA 3UN5A 1YJNN 4H4OB 2HEKA 4RW7B 2VA2A 5B0AA 2I7NA 3SLCA 1TL1A 1XC3A 1NK6A 4PKGA 4YOEA 2GIFA 3TZYA 2EK1A 2UU9J 3UI3A 3ZTSA 3RAMA 2KB2A 2GX8A 1T3OA 3UDCA 4K25A 1RT2A 3L6QA 4BR9A 2NR0A 3KJQB 2KFNA 3EN9A 5L1LA 3AY0A 2CQ0A 4BWJA 3NMUA 2BYCA 4JKGA 3O8MA 4KE5A 3QAEA 1OH5A 1NCLA 3H1QA 2E5IA 3WNFA 3NGUA 2BRKA 5C10A 1RACB 2D0PA 1ZBIA 1HR0J 3MOJB 1M0SA 5K8MA 4F7VA 3DRRA 1YQHA 1C1AA 2ZHBA 4TLQA 4BRQA 1BQMB 4H0XB 1N36F 2IJRA 1N56A 1JQGA 2DNOA 4MH8A 1N5YA 2VBZA 3DRRB 2ASPA 1APSA 2KG0A 4RR5A 3NGRA 3QEPA 2IC3A 3TNVA 2E7VA 3V5RA 4KI4A 4OYBA 3DFEA 2BW7A 2YY3A 3HD2A 3AVLA 4LF8J 1AXQA 1BI4B 1VYAA 4DLEA 1QAXA 3KTQA 2KFZA 5CZ1A 3ZZZA 2LXFA 2AP1A 4ICLB 2PN6A 3N28A 3ZC4A 4HVJA 3FFKB 5AFUH 2BV3A 4DR5F 1FERA 4DV4K 3EL2A 2CQCA 3HHDA 2J9DE 3QESA 4CT8A 1Q16B 4DPYA 2UUAF 4DFJA 1CJTB 2PFDA 4J9QA 3DN9A 3BS9A 4DV3J 2E7XA 3B6PA 4YOUA 4CNZA 4A59A 1WKLA 2K1RB 2VBYA 3TI0A 2XY8A 3FSYA 3SJHA 3CNQP 4OI3A 3QO9B 3IGVA 3LM2A 4NCAA 4ZHRA 2VQFJ 4E2FB 1LFWA 3AD8C 3P49B 4BHQA 2DGTA 3K89A 1P1LA 3CC4S 3U9DA 3M8RA 4J9PA 4W4MA 3VGTA 1A9NB 4I6MA 1NG9A 2FJWA 1OIAA 2B7BB 3PSIA 1C4AA 2XMVA 3H5XA 3K9JA 2CZ4A 5LMNF 3N5BA 2HFNA 1FFGB 3D1HA 2OPPA 4DV0F 3MN5A 4CI6A 1DT9A 3UR0A 4BG8A 4JV0A 2ZNZA 2KT3A 2DH7A 5JICA 1ZZFA 4YOTA 2UXCK 2V8GA 2CPIA 3VQCA 3CIPA 2P5OA 2UP1A 5GADP 3NL0A 3GTYX 3MD1A 2LMIA 1IBKF 2LQ5A 1TVRA 2AYBA 3HI0A 5LL6d 2XS7A 2B51A 4IUFA 2KLAA 1RCOB 2CJ9A 4HACB 1QD1A 3NWRA 3LZJA 3PLAA 1YJNS 4M3TA 1U1RA 1N5TA 2WAQD 3ENAA 1VIXA 3W9IA 2R8JA 4J2BA 3Q24A 1D8ZA 4QU7A 2ZJQL 3LAMA 4CEFA 3SZ2A 4ED6A 3VA0A 3IFEA 3EPIA 2E44A 3OXGA 2G0IA 1VK3A 5KFXA 4O55A 3CFOA 2CNLB 3OTEA 3DLKB 3WQTA 3PFEA 2DITA 1KRPA 3SQ4A 1QAIA 3G4SN 2DPIA 3OYBA 1JKHA 4BRPA 4FYWB 2YWHA 4DZDA 4C11A 3HF5A 3O4QA 2V2QA 1KLNA 1H73A 1EQYA 4NLBA 3RGIA 1NKBA 2AEFA 1PC4A 2P9SB 1UMJA 3GZ7A 3OYLA 1OQ6A 5KG4A 4MKBA 4WIIA 5IXUA 3EYZA 2YKPA 5A0YB 4DFPA 3DI6A 2ASYA 2EFOA 2UVWA 4Y0WA 1IKWA 4B1WB 1JL1A 4ZN3A 4DV4F 4M5DA 1RWOB 1RBRA 4U7CA 3J7YP 2HS0A 2U1AA 2PGCA 1FD2A 3MCNA 3MX5A 3WEEB 3V9UA 1YZ7A 3N9UC 4EUVA 4BRCA 1HR0F 2GFFA 2Q6BA 1HJOA 4CJ5A 1Z2LA 4NYOA 4CW7B 1LAWA 4PG8A 3KHYA 4M5LA 2CQIA 1YAGA 3W8GA 5KQDA 3IG1B 5KFHA 3K5OA 2K06A 2VPZB 1X4EA 4Y2AA 4URGA 4IO9Q 1JCGA 1NGBA 3FDSA 3G25A 4JI5K 3OS2A 3I82A 2MB0B 5FPMA 2C42A 4IG0A 4J5OA 3C94A 2ZUAA 2MQOA 5EDWA 4LFBK 1ZXOA 2JEIA 1WNEA 2HGMA 4MK7A 1XIQA 4FWLA 4TQSA 1LNQA 2MYFA 5BN9A 3A8EA 4BRGA 1S57A 3N79A 1KQFB 4CYUB 3UKRA 1SUQB 2HF4A 1FK9A 4WQ4A 1CEZA 3J81O 3QLHA 2XI2A 2ASJA 4USVA 4WU3A 1CZBA 3LGNA 4LF5K 1FFWB 4OZ1A 4TY8B 3HHKA 1U1QA 4KHQA 4FJLA 2VFSA 3IR6B 4YHHF 2ATCB 3DWLA 3QFPA 4NXNJ 2LDIA 1G15A 5GAEI 1U1LA 3PW7A 4DSIA 5J2MB 3OPKA 5HMYA 2OTJN 1Z26A 5CYMA 4CEQA 3AJ2A 1D09B 3QMQA 2HVEA 3BZQA 4Z4HA 1NBEB 4F36A 1ZYQA 3R3TA 3RJMB 1RAAB 2OCEA 2AF6A 1VQ4S 3TAFA 5CD4A 4F4WA 3P39A 1HNIB 3NCPA 1VQNS 1BA0A 1SZ2A 4GVEA 3WXKA 3SUQA 3M4XA 3BPSP 4WE1A 4C0BA 1IKVB 3PX6A 4Z4EA 3R1HA 2ZH1A 4YY3J 4IH5A 2JRSA 2VC0A 2ZWOA 1X9JA 1D9FA 5IQQA 5HBMA 1BC6A 5E3QA 1HMVB 1PC5A 1UOCA 1QZ5A 3MCOA 3LP3A 4DCOB 4DX8H 2HK3A 2DEJA 4KGVB 4Y00A 5IM0A 4EWTA 4RWWA 3PHTA 3CQYA 1ITPA 3QT5A 1T03B 1VBXA 4ZPWR 5EWFA 4OLBA 4HDHA 3DM2B 2NZCA 1WHXA 1MNEA 1S5JA 1WTFA 3B82A 2OSRA 3HX9A 4NLYA 4WP9A 3F56A 1JLFB 4KHMA 4P71A 4JI8K 3ZETB 1OH7A 4CZLA 1AROP 3NKYA 3NDKA 4E7HA 1HNIA 3CMAS 3CCEN 3M05A 5KFWA 1LOUA 3TX0A 5LL6Z 4A62A 2QFIA 5G0RB 4DL7A 4CGHA 5HROB 2OLWA 2F4VF 3C15B 1SVDA 1XHXA 3FRZA 3R6GB 3MPYA 2J8AA 5KFFA 3VQ5A 2XHBA 3QGGA 1V5IB 3MR6A 3W62A 1E6VA 2YJEA 2RB7A 2LQBA 2BE7D 4UF4A 4LH4A 5JS1A 3CJSA 5EX0A 1UWBB 2O8BA 3MXJA 5KFIA 3KJNB 4CRJA 2DY4A 2AEMA 1K9MT 4AHCA 3Q7CA 1HNXK 4IOCQ 1TTHB 1KOOA 2DTUA 2HS3A 2OFHX 3T19A 4ZPAA 4C3LA 4L73A 5HBMB 4DV7J 5FRNA 1U6ZA 3RSEB 4DPWA 3IAYA 2KT5A 4E89A 3SSRA 1ZBSA 4EBCA 2ZGYA 3OY9A 3FEZA 5D4NA 3PJXA 2K3IA 3UCGA 4WCEL 1TKDA 1EP4A 4YS2A 4KHRA 4KB1A 3MM9B 3Q2TC 2AQ4A 2YNFA 4IG3B 1NM1A 4I9LA 2ZHOA 1DTQA 3VEOA 1WDTA 4KIAA 4LFCK 2IOCA 3IS9A 4PPDA 2UYTA 3IRXB 4ISFA 4JI2F 5JMNA 2P9LA 1NHUA 3M1VB 4Q2LA 2VJUA 4F3QA 4A8WA 5AZIA 3HXMA 1U49A 3MMVA 3TR8A 3T1AA 2VG5B 2GAGC 1NOZA 4YOXA 2QEXS 1F3FA 3CM5A 1TKTB 4LF1A 5KG3A 4CJVA 1O8BA 2R8HA 3CJ7A 3RRKA 2ATLA 2FBXA 1RDDA 1EETB 1CSJA 3DHWC 4JYAJ 2QEXN 3UCUP 1JJCB 2QGFB 1RISA 4B3TJ 1UJ6A 3QATA 3M32B 1SJFA 5KT2A 3MCPA 3RWUA 2KJWA 4FWKA 4JHDA 3TVZA 3ZSXA 3GFYA 1S1XA 3J80Y 3D1OA 3DLLQ 1IBLF 1SB6A 3QIDA 3R5JB 2YHWA 4RW9B 1RYRA 3FBBA 3N0VA 2DKOB 3S6EA 3MTJA 1QSSA 2JFDA 3G82A 3NF9A 2RH3A 2DFFA 4RNMA 4O4GA 3TUPA 3T6JA 2Z2LA 3MFIA 1K73T 4TYBA 1RT3A 2ADBA 2F9TA 5KFKA 3QGPA 1N33J 1IBMF 3GOIA 2P9IB 4C0OC 4I0WA 4CJ4A 2EC2A 3V9WA 1RA7A 1G1XA 2JVOA 2YQ3A 3IP0A 2FC0A 2GV9A 4OGEA 1NJXA 4AILC 2L3MA 2P9NB 2W6LA 3QQCD 5JJBA 1NGGA 3CDAA 2W8LA 4NXMF 3DLGB 5M1PA 3CCZA 3VF6A 4OYMA 5GINA 4LIRA 3MM7B 2Z0GA 3CCLS 3MM5B 1YXQA 4N77A 3O9SA 2KU7A 4J9MA 1X4CA 1X0FA 4N5SA 1QSYA 5D4PA 1HPZA 1WBDA 2A0FB 2OHDA 3V4MA 2HHSA 3O9UA 3RBZA 4CEOA 3ZT0A 3PG9A 1NU0A 1R31A 1U2VB 4JI1J 8AT1B 1CXUA 4U95A 1TR0A 1GMUA 3O9RA 3JAMY 4HUEA 4MYUA 2HHHJ 4WZQA 1T05A 3KJFB 2BZ2A 2YPZA 4JV5F 5EN1A 2XYPB 2DGWA 4DG1B 4P74A 4KHNA 2G0CA 4LC9B 3WIUA 3OHRA 2BRLA 1P8GA 3HSCA 2DXDA 1O5JA 1QAJA 2XLIA 3GIKA 1NWKA 1DKGD 2QC3A 3A8JA 2IVPA 2VCPA 4I1TA 4RPFA 3UN2A 3H46O 2H51B 3L2RA 1UFWA 5EVZA 5J1EB 1HYSA 1Y4ZB 3QBWA 3MDQA 3AVHA 1R27B 4OYXA 2F4FA 2CPHA 1RB0A 3AHPA 3X3UA 1NZ8A 2W8KA 1SQFA 2HKEA 3PO4A 4P2MA 2CQ2A 4NLCA 4DMNA 4EI2A 5HQLA 4M5MA 2UUCK 4E8UA 2ZZTA 3ULEA 3ZSWA 4FXDA 1QLNA 5M1NA 4O44B 3M8SA 3BR9A 4CZEA 4J9UE 2WONA 4DV0K 3HJFA 4BLGA 1ZA1B 1OSCA 4WE1B 2O4GA 1FJGJ 3TAMA 4CJSA 2BGGA 4LBIA 1FT8A 4OKKA 2QA4S 1SC1B 5HRRA 2YKQA 4F4XA 1UJ5A 4USJC 3NOCA 1DLOB 4WFBL 3CQXA 3MEEB 1RADB 3MD3A 4B9VA 4ENOA 1OVQA 3GCXP 1VQON 1Q95G 4PKDB 4FZYA 4CTAB 3VAMA 5IWAJ 1WHVA 2XMWA 2VQEF 1HQUA 4Y2IA 1L3SA 5A8KB 3HP6A 3BF3A 2I6WA 5HMZA 1S76D 2HGLA 2XMMA 4NLWA 4OI2A 3CJKB 5F0XA 4Y2MA 3HOSA 1HQEB 2BJDA 4LRFA 4BGBA 2Y0SD 1TUYA 3OYDA 3HHLD 3TU5A 2XB2D 4I6WA 1S6PA 2V4JB 4O3QA 1HBMB 1S6OA 1S3XA 4CBXA 2F9WA 4ITSA 3SPYA 2V94A 3M32A 1K44A 1VQMS 1GOBA 4BRNA 2X3GA 2DR8A 4ZLLA 3CO0P 4NMXA 3HKZD 1NK5A 3PUFA 4I2QA 1KTQA 3M2UA 3PEJA 5KGXA 2F9DA 5IFMA 3PKMA 1S0MA 4JV2A 4PWDA 2DNZA 4CQ1A 2P9KB 3ZSRA 2ZD1A 2A6OA 2NLWA 3NNCA 4C7QA 2D4WA 2OIHA 4HKQA 1TUWA 4FS2A 1I3AA 1IBMJ 2HVZA 1VC0A 2QYGA 3BGOP 2ZQBA 1GLDG 1U26A 5AQSA 4K4UA 3AAPA 1HBNB 1UFLA 4B9QA 1ZPWX 4ED7A 5B7WA 5I4MA 4QIFA 4WKRA 3TZXA 3UCZP 4IDKA 2NLXA 2MHEA 2OA8A 4O5BA 3WBZA 4NWBA 3UE5A 2Z8QA 2DNGA 3W7BA 4HTUA 4PG7A 2DO4A 2DB1A 3SUNA 2O1PA 4TQRA 2E5JA 3VV2B 4BRKA 3P38A 5T7BA 4CO4A 4V19S 2LECA 5E41A 4O23A 4K41A 4JKHA 5CH7B 2FHJD 3T5HA 2W25A 3HVRA 5AQWA 2P5VA 2ZDPA 4ZJQA 2CPEA 4GV3A 1M90T 4F0MA 1FNMA 2IVYA 4WFAL 3QYYA 2X74A 4DLGA 2CKWA 2VG5A 4DV2F 3IM8A 4CLKA 4F67A 2V7YA 2K8GA 2E2OA 1KTVA 3ZLJA 3Q86A 1HL6A 1ATRA 2ATQA 1KQKA 4ID8A 3CJKA 1FA0A 3HYFA 3TW0A 3P4IA 4JRQA 4C11B 3BGRB 4WQ5C 4J2AA 4CJTA 5KQ8A 3M8YA 3D3BJ 3PYDA 4C3MA 3NXZA 2H48B 5LOQA 2ZE2B 4PKIA 3T5LA 1EIYB 1MU2B 2XHWA 3HLUA 3C16B 1ITGA 1C0FA 1SH2A 3O5BA 2EW9A 4P52A 4DV5F 1IQTA 2ASMA 4YR3A 4O5FA 3S41A 4DUYK 1NUEA 4E7IA 1RHQB 1WD6A 4KY3A 2HNDB 1OH6A 1K73O 1VCTA 4EZ6A 4M3UA 1TK8A 1NJZA 2G4BA 4FNHA 1JLFA 1VC6A 2VODA 4O44A 4IZ9A 5IC4B 3RW6A 4X4VA 2OFGX 1U6BA 4A8OA 5IT9U 4DV2J 1P8ZA 4ED8A 1HD1A 1RABB 4ELUA 1IBLK 2BKNA 1VRTB 2HFVA 3THVA 3TTFA 3EZ5A 3J81U 4QWBA 5RUBA 1JNRB 2H3EB 3QWPA 3EEQA 1HYVA 5J1PA 4ZVPB 2AMCB 1NJYA 4ZLNA 2LLZA 3CDBA 3HM9A 5KRSA 1YKWA 1S77D 2D9PA 4QJVA 2RU3A 5AXKA 4IOCL 1R7IA 2LKZA 4C97A 3CCSN 1NH8A 3UN3A 1HNZF 4H5WA 1TGOA 2OPPB 3KK1A 3GYXB 3K2YA 5A8WB 3CD6N 5D4OA 2AHOB 3D28A 2DGOA 1C0GA 3BY5A 1E6YA 1W0HA 4G1IA 5ETVA 4X65K 4MJKA 1DHMA 3IR5B 5JXSA 2NRTA 1U2VA 3B6OA 3PVXA 4FLVA 3CJ4A 2J7KA 3O5TB 4CH7A 3ZT1A 3FSXA 3HI9A 3WXLA 2RD5C 4M3ZA 4CIGA 4BC3A 2FJAB 1RTIB 4M7YA 1AFIA 4FJMA 2V34A 1YITN 2KHCA 4YOYA 4DUTA 4Q5VA 2QL7B 2VPYB 4CZIA 1A0OB 1XUPO 3IMQJ 3QSIA 1NK7A 1OY9A 5E33A 2HNYB 3T5KA 1R8BA 3VMFB 4LQ3A 3O1WA 3J81j 4DX7A 4M42A 1YRXA 4Z7YA 1S12A 3OYKA 4PXCA 3M3ZA 2CG4A 2HSEB 3WXIA 1DQ9A 1F21A 4IFEA 2UXBK 3KK1B 4ZCLA 2OPSA 4NLTA 4I9QA 3D3CJ 3KLEB 2YWEA 1UVMA 2VU5A 4HEA9 5C2DA 5KFNA 2QWMA 2YNIB 2YWKA 5AQZA 4CFCA 5AQIA 1N32K 1Q53A 3KUHA 1X4DA 5J2MA 2RE1A 1URRA 1VS3A 1SC3B 4DQPA 1BU6O 2IM0A 4CLSA 1KQSR 1R3NA 3U3GA 4RW4B 3NS5A 2CUYA 3SUPA 1NKEA 4QBUA 1SI9A 3R27A 2MQPA 2IYGA 3DJCA 3FMWA 2YNHA 1H38A 3HSGA 1RAJA 2ZITA 2C3YA 4WFNQ 5FRMA 2IBKA 1IKYA 2C2EA 2IA0A 5IT4A 1JL2A 1T0TV 2GAHC 4ANEA 1ZETA 2EVZA 4YQWA 1Q8IA 1UA0A 4CBUA 4IG3A 2DCUB 3G6ES 2O8FA 2VL1A 4OJHA 1LW2B 4TY9A 3AGKA 2D5RA 1WSRA 4RTFD 4DL4A 4KTQA 2G8IA 2MQMA 4OLOA 4USMA 3AVMA 3JTPA 3M7VA 2MJNA 2IYIA 3THXB 4ED1A 4OJ3A 4C6AA 4KHWA 3C6AA 4UOGA 5DRKA 3U3YA 2HZVA 4ZIVA 1S7IA 4YR0A 1S0OA 4Z37A 5A8RB 4C8OA 2HOEA 2FSJA 1Q78A 4JI2K 1FI4A 4LBPA 2UU9F 3TSPA 2PAVA 1X3NA 1ZS6A 5DQHA 3BB5A 3ENWA 5DJBA 1HBOA 2J0SD 3BEXA 2FC8A 4EYIB 1FRJA 5ITHA 1K8AT 2IDOA 3J7YU 4HACA 4FSVA 2A3ZA 1FJCA 2BACA 1P6TA 4LR8A 2HBYB 3CPWM 1OWXA 1E6VB 3CFRA 3G86A 3K9KA 1VFJA 3AQPA 4DR5K 1Y9OA 4MIBA 4AQYJ 4IKFA 3C15A 4K7QA 3GJQB 2RIJA 3OQ2A 3W66A 3ITHB 4DPTA 4NEYA 2YBVA 2A2DA 1SL0A 4PG4A 2HZAA 5A8KA 1UVLA 2C3OA 4NCGB 1YRTA 2CJYB 1VQYA 2J5AA 4N47A 2D69A 2BUNA 3NMAA 4K43A 2WTFA 1R59O 4B1YB 4K42A 2D9OA 4JOUA 2VICA 4HR2A 3TUZC 4CEBA 1U45A 2KRBA 2DJWA 3UE2A 4DOZA 1IN0A 4N8OA 1BHNA 3LWLA 4BC9A 5F8IA 2CPJA 4F2SA 4FWOA 1LWXA 4NXNK 4OHZA 2KXHA 1A5WA 2ZOGA 1RTJB 3D2EA 2QKKA 4L74A 3MN9A 3LW5C 4FJNA 4FOEA 2WVDA 2KI2A 3OL9A 3Q83A 3HP9A 5BN8A 3LH2S 3CMQA 2KT2A 1VSEA 3ZNUA 2QL5B 1OY6A 2BJ9A 1Q5YA 4Q45A 2WBMA 1QZ6A 3RZAA 4FJJA 4RUBA 1IM6A 4WWSA 2E1ZA 4JP8A 2FJEB 2WSCC 4ES1A 3WZ0A 4Z94A 2MLZA 4KH0B 3JB9k 5CR4A 4HCCA 2GUPA 4XPEA 4DV7K 3MMCA 4CLWA 3U02A 2B4OA 4NB4A 3MHYA 4ZTJA 3MTKA 5DZ6A 1U09A 4V19J 3TAMB 3THYA 1KDNA 2AD9A 1F2GA 2W9CB 1K0VA 2ZC4A 3VCDA 3X1LB 1LKZA 4E0DA 1RGVA 2RE2A 5HRSA 4PCQA 1FRXA 2XO7A 5FDLA 4DR1K 3CDEA 3GDQA 3GYGA 4JS4A 5HJYA 4K50A 1N32F 1DQ8A 2IDEA 4UTGA 1YVUA 3AD7C 4RUCA 2QMWA 5K8PA 2HHQA 2VQFK 2VWJA 4JK9A 3MXHP 3KK2A 3MCMA 4WFZA 2GQQA 3MMBA 2RRBA 3CCWA 2MQ8A 1S1VB 2VFUA 4KHPF 5BPNA 3ISNC 3CIMA 2FJXA 1FDBA 3MCAB 3PEHA 1J54A 2HVIA 3G87A 5G4DA 3VQ7A 2JL9A 1N33F 2R9LA 4WPAA 3CF5L 3NY0A 3C6HA 4JLHA 4NASA 3SCIE 1VJQA 3PZPA 3Q8YA 4I7FA 3P31A 1ELOA 1YJRA 4BY9C 1HNWK 1XERA 4NLVA