3DMJA

Crystal structure of hiv-1 v106a and y181c mutant reverse transcriptase in complex with gw564511.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
539
structure length
531
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 142
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dmjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dmjA05
5KFBA 4IH5A 3OYDA 1TKXA 4TN2A 4RW7A 1LWEA 3NF9A 4FJKA 2RDIA 4DTMA 2HNZB 4BDPA 1U47A 2RKIB 1VSLA 5K14B 1XR6A 3M9OB 1NK8A 3CO9A 4B8AB 3ZT1A 3TWHA 1X1PA 1RT7B 4O0IA 3RWUA 2BE2B 1JKHA 2V4RA 3M9NB 1VSJA 2EX3A 5FDLA 3K57A 2AU0A 3H08A 3ZSXA 3HVAA 2FBYA 2IM1A 3C6UB 1RT5B 1ZBUA 5KG1A 4MKBA 2RF2B 3HO1A 3AVBA 2DPIA 2IM0A 1N4LA 2AX0A 4E7HA 4IKAA 3AVHA 1HJRA 3KLGB 2ZQBA 4I2PA 4F3TA 4EO8A 4IG0B 1S48A 3OHAA 3CIZA 1LW2A 3HP9A 3SI8A 4B9MA 4WE1A 1HMVA 3KK2B 3AV9A 4JRQA 1ZBLA 4EBCA 1CXQA 4HUGA 1X9WA 3RB4A 4KKOB 2E6LA 1FKPB 3BQ0A 3UDLA 1BIUA 2XY8A 1SL0A 3LAMA 4RW6B 1JLAA 4DF8A 3KLFA 4NCGA 2GV9A 5I3UB 3O3GA 1CZBA 3KK1B 4CIGA 1T8EA 1NOZA 4DTUA 4DSLA 4DLEA 5J2PB 2FC0A 1LWCA 4IDKB 3KJVA 4ID5B 4DF4A 2ITGA 3DRPA 3RBDA 3RAQA 5KI6A 2FJWA 4B08A 4MK7A 4Z4FA 5F9NA 3TAMA 4JV0A 4RNFA 1JX4A 2HVHA 4KV8B 4CHYA 5KT3A 3CJ2A 4TY8A 5F9LA 5HRRA 1LWFA 1RA7A 2RDJA 4FLWA 1N5YB 1U4BA 4LSNA 2FBXA 4IQXA 3GIJA 4IFYB 4YFUA 5J1EA 1A5XA 3KLHA 5KFTA 3E51A 4GW6A 2JEFA 3BDPA 4B3OA 4G1QA 1SH3A 2D0BA 4HUEA 4F4XA 4MFBA 1TV6B 1YVFA 1REVB 4ZVFA 4E3SA 3BJYA 3SQ0A 1TVRA 3DLEA 3VQ9A 3GIMA 2UVRA 1SUQB 4DSIA 2J6SA 1HNVA 4FLXA 3T19A 2NUBA 3DOKB 4F4YA 4K4ZA 3NGDA 3N6NA 3T5JA 4CF0A 5KFWA 1N6QA 1J54A 4H4OB 4M3ZA 3IRXA 3BQ1A 3HVRA 1I6JA 1SL1A 1FXXA 4ZHRB 2XY7A 1S9GA 4NLVA 1EETB 3RMBA 4CESA 3O4NA 4ZTFA 5J2MB 1JLGA 3AVGA 5HROA 4WFZA 4C8OA 3BSAA 1WSGA 3ITHB 1IKVB 1TAQA 1RT6B 4F2RA 3ZCMA 4H8KA 4E1NA 5L1IA 4ECSA 3K59A 4DS4A 3K5LA 4TXSA 1HQEB 2KW4A 1WSEA 2OPQB 2FLPA 1QAIA 4YR0A 3GIIA 1DLOA 1S1TA 3QNNA 5EU7A 5C24A 1OS5A 1EXQA 3PZPA 4ECUA 1QUVA 2YNFA 2FVSA 4O5BA 2FLNA 2YHAA 2XCAA 3QO9A 3KLEA 1I39A 3K58A 4NLOA 4WXOA 4MH8A 4GC6A 1RYRA 3QIPA 1RNHA 1ZTWA 4DLGA 4FLUA 4O3OA 2E6MA 3U3GA 3SJJA 4O0JA 3VQ8A 2P5OA 5CYMA 2C28A 1R0AA 3I5BA 1A5VA 3OYAA 4AHUA 1BI4B 4IFVB 2O4IA 3BQ2A 2W7PA 1JLFA 4I2QB 4RW4B 3OYNA 1FK9A 4KAIA 4M42A 4DG1A 4W5OA 3CWJA 1QSLA 1K1SA 3Q8QB 4CEEA 3MEEA 1WN7A 1YTAA 4DTOA 1DTQA 2BRLA 1S1WA 4ZP8A 2BQRA 2HB5A 2G8IA 2G8UA 4RNMA 1SH2A 1WAJA 3GIKA 5KFCA 2FJVA 4ECXA 3LWMA 4XPCA 3KHRA 1KLMB 3SYZA 1TGOA 1UAXA 3HVTA 5C25B 5D3GB 1NOYA 5F8JA 4PQUA 4J9QA 4KI6A 1U45A 3Q8SB 3MEDA 3QEPA 1RDDA 4AH9A 1JL2A 1VSMA 3M8PA 4RNHA 4J9PA 2WOMB 4IRKA 4ED6A 3TAGA 1LW0A 1NKCA 3HT3A 3ZSVA 3HJFA 3VQCA 2QKKA 3RRGA 4Y1CA 4LQ9A 3LALA 3LP2B 3BSNA 4CJUA 4QW9A 4HCBA 4RW8B 2YNHB 3K5MA 5KFFA 3MEGB 2J6UA 4EP5A 4DL7A 4ECRA 4FZXC 5HBMA 3M8RA 4DQRA 3HP6A 4Z4HA 3PO5A 3EZ5A 1HPZA 1RT1B 3ALYA 5L9XA 3KKSA 3H2LA 3RAXA 5DQGA 1X9MA 4ELTA 4FJ5A 2WONA 4CF8A 1RT2B 2PYLA 4C8MA 4M45A 4QW8A 4KHNA 4M95A 3JYTB 3HXMA 5KFIA 4K4YA 3VQQA 4DMNA 3QNOA 3UQSA 4ECYA 5T7BA 4TYBA 3E01B 2HNZA 4WZMA 4ECQA 3OL9A 1NK9A 2RKIA 4N5SA 1RT7A 2BE2A 4FJJA 4U7CA 4NZ0A 1D5AA 3VQ7A 4AHRA 2FVRA 3V81B 5KTQA 3L8BA 1SV5B 3AVCA 2VWJA 2RN2A 4NLDA 3OYJA 3EY1A 1T7PA 1IKYB 4O4RA 3O3FA 4AILC 3ULDA 3H4BA 4EO6A 2OZSA 3L2RA 4NLYA 3C6UA 3ISNC 2P51A 4Z4CA 2RF2A 4F4ZA 3TANA 4B9TA 3KK3A 1S6PA 1BCMA 3VQBA 3KLGA 2UVUA 4IG0A 4FZYA 2B4JA 4K4VA 1XWLA 4M3YA 4PY5A 2GUIA 2D7SA 2WHOA 4KHUA 3VQDA 2YKNB 1N56A 3PUFA 1S0NA 2YNIB 5FRNA 4URSA 2X6SA 4FK2A 3KK2A 1LV5A 3KLIB 2R8JA 4YMEA 4OL8A 4B8CA 2XRIA 4ELUA 4KKOA 3OYHA 4K4SA 4FJ7A 1FKPA 4FJ8A 5DK5A 2FVPA 3PX4A 3KD1E 4RW6A 2IBKA 4XPEA 1W9HA 3OLAA 5KT2A 3FQLA 3DI6B 4Y1DA 3SPZA 3SQ4A 4WFYA 5I42B 5I3UA 3DLRA 3V1RA 1UWBB 1D0EA 4CGJA 2C2RA 1T05B 2OH2A 5DQHA 2E9RX 4FM1A 5J2PA 3CM5A 2DY4A 1Z25A 4ID5A 1HRHA 3OYMA 3ZT4A 3CYMA 2VG6B 4CFDA 3HM9A 2D0AA 3HPOA 3OYBA 3Q8RB 4C8LA 2PZSA 3VQ6A 2KFZA 4KV8A 3CG7A 2QXFA 4ZTJA 1NK0A 3MECB 4K4WA 4NRTA 3NF7A 4AHCA 1N5YA 2D3UA 2BR0A 1B9DA 4GC7A 3CVKA 2GC8A 4BDZA 5KFUA 4CK2A 4IFYA 5CYQB 4GVMA 1SL2A 3ZSWA 2C22A 1SH0A 3I5CA 4CIEA 1WAFA 1J53A 1HYZA 2X6NA 1XC9A 3GV5B 1TV6A 3KMQA 5KT7A 1REVA 5KG3A 4CE9A 2BDPA 3MFHA 2FLLA 3DRSB 2X78A 1U48A 1VSIA 2BQUA 5EWGA 4FLZA 2G8KA 1SUQA 2HHWA 4BWJA 4QWBA 3MR5A 2HWHA 3DOKA 3N6LA 3V4IB 5KFGA 2KTQA 3CDEA 2Y1JA 4H4OA 5HRNA 2YNGB 4W5NA 1DTTB 4OGEA 4ZHRA 1EETA 4FXDA 3NGIA 3IS9B 4HYKA 2VWKA 4XIUA 2Y1IA 5CZ1A 5J2MA 5KFZA 4CJLA 1RAJA 2HNDB 4CHPA 3F9KA 4ID1A 3HKWA 3DLGB 2Z1GA 3RB0A 2WTFA 4E0DA 4RNNA 3ITHA 1IKVA 1RT6A 4FJMA 3PW7A 4EZ9A 3VQSA 5KFEA 1RBVA 4CGFA 3OJSA 2QE5A 1HQEA 4RUAA 2OPQA 3DYAB 1BCOA 4BWMA 1NJYA 4CHQA 1RT4B 3AA2A 2ZE2B 4LD0A 1U49A 4YQWA 4E7IA 1NK5A 3DRRA 3S9HA 4EBDA 2HVIA 4FZZA 3OSNA 1IO2A 4URQU 1JLCA 4JUZA 3AO3A 4TQSA 5EWFA 4LH4A 1VSKA 1QS4A 1JLQB 3BGRB 4HVJA 3PW0A 4FS1A 3QEIA 1BI4A 4CHNA 3CJ3A 4I2QA 4RW4A 4N47A 4Y2CA 3NAEA 4CEZA 2XY6A 4PA1A 1JLEB 2VG7A 3V6HA 4H4MB 1SKRA 2HHXA 4O4GA 1JXEA 1EKEA 2HHUA 2IMWP 3V1QA 4J9SA 4B9NA 2HNYA 3SPYA 2HMIB 1LAVA 2G8FA 1BIZA 5JS2A 2GIRA 4M3RA 4CHOA 3C6TB 3OYFA 4F4WA 4FBTA 1KLMA 4FS2A 1KRPA 4KTQA 1RT3B 5C25A 5D3GA 3N6MA 1KSPA 4Q43A 1HYSB 1S1XB 4Z4GA 1ZBFA 5F8LA 5F8MA 1A5WA 2IJFA 5F8NA 1VSFA 3RTVA 2G8VA 3KTQA 1C1BB 1UA1A 3QEVA 3TAPA 4B9VA 1I3AA 2OYQA 4EP4A 3ZT0A 3TQ1A 4Z4EA 4I9LA 3P5JA 1D9FA 5KGWA 4OPKA 5EUHA 3EYZA 3LP2A 1VSEA 3OYGA 4RW8A 2YNHA 3MEGA 2WB4A 4RG8A 4KB7A 3PX6A 4H54A 3OL8A 5KFDA 4FW2A 3NBPB 2XGPA 4KHSA 2OPRB 4F50A 4M3XA 2KZZA 2XY5A 4C8KA 4ED0A 1RT1A 4DSKA 5KG5A 4TQRA 2DFEA 2O5DA 2FVQA 4FJXA 4CFCA 3D45A 3V9UA 3I5AA 3LPUA 4LH5A 3V9SA 2D41A 4CJVA 4DWIA 2IAJB 1RTHB 3ZT2A 3PW2A 2R8GA 3QGIA 5SWMA 4R0EA 1RT2A 2IC3A 3H5XA 3JYTA 3HK2A 1HARA 3WNGA 2ZD1A 4IOBA 4J9KA 2AGPA 3E01A 3GILA 1UOCA 3UPFA 1NHVA 1S0OA 2JEJA 4J2DA 2E4LA 4CHZA 3NHGA 1VSHA 4HHTA 4FJLA 3V81A 1TL1B 1SV5A 2VG5B 3OYKA 4DTPA 3ZSYA 2XC9A 4DU3A 3KKRA 1IKYA 1XI1A 2HHQA 2V0NA 3QLHB 3T5KA 2BGGA 1QQCA 3ZSOA 3SCXA 4QCLA 3FFIB 1B9FA 3SQ1A 4CJPA 4CEOA 3MAQA 3BSOA 4KBIA 4JLHA 1S1UB 3MF5A 4CGDA 1Q9XA 4KFBB 4FM2A 2JEIA 1HNIB 2P1JA 5KRSA 4CEDA 2YKNA 2WCXA 4DTNA 2YNIA 4QWAA 4J9NA 1G15A 1D9DA 3KLIA 2D3ZA 4OLBA 4HUFA 3LZJA 5DG7A 3NH2A 2R8HA 3KIOA 4OVLA 4WYWA 3CM6A 3HHKA 2J6TA 1RDRA 3DI6A 1ASUA 5KFRA 4KHWA 1KCFA 5I42A 3GV7B 1UWBA 3IN5A 4CJWA 3B6PA 1KFDA 2IJNA 4EBEA 1T05A 2Z1IA 3AVNA 1RBUA 4DL6A 3NDKA 4CK1A 3CJ0A 1HQUB 4NRUA 2VG6A 3CFPA 3TVKA 4PUOB 3BSCA 5J2NB 3RB6A 5KT4A 3IG1B 4C8NA 4DTRA 4FW1A 4QPXA 1C0TB 2ATLA 4OLAA 1S9FA 3MECA 1S1VB 5KT5A 3RBEA 2XHBA 4URGA 2W9BB 4M41A 2IOCA 4FK4A 1MU2B 4CJ3A 1QTMA 4NLXA 3AVKA 4KPYA 5CYQA 1VRTB 4ZP7A 3L3VA 1IG9A 2HW3A 4O44B 4E89A 2XWYA 4NCBA 2BANB 3SI6A 3NE6A 3DRSA 5HLFB 3CJ4A 3H98A 3LWLA 4LQ3A 4DL5A 4WFXA 3U6FA 4O3QA 4DQSA 3V4IA 1L5UA 2EHGA 5DGBA 1RTDB 4NLWA 3NFAA 3V1OA 2YNGA 3V6JA 1EX4A 4QWDA 4DEZA 4OKJA 3AA3A 4QAGA 5KG7A 3VN5A 1XR7A 3IS9A 1D8YA 3H4DA 3KHHA 3GV8B 2HNDA 4Q0BB 1EP4B 1KLNA 4ED1A 3O3HA 3AA4A 3PO4A 2I5JB 2PY5A 5EDWA 4IKFA 1BQMB 4FJIA 3DYAA 1RT4A 4J9MA 4CECA 4GMJB 3H5SA 2ZE2A 1VSDA 4MK9A 4DS5A 3WNEA 2XCPA 1TKZB 4NLTA 4CGHA 2YKMB 5K14A 2OPPB 2IM2A 4W5TA 3PY8A 4B3OB 3LP1B 2IDOA 4F2SA 5DG8A 4R5PB 4CJ5A 1X9SA 3WNHA 1JLQA 3BGRA 1WSFA 3DLEB 3S3NA 4EYHB 4HTUA 2JGUA 4IR1A 4CJRA 4WXWA 2DPJA 4I7FB 4DFPA 5F8HA 2VA2A 1RT5A 4EYIB 4ZVHA 3AO5A 5KFXA 3HVWA 1JLEA 5DLGA 5KFNA 4H4MA 3LDSA 5DLFA 2DFFA 4B9UA 2HMIA 1KVCA 1NJZA 1JLGB 3QYYA 4QOZB 3U3YA 3C6TA 4IBNA 4FM0A 1K6YA 1BISA 4FLTA 2P5GA 2Z1HA 4K8XA 4MK8A 5KFHA 1FKOB 1RT3A 4FK0A 5HP1B 4AHVA 2JC0A 3LP0B 4K4XA 3GYNA 4J9RA 1HYSA 4J9LA 4J2AA 1S1XA 3CDWA 3EPIA 3DLHA 1IKXB 1Q9YA 1U04A 3DOLB 1C0UB 3NF6A 3KHGA 3QZ8A 1C1BA 4DTJA 3KK1A 3V6DB 4E7JA 4RU9A 4J2BA 4KHRA 4KO0B 1S6QB 3QERA 4TLRA 3RR7A 4KAZA 3T5HA 4IDKA 4CJSA 2BRKA 4NCAA 5HRSA 4KI4A 4N56A 1KVBA 1YTUA 2QKBA 1CLQA 3BREA 1WNSA 4KHMA 1D1UA 3NBPA 5KFLA 3KD5E 2OPRA 2I1RA 4J2EA 4R8UB 4CGGA 3H40A 3FSIA 4ED2A 4M3TA 1TK0A 4BACA 2W8LA 5DQIA 4FJHA 1ZBIA 2B6AB 1TK5A 4ED7A 4FLVA 1KHVA 3FRZA 4ECWA 4BE1A 2IAJA 1RTHA 3QEWA 3G6VA 3CFOA 1ZETA 3LP3A 2F96A 3AVMA 4M3WA 1Z26A 4E1MA 2B5JB 1NJXA 1N48A 2AJQA 2ETJA 4DQPA 3EPGA 4CIFA 1JL1A 5CZ2A 3I0RB 4F8RA 3DM2B 1ASWA 4AHTA 3H5UA 3TABA 1TL1A 5KFJA 2VG5A 3NAIA 2Q3SA 3OSPA 4ZVEA 3WNFA 2OPSB 4NLPA 1TK8A 4HKQA 3ZSRA 1WLJA 1C6VA 3QLHA 1XHZA 2UVVA 1RBSA 2D0CA 2ATQA 4F3OA 3V9XA 2W9AA 1HYVA 2OZMA 1S1UA 1JIHA 4KFBA 1RTJB 1L3SA 3S3OA 1HNIA 3M8QB 4RW9B 4YR2A 3KLVA 4CJKA 2R2RA 5KFMA 4TYAA 2PYJA 3MXMA 1J5OB 3PW5A 4RNOA 2GIQA 2WRMA 4OJRA 3CDUA 1QE1B 4KB1A 2W9CB 3H59A 2V9WA 5C42B 1RA6A 3DMJB 4Q8FA 2ZKUA 4LSLB 4IFVA 4FJ9A 3NH0A 1RDAA 3C94A 2AX1A 5KFAA 1C2PA 3OHBA 4ZPCA 2YV0X 1HQUA 2C2EA 1S10A 3DLBA 1NNDA 3V9ZA 3SUPA 4WYLA 3OYIA 3L2QA 1S9EB 4JS5A 1NJWA 4PUOA 2GBZA 1JLBB 5J2NA 1CXUA 3AO1A 4CK3A 4DTSA 3HYFA 4KHQA 3IG1A 3I8DA 4ELVA 3OY9A 1C0TA 2O4GA 2BQ3A 3TAFA 4U6PA 1S1VA 3KK3B 2W9BA 1S6PB 1W25A 4K4TA 2IA6A 1NK6A 1MU2A 4Y34A 1ZBHA 4O55A 3OL7A 1W0HA 4YNQA 1CZ9A 3SV3A 1VRTA 4NLQA 4O44A 1GOAA 4FBUA 2WOMA 1VRUB 3KOAA 4FYDA 1LAWA 2BANA 2WK4A 3QGHA 3PW4A 3ICLA 1RTIB 3ASMA 5HLFA 4F4KA 3MR3A 3AVIA 1ITGA 2FBVA 2R2UA 4IH7A 4CJ4A 1MMLA 3SFUA 3MR2A 3IAYA 1QSSA 4M3UA 5KG6A 2DTUA 3NF8A 3D5MA 1KTQA 4CERA 1NKEA 1RTDA 4I9QA 4KE5A 1NHUA 4IR9A 1TKTB 1TL3B 3AA5X 3P83D 3AO4A 5C5JA 4HCCA 3AVLA 1ASVA 3VQEA 4Q0BA 1Q8IA 3PVXA 1EP4A 1C1CB 5CY4A 4CEBA 3SQ2A 3G86A 5L1LA 5J2QB 4FCYA 1NK4A 3L3UA 4N41A 2FBTA 3ZSZA 5KG4A 4IG3B 1BQNB 3NH1A 2I5JA 1XR5A 1BQMA 3Q8PB 2F8SA 3NCIA 3SV4A 4WZQA 4ICLB 4PWDB 3NMAA 2XI3A 5E41A 2F8TA 2JLEA 3VA3A 5SZTA 1TKZA 3ZSQA 3OS1A 1QHTA 4Z4IA 3OS2A 2YKMA 1C1AA 2OPPA 5L1JA 2R7YA 3LP1A 5F8IA 3H5YA 2G8WA 4R5PA 4IRDA 4KSEB 4Y2AA 3HPGA 4CFAA 1S49A 1QSYA 1YT3A 3OYCA 2XGQA 4ZPDA 4E19A 4I7FA 1S0MA 3HL8A 4CJTA 4XO0A 4CJQA 2QK9A 2ASDA 3KNAA 4E7LA 1XHXA 2ILYA 1L3TA 3A2FA 2XI2A 3VQ4A 3RMAA 4NYFA 3B6OA 2R8KA 1U09A 1JXLA 1BHLA 3I0SB 3MXIA 4M94A 4Q8EA 2AGOA 2W42A 3JSMB 4O3SA 4IH6A 3PX0A 1FKOA 3EZUA 2V4QA 1IKWB 5HP1A 3HPHA 3MFIA 2HHSA 3LP0A 3SZ2A 1T03B 3DLKB 3GQCA 3T1AA 1IKXA 4Y3CA 4KHYA 1RILA 4CF2A 4DFMA 1TKXB 1GX6A 3DOLA 1C0UA 1LWEB 4RW7B 3MR6A 1L3UA 2KQ2A 3SUOA 1YVUA 1Y97A 5KG2A 3DRRB 5L1KA 3V6DA 4O3NA 4L8RB 1RYSA 4KO0A 1S6QA 3RR8A 1JLCB 2XO7A 4MIAA 5KG0A 1BGXT 1JKHB 2W8KA 4JV1A 3L2WA 2UVWA 4X2BA 3UR0A 1TAUA 1C0MA 5FDLB 2AQ4A 2KZMA 2HHVA 4DQIA 1TKDA 4DSFA 3SFGA 4R8UA 4QWCA 3OYLA 2AWZA 4KREA 5T14A 2DFHA 1ZYQA 2VG7B 4O4GB 4KB0A 3SUNA 4RZRA 2B6AA 2HNYB 3NKYA 3G10A 4FVMA 1NKBA 4I2PB 3FQKA 3QGGA 1KVAA 1LW2B 5KRTA 3OYEA 1S97A 3K2PA 5JXSA 1O1WA 4J9OA 4WE1B 3AVJA 5JS1A 1HMVB 3LPTA 3OS0A 4IRCA 2B5JA 4KRFA 1T3NA 3OVNA 1WSIA 4ED3A 4G3IA 1J9AA 1IH7A 4MKAA 4ECTA 1JLAB 4NLUA 3NL0A 2HAIA 2VA3A 3I0RA 3KLFB 4NCGB 3M9MB 3DM2A 4CEQA 4ZP9A 1WNEA 3QINA 4Q44A 5KGXA 1JXBA 4NLGA 3NAHA 1DTTA 4ED8A 5DG9A 4DU1A 5JUMA 4YR3A 4KTWA 2JC1A 3L2UA 1LWCB 2UUTA 3SUQA 2OPSA 3KJVB 3RB3A 3NGYA 3DRPB 3RRHA 5KFPA 3DLGA 1UA0A 4N76A 5KFKA 1SKWA 1CSJA 4DL4A 3TAMB 3G6YA 1S4FA 1SKSA 3PJWA 4DSEA 4CCHA 4DU4A 3FDSA 1B92A 3QETA 4CEAA 4TY8B 3IGNA 3OLBA 1RTJA 3PHEA 1LWFB 2R8IA 3CFRA 4FJGA 4NYZA 4UQGA 2ASJA 1WSHA 3M8QA 4RW9A 3PR5B 4Q5VA 2G8HA 5KFQA 2R2TA 3T3FA 3D0PA 1KFSA 1J5OA 4LSNB 2QV6A 3PV8A 5J1EB 3BR9A 4JRPA 3NGZA 3KLHB 3PR4A 5KFYA 2IC3B 4G1QB 1BL3A 5FROA 1QE1A 4K50A 4K4UA 2W9CA 4MFBB 1ZTTA 5C42A 1L3VA 4ECZA 4OKKA 2ZD1B 3DMJA 1TVRB 3DDKA 3TAQA 4LSLA 1KHWA 4NLRA 3AO2A 4OKEA 2OA8A 4CGIA 2LSNA 3C95A 1HNVB 4CFBA 2R2SA 2A1SA 1GOCA 1N6QB 4CJFA 2RPIA 3IRXB 3THVA 3P1GA 1RDBA 1S9GB 1S9EA 4B9LA 2YHBA 4DFKA 2W7OA 3ISND 1JLBA 5KFVA 4MIBA 3T5LA 4O3RA 4RUCA 3QZ7A 5HROB 3LZIA 1GOBA 3PJXA 1RBRA 1NK7A 4ZP6A 3V6KA 1K1QA 2UUWA 3IGVA 3TI0A 3UIQA 1RDCA 3VQAA 3L2VA 2HHTA 5KFOA 4BE2A 1DLOB 3LAKA 1S1TB 2HWIA 4EEYA 2Z1JA 5C24B 4AHSA 3MXJA 4BE0A 5HRPA 4CJEA 1VRUA 1T94A 4BDYA 4QWEA 2YNFB 1S5JA 3MTKA 3O4QA 3QO9B 3KLEB 4LY7A 1RTIA 4DL2A 3QIPB 4E7KA 5KT6A 2JEGA 4Q45A 4FJNA 1F21A 1WSJA 4OPJA 3VQPA 5CYMB 1R0AB 3G0ZA 3VQ5A 4O3PA 1JLFB 5F8GA 1FK9B 1TKTA 4DG1B 2ILZA 1TL3A 2D5RA 5DMRA 3AVAA 3MEEB 4YP3A 4ZPAA 3CJ5A 2E9TA 1DTQB 1S1WB 4DL3A 1RCHA 3M8SA 4TY9A 1C1CA 3SNNA 2C2DA 4EZ6A 4JV2A 5J2QA 4DFJA 4NLSA 2B43A 2E9ZA 4IG3A 1BQNA 2EC0A 3CQ8A 2KFNA 5FRMA 3AVFA 2FJXA 4ICLA 4CF9A 2IM3A 4PWDA 3HVTB 4ZPBA 3ZT3A 3QESA 1GX5A 4PQUB 1TQLA 1TP7A 5EWEA 4TSXA 2F8EX 2ALZA 3TAEA 3MEDB 2A1RA 3KHLA 2X74A 4DTXA 4K8ZA 2CJQA 1VK0A 3M8PB 3OL6A 5DGAA 3RMCA 1LW0B 4ZVGA 3QIOA 4W5RA 3D28A 3TR8A 4Z0UA 4MQ3A 4DQQA 4JS4A 3TARA 3S3MA 2FVCA 4OGCA 1QAJA 3G6XA 3FFIA 3KMSA 4CEFA 3QEXA 1RBTA 5KFSA 5HBMB 4ECVA 4DSJA 4B9SA 2ASLA 4NYNA 2AGQA 2CKWA 4ZMMA 3RMDA 1IM4A 4W5QA 1HPZB 4FLYA 3K5OA 3I0SA 4CF1A 3K5NA 3VA0A 3OJUA 3V9WA 3JSMA 3F73A 3LANA 1IKWA 2WONB 3HSTB 3QIDA 2IS3A 4KTZA 1Z4UA 2IGIA 1T03A 3DLKA
chains in the Genus database with same CATH superfamily
1UW9A 4IH5A 4U67L 4NXNJ 2CPZA 1WORA 3TUPA 3ENBA 1QQMA 1X4BA 1VSLA 3KDNA 2Q6CA 3M9OB 2QYCA 1SCJB 4PXEA 4YN3B 3ZT1A 4XH4A 1X1PA 2BE2B 2VQFK 1JKHA 5AQHA 1P8GA 3CCES 5FDLA 3K57A 3HVAA 1QVFM 5A8RA 4K0KK 4F67A 2ADCA 1HWJA 3FFKB 1RT5B 3AOCA 3CIPA 1UKUA 4MKBA 2RF2B 3D0HE 2DPIA 4BRKA 2NXJA 1SJ4P 4E7HA 1PBAA 3TA2A 2ZQBA 4I2PA 4F3TA 4X65J 4AM6A 2YX7A 3CIZA 4JI1F 3K2YA 1BLUA 3BH7B 3L9ZA 4B9MA 1E6VB 3KK2B 3BF1A 2KN4A 2YPYA 4C8YA 2PSZA 5B0EA 1X9WA 2E6LA 2N3OA 4OYXA 2AEJA 1W97L 3GR0A 4JI4F 3O3GA 4HACB 1CZBA 2ZM6J 1U8SA 2ZJRQ 2F4VK 3ATVA 3JS9A 2KO1A 1ZZNA 1W2BM 4DSLA 5D15A 3B4DA 4QYZJ 4IDKB 4ID5B 1DURA 1N5TA 3O6QA 3Q8VA 4DF4A 5LMUK 3RBDA 1N34J 1IXKA 3EVWA 4B08A 4DX8H 5HVGA 3U27A 5AQZA 3W3DA 1WC3A 2XS2A 2PA8D 3SCIE 2B4OA 1CULA 4KV8B 4KGKA 4CHYA 4DPUA 1HL6A 3EVMA 3K9JA 3UNYA 1TMJA 1BWEA 1RA7A 3NOGA 2OSRA 4DPWA 3L4IA 1U4BA 2RIJA 3L7OA 5J1EA 2VOOA 1S22A 4N77A 2JEFA 4LF8K 1SH3A 2BV3A 4MFBA 4K2JA 1YVFA 1REVB 4ZVFA 4E3SA 1TVRA 3DLEA 3K0JA 1YJTA 2QGFB 2XBPA 4DR2J 1E4GT 4IZ9A 2NUBA 4F4YA 2CAJA 2CPDA 1N6QA 4RX6A 4H4OB 3IRXA 3S8SA 1NRKA 1SL1A 2PFDA 1QQNA 4K43A 4NLVA 3RMBA 2NRRA 3NWGA 4ZTFA 2HEKA 1Z05A 3AVGA 4WFZA 4C8OA 1TAQA 5L1IA 4OYBA 4DS4A 2Q36A 1R8HA 2MSTA 2KW4A 2UXCF 4YR0A 3DU5A 2ABYA 3QNNA 5A0YA 4P7VA 2AJ2A 1W2IA 3KK7A 3ZTRA 1QUVA 4M5NA 2XCAA 3QO9A 3KLEA 1I39A 3O6WA 1U1OA 3GYXB 3VQTA 4O3OA 2E6MA 2JZ5A 4CLPA 2CNOB 1A5VA 3TOQA 3NS5A 2ASPA 3K8VA 4DR7J 1JLFA 1N88A 4RW4B 3BGFA 3D1HA 3QWPA 4W5OA 5A76A 2CPFA 2HRUA 1RABB 1YTAA 4DTOA 1DTQA 2BRLA 1TU0B 4OI1A 1BU6O 2G8IA 4EIAA 2Z57B 4RNMA 3DGPA 3TR5A 4C11B 5KFCA 1NSQA 2EXUA 4ECXA 4XPCA 4CO5A 1I5OB 2HSTA 2ZH9A 2DIUA 4C9DA 2XMVA 1BY9A 1SQFA 5E2QA 1JCEA 5D3GB 3C66A 4LUBA 5DM6Q 1HQ2A 4BR0A 4PQUA 3CD5A 5HJYA 1KC8O 5G4DA 1KNZA 4Y2IA 1VSMA 3ADAC 4RNHA 3HDSA 3MCOA 2KKZA 1LFWA 1NKCA 5F0XA 3VQCA 1XC3A 4Y1CA 3CC2S 1FEEA 2I7NA 3PYEA 3LP2B 3DN9A 3BSNA 1Q81T 4RW8B 2XQCA 2GW8A 1DBDA 4RR5A 1HLUA 1WC1A 3EGZA 2CJXB 4BC9A 3CQXA 1U1NA 2P9IA 5AZIB 2CA9A 2R7SA 3M8RA 1WF2A 2AJ1A 1F5CA 3EDQB 4CD3A 4Z4HA 2F3JA 3PO5A 1HPZA 1TFWA 4GNIA 2V34A 5L9XA 2YX1A 4WJBA 3GYGA 3H2LA 3KKSA 2E44A 4QZVB 3SBGA 3TVZA 1RT2B 3BV8A 3CJAA 2LEPA 3OBYA 1KVJA 4KHNA 4M95A 5GAHU 4OX9J 4K7QA 5KFIA 1YJRA 3VHQA 3VQQA 3UQSA 5T7BA 3OL9A 2RKIA 5E3RA 2A1BA 4ITSA 1FHTA 4FJJA 2IYGA 1VQYA 3OFFA 2B56A 3BUZB 3JXUA 1FRMA 2RN2A 4RTFD 3OYJA 1T7PA 2V67A 3EY1A 3D6HB 5AQUA 1F9HA 3RAMA 3UWTA 3H4BA 3DRYA 2OZSA 3ZZTA 2FHKA 2QWQA 4KHPK 2YJFA 2Z2LA 4IWVA 5DZ7A 3OVBA 2JVOA 5AXLA 3E9OA 2JWNA 2KL8A 3QT8A 3VQBA 4DV4F 1M1KO 2G2YA 3KLGA 1RLDA 1FJCA 4K4VA 2GUIA 3HHLB 1N56A 3PUFA 3PNIA 3N4QA 2JL9A 2R8JA 2APOA 2RE1A 3ENHA 1N36F 4KKOA 4FJ7A 1FKPA 1NJIO 4FJ8A 1ZM9A 2FVPA 3KD1E 2A18A 3L09A 4XPEA 2IBKA 3OLAA 3MURP 1V3RA 5LSRA 4JK8A 3F44A 5I42B 3DLRA 2C2RA 2V2VA 1T05B 2E9RX 3I56N 1R8CA 1IBCB 1LOUA 3DKDA 1Z25A 1HRHA 3HBTA 2QTWA 2M7SA 2D0AA 3CJKA 3HPOA 3OYBA 2MGZB 2V8DA 2GX9A 3H2VE 1WC5A 4WTYA 1WHWA 3H45C 1F5BA 4UZCA 2QXFA 2AKWB 4ZTJA 2R3VA 3JAMO 4NRTA 4O23A 1C4AA 1U2CA 2OEKA 2P9NA 3MMVA 4AHCA 1XNQF 2F1FA 2BR0A 3DJCA 4DX6A 3NEKA 3SMZA 5ETTA 2P9SA 1S0VA 2K3KA 4IFYA 3IFEA 1HNXF 1LFPA 2C22A 2WVEA 2HVZA 4CIEA 3G82B 2ZH5A 1XC9A 1TV6A 3KMQA 2DD8S 2JJ4D 2BDPA 1YBAA 2X78A 5C0YA 3FCHA 2G8KA 1SUQA 4DU8A 4BWJA 4YHHJ 1Y4ZB 3GJSB 3N6LA 1JJ4A 2KTQA 2Y1JA 4W5NA 3W5YA 4ZHRA 3NGIA 3IS9B 5KPZA 3M6XA 3FMBA 3D1QA 3R2DJ 1WOSA 3TA1A 4CLSA 4CHPA 2HNDB 1Z1ZA 1Q82T 3CCLS 4JKAA 4E0DA 4B3TF 3ITHA 1IKVA 1KD1T 1RT6A 2CVIA 3PW7A 1WTBA 4AUKA 2E1PA 2RE2A 4B3RK 3NY0A 2QE5A 2ZJPQ 3CGIA 3LW5C 2OPQA 5BRFA 1NJYA 2W2QP 3ZTSA 4V19X 1UMJA 3CCQN 2UUCF 2IVNA 1KQKA 2OD4A 4YQWA 1ITPA 3S9HA 4O0NA 4U7UK 2DNNA 1ESVA 1KS2A 3KNGA 5MAOA 4HWIA 4CNYA 1FA0A 4JUZA 3AO3A 5EWFA 4IJAA 1GK8A 3D6MB 1QS4A 1JLQB 4NMXA 2F8MA 2BJDA 3ZNUA 4HVJA 3PW0A 5KPRA 2FY1A 3SBTA 1BI4A 1YJNN 4CHNA 4I2QA 5GADU 3J81j 1I94K 4DJBA 2P9LB 3QNWB 1F60B 2F4VF 1UPMB 1JLEB 4C48A 3TRGA 5BYSA 4CH7A 1EAYC 4DV1F 2HMIB 3IFRA 2UU9J 2Y8YA 2DB1A 4JI3J 1IBKK 1OKJA 4B3SJ 1EKRA 3C6TB 2VPYB 2YXLA 3OYFA 1YQHA 1N32K 1X4AA 1KLMA 4KTQA 4C3LA 3VERA 3N6MA 4K8RA 1NSKL 5BR8J 2W7AA 4K5SA 5F8MA 2HF4A 2KRRA 2IJFA 5F8NA 5AQWA 4LF7J 2QI2A 5JMVA 3BO2A 5A2QO 4YY3K 4I0WA 1C1BB 3J80Y 2BKOA 3IWXA 2DCLA 1I3AA 2OYQA 4KYZA 2WW8A 3NGTA 1A6LA 2CQ0A 1TTHB 1R3NA 1MSWD 2C42A 4CBXA 3L95X 4AXJA 1R27B 2FB0A 4YDXA 3JB9k 3PX6A 2HS0A 4L73A 3C16B 2XGPA 2GVZB 2HBJA 4M3XA 2EEYA 4DV5K 2MZQA 3T1YJ 2HVEA 2R7QA 4LIRA 1K47A 2FVQA 3C2PA 4FJXA 4CFCA 3PIPQ 4NOHA 2W1BA 2VICA 4DWIA 2HK3A 3PW2A 5AXMA 3HRGA 5F0WA 2IC3A 4GKJJ 2L48A 1SQEA 1HX1A 3D2EA 4J37A 1HARA 3WNGA 4I6MB 1XMQJ 2ZVIA 4ZLPA 4OHWA 2AGPA 3AA9A 3GILA 1SI9A 2ACYA 1S0OA 4RPFA 2E4LA 1BXNA 5G0RA 2QSWA 1P8ZA 2A40A 1TL1B 1SV5A 2O1PA 1IBMJ 3OYKA 4DTPA 2I8EA 3J7A1 1OSDA 3O5TB 1DQ9A 3ENAA 1LEOA 4LF5F 5M1OA 2ZH3A 1PJ7A 2B9WA 3M3ZA 3QLHB 6AT1B 2BGGA 2QMXA 2J4RA 2Z2MA 2JH3A 1NGCA 4CEOA 5D0HA 3F9MA 4FOIA 3BSOA 2V8HA 3E9PA 3FCVA 2KYXA 6FDRA 2LKZA 1PJ6A 3QFUA 4QR0A 1HNIB 4CEDA 2YKNA 1U6FA 3D7SB 2YNIA 1KBRA 4F7VA 4QWAA 4J9NA 2Z8QA 5AFUH 2D3ZA 4WCEQ 3PCOB 4HUFA 3LZJA 3FZFA 4JI7F 5D0RA 3NH2A 2E7XA 4FVUA 4ZITA 5AQMA 4WYWA 2QWLA 3HHKA 1RDRA 1ASUA 2MYFA 3CJRA 2MZ1A 4E1JA 2DHXA 4DMZA 1UWBA 1KFDA 2HFVA 4A62A 1RBUA 2DPNA 1LCUA 3W2WA 1TZ0A 1Y11A 4M8LA 1CQNA 3NDKA 2YWEA 3QSYB 4NRUA 4ATNA 4RL1A 1QAYA 1XJWB 2VG6A 4O8UA 4IOXA 3CEDA 4A46A 3GG4A 3V4MA 4PG6A 5J2NB 3GE9A 5KT4A 2BUNA 3HSDA 4C8NA 3CMAS 3G4SN 2AZ3A 3IM8A 1S9FA 3O9QA 1KWMA 4G6VB 3DOMB 1MU2B 4JI2F 1QTMA 1RCXB 2QRRA 5CYQA 2N7YA 1IG9A 2HW3A 3TVYA 2XWYA 3D9BA 5JJBA 3HJVA 2EFPA 3NE6A 5HSPA 2DGTA 2V2KA 1NB2A 2OANA 2MSSA 3GCWP 3ZZPA 2AV5A 4PPDA 1HA1A 3LTOA 3H98A 4WFXA 3V4IA 4LFCK 3ZX2A 1RI7A 2IA0A 1HBMA 4PKDB 1XR7A 1WI6A 2QT7A 1P1TA 5TKYA 1GXUA 3D1OA 4JKGB 3O3HA 2ZDPA 1LXJA 3M2VA 1OVQA 3VGUA 1HLWA 1BQMB 3SCJE 2O8DB 3QB0A 1WB9A 5GMDA 3CPWR 4MK9A 3PJ9A 3CMES 4WFNL 1KONA 5K14A 2UYTA 4W5TA 5HMYA 4UOFA 4B3OB 2M9KA 2WVBA 4CJ5A 4G1PA 1HNZK 3MM8B 2VF3A 1HW9A 4H5NA 2LXFA 1WSFA 4I1TA 4DBQA 3S3NA 5LJ5Y 4G9ZA 2ACMA 2CQHA 1K44A 3MWBA 3HHNB 3QMLA 3B54A 2PDAA 2ZBIA 3DGVA 2PMZD 4WQ5C 4DV6F 2HIYA 1HBUB 1NJZA 1KVCA 3QYYA 1ULRA 3W60A 3GOIA 1Y9OA 4WIQA 2Z1HA 4MKVA 5KFHA 1FKOB 2F40A 5ETLA 4OHYA 3LP0B 4K4XA 2FQQB 1HYSA 3VALA 3P4UB 3IP0A 4J2AA 3EPIA 3DLHA 1VQ7S 1Q9YA 4MLHA 3DOLB 4FWQA 4UUWA 3KHGA 3TJAA 3QZ8A 4DTJA 4C23A 1K8KA 1RU1A 4E7JA 4DR1K 1UVMA 5AZJB 5FJ4A 4KHRA 4KO0B 4C8ZA 2CDQA 2B9EA 4KAZA 1MA9B 2DXEA 1XMOK 4NCAA 2NYHA 4BRPA 3EX7B 2QKBA 2B7BB 3HMJG 3ZZOA 3VESA 4KHMA 2VB6A 1NGAA 4GVEA 9RUBA 3NBPA 3GU0A 1E3MA 3FBEA 4J2EA 4L6V3 1H38A 3OTCA 1BHNA 1ACMB 5EY4A 2MZSA 5GMEA 2VONA 4H4KA 1WTFA 2PE8A 1WEXA 5A6WA 4CH1A 3FRZA 4ECWA 4BR5A 4BE1A 4ZIVA 3RJMB 1Q1KA 2E1ZA 2A0FB 2VBYA 2K1RA 4JB8B 3HI0A 1RB0A 4CLWA 1ZETA 3MM6A 4LRCA 2B3TB 2IVPA 4A5AA 1C4CA 3R5AA 3EPGA 4BRDA 4JI1J 4K5RA 2W2MP 2MTLA 4DV3K 2XSJB 2C3OA 3TABA 3NAIA 2MPUA 4OZJA 3WNFA 2MKJA 2OPSB 3TNVA 1TK8A 4R0JA 4RBTA 1C6VA 4EGLA 5M1KA 3NGUA 1RBSA 5E33A 4C0OC 4JI4J 2ATQA 5B0FA 3WXKA 5ADZA 2WB1D 1CQMA 5CA5A 3G71N 4OX8A 3AJDA 4I6WA 3MAAA 2VPWB 1SQGA 4KFBA 1RTJB 4ILLA 4ZVOB 5E0OA 3ILJA 4OQJA 1A9NB 1NUEA 1J5OB 2EFGA 4X64F 5IFMA 4FPRA 4CVNE 2XLJA 4KR0B 5GAGI 4OJRA 2X1AA 1TUWA 3DMJB 2RHKA 3E3XA 2QG9B 4WK3A 4IFVA 4ANEA 3I87A 1UTAA 3C94A 2W6LA 5DETA 3WUHA 2C2MB 1WC4A 3DLBA 1NNDA 2KU7A 1RISA 2YH0A 4JS5A 2J9DA 3L7UA 3C3LA 3DXMB 3G6EN 1YJWS 3HYFA 1CJTB 3R27A 4KHQA 3IG1A 5IZHA 1BUPA 1C0TA 3TEHB 1WACA 2O4GA 1KVIA 4U7BA 1S1VA 2W9BA 1S6PB 4K4TA 3R3LA 2C3PA 5E3CA 3QBXA 4DX5A 3C6HA 5GADP 1T9UA 3OL7A 4YNQA 3SAGA 1VRTA 2XMJA 2PAVA 4O44A 2AJ0A 3HULA 3KOAA 4GMKA 3PW4A 4FPBA 2R7TA 4FXVA 3ICLA 2NQPA 1RTIB 1ITGA 1FE4A 4IH7A 4BR4A 1K9MO 4CJ4A 2L41A 5H9FJ 1MMLA 5JMNA 3FLCO 2GMHA 4BS2A 2DTUA 3KG4A 1NKEA 2LA4A 2DHSA 3LDPA 4KE5A 1KAZA 4WU2A 3P83D 1AUDA 5C5JA 2XMWA 4KH1B 4HCCA 3AVLA 1ASVA 1Q8IA 2V6AA 4DCHA 3PVXA 2JNJA 3QATA 4OJ1A 1FNMA 3SQ2A 4PG7A 5E7OB 1NK4A 3ZSZA 4IG3B 2W2NP 3JXOA 4UOGA 1XR5A 3TZYA 3Q8PB 1YJ9N 2VQEF 2DR9A 3WT0A 3UFCX 1IBLJ 3MR7A 1SKUB 1YJUA 4CO0A 1VBXA 3VA3A 1TKZA 3OR2B 1EWQA 4BRCA 2J9EA 3OS1A 4Z4IA 4MAKA 2OPPA 5ITHA 4KGMA 2R7YA 3LP1A 2G8WA 4K41A 4IRDA 2MKKA 3UDCA 1BWVA 4CFAA 1QVGR 1QSYA 2NYIA 3PG9A 3NXZA 2ZJRL 1Y5LB 1Y64A 3IRWP 4OLPA 4C0BA 2W4CA 4E19A 4XH5A 5CCLA 2KHCA 2N3LA 2ASDA 1WUUA 2NRZA 1RAGB 2E66A 2D3O1 2JLFA 5T41A 2G0CA 3WQUA 4NXNK 1URNA 5AQYA 1WG4A 2ILYA 5F2RA 1SIWB 3QMQA 1U09A 3ET6B 4BRNA 1BHLA 4ENOA 2DNOA 3T1HK 4YOYA 3PX0A 1OY6A 3CCJN 2V4QA 3CCWA 2YPZA 5HP1A 3HPHA 5DS7A 1PCAA 3CC4N 3SZ2A 1T9WA 1N5VA 3U1MA 2DGVA 2V8VA 1Q8LA 4OZ5A 3T1AA 2EC2A 1RILA 4CF2A 1GX6A 3MR6A 2VFSA 1YJ7A 2DH9A 1DAXA 1QUPA 1A0OB 5D0EA 1S6QA 2XO7A 4MIAA 1BGXT 3WXLA 2KXHA 4B1YB 1JKHB 2W8KA 3ZETA 3BBFA 3Q8YA 4EHTA 3B8HA 4X2BA 3UR0A 5FDLB 4EUVA 5E84A 3I33A 1F2HA 3MWTA 1K73T 5A8RB 2HHVA 4DQIA 1NU0A 3G25A 4DL0C 1FVQA 2J0QD 4LFCF 2G0IA 3J8AA 3OYLA 1ZYQA 2MMYA 4KB0A 3W9JA 2B6AA 2HNYB 3NKYA 3G10A 4FVMA 2CGJA 1WEYA 4JI5F 4I2PB 1R0BG 4NZ7A 3Q2SC 2ZM6K 2NRXA 1Y00A 2KLAA 5JXSA 2R4FA 3M8ZA 5BN8A 2O8FA 3LPTA 2PMHA 2NSCA 4IRCA 2B5JA 4DPTA 4DV4J 1T3NA 1OO0B 1WSIA 4ED3A 1IH7A 1T3OA 4MKAA 2R7WA 3NL0A 3E66A 3I0RA 3GSIA 3M9MB 4CEQA 4ZP9A 2G2OA 3HFZB 3SXLA 4XDDA 3GJTB 3NAHA 4C2MA 4ED8A 1N36J 4CZKA 3SUQA 1JXVA 2RQCA 1HNZF 2HK2A 4CZMA 1WF1A 3DLGA 2QLJB 2LQ9A 4I64A 5KFKA 4DU7A 2K2PA 1SKWA 4DL4A 3G6YA 1S4FA 4HT7A 4DOZA 2ZH4A 2BOPA 5HMWA 3PJWA 1CULB 3J7ZO 2J8SA 4DHVA 2R8IA 3ULEA 1MWKA 3C19A 1GLDG 3ZX3A 2UXDJ 2XZDB 4QU6A 2W4DA 5BR9A 1HIYA 5KFQA 1KFSA 1YRXA 1NPRA 5DM6L 3A8YA 5J1EB 3BR9A 1WC6A 1RKIA 2KHDA 3UD5A 1T9XA 4K50A 4Y2MA 4K4UA 3SDEB 4OHZA 2W9CA 4MFBB 1ZTTA 5HJXA 4OKKA 2QLBB 2HGLA 1TVRB 2W01A 2KM8B 3MDQA 4OKEA 2PEBA 1GLCG 2LSNA 3CJ1A 3R7BB 1HNXJ 3CJ9A 2F7VA 4DUYF 1VK8A 1N6QB 1JJ2R 2RPIA 1ILYA 3IRXB 1B7YB 2G0JA 2M5YA 5EVZA 3K9KA 3OXGA 3VOVA 4B9LA 2W7OA 3Q86A 3OFHA 4MIBA 3T5LA 4RUCA 1J5EF 2YQ1A 3PJXA 5IS2A 2DNKA 1NK7A 3V6KA 1VQNS 3IGVA 3OTOK 1RDCA 2JVRA 3VQAA 5HO4A 1YIJN 3ONQA 3GL1A 5A0YB 3LA0A 3D67A 2OJ3A 2WVDA 3FGVA 4QOTA 1VRUA 2UUAF 4BDYA 4UOHA 5L9NA 3D6FB 4P72A 3MTKA 2Y1LB 4M5IA 3QO9B 3KLEB 3TP2A 1O13A 3I55N 2JEGA 4FJNA 1RZMA 3VQPA 1H2VZ 3EXCX 3UE5A 1JLFB 1TKTA 2ILZA 4DV3F 2QYGA 3JAMY 2QFJA 3AD9C 1XN9A 3CJ5A 1DTQB 4DL3A 4H5VA 1UZDA 4JV2A 5J2QA 3LGHA 4DCPB 4RWWA 2E9ZA 4PRFA 1BQNA 1WKLA 3NGRA 1VQOS 3DGPB 3CI5A 4ANDA 3AVFA 2F4VJ 4ICLA 2WVFA 3PDNA 3LPYA 4ZPBA 3QESA 5M1NA 4PQUB 4DV1J 5LMUJ 2CWKA 2OLWA 2MQMA 2A1RA 3M05A 4KGVB 4WFBQ 4A8SA 3OL6A 1HUXA 3KFWX 3QIOA 4W5RA 4QS8A 1CVJA 2VOPA 3TR8A 1H0HB 1IN0A 1RWOB 3R3TA 4Y65A 4MQ3A 4OGCA 2SXLA 4LT6A 2XLIA 3CCVS 4P52A 2YCHA 1ZM3A 1QAJA 2LVWA 3R5DA 3FFIA 3KMSA 4CEFA 2P9IB 4E8UA 1RWVB 4ECVA 4RKUC 1G6BA 4DSJA 3EICA 3I9V9 4NO7A 1IM4A 1HPZB 2IHR1 4H5WA 3K5OA 1HKBA 4ZDNA 3K5NA 1IM6A 1RHKB 3JSMA 3MX2A 4U96A 1N52B 4YEAA 1V4SA 3HSTB 1I3OB 1VQMS 4JKBA 3K17A 3FEYB 2HFNA 1DFDA 4DSKA 3DLKA 5KFBA 3QICA 1TKXA 1NXIA 4TN2A 4RW7A 1LWEA 3NF9A 4FJKA 4FF1A 5IT9U 4DTMA 3VEVA 2RKIB 2CQIA 1NK8A 1TELA 2MQLA 2I6WA 4N8OA 3RWUA 4JHDA 2V4RA 2CGLA 3UVJA 3P5BP 3U9DA 4KGZB 3POTA 4C3MA 4B1VA 2AU0A 3OBWA 3ZSXA 1QM9A 3CQYA 2FBYA 4QR2A 4LRFA 3BGLA 1LOTB 4HH0A 2H5IB 4B17A 1MWMA 4CBWA 3A5NC 3QJPA 3AVBA 2P9PA 1N4LA 2N4DA 4ED5A 3AVHA 1HJRA 1Q8BA 3J81Y 2BVZA 3KLGB 3KZBA 4HH1A 3RZAA 3MMBA 1S48A 1Y5IB 2CQGA 5A2QY 1LW2A 5LJVA 1TUYA 4OV1A 4IQMA 1VQ4S 3AV9A 4JRQA 1ZBLA 2PGCA 3MM9A 1NGIA 4HUGA 4AE5A 4KKOB 1FKPB 3UDLA 1BIUA 3MM5A 3LAMA 4DF8A 2B8QA 2F9JA 2OO4A 3KK1B 2E7WA 4OJHA 1NOZA 1VJWA 3UDEA 3NCRA 3KJVA 4ZVTB 2DRDA 3D2FA 5KI6A 4DV0F 2FJWA 2AZ1A 3CJKB 2F9TA 1BE4A 2CZ4A 4WQ5A 1VMBA 1JX4A 1Q82O 5KT3A 1YSJA 4DHYA 4PCQA 4FLWA 2P9NB 4YHHK 3TJ8A 1H7WA 2P9SB 2FBXA 4IFYB 1YKWA 1FE0A 1A5XA 2CVEA 5KFTA 2VBXA 3T1HF 4GW6A 3HHEA 3P39A 4F4XA 1W7AA 1FJ7A 1TV6B 4PXBA 1HHSA 3BJYA 1Q4RA 2E5LK 5U47A 3VQ9A 2MEWA 2UVRA 3QWUA 1SUQB 4LF9K 1Q7LB 2Y8WA 1WG5A 4UF4A 3RBXA 2J6SA 2ZFHA 4IO9Q 4LF6K 4K4ZA 3NGDA 4CF0A 1W2BR 3AT1B 4TNOA 4NEYA 5KFWA 4UY8O 1DQ8A 3BQ1A 2F63A 1I6JA 4FF2A 4ZHRB 1S9GA 2J0WA 2Y0SD 4BG9A 2A6OA 2KVQE 1H3DA 2QIFA 3ITHB 1IKVB 1RT6B 3A13A 2KHOA 3PIPL 4ECSA 3LOUA 3K59A 4TXSA 3MD1A 3CCEN 1OSCA 2OPQB 4WYBA 2FLPA 2GELA 1S1TA 3R5GA 4NLBA 3CTRA 4CW7B 1UWAA 1Y3JA 3PM9A 2V68A 2FVSA 4KHPJ 2OEMA 3W62A 2FLNA 4GC6A 1RYRA 3EZWA 2OI2A 2UU9K 4QPTA 4L3KA 4KPCA 2GEMA 2P5OA 4B3SK 3OYAA 1X5SA 4FO0A 2J7KA 4AHUA 1BI4B 1JB0C 3BQ2A 2W7PA 2EG1A 2AJ4A 4I2QB 4KAIA 5JVGQ 1QSLA 2ZH7A 3MEEA 4CEEA 4CZHA 4GVBB 4ZP8A 1X31C 4H0TB 2BQRA 2HB5A 4C97A 3H42A 2V5HG 2QW9A 1NO8A 2N4CA 3WIUA 1ATRA 3ZXWA 4KJIA 5HMZA 3MPUB 1KLMB 3SYZA 4LVNP 3HVTA 4AM7A 2EFQA 4A59A 1CBKA 4KI6A 4WCEL 3Q8SB 3MEDA 3CPWM 3MOJB 4IOAQ 4AH9A 2HQDA 3RW6A 1JL2A 1MG7A 3M8PA 1B7FA 4J9PA 2WOMB 3BZKA 1S7HA 1WI8A 1LW0A 5ETRA 2O8BA 3T1YK 3ZSVA 3HJFA 1HBNA 3RRGA 2X1FA 1SXLA 4KIAA 4CJUA 3DDNA 1AZSA 2DEIA 4LMZA 3SEOA 1NZAA 3EE8A 2HG4A 4ECRA 5HBMA 4OI0A 2ZBPA 5IC6B 4L74A 3EZ5A 4FNIA 5LSOA 1YRUA 2VHGA 3AB4B 2QM1A 5HL7Q 4LR7A 4A8WA 1EARA 2WONA 1RXOB 3PFEA 5GAGU 2PMWA 3D2EB 3OTOF 3HXMA 1NMEB 1WELA 2K3IA 4K4YA 4BG8A 3HKZD 3QNOA 4ECYA 1GAOA 1X5PA 1U8WA 5K8NA 1VQLN 4WZMA 2LQ5A 4ZVSB 4N5SA 2BJ1A 5G0RB 2NLXA 2NCKL 3QFWA 3L8BA 4AHRA 1SV5B 3AVCA 2ZH6A 2MLZA 4E98A 1JMTA 4BVOA 1RAEB 2GX8A 2FHJA 2RT3A 3O3FA 3GWCA 4AILC 1SB6A 3KXDA 4CLTA 3C6UA 3M32A 2P51A 1BA0A 3HT0A 3O3LA 4HLBA 4F4ZA 3HZEA 4B9TA 3KK3A 4IG0A 4FZYA 3MXHP 3GONA 4M3YA 1XWLA 3IWLA 3C14A 3VQDA 2YKNB 5HVHA 1S0NA 2YNIB 3VAJA 2X6SA 1LV5A 2A6AA 2DGUA 3R5CA 4YMEA 4F02A 4K4SA 1RADB 3MMAA 1W9HA 2C2NA 5KT2A 2E88A 5DDOC 3SQ4A 4WFYA 1EZZB 1PYSB 4X64J 3W3SA 2KT3A 1UWBB 1NGFA 2OH2A 4FM1A 4FYYB 1N32J 3CM5A 3W2WB 1TMMA 3GJQB 2CWXA 1O5JA 3H6EA 3CYMA 2VG6B 2NUUG 5JLFA 5A8WB 3FZMA 3AODA 3SBMA 1FX4A 4DZDA 4R79A 4C8LA 2KFZA 4X4NA 4YY3J 2JFKA 4YDDB 4ZJQA 3CG7A 2JRSA 2CH5A 4OI4A 1NK0A 4CLUA 3M7VA 3CC2N 1F2GA 4PYAA 1WBDA 3B78A 2GC8A 4BDZA 5E3PA 3G2XA 1SBRA 4FPAA 5CYQB 1SL2A 4M63A 1JCFA 3OV7A 4M5MA 4QIFA 5K8MA 3TTDA 1ZBTA 4IEEA 3GV5B 3WEEB 1U02A 1VIOA 2FLLA 3IXQA 2BQUA 4FLZA 1MWQA 3Q8UA 2HHWA 4C1NK 4JNEA 3V4IB 5KFGA 2YHXA 3BBBA 3UO0A 4TVAB 4JKDA 3R6MA 3TX0A 1HBMB 1HPMA 2VFUA 4FXDA 5DZ6A 3HOTA 1CJVA 3H1VX 4XIUA 4OZ3A 5CZ1A 5J2MA 5KFZA 4CJLA 3L4QA 4A8OA 3THTA 3F9KA 4ID1A 3HKWA 2M70A 5AJ3F 1AUSL 4FJMA 4CZJA 4EZ9A 3M2VB 2WFBA 5KFEA 2HHHK 3N4PA 1RBVA 4B3MF 4CGFA 1WJ9A 1M5OC 3QAUA 1EKSA 2I2YA 5KOWA 4CHQA 1EWRA 3NS6A 1NGDA 4XAKA 3WBZA 2YWKA 4BRGA 4DKWA 1U49A 4E7IA 4EBDA 2NRWA 4FZZA 1NH7A 3D68A 3X3UA 1SC4B 4M1KA 1Q78A 4P71A 4TQSA 3HOSA 4MYUA 3OA9A 3HZGA 5HATA 3BEGB 3TPQA 5AQIA 1VISA 4FL9A 1RWKB 1GMVA 3CJ3A 4Y2KA 3AAWB 3TA0A 4NZ6A 3PFOA 4KH5A 4B1XB 1G99A 3M5RA 3NAEA 1R43A 4CEZA 2XY6A 3VGKA 4PA1A 1P9YA 1SKRA 1NPKA 2RH3A 1JXEA 4U9RA 4DPYA 2IMWP 4GVLA 4J9SA 1GQEA 1LAVA 2AYGA 2UUBF 1EQ0A 4FWLA 3SLCA 5ADXA 2HFZA 4O8KA 4F36A 4F4WA 3AH6A 4FS2A 2GS8A 3TU5A 2HQGA 1HYSB 1OWXA 1OYDA 4CO2A 3CC7S 4Z4GA 2OMOA 1WHYA 3RSEA 3RTVA 2VH7A 4FF4A 3V2UC 3QEVA 1K8KB 3TAPA 5GMKa 2DGOA 1P27B 2I0XA 4U95A 3CDAA 4Z4EA 1D9FA 3P5JA 5KGWA 5EUHA 2H48B 3EYZA 2FHJD 1QVGM 2G2ZA 2V51B 1UFLA 2YNHA 5GIPA 1X7VA 2D9PA 3NBPB 4LF6F 4KHSA 4BC5A 2B8PA 2D0PA 4F50A 2XY5A 4RCHA 2Z30B 1RHUB 5BYRA 4TQRA 2O5DA 3H1QA 3D45A 3V9UA 4LH5A 1DRZA 1VHFA 2Y3YA 4YOWA 3ZT2A 4U8YA 4K25A 4LFCJ 2V94A 4WKYA 2K1RB 5SWMA 4DV7K 2J8AA 1EHWA 4QIEA 2Q1LA 1Q86T 3MM6B 3JYTA 3HK2A 3G8SA 4QU7A 4GV6A 4J9KA 1VBKA 3MMCB 4Z7CA 4JI6F 1N0UA 3E01A 1UOCA 4J91A 4JI4K 3CCLN 1ZM2A 4ANCA 4J2DA 4FJLA 4GV3A 5IT4A 2NXNA 3VTIA 3KG1A 3DHWC 3ZSYA 4DU3A 2GMLA 5IT9O 1IKYA 8AT1B 2DRBA 4RLEA 1UFKA 3K5PA 5M1QA 1U6ZA 3T5KA 1NLVA 1FDDA 3ZSOA 3SCXA 1MMDA 5KQDA 2QA4S 2P9UA 3PYGA 3SQ1A 2FXUA 4LFAF 1M5KC 3MF5A 4CGDA 3MPVA 3MAAB 1HNZJ 1YVNA 4OI6A 1Q9XA 4KFBB 2N82B 2UV8G 2ZNYA 1OIAA 4AFFA 2R7XA 5KRSA 3PYFA 2CQ3A 3TQEA 1X4GA 4DX7A 4LF2A 1RAAB 1BO5O 1D9DA 3ATUA 4WPAA 1UJ6A 1ZAXA 2O3DA 1KOOA 4EWTA 3KUGA 4OVLA 3DI6A 3AXMA 5KFRA 4KHWA 5EGYA 3IN5A 1NBWA 3D4JA 5AXNA 2IJNA 4DL6A 1X9JA 4ISGA 5HN0A 5LJ3Y 4MIWA 1WEZA 5L39A 3Q23A 2A42A 3TVKA 3IAS9 4FYXB 4IO8A 5E3QA 1ZAVA 3RB6A 4DUYJ 4XDCA 4JKHA 4OZLA 3IG1B 4FW1A 4QPXA 1C0TB 2ZWPA 4OLAA 3BN4A 3MECA 2YWGA 2D4WA 2UXCK 1U24A 1S76D 1S1VB 4URGA 2W9BB 5H9FK 3MDFA 5C2FA 2MB0B 3ULHA 2YBVA 3AVKA 1FRHA 1GXTA 1VRTB 3L3VA 1X4EA 3EGVA 2IVYA 3O80A 4O44B 1J5EJ 2RUGA 2VBZA 3WQTA 1FESA 2LEAA 2VC1A 3FGUA 3KJFB 2BABA 2KFYA 3CJTA 2P9EA 3P38A 5LL6Z 4LBPA 3CJ4A 3F5TA 1UJ4A 2EVZA 4O3QA 4DQSA 1L5UA 5DGBA 4Y0WA 1ZA1B 4Y00A 4NLWA 2ZJQQ 2X3DA 2DITA 2YNGA 2ASYA 4QWDA 4OKJA 3AA3A 1ZBSA 4QAGA 1RJJA 1JJ2M 3G8TA 2EFVA 2P9KA 1D8YA 3K89A 3OHRA 2RAQA 1YZ6A 2RD5C 3KWMA 3CW2C 3OUYA 3A0IX 3CIMA 3QBCA 3AA4A 3SAFA 1M5PC 2PY5A 2HRTA 5EDWA 4DV3J 3EGWB 1EB0A 4FJIA 4NWBA 3DYAA 1HNWK 4CECA 2ZE2A 1VSDA 3WNEA 3C7NA 3AJ1A 3BPSP 5C10A 2DKOB 1TKZB 2HZAA 4B9QA 2IM2A 2OPPB 4M5DA 4DI6A 3U02A 3LP1B 1S59A 5DG8A 2Q1NA 4JV5F 2CPJA 5AQPA 4ETZA 2Q6BA 3QBWA 2JGUA 1T6CA 1GLJO 1H7XA 4WXWA 5AT1B 2MLYA 4ZPVR 1RT5A 3AO5A 5KFXA 5DLGA 4H4MA 2RRAA 1SS6A 1FNOA 2MQOA 3LDSA 5DLFA 1WG1A 3VTHA 1JLGB 5K20B 5LXRA 2BW2A 3CCMS 4LBIA 1Z6RA 4BGBA 4JI0K 4IBNA 1RE1B 1BISA 4OO1J 4X62F 2CJKA 4FLTA 4K8XA 1PYTA 4CT9A 2DCUB 5BXIA 1RT3A 1UJ5A 5HP1B 4X4RA 1UVJA 3EKUA 2GTDA 2GJ2A 1UPPA 3BKFA 3GSDA 2DO0A 3Q7BA 2QO3A 1ZH5A 3CD0A 4WKRA 3CMAN 4J2BA 2OTLS 1S6QB 1AA1B 3N5FA 4TLRA 3RR7A 4IDKA 1QQOA 3ZETB 4CJSA 2RSQA 3MAHA 4N56A 3ZTOA 1KVBA 2PC6A 1D1UA 1OPIA 5A6PA 3KD5E 2OPRA 4KT0C 2KJVA 1V9OA 4IDHA 3VR1A 3VZIA 4CGGA 4BACA 2KXNB 2HVDA 4FJHA 3DRXA 1ZBIA 2B6AB 5BJRA 1OH5A 1WHXA 4FLVA 3R9LA 1KHVA 1FFWB 2J9CA 1BQXA 2JFDA 2IAJA 4C3KA 1U26A 4NYPA 1N36K 3UW1A 2JWKA 1SC1B 3LP3A 2O8FB 2RRBA 2HHHF 3W64A 3P49B 2VYPA 5CZVA 4JN4A 3J80U 2B5JB 3QDKA 4Y6IA 2AJQA 4DQPA 4LFBF 1GMWA 3ZZZA 3I0RB 5IT0A 5FLXU 3QQCD 2VKZG 5CZXA 2EK1A 2VG5A 4FNHA 2ZBRA 3OSPA 4X4UA 5I3PA 3RVCA 3W9HA 4NLPA 4YOXA 4JYAK 2Z0GA 3CMEN 2UVVA 4CYUA 3GFYA 3MCAB 1HBOA 5B0AA 3Q24A 2ZC4A 4USMA 3MUVP 2AW0A 3QT5A 4X4PA 3IKMA 3Q83A 1BG3A 2W9AA 1PAUB 2OZMA 1XNQK 1JIHA 3QFHA 1RDUA 2L9WA 3ULEB 3S3OA 1AW0A 1HNXK 3KLVA 4YR2A 2R2RA 5KFMA 2FJBB 1IJEB 4TYAA 3MPDA 1RACB 1VCTA 4L75A 4M5JA 5B09A 2W9CB 2V9WA 1WUAA 2GZOA 4WFBL 4DR3F 3O5BA 1F0XA 1B0PA 3T1HJ 1O0PA 3H8YA 3OHBA 1KEKA 1HQUA 1YK9A 3SUPA 1VQ7N 2FLOA 3L2QA 2MQ8A 2KT2A 4B3TK 3HSZA 4CO4A 5BPNA 4L72B 5KPTA 3AO1A 2YTCA 5LMNK 3OY9A 3ETMA 5CD4A 2NS1B 4ZLJA 2IA6A 1NK6A 2UUCK 4BRLA 4ZVQB 2DTJA 2BW7A 3WXJA 2YKQA 2R7VA 1EQMA 1YBTA 1GOAA 1VRUB 2FZKB 1JWWA 4HDHA 3QGHA 5FIIA 4DV7F 3Q0AA 3AVIA 3WX4A 2OCEA 3TZXA 2O01C 4CDIA 2WBMA 3MR2A 3IAYA 1NSPA 2V8GA 5KG6A 3NF8A 3T69A 1RTDA 5RUBA 3W9IA 4I9QA 4MLEA 1NHUA 1TKTB 4OJGA 3MD3A 3AA5X 3AO4A 4DV1K 1OPZA 3I9ZA 4LRDA 3H2UB 4OYPA 5CY4A 2C3YA 2HZCA 4LR9A 3KWIA 5J2QB 1R0CB 4FCYA 4N41A 1T9YA 1BQNB 2MY8A 1KC8T 2H54B 2DHAA 3SV4A 4WZQA 4ICLB 1HKGA 3TUIC 3E1YA 3NMAA 2XI3A 4W92B 3FZ2A 2HGNA 5SZTA 2FUG9 3OPKA 5T7LA 4F3QA 4CLLA 2YKMA 1C1AA 4DB3A 3HI9A 2ZUAA 1KOHA 4PXDA 2MZRA 2R7OA 1S49A 2WZ1A 2PI4A 3OYCA 2XGQA 1FFSB 1UP1A 4ID8A 1FXRA 4OI3A 1N54B 5B0GA 4XO0A 5FPEA 5C2DA 4WIIA 1T6DA 4C98A 3DAWA 3DFEA 5LY3A 2ZGZA 1L3TA 3RMAA 3B6OA 5H9EK 4JOUA 4H4KC 3OXLA 3JSMB 4QYRA 4IH6A 1NAQA 3EZUA 3P3DA 3OW2R 3MFIA 1SQKA 2DH7A 1DZ5A 5ELZA 3M2UA 3TWZA 3QGPA 1E6YA 3DLKB 3D7EO 4LF4K 5LM7E 4DFMA 1TKXB 1N34F 4RW7B 1LWEB 1RKJA 2FC9A 2KQ2A 2LQ8A 1GMWD 1YJWN 3DRRB 3W63A 2DRAA 2KG0A 3V6DA 3RR8A 3MPYA 1JLCB 3PIOQ 5DM7Q 4JHDB 4IO9L 2RU9A 4JV1A 5IV4A 3OTOJ 4LF5K 3UVJB 1WF0A 3FZLA 2CZVC 3POTB 1F3FA 2NRTA 1C0MA 3MOZA 1JCGA 2AT1B 1H98A 2CFXA 4NL5A 3MPWA 5AQVA 1TKDA 4DSFA 1RCOB 4QWCA 2AWZA 1KKHA 4NI2A 2PA3A 2VG7B 2FJAB 4O4GB 2P9PB 2A41A 3SUNA 4OLOA 2KVIA 1YF5L 3MN7A 2MY7A 1NKBA 2NZ4A 3MMBB 3QGGA 1LNQA 2XMTA 2RU3A 4DR2F 1LW2B 4QBUA 1NJIT 3UN2A 3CXCM 4JI7K 4FDFA 3MM9B 2Q31A 4KRFA 3OVNA 1FXDA 2UXBK 3M6WA 1S79A 4G3IA 2QTDA 2MQQA 3MM5B 1HNWF 1RAFB 2ZZNA 2E2NA 3CD6S 5J1NA 3VZHA 4Q44A 3O9UA 5KGXA 2I7PA 4NLGA 5AR0A 5JUMA 4YR3A 2XMKA 2DNPA 2VPZB 2BYCA 3KJVB 3RB3A 3NGYA 3RRHA 4XK8C 3D2FB 2Y1RI 3SMSA 2WUSA 2GHWA 3ENVA 1CSJA 3G96A 3N9UC 5HQ8A 3KYLA 4ZPTR 4LJMA 4LF1A 4CEAA 1TYQA 4JI2K 4M7YA 4IOCQ 3CFRA 2D1CA 1WSHA 3M8QA 4RW9A 3PR5B 1PJ5A 3D0PA 3JQMA 4DR7F 3PV8A 3DXBA 4RWXA 4JI0F 3PR4A 2LCWA 2FJEB 5DO2A 5FROA 4IOAL 1IWGA 1ZAWA 1YZ7A 3A3OB 5C42A 5HQMA 4ECZA 1Z2ZA 2ZD1B 3DDKA 4H0PA 1KHWA 4ZLNA 5D4OA 4CI6A 3AO2A 4X66F 2XM3A 4J8FA 4CT8A 4F3MA 3M6GA 1YUWA 5FPNA 1GOCA 1U2FA 3CCUN 3J7AN 1S9GB 2F8HA 4OV6A 5AQNA 4DFKA 4NE9C 4A4JA 5KFVA 4I67A 1VC6A 4NXMK 4BC2A 1IJJA 1K1QA 2UUWA 4PL7A 4A8FA 5HL7L 3UIQA 2HBMA 2GVDA 5I3QA 3L2VA 2HHTA 5CH7B 5KAKA 1QDUB 5KFOA 4FVCA 4U8VA 1S1TB 4IYQA 2IVOA 2EKYA 2HWIA 1BC6A 4AHSA 4BE0A 1SC3B 3MXJA 2YY3A 5AJ3J 4ZCIA 4CJEA 4NMLA 3G6ES 5M2PA 3GG0A 2XWXA 4D3GA 1U1LA 4ISEA 4DL2A 3MGJA 4E7KA 5MLCQ 2M3DA 2OGUA 3AQPA 4QIWD 3CPEA 1F21A 2BH1A 3ENOA 4OPJA 5A8KA 2QLWA 1JNRB 2DGSA 2IRXA 5F8GA 1NG9A 3MTJA 2A6MA 1YJVA 4DV6K 1VQ6S 1HWUA 4EHUA 3SSRA 3MEEB 4ZPAA 2V7ZA 4OX9F 1X3MA 1RCHA 4CZIA 2C2DA 2JSXA 2E1CA 4JYAF 3RBZA 2EC0A 2KFNA 5FRMA 2WSCC 3CCSN 4CF9A 2IM3A 3UKUA 4ES3A 4PWDA 3HVTB 2E2OA 3BZQA 2G4BA 4GY2B 5K8OA 4PL8A 1GX5A 4UW2A 1D8ZA 5EWEA 1EIYB 2F8EX 4PABA 4DV2K 4AQYF 3MEDB 3R9PA 3TAEA 2ZITA 3FE1A 2X74A 1FRLA 4DTXA 2DNZA 1VK0A 1D4XA 3M8PB 2XO6A 3VAGA 4V19S 3DC2A 3L7PA 1LW0B 1YJ9S 2O8BB 1APSA 1IR2A 2CQ4A 2CQPA 1IR0A 1HBNB 4JP8A 4Z0UA 1ATNA 5BPMA 2VBWA 1K8AT 5EXWA 4DQQA 4JS4A 3S3MA 1AZSB 4I6YA 5D0GA 4ZN3A 2AYBA 1ROFA 4BY9C 3B4MA 5LSLA 3QEXA 2FF6A 3TSPA 5KFSA 5HBMB 1VQ8S 3HZ6A 1KAYA 4NYNA 2C2OB 3RMDA 2E5LJ 3UR3C 4LF9J 4CBUA 4JI8F 2OKQA 4LF6J 2OTJS 1IKWA 5LMNF 2WONB 2IS3A 4KTZA 2QMUB 4CP5A 3D66A 2HFUA 1FVSA 4FWOA 1FD2A 3ILLA 2NXUA 1XR6A 3ZTPA 3CO9A 3THYA 3TYTA 1FD8A 1VQNN 4B8AB 4X4SA 3TWHA 2FY8A 4O0IA 2AYEA 1B3TA 3BGOP 1FT8A 4ZJOA 4NEZA 1VSJA 3MUTP 2ITMA 4HTLA 2HHPA 2HBKA 3W8GA 4UT4A 3H08A 3DDIA 4JI6J 2XMAA 4OX7A 3C6UB 1B64A 3MM7A 3M32B 3R2CJ 3ZEUA 1MROA 1ZBUA 1Q7YT 3HO1A 5CR4A 2BUPA 4KH0B 3O1WA 4IKAA 3VMFB 3LDNA 5HMXA 2CGKA 2E2QA 4IG0B 4CO3A 2P5VA 3LF0A 4X64K 1R7IA 2FGOA 1FERA 3SI8A 1Q79A 4LFAJ 4MKYA 3N4WA 1HMVA 1RHRB 4EBCA 3NMUA 3BGUA 3BQ0A 4XEIA 3J81O 1SL0A 2XY8A 3MMAB 1JLAA 4MYTA 3KLFA 4NCGA 2AJFE 1RGVA 2GV9A 1WC0A 2MKIA 4CIGA 1T8EA 4A48A 4DTUA 4DLEA 2FC0A 2V50A 3H3NO 3C0BA 2ITGA 3RAQA 2YKOA 3AHPA 1REGX 2B7CB 2EG2A 4MK7A 1XK8A 3R8YA 1VQSA 1W7WA 2EBEA 5F9NA 2V52B 4JV0A 3RYLA 4RNFA 3CJ2A 1LWFA 1NM2A 2RDJA 3FK4A 4G1IA 1Q16B 2DR7A 2ZHOA 3AXKA 2QL5B 4IQXA 3GIJA 2M0GB 4YFUA 3E51A 5H1SQ 4B3OA 4G1QA 2D0BA 2BX6A 2J9DE 1VQ9S 3TTCA 1H73A 5IT9Y 1EO1A 3BS9A 3BDEA 4LF4F 4JI3F 4DSIA 1HNVA 3T19A 3N6NA 1Y3KA 1J54A 1UW4A 3W7BA 5TKWA 4PHTX 4X84A 1FXXA 4CESA 1GLEG 1DJ0A 3U4LA 4CTAA 1CJVB 5BR8F 3O4NA 1U1QA 5J2MB 3GTYX 1N8RO 4WP9A 5HROA 4LF7F 2P6TA 3BSAA 3RU0A 1WSGA 4NLCA 1WBBA 3WX8A 4H8KA 4E1NA 1KN6A 1NMDA 2VQEK 3K5LA 1NDPA 1WSEA 1U7LA 4B02A 1H2TZ 2ZWOA 2ATCB 5EU7A 1G3OA 4DN0A 1EXQA 1F3VA 4BC7A 4RBUA 3PZPA 4ECUA 1MLAA 3O44A 3F0NA 4X4TA 1HKCA 4O5BA 1S77D 2YHAA 2BM0A 3UCZP 3K58A 4NLOA 4WXOA 3QIPA 3CULA 4FLUA 2BA9A 3GR1A 3SJJA 4O0JA 3PKMA 4P2SA 1N33F 1HD1A 2UXBF 2J7WA 1YIJS 4JD2A 5D78A 3T6BA 2O4IA 1PO6A 4QIVA 5CQGA 4M42A 4DG1A 1FDBA 1VQ4N 1VYAA 2WBNA 4GKJF 4JV5J 1K1SA 3Q8QB 3GB0A 2YJEA 4YB1P 1S1WA 5AXKA 2CQBA 3I55S 4BVPA 1RAHB 1XMQF 5F1XA 2Q43A 3SJHA 3O8MA 2YQ3A 1SH2A 3GIKA 2LU1A 2FJVA 3IR7B 3LWMA 3KHRA 4U7UD 2XNQA 3L4BC 3QJLA 1U45A 2RUSA 3QEPA 3O9TA 3ZTQA 5J1PA 4DUZF 3DXSX 4X62J 4IRKA 4ED6A 3FSXA 1V3SA 4AL6A 4ES1A 3CCZA 2D69A 3VGTA 2H65B 3M1VA 4MDBA 1WOOA 4LQ9A 4LC9B 4QW9A 4HCBA 2YNHB 2YWWA 1D3WA 3VAIA 3W66A 4EP5A 4DL7A 1FEHA 3L0QA 4Y0FA 4NX9A 3OXFA 4DQRA 2HYIB 2WSEC 4JI5K 1M1HA 3JTOA 4ZVPB 3NG8A 4WP3A 4JK9A 5DQGA 3GFHA 2HLUA 5M1FA 2W4PA 2CG8A 1JJHA 4NXMF 5AQSA 2PYLA 3MN5A 1VI7A 3UD3P 3VVTA 2DR6A 2PT0A 4M45A 2Z2YB 3JYTB 2D74B 1S5ZA 3MUMP 3E01B 2HNZA 2LA6A 4ECQA 1NK9A 2XNRA 3UN5A 4K2XA 2E1YA 4B1WB 3R97A 1RT7A 2WBRA 3QAEA 2B9YA 2HHHJ 2Q66A 1D5AA 2FVRA 4Z37A 2VWJA 3KKFA 4L76A 2ZJQL 1YI2N 4DXLA 1IKYB 4O4RA 4LFBJ 3ULDA 4YB7A 5DJBA 1CC7A 2HAFA 3L2RA 3JS6A 4NLYA 3H7HB 5HANA 3ISNC 3GIRA 4MO4A 4RU2A 1HJOA 1H74A 1T44A 4Z4CA 1E4FT 2AIRB 1S6PA 4YORA 4USVA 2UVUA 4CLZA 2HS3A 2GIFA 1PC4A 4P2MA 2WHOA 3NGSA 4PEOA 5FRNA 4P2XA 4ZA1A 4OL8A 3P31A 4FSVA 1FTCA 2IVMA 4RW6A 2HS4A 1U1RA 1MW7A 1FI4A 4N7TA 2O8CA 3FQLA 3DI6B 3SPZA 4DUYK 4DV2F 5I3UA 3VAKA 2POKA 3A8KA 2EPIA 3V1RA 2PI5A 3SCKE 4CGJA 2K8GA 5J2PA 2Z56B 2RMLA 2X51A 1R6VA 3ZT4A 3CCRS 1PYOB 3TO8A 4PAAA 3BM7A 1J5EK 4P6QA 3VAMA 1Q95G 2PZSA 2AA4A 3GPAA 1AYEA 3PEHA 1UVIA 1NSAA 4PPZA 3MECB 3EDRB 3UN3A 1DHMA 4FPIA 1N5YA 2D3UA 1Y5NB 1B9DA 4GC7A 3CVKA 2UUAK 3OVAA 4OZNA 3ZSWA 2MKYA 3I5CA 3BP8A 1ZPWX 1WAFA 3VAFA 1J53A 1M90O 4RUBA 2E1AA 1K9MT 2X6NA 1A7GE 5KT7A 5KG3A 1RBAA 1QY7A 1F1BB 3MFHA 1U48A 2Q0UA 1UEVA 1VSIA 5EWGA 2XZTB 5GAEI 1SC6A 3AQOA 4H0XB 1OVYA 2VFRA 4CZEA 1YXQA 3DOKA 4PR6A 4M5LA 3D54A 1YX2A 3PHTA 2RVJA 3M6UA 5HK4A 2FC8A 2YNGB 1DTTB 4OGEA 5AQKA 1NB7A 4DV7J 1EETA 3DLJA 2NZTA 1TL5A 3RRKA 2Y1IA 2VZ9A 1RAJA 2Z1GA 2WTFA 4FOEA 2IBOA 1B0VA 4RNNA 2ERRA 2H5EA 3OUYB 2BJ8A 1I51B 1NLKL 4MT1A 3OJSA 1HQEA 1BMQB 3ZC4A 4RUAA 4P73A 3DYAB 4BWMA 2CPEA 5DRKA 2R7UA 3AA2A 2ZE2B 4LD0A 5AQTA 3C7NB 2DO4A 1VC0A 3CUNA 4NPOA 2AYMA 2HVIA 1TR0A 3OSNA 1IO2A 5IWAK 4M5DB 2V4JA 3JQJA 2J0XA 4FS1A 3UB5A 3NS7B 4N47A 4DZ6A 1QHAA 1LXNA 3RW7A 4H4MB 2HHUA 1OH8A 2K7JA 2IDLA 4B9NA 2HNYA 1FJGK 4W98A 2M8DB 2C2KB 2GIRA 4M3RA 2YHYA 2HSEB 1P9QC 2QWRA 2HWTA 4FBTA 2PN6A 1RT3B 2GV1A 3FBFA 1Q18A 1VBZA 5BRDA 5C25A 1OQ6A 2X1GA 1KSPA 2F65A 2H3EB 5SUHA 2B4VA 5F8LA 4AF1A 1A5WA 3ZZ0A 2BEFA 1EX8A 2HQCA 3IM9A 1UA1A 2GO8A 4P75A 3ZT0A 4OPKA 2UXCJ 1VOMA 3R6LB 1FKAF 3R5BA 3TSQA 2NZCA 5DDPC 1VSEA 2VU5A 3IUCA 1NNEA 3MEGA 2LLZA 4M5KA 4KB7A 2H4YB 2YX6A 4FW2A 2PEHA 3ZO7A 2OPRB 2DXFA 2KZZA 2M4MA 1CS4A 5ETSA 1RT1A 2XYPB 2DFEA 4DR5K 3UCUP 3Q2TC 3LPUA 1DGKN 2VDHA 2IAJB 1RSCA 4WP8A 2R8GA 3L6QA 3SDEA 4A2BA 1ZZFA 2VJVA 2KG1A 1UAWA 3OW2M 4F26A 1VQKN 2ASOA 5JVHQ 2G9OA 2YX4A 3DNCA 1NEEA 1HI0P 2BJ3A 2V7YA 4BCAA 1VSHA 4HHTA 2CXEA 1JJCB 1U1MA 2VJUA 1UEKA 4QS9A 3V81A 1S12A 2VG5B 1GMUA 4ALZA 1CJUA 1XNRF 2HQ3A 2QXLA 2XC9A 1T3VA 4DV0K 3PXGa 3AGRA 1HNWJ 1XI1A 4DR6K 2V0NA 3E2EA 1QQCA 3CO0P 3J7ZT 4CYUB 1VQLS 1HBOB 4FZVA 1FCAA 4QCLA 1EJ7L 4USHA 1RHJB 3U8XA 2FYXA 3MAQA 4JLHA 2DR8A 4FM2A 3VF2A 3AOAA 4RJVA 3R1LA 2HZVA 3GE1A 2R9LA 1RDWX 2QEXS 3W2VA 3WDOA 4M63C 3KLIA 4BQLA 3GMGA 5D4PA 4C0HA 1SVDA 1H6KX 3KIOA 4I6AA 1NGEA 3QT6A 4EFAC 1G4CA 3Q22A 1FRKA 2KT5A 4JI0J 3B6PA 2XSFA 4CK1A 1HQUB 2IRYA 2ASMA 3CC7N 3QPIA 1IBLF 1QD1A 3FBBA 2BMBA 3AB2B 3BSCA 4X66J 1V4TA 5ETQA 1FWPA 3SSQA 4CI0B 3ILOA 1C0GA 1PG5B 2B4PA 5KT5A 2XHBA 3MCNA 1ATSA 2IOCA 2FZCB 1HKAA 4CJ3A 4KPYA 4Y28C 4ZP7A 4YB6A 4E89A 1T02A 1XQSC 1PSDA 1R8BA 1VRQC 4NCBA 2C1EB 3SI6A 2ZKTA 3DRSA 5BREA 4USWA 3J7YP 3PIOL 5DM7L 2FHMA 4OZ0A 3W1YC 4LQ3A 1SJRA 3DHXA 4FF3A 1RTDB 3NFAA 1BWFO 3V1OA 1EX4A 3F56A 4H0YB 5KG7A 4NA1A 2WC9A 3H4DA 3KHHA 3GV8B 3HD1A 2R7RA 1CJKA 3EJMA 3MMJA 5FPMA 1G7CB 4CWBA 3PEJA 3CMQA 5CD4H 3PO4A 4ES2A 4IKFA 3QJJA 3IBWA 2E8AA 1VQ5N 1YITS 1RT4A 1XEZA 4J9MA 2VDIA 3H5SA 1KQGB 3N0VA 2NSBA 1HWKA 4DS5A 1XTZA 2LYVA 4A5BA 3QFPA 2YI1A 3F41A 5B8HA 4JYAJ 4CGHA 2QA4N 5T7LB 2YKMB 2FTRA 2LQBA 3CF5Q 1X9SA 1KQSR 2PFFB 3WNHA 5EX3A 1SJ3P 3BGRA 1KAXA 3DLEB 1XNQJ 3VWSA 4EYHB 3T7ZA 3AOBA 1X0PA 1IVZA 4AQYJ 2H1YA 2DPJA 5AQXA 3TX8A 2U2FA 1S72S 3LDOA 4DFPA 5F8HA 3R1XA 3DU6A 4PZVA 2CQDA 3HVWA 5C7PA 4HL9A 2DFFA 4B9UA 2E20A 3JTNA 4QOZB 1OY8A 2OELA 4FM0A 4IOCL 2P5GA 3D3BJ 4FK0A 1T95A 2ZGYA 2JC0A 1X4CA 3A3NB 3GYNA 3M2UB 4CQ1A 2GCFA 1E6YB 4ZN1A 1S1XA 3CDWA 4EFHA 3OR1A 1U0HA 1U04A 3IBFB 2EK6A 3A12A 2LU2A 1CPZA 3NF6A 4B3TJ 4JI8J 3KK1A 3V6DB 3UE2A 4RU9A 5LMNJ 2XHWA 1ZOTA 3QERA 5B08A 4IFEA 3T5HA 4KC5A 2BRKA 3FJ2A 5HRSA 5FPDA 4KI4A 3DCAA 2UUCJ 1X5TA 2UXDF