3DMJA

Crystal structure of hiv-1 v106a and y181c mutant reverse transcriptase in complex with gw564511.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 142
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dmjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dmjA05
4IDKA 4M45A 1FKOA 4CJPA 1HJRA 1R0AB 3H5SA 2HNZA 1BQNB 1C0UA 3UR0A 3AVBA 2IS3A 3KHHA 2WHOA 1VSEA 2OYQA 5KFXA 2P5OA 4AHTA 1TK8A 3LANA 4WYLA 2HNDA 3DOLB 4CJWA 4N56A 1LW2A 4DFMA 4NRUA 2O4GA 4MK9A 1Y97A 1R0AA 4O44B 1XWLA 1BQNA 4TXSA 1KTQA 2P1JA 2JLEA 4Z4CA 2Z1JA 4DWIA 3JYTB 3QESA 3VQAA 3DI6B 4ZTJA 3ZSXA 2EX3A 4FJ5A 1S0MA 2B6AB 3DOLA 4CGIA 3RRHA 1B92A 4BDZA 2UVWA 4CIGA 3OY9A 4C8OA 4FLVA 4O44A 1BCOA 3JYTA 5K14B 4RZRA 3DI6A 2D3UA 4MQ3A 3QEXA 3MF5A 3KLHB 1UOCA 3H5UA 2AGOA 2ASDA 2B6AA 2V0NA 1A5WA 4FJXA 3CFRA 4ZPAA 1J54A 1CXQA 1TKTB 1A5XA 4FBUA 3PZPA 4WE1B 4Q0BA 1RTJB 3QZ7A 4URQU 4TYAA 1CZBA 4E7KA 5K14A 4ELVA 4K4XA 4NLUA 3KLHA 4G1QB 4H54A 3HP9A 3VQ4A 2XHBA 1SV5B 3SPYA 4NYNA 4LH5A 1T94A 5HLFB 3HSTB 3KK2B 1O1WA 4WE1A 2DFFA 4AH9A 3PJWA 1NJWA 4W5RA 4JUZA 4DQQA 3KK3B 4G1QA 3HO1A 4DSEA 1SV5A 4AILC 2BGGA 4Z4FA 4OLAA 1VSFA 5HLFA 3KK2A 3HT3A 3MFHA 3V6JA 3PHEA 4LH4A 4WFZA 3ZT0A 5F8NA 3KK3A 1ZBLA 3UIQA 2D41A 2FJVA 1NOZA 3AO2A 4KO0B 4ZHRB 3U3YA 3OL9A 3IGNA 3QNNA 4NLOA 1GX5A 4ID5B 5FRMA 3HYFA 2Z1IA 3Q8PB 3OLBA 3LZIA 5CZ2A 4FXDA 3GV7B 3I8DA 3IN5A 1Q9YA 4CJEA 4KO0A 4ZHRA 3DLBA 3TAEA 3ISNC 4ID5A 4ZPBA 4HUEA 3ZSZA 4EBCA 1JX4A 3Q8QB 1JXEA 4CK2A 3VQQA 4K8ZA 2KW4A 4WZMA 3FRZA 5KFCA 4R0EA 3MXMA 4FBTA 2RF2B 1N4LA 1HYSB 3S3OA 4K4WA 2UUWA 1WNEA 3AA3A 2HWHA 2WCXA 2ZD1B 2C22A 1WSHA 1RT1B 1LAWA 2YKNB 4FLWA 1Z26A 5L1JA 3AVIA 4EO6A 2RF2A 1HYSA 4JLHA 4AHVA 4MKBA 3QGHA 2IM3A 2ZD1A 3MEDB 1RT1A 2YKNA 3HJFA 3KLEB 2D0BA 3OJSA 4Q44A 2RKIB 5FROA 1U48A 1S1XB 2PY5A 3V9ZA 5J2PB 2GUIA 3K5MA 3UDLA 3KMSA 4DL6A 2QXFA 4AHUA 1LWEB 3MEDA 3I0SB 1C0TB 3KLEA 4B9LA 1TL3B 4OJRA 2RKIA 4RW8B 5KFGA 4URSA 1U49A 2JEGA 4M3WA 4RUAA 1S1XA 2OPSA 1SL2A 3T5JA 5J2PA 4C8NA 3MR5A 1Z4UA 3VQEA 1S6PA 4YR0A 2IC3B 1LWEA 1NK5A 5F9NA 1C0TA 1G15A 2R7YA 2HHTA 1TL3A 1RYRA 4B9MA 2IMWP 3SJJA 5CZ1A 4RW8A 3RBDA 5KFZA 5C25B 3HVRA 2HHXA 3BQ1A 2FJWA 4ECSA 3E51A 3SV3A 3VN5A 4TY8B 3L8BA 4E7HA 3PW4A 4MKAA 2IC3A 4CIFA 3SPZA 3ITHB 1QE1B 4K50A 3SQ2A 4OKJA 5C25A 4KTWA 3M8PB 3CIZA 4RNHA 5KT4A 4BE2A 1LWCB 4DTPA 1XR6A 4TY8A 5DGBA 2HHUA 1XHZA 3VQSA 4LQ3A 4ED0A 4O4RA 3ITHA 4F8RA 1SKSA 2E9ZA 1QE1A 4EBDA 4KAZA 3LP3A 1JIHA 3M8PA 1C6VA 2GBZA 3V81A 4O3NA 1LWCA 3GILA 4GMJB 1NK9A 3O3HA 5KGXA 3NGZA 1EETB 3LPTA 5T7BA 3AO4A 4FK2A 3CDEA 4I9QA 1JLBB 4RNFA 4J2EA 1SUQB 3PW7A 4IQXA 4DTXA 3VA3A 4FJKA 2D0CA 3AO1A 3RWUA 4RNNA 4QCLA 5L1LA 3AA4A 4NLWA 3QEPA 2W42A 5KG7A 1JLBA 4F4ZA 1SUQA 4CJRA 3PW2A 4OVLA 3EZUA 4FJLA 4DL3A 2GV9A 2X74A 2DTUA 3KJVB 4RNMA 3DLRA 1F21A 5J2NB 5DLGA 4F2SA 3CJ4A 2FBYA 3H5YA 1RBRA 3G10A 2RN2A 3LPUA 2V4RA 3RR7A 3CJ2A 3LWMA 3SQ1A 3M9OB 2XC9A 3OL8A 2BANB 2XRIA 3NAEA 3DLKB 1RILA 1NOYA 2WOMB 5I3UA 2J6UA 4DTUA 3QNOA 3PX0A 1TVRB 3OSPA 4WXOA 1NKBA 1K1QA 4JV1A 4C8LA 4KHQA 3F9KA 3KKRA 3LP1B 3IGVA 1ZTTA 1S97A 2BDPA 5EWEA 2RDJA 2YHAA 1NJYA 2BANA 2D7SA 1JKHB 2W7OA 3L3VA 1D9DA 3DLKA 1TV6B 3RAQA 3BQ2A 4ZMMA 2WOMA 3KLFB 4NLRA 1TVRA 4ECTA 1ZBIA 2OPQB 4DU3A 3KNAA 3TAQA 4FLUA 1TAUA 2P51A 4NLQA 3LP1A 3C95A 1X1PA 4LSNB 4NLYA 4FJMA 2XI3A 3DRPB 2F8TA 1LAVA 3KLIB 2HVHA 3DOKB 2HHVA 1JKHA 3MFIA 2R8JA 2OA8A 2IA6A 1JXLA 3SYZA 3OHBA 3KLFA 2X78A 5KRTA 4NCAA 3G6XA 4ECVA 3V6HA 2HNYB 2VWKA 4NYFA 1HNIB 2IAJB 2OPQA 1JL2A 4CE9A 4CGFA 1VSKA 3OLAA 4FJ8A 2ZQBA 4LSNA 3SFGA 2E6LA 3DRPA 3KLIA 4M42A 3RR8A 3AVCA 3Q8RB 3DOKA 4RW9A 3PR5B 4TY9A 3DMJB 4DQIA 4QW8A 4Y34A 2HNYA 4DFJA 1HNIA 2IAJA 2KQ2A 4E19A 1N56A 4Q5VA 4BDPA 4ED2A 2ITGA 4ELTA 3RB3A 4QOZB 3DMJA 3UQSA 3B6PA 4JS4A 2O5DA 1NK8A 2IM2A 1ASWA 4CEFA 1WN7A 1S1WA 1I3AA 4DU1A 4HYKA 4CEEA 1S6QB 4ED1A 2YNFB 3SNNA 1KRPA 1DLOB 3RB4A 2W8KA 2KZMA 1HARA 1NJXA 3AVKA 3G0ZA 1X9SA 1IKXB 3U3GA 1RTHB 3OYFA 3NHGA 4J9OA 4DS5A 2PZSA 1S6QA 3CYMA 1HQUB 4FZZA 2YNFA 1IH7A 1DLOA 2D3ZA 4B8AB 4W5OA 3NGYA 1NK6A 1L3TA 5KFAA 4YFUA 2AU0A 4O3SA 1RTHA 1K6YA 1OS5A 5EUHA 1LWFB 2HNZB 1HQUA 4KRFA 3NGIA 4HCCA 1BISA 2FC0A 1CLQA 4J9NA 2HB5A 3VQ6A 3RB6A 2J6SA 1RTDB 4JV0A 4K4TA 5KT2A 5HRRA 2XY5A 3FQKA 3NDKA 4CGHA 2R8IA 3I0RB 1ZYQA 3NCIA 4KTZA 1VSJA 1LWFA 3U6FA 4Z4IA 4XPCA 3N6NA 1NNDA 2YNGB 4CCHA 1L3VA 4B9NA 3HL8A 1JXBA 1VSIA 1RTDA 4BE1A 2R8HA 3I0RA 3KOAA 3I5BA 2FBXA 3HVWA 2XGQA 4F50A 3OYJA 3OL7A 4JRPA 3ICLA 4R8UB 1EXQA 2YNGA 3EPIA 1S5JA 3RBEA 5DG8A 4KTQA 3KK1B 3QINA 1IKWB 5KFIA 3NBPB 2IBKA 5F8GA 2G8KA 3K59A 1J5OB 3S3NA 4ZVFA 4CJSA 4O0IA 4R8UA 4Q0BB 4DQPA 2HVIA 4R5PB 3P5JA 3OYCA 3KK1A 4KB1A 1IKWA 4CK1A 3KD1E 4QWAA 1IO2A 4F4KA 3NBPA 4CFDA 3JSMB 4J2BA 1J5OA 5J2QB 2F96A 4QAGA 4IRCA 4OLBA 5HBMB 5J2MB 3ZT1A 4R5PA 1SH0A 4CIEA 4KHNA 3JSMA 3NL0A 4M95A 3MXJA 2XGPA 3NAIA 4EYIB 4B8CA 4K4YA 5J2QA 4M41A 3M9NB 5HBMA 2VG5B 5J2MA 4IKFA 3P1GA 3KLGB 5KFVA 4QWEA 1QAJA 4FLXA 4OGCA 1Z25A 3CQ8A 1RA6A 5KFBA 1TAQA 2Z1GA 4F4WA 3LWLA 3SFUA 4ZVEA 4DEZA 2KTQA 3ZSOA 4N5SA 3M8SA 2VG5A 4Q8EA 4B3OB 3KLGA 4ICLB 3V9WA 3A2FA 1EX4A 4CEBA 2Y1JA 3BR9A 1SL0A 3GIJA 1IG9A 3I5AA 4DL7A 4DLGA 5F8IA 5KFUA 3EZ5A 4F4YA 3O4NA 2WONB 3IAYA 2XCPA 5KG0A 4B3OA 1WSGA 4CFCA 2Q3SA 2QKKA 3C6UB 3PVXA 3DLHA 4ICLA 1SH3A 1WSEA 4W5NA 3D5MA 4DQSA 1X9WA 3AVNA 4KPYA 2G8VA 3HVAA 4CEDA 2YNIB 3ASMA 4KI6A 2WONA 3LP0B 4DSLA 3IRXB 3C6UA 1KCFA 4NCGB 1RCHA 3SI8A 3HPOA 3MEGB 4IRDA 1SH2A 1NKCA 3IS9B 2XY6A 3HVTB 1TL1B 2YNIA 4CK3A 3QGIA 4TYBA 1IM4A 2AGPA 4ECXA 2ZKUA 3LP0A 2UUTA 4FLZA 3IRXA 1WSJA 2PYLA 3LAMA 4NCGA 3OYNA 4DTMA 3WNEA 3MEGA 2DFHA 4MH8A 5EWFA 4KHYA 4CJUA 2F8SA 4H4MB 3IS9A 3HVTA 3PR4A 1TL1A 1C0MA 3ZSYA 4FM0A 4PY5A 2VG7B 2QV6A 5KTQA 4K4UA 3CM6A 4CGGA 1RT2B 5I42B 4NLSA 1RT5B 4KHRA 2JC0A 2UVVA 2HW3A 2WK4A 1T3NA 4H4MA 3D45A 3QLHB 2OPSB 4C8MA 2VG7A 1VRUB 1VSLA 3LAKA 4ECQA 4FJ9A 2Z1HA 1S6PB 2W8LA 1RT2A 5I42A 3H40A 3OYHA 3ZSQA 1RT5A 4CEOA 4E1MA 3RTVA 1BCMA 4IG3B 2QK9A 5F8HA 5C42B 3QLHA 5T14A 4DQRA 3RMBA 5KT7A 3OYEA 3NH2A 1VRUA 3Q8SB 3S9HA 2XY7A 4DF4A 1S1VB 1RBTA 4GVMA 3KLVA 2HHSA 3QZ8A 1HQEB 4FJGA 4IG3A 1RBUA 5KFRA 2C2EA 3V1OA 3SUNA 5C42A 4GW6A 3ISND 3FQLA 3L2UA 3K2PA 4NLXA 3QO9B 2KZZA 4CFAA 1S1VA 1ZBFA 5KFTA 4ED6A 5DG9A 1HQEA 2XI2A 5JUMA 3ZT4A 3BDPA 1U09A 1D0EA 2ZE2B 3EYZA 5KRSA 2ASJA 3K57A 3T5KA 3V81B 1VSMA 3QO9A 2HWIA 4F3OA 4O3OA 3ZT3A 1FK9B 1L3UA 2D0AA 4OKKA 5HRSA 5FRNA 3SUOA 3NFAA 4J9LA 1C1BB 2ZE2A 4MK7A 4OPJA 1Q9XA 1UWBB 3H4DA 4KREA 4KBIA 4N76A 1TQLA 5HRNA 1FK9A 5KGWA 1JLCB 1KLMB 3QGGA 4E0DA 3MR3A 3OS1A 3BQ0A 1QSSA 4M3XA 1C1BA 2C28A 4QW9A 5KG2A 3RMCA 4X2BA 1KHWA 1UWBA 3T5LA 3H08A 4OL8A 4J9QA 4OPKA 4O3PA 1JLCA 3TARA 1KLMA 3HKWA 2G8UA 4YP3A 2KFZA 2VA2A 3QETA 2BRLA 3CWJA 3OYAA 1S49A 3NAHA 1N48A 2IGIA 1U4BA 4MK8A 4DTSA 1ZETA 4KSEB 5I3UB 4K4ZA 4FZXC 5HP1B 2FLNA 4CHZA 4WFXA 1S9FA 2ETJA 4RW4B 4O4GB 2E4LA 2YV0X 4ZTFA 5DK5A 1JLEB 4Q43A 1J9AA 4CJQA 5HP1A 3CVKA 1DTTB 4CF8A 5D3GB 1RT7B 4IOBA 1N6QB 3TABA 1T7PA 3K5NA 4RW4A 1T03B 5F9LA 4O4GA 1RNHA 3M8RA 2OZMA 2FJXA 4E89A 5KG4A 4J9PA 2LSNA 4J9RA 4ED3A 3ZSRA 1TP7A 3OYLA 3NF8A 1JLEA 3SCXA 4FJNA 1DTTA 1MMLA 4Q45A 1C1CB 5D3GA 1RDDA 3VQ5A 1RT7A 3RRGA 3SUQA 5FDLB 1N6QA 4JRQA 1T03A 4M3ZA 4I2QB 4E1NA 4H4OB 3E01B 3O4QA 3DYAB 1QS4A 3UPFA 4M3RA 3SUPA 4B9UA 4RW9B 3PW5A 3AO5A 5KT5A 4CJ5A 3RMDA 5F8MA 2V4QA 1C1CA 5KG5A 4EYHB 5FDLA 5J1EB 3I5CA 1SKWA 1GOCA 1YTUA 4I2QA 4KHWA 4H4OA 2BR0A 2G8IA 1S9EB 3E01A 3DYAA 4K8XA 1BL3A 4RG8A 3AVJA 3H59A 3T19A 4ELUA 3C94A 2FVSA 4OGEA 4O5BA 4PUOB 3KIOA 1WAFA 3HPGA 3CJ5A 1GOBA 5JS1A 5J1EA 4TQRA 2KFNA 3NKYA 4AHCA 3SV4A 1S0NA 1S1WB 3QIPB 2G8FA 1S9EA 1QHTA 4NLVA 5KFEA 2BE2B 4LY7A 1BIUA 2BRKA 5JS2A 4IBNA 4M3YA 3F73A 4PUOA 1FXXA 1U45A 5L1IA 4J9SA 4FJ7A 4KKOB 2RDIA 4AHSA 1VK0A 1UA1A 4HTUA 4HUGA 4KHMA 3QIPA 1UAXA 3HHKA 3CO9A 4Q8FA 2R2SA 4CF1A 4TSXA 4FLTA 2BE2A 1RT3B 2CKWA 4W5QA 4EP4A 3V1QA 4ZP9A 3KKSA 4CHPA 3B6OA 3ZSVA 4RU9A 4KKOA 4BWJA 3L2RA 4HHTA 3SI6A 2W9CB 4KV8B 2GIRA 3ULDA 3OSNA 4FCYA 4O0JA 1XI1A 3PX4A 1KVBA 4IG0A 3V6KA 1RT3A 4DG1B 4DSKA 1ASUA 4CJ3A 4CJKA 4B9SA 3VQBA 4CHYA 1S1TB 4BE0A 2GC8A 3QIOA 1D5AA 3FFIB 1TGOA 4L8RB 2VWJA 3NE6A 3OS2A 2W7PA 1VSDA 4O55A 3N6MA 2W9CA 4KV8A 2EHGA 4FM2A 4ID1A 3CDWA 3H98A 4DG1A 4FM1A 1LW0A 1TKXB 2IDOA 1MU2B 4EEYA 1S1TA 3KHGA 2YHBA 4CEAA 4BDYA 2P5GA 1XR7A 3FFIA 3NMAA 4HUFA 3PO4A 4IFYB 2D5RA 4F2RA 4EZ6A 1WSIA 3RB0A 4CHOA 5KFJA 1NHUA 4K4VA 1TKXA 1MU2A 4ZVHA 4BACA 5KFNA 4FK4A 1D9FA 4LD0A 3AA2A 4TN2A 4IFYA 4IRKA 4DLEA 4CEQA 3VQDA 1BGXT 4N41A 4I7FB 5EWGA 1ZTWA 3C6TB 4DL5A 2DFEA 1B9DA 2C2RA 4TLRA 1U04A 1GOAA 1UA0A 4MFBB 1NK0A 2A1RA 3P83D 3H5XA 4B9VA 2XO7A 1SKRA 5JXSA 4I7FA 5KT6A 3OVNA 3SZ2A 4J2AA 4ECWA 4DTOA 3C6TA 3MXIA 4IFVB 3RAXA 5L1KA 4MFBA 4MIBA 5DQGA 1RAJA 4KI4A 1WSFA 2PYJA 3NF7A 4RW6B 3D0PA 3KTQA 4FJJA 1QTMA 1ZBUA 4IFVA 1C2PA 3L2QA 4NCBA 3V4IB 4QPXA 1REVB 2X6NA 4CF0A 2E6MA 4FS2A 1S1UB 2FVCA 2AGQA 3DLEB 5KFOA 2FVPA 4RW6A 1ZBHA 1CSJA 4OKEA 1RA7A 1GX6A 4JV2A 3V4IA 5E41A 1SL1A 4HCBA 1REVA 4I9LA 3VA0A 4NLTA 5C24B 1S1UA 5HROB 5C5JA 4DF8A 1TKDA 3KMQA 4FK0A 3DLEA 4KAIA 4CF2A 4URGA 1TKTA 2AX0A 2I1RA 4B08A 1KLNA 2R8GA 2FLLA 2O4IA 1RTJA 3CG7A 5DQHA 1L5UA 1EP4B 4KFBB 4BWMA 5C24A 4Y1CA 4AHRA 5HROA 3O3FA 5KFQA 4CF9A 2OZSA 2YKMB 5DGAA 4HKQA 3ZCMA 3T3FA 3GQCA 5F8LA 3BSCA 5KFLA 2ATLA 4DL2A 3DRRB 2AJQA 4FJHA 3OS0A 2XCAA 3HP6A 4CHQA 1HYZA 1T05B 4YQWA 4DSFA 1EP4A 4KFBA 5KFWA 2VG6B 2OPRB 1N5YB 2AX1A 5KFDA 2YKMA 5DLFA 1I6JA 3QEVA 1HRHA 4B9TA 1HPZB 4PA1A 3DRRA 3QEWA 1S9GB 4XIUA 1T05A 2VG6A 1TK0A 2OPRA 3NF6A 1N5YA 4KHSA 2IOCA 1HMVB 2ASLA 3T1AA 1YVFA 5KFSA 3PV8A 1HPZA 4ZVGA 3NF9A 1I39A 3VQ8A 1CXUA 4O3RA 3VQ7A 1S9GA 2WRMA 5KFKA 3BSOA 2E9TA 3NH0A 1DTQB 1KHVA 4FVMA 3OYGA 1HMVA 4WZQA 4Z4EA 4ZP7A 4KHUA 1QAIA 4EBEA 3CFPA 4PWDB 4DS4A 3MEEB 1NK7A 1TK5A 2IJNA 4EO8A 5CYQB 2C2DA 4C8KA 3OYIA 3NH1A 3FDSA 3L2VA 1DTQA 3LP2B 5EDWA 2HAIA 5KG1A 2VA3A 3TI0A 4RUCA 4FS1A 2FBVA 3TANA 1B9FA 4PWDA 3MEEA 1S10A 4ECUA 4KB7A 4E7JA 2BQUA 3HXMA 5CYQA 2Y1IA 4M3UA 4N47A 4W5TA 4WXWA 3LP2A 1C1AA 1RDBA 2R2TA 4HVJA 3V6DB 3CFOA 4MIAA 4WYWA 4DTRA 1BIZA 2YNHB 1HNVB 2CJQA 3AO3A 3GV8B 3PX6A 5KFPA 3H2LA 3OYBA 1RDCA 3PW0A 1KFSA 3BREA 3MTKA 4QWDA 2WTFA 1U47A 1KSPA 2FVQA 3GIIA 4CECA 3V6DA 4ZP6A 2EC0A 2YNHA 1HNVA 2AQ4A 2ILYA 3D28A 2FLPA 4CERA 4ZPCA 3G86A 2OPPB 4J9MA 3I0SA 3QERA 3G6YA 1HYVA 4CJFA 3CJ3A 2RPIA 1BQMB 4NLPA 4FW2A 4Y2AA 1D1UA 1W9HA 4KE5A 1QSLA 3CJ0A 4F4XA 3DRSB 4DTJA 2IJFA 3QYYA 5KFYA 3AA5X 3G6VA 4Y2CA 1ASVA 1RTIB 2OPPA 1RBVA 4ZP8A 4CGJA 1T8EA 1RT4B 5KT3A 1LV5A 1IKVB 1BQMA 1JL1A 1XR5A 4DL4A 1WNSA 3DRSA 3WNFA 2G8WA 3LALA 3EY1A 4M94A 3OHAA 1RTIA 1RT4A 1IKVA 3H4BA 2E9RX 4PQUB 4CESA 2G8HA 2OH2A 2AWZA 3HM9A 2FVRA 5KFHA 4IR1A 4H8KA 1RYSA 4NRTA 1VRTB 3OYDA 3VQPA 2JC1A 3TR8A 3AVFA 1A5VA 1FKPB 3LZJA 2R8KA 4PQUA 4RNOA 3TWHA 3THVA 5L9XA 1QSYA 2UVRA 1NJZA 3BSNA 3V9UA 4J2DA 4LSLB 2HHWA 4EZ9A 4KB0A 4DFKA 3OL6A 1VRTA 3EPGA 3PUFA 4FYDA 2ALZA 1EETA 3KD5E 3TAMB 1YT3A 1FKPA 4EP5A 4ECZA 1JLQB 1QUVA 3L3UA 4QWBA 3S3MA 3CM5A 3OYKA 4O3QA 3V9SA 4LSLA 2BQRA 5DG7A 1S48A 3V1RA 2W9AA 2B4JA 4DTNA 3HPHA 4IKAA 4Z4HA 3TAMA 4CJ4A 2IM1A 4E7LA 1JLGB 4QWCA 3K5OA 1JLQA 4DSIA 4DMNA 3PY8A 3ZSWA 2R2UA 3QIDA 4NLDA 1JLAB 4FJIA 3KJVA 2NUBA 5J2NA 2HMIB 2B43A 1JLFB 2F8EX 1KVAA 4ZPDA 1JLGA 5KFMA 2WB4A 1QQCA 4JS5A 2HHQA 3VQ9A 4G3IA 4Z0UA 3V9XA 1KFDA 4YR2A 3GIKA 2V9WA 1W25A 5F8JA 1CZ9A 3FSIA 1JLAA 5KG3A 3OJUA 1ITGA 3M9MB 2HMIA 1JLFA 3VQCA 2FBTA 1X9MA 4YMEA 3AVAA 4LQ9A 2ATQA 4Z4GA 1XHXA 1YVUA 3MR2A 4ED8A 3HK2A 3DDKA 2W9BB 1XC9A 2DPIA 1RDRA 1WAJA 4FLYA 4CJTA 3TAGA 4GC7A 3AVLA 4UQGA 1KVCA 4XO0A 4ECYA 3WNHA 1TV6A 1NK4A 4CFBA 3RMAA 4NYZA 5KFFA 3SQ0A 4NLGA 5EU7A 4ED7A 1NHVA 3OYMA 1S0OA 2W9BA 3AVGA 4YNQA 2JEIA 2JGUA 3DLGB 3DM2B 5KG6A 3L2WA 4TQSA 2QKBA 5CY4A 1Q8IA 5HRPA 4IH7A 1TKZB 3M8QB 3GV5B 5DQIA 5SZTA 1D8YA 5SWMA 1RT6B 1W0HA 4YR3A 1EKEA 3QEIA 4CJVA 4IG0B 3DLGA 3CDUA 3LDSA 4DFPA 3DM2A 3MECB 3GIMA 4NZ0A 3WNGA 1L3SA 2X6SA 5KI6A 2ILZA 4GC6A 1TKZA 3M8QA 4U6PA 2DPJA 2R2RA 2JEJA 3TVKA 1BI4B 1BHLA 3MAQA 1RT6A 4CGDA 3IG1B 1J53A 3O3GA 4WFYA 1RDAA 5DMRA 2DY4A 3BJYA 1LW0B 4M3TA 4I2PB 2GIQA 3MECA 4DSJA 4CHNA 4CJLA 4E3SA 2IM0A 3BGRB 2I5JB 1BI4A 4ECRA 4FW1A 2J6TA 3T5HA 4IR9A 4RW7B 4XPEA 4Y3CA 4F3TA 3TAFA 3IG1A 3SQ4A 3ALYA 1YTAA 5CYMB 3PO5A 2BQ3A 4I2PA 4IH5A 4Y1DA 4K4SA 1RBSA 3ZT2A 4U7CA 4DU4A 3BGRA 2I5JA 1K1SA 3MR6A 3TAPA 1IKYB 3BSAA 4RW7A 2B5JB 1IKXA 3AVHA 3K58A 3N6LA 5CYMA 2QE5A 4IDKB 3PJXA 1FKOB 3AVMA 3AV9A 1NKEA 4E7IA 2A1SA 2JEFA 1C0UB 4FZYA 3GYNA 3K5LA 1S4FA 1WLJA 3KHRA 3TQ1A 1IKYA 4J9KA 2B5JA 1VSHA 3KHLA 4IH6A 2UVUA 4CEZA 2HNDB 3NGDA 2XY8A 1LW2B 2XWYA
chains in the Genus database with same CATH superfamily
4LVOP 1VLOA 4M45A 1FKOA 2E2NA 1R0AB 2F9TA 3SEOA 2HAFA 2BABA 1S5ZA 3PSIA 2XSJB 1WEZA 2OFHX 1ESVA 1XNRK 4CJWA 1R43A 4NRUA 2P9UA 3QRQA 1Y97A 1HBNB 1RAHB 4TXSA 2K3IA 1TZ0A 4FWOA 1W26A 2GVDA 4DWIA 2A3JA 2DIUA 2YKPA 5AQPA 5B7WA 3KWIA 1M0SA 2F7VA 2UVWA 1Y10A 3BM7A 3OY9A 1XEZA 4O44A 4FLVA 4G6VB 5M1QA 3EGVA 2E20A 1V3RA 1K9MO 4K25A 2GELA 2Q6CA 3DI6A 2D3UA 4MYUA 5HMXA 2PO4A 3HHLB 1DQAA 4OYPA 2HIYA 2ASDA 3FFKB 3CCEN 1N33K 3CFRA 1CQMA 4DR1F 3I4PA 5I9EB 3C15B 3D3BJ 4A59A 1XTZA 3O1WA 1RU2A 3KLHA 5L46A 3VQ4A 4M5DB 4HACA 3FK4A 2NR0A 1T94A 2DNMA 5HLFB 3KK2B 4X4OA 1VC5A 2D4WA 5FLXU 4ISGA 4JK8A 4AH9A 5DM7L 3TP2A 4C7QA 1XMOK 4DQQA 2JFKA 4G1QA 4IOAQ 1F2GA 1JJ4A 1SV5A 5ELZA 5GINA 5SUHA 3V6JA 1IBMJ 1EJ7L 3UKUB 5M1NA 2FTRA 4PG4A 3AT1B 4A2BA 3Q89A 3VF0B 2MQOA 3GSDA 5CAAA 1NOZA 4KO0B 3U3YA 2ZH5A 1RDUA 1RAOA 3KWMA 4NEZA 1Q7LB 4S0MA 1GX5A 4JKFA 2MHNA 3CTRA 2NREA 3OLBA 2F40A 2VPWB 1YSJA 1IWAA 2RB7A 3FKBA 3GV7B 3P6YC 3I8DA 3CCVN 3EWGA 2FHKA 3N4WA 2GMLA 1U6FA 2CG8A 3M2UA 4K2XA 4U7UK 4YDXA 2GVZA 1W2IA 3ENQA 1Q16B 2OD4A 5BYRA 4A47A 4ZIVA 3O44A 3PRBA 5CZVA 4LFCK 2KW4A 3FRZA 3CPEA 2H9ZA 3G82B 1N4LA 1JNZB 2GAHC 4OYAA 2YHXA 2HQIA 3AA3A 2WCXA 3D2FA 2ZD1B 3R5DA 1E3MA 4EO6A 2YWFA 3VOVA 2QZ8A 1N32K 3QGHA 5AQJA 2YQ1A 4BS2A 3THXB 2BMBA 2RKIB 1Q18A 1U48A 4CQ1A 2Q0RA 4V19J 3OR1B 4ZPTR 3MMJA 1VBYA 3K5MA 2LQJA 4KGZB 3C19A 2QXFA 3AQOA 1LWEB 4IO9L 3MEDA 1C0TB 1MDUB 1TL3B 1ZBSA 4WBFA 2FHOB 3SBGA 4URSA 2P9NB 4RUAA 1S1XA 3T5JA 4N77A 5HMYA 4NB4A 1GTEA 1Z4UA 2IC3B 3M6UA 2B4PA 1RWMB 1G15A 4FPIA 3HZ6A 3W65A 4RW8A 3RBDA 2CH5A 2DKOB 2YPYA 2DEJA 5C25B 1IJEB 3HVRA 2HHXA 3E51A 3SV3A 4X66F 2W01A 2I38A 2RS2A 4RWWA 3PW4A 5AFUH 3ITHB 1QE1B 3DRXA 3RBZA 4RNHA 5KT4A 5ETMA 1Q1KA 4ILJA 4TY8A 4P74A 2L41A 5AQLA 3TPQA 1XHZA 1SPBP 3VQSA 4LQ3A 2XMUA 3DDIA 2E9ZA 2Z2MA 4RBVA 3K8WA 3NEKA 3FMBA 4OX9J 3LP3A 4E98A 2GBZA 3MDFA 4I6MA 5JVHL 4F9OA 2HQGA 2DNPA 4C8YA 2Y1RI 3O3HA 2KL8A 3SLCA 1FWKA 1WEYA 3LPTA 5T7BA 3CCUS 4I9QA 1VR6A 2XBPA 3Q83A 4MT1A 4DUYF 4X4RA 4K0KK 3VA3A 1SJFA 2D0CA 1W97L 3W2VA 3BUZB 1VJQA 2IRUA 3E66A 3N79A 3L3CA 1ZZFA 3DN9A 4LF2A 4F4ZA 4CJRA 4AQYJ 4OVLA 4FJLA 3THTA 1HBUA 5HJXA 2DTUA 5EN1A 3KJVB 1F21A 4NEYA 1YX2A 2YKAA 4LR7A 1RBRA 3G10A 1RFQA 3RR7A 3CJ2A 1Q95G 1BLUA 1KAXA 3CERA 5EHHA 3BZKA 3F2KA 2NXUA 5FPDA 5I3UA 2J6UA 5A6PA 3AOAA 4ZCKA 4NI2B 1TVRB 2WVDA 5L38A 1NKBA 3F9KA 1S97A 4B9QA 3RW7A 3CMEN 1U25A 2RDJA 2Q1LA 2D7SA 5B0GA 3DLKA 1TV6B 4YY3J 3KLFB 1XNRJ 2V2ZA 4ECTA 1NMEB 1U2FA 4FLUA 1TAUA 3C95A 3LP1A 3MURP 4LR9A 4WF9Q 2E5LK 4NLYA 3GR1A 4B3MJ 1WEXA 2DY9A 3DOKB 1JKHA 1FVQA 3MFIA 2OA8A 2YWGA 4DUTA 3BGOP 2Q66A 3B8HA 2V34A 1JL2A 3OLAA 1IQTA 4FJ8A 2ZQBA 2HRTA 3MAAB 3L4IA 5KPZA 4DZDA 3VR1A 3CCES 3OQ2A 2VQEJ 4Y34A 4OX9F 5EY4A 4DFJA 1HNIA 2IAJA 1NU0A 4CYUB 4C2MA 2R7VA 3C6AA 1X3MA 2FQQB 2QJ3A 3MCPA 2XWXA 4HWIA 4ED2A 3GU0A 3P5BP 2DNKA 2DNRA 3W9JA 1TL7A 4I68A 1HNWJ 4BC3A 1VI7A 1WN7A 1TUGB 4HDHA 4OZ2A 4USKA 1SJ1A 5HJYA 2K7KA 4HYKA 1IR1A 3DHWC 3BO3A 2R7RA 3VEOA 1WDTA 3QT6A 2AW0A 2X1GA 2P9EA 4DPYA 3VAGA 3RB4A 3TUIC 4ILGB 3R1LA 1HARA 4OI2A 1YBUA 2MYFA 2WVBA 3D6MB 3J81j 5K9FA 1S6QA 1M5PC 1T9WA 1IH7A 3A3PB 1CJKB 1DLOA 1HD1A 2IVMA 3TR5A 1YUWA 1Y3JA 1SZ2A 1UAWA 2ZJPL 2CWXA 4ES2A 1RTHA 5HMWA 4DPWA 4M5LA 2FPHX 2WBRA 2DGVA 3THYB 1AFJA 1BISA 5IWAJ 2HB5A 2CVIA 2UZAA 2W4CA 2A3ZA 3TTCA 1Y5LB 4JV0A 3D54A 2XY5A 4DV2K 1S22A 5K5MA 3E8OA 2WAQD 1ZYQA 4YY3F 4DV1J 3NCIA 4CNYA 4KTZA 1K8KA 1LWFA 3RG6A 4Z4IA 2QWMA 4XPCA 3ZX2A 4B3SK 3SCIE 2N82B 2ZM6J 4CCHA 2GVDB 1L3VA 3A5MC 1RTDA 4QIGA 4B3MF 1ZZNA 1IN0A 3CIMA 3I0RA 5E3QA 4BG9A 3T41A 3D66A 3GYGA 3HVWA 4LBHA 2P9LA 3OL7A 3AY9A 1EXQA 3FCVA 5BR9A 1S5JA 2IRXA 2W7AA 4XEIA 4IUFA 2IBKA 1R27B 2XG8A 2K1RB 2VQEF 2G8KA 3K59A 3S41A 2ZKTA 3TO8A 4BRNA 4OQJA 4PL7A 4R5PB 2KT2A 3TZYA 1AFIA 4R25A 4CK1A 3KD1E 3CNQP 1RB0A 4CFDA 4X4SA 1U7LA 1HNWF 2DH9A 4RKUC 4OLBA 5ETOA 3ZT1A 1SH0A 2UUAK 4R79A 3WIUA 1NGHA 1FTRA 1YGYA 4QPTA 2NPFA 3VAHA 3JSMA 4M95A 3NAIA 4C0BA 5J2MA 4YB6A 4MLEA 2J7UA 1WSVA 3P1GA 3MWBA 4ILLA 3Q2TC 1TMMA 1X4BA 4QWEA 2RUSA 1I94J 4YDUC 1RA6A 3LWLA 3MM7B 2ZF5O 4N5SA 5CHCB 2J0XA 3H46O 1R3NA 4B3OB 3BB5A 4JI1J 1VQ7S 1P90A 3CW2C 4CLTA 1W2BM 4FOEA 4CM2A 1XNQK 4DX5A 3NGRA 1N0VC 1S6UA 2K2PA 3TSUA 1IG9A 3I5AA 4BGBA 5A0YB 2R7OA 5IWAF 2BUPA 2P9SB 3R6MA 2P9GA 5KFUA 4B1XB 3EZ5A 3HBTA 1Q78A 1WF2A 3C6UB 4ZLLA 2HBKA 2QKKA 3DLHA 3VGTA 4DV1F 4XH5A 1YJNN 4GVLA 1X9WA 4OV1A 4FWLA 2ZM6F 4KPYA 2G8VA 3HVAA 5H1SV 4CLSA 5A2QU 3UWTA 3JQKA 3ASMA 2NZTA 2RILA 4CZEA 1YTYA 3MM5B 1WDDA 2RAQA 3CMAN 3IWNC 2R9LA 3SI8A 2F63A 1TFWA 3HPOA 4QYRA 1JCFA 1AUSL 1NKCA 5KPTA 3IS9B 3HVTB 3OTCA 3MM8B 4DR7K 4W92B 1Q4RA 4M5JA 1TUYA 4DV7K 1IG8A 4WF9L 3W9HA 2HFVA 1WSJA 1Y64A 5AQYA 2PYLA 4YOWA 1V5IB 7FDRA 4RBTA 2VH7A 5EWFA 2E5IA 1TL1A 3D1HA 1WHYA 5KTQA 3O9UA 4CLYA 3CC7S 5D4NA 1P8GA 4Y2KA 2HW3A 2LQ9A 2IVFB 3VEXA 3E2EA 4KC5A 2MQQA 3DGVA 3D45A 3H3NO 2B7BB 4JKCA 2VBXA 4ECQA 2Z1HA 1ZAXA 3DXKB 1EQMA 1RT5A 4CEOA 3LUYA 2QI2A 3T6JA 5C42B 2W24A 5T14A 2D1CA 3GJSB 3NH2A 4MJKA 1NSQA 1I94F 3U4LA 3A8YA 1RBTA 1J2VA 3MN5A 4OYBA 2E5LJ 1S59A 1HQEB 2A10A 1RBUA 3E9OA 2ZDOA 4GW6A 3GP9A 3FQLA 1N34J 5TKWA 3IWXA 1F3FA 4NLXA 5EXWA 3P39A 4I0WA 4LT6A 4ZCIA 1S1VA 1OVYA 5KFTA 4ED6A 4DV5K 3DRYA 5DG9A 4DV3F 3CHWA 5JUMA 3ZT4A 5J1NA 4X66K 5HAOA 3K57A 5EGYA 3T5KA 2RQ4A 2PA3A 3AAWB 5FRNA 3SUOA 1QVFR 5LT5A 4X62J 4KH5A 3MZIA 1U1NA 3H4DA 4KREA 1R6VA 1FFWB 4KBIA 1WC1A 3MMCA 2QA4G 1MN9A 3MR3A 1YQHA 1QSSA 2PI4A 6FD1A 2DPNA 1BO5O 3C16B 3QB0A 3B54A 3UNYA 3SMSA 5A8WB 2XYGB 3CC2N 3UB5A 2PMWA 4PG7A 5FLXY 3TARA 1EHWA 2NRVA 3HKWA 4EFHA 4YP3A 3Q8UA 2BRLA 4FF3A 2MJNA 1V3SA 2A5XA 1U4BA 3BF3A 3M05A 1NEEA 4KSEB 5I3UB 5HP1B 4CZJA 1VHIA 1DFDA 3B82A 3FZLA 4RW4B 4O4GB 2CNLB 2DJWA 4Y00A 4XDDA 2Q2RA 4Q43A 3BO4A 4CF8A 5D3GB 2DNYA 1UFKA 4IOBA 3TABA 4OHXA 3M8RA 3ZZUA 2OZMA 5DRKA 2ZVSA 4NXMK 3OVAA 1HBMA 3AD8C 4ED3A 3SSQA 3ZSRA 3SJHA 3O9RA 5AJ3J 1FRIA 2CQ0A 4FJNA 1SIWB 1DTTA 1OYEA 3RRGA 1N34F 3L7PA 2DR9A 4M3ZA 4I2QB 2ZJQQ 2EXUA 3M6GA 3O4QA 4M3RA 1UWAA 1UVKA 2VC1A 2FIUA 1KP6A 2M0GB 1C1CA 5KG5A 3I5CA 1SKWA 1GOCA 4H4OA 2BR0A 2G8IA 3E01A 3DYAA 3UVJB 2MTLA 4QIFA 5LSOA 3RJMB 3H59A 3T19A 3OBWA 1V5VA 3C94A 4O5BA 4X62F 4K8RA 2ZGZA 3KIOA 1DKGD 3CJ5A 5B8HA 5JS1A 4TQRA 3VAJA 4AHCA 4OI0A 3SV4A 1WORA 2H51B 2FF3B 2G8FA 4JI6J 1S9EA 3TZZA 2MLZA 4CO4A 1U2VA 2GO8A 2QYGA 5JS2A 2UUAJ 4PG6A 4PUOA 1FXXA 2HSEB 3ZYYX 4DR6K 3NMRA 4HTUA 1UAXA 3HHKA 3VGVA 2R2SA 2BE2A 2YI1A 3VENA 2QMXA 4KGKA 2E5GA 4FVUA 5HANA 4K43A 4HHTA 5AQSA 3JAMO 2B4OA 3ULDA 3OSNA 3PX4A 1UJ6A 4ILMA 1RT3A 4DG1B 1ASUA 3ID8A 1CJVA 4MYTA 1S1TB 3LTOA 4BE0A 1S76D 5AZIA 1D5AA 3FFIB 4LF4F 1B0TA 3VQTA 1TGOA 4H0OA 3NE6A 3GPAA 1VSDA 1WACA 1NB2A 4KV8A 2ZH2A 3OV7A 4B3RK 2RDDA 2EHGA 4GY2B 2HZAA 3ZO7A 4ID1A 4DR5K 1LW0A 1YJNS 1MU2B 2MB0B 4EEYA 3PNIA 3HSGA 2P5GA 2YX6A 4IFYB 4HR2A 1T3OA 1HUXA 3OVSA 3FEYB 2IBOA 2BJDA 3D6RA 1S7IA 1FERA 1TKXA 2APOA 3I9ZA 3Q8YA 4ZVHA 3U7JA 4OZ3A 1D9FA 4FK4A 4F4AA 4FO0A 1PCAA 3MUTP 4IRKA 4DR7J 3SQGA 4CEQA 1BGXT 3WBZA 3RZAA 2AJ0A 5EWGA 3QBCA 1M1KT 5AE1A 4BRCA 2HQ3A 2K3KA 2BOAA 3DU5A 4C1NK 2VFUA 2A1RA 5LJVA 4B9VA 3MTJA 2MGZB 2XO7A 2I0XA 5KT6A 2WFBA 3OVNA 3OTOJ 2ITMA 3C6HA 3D6HB 4FWQA 4OV6A 4IFVB 1X0PA 5AQWA 1DEJA 4GKJK 1GTHA 1NU4A 1FJEB 4JI6F 5L1KA 4MFBA 2AEMA 4JK7A 4LF7J 3FUYA 2CZ4A 1Q81T 1BOTO 2OTJN 2KRRA 4FDFA 3HMJG 3J7AP 1OO0B 4FJJA 1QTMA 2DGOA 2Y9HA 5IT9U 3V4IB 2E6MA 1C0FA 4A4JA 2JLGA 3MM6B 4YB7A 2AGQA 3DLEB 5KFOA 2HOEA 3TUPA 5I4MA 1CSJA 4H0TB 3IR6B 1RA7A 2JWLA 4ZVQB 1RSCA 3W8GA 1REVA 3DXMB 4RJVA 2RS8A 3VA0A 1CJTB 3UI3A 1TKDA 1X7VA 2FZKB 4OFZA 4CF2A 1NB7A 4URGA 1TKTA 3SXLA 2AX0A 2XYHB 4B08A 2VPZB 4USUA 2R8GA 2V8VA 2P9PA 5LOQA 2ZOMA 1RQ0A 2G2ZA 3CG7A 5IM0A 4BC7A 4BWMA 3R5GA 5KFQA 4CF9A 4J9VA 3FEXB 4U9RA 1B0VA 3GQCA 3L95X 2EFGA 4AXJA 3BSCA 2GGPA 3LPYA 1WF1A 3QSIA 3OS0A 3NCQA 3ET6A 4CHQA 4DSFA 3R2DJ 2CDQA 1EP4A 3P96A 3EE3A 2YKMA 1I6JA 3OXLA 2WBMA 3DRRA 3QEWA 3CJCA 1CC8A 1T05A 2XZDB 1CS4A 2OPRA 3NF6A 2J0SD 4N8NA 2IOCA 3T1AA 4ZPWR 4X4PA 2E7WA 1ZAVA 3H2VE 3V5RA 2H65B 5GMKa 1UFLA 2WRMA 3BSOA 3NH0A 3OTOF 2HVDA 2BKPA 2DO0A 3LDOA 1KC8O 1HMVA 3AJ1A 4WZQA 4Z4EA 1H7WA 1NGEA 3TJAA 4N7TA 4PWDB 4DS4A 4OZJA 1NK7A 1Q79A 3RVCA 3CCJN 2IJNA 3D67A 2HBRB 4C8KA 4LF7F 3EO3A 3P38A 4JI0J 1YJ9N 2QL9B 2CZ9A 2ZWPA 3GWCA 1EQYA 3A5OC 3M2RA 4FYWB 1VBKA 5KG1A 4RUCA 5IZHA 3TANA 3LDPA 1NWKA 4I69A 4ECUA 1IM6A 1R89A 1RBLA 4OHWA 4E7JA 1NBEB 4HT5A 4PPDA 4DR4K 4FWMA 2RHQB 4N47A 3I55N 4CLWA 4WXWA 3QRRA 3JAMU 2RH3A 1CC7A 2KVIA 2UV8A 5ADXH 1U2RA 4MIAA 4CJ7A 1RU1A 4ZVTB 3L9ZA 4ZLNA 1CBKA 3PW0A 2HS0A 1R0BG 4DHYA 2U1AA 4ZN3A 4TKTA 4CECA 3DLJA 3U1MA 1GK8A 5DDRC 3CXCR 1NDKA 2KLAA 2ILYA 1FRLA 1V4SA 1ZPVA 4IXCA 3IMQJ 5L39A 2E2OA 5GIPA 2OPPB 4AF1A 4CJFA 2I9SA 2RPIA 4Z94A 4NLPA 3PTWA 4WJBA 1D1UA 3V2UC 1W9HA 4HL9A 4KE5A 1O0PA 2GUPA 1OH6A 1RTIB 2LFVA 3CDBA 1SBRA 4ZP8A 4CGJA 1IKVB 1BD6A 1E6VB 1RAFB 3K0JA 1HHSA 3QICA 3MMBB 3GZ7A 3UE2A 4ES1A 2VCPA 3W5YA 4X65J 2QT7A 3LALA 3CF5Q 3EY1A 3OR2B 2DNNA 3OHAA 5M1FA 1N36K 2B9XA 3HI9A 4PYAA 1RT4A 1QVGR 2ZH4A 4FSVA 1S99A 1S4EA 4PQUB 2X7IA 2YKOA 2QFJA 3QMLA 4WQ5C 3EGWB 5KFHA 4H8KA 4Y6IA 2N4CA 3HTVA 4ERDA 3CQYA 1RAEB 4RNOA 1FX4A 4G1PA 4A8WA 3V9UA 4J2DA 1RHMB 4BC5A 3EJMA 4KB0A 1QDUB 2GQ2A 4TVAB 1NG9A 4B3RJ 2ACYA 3UN3A 4DR5J 3KHYA 2DXEA 2GA7A 4B3TJ 2XMTA 4O3QA 3NGTA 2CJBA 1FI4A 5DG7A 2XZTB 3V1RA 1WC3A 1NGFA 3VAIA 3TAMA 4HHUA 1JLGB 3K5OA 1OH7A 1QUPA 4DSIA 3QAEA 4CWBA 4MTPA 4ES3A 1HJOA 4CO5A 4Y0WA 4NLDA 1JLAB 1BWFO 4BREA 5J2NA 4W98A 5HN0A 2RQCA 4X64K 2D0PA 1CG2A 2WB4A 1KFDA 3GIKA 4JI7K 9RUBA 1CZ9A 4WKYA 2HMIA 4BVOA 1FRXA 1YVUA 2LEAA 1U26A 3HK2A 2CQCA 2DPIA 3GCXP 2POKA 3TAGA 2V50A 2IY5B 1KVCA 3WNHA 1RWNB 3FE1A 3F9MA 3CCMN 4UY8T 4M5KA 3SQ0A 4PPZA 3THWA 2OTJS 4NLGA 4WFBQ 5EU7A 2AEJA 4X65F 1BDGA 3OYMA 4M63C 1S0OA 2W9BA 1T6DA 3X1LB 3AVGA 4YNQA 5B0BA 3P8BB 4Q7AA 2JOQA 2O8FA 3DM2B 2ZUGA 3SMZA 3L2WA 4TQSA 4L76A 2QA2A 1IBLF 4IH7A 1F60B 1TKZB 5DQIA 4U7UD 1XC3A 2KFYA 5SWMA 2BJ7A 2UV8G 2KU7A 2HIQA 4XH1A 1HD0A 5J1PA 1UKUA 1T0TV 1OY6A 4RUBA 1EIYB 5HQLA 4DZ6A 2H4WB 3D2WA 4DFPA 1LEOA 3GIMA 1F1BB 3VEVA 2A6MA 3M8QA 3CD6S 4RUHA 1BI4B 1YXQA 3OFFA 4TU8A 4K59A 5AQRA 5T7LA 2LEPA 2HBMA 1WKLA 1J5EJ 5DMRA 2ZOFA 5AXMA 1LW0B 3ZX3A 1GLLO 2GIQA 2PSZA 3MECA 4DSJA 3RU0A 4CJLA 4FW1A 2J6TA 3W3SA 4RW7B 4Y3CA 2XLKA 1YTAA 2BE7D 3PO5A 3PIOQ 2BQ3A 4I2PA 2NS1B 4JI8J 3PKMA 4HTLA 2CGJA 2PAVA 2I5JA 1K1SA 3TAPA 1IKYB 1HKBA 4LFBJ 1ACMB 5LMNJ 3H45C 1IKXA 2E66A 4A5AA 1NH7A 2QE5A 3KXDA 1PJ5A 4IDKB 3PJXA 1MMDA 3AV9A 4FZYA 2MKYA 3O4WA 1HHTP 2V9KA 5AQXA 2OGUA 4DI6A 3M8ZA 3KHLA 2UVUA 3HHEA 1LW2B 3P4UB 1TR0A 1BQNB 1C0UA 3HFZB 4I1TA 2XULA 4F0MA 2WHOA 4FP9A 2P5OA 1TK8A 4HI1A 3LANA 4I6WA 3C14A 3CCJS 3DOLB 4FPBA 2DHHA 2MLYA 2BOPA 3NWRA 2O4GA 2QSWA 4MK9A 4AD6A 5GAEI 5IC4B 4GKKK 2JLEA 4Z4CA 4F26A 2FGOA 2LU2A 4HLBA 3JYTB 3QESA 3VEZA 2DGSA 1JJ2M 4PKIA 2EX3A 3PG9A 4L6V3 4RTFD 3G71N 2OEKA 3RRHA 1HWJA 3MOZA 1B92A 5BR8K 3I55S 2PDAA 2WVFA 3U9DA 1BCOA 1DY3A 5K14B 5E3RA 3CF5L 3CCSS 2B6AA 1A5WA 2J9CA 4JN4A 4RR5A 4ZPAA 4FYXB 1CXQA 1TKTB 1A5XA 4F02A 2ZVIA 4LR8A 4Q0BA 1EO1A 3QSYB 4WTOB 1J5EF 4EFAC 2RU3A 4TYAA 4OYIA 1CZBA 5JLFA 4K4XA 3SAFA 5DDQC 1YJ7A 3HP9A 2XHBA 4M5IA 4NYNA 4LH5A 1XMBA 1RJJA 1RWVB 4WE1A 2C2MB 3IA0A 3PJWA 2DCUB 7FD1A 1FEHA 3KK3B 1FFGB 4JI8F 3IBFB 3KVGA 4OYXA 4AILC 4JKEA 2YY3A 2YJEA 5LMUK 1G99A 2HHHK 3CJKA 3B78A 1Q7YT 3OA9A 5LMNF 4JD2B 5ETKA 4WFZA 5F8NA 3GYXB 2WZ1A 2GO9A 4DPOA 2FJVA 1KVIA 1IR2A 2CWKA 2ZNZA 1FFSB 3IGNA 3QNNA 1B7FA 4NYOA 3R2CJ 3HYFA 1OPZA 1FE0A 1OYDA 1I3OB 4C8ZA 1N5QA 4WKRA 3R27A 3LZIA 3UN5A 4FXDA 5CABA 4IOXA 4GO5X 4ZHRA 3CCZA 1QLNA 4UF4A 2FLOA 4ID5A 1QD1A 4CTAA 1JXEA 5B08A 5ITHA 4K8ZA 1SJQA 2YCHA 1VQON 4JI3J 1CLFA 4I67A 2RF2B 4NXNF 1NPPA 1RWPB 1HYSB 1MN7A 3S3OA 4FL9A 1WNEA 2C22A 1LAWA 5L1JA 2UXDJ 3AVIA 2AJ2A 4WFBL 1LNQA 1BG3A 2MKCA 2HFNA 2VB6A 1MWKA 5AQZA 3PXGa 1RT1A 2YKNA 3V4MA 1AYEA 4Q44A 3OTDA 3LQVA 1MLAA 3TRGA 4UQTA 2GUIA 3UDLA 3KMSA 2IVOA 2JJ4D 1BU6O 2V8PA 1JWWA 1FJCA 4CBUA 2VHGA 1HWKA 3DHXA 3KLEA 4NX9A 4ZKAA 4B9LA 1HWUA 2VPXB 2BTFA 2JEGA 2K7JA 4J91A 3GG0A 5J2PA 3MR5A 2C1EB 1S6PA 3SSRA 5MLCV 2IMWP 3SJJA 3O9QA 1XQSC 4NL5A 4OPAA 3GL1A 4ECSA 4C4WA 4JI2K 1MW7A 3BY5A 3CE8A 3DGPA 2KKHA 3WX4A 2D9PA 3WUHA 5E3AA 4JKDA 4NO7A 4K41A 1UW4A 4OKJA 3PIPQ 1WOPA 4PXBA 3CIZA 3K0SA 4GV3A 3JTPA 1UEUA 1XR6A 3ENOA 4CLKA 4IDHA 3QFUA 2DK2A 3JSBA 4ED0A 2FZGB 5IT9Y 1Y11A 4PEOA 4EBDA 3KDNA 2RUGA 4C48A 3M8PA 1C6VA 3V81A 2A18A 1LWCA 1A9NB 1NK9A 2VKRA 5M2RA 5KGXA 4ZDNA 2NSCA 3N5BA 1RISA 3UDCA 4IO1A 4J2EA 1WG4A 1HPMA 4M8LA 3PW7A 4FWSA 4IQXA 2KH9A 3L6QA 4DTXA 4JKGA 1UEVA 3Q22A 1KVKA 3R3TA 2HHPA 3IR5B 3AO1A 3D4JA 3QT8A 4RO0A 1ZH5A 4QCLA 5L1LA 2KJVA 1NH8A 3AD7C 3QBXA 4WTYA 4UT4A 1JLBA 3AA9A 1SUQA 3G9CA 5JMNA 3FZMA 3EZUA 4DL3A 2GV9A 3QAUA 4DUZK 1VQPN 1ZM4A 5J2NB 5DLGA 3H5YA 4GVBA 2KG0A 2UXBK 2HMPA 3LM9A 3M30B 2FD2A 5D78A 3HCXA 5AZJB 3VGLA 3SBTA 2BANB 2XRIA 1H2UX 3A4TA 2HPUA 1N8RO 1RHKB 3CD7A 4Y2IA 2CPEA 4DTUA 1LK5A 4ANCA 2CQ4A 3OSPA 5ETTA 4WXOA 4JV1A 1NGBA 4ILHA 2V68A 2BDPA 5EWEA 5H9FJ 3NGSA 4PG5A 1NGGA 4LF5F 5JVGQ 3C2PA 3AGRA 1NJYA 2W7OA 3L3VA 3RAQA 2QIFA 3NCRA 2WOMA 3FEZA 4C9DA 1ZBIA 2OPQB 3TA2A 1LK7A 3TAQA 2Q0UA 4PKGA 2P9CA 2P51A 4KT0C 3CJ1A 2XI3A 4GKKJ 3DRPB 2F8TA 4FPRA 2HVHA 1P8ZA 4BR5A 2R8JA 3SYZA 3OHBA 3A8EA 1CJUB 2X78A 4HH0A 3M1VB 3M32B 5D6GA 5IOLA 3H25A 2HNYB 2VWKA 5E7OB 4CE9A 4CGFA 4LSNA 4USHA 4ZJOA 3SFGA 1AXQA 2W2OP 3KLIA 2FHMA 4M42A 2HVZA 4RW9A 1H1VA 3ATVA 4L74A 4DBQA 2PIIA 2KQ2A 1N5SA 1G3OA 1VQNS 1VIOA 3JAMY 2CQGA 1N56A 1KD1O 1UETA 4QS9A 1SQGA 4BDPA 2MQNA 1SJ3P 2YHWA 3DMJA 2MKJA 4U8YA 4C11A 1MROB 4JS4A 1VQ9S 1KS2A 4PXCA 4JOUA 2ZH1A 2FSNA 2VFSA 2V4JB 4USTA 4CNZA 4CEEA 1YI2N 4DR3F 2GEMA 2I6WA 2DR6A 5DS7A 5H9EJ 4HHHA 5CXTA 1X9JA 4ED1A 3OUYB 4PWWA 3J7YU 2WBNA 1FRKA 2KZMA 2E7VA 5LMUJ 4ED5A 1CQNA 1IKXB 1Q8BA 2HHHJ 1LCUA 3BN7A 2HVEA 1QVGM 1PIEA 3US5A 1VFJA 2WW8A 4OHVA 1HQUB 4FZZA 3FCWA 1VQ6N 2YNFA 5AT1B 2QWRA 2D3ZA 1L3TA 3WIVA 4USMA 3EZWA 4O3SA 2LA6A 3M6VA 2V6AA 3EUNA 3I31A 4KRFA 3WHIA 6FDRA 4HCCA 1B70B 1NGAA 1RLDA 3RB6A 3O8WA 4K4TA 4M7XA 4DCHA 1WD6A 1PYSB 3O9SA 4Z7YA 4CO1A 1PG5B 1NNDA 1VQOS 2YNGB 1REGX 3W5XA 4B9NA 2I7PA 1UCNA 4ID8A 2R8HA 4KHPJ 1OY8A 1QZ6A 2ZDPA 4ZJQA 2Y8YA 2XGQA 3GIRA 5AR0A 4JRPA 2UXCJ 4R8UB 2A1BA 1H72C 2BYCA 4YB5A 4DV6J 2ZITA 2V2VA 3TVZA 3L0QA 4LBIA 5DG8A 2O8BA 4KTQA 2OEMA 3KK1B 2QW9A 2DH7A 2ZZTA 3MMAA 2EWSA 1VHFA 1J5OB 2QLJB 3S3NA 4CJSA 5F1XA 4WK1A 3R1XA 3ULEB 3QFHA 4O0IA 4Q0BB 1Y3KA 3PIPL 1IBKJ 4FVCA 1WBDA 2DRBA 4KB1A 1IKWA 2ZH3A 4LF9K 3T1HK 4LBPA 1VAZA 3NBPA 4GRSA 3MMVA 1H38A 3W61A 4IRCA 1KAYA 1OH5A 3GE1A 3CCRS 2GNKA 1GLFO 4EGLA 4CIEA 5E0OA 3G4SN 2J7KA 3CMQA 3WC0A 4KHNA 2XQCA 2WVEA 2PFUA 3B8AX 4Z7CA 2P9KB 4EYIB 4F3MA 3DDNA 5J2QA 1BQXA 3M9NB 5HBMA 3N4QA 5DETA 1E6YA 4USVA 1T9XA 4OGCA 3LGHA 2QA4N 5GADP 4JI2J 2ZC4A 1Y5NB 3CJTA 1FX2A 2KTQA 4H5VA 2LQ8A 2JRSA 2O8CA 3M8SA 3R6LB 1HX1A 2VG5A 4Q8EA 3AB4B 2DRDA 3KLGA 4FF4A 2GQQA 2QMUB 2Y3YA 3A2FA 4YHHJ 4CEBA 4WFNQ 2Y1JA 1UVJA 1OQ3A 3W2WA 1AZSB 4WQ4C 5F8IA 1ZXOA 2VD3A 4CT9A 3IAYA 4BRDA 2XMMA 4CFCA 4JHDB 2BJ9A 4PR6A 4EHTA 4ICLA 1SH3A 4JP8A 5MAOA 4DQSA 2H3EB 3AVNA 4CEDA 2YNIB 3TQEA 2WONA 2O01C 3DOMA 1KCFA 5JVGL 1KTVA 2ZH7A 3W62A 1XMQF 4NCGB 3MEGB 4IRDA 4IQMA 4L73A 1SH2A 1WI6A 2UXCF 5IV3A 3FBCA 4L3QA 2MMYA 4DV6F 1YK9A 4CK3A 1BWVA 2W2PP 2UU9J 3QGIA 3KFWX 4JYAF 4ECXA 3LP0A 2DNQA 3IRXA 2DR5A 3KUHA 3OYNA 4DTMA 3DJCA 4CM0A 3WNEA 3J7ZO 4KHYA 4CJUA 5AQNA 1VQPS 3PR4A 3AAPA 1IBKF 1C0MA 4DUZJ 1R0CB 1U24A 3UNGC 3MOJB 3TTFA 2M7SA 1Z05A 4A61A 2PEBA 1RT2B 2LKZA 2XSFA 4NLSA 1DARA 4KHRA 2JC0A 2NXCA 4BRLA 2QWPA 1T3NA 2AT1B 3WT0A 4H4MA 3BS9A 1NSPA 3RYLA 2VG7A 4HVZA 1VRUB 4PQAA 2OLWA 3FCHA 1S6PB 2W8LA 5I42A 2VQFJ 3OYHA 4E1MA 3N4PA 3JB9k 4KGMA 3RTVA 2EFOA 1BCMA 4IG3B 2QK9A 5C0YA 3ONQA 3JSRA 2D74B 2ASPA 3QLHA 3ENVA 1F3VA 1D4XA 2GJIA 3Q8SB 5H1SQ 2XY7A 1SJRA 4JKHA 2OP5A 4C98A 3KLVA 4FXWA 3CCQN 1YAGA 4TNOA 4DPXA 5F0WA 2J7WA 3G87A 3ISND 3UW1A 3L2UA 3EMTA 3DXSX 1ZS6A 4JV5F 3Q24A 1HHQA 2DB1A 3BDPA 4NYPA 3EYZA 4BRFA 4Q2LA 2UUCK 1TU0B 1GAOA 3V81B 1TL5A 3NS6A 3T1YK 3QO9A 2BACA 5LL6Z 4F3OA 4O3OA 3NY0A 3IR7B 4UZBA 3MUVP 2CQBA 4OKKA 4BRKA 4MIWA 1O8BA 4J9LA 1C1BB 2ZE2A 3R8EA 4OPJA 3A8IA 1FRHA 2HLUA 3R8YA 4RWTA 4OI4A 2XLJA 4H03B 4YOVA 1TQLA 1N88A 4JI5K 5HRNA 1FK9A 4JI4K 2UU9F 4DV0J 4WFAL 2GV1A 2H5EA 4PWUA 3CPWM 4PAAA 4FNIA 1KHWA 4X2BA 1UWBA 4MO4A 3H08A 4OL8A 4O3PA 1JLCA 1KLMA 4H5RA 1S77D 1SQKA 2H5JB 3A0IX 1WSRA 2G1HA 2VA2A 1Y7PA 3OYAA 3NAHA 1IXKA 5DM7Q 1RCOB 2F1FA 2IGIA 1HR0F 4JKAA 3FR0A 3MX5A 3CGIA 1D8ZA 4DTSA 3MCSA 8ATCB 2A40A 2KXNB 4CHZA 4WFXA 1S9FA 4H4KA 2ETJA 4AE5A 1GLEG 1HW8A 3SDEB 4ZTFA 2UUBJ 1RGVA 3AOBA 2ASYA 5FLXO 1TUWA 2VBYA 3ETMA 1JLEB 1R8PA 2CPHA 4CJQA 3CVKA 1RT7B 1ATSA 5E33A 2AZ1A 1Q5VA 2YWKA 1T03B 2CJ9A 2RIJA 1HA1A 1G1XA 1NMNA 5A8RB 1T6CA 4J9PA 2ZHBA 2LSNA 2C2ZB 3H1VX 2MDAA 1VQSA 5B0AA 3OYLA 2RD5C 3NF8A 4KYZA 5IT0A 3QFPA 3VQ5A 2RT3A 2MZQA 5FDLB 1P6TA 1N6QA 5G0RA 4JRQA 2EG1A 3R6GB 4HHJA 1DAXA 3NP5A 4B9UA 4RW9B 2G1DA 3AO5A 4CJ5A 3RMDA 4AM7A 2V4QA 1TFYA 3PFOA 2Q43A 4EYHB 2O3DA 3WXMB 1U1MA 4PKDB 2O8EA 3TUJC 2NLXA 1H74A 4RG8A 4U95A 4DX7A 2FVSA 2BJ8A 4OZ0A 4I4BA 1G4CA 2F4VK 3SCLE 1HNZJ 1YLXA 3GDQA 5J1EA 3UE5A 4DR2J 2VGNA 2R7TA 3QIPB 1DQ9A 3ID6A 5GAEU 3RBXA 1J6ZA 4DV0F 4M3YA 5L8RC 1FJGF 4G65A 3F73A 2NNWA 3HSJA 3J80O 4FJ7A 5AQGA 3K17A 4ZVPB 1VK0A 4QIVA 1UA1A 4KHMA 2CPFA 3ZC4A 4CZKA 4FLTA 4CF1A 4OLPA 2H3GX 2AJFE 2CKWA 4ZP9A 1W2BR 4UZCA 2CQHA 2YWWA 3F44A 4IOCQ 2MY7A 2PA8D 4BWJA 4KKOA 4RU9A 3M4XA 3SI6A 4DR3K 2CIMA 3Q23A 1PYTA 1XI1A 3CCUN 1PBUA 3V6KA 3NVKA 4DSKA 1WG1A 5LL6d 4CJ3A 2IYIA 1R31A 3HOTA 4DPTA 3QIOA 1H6KX 2ZBIA 2BZ2A 4N8OA 2UUBF 2VWJA 4IEIA 4O55A 3N6MA 2W9CA 2ROEA 4V19S 2F65A 2XB2D 3C7NB 3CDWA 3H98A 3VAKA 3L7UA 2IDOA 2YHBA 3OPKA 1HNXJ 3OBIA 3NMAA 1PILA 2GTDA 3PO4A 1R7IA 4EZ6A 3RB0A 2KB2A 3K89A 3MWPA 2PFFB 5KFNA 3P3DA 5JVHQ 2YKQA 3NOCA 1KOOA 4I7FB 3PYEA 1ZTWA 3C6TB 3AJ2A 3LPEA 4O0NA 3TYTA 1VK8A 1F2HA 3VGUA 1KQSM 2ALYB 4YOEA 1UA0A 4WU2A 5C2GA 3DCAA 2LP4A 3H5XA 4GO7X 4X84A 3HI0A 1YWXA 3PACA 1HNZF 3OVBA 3IKMA 1WC5A 4DR2F 4RCHA 1GLJO 2LCWA 4HT7A 4KY3A 5CCLA 3VWSA 2Z30B 1EB0A 3HSDA 4DV4K 1RAJA 3R7BB 4JB8B 4OYZA 3NF7A 4EHUA 1ZBUA 2WC9A 2CQIA 3L2QA 4E2FB 2X6NA 2V52B 3N0VA 2AJ1A 4FS2A 4MDAA 5DZ7A 3GJRB 3O8MA 1YF5L 2R42A 2MKIA 1M5HA 4OJ1A 1PJ7A 4AL6A 4RW6A 3ZXWA 3CCQS 1ZA2B 3P31A 5IQQA 3QPIA 2W41A 1SL1A 2Q36A 4I9LA 1S1UA 2CXEA 4DF8A 4F7VA 1R8BA 1TYQA 4YUDA 2I1RA 2FLLA 1RTJA 1VIXA 4KH6A 1S79A 2Q79A 5C24A 3BEGB 3CO0P 5HROA 2OZSA 2UUCJ 5DGAA 5A8KB 1VQ4S 5F8LA 4FN5A 1PKUA 5DDOC 1NPKA 3HULA 1H2TZ 3PM9A 4FJHA 3DOMB 2XCAA 2VF3A 3ILOA 1HYZA 4YQWA 3S7RA 5A6WA 1S3XA 4KFBA 5KFWA 3IDHA 2G0JA 1RE1B 4MMOA 2AX1A 5DLFA 1LFPA 3KG4A 4DXLA 1HRHA 1NCLA 3BKTA 1HPZB 4PA1A 5CHIA 4BBYA 2CUYA 2U2FA 3ZZYA 2BA9A 1S9GB 4XIUA 1XK8A 3IUCA 3P4IA 2R7UA 2VG6A 1TK0A 1N5YA 5LSRA 3TZWA 2DNLA 2QX0A 3MWTA 3Q2SC 1I39A 1CXUA 5KFKA 1DTQB 3OYGA 3A1YG 3J7YP 2YX1A 4NLCA 2O8DA 2A6OA 1IWGA 1TK5A 2MQ8A 3CCWA 4B1VA 3J80U 3FDSA 3OFGA 4OX6A 1WOQA 1Q0NA 3LP2B 4FF1A 2I2YA 2HAIA 4C3KA 2VA3A 3ZTOA 1B9FA 5GMDA 4YOYA 1XIQA 3MEEA 4FYYB 1S10A 1K44A 1RADB 3POTB 3HXMA 5CYQA 2Y1IA 2PBDA 1EX8A 2ZJPQ 2JH3A 2BE9B 3KYLA 1RDBA 2R2TA 4HVJA 3V6DB 3QT7A 1HNVB 2CJQA 3PX6A 4ZLPA 3OYBA 2HQCA 1KFSA 3BREA 3NNHA 4QJVA 3H6EA 1EWQA 3GFZA 4IOCL 2YNHA 4CZCA 5CE3A 3GFXA 3D28A 1X5PA 2AYBA 2D69A 3I0SA 4QIWD 3CJ3A 2EI5A 1BQMB 1IBMF 3D7EO 2DYAA 1DURA 5I3PA 3GCWP 1QSLA 1APSA 4PXDA 3DRSB 4DTJA 4LF8K 3QYYA 1Z2LA 4Y2CA 1ASVA 1LXJA 4AUKA 1CULB 3G96A 2EBGA 1JL1A 1VQ7N 1XR5A 4DL4A 3UKRB 4M94A 2EK1A 2P9IB 5C2CA 3D3CJ 7AT1B 1H0HB 2A6AA 4X4QA 2OH2A 3VESA 2HURA 2VWBA 4F0KA 2QLBB 2IMOA 3D7SB 3BPDA 4OI6A 3VQPA 3O08A 3MR7A 5GAGI 4BR7A 3TWHA 1QSYA 3PYDA 2UVRA 1NJZA 3BSNA 4BCAA 4CVNE 2H1YA 1FXLA 3OL6A 4DFKA 1RHQB 1VRTA 3EPGA 4OJGA 3FBFA 3PUFA 2QM1A 2LA4A 3MX2A 2QYCA 1B0PA 3VZHA 2ALZA 2QEXN 1HI8A 1YT3A 1FKPA 1JLQB 4G9ZA 5B0FA 1GLAG 2X1AA 1O13A 3CM5A 5THWA 1S72S 2ZJRL 4LSLA 4QYZJ 1S48A 2B4JA 2QN6B 4DTNA 3VALA 4IKAA 5HI7A 2IVPA 4C3MA 2IM1A 1M5OC 4JNEA 2PD1A 4JBCA 5CZXA 3PY8A 3CC7N 3ILIA 2CQ1A 1FNOA 3NCPA 3ZSWA 3QIDA 2HK2A 2HGMA 4FJIA 4OX8A 1QHAA 4LFAJ 1JLFB 4ZCLA 3QNWB 4K5RA 2KYZA 4ZPDA 1QQCA 4JS5A 3RUBL 3VQ9A 3V9XA 3D1QA 2QWOA 5A76A 4IJAA 3GBTA 3I4HX 5F8JA 5JJBA 5KG3A 2KXHA 1X9MA 4YMEA 4NOHA 3AVAA 2DXFA 4LQ9A 2ATQA 4Z4GA 4XK8C 3DDKA 3VGKA 3ZEUB 1V6HA 1WAJA 1FA0A 5LJ3Y 4YDDB 3TSQA 3AVLA 1JXVA 5A2QO 3BBCA 4ECYA 2LECA 1NK4A 4CFBA 2F7TA 1FXDA 1C4CA 4P10A 4DV4J 4BRMA 3FJ2A 2GAGC 4ED7A 2LDIA 2YX7A 4F67A 5CH7B 3WEEB 3GG1A 1BHNA 1WC4A 2JGUA 1JK9B 2FF6A 5CY4A 2WVCA 5HRPA 3EICA 2AMCB 2BJ3A 5SZTA 1D8YA 1N33J 1CEZA 1RT6B 1W0HA 1NZ8A 5D4PA 1FJGK 3RRKA 2KKZA 3QEIA 2ZBCA 1JCEA 3DLGA 3CDUA 3LDSA 3E9PA 4LRCA 3R7NB 5KI6A 3VZIA 2ILZA 4U6PA 2DPJA 3RSEB 4HEA9 1IQZA 3WXIA 1F9FA 1BHLA 1QAXA 3MAQA 4CGDA 1J53A 1Y5IB 3VAFA 3S6EA 1X4GA 1XMOJ 3EGNA 2CJKA 2ERRA 3KG0A 1M90O 2IM0A 3BGRB 2NCKL 2CDRB 2E1YA 4AQYF 4ECRA 5C2FA 3ZTPA 5HO4A 5M1KA 2E1RA 1X3NA 3TAFA 3IG1A 1KR4A 3SQ4A 2QGFB 3TX8A 2VASA 1A6LA 3ZT2A 1RAAB 2W6LA 1U0HA 3VVTA 1HBOA 3CJ7A 4FXVA 5BRFA 2ABYA 3W7BA 3SAGA 3AVHA 5CYMA 3AVMA 1FKOB 2A2CA 4RPFA 5IC6B 4WP3A 2KXFA 3GYNA 3KHRA 3TQ1A 3SCJE 4K7QA 1NDCA 4WCEQ 2FC8A 2B5JA 1O51A 2ZHAA 2EBEA 1C0GA 2WTUA 4LF6K 1GXLA 2H48B 2P9UB 4PKHA 1WUUA 5JICA 1HJRA 3H5SA 2HNZA 4EIAA 1XNRF 3GJQB 3MM9A 3UR0A 2F5GA 3HF5A 2X51A 2FUG9 4LFCJ 3AVBA 2IS3A 2RQMA 3KHHA 1VSEA 5KFXA 2D9OA 2DISA 4H0VB 1UPPA 1D3WA 1YDLA 2HNDA 2VBWA 3L7OA 4N56A 2E5HA 4DFMA 5HSPA 4KBOA 4V19X 1GT8A 4FKYA 1R0AA 4O44B 1XWLA 1KTQA 2C3PA 2P1JA 4YB1P 2YH0A 1X8DA 3T6BA 3VQAA 3DI6B 2XSJA 1OIAA 3PFEA 4FJ5A 1S0MA 1ZAWA 4CGIA 3AXMA 1N32J 1WC6A 4CZGA 4BDZA 2CAJA 4CIGA 1HBNA 1N33F 1VCTA 2KJWA 4RZRA 2HRUA 3KLHB 1KDNA 1UVLA 5FIIA 2H54B 2V0NA 4HACB 3BR8A 1AT1B 4FJXA 2JWKA 4OYOA 1SKUB 3TTDA 2JWNA 2RRAA 1NJIT 1RTJB 2IYGA 1H73A 4URQU 4E7KA 2BXJA 4ELVA 4NLUA 4UOFA 4G1QB 4DR1K 3HHLA 1XMOF 4NMXA 4ZOSA 1SV5B 3HSTB 1VOMA 3C15A 3UDVA 2MQLA 1NJWA 5LJ5Y 4W5RA 2Q3PA 4A8SA 4OX7A 2NPIA 1FDBA 2E1PA 2DHXA 3IC1A 3HO1A 4M5DA 4DSEA 2ZH8A 4LF8J 3C46A 2QWQA 5HLFA 3KK2A 3EM1A 1MA9B 2VL1A 3L4BC 4LH4A 4BRQA 4IFEA 1ZBLA 4BRPA 3UIQA 4P7TA 2D41A 4FPAA 3M2UB 3OFHA 3OL9A 4ETZA 2GVZB 2Y1LB 3BZQA 5BJRA 3UKUA 4NZ7A 3TWZA 2KM8C 2Z1IA 1G6BA 3CUNA 1NPRA 1UL3A 2BM1A 1Q9YA 3EDQB 4O23A 4KO0A 1K0VA 4LFCF 3DLBA 3TAEA 3ISNC 1ILYA 1UMJA 3D2FB 4EBCA 1YJUA 1JX4A 3Q8QB 4CK2A 2MJUA 2CNNB 4K0KJ 4WZMA 2V2QA 3MXMA 4FBTA 2VOPA 3WX8A 5AE2A 1VYAA 1HIYA 2BJEA 2QEXS 2QSFA 4FWRA 2UUWA 4KH0B 3HHNB 2PGCA 1WSHA 3P49B 1I5OB 2EK6A 1Z26A 3M1FA 1PAEX 5M2UA 1KAZA 3G82A 1JQGA 1R8AA 2W4DA 2IM3A 3Q86A 2ZD1A 3MEDB 3HJFA 2DEIA 1NRKA 5CYJA 1K8AT 5FROA 3HLUA 1S1XB 2VIHA 3PSFA 4MKVA 2XS5A 3ZZOA 3THXA 4AHUA 1NBWA 3CJSA 2RE2A 3I0SB 3KNGA 1QY7A 4OJRA 2RKIA 4RW8B 1OWXA 5AQOA 3OR1A 2NQPA 1FDAA 3PRVA 2OPSA 1SL2A 4DU8A 2ROGA 3HHDA 5D4LA 3GB0A 3VQEA 4YR0A 2HZVA 1Z1ZA 1LWEA 4CZFA 5F9NA 1C0TA 2R7YA 2HHTA 1OVQA 1TL3A 5JMVA 3ISZA 2VGMA 5I3QA 5KFZA 5CD4A 2P9NA 1MWZA 4JI1F 2V7ZA 1GQEA 5AXNA 4TY8B 3L8BA 4E7HA 1GLBG 5AQMA 2IC3A 3FSYA 4B1WB 3O6WA 3H3OB 4CIFA 2DRAA 1Q86T 1FDNA 4OJHA 4OZ1A 4X4UA 3SQ2A 5C25A 4KTWA 3AODA 4I6MB 4LSZB 1H2VZ 1VS3A 4DTPA 5DGBA 3R97A 4M7YA 2HHUA 3HZEA 2OTLN 1Y00A 3ITHA 2QC3A 2LDYA 1SKSA 1QE1A 4H5NA 3GE9A 1JIHA 3UCGA 4WCEL 3R9PA 2AKWB 3D2EA 3EE8A 1UPMB 4NA1A 4GMJB 2IPOB 3W2VB 2Y8WA 1SC1B 4DX8H 3NGZA 3AO4A 2KHDA 3W8PA 4RNFA 5ETSA 3IMXA 3N5FA 2P6TA 5GAHI 4FJKA 1HBUB 3RWUA 2YQ3A 3MN6A 2ZOGA 4WIIA 3TOQA 4QR1A 5IT9O 4NLWA 3BF1A 4CBWA 3QEPA 2W42A 3LF0A 4DUYK 5KG7A 5MLCQ 2BW7A 1N0UA 1QJHA 2VODA 3U1NA 4ZVOB 1HLWA 2EEYA 1D09B 1WOSA 2GFFA 2GJFA 1W7AA 2X74A 1YJWN 4RNMA 4U7BA 4F2SA 2MZJA 1NM2A 2RN2A 2C3UA 1BA1A 3LPUA 2V4RA 1M1HA 3LWMA 3M9OB 3JXOA 4CD3A 1I51B 1PYOB 4DOZA 3OL8A 4NZ6A 3DLKB 2E88A 1RILA 1NOYA 1OKJA 3FLCO 3QNOA 3PX0A 4DKWA 5ETLA 2OELA 4DV2J 3J7A1 4CLLA 4LF6J 4C8LA 4NASA 3MCOA 3KKRA 3LP1B 3ZTSA 3IGVA 4A48A 1FT8A 4B3SJ 3F41A 4P71A 2DHSA 3MXHP 1JJ2R 2E5LF 1LOTB 1JKHB 2XMVA 1RI7A 3W63A 4ZMMA 4NLRA 4NI2A 1TVRA 3F56A 4B1YB 4DU3A 3KNAA 5BRDA 3B6BA 1X1PA 3O1LA 3E1YA 5BYQA 4B17A 1LAVA 1S0VA 4ZN1A 4CLZA 2HG4A 3W64A 3W66A 3JTNA 3MI7X 4AYBD 3KLFA 2MHEA 3NS7B 2YX4A 5AXKA 4NCAA 4ECVA 3V6HA 1HNIB 2IAJB 4UOHA 2KDOA 3J80Y 1R6YA 1VSKA 3JXUA 2E6LA 3KUEA 3QJPA 2JVRA 3SK3A 3Q8RB 4IEEA 2AP6A 3DOKA 3PR5B 4TY9A 4DQIA 2YBVA 4QW8A 5JLHA 3VTHA 1TL7B 4HH1A 1IR0A 1SC4B 3JSYA 2HEKA 3HRGA 1V9OA 4AM6A 2ITGA 3MAAA 1HI1A 1PO6A 4E8UA 3H90A 4ELTA 1IV0A 3RB3A 4OX9K 4U8VA 4QOZB 3UQSA 1YJRA 1JB0C 3B6PA 3QDKA 1ZM2A 3CC4N 3HD2A 3FNNA 4L75A 2IM2A 1ASWA 4CYUA 3FVYA 3BPSP 3NNAA 3C65A 1UTAA 2XEXA 4X4NA 1Q82T 5C15A 5BYSA 1S6QB 2GZOA 2M2BA 1HKAA 4A5BA 1FDDA 1X5OA 4GMKA 1B4SA 3SNNA 1DLOB 3AARA 3M7VA 1H7XA 2FHJA 3AVKA 2XS7A 1JJCB 2V63A 3G0ZA 1X9SA 1OY9A 2YXLA 1RTHB 3G8TA 3OYFA 4FWPA 4J9OA 3CYMA 5E3CA 4AQYK 4ZCMA 2B51A 4DX6A 5F2RA 1XNQJ 3EXCX 4W5OA 1NK6A 3NGYA 1OH8A 2Q31A 3MD1A 2CPIA 2V8GA 1K6YA 3UO0A 3IFEA 3TW0A 1OS5A 3GLJA 4R0JA 4DV2F 1K8KB 1NHKL 4ILRA 1LWFB 2HNZB 2KYXA 3NGIA 2FC0A 1CLQA 1CJKA 4J9NA 2AYEA 5C10A 3ILLA 4QU6A 1RTDB 1OPIA 2XLIA 2GX9A 5KT2A 5HRRA 2MZRA 5KOXA 4CGHA 4AT1B 2R8IA 1Y9OA 3I0RB 5AJ3F 4PYDA 1VSJA 3THYA 2V8HA 2JL9A 1U2CA 2P9LB 3CETA 3N6NA 2EFNA 2BKNA 2ATCB 1K9MT 4BE1A 1RDWX 4YY3K 1GXTA 2LLZA 4DB3A 2RVJA 3D0HE 4DV7J 5K8PA 3R3LA 2DR7A 2PN6A 2OCEA 5M1OA 2JFDA 3I5BA 2FBXA 4F50A 4YS2A 1PBAA 2MY8A 4W4MA 4B3MK 4LUBA 3EPIA 2AYGA 3BH7B 3R7SB 3QINA 1FWPA 5KFIA 1FJ7A 3A12A 1Q8LA 1E4GT 4P2XA 2J9DA 4DQPA 2HVIA 4HI2A 3EVWA 3D6TB 1ATNA 3P5JA 3OYCA 2VQEK 2DTJA 4F25A 4QWAA 4J7CA 2M8HA 3CD5A 2UUAF 4F4KA 2M8DB 4QOTA 5BREA 1VQ5S 3ENHA 2B3TB 2K1RA 3JSMB 5DDPC 1M1KO 5LY3A 3SQOP 2NRWA 4U67Q 4LC9B 4QAGA 5J2MB 4I56A 2AYMA 1NUEA 4R5PA 3AHPA 3WQPA 2OSRA 4EU0A 2RRNA 3EE9A 1HNWK 2JNJA 2E2PA 3MXJA 5BPNA 4BGAA 4C97A 3I96A 4IKFA 3EVOA 1FD8A 4DHVA 2YWEA 3TX0A 4QS7A 5BN8A 1RXOB 4FLXA 3DLLQ 2F8MA 3R5AA 1Q81O 1VQ8S 1TAQA 3CD6N 2Z1GA 4F4WA 3SFUA 1BA0A 1XNQF 5LXYA 3THPA 2AJ4A 4ZVEA 4DEZA 4DV5J 4O5FA 3JS9A 3B4DA 1EX4A 4X66J 3BR9A 2MPUA 1SL0A 3IAS9 1VC0A 4DU7A 3W9IA 3MM7A 1HW9A 4H0XB 2OTLS 1NXIA 4F4YA 2XCPA 4B3OA 3CB4A 1VQMS 2CGLA 3PVXA 8AT1B 2EW9A 1WSEA 4ATNA 5IWAK 3D5MA 5DJBA 4TU7A 2HGNA 2BJ1A 2J8SA 3NS5A 3BBBA 5A0YA 2P9SA 4U96A 1U1RA 2AHOB 4H0YB 4KI6A 4EMDA 2O67A 4DV1K 2GQCA 4DR7F 2A41A 4XTTA 4DV7F 3C6UA 1RCHA 2ZM6K 3ATUA 1U1KA 2LEBA 1RCXB 4PL8A 1TL1B 2C3YA 1VQLS 3T7ZA 1IBCB 3A3NB 4TYBA 2XTJP 2AGPA 2ZKUA 4P2FA 4DUYJ 2OUGA 3MM5A 2UUTA 2LMIA 3LAMA 3AB2B 2OD6A 4P6QA 2CQPA 3O3LA 1YJWS 3BGUA 3IS9A 4CLPA 3HVTA 3MM8A 1KXPA 1SQEA 3OXFA 4PY5A 1VRQC 2QV6A 1FO1A 3N01A 4K4UA 5GAGU 2P8IA 4IYQA 4CH1A 4CGGA 4CT8A 1RT5B 1AROP 3ENAA 2KM8B 1FESA 2AD9A 2KVQE 4WIQA 4O8KA 2OPSB 1ZM3A 2EVZA 2Z2ZA 4Z37A 4H0PA 3LAKA 1WTBA 5TKYA 1IJFB 3ZSQA 4RLEA 4YOUA 2QTDA 4NXMJ 3BYPA 3PKYA 5F8HA 2K06A 4TU9A 4DQRA 3OYEA 4C6AA 3CCSN 2CG4A 1S6OA 4DF4A 2NRTA 1S1VB 4GVMA 3LOUA 3DXKA 3CQXA 1F9HA 4PXEA 3IP0A 4BQZA 2MZTA 1T95A 3QZ8A 4DV5F 1DRZA 1Y0HA 3ZNUA 2C2EA 3V1OA 5C42A 3R9LA 1I94K 1K0TA 4OJ3A 3OW2R 1SC6A 1ZBFA 2YWHA 3VF4A 1GMWA 2EPIA 4QBUA 1HQEA 4JI1K 2IVNA 1YITS 1U09A 1D0EA 3BBFA 2ASJA 2NRZA 3DAWA 2HS4A 1F0XA 3H8YA 3D2EB 1VSMA 2VZ9A 1BWEA 2HWIA 1U1QA 4DV3K 3AAQA 3MMCB 1L3UA 3AQPA 2D0AA 8RUCA 3NFAA 5B0CA 2SXLA 1V3ZA 1Q9XA 3FBBA 3CC4S 4NPOA 2GHWA 4DR6J 3I9V9 4N76A 3EVMA 5KGWA 3QGGA 4E0DA 4IJNA 2V67A 2C28A 2W25A 5KG2A 3H0PA 5BPMA 1KQKA 3T5LA 3EDRB 4YOTA 5ETRA 5AQHA 3LH2S 1YHQS 3U1LA 1FXRA 4DCPB 3QWPA 1PC5A 2KFZA 2VUGA 3C16A 4JI0F 3QRPA 4OYMA 5A8WA 4YEAA 2G0IA 4BR0A 4K4ZA 1FHTA 2FLNA 1YIJN 4CBXA 3G6EN 2XHWA 3FZKA 2E4LA 3VMFB 1BXNA 3I56S 4A2AA 5DK5A 1HBMB 1VHXA 2V8DA 3IXQA 2NYHA 3A13A 4NXMF 3AGKA 1J9AA 5HP1A 1DTTB 2KT3A