3DMJA

Crystal structure of hiv-1 v106a and y181c mutant reverse transcriptase in complex with gw564511.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 142
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dmjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dmjA05
1ASWA 3CDEA 1ASUA 4F4YA 1RNHA 4K4TA 3VQ5A 1LWFA 2IC3B 3GQCA 4OLBA 2IAJA 1IKYB 4O44B 3P1GA 4M3TA 4IFYA 5KFMA 1XC9A 1JKHB 3KLIB 4RW8A 4AHSA 4H8KA 3BGRA 3SUOA 4MK9A 2RF2A 5F8HA 4FYDA 3I0SB 4YR3A 3AVBA 2VG7B 3H5XA 2OPPB 1JXBA 3CWJA 3H59A 2G8UA 1C1BB 5HBMA 3QYYA 5L1JA 3DLRA 4EBEA 4CHQA 4KB0A 3KK2B 5HLFB 1TKZB 2IMWP 4EBCA 1CXQA 1C0UA 1SL2A 2YKNA 5FROA 3RMCA 3RMBA 3KMQA 2BR0A 3CJ0A 1C6VA 3NHGA 2CKWA 2RN2A 3LAKA 2Z1GA 3AO3A 3SPYA 4FJJA 3DLHA 5KT4A 4HCCA 3OS0A 4PUOA 3OYJA 4HUEA 4O4RA 2R8IA 4NLGA 4MKAA 3OYDA 4DSJA 3PHEA 4JRPA 1NHUA 5HP1B 3CFRA 4FJMA 3NGIA 2KQ2A 1QAIA 4K4XA 4J2DA 1BIUA 3HVRA 4O5BA 4FJ5A 1NK9A 3Q8QB 3H2LA 1VSHA 4E19A 1S6QB 4LSNB 4CJQA 4IOBA 3G6YA 1S1XA 2JEJA 5F8LA 3GIJA 1RT1B 3AO4A 3DLEB 4CFDA 2HNDB 3H08A 2E9TA 3NF7A 1UA1A 1S49A 5F8MA 4K4YA 3IRXB 4IFVA 1CXUA 2WTFA 4ECSA 3VQDA 4J2EA 4DFKA 4FK0A 4ELVA 4DF8A 4ZP8A 1REVA 2YNGB 4KO0A 4IFVB 4CEQA 4KB7A 3PX4A 3RBDA 1NK4A 1C2PA 4FW1A 2BE2A 3CG7A 3DDKA 3FSIA 3AO2A 4C8NA 4I9QA 1HQEA 1T03B 4ZP6A 1JLCA 3ULDA 1U04A 1UOCA 1NK0A 1TKDA 3PW2A 4H54A 5KFXA 3PW4A 2KW4A 2CJQA 3QETA 4EO6A 4E89A 2XI2A 3UPFA 4JV2A 3NGZA 3T19A 3MR5A 3RR8A 4DSLA 1VSKA 4CERA 2EC0A 3QGGA 1TKTB 3OL6A 4CF2A 2KTQA 2ILYA 1S9EA 1RT7B 3I5CA 1S6PB 3AVCA 4ECQA 2RKIA 5T14A 3DLBA 4KI6A 2IJNA 4NYFA 2FJXA 4PQUB 4LD0A 5C25A 5J2PA 2V4RA 3RB6A 4KHYA 3I8DA 2ASLA 2VG6B 1N6QB 1BQNA 3GIMA 1YTUA 3AVHA 1T8EA 2FBXA 3FFIB 2FVPA 2XY7A 5KT6A 4KFBB 1XR7A 3NH1A 4FJIA 4DQSA 4XPCA 3E01B 2FLPA 3V4IA 4M3ZA 4YQWA 4DG1B 3N6MA 1A5VA 4QCLA 2FLLA 4NLQA 1I6JA 4WXWA 4U7CA 1VRUB 3AO1A 3RAQA 3S3MA 4OJRA 3C6UA 1FKOA 2XHBA 4DSKA 3V9SA 1X1PA 2AGPA 3ASMA 4HUGA 1RT5B 4J9PA 2JC0A 4XPEA 3QEIA 3V6DA 3SYZA 3TAMB 4JS4A 2V0NA 3SUQA 5KT2A 4F50A 3DI6A 2YNHB 3G86A 2XY5A 4MK7A 3BQ1A 1BHLA 5KG7A 4B8CA 3I5BA 2EX3A 2J6TA 3BQ2A 4F8RA 4R8UA 4E7JA 4I2PB 2OPQB 3ZSRA 1LW2A 4FJNA 2KFZA 3B6OA 3L8BA 4CESA 1WSIA 3OL7A 2IA6A 4CJ3A 2ASDA 3CM6A 4JUZA 5KFFA 1WSFA 2JEIA 2HVIA 3OL8A 1TAUA 2IBKA 3KK3A 3OYEA 3T1AA 4CF8A 2D0BA 3V9UA 1DTTA 5KT7A 4CHZA 1KHVA 1I39A 1HYVA 4DSIA 4DSEA 3GIIA 2BANA 5I3UB 3PJWA 3DYAB 2OPSB 5KG3A 3GV8B 2ATLA 2E4LA 3AO5A 4O3PA 1MU2B 4FM1A 3BR9A 5DMRA 5T7BA 3CO9A 1RTDA 1RA7A 1KVBA 4NLPA 1QE1B 3H4BA 1GOBA 4DF4A 4FBTA 3H40A 4WZMA 1CSJA 2OPRA 2F8TA 2I5JA 4K4WA 1WSGA 3OLAA 4EP5A 2QK9A 3OJSA 2XI3A 5KFGA 3IG1A 4TY8B 1ASVA 4URQU 5KFHA 1VSDA 1IG9A 3ZT0A 4Z4CA 3D5MA 3MAQA 4ZP7A 4QWBA 2W9CB 5KFEA 3IS9B 5C42A 4R5PA 1FK9A 4KPYA 4IRDA 3AVJA 3DOLA 3MEDB 5KFJA 3MXJA 1W25A 3NAIA 4R0EA 4OKKA 4E1NA 3IAYA 4JS5A 3V81B 2FVQA 4Q0BB 2ZQBA 4LSLA 3KD5E 5DG9A 2B6AA 5K14A 4WE1B 4CF1A 5EWEA 4L8RB 3TARA 3NDKA 4DTMA 4ZTJA 3HVAA 2ATQA 3ALYA 1TV6A 4CJTA 5KTQA 4CEEA 4Q43A 3PO4A 4RW7B 4ED2A 3KJVB 3DRPB 1HQUB 2YKMA 3KHRA 2YNIA 1S5JA 4FLVA 2G8VA 1BGXT 1L3TA 3NBPB 1JXLA 4PWDA 1KFSA 3GV5B 3MFIA 4NLUA 2YKMB 4DTJA 1HNVB 2BQUA 2HNYA 3DLGB 2X6NA 5HRPA 2VA3A 2FJVA 3DOKA 4BWJA 5KG6A 5KFYA 3PO5A 4G1QB 2B43A 4BDZA 3PVXA 1RYSA 5HRSA 4DFMA 3PY8A 4DWIA 1B9DA 2HHTA 2YNFB 1NKCA 5F9NA 3KKRA 3RBEA 4BE1A 1S1VA 4FJLA 5KT3A 1HPZA 4ED8A 3LZIA 4HTUA 4MQ3A 3O4NA 4DFJA 1LWEA 3PZPA 1RT2A 5KFUA 3OYGA 4CFCA 3HP9A 4DL7A 3UIQA 4MK8A 1HMVB 1QSYA 5KRSA 2WONB 1S97A 3ZSXA 5CYQB 2ZD1B 3LP1A 4WXOA 1JLBB 3SFUA 2ASJA 3AA2A 1C0TB 2IDOA 4ECZA 3OS2A 4OKEA 1A5WA 4CEAA 3K5NA 3TI0A 4HHTA 2R2SA 4CJEA 3QO9A 1FXXA 3DM2A 1FKPA 3NMAA 1TL3B 4ZPAA 3CFOA 2FVCA 3M9OB 4ZPDA 4DL2A 3EY1A 3NAEA 2B5JA 3FQKA 3KHHA 3SQ0A 2KZMA 1Q8IA 1C1CB 3PUFA 4AHUA 2GBZA 1JLEB 5FDLB 3ZT3A 1ZETA 1J5OB 3TANA 4W5OA 1X9SA 2D3UA 5J2QB 2UVVA 1B9FA 3QEWA 3RB3A 1RTIB 1ZYQA 2GIRA 3Q8PB 4Z4FA 2QXFA 3HKWA 3CIZA 1ZTTA 1WAFA 4DS4A 3OS1A 4B9SA 4LQ3A 5KFKA 2OZSA 4ZHRA 4FZYA 4TN2A 3VQ4A 2QE5A 3HP6A 4IR1A 1EKEA 4ID5B 1RT6A 3O3FA 1JXEA 1NOZA 3UDLA 1DTQB 4Y34A 1NJYA 5DK5A 3ITHA 3KLGA 4HYKA 2J6UA 3GV7B 4CK3A 4FVMA 2P51A 1EX4A 3VQ8A 2QKBA 2W8KA 3EPIA 3JSMA 3KLGB 4E7IA 3RRGA 3QGIA 3V6JA 5J2MA 3ZSVA 1RCHA 4CK1A 4Y3CA 1RBTA 1L3SA 4ZVEA 4CK2A 3KLEA 4Z4EA 3VQAA 4B3OA 4RUAA 3TAGA 2Z1HA 4XIUA 3TR8A 3AVKA 3VQQA 3ZT1A 4CF0A 4J9SA 5KFIA 4KAIA 4YFUA 3AA5X 4CJKA 3SNNA 3OY9A 1JX4A 1S1WA 5CYMB 3T5JA 4Y1DA 4WZQA 2WB4A 1RBSA 3H98A 3BSOA 5I42A 4RZRA 1GOCA 2FJWA 3NF9A 3AVGA 5SZTA 4FK4A 4ZVGA 1LWFB 3N6LA 1GOAA 1VRTA 4NLWA 2IAJB 4IFYB 3THVA 2EHGA 1EETA 1UWBA 4RW8B 3S9HA 2HHVA 4ELTA 3BGRB 3ISND 3V1OA 4Z0UA 2RF2B 5J2NA 1T94A 3L2UA 3NGDA 3MEGA 2BDPA 3QZ8A 4O0IA 3M9MB 4OLAA 5HROA 5HBMB 4NCGA 5KG0A 3C6TA 4N47A 2WOMA 3CJ3A 1XR5A 1C0UB 4EO8A 3K58A 2YKNB 4ED3A 2DPIA 4FZXC 3VN5A 4FJ9A 4Q45A 4JV0A 3SJJA 4KSEB 2R8HA 1S0NA 3AVLA 3BJYA 4J9KA 2IM0A 4EBDA 3V9WA 4WFYA 4DQPA 2IJFA 4CCHA 2BGGA 4C8KA 1HNIA 4I2QA 3N6NA 1D0EA 2UVUA 5EUHA 1T7PA 4IRCA 4PUOB 3K5MA 3MTKA 1RDAA 3AVNA 4DSFA 1QUVA 1BI4A 4CE9A 4FLTA 3H5SA 1JLQA 4CEFA 2OZMA 3OVNA 1JLFA 4O4GA 2R2RA 3IGVA 4O3NA 2VWKA 1OS5A 4TYBA 3SV3A 1GX6A 5DLGA 5DQGA 4Q44A 4W5RA 3HHKA 1ZTWA 1S1XB 2AX1A 3MECA 5DQIA 3NGYA 4NLVA 3LP3A 3B6PA 4OKJA 3H4DA 4Z4IA 2FVRA 2KZZA 3OHAA 1GX5A 1MMLA 1REVB 2FBTA 4KO0B 1RT3A 1RT4A 2BE2B 3UQSA 4Z4HA 3LP0A 3LPUA 4JLHA 1HQEB 2UUTA 2XWYA 1JLCB 4O3RA 3OL9A 1VSFA 4K4VA 3SFGA 1SUQA 1T05A 3VA3A 3L2WA 3TAQA 2R7YA 2HWIA 4ED0A 4B9TA 4NLXA 5C5JA 5L1KA 5EWGA 4EYHB 3K57A 2Q3SA 4FJXA 1S9EB 2DFHA 4CEDA 3HM9A 4J9QA 2RKIB 3VQBA 4QPXA 1QQCA 3HYFA 3M8QA 1NHVA 1ITGA 2JEGA 3KIOA 1S4FA 4OGEA 5C25B 5J2PB 4CFBA 3QIPA 1SKSA 3VQSA 1LAWA 3CYMA 5JS2A 1JL1A 1RTJA 4CHPA 1NKBA 4W5NA 1BQNB 1RBUA 4K4ZA 4CIEA 1L5UA 3C95A 3V9ZA 1JLGA 1HARA 1D9DA 4MIAA 1NJZA 4GC6A 4IKAA 1HRHA 2LSNA 2HNZA 3NFAA 4OL8A 3V4IB 1WAJA 3I5AA 3UR0A 1S1TA 1SH2A 4CIGA 5SWMA 2FBYA 2OH2A 1WN7A 4ECWA 3K5OA 2QKKA 3RR7A 4M95A 4GC7A 3C6UB 1FKOB 4DFPA 3NH0A 3HVWA 4DTRA 4KKOA 4UQGA 2HVHA 4LQ9A 2A1SA 3ZCMA 1RAJA 4H4OA 3V6DB 4RW9A 3U3YA 1RYRA 5KFTA 2P1JA 5KFOA 4RW4A 4C8OA 3DI6B 3U3GA 4CJRA 4W5QA 2IM1A 3QGHA 4DTOA 5KFRA 4K4SA 2UVRA 4C8LA 2HHSA 3E51A 4M3XA 4MIBA 4YP3A 4CEBA 1IKVA 4O3OA 4CEZA 5CZ2A 3VA0A 1U49A 2VG5A 3GIKA 4M3UA 1KVAA 3SI8A 4R8UB 3PW0A 2XCAA 4IH5A 1QSSA 2RDIA 5KFZA 4MKBA 4CGJA 3MF5A 5KGWA 1LW2B 4J9MA 3M8SA 3V6KA 2D41A 2O4GA 4F2SA 2C22A 2Y1IA 5JUMA 4B9UA 2G8FA 1TQLA 3KK3B 4DL6A 3F9KA 4AHRA 4CJWA 4F3OA 2G8WA 4ZMMA 4KE5A 3LP2A 1DTTB 1YVUA 3SI6A 5HRNA 2BANB 4YR2A 4DQIA 4M45A 2NUBA 3TAPA 4K8ZA 1UAXA 4M42A 4M3WA 1EP4A 3V9XA 2IM3A 4HUFA 1WSJA 5KFCA 3JYTA 1RTDB 2WRMA 1VSEA 4DTXA 1N5YA 3BSAA 4OPKA 2OPRB 3RMAA 2I5JB 3SPZA 2IM2A 4HVJA 1QAJA 1SH0A 2DFFA 3IG1B 2W9AA 4LY7A 3RB0A 3V1RA 4CGHA 4DL3A 3BREA 4FJHA 4FJ7A 3ZT2A 2JC1A 2JLEA 1LW0A 1WLJA 4OVLA 3CFPA 3WNFA 1JLAA 1N4LA 1HJRA 1ZBHA 4NLSA 2HMIA 3DRSA 5C42B 4R5PB 1FK9B 3KLVA 3DOLB 3LZJA 5J1EA 4IDKA 2DFEA 2GV9A 2XY6A 3KLHA 4LSLB 4YR0A 2B6AB 5K14B 4E0DA 3DLKA 1HYSA 3OYBA 3RTVA 3KLHB 1TV6B 2HAIA 5KFQA 3NF8A 3OYKA 1HYSB 5KFDA 3MR2A 2YNIB 3LWLA 2J6SA 3KKSA 5CZ1A 4QWEA 4PWDB 5DQHA 3HVTA 2C2DA 2D3ZA 3WNEA 1O1WA 3CM5A 3HK2A 3OLBA 4O3SA 2HNYB 1IKXA 3EYZA 4CJUA 3KLFA 4LH5A 1KFDA 4QOZB 1CLQA 1CZBA 3DOKB 3AV9A 4O55A 1TAQA 2E6LA 1S9GA 5KFVA 3QZ7A 1UA0A 1RDCA 4B9MA 5C24A 1J54A 4DS5A 4JV1A 2IS3A 3RB4A 4YMEA 4IG0A 3LDSA 2V4QA 1S1VB 1HPZB 4RUCA 4I7FA 1ZBUA 3NAHA 1SL0A 2XC9A 3S3OA 4J2BA 4RU9A 2FLNA 1R0AA 1LWEB 1TK8A 3HSTB 3LPTA 1RT2B 1SV5A 3L2QA 1U4BA 1BCMA 1RDRA 2PZSA 2ZE2A 3FRZA 2GC8A 2HWHA 1S0MA 3LP1B 3MEEA 4CGGA 3SUNA 1KLMA 3FQLA 1VSLA 1BQMA 1SKWA 2HB5A 3KMSA 3MXIA 1LWCA 5D3GA 4QW9A 3BQ0A 3BDPA 1Q9XA 2XRIA 4CJ5A 3QO9B 4M3YA 1BIZA 1LWCB 3DM2B 1FKPB 3K2PA 1DLOA 3DMJA 3QLHA 4FCYA 4K8XA 4TSXA 3QEPA 4XO0A 1S48A 2RPIA 1K6YA 3CVKA 1WNSA 4EZ9A 5DG7A 2B5JB 4NYNA 1XWLA 1IKWA 4MH8A 1TVRA 4ICLA 4RNNA 1Z26A 3LWMA 4KV8A 4ZVFA 4BE0A 3NL0A 2FBVA 3CDWA 4RW6A 1S0OA 3OYCA 1RTHA 3F73A 4J9OA 3VQPA 4DU4A 2PYLA 3NE6A 4DMNA 4NRUA 3T5KA 3HT3A 2AWZA 4TXSA 4Q8FA 2XGQA 3PJXA 4BWMA 4CJFA 2R8JA 4NYZA 4O3QA 4QW8A 3KK1A 3RAXA 5L1IA 4ECRA 3P5JA 1QTMA 4U6PA 1TKXA 4ZHRB 3QNNA 1NK6A 4ED7A 4IKFA 1VSIA 2D0AA 3AVFA 4B9NA 2YHBA 1KHWA 1BCOA 1RT6B 3M8PA 3HJFA 3I0RA 4CJ4A 3ITHB 4DU1A 4JRQA 3LALA 2R2UA 1LAVA 1RILA 1Z4UA 4IR9A 3JSMB 4PA1A 5J2MB 2IOCA 5F8IA 4FLWA 1KRPA 3DRRA 4DTNA 3KLEB 4KRFA 4F4WA 4E7HA 4B3OB 3KOAA 4WYLA 2X6SA 3NKYA 4LH4A 5F8JA 4N76A 5KG2A 3EZ5A 1VSMA 2AJQA 2IC3A 4IRKA 4FS2A 1IKYA 1S1WB 4FM0A 1JKHA 3KLIA 3D0PA 1KSPA 5I42B 5F9LA 3I0SA 5CY4A 2P5OA 3O3GA 2VG7A 1WSHA 1VRTB 2OPPA 4ECYA 2RDJA 3TWHA 1EETB 1C1BA 1UWBB 3OJUA 3HO1A 3KK2A 5HLFA 1TKZA 2Y1JA 1W0HA 5J2NB 1S1UA 3MEGB 4BDPA 1VK0A 5F8GA 1NNDA 5HROB 1IM4A 4RNHA 3VQEA 3RMDA 4NCGB 4ECTA 2F96A 1S1UB 3C6TB 2HHQA 2WOMB 3CDUA 2V9WA 4TYAA 3D45A 3QEVA 3AA4A 3T3FA 4EP4A 4E7KA 3VQ9A 1IO2A 4FW2A 1XI1A 2BQRA 3G6VA 4M3RA 4DTPA 3SUPA 4QWCA 3L3UA 5HP1A 2WCXA 3MR3A 4N56A 4CGDA 1HNIB 4I2QB 2AGOA 3GYNA 5HRRA 4KHMA 5DG8A 4FJKA 1BI4B 1S6QA 4LSNA 4HCBA 1JLQB 1JLFB 4O4GB 1RT1A 5KFNA 3ZT4A 3QIDA 3U6FA 3DLEA 2HNDA 1QS4A 4RG8A 4NCAA 1BISA 3IRXA 5KG1A 4B8AB 5L1LA 4QWDA 1S9FA 4IQXA 4ZVHA 3MECB 4O0JA 2YNGA 1C0MA 4EYIB 4Q8EA 4PY5A 3QNOA 2W8LA 4CJPA 3T5HA 1F21A 1SL1A 1T03A 5KFSA 3H5YA 4TLRA 4AHTA 3TVKA 1RT3B 3G0ZA 3EZUA 4DTSA 1RT4B 3LP0B 1K1QA 3KHLA 2O4IA 2W7OA 1TKTA 2C2RA 2FC0A 4M41A 2X78A 4KI4A 4C8MA 3IGNA 4ED1A 4H4MA 1RT7A 1SUQB 1T05B 1S6PA 2QV6A 1YT3A 4DEZA 3PX6A 4E7LA 2A1RA 4H4MB 4OPJA 4AHVA 4PQUA 4DL4A 3IN5A 4QWAA 2Z1IA 4NRTA 2R8GA 3RWUA 1S10A 3T5LA 3VQCA 4W5TA 4BDYA 2HHUA 3M8QB 2BQ3A 2VG6A 1N6QA 3M8RA 4RNFA 3G6XA 1TL1A 3KD1E 1RDDA 5KFAA 3V6HA 2C28A 3FFIA 3QIPB 4KFBA 1X9MA 3O3HA 4E3SA 2HHXA 3M9NB 1RTJB 3HL8A 1U09A 1TL1B 2AX0A 3E01A 5KG4A 3ZSQA 4DG1A 5KFPA 4KREA 2ALZA 3HXMA 4NLTA 4CGIA 4KHWA 1JLGB 1VRUA 4TY9A 4KAZA 3OYFA 1NOYA 2HNZB 3CJ2A 1TP7A 3GILA 4B9LA 5JS1A 2AGQA 1S1TB 4DL5A 4CFAA 3SCXA 5EU7A 4NZ0A 1RT5A 3OSPA 4FBUA 2IGIA 3TAMA 3H5UA 4ECUA 2AU0A 4YNQA 1D8YA 1IH7A 4KKOB 3QIOA 2YNHA 3HPOA 4H4OB 4RW9B 4GW6A 2VA2A 5EWFA 1SH3A 4RW4B 1I3AA 4ZPCA 3OSNA 4M94A 3RRHA 3PW7A 4I2PA 3EPGA 2C2EA 4IBNA 3ISNC 2Z1JA 2OPQA 2E6MA 1IKVB 4F4ZA 1D9FA 2VG5B 3VQ6A 1TK5A 3OYHA 4OGCA 2AQ4A 5DLFA 2W7PA 3QINA 1D5AA 3AVIA 1W9HA 2ITGA 1B92A 4FLUA 4CF9A 3V1QA 4K4UA 1YVFA 1ZBFA 2E9RX 1NKEA 4K50A 3K5LA 1HYZA 2D0CA 5I3UA 3DYAA 2OPSA 1RA6A 1NK8A 4J2AA 2G8KA 1MU2A 3LP2B 2DTUA 4DTUA 4J9NA 2OA8A 4CHYA 2OYQA 5DGBA 1QE1A 3TQ1A 2G8HA 4KHUA 3QERA 2PYJA 2I1RA 4FXDA 2YV0X 4AHCA 4BACA 2R2TA 4Y2AA 5E41A 4CJVA 4FJGA 1EP4B 3Q8RB 1T3NA 3OHBA 1RDBA 2XGPA 4FLZA 4GMJB 3JYTB 3SZ2A 1Y97A 1KLNA 4NCBA 4DU3A 1U45A 2KFNA 4TY8A 1N5YB 1KTQA 3VQ7A 4CIFA 4ZPBA 2D7SA 4MFBA 1Z25A 3SV4A 3C94A 2XO7A 2XCPA 3ZSOA 2W9CA 5JXSA 3G10A 4MFBB 4Z4GA 4IH6A 3IS9A 4KHQA 5KFLA 4J9LA 4G3IA 4F2RA 1LW0B 4QAGA 3MEDA 3BSNA 4N5SA 2DY4A 1JLAB 4CEOA 2HMIB 3DRSB 4IG3A 4ID1A 4NLOA 4RNMA 3V81A 4Q0BA 1XHZA 4WE1A 3OYIA 5J1EB 4IDKB 4IG3B 3OYNA 1X9WA 5KG5A 4CGFA 3SQ4A 4F3TA 3TAFA 3KNAA 4RW7A 2JGUA 3KJVA 4F4KA 2YHAA 3DRPA 3DLKB 1RBVA 1HQUA 4Y2CA 2ETJA 3PX0A 1K1SA 3MFHA 5KGXA 4RNOA 4DQQA 4NLYA 4ELUA 3NBPA 5KI6A 4DLGA 1C1AA 3OYLA 1HNVA 3LANA 3PR4A 3DLGA 2WHOA 3ZSYA 1WSEA 1XHXA 1TK0A 4G1QA 4EZ6A 3PW5A 1EXQA 3HVTB 3HPGA 1IKXB 4B08A 1L3UA 3KLFB 1QSLA 4X2BA 2YNFA 1LV5A 1JIHA 2P5GA 4ZTFA 1WNEA 1N48A 1NK5A 3S3NA 1ZBIA 4DQRA 3NCIA 3A2FA 1S9GB 3PR5B 2HHWA 5C24B 1Q9YA 5FRMA 4IG0B 4FK2A 2X74A 4FZZA 3PV8A 2ILZA 5KT5A 4IH7A 4BE2A 4HKQA 4I7FB 1TGOA 4CJSA 2HW3A 1G15A 2F8SA 2DPJA 1HMVA 4E1MA 2WONA 4WFZA 2UUWA 5CYQA 2ZD1A 5FRNA 4ED6A 1JLBA 1R0AB 2ZKUA 4FLYA 1SV5B 2WK4A 1C0TA 5KFWA 2GUIA 2W42A 4WFXA 2ZE2B 5KRTA 1A5XA 4GVMA 1NK7A 3MEEB 2E9ZA 1XR6A 2PY5A 3Q8SB 4ZP9A 5F8NA 1BL3A 1KLMB 4CECA 3WNGA 3AA3A 1BQMB 1U47A 5D3GB 1YTAA 1D1UA 1TL3A 1U48A 4ECXA 1KVCA 4KBIA 3OYAA 4DLEA 4B9VA 3NH2A 3SQ1A 1C1CA 3AVAA 3NF6A 3OYMA 4FM2A 3L2RA 3KHGA 4J9RA 1JLEA 5FDLA 4EEYA 4URSA 4TQRA 1J5OA 1DLOB 3DMJB 3O4QA 4Q5VA 3QLHB 4KHSA 3L2VA 5J2QA 3CJ5A 3ZSZA 3CJ4A 1RTIA 4AH9A 3ICLA 1IKWB 1TVRB 1NJXA 4ICLB 3AVMA 2FVSA 2O5DA 4KV8B 2BRLA 4KHNA 4RW6B 1L3VA 1RTHB 4I9LA 3KTQA 4NLDA 3L3VA 2GIQA 3D28A 2W9BA 1ZBLA 2BRKA 3FDSA 1CZ9A 1J53A 3TABA 4FLXA 1KCFA 4F4XA 3KK1B 4KB1A 4CJLA 5L9XA 4CHOA 3K59A 4ID5A 2W9BB 1QHTA 2F8EX 1N56A 3MR6A 1TKXB 1DTQA 4KHRA 2XY8A 1SKRA 2G8IA 2UVWA 3LAMA 5DGAA 2JEFA 4FS1A 4ECVA 3MXMA 4CHNA 4TQSA 3M8PB 5EDWA 3BSCA 3I0RB 3P83D 4WYWA 3QESA 1J9AA 5KFBA 4AILC 1NJWA 4NLRA 1JL2A 3WNHA 4N41A 2B4JA 1RBRA 2D5RA 3HPHA 3SQ2A 4KTWA 4KTQA 3CQ8A 3DRRB 3ZSWA 3QEXA 4KTZA 1VSJA 4URGA 5CYMA 4FJ8A 3TAEA 4O44A 2R8KA 2VWJA 4Y1CA
chains in the Genus database with same CATH superfamily
2XBPA 3C46A 3NVKA 5ELZA 3P1GA 4M3TA 1NNEA 1O51A 1X5OA 4RW8A 3CO0P 3BZKA 4X65K 4BRFA 1OH8A 4QYZK 4PG7A 1HNZJ 2BJDA 4FWKA 3H5XA 3CWJA 1C1BB 3CJSA 5IFMA 2RAQA 5DO2A 3DLRA 2YH0A 2JHEA 3AXMA 4Z94A 4EBCA 1RU2A 1PJ5A 3NY0A 1SJ3P 1X4EA 3KMQA 3VCDA 2QMXA 2CQPA 2CH5A 5FIIA 1R0CB 3VTHA 3LAKA 5IT9O 2YKOA 3AO3A 4EFHA 4PYAA 4FJJA 5HANA 3DLHA 2QEXS 3NCQA 2M88A 4O4RA 2R8IA 4MKAA 2BW7A 4JRPA 2DNQA 3WQPA 4FJMA 3DKDA 5GMKa 4DV7F 1E3MA 1FT8A 2A42A 1BIUA 4O5BA 1NK9A 4AL7A 1S6QB 4AFFA 4IOBA 2O66A 4RWXA 3W66A 4JKAA 3L3CA 1F5AA 2MSSA 2JEJA 1YIJS 4JKGA 5LJWA 3WXJA 3H08A 1S49A 4K4YA 4IFVA 2PN6A 1NPPA 4ECSA 3IAM9 4FK0A 4ELVA 3P39A 1ZM4A 2YNGB 1HI1A 3GYXB 4WFNL 2E2NA 3RBDA 1C2PA 3CG7A 3NVMA 3AO2A 4I9QA 3UDCA 3AA8A 3T6JA 3ULDA 1U04A 3QETA 3J7A1 4PAAA 5C2DA 3RR8A 3HD1A 2W2MP 2FDNA 4RWWA 1XNQK 2H5EA 2EKYA 4CF2A 3BV8A 3BO4A 3M3ZA 1A6LA 5DZ6A 1S6PB 3WXKA 3AVCA 3DU6A 4JI4K 2BEFA 4DR7F 4CVNE 4PQUB 2JOQA 2PI5A 2V4RA 2O8EB 3I8DA 3MM8B 2ASLA 3I55S 2HQDA 4JI3K 1BQNA 1AUSL 3AVHA 2J76E 2HRUA 5DDRC 4OZNA 2FBXA 3FFIB 2XY7A 4I1TA 3JSBA 2DHXA 3Q24A 2P9IB 3IRWP 4M3ZA 4P7TA 4X64K 1SQEA 1HWLA 2AZ3A 3G96A 4NLQA 4XH1A 3FZBA 3AO1A 3S3MA 2QFIA 1PIEA 4E1JA 1N36K 3QJPA 1U7LA 4A2BA 2CJBA 2BBEA 4M5LA 2PI4A 4ZK7M 4AXJA 3S7RA 3SYZA 2C2KB 3K89A 4UOCA 4JI6K 1SBRA 3FSYA 1MWMA 4YOTA 2PT0A 4DR6F 3DI6A 1HHTP 1ZZNA 2NLWA 3BQ1A 1BHLA 4FF2A 3LGHA 2BMBA 4CT9A 1N32K 3UI3A 3BQ2A 4R8UA 4H5WA 2OPQB 3CMAN 4FP9A 2AMCB 2JX2A 2H51B 2IA6A 1FNXH 4DPUA 3CM6A 4HACA 3KK3A 1K0TA 3AT1B 4CF8A 4CM2A 1IBCB 5KG3A 3GV8B 2XQCA 3TSPA 1N33F 4FM1A 1T6CA 3BR9A 1F9EB 4DCJB 2SXLA 2F9DA 1QQOA 1EQYA 3HDSA 5M1OA 3T69A 3H4BA 3W63A 3LGMA 1GOBA 1CJTA 5D0HA 3H40A 3ZTOA 3GFYA 2VFRA 2I5JA 4K4WA 1NMNA 2FLOA 2XI3A 1IG9A 5F0WA 3ZT0A 2AKWB 3N5BA 2XHCA 2QSFA 1IR2A 3VEOA 4K0KJ 3NNCA 4C3KA 1FK9A 5HVHA 4IRDA 1U1OA 1UVKA 2FC9A 1PGZA 2K1RB 1VC5A 4R0EA 4JS5A 3V81B 2ZQBA 1KS2A 5AE3A 4L8RB 2DNKA 3TARA 3HVAA 2ZH4A 3MM7A 3D67A 4TU8A 1RWXB 3ALYA 2ZM6K 4CJTA 3G71S 4USJC 2QWQA 3OFHA 1ZA1B 4CEEA 4RW7B 1Y5LB 2AJ4A 1S5JA 4LR9A 1BGXT 2CFXA 5GMEA 2HVEA 3FBEA 1X8DA 1KFSA 4FOIA 3GV5B 3GZ7A 1HNVB 1RAEB 2HNYA 5HRPA 4BWJA 1AYEA 5AJ3F 1ZC6A 1RHQB 1RYSA 5HRSA 2HHTA 5G0RA 1NKCA 3TO8A 2KB2A 4F0KA 1CS4B 2GCFA 4FJLA 1HPZA 2P9SA 1HR0K 2FSNA 3O80A 3SCJE 3O4NA 1PJ6A 5KFUA 3IMXA 4CFCA 4FWNA 1HMVB 3P96A 3ZSXA 1S97A 4M5DA 2ZD1B 2C2ZB 2W41A 3IBFB 3IWNC 4FWSA 4B1UB 2IDOA 1RSCA 2HF4A 2HS0A 4OKEA 4RUBA 1A5WA 3K5NA 4WF9Q 3W61A 3L4QA 5AZIA 3QO9A 1F5CA 2JSXA 3DM2A 3RVCA 1TL3B 1OVYA 2FVCA 2P8IA 4NA3A 4NLCA 2HPUA 3EY1A 2B5JA 2R7UA 2AYEA 2KZMA 3EKSA 4AUKA 1ZETA 1J5OB 1X9SA 4W5OA 3JTOA 3QEWA 1UJ5A 2MKCA 3Q8PB 4CZMA 4DUZJ 4BROA 2O3DA 4EGLA 1O0PA 2X1GA 4B9SA 4LQ3A 5JLHA 5KFKA 3G8QA 2IRYA 4LF9K 4NLBA 3VQ4A 2QE5A 3L6QA 2W6KA 3J7YU 4Y34A 2EBEA 2CPFA 2YTCA 2UXBF 2MQMA 4HYKA 3Q8VA 4CZEA 3HFVA 3UW1A 3VQ8A 5JLFA 4E7IA 4M63A 3QGIA 3RBXA 1CVJA 4CK1A 2BM1A 2MB0B 2ROEA 4P52A 1RBTA 4HVZA 1KD1T 3KLEA 1IBLJ 3VQAA 4JV5F 3J81j 3ZT1A 3HFKA 2N4CA 3IR6B 4YFUA 4OZ3A 1Q5VA 3Q22A 4FYXB 3ONQA 3CGIA 3UCZP 3T5JA 1S22A 4Y1DA 1T3OA 2YH1A 1GFWB 2WB4A 3BSOA 5I42A 4RZRA 5THWA 3NF9A 4JI2J 5SZTA 4ZVGA 3HZGA 1LWXA 1ITPA 2HHVA 3BGRB 5HJXA 3ISND 1JNZB 5HMZA 2VQFF 2RF2B 5DZ7A 4AXIA 3MEGA 2ZJRL 3GSIA 2B0GA 2AF6A 3IA0A 1NBWA 5HBMB 3VVUA 2WOMA 3IDHA 1P9QC 1JWWA 4CZLA 4FZXC 2PEBA 5AQLA 2C2NA 3PIPQ 2F65A 3LO3A 4MJKA 3T9ZA 1AZSA 3HSGA 3CCMS 3V9WA 1XBWA 4DQPA 2RQKA 2MGZA 4C8KA 1NH8A 4USMA 1HNIA 1FRHA 4I2QA 3K5MA 1NMEB 3MTKA 1RDAA 5ETTA 1QUVA 2P9KB 4FLTA 1RAIB 1JLQA 3OVNA 3IGVA 4O3NA 2VWKA 3ET6A 1WDDA 4M5HA 5BN8A 3G6ES 1WEYA 1H0HB 4W5RA 2AX1A 4KHPF 4MYUA 4BR0A 4B3TF 3MECA 3CMEN 3AD9C 2CZVC 3U4LA 4C8YA 3VEZA 4I6MB 3X1LB 3LP3A 3B6PA 4U67Q 4Z4IA 3TA0A 4WP3A 2FVRA 1MMLA 2BE7D 4BRAA 2RQCA 4YOVA 2OTJS 2V2ZA 2JVOA 2BE2B 4DV6K 3D4JA 5EN1A 3LPUA 3SJHA 1HQEB 1XNQJ 4O3RA 5LSLA 4DCOB 3PEJA 3H2VE 2YJFA 3SFGA 2MZJA 4DV3K 3QFWA 4CLYA 4JI4J 3TAQA 3LM2A 1X4CA 2R7YA 3R7BB 3U02A 4IZ9A 4C98A 4NLXA 5C5JA 5L1KA 4KR0B 2HAFA 1DGKN 3CJQA 3W5XA 1VC6A 2QG9B 5E5NA 2VD3A 2VODA 3HM9A 4Z7YA 2ZH1A 3EICA 4JI3J 2UUCK 3PYDA 1KP6A 2JFDA 4DUYF 1NWKA 3KIOA 1S4FA 1F3VA 4FO0A 3BUZB 1NHKL 3CPWM 2A18A 2NPFA 5C25B 5J2PB 2A3ZA 4CFBA 2DGWA 1DURA 1YITS 1LAWA 3CYMA 2QA4G 2XULA 1JL1A 2FD2A 4X64J 2Z30B 4PKHA 4CIEA 1QAXA 4WCEQ 2D3OR 1PSDA 1RQ0A 2CPIA 2QGFB 4BGBA 5LSRA 2VQEK 1HRHA 2OTLN 4B3MF 1AW0A 1BWFO 3M32A 3VAMA 1WN7A 1FERA 4CLTA 2BW2A 2E2OA 3C6UB 3H6EA 4CLKA 1HBUB 5L38A 4DTRA 1VQSA 3UO0A 3EM1A 3O5BA 4OI4A 2LVWA 1TL7B 5LXRA 3V6DB 4ZITA 3HF5A 2MMYA 1P1TA 1N32J 5LY3A 1RYRA 4HTJA 2BXJA 4DX7A 4W5QA 2VOOA 1VQ8N 2OFGX 2Y9HA 3E51A 4PWUA 4M3XA 4MIBA 4CEBA 1TYQA 4Y28C 3CPWR 2AJ2A 4HTIA 4ZN1A 3THYB 1KVAA 3TTCA 2NRWA 3PW0A 3D2EA 2UV8G 4ZKAA 1YJWN 3MOJB 1Y11A 1LW2B 5C7PA 1XNRF 3EXYA 5LL6Z 3J80Y 3D3BJ 3VF4A 2KT3A 4B3SK 1TUWA 1FCAA 2XLKA 4O8KA 4KRWA 2CQCA 4AHRA 3KJNB 1WELA 2G8WA 4ZMMA 1DTTB 4DV0K 1VQYA 5HRNA 3MDFA 4YR2A 2NUBA 4KGMA 3MZIA 2MDAA 4JI7K 2IVMA 3H1QA 2IM3A 4DV2K 2ZJPQ 3EKUA 1RTDB 1OVQA 3W64A 4ETZA 1YDLA 1N5YA 1ZBTA 2CUYA 3BSAA 1ZPVA 2EFGA 4OPKA 2OPRB 4DMZA 1V4TA 2MKJA 1R59O 3RMAA 1X0PA 3W60A 3HZEA 3FVYA 2K3KA 3RB0A 5FPDA 3RUBL 2GGPA 3GFHA 4DX5A 3BREA 3OR2B 2JC1A 3R5GA 1K9MO 3CFPA 2J7KA 4NLSA 2KLAA 3AQOA 2HMIA 3DRSA 1WC6A 4R5PB 1WG5A 3KUEA 3DOLB 2C3PA 4ID8A 5IT0A 2RQMA 1G1XA 1J2VA 2GV9A 3ADAC 2AD9A 5B0GA 3ENHA 3LQVA 4IJAA 2QL9B 3W0LA 3OYBA 4LF6K 4KQZA 4ANDA 3G9CA 3RTVA 3KLHB 3OPKA 3LDPA 1UFLA 3NWGA 4GY2B 2HAIA 3MXHP 1YJ9N 3MR2A 3RBZA 2YNIB 3FZHA 2B9WA 2E5GA 3LWLA 4WQ4C 1X4FA 5CZ1A 2D4WA 3CCJN 3WNEA 2ADCA 3I8BA 3PXGa 3CM5A 3HK2A 3V5RA 4ETXA 1IKXA 1KFDA 1CZBA 3DOKB 2FIUA 1SCJB 3FZLA 3QZ7A 4GVBB 5AE2A 4DR3K 1HR0J 2L08A 2HVDA 2GO8A 1J54A 4DR4F 2VFTA 2IS3A 3RB4A 4BRQA 1PBUA 4YMEA 3MR7A 1FDBA 1Q16B 2Q66A 5BR8K 1S1VB 1Q4RA 4MYTA 1NRKA 1JJ4A 2DHAA 1LKZA 2BKNA 1SL0A 3S3OA 4J2BA 5CHIA 2FLNA 1FHTA 4M7XA 7FD1A 4Z2XA 3IR5B 5D4LA 4F36A 1RACB 1R0AA 1LWEB 3CCVS 2UU9F 1EKSA 4I0WA 2HZCA 5T7LB 3HHLD 2PZSA 3FRZA 4QIFA 2GC8A 5C10A 1S0MA 3LP1B 4WF9L 4ZVTB 2GHVC 2R7TA 2E1MC 2GX8A 1KLMA 1FTRA 2B9XA 1YJUA 4RU2A 2HB5A 3KMSA 4YOYA 3GJQB 3SLCA 3J81Y 2ROGA 2MZRA 3BDPA 4FYWB 1RWUA 1BIZA 3VWSA 4W92B 3B8HA 3K2PA 1K73O 3QLHA 1U24A 4K8XA 2NXCA 2VCPA 3N79A 1OIAA 1UEVA 3CVKA 1WNSA 3PG9A 4NYNA 1XWLA 3R6LB 2H4WB 4K2JA 4RNNA 4KV8A 4NL5A 3OBYA 4CQ1A 4UOHA 3NL0A 1S0OA 3PKMA 4JI5K 2POKA 5BRFA 3H3OB 2HWTA 3VQPA 4DU4A 4NRUA 1HNWK 4LF9J 3VERA 2M9KA 1F0XA 1E6YA 3P5JA 1QTMA 1NK6A 1VCTA 5DRKA 1G7CB 5B08A 4YY3K 2RHQB 4H0VB 4B9NA 5K8OA 2HFNA 3M8PA 3D66A 3HJFA 3RG6A 1EWQA 2O8FB 2YX4A 3ITHB 3DXKB 1KAZA 3LALA 1QD1A 1UMJA 5D0RA 3UKUA 5F8IA 3QRPA 3P3DA 5A2QO 1HHQA 3CDBA 1KRPA 3WEEA 3GJRB 3CD7A 1WBDA 4E7HA 3EGNA 4WU3A 3CNQP 4LVNP 5KG2A 2DNHA 2HG4A 3EZ5A 2QWPA 3DGPA 4FS2A 3J7Z5 3NNAA 3D0PA 5HMXA 3POTA 4CYUA 1NDPA 3AJDA 4GKKK 2IBOA 2OUGA 4BRMA 2R3VA 2VG7A 4G1IA 3DLLL 2OPPA 1RAOA 2X3DA 4QS9A 5AFUH 1U2VB 1IN0A 5B0DA 3HO1A 2X7IA 3BM7A 5HROB 1F9FA 2G0CA 3ULHA 4A62A 4HI1A 4ILJA 1DJ0A 5IWAK 1PYSB 3MM5B 4QU6A 4EP4A 2CQDA 1IO2A 1FTCA 4FW2A 2F1FA 3TU5A 3MMAA 2FHJA 2BQRA 1G99A 5E7OB 2XYPB 3L3UA 2W6LA 2HFOA 3UR3C 1N36F 2OD4A 3MR3A 4CGDA 4ES3A 4F02A 4KHMA 4A8FA 1PYOB 4FJKA 4XH5A 1MROB 3NGTA 4P2XA 4O4GB 1DKGD 2EK1A 3KG0A 1TUUA 3QIDA 2PMWA 3CQYA 3DLEA 2EFNA 2HNDA 5LJ5Y 3AXKA 1QS4A 2HMPA 2E7VA 3IRXA 5L1LA 4QWDA 1YRTA 4ZVHA 1FFGB 4Q8EA 4DV6J 1JQGA 1SL1A 2DGXA 3D6FB 4B1XB 1FDAA 2VZ9A 3EWGA 1MMDA 3TVKA 4DTSA 1RT4B 4DV3J 2W2PP 2MJNA 1SQKA 4UW2A 4JHDB 3FBCA 2O4IA 4ANEA 3U27A 2CPXA 3GG0A 5E3RA 2FC0A 2X78A 4C8MA 1BD6A 3IGNA 2GMHA 3B82A 1RT7A 1ILYA 4ED5A 4XDDA 2UUCJ 1R7IA 4OYPA 2QV6A 3BF4A 4LR8A 8RUCA 3TSUA 1YT3A 4V19X 2GVDA 3FEXB 3DXMA 2WW8A 2MKYA 4QWAA 2Z1IA 4NRTA 1UJ6A 1LXJA 4BDYA 1TL1A 5KFAA 2GEMA 4JD2B 3V6HA 2Z57B 4JKBA 1VC0A 2QLXA 2VQEJ 2R9LA 3W9HA 4WCEL 1HKAA 1RTJB 3A5MC 3ZSQA 3QNWB 3HXMA 4X4RA 3U9DA 1V5IB 1VRUA 4CW7B 1RLCL 4BR2A 1H72C 3JAMU 4EWTA 3L7UA 1FJGF 3HHEA 4NZ0A 1RT5A 4A8WA 1N8RO 3VGKA 2JLGA 2BJ3A 2F7TA 4IWVA 3H5UA 2DIVA 2AU0A 5IT4A 5D8HB 2M3DA 2FJBB 7AT1B 4XH4A 1BWVA 4KGVB 4KKOB 3CC4N 1EQ0A 3QIOA 2YNHA 1RCXB 2BKPA 2QM1A 1SQFA 3HPOA 4H4OB 4J91A 3UKRA 3TRGA 1UAWA 1XERA 3KHYA 5H9FJ 3CJBA 1SH3A 4W98A 3MCMA 2RUSA 1YQHA 2V2KA 4Q2MA 4DPOA 2HVZA 4I2PA 3W9IA 3D68A 4MLHA 1IKVB 1S99A 1D9FA 1TK5A 1N52B 2E1ZA 4B3SJ 3JQMA 1HA1A 1LXNA 4G65A 3EGWB 1D5AA 3AVIA 2Q6BA 2N82B 1W9HA 4BRNA 4ZVUB 4TU9A 1B92A 2V94A 4CH7A 4CF9A 4DV0J 2E5HA 5RUBA 3M2RB 1YVFA 2UXDF 1WF1A 2JLFA 3T1YK 2UUBK 3K5LA 2D0CA 4JI7J 3CC2S 1NSKL 5K20B 4A8YA 1S7HA 4J2AA 4DV2J 3FZMA 1MU2A 3LP2B 5D77A 1VJWA 1JJCB 5DGBA 5LSOA 3F41A 1RDWX 1S79A 3IFEA 2RRBA 1EP4B 2YY3A 1PAEX 3Q8RB 1T3NA 1PCAA 2HKEA 4FLZA 3SZ2A 4AD6A 1UKUA 1KVKA 1HBOA 4DU3A 2HHPA 1U45A 1ZBSA 1KTQA 2PSZA 4CIFA 3PLAA 3NRBA 4MFBA 4A5AA 2XO7A 1RLDA 2ASYA 3IAS9 3QATA 3EXCX 2QEXN 1NGEA 4CBWA 2HGNA 2Z2YB 4GKJF 4G3IA 4F2RA 3EE3A 3MEDA 3UCGA 2MYFA 5ETOA 2DY4A 2J8AA 5CH7B 4IG3A 2OJ3A 4IQMA 2Y1RI 4WK1A 4LF6J 1NLVA 2L9DA 1YIJN 2JZ5A 4U7UD 2GA7A 1Q82O 3UN2A 1NJIO 3THWA 2V67A 2KJVA 4BBYA 5IZHA 1U1PA 2YHAA 3DRPA 3DLKB 2ETJA 2DGSA 4Y2CA 2VPZB 3VZIA 1K1SA 4BRCA 3MFHA 3W65A 2CRLA 2PFUA 4WQ5C 3NBPA 1IV0A 2JH3A 1WG1A 4DLGA 1IG8A 3CDAA 4LFBJ 4LUBA 1Y5IB 2CH6A 2KYZA 4AL6A 1E6VA 2NRHA 4MDAA 5CAAA 3D1HA 4G1QA 3GE9A 4DR3J 3OTOK 4B17A 2Q79A 2CG4A 3UCUP 4HHJA 1EAYC 4F3QA 3KLFB 3OBIA 3SK3A 4WIIA 1LV5A 2K7JA 5U47A 3LDLA 5BR8J 3HSDA 1WNEA 1ZBIA 3UVJB 2DO4A 1DEJA 2HHWA 5C24B 1MA9B 2WSEC 1Q9YA 1Y64A 1CJVB 4IG0B 2KU7A 4FK2A 1WG4A 3PV8A 4HDHA 2FJEB 2ZH7A 1M5OC 3O8WA 4X66J 3T7ZA 4HKQA 1TGOA 2E5LK 1WKKA 3I55N 2HW3A 2EW9A 2DPJA 4E1MA 2WONA 4IFEA 5CYQA 5AQJA 5LT5A 4ED6A 3QT8A 2HFVA 4DV4F 1YZ7A 4LSZB 3LPEA 5BYRA 3ULEB 1ATNA 5F1XA 1W26A 4IUFA 5AQKA 3UE2A 5KRTA 5BYSA 4GVMA 3MEEB 4B3RK 1EKRA 2P9EA 1J5EF 3OXGA 1BL3A 2V7YA 2DHSA 2MKKA 4KH5A 1CQNA 3BGLA 2C3OA 1HW8A 3NH2A 3SQ1A 3BN7A 3TNVA 4DJBA 1DY3A 3DFEA 1IBMK 1Q53A 4J9RA 1JLEA 5FDLA 4EEYA 1DLOB 2ZZNA 4Q5VA 1N0VC 4JI5J 4XEIA 3SSSA 4FSVA 2WVCA 2NZCA 4NX9A 1RTIA 4AH9A 4MDBA 3ZYYX 4UUXA 1IKWB 3VAJA 3VGTA 1C0FA 4KC5A 2FVSA 2XZWA 2FF6A 2CXEA 1L3VA 1RTHB 3C14B 3L3VA 5HMWA 1NB2A 3CCTA 3D28A 1X4HA 1VLOA 1ZBLA 3FDSA 4DR5F 1NZ8A 3FZFA 4YY3J 3TABA 2OCEA 4OYIA 3JTPA 4F4XA 4V1Ak 2UYTA 4YHHK 2F8EX 2GUPA 2BOPA 2P9UA 4PYDA 4M5KA 3QGPA 3LAMA 3NS5A 4OYXA 2JL9A 1P27B 3G8SA 4CHNA 1OH5A 3BSCA 3P83D 1FRJA 4CZGA 1Z05A 2LFVA 3HPHA 2K3IA 3AOAA 4CO4A 4KTQA 4IJNA 3DRRB 1T44A 1JXVA 3O9SA 4KTZA 1VSJA 2XS7A 4URGA 5CZXA 1SJFA 4GKKJ 1ASWA 3CDEA 3KDNA 1RNHA 3GTYX 5HN0A 4K4TA 1LWFA 2IC3B 1X3MA 4OLBA 1XC9A 1JKHB 1FRXA 4UY8O 3BZQA 1HJOA 4V19J 1ZS6A 2IVOA 3U1LA 1MMNA 4USKA 5KOXA 3MWTA 2G8UA 1R8AA 2EFVA 3QYYA 2UP1A 4EBEA 5IWAJ 4R0JA 4KB0A 2QA2A 2F63A 2CQ4A 1RISA 4OX6A 4Y2IA 2XZDB 5IXUA 1OSDA 1CXQA 4OX8A 5LMUF 1ATRA 4IYQA 5FROA 3RMCA 2CNNB 1C6VA 3NHGA 1VOMA 2CKWA 2RN2A 5GAGU 4JI1K 3NGKA 4ZA1A 5M1KA 1CJKB 3SPYA 3G71N 4EAHD 5D4OA 1Y5NB 4CLUA 4HCCA 5KQ8A 1QVGM 1U6ZA 2FHMA 1PILA 3OYJA 4NLGA 2H9ZA 4A59A 3NGIA 3SMPA 3AQPA 2GJFA 2NXUA 3EMTA 1JMTA 4C23A 3Q8QB 1RADB 4E19A 4LSNB 5IOLA 3SQGB 3CETA 2I38A 2DITA 1XUPO 1U1QA 5F8LA 1WUUA 4PQAA 4H03B 3AO4A 1V3RA 4CNYA 5F8MA 3ENOA 3CCRS 1CXUA 2WW4A 3VQDA 4DFKA 5AQOA 4DF8A 2VFUA 1REVA 2WVBA 5BRDA 4CEQA 3IBCB 4FW1A 2GWJA 2WBRA 4C8NA 4LIWA 2N7YA 5KPRA 2CQ3A 1TKDA 4H54A 2KW4A 4E89A 1HKBA 4JV2A 3IWXA 1U1RA 4DSLA 1W7AA 2LA4A 1YI2S 5AQUA 1Q8KA 5A8WA 1QVGR 4LREA 1WEXA 3OL6A 4JP8A 1S9EA 3I5CA 2HZVA 3QICA 3FUYA 2KHCA 1W97L 2ZH2A 1H74A 3IP0A 1KWMA 3ENVA 2PFFB 3AAWB 6FDRA 5EVZA 4KHYA 1N6QB 5ETRA 2NQPA 2MZ1A 2VDHA 1T8EA 3SAHA 1CLFA 4LF2A 1S5ZA 2QYGA 5GMDA 5B09A 4KFBB 1XR7A 2KO1A 5FLXU 4LFAF 1U2CA 2DNMA 5JICA 4XPCA 2VC1A 3PCOB 3V4IA 4YQWA 1F2HA 4L76A 1A5VA 5GIPA 3UB5A 4JKDA 1I6JA 1TTHB 3CI5A 3RAQA 5MAOA 4RLEA 2XHBA 1VIXA 5ETPA 3V9SA 1X1PA 2J4RA 4CO1A 2AGPA 3QJLA 3ASMA 4HUGA 3WXLA 4CLFA 3LDOA 4I6AA 4DV7K 5ETNA 5IM0B 1N54B 3TAMB 2QC3A 3BF3A 2DKOB 3TA1A 2L41A 4B9QA 1RJJA 1NGGA 3G86A 4EHTA 1Y10A 2XY5A 2Y0SD 2F3JA 1M90T 4MK7A 3MWBA 4B8CA 4O23A 2CQ0A 4BR5A 4F8RA 5FD1A 1CULA 4ZVRB 2EWSA 4OV6A 1FNOA 1HHSA 5AQNA 1S57A 3GCWP 2WB1D 1JJ2M 3ZSRA 4H0YB 2FYXA 4DL0C 3B6OA 1B7FA 2P5VA 3T1YJ 3CPEA 4CJ3A 3CCUS 4H0OA 5DM7Q 1WOQA 1TAUA 3HHLB 1G2EA 4FNIA 3C2PA 3D7EO 1KHVA 1HYVA 3K0SA 4DSEA 1KQSM 2BANA 4B1YB 5I3UB 3PJWA 4ZLLA 1B4SA 4FWPA 2MLYA 2DBBA 4O3PA 5DMRA 2VUGA 3MMVA 5T7BA 1UZHA 3CO9A 1RA7A 1QE1B 2HQIA 4DR7K 5D6GA 4FBTA 5AQVA 2V4JA 4WZMA 2A0FB 3E9OA 2DY1A 4NZ7A 3W3DA 4L3NA 2F8TA 1SIZA 3CD5A 2P9PA 1WSGA 3JXOA 4FWQA 5A76A 5KFGA 2NXEA 5KFHA 3DGVA 1MSWD 5F0XA 4F25A 3HHDA 4LF5F 4JAXA 3VAKA 3CCMN 4Z4CA 3D5MA 3MAQA 4OZ1A 1VISA 1JJ2R 4TNOA 2E1AA 3IS9B 4X62F 3DAWA 2E1PA 5C42A 1FRIA 4I67A 1K8AO 1BQXA 4KPYA 2MQ8A 3MAAB 3NAIA 4RWTA 3GOIA 4LSLA 2DGVA 1BE4A 2B6AA 4BRGA 2DR5A 1KQSR 4WE1B 5EWEA 2MQPA 4DTMA 3W2VB 3O1BA 2Z2MA 3CIMA 4X4OA 4ZTJA 1IQZA 4CI6A 5KTQA 4V19S 4DR6K 1UJ4A 4HLBA 4OYWA 3KJVB 2YHWA 2CJ9A 1HQUB 1P8GA 4CBUA 5ETMA 3OTOJ 1RUSA 2OTJN 1L3TA 5E3QA 3F9MA 4PWDA 2PFDA 5I3QA 3MFIA 2YKMB 4DTJA 4ZJQA 1YBTA 2BQUA 2RHKA 3WZ0A 3Q86A 2ZBPA 3EE8A 1SKUB 3PY8A 4OLOA 1GLEG 4LIRA 2YNFB 2GW8A 2LU2A 3KKRA 1EARA 1HBNA 2RJZA 4QR0A 5JVGL 1IR0A 4MO4A 1D8ZA 2E5LJ 5KT3A 3M2UA 3BN4A 3J7YI 1IBLF 5AQZA 4WIQA 2O8CA 3KJQB 1SVDA 3PZPA 1N33K 1AFJA 2RE2A 1RT2A 3B78A 3OYGA 1RHJB 3TUPA 1QSYA 1K9MT 5KPZA 2P9NB 1WKLA 4BQZA 4WXOA 1JLBB 4AM7A 3AA2A 4JI2F 2MKIA 1U0SA 1U6FA 2Q1LA 4HHTA 3BYPA 2A41A 4A4JA 1IBMJ 1FXXA 2RDDA 3MN9A 3AFGA 1G6BA 1Z6RA 2CNOB 3FQKA 3SQ0A 3C6HA 1C1CB 1HI0P 2BX6A 3UD5A 3VV2B 4AHUA 3NCPA 2H4YB 2G13A 5J2QB 3T1HJ 3RB3A 4QQBA 2GIRA 2PDAA 3M30A 3OV7A 3SQOP 4YHHJ 3CIZA 4GV9A 2J0XA 1DFDA 2ALYB 1KOHA 3SDEA 4LRAA 1R31A 4UZCA 3K9KA 3HP6A 2QO3A 4ZLPA 4ID5B 1EKEA 2MLXA 4QPTA 1UWAA 2HEKA 3THXB 5B0AA 3RZAA 2RMLA 1BY9A 4C0HA 9RUBA 1IJEB 2MPUA 3JS6A 1UVIA 1EX4A 5AJ3K 1EIYB 1YZ6A 3I9ZA 3EPIA 5KAKA 3JSMA 3KLGB 3A5NC 5J2MA 4OFZA 1VHIA 5GAHU 4ZVEA 3BDEA 4B3OA 3TAGA 3EJMA 2ACYA 3TR8A 2KG0A 3R3TA 2BUPA 4BC3A 5M1NA 3AVKA 4WQ4A 4J9SA 2YI1A 2O8DB 5KFIA 2Q1NA 1D9AA 3SNNA 5CYMB 1RBLA 5DM6L 1KAXA 1RBSA 3MCOA 3H98A 3HFZB 3MMBA 1VLYA 1WHXA 1GOCA 3MK6A 4M5IA 1Q79A 2R7SA 3SBGA 1GOAA 1K73T 1VRTA 2KXFA 2X1BA 3THVA 1UWBA 4RW8B 2CQ2A 2DRAA 3OBWA 2W2QP 2RT3A 1AFIA 4Z0UA 2U1AA 4IOXA 2NYIA 4RBTA 3NGDA 3QZ8A 4JI1J 2QWLA 3D0HE 3E3XA 4MO5A 3IBWA 1GK8A 1TZ0A 3C6TA 4N47A 1XR5A 3JXUA 1SJRA 3W1YC 2DPIA 2HRTA 4FJ9A 4Q45A 2DJWA 4KPCA 2RSQA 3FCWA 4KSEB 1S0NA 4QS7A 3BJYA 2A2CA 2IM0A 2X1FA 1U1NA 4CCHA 3CCQN 3CF5L 3G2XA 1VBYA 1HLUA 2KG1A 1YVNA 1D0EA 3ZETA 5ETKA 4AE5A 1DZ5A 1BI4A 2VGNA 4CE9A 4USTA 1JLFA 5ETSA 3BO2A 3J7YP 1RAHB 1WOSA 4MIWA 3SV3A 4NXMF 2P9LA 5DQGA 3HHNB 2QIFA 3HHKA 1ZTWA 1AA1B 2UV8A 4QR1A 4JKGB 5DQIA 3NGYA 1MWQA 4A57A 2I0XA 4C1NK 5F3ZA 1CJUA 3K5PA 2UXBK 4OKJA 3CJKA 1R6YA 2HF3A 2KZZA 4ERDA 3ZNJ1 4A5BA 2CDRB 3LGNA 3P5BP 4A46A 2VJUA 3QWPA 5JVHQ 4OJGA 1GH8A 3LP0A 5IC4B 4JI0F 1KEKA 3CCVN 2E1RA 3N9UC 4JLHA 4JV5K 2UUTA 2XWYA 3OL9A 1HD0A 1GEHA 2NNWA 1T05A 4P71A 3TSQA 5HMYA 2UUBF 5B7WA 2PMHA 2WAQD 3JAMY 1Q86O 4WK3A 4ED0A 2MZSA 3I31A 4DB3A 2V9KA 1KQKA 3R5BA 4FJXA 1RP5A 2MSTA 2DFHA 3A5OC 1KR4A 1X5SA 1YBAA 3ZFVA 1R27B 1QQCA 1VBXA 4U96A 1B99A 2VQFK 3LOUA 3MPUB 2FY1A 4UQTA 4IO1A 3L4IA 4W5NA 1BQNB 4D3HA 4K4ZA 1DRZA 2FZKB 1L5UA 5A6WA 3C95A 3V9ZA 1JLGA 1HARA 3MCPA 4MIAA 2XS5A 3Q7BA 3VAIA 3N4PA 1S1TA 4CIGA 5A8RA 2B8QA 4DV7J 4QIGA 4CNZA 2OH2A 4ECWA 3K5OA 2XMWA 4EI2A 2QKKA 4JKHA 1NXIA 1ESVA 1UW9A 4CLZA 3HVWA 1TMJA 3VF2A 2ZWOA 4LQ9A 2ZZTA 2A1SA 2XNQA 1HX1A 4LR7A 2XMAA 3C7NB 5KFTA 1S0VA 1B64A 5KFOA 1X4GA 4C8OA 3DI6B 2GJ2A 2IIHA 2E2PA 3U3GA 4CJRA 4KHPK 2YCHA 3UNYA 3THYA 2FHJD 4DTOA 3GB0A 2RE1A 3GJSB 4B3TK 2IHR1 2F4FA 4MAKA 1RHKB 1U49A 2VG5A 1NDLA 2YKQA 4USVA 2QA4N 1FRLA 3L0QA 3GIKA 4M3UA 4PRFA 1X60A 4R8UB 3MUMP 3D0GE 2XHWA 1F60B 5KGWA 5DM7L 3ZZRA 3WXIA 3GJTB 3PFOA 2OLWA 4F2SA 5EX3A 3T9NA 3I87A 3K17A 5JUMA 4NWBA 4HACB 4B9UA 4OI3A 4NPOA 4PPDA 4LF1A 3KK3B 4DL6A 4M1KA 4M5JA 1YJNN 3HOTA 4CLLA 2PGCA 4M45A 2QI2A 2GZOA 2M4MA 1UAXA 3WT0A 4M3WA 1U26A 2R7QA 4GV6A 2AP6A 4HUFA 1WSJA 5KFCA 3JYTA 3IM9A 3WQTA 4DUYK 1CJTB 4ZVSB 3PSFA 2NUHA 3JQKA 2ZVSA 1QZ5A 3Q2TC 4E98A 2QXLA 2I5JB 2ZH8A 1N8RT 1W2BM 4DZ6A 3FEYB 2LP4A 1QAJA 3E2EA 2W9AA 4LY7A 1BA1A 4FJHA 1OO0B 3ZT2A 2J0WA 2JLEA 4OVLA 3WNFA 4B3MK 2EFPA 4KH4A 1FK9B 4DR2J 1HBMA 2NRVA 1RGVA 2CZ9A 4IDKA 1GNKA 2DFEA 2XY6A 4DR6J 3KLHA 5MLCQ 1BUPA 2NRZA 1HNXF 2LDYA 4G9ZA 1WTBA 1NU0A 3MM7B 5CR4A 3HI9A 4A8OA 1HYSB 5KFDA 1UTAA 2DRBA 2R7XA 3UN5A 4QWEA 3FCHA 2C2DA 4PABA 3EX7B 1O1WA 3H25A 3OLBA 1WOOA 1W2BR 2HNYB 4DUTA 5AR0A 2NR0A 1FE0A 4CZJA 4QOZB 1FWPA 3AV9A 1XNRK 2E6LA 5KFVA 1S7IA 3RW7A 4QZVB 5G0RB 1WF0A 3OD2A 1S6OA 1N33J 1XMQF 1HPZB 4RUCA 3FGVA 2VF3A 1YHQS 1ZBUA 2P9SB 3QT5A 1QHAA 3TA2A 2BABA 2XLIA 3LPTA 3L2QA 2RD5C 1BCMA 2ZE2A 5JMNA 3SCKE 4M5DB 2HWHA 3O4WA 1H2TZ 2ZC3A 4RR5A 4CGGA 4OHXA 3FQLA 1VSLA 3ETOA 2KM8B 5D3GA 1X7VA 4L75A 1GLJO 2LQBA 3UDEA 5HOOA 3I56S 3VESA 1Q82T 5AZIB 3QO9B 4M3YA 4PXCA 2GELA 1PC4A 3DM2B 2W2NP 1NJIT 4J5OA 2RVJA 4X4VA 5CYJA 3DMJA 4TSXA 2AEJA 3QEPA 4NYOA 1S48A 2RPIA 4CM0A 1K6YA 2B5JB 2P6TA 3DRXA 1GXUA 2ZJQL 4ICLA 2DH7A 4ZVFA 4E8UA 2RILA 3NS7B 4PCQA 3ISZA 4RW6A 4BR9A 3F73A 3P8BB 5CZVA 4BQLA 3T5KA 1NGCA 4Q8FA 4Y2MA 3PJXA 3E66A 4BWMA 3VEVA 4CJFA 3GU0A 2R8JA 4NYZA 2ZEJA 2XMKA 4QW8A 3SMSA 3KK1A 3RAXA 1IBKF 3ZEUA 4ECRA 1D4XA 1TKXA 2NXJA 5K9FA 2ASPA 2E29A 3X3UA 4X4UA 1VSIA 3R7SB 3TTDA 5AJ3J 3M5RA 4BC9A 4OHYA 4BC7A 2B4OA 4DU1A 3CC2N 2N3OA 1RK8A 4E2FB 7FDRA 1RILA 4IR9A 3M1VA 4WQ5A 3MCSA 5A2QY 4RBVA 2IOCA 4DR4K 1UZDA 4DDFA 3ILJA 1V6HA 1NGIA 3KLEB 4J8FA 4FWMA 4LH4A 4N76A 1YRXA 2ZBRA 4C7QA 1UL3A 2YPYA 2N3LA 4C6AA 2AJQA 5L39A 1IKYA 2UU9K 5CABA 4O5FA 3KLIA 3HM8A 5E3AA 1KTVA 1P1LA 5I42B 4U8VA 5F9LA 3DXBA 3I0SA 4BRIA 1VBZA 4MTPA 2RDJA 3OFEA 3TWZA 3T6BA 1A7GE 3D2FA 3KK2A 5HLFA 2DNLA 1TKZA 2Y1JA 1W0HA 5LOQA 2P9GA 5AQXA 3MEGB 4BDPA 5F8GA 2KYXA 1IM4A 4M8LA 2F96A 1S1UB 2WOMB 3MMJA 3CDUA 4TYAA 2CWKA 3T3FA 2VGMA 4E7KA 3VQ9A 2CPDA 3DDIA 3N28A 2CQGA 5C2CA 3G6VA 4OQJA 4DTPA 2IIRA 1AZSB 4QWCA 2RS2A 1OYEA 5HP1A 2WCXA 4UZBA 4OZLA 2HBZB 4FN5A 2MGZB 5HO4A 1HNIB 4I2QB 2NCKL 3NGSA 1N34K 1JLQB 2A6MA 4CLWA 1RT1A 5F3TA 3ZT4A 3M05A 2UXBJ 3ET6B 2PD1A 3MCAB 4NCAA 2ERRA 4B8AB 2E20A 4C3MA 2MQNA 3VAHA 3MECB 4OJ1A 2Z58B 4QOTA 5LMNK 4CTAA 4LF7F 2W8LA 1F21A 4JV5J 3OTBA 5JVHL 3GE1A 1T03A 3ZLJA 5KFSA 4JHDA 3H5YA 3SXLA 2Z4PA 4TLRA 3DC2A 4AHTA 3S6EA 3K8VA 3HZ6A 4OYZA 5A0YA 4UY8T 5FLXY 1NSPA 2GQCA 2XNRA 1TKTA 4M41A 4KI4A 2L9WA 3B4DA 4X4SA 4ED1A 3R2CJ 4FYYB 3LH2S 1NSQA 4CP5A 5ADZA 2D1KA 4BG9A 3PX6A 2VQFJ 4H4MB 4OPJA 3E8OA 2L9NA 3VOVA 2KHOA 1T9UA 5M1PA 4PWWA 2QW9A 1TL5A 4ZVOB 4PR6A 1P6TA 1QLNA 3T5LA 2HHUA 3VQCA 2VG6A 3M8RA 3KD1E 3BGUA 3TUJC 1V3SA 1MLAA 5AQGA 1K47A 4JYAF 3CW2C 1X9MA 2HHXA 2Q31A 4E3SA 1B0VA 3HL8A 3HOSA 3E01A 2PEHA 4DG1A 2NZ4A 4KREA 2DGTA 4LMZA 5GAEU 4DV1K 4CGIA 1R6VA 4KYZA 2MJUA 4KAZA 3QRQA 1NCLA 3CJ2A 1M0SA 4DL5A 2OAUA 1NPRA 5EU7A 3M32B 1HFEL 2OO4A 2B4PA 4USWA 4ECUA 4KHPJ 3FSXA 4AL5A 4B3TJ 2FZGB 1OMSA 4CT8A 3EVOA 4ZPCA 3OSNA 5AE1A 3PW7A 2C2EA 2Z1JA 4HH0A 4F4ZA 4LFBF 1TYQB 4WBFA 2Z2ZA 5HATA 3VQ6A 5DLFA 1VQNS 2W7PA 3D2EB 3CC7S 3U9ZA 3E1YA 3WX8A 2XYHB 2KKHA 4FLUA 3P49B 1EZZB 1N5TA 4BREA 2IMOA 1ZBFA 2KM8C 5FPMA 2E9RX 3AB2B 4OLPA 3O9QA 4FYVB 3PIOQ 4HHUA 1VQPS 3DYAA 2OPSA 4JBCA 4USIA 3CUNA 3CE8A 4JKFA 1NK8A 3AARA 2H48B 5K8PA 3MPWA 4J9NA 2OA8A 4CHYA 2OYQA 2OEJA 4DUYJ 4IOCQ 4RPFA 4X66F 2G8HA 4BCAA 1RAGB 2PYJA 3QWUA 3EDRB 2YV0X 1Q95G 4AHCA 4CJVA 1VRQC 1Y97A 4NCBA 2KFNA 4TY8A 1N5YB 4KGZB 2D7SA 4ZPBA 3L95X 1Z25A 2DYAA 3C94A 5EXWA 2XCPA 4KY3A 2VYPA 3L7OA 2W9CA 4B3MJ 3M6VA 3G10A 4Z4GA 4PHTX 2GGPB 1SS6A 5KFLA 4J9LA 5M1FA 1ICEB 1FW6A 3BSNA 4N5SA 1KC8O 1X3NA 1H1VA 2E7WA 3B54A 4KJIA 2HMIB 3DRSB 1FJGK 3FEZA 2Q0RA 4ID1A 3I9V9 1WI8A 4RNMA 4Q0BA 3O9TA 1XHZA 1WEZA 2BJ7A 1AROP 3CCRN 1JCGA 5GIOA 2HFZA 3KNAA 1RBVA 5J1NA 3B8AX 4KGKA 3A3NB 4K25A 5KGXA 3MM9A 4DQQA 3AHPA 4ELUA 4NXNF 5KI6A 5H9EK 4YDUC 1S12A 3KWMA 3OYLA 1QM9A 5KQDA 3DLGA 1XNRJ 4DPXA 1WSEA 2X1AA 1XHXA 1VQON 4FXVA 1TK0A 4EZ6A 5AQMA 5M2UA 1YI2N 1IKXB 2G1HA 4HI2A 2M70A 1TU0B 3OFGA 2P5GA 1U8SA 4PG5A 1Z1ZA 2BTFA 1S3XA 2F9JA 3D7SB 2UXDK 5A8KA 4WPAA 4Z37A 2X74A 4FZZA 3NMUA 3TX8A 5AQQA 2ILZA 1IWGA 3ZTQA 4IH7A 3OUYA 4C4WA 2C42A 2LEPA 3SAFA 3C16A 2V68A 3ZX3A 1R0AB 4FLYA 1XC3A 4ZN3A 2WK4A 1YXQA 2YWEA 1C0TA 2CDQA 5KFWA 2GUIA 4LRFA 2VV5A 1K8AT 1RE1B 2K06A 2PO4A 2XO6A 2HLTA 2E9ZA 1D3WA 1XR6A 3Q8SB 4ZP9A 5EOYA 1KLMB 5C15A 2ZUGA 3R6GB 2GS8A 3EUNA 9ATCB 1D1UA 1U48A 4ECXA 1KVCA 3SIPB 1AB8A 2QWRA 3OYAA 3IUCA 4GKJK 2PIIA 2EEYA 2W4CA 4CI0B 4NI2A 4H4KC 2RHSB 1R43A 3L2RA 1KAYA 3ZZOA 4URSA 3O4QA 5C12A 5TKYA 4CZKA 3MEKA 3QLHB 2DTJA 3MI7X 3BEGB 2F8HA 3ICLA 1CZAN 4DOZA 4ZCIA 1NJXA 3CEDA 4DR1J 3C19A 4KV8B 3SSQA 3K0JA 4OHVA 3ILOA 3C15B 4I9LA 2EBGA 4NLDA 4AQYF 2GIQA 2IVFB 4K8RA 1J53A 3KK7A 1U0HA 2V8GA 2W2OP 1ZOTA 5GAGI 1KCFA 4KB1A 3K59A 2BZ2A 1E6YB 2XMTA 1QHTA 3PTWA 1MDUB 1DTQA 1O5JA 4WKYA 1SZ2A 3U1NA 2G8IA 2UVWA 3GYGA 5DGAA 3EGZA 4TQSA 3M8PB 4DR4J 2FPHX 2CQHA 3W2WA 4WYWA 5E3CA 3QESA 3UE5A 2RU9A 1NJWA 3CULA 3WNHA 4N41A 3UKUB 2D5RA 4XAKA 5GADU 4DPYA 3E9LA 2LA6A 1PBAA 3WEEB 2DB1A 4J9VA 2XG8A 2UU9J 1OQ6A 3ZSWA 2F4VF 4FJ8A 3HKZD 3RW6A 2R8KA 1JB0C 4NEZA 4IO9Q 2B3TB 1ASUA 2YBVA 4F4YA 2DNZA 3DGPB 2ZHAA 4C11A 3GQCA 2IAJA 4X65J 4IFYA 3V4MA 5KFMA 4DV4K 2FF3B 4IXCA 3POTB 4CYUB 4QYZJ 4AHSA 3R9LA 2DIUA 2DNNA 3D6MB 4H8KA 3SUOA 4MK9A 4NO7A 4C2MA 5F8HA 3BY5A 3VVTA 1KQGB 3AVBA 1QJHA 2VG7B 1R8CA 1GAOA 2OPPB 2OMOA 4DKWA 4BGAA 1J5EK 1FX2A 2J0SD 4YB1P 1TUVA 4CLPA 4CHQA 1XJWB 4PG8A 1TELA 2IY5B 3R8YA 2IVPA 1C0UA 3VF0B 1H2UX 4FVCA 2YKNA 1SL2A 2BR0A 4K2XA 1FXRA 1N5VA 2DH9A 2Q43A 1M5PC 3S8SA 2XSJA 2IVYA 4DPTA 5KPTA 3VGSA 1IWAA 3NP5A 1LOTB 4NOHA 5KT4A 3OS0A 4A61A 3HI0A 4PUOA 3MMAB 1KVIA 2DY9A 4F4AA 4DSJA 3PHEA 1OYDA 3FRYA 2ITMA 1FRMA 2K8GA 3CFRA 2YKPA 1QAIA 3GPAA 4K4XA 2GVZA 2M2BA 4DR5K 2A2DA 4CJQA 1U1KA 3OVAA 3IWLA 1S1XA 2WBMA 4GRSA 4BRLA 2OGUA 1BWEA 2ZDOA 3KZBA 2WVEA 3DLEB 4CFDA 4KIAA 3CCWA 2HNDB 5DDOC 1JCFA 2QZ8A 4CRJA 1UA1A 2E9TA 3NF7A 3IRXB 2WTFA 3M1FA 3HT0A 3Q8UA 4J2EA 1FEEA 2OEKA 2UXCF 4KO0A 3ATVA 2OIHA 1OKJA 2MY7A 4P9SA 1T95A 1FF2A 4DX8H 3CCJS 1FKAF 3TVYA 1JLCA 1UOCA 1NK0A 3PW2A 2HS4A 3BEXA 4EO6A 1M90O 3AAPA 2XI2A 2NRRA 1HL6A 3DJCA 5GVQA 1VSKA 3P45B 2QSWA 3TJ9A 5CE3A 2KT5A 1RT7B 3CTRA 2NSBA 1NGAA 3JAMO 4ECQA 2VBXA 4R79A 2RKIA 5T14A 4CH1A 2E44A 2RUGA 2GVDB 2IJNA 2DT9A 2YWHA 3DXMB 4BG8A 3OTCA 1VQ7S 3RB6A 1NB7A 1MNEA 1X4DA 1H6KX 5AQYA 1YBUA 1YTUA 1S59A 5GAGP 2FVPA 1WC4A 5KT6A 5LMUK 1MWYA 2LQ8A 3NH1A 4DQSA 5H1SQ 2NSCA 3L09A 4U95A 3N6MA 2KI2A 1C4CA 1MWZA 4WXWA 1N36J 1VRUB 1FA0A 1CBKA 1FX4A 3QAEA 1OQ3A 3KWGA 3THTA 3MAHA 2YQ1A 4OJRA 4K59A 1FKOA 4DSKA 1WORA 1RT5B 4J9PA 2JC0A 4XPEA 1OPIA 4WFBQ 3UD4P 4JI6J 3QEIA 5AXNA 1WJ9A 4JS4A 4BY9C 2V0NA 3ZX2A 3SUQA 2YNHB 4EU0A 3MN7A 3FBFA 3PJ9A 4H5VA 3UKRB 2B9EA 3JSRA 1SQGA 2ZUAA 3I5BA 2EX3A 1GLAG 2BJEA 3WUHA 3BGOP 5C2FA 4E7JA 4I2PB 1G4CA 2I8EA 1T02A 3VEYA 1Q18A 3JS9A 1Q86T 1F2GA 4I64A 2KKZA 2ASDA 4JUZA 5KFFA 2HVIA 1WSFA 3OL8A 2IBKA 3D1OA 5BJRA 3T1AA 3V9UA 2YXLA 2ZH3A 4EMDA 5KT7A 2HURA 1I39A 2LDIA 3BH6B 3GIIA 4IOCL 2LCWA 3BYRA 2FJDB 4USUA 4OHZA 4RL1A 3OR1A 3HJVA 2GX9A 3AO5A 1MU2B 4G6VB 2GTDA 5IQ6A 4OI1A 3MMCA 3VQTA 5FPNA 4NLPA 4DF4A 2LYVA 1CSJA 4LFCF 2XB2D 4BLGA 2F5GA 2V5HG 4P6QA 4C0BA 3OLAA 2KL8A 1HBOB 3J80U 1F3FA 3H46O 3IG1A 4QYRA 4URQU 1VSDA 3EN9A 4ZLJA 2V51B 4ZP7A 4LFAK 2B8PA 1FJGJ 3DOMA 2LKZA 3MM6A 4L6V3 1SC3B 1GLFO 1C4AA 2MTLA 3AVJA 4RX6A 3MEDB 5KFJA 2ZWHA 3MXJA 3DLJA 3R5CA 1K8KA 4NASA 3G82A 3IAYA 3I6PA 2FVQA 4HR2A 1X0FA 3KD5E 5DG9A 3MN6A 3O2IA 5K14A 2ZM6J 5C0YA 1I94F 4FPAA 3NDKA 1XK8A 1N5QA 1TV6A 5H9EJ 2Y8YA 3H2UB 3THWB 3OQ2A 3PO4A 4ED2A 3DRPB 2YKMA 4FLVA 2G8VA 3M6UA 4ZS6A 2GAHC 3NBPB 1JXLA 2AJFE 2XLJA 2H3GX 2X6NA 2I9SA 3O1WA 1E6VB 3EDQB 5KFYA 4G1QB 3TOQA 1WC3A 2HFUA 1ZZFA 2UXDJ 1VQMS 1EX8A 1I51B 1VQLS 4DWIA 4IEEA 2JDJA 4DV5F 5F9NA 1VQ4S 3P4IA 1T3VA 3RBEA 1OH6A 2FB0A 5HSPA 3AOCA 4ED8A 5AZJA 3LZIA 4HTUA 1ELOA 3FKBA 4MQ3A 4Y1CA 1VFJA 2ZH9A 2YKAA 3CCSN 2XS2A 1WC0A 1S72S 2CGJA 3WQUA 4BVPA 4MK8A 5BYQA 5SUHA 5KRSA 2WONB 3CCZA 5C2GA 1RZMA 5CYQB 4P2SA 1ZH5A 2A6OA 5GAHI 1DT9A 2D1CA 1KVJA 3GFZA 4ECZA 1OY6A 3OS2A 2VWBA 3TI0A 4CEAA 3CJ8A 4GKJJ 2R2SA 1KONA 3AODA 4OX9F 3ENAA 5AQRA 4LF5K 2JFKA 2K7KA 4ZPVR 4M5MA 3J7ZO 3I33A 2N4DA 1FKPA 3HSCA 3NMAA 4ZCKA 1RTZA 4ZPAA 3CFOA 2JNJA 5E0OA 4ZPDA 4X62K 2AV5A 1RAAB 4RUHA 3CIPA 1U6BA 3C66A 1Q8IA 5HJYA 5IV3A 3PUFA 2GBZA 2G4BA 1JLEB 5FDLB 2W4DA 3DCAA 3ZZTA 3MURP 2UVVA 1B9FA 2PA3A 1RTIB 3ENQA 1ZYQA 4UTGA 4Z4FA 2QXFA 2QL5B 1WAFA 1ZTTA 3J81U 4DBQA 2H5JB 2HHHF 2OZSA 2GQQA 1O13A 3C3LA 4ZHRA 1N34F 3H7HB 2ZVIA 2V8DA 1RHUB 2O8BA 3Q89A 1RT6A 4XDCA 2NZTA 5D4NA 1CPZA 5B0BA 3O3FA 1JXEA 3CCLS 1YTYA 1NJYA 2P9UB 1BU6O 5DK5A 3KLGA 1BO5O 4L3QA 3M6WA 3GV7B 4CK3A 4FVMA 2P51A 1NU4A 1XQIA 2DK2A 5LMNF 3WHIA 2QKBA 2W8KA 3V6JA 2P2CB 2HSTA 3ZSVA 1L3SA 2QX0A 4CK2A 3WXMB 1TL4A 5B8HA 3VQQA 4O0NA 1IBLK 3QT7A 3HMJG 4IO9L 4KAIA 4HWIA 4DV4J 3AA5X 1UFKA 4FOEA 1JX4A 1S1WA 1NUEA 1Q7YO 2C3YA 4WZQA 1WUAA 1UP1A 1NMDA 2VFVA 2HOEA 3AVGA 3H1VX 2HBMA 3CT9A 4FK4A 1J5EJ 1LWFB 2DHHA 3N6LA 1HUXA 4NLWA 4J90A 4JI2K 5B0CA 1EETA 1UETA 4JI8F 2IVNA 3C6AA 5J2NA 4K43A 1T94A 2FC8A 5CD4A 1XTZA 2BDPA 3AH6A 4O0IA 2ZJRQ 3M9MB 3FCVA 3I82A 5CXTA 4PKGA 4NCGA 2AJ0A 1YSJA 2ADBA 1BUXA 1FE4A 5KG0A 2AJ1A 3QBCA 4EO8A 3K58A 3ZZZA 4ED3A 3VN5A 3ZTPA 2MKHA 3U8XA 4K42A 4DV1F 3PIPL 2R8HA 3AVLA 4ATNA 4Z7CA 4WFYA 2IJFA 3R27A 2BGGA 4DR5J 3H8YA 5EUHA 1T7PA 4DSFA 1M5HA 4LF8F 3AVNA 3H5SA 4CEFA 2DGUA 3TUIC 2RRAA 4L73A 3VEWA 3DN9A 1OS5A 4TYBA 4RJVA 2EG2A 1E4GT 3RSEA 1PG5B 1GMWD 5DLGA 1P8ZA 1NGBA 1O6XA 1LNQA 3R5AA 1LK7A 1RBAA 3ZO7A 2G0JA 4TKTA 4U67L 2CGLA 3W5ZA 2QWNA 3TPQA 1FWLA 4QBUA 2WSFC 5GAHP 8ATCB 1GX5A 3F56A 1REVB 4ZIVA 1YHQN 4Q2LA 1RT3A 2KXNB 5D4PA 4Z4HA 4F0MA 3J7AN 2E5IA 3H0PA 4CZCA 2Z56B 4ZOSA 1SUQA 1X5PA 1Y3KA 5FLXO 2VL1A 4Y6IA 4B9TA 5A8WB 5EWGA 4B1VA 4M5NA 1S9EB 1M5KC 3I56N 1HQ2A 3VQBA 3I32A 3HYFA 4BR7A 2AYGA 3M8QA 1RHMB 1UCNA 4OGEA 1YJ7A 4LJMA 4N7TA 5LMUJ 2FGCA 3QIPA 3VQSA 1B7YB 3GR1A 4CHPA 1GXTA 1O8BA 1QQNA 3KJFB 1QDUB 2E1CA 1WD6A 4OZ0A 1X4AA 5HL7Q 3HSJA 2ZH5A 4FF4A 1F5BA 2DCLA 2RQ4A 3R7NB 2LSNA 2HNZA 3V4IB 1UPMB 1SH2A 5SWMA 2FBYA 5DS7A 4WFBL 4DR2F 2L3MA 2LEBA 3EZWA 2ABYA 4LRCA 4DFPA 3NH0A 4YOUA 4F0HA 3C7NA 4DI6A 4UQGA 4ALZA 2HVHA 1XIQA 3ZCMA 1RAJA 4RW9A 2ZOGA 3JB9k 4NXMK 5L9NA 2P1JA 2QLWA 1VBKA 2QTWA 4RW4A 2XMMA 2IM1A 5KFRA 4NMXA 4K4SA 1HD1A 3KWIA 4PXEA 2HHSA 4C8LA 2QYCA 4YP3A 1DQ8A 4O3OA 2HZAA 4CEZA 2GJIA 2Y3YA 1VJQA 1CULB 2DGOA 4P7VA 3SI8A 2DXFA 4YS2A 1QSSA 2RDIA 2KN4A 3MF5A 4J9MA 3M8SA 2D41A 2J9EA 4JI0K 3PACA 1TQLA 3F9KA 4P10A 2HBRB 4CJWA 2H5IB 4KE5A 3H3NO 3EVMA 5KOWA 3D6HB 2I7NA 3SI6A 2BANB 4DQIA 1GMUA 3UD3P 3TAPA 4K8ZA 1TMMA 2D3O1 4TU7A 2NREA 4M42A 2ZBQA 3IM8A 4Y65A 5L46A 3V9XA 3UWTA 2A10A 3LF0A 1XMBA 2ZJPL 5D78A 2WRMA 1VSEA 2OP5A 3PKYA 2V4JB 2OKQA 5B0EA 1ATSA 4OO1J 4LFAJ 3SPZA 2P9PB 2IJRA 3ETMA 4HVJA 3EE9A 1SH0A 3QBWA 2WUSA 3V1RA 2M52A 2RS8A 1VMBA 3FBBA 1LW0A 4BC2A 5BR9A 3WIVA 4ES2A 1JLAA 1N4LA 3QB0A 1ZBHA 1RAFB 1T0TV 2PBDA 3FC9A 5C42B 4QIEA 2CZ4A 4MKYA 3F0NA 3KLVA 3W3SA 4QU7A 2YHYA 3ZZYA 5J1EA 2QL7B 3A13A 2C3UA 2WC9A 3M2VA 2UUAF 1SI9A 3VGUA 4DU8A 4LSLB 1Y0HA 1S6UA 2B6AB 4YR0A 4E0DA 2CNLB 2IRXA 1HYSA 3PNIA 3HBTA 2GQ2A 3PYEA 1NAQA 5D0EA 5KFQA 4BVOA 3NF8A 1KBRA 3DHWC 1H2VZ 1WC1A 2U2FA 3OXFA 3R3LA 2BM0A 3GDQA 2M8HA 2FZCB 3KKSA 1P90A 2CNKB 2H54B 4PWDB 5DQHA 4ZDNA 4LF4F 3HVTA 1WDTA 2YPZA 2Q0UA 1XMOF 1ZAXA 4O3SA 4LH5A 2QTDA 3K9JA 2L48A 4C97A 3AD8C 1TAQA 1S9GA 4FWOA 1UA0A 1RDCA 4FKYA 4B9MA 3SBTA 2OSRA 4DS5A 2AA4A 2GMJA 2VONA 1UVJA 3LDSA 1HBNB 4FXWA 3DDNA 2V4QA 4IEIA 4RTFD 5AQPA 1SC6A 2FY8A 3M2UB 1VAZ<