3DMJA

Crystal structure of hiv-1 v106a and y181c mutant reverse transcriptase in complex with gw564511.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 142
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dmjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dmjA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dmjA05
4IFVA 4KB7A 4B08A 5F8GA 3LWMA 1RT1A 2V0NA 4DL3A 2YHAA 3CM5A 3V9UA 1L3SA 1YT3A 2HNYB 1SL0A 3K58A 3HPGA 4CGDA 4RUCA 1N4LA 4IH6A 3LDSA 3PW2A 4MQ3A 3TAGA 4ICLA 1LAWA 3M9OB 2WRMA 3QGIA 4J9MA 4I7FB 4ED1A 2C2EA 3WNFA 4CFAA 1RTHB 3RMCA 2B6AB 3OJUA 4WZQA 3AA4A 4TY9A 3NDKA 3GIIA 3DOLB 3PR4A 2HNZB 3SYZA 4PUOA 4ZP6A 3AV9A 4KV8B 1HNIA 3DRRB 1W0HA 1TAQA 2WONB 4BDPA 1WN7A 4LQ9A 5KG7A 4DL5A 3Q8SB 3RTVA 4CJ5A 1JLEA 5KT4A 1C0MA 3RMBA 1SL2A 5KFOA 4YQWA 1SUQB 4LSLA 3T3FA 4R8UA 3V6HA 2VG7A 3VQ8A 5J1EB 3QGGA 3H4DA 3MEDB 5I42B 2D3UA 1BQMB 4TSXA 3ZCMA 1RBVA 4RG8A 4QWEA 1VRUA 5DLFA 3C95A 2J6SA 5KG0A 1NHVA 4CJQA 4K4WA 2DPJA 4RW7A 3WNHA 5KG3A 4ELTA 1IKWB 1S1XB 3IS9B 5CYMB 1JLCA 2ASDA 5F8IA 3CWJA 5C42A 3OL7A 3DLKA 2RN2A 3NF7A 4CGJA 1MU2B 4DWIA 5JXSA 2QXFA 1DLOA 1RTJB 1D0EA 3VA0A 2KTQA 2BRKA 3NH1A 4RW9A 2BANA 3IG1B 2YNHB 3V9WA 4KHMA 2W8KA 4C8LA 4NLUA 4WYWA 2HHWA 4JS5A 4TN2A 3ZSVA 3KLFB 4C8MA 2Y1IA 3AVLA 2WOMA 2BE2B 2X74A 2C2RA 4Z4EA 5T7BA 1KRPA 3I8DA 4J9KA 3ASMA 3IRXA 4IQXA 2FJXA 4E7KA 2YNGB 1KFDA 1ZTTA 1RILA 3MEGB 4XPEA 3SZ2A 1T05B 3KK2A 4Q0BA 1RT7A 4CE9A 4O0JA 2ZD1B 3FQLA 2IAJB 1S5JA 3UR0A 4RW4A 4YMEA 4K4TA 2YHBA 2AGPA 1RDCA 3CJ4A 2DY4A 4JV0A 4L8RB 5EU7A 3AVJA 4PA1A 4W5NA 1NKCA 2FJWA 4KAIA 3T5KA 5F8HA 4BE2A 3IGNA 5KFBA 1WAFA 1HMVB 3H59A 1S1WB 4K8XA 4JUZA 1NKBA 4TQRA 3HVRA 4DTSA 4R5PB 3QERA 1QE1A 4WFYA 4IDKA 3VN5A 5L1LA 3PW0A 1KVBA 1Q9YA 1QUVA 4YFUA 5DG8A 1UWBA 3ICLA 2G8FA 1S1UA 2I5JA 3CDEA 1QSSA 1HPZB 3GIJA 3G6XA 4QWDA 3ZT3A 3KK3B 3QO9A 4EZ6A 4LSNB 3BSAA 1HYSA 5KFXA 4Y1DA 4IG0A 3QEXA 3MXJA 3MR6A 1TK8A 4MKAA 4JV1A 2YKMA 3PJXA 4PWDB 2HAIA 3DRSB 1S1VA 1EKEA 2EX3A 3H98A 4O3RA 4QWAA 1IKXB 3ITHB 4IH5A 1RBTA 4E7JA 1HJRA 3OYKA 3GV5B 1NK0A 2FBTA 3OHAA 4F2SA 3QNOA 1SH2A 3BSCA 3CM6A 1ZETA 5KT3A 1TGOA 2VG6B 3ISNC 4XIUA 4M3UA 3B6PA 2FVQA 3AVNA 1C0UA 5EUHA 4W5QA 2PYLA 3AVKA 2R8JA 1JLFB 4C8KA 1XR7A 5EWGA 3KHLA 1N6QB 3KLVA 3LP3A 2KZZA 4F4XA 4URSA 4ZPDA 3NCIA 3OYAA 5KRSA 2JC0A 1D9DA 4WFZA 1DTQA 1S49A 3I0RB 5F8MA 1T03B 4CEZA 3QZ7A 4FJ8A 5C24A 3KK1A 2JC1A 3LP2A 3RMDA 4KKOB 2OPPB 4O4GB 1XI1A 4CHOA 1GX6A 5DQHA 2IS3A 1VSDA 1YTAA 4CHPA 5F9LA 1T8EA 1SKSA 4B3OA 4DU1A 4CF1A 3PO5A 3AO4A 5D3GB 3IGVA 1BHLA 1TV6B 2HMIA 4N41A 5HRRA 1NK8A 2R2SA 3NKYA 1JL1A 5KFCA 4J9RA 1RBRA 3L2UA 2IJFA 3KKRA 3LP0A 4KO0B 2AJQA 3TWHA 2W9BB 4ECXA 4W5OA 2FLPA 4KHWA 4QAGA 1RYRA 1UA1A 3CJ0A 1FKPB 3HKWA 4M3TA 3PR5B 4DQIA 4Q45A 2XC9A 3OYJA 4ECSA 4ZPBA 1OS5A 1TKTA 1RNHA 5C5JA 3BQ0A 1NK4A 4N76A 2W9AA 3CDUA 4WZMA 1RT2A 3GV7B 2D0CA 4KHUA 4FM0A 2P5OA 1NJWA 2ASJA 4CGFA 4EEYA 2VA3A 4I2QB 4RNOA 4Z0UA 1ASUA 2QKBA 4ED2A 1QQCA 2IM0A 3CG7A 4RW8B 1S9EA 4ECRA 4ID5A 3L8BA 4O55A 3I0SB 2FJVA 1IH7A 4DLEA 2QKKA 3V1OA 4DMNA 4FS2A 3SFGA 3KLGB 4QW9A 4KHQA 1XHZA 4WFXA 1ASWA 4KPYA 3AA5X 4X2BA 3FSIA 4ED7A 1K6YA 3SUOA 2E9ZA 3NF6A 3QNNA 3OHBA 3KD1E 3RB4A 3OYEA 4CJLA 1VRTA 3AVMA 4HHTA 4FVMA 4IKAA 3EYZA 3UDLA 1UAXA 3VQ5A 4TYAA 5J2PA 4IG3B 5I3UB 3SNNA 2UVRA 5DLGA 5HP1B 4OPKA 5JS2A 2OPQA 1L3VA 2Z1GA 4YP3A 3OL6A 4BWMA 4U6PA 3PY8A 1RDRA 2F8TA 4KAZA 1S6QB 4ID1A 5KGXA 3C6UA 1N5YA 3OS0A 2EC0A 4Q43A 3MR2A 5C25A 1X9WA 2OPSB 3ZSRA 1IO2A 1U47A 4JRQA 3EPGA 1IKYA 1S1TB 1VSJA 2IM2A 3HSTB 4QPXA 4ECYA 3Q8RB 5L1IA 1TL3A 5HLFB 3NGDA 3IAYA 3QIPA 4WE1B 2D0AA 2OPRA 4IRDA 1TK0A 4ZHRA 1SKWA 1BIUA 2OA8A 4O0IA 2XY7A 1IG9A 3FDSA 4FBTA 3DM2B 1RA6A 1K1QA 2Y1JA 3TAMB 4E1MA 2ATQA 1I3AA 4B9TA 2R7YA 2D41A 4CJ4A 5KFZA 5J2NB 4JLHA 1YVUA 2WB4A 2B5JB 4IR9A 3QLHB 4IFVB 4O3PA 2IGIA 3HO1A 4M3ZA 4ECQA 1NJZA 4BE0A 1RT1B 4J2DA 5HRPA 2J6TA 3KLIB 5CYQB 3NBPB 1A5XA 3C6TA 2UUTA 4CJEA 5KFLA 3DLEB 4H4MA 3ULDA 5FRNA 4FLZA 1ZBFA 3DRPA 3T5LA 1RT5A 5L9XA 5KFNA 3EPIA 4CFBA 3E51A 4OPJA 1VSHA 2RKIA 4R0EA 3UQSA 3TVKA 1S10A 4KE5A 3M8QA 1WNSA 3MECA 4DU3A 4ED3A 3AO1A 2C2DA 3DYAA 1EP4A 3NGZA 1KVAA 2FVSA 5KTQA 3LPTA 4DLGA 1HQEA 3K57A 4PUOB 3RR8A 3KD5E 1W25A 3HL8A 2CKWA 4CEAA 3QEIA 1HNIB 1NHUA 4AHVA 4F8RA 4DF8A 3MXIA 3SCXA 4CGGA 1D9FA 3AVBA 1RBUA 5F8LA 2IC3B 4MK8A 4FLWA 4R8UB 3KLEA 3M8PA 3I5BA 4CK2A 5CY4A 1WSEA 3V6DA 2HNDA 2C28A 4EBCA 4QWBA 4PQUA 1RDDA 2D5RA 4TLRA 2G8IA 2ZE2A 1LW0A 4RW7B 1RTDA 1SH0A 2GIQA 3DMJB 4YR3A 3RBDA 4HUFA 1JLCB 1BI4A 4CEFA 1REVA 4CEQA 2XGQA 1RCHA 1LV5A 2OYQA 3RWUA 3N6LA 1RT3A 4O3SA 1KHVA 4DEZA 3BDPA 2W9CB 4RW9B 4DG1A 3KJVB 2ZQBA 5SZTA 2BANB 1FK9A 3PW5A 4DL2A 1S9FA 1S48A 3PW7A 1KHWA 2D3ZA 5FDLA 4J2EA 2HHQA 2Q3SA 4FW2A 1JKHB 1BGXT 4FLXA 1TVRB 1SH3A 3G0ZA 1W9HA 2R8KA 1VSEA 3RRHA 3DLGA 3VQCA 1B9FA 4Q5VA 4H4OA 4AHCA 3OYBA 1CZ9A 1NOYA 4MIBA 3AA2A 2Z1IA 4OKEA 4M3XA 3HPOA 1B9DA 3L3UA 4CGHA 4NRTA 3IRXB 3CFRA 3PO4A 2RPIA 3DI6B 4HKQA 1NNDA 3ZSXA 4Q0BB 1RT7B 3NGIA 4DTNA 4YR2A 2KFNA 4RW4B 3HVTB 1EETA 4Q8EA 3KLHA 1R0AA 2XI2A 1YVFA 4E0DA 4CJFA 3ISND 1VK0A 3CDWA 2AWZA 1O1WA 3V9XA 1QSLA 3QGHA 4K4VA 4ZTJA 1C0TB 3T19A 3H2LA 3BR9A 3PVXA 4CEEA 4ZVGA 2X6SA 4CEBA 2F8EX 3EZ5A 3RR7A 4NYFA 3V9SA 1N56A 3VQQA 3K5LA 1QE1B 1Z26A 4IDKB 3DOLA 4ECZA 3SI8A 2I1RA 2W7OA 3G86A 1UWBB 4NZ0A 3VQSA 2KFZA 5KFRA 1J53A 1S1UB 1T7PA 2YKNB 3SUNA 3DRRA 4M3YA 3HVAA 2WONA 3QEWA 3QO9B 1S4FA 4CJRA 1NJYA 5DGBA 1JLAB 3HHKA 4IG0B 3VQAA 4DQPA 1WSJA 3AO2A 4FS1A 4TYBA 2YKMB 3MAQA 4FZZA 4I2PB 3KMSA 5DMRA 4K4YA 3QETA 5KFQA 5J1EA 3MEDA 2FBXA 1BQMA 1S1VB 2RF2B 2FVRA 5F8NA 1TKXB 2FVCA 5KFFA 4DFMA 2ATLA 4M41A 3OYMA 3CVKA 3WNGA 3HXMA 2WTFA 1TL1A 4KSEB 5KFTA 1S1XA 3IS9A 5FRMA 4M3RA 4Z4HA 4N56A 4DFJA 1J5OB 1WSHA 2GIRA 1DTTB 1JLBB 2WK4A 1RTJA 4RW6B 1ZBUA 1K1SA 2VWJA 2GC8A 4B9VA 3SQ0A 1C0UB 4ECVA 3O3GA 5T14A 2YNHA 1U09A 4DTUA 2CJQA 2AX1A 4RNMA 1NJXA 3CFOA 4CEOA 3ZT0A 3L2VA 4W5TA 2HHVA 3KLFA 4M42A 1RTIB 5HRNA 3FQKA 2P51A 5KFYA 5C24B 4OLAA 3MEEB 1T94A 2FBVA 4F50A 2UVUA 4DTPA 2KW4A 2RDJA 1JLQA 1I6JA 3Q8PB 1D5AA 3KHHA 4FBUA 2G8HA 1IKVA 4ZP8A 4Y2AA 3U3GA 3UPFA 2WHOA 3G6VA 4YNQA 3MEGA 2IM1A 3MFHA 4E3SA 4MFBA 1FKOB 2HWIA 3L2QA 1KLMA 4EBDA 4AILC 4DSKA 3LP0B 2ZD1A 1L5UA 3HPHA 1RT4B 4K50A 4ELVA 1RT6B 4CJTA 1BL3A 4M45A 4AHSA 4J9PA 1B92A 3O3FA 3DDKA 3L2WA 2PZSA 5K14A 4NLOA 1RBSA 1LWCB 2NUBA 1XWLA 2FLLA 1C6VA 4F3TA 3OLAA 4CERA 4FJHA 1HQUB 4IKFA 1U45A 4FZYA 3V1QA 1S1WA 4XPCA 2IJNA 2YNIA 5HRSA 1RT2B 4J2AA 5KFIA 4R5PA 3K2PA 3VQ4A 1JLGA 4KI4A 4LQ3A 3JSMA 2R8IA 2XY6A 5KFKA 1S9EB 4ID5B 3SV4A 1KTQA 1D8YA 3KK3A 4NLDA 3KOAA 3DLRA 1BCOA 5HBMA 3K5OA 5DQIA 4CK3A 4J2BA 3D5MA 4F4YA 5KFJA 4HCCA 3TABA 5JS1A 4OJRA 1U49A 5DGAA 1NK7A 3DRSA 3ALYA 3E01B 3ITHA 2R2UA 2XWYA 4DTMA 2GBZA 3DLBA 1NK9A 5J2PB 4FJXA 4JRPA 4RNHA 4CJKA 1HNVB 3OYGA 2V9WA 4KFBB 4KHRA 2DPIA 3KHRA 2OH2A 4OL8A 4J9OA 3BJYA 2VG6A 2B4JA 4ZPCA 3RBEA 4E19A 1S9GB 1HARA 4IRCA 3VQDA 5KFGA 3FFIB 2O5DA 3TAEA 3I5CA 4OLBA 3CIZA 2F96A 3BQ1A 4HCBA 5C25B 2RDIA 3PW4A 3BGRA 1LWEA 1TKDA 3I0RA 1GOBA 1T03A 3OYFA 5J2QB 4KI6A 2JGUA 4FJNA 3H5UA 4BDZA 3OVNA 2ASLA 3PX4A 2PYJA 2OPPA 4O3OA 3GIKA 1TL3B 4BWJA 3QIPB 1CSJA 2OPRB 4F4KA 4ZVHA 3GILA 3VA3A 3TQ1A 5D3GA 3NMAA 4KRFA 1TV6A 4GW6A 1QTMA 1BQNA 3CJ2A 3RB0A 1VSMA 4URQU 4NLVA 4K4UA 4B9MA 4MH8A 4O3NA 1N48A 1RYSA 4E7LA 4KO0A 2AX0A 3LZIA 2D0BA 3L3VA 3FRZA 4RNFA 4Q8FA 4ZTFA 5KG2A 3PHEA 2X6NA 3SFUA 3V4IA 3EZUA 4CJ3A 1KFSA 1X1PA 1RDBA 2P1JA 1XR6A 1HRHA 4H8KA 3KHGA 2ZKUA 4MKBA 4G1QA 4LH5A 1ZBHA 2VG5A 4O44A 3SPYA 2KZMA 3C6TB 1LWFB 3AVGA 3H5YA 4QOZB 3DRPB 1NK6A 4O4RA 1RT5B 4RW8A 1JXBA 4NCGB 4NLSA 4CESA 4F3OA 4KTQA 1TQLA 3NAIA 2UVVA 4NRUA 5KG1A 1QS4A 3MECB 3CJ5A 3KLGA 4TXSA 2V4QA 2XRIA 5J2MA 5KFDA 3VQ9A 1YTUA 4RU9A 4KBIA 3DYAB 4CF8A 2XY5A 4NLYA 1QHTA 4B8CA 1HQEB 4FJ9A 5KG6A 3LAMA 1MMLA 3NF9A 3OYIA 2UUWA 3U3YA 4YR0A 2Z1JA 4FM1A 5KFMA 4CF2A 1WAJA 2ETJA 3V6KA 2AQ4A 2HB5A 4IG3A 5I3UA 4FK4A 3S9HA 3NL0A 4B9SA 3OYNA 4BACA 3KMQA 3LALA 2HHSA 3G10A 2BQUA 5L1KA 3M8PB 5HROA 3QIDA 1UOCA 3NAEA 3V6DB 2HNDB 4RZRA 3OJSA 4DQSA 2C22A 3HT3A 4KB1A 3N6MA 1C1CA 4DTJA 4K8ZA 2ZE2B 1RTDB 4ICLB 2XI3A 3ZT4A 5SWMA 4OKKA 1D1UA 4M3WA 2A1RA 3ZSQA 4DQQA 3RRGA 4Z4GA 3TAQA 1REVB 4E89A 2AGOA 1FXXA 1VSLA 3AVCA 3TR8A 4EZ9A 1RT3B 3LP1A 3AA3A 3AVIA 1EX4A 4DG1B 1JIHA 3T5JA 2IBKA 5KG5A 4WE1A 3AVFA 3HYFA 1ZTWA 1G15A 1I39A 2JEJA 3V81A 4BDYA 2V4RA 3PZPA 5FDLB 4NYZA 4DSLA 2YNFA 3JYTA 5KFSA 4LY7A 3NF8A 3U6FA 4F4ZA 1JLEB 3DM2A 4H4OB 2DTUA 5E41A 3TAMA 4LSLB 3OY9A 3SJJA 1JXLA 4IFYA 2VG7B 4GMJB 5J2NA 4DFPA 2HHUA 1VRUB 1SV5A 4NCBA 1CLQA 3NAHA 4CHQA 2B5JA 4W5RA 1XC9A 4B9LA 4TQSA 3QLHA 2FC0A 4NYNA 4CF9A 5C42B 1Z4UA 1EETB 3DLKB 1TKZA 3KLIA 4ELUA 5CYQA 3NBPA 3CQ8A 3D0PA 3KLHB 1R0AB 1DLOB 4KREA 1C1BA 4FJLA 3DLEA 4IRKA 4F2RA 3DOKA 4TY8A 3THVA 1S6PA 3O4QA 1HYZA 3VQEA 4NLPA 1KSPA 2ILYA 4E1NA 3ZSOA 5DK5A 4FJIA 2W7PA 1KVCA 4Z4FA 4HVJA 3KNAA 4QWCA 1LW2A 2WOMB 4DU4A 4CHZA 5KT6A 3LPUA 4CJVA 4FYDA 4EYHB 3QYYA 4C8NA 3ZSYA 4ZVFA 2XO7A 4QW8A 3K5MA 2QK9A 1C1AA 5F8JA 3CJ3A 4NLRA 3TARA 2J6UA 2R2TA 2JLEA 3KK2B 5FROA 2IC3A 4Y2CA 1BISA 1RAJA 1RDAA 1Z25A 3IN5A 2HNYA 4CJUA 4DFKA 2GV9A 3RAQA 1U4BA 3QIOA 1TL1B 1NK5A 3DMJA 3KKSA 4MK9A 4I7FA 1RTHA 2Z1HA 3HP9A 5KFAA 2BQ3A 3KTQA 2B6AA 3NHGA 3F73A 4DS4A 2W9CA 3KJVA 3AVHA 2R8HA 2HNZA 1IM4A 4FJJA 3CO9A 2IMWP 4C8OA 1HYVA 3RMAA 2I5JB 4KV8A 1RA7A 3BQ2A 5KFWA 1WSGA 1WLJA 3NGYA 3P1GA 2JEGA 4CF0A 3SQ1A 1JKHA 4DSJA 1TVRA 2O4IA 1HYSB 4B8AB 3HJFA 4K4SA 2E9RX 4FZXC 4CFCA 4ECUA 3LANA 4FJGA 4FJMA 3BSOA 1SUQA 1JLQB 3B6OA 4LD0A 3OS1A 1IKVB 5I42A 2HHXA 3Q8QB 3OSNA 1VSKA 3LZJA 2E6MA 4NLWA 4IBNA 3DI6A 3PV8A 4MFBB 1C2PA 4J9NA 1J54A 3VQBA 3GV8B 1KLMB 1SL1A 1IKWA 5CYMA 1L3UA 1JL2A 3SV3A 3HVTA 4KTWA 3VQ7A 5F9NA 2O4GA 1MU2A 5K14B 3TANA 1GOCA 5KT5A 1LAVA 2HW3A 1TP7A 2LSNA 4WXOA 3IG1A 1C0TA 4K4ZA 4DTRA 4OVLA 3GIMA 3MXMA 2YNIB 4XO0A 3OYDA 4KHSA 1DTQB 1JLGB 4CECA 4AH9A 4G3IA 4FLTA 4N47A 3KK1B 3JSMB 1ZYQA 2BE2A 1BIZA 3LP2B 3OLBA 1S97A 3H5XA 2YKNA 4ZVEA 3D28A 5KG4A 2OZMA 2FLNA 4EBEA 4B3OB 2BDPA 1CZBA 3K5NA 4DSIA 1ZBIA 1JLAA 1JXEA 2HMIB 2YNGA 4KHNA 5HBMB 1T05A 1KCFA 2BRLA 4ECWA 5KT2A 3OS2A 4I9QA 3NE6A 4I9LA 4I2PA 3QZ8A 2IAJA 5KI6A 3V6JA 3GQCA 4RUAA 1QAJA 3EY1A 2RF2A 4DSFA 1TKXA 3QEVA 4M95A 2A1SA 4CIEA 4CHNA 3SQ4A 3PX6A 1CXUA 4ZP9A 3I5AA 1TKTB 4RNNA 2R8GA 3P5JA 4F4WA 3QEPA 4DL6A 1HMVA 1Y97A 4FK0A 3TAFA 1J5OA 1DTTA 1JLBA 4QCLA 2VA2A 4RW6A 4MK7A 1A5VA 3DLHA 3SUQA 2XCPA 2E9TA 1GOAA 4URGA 2W8LA 4CHYA 1HPZA 4ED6A 2XHBA 3S3OA 4DQRA 3BGRB 4DS5A 1RTIA 1LWEB 4LSNA 2W42A 1NKEA 4LH4A 4JS4A 4CK1A 5L1JA 3QESA 4NLTA 3RAXA 2HVIA 3MEEA 4K4XA 2DFHA 1S0OA 3HP6A 4EO6A 3S3NA 4ZPAA 3UIQA 4PWDA 4AHTA 2GUIA 1VRTB 3O3HA 3LWLA 3MF5A 1IKXA 1WNEA 1BQNB 5EDWA 4J9QA 1CXQA 1U04A 2R2RA 1FKOA 2HWHA 4FJ7A 3SQ2A 3V9ZA 1RT4A 3NFAA 4FLVA 1RT6A 2OPQB 4PY5A 4J9LA 3MFIA 1U48A 3CFPA 3RB6A 5EWEA 3V4IB 2G8KA 1S0MA 1LWCA 3OYHA 4OGEA 3C94A 4FCYA 1JLFA 2XCAA 3C6UB 1N5YB 1HQUA 4EYIB 1N6QA 4CEDA 2JEFA 3D45A 4G1QB 2G8VA 4CJSA 2VG5B 1Q8IA 2HVHA 3OL8A 4O44B 4GC7A 4HUGA 3GYNA 5DQGA 4DL4A 1NOZA 4FJ5A 1IKYB 4CFDA 4KKOA 4O4GA 3M9NB 3NH0A 3MR3A 2QV6A 4WXWA 3NH2A 2ITGA 1VSFA 4FXDA 4ZHRB 4DF4A 4GVMA 4Y34A 5KFPA 3P83D 3M9MB 2IOCA 2F8SA 1TK5A 3MTKA 3T5HA 4CIGA 4HYKA 5KFHA 5J2MB 1XHXA 3PUFA 4DSEA 2W9BA 1A5WA 4HUEA 1Q9XA 3PJWA 3A2FA 4DL7A 4Y1CA 3M8SA 4Z4CA 1FKPA 1WSIA 2IDOA 4FK2A 1ITGA 4FLUA 4Y3CA 3E01A 1ASVA 4Q44A 2AGQA 4IR1A 4IH7A 5DG7A 4FM2A 2UVWA 3ZT1A 4H54A 2BQRA 4GC6A 1X9SA 1HNVA 2EHGA 2B43A 4KFBA 4CJWA 1T3NA 3O4NA 3VQPA 2QE5A 5HROB 3ZT2A 2BGGA 2X78A 1ZBLA 4DTXA 2YV0X 4H4MB 4EP4A 1WSFA 1S9GA 4I2QA 2XY8A 4Z4IA 3ZSWA 4J9SA 4IOBA 1C1CB 4ED0A 3FFIA 3AO5A 3OSPA 3I0SA 2E6LA 1JX4A 3F9KA 4E7IA 2RKIB 4ZMMA 4CIFA 3H40A 3M8RA 2FBYA 1TAUA 3M8QB 1EXQA 5KGWA 4ZP7A 4O5BA 2P5GA 4FJKA 4HTUA 3BREA 4KB0A 5J2QA 3AVAA 4NLQA 3H08A 3LP1B 1EP4B 5KFUA 1QSYA 3AO3A 3V81B 2AU0A 5KFVA 5DG9A 3KIOA 1QAIA 4FLYA 1L3TA 3OYLA 3H5SA 5JUMA 2IM3A 2WCXA 2BR0A 2YNFB 3JYTB 4JV2A 3HM9A 1KLNA 2D7SA 3H4BA 5HP1A 4CJPA 2IA6A 4O3QA 4BE1A 2KQ2A 3KLEB 4IFYB 3SUPA 4E7HA 3SPZA 3TI0A 2G8UA 1SV5B 2XGPA 4EP5A 4PQUB 4NLXA 1S6QA 3CYMA 1XR5A 2ALZA 3OL9A 1GX5A 3OYCA 4N5SA 1LW0B 4M94A 4FW1A 3K59A 1VSIA 3ZSZA 3MR5A 4KHYA 2OPSA 1BI4B 4OKJA 3WNEA 5CZ1A 1TKZB 3HK2A 1J9AA 3HVWA 3T1AA 3LAKA 1S1TA 3VQ6A 1C1BB 4KTZA 1LWFA 4EO8A 3DOKB 4TY8B 4CCHA 1S6PB 2DFEA 3V1RA 4NCGA 5HLFA 1UA0A 2G8WA 4DTOA 4CGIA 1FK9B 3SI6A 4WYLA 4OGCA 3PX0A 4ECTA 1F21A 2PY5A 1S0NA 3BSNA 3QINA 5EWFA 4B9UA 3S3MA 5KFEA 1BCMA 1LW2B 3DLGB 4AHUA 5KRTA 3TAPA 2ILZA 5CZ2A 4NCAA 4NLGA 3RB3A 3L2RA 4B9NA 3G6YA 2E4LA 2OZSA 4ED8A 5KT7A 1X9MA 4MIAA 4AHRA 4UQGA 2VWKA 1SKRA 2JEIA 4U7CA 2DFFA 2HHTA 2FVPA 3N6NA
chains in the Genus database with same CATH superfamily
3FEYB 4IFVA 3TOQA 3R5CA 1R8CA 4KB7A 2ZFHA 2KG1A 2YHAA 3K58A 4L3KA 2EKNA 4CGDA 1F5CA 1UETA 3HMJG 4WPAA 1N4LA 2VUGA 1NMNA 4U67L 3CXCM 2XQCA 3KYLA 4CFAA 2QEXS 3LDOA 3QRQA 3RMCA 2E1CA 4WZQA 5E2QA 3MHYA 3OV7A 3AA4A 1FI4A 1WEYA 3O1LA 4CBXA 4H5VA 3MX2A 3NDKA 3GIIA 1S3XA 2HNZB 2W24A 1IBKF 2H65B 3AV9A 1JJCB 3DRRB 3G6ES 3JXUA 4DUTA 1K73O 1WN7A 3Q86A 3G71S 4M7YA 2LMIA 2P9EA 2VFVA 2UUBJ 1JLEA 3RMBA 1SL2A 2BJ1A 3DCAA 2YHYA 4BQZA 1NSKL 3UE5A 3V6HA 2YKPA 5BRFA 3VQ8A 3LO3A 3IAS9 3H4DA 5I42B 1BQMB 3DAWA 3M30A 2J6SA 1NHVA 3IM8A 2XNQA 1YJVA 2RHKA 4I6MA 4ELTA 1LKZA 4DPOA 5CYMB 2ASDA 3HSDA 2XHWA 2RN2A 3NGSA 1MU2B 1QQMA 4OX8A 3CMES 3BO2A 1LFWA 3W62A 1RZMA 5JMVA 2P9CA 3NH1A 4DR7F 3VZHA 2P5VA 2W8KA 4NLUA 2MGZB 4JS5A 4B3MJ 5LMUF 3PACA 2GGPA 1RAFB 1VQKN 2A2DA 3UN2A 3WQUA 2NREA 2C2MB 3I96A 1NBWA 2C2RA 2P9NB 2DR6A 2GMLA 3UCGA 4FKYA 7FDRA 3I8DA 1U1QA 2AYEA 4E7KA 2YNGB 2GW8A 3TTDA 3SZ2A 3KK2A 3A8JA 5DDPC 4O0JA 2ZD1B 4TU7A 1R3NA 3VGUA 4DUYK 1HFEL 4H5WA 1KC8T 4DR4K 4LFBK 4EI2A 1JJHA 2AGPA 3FRYA 2HQFA 1SB6A 4RR5A 4XH5A 3AVJA 4X64J 3CJBA 5F8HA 1VBXA 2PE8A 3IGNA 1MW7A 4LF7F 3Q7BA 2GEMA 4K8XA 5M1KA 5ETPA 4B3SK 3QERA 4WFYA 2MJNA 3VGMA 1NJIT 5AZJA 4YS2A 1QUVA 3RJMB 5DG8A 5FLXU 1WC3A 3DLLQ 1OH7A 4PKHA 1RGIA 2FDNA 2WVEA 3X3UA 3MUVP 2ZZMA 2HGMA 3CNQP 4H0VB 4IG0A 3AB2B 1TK8A 2NPFA 1FW6A 3AA8A 3RU0A 3BH6B 4YDDB 3DRSB 3BEGB 2XSJA 1V5IB 1IKXB 2DNKA 1AXQA 2VB6A 4E7JA 1HJRA 1GT8A 3OYKA 4L73A 2D74B 5C12A 2R7SA 3TUIC 3OHAA 1YK9A 5T7LA 4J7CA 4KHPJ 1ZETA 3F2KA 3PTWA 2VG6B 3ISNC 2MSSA 1Q18A 4DPYA 4XIUA 4M3UA 2ZKTA 2FVQA 2A6MA 3E3XA 3ONQA 4ANEA 1XC3A 3AVKA 1XR7A 1WDTA 4PR6A 3W63A 3HHNB 2V34A 3NCIA 1HWUA 5ETKA 4CM0A 5F8MA 4FJ8A 4HI1A 3QZ7A 3MR7A 5IXUA 5C24A 2MKIA 4HTIA 5A8RA 2YXLA 3RMDA 3ILIA 4J91A 3ISZA 1KWMA 3SBMA 4CHOA 4X4VA 1VHFA 1GX6A 2IS3A 1VSDA 1T8EA 1YTAA 4CHPA 4KH4A 1SKSA 3R6MA 2LFVA 4CF1A 3AO4A 4N41A 5HRRA 1NK8A 4LRBA 4PYDA 3GLJA 1RACB 4LVOP 5KFCA 4J9RA 3L2UA 4YDXA 2X1FA 3LP0A 4DI6A 2N3OA 4ECXA 4W5OA 5LJ5Y 5GMKa 2BA9A 4QR1A 4QAGA 1WHVA 3AA9A 1V9OA 2NXCA 2AEJA 4M3TA 3PR5B 4Q45A 3PYFA 4GV9A 2LQ5A 2C3PA 1RNHA 5FPEA 1B3TA 3J7ZO 2F9JA 4DV7K 1S57A 3L6QA 1NK4A 2W9AA 2DISA 5A8KB 4ZOSA 4FM0A 4JI1F 2BV3A 2ZOMA 4FWKA 2B9EA 2VA3A 4OI1A 4I2QB 1ASUA 2RRNA 2QWNA 3TEGA 2IM0A 3L8BA 2FJVA 2KDOA 3V1OA 1E6YA 1RGVA 2EFNA 3KLGB 4QW9A 1XHZA 4WFXA 3D7EO 2ZWHA 4G1IA 2JWNA 3FZBA 3BKFA 1K6YA 3SUOA 1Q82O 1AFJA 4PG4A 4NLBA 3JAMU 3QNNA 3I33A 3OHBA 5KAKA 2IVOA 2J0SD 5M1QA 2A42A 5HSPA 4HHTA 2VIHA 3EYZA 1X5PA 4TNOA 3UDLA 5KPRA 3GE1A 3VQ5A 2X3GA 4IG3B 5I3UB 4F36A 5HP1B 5IT0A 5L46A 2ZVIA 3QJPA 5JS2A 5M1PA 5D4PA 3VEOA 5ADXA 3T6JA 2DGOA 4LFCJ 4OJ3A 3BBCA 4IO9Q 2EC0A 4WKYA 4DPWA 3MR2A 3AJDA 5LJVA 5A6PA 3ZSRA 3RZAA 4DV1K 2W6LA 4JRQA 3PRBA 4ZVSB 1VSJA 3DN9A 4ZS6A 4L74A 3NVMA 1DQ8A 3NGDA 3TNVA 3IAYA 4RCHA 3MGJA 4QR2A 2DGQA 2IVPA 3WBZA 4DR1J 2OPRA 3W66A 4ZHRA 3U1LA 1SKWA 3CJ8A 2J0XA 2XLIA 2OA8A 4O0IA 4DOZA 2XY7A 3W61A 1IG9A 4JI0J 3EDQB 1NHKL 2Y1JA 5HL7L 5HK4A 3TAMB 2LQBA 3AARA 2MY8A 1J5EJ 2D41A 2V8DA 2XHCA 4IXCA 2X3DA 4IFVB 2IGIA 3HO1A 4CLUA 4E2FB 4JI4K 4ZITA 2R7QA 2W4DA 4OX9K 5CCLA 3TP2A 4FYXB 1EKSA 4GKJJ 4BR5A 1VQLS 2F65A 1UL3A 4CFBA 4DU7A 2RIJA 3CCWA 3UQSA 3TVKA 3POTA 3MMAB 3MECA 1I5OB 3CC2N 1L3KA 2IIRA 4ZK7M 3MEKA 3DHXA 2C3MA 2FVSA 4PKGA 3P49B 3UB5A 3LPTA 4ZIWA 3K57A 1SJFA 1BU6O 3KD5E 4CEAA 3G2XA 4CO5A 4DF8A 3MXIA 4JD2B 4CGGA 2EFQA 4BY9C 4HI2A 1ATRA 5CAAA 5KQDA 1YQHA 3KLEA 5HATA 4ENOA 3I5BA 4KQZA 4CT8A 1DRZA 2QWLA 2UXBF 2HNDA 3LOUA 2QWMA 2G8IA 1KN6A 2ZE2A 2JZ5A 2QYCA 1LW0A 3UCUP 2FC8A 2WBRA 5HVFA 4I6MB 2G1DA 3ZYYX 1QLNA 2XGQA 1HKGA 1KVJA 1T6CA 1P1LA 5E3AA 3TUPA 5BRDA 4X65J 4BC5A 1KHVA 4M5DA 1Y5NB 4XEIA 3K17A 3OUYB 2KH9A 2J0WA 2ZHAA 4DL2A 1S48A 2MKYA 3PW7A 3D1HA 1S6UA 2GGPB 3R27A 2D3ZA 3BYRA 3ADAC 1JKHB 2QN6B 3CCLN 3G0ZA 1R8AA 3WXMB 3VQCA 2IBOA 4H4OA 3GZ7A 4P10A 1VDHA 3OYBA 2ZH9A 3W9HA 2DEJA 3N01A 3AA2A 1GLDG 2HKEA 2HK3A 2ZEJA 4U7UK 1UEKA 3GSDA 4OKEA 2ZJPL 3HPOA 3L3UA 1VQKS 4NRTA 3U9ZA 1FE4A 4C23A 4B02A 3P31A 1YAGA 4HKQA 1QZ5A 4DX7A 2NRVA 4KH6A 1WUAA 3QFHA 4DTNA 4DN9A 5DDRC 1TFWA 3HVTB 1AYEA 3EGWB 3QATA 1T3OA 2P9KB 4HTJA 4CJFA 2AWZA 1O1WA 2QMWA 4FOIA 1QSLA 4N8OA 1K8AO 5HMWA 5M2PA 3I31A 4CEBA 3V9SA 1N56A 3K5LA 1IBMJ 1IJEB 1C0GA 4H0PA 3MMCB 2DYAA 4IOCL 5AZJB 1ZC6A 4B3TF 2I1RA 4ZVOB 4FWMA 2W7OA 1YGYA 3VQSA 3LW5C 2QLBB 1J53A 3W3SA 2WONA 2ZM6J 3QEWA 5TKWA 4ILHA 3E1YA 3E9OA 1WC5A 3HHKA 4IG0B 1H98A 5CA5A 3TUZC 4BC2A 1Q81O 4FS1A 1HHQA 2G4BA 2AJ4A 5J1EA 5KFQA 5D8HB 2XSJB 1TKXB 2FVCA 2F4VK 4M41A 2XMKA 2WTFA 4A8KA 1TL1A 4KSEB 1RAOA 1K0VA 1BDGA 2NXNA 3O1WA 3IS9A 4YHHK 4F67A 2OKQA 3D2FA 3O1BA 4Z4HA 4DZDA 5T7LB 1ZS6A 4YORA 1RTJA 2GC8A 3H2UB 2MLYA 3DHWC 4BRGA 4NI2A 4CTAA 4RNMA 3PIOL 1KVIA 1NJXA 5ETQA 2CJKA 4CEOA 3ZT0A 3T1HJ 3BY5A 2DRBA 4LRFA 3H45C 2V69A 2BTFA 5C24B 1VLOA 4C0BA 4CO1A 4BRAA 5A8RB 3MEEB 3RBXA 3TR5A 2UVUA 2RDJA 1D5AA 3KHHA 4FBUA 1GLBG 1QVGR 1QM9A 5JVGQ 1IKVA 4Y2AA 3U3GA 4OPHA 3J7Z5 2M88A 4CLKA 2CJXB 4YNQA 2IM1A 3MFHA 3T1YK 3HOTA 4MFBA 1WBBA 4RBTA 2HWIA 1WSRA 3JB9k 2CNNB 4AILC 3LP0B 4M63A 2OD6A 3MD3A 4OYWA 1FT8A 3OA9A 3JTOA 4QZVB 4OI0A 2QTDA 1B92A 3O3FA 4NLOA 2AYMA 5LXRA 3ZTOA 3CCEN 1NGJA 4H03B 1N8RT 3OLAA 5HQ8A 3RVCA 4IJAA 3V1QA 5M2RA 3C15A 1CVJA 4C48A 2NRXA 1CJTA 3VQ4A 3NOCA 2GTDA 3M6WA 4PKIA 3QBXA 4BHQA 3BEXA 3JSMA 2R8IA 5KFKA 2E5LK 1QTNB 3L7PA 1KTQA 3KK3A 4NLDA 1E6YB 3HF5A 3KOAA 5I3QA 1WDDA 1ZBTA 3DLRA 3K5OA 5DQIA 1NDKA 4GO5X 3D5MA 2ZHBA 3H2VE 3I4HX 4F4YA 4BC9A 5KFJA 5B0GA 5IV4A 2DR7A 3GDQA 5JVHL 3TABA 2ZBCA 1NK7A 1N5VA 3KZBA 4DZ6A 1OYDA 4PABA 1Q95G 2R2UA 2Q31A 2CRLA 3A5MC 4RNHA 3OYGA 4F9OA 3FBFA 4J9OA 5K9FA 1OMSA 3PHTA 2J9DA 2B4JA 3RBEA 1JWWA 5H1SQ 3CULA 2VPWB 3DNCA 1S9GB 1RB0A 1PGZA 2L08A 5KFGA 2BJ8A 5B0BA 4YOYA 1LOUA 3PW4A 4IJNA 1D8ZA 1LWEA 3SCKE 4TLQA 3OYFA 5J2QB 2JGUA 4BDZA 3OVNA 4F26A 3VZIA 4BGBA 2E1MC 3SQOP 3PX4A 2QTWA 4DR2F 4NMLA 2OPPA 2R7TA 1RLCL 4JI3K 3AGKA 5EOYA 3O08A 4JI5F 3CJRA 4A8MP 1O13A 2YKOA 2OPRB 3PRVA 1HNXK 3W0LA 3VA3A 1FRJA 3JTNA 1BQNA 5K8OA 3CJ2A 1VSMA 2P9GA 4NLVA 2NRWA 4O3NA 4F02A 4KO0A 2AX0A 3ID6A 4OO1J 2OEMA 3L3VA 3FRZA 2F63A 5KG2A 2RH3A 5DZ7A 2H1YA 3PHEA 2YVSA 3V4IA 2QW9A 1Y00A 2G0IA 1F1BB 1X1PA 4YY3K 3AY9A 4H8KA 2RRBA 2ZKUA 1Z1ZA 4MKBA 2RE2A 5LJ3Y 1ZM3A 4MAKA 2ZNYA 4O44A 2ZH5A 3CB4A 3I82A 4MO4A 4P2MA 2XO6A 2C2ZB 3LPYA 1MSWD 1YITN 2K1RB 2AKWB 1WJ9A 4NCGB 2G2OA 2HG4A 4KTQA 1GEHA 4MDBA 2DCLA 4NRUA 3POTB 3MECB 4OHZA 4TXSA 2V4QA 3MM6A 3VQ9A 5GAEP 4NO7A 2LDIA 3M8ZA 2HVEA 4QYRA 4Y0FA 4WF9L 3MM9B 1F5AA 1V4TA 1U26A 5KG6A 4I68A 3UO0A 4FM1A 2E44A 4V1Ak 1V3SA 3D2WA 1KQSR 3V6KA 4ZPTR 3FKBA 5M2UA 3S9HA 4NMXA 3NL0A 4JYAF 1NO8A 3ENOA 1RP5A 1O8BA 1VJQA 4CZJA 3G10A 3I87A 5HROA 4NXNF 3NAEA 4PXDA 2HNDB 3OJSA 5CR4A 2C22A 4OZ0A 2BM0A 1C1CA 4DTJA 2ZE2B 2CPZA 1GQEA 4KR0B 3ZT4A 2YX7A 3IR6B 4M3WA 4Z4GA 4DQQA 4QJVA 2E1YA 4DR4F 4LFBF 1TUYA 4EZ9A 3AODA 3AA3A 1IJFB 1D3WA 3WT0A 4RBVA 1H1VA 4WE1A 3AVFA 3HYFA 4DUYJ 1ZTWA 4WFNL 2JEJA 4EHUA 3P6YC 5L38A 4LFBJ 5GAEI 3TZWA 5A2QO 4NYZA 2GNKA 1SJQA 3NF8A 3ENWA 5ETVA 4F4ZA 2GZOA 5BPLA 3DM2A 4H4OB 2R7WA 2O67A 5ELZA 3J81j 3KG4A 2VG7B 3PNIA 2RHQB 4IEIA 4DFPA 1VQNS 4B3SJ 2BKNA 3MWPA 2BUNA 4DV5K 4B9LA 2UU9F 3THWA 1NGFA 1F2HA 1Z4UA 3KLIA 4ELUA 2LXIA 3OBYA 4KBOA 3CQ8A 3SDEA 1T9UA 1D09B 1DLOB 4J5OA 1BUPA 4KREA 1C1BA 1FCAA 4F2RA 2CQHA 3THVA 2HFOA 3EUNA 3O4QA 2YWKA 5AQFA 4NLPA 3C14A 2W2MP 1YI2S 1V4SA 2E2NA 3SSRA 3ULEA 4E1NA 3CJQA 1KVCA 4HVJA 5C10A 4A62A 4DB3A 3M2VA 3NGTA 2H4WB 4JHDB 2O3DA 1N5QA 2MQ8A 1XNRF 1X4DA 2AEFA 5GAHU 1YHQN 4CO3A 2EG1A 3PSIA 2XO7A 1WKJA 4NLRA 3TARA 4NX9A 2R2TA 1N0UA 1R0BG 4H0YB 2CNOB 2V63A 2IC3A 4Y2CA 4CJ7A 3EICA 1UKUA 1BISA 5AQQA 3H1VX 3ET6A 3MTJA 2RU9A 1RDAA 2HNYA 3QRPA 1R43A 4CYUA 3GL1A 3THPA 2IYGA 4QPTA 1TL1B 1NK5A 2GJFA 3T7ZA 3D2FB 3GR1A 2DVIA 2Z1HA 5KFAA 1HBNA 2X1BA 2BW7A 1TYQB 4MMOA 2HGNA 3FZLA 1X4AA 2Z2ZA 2XSFA 3KFWX 1NXIA 3KJVA 1J2VA 3BS9A 2R8HA 3BZQA 4CTAB 1CULA 3FSYA 1REGX 4KV8A 2C2OB 3BQ2A 2DHAA 4WJBA 4CD1A 4CF0A 2O4IA 4B8AB 3ZTPA 3HJFA 3E8OA 2HGLA 4B1WB 3GP9A 8ATCB 4ECUA 4DV7J 2CGKA 4RWWA 3ZEUB 3B6OA 2OTLS 4LD0A 5AQHA 1IKVB 5GIOA 3DKDA 3Q8QB 3CETA 2Y9HA 5DM6Q 4YOVA 4JEPA 4MFBB 1J54A 1X5TA 2CQ1A 4KH1B 2XS5A 1JL2A 1Q86T 3VQ7A 5F9NA 5CHCB 2UXDK 2DBBA 4RBUA 2MKCA 4L3QA 2V2KA 3IG1A 1S7IA 3CC4S 2FJDB 2BJ7A 3C15B 1XNQK 2F5GA 2NPIA 2WTUA 3O9QA 4F7VA 3R7NB 1QVFR 4E98A 4JNEA 5LSLA 3JSMB 2BVZA 3CCES 3I8BA 4BC4A 1HKBA 1BIZA 3OLBA 1HI1A 3ATVA 3FCVA 4OYZA 4DCOB 1CZBA 4DV1F 4DSIA 2HMIB 2EW9A 4QYZK 1T05A 4GV3A 3DU5A 2BRLA 1ATSA 3OS2A 3VAMA 1DHMA 4I9QA 5I4MA 1HX1A 2IAJA 5KI6A 3BDEA 5LY3A 5IT9Y 2RF2A 3VCDA 4DV1J 2FTRA 1KTVA 2A1SA 4CIEA 3SQ4A 3B54A 3BGFA 4F4WA 2K2PA 2DO4A 3EXYA 1UZHA 2V5HG 3QEPA 1HMVA 5DDOC 2EWHA 3TAFA 3D0HE 2KXHA 5CE3A 4DX8H 3MCOA 2GX9A 3FE1A 2VA2A 1LOTB 1NPPA 4JI6K 4CLLA 3R1XA 1SIWB 3FJ2A 3ZZPA 2E9TA 1GOAA 1PC5A 4URGA 5ETTA 1FFWB 2W8LA 4JOUA 4JI4F 1X5SA 2XHBA 1ICEB 4DS5A 4JKHA 1LWEB 4PG5A 4OX9F 5B0AA 4X62K 2YX4A 3QESA 2DO0A 3IMXA 3RAXA 2RQKA 2LU2A 3PDNA 4I69A 1WKKA 2VZ9A 3S3NA 4JI4J 3PJ9A 2HLTA 4OX9J 3VEWA 2XULA 3KDNA 4K5SA 1BQNB 4F4AA 3GTYX 5EDWA 4U95A 3MN7A 2ZH2A 2HWHA 5F3TA 4X4OA 2X7IA 2QWRA 1RT6A 1TZ0A 2OPQB 1H73A 5C2DA 3V4IB 2G8KA 1S0MA 4DX5A 3MPVA 2UP1A 1HWKA 3K9JA 4OGEA 4FCYA 1JLFA 1N5YB 3GFXA 4CEDA 5HVGA 1DT9A 2GV1A 1BY9A 3MMJA 2QO3A 2HVHA 2KT5A 3ZTRA 4O44B 2E66A 4DL4A 2AT1B 1VAZA 1NOZA 2V51B 1RHQB 3O6WA 1IKYB 1MNEA 4L6V3 2QFJA 4GKKF 4PYAA 4CBWA 3CCQN 4O0NA 4FF3A 3ZZTA 2HHHK 4EWTA 1JCEA 4BLGA 3RSEA 1V3RA 1TK5A 3M1VB 3MM6B 4IO1A 4JKEA 4ER8A 3M6XA 1YITS 1BO5O 4E1JA 1BLUA 1VQ6N 3E66A 1Q9XA 3PJWA 3CCMS 3M8SA 4Z4CA 1FKPA 2IDOA 1YRXA 2RD5C 2AGQA 4IR1A 3WXJA 4FM2A 2UVWA 2YWWA 2HFVA 4GC6A 4DR5K 1X9SA 3K9KA 4NXMF 2EHGA 1O0PA 2D3O1 3QAUA 4KFBA 2J5AA 5D0HA 3U7JA 4OYXA 1NDPA 1QD1A 5HROB 2P9UA 2BGGA 4U67Q 2AJ2A 3BH7B 2MLXA 2YTCA 1X5OA 4EP4A 3D68A 2ZHOA 5AQOA 2RQCA 4J9SA 3ENHA 4IOBA 1C1CB 2APOA 4JV5K 1VQON 4A8SA 3CC7S 3I0SA 2E6LA 1JX4A 1BWEA 2RKIB 4CIFA 3H40A 4LF8K 3M8QB 4ETZA 4LF5K 4O5BA 2P5GA 2Q6CA 4HTUA 4KJIA 1H7WA 3AVAA 3WIVA 3UD5A 1EP4B 3HD2A 5AQMA 5KFUA 2E20A 3DDIA 2YHXA 5HMYA 4OZJA 4ANDA 1N32F 1EARA 2V68A 4QS7A 3AD7C 2K3KA 2ASOA 1F60B 3NNHA 5JUMA 2WCXA 3WEEA 1CBKA 3N0VA 1X4GA 2IA6A 3AQOA 5HJXA 5B0DA 4OLPA 4BE1A 3D54A 4XTTA 3KK7A 3MM5B 3ZO7A 1K44A 1TMMA 3P45B 4CZGA 3VGSA 5ADZA 2OI2A 2DR5A 4NZ6A 4EP5A 4PQUB 1S6QA 1GX5A 3CPWR 4KGKA 3THWB 1OPZA 3ZETA 5CZ1A 4NA3A 4WFBL 3HK2A 3CHWA 1U1PA 3SDEB 1RWUA 1X7VA 3LAKA 3HVWA 1S79A 4P7VA 2F4VF 3CCVN 1C1BB 3VAFA 4KTZA 1SS6A 2V8PA 1VQ8N 3CXCR 4G1PA 1UA0A 3C14B 2MZTA 1JJ4A 4YHHF 1FJGF 3SI6A 5IQ6A 4FF4A 1FERA 1D9AA 4TU8A 4Y0WA 3FBBA 1JCFA 3S3MA 1BA0A 1VQMN 2E2QA 1BCMA 3DLGB 4USJC 5LSRA 4AQYJ 3GCXP 3MDFA 2B8QA 2N4DA 1V5VA 3PCOB 4MJKA 3ILOA 4UQGA 4K0KK 1KP6A 3GYGA 1SQKA 2HHTA 4RKUC 2O8CA 5IC4B 3CPEA 1HNWF 4B08A 5F8GA 3LWMA 1RT1A 2V0NA 2WW4A 1FEEA 2JDJA 4LF4K 1YHQS 2HNYB 4WP8A 3HPGA 4K25A 4A8YA 3T1YF 4IH6A 4DJBA 2VQEJ 3PW2A 4MQ3A 3TAGA 3UDVA 4J9MA 3LDPA 1QDUB 1Q4RA 3HULA 5AQYA 4TY9A 2AJ0A 2OO4A 2E2OA 1BE4A 2I38A 3SYZA 5AQSA 3ILLA 3R5BA 4WQ4C 4KV8B 2OD4A 1W0HA 4X4UA 1FJCA 1TAQA 2GFFA 5JJBA 3NY0A 4LQ9A 2H54B 1NGAA 3QJLA 4CJ5A 5KFOA 2E5LF 4YQWA 4LSLA 3T3FA 1R89A 3Q0AA 1RBVA 1VRUA 1FJEB 5DLFA 3C95A 4DR3F 3EKSA 1Q86O 4CJQA 2V7ZA 2ROEA 4K4WA 2DPJA 3TSUA 3OXGA 1OH6A 5KG3A 1FNXH 3TA1A 1S1XB 3CWJA 3OL7A 3T41A 3DLKA 1U7LA 5L39A 4DWIA 5JXSA 2QXFA 3GSIA 3J7AP 3VA0A 3HLUA 1RWWB 3IG1B 2YNHB 1HJOA 4KHMA 3MUTP 4ATNA 5GMDA 4TN2A 1JNZB 1RWVB 4C8MA 2D9PA 2GX8A 3OFEA 2V94A 1NGDA 1HR0K 4FPBA 3VPZA 4C0OC 1ZM2A 5DO2A 3THTA 3W3DA 5T7BA 3G8SA 4J9KA 1SKUB 3IRXA 1ITPA 2FJXA 1KFDA 2GUPA 3VERA 3N5FA 1T05B 1GLLO 3WQTA 3DU6A 4CE9A 5DETA 4JI3F 2IAJB 1RAIB 3UR0A 3FEZA 5HO4A 3BZCA 4AL6A 2LKZA 1UJ5A 1U1LA 4YMEA 4K4TA 2NLXA 3CUNA 1QY7A 3CJ4A 2DY4A 8RUCA 1NKCA 2ALYB 4X66J 5GAGU 5FPDA 4KAIA 3T5KA 5U47A 4UQTA 2H5JB 4BE2A 1HQ2A 3V4MA 5KFBA 2DGTA 1HMVB 3H59A 3CJSA 2XMUA 1S1WB 1HNXJ 1G99A 2H3GX 2K8GA 4QQBA 4OJGA 4ANCA 3LL3A 1QE1A 2CG8A 3P4IA 3VN5A 3MWBA 1Q9YA 1X4CA 2NYHA 3FBCA 2ZJQQ 2ZBQA 4YFUA 5F1XA 5IS2A 1S1UA 2I5JA 1NZ8A 3GIJA 4OZ5A 1VYAA 4QWDA 3MDQA 1X4FA 2DHSA 4EZ6A 4C8YA 3BSAA 4USKA 1HYSA 5KFXA 4Y1DA 2JHEA 2XWXA 2G1HA 4YY3J 5E3RA 4JV1A 3BGLA 2ZBRA 3D3BJ 3PJXA 3DGPB 1PO6A 1M5PC 2HAIA 1EKEA 2EX3A 3H98A 1FNMA 3ITHB 3IAM9 4DBQA 3SMSA 4G65A 2A2CA 3I9V9 1UW9A 1ILYA 3PG9A 4PRFA 3BSCA 3HM8A 1TGOA 2V2VA 5IT4A 4FWSA 4ERDA 5E26A 2V9KA 2G9OA 3AVNA 5A0YB 3M6UA 5EVZA 3TVZA 4W5QA 2ZGZA 3LUYA 3TRGA 1JLFB 2Z58B 2P9LB 5EWGA 3KHLA 2KZZA 4URSA 5KRSA 2OMOA 5IT9U 3CMQA 2ZWPA 4WFZA 4CEZA 2L48A 1T03B 2HF4A 2DPNA 2V2QA 2HRYA 3WDOA 3KK1A 2Z0GA 2RQ4A 2RE1A 4UOCA 2B51A 1VRQC 2ZDPA 1WHWA 2Z8QA 4DU1A 3EKUA 2QC3A 4L3NA 5AZIA 2I7PA 2IJRA 3SEOA 4LFAF 1JL1A 3CJKB 3K8WA 2IJFA 1K9MT 1XQIA 4PXEA 1VQ4N 2FLPA 2M2BA 3CW2C 3KWIA 1RCOB 3CJ0A 4IFEA 1FKPB 3G8QA 1TUVA 4DQIA 2XC9A 3VVTA 4ZPBA 4CZMA 3BF4A 3J81O 3KG0A 1VQ6S 5C5JA 1KAYA 3BQ0A 3A13A 1FRXA 2RVJA 1RT2A 1RDWX 1IBLF 1NJWA 2P9UB 2P2CB 4WIQA 2ASJA 2VQFF 4CVNE 3S1TA 2IVMA 1IQTA 4TVAB 3HZEA 1R59O 4RNOA 2JX2A 4Z0UA 4ED2A 1FKAF 1QQCA 3CG7A 2UUAK 1S9EA 3T69A 3I0SB 5BR8K 2CGLA 5BPMA 4OLOA 3G8TA 2EG2A 4KHQA 3A3NB 1SCJB 1VQ9N 4DV5J 3HDSA 1ASWA 5D77A 4DV4F 2UV8A 1VQOS 2QRRA 2D4WA 3KD1E 1YJWN 1YKWA 3RB4A 3OYEA 4CJLA 4DV3K 7AT1B 4FVMA 1UAXA 3OHRA 2YH1A 3BYPA 3SNNA 2UVRA 3A12A 4UUWA 4AUKA 1NGCA 4GVBA 3VVUA 4DR6K 1B64A 1L3VA 4PXBA 3OL6A 3PY8A 3FLCO 3QRRA 2AV5A 1S6QB 3LDNA 4ID1A 2I2YA 3D66A 3D6TB 1SJ1A 2K7JA 1DQ9A 5M1NA 3ZETB 3EVOA 1U47A 1RHRB 2O8DB 3EPGA 1NM1A 2IM2A 2CDQA 3M6VA 4ECYA 2YCHA 5L1IA 3M8WA 5D0EA 1TL3A 1IJJA 2FY8A 2HURA 4WQ5C 3QIPA 2Q1LA 3O5TB 3OVAA 2BXJA 1Q1KA 3ZNUA 5C2GA 3CCVS 3M2RA 3SXLA 3D6HB 3FDSA 4FBTA 1VQ8S 1RA6A 2K7KA 4BVOA 2ZJPQ 3GFYA 2HFSA 2WSEC 4B9TA 3DXMA 2BBEA 1WHXA 5J2NB 4ZPVR 1JMTA 2CPIA 3D4JA 1Y9OA 1W2BM 2B5JB 4IR9A 2W2NP 5AQUA 5FIIA 2O8CB 4DCPB 4O3PA 3H1QA 5CCMA 1HD0A 2CVEA 2IRYA 1WG5A 3MAHA 2VD3A 3P4UB 4BE0A 1RT1B 5HRPA 2VL1A 1APSA 1A5XA 4WYBA 1M5KC 3AAPA 2UUTA 5KFLA 3WXIA 3DLEB 2VPZB 4OJHA 3DRPA 3T5LA 3NGRA 1CEZA 2DR8A 4OYAA 1R8HA 2K06A 1S10A 2FF6A 4RJVA 5FLXO 4IOCQ 3ZZUA 4H5NA 1Y3KA 1YJRA 3RG6A 3OTOK 3LH2S 2UXDF 2MKSA 2C2DA 1KR4A 2KHCA 3NGZA 1KVAA 2DKOB 4DLGA 1W25A 2MZ1A 2CKWA 3TJ9A 1NHUA 1XNQF 1WBDA 2OLWA 2UXDJ 2CQIA 1CPZA 1A7GE 1RBUA 3CD7A 2Z4PA 3J7YU 4FLWA 1CS4B 1XNQJ 1LXJA 4JI2K 4RUBA 3M8PA 2Z2YB 3W8PA 4JK7A 1WSEA 1OY9A 3R5AA 4TLRA 4YUDA 2GIQA 3CD5A 1XMQK 4HUFA 2AHOB 1BI4A 5ETMA 2HBZB 1QQOA 4CEQA 4LF6K 3MM7B 2XMMA 2N4CA 2AMCB 1MG7A 4QYZJ 4DG1A 5AXNA 2QLJB 4JI8K 1FK9A 1YRUA 5HQLA 4FOEA 1WG4A 2LVWA 1N0VC 3HRGA 5FDLA 1R7IA 3ZXWA 2Q3SA 4FW2A 2LQ8A 1N36K 4FLXA 2R8KA 1VSEA 4FWRA 1YJUA 1TL4A 4Q5VA 4I0WA 2F40A 4DV0J 5E84A 4MIBA 1UJ6A 1XMOF 4DMZA 3JSBA 3CTRA 3PKMA 1TMJA 2MZJA 4M3XA 1CG2A 4JI6J 1Z2ZA 3IRXB 2XMWA 1T9YA 2NLWA 3K0JA 4O8UA 3ZSXA 4B9QA 3VGLA 3KJNB 4HEA9 4WP3A 3AD9C 2KFNA 4NASA 2GHWA 1X0PA 4O23A 2U1AA 1FNOA 4Q8EA 3KLHA 1R0AA 1NPKA 1T9TA 4X62J 1U2VA 1SQEA 2ZH6A 3ZFVA 2I8EA 2CIMA 2XYGB 3QGHA 4K4VA 2DB1A 2MKJA 1C0TB 1VQSA 3H2LA 2N7CA 2X6SA 2V52B 3EZ5A 3VQQA 2A6OA 5I9EB 5E5NA 1QE1B 3BO4A 2A18A 3EE3A 5BYRA 6FDRA 3HHEA 2KFZA 1UP1A 1T7PA 1S1UB 3TVYA 2YKNB 2OANA 3DRRA 2E29A 1HNZK 3W2VB 2Y8WA 1YDLA 3UNGC 4CJRA 2IRXA 1JLAB 4GKJK 2HQDA 3VQAA 2ACYA 4M7XA 4DUZF 4EK2A 4J8FA 4EFAC 3MAQA 4I2PB 3R9LA 3CCUN 5D78A 5DMRA 1H2UX 1G2EA 2U2FA 1BQMA 2E88A 1NMEB 5KFFA 2ATLA 1H38A 4CBUA 3HXMA 5KFTA 4K5RA 1CZAN 2OHDA 5FRMA 4M3RA 4IDHA 1J5OB 2QGFB 5CH7B 2HHHJ 1DTTB 1CJVB 2XMJA 4RW6B 1ZBUA 3AD8C 2VWJA 3VETA 4OX6A 3M7VA 5L8RC 3SQ0A 4C3LA 4ECVA 3O3GA 1U09A 4DTUA 3FZMA 2CJQA 2MGZA 3IXQA 2ZITA 1V3ZA 1F3FA 3L2VA 2CZ4A 2QT7A 4GMKA 4M42A 3FQKA 2X1AA 3Q23A 2P51A 2DHHA 3DXKA 3IA0A 4DR5J 4F50A 4JV5F 2DIUA 3GMGA 1ZZNA 2P9NA 3SBGA 4LF8F 2KYXA 5LL6Z 1N5SA 2WHOA 1K9MO 4X65K 2HZAA 2GHPA 1OQ3A 3ZX2A 3UR3C 1KLMA 4DSKA 2DY1A 2QWQA 4ILRA 2ZD1A 1WACA 3KDOA 4J90A 3L4BC 1NSPA 1BL3A 4LF5J 3DDKA 2PZSA 2DK2A 2VPYB 1RKJA 4CERA 4FZYA 4BREA 1RT2B 5CQGA 3MOZA 3K2PA 1XERA 2B9WA 4C6AA 5DDQC 2CZVC 4LQ3A 4FPAA 2EFOA 2CQ2A 2Q66A 3QFPA 1CC7A 3TZZA 1S9EB 2LECA 4HACA 3EL2A 1S99A 3MAAA 1D8YA 3WC2A 1PAUB 3VTIA 3CF5L 2MTLA 1TUUA 1BMQB 5HBMA 4WF9Q 2YPZA 2DHXA 1AUSL 3QMQA 2VFRA 3MN5A 2BH1A 3OFFA 4OJRA 5A8WA 5DGAA 1H6KX 1UEUA 4JK9A 3DRSA 3E01B 4Y2IA 2MB0B 1NK9A 4QU7A 3CSKA 1VQ9S 4WTOB 1VQ5N 3GU0A 3E2EA 5IFMA 5IM0A 4NA1A 1HNVB 1CQMA 2VHGA 5DM6L 2F7VA 4KHRA 4GVBB 1X4BA 3HZGA 2OH2A 4FKXA 3BJYA 5AQJA 2VG6A 4E19A 2YQ0A 5F0WA 1HARA 4PPZA 1NU0A 1P6TA 4M8LA 2O5DA 3CDBA 2EK1A 3I5CA 3CIZA 1Q53A 4HCBA 3W8GA 4CZLA 3HHLA 3P5BP 1W26A 5EY4A 2CQBA 2N7YA 4K0KJ 4KI6A 5RUBA 4CLPA 2PYJA 4BR2A 3DXSX 4O3OA 5F0UA 3GIKA 1SJ4P 1TL3B 2KLAA 2VKZG 2FZKB 3TQEA 3I32A 2V4JB 3QIPB 3U9DA 2DGVA 1CSJA 1T11A 4F4KA 2DEIA 3GILA 2G2ZA 4LF4J 1Q8KA 2MXYA 3RB0A 1ZOTA 4DV6J 4MH8A 2BKOA 5AJ3F 1JJ2M 2HOEA 4Q8FA 4ZTFA 4UF4A 1F3VA 5AR0A 3AJ1A 3UE2A 3DXMB 1E3MA 3SFUA 2AZ1A 3EZUA 5ETNA 4A57A 1UZDA 2Y8YA 1HRHA 2FXUA 3KHGA 3VAJA 1X4EA 4AF1A 2PFDA 4LH5A 2VG5A 5A8KA 2QLWA 1U1NA 4DV2F 2KZMA 2NYIA 4HDHA 2MSTA 3AVGA 3DRPB 4IYQA 2P9PA 1K8KB 5HN0A 4F3OA 3CJ9A 4UOHA 3OBIA 3CQYA 3N4PA 1RBAA 4C1NI 2NSCA 2UVVA 5KG1A 4B3RK 5CD4H 3KLGA 4P52A 2XRIA 4ILJA 3PM9A 2FSNA 4DPTA 1Y3JA 2XY5A 4TKTA 3NF9A 2LXFA 2W6KA 3U3YA 4YR0A 3BZKA 2O1PA 2CVIA 4C2MA 5IC6B 4CF2A 1WAJA 4Y28C 3H8YA 3NS7B 4IG3A 3LDQA 5I3UA 4WKRA 2FIUA 4LVNP 1HR0F 3PYDA 1J6ZA 2VBYA 3OYNA 4BACA 3CJ7A 3LALA 5LMNJ 2EKYA 3H25A 5D4OA 4ILGB 2BQUA 5L1KA 3M8PB 3LA0A 4CH7A 2Q6BA 4MKVA 3TX8A 1IV0A 1C0FA 1WC1A 4DQSA 5CYJA 3IC1A 3N6MA 1HR0J 4OYBA 1W2IA 1N5TA 3VGVA 4ICLB 2XI3A 3O4WA 8AT1B 1D1UA 3UDEA 1GXTA 1ZA1B 3ZSQA 4QIGA 4E89A 2AGOA 4CO2A 1PYOB 3VAKA 4OYMA 1VSLA 1Z2LA 3AVCA 1NUEA 3TR8A 3D6FB 1S4EA 4GVLA 4LR9A 3AVIA 3CJCA 4DG1B 1JIHA 2IBKA 3HD1A 5CHIA 2YI1A 3AJ2A 5FDLB 1VQ7S 1HHTP 1BWFO 1VK3A 3GR0A 4LF9F 2VC0A 3QQCD 3R3LA 2DTUA 4C9DA 3PEHA 3TAMA 4OI3A 4DKWA 4IFYA 4QIVA 3SQGB 1RFQA 2UZAA 1CLQA 3NAHA 4CHQA 4W5RA 1XC9A 3J80Y 3NRBA 2FC0A 3FNNA 1F5BA 4JKFA 4CF9A 2VGNA 2IVNA 2DH7A 2DXFA 1JB0C 2POKA 5C42B 1WI6A 1FXRA 1N33K 3AQPA 4OV6A 3D0PA 3KLHB 1R0AB 4KRWA 1WHYA 2FPHX 5MLCV 1U2VB 1UFLA 4IRKA 3DOKA 1WSVA 3J81U 1GTHA 4ETXA 2VJVA 1HYZA 2YPYA 3MCSA 4BQLA 1OIAA 4B1VA 1KSPA 3U02A 4C1NK 3A8KA 3MMAA 3EZOA 3ZSOA 5C15A 3IBWA 3KNAA 1TU0B 2UUBF 2WOMB 5KT6A 4FYDA 3QWUA 4EYHB 2DH8A 1TUWA 4C8NA 1JCGA 2BMBA 4I64A 3MURP 4JD2A 4R79A 2IMOA 2G0CA 4ZA1A 3K5MA 2QK9A 1C1AA 1RWPB 4LIRA 3VF4A 2J6UA 1T6DA 2KHOA 4YDUA 3FSXA 3TSQA 3NLCA 1ESVA 2BW2A 3DJCA 3MXHP 2XZTB 4MYUA 1I94K 4ES2A 2MY7A 4CW7B 1RAJA 5THWA 1CQNA 3M32A 1FXLA 1Z25A 4CJUA 3V5RA 1RAEB 2GV9A 3RAQA 3RYLA 1U4BA 3QIOA 4TU9A 1EZZB 1RDUA 1GLFO 3KKSA 2J9DE 4I7FA 3T6BA 4B3MF 1M5OC 1RTHA 3CCUS 3HP9A 3KTQA 2ZBPA 3NHGA 4DS4A 3W9IA 4CNZA 3OUYA 4A8FA 1PSDA 1OY6A 1IM4A 2KKHA 4FJJA 4C8OA 2DCUB 1DQAA 4D3HA 4RO0A 2HBJA 4H0XB 1MN9A 1ZAWA 3W1YC 5G0RB 3SQ1A 1JKHA 3VTHA 2NSBA 4JKGA 3DXKB 4K4SA 3R1HA 4MKYA 2E9RX 2FY1A 1SUQA 2DNRA 3OS1A 4NZ7A 2O8FA 4X64F 5E7OB 3VQBA 1DARA 2UUAJ 2R4FA 1KLMB 1SL1A 1NB2A 2ZWOA 1IKWA 1L3UA 4NEZA 5BR8J 2FUG9 3FGVA 2VV5A 3HVTA 1FRMA 5K8MA 2ZF5O 2DNPA 4PXCA 1YXQA 2P9KA 5KT5A 3GJQB 1P8ZA 1LAVA 2HW3A 2JLFA 2E1PA 2CJAA 2QA4S 3GIMA 1CJKB 4V19J 2W4PA 4DR6F 4DV3J 1GLAG 3OYDA 2HSTA 1DTQB 3MMCA 1Q7YT 1S77D 2Q0UA 4A48A 3LP2B 4JB8B 1OY8A 1S97A 3H5XA 4HACB 1RHJB 4ZVEA 4DR6J 3D28A 1URRA 5KG4A 3MAAB 4CWBA 4EBEA 2FLNA 4B3OB 2BDPA 2J8SA 4OI2A 1PJ5A 3DXBA 4P75A 3PYEA 3Q8YA 5HBMB 3BKUA 5E3CA 4JK8A 1YIJN 1M90O 2HS4A 4ECWA 2LCWA 2DNQA 4FWPA 3P38A 1FRIA 5A8WB 1QAJA 3EY1A 4MDAA 2PSZA 1TKXA 3QEVA 4KHPF 4ZVPB 4ZIVA 1TKTB 4ZN3A 4RNNA 3IWXA 4ISEA 2JL9A 5IOLA 3P5JA 5IM0B 1IBKK 4USTA 3R8YA 4YB1P 4LR8A 4G6VB 1HWIA 2FQQB 2WVDA 5BN8A 3WC0A 2XCPA 1SJ3P 4F3MA 4ED6A 2MKKA 3JTPA 2IFXA 4H4KA 1NKEA 3HHLB 4JS4A 4LIWA 3V2UC 2HBLA 3MEEA 4K4XA 1NNEA 2C3YA 2DFHA 4UTGA 2BE9B 4Y00A 4DPUA 1URNA 2GQQA 3QT6A 3LGHA 1VRTB 2P8IA 1X3MA 4ITSA 2J8AA 2ADCA 3RAMA 1CXQA 1U04A 3BBBA 6FD1A 1MWMA 4DR7K 4OFZA 1VOMA 2Q2RA 4PWWA 3V9ZA 5LMUK 2IA0A 3A0IX 2H9ZA 3NFAA 4EGLA 1SPBP 2FSKA 1U48A 1XTZA 1YZ6A 4ZCLA 1LFPA 3OTOJ 1RK8A 1P90A 4WFBQ 3C6UB 2AZ3A 1N6QA 3RUBL 2PD1A 2YBVA 2MQLA 2VG5B 2DGUA 3OL8A 1MN7A 4GC7A 2C3OA 4HUGA 3GYNA 5DQGA 1UTAA 4N8NA 4BRMA 2P9PB 1BWVA 4KKOA 4O4GA 5M1OA 3MR3A 1XMQF 2QV6A 4WXWA 2FB0A 2ITGA 2ZJQL 4JI2J 1U1RA 1CLFA 4DF4A 3R2DJ 5BYSA 3M9MB 1RISA 2IOCA 4U7UD 2F8SA 3GFHA 4CIGA 4HYKA 5KFHA 2O8EB 1EKRA 4WIIA 4USVA 1FTCA 2W9BA 2PMHA 4LF7K 2ROGA 1BC6A 1XMQJ 1MWKA 1XQSC 4LF6J 4FK2A 1WSIA 2Q97A 2A6AA 4FLUA 1P9YA 1ASVA 1ZAVA 2JVRA 4LR7A 5DG7A 1N36F 4Z7YA 3R5DA 4LREA 3I55S 1DY3A 4LFCF 2BQRA 1VQYA 2CQ4A 4H5TA 2D3OR 1ROFA 3QDKA 4JI8J 1MLAA 2BM1A 1DEJA 1T3NA 2H4YB 2GVDB 3ZT2A 1ZBLA 4DTXA 1N36J 2YV0X 5ETSA 4H4MB 4J9VA 1S9GA 2C1EB 3ZSWA 4A46A 3AO5A 1U8SA 1MDUB 1U0SA 1B4SA 3CMAN 4DR1F 5KPZA 2HQCA 3W60A 3Q8VA 5LM7E 5KGWA 1IWAA 4FJKA 5J2QA 4NLQA 5E33A 4JI0F 2XG8A 1KQGB 3AO3A 4BRIA 4QOTA 2M0GB 3OQ2A 1J5EF 5HQMA 5DG9A 2VONA 4LUBA 3KIOA 1QAIA 3I56N 3H5SA 2WVFA 3IP0A 1K47A 1FRKA 5A6WA 5AQGA 2HBYB 2NZCA 4U8VA 3GPAA 5D0RA 1VC0A 4IFYB 2CUYA 2M5YA 3SUPA 3EDRB 3TI0A 1RBLA 2XGPA 3QT7A 4GKJF 3CYMA 3OL9A 3OD2A 1PG5B 3A5OC 1UFWA 2IPOB 1KQFB 2H51B 3B6BA 4OKJA 1UPMB 1HNZJ 4NA2A 3RW7A 3UCZP 3EWGA 3T1AA 3NS5A 1M1HA 1S1TA 3DOKB 4CCHA 2K1RA 4F0KA 3DDNA 4NCGA 2X1GA 3JSYA 2MKHA 4DTOA 4CIOA 3EE9A 5AQNA 1VMBA 1TFYA 2PY5A 1S0NA 3VMFB 3BSNA 3QINA 2OTJN 1Q78A 4B9UA 5KFEA 2CNKB 2PMWA 3KJQB 5KRTA 3TAPA 2MQNA 3MM9A 2QL9B 4B9NA 3E9LA 2VBZA 3X1LB 1YX2A 3EM1A 2MMYA 2PMZD 2HYIB 3ZNJ1 2VWKA 2MQPA 2BJ9A 2FGOA 2CPYA 2FVPA 2GJ2A 3SJHA 2E5IA 3W7BA 1NH8A 4DL3A 2KM8C 2Y0SD 3V9UA 3M32B 2DNNA 1EO1A 1YT3A 4WU3A 2YX6A 4IQMA 4X65F 4RUCA 2E2PA 3IR5B 2HFUA 1VISA 1MWZA 2WRMA 4PAAA 1ELOA 4I7FB 4ED1A 3OR2B 3W2WA 4RWTA 1RTHB 1GK8A 2NUUG 2CWKA 1UCNA 3FEXB 3T9NA 3DOLB 2V6AA 4PUOA 1RI7A 3MWTA 5BJRA 1PJ7A 3K89A 4AE5A 4M5KA 5KG7A 3L7UA 2FSJA 4JKGB 2DIVA 1C0MA 3H0PA 5EX5A 1SUQB 4R8UA 2QEXN 2VG7A 3QGGA 3MEDB 3ZCMA 2D3UA 5B0FA 4USHA 4EU0A 4QWEA 2W01A 2AYBA 4RG8A 3FZKA 1I51B 1O51A 2O8FB 2ATCB 2E1AA 3CJTA 2HWTA 3GONA 4RW7A 1KC8O 3WNHA 4FYWB 1IKWB 2HK2A 2HF3A 3G6EN 3NF7A 3GOIA 3VR1A 4CGJA 1VHXA 1DLOA 3G71N 1YJNN 1IBMF 1FD8A 1HW8A 1D0EA 3MOJB 5HMXA 2KTQA 2D0PA 2BRKA 2CQ0A 4RW9A 3JQMA 1NJIO 4YOUA 3ZSVA 3KLFB 2ZM6F 2Y1IA 3GG0A 1B0TA 4CDIA 4FYVB 4K41A 1K73T 5JMNA 4C3MA 4JHDA 2KI2A 3K2YA 1KOOA 3H3OB 2PFFB 4FPRA 4A61A 4OYIA 1G4CA 3MN6A 4Z4EA 3D2EB 5JLHA 1KRPA 1RWMB 1DBDA 3CMEN 5KPTA 2OSQA 4K8RA 5DZ6A 4NLCA 1KS2A 2CXEA 1RILA 4M63C 3MEGB 4XPEA 3UKUB 5DS7A 4ISFA 1VS3A 1TELA 1RT7A 1U0HB 3LF0A 5FLXY 2YKQA 4RW4A 4CLSA 3R6GB 2YHBA 3FGUA 1RDCA 4L8RB 3B4DA 4W5NA 3HOSA 1RCXB 1YIJS 5AE3A 3F5TA 4C11B 4AQYK 3MK6A 1WAFA 3SMPA 4YOTA 4ZCMA 1E6VA 3R2CJ 3T1HF 1NKBA 3A5LC 1TYQA 1T9XA 4DTSA 3B4MA 4R5PB 3QB0A 1KVBA 2G8FA 3CDEA 1QSSA 3G6XA 3GJSB 2ZGYA 1HBUB 2P9SA 3ENAA 3A4TA 4XH4A 3QEXA 3MXJA 1MWYA 5EX3A 2VQEK 5B08A 2WB1D 2RHSB 2QL7B 2YKMA 3ZEUA 1QUPA 4RLEA 5FD1A 3PKYA 1VIOA 1S1VA 4O3RA 1WUUA 3O80A 2W40A 2FF3B 1GLEG 3R8EA 2P9IA 2XB2D 3IWNC 2KRBA 2FBTA 1GMUA 2KHDA 2UXCJ 3CM6A 1HA1A 3L95X 4B3RJ 3B6PA 1QVFM 3CCRN 2RUGA 1OVQA 4UOFA 4KC5A 2PYLA 1BA1A 2R8JA 4M1KA 1WF0A 2OIHA 2GO8A 5BR9A 1N6QB 3KLVA 2VC1A 4ZPDA 2VYPA 1A0OB 5EXWA 1HI0P 4LBPA 2IY5B 2JC0A 2KL8A 1S49A 3VWSA 3I0RB 4UZBA 3C2PA 1IR1A 2JC1A 4KKOB 4O4GB 3F9MA 5H9FJ 2MZQA 1XI1A 3ZZZA 2BABA 2M70A 5D3GB 1WWHA 1BHLA 1TV6B 2HMIA 4DN0A 3MM8A 2R2SA 1RHKB 1RKIA 3NKYA 3M8YA 1NWKA 3GIRA 2PEHA 2OFGX 1NM2A 2AJQA 2W9BB 4OHXA 2ZBIA 3UW1A 1NEEA 1DURA 1RYRA 1UA1A 2KVQE 1RBOB 4KGVB 3OYJA 2OUGA 4NPOA 4ECSA 3BB5A 3EZWA 4B3TK 4OMFG 1UVKA 2XS2A 3JAMY 2KJVA 2CPHA 3MMVA 3P5TL 1R0CB 4N76A 4OZ1A 1NBEB 3GV7B 2D0CA 1E4FT 4PKDB 3R9PA 1N52B 5B09A 3O44A 1GMWD 2CQCA 1NGIA 4RW8B 2L3MA 3OTCA 4O55A 3UVJA 1IH7A 3QT8A 2HS0A 2DNZA 2ASYA 3J7A1 4FS2A 2QSWA 1S7HA 1SQFA 2VOPA 4Y6IA 3QBCA 1XJWB 3VALA 1SC4B 4KPYA 4AXIA 4X66K 4X2BA 4AYBD 2RT3A 2E9ZA 5GAHP 3NF6A 3Q2SC 4AM7A 1ZA2B 4ALZA 1N33J 2QJ3A 4IKAA 1RAHB 2CADA 5JLFA 4TYAA 5J2PA 2OELA 1VBZA 2AJ1A 2DT9A 3N28A 4OPKA 4I6AA 2PGCA 2OPQA 4M5GA 1UVLA 1ZPWX 4BWMA 3H20A 2KO1A 2F8TA 3I56S 4JI7K 3LQVA 1KOHA 2HQIA 5KGXA 1HWJA 3N9UC 1N5YA 3OS0A 3UN3A 4QIWD 4Q43A 3M05A 4OI4A 1X9WA 4AL7A 4PZVA 1IO2A 3SSSA 2B56A 4Q2LA 1IKYA 1S1TB 4H5RA 1U6FA 2LYVA 3EMTA 2R9LA 4QPXA 3Q8RB 3O8WA 3W9JA 1EQ0A 1I94J 3QBWA 2D0AA 2PO4A 1Q82T 1PAEX 3A3OB 1UVNA 1M1KT 5D4LA 3M1VA 5GAHI 2JWKA 4R0JA 1DFDA 3IO1A 3SCIE 1OPIA 2L9WA 4NYPA 5LOQA 4OYOA 4E1MA 2RMLA 3UWTA 2ATQA 2PDAA 2R7YA 2HBQB 4CJ4A 5KFZA 1Z6RA 1FA0A 4JLHA 3CC2S 5FPNA 2OTJS 2ZVSA 1VLYA 3QLHB 4HLBA 5CZXA 3VAGA 1NJZA 4J2DA 1WTBA 5CYQB 3NBPB 1RU2A 4A59A 4CJEA 2ZUAA 5FRNA 4FLZA 1ZBFA 1FF2A 1ZM9A 2AF6A 4M5NA 1RT5A 3DRXA 5L9XA 3E51A 3C6HA 3IBCB 3H90A 2RKIA 4R0EA 4DUYF 4KE5A 3M8QA 3W2WB 2O8BB 2JNJA 4DU3A 1OSCA 2HZVA 2CPXA 3O3LA 4ED3A 1VFJA 4RUHA 1MMNA 3DYAA 1EP4A 2YWEA 3M4XA 3A8IA 3B8AX 1S12A 1YZ7A 4PUOB 3RR8A 4BR4A 3M6GA 4UZCA 4BRCA 3WXLA 4F8RA 2VFUA 5H9EK 3GCWP 3QICA 4B3SF 1SQGA 3SCXA 1VQLN 1D9FA 1HKAA 3AVBA 3MD1A 1KKHA 1H72C 5F8LA 4ZLNA 3CPWM 4U96A 1RXOB 4R8UB 3MM5A 3DFEA 2ZH1A 3TTCA 3V6DA 2UUCJ 2C28A 4CZFA 3K7RA 4PQUA 4DR2K 3CCLS 4RW7B 4FXVA 4I67A 3DMJB 4JI5K 1C4AA 3RGIA 1RHMB 2OYQA 1RE1B 1WC4A 5IT9O 2GCFA 3MPYA 1GMWA 4RW9B 2H48B 2W9CB 2ZQBA 5SZTA 3Q24A 3HKZD 3PW5A 4KGXB 1X60A 2GWKA 5BREA 4J2EA 2HHQA 4LF2A 1BGXT 4ZCIA 1YJNS 4EUVA 1TVRB 1FWLA 3FR0A 2JH3A 1W9HA 3RRHA 3DLGA 3VEVA 1YTYA 1S72N 4EIAA 1IBKJ 1NOYA 3KVGA 2E7VA 4ZJLA 3PEJA 3DI6B 1NNDA 1N34K 2D0OA 4WK3A 1RT7B 2Q0RA 3NGIA 3VEYA 4RW4B 1EETA 4FSVA 1WF1A 4YB5A 1YVFA 3R97A 3L3CA 3MPWA 4CLFA 2EVZA 3ISND 1W7WA 3V9XA 3VF6A 1D4XA 2PIIA 4ZTJA 2RU3A 3PVXA 3SAGA 4CEEA 2EK6A 4ZKAA 1E6VB 3RR7A 4ZVTB 1FDNA 2MZRA 3NMUA 1KONA 1RABB 2FGCA 1WELA 4DR7J 4ECZA 4JYAK 3CF5Q 3W5ZA 2DXDA 3G86A 5LMUJ 1R8PA 4DV7F 5KFRA 1PKUA 2KJWA 2OEJA 4LF1A 4NXNK 1S4FA 1WB9A 1FFGB 2P9SB 5DGBA 1LK7A 2A3ZA 4X4RA 4R25A 1WSJA 1G3OA 1Q0NA 5A76A 2AYGA 3AO2A 1RTZA 2YKMB 3C19A 2WVCA 3N5BA 4FZZA 5KQ8A 2HQ3A 5HOOA 3DOMA 3OTEA 1FVQA 1S1VB 2FVRA 4ES1A 3D1OA 3OYMA 3WNGA 2DHGA 5J1PA 2P9IB 2NXEA 1F9HA 2Z30B 4O5FA 2QG9B 1Q5YA 1S1XA 3G82A 1NCLA 2GIRA 1K8AT 1JLBB 2CWXA 1N8RO 3BKTA 2AIRB 4KH5A 4B9VA 1BUXA 5T14A 2YNHA 2AX1A 4OZLA 1UAWA 4LF7J 3BBFA 3ETOA 4W5TA 4WFAL 1RTIB 5HRNA 4M5LA 4JKAA 5KFYA 2VF3A 3CCRS 2UU9K 4OLAA 2MJUA 1T94A 2DY9A 2FBVA 4DHVA 3EVWA 2KW4A 1JLQA 1I6JA 3Q8PB 1DZ5A 4UOGA 3SMZA 1GLJO 1Q81T 1GAOA 3QMLA 1RUSA 3W64A 2JLGA 4JAXA 2LQJA 1H0HB 3G6VA 5ETOA 2RAQA 3GWCA 3MM8B 4E3SA 1FKOB 4PG6A 3HPHA 1RT4B 4CH0S 4ELVA 1KD1T 4J9PA 2CA9A 3TX0A 3L2WA 3IR7B 2CQDA 4CLYA 1LWCB 1RWXB 2NUBA 1C6VA 3NGKA 4RWXA 4DV0K 1XIQA 1HQUB 1XNRK 1S1WA 4XPCA 2IJNA 2NCKL 2BZ2A 2O01C 4BRHA 5HRSA 4M5JA 4J2AA 1S76D 3TEHB 3ENQA 1JLGA 4KI4A 3EX7B 2XY6A 3IFEA 4HR2A 3FZHA 3UVJB 2XTJP 3SV4A 4P73A 3NCPA 1SXLA 2PFUA 3OTDA 3M2UA 5TKYA 4A8XA 2EBEA 2ZUGA 4HCCA 2VJUA 4FL9A 1VC6A 1U49A 3DGPA 3ILJA 2I7NA 1VIXA 3TSPA 3OR1A 3ALYA 2W7AA 3ITHA 4DTMA 1U24A 2GBZA 3N79A 2HBKA 5J2PB 4FJXA 1JJ2R 4CJKA 3Q2TC 2V9WA 1SJRA 2ZDOA 3KHRA 4OL8A 1FO1A 3M5RA 4AFFA 5I3PA 3R6LB 5A0YA 3VQDA 2RJZA 2P9LA 3PIPL 3FFIB 3TAEA 2YWHA 2F96A 3BQ1A 3KJFB 2RDIA 4FP9A 3BGRA 3MN9A 4JI1J 4OHVA 1TKDA 1NH7A 4PL7A 1T03A 1I3OB 1RJJA 3UKRA 4L76A 1AUDA 1M1KO 4QS8A 4BWJA 4ZVUB 4FXWA 4BR0A 1Q7LB 3NMAA 3DRYA 4KRFA 4GW6A 1QTMA 1GMVA 1OKJA 1CJUA 4B1UB 3CJKA 3O2IA 3TYTA 2NXJA 2D1KA 1N48A 1RYSA 4XH1A 5BPNA 3O9TA 4RNFA 3FK4A 1QQNA 4CQ1A 2X6NA 1ZZFA 2HHPA 5MLCQ 2J0QD 3THYA 2CAJA 4A8WA 4CJ3A 1KFSA 1TL5A 2LU1A 2P1JA 3P39A 2PBDA 1RU1A 2CGJA 2COLA 1T95A 5AQLA 3DLJA 1ZBHA 3VAIA 4MT1A 4HL9A 4C4WA 2GQCA 1H3DA 4FF2A 4GY2B 1WTFA 1LWFB 1LCUA 3H5YA 5F41A 4QOZB 4GVEA 5IV3A 3CIPA 1ULRA 2F1F<