1R0AA

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 138
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1r0aA05
1TKXB 1C6VA 1VSIA 4DL6A 2XHBA 5EUHA 3DLHA 4O3QA 2HNYB 5C24B 3I0SB 3PW2A 3SQ0A 3FDSA 3HYFA 3HVTB 4O44A 3ZSYA 3QZ7A 3HXMA 4RNNA 4FJJA 2E9ZA 1TV6B 2UVWA 2ASJA 3AO3A 2UUTA 3AVNA 1FK9B 1S9EA 3ZT0A 1DTTA 1LAWA 1NKBA 4J2BA 4O3NA 4CHNA 3PVXA 2GBZA 1RA6A 5KGXA 3LANA 2VG7B 2W9CB 5DGAA 3VQ5A 4ID5B 4M3WA 3FRZA 3KK1B 2W9CA 3V9WA 1QSYA 2OPPB 1RCHA 1NOZA 4J9PA 2ZD1A 5C24A 4HYKA 4YNQA 3QLHB 4WXOA 4NLVA 4H4MA 5L1IA 2FLNA 3VQ4A 3VN5A 3LP1B 1ZTTA 4Q45A 3T5JA 2YHAA 1KHVA 1HPZB 2D0BA 2YV0X 4EYHB 3NFAA 3SJJA 3GV5B 1HYVA 3KKSA 4NYZA 3DRRA 4F2RA 4F3TA 4DQRA 2B5JA 4M95A 3KLEA 3MEDB 3LAMA 5KFMA 4JS5A 1RT7B 4IFYB 5L9XA 4ZPAA 3H40A 3Q8QB 4MH8A 4CJVA 5F8NA 3PX4A 4O4RA 5HRSA 3KLFB 3GV8B 4TN2A 2XY6A 1UA1A 1JLEB 1TQLA 2UVVA 4QWBA 4EO8A 2DPJA 3AVIA 2HNZA 2A1SA 1BIUA 4FLZA 1HNVA 3OHBA 2QV6A 3B6PA 3CQ8A 3GIJA 3DRRB 5KFYA 1RTIB 2XI2A 1HJRA 5J2QA 1Z25A 1MMLA 2YNGB 2IM1A 4DTXA 2IC3A 4RW6B 4AH9A 4IG0A 4WYLA 4R5PB 4BDYA 3H5UA 1F21A 1EP4B 4O0JA 2Y1JA 3MR3A 3SV3A 3RMDA 1C1CA 4ED3A 3NAEA 3OYAA 3G6XA 4PA1A 3NF9A 1X1PA 2KZMA 2WONA 3QLHA 4WYWA 1JLCB 1HNIA 3DRSA 1SV5A 4ZP8A 4CIGA 1NJWA 3CM6A 3V6KA 3BGRB 4OKKA 1ITGA 1ZYQA 1FK9A 1S9EB 3H4DA 3L2RA 5KFBA 3BQ2A 4HHTA 1FKOB 3PX0A 3QETA 2ATQA 4FJHA 1C1AA 1X9MA 3JSMB 4J2EA 4TY8B 1RT4B 1QSLA 5DGBA 2HVHA 5KFQA 2VG5B 3H08A 4DMNA 1CSJA 4RW6A 3NH2A 3M9OB 3KHLA 1O1WA 5KFGA 1NK8A 1NOYA 1SKSA 2GUIA 4KB1A 3I0SA 2W7OA 4RNMA 1JXLA 3DRSB 3SPZA 1EKEA 4H8KA 5J2NB 2WRMA 4FLUA 2OZMA 4MK8A 3N6NA 3NAIA 1WSGA 5J2MA 5KG2A 2KQ2A 4OLAA 3V6HA 4PWDA 2W8KA 4TSXA 1SH2A 4CJSA 1OS5A 3LALA 4C8OA 4O3SA 4ICLA 3H5YA 2IGIA 1RTIA 4LH5A 3MECB 1KLNA 2HNDA 4FJ8A 2IM2A 1XHXA 2C28A 4DWIA 3QIPA 3VA3A 1UAXA 3KIOA 4PY5A 1XR7A 1B9FA 3ZCMA 1S1WB 3AVGA 3FQLA 1C2PA 3K5OA 3KD1E 4KAZA 1C0UA 4CEQA 1XI1A 4KREA 1K6YA 2KW4A 4J2DA 5FRMA 2ZE2A 4Q0BA 3OJUA 1NK0A 2J6UA 4E7IA 4IFVA 1RTDB 4AHSA 2E6LA 1RTHA 1L3SA 2IS3A 2HHQA 4KBIA 4O3RA 3NF7A 3SZ2A 3RAXA 2W9BB 4ZMMA 1VSHA 3ISNC 4Z4IA 3AA2A 1QAJA 3K58A 3F9KA 5KT5A 4MFBA 4Q8EA 4Z4HA 4K4TA 4OPKA 4CJKA 1WSIA 5KFTA 4C8KA 1NNDA 1S9FA 3ALYA 5KT7A 3QGIA 3LP0B 4KI4A 2XGPA 1NJXA 4R8UB 2QKBA 3AO1A 3V81B 1HQEA 4F2SA 4KHUA 2FVRA 3OLBA 3GYNA 4HKQA 3O3FA 1X9WA 5KI6A 3KHRA 1ZBFA 2AU0A 2YNHA 3BSNA 4B3OB 4DL4A 3AO5A 3G6VA 3K57A 4HUEA 1BCOA 1BIZA 4WE1B 2FVPA 5CY4A 2YKMA 4NLTA 4OGEA 2BE2B 4YR0A 4ECWA 1VSLA 4FJNA 5E41A 5F8HA 2D0AA 5KFDA 2DFHA 3M9MB 4CF9A 3AVCA 4IRDA 3QO9A 1KFDA 4ECUA 1TGOA 4ZPDA 4DEZA 4HUGA 4KO0A 4TQRA 1L3UA 4FLTA 4E19A 5J2QB 1TKXA 1K1SA 1RBVA 2GC8A 3OL6A 3MAQA 1RT3B 1RAJA 1CXQA 5J2MB 5KFFA 3SUNA 3KHGA 2G8FA 1TK5A 3K5MA 3AO2A 1BQNB 4QCLA 3RTVA 1ASUA 3NF6A 4CK3A 4KFBA 2DFEA 4NLUA 1HYSB 4DSLA 2Z1HA 1WSJA 3D0PA 4ECXA 3RMBA 1D9FA 5KFHA 4OJRA 3OS2A 1IG9A 3E01B 4KHMA 2UUWA 3QZ8A 3MFHA 4RU9A 4UQGA 1CZBA 3THVA 1R0AB 3PO4A 3RB0A 1N56A 3CJ0A 1T3NA 4I2PA 1TAUA 2WB4A 1VRTB 4CJQA 4OLBA 4E7KA 3LP1A 3BSCA 3BGRA 4W5OA 3IG1B 5KFEA 3OYMA 2GIQA 4ED8A 1XHZA 2FBTA 1RT1A 3KJVA 2ZD1B 5KFXA 3NGZA 3T19A 3BSAA 4URGA 1IKYB 1X9SA 3HKWA 4URQU 4ZP9A 4K4UA 4LH4A 4ZHRB 2VG5A 5HBMB 3V9UA 3MXJA 3AVLA 3V6JA 5DMRA 4KB0A 3EPGA 4RW7B 3OHAA 5D3GA 4E89A 4CJWA 3M8QB 5CZ1A 4CFDA 1RNHA 4CFAA 3RBDA 1BI4B 4DFMA 3AVFA 4Y2CA 5SWMA 3HVTA 1YVUA 3VQCA 2E9TA 2B6AB 4FZXC 1U48A 5L1LA 1NK6A 1IKVB 5DG8A 1LW0B 2O4GA 3MEEB 1JLCA 4CJ5A 1HNVB 3L2VA 3KK3B 1LWEB 1S0OA 2GV9A 5KFZA 5J2PA 3TAFA 2I5JA 1QE1B 3BDPA 3HJFA 2V4RA 1IH7A 3H4BA 4EP4A 2HHSA 4KTZA 4TXSA 2V9WA 4DLGA 1HYSA 2KFZA 3F73A 4CGIA 2ETJA 1Q9YA 4PWDB 3AA3A 2XCAA 3B6OA 1ZBHA 2OPRB 1C1BB 4CF8A 4ED6A 3NGIA 4FK0A 1DTQB 1T94A 2BRLA 3MFIA 4J9OA 1UWBA 3GIMA 1GOCA 3WNFA 4B9UA 3SQ2A 4ELVA 5DQGA 3DLGB 4XPCA 1HARA 4Y1CA 3MR2A 4QAGA 2QK9A 4MIAA 4N41A 4IQXA 3WNGA 4ID5A 1GX6A 3L3UA 4J9KA 4YMEA 2JEIA 3KMQA 3I8DA 4DQIA 1T03B 1WAFA 3KLEB 1TK0A 3V6DB 3DDKA 4NLSA 3QYYA 1W0HA 4N5SA 4KHWA 3KLHB 3DI6B 5KFJA 4LY7A 4M3YA 2FJXA 4IR9A 1SUQA 5FDLA 2WK4A 4Q5VA 3RR7A 2VG7A 2WOMA 4F50A 3V9SA 1BGXT 5J1EB 3BSOA 4KTWA 2AWZA 2WOMB 5EWFA 3DLEA 2W9BA 4CE9A 3HP6A 3OYNA 3H2LA 3GIKA 4K4XA 3E01A 1JLBA 1Z26A 4TY9A 5KFRA 5KRTA 4GMJB 5KFPA 3GIIA 2DFFA 3S3OA 3OYCA 4CESA 4Z4EA 2GIRA 4RUAA 3QIOA 4L8RB 3MXIA 1NK4A 1FXXA 4MKBA 1ASVA 3HPGA 3OYDA 3RMCA 1W9HA 1BQNA 4EO6A 5F8IA 2IMWP 3PR4A 3V1QA 4OKEA 1KRPA 3KLGB 4CEFA 2J6SA 2ZE2B 4FJ7A 3LP3A 5KT2A 3D5MA 4DL7A 1WNSA 3PJWA 4K8ZA 4E1NA 2R8GA 5I42B 3CDUA 1C0UB 3O4NA 4NYNA 3ICLA 1KSPA 1DTQA 3TQ1A 4CFBA 5F8GA 1SL0A 5KFWA 4IRCA 3PHEA 2PYLA 1XWLA 4Q8FA 3IS9B 4RW9A 3DMJA 1TK8A 3EZ5A 2YNFA 2HHXA 4ECYA 2HWHA 3NH0A 4FJKA 4AHRA 3FFIB 2FVCA 2XI3A 1N5YB 5KFKA 3OSPA 3QEVA 2RF2A 3ZT4A 4QW9A 4ED0A 2IM0A 4KRFA 3RRHA 4N56A 4FM1A 4EP5A 5HBMA 4ZP7A 1XR5A 1S1VA 2FBVA 1KVAA 2LSNA 2XO7A 2AJQA 2I5JB 4YR2A 4CERA 4Z0UA 3PW5A 2IBKA 3LWMA 3VQEA 4M3XA 3QERA 1NK7A 2DTUA 4I2PB 1S1UB 4M45A 4E3SA 4KV8B 3G6YA 4F3OA 1D9DA 3CVKA 1RT2B 1A5XA 5JS2A 4IH5A 1N48A 4FZZA 4ELUA 3O3GA 1BI4A 3MXMA 5J2NA 2AX1A 3AVKA 1KLMA 4KSEB 3UIQA 2R8JA 3T5LA 2YHBA 1FKOA 1J54A 3KOAA 1BCMA 4H4OB 1KLMB 4I7FB 1MU2B 4HTUA 4WXWA 2W42A 3IRXB 1TKZA 3OYBA 4IRKA 2AGPA 5EWGA 2OH2A 4CGJA 3JYTB 5KG3A 1S48A 3RB3A 2ITGA 2P5GA 3JYTA 4Y2AA 2WONB 3NBPA 4M3TA 1VRUA 4O5BA 3ZSXA 3DOKA 1L3VA 3WNHA 2G8IA 4FVMA 1RT5B 1S1WA 2J6TA 2P5OA 2IC3B 2BRKA 4B8CA 2W7PA 4AILC 4CGDA 4CCHA 3FQKA 4O3OA 4FW1A 2EX3A 3T1AA 4DS4A 1I6JA 1EXQA 4FK2A 2BANB 1JKHB 3K5LA 3CFRA 1C1CB 1FKPA 2RN2A 4URSA 4ZVHA 1HYZA 2YNFB 3NGYA 3FSIA 4FJXA 4IG0B 1RDRA 3RWUA 1SL2A 3SQ1A 4C8LA 4N47A 4DSJA 4M41A 4C8MA 1KFSA 4KE5A 1KTQA 4H4MB 3VQ9A 1JLFB 4RZRA 3C6TA 4IOBA 1QE1A 3NDKA 5J2PB 3MEGB 4FJ9A 1QHTA 1B9DA 2ILZA 4GVMA 1KCFA 4DSKA 4Y34A 4I9LA 1WAJA 5I42A 1U45A 2QKKA 3OSNA 2ZKUA 2XGQA 3JSMA 1GX5A 4JV0A 1JXBA 4IG3A 2D5RA 5F8MA 2FLLA 4NCGA 2IJNA 4TYAA 3L2UA 1TVRA 1N6QA 1S6QA 3NE6A 1RT6B 2FJWA 2RDJA 4RW7A 1VK0A 3CG7A 2ATLA 1ZBLA 2XCPA 3OYHA 1D5AA 3SYZA 1BISA 3OS0A 5CYQB 2AQ4A 5F8JA 1REVA 2XWYA 2D7SA 4FM0A 2F8EX 4FYDA 4W5NA 2X74A 1YTAA 2OPPA 3L8BA 3MTKA 4JUZA 1IKWB 3OVNA 3OL7A 4DS5A 3RRGA 1LWFA 3CDWA 2KZZA 1SKRA 1W25A 4I2QA 3U6FA 5JS1A 1Z4UA 4ZVFA 4RUCA 4CEBA 2V0NA 1ASWA 3BREA 4ZPBA 2VA2A 4DU4A 3DYAB 1HRHA 2OZSA 4YR3A 1UWBB 4IH6A 4DF8A 1VSJA 4DF4A 3MF5A 3RAQA 3RMAA 4R0EA 4OKJA 1J5OB 4DSEA 4FBTA 2FBXA 4NLXA 3ZSVA 1RT7A 5L1JA 1Y97A 3SPYA 4QWAA 3SCXA 2IM3A 4KI6A 3DLGA 3UR0A 4NLDA 4FS1A 3GQCA 3TAEA 2IAJA 2HHTA 4LSLA 4J9RA 4ICLB 3ZT1A 4I2QB 1A5WA 4JRPA 5I3UB 1T05A 4OL8A 1SH3A 2YNIB 3H5XA 3HVWA 3OY9A 3L3VA 1NK9A 4JV1A 3KHHA 3QIPB 1RT5A 4CGHA 1MU2A 1ZBIA 4ZVGA 2JLEA 4CJPA 2HNDB 1JLQB 3HPHA 3DYAA 3C6UB 4U7CA 1IKVA 4HVJA 3TI0A 4DSIA 3VQBA 5HRRA 3TANA 4ECQA 2RKIB 1RDBA 1RT4A 2BE2A 5KFNA 3K59A 4OVLA 3M8QA 3DOKB 3ULDA 5SZTA 2PY5A 5D3GB 4G3IA 5HLFB 3O3HA 2VWKA 1LV5A 2BQRA 5HLFA 1RDDA 4MIBA 4DTJA 4DSFA 3IAYA 4KHQA 1RA7A 3V9XA 3CIZA 2P1JA 2R2SA 3U3YA 4G1QA 3TWHA 4CHQA 5C25B 1J9AA 3QEIA 1HMVB 1L5UA 4Q43A 1TKTB 4IDKB 1WSFA 4O0IA 2OA8A 3CWJA 4CHYA 1JLFA 4KB7A 1TVRB 4KHNA 2HB5A 3S3NA 1S1XA 1XC9A 2RPIA 3PY8A 4ED1A 3SQ4A 4R5PA 4IG3B 2FC0A 2G8UA 3RB6A 1LAVA 1CLQA 5I3UA 3MEDA 3RR8A 3M8PA 2VG6A 4K50A 4FJIA 1GOAA 4J9QA 4ZVEA 1UA0A 1JKHA 3QNOA 2C2RA 3S3MA 1U49A 3VQPA 5DK5A 4CJRA 3M8RA 2JEFA 3UPFA 3M8SA 2YNGA 3SFGA 2VWJA 4RNHA 4ZTFA 2IAJB 1TL1B 3Q8SB 4M42A 4JV2A 4N76A 4AHTA 5L1KA 2KFNA 3I5CA 1JLGB 4CF1A 2HHVA 4XIUA 3I5AA 1NKEA 1LWEA 1LWCA 4IKFA 1VRUB 3KK2B 3SI6A 4MQ3A 4AHCA 3KLFA 1LWFB 3CDEA 3LZIA 1S1XB 3I0RB 4KHRA 2FJVA 3Q8RB 2B4JA 4B08A 4BDZA 3EYZA 3CJ2A 3N6LA 4ECRA 1U4BA 2B6AA 1REVB 4EZ9A 1D0EA 4JRQA 2BQ3A 4EBDA 3DRPB 3V4IA 3OL8A 4Z4CA 1T8EA 2XY7A 4K4WA 2D41A 4IKAA 2KTQA 4DL5A 4J2AA 4RW4A 3OLAA 3AVAA 1NJZA 2Z1JA 3VQDA 4Q44A 3WNEA 5KG0A 1S49A 3VQAA 4QW8A 1EX4A 3RB4A 5KFUA 3HPOA 3CJ5A 4Q0BB 5KFOA 3HSTB 5CYQA 4HCBA 2Q3SA 5DG7A 3AV9A 3SUOA 3V81A 3DOLB 3I0RA 3AVJA 2XC9A 4XPEA 1RBRA 3TABA 4DU1A 3N6MA 1S97A 4BWMA 1QQCA 2CKWA 2HMIB 2R2TA 2D3UA 3NAHA 2RKIA 3C6TB 3AA5X 1JL2A 4W5QA 4RNFA 4O4GB 3VQSA 4Z4FA 4DQPA 2V4QA 1DTTB 3ZSQA 3MECA 1JL1A 4ECZA 3C6UA 4DTNA 3QGHA 2DY4A 3I5BA 3A2FA 3EZUA 1U04A 2HVIA 3V1RA 2YNIA 3QEWA 3HHKA 2QE5A 4Y3CA 3PUFA 1LW0A 4RW9B 4C8NA 3AO4A 3BQ1A 4HUFA 4B9MA 4IFVB 1SKWA 3CYMA 3HVRA 3C94A 4PQUB 4RNOA 1C1BA 1N5YA 4NLGA 2G8WA 1QS4A 4H54A 3VQ6A 1GOBA 3T5HA 3MEEA 4ZHRA 4LSNA 3PZPA 4BACA 5JXSA 1DLOB 4DTMA 2IJFA 3NL0A 3VQ8A 1IKWA 1NK5A 2YKNA 4W5TA 2ASLA 3SUPA 5KFAA 3QESA 4NRUA 1TKTA 4IDKA 1IM4A 1S6PA 2AGQA 2R2UA 2BDPA 4E1MA 3LPTA 2F96A 1TKZB 1SV5B 2WCXA 5HRNA 1YT3A 2EHGA 5FDLB 4CEDA 4ECSA 3VQQA 2XY5A 3QEXA 4NLYA 1CZ9A 1BQMB 3SNNA 4KTQA 4F4YA 4DFJA 3QIDA 3TAMB 1RBTA 2E4LA 2P51A 4NRTA 1UOCA 3H98A 3V9ZA 1T03A 1VSEA 1VSMA 3KKRA 1HQEB 4GW6A 4CEOA 2E6MA 1B92A 1N6QB 4RG8A 1R0AA 4TY8A 3DLKA 3CFPA 1RBSA 5KTQA 2R7YA 3PW4A 4FJ5A 3S9HA 5KRSA 5T7BA 1RT2A 3L2WA 1K1QA 3EY1A 4QOZB 4CJUA 4FXDA 2VA3A 1QAIA 5F8LA 3KLIA 4ECTA 3HP9A 3ISND 4DG1B 3KNAA 4TQSA 3KK2A 1RYRA 2D3ZA 4CIEA 3ZT3A 4ED2A 3H5SA 5DQIA 3OJSA 1WN7A 4RW4B 4QWEA 3P1GA 4B9SA 4CF0A 2CJQA 1S0MA 2IOCA 2UVRA 2C2DA 2OPSA 3DM2B 4DTRA 3MEGA 3L2QA 3CO9A 3VA0A 4E7JA 5C5JA 4KFBB 3ZSZA 2F8SA 2RDIA 5HP1B 5HROB 1RT3A 1A5VA 1KVBA 4WFXA 2X6NA 4NLOA 4BE1A 1D8YA 2HNZB 3KD5E 4FLVA 1RDAA 2ZQBA 3C95A 3AVMA 4KO0B 1ZTWA 2OPSB 3DM2A 3DLKB 1TL3A 2YNHB 4NLRA 5KFVA 3NGDA 1I39A 3M8PB 4FS2A 4DTSA 4FZYA 4CIFA 5DLFA 2AGOA 1I3AA 1NHVA 2HMIA 1Q9XA 4K4YA 4DQSA 3LP0A 2B5JB 3OYIA 2PYJA 5HROA 1JXEA 4M3ZA 4IFYA 5KT4A 1RTJB 3O4QA 4U6PA 4DFKA 2IDOA 5KG7A 4YQWA 4ZP6A 4ECVA 1VSDA 1T7PA 2BGGA 2HW3A 4B9NA 3LZJA 5DQHA 3IG1A 3KLVA 4CJLA 1SUQB 2JEJA 4CJ4A 4ELTA 1S1TB 1RT6A 2O4IA 4K4SA 4KV8A 1RTHB 3U3GA 1HPZA 3D28A 4ZTJA 1VSFA 4H4OA 4I7FA 4CEAA 1S6PB 4E7HA 1KHWA 4BDPA 4CF2A 4FJLA 3V6DA 3IRXA 2C22A 1SH0A 1TAQA 4IR1A 4MFBB 4O3PA 4WZMA 4CECA 4TLRA 4IBNA 1C0TA 2Y1IA 4FJMA 1S9GA 1JIHA 4YP3A 5C25A 3TR8A 2Z1GA 3KK1A 4M3RA 4K4ZA 5DLGA 3HL8A 4DU3A 4NLWA 2W9AA 3PW7A 4BE0A 4NCBA 3DI6A 1DLOA 5K14A 4RW8B 1JLQA 3MR6A 4E7LA 2F8TA 3KTQA 3LP2B 2QXFA 1BQMA 4ZPCA 2RF2B 2FBYA 3VQ7A 1WSEA 3PO5A 3QGGA 4GC6A 5F9NA 4MK7A 4NZ0A 1ZETA 3UQSA 4AHVA 2OPQA 4CJEA 4BE2A 4M94A 3SUQA 1HQUB 1J5OA 4QWDA 4DTOA 2G8KA 5HP1A 5EU7A 3NH1A 5FRNA 4DQQA 1U47A 2WHOA 4FW2A 3TAPA 3PV8A 3LP2A 5KG5A 4CFCA 4DTPA 4OPJA 4WFZA 1D1UA 4KKOA 2W8LA 2A1RA 3K2PA 3QO9B 4JLHA 4F8RA 5KFLA 5KGWA 4FLWA 3P5JA 1T05B 3NKYA 1JLEA 1JX4A 3Q8PB 4LSNB 2O5DA 5JUMA 3DOLA 3RBEA 3LPUA 4F4KA 5KT3A 3SFUA 4F4XA 1G15A 2UVUA 2ASDA 2NUBA 1RYSA 1BHLA 3KLGA 2JC0A 3V1OA 1ZBUA 4LD0A 4ED7A 2I1RA 4W5RA 4KHSA 4I9QA 4LQ3A 3AVBA 3TAGA 2OPQB 5KG4A 1S9GB 1Q8IA 5KT6A 3E51A 2ALZA 1C0TB 4AHUA 4IH7A 4EEYA 2YKMB 3NHGA 4WE1A 3OYFA 3KLHA 4DTUA 4MKAA 4XO0A 4K8XA 4KHYA 3IN5A 1NKCA 4RW8A 4NCGB 4LQ9A 5J1EA 4DLEA 5KG6A 2C2EA 3HVAA 4CEZA 3QNNA 1IKYA 3ZSRA 4R8UA 1S6QB 3P83D 4CK2A 1TKDA 3LDSA 1HNIB 1RBUA 2DPIA 4EBCA 3DRPA 3V4IB 1VSKA 5C42B 2AX0A 1RTJA 4WFYA 1C0MA 2OYQA 3BR9A 4J9LA 4E0DA 4O55A 5DG9A 1EP4A 2G8VA 2D0CA 5KG1A 1TL1A 4CHPA 3H59A 1LWCB 3PW0A 3TARA 3HT3A 4YFUA 3G86A 4LSLB 3KMSA 1J53A 5CYMA 2JC1A 1IKXB 5KFIA 4PUOA 3DLRA 4ID1A 5EWEA 4QWCA 3DLBA 2VG6B 3ZT2A 4FK4A 4CJ3A 3AVHA 3DMJB 4DL2A 3UDLA 2OPRA 2HHWA 3CJ4A 4MK9A 3GILA 4J9MA 3PR5B 4CJTA 1L3TA 1BL3A 1TP7A 2X6SA 3T3FA 4CHZA 3NCIA 2FVQA 1S5JA 5FROA 4CJFA 1KVCA 4J9SA 1YVFA 4OGCA 1SL1A 1JLAA 3OL9A 1N4LA 4FJGA 5EDWA 4K4VA 3ASMA 3KK3A 1TL3B 1JLGA 4KAIA 4NCAA 2R8HA 2G8HA 3CFOA 4DFPA 5T14A 5CYMB 4JS4A 2EC0A 4CHOA 4EZ6A 1IO2A 4J9NA 3MR5A 2ILYA 1HMVA 4DG1A 3HO1A 3KLIB 4B8AB 4M3UA 4F4ZA 4G1QB 3QINA 1WNEA 4PUOB 1S4FA 1IKXA 3AA4A 1JLBB 4GC7A 2HAIA 2X78A 5C42A 4B3OA 2XY8A 1RILA 1TV6A 3EPIA 2JEGA 3NBPB 3SI8A 3OYLA 3OS1A 4FLXA 4Y1DA 2Z1IA 5K14B 5KFCA 2IA6A 1RDCA 3ZSOA 3D45A 2PZSA 4NLPA 3G10A 3QEPA 2R8IA 4FBUA 4KPYA 2HNYA 3BJYA 2XRIA 5HRPA 1XR6A 1RT1B 3KJVB 3TAMA 1WLJA 3OYEA 3NMAA 2HHUA 4QPXA 2R2RA 4CGGA 4BWJA 3OYJA 1NJYA 1CXUA 3DLEB 2JGUA 3CM5A 2HWIA 3LWLA 3OYGA 2BQUA 2FVSA 3LAKA 4Z4GA 1S1UA 2R8KA 4CK1A 1U09A 3IGNA 5CZ2A 1S10A 1S1TA 1VRTA 4TYBA 4EYIB 1S1VB 1RTDA 4PQUA 4HCCA 1WSHA 1QSSA 1QUVA 1S0NA 2YKNB 4O44B 3ZSWA 1HQUA 4CGFA 4WZQA 4FCYA 3PX6A 1YTUA 3K5NA 2WTFA 4EBEA 3IS9A 2BR0A 1FKPB 4NYFA 3PJXA 4F4WA 3TAQA 4B9LA 4B9VA 3HM9A 2BANA 4KKOB 2E9RX 4CEEA 3FFIA 1EETB 1LW2B 3ITHA 3HK2A 3NF8A 4O4GA 5KFSA 1LW2A 1EETA 3ITHB 2FLPA 3GV7B 3M9NB 3G0ZA 4X2BA 3TVKA 4FM2A 2B43A 1JLAB 3IGVA 1NHUA 4B9TA 3CJ3A 3T5KA 5F9LA 3OYKA 4DL3A 4FLYA 3SV4A 1QTMA 4NLQA 3BQ0A
chains in the Genus database with same CATH superfamily
1FJCA 2ZBRA 4DL6A 3VHQA 1DZ5A 4CZJA 3G71N 4PWWA 2VODA 5EUHA 1VIXA 4O3QA 2E8AA 4JK7A 2G0IA 4CLTA 5C24B 3PW2A 3RAMA 5HMZA 4HLBA 3FCVA 3NOCA 2O8EB 3ZETA 4O44A 1HLUA 3QZ7A 2E2OA 3HXMA 4RNNA 4A2AA 3NG8A 5DM7L 5HMYA 1ATNA 1S9EA 1LAWA 4ILJA 4EHTA 3CE8A 2IIRA 5KGXA 1T9XA 3JXOA 5DGAA 3VQ5A 4ID5B 5A8RA 1HLWA 2F65A 3B8AX 3KK1B 1K8KA 3D9BA 5M1NA 4X62K 3V9WA 2OPPB 1WACA 4C4WA 1RCHA 1KNZA 4BRNA 4YNQA 4X64F 4NLVA 1BU6O 2FLNA 3VQ4A 1SCJB 3NCPA 2BVZA 2BA9A 3PYFA 3LP1B 5GADI 1KR4A 1ZTTA 4NMXA 1CLFA 4CYUB 3ZZ0A 4OMFG 1S77D 3P3DA 1HPZB 5M2RA 4KY3A 4EYHB 2P9PB 5BJRA 1M90T 2ZC4A 3NGUA 4OJGA 2BE9B 4JI3K 4P2SA 2B5JA 4ZA1A 3WZ0A 1C4AA 1YKWA 3LAMA 1VQKN 4X66K 2KN4A 2GHPA 3B54A 1FXDA 4CJVA 5FLXY 1IBMF 2JFKA 2JVOA 4TN2A 3UCUP 4LVNP 4QWBA 2LA6A 2YHXA 2HNZA 1HNVA 1NLKL 3E9LA 4E2FB 5MLCV 5AQHA 3CQ8A 2OD4A 2V2ZA 4CLZA 5KFYA 2XI2A 1Z25A 4K43A 4ILHA 2YNGB 2J4RA 4RW6B 4AH9A 3GPAA 1M1KT 4R5PB 1RADB 4BDYA 1OY8A 3V2UC 2ZDPA 3SV3A 5E33A 1C1CA 4ED3A 3OYAA 1K0VA 2VQEK 3NP5A 5LJWA 1GMWD 3VZHA 1X1PA 3CCVN 2KZMA 3QLHA 3MOZA 5CCLA 3DRSA 1H73A 1AYEA 3AARA 3HHLB 3CMAS 2P9GA 1GQEA 3R9LA 3BGRB 3MAHA 2RQCA 2C2OB 2I8EA 1ZYQA 1FK9A 2QWQA 4OX9K 3H4DA 5LL6d 2XB2D 3POTA 2F9WA 3QETA 2ATQA 1Y3KA 1I94K 2IDEA 1FWKA 1FT8A 2F8HA 4TY8B 3PEHA 3BN7A 2YKAA 3TJ9A 1F5AA 2YWFA 3H08A 4DMNA 1CSJA 3Q23A 4RW6A 3JQJA 3NH2A 4TKTA 4ZVUB 3LDPA 4KB1A 2W7OA 4I6AA 1M90O 3M4XA 1EKEA 3AFGA 5J2NB 2HQDA 2WRMA 3HDSA 3R9PA 4MK8A 3N6NA 2KQ2A 3V6HA 4FL9A 3CD5A 4DV3J 4AQYJ 1OS5A 3VCDA 3LALA 1WBDA 4C8OA 5A8KB 2DH8A 3I31A 2MLZA 1Y4ZB 4WCEQ 2IGIA 1RTIA 4WBFA 5GAGI 4QS7A 3MECB 2ZWOA 1Z2ZA 5AE3A 2HNDA 5BR8J 4FJ8A 1XHXA 2C28A 5HAOA 3VAMA 1UAXA 2AA4A 5HO4A 1R43A 1VYAA 1XR7A 4TU8A 2W01A 2FZCB 1S1WB 3ZFVA 2UXDJ 5IQQA 3K5OA 5GAHU 4KAZA 4F3QA 1XEZA 4KREA 8ATCB 2HQFA 2KW4A 3O9QA 5FRMA 4QU7A 1ZXOA 2W2PP 4NA1A 1NGEA 3VV2B 5B09A 3DU5A 4E7IA 4IFVA 3DC2A 4RBTA 2HHQA 2IS3A 3NF7A 5B0EA 1WJ9A 1VSHA 3CUNA 1PO6A 2ZZNA 4DR1K 3K58A 1VDHA 3F9KA 2NPIA 4NOHA 5KT5A 1JXVA 5LJVA 1EAYC 3BPSP 3GCWP 1UWAA 4F7VA 5THWA 2V52B 5EVZA 1T3VA 1Q8BA 2EG1A 2YPYA 1QQOA 2XGPA 1NJXA 1HQEA 4KHUA 4EI2A 2FVRA 3GYNA 3O3FA 3EE8A 3QBXA 4QYRA 3KHRA 2QZ8A 4J37A 3BSNA 3J81O 2Q3PA 3K57A 3VAFA 1HWIA 2VHGA 2FVPA 3VGSA 5CY4A 2CG4A 4OGEA 3WXIA 1PJ5A 2BE2B 2MKKA 4YR0A 4ECWA 5E41A 5LSRA 3GZ7A 4EU0A 1CPZA 2RAQA 2JH3A 1LOTB 3R2DJ 4FXWA 1VBYA 4K2JA 1TGOA 4PG7A 4HUGA 4KO0A 3U27A 1YUWA 2JX2A 4CVNE 4K8RA 1QVGM 1TKXA 2GC8A 3IR7B 1ZPWX 4JEPA 1FW6A 2BH1A 1RT3B 2AP1A 1RAJA 3L95X 1HX1A 2VJUA 4PXBA 3BF3A 4EAHD 2G8FA 3AQPA 2Z58B 3Q2SC 4ZVOB 3O9UA 2R7QA 5E2QA 1ATRA 5ITHA 4MKVA 4FP9A 5ETMA 4A48A 3GR1A 4GO5X 3MD1A 2P9NA 4NLUA 2P5VA 2Z1HA 1WSJA 1EO1A 3CEDA 3C66A 3J7ZT 3QT6A 3NNAA 3HULA 3UD5A 1Q53A 3TR5A 3OS2A 2OTJN 3E01B 1P9YA 2EWSA 4BY9C 3LO3A 4I2PA 2G9OA 1RBAA 3MCMA 2WB4A 1VRTB 3LP1A 1XQSC 3BSCA 1NUEA 5A6PA 2RUSA 2HIQA 4CO0A 2QLXA 1RACB 2PE8A 3KJVA 4G1PA 2V50A 4L73A 2XYGB 1IKYB 4EUVA 2VFVA 4K4UA 4I64A 4ZHRB 2AZ1A 5HBMB 3JAMU 3AVLA 5AJ3J 4USJC 3V6JA 2I38A 1FRIA 2XYHB 4BRIA 4CJWA 3M8QB 4LF4F 2HMPA 2R7WA 3RBDA 3OQ2A 4OX8A 4Y2CA 3GJRB 3JSYA 4RO0A 1AFIA 3MEEB 5KAKA 2DGQA 1S0OA 4R79A 5F1XA 5J2PA 2CQPA 3W9HA 3BDPA 1IH7A 3H4BA 1HNWJ 4KTZA 1KC8T 1VBZA 1FX4A 4DXLA 1FDNA 2BV3A 3KHYA 1C1BB 3NGIA 4FK0A 4P10A 4J9OA 4WFNQ 4B3MK 3GIMA 1FFGB 2DGTA 1GMWA 4KHPJ 1U8SA 2GJFA 3DU6A 2C2ZB 5I3QA 2ZHBA 1CULB 1MWMA 4DV1K 4QAGA 2FD2A 2QK9A 1YHQS 4N41A 4K25A 4I0WA 3BKUA 1GX6A 2FSJA 3C65A 4J9KA 4GV9A 2W4CA 2CPIA 1GXLA 3KLEB 3V6DB 3DDKA 1K8AT 4NLSA 3QYYA 3ILOA 4IYQA 1GLAG 4N5SA 4M3YA 2FJXA 4IR9A 1SUQA 3RR7A 3V9SA 3BSOA 4KTWA 5EWFA 5L38A 4CE9A 4AYBD 3E01A 1JLBA 2XULA 4GMJB 2CJYB 2DFFA 4L3NA 1T95A 2YH1A 1UVMA 3IA0A 4FNHA 1ASVA 3RMCA 3RG6A 2RS2A 4JI3J 4ILLA 1WSVA 1WI6A 2IMWP 3V1QA 3VEZA 4DHYA 3UWTA 3UKRA 4LBHA 4OKEA 3M1VB 2J6SA 4CP5A 1NBEB 5GIPA 4DUZJ 2GX8A 2R8GA 2ZKTA 1N8RT 1C0UB 4YDUC 4NYNA 3ICLA 1KSPA 2MDAA 3UN2A 5KFWA 4IRCA 3PHEA 3MUTP 2U2FA 2PYLA 2OIHA 3SMPA 5JVGL 4IZ9A 4BGBA 3DMJA 3OT9A 2E66A 3C15A 4X84A 2YNFA 2HHXA 2HWHA 4FJKA 1DHMA 2CJXB 3OSPA 2OCEA 2RF2A 4LF5J 3DGVA 4F26A 2HFOA 5EY4A 4FPRA 2XMMA 4FM1A 4EP5A 3A1YG 3PIOL 5HVGA 4FYYB 2BOPA 2FBVA 1S72S 3CJBA 3HD2A 2XO7A 4YB7A 3L0QA 1VHXA 5HQMA 2ZH5A 2OSRA 4Z0UA 3PW5A 3LWMA 2GTDA 3HHLD 2UZAA 4NX9A 4M3XA 4KH4A 1NK7A 3LDOA 4DR3F 4KV8B 4F3OA 5AZJA 1A5XA 4IH5A 4FZZA 2DR8A 5AQTA 4KSEB 3UIQA 1FKOA 1J54A 5BRHA 2BUNA 4H4OB 1KLMB 2QA4N 1Q81T 2LA4A 3M1FA 2O8CB 4WXWA 3OYBA 4ZCMA 4ZCLA 5EWGA 2OH2A 1EKRA 3TUJC 4ANCA 1BOTO 2MYFA 1S48A 1WDTA 1VRUA 3NCRA 2QIFA 2M5YA 1HNXF 4Q2MA 3DOKA 3IMQJ 3LPYA 1S6UA 3U7JA 3WNHA 2NRXA 4OYOA 2ZGZA 5M2UA 1Q5VA 2YWWA 3QRRA 4OV1A 1N52B 2YI1A 1S1WA 2J6TA 3E66A 4B8CA 1T0TV 4CLUA 3MM8B 4AILC 3FZLA 2QTDA 2XG8A 1XNQF 1JJ4A 4C8ZA 1FVQA 3T1AA 1I6JA 1EXQA 3EO3A 3DLLQ 5GIOA 2RN2A 4URSA 4G65A 3CETA 3FSIA 4FJXA 4IG0B 1OH8A 4JP8A 4X4OA 1H2TZ 3RWUA 4HTJA 1FNOA 1HD0A 2CQGA 3KG4A 4LFBF 3ZYYX 3CT9A 4N47A 1VI7A 1AT1B 4M41A 4C8MA 3LW5C 1KFSA 1TMJA 3C6TA 4JI7J 3NDKA 4LRCA 3ENHA 2X1GA 4FJ9A 2HG4A 4ZLPA 1NG9A 1UCNA 1KCFA 3A4TA 4UY8T 1VQPS 3H2UB 2GO9A 2B4VA 3UNGC 4I68A 5AQOA 2QKKA 3OSNA 2ZKUA 2XGQA 3E3XA 1BQXA 5H9FK 1FO1A 2VJVA 1JXBA 3QPIA 4RUHA 1MWKA 4NCGA 1RU1A 2ZEJA 2OLWA 1RE1B 4Z37A 2ZJPL 2BMBA 2Z57B 4K2XA 4GKKK 1RT6B 1YDLA 3SSQA 4M1KA 4RW7A 2BW2A 4ZITA 1SQGA 2JWKA 3MPYA 1RAGB 2E2PA 1ZBLA 2J0QD 1D5AA 3SYZA 1N0UA 5B0AA 3OS0A 2AQ4A 1GLBG 4BQLA 3R5AA 2D7SA 1LQ9A 2F5GA 2FC9A 4W5NA 3EICA 3L8BA 4JUZA 3KFWX 2WSCC 2VCPA 3OL7A 4USTA 5M1FA 3GIRA 4DS5A 3ULHA 1LWFA 2F7TA 1SKRA 3PYGA 1O6XA 3AA8A 2V0NA 3BREA 4ZPBA 3ETOA 1FJGK 4CH0S 3CQYA 2FHKA 3ZLJA 1RDUA 1OVYA 4DF4A 2E1RA 2V9KA 5AQJA 3CIPA 4ATNA 3J7AN 4DSEA 2QWMA 5AT1B 2V7ZA 4QWAA 3SCXA 2DR6A 1YJNN 3UR0A 3B4MA 1RFQA 3TAEA 5KPRA 2ZWPA 1IWAA 1T11A 2HVEA 3BGFA 4I2QB 4FO0A 3C0BA 1A5WA 1MROA 1F60B 1N36F 3H5XA 1X4CA 2Y0BB 1X9JA 3Q89A 4LF9K 1NK9A 5C15A 4JV1A 1PJ6A 3MX2A 1ZBIA 3BKTA 2HNDB 1UZDA 5M1KA 1K8KB 1RHJB 4FYWB 3EGWB 1WHVA 2ACMA 5EGYA 4C11B 4ECQA 3SSRA 4LR8A 4DV0F 5I4MA 4OVLA 3M8QA 4F0KA 1CJUB 1S12A 2PY5A 2JHEA 5DDQC 4H0XB 4M5DB 3JAMY 1LV5A 1FD8A 2VWKA 5B0BA 3O3HA 1PAEX 2L9DA 3ZXWA 2YKQA 1WG5A 3EJMA 4DSFA 2V34A 4YN3B 3WC2A 1N36J 3DHXA 2OMLA 4JI7K 2CNNB 4A47A 3OD2A 1HMVB 1XNRK 1DT9A 4IDKB 3CWJA 4XH1A 3D2EA 1NHKL 3BPDA 2GA7A 1Y0HA 4HVZA 1FXLA 4AF1A 4KB7A 4ER8A 4CJ7A 2HB5A 4HT7A 2RPIA 4ED1A 4R5PA 5C2GA 4WP9A 5I3UA 4CH1A 3CC2S 3MEDA 4FWKA 2P9IA 1PIEA 2MZ1A 1BLUA 2RRBA 3O9RA 3HI0A 3S3MA 4DUYJ 1SJRA 2CADA 2DNZA 1OH5A 1N5SA 5HMXA 1YG0A 2HF4A 5DK5A 4CJRA 2JEFA 1YJTA 1DFDA 5DM7Q 1GNKA 1T9UA 3FBFA 3D2FA 1KOOA 4B3RK 2YNGA 3PNIA 2IAJB 2M4MA 4M42A 3W1YC 4EFAC 5L1KA 3KZBA 5ETRA 1GAOA 4CW7B 2XMUA 1VQPN 3OFHA 1WC6A 3HSCA 3I5AA 1LWEA 4L74A 1LWCA 3CB4A 3CDEA 4C7QA 1FDAA 1XMOF 3Q8RB 1TYQB 4I6YA 2PC6A 2HFZA 1U4BA 3TNVA 4K5RA 4EZ9A 2R7SA 3FSYA 2XZTB 2YXLA 4Z4CA 4YOWA 2XY7A 1NM2A 3Q83A 4PKHA 3GYGA 1RAEB 2QLBB 1AZSA 3OLAA 2B3TB 2F4FA 3TEGA 3PLAA 3VQDA 1U0HA 4Q44A 3WNEA 2ZUAA 3IFRA 4QW8A 4DJBA 3RB4A 1E6VA 4NA2A 5KFUA 4R25A 1U8WA 2VPZB 4Q0BB 3FBEA 3GB0A 3A0IX 3HSTB 4L3KA 4N7TA 4HCBA 5AXLA 1DARA 2BOAA 2XC9A 4XPEA 4KGMA 2DB1A 1IQZA 3TABA 4AL7A 4C0BA 2AKWB 3EDQB 2YKPA 2HMIB 5L39A 4HHJA 3TSUA 2R3VA 3C6TB 3TA0A 2P9LA 2LCWA 4DU7A 2ZVSA 1BO5O 3C6UA 2HPUA 5M1PA 3I96A 3EZUA 1U04A 2HVIA 3V1RA 4X4NA 3T6BA 2W2OP 3CJ8A 3M2UB 1YJNS 4WU3A 3U9ZA 3BQ1A 1Z05A 2HZVA 4B9MA 5E3PA 3MAAB 7AT1B 3ATUA 3RW6A 4L6V3 4RNOA 4DX8H 4HTIA 2E5LF 3QAUA 1QS4A 3G8SA 3T5HA 3MEEA 4ZHRA 4A8YA 3X1LB 3T41A 3TYTA 5JXSA 4HTLA 3UN5A 4WIQA 4C6AA 3IM9A 5HK4A 4LF7F 5AQIA 3SUPA 3TO8A 5KFAA 3SQOP 2DISA 3QESA 1TKTA 1H7WA 2GV1A 2AGQA 4LF2A 2KVQE 4M5NA 2BDPA 3AOAA 1D09B 3T9ZA 2F96A 2QYGA 5C2CA 3PKMA 5C7PA 4FPAA 1U02A 4QBUA 2EHGA 2PI5A 1NNEA 4CEDA 3VQQA 3QEXA 1AZSB 1CZ9A 1BQMB 3SNNA 5AZJB 3HJVA 1LFWA 2HIYA 2L9WA 2KT2A 3QIDA 4DX5A 4A8WA 1C0GA 2CQIA 3H98A 2EI5A 3V9ZA 1VSEA 3CC7N 2FJEB 5IWAK 3KKRA 4GW6A 4CEOA 2E6MA 1FRHA 2CQHA 1Q78A 2UUBF 2FLOA 5KTQA 3I82A 3POTB 1QVFR 3S9HA 1X5PA 2V2QA 1RT2A 3SMSA 4QR2A 3JTPA 3W64A 4QOZB 4FXDA 4CJUA 3JQKA 1H1VA 4ECTA 3HP9A 4FF3A 3ISND 3KNAA 1RYRA 2PT0A 2L41A 4DR4K 3H5SA 5DQIA 3Q2TC 4DV2J 4RW4B 3P1GA 3DDNA 4PHTX 2RVJA 1EWQA 2XBPA 1VFJA 1NH7A 4P71A 1GMVA 3WIUA 3VA0A 4LRAA 2FHJD 3O4WA 3UCGA 5HROB 1RT3A 3M6XA 1A5VA 1KVBA 2X6NA 4NLOA 2CXEA 3GFZA 3VQTA 5LY3A 2OTLS 1IBLK 4WQ4A 3GFYA 2UUAF 2HNZB 2XLKA 4KH5A 3KD5E 1N34F 4LJMA 4DR2J 4KO0B 3L7PA 2OPSB 2HLUA 3WIVA 4FS2A 3Q7CA 1SJ1A 1SQFA 1HKGA 4FF2A 1BE4A 5DLFA 2AGOA 2BJ1A 1WEZA 2HVZA 2CJKA 4NEZA 1YI2S 5AQPA 1U25A 3OR2A 2B5JB 4OZ0A 4JI4F 1JXEA 3UO0A 5C0YA 2HWTA 4BC7A 1FRKA 4UOHA 4KC5A 2PEHA 2O3DA 3KK7A 4U6PA 1X0PA 1QVGR 1VSDA 3OBIA 1ZM9A 1T6DA 3OTOJ 3LZJA 5DQHA 1SUQB 4TLQA 3M30B 5HMWA 4ELTA 2XWXA 1NJIT 4K4SA 2W40A 3AGRA 2MJUA 3SAFA 2O8CA 4K5SA 5BPLA 4H4OA 4CEAA 2ZVIA 4E7HA 3V6DA 2EXUA 4JI4K 2C22A 2HHHF 4JI2K 1TAQA 3CCSN 4O3PA 5DS7A 3H90A 4CECA 4BR2A 4O8UA 2AEJA 4FJMA 3O44A 3PRBA 1RCXB 1VQ4S 2XS5A 1RGIA 4K4ZA 3HL8A 3BGOP 4BE0A 4NCBA 1KVJA 2L48A 2DNLA 4QIWD 2AYGA 1JLQA 2F8TA 4X4RA 1Z6RA 3KTQA 1Y7PA 4E98A 4P75A 4ZPCA 4X4SA 2FF6A 3QGGA 1QD1A 1NGIA 3ZETB 1NO8A 1TL7A 2DR7A 1RLCL 5JVHQ 4LF9J 3H7HB 3IC1A 4EMDA 2ZH9A 4KBOA 3EVWA 1HQUB 1R0CB 5K20B 1XNRF 2EEYA 2P9SA 4WKRA 2WVBA 2HSEB 4PXDA 3ENQA 5CQGA 3QO9B 3ZTPA 4USKA 3JS6A 5ADXH 3MUMP 3Q24A 3NKYA 3Q8PB 3NS5A 4OJ1A 5JUMA 5AQWA 2HGMA 1NH8A 2ZH4A 4LF5F 1PCAA 3HHNB 2UVUA 2R7XA 1W26A 5K8OA 2Q43A 1GT8A 3FUYA 5D78A 1NGGA 3OVBA 1HJOA 5IV3A 2FJDB 3ID6A 4W5RA 1FEHA 4KHSA 3OTBA 4LQ3A 3AA9A 2LEAA 3FLCO 3TX8A 3J80U 1S9GB 5KT6A 2ALZA 4IH7A 4LRFA 2UU9F 3OYFA 3KLHA 1B4SA 2DXDA 4N8NA 3H46O 1NKCA 3QDKA 4NCGB 4DLEA 5KG6A 2C2EA 3UKUB 4CEZA 1F9EB 1UKUA 3VEVA 2CGJA 3A3NB 4JI3F 1SIZA 1J5EF 2HQIA 2PSZA 2XMVA 4LFCK 4EBCA 3L7OA 3V4IB 2XO6A 3QRQA 5E26A 2OYQA 3BR9A 1X4HA 4JYAK 3B82A 5FPEA 2F8MA 2G8VA 2D0CA 1YRXA 2NSCA 2E5LK 3OFFA 4TNOA 1HL6A 3H59A 4ZVSB 3THWB 3BH7B 5KFIA 3DLRA 4M8LA 1IBLJ 2NLXA 4ZOSA 1ZH5A 1REGX 3CNQP 2KYXA 3CJ4A 4MK9A 4DV6F 3PR5B 1L3TA 2P9PA 2B4OA 3U1LA 3MI7X 2OUGA 4OYZA 1O8BA 2FVQA 1S5JA 3BM7A 3HT0A 2W2MP 4NXMK 2CNKB 2MQ8A 1L3KA 4KHPF 4QYZJ 4K4VA 3ASMA 1DAXA 3J7ZO 2W7AA 1JLGA 2G8HA 3T1HF 1B0VA 2UXBJ 3M8YA 2EC0A 4CHOA 2NYHA 1S7IA 4HT5A 3MR5A 2PO4A 4DG1A 3K8VA 3HO1A 5GAEU 4M3UA 1WNEA 2MKIA 1S4FA 2VASA 4GC7A 3THPA 1U6ZA 2DKOB 4B3OA 3EPIA 2J7KA 2JEGA 3CCTA 3OYLA 3OS1A 1RCOB 1RDCA 3D45A 1WHWA 2OAUA 4NLPA 1OVQA 1YRTA 1SPBP 4CBWA 1G2EA 5HANA 1XR6A 3KJVB 2A1BA 4ISFA 3OYEA 4DKWA 3OYJA 2EKNA 3DLEB 2BQUA 3LAKA 1J27A 1S1UA 5AJ3F 1Q4RA 5FD1A 1S10A 3BB5A 1I3OB 2M70A 3QAEA 1A9NB 4EYIB 5BR8F 3SSSA 3BKFA 3UDVA 5IT4A 4WTOB 1EQYA 3LPEA 2F9DA 3ZSWA 4CD1A 4CGFA 3PX6A 3WQPA 4AQYF 2VQEJ 3LOUA 2BR0A 2EFVA 1WB9A 2GMLA 4B9VA 2E9RX 4CEEA 3FFIA 3HK2A 4CZCA 3ITHB 2MGZB 4OX9J 3GV7B 4X2BA 5T41A 1JLAB 1RZMA 3CJ3A 1CJVB 3OYKA 3SV4A 1Q16B 1FXRA 5LJ3Y 3W8PA 4JI0F 1C6VA 2HBYB 1VSIA 1KAYA 1FRMA 3DLHA 1V6HA 2NZCA 4MMOA 3I0SB 4OYMA 3VAIA 1CC8A 1WWHA 3U1MA 3W5YA 1GTEA 1SQEA 2A42A 1UVLA 3SQGA 1TV6B 3AO3A 2UUTA 1G6BA 4CD3A 1OH7A 4I69A 3AVNA 1FK9B 5E0OA 1DTTA 4J2BA 1NKBA 4DCJB 4CZFA 2GBZA 1WORA 3LANA 2VF3A 2VG7B 3UFCX 2BKNA 3FRZA 1QSYA 4OHXA 4YB6A 4J9PA 4HYKA 5C2DA 2H3GX 2W2QP 3PSFA 2H65B 1MMNA 3ENAA 1Q7YT 3GOIA 3VN5A 2JNJA 2LQ9A 2ZOFA 1IBMJ 5EX5A 3NFAA 4FWQA 3GV5B 4B1WB 1RBOB 1HYVA 2FHJA 2J8SA 3MMJA 4NYZA 4WKYA 4F3TA 4DQRA 5IS2A 1RT7B 3NMRA 3EN9A 3H40A 3H3OB 3Q8QB 3MUVP 4IOAL 2J0XA 2JDJA 3OR2B 5F8NA 3PX4A 3GG4A 2O67A 3GV8B 1UA1A 1TQLA 2ZOGA 2W25A 3CGIA 3HX9A 2P9CA 4XEIA 2UYTA 2EWHA 2DPJA 4GVBB 1RAHB 1W97L 2A1SA 2O01C 1DQAA 1FRXA 3OHBA 5A8KA 2OANA 2QV6A 3JAMO 2AEMA 2F3JA 4DTXA 3OW2R 2IC3A 3J7YI 4WYLA 2V6AA 1QZ6A 4CH7A 2WW4A 3H5UA 1HNZF 1EP4B 1F21A 3VWSA 5K8MA 3UB5A 2I6WA 4IFEA 3N79A 3NF9A 2CYYA 3AH6A 4WYWA 1KN6A 2HFSA 4QIFA 2BJ9A 5G4DA 1NJWA 2AYEA 5ADZA 4OKKA 1S9EB 2NXEA 3JQMA 5KFBA 3BQ2A 4B3RJ 3HF5A 3CMAN 5GADU 3PX0A 1N32J 1Y5NB 1XMOK 1FFWB 4JI0J 5HOOA 1CJTA 5EX3A 3L6QA 1RT4B 2VG5B 3EEQA 2CIMA 1WG1A 4P2MA 3KHLA 1DQ8A 2WSFC 1O1WA 3AOBA 3HFZB 4OX9F 3I0SA 1JXLA 3HSJA 1UL3A 4B3TK 4H5NA 2Q6CA 3DXKA 4H8KA 3NAIA 3UD3P 1V5IB 3GWCA 2F4VJ 1XC3A 5GAEP 1SH2A 4DOZA 4YHHJ 3L7UA 5AQUA 3VGKA 2R7UA 4LH5A 1KLNA 2F4VK 3S1TA 1F0XA 3CJAA 2IM2A 2QA1A 2CPFA 4DWIA 1Y10A 2GIFA 2YX1A 3W9JA 4GV3A 1FFSB 2POKA 3NLCA 4GKJK 2EFNA 3AVGA 1RABB 3FQLA 2VU5A 3MWTA 1UPPA 3PHTA 5HJYA 5B7WA 1W2BM 3KD1E 3CC7S 2VBXA 2YPZA 1K6YA 1SI9A 4OZLA 3VAGA 1VMBA 2MZSA 1Q0NA 2BEFA 3J7A1 3OJUA 3QWUA 1UVJA 2J6UA 3E9OA 1AUSL 2GCFA 2W9BB 4ZMMA 1RWPB 5H1SQ 3AA2A 1QAJA 4XDDA 3G25A 2IPOB 2NR0A 4WF9Q 4MFBA 1JJHA 4U7UK 3GFHA 4RTFD 4M7YA 3LH2S 5KFTA 3UCZP 2UP1A 1NNDA 5C10A 1TU0B 1S9FA 2QJ3A 3QGIA 4X65K 4YHHK 4KI4A 3MM7A 4R8UB 4NYOA 2JRSA 4RWTA 4PWUA 3OLBA 1CQMA 1X9WA 2VKZG 1CJKA 3GJSB 1BD6A 3D2WA 5KI6A 1ZBFA 1UFWA 3GSDA 4B3OB 3I56S 4DL4A 2VGNA 1RWVB 3G6VA 3J81U 3K9JA 4P52A 3KUHA 4HUEA 5ETOA 4DR1J 1BIZA 4NLTA 4UT4A 2OJ3A 3MM7B 5AFUH 3EZOA 4ED5A 4DV6J 2DFHA 1YBUA 4CF9A 1X4AA 1OPIA 3AVCA 3WXLA 1NGFA 3F0NA 4JI8J 2C2NA 4ECUA 1IBLF 5FPDA 2BJ3A 3LL3A 2JJ4D 1U2RA 2LDYA 4DV3K 4CLWA 3EDRB 3ZZUA 1CS4A 5J2QB 4W90B 3OL6A 1F9FA 1M5HA 1XMBA 4P7VA 3O9SA 3VGMA 1I5OB 2DNOA 4QR1A 3N5FA 3P6YC 3KHGA 2DR5A 1W7WA 5CAAA 1IJEB 1RAFB 2Q1NA 4UF4A 5ETNA 2O66A 8AT1B 1PGZA 4CK3A 5D4OA 2WBMA 1IQTA 1HYSB 4DSLA 4A8XA 3O6QA 1B99A 2F63A 3RMBA 5M1OA 2MQLA 4OJRA 4E1JA 1IG9A 1OIAA 5IT9O 4KHMA 3C16B 4N77A 2UUWA 2DD8S 3MFHA 4RU9A 2YQ0A 2G0JA 3ENVA 1T3NA 3EL2A 3TSQA 4E7KA 3SBTA 3BGRA 2NUUG 4W5OA 2UU9K 1FJ7A 5KFEA 3T6JA 3OYMA 2GIQA 4ED8A 2QRRA 1XHZA 2FBTA 3LDQA 1RT1A 3CPEA 5D0GA 3LGNA 4NXNF 1HQ2A 2ZC3A 3ZZYA 4URGA 3ULEA 2PEBA 2V8PA 2DR9A 3CCMS 2HSTA 2VG5A 3MXJA 3H8YA 4H5RA 1IR2A 5DMRA 3MMCB 3OHAA 5D3GA 2YWKA 4LIWA 4E89A 4JI1J 1FD2A 1R6YA 4CFDA 2CA9A 1RNHA 4CFAA 1D3WA 1MMDA 4ZK7M 2Z2YB 3AVFA 3VQCA 2B6AB 5DETA 1R59O 4FZXC 2IHR1 2V4JA 1NK6A 3O2IA 4J7CA 4FN5A 1IKVB 2V7YA 1Q86T 4CZHA 5D4LA 1FF2A 1X31C 2MZRA 3DKDA 3L2VA 3KK3B 1ICEB 3UVJB 3AHPA 2UV8A 1ZOTA 2EVZA 3TAFA 3HSDA 2I5JA 1QE1B 4OI1A 5RUBA 1HBUA 2V68A 1MLAA 1VC0A 4DLGA 2KFZA 1BC6A 3F73A 2P9SB 1ZS6A 2RRNA 4CDIA 2LXIA 2ETJA 4PWDB 3AA3A 2DNQA 1ZZFA 3CF5Q 3M7VA 4NMLA 1DTQB 1T94A 3MFIA 2J9DA 3QMLA 3LDNA 1UWBA 2DH7A 1P8GA 5AQRA 1XTZA 3TZYA 1GOCA 3UN3A 3SQ2A 2QXLA 4Y1CA 3KUGA 3SAGA 4F25A 1R7IA 4JI1K 4OHVA 3S41A 4OO1J 4LF6J 4ID5A 3AJ2A 1UJ6A 3EWGA 3KMQA 2PA3A 3CQXA 5J1NA 1Q8KA 2UXBK 5D0RA 1YHQN 3G8TA 2Q36A 4NLCA 1NEEA 5D4NA 3CJSA 2QWNA 2WK4A 2VG7A 3BUZB 3BP8A 3P49B 4JHDA 5J1EB 4DHVA 1F3FA 4C1NI 2B9EA 4CO2A 2W9BA 3GIKA 4K4XA 3UKUA 2ZBPA 4TY9A 3W3SA 2DGVA 3S3OA 3OYCA 2EPIA 3V5RA 3SQGB 4L8RB 3HPGA 3OYDA 5F8IA 3PR4A 1UETA 2AYMA 1VLOA 3KLGB 1F1BB 5F3TA 2Z4PA 5D77A 2ZE2B 4FJ7A 3D5MA 4K8ZA 3PJWA 3ENBA 2Y0SD 4DV1J 2W24A 4YOYA 3G2XA 4I56A 3CDUA 2UU9J 1U2VA 2D0PA 4U7UD 1X60A 5AQNA 4CFBA 1HUXA 4GNIA 5AXMA 4Q8FA 2HHPA 4BROA 3IS9B 4RW9A 3FKBA 3NMUA 2DGXA 3ET6B 4LF8K 2MXYA 2N4CA 3RGIA 4ECYA 3NH0A 5KQDA 5K9FA 3FFIB 3BF1A 1LK7A 4BRMA 1UVNA 5KFKA 3QEVA 2B7BB 2G0CA 4QW9A 4KRFA 1S4EA 3RRHA 2CVEA 2DHGA 2W41A 1WF0A 5E3RA 2P9EA 4QYZK 3R5DA 1RHKB 1N0VC 2HZAA 4LFCJ 1KVAA 2A2DA 1DQ9A 1IG8A 3GG0A 1E6YB 3MM9A 1U2CA 1CJTB 3EKUA 4C3LA 5A2QU 4HDHA 2GMJA 1XNRJ 3S7RA 5AQSA 5A6WA 3MR7A 1S1UB 5AQYA 4ES2A 4YOUA 2WC9A 1D9DA 3AQOA 4DU8A 5JS2A 3O3GA 1BI4A 2FZKB 3ILIA 2YHBA 3G6EN 1BCMA 4I7FB 3D3CJ 4HTUA 2W42A 5GAHI 2AGPA 4CGJA 4WU2A 2QA4S 2O8DB 3QNWB 3JSBA 3RB3A 2PN6A 1VQLS 3VTIA 2WONB 3GL1A 8RUCA 1U1PA 4O5BA 3ZSXA 2Q2RA 1T02A 1L3VA 2HHHJ 2G8IA 3SIPB 1F2GA 2YHWA 1RT5B 3W5ZA 1AROP 1XMQF 4WQ5A 3WX8A 3PJ9A 3L4QA 4FW1A 2EX3A 5GAGP 2VL1A 4FK2A 2BANB 3DGPB 4W4MA 3WHIA 1CZAN 1HWLA 4L72B 4ZVHA 4JI4J 1VQOS 4KH6A 1NGBA 3NGYA 2AJ0A 2CPDA 1NWKA 4DCPB 4NZ7A 3PM9A 3JS9A 2HFUA 2LLZA 4F3MA 4DSJA 1U24A 3NGTA 2L3MA 3VQ9A 1PBAA 1QE1A 4DR2F 1TFYA 3VGUA 3OW2M 5K8PA 2ILZA 2DNGA 4GVMA 3IDHA 2CPZA 3GP9A 5I42A 1URRA 4CLKA 3JSMA 3CCVS 4YDDB 2BUPA 1WUUA 2MY7A 1M1GA 3VETA 2RILA 2IVPA 1OWXA 3CPWR 3I9V9 2FJWA 3HM8A 1XMOJ 3AAQA 1VK0A 2B9YA 2YY3A 3BEXA 4I4BA 2ATLA 3W5XA 2XCPA 4H5TA 5H1SV 5I9EB 1D8ZA 1REVA 3R8YA 1NSAA 1YK9A 2XWYA 3C7NA 5CD4H 5BRDA 4Y65A 3MMBA 1WHYA 1YJ9S 4BRLA 4FYDA 3AY9A 3I32A 4CZKA 3CD0A 1QUPA 2D1CA 3QWPA 1R8HA 2VH7A 2XM3A 3H42A 3ZTOA 2GS8A 1W25A 5LL6Z 2PMZD 3U6FA 1Z4UA 2J9DE 1OSCA 1K9MO 2VA2A 4DU4A 1WDDA 4IO1A 3DYAB 3VF4A 2OZSA 4AM6A 4YR3A 1VSJA 4DV2K 3QJPA 4HDGA 3RMAA 4R0EA 3ONQA 1NSPA 1BA0A 1Z1ZA 1MNEA 2DNPA 4NLXA 4RX6A 2AIRB 3GU0A 1Y97A 2QO3A 3ZX3A 4LFAK 2IM3A 3VF0B 2ZM6F 3OTOK 5IQ6A 4M7XA 4PKGA 1GLEG 3GQCA 4IOXA 2E44A 4AQYK 1RWXB 3BO2A 4LSLA 4C3MA 4LF7J 4ICLB 2GO8A 2Z30B 2CQ3A 4CLSA 4CZGA 5CD4A 2XQCA 1GLCG 1HR0J 4JRPA 5I3UB 1WKLA 1HW8A 1CVJA 3OY9A 2ZBQA 3QIPB 4CGHA 1MU2A 4ZVGA 2FY8A 3D66A 4CJPA 1BHNA 4JB8B 1JLQB 3HPHA 1JQGA 4GKJF 1Q5YA 3C6UB 2B4PA 1F9HA 4DV0J 1G1XA 3TI0A 3SXLA 4DI6A 3TANA 3IRWP 2H3EB 4A59A 3CC4S 5KFNA 3K59A 4JBCA 3DOKB 3ULDA 5SZTA 1P9QC 3I55S 4G3IA 3RBZA 3OXGA 2FHMA 3VMFB 2BQRA 1JCGA 4YY3K 2C3PA 4LF4K 1IUJA 4MIBA 4YOVA 2UXCF 1CJKB 1RA7A 4BC3A 3W8GA 3RU0A 3CJKB 4FNIA 3U3YA 4C11A 2NUHA 5ADXA 2MQMA 4MYUA 2DY1A 1L5UA 4Q43A 2LVWA 1TKTB 2CAJA 1EHWA 4CHYA 2W6LA 3HOSA 1K8AO 1TVRB 3SEOA 4KJIA 1XC9A 3PY8A 3SQ4A 3WX4A 3MGJA 3DXMA 4WK3A 2G8UA 1OQ6A 5F0WA 4K50A 4FJIA 1VQON 2OGUA 2CPXA 2QC3A 4ZVEA 3OVAA 1S5ZA 4JI5F 3HKZD 1NLVA 1U49A 1BWFO 1I94J 3VQPA 2RSQA 2DVIA 3BF4A 3GCXP 2H4YB 2ADBA 1RU2A 3M8SA 3D54A 1N5QA 2VWJA 4RNHA 1SIWB 5AQLA 2MKSA 5DRKA 3Q8SB 2FTRA 1QVFM 2QEXS 3BGUA 1R8AA 2IRXA 4CF1A 3GR0A 2YX6A 1SXLA 2HHVA 2BKOA 4KRWA 4XIUA 5E7OB 1YBAA 2WAQD 2P6TA 2XTJP 1UP1A 2ALYB 2CNOB 3I56N 2HF3A 4KYZA 1LWFB 1B0TA 3LZIA 1YIJS 1YRUA 1QLNA 5MAOA 2AJ4A 3HOTA 4KGZB 1D9AA 4B08A 3EYZA 1UEKA 4LBPA 4H0OA 4JRQA 4WJBA 4EBDA 2WFBA 1Y00A 3DRPB 3OL8A 1E3MA 4W92B 2RD5C 4DV7J 2D41A 4K4WA 5FLXO 5CHIA 3MX5A 3O80A 4RW4A 3PACA 3P4UB 3D2EB 2VYPA 2XLIA 4ZLJA 1S49A 1U26A 3H45C 5EX0A 4J8FA 5KFOA 1PJ7A 1VQNS 3MM6B 4PZVA 2Q3SA 2YHYA 1M5OC 1QQMA 2GUPA 4M5GA 3V81A 4OYAA 3AVJA 3C46A 3QGPA 1BG3A 1RBRA 1YJVA 4I1TA 3N6MA 2KG1A 1S97A 2ZM6K 1R8CA 2CKWA 1IVZA 5LMUK 4YY3J 4R0JA 2MZTA 3B78A 4WTYA 1AA1B 4NXNK 4XK8C 2GVZB 4DR4F 3VQSA 2V4QA 1H6KX 2DRAA 3E8OA 3QGHA 3I5BA 2ZHOA 4NXMJ 2YNIA 2Z2MA 4RW9B 1HD1A 1YXQA 4WCEL 4FSVA 1BWEA 2UUBK 5ETQA 3L4IA 2JFDA 4JV5F 4IFVB 3IBWA 4RCHA 3CYMA 4DPXA 3NWRA 3D7EO 3HVRA 3M6UA 2DCLA 1C1BA 1DBDA 3LQVA 4NLGA 1R6VA 2ZJQQ 3GE1A 2DT9A 1KAZA 3PZPA 5B0CA 4DTMA 2VUGA 4USMA 4X64K 1IKWA 2G13A 2YKNA 4W5TA 3CCMN 4IDKA 2BYCA 2F40A 2C3YA 2CZVC 2ASPA 1GH8A 1WC3A 4RR5A 3R3LA 3LPTA 2IVNA 2EG2A 5IT0A 4NEYA 4OZ3A 2ZJRL 1TKZB 2QLFB 2EKYA 1SV5B 1CQNA 1WUAA 2HKEA 1ZPVA 3GJQB 2XYPB 3CD7A 3W2VB 1RQ0A 1Q1KA 2Q0RA 3SCLE 5A2QY 2XY5A 4JI8F 2D9OA 2GAHC 4KTQA 5AQZA 4F4YA 2GFFA 4ES3A 3QB0A 3K89A 4NRTA 3FMWA 4XDCA 2Y1LB 1LK5A 3DJCA 4DPTA 3P31A 1R0AA 4YORA 1AXQA 4TY8A 3PW4A 4A5BA 5KRSA 5AR0A 3US5A 1U6BA 3MMVA 3EY1A 2VA3A 5F8LA 5AXNA 2VFUA 4FKXA 4DG1B 4RBVA 3VESA 3BYPA 5LXYA 2D3ZA 3FZFA 4BR9A 2RU3A 1HW9A 4QWEA 2RUGA 4HH0A 4CF0A 3QFWA 1S0MA 4H0YB 4LUBA 2C2DA 3CO9A 5C5JA 3ZSZA 4WIIA 1MSWD 4FWRA 4I6WA 4Y28C 1LXNA 1NGHA 6FDRA 2G2ZA 3K7RA 4JKFA 4PQAA 3C95A 1FNMA 1H74A 1TL3A 2YNHB 4LF1A 1I39A 4DTSA 4FZYA 5CABA 4C1NK 3ET6A 3R5BA 4OIXA 4BRHA 1YIJN 5D4PA 2ROPA 4DV5F 1NHVA 1KP6A 3QT7A 4L75A 2CPJA 4CI0B 3ZEUB 5A8WA 5CR4A 4DQSA 3LP0A 4X4VA 2EBEA 3M6WA 3MM5A 2OD6A 3RW7A 4Q2LA 4QU6A 4KIAA 1ACMB 5KPZA 1VBKA 1X4EA 3OR1B 5KG7A 4ECVA 3A8KA 3PFOA 2BGGA 3M8ZA 4CJLA 1X3MA 2JEJA 3DHWC 1RT6A 1HPZA 4OLPA 2I7PA 1S6PB 4BRFA 1KHWA 4PEOA 1SH0A 3ADAC 4OZ5A 5CHCB 1HBOB 1HNXJ 4I6MA 3D6TB 4K42A 4WZMA 4TLRA 2Y1IA 2XMJA 2M0GB 4AE5A 1S9GA 2Z1GA 2BZ2A 5BN8A 2CDQA 3KK1A 4M3RA 3NGKA 5IC4B 2IDLA 4ID8A 1RWOB 3PW7A 2RS8A 3THYB 4JI2J 4RW8B 4DX6A 4PPDA 5DJBA 3LM9A 4NLBA 3DLJA 2D69A 1YX2A 2QXFA 3R5GA 3CJ1A 4GC6A 5CH7B 4IDHA 4U67L 3FCWA 3H0PA 1ZETA 4DV4K 2HBRB 2OPQA 2EK1A 2OTJS 4DR3J 3SUQA 3DRXA 3L3CA 2FSNA 2AJFE 5HP1A 2QTWA 2Q6BA 3NH1A 3SCKE 1LOUA 4KH1B 2E88A 2WHOA 3TAPA 3PV8A 5BPMA 5KG5A 2A6MA 2ZH7A 5IWAF 2B7CB 4OPJA 4EWTA 2E7VA 4KKOA 5U47A 3HZGA 1IJFB 2A1RA 3K2PA 4F8RA 5KFLA 3G6ES 1JJCB 4FLWA 1JLEA 2A40A 1P8ZA 4QS9A 3DOLA 3LPUA 1TUWA 1SC4B 4Y2IA 2XS2A 1G15A 1QDUB 1A7GE 2X7IA 2KT3A 2A10A 3CCLS 2HEKA 4MT1A 2VQFJ 2MB0B 1BHLA 5ELZA 5KPTA 2QL5B 4A61A 1MA9B 5F0UA 1WHXA 2ZUGA 4LRDA 3V1OA 2H5JB 5IFMA 1Q8IA 2IMOA 4EEYA 2YKMB 2DHHA 3ZX0A 2FB0A 2MSTA 1PG5B 4DTUA 2N4DA 2D9PA 2ZFHA 4K8XA 2OHDA 4LQ9A 1HI8A 1VQNN 2OP5A 4PRFA 2RHSB 1APSA 4YOEA 2CH5A 3P83D 4UOCA 1HNIB 3ZZTA 1T9YA 4LF5K 2DPIA 3P5TL 3DRPA 2M3DA 2HRUA 1RTJA 3FZMA 2XNQA 3QFPA 4HL9A 2ZM6J 4DUZK 1WOSA 1UFKA 3WC0A 5KG1A 2A5XA 4DR5F 2CH6A 3TARA 4YFUA 3C16A 4KR0B 3QRPA 4LSLB 2V63A 1FEEA 3KMSA 1J53A 5CYMA 2JC1A 2I2YA 4C8YA 1N33F 3CERA 5EWEA 3DLBA 1T6CA 3P8BB 4CRJA 1KQKA 3DMJB 4PYDA 3IR5B 2OPRA 2MZQA 4FXVA 4KGXB 1TP7A 2ZGYA 2C2MB 4LRBA 3QSYB 3HHDA 4CJFA 1KVCA 4J9SA 1QHAA 1HBMB 5JLHA 4OX7A 1N4LA 5T7LB 2YQ3A 1T44A 2RE1A 4F36A 3OUYB 4NCAA 3CFOA 2V51B 3D6RA 1X4FA 3W63A 4DFPA 5T14A 5CYMB 4DN9A 4BVOA 1CS4B 2DIUA 2ILYA 5B08A 1HMVA 2DEJA 4FWPA 3KLIB 1PYTA 2IA0A 2QN6B 4OV6A 4PUOB 1S3XA 2U1AA 3M2VB 1IKXA 3WQUA 1JLBB 2JLFA 1NZAA 3Q8UA 4FPIA 1OQ3A 2YWGA 1FWPA 3VERA 1Y11A 4FLXA 1VR6A 4DPOA 5KFCA 2IA6A 2PZSA 3QEPA 3QATA 2R8IA 2HNYA 4OI3A 3R7NB 2CZ4A 5B0GA 4C23A 3TAMA 3LA0A 4CBXA 1NU4A 1NDLA 3NMAA 3T69A 2R2RA 4ANEA 4LF4J 5GAEI 4BWJA 1NJYA 3HFKA 1YSJA 3LDLA 2JGUA 2HWIA 2BJ8A 4Z4GA 5K8NA 2R8KA 4CK1A 3EUNA 5L46A 3IGNA 5CZ2A 2VQFK 1FJEB 3M30A 1VRTA 1S1VB 5BYQA 3PSIA 4QS8A 1RGVA 3I6PA 3W60A 3F9MA 3WBZA 2AD9A 1WEXA 1QSSA 4ZCKA 1S0NA 4Z7YA 4O44B 4N8OA 4NB4A 3CC2N 2Q97A 4PCQA 4HHUA 2V8HA 4WZQA 1KC8O 2FXUA 3SBGA 2OEMA 4MTPA 3A8IA 3HCXA 4EBEA 4Z7CA 3DLLL 3PJXA 4F4WA 3HM9A 2BANA 4KKOB 4UOFA 3NCQA 4KPCA 1SAZA 1EETB 4P2XA 2VWBA 2UUCK 2Y1RI 3NF8A 2VDHA 1LW2A 3A8YA 4ILGB 2FLPA 4ZVRB 1VCTA 3KWMA 4JI6F 1HNXK 4EIAA 3QBWA 4FM2A 2B43A 2YKOA 4B9TA 4C2MA 5F9LA 3MWBA 3AD8C 2YVSA 4FOEA 2HFVA 2I0XA 2GQQA 4DL0C 1TKXB 2Z0GA 1PILA 1H72C 2J76E 2XHBA 4OHZA 4P2FA 4F4AA 1VS3A 3RSEB 1V3SA 3I9ZA 5IOLA 2DH9A 3VAJA 3HVTB 4OJ3A 3ELHA 3ZSYA 2QI2A 2BBEA 4DR3K 2KXHA 2OO4A 3EGVA 5CCMA 4FJJA 4DV4F 1LXJA 2E9ZA 2WVFA 4OYBA 4D3HA 1S6OA 4I6MB 5A0YB 2ASJA 3S6EA 2E1ZA 2DNNA 4K59A 1S59A 2P2CB 1E4GT 1Q95G 3PVXA 1RA6A 1XJWB 1F5CA 3A5MC 2W9CB 4DPWA 2Q1LA 4YOTA 4M3WA 1IBCB 1U0SA 4NWBA 3CCZA 1U1KA 5EXWA 2ZD1A 3QLHB 4H4MA 1RXOB 4FVUA 1UPMB 4Q45A 3T5JA 2KHOA 2DPNA 2YHAA 2DNRA 4OZ2A 2D0BA 1NB7A 1JCFA 3MMAA 4HH1A 5ETTA 3FEXB 3D1HA 1FDDA 1VQ5S 4IQMA 4M95A 4MO5A 3KLEA 3MEDB 5KFMA 3C3LA 3GMGA 3WEEA 4JS5A 2XLJA 1OSDA 4IFYB 5L9XA 3ZNJ1 3C6HA 3CW2C 5GVQA 3F41A 4MH8A 4CTAA 4O4RA 4XTTA 1ZAWA 4RWWA 5HRSA 3KLFB 3FR0A 1JLEB 3MM8A 1VQ6N 4PKIA 2B0GA 4CO3A 1HI0P 3AVIA 2AEFA 1WC4A 5AQXA 4FLZA 2NZ4A 4OPAA 3QJLA 1RTIB 3AD7C 1HJRA 2CJ9A 2DGUA 2IM1A 2RQ4A 4NZ6A 1MG7A 2OSQA 2K06A 3IP0A 3TU5A 2AMCB 2LKZA 5BYRA 4FF1A 2WVEA 3NAEA 4AT1B 5ETVA 3G6XA 4BG8A 4PA1A 5AXKA 3UI3A 3M32A 4HI1A 2WONA 2NZTA 1Q81O 4AXJA 1SV5A 4ZP8A 4DV3F 4ZJOA 2KXFA 1ITGA 2KJWA 5D0EA 2KRBA 3MK6A 2WTUA 1NGJA 4JD2B 3R1LA 3O5BA 4FJHA 1C1AA 1X9MA 4UY85 3DXSX 5DGBA 5KFQA 1KAXA 3OVSA 5M1QA 2O8EA 4JKEA 1NK8A 1Q79A 2GUIA 4WFNL 1ATSA 4ZDNA 2P9UB 3DRSB 4LC9B 3SPZA 2ZWHA 4FLUA 2OZMA 2P9NB 2IVMA 2ADCA 1WSGA 5J2MA 3R8EA 4B1VA 4OLAA 4PWDA 3VEWA 4DV7K 1KXPA 1FERA 2ZNYA 3AY0A 3MM5B 1FHTA 5HL7Q 1M5VC 4OPHA 4CJSA 4GKKJ 5GINA 2VIHA 4BREA 4O3SA 4J90A 2KRRA 2QLJB 3QFUA 1VQ9N 3ZEUA 3H5YA 1UVKA 2QWLA 1HIYA 2KXNB 3FVYA 4JK9A 1VQ7N 3VA3A 2MMYA 4WFAL 3BBBA 5JMVA 1B9FA 1C2PA 1Y5IB 4F0MA 5LMUJ 1K73O 1U2VB 2ACYA 4CEQA 4YDXA 4BC2A 2K8GA 2QL9B 4QR0A 4NXNJ 3SDEA 5E5NA 2C3OA 1N34J 2A3JA 1RHUB 2F1FA 2ZE2A 2BW7A 3BY5A 2I7NA 1ZAVA 1S79A 5AQGA 4M5LA 1RAAB 2E6LA 1RTHA 4KBIA 4MIWA 4KT0C 3RAXA 2R7VA 3ISNC 1NRKA 5F3ZA 2JLGA 4NI2B 1JMTA 2ATCB 1NZ8A 2CQBA 5AE1A 1OO0B 1UEVA 2KI2A 4K4TA 4Q8EA 4Z4HA 4OPKA 1T3OA 4QIGA 4CJKA 4S0MA 1WSIA 1P1LA 2LMIA 3ALYA 1U7LA 4NL5A 4BRKA 2QKBA 1KWMA 5AE2A 3AO1A 3GTYX 3PRDA 4F2SA 3R5CA 5FPNA 4HKQA 2AU0A 3Q7BA 4ERDA 2VPWB 4DR6J 1BCOA 4WE1B 1CJUA 1VSLA 1URNA 4JHDB 5F8HA 3M9MB 3EXCX 3N01A 3QO9A 1KFDA 5SUHA 3R7BB 3FEZA 4DEZA 4ZVQB 4M5MA 5AQKA 1B64A 2N3OA 4TQRA 1L3UA 4FLTA 2LXFA 1RHQB 1E4FT 4E19A 2LQ8A 1K1SA 1RBVA 2GWJA 3MAQA 4OFZA 1UAWA 1PC5A 2FF3B 2Q0UA 3KJNB 2ABYA 3CD6S 3LM2A 1WF2A 4EK2A 1J6ZA 4J9UE 1KQFB 1SQKA 2UXCK 4WFBQ 5AQQA 1TK5A 3K5MA 2FC8A 2GQ2A 1BQNB 4Y6IA 4F67A 2DFEA 2QL7B 2HYIB 2QFJA 2H51B 4ECXA 1SJ3P 1D9FA 5KFHA 1Y64A 5L8RC 5DZ7A 5A8RB 3MMCA 4UQGA 3QZ8A 2ZZTA 1CZBA 2FJAB 2F9TA 1N56A 4AUKA 1TAUA 2IYGA 1B7YB 2IYIA 1NU0A 1ZM4A 3CSKA 4OLBA 3EGZA 2DRDA 1ZAXA 2JZ5A 2QLWA 2H5EA 4NXMF 1IBKJ 2FSKA 3GG1A 1I51B 2PIIA 3KDOA 2PAVA 2O8FA 4WK1A 2ZD1B 3NGZA 3BSAA 2HBMA 1U1MA 1KS2A 2CJAA 3HKWA 3A8JA 4XH5A 4LH4A 3A3PB 2CDRB 2K3IA 4OZ1A 3L09A 4ALZA 1OY6A 5F41A 3R6LB 3QJJA 4KB0A 4RW7B 4ZLNA 4P74A 2OEKA 1X4BA 5CZ1A 4JYAF 3HVTA 2DY9A 2VB6A 1U48A 2EW9A 4Y2KA 2WW8A 5DG8A 1LW0B 1PKUA 2F7VA 3F2KA 4CJ5A 4DV7F 1HNVB 1GXTA 1ZZNA 1HHQA 1DGKN 4IUFA 2V4RA 3HJFA 4EP4A 3DOMA 2V9WA 1HYSA 1X5OA 1Q7YO 3O1WA 4Y2MA 1Q9YA 2XHWA 2GGPB 3ZZRA 1NCLA 4ED6A 5JICA 3KDNA 2RT3A 2AJ1A 2BRLA 2O1PA 1GLFO 2QM1A 2LU2A 2QMWA 4LT6A 4ELVA 5DQGA 1MWZA 3DLGB 4AD6A 4B3RF 4XPCA 1V3ZA 4H0PA 3UKRB 4MIAA 3QQCD 1TL7B 1HNWK 1QJHA 4IQXA 2M88A 3WNGA 4YMEA 2VONA 4P7TA 5HN0A 5LMNK 1RISA 2XZDB 4CM0A 2LYVA 3R1XA 1W0HA 5CXTA 2B8QA 4KHWA 1EARA 1YTYA 1HNZJ 4Q5VA 2EFOA 2CPEA 4Y00A 3TSPA 1SZ2A 3M05A 3HP6A 3OYNA 3H2LA 1Z26A 5KFRA 5KRTA 1H2UX 5KFPA 3GIIA 4B02A 4ISGA 4MYTA 4RUAA 3MXIA 3DXBA 1NK4A 3FEYB 4MKBA 1ZBSA 1BQNA 4EO6A 4CM2A 3PKYA 2D3O1 4MO4A 5C12A 1KRPA 4CEFA 4PR6A 2KJVA 3LP3A 3WDOA 5KT2A 3G87A 4DL7A 4LR9A 4E1NA 1C4CA 2PMWA 3A12A 2FHOB 2HHHK 2NRWA 3I55N 2LEPA 2AP6A 3CJRA 3J80Y 1TK8A 4X4UA 2NRZA 3THXB 4GKJJ 4RU2A 3FZKA 1SB6A 2FVCA 2XI3A 3VEOA 1N5YB 2WVDA 2VBYA 4Y0FA 4ED0A 3KXDA 4N56A 5HBMA 2DEIA 2P9LB 1HR0F 3EXYA 3SK3A 1HA1A 4CZIA 3HLUA 2JWNA 1NXIA 2CGLA 3PYDA 3GYXB 4CERA 3CCRN 2QMUB 4DR7J 2MQNA 3Q22A 5IT9Y 1YVNA 1SVDA 2X3DA 2NRHA 3MN9A 2R9LA 3QERA 4NE9C 2DTUA 4I2PB 2O8DA 4M45A 4E3SA 5ETKA 2DCUB 2NXUA 2QMXA 1RT2B 2Q66A 1N48A 3MXMA 1M5PC 2XNRA 2AX1A 3AVKA 3T5LA 4A8OA 4FWLA 2O8FB 2VFRA 2DGOA 3UR3C 2QYCA 5JVHL 4B1ZA 3IRXB 4IRKA 2EFGA 2DITA 5AQMA 2ITGA 3JYTA 4Y2AA 3NBPA 4ZN1A 4MDBA 2P9KA 4M3TA 2OI2A 3SDEB 4JI6J 4PG8A 1WTBA 3NWGA 4PAAA 2B8PA 1E6YA 5EHHA 2KFYA 2IC3B 3MPUB 4DBQA 4IO9Q 1VOMA 3HFVA 2W7PA 2JOQA 3RZAA 1X5TA 2XS7A 2LU1A 4DS4A 3E2EA 2H1YA 5DDOC 3TOQA 2WBNA 2PFFB 2HQGA 3O6WA 1HYZA 2GWKA 1FKAF 1ULRA 4O23A 3CIMA 5B8HA 1EQMA 2AV5A 2D1KA 4K0KJ 3K9KA 2AHOB 4AL5A 1SL2A 2P8IA 3DN9A 3UW1A 3SQ1A 4C8LA 4UUXA 3FSXA 4JI7F 1KTQA 2X1AA 3FE1A 2NNWA 2XSJB 2G4BA 4CT8A 1ROFA 4CQ1A 1HI1A 3FC9A 3MAAA 2Y8WA 4C97A 3EE3A 4IOBA 1ZM3A 5J2PB 3MEGB 1V4SA 2MQQA 2FIUA 1LNQA 1X7VA 1QHTA 1Q18A 1B9DA 4FVCA 2DIVA 3L4BC 4Y34A 4I9LA 1U45A 1NJIO 1R0BG 1GX5A 1SJQA 4JV0A 4ZJQA 4IG3A 2D5RA 4OQJA 4YOXA 2GHWA 5HSPA 2Y9HA 3OBYA 3GFXA 5GADP 1N6QA 1RWMB 4PG6A 3H3NO 1S6QA 3NE6A 2RDJA 2Q31A 3IR6B 4QOTA 4HACA 5LT5A 2QW9A 4PXEA 3MZIA 5M2PA 4USWA 2DGSA 3OYHA 3T1HJ 4JKHA 5F8JA 1Y9OA 3QICA 2VFTA 1U1RA 1VIOA 3FGVA 3MN5A 2A3ZA 3O08A 2X74A 1YTAA 1IKWB 5BXIA 3TQEA 1O5JA 3RRGA 2KZZA 4V1Ak 4HEA9 3VEYA 4I2QA 2ZH1A 4LFBK 5JS1A 1HBUB 4ZVFA 3N5BA 3TJAA 1ASWA 4B1UB 1HRHA 2MKCA 5BPNA 2QWPA 3G9CA 1TYQA 3JXUA 1UWBB 1IBKK 2NRRA 1N33J 3MF5A 1VQ8S 3J7Z5 4DR5J 1J5OB 4IOCQ 3ZSVA 5IM0A 3TUIC 3IWXA 3NXZA 4FS1A 2E2NA 2IAJA 1YLXA 2CFXA 3FZ2A 2HHTA 3THWA 4J9RA 1EB0A 3FZHA 1KEKA 3ZT1A 2UV8G 4Z2XA 3MD3A 4QPTA 3HVWA 2L08A 3L3VA 4W98A 3KHHA 2GW8A 3CCRS 1O0PA 1Y3JA 3WXMB 3FK4A 2JVRA 4H4KA 2RMLA 5HRRA 2BM0A 4ED4A 3MCAB 2KO1A 2RKIB 3MURP 3S01A 4UW2A 4H03B 2BE2A 4NASA 3MWPA 3R97A 1O13A 5F0XA 1TUUA 4OI6A 1FX2A 4JD2A