1R0AA

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 138
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1r0aA05
2OZSA 1XR6A 1HJRA 3AVFA 5KFIA 3KLEA 5KFKA 3DI6A 3MFIA 3DYAA 4F50A 2F8EX 3CDEA 4IQXA 4GW6A 4IRCA 4E7KA 3QEWA 2FLNA 4Y2CA 1U48A 1JLGA 1HQUA 1TKZA 2O5DA 4TLRA 2W9AA 2BE2A 3I0SB 2O4GA 5E41A 4KTWA 4G1QA 3KMQA 3KK2B 1A5WA 4O44A 1C1BB 1BGXT 2JC0A 3QIPB 1IKXA 2FVSA 2I1RA 1JKHA 1FXXA 3TAQA 1EP4A 1EETA 5KFFA 4FJMA 4CGJA 2P51A 4DL2A 4TY8B 2HWHA 4CGDA 4FJ5A 2IC3B 3DLKA 3OSPA 4RNOA 3MAQA 2BANB 3I0RA 3OYHA 3ZSVA 2QE5A 4RUCA 2WRMA 3LP1A 3KNAA 1RT6B 4WZQA 3SUOA 4NLUA 4CEEA 5I42A 1BI4A 5F8GA 2JLEA 2OA8A 1GOAA 4KHRA 2HNYB 2X6SA 4H4MA 3NDKA 3CJ2A 1NK4A 3SUPA 3T5JA 4NCGA 1C0TB 1LWEB 4CERA 1S5JA 4WYLA 5C25B 4ZMMA 3IAYA 2AX0A 3FFIB 4IR9A 3AVBA 3N6NA 4DEZA 1QAIA 1TKTA 4I2QB 4MQ3A 3ICLA 3L2UA 4I2PB 2HHUA 3QO9B 3T19A 4I9QA 1ASUA 3OHAA 4DL6A 5KFQA 4NLXA 4IOBA 4K4SA 3VQAA 3DRRB 1BQNA 3H5SA 1RA6A 1SV5B 5HLFB 3QEXA 4CF9A 3SUNA 2B6AA 1LW0A 5EU7A 3ITHA 3HXMA 3PJXA 2FVCA 3D28A 3NF7A 2YNGA 2ZD1B 1TKDA 4B9NA 2KTQA 2ITGA 2V4QA 2B5JA 3PW7A 1NKCA 1ZBLA 4MKBA 3QEIA 4CJKA 3BQ2A 4ED8A 4Z4EA 1WNEA 2F8SA 4QWDA 4DS4A 4DSFA 4LSLA 3VA3A 3KK3A 3M9NB 2HVIA 4Q0BB 5KI6A 3GIKA 3V81A 3KLGB 3AA5X 5KT6A 4XPCA 4QAGA 1X9SA 3DRSB 4CJRA 4OVLA 2BRLA 4LQ3A 3NBPA 4IDKA 4IFYB 4L8RB 3ZT0A 1R0AB 5F8NA 3TAPA 3TAFA 4IFVB 4KKOB 1TV6B 4WZMA 2JEIA 3CVKA 4TSXA 1QAJA 3V9XA 1SKSA 4PQUA 1RT1A 4JLHA 1SH2A 1TP7A 3AVHA 2IS3A 4WYWA 3CO9A 4IH6A 5EWGA 3D5MA 3TAGA 1JLQB 3K2PA 3KD5E 3HJFA 3SQ4A 3H59A 1QSLA 4O4RA 1OS5A 2R8JA 2VG5A 3H2LA 4W5QA 1FK9A 4QWAA 2AGQA 1UA1A 3RWUA 3AO1A 4DG1A 3BJYA 1D1UA 4DQQA 1IO2A 3K5MA 4LH5A 2PYLA 4ECQA 3B6PA 3BR9A 4BACA 1HPZA 2FJXA 3SNNA 4DLGA 4PUOA 2V0NA 1JLBA 1BQMA 2Z1IA 4KO0A 1S0OA 3HM9A 2YNHB 4E3SA 2C2DA 4Y1CA 1VSKA 2DFEA 1VSMA 1T05B 1NK5A 3QEVA 4F4ZA 3LPUA 4KI4A 3IS9B 3V1QA 5KFPA 4FVMA 1S1VB 3DLGA 3KHLA 2R2SA 1JLFB 3CFPA 1QSSA 1TVRA 2HNZB 1L3SA 4N41A 2IJFA 4Y1DA 1RBRA 4DMNA 3P5JA 3O3GA 3OYDA 3DMJB 4PWDB 4TQRA 4F4YA 1RTJB 4B9UA 3N6LA 1WSIA 1RT5A 4FJKA 2XO7A 4AHCA 3V6JA 3IRXA 2OPPB 4RU9A 4H4OA 4ECYA 3LWLA 4RW4B 2BR0A 4OKKA 4ID5A 4RW6B 2D3ZA 4R8UB 4Q8EA 4MIBA 4ELUA 4OLBA 1N6QA 2WB4A 3RR8A 2OH2A 2XWYA 3TABA 2DPJA 4KFBA 1ZETA 4K8XA 2W8LA 4W5OA 4RW7A 1MU2B 2XHBA 1SL2A 2XY6A 4TYBA 4OL8A 3SUQA 4DTXA 3AA4A 1T03A 1EKEA 1FKPA 3QESA 3KLHB 1U47A 5K14A 4ECZA 4QW8A 2Y1JA 3NGYA 4Z4IA 4FJJA 1IH7A 2FC0A 1XC9A 4BDZA 4CJEA 3CDUA 3OYMA 4CHNA 4JV1A 4Z4CA 2GV9A 3NAEA 4FJ8A 2QXFA 1QTMA 3ASMA 4GVMA 2ZKUA 3NGIA 1A5XA 1NJXA 1BIZA 5KFSA 4IG0B 2ASDA 3C6TA 4MIAA 1RDRA 4CF2A 4URQU 3I0SA 3LZJA 1RYRA 3B6OA 4O3SA 2O4IA 3KK2A 2FLLA 4KHWA 3QIOA 1C1BA 5KFGA 4M42A 2G8KA 3LZIA 3QIPA 4I9LA 4K4ZA 4QOZB 4DLEA 2ASJA 2A1SA 4FJ9A 1ZTTA 4AH9A 4FK2A 2R2RA 1GOBA 4DQPA 5J2QB 3DLBA 5KG2A 5KG4A 5KFEA 4DL7A 4CJWA 1C1CB 2GC8A 4E89A 2IC3A 3GILA 1KVAA 4FJIA 3LALA 4J9NA 4CK2A 3NGDA 3PHEA 1TAQA 2BANA 4B9VA 5J2MA 1ASVA 3BGRA 2OPRA 3K59A 1RT6A 1RDAA 3AVAA 1QSYA 4ZPBA 4ECVA 4F3TA 4M3ZA 3VQ6A 2IAJB 4C8LA 2HNYA 1SH0A 2XY7A 3WNHA 4HUFA 1X1PA 1DTQA 4NLPA 1TL1A 3QETA 5C25A 2ASLA 4PY5A 3FFIA 3RB0A 2D7SA 4I2QA 3HVWA 3QNNA 4RNHA 4DFMA 3QO9A 2HHVA 4J9PA 3HO1A 4AHVA 3QINA 4CJPA 1B9FA 4B3OB 5JS1A 3DRRA 3CG7A 4CJUA 1WLJA 4KHNA 4CHZA 3MR3A 1GOCA 2RF2B 1SV5A 2OPSB 5HLFA 1BISA 2XGPA 3LAKA 4CJSA 3E51A 1REVB 4RNFA 2XCPA 3MR2A 3RMDA 3G10A 4J9MA 4M94A 4HHTA 4O3PA 1S1UB 5F8LA 5KFMA 3ZT4A 3CQ8A 2ZD1A 1FKOB 1S1XB 2VWKA 3BQ0A 3SZ2A 4RNNA 3VN5A 4QCLA 4EO6A 4TQSA 1VRUB 2AX1A 2EHGA 1RTHB 2XGQA 1VSHA 5HRPA 4EEYA 3GYNA 4RW8B 3C6UB 5KFDA 4O4GB 1VRTB 4NZ0A 4U6PA 5FRNA 4HUEA 3IG1B 4IH7A 1CZ9A 3M8RA 3M8QB 4WE1B 3PJWA 4FS1A 1NJWA 5C24B 1U04A 3D45A 2R8HA 3LP2B 3ZT3A 4CJTA 4E7HA 1NJYA 4CGGA 3NE6A 1QUVA 3DRSA 1LW2B 1KVCA 3OJUA 3LP0B 3VQDA 1IKVA 1TK0A 2ALZA 5KG7A 3PZPA 2WONA 4OPJA 3SPYA 2HNDA 2JEGA 4IFVA 2BGGA 4ZP8A 1TV6A 4CEAA 1QE1B 4ZVGA 4CESA 4DQIA 4KHUA 3PO4A 2FLPA 4AILC 4EYHB 1EXQA 1WSHA 1UWBA 5SWMA 2AWZA 3Q8RB 4OPKA 4ZTJA 4QPXA 3MEEB 2DTUA 4NLGA 4FW2A 1JLQA 4H54A 2OZMA 4KPYA 2EX3A 2JC1A 1U4BA 1KFSA 3HYFA 1TL3B 2Z1JA 4R0EA 4LH4A 3ZSWA 1UOCA 1DTTA 3Q8QB 2E6LA 3MECB 4BE0A 2FJWA 2R8IA 4ZPDA 2YHAA 1L3VA 5CYMB 2EC0A 1YTUA 2G8UA 2OYQA 4CIEA 2YNHA 4YQWA 3KHHA 4GC7A 3WNFA 5KFWA 3OYAA 1ZBFA 4O3OA 3OYGA 1T05A 2HMIA 2HVHA 4NCAA 3RR7A 3WNEA 3IS9A 2XY5A 3ZCMA 1NNDA 1S1VA 3AVJA 1JLFA 4H8KA 2YV0X 2BQUA 3T5KA 4ID1A 2IM0A 3RAQA 3U3GA 4B8CA 3Q8SB 4PWDA 4NLWA 3DLRA 4B9SA 1RTJA 3PW0A 2WHOA 2C28A 4CE9A 3TWHA 2YKMB 1S9EB 4DSJA 4N5SA 4FBUA 2G8WA 4O55A 4DSIA 2OPPA 4O3QA 1SH3A 1NHUA 4ED2A 4FLYA 4BDYA 3M8PB 5HROB 4RW4A 2BDPA 4RW6A 5DQIA 4R8UA 3H5YA 4ICLB 3MFHA 1WSGA 1YVUA 3GV5B 4EZ9A 3NL0A 4HYKA 3M9OB 4ELTA 4E0DA 3CYMA 3ZSQA 1CLQA 1MU2A 5HBMA 2P5GA 3AO4A 4QWBA 3Q8PB 3AA3A 5EDWA 2E6MA 1W0HA 3KLHA 3NH1A 3QERA 1SUQB 2X6NA 2BQ3A 1HYSB 4CIGA 4Q5VA 4R5PB 4CJLA 4CFCA 4FM0A 4AHRA 1TAUA 4KHQA 3HK2A 2VA3A 4C8OA 1C0UA 2VG6B 3OY9A 3OLBA 4WFXA 1WAJA 1VSIA 4CHPA 3TAMB 1JLEB 5J1EB 4DWIA 3HVTA 3G6VA 4GMJB 2UUWA 3ALYA 3L2RA 3MR5A 5DLFA 1Q8IA 4KHYA 4MH8A 4U7CA 3VQEA 4KV8A 1RTIA 4IG0A 4WXOA 1JIHA 1S0NA 5KG1A 3M9MB 4CK1A 2KQ2A 3ISND 3VQ7A 3UQSA 4FLZA 4RW9B 4ED3A 1ZBUA 1RDCA 4LSNB 2DFHA 2FBXA 4ZP7A 3DM2B 3QLHA 3ULDA 3AVKA 3CDWA 3KKSA 3VQPA 1IKWB 4ZPAA 2HHXA 4NRUA 3ZSRA 3OYLA 4W5TA 1U09A 1S9FA 1J54A 3V6KA 4FLWA 5J2QA 4K8ZA 4ZPCA 3KLVA 4CGIA 3KJVB 1IM4A 1N56A 1S6PB 2XCAA 3V9ZA 4DFJA 2UVWA 3EY1A 3F73A 3RRHA 4URGA 2J6SA 2D5RA 1SKRA 5L1KA 1HNIA 3O4QA 4KHSA 1C1CA 4B9MA 3AVLA 4IH5A 3SQ0A 4NLSA 1XWLA 1D0EA 3H5UA 3HHKA 4K4WA 4MKAA 4NLOA 2R8KA 1KTQA 2JEFA 4IRDA 1T8EA 1RBTA 5DG9A 2QKKA 3RB3A 4Y2AA 1WAFA 2IAJA 3MEDB 1C6VA 4FM2A 1KVBA 1UA0A 1S6QB 2XY8A 4M95A 1DLOA 3BREA 3HP9A 3V4IB 4URSA 4FS2A 4MFBB 5KFUA 5KT7A 2W9CA 4DTJA 3LPTA 4CECA 4YP3A 1RT3A 4K4XA 2ATQA 4Y34A 4M3WA 1S48A 1MMLA 3ISNC 1QHTA 5EWFA 4KB7A 4JUZA 2R8GA 3N6MA 2RF2A 2OPSA 1RILA 5FDLB 1REVA 5DK5A 5KFOA 4BDPA 1S9GB 5C5JA 4FJGA 3GIIA 4KREA 1KHWA 1S1UA 4FZZA 1HYZA 1TKXA 4I7FA 3CJ4A 3HT3A 3TVKA 4K4UA 4J9LA 1FKOA 5KRTA 2KFNA 1S1XA 1J5OB 3KLEB 3DI6B 1W25A 3DYAB 4ED7A 4FZXC 1VRUA 5KFZA 1Q9YA 1RTHA 4NYZA 4F4WA 2P1JA 1B9DA 4Y3CA 4N56A 3OS1A 1KLMB 4RW8A 3C6UA 4JRPA 3TANA 1HQUB 4UQGA 3NH0A 1TKZB 4OKJA 3L2WA 1RT7B 2BE2B 4F4KA 3L2VA 4FZYA 3IG1A 4CJQA 1F21A 4G1QB 4DTRA 3M8QA 4WE1A 1HYVA 4BWMA 4FLUA 1B92A 5C24A 1WSFA 3CJ5A 3RBEA 5I3UB 2VA2A 4E7LA 3AO3A 3K5LA 1J9AA 4JV0A 1C2PA 3OYJA 3PY8A 3PV8A 1Q9XA 3S9HA 3K57A 1LW2A 5J2PA 3OYNA 1YT3A 3MXMA 2C2RA 5KRSA 2ZE2B 3NAHA 4KTZA 4HVJA 3OYFA 4DTMA 3JSMB 4GC6A 3EPGA 2HHTA 5JUMA 4FXDA 2GIRA 3MXJA 3TI0A 2B43A 4J9SA 1QE1A 1HMVB 2IA6A 3KD1E 4KB0A 1Y97A 4OLAA 2Q3SA 4DF4A 4EBEA 4ECRA 3PW4A 3OYIA 2BRKA 5CY4A 5FRMA 1RT2B 3OHBA 4NLQA 5KFYA 4CHOA 3S3MA 5KG6A 1LV5A 3P1GA 3AO2A 1X9MA 1TL3A 3VQ4A 1NK7A 2FVQA 1Z25A 1N48A 3OVNA 2G8VA 3MECA 2HHQA 3A2FA 2AGPA 4TY9A 1Z26A 5CYMA 1JLAB 3KHRA 4DL4A 5EUHA 4YR2A 3LANA 4DSLA 4CEDA 4CGFA 3BSNA 2YKNB 2GIQA 4HUGA 1HQEB 1VSLA 4FLTA 2B6AB 2HWIA 1S10A 2D0AA 3CJ0A 4IKAA 3RB6A 3SQ1A 2J6TA 2YNGB 4HCBA 3OS0A 5JXSA 1WSEA 1LAVA 1RBSA 1X9WA 4M3XA 3OYBA 3OYKA 4M45A 4EO8A 5KFCA 4TY8A 1WN7A 3UDLA 4G3IA 5F8MA 3NH2A 4O0JA 1SL1A 4O5BA 2YKMA 1S9EA 2XI3A 3OSNA 4RUAA 4NCBA 2ILZA 5C42B 4LSLB 3KK3B 1YVFA 2FBYA 5HROA 3RRGA 3LP3A 4ZHRB 4YR0A 4ICLA 3GV7B 4RNMA 2E9RX 1JX4A 5KFNA 3SV4A 4DL5A 1A5VA 3KIOA 4BE1A 1C0TA 1LWEA 3QZ8A 4FW1A 3HP6A 4FK0A 1RT4B 1SUQA 2VWJA 5DG7A 3L3UA 3HSTB 1HYSA 3O3FA 1J53A 1JLCB 4DF8A 4R5PA 3UR0A 4DTOA 4I2PA 1I3AA 1HNVB 4IRKA 3CWJA 5CZ1A 5KFTA 4Q44A 4XO0A 4KBIA 2VG6A 3FQKA 1UAXA 4PA1A 3SI6A 3T3FA 4ELVA 1JLEA 1RNHA 5J1EA 1XR5A 1RDDA 1N5YB 3O3HA 1NK8A 4J2EA 4CHYA 4ZVHA 2CJQA 4ECXA 1NOZA 5DGAA 5L9XA 4FLXA 3NF8A 3ZT2A 3PR4A 3KLFB 3OL6A 4QWEA 1FK9B 3U3YA 4RW9A 3MEGB 2ZQBA 5T7BA 4LSNA 3H5XA 1BCMA 3DM2A 4OJRA 5DMRA 3OL8A 4ECTA 2WK4A 5JS2A 1IKWA 1JLBB 3C94A 4CJ4A 3CIZA 2JGUA 4EYIB 4O0IA 4XIUA 4FM1A 3KJVA 1S6PA 2OPQB 4Q0BA 4FJXA 2E4LA 3KLGA 2R2UA 4RZRA 3QGIA 4Z4FA 2I5JB 2F96A 1S1TB 3BDPA 4HKQA 4IFYA 4WXWA 5T14A 3OL7A 4Q45A 1KSPA 1L3TA 1R0AA 3T5HA 2R2TA 4ZTFA 3H08A 2WCXA 3QIDA 2IM1A 4TXSA 4KKOA 3OJSA 1T94A 1RT5B 2HHSA 3S3NA 5KG5A 2KFZA 4K50A 3MEDA 4Q43A 5DQHA 4BWJA 4M41A 5CYQB 5L1IA 4WFYA 3H4DA 1S6QA 4JV2A 2IMWP 5D3GB 1N6QB 3BSOA 2D3UA 3DLEB 3LAMA 4MFBA 3V1RA 3AV9A 4DFKA 3NFAA 4X2BA 4CEZA 1D5AA 2WTFA 2E9ZA 3IGVA 2G8HA 3NKYA 3NHGA 3AO5A 2FVPA 5K14B 4J9OA 3TQ1A 1D9FA 3I8DA 3PX4A 5F8JA 1NKBA 1S4FA 4BE2A 5FDLA 4ECWA 1HRHA 3KKRA 1S9GA 1KLNA 4F2SA 4KI6A 1ZBHA 3PW5A 1SKWA 1S49A 3P83D 1J5OA 4K4VA 2RDJA 2F8TA 4E7JA 2G8IA 3DOLB 4CGHA 3H40A 4FJ7A 1KLMA 3C6TB 2KW4A 2PYJA 4EZ6A 1RT7A 1IG9A 4J2AA 2IGIA 3K5NA 2IM2A 2YNFB 4OGEA 3RMCA 2HNZA 3U6FA 1D8YA 3EZUA 5I3UA 4ECSA 3L8BA 3DMJA 4KE5A 4CF8A 1BCOA 5KFHA 4W5RA 2VG7B 2AU0A 2ZE2A 1VSDA 3KLIB 3JYTB 3S3OA 3DRPB 3HKWA 3V9SA 4NRTA 3K58A 5KT5A 3JSMA 4Z4HA 1G15A 3SFGA 2HHWA 3VQ9A 4JS5A 4IR1A 2FVRA 1HMVA 4B8AB 2AGOA 2AJQA 3KOAA 5J2MB 3BGRB 2OPRB 1L3UA 5F8HA 1RT2A 5SZTA 3QNOA 1RBVA 1IKYB 4KHMA 2RDIA 2Z1HA 1N4LA 2X78A 3GQCA 3HL8A 3CM5A 3NCIA 1S1WB 5HP1B 3FRZA 1DTQB 3NF6A 4AHTA 4YNQA 1TL1B 4ZVFA 1XR7A 4FYDA 4EP5A 1JXEA 4B9TA 5KG0A 4YFUA 1LWFB 4B08A 3HVAA 2GBZA 4CF0A 5KGXA 4CK3A 2WOMB 3V9UA 3IN5A 1I6JA 5HRNA 3THVA 1WSJA 1JLAA 2BQRA 4CF1A 4KTQA 2IBKA 2YKNA 3L2QA 4RG8A 4DU4A 1HQEA 3K5OA 5KFXA 4FJNA 3DOKB 4DTSA 3AVMA 1D9DA 4M3RA 3TR8A 2QK9A 4FCYA 3QZ7A 5KFLA 4DSEA 3HPHA 2HB5A 1QQCA 4CJVA 5KTQA 3T5LA 4DL3A 4CFAA 3AVGA 4O3NA 4KAIA 2AQ4A 4CJ5A 1BIUA 3E01B 2D0BA 1JXLA 4F2RA 3O4NA 2RKIB 4QW9A 5HRSA 2LSNA 3DDKA 4DQSA 4B9LA 5C42A 3AVNA 1RTDB 5KFBA 4MK8A 4ZHRA 5FROA 3FSIA 3BSCA 3CFRA 3KK1B 4IG3B 4Q8FA 1KRPA 2W9BB 1IKVB 4DTNA 4J2BA 3OYEA 3RAXA 3MTKA 2YHBA 2WONB 2HNDB 3BQ1A 1RBUA 1RT4A 1JXBA 3V6DB 4LD0A 1L5UA 1JLCA 1W9HA 4CFDA 4M3UA 1HNVA 1UWBB 3SFUA 3ZSXA 2FBTA 3QGGA 4DQRA 4Z4GA 2W7PA 3G6XA 3T1AA 4YMEA 3HVRA 4F4XA 4B3OA 4ZP9A 5J2NB 4IBNA 2YNIB 1N5YA 1LWCB 3PO5A 3H4BA 1NOYA 1NK0A 3VQBA 1LAWA 4Z0UA 3KLFA 1DTTB 4F3OA 3MEGA 4KSEB 3WNGA 4KAZA 2W8KA 1VK0A 4XPEA 1RA7A 4O3RA 1JLGB 4WFZA 4O4GA 2ILYA 1VRTA 2UUTA 3L3VA 3VQCA 3CFOA 4EP4A 2XI2A 4LY7A 4E1NA 3QYYA 1CXUA 4NYFA 4O44B 3ZSYA 3LP2A 1IKXB 2HMIB 3G86A 1U49A 2OPQA 1SL0A 1JKHB 3KTQA 1KCFA 5F9LA 2I5JA 1EP4B 1S1TA 4HTUA 1EETB 2UVUA 3LP0A 2IM3A 3I5CA 3GIJA 4C8NA 1RCHA 4CEFA 4NLVA 3DLKB 1KFDA 3I5AA 4J9KA 5KT4A 2HAIA 3I0RB 2ATLA 1CXQA 4ED6A 1GX6A 4E1MA 5DG8A 4QWCA 2HW3A 2Y1IA 3PR5B 1NK6A 5CYQA 1XI1A 3LP1B 2PY5A 3GV8B 5I42B 1BI4B 3MEEA 3AA2A 3C95A 5D3GA 5DLGA 2KZMA 3DLEA 1K1SA 3SCXA 1BL3A 1XHXA 4H4MB 5HBMB 5DGBA 3G0ZA 1S0MA 4NCGB 1VSJA 4DSKA 4K4YA 1T3NA 3QEPA 3EYZA 2V9WA 3QGHA 5KT3A 1TKTB 4CFBA 4DTPA 3NAIA 3TARA 4NYNA 1S97A 1CZBA 3PX0A 1C0UB 3MF5A 5KG3A 3I5BA 1BQNB 1VSFA 3NGZA 3RTVA 4NLRA 2NUBA 3LWMA 4N76A 4CJFA 2ETJA 3HVTB 4W5NA 2XC9A 3UIQA 1LW0B 4KV8B 1GX5A 1U45A 4KB1A 3DOLA 3ITHB 1RTIB 1NK9A 1TGOA 2PZSA 2W7OA 2FJVA 3EZ5A 3KMSA 2YNFA 2UVRA 1RYSA 3QLHB 1C0MA 2B5JB 4CEBA 4M3TA 4LQ9A 2A1RA 4CHQA 3OLAA 5L1LA 5KFVA 1I39A 3NMAA 3HPOA 3SV3A 3DLHA 1T7PA 2VG7A 1HARA 5KFJA 2QKBA 3KLIA 3JYTA 3DRPA 4ED1A 3M8PA 3PX6A 3FQLA 3V81B 3G6YA 1KHVA 1QS4A 3TAEA 2KZZA 1HNIB 4AHSA 4YR3A 3HPGA 5HRRA 2J6UA 4HCCA 3NBPB 4IDKB 4TYAA 3VQSA 3EPIA 2Z1GA 4KRFA 3V1OA 3H98A 2GUIA 1XHZA 3PVXA 1YTAA 4C8KA 1CSJA 1NJZA 3V6HA 3IGNA 1IKYA 3SQ2A 1ZBIA 4FJHA 1O1WA 4PQUB 2R7YA 4DFPA 2DFFA 1RT1B 2RN2A 1Z4UA 3V9WA 1S1WA 5HP1A 4N47A 1ZTWA 1DLOB 3TAMA 4CJ3A 2G8FA 2W9CB 2W42A 1LWFA 4JS4A 3VQ8A 5KFAA 2WOMA 1BHLA 1RT3B 3OS2A 4CCHA 2IDOA 2VG5B 3D0PA 2JEJA 2IJNA 1TQLA 4ED0A 3RB4A 3AVIA 4DG1B 1VSEA 1K1QA 4MK7A 1NHVA 2RPIA 4EBCA 3KHGA 1HPZB 3RMBA 4PUOB 3VQ5A 3VA0A 1JL2A 3DOKA 1BQMB 4KO0B 2V4RA 1TKXB 4I7FB 3PW2A 4ZVEA 1TK5A 2B4JA 4NLDA 3MR6A 3RMAA 4F8RA 3VQQA 3UPFA 3ZSZA 4FBTA 3E01A 4NLTA 4OGCA 3SJJA 4DTUA 4EBDA 3AVCA 3DLGB 2D41A 3NF9A 5DQGA 5KGWA 4CIFA 1ZYQA 2RKIA 1TK8A 1TVRB 3SI8A 4DS5A 3ZSOA 3OYCA 2FBVA 4J9QA 4MK9A 2XRIA 4ECUA 3F9KA 4DU3A 4J9RA 3FDSA 5F9NA 2E9TA 2D0CA 1C1AA 4C8MA 4JRQA 4NLYA 1RTDA 5KT2A 3PUFA 3M8SA 2DY4A 4OKEA 3LDSA 4ZP6A 3OL9A 5J2PB 2QV6A 3BSAA 4FK4A 3KK1A 4IG3A 1NKEA 3IRXB 4M3YA 1ASWA 4H4OB 2W9BA 2X74A 1K6YA 5F8IA 3RBDA 3GIMA 3SPZA 4ID5B 4E19A 1RAJA 3CM6A 2C22A 3V4IA 2UVVA 3V6DA 4KFBB 2IOCA 1WNSA 1RDBA 4RW7B 2DPIA 3SYZA 2P5OA 1T03B 1FKPB 4J2DA 5KFRA 1EX4A 3CJ3A 1JL1A 4CEQA 2C2EA 2CKWA 5CZ2A 4IKFA 5J2NA 2YNIA 4AHUA 4FJLA 3MXIA 4DU1A 5EWEA 1LWCA 1ITGA 4FLVA 4K4TA 3ZT1A 4E7IA 4TN2A 5L1JA 4CEOA
chains in the Genus database with same CATH superfamily
1SCJB 3KKFA 4RWWA 2PFUA 3KLEA 4BG8A 4OZNA 3CDEA 4E7KA 4X64K 2X51A 3VEYA 2FLNA 3G71S 1VK3A 3D3BJ 1OVYA 4C23A 2NS1B 1FWLA 2AV5A 3I0SB 5E41A 1K8KA 4G1QA 4DZ6A 3KMQA 1A5WA 2RU3A 3RJMB 2FVSA 1KQGB 3PEJA 4OX9K 1YVNA 5AQZA 3TAQA 2Z2LA 1MMDA 2YWGA 4CGJA 3TTCA 2J7KA 3EEQA 2P51A 3MDQA 4TY8B 4ITSA 5H9EK 4KHPJ 1HHTP 3TQEA 5ETQA 3OSPA 1FNMA 3MAQA 2PAVA 5IFMA 4Y0WA 1FJGF 4FWLA 2BANB 3I0RA 3QMQA 3PHTA 3JB9k 4IOCQ 3MM5B 3D7EO 3ZSVA 2HZAA 2QE5A 4LVNP 1W97L 2WRMA 3LP1A 2ROGA 3MPUB 1RT6B 4WZQA 3SUOA 1NBWA 5I42A 2IVNA 5BJRA 2ZHAA 4H4MA 3CJ2A 2AJ4A 4A8KA 3SUPA 3T1HF 4USVA 3T5JA 3EZOA 1N34F 4WYLA 5LMNF 3IAYA 3FFIB 3AVBA 3BZQA 3NNCA 4MQ3A 3QO9B 4CZCA 4DR7K 3OHAA 4DOZA 1SQKA 2NRXA 3DRRB 2AD9A 3H5SA 1IUJA 3DGPA 4FWKA 3QEXA 4DV6F 4JI0K 4P72A 1M90O 4QIVA 2HQDA 1NNEA 4A8FA 2UUAJ 5KPTA 3BBFA 5EU7A 3PJXA 2FVCA 4WP8A 9ATCB 1UCNA 5DRKA 2YNGA 1M5PC 3EVOA 3K0SA 3ENQA 3K7RA 3T7ZA 3SQGA 2QG9B 2B5JA 3ZNJ1 3IFRA 4MKBA 4ANCA 3MMAB 1GLJO 1ZZNA 3VGVA 1YRXA 1WBBA 3KZBA 1WNEA 3X3UA 2ZOGA 2PSZA 4ZN1A 4JYAK 3FGUA 3QFWA 2DR9A 1VFJA 4JHDA 1OH6A 1CULB 1KVJA 5AZIA 3KLGB 5KT6A 4A59A 4XPCA 1WOSA 1Q16B 3DRSB 2OD4A 1Y00A 3H3OB 4LQ3A 1AA1B 3TAPA 3TAFA 1FF2A 3O08A 4IFVB 4K0KF 3ZZOA 3F9MA 4HWIA 2DHSA 3A12A 1GQEA 4TSXA 3BH6B 1M5HA 1PG5B 3VETA 1SKSA 1N36J 2DNRA 2FZGB 5E33A 1TP7A 2IS3A 4DR4K 1M0SA 2RSQA 4IH6A 5EWGA 4RBVA 3TAGA 2Q6BA 2RE2A 5C15A 1BHNA 4O4RA 1NZ8A 2VG5A 3H2LA 2KVQE 2W2OP 2DNPA 2GO9A 3AFGA 3UWTA 3WEEA 1J6ZA 2AGQA 2RNEA 1E3MA 3RWUA 4BBYA 2RE1A 4X4QA 2FTRA 2PYLA 2W6LA 3CC4S 4I69A 3NOCA 3L4BC 3BR9A 1AUDA 2KXNB 4PUOA 4PXCA 2QWOA 5DDOC 2V0NA 2Z1IA 3H42A 5L9NA 2C2DA 2AYGA 2XMVA 5T7LB 3EWGA 1VQ8S 4GKKJ 5FPMA 4OLPA 3IS9B 2P9PA 2ADCA 2XSJB 4OYMA 4WF9Q 3FJ2A 1PC4A 4C0HA 1L3SA 2NXNA 4DV3F 2O8BB 4Y1DA 1RBRA 3OYDA 4TQRA 4B9UA 5TKWA 4FJKA 2BA9A 5AQXA 1FRJA 2GFFA 2OPPB 1R89A 4F02A 4J8FA 2GWKA 4UOCA 1HBMA 2CZ9A 3PYDA 1N6QA 4P6QA 3MDFA 1XC3A 2XWYA 3TABA 3NCRA 4YOVA 5IOLA 2KJVA 1R7IA 4W5OA 7FD1A 2CDQA 2XHBA 1N0UA 4JI7K 1SL2A 3ZNUA 4TYBA 4KIAA 3SUQA 4WKYA 3DC2A 3ET6B 1XNRK 4FWMA 5K14A 4ECZA 2GHWA 3QFHA 1Q0NA 2NUUG 2IRUA 3CE8A 2Z4PA 3W60A 4BDZA 1F3VA 4UW2A 4ZDNA 3R5GA 4BRNA 3A0IX 2QXFA 4I64A 4GVMA 3HZ6A 1NSQA 3I4HX 1QHAA 1BIZA 2MKKA 2VJVA 1DBDA 2HRTA 4QYRA 2KVIA 2ASDA 1KS2A 5DM7Q 3C6TA 4OI3A 1RDRA 4QR2A 4CF2A 4URQU 3I0SA 3HSJA 4LR9A 2FLLA 2DNHA 2ASPA 1IWGA 3SSSA 1S57A 2A3JA 4I9LA 2IVPA 1L3KA 1UWAA 3TTFA 1GMWA 4TNOA 3FEYB 4LFCJ 2QWQA 5BYRA 4AH9A 2YTCA 3MURP 4DQPA 1IQZA 3EE8A 5AQHA 4DL7A 2XLJA 2BZ2A 3GILA 4FJIA 4CK2A 4WK1A 3NGDA 4LF8K 3SCKE 1ATNA 3R6MA 2BANA 4B9VA 5J2MA 3AD7C 3VPZA 3BGRA 2FC8A 2VQFF 3HI0A 1RT6A 4PABA 1WI6A 3AVAA 1I3OB 3CMEN 1SB6A 3CCMN 4B3MK 2B8QA 4J90A 1DTQA 3L4IA 4FF3A 1HW9A 1RAFB 1TL1A 4HL9A 3UN2A 1FERA 2PC6A 3FFIA 2O8FB 1N32J 4RNHA 3E9PA 3QO9A 2V34A 3M8YA 1IBKJ 2DXDA 3DRRA 4KHNA 4X65J 1WLJA 3CJ1A 1BISA 4ZVQB 1FWKA 2G0CA 3ZEUA 2XGPA 2P9LB 2YKPA 3IKMA 2KDOA 2A6OA 1S1UB 4A46A 2GEMA 4DV4F 2GTDA 1FKOB 4LF9K 2VWKA 1U1KA 4QCLA 1VR6A 4EO6A 2RDDA 3AXMA 3SAFA 3CSKA 4EEYA 4ZCLA 3C6UB 1JNRB 5KFDA 2Z56B 5CHCB 1Q7YO 1J5EK 2VPXB 1NDLA 4FKXA 3PKMA 4HUEA 3IG1B 4IH7A 4KT0C 5FRNA 4KQZA 5IWAF 3PJWA 4ZPWR 2BKPA 4A8QA 3EN9A 4IZ9A 1NJYA 4E7HA 3NE6A 1GXUA 5DZ7A 2HHHJ 2Y9HA 2DNYA 1HI1A 3JQJA 4DI6A 3DRSA 4C3MA 1XJWB 2BUNA 4Q7AA 5B09A 1RCXB 3CCUS 2A3ZA 3OJUA 4YOWA 4BR9A 2NCKL 1HKBA 2ALZA 5JVHQ 5AQGA 2JEGA 3DU5A 4IFVA 1VQLS 2DNQA 4ZP8A 4LIRA 2Y8WA 3SMZA 1RP5A 2KFYA 4EYHB 1N8RO 1WSHA 2J9CA 4PKIA 1CJUB 2O66A 2J5AA 2GMLA 3J7AN 2Z30B 3OW2R 3CD7A 4FW2A 4IJAA 3MM8B 5ETTA 1NDPA 3GL1A 4KPYA 5BPLA 2EX3A 2JC1A 1U4BA 3VVTA 4FWPA 2HIQA 3HYFA 1XMQJ 2A6MA 4NZ7A 2GX8A 4B1XB 4DR3J 1ZAWA 5D4OA 4DR1K 4R0EA 3O5BA 1UOCA 4XH5A 1DTTA 8AT1B 4ZPDA 3H1QA 2YHAA 1L3VA 4MIWA 1U1PA 2LXIA 4ETZA 4BRHA 4YQWA 3ISZA 2LEBA 1KP6A 3WNFA 3EXCX 4KC5A 3GLJA 5T7LA 2Q2RA 2VFRA 1Q81T 1KN6A 2HVHA 1VBYA 4NCAA 4BS2A 3CJ9A 3IS9A 1E6VB 3J80Y 2XSJA 2YV0X 1AFJA 1YI2S 4RKUC 1REGX 3T5KA 2O8BA 2OTJN 4JK7A 4DBQA 3OFHA 2MLXA 2YJFA 3BGLA 4YUDA 2R7TA 1S9EB 1U1QA 4DSJA 4N5SA 2G8WA 3C16B 4DSIA 2OPPA 1KAZA 4IO9Q 4JI6F 4ED2A 5LMUF 4B3TK 3M8PB 5HROB 2HVZA 2BDPA 3NS6A 2LU1A 4ICLB 3MFHA 3OA9A 4BC4A 3GIRA 4ELTA 4LVOP 1WSVA 4RUHA 4UT4A 3CO0P 1W7WA 3ET6A 5EDWA 1K0TA 2E6MA 3WQPA 2E1PA 3NH1A 3QDKA 1DKGD 3FNNA 2GGPB 4DPWA 4R5PB 5B7WA 1PJ7A 3GFZA 3BZKA 1UFKA 1TAUA 3ADAC 4KHQA 2VA3A 3TVZA 1T9UA 2VG6B 2JFKA 4CHPA 2DNLA 2DGXA 4YHHJ 3L2RA 5DLFA 4KHYA 4U7CA 4L6V3 3MTJA 3P5TL 4YDUA 4WXOA 4AQYF 2VGMA 3R1XA 3M9MB 2UXCK 2PA3A 1OQ6A 2UV8G 2FPHX 2JOQA 2MPUA 1RGVA 3ZC4A 1IKWB 4ZPAA 2AF6A 2HHXA 4NRUA 3QFUA 2FB0A 5I9EB 4W5TA 2QWPA 1J54A 2VF3A 1S6PB 2VOPA 1Q79A 2VDIA 3HFZB 4URGA 1E4FT 2QZ8A 2AYBA 1QJHA 2POKA 1VBKA 4R79A 2CQ1A 1Y9OA 1CZAN 2UUCF 1XWLA 3A1YG 4CZEA 3O6WA 2EFGA 1F2HA 4YOYA 5LY3A 3W1YC 1NHKL 3CC7S 2OAUA 2JEFA 4YN3B 4B3RF 1M5KC 1RBTA 4X4TA 3RB3A 2VGNA 2DEIA 2KT2A 1EHWA 2B9XA 4LBPA 3UE5A 5AFUA 1U1NA 4BQLA 5JLHA 1S6QB 4M95A 1NPKA 1DLOA 3BREA 3HP9A 2MHNA 3FVYA 3DLLL 3I9ZA 1RAGB 5KFUA 2O8FA 3DDIA 2CADA 1RT3A 2ATQA 3CF5Q 4Y34A 1S48A 1MMLA 3ISNC 4GMKA 5EWFA 4KB7A 3MN9A 2QYGA 4JUZA 4ILJA 4NA2A 3N6MA 2DGSA 2V67A 4F4AA 2P9LA 1SS6A 1NU4A 5KFOA 2MZRA 1U24A 1KOOA 4KREA 1S1UA 1TKXA 4U67Q 4LSZB 4K4UA 1FKOA 2GAHC 2KFNA 1J5OB 3DI6B 4FZXC 4LF5K 3W65A 1IG8A 4N56A 3C6UA 1HQUB 4UQGA 3L2WA 3IG1A 3BM7A 3R5BA 3ONQA 4JI3K 2R3VA 2AHOB 2BE7D 5HQ8A 1HYVA 2ZWOA 2CGJA 2YKAA 4QIFA 1OPZA 1WSFA 4E7LA 2DTJA 4DV0K 1J9AA 1ZM9A 2RVJA 5FLXU 3OYNA 2KHCA 5KRSA 2ZE2B 3TJ8A 3NAHA 5EN1A 4KTZA 2OTLN 4UY8T 2O8CA 4DTMA 3JSMB 3J81j 4CZKA 3F2KA 5JUMA 4FXDA 1WBDA 3AD9C 3E9LA 4PQAA 3A5OC 1FE4A 5IV3A 1XMOF 5F41A 4DF4A 2KHOA 3PW4A 3OYIA 1CJUA 1HQ2A 1GH8A 5CY4A 1RT2B 3OHBA 4PAAA 4NLQA 4NMLA 2DJWA 4OO1J 3MM8A 2O01C 4X64J 3C0BA 4CHOA 1VQKS 2BBEA 3IA0A 3IXQA 2VIHA 4NB4A 2WW8A 4RO0A 3AO2A 3VQ4A 1NK7A 3RVCA 3W2VB 3HX9A 3W9JA 1D4XA 4YY3K 3G82B 4OX9J 4A8YA 1JLAB 2CGLA 1VRQC 1UW4A 1FTRA 4CGFA 3HFKA 4HUGA 5HK4A 5AR0A 4YB1P 2LQJA 2HWIA 5H9EJ 1N5QA 2DYAA 2DH9A 4IKAA 3RB6A 1E6VA 1RAIB 3JTOA 5L38A 3E2EA 1X9WA 1RBSA 4M3XA 3OYBA 3MCNA 4EO8A 1CLFA 5A2QY 3U9ZA 2KG0A 3AT1B 2COLA 2NZ4A 2ZM6F 3UDVA 4O5BA 1CJKA 3DFEA 2DHHA 1S9EA 3R1LA 3C16A 3WQTA 1R8PA 1YVFA 4GKJJ 5HROA 2FBYA 1SQGA 1U7LA 3LP3A 2E5LK 5HVFA 4ICLA 5HL7L 4CVNE 4RNMA 2E9RX 4DR7J 5AJ3F 3AA9A 3PYGA 1BA1A 1DAXA 3L7PA 3HP6A 4FW1A 4C0BA 1B0PA 4WFNQ 4JI0J 5DG7A 3L3UA 1TUUA 3O3FA 2GGPA 4DF8A 4JI4K 4R5PA 2BJ8A 3N79A 1IM6A 2CFXA 2KRRA 4DV1K 2LCWA 2FF6A 2QLJB 2VG6A 3IO1A 5FPNA 3WX8A 4PA1A 3SMSA 2E1AA 1RNHA 3R5CA 1NK8A 1IBLK 4ZVHA 2AP1A 3FEZA 3DXBA 5DGAA 2WVEA 4ZK7M 2EPIA 4O0NA 3ZO7A 1MA9B 4PG8A 3IAS9 4JYAJ 4E98A 2ZQBA 1S7IA 5T7BA 3H5XA 4B3SF 4OJRA 2KG1A 1YF5L 4ECTA 1V5IB 1IKWA 1NAQA 3LW5C 4U7UD 2DO4A 1VQPS 4ID8A 2I7PA 4XIUA 5AE1A 1S6PA 2F4VK 1TUVA 2OPQB 4FJXA 3TX0A 2I5JB 2Q43A 1V4SA 2F96A 2X1FA 3BDPA 2ZJQL 5T14A 2CPYA 3OJSA 3B54A 1RT5B 4ETXA 2V2QA 2MTLA 3M6GA 2H48B 5DQHA 2DCLA 5DO2A 1RLCL 1O8BA 1S6QA 4JV2A 3BSOA 3AOBA 4JKEA 3LAMA 2C2ZB 4DFKA 5E84A 2P9EA 4RPFA 4CEZA 1D5AA 2E7VA 2YX1A 4BRDA 4LRAA 3R9LA 2EFQA 4PXEA 1N54B 1OJ4A 1Q18A 1D9FA 4FZVA 5E3AA 3PX4A 2DNGA 3IBCB 3RZAA 4BHQA 4ECWA 1HRHA 2E2NA 4F2SA 8RUCA 1SKWA 3VZHA 4GVBB 4TVAB 2P9UB 2EKNA 2QXLA 1J5OA 3JAMO 2RDJA 4FYYB 1DRZA 2G8IA 4MLEA 3FZFA 4CGHA 3H40A 3BGUA 2PYJA 4JV5F 4J2AA 4I0WA 3QRQA 3RMCA 4X62F 3LGMA 3QNWB 1D8YA 2LQ8A 3L8BA 3KUEA 4KE5A 3U27A 1KNZA 2Q97A 4XH1A 1T9XA 3HOSA 1VK8A 4JI7J 4H0XB 4Z2XA 3US5A 1Q4RA 2ZE2A 1SJ3P 1XNRJ 1D3WA 3S3OA 3DRPB 1OY9A 3HKWA 3K58A 3JSMA 4Z4HA 2C2OB 2YVSA 2M52A 4TU9A 1FDNA 3VMFB 4HTJA 1YJ9S 1FA0A 5H1SQ 3DXSX 3AJ2A 2UUBK 3THYA 2AGOA 2RS8A 2R7RA 2ZNZA 3OR2B 3KOAA 3JSBA 3ULHA 4NEZA 3DXKB 1RT2A 3QNOA 2ZH9A 4KHMA 4CP5A 2F40A 5CA5A 3GQCA 3NCIA 5HP1B 4AHTA 1TL5A 2DEJA 1ITPA 4ZVFA 4FYDA 2E7XA 5K8PA 3R6GB 5KG0A 1LWFB 3ZTSA 3HVAA 3AQPA 3G82A 4X4PA 3IN5A 1I6JA 2YHXA 1WSJA 1JLAA 4CF1A 2CZ4A 1Z2ZA 1VGYA 1W2BM 3L2QA 3K5OA 4UZCA 5B0FA 2QL9B 3C8YA 1N33F 3OR1A 3DOKB 3AVMA 5DDQC 3TR8A 3E8OA 4FCYA 4JI8K 4LT6A 5KFLA 1FFWB 1LQ9A 3TZXA 2FHJA 3VGLA 1QQCA 1DT9A 4DL3A 1RAHB 1VHFA 4O3NA 2F5GA 2GZOA 3MOZA 3JSRA 1BIUA 1G99A 4ZA1A 2H4WB 4F2RA 2CAJA 4B3MJ 4JNEA 2LSNA 3DDKA 5AQQA 4LFAK 4DQSA 1EIYB 3CJSA 4CQ1A 2P9IA 1X4FA 4LF6K 1RTDB 2A40A 1VQON 4OZJA 1Y10A 3JAMU 3IC1A 2BVZA 4Q8FA 1KRPA 2W9BB 1IKVB 4DTNA 4J2BA 3MTKA 2WONB 2HNDB 3BQ1A 4IOAL 1L5UA 1VQNS 1YX2A 5H1SV 4M3UA 1VMBA 3SFUA 4LF4J 2FBTA 3AOAA 3G6XA 3KJFB 3T1AA 4LF9J 3P5BP 4B3OA 3M7VA 5LMNK 4IBNA 2YX7A 3FR0A 1NZAA 2IPOB 2CNNB 2WVDA 3PO5A 2JRSA 2XHCA 1J5EJ 1HKGA 2RRAA 3Q0AA 4QIEA 3X1LB 4Z0UA 2AJFE 1BC6A 2MKSA 1V4TA 1GT8A 4KAZA 5AQTA 1VK0A 3FLCO 2CGKA 1Y5LB 4WFZA 2ILYA 4ZCKA 1VRTA 2OGUA 3CFOA 4RBTA 4EP4A 3R7NB 5HMZA 1B99A 3QYYA 1VBZA 1OYEA 3MPVA 1NMNA 3ZSYA 1IKXB 2OPQA 1ZZFA 2B9WA 2O8EB 3KTQA 3AA8A 1KCFA 2ZBQA 2I5JA 5F9LA 4LRFA 2J0QD 1EETB 3PEHA 4HH1A 4HEA9 2ITMA 4B1VA 2MQPA 1RWVB 2F9JA 4C8NA 3UCUP 3BO4A 1G1XA 3MM6A 4WQ5C 5K20B 3CCQS 2HAIA 3H7HB 2QT7A 3CQXA 1BU6O 1IBMJ 1BA0A 3M2VB 4QWCA 4OYXA 4DR1J 5GADU 4ZS6A 2Q0RA 3MAAB 3GV8B 1BI4B 3AA2A 3V2UC 4V19J 3WIVA 1O51A 2KZMA 4A8OA 3VEZA 1K1SA 3SCXA 4S0MA 5DGBA 4NCGB 1VSJA 4DSKA 2EC2A 1VC5A 7FDRA 2EG2A 3QEPA 3EYZA 2V9WA 4CDIA 4YS2A 5BRHA 3NAIA 3TARA 4DUYK 1QVFM 5GAHU 4NYNA 1CZBA 3CJQA 2MZSA 2FSJA 1C0UB 3ID6A 1RSCA 3I5BA 3BN7A 4GVBA 3FGVA 4N76A 1R31A 2ETJA 1BXNA 1JCFA 1RBOB 1LW0B 4KB1A 1U45A 1RTIB 3LDNA 1NPRA 1OSCA 3HHLC 3BEXA 1APSA 3HD1A 4B3TJ 1WG1A 3A4TA 5I4MA 4CHQA 4JBCA 2CWKA 4F3MA 1WJ9A 1HUXA 3HPOA 2BX6A 2OI2A 5GMDA 3HRGA 3DRPA 2UXBF 4ED1A 4DV3K 3PX6A 3V81B 1QS4A 4H4KC 1JB0C 4M5LA 3WIUA 4TYAA 1U0SA 2P9GA 3W2WB 5HMYA 3D0IE 3MWPA 3TUPA 3H98A 2QYCA 4Y2MA 3PVXA 3MI7X 4DV5F 3DXKA 1KQSR 4WF9L 3SQ2A 2DHGA 2X3GA 4FJHA 5E0OA 5AQMA 1O1WA 4PQUB 4DFPA 2YX4A 1MSWD 4FL9A 2XMJA 5HP1A 2UXCJ 4N47A 3L4QA 3VTHA 2E5HA 4L3NA 2V8VA 3FSYA 2FXUA 1LWFA 2QI2A 1BHLA 2F3JA 3MM7A 1P27B 1F3FA 4WJBA 2F7VA 4EU0A 3DCAA 4BQZA 4ILMA 5E7OB 2WB1D 1HNXK 4DPTA 1NHVA 2RPIA 2RQMA 1HPZB 2R7XA 1EQYA 4JEPA 3VQ5A 1JL2A 3DOKA 4CLTA 1Q7YT 5IT9U 2V4RA 4DX7A 4I7FB 2VB6A 4U7UK 4ZVEA 5CHIA 4NWBA 3CCTA 2CQDA 4RWXA 3PSFA 1SQEA 1IR1A 2WBRA 2ZITA 1UTAA 2CJAA 3ZSZA 4DQ8A 4FBTA 4DTUA 3DLGB 2C3MA 5DQGA 1ZYQA 5M2RA 2V4JB 1TVRB 4FXWA 4DS5A 3SI8A 1TK8A 4J9QA 5LSLA 4MK9A 5LSOA 4ECUA 2CZVC 1VLOA 2D0CA 4C8MA 7AT1B 1RTDA 3NNAA 1TFWA 5KT2A 4DCPB 2CJKA 4JK8A 4ZP6A 1RXOB 1N8RT 1ASWA 4OI2A 3C46A 2HLTA 2W9BA 4ANEA 3QFPA 3GIMA 1H0HB 3VWSA 4QS9A 1WG5A 4L72B 3D2FB 2F9DA 1T9TA 3CM6A 4HLBA 1N88A 4BRAA 4DN0A 1W26A 1WNSA 4RW7B 2IMOA 3SYZA 2QLWA 3D54A 5KFRA 2C2EA 5CZ2A 5BRFA 2PIIA 1FD2A 3I9V9 3MXIA 4LF5J 1O0PA 1ITGA 2GHVC 4E7IA 2V5HG 5DDRC 4CEOA 2YX6A 2OZSA 1HJRA 4OPAA 3B78A 2HRUA 3MFIA 4CZIA 3RRKA 3G6ES 4IQXA 3EGWB 4MO4A 4K7QA 4Y2CA 3NOGA 1FRXA 3QT6A 2BM1A 5LXYA 2B56A 3KWGA 4JI1F 1TMJA 3KK2B 4DV2K 2QM1A 1IKXA 2KXFA 2RRNA 5FPEA 1GLDG 3A8JA 1OO0B 3TWZA 1EETA 3G4SN 3OD2A 5KQ8A 3DLJA 5IS2A 2QX0A 1CC7A 4CGDA 2JWNA 4ZPTR 3FCWA 3MMCA 2E29A 5HATA 3A8YA 3CJ7A 1RHRB 3ZYYX 4H5TA 4DR6F 2BYCA 3M2VA 1S22A 1Y5NB 1Z1ZA 5MLCQ 1X4EA 3MAAA 4E1JA 4PHTX 1BI4A 4YY3J 5F8GA 2DIVA 3SDEB 4I6AA 1FJCA 2JLEA 1GOAA 4NCGA 1C0TB 1LWEB 2Y1RI 2IVFB 4GV6A 1S5JA 3JS9A 3AH6A 2AX0A 3M4XA 3O1LA 2VODA 3D6HB 4NI2B 2V2ZA 4I2QB 1DY3A 4QQBA 4I2PB 3HSCA 4X84A 4DL6A 5KFQA 3D2EB 2O1PA 3PIPQ 3THPA 1RA6A 1SV5B 5EXWA 4CF9A 1I94F 4JI2F 1LW0A 1EKRA 5CAAA 3D28A 4XK8C 2BJ9A 2JX2A 2I8EA 3DNCA 3J7Z5 3CXCR 2V4QA 2HQ3A 3BO3A 2E5LJ 3CCLS 1ZBLA 4CH0S 5E26A 3QEIA 5H9FJ 4EHTA 1KQFB 3OQ2A 4ED8A 5CABA 4Z4EA 3VALA 3TP2A 1PJ6A 2ADBA 2GAGC 2UZAA 2UU9K 2A2CA 3KK3A 2P2CB 3B82A 2GWJA 4Q0BB 3V81A 3AA5X 4C6AA 4C8YA 4QAGA 4CJRA 4P2SA 1S72N 4JI4J 4HR2A 4OX7A 4QU7A 3AARA 2CJXB 4AM6A 1WELA 3OVBA 2H9ZA 3H2UB 4IFYB 4CI0B 3W2WA 4L8RB 1D9AA 3H8YA 3NY0A 1RJJA 1R0AB 1WKJA 5F8NA 3AB4B 4KKOB 3TRGA 4KHPF 1UMJA 1IBLJ 4B1ZA 3CVKA 3CHWA 2HFUA 3V9XA 4PQUA 1BMQB 1SH2A 3AVHA 3BS9A 3A8EA 2F9WA 4X4UA 2Y8YA 3D5MA 5MLCV 1JLQB 3K2PA 3KD5E 3TU5A 3SQ4A 3TX8A 4IO9L 3H59A 3EGZA 2HIYA 3BGOP 1U26A 1S0VA 4I67A 3ZZRA 2J0XA 1FK9A 3Q83A 4QWAA 4ES1A 3AO1A 1H98A 4WCEQ 3D1HA 3BJYA 2F4VJ 4USWA 4LH5A 5ETMA 1HBNB 5GINA 3SNNA 1HPZA 3M8WA 4AQYK 1JLBA 1XIQA 3HM9A 3N4PA 4E3SA 3GR0A 1QZ6A 2KKHA 2PMHA 4AM7A 1VSKA 1YHQN 2DY9A 1T05B 2UUAF 5AQRA 2ROPA 2RQKA 4NPOA 3DLGA 2V4JA 1TVRA 4NXNJ 2IDEA 3G8QA 2WTUA 2D3OR 4PKGA 3O3GA 2LECA 1RTJB 3G8SA 5M1PA 1F9HA 3N6LA 2XQCA 4PKDB 4FF1A 4I56A 1Z05A 4AHCA 2HZCA 4PEOA 3R5JB 4CO2A 2MKYA 4GRSA 3O4WA 4BGBA 2QLXA 1NH8A 1YRTA 2Y1LB 1BG3A 2OH2A 1MN7A 1ZETA 5B0EA 2W8LA 4RW7A 1MU2B 1OY8A 1XNQK 4NA3A 1PYOB 2Z8QA 2XMAA 2FHMA 1U47A 4JAXA 5DM6Q 4Z4IA 2GCFA 1YAGA 3O1WA 3CMQA 2C1EB 2JDJA 2RUGA 2A2DA 1XC9A 4NZ6A 3QJLA 3ZZ0A 3CDUA 4USJC 1N36F 4ILHA 4CHNA 4JV1A 4Z4CA 5AQYA 2DK2A 3A5LC 4X4SA 3NAEA 3ASMA 2JHEA 4ENOA 4OX8A 1NJXA 3W63A 5KFSA 3QBCA 1RDUA 2ZBCA 3OBIA 2EFOA 2J9EA 3U4LA 2HSTA 1UETA 2LQ9A 3I55N 4P10A 5LL6d 2VFSA 1RYRA 1T3VA 4DR2J 4O3SA 4JKGB 5HI7A 3KK2A 3QIOA 1FESA 4OYIA 4IUFA 2G8KA 3LZIA 2BEFA 2VQEK 4FOEA 4QOZB 2ASJA 3LQVA 2A1SA 2I2YA 2R2RA 2CQHA 5KG2A 3VGUA 3R8EA 3OXFA 1SZ2A 1RB0A 5KFEA 1S12A 4GKKF 4Z7YA 3J7YI 2NLWA 3T9NA 3LALA 4KGVB 1RWMB 5AQNA 3PHEA 4I6YA 2QWRA 1ACMB 4K5RA 1ASVA 3FZKA 2OPRA 4UZBA 1FE0A 3ATUA 3PJ9A 5FIIA 1QSYA 4ECVA 1FI4A 3MD3A 3NGSA 3O3LA 4C8LA 1XMOK 2XY7A 2EG1A 4PZVA 2AEMA 4OX6A 1X1PA 5BR8K 3LA0A 2DR6A 2JH3A 3K17A 1SC3B 4GV9A 3M5RA 3RB0A 4NI2A 1N5TA 4ZVPB 4I2QA 4X4OA 2C3YA 5IC6B 3OXLA 1CPZA 2XMTA 3GJSB 3PIOQ 4JI8J 3D2EA 2B8PA 3QINA 1WOQA 2XULA 4F0MA 1GOCA 1SV5A 2OPSB 3RUBL 3CCZA 4CJSA 4RNFA 1S76D 3RMDA 2D1CA 1UW9A 5L46A 2YCHA 3P4IA 1VLYA 3QSYB 1S1XB 4LFAJ 5K8NA 4OHYA 1YKWA 3AD8C 4ZLPA 2XGQA 4LF6J 3WX4A 3U8XA 1VSHA 1AZSB 5GMEA 5IM0A 3GYNA 4O4GB 3OTDA 4W90B 4NZ0A 4U6PA 3M8RA 2KT5A 3M8QB 4WE1B 2CQIA 3GFYA 3ETOA 3BO2A 1NJWA 1U04A 2G9OA 3H90A 3D45A 3ZT3A 3B4MA 2VC0A 1BDGA 2MY7A 1LW2B 4LFCF 3AAWB 3LP0B 2GQ2A 1GLBG 3KG0A 3SSRA 1ROFA 1M1HA 3O44A 1MDUB 2FLPA 1EXQA 3MMBB 2HG4A 1R6VA 1YJTA 3FFKB 2AWZA 1NO8A 4ZTJA 1TL7B 2WC9A 3PRBA 3MEEB 2DTUA 3BYPA 4AT1B 1JLQA 2HPUA 4C98A 2OZMA 2N7YA 1FDBA 3B8AX 2LA6A 4ER8A 2ZHBA 5F1XA 3P8BB 2BE9B 4LH4A 4E8UA 2XZTB 2E6LA 4WFAQ 1N32F 2FJWA 2R8IA 1HBNA 5CYMB 2EC0A 1P90A 2WSFC 2UXDK 1VC0A 4OZ3A 2J4RA 4X65F 3V4MA 2VFTA 2HWTA 4GC7A 1ZBFA 5GMKa 4B3SK 1T05A 2HMIA 4KJIA 3RR7A 3OBYA 3WNEA 3VTIA 3ZCMA 3AVJA 1MG7A 4H8KA 4BR5A 3SMPA 3WQUA 2WVBA 1RWXB 2IM0A 3RAQA 1ZA1B 1K73O 2VPYB 3LH2S 2VH7A 2V7ZA 4CZGA 3Q2TC 4M8LA 2C42A 4NLWA 3CMES 5F3ZA 3DLRA 1RTJA 4B9QA 1UPMB 2WHOA 5GIPA 1NSAA 1JJCB 4FYXB 4A47A 2C2NA 4O55A 1NHUA 4FLYA 5DQIA 3H5YA 3R7BB 4USKA 2NUHA 2HHHF 1YVUA 4N8NA 4DUYJ 4EZ9A 3J7AP 4HYKA 4FWOA 3CYMA 2M5YA 4NXMK 1MU2A 4LRBA 2BTFA 2QWLA 2R7VA 3AO4A 4QWBA 3Q8PB 3FMBA 3M6XA 3RW7A 2WW4A 1W0HA 1SUQB 3WC2A 2X6NA 2LVWA 2U1AA 3GE1A 5JVGQ 4HACB 4A48A 4Q5VA 4CJLA 2QRRA 3HHEA 5AQPA 2ZGZA 2WFBA 1JJ4A 1UJ4A 4WFXA 4LJMA 1VSIA 3TAMB 3G6VA 3U1NA 3ALYA 2NPFA 4KV8A 1XMQF 1YJVA 1OY6A 4DR3F 1S0NA 5KG1A 5HN0A 2RHSB 3A5MC 2XHWA 1YXQA 3D0HE 4CK1A 3VQ7A 3UQSA 3TJ9A 4FLZA 4BR2A 1Y3JA 1ZBUA 4LSNB 1G4CA 2PO4A 2DFHA 4WQ5A 3QLHA 3ULDA 1JXVA 3AVKA 3CDWA 2FHKA 3PCOB 3ETMA 4HTIA 1JWWA 2QL5B 2LQ5A 3HLUA 3ZSRA 3BN4A 2JWLA 3CCSS 4ISEA 2CQ4A 4CGIA 3KJVB 1IM4A 2Z2MA 2GVZB 5KOXA 3F73A 3RRHA 5L1KA 4KHSA 3M32B 2DGTA 4ZN3A 3AVLA 2HQFA 3CCVN 1YJWN 2WBNA 3C19A 4KRWA 4DX6A 4AYBD 1D0EA 1RWPB 5C2CA 4MDBA 2VFUA 3MPDA 4K4WA 5BN8A 1SIZA 2R8KA 5LT5A 3GG0A 2QKKA 3F0NA 1X0FA 4YB6A 2BOAA 4AF1A 3NVMA 2DHAA 2HHPA 1KVBA 2VUGA 1HNXJ 2PFFB 3V4IB 4FS2A 2ZC3A 2HQCA 1F2GA 4CECA 2OANA 2LEPA 4YP3A 5C7PA 4M3WA 3BP8A 1NGDA 5B08A 1KWMA 1X4AA 3VF0B 2R8GA 3C6HA 5HSPA 4FP9A 1EKSA 4DN9A 2OPSA 3BEGB 2D4WA 2MDAA 3PTWA 1RILA 5FDLB 5DK5A 4DPUA 4BDPA 4FJGA 3GIIA 1P9QC 2NREA 4FZZA 4H4KA 3ZX3A 3CJ4A 4RX6A 2FIUA 3UO0A 4J9LA 4C7QA 1S1XA 1ICEB 3EE3A 2OTJS 3KLEB 4BLGA 1W25A 4NYZA 4YHHF 4DX5A 4X4RA 4J9UE 2P1JA 1KLMB 1U2VB 4JRPA 3FBCA 1FCAA 1RT7B 2R7OA 4LBIA 3L2VA 5IV4A 4CJQA 3LL3A 1RK8A 4G1QB 2XWXA 3M8QA 1QD1A 4WE1A 4FLUA 2CA9A 2E5JA 1VOMA 3CJ5A 1B0TA 4C1NI 4JV0A 1C2PA 4DB3A 3NMRA 1RWNB 4RJVA 1LW2A 5J2PA 1FX4A 4A62A 3HHLD 1CG2A 2VU5A 4GC6A 2OMLA 5KOWA 2HHTA 2M2BA 1FDAA 2NYIA 3FCVA 5ETVA 2GIRA 3MXJA 3TI0A 4J9SA 2IA6A 2M88A 3RAMA 5D0RA 1NJIO 3GB0A 4OLAA 2QMXA 2Q3SA 4EBEA 3CCJN 3M2RB 1TL7A 5FRMA 4PRFA 3AQOA 2KXHA 2ASYA 4HT5A 5KG6A 2W7AA 4KR0B 1Z25A 4DV2J 4CZFA 3LDLA 4DXLA 2E1YA 3HKZD 2N4CA 1Q5YA 1TMMA 2AGPA 1Z26A 5CYMA 2DITA 3KHRA 4MKVA 1RAOA 4MJKA 2PMZD 4YR2A 3IMXA 4U8VA 2HYIB 2GIQA 1S77D 1IVZA 2M4MA 2GJIA 4DDFA 3I56N 4FLTA 3QWPA 2NSBA 3CJ0A 5LXRA 2KU7A 3SQ1A 4EI2A 2J6TA 4ZJOA 2YNGB 4EFAC 2YPYA 3OYKA 1YJUA 2YH1A 1Q8LA 4A8WA 5EY4A 1SL1A 2MZ1A 4O0JA 2L41A 4RUAA 5C42B 4IXCA 1YI2N 2ASMA 5HQLA 1NGJA 1R8AA 1QTNB 1GTEA 1DGKN 2E5IA 5KFNA 3IR6B 1A5VA 4CNZA 4BE1A 4OYAA 3CERA 1RHUB 4FK0A 5CZXA 1RT4B 1SUQA 4L74A 2N3OA 2FGOA 2VWJA 2CWXA 1J53A 2HGMA 1JLCB 5HAOA 4HACA 4I6MA 4DTOA 2CQPA 2FZCB 1I3AA 1HNVB 4FVCA 3CWJA 1OPIA 3AY0A 2AIRB 4XO0A 4KBIA 3DGVA 1U02A 4BREA 3MMVA 3ENAA 3SI6A 3W5YA 4X64F 4IYQA 1NOZA 4BRFA 2DXEA 2C2MB 4FLXA 3ZT2A 2Z2YB 2JJ4D 2OP5A 1SAZA 4QWEA 2UU9J 4BRGA 3MEGB 4LSNA 1BCMA 4HI2A 3OL8A 4OX9F 2WK4A 2XZDB 2OTLS 1RDWX 1UEKA 3CIZA 2P9NA 2F1FA 2MSSA 3EVWA 3KJVA 2GVZA 2E4LA 2R2UA 1YITN 2YQ0A 4AD6A 2OHDA 5TKYA 3M32A 4Z4FA 1PILA 1DQ9A 2KLAA 4HKQA 4WXWA 4DHVA 3OL7A 1NEEA 4Q45A 4ZPVR 1L3TA 4A2BA 3E1YA 5BRDA 3H08A 2N3LA 2XEXA 1GLEG 4O5FA 2HHSA 2E20A 2P9KA 1VC6A 3FBFA 3EICA 4K50A 4Q43A 3H25A 1RKJA 4CLSA 4GKJF 1RBLA 2VONA 2EFNA 3H4DA 2IMWP 5EOYA 1QVGR 1N6QB 2M3DA 2D3UA 2QEXN 2I9SA 3GP9A 4DR7F 4RLEA 4C3KA 3NFAA 4X2BA 2AKWB 2WTFA 2E9ZA 2E1MC 2G8HA 3NKYA 2AYEA 3NHGA 3AO5A 4J9OA 5K14B 1WHYA 4JI0F 3Q86A 2QLBB 1VQ4N 2MJUA 3SBTA 3I8DA 2PDAA 2FUG9 4Y2KA 1NKBA 1S4FA 5FDLA 3KKRA 1A6LA 3PW5A 2EBEA 3IBFB 4QU6A 1NGIA 3DOLB 1BLUA 3LTOA 3UDEA 1KLMA 2K1RA 3C6TB 1U2VA 2QGFB 3POTB 1RT7A 1IG9A 4C8ZA 4USIA 4JYAF 3KWMA 1MMNA 4OGEA 2F63A 2HNZA 3U6FA 2DIUA 3EUNA 2XYPB 2V52B 3DMJA 2DT9A 1X0PA 3EVMA 1XNQJ 1VSDA 3ZTPA 3FE1A 3OFFA 2OFHX 4CLYA 2Q1NA 2HHWA 2AYMA 3D3CJ 4B8AB 4KH1B 2FYXA 5J2MB 4DL0C 3CQYA 2OJ3A 5AE3A 3BGRB 1L3UA 3M2RA 2RAQA 1T44A 2BUPA 1M1GA 4PPDA 3OW2M 2C3UA 3PYEA 4MYTA 2MQLA 4CIOA 1FVQA 2ZNYA 3HD2A 2FJAB 3FRZA 1DTQB 3H46O 4H0YB 4YNQA 1TL1B 3CIPA 1PSDA 1XR7A 4OYWA 3Q23A 3L9ZA 4H0OA 4CF0A 5KGXA 2VQEJ 4HHUA 3LPEA 2BQRA 1FHTA 2FJBB 1WEZA 2IBKA 3WT0A 4RG8A 4DU4A 3FBBA 5F0WA 3ZEUB 4CO4A 1YZ6A 3GZ7A 2FSKA 4M3RA 2LA4A 4DSEA 2HB5A 4CJVA 3T5LA 3GJRB 4KAIA 5AFUH 5AZJB 1V6HA 3HZGA 3E01B 1SC6A 2XM3A 4CD1A 1WKKA 2RKIB 2YQ3A 3HULA 3ILIA 5BR8J 4FF4A 5C42A 1NGBA 2ZUGA 4WQ4A 2CJ9A 1ILYA 4DPOA 4F0KA 4IG3B 4JI7F 4AXIA 1VJQA 2Z0GA 4WFBQ 1IWAA 2MZTA 1XNRF 2FC9A 2CVIA 1R8HA 2ACYA 1RT4A 3PDNA 1JXBA 1XQSC 1MWYA 1URNA 3V6DB 4LD0A 1T9WA 1JLCA 3TVYA 5E2QA 2CRLA 1HNVA 1EWRA 2R42A 4DQRA 4Y0FA 4CO3A 4F4XA 1QVFR 4B1UB 2YNIB 1SC1B 3ZZPA 3H4BA 1BWFO 4I68A 1FRIA 4EIAA 1K8AO 2MLYA 3CJTA 2HRYA 2HVEA 3CC2S 1DTTB 1EQ0A 4F3OA 3MEGA 2DGUA 3EM1A 1I94K 2BW2A 2VYPA 1RA7A 2UUTA 3VQCA 3MCAB 4LY7A 4E1NA 2ZOFA 4NYFA 4O44B 3K5PA 4WP9A 3LP2A 1WF0A 1WHVA 2ALYB 1U49A 2MQQA 4J5OA 2HFNA 1EP4B 3G2XA 3HHDA 4P2MA 2GNKA 2J0WA 2ROEA 1EAYC 4OV1A 4NLVA 4ES2A 3DLKB 5F0XA 4MTPA 1EWQA 1GXTA 3R6LB 4A8SA 4B3MF 2C3OA 4ED6A 2ZDPA 3ZZZA 1HWKA 2WVFA 3GDQA 5A8RA 3UCGA 3PR5B 2XS7A 2QN6B 4LF7J 3MUMP 3NCPA 2IIHA 1LK5A 1BL3A 3D67A 1KC8O 3G0ZA 1CC8A 2BXJA 2UXDJ 3J7YU 1T3NA 2DY1A 4CFBA 4B3SJ 2XO6A 2NXJA 1S97A 3VF2A 3PX0A 2DXFA 4LF4F 4LF9F 4QJVA 3UVJB 1AYEA 2HMPA 1IBCB 4M5HA 5B0AA 3RTVA 3LWMA 2XB2D 2DGVA 4W5NA 1WTFA 4CWBA 3DOLA 3PNIA 1J5EF 2JSXA 1HW8A 3POTA 3CPWR 1VHXA 2FJVA 1VQ6N 1FXLA 3VVUA 1F9FA 1C0MA 5A2QU 2L9WA 2ABYA 1VQOS 4IJNA 3KUHA 3HT0A 1CBKA 3TZZA 3BBBA 4NXMJ 3CJKA 3DLHA 4WCEL 1T7PA 1NLKL 2QKBA 3JQMA 4OV6A 4DU8A 5A8KA 1GXLA 2MHEA 4AHSA 3HPGA 1BUPA 5HRRA 5M1KA 1C0FA 1VQYA 3VQSA 4V19X 2Z1GA 4FPAA 3V1OA 1AROP 4OI6A 3H1VX 2GUIA 4CH1A 1XHZA 3OVAA 2ZH2A 2AJ2A 4ZCIA 4YEAA 1NJZA 3V6HA 3IGNA 5D4LA 2GW8A 4BVOA 1C0GA 1HX1A 3DHXA 1IBMF 2QSFA 2RN2A 2ZH5A 4ZLJA 1WD6A 4DR1F 2P5VA 1ZTWA 1DLOB 3TA1A 4RCHA 1TTHB 4CJ3A 3ZX0A 3QMLA 1ATRA 4KPCA 1MWQA 2W42A 3CPEA 1EQMA 5KFAA 1XUPO 1RT3B 3M1VB 1VCTA 1T9YA 1N52B 5CXTA 2IDOA 3D0PA 3S8SA 2JEJA 1UFLA 2YH0A 3FUYA 3AVIA 3W3SA 1RBAA 5LSRA 1K1QA 4MK7A 2HBRB 3KHGA 2DD8S 4BCAA 3RMBA 1P1LA 1H74A 2LU2A 5ETPA 5BYSA 4KO0B 4IEEA 5DM6L 3U1MA 1TKXB 3PW2A 2GELA 3BY5A 1TK5A 4G6VB 4NLDA 3C7NB 4F8RA 5AZJA 5D0HA 3E01A 1OQ3A 1EJ7L 4NLTA 4OGCA 3JTPA 1DJ0A 4EBDA 3NF9A 5JMNA 1TL4A 3I82A 1FWPA 5KGWA 2RKIA 3ZSOA 3W5XA 4OZ5A 2XRIA 4B3TF 2E1ZA 2LP4A 2GMHA 1C1AA 4TU8A 3IWXA 2DY4A 4IG3A 4TLQA 2B51A 4M3YA 3AGKA 2O8CB 2X74A 1K6YA 3D1OA 2OELA 5I3PA 2ZGYA 4E19A 1RAJA 2C22A 1MWZA 2GX9A 2A1BA 3V6DA 4KFBB 1RDBA 2DPIA 4AL5A 1NGFA 2CVEA 5G0RB 3O9QA 3CJ3A 3CB4A 4CEQA 3HCXA 1F6TA 2ZVIA 1VQ9N 1UVLA 4OI0A 2CQGA 2YNIA 4AHUA 3BF1A 5EWEA 2DR7A 4K4TA 3NGTA 4KGMA 3T41A 4L3KA 4QIWD 3AAPA 2UXCF 2CQ3A 5JLFA 2D0PA 3AVFA 5KFIA 2EWSA 2GA7A 4F50A 3DYAA 3MHYA 2F8EX 3BH7B 3I4PA 4GW6A 1TKZA 4TLRA 4BR0A 2PBDA 2BE2A 2O4GA 2RQ4A 3ENBA 1P9YA 2W4PA 3BV8A 4O44A 1BGXT 1O13A 2RU9A 1K73T 3KXDA 3BGFA 4WU3A 3PIOL 1RTZA 2I1RA 3RBXA 4QS7A 3LDOA 3ZFVA 4K8RA 2OSRA 3UNGC 2J9DA 1EP4A 3DLLQ 4ZLNA 1GMVA 4OZLA 3N4QA 1RUSA 4FJ5A 4OI4A 3F41A 2HKEA 2G0IA 3DLKA 1ZXOA 1SJ1A 1CJKB 1RZMA 2ZBRA 4CLKA 5EX5A 3OYHA 3OTOK 3IWLA 3KNAA 4PL7A 4NLUA 4CEEA 1WC6A 3QT8A 4KHRA 3L7UA 2X6SA 1NK4A 6FD1A 1IXKA 4DV7K 5L8RC 5T41A 1FFGB 1CVJA 2NR0A 3ICLA 3L2UA 1X4DA 3T19A 1PJ5A 4I9QA 5MAOA 2V6AA 4NLXA 3UVJA 1HNWK 2C3PA 5HLFB 5FLXO 5AQVA 3W3DA 4LF5F 2B6AA 1N32K 3M6UA 1RGIA 2WZ1A 5CZVA 4EHUA 3FZBA 2RIJA 4B9NA 3MOJB 3UN5A 4X65K 1S5ZA 5IT0A 1NKCA 3UNYA 2EBGA 1NGCA 2M0GB 3TW0A 4OMFG 4PYDA 3TUIC 1RADB 2F8SA 5KQDA 2KJWA 4Q2MA 4DS4A 2OLWA 1HFEL 3HHNB 3HFVA 4LSLA 3VA3A 4M63A 3VEWA 5E3QA 1HD1A 4UTGA 1V3SA 3RYLA 1A9NB 4OVLA 2BRLA 3D9BA 3ZT0A 4IQMA 4ZITA 5AQOA 2W2MP 4UF4A 2H1YA 1TV6B 4WZMA 2HHHK 3CUNA 4L73A 2MGZB 4C0OC 2C2KB 3CW2C 1C4CA 3UN3A 2FLOA 4WYWA 3CJCA 2QIFA 3J81O 5ETRA 4YY3F 2PI4A 1RFQA 3M6WA 2MXYA 3T1YJ 2FJDB 1QSLA 1OS5A 3M1VA 5LJ5Y 3VR1A 2R8JA 3W7BA 2GIFA 2HFSA 5DS7A 4W5QA 1UA1A 3ZTOA 1D1UA 4DQQA 2ACMA 3WXIA 3B6PA 2B3TB 4BACA 4DLGA 5AQLA 4DR3K 4KGKA 3G4SS 4KO0A 3EGVA 1S0OA 2YNHB 3CMAN 5K9FA 4Y1CA 3R2CJ 1LFPA 3C7NA 1LKZA 2DFEA 3QEVA 4F4ZA 3LPUA 2CQ2A 1VIOA 3V1QA 3JS6A 4FVMA 1HR0K 3EL2A 2L08A 3KHLA 3CFPA 2R2SA 1QSSA 1T0TV 1EX8A 1YIJN 4FPIA 4A5BA 1FT8A 2ZH3A 1OKJA 2EKYA 2V8HA 1BO5O 4DMNA 2E5LF 4PWDB 3CTRA 2QA4S 2GJFA 3KUGA 3OHRA 5AE2A 3BF4A 3K8VA 4UY8O 1UL3A 1NJIT 3GTYX 3LWLA 4ECYA 4OKKA 4F9OA 2CG8A 4RW6B 1N0VC 2D3ZA 5A76A 4OZ1A 5A0YB 4ELUA 2WB4A 4JI4F 1TYQB 3TPQA 3THYB 1AFIA 2K2PA 4KFBA 4K8XA 1SJRA 3CETA 4H5VA 3BYRA 1JJ2R 2XY6A 4OL8A 5DDPC 5G0RA 4WYBA 4DTXA 1FO1A 3QESA 1UKUA 4DUZK 3KLHB 1DARA 5B0DA 2CPEA 3TA2A 2EFPA 4CT9A 2IYIA 3NGYA 5A8WB 1IBLF 2KB2A 3LDPA 2FC0A 3B6BA 3GFXA 1JCEA 3QGPA 3I8BA 2CQCA 3OYMA 2GV9A 3J7A1 4A57A 3ENWA 2ZJQQ 3Q22A 3FEXB 1A5XA 1ZM4A 4DUTA 4DR5K 3QATA 1NBEB 4IG0B 1HLWA 2IVMA 4YOEA 3PM9A 3P6YC 5KFGA 1Q7LB 1S72S 2Q3PA 3J81U 4K4ZA 3OR1B 4DLEA 4FJ9A 1ZTTA 3K2YA 1GOBA 3DLBA 2YWKA 2W1BA 1VS3A 2B9EA 2ZWPA 1C1CB 4E89A 4IOXA 2KI2A 3MGJA 3SQOP 1ELOA 4U96A 4NXNF 2HK2A 1RHKB 5GAEI 4C3LA 3WXKA 1QAXA 3CCRN 2CPXA 2P9IB 1WEXA 3K59A 1BWVA 1V9OA 4NEYA 2YY3A 3UD3P 3O8MA 1RDAA 4ZPBA 2AJ0A 3TTDA 4M3ZA 3L0QA 1SH0A 2OEMA 4H0PA 3OUYB 4K43A 2ASLA 4PY5A 3GONA 4LFBK 1HNZF 1LXJA 5GAGI 4DFMA 1UVKA 4OZ0A 2HHVA 3H20A 4X4NA 4J9PA 4ED5A 3EE9A 4AHVA 4B3OB 2IVYA 3CG7A 4CJUA 1YHQS 4CHZA 3MR3A 1IJEB 4Z7CA 2RF2B 5HLFA 3W61A 2EK6A 2LFVA 1R3NA 2NRHA 3LAKA 1DQAA 1REVB 2VFVA 2XCPA 3MR2A 4J9MA 5AQUA 1WG4A 4M94A 2IY5B 2FHOB 3ZT4A 3MCSA 3BQ0A 4RNNA 4X66K 1VRUB 2AX1A 4BR4A 4DU7A 2EHGA 3KJNB 4GO7X 3NWGA 4YOTA 5J1NA 2VC1A 4RW8B 4XTTA 1VRTB 5K8MA 1WC4A 3I31A 2HQIA 2PI5A 4DR2F 3MCOA 1FNXH 5C24B 2ZOMA 3UE2A 2R8HA 1FFSB 4CJTA 2EEYA 1URRA 3ELHA 1H2UX 4CGGA 1QUVA 1U25A 3M2UB 1WORA 4R0JA 4GNIA 3UCZP 3VQDA 3C3LA 1TK0A 4DR4J 5KG7A 4OPJA 3SPYA 2JWKA 2YBVA 3G96A 4IEIA 4BC9A 5HJXA 1WF1A 1TV6A 4DQIA 4CEAA 4ZVGA 2ZWHA 3MM6B 3PO4A 2DNZA 5ADXA 2MGZA 3DRYA 3H45C 4WKRA 4CZMA 4Y28C 4AFFA 3ID8A 1UWBA 3S41A 2XMKA 5SWMA 3K8WA 2E66A 3MWTA 1KVIA 2MKIA 4NLGA 4DJBA 2VZ9A 1SXLA 1KFSA 3P38A 5D8HB 4USUA 2D1KA 3ATVA 3I55S 3NWRA 1HI0P 1WC5A 5HANA 3AGRA 1TL3B 1NUEA 4UY85 3ZSWA 2PN6A 2HF4A 4LRDA 4CH7A 3Q8QB 3QJJA 3PACA 4C2MA 3MECB 3OTBA 4BE0A 3MWBA 4QYZK 3SCIE 1NDKA 2J7WA 4B1YB 1UZDA 3VAGA 4KYZA 5FPDA 4JI8F 2G8UA 1HHSA 3S01A 2H51B 2YNHA 3KHHA 3MUVP 3OYAA 4P75A 1CJVB 4O3OA 1S4EA 5C2GA 3OYGA 2FZKB 2IRXA 1YZ7A 3CEDA 2QMUB 4IOAQ 2EK1A 2KT3A 3SCLE 4LFAF 2I0XA 2BQUA 4LF6F 1EARA 1K0VA 4BRMA 4PWDA 4M1KA 4NLBA 5CE3A 2C28A 4JKBA 3SCJE 4CO0A 4FBUA 1Q82O 5D6GA 1SH3A 4BRQA 4BDYA 4Q2LA 4RUBA 4RW6A 2YQ1A 3VOVA 5A6WA 5A0YA 2HOEA 1R6YA 3GV5B 5AT1B 3M9OB 1TYQA 4E0DA 3ZSQA 5HBMA 2KYZA 3AA3A 1QM9A 2Q36A 5GIOA 3KLHA 3QERA 4GKJK 4JN4A 1HYSB 2IIRA 2KM8C 5A8WA 3T69A 3TO8A 3N9UC 4CFCA 4FM0A 4EAHD 4AHRA 2EVZA 4OYOA 3DKDA 3HF5A 3S6EA 1DFDA 2Q6CA 3D6RA 3OY9A 2JZ5A 3OLBA 2AA4A 1WAJA 1JLEB 3N4WA 9RUBA 3HVTA 4GMJB 1M90T 2UUWA 3NGKA 2W6KA 2CQBA 1U8WA 3MR5A 1Q8IA 3OVSA 3VQEA 3MM7B 3BR8A 4IG0A 1JIHA 4NYOA 2DRAA 3C65A 2KQ2A 3LUYA 1Y4ZB 1OH7A 4RW9B 2GJ2A 3C15B 2EW9A 5L39A 3U02A 4HT7A 4LF8J 4AL6A 3OYLA 4R25A 1U09A 1JMTA 1S9FA 3V6KA 3QB0A 3HI9A 2Y3YA 3L6QA 4ZPCA 4CW7B 4FWRA 3KLVA 2B7CB 3V9ZA 2K06A 2MEWA 2DNOA 4ZIWA 3FZ2A 5C12A 1HNIA 1X31C 2R7WA 1C1CA 2FQQB 1YJNN 4NLSA 4ZVTB 1HJOA 1PYTA 4CLUA 2XMWA 5ELZA 3AAQA 3HHKA 4NE9C 3A5NC 4MKAA 5AXMA 4NLOA 1KTQA 3CJRA 4IRDA 2XYGB 4P7VA 3MCMA 3N28A 1YGYA 4Y2AA 2E7WA 4IFEA 1WAFA 1XTZA 1FJGK 3R97A 3MEDB 1YBAA 3O9TA 2A41A 2HBMA 1UA0A 1NGGA 3IWNC 2MY8A 3MMJA 3OUYA 4MFBB 4DUYF 5JJBA 1RHJB 2W9CA 4DTJA 3P4UB 1F5CA 3Q89A 1KD1O 3U9DA 4K4XA 1TUWA 4ZOSA 3J7YP 1K8AT 1QHTA 3T1HK 5K8OA 1N34K 2BM0A 2HAFA 2RF2A 2HFVA 5LJ3Y 5I3QA 1G2EA 5CD4A 4IOCL 1REVA 4H5WA 2ZH8A 1Y64A 2CPDA 1KHWA 4FWQA 2ATCB 4OLOA 1HYZA 4NX9A 3HT3A 5KRTA 2DH7A 2K7JA 3TUZC 1VRUA 4DV6K 2DISA 4F4WA 2Q66A 8ATCB 4DX8H 1MNEA 5LM7E 4Y3CA 3GCWP 3NP5A 3OS1A 4RW8A 3TANA 2NPIA 1ESVA 3NH0A 4OKJA 3CXCM 2VHGA 4F4KA 3JSYA 2VWBA 1I51B 3P31A 1B92A 1X3NA 5C24A 4K42A 5F3TA 2VA2A 3O9SA 2XG8A 3PY8A 2AZ1A 4BC7A 4QR0A 3PV8A 1Q9XA 3M2UA 2GQCA 3K57A 4G1PA 2C2RA 4B1WB 3GMGA 4HVJA 2ZJPQ 3FBEA 3EPGA 5IQQA 1UEUA 3GSDA 4P71A 5ETSA 3JXOA 3MMCB 1GNKA 3P45B 1HMVB 5HVGA 1K9MO 4RBUA 4JD2A 1KC8T 2RHQB 3UR3C 3GJQB 4RU2A 3DWLA 2BRKA 4AE5A 5KFYA 1PGZA 4K0KK 5IT9O 4EMDA 3S3MA 1BD6A 1U6ZA 4ATNA 2RD5C 1GK8A 4U9RA 1U6BA 3P1GA 4EWTA 1D09B 2I7NA 1X9MA 1TL3A 3CCEN 1HNXF 2FVQA 1UFWA 4WFBL 3MECA 1IN0A 2X1BA 3A2FA 3R8YA 2FSNA 4TY9A 1JNZB 4EUVA 2RQCA 4DL4A 5B8HA 4DSLA 3GOIA 3MCPA 2YKNB 1CJVA 2D0AA 4K5SA 4JP8A 2UYTA 1NGEA 3CCVS 1YJWS 5GADI 4CO1A 5EX3A 4XEIA 4HCBA 2WVCA 5JXSA 1WSEA 3ILLA 1LAVA 4DHYA 4BGAA 3OTOJ 2AMCB 1C4AA 4M45A 5KFCA 4TY8A 2D3O1 1FEHA 3HSDA 5B0BA 2SXLA 4ZCMA 2XS2A 3EKUA 4NCBA 2ILZA 4DV7J 3MM5A 5GAHI 3KK3B 5HMWA 2QA1A 3RRGA 4FF2A 3GV7B 3L09A 1TUYA 2AT1B 1JX4A 1Y3KA 3WC0A 1F5BA 3H2VE 3KIOA 5JICA 4CYUB 3VAFA 3QZ8A 4FO0A 1HNWJ 2H3GX 4JI5F 1HYSA 1KONA 3UR0A 1VQMN 3M8ZA 4NASA 5IQ6A 3J7ZO 1WHWA 4H5RA 5KFTA 1S6OA 4Q44A 3JQKA 3NVKA 3FQKA 1GMWD 4C48A 1JLEA 5U47A 1RDDA 1N5YB 5IXUA 4J2EA 4CHYA 1NRKA 4ECXA 5L9XA 1QLNA 3VAKA 3TZWA 4LF4K 3NF8A 3CD6N 5BPMA 2DB1A 3KLFB 1ZAVA 1FK9B 3Q8YA 4RW9A 4DV2F 2DCUB 4DMZA 3C15A 5DMRA 2IBOA 4M5GA 3NNHA 3TR5A 1BQXA 5JS2A 3MMAA 4KH6A 1JLBB 3C66A 3C94A 4CJ4A 1PIEA 4EYIB 4O0IA 2HQGA 1VQ7N 1YUWA 4FM1A 2V8PA 4P74A 3ULEB 1CULA 3KLGA 4RZRA 3FZHA 3QGIA 1UEVA 3KNGA 3QT7A 2RMLA 4J7CA 3CCJS 2RJZA 3W64A 1KSPA 3W66A 4O8KA 2R2TA 3GR1A 1KAXA 3CCSN 4ZTFA 1JK9B 5DM7L 3TNVA 3DJCA 3QIDA 2IM1A