1R0AA

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 138
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1r0aA05
4TY9A 4OPKA 1W0HA 3ULDA 1S6PA 2BRKA 4LH4A 1N4LA 2OZMA 5C25B 4F4KA 4DFKA 5KFNA 4MH8A 4URSA 3KK2B 3IRXA 4QWBA 3SQ1A 4CGHA 3NF7A 2IJNA 1S0MA 5HRNA 4H4OB 3HVWA 3FDSA 1RTIB 1SL2A 1WSIA 1KVCA 1HQEB 3RRHA 3BSOA 3PJWA 5C5JA 2HVIA 4OKEA 4K4WA 4YQWA 4ID1A 3OYLA 3SUNA 4LSNB 3HP9A 4M3WA 3PX4A 1Z25A 3NF8A 3M8QA 5I42B 3KLGA 1XI1A 5KFIA 1HMVA 3SI6A 4I7FB 5KFAA 3QEPA 4CGGA 1SKRA 4QWEA 3GYNA 4O4GB 2D7SA 4C8OA 4MFBB 1Q9XA 5EUHA 5KFDA 4CECA 3H5UA 1NKCA 4IR9A 3SPZA 5HRRA 2HHWA 1A5WA 3ISND 1TKXA 1N6QA 4G1QA 3EPIA 4C8LA 3OYDA 4DSEA 3HP6A 4FLWA 4LSNA 2OPSA 1J53A 3EZUA 1RT5A 4EO6A 3JSMB 1NKBA 1WAFA 2HNZB 2XGQA 3DMJA 2RN2A 1IKYA 4FJ7A 3HJFA 1RT7A 5F8IA 3RMDA 1VSMA 1BI4B 3K5OA 4M3RA 1EETB 4KO0B 3QESA 2R8KA 2JEIA 1FKOA 1BIZA 2IDOA 2F8SA 2ALZA 4K4VA 1S1VB 4CJRA 4JV0A 3MEDA 2A1RA 4DTRA 2OA8A 3QIOA 2IM3A 1BISA 3TANA 3NL0A 3VQ4A 4OLBA 1MMLA 2R2RA 5CYMB 2YNGB 1SKSA 3QEXA 3QLHA 5FRNA 1S4FA 2E6MA 1YTAA 1J5OB 1JL2A 2XY5A 3MECA 3BR9A 4B9UA 4KAZA 4H4MA 1NNDA 4FW2A 2IM1A 4YNQA 3DLHA 4N56A 3SNNA 1VRTB 3TAQA 1TK5A 1CXUA 4FK2A 1FK9B 1VSJA 4NLUA 4J2AA 1VSDA 3DOKB 3THVA 1VSKA 3QLHB 4E1NA 3PZPA 2Z1IA 2OPPA 1SUQA 1I3AA 1Q9YA 1NK0A 5KT6A 4E3SA 3CVKA 4JUZA 4DF8A 4J9NA 4IRDA 1NOYA 2QV6A 3ICLA 3HXMA 2Y1JA 3QEVA 4YFUA 2WK4A 1IG9A 3LAKA 1BHLA 3Q8PB 3OHBA 4EBEA 1KFSA 2E4LA 4C8KA 1UA0A 5HROB 1S9EB 4LQ3A 3PUFA 2YKNA 3KJVA 3DOKA 2UVWA 4DU4A 1FKPB 2GIQA 3DRSA 1VRUA 3OLBA 1JLFA 3N6NA 4NCGB 4KPYA 4ECXA 4YP3A 3PR5B 2X74A 3JYTA 4I2QB 5F8GA 1DTTB 4FLVA 3TARA 3CDUA 5KFGA 3CM5A 4EZ6A 1RT5B 4J9MA 2AU0A 1YVUA 1GX6A 3ZSYA 3V4IB 1BCMA 4CGIA 3TAMA 4FZXC 1T7PA 3PW7A 4PQUB 3BJYA 3SV4A 4B9MA 3L2VA 3HT3A 3BQ1A 1O1WA 1JLGA 2VG5B 2C2DA 3AV9A 3BGRA 4OKKA 4CE9A 1HMVB 3SFGA 3V6DB 1LWEA 3HSTB 3V81A 4FJHA 4M42A 4R5PA 4ECWA 4HCBA 4LQ9A 5C42A 5KFTA 1MU2B 1L3VA 1S0OA 1EKEA 4W5OA 1WSGA 3VQDA 2FBYA 4FLXA 4B9NA 2YHBA 3AVAA 2OH2A 1RA7A 1QE1B 4WYLA 3S3NA 2HWIA 1JLAB 4CHZA 2YKNB 4CHNA 2JGUA 5L1JA 2KFNA 3QO9A 4EBCA 3M9OB 4FJLA 2ZE2B 3QGGA 4KHNA 4IFVA 5KRTA 4FJNA 3TR8A 3PY8A 3KLEB 2R2TA 1S6QB 5KFFA 3PW5A 3LP0B 1RT1B 1VSLA 3L3UA 4KHWA 5KT2A 3I5AA 4M3YA 4ECTA 2XY8A 4OKJA 1JLEA 4DQQA 3KD1E 2X78A 4KV8B 2J6TA 2QXFA 2B5JB 3I8DA 4Y1CA 5I3UB 4I2QA 3HVTA 3CDEA 3I5CA 4BDPA 1NK4A 4NLXA 4KHUA 4NLPA 4TQRA 2YV0X 5KFRA 3I0SB 4O44A 5KFEA 2W8KA 2QK9A 4ED7A 3H4DA 2XCPA 2XI3A 3KJVB 5KT4A 2XO7A 4RG8A 1RBVA 4AHVA 3O3FA 1S9EA 3VN5A 3ISNC 2BE2A 4DU3A 4IKAA 4RNMA 1JX4A 3VQ6A 3KNAA 1FXXA 1XR5A 3IGNA 1XHXA 5EWEA 4DTPA 1RYSA 1BQNB 3Q8SB 3KHLA 5CZ2A 1C0UA 1QTMA 4GVMA 4HCCA 4KFBB 4O0IA 3O3GA 1TQLA 4B08A 3TAPA 2BE2B 4FK4A 1REVA 1S0NA 3OYIA 5KG6A 4WFXA 4OJRA 4N5SA 1C1CA 2XHBA 4ZTJA 2VWKA 1T8EA 1RT6B 4URGA 3VQPA 4F50A 4KREA 4IG3B 2EX3A 3KKSA 3O4QA 4DL6A 4E7LA 2OPQB 2HB5A 4ECYA 4CIEA 2PYJA 4NLWA 4HKQA 4M94A 4ZTFA 4YR0A 4O3SA 4CEQA 2W9CA 2D3ZA 3G10A 3BQ0A 2ATQA 3AVGA 4CGFA 3PX0A 1WN7A 4K4ZA 3H08A 5J2PB 2XY7A 4QWCA 4FW1A 1U45A 3H5YA 3EYZA 4K8XA 4KB1A 2QKKA 4KHSA 4RW7B 4JRPA 4IFVB 2VA3A 3TVKA 3DI6B 1XWLA 5KFVA 4E89A 5HP1A 1LAVA 5DG8A 2QKBA 2IM2A 3SQ4A 4WYWA 3ASMA 4ICLA 4TY8A 4ECVA 1XC9A 4LY7A 2W7PA 4BWMA 4FBTA 1TKDA 3DMJB 2OPRB 2AGPA 1WNEA 3GIJA 3JSMA 2FBTA 3VQEA 1NK6A 3UDLA 1TGOA 4QWAA 4TSXA 2OPSB 3NH0A 1NJWA 2IAJB 1RT4B 4FBUA 1HYZA 4CJFA 4W5NA 3QGHA 3PO5A 4DFJA 4Y3CA 1RA6A 4YR3A 4CEEA 2R7YA 3ZSRA 5DK5A 4RW9B 2AWZA 4K4XA 3RR7A 3P1GA 4FJGA 4NZ0A 2YNFB 4BDYA 2J6SA 3UQSA 4ZPDA 4FM1A 2RF2A 4ZHRB 1QHTA 4ECUA 4F8RA 4O3NA 2BQUA 3Q8QB 3DRSB 4E1MA 3KLIB 3AO3A 2A1SA 1S1TB 1XR7A 3M8SA 3T5HA 2FC0A 3AVCA 3BSAA 3DDKA 1BQMA 2IAJA 2UUWA 4CEZA 1CXQA 1T3NA 1S6PB 3MR5A 4QW9A 2IS3A 4ED8A 4FJXA 1IKVA 4IG0A 4CEAA 5JS1A 2FLPA 3OYNA 4HYKA 3V9WA 3SUOA 3CJ3A 1UWBA 1RTJA 4FJIA 1HYVA 4CJPA 5KFUA 3VQAA 3S3MA 1HYSA 4ZP6A 4GC6A 4O3OA 4CFBA 5DQIA 3H5SA 4IOBA 3U6FA 2DPIA 4IH6A 4CGJA 4DFPA 5J2QB 3OL6A 4BE1A 1Y97A 4WE1A 5KFSA 3MECB 4O55A 5CYQA 4NLSA 1CZBA 5KRSA 3V6JA 3KK3A 4KHQA 3AVLA 4E0DA 2V9WA 4FJ8A 1ZBLA 4KRFA 3C6UA 3HO1A 5CYQB 4ZP9A 1LW0A 4DF4A 2WONA 3QZ7A 1N5YB 1JXLA 4CFCA 3BSNA 2HW3A 1JLQA 3QIDA 5FROA 3CM6A 3KHHA 4PWDB 4Q0BB 4CJWA 3P5JA 3MXJA 4CJSA 3MEEB 3MF5A 3M8RA 1L5UA 1QAIA 4K4TA 4BDZA 1N5YA 1HARA 3I0RA 2F8TA 1NK8A 4B9LA 4DU1A 4NCBA 3TI0A 5KT5A 5C24A 3WNGA 4K4UA 1KLMA 2RDJA 4B8CA 4O4RA 4DTNA 1TKXB 4MIAA 3AVHA 2XCAA 5J2NA 2G8FA 1LAWA 2D0AA 2OPQA 2JLEA 4O3QA 2GBZA 3LZIA 4I9LA 4ID5A 4MFBA 3RBDA 4N47A 3KD5E 3L2RA 3VQSA 4KI6A 3MR6A 3LP1B 1RBTA 3ZT3A 4M45A 1SKWA 3PR4A 2VA2A 1JKHB 4DMNA 4QAGA 4HUFA 4KHYA 4CESA 5KGXA 4DSLA 4IRCA 5KFXA 2XWYA 5KG3A 2XGPA 3CFOA 4CK1A 1EP4A 2F96A 4NLRA 1RT2A 2FLLA 4RW8B 1WAJA 3MEGA 4H4OA 2ZD1A 5KFZA 1BIUA 1TV6B 2HHTA 4IH5A 4NRUA 3O4NA 2VG7B 2HMIA 4ED0A 3MFIA 2ILYA 4CCHA 1BQMB 3TABA 5FRMA 1TL1A 3SFUA 1SV5B 4I2PA 2VG7A 1KLMB 4E7HA 5KFMA 1TV6A 1TK8A 3RMAA 1NOZA 2I1RA 3M8PB 1IKXB 3K59A 2YKMA 3AA4A 2ITGA 4JS5A 4IDKA 3OHAA 5I3UA 4Q8EA 5EWGA 2VG6A 1S1XA 4IKFA 3GILA 4DTMA 1IKWB 4CEOA 3HKWA 1LW2B 3RTVA 3ZSQA 2HHSA 4RW9A 1LWEB 3FFIA 1TVRA 3NDKA 3LP1A 3QYYA 5SWMA 1LWCA 4KAIA 1IH7A 4DWIA 2C2RA 4E7IA 4RW7A 4MKBA 4FJKA 1ZTTA 4FJMA 4EYHB 4BACA 1TAQA 3SQ0A 2D0BA 4FS1A 3SUQA 3QO9B 4Y2CA 4O0JA 2B6AB 4X2BA 3AVJA 3BDPA 1U49A 4F4ZA 1RNHA 2D0CA 3NGZA 2PZSA 3DYAB 4IFYA 4Q44A 2DFEA 1TP7A 4IG3A 4B8AB 3KMSA 2HNYA 3MEEA 4EP5A 4DLEA 2HNDB 3V1RA 2IMWP 5HP1B 1J9AA 2HNDA 3B6PA 2W9AA 2WRMA 1RTJB 5F8MA 4DTOA 3RB0A 3ZSVA 4CIFA 4CJEA 2JEFA 4CF2A 4NYFA 1JLBB 3DYAA 1QSYA 3C6UB 2OPPB 3K57A 1D1UA 4KB0A 3M9NB 3K5MA 2P5OA 2JC1A 2C22A 2ZQBA 3IG1B 2RDIA 5T7BA 3G6VA 3WNEA 4KBIA 4RW8A 1JLFB 3NH1A 2VWJA 4J9SA 1KVBA 3SQ2A 1HNIA 3T5KA 1YTUA 1D8YA 4ZHRA 3AO1A 1WSJA 3T1AA 4ECRA 4XPEA 1IKWA 4AHCA 2YNFA 2IJFA 4PY5A 1S1XB 4KFBA 3PO4A 3GIIA 2YNGA 3RRGA 5KFHA 5EU7A 3NGYA 1RDAA 4DSIA 4LH5A 2OYQA 1TKZA 3KLEA 2GUIA 1SUQB 3MEDB 3OSNA 1X1PA 4RW6B 2XRIA 2LSNA 4M3TA 4HTUA 2FVQA 3Q8RB 3HK2A 1EETA 1TL3A 1S1TA 4KO0A 1RDCA 3MEGB 5C24B 3AVBA 2YNHB 1FK9A 4QPXA 4TYBA 4IRKA 1IKYB 4NRTA 4ZMMA 3I0RB 4KB7A 3TWHA 3M9MB 4UQGA 4FJJA 1QS4A 4DFMA 3OL9A 5L1IA 3KHRA 4J9QA 4ICLB 4TY8B 4R8UB 4R5PB 3WNHA 5F8NA 4DEZA 4FZYA 3QGIA 4DQRA 4BE2A 3CDWA 4CFDA 4TN2A 1K6YA 4B9TA 3T5JA 2BANB 4OL8A 3HVAA 3LP0A 1RT3A 1JLGB 3E01B 2VG5A 4Q8FA 1SH0A 4FM2A 4AILC 1S48A 2ZE2A 1KHWA 1LV5A 4FJ5A 4RUAA 4CJUA 3LANA 1W25A 4K4YA 3UPFA 3M8QB 3NHGA 3K2PA 5KFCA 2HVHA 3VA0A 3OJSA 1D5AA 4ED3A 4RW4B 2G8UA 1QSLA 1C6VA 3JYTB 2FVCA 5KG1A 3K5LA 3CJ4A 2XI2A 1HPZA 4J2DA 3SV3A 4NCGA 4Q5VA 4J2EA 4NLVA 5KT3A 4Z4GA 2I5JB 3OYGA 1SL1A 1X9SA 3SI8A 4B3OA 4O3PA 4Q45A 3FSIA 1DTQA 2F8EX 1RTDB 5K14B 3V6DA 3OS1A 4EP4A 4DTXA 3HYFA 4FLTA 2FVRA 3NKYA 2IA6A 1S5JA 4BE0A 1RDDA 4ECZA 5KGWA 3ZCMA 1LWFA 3KLFA 1IKVB 1IO2A 3DLEB 2GIRA 4JV2A 2FVPA 3V9XA 4K8ZA 2W9CB 5DQGA 4H54A 3CWJA 1A5XA 1D9FA 4F2RA 4N41A 3L2WA 3RB6A 1HRHA 1ZYQA 3QNNA 4XIUA 2GC8A 2E6LA 4KE5A 2WCXA 3LP2B 3DRPB 1JXEA 1VRUB 2BR0A 1FKPA 3SUPA 4Z4CA 3QEIA 4OPJA 1DLOB 4WZMA 5KFQA 1TAUA 1OS5A 5C25A 4DSFA 1C2PA 4WZQA 3PHEA 3RR8A 1GOCA 2ETJA 3V9ZA 4RZRA 3C6TB 1RILA 4IG0B 1RAJA 1S6QA 1BQNA 2D3UA 2Z1GA 1GOBA 4Y34A 1L3UA 3QETA 1S1UA 4ZVEA 3HHKA 1CLQA 2DPJA 4OGEA 1ZBIA 4AHUA 4W5RA 3SCXA 2R2UA 5FDLB 4ELUA 2DY4A 2D5RA 1BI4A 1EX4A 1ZBUA 4AHRA 3CFRA 1T05A 2O5DA 1VRTA 3PVXA 2OPRA 2R2SA 2ASLA 1BCOA 4RU9A 3AA2A 5SZTA 5KFKA 3DLKB 4ZPAA 2UVVA 2FBVA 1ASWA 2B6AA 5CYMA 5KFJA 3OYHA 3H5XA 3SPYA 3SZ2A 4FCYA 4NCAA 2V0NA 2HHVA 1X9MA 1NK9A 5L9XA 3IGVA 4CJKA 4J9OA 3KOAA 5K14A 3TAFA 4DTUA 2KZZA 4WXOA 3OL7A 4EEYA 4QCLA 2V4RA 1U04A 4TXSA 3GV5B 1QAJA 1RDBA 4KI4A 4IDKB 3AO2A 2YNIA 1I6JA 3CJ0A 4PUOB 2J6UA 3NAHA 1K1SA 4FM0A 3AVMA 5JXSA 3HPHA 5HRPA 4DSKA 1TL3B 4RNHA 3KK2A 5FDLA 1TL1B 3OS0A 1REVB 3QERA 1KTQA 3BGRB 2ZD1B 3D5MA 3F73A 3MTKA 2EHGA 3NAEA 1ASUA 3DRRA 3C6TA 4OLAA 5J2PA 1C0UB 2BANA 3TQ1A 1NJXA 2ZKUA 2R8IA 4PQUA 3OL8A 4ED6A 5I42A 4OVLA 1UAXA 3DLKA 3C95A 4DSJA 3OYFA 4DS5A 2IBKA 2AQ4A 3OYCA 2KZMA 4DQPA 1DTTA 2BDPA 4ZPBA 4B9SA 4DG1A 1WNSA 3EZ5A 1JLCB 1HNIB 2P5GA 4GC7A 4MK7A 1HQUA 2UVRA 1RTIA 1RT6A 3H2LA 2BQRA 2HHXA 3HVTB 2V4QA 4DQIA 2DFFA 4H4MB 3ZSXA 4YR2A 3RB4A 3PV8A 1C1AA 3NGDA 1SH2A 5J2MA 3ZT1A 4KTQA 5KFPA 2KTQA 4AH9A 2C2EA 2P51A 4F4YA 3HVRA 4Z4IA 3DM2A 3QIPB 5J1EB 1N56A 3NF6A 3G0ZA 4PA1A 4Q0BA 4CJ5A 1J54A 3N6MA 3NMAA 1CSJA 3V6KA 2G8WA 3PJXA 1RCHA 1CZ9A 4CERA 4IQXA 4ELTA 2G8IA 2HNZA 1MU2A 1Q8IA 4JS4A 3LAMA 3ITHA 1J5OA 4ELVA 3P83D 1NJZA 1GX5A 2R8HA 3LWLA 4F3OA 3V81B 4J9KA 1X9WA 1JLEB 4TYAA 2P1JA 4DL3A 4CK2A 4KTWA 1RT1A 4EO8A 1VSHA 2FJVA 5DGAA 3MXMA 3DRRB 4FLZA 1NK7A 3E01A 3D45A 5HLFB 1JL1A 2KFZA 4Q43A 1S1VA 1YVFA 1UOCA 3PW2A 4I9QA 3RAXA 2OZSA 1DTQB 2B43A 2I5JA 3ZSOA 1YT3A 4MQ3A 4J9PA 3AVFA 4LSLB 3DLGB 2WHOA 4PUOA 3OYEA 1HPZB 3LZJA 3EY1A 2JEGA 4E7JA 1QSSA 2BQ3A 3DOLB 4I2PB 1B9DA 1N6QB 3MR3A 4DLGA 1S1UB 1GOAA 3LALA 3H59A 3G86A 3F9KA 4WXWA 1RT2B 1RBUA 4CJVA 2FVSA 4O4GA 1XHZA 2D41A 1HNVA 2C28A 3I5BA 3KLGB 1C0MA 3MXIA 3TAMB 2UUTA 3BQ2A 3KHGA 3VQBA 3O3HA 4CGDA 3ITHB 1ZBFA 4KKOA 4MK8A 1RYRA 3KK1A 1U47A 2RKIB 3LP2A 3D0PA 2CKWA 3V9UA 3FQKA 4YMEA 2AGOA 4C8MA 3IRXB 4MIBA 3ZSZA 1NJYA 2R8GA 4F2SA 4RW6A 3LPTA 4F4XA 4FYDA 3HL8A 3PW0A 1KSPA 4IBNA 3KTQA 4JLHA 2IOCA 4Z0UA 5KFLA 3QZ8A 1R0AB 1RBSA 3VQ7A 5KG2A 5KI6A 5KG0A 4CFAA 2Z1HA 5J2MB 3QINA 1KVAA 3ZSWA 2ATLA 2FJWA 1DLOA 4KTZA 2W42A 1FKOB 1JLQB 1C1BA 4N76A 4K4SA 1RT7B 2HNYB 4NLQA 4WFZA 3KLHB 2JEJA 3D28A 3FRZA 2WOMA 3ZT4A 3C94A 5EWFA 5KG4A 3IAYA 1S9FA 4DG1B 1G15A 3LP3A 4RW4A 2R8JA 1Z4UA 3KIOA 3AA3A 4E7KA 1VSEA 2YHAA 3VQ9A 3GV8B 1F21A 3AO4A 3T5LA 3SJJA 1LWFB 3KLFB 3L2UA 1A5VA 4U7CA 2XY6A 5F8LA 5HRSA 1B92A 3OYKA 4TLRA 4FK0A 3KLHA 5D3GB 4Y1DA 1RT3B 3KKRA 1TKTA 1LWCB 1NK5A 4AHSA 2DTUA 4B3OB 3GIKA 4DL2A 2XC9A 1WLJA 5F9LA 3OJUA 4Y2AA 1ITGA 2B4JA 1WSHA 3CO9A 1HQEA 1RTHB 5T14A 3QEWA 2Z1JA 3QNOA 2YKMB 4DTJA 4H8KA 3UIQA 2FBXA 1VK0A 4FVMA 3V1OA 3ZT0A 3BREA 3CYMA 2BGGA 3U3YA 4KHRA 3K58A 4WE1B 4RUCA 3GIMA 3T3FA 4CJTA 3AVKA 1VSIA 2RKIA 1EP4B 5L1LA 1ZBHA 1Z26A 4C8NA 4CJLA 4I7FA 4ZVGA 3KLVA 4CJQA 3FFIB 4KSEB 3H40A 3VQQA 5L1KA 1S97A 2HHUA 1D0EA 3NFAA 1KLNA 4CF9A 3IS9A 4R0EA 4OGCA 1JKHA 4Z4FA 4NLYA 4J9RA 4NLOA 1UWBB 1WSFA 4AHTA 2W7OA 5KFWA 3V6HA 3CIZA 4O3RA 4TQSA 5CZ1A 2G8KA 4F4WA 1S1WA 4FLYA 4BWJA 4CEDA 4O5BA 1SV5A 3IG1A 5KFYA 2HAIA 3OY9A 4L8RB 3V9SA 2FJXA 5F8JA 4URQU 2JC0A 3TAEA 3G6YA 3NF9A 3CQ8A 4DL4A 2W9BA 1I39A 3ALYA 1RTHA 2NUBA 1QQCA 3DLGA 5KFBA 4KKOB 1KHVA 2RF2B 3AO5A 1BL3A 3DLRA 3GQCA 4PWDA 3L8BA 1UA1A 1NKEA 2FLNA 3L3VA 2IC3A 3EPGA 1B9FA 2BRLA 3VQ8A 4CJ3A 2AGQA 2E9RX 3LDSA 1LW0B 2UVUA 4M3ZA 3CJ5A 5J2NB 4LD0A 4ED1A 4HUGA 4CHQA 5DLFA 3S9HA 1S9GB 1JIHA 3H4BA 4G3IA 3OYMA 4FXDA 3HPGA 4NYNA 4M95A 4FZZA 4DTSA 5KTQA 5KFOA 5DQHA 4EBDA 4NLGA 4J2BA 1TK0A 1JLBA 2E9ZA 1T03A 4QWDA 1XR6A 1HJRA 3TAGA 2WOMB 3CG7A 4JV1A 4LSLA 3OLAA 2W8LA 4DL7A 2ILZA 1L3TA 1RTDA 1U09A 4HHTA 3NBPA 5F8HA 3DI6A 2PYLA 5HROA 3NH2A 1TKTB 3OYAA 4CIGA 1ASVA 5HLFA 5EDWA 5D3GA 3RAQA 5J1EA 2WONB 3DM2B 2CJQA 3MR2A 3NAIA 4FJ9A 5DGBA 3RWUA 3FQLA 2GV9A 3M8PA 4M3UA 2Q3SA 2G8HA 2X6SA 1S9GA 3V1QA 2AJQA 3LPUA 4J9LA 3LWMA 2AX0A 4CHYA 1IM4A 4CF0A 1S49A 3IN5A 3KK1B 5HBMB 1NHUA 1ZTWA 3RB3A 3VQCA 2IC3B 1U4BA 2E9TA 3CFPA 3PX6A 3HPOA 4R8UA 4NLTA 1QUVA 3H98A 2VG6B 3VA3A 2HHQA 5DMRA 3QIPA 1KFDA 4W5TA 5E41A 2WTFA 1KRPA 3DLBA 3T19A 3A2FA 4ID5B 4IR1A 2YNHA 1ZETA 1SH3A 2EC0A 4W5QA 4EZ9A 1BGXT 4CK3A 2PY5A 3OYBA 1RT4A 5CY4A 1JLAA 4IH7A 2HMIB 1QE1A 3NGIA 3I0SA 4O44B 1S1WB 4RNNA 1TKZB 3OSPA 4RNOA 1HQUB 4ZVFA 3NE6A 2YNIB 4ECQA 4HVJA 1JLCA 1RDRA 4E19A 3ZT2A 2O4GA 5F9NA 3N6LA 3U3GA 3VQ5A 3AVIA 1L3SA 5C42B 2B5JA 3BSCA 4QW8A 3OVNA 2RPIA 4GMJB 3NBPB 4CF1A 3MAQA 4KV8A 5KG5A 4Z4HA 4G1QB 3OS2A 3K5NA 4CEBA 1HNVB 5HBMA 5KT7A 4K50A 3GV7B 4XPCA 1VSFA 3B6OA 1T94A 2Y1IA 4B9VA 1KCFA 1W9HA 2DFHA 2G8VA 4WFYA 5JUMA 4FS2A 3WNFA 3DOLA 4ZPCA 3RMBA 5JS2A 2KW4A 2KQ2A 2IGIA 4CEFA 1N48A 4CF8A 1U48A 1JXBA 5DG9A 1C1CB 1NHVA 2HWHA 4MKAA 1WSEA 4HUEA 3SYZA 4RNFA 3G6XA 1K1QA 3KMQA 4DS4A 3RMCA 3OYJA 1D9DA 2O4IA 1R0AA 2X6NA 4CHOA 4QOZB 3HM9A 5DG7A 1T03B 4IFYB 2WB4A 3RBEA 3UR0A 4ED2A 2IM0A 3V4IA 3KK3B 3CJ2A 4M3XA 4CHPA 4CJ4A 4DL5A 2AX1A 2ASDA 4Z4EA 3AVNA 1C0TB 1EXQA 3KLIA 3MFHA 4ECSA 3PW4A 4JRQA 5J2QA 3DRPA 4NYZA 1T05B 3E51A 4U6PA 4XO0A 4FLUA 3AA5X 1TVRB 1C0TA 1RBRA 1C1BB 5DLGA 1LW2A 3L2QA 4M41A 1S10A 1HYSB 4KHMA 4EYIB 4DQSA 3IS9B 4F3TA 4ZP8A 4GW6A 1SL0A 3DLEA 5KG7A 3NCIA 4ZP7A 3S3OA 2W9BB 4MK9A 4ZVHA 2ASJA 2QE5A 4NLDA 1IKXA
chains in the Genus database with same CATH superfamily
5BYSA 3MN5A 1RSCA 3E66A 3IR7B 3NNCA 4DFKA 4M5GA 4MH8A 4URSA 3IRXA 1YBUA 3RW6A 4NL5A 3TX8A 2O01C 1RTIB 2I9SA 3HRGA 3J7AP 2DIVA 4K5RA 4IWVA 5CCMA 2QSWA 1VQ6N 5C5JA 3NNHA 1SQFA 1Y11A 2F1FA 1EAYC 3GJRB 3SUNA 4LSNB 3PX4A 1Z25A 3NF8A 3NEKA 3M8QA 5FD1A 3I87A 3WXIA 1HMVA 4H0YB 4I7FB 1WOOA 1SKRA 4CGGA 3SI6A 4QWEA 3KDNA 4O4GB 2D7SA 2V50A 3FZBA 3I56N 1KTVA 3T9NA 3ISND 2NZTA 4FVCA 2N7CA 4M5LA 3VEXA 3WUHA 4ZCKA 3HP6A 5IQ6A 4EO6A 3BH6B 4BC5A 2E7WA 5AQYA 2ZJRQ 4ZIVA 2O8EA 1S6UA 2EFQA 2ZH4A 4LRFA 1IKYA 2F9DA 2CQPA 3U1MA 5D4LA 4PWWA 3RMDA 2A2CA 1LKZA 3K5OA 4KO0B 3R2CJ 3F9MA 1GNKA 1DURA 1BIZA 4ANDA 2IDOA 2F8SA 2DTJA 4RU2A 3RVCA 2QX0A 3HFZB 3C15B 4ZVRB 4LRCA 1OQ3A 5HATA 3R97A 2O3DA 4UUWA 3OFHA 1KP6A 1ACMB 5AQIA 2R2RA 3Q7BA 3D2FB 4X4QA 4Y0FA 4B1WB 3M1VB 4RLEA 4I1TA 4F02A 3QLHA 4QOTA 2E6MA 1RGIA 2P9UA 3EMTA 3W2VB 3BR9A 4B9UA 4IO1A 4KAZA 1NNDA 4JP8A 3SNNA 1VRTB 3SSQA 1FK9B 5H1SQ 1VSJA 1M5HA 3DOKB 1SC4B 3P8BB 2B51A 1IV0A 1K9MT 3IFEA 3BH7B 2CQCA 2LU1A 1M5KC 3QLHB 1SUQA 1Q9YA 1NK0A 1S12A 3TJ9A 3CVKA 3OVSA 4J9NA 4IRDA 2G13A 2QV6A 5A0YB 4P2SA 3HXMA 2E7VA 1T9UA 2XSJA 4DL0C 3Q8PB 1KFSA 5BN8A 4C8KA 2E4LA 4LQ3A 3VTIA 4PZVA 4DU4A 5E33A 1Y5LB 1FKPB 2GIQA 4LIWA 3BYPA 3CCSN 3DGPA 3N6NA 5MAOA 3PR5B 3IBWA 4J5OA 3IO1A 4QJVA 3CDUA 5KFGA 3IC1A 3CM5A 4IOXA 2UU9J 1CC7A 4PR6A 3DFEA 1GX6A 3O8WA 1BCMA 3TAMA 4FZXC 1M1HA 3MWTA 3ULHA 3BJYA 4B9MA 3L2VA 1JJCB 4QS9A 4B3RJ 2LP4A 2C2DA 3D0GE 3A12A 4NYPA 3BGRA 1X4EA 1WOQA 4YOEA 1HMVB 3V6DB 3FBFA 2ACYA 1O51A 3HSTB 3V81A 4FJHA 1R3NA 2M3DA 4M42A 4DCPB 4DU7A 2YQ3A 5C2GA 1CJKA 3NS5A 2CGKA 3G71N 4W5OA 1DY3A 4AM7A 1WSGA 5B7WA 2FBYA 4B9NA 3BGLA 2YHBA 5ETRA 3TUIC 1VK8A 1UMJA 1QAYA 3MZIA 4WP8A 4DUZF 2HWIA 1JLAB 3QO9A 1RGVA 2POKA 2KFYA 2ZE2B 4KHNA 3OFEA 1S6QB 5KFFA 2CQ4A 3W8GA 1Q86T 4Y6IA 5AQPA 4OKJA 4DQQA 5IWAK 3KD1E 2X78A 3CJ1A 3NWGA 1GLBG 3EKUA 4DR1K 1F5CA 3OR1B 1XIQA 2K3KA 3F2KA 2QXFA 3I8DA 1B99A 4DUYK 4BC3A 4GV3A 4I2QA 3C2PA 2V51B 3MPYA 4B1XB 3NGKA 4KHUA 4NLPA 4CDIA 4Q2LA 2MLXA 4TQRA 2YV0X 5KFEA 3CCVS 1BXNA 2XI3A 2IMOA 4JI0J 4K0KF 3O3FA 3HSDA 3RJMB 1WF0A 2BE2A 2P9LA 4DU3A 3TWZA 4RNMA 2Z30B 1JX4A 3VQ6A 3BZCA 1YJRA 3LQVA 1XHXA 1U2FA 2GX9A 1X4BA 2K1RB 1C0UA 4GVMA 4HCCA 3WXJA 5LSOA 4Y2IA 1SB6A 4KFBB 2O8BB 4OHYA 4BRCA 2E5IA 2CQ1A 2LECA 3R6GB 4IJAA 4CLSA 1GXLA 4JKFA 4LFBK 2XHBA 4OX8A 2ZGYA 2Y1RI 1T02A 1T8EA 2M5YA 1RT6B 2F7VA 4P2XA 1RAFB 1WG5A 4URGA 1Y00A 4OHWA 2EX3A 4DL6A 1I94F 2OPQB 4E7LA 1HLWA 1OWXA 2R7OA 1SS6A 5D4OA 5A8KB 5C2CA 3W5XA 4JD2A 4O3SA 2JWKA 3G10A 3MCMA 3AVGA 2AEFA 3JQMA 4QIGA 2D4WA 3B8HA 1ZOTA 2KKHA 1PKUA 4DV0F 1U45A 4KB1A 4G6VB 2A18A 2B8QA 1UKUA 2RU3A 4JRPA 4IFVB 5CA5A 1EKSA 3TVKA 2HQIA 3DI6B 1LXJA 4E89A 1LAVA 3IKMA 5DG8A 1XNRF 2WUSA 2IM2A 3NGTA 3RAMA 2M8DB 1X4DA 4ICLA 4LY7A 1FXLA 3U4LA 2W7PA 4LF9J 4FBTA 1PC4A 2E2OA 3KVGA 2OPRB 4A59A 1WNEA 2G2YA 2KVQE 3JSMA 1LXNA 1VCTA 4TU7A 1MWQA 3SQGA 3CT9A 2OPSB 2E1CA 1KVKA 3NH0A 5M2RA 3H0PA 4WTOB 1RT4B 1CQNA 4FBUA 3FZFA 2YX4A 4UY8T 3THXB 2E1MC 5EGYA 3WHIA 4W5NA 3PO5A 5F3ZA 4DFJA 1RA6A 2C2OB 5DK5A 3MMBB 4DHYA 3UQSA 4ZPDA 3SBMA 2PC6A 3G6EN 2CAJA 4MJKA 5BPLA 3AARA 4BRAA 4H0TB 1WBBA 3O80A 1K73O 3Q8QB 5AQLA 2G0CA 4E1MA 1RHJB 3A8IA 1NNEA 4HLBA 3C46A 2VQFJ 4I69A 2NYHA 3AVCA 3AB2B 2IAJA 2UUWA 1Q7YO 4ZVOB 4DR4J 4G65A 2ZFHA 2HGNA 1GLCG 2FLPA 4HR2A 2AKWB 3QWUA 2WVEA 1YZ7A 1RTJA 4FJIA 4DUZK 5KFUA 3S3MA 1U7LA 1RDUA 2X3DA 3D67A 4CFBA 5BR9A 3E8OA 1KR4A 2RHQB 2HPUA 4CGJA 5BJRA 4R79A 2GO9A 4DFPA 1KKHA 2ZBIA 3UDCA 1VQMN 4JI7J 1OY6A 4WE1A 3VV2B 5KFSA 2EW9A 5CYQA 2FF3B 5KRSA 1JWWA 4LFCK 3KK3A 3HLUA 3HSCA 1X5OA 4DX5A 3C6UA 1OPIA 4J9UE 2H5IB 1GLJO 4DF4A 5B08A 3ZLJA 4CFCA 2BEFA 2MQ8A 3M2UA 3FK4A 4JI5F 2MJNA 4BBYA 5FROA 1Q82T 1QHAA 1KD1O 4Q0BB 4Z2XA 5FLXU 4CJSA 5FPDA 3U1LA 2AD9A 1C4CA 1L5UA 4BDZA 4K4TA 5E26A 4K8RA 3OPKA 2MGZA 1HARA 2F8TA 4B9LA 2DPNA 4NCBA 5LXYA 2Q36A 3Q7CA 3OTCA 3WNGA 3HF5A 3UDVA 1KLMA 2E88A 1NU0A 3GYGA 4MIAA 2B7CB 4X4VA 2UZAA 5J2NA 3TSUA 3P45B 1RHQB 2G8FA 2KKZA 3RW7A 1ULRA 3R1LA 4CLYA 3C16B 2X1AA 3HFKA 3RBDA 1RBTA 3L7OA 1SKWA 3QQCD 4EI2A 3VAKA 1YI2S 1WHXA 1UVIA 4QAGA 3SAHA 4CESA 4DSLA 3ENAA 5CYJA 4IRCA 4ZVUB 3X1LB 5KG3A 2XGPA 3CFOA 1N8RO 3O1BA 1EP4A 2F96A 3Q8VA 2UUBK 3J80Y 5AR0A 1WAJA 3MEGA 2ZH1A 1TV6B 1UEVA 3P96A 4IH5A 3MFIA 4CCHA 4JN4A 5LJVA 3E2EA 3SFUA 4WBFA 1TV6A 3MHYA 1IKXB 2DKOB 3AA4A 2ITGA 4JKGA 1NPKA 2MJUA 6AT1B 3O9RA 2V7ZA 3BS9A 5EWGA 4JI1F 4LF8K 4MO4A 2DGWA 4RBVA 3SLCA 4B1YB 4DV3J 5SWMA 4GKKJ 1YJWS 1IH7A 2Q2RA 1ZPWX 4E7IA 2PA8D 4RW7A 3K9JA 4FJKA 3M4XA 2JLFA 5BRDA 2B9EA 3GCXP 4FS1A 2B6AB 4I6AA 1MWKA 4X2BA 2E5LK 4F4ZA 3ZTSA 1RNHA 4C98A 3NGZA 4Q44A 3N01A 2W1BA 3MCSA 2DFEA 3UWTA 1TP7A 4IG3A 3SMZA 3MTJA 2CJXB 4EP5A 5ETSA 4B1UB 4CO2A 3V1RA 1V9OA 2B9YA 1HWUA 3I4PA 4DPWA 1IQZA 3L4IA 3B6PA 2M4MA 2QEXN 4DV3K 3OQ2A 1RAAB 2XLIA 3W9HA 1K0TA 1ZAVA 4ZK7M 4HHHA 2VFUA 2JEFA 1CS4A 2LU2A 1JLBB 4XH1A 2HVZA 3I9V9 4OYZA 5KOXA 3C6UB 1H74A 4O8KA 3MMAB 4JI1J 3W64A 3K5MA 3R7BB 1CG2A 3GFHA 3HZ6A 2GVZA 3QB0A 4Y0WA 3WNEA 1FDBA 2XB2D 2KH9A 2GJ2A 1UEUA 4YEAA 2B4VA 5CZVA 3VGTA 2CJYB 2GAHC 2WSFC 4ZHRA 2FYXA 3MAHA 2UXCF 3CCVN 3RBXA 1OH6A 3M6XA 2YNGA 3V2UC 1Y7PA 2MEWA 2VYPA 5KFHA 2PE8A 2DITA 3NGYA 3LGNA 1RDAA 3W9JA 2OYQA 1TKZA 1PJ6A 1HR0J 2D9OA 2GUIA 3MEDB 2W7AA 3KDOA 1FFGB 3DXBA 3GLJA 4QYRA 3QJJA 2LSNA 4M3TA 2YH1A 3MAAB 2FVQA 1WEZA 4P75A 1RDCA 3PIPL 2PEBA 3N9UC 2Z2LA 1VS3A 4H5WA 5IT9Y 4BLGA 4IRKA 4NRTA 3TWHA 1KAYA 3M9MB 2MGZB 2K7JA 3OL9A 3KHRA 4J9QA 4LF8F 4R8UB 4R5PB 3CCQN 2F9WA 4BGBA 5F8NA 4X64J 4DQRA 3IWNC 3CDWA 1S77D 1ROFA 3T5JA 3HVAA 2U2FA 1JLGB 2VG5A 4Q8FA 2L48A 4PPDA 4ZPTR 2I38A 1RBOB 1I51B 4FJ5A 1FDNA 4ERDA 3LANA 1W25A 4K4YA 3NHGA 4DR5K 2MLZA 3BV8A 3K17A 3SQGB 2MQPA 5KFCA 3DXSX 4RW4B 3M6GA 1I3OB 2FVCA 2RQCA 3FVYA 1XEZA 2FSKA 1HPZA 1NGFA 4NCGA 1NZ8A 1BY9A 3GDQA 3OYGA 2KVIA 4B3OA 1OKJA 3BZKA 2DHGA 3JXOA 2FVRA 2HZVA 1S3XA 2HS0A 3D3CJ 1GMUA 2K2PA 5T7LB 3ZCMA 1LWFA 1F5AA 2CPIA 2GIRA 3LL3A 4ZN1A 2QLWA 2JH3A 3KXDA 3L2WA 3EWGA 3QNNA 3KNGA 3QMLA 2QEXS 2GC8A 3N79A 1ICEB 1UL3A 1HA1A 4DR2K 1JXEA 3TRGA 2YWFA 1REGX 1RISA 2HQDA 4M7XA 5FPNA 1VBZA 3HI9A 2M2BA 1XK8A 4FWRA 3AAPA 5KFQA 1TAUA 4JI8J 1E4FT 5DO2A 2GAGC 5HJYA 2OTLN 3PHEA 1BWVA 4F26A 2M70A 5JJBA 2A42A 1PGZA 3GFZA 3C6TB 1RILA 4IZ9A 1RAJA 2D3UA 2EG2A 5AQTA 1C4AA 3QETA 2BJEA 5M1OA 1CC8A 3G82B 1ZBIA 4AHUA 3C3LA 3BEXA 5FDLB 2D5RA 3AOCA 1VMBA 4WFBQ 2DR7A 2ZC3A 4B3RK 3TNVA 2OPRA 3GR1A 5HVFA 2R2SA 3D6FB 2KRBA 1QVFR 3A5OC 4O23A 3AA2A 1WC5A 5KFKA 3F44A 3ZFVA 3O6QA 2AYMA 2FBVA 4YOYA 1ASWA 3D0IE 4C6AA 4LF9K 5C12A 3SZ2A 4NCAA 2V0NA 2LEAA 2HHVA 2QL5B 4CJKA 2HYIB 2YKAA 4DTUA 3CD0A 3OL7A 3VAJA 4U7BA 3GV5B 3ID8A 2QWPA 3U02A 3AO2A 4P9SA 3TVZA 2J6UA 1UJ5A 4OZ2A 3HPHA 4EMDA 3B78A 3X3UA 1OH8A 3I32A 2P2CB 3KK2A 3NRBA 3M1FA 4EWTA 2Z2MA 3OVAA 1N54B 4DR7K 2A5XA 4DZ6A 3BGRB 4ZVSB 2ZD1B 1HI8A 3D5MA 2ZNZA 2GMJA 3CTRA 4MYTA 5J2PA 1MMDA 1C0UB 5AZJB 4OZ1A 1Q5YA 2MZRA 5JVGL 3FBBA 1NJXA 2ZKUA 2R8IA 5I42A 4OVLA 1OH7A 1XJWB 1Q53A 4KHPF 3MXHP 4Y2MA 3CIPA 3L0QA 3OYCA 5AE2A 3A5MC 3EGVA 2P5GA 3ZETA 4MK7A 1U1RA 2QWNA 1LFWA 1OSCA 2MHNA 5IT9O 4LF5F 2BQRA 3SSRA 2V4QA 4DQIA 3BB5A 4H4MB 3AJ2A 4IO8A 3SMSA 3TSPA 2MQMA 3ZT1A 5HMYA 1RAHB 1RWMB 2DO0A 4WU2A 4DHVA 4AH9A 2P51A 2RRAA 2QTWA 1CS4B 2ERRA 3HVRA 1OVYA 4LF7K 5J1EB 2F40A 3G0ZA 1WKJA 3O8MA 2A10A 2CPZA 1WKLA 1CSJA 1RBAA 3V6KA 4K2XA 4CERA 1J2VA 4IO9L 5CH7B 1URNA 3BYRA 2C3MA 1Q8IA 2CA9A 3EE3A 2PT0A 4JI1K 1UW9A 3BN4A 1J5EJ 3R5DA 3LWLA 3P5TL 3V81B 3R27A 4FWQA 1JLEB 3UVJB 3ULEB 4CZKA 3D2FA 4CK2A 2PN6A 4EO8A 2FJVA 5FLXO 2R7RA 2ZDPA 3MR7A 2AJFE 3E01A 1JL1A 2KFZA 4Z7YA 1YVFA 1WC0A 3BBFA 3K7RA 1GMWA 1JB0C 2B43A 2HHPA 2HF4A 4MQ3A 4LSLB 3DLGB 2E1YA 2CQHA 4DZDA 5G0RB 3QSYB 3CSKA 2O8EB 3KK7A 4E7JA 4ZPWR 2HBZB 2QMWA 1YIJS 5AJ3K 4C3KA 1JK9B 4OX9J 1R8BA 4DLGA 3VMFB 1EQ0A 1YF5L 3LALA 2IVYA 4RUHA 4WXWA 1YHQN 2E1ZA 2MZ1A 5E84A 1FO1A 4CJVA 2FVSA 4O4GA 2V63A 1XHZA 2CWKA 2LMIA 3MWBA 1HNVA 2QA4N 5KAKA 3O3HA 3BKFA 4PG4A 3JTNA 4LFBF 1Y3KA 4PEOA 4KKOA 1FRMA 4M5DB 3MK6A 4CO1A 1NSPA 1H3DA 3LP2A 3D0PA 2CKWA 1P9YA 4LF5K 4CQ1A 2OD4A 4C8MA 4EK2A 3A3PB 3KUEA 4U95A 2RS2A 3IRXB 4MIBA 5HAOA 3MN6A 4XAKA 4RW6A 1OY8A 3LPTA 3PYFA 4I6YA 4JI3K 4DV1F 3OXLA 2IY5B 3C14A 3PW0A 4B1VA 2VL1A 4IBNA 4JLHA 1IR1A 4MKVA 4HDGA 2HBYB 3I82A 2QLBB 1R0AB 1RBSA 9RUBA 4CJ7A 1FRLA 2DK2A 2HHHF 3N5FA 4FKYA 3AOBA 3FMBA 3AY0A 4ZVPB 3RYLA 2V69A 3FNNA 3TA0A 4IO9Q 2DH8A 4CO0A 5GADP 3J7YP 2HNYB 4NLQA 4BREA 3KLHB 4RL1A 3ZT4A 1VQYA 3IAYA 2KDOA 3US5A 2RAQA 2RS8A 2GMHA 4E7KA 1VSEA 5D0RA 3D7SB 3SJJA 1AXQA 4TLRA 1Q8LA 5C7PA 5D3GB 3LUYA 4WQ4C 4Y1DA 1RT3B 2OGUA 3D7EO 1HBOB 5EOYA 4X66J 3I55N 4GV6A 3DXMA 3G4SN 3UN3A 1WLJA 2JSXA 1U0HA 5F9LA 2YJEA 2B4JA 1ITGA 1FVQA 3CO9A 3QEWA 4PRFA 1F2HA 1N88A 1NDCA 2YKMB 2CJKA 3UIQA 2ZBQA 2FBXA 4BRPA 1RHMB 2BH1A 3BEGB 1VK0A 4OJGA 4AL7A 3THWB 1LK5A 1FD2A 1VQKS 3AHPA 2GHVC 4R25A 3ZT0A 1AFJA 2OKQA 1T95A 3FCHA 2MB0B 3M32A 4TVAB 3CF5L 3AVKA 4QZVB 1SZ2A 1ZBHA 4C8NA 4J9VA 1PO6A 1S97A 2HHUA 2OFGX 5FLXY 3KHYA 4R0EA 3FZ2A 4OGCA 3DU5A 4J9RA 3MMBA 1UWBB 4AHTA 2KJVA 2P6SA 4O3RA 4N8NA 3L6QA 2YQ0A 4BRNA 3R5GA 2GGPB 3QAUA 1VHXA 4X4NA 4CLUA 5F8JA 4CBXA 3TAEA 4JI2K 4OI3A 4TKTA 4DV6J 4R0JA 3R5JB 1WDTA 3CQ8A 5BPNA 3DGVA 1HIYA 2QA1A 1BUPA 2GFFA 6FDRA 3K0JA 1QQCA 2XULA 2L9WA 1VLYA 3VCDA 2Q0RA 1J5EK 3AO5A 3GQCA 1WOPA 4AFFA 1NKEA 3L8BA 2HLTA 2BRLA 4NXMF 2HGLA 2J0WA 3TZWA 1M5SA 2E9RX 3E9PA 1EZZB 1UW4A 3VGLA 3PCOB 4USKA 4UZBA 4LD0A 1RCXB 4OJ3A 2O66A 4FXDA 1HBNB 4FZZA 3S7RA 5IS2A 4EBDA 5GAGP 2OEMA 1T03A 1NMNA 1HJRA 5IV3A 2HFNA 3UNYA 3CETA 3CG7A 1S5ZA 3HJVA 2BE9B 4NOHA 4A8QA 2W8LA 1Q7LB 1L3TA 2QYGA 4HHTA 5AQJA 3NBPA 3BF3A 3IMQJ 2IFXA 1TMJA 3R3TA 1NMDA 2A6MA 3OUYB 3U8XA 4CIGA 1ASVA 5D3GA 4CLFA 2WONB 1A0OB 4A62A 2HQFA 5ETVA 5DGBA 3RWUA 4LVOP 2GV9A 4QU6A 3HT0A 1XBWA 4M3UA 3PM9A 1DQ9A 2Q3SA 3OFGA 4A46A 1DEJA 1S9GA 1G99A 4H4KA 2NXUA 3M6UA 3BP8A 2AA4A 4CHYA 4CF0A 3ZTRA 1S49A 3WXKA 3FEZA 5IM0B 3LDNA 2V8VA 4H0VB 3IN5A 3KK1B 1ZTWA 3VQCA 3LF0A 1U4BA 1UZHA 2E9TA 3OFFA 3HPOA 4R8UA 2Y9HA 3UCZP 3IM9A 2HS3A 2HHQA 3QIPA 4W5TA 3V5RA 1SKUB 5HL7Q 5E41A 1I94J 3R1XA 3ZZTA 4E1JA 3I31A 1U1OA 1NHKL 3QDKA 4IR1A 1S76D 2BUNA 1HNXK 5AXKA 4EZ9A 4HVZA 1BGXT 2MY8A 2HVDA 1N32K 4CK3A 3N4PA 2PY5A 2C42A 2FHMA 1JLAA 4IH7A 3DC2A 3NOGA 1X3NA 2HK2A 3CCUN 1TKZB 4M5MA 4P6QA 3A5NC 2BM0A 3HM8A 1XMOJ 2YNIB 5D8HB 5KQ8A 5F9NA 1RBLA 1Q8BA 2HBQB 3VQ5A 4MO5A 3BSCA 2MMYA 1HW8A 2P9PA 4G1QB 4WQ4A 4JI6J 4CEBA 1T9XA 1WDDA 2MZQA 1HNVB 3SAFA 5KT7A 2EFVA 5ITHA 1BO5O 3IMXA 4ZLJA 3R5CA 1SJ3P 3FFKB 2DR5A 4N7TA 2Y1IA 4B9VA 1KCFA 1DT9A 2QMXA 3EZWA 1P1TA 4ISFA 2VPXB 3NCRA 4LC9B 5AXLA 3T1YF 1K9MO 1U0SA 3LH2S 1AZSB 4QR2A 1HNZK 2KW4A 1L3KA 2FSNA 1RKIA 2A40A 2JL9A 2GO8A 3W5YA 1U48A 5DG9A 4OYBA 1C1CB 5F1XA 2HWHA 2IYIA 2O1PA 1WSEA 1FRXA 1QDUB 1AW0A 4X4UA 5GAGU 3PSIA 3WBZA 3NCQA 1M90O 2J9CA 3IBFB 3CC4S 1P27B 3BBCA 2JNJA 2XZDB 3WIUA 1R0AA 3VR1A 4FF1A 3BDEA 4WP9A 3HHLD 2WB4A 4FNIA 1KBRA 3MPVA 3C14B 4C1NI 5IXUA 3MURP 4CVNE 5IQQA 3CJ2A 1D09B 4M3XA 4CJ4A 1R8PA 2ZH7A 2F4FA 1V3RA 4W98A 4ZPVR 4Z4EA 4LBHA 1TYQB 2Z57B 3B4MA 3CJRA 2HG4A 2KB2A 4JRQA 3BGUA 4P52A 3DRPA 1T05B 2RQKA 2YHWA 3AA5X 2XMAA 1Q79A 3IAS9 4FSVA 1BWFO 3GONA 1HYSB 4KHMA 2ZGZA 5ETOA 1RLCL 5KG7A 1NBEB 3NCIA 3MM7B 4ZP7A 1WF2A 5CAAA 2W9BB 4MK9A 2GW8A 4ZVHA 4NLDA 1IKXA 4TY9A 4OPKA 4JYAK 5DETA 3ULDA 3K8WA 1S6PA 2W24A 3CEDA 1N4LA 1HNWF 3NG8A 3K5PA 1YDLA 5C25B 3LPEA 2CJ9A 4F4KA 3CJTA 2CH6A 1OMSA 3QT5A 1FJGJ 3I4HX 5AQNA 4ETXA 1N33K 4DJBA 3ZETB 1Q5VA 3EJMA 1UTAA 1UVNA 1EARA 1X31C 2E7XA 4LFCF 3IDHA 2IRUA 4YHHJ 4M3WA 3TUZC 3K0SA 3WXLA 5I42B 1IBMF 5KFIA 1GMVA 1S6OA 5KFAA 3QEPA 3F0NA 3GYNA 4C8OA 5EUHA 1VISA 5KFDA 2BE7D 2OFHX 4CECA 4IR9A 1WSVA 2HHWA 3OW2R 2VGMA 1FF2A 1RP5A 1WG4A 1TUYA 2FSJA 4G1QA 4ES1A 2YBVA 4B17A 4LSNA 3EZUA 1RT5A 4WWSA 3SCIE 4F25A 1KAXA 2V8GA 1E6VA 2PSZA 1NKBA 1WAFA 3O1WA 3DMJA 3VTHA 2ROPA 4A2AA 1P90A 2ROGA 3HJFA 4FJ7A 4DX6A 1RT7A 2EPIA 5F8IA 3QAEA 1K47A 1N32F 2HHHJ 2ZJQQ 2DRDA 1ZBSA 3WEEA 2J0XA 2MQNA 4K4VA 1S1VB 5B0FA 2QWMA 4HTIA 3QIOA 4C23A 1URRA 2UUCK 3VQ4A 1MMLA 2BABA 2WTUA 3MD1A 1FX4A 4CO5A 3QEXA 2P6TA 1YTAA 1JL2A 2BUPA 5GMKa 2AEJA 4JKBA 3VGUA 4H4MA 4FW2A 3DLHA 3ZX3A 3IP0A 2W4CA 1Z6RA 4FO0A 2G4BA 1TK5A 3TAQA 2ZZTA 1CXUA 4PYAA 3OTOF 1GLAG 2WBRA 2J8AA 3GE1A 1WG1A 1ATRA 1WEXA 3HDSA 3CCES 4E1NA 1W26A 2OPPA 3UDEA 3TA1A 3ISZA 1ZM9A 5M1NA 5KT6A 4DV2J 4E3SA 3CIMA 1NOYA 3ICLA 2BX6A 1ZXOA 4U96A 2NXJA 5F2RA 1NO8A 1IG9A 3NWRA 4EBEA 2YQ1A 3PYGA 3M5RA 2H9ZA 1GLLO 1B7FA 3PUFA 5ELZA 2YKNA 2EK1A 2V2KA 3KJVA 4CD3A 2UVWA 2DNRA 3DJCA 3VZIA 1JLFA 2AYGA 5JICA 3SCJE 4A8OA 2X74A 3JYTA 3GU0A 5F8GA 1DTTB 2VGNA 4AF1A 3UD4P 3NGRA 4J9MA 3MPDA 3A1YG 4CGIA 3GB0A 5AQGA 1T7PA 1S22A 3D54A 3PW7A 5TKYA 4PQUB 2RQ4A 3HULA 3JS6A 3BQ1A 3AV9A 2RHKA 4OKKA 1S7HA 4NA3A 4CLPA 2QA2A 2DB1A 1LWEA 3QSIA 1WTFA 1NAQA 4JI3J 4LQ9A 5C42A 2FY8A 2NUUG 4OJ1A 4DR4F 1FTRA 1MROB 2YH0A 3KG4A 4JNEA 3ET6A 4FLXA 1IR0A 3AVAA 2OH2A 1QE1B 5HI7A 2YY3A 4CNZA 4DR7J 2ZOMA 2JGUA 3CMES 2KFNA 3ZZOA 4DV5F 1F9FA 4IFVA 1M90T 2R4FA 1B70B 2YPZA 1R0CB 3KLEB 2GHPA 1LOTB 2HK3A 4CLKA 1RT1B 4C1NK 5BN9A 3EO3A 4KHWA 1S7IA 4ECTA 2XY8A 1FNXH 4KV8B 1RUSA 3C19A 4X64F 2J6TA 1N32J 3T9ZA 2B5JB 4YOXA 4KPCA 3U9DA 4WF9Q 4NX9A 5I3UB 4KH1B 3HVTA 3CJ7A 3P31A 3R5AA 3I5CA 3WT0A 4BDPA 2DGTA 4NLXA 1ILYA 3THYB 1B3TA 4EAHD 1DARA 1QVGM 4O44A 2LFVA 3KJVB 3MAAA 2XO7A 2OP5A 4BR0A 1RBVA 3CC2N 2DCLA 1IWGA 3TJAA 1G2EA 3I9ZA 1QM9A 2CQ2A 1FXXA 3HHDA 1BQNB 3Q8SB 3KHLA 1EIYB 1QZ6A 2VFTA 5ETKA 1YKWA 2BZ2A 3AFGA 1U6BA 1ZZNA 2K7KA 2W4DA 5H9EK 5AQFA 4FK4A 2BE2B 2P9LB 4A5BA 1S0NA 5M2UA 2ZEJA 5KG6A 5L46A 1KVJA 1NU4A 2VWKA 2RT3A 1LK7A 5IOLA 4F50A 3O4QA 2DCUB 3J81O 3G2XA 1OO0B 3BF4A 4CIEA 2PYJA 5U47A 4M94A 4CEQA 2W9CA 4N8OA 2D3ZA 2QTDA 2FGCA 4CGFA 3HZEA 3ILOA 4MIWA 4FPIA 1Y5IB 2A0FB 3M6WA 2XY7A 4QWCA 4FW1A 3EYZA 3G87A 2OUGA 1RWUA 4OYPA 1XWLA 5AQXA 2DGSA 3TU5A 3SQ4A 3PRVA 3QNWB 4ECVA 1FJ7A 2BMBA 3AD9C 1T9YA 5JVHQ 2D69A 1OY9A 1TKDA 3H1VX 2DXEA 4ISEA 3DMJB 1YI2N 3D2EA 3SSSA 3O9SA 4GNIA 5A8RA 3UDLA 2V34A 1QVFM 1Y5NB 2BW7A 3AQOA 2CWXA 3DDNA 1HQ2A 4X4OA 1NJWA 4OZNA 1FRKA 3QFUA 3HX9A 1O13A 3QGHA 2B9XA 5HMWA 4CO3A 4Y3CA 3TUPA 4YR3A 4CEEA 1WF1A 4OLOA 5A8WA 2R7YA 3ZSRA 4WJBA 3A8YA 1RHKB 1FJGF 3SIPB 4DMZA 2AWZA 4K4XA 3P1GA 1IBKJ 1FFWB 3UI3A 3G8TA 4ZHRB 1QHTA 4HHJA 4ECUA 5H9FJ 5AQWA 3IFRA 2DHXA 5K9FA 4QS7A 3UKRB 3AO3A 2A1SA 1S1TB 3M8SA 1TMMA 2FC0A 5BYRA 1NPPA 3DDKA 4BC2A 1U24A 4CEZA 3CD7A 1S6PB 1CJVB 2IS3A 4FJXA 1IKVA 3CF5Q 5JVGQ 4CEAA 3MM7A 4CTAB 3V9WA 2DEJA 3SUOA 2MYFA 2R7VA 3I8BA 1N5TA 1HYSA 1T9WA 1PSDA 2VD3A 1XUPO 4ZP6A 4GC6A 3H5SA 5MLCQ 3P39A 1ITPA 4H4KC 4BE1A 3QATA 2LLZA 2GVDA 2XQCA 3W2VA 4O55A 3V6JA 2V2VA 4B3MF 5DS7A 3M3ZA 3AVLA 2V9WA 2HRYA 4KRFA 3HO1A 1VJQA 2HIQA 4DV0K 4ZP9A 1LW0A 4DPYA 3NCPA 3NMUA 3OTDA 3O4WA 3C15A 1IJJA 3BSNA 1GLFO 5GIPA 2YVSA 2AJ0A 1F2GA 4CZFA 3ONQA 1HHTP 3KHHA 4PWDB 4JKAA 5B09A 4CJWA 1K8AT 1PC5A 3MEEB 3M8RA 4FWNA 1QAIA 2XS5A 2MXYA 1XMOK 2JJ4D 3ZZUA 2OHDA 3TI0A 2ZH5A 2J0SD 2Z2ZA 1KQGB 3HOTA 4B8CA 1Q81T 4FKXA 3CCQS 5F0WA 3SJHA 1PJ5A 1VQMS 1UEKA 2CDRB 1DZ5A 3BZQA 3QFWA 2GBZA 3LZIA 4IOAL 1YWXA 4ID5A 4N47A 3KD5E 3L2RA 3VQSA 1HHQA 2EWSA 2V6AA 3LP1B 3DAWA 2VFSA 1SJFA 3C0BA 1WBDA 3PR4A 1ZS6A 5CHIA 3I6PA 2ZC4A 4FWKA 1T6CA 5A8WB 1QQMA 2CZ9A 1IJEB 2OIHA 1FHTA 1RT2A 4PCQA 5RUBA 3AGKA 4FP9A 3WIVA 1HUXA 2ZD1A 2HHTA 4NRUA 2ILYA 4OHZA 1H72C 3RSEA 2CNKB 5FRMA 1GQEA 1KLMB 4JK9A 2XM3A 4WFAQ 1HJOA 3K59A 4H0XB 5IZHA 4FYVB 4K59A 2ZVSA 5I3UA 5DM6Q 4Q8EA 2MKCA 4L74A 1UVJA 4IKFA 1S1XA 4BRLA 3GILA 2VU5A 4NI2A 2LQ8A 5IT4A 4Z37A 3RTVA 1D9AA 5AT1B 4X84A 1TVRA 4RWWA 3LOUA 1EX8A 1LWCA 2KLAA 2CNNB 5GINA 4JKCA 4DV6F 2LXIA 4IFEA 1NGHA 4EYHB 2UP1A 2FXUA 3PHTA 3SQ0A 2VIHA 5IFMA 4L72B 3AVJA 4DV1K 2BTFA 2CVIA 1X8DA 5C10A 2D0CA 4QR0A 3VEWA 3VZHA 4DR2F 2PZSA 2F8MA 4CZEA 2H65B 2EBGA 5SUHA 1SIWB 1QLNA 4QBUA 2ZH8A 3VAFA 3KMSA 3GG4A 4PPZA 4F4AA 4DLEA 3A3OB 2HNDA 4CI6A 2W9AA 1RTJB 4BRGA 4DTOA 3PEJA 4USJC 2FHJD 4CF2A 1X7VA 2UV8G 2BOAA 3MPUB 3DYAA 3TTFA 1QSYA 4RX6A 3TO8A 4CRJA 5D15A 2Q79A 3K57A 1D1UA 1HBMA 1HBNA 5IWAJ 2P5OA 2JC1A 1NGJA 2C22A 3P49B 3IG1B 5T7BA 3G6VA 4KBIA 1DQ8A 1VQ7N 5EXWA 2EKNA 1JLFB 3NH1A 2VWJA 4OX7A 4I6MA 1HNIA 3E9LA 1D8YA 3AO1A 1WSJA 1PJ7A 4ECRA 2A3ZA 1J27A 3AY9A 1KD1T 1IKWA 1Q82O 2QC3A 1PYSB 2C2MB 3CJ9A 4KFBA 1VQ8N 3RRGA 2RRNA 4P10A 3DOMA 5IT9U 1VQ5S 4LH5A 3KLEA 2C3UA 2C1EB 2FHKA 1TZ0A 1A9NB 3O5BA 2XRIA 3KWGA 3J7ZO 3Q8RB 1T9TA 3J7ZT 1EETA 3HK2A 3TP2A 3R8YA 5AFUH 3HSJA 3RGIA 4KB7A 4UQGA 1H1VA 4FJJA 4DDFA 1FFSB 4KBOA 3VETA 5HK4A 4ICLB 1FXRA 2N4DA 1UFWA 1IM6A 3B82A 4FZYA 4CFDA 4TN2A 1K6YA 4OL8A 1NCLA 1ZZFA 1JNRB 4K42A 2SXLA 1S48A 1X5TA 4J90A 4HACB 2ZE2A 1LV5A 2I8EA 2WW8A 3QT6A 4RUAA 4CJUA 3OBIA 4CH0S 3DU6A 1WHVA 5JLFA 3VA0A 1QQOA 1HBUA 1C6VA 3OVBA 3JYTB 5KG1A 1FWLA 2F65A 3K5LA 3CJ4A 4J2DA 4ENOA 1CJUA 4NLVA 3JB9k 3FEXB 4Z4GA 2I5JB 3MUVP 2LKZA 3FSIA 3EVMA 1DTQA 3FZHA 2GJFA 4NPOA 5K14B 3V6DA 2IA0A 1SXLA 4EP4A 5LL6Z 1PYOB 4ZLPA 3HYFA 3MCNA 1S5JA 2DGQA 2QYCA 5ADXA 1WWHA 1IO2A 3BM7A 3SAGA 1UVKA 3ZC4A 2FVPA 5DQGA 1YJUA 4H54A 2PMWA 3ETMA 1CJTA 1A5XA 2YWWA 1JJ2M 2HIYA 3RB6A 1HRHA 2MTLA 2V52B 4UUXA 4HDHA 1FKPA 3QEIA 2L9DA 2Y8WA 4JAXA 4L6V3 5C25A 2XLJA 5LMUK 2C3PA 2XLKA 4DSFA 2V8DA 4IG0B 1S6QA 2CDQA 2EK6A 2CNLB 4Y34A 1L3UA 1S1UA 4ZVEA 1CLQA 4YS2A 1WOSA 1GK8A 3QFPA 2AP6A 2DY4A 1EX4A 1ZBUA 4FYXB 1T05A 2O5DA 1VRTA 4OJHA 3UW1A 1WC6A 3FJ2A 1CJKB 1E6VB 5SZTA 3DLKB 2JZ5A 2H4YB 1X4FA 2B6AA 4J91A 2JWLA 5ADZA 4PKIA 3R5BA 1DRZA 3NNAA 2P9GA 3QRQA 3GG1A 4J9OA 4UOCA 3ENOA 5LM7E 1T0TV 3JSYA 2PGCA 5GAEU 4AE5A 2V4RA 1N5QA 4DN0A 1RDBA 4KI4A 3ENHA 1BC6A 3GP9A 3NAHA 2RJZA 1K8AO 4BS2A 1AZSA 5HRPA 2V8PA 4PL8A 4XDCA 2HHHK 4C48A 4QYZJ 3CJKA 3TPQA 3M05A 2LQBA 2X1BA 1KTQA 2VF3A 1F9EB 2ZBRA 2H3GX 2UUCJ 5LT5A 3NAEA 4OLAA 5A0YA 2BANA 1GLEG 1CULB 3MM5A 3TQ1A 2G0JA 3VERA 3H6EA 5AQVA 3DLKA 4DSJA 2KZMA 4ZPBA 4B9SA 2CGJA 1WNSA 3U27A 3AT1B 4OLPA 3ZEUB 4LF7J 3C16A 1RTIA 1OIAA 3H90A 5D6GA 5LSLA 2HHXA 3IRWP 3LGHA 2HQ3A 4EU0A 3M6VA 4BVOA 2VPYB 4YR2A 3RB4A 1C1AA 4D3HA 3NGDA 1SH2A 5J2MA 3L9ZA 1WI6A 4DV6K 2B4PA 3A13A 3GYXB 3EGWB 1F5BA 3QIPB 4GY2B 1N56A 2UUBF 1VQ7S 4OX9F 3NF6A 3G6ES 1H73A 2BM1A 4FXWA 4B02A 4Q0BA 4CJ5A 1J54A 5GIOA 2RUGA 2X7IA 7FDRA 4KH6A 3M2UB 2FLOA 4DV0J 4GVLA 1S72S 4ELTA 1X60A 1XMBA 2G8IA 4WIIA 1NDPA 1RCOB 1YJNN 2IIHA 3ITHA 1J5OA 4ELVA 1N36K 3P83D 1GX5A 2R8HA 4F3OA 2PD1A 2JHEA 1U8SA 4A47A 3HFVA 4I68A 3P6YC 4ED5A 2CYYA 4TYAA 2XTJP 4QU7A 1B4SA 3DLLQ 1VSHA 2AJ1A 4FLZA 3D45A 1YIJN 4CLTA 5AJ3J 1Q8KA 4Q43A 1CEZA 4MKYA 3HOSA 3TR5A 5IWAF 3RAXA 3OBWA 1DTQB 2BBEA 2CPFA 3SDEA 3RRKA 2MZSA 4ALZA 4JK8A 2I5JA 3S01A 1YT3A 2GJIA 3WQPA 2AYBA 2HZAA 2W01A 3KZBA 1NWKA 3LZJA 2JEGA 3QFHA 4CBWA 1HBUB 4ANCA 5ETQA 2BQ3A 2F4VF 3E1YA 3DOLB 1TL4A 4OV6A 1M5PC 3FGUA 2MQLA 4JI4F 5AQHA 3V4MA 5HJXA 1S1UB 3H59A 5LMNF 5BYQA 2X1FA 3WX8A 3F9KA 2D3OR 4I67A 1NBWA 3J8AA 1HR0F 1R8AA 4TU8A 3CMQA 1K8KA 3I5BA 1N8RT 2XWXA 1IBLF 2OELA 3MXIA 3M2RB 5LMUJ 4CGDA 2Q0UA 2XYHB 1MSWD 3AD7C 1RYRA 3KK1A 2KXNB 3TQEA 3O5TB 4HWIA 4DPTA 4FVUA 3V9UA 3LW5C 3FQKA 4YMEA 2AGOA 5CHCB 3CJCA 2G1DA 1NJYA 2GGPA 4NLCA 4X4SA 1Q95G 1B64A 1O8BA 3J7YU 4CZJA 4BC9A 1SBRA 4Z0UA 4LRBA 2HZCA 5F41A 4JI7F 2ASPA 4YDUC 3QZ8A 3ILJA 5KG0A 4CFAA 2Z1HA 3QINA 2XHCA 3UO0A 3ZSWA 2FJWA 1WKKA 4OX6A 1RWOB 1JLQB 1C1BA 3EN9A 4N76A 2QA4S 2HSEB 3TOQA 1PG5B 3D28A 4KQZA 5KPRA 2CPJA 5EWFA 2GUPA 1FESA 1WHWA 4DG1B 3M32B 1G15A 1RWKB 1Z4UA 2W4PA 4C97A 1AT1B 1GXTA 2ZNYA 2NXNA 2YHAA 5AZIB 5FJ4A 5A2QY 1LWFB 4U7CA 5HRSA 1RHRB 1U2CA 2FZGB 4UY8O 3CCLN 3KKRA 1TKTA 2LCWA 3LTOA 4AHSA 4ATNA 4CWBA 4V19X 1R31A 4LFCJ 4B3OB 3GIKA 4DL2A 5A2QO 2EVZA 3OJUA 4Y2AA 1XNQJ 1WSHA 3PEHA 3GZ7A 4DKWA 1HQEA 2BYCA 1FWPA 4YOWA 2OANA 2PIIA 1YITN 3SCLE 2RE2A 2DNKA 2ZWOA 3QPIA 4FVMA 2V9KA 4ID8A 3B4DA 3U3YA 3K58A 1YJTA 3CI5A 5H1SV 2JFDA 3GIMA 4CH7A 1VSIA 3L4QA 5L1LA 3ID6A 4ZVGA 4CJQA 4KSEB 2HRUA 1IBLK 4YOVA 4LF4K 2EC2A 3LGMA 3ZYYX 1D0EA 3NFAA 4OI6A 3MX5A 1KLNA 3CXCR 1JKHA 4ANEA 3T1YJ 3W2WA 4NLOA 5H9FK 4CZIA 2W7OA 2O8DA 2A6AA 4JK7A 4LJMA 3I33A 2G8KA 2NNWA 5E3PA 2C3YA 1FA0A 1M1KO 4BWJA 4USTA 2JX2A 3Q83A 3PYEA 4O5BA 3IG1A 2IRXA 2F4VK 4TLQA 2J8SA 2WAQD 1BG3A 2YJFA 2JDJA 4JI6F 2WVFA 3V9SA 3HI0A 2M8HA 3CERA 5CD4A 3GJSB 3G6YA 4A5AA 1FRIA 4DL4A 3ALYA 4BRQA 1NGBA 4KKOB 4UQTA 2RF2B 1N36J 3ZZZA 2OCEA 3DLRA 4WF9L 2J4RA 3PTWA 3IUCA 2FLNA 3L3VA 5J1PA 1R27B 2AGQA 3LDSA 3VVTA 2UVUA 2B9WA 1Q78A 1EWQA 3G71S 5DLFA 3S9HA 4G3IA 3OYMA 4M95A 3OD2A 2FF6A 4DTSA 5KFOA 1RDWX 1JLBA 4QWDA 2ZH3A 3DLJA 2R7QA 4DU8A 1HNZF 3TAGA 4GVBB 4LSLA 1BA0A 1FD8A 1RTDA 2DNZA 4YB7A 2YWEA 2F9JA 4PQAA 2B4UA 4IQMA 4YB6A 3OYAA 2J7UA 1GLDG 3D1HA 2CG4A 3RAQA 2CJQA 3MR2A 4PYDA 4FJ9A 1YJ9S 2QXLA 2NLXA 2BJ3A 3FRYA 4DPUA 2X6SA 9ATCB 2OEKA 4FN5A 3V1QA 1IBMK 1W2IA 3OA9A 3S41A 3H46O 2Z58B 3LWMA 2P8IA 2VASA 3PRDA 3MI7X 1IM4A 3CD6S 2ZBPA 3TTCA 4NXMJ 3ZEUA 3TZZA 1HNWJ 1ZM4A 3CPEA 2IC3B 4JYAJ 3ZNJ1 1TL7B 4M5DA 3AJ1A 2G9OA 2DY9A 3H7HB 3CW2C 4NLTA 1QUVA 3SQOP 3ZX2A 2FJAB 5A76A 1G3OA 1AA1B 2U1AA 2ZM6F 3N4QA 2WTFA 4HT5A 3T19A 3A2FA 4ID5B 2EG1A 2YNHA 1ZETA 1F9HA 1SH3A 3AJDA 2M9KA 3CJKB 1IBCB 3D3BJ 3I0SA 1S1WB 3ENWA 4RNNA 5L39A 2APOA 1JCFA 3NE6A 5HANA 4NEZA 2UUCF 2Y3YA 1IJFB 1N34K 1FNMA 1RDRA 2RUSA 3ZT2A 4TNOA 2L41A 3MGJA 1MMNA 3AB4B 1FT8A 2ZJPL 3C7NB 4KR0B 3OS2A 2K8GA 1Q18A 2GX8A 4QIWD 4XPCA 4USMA 4ZN3A 2QFIA 4ZLNA 1T94A 3H1QA 2DT9A 4P7VA 2DFHA 1N0UA 4FS2A 4MDBA 2XBPA 3IM8A 3WNFA 2QO3A 2JWNA 5CZXA 5EN1A 5JS2A 2OJ3A 5GVQA 4CEFA 2O8CB 2ZZNA 1X9JA 1JXBA 3S6EA 2CQ0A 4U7UK 3WDOA 2XS7A 2KI2A 3R2DJ 3O08A 3KMQA 4DS4A 4OPAA 3RMCA 4OYXA 1D9DA 3CQYA 3UCUP 1JCEA 4OPHA 3BGOP 1YXQA 4QOZB 1JQGA 3HM9A 1WELA 5DG7A 2DGOA 3N0VA 4IFYB 3CCMN 2CPXA 3HCXA 3RBEA 3SXLA 3V4IA 4C0HA 3KK3B 2N7YA 2OAUA 4C0BA 5L9NA 4CHPA 4A8MP 4DL5A 2ASDA 2KJWA 1N52B 1T3VA 2I2YA 1Z1ZA 3PW4A 4IDHA 4NYZA 3E51A 1NGIA 2XMJA 4USIA 4U6PA 4XO0A 2CJBA 1C0TA 1T44A 2MKJA 2QLFB 4X4RA 3L2QA 4EHTA 1S10A 5M1QA 1CJTB 2D1KA 3VAMA 3G82A 4EYIB 4DQSA 3TSQA 3IS9B 4CYUB 4F3TA 4CT9A 3LDPA 4UOFA 1SL0A 3S3OA 3M8YA 4O8UA 5KPZA 2OZMA 4PG8A 4DR6K 3GJQB 3THPA 3DCAA 4U8YA 5KFNA 2AEMA 3KK2B 2NR0A 4QWBA 2GEMA 3SQ1A 4ZLLA 4A8FA 2IJNA 3NF7A 5ETTA 4H4OB 3T41A 1YJ9N 1SL2A 3THYA 1AYEA 1WSIA 1U2RA 5D77A 1YVNA 2P5VA 3RRHA 3BSOA 4C7QA 3PJWA 3A4TA 4K4WA 4OKEA 4YQWA 5GMDA 4OZJA 3HP9A 3KLGA 3EVWA 1XI1A 4Q7AA 2MLYA 3WXMB 2NRWA 1T9VA 6FD1A 4QIVA 2GV1A 1WUUA 5HRRA 1M1GA 1A5WA 1X5SA 1TKXA 5HVHA 1N6QA 2VQEF 4C8LA 3EPIA 2ADBA 3OYDA 4DSEA 2OPSA 2QI2A 1J53A 4LBPA 2IJRA 3TZYA 4BHQA 1N5VA 3JSMB 1NSAA 2FY1A 2RN2A 4A8KA 2HQCA 1U1LA 4QIEA 3UKUB 3ILIA 2HLUA 5B0DA 4M3RA 1EETB 2JEIA 4NLBA 4ER8A 1FKOA 2A2DA 3FUYA 1TELA 5AQMA 2ALZA 4X65J 3JQKA 3PACA 4DTRA 2OA8A 2AHOB 1VIOA 2IM3A 4IUFA 3TANA 1VQ8S 3NL0A 4WK1A 3SCKE 2WZ1A 2NSBA 3J7Z5 3J7A1 1VBYA 4AQYJ 1VC0A 1RJJA 2NZ4A 3W63A 2IM1A 4YNQA 3KKFA 4N56A 2XMMA 1CQMA 4EUVA 3HTVA 2NXCA 2DR6A 2XMTA 4V19S 1FRHA 3PDNA 2UV8A 1VSKA 2I7PA 4F04B 1V4SA 3PZPA 2Z1IA 2O8FB 2ZWPA 4JUZA 4DF8A 2RDDA 4HHUA 1XNQF 2EFGA 3QEVA 4YFUA 2GELA 2WK4A 4DV7K 5DZ6A 2OSQA 3OHBA 4PXCA 2QA4G 2LQJA 2WVCA 4BR5A 1SCJB 2MQOA 3MEKA 3GTYX 1P8GA 4F0HA 2QT7A 3DRSA 2CNOB 1WHYA 3ET6B 5AQQA 3BY5A 4NCGB 1O5JA 4U67L 3W3DA 2KG0A 1AUDA 4I2QB 3TW0A 4FLVA 2GVZB 1P1LA 1GH8A 1YVUA 3ZSYA 1NLKL 2AIRB 3V4IB 4ZVTB 2XHWA 3QT8A 5BRHA 3SV4A 4HEA9 1Z2LA 2KT2A 1H2TZ 1AFIA 3HT3A 3B6BA 3NVMA 1FX2A 1JLGA 2VG5B 4LF5J 3GIRA 4CE9A 2VBZA 3WEEB 2UXBF 3ZTQA 2FB0A 4EIAA 2Q43A 3MN7A 5DDPC 4R5PA 1RU2A 4ECWA 4HCBA 1W7WA 5KFTA 1MU2B 1E3MA 1S0OA 1RAIB 3OR2B 3M30A 4HI2A 3OXGA 1R8HA 1YJNS 2D3O1 3LPYA 4B3SJ 4ILRA 3VQDA 1IBLJ 1RA7A 4YDUA 3S3NA 4LREA 4RO0A 4CHZA 2YKNB 5L1JA 1V4TA 2W25A 4EBCA 4FJLA 4OV1A 3F41A 2R2TA 2CQ3A 3Q8YA 3PW5A 4QQBA 5KT2A 3I5AA 4M3YA 4CM0A 1BWEA 5GADI 4ZITA 3S1TA 1ATSA 2H3EB 4ISGA 3R1HA 2LQ5A 1WC3A 3CDEA 3CO0P 1VQPS 3BF1A 1BD6A 1VQKN 5KFRA 3UE2A 4GRSA 3I0SB 2QK9A 2W8KA 1U1KA 4X66K 1E6YA 1S59A 2VV5A 3NS7B 5KT4A 2ADCA 4AHVA 2UXBJ 1MNEA 4WQ5C 2ABYA 4DV4K 4IKAA 3THTA 3KNAA 2FTRA 3GCWP 1XN9A 1DFDA 3IGNA 2GIFA 1RYSA 5CZ2A 3DKDA 3ZXWA 3BR8A 4U7UD 3VGSA 2P9IA 5CABA 1S79A 2NPFA 4O0IA 3O3GA 4J37A 1TQLA 4FL9A 3TAPA 2IVNA 1REVA 3OYIA 2E29A 2L9NA 3R6MA 4NXNK 1MWZA 4WFXA 4OJRA 2E2PA 4N5SA 1TL7A 1BDGA 2ZM6K 4KGMA 2O8CA 3IA0A 3VQPA 4IG3B 4W90B 3KKSA 3NS6A 2OD6A 1ZBTA 3PRBA 5JMVA 2B3TB 4ECYA 3L7UA 1C0GA 1NH7A 3BQ0A 1H38A 1WB9A 2YCHA 3NXZA 1WN7A 1CULA 3MM5B 4WKRA 2XMWA 4XH5A 1YZ6A 4KHSA 4RW7B 4M5IA 2VA3A 5DRKA 4LUBA 3K8VA 2QKBA 1NPRA 3LDQA 4YHHK 2UUAK 4WYWA 2VB6A 4X4PA 3K2YA 1XC3A 2LXUA 3MN9A 3G8SA 4BQZA 2CQBA 3VOVA 3GIJA 3TTDA 5HMXA 2FBTA 3VQEA 4QWAA 4TSXA 5J1NA 3CCSS 1UVMA 4PAAA 4M5JA 3MOJB 2HF3A 1FERA 2HAFA 3G96A 4CJFA 1HI1A 4NO7A 1LOUA 1BHNA 3QBCA 3VAGA 2CPDA 2HFZA 4OHXA 2Y0BB 4B3SF 4RW9B 2Q31A 1UCNA 1OH5A 3RR7A 4NZ0A 5CR4A 2J6SA 3CCJN 4FM1A 2UXDJ 2RF2A 2OSRA 2OTJS 2IDEA 4O3NA 1K73T 3ZNUA 1VLOA 2DXFA 3ENBA 2CJAA 1XR7A 3W61A 2Z8QA 3H8YA 2XG8A 2NRXA 1BQMA 5E3AA 1GAOA 4U9RA 4CZLA 1CXQA 1T3NA 2O67A 4F0KA 3MR5A 3BKTA 4QW9A 4ED8A 4USWA 4RTFD 5GAEP 1IUJA 4IG0A 2FUG9 3UCGA 4HYKA 3FZLA 2AV5A 2J7WA 1LQ9A 2ATCB 1M0SA 4KT0C 4CBUA 2ZH9A 4L3NA 3VEVA 4AD6A 3VQAA 4ZA1A 1J6ZA 3H25A 1FI4A 1ZA1B 4O3OA 2R42A 2OMOA 3U6FA 4IOBA 5JVHL 2DPIA 4IH6A 1YJVA 4RUBA 3VHQA 1VAZA 3OL6A 1X4HA 3W8PA 1FNOA 4O0NA 3MECB 2UXCK 4QR1A 4E0DA 4NA1A 4FJ8A 1ZBLA 4YB1P 3U1NA 5CYQB 4KY3A 1JMTA 1VI7A 2BVZA 4OYMA 2R7XA 2WONA 3UR3C 3QZ7A 1N5YB 1JXLA 1Y3JA 1OYEA 4ILLA 1KQSM 4IJNA 2GWKA 4LVNP 1P9QC 1KONA 3P5JA 4DV4F 3GMGA 4HTJA 4CM2A 2HFSA 5AQRA 4RBUA 2KO1A 3I0RA 3HHNB 4BR9A 4WCEQ 1NK8A 4J8FA 5KT5A 1EJ7L 5C24A 4GKJJ 2RDJA 5GAGI 2OTLS 5I3QA 4DTNA 2E1AA 2EXUA 3AVHA 5A8KA 2KM8B 3A0IX 2XCAA 1W2BR 4HACA 2ZM6J 1X4AA 3HD1A 3GSIA 2OPQA 4O3QA 3VF4A 3ZTPA 2WW4A 3CDBA 4MFBA 2EFOA 3FE1A 1VDHA 1HKCA 2LA6A 2VA2A 1JKHB 4DMNA 1RB0A 5LJWA 5GMEA 5KGXA 3PIOQ 1XQIA 4PXEA 3CULA 2XWYA 2CPYA 1VGYA 4CK1A 5HMZA 5AJ3F 4PXDA 2FLLA 4RW8B 5KFZA 1BIUA 2ZUGA 2VG7B 4ED0A 3ZX0A 4CZHA 2CXEA 3TABA 1TL1A 4I2PA 1U25A 2VG7A 2DNOA 2IDLA 2UUAF 5KFMA 1TK8A 4KHPK 1NOZA 1APSA 3N4WA 2I1RA 5D4PA 4YOUA 2ZH2A 4Z7CA 1BQXA 4DV7F 2V67A 3OTOJ 2VG6A 3CCLS 1PAEX 1ZAXA 5BXIA 1IKWB 4CEOA 3HKWA 1LW2B 1UJ4A 3ZSQA 3QJLA 2HHSA 1LWEB 3NDKA 4KAIA 2LDYA 2CUYA 4DWIA 3CJSA 1RKJA 4MKBA 3GBTA 4K41A 4PG6A 4ZVQB 1GXUA 2VFVA 1NLVA 2D0BA 2DNGA 3QO9B 2PI4A 4Y2CA 4C9DA 5AZIA 2N4CA 1VBKA 3BDPA 1U49A 4KGVB 2DY1A 4YN3B 1R59O 2CQGA 1M1KT 3DYAB 3G25A 5LMNK 5DDQC 1FXDA 2IHR1 3HHEA 4B8AB 4X4TA 1HR0K 1BA1A 2HNDB 2IMWP 2UXBK 5HP1B 3DXMB 1J9AA 2F9TA 1SC1B 5FIIA 5F8MA 1HBOA 2OLWA 5D0HA 2IPOB 3RB0A 2RILA 1FJEB 4PKGA 3LM2A 4CIFA 4I0WA 2XEXA 4CJEA 4NYFA 4TU9A 1RQ0A 1AB8A 5C0YA 1TU0B 2OPPB 5K8PA 3W60A 2MKSA 3RBZA 3SBTA 4RW8A 2AZ3A 3M8ZA 3HHLB 3P3DA 1GTHA 3DGPB 4LFAF 4J9SA 3UFCX 1KVBA 5DM6L 2KYXA 2ROEA 2VZ9A 5A6WA 5MLCV 3T5KA 3QBXA 1YTUA 4Q2MA 3T1AA 2YNFA 2IJFA 4PY5A 2H51B 4JI4J 4DN9A 1S1XB 5E2QA 3GIIA 1S0VA 5EX5A 2XSJB 4RCHA 2MQQA 4O5FA 2GQ2A 3AXKA 3CB4A 4DSIA 1ZPVA 1VBXA 3NMRA 4EFHA 4YY3K 2RIJA 1HWJA 2GNKA 4P71A 1SUQB 1H6KX 4LBIA 4L3KA 4RW6B 2H5EA 2KT3A 4K2JA 4HTUA 4DR7F 3VF0B 1TL3A 3KG1A 5C24B 3AVBA 5C2DA 4MAKA 1FK9A 2QJ3A 4LSZB 2ALYB 3I0RB 2MZJA 4RWTA 1QS4A 4DFMA 4GKJF 1IR2A 1MWYA 5L1IA 1YRXA 4TY8B 2G2ZA 1Q81O 4K43A 3AQPA 3CXCM 2KN4A 4DEZA 1X4GA 4PKDB 1XMQK 2KYZA 4BE2A 4C4WA 2BANB 3LP0A 1RT3A 2WVBA 2QW9A 1SH0A 4FM2A 3VESA 1X0FA 4OHVA 2E5LF 4UT4A 1OPZA 1W7AA 3UN2A 2H54B 1YHQS 3K2PA 4MDAA 3OJSA 1D5AA 2N3LA 2AT1B 4ED3A 4KGKA 1QSLA 1UVLA 2XI2A 3JXUA 2DISA 4P73A 2V2QA 3SV3A 4Q5VA 2H5JB 1VQ6S 5KT3A 4FWSA 2BJ9A 3MPWA 1SQKA 5B0AA 1X9SA 4Q45A 4LF4F 2F8EX 4LMZA 3EE9A 3OS1A 2UXDK 2BJ7A 4FLTA 1D3WA 3NKYA 2IA6A 2H4WB 1RDDA 2BJ8A 3KLFA 4L76A 4HTLA 4H03B 4HT7A 4L75A 5ETMA 4FXVA 3CGIA 4DUYJ 1GEHA 3CWJA 3N28A 1D9FA 1O0PA 5D4NA 2EKYA