1R0AA

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 138
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1r0aA05
3BSNA 4OPKA 4K4UA 4CK2A 4WFYA 3HO1A 4F4KA 4J9LA 3DI6A 3S3OA 4ZPDA 1QHTA 4KHQA 4CEFA 2BANB 4MIAA 1RTDA 5EDWA 4KI4A 1RDCA 3VQSA 3G10A 4OJRA 4CEAA 2AJQA 4F3TA 4CJQA 2BQ3A 5KGXA 1GOCA 2UVWA 4B9MA 3M8QB 1CSJA 2G8UA 2PY5A 1DTTA 4FZZA 3P1GA 3MXIA 4AHVA 3DLBA 4EBEA 3L2QA 1SV5B 4YMEA 4KKOA 3M8PB 4KFBA 1FKOA 4NLWA 4FXDA 3ISNC 1N4LA 2AGOA 4BE0A 3BQ1A 2HVHA 3OL8A 5KFRA 4O4RA 4R0EA 5KFJA 2JGUA 1JLEB 3KK1A 3IRXA 1KFDA 3MECA 4E3SA 3PO4A 3QEXA 4FJJA 4CF2A 3KLGB 4KV8B 3LP2B 2VG5B 2GV9A 4CF1A 1NK9A 3DRPB 4RW6B 3NAHA 4B8AB 5DG7A 1LW2A 4ZTFA 1ZYQA 2QKKA 3HP6A 4FCYA 1Z4UA 2P51A 3LALA 3IG1A 2V4RA 4YFUA 2DY4A 2O4GA 5D3GB 4J9RA 3DOKB 3FDSA 1RT1B 1N6QB 1WSFA 4Y34A 4TY8A 2QXFA 3RMBA 4LD0A 2BQRA 3F9KA 3VQQA 4WZMA 3ZSWA 4MKBA 4IG0A 3RRGA 4E7LA 4CJ5A 4KRFA 4RW9A 4HUEA 1WSIA 2E9RX 3QNOA 4CJWA 2X6SA 1LWFB 4DSJA 2BGGA 1L3VA 3MXMA 2R2RA 2OPSA 1WNEA 2IOCA 2J6UA 3SUNA 1XC9A 2IA6A 2VWJA 2Y1JA 1VRTB 1CZ9A 5F8HA 5HROB 1T05B 2I5JB 1O1WA 3LP0A 2ZD1A 2YNGA 3RB3A 3WNEA 3L3UA 2HW3A 3ALYA 4QWDA 4ZVHA 4DF4A 4KTWA 3MEEB 1TAUA 5C5JA 1SH0A 4FJMA 3DRSB 4ECTA 1YVFA 2Z1GA 3SUOA 4LQ3A 4JV0A 2DTUA 1K1SA 1I3AA 4M3XA 2XI2A 5KI6A 1BI4B 3K5LA 4M41A 3BR9A 4RG8A 1BIZA 1Y97A 5F8MA 2RN2A 1K6YA 3SZ2A 4DL6A 3AO5A 4FJKA 2J6TA 4DG1B 1S6PA 3N6NA 3DMJA 4R5PB 1TKTB 1NJWA 3AO4A 2HMIA 2B5JA 4NCBA 3GV7B 3I5CA 4I2QB 3T19A 2W9CA 3PJWA 1JL2A 2O5DA 4YR3A 1YTAA 2AU0A 1LWEB 4KHYA 4ZP9A 3MR5A 4DFJA 1J5OB 5KFXA 3UQSA 2G8IA 2QKBA 5I42B 5C42B 3BJYA 3NH2A 1QSYA 1JL1A 1DLOB 5KFMA 1XWLA 5J2QA 4DSIA 4MFBB 1SH2A 2XCPA 3KJVB 1HQUB 4L8RB 3OYDA 1HJRA 3RMDA 1SKRA 4E0DA 4B9NA 1S0MA 1S6QB 5FDLB 5KFDA 4KBIA 2YKMB 4Z4CA 4E1MA 1RTJB 2W7PA 4KSEB 4ED6A 4CJ4A 3KIOA 3QEPA 4CE9A 2VA3A 4PQUB 1JLGA 3TI0A 1I6JA 3SFGA 4OL8A 3NGDA 5I3UA 2WONA 3OJUA 3ZSVA 3QZ7A 3VQ9A 1QE1A 1ASVA 1LAWA 2D5RA 2OPPA 3TAGA 1TVRA 1U49A 1NOZA 5EWFA 4CEBA 5K14B 1JLBB 4EBCA 4CGGA 1XR7A 4TQSA 1QS4A 3HVAA 5J1EA 1RTHB 2UVRA 4FLYA 3QZ8A 4XPEA 1IKWB 1BQMB 4HHTA 2PYLA 1RT5B 3QGIA 4FYDA 3DYAB 5C25A 3CWJA 4G3IA 2FVCA 4O55A 5KFUA 5KFVA 4J9QA 4CGFA 4DU1A 3MFHA 3AVNA 3KK3A 4Z4GA 5KFZA 5DQIA 4EYIB 4IDKB 1S9GB 4IFVB 3H4BA 1SL0A 2YNIA 3ZSOA 3HPGA 3U3GA 2DFHA 4CEQA 3NDKA 4ZHRA 5DMRA 3L2UA 1QQCA 3TAMA 1YVUA 4ZPAA 5HRRA 5C24A 4O44A 3CJ5A 1YT3A 4RNMA 4J2BA 4IBNA 1ZBHA 3CO9A 2IS3A 4AHUA 3D28A 4CFBA 2HHSA 1JIHA 4CJKA 3TAFA 5CZ1A 4ZTJA 4PUOA 4NLUA 1JX4A 3KLFA 2UVVA 1VSEA 4BDZA 1W0HA 1WNSA 2AGQA 4KTZA 3S3MA 1RT4B 4F2SA 5DK5A 5HLFB 1FK9B 1IH7A 3BREA 1C0TA 1FKPA 2CKWA 3EPIA 1C1CB 2HHXA 2OPRA 1BQNB 2G8HA 3SV4A 4FJHA 5KFFA 1RA7A 3VQDA 4Q8FA 3QIDA 4GW6A 3CJ4A 3E51A 1LW0B 3VQAA 1VSMA 4HYKA 2RF2B 1QSSA 3ZT2A 3SI8A 4O3PA 5KG0A 4PWDA 4NLGA 1KLMA 5HRPA 3DI6B 3CFOA 1LWCA 5KT6A 4CESA 1RTDB 3JYTA 5KFQA 4E89A 1JXEA 5DG8A 2EC0A 4WXWA 4CGJA 5KFSA 5HRNA 2X6NA 1NJXA 2O4IA 5DLFA 1DTTB 2Z1IA 2D3UA 1NOYA 4F2RA 4ECXA 3RAQA 2E6MA 5EUHA 4HCCA 3LAMA 1NNDA 1XR5A 1UOCA 4H8KA 4ECVA 2IJFA 3DLGA 3TQ1A 2YHAA 5KG5A 4KKOB 3O3GA 3CFPA 3I5BA 1KLNA 4KB1A 5L9XA 2G8FA 4KFBB 1FKOB 3AVFA 2FBTA 1RBVA 1C6VA 3O4NA 3U6FA 3PV8A 4MK7A 3KK1B 1RT2A 2VWKA 1OS5A 5KFIA 2BQUA 2HNZA 3SPYA 2OZSA 2D3ZA 5KGWA 4C8OA 5F8LA 1I39A 2HVIA 2ILYA 3QYYA 5DGBA 1SUQB 5J2PA 3PX6A 4G1QB 4B3OA 5J2NA 4RNFA 1LW2B 5KT7A 3GV5B 3HKWA 4DTSA 5KG2A 1WAJA 1EETB 4DF8A 2E6LA 4CHQA 3QEWA 1U48A 3V81A 3LWLA 4JV1A 2EHGA 3TVKA 4HVJA 4Q44A 4TY8B 2E9TA 1ZTWA 4LY7A 1D9DA 3KTQA 4R8UA 1JLFA 4NLQA 2WOMA 3EYZA 2HWHA 4NCGA 3PX0A 2KTQA 4IG0B 4QPXA 1S9FA 3ZSQA 3UIQA 1UWBA 3H2LA 1U47A 2W8LA 1HNVA 3EPGA 4RW9B 3OJSA 3O4QA 4Q8EA 3OSNA 4ID1A 4RW8B 2G8KA 2ZE2B 4AHTA 3C95A 3V1OA 3AVJA 1QTMA 4FBTA 4HTUA 4M95A 5JS2A 4FZXC 2OPSB 4KPYA 3VQBA 1REVA 3NBPA 4QWBA 3H08A 2R8GA 5KFGA 4H4OB 1VRUB 4I2PA 4BE1A 3DOLB 4DSEA 3T5HA 4EBDA 3TWHA 2HHWA 4FJ8A 2QE5A 4E7KA 1C1AA 4OPJA 2XY8A 1BCOA 2XY6A 1TKXA 2ZD1B 2YNGB 5EWEA 1S0OA 1S9EA 2Z1JA 4BE2A 1WN7A 4FS1A 4ZVGA 1C1BA 4LSNA 1TKZA 1RT6A 4Y1DA 3NKYA 1RILA 3PHEA 1NKEA 4FJLA 3KNAA 1EP4B 1ZTTA 3QO9A 1RT3A 2XCAA 4JS4A 4AHRA 5E41A 4CHZA 3MEDB 4O0JA 3F73A 4IH6A 1HYSA 4B9TA 3DM2B 3AV9A 1RDAA 4IRDA 3NMAA 1QSLA 3QNNA 3OVNA 3DMJB 4CGDA 3SQ4A 1Q9YA 4CFAA 4KHSA 2HMIB 2VG6A 1RT7A 2OPQB 3KHRA 3OL7A 2BR0A 3ZT0A 4ECZA 2XGPA 1HYZA 3KLVA 2FC0A 2IC3A 4CHPA 4FM0A 1R0AA 2D0CA 1TL3A 3AVMA 4WFXA 5KRTA 4DSLA 1IKYA 1ZBUA 1N5YA 3FRZA 4ED0A 4FJ5A 3LPTA 3OYMA 3HVRA 4K8ZA 2A1SA 3CFRA 1VSKA 4DSFA 4H4MB 4CEZA 4KB7A 4J9OA 1KRPA 3OYEA 5KG1A 4N56A 4TN2A 3NH0A 1ASWA 4QCLA 2W7OA 3QETA 2EX3A 3RTVA 2HAIA 3ZCMA 5KFBA 4CJVA 4O5BA 4F4XA 5KG4A 4DQQA 5HP1B 3HJFA 4K4WA 5SWMA 4LSLB 4CJTA 3CQ8A 4J9SA 2UVUA 4QAGA 3OYBA 2FBYA 4EP5A 3OYKA 2IM3A 4OLBA 3VQEA 4TYBA 4K4YA 1C2PA 3KD1E 4FJIA 4NLYA 3KLEA 3K5NA 1ITGA 4CJFA 3THVA 4HUFA 1JLAB 4M3RA 5KFOA 5L1LA 2VA2A 3OYHA 1UA0A 4ECRA 4RW4A 3HPHA 1WLJA 4WE1B 2XY7A 2A1RA 4IRCA 3VQCA 1TK0A 4ELTA 2D0BA 1RCHA 1NHVA 3I5AA 1XI1A 3VQ8A 4URQU 5KFEA 4ID5A 3V4IA 2IMWP 3OSPA 4CGIA 2HHVA 4CF0A 3OS0A 4Z4IA 1J54A 1N56A 4Y2AA 3VQ5A 1RBTA 3HXMA 4KB0A 4NLDA 3OS1A 3SI6A 3ITHA 3LWMA 1U09A 3OLAA 3KK3B 4DQRA 3V1QA 4RU9A 4Y1CA 1JKHA 3MEGA 4IH7A 2JC1A 2ALZA 2WRMA 1WAFA 3PVXA 1RBSA 1A5XA 4CJSA 2YNHA 4ZHRB 3TAMB 4DTNA 4CJUA 5C24B 3VN5A 1RA6A 2KQ2A 1TV6B 2ZQBA 1NK8A 4TXSA 4J2EA 1NJYA 4MIBA 3RB6A 4IFYB 2Z1HA 5CZ2A 3KLFB 4CHYA 2W42A 1XR6A 4BACA 4DL7A 2P1JA 4ICLA 4TQRA 3NE6A 1NK6A 2R8IA 3CM6A 4E1NA 3ASMA 3AVCA 4TLRA 3VQ7A 3QEIA 4I7FB 3IN5A 3CDEA 1FKPB 1C0MA 2JEFA 3QIPA 3TAEA 2OZMA 2ASLA 2IJNA 4CFCA 2ATLA 2RKIA 4FW2A 4ECSA 1YTUA 4DWIA 3M9MB 5JXSA 5JUMA 4URSA 2IM1A 3SV3A 1TGOA 3CDWA 4J9NA 4K4SA 2BE2A 3G6VA 3QLHB 4WXOA 1KLMB 3FFIA 2ZKUA 3UPFA 3LP1B 4BDPA 4J9MA 4YQWA 3L8BA 4GVMA 3OYIA 2HNDA 3JYTB 4I9QA 4XPCA 1HYVA 4JS5A 5KRSA 3SQ2A 3QGHA 3FSIA 1BIUA 4EEYA 3ZT3A 1EKEA 3SUQA 2ATQA 4BWJA 1IG9A 4AH9A 3O3FA 1U45A 4ED1A 4NLXA 1S5JA 3WNFA 1S1VB 4CIFA 4EZ6A 3H40A 4IKAA 5L1KA 5KT2A 1DTQB 3GQCA 3DLEA 1D5AA 3OY9A 2F8EX 4FBUA 1TL1B 1IKVA 3K2PA 4AHCA 3PW2A 3M8QA 1S10A 3V6DA 4URGA 5DQGA 4CF8A 5CYMB 4ECYA 3OYCA 3AVIA 3PW5A 4RUCA 1RT2B 1T7PA 2B6AA 4KAZA 3MF5A 1SV5A 4NZ0A 4F50A 4OKKA 4M3YA 3BGRB 3ZSZA 1SL1A 4IG3A 4K4VA 3GV8B 3LZIA 2FVSA 5J2PB 3MR3A 4K8XA 4DQIA 4C8LA 1KCFA 3OYNA 4KTQA 2X78A 5J2MB 3OYGA 5KFCA 4M3WA 5FROA 1HPZA 4AHSA 1IKXB 4C8MA 2YHBA 5HBMB 4IR1A 4FLWA 4N76A 3KLGA 4KV8A 5JS1A 2VG7A 4J9KA 3HT3A 4R8UB 4IH5A 1WSHA 1JLFB 2WOMB 1Z26A 3KLIA 4M3UA 2D0AA 1HNVB 2PZSA 4O3QA 3PUFA 3PW0A 4UQGA 4ZP8A 4FVMA 3C6UA 1T03B 1TP7A 3DOKA 1RT1A 1BHLA 1N6QA 3AVKA 1REVB 4DU4A 3DLHA 4CHOA 2YNFB 4BDYA 4J9PA 4E7JA 4YR0A 3L2WA 1KHWA 3NHGA 1VSHA 4N41A 3CVKA 3AA5X 3ULDA 1S9EB 3HHKA 1LWFA 4F8RA 1C1BB 2ITGA 1JLCA 4Q0BA 1BISA 1TKZB 3K57A 3KLHB 3BDPA 3OHAA 1MU2B 3I0RA 4QWAA 3QO9B 1RT3B 1KTQA 1NK0A 1TKDA 1VRTA 2W8KA 3D5MA 4OGEA 1TK5A 1NKCA 3NF8A 3MAQA 5KT3A 4NRTA 5F9LA 4JRQA 2X74A 4CCHA 3JSMA 4CEEA 1XHZA 4EYHB 2KW4A 3SCXA 4PA1A 1RT7B 3DRSA 3M9NB 1BGXT 4NLRA 4O0IA 4ZVFA 5FRMA 3Q8QB 1BI4A 1R0AB 4OKEA 2BDPA 1TL3B 3PO5A 3OYJA 1L5UA 3T5JA 1N5YB 4WZQA 4J2DA 2RDIA 3RWUA 3OLBA 3TARA 2GBZA 1S97A 2HNYA 4NLPA 4M45A 4FLTA 4ZPCA 1KHVA 2G8VA 4QOZB 4I2QA 3V1RA 2C2DA 4EP4A 2B43A 3MFIA 4QW8A 1A5WA 3SQ1A 4X2BA 3AO3A 5KFTA 5I42A 5CY4A 4DL3A 1RBUA 4KI6A 3D45A 3Q8SB 4W5OA 3B6OA 2FVQA 4MFBA 3QIOA 3VQ4A 4E7HA 1HQUA 1HMVA 4CIEA 1S6QA 5FDLA 1S1TA 4IOBA 3K59A 3NCIA 3IRXB 1SH3A 2XRIA 4YR2A 3NGZA 2C22A 3MECB 3PW4A 1N48A 5T14A 1S49A 1RTJA 3I0SA 4E7IA 3DRRA 4CJPA 4DTMA 3ISND 3CJ0A 2RDJA 2XY5A 4RNHA 2AQ4A 4PQUA 3HPOA 4J2AA 4CJ3A 2HHQA 2Q3SA 3SPZA 4CERA 3IG1B 2FLLA 4GMJB 1ZETA 5DQHA 4MH8A 3BQ2A 3GIKA 4CGHA 1VK0A 4FJXA 3OL9A 4FJ7A 1W9HA 3BSOA 5KTQA 4O4GA 4FS2A 5K14A 1JLBA 4WYWA 1JKHB 3MEGB 1RTHA 3RB4A 5EU7A 1BCMA 1S1XA 5KG7A 3MTKA 4FK4A 4EO8A 4TYAA 3MXJA 2D41A 3DYAA 1K1QA 4B9VA 4NCAA 4KHRA 3AO1A 2PYJA 1JLQA 3BSAA 4NLVA 2J6SA 1S1UA 1NK4A 2HHTA 3PR4A 4K50A 4O3SA 4CK3A 4ICLB 3LP0B 4DFPA 4FJ9A 4CJRA 4XO0A 3KHGA 2JEIA 4GC7A 1U4BA 2F96A 3KHLA 2BRKA 4DTUA 3RBDA 3IGNA 4YNQA 2XWYA 3QIPB 4ECQA 3WNHA 5SZTA 2B4JA 1D9FA 2IM0A 3AVBA 1D8YA 1S4FA 3UR0A 2R2SA 4ED3A 1X9MA 3OHBA 5CYQA 3GILA 4Z0UA 1S6PB 3CG7A 1RT4A 4N47A 2BE2B 4FLXA 3TAPA 3V6HA 2W9BA 4W5QA 4PY5A 2B5JB 2YKNA 4I9LA 1G15A 1BQNA 3A2FA 1ZBLA 1WSEA 2W9CB 3LPUA 2WCXA 3BSCA 3CDUA 1Q9XA 4JRPA 2R2TA 3BQ0A 3E01A 4DL2A 1KVBA 2Y1IA 2RF2A 4RNNA 3N6MA 2WHOA 4GC6A 4CHNA 5J2QB 3P83D 1S1WA 3MR2A 4OKJA 3KKRA 4DFMA 3RR7A 4MK9A 3KD5E 5F8NA 4RW7A 2HWIA 2XGQA 3DLEB 4KHNA 3DLKA 3HK2A 4B08A 1IKVB 4DQPA 4ECWA 2AX1A 4K4TA 4QWCA 4IQXA 2JC0A 5KFPA 3V6DB 4DLGA 4KHUA 1C0UA 1JLGB 2IAJA 1GX6A 1NK7A 5I3UB 4H54A 2UUTA 2W9AA 4Z4EA 2B6AB 2WONB 1IO2A 1VSFA 3EZ5A 2AWZA 2WB4A 3M9OB 3AVGA 1QE1B 3EY1A 4IG3B 1S0NA 1L3TA 1ZBIA 4DTOA 3L3VA 2OPPB 3G6YA 1QAIA 1TVRB 2FLNA 2P5OA 3GIMA 2E4LA 4NLSA 3K58A 5J1EB 2AGPA 4JLHA 4F4WA 4NLTA 1HPZB 4CJLA 4FJGA 4FK2A 4Y3CA 1QUVA 3VQ6A 5KG6A 2QV6A 3HSTB 1TQLA 5C25B 1L3SA 1EXQA 1RNHA 2VG7B 1SUQA 3NH1A 1HQEA 3V6KA 1NJZA 1CXUA 1VSLA 4G1QA 4WFZA 3KLIB 4XIUA 3V9SA 3PX4A 2XC9A 1SKSA 1KVCA 3LAKA 3CYMA 3TAQA 1EETA 3AVAA 3C6UB 2YNIB 3LP3A 1CZBA 2FBVA 3GIJA 2IDOA 1HNIA 3H5YA 4DU3A 3HVTA 3PJXA 4LH5A 4O44B 4Q5VA 4KE5A 4DLEA 4EZ9A 3RRHA 4KO0A 1F21A 2R8JA 1SKWA 4ED2A 3GYNA 2IGIA 4FLUA 3ZSXA 3T5LA 2C2RA 2FJWA 4CF9A 4PUOB 1RAJA 4U7CA 2R8KA 4DTXA 2E9ZA 4CJEA 1RDRA 3C6TA 3IS9A 4RW8A 5HRSA 2ZE2A 2HHUA 4O3NA 2V4QA 3T1AA 2DPIA 2I1RA 3KK2A 1JLCB 4Q0BB 3SUPA 4LH4A 3SFUA 5KFAA 2GC8A 3NAIA 4JV2A 3I0RB 3S3NA 4ZP7A 1GOAA 5F8JA 3NF9A 1C0TB 4H4OA 4DTPA 1VRUA 3DOLA 5F9NA 2XO7A 2UUWA 4LQ9A 3NGIA 2OPRB 3P5JA 3HYFA 4WYLA 5DGAA 3JSMB 3CJ2A 4M42A 4DSKA 4NRUA 3LZJA 1QAJA 4KHMA 1W25A 2HB5A 4NYNA 4CFDA 3K5MA 1EP4A 4PWDB 1RTIA 3AVHA 3G6XA 4C8KA 3MEDA 4F4YA 4W5RA 3MR6A 4ECUA 4HUGA 1LWCB 3DM2A 4ED8A 2GIRA 1RDDA 3PZPA 4ZMMA 1MMLA 2HNYB 2WK4A 4W5NA 3H59A 2XHBA 2D7SA 2OPQA 1UAXA 4TSXA 2OYQA 2BANA 3OYFA 1D0EA 1A5VA 3U3YA 2FLPA 4FW1A 1HRHA 1TAQA 2F8SA 4IKFA 2CJQA 3DLGB 4H4MA 5KFLA 4MKAA 3OYAA 4DTJA 5L1IA 5KT4A 5T7BA 3V9UA 2KFZA 1JXLA 2C28A 4OVLA 1HMVB 3QESA 2OH2A 3SYZA 1X9SA 1D1UA 4CIGA 1S1TB 3HL8A 4DMNA 1WSGA 5HP1A 5F8GA 3CIZA 3FQLA 2HNZB 1HARA 4LSLA 4KHWA 2JEGA 4C8NA 3I0SB 3RAXA 3DRRB 3AA2A 3V9WA 3Q8PB 3ZSYA 4FLZA 3M8PA 3L2VA 5KFKA 3TANA 3RBEA 4RUAA 3NF6A 4B3OB 1JLAA 5J2NB 3GIIA 3LANA 5KFWA 1JLEA 1U04A 3SQ0A 5DLGA 4B8CA 4F3OA 3DLRA 3V81B 2XI3A 3H5SA 1T3NA 4WE1A 1X1PA 3OL6A 4RNOA 4IR9A 3LP2A 3V9ZA 2VG5A 3NFAA 4O4GB 4B9UA 5EWGA 4NCGB 3DRPA 3T5KA 4RW6A 1UWBB 2JLEA 4Q43A 1S1XB 1WSJA 4KAIA 3L2RA 3I8DA 1VSJA 3K5OA 5D3GA 1KFSA 3T3FA 5KFNA 2GIQA 3NBPB 4MK8A 1JLQB 4DS4A 3H98A 2V9WA 4I2PB 4AILC 4Q45A 1S1UB 2RPIA 3QEVA 2KZMA 3NF7A 4B9SA 4NYZA 4M3ZA 1TKXB 1FXXA 3FQKA 3RMCA 4FJNA 3QERA 4MQ3A 4LSNB 2F8TA 1TV6A 1RT6B 1GOBA 3S9HA 3OS2A 2GUIA 1IM4A 3VA3A 1VSIA 4HCBA 3G0ZA 3VQPA 4FK0A 2KZZA 4BWMA 3SJJA 4IFYA 4K4XA 3G86A 1HYSB 5HROA 1T05A 5L1JA 3RB0A 2I5JA 5KFHA 4TY9A 3H4DA 4OGCA 3RMAA 4CEOA 5CYQB 4DL4A 2LSNA 4FZYA 4FLVA 4I7FA 3MEEA 2JEJA 4ZP6A 2VG6B 2W9BB 3V9XA 2WTFA 4Z4HA 2YKNB 3CJ3A 4U6PA 2YV0X 2IC3B 3H5UA 1J9AA 4KREA 3VA0A 4M94A 1ZBFA 1IKYB 1LV5A 3RR8A 3E01B 4IRKA 1KVAA 3PY8A 4ELUA 2IBKA 4DG1A 1RYSA 1RBRA 4R5PA 1TKTA 1ASUA 1B9DA 4DFKA 2R2UA 3QLHA 2P5GA 3KOAA 1S1WB 1Z25A 3AA3A 3LP1A 3ZT1A 4K4ZA 1BL3A 4CECA 4RW7B 2OA8A 1CXQA 3WNGA 2AX0A 1L3UA 1LWEA 3DLKB 1J5OA 1Q8IA 2ETJA 5C42A 1DLOA 3KLEB 3KJVA 1C0UB 4Z4FA 2IAJB 1LAVA 5KT5A 3M8RA 1J53A 1S1VA 4QW9A 3CM5A 2FVPA 1DTQA 4RW4B 3QINA 4JUZA 1KSPA 2YKMA 4FM2A 3PW7A 3AO2A 1TL1A 3ZT4A 2ASDA 1EX4A 3KMQA 1RDBA 2FJVA 2NUBA 4DS5A 3M8SA 3H5XA 3O3HA 3OYLA 4QWEA 2KFNA 3EZUA 5CYMA 1NKBA 4ID5B 3V4IB 3KKSA 1X9WA 1VSDA 1XHXA 4YP3A 1B92A 1NHUA 4RZRA 3TR8A 3BGRA 2R7YA 3N6LA 3TABA 1B9FA 2G8WA 4ED7A 3HM9A 1HQEB 4DL5A 3NGYA 2FJXA 3ITHB 4ZVEA 2ILZA 4ZPBA 1T94A 3PR5B 1CLQA 4N5SA 5J2MA 3AVLA 3KHHA 3AA4A 1IKWA 2DFFA 4B9LA 3D0PA 1IKXA 1BQMA 2YNHB 3QGGA 1UA1A 1HNIB 1RT5A 1RYRA 2BRLA 5HBMA 3HVTB 1TK8A 3LDSA 3IGVA 5KFYA 3NL0A 4O3RA 4CK1A 2C2EA 2R8HA 4M3TA 4KO0B 3HP9A 1JXBA 5DG9A 3HVWA 4NLOA 3IAYA 4IDKA 1S9GA 4IFVA 3KMSA 3V6JA 4CEDA 1NK5A 2QK9A 3C6TB 3IS9B 4FM1A 5FRNA 1T03A 3KK2B 4DQSA 5KG3A 3ZSRA 1S48A 4W5TA 3ICLA 4NYFA 2YNFA 3SNNA 3UDLA 2FBXA 3DDKA 2ASJA 2RKIB 2FVRA 1GX5A 4HKQA 5F8IA 3Q8RB 4E19A 4OLAA 1SL2A 3KLHA 1MU2A 2DPJA 2V0NA 2IM2A 1T8EA 4ELVA 1RTIB 5HLFA 1FK9A 3FFIB 4DTRA 1C1CA 4O3OA 3B6PA 3NAEA 2DFEA 2HNDB 4Y2CA 3C94A 4F4ZA 1LW0A 4DEZA 4EO6A
chains in the Genus database with same CATH superfamily
1ZM9A 2AEJA 4OPKA 4ISEA 4CK2A 4WFYA 4F4KA 3I82A 1AUSL 1QHTA 3BO3A 4CBUA 2BANB 4MIAA 1RCOB 3P38A 1RDCA 3VQSA 3SCJE 2PBDA 3SAHA 5CZVA 3G10A 3NGRA 5KGXA 3K89A 1CSJA 2D69A 3KJNB 2PY5A 4DX6A 2E1AA 1DTTA 3P1GA 2H3GX 2HHHK 5LSRA 4AHVA 3PJ9A 2CQ3A 2GQCA 4EBEA 3IFEA 1U1LA 2ZH6A 3A4TA 3CD6N 4YMEA 5IQQA 2HBLA 1WSVA 3PSFA 2AEFA 2W4CA 2DPNA 3J81O 1OQ6A 2C2NA 3P39A 1N4LA 1BHNA 1NSQA 2D3O1 2KJWA 3OL8A 2CNNB 7AT1B 5KFJA 2JGUA 4ES3A 3OXLA 3MECA 4C8YA 2F8MA 4CI6A 4X4QA 4AF1A 1RADB 3QEXA 3M6VA 2P6TA 2HS3A 2JVRA 3WQUA 1KVKA 3DXKB 5JVHQ 4CF1A 4PG4A 4RW6B 3NAHA 3HD2A 4LRAA 2UUAK 3NGSA 4I6WA 2QKKA 2DITA 4TNOA 4BBYA 2ZM6K 3IG1A 4DV2F 4J7CA 5THWA 4DBQA 2E88A 1RT1B 3GSDA 2LU2A 4LD0A 1NB2A 4HTIA 2BQRA 2FXUA 3VQQA 4QYZJ 4WZMA 1PO6A 3RRGA 4DR3F 1DFDA 4KRFA 4HUEA 5K8MA 4CJWA 4ZA1A 2ZHBA 2OTLN 1LWFB 3DN9A 1L3VA 4E1JA 2R2RA 4HACA 3ETMA 4OYWA 1YBTA 1WNEA 1RAGB 1XMQK 1UVNA 4LFBF 2Y1JA 1CZ9A 5AQFA 5F8HA 3LDLA 2CQGA 3QNWB 2YVSA 3DU6A 3CCSS 3A3NB 2GAGC 3C6AA 2PAVA 3LP0A 2ZD1A 4WP3A 3RB3A 1UJ4A 3M30A 3L3UA 1OKJA 4AQYJ 3TYTA 1U0SA 3RSEB 3G8TA 2MGZB 5IV4A 1QAYA 3SUOA 4LQ3A 3WIUA 4U8YA 2J0SD 2DTUA 5KI6A 4YORA 3R27A 3ZTSA 3MM6B 4M5IA 2XMUA 3IR6B 1K6YA 2P9SA 3CD5A 1RWPB 4DL6A 3D6FB 2A10A 3W3SA 1S6PA 3DMJA 1W7WA 2P8IA 3AO4A 1GMWD 4LT6A 2B5JA 2FGCA 3W3DA 4ER8A 3K5PA 1HLUA 1AW0A 5BRDA 5HQ8A 3T19A 4G9ZA 3PJWA 2XMTA 1YTAA 2VQFK 1VIOA 1VFJA 2Z4PA 3J81U 3MR5A 4DFJA 1I94J 2HZVA 1YRTA 2E1YA 1QSYA 1JL1A 1DLOB 1XWLA 2HWTA 4FYWB 1NAQA 4OV1A 5HMZA 3RMDA 4BC5A 1BU6O 1SI9A 1SKRA 1VBZA 4B9NA 1Y10A 5D15A 5JLFA 5KFDA 2HF3A 5HATA 3CQXA 3G71N 3CMEN 1RLDA 3JSBA 1Q82T 4CTAA 4D3GA 3TX8A 2B7CB 4WJBA 5HSPA 1JLGA 2F7TA 2CDRB 3M2RA 1GT8A 1I6JA 1L3KA 4ILRA 3PYGA 2J0QD 5I3UA 4OX7A 2WONA 5EX3A 4ED4A 3ZSVA 3NNCA 3MURP 1GMWA 3DWLA 4E98A 3QZ7A 3HMJG 3B6BA 4Z2XA 1BO5O 1U49A 2XZWA 2WBNA 4CGGA 2KG0A 4ENOA 1E6YB 2UVRA 5EXWA 4XPEA 3E66A 2A40A 3I8BA 4ANEA 5FLXY 3QGIA 5L38A 3UFCX 3W65A 2JZ5A 4JI5J 3NNHA 4JKBA 4J9UE 1P8ZA 4DU1A 3O9TA 3SJHA 3CPWM 3AVNA 3KK3A 4BRDA 2DO0A 5DQIA 4GKKF 1UMJA 4DUYJ 2VV5A 1YBUA 3H4BA 1EX8A 3ZZUA 2DFHA 1N36J 4ATNA 4ZHRA 3NDKA 3EZOA 3L2UA 3TAMA 5IC6B 1DY3A 4O44A 1YT3A 1FJGK 1ZBHA 2IS3A 4AHUA 3D28A 2HHSA 2K3KA 4CJKA 4ZTJA 3ZZTA 1VQPS 3GOIA 3BDEA 1GH8A 1O5JA 3G6ES 1TYQB 2EFNA 1TUYA 3C8YA 2JH3A 2FY1A 2J9EA 4NWBA 2E2QA 4KTZA 3S3MA 1RT4B 4F2SA 4YDUA 3G9CA 5HLFB 1C0TA 1FKPA 2CKWA 2JFDA 2OPRA 3SV4A 5KFFA 1Q7YO 3CCMS 3KG0A 3QIDA 3CJ4A 3E51A 3IMXA 2ZWPA 3VQAA 2NSCA 4HYKA 3OR1B 2ZVIA 2YCHA 5LJ5Y 2MQMA 4CM2A 4O3PA 5KG0A 4PWDA 4NLGA 4IEIA 4PEOA 2KFYA 5IT0A 2B8PA 4CESA 3MMVA 5KFQA 3K0JA 5DM6Q 1JXEA 1QVGR 2FLOA 2NUHA 3AJDA 2DIUA 1NJXA 5DLFA 4B1VA 2D3UA 3HCXA 3ATUA 2RHKA 4ECXA 2E6MA 4HCCA 4LBIA 3QMQA 5KG5A 2EKNA 4R0JA 4KB1A 3I5BA 3C19A 3THXB 2J76E 3CERA 3D6RA 2K1RB 3AVFA 3ILLA 2ASPA 2O67A 3P5TL 4CLLA 1HBUB 3U6FA 2AP6A 3KK1B 5M1QA 2V2VA 1OS5A 2L9DA 1FD2A 5KFIA 1NEEA 2D3ZA 4ZLNA 1YBAA 6AT1B 1VHIA 2C42A 2ILYA 2U2FA 3QYYA 4PL8A 1VGYA 4KH4A 3GJRB 2B9WA 5J2NA 4RNFA 1LW2B 5D4NA 2IDEA 4DKWA 2XG8A 5LY3A 1EAYC 5A8RB 3QBWA 2OGUA 4TY8B 5F2RA 4BRGA 4U67L 4RPFA 3HHLA 4PG5A 1VOMA 4NLQA 3EYZA 5JVHL 3IC1A 2W8LA 1R27B 1HNVA 2C3UA 4RX6A 4OHXA 3OJSA 4RW8B 1ELOA 3HULA 2ZE2B 3UKRB 3V1OA 1QTMA 1IBMK 4N7TA 4M95A 3D2FB 1P9QC 5JS2A 5F0WA 4BLGA 3W7BA 4QWBA 3N4QA 2LQ9A 5CA5A 2WBRA 3D6TB 1NH8A 5HI7A 2HHWA 4OPJA 4HHHA 3OBYA 3OTBA 2AYMA 4BE2A 4DR2F 1TKZA 4K7QA 4Y1DA 3NKYA 4ZCMA 3PHEA 5AR0A 2BE9B 3KNAA 3QO9A 5E41A 4OZ1A 3F73A 4O0JA 4IH6A 2EVZA 5B0BA 2O3DA 3W62A 1WTFA 3ZZZA 3E2EA 3D2EA 2DHGA 1N52B 4M8LA 2W40A 2CQ2A 4LF7J 4KIAA 4KHSA 2M7SA 3KHRA 2BR0A 3ZT0A 4ECZA 1RXOB 2XWXA 2FC0A 2V8PA 1YITN 4U7UK 4FM0A 3VENA 3AVMA 3U1NA 1VI7A 4GMKA 2X51A 4FJ5A 5AQRA 4JKDA 1VSKA 4DSFA 2BUPA 3BYRA 4CEZA 1CJTA 5K20B 1FA0A 1F1BB 4MO4A 3NH0A 3NMUA 4CH0S 5B09A 2CVEA 4NEZA 3QETA 2HAIA 2P9PB 5IWAF 4O5BA 4F4XA 5KG4A 1U24A 1TL7A 4LSLB 1XBWA 2FBYA 1N88A 5D77A 4EP5A 1C2PA 4NLYA 4ILLA 2Z2ZA 3W5ZA 4M3RA 3MCNA 8AT1B 1PILA 3OVBA 3F2KA 2LXFA 2RHQB 4CYUA 2VA2A 2LDYA 3F41A 3R6MA 3TZZA 4WE1B 3CJAA 1P27B 4IRCA 1EWRA 3DOMB 4ELTA 2AF6A 4M5LA 1RBOB 1RCHA 1NHVA 3I5AA 4JV5F 5JVGQ 1VQKN 1YI2N 3OSPA 1SB6A 5D0GA 4QYZK 1VQON 2R7RA 1J54A 4F0HA 1RBAA 3TZWA 4KGMA 3ULEA 5C0YA 4KB0A 1YJUA 4UF4A 3OS1A 4PG6A 3SI6A 3ENVA 2M3DA 3BY5A 4DQRA 5BPNA 4FF2A 3V1QA 4RU9A 2ALZA 3MEGA 3W9HA 1M5OC 1U1OA 1IR0A 2P9LB 1WAFA 3PVXA 3O4WA 4H0PA 1U2VB 4DHVA 5C24B 4DV5F 3U4LA 3OW2R 2ACYA 1UPPA 2IY5B 3FZHA 4J2EA 4AQYK 3H42A 4NI2B 3R9PA 4I1TA 3LOUA 4JKHA 2O8EA 2P2CB 4BC2A 3BGOP 1HW8A 2R8IA 2QEXN 3ASMA 1T9TA 1VK8A 2QC3A 3QEIA 3IDHA 3IN5A 3VF4A 3EGNA 4DV3F 4ZLLA 3QIPA 4X84A 4M7XA 3TAEA 1YVNA 4FKYA 3CC2S 4EUVA 3DXMA 4ECSA 4DWIA 2LDIA 5JXSA 2UXBJ 3WXIA 1HFEL 1DJ0A 2Z58B 3CDWA 3R7SB 4J9NA 4FWNA 1I94K 3BEXA 2ZKUA 2CPHA 3GP9A 1VC6A 4XK8C 4JD2B 3L8BA 2OSRA 4GVMA 3OYIA 1YJTA 2L9NA 5EOYA 3K9KA 3SQ2A 1FF2A 2P9UB 3RU0A 3ZT3A 1Q4RA 2I38A 1EKEA 3ZZYA 2ATQA 4BWJA 5IT9O 1WOSA 2WB1D 4F67A 1OY9A 3M6GA 3J7YP 3G4SN 4ED1A 1KQSR 1YWXA 2JX2A 3ONQA 4CIFA 2DD8S 3CMQA 4EZ6A 1JCFA 4F3MA 4IKAA 5L1KA 5KT2A 1DTQB 3DLEA 2DR5A 2F8EX 4FBUA 1U0HB 2DGTA 4W92B 1K73O 5FD1A 3AGRA 3QFHA 1NSPA 1X4CA 3KJQB 1YZ6A 4M7YA 3V6DA 1HR0J 5LXYA 4CF8A 3H3OB 3OYCA 3PW5A 1S7IA 1NG9A 3TVZA 3MF5A 4OKKA 3THWB 2VD3A 5LMNJ 3TOQA 2BVZA 4BG9A 4V19J 2QL7B 2A3ZA 4JI5K 4DQIA 1FEHA 1KCFA 4KTQA 4FYXB 2VQEF 1K8AT 3OYGA 4XEIA 1X5OA 3BZCA 1HPZA 4DUYK 2AJ4A 3Q8VA 1IKXB 3EM1A 3W0LA 3R2CJ 3AQPA 4C8MA 4IOAQ 3OPKA 2RT3A 4ZVTB 1N36K 3DXKA 3NWGA 3HT3A 4IH5A 3JS6A 5M1FA 1JLFB 2WOMB 1PBAA 3IXQA 1YJWS 4M3UA 2E2OA 4WQ4A 1Y3JA 2YH1A 3MOZA 3H25A 1RLCL 1T03B 4L3KA 1RT1A 1BHLA 2ZWOA 4FXWA 4CZEA 2AMCB 4GV9A 1DKGD 4CHOA 3HKZD 2YNFB 4J9PA 2ATCB 4YR0A 4RBTA 1N33J 2QYCA 1UJ5A 3DDIA 3CVKA 1RWVB 3AA5X 3ULDA 4DPYA 3FEZA 1LWFA 1C1BB 2ITGA 1JLCA 4RLEA 1HKGA 4HT5A 1HD1A 1VQMN 2DR9A 3W2WB 2W8KA 4LRCA 1X4GA 5AJ3J 3PSIA 4OGEA 1R8HA 1WEXA 3CCES 4NRTA 2DXFA 1ZZNA 2V67A 4H0XB 1X3NA 3QAUA 4KQZA 2KW4A 5IT9U 2OFHX 1KAXA 4MO5A 3MCAB 2MGZA 1GEHA 4OX6A 1WEYA 4O0IA 4ZVFA 3Q8QB 2FC9A 1R0AB 2O1PA 2RDIA 1OPZA 1U6ZA 4O5FA 3PFOA 4ZPCA 4EP4A 1A5WA 1RKJA 3AO3A 1AXQA 5CY4A 1NGDA 2R7WA 3C0BA 1N5QA 3EXYA 1U26A 4E7HA 3LDQA 2OIHA 1ZH5A 4CZFA 5LL6d 3PFEA 4DR5J 4IOBA 3IRXB 1FI4A 1SH3A 2XRIA 2C22A 1HKBA 4BRPA 2XYPB 4BRMA 3QJLA 2N4DA 1V6HA 1BOTO 2HBKA 5BYQA 3DRRA 3NY0A 5MLCV 4CJPA 3CJ0A 3VGSA 4TVAB 2XY5A 1ZC6A 2CVIA 4YB7A 4J2AA 1HNWJ 3SPZA 2XQCA 1YRXA 2FLLA 3WEEB 3ETOA 1H2UX 5DQHA 1JWWA 2PA8D 4JI8J 3CW2C 5M2RA 3BQ2A 4CGHA 1R43A 3T1YJ 1C0GA 3PNIA 5EX5A 4NYOA 2EK6A 2VF3A 4OZ5A 4FF4A 2LQBA 5JVGL 3RB4A 2MY7A 2M52A 1BCMA 1WUUA 1N34F 1Y64A 3MTKA 4QS8A 1U8SA 1BWVA 2J8SA 3MXJA 3VEYA 3SMZA 2ZBQA 4WU3A 5IT4A 2HQ3A 2D41A 3ZNUA 2DY9A 4P52A 4NCAA 3EDQB 3A8JA 3WC0A 4RBUA 4KHRA 4HDHA 3S41A 1V4TA 4R25A 1TUUA 4OYAA 1S72S 5FLXO 5GIPA 4AL5A 2C2MB 3E1YA 2BUNA 4PXCA 4DFPA 4XO0A 3H6EA 4GC7A 4FNIA 4YDXA 1SPBP 3V5RA 1ATNA 5GVQA 4OZ2A 2HAFA 3IGNA 5KQ8A 4CT8A 2FHMA 3AFGA 2WSEC 1IVZA 1Q8BA 3CE8A 4LF7K 4NXMF 1Y4ZB 4YY3J 2B4JA 1YXQA 1CULB 1S4FA 2GW8A 4ED3A 1TUGB 1X9MA 4TU7A 3EGVA 4Z0UA 4W90B 1B0VA 3CG7A 1RT4A 3F44A 4JI6K 4FLXA 4LVOP 5M2PA 4CD1A 3PYDA 1G15A 3M2UB 3A2FA 2B51A 2WCXA 2NNWA 2GVDA 2OI2A 2BH1A 3E01A 2FHJA 3JQJA 3KXDA 1KVBA 2Q6BA 3VAGA 1BY9A 2YBVA 3FGVA 3OR1A 4RNNA 4OZ3A 1WKKA 2NRRA 4BY9C 1FWLA 1VRQC 4WWSA 4LF4F 3MDQA 3VTIA 1CJKA 1S1WA 4MLEA 1VQ4S 3RR7A 4MK9A 4USWA 2RS8A 4KHNA 3HK2A 1X5SA 4MYUA 2YI1A 2OEMA 3DRYA 4ECWA 4ZS6A 4K4TA 4IQXA 4KHUA 2IAJA 1NK7A 3CCRN 3ENOA 4GVBB 3BEGB 3FUYA 4DPOA 4H54A 4Z4EA 2W9AA 3MCSA 1IO2A 2H9ZA 3EZ5A 2LQ5A 2YPYA 4OHWA 3A12A 3THXA 2WW8A 2NLWA 2K1RA 1QAIA 2HVEA 1PAEX 2P9NA 1VQ5N 1S76D 4NLSA 3K58A 1HBUA 2WVBA 1WHWA 3QATA 3PIPQ 2ZJRL 2DBBA 1RFQA 2J9DA 5KG6A 3QGPA 3HSTB 2X7IA 4ZJQA 2VG7B 1M0SA 4K5RA 1RWNB 1SJQA 5BREA 1KOOA 4DV2J 1FJEB 4PXEA 5FLXU 4I6YA 2MKHA 3PX4A 3TAQA 4LF8F 3AVAA 2YNIB 2QLBB 1BXNA 1CZBA 2QWLA 3KJFB 3GIJA 1F0XA 1HNIA 3H5YA 2WAQD 1NUEA 3AOAA 3ZETB 3O08A 4QR0A 1DURA 3T41A 4ZVSB 4KO0A 2WZ1A 1F21A 2R8JA 2IGIA 2BTFA 5KQDA 4XH5A 2R8KA 2E9ZA 2FZCB 1RDRA 4RW8A 4DV7J 2VKRA 2ZE2A 3UKRA 3T1AA 4M63A 2I1RA 4J37A 3SUPA 3D2FA 5HK4A 3NAIA 1VIXA 3UVJB 4WP9A 1FNXH 4JK7A 2E5LF 3G87A 1GOAA 4LRFA 2UXBK 1VLYA 5F9NA 1NSKL 3CJ1A 4LQ9A 3FSYA 3P5JA 3HYFA 2MZTA 4B1YB 1FEEA 1A0OB 3U7JA 5F41A 2GO9A 5DDPC 2HB5A 4NYNA 4JK8A 2AT1B 1TMMA 3G6XA 5CR4A 2A6MA 4F4YA 4PKGA 2KRBA 5LJVA 4KR0B 3I87A 4ECUA 3MN7A 1LWCB 4HUGA 1XNRF 4BGBA 1WG4A 2KXHA 3OFEA 1YKWA 3PZPA 2CJ9A 5ADZA 2J7UA 1VC5A 2HNYB 4CZGA 1EHWA 2GZOA 3O9SA 3AD8C 1UAXA 1TMJA 2K8GA 5ITHA 3ZTOA 3OFHA 3KKFA 4EAHD 5HMXA 1D0EA 3LTOA 4FW1A 1HRHA 4U95A 3W64A 1HR0K 2RH3A 4ILJA 5KFLA 6FD1A 5T7BA 5LMNK 2KFZA 2LA6A 2AW0A 3QESA 1X9SA 3SYZA 2P9PA 3HL8A 2UU9F 1W2BM 3V4MA 4ZK7M 4PPZA 1BQXA 3CTRA 4LSLA 3CD7A 3VGKA 2JEGA 4YOVA 3BKUA 3RAXA 3MM5B 3V9WA 3ZFVA 1H73A 4PKDB 3MUTP 4ZVUB 5KFKA 4RUAA 5CXTA 3UI3A 1R8AA 2E1PA 2F9DA 1JLEA 3OQ2A 5DLGA 4IO1A 4F3OA 4AUKA 4PXDA 4X66F 2XI3A 3G2XA 4WE1A 2OMOA 3OL6A 3PLAA 2DNQA 3LGHA 1V5IB 3IWNC 4ED5A 2YWEA 3SCKE 2JLEA 4FWQA 1ZPWX 2LU1A 1WSJA 4KAIA 3D1QA 3TSQA 5A2QY 1N33K 2DIVA 5D3GA 2MB0B 4J90A 2G2ZA 4PG7A 4GKKJ 5KFNA 2A6OA 4CZMA 3FJ2A 4JKAA 1T6CA 1M5PC 4I2PB 3WC2A 4AILC 1RAAB 4Q45A 1S1UB 3QEVA 4B9SA 2CGKA 2HQCA 2IVYA 3M4XA 4M3ZA 1FXXA 3QFUA 3CCUS 1Z05A 4HHUA 5AJ3K 5AQPA 2B56A 1Q8KA 4M5KA 1RT6B 1GOBA 1CVJA 1SJ4P 4L3QA 1VQNN 2G2OA 4DHYA 3H2VE 2ZH8A 1UPMB 4NI2A 4QR1A 3G0ZA 3C7NB 4XTTA 2I5JA 3Q7CA 1YF5L 4TY9A 4CRJA 3RMAA 2M70A 2XULA 3UN5A 1FDAA 4FZYA 1J6ZA 2AJFE 1KP6A 1KEKA 4LVNP 4DDFA 2GMLA 3TNVA 3CCQS 2HFZA 4ZP6A 2VG6B 3V9XA 2CDQA 2MSTA 1J5EK 4HH0A 2CYYA 2IC3B 2FQQB 1XMOF 1J9AA 3ZTQA 1HBOB 2AV5A 1ZBFA 3QJPA 3EVMA 2Q66A 1R6VA 4BROA 1XNQJ 5AQSA 4YS2A 3A5MC 1TKTA 4DFKA 1B9DA 1QZ5A 3NCRA 4PPDA 2ZEJA 1NZ8A 3TZXA 3KOAA 3TEHB 5A8KB 4OJ1A 3UR3C 1LK7A 4RW7B 2OA8A 4X4SA 1CXQA 2AX0A 3DLKB 1ESVA 2E8AA 4DR5K 5HMYA 2ETJA 3TPQA 2JOQA 2MQLA 3SQGB 3VF2A 2P9UA 4MMOA 2HK2A 2KT3A 3TUIC 3D0IE 2VL1A 3D9BA 2F1FA 3CM5A 1F2GA 1NLKL 3RW7A 1HNWK 1DTQA 2D4WA 3M6UA 2VYPA 3KUGA 1VMBA 1U0HA 2ASDA 3KMQA 1RDBA 1D9AA 2FJVA 1MA9B 4JI8K 3T1YK 3EZUA 1Q5VA 2DNHA 1NKBA 2MQNA 1X9WA 2VPZB 1XHXA 3SMPA 4YP3A 1Y7PA 2F9WA 4BC9A 1MWYA 2YJFA 2MZ1A 2RNEA 4IOCQ 1B9FA 5AZJB 2DO4A 3NGYA 2FJXA 3A5NC 2NPFA 1GK8A 3Q2TC 1TL5A 2PFFB 3BS9A 1T94A 1V3RA 2UP1A 1FFSB 4CZCA 4X4PA 3PR5B 4N5SA 4Z7YA 2GGPB 3U27A 4WFNL 4B9LA 5D4LA 1IKXA 3AOCA 3HVTB 2XSFA 3CSKA 3IGVA 5KFYA 1RKIA 5DS7A 3HM8A 1KQGB 4PWUA 1QVFM 1JXBA 3HVWA 3EGWB 5L39A 4U7BA 4DPXA 1DZ5A 2W2MP 3QPIA 5AQKA 3V6JA 1AYEA 2QK9A 3C6TB 3IS9B 1VC0A 2CWKA 1T03A 4YY3K 1GLAG 3IBWA 5DM7L 1WBDA 4MAKA 3NWRA 3ZZRA 3B8HA 2YNFA 5GAHP 1XUPO 2FBXA 5I4MA 3J7A1 1D09B 2KH9A 4DR2J 3B82A 1GX5A 3IM9A 2B9YA 4ZITA 1FRLA 2HFSA 3Q8RB 1SL2A 4ZVRB 2DPJA 2M8HA 2V0NA 1AZSB 2YWWA 2IM2A 1T8EA 1RTIB 5IM0B 4DZ6A 4DTRA 4W4MA 3W2WA 5B0EA 3B6PA 4LRDA 1RAIB 1LW0A 4DEZA 1YZ7A 2QLJB 3BSNA 1HI8A 1F5CA 2RD5C 4F36A 3S3OA 1UEUA 3F0NA 2GHPA 5GAHU 2AJ0A 2KDOA 5EDWA 4JKEA 2KRRA 1UKUA 2MKIA 2BW2A 3BPDA 3OTDA 4WKRA 3KG4A 2RAQA 4CEAA 1RSCA 5E33A 4B9MA 2UVWA 1GOCA 1HBNB 2FSKA 3M8QB 3S7RA 4V1Ak 3GLJA 1HKCA 3EE9A 5IFMA 3RYLA 3DLBA 1HNXJ 4WFAQ 1R6YA 5BR8F 3L2QA 3L4QA 2XZTB 1HX1A 2KT2A 2AYEA 1FKOA 3E9OA 2AGOA 2HGLA 1DRZA 2HVHA 1SQKA 4O4RA 4IFEA 2BBEA 2G4BA 3IRXA 3HTVA 3QT7A 4DV2K 3D6MB 4AM7A 4JV5J 2GJIA 1KAZA 1FDDA 4WQ5A 4FJJA 4DX5A 2QWQA 4CF2A 2B4PA 1T9UA 2VKZG 5H1SV 2IHR1 2F65A 3MEKA 3DRPB 1ZYQA 3HP6A 2XMVA 1Z4UA 1HL6A 3LALA 2V4RA 4QR2A 4YFUA 1PGZA 5ETNA 4FP9A 2LCWA 5AQVA 2UUBJ 1WSFA 2F8HA 1K44A 2QXFA 4DV7K 3BH6B 3RMBA 4CLYA 3F9KA 4CLKA 5KPTA 4MKBA 4IG0A 2DNGA 4E7LA 4CJ5A 2E9RX 4DV5J 1S12A 4FOIA 2X6SA 4Q2LA 2OP5A 1Q18A 2IOCA 3CJSA 5D78A 3SUNA 4K2JA 2YX6A 1YLXA 1DQAA 2BABA 1VRTB 1WI6A 3NVMA 1VCTA 5HROB 2XMAA 1O1WA 1U6FA 3PXGa 1DT9A 2HW3A 4DV3J 4QWDA 3P8BB 2EFPA 2VDIA 1UFWA 2ZHOA 1EQYA 1SH0A 4C7QA 1TUVA 3PEHA 1YVFA 3SK3A 1W26A 1K1SA 1S22A 2QWOA 4YHHJ 4M3XA 2XI2A 4PL7A 4M41A 3BR9A 1Y97A 2CA9A 3K7RA 2RN2A 1IM6A 2BV3A 2J6TA 1RAFB 3N6NA 4R5PB 3NGKA 1NGIA 1WF2A 3M2UA 2OTJN 3PDNA 3M8YA 4LR9A 3Q23A 1JL2A 4YR3A 2AU0A 1LWEB 4OI0A 4CZJA 3IRWP 4FPIA 1FD8A 1F9FA 2NYHA 5C42B 2FIUA 4DV6F 5E0OA 4DSIA 2IMOA 1SH2A 2NSBA 3KJVB 2EPIA 2ERRA 1HJRA 4E0DA 1KBRA 1S6QB 1IBCB 2GJFA 4X4TA 2XBPA 2APOA 4KBIA 2YKMB 2DCLA 4E1MA 3C3LA 2D74B 2ZH9A 4CJ4A 1CJUB 1YX2A 4JKFA 1JQGA 4FZVA 2VA3A 1SIZA 4OZJA 5D4PA 3R5GA 1BA1A 4OLPA 3GE1A 1REGX 5E3PA 3TR5A 1QUPA 3MGJA 5GINA 2O66A 1LAWA 4LBPA 2R7TA 2VQEJ 2D5RA 3TAGA 4K59A 3HSJA 5EWFA 4CEBA 1UTAA 1X5PA 4GKKK 3GFYA 2BOPA 4DZDA 2QMUB 1RTHB 4FLYA 1Y0HA 3QZ8A 1X31C 1UVKA 1BQMB 4BRQA 1Z2LA 3W2VA 2HFNA 5AQMA 3MM7A 4B1XB 1JXVA 3CWJA 3LDNA 1XIQA 3KUEA 5GMDA 5KFVA 3MFHA 1OWXA 4Z4GA 1WF1A 4IDKB 2V5HG 1S9GB 4L72B 4IFVB 1SL0A 4C0HA 2YNIA 2MHNA 3U3GA 2VCPA 4CEQA 1QQCA 4I68A 1V5VA 4RNMA 4FWRA 3ZEUB 2UV8A 4J2BA 1LWXA 2V34A 1FKAF 1RABB 1JIHA 4NLUA 3FK4A 3KLFA 1VSEA 4UY8O 2HLTA 3QQCD 2W2QP 2PE8A 3UVJA 3OR2B 3BR8A 5DK5A 1IH7A 2YX7A 3TA2A 4L3NA 2G8HA 3UKUB 4UZBA 2JWLA 5C2CA 4LRBA 1RA7A 4B3MJ 3VQDA 2N4CA 4NE9C 2E7XA 5AQHA 3VF0B 2X1AA 3CD6S 1VK3A 3SI8A 3CCSN 3VVUA 5HRPA 1R8CA 1LWCA 3CFOA 3RGIA 2JL9A 1H7WA 4IUFA 1U2RA 1DQ8A 3BKTA 3GZ7A 5GAEI 5DG8A 4CGJA 3HSCA 2X6NA 2O4IA 2RE2A 1DTTB 2QX0A 4YB1P 2Z1IA 4F2RA 1NOYA 1CS4A 3NNAA 3RAQA 2QWPA 2LA4A 5EUHA 1NDKA 3LAMA 1BUXA 3GE9A 3N0VA 2IJFA 2RRBA 3A3OB 3TQ1A 2YHAA 1FNMA 2ASMA 3QBCA 3VCDA 3CFPA 3Q83A 2AKWB 4G6VB 2FBTA 2MQ8A 1Q78A 2HRYA 2OMLA 3CCJS 4A8KA 1RT2A 3IBCB 3NOGA 5IOLA 4HI1A 1NDLA 4Q2MA 4L73A 4C8OA 4UUXA 3MM5A 1WD6A 2OTLS 5J2PA 4L76A 4G1QB 2WSCC 1X4FA 4F7VA 3GV5B 1NH7A 5KG2A 1WAJA 3IAS9 4LC9B 3QEWA 5AXKA 1WUAA 3QT8A 4NA3A 4JV1A 2EHGA 4HVJA 4Q44A 2M2BA 2LEAA 2DXDA 3IKMA 1ZTWA 4R8UA 1N34J 2L3MA 4YOYA 4QPXA 1NRKA 3ZSQA 1U2CA 3H2LA 1HJOA 2J9DE 1QHAA 4J91A 3ZX0A 4PWWA 2G8KA 1AA1B 4NXNF 3RZAA 3C95A 3GJQB 2ROGA 4HTUA 4DR2K 4HACB 2VPXB 1KD1T 1FCAA 2DY1A 2DGUA 2F4FA 4H4OB 2HQFA 4I2PA 2CQ0A 4BE1A 4DSEA 3CEDA 4EBDA 3T5HA 1XEZA 3GSIA 1C1AA 1V9OA 1SBRA 5ADXA 5A2QO 2ZD1B 5EWEA 2Z1JA 1S9EA 2E44A 3W8GA 2BW7A 4O0NA 1RT6A 3POTB 5KPRA 4NXMJ 3KUHA 1FRHA 4JS4A 1QQOA 3MEDB 3S6EA 3HZEA 3EE8A 2Q6CA 3DM2B 5M1NA 1QSLA 1P8GA 3DMJB 2FC8A 2V52B 2EW9A 4LFCF 5HVFA 3G71S 3CMES 2VG6A 1RT7A 2OPQB 4IO9Q 1P1LA 3KLVA 2IC3A 1KS2A 5IWAK 5E3AA 2DNRA 2M5YA 1NM2A 1HBOA 5KRTA 4DSLA 2UYTA 2NPIA 4CQ1A 3HVRA 3OYMA 4QIGA 5JMNA 1HNXK 3N4WA 4LF4J 2DRAA 4H4MB 4A8OA 2GWKA 1Q0NA 1UW9A 2DNMA 4DCPB 4L75A 5KG1A 4N56A 2DK2A 1XMBA 1RWUA 2D1KA 2R7OA 4WF9L 4OX9F 1NMEB 3L7UA 3RTVA 3ZCMA 5KFBA 4CJVA 3R5CA 4ERDA 4B3TF 5HP1B 1NXIA 2MZJA 1VQSA 3CQ8A 2KLAA 4L6V3 2UVUA 3SQGA 4Q7AA 3OYBA 4H0OA 2IM3A 1NJIT 4K4YA 3KD1E 1GLDG 4JV5K 3ZXWA 1FTCA 5KFOA 1SXLA 2VFSA 4A47A 3MX5A 4ETXA 1UA0A 4ECRA 3CPEA 2YX4A 5AT1B 2PFUA 3AJ2A 2XY7A 4AFFA 2YHWA 3GG1A 3EXCX 3ATVA 2D0BA 4A8MP 2MXYA 3JXOA 2UUBK 4URQU 5KFEA 2IMWP 1CQNA 1SZ2A 1F6TA 4YB5A 3UDVA 1VQLN 1VLOA 3VQ5A 3HBTA 3P5BP 2YKQA 4DV5K 3KYLA 5AZJA 3MCPA 4CNYA 4GNIA 4FWMA 1RDWX 4DI6A 4LF8J 3KK3B 2VPYB 2DVIA 3HOSA 3TSPA 1PG5B 4M5JA 1JKHA 4IH7A 5A2QU 1U1QA 4H5VA 2GGPA 4MIWA 3FZMA 3M8ZA 5AXMA 2VU5A 4ZHRB 3I96A 3TAMB 3TA0A 4DTNA 5AXLA 3VN5A 2KO1A 1RA6A 2QG9B 2KQ2A 3HF5A 2CRLA 3GIRA 3W9IA 2W6LA 1U25A 1OPIA 4DV3K 2HK3A 4B3SJ 1NJYA 3RB6A 2PMZD 3ILIA 2G0IA 4NX9A 2RILA 3QWPA 1X0FA 4AD6A 3TZYA 4CHYA 1XR6A 3AHPA 5LJ3Y 4DL7A 4ICLA 3NE6A 1NK6A 2E5LJ 2G13A 4BRFA 3AVCA 5BYSA 4I7FB 2YWKA 3CDEA 1ZZFA 1FKPB 1C0MA 4B1ZA 3VWSA 2PT0A 3Q86A 2ASLA 4BRHA 3D67A 2ATLA 2JSXA 3MAHA 3M9MB 2DT9A 2A3JA 5JUMA 3VETA 4WU2A 5H9EJ 1O13A 3SV3A 3BPSP 1N0UA 2QLFB 4K4SA 2BE2A 4HWIA 5IM0A 1XNRJ 3IM8A 1Y5IB 4UZCA 4WXOA 1OVQA 4J9MA 4YQWA 1YAGA 2CPIA 2W1BA 1Z1ZA 3SSSA 2DNPA 4KPCA 3TQEA 5AZIA 2HLUA 3BBFA 2KXNB 2DB1A 3TSUA 4NOHA 1WELA 3UWTA 3F5TA 3SUQA 4F25A 3GL1A 5HANA 2L41A 1VBXA 3FZBA 1S5JA 3WNFA 3CULA 1S1VB 1QY7A 4LFAJ 4DPWA 4WBFA 3LDOA 4X4UA 3GWCA 3WIVA 3K2PA 4CD3A 3R5BA 4JP8A 1HBNA 3M8QA 1X4DA 2UU9J 1Y9OA 2GTDA 1M90T 4ECYA 2YY3A 2VQEK 3AVIA 4RUCA 2NRVA 3BP8A 2F5GA 1CC8A 2B6AA 2IRUA 3V2UC 4M3YA 3PKYA 2IRXA 3UD4P 4IG3A 2Q3PA 4IO8A 3CJKA 3HFKA 1OSDA 4BC7A 3MR3A 4K8XA 4CO5A 4X66J 3IWXA 2FZKB 5CHIA 1RHKB 4X64F 2H4YB 2F4VF 3MN5A 4Y2KA 1S57A 1T6DA 3FCWA 4N76A 3FLCO 2ASOA 3G8QA 5JS1A 1NPPA 1WSHA 1OY6A 3THYB 4JI7F 3EUNA 4HEA9 1HNVB 3PW0A 1GFWB 3R1LA 2CNOB 3MUMP 2DEJA 3CJQA 1U1PA 1T3VA 3W66A 2H65B 2RE1A 2YKOA 3VGLA 3GG0A 1K8KB 4BDYA 2RVJA 1NGJA 1VSHA 2HMPA 2CQDA 3HHKA 1YITS 1BISA 1TKZB 1XK8A 3BDPA 3MM9A 2DISA 2L9WA 1CPZA 3I0RA 1RTZA 3JXUA 3QO9B 1PYSB 1TKDA 1VRTA 2JLFA 3D5MA 5HMWA 3O9QA 3NF8A 3C14A 6FDRA 5BRFA 1TTHB 4CCHA 1QLNA 1Y11A 2I2YA 1JK9B 1E4GT 4USIA 1FX4A 5A0YA 2CPYA 4X65F 2NXEA 1BA0A 3HI0A 2W4DA 5FRMA 4OX8A 2QFJA 1JJ4A 3VHQA 2BDPA 4OKEA 3PO5A 3T5JA 4WZQA 3ZNJ1 2G0JA 3RWUA 1RWMB 3O44A 2ROEA 3GFXA 2ZBPA 5JMVA 4WK1A 3LPEA 1S97A 4FLTA 3CC2N 2FSNA 3U02A 4JN4A 5GAGP 5LL6Z 1IBLJ 1CQMA 5J1PA 2VBXA 4QW8A 4F9OA 2Z2LA 3R5AA 1VQKS 3R5DA 4FYVB 4X2BA 1YI2S 5KFTA 4DL3A 4FWLA 4KI6A 3B6OA 3QIOA 3VQ4A 4JKCA 3TA1A 3MMBB 4JI0F 4HTJA 3NGUA 1S6QA 3K59A 3NCIA 4YR2A 3NGZA 2J8AA 1N48A 1TU0B 3QT6A 4F04B 5BXIA 3I0SA 1K47A 4E7IA 1UVIA 4ZVPB 2VOOA 2PO4A 1P1TA 2X3DA 4RNHA 5TKYA 1SJFA 2HIYA 3HPOA 4C9DA 3QWUA 2Q3SA 1N34K 3NEKA 1NGAA 4I56A 4IZ9A 4CERA 1KVIA 3H2UB 4EGLA 3GIKA 3NXZA 1VK0A 3VV2B 4FJXA 2P9KA 3GBTA 4O4GA 4Y2IA 2PC6A 2BACA 3MEGB 1RTHA 1S1XA 5KG7A 5GADP 3P4IA 5AQGA 1Q16B 2AJ1A 3FFKB 5CD4A 4DUZF 4TYAA 4DN9A 3PHTA 2FPHX 5AQLA 4B9VA 3FBFA 3VEOA 1VR6A 2PYJA 1JLQA 3PG9A 4NLVA 4NXMK 2O8EB 1NK4A 3PR4A 3D7SB 3ET6B 4GV3A 2RIJA 1RU1A 2O8CA 4FJ9A 4RBVA 3KHGA 2JEIA 4OJ3A 3O6QA 3KHLA 2BRKA 3A8YA 1YJWN 3ZEUA 2BA9A 1F5AA 1NSAA 3QIPB 5SZTA 4H4KC 3DXMB 4YOXA 4OYBA 4KYZA 5K5MA 2GNKA 5CYQA 2Y0BB 5GADU 1UAWA 3OR2A 5MLCQ 2E7WA 4MDAA 4LF4K 3PACA 2CQHA 2W9BA 4PY5A 4MYTA 4KJIA 2YKNA 1RGVA 1FW6A 4IDHA 3BN7A 3UKUA 3LPUA 2YJEA 2ZDPA 3BSCA 1NPKA 3CDUA 1Q9XA 2ZITA 4JRPA 2Q79A 3BGLA 2Y1IA 4A48A 1UEKA 3N6MA 4GC6A 3GR0A 3H90A 4CHNA 5J2QB 1ACMB 1XJWB 2BJEA 4USVA 4DCHA 3CCVN 2MZRA 4OKJA 4QZVB 3KD5E 2KB2A 1Y3KA 4AXJA 2MYFA 5HO4A 3JS9A 1U1NA 4CDIA 3DLEB 5DRKA 5B7WA 1MNEA 4N77A 4HI2A 2XZDB 1Q7LB 2XHCA 4QWCA 2JC0A 2JJ4D 3V6DB 1C0UA 5BR8J 2DR8A 2EG1A 1PC4A 1K9MO 1Q7YT 1ZA1B 2UUTA 2LFVA 1OYEA 2AWZA 2MPUA 1LOUA 3M9OB 2M4MA 1QE1B 4C48A 4DTOA 4CO3A 3L3VA 3VESA 1TVRB 3B4DA 3BO2A 3QBXA 2XNQA 3GIMA 2E4LA 4USJC 4QOTA 4CNZA 5J1EB 2AGPA 2FJDB 4LSZB 4JLHA 4EHUA 4LF8K 2P6SA 4G1PA 4NLTA 1HPZB 4CJLA 4FJGA 4ISGA 4U67Q 1EO1A 1R8PA 1EZZB 1RNHA 2COLA 2PI5A 3V6KA 1CXUA 4A8WA 5BN9A 3R97A 1VSLA 4G1QA 4XIUA 2H3EB 2BKNA 4K5SA 1VQMS 2WVFA 3CF5Q 4B3SK 5BPLA 2ZZTA 1H2VZ 5B0CA 2IDOA 1Q1KA 3OUYB 1RCXB 2NLXA 4MLHA 2E5LK 2H5JB 2CPEA 4Q5VA 2QGFB 3M8WA 4DLEA 3RRHA 2IFXA 3OXFA 4LF5F 1UP1A 4LF6F 2DGOA 4FLUA 1F9EB 2GHWA 4FF1A 1WOPA 4ZCIA 2R3VA 4QQBA 2HHUA 4CM0A 4O3NA 3MD3A 3KK2A 1JLCB 4LH4A 3A5OC 3SFUA 1IR2A 5KFAA 1YTYA 4DV7F 2GC8A 4JV2A 3S3NA 2BJ7A 4ZP7A 3NF9A 2XTJP 4H4OA 1NGHA 4DTPA 2XO7A 5H9EK 3E8OA 4GKJF 3MMAA 2CQIA 3FKBA 2VC1A 2WVCA 2YWFA 1XNRK 4A46A 2VHGA 2HFOA 1CG2A 3CJ2A 2V9KA 1N8RO 5AQXA 3KK7A 4HTLA 4DSKA 4NRUA 2QI2A 1QAJA 4KHMA 1W25A 3POTA 3K5MA 2NQPA 4XAKA 1S72N 3AVHA 3LQVA 4C8KA 3MEDA 1FHTA 3DM2A 4I4BA 3L9ZA 1RDDA 1RB0A 2QL5B 1FE4A 3ZO7A 4ZMMA 2IRYA 2WK4A 1PIEA 3H59A 2OPQA 3FC9A 2OYQA 2Z2MA 2UU9K 2QT7A 1OY8A 4DV6J 2DH8A 5CCMA 3DLGB 1ICEB 4H4MA 4BRLA 4MKAA 1FWKA 5KT4A 3JQMA 1QQMA 2GELA 3ELHA 3H8YA 3G96A 2WUSA 1JXLA 1BE4A 1WHXA 3WBZA 5G0RA 3CC7N 1WSGA 4K43A 4X66K 2ZOGA 3Q89A 5HP1A 5F8GA 3FQLA 4ZLPA 3J80Y 4KHWA 4C8NA 3DRRB 1MMNA 4PKHA 2C1EB 4FLZA 3M8PA 3KWGA 1IBKJ 1E3MA 1VQ4N 3L2VA 3P3DA 2XSJB 2CNLB 4B3OB 4EFAC 4UOCA 1IUJA 1N5TA 1HWJA 3W60A 3HOTA 1U04A 1U1MA 1VQ9S 3SQ0A 4B8CA 2K7KA 4DUTA 1O6XA 3H1QA 2V6AA 3T1HF 3LP2A 2KM8C 2VG5A 4Y65A 1PC5A 2DGWA 4DQ8A 3CGIA 3ISZA 4Q43A 2LQJA 5ETVA 3N5FA 2OEJA 3L2RA 1XC3A 2GX8A 5DZ7A 1VHFA 4H5RA 2GIQA 2X3GA 3AB2B 4MK8A 3EE3A 4OI1A 4W98A 2E5IA 2KZMA 3NF7A 4NYZA 4TU8A 2AYGA 2EXUA 3RMCA 2E2PA 3QERA 4MQ3A 4LSNB 4B3RF 1KAYA 3OS2A 2OD6A 2GUIA 1QDUB 3VA3A 1CBKA 1VSIA 1JJ2R 4FK0A 2MJNA 3TTFA 2DHSA 4ES1A 4KBOA 1XMOK 1HYSB 1T05A 5L1JA 3RB0A 3OTOF 3H4DA 4OGCA 4CEOA 1PJ5A 4DL4A 2LSNA 2X1BA 1PYOB 2FD2A 4FLVA 4QYRA 4I7FA 4A2AA 4YN3B 3MEEA 2JEJA 4DR1F 1WG1A 3O5TB 2WTFA 4Z4HA 3TJAA 4C1NK 4U6PA 3SMSA 2GVDB 1NMDA 1IKYB 4YDDB 3TJ9A 1SJ3P 3E01B 2MLYA 3CCRS 1MLAA 2H48B 2P9GA 1IBLK 4IRKA 4DG1A 1RBRA 1WSRA 5EY4A 1XNQF 4DV4F 1CJKB 1KQKA 1S1WB 9ATCB 3JAMO 4ZN3A 2N7YA 5T41A 4K4ZA 4FWPA 1UW4A 1Z6RA 5C12A 2VJVA 3WNGA 1J5OA 3IAM9 1KTVA 1R0BG 2MKSA 1KKHA 2IAJB 1LAVA 5KT5A 1IWAA 1J53A 2QL9B 1S1VA 3WXMB 2FVPA 3UCUP 2E5HA 4RW4B 4CZLA 3HI9A 3AO2A 3ZT4A 1EX4A 4OI3A 3QAEA 3DHXA 3O3HA 3OYLA 3N4PA 2P9NB 3R8EA 1SVDA 1P6TA 3L6QA 1MW7A 2YTCA 4WCEL 3T6JA 3Q0AA 1I51B 4BRAA 4YOWA 3VR1A 2PIIA 3HX9A 3CCZA 3HM9A 3ITHB 3HD1A 2VJUA 1B64A 3WXKA 3CDAA 2AJ2A 2W25A 3SEOA 1IKWA 2VGNA 2DFFA 2A1BA 2ZHAA 1HNIB 1RT5A 1K73T 4M5HA 5E7OB 4TKTA 3I33A 2HIQA 2RS2A 2ZKTA 4M3TA 4KO0B 2NRHA 2G0CA 3THYA 3IUCA 5DG9A 4NXNJ 5AFUA 3DJCA 3KMSA 4CEDA 2CFXA 3CF5L 3TW0A 4YOEA 1FX2A 1S48A 5B0FA 2GVZA 3ICLA 3UO0A 2I9SA 1K8KA 3SNNA 2EWHA 3KVGA 4CZIA 3O3LA 3EVWA 1QVGM 4HKQA 2HYIB 2FJEB 4O8KA 1YJNN 3LW5C 4ELVA 3MD1A 3JAMU 4ES2A 1FK9A 4BVPA 1UCNA 3FFIB 2DNLA 2FUG9 4KGKA 2MJUA 1C1CA 3CCUN 1M1KO 4O3OA 1YIJN 4WFBL 2MLZA 2W7AA 1RWWB 3EKUA 1IQZA 4FXVA 4LFCJ 3KFWX 3JSYA 3CC4S 4K4UA 2Z2YB 3OV7A 4J9LA 3DC2A 3DI6A 1GLFO 2V8VA 4ZPDA 2F9JA 1RTDA 5BR8K 1GTEA 4B02A 5C2FA 3CCQN 2ZH1A 4LR7A 2VB6A 4HL9A 4OJRA 2AJQA 5EN1A 5ADXH 2J4RA 4CJQA 4F3TA 1U8WA 2BQ3A 4OX9J 2QW9A 2Y9HA 4IYQA 2G8UA 3BZKA 4B3TJ 4FZZA 3MXIA 3VZIA 2IA0A 2F7VA 1SV5B 1RI7A 1HNXF 3PYEA 3TTDA 3BV8A 4Y0FA 4KKOA 2BJDA 3CXCR 4A8FA 4KFBA 1OQ3A 2HHHJ 5B08A 3RJMB 4JI4F 4FXDA 1DBDA 3MMBA 1EWQA 1GNKA 2R7QA 5KFRA 4UOFA 1T02A 1JLEB 4DJBA 3VPZA 1HWIA 2R7XA 5K8PA 3MWPA 2ZUGA 5FJ4A 1UETA 3PO4A 5AQNA 1C4AA 4KV8B 4M5MA 2KHOA 4JHDB 4UTGA 1MSWD 2GV9A 2OANA 2DGSA 1NK9A 3J7ZO 3DHWC 4B8AB 5L8RC 1ULRA 3JB9k 2ZVSA 1VQNS 3GCXP 2DXEA 1ZPVA 3BBCA 5D3GB 4KGVB 3FDSA 1N6QB 2OO4A 1LCUA 1SAZA 3BF1A 4DCJB 3Q8UA 3VGTA 2UUBF 1BWFO 3D68A 4IWVA 1UVLA 4RW9A 1WSIA 5C2DA 3QNOA 4QIVA 3GYGA 5CQGA 2EFOA 4A2BA 2BGGA 2N3OA 4H5WA 5F3TA 2OPSA 2E2NA 1SJ1A 5C15A 2J6UA 2CZ4A 5LT5A 5LSOA 2VWJA 2GUPA 1HHTP 3LH2S 4DR6F 3ET6A 1JCGA 2I5JB 2YNGA 2BJ8A 2B7BB 3F56A 3ALYA 4CO0A 4QIWD 5C5JA 4FJMA 4ECTA 2Z1GA 4DV0F 1NDCA 4K0KF 2FYXA 1I3AA 2V68A 5AQTA 3K5LA 4RG8A 5F8MA 2WBMA 4H0TB 4YHHF 3AO5A 4FJKA 3SCIE 1YSJA 4UW2A 3I55N 1TKTB 1NJWA 4DV6K 1AB8A 2HMIA 3H0PA 5H1SQ 5B8HA 3A8IA 5GADI 1FWPA 1V3ZA 1JJCB 5LXRA 4USMA 4KHYA 4ZP9A 4ETZA 2ZGYA 3UQSA 4P9SA 3NLCA 5I42B 4WIQA 1NCLA 3VMFB 5J2QA 4MFBB 1RUSA 2Y8WA 2XCPA 1HQUB 2HQIA 2VBWA 1IBKK 1HWUA 2QYGA 1ZXOA 1S0MA 4BC4A 1U1KA 3A0IX 1S4EA 3QRQA 1U7LA 1R31A 4Z4CA 3IBFB 1RTJB 2W7PA 2HBMA 2UXDJ 3CI5A 3KIOA 1RZMA 1SIWB 4H5TA 3ENQA 3MHYA 2OEKA 4PQUB 5A6WA 3TI0A 2ZJRQ 4OL8A 3FSXA 3NGDA 4JYAF 3U8XA 2Q1LA 2MQQA 3OW2M 3VQ9A 5HN0A 1QE1A 4C4WA 1VJWA 2QTWA 2HQGA 1ASVA 2IJRA 4X64J 1TVRA 2F4VJ 1NOZA 4EBCA 3W61A 2RQ4A 4IJNA 5I3QA 1MG7A 5J1EA 3J7YU 4HHTA 2E5GA 3TU5A 3SLCA 4JI7J 2J0WA 2BM0A 3AD7C 4O55A 3M32B 5KFUA 4MJKA 4J9QA 4CGFA 2MZQA 4O23A 5KFZA 3TUJC 4EYIB 4OYPA 1WKJA 2JNJA 4ZIVA 2N3LA 2CJYB 4P2MA 4PXBA 3J8AA 5HRRA 3OUYA 4FYYB 3KZBA 4IBNA 5EX0A 3MK6A 5AQJA 2B9XA 1F2HA 4BCAA 4YEAA 1TELA 1NHKL 3MAAB 2Q43A 3VGMA 4WPAA 2R9LA 3QJJA 1W0HA 2C2KB 3M1FA 3WT0A 5F0UA 3FEYB 5E84A 4RTFD 1KQSM 3BREA 3NMRA 3WXJA 1ZAXA 2HHXA 1I3OB 4FJHA 3W1YC 3NGTA 3MR7A 3MMJA 1LW0B 3SCLE 4X65J 1Y5NB 3I9V9 4B3MF 4G65A 1HPMA 3JTNA 4H0YB 1KLMA 1B7YB 2W4PA 1SC4B 2O8DB 5KT6A 3NOCA 4DB3A 4HVZA 3JYTA 1S59A 4PABA 1WG5A 2EC0A 5M1PA 4X62F 5KFSA 5HRNA 1GMVA 4CO1A 3MN9A 3FR0A 4DPTA 1NNDA 2B4VA 1XR5A 1UOCA 4ECVA 3DLGA 4RR5A 4RWTA 4V19S 4JI0J 5L9XA 1FKOB 4CLWA 3NS5A 3R3TA 2GQ2A 5BYRA 4LJMA 2HBZB 1WTBA 5CHCB 2VWKA 4H0VB 2BQUA 1KDNA 3SPYA 1W7AA 1KOHA 5SUHA 3O80A 5F8LA 5C10A 2C3MA 4J8FA 2XSJA 3PX6A 4F4AA 4B3OA 1WI8A 4LUBA 5KT7A 3BH7B 3HKWA 4EMDA 3U1LA 3J80O 1EETB 2E6LA 1U48A 2RQKA 2UXCF 4NXNK 1EJ7L 2VH7A 2DNZA 1F5BA 1Q81O 3LWLA 2V7ZA 2GS8A 3TVKA 1VQ7S 3MOJB 4RUBA 4USHA 2LECA 3D54A 1D9DA 3KTQA 3PX0A 2KTQA 4IG0B 1S9FA 1VQ8N 4DUZJ 1U47A 3RW6A 1UEVA 2QA2A 2VFVA 3M7VA 2W6KA 4DR7F 1K0TA 4AHTA 4EI2A 4BR5A 4FBTA 1Y00A 2D0OA 4KPYA 3JTPA 3VAMA 1REVA 5KFGA 3D1OA 5CE3A 4FVUA 5DO2A 3OTCA 2RUSA 4FJ8A 2QE5A 2XS7A 3CJCA 4P2FA 1BCOA 3AD9C 2XY6A 1H7XA 3OBIA 1S0OA 2OTJS 2DNYA 4RL1A 4LSNA 2CJKA 1RILA 1OH8A 4LFCK 2KU7A 1NKEA 4FJLA 1EP4B 1RT3A 4KH6A 4AHRA 3CCLS 5IT9Y 1HYSA 2F9TA 3AV9A 3KDNA 1A9NB 2GCFA 3AODA 3DU5A 2P9CA 4IRDA 2QM1A 3IP0A 5CD4H 4CGDA 3SQ4A 1Q9YA 1DQ9A 5E26A 3OL7A 2XGPA 2E1CA 4JI2F 4M5DB 3MN6A 4OX9K 2CQBA 4QS9A 1UFKA 3ZZPA 3ID6A 2D0CA 1TL3A 4WFXA 1R59O 4B3TK 5EGYA 1IKYA 1N5YA 3FRZA 2G1DA 1YJ9N 2A1SA 3CFRA 2MY8A 3OTEA 2PEBA 4J9OA 3I9ZA 1QAXA 1KRPA 4KGXB 2FB0A 4C6AA 2VUGA 4TN2A 1ASWA 4U96A 2W7OA 2C2OB 2D1CA 5AE1A 2YQ0A 1U6BA 2EX3A 2AZ1A 3CIMA 4DQQA 4K4WA 3GONA 4I6AA 1M5KC 3EL2A 4GV6A 1FO1A 2QLWA 5CAAA 4QAGA 2HVZA 4OYZA 3OYKA 4BR4A 4OLBA 1CJVB 3K5NA 1ITGA 2HHPA 4LMZA 2FF3B 3A8KA 1JLAB 3J80U 1N54B 1MWQA 3M6WA 1N0VC 4P7TA 2FZGB 2CPFA 4ZPTR 5L1LA 3OYHA 4FNHA 3BYPA 4RW4A 4CVNE 3HPHA 3ZLJA 1PJ6A 1WC3A 3U1MA 1O8BA 3AB4B 4UY85 4J5OA 5E5NA 1YJRA 1XI1A 3VQ8A 4USTA 5ETPA 4LF9F 4I69A 4WFNQ 2HHVA 4RWWA 1B3TA 3OS0A 1N56A 3W2VB 7FDRA 3R6GB 3EJMA 3MM7B 2DEIA 2AA4A 1HW9A 3R1HA 5ELZA 5LJWA 3ITHA 3CCJN 3G82B 1SQGA 3PYFA 1M5VC 2WRMA 4X4OA 2AEMA 3DLLL 2DRDA 1RBSA 1A5XA 4Z37A 3N28A 1QQNA 5DM7Q 4CJUA 4LF5J 4LF6J 3CB4A 1TV6B 2AP1A 1HQ2A 4CT9A 3GR1A 2ZQBA 1NK8A 4TXSA 2FHKA 1AFIA 3GG4A 1KNZA 4MIBA 1T0TV 2JHEA 4IFYB 1HD0A 2W2NP 3NVKA 1QD1A 4B3SF 2Z1HA 5CZ2A 3KLFB 2W42A 2P1JA 1KXPA 1WC0A 3EDRB 2RB7A 4TLRA 1RWXB 4GKJJ 1XQSC 3TUPA 3PCOB 1HNZF 4MKVA 1CLFA 2JEFA 2OZMA 3GYXB 3CPWR 4OZNA 2OAUA 4FW2A 1YTUA 1EARA 3LM2A 1T9YA 4URSA 1PAUB 1HUXA 4DX7A 1QTNB 4I67A 3H7HB 3GU0A 1TGOA 2AIRB 4JKGA 2KT5A 3R6LB 3G6VA 3QLHB 3FFIA 3UPFA 3ENBA 2R7VA 2B4UA 2CJAA 2G1HA 3FZKA 4L74A 3C16B 5DZ6A 4I9QA 1KN6A 2CJXB 4XPCA 4RWXA 1HYVA 3SIPB 2JRSA 4JS5A 2IYIA 2DJWA 5BRHA 3QGHA 1FRMA 1VDHA 2KYZA 4PR6A 3FSIA 4UQTA 4EEYA 1WHYA 2EKYA 1BLUA 3BZQA 1IG9A 4AH9A 3O3FA 2J7WA 1U45A 2UXDK 2CQPA 5KOXA 1YHQS 1CS4B 5DETA 1LQ9A 3H40A 2PMWA 4DV1F 3OY9A 4U7UD 4LFAF 4CI0B 1IKVA 4AHCA 1GQEA 4CIOA 4J9VA 4WIIA 1S10A 2QWRA 4KH0B 4ZOSA 4BS2A 5CYMB 1MWZA 4X64K 4HDGA 4ZVOB 3GTYX 1RT2B 4S0MA 2F4VK 1H1VA 3SAGA 3FBEA 2DKOB 1SV5A 4NZ0A 4DR4F 1T9XA 1I5OB 3BGRB 1YJ7A 2L08A 1MWKA 1VQ6S 1SL1A 3GV8B 5J2PB 1RAOA 1F60B 3DRXA 4JI7K 3CJ8A 3KNGA 4C8LA 3P4UB 3VAKA 4IOXA 4I6MA 5J2MB 5TKWA 1GTHA 4EU0A 4M3WA 3T1HJ 4TLQA 4OYMA 2DRBA 4AHSA 1D4XA 5LOQA 3P96A 2YHBA 4IR1A 4FLWA 3LUYA 4KV8A 4Y0WA 4JI1F 4JHDA 4R8UB 3KLIA 5D6GA 2D0AA 4NA1A 3ZYYX 3A8EA 3EKSA 2PZSA 1YDLA 4O3QA 3PUFA 3L3CA 4ZP8A 3TWZA 1RU2A 3C6UA 3I56S 3OBWA 3DGVA 4H5NA 1WDDA 3J7AN 1N6QA 3AVKA 3ENHA 3Q22A 4LIRA 1T9WA 3DLHA 1FVQA 1UZHA 1MROA 4E7JA 1KHWA 5B0GA 1LXNA 4CW7B 4B3RJ 1S9EB 2DGVA 2O8FB 4Q0BA 4IXCA 3OHAA 1MU2B 3OHRA 4OZ0A 4X65K 1KTQA 3OTOJ 1A7GE 4ZVQB 3GCWP 5CCLA 2E20A 1NKCA 3MAQA 5KT3A 4PZVA 5F9LA 4JRQA 2RUGA 4DPUA 3MMCA 4DR1J 3JSMA 1XHZA 1F3VA 2CH6A 4OI2A 1RK8A 4PA1A 1QM9A 1R89A 1GXUA 4BRIA 1RT7B 2HBQB 2Z8QA 4HHJA 1BGXT 5M1KA 2ZF5O 1BC6A 1URRA 4CZHA 1UVMA 3OYJA 2CZVC 1L5UA 4KHPF 3G25A 4A59A 4P10A 3OLBA 3TARA 4DV4J 5FPDA 2RQCA 2BJ3A 2R4FA 4JI0K 4QOZB 4BRNA 2NRWA 3L4BC 1G7CB 3V1RA 3HHLD 3O5BA 4C97A 2KYXA 1S7HA 2B43A 3MFIA 3SBTA 3E9LA 2QA4S 5CZXA 2ZBRA 3SQ1A 1IBLF 2DGXA 2VZ9A 5I42A 3VQTA 2NRTA 1VQLS 3Q8SB 1RDUA 4MFBA 4K41A 3MWBA 2LP4A 1S3XA 1HQUA 3FVYA 3EGZA 1HMVA 4CIEA 3AARA 3FMWA 1S1TA 3L7PA 4DL0C 3S8SA 1FERA 3CD0A 2C3OA