1R0AA

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 138
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1r0aA05
4I7FB 3NAIA 4IRKA 4WYWA 1NOZA 1TP7A 1C0UB 4WZMA 1SH0A 2P1JA 1S9GA 3SZ2A 4KFBA 2P5GA 4LY7A 3MR5A 3N6LA 1VSJA 2Z1GA 1RA7A 4O55A 4FJMA 4ID5A 3QGHA 4BACA 3V6DA 4RW8B 1VRUB 4RNMA 1RNHA 2BGGA 2F8SA 5J2PA 2HWHA 4O3PA 4XPCA 1RTJA 3JYTB 2W8LA 3ZSOA 3DMJB 1NKCA 1LAWA 2OPSB 2DTUA 3CM6A 5CZ2A 4ZTJA 1RTDB 5KFNA 4IFYA 3BGRA 3CQ8A 4Q45A 4DS4A 1VSKA 1QAIA 2IGIA 3KLHA 1XR7A 3ZT2A 3L3VA 1N4LA 3PJWA 2GC8A 1CZBA 5KTQA 4J9RA 3TAGA 1NK0A 4DU1A 2IAJB 5C42A 4QPXA 1U48A 4KTWA 3NHGA 3FSIA 1BGXT 3QIOA 4BWMA 4J9OA 4EEYA 2R8HA 5L1IA 4Q8EA 4CEDA 1F21A 4NYNA 2XRIA 1EX4A 2W42A 3QEVA 1DLOA 4O4GA 3KOAA 1QE1B 2YNHA 3H40A 1TL1A 1S97A 2HW3A 3BQ1A 3VQEA 3M8PB 2KFNA 1VRUA 3SYZA 4JV0A 3L2WA 1HNVA 3BSNA 2XY7A 5I3UA 2HNZA 4DEZA 4NYFA 3L2UA 2WONA 5KG4A 1C1CB 2XGQA 3RMCA 5FRNA 4DTNA 4FK4A 4UQGA 1C1BB 3G0ZA 3HVAA 4Q8FA 4ID5B 4LQ3A 2ASJA 1RTHB 5KFSA 2OPPB 4K4TA 3BGRB 4F4XA 4ZPBA 2P5OA 2KTQA 2VWKA 1J5OB 3AVBA 4E1MA 3NCIA 5SWMA 1TKZB 2G8VA 2WB4A 5DG7A 1S10A 3PR5B 1BISA 2FVQA 1I3AA 4IDKB 3NF9A 2PYJA 4LQ9A 4GMJB 4O3QA 3NL0A 3VN5A 1BQNA 1K6YA 4Y2CA 4PUOB 3PW7A 4ECYA 4FJ9A 2DPJA 4FVMA 3CJ5A 3MXIA 4ZMMA 3KNAA 3TAMB 1S9EB 2ZD1A 3OS2A 3EZ5A 4DQPA 1IM4A 4YR3A 3RMBA 4KAIA 2XCPA 3MTKA 3VQCA 1RDDA 5KGWA 1GOBA 1GX6A 3AVMA 4W5TA 1LWFA 4CFCA 5KFVA 3AA4A 3VQ7A 4H8KA 3A2FA 4ZVHA 3D5MA 2QV6A 3BR9A 4WE1A 3H08A 3LWLA 2HHXA 4TXSA 2YV0X 3DLEA 1SL2A 3TAPA 4Z4CA 1JLBB 4EP5A 4OGCA 2HHSA 3OJSA 1C1BA 1TL3B 4CJ5A 2G8WA 1WSHA 4DL5A 2FLLA 1ITGA 3EY1A 4TSXA 2EC0A 3SI6A 2V0NA 1T03B 4ECZA 4O3SA 4CJKA 4ED6A 2P51A 3IS9A 2YNIA 4TYAA 2BR0A 1LW2B 4AHSA 3H2LA 4IH5A 3QNOA 5HRNA 2IM3A 2J6UA 2VG5A 2ZD1B 3FQLA 4CJLA 3AVFA 4IDKA 3V9UA 1S6PA 4KO0A 3KK3A 2D3UA 3K5OA 4FJIA 5KFAA 4RZRA 2ZKUA 1S0NA 5DLGA 3NAEA 3QEPA 1TK8A 2GIQA 4EP4A 3M8QB 3KLGB 3DRRB 3DM2B 4CEFA 4DLGA 3OL8A 4LSNA 3UR0A 2RDIA 4FBTA 2WK4A 4DQRA 4B9TA 1N6QA 1EXQA 3MXMA 4IRDA 3KHHA 4J2BA 4JLHA 1ZTTA 2RF2B 4NLQA 4DTOA 2OPRA 1SL0A 1CZ9A 4M42A 3NH0A 4HCCA 3TAEA 4ECSA 4F2RA 1JXLA 3THVA 2V9WA 3OL6A 3U3YA 4DTJA 5CYQA 4WXWA 4GC7A 3E01A 4QCLA 4NCGA 4LH4A 1RTIA 3HL8A 1JLEB 5CY4A 1YT3A 4DL6A 4ZP6A 3DRSA 2FBVA 2V4RA 3KKSA 4PUOA 5KG3A 3H5YA 1C2PA 4ZP7A 2BRLA 3DLBA 3H4DA 1LW0A 2ETJA 3PHEA 3OYBA 3NGIA 1RT3A 1C1AA 5F8JA 1KVBA 3U3GA 3S3OA 2Q3SA 4KV8A 2FVRA 1HARA 3T1AA 3QO9A 3N6NA 4DFPA 1IKXA 5KI6A 3RB3A 1CSJA 4KHRA 2WRMA 3ZSRA 4CF1A 1SKWA 1WAJA 5KT3A 3AVJA 4YR2A 1TKTA 1S6QB 2J6SA 4CEZA 3OHAA 5EWFA 3B6OA 2D0AA 1TL3A 3CJ2A 4R0EA 4XPEA 2RPIA 1TK0A 4FZZA 4Q0BA 1X9MA 4B8AB 1RDBA 1JKHB 1K1SA 1FKPB 1A5XA 1VSEA 3H5SA 1UWBA 4B9UA 3PW5A 3SUOA 4CGIA 3MF5A 4E19A 2ALZA 4FS1A 3G6YA 1GOAA 4ECUA 4IG0A 4PWDA 5T14A 3SQ4A 4BWJA 4OJRA 4RW9B 2W9CB 4C8OA 2XGPA 3LPTA 4G3IA 3CJ4A 4KHNA 3DYAA 3V6KA 3OLBA 5HP1A 5F9LA 3ZT4A 4KHQA 2ILYA 4ECWA 2FVPA 3M8RA 2E9TA 4FBUA 4QWEA 2AX1A 1RYSA 5HRRA 1NKBA 4J9KA 2ZE2A 3I5CA 4KHSA 3TQ1A 3QO9B 3SFGA 4WFZA 4CHQA 4FJ8A 2YKMB 2F8TA 4Q5VA 1KVCA 3DM2A 4G1QA 4CF8A 5KFLA 4DFKA 1Q9XA 1HMVB 3MEGB 1N5YA 4J2DA 2D41A 4EYIB 4KTZA 2FBYA 5KRSA 3OYCA 4H4OB 2D5RA 1BIZA 3RAQA 4CJVA 4DG1A 4FW2A 3WNGA 3VQSA 1S48A 3ITHA 4DSEA 3KHRA 4CJSA 4CERA 2G8FA 4J9NA 1HPZA 3PJXA 1LWEA 3RB4A 3RRGA 4FLYA 5KFGA 4O4GB 3QLHB 3KLFA 1L3TA 4KTQA 3I0RB 4ZVGA 3OYIA 3TWHA 3NGZA 1IKXB 3BSCA 4ZTFA 2XHBA 2JEGA 1SV5A 3N6MA 4AHRA 4YQWA 2YHAA 3DLGB 1XR5A 1ASUA 3WNEA 4DSKA 4K4YA 2FVSA 3OY9A 4DL4A 4NZ0A 2HHWA 2R2TA 3PX0A 3KK1B 1QS4A 3HO1A 1JLQA 2OPQB 2WTFA 1HNIB 4E1NA 3CFRA 1ZBUA 2A1SA 3OYHA 4IBNA 4U7CA 4N76A 1S1UA 4NRTA 2R8JA 4ECTA 4FJHA 2W9CA 2O5DA 2OPPA 4CJWA 3NAHA 1WN7A 3LALA 3NF6A 1UA1A 1Z25A 1QAJA 4GC6A 3GIKA 3RAXA 1CXQA 1S5JA 3GQCA 2W9BB 4WXOA 4EBEA 5KGXA 4FJ7A 2BANA 1B92A 4TN2A 4Y3CA 5CYMB 4CGGA 1VSIA 1KLNA 4DG1B 1X9WA 3ISND 4IH6A 5KFCA 4IOBA 3CM5A 4PA1A 5HLFA 1L3UA 1HQUA 4CEBA 2IS3A 1RT5A 1KCFA 3OS0A 3KHGA 3SQ0A 1LWEB 1T8EA 4KFBB 3VA3A 3JSMB 3Q8RB 4DTSA 4DS5A 1VRTA 3AA5X 4ELVA 3MECB 3EZUA 3NKYA 3T5LA 1CXUA 2R8IA 3ZSQA 3O4QA 4KAZA 3D45A 4WZQA 3NDKA 4NLUA 3U6FA 3SUQA 2D3ZA 2YKNA 1FKOA 2C2RA 2DFFA 1NOYA 5KFEA 5KFBA 3DOKA 4E89A 4OKEA 2AX0A 3V81A 3TANA 3V9SA 1HNIA 1U4BA 4CF2A 1C0MA 1T03A 4Q43A 4ED7A 3V6HA 4FLWA 3T5HA 5J1EA 4F50A 1S1WB 4CHOA 4DQIA 4N5SA 3IAYA 3FRZA 1WSGA 3AVIA 5F8LA 4CJRA 1MU2A 2UVVA 2DPIA 3P5JA 3CO9A 3VQ9A 3SCXA 3KK2B 1S6PB 2FBXA 1BHLA 4NCGB 1KHVA 3NH2A 5C42B 3K5MA 2XI3A 4R5PB 2AGOA 4FZYA 1DTTA 2ZQBA 3MECA 2OA8A 5KFUA 4FXDA 5D3GB 3AV9A 3NF7A 4B9LA 4ECXA 1TKDA 4XO0A 4M3YA 3CDEA 4W5RA 1BCMA 2FBTA 2WOMB 4KV8B 5I42A 1TL1B 3QETA 4K8ZA 2HHUA 3NBPA 3OVNA 4ED1A 4CJFA 4NLYA 4Y1CA 4OPKA 1FK9B 5C5JA 3AO4A 3DRSB 3V9WA 5L9XA 5KFWA 2UUTA 5HBMA 1BQMB 3HPGA 1JLGB 3FDSA 3GV5B 1TAQA 3HSTB 4J2AA 1I6JA 3SFUA 1KVAA 1RAJA 1FKPA 1N48A 5DMRA 4CGDA 4C8LA 4CJQA 1QSLA 3LANA 4KRFA 3L8BA 3C6UB 1JLFA 4KKOA 3CJ3A 3DOLB 3VQQA 3KTQA 5F8GA 2WONB 1SUQB 4QWAA 3O3HA 4H4MB 3ZSXA 4CEQA 1VSLA 3KK2A 2FVCA 2QK9A 2HNYA 5HP1B 3BDPA 4EYHB 4TY8B 4ID1A 3RB6A 3T5JA 1WNSA 4M3UA 2IC3A 4FLTA 5JXSA 4MIAA 4RUAA 1RBVA 3I5AA 1RDAA 2HNZB 2HNDB 5KT6A 2Z1JA 3F73A 2KZMA 4YFUA 2FC0A 4CJ4A 3RBEA 1GX5A 4BE2A 3KMQA 4Z4FA 1KHWA 3PX6A 4NLDA 1O1WA 4MFBA 1RT2A 4HTUA 3M9NB 4DLEA 3V1RA 2G8IA 5F8IA 4IKFA 3LP1A 3QIDA 2AGPA 4LSLB 1NNDA 2YHBA 3GIIA 3LAMA 5L1LA 1TKZA 3C6TA 4M45A 5KT7A 4KB7A 3AO5A 3S3MA 2GV9A 4ZVEA 4CJTA 2R2UA 4CHPA 2IMWP 4DL2A 2IM1A 4IKAA 4RNFA 2YNIB 4B9VA 1NJXA 5FRMA 3FFIB 1LW2A 3PO5A 2XO7A 4MKBA 5KT2A 5K14A 3V1QA 2GIRA 2AU0A 5KFHA 4H4MA 2AWZA 3AVNA 3QNNA 3H4BA 5DQHA 1JLAA 4CK3A 4XIUA 1U49A 2F8EX 3VQ6A 4K4ZA 1T7PA 1K1QA 4E7JA 4Y1DA 4NLXA 2HB5A 5DG8A 3SUPA 3M8SA 4MH8A 1REVB 3VQPA 1RTJB 3JYTA 4KI4A 1HYSB 3KK3B 1RT4A 4J9PA 4WE1B 1JLCA 4IH7A 2OYQA 2RKIB 5KRTA 4CJUA 3ZSVA 5JUMA 1LWCB 4QOZB 3ZSYA 4IG3B 3LPUA 3TI0A 3SJJA 3SPYA 1HYZA 2PYLA 4F3TA 2X78A 4OKKA 3G10A 1HQEA 2CKWA 1WSIA 5CYMA 5KFXA 4B9NA 4MFBB 2RF2A 1S1TA 5J2QB 4MK8A 2E9RX 1RTDA 4MQ3A 1EETB 2IDOA 5HLFB 4AILC 3EPIA 1XHZA 3GILA 5SZTA 1QSYA 3DLHA 3LP2B 5DG9A 1U47A 3ZT3A 4KHYA 3DLGA 5DLFA 1VK0A 1RT3B 3P1GA 3AVLA 2D0CA 4R8UB 4DQSA 2E6MA 2YNGB 4FLZA 2QKKA 1VSMA 2IOCA 2X74A 4KHUA 4FJKA 3HP9A 2KFZA 3KLVA 4NLGA 1HRHA 3OL7A 3DRRA 4I2QB 4K4UA 4FCYA 3GIJA 4EBCA 1ASVA 4CEOA 4E7IA 1W25A 3V4IB 4WFXA 2XC9A 3HJFA 3NGDA 4TLRA 2R8GA 4CHNA 1HQEB 2B5JA 3G6XA 2CJQA 5KFRA 4K4WA 3QEXA 3BSAA 3PY8A 1JKHA 4DTRA 5KFDA 3OYNA 4IRCA 1RBRA 2C28A 1C6VA 3H5UA 1JLAB 2G8HA 3UQSA 2IJNA 2JEFA 5KFPA 1D5AA 1ZBIA 3DLRA 2FJWA 2ATLA 1CLQA 3PW2A 3AVKA 1DTQA 4F4ZA 2OZSA 4W5NA 1XI1A 3L2VA 2O4GA 4E7LA 4L8RB 3Q8QB 4RG8A 1FKOB 5EWGA 4LD0A 4O3OA 1DTTB 1QE1A 2YNHB 1WLJA 1BQNB 4Z4HA 1RT1A 1QQCA 2O4IA 1RT7B 1JLCB 1I39A 3RB0A 4RW4B 3OJUA 1ASWA 2IJFA 2VG7B 2I5JB 2ASDA 1Y97A 5EWEA 4IG3A 1S0OA 2WOMA 4K4SA 1N56A 3HVWA 1HYVA 3AVCA 3BQ0A 1L3SA 1ZBHA 3NE6A 3AO3A 5JS2A 5CZ1A 4RW9A 3GV7B 4KE5A 5J2NB 3TR8A 1LWCA 3B6PA 4URSA 4NYZA 4KHWA 4EZ6A 5T7BA 1RILA 2VA2A 3UIQA 3OHBA 4DFJA 4PWDB 2W7OA 3G86A 3PR4A 1R0AA 5C24A 1LV5A 3OSNA 1YTAA 2AJQA 2B5JB 3KMSA 3QEWA 1NK5A 1NK9A 1HPZB 4O44B 5DGBA 4N41A 3V1OA 4HKQA 3SV4A 4RW6A 2B43A 4I9QA 2HNYB 4K4VA 4KSEB 3IS9B 3I0RA 3Q8SB 1W9HA 2RN2A 1JIHA 4KPYA 1RBSA 3T5KA 5KFIA 1L5UA 5KG5A 2D0BA 1S1VB 4TQRA 1SUQA 1IKYB 2R8KA 3RMAA 1ZBFA 1UAXA 2HHVA 5KG6A 1NHUA 3AA2A 4DTMA 3PV8A 3CYMA 4QWDA 1HJRA 2HAIA 3KLFB 3HHKA 1JL1A 5FDLA 4AHCA 4F2SA 1VSFA 4H54A 1RCHA 4KB0A 3AVAA 3RMDA 4FLXA 1KFDA 1ZBLA 3S9HA 1DTQB 3K5LA 3QZ7A 1JLGA 1VSHA 1D1UA 2OPSA 2OPRB 3IGNA 1SH2A 4FYDA 3NMAA 4ELTA 2W9BA 1OS5A 3KK1A 3ICLA 3F9KA 3ZSWA 3AA3A 3E01B 2I5JA 3IRXA 1S1XB 3OLAA 2C2EA 4DWIA 1JLEA 4LH5A 3SUNA 1FXXA 4KB1A 3CG7A 3H59A 2AQ4A 4DMNA 1L3VA 3OYFA 4KREA 1T05A 5KG7A 3PX4A 1XR6A 3HM9A 1JL2A 2IC3B 3HT3A 3OYGA 2PZSA 4ZPAA 2YNFA 4O3NA 1LW0B 1XWLA 1T94A 1REVA 4NLRA 1NKEA 1KTQA 1N6QB 3KLHB 1RT4B 3DI6B 2W8KA 1KFSA 1NK8A 3HXMA 4QW8A 3VA0A 3K2PA 1RTIB 4E0DA 3QIPA 1QTMA 3C95A 5HROA 3S3NA 1S1WA 2FJXA 4Q0BB 3AVGA 5HRSA 5J2QA 2RDJA 3RWUA 1KSPA 4RW6B 3KLIB 2UVWA 1EETA 4Z4IA 4CESA 1VRTB 4K50A 4RW7A 4O3RA 3C94A 4NLTA 4B3OB 4CF9A 1J5OA 3FFIA 1HQUB 4Z4GA 5HRPA 1S9EA 1EP4B 1KLMA 1J9AA 5KFJA 3OS1A 4R5PA 1TKTB 3MR6A 1C1CA 3V6JA 3BSOA 2Z1HA 1B9FA 3LP2A 5F8NA 5KFMA 3RTVA 3TAMA 4AHVA 5I3UB 3CFPA 4E7KA 3HK2A 2HVIA 5FDLB 3SI8A 2YKNB 4ZPCA 4FZXC 1U09A 5I42B 3LP0B 3EPGA 4O0JA 3MR2A 1Q8IA 1T05B 1T3NA 5EUHA 2WHOA 4AHUA 3GV8B 3M9MB 4DF4A 5KFFA 5KFZA 4NLOA 3UPFA 4FJ5A 3QERA 2XCAA 4CJPA 4CHZA 3DDKA 1QHTA 3MEGA 4KI6A 5J1EB 2DFEA 2BQUA 2WCXA 3KLEA 1MMLA 4F4YA 4ED2A 2C22A 1QUVA 4HUEA 4QWBA 2IM2A 2Y1IA 3I0SB 3LDSA 4NRUA 1SV5B 4ELUA 4F8RA 1BQMA 2B6AA 3CWJA 4NCBA 4BDZA 3AO1A 4MKAA 3LAKA 4BDYA 4CK1A 3WNHA 4MK7A 4URQU 2ZE2B 2IBKA 4RUCA 1NJYA 1SH3A 1TVRB 1B9DA 4M94A 4FJLA 1RT7A 3QESA 2Z1IA 4RW8A 2XY8A 1NHVA 3DOLA 4M95A 5FROA 2LSNA 2DFHA 1KLMB 1RYRA 4FM1A 2JLEA 4CE9A 4DSIA 3VQ5A 1SKRA 1TGOA 3Q8PB 3HVTB 3OYEA 2J6TA 3AO2A 4F4WA 3QIPB 1FK9A 1RDCA 4ZP8A 3O3FA 1JLBA 3QGGA 4FK0A 5E41A 5L1JA 1BIUA 1WSFA 3HYFA 1R0AB 4ZVFA 5KG1A 1TQLA 3L2RA 2EX3A 4AHTA 4E7HA 1RT5B 1JLFB 4RW4A 4M3XA 3KLGA 4M3RA 4CEEA 2VG6A 2HNDA 4B9MA 4J9QA 2VG5B 3PZPA 1A5WA 3OYDA 4JS4A 3MAQA 5C24B 2R7YA 1ZETA 3VQ8A 3O3GA 3DRPA 1NJWA 1QSSA 1VSDA 1RT2B 2OPQA 4FM0A 3LZJA 4CCHA 3M8QA 4JRQA 2XY6A 1BL3A 4CIGA 3K57A 4O5BA 3KD5E 3DOKB 4FJNA 4DQQA 4ECVA 1J54A 4OLBA 4CIFA 5EDWA 1HNVB 4EO6A 2HVHA 3IGVA 4ZPDA 4CFBA 4JRPA 2FLPA 2HMIB 2BQ3A 4IR1A 4QWCA 3KJVB 4AH9A 1D9FA 2B6AB 1ZTWA 2A1RA 3SNNA 3C6TB 3V81B 1S4FA 4FLUA 4HUFA 2B4JA 3M9OB 4IR9A 3H98A 4ICLA 1TV6B 1Q9YA 1WSJA 1IKWA 1X9SA 1S0MA 1TKXB 3CDWA 3L2QA 1NK7A 1WSEA 3HVRA 3K59A 4R8UA 4EZ9A 1IO2A 4TY9A 4NLPA 3DRPB 1JXEA 2E4LA 1RA6A 4O0IA 4B9SA 3IG1A 2VWJA 4O4RA 2BE2A 4WFYA 3QZ8A 5J2MA 3V9ZA 3L3UA 3OSPA 3OYJA 3ALYA 2I1RA 3V4IA 4KHMA 1WAFA 1RT6B 5F8MA 1D9DA 5C25A 2YNFB 4FM2A 4ECQA 3E51A 4CJEA 5DQGA 3MEDA 3KJVA 2XI2A 3PVXA 3HP6A 3NBPB 3SV3A 4HYKA 4JV2A 4CGFA 1S1XA 1S49A 4RNHA 4Z4EA 2HWIA 4U6PA 4F3OA 2ILZA 2JC0A 3AVHA 1C0TA 3DYAB 5L1KA 2IA6A 1IKWB 4RU9A 4QAGA 3VQAA 4BE0A 1C0UA 4CHYA 4CIEA 4C8NA 2HHQA 2VG6B 1GOCA 3QYYA 3IRXB 4HHTA 1HMVA 1N5YB 4K8XA 4CF0A 3OYAA 2OZMA 1XHXA 3MEEB 4KO0B 1RBUA 4OPJA 3KD1E 4I7FA 3WNFA 4B3OA 3TAQA 4H4OA 4Y2AA 4CECA 4EBDA 2UUWA 3H5XA 3UDLA 2X6SA 1JXBA 3TARA 2EHGA 1NJZA 4G1QB 3PO4A 2JC1A 3FQKA 2DY4A 2ASLA 1IKVA 3G6VA 3ZCMA 5HBMB 5EU7A 2E6LA 1IH7A 1XC9A 3MFIA 4DTPA 3BJYA 3ISNC 2F96A 3ZSZA 4DU4A 1S1UB 3V9XA 3LP0A 4CFAA 3DMJA 3PUFA 1SL1A 2IAJA 1EP4A 1S9GB 4DL7A 4N47A 2BRKA 2IM0A 1RT1B 4RW7B 2BANB 4KKOB 4DTUA 2HHTA 3KLEB 3LP3A 4M3WA 1Z26A 4ECRA 3SQ1A 4DSJA 2R2SA 3TVKA 4LSNB 4FLVA 4MK9A 5DGAA 3TABA 2NUBA 3ZT1A 4CFDA 1TVRA 4PY5A 3QINA 3KKRA 1D0EA 2VA3A 3TAFA 3OYLA 1LAVA 4ED3A 4O44A 3RBDA 2VG7A 1S1VA 2Y1JA 3D28A 3VQDA 1BI4B 4B08A 4CEAA 3MEEA 4Q44A 3SPZA 4LSLA 1U45A 4FS2A 4M3TA 2JEJA 4JUZA 1G15A 4N56A 1RTHA 2C2DA 4TQSA 5C25B 2KQ2A 2PY5A 5J2NA 4GW6A 5KG2A 4OGEA 2W9AA 4GVMA 5F9NA 4J9MA 4I2PA 3ZT0A 1IKVB 3I0SA 4PQUB 3LP1B 3MEDB 1IKYA 1YTUA 1WNEA 4IG0B 1UA0A 4ED0A 4HCBA 5F8HA 3OL9A 4FW1A 3I5BA 2RKIA 2XWYA 4OKJA 4FJJA 3NH1A 4NLVA 3SQ2A 3T19A 2D7SA 1C0TB 2BDPA 1U04A 2JEIA 3ULDA 4NLSA 1UOCA 3MR3A 3D0PA 4B8CA 3NGYA 2YNGA 2W7PA 1S6QA 4IFVB 3DLKA 3RR7A 4ED8A 4X2BA 1RBTA 1KRPA 1EKEA 2FLNA 3M8PA 1TK5A 2QXFA 4WYLA 1IG9A 4KBIA 5D3GA 1J53A 1ZYQA 4W5OA 4ZHRA 4HVJA 1TAUA 1UWBB 4M41A 5HROB 3OYKA 3CJ0A 2KW4A 3QEIA 4DSFA 3DI6A 5KFOA 4DSLA 3OYMA 4DFMA 1BCOA 1S1TB 4C8MA 4YMEA 1MU2B 4FK2A 3ITHB 1YVFA 2OH2A 5KFTA 3BREA 3MFHA 3C6UA 4RNNA 5KG0A 4Z0UA 2YKMA 1W0HA 3KHLA 3MXJA 3P83D 4CJ3A 4I2QA 3I8DA 5KFQA 3KLIA 3DLKB 4MIBA 2UVRA 4ICLB 3PW4A 4YP3A 3HKWA 4CGHA 3EYZA 3K5NA 3T3FA 3O4NA 5KFYA 4TYBA 2ITGA 1S9FA 1NK4A 3GIMA 3KIOA 5KFKA 4DTXA 1LWFB 4I2PB 4FJXA 4IFVA 5DQIA 2FJVA 4C8KA 4PQUA 1BI4A 2JGUA 4FJGA 2G8UA 1YVUA 2GUIA 5DK5A 4NLWA 4JV1A 2E9ZA 4M3ZA 1RT6A 3RRHA 3K58A 2BE2B 3QLHA 3DLEB 2QKBA 4YR0A 2QE5A 4W5QA 2KZZA 2HMIA 3NFAA 4CK2A 4ZP9A 4CGJA 4RNOA 2BQRA 4BE1A 2R2RA 4QW9A 5KT5A 3HPHA 3VQBA 3CVKA 3NF8A 3RR8A 4HUGA 3LWMA 1TV6A 1SKSA 1JLQB 3VQ4A 4OVLA 3IG1B 1TKXA 4OL8A 2ATQA 4DU3A 1NK6A 5JS1A 3PW0A 4OLAA 4YNQA 3BQ2A 3QGIA 4TY8A 4DF8A 1RDRA 3V6DB 3CDUA 5K14B 4J9SA 4I9LA 2G8KA 4IFYB 3JSMA 2UVUA 1DLOB 3CIZA 4Y34A 1A5VA 4NCAA 4BDPA 5J2MB 3ASMA 4J9LA 5J2PB 4J2EA 1Z4UA 3IN5A 2AGQA 4ZHRB 3HVTA 2XY5A 4EO8A 1X1PA 2GBZA 3CFOA 2X6NA 3GYNA 1D8YA 2V4QA 1JX4A 1HYSA 4F4KA 4IQXA 4K4XA 5CYQB 5KT4A 4DL3A 4E3SA 3LZIA 4URGA 3HPOA 4JS5A
chains in the Genus database with same CATH superfamily
2MYFA 4A48A 3CC4S 2P8IA 1QVGM 2LLZA 1VQ4S 2DNLA 1TP7A 3CJ9A 3C14B 3VAMA 3SZ2A 4RBTA 1IQTA 1NSAA 2M8DB 3VZIA 3AAPA 1VSJA 4IWVA 4O55A 4FJMA 4UZBA 3AXMA 1CJVB 2QLWA 1VRUB 4AL7A 2XMJA 2F8SA 2O8BB 4UQTA 1T6CA 3I55S 3A13A 5AQGA 2HWHA 4XPCA 3JYTB 2W8LA 2E5IA 3G96A 1NKCA 4ZLJA 3WC0A 1FA0A 1NSKL 3T41A 2IVPA 4MTPA 1S4EA 1IN0A 4LRFA 4CNZA 4JHDB 4JN4A 1O8BA 3T1YF 1LFPA 2W7AA 1VSKA 3QFWA 2IDEA 1N4LA 4RWWA 2GC8A 2C2NA 5KTQA 2IHR1 4JYAF 3AAQA 2IAJB 4QPXA 2M4MA 2HRUA 3IP0A 4G1IA 2CJXB 3CE8A 1NWKA 1U2CA 1N33K 3NHGA 1NGCA 3I56S 4J9OA 5HAOA 4K42A 4BC7A 5L1IA 4Q8EA 2MZTA 3CCVN 3IKMA 2XRIA 4WJBA 1EX4A 5CCMA 3L7OA 1DLOA 4O4GA 3KOAA 2YNHA 4OYBA 3BZQA 2EWHA 3D2FB 3KYLA 3SYZA 4LFBJ 3L2WA 2DHSA 5D78A 1ZM3A 4P2MA 3MM5B 1UFKA 2WONA 1C1CB 4FK4A 7FD1A 1C1BB 3G0ZA 5KPRA 4Q8FA 4ID5B 4LQ3A 2ASJA 1RTHB 1F60B 5LMNK 4TNOA 2P5OA 4E1MA 1Q1KA 2DT9A 5DG7A 2W40A 4OO1J 3MM7B 4OYAA 4IDKB 2PYJA 4FWOA 4O3QA 3NL0A 4OX8A 1HLWA 1K6YA 3OTDA 1HNWJ 5AQHA 4A8FA 2DPJA 2DHXA 3CJ1A 4FWLA 4DQPA 1DJ0A 4WBFA 3FEZA 4KAIA 2XCPA 1GH8A 1WC0A 2G1DA 2YJFA 2V2VA 4X65K 1LWFA 4CFCA 2EFOA 3VQ7A 4H8KA 3D5MA 1NAQA 4DV4F 4WE1A 3MTJA 2WFBA 4RU2A 1JCEA 2VQFK 2QFIA 4I67A 1WHYA 4I68A 4WTYA 3OVBA 1FFSB 4CNYA 3GG1A 1ZZNA 4OGCA 3MK6A 2BUPA 1C1BA 4CDIA 1TL3B 3WZ0A 4DL5A 2FLLA 1ITGA 5AE1A 1SC4B 4AL5A 3SI6A 3GYXB 4O3SA 2N4DA 3I9ZA 5EY4A 2FSJA 1LW2B 2RUSA 3L3CA 4IH5A 4DPWA 3NGUA 3R2CJ 5HRNA 2J6UA 2XMKA 1R89A 4CJLA 3V9UA 1S6PA 3KK3A 3K5OA 3PIPL 2A6AA 4RZRA 4A8MP 1CQNA 3FFKB 3AOAA 3U1NA 4EP4A 4KGKA 4CEFA 1QDUB 3OL8A 1WC6A 3W9HA 2KXFA 2R7OA 4C23A 4DQRA 5E7OB 3POTB 2CQDA 3MXMA 1FVSA 3OTOK 1RGIA 2RF2B 2H65B 4DV6J 5HQ8A 2FGCA 4RPFA 1JCGA 2AJ2A 1Q5VA 1RXOB 4M8LA 4F2RA 1JXLA 2ROPA 2V9WA 3OL6A 4B1WB 5GAHI 3QRRA 4DPXA 4H0PA 1YJTA 3MI7X 3DFEA 1PG5B 3HL8A 4DL6A 4CBXA 1RGVA 3MXHP 2BMBA 3KKSA 4CZCA 1WB9A 4K8RA 3ZZRA 2BX6A 3PHEA 5F8JA 1KVBA 1WOSA 2F7TA 1HARA 3T1AA 3I33A 3QO9A 1TUUA 4LFCK 3N6NA 1IKXA 3TVYA 1KD1T 2E1AA 5E3CA 2F4VF 3HOSA 4PKIA 2N3LA 3T69A 4Z7YA 5JLFA 3W8PA 2HHPA 2ZH2A 3EXYA 1OSCA 1VQ5S 2CPEA 3M7VA 3J80Y 4R0EA 1X9MA 4JKHA 1FKPB 2WZ1A 1A5XA 1S3XA 4C0BA 4B9UA 4JI7K 1BHNA 4CZLA 3RJMB 1GT8A 2QSFA 2HBJA 2H5EA 2ALZA 5A8WB 3SQ4A 4OJRA 4FPRA 4RW9B 4C8OA 4ZITA 3OLBA 5HP1A 5F9LA 2UV8G 2Y0BB 2E9TA 2U1AA 2BJ3A 4QWEA 1Q18A 2CXEA 1NKBA 7AT1B 2CIMA 3I5CA 3VCDA 3ZNUA 1MWZA 4KHSA 3BH7B 4KH6A 2VOPA 2YKMB 4Q5VA 1AB8A 3UCUP 4G1QA 2V5HG 5KFLA 2MZRA 4DFKA 3M30A 2QJ3A 1OVQA 2NRHA 2D41A 5KRSA 3M1FA 1RWWB 1MMDA 4X4PA 1M90T 5AZIB 2GV1A 1MROB 3H8YA 4FW2A 2OTLS 3ITHA 4DSEA 4QR0A 2J8SA 3KHRA 2DEJA 3PJXA 3RRGA 4FLYA 2RUGA 5C2DA 2XYGB 5ETNA 2RD5C 4ZA1A 3H1QA 3TWHA 3NVKA 3NGZA 3BSCA 1UFWA 2XMTA 3FCWA 2XHBA 2A3JA 3C66A 4TVAB 5TKWA 3WNEA 3TNVA 4DL4A 2F9TA 1LFWA 2KYZA 4PXCA 3C16B 3QT5A 3E1YA 2R2TA 3G2XA 2E20A 2EBEA 2OPQB 3N28A 4NI2B 2DY9A 3OYHA 3D1QA 2LVWA 3D7EO 3MM5A 5KPZA 1X4DA 4N76A 1KAZA 3PG9A 3MN9A 3W2WB 3VAHA 2O8DB 2J9EA 1UVKA 1NZ8A 2FYXA 2AEMA 2W9CA 3NF6A 2OTJN 4CLZA 1Z25A 1KC8T 4YOVA 1WOOA 1S5JA 4WXOA 4LVOP 4EBEA 2JDJA 3CCRS 1Y64A 2BANA 4A8XA 2B9EA 4R25A 2ZWOA 2FY1A 4PG4A 3MD3A 5D0HA 5CYMB 3UE2A 4FF1A 3CF5L 4QIVA 1W2IA 3CM5A 2GMLA 5AJ3F 5JVGL 3MPYA 5CCLA 3JAMO 1YG0A 5FPDA 3SQ0A 3ET6B 4A2BA 1T8EA 3A3OB 3JSMB 2D74B 4ZDNA 4IUFA 3NNHA 1WWHA 2H51B 3DU5A 3EZUA 1T3VA 4AYBD 4DR5K 1T9WA 3R1LA 2O8EB 2OEKA 4MO4A 3NDKA 1Y3KA 2DNKA 1X0FA 2VYPA 2YKNA 2DFFA 4DHVA 2R7TA 4QIGA 3DOKA 4ISEA 4WK3A 2AX0A 4E89A 3E66A 1OKJA 1PSDA 4KHPF 1T03A 1XMOF 1KNZA 2OCEA 3H45C 1U8WA 4ED7A 1ZM2A 2WVEA 4TU7A 2IVYA 2ZNZA 3TOQA 1S1WB 4N5SA 3FRZA 4DR5J 4CJRA 3CO9A 3N01A 2ZJRL 3HRGA 2FBXA 1PJ7A 3THPA 4B02A 3K5MA 4DV5F 3MAAB 4HDGA 2CPIA 4M5LA 1DTTA 3MECA 2DGVA 5E2QA 1TKDA 4M3YA 3EDRB 3EE9A 1JJ2M 4OHWA 1BCMA 2JOQA 3C15B 2FBTA 4D3HA 1OQ3A 4KV8B 4IFEA 1TL1B 4Q2LA 2O8CB 1VQON 2WBNA 3NBPA 2C3MA 3AGKA 2UUBK 4OPKA 2O8FB 1FK9B 2ZGZA 2LU2A 5AQZA 3DRSB 3W2VA 4DR7F 3V9WA 3J7YU 5KFWA 3SSSA 2L3MA 1BQMB 1YITN 2JLGA 3HSTB 4PKGA 3MX2A 5JICA 3U02A 1KVAA 3THYB 4C8LA 4CJQA 2CYYA 1X7VA 3GZ7A 3ILIA 4W90B 2F8HA 2DGSA 2OEJA 2VB6A 2F1FA 3CJ3A 5GMDA 4IOCQ 3GDQA 4NMLA 5F8GA 4WCEQ 3O3HA 5T7LA 1BA1A 1JQGA 4TY8B 3RB6A 4A4JA 4FYYB 2YH0A 1WNSA 2IC3A 2FQQB 4MIAA 1RBVA 3I5AA 1F9EB 4RUBA 2I9SA 5KT6A 3OR2A 2KZMA 2XS2A 2HGLA 5J1NA 1X9JA 1GX5A 1RU1A 3H3OB 3KMQA 4BC3A 1KHWA 5BPNA 4I6AA 4NLDA 4MFBA 1K8KA 1RT2A 2M8HA 3LP1A 3QIDA 5C12A 2MKIA 1SJRA 3LAMA 1TKZA 4UOGA 2B4PA 4M45A 4X65J 2GV9A 4CJTA 1XNRK 1VHXA 5FRMA 4WK1A 4GKKJ 4N8OA 5E5NA 1RWVB 4UW2A 3SXLA 5K14A 4LUBA 4QIEA 5JJBA 4RLEA 1V3RA 3H4BA 2KHOA 5DQHA 1JLAA 4B3MK 3VEOA 2AV5A 3OV7A 3D6FB 4XIUA 3E9LA 3VEYA 4K4ZA 4Y1DA 4DOZA 4NLXA 3SUPA 3ZNJ1 4CLFA 1GK8A 1U1NA 3Q2TC 2BV3A 4XH1A 2R3VA 2UUBF 4IH7A 1Q4RA 4OJ1A 1D9AA 4CJUA 5JUMA 3QBXA 4B1UB 3O9SA 3LPUA 4RWXA 3R97A 2PYLA 4LF4J 3A4TA 4EWTA 4OKKA 1NO8A 1NJIT 1XMQF 4P72A 4B9NA 4MFBB 4M5JA 1K44A 4F25A 4MK8A 5J2QB 2E9RX 2XNQA 4JHDA 4MQ3A 1EETB 2IDOA 1LNQA 2YWEA 2BEFA 4JYAJ 3GILA 3HI0A 3ZT3A 3CCJN 3DLGA 5DLFA 1YGYA 4DPUA 4M1KA 1QVGR 3AVLA 4R8UB 1AW0A 4CZGA 4DR6F 1WTBA 2P9SB 2IOCA 2APOA 4KHPJ 4KHUA 2W2NP 3E8OA 2RT3A 4BQLA 3DRRA 3F56A 1DHMA 3Q24A 4CH0S 3GIJA 4H0VB 1HR0J 3KXDA 3V4IB 4A57A 5FLXY 4YN3B 1E4GT 3G71S 5DETA 2P9KB 4A2AA 5M1KA 1NBEB 1NHKL 4WTOB 3UKRA 4TLRA 2R8GA 4K4WA 3NWRA 2CQCA 2YXLA 4DTRA 5KFDA 1J27A 1B4SA 4AQYJ 3R5BA 1JJ4A 2C28A 2IYGA 4PG6A 2BW7A 3H5UA 2ASPA 3J81Y 1TFYA 2IJNA 2EFVA 2FJWA 3PW2A 1DTQA 3T7ZA 4G65A 1UETA 2O4GA 4L8RB 3LTOA 3WDOA 5LMUK 1QVFM 3CPWR 2ZH5A 2DTJA 1DTTB 2BOAA 1QQCA 3GE9A 3G4SN 3OJUA 4DX6A 2MDAA 3X1LB 5B8HA 3I31A 3GSDA 5EWEA 3BKTA 1S0OA 2WOMA 1N56A 5CD4A 1ZH5A 2MQ8A 4LBIA 1WEZA 4XAKA 2MXYA 4MT1A 2E2QA 3UVJB 1TELA 1UZDA 3ATUA 1WHVA 3G9CA 2B9YA 1RILA 5M1PA 1HNXK 4DFJA 3ZYYX 2MLYA 3G86A 5DS7A 4WQ5C 2MHEA 4IJAA 3TRGA 3OSNA 1SKUB 5AJ3J 4HTLA 2XTJP 4HKQA 3SV4A 5L46A 3CULA 5DM7L 4V19J 4KSEB 4QU6A 3H2UB 2RN2A 5AZIA 4GVEA 4NI2A 2O67A 1A0OB 2DB1A 3T5KA 2D0BA 1HBMA 4PG8A 4TQRA 3H7HB 1SUQA 3VR1A 4L3QA 4NXMK 2R8KA 3MPUB 2HHVA 3AA2A 4QYZK 4WCEL 4DR3F 3QWPA 3Q23A 3FKBA 3MM6B 4AHCA 4IO9L 5D8HB 3PKYA 4IO8A 4H54A 1RCHA 3OXLA 2VFRA 5H1SV 3LW5C 2YHYA 2G9OA 1GLLO 1UW9A 1D1UA 3PCOB 3F2KA 1YZ7A 2OPRB 1TMJA 4X4QA 4KT0C 1YBAA 1RSCA 1OS5A 1ATRA 4OZLA 3MPVA 1I51B 3H1VX 2DR8A 2NRTA 3C14A 3IRXA 2C2EA 4LH5A 3W64A 3HHEA 3OYFA 3FC9A 4KREA 4OJ3A 4B1XB 2HLTA 1VI7A 2IC3B 3HT3A 2PZSA 4ZPAA 1GLBG 4O3NA 4HT5A 2GMHA 4PQAA 3GFHA 4NLRA 3R7SB 5CXTA 2I7PA 5L9NA 3TWZA 3AOBA 2W8KA 5CZVA 4DV2J 5HK4A 1BQXA 4C6AA 2IVNA 3DU6A 4KJIA 3VTHA 1NGDA 2ZH4A 2XS7A 3M1VB 1QTMA 5CE3A 5ETPA 4OJGA 3QGPA 2ZBIA 5AQQA 2P6TA 5J2QA 4RW6B 1U02A 3GBTA 3MN7A 4UY8T 2A40A 4DN0A 3C94A 3A8YA 2DNZA 2VIHA 4CD3A 1HQUB 1TL7B 4OI0A 4EGLA 4WKRA 2AW0A 4Z2XA 1KLMA 4FO0A 2HBKA 2RQMA 4USMA 2GJ2A 1U24A 3BSOA 3LF0A 2CFXA 4U95A 1HWKA 2G2OA 1MWQA 4CBWA 2ZHOA 3CFPA 5BN8A 5FDLB 4ZPCA 4DU7A 1UVNA 3LP0B 3MR2A 4LR9A 3E2EA 3HKZD 2J7WA 4L6V3 4AHUA 4CJ7A 5KFFA 1JJHA 3FCHA 3I55N 4CHZA 3DDKA 3D6RA 3M30B 3MGJA 4RO0A 4OZJA 4E8UA 1RFQA 2YQ0A 2LQ8A 5J1EB 2UXBF 2BQUA 1M1KO 2LEBA 3KLEA 5K8OA 5L38A 3J8AA 4ED2A 3D9BA 3VEVA 1QUVA 2ZOMA 3LDSA 2DGQA 1RHUB 2J7KA 3CWJA 2YHWA 2RILA 3AO1A 2JLFA 5A8RB 2XHWA 3S6EA 3THWA 3WNHA 2A41A 4WWSA 4LIWA 1NDPA 5T7LB 2IBKA 4RUCA 3DDIA 2XYPB 4BROA 4HWIA 3T1YJ 1RYRA 2XWXA 5AXKA 2Q3PA 2JLEA 3E9OA 4DSIA 1C4CA 5A2QO 1SKRA 3FZKA 4JD2A 2CADA 4F4WA 2B9WA 1KQSR 4CYUB 1X5TA 5BYSA 4AXJA 3WX4A 1JLBA 3NNCA 2HBRB 1OYEA 2O66A 4LF9J 4FK0A 1NGBA 2J76E 4B3TJ 3OQ2A 3Q2SC 1FJGF 2EFNA 5JMVA 3VQTA 3BO3A 3N5BA 2ZNYA 3ZZTA 3HFZB 3IFEA 2EX3A 4AHTA 4E7HA 3G87A 1RT5B 1EKRA 4M3RA 3J7Z5 2K8GA 2VG5B 3MAQA 5C24B 3EX7B 4Y65A 1CC7A 2P6SA 5F0UA 4A8KA 1R0CB 1CJUB 2JFDA 2OPQA 3LZJA 4CCHA 3M8QA 4JRQA 2XY6A 1M0SA 1NMEB 1BL3A 3P4IA 4FL9A 8AT1B 5IWAJ 5DDRC 3KD5E 3HDSA 4LF8K 3VGUA 4IJNA 1FJEB 4FJNA 4DQQA 2HVHA 3IGVA 3CJKA 3TZZA 4ZCKA 2CZ4A 2GVZA 2E1MC 2B6AB 1ZTWA 3BDEA 2W6KA 2A1RA 3VERA 2EFPA 4N8NA 3CXCR 4J37A 2B4JA 1HPMA 3H98A 3C3LA 3M8YA 3JTOA 1U7LA 2CDQA 2UUCK 1WORA 1IKWA 2HGNA 1X9SA 3SSQA 1U6BA 3CDWA 4DUYF 3HVRA 3K59A 4R8UA 3CDBA 1HWJA 4KY3A 2GWJA 2E4LA 2JWKA 3RYLA 4ITSA 1RA6A 3HX9A 4E98A 2ZZTA 4JAXA 5MAOA 2MTLA 3QZ8A 1G3OA 4Y2KA 2VFTA 4ZPVR 5GAHP 2IJRA 1NGGA 3Q7BA 3OYJA 4CZIA 2A6MA 4BRAA 4F36A 4KHMA 3BF1A 3JQJA 4CTAA 1D9DA 3QT7A 1NG9A 1FWKA 2BA9A 3M3ZA 2OTJS 3NBPB 3GJRB 3BGLA 1KBRA 2Q31A 4M5GA 3TUJC 3L4IA 2V52B 3EUNA 4X4TA 4CGFA 1S1XA 2VV5A 4U6PA 4F3OA 4V19X 2JC0A 4BRNA 4F0MA 3QJLA 2Y3YA 3D6HB 2XBPA 1QZ5A 3TVZA 2YKOA 3FLCO 4ILJA 4RU9A 4XH4A 3J7YP 4H4KA 4UOFA 2E1YA 4GKJF 1EWRA 1N5YB 3PLAA 2I7NA 1GFWB 4BR4A 3TAQA 4H4OA 4Y2AA 4CECA 2UUWA 1I94K 1HR0F 5G0RB 3SQGA 4F9OA 2ZJRQ 4XK8C 1JXBA 2EHGA 4G1QB 3FQKA 2DY4A 2ZUGA 1VC6A 3G6VA 3JSYA 3CF5Q 2ZWHA 4FF2A 2BXJA 3WEEB 4PG7A 1V3ZA 3HULA 3D3BJ 3THYA 2O8FA 1DKGD 5LMNJ 2GHVC 2C2MB 4JKDA 4HVZA 5AFUA 1PYTA 4CFAA 2ASYA 2GVZB 3DMJA 4USUA 2PDAA 1EP4A 1S9GB 2EBGA 4N47A 3BF4A 5RUBA 1N54B 2HHHK 2BRKA 3UB5A 1IBLJ 4I1TA 2DIUA 4TKTA 3MZIA 3KUGA 3M6VA 4LMZA 1I3OB 2HHTA 4DSJA 3V2UC 5IC6B 4ECRA 2QWLA 3EZWA 2X1FA 4YOUA 1KAYA 3O9RA 3K5PA 2KG1A 1X4FA 1D0EA 3CCSN 1RACB 2QEXN 1LAVA 5KPTA 3JTNA 3WUHA 3RBDA 2VG7A 1U26A 1S1VA 5AQYA 4X4OA 3DXKA 4B08A 4B3TF 3D2EA 4Q44A 3K2YA 1U45A 4FS2A 1URRA 4M5MA 3RUBL 1VLOA 1G15A 2KT2A 1IJEB 3CJTA 2HG4A 4GW6A 2IIHA 1IUJA 1HNZF 4ZVTB 3CMQA 3ZT0A 3JS9A 4O23A 1YTUA 4RBUA 1WNEA 4USIA 3O1BA 3BEXA 4HCBA 4FW1A 3NGKA 1JB0C 4FJJA 4DR1F 3ZO7A 3TA1A 3BO2A 4B3RK 4WQ5A 2E44A 1DQ9A 2DNYA 2CQBA 2ZEJA 3MR3A 4IYQA 3CPEA 2GX8A 4PWUA 4ED8A 1RBTA 5IT9Y 2I38A 1XEZA 3MCOA 3VGVA 2FLNA 1TUGB 3M8PA 3EZOA 4DR4J 3U7JA 1RUSA 1XBWA 3O5BA 1IG9A 2Q79A 1HHTP 2FJEB 2W01A 4EUVA 3U27A 1J53A 4ZHRA 4NEZA 5C7PA 4BRCA 3ZTSA 5GAGP 4M41A 4GV3A 1N32J 5HROB 2GVDB 3CJ0A 3EGZA 3DI6A 3I96A 5KFOA 4DSLA 3EKSA 4QBUA 1AUDA 2OIHA 4YMEA 4BQZA 1MDUB 4YORA 1APSA 5KFTA 3BREA 3VAJA 4UOHA 4Z0UA 2YKMA 1W0HA 3M2RA 3HFKA 3FGVA 3I8DA 1BWFO 4JYAK 3H6EA 3HHLB 4P52A 2UVRA 3ENWA 3PW4A 4YP3A 4U96A 5KOXA 2VPXB 4GVLA 3G82B 5CAAA 2ITGA 4WIQA 4P7TA 3GIMA 2IVFB 3KIOA 5KFKA 4H03B 4FJXA 2ZH8A 2FJVA 4C8KA 3DXKB 2GUIA 5DK5A 4M3ZA 1CJVA 1Q16B 2V8DA 3T9ZA 4ZCLA 1NUEA 4C98A 2F63A 4K0KF 1L3KA 2R2RA 5KT5A 2VCPA 1CJTB 3VQBA 3CVKA 1WC1A 1XIQA 3ILOA 3I87A 3VAIA 1ULRA 3L0QA 4NA2A 3TTCA 1KXPA 2LP4A 4OVLA 2QXLA 1H2UX 4J91A 4CLSA 3TUZC 3HMJG 3FE1A 1N34J 4TY8A 4DF8A 1B0TA 1V5VA 4KRWA 4MYUA 2LQ9A 2N7CA 4IFYB 3BN4A 3CCZA 4Y34A 4BDPA 3HHLA 2D69A 2DK2A 5BR8J 3IN5A 3PSFA 3D2FA 2BACA 2B51A 2D3OR 4CI0B 4OIXA 1QD1A 3KFWX 4JP8A 4AM6A 1QHAA 5A8KA 5FLXO 1OVYA 2BZ2A 4IQXA 3ZZ0A 3IA0A 5JVGQ 5KT4A 2ZM6F 3A3NB 4DL3A 4BRLA 3GIRA 2HSTA 3LZIA 1K0TA 1VISA 3NS6A 3TZWA 1DURA 2XMUA 4C1NI 3TYTA 5E84A 2I6WA 2PE8A 4KGZB 4IRKA 3KDNA 3GYGA 1NOZA 3D0HE 4XDCA 2M88A 2OUGA 3D0IE 4KFBA 3ZTPA 2G2ZA 1RAOA 1RA7A 4XDDA 1JJ2R 4RW8B 2EXUA 1RNHA 2QMWA 2HQGA 3I8BA 4O3PA 4ILMA 4WU2A 3SAFA 3PTWA 2PFUA 4ATNA 2DTUA 2FLOA 3CM6A 4BHQA 3HSCA 4ZTJA 1LK5A 4IFYA 3J81j 1WKJA 4GKKF 4DS4A 1QAIA 3SBMA 3HSGA 3L3VA 3EWGA 3GCXP 2UXDF 1H7XA 4DV1F 4RBVA 5C42A 4FYVB 4A5BA 2GIFA 1U48A 1QQNA 1FJCA 2NR0A 3PYFA 4ZK7M 3FSIA 1BGXT 4BWMA 4EEYA 1CJUA 1F21A 3QAEA 1QQOA 4NYNA 4V19S 1YI2N 3PEJA 2X1GA 1QE1B 2NRWA 1TL1A 3CNQP 3N5FA 3LL3A 1G6BA 3QDKA 4ZJQA 5ADXA 2KFNA 1VRUA 4JV0A 2HNZA 3CO0P 4DEZA 3VGMA 2ZOFA 5AQUA 4N77A 1N0UA 5KG4A 2XGQA 3RMCA 1VIXA 4DTNA 3MHYA 3D7SB 1GXUA 1FRIA 3U8XA 5KFSA 2OPPB 4GY2B 2MY8A 1N8RT 3BGRB 2WC9A 4F4XA 4LF6F 3TW0A 2ZBQA 2KTQA 1J5OB 1U1LA 2DRDA 3AVBA 5C0YA 2ZGYA 2JL9A 2G8VA 2WB4A 1S10A 2QMXA 2V2ZA 2FVQA 2YWGA 4J9UE 3NF9A 4GMJB 4Y2IA 3W5XA 4UUWA 5C15A 4FPBA 3VN5A 3M2VA 1BQNA 1IBMK 3CHWA 2E7WA 1HX1A 3PW7A 2E5LJ 3M2RB 3MX5A 3RSEA 3MXIA 3TAMB 4WF9Q 2LDIA 1N36K 3CT9A 4YR3A 3EM1A 3D2WA 1S12A 3RAMA 1FNXH 2GAHC 2W24A 1GX6A 2OO4A 5BYQA 4OFZA 2YX4A 1XMQJ 4GMKA 3FCVA 2BUNA 3H08A 3NGTA 3LWLA 1FI4A 3P3DA 2XG8A 4TXSA 3WEEA 5D4LA 3FBBA 4K41A 3ZETB 2VQFF 1SQFA 3Q8VA 3TAPA 4GVBB 3TEGA 1YIJN 4JKGA 3D1OA 4HHHA 4CJ5A 2G8WA 1HI0P 1WSHA 1HFEL 2AJ4A 2V0NA 4ECZA 2ZJPQ 4MKVA 3M05A 4H5TA 2P51A 2YNIA 2FHOB 3TJ8A 2EC2A 3R5CA 3LA0A 5I3QA 2V69A 3W60A 2B8QA 3QNOA 5CABA 3FQLA 3IAM9 2KRRA 3AVFA 1YJ7A 4FYWB 2UXCJ 4KO0A 4FJIA 4JD2B 1S0NA 4C3LA 5DLGA 3NCQA 1YVNA 3DRRB 3DM2B 1CS4B 4LREA 3ZEUA 4LSNA 4JI2K 4DZ6A 4FBTA 1VQ7N 2P9CA 3HBTA 1EXQA 2P9LB 4IRDA 2D1CA 2HQDA 4NLQA 1U2FA 1FX4A 3UN2A 4M42A 2V8HA 1J5EF 1ITPA 3GR1A 1FFWB 4QR2A 4WXWA 4QCLA 3GOIA 4NCGA 2RVJA 4LH4A 3VOVA 1RTIA 4ANEA 4KGVB 2V63A 4DR2K 2ACMA 2G0CA 1YT3A 1K8AT 4JI1F 4QS9A 3CIPA 1R3NA 5U47A 4PUOA 1B0VA 1N5SA 4ZP7A 3MCNA 3RSEB 1OWXA 1KKHA 3DLBA 1Z2ZA 2VPZB 2ETJA 3CETA 1Z05A 5GIPA 2MQPA 4DV6K 1E3MA 2FVRA 1KVIA 2O8CA 4DFPA 1N52B 2GZOA 3ZSRA 4OHXA 4C11A 1WAJA 3L7PA 3EVWA 3J7AP 2P5VA 1AFIA 5C10A 2J6SA 4GO5X 2D0AA 2RPIA 1TK0A 4B8AB 4G1PA 2RQCA 3KG4A 2KXNB 1UWBA 2R42A 2O8BA 2NS1B 4S0MA 3SUOA 4CGIA 5IM0A 1R31A 4FS1A 3CCLN 1FEHA 4PWDA 5T14A 2DNMA 2W9CB 2QYCA 2WSCC 2XGPA 5F2RA 3B78A 1JMTA 3V6KA 3VVTA 3ZTRA 5GADU 3ZT4A 1IXKA 2C42A 3WQUA 4ECWA 3O3LA 3MM9B 3R1HA 4PCQA 2AX1A 1RYSA 1FJ7A 1X4GA 3MM8B 4ZOSA 3QO9B 2RRNA 3QNWB 3SFGA 4WFZA 5B0GA 2LEPA 4RCHA 4CHQA 4FJ8A 2F8TA 1RABB 2CH5A 1KVCA 4P74A 3DM2A 1CBKA 1CS4A 3ENQA 3D54A 3MUMP 3PHTA 2X3GA 3U1MA 1BDGA 2QMUB 3OYCA 1VHIA 4H4OB 4DCOB 4H5RA 1R8HA 2RMLA 2CUYA 2L41A 1NGFA 4NLCA 2F5GA 2DR7A 3WHIA 5E3PA 1ZOTA 1FRJA 2G8FA 5EXWA 3CGIA 3ZLJA 3O44A 3RB4A 2NLWA 4O4GB 3QLHB 2E5GA 2GGPA 2VBZA 1NPRA 1IKXB 3KG0A 5IM0B 4QPTA 1FDBA 1SV5A 4AHRA 4J5OA 4DUZF 1XR5A 1ASUA 3F44A 1HQ2A 3N4WA 3OY9A 4JV5F 2IY5B 1I5OB 2HHWA 2DGOA 3ULEB 3KK1B 1W7AA 5B0AA 1JLQA 1OPIA 1HNIB 1DGKN 3CFRA 1ZBUA 2A1SA 4C11B 4ZLLA 4U7CA 2BJ7A 4NRTA 4YHHF 4DUYK 1RCOB 5D0EA 4NXMF 3OUYA 2R8JA 2AD9A 2EFQA 1H2TZ 1RAGB 1IG8A 4FJHA 1XMOK 3T1YK 2OPPA 3LALA 2MGZA 4DR4F 2PO4A 2CNNB 5DM6Q 3GIKA 3GQCA 2V4JB 5A8KB 4AQYF 5CH7B 1VC5A 3VF0B 4TN2A 2XYHB 3R6GB 3Q89A 1VSIA 1KLNA 3HI9A 4IH6A 2QZ8A 2WSFC 3FR0A 2A3ZA 5HLFA 2FTRA 3R6MA 1DARA 2HHHJ 4CEBA 1RT5A 1YIJS 3KHGA 1LWEB 1HNXF 3VA3A 4DV0J 5M1FA 1EX8A 3P8BB 3VGTA 5AQRA 4DTSA 3W65A 5KAKA 1BUXA 4DS5A 1VRTA 3MECB 3RBXA 3T5LA 1CXUA 3ZSQA 3O4QA 4OZ0A 4KAZA 4F4AA 4WZQA 4KR0B 3U6FA 2O3DA 3R5JB 1XN9A 4QU7A 1XJWB 2EI5A 3DC2A 4CH7A 2YX7A 1RU2A 4FVUA 3ENOA 3V81A 3TANA 1HNIA 1U4BA 4CF2A 3CD7A 1C0MA 2ZVSA 1SIWB 3CCMS 4WP3A 3LPEA 3VTIA 3T5HA 5J1EA 4F50A 3HLUA 5M1NA 1OH8A 3JB9k 1MU2A 2UVVA 1NRKA 4WFNL 2K7KA 3SCXA 3KK2B 2DEIA 1S6PB 4YUDA 2DHGA 1KHVA 1XNQF 2W25A 3OTBA 2MKHA 2DH9A 1NM1A 3SCLE 4R5PB 2AP6A 3TA0A 4FXDA 3GFZA 5AQNA 3NF7A 1IR2A 4B9LA 1VAZA 4XO0A 2BKPA 5BN9A 1S7IA 2KKHA 1TYQA 3CIMA 3ZZPA 1C0FA 1NDCA 1HKCA 2XSJB 5I42A 3QETA 4K8ZA 4CLUA 3J81O 3G82A 4ED1A 2A18A 3KDOA 2JZ5A 4DR3J 2ZM6J 2K2PA 5L9XA 2A10A 1DT9A 2W41A 2UUTA 1J5EJ 1HNZJ 1EB0A 3JSRA 2HFVA 3CCJS 4LFCF 1TAQA 4J2AA 4BCAA 1Y0HA 4DR2F 1FKPA 1N48A 3TUIC 4FP9A 4I64A 3LANA 5GAGU 3GONA 5HJXA 2W6LA 2QGFB 3CMAN 5DDQC 3AJ2A 4KIAA 3DOLB 3WXKA 1Y5LB 3I32A 3N4QA 3PRDA 4QWAA 4H4MB 2DXEA 1BA0A 4CEQA 3KK2A 2QK9A 3BDPA 4ZKAA 1O0PA 4EYHB 2DXFA 4ID1A 3GJTB 2MEWA 4M3UA 5ELZA 1RK8A 3TSQA 2LCWA 4YFUA 4BBYA 2FC0A 1VRQC 1HW9A 5JMNA 3RBEA 3R27A 2JRSA 2MB0B 4M5HA 1U0HB 1YDLA 2E1PA 1GMWA 3M9NB 2FSKA 5D77A 1Q82O 4JI3J 4IKFA 3A5NC 4RR5A 4LSLB 3O1LA 1NNDA 2XLKA 4RTFD 2ADBA 1WSRA 5KT7A 4PHTX 3AO5A 5H1SQ 1N34F 4DUYJ 1FERA 1NBWA 2R7QA 5K9FA 5HMWA 2R2UA 2ASMA 2AZ3A 4CHPA 1FWPA 4RNFA 4B9VA 1NJXA 1WF0A 2AMCB 1XNRF 3PO5A 2CQ4A 3A8JA 2XO7A 2HMPA 2M5YA 1AUSL 2HS4A 3DOMB 2CJYB 3V1QA 1Q7YT 3TR5A 4CLTA 1P6TA 3AVNA 3QNNA 2GCFA 3K0SA 1WBDA 4NB4A 4YHHK 6FDRA 5F3TA 4OQJA 2F8EX 4OHVA 1T7PA 1K1QA 2H9ZA 5DG8A 3M8SA 4Z37A 5CR4A 3JYTA 4XEIA 3KK3B 2GS8A 4EHUA 4LFCJ 3R8YA 2OD4A 2RKIB 5KRTA 3EL2A 3ZSVA 2W2PP 2FZKB 1EQ0A 4C97A 1WF2A 2OHDA 4JKBA 4F3TA 1KQKA 1R0BG 2CKWA 1WSIA 4PR6A 1S1TA 2B3TB 1RTDA 4C8ZA 2M0GB 2J9CA 4AILC 2FHKA 5BYRA 4HR2A 5SZTA 1QSYA 3DLHA 3LP2B 4BR7A 3THXA 1RT3B 3VF2A 2CDRB 3W5YA 4PKHA 2C2OB 2HVEA 3Q8YA 1M5SA 3P1GA 3TSPA 2MLXA 3UDCA 5IT9U 4UTGA 2OAUA 3OTOJ 4LF5J 1VDHA 2Y1LB 2VOOA 4P2FA 4JOUA 4EBCA 1ASVA 3FBEA 4PWWA 4UY85 5AQVA 2FB0A 2J7UA 3TTDA 4E7IA 3TJAA 2KXHA 2DR9A 5KOWA 4WFXA 1PILA 2YWWA 1VQ5N 4JI5K 3VAKA 2V8GA 3HJFA 3DRYA 2V7ZA 4A46A 3NGDA 3W63A 4DUZK 1SQKA 1HQEB 2B5JA 5ETRA 2CJQA 3HHDA 1CEZA 4NZ7A 2GX9A 2ACYA 1R8CA 3UE5A 2BE7D 1VQ4N 3P31A 3PKMA 1JLAB 2G8HA 4FNHA 1ZBIA 2H3GX 3DLRA 3DXSX 4ZLPA 1CLQA 1GTEA 3OFHA 5ETSA 4W5NA 1XI1A 2XMAA 5H9FJ 1HBUB 1FKOB 5EWGA 2HAFA 3MMAA 4O3OA 1QE1A 1GMVA 1H7WA 2ZDOA 3CD6S 1EQMA 1JLCB 2PIIA 2CWKA 3UNYA 3CQYA 5AQJA 2QM1A 1NU4A 2VFUA 1O5JA 2VG7B 2I5JB 2OTLN 4IG3A 2Z2ZA 5LMUF 2XQCA 4K4SA 3M5RA 3HVWA 5AFUH 4LF1A 2H4WB 1HYVA 1L3SA 3F5TA 5JS2A 3GV7B 1V6HA 4K43A 1FD8A 3CUNA 4FOIA 5AQWA 3B6PA 4AF1A 4NYZA 4KHWA 3UN3A 2WAQD 3NWGA 5T7BA 1RE1B 2VA2A 3UIQA 4NYOA 4O5FA 5BRHA 3AT1B 2OD6A 4ZVPB 1R0AA 4CWBA 5C24A 5FLXU 4DR6J 1LV5A 2AJQA 3C7NA 2W4PA 3T6BA 1RAIB 4N41A 3V1OA 5A6WA 2WTUA 3KJNB 2PMHA 1OJ4A 3FEYB 2O01C 3I0RA 1W9HA 3KKFA 2RHSB 4PL8A 2X51A 5LL6Z 1RBSA 4Y6IA 5KFIA 1L5UA 2WVCA 4I6YA 5EGYA 3O9TA 2PI5A 3RMAA 3B8HA 4KYZA 3VGSA 2Z2YB 2UXCK 4KH5A 1HJRA 2HAIA 4HACB 3R3LA 5FDLA 1X4BA 4P73A 3LPYA 2EWSA 3VEXA 3AVAA 4P10A 3RMDA 1BXNA 5C2FA 4FLXA 1ZBLA 1DTQB 3K5LA 4HDHA 1VSHA 2OPSA 1HI1A 3TTFA 2VFSA 4BR5A 2GMJA 3TZXA 3AQOA 4L3NA 4B3RF 2VDIA 3PRVA 3KK1A 2MSSA 5FPEA 3C19A 3E01B 4IXCA 4OV1A 1S1XB 3OR2B 3NRBA 1WG1A 1FXXA 4LC9B 4USVA 3CG7A 3H59A 2V8VA 2VZ9A 5KG7A 3ENVA 5IWAK 2EW9A 1GNKA 2XSFA 3SMPA 5B08A 1T94A 2XMVA 2UUAJ 1KTQA 5ETQA 1N6QB 2HYIB 2YKAA 3CEDA 3DI6B 5BRDA 1KFSA 5IV3A 1NK8A 5K8NA 3HXMA 3ELHA 1PIEA 4E0DA 3TEHB 2YI1A 3KNGA 4BVPA 5D15A 1OQ6A 4F26A 4CO1A 2PI4A 3LDLA 2QLBB 2XMWA 2ZVIA 4JI3F 3RVCA 3AVGA 4OYIA 5HRSA 1S72N 3VGLA 2K7JA 5LXYA 2UVWA 4KQZA 5IT4A 4K50A 2J4RA 4NLTA 1QM9A 3ZX0A 3IBFB 5IC4B 2H5JB 5HVGA 4LR8A 1S79A 2QA1A 2QN6B 5KFJA 4R5PA 3MR6A 1C1CA 2FSNA 2A2DA 3EXCX 2IRXA 3J7ZT 2BE9B 3CTRA 5KFMA 4IOXA 4AHVA 5I3UB 4E7KA 3HK2A 4O0NA 3MM6A 4FZXC 1JWWA 3EICA 2HBYB 3W3DA 2IPOB 4ETZA 2WHOA 5D4PA 3X3UA 2NRZA 4X64J 3EEQA 1OH6A 3D3CJ 2YX6A 2XCAA 4YDUC 4ZPWR 4CO2A 4KI6A 2WW8A 4C3MA 3QFHA 1EHWA 3CCSS 1SBRA 4BY9C 2WBMA 1FRLA 4MLEA 2A6OA 2WCXA 2AT1B 1NGHA 3AB2B 1MMLA 2ROGA 3CJAA 1IBMF 4HUEA 5J1PA 2IM2A 2Y1IA 1KQGB 1T9YA 3DHXA 1BQMA 3OFFA 4O8KA 2YQ3A 2C3UA 3R8EA 4CK1A 4MK7A 5ETOA 3S41A 2YTCA 1SJQA 2ZE2B 2U2FA 3C16A 1SH3A 3KJFB 1B9DA 4FJLA 4M5NA 4RW8A 1N36F 2CGLA 5FROA 2LSNA 1CG2A 3M1VA 1HKBA 4FM1A 4FF4A 5A76A 2HVZA 4DV7J 1VQPN 1S72S 3ULEA 4PYAA 2GJIA 4CLWA 1M1GA 5D0RA 3OYEA 3FZLA 2J6TA 3AO2A 1FK9A 2WB1D 1UWAA 2QWPA 1D09B 2GUPA 3O3FA 3I6PA 3HD1A 3QSYB 1FJGK 1OMSA 1Q82T 3K9JA 4CW7B 3G4SS 5L1JA 3EGVA 3FBCA 3PRBA 3KUEA 3TO8A 1BIUA 3WQTA 1PGZA 2HVDA 4J9VA 1URNA 3L2RA 2DH8A 3P45B 3HD2A 1QUPA 4CEEA 2H4YB 2QRRA 3PZPA 4CVNE 3S7RA 1Q7YO 1ZETA 2NRXA 4DV4J 2ZWPA 1UKUA 4ANCA 3ENBA 3WBZA 2A1BA 1NJWA 3VENA 2PA3A 2RRBA 3UR3C 1VSDA 2RE1A 2VQFJ 3MCMA 1NGIA 3WX8A 3ZZOA 3DOKB 3W0LA 2MKCA 4ECVA 4OLBA 4P7VA 1Y5IB 1R27B 4EO6A 4J7CA 3B8AX 1YJ9N 1SC1B 4HACA 4ZPDA 4WFAL 4CFBA 4FWNA 2FLPA 2HMIB 4FXWA 4IR1A 1WOQA 2Z56B 2VONA 3SNNA 1BLUA 3CC7S 2DISA 2LXIA 2QA2A 3CCEN 4HUFA 3M9OB 1M90O 4ICLA 2FC9A 4OPAA 3CC4N 1Q9YA 4DKWA 4C4WA 2G1HA 5DO2A 1VBYA 2YJEA 4AM7A 2P9IB 1S0MA 2POKA 3SLCA 1WSEA 3DNCA 2BVZA 4CM2A 4JEPA 4HT7A 4NLPA 3DRPB 1ICEB 5CYJA 3HHLC 1YTYA 2VWJA 2BE2A 2V34A 1IR0A 3VGKA 1T6DA 5J2MA 5BPMA 3KK7A 2KHDA 3BP8A 3AHPA 3ALYA 2LQ5A 4BGBA 4DV0K 1RHJB 5F8MA 3P5TL 4C48A 2ZM6K 3EMTA 3BGOP 4V1Ak 1WJ9A 2P9EA 2UU9F 1H72C 2ZJQL 4HYKA 3FK4A 4JV2A 3JAMU 2YHXA 4CO3A 1IM6A 6AT1B 2VODA 4JI3K 2HWIA 2OI2A 2ILZA 3R5GA 1C0TA 3DYAB 5AQFA 1DBDA 1PO6A 2E1CA 1IKWB 3ATVA 4DR2J 1T3OA 1BC6A 4ZVQB 4OI4A 1J2VA 1VJQA 2KL8A 1GOCA 1XMOJ 1HMVA 3OYAA 1GMWD 4YOXA 3R5DA 3MEEB 4KO0B 4OPJA 4DUTA 3VAFA 4MJKA 3IR6B 1EJ7L 3NOCA 4PXEA 5HANA 4OX7A 1TFWA 3UDLA 3TARA 4FWSA 1IKVA 3H2VE 3ZCMA 5HBMB 5EU7A 2QC3A 3DWLA 2A42A 4AT1B 2DR5A 1UMJA 2F9JA 2MQMA 3BJYA 3ISNC 1JNZB 1D4XA 4OHZA 4B3SK 1S1UB 3V9XA 2B56A 1CULA 1Y4ZB 3OW2M 2CVIA 2J0XA 2NLXA 3O08A 4W4MA 2IAJA 2CPYA 4OYWA 5CD4H 5FPNA 4ZPTR 3MN5A 2BANB 3I4PA 4CP5A 2PD1A 4DR1J 4M3WA 3W9IA 3SQ1A 2R2SA 3TVKA 2RQ4A 4LSNB 4IO1A 3TABA 2E8AA 2NUBA 1ILYA 2L08A 3BR8A 2BM1A 3O5TB 4IZ9A 4CH1A 3TAFA 4CZKA 4ED3A 2AYBA 5B0CA 4DX8H 3D28A 4K5SA 3MEEA 4LSLA 5LSRA 4N56A 4B1YB 1RTHA 2PEBA 4U67L 4TQSA 5C25B 5J2NA 1NB2A 3FNNA 2ZZNA 4OGEA 4UT4A 4DB3A 4JNEA 1RI7A 3HT0A 4GVMA 5HI7A 3BS9A 1IKVB 3I0SA 1AZSB 2K3IA 3OW2R 1S99A 1VQNS 4IG0B 3CW2C 1E6YA 1S0VA 3OL9A 1X5SA 2RKIA 2XWYA 4OKJA 3MCAB 1LXNA 1C0TB 2MJUA 1RKIA 3D4JA 4C3KA 2GW8A 1RWMB 3ULDA 2CPJA 3CERA 3D0PA 5GADI 2COLA 2YNGA 2OJ3A 4NXNF 4P2XA 1CZAN 1CPZA 1S6QA 1FFGB 4X2BA 2AKWB 1GTHA 1HWIA 4LF7K 5LJ3Y 3ENAA 1RWOB 1X3MA 4PPZA 5A6PA 3B4MA 1UVJA 4DPOA 3P49B 1WC3A 2HFNA 3ZC4A 3O8WA 2L9NA 4KBIA 5D3GA 5HOOA 4HVJA 1SQEA 4DV7F 3MMCB 2H54B 2R4FA 1BE4A 1F2GA 3UKRB 4DSFA 2QO3A 1KQSM 3D66A 1QTNB 5DJBA 2CQ3A 2KVIA 2UXBJ 4DV0F 1BCOA 1BO5O 4B1ZA 1PC5A 1Q8KA 1S1TB 4FK2A 1W26A 3E9PA 1SC6A 3ITHB 1YVFA 3BPDA 4M5IA 5CHIA 3P83D 4CJ3A 2NCKL 5HVFA 1ATSA 3WC2A 3IR7B 3DLKB 2DNOA 4OI3A 1IV0A 2F4VK 3PM9A 1MSWD 4TYBA 1S9FA 4IEEA 4DTXA 1LWFB 3R9PA 5DQIA 1YVUA 1YWXA 2M52A 3AY0A 2F9WA 4NLWA 2D9OA 5AQMA 4ALZA 4JV1A 2E9ZA 1RT6A 3RRHA 2ZHBA 2PGCA 3RBZA 2QKBA 3ZEUB 2Z8QA 2XMMA 4W5QA 2Q1LA 3BBBA 3L6QA 4FWPA 1ZAXA 2E29A 4I69A 1PJ5A 4CGJA 2JX2A 4JI4J 3AARA 4FWKA 3HPHA 3OTCA 3AFGA 4WFBQ 1WHWA 2FHJA 3FZHA 2YWFA 1S7HA 2R7SA 1TV6A 3MD1A 1JLQB 2Z2MA 1LWXA 2ATQA 4DU3A 2CQIA 5JS1A 4KH1B 3A12A 3PW0A 2IRYA 3ZTOA 4M63A 4OLAA 3US5A 2YH1A 4EK2A 4C2MA 1GQEA 2HIQA 2CQ0A 3V6DB 5KQDA 1NZAA 4OZ1A 4J9SA 4JB8B 4I9LA 3CIZA 1A5VA 5J2PB 1SXLA 3MURP 4OHYA 2FZGB 1UJ6A 3UD4P 1FNOA 2QT7A 1UFLA 4E1JA 3CXCM 4YY3J 3BM7A 3BKUA 2X6NA 2W4CA 2V4QA 3P96A 2NPIA 4RWTA 3CCUN 1ZBTA 2GWKA 3QFUA 4K4XA 4FNIA 4BR9A 2UUCF 2IDLA 4B3SJ 4URGA 3HPOA 2HWTA 4L76A 2V50A 2P9UA 3C7NB 1WI8A 1C0UB 5BPLA 2P1JA 1S9GA 2HKEA 1T44A 3MR5A 4CZHA 2MZQA 3N6LA 1UEKA 2IIRA 4ID5A 3QGHA 1YF5L 4RNMA 2BGGA 2CG8A 1RWNB 4X64F 3KUHA 3QT8A 4LR7A 1RTJA 2J9DE 3ZSOA 3DMJB 1MROA 1LAWA 2OPSB 4K0KJ 1KOOA 4X62K 2DJWA 5KFNA 2W2OP 1OO0B 3BGRA 1FDDA 2CQGA 1DZ5A 1XNRJ 2SXLA 3KLHA 1Q81O 2OELA 5SUHA 3CCTA 5LOQA 3QJJA 4J9RA 1NK0A 4HI2A 4KTWA 2GO8A 2JVRA 5AT1B 4DPYA 4ZCMA 4CT9A 2R8HA 2LYVA 1IR1A 2GHPA 5E3RA 4U67Q 4CEDA 3IBCB 5M2RA 3O8MA 1RJJA 2KFYA 1MWKA 3QEVA 4RX6A 5LT5A 3H40A 4MIWA 2GQ2A 2HW3A 1ZC6A 3BQ1A 2PC6A 2BABA 2N7YA 4KHPK 3OR1B 1WDTA 5E26A 3FRYA 3W9JA 4FWMA 3L2UA 1XUPO 5ADXH 4DPTA 3L7UA 2DNNA 2VQEK 3MR7A 2NZ4A 3VAGA 2WW4A 2QA4G 2DNPA 3HVAA 3G8QA 3ULHA 4CRJA 4MDBA 3SK3A 3H20A 3WIUA 3CPWM 2FF6A 4K4TA 1YJNN 2KDOA 3TPQA 3OUYB 4LFAK 4FVCA 2KB2A 5SWMA 2CA9A 1FVQA 1BISA 4USKA 2UXCF 4B3RJ 4LQ9A 1WD6A 2JNJA 1XMBA 1B0PA 2E7VA 4Y2CA 3CB4A 5EX0A 1D3WA 4FVMA 3CJ5A 3KNAA 3A8IA 1S9EB 4MKYA 1H73A 2ZD1A 1RDUA 3EZ5A 3OS2A 1P8ZA 3RMBA 2ZJPL 3B4DA 3VQCA 4IO9Q 1B99A 1QAYA 4LRDA 1HD1A 1GOBA 4RJVA 4W5TA 3CC2S 4HTIA 5KFVA 3B6BA 3AA4A 2ALYB 3P4UB 3A2FA 1X4EA 4ZVHA 4ILHA 4DV5K 3BR9A 2DITA 3BN7A 3BB5A 4X4RA 3PIPQ 3DLEA 4Q7AA 1SL2A 2QWQA 1JLBB 4L74A 2HS0A 2XO6A 3CC2N 3OJSA 1P1LA 2QX0A 3R3TA 1S6OA 1ACMB 4DV7K 1NGAA 4TSXA 2EC0A 4CT8A 1Q8BA 2VC1A 3D6MB 5DDOC 4JKFA 1YRXA 3IXQA 4WU3A 2NSBA 3LDNA 1V3SA 3TUPA 4CJKA 3IS9A 2BR0A 2IVOA 3VMFB 4DV3J 2KKZA 2VG5A 4YHHJ 4IDKA 2ZH9A 3GPAA 2D3UA 5LJ5Y 2VPYB 1DQ8A 2ZKUA 3HOTA 3QEPA 2GIQA 2EKYA 3M8QB 3P6YC 1RBLA 3OHRA 4C7QA 4DLGA 3H0PA 3EN9A 2RDIA 5LJWA 2NRVA 1Q8LA 3KHHA 3OT9A 3L4QA 3PYGA 3ONQA 4JLHA 4B3SF 2OPRA 4DTOA 4LFBK 2PT0A 3MAHA 2V68A 1CZ9A 3UDEA 3TAEA 4ECSA 2DGTA 5AJ3K 1UEUA 3U3YA 3RRKA 4DTJA 3UDVA 5B0DA 1R6YA 2HURA 4FDFA 2UXBK 1JLEB 2FBVA 4H0TB 4K2JA 4K0KK 3I82A 1XNQJ 3H5YA 1LW0A 3I56N 3NGIA 3SEOA 2LECA 3Q22A 1C1AA 1FF2A 3U3GA 3S3OA 1WEXA 2Q3SA 2E5HA 1AFJA 3RB3A 1YRUA 2B4OA 4KHRA 4YOTA 3ISZA 2WRMA 4CF1A 2XULA 1SKWA 2NXCA 5KT3A 2OEMA 3NMRA 3AVJA 4LFAJ 4YR2A 1TKTA 1HHQA 2VUGA 5EWFA 1R8PA 3B6OA 3CJ2A 1VQLS 1RWPB 5K20B 4XPEA 2UU9K 4Q0BA 1CVJA 1RDBA 1JKHB 1K1SA 4AFFA 1VMBA 2P9NB 4DZDA 1AA1B 1QVFR 2HIYA 5LMUJ 3PW5A 2KI2A 3EGNA 1ZM4A 4MDAA 1Y11A 3G6YA 4ECUA 1GOAA 4BC5A 1A7GE 4BWJA 3UVJA 1ATNA 3C0BA 2ILYA 3BKFA 1N8RO 1N0VC 3M8RA 4P2SA 1WACA 1U6ZA 4J9KA 1VBXA 4GNIA 3DGPA 3T1HJ 1N36J 1SPBP 2HBZB 1YI2S 3UKUA 1HMVB 3MEGB 4EYIB 1PKUA 2FBYA 1N32F 2D5RA 3RAQA 3JQKA 5BR8F 4CJVA 4DG1A 3VQSA 2KJWA 4YDXA 2MGZB 1IBLK 1S48A 3QBWA 1TMMA 2M7SA 4J9NA 1HPZA 1KEKA 4ZVSB 5C2GA 1DY3A 5KFGA 4YB1P 3KLFA 5HJYA 3I0RB 4ZVGA 3GE1A 2JEGA 3N6MA 4ES1A 4YQWA 4IQMA 2O8EA 3PSIA 3DLGB 5HO4A 3D1HA 4QIWD 1NSQA 1CJKA 2FVSA 4K4YA 1XERA 4LJMA 3OFGA 2VGMA 4NZ0A 1TR0A 2KM8B 1MW7A 3PX0A 1HD0A 1YAGA 3HO1A 2WTFA 4E1NA 4JI7J 4ZJOA 1S1UA 5B0EA 4CBUA 1W2BR 1YHQS 1V9OA 1ZA2B 3HZEA 3GCWP 3CMES 4ECTA 3EDQB 2BM0A 2O5DA 5BR8K 1UA1A 4DR6K 1QAJA 2HK2A 4GC6A 4C0OC 1LEOA 4FZVA 1CXQA 3RAXA 1F1BB 5KGXA 4FJ7A 1B92A 4NEYA 1N88A 1W97L 2RHQB 4CGGA 4DG1B 1X9WA 3ISND 1MLAA 4DV1J 2WVBA 3T1HK 4IOBA 3W1YC 2VD3A 1XMQK 1L3UA 2JFKA 5GAEP 1X5PA 9RUBA 2IS3A 3OS0A 1KCFA 2HF3A 3CCRN 3E3XA 2HFOA 3C8YA 3WXLA 1H1VA 4ELVA 3NKYA 4NLUA 4OI2A 3Q7CA 2B7BB 2GNKA 1FKOA 2OMLA 1KN6A 3H25A 5A0YB 1VHFA 1NOYA 2DY1A 5KFEA 2XSJA 4AUKA 2NXNA 4HHUA 4K25A 1EAYC 3SCJE 4OKEA 1ZZFA 2VDHA 3Q86A 1DEJA 4CZMA 4CO5A 4X62F 3HTVA 4QS8A 4Q43A 3VF6A 4YDDB 2JWLA 2AZ1A 2UUBJ 2GA7A 1WBBA 4E2FB 4YOEA 2DRAA 3D67A 3D0GE 4CHOA 4DQIA 4I6MA 1VFJA 3P5JA 3VQ9A 2X3DA 3P39A 1N5TA 1SIZA 3FEXB 4NCGB 3NH2A 5C42B 4FPIA 4FZYA 8RUCA 2MKKA 2M3DA 1FRMA 3LGHA 3OA9A 2CWXA 3UWTA 5D3GB 1U6FA 4LF8J 4CIOA 4ES2A 4X66K 4ECXA 1E6VA 3H90A 3A3PB 1UVMA 4W5RA 2WOMB 1S76D 1NH7A 2QLFB 2Q2RA 5ETVA 2HHUA 3JAMY 5HN0A 2D3O1 3OVNA 2NYIA 4JI8F 4FWRA 3EE3A 4Y1CA 4DN9A 4ZCIA 5HL7L 2GAGC 3A8KA 3HPGA 3SSRA 3UNGC 3GV5B 3FDSA 1MA9B 4DR4K 1YQHA 2VASA 1I6JA 4O8UA 2J0SD 3VETA 3AODA 3NGRA 1RAJA 3CCQN 5DMRA 1QSLA 2OANA 2OSQA 4KRFA 2KO1A 3IFRA 2XZTB 2FDNA 4KKOA 3SMSA 2QA4N 3KTQA 3O80A 3M32A 5AR0A 2WONB 1HKAA 4CD1A 3ZSXA 1VSLA 2FVCA 1DRZA 5LL6d 2KVQE 3OPKA 3T5JA 4BRFA 4RUAA 2W2MP 1RDAA 2E5LF 2HNZB 2HNDB 1M5OC 2Z1JA 3DXMB 2M2BA 3F73A 1HBMB 2ZHAA 4ED4A 4CJ4A 2WVFA 4ZLNA 3QRQA 1FCAA 4DX7A 4DV1K 2V7YA 3QQCD 1O1WA 5IXUA 4DLEA 1QQMA 2Y1RI 3LDQA 3U4LA 1FTCA 4CYUA 1Y3JA 5F8IA 2AGPA 4DR7K 3GIIA 5L1LA 3C6TA 2Q6BA 4KB7A 2DCLA 4KC5A 3JXUA 1Q7LB 2I2YA 3CJKB 2IM1A 4IKAA 4NASA 5IV4A 3FFIB 1EKSA 1LW2A 3C2PA 4MKBA 2GIRA 5EX3A 2RU9A 5KFHA 3Q8UA 4H4MA 2AWZA 3MAAA 4MYTA 4NOHA 3SAHA 4OV6A 2HFZA 3PEHA 4R0JA 1UL3A 2HB5A 4PG5A 1REVB 4K59A 5A2QU 3VQPA 4LFAF 1NGEA 1HYSB 1RT4A 4J9PA 2JJ4D 2H48B 1JLCA 1VK8A 3QPIA 2OYQA 3MOJB 3EKUA 4LT6A 1H6KX 4OYXA 4QIFA 4KGMA 4BRMA 2PBDA 3V5RA 2W1BA 1Q5YA 4IG3B 5IS2A 3TI0A 3SJJA 2C3YA 2QWMA 3EO3A 1HYZA 2X78A 1HQEA 4B17A 3G10A 5CYMA 5KFXA 4ZIVA 1U8SA 4DDFA 5GAEI 1JNRB 1JXVA 3NP5A 4C8YA 1FRHA 5DG9A 1TL7A 1VK0A 4DQSA 2Y9HA 4HI1A 2YNGB 2E1RA 5D4OA 2E6MA 4FLZA 1VSMA 2X74A 2E2PA 3ID8A 1DAXA 2AP1A 1ZAWA 4JI1J 3MPWA 1P90A 3HP9A 3KLVA 4NLGA 1FX2A 5E33A 1HRHA 3OL7A 1FXRA 4I2QB 1BWEA 2E66A 4K4UA 4FCYA 5E0OA 4HHJA 3ZFVA 4CEOA 3PFEA 2FZCB 1W25A 2GJFA 4CLPA 3NS7B 4HTJA 5FIIA 3IMXA 2HSEB 2FJBB 4HH1A 2V51B 2HZCA 1XK8A 3IUCA 2RDDA 4NYPA 3G6XA 3BBCA 5KFRA 3BSAA 1VC0A 5HMXA 3FSYA 4IRCA 1RBRA 3TQEA 1C6VA 1X5OA 5AXNA 1PYSB 2JEFA 1D5AA 4CLLA 3THXB 1EARA 3AVKA 4CO4A 4F4ZA 1BWVA 3L2VA 4WKYA 4ZJLA 4Z94A 5JVHQ 4RG8A 4N7TA 2YNHB 2V8PA 3NG8A 1WLJA 1Q95G 2VBYA 4Z4HA 2P2CB 5ETTA 2O4IA 2XS5A 1RT7B 3RB0A 2C1EB 5C2CA 4RW4B 3HSZA 1ASWA 3MM9A 2IJFA 2P9NA 2VFVA 3DDNA 5L39A 3GB0A 2ZBPA 3CDAA 1VQKS 2RIJA 5AE3A 1M5KC 1PBUA 4AE5A 1OYDA 3G8TA 3AVCA 4B3MJ 5TKYA 4PKDB 1LOTB 3AO3A 5CZ1A 4RW9A 2V6AA 4KE5A 5J2NB 4ERDA 3ZTQA 4EZ6A 5T41A 5AZJB 3OHBA 4PWDB 2J0QD 3J81U 4JI0J 3PR4A 5K5MA 2XEXA 5FJ4A 2A2CA 1G1XA 1HIYA 4RL1A 3BUZB 4YB6A 3KMSA 3QEWA 1NK5A 1NK9A 9ATCB