4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
1FJGK 4B3TK 4JI5K 1XNQK 2ZM6K 1I94K 4YHHK 4K0KK 4B3MK 4DR6K 4NXMK 1XMQK 4B3SK 4OX9K 1XNRK 4DV2K 2F4VK 4JYAK 3T1YK 2HHHK 4X64K 4LF7K 3J80O 4JI8K 4JI3K 4DV0K 4V19S 4LFCK 3OTOK 3J7YP 1N32K 2UXBK 4JI1K 2VQEK 4DV5K 1HNWK 4DV6K 4X62K 4DUYK 2UUAK 4DUZK 4GKJK 2UXDK 5LMUK 1HNXK 1N33K 4GKKK 4DV3K 4JI4K 4JI6K 1N34K 4CW7B 4DR7K 4LFBK 4LF8K 4DR1K 1IBMK 1HNZK 4DR3K 4JI2K 4DR2K 4LF9K 4DR4K 2VQFK 1HR0K 4LF6K 2E5LK 2UU9K 5LL6Z 4JV5K 4AQYK 4DV4K 1N36K 3J7AP 2UUBK 4X66K 4DV7K 4KHPK 4DR5K 2UUCK 3JAMO 5A2QO 1XMOK 4LF5K 1IBLK 4YY3K 1J5EK 4LFAK 4CVNE 5FLXO 5IWAK 1IBKK 5IT9O 5AJ3K 5BR8K 4X65K 3J81O 4LF4K 5LMNK 4JI7K 2UXCK 4JI0K 3T1HK 4NXNK 4DV1K 4B3RK
chains in the Genus database with same CATH superfamily
1W0HA 3QICA 4E1JA 1KLNA 4WE1A 2F8TA 4K0KK 1YTAA 3O3HA 3PX4A 4Z4FA 5M1PA 1S6PA 3D45A 1B9DA 3L4QA 4JYAK 3V9XA 4CGGA 1ZBIA 4X64K 4OPKA 4JI8K 1IJJA 1HJOA 3AAPA 2G8WA 1BI4A 4CJUA 4BRPA 1MU2A 1N6QA 1XHZA 4KHUA 3K9KA 4H5WA 4CFDA 4JN4A 2ZJPL 3ID8A 3ZT2A 5C2FA 1S72N 3OYNA 2O8FA 5KRSA 3MEDA 2QA4N 4CESA 4PL7A 4FJ7A 1XQSC 3OYMA 1SZ2A 1JCGA 4JRQA 4J2DA 3O4QA 3QIOA 4OKJA 2VG7A 3TI0A 3ZEUB 3MXIA 1NGGA 3KK2A 4FPAA 5JICA 3WQTA 2FLOA 2F96A 3O3GA 3THWB 1H1VA 4CEEA 1QSSA 1VSFA 4FW2A 4CGIA 3MN7A 4PA1A 4CJVA 5DMRA 1V4TA 1NGFA 2QKBA 1WUAA 2HBMA 1U6ZA 1X3MA 4R79A 1WBDA 1WSIA 2X78A 4DTSA 4FLXA 3SZ2A 2CH6A 2Z1JA 4NO7A 4CVNE 5J2MA 1WB9A 2ZJQL 3O9TA 4DSKA 3ZETA 2BH1A 4QAGA 3IAYA 1D9DA 3ISNC 3OS1A 2F7TA 3ZYYX 3QEXA 1SS6A 5T7BA 4Z4EA 4FWLA 4AHUA 1HQEA 2OYQA 4K8XA 4G1QA 5I9EB 1NLVA 3PSIA 4B3TK 4JLHA 3VA0A 3EZWA 4H5TA 2FBXA 1TAUA 2NRXA 2JLEA 1S1XA 3DYAA 1D5AA 3CG7A 2HHXA 3NDKA 1S1VA 4AH9A 3SK3A 5AQTA 4LF7K 4JKHA 3AGKA 3K59A 4HVJA 2Q36A 3HPGA 2QM1A 2D0PA 3EE8A 5F1XA 4ISFA 4IJNA 3EE9A 4WQ5C 4K8ZA 1RILA 3V9UA 3GL1A 4BDPA 4LFCK 1RTJA 3ENOA 3WXMB 4CJEA 4W5QA 2DPNA 1YVUA 4BDYA 3AGRA 1HKGA 1TKTA 5GAHP 2E2PA 1QSLA 4AHTA 2BANA 2Q1NA 4IBNA 4W5NA 3WEEA 1JLBA 2Z1GA 2OPRA 3LM9A 4DR7K 1HQUA 2YJFA 3OYKA 2E8AA 1BL3A 1GLBG 3IUCA 4H5RA 1TYQB 4N5SA 3CJBA 2P5GA 2HHSA 4DS5A 1X3NA 3DWLA 3LWMA 3I55N 5LL6Z 3K5MA 1NKCA 3CCSN 4N47A 4CZHA 2QK9A 1CZ9A 4I7FA 4FWOA 5BREA 5AQJA 3MCPA 2QWNA 3FZHA 1K9MO 1W7AA 1KSPA 1ESVA 4CFAA 1WAFA 1IBKK 5BRHA 1BA0A 3E01A 4Z4GA 3VEYA 3QLHA 3TSQA 4CJRA 3OBYA 2P9SB 1Q81O 4GV6A 1HYZA 4M3ZA 1TYQA 3HPOA 2ZJRL 4CD1A 3V81A 5AR0A 4N41A 4JKGA 4WFAL 4DTOA 3OYAA 5C15A 1P8ZA 4CF0A 4DF4A 3THXA 2XY6A 1BCMA 3P83D 3T7ZA 2OPQA 1MWKA 1SKRA 3PLAA 3TR8A 1RBUA 2FC0A 4Y0WA 4CJSA 1Q86O 4E7KA 4B9NA 2F9WA 3KK7A 4ISGA 3WNHA 3LP0A 1NJYA 1NK8A 2JGUA 1RTHA 3QEVA 3AVJA 4QS9A 3A5NC 3SBTA 4DCHA 3V9WA 4O0JA 5DK5A 5EY4A 2OZMA 3NH1A 3CM5A 3B6PA 5E26A 5F0XA 2UXBK 4DQIA 1HNWK 4CJ3A 4JKGB 3E9OA 1QQNA 5AQIA 1DT9A 4J2BA 4JD2B 3DXMA 3HTVA 3R9PA 1HNXK 3RMBA 4GKKK 1TKZA 3A8YA 4GVMA 3NGIA 4LFBK 4ELVA 3BF1A 3M3ZA 1ZC6A 3R6MA 3RMAA 4IJAA 3PY8A 3D2FA 2ZWHA 1KVBA 3AVBA 2DFEA 2HB5A 2NNWA 1EWQA 3VA3A 1MA9B 1ASUA 3J7AP 1KAYA 1E4FT 4CJFA 3QFPA 3OHRA 1G99A 4KO0A 2NUBA 1NK0A 4N76A 3MK6A 3DLBA 4K25A 3PSFA 1BA1A 4I2QA 4JD2A 3DXMB 3CM6A 4FZYA 3ASMA 5KQ8A 5FPDA 2A42A 1NWKA 4CEAA 4KH5A 3SUPA 2DY4A 1NGHA 3VQPA 3D2EA 3HPHA 2YHAA 5CR4A 2GV9A 2KZZA 1C0MA 5GAGP 3VQ7A 4EP4A 2RE2A 3D2FB 3VESA 4XEIA 1BCOA 4FVMA 4CZIA 1RDWX 3L6QA 4JK8A 3DRPA 2RPIA 1XNQK 1I94K 3I0RA 3LWLA 4CZEA 1C6VA 2GEMA 1L5UA 2PYLA 2DTUA 1EQYA 4DSEA 1XNRK 3CCEN 4JHDA 2WOMA 3CJ7A 3CIPA 4RW8A 2P51A 3O6WA 4DSLA 5HROA 4M3TA 1BQMA 1UOCA 3BF3A 2ZGZA 5KRTA 1T8EA 3SQ1A 2A1SA 1NKEA 2HHWA 4DQPA 1IO2A 2O8CB 1VSLA 4O4GA 4QS8A 4GW6A 2E1ZA 3LANA 4YOUA 4KB0A 3SQ2A 5C0YA 1LAWA 2A1RA 4I2PA 3RVCA 2A40A 1NJZA 4GKJK 2KQ2A 4A62A 1N33K 3ZSRA 3C7NB 4K42A 3OYJA 1NGEA 2BGGA 2Z1IA 4CHNA 4H5VA 3T1AA 1HPMA 2WONA 1KLMA 2ZF5O 3G6EN 3HK2A 1LW2A 4ID5A 3I8BA 5JVHL 5I3UA 2GBZA 4OO1J 3VQ4A 3CJAA 4OPHA 4CE9A 1J54A 3SNNA 1ASWA 2V7YA 3S3NA 4FJJA 1NK4A 3DI6A 4JK7A 4F3OA 4KI4A 4O0IA 2OA8A 1DTTA 3VF4A 1WSEA 2YJEA 3E66A 3C0BA 2P9PB 5ELZA 1RT6A 3AARA 3L3VA 4B9UA 2IOCA 4GV9A 3DLEA 5AJ3K 1X9MA 1VQ6N 1RCHA 5J2NA 4HCCA 4Q5VA 3WXJA 3CCLN 4H0OA 1KVAA 4JKAA 4FLVA 4KFBA 1XWLA 4JS5A 3E9LA 3OVNA 3OS0A 3AO1A 2QWRA 3AVNA 4PHTX 4B3SK 5KGWA 2PZSA 3VQ6A 2QWPA 4HTUA 2QEXN 4ZTJA 2IVOA 5M1QA 3DXKA 1JCFA 1C1BA 2HNDA 2IVPA 3PX6A 1DGKN 4A2AA 2YHXA 3PIOL 4JNEA 3BDPA 2P9PA 1QQOA 3CQXA 3VEZA 1Q82O 1RDDA 4EAHD 3O80A 3SAFA 4IOCL 4PKHA 1CLQA 2X74A 3SCXA 2B6AA 1VQ5N 3P31A 4DB3A 1ATSA 1KXPA 3RWUA 4B3OA 2HF4A 4FWPA 2YKMA 1L3SA 2FF3B 3C6TA 1BGXT 3IKMA 4I6MB 4DQQA 1BO5O 3SPYA 3G71N 3O9SA 1K73O 4CIFA 4BGAA 4JKFA 3DXKB 3ZX3A 3UIQA 3MXMA 4CK1A 1SL0A 4JKCA 2I7PA 3VGLA 4LF9K 3CCVN 3EO3A 3SLCA 4IZ9A 4IXCA 4HUFA 1UWBA 3H1QA 4YOYA 3OYDA 3ENBA 3WNGA 4CBUA 3U3GA 3CMEN 4FWMA 1LAVA 4FWQA 3SJHA 1GLDG 3CF5L 3SI6A 3AVCA 1WN7A 1VK0A 4RW6A 3MX2A 2O8BB 5CZ1A 3L2QA 2YNGA 5EX5A 2A6AA 5M1NA 2IVNA 4YY3K 3LDSA 2Q2RA 4LFAK 3FR0A 3VGMA 4IOXA 2GWJA 2D1KA 3CD6N 5J2PA 1RBRA 3M8PA 4M63C 2CGKA 1IG9A 3HYFA 1ZYQA 1ASVA 5AQGA 4M42A 4B1ZA 2HHUA 2QW9A 1L3VA 4ZTFA 2P5OA 1QS4A 1Q8IA 3T3FA 5C24A 3NAEA 3AO5A 3O9RA 3AA4A 1W2BM 4DLGA 4RW7A 2WBNA 3FZLA 4TSXA 4B8AB 1QTMA 3TAGA 3OYLA 1FXXA 4J2AA 3O1WA 4KHYA 3U4LA 3TSPA 3T1YK 2G8UA 4QOZB 3ZX2A 3R1XA 1YITN 3WNEA 3OYCA 3VQ5A 2HF3A 1ITGA 2IGIA 5AZJA 4YOVA 2KZMA 5JS1A 2HBJA 4DWIA 1JLCA 3JYTA 3U8XA 2EHGA 4GV3A 2BTFA 2P9UA 1RNHA 1D9FA 2D0CA 3QBWA 4FWRA 1FKOA 4DS4A 5FRMA 1CXQA 2Q0UA 1VQ4N 4FL9A 3O8MA 4KB1A 3BZCA 5GAEP 3AAQA 3VTIA 1BOTO 1HRHA 1WLJA 3D0PA 2D5RA 1HYSA 4KKOA 1T05A 3M8SA 4DR1K 1LWFA 3N4QA 3BGRA 4DU1A 3LZJA 1J9AA 4E89A 2NRRA 2OCEA 4FJ5A 4DR4K 3QMLA 5AZJB 3F73A 1S3XA 4BG8A 3KLFA 2IIRA 5C2DA 4DFPA 4CJTA 3CERA 2KLAA 4IEEA 4KHQA 3JAMO 4FM2A 1OVYA 4CEFA 3OW2M 1J5OA 3F9KA 3LP3A 4DFKA 1K6YA 5AQRA 2GWKA 3HM9A 5FDLA 3N4PA 5BR8K 5GADP 2BDPA 1TL1A 5H1SQ 2E4LA 1Q9YA 2UXCK 2RN2A 1RFQA 4KAZA 1ZBUA 2E2OA 3KJVA 4E7LA 3MWPA 4EFHA 2QWLA 5D3GA 5MLCQ 4F2SA 4F8RA 2PFUA 1OH8A 1C1AA 3ATVA 3CC2N 4RG8A 4M45A 4E7HA 2A41A 3MAQA 1ATNA 1BWFO 3UB5A 4AF1A 2OPPA 3IG1A 3SMPA 1R0AA 3F2KA 4A5AA 4FW1A 4O5BA 4JRPA 2HHQA 1JLFA 3FFKB 4BVOA 2W41A 5AZIB 4CJ5A 1NK7A 3GG4A 2P9KA 3QDKA 1RT5A 1F21A 2RKIA 3CETA 2VGMA 3ZT3A 3V1QA 1RT4A 3WXIA 3CJ9A 2QXLA 1ILYA 2X6NA 4YOWA 2VWKA 4BVPA 4JI1K 4C8LA 3K2PA 4YNQA 4YDUA 2WUSA 2ATQA 5AQPA 2CGJA 3DLHA 1VQ9N 1RT2A 1HNVA 2D0AA 4BR9A 3VQQA 1WSHA 3SUNA 1NJXA 3C6UA 3MN9A 4OVLA 1JLAA 4NLBA 1JJ2M 2O8EB 4LF8K 3L2WA 3UKRB 4CERA 3PO4A 3KTQA 3VQAA 2BE2A 3OYHA 2P9KB 3P39A 1TVRA 3LDPA 5ADXA 4FVUA 1FKPA 4IEIA 1KFSA 5CYMA 2HSTA 2UYTA 4PQUA 3NFAA 2XRIA 4AILC 5KQDA 4FOIA 1U04A 4BC2A 4DTUA 4I9LA 4PKIA 4XH4A 3L2VA 2FSJA 4BY9C 3CQ8A 1OH7A 1HNIA 4FZZA 3EZ5A 4WQ4C 2CH5A 2GELA 3LPTA 1IBLK 4HHTA 1I3AA 3O5BA 4FOEA 3M5RA 1U49A 4B8CA 1VAZA 1QHTA 1VQON 2PY5A 1T03A 1IKWA 1S1TA 4M3RA 3KZBA 3UKRA 3V9SA 1YUWA 2WC9A 4H4OA 4A2BA 4DU4A 3KD1E 5HRPA 1SKSA 3VGKA 4FK0A 1FJGK 2A3ZA 3ZSZA 1NKBA 3ZLJA 4FK4A 2W40A 5LJVA 1J6ZA 1REVA 2FSKA 4DQSA 2EWSA 2YKNA 3Q7BA 3CCJN 4YOXA 2FXUA 1XMQK 4KH6A 4KHWA 4OX9K 2W6LA 1NMNA 3DLKA 1VQMN 2E88A 1Z25A 2GX9A 1Q9XA 3ALYA 4WF9L 4B9VA 4NB4A 1YJ9N 3G4SN 2P9NA 2BUPA 3B8AX 1A5WA 5HBMA 3PV8A 4WQ5A 2VCPA 3UKUA 3RMCA 1JXEA 4C1NI 3L2UA 2YI1A 3HZ6A 2NRZA 2G8HA 4LSNA 4BR2A 4KHNA 4FWNA 1VRTA 3O4WA 3ZSVA 4Q0BA 4PY5A 1C0GA 1GLFO 3WXLA 3AA3A 1IH7A 3QERA 4A57A 3L8BA 4DV3K 1DLOA 2OPSA 1GLCG 3S3MA 1IV0A 4B9SA 3OYEA 2HMPA 3HP9A 2FBYA 3ATUA 3QO9A 4KV8A 4Y1CA 3VTHA 4FJLA 5EU7A 4DSFA 3AVAA 2E5LK 4AHRA 1XC3A 3ZX0A 1JCEA 2YNIA 3NHGA 3VEWA 5HP1A 2UUBK 4BR7A 5BR9A 4CJLA 1M90O 1NJIO 4WQ4A 4O5FA 3MECA 3O1BA 1RT3A 5AQWA 3KKSA 3NCIA 5C10A 3DMJA 5KTQA 4FJMA 3NBPA 3OBWA 1NGAA 1BI4B 4KI6A 1IG8A 4GVEA 5K14A 2XY7A 2XY8A 4JS4A 1JL2A 4EZ9A 3ZT0A 3KLHA 4B1YB 4HUEA 3QBXA 5CZ2A 4XIUA 5JLHA 3RRGA 3T1HK 4F4KA 3A5OC 4DV1K 3HXMA 1GOAA 4JI5K 5EXWA 2HVIA 1HYVA 4MO5A 4GNIA 4NXMK 2VYPA 1VQLN 3DOLA 1KTQA 2B4JA 4FCYA 2HBKA 4PL8A 4FJIA 2P1JA 4RCHA 4EHUA 5JLFA 4CJ4A 1QVGM 3RR7A 3OS2A 4IG3A 3A5MC 5AQKA 2E20A 3E9PA 3L0QA 4CEBA 1NK9A 4OKKA 2HNYA 3THWA 4FLUA 3TABA 3AA2A 3VETA 5DM6L 3NE6A 4FM1A 1NU0A 3EN9A 3CCQN 2F8SA 3P4IA 2VGNA 2XHBA 1TL3A 3JS6A 3VENA 3ZETB 4AHSA 1HLUA 3SBGA 4EP5A 4LC9B 3FZMA 3CFPA 3LDLA 4BE1A 2ZE2A 1ZBFA 3MXJA 1YXQA 1X9JA 1BU6O 1XC9A 4RTFD 5SWMA 1CZBA 2HOEA 2QWMA 3SQ0A 1C0UA 5GIOA 3HT3A 4YOTA 1QQCA 2QTDA 4OJRA 1P90A 3AVMA 1NM1A 3IS9A 1UA1A 1J53A 2G8KA 4C8KA 4E0DA 3QEWA 1S5JA 2XO7A 3W3DA 4BE2A 2O8FB 5BN8A 3THVA 5C12A 4BC4A 3ULDA 4W5RA 2DFHA 2P9LA 1TAQA 1KAXA 4CZKA 2Z1HA 4MFBA 4JI7K 1WOQA 4CZJA 5BPMA 1BUPA 4A5BA 4RWTA 1S22A 4BREA 4L3QA 1BISA 3ZEUA 3V1OA 4B1UB 2J4RA 4BR4A 1MDUB 1L3TA 1T7PA 3NVMA 2NRTA 3SQ4A 4A59A 1XI1A 3VQCA 5C42A 1VSMA 2VG5A 3WEEB 5ADXH 1YTUA 1Z6RA 4LH5A 1SAZA 4E3SA 4FJNA 1DTQA 1KRPA 1TUYA 2H3GX 1ZBLA 1MWMA 2I5JA 4DKWA 1Z26A 1N5YA 1LWCA 3CHWA 4CIEA 2IAJA 5KPTA 1B9FA 3NF6A 3RRHA 2P9LB 1U2VB 4FXDA 3B6OA 4KRFA 3HM8A 4EZ6A 5JVGL 4FLWA 2D0OA 4DV5K 4DSJA 3MWTA 4BRAA 1VQ7N 4C8NA 4CFBA 4A61A 4CIGA 4CF9A 4U67L 4DUZK 3VQBA 5LMUK 5AQVA 3PUFA 4NCAA 2G8FA 2OTJN 1TK8A 2HMIA 2PYJA 3K0SA 3CXCM 1NGBA 1RBSA 3ITHA 4BC5A 5HL7L 1EETA 2YX6A 4E7IA 4DMNA 2ITMA 4MQ3A 1LOTB 2D4WA 3D7EO 4BRKA 1T6CA 3KVGA 3WUHA 4B9MA 4HUGA 1WAJA 4FM0A 3U3YA 1U2VA 3AA5X 4B9LA 3NGYA 4FLZA 4I9QA 1EXQA 2FSNA 3LALA 2KFZA 3I0SA 1LCUA 3WNFA 4DV7K 1BIZA 3C6HA 4E1MA 5A2QO 2OANA 4FZXC 3QESA 3O08A 3EL2A 1J5EK 1NMDA 4ZHRA 4WYBA 5IWAK 4CHZA 3AVFA 3KWGA 4E7JA 4IO8A 1JLGA 4OKEA 4H0VB 3HBTA 2YCHA 1JLEA 3IDHA 5AFUH 2ZM6K 1BIUA 1Q7YO 3VEVA 1HKBA 5C25A 3IFRA 4NCGA 1YVNA 3QNOA 4DV2K 4CGFA 4KH4A 4B1XB 3HP6A 3ULEA 4OGEA 3HJFA 3LDQA 3P1GA 4CHPA 4CEZA 3K5OA 3NVKA 3R3LA 2P9SA 4CJQA 4NYNA 1N8RO 2E6MA 5E84A 1RDBA 1TV6A 3HVTA 1TK0A 1D4XA 4G9ZA 4YDUC 3GE1A 3ZT1A 4XH5A 4X62K 3K5LA 1Y64A 4DUYK 3TAPA 1S9GA 2OTLN 3AV9A 2QXFA 3THXB 2UXDK 3H45C 1NGIA 1DKGD 3VF6A 2NRWA 3KHYA 1N34K 3T69A 4WFBL 3QFUA 3RSEB 3SV4A 1IBMK 1QZ5A 4CK3A 4IKFA 1E3MA 4BDZA 1L3UA 3ULEB 4DR2K 2E2QA 3KWIA 2VQFK 1KD1O 2RHKA 3WXKA 1U47A 4LSLA 3KIOA 1JLQA 3DRRA 2Y1IA 1TUUA 3MN6A 3CCRN 4AQYK 5AQSA 4DV4K 3V4IA 3H08A 4KTZA 3I56N 3EY1A 4BC3A 3S3OA 3PO5A 4LF5K 4JHDB 1A5XA 3V9ZA 3LDOA 3DRSA 3PIPL 2VG6A 2HHVA 1K8AO 2O4IA 4FJKA 3T19A 3RSEA 3DM2A 4O8UA 4C23A 3MN5A 4BQLA 3C95A 4MDAA 3TTFA 3M1FA 2G8VA 4EIAA 5KI6A 2ZD1A 4CBWA 4BRCA 4CEQA 4C8MA 1YIJN 3LL3A 1GLAG 1KVCA 3LZIA 4FLYA 4AHCA 4DR6K 4FO0A 3DLRA 3VEXA 1RTIA 4BROA 4YFUA 3OA9A 4CI6A 3VQ8A 4FJ9A 4E1NA 5EVZA 2IDOA 3SPZA 2CGLA 2NRVA 1M1KO 4FJHA 3VN5A 2E1YA 5LY3A 3J80O 5AQOA 3H46O 4DLEA 4FYDA 4BQZA 2D0BA 3D2EB 4NLCA 1I39A 4JI3K 4LH4A 4B08A 4H0YB 4DG1A 5F2RA 3ZSXA 3KLEA 2FBVA 3MEEA 1C0TA 3QIPA 1DEJA 4NCBA 4LY7A 4M3YA 3WQUA 4HTLA 3IRXA 2DFFA 3J8AA 1X1PA 1LWEA 3TANA 1C0FA 1EO1A 3MX5A 2FF6A 4CK2A 4ICLA 3U9ZA 4AM7A 2Q31A 3LAKA 2LSNA 4CW7B 5HRNA 4CF1A 3M8RA 5E41A 4BR5A 1VQ8N 4JI2K 4CGHA 1OH6A 4YORA 1QQMA 4C1NK 3VOVA 4MO4A 4OGCA 4BR0A 1NGJA 1QVFM 1NK5A 2GTDA 2R7YA 2OZSA 4ILGB 4JV5K 1N36K 1D8YA 2O8CA 3KLIA 4ELUA 3TPQA 5BN9A 5FROA 1YHQN 5KGXA 1EP4A 2ZGYA 3P38A 5M1OA 2JWLA 2GUPA 3C7NA 2V51B 1XHXA 1HPZA 1NGDA 3FE1A 3MMVA 4WCEL 3LP2A 1RGIA 3SAGA 3I8DA 5HRSA 5LMNK 3EYZA 4CD3A 3FZFA 3NMUA 4GMJB 4KREA 3ZT4A 4CJPA 1QE1A 4ILJA 4PUOA 4OLAA 2AA4A 3C65A 2HVHA 4DSIA 3VQ9A 4IDKA 5AQYA 1IKVA 3V1RA 4JK9A 1NNEA 2FBTA 3K9JA 1TKXA 2VWJA 4IFEA 1SV5A 2HHHK 3DJCA 4DTJA 3PX0A 3SUOA 3FZKA 1YJWN 3WT0A 1NK6A 4FSVA 3P5JA 3ZSQA 3ZSWA 1VSKA 2KKZA 1O13A 5J1EA 4PWDA 4V19S 3FFIA 4CJWA 1KAZA 4BRMA 4BWJA 3OTOK 3SYZA 3RMDA 1N32K 1RT7A 3CI5A 1TKDA 1VRUA 1RDAA 1YF5L 1WSJA 2QWQA 3GOIA 1X9WA 2O8BA 3RR8A 1EX4A 1Z05A 1TGOA 3HO1A 2I7NA 3G10A 1VSEA 4JI6K 4DTRA 2Q3SA 1HUXA 3FLCO 4DF8A 4CF8A 4Z0UA 4IO9L 1UA0A 4UY8O 1GOBA 1V4SA 2YNHA 5AQUA 4CECA 1GLJO 1OKJA 4M7XA 1QZ6A 4EHTA 2Q97A 3L2RA 4W5TA 3LP1A 4Z4CA 2HW3A 1NOZA 5GINA 1RDCA 1JL1A 4BRGA 3TU5A 1U4BA 1T6DA 1NGCA 3CCUN 3CMAN 5AQFA 4KTWA 4DR5K 1GOCA 2NLXA 3LAMA 4H0TB 5TKWA 3ID6A 1CZAN 3I33A 4I6MA 1EKEA 5CYQA 4ID1A 4IOAL 4R5PA 1NBWA 3SJJA 2O4GA 4X65K 3NGZA 4CZFA 2PAVA 3S41A 3SAHA 3DAWA 3CFOA 4MLEA 2QKKA 3TAQA 4OPAA 3AVLA 4K43A 2W6KA 3O3FA 1EWRA 3EKUA 2P9UB 3MDQA 3QINA 5DM7L 4HCBA 2PBDA 2YHWA 3TTDA 4DQRA 3OY9A 3ZCMA 3SMSA 4BWMA 1UAXA 4CZMA 3VF2A 3VMFB 1VQKN 1KFDA 5AQNA 1QHAA 4CF2A 4JKDA 2E2NA 1XUPO 2QWOA 4NYFA 4H0PA 3BP8A 4BRIA 4QS7A 3A0IX 3G0ZA 3C94A 4DTXA 1JKHA 1A5VA 2B5JA 1VSJA 2ASPA 3K5NA 4CZLA 1G15A 3H3OB 3JXUA 4H0XB 1WNSA 4DU3A 5SZTA 3TWHA 4CCHA 3J7ZO 2RF2A 4J2EA 2Q0RA 3BEXA 4PKGA 4CFCA 1BDGA 3HL8A 4DV6K 4OLBA 1BHLA 2WFBA 5BRFA 3HI0A 2UUAK 3LM2A 3HSTB 4IWVA 1T3VA 3NH2A 1VSHA 1T44A 4CEOA 1CXUA 3CFRA 5BPLA 4F2RA 1NOYA 3QB0A 4BRHA 4RW4A 2ASOA 3OYGA 4KBOA 4Y1DA 5FPMA 4IDHA 4IFYA 2ETJA 1E4GT 5HRRA 3V6DA 4C8OA 1HR0K 3F5TA 3EEQA 1YI2N 3TAMA 4MLHA 1TK5A 2UU9K 2GUIA 3GBTA 2KFNA 3TARA 2HBLA 3CJ1A 5TKYA 3OYBA 4J8FA 5AQQA 5FPNA 1SQKA 4X66K 4N56A 2JWKA 2HHTA 3CPEA 1VSIA 3NF7A 3NF9A 3HOTA 1NG9A 3E1YA 1B92A 2YV0X 2UUCK 4QCLA 3TTCA 3CYMA 1KQSM 4B9QA 4KHSA 5AZIA 1RTDA 4MDBA 2KHOA 5CY4A 3A2FA 4M3XA 4KTQA 5FLXO 3MEGA 3VEOA 3HSCA 1WSFA 3SUQA 3J81O 1KC8O 5M1KA 3S9HA 1Q18A 4GY2B 3KK3A 3M8QA 4JEPA 4O44A 3OJSA 4BRFA 3AVIA 3Q7CA 3AVHA 4W5OA 1SKWA 3ZSOA 3AO3A 1W97L 2QI2A 5CE3A 5AQHA 3KKRA 2V7ZA 4YHHK 4FWKA 2O8DB 1IKYA 3IMXA 4DTPA 1GLEG 4JKEA 2W42A 3AVGA 2F4VK 4ISEA 5AFUA 3K58A 4DTNA 1JXBA 4BE0A 2AP1A 5LJWA 4XH1A 4F9OA 2YNFA 1ZBSA 3H6EA 5GIPA 1YAGA 5BPNA 4B1VA 4CBXA 3J7YP 3QNNA 4CHYA 1O1WA 4IFVA 2VQEK 4CEDA 5AQMA 3VQEA 5KPZA 3UE5A 5EOYA 4M7YA 4FK2A 4FPBA 3C6AA 4FJGA 1U45A 4CZGA 3THYB 2V52B 2O8DA 1RBTA 4H4MA 3VQDA 3K57A 1K8KA 4FJXA 4OPJA 2EX3A 4CGDA 3EKSA 5J2QA 5CHIA 3A5LC 3U9DA 1NJWA 3CQYA 4LD0A 3W0LA 4BRQA 4H5NA 1IKXA 4LF6K 1C1CA 1OH5A 3OYFA 2X6SA 3JSMA 3HVRA 4CJKA 2IS3A 2HNZA 3DLGA 2YHBA 4DFMA 3QETA 4DHYA 3AY9A 3D6RA 3MCAB 3G25A 2VWBA 1FW6A 4BRDA 3VPZA 4Z4HA 2ASMA 3THYA 3BZKA 3CC4N 3NH0A 3TAFA 1SUQA 1K8KB 1U48A 3QEPA 4CGJA 1LW0A 3UKUB 4FLTA 2O8EA 4LF4K 1R59O 2NRHA 1HKCA 4E19A 1VQPN 5JS2A 3R8EA 2NZTA 4NXNK 4IG0A 3L3UA 1LV5A 2P9IA 3KK1A 5FRNA 4AM6A 4B1WB 3AO4A 4RW9A 3H3NO 4B3MK 3LDNA 2XY5A 1HMVA 2AJQA 3HRGA 3NF8A 2E6LA 3CJCA 5JMVA 1GLLO 1ZBHA 1HX1A 3KD5E 2IC3A 2ITGA 4K41A 1YT3A 4DTMA 3BY5A 2WTUA 3M6GA 1WBBA 3HOSA 3DLLL 4DV0K 1QSYA 3O4NA 3RTVA 4BACA 1W9HA 3CPWM 4M3WA 5AQZA 3OJUA 1FK9A 2A5XA 1VQNN 1OVQA 3AO2A 4JAXA 3VERA 5M1FA 2P9IB 3AVKA 1BG3A 4UQGA 4BG9A 1RT1A 1S1UA 5FPEA 1VHXA 2G8IA 1RBVA 4JI4K 1S9EA 1KCFA 3FGUA 1S6QA 4CHQA 3O9UA 5B8HA 3H1VX 4H03B 5AQLA 1BQNA 1SL1A 1S1WA 1WSGA 1HNZK 4DR3K 2KW4A 3LPUA 4KPYA 2P9NB 4ILHA 1RDUA 1ZXOA 3OYIA 4B9TA 1SL2A 3CC7N 4ELTA 4FJ8A 3SV3A 3CCMN 4FWSA 1VSDA 4CJ7A 4BRNA 4F3TA 1HJRA 3QEIA 4Z4IA 3TAEA 5HLFA 2KTQA 4DFJA 4CHOA 3ZSYA 4O55A 1YJNN 4WFNL 4KHPK 3U6FA 3ENHA 1XMOK 3BUZB 3F9MA 4U7BA 5KPRA 3GDQA 3TSUA 4HWIA 2YHYA 4BGBA 1X9SA 3L4IA 4BRLA 5IT9O 1Y97A 5BRDA 4DQ8A 4M41A 3KLGA 4L8RB 2ZQBA 2F9TA 3DOKA 4JI0K 2Y1JA 5I42A 3O9QA 5AQXA 5HOOA 4O8KA 4JKBA 1ATRA 4AHVA 4Z94A 4M3UA 4H8KA 4B3RK
chains in the Genus database with same CATH topology
1FJGK 4B3TK 4JI5K 1XNQK 2ZM6K 1I94K 4YHHK 4K0KK 4B3MK 4DR6K 4NXMK 1XMQK 4B3SK 4OX9K 1XNRK 4DV2K 2F4VK 4JYAK 3T1YK 2HHHK 4X64K 4LF7K 3J80O 4JI8K 4JI3K 4DV0K 4V19S 4LFCK 3OTOK 3J7YP 1N32K 2UXBK 4JI1K 2VQEK 4DV5K 1HNWK 4DV6K 4X62K 4DUYK 2UUAK 4DUZK 4GKJK 2UXDK 5LMUK 1HNXK 1N33K 4GKKK 4DV3K 4JI4K 4JI6K 1N34K 4CW7B 4DR7K 4LFBK 4LF8K 4DR1K 1IBMK 1HNZK 4DR3K 4JI2K 4DR2K 4LF9K 4DR4K 2VQFK 1HR0K 4LF6K 2E5LK 2UU9K 5LL6Z 4JV5K 4AQYK 4DV4K 1N36K 3J7AP 2UUBK 4X66K 4DV7K 4KHPK 4DR5K 2UUCK 3JAMO 5A2QO 1XMOK 4LF5K 1IBLK 4YY3K 1J5EK 4LFAK 4CVNE 5FLXO 5IWAK 1IBKK 5IT9O 5AJ3K 5BR8K 4X65K 3J81O 4LF4K 5LMNK 4JI7K 2UXCK 4JI0K 3T1HK 4NXNK 4DV1K 4B3RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG K;  4B3T K;  4JI5 K;  1XNQ K;  2ZM6 K;  1I94 K;  4YHH K;  4K0K K;  4B3M K;  4DR6 K;  4NXM K;  1XMQ K;  4B3S K;  4OX9 K;  1XNR K;  4DV2 K;  2F4V K;  4JYA K;  3T1Y K;  2HHH K;  4X64 K;  4LF7 K;  3J80 O;  4JI8 K;  4JI3 K;  4DV0 K;  4V19 S;  4LFC K;  3OTO K;  3J7Y P;  1N32 K;  2UXB K;  4JI1 K;  2VQE K;  4DV5 K;  1HNW K;  4DV6 K;  4X62 K;  4DUY K;  2UUA K;  4DUZ K;  4GKJ K;  2UXD K;  5LMU K;  1HNX K;  1N33 K;  4GKK K;  4DV3 K;  4JI4 K;  4JI6 K;  1N34 K;  4CW7 B;  4DR7 K;  4LFB K;  4LF8 K;  4DR1 K;  1IBM K;  1HNZ K;  4DR3 K;  4JI2 K;  4DR2 K;  4LF9 K;  4DR4 K;  2VQF K;  1HR0 K;  4LF6 K;  2E5L K;  2UU9 K;  5LL6 Z;  4JV5 K;  4AQY K;  4DV4 K;  1N36 K;  3J7A P;  2UUB K;  4X66 K;  4DV7 K;  4KHP K;  4DR5 K;  2UUC K;  3JAM O;  5A2Q O;  1XMO K;  4LF5 K;  1IBL K;  4YY3 K;  1J5E K;  4LFA K;  4CVN E;  5FLX O;  5IWA K;  1IBK K;  5IT9 O;  5AJ3 K;  5BR8 K;  4X65 K;  3J81 O;  4LF4 K;  5LMN K;  4JI7 K;  2UXC K;  4JI0 K;  3T1H K;  4NXN K;  4DV1 K;  4B3R K; 
#chains in the Genus database with same CATH topology
 1W0H A;  3QIC A;  4E1J A;  1KLN A;  4WE1 A;  2F8T A;  4K0K K;  1YTA A;  3O3H A;  3PX4 A;  4Z4F A;  5M1P A;  1S6P A;  3D45 A;  1B9D A;  3L4Q A;  4JYA K;  3V9X A;  4CGG A;  1ZBI A;  4X64 K;  4OPK A;  4JI8 K;  1IJJ A;  1HJO A;  3AAP A;  2G8W A;  1BI4 A;  4CJU A;  4BRP A;  1MU2 A;  1N6Q A;  1XHZ A;  4KHU A;  3K9K A;  4H5W A;  4CFD A;  4JN4 A;  2ZJP L;  3ID8 A;  3ZT2 A;  5C2F A;  1S72 N;  3OYN A;  2O8F A;  5KRS A;  3MED A;  2QA4 N;  4CES A;  4PL7 A;  4FJ7 A;  1XQS C;  3OYM A;  1SZ2 A;  1JCG A;  4JRQ A;  4J2D A;  3O4Q A;  3QIO A;  4OKJ A;  2VG7 A;  3TI0 A;  3ZEU B;  3MXI A;  1NGG A;  3KK2 A;  4FPA A;  5JIC A;  3WQT A;  2FLO A;  2F96 A;  3O3G A;  3THW B;  1H1V A;  4CEE A;  1QSS A;  1VSF A;  4FW2 A;  4CGI A;  3MN7 A;  4PA1 A;  4CJV A;  5DMR A;  1V4T A;  1NGF A;  2QKB A;  1WUA A;  2HBM A;  1U6Z A;  1X3M A;  4R79 A;  1WBD A;  1WSI A;  2X78 A;  4DTS A;  4FLX A;  3SZ2 A;  2CH6 A;  2Z1J A;  4NO7 A;  4CVN E;  5J2M A;  1WB9 A;  2ZJQ L;  3O9T A;  4DSK A;  3ZET A;  2BH1 A;  4QAG A;  3IAY A;  1D9D A;  3ISN C;  3OS1 A;  2F7T A;  3ZYY X;  3QEX A;  1SS6 A;  5T7B A;  4Z4E A;  4FWL A;  4AHU A;  1HQE A;  2OYQ A;  4K8X A;  4G1Q A;  5I9E B;  1NLV A;  3PSI A;  4B3T K;  4JLH A;  3VA0 A;  3EZW A;  4H5T A;  2FBX A;  1TAU A;  2NRX A;  2JLE A;  1S1X A;  3DYA A;  1D5A A;  3CG7 A;  2HHX A;  3NDK A;  1S1V A;  4AH9 A;  3SK3 A;  5AQT A;  4LF7 K;  4JKH A;  3AGK A;  3K59 A;  4HVJ A;  2Q36 A;  3HPG A;  2QM1 A;  2D0P A;  3EE8 A;  5F1X A;  4ISF A;  4IJN A;  3EE9 A;  4WQ5 C;  4K8Z A;  1RIL A;  3V9U A;  3GL1 A;  4BDP A;  4LFC K;  1RTJ A;  3ENO A;  3WXM B;  4CJE A;  4W5Q A;  2DPN A;  1YVU A;  4BDY A;  3AGR A;  1HKG A;  1TKT A;  5GAH P;  2E2P A;  1QSL A;  4AHT A;  2BAN A;  2Q1N A;  4IBN A;  4W5N A;  3WEE A;  1JLB A;  2Z1G A;  2OPR A;  3LM9 A;  4DR7 K;  1HQU A;  2YJF A;  3OYK A;  2E8A A;  1BL3 A;  1GLB G;  3IUC A;  4H5R A;  1TYQ B;  4N5S A;  3CJB A;  2P5G A;  2HHS A;  4DS5 A;  1X3N A;  3DWL A;  3LWM A;  3I55 N;  5LL6 Z;  3K5M A;  1NKC A;  3CCS N;  4N47 A;  4CZH A;  2QK9 A;  1CZ9 A;  4I7F A;  4FWO A;  5BRE A;  5AQJ A;  3MCP A;  2QWN A;  3FZH A;  1K9M O;  1W7A A;  1KSP A;  1ESV A;  4CFA A;  1WAF A;  1IBK K;  5BRH A;  1BA0 A;  3E01 A;  4Z4G A;  3VEY A;  3QLH A;  3TSQ A;  4CJR A;  3OBY A;  2P9S B;  1Q81 O;  4GV6 A;  1HYZ A;  4M3Z A;  1TYQ A;  3HPO A;  2ZJR L;  4CD1 A;  3V81 A;  5AR0 A;  4N41 A;  4JKG A;  4WFA L;  4DTO A;  3OYA A;  5C15 A;  1P8Z A;  4CF0 A;  4DF4 A;  3THX A;  2XY6 A;  1BCM A;  3P83 D;  3T7Z A;  2OPQ A;  1MWK A;  1SKR A;  3PLA A;  3TR8 A;  1RBU A;  2FC0 A;  4Y0W A;  4CJS A;  1Q86 O;  4E7K A;  4B9N A;  2F9W A;  3KK7 A;  4ISG A;  3WNH A;  3LP0 A;  1NJY A;  1NK8 A;  2JGU A;  1RTH A;  3QEV A;  3AVJ A;  4QS9 A;  3A5N C;  3SBT A;  4DCH A;  3V9W A;  4O0J A;  5DK5 A;  5EY4 A;  2OZM A;  3NH1 A;  3CM5 A;  3B6P A;  5E26 A;  5F0X A;  2UXB K;  4DQI A;  1HNW K;  4CJ3 A;  4JKG B;  3E9O A;  1QQN A;  5AQI A;  1DT9 A;  4J2B A;  4JD2 B;  3DXM A;  3HTV A;  3R9P A;  1HNX K;  3RMB A;  4GKK K;  1TKZ A;  3A8Y A;  4GVM A;  3NGI A;  4LFB K;  4ELV A;  3BF1 A;  3M3Z A;  1ZC6 A;  3R6M A;  3RMA A;  4IJA A;  3PY8 A;  3D2F A;  2ZWH A;  1KVB A;  3AVB A;  2DFE A;  2HB5 A;  2NNW A;  1EWQ A;  3VA3 A;  1MA9 B;  1ASU A;  3J7A P;  1KAY A;  1E4F T;  4CJF A;  3QFP A;  3OHR A;  1G99 A;  4KO0 A;  2NUB A;  1NK0 A;  4N76 A;  3MK6 A;  3DLB A;  4K25 A;  3PSF A;  1BA1 A;  4I2Q A;  4JD2 A;  3DXM B;  3CM6 A;  4FZY A;  3ASM A;  5KQ8 A;  5FPD A;  2A42 A;  1NWK A;  4CEA A;  4KH5 A;  3SUP A;  2DY4 A;  1NGH A;  3VQP A;  3D2E A;  3HPH A;  2YHA A;  5CR4 A;  2GV9 A;  2KZZ A;  1C0M A;  5GAG P;  3VQ7 A;  4EP4 A;  2RE2 A;  3D2F B;  3VES A;  4XEI A;  1BCO A;  4FVM A;  4CZI A;  1RDW X;  3L6Q A;  4JK8 A;  3DRP A;  2RPI A;  1XNQ K;  1I94 K;  3I0R A;  3LWL A;  4CZE A;  1C6V A;  2GEM A;  1L5U A;  2PYL A;  2DTU A;  1EQY A;  4DSE A;  1XNR K;  3CCE N;  4JHD A;  2WOM A;  3CJ7 A;  3CIP A;  4RW8 A;  2P51 A;  3O6W A;  4DSL A;  5HRO A;  4M3T A;  1BQM A;  1UOC A;  3BF3 A;  2ZGZ A;  5KRT A;  1T8E A;  3SQ1 A;  2A1S A;  1NKE A;  2HHW A;  4DQP A;  1IO2 A;  2O8C B;  1VSL A;  4O4G A;  4QS8 A;  4GW6 A;  2E1Z A;  3LAN A;  4YOU A;  4KB0 A;  3SQ2 A;  5C0Y A;  1LAW A;  2A1R A;  4I2P A;  3RVC A;  2A40 A;  1NJZ A;  4GKJ K;  2KQ2 A;  4A62 A;  1N33 K;  3ZSR A;  3C7N B;  4K42 A;  3OYJ A;  1NGE A;  2BGG A;  2Z1I A;  4CHN A;  4H5V A;  3T1A A;  1HPM A;  2WON A;  1KLM A;  2ZF5 O;  3G6E N;  3HK2 A;  1LW2 A;  4ID5 A;  3I8B A;  5JVH L;  5I3U A;  2GBZ A;  4OO1 J;  3VQ4 A;  3CJA A;  4OPH A;  4CE9 A;  1J54 A;  3SNN A;  1ASW A;  2V7Y A;  3S3N A;  4FJJ A;  1NK4 A;  3DI6 A;  4JK7 A;  4F3O A;  4KI4 A;  4O0I A;  2OA8 A;  1DTT A;  3VF4 A;  1WSE A;  2YJE A;  3E66 A;  3C0B A;  2P9P B;  5ELZ A;  1RT6 A;  3AAR A;  3L3V A;  4B9U A;  2IOC A;  4GV9 A;  3DLE A;  5AJ3 K;  1X9M A;  1VQ6 N;  1RCH A;  5J2N A;  4HCC A;  4Q5V A;  3WXJ A;  3CCL N;  4H0O A;  1KVA A;  4JKA A;  4FLV A;  4KFB A;  1XWL A;  4JS5 A;  3E9L A;  3OVN A;  3OS0 A;  3AO1 A;  2QWR A;  3AVN A;  4PHT X;  4B3S K;  5KGW A;  2PZS A;  3VQ6 A;  2QWP A;  4HTU A;  2QEX N;  4ZTJ A;  2IVO A;  5M1Q A;  3DXK A;  1JCF A;  1C1B A;  2HND A;  2IVP A;  3PX6 A;  1DGK N;  4A2A A;  2YHX A;  3PIO L;  4JNE A;  3BDP A;  2P9P A;  1QQO A;  3CQX A;  3VEZ A;  1Q82 O;  1RDD A;  4EAH D;  3O80 A;  3SAF A;  4IOC L;  4PKH A;  1CLQ A;  2X74 A;  3SCX A;  2B6A A;  1VQ5 N;  3P31 A;  4DB3 A;  1ATS A;  1KXP A;  3RWU A;  4B3O A;  2HF4 A;  4FWP A;  2YKM A;  1L3S A;  2FF3 B;  3C6T A;  1BGX T;  3IKM A;  4I6M B;  4DQQ A;  1BO5 O;  3SPY A;  3G71 N;  3O9S A;  1K73 O;  4CIF A;  4BGA A;  4JKF A;  3DXK B;  3ZX3 A;  3UIQ A;  3MXM A;  4CK1 A;  1SL0 A;  4JKC A;  2I7P A;  3VGL A;  4LF9 K;  3CCV N;  3EO3 A;  3SLC A;  4IZ9 A;  4IXC A;  4HUF A;  1UWB A;  3H1Q A;  4YOY A;  3OYD A;  3ENB A;  3WNG A;  4CBU A;  3U3G A;  3CME N;  4FWM A;  1LAV A;  4FWQ A;  3SJH A;  1GLD G;  3CF5 L;  3SI6 A;  3AVC A;  1WN7 A;  1VK0 A;  4RW6 A;  3MX2 A;  2O8B B;  5CZ1 A;  3L2Q A;  2YNG A;  5EX5 A;  2A6A A;  5M1N A;  2IVN A;  4YY3 K;  3LDS A;  2Q2R A;  4LFA K;  3FR0 A;  3VGM A;  4IOX A;  2GWJ A;  2D1K A;  3CD6 N;  5J2P A;  1RBR A;  3M8P A;  4M63 C;  2CGK A;  1IG9 A;  3HYF A;  1ZYQ A;  1ASV A;  5AQG A;  4M42 A;  4B1Z A;  2HHU A;  2QW9 A;  1L3V A;  4ZTF A;  2P5O A;  1QS4 A;  1Q8I A;  3T3F A;  5C24 A;  3NAE A;  3AO5 A;  3O9R A;  3AA4 A;  1W2B M;  4DLG A;  4RW7 A;  2WBN A;  3FZL A;  4TSX A;  4B8A B;  1QTM A;  3TAG A;  3OYL A;  1FXX A;  4J2A A;  3O1W A;  4KHY A;  3U4L A;  3TSP A;  3T1Y K;  2G8U A;  4QOZ B;  3ZX2 A;  3R1X A;  1YIT N;  3WNE A;  3OYC A;  3VQ5 A;  2HF3 A;  1ITG A;  2IGI A;  5AZJ A;  4YOV A;  2KZM A;  5JS1 A;  2HBJ A;  4DWI A;  1JLC A;  3JYT A;  3U8X A;  2EHG A;  4GV3 A;  2BTF A;  2P9U A;  1RNH A;  1D9F A;  2D0C A;  3QBW A;  4FWR A;  1FKO A;  4DS4 A;  5FRM A;  1CXQ A;  2Q0U A;  1VQ4 N;  4FL9 A;  3O8M A;  4KB1 A;  3BZC A;  5GAE P;  3AAQ A;  3VTI A;  1BOT O;  1HRH A;  1WLJ A;  3D0P A;  2D5R A;  1HYS A;  4KKO A;  1T05 A;  3M8S A;  4DR1 K;  1LWF A;  3N4Q A;  3BGR A;  4DU1 A;  3LZJ A;  1J9A A;  4E89 A;  2NRR A;  2OCE A;  4FJ5 A;  4DR4 K;  3QML A;  5AZJ B;  3F73 A;  1S3X A;  4BG8 A;  3KLF A;  2IIR A;  5C2D A;  4DFP A;  4CJT A;  3CER A;  2KLA A;  4IEE A;  4KHQ A;  3JAM O;  4FM2 A;  1OVY A;  4CEF A;  3OW2 M;  1J5O A;  3F9K A;  3LP3 A;  4DFK A;  1K6Y A;  5AQR A;  2GWK A;  3HM9 A;  5FDL A;  3N4P A;  5BR8 K;  5GAD P;  2BDP A;  1TL1 A;  5H1S Q;  2E4L A;  1Q9Y A;  2UXC K;  2RN2 A;  1RFQ A;  4KAZ A;  1ZBU A;  2E2O A;  3KJV A;  4E7L A;  3MWP A;  4EFH A;  2QWL A;  5D3G A;  5MLC Q;  4F2S A;  4F8R A;  2PFU A;  1OH8 A;  1C1A A;  3ATV A;  3CC2 N;  4RG8 A;  4M45 A;  4E7H A;  2A41 A;  3MAQ A;  1ATN A;  1BWF O;  3UB5 A;  4AF1 A;  2OPP A;  3IG1 A;  3SMP A;  1R0A A;  3F2K A;  4A5A A;  4FW1 A;  4O5B A;  4JRP A;  2HHQ A;  1JLF A;  3FFK B;  4BVO A;  2W41 A;  5AZI B;  4CJ5 A;  1NK7 A;  3GG4 A;  2P9K A;  3QDK A;  1RT5 A;  1F21 A;  2RKI A;  3CET A;  2VGM A;  3ZT3 A;  3V1Q A;  1RT4 A;  3WXI A;  3CJ9 A;  2QXL A;  1ILY A;  2X6N A;  4YOW A;  2VWK A;  4BVP A;  4JI1 K;  4C8L A;  3K2P A;  4YNQ A;  4YDU A;  2WUS A;  2ATQ A;  5AQP A;  2CGJ A;  3DLH A;  1VQ9 N;  1RT2 A;  1HNV A;  2D0A A;  4BR9 A;  3VQQ A;  1WSH A;  3SUN A;  1NJX A;  3C6U A;  3MN9 A;  4OVL A;  1JLA A;  4NLB A;  1JJ2 M;  2O8E B;  4LF8 K;  3L2W A;  3UKR B;  4CER A;  3PO4 A;  3KTQ A;  3VQA A;  2BE2 A;  3OYH A;  2P9K B;  3P39 A;  1TVR A;  3LDP A;  5ADX A;  4FVU A;  1FKP A;  4IEI A;  1KFS A;  5CYM A;  2HST A;  2UYT A;  4PQU A;  3NFA A;  2XRI A;  4AIL C;  5KQD A;  4FOI A;  1U04 A;  4BC2 A;  4DTU A;  4I9L A;  4PKI A;  4XH4 A;  3L2V A;  2FSJ A;  4BY9 C;  3CQ8 A;  1OH7 A;  1HNI A;  4FZZ A;  3EZ5 A;  4WQ4 C;  2CH5 A;  2GEL A;  3LPT A;  1IBL K;  4HHT A;  1I3A A;  3O5B A;  4FOE A;  3M5R A;  1U49 A;  4B8C A;  1VAZ A;  1QHT A;  1VQO N;  2PY5 A;  1T03 A;  1IKW A;  1S1T A;  4M3R A;  3KZB A;  3UKR A;  3V9S A;  1YUW A;  2WC9 A;  4H4O A;  4A2B A;  4DU4 A;  3KD1 E;  5HRP A;  1SKS A;  3VGK A;  4FK0 A;  1FJG K;  2A3Z A;  3ZSZ A;  1NKB A;  3ZLJ A;  4FK4 A;  2W40 A;  5LJV A;  1J6Z A;  1REV A;  2FSK A;  4DQS A;  2EWS A;  2YKN A;  3Q7B A;  3CCJ N;  4YOX A;  2FXU A;  1XMQ K;  4KH6 A;  4KHW A;  4OX9 K;  2W6L A;  1NMN A;  3DLK A;  1VQM N;  2E88 A;  1Z25 A;  2GX9 A;  1Q9X A;  3ALY A;  4WF9 L;  4B9V A;  4NB4 A;  1YJ9 N;  3G4S N;  2P9N A;  2BUP A;  3B8A X;  1A5W A;  5HBM A;  3PV8 A;  4WQ5 A;  2VCP A;  3UKU A;  3RMC A;  1JXE A;  4C1N I;  3L2U A;  2YI1 A;  3HZ6 A;  2NRZ A;  2G8H A;  4LSN A;  4BR2 A;  4KHN A;  4FWN A;  1VRT A;  3O4W A;  3ZSV A;  4Q0B A;  4PY5 A;  1C0G A;  1GLF O;  3WXL A;  3AA3 A;  1IH7 A;  3QER A;  4A57 A;  3L8B A;  4DV3 K;  1DLO A;  2OPS A;  1GLC G;  3S3M A;  1IV0 A;  4B9S A;  3OYE A;  2HMP A;  3HP9 A;  2FBY A;  3ATU A;  3QO9 A;  4KV8 A;  4Y1C A;  3VTH A;  4FJL A;  5EU7 A;  4DSF A;  3AVA A;  2E5L K;  4AHR A;  1XC3 A;  3ZX0 A;  1JCE A;  2YNI A;  3NHG A;  3VEW A;  5HP1 A;  2UUB K;  4BR7 A;  5BR9 A;  4CJL A;  1M90 O;  1NJI O;  4WQ4 A;  4O5F A;  3MEC A;  3O1B A;  1RT3 A;  5AQW A;  3KKS A;  3NCI A;  5C10 A;  3DMJ A;  5KTQ A;  4FJM A;  3NBP A;  3OBW A;  1NGA A;  1BI4 B;  4KI6 A;  1IG8 A;  4GVE A;  5K14 A;  2XY7 A;  2XY8 A;  4JS4 A;  1JL2 A;  4EZ9 A;  3ZT0 A;  3KLH A;  4B1Y B;  4HUE A;  3QBX A;  5CZ2 A;  4XIU A;  5JLH A;  3RRG A;  3T1H K;  4F4K A;  3A5O C;  4DV1 K;  3HXM A;  1GOA A;  4JI5 K;  5EXW A;  2HVI A;  1HYV A;  4MO5 A;  4GNI A;  4NXM K;  2VYP A;  1VQL N;  3DOL A;  1KTQ A;  2B4J A;  4FCY A;  2HBK A;  4PL8 A;  4FJI A;  2P1J A;  4RCH A;  4EHU A;  5JLF A;  4CJ4 A;  1QVG M;  3RR7 A;  3OS2 A;  4IG3 A;  3A5M C;  5AQK A;  2E20 A;  3E9P A;  3L0Q A;  4CEB A;  1NK9 A;  4OKK A;  2HNY A;  3THW A;  4FLU A;  3TAB A;  3AA2 A;  3VET A;  5DM6 L;  3NE6 A;  4FM1 A;  1NU0 A;  3EN9 A;  3CCQ N;  2F8S A;  3P4I A;  2VGN A;  2XHB A;  1TL3 A;  3JS6 A;  3VEN A;  3ZET B;  4AHS A;  1HLU A;  3SBG A;  4EP5 A;  4LC9 B;  3FZM A;  3CFP A;  3LDL A;  4BE1 A;  2ZE2 A;  1ZBF A;  3MXJ A;  1YXQ A;  1X9J A;  1BU6 O;  1XC9 A;  4RTF D;  5SWM A;  1CZB A;  2HOE A;  2QWM A;  3SQ0 A;  1C0U A;  5GIO A;  3HT3 A;  4YOT A;  1QQC A;  2QTD A;  4OJR A;  1P90 A;  3AVM A;  1NM1 A;  3IS9 A;  1UA1 A;  1J53 A;  2G8K A;  4C8K A;  4E0D A;  3QEW A;  1S5J A;  2XO7 A;  3W3D A;  4BE2 A;  2O8F B;  5BN8 A;  3THV A;  5C12 A;  4BC4 A;  3ULD A;  4W5R A;  2DFH A;  2P9L A;  1TAQ A;  1KAX A;  4CZK A;  2Z1H A;  4MFB A;  4JI7 K;  1WOQ A;  4CZJ A;  5BPM A;  1BUP A;  4A5B A;  4RWT A;  1S22 A;  4BRE A;  4L3Q A;  1BIS A;  3ZEU A;  3V1O A;  4B1U B;  2J4R A;  4BR4 A;  1MDU B;  1L3T A;  1T7P A;  3NVM A;  2NRT A;  3SQ4 A;  4A59 A;  1XI1 A;  3VQC A;  5C42 A;  1VSM A;  2VG5 A;  3WEE B;  5ADX H;  1YTU A;  1Z6R A;  4LH5 A;  1SAZ A;  4E3S A;  4FJN A;  1DTQ A;  1KRP A;  1TUY A;  2H3G X;  1ZBL A;  1MWM A;  2I5J A;  4DKW A;  1Z26 A;  1N5Y A;  1LWC A;  3CHW A;  4CIE A;  2IAJ A;  5KPT A;  1B9F A;  3NF6 A;  3RRH A;  2P9L B;  1U2V B;  4FXD A;  3B6O A;  4KRF A;  3HM8 A;  4EZ6 A;  5JVG L;  4FLW A;  2D0O A;  4DV5 K;  4DSJ A;  3MWT A;  4BRA A;  1VQ7 N;  4C8N A;  4CFB A;  4A61 A;  4CIG A;  4CF9 A;  4U67 L;  4DUZ K;  3VQB A;  5LMU K;  5AQV A;  3PUF A;  4NCA A;  2G8F A;  2OTJ N;  1TK8 A;  2HMI A;  2PYJ A;  3K0S A;  3CXC M;  1NGB A;  1RBS A;  3ITH A;  4BC5 A;  5HL7 L;  1EET A;  2YX6 A;  4E7I A;  4DMN A;  2ITM A;  4MQ3 A;  1LOT B;  2D4W A;  3D7E O;  4BRK A;  1T6C A;  3KVG A;  3WUH A;  4B9M A;  4HUG A;  1WAJ A;  4FM0 A;  3U3Y A;  1U2V A;  3AA5 X;  4B9L A;  3NGY A;  4FLZ A;  4I9Q A;  1EXQ A;  2FSN A;  3LAL A;  2KFZ A;  3I0S A;  1LCU A;  3WNF A;  4DV7 K;  1BIZ A;  3C6H A;  4E1M A;  5A2Q O;  2OAN A;  4FZX C;  3QES A;  3O08 A;  3EL2 A;  1J5E K;  1NMD A;  4ZHR A;  4WYB A;  5IWA K;  4CHZ A;  3AVF A;  3KWG A;  4E7J A;  4IO8 A;  1JLG A;  4OKE A;  4H0V B;  3HBT A;  2YCH A;  1JLE A;  3IDH A;  5AFU H;  2ZM6 K;  1BIU A;  1Q7Y O;  3VEV A;  1HKB A;  5C25 A;  3IFR A;  4NCG A;  1YVN A;  3QNO A;  4DV2 K;  4CGF A;  4KH4 A;  4B1X B;  3HP6 A;  3ULE A;  4OGE A;  3HJF A;  3LDQ A;  3P1G A;  4CHP A;  4CEZ A;  3K5O A;  3NVK A;  3R3L A;  2P9S A;  4CJQ A;  4NYN A;  1N8R O;  2E6M A;  5E84 A;  1RDB A;  1TV6 A;  3HVT A;  1TK0 A;  1D4X A;  4G9Z A;  4YDU C;  3GE1 A;  3ZT1 A;  4XH5 A;  4X62 K;  3K5L A;  1Y64 A;  4DUY K;  3TAP A;  1S9G A;  2OTL N;  3AV9 A;  2QXF A;  3THX B;  2UXD K;  3H45 C;  1NGI A;  1DKG D;  3VF6 A;  2NRW A;  3KHY A;  1N34 K;  3T69 A;  4WFB L;  3QFU A;  3RSE B;  3SV4 A;  1IBM K;  1QZ5 A;  4CK3 A;  4IKF A;  1E3M A;  4BDZ A;  1L3U A;  3ULE B;  4DR2 K;  2E2Q A;  3KWI A;  2VQF K;  1KD1 O;  2RHK A;  3WXK A;  1U47 A;  4LSL A;  3KIO A;  1JLQ A;  3DRR A;  2Y1I A;  1TUU A;  3MN6 A;  3CCR N;  4AQY K;  5AQS A;  4DV4 K;  3V4I A;  3H08 A;  4KTZ A;  3I56 N;  3EY1 A;  4BC3 A;  3S3O A;  3PO5 A;  4LF5 K;  4JHD B;  1A5X A;  3V9Z A;  3LDO A;  3DRS A;  3PIP L;  2VG6 A;  2HHV A;  1K8A O;  2O4I A;  4FJK A;  3T19 A;  3RSE A;  3DM2 A;  4O8U A;  4C23 A;  3MN5 A;  4BQL A;  3C95 A;  4MDA A;  3TTF A;  3M1F A;  2G8V A;  4EIA A;  5KI6 A;  2ZD1 A;  4CBW A;  4BRC A;  4CEQ A;  4C8M A;  1YIJ N;  3LL3 A;  1GLA G;  1KVC A;  3LZI A;  4FLY A;  4AHC A;  4DR6 K;  4FO0 A;  3DLR A;  3VEX A;  1RTI A;  4BRO A;  4YFU A;  3OA9 A;  4CI6 A;  3VQ8 A;  4FJ9 A;  4E1N A;  5EVZ A;  2IDO A;  3SPZ A;  2CGL A;  2NRV A;  1M1K O;  4FJH A;  3VN5 A;  2E1Y A;  5LY3 A;  3J80 O;  5AQO A;  3H46 O;  4DLE A;  4FYD A;  4BQZ A;  2D0B A;  3D2E B;  4NLC A;  1I39 A;  4JI3 K;  4LH4 A;  4B08 A;  4H0Y B;  4DG1 A;  5F2R A;  3ZSX A;  3KLE A;  2FBV A;  3MEE A;  1C0T A;  3QIP A;  1DEJ A;  4NCB A;  4LY7 A;  4M3Y A;  3WQU A;  4HTL A;  3IRX A;  2DFF A;  3J8A A;  1X1P A;  1LWE A;  3TAN A;  1C0F A;  1EO1 A;  3MX5 A;  2FF6 A;  4CK2 A;  4ICL A;  3U9Z A;  4AM7 A;  2Q31 A;  3LAK A;  2LSN A;  4CW7 B;  5HRN A;  4CF1 A;  3M8R A;  5E41 A;  4BR5 A;  1VQ8 N;  4JI2 K;  4CGH A;  1OH6 A;  4YOR A;  1QQM A;  4C1N K;  3VOV A;  4MO4 A;  4OGC A;  4BR0 A;  1NGJ A;  1QVF M;  1NK5 A;  2GTD A;  2R7Y A;  2OZS A;  4ILG B;  4JV5 K;  1N36 K;  1D8Y A;  2O8C A;  3KLI A;  4ELU A;  3TPQ A;  5BN9 A;  5FRO A;  1YHQ N;  5KGX A;  1EP4 A;  2ZGY A;  3P38 A;  5M1O A;  2JWL A;  2GUP A;  3C7N A;  2V51 B;  1XHX A;  1HPZ A;  1NGD A;  3FE1 A;  3MMV A;  4WCE L;  3LP2 A;  1RGI A;  3SAG A;  3I8D A;  5HRS A;  5LMN K;  3EYZ A;  4CD3 A;  3FZF A;  3NMU A;  4GMJ B;  4KRE A;  3ZT4 A;  4CJP A;  1QE1 A;  4ILJ A;  4PUO A;  4OLA A;  2AA4 A;  3C65 A;  2HVH A;  4DSI A;  3VQ9 A;  4IDK A;  5AQY A;  1IKV A;  3V1R A;  4JK9 A;  1NNE A;  2FBT A;  3K9J A;  1TKX A;  2VWJ A;  4IFE A;  1SV5 A;  2HHH K;  3DJC A;  4DTJ A;  3PX0 A;  3SUO A;  3FZK A;  1YJW N;  3WT0 A;  1NK6 A;  4FSV A;  3P5J A;  3ZSQ A;  3ZSW A;  1VSK A;  2KKZ A;  1O13 A;  5J1E A;  4PWD A;  4V19 S;  3FFI A;  4CJW A;  1KAZ A;  4BRM A;  4BWJ A;  3OTO K;  3SYZ A;  3RMD A;  1N32 K;  1RT7 A;  3CI5 A;  1TKD A;  1VRU A;  1RDA A;  1YF5 L;  1WSJ A;  2QWQ A;  3GOI A;  1X9W A;  2O8B A;  3RR8 A;  1EX4 A;  1Z05 A;  1TGO A;  3HO1 A;  2I7N A;  3G10 A;  1VSE A;  4JI6 K;  4DTR A;  2Q3S A;  1HUX A;  3FLC O;  4DF8 A;  4CF8 A;  4Z0U A;  4IO9 L;  1UA0 A;  4UY8 O;  1GOB A;  1V4S A;  2YNH A;  5AQU A;  4CEC A;  1GLJ O;  1OKJ A;  4M7X A;  1QZ6 A;  4EHT A;  2Q97 A;  3L2R A;  4W5T A;  3LP1 A;  4Z4C A;  2HW3 A;  1NOZ A;  5GIN A;  1RDC A;  1JL1 A;  4BRG A;  3TU5 A;  1U4B A;  1T6D A;  1NGC A;  3CCU N;  3CMA N;  5AQF A;  4KTW A;  4DR5 K;  1GOC A;  2NLX A;  3LAM A;  4H0T B;  5TKW A;  3ID6 A;  1CZA N;  3I33 A;  4I6M A;  1EKE A;  5CYQ A;  4ID1 A;  4IOA L;  4R5P A;  1NBW A;  3SJJ A;  2O4G A;  4X65 K;  3NGZ A;  4CZF A;  2PAV A;  3S41 A;  3SAH A;  3DAW A;  3CFO A;  4MLE A;  2QKK A;  3TAQ A;  4OPA A;  3AVL A;  4K43 A;  2W6K A;  3O3F A;  1EWR A;  3EKU A;  2P9U B;  3MDQ A;  3QIN A;  5DM7 L;  4HCB A;  2PBD A;  2YHW A;  3TTD A;  4DQR A;  3OY9 A;  3ZCM A;  3SMS A;  4BWM A;  1UAX A;  4CZM A;  3VF2 A;  3VMF B;  1VQK N;  1KFD A;  5AQN A;  1QHA A;  4CF2 A;  4JKD A;  2E2N A;  1XUP O;  2QWO A;  4NYF A;  4H0P A;  3BP8 A;  4BRI A;  4QS7 A;  3A0I X;  3G0Z A;  3C94 A;  4DTX A;  1JKH A;  1A5V A;  2B5J A;  1VSJ A;  2ASP A;  3K5N A;  4CZL A;  1G15 A;  3H3O B;  3JXU A;  4H0X B;  1WNS A;  4DU3 A;  5SZT A;  3TWH A;  4CCH A;  3J7Z O;  2RF2 A;  4J2E A;  2Q0R A;  3BEX A;  4PKG A;  4CFC A;  1BDG A;  3HL8 A;  4DV6 K;  4OLB A;  1BHL A;  2WFB A;  5BRF A;  3HI0 A;  2UUA K;  3LM2 A;  3HST B;  4IWV A;  1T3V A;  3NH2 A;  1VSH A;  1T44 A;  4CEO A;  1CXU A;  3CFR A;  5BPL A;  4F2R A;  1NOY A;  3QB0 A;  4BRH A;  4RW4 A;  2ASO A;  3OYG A;  4KBO A;  4Y1D A;  5FPM A;  4IDH A;  4IFY A;  2ETJ A;  1E4G T;  5HRR A;  3V6D A;  4C8O A;  1HR0 K;  3F5T A;  3EEQ A;  1YI2 N;  3TAM A;  4MLH A;  1TK5 A;  2UU9 K;  2GUI A;  3GBT A;  2KFN A;  3TAR A;  2HBL A;  3CJ1 A;  5TKY A;  3OYB A;  4J8F A;  5AQQ A;  5FPN A;  1SQK A;  4X66 K;  4N56 A;  2JWK A;  2HHT A;  3CPE A;  1VSI A;  3NF7 A;  3NF9 A;  3HOT A;  1NG9 A;  3E1Y A;  1B92 A;  2YV0 X;  2UUC K;  4QCL A;  3TTC A;  3CYM A;  1KQS M;  4B9Q A;  4KHS A;  5AZI A;  1RTD A;  4MDB A;  2KHO A;  5CY4 A;  3A2F A;  4M3X A;  4KTQ A;  5FLX O;  3MEG A;  3VEO A;  3HSC A;  1WSF A;  3SUQ A;  3J81 O;  1KC8 O;  5M1K A;  3S9H A;  1Q18 A;  4GY2 B;  3KK3 A;  3M8Q A;  4JEP A;  4O44 A;  3OJS A;  4BRF A;  3AVI A;  3Q7C A;  3AVH A;  4W5O A;  1SKW A;  3ZSO A;  3AO3 A;  1W97 L;  2QI2 A;  5CE3 A;  5AQH A;  3KKR A;  2V7Z A;  4YHH K;  4FWK A;  2O8D B;  1IKY A;  3IMX A;  4DTP A;  1GLE G;  4JKE A;  2W42 A;  3AVG A;  2F4V K;  4ISE A;  5AFU A;  3K58 A;  4DTN A;  1JXB A;  4BE0 A;  2AP1 A;  5LJW A;  4XH1 A;  4F9O A;  2YNF A;  1ZBS A;  3H6E A;  5GIP A;  1YAG A;  5BPN A;  4B1V A;  4CBX A;  3J7Y P;  3QNN A;  4CHY A;  1O1W A;  4IFV A;  2VQE K;  4CED A;  5AQM A;  3VQE A;  5KPZ A;  3UE5 A;  5EOY A;  4M7Y A;  4FK2 A;  4FPB A;  3C6A A;  4FJG A;  1U45 A;  4CZG A;  3THY B;  2V52 B;  2O8D A;  1RBT A;  4H4M A;  3VQD A;  3K57 A;  1K8K A;  4FJX A;  4OPJ A;  2EX3 A;  4CGD A;  3EKS A;  5J2Q A;  5CHI A;  3A5L C;  3U9D A;  1NJW A;  3CQY A;  4LD0 A;  3W0L A;  4BRQ A;  4H5N A;  1IKX A;  4LF6 K;  1C1C A;  1OH5 A;  3OYF A;  2X6S A;  3JSM A;  3HVR A;  4CJK A;  2IS3 A;  2HNZ A;  3DLG A;  2YHB A;  4DFM A;  3QET A;  4DHY A;  3AY9 A;  3D6R A;  3MCA B;  3G25 A;  2VWB A;  1FW6 A;  4BRD A;  3VPZ A;  4Z4H A;  2ASM A;  3THY A;  3BZK A;  3CC4 N;  3NH0 A;  3TAF A;  1SUQ A;  1K8K B;  1U48 A;  3QEP A;  4CGJ A;  1LW0 A;  3UKU B;  4FLT A;  2O8E A;  4LF4 K;  1R59 O;  2NRH A;  1HKC A;  4E19 A;  1VQP N;  5JS2 A;  3R8E A;  2NZT A;  4NXN K;  4IG0 A;  3L3U A;  1LV5 A;  2P9I A;  3KK1 A;  5FRN A;  4AM6 A;  4B1W B;  3AO4 A;  4RW9 A;  3H3N O;  4B3M K;  3LDN A;  2XY5 A;  1HMV A;  2AJQ A;  3HRG A;  3NF8 A;  2E6L A;  3CJC A;  5JMV A;  1GLL O;  1ZBH A;  1HX1 A;  3KD5 E;  2IC3 A;  2ITG A;  4K41 A;  1YT3 A;  4DTM A;  3BY5 A;  2WTU A;  3M6G A;  1WBB A;  3HOS A;  3DLL L;  4DV0 K;  1QSY A;  3O4N A;  3RTV A;  4BAC A;  1W9H A;  3CPW M;  4M3W A;  5AQZ A;  3OJU A;  1FK9 A;  2A5X A;  1VQN N;  1OVQ A;  3AO2 A;  4JAX A;  3VER A;  5M1F A;  2P9I B;  3AVK A;  1BG3 A;  4UQG A;  4BG9 A;  1RT1 A;  1S1U A;  5FPE A;  1VHX A;  2G8I A;  1RBV A;  4JI4 K;  1S9E A;  1KCF A;  3FGU A;  1S6Q A;  4CHQ A;  3O9U A;  5B8H A;  3H1V X;  4H03 B;  5AQL A;  1BQN A;  1SL1 A;  1S1W A;  1WSG A;  1HNZ K;  4DR3 K;  2KW4 A;  3LPU A;  4KPY A;  2P9N B;  4ILH A;  1RDU A;  1ZXO A;  3OYI A;  4B9T A;  1SL2 A;  3CC7 N;  4ELT A;  4FJ8 A;  3SV3 A;  3CCM N;  4FWS A;  1VSD A;  4CJ7 A;  4BRN A;  4F3T A;  1HJR A;  3QEI A;  4Z4I A;  3TAE A;  5HLF A;  2KTQ A;  4DFJ A;  4CHO A;  3ZSY A;  4O55 A;  1YJN N;  4WFN L;  4KHP K;  3U6F A;  3ENH A;  1XMO K;  3BUZ B;  3F9M A;  4U7B A;  5KPR A;  3GDQ A;  3TSU A;  4HWI A;  2YHY A;  4BGB A;  1X9S A;  3L4I A;  4BRL A;  5IT9 O;  1Y97 A;  5BRD A;  4DQ8 A;  4M41 A;  3KLG A;  4L8R B;  2ZQB A;  2F9T A;  3DOK A;  4JI0 K;  2Y1J A;  5I42 A;  3O9Q A;  5AQX A;  5HOO A;  4O8K A;  4JKB A;  1ATR A;  4AHV A;  4Z94 A;  4M3U A;  4H8K A;  4B3R K; 
#chains in the Genus database with same CATH homology
 1FJG K;  4B3T K;  4JI5 K;  1XNQ K;  2ZM6 K;  1I94 K;  4YHH K;  4K0K K;  4B3M K;  4DR6 K;  4NXM K;  1XMQ K;  4B3S K;  4OX9 K;  1XNR K;  4DV2 K;  2F4V K;  4JYA K;  3T1Y K;  2HHH K;  4X64 K;  4LF7 K;  3J80 O;  4JI8 K;  4JI3 K;  4DV0 K;  4V19 S;  4LFC K;  3OTO K;  3J7Y P;  1N32 K;  2UXB K;  4JI1 K;  2VQE K;  4DV5 K;  1HNW K;  4DV6 K;  4X62 K;  4DUY K;  2UUA K;  4DUZ K;  4GKJ K;  2UXD K;  5LMU K;  1HNX K;  1N33 K;  4GKK K;  4DV3 K;  4JI4 K;  4JI6 K;  1N34 K;  4CW7 B;  4DR7 K;  4LFB K;  4LF8 K;  4DR1 K;  1IBM K;  1HNZ K;  4DR3 K;  4JI2 K;  4DR2 K;  4LF9 K;  4DR4 K;  2VQF K;  1HR0 K;  4LF6 K;  2E5L K;  2UU9 K;  5LL6 Z;  4JV5 K;  4AQY K;  4DV4 K;  1N36 K;  3J7A P;  2UUB K;  4X66 K;  4DV7 K;  4KHP K;  4DR5 K;  2UUC K;  3JAM O;  5A2Q O;  1XMO K;  4LF5 K;  1IBL K;  4YY3 K;  1J5E K;  4LFA K;  4CVN E;  5FLX O;  5IWA K;  1IBK K;  5IT9 O;  5AJ3 K;  5BR8 K;  4X65 K;  3J81 O;  4LF4 K;  5LMN K;  4JI7 K;  2UXC K;  4JI0 K;  3T1H K;  4NXN K;  4DV1 K;  4B3R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...