4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
4JV5K 2VQEK 1IBKK 4X65K 4DUZK 4JI8K 3JAMO 4JI1K 5BR8K 4LFCK 4DV3K 4DV5K 4GKJK 3OTOK 5IT9O 4NXMK 4DV4K 4CVNE 4DV6K 1J5EK 4DV0K 4DR2K 1N34K 4X64K 1XNQK 4B3MK 4KHPK 4DR6K 4JI2K 4B3TK 1IBMK 4OX9K 4DV2K 5A2QO 1I94K 2UUAK 1N32K 4LF9K 2VQFK 2HHHK 4JI0K 5LL6Z 4X66K 4YHHK 2E5LK 4LF5K 4DR5K 4LF7K 4NXNK 4DR1K 2UXCK 4DV7K 2UU9K 5FLXO 3J80O 1N36K 3J7YP 4CW7B 1XMOK 3T1YK 3J81O 1N33K 4JI4K 5AJ3K 1FJGK 4DUYK 4DV1K 1HNXK 4DR7K 4DR3K 2UUBK 4LF8K 4V19S 4JI3K 5IWAK 1XNRK 3T1HK 4LFBK 4B3SK 4JI7K 4X62K 4B3RK 3J7AP 4K0KK 4JI5K 4YY3K 4LF6K 2ZM6K 1IBLK 1HR0K 4JI6K 4LFAK 4LF4K 1XMQK 2UUCK 4DR4K 1HNZK 4AQYK 4JYAK 5LMUK 1HNWK 4GKKK 2UXBK 2UXDK 5LMNK 2F4VK
chains in the Genus database with same CATH superfamily
1VK0A 1U48A 4YDUC 4DTXA 1LOTB 5AQFA 2BE2A 2A5XA 1VSEA 1KCFA 3HJFA 4H0YB 2Q31A 2RPIA 1Q18A 3EKUA 1YIJN 4YDUA 3AVAA 4A2BA 4CECA 3DXKA 1QVGM 3MEGA 2A1SA 4JKAA 1BG3A 3CYMA 1Z25A 3CIPA 4Z0UA 4KI6A 1F21A 1L5UA 3QERA 3L2QA 2NRRA 3KTQA 2O8EB 1X3NA 3MXIA 4FJMA 2OTJN 3ATVA 4DTRA 2QKKA 1IG9A 1XNQK 3AO5A 4M7XA 4CD3A 3LDLA 1LWCA 4DFPA 1P8ZA 1XHXA 2IC3A 4H5VA 3QNNA 1CXQA 1S22A 4OKJA 1KFDA 1T44A 4FO0A 2ITMA 3B8AX 3O4WA 3HVTA 3C94A 3MEEA 4FJIA 1RT2A 3SLCA 2CH5A 2X74A 2ATQA 3PLAA 4C23A 1EWQA 4KTQA 4C8NA 1OH8A 3VPZA 1KFSA 3O4QA 1NK9A 2QWRA 3O1WA 5I42A 4MFBA 4CZIA 2E88A 4NCGA 5I9EB 2F96A 3DMJA 4Z4HA 4JI3K 5GIPA 5CHIA 1EKEA 3E1YA 4IJNA 1MWMA 3LDPA 4C8KA 3U8XA 3WXMB 4K0KK 2G8UA 3KLHA 4QAGA 2FF6A 3O9SA 2VGNA 3SBGA 4YY3K 1VQMN 1TK5A 1HR0K 1KSPA 3JSMA 1HNZK 1S1UA 1JL2A 3NF8A 4PKIA 1LW2A 1QHTA 5HRRA 2ZJRL 4HUGA 2HF3A 2YJEA 4FZZA 3LDQA 1NMDA 2F9WA 4DTNA 4CCHA 1BHLA 3TAMA 3L3VA 2P51A 2OANA 3RSEB 3JAMO 5F1XA 3THWB 3HBTA 4N56A 4ID1A 4LFCK 1RDUA 3SCXA 2EX3A 3V9XA 2F8TA 4OGEA 1QQMA 4O0IA 1NK0A 1BO5O 1NOZA 3ULEA 3VTHA 4BWJA 1RT1A 4N76A 1RGIA 3DLEA 1NK7A 3H1QA 1U2VB 3U9DA 1V4SA 1P90A 1J5EK 3CC2N 3DWLA 3WNGA 2HBJA 2QI2A 4X64K 5KRSA 3MCAB 3VQ9A 3K9JA 1J9AA 1HYSA 4Z4CA 3M8SA 1MU2A 4A2AA 3PUFA 3ZETA 3UKUB 3KLEA 1X9WA 2V52B 3VF6A 2F9TA 3CMAN 2Q1NA 1Q82O 1BIUA 3HO1A 3O8MA 4JI0K 5FPDA 2E5LK 3VGKA 1JXBA 4J2BA 3OYJA 1W7AA 4ICLA 5CR4A 2GBZA 2P9KA 3P31A 2HNYA 2QWOA 3V9SA 4B9TA 2QEXN 3AO3A 4K43A 1HKCA 3DLBA 4FVUA 1XWLA 4JHDB 4BRIA 4DR3K 2E2PA 4CJ7A 4M3RA 1QZ5A 2IDOA 4EAHD 1GOBA 4DCHA 1QQOA 3IUCA 3R9PA 2G8KA 5HLFA 3AY9A 3OYMA 1VQON 5GINA 3TR8A 3VN5A 4PUOA 2FBTA 4FL9A 4HCCA 2W41A 4KHQA 3KVGA 4A5AA 3MECA 1M90O 2O8CA 1C0TA 5AFUH 5KGWA 5SWMA 1LV5A 4OGCA 4E1NA 3EKSA 3ZT3A 4CBWA 3O80A 4DG1A 1RCHA 3AVIA 3I33A 1BI4B 2Q36A 5FRNA 1JL1A 4HVJA 2IGIA 4IKFA 4BR4A 4KH5A 1GLLO 1ATSA 4M3YA 2FBXA 3F9MA 4AHCA 3FZLA 1BI4A 3DLKA 5AQIA 1JLBA 4O5BA 1VHXA 3CJBA 1RT7A 5KRTA 3MN5A 4GV3A 3HPHA 2O8DA 3T1AA 4W5RA 1SKWA 4IEEA 1DTTA 4BRPA 2X78A 4DR2K 1HPMA 2CGKA 1S3XA 3OY9A 2KZZA 1H1VA 4FLYA 4B3MK 4IFYA 4DR6K 3SYZA 2HHSA 4CEEA 3GOIA 4BRAA 2Y1IA 2P9KB 4U7BA 3L0QA 1VSDA 3WUHA 1TYQB 5AQSA 2VQFK 3PV8A 4E3SA 3NHGA 5CY4A 3MXMA 5KTQA 1W2BM 4KH4A 1Q86O 3VEZA 3L3UA 5JLHA 4K41A 1NM1A 2WFBA 3J7YP 5J2QA 4BVPA 1WBDA 2O8EA 1BA1A 1SUQA 4YOVA 1X1PA 3J8AA 3QEPA 3ZEUA 3RMBA 3BF1A 4BR2A 5CYQA 5AQHA 2HSTA 1KVCA 3AVBA 3TABA 1D4XA 3QMLA 1Z6RA 3THVA 3GL1A 1RNHA 2P1JA 4NYFA 2OCEA 1WSFA 4B3RK 3WQTA 1BQMA 2P5OA 1WNSA 1QQNA 5AQNA 4CESA 3SBTA 4LF6K 3F73A 4DB3A 4JI6K 3ENBA 1VQKN 3CPEA 2HVHA 3I56N 3S41A 3VMFB 3SZ2A 4JK9A 1HJOA 3C95A 4MDAA 1X9SA 2W40A 1QSSA 1NKBA 4WE1A 4BRGA 2QKBA 2VG5A 3GE1A 1OVQA 1HLUA 5GAGP 3JYTA 1NMNA 3M5RA 3TWHA 1K73O 4J2DA 4ILGB 2O8FB 2AA4A 1QTMA 4UQGA 4DMNA 4B9UA 3OA9A 1TL3A 3WXIA 1VQNN 4BDPA 2BUPA 4BVOA 2DFHA 3LZIA 3MDQA 4CF0A 4Z4FA 4H03B 3C6TA 4EIAA 4NCAA 3LWLA 3ZSVA 5JMVA 2HHQA 5E41A 1C6VA 4B8CA 1NKCA 1CZ9A 4RWTA 4IDKA 1M1KO 2DFFA 4MO4A 1FKPA 2XHBA 3RTVA 4O55A 4E19A 4DV2K 4M42A 3NE6A 4W5TA 4DQIA 1O13A 3CERA 4C1NI 1WB9A 4FJGA 3WNEA 4IFVA 4H5NA 1QSLA 5FLXO 3A5MC 4FWPA 4B1UB 3VF4A 2I7NA 2QWMA 4JI4K 4FCYA 1SS6A 2DFEA 4FOEA 5AJ3K 2CGLA 1FJGK 4F4KA 1WSIA 2Z1JA 1VSMA 1VQ4N 3QINA 4F2SA 1KAZA 4DQRA 3OYHA 3S3MA 4CHPA 4DQ8A 1MA9B 4OPAA 4FK4A 1ZBSA 3UKUA 4CEFA 4R5PA 1WUAA 2V51B 3O6WA 1ITGA 1T05A 1NNEA 5C15A 4PKHA 1XMQK 4DR4K 2HF4A 5LJVA 3VGLA 3V9UA 4DWIA 3HVRA 3E9LA 2KFZA 3A2FA 2UXDK 3K58A 4H5RA 2P9UB 4DTPA 4CJQA 3S9HA 2P5GA 2A40A 1JLGA 1K9MO 2VG7A 4BREA 1NGIA 4NLBA 3U3GA 3G6EN 3O9UA 4BQLA 1EQYA 1GLEG 3ZSQA 4CJFA 3OYCA 4FWNA 1BA0A 3AARA 1U6ZA 1K6YA 5FDLA 3NF9A 1YJWN 2YHAA 2RE2A 3HSTB 4GY2B 3JXUA 2ZWHA 1YXQA 1BL3A 2D1KA 4RG8A 1NKEA 2GUIA 2YNGA 3SAFA 4OX9K 1GLCG 5D3GA 3P4IA 4OLAA 3J7ZO 4FYDA 3I8DA 1SL0A 4W5QA 2PYJA 3RVCA 3MAQA 1IKVA 3AGKA 5AQTA 3SQ1A 4B9MA 4KH6A 2OZMA 1JXEA 4K8ZA 2IS3A 4XH1A 1XMOK 1N33K 3ZLJA 1D9DA 4DSJA 2NRVA 4FWQA 4DSLA 1W97L 2O8CB 4ZHRA 2D5RA 3DLHA 3SQ4A 4BC5A 3Q7CA 3T1HK 3P39A 4JK8A 4H5TA 5HRPA 1VQPN 1DTQA 2BGGA 1O1WA 3QLHA 3O3FA 3TTDA 2ZM6K 4KHNA 3S3NA 2QWNA 3S3OA 4CZEA 3LAMA 2GELA 3R6MA 5BPMA 2NRWA 4CHYA 1A5WA 4JYAK 3CCRN 5LMUK 3HI0A 4CJWA 4KKOA 4BC4A 5EXWA 1MDUB 4CIEA 2VQEK 3H6EA 4PQUA 4DUZK 5FRMA 4CEDA 4YORA 4JAXA 1S6QA 2YKNA 2G8VA 3FZHA 1WAFA 3QEIA 1X9JA 2KFNA 1VQ5N 1YAGA 4FJ5A 1NGFA 3HP6A 3FFKB 3WXLA 3OS2A 5AZJA 3TARA 4DV6K 3H3NO 3CD6N 3UB5A 2YHWA 4BR0A 3EN9A 1UA1A 4JK7A 3KIOA 4OPKA 4DU1A 2ASMA 5AQZA 1TAUA 4RW4A 4N41A 4DSEA 1LWEA 3OYKA 4B08A 2P9SA 1I94K 3M8PA 3M1FA 1YF5L 4CHQA 3SNNA 5AQRA 1KC8O 4KB0A 2G8IA 2VWKA 3T3FA 1TUYA 1YTAA 4EHTA 2VCPA 2E6MA 3THXA 5E26A 2HOEA 4C8MA 1CZAN 4GVMA 4CK1A 1G99A 4MDBA 3VQCA 4B1XB 3T69A 4E7LA 3KKSA 3ZSXA 3SUNA 4WYBA 3OYBA 3OYDA 3KJVA 3TAEA 2NRHA 3QESA 5IWAK 4KREA 1YJNN 4NLCA 4PHTX 2HNDA 1BGXT 4CBUA 4DU4A 2NUBA 1S5JA 3RR8A 1VSJA 4FLUA 1S6PA 1IJJA 5M1NA 3PO4A 1HRHA 2X6SA 4BG9A 3AA5X 3K5OA 3O08A 4Q5VA 3TTFA 1ZBFA 4AH9A 3L2WA 4BE1A 4A62A 4IO8A 2VWBA 3Q7BA 5JS2A 5AQKA 5BPLA 4DHYA 1T6DA 4Y0WA 5FPEA 1KRPA 1UWBA 2P9IA 3D2FB 1HNWK 3VF2A 3PY8A 3KLGA 4I9QA 4DLGA 2Q0UA 3LZJA 2JWKA 1JLQA 2OPSA 4DQPA 3SJJA 4RCHA 1YUWA 4JI8K 2P9UA 4DTUA 3CI5A 3FE1A 1NK5A 3I8BA 4AHRA 1LAVA 2KQ2A 3D2FA 1N6QA 4H5WA 2FBVA 4JKEA 4OPJA 1GLBG 4OKEA 5KPTA 1RTIA 2FXUA 3R8EA 1OH7A 4KHUA 1Y64A 4CFCA 3HYFA 5AQQA 1C0MA 1TV6A 4M41A 3V6DA 3OYNA 2HVIA 1N34K 4FLZA 4KI4A 3AO2A 1NLVA 4JI2K 4IXCA 4B3TK 4MO5A 4O8KA 2OZSA 2UUAK 2PY5A 1TAQA 3RSEA 3KD5E 2ZJPL 4PA1A 1BCMA 5LL6Z 4X66K 4ELVA 4DR5K 1C0FA 4CEBA 3LP0A 3OJSA 2UXCK 2D0PA 4H0VB 4I2PA 4JKGB 1S1TA 2RF2A 3OHRA 4B8AB 4BY9C 4JLHA 5CZ2A 2WUSA 4OVLA 1TGOA 4DLEA 1L3VA 3I55N 4CZKA 1VSIA 4GNIA 3RRHA 4V19S 5M1PA 1RDAA 3SAGA 3RMCA 4X62K 3RMAA 3IS9A 2HNZA 3VQ4A 3NMUA 3AAPA 1B9DA 2YV0X 4Q0BA 3CJ1A 3UKRB 1ZXOA 2PYLA 4CJEA 1HUXA 2D0BA 3OW2M 4ELUA 2AP1A 3KLFA 4LY7A 4WCEL 1E3MA 3VQQA 4E7HA 3KWIA 5J2PA 1NGCA 1TYQA 4CFDA 4O4GA 3CCUN 4ID5A 1NG9A 3H46O 5JS1A 4FWKA 2F8SA 4H4OA 4IEIA 3VQ8A 4C8LA 3CC7N 1RBVA 1ATRA 1HKGA 4FW1A 3AVMA 1XUPO 4XH5A 4H4MA 4X65K 4BROA 4CJ4A 4DTJA 1S72N 3U9ZA 2O4IA 4CJSA 3QETA 1VRUA 4DF8A 4FWOA 4CK3A 3CCVN 3NBPA 3OTOK 2QTDA 4IG0A 2RKIA 4JNEA 3MXJA 4BWMA 1YITN 3KZBA 4JS5A 4DFKA 2W6KA 4TSXA 3M3ZA 3SK3A 1NJYA 3AVHA 5JICA 3VA0A 4BRDA 3CQXA 3KHYA 2W6LA 5EX5A 3DAWA 2RHKA 3MCPA 1E4FT 2E2QA 3FZMA 3HL8A 2IVOA 4JKGA 3CJ7A 1N32K 3O1BA 2OYQA 4FJ7A 2FC0A 5JLFA 4CI6A 1C0GA 1Z05A 2LSNA 4CJPA 4RW9A 3PIOL 4JKDA 3B6PA 4JN4A 4FJKA 4H0OA 3D6RA 3J80O 2AJQA 4N5SA 4K25A 4OKKA 1RBUA 4CD1A 3LANA 3A5NC 2HHVA 1KTQA 2QWQA 4ZTFA 3NF6A 3RRGA 1WSJA 3TAQA 3BDPA 4E89A 4FLWA 1XQSC 4CEAA 5C2FA 4XH4A 5JVHL 3SMSA 4BRKA 5HRNA 1HQUA 2O4GA 2Z1GA 1SKSA 4BDZA 4HUEA 1RFQA 3UE5A 3THWA 1KVAA 3EO3A 4IJAA 3IRXA 2PZSA 1NOYA 4KTWA 2E1YA 4OLBA 4IOCL 1TUUA 2OA8A 2P9NB 4O44A 3LPTA 3ZETB 4B1YB 5LY3A 4CFAA 3E9PA 3SAHA 4KHWA 1RT3A 2E8AA 1IH7A 4WFBL 3C6AA 5J2NA 4CF1A 1KAYA 3BF3A 3WEEB 4R79A 4B1WB 1SL2A 2YHXA 4QS9A 3ZT1A 2KKZA 5C2DA 5I3UA 4RW8A 3VOVA 1YI2N 4CIGA 4AHTA 3BY5A 2ZGYA 4DKWA 2NRTA 3NCIA 3I0SA 3WQUA 3CCLN 4E1MA 5KPZA 1DGKN 1I39A 2NZTA 4FPBA 4FM1A 3AA4A 5F2RA 5HBMA 1YTUA 2D0OA 4FJ8A 5EOYA 1G15A 5B8HA 5HOOA 3V4IA 5JVGL 4BE0A 1RBTA 3KK2A 4CGIA 4W5OA 1HX1A 1L3SA 3E66A 4Z4IA 5A2QO 3OYEA 2IIRA 2HHHK 1WLJA 3VGMA 3CG7A 3CCSN 4AHSA 4DF4A 1OKJA 1S9GA 2ZQBA 1EXQA 1NBWA 3ITHA 3RWUA 1QS4A 4DR1K 4LSLA 4AHUA 1RTDA 1DKGD 3K2PA 3NAEA 1TKTA 3AVCA 5E84A 1J6ZA 1WSGA 5DMRA 1TKXA 3KK1A 3OYGA 4DV1K 1OH5A 1JJ2M 5AQGA 2KZMA 4CHNA 2VG6A 2E6LA 3U4LA 3L4QA 1BUPA 2ZGZA 4MLEA 4BRCA 4NO7A 1RBRA 3E01A 3OYFA 2WBNA 3CFRA 2VYPA 2E2NA 4PKGA 1SZ2A 1X9MA 2GX9A 5M1FA 1D5AA 3M8QA 5AR0A 3OYAA 3GDQA 4WFNL 3DXMB 5DM6L 2HHXA 3LDOA 3VA3A 3FLCO 3O9TA 4FVMA 3DOKA 4GKKK 1VRTA 2QK9A 4HTUA 3A8YA 3GBTA 3LP1A 4BACA 3K57A 2WONA 1UOCA 3ENOA 3QICA 4K8XA 3SPZA 1VAZA 3V1OA 3U3YA 3HSCA 1NGJA 3H08A 3DLLL 3ZSYA 4YFUA 2FSKA 1ZYQA 2QXLA 3ID6A 1T6CA 1D8YA 3C7NA 1KVBA 3CETA 5AQPA 3HM9A 1LWFA 3AO1A 5EVZA 1NGAA 4LD0A 2O8DB 1IKXA 3VEVA 5AQLA 3TSQA 4B9LA 3TPQA 4DV0K 3CQYA 4BGBA 2HB5A 5GAHP 3THXB 3AVLA 3ATUA 3P38A 4E7IA 4KHPK 1NJXA 1A5VA 4FWMA 3AA3A 5H1SQ 1R0AA 4DU3A 3HPOA 3QO9A 2HBKA 1BQNA 1NWKA 4LF7K 4J8FA 2Q0RA 3PSFA 4BRNA 3K5NA 3NGIA 3VEXA 5ADXA 4EZ6A 4Z4GA 4DS5A 2Q2RA 1YT3A 4RW6A 1YJ9N 5AQYA 1J5OA 1EX4A 1BOTO 2YJFA 2W42A 3NVMA 3TSUA 1JKHA 2CH6A 5BRHA 1HYVA 3LP2A 3KD1E 3O3GA 2OPQA 4F2RA 3D2EA 1XNRK 1W9HA 4BE2A 4M3UA 4JI7K 4FLVA 3L4IA 2A42A 3D7EO 1VQ8N 3EE8A 1WSEA 2ZF5O 3JS6A 1Y97A 1NGBA 3P1GA 4BGAA 1L3UA 4F3TA 3F2KA 3NGYA 3A0IX 1GLAG 3VQPA 3IMXA 3CHWA 2Y1JA 4B9VA 4LF4K 1VSFA 3AVNA 1J54A 3WXKA 4PWDA 1SV5A 3CF5L 3AVKA 1OVYA 4BRMA 3LALA 1ZBIA 3AA2A 4FWRA 5ADXH 4YOWA 1S1VA 1RILA 2UXBK 3NH0A 3AGRA 3H3OB 4GMJB 1ESVA 1XC3A 2QW9A 4E7JA 3K9KA 3VESA 3QEWA 4DV3K 1RTHA 1HNIA 1RDBA 1C0UA 3VQDA 4JRPA 4ISGA 5IT9O 5C10A 1ASWA 4N47A 1U2VA 1RTJA 5GIOA 3M6GA 3T19A 4MLHA 2HHWA 3WNHA 1E4GT 5BRFA 3DJCA 3SQ2A 4O0JA 5KPRA 1JLEA 3PO5A 3CMEN 4AM6A 1YHQN 2GTDA 4E7KA 4CJKA 1N5YA 2P9PB 2YI1A 2WOMA 4NXNK 3TSPA 4G9ZA 5KQDA 1N36K 3EZ5A 1K8KB 3HOTA 5J2MA 4B1ZA 3NGZA 4ZTJA 3TAPA 5CE3A 1KLNA 1VQ9N 3EEQA 5AQWA 2D0AA 4F9OA 4FZXC 4OO1J 4BC3A 1Q8IA 1K8KA 4KBOA 3DRRA 2YNIA 4DTSA 4DFJA 4KV8A 4ILHA 1XI1A 4HWIA 4EHUA 2P9PA 2HMIA 1B9FA 1GLFO 1T03A 3C0BA 3R1XA 4IFEA 4JI5K 3TAGA 4CJ3A 2DY4A 3G71N 4AILC 1SKRA 3DRPA 4AHVA 2Z1HA 4LFAK 2O8FA 4CGFA 4JRQA 4YOUA 1SQKA 4IBNA 2UYTA 4A59A 5BRDA 4DQQA 5EU7A 3L2RA 4JKHA 1IV0A 2BDPA 3LDSA 3PSIA 2F4VK 3MMVA 5J1EA 5BR9A 4JV5K 3BEXA 4XIUA 2HW3A 4KPYA 4JI1K 1DEJA 2D4WA 3ISNC 4LH4A 4OPHA 1WAJA 4DSFA 3K0SA 2ZD1A 3ZT2A 4H8KA 1C1CA 3QFUA 2A3ZA 4HHTA 4JS4A 3G10A 5LJWA 3MX2A 4JEPA 1JLAA 3C6UA 4FLXA 1TKDA 1VQLN 4NXMK 3HRGA 3MK6A 1FW6A 1NJWA 2HHTA 4BRHA 4DFMA 1FKOA 5FPMA 4WQ4C 3PX6A 3H1VX 3ZSRA 5BN9A 2V7YA 5AQXA 4KFBA 4W5NA 4QS7A 4DSIA 3OVNA 1YVUA 2QM1A 1T3VA 1K8AO 1YVNA 5ELZA 2YX6A 4WQ5C 5K14A 4HCBA 1NK6A 4M3XA 3C6HA 4H0PA 2ASOA 4CGDA 3OS1A 3UIQA 3LP3A 2B5JA 2XRIA 4MQ3A 4KHYA 3P83D 3O4NA 3PX0A 3K5MA 4F8RA 5FPNA 3NF7A 4EP4A 4E0DA 4BDYA 3PX4A 4K42A 1FXXA 3O3HA 3MN6A 3V9ZA 3IDHA 3VQ6A 4IOXA 4O5FA 5MLCQ 2E2OA 4FSVA 3MN7A 3VQBA 5C24A 2ASPA 2OPRA 4XEIA 4LF8K 1U04A 2ZE2A 3SUOA 3CCMN 3TTCA 4AF1A 3RR7A 1HYZA 1W0HA 4CJ5A 5T7BA 2IOCA 3HTVA 4CZFA 3CXCM 1KLMA 3L2VA 3SUQA 4I7FA 2I7PA 2R7YA 3FFIA 1NJIO 4H0XB 4F3OA 1DT9A 2D0CA 1REVA 2UUCK 3ULDA 3CC4N 5GAEP 4AQYK 1I3AA 1KXPA 3ZX3A 4FWLA 4CBXA 2FF3B 4YOTA 3LL3A 2GV9A 4CIFA 1DLOA 3C7NB 2PFUA 3W3DA 3IKMA 1JLFA 1IBKK 5F0XA 4ISFA 4FJHA 3FZKA 3QEVA 1U49A 4BRFA 3ZT4A 2FBYA 2I5JA 4EZ9A 2Z1IA 1WBBA 4GKJK 4CZMA 2F7TA 1RT6A 4IO9L 4B9SA 3KK7A 4FM0A 3ZEUB 4CF8A 4WQ4A 3VQ7A 4CVNE 5C25A 1HNVA 2BTFA 4I9LA 3BP8A 3SUPA 4IG3A 4JKBA 3O9RA 1R59O 3THYA 3EZWA 1ASVA 2DPNA 2YHYA 3CCQN 3D45A 2YHBA 2ITGA 2NNWA 3MN9A 3PIPL 1FK9A 1XC9A 1NGDA 1EWRA 2G8WA 4QCLA 3THYB 2OTLN 3FGUA 4FJJA 3TI0A 3E9OA 2JWLA 1RT4A 3CCJN 4IZ9A 1N8RO 2QA4N 1T7PA 3AVJA 4CGGA 3SJHA 4JHDA 4Y1CA 1NGEA 5HL7L 3OYIA 4DR7K 1Z26A 3SV3A 4B3OA 2HBLA 2NLXA 2JLEA 4PL8A 4WFAL 4A61A 1VSLA 4WF9L 4BR7A 4BC2A 5TKYA 4CF2A 4NYNA 2XY5A 3ULEB 4BR9A 3L8BA 3W0LA 1NJZA 4KB1A 4DTMA 4FK2A 1SL1A 4I6MB 3HOSA 1HQEA 2KW4A 3BGRA 3CFPA 4GW6A 3CJCA 3CQ8A 4GV6A 2HHUA 3QBWA 3P5JA 1HPZA 5AZIB 5AFUA 2GWJA 1QSYA 4M45A 3DYAA 5BREA 3CM5A 2Q3SA 1KQSM 4I2QA 4Z4EA 1QVFM 4A5BA 4EFHA 4CE9A 3ZCMA 1XHZA 1KD1O 3I0RA 4NB4A 3VERA 5BPNA 2Q97A 2E1ZA 3DLRA 4DS4A 1GLJO 2BH1A 4CK2A 4B9QA 3EY1A 5C0YA 2HMPA 3RMDA 4J2AA 4DSKA 4NCBA 3ID8A 4ISEA 1SAZA 1BDGA 4YOYA 3N4PA 4DV5K 1S1XA 3QIOA 3FR0A 4FXDA 4I6MA 4CGHA 1WOQA 3KKRA 4B1VA 1JLCA 4L8RB 3OJUA 1QZ6A 1V4TA 4CZGA 3VEWA 3TU5A 2JGUA 2P9NA 4ILJA 3CM6A 1TKZA 3VEYA 4CEOA 3QIPA 4KAZA 3GG4A 3AV9A 3ZT0A 1IKYA 1GOCA 4FJXA 1IBMK 3WEEA 1IO2A 4M3WA 3WXJA 3R3LA 2GEMA 3OS0A 1LW0A 3ALYA 4YHHK 1EP4A 1ATNA 3D2EB 2XY7A 2KLAA 2NRZA 2YKMA 4DV7K 3IFRA 1OH6A 3IG1A 1D9FA 4KHSA 1LCUA 1EETA 3QBXA 3N4QA 3SI6A 4Y1DA 5KQ8A 2GUPA 2XY6A 3K59A 5AQOA 5KGXA 1S9EA 2P9LA 3QB0A 3T7ZA 3EE9A 2E20A 3BZKA 1Q9XA 2V7ZA 4A57A 4LFBK 2E4LA 2G8FA 3CFOA 2PBDA 2G8HA 2YNFA 3VQEA 3CJAA 1U4BA 4CJVA 3D0PA 2A1RA 4CHZA 3ZSWA 2IVPA 2EWSA 4FOIA 4H0TB 1MWKA 1IBLK 1QE1A 2P9LB 3MEDA 5HROA 1CLQA 3LM2A 3OBYA 1VQ7N 1S1WA 1ZC6A 4HTLA 2IVNA 3FZFA 1CZBA 5KI6A 4CJLA 4YNQA 3OYLA 1RDDA 3NH2A 1L3TA 4CZJA 5AQUA 4RW7A 4DQSA 2B6AA 2H3GX 3CPWM 1B92A 3MWPA 3QFPA 2A41A 4B9NA 4OJRA 4CJUA 3KK3A 4FJNA 2WC9A 4KRFA 1JCGA 5BR8K 5HP1A 2A6AA 3KLIA 4E1JA 2XY8A 3LM9A 1KAXA 2FSNA 4Z94A 4JD2B 2O8BB 3WNFA 1NU0A 3AO4A 3MWTA 4IWVA 2KHOA 4CEQA 3HK2A 4GVEA 2XO7A 3DXMA 5GADP 3DOLA 4CFBA 1C1AA 3NFAA 3VTIA 1WSHA 1ASUA 3M8RA 3VETA 3ZYYX 2QWPA 1BIZA 1Q9YA 2O8BA 4BG8A 4CGJA 4JD2A 5M1QA 3G0ZA 3LPUA 3UKRA 4LF9K 5M1KA 3QEXA 4KO0A 1ZBHA 1RT5A 4IOAL 4QOZB 1QQCA 1J53A 3LWMA 2FSJA 3DLGA 1BU6O 1Q7YO 3HPGA 4WQ5A 1ZBUA 1TK0A 2P9SB 4CW7B 4CF9A 2HBMA 1HKBA 2WTUA 4IDHA 1CXUA 3SV4A 3B6OA 4FM2A 4DUYK 3A5OC 4AM7A 1HNXK 1Q81O 4HUFA 2OPPA 2IAJA 3AVFA 2B4JA 3ZSOA 3DM2A 1GOAA 2FLOA 4FJ9A 4FK0A 4B3SK 4QS8A 3G4SN 3HT3A 3NVKA 4C8OA 5BN8A 1VSKA 3EL2A 4G1QA 3G25A 1TK8A 3SPYA 4FZYA 5CZ1A 5CYMA 1NGGA 3C65A 4ELTA 4LH5A 3AVGA 4CZHA 3BUZB 3WT0A 5AQJA 4FW2A 4RTFD 2PAVA 1U47A 4L3QA 4YOXA 2X6NA 4CJRA 2CGJA 1LAWA 5C12A 5LMNK 5TKWA 3O9QA 4CEZA 2QXFA 3SMPA 2DTUA 4EP5A 5SZTA 4J2EA 4M7YA 3H45C 4GV9A 3LAKA 3L6QA 4FJLA 3A5LC 3V9WA 1BWFO 3HXMA 4U67L 1HJRA 4LC9B 3DRSA 1JCEA 3HZ6A 3OBWA 4BRLA 1RDWX 4DV4K 1IKWA 3AAQA 3IAYA 3V1QA 3V1RA 4CJTA 3HP9A 3DI6A 4M3TA 3CJ9A 5AQVA 5AZIA 3VENA 4JKFA 1EO1A 4BR5A 5FROA 3K5LA 5EY4A 3ZSZA 4O8UA 2ETJA 4C1NK 3NH1A 2YNHA 1VQ6N 3KWGA 4UY8O 3MX5A 5AQMA 3TAFA 4M63C 4FWSA 3LDNA 2ZJQL 2NRXA 1BISA 4LF5K 1UA0A 4CHOA 2KTQA 1WN7A 1TL1A 4M3ZA 3QNOA 2UU9K 4PL7A 1QHAA 2P9IB 1C1BA 5DK5A 1TVRA 3QDKA 5HRSA 3T1YK 3J81O 4KTZA 4BRQA 1UAXA 1RBSA 3TANA 5AZJB 1A5XA 4FLTA 2VWJA 1GLDG 3VQAA 1ZBLA 1X3MA 2UUBK 1HMVA 3ZX2A 4CERA 3VQ5A 2EHGA 5C42A 3BZCA 2YCHA 3F9KA 4CZLA 3O5BA 3HM8A 1VSHA 2QWLA 5M1OA 3J7AP 4FPAA 3U6FA 3F5TA 1NK4A 1U45A 1NGHA 3DXKB 3ENHA 1IG8A 1T8EA 3VEOA 1BCOA 4PY5A 3ASMA 4LSNA 5DM7L 4DTOA 4BQZA 3CCEN 3L2UA 3NDKA 2RN2A 1JCFA 1ILYA 1RDCA 2VGMA 3SQ0A 3EYZA 1NK8A 3ZX0A 3V81A 2J4RA 4JKCA 2GWKA 2BANA
chains in the Genus database with same CATH topology
4JV5K 2VQEK 1IBKK 4X65K 4DUZK 4JI8K 3JAMO 4JI1K 5BR8K 4LFCK 4DV3K 4DV5K 4GKJK 3OTOK 5IT9O 4NXMK 4DV4K 4CVNE 4DV6K 1J5EK 4DV0K 4DR2K 1N34K 4X64K 1XNQK 4B3MK 4KHPK 4DR6K 4JI2K 4B3TK 1IBMK 4OX9K 4DV2K 5A2QO 1I94K 2UUAK 1N32K 4LF9K 2VQFK 2HHHK 4JI0K 5LL6Z 4X66K 4YHHK 2E5LK 4LF5K 4DR5K 4LF7K 4NXNK 4DR1K 2UXCK 4DV7K 2UU9K 5FLXO 3J80O 1N36K 3J7YP 4CW7B 1XMOK 3T1YK 3J81O 1N33K 4JI4K 5AJ3K 1FJGK 4DUYK 4DV1K 1HNXK 4DR7K 4DR3K 2UUBK 4LF8K 4V19S 4JI3K 5IWAK 1XNRK 3T1HK 4LFBK 4B3SK 4JI7K 4X62K 4B3RK 3J7AP 4K0KK 4JI5K 4YY3K 4LF6K 2ZM6K 1IBLK 1HR0K 4JI6K 4LFAK 4LF4K 1XMQK 2UUCK 4DR4K 1HNZK 4AQYK 4JYAK 5LMUK 1HNWK 4GKKK 2UXBK 2UXDK 5LMNK 2F4VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 K;  2VQE K;  1IBK K;  4X65 K;  4DUZ K;  4JI8 K;  3JAM O;  4JI1 K;  5BR8 K;  4LFC K;  4DV3 K;  4DV5 K;  4GKJ K;  3OTO K;  5IT9 O;  4NXM K;  4DV4 K;  4CVN E;  4DV6 K;  1J5E K;  4DV0 K;  4DR2 K;  1N34 K;  4X64 K;  1XNQ K;  4B3M K;  4KHP K;  4DR6 K;  4JI2 K;  4B3T K;  1IBM K;  4OX9 K;  4DV2 K;  5A2Q O;  1I94 K;  2UUA K;  1N32 K;  4LF9 K;  2VQF K;  2HHH K;  4JI0 K;  5LL6 Z;  4X66 K;  4YHH K;  2E5L K;  4LF5 K;  4DR5 K;  4LF7 K;  4NXN K;  4DR1 K;  2UXC K;  4DV7 K;  2UU9 K;  5FLX O;  3J80 O;  1N36 K;  3J7Y P;  4CW7 B;  1XMO K;  3T1Y K;  3J81 O;  1N33 K;  4JI4 K;  5AJ3 K;  1FJG K;  4DUY K;  4DV1 K;  1HNX K;  4DR7 K;  4DR3 K;  2UUB K;  4LF8 K;  4V19 S;  4JI3 K;  5IWA K;  1XNR K;  3T1H K;  4LFB K;  4B3S K;  4JI7 K;  4X62 K;  4B3R K;  3J7A P;  4K0K K;  4JI5 K;  4YY3 K;  4LF6 K;  2ZM6 K;  1IBL K;  1HR0 K;  4JI6 K;  4LFA K;  4LF4 K;  1XMQ K;  2UUC K;  4DR4 K;  1HNZ K;  4AQY K;  4JYA K;  5LMU K;  1HNW K;  4GKK K;  2UXB K;  2UXD K;  5LMN K;  2F4V K; 
#chains in the Genus database with same CATH topology
 1VK0 A;  1U48 A;  4YDU C;  4DTX A;  1LOT B;  5AQF A;  2BE2 A;  2A5X A;  1VSE A;  1KCF A;  3HJF A;  4H0Y B;  2Q31 A;  2RPI A;  1Q18 A;  3EKU A;  1YIJ N;  4YDU A;  3AVA A;  4A2B A;  4CEC A;  3DXK A;  1QVG M;  3MEG A;  2A1S A;  4JKA A;  1BG3 A;  3CYM A;  1Z25 A;  3CIP A;  4Z0U A;  4KI6 A;  1F21 A;  1L5U A;  3QER A;  3L2Q A;  2NRR A;  3KTQ A;  2O8E B;  1X3N A;  3MXI A;  4FJM A;  2OTJ N;  3ATV A;  4DTR A;  2QKK A;  1IG9 A;  1XNQ K;  3AO5 A;  4M7X A;  4CD3 A;  3LDL A;  1LWC A;  4DFP A;  1P8Z A;  1XHX A;  2IC3 A;  4H5V A;  3QNN A;  1CXQ A;  1S22 A;  4OKJ A;  1KFD A;  1T44 A;  4FO0 A;  2ITM A;  3B8A X;  3O4W A;  3HVT A;  3C94 A;  3MEE A;  4FJI A;  1RT2 A;  3SLC A;  2CH5 A;  2X74 A;  2ATQ A;  3PLA A;  4C23 A;  1EWQ A;  4KTQ A;  4C8N A;  1OH8 A;  3VPZ A;  1KFS A;  3O4Q A;  1NK9 A;  2QWR A;  3O1W A;  5I42 A;  4MFB A;  4CZI A;  2E88 A;  4NCG A;  5I9E B;  2F96 A;  3DMJ A;  4Z4H A;  4JI3 K;  5GIP A;  5CHI A;  1EKE A;  3E1Y A;  4IJN A;  1MWM A;  3LDP A;  4C8K A;  3U8X A;  3WXM B;  4K0K K;  2G8U A;  3KLH A;  4QAG A;  2FF6 A;  3O9S A;  2VGN A;  3SBG A;  4YY3 K;  1VQM N;  1TK5 A;  1HR0 K;  1KSP A;  3JSM A;  1HNZ K;  1S1U A;  1JL2 A;  3NF8 A;  4PKI A;  1LW2 A;  1QHT A;  5HRR A;  2ZJR L;  4HUG A;  2HF3 A;  2YJE A;  4FZZ A;  3LDQ A;  1NMD A;  2F9W A;  4DTN A;  4CCH A;  1BHL A;  3TAM A;  3L3V A;  2P51 A;  2OAN A;  3RSE B;  3JAM O;  5F1X A;  3THW B;  3HBT A;  4N56 A;  4ID1 A;  4LFC K;  1RDU A;  3SCX A;  2EX3 A;  3V9X A;  2F8T A;  4OGE A;  1QQM A;  4O0I A;  1NK0 A;  1BO5 O;  1NOZ A;  3ULE A;  3VTH A;  4BWJ A;  1RT1 A;  4N76 A;  1RGI A;  3DLE A;  1NK7 A;  3H1Q A;  1U2V B;  3U9D A;  1V4S A;  1P90 A;  1J5E K;  3CC2 N;  3DWL A;  3WNG A;  2HBJ A;  2QI2 A;  4X64 K;  5KRS A;  3MCA B;  3VQ9 A;  3K9J A;  1J9A A;  1HYS A;  4Z4C A;  3M8S A;  1MU2 A;  4A2A A;  3PUF A;  3ZET A;  3UKU B;  3KLE A;  1X9W A;  2V52 B;  3VF6 A;  2F9T A;  3CMA N;  2Q1N A;  1Q82 O;  1BIU A;  3HO1 A;  3O8M A;  4JI0 K;  5FPD A;  2E5L K;  3VGK A;  1JXB A;  4J2B A;  3OYJ A;  1W7A A;  4ICL A;  5CR4 A;  2GBZ A;  2P9K A;  3P31 A;  2HNY A;  2QWO A;  3V9S A;  4B9T A;  2QEX N;  3AO3 A;  4K43 A;  1HKC A;  3DLB A;  4FVU A;  1XWL A;  4JHD B;  4BRI A;  4DR3 K;  2E2P A;  4CJ7 A;  4M3R A;  1QZ5 A;  2IDO A;  4EAH D;  1GOB A;  4DCH A;  1QQO A;  3IUC A;  3R9P A;  2G8K A;  5HLF A;  3AY9 A;  3OYM A;  1VQO N;  5GIN A;  3TR8 A;  3VN5 A;  4PUO A;  2FBT A;  4FL9 A;  4HCC A;  2W41 A;  4KHQ A;  3KVG A;  4A5A A;  3MEC A;  1M90 O;  2O8C A;  1C0T A;  5AFU H;  5KGW A;  5SWM A;  1LV5 A;  4OGC A;  4E1N A;  3EKS A;  3ZT3 A;  4CBW A;  3O80 A;  4DG1 A;  1RCH A;  3AVI A;  3I33 A;  1BI4 B;  2Q36 A;  5FRN A;  1JL1 A;  4HVJ A;  2IGI A;  4IKF A;  4BR4 A;  4KH5 A;  1GLL O;  1ATS A;  4M3Y A;  2FBX A;  3F9M A;  4AHC A;  3FZL A;  1BI4 A;  3DLK A;  5AQI A;  1JLB A;  4O5B A;  1VHX A;  3CJB A;  1RT7 A;  5KRT A;  3MN5 A;  4GV3 A;  3HPH A;  2O8D A;  3T1A A;  4W5R A;  1SKW A;  4IEE A;  1DTT A;  4BRP A;  2X78 A;  4DR2 K;  1HPM A;  2CGK A;  1S3X A;  3OY9 A;  2KZZ A;  1H1V A;  4FLY A;  4B3M K;  4IFY A;  4DR6 K;  3SYZ A;  2HHS A;  4CEE A;  3GOI A;  4BRA A;  2Y1I A;  2P9K B;  4U7B A;  3L0Q A;  1VSD A;  3WUH A;  1TYQ B;  5AQS A;  2VQF K;  3PV8 A;  4E3S A;  3NHG A;  5CY4 A;  3MXM A;  5KTQ A;  1W2B M;  4KH4 A;  1Q86 O;  3VEZ A;  3L3U A;  5JLH A;  4K41 A;  1NM1 A;  2WFB A;  3J7Y P;  5J2Q A;  4BVP A;  1WBD A;  2O8E A;  1BA1 A;  1SUQ A;  4YOV A;  1X1P A;  3J8A A;  3QEP A;  3ZEU A;  3RMB A;  3BF1 A;  4BR2 A;  5CYQ A;  5AQH A;  2HST A;  1KVC A;  3AVB A;  3TAB A;  1D4X A;  3QML A;  1Z6R A;  3THV A;  3GL1 A;  1RNH A;  2P1J A;  4NYF A;  2OCE A;  1WSF A;  4B3R K;  3WQT A;  1BQM A;  2P5O A;  1WNS A;  1QQN A;  5AQN A;  4CES A;  3SBT A;  4LF6 K;  3F73 A;  4DB3 A;  4JI6 K;  3ENB A;  1VQK N;  3CPE A;  2HVH A;  3I56 N;  3S41 A;  3VMF B;  3SZ2 A;  4JK9 A;  1HJO A;  3C95 A;  4MDA A;  1X9S A;  2W40 A;  1QSS A;  1NKB A;  4WE1 A;  4BRG A;  2QKB A;  2VG5 A;  3GE1 A;  1OVQ A;  1HLU A;  5GAG P;  3JYT A;  1NMN A;  3M5R A;  3TWH A;  1K73 O;  4J2D A;  4ILG B;  2O8F B;  2AA4 A;  1QTM A;  4UQG A;  4DMN A;  4B9U A;  3OA9 A;  1TL3 A;  3WXI A;  1VQN N;  4BDP A;  2BUP A;  4BVO A;  2DFH A;  3LZI A;  3MDQ A;  4CF0 A;  4Z4F A;  4H03 B;  3C6T A;  4EIA A;  4NCA A;  3LWL A;  3ZSV A;  5JMV A;  2HHQ A;  5E41 A;  1C6V A;  4B8C A;  1NKC A;  1CZ9 A;  4RWT A;  4IDK A;  1M1K O;  2DFF A;  4MO4 A;  1FKP A;  2XHB A;  3RTV A;  4O55 A;  4E19 A;  4DV2 K;  4M42 A;  3NE6 A;  4W5T A;  4DQI A;  1O13 A;  3CER A;  4C1N I;  1WB9 A;  4FJG A;  3WNE A;  4IFV A;  4H5N A;  1QSL A;  5FLX O;  3A5M C;  4FWP A;  4B1U B;  3VF4 A;  2I7N A;  2QWM A;  4JI4 K;  4FCY A;  1SS6 A;  2DFE A;  4FOE A;  5AJ3 K;  2CGL A;  1FJG K;  4F4K A;  1WSI A;  2Z1J A;  1VSM A;  1VQ4 N;  3QIN A;  4F2S A;  1KAZ A;  4DQR A;  3OYH A;  3S3M A;  4CHP A;  4DQ8 A;  1MA9 B;  4OPA A;  4FK4 A;  1ZBS A;  3UKU A;  4CEF A;  4R5P A;  1WUA A;  2V51 B;  3O6W A;  1ITG A;  1T05 A;  1NNE A;  5C15 A;  4PKH A;  1XMQ K;  4DR4 K;  2HF4 A;  5LJV A;  3VGL A;  3V9U A;  4DWI A;  3HVR A;  3E9L A;  2KFZ A;  3A2F A;  2UXD K;  3K58 A;  4H5R A;  2P9U B;  4DTP A;  4CJQ A;  3S9H A;  2P5G A;  2A40 A;  1JLG A;  1K9M O;  2VG7 A;  4BRE A;  1NGI A;  4NLB A;  3U3G A;  3G6E N;  3O9U A;  4BQL A;  1EQY A;  1GLE G;  3ZSQ A;  4CJF A;  3OYC A;  4FWN A;  1BA0 A;  3AAR A;  1U6Z A;  1K6Y A;  5FDL A;  3NF9 A;  1YJW N;  2YHA A;  2RE2 A;  3HST B;  4GY2 B;  3JXU A;  2ZWH A;  1YXQ A;  1BL3 A;  2D1K A;  4RG8 A;  1NKE A;  2GUI A;  2YNG A;  3SAF A;  4OX9 K;  1GLC G;  5D3G A;  3P4I A;  4OLA A;  3J7Z O;  4FYD A;  3I8D A;  1SL0 A;  4W5Q A;  2PYJ A;  3RVC A;  3MAQ A;  1IKV A;  3AGK A;  5AQT A;  3SQ1 A;  4B9M A;  4KH6 A;  2OZM A;  1JXE A;  4K8Z A;  2IS3 A;  4XH1 A;  1XMO K;  1N33 K;  3ZLJ A;  1D9D A;  4DSJ A;  2NRV A;  4FWQ A;  4DSL A;  1W97 L;  2O8C B;  4ZHR A;  2D5R A;  3DLH A;  3SQ4 A;  4BC5 A;  3Q7C A;  3T1H K;  3P39 A;  4JK8 A;  4H5T A;  5HRP A;  1VQP N;  1DTQ A;  2BGG A;  1O1W A;  3QLH A;  3O3F A;  3TTD A;  2ZM6 K;  4KHN A;  3S3N A;  2QWN A;  3S3O A;  4CZE A;  3LAM A;  2GEL A;  3R6M A;  5BPM A;  2NRW A;  4CHY A;  1A5W A;  4JYA K;  3CCR N;  5LMU K;  3HI0 A;  4CJW A;  4KKO A;  4BC4 A;  5EXW A;  1MDU B;  4CIE A;  2VQE K;  3H6E A;  4PQU A;  4DUZ K;  5FRM A;  4CED A;  4YOR A;  4JAX A;  1S6Q A;  2YKN A;  2G8V A;  3FZH A;  1WAF A;  3QEI A;  1X9J A;  2KFN A;  1VQ5 N;  1YAG A;  4FJ5 A;  1NGF A;  3HP6 A;  3FFK B;  3WXL A;  3OS2 A;  5AZJ A;  3TAR A;  4DV6 K;  3H3N O;  3CD6 N;  3UB5 A;  2YHW A;  4BR0 A;  3EN9 A;  1UA1 A;  4JK7 A;  3KIO A;  4OPK A;  4DU1 A;  2ASM A;  5AQZ A;  1TAU A;  4RW4 A;  4N41 A;  4DSE A;  1LWE A;  3OYK A;  4B08 A;  2P9S A;  1I94 K;  3M8P A;  3M1F A;  1YF5 L;  4CHQ A;  3SNN A;  5AQR A;  1KC8 O;  4KB0 A;  2G8I A;  2VWK A;  3T3F A;  1TUY A;  1YTA A;  4EHT A;  2VCP A;  2E6M A;  3THX A;  5E26 A;  2HOE A;  4C8M A;  1CZA N;  4GVM A;  4CK1 A;  1G99 A;  4MDB A;  3VQC A;  4B1X B;  3T69 A;  4E7L A;  3KKS A;  3ZSX A;  3SUN A;  4WYB A;  3OYB A;  3OYD A;  3KJV A;  3TAE A;  2NRH A;  3QES A;  5IWA K;  4KRE A;  1YJN N;  4NLC A;  4PHT X;  2HND A;  1BGX T;  4CBU A;  4DU4 A;  2NUB A;  1S5J A;  3RR8 A;  1VSJ A;  4FLU A;  1S6P A;  1IJJ A;  5M1N A;  3PO4 A;  1HRH A;  2X6S A;  4BG9 A;  3AA5 X;  3K5O A;  3O08 A;  4Q5V A;  3TTF A;  1ZBF A;  4AH9 A;  3L2W A;  4BE1 A;  4A62 A;  4IO8 A;  2VWB A;  3Q7B A;  5JS2 A;  5AQK A;  5BPL A;  4DHY A;  1T6D A;  4Y0W A;  5FPE A;  1KRP A;  1UWB A;  2P9I A;  3D2F B;  1HNW K;  3VF2 A;  3PY8 A;  3KLG A;  4I9Q A;  4DLG A;  2Q0U A;  3LZJ A;  2JWK A;  1JLQ A;  2OPS A;  4DQP A;  3SJJ A;  4RCH A;  1YUW A;  4JI8 K;  2P9U A;  4DTU A;  3CI5 A;  3FE1 A;  1NK5 A;  3I8B A;  4AHR A;  1LAV A;  2KQ2 A;  3D2F A;  1N6Q A;  4H5W A;  2FBV A;  4JKE A;  4OPJ A;  1GLB G;  4OKE A;  5KPT A;  1RTI A;  2FXU A;  3R8E A;  1OH7 A;  4KHU A;  1Y64 A;  4CFC A;  3HYF A;  5AQQ A;  1C0M A;  1TV6 A;  4M41 A;  3V6D A;  3OYN A;  2HVI A;  1N34 K;  4FLZ A;  4KI4 A;  3AO2 A;  1NLV A;  4JI2 K;  4IXC A;  4B3T K;  4MO5 A;  4O8K A;  2OZS A;  2UUA K;  2PY5 A;  1TAQ A;  3RSE A;  3KD5 E;  2ZJP L;  4PA1 A;  1BCM A;  5LL6 Z;  4X66 K;  4ELV A;  4DR5 K;  1C0F A;  4CEB A;  3LP0 A;  3OJS A;  2UXC K;  2D0P A;  4H0V B;  4I2P A;  4JKG B;  1S1T A;  2RF2 A;  3OHR A;  4B8A B;  4BY9 C;  4JLH A;  5CZ2 A;  2WUS A;  4OVL A;  1TGO A;  4DLE A;  1L3V A;  3I55 N;  4CZK A;  1VSI A;  4GNI A;  3RRH A;  4V19 S;  5M1P A;  1RDA A;  3SAG A;  3RMC A;  4X62 K;  3RMA A;  3IS9 A;  2HNZ A;  3VQ4 A;  3NMU A;  3AAP A;  1B9D A;  2YV0 X;  4Q0B A;  3CJ1 A;  3UKR B;  1ZXO A;  2PYL A;  4CJE A;  1HUX A;  2D0B A;  3OW2 M;  4ELU A;  2AP1 A;  3KLF A;  4LY7 A;  4WCE L;  1E3M A;  3VQQ A;  4E7H A;  3KWI A;  5J2P A;  1NGC A;  1TYQ A;  4CFD A;  4O4G A;  3CCU N;  4ID5 A;  1NG9 A;  3H46 O;  5JS1 A;  4FWK A;  2F8S A;  4H4O A;  4IEI A;  3VQ8 A;  4C8L A;  3CC7 N;  1RBV A;  1ATR A;  1HKG A;  4FW1 A;  3AVM A;  1XUP O;  4XH5 A;  4H4M A;  4X65 K;  4BRO A;  4CJ4 A;  4DTJ A;  1S72 N;  3U9Z A;  2O4I A;  4CJS A;  3QET A;  1VRU A;  4DF8 A;  4FWO A;  4CK3 A;  3CCV N;  3NBP A;  3OTO K;  2QTD A;  4IG0 A;  2RKI A;  4JNE A;  3MXJ A;  4BWM A;  1YIT N;  3KZB A;  4JS5 A;  4DFK A;  2W6K A;  4TSX A;  3M3Z A;  3SK3 A;  1NJY A;  3AVH A;  5JIC A;  3VA0 A;  4BRD A;  3CQX A;  3KHY A;  2W6L A;  5EX5 A;  3DAW A;  2RHK A;  3MCP A;  1E4F T;  2E2Q A;  3FZM A;  3HL8 A;  2IVO A;  4JKG A;  3CJ7 A;  1N32 K;  3O1B A;  2OYQ A;  4FJ7 A;  2FC0 A;  5JLF A;  4CI6 A;  1C0G A;  1Z05 A;  2LSN A;  4CJP A;  4RW9 A;  3PIO L;  4JKD A;  3B6P A;  4JN4 A;  4FJK A;  4H0O A;  3D6R A;  3J80 O;  2AJQ A;  4N5S A;  4K25 A;  4OKK A;  1RBU A;  4CD1 A;  3LAN A;  3A5N C;  2HHV A;  1KTQ A;  2QWQ A;  4ZTF A;  3NF6 A;  3RRG A;  1WSJ A;  3TAQ A;  3BDP A;  4E89 A;  4FLW A;  1XQS C;  4CEA A;  5C2F A;  4XH4 A;  5JVH L;  3SMS A;  4BRK A;  5HRN A;  1HQU A;  2O4G A;  2Z1G A;  1SKS A;  4BDZ A;  4HUE A;  1RFQ A;  3UE5 A;  3THW A;  1KVA A;  3EO3 A;  4IJA A;  3IRX A;  2PZS A;  1NOY A;  4KTW A;  2E1Y A;  4OLB A;  4IOC L;  1TUU A;  2OA8 A;  2P9N B;  4O44 A;  3LPT A;  3ZET B;  4B1Y B;  5LY3 A;  4CFA A;  3E9P A;  3SAH A;  4KHW A;  1RT3 A;  2E8A A;  1IH7 A;  4WFB L;  3C6A A;  5J2N A;  4CF1 A;  1KAY A;  3BF3 A;  3WEE B;  4R79 A;  4B1W B;  1SL2 A;  2YHX A;  4QS9 A;  3ZT1 A;  2KKZ A;  5C2D A;  5I3U A;  4RW8 A;  3VOV A;  1YI2 N;  4CIG A;  4AHT A;  3BY5 A;  2ZGY A;  4DKW A;  2NRT A;  3NCI A;  3I0S A;  3WQU A;  3CCL N;  4E1M A;  5KPZ A;  1DGK N;  1I39 A;  2NZT A;  4FPB A;  4FM1 A;  3AA4 A;  5F2R A;  5HBM A;  1YTU A;  2D0O A;  4FJ8 A;  5EOY A;  1G15 A;  5B8H A;  5HOO A;  3V4I A;  5JVG L;  4BE0 A;  1RBT A;  3KK2 A;  4CGI A;  4W5O A;  1HX1 A;  1L3S A;  3E66 A;  4Z4I A;  5A2Q O;  3OYE A;  2IIR A;  2HHH K;  1WLJ A;  3VGM A;  3CG7 A;  3CCS N;  4AHS A;  4DF4 A;  1OKJ A;  1S9G A;  2ZQB A;  1EXQ A;  1NBW A;  3ITH A;  3RWU A;  1QS4 A;  4DR1 K;  4LSL A;  4AHU A;  1RTD A;  1DKG D;  3K2P A;  3NAE A;  1TKT A;  3AVC A;  5E84 A;  1J6Z A;  1WSG A;  5DMR A;  1TKX A;  3KK1 A;  3OYG A;  4DV1 K;  1OH5 A;  1JJ2 M;  5AQG A;  2KZM A;  4CHN A;  2VG6 A;  2E6L A;  3U4L A;  3L4Q A;  1BUP A;  2ZGZ A;  4MLE A;  4BRC A;  4NO7 A;  1RBR A;  3E01 A;  3OYF A;  2WBN A;  3CFR A;  2VYP A;  2E2N A;  4PKG A;  1SZ2 A;  1X9M A;  2GX9 A;  5M1F A;  1D5A A;  3M8Q A;  5AR0 A;  3OYA A;  3GDQ A;  4WFN L;  3DXM B;  5DM6 L;  2HHX A;  3LDO A;  3VA3 A;  3FLC O;  3O9T A;  4FVM A;  3DOK A;  4GKK K;  1VRT A;  2QK9 A;  4HTU A;  3A8Y A;  3GBT A;  3LP1 A;  4BAC A;  3K57 A;  2WON A;  1UOC A;  3ENO A;  3QIC A;  4K8X A;  3SPZ A;  1VAZ A;  3V1O A;  3U3Y A;  3HSC A;  1NGJ A;  3H08 A;  3DLL L;  3ZSY A;  4YFU A;  2FSK A;  1ZYQ A;  2QXL A;  3ID6 A;  1T6C A;  1D8Y A;  3C7N A;  1KVB A;  3CET A;  5AQP A;  3HM9 A;  1LWF A;  3AO1 A;  5EVZ A;  1NGA A;  4LD0 A;  2O8D B;  1IKX A;  3VEV A;  5AQL A;  3TSQ A;  4B9L A;  3TPQ A;  4DV0 K;  3CQY A;  4BGB A;  2HB5 A;  5GAH P;  3THX B;  3AVL A;  3ATU A;  3P38 A;  4E7I A;  4KHP K;  1NJX A;  1A5V A;  4FWM A;  3AA3 A;  5H1S Q;  1R0A A;  4DU3 A;  3HPO A;  3QO9 A;  2HBK A;  1BQN A;  1NWK A;  4LF7 K;  4J8F A;  2Q0R A;  3PSF A;  4BRN A;  3K5N A;  3NGI A;  3VEX A;  5ADX A;  4EZ6 A;  4Z4G A;  4DS5 A;  2Q2R A;  1YT3 A;  4RW6 A;  1YJ9 N;  5AQY A;  1J5O A;  1EX4 A;  1BOT O;  2YJF A;  2W42 A;  3NVM A;  3TSU A;  1JKH A;  2CH6 A;  5BRH A;  1HYV A;  3LP2 A;  3KD1 E;  3O3G A;  2OPQ A;  4F2R A;  3D2E A;  1XNR K;  1W9H A;  4BE2 A;  4M3U A;  4JI7 K;  4FLV A;  3L4I A;  2A42 A;  3D7E O;  1VQ8 N;  3EE8 A;  1WSE A;  2ZF5 O;  3JS6 A;  1Y97 A;  1NGB A;  3P1G A;  4BGA A;  1L3U A;  4F3T A;  3F2K A;  3NGY A;  3A0I X;  1GLA G;  3VQP A;  3IMX A;  3CHW A;  2Y1J A;  4B9V A;  4LF4 K;  1VSF A;  3AVN A;  1J54 A;  3WXK A;  4PWD A;  1SV5 A;  3CF5 L;  3AVK A;  1OVY A;  4BRM A;  3LAL A;  1ZBI A;  3AA2 A;  4FWR A;  5ADX H;  4YOW A;  1S1V A;  1RIL A;  2UXB K;  3NH0 A;  3AGR A;  3H3O B;  4GMJ B;  1ESV A;  1XC3 A;  2QW9 A;  4E7J A;  3K9K A;  3VES A;  3QEW A;  4DV3 K;  1RTH A;  1HNI A;  1RDB A;  1C0U A;  3VQD A;  4JRP A;  4ISG A;  5IT9 O;  5C10 A;  1ASW A;  4N47 A;  1U2V A;  1RTJ A;  5GIO A;  3M6G A;  3T19 A;  4MLH A;  2HHW A;  3WNH A;  1E4G T;  5BRF A;  3DJC A;  3SQ2 A;  4O0J A;  5KPR A;  1JLE A;  3PO5 A;  3CME N;  4AM6 A;  1YHQ N;  2GTD A;  4E7K A;  4CJK A;  1N5Y A;  2P9P B;  2YI1 A;  2WOM A;  4NXN K;  3TSP A;  4G9Z A;  5KQD A;  1N36 K;  3EZ5 A;  1K8K B;  3HOT A;  5J2M A;  4B1Z A;  3NGZ A;  4ZTJ A;  3TAP A;  5CE3 A;  1KLN A;  1VQ9 N;  3EEQ A;  5AQW A;  2D0A A;  4F9O A;  4FZX C;  4OO1 J;  4BC3 A;  1Q8I A;  1K8K A;  4KBO A;  3DRR A;  2YNI A;  4DTS A;  4DFJ A;  4KV8 A;  4ILH A;  1XI1 A;  4HWI A;  4EHU A;  2P9P A;  2HMI A;  1B9F A;  1GLF O;  1T03 A;  3C0B A;  3R1X A;  4IFE A;  4JI5 K;  3TAG A;  4CJ3 A;  2DY4 A;  3G71 N;  4AIL C;  1SKR A;  3DRP A;  4AHV A;  2Z1H A;  4LFA K;  2O8F A;  4CGF A;  4JRQ A;  4YOU A;  1SQK A;  4IBN A;  2UYT A;  4A59 A;  5BRD A;  4DQQ A;  5EU7 A;  3L2R A;  4JKH A;  1IV0 A;  2BDP A;  3LDS A;  3PSI A;  2F4V K;  3MMV A;  5J1E A;  5BR9 A;  4JV5 K;  3BEX A;  4XIU A;  2HW3 A;  4KPY A;  4JI1 K;  1DEJ A;  2D4W A;  3ISN C;  4LH4 A;  4OPH A;  1WAJ A;  4DSF A;  3K0S A;  2ZD1 A;  3ZT2 A;  4H8K A;  1C1C A;  3QFU A;  2A3Z A;  4HHT A;  4JS4 A;  3G10 A;  5LJW A;  3MX2 A;  4JEP A;  1JLA A;  3C6U A;  4FLX A;  1TKD A;  1VQL N;  4NXM K;  3HRG A;  3MK6 A;  1FW6 A;  1NJW A;  2HHT A;  4BRH A;  4DFM A;  1FKO A;  5FPM A;  4WQ4 C;  3PX6 A;  3H1V X;  3ZSR A;  5BN9 A;  2V7Y A;  5AQX A;  4KFB A;  4W5N A;  4QS7 A;  4DSI A;  3OVN A;  1YVU A;  2QM1 A;  1T3V A;  1K8A O;  1YVN A;  5ELZ A;  2YX6 A;  4WQ5 C;  5K14 A;  4HCB A;  1NK6 A;  4M3X A;  3C6H A;  4H0P A;  2ASO A;  4CGD A;  3OS1 A;  3UIQ A;  3LP3 A;  2B5J A;  2XRI A;  4MQ3 A;  4KHY A;  3P83 D;  3O4N A;  3PX0 A;  3K5M A;  4F8R A;  5FPN A;  3NF7 A;  4EP4 A;  4E0D A;  4BDY A;  3PX4 A;  4K42 A;  1FXX A;  3O3H A;  3MN6 A;  3V9Z A;  3IDH A;  3VQ6 A;  4IOX A;  4O5F A;  5MLC Q;  2E2O A;  4FSV A;  3MN7 A;  3VQB A;  5C24 A;  2ASP A;  2OPR A;  4XEI A;  4LF8 K;  1U04 A;  2ZE2 A;  3SUO A;  3CCM N;  3TTC A;  4AF1 A;  3RR7 A;  1HYZ A;  1W0H A;  4CJ5 A;  5T7B A;  2IOC A;  3HTV A;  4CZF A;  3CXC M;  1KLM A;  3L2V A;  3SUQ A;  4I7F A;  2I7P A;  2R7Y A;  3FFI A;  1NJI O;  4H0X B;  4F3O A;  1DT9 A;  2D0C A;  1REV A;  2UUC K;  3ULD A;  3CC4 N;  5GAE P;  4AQY K;  1I3A A;  1KXP A;  3ZX3 A;  4FWL A;  4CBX A;  2FF3 B;  4YOT A;  3LL3 A;  2GV9 A;  4CIF A;  1DLO A;  3C7N B;  2PFU A;  3W3D A;  3IKM A;  1JLF A;  1IBK K;  5F0X A;  4ISF A;  4FJH A;  3FZK A;  3QEV A;  1U49 A;  4BRF A;  3ZT4 A;  2FBY A;  2I5J A;  4EZ9 A;  2Z1I A;  1WBB A;  4GKJ K;  4CZM A;  2F7T A;  1RT6 A;  4IO9 L;  4B9S A;  3KK7 A;  4FM0 A;  3ZEU B;  4CF8 A;  4WQ4 A;  3VQ7 A;  4CVN E;  5C25 A;  1HNV A;  2BTF A;  4I9L A;  3BP8 A;  3SUP A;  4IG3 A;  4JKB A;  3O9R A;  1R59 O;  3THY A;  3EZW A;  1ASV A;  2DPN A;  2YHY A;  3CCQ N;  3D45 A;  2YHB A;  2ITG A;  2NNW A;  3MN9 A;  3PIP L;  1FK9 A;  1XC9 A;  1NGD A;  1EWR A;  2G8W A;  4QCL A;  3THY B;  2OTL N;  3FGU A;  4FJJ A;  3TI0 A;  3E9O A;  2JWL A;  1RT4 A;  3CCJ N;  4IZ9 A;  1N8R O;  2QA4 N;  1T7P A;  3AVJ A;  4CGG A;  3SJH A;  4JHD A;  4Y1C A;  1NGE A;  5HL7 L;  3OYI A;  4DR7 K;  1Z26 A;  3SV3 A;  4B3O A;  2HBL A;  2NLX A;  2JLE A;  4PL8 A;  4WFA L;  4A61 A;  1VSL A;  4WF9 L;  4BR7 A;  4BC2 A;  5TKY A;  4CF2 A;  4NYN A;  2XY5 A;  3ULE B;  4BR9 A;  3L8B A;  3W0L A;  1NJZ A;  4KB1 A;  4DTM A;  4FK2 A;  1SL1 A;  4I6M B;  3HOS A;  1HQE A;  2KW4 A;  3BGR A;  3CFP A;  4GW6 A;  3CJC A;  3CQ8 A;  4GV6 A;  2HHU A;  3QBW A;  3P5J A;  1HPZ A;  5AZI B;  5AFU A;  2GWJ A;  1QSY A;  4M45 A;  3DYA A;  5BRE A;  3CM5 A;  2Q3S A;  1KQS M;  4I2Q A;  4Z4E A;  1QVF M;  4A5B A;  4EFH A;  4CE9 A;  3ZCM A;  1XHZ A;  1KD1 O;  3I0R A;  4NB4 A;  3VER A;  5BPN A;  2Q97 A;  2E1Z A;  3DLR A;  4DS4 A;  1GLJ O;  2BH1 A;  4CK2 A;  4B9Q A;  3EY1 A;  5C0Y A;  2HMP A;  3RMD A;  4J2A A;  4DSK A;  4NCB A;  3ID8 A;  4ISE A;  1SAZ A;  1BDG A;  4YOY A;  3N4P A;  4DV5 K;  1S1X A;  3QIO A;  3FR0 A;  4FXD A;  4I6M A;  4CGH A;  1WOQ A;  3KKR A;  4B1V A;  1JLC A;  4L8R B;  3OJU A;  1QZ6 A;  1V4T A;  4CZG A;  3VEW A;  3TU5 A;  2JGU A;  2P9N A;  4ILJ A;  3CM6 A;  1TKZ A;  3VEY A;  4CEO A;  3QIP A;  4KAZ A;  3GG4 A;  3AV9 A;  3ZT0 A;  1IKY A;  1GOC A;  4FJX A;  1IBM K;  3WEE A;  1IO2 A;  4M3W A;  3WXJ A;  3R3L A;  2GEM A;  3OS0 A;  1LW0 A;  3ALY A;  4YHH K;  1EP4 A;  1ATN A;  3D2E B;  2XY7 A;  2KLA A;  2NRZ A;  2YKM A;  4DV7 K;  3IFR A;  1OH6 A;  3IG1 A;  1D9F A;  4KHS A;  1LCU A;  1EET A;  3QBX A;  3N4Q A;  3SI6 A;  4Y1D A;  5KQ8 A;  2GUP A;  2XY6 A;  3K59 A;  5AQO A;  5KGX A;  1S9E A;  2P9L A;  3QB0 A;  3T7Z A;  3EE9 A;  2E20 A;  3BZK A;  1Q9X A;  2V7Z A;  4A57 A;  4LFB K;  2E4L A;  2G8F A;  3CFO A;  2PBD A;  2G8H A;  2YNF A;  3VQE A;  3CJA A;  1U4B A;  4CJV A;  3D0P A;  2A1R A;  4CHZ A;  3ZSW A;  2IVP A;  2EWS A;  4FOI A;  4H0T B;  1MWK A;  1IBL K;  1QE1 A;  2P9L B;  3MED A;  5HRO A;  1CLQ A;  3LM2 A;  3OBY A;  1VQ7 N;  1S1W A;  1ZC6 A;  4HTL A;  2IVN A;  3FZF A;  1CZB A;  5KI6 A;  4CJL A;  4YNQ A;  3OYL A;  1RDD A;  3NH2 A;  1L3T A;  4CZJ A;  5AQU A;  4RW7 A;  4DQS A;  2B6A A;  2H3G X;  3CPW M;  1B92 A;  3MWP A;  3QFP A;  2A41 A;  4B9N A;  4OJR A;  4CJU A;  3KK3 A;  4FJN A;  2WC9 A;  4KRF A;  1JCG A;  5BR8 K;  5HP1 A;  2A6A A;  3KLI A;  4E1J A;  2XY8 A;  3LM9 A;  1KAX A;  2FSN A;  4Z94 A;  4JD2 B;  2O8B B;  3WNF A;  1NU0 A;  3AO4 A;  3MWT A;  4IWV A;  2KHO A;  4CEQ A;  3HK2 A;  4GVE A;  2XO7 A;  3DXM A;  5GAD P;  3DOL A;  4CFB A;  1C1A A;  3NFA A;  3VTI A;  1WSH A;  1ASU A;  3M8R A;  3VET A;  3ZYY X;  2QWP A;  1BIZ A;  1Q9Y A;  2O8B A;  4BG8 A;  4CGJ A;  4JD2 A;  5M1Q A;  3G0Z A;  3LPU A;  3UKR A;  4LF9 K;  5M1K A;  3QEX A;  4KO0 A;  1ZBH A;  1RT5 A;  4IOA L;  4QOZ B;  1QQC A;  1J53 A;  3LWM A;  2FSJ A;  3DLG A;  1BU6 O;  1Q7Y O;  3HPG A;  4WQ5 A;  1ZBU A;  1TK0 A;  2P9S B;  4CW7 B;  4CF9 A;  2HBM A;  1HKB A;  2WTU A;  4IDH A;  1CXU A;  3SV4 A;  3B6O A;  4FM2 A;  4DUY K;  3A5O C;  4AM7 A;  1HNX K;  1Q81 O;  4HUF A;  2OPP A;  2IAJ A;  3AVF A;  2B4J A;  3ZSO A;  3DM2 A;  1GOA A;  2FLO A;  4FJ9 A;  4FK0 A;  4B3S K;  4QS8 A;  3G4S N;  3HT3 A;  3NVK A;  4C8O A;  5BN8 A;  1VSK A;  3EL2 A;  4G1Q A;  3G25 A;  1TK8 A;  3SPY A;  4FZY A;  5CZ1 A;  5CYM A;  1NGG A;  3C65 A;  4ELT A;  4LH5 A;  3AVG A;  4CZH A;  3BUZ B;  3WT0 A;  5AQJ A;  4FW2 A;  4RTF D;  2PAV A;  1U47 A;  4L3Q A;  4YOX A;  2X6N A;  4CJR A;  2CGJ A;  1LAW A;  5C12 A;  5LMN K;  5TKW A;  3O9Q A;  4CEZ A;  2QXF A;  3SMP A;  2DTU A;  4EP5 A;  5SZT A;  4J2E A;  4M7Y A;  3H45 C;  4GV9 A;  3LAK A;  3L6Q A;  4FJL A;  3A5L C;  3V9W A;  1BWF O;  3HXM A;  4U67 L;  1HJR A;  4LC9 B;  3DRS A;  1JCE A;  3HZ6 A;  3OBW A;  4BRL A;  1RDW X;  4DV4 K;  1IKW A;  3AAQ A;  3IAY A;  3V1Q A;  3V1R A;  4CJT A;  3HP9 A;  3DI6 A;  4M3T A;  3CJ9 A;  5AQV A;  5AZI A;  3VEN A;  4JKF A;  1EO1 A;  4BR5 A;  5FRO A;  3K5L A;  5EY4 A;  3ZSZ A;  4O8U A;  2ETJ A;  4C1N K;  3NH1 A;  2YNH A;  1VQ6 N;  3KWG A;  4UY8 O;  3MX5 A;  5AQM A;  3TAF A;  4M63 C;  4FWS A;  3LDN A;  2ZJQ L;  2NRX A;  1BIS A;  4LF5 K;  1UA0 A;  4CHO A;  2KTQ A;  1WN7 A;  1TL1 A;  4M3Z A;  3QNO A;  2UU9 K;  4PL7 A;  1QHA A;  2P9I B;  1C1B A;  5DK5 A;  1TVR A;  3QDK A;  5HRS A;  3T1Y K;  3J81 O;  4KTZ A;  4BRQ A;  1UAX A;  1RBS A;  3TAN A;  5AZJ B;  1A5X A;  4FLT A;  2VWJ A;  1GLD G;  3VQA A;  1ZBL A;  1X3M A;  2UUB K;  1HMV A;  3ZX2 A;  4CER A;  3VQ5 A;  2EHG A;  5C42 A;  3BZC A;  2YCH A;  3F9K A;  4CZL A;  3O5B A;  3HM8 A;  1VSH A;  2QWL A;  5M1O A;  3J7A P;  4FPA A;  3U6F A;  3F5T A;  1NK4 A;  1U45 A;  1NGH A;  3DXK B;  3ENH A;  1IG8 A;  1T8E A;  3VEO A;  1BCO A;  4PY5 A;  3ASM A;  4LSN A;  5DM7 L;  4DTO A;  4BQZ A;  3CCE N;  3L2U A;  3NDK A;  2RN2 A;  1JCF A;  1ILY A;  1RDC A;  2VGM A;  3SQ0 A;  3EYZ A;  1NK8 A;  3ZX0 A;  3V81 A;  2J4R A;  4JKC A;  2GWK A;  2BAN A; 
#chains in the Genus database with same CATH homology
 4JV5 K;  2VQE K;  1IBK K;  4X65 K;  4DUZ K;  4JI8 K;  3JAM O;  4JI1 K;  5BR8 K;  4LFC K;  4DV3 K;  4DV5 K;  4GKJ K;  3OTO K;  5IT9 O;  4NXM K;  4DV4 K;  4CVN E;  4DV6 K;  1J5E K;  4DV0 K;  4DR2 K;  1N34 K;  4X64 K;  1XNQ K;  4B3M K;  4KHP K;  4DR6 K;  4JI2 K;  4B3T K;  1IBM K;  4OX9 K;  4DV2 K;  5A2Q O;  1I94 K;  2UUA K;  1N32 K;  4LF9 K;  2VQF K;  2HHH K;  4JI0 K;  5LL6 Z;  4X66 K;  4YHH K;  2E5L K;  4LF5 K;  4DR5 K;  4LF7 K;  4NXN K;  4DR1 K;  2UXC K;  4DV7 K;  2UU9 K;  5FLX O;  3J80 O;  1N36 K;  3J7Y P;  4CW7 B;  1XMO K;  3T1Y K;  3J81 O;  1N33 K;  4JI4 K;  5AJ3 K;  1FJG K;  4DUY K;  4DV1 K;  1HNX K;  4DR7 K;  4DR3 K;  2UUB K;  4LF8 K;  4V19 S;  4JI3 K;  5IWA K;  1XNR K;  3T1H K;  4LFB K;  4B3S K;  4JI7 K;  4X62 K;  4B3R K;  3J7A P;  4K0K K;  4JI5 K;  4YY3 K;  4LF6 K;  2ZM6 K;  1IBL K;  1HR0 K;  4JI6 K;  4LFA K;  4LF4 K;  1XMQ K;  2UUC K;  4DR4 K;  1HNZ K;  4AQY K;  4JYA K;  5LMU K;  1HNW K;  4GKK K;  2UXB K;  2UXD K;  5LMN K;  2F4V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...