4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
b'KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
molecule tags Transferase
source organism Pyrococcus abyssi ge5
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
5AJ3K 4LFBK 2UXDK 1XNQK 4JI1K 4DR4K 4K0KK 3J7AP 4X65K 4AQYK 4OX9K 4LF6K 2UU9K 4DV1K 3T1YK 4JV5K 1HNXK 4JYAK 4NXMK 1N36K 5IWAK 4X62K 2UUCK 4JI0K 4X64K 4DV3K 1N33K 1I94K 4B3SK 3J7YP 3J81O 5A2QO 1IBMK 4NXNK 5LMUK 2UUBK 4YHHK 5IT9O 1XMOK 2E5LK 4DR2K 4CW7B 4LF7K 4JI8K 1HR0K 4CVNE 2VQFK 3T1HK 4DUZK 4LF8K 4JI4K 2F4VK 4DR1K 4LFCK 1N34K 4B3TK 1IBKK 3J80O 4LFAK 5BR8K 4JI5K 5LMNK 4DR5K 4B3MK 5FLXO 4LF4K 1N32K 3OTOK 5LL6Z 1FJGK 4DV5K 4LF5K 4DUYK 4KHPK 4JI7K 4DV4K 1HNWK 4DV2K 4JI2K 4X66K 2UXCK 4V19S 4DV7K 1J5EK 1IBLK 4B3RK 4DR6K 4DV6K 1XNRK 4DR7K 4GKKK 4DV0K 4LF9K 4JI3K 4YY3K 2VQEK 2HHHK 2UUAK 3JAMO 1HNZK 4JI6K 1XMQK 4GKJK 2UXBK 4DR3K 2ZM6K
chains in the Genus database with same CATH superfamily
4AHUA 4G1QA 2UXDK 3U9ZA 3VTHA 4PY5A 3TAGA 4KV8A 1T7PA 2Q36A 3AA3A 4Z4GA 1FK9A 3T1YK 3M8QA 3VGKA 1TAQA 3OHRA 4DV3K 3NE6A 3CCEN 4OPJA 1NK5A 3D6RA 4DQPA 2GWJA 1RBRA 1DTQA 1TL1A 3IMXA 3VEZA 4RW4A 2QK9A 3N4QA 2AJQA 2HBJA 4JKGA 4BWMA 4EZ6A 2ATQA 4YORA 1ITGA 4LH5A 4WFAL 5DMRA 4M42A 2HHQA 2AA4A 2ASPA 4KKOA 2A5XA 2Q2RA 3KJVA 1DGKN 2Z1JA 1P90A 4CJ5A 2PYLA 4N47A 1TYQB 4A2BA 1KQSM 2O8DA 5AQMA 3TSUA 4DCHA 1SAZA 3VQDA 1NGJA 3HRGA 3SMPA 4O44A 4WQ5C 1WSEA 4CJEA 4BRGA 5AQFA 1NGAA 4JKFA 4IWVA 1MWKA 3O5BA 1NGFA 3QIOA 2I7PA 1GOAA 1NGDA 5HOOA 4PL7A 3J8AA 1VQON 3UKRB 3CFOA 4DV2K 1IO2A 3HK2A 1WN7A 4BQLA 4KHUA 4DTUA 1MU2A 3KLEA 4JK7A 5M1QA 3ZLJA 5J2MA 3EE8A 1NOYA 1TK0A 2ASOA 4B9TA 3O1BA 3QB0A 4QS7A 4CEFA 1IH7A 4FOIA 2E2PA 5KGXA 1JLFA 3ZT2A 5FRNA 3VEVA 1HRHA 2E88A 3EZ5A 3CMEN 3LP1A 3O9SA 4IXCA 3OYHA 4OPKA 1M90O 4DS5A 4CHZA 4FJ7A 2NUBA 4N76A 1VSIA 3TARA 4FJ9A 3L2QA 3RSEA 4C8OA 2BTFA 4FLZA 1T44A 3DMJA 3H1QA 3E1YA 1G99A 5BRHA 3VGLA 3CCJN 1SS6A 5BRFA 1VAZA 1CZ9A 3VQQA 4KB0A 4BR2A 3C6UA 3CC2N 4FWMA 4JD2A 3BY5A 4KI4A 3MMVA 4E1MA 3QBWA 4M3XA 1C0UA 1TL3A 1XMOK 4M3UA 2V52B 2RF2A 2VWJA 3AVJA 3TTDA 3VN5A 4CVNE 3BP8A 3ASMA 1BCOA 3CYMA 4DFMA 4CF9A 3DWLA 2IC3A 2XHBA 4JKGB 4WQ4C 3MAQA 1IBKK 3SZ2A 3ITHA 4CK2A 1YJNN 1BIUA 4FWQA 3SUNA 3SPYA 5GINA 1WNSA 4IFVA 3VQ4A 2R7YA 3U9DA 5F1XA 3LDOA 3TR8A 4KPYA 2KQ2A 1DKGD 2IDOA 1Y97A 1KVBA 4R79A 2HHTA 1BOTO 1RDDA 2FXUA 3OVNA 1NK0A 4RW7A 4LF5K 1JCGA 5K14A 1SZ2A 3C95A 2V7ZA 4RWTA 1YHQN 1JLCA 4CJQA 4DV7K 3ZX3A 4DR6K 3VQBA 3S3MA 1WSJA 4BDPA 3IDHA 1CXUA 4UY8O 3K59A 4JK9A 2RN2A 4CZEA 3FR0A 3V1RA 4O5BA 3VA0A 3NCIA 4J2EA 2O4IA 1RDWX 2RKIA 4K42A 3LP2A 5HRRA 3G4SN 5HRNA 2IOCA 4M63C 3DRRA 4OKKA 2DFFA 5D3GA 3KLIA 1JLEA 3DLLL 4CGIA 4AQYK 4YOYA 5BREA 1YITN 3ZSXA 2PFUA 3U3GA 4C1NI 5T7BA 2UUCK 3HTVA 3P31A 5J2PA 3WT0A 2E4LA 2F7TA 4A5BA 5JS1A 2ETJA 3SV3A 2OANA 1KAZA 3AO2A 2ZGZA 2O4GA 4UQGA 5A2QO 2X6SA 3C6HA 5HBMA 3CPEA 5M1KA 4BC3A 5DK5A 1NK6A 5FPNA 4OKEA 3F9MA 3PO4A 4I9QA 3VMFB 1ZYQA 4MLEA 3VESA 4PQUA 3THXA 3T1HK 4B1UB 3NVKA 1BG3A 4GVEA 4M7XA 5BR9A 3VA3A 2QWQA 2OA8A 3O4WA 1U04A 1LWFA 2YCHA 3WEEA 1HKGA 2FLOA 3ENBA 2Q31A 1A5XA 4PKIA 1RDCA 3NBPA 2ZJRL 3HVRA 4B3MK 4DHYA 4EFHA 5AQQA 1Q9YA 5AZJA 4JRQA 3ISNC 3SQ1A 1QSLA 3LP3A 4I6MA 4OLBA 4JAXA 1NKEA 1J9AA 3P83D 3L3UA 4DMNA 1BU6O 4WFBL 3KK1A 3EYZA 3IAYA 4JI7K 1TUUA 5FPDA 2W41A 4OPAA 4B1YB 4DSKA 3DLBA 4FCYA 5JMVA 3VQAA 4ZHRA 3OA9A 1RT4A 4BRMA 5ELZA 4B3OA 1SKSA 3EY1A 4O5FA 1SL2A 2HHHK 3KTQA 3TANA 2VWBA 4QOZB 1NK7A 3OS2A 4FZZA 1EP4A 5AJ3K 4CEDA 4JD2B 4DTPA 3WNFA 2G8WA 3QLHA 1LWCA 5M1PA 4FSVA 3SMSA 1L3SA 4I6MB 2F9TA 3ZSVA 2D0AA 4DQ8A 4BWJA 3CC4N 3C0BA 4Z0UA 3OYNA 1U47A 3O1WA 2DTUA 3A5NC 3CQYA 4J2BA 5FROA 1S9GA 3AO5A 4PKGA 4CZFA 4Z4CA 4FJNA 3GDQA 3FZLA 2QWNA 4YOXA 4FJKA 2UUBK 2PBDA 1L3VA 2IIRA 4BRQA 3SV4A 3I0SA 1Z6RA 3SYZA 1Q18A 1BA1A 1NGHA 2NRVA 4I2PA 3EKSA 3E9OA 5CYQA 3AA5X 4AM7A 1HKCA 3NH2A 3R1XA 3D2FB 1IKVA 1YTAA 5C0YA 3IG1A 2NRXA 4DTXA 5AQRA 2RE2A 4PWDA 3VQ5A 4DFPA 3A5OC 3VETA 1LCUA 1T03A 4CFAA 3UB5A 4ILJA 3LDSA 1YJWN 1W2BM 4A57A 4DF8A 4DTJA 1NJXA 3V1QA 2QM1A 4CD1A 3O80A 3SCXA 2G8HA 2O8FA 4M3ZA 1Q8IA 3I8DA 2VGNA 4CZHA 3CPWM 2HHSA 3CFRA 3CG7A 2ITGA 4HTLA 2J4RA 4W5TA 4K25A 2OTLN 3VQ7A 3CCMN 1WBDA 3VEXA 4CGDA 3LPUA 1XQSC 4JI6K 5AQGA 2VG5A 5F2RA 2Z1IA 3D45A 1NK8A 4ID1A 1YUWA 4FWRA 2EHGA 4E7KA 3PUFA 1VSLA 3UIQA 5ADXA 2P1JA 1K9MO 4JKAA 3MN5A 4E19A 4IDHA 3CETA 4JV5K 2OPPA 2WTUA 5C42A 3DOKA 5AQWA 1ZBHA 3SBGA 5DM6L 3EZWA 3F9KA 3ZEUB 4DSFA 1TV6A 1SKRA 2PY5A 3CQXA 3VF6A 2PZSA 4B9UA 2JGUA 3ZT4A 1LV5A 5AQLA 4AM6A 3BEXA 1UA1A 4NO7A 1JLQA 3THYB 5HROA 4H5TA 1L3TA 4KBOA 1QZ6A 4DUZK 4DR1K 3SQ2A 2P9LB 1WSFA 2HBLA 3O3FA 3L2RA 2NNWA 2OZSA 4B3TK 4KHWA 3EN9A 2ZE2A 4GVMA 3HPHA 4E7LA 3NH0A 3C6AA 3P39A 4OO1J 4DQRA 3K5LA 3KD5E 5C15A 2FF3B 5E41A 4DWIA 2KW4A 4FJJA 4QS9A 1NOZA 1KC8O 4GW6A 5I3UA 4IKFA 2XY7A 3MWPA 1RILA 4CJPA 1ILYA 3VPZA 3EO3A 3OS1A 1DEJA 1RBUA 2OYQA 2CH6A 4U7BA 3LANA 4BRLA 3M1FA 3V9XA 1ASWA 3U8XA 4XH5A 1Q81O 4FK2A 3E66A 1GLBG 4H5NA 1C1CA 1NMDA 1UWBA 2D0OA 1QQNA 1KRPA 1BCMA 3ZSWA 4IZ9A 5BPLA 1XHZA 3WNHA 1N6QA 1W7AA 3VQ9A 4F3TA 5GAEP 1EXQA 4CEOA 4KHQA 2FF6A 4DR4K 1DLOA 3OW2M 2CGKA 4JK8A 3LZIA 1CLQA 2QWLA 1JCFA 3C94A 4JYAK 4RW9A 3THYA 4YFUA 4JI0K 3ULEB 4KB1A 1S1XA 1R59O 4KTZA 3TI0A 2FBTA 1X3MA 4JKDA 4FJHA 2O8DB 3ZEUA 3J81O 3PSIA 4IBNA 4OLAA 1K8AO 2GUIA 2YHYA 2P9PB 3A8YA 4YDUA 4LC9B 3TSPA 1OKJA 1HR0K 1VSHA 1SKWA 4DSIA 3IUCA 4LY7A 4A2AA 4IO9L 2HNYA 2F4VK 1ATRA 5C25A 1TK8A 3CJAA 3DOLA 2Q0RA 2Y1JA 3IKMA 4LFAK 4C23A 3SAHA 2BGGA 1W9HA 4H0YB 1TKXA 3OYLA 2BE2A 1FKOA 3U6FA 3JS6A 3LL3A 1RTDA 1VSEA 5JLFA 3V4IA 1FXXA 4KTWA 4F8RA 2Q1NA 4E1JA 3LM9A 2WFBA 5FLXO 4DSLA 3PV8A 2F8TA 1ZC6A 3WXJA 3OYJA 3OYBA 4QS8A 5E26A 1VQ9N 4Z4IA 5SWMA 1WSHA 1VRTA 3AVFA 1SL0A 1SV5A 2NRTA 4DQSA 4XIUA 3AVBA 3NAEA 1RCHA 4KAZA 4DR7K 1UA0A 4DV0K 4JI3K 3K0SA 1HKBA 3VGMA 2QWMA 2G8VA 1GLAG 3TAFA 3PX0A 1JCEA 3SQ0A 1VQ7N 3OYFA 3CCLN 3FZKA 5CZ2A 1ESVA 2F9WA 4GKJK 3KWIA 4H0XB 4E7JA 1T05A 4Z4FA 4LFBK 1YJ9N 4LSLA 2KZMA 1BWFO 1TUYA 2Z1GA 3H45C 4I2QA 4K0KK 4X65K 4HCBA 4FPAA 1S3XA 5B8HA 4FLUA 1B9DA 4CHPA 3TTCA 5LY3A 4DTNA 2A42A 4CJTA 1BIZA 4IJNA 4CGFA 3L2UA 4H5VA 1T6CA 4NXMK 3CJ1A 3NF6A 1N36K 2YHXA 3VOVA 3ZYYX 3AO3A 3FZMA 3NVMA 4YNQA 1I94K 1C0MA 3KK7A 3QDKA 4IFEA 4KH4A 3AVIA 1WAJA 1QHAA 3QESA 1NGCA 2YX6A 1YVUA 1NMNA 5EOYA 2E8AA 1P8ZA 4PUOA 4JEPA 4WQ4A 4A62A 4FLWA 4OGEA 3RVCA 4CJVA 1RT1A 2Q3SA 4FWNA 4JHDA 1D5AA 3H3NO 4BREA 3C6TA 1WSGA 1QZ5A 3QINA 3U3YA 4JKCA 3JSMA 1Q9XA 5LJWA 2P9NB 4JKBA 1IV0A 3O8MA 4QAGA 3QFUA 4CJ7A 4CCHA 4AILC 2W6KA 1Z05A 4ICLA 4FK0A 1RDBA 3SNNA 1BI4B 3S9HA 4B1VA 4KH6A 3CCRN 1HNVA 4M7YA 1OVYA 2ZF5O 3OTOK 5AQKA 1T6DA 1U4BA 2NZTA 4OJRA 3G6EN 1FW6A 4DUYK 1X9JA 4YOWA 1QVFM 5KI6A 1QS4A 3B6PA 3TU5A 5HRSA 4RCHA 4B3RK 3RMCA 1UAXA 4FPBA 3P5JA 5KRTA 4LSNA 1OH5A 4KHSA 1ZBUA 2HB5A 2P9IB 4CGHA 2UUAK 4PL8A 4H0OA 3HOTA 3OYCA 2WBNA 3PIPL 2YJFA 4CF8A 2ZM6K 3SUOA 3KHYA 3CHWA 1S1WA 3G25A 2HF4A 4CD3A 1ZBSA 2P9NA 1LAVA 3WQUA 1XUPO 4HWIA 3K9KA 3LWLA 3UKUB 3K5OA 4CEBA 5AQTA 4JI1K 1GLFO 1WLJA 4FZXC 2B4JA 4J8FA 4Q5VA 3V9WA 4B9VA 5HP1A 1XC9A 1VSFA 1LOTB 2UU9K 1A5WA 4A59A 4BRHA 2P5OA 3OJUA 2P5GA 3K5NA 4BDZA 4CE9A 2FBVA 1N33K 1JLAA 2D5RA 1KVAA 3J7YP 4L3QA 3QEWA 5J1EA 4FZYA 1S1TA 3ZSOA 3V6DA 4Y1DA 1J6ZA 4KO0A 2KZZA 1G15A 4BE2A 1D9DA 4BE0A 3O9TA 5KPTA 1YTUA 4NXNK 5KQDA 4DKWA 4BACA 1WAFA 4E0DA 3ID6A 3FZHA 5CZ1A 4J2AA 4BR9A 4FK4A 1BQMA 3K5MA 1RT7A 1KFSA 2GEMA 2YHWA 4BE1A 1UOCA 2VWKA 4MDBA 1DTTA 4M45A 4TSXA 1X9MA 3B6OA 3TTFA 5AQHA 4DR5K 3EEQA 4FO0A 2BANA 5MLCQ 4BC2A 2CGJA 3HYFA 1S1UA 3M6GA 4GV9A 5KPZA 2B5JA 4JRPA 2NRWA 4CZLA 4CEZA 3RRHA 4ILGB 3CERA 3TPQA 3S3OA 1I39A 4CEAA 3TABA 4W5RA 3GBTA 4B9QA 4CGJA 3WEEB 5AZIA 3ENHA 4IO8A 1T3VA 1BUPA 4CJ3A 3A5MC 4BRPA 1W97L 1JKHA 1N8RO 1QQMA 1CZBA 4ELTA 5M1OA 4M41A 1HNZK 1IKXA 1RBSA 1NGBA 2GELA 2RHKA 3H1VX 4F2SA 4HTUA 4CFCA 1XI1A 3GG4A 1NBWA 4CJSA 4CJFA 1EX4A 3G10A 2YHBA 2A40A 1U2VB 2IVOA 4ELVA 1YT3A 3RMDA 2ZGYA 3MN7A 2P9PA 5AFUA 1NM1A 4IEIA 1KFDA 4WCEL 4GV6A 3AVMA 3JXUA 4IOCL 3PO5A 2H3GX 4FJGA 3VEYA 4CHNA 1KD1O 4B8AB 4B9MA 1GLCG 4WQ5A 2QKBA 1ZXOA 4F4KA 1HJRA 2F96A 3NF8A 2CGLA 3LM2A 3ZETB 4HUGA 1ASVA 5IT9O 3VQ8A 2HVIA 2XRIA 4ILHA 2HVHA 4CW7B 4MFBA 3KLHA 4EHUA 3U4LA 3CM5A 3LDNA 2DFHA 1BL3A 5E84A 5EU7A 5GADP 1Y64A 2YKNA 1HJOA 3CF5L 1R0AA 2O8EB 3WXLA 2DY4A 2P9SB 1RGIA 4H5WA 4H4OA 4IJAA 5JICA 3J80O 4YOVA 1K6YA 3HZ6A 3ZX0A 4C8LA 3LZJA 4FLYA 2BDPA 5CY4A 3MXJA 2X6NA 1ATNA 4EP4A 4KHYA 1Z25A 4BR7A 1VQNN 4DU3A 4BRNA 4LH4A 5FPMA 1TAUA 3M3ZA 2D4WA 3M5RA 2QWRA 2EWSA 3QIPA 3ZX2A 1RDUA 4RG8A 3T19A 2YV0X 4GY2B 5LL6Z 1KCFA 1ASUA 3MX2A 4KHPK 3OJSA 3L0QA 3KKRA 5KTQA 1LAWA 1O1WA 1REVA 5CE3A 2RPIA 3LALA 3MWTA 1NJIO 4DV6K 1NJZA 3TWHA 4DQQA 2GBZA 3RRGA 1KSPA 1DT9A 5KGWA 3VF2A 4FJXA 1L3UA 3LDPA 3HVTA 3CCVN 4JS4A 1YXQA 1KVCA 4H0TB 2YNGA 4ISEA 3O3GA 1FJGK 4CJLA 3VTIA 3O9UA 3BUZB 1TYQA 1U48A 2WONA 4CECA 4KREA 4IG3A 1VRUA 3W0LA 2V51B 2X74A 3KLFA 1TVRA 2P9LA 4DTOA 3GE1A 3QNOA 2IAJA 3DXMB 4OPHA 2GV9A 1OH7A 2ZJPL 1C1BA 2KKZA 1NGIA 4CHYA 1HNXK 3LP0A 1GLJO 5GIOA 5IWAK 4CZJA 4X62K 4Z4EA 5AZJB 5TKYA 2QXLA 3AGKA 3FFIA 1RT3A 1VQ6N 5AZIB 1J53A 1HX1A 4CBXA 3D2EA 2E6LA 1EQYA 3RR7A 5AQVA 3F2KA 4MO5A 4H4MA 3NFAA 5SZTA 3R6MA 1MWMA 4PKHA 3ULDA 4J2DA 2Q97A 4CHQA 4LF8K 4OGCA 1IG9A 4DU4A 3GL1A 3AAQA 3ZETA 3VENA 4I7FA 4U67L 3QETA 1RDAA 3HPGA 1RTJA 3CCQN 3MK6A 5C24A 4OKJA 3O3HA 5H1SQ 4FW1A 4BDYA 4JI5K 4AF1A 5LMNK 3L3VA 2P51A 2G8UA 5C2DA 4M3YA 4JLHA 4N5SA 2FSJA 2V7YA 2ZD1A 1VQ5N 1BGXT 5JVHL 3CCSN 4FM0A 3HBTA 1OVQA 4CFDA 3TSQA 2A1RA 1IKYA 2O8CA 3NGZA 1HNWK 2UYTA 4HUEA 1LW0A 3VEOA 1HQEA 4RW8A 3NGIA 1YAGA 3K2PA 2B6AA 4FVMA 1GOCA 3ULEA 3K57A 3DXKA 5C2FA 3SAFA 3CFPA 1ATSA 1NNEA 1A5VA 4H5RA 3A0IX 3PLAA 1NJWA 4BVOA 3MECA 4O55A 2FC0A 4W5QA 3DM2A 2UXBK 5HRPA 2ZJQL 5CHIA 2HHUA 4EP5A 4H0PA 3AGRA 1SQKA 4DTRA 1MDUB 4BR4A 3BZKA 4C8MA 4CF2A 3IFRA 3OYAA 3HM8A 4M3RA 1QSSA 1GOBA 1HLUA 4XH1A 3MEDA 4BRIA 3QEVA 2KTQA 2HF3A 3ENOA 2QI2A 3PIOL 3DLKA 4LD0A 1WUAA 3SUPA 1C0FA 5TKWA 4RTFD 2P9UB 2YI1A 3ZT3A 2XY8A 1NJYA 2VG6A 3BDPA 4E1NA 2GWKA 3ZCMA 1RBVA 4BG9A 1IBMK 1E4GT 4C8NA 4K8ZA 2QWOA 3KLGA 5J2QA 3VQEA 4NYNA 3CQ8A 3O9QA 4BQZA 1KAXA 4JI4K 2QEXN 2HHVA 3ZSYA 3AA4A 4XH4A 4FM1A 3KKSA 3JYTA 3SLCA 1TGOA 3VQCA 3L8BA 1B9FA 3NF7A 4F2RA 2A41A 2O8CB 1RT6A 4FJLA 3LDQA 3G0ZA 1QQCA 3HP6A 1KLMA 2HHXA 4FL9A 3SJHA 2YNHA 1VHXA 3LAMA 1YIJN 3E01A 4NLBA 1EO1A 4BRKA 3I8BA 4KH5A 4X66K 1BDGA 1KAYA 1J5EK 1IBLK 4O4GA 3DLHA 3H6EA 2P9UA 3MXMA 4CBUA 3S3NA 2D1KA 1RTIA 4BY9C 3KD1E 4K41A 1OH6A 4ELUA 3C65A 1QQOA 3E9PA 3EL2A 5AR0A 4CIFA 3ALYA 3L2VA 2P9IA 1EETA 1QTMA 4KFBA 3S41A 3DRPA 2OCEA 4CZMA 2I5JA 2I7NA 2P9KB 2QTDA 4CESA 3LPTA 5JVGL 5JLHA 4JKEA 4H03B 3OYEA 4QCLA 3H46O 2EX3A 4BRAA 4O8UA 1HYZA 2WOMA 3AVHA 4DSEA 3DXKB 1T8EA 3EE9A 1JLGA 4C8KA 2FBYA 3OS0A 1BISA 3CMAN 3THVA 3R8EA 5BN9A 3THWA 5KPRA 5BN8A 4IDKA 4BR5A 1WSIA 2YKMA 2YHAA 2Z1HA 5LMUK 5C12A 3OBWA 4CFBA 1QSYA 1VQLN 4CK1A 1NU0A 3I0RA 4BGBA 4B1ZA 4B1WB 4CIGA 4JHDB 5AQZA 1U2VA 4CIEA 1W0HA 4PA1A 4BROA 2VQFK 1B92A 1NK9A 2E2NA 1HPMA 4GMJB 1VSKA 4IOAL 5M1FA 4FWKA 3QEIA 4CI6A 3CJBA 4BG8A 4E7IA 3PSFA 2O8BB 3ZT0A 2E2OA 4F9OA 3SQ4A 2OZMA 3DLEA 4O8KA 4CJKA 1RT2A 5KRSA 2Y1IA 2JLEA 4MO4A 5BRDA 1EWQA 3E9LA 4LF4K 4BRDA 1JL1A 1JLBA 1S1VA 5CR4A 3ATUA 2X78A 5HL7L 4A61A 3EKUA 4DV5K 3TAQA 3J7ZO 2O8FB 4JI2K 1BO5O 4AH9A 2YJEA 3ZT1A 2F8SA 3V9ZA 4ZTJA 3I33A 2P9SA 4LF9K 4DLEA 4K43A 2Q0UA 4FYDA 2CH5A 4CGGA 2DPNA 2W6LA 2G8KA 3AO4A 4R5PA 1D4XA 3AVNA 4FW2A 3JAMO 1X3NA 3DXMA 1H1VA 4AHVA 3QERA 3ATVA 1S22A 3NF9A 4DR3K 1RBTA 2NRRA 3T69A 3M8PA 3D2FA 1ZBFA 4GV3A 4L8RB 1C0TA 1V4TA 3MCPA 1XNQK 2A6AA 3QFPA 4O0JA 3VF4A 4KRFA 3ZSRA 1X9WA 3WNGA 2IS3A 1CXQA 1ZBIA 4WE1A 3T3FA 5GAGP 4BR0A 4FWPA 4ISGA 3QO9A 4X64K 3Q7CA 3PY8A 3WQTA 3ZSQA 5ADXH 2HNDA 1MA9B 3AARA 2E20A 2WUSA 5AQPA 1K8KA 3MCAB 1U49A 3AY9A 3KWGA 3RTVA 3QMLA 1HQUA 1EKEA 5EX5A 4DB3A 4YHHK 1VQ8N 4ISFA 3I56N 4BRCA 1GLLO 2E5LK 2QXFA 4BGAA 3F73A 1IG8A 2HBMA 4IEEA 4DS4A 3SAGA 3AVGA 4AHRA 3QICA 3NMUA 3MXIA 1NG9A 4O0IA 4XEIA 4BVPA 3SUQA 3RR8A 5FPEA 3HT3A 3G71N 1Q86O 3KVGA 4CK3A 3I55N 3PX6A 3THWB 4BC5A 1JL2A 2DFEA 3VQ6A 3A2FA 3THXB 1NKBA 4GNIA 4CEEA 4FOEA 2OPSA 4OVLA 4NB4A 5AQUA 3SI6A 2GTDA 1XC3A 1S6PA 3KIOA 2VGMA 1K73O 3HJFA 3MEGA 3B8AX 4KI6A 1JXBA 4CJUA 3HM9A 4DV4K 5LJVA 3QBXA 5CYMA 2E6MA 1WBBA 2UXCK 3L2WA 4IOXA 2P9KA 2ZWHA 3QNNA 3O6WA 1J5OA 2OPRA 4CEQA 4YY3K 4H8KA 2KFNA 1TKDA 4FWLA 1C0GA 3T7ZA 3CI5A 3L6QA 1WOQA 3C7NA 2XY5A 1S5JA 3R9PA 2BH1A 1S6QA 3HXMA 3O4NA 1D8YA 3IRXA 4M3WA 3D2EB 1KLNA 5J2NA 1XWLA 2YNIA 2QKKA 3CM6A 3DYAA 3K58A 1JXEA 4OX9K 4N56A 3FFKB 2HOEA 5DM7L 1N5YA 4DV1K 1VQMN 3AV9A 4EIAA 2GUPA 3D0PA 1IKWA 3V9UA 4B3SK 1VSMA 3HSTB 2HMIA 3V81A 3UKUA 1Q7YO 2HNZA 1KTQA 1RT5A 3MEEA 1O13A 1TK5A 2HBKA 3AVAA 4MLHA 3DJCA 1XHXA 2LSNA 3CJ7A 3VQPA 4DR2K 3ID8A 3HSCA 3AO1A 4NLCA 5GAHP 4ZTFA 4DTMA 2JWLA 4WF9L 3V9SA 1QHTA 3KK3A 2HW3A 3LWMA 3KK2A 2E1ZA 3HOSA 1YI2N 4F3OA 3OY9A 2QW9A 4DG1A 1M1KO 3O9RA 1C6VA 5AQOA 1HYSA 1VSJA 4JNEA 3MX5A 3V1OA 1LW2A 1NK4A 2KLAA 3VEWA 1IJJA 4FXDA 3TAMA 3CIPA 4DTSA 2PAVA 4BRFA 1X1PA 2VYPA 4W5OA 3CCUN 1TKZA 3AAPA 1Z26A 3AVKA 5JS2A 5BPMA 1D9FA 3DAWA 1BI4A 3N4PA 5AQYA 2YNFA 3FLCO 4CBWA 2OTJN 3HI0A 4DQIA 1E4FT 1V4SA 2OPQA 2E1YA 4FJ5A 4V19S 1ZBLA 3P4IA 2KFZA 1XNRK 4CHOA 2HMPA 2O8EA 5FDLA 4FWSA 4Z4HA 4CJWA 4MQ3A 1U6ZA 4CZKA 1NLVA 5AQJA 2HSTA 3RSEB 2NRZA 3NDKA 4FM2A 4G9ZA 3NGYA 1HYVA 2HHWA 5AQSA 4E89A 4CJRA 2JWKA 4NCGA 3WUHA 3R3LA 2E2QA 3AVLA 3WXIA 2IVPA 4FLVA 3SBTA 4B9SA 3C7NB 2A3ZA 4CZIA 4LF6K 3UE5A 1NGEA 5AFUH 4Q0BA 4EHTA 3RMAA 3PX4A 3SJJA 4CERA 5M1NA 4A5AA 1I3AA 3H08A 1HNIA 1HMVA 3MN6A 2NLXA 1BHLA 3HL8A 4KTQA 4M3TA 1E3MA 2IVNA 5BPNA 1S72N 1RFQA 5I42A 2AP1A 2WC9A 5C10A 4HHTA 4FLTA 4N41A 1VQ4N 3NH1A 5FRMA 3K9JA 4Y0WA 4CJ4A 3M8RA 3L4QA 3CC7N 1HPZA 4W5NA 4LF7K 4B1XB 3T1AA 3BF1A 2ITMA 4JI8K 1F21A 3O08A 4PHTX 2D0BA 1GLDG 3AA2A 1N34K 2FBXA 3A5LC 1FKPA 4FWOA 5F0XA 3CXCM 4NCAA 4DF4A 2VG7A 3O4QA 3MN9A 4AHCA 4B08A 1JJ2M 2G8FA 4ID5A 3BF3A 2QA4N 1NWKA 3LAKA 4C1NK 3WXKA 3DLGA 1VQPN 3OYKA 2BUPA 2O8BA 4YOUA 3UKRA 3MDQA 4DLGA 1BQNA 1Q82O 4DFJA 3RWUA 2D0PA 5EY4A 4CF0A 5EXWA 4WYBA 4E7HA 4H0VB 4NCBA 4AHTA 3Q7BA 5HLFA 4EAHD 5I9EB 2VQEK 1VQKN 4B9NA 1YF5L 3FE1A 1L5UA 4CF1A 4DFKA 2ZQBA 5AQXA 2PYJA 1CZAN 3P38A 4IFYA 1RTHA 3QEXA 3SPZA 3AVCA 3WXMB 3J7AP 3BZCA 3LDLA 5AQIA 3OYMA 4DU1A 3NHGA 3HO1A 1S9EA 1OH8A 4FLXA 3HPOA 1EWRA 1QVGM 4CZGA 3QEPA 2IGIA 3CJCA 2ASMA 4E3SA 4I9LA 2VCPA 1NKCA 3OYIA 2KHOA 4B8CA 1J54A 3DRSA 5AQNA 3M8SA 4FVUA 3ZSZA 3BGRA 2GX9A 3P1GA 4YDUC 3TAEA 4FJIA 1TKTA 5EVZA 5GIPA 1SUQA 3OYGA 3RMBA 4RW6A 4LFCK 1VSDA 1YVNA 3CJ9A 3OYDA 1C1AA 4KHNA 1VK0A 3FGUA 4HUFA 4Y1CA 4AHSA 5BR8K 4IG0A 4NYFA 1K8KB 4YOTA 1X9SA 4K8XA 3L4IA 1NGGA 3F5TA 3DI6A 4JKHA 3CD6N 3SK3A 4B9LA 4WFNL 1GLEG 1N32K 3KZBA 4EZ9A 1HUXA 4HVJA 2A1SA 2FSNA 2FSKA 3OBYA 2D0CA 3GOIA 1BA0A 1LWEA 4JS5A 4MDAA 2XO7A 4BC4A 2G8IA 3TAPA 3H3OB 5KQ8A 4Z94A 2XY6A 3VERA 2NRHA 4JN4A 4GKKK 2QWPA 1RNHA 3W3DA 1WB9A 1U45A 1SL1A 4FJMA 3IS9A 4FJ8A 2W42A 3DLRA 1XMQK 3HP9A 3FZFA 3WNEA 2W40A 1QE1A 4HCCA 1KXPA 4DSJA 3D7EO
chains in the Genus database with same CATH topology
5AJ3K 4LFBK 2UXDK 1XNQK 4JI1K 4DR4K 4K0KK 3J7AP 4X65K 4AQYK 4OX9K 4LF6K 2UU9K 4DV1K 3T1YK 4JV5K 1HNXK 4JYAK 4NXMK 1N36K 5IWAK 4X62K 2UUCK 4JI0K 4X64K 4DV3K 1N33K 1I94K 4B3SK 3J7YP 3J81O 5A2QO 1IBMK 4NXNK 5LMUK 2UUBK 4YHHK 5IT9O 1XMOK 2E5LK 4DR2K 4CW7B 4LF7K 4JI8K 1HR0K 4CVNE 2VQFK 3T1HK 4DUZK 4LF8K 4JI4K 2F4VK 4DR1K 4LFCK 1N34K 4B3TK 1IBKK 3J80O 4LFAK 5BR8K 4JI5K 5LMNK 4DR5K 4B3MK 5FLXO 4LF4K 1N32K 3OTOK 5LL6Z 1FJGK 4DV5K 4LF5K 4DUYK 4KHPK 4JI7K 4DV4K 1HNWK 4DV2K 4JI2K 4X66K 2UXCK 4V19S 4DV7K 1J5EK 1IBLK 4B3RK 4DR6K 4DV6K 1XNRK 4DR7K 4GKKK 4DV0K 4LF9K 4JI3K 4YY3K 2VQEK 2HHHK 2UUAK 3JAMO 1HNZK 4JI6K 1XMQK 4GKJK 2UXBK 4DR3K 2ZM6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  4LFB K;  2UXD K;  1XNQ K;  4JI1 K;  4DR4 K;  4K0K K;  3J7A P;  4X65 K;  4AQY K;  4OX9 K;  4LF6 K;  2UU9 K;  4DV1 K;  3T1Y K;  4JV5 K;  1HNX K;  4JYA K;  4NXM K;  1N36 K;  5IWA K;  4X62 K;  2UUC K;  4JI0 K;  4X64 K;  4DV3 K;  1N33 K;  1I94 K;  4B3S K;  3J7Y P;  3J81 O;  5A2Q O;  1IBM K;  4NXN K;  5LMU K;  2UUB K;  4YHH K;  5IT9 O;  1XMO K;  2E5L K;  4DR2 K;  4CW7 B;  4LF7 K;  4JI8 K;  1HR0 K;  4CVN E;  2VQF K;  3T1H K;  4DUZ K;  4LF8 K;  4JI4 K;  2F4V K;  4DR1 K;  4LFC K;  1N34 K;  4B3T K;  1IBK K;  3J80 O;  4LFA K;  5BR8 K;  4JI5 K;  5LMN K;  4DR5 K;  4B3M K;  5FLX O;  4LF4 K;  1N32 K;  3OTO K;  5LL6 Z;  1FJG K;  4DV5 K;  4LF5 K;  4DUY K;  4KHP K;  4JI7 K;  4DV4 K;  1HNW K;  4DV2 K;  4JI2 K;  4X66 K;  2UXC K;  4V19 S;  4DV7 K;  1J5E K;  1IBL K;  4B3R K;  4DR6 K;  4DV6 K;  1XNR K;  4DR7 K;  4GKK K;  4DV0 K;  4LF9 K;  4JI3 K;  4YY3 K;  2VQE K;  2HHH K;  2UUA K;  3JAM O;  1HNZ K;  4JI6 K;  1XMQ K;  4GKJ K;  2UXB K;  4DR3 K;  2ZM6 K; 
#chains in the Genus database with same CATH topology
 4AHU A;  4G1Q A;  2UXD K;  3U9Z A;  3VTH A;  4PY5 A;  3TAG A;  4KV8 A;  1T7P A;  2Q36 A;  3AA3 A;  4Z4G A;  1FK9 A;  3T1Y K;  3M8Q A;  3VGK A;  1TAQ A;  3OHR A;  4DV3 K;  3NE6 A;  3CCE N;  4OPJ A;  1NK5 A;  3D6R A;  4DQP A;  2GWJ A;  1RBR A;  1DTQ A;  1TL1 A;  3IMX A;  3VEZ A;  4RW4 A;  2QK9 A;  3N4Q A;  2AJQ A;  2HBJ A;  4JKG A;  4BWM A;  4EZ6 A;  2ATQ A;  4YOR A;  1ITG A;  4LH5 A;  4WFA L;  5DMR A;  4M42 A;  2HHQ A;  2AA4 A;  2ASP A;  4KKO A;  2A5X A;  2Q2R A;  3KJV A;  1DGK N;  2Z1J A;  1P90 A;  4CJ5 A;  2PYL A;  4N47 A;  1TYQ B;  4A2B A;  1KQS M;  2O8D A;  5AQM A;  3TSU A;  4DCH A;  1SAZ A;  3VQD A;  1NGJ A;  3HRG A;  3SMP A;  4O44 A;  4WQ5 C;  1WSE A;  4CJE A;  4BRG A;  5AQF A;  1NGA A;  4JKF A;  4IWV A;  1MWK A;  3O5B A;  1NGF A;  3QIO A;  2I7P A;  1GOA A;  1NGD A;  5HOO A;  4PL7 A;  3J8A A;  1VQO N;  3UKR B;  3CFO A;  4DV2 K;  1IO2 A;  3HK2 A;  1WN7 A;  4BQL A;  4KHU A;  4DTU A;  1MU2 A;  3KLE A;  4JK7 A;  5M1Q A;  3ZLJ A;  5J2M A;  3EE8 A;  1NOY A;  1TK0 A;  2ASO A;  4B9T A;  3O1B A;  3QB0 A;  4QS7 A;  4CEF A;  1IH7 A;  4FOI A;  2E2P A;  5KGX A;  1JLF A;  3ZT2 A;  5FRN A;  3VEV A;  1HRH A;  2E88 A;  3EZ5 A;  3CME N;  3LP1 A;  3O9S A;  4IXC A;  3OYH A;  4OPK A;  1M90 O;  4DS5 A;  4CHZ A;  4FJ7 A;  2NUB A;  4N76 A;  1VSI A;  3TAR A;  4FJ9 A;  3L2Q A;  3RSE A;  4C8O A;  2BTF A;  4FLZ A;  1T44 A;  3DMJ A;  3H1Q A;  3E1Y A;  1G99 A;  5BRH A;  3VGL A;  3CCJ N;  1SS6 A;  5BRF A;  1VAZ A;  1CZ9 A;  3VQQ A;  4KB0 A;  4BR2 A;  3C6U A;  3CC2 N;  4FWM A;  4JD2 A;  3BY5 A;  4KI4 A;  3MMV A;  4E1M A;  3QBW A;  4M3X A;  1C0U A;  1TL3 A;  1XMO K;  4M3U A;  2V52 B;  2RF2 A;  2VWJ A;  3AVJ A;  3TTD A;  3VN5 A;  4CVN E;  3BP8 A;  3ASM A;  1BCO A;  3CYM A;  4DFM A;  4CF9 A;  3DWL A;  2IC3 A;  2XHB A;  4JKG B;  4WQ4 C;  3MAQ A;  1IBK K;  3SZ2 A;  3ITH A;  4CK2 A;  1YJN N;  1BIU A;  4FWQ A;  3SUN A;  3SPY A;  5GIN A;  1WNS A;  4IFV A;  3VQ4 A;  2R7Y A;  3U9D A;  5F1X A;  3LDO A;  3TR8 A;  4KPY A;  2KQ2 A;  1DKG D;  2IDO A;  1Y97 A;  1KVB A;  4R79 A;  2HHT A;  1BOT O;  1RDD A;  2FXU A;  3OVN A;  1NK0 A;  4RW7 A;  4LF5 K;  1JCG A;  5K14 A;  1SZ2 A;  3C95 A;  2V7Z A;  4RWT A;  1YHQ N;  1JLC A;  4CJQ A;  4DV7 K;  3ZX3 A;  4DR6 K;  3VQB A;  3S3M A;  1WSJ A;  4BDP A;  3IDH A;  1CXU A;  4UY8 O;  3K59 A;  4JK9 A;  2RN2 A;  4CZE A;  3FR0 A;  3V1R A;  4O5B A;  3VA0 A;  3NCI A;  4J2E A;  2O4I A;  1RDW X;  2RKI A;  4K42 A;  3LP2 A;  5HRR A;  3G4S N;  5HRN A;  2IOC A;  4M63 C;  3DRR A;  4OKK A;  2DFF A;  5D3G A;  3KLI A;  1JLE A;  3DLL L;  4CGI A;  4AQY K;  4YOY A;  5BRE A;  1YIT N;  3ZSX A;  2PFU A;  3U3G A;  4C1N I;  5T7B A;  2UUC K;  3HTV A;  3P31 A;  5J2P A;  3WT0 A;  2E4L A;  2F7T A;  4A5B A;  5JS1 A;  2ETJ A;  3SV3 A;  2OAN A;  1KAZ A;  3AO2 A;  2ZGZ A;  2O4G A;  4UQG A;  5A2Q O;  2X6S A;  3C6H A;  5HBM A;  3CPE A;  5M1K A;  4BC3 A;  5DK5 A;  1NK6 A;  5FPN A;  4OKE A;  3F9M A;  3PO4 A;  4I9Q A;  3VMF B;  1ZYQ A;  4MLE A;  3VES A;  4PQU A;  3THX A;  3T1H K;  4B1U B;  3NVK A;  1BG3 A;  4GVE A;  4M7X A;  5BR9 A;  3VA3 A;  2QWQ A;  2OA8 A;  3O4W A;  1U04 A;  1LWF A;  2YCH A;  3WEE A;  1HKG A;  2FLO A;  3ENB A;  2Q31 A;  1A5X A;  4PKI A;  1RDC A;  3NBP A;  2ZJR L;  3HVR A;  4B3M K;  4DHY A;  4EFH A;  5AQQ A;  1Q9Y A;  5AZJ A;  4JRQ A;  3ISN C;  3SQ1 A;  1QSL A;  3LP3 A;  4I6M A;  4OLB A;  4JAX A;  1NKE A;  1J9A A;  3P83 D;  3L3U A;  4DMN A;  1BU6 O;  4WFB L;  3KK1 A;  3EYZ A;  3IAY A;  4JI7 K;  1TUU A;  5FPD A;  2W41 A;  4OPA A;  4B1Y B;  4DSK A;  3DLB A;  4FCY A;  5JMV A;  3VQA A;  4ZHR A;  3OA9 A;  1RT4 A;  4BRM A;  5ELZ A;  4B3O A;  1SKS A;  3EY1 A;  4O5F A;  1SL2 A;  2HHH K;  3KTQ A;  3TAN A;  2VWB A;  4QOZ B;  1NK7 A;  3OS2 A;  4FZZ A;  1EP4 A;  5AJ3 K;  4CED A;  4JD2 B;  4DTP A;  3WNF A;  2G8W A;  3QLH A;  1LWC A;  5M1P A;  4FSV A;  3SMS A;  1L3S A;  4I6M B;  2F9T A;  3ZSV A;  2D0A A;  4DQ8 A;  4BWJ A;  3CC4 N;  3C0B A;  4Z0U A;  3OYN A;  1U47 A;  3O1W A;  2DTU A;  3A5N C;  3CQY A;  4J2B A;  5FRO A;  1S9G A;  3AO5 A;  4PKG A;  4CZF A;  4Z4C A;  4FJN A;  3GDQ A;  3FZL A;  2QWN A;  4YOX A;  4FJK A;  2UUB K;  2PBD A;  1L3V A;  2IIR A;  4BRQ A;  3SV4 A;  3I0S A;  1Z6R A;  3SYZ A;  1Q18 A;  1BA1 A;  1NGH A;  2NRV A;  4I2P A;  3EKS A;  3E9O A;  5CYQ A;  3AA5 X;  4AM7 A;  1HKC A;  3NH2 A;  3R1X A;  3D2F B;  1IKV A;  1YTA A;  5C0Y A;  3IG1 A;  2NRX A;  4DTX A;  5AQR A;  2RE2 A;  4PWD A;  3VQ5 A;  4DFP A;  3A5O C;  3VET A;  1LCU A;  1T03 A;  4CFA A;  3UB5 A;  4ILJ A;  3LDS A;  1YJW N;  1W2B M;  4A57 A;  4DF8 A;  4DTJ A;  1NJX A;  3V1Q A;  2QM1 A;  4CD1 A;  3O80 A;  3SCX A;  2G8H A;  2O8F A;  4M3Z A;  1Q8I A;  3I8D A;  2VGN A;  4CZH A;  3CPW M;  2HHS A;  3CFR A;  3CG7 A;  2ITG A;  4HTL A;  2J4R A;  4W5T A;  4K25 A;  2OTL N;  3VQ7 A;  3CCM N;  1WBD A;  3VEX A;  4CGD A;  3LPU A;  1XQS C;  4JI6 K;  5AQG A;  2VG5 A;  5F2R A;  2Z1I A;  3D45 A;  1NK8 A;  4ID1 A;  1YUW A;  4FWR A;  2EHG A;  4E7K A;  3PUF A;  1VSL A;  3UIQ A;  5ADX A;  2P1J A;  1K9M O;  4JKA A;  3MN5 A;  4E19 A;  4IDH A;  3CET A;  4JV5 K;  2OPP A;  2WTU A;  5C42 A;  3DOK A;  5AQW A;  1ZBH A;  3SBG A;  5DM6 L;  3EZW A;  3F9K A;  3ZEU B;  4DSF A;  1TV6 A;  1SKR A;  2PY5 A;  3CQX A;  3VF6 A;  2PZS A;  4B9U A;  2JGU A;  3ZT4 A;  1LV5 A;  5AQL A;  4AM6 A;  3BEX A;  1UA1 A;  4NO7 A;  1JLQ A;  3THY B;  5HRO A;  4H5T A;  1L3T A;  4KBO A;  1QZ6 A;  4DUZ K;  4DR1 K;  3SQ2 A;  2P9L B;  1WSF A;  2HBL A;  3O3F A;  3L2R A;  2NNW A;  2OZS A;  4B3T K;  4KHW A;  3EN9 A;  2ZE2 A;  4GVM A;  3HPH A;  4E7L A;  3NH0 A;  3C6A A;  3P39 A;  4OO1 J;  4DQR A;  3K5L A;  3KD5 E;  5C15 A;  2FF3 B;  5E41 A;  4DWI A;  2KW4 A;  4FJJ A;  4QS9 A;  1NOZ A;  1KC8 O;  4GW6 A;  5I3U A;  4IKF A;  2XY7 A;  3MWP A;  1RIL A;  4CJP A;  1ILY A;  3VPZ A;  3EO3 A;  3OS1 A;  1DEJ A;  1RBU A;  2OYQ A;  2CH6 A;  4U7B A;  3LAN A;  4BRL A;  3M1F A;  3V9X A;  1ASW A;  3U8X A;  4XH5 A;  1Q81 O;  4FK2 A;  3E66 A;  1GLB G;  4H5N A;  1C1C A;  1NMD A;  1UWB A;  2D0O A;  1QQN A;  1KRP A;  1BCM A;  3ZSW A;  4IZ9 A;  5BPL A;  1XHZ A;  3WNH A;  1N6Q A;  1W7A A;  3VQ9 A;  4F3T A;  5GAE P;  1EXQ A;  4CEO A;  4KHQ A;  2FF6 A;  4DR4 K;  1DLO A;  3OW2 M;  2CGK A;  4JK8 A;  3LZI A;  1CLQ A;  2QWL A;  1JCF A;  3C94 A;  4JYA K;  4RW9 A;  3THY A;  4YFU A;  4JI0 K;  3ULE B;  4KB1 A;  1S1X A;  1R59 O;  4KTZ A;  3TI0 A;  2FBT A;  1X3M A;  4JKD A;  4FJH A;  2O8D B;  3ZEU A;  3J81 O;  3PSI A;  4IBN A;  4OLA A;  1K8A O;  2GUI A;  2YHY A;  2P9P B;  3A8Y A;  4YDU A;  4LC9 B;  3TSP A;  1OKJ A;  1HR0 K;  1VSH A;  1SKW A;  4DSI A;  3IUC A;  4LY7 A;  4A2A A;  4IO9 L;  2HNY A;  2F4V K;  1ATR A;  5C25 A;  1TK8 A;  3CJA A;  3DOL A;  2Q0R A;  2Y1J A;  3IKM A;  4LFA K;  4C23 A;  3SAH A;  2BGG A;  1W9H A;  4H0Y B;  1TKX A;  3OYL A;  2BE2 A;  1FKO A;  3U6F A;  3JS6 A;  3LL3 A;  1RTD A;  1VSE A;  5JLF A;  3V4I A;  1FXX A;  4KTW A;  4F8R A;  2Q1N A;  4E1J A;  3LM9 A;  2WFB A;  5FLX O;  4DSL A;  3PV8 A;  2F8T A;  1ZC6 A;  3WXJ A;  3OYJ A;  3OYB A;  4QS8 A;  5E26 A;  1VQ9 N;  4Z4I A;  5SWM A;  1WSH A;  1VRT A;  3AVF A;  1SL0 A;  1SV5 A;  2NRT A;  4DQS A;  4XIU A;  3AVB A;  3NAE A;  1RCH A;  4KAZ A;  4DR7 K;  1UA0 A;  4DV0 K;  4JI3 K;  3K0S A;  1HKB A;  3VGM A;  2QWM A;  2G8V A;  1GLA G;  3TAF A;  3PX0 A;  1JCE A;  3SQ0 A;  1VQ7 N;  3OYF A;  3CCL N;  3FZK A;  5CZ2 A;  1ESV A;  2F9W A;  4GKJ K;  3KWI A;  4H0X B;  4E7J A;  1T05 A;  4Z4F A;  4LFB K;  1YJ9 N;  4LSL A;  2KZM A;  1BWF O;  1TUY A;  2Z1G A;  3H45 C;  4I2Q A;  4K0K K;  4X65 K;  4HCB A;  4FPA A;  1S3X A;  5B8H A;  4FLU A;  1B9D A;  4CHP A;  3TTC A;  5LY3 A;  4DTN A;  2A42 A;  4CJT A;  1BIZ A;  4IJN A;  4CGF A;  3L2U A;  4H5V A;  1T6C A;  4NXM K;  3CJ1 A;  3NF6 A;  1N36 K;  2YHX A;  3VOV A;  3ZYY X;  3AO3 A;  3FZM A;  3NVM A;  4YNQ A;  1I94 K;  1C0M A;  3KK7 A;  3QDK A;  4IFE A;  4KH4 A;  3AVI A;  1WAJ A;  1QHA A;  3QES A;  1NGC A;  2YX6 A;  1YVU A;  1NMN A;  5EOY A;  2E8A A;  1P8Z A;  4PUO A;  4JEP A;  4WQ4 A;  4A62 A;  4FLW A;  4OGE A;  3RVC A;  4CJV A;  1RT1 A;  2Q3S A;  4FWN A;  4JHD A;  1D5A A;  3H3N O;  4BRE A;  3C6T A;  1WSG A;  1QZ5 A;  3QIN A;  3U3Y A;  4JKC A;  3JSM A;  1Q9X A;  5LJW A;  2P9N B;  4JKB A;  1IV0 A;  3O8M A;  4QAG A;  3QFU A;  4CJ7 A;  4CCH A;  4AIL C;  2W6K A;  1Z05 A;  4ICL A;  4FK0 A;  1RDB A;  3SNN A;  1BI4 B;  3S9H A;  4B1V A;  4KH6 A;  3CCR N;  1HNV A;  4M7Y A;  1OVY A;  2ZF5 O;  3OTO K;  5AQK A;  1T6D A;  1U4B A;  2NZT A;  4OJR A;  3G6E N;  1FW6 A;  4DUY K;  1X9J A;  4YOW A;  1QVF M;  5KI6 A;  1QS4 A;  3B6P A;  3TU5 A;  5HRS A;  4RCH A;  4B3R K;  3RMC A;  1UAX A;  4FPB A;  3P5J A;  5KRT A;  4LSN A;  1OH5 A;  4KHS A;  1ZBU A;  2HB5 A;  2P9I B;  4CGH A;  2UUA K;  4PL8 A;  4H0O A;  3HOT A;  3OYC A;  2WBN A;  3PIP L;  2YJF A;  4CF8 A;  2ZM6 K;  3SUO A;  3KHY A;  3CHW A;  1S1W A;  3G25 A;  2HF4 A;  4CD3 A;  1ZBS A;  2P9N A;  1LAV A;  3WQU A;  1XUP O;  4HWI A;  3K9K A;  3LWL A;  3UKU B;  3K5O A;  4CEB A;  5AQT A;  4JI1 K;  1GLF O;  1WLJ A;  4FZX C;  2B4J A;  4J8F A;  4Q5V A;  3V9W A;  4B9V A;  5HP1 A;  1XC9 A;  1VSF A;  1LOT B;  2UU9 K;  1A5W A;  4A59 A;  4BRH A;  2P5O A;  3OJU A;  2P5G A;  3K5N A;  4BDZ A;  4CE9 A;  2FBV A;  1N33 K;  1JLA A;  2D5R A;  1KVA A;  3J7Y P;  4L3Q A;  3QEW A;  5J1E A;  4FZY A;  1S1T A;  3ZSO A;  3V6D A;  4Y1D A;  1J6Z A;  4KO0 A;  2KZZ A;  1G15 A;  4BE2 A;  1D9D A;  4BE0 A;  3O9T A;  5KPT A;  1YTU A;  4NXN K;  5KQD A;  4DKW A;  4BAC A;  1WAF A;  4E0D A;  3ID6 A;  3FZH A;  5CZ1 A;  4J2A A;  4BR9 A;  4FK4 A;  1BQM A;  3K5M A;  1RT7 A;  1KFS A;  2GEM A;  2YHW A;  4BE1 A;  1UOC A;  2VWK A;  4MDB A;  1DTT A;  4M45 A;  4TSX A;  1X9M A;  3B6O A;  3TTF A;  5AQH A;  4DR5 K;  3EEQ A;  4FO0 A;  2BAN A;  5MLC Q;  4BC2 A;  2CGJ A;  3HYF A;  1S1U A;  3M6G A;  4GV9 A;  5KPZ A;  2B5J A;  4JRP A;  2NRW A;  4CZL A;  4CEZ A;  3RRH A;  4ILG B;  3CER A;  3TPQ A;  3S3O A;  1I39 A;  4CEA A;  3TAB A;  4W5R A;  3GBT A;  4B9Q A;  4CGJ A;  3WEE B;  5AZI A;  3ENH A;  4IO8 A;  1T3V A;  1BUP A;  4CJ3 A;  3A5M C;  4BRP A;  1W97 L;  1JKH A;  1N8R O;  1QQM A;  1CZB A;  4ELT A;  5M1O A;  4M41 A;  1HNZ K;  1IKX A;  1RBS A;  1NGB A;  2GEL A;  2RHK A;  3H1V X;  4F2S A;  4HTU A;  4CFC A;  1XI1 A;  3GG4 A;  1NBW A;  4CJS A;  4CJF A;  1EX4 A;  3G10 A;  2YHB A;  2A40 A;  1U2V B;  2IVO A;  4ELV A;  1YT3 A;  3RMD A;  2ZGY A;  3MN7 A;  2P9P A;  5AFU A;  1NM1 A;  4IEI A;  1KFD A;  4WCE L;  4GV6 A;  3AVM A;  3JXU A;  4IOC L;  3PO5 A;  2H3G X;  4FJG A;  3VEY A;  4CHN A;  1KD1 O;  4B8A B;  4B9M A;  1GLC G;  4WQ5 A;  2QKB A;  1ZXO A;  4F4K A;  1HJR A;  2F96 A;  3NF8 A;  2CGL A;  3LM2 A;  3ZET B;  4HUG A;  1ASV A;  5IT9 O;  3VQ8 A;  2HVI A;  2XRI A;  4ILH A;  2HVH A;  4CW7 B;  4MFB A;  3KLH A;  4EHU A;  3U4L A;  3CM5 A;  3LDN A;  2DFH A;  1BL3 A;  5E84 A;  5EU7 A;  5GAD P;  1Y64 A;  2YKN A;  1HJO A;  3CF5 L;  1R0A A;  2O8E B;  3WXL A;  2DY4 A;  2P9S B;  1RGI A;  4H5W A;  4H4O A;  4IJA A;  5JIC A;  3J80 O;  4YOV A;  1K6Y A;  3HZ6 A;  3ZX0 A;  4C8L A;  3LZJ A;  4FLY A;  2BDP A;  5CY4 A;  3MXJ A;  2X6N A;  1ATN A;  4EP4 A;  4KHY A;  1Z25 A;  4BR7 A;  1VQN N;  4DU3 A;  4BRN A;  4LH4 A;  5FPM A;  1TAU A;  3M3Z A;  2D4W A;  3M5R A;  2QWR A;  2EWS A;  3QIP A;  3ZX2 A;  1RDU A;  4RG8 A;  3T19 A;  2YV0 X;  4GY2 B;  5LL6 Z;  1KCF A;  1ASU A;  3MX2 A;  4KHP K;  3OJS A;  3L0Q A;  3KKR A;  5KTQ A;  1LAW A;  1O1W A;  1REV A;  5CE3 A;  2RPI A;  3LAL A;  3MWT A;  1NJI O;  4DV6 K;  1NJZ A;  3TWH A;  4DQQ A;  2GBZ A;  3RRG A;  1KSP A;  1DT9 A;  5KGW A;  3VF2 A;  4FJX A;  1L3U A;  3LDP A;  3HVT A;  3CCV N;  4JS4 A;  1YXQ A;  1KVC A;  4H0T B;  2YNG A;  4ISE A;  3O3G A;  1FJG K;  4CJL A;  3VTI A;  3O9U A;  3BUZ B;  1TYQ A;  1U48 A;  2WON A;  4CEC A;  4KRE A;  4IG3 A;  1VRU A;  3W0L A;  2V51 B;  2X74 A;  3KLF A;  1TVR A;  2P9L A;  4DTO A;  3GE1 A;  3QNO A;  2IAJ A;  3DXM B;  4OPH A;  2GV9 A;  1OH7 A;  2ZJP L;  1C1B A;  2KKZ A;  1NGI A;  4CHY A;  1HNX K;  3LP0 A;  1GLJ O;  5GIO A;  5IWA K;  4CZJ A;  4X62 K;  4Z4E A;  5AZJ B;  5TKY A;  2QXL A;  3AGK A;  3FFI A;  1RT3 A;  1VQ6 N;  5AZI B;  1J53 A;  1HX1 A;  4CBX A;  3D2E A;  2E6L A;  1EQY A;  3RR7 A;  5AQV A;  3F2K A;  4MO5 A;  4H4M A;  3NFA A;  5SZT A;  3R6M A;  1MWM A;  4PKH A;  3ULD A;  4J2D A;  2Q97 A;  4CHQ A;  4LF8 K;  4OGC A;  1IG9 A;  4DU4 A;  3GL1 A;  3AAQ A;  3ZET A;  3VEN A;  4I7F A;  4U67 L;  3QET A;  1RDA A;  3HPG A;  1RTJ A;  3CCQ N;  3MK6 A;  5C24 A;  4OKJ A;  3O3H A;  5H1S Q;  4FW1 A;  4BDY A;  4JI5 K;  4AF1 A;  5LMN K;  3L3V A;  2P51 A;  2G8U A;  5C2D A;  4M3Y A;  4JLH A;  4N5S A;  2FSJ A;  2V7Y A;  2ZD1 A;  1VQ5 N;  1BGX T;  5JVH L;  3CCS N;  4FM0 A;  3HBT A;  1OVQ A;  4CFD A;  3TSQ A;  2A1R A;  1IKY A;  2O8C A;  3NGZ A;  1HNW K;  2UYT A;  4HUE A;  1LW0 A;  3VEO A;  1HQE A;  4RW8 A;  3NGI A;  1YAG A;  3K2P A;  2B6A A;  4FVM A;  1GOC A;  3ULE A;  3K57 A;  3DXK A;  5C2F A;  3SAF A;  3CFP A;  1ATS A;  1NNE A;  1A5V A;  4H5R A;  3A0I X;  3PLA A;  1NJW A;  4BVO A;  3MEC A;  4O55 A;  2FC0 A;  4W5Q A;  3DM2 A;  2UXB K;  5HRP A;  2ZJQ L;  5CHI A;  2HHU A;  4EP5 A;  4H0P A;  3AGR A;  1SQK A;  4DTR A;  1MDU B;  4BR4 A;  3BZK A;  4C8M A;  4CF2 A;  3IFR A;  3OYA A;  3HM8 A;  4M3R A;  1QSS A;  1GOB A;  1HLU A;  4XH1 A;  3MED A;  4BRI A;  3QEV A;  2KTQ A;  2HF3 A;  3ENO A;  2QI2 A;  3PIO L;  3DLK A;  4LD0 A;  1WUA A;  3SUP A;  1C0F A;  5TKW A;  4RTF D;  2P9U B;  2YI1 A;  3ZT3 A;  2XY8 A;  1NJY A;  2VG6 A;  3BDP A;  4E1N A;  2GWK A;  3ZCM A;  1RBV A;  4BG9 A;  1IBM K;  1E4G T;  4C8N A;  4K8Z A;  2QWO A;  3KLG A;  5J2Q A;  3VQE A;  4NYN A;  3CQ8 A;  3O9Q A;  4BQZ A;  1KAX A;  4JI4 K;  2QEX N;  2HHV A;  3ZSY A;  3AA4 A;  4XH4 A;  4FM1 A;  3KKS A;  3JYT A;  3SLC A;  1TGO A;  3VQC A;  3L8B A;  1B9F A;  3NF7 A;  4F2R A;  2A41 A;  2O8C B;  1RT6 A;  4FJL A;  3LDQ A;  3G0Z A;  1QQC A;  3HP6 A;  1KLM A;  2HHX A;  4FL9 A;  3SJH A;  2YNH A;  1VHX A;  3LAM A;  1YIJ N;  3E01 A;  4NLB A;  1EO1 A;  4BRK A;  3I8B A;  4KH5 A;  4X66 K;  1BDG A;  1KAY A;  1J5E K;  1IBL K;  4O4G A;  3DLH A;  3H6E A;  2P9U A;  3MXM A;  4CBU A;  3S3N A;  2D1K A;  1RTI A;  4BY9 C;  3KD1 E;  4K41 A;  1OH6 A;  4ELU A;  3C65 A;  1QQO A;  3E9P A;  3EL2 A;  5AR0 A;  4CIF A;  3ALY A;  3L2V A;  2P9I A;  1EET A;  1QTM A;  4KFB A;  3S41 A;  3DRP A;  2OCE A;  4CZM A;  2I5J A;  2I7N A;  2P9K B;  2QTD A;  4CES A;  3LPT A;  5JVG L;  5JLH A;  4JKE A;  4H03 B;  3OYE A;  4QCL A;  3H46 O;  2EX3 A;  4BRA A;  4O8U A;  1HYZ A;  2WOM A;  3AVH A;  4DSE A;  3DXK B;  1T8E A;  3EE9 A;  1JLG A;  4C8K A;  2FBY A;  3OS0 A;  1BIS A;  3CMA N;  3THV A;  3R8E A;  5BN9 A;  3THW A;  5KPR A;  5BN8 A;  4IDK A;  4BR5 A;  1WSI A;  2YKM A;  2YHA A;  2Z1H A;  5LMU K;  5C12 A;  3OBW A;  4CFB A;  1QSY A;  1VQL N;  4CK1 A;  1NU0 A;  3I0R A;  4BGB A;  4B1Z A;  4B1W B;  4CIG A;  4JHD B;  5AQZ A;  1U2V A;  4CIE A;  1W0H A;  4PA1 A;  4BRO A;  2VQF K;  1B92 A;  1NK9 A;  2E2N A;  1HPM A;  4GMJ B;  1VSK A;  4IOA L;  5M1F A;  4FWK A;  3QEI A;  4CI6 A;  3CJB A;  4BG8 A;  4E7I A;  3PSF A;  2O8B B;  3ZT0 A;  2E2O A;  4F9O A;  3SQ4 A;  2OZM A;  3DLE A;  4O8K A;  4CJK A;  1RT2 A;  5KRS A;  2Y1I A;  2JLE A;  4MO4 A;  5BRD A;  1EWQ A;  3E9L A;  4LF4 K;  4BRD A;  1JL1 A;  1JLB A;  1S1V A;  5CR4 A;  3ATU A;  2X78 A;  5HL7 L;  4A61 A;  3EKU A;  4DV5 K;  3TAQ A;  3J7Z O;  2O8F B;  4JI2 K;  1BO5 O;  4AH9 A;  2YJE A;  3ZT1 A;  2F8S A;  3V9Z A;  4ZTJ A;  3I33 A;  2P9S A;  4LF9 K;  4DLE A;  4K43 A;  2Q0U A;  4FYD A;  2CH5 A;  4CGG A;  2DPN A;  2W6L A;  2G8K A;  3AO4 A;  4R5P A;  1D4X A;  3AVN A;  4FW2 A;  3JAM O;  1X3N A;  3DXM A;  1H1V A;  4AHV A;  3QER A;  3ATV A;  1S22 A;  3NF9 A;  4DR3 K;  1RBT A;  2NRR A;  3T69 A;  3M8P A;  3D2F A;  1ZBF A;  4GV3 A;  4L8R B;  1C0T A;  1V4T A;  3MCP A;  1XNQ K;  2A6A A;  3QFP A;  4O0J A;  3VF4 A;  4KRF A;  3ZSR A;  1X9W A;  3WNG A;  2IS3 A;  1CXQ A;  1ZBI A;  4WE1 A;  3T3F A;  5GAG P;  4BR0 A;  4FWP A;  4ISG A;  3QO9 A;  4X64 K;  3Q7C A;  3PY8 A;  3WQT A;  3ZSQ A;  5ADX H;  2HND A;  1MA9 B;  3AAR A;  2E20 A;  2WUS A;  5AQP A;  1K8K A;  3MCA B;  1U49 A;  3AY9 A;  3KWG A;  3RTV A;  3QML A;  1HQU A;  1EKE A;  5EX5 A;  4DB3 A;  4YHH K;  1VQ8 N;  4ISF A;  3I56 N;  4BRC A;  1GLL O;  2E5L K;  2QXF A;  4BGA A;  3F73 A;  1IG8 A;  2HBM A;  4IEE A;  4DS4 A;  3SAG A;  3AVG A;  4AHR A;  3QIC A;  3NMU A;  3MXI A;  1NG9 A;  4O0I A;  4XEI A;  4BVP A;  3SUQ A;  3RR8 A;  5FPE A;  3HT3 A;  3G71 N;  1Q86 O;  3KVG A;  4CK3 A;  3I55 N;  3PX6 A;  3THW B;  4BC5 A;  1JL2 A;  2DFE A;  3VQ6 A;  3A2F A;  3THX B;  1NKB A;  4GNI A;  4CEE A;  4FOE A;  2OPS A;  4OVL A;  4NB4 A;  5AQU A;  3SI6 A;  2GTD A;  1XC3 A;  1S6P A;  3KIO A;  2VGM A;  1K73 O;  3HJF A;  3MEG A;  3B8A X;  4KI6 A;  1JXB A;  4CJU A;  3HM9 A;  4DV4 K;  5LJV A;  3QBX A;  5CYM A;  2E6M A;  1WBB A;  2UXC K;  3L2W A;  4IOX A;  2P9K A;  2ZWH A;  3QNN A;  3O6W A;  1J5O A;  2OPR A;  4CEQ A;  4YY3 K;  4H8K A;  2KFN A;  1TKD A;  4FWL A;  1C0G A;  3T7Z A;  3CI5 A;  3L6Q A;  1WOQ A;  3C7N A;  2XY5 A;  1S5J A;  3R9P A;  2BH1 A;  1S6Q A;  3HXM A;  3O4N A;  1D8Y A;  3IRX A;  4M3W A;  3D2E B;  1KLN A;  5J2N A;  1XWL A;  2YNI A;  2QKK A;  3CM6 A;  3DYA A;  3K58 A;  1JXE A;  4OX9 K;  4N56 A;  3FFK B;  2HOE A;  5DM7 L;  1N5Y A;  4DV1 K;  1VQM N;  3AV9 A;  4EIA A;  2GUP A;  3D0P A;  1IKW A;  3V9U A;  4B3S K;  1VSM A;  3HST B;  2HMI A;  3V81 A;  3UKU A;  1Q7Y O;  2HNZ A;  1KTQ A;  1RT5 A;  3MEE A;  1O13 A;  1TK5 A;  2HBK A;  3AVA A;  4MLH A;  3DJC A;  1XHX A;  2LSN A;  3CJ7 A;  3VQP A;  4DR2 K;  3ID8 A;  3HSC A;  3AO1 A;  4NLC A;  5GAH P;  4ZTF A;  4DTM A;  2JWL A;  4WF9 L;  3V9S A;  1QHT A;  3KK3 A;  2HW3 A;  3LWM A;  3KK2 A;  2E1Z A;  3HOS A;  1YI2 N;  4F3O A;  3OY9 A;  2QW9 A;  4DG1 A;  1M1K O;  3O9R A;  1C6V A;  5AQO A;  1HYS A;  1VSJ A;  4JNE A;  3MX5 A;  3V1O A;  1LW2 A;  1NK4 A;  2KLA A;  3VEW A;  1IJJ A;  4FXD A;  3TAM A;  3CIP A;  4DTS A;  2PAV A;  4BRF A;  1X1P A;  2VYP A;  4W5O A;  3CCU N;  1TKZ A;  3AAP A;  1Z26 A;  3AVK A;  5JS2 A;  5BPM A;  1D9F A;  3DAW A;  1BI4 A;  3N4P A;  5AQY A;  2YNF A;  3FLC O;  4CBW A;  2OTJ N;  3HI0 A;  4DQI A;  1E4F T;  1V4S A;  2OPQ A;  2E1Y A;  4FJ5 A;  4V19 S;  1ZBL A;  3P4I A;  2KFZ A;  1XNR K;  4CHO A;  2HMP A;  2O8E A;  5FDL A;  4FWS A;  4Z4H A;  4CJW A;  4MQ3 A;  1U6Z A;  4CZK A;  1NLV A;  5AQJ A;  2HST A;  3RSE B;  2NRZ A;  3NDK A;  4FM2 A;  4G9Z A;  3NGY A;  1HYV A;  2HHW A;  5AQS A;  4E89 A;  4CJR A;  2JWK A;  4NCG A;  3WUH A;  3R3L A;  2E2Q A;  3AVL A;  3WXI A;  2IVP A;  4FLV A;  3SBT A;  4B9S A;  3C7N B;  2A3Z A;  4CZI A;  4LF6 K;  3UE5 A;  1NGE A;  5AFU H;  4Q0B A;  4EHT A;  3RMA A;  3PX4 A;  3SJJ A;  4CER A;  5M1N A;  4A5A A;  1I3A A;  3H08 A;  1HNI A;  1HMV A;  3MN6 A;  2NLX A;  1BHL A;  3HL8 A;  4KTQ A;  4M3T A;  1E3M A;  2IVN A;  5BPN A;  1S72 N;  1RFQ A;  5I42 A;  2AP1 A;  2WC9 A;  5C10 A;  4HHT A;  4FLT A;  4N41 A;  1VQ4 N;  3NH1 A;  5FRM A;  3K9J A;  4Y0W A;  4CJ4 A;  3M8R A;  3L4Q A;  3CC7 N;  1HPZ A;  4W5N A;  4LF7 K;  4B1X B;  3T1A A;  3BF1 A;  2ITM A;  4JI8 K;  1F21 A;  3O08 A;  4PHT X;  2D0B A;  1GLD G;  3AA2 A;  1N34 K;  2FBX A;  3A5L C;  1FKP A;  4FWO A;  5F0X A;  3CXC M;  4NCA A;  4DF4 A;  2VG7 A;  3O4Q A;  3MN9 A;  4AHC A;  4B08 A;  1JJ2 M;  2G8F A;  4ID5 A;  3BF3 A;  2QA4 N;  1NWK A;  3LAK A;  4C1N K;  3WXK A;  3DLG A;  1VQP N;  3OYK A;  2BUP A;  2O8B A;  4YOU A;  3UKR A;  3MDQ A;  4DLG A;  1BQN A;  1Q82 O;  4DFJ A;  3RWU A;  2D0P A;  5EY4 A;  4CF0 A;  5EXW A;  4WYB A;  4E7H A;  4H0V B;  4NCB A;  4AHT A;  3Q7B A;  5HLF A;  4EAH D;  5I9E B;  2VQE K;  1VQK N;  4B9N A;  1YF5 L;  3FE1 A;  1L5U A;  4CF1 A;  4DFK A;  2ZQB A;  5AQX A;  2PYJ A;  1CZA N;  3P38 A;  4IFY A;  1RTH A;  3QEX A;  3SPZ A;  3AVC A;  3WXM B;  3J7A P;  3BZC A;  3LDL A;  5AQI A;  3OYM A;  4DU1 A;  3NHG A;  3HO1 A;  1S9E A;  1OH8 A;  4FLX A;  3HPO A;  1EWR A;  1QVG M;  4CZG A;  3QEP A;  2IGI A;  3CJC A;  2ASM A;  4E3S A;  4I9L A;  2VCP A;  1NKC A;  3OYI A;  2KHO A;  4B8C A;  1J54 A;  3DRS A;  5AQN A;  3M8S A;  4FVU A;  3ZSZ A;  3BGR A;  2GX9 A;  3P1G A;  4YDU C;  3TAE A;  4FJI A;  1TKT A;  5EVZ A;  5GIP A;  1SUQ A;  3OYG A;  3RMB A;  4RW6 A;  4LFC K;  1VSD A;  1YVN A;  3CJ9 A;  3OYD A;  1C1A A;  4KHN A;  1VK0 A;  3FGU A;  4HUF A;  4Y1C A;  4AHS A;  5BR8 K;  4IG0 A;  4NYF A;  1K8K B;  4YOT A;  1X9S A;  4K8X A;  3L4I A;  1NGG A;  3F5T A;  3DI6 A;  4JKH A;  3CD6 N;  3SK3 A;  4B9L A;  4WFN L;  1GLE G;  1N32 K;  3KZB A;  4EZ9 A;  1HUX A;  4HVJ A;  2A1S A;  2FSN A;  2FSK A;  3OBY A;  2D0C A;  3GOI A;  1BA0 A;  1LWE A;  4JS5 A;  4MDA A;  2XO7 A;  4BC4 A;  2G8I A;  3TAP A;  3H3O B;  5KQ8 A;  4Z94 A;  2XY6 A;  3VER A;  2NRH A;  4JN4 A;  4GKK K;  2QWP A;  1RNH A;  3W3D A;  1WB9 A;  1U45 A;  1SL1 A;  4FJM A;  3IS9 A;  4FJ8 A;  2W42 A;  3DLR A;  1XMQ K;  3HP9 A;  3FZF A;  3WNE A;  2W40 A;  1QE1 A;  4HCC A;  1KXP A;  4DSJ A;  3D7E O; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  4LFB K;  2UXD K;  1XNQ K;  4JI1 K;  4DR4 K;  4K0K K;  3J7A P;  4X65 K;  4AQY K;  4OX9 K;  4LF6 K;  2UU9 K;  4DV1 K;  3T1Y K;  4JV5 K;  1HNX K;  4JYA K;  4NXM K;  1N36 K;  5IWA K;  4X62 K;  2UUC K;  4JI0 K;  4X64 K;  4DV3 K;  1N33 K;  1I94 K;  4B3S K;  3J7Y P;  3J81 O;  5A2Q O;  1IBM K;  4NXN K;  5LMU K;  2UUB K;  4YHH K;  5IT9 O;  1XMO K;  2E5L K;  4DR2 K;  4CW7 B;  4LF7 K;  4JI8 K;  1HR0 K;  4CVN E;  2VQF K;  3T1H K;  4DUZ K;  4LF8 K;  4JI4 K;  2F4V K;  4DR1 K;  4LFC K;  1N34 K;  4B3T K;  1IBK K;  3J80 O;  4LFA K;  5BR8 K;  4JI5 K;  5LMN K;  4DR5 K;  4B3M K;  5FLX O;  4LF4 K;  1N32 K;  3OTO K;  5LL6 Z;  1FJG K;  4DV5 K;  4LF5 K;  4DUY K;  4KHP K;  4JI7 K;  4DV4 K;  1HNW K;  4DV2 K;  4JI2 K;  4X66 K;  2UXC K;  4V19 S;  4DV7 K;  1J5E K;  1IBL K;  4B3R K;  4DR6 K;  4DV6 K;  1XNR K;  4DR7 K;  4GKK K;  4DV0 K;  4LF9 K;  4JI3 K;  4YY3 K;  2VQE K;  2HHH K;  2UUA K;  3JAM O;  1HNZ K;  4JI6 K;  1XMQ K;  4GKJ K;  2UXB K;  4DR3 K;  2ZM6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...