4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
4LF7K 4LF6K 4DR1K 4DUZK 5IT9O 2UXDK 4JI7K 4LF5K 4JYAK 4DR7K 4NXMK 4CW7B 4GKKK 4JI3K 4NXNK 5BR8K 1HNZK 4DV7K 2UU9K 1HNXK 4B3MK 4JI0K 2ZM6K 5A2QO 5IWAK 1I94K 4B3SK 1HNWK 4B3TK 4DR2K 3J80O 4DV6K 1HR0K 2UUBK 4LFAK 4B3RK 4DR4K 3OTOK 3J7YP 2UUAK 4DR5K 1N34K 3J7AP 5LL6Z 1N33K 2UXBK 1IBLK 2HHHK 4DV5K 1XNQK 4JI2K 4DUYK 2UUCK 1J5EK 4YY3K 4DV3K 2E5LK 4JI1K 4JI5K 1N32K 4CVNE 1FJGK 4LFBK 2F4VK 1XMQK 2UXCK 5FLXO 4JI6K 4JI8K 4LF4K 4X65K 4YHHK 4X66K 4LF8K 1IBMK 5LMNK 1XNRK 4OX9K 4X64K 4DV1K 3J81O 4DR3K 4V19S 2VQFK 4LF9K 3T1HK 4JI4K 4GKJK 5LMUK 4LFCK 4KHPK 5AJ3K 1IBKK 4X62K 3JAMO 1N36K 4DV4K 4K0KK 2VQEK 4DV2K 4DR6K 4DV0K 3T1YK 4AQYK 4JV5K 1XMOK
chains in the Genus database with same CATH superfamily
4WFBL 1SAZA 2NUBA 4BRCA 3IRXA 1VQNN 2HVIA 3TTDA 3JS6A 3S3MA 3ITHA 3MWPA 3UE5A 2HNYA 2OZSA 5JS1A 4QOZB 5LJWA 3PO4A 4CZMA 2YJEA 3KWGA 3DLBA 5AQTA 1QTMA 3K2PA 3MCPA 3AGRA 3FLCO 4EIAA 3THYA 5AQOA 3MN9A 1BOTO 4OPAA 1SKRA 2Q97A 1U48A 4O55A 1I94K 3TSQA 4W5TA 4ZTFA 3DXKA 2QWPA 5KI6A 1QS4A 4B3RK 1TKDA 1VHXA 4FJGA 3SLCA 3ZCMA 3CPEA 4E7JA 3AO2A 5BR9A 4OPJA 4H4MA 3E01A 2E4LA 3CPWM 3AA4A 4Y1CA 5AQGA 4BREA 1WSGA 4FYDA 1VQMN 4JI1K 2PYJA 2OYQA 1DTQA 5SWMA 1LAVA 1FJGK 1XUPO 3FFIA 1Q9XA 3I55N 2NNWA 4CECA 5C15A 2KZMA 4B9MA 3QB0A 3AO1A 5FPNA 5AQJA 4CZHA 4XEIA 1HQEA 4WQ4A 2FXUA 4HUEA 3KZBA 1J6ZA 4BRMA 3BDPA 5M1KA 4RWTA 3THWB 4F8RA 1T6CA 1VSEA 2VQFK 1ZBSA 2D0CA 4FM2A 3T1AA 3B8AX 1VSKA 4BR0A 1QE1A 2DFEA 4FPBA 4IJAA 1Q8IA 3HXMA 1BA1A 1T44A 4WQ4C 4DTPA 1OH7A 2IC3A 1X1PA 2YX6A 2OCEA 4H5TA 2DFFA 3VEOA 4YOXA 3E1YA 3TPQA 1L3TA 5E84A 1O1WA 1Z25A 3VGKA 4WQ5A 1IG8A 5MLCQ 2B5JA 4CZGA 2QWOA 4ELUA 4CIEA 4GNIA 1BI4A 3LDLA 2YHWA 3SV4A 4CFCA 1KLMA 1C0TA 3THVA 3HOSA 3O3GA 1IKWA 5CYQA 2FBXA 5C2DA 1RDBA 3CJ7A 4QS9A 3NBPA 3HJFA 4JAXA 3UB5A 4FJ9A 4UY8O 4JYAK 2YJFA 3EO3A 4DR7K 4WQ5C 3CC4N 3H46O 4JI3K 3IFRA 2QTDA 3AVHA 3L2WA 4JI0K 1JXEA 4DB3A 2G8WA 3SUOA 3VGLA 1LW2A 3BZCA 1GLAG 2UUBK 3AA3A 4GVMA 3G6EN 4K8ZA 1C1BA 3HM9A 4FWPA 1QSYA 4H4OA 4XH1A 3OHRA 3K5LA 3ULEB 3UKUA 4NCAA 1BCOA 1ZC6A 3ENHA 1N32K 3SQ0A 3DRPA 1NJWA 1VSIA 5GAGP 3U3YA 3T3FA 2BTFA 2W6KA 1NU0A 4FLXA 4X65K 4IEIA 1UOCA 3SUNA 4FLZA 2WOMA 3EZ5A 4YOUA 1U2VA 4LH5A 4E1MA 3E9LA 4CJKA 4KH4A 2VWBA 1QHAA 4BRGA 4E7HA 3EZWA 5F1XA 2HB5A 4CD1A 1H1VA 4G1QA 4E0DA 1C0FA 2X74A 4NCBA 4J2DA 3RR7A 1ZYQA 3VESA 1VQ8N 3HL8A 4FWSA 4Y0WA 1DT9A 1HPZA 3AO3A 1RNHA 4FWMA 2FSNA 1KVAA 4Z0UA 3QERA 3UIQA 3CD6N 4YOYA 4FCYA 3EY1A 4MO4A 1DKGD 1Q9YA 2GUIA 3FZMA 2ZJQL 4DV0K 4PL8A 3C95A 1W97L 2RE2A 1GLBG 2DPNA 1G99A 3NF6A 3WUHA 5J2PA 3HK2A 4FJ7A 3O6WA 4AILC 1UA0A 5K14A 3L4IA 4B9UA 1E4FT 3VETA 2GEMA 5KRSA 1EWRA 1LW0A 3D2FB 4DTSA 1NGIA 3TAFA 4W5OA 1SS6A 2W40A 3LZJA 3CF5L 3V9SA 3LANA 2PAVA 4NXNK 2OPRA 1ATNA 4CK3A 1K9MO 2FF3B 4A61A 5KGWA 3KK3A 1K8KB 4DSEA 2P9LB 1ATSA 3CM5A 3PUFA 1HNWK 3F73A 3FZFA 2F96A 1RTJA 4MLEA 4DS4A 4LFAK 3VMFB 4PY5A 4GY2B 3MXMA 3RSEA 2E2OA 4BR2A 1X3NA 5BREA 4CJPA 4RW6A 1ASWA 1WB9A 4N5SA 3TARA 4F2SA 4A59A 4CIFA 2O8FA 2ZF5O 4A2AA 1KAYA 4BG8A 4IOCL 1U4BA 4GMJB 3SAGA 2HHTA 1BIZA 3PLAA 2QWRA 2W41A 3KLFA 3OYCA 1XHZA 4BDPA 2P9SB 3DRSA 3QIPA 4BWMA 3G25A 3KIOA 2HMPA 1J5OA 3VGMA 4L3QA 1NM1A 3AA5X 4BC2A 3OS0A 3SBGA 4CEEA 1TKXA 3CMAN 3VERA 4BRLA 1XHXA 4KI6A 1J53A 3CJ1A 4PKGA 3BP8A 4JHDB 1T8EA 2PBDA 4FLTA 3TAGA 1KXPA 2D5RA 4FWQA 4O0JA 1TAQA 1KAZA 4FJLA 2A5XA 4Z94A 5C42A 1TL1A 4K41A 4BDZA 3VEWA 1HYZA 3U3GA 1QVFM 4CJ3A 2BGGA 4IJNA 4BVOA 1SQKA 3KK7A 1F21A 1D5AA 3QEPA 1OH8A 1NG9A 5AQLA 4I9LA 5F0XA 4KRFA 2YNIA 2HVHA 3ZETA 4CGFA 2NRRA 4ID1A 1RBVA 3C65A 3QDKA 2Q36A 4E1JA 4M7YA 3JXUA 3L2QA 1NGJA 4CW7B 4IO9L 2YNHA 1ESVA 4C8MA 4OLBA 3VF6A 1YT3A 1TYQB 2IS3A 4JEPA 3OY9A 1S1UA 1EXQA 4OGEA 4CJVA 2KFZA 1JCGA 3E9PA 4MDAA 3B6OA 1U45A 4H0VB 1KVBA 3G10A 4M41A 1XWLA 2CGLA 3CCRN 3D6RA 2UUAK 1QQMA 1OH5A 3L6QA 3OYMA 3F2KA 2E2PA 3ZSZA 3HSCA 3MXJA 1CZBA 4JI2K 1L5UA 3O9UA 3NH0A 1LWEA 4HVJA 2WBNA 4H5WA 4ILGB 3TTFA 4CF2A 1YJWN 1WBBA 5J2QA 4BWJA 4LFBK 2IOCA 4OKJA 4JNEA 3CIPA 1VQ6N 4J2AA 2O4IA 3WQTA 2O8CA 3CCJN 3OYJA 1NK9A 2QWNA 2AP1A 4U67L 2OPSA 4ICLA 2O8EA 3HI0A 1KTQA 2P9PA 4IWVA 2HNDA 2A1SA 1CLQA 4OKKA 3J8AA 4GKJK 2DTUA 1YIJN 4I9QA 4WF9L 3VQBA 3T7ZA 3OJSA 3P38A 3DJCA 3OYEA 3W3DA 4C8KA 2NRVA 2IIRA 3G4SN 4CZJA 1SL0A 3EN9A 3OA9A 4PKHA 1U04A 3K57A 3EEQA 1NK4A 3VQPA 3U8XA 1HNVA 2GUPA 5J2NA 3BEXA 4CJUA 4CCHA 1D9FA 4JKGA 2Q31A 3BZKA 2D0PA 3R9PA 3ZSVA 4CHQA 1RDAA 3QBXA 3I8DA 3HPGA 3VOVA 2CH6A 2E6MA 1R59O 5JICA 1VQKN 4FJ5A 3CJ9A 2FSKA 4PKIA 3OYDA 5AQZA 3QEXA 3WEEB 1RFQA 3EYZA 3QIOA 2O8FB 4BC3A 4CJQA 4M3TA 2FSJA 2XY8A 2BANA 3MAQA 3LP2A 3K59A 1YXQA 3OS2A 1I3AA 2E1ZA 4XH4A 1HR0K 3CYMA 4N76A 2ASMA 3HT3A 3LM2A 2P9IA 3WXJA 1CZ9A 2GTDA 5HP1A 2YI1A 4LD0A 4DSJA 1N33K 4E19A 3ZX2A 4PWDA 1GLFO 1NGCA 2IVOA 3NAEA 3KKSA 2IGIA 3SQ4A 3VQ5A 4YDUA 4DMNA 1HRHA 3V9WA 4FO0A 4JKAA 3OYBA 3L2RA 2B6AA 2UXCK 4CGGA 4KHYA 5J1EA 3M8SA 3DXMB 5KPRA 1MWKA 3K58A 1XNRK 2VGMA 2KQ2A 1N6QA 1NK0A 4DWIA 3LPUA 1WOQA 2JGUA 4V19S 4N41A 4M3RA 4MFBA 5AFUA 4ZHRA 2HHWA 2A1RA 2P9UA 5GADP 3HP6A 3VF2A 1Z6RA 4KB1A 4EHUA 3CFPA 1T7PA 2RN2A 4DQ8A 3I56N 4AM7A 4BACA 3CC7N 4K8XA 3DOLA 1V4TA 3OJUA 2VQEK 2AA4A 1NGBA 4DG1A 3CCSN 1WN7A 1WSJA 2EHGA 1NNEA 1RDWX 1BCMA 2HF4A 4BROA 1S9GA 3T69A 3ULDA 3PIOL 2P9KA 1RBUA 3SK3A 4EZ6A 3H1QA 4DHYA 5CY4A 1YVUA 3AVBA 1Z26A 5KGXA 4Y1DA 4JS4A 4B3MK 3ID8A 1WLJA 3KKRA 4Z4GA 3MEEA 5HRNA 4YNQA 2HW3A 1M1KO 5M1QA 4B3TK 4H0XB 4OO1J 1K8AO 2ETJA 4CJ4A 3C6HA 5C10A 1D4XA 3AVAA 3DOKA 2ITGA 3AARA 4JD2B 5HBMA 3QEVA 4FZXC 3J7AP 5KPTA 4IFYA 3BGRA 1GLEG 1WSEA 4CZLA 5AQVA 4AH9A 4CF1A 4CJ7A 2P9PB 1WUAA 4DQSA 1JLFA 1HYVA 3GDQA 4KHWA 3O4WA 3PIPL 1JL1A 4R5PA 3THXB 4KI4A 1RCHA 1NGEA 2PZSA 4CD3A 2Z1GA 4FWNA 1NJIO 1WAJA 4YHHK 5GAHP 4AHUA 4FK0A 3OYFA 4RW7A 4B1YB 2HOEA 4KHUA 4H5NA 4JKEA 4CF0A 3OW2M 4CZFA 4DR3K 4Z4CA 1BUPA 2X6NA 3AAPA 1QVGM 4CK2A 4EP4A 1KD1O 4JI4K 3MK6A 4EHTA 3FFKB 4CFAA 1FK9A 4Z4EA 1U49A 1NK5A 3O4QA 5FDLA 5AQRA 1HX1A 3LDOA 3MEGA 1J54A 3VA3A 2Y1JA 2QEXN 3PSFA 5LJVA 3S41A 4K0KK 1TUYA 1HKBA 1QQNA 4I6MA 1TK0A 2HHSA 1VQ5N 3OS1A 3RTVA 1EQYA 1X9SA 3G0ZA 1WAFA 3NF8A 3V1RA 1VQ9N 1WSHA 1HMVA 2CGJA 1QZ6A 1YAGA 5AQMA 3IAYA 1RT2A 4JRPA 1TK8A 1CXQA 4OPHA 4KKOA 3LDPA 4ID5A 3BF1A 2P9NA 1HPMA 2UYTA 1GOBA 3CCLN 2E2QA 3LP3A 4CGIA 3ENBA 1L3UA 4BRDA 4R79A 5CZ2A 1A5WA 4KTQA 2KHOA 4NB4A 2Y1IA 1NLVA 3C7NB 4KV8A 2OPQA 4B3SK 1ASVA 4JKDA 2KZZA 1S3XA 3H08A 5CZ1A 4I2PA 3VEVA 4K42A 2F7TA 3AVKA 2YKNA 5LL6Z 3VTHA 4BR9A 2QA4N 2P51A 4J8FA 3KK1A 3VTIA 5AQPA 3DM2A 2F9TA 2FBYA 5HL7L 1HQUA 2D4WA 3H6EA 2ASOA 3OYLA 1J9AA 1T05A 3DLHA 2WONA 4DFMA 3SI6A 1YHQN 1IO2A 4IEEA 2HF3A 3ID6A 4CZKA 4OVLA 3BY5A 3O4NA 3WNGA 3LPTA 4RW4A 2VWJA 2VGNA 1O13A 4FJIA 1Q18A 1XI1A 3I0RA 3KTQA 2XY5A 3QFPA 3Q7CA 1IBMK 4OX9K 2I7PA 3HTVA 1BWFO 5EY4A 5FPDA 2P5OA 4CEOA 2YCHA 2BE2A 3LL3A 1RILA 1X9JA 1S22A 2Z1IA 3L2UA 1KAXA 2JLEA 1NOYA 4J2EA 1M90O 2OZMA 4FZYA 4B1WB 3C0BA 1BU6O 3SZ2A 1YF5L 5AFUH 5LY3A 2PFUA 3C94A 3ZSWA 5HRRA 1JLQA 1V4SA 4OPKA 3CFOA 1GOAA 3ISNC 5KRTA 4FJHA 2YV0X 3EE9A 2FF6A 3M8PA 3VQEA 5JMVA 3LWLA 4FJJA 4FJKA 4IKFA 1GLDG 4CERA 1WBDA 3VEZA 3M6GA 3LALA 5BPMA 2XO7A 3IDHA 1TVRA 1UWBA 4CJWA 4NYFA 4H03B 4F9OA 1NK7A 1NK6A 3KLGA 5DM7L 1ASUA 3TAEA 1LCUA 3ZSYA 1NGDA 5BR8K 3THYB 4HTUA 3HM8A 3MWTA 4B9QA 4Q0BA 3EL2A 5D3GA 4BRKA 5A2QO 3FE1A 4CF8A 3DXKB 3U4LA 2WFBA 1T3VA 1NMNA 3VQDA 4M63C 2HNZA 3ATVA 3OVNA 2ZGZA 4PQUA 3EKUA 4BGBA 5AQXA 2KW4A 1IH7A 2UUCK 3RR8A 4IDHA 5E26A 2IDOA 4CVNE 3E66A 3C6UA 5JLFA 3K5MA 1C0GA 4LSNA 1IKXA 3RMAA 3CCVN 4A62A 5LMNK 4WE1A 3EKSA 3N4PA 1RT7A 1DTTA 1KVCA 4CBXA 2A42A 3ZX3A 1S72N 4O8UA 3LDNA 2QI2A 4LF9K 4FWOA 2G8IA 4YOVA 1D8YA 2ITMA 3JSMA 1NJYA 4FJXA 4B9SA 4CJEA 4ISGA 3DLLL 2DFHA 2Z1JA 5FROA 3ZEUA 1U47A 3P1GA 2YNFA 4FXDA 1GOCA 1VSHA 3S3OA 3L3UA 4HCBA 5AZIA 1Z05A 4DLGA 3ZT3A 5EOYA 1BI4B 1T03A 4FLYA 2GWKA 4JKHA 3SJHA 2F8TA 3ZT1A 4CZIA 4CHOA 4BR4A 3NH1A 1NKEA 1BA0A 3KJVA 3M3ZA 2VG6A 3IUCA 1HLUA 5H1SQ 3WQUA 1WSFA 4H5VA 1VK0A 1C0UA 4EP5A 3JYTA 3UKRA 5HOOA 1GLJO 4DLEA 3RMBA 4H0TB 4E1NA 3SV3A 4DTJA 3NF7A 4CJRA 1JLEA 3QLHA 4DR4K 1VSDA 4FJ8A 2FLOA 4C8LA 1XQSC 2VWKA 4YOTA 4IOXA 4C8NA 2VYPA 3NMUA 4BRIA 5AQQA 2RKIA 3CHWA 3NDKA 3UKUB 1GLCG 2HBMA 1BIUA 4DF8A 1SZ2A 2HHXA 4EAHD 4NLBA 4HTLA 4BRAA 5C25A 4M42A 5BN8A 3QNNA 2KTQA 4H0OA 1S1TA 1VAZA 3GBTA 1C0MA 3FR0A 3R6MA 5AZJA 3CC2N 5F2RA 1RBSA 3O80A 2IAJA 4CEDA 3MN5A 3A5LC 1U2VB 3SQ2A 2B4JA 4CJFA 1RT5A 5FPEA 1ZXOA 3CXCM 1S1XA 4PA1A 4CHNA 3A8YA 2O8BA 3SUPA 3D2EA 1VQON 4O5FA 1ZBHA 2PYLA 2CGKA 4CJ5A 1JLAA 4CHYA 1RDDA 3U6FA 5LMUK 2HSTA 4FOEA 1TL3A 3PSIA 4LFCK 4B1ZA 3QETA 1YJNN 1VSMA 1N8RO 4X62K 3V1QA 3EE8A 4JS5A 2OTJN 4W5NA 2IVNA 1RDCA 1VSFA 1ZBUA 2NRHA 3QMLA 1IG9A 2IVPA 2HHUA 4DFPA 5EU7A 4CEAA 3V4IA 5AQIA 2YHBA 3OYIA 3TU5A 4BE2A 2D0AA 4KAZA 3A0IX 3DRRA 1NMDA 1KSPA 4DUZK 5IT9O 2UXDK 1BDGA 3NF9A 3SBTA 3O9RA 2E6LA 4F2RA 2QKBA 1YVNA 2QW9A 2JWKA 3TR8A 1KCFA 3A5OC 3ENOA 5I42A 4ELVA 1HNXK 2O4GA 1W2BM 4KFBA 2ZWHA 5DM6L 1RDUA 4FL9A 1VQ7N 3KVGA 3CJCA 4DR2K 4NYNA 5AQWA 3RSEB 1OKJA 3K0SA 1N34K 1K6YA 4CEQA 2GBZA 4BGAA 3C6AA 4ISEA 4AM6A 1NKCA 4DQPA 2G8KA 4H8KA 4CGJA 2Q0UA 1RBRA 2NZTA 3LWMA 1J5EK 3V9UA 3L4QA 4QAGA 4FM0A 3H45C 1JL2A 3IS9A 4IO8A 1VQPN 5C24A 2YHAA 4DSLA 3KWIA 5EXWA 3A2FA 4X66K 3ZSXA 3CETA 3M8RA 1NWKA 3VA0A 3ZT2A 3AA2A 4B1UB 4FSVA 4CEBA 3THWA 3SNNA 4KHNA 1G15A 3GL1A 5AZIB 1LAWA 1K73O 4CHZA 1CZAN 2OTLN 3WNHA 3DWLA 4BR5A 4O5BA 1VSJA 2OA8A 1C1AA 4BE1A 4E89A 4C1NK 2CH5A 3NFAA 2QXFA 3LZIA 3JAMO 4CBUA 2A6AA 4BRQA 3E9OA 3T1YK 4QS7A 4YDUC 3AVMA 3FZKA 4B9VA 1HYSA 4LF7K 1YITN 1BHLA 4U7BA 4YORA 3ZETB 3WXKA 4RTFD 3LAMA 1XC9A 4CFBA 1S1WA 4JI7K 1TKTA 4WFNL 4HUFA 4CEZA 1TGOA 4DTMA 2UU9K 4N56A 3PO5A 3TI0A 4K25A 5FRMA 3PX0A 4O0IA 4FWKA 5JVGL 3DLRA 2OPPA 2HHVA 4M3YA 5AZJB 3R8EA 3J80O 4JK9A 3ASMA 5I3UA 2VCPA 3M1FA 4CESA 3HRGA 2OANA 4MDBA 4B8CA 5BN9A 4WCEL 2HBJA 4CE9A 4FW2A 2YNGA 5HROA 4GV9A 3RRGA 1SL2A 4C1NI 1QSSA 3ZYYX 4DUYK 3HOTA 3ZT4A 1HJOA 3D2EB 2W6LA 1KRPA 3KD5E 3A5NC 5AQSA 3VENA 3KLHA 3L8BA 3NHGA 3KLEA 4MQ3A 5CE3A 1KFSA 2E1YA 2ZE2A 1MU2A 4AHSA 1RT4A 3HPHA 3BUZB 3N4QA 3MX5A 2ZJRL 4BRPA 4ELTA 1DGKN 4IXCA 2O8CB 1FKOA 3V9XA 5GIPA 3MMVA 4FK2A 1BL3A 4OGCA 3CG7A 3QEIA 4DV1K 3V81A 2DY4A 2O8EB 1IKYA 4O4GA 4BVPA 3AO4A 4EFHA 1BGXT 5SZTA 3DYAA 4CEFA 3NVMA 4OLAA 3HZ6A 2RPIA 1B9DA 3FZHA 1IKVA 4DFKA 3PX6A 1KFDA 3MDQA 3TAQA 4DCHA 1IBKK 1ZBFA 3LP1A 4M3WA 2FC0A 3GG4A 3QBWA 4DQIA 1JLCA 1FW6A 2QK9A 1P8ZA 1NK8A 3CCMN 1BISA 4JKGB 4DF4A 1YTUA 2GX9A 3CFRA 3G71N 5CR4A 1OVYA 3TWHA 5BRHA 1EO1A 3D45A 2ATQA 5EX5A 3D2FA 4DFJA 4BQZA 2VG5A 1TK5A 3LP0A 4JKBA 3K5NA 1S9EA 2Q1NA 3P39A 3GOIA 2XY6A 4M3ZA 1WNSA 3J7ZO 3AV9A 1K8KA 5FPMA 1BG3A 2P9LA 4FW1A 3SMSA 1YJ9N 2P5GA 3LDSA 4B9NA 4CZEA 1X9WA 1W0HA 1QHTA 3A5MC 3J7YP 2P9IB 4KB0A 3QESA 2ASPA 3KHYA 3KK2A 4FWRA 3V6DA 3ZLJA 4DV5K 4A5AA 2QWMA 3O3HA 1E4GT 4HUGA 2I7NA 4B8AB 4IFVA 4BQLA 4E7LA 1JJ2M 3O8MA 5M1NA 1Q81O 4IOAL 5AQUA 3SAFA 1NJXA 1JLGA 5EVZA 2PY5A 1TAUA 1Q82O 2P9SA 3CM6A 1FXXA 4IG3A 3VF4A 1NBWA 2BH1A 4JK7A 3QFUA 5KPZA 3NGZA 3IG1A 3SYZA 1MA9B 3AAQA 3VEXA 5DK5A 1RT6A 2V52B 2P9UB 5BRFA 2G8UA 4DSIA 4JHDA 4BR7A 2VG7A 2E2NA 3FGUA 3P4IA 3P5JA 3TTCA 1RTDA 4JRQA 1SV5A 2F8SA 3WT0A 4E7KA 5M1OA 1I39A 5JS2A 1S6PA 5ADXH 1HUXA 2NRZA 1EETA 1RTHA 4KHQA 3HSTB 1QQCA 4WYBA 3ZSRA 1Q86O 1A5XA 3K5OA 4CJTA 4DV2K 3HPOA 4DR6K 1NGGA 3KD1E 4FVMA 1TKZA 4FWLA 3M5RA 3VN5A 2P9KB 4HWIA 4DU1A 1YTAA 4FPAA 3VQ6A 4IFEA 3QNOA 4AHVA 4NCGA 4MO5A 4GKKK 3WNEA 1TYQA 5DMRA 5GINA 1HNZK 4DV7K 4XIUA 3DI6A 3RWUA 3MEDA 2EWSA 4RCHA 1ATRA 4PL7A 2P1JA 1UA1A 4DTRA 4JKFA 1SL1A 1KQSM 1SKWA 3MN6A 4KREA 4FJNA 4DR5K 5TKWA 3AVCA 3RMCA 3F9KA 1EWQA 1IBLK 2HHHK 4BC4A 1LWFA 5C12A 1S1VA 4DQRA 2D1KA 4FM1A 1IJJA 3VQQA 4B1XB 3PY8A 1L3SA 4B9TA 4M3UA 4BY9C 3L2VA 5AR0A 3RVCA 1R0AA 2KFNA 3DMJA 2F4VK 2YKMA 3P31A 2AJQA 3ZSQA 5FLXO 3SUQA 1YI2N 3R3LA 1DLOA 2G8FA 4KBOA 3CQYA 2ZD1A 4CIGA 5HRSA 3CQXA 4KPYA 4X64K 4N47A 3AY9A 2WUSA 3HBTA 3WXIA 3AVIA 4Z4IA 3HO1A 1YUWA 3HVTA 4Z4FA 4OJRA 3WNFA 4XH5A 3QO9A 3T1HK 4NO7A 4OKEA 5TKYA 4F4KA 4IDKA 4RW8A 1MWMA 4KHPK 4PUOA 1HKGA 4B9LA 4CJSA 1GLLO 3CQ8A 3T19A 3TAMA 1RBTA 1N36K 1JXBA 5C0YA 4BRHA 4I6MB 4DTXA 2EX3A 1JCFA 4O44A 3R1XA 3K9KA 1XMOK 4YOWA 5AQFA 1EX4A 4H5RA 4DKWA 2BUPA 5AQNA 4DR1K 3CJAA 4DU4A 3I33A 2JWLA 3WXMB 4RW9A 4DTOA 1VSLA 3AVFA 1NKBA 3TABA 2P9NB 3I0SA 4CFDA 4QCLA 2XRIA 3O08A 4KHSA 4NXMK 3WEEA 4A2BA 3VPZA 4GV3A 3DLKA 4NLCA 4LC9B 4DTUA 2O8DA 3O9QA 3S3NA 3PV8A 4RG8A 4MLHA 3AO5A 3NVKA 1VQ4N 1X3MA 2WTUA 2J4RA 4PHTX 4M7XA 3KLIA 3OTOK 4KTWA 5KQDA 2HHQA 5M1PA 5C2FA 3CMEN 4IG0A 1UAXA 3ATUA 5ELZA 3VEYA 3LM9A 4C23A 4DV3K 1HKCA 4AF1A 3O1BA 4KH6A 3U9DA 4AHRA 5BPLA 1U6ZA 3PX4A 3D0PA 3TSUA 4Q5VA 1DEJA 1TUUA 5JLHA 4FVUA 4FLVA 2A40A 2X6SA 4AHTA 3SPZA 4JI8K 4LF4K 1ZBIA 3DXMA 1XC3A 2G8HA 1BQMA 3D7EO 3L3VA 3IKMA 4J2BA 1TV6A 2BDPA 4I2QA 5KTQA 5I9EB 4A5BA 4KTZA 1NGAA 4FJMA 1D9DA 4DSKA 4FK4A 4L8RB 4W5QA 3IMXA 3H3NO 2RF2A 4DU3A 5AJ3K 4UQGA 4HHTA 2XHBA 3H3OB 3O3FA 1SKSA 3OYAA 1LV5A 3FZLA 4DTNA 3GE1A 2G8VA 4JV5K 3BF3A 3NGIA 2F9WA 2GWJA 4CHPA 4ILHA 3AVGA 4A57A 4FOIA 5CHIA 1JCEA 5HLFA 4FLWA 4GVEA 3SQ1A 3QICA 3CCEN 4CBWA 4QS8A 2QWLA 5HRPA 1ITGA 1QQOA 2QXLA 1KC8O 3P83D 1WSIA 4CJLA 2R7YA 5T7BA 4W5RA 1OVQA 1RGIA 2Q0RA 4JKCA 3TANA 2GV9A 1QZ5A 2NRWA 5AQYA 1VRUA 3CCQN 4JD2A 3L0QA 2HMIA 4JN4A 3H1VX 2XY7A 2UXBK 4TSXA 1W7AA 1N5YA 2KLAA 3HYFA 4CGHA 4IBNA 2ZJPL 4DQQA 2E88A 4G9ZA 3OYHA 4BRFA 4M3XA 4GV6A 1T6DA 1HNIA 2E5LK 1JKHA 3ZSOA 2D0OA 4F3TA 4BG9A 3THXA 3S9HA 1NGFA 1S5JA 3SCXA 2A3ZA 1RTIA 1LOTB 4HCCA 4JI6K 1FKPA 3AVNA 4K43A 3MCAB 4FZZA 2X78A 4JLHA 4LF8K 4BDYA 4ZTJA 3DLEA 3I8BA 2NRXA 3J81O 2GELA 3MX2A 2D0BA 1BO5O 1B92A 3C6TA 5BRDA 4KH5A 4BE0A 1C6VA 2NRTA 3M8QA 3VQCA 2KKZA 2LSNA 3LDQA 3AVJA 3O5BA 1A5VA 2Z1HA 3SAHA 4ISFA 4C8OA 1S6QA 4GW6A 3V1OA 2QKKA 2YHXA 3ZEUB 2O8DB 3HVRA 4I7FA 3RMDA 5ADXA 2ZQBA 1KLNA 1NOZA 3DLGA 4E7IA 5GIOA 1VQLN 1W9HA 4LF6K 1QSLA 3SPYA 3MXIA 4B08A 1E3MA 2W42A 3ZT0A 5J2MA 3SJJA 1IV0A 1L3VA 3MN7A 3F5TA 2WC9A 4LF5K 1B9FA 2Q2RA 3Q7BA 2QM1A 4EZ9A 5FRNA 4H0PA 4LY7A 4KO0A 4BRNA 1HJRA 3HP9A 2QWQA 1LWCA 3F9MA 4DS5A 4O8KA 2ZM6K 3C7NA 5E41A 5IWAK 1Q7YO 3OYKA 4ILJA 4Z4HA 3VQ8A 4DSFA 3UKRB 1JLBA 4H0YB 4YFUA 4DV6K 1Y64A 3LAKA 1SUQA 4M45A 1EP4A 3ALYA 3OBYA 4B1VA 4JK8A 5M1FA 5B8HA 1OH6A 3RRHA 4LSLA 5AQHA 1XNQK 3VQ7A 3CCUN 3NCIA 4LH4A 3W0LA 2I5JA 2Q3SA 3NE6A 2V51B 3VQ9A 2RHKA 4YY3K 2HBLA 1MDUB 4JI5K 4WFAL 3ZX0A 2ZGYA 4CGDA 3O9TA 3OYGA 4IZ9A 2E20A 4AHCA 3WXLA 4CI6A 2A41A 1RT3A 2FBTA 1XMQK 1ILYA 5BPNA 5KQ8A 2HBKA 1REVA 3CI5A 1NGHA 3O9SA 3B6PA 2FBVA 5CYMA 2NLXA 3QEWA 3AGKA 1P90A 4CF9A 3O1WA 2E8AA 1CXUA 2YHYA 3CERA 1EKEA 4CK1A 2O8BB 3ULEA 3CJBA 3OYNA 1RT1A 3U9ZA 2H3GX 1Y97A 3TSPA 3SMPA 1NJZA 4BC5A 3NGYA 3AVLA 3TAPA 1C1CA 4F3OA 3NH2A 1VRTA 5GAEP 1X9MA 3OBWA 3DAWA 3K9JA 4E3SA 5AQKA 1BQNA 2V7ZA 2V7YA 4DV4K 3VQ4A 3V9ZA 4FLUA 3MECA 5JVHL 4B3OA 4AQYK 3QINA 1ZBLA 3VQAA
chains in the Genus database with same CATH topology
4LF7K 4LF6K 4DR1K 4DUZK 5IT9O 2UXDK 4JI7K 4LF5K 4JYAK 4DR7K 4NXMK 4CW7B 4GKKK 4JI3K 4NXNK 5BR8K 1HNZK 4DV7K 2UU9K 1HNXK 4B3MK 4JI0K 2ZM6K 5A2QO 5IWAK 1I94K 4B3SK 1HNWK 4B3TK 4DR2K 3J80O 4DV6K 1HR0K 2UUBK 4LFAK 4B3RK 4DR4K 3OTOK 3J7YP 2UUAK 4DR5K 1N34K 3J7AP 5LL6Z 1N33K 2UXBK 1IBLK 2HHHK 4DV5K 1XNQK 4JI2K 4DUYK 2UUCK 1J5EK 4YY3K 4DV3K 2E5LK 4JI1K 4JI5K 1N32K 4CVNE 1FJGK 4LFBK 2F4VK 1XMQK 2UXCK 5FLXO 4JI6K 4JI8K 4LF4K 4X65K 4YHHK 4X66K 4LF8K 1IBMK 5LMNK 1XNRK 4OX9K 4X64K 4DV1K 3J81O 4DR3K 4V19S 2VQFK 4LF9K 3T1HK 4JI4K 4GKJK 5LMUK 4LFCK 4KHPK 5AJ3K 1IBKK 4X62K 3JAMO 1N36K 4DV4K 4K0KK 2VQEK 4DV2K 4DR6K 4DV0K 3T1YK 4AQYK 4JV5K 1XMOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 K;  4LF6 K;  4DR1 K;  4DUZ K;  5IT9 O;  2UXD K;  4JI7 K;  4LF5 K;  4JYA K;  4DR7 K;  4NXM K;  4CW7 B;  4GKK K;  4JI3 K;  4NXN K;  5BR8 K;  1HNZ K;  4DV7 K;  2UU9 K;  1HNX K;  4B3M K;  4JI0 K;  2ZM6 K;  5A2Q O;  5IWA K;  1I94 K;  4B3S K;  1HNW K;  4B3T K;  4DR2 K;  3J80 O;  4DV6 K;  1HR0 K;  2UUB K;  4LFA K;  4B3R K;  4DR4 K;  3OTO K;  3J7Y P;  2UUA K;  4DR5 K;  1N34 K;  3J7A P;  5LL6 Z;  1N33 K;  2UXB K;  1IBL K;  2HHH K;  4DV5 K;  1XNQ K;  4JI2 K;  4DUY K;  2UUC K;  1J5E K;  4YY3 K;  4DV3 K;  2E5L K;  4JI1 K;  4JI5 K;  1N32 K;  4CVN E;  1FJG K;  4LFB K;  2F4V K;  1XMQ K;  2UXC K;  5FLX O;  4JI6 K;  4JI8 K;  4LF4 K;  4X65 K;  4YHH K;  4X66 K;  4LF8 K;  1IBM K;  5LMN K;  1XNR K;  4OX9 K;  4X64 K;  4DV1 K;  3J81 O;  4DR3 K;  4V19 S;  2VQF K;  4LF9 K;  3T1H K;  4JI4 K;  4GKJ K;  5LMU K;  4LFC K;  4KHP K;  5AJ3 K;  1IBK K;  4X62 K;  3JAM O;  1N36 K;  4DV4 K;  4K0K K;  2VQE K;  4DV2 K;  4DR6 K;  4DV0 K;  3T1Y K;  4AQY K;  4JV5 K;  1XMO K; 
#chains in the Genus database with same CATH topology
 4WFB L;  1SAZ A;  2NUB A;  4BRC A;  3IRX A;  1VQN N;  2HVI A;  3TTD A;  3JS6 A;  3S3M A;  3ITH A;  3MWP A;  3UE5 A;  2HNY A;  2OZS A;  5JS1 A;  4QOZ B;  5LJW A;  3PO4 A;  4CZM A;  2YJE A;  3KWG A;  3DLB A;  5AQT A;  1QTM A;  3K2P A;  3MCP A;  3AGR A;  3FLC O;  4EIA A;  3THY A;  5AQO A;  3MN9 A;  1BOT O;  4OPA A;  1SKR A;  2Q97 A;  1U48 A;  4O55 A;  1I94 K;  3TSQ A;  4W5T A;  4ZTF A;  3DXK A;  2QWP A;  5KI6 A;  1QS4 A;  4B3R K;  1TKD A;  1VHX A;  4FJG A;  3SLC A;  3ZCM A;  3CPE A;  4E7J A;  3AO2 A;  5BR9 A;  4OPJ A;  4H4M A;  3E01 A;  2E4L A;  3CPW M;  3AA4 A;  4Y1C A;  5AQG A;  4BRE A;  1WSG A;  4FYD A;  1VQM N;  4JI1 K;  2PYJ A;  2OYQ A;  1DTQ A;  5SWM A;  1LAV A;  1FJG K;  1XUP O;  3FFI A;  1Q9X A;  3I55 N;  2NNW A;  4CEC A;  5C15 A;  2KZM A;  4B9M A;  3QB0 A;  3AO1 A;  5FPN A;  5AQJ A;  4CZH A;  4XEI A;  1HQE A;  4WQ4 A;  2FXU A;  4HUE A;  3KZB A;  1J6Z A;  4BRM A;  3BDP A;  5M1K A;  4RWT A;  3THW B;  4F8R A;  1T6C A;  1VSE A;  2VQF K;  1ZBS A;  2D0C A;  4FM2 A;  3T1A A;  3B8A X;  1VSK A;  4BR0 A;  1QE1 A;  2DFE A;  4FPB A;  4IJA A;  1Q8I A;  3HXM A;  1BA1 A;  1T44 A;  4WQ4 C;  4DTP A;  1OH7 A;  2IC3 A;  1X1P A;  2YX6 A;  2OCE A;  4H5T A;  2DFF A;  3VEO A;  4YOX A;  3E1Y A;  3TPQ A;  1L3T A;  5E84 A;  1O1W A;  1Z25 A;  3VGK A;  4WQ5 A;  1IG8 A;  5MLC Q;  2B5J A;  4CZG A;  2QWO A;  4ELU A;  4CIE A;  4GNI A;  1BI4 A;  3LDL A;  2YHW A;  3SV4 A;  4CFC A;  1KLM A;  1C0T A;  3THV A;  3HOS A;  3O3G A;  1IKW A;  5CYQ A;  2FBX A;  5C2D A;  1RDB A;  3CJ7 A;  4QS9 A;  3NBP A;  3HJF A;  4JAX A;  3UB5 A;  4FJ9 A;  4UY8 O;  4JYA K;  2YJF A;  3EO3 A;  4DR7 K;  4WQ5 C;  3CC4 N;  3H46 O;  4JI3 K;  3IFR A;  2QTD A;  3AVH A;  3L2W A;  4JI0 K;  1JXE A;  4DB3 A;  2G8W A;  3SUO A;  3VGL A;  1LW2 A;  3BZC A;  1GLA G;  2UUB K;  3AA3 A;  4GVM A;  3G6E N;  4K8Z A;  1C1B A;  3HM9 A;  4FWP A;  1QSY A;  4H4O A;  4XH1 A;  3OHR A;  3K5L A;  3ULE B;  3UKU A;  4NCA A;  1BCO A;  1ZC6 A;  3ENH A;  1N32 K;  3SQ0 A;  3DRP A;  1NJW A;  1VSI A;  5GAG P;  3U3Y A;  3T3F A;  2BTF A;  2W6K A;  1NU0 A;  4FLX A;  4X65 K;  4IEI A;  1UOC A;  3SUN A;  4FLZ A;  2WOM A;  3EZ5 A;  4YOU A;  1U2V A;  4LH5 A;  4E1M A;  3E9L A;  4CJK A;  4KH4 A;  2VWB A;  1QHA A;  4BRG A;  4E7H A;  3EZW A;  5F1X A;  2HB5 A;  4CD1 A;  1H1V A;  4G1Q A;  4E0D A;  1C0F A;  2X74 A;  4NCB A;  4J2D A;  3RR7 A;  1ZYQ A;  3VES A;  1VQ8 N;  3HL8 A;  4FWS A;  4Y0W A;  1DT9 A;  1HPZ A;  3AO3 A;  1RNH A;  4FWM A;  2FSN A;  1KVA A;  4Z0U A;  3QER A;  3UIQ A;  3CD6 N;  4YOY A;  4FCY A;  3EY1 A;  4MO4 A;  1DKG D;  1Q9Y A;  2GUI A;  3FZM A;  2ZJQ L;  4DV0 K;  4PL8 A;  3C95 A;  1W97 L;  2RE2 A;  1GLB G;  2DPN A;  1G99 A;  3NF6 A;  3WUH A;  5J2P A;  3HK2 A;  4FJ7 A;  3O6W A;  4AIL C;  1UA0 A;  5K14 A;  3L4I A;  4B9U A;  1E4F T;  3VET A;  2GEM A;  5KRS A;  1EWR A;  1LW0 A;  3D2F B;  4DTS A;  1NGI A;  3TAF A;  4W5O A;  1SS6 A;  2W40 A;  3LZJ A;  3CF5 L;  3V9S A;  3LAN A;  2PAV A;  4NXN K;  2OPR A;  1ATN A;  4CK3 A;  1K9M O;  2FF3 B;  4A61 A;  5KGW A;  3KK3 A;  1K8K B;  4DSE A;  2P9L B;  1ATS A;  3CM5 A;  3PUF A;  1HNW K;  3F73 A;  3FZF A;  2F96 A;  1RTJ A;  4MLE A;  4DS4 A;  4LFA K;  3VMF B;  4PY5 A;  4GY2 B;  3MXM A;  3RSE A;  2E2O A;  4BR2 A;  1X3N A;  5BRE A;  4CJP A;  4RW6 A;  1ASW A;  1WB9 A;  4N5S A;  3TAR A;  4F2S A;  4A59 A;  4CIF A;  2O8F A;  2ZF5 O;  4A2A A;  1KAY A;  4BG8 A;  4IOC L;  1U4B A;  4GMJ B;  3SAG A;  2HHT A;  1BIZ A;  3PLA A;  2QWR A;  2W41 A;  3KLF A;  3OYC A;  1XHZ A;  4BDP A;  2P9S B;  3DRS A;  3QIP A;  4BWM A;  3G25 A;  3KIO A;  2HMP A;  1J5O A;  3VGM A;  4L3Q A;  1NM1 A;  3AA5 X;  4BC2 A;  3OS0 A;  3SBG A;  4CEE A;  1TKX A;  3CMA N;  3VER A;  4BRL A;  1XHX A;  4KI6 A;  1J53 A;  3CJ1 A;  4PKG A;  3BP8 A;  4JHD B;  1T8E A;  2PBD A;  4FLT A;  3TAG A;  1KXP A;  2D5R A;  4FWQ A;  4O0J A;  1TAQ A;  1KAZ A;  4FJL A;  2A5X A;  4Z94 A;  5C42 A;  1TL1 A;  4K41 A;  4BDZ A;  3VEW A;  1HYZ A;  3U3G A;  1QVF M;  4CJ3 A;  2BGG A;  4IJN A;  4BVO A;  1SQK A;  3KK7 A;  1F21 A;  1D5A A;  3QEP A;  1OH8 A;  1NG9 A;  5AQL A;  4I9L A;  5F0X A;  4KRF A;  2YNI A;  2HVH A;  3ZET A;  4CGF A;  2NRR A;  4ID1 A;  1RBV A;  3C65 A;  3QDK A;  2Q36 A;  4E1J A;  4M7Y A;  3JXU A;  3L2Q A;  1NGJ A;  4CW7 B;  4IO9 L;  2YNH A;  1ESV A;  4C8M A;  4OLB A;  3VF6 A;  1YT3 A;  1TYQ B;  2IS3 A;  4JEP A;  3OY9 A;  1S1U A;  1EXQ A;  4OGE A;  4CJV A;  2KFZ A;  1JCG A;  3E9P A;  4MDA A;  3B6O A;  1U45 A;  4H0V B;  1KVB A;  3G10 A;  4M41 A;  1XWL A;  2CGL A;  3CCR N;  3D6R A;  2UUA K;  1QQM A;  1OH5 A;  3L6Q A;  3OYM A;  3F2K A;  2E2P A;  3ZSZ A;  3HSC A;  3MXJ A;  1CZB A;  4JI2 K;  1L5U A;  3O9U A;  3NH0 A;  1LWE A;  4HVJ A;  2WBN A;  4H5W A;  4ILG B;  3TTF A;  4CF2 A;  1YJW N;  1WBB A;  5J2Q A;  4BWJ A;  4LFB K;  2IOC A;  4OKJ A;  4JNE A;  3CIP A;  1VQ6 N;  4J2A A;  2O4I A;  3WQT A;  2O8C A;  3CCJ N;  3OYJ A;  1NK9 A;  2QWN A;  2AP1 A;  4U67 L;  2OPS A;  4ICL A;  2O8E A;  3HI0 A;  1KTQ A;  2P9P A;  4IWV A;  2HND A;  2A1S A;  1CLQ A;  4OKK A;  3J8A A;  4GKJ K;  2DTU A;  1YIJ N;  4I9Q A;  4WF9 L;  3VQB A;  3T7Z A;  3OJS A;  3P38 A;  3DJC A;  3OYE A;  3W3D A;  4C8K A;  2NRV A;  2IIR A;  3G4S N;  4CZJ A;  1SL0 A;  3EN9 A;  3OA9 A;  4PKH A;  1U04 A;  3K57 A;  3EEQ A;  1NK4 A;  3VQP A;  3U8X A;  1HNV A;  2GUP A;  5J2N A;  3BEX A;  4CJU A;  4CCH A;  1D9F A;  4JKG A;  2Q31 A;  3BZK A;  2D0P A;  3R9P A;  3ZSV A;  4CHQ A;  1RDA A;  3QBX A;  3I8D A;  3HPG A;  3VOV A;  2CH6 A;  2E6M A;  1R59 O;  5JIC A;  1VQK N;  4FJ5 A;  3CJ9 A;  2FSK A;  4PKI A;  3OYD A;  5AQZ A;  3QEX A;  3WEE B;  1RFQ A;  3EYZ A;  3QIO A;  2O8F B;  4BC3 A;  4CJQ A;  4M3T A;  2FSJ A;  2XY8 A;  2BAN A;  3MAQ A;  3LP2 A;  3K59 A;  1YXQ A;  3OS2 A;  1I3A A;  2E1Z A;  4XH4 A;  1HR0 K;  3CYM A;  4N76 A;  2ASM A;  3HT3 A;  3LM2 A;  2P9I A;  3WXJ A;  1CZ9 A;  2GTD A;  5HP1 A;  2YI1 A;  4LD0 A;  4DSJ A;  1N33 K;  4E19 A;  3ZX2 A;  4PWD A;  1GLF O;  1NGC A;  2IVO A;  3NAE A;  3KKS A;  2IGI A;  3SQ4 A;  3VQ5 A;  4YDU A;  4DMN A;  1HRH A;  3V9W A;  4FO0 A;  4JKA A;  3OYB A;  3L2R A;  2B6A A;  2UXC K;  4CGG A;  4KHY A;  5J1E A;  3M8S A;  3DXM B;  5KPR A;  1MWK A;  3K58 A;  1XNR K;  2VGM A;  2KQ2 A;  1N6Q A;  1NK0 A;  4DWI A;  3LPU A;  1WOQ A;  2JGU A;  4V19 S;  4N41 A;  4M3R A;  4MFB A;  5AFU A;  4ZHR A;  2HHW A;  2A1R A;  2P9U A;  5GAD P;  3HP6 A;  3VF2 A;  1Z6R A;  4KB1 A;  4EHU A;  3CFP A;  1T7P A;  2RN2 A;  4DQ8 A;  3I56 N;  4AM7 A;  4BAC A;  3CC7 N;  4K8X A;  3DOL A;  1V4T A;  3OJU A;  2VQE K;  2AA4 A;  1NGB A;  4DG1 A;  3CCS N;  1WN7 A;  1WSJ A;  2EHG A;  1NNE A;  1RDW X;  1BCM A;  2HF4 A;  4BRO A;  1S9G A;  3T69 A;  3ULD A;  3PIO L;  2P9K A;  1RBU A;  3SK3 A;  4EZ6 A;  3H1Q A;  4DHY A;  5CY4 A;  1YVU A;  3AVB A;  1Z26 A;  5KGX A;  4Y1D A;  4JS4 A;  4B3M K;  3ID8 A;  1WLJ A;  3KKR A;  4Z4G A;  3MEE A;  5HRN A;  4YNQ A;  2HW3 A;  1M1K O;  5M1Q A;  4B3T K;  4H0X B;  4OO1 J;  1K8A O;  2ETJ A;  4CJ4 A;  3C6H A;  5C10 A;  1D4X A;  3AVA A;  3DOK A;  2ITG A;  3AAR A;  4JD2 B;  5HBM A;  3QEV A;  4FZX C;  3J7A P;  5KPT A;  4IFY A;  3BGR A;  1GLE G;  1WSE A;  4CZL A;  5AQV A;  4AH9 A;  4CF1 A;  4CJ7 A;  2P9P B;  1WUA A;  4DQS A;  1JLF A;  1HYV A;  3GDQ A;  4KHW A;  3O4W A;  3PIP L;  1JL1 A;  4R5P A;  3THX B;  4KI4 A;  1RCH A;  1NGE A;  2PZS A;  4CD3 A;  2Z1G A;  4FWN A;  1NJI O;  1WAJ A;  4YHH K;  5GAH P;  4AHU A;  4FK0 A;  3OYF A;  4RW7 A;  4B1Y B;  2HOE A;  4KHU A;  4H5N A;  4JKE A;  4CF0 A;  3OW2 M;  4CZF A;  4DR3 K;  4Z4C A;  1BUP A;  2X6N A;  3AAP A;  1QVG M;  4CK2 A;  4EP4 A;  1KD1 O;  4JI4 K;  3MK6 A;  4EHT A;  3FFK B;  4CFA A;  1FK9 A;  4Z4E A;  1U49 A;  1NK5 A;  3O4Q A;  5FDL A;  5AQR A;  1HX1 A;  3LDO A;  3MEG A;  1J54 A;  3VA3 A;  2Y1J A;  2QEX N;  3PSF A;  5LJV A;  3S41 A;  4K0K K;  1TUY A;  1HKB A;  1QQN A;  4I6M A;  1TK0 A;  2HHS A;  1VQ5 N;  3OS1 A;  3RTV A;  1EQY A;  1X9S A;  3G0Z A;  1WAF A;  3NF8 A;  3V1R A;  1VQ9 N;  1WSH A;  1HMV A;  2CGJ A;  1QZ6 A;  1YAG A;  5AQM A;  3IAY A;  1RT2 A;  4JRP A;  1TK8 A;  1CXQ A;  4OPH A;  4KKO A;  3LDP A;  4ID5 A;  3BF1 A;  2P9N A;  1HPM A;  2UYT A;  1GOB A;  3CCL N;  2E2Q A;  3LP3 A;  4CGI A;  3ENB A;  1L3U A;  4BRD A;  4R79 A;  5CZ2 A;  1A5W A;  4KTQ A;  2KHO A;  4NB4 A;  2Y1I A;  1NLV A;  3C7N B;  4KV8 A;  2OPQ A;  4B3S K;  1ASV A;  4JKD A;  2KZZ A;  1S3X A;  3H08 A;  5CZ1 A;  4I2P A;  3VEV A;  4K42 A;  2F7T A;  3AVK A;  2YKN A;  5LL6 Z;  3VTH A;  4BR9 A;  2QA4 N;  2P51 A;  4J8F A;  3KK1 A;  3VTI A;  5AQP A;  3DM2 A;  2F9T A;  2FBY A;  5HL7 L;  1HQU A;  2D4W A;  3H6E A;  2ASO A;  3OYL A;  1J9A A;  1T05 A;  3DLH A;  2WON A;  4DFM A;  3SI6 A;  1YHQ N;  1IO2 A;  4IEE A;  2HF3 A;  3ID6 A;  4CZK A;  4OVL A;  3BY5 A;  3O4N A;  3WNG A;  3LPT A;  4RW4 A;  2VWJ A;  2VGN A;  1O13 A;  4FJI A;  1Q18 A;  1XI1 A;  3I0R A;  3KTQ A;  2XY5 A;  3QFP A;  3Q7C A;  1IBM K;  4OX9 K;  2I7P A;  3HTV A;  1BWF O;  5EY4 A;  5FPD A;  2P5O A;  4CEO A;  2YCH A;  2BE2 A;  3LL3 A;  1RIL A;  1X9J A;  1S22 A;  2Z1I A;  3L2U A;  1KAX A;  2JLE A;  1NOY A;  4J2E A;  1M90 O;  2OZM A;  4FZY A;  4B1W B;  3C0B A;  1BU6 O;  3SZ2 A;  1YF5 L;  5AFU H;  5LY3 A;  2PFU A;  3C94 A;  3ZSW A;  5HRR A;  1JLQ A;  1V4S A;  4OPK A;  3CFO A;  1GOA A;  3ISN C;  5KRT A;  4FJH A;  2YV0 X;  3EE9 A;  2FF6 A;  3M8P A;  3VQE A;  5JMV A;  3LWL A;  4FJJ A;  4FJK A;  4IKF A;  1GLD G;  4CER A;  1WBD A;  3VEZ A;  3M6G A;  3LAL A;  5BPM A;  2XO7 A;  3IDH A;  1TVR A;  1UWB A;  4CJW A;  4NYF A;  4H03 B;  4F9O A;  1NK7 A;  1NK6 A;  3KLG A;  5DM7 L;  1ASU A;  3TAE A;  1LCU A;  3ZSY A;  1NGD A;  5BR8 K;  3THY B;  4HTU A;  3HM8 A;  3MWT A;  4B9Q A;  4Q0B A;  3EL2 A;  5D3G A;  4BRK A;  5A2Q O;  3FE1 A;  4CF8 A;  3DXK B;  3U4L A;  2WFB A;  1T3V A;  1NMN A;  3VQD A;  4M63 C;  2HNZ A;  3ATV A;  3OVN A;  2ZGZ A;  4PQU A;  3EKU A;  4BGB A;  5AQX A;  2KW4 A;  1IH7 A;  2UUC K;  3RR8 A;  4IDH A;  5E26 A;  2IDO A;  4CVN E;  3E66 A;  3C6U A;  5JLF A;  3K5M A;  1C0G A;  4LSN A;  1IKX A;  3RMA A;  3CCV N;  4A62 A;  5LMN K;  4WE1 A;  3EKS A;  3N4P A;  1RT7 A;  1DTT A;  1KVC A;  4CBX A;  2A42 A;  3ZX3 A;  1S72 N;  4O8U A;  3LDN A;  2QI2 A;  4LF9 K;  4FWO A;  2G8I A;  4YOV A;  1D8Y A;  2ITM A;  3JSM A;  1NJY A;  4FJX A;  4B9S A;  4CJE A;  4ISG A;  3DLL L;  2DFH A;  2Z1J A;  5FRO A;  3ZEU A;  1U47 A;  3P1G A;  2YNF A;  4FXD A;  1GOC A;  1VSH A;  3S3O A;  3L3U A;  4HCB A;  5AZI A;  1Z05 A;  4DLG A;  3ZT3 A;  5EOY A;  1BI4 B;  1T03 A;  4FLY A;  2GWK A;  4JKH A;  3SJH A;  2F8T A;  3ZT1 A;  4CZI A;  4CHO A;  4BR4 A;  3NH1 A;  1NKE A;  1BA0 A;  3KJV A;  3M3Z A;  2VG6 A;  3IUC A;  1HLU A;  5H1S Q;  3WQU A;  1WSF A;  4H5V A;  1VK0 A;  1C0U A;  4EP5 A;  3JYT A;  3UKR A;  5HOO A;  1GLJ O;  4DLE A;  3RMB A;  4H0T B;  4E1N A;  3SV3 A;  4DTJ A;  3NF7 A;  4CJR A;  1JLE A;  3QLH A;  4DR4 K;  1VSD A;  4FJ8 A;  2FLO A;  4C8L A;  1XQS C;  2VWK A;  4YOT A;  4IOX A;  4C8N A;  2VYP A;  3NMU A;  4BRI A;  5AQQ A;  2RKI A;  3CHW A;  3NDK A;  3UKU B;  1GLC G;  2HBM A;  1BIU A;  4DF8 A;  1SZ2 A;  2HHX A;  4EAH D;  4NLB A;  4HTL A;  4BRA A;  5C25 A;  4M42 A;  5BN8 A;  3QNN A;  2KTQ A;  4H0O A;  1S1T A;  1VAZ A;  3GBT A;  1C0M A;  3FR0 A;  3R6M A;  5AZJ A;  3CC2 N;  5F2R A;  1RBS A;  3O80 A;  2IAJ A;  4CED A;  3MN5 A;  3A5L C;  1U2V B;  3SQ2 A;  2B4J A;  4CJF A;  1RT5 A;  5FPE A;  1ZXO A;  3CXC M;  1S1X A;  4PA1 A;  4CHN A;  3A8Y A;  2O8B A;  3SUP A;  3D2E A;  1VQO N;  4O5F A;  1ZBH A;  2PYL A;  2CGK A;  4CJ5 A;  1JLA A;  4CHY A;  1RDD A;  3U6F A;  5LMU K;  2HST A;  4FOE A;  1TL3 A;  3PSI A;  4LFC K;  4B1Z A;  3QET A;  1YJN N;  1VSM A;  1N8R O;  4X62 K;  3V1Q A;  3EE8 A;  4JS5 A;  2OTJ N;  4W5N A;  2IVN A;  1RDC A;  1VSF A;  1ZBU A;  2NRH A;  3QML A;  1IG9 A;  2IVP A;  2HHU A;  4DFP A;  5EU7 A;  4CEA A;  3V4I A;  5AQI A;  2YHB A;  3OYI A;  3TU5 A;  4BE2 A;  2D0A A;  4KAZ A;  3A0I X;  3DRR A;  1NMD A;  1KSP A;  4DUZ K;  5IT9 O;  2UXD K;  1BDG A;  3NF9 A;  3SBT A;  3O9R A;  2E6L A;  4F2R A;  2QKB A;  1YVN A;  2QW9 A;  2JWK A;  3TR8 A;  1KCF A;  3A5O C;  3ENO A;  5I42 A;  4ELV A;  1HNX K;  2O4G A;  1W2B M;  4KFB A;  2ZWH A;  5DM6 L;  1RDU A;  4FL9 A;  1VQ7 N;  3KVG A;  3CJC A;  4DR2 K;  4NYN A;  5AQW A;  3RSE B;  1OKJ A;  3K0S A;  1N34 K;  1K6Y A;  4CEQ A;  2GBZ A;  4BGA A;  3C6A A;  4ISE A;  4AM6 A;  1NKC A;  4DQP A;  2G8K A;  4H8K A;  4CGJ A;  2Q0U A;  1RBR A;  2NZT A;  3LWM A;  1J5E K;  3V9U A;  3L4Q A;  4QAG A;  4FM0 A;  3H45 C;  1JL2 A;  3IS9 A;  4IO8 A;  1VQP N;  5C24 A;  2YHA A;  4DSL A;  3KWI A;  5EXW A;  3A2F A;  4X66 K;  3ZSX A;  3CET A;  3M8R A;  1NWK A;  3VA0 A;  3ZT2 A;  3AA2 A;  4B1U B;  4FSV A;  4CEB A;  3THW A;  3SNN A;  4KHN A;  1G15 A;  3GL1 A;  5AZI B;  1LAW A;  1K73 O;  4CHZ A;  1CZA N;  2OTL N;  3WNH A;  3DWL A;  4BR5 A;  4O5B A;  1VSJ A;  2OA8 A;  1C1A A;  4BE1 A;  4E89 A;  4C1N K;  2CH5 A;  3NFA A;  2QXF A;  3LZI A;  3JAM O;  4CBU A;  2A6A A;  4BRQ A;  3E9O A;  3T1Y K;  4QS7 A;  4YDU C;  3AVM A;  3FZK A;  4B9V A;  1HYS A;  4LF7 K;  1YIT N;  1BHL A;  4U7B A;  4YOR A;  3ZET B;  3WXK A;  4RTF D;  3LAM A;  1XC9 A;  4CFB A;  1S1W A;  4JI7 K;  1TKT A;  4WFN L;  4HUF A;  4CEZ A;  1TGO A;  4DTM A;  2UU9 K;  4N56 A;  3PO5 A;  3TI0 A;  4K25 A;  5FRM A;  3PX0 A;  4O0I A;  4FWK A;  5JVG L;  3DLR A;  2OPP A;  2HHV A;  4M3Y A;  5AZJ B;  3R8E A;  3J80 O;  4JK9 A;  3ASM A;  5I3U A;  2VCP A;  3M1F A;  4CES A;  3HRG A;  2OAN A;  4MDB A;  4B8C A;  5BN9 A;  4WCE L;  2HBJ A;  4CE9 A;  4FW2 A;  2YNG A;  5HRO A;  4GV9 A;  3RRG A;  1SL2 A;  4C1N I;  1QSS A;  3ZYY X;  4DUY K;  3HOT A;  3ZT4 A;  1HJO A;  3D2E B;  2W6L A;  1KRP A;  3KD5 E;  3A5N C;  5AQS A;  3VEN A;  3KLH A;  3L8B A;  3NHG A;  3KLE A;  4MQ3 A;  5CE3 A;  1KFS A;  2E1Y A;  2ZE2 A;  1MU2 A;  4AHS A;  1RT4 A;  3HPH A;  3BUZ B;  3N4Q A;  3MX5 A;  2ZJR L;  4BRP A;  4ELT A;  1DGK N;  4IXC A;  2O8C B;  1FKO A;  3V9X A;  5GIP A;  3MMV A;  4FK2 A;  1BL3 A;  4OGC A;  3CG7 A;  3QEI A;  4DV1 K;  3V81 A;  2DY4 A;  2O8E B;  1IKY A;  4O4G A;  4BVP A;  3AO4 A;  4EFH A;  1BGX T;  5SZT A;  3DYA A;  4CEF A;  3NVM A;  4OLA A;  3HZ6 A;  2RPI A;  1B9D A;  3FZH A;  1IKV A;  4DFK A;  3PX6 A;  1KFD A;  3MDQ A;  3TAQ A;  4DCH A;  1IBK K;  1ZBF A;  3LP1 A;  4M3W A;  2FC0 A;  3GG4 A;  3QBW A;  4DQI A;  1JLC A;  1FW6 A;  2QK9 A;  1P8Z A;  1NK8 A;  3CCM N;  1BIS A;  4JKG B;  4DF4 A;  1YTU A;  2GX9 A;  3CFR A;  3G71 N;  5CR4 A;  1OVY A;  3TWH A;  5BRH A;  1EO1 A;  3D45 A;  2ATQ A;  5EX5 A;  3D2F A;  4DFJ A;  4BQZ A;  2VG5 A;  1TK5 A;  3LP0 A;  4JKB A;  3K5N A;  1S9E A;  2Q1N A;  3P39 A;  3GOI A;  2XY6 A;  4M3Z A;  1WNS A;  3J7Z O;  3AV9 A;  1K8K A;  5FPM A;  1BG3 A;  2P9L A;  4FW1 A;  3SMS A;  1YJ9 N;  2P5G A;  3LDS A;  4B9N A;  4CZE A;  1X9W A;  1W0H A;  1QHT A;  3A5M C;  3J7Y P;  2P9I B;  4KB0 A;  3QES A;  2ASP A;  3KHY A;  3KK2 A;  4FWR A;  3V6D A;  3ZLJ A;  4DV5 K;  4A5A A;  2QWM A;  3O3H A;  1E4G T;  4HUG A;  2I7N A;  4B8A B;  4IFV A;  4BQL A;  4E7L A;  1JJ2 M;  3O8M A;  5M1N A;  1Q81 O;  4IOA L;  5AQU A;  3SAF A;  1NJX A;  1JLG A;  5EVZ A;  2PY5 A;  1TAU A;  1Q82 O;  2P9S A;  3CM6 A;  1FXX A;  4IG3 A;  3VF4 A;  1NBW A;  2BH1 A;  4JK7 A;  3QFU A;  5KPZ A;  3NGZ A;  3IG1 A;  3SYZ A;  1MA9 B;  3AAQ A;  3VEX A;  5DK5 A;  1RT6 A;  2V52 B;  2P9U B;  5BRF A;  2G8U A;  4DSI A;  4JHD A;  4BR7 A;  2VG7 A;  2E2N A;  3FGU A;  3P4I A;  3P5J A;  3TTC A;  1RTD A;  4JRQ A;  1SV5 A;  2F8S A;  3WT0 A;  4E7K A;  5M1O A;  1I39 A;  5JS2 A;  1S6P A;  5ADX H;  1HUX A;  2NRZ A;  1EET A;  1RTH A;  4KHQ A;  3HST B;  1QQC A;  4WYB A;  3ZSR A;  1Q86 O;  1A5X A;  3K5O A;  4CJT A;  4DV2 K;  3HPO A;  4DR6 K;  1NGG A;  3KD1 E;  4FVM A;  1TKZ A;  4FWL A;  3M5R A;  3VN5 A;  2P9K B;  4HWI A;  4DU1 A;  1YTA A;  4FPA A;  3VQ6 A;  4IFE A;  3QNO A;  4AHV A;  4NCG A;  4MO5 A;  4GKK K;  3WNE A;  1TYQ A;  5DMR A;  5GIN A;  1HNZ K;  4DV7 K;  4XIU A;  3DI6 A;  3RWU A;  3MED A;  2EWS A;  4RCH A;  1ATR A;  4PL7 A;  2P1J A;  1UA1 A;  4DTR A;  4JKF A;  1SL1 A;  1KQS M;  1SKW A;  3MN6 A;  4KRE A;  4FJN A;  4DR5 K;  5TKW A;  3AVC A;  3RMC A;  3F9K A;  1EWQ A;  1IBL K;  2HHH K;  4BC4 A;  1LWF A;  5C12 A;  1S1V A;  4DQR A;  2D1K A;  4FM1 A;  1IJJ A;  3VQQ A;  4B1X B;  3PY8 A;  1L3S A;  4B9T A;  4M3U A;  4BY9 C;  3L2V A;  5AR0 A;  3RVC A;  1R0A A;  2KFN A;  3DMJ A;  2F4V K;  2YKM A;  3P31 A;  2AJQ A;  3ZSQ A;  5FLX O;  3SUQ A;  1YI2 N;  3R3L A;  1DLO A;  2G8F A;  4KBO A;  3CQY A;  2ZD1 A;  4CIG A;  5HRS A;  3CQX A;  4KPY A;  4X64 K;  4N47 A;  3AY9 A;  2WUS A;  3HBT A;  3WXI A;  3AVI A;  4Z4I A;  3HO1 A;  1YUW A;  3HVT A;  4Z4F A;  4OJR A;  3WNF A;  4XH5 A;  3QO9 A;  3T1H K;  4NO7 A;  4OKE A;  5TKY A;  4F4K A;  4IDK A;  4RW8 A;  1MWM A;  4KHP K;  4PUO A;  1HKG A;  4B9L A;  4CJS A;  1GLL O;  3CQ8 A;  3T19 A;  3TAM A;  1RBT A;  1N36 K;  1JXB A;  5C0Y A;  4BRH A;  4I6M B;  4DTX A;  2EX3 A;  1JCF A;  4O44 A;  3R1X A;  3K9K A;  1XMO K;  4YOW A;  5AQF A;  1EX4 A;  4H5R A;  4DKW A;  2BUP A;  5AQN A;  4DR1 K;  3CJA A;  4DU4 A;  3I33 A;  2JWL A;  3WXM B;  4RW9 A;  4DTO A;  1VSL A;  3AVF A;  1NKB A;  3TAB A;  2P9N B;  3I0S A;  4CFD A;  4QCL A;  2XRI A;  3O08 A;  4KHS A;  4NXM K;  3WEE A;  4A2B A;  3VPZ A;  4GV3 A;  3DLK A;  4NLC A;  4LC9 B;  4DTU A;  2O8D A;  3O9Q A;  3S3N A;  3PV8 A;  4RG8 A;  4MLH A;  3AO5 A;  3NVK A;  1VQ4 N;  1X3M A;  2WTU A;  2J4R A;  4PHT X;  4M7X A;  3KLI A;  3OTO K;  4KTW A;  5KQD A;  2HHQ A;  5M1P A;  5C2F A;  3CME N;  4IG0 A;  1UAX A;  3ATU A;  5ELZ A;  3VEY A;  3LM9 A;  4C23 A;  4DV3 K;  1HKC A;  4AF1 A;  3O1B A;  4KH6 A;  3U9D A;  4AHR A;  5BPL A;  1U6Z A;  3PX4 A;  3D0P A;  3TSU A;  4Q5V A;  1DEJ A;  1TUU A;  5JLH A;  4FVU A;  4FLV A;  2A40 A;  2X6S A;  4AHT A;  3SPZ A;  4JI8 K;  4LF4 K;  1ZBI A;  3DXM A;  1XC3 A;  2G8H A;  1BQM A;  3D7E O;  3L3V A;  3IKM A;  4J2B A;  1TV6 A;  2BDP A;  4I2Q A;  5KTQ A;  5I9E B;  4A5B A;  4KTZ A;  1NGA A;  4FJM A;  1D9D A;  4DSK A;  4FK4 A;  4L8R B;  4W5Q A;  3IMX A;  3H3N O;  2RF2 A;  4DU3 A;  5AJ3 K;  4UQG A;  4HHT A;  2XHB A;  3H3O B;  3O3F A;  1SKS A;  3OYA A;  1LV5 A;  3FZL A;  4DTN A;  3GE1 A;  2G8V A;  4JV5 K;  3BF3 A;  3NGI A;  2F9W A;  2GWJ A;  4CHP A;  4ILH A;  3AVG A;  4A57 A;  4FOI A;  5CHI A;  1JCE A;  5HLF A;  4FLW A;  4GVE A;  3SQ1 A;  3QIC A;  3CCE N;  4CBW A;  4QS8 A;  2QWL A;  5HRP A;  1ITG A;  1QQO A;  2QXL A;  1KC8 O;  3P83 D;  1WSI A;  4CJL A;  2R7Y A;  5T7B A;  4W5R A;  1OVQ A;  1RGI A;  2Q0R A;  4JKC A;  3TAN A;  2GV9 A;  1QZ5 A;  2NRW A;  5AQY A;  1VRU A;  3CCQ N;  4JD2 A;  3L0Q A;  2HMI A;  4JN4 A;  3H1V X;  2XY7 A;  2UXB K;  4TSX A;  1W7A A;  1N5Y A;  2KLA A;  3HYF A;  4CGH A;  4IBN A;  2ZJP L;  4DQQ A;  2E88 A;  4G9Z A;  3OYH A;  4BRF A;  4M3X A;  4GV6 A;  1T6D A;  1HNI A;  2E5L K;  1JKH A;  3ZSO A;  2D0O A;  4F3T A;  4BG9 A;  3THX A;  3S9H A;  1NGF A;  1S5J A;  3SCX A;  2A3Z A;  1RTI A;  1LOT B;  4HCC A;  4JI6 K;  1FKP A;  3AVN A;  4K43 A;  3MCA B;  4FZZ A;  2X78 A;  4JLH A;  4LF8 K;  4BDY A;  4ZTJ A;  3DLE A;  3I8B A;  2NRX A;  3J81 O;  2GEL A;  3MX2 A;  2D0B A;  1BO5 O;  1B92 A;  3C6T A;  5BRD A;  4KH5 A;  4BE0 A;  1C6V A;  2NRT A;  3M8Q A;  3VQC A;  2KKZ A;  2LSN A;  3LDQ A;  3AVJ A;  3O5B A;  1A5V A;  2Z1H A;  3SAH A;  4ISF A;  4C8O A;  1S6Q A;  4GW6 A;  3V1O A;  2QKK A;  2YHX A;  3ZEU B;  2O8D B;  3HVR A;  4I7F A;  3RMD A;  5ADX A;  2ZQB A;  1KLN A;  1NOZ A;  3DLG A;  4E7I A;  5GIO A;  1VQL N;  1W9H A;  4LF6 K;  1QSL A;  3SPY A;  3MXI A;  4B08 A;  1E3M A;  2W42 A;  3ZT0 A;  5J2M A;  3SJJ A;  1IV0 A;  1L3V A;  3MN7 A;  3F5T A;  2WC9 A;  4LF5 K;  1B9F A;  2Q2R A;  3Q7B A;  2QM1 A;  4EZ9 A;  5FRN A;  4H0P A;  4LY7 A;  4KO0 A;  4BRN A;  1HJR A;  3HP9 A;  2QWQ A;  1LWC A;  3F9M A;  4DS5 A;  4O8K A;  2ZM6 K;  3C7N A;  5E41 A;  5IWA K;  1Q7Y O;  3OYK A;  4ILJ A;  4Z4H A;  3VQ8 A;  4DSF A;  3UKR B;  1JLB A;  4H0Y B;  4YFU A;  4DV6 K;  1Y64 A;  3LAK A;  1SUQ A;  4M45 A;  1EP4 A;  3ALY A;  3OBY A;  4B1V A;  4JK8 A;  5M1F A;  5B8H A;  1OH6 A;  3RRH A;  4LSL A;  5AQH A;  1XNQ K;  3VQ7 A;  3CCU N;  3NCI A;  4LH4 A;  3W0L A;  2I5J A;  2Q3S A;  3NE6 A;  2V51 B;  3VQ9 A;  2RHK A;  4YY3 K;  2HBL A;  1MDU B;  4JI5 K;  4WFA L;  3ZX0 A;  2ZGY A;  4CGD A;  3O9T A;  3OYG A;  4IZ9 A;  2E20 A;  4AHC A;  3WXL A;  4CI6 A;  2A41 A;  1RT3 A;  2FBT A;  1XMQ K;  1ILY A;  5BPN A;  5KQ8 A;  2HBK A;  1REV A;  3CI5 A;  1NGH A;  3O9S A;  3B6P A;  2FBV A;  5CYM A;  2NLX A;  3QEW A;  3AGK A;  1P90 A;  4CF9 A;  3O1W A;  2E8A A;  1CXU A;  2YHY A;  3CER A;  1EKE A;  4CK1 A;  2O8B B;  3ULE A;  3CJB A;  3OYN A;  1RT1 A;  3U9Z A;  2H3G X;  1Y97 A;  3TSP A;  3SMP A;  1NJZ A;  4BC5 A;  3NGY A;  3AVL A;  3TAP A;  1C1C A;  4F3O A;  3NH2 A;  1VRT A;  5GAE P;  1X9M A;  3OBW A;  3DAW A;  3K9J A;  4E3S A;  5AQK A;  1BQN A;  2V7Z A;  2V7Y A;  4DV4 K;  3VQ4 A;  3V9Z A;  4FLU A;  3MEC A;  5JVH L;  4B3O A;  4AQY K;  3QIN A;  1ZBL A;  3VQA A; 
#chains in the Genus database with same CATH homology
 4LF7 K;  4LF6 K;  4DR1 K;  4DUZ K;  5IT9 O;  2UXD K;  4JI7 K;  4LF5 K;  4JYA K;  4DR7 K;  4NXM K;  4CW7 B;  4GKK K;  4JI3 K;  4NXN K;  5BR8 K;  1HNZ K;  4DV7 K;  2UU9 K;  1HNX K;  4B3M K;  4JI0 K;  2ZM6 K;  5A2Q O;  5IWA K;  1I94 K;  4B3S K;  1HNW K;  4B3T K;  4DR2 K;  3J80 O;  4DV6 K;  1HR0 K;  2UUB K;  4LFA K;  4B3R K;  4DR4 K;  3OTO K;  3J7Y P;  2UUA K;  4DR5 K;  1N34 K;  3J7A P;  5LL6 Z;  1N33 K;  2UXB K;  1IBL K;  2HHH K;  4DV5 K;  1XNQ K;  4JI2 K;  4DUY K;  2UUC K;  1J5E K;  4YY3 K;  4DV3 K;  2E5L K;  4JI1 K;  4JI5 K;  1N32 K;  4CVN E;  1FJG K;  4LFB K;  2F4V K;  1XMQ K;  2UXC K;  5FLX O;  4JI6 K;  4JI8 K;  4LF4 K;  4X65 K;  4YHH K;  4X66 K;  4LF8 K;  1IBM K;  5LMN K;  1XNR K;  4OX9 K;  4X64 K;  4DV1 K;  3J81 O;  4DR3 K;  4V19 S;  2VQF K;  4LF9 K;  3T1H K;  4JI4 K;  4GKJ K;  5LMU K;  4LFC K;  4KHP K;  5AJ3 K;  1IBK K;  4X62 K;  3JAM O;  1N36 K;  4DV4 K;  4K0K K;  2VQE K;  4DV2 K;  4DR6 K;  4DV0 K;  3T1Y K;  4AQY K;  4JV5 K;  1XMO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...