4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
b'KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
4DV5K 5FLXO 4OX9K 4LFCK 1XNQK 4CVNE 5A2QO 2UXBK 3T1YK 4LF7K 4NXNK 4JV5K 4DR6K 4B3TK 4JI5K 4JI0K 4YY3K 4DR1K 4DUZK 2UXDK 4JI2K 5BR8K 2HHHK 4V19S 4X66K 1FJGK 1HR0K 4DR7K 4GKKK 4JI6K 3OTOK 4DV6K 4JI1K 4X62K 4X65K 3J7AP 4JI4K 4DR5K 4LFBK 2UUAK 1N32K 4YHHK 3J81O 4JI7K 4DV0K 4DR3K 3T1HK 4B3SK 4DV2K 4AQYK 4LFAK 4DV7K 4LF5K 5AJ3K 1IBLK 4JYAK 4LF9K 2UUBK 5LMNK 4GKJK 1HNWK 3J7YP 1IBMK 4B3RK 1XMOK 4JI8K 3J80O 3JAMO 1XNRK 2ZM6K 2VQEK 1I94K 2UU9K 4DR2K 4DV1K 1N36K 1J5EK 5IT9O 1IBKK 4LF4K 4NXMK 2F4VK 4CW7B 5LMUK 1HNXK 5LL6Z 4B3MK 4DUYK 1HNZK 4JI3K 1N33K 4LF8K 4K0KK 2UUCK 2E5LK 4DR4K 4KHPK 4DV4K 2UXCK 2VQFK 4DV3K 1N34K 1XMQK 5IWAK 4LF6K 4X64K
chains in the Genus database with same CATH superfamily
3THYB 1BG3A 2HF3A 1G15A 5FLXO 5E84A 3LPUA 3U8XA 2UXBK 1ASVA 3KLHA 5HLFA 3D2EB 2BH1A 4FPBA 1EKEA 3AVBA 4IKFA 3O9RA 4FLZA 4CBUA 3KKSA 2ETJA 4CJQA 4UQGA 2VGNA 1SL0A 1G99A 4FWNA 4DTNA 3OTOK 4MDAA 2VWBA 3L0QA 4CI6A 3A5OC 1NGFA 2GUIA 5AQYA 1LV5A 1EQYA 3RMDA 1GLFO 3FZHA 5F1XA 4DR5K 3LP1A 5AFUH 3V4IA 4CJ3A 3C95A 3BZCA 1GOAA 1T05A 3V1RA 3HP9A 3G6EN 3L2WA 3ZT3A 5HL7L 3DXKB 4FJMA 4DHYA 4FZZA 3M1FA 4LFAK 3V9ZA 4ID5A 3TAEA 2IDOA 4A5AA 1WBBA 3F2KA 3V9XA 3IFRA 4I7FA 3THWA 4IEEA 1YVUA 2UUBK 3WXJA 4I9LA 4JK7A 5KRSA 1RDDA 3U3YA 3LDPA 3RVCA 2DFEA 2F9TA 5AQIA 4DMNA 1HYZA 1NJZA 2GV9A 1QQMA 3MX5A 1HJOA 5SWMA 2HSTA 4JAXA 1RBVA 4CJVA 3HPHA 3AVMA 3ZETA 1N36K 1JXEA 1X3MA 4CD1A 3U3GA 4DTXA 3QBWA 2YNFA 1EX4A 4CF8A 2XHBA 2QWRA 1HNZK 1IG8A 4F2SA 5M1PA 4XH1A 3D7EO 2E5LK 2D0CA 3L4IA 2YV0X 4ZHRA 4FWPA 1IKXA 2JWLA 2VGMA 4IG3A 1BUPA 2YJEA 4FOEA 3WXMB 1ZC6A 4CEDA 3C6UA 3EO3A 4DV5K 3M8QA 4DB3A 1RTDA 3M3ZA 4DU1A 1VHXA 1OVYA 2GWKA 4CK1A 1ZBSA 5AZIB 4CF0A 3ZSOA 4B1XB 3UE5A 4AHUA 5TKYA 2OZSA 4DF4A 1SV5A 4CBWA 3OYFA 1WSHA 3UKUB 4OPHA 4X66K 3NF7A 1TYQB 4BC5A 1ILYA 4CEFA 4CZMA 3MXJA 2Y1JA 3O08A 1U4BA 4BRPA 3B8AX 1VSKA 3SV3A 3TPQA 4N41A 5LJVA 3DOKA 2OZMA 1NK8A 4CZEA 3PX0A 1ZBLA 5HRSA 1HMVA 2IC3A 2ZE2A 5GIOA 4BRCA 4RW7A 4DR3K 2FBVA 5KPTA 3SUPA 3OBYA 5AZJA 3K5NA 3NH0A 3HRGA 2Q0UA 4JKGA 3H46O 4CZGA 1VSLA 4H0XB 4BRDA 1GLLO 4CZJA 4KB1A 2PY5A 1BWFO 3VEYA 3TU5A 4FJXA 5H1SQ 4FJ8A 4BRGA 5AQXA 5C12A 2ZF5O 2A3ZA 2WONA 3ZX3A 3AAPA 5FPEA 4BWMA 2P5OA 2YHAA 3AVJA 2Q97A 1X3NA 4O55A 3VQAA 2YNIA 4H0OA 4JS5A 1B9DA 4DR2K 4A57A 3DXMB 5IT9O 2O8CB 4JKDA 4E3SA 3ENBA 1U48A 1S3XA 5CYMA 2HB5A 1ATNA 3I0RA 4O5FA 4PKHA 3BF1A 2P9LA 2O8EA 4DQ8A 4Z4CA 1HUXA 4JHDA 1GOCA 5F0XA 2VQFK 3MDQA 3MEDA 1QZ6A 3I55N 4PA1A 3RMCA 2QWLA 3ZT1A 1KAXA 2YJFA 3QNNA 4K25A 3CCSN 3L4QA 2P9UA 4KHNA 4DG1A 4I9QA 3C7NB 4H5VA 1K9MO 3ULDA 5T7BA 4KI4A 3V1QA 4DLGA 2Z1IA 1WSFA 3CCUN 1NJXA 5AQLA 3KK2A 3DJCA 4IFVA 3EY1A 1DTQA 4KH4A 3E01A 2GWJA 5I9EB 2O8BB 1FK9A 4MO5A 4CIEA 2WFBA 1QSLA 1DGKN 4C23A 1HRHA 3SZ2A 1MDUB 4LFBK 1IKYA 3VESA 3WNGA 1YJ9N 4B1WB 3QBXA 1S1TA 1RT3A 3I8DA 3HI0A 5BRHA 1LWFA 1C0MA 3AA2A 1IKWA 4DV2K 4WQ4C 4DTRA 2PYLA 3Q7CA 1W97L 4JKHA 1QSYA 4BDPA 1JLEA 4DQSA 3ZSQA 2FSJA 4DCHA 2GUPA 1NJWA 4RW6A 5BRDA 1L3TA 4H4OA 1VQ8N 4GKJK 2OPPA 2EHGA 2RHKA 3A5LC 3VQ4A 3CIPA 4KO0A 3SQ2A 4BDYA 1O1WA 3J80O 3E1YA 3O3HA 1TK5A 2QWOA 3LM2A 1Z05A 5ADXA 3AVNA 2YNHA 2QK9A 1ZBFA 4RW4A 4RCHA 4JEPA 3R1XA 3GG4A 4FLTA 2FXUA 2QM1A 2AJQA 5AQGA 4BR7A 4CFAA 3CCQN 2DTUA 3NCIA 4B1VA 3VGKA 3TAPA 1IG9A 2HMIA 1JLBA 4U67L 4KV8A 4QS7A 4BVOA 3ZSZA 4CJ4A 4ICLA 5M1QA 1Q86O 3QLHA 4E7LA 3CCEN 3KD1E 4YOWA 1GLDG 1EP4A 3KLIA 3MN9A 4Z0UA 3VQ7A 1NK4A 2HBLA 1S9GA 4XEIA 4B9SA 1L5UA 4B8CA 3NH2A 4JV5K 5CZ1A 4M3WA 1XC3A 2FF3B 4JKCA 4EZ9A 3ZYYX 4DSFA 5JLFA 1J5OA 3CQYA 1BI4A 1RT6A 3O8MA 1IKVA 3MXIA 3C6HA 4GV9A 1X9JA 4FJ5A 4MQ3A 3SQ1A 2QA4N 4WQ5C 4F4KA 4FLUA 1O13A 5CR4A 3H08A 3DRRA 5FPDA 4CESA 3J7AP 2QWNA 3RR8A 1T6DA 2NLXA 3F73A 5C2DA 4ILJA 4DWIA 3K2PA 4FWSA 5MLCQ 4KHYA 2A40A 5HP1A 2NRXA 4YOUA 4FJHA 2R7YA 4AHRA 4ILHA 4AQYK 5LY3A 3THYA 4CGIA 3MN7A 4W5RA 2GEMA 4LF9K 4C8LA 3NVKA 2Q3SA 1VQ4N 3CJAA 3FZFA 1RT5A 3SQ0A 1VAZA 4C8NA 3D2EA 4B08A 4DQPA 3M8RA 1GLJO 5EOYA 3ZT2A 3FGUA 4M7YA 2D0PA 3P1GA 2IOCA 2RF2A 1VSHA 3C6TA 2O8DB 1TUUA 2P9LB 5TKWA 3OYIA 4JHDB 3NF6A 4Z94A 1W0HA 1WSGA 2YI1A 3L2QA 2HHWA 2BDPA 3R3LA 5C24A 1VQ5N 2KFNA 4FM1A 3ENOA 3WXKA 4IWVA 3IS9A 2YKMA 4B1YB 1NG9A 2LSNA 3FLCO 1GLEG 4EHTA 3JSMA 5E41A 2B6AA 3L3VA 3CM6A 1MWKA 1JL2A 5A2QO 4Z4GA 3KHYA 1TAUA 5J1EA 2FSNA 1C0GA 3VGMA 3ZLJA 1HKCA 2E1ZA 4DR1K 5KPRA 2A5XA 5AQJA 3PSIA 4B1ZA 1A5XA 3ASMA 5C42A 3OYHA 4GKKK 2A41A 3HPOA 1FKPA 1RDCA 4O4GA 5C15A 4CJRA 1F21A 1RBTA 1XWLA 3THVA 4HTUA 4TSXA 1XQSC 1NGEA 3TI0A 2JGUA 3WEEB 4AHTA 4BGAA 2E2NA 3TANA 4E1NA 1K6YA 1MU2A 3AARA 5FRNA 4E7JA 3SNNA 3K9KA 4QS8A 2HBJA 4WFAL 3ZT0A 3TSQA 2KZMA 4BRKA 3VQ6A 2HVHA 4O0JA 2ASMA 4IFYA 2HHXA 1IBLK 1A5WA 2VG6A 3DLGA 3EN9A 3P5JA 1N6QA 2IVNA 5GINA 4DQRA 3SV4A 1CZBA 3AGRA 3EZWA 1KSPA 3CXCM 1YUWA 3DAWA 3UKUA 4B3RK 3ENHA 2FBTA 5KQ8A 1TYQA 2X78A 3HK2A 3DLKA 1E4GT 2PAVA 1YF5L 1C6VA 5AQUA 3LZIA 2P9IA 1U45A 1RBSA 4HUGA 5FDLA 3LDOA 2A1RA 1UOCA 5BREA 3HVRA 3V9SA 1KLNA 4LH4A 3WNFA 3L6QA 4NXMK 4YOVA 2F4VK 3VA0A 1OVQA 2VG7A 2KFZA 1XC9A 4LF8K 4BE0A 1KVAA 4M3RA 3AAQA 4E7IA 3AVIA 3K0SA 4BVPA 3IDHA 4AHCA 3JS6A 4DFKA 4ILGB 4H0PA 5FROA 4BROA 4FZXC 3OS2A 1U49A 1BHLA 3O9TA 5J2MA 4W5NA 3PLAA 4RW8A 3O9SA 4GY2B 3MK6A 2KZZA 3SJJA 3EE9A 4WCEL 5CE3A 4BC2A 4UY8O 3OYMA 4PUOA 1VQ9N 1S9EA 4JI2K 1TKZA 3DXMA 4LH5A 4CJSA 3AO5A 2QWQA 1T7PA 1YVNA 2O8CA 4ELVA 3TTCA 2OYQA 3BDPA 4JI1K 3W3DA 5J2QA 1H1VA 2E8AA 3K57A 4J2BA 3TAFA 3QEPA 1B92A 3SUOA 2KQ2A 3GE1A 1RDAA 2GX9A 3PX6A 3TTFA 2PZSA 1BISA 3CC4N 2O8FB 4CK2A 1HYVA 2QW9A 5AQPA 3QDKA 4NYNA 3C7NA 4JYAK 3UB5A 4OPKA 1LAVA 3O1WA 3M6GA 3GDQA 4KBOA 1IBMK 3CCLN 3VEXA 1RCHA 3R8EA 3Q7BA 5ELZA 3AVGA 1W9HA 3MN5A 4WE1A 2O8BA 2ZM6K 1SS6A 1VQPN 1C0TA 4CJKA 4EP4A 1NGCA 3T1AA 3UKRA 3NDKA 1J53A 3QFPA 3OJUA 3SUNA 3TAQA 1IBKK 4K8XA 1K73O 3TAMA 1W7AA 4MLHA 3LL3A 1TK8A 3O1BA 3NGYA 5AR0A 3U9DA 2HNDA 3E66A 1S6QA 4IOAL 4OKKA 1RTIA 1S5JA 4JKEA 1XHZA 3RTVA 5K14A 2KLAA 2P9SB 1HPZA 2X74A 4Y1CA 3J8AA 4NLBA 1HLUA 2E2OA 4CHPA 1JLAA 1TL1A 4CE9A 1BOTO 2UYTA 5DM6L 4BRIA 5AQSA 4FVMA 2PBDA 3D6RA 4JKAA 3W0LA 3CPWM 4EZ6A 3VQPA 5KRTA 3V81A 4ZTJA 1HR0K 3BUZB 5EVZA 1RDBA 4PQUA 4B9QA 4CHYA 4EAHD 2OA8A 2NRTA 1GLAG 5AQFA 4YORA 1QQCA 1ZBUA 4LY7A 3BF3A 5DMRA 3JYTA 3AO4A 3VF6A 4ISGA 1HKGA 1DEJA 4CJ5A 4L3QA 1VSIA 3TARA 5DK5A 2P5GA 4CGGA 3CMAN 2XY7A 4CECA 2JLEA 2Q31A 1HX1A 1ASWA 3ZCMA 2P9IB 3ZSVA 2V51B 3DLEA 1DT9A 4FYDA 3AVCA 3MXMA 1TK0A 4FZYA 4WQ4A 3MEGA 2F9WA 1LW2A 1CZ9A 2OPRA 4FXDA 4FJNA 1RT7A 2P9KA 4KFBA 2VQEK 4B8AB 3FFIA 4WYBA 1RILA 4LC9B 1J5EK 2P9PB 3U4LA 1L3VA 1TKXA 2ITGA 4KTWA 3T3FA 4E0DA 5LMUK 1VQLN 4LSNA 1TL3A 2W42A 1JXBA 2XY8A 1L3SA 3SPZA 2FLOA 4K0KK 1RT1A 4CJEA 4M45A 3CC7N 3QEWA 3KK1A 4N76A 3SI6A 4KHQA 1QHTA 2GTDA 2JWKA 2H3GX 4DS5A 3NH1A 3VERA 3KVGA 4H0TB 4ELUA 4BRLA 4FWRA 4BR9A 4BG8A 4OGEA 3NVMA 1ZXOA 1QSSA 3O9QA 1BA1A 5E26A 2OPSA 4PKGA 1EO1A 3VTHA 2YCHA 2O8DA 2O4IA 3A5MC 3RSEB 4MDBA 3L2RA 4O44A 5JVHL 2ZWHA 4CZFA 3CCRN 3THXB 5GIPA 1YHQN 3LP2A 2EWSA 1NGGA 4GW6A 1K8AO 2IIRA 4CHNA 5KI6A 3DRSA 1UWBA 2KTQA 3KKRA 3PUFA 1VSEA 3QO9A 3HL8A 4JI4K 4KHUA 3R6MA 1SKRA 1WBDA 1KFDA 2E4LA 4BACA 4MO4A 4JK9A 1S1XA 3BEXA 3TABA 3NMUA 1JKHA 4BC3A 1HPMA 3OYLA 4DV7K 2Q36A 5AJ3K 1ITGA 1IH7A 5FRMA 5AQKA 2OTJN 1P8ZA 3HT3A 2BTFA 3A5NC 4FWMA 1NLVA 3UKRB 3VEWA 1UAXA 4EIAA 1JLCA 1Q18A 4YDUA 5GAEP 3SK3A 1Q82O 3OS0A 4N56A 4O8KA 3HM9A 3PY8A 1XNRK 3PO5A 3M5RA 3FZKA 4JRQA 2IVOA 2Q2RA 4Z4EA 4KHSA 3VENA 3RMBA 3IRXA 3WEEA 4C1NK 4HHTA 1HNXK 3CFRA 3LDQA 2CGKA 3QIPA 3CJ1A 3BY5A 2BGGA 3EL2A 2D1KA 2V52B 1DLOA 3CFPA 3SUQA 2D0AA 1E3MA 4PKIA 5KGXA 1X1PA 1VSFA 4OLBA 5CZ2A 4O0IA 4DKWA 1N34K 4CJTA 3OYDA 1U47A 4IZ9A 5GADP 3VN5A 3VEOA 1C1CA 4Z4HA 1KRPA 4Q5VA 3TSPA 2B4JA 1EWQA 4E7KA 3GL1A 3S3OA 4LFCK 3OYAA 3HJFA 3VQ9A 5JS1A 1VSDA 4LF7K 1QQOA 3NF9A 2WC9A 1Y64A 4NB4A 4YY3K 1E4FT 1ZYQA 3NBPA 1VQNN 1SQKA 5AQQA 4CHZA 4CHQA 1C0UA 1T44A 5F2RA 3SPYA 3ZSRA 3VMFB 1DKGD 2OANA 3CM5A 3VETA 1GLCG 2FBYA 1RT2A 3OY9A 2HNZA 2E88A 4DTMA 2QTDA 2NZTA 4BRNA 1C1BA 3J81O 4C8OA 4BY9C 2RPIA 2P51A 5C10A 4ZTFA 5AQOA 4A2AA 1NK5A 4C1NI 4KTQA 5KQDA 3T7ZA 3CCVN 3B6PA 4FW1A 4FLWA 2P9KB 4I2QA 1YT3A 1JCFA 5J2PA 3S3MA 1KLMA 1U2VA 4L8RB 1NJIO 1D9FA 2XY5A 3HOSA 1HNWK 3LP0A 1SAZA 2NRZA 1JLQA 1R0AA 3ZSWA 1BCOA 2HBKA 4C8MA 1YIJN 3ZEUB 3G4SN 1BL3A 3TR8A 1GOBA 4G1QA 4N47A 3U9ZA 5DM7L 4FK0A 2DPNA 4WFBL 3AO3A 4DTJA 1ESVA 2A6AA 3OYNA 4KI6A 3T19A 4R5PA 1C1AA 3G25A 4DUYK 4E19A 1LWEA 2QXFA 1KXPA 2YHXA 2O8FA 4H8KA 4Y0WA 3QEXA 5JLHA 3O4WA 4CEAA 4FJ9A 3MMVA 1NJYA 5AQRA 1IV0A 1S6PA 1OH8A 2QWMA 3NAEA 3OVNA 3HM8A 3CJCA 4BR0A 4LF6K 1NGDA 1NU0A 5AQVA 2D4WA 4M42A 3OW2M 2ASOA 1WOQA 3LAMA 4FK4A 3FZLA 4Z4FA 4IO9L 1YTUA 4H03B 4BE2A 2HVIA 4V19S 3K59A 3GBTA 3CI5A 3HVTA 1KCFA 2IVPA 5BPLA 1I3AA 2W6KA 3KD5E 4BRQA 4X65K 4B9LA 1HQUA 1VK0A 1NOYA 1EETA 4OGCA 1T3VA 1WLJA 2RN2A 4DSJA 3WUHA 1N32K 4DTUA 5SZTA 4PL7A 3RWUA 3BZKA 4IFEA 4M63C 1XI1A 2P9SA 1NGBA 4FJJA 3KWGA 4H5RA 3I33A 1OH5A 1JJ2M 2PYJA 1T03A 3O3GA 3S9HA 1YI2N 4QS9A 4FPAA 4CZKA 4IG0A 2VWJA 3AGKA 3SBGA 3NGIA 2F96A 3SLCA 4FLXA 2XRIA 4DFPA 2HNYA 4F2RA 4ELTA 4FW2A 4FO0A 4FWQA 3P31A 4LD0A 3ZX0A 1TAQA 4AH9A 3TTDA 1X9SA 4J2AA 4GV3A 4M3ZA 2ASPA 1QS4A 1LOTB 1L3UA 4CGJA 4FWOA 1RDWX 3OHRA 3JXUA 3CJBA 1Q9YA 3HO1A 3B6OA 3TAGA 4K8ZA 4CIGA 2VG5A 1JLGA 3OJSA 4CW7B 2VYPA 1LCUA 2ZJPL 4DU3A 3MWTA 4BE1A 3OBWA 3CHWA 1NK6A 5AQMA 3DLBA 1TGOA 4DS4A 3DLLL 1LAWA 4IBNA 2IAJA 5IWAK 1NKCA 2O4GA 4CEQA 1MA9B 1RFQA 3D2FB 4X64K 4IXCA 5B8HA 4OX9K 2IS3A 2DFFA 4JN4A 4WFNL 3EEQA 4H4MA 1P90A 4CJUA 4W5TA 3O4QA 3WNEA 2FC0A 2UXDK 4KKOA 2HHSA 4NCAA 3AA3A 1NNEA 2P9PA 3WXIA 4YOYA 1DTTA 2BUPA 4CD3A 3WXLA 3H3NO 4GMJB 3OYKA 2WUSA 1BQMA 3MCPA 4EHUA 3PIPL 1QVFM 2AP1A 1U2VB 5KTQA 3D0PA 4JI7K 3AA4A 3LAKA 3P39A 4DSEA 3AVHA 5EX5A 3ATUA 3CMEN 5AQWA 4LF5K 1BO5O 3AO2A 3NE6A 1HKBA 1D4XA 1NBWA 5AFUA 3UIQA 4CGFA 3HOTA 3HPGA 2E6MA 4YOTA 4HUFA 4HCBA 4PY5A 1NKBA 3K5MA 2ZQBA 3SCXA 4FJIA 3RSEA 1Q9XA 2I7NA 4AM6A 3HSTB 3THXA 5FPNA 3ID8A 3P83D 4F3OA 3GOIA 4M41A 3QEVA 3DRPA 2QEXN 2YHBA 2UU9K 2FSKA 4AHVA 3HSCA 4RTFD 3FE1A 3EYZA 4A59A 3FR0A 3DLHA 1NGIA 2P9NA 1CXUA 5JVGL 1J9AA 4JI3K 1QVGM 2OCEA 1VSMA 3V9UA 2QWPA 4JNEA 3SMPA 3VQDA 3VQEA 2GBZA 1ASUA 2Q0RA 1A5VA 4GNIA 5BPNA 1UA1A 2X6SA 3HZ6A 4IJNA 1Y97A 4DV3K 4PWDA 3A8YA 4Y1DA 2E1YA 3VQBA 2HHTA 2RKIA 1Q7YO 3H1VX 1NK7A 5CHIA 4N5SA 4MFBA 1XNQK 2AA4A 4BQZA 3O4NA 1YTAA 3SJHA 1HNVA 1EXQA 4J2EA 4IO8A 1BU6O 1S1UA 4JS4A 4JI0K 1RT4A 4DF8A 1WB9A 3NGZA 3S3NA 5HRPA 4DUZK 1CZAN 1JLFA 4JK8A 4B9TA 3MWPA 4JI6K 1T8EA 4CF1A 1N5YA 3ITHA 4X62K 3RMAA 1YAGA 4CEEA 1M1KO 2VCPA 3SYZA 3F9KA 3SAGA 2E20A 3ULEA 3QNOA 1ATRA 3G0ZA 3NFAA 4GVMA 3QETA 3CG7A 4BC4A 4B3SK 1Z26A 1WSIA 4CERA 2X6NA 2ZD1A 3HTVA 1JCGA 1OKJA 5GAGP 5LMNK 3QERA 2NRRA 3RRGA 4AILC 4O8UA 1JL1A 4BREA 3KLEA 3VQ8A 1XMOK 4CJPA 4OPAA 4JI8K 2V7ZA 3OA9A 4JLHA 4IEIA 1RTHA 3CYMA 2HHQA 1X9WA 4CFCA 4OPJA 2D0OA 5CY4A 4IOCL 3KK7A 3SQ4A 2D0BA 1BQNA 2FBXA 3QEIA 4BRAA 3VEZA 1HNIA 3SAFA 3LPTA 1U6ZA 4KTZA 1B9FA 1C0FA 4O5BA 3H3OB 4CZHA 4EFHA 2YX6A 3ATVA 3V1OA 3VF2A 2Z1JA 3U6FA 2DY4A 4Q0BA 2NNWA 4K43A 1VSJA 3VGLA 4G9ZA 1LWCA 1S1VA 4CF2A 1M90O 1WSEA 5M1KA 3PSFA 3AY9A 2HHVA 1XMQK 3HYFA 1T6CA 3LWMA 3OYGA 4KB0A 3LM9A 1FXXA 1QE1A 2F8SA 4DLEA 4BRHA 2ATQA 3L2UA 3ZEUA 3H45C 4NXNK 4PHTX 4DR6K 5JICA 4B3TK 4CZLA 1Z25A 3WQUA 1NM1A 3AVAA 3G71N 4A62A 5BR8K 4W5QA 4DQQA 1FJGK 4DR7K 1YXQA 5FPMA 1S1WA 2PFUA 5JS2A 3MN6A 3QIOA 3KJVA 4CJWA 2ZGZA 2NRVA 2Q1NA 1NK0A 2HBMA 1K8KA 2ZGYA 2XY6A 3PO4A 3CC2N 1KD1O 4DSIA 4F9OA 3RRHA 1IJJA 4CFDA 1NK9A 1BIUA 4CGDA 1SL1A 4K42A 5AQZA 4B3OA 3DI6A 4HWIA 3EKUA 5HRRA 4B9NA 1NGHA 3DMJA 2OTLN 1W2BM 2BANA 1TUYA 1HJRA 3T69A 4M3TA 4JD2A 1D5AA 1KAZA 4DFJA 2D5RA 5EY4A 5HROA 1TV6A 3ZX2A 4CEOA 2E2PA 4AHSA 2P9NB 4RW9A 1SUQA 3K5LA 3A2FA 4A2BA 3M8PA 4OVLA 4WQ5A 1J54A 2KW4A 1VRUA 2KHOA 4FWKA 1ZBHA 4BRMA 4AF1A 2F7TA 1YJNN 1Q8IA 4DV1K 3CQXA 1HYSA 4FOIA 4LF4K 4KPYA 3FFKB 4BR2A 4DU4A 2P1JA 1Z6RA 2F8TA 4FVUA 4MLEA 5BPMA 1MWMA 1WUAA 4AM7A 4FM0A 4DTPA 3K9JA 3NF8A 5AQNA 4CHOA 1QQNA 5BRFA 3KK3A 4B9UA 2A42A 4XH4A 4FM2A 4IJAA 4CEZA 4CEBA 4NO7A 1CXQA 3C65A 2NUBA 3E9PA 2WOMA 3OYEA 5HOOA 4NCBA 4DTSA 4KH6A 4BR5A 2J4RA 3QMLA 2HHUA 4E1JA 3O9UA 4A5BA 4J2DA 3THWB 3QINA 4FJKA 4FJGA 4KH5A 3T1YK 4HVJA 4NLCA 2HF4A 3TSUA 5EXWA 4BQLA 3L8BA 3VOVA 1JCEA 4FCYA 1RBUA 3E9LA 3ULEB 1KQSM 2HHHK 2OPQA 4FJ7A 4J8FA 3V9WA 1RTJA 4FWLA 1BCMA 4DSKA 4DV6K 4OLAA 3O6WA 3MECA 4E89A 1QHAA 3CERA 3ZETB 5C2FA 4H0VB 5D3GA 3RR7A 1IO2A 2B5JA 3A0IX 3LDSA 3C6AA 5I42A 1V4SA 1NGJA 4DV0K 1XHXA 3WQTA 1SKWA 3LALA 3VEVA 3L3UA 2A1SA 4H5TA 3MCAB 1U04A 4OKEA 3D2FA 4I2PA 3O5BA 2G8UA 5BN9A 3IUCA 4CJ7A 4FLYA 2Z1GA 3ID6A 3N4PA 1KVBA 5HBMA 1KC8O 4IDHA 1GLBG 3AO1A 4DFMA 1XUPO 5AQHA 4CK3A 5CYQA 3AVFA 3SBTA 4BR4A 1NMDA 4CGHA 1RDUA 3CPEA 4OO1J 3DYAA 5I3UA 4QCLA 4F3TA 3ZSYA 4WF9L 2DFHA 1KTQA 2YNGA 3P4IA 4B9MA 1QTMA 2ITMA 5ADXH 2G8KA 4M3UA 3PX4A 1RNHA 2G8HA 3OYCA 5BN8A 3CCMN 4IOXA 1NMNA 4CZIA 2E6LA 3KWIA 2HMPA 2EX3A 4JKBA 2W40A 5AZJB 2CGLA 4K41A 5EU7A 1J6ZA 4ISEA 4JKGB 3MX2A 4HUEA 2QKKA 3QESA 3DM2A 3J7ZO 5AQTA 3OS1A 3O3FA 1VQ6N 4FLVA 4I6MA 1K8KB 4BG9A 4JI5K 3C0BA 3VPZA 4BGBA 2NRWA 1R59O 4NCGA 1NWKA 3BP8A 4RWTA 3TWHA 4YDUC 1I39A 3CQ8A 3CD6N 2YHYA 4IDKA 3G10A 2QKBA 2VWKA 3H1QA 3NHGA 3HBTA 1CLQA 4EP5A 4DQIA 2I7PA 3VQCA 2RE2A 4KREA 4XIUA 2QXLA 4JD2B 4KHWA 1BDGA 4JKFA 4CJLA 4W5OA 3EZ5A 3P38A 4BDZA 2O8EB 1TKTA 1RBRA 1RGIA 4YOXA 5GAHP 5C0YA 1LW0A 4OJRA 3HXMA 3PIOL 3K58A 3ZT4A 5HRNA 2I5JA 3LWLA 2W41A 3CCJN 1SL2A 3D45A 1UA0A 3AV9A 2CGJA 3SMSA 3I8BA 1N8RO 3DXKA 4BWJA 2P9UB 3VF4A 4XH5A 4HTLA 2CH5A 1NGAA 1WAJA 1OH7A 3JAMO 3KIOA 4YNQA 3CJ7A 3IKMA 3K5OA 3KZBA 4YFUA 3H6EA 1I94K 3AVLA 3KTQA 4ID1A 2FF6A 3E9OA 1HQEA 1S72N 1Q81O 4H0YB 3KLFA 4FJLA 3IMXA 2KKZA 5KGWA 1EWRA 2YKNA 5LL6Z 4B3MK 3F9MA 3MAQA 4U7BA 4CIFA 2UUCK 4DR4K 4R79A 4KHPK 4H5WA 3O80A 2UXCK 3EE8A 1BA0A 1WSJA 3CF5L 1REVA 4B9VA 4CJFA 3EKSA 1VQMN 3ZSXA 4M7XA 1NKEA 2E2QA 1BIZA 2IGIA 1FKOA 4JRPA 1OH6A 2V7YA 3IAYA 4CVNE 1ZBIA 3S41A 1KAYA 4CCHA 4KRFA 3C94A 3F5TA 4FSVA 4H5NA 3AVKA 3QB0A 3LDLA 3PV8A 3DWLA 1TKDA 4CF9A 2GELA 3R9PA 2XO7A 1S22A 4FK2A 1YITN 3HP6A 5AZIA 1VQKN 3LP3A 1YJWN 4DSLA 3FZMA 1KVCA 3DOLA 3LDNA 2WBNA 2G8IA 1FW6A 1QZ5A 2G8FA 2UUAK 4PL8A 4YHHK 4C8KA 3VA3A 4Z4IA 2NRHA 3SAHA 3M8SA 3LZJA 3T1HK 1V4TA 1TVRA 3DLRA 4QAGA 5KPZA 5LJWA 3WNHA 2ZJRL 3L2VA 4RG8A 3MEEA 3OYJA 2BE2A 3CETA 2G8WA 1KFSA 2HW3A 1ATSA 4DTOA 3ALYA 3QICA 1WN7A 1BGXT 4BRFA 3J7YP 3AA5X 4LSLA 1X9MA 4ISFA 1WAFA 4E1MA 4A61A 1VRTA 3WT0A 4B1UB 2Z1HA 3OYBA 5BR9A 3I0SA 1VQ7N 5M1NA 4M3XA 3CFOA 2WTUA 1WNSA 2G8VA 4KAZA 1BI4B 1NOZA 4M3YA 3VQ5A 2HOEA 3N4QA 4OKJA 4CFBA 4GVEA 5M1FA 5J2NA 1D8YA 3KLGA 3LANA 2CH6A 3ISNC 1VQON 5C25A 1D9DA 1SKSA 5JMVA 1SZ2A 2YHWA 4HCCA 5M1OA 1N33K 3BGRA 4FL9A 4GV6A 2Y1IA 3VQQA 4QOZB 2QI2A 4CBXA 3VTIA 4I6MB 4DV4K 3I56N 3V6DA 4NYFA 2W6LA 3IG1A 4F8RA 3CJ9A 2ZJQL 4E7HA 3QFUA
chains in the Genus database with same CATH topology
4DV5K 5FLXO 4OX9K 4LFCK 1XNQK 4CVNE 5A2QO 2UXBK 3T1YK 4LF7K 4NXNK 4JV5K 4DR6K 4B3TK 4JI5K 4JI0K 4YY3K 4DR1K 4DUZK 2UXDK 4JI2K 5BR8K 2HHHK 4V19S 4X66K 1FJGK 1HR0K 4DR7K 4GKKK 4JI6K 3OTOK 4DV6K 4JI1K 4X62K 4X65K 3J7AP 4JI4K 4DR5K 4LFBK 2UUAK 1N32K 4YHHK 3J81O 4JI7K 4DV0K 4DR3K 3T1HK 4B3SK 4DV2K 4AQYK 4LFAK 4DV7K 4LF5K 5AJ3K 1IBLK 4JYAK 4LF9K 2UUBK 5LMNK 4GKJK 1HNWK 3J7YP 1IBMK 4B3RK 1XMOK 4JI8K 3J80O 3JAMO 1XNRK 2ZM6K 2VQEK 1I94K 2UU9K 4DR2K 4DV1K 1N36K 1J5EK 5IT9O 1IBKK 4LF4K 4NXMK 2F4VK 4CW7B 5LMUK 1HNXK 5LL6Z 4B3MK 4DUYK 1HNZK 4JI3K 1N33K 4LF8K 4K0KK 2UUCK 2E5LK 4DR4K 4KHPK 4DV4K 2UXCK 2VQFK 4DV3K 1N34K 1XMQK 5IWAK 4LF6K 4X64K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 K;  5FLX O;  4OX9 K;  4LFC K;  1XNQ K;  4CVN E;  5A2Q O;  2UXB K;  3T1Y K;  4LF7 K;  4NXN K;  4JV5 K;  4DR6 K;  4B3T K;  4JI5 K;  4JI0 K;  4YY3 K;  4DR1 K;  4DUZ K;  2UXD K;  4JI2 K;  5BR8 K;  2HHH K;  4V19 S;  4X66 K;  1FJG K;  1HR0 K;  4DR7 K;  4GKK K;  4JI6 K;  3OTO K;  4DV6 K;  4JI1 K;  4X62 K;  4X65 K;  3J7A P;  4JI4 K;  4DR5 K;  4LFB K;  2UUA K;  1N32 K;  4YHH K;  3J81 O;  4JI7 K;  4DV0 K;  4DR3 K;  3T1H K;  4B3S K;  4DV2 K;  4AQY K;  4LFA K;  4DV7 K;  4LF5 K;  5AJ3 K;  1IBL K;  4JYA K;  4LF9 K;  2UUB K;  5LMN K;  4GKJ K;  1HNW K;  3J7Y P;  1IBM K;  4B3R K;  1XMO K;  4JI8 K;  3J80 O;  3JAM O;  1XNR K;  2ZM6 K;  2VQE K;  1I94 K;  2UU9 K;  4DR2 K;  4DV1 K;  1N36 K;  1J5E K;  5IT9 O;  1IBK K;  4LF4 K;  4NXM K;  2F4V K;  4CW7 B;  5LMU K;  1HNX K;  5LL6 Z;  4B3M K;  4DUY K;  1HNZ K;  4JI3 K;  1N33 K;  4LF8 K;  4K0K K;  2UUC K;  2E5L K;  4DR4 K;  4KHP K;  4DV4 K;  2UXC K;  2VQF K;  4DV3 K;  1N34 K;  1XMQ K;  5IWA K;  4LF6 K;  4X64 K; 
#chains in the Genus database with same CATH topology
 3THY B;  1BG3 A;  2HF3 A;  1G15 A;  5FLX O;  5E84 A;  3LPU A;  3U8X A;  2UXB K;  1ASV A;  3KLH A;  5HLF A;  3D2E B;  2BH1 A;  4FPB A;  1EKE A;  3AVB A;  4IKF A;  3O9R A;  4FLZ A;  4CBU A;  3KKS A;  2ETJ A;  4CJQ A;  4UQG A;  2VGN A;  1SL0 A;  1G99 A;  4FWN A;  4DTN A;  3OTO K;  4MDA A;  2VWB A;  3L0Q A;  4CI6 A;  3A5O C;  1NGF A;  2GUI A;  5AQY A;  1LV5 A;  1EQY A;  3RMD A;  1GLF O;  3FZH A;  5F1X A;  4DR5 K;  3LP1 A;  5AFU H;  3V4I A;  4CJ3 A;  3C95 A;  3BZC A;  1GOA A;  1T05 A;  3V1R A;  3HP9 A;  3G6E N;  3L2W A;  3ZT3 A;  5HL7 L;  3DXK B;  4FJM A;  4DHY A;  4FZZ A;  3M1F A;  4LFA K;  3V9Z A;  4ID5 A;  3TAE A;  2IDO A;  4A5A A;  1WBB A;  3F2K A;  3V9X A;  3IFR A;  4I7F A;  3THW A;  4IEE A;  1YVU A;  2UUB K;  3WXJ A;  4I9L A;  4JK7 A;  5KRS A;  1RDD A;  3U3Y A;  3LDP A;  3RVC A;  2DFE A;  2F9T A;  5AQI A;  4DMN A;  1HYZ A;  1NJZ A;  2GV9 A;  1QQM A;  3MX5 A;  1HJO A;  5SWM A;  2HST A;  4JAX A;  1RBV A;  4CJV A;  3HPH A;  3AVM A;  3ZET A;  1N36 K;  1JXE A;  1X3M A;  4CD1 A;  3U3G A;  4DTX A;  3QBW A;  2YNF A;  1EX4 A;  4CF8 A;  2XHB A;  2QWR A;  1HNZ K;  1IG8 A;  4F2S A;  5M1P A;  4XH1 A;  3D7E O;  2E5L K;  2D0C A;  3L4I A;  2YV0 X;  4ZHR A;  4FWP A;  1IKX A;  2JWL A;  2VGM A;  4IG3 A;  1BUP A;  2YJE A;  4FOE A;  3WXM B;  1ZC6 A;  4CED A;  3C6U A;  3EO3 A;  4DV5 K;  3M8Q A;  4DB3 A;  1RTD A;  3M3Z A;  4DU1 A;  1VHX A;  1OVY A;  2GWK A;  4CK1 A;  1ZBS A;  5AZI B;  4CF0 A;  3ZSO A;  4B1X B;  3UE5 A;  4AHU A;  5TKY A;  2OZS A;  4DF4 A;  1SV5 A;  4CBW A;  3OYF A;  1WSH A;  3UKU B;  4OPH A;  4X66 K;  3NF7 A;  1TYQ B;  4BC5 A;  1ILY A;  4CEF A;  4CZM A;  3MXJ A;  2Y1J A;  3O08 A;  1U4B A;  4BRP A;  3B8A X;  1VSK A;  3SV3 A;  3TPQ A;  4N41 A;  5LJV A;  3DOK A;  2OZM A;  1NK8 A;  4CZE A;  3PX0 A;  1ZBL A;  5HRS A;  1HMV A;  2IC3 A;  2ZE2 A;  5GIO A;  4BRC A;  4RW7 A;  4DR3 K;  2FBV A;  5KPT A;  3SUP A;  3OBY A;  5AZJ A;  3K5N A;  3NH0 A;  3HRG A;  2Q0U A;  4JKG A;  3H46 O;  4CZG A;  1VSL A;  4H0X B;  4BRD A;  1GLL O;  4CZJ A;  4KB1 A;  2PY5 A;  1BWF O;  3VEY A;  3TU5 A;  4FJX A;  5H1S Q;  4FJ8 A;  4BRG A;  5AQX A;  5C12 A;  2ZF5 O;  2A3Z A;  2WON A;  3ZX3 A;  3AAP A;  5FPE A;  4BWM A;  2P5O A;  2YHA A;  3AVJ A;  2Q97 A;  1X3N A;  4O55 A;  3VQA A;  2YNI A;  4H0O A;  4JS5 A;  1B9D A;  4DR2 K;  4A57 A;  3DXM B;  5IT9 O;  2O8C B;  4JKD A;  4E3S A;  3ENB A;  1U48 A;  1S3X A;  5CYM A;  2HB5 A;  1ATN A;  3I0R A;  4O5F A;  4PKH A;  3BF1 A;  2P9L A;  2O8E A;  4DQ8 A;  4Z4C A;  1HUX A;  4JHD A;  1GOC A;  5F0X A;  2VQF K;  3MDQ A;  3MED A;  1QZ6 A;  3I55 N;  4PA1 A;  3RMC A;  2QWL A;  3ZT1 A;  1KAX A;  2YJF A;  3QNN A;  4K25 A;  3CCS N;  3L4Q A;  2P9U A;  4KHN A;  4DG1 A;  4I9Q A;  3C7N B;  4H5V A;  1K9M O;  3ULD A;  5T7B A;  4KI4 A;  3V1Q A;  4DLG A;  2Z1I A;  1WSF A;  3CCU N;  1NJX A;  5AQL A;  3KK2 A;  3DJC A;  4IFV A;  3EY1 A;  1DTQ A;  4KH4 A;  3E01 A;  2GWJ A;  5I9E B;  2O8B B;  1FK9 A;  4MO5 A;  4CIE A;  2WFB A;  1QSL A;  1DGK N;  4C23 A;  1HRH A;  3SZ2 A;  1MDU B;  4LFB K;  1IKY A;  3VES A;  3WNG A;  1YJ9 N;  4B1W B;  3QBX A;  1S1T A;  1RT3 A;  3I8D A;  3HI0 A;  5BRH A;  1LWF A;  1C0M A;  3AA2 A;  1IKW A;  4DV2 K;  4WQ4 C;  4DTR A;  2PYL A;  3Q7C A;  1W97 L;  4JKH A;  1QSY A;  4BDP A;  1JLE A;  4DQS A;  3ZSQ A;  2FSJ A;  4DCH A;  2GUP A;  1NJW A;  4RW6 A;  5BRD A;  1L3T A;  4H4O A;  1VQ8 N;  4GKJ K;  2OPP A;  2EHG A;  2RHK A;  3A5L C;  3VQ4 A;  3CIP A;  4KO0 A;  3SQ2 A;  4BDY A;  1O1W A;  3J80 O;  3E1Y A;  3O3H A;  1TK5 A;  2QWO A;  3LM2 A;  1Z05 A;  5ADX A;  3AVN A;  2YNH A;  2QK9 A;  1ZBF A;  4RW4 A;  4RCH A;  4JEP A;  3R1X A;  3GG4 A;  4FLT A;  2FXU A;  2QM1 A;  2AJQ A;  5AQG A;  4BR7 A;  4CFA A;  3CCQ N;  2DTU A;  3NCI A;  4B1V A;  3VGK A;  3TAP A;  1IG9 A;  2HMI A;  1JLB A;  4U67 L;  4KV8 A;  4QS7 A;  4BVO A;  3ZSZ A;  4CJ4 A;  4ICL A;  5M1Q A;  1Q86 O;  3QLH A;  4E7L A;  3CCE N;  3KD1 E;  4YOW A;  1GLD G;  1EP4 A;  3KLI A;  3MN9 A;  4Z0U A;  3VQ7 A;  1NK4 A;  2HBL A;  1S9G A;  4XEI A;  4B9S A;  1L5U A;  4B8C A;  3NH2 A;  4JV5 K;  5CZ1 A;  4M3W A;  1XC3 A;  2FF3 B;  4JKC A;  4EZ9 A;  3ZYY X;  4DSF A;  5JLF A;  1J5O A;  3CQY A;  1BI4 A;  1RT6 A;  3O8M A;  1IKV A;  3MXI A;  3C6H A;  4GV9 A;  1X9J A;  4FJ5 A;  4MQ3 A;  3SQ1 A;  2QA4 N;  4WQ5 C;  4F4K A;  4FLU A;  1O13 A;  5CR4 A;  3H08 A;  3DRR A;  5FPD A;  4CES A;  3J7A P;  2QWN A;  3RR8 A;  1T6D A;  2NLX A;  3F73 A;  5C2D A;  4ILJ A;  4DWI A;  3K2P A;  4FWS A;  5MLC Q;  4KHY A;  2A40 A;  5HP1 A;  2NRX A;  4YOU A;  4FJH A;  2R7Y A;  4AHR A;  4ILH A;  4AQY K;  5LY3 A;  3THY A;  4CGI A;  3MN7 A;  4W5R A;  2GEM A;  4LF9 K;  4C8L A;  3NVK A;  2Q3S A;  1VQ4 N;  3CJA A;  3FZF A;  1RT5 A;  3SQ0 A;  1VAZ A;  4C8N A;  3D2E A;  4B08 A;  4DQP A;  3M8R A;  1GLJ O;  5EOY A;  3ZT2 A;  3FGU A;  4M7Y A;  2D0P A;  3P1G A;  2IOC A;  2RF2 A;  1VSH A;  3C6T A;  2O8D B;  1TUU A;  2P9L B;  5TKW A;  3OYI A;  4JHD B;  3NF6 A;  4Z94 A;  1W0H A;  1WSG A;  2YI1 A;  3L2Q A;  2HHW A;  2BDP A;  3R3L A;  5C24 A;  1VQ5 N;  2KFN A;  4FM1 A;  3ENO A;  3WXK A;  4IWV A;  3IS9 A;  2YKM A;  4B1Y B;  1NG9 A;  2LSN A;  3FLC O;  1GLE G;  4EHT A;  3JSM A;  5E41 A;  2B6A A;  3L3V A;  3CM6 A;  1MWK A;  1JL2 A;  5A2Q O;  4Z4G A;  3KHY A;  1TAU A;  5J1E A;  2FSN A;  1C0G A;  3VGM A;  3ZLJ A;  1HKC A;  2E1Z A;  4DR1 K;  5KPR A;  2A5X A;  5AQJ A;  3PSI A;  4B1Z A;  1A5X A;  3ASM A;  5C42 A;  3OYH A;  4GKK K;  2A41 A;  3HPO A;  1FKP A;  1RDC A;  4O4G A;  5C15 A;  4CJR A;  1F21 A;  1RBT A;  1XWL A;  3THV A;  4HTU A;  4TSX A;  1XQS C;  1NGE A;  3TI0 A;  2JGU A;  3WEE B;  4AHT A;  4BGA A;  2E2N A;  3TAN A;  4E1N A;  1K6Y A;  1MU2 A;  3AAR A;  5FRN A;  4E7J A;  3SNN A;  3K9K A;  4QS8 A;  2HBJ A;  4WFA L;  3ZT0 A;  3TSQ A;  2KZM A;  4BRK A;  3VQ6 A;  2HVH A;  4O0J A;  2ASM A;  4IFY A;  2HHX A;  1IBL K;  1A5W A;  2VG6 A;  3DLG A;  3EN9 A;  3P5J A;  1N6Q A;  2IVN A;  5GIN A;  4DQR A;  3SV4 A;  1CZB A;  3AGR A;  3EZW A;  1KSP A;  3CXC M;  1YUW A;  3DAW A;  3UKU A;  4B3R K;  3ENH A;  2FBT A;  5KQ8 A;  1TYQ A;  2X78 A;  3HK2 A;  3DLK A;  1E4G T;  2PAV A;  1YF5 L;  1C6V A;  5AQU A;  3LZI A;  2P9I A;  1U45 A;  1RBS A;  4HUG A;  5FDL A;  3LDO A;  2A1R A;  1UOC A;  5BRE A;  3HVR A;  3V9S A;  1KLN A;  4LH4 A;  3WNF A;  3L6Q A;  4NXM K;  4YOV A;  2F4V K;  3VA0 A;  1OVQ A;  2VG7 A;  2KFZ A;  1XC9 A;  4LF8 K;  4BE0 A;  1KVA A;  4M3R A;  3AAQ A;  4E7I A;  3AVI A;  3K0S A;  4BVP A;  3IDH A;  4AHC A;  3JS6 A;  4DFK A;  4ILG B;  4H0P A;  5FRO A;  4BRO A;  4FZX C;  3OS2 A;  1U49 A;  1BHL A;  3O9T A;  5J2M A;  4W5N A;  3PLA A;  4RW8 A;  3O9S A;  4GY2 B;  3MK6 A;  2KZZ A;  3SJJ A;  3EE9 A;  4WCE L;  5CE3 A;  4BC2 A;  4UY8 O;  3OYM A;  4PUO A;  1VQ9 N;  1S9E A;  4JI2 K;  1TKZ A;  3DXM A;  4LH5 A;  4CJS A;  3AO5 A;  2QWQ A;  1T7P A;  1YVN A;  2O8C A;  4ELV A;  3TTC A;  2OYQ A;  3BDP A;  4JI1 K;  3W3D A;  5J2Q A;  1H1V A;  2E8A A;  3K57 A;  4J2B A;  3TAF A;  3QEP A;  1B92 A;  3SUO A;  2KQ2 A;  3GE1 A;  1RDA A;  2GX9 A;  3PX6 A;  3TTF A;  2PZS A;  1BIS A;  3CC4 N;  2O8F B;  4CK2 A;  1HYV A;  2QW9 A;  5AQP A;  3QDK A;  4NYN A;  3C7N A;  4JYA K;  3UB5 A;  4OPK A;  1LAV A;  3O1W A;  3M6G A;  3GDQ A;  4KBO A;  1IBM K;  3CCL N;  3VEX A;  1RCH A;  3R8E A;  3Q7B A;  5ELZ A;  3AVG A;  1W9H A;  3MN5 A;  4WE1 A;  2O8B A;  2ZM6 K;  1SS6 A;  1VQP N;  1C0T A;  4CJK A;  4EP4 A;  1NGC A;  3T1A A;  3UKR A;  3NDK A;  1J53 A;  3QFP A;  3OJU A;  3SUN A;  3TAQ A;  1IBK K;  4K8X A;  1K73 O;  3TAM A;  1W7A A;  4MLH A;  3LL3 A;  1TK8 A;  3O1B A;  3NGY A;  5AR0 A;  3U9D A;  2HND A;  3E66 A;  1S6Q A;  4IOA L;  4OKK A;  1RTI A;  1S5J A;  4JKE A;  1XHZ A;  3RTV A;  5K14 A;  2KLA A;  2P9S B;  1HPZ A;  2X74 A;  4Y1C A;  3J8A A;  4NLB A;  1HLU A;  2E2O A;  4CHP A;  1JLA A;  1TL1 A;  4CE9 A;  1BOT O;  2UYT A;  5DM6 L;  4BRI A;  5AQS A;  4FVM A;  2PBD A;  3D6R A;  4JKA A;  3W0L A;  3CPW M;  4EZ6 A;  3VQP A;  5KRT A;  3V81 A;  4ZTJ A;  1HR0 K;  3BUZ B;  5EVZ A;  1RDB A;  4PQU A;  4B9Q A;  4CHY A;  4EAH D;  2OA8 A;  2NRT A;  1GLA G;  5AQF A;  4YOR A;  1QQC A;  1ZBU A;  4LY7 A;  3BF3 A;  5DMR A;  3JYT A;  3AO4 A;  3VF6 A;  4ISG A;  1HKG A;  1DEJ A;  4CJ5 A;  4L3Q A;  1VSI A;  3TAR A;  5DK5 A;  2P5G A;  4CGG A;  3CMA N;  2XY7 A;  4CEC A;  2JLE A;  2Q31 A;  1HX1 A;  1ASW A;  3ZCM A;  2P9I B;  3ZSV A;  2V51 B;  3DLE A;  1DT9 A;  4FYD A;  3AVC A;  3MXM A;  1TK0 A;  4FZY A;  4WQ4 A;  3MEG A;  2F9W A;  1LW2 A;  1CZ9 A;  2OPR A;  4FXD A;  4FJN A;  1RT7 A;  2P9K A;  4KFB A;  2VQE K;  4B8A B;  3FFI A;  4WYB A;  1RIL A;  4LC9 B;  1J5E K;  2P9P B;  3U4L A;  1L3V A;  1TKX A;  2ITG A;  4KTW A;  3T3F A;  4E0D A;  5LMU K;  1VQL N;  4LSN A;  1TL3 A;  2W42 A;  1JXB A;  2XY8 A;  1L3S A;  3SPZ A;  2FLO A;  4K0K K;  1RT1 A;  4CJE A;  4M45 A;  3CC7 N;  3QEW A;  3KK1 A;  4N76 A;  3SI6 A;  4KHQ A;  1QHT A;  2GTD A;  2JWK A;  2H3G X;  4DS5 A;  3NH1 A;  3VER A;  3KVG A;  4H0T B;  4ELU A;  4BRL A;  4FWR A;  4BR9 A;  4BG8 A;  4OGE A;  3NVM A;  1ZXO A;  1QSS A;  3O9Q A;  1BA1 A;  5E26 A;  2OPS A;  4PKG A;  1EO1 A;  3VTH A;  2YCH A;  2O8D A;  2O4I A;  3A5M C;  3RSE B;  4MDB A;  3L2R A;  4O44 A;  5JVH L;  2ZWH A;  4CZF A;  3CCR N;  3THX B;  5GIP A;  1YHQ N;  3LP2 A;  2EWS A;  1NGG A;  4GW6 A;  1K8A O;  2IIR A;  4CHN A;  5KI6 A;  3DRS A;  1UWB A;  2KTQ A;  3KKR A;  3PUF A;  1VSE A;  3QO9 A;  3HL8 A;  4JI4 K;  4KHU A;  3R6M A;  1SKR A;  1WBD A;  1KFD A;  2E4L A;  4BAC A;  4MO4 A;  4JK9 A;  1S1X A;  3BEX A;  3TAB A;  3NMU A;  1JKH A;  4BC3 A;  1HPM A;  3OYL A;  4DV7 K;  2Q36 A;  5AJ3 K;  1ITG A;  1IH7 A;  5FRM A;  5AQK A;  2OTJ N;  1P8Z A;  3HT3 A;  2BTF A;  3A5N C;  4FWM A;  1NLV A;  3UKR B;  3VEW A;  1UAX A;  4EIA A;  1JLC A;  1Q18 A;  4YDU A;  5GAE P;  3SK3 A;  1Q82 O;  3OS0 A;  4N56 A;  4O8K A;  3HM9 A;  3PY8 A;  1XNR K;  3PO5 A;  3M5R A;  3FZK A;  4JRQ A;  2IVO A;  2Q2R A;  4Z4E A;  4KHS A;  3VEN A;  3RMB A;  3IRX A;  3WEE A;  4C1N K;  4HHT A;  1HNX K;  3CFR A;  3LDQ A;  2CGK A;  3QIP A;  3CJ1 A;  3BY5 A;  2BGG A;  3EL2 A;  2D1K A;  2V52 B;  1DLO A;  3CFP A;  3SUQ A;  2D0A A;  1E3M A;  4PKI A;  5KGX A;  1X1P A;  1VSF A;  4OLB A;  5CZ2 A;  4O0I A;  4DKW A;  1N34 K;  4CJT A;  3OYD A;  1U47 A;  4IZ9 A;  5GAD P;  3VN5 A;  3VEO A;  1C1C A;  4Z4H A;  1KRP A;  4Q5V A;  3TSP A;  2B4J A;  1EWQ A;  4E7K A;  3GL1 A;  3S3O A;  4LFC K;  3OYA A;  3HJF A;  3VQ9 A;  5JS1 A;  1VSD A;  4LF7 K;  1QQO A;  3NF9 A;  2WC9 A;  1Y64 A;  4NB4 A;  4YY3 K;  1E4F T;  1ZYQ A;  3NBP A;  1VQN N;  1SQK A;  5AQQ A;  4CHZ A;  4CHQ A;  1C0U A;  1T44 A;  5F2R A;  3SPY A;  3ZSR A;  3VMF B;  1DKG D;  2OAN A;  3CM5 A;  3VET A;  1GLC G;  2FBY A;  1RT2 A;  3OY9 A;  2HNZ A;  2E88 A;  4DTM A;  2QTD A;  2NZT A;  4BRN A;  1C1B A;  3J81 O;  4C8O A;  4BY9 C;  2RPI A;  2P51 A;  5C10 A;  4ZTF A;  5AQO A;  4A2A A;  1NK5 A;  4C1N I;  4KTQ A;  5KQD A;  3T7Z A;  3CCV N;  3B6P A;  4FW1 A;  4FLW A;  2P9K B;  4I2Q A;  1YT3 A;  1JCF A;  5J2P A;  3S3M A;  1KLM A;  1U2V A;  4L8R B;  1NJI O;  1D9F A;  2XY5 A;  3HOS A;  1HNW K;  3LP0 A;  1SAZ A;  2NRZ A;  1JLQ A;  1R0A A;  3ZSW A;  1BCO A;  2HBK A;  4C8M A;  1YIJ N;  3ZEU B;  3G4S N;  1BL3 A;  3TR8 A;  1GOB A;  4G1Q A;  4N47 A;  3U9Z A;  5DM7 L;  4FK0 A;  2DPN A;  4WFB L;  3AO3 A;  4DTJ A;  1ESV A;  2A6A A;  3OYN A;  4KI6 A;  3T19 A;  4R5P A;  1C1A A;  3G25 A;  4DUY K;  4E19 A;  1LWE A;  2QXF A;  1KXP A;  2YHX A;  2O8F A;  4H8K A;  4Y0W A;  3QEX A;  5JLH A;  3O4W A;  4CEA A;  4FJ9 A;  3MMV A;  1NJY A;  5AQR A;  1IV0 A;  1S6P A;  1OH8 A;  2QWM A;  3NAE A;  3OVN A;  3HM8 A;  3CJC A;  4BR0 A;  4LF6 K;  1NGD A;  1NU0 A;  5AQV A;  2D4W A;  4M42 A;  3OW2 M;  2ASO A;  1WOQ A;  3LAM A;  4FK4 A;  3FZL A;  4Z4F A;  4IO9 L;  1YTU A;  4H03 B;  4BE2 A;  2HVI A;  4V19 S;  3K59 A;  3GBT A;  3CI5 A;  3HVT A;  1KCF A;  2IVP A;  5BPL A;  1I3A A;  2W6K A;  3KD5 E;  4BRQ A;  4X65 K;  4B9L A;  1HQU A;  1VK0 A;  1NOY A;  1EET A;  4OGC A;  1T3V A;  1WLJ A;  2RN2 A;  4DSJ A;  3WUH A;  1N32 K;  4DTU A;  5SZT A;  4PL7 A;  3RWU A;  3BZK A;  4IFE A;  4M63 C;  1XI1 A;  2P9S A;  1NGB A;  4FJJ A;  3KWG A;  4H5R A;  3I33 A;  1OH5 A;  1JJ2 M;  2PYJ A;  1T03 A;  3O3G A;  3S9H A;  1YI2 N;  4QS9 A;  4FPA A;  4CZK A;  4IG0 A;  2VWJ A;  3AGK A;  3SBG A;  3NGI A;  2F96 A;  3SLC A;  4FLX A;  2XRI A;  4DFP A;  2HNY A;  4F2R A;  4ELT A;  4FW2 A;  4FO0 A;  4FWQ A;  3P31 A;  4LD0 A;  3ZX0 A;  1TAQ A;  4AH9 A;  3TTD A;  1X9S A;  4J2A A;  4GV3 A;  4M3Z A;  2ASP A;  1QS4 A;  1LOT B;  1L3U A;  4CGJ A;  4FWO A;  1RDW X;  3OHR A;  3JXU A;  3CJB A;  1Q9Y A;  3HO1 A;  3B6O A;  3TAG A;  4K8Z A;  4CIG A;  2VG5 A;  1JLG A;  3OJS A;  4CW7 B;  2VYP A;  1LCU A;  2ZJP L;  4DU3 A;  3MWT A;  4BE1 A;  3OBW A;  3CHW A;  1NK6 A;  5AQM A;  3DLB A;  1TGO A;  4DS4 A;  3DLL L;  1LAW A;  4IBN A;  2IAJ A;  5IWA K;  1NKC A;  2O4G A;  4CEQ A;  1MA9 B;  1RFQ A;  3D2F B;  4X64 K;  4IXC A;  5B8H A;  4OX9 K;  2IS3 A;  2DFF A;  4JN4 A;  4WFN L;  3EEQ A;  4H4M A;  1P90 A;  4CJU A;  4W5T A;  3O4Q A;  3WNE A;  2FC0 A;  2UXD K;  4KKO A;  2HHS A;  4NCA A;  3AA3 A;  1NNE A;  2P9P A;  3WXI A;  4YOY A;  1DTT A;  2BUP A;  4CD3 A;  3WXL A;  3H3N O;  4GMJ B;  3OYK A;  2WUS A;  1BQM A;  3MCP A;  4EHU A;  3PIP L;  1QVF M;  2AP1 A;  1U2V B;  5KTQ A;  3D0P A;  4JI7 K;  3AA4 A;  3LAK A;  3P39 A;  4DSE A;  3AVH A;  5EX5 A;  3ATU A;  3CME N;  5AQW A;  4LF5 K;  1BO5 O;  3AO2 A;  3NE6 A;  1HKB A;  1D4X A;  1NBW A;  5AFU A;  3UIQ A;  4CGF A;  3HOT A;  3HPG A;  2E6M A;  4YOT A;  4HUF A;  4HCB A;  4PY5 A;  1NKB A;  3K5M A;  2ZQB A;  3SCX A;  4FJI A;  3RSE A;  1Q9X A;  2I7N A;  4AM6 A;  3HST B;  3THX A;  5FPN A;  3ID8 A;  3P83 D;  4F3O A;  3GOI A;  4M41 A;  3QEV A;  3DRP A;  2QEX N;  2YHB A;  2UU9 K;  2FSK A;  4AHV A;  3HSC A;  4RTF D;  3FE1 A;  3EYZ A;  4A59 A;  3FR0 A;  3DLH A;  1NGI A;  2P9N A;  1CXU A;  5JVG L;  1J9A A;  4JI3 K;  1QVG M;  2OCE A;  1VSM A;  3V9U A;  2QWP A;  4JNE A;  3SMP A;  3VQD A;  3VQE A;  2GBZ A;  1ASU A;  2Q0R A;  1A5V A;  4GNI A;  5BPN A;  1UA1 A;  2X6S A;  3HZ6 A;  4IJN A;  1Y97 A;  4DV3 K;  4PWD A;  3A8Y A;  4Y1D A;  2E1Y A;  3VQB A;  2HHT A;  2RKI A;  1Q7Y O;  3H1V X;  1NK7 A;  5CHI A;  4N5S A;  4MFB A;  1XNQ K;  2AA4 A;  4BQZ A;  3O4N A;  1YTA A;  3SJH A;  1HNV A;  1EXQ A;  4J2E A;  4IO8 A;  1BU6 O;  1S1U A;  4JS4 A;  4JI0 K;  1RT4 A;  4DF8 A;  1WB9 A;  3NGZ A;  3S3N A;  5HRP A;  4DUZ K;  1CZA N;  1JLF A;  4JK8 A;  4B9T A;  3MWP A;  4JI6 K;  1T8E A;  4CF1 A;  1N5Y A;  3ITH A;  4X62 K;  3RMA A;  1YAG A;  4CEE A;  1M1K O;  2VCP A;  3SYZ A;  3F9K A;  3SAG A;  2E20 A;  3ULE A;  3QNO A;  1ATR A;  3G0Z A;  3NFA A;  4GVM A;  3QET A;  3CG7 A;  4BC4 A;  4B3S K;  1Z26 A;  1WSI A;  4CER A;  2X6N A;  2ZD1 A;  3HTV A;  1JCG A;  1OKJ A;  5GAG P;  5LMN K;  3QER A;  2NRR A;  3RRG A;  4AIL C;  4O8U A;  1JL1 A;  4BRE A;  3KLE A;  3VQ8 A;  1XMO K;  4CJP A;  4OPA A;  4JI8 K;  2V7Z A;  3OA9 A;  4JLH A;  4IEI A;  1RTH A;  3CYM A;  2HHQ A;  1X9W A;  4CFC A;  4OPJ A;  2D0O A;  5CY4 A;  4IOC L;  3KK7 A;  3SQ4 A;  2D0B A;  1BQN A;  2FBX A;  3QEI A;  4BRA A;  3VEZ A;  1HNI A;  3SAF A;  3LPT A;  1U6Z A;  4KTZ A;  1B9F A;  1C0F A;  4O5B A;  3H3O B;  4CZH A;  4EFH A;  2YX6 A;  3ATV A;  3V1O A;  3VF2 A;  2Z1J A;  3U6F A;  2DY4 A;  4Q0B A;  2NNW A;  4K43 A;  1VSJ A;  3VGL A;  4G9Z A;  1LWC A;  1S1V A;  4CF2 A;  1M90 O;  1WSE A;  5M1K A;  3PSF A;  3AY9 A;  2HHV A;  1XMQ K;  3HYF A;  1T6C A;  3LWM A;  3OYG A;  4KB0 A;  3LM9 A;  1FXX A;  1QE1 A;  2F8S A;  4DLE A;  4BRH A;  2ATQ A;  3L2U A;  3ZEU A;  3H45 C;  4NXN K;  4PHT X;  4DR6 K;  5JIC A;  4B3T K;  4CZL A;  1Z25 A;  3WQU A;  1NM1 A;  3AVA A;  3G71 N;  4A62 A;  5BR8 K;  4W5Q A;  4DQQ A;  1FJG K;  4DR7 K;  1YXQ A;  5FPM A;  1S1W A;  2PFU A;  5JS2 A;  3MN6 A;  3QIO A;  3KJV A;  4CJW A;  2ZGZ A;  2NRV A;  2Q1N A;  1NK0 A;  2HBM A;  1K8K A;  2ZGY A;  2XY6 A;  3PO4 A;  3CC2 N;  1KD1 O;  4DSI A;  4F9O A;  3RRH A;  1IJJ A;  4CFD A;  1NK9 A;  1BIU A;  4CGD A;  1SL1 A;  4K42 A;  5AQZ A;  4B3O A;  3DI6 A;  4HWI A;  3EKU A;  5HRR A;  4B9N A;  1NGH A;  3DMJ A;  2OTL N;  1W2B M;  2BAN A;  1TUY A;  1HJR A;  3T69 A;  4M3T A;  4JD2 A;  1D5A A;  1KAZ A;  4DFJ A;  2D5R A;  5EY4 A;  5HRO A;  1TV6 A;  3ZX2 A;  4CEO A;  2E2P A;  4AHS A;  2P9N B;  4RW9 A;  1SUQ A;  3K5L A;  3A2F A;  4A2B A;  3M8P A;  4OVL A;  4WQ5 A;  1J54 A;  2KW4 A;  1VRU A;  2KHO A;  4FWK A;  1ZBH A;  4BRM A;  4AF1 A;  2F7T A;  1YJN N;  1Q8I A;  4DV1 K;  3CQX A;  1HYS A;  4FOI A;  4LF4 K;  4KPY A;  3FFK B;  4BR2 A;  4DU4 A;  2P1J A;  1Z6R A;  2F8T A;  4FVU A;  4MLE A;  5BPM A;  1MWM A;  1WUA A;  4AM7 A;  4FM0 A;  4DTP A;  3K9J A;  3NF8 A;  5AQN A;  4CHO A;  1QQN A;  5BRF A;  3KK3 A;  4B9U A;  2A42 A;  4XH4 A;  4FM2 A;  4IJA A;  4CEZ A;  4CEB A;  4NO7 A;  1CXQ A;  3C65 A;  2NUB A;  3E9P A;  2WOM A;  3OYE A;  5HOO A;  4NCB A;  4DTS A;  4KH6 A;  4BR5 A;  2J4R A;  3QML A;  2HHU A;  4E1J A;  3O9U A;  4A5B A;  4J2D A;  3THW B;  3QIN A;  4FJK A;  4FJG A;  4KH5 A;  3T1Y K;  4HVJ A;  4NLC A;  2HF4 A;  3TSU A;  5EXW A;  4BQL A;  3L8B A;  3VOV A;  1JCE A;  4FCY A;  1RBU A;  3E9L A;  3ULE B;  1KQS M;  2HHH K;  2OPQ A;  4FJ7 A;  4J8F A;  3V9W A;  1RTJ A;  4FWL A;  1BCM A;  4DSK A;  4DV6 K;  4OLA A;  3O6W A;  3MEC A;  4E89 A;  1QHA A;  3CER A;  3ZET B;  5C2F A;  4H0V B;  5D3G A;  3RR7 A;  1IO2 A;  2B5J A;  3A0I X;  3LDS A;  3C6A A;  5I42 A;  1V4S A;  1NGJ A;  4DV0 K;  1XHX A;  3WQT A;  1SKW A;  3LAL A;  3VEV A;  3L3U A;  2A1S A;  4H5T A;  3MCA B;  1U04 A;  4OKE A;  3D2F A;  4I2P A;  3O5B A;  2G8U A;  5BN9 A;  3IUC A;  4CJ7 A;  4FLY A;  2Z1G A;  3ID6 A;  3N4P A;  1KVB A;  5HBM A;  1KC8 O;  4IDH A;  1GLB G;  3AO1 A;  4DFM A;  1XUP O;  5AQH A;  4CK3 A;  5CYQ A;  3AVF A;  3SBT A;  4BR4 A;  1NMD A;  4CGH A;  1RDU A;  3CPE A;  4OO1 J;  3DYA A;  5I3U A;  4QCL A;  4F3T A;  3ZSY A;  4WF9 L;  2DFH A;  1KTQ A;  2YNG A;  3P4I A;  4B9M A;  1QTM A;  2ITM A;  5ADX H;  2G8K A;  4M3U A;  3PX4 A;  1RNH A;  2G8H A;  3OYC A;  5BN8 A;  3CCM N;  4IOX A;  1NMN A;  4CZI A;  2E6L A;  3KWI A;  2HMP A;  2EX3 A;  4JKB A;  2W40 A;  5AZJ B;  2CGL A;  4K41 A;  5EU7 A;  1J6Z A;  4ISE A;  4JKG B;  3MX2 A;  4HUE A;  2QKK A;  3QES A;  3DM2 A;  3J7Z O;  5AQT A;  3OS1 A;  3O3F A;  1VQ6 N;  4FLV A;  4I6M A;  1K8K B;  4BG9 A;  4JI5 K;  3C0B A;  3VPZ A;  4BGB A;  2NRW A;  1R59 O;  4NCG A;  1NWK A;  3BP8 A;  4RWT A;  3TWH A;  4YDU C;  1I39 A;  3CQ8 A;  3CD6 N;  2YHY A;  4IDK A;  3G10 A;  2QKB A;  2VWK A;  3H1Q A;  3NHG A;  3HBT A;  1CLQ A;  4EP5 A;  4DQI A;  2I7P A;  3VQC A;  2RE2 A;  4KRE A;  4XIU A;  2QXL A;  4JD2 B;  4KHW A;  1BDG A;  4JKF A;  4CJL A;  4W5O A;  3EZ5 A;  3P38 A;  4BDZ A;  2O8E B;  1TKT A;  1RBR A;  1RGI A;  4YOX A;  5GAH P;  5C0Y A;  1LW0 A;  4OJR A;  3HXM A;  3PIO L;  3K58 A;  3ZT4 A;  5HRN A;  2I5J A;  3LWL A;  2W41 A;  3CCJ N;  1SL2 A;  3D45 A;  1UA0 A;  3AV9 A;  2CGJ A;  3SMS A;  3I8B A;  1N8R O;  3DXK A;  4BWJ A;  2P9U B;  3VF4 A;  4XH5 A;  4HTL A;  2CH5 A;  1NGA A;  1WAJ A;  1OH7 A;  3JAM O;  3KIO A;  4YNQ A;  3CJ7 A;  3IKM A;  3K5O A;  3KZB A;  4YFU A;  3H6E A;  1I94 K;  3AVL A;  3KTQ A;  4ID1 A;  2FF6 A;  3E9O A;  1HQE A;  1S72 N;  1Q81 O;  4H0Y B;  3KLF A;  4FJL A;  3IMX A;  2KKZ A;  5KGW A;  1EWR A;  2YKN A;  5LL6 Z;  4B3M K;  3F9M A;  3MAQ A;  4U7B A;  4CIF A;  2UUC K;  4DR4 K;  4R79 A;  4KHP K;  4H5W A;  3O80 A;  2UXC K;  3EE8 A;  1BA0 A;  1WSJ A;  3CF5 L;  1REV A;  4B9V A;  4CJF A;  3EKS A;  1VQM N;  3ZSX A;  4M7X A;  1NKE A;  2E2Q A;  1BIZ A;  2IGI A;  1FKO A;  4JRP A;  1OH6 A;  2V7Y A;  3IAY A;  4CVN E;  1ZBI A;  3S41 A;  1KAY A;  4CCH A;  4KRF A;  3C94 A;  3F5T A;  4FSV A;  4H5N A;  3AVK A;  3QB0 A;  3LDL A;  3PV8 A;  3DWL A;  1TKD A;  4CF9 A;  2GEL A;  3R9P A;  2XO7 A;  1S22 A;  4FK2 A;  1YIT N;  3HP6 A;  5AZI A;  1VQK N;  3LP3 A;  1YJW N;  4DSL A;  3FZM A;  1KVC A;  3DOL A;  3LDN A;  2WBN A;  2G8I A;  1FW6 A;  1QZ5 A;  2G8F A;  2UUA K;  4PL8 A;  4YHH K;  4C8K A;  3VA3 A;  4Z4I A;  2NRH A;  3SAH A;  3M8S A;  3LZJ A;  3T1H K;  1V4T A;  1TVR A;  3DLR A;  4QAG A;  5KPZ A;  5LJW A;  3WNH A;  2ZJR L;  3L2V A;  4RG8 A;  3MEE A;  3OYJ A;  2BE2 A;  3CET A;  2G8W A;  1KFS A;  2HW3 A;  1ATS A;  4DTO A;  3ALY A;  3QIC A;  1WN7 A;  1BGX T;  4BRF A;  3J7Y P;  3AA5 X;  4LSL A;  1X9M A;  4ISF A;  1WAF A;  4E1M A;  4A61 A;  1VRT A;  3WT0 A;  4B1U B;  2Z1H A;  3OYB A;  5BR9 A;  3I0S A;  1VQ7 N;  5M1N A;  4M3X A;  3CFO A;  2WTU A;  1WNS A;  2G8V A;  4KAZ A;  1BI4 B;  1NOZ A;  4M3Y A;  3VQ5 A;  2HOE A;  3N4Q A;  4OKJ A;  4CFB A;  4GVE A;  5M1F A;  5J2N A;  1D8Y A;  3KLG A;  3LAN A;  2CH6 A;  3ISN C;  1VQO N;  5C25 A;  1D9D A;  1SKS A;  5JMV A;  1SZ2 A;  2YHW A;  4HCC A;  5M1O A;  1N33 K;  3BGR A;  4FL9 A;  4GV6 A;  2Y1I A;  3VQQ A;  4QOZ B;  2QI2 A;  4CBX A;  3VTI A;  4I6M B;  4DV4 K;  3I56 N;  3V6D A;  4NYF A;  2W6L A;  3IG1 A;  4F8R A;  3CJ9 A;  2ZJQ L;  4E7H A;  3QFU A; 
#chains in the Genus database with same CATH homology
 4DV5 K;  5FLX O;  4OX9 K;  4LFC K;  1XNQ K;  4CVN E;  5A2Q O;  2UXB K;  3T1Y K;  4LF7 K;  4NXN K;  4JV5 K;  4DR6 K;  4B3T K;  4JI5 K;  4JI0 K;  4YY3 K;  4DR1 K;  4DUZ K;  2UXD K;  4JI2 K;  5BR8 K;  2HHH K;  4V19 S;  4X66 K;  1FJG K;  1HR0 K;  4DR7 K;  4GKK K;  4JI6 K;  3OTO K;  4DV6 K;  4JI1 K;  4X62 K;  4X65 K;  3J7A P;  4JI4 K;  4DR5 K;  4LFB K;  2UUA K;  1N32 K;  4YHH K;  3J81 O;  4JI7 K;  4DV0 K;  4DR3 K;  3T1H K;  4B3S K;  4DV2 K;  4AQY K;  4LFA K;  4DV7 K;  4LF5 K;  5AJ3 K;  1IBL K;  4JYA K;  4LF9 K;  2UUB K;  5LMN K;  4GKJ K;  1HNW K;  3J7Y P;  1IBM K;  4B3R K;  1XMO K;  4JI8 K;  3J80 O;  3JAM O;  1XNR K;  2ZM6 K;  2VQE K;  1I94 K;  2UU9 K;  4DR2 K;  4DV1 K;  1N36 K;  1J5E K;  5IT9 O;  1IBK K;  4LF4 K;  4NXM K;  2F4V K;  4CW7 B;  5LMU K;  1HNX K;  5LL6 Z;  4B3M K;  4DUY K;  1HNZ K;  4JI3 K;  1N33 K;  4LF8 K;  4K0K K;  2UUC K;  2E5L K;  4DR4 K;  4KHP K;  4DV4 K;  2UXC K;  2VQF K;  4DV3 K;  1N34 K;  1XMQ K;  5IWA K;  4LF6 K;  4X64 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...