4CVNE

Structure of the fap7-rps14 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
KEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ADENYLATE KINASE
publication title RNA Mimicry by the Fap7 Adenylate Kinase in Ribosome Biogenesis
pubmed doi rcsb
source organism Pyrococcus abyssi ge5
molecule tags Transferase
total genus 35
structure length 126
sequence length 126
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2014-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4cvnE00
4DV3K 2UUCK 2UXDK 4LF5K 1XMQK 5A2QO 4JI5K 1IBKK 1N34K 1N36K 4GKKK 4X64K 2F4VK 5LL6Z 5IT9O 4KHPK 2VQFK 2UXBK 4DV7K 4DUYK 4YHHK 1FJGK 1HNWK 3J7YP 4JYAK 4JI6K 4AQYK 4V19S 3T1HK 4LF4K 3J81O 4DV4K 4B3TK 4LFCK 5LMUK 4LF8K 4DV0K 4JI3K 4B3SK 4GKJK 4X62K 4DV6K 4NXNK 4DR6K 1N33K 4LF7K 4DR7K 4DR1K 4LF9K 4JV5K 4K0KK 4DR5K 1I94K 4DUZK 1IBMK 4DR4K 4DV2K 3J7AP 2UU9K 4CW7B 4X65K 1HR0K 2UUBK 4LFAK 4YY3K 4B3MK 5LMNK 4JI1K 1HNZK 1XNRK 1J5EK 1XMOK 2E5LK 1IBLK 2VQEK 4DR2K 4JI8K 1N32K 3JAMO 4LF6K 4X66K 3T1YK 4DV5K 4JI7K 5IWAK 4DV1K 1XNQK 3J80O 4DR3K 4JI0K 2ZM6K 5BR8K 1HNXK 5FLXO 2UXCK 2UUAK 4OX9K 2HHHK 4NXMK 4JI2K 4LFBK 4B3RK 4JI4K 4CVNE 3OTOK 5AJ3K
chains in the Genus database with same CATH superfamily
1ESVA 4W5OA 2DFHA 2Q3SA 3M8RA 3SUQA 3CCEN 1BO5O 5KRSA 3PX6A 3V9SA 4DSJA 4B9QA 5E26A 2DPNA 3VQ9A 4M42A 4JD2A 2VQFK 2IVPA 1MA9B 2PFUA 5KI6A 1WSJA 3CPWM 2QWNA 2GWJA 4JYAK 3KK1A 3J81O 2W40A 2NZTA 1NKBA 1DEJA 3OVNA 2IOCA 1ATSA 1KSPA 4DWIA 4LF8K 3SV4A 4DMNA 1KAYA 1RT3A 4FVUA 1NJIO 1KCFA 3AA5X 3HP6A 3L2WA 4N47A 1TGOA 3OYHA 3ASMA 4E1NA 2XHBA 2E2NA 4RCHA 4RW6A 1YJ9N 3D0PA 3AY9A 4CHNA 1VQMN 2O8BB 5GAEP 3QIPA 3CQ8A 3KKRA 1BL3A 5T7BA 1MWKA 4DTXA 1QZ5A 3L3UA 1NWKA 1NKEA 3DXKB 4FVMA 4BDZA 3ATVA 4C1NK 4KAZA 2YV0X 1XMOK 3D2FA 1HQUA 2ITMA 3KIOA 4Y1CA 3V9XA 4MLHA 3E01A 3R8EA 3NH0A 4KTZA 5LJWA 3OBYA 4N41A 4BDYA 1W2BM 3ATUA 3BF3A 4CBWA 4CEDA 2ZM6K 2P5GA 3VQQA 1NGGA 3P38A 1A5VA 2OZMA 1KVCA 4ILHA 1X9SA 1TKTA 4KHYA 3QEVA 4AHRA 4GW6A 1GLJO 5GAGP 3O9QA 4FSVA 4FM1A 4NCAA 3TAFA 4CBUA 3S9HA 1T6CA 4KKOA 1IBKK 3VQPA 1S1UA 1VRTA 3FGUA 4ELTA 4WF9L 1XHXA 4NYFA 1MWMA 1DTTA 3SBTA 2B4JA 1SKWA 3TSUA 3WQUA 3QLHA 1XC9A 4V19S 3VQDA 2GBZA 4JKHA 2WFBA 4IWVA 3TAMA 1Q18A 2BANA 1FK9A 3DRRA 1W9HA 4B3SK 4YOTA 1JCEA 1GLFO 2GV9A 3GOIA 4RW4A 2YNHA 2GELA 1ASWA 4DR6K 2I5JA 3EZWA 4FWMA 5C2DA 2QEXN 4AILC 4CFCA 4J8FA 4FW2A 2NRHA 4YNQA 4JKBA 4CFDA 4JV5K 1U6ZA 3THVA 4ISEA 4DR4K 4FWOA 1BGXT 2ZF5O 3FZHA 2WONA 3C94A 3Q7CA 1TUYA 2D0BA 2R7YA 2WOMA 4ILGB 4BR9A 5H1SQ 4YOWA 5FRMA 3KKSA 1HNZK 2P9SA 4PY5A 4KFBA 3EE9A 5DMRA 2W42A 4GMJB 1C0MA 1JLQA 4K8XA 5D3GA 4FLYA 2Q31A 4TSXA 1RDCA 2PZSA 3T69A 3ULEA 4DU4A 3HXMA 3SUNA 4JI0K 3UKUB 4FLWA 4DTMA 4F3OA 1K8KA 4PKHA 4RW8A 2E6MA 4DCHA 3LL3A 3A5NC 1BHLA 2YKNA 4F8RA 1WSFA 2D0CA 4BWMA 1IKYA 4HHTA 3HO1A 2ATQA 2G8KA 3H1VX 4QS7A 4WQ5A 3P83D 4CZJA 4Y0WA 1FKOA 2BDPA 3DYAA 2E1YA 1RILA 3VESA 3V1OA 4FK0A 3ENHA 3VETA 2OTLN 3RVCA 3OW2M 4BG8A 1UWBA 2WBNA 2QA4N 4GY2B 3SJJA 2D0PA 3OJUA 5J2NA 1U2VA 1NK8A 3S3OA 1LV5A 2HVIA 1RNHA 4GKJK 4MFBA 3THWA 4FL9A 2DTUA 3AAPA 3H46O 3QFPA 4C8MA 1CZ9A 1CXUA 3AVLA 2E1ZA 4BRMA 5AQHA 3CCJN 5EY4A 3N4QA 3G71N 3O1WA 3M8PA 5EVZA 5DM6L 3EYZA 1RBRA 1UAXA 4HTUA 3NGZA 4NB4A 2H3GX 3QEWA 4BC4A 1RGIA 4CHOA 1ASUA 1NLVA 2P1JA 4ZTJA 3U8XA 5LY3A 4IOAL 3H45C 3HPHA 3OHRA 3P4IA 5J2MA 5CHIA 4E3SA 4FJ9A 1GLDG 4JI8K 1N32K 4BRKA 4KTQA 3CM5A 5IWAK 3VGKA 4Z4HA 3SMPA 2PY5A 4E0DA 2XRIA 1K6YA 3ZSVA 2A3ZA 4MO4A 3G25A 3HZ6A 5EOYA 2AJQA 5AQWA 3O08A 5AQNA 3THYB 1QVFM 3DJCA 1DT9A 4LFBK 1VSFA 4YOVA 1RTHA 4FLZA 4CIFA 5AQSA 1ITGA 3BZCA 3VQ7A 4H0PA 4Z4IA 3E9LA 4GVEA 1BQMA 3HVTA 1JXBA 1IH7A 1B9DA 3CPEA 4CGIA 1RT1A 1T6DA 3OYBA 1T7PA 3P1GA 1ZBSA 4JAXA 5AFUA 2QWQA 1YJNN 3WXIA 2HVHA 1GLBG 1IKXA 1HNWK 2P9PB 1CZBA 4BRGA 1C0TA 3NE6A 2PAVA 5FPMA 3A2FA 3QMLA 3MXIA 3G0ZA 4KV8A 1HNVA 1XHZA 3VERA 4WQ4C 4FJMA 3OS2A 3AVIA 4EIAA 3VA3A 4L8RB 1A5WA 5CE3A 1WB9A 4LSLA 1LW0A 4YDUA 3K5MA 1NGDA 2HOEA 4O55A 1JCFA 2Y1JA 4M3YA 4CEBA 4DR5K 4IFYA 1D5AA 1L3SA 4CD1A 2ZGYA 5EU7A 4O4GA 2O8FB 3LAKA 4KB1A 5JS1A 1SAZA 4FJHA 4IDKA 1EP4A 2HSTA 2OPQA 3VEZA 4M3ZA 3SAFA 3VF4A 3A5MC 3B6OA 3O5BA 2UYTA 1XNRK 3DMJA 3ITHA 4BQLA 2YKMA 2O8DA 4NLCA 1OH6A 4FLTA 4J2DA 1FXXA 2XO7A 3WEEB 3F73A 1KLMA 4OLAA 4I7FA 1TKXA 2P9UA 2NRWA 3M1FA 4CZKA 4DKWA 5M1FA 1J54A 3SQ1A 1SUQA 3OS1A 3ZX2A 3CCLN 3ZT2A 4EP4A 1HJOA 3CC2N 1TYQB 5ADXA 2P9LB 2YX6A 4KH4A 3ZX3A 4H03B 4DFKA 1CLQA 1SQKA 5AQUA 1VQ5N 3LDNA 4CZHA 3EL2A 2D0AA 1BUPA 3OTOK 3AA3A 2QI2A 3RWUA 2FBXA 3ZSRA 2BH1A 2D4WA 4EHUA 3QERA 4BRIA 1VSKA 3PIOL 2O4GA 4G9ZA 4CJTA 4KREA 4OJRA 1NJZA 2D0OA 4W5TA 4QCLA 3LANA 4X64K 2W6KA 4IEEA 1ZBHA 1RBVA 2GTDA 2D5RA 1HKCA 3CJAA 4JI6K 2OPSA 3KWGA 4ZTFA 4A62A 3LZJA 3SZ2A 2HMPA 3VOVA 4O8UA 2E8AA 1Q81O 1IJJA 4DV6K 2O8BA 3TABA 1GLEG 1LW2A 4CEFA 2WC9A 1U48A 2VG5A 1S22A 4G1QA 3PO5A 4CI6A 4NYNA 3E1YA 1QQCA 3VEXA 3OYJA 3M8SA 3SAGA 5AZIB 3SUPA 3H08A 3JYTA 3FE1A 3J7AP 3K59A 5E84A 1TK8A 3L4QA 3MEDA 1KVBA 4Z94A 4E89A 3CD6N 2BTFA 1LWCA 5HRSA 4O0IA 4FJNA 3EN9A 4H0VB 4DQIA 3QINA 2IVOA 1T03A 3W3DA 3CC4N 3NF6A 4I6MB 4KHNA 1DGKN 4BREA 1YJWN 4B9LA 1VAZA 4XH4A 4BR5A 4F9OA 2E6LA 2IIRA 3CETA 5JVGL 1LOTB 1Z26A 3VEOA 3V4IA 3A5LC 2HF3A 3U3GA 2IDOA 1L3TA 1HYZA 1SKSA 2EX3A 3CCQN 1LWFA 1TAUA 3O4NA 1SL1A 4PWDA 4A59A 4BY9C 1N34K 3PSIA 1NM1A 3ZSOA 4DLEA 4CJKA 4A61A 4DSFA 4JEPA 5LL6Z 2P9IA 1NOZA 1S1VA 4RW9A 3B6PA 3V9UA 1KTQA 3VEYA 5GAHP 3J7YP 3SCXA 1WSHA 4Z0UA 3AVJA 2FF3B 3O1BA 3JS6A 4CJPA 1YHQN 1JLFA 4JI3K 4KBOA 3SUOA 1I3AA 1HMVA 3TTFA 1VQNN 5AR0A 4BQZA 3HM9A 2A1SA 4NXNK 4JKCA 5M1KA 3CQYA 2YNIA 3T1AA 3VA0A 2HBMA 3TAQA 3VF2A 3ULDA 4DR1K 4LF9K 3M5RA 3ZEUA 1NGCA 1QHTA 4FJJA 2VWJA 4N56A 5B8HA 1NKCA 1XUPO 1VQON 5AQRA 1M90O 1Z25A 2NRZA 5C42A 4FLUA 3AA4A 3GDQA 3ZT3A 3HTVA 5LMNK 3H1QA 4IZ9A 3K57A 3C7NA 4M3TA 4DTRA 3SV3A 4CGDA 3RR8A 4CJLA 2CH6A 3JAMO 3OA9A 4E7JA 4X66K 2JWLA 2FSNA 3DOKA 4B9TA 4JI7K 4DV1K 2O8EB 3RMCA 2YHYA 3J80O 2Q1NA 1ILYA 3CFOA 3CG7A 4J2AA 3BZKA 5AQQA 4JK9A 3QEXA 3O3FA 2QKKA 4FZZA 3T19A 3AO3A 1QSLA 1KFDA 4W5NA 1O13A 2QWOA 3MWPA 4Z4CA 5FROA 3D45A 4DS5A 1NMDA 3CF5L 4J2EA 1V4TA 3SLCA 4JHDB 2RHKA 4IXCA 4WE1A 1T8EA 1NGIA 4KHPK 4O5BA 2GEMA 1X9WA 1FKPA 3FFKB 3SI6A 3THXB 5KPTA 5BPLA 1NMNA 2YHXA 3MXMA 2X78A 3C6TA 4C8KA 3CFRA 2ZWHA 4ZHRA 5GADP 4CJ5A 4FWNA 2QWLA 4DU1A 2XY8A 2VWBA 3NGIA 4QOZB 3SBGA 3IRXA 2NRRA 2HF4A 2CGLA 4JLHA 5AQXA 3CJBA 5F2RA 3CCSN 3ENBA 3PLAA 2E88A 5J2PA 2KQ2A 4WFAL 3KZBA 4CFBA 4DS4A 2BE2A 3K9JA 3KLFA 4LF7K 3F9MA 3S41A 2FBYA 4BRHA 1ZBLA 4K0KK 3PUFA 3QETA 2Z1HA 1BI4B 2KW4A 3LAMA 4DSIA 4GVMA 3J7ZO 4E7HA 3CYMA 3TI0A 1IO2A 3LP0A 3LPUA 3HJFA 5AQZA 4BGBA 4PL8A 1U47A 3NHGA 4B3MK 3U9ZA 4BRFA 5HRRA 2KZMA 1ATNA 4KH6A 3O9TA 4WFNL 2QXLA 1GOBA 2VQEK 1WAFA 1RT7A 3I0RA 4FWPA 3VGMA 1SL0A 4CF1A 4J2BA 3F9KA 3LM9A 1NNEA 2YCHA 4LF6K 4H8KA 4CHYA 3THYA 1X3NA 3QESA 3PO4A 3D2EB 5JLFA 4KO0A 2JLEA 4C1NI 5SZTA 4IOXA 1OH5A 1R0AA 1BDGA 1N6QA 1RDBA 3SQ4A 1R59O 2HB5A 3IFRA 3LP2A 3OYAA 4AHVA 3SAHA 3AVHA 4E19A 2BGGA 3F2KA 4OKEA 5FPNA 3U4LA 5AFUH 1YT3A 4BVOA 2HBKA 5AJ3K 3DOLA 5BN8A 4JN4A 2P9PA 3AVBA 2EHGA 3HPOA 1JCGA 5KGWA 3EZ5A 3LP3A 3OYDA 3RTVA 1S5JA 2E4LA 1BWFO 1KXPA 4FWQA 1RBTA 3K5NA 4F2SA 4H5RA 2UXBK 4IEIA 4DUYK 5JVHL 3HRGA 3VQ5A 4B9VA 3K2PA 4H5WA 1VQLN 4DV4K 4B3TK 4OO1J 2A5XA 3EE8A 1LCUA 3DLKA 1LAWA 3ZX0A 1L3UA 3AVNA 5C0YA 4CIEA 3NF9A 5HP1A 4KHWA 1X1PA 1WAJA 4HWIA 3OYKA 3V1RA 2AP1A 5AQPA 1Q9XA 4IO9L 4CZMA 3ZETA 3FZLA 3O3HA 5EX5A 2HNYA 2HNDA 4R79A 4FJKA 3L2VA 2QXFA 5KPRA 4FJ5A 2V52B 3VQ4A 1WBBA 4CE9A 5AQLA 4FPBA 3DXMA 3AA2A 5F1XA 4CW7B 3QDKA 1HR0K 2UUBK 3OJSA 2WTUA 1REVA 4UQGA 3HYFA 4R5PA 4DFJA 1RDUA 4BGAA 1VQ7N 4KI4A 4Z4EA 3DLEA 2XY7A 3TWHA 1JLGA 1OH8A 1UA0A 1WSIA 1OKJA 2FC0A 1HPMA 3VQ8A 1WNSA 4KI6A 4A2BA 4H0OA 4BC3A 2HHSA 3IDHA 2P9LA 1SZ2A 5ADXH 4PHTX 1DTQA 5CYMA 1C1BA 1QTMA 1RTIA 3AO5A 3LDSA 3TR8A 2OA8A 4CJVA 2UXCK 3MAQA 1QZ6A 3H3OB 1BQNA 1BG3A 4GV6A 4BROA 4HUEA 5AQKA 4JI2K 2XY6A 1RTDA 5FRNA 3B8AX 4M45A 1TK0A 1Y97A 1X9MA 3JXUA 1YTUA 4DV3K 1N5YA 4HUGA 3C6HA 4JI5K 3CCUN 5DM7L 3AV9A 4PQUA 4CJSA 2F96A 3MX5A 4BR7A 4CEAA 1LWEA 5HROA 1TKDA 3CQXA 1NBWA 3OYNA 3IG1A 4N5SA 3V9ZA 3LWMA 1RCHA 3PX4A 5ELZA 1OVQA 5LMUK 3TARA 2YNFA 4U67L 1E3MA 3K9KA 3T7ZA 4CF2A 2J4RA 4HUFA 4H5VA 1GOAA 2EWSA 4JK8A 3NH2A 2ZJPL 2RPIA 4JKGA 1ZXOA 3ZSQA 2JWKA 2GUPA 1K8AO 3L4IA 4O8KA 3WXJA 2DFFA 4KHQA 3R6MA 4IG3A 1VSDA 3OYGA 1BISA 2KFNA 1VHXA 4I6MA 1S9GA 1X9JA 1HPZA 4M41A 3ID8A 4IFVA 4MDBA 3WNFA 3C65A 3ZYYX 3BUZB 5J1EA 4JK7A 3WUHA 5AQTA 4AM7A 3MX2A 4BRNA 1CZAN 4DR3K 3PV8A 4NO7A 1WSEA 1VQ6N 4CGFA 5JICA 3C0BA 4CGHA 4E7KA 4B1YB 2UUAK 3O3GA 2YJEA 4ID5A 4OX9K 3MN5A 3ZSWA 2Z1GA 3VEVA 5JLHA 3ALYA 4ICLA 2Z1JA 5HLFA 4CGGA 4IDHA 3VQ6A 3TSQA 1TL3A 2YJFA 3AVCA 3RRHA 2I7PA 3UKRA 2HMIA 3VQBA 1UA1A 3H3NO 3AVAA 1XMQK 3KWIA 4JNEA 1Q8IA 2Y1IA 2P9NB 3D7EO 1D8YA 4QS9A 3RMAA 3WNHA 4WYBA 5E41A 4DFMA 5KQ8A 5AQOA 4DTOA 3A8YA 3IS9A 3TTCA 3QO9A 3O9RA 4O5FA 2NLXA 1BU6O 4DQQA 4XIUA 2FF6A 1X3MA 2QWRA 4LF4K 3THWB 4DTSA 4OKKA 4CHZA 4EHTA 2Q36A 5FDLA 4IJAA 4M7YA 2HHVA 1YUWA 4DF4A 4PKGA 4WQ5C 4CF0A 3CJ9A 5C2FA 3AVGA 5GIPA 1J5OA 1N33K 1IV0A 2QKBA 1S3XA 3SJHA 3AVMA 3ZSXA 3SQ2A 3NF7A 4M3UA 1D4XA 3I55N 1K9MO 3VQAA 5I9EB 1YAGA 2V7ZA 2I7NA 3R9PA 2P51A 5CYQA 3LDLA 3K5OA 3V1QA 1CXQA 2ASMA 5AQYA 4A2AA 1QQOA 2HBJA 3I8BA 3AVKA 3D6RA 5BPNA 4OPAA 1WUAA 1C0FA 3MXJA 1BA1A 4KB0A 2KHOA 2ZJQL 1OVYA 2A41A 2O8EA 1E4FT 4DSKA 2GWKA 2VG6A 3HBTA 1EWQA 5TKWA 3IUCA 2FSJA 2G8HA 3MN7A 3ID6A 3NGYA 4H0XB 4I9QA 3DXKA 2G8UA 4CEEA 4IJNA 1L5UA 2AA4A 3HSTB 4DB3A 1UOCA 3BDPA 4NCBA 4A5AA 4B8AB 2IS3A 2HW3A 3HOSA 4QAGA 4FJGA 1T44A 2YHBA 3TANA 3M6GA 2HHHK 1NGHA 4C8NA 1KQSM 1NJYA 4PL7A 5HRPA 1Q7YO 3THXA 1W97L 1HYSA 4EAHD 2RF2A 3BGRA 1S72N 4N76A 2UXDK 3VENA 2IAJA 3QB0A 1BCMA 5A2QO 3CMEN 5BRDA 1EXQA 4MO5A 1O1WA 4FWSA 1B92A 3NBPA 3RSEB 1QSSA 2W41A 4B1ZA 4DLGA 3QNOA 2QW9A 1YXQA 4A5BA 5KPZA 3LDOA 3MN6A 1NK0A 3O6WA 4EZ9A 3ZT4A 2DY4A 2QM1A 4KRFA 1SL2A 5BRFA 3AGKA 2KZZA 1EWRA 4FWKA 2ASOA 3DM2A 3PSFA 4KTWA 1C1AA 4AF1A 3HT3A 5BR9A 5AQGA 4DFPA 4BRCA 3FZFA 4GV9A 1HQEA 1RDDA 1BI4A 1YITN 1MU2A 4JKEA 1KC8O 5GIOA 3CERA 3CXCM 4IO8A 1T05A 3UE5A 4MLEA 3I33A 2ITGA 3VTHA 4CEOA 1GLAG 1C0GA 4I9LA 4FZXC 2P5OA 1HUXA 4DV2K 2PBDA 1J9AA 2UU9K 5GINA 3U9DA 3WNGA 2OANA 1NGBA 3KLIA 1EQYA 3VN5A 3LZIA 4LFAK 5K14A 4YY3K 4IG0A 3K0SA 3V81A 3SK3A 4YDUC 2QTDA 2VCPA 4BRQA 3D2EA 2KFZA 3JSMA 4C8LA 2P9UB 1IBLK 1DKGD 2O8CB 3SYZA 1U45A 4KHSA 3BY5A 3RRGA 4RW7A 1KAXA 3TAPA 1MDUB 3TAGA 5CZ2A 3NH1A 2JGUA 1VSHA 3DRSA 3CMAN 1HNXK 2XY5A 4K43A 1NOYA 5JMVA 4NXMK 3NAEA 3QNNA 3UKUA 1VSJA 1NGJA 4A57A 3SQ0A 4K8ZA 4C23A 5I3UA 3V9WA 4JI4K 3K5LA 1SV5A 4IBNA 3DRPA 5BPMA 4BE0A 4FZYA 4LF5K 2YHAA 5FPEA 1S1WA 4DQ8A 1BIUA 1ZBFA 2CGJA 5HL7L 1BCOA 4EFHA 1F21A 1D9FA 3HSCA 1RDAA 4LH5A 4E1JA 4IFEA 3L2UA 2PYLA 4XEIA 2KKZA 4YHHK 4BC5A 3L2QA 1EETA 4FK4A 4CJUA 4QS8A 3WXLA 1HKBA 2OYQA 4FJLA 4CJQA 3MN9A 4CEQA 4YFUA 3K58A 3CCMN 1S1TA 4RTFD 4B08A 1P90A 3ZT1A 1S9EA 1KLNA 3L0QA 4ISFA 1NJWA 4CJWA 3KD5E 4CZEA 4DQSA 3TTDA 4FJIA 2DFEA 3FFIA 4CZFA 4FLXA 2P9KB 1VRUA 3AVFA 4EZ6A 2ZGZA 1RT2A 4IOCL 5AZJB 3NVMA 4DTPA 1NK7A 5BREA 4BRPA 3LDPA 1TVRA 3IKMA 4BDPA 4K25A 3TAEA 4FM2A 3ZSZA 3L8BA 1VQKN 2BUPA 1VQ8N 1NGEA 3AO4A 3BEXA 3KLHA 4CD3A 4ILJA 4OGEA 5CR4A 4H0TB 4E1MA 2E2PA 1ZYQA 4MQ3A 4B9SA 3W0LA 3VGLA 3GBTA 1SS6A 3I8DA 4CESA 3OBWA 3S3NA 4Q5VA 1D9DA 3RR7A 3IAYA 5J2QA 4PKIA 2GX9A 2RKIA 3O4WA 2HBLA 5BR8K 5KTQA 1GLLO 4Y1DA 4B9MA 4F2RA 3PX0A 2X74A 2YHWA 5KGXA 4B1VA 4FJ8A 3QICA 3AO2A 3VMFB 4HCCA 3H6EA 1H1VA 4B3RK 3V6DA 4CVNE 2VWKA 4OLBA 3AGRA 2P9IB 2NNWA 2UUCK 4MDAA 3VTIA 1OH7A 5C25A 4WQ4A 4FM0A 3HL8A 1WBDA 5DK5A 5IT9O 4BWJA 2ASPA 4DV7K 1WOQA 3CC7N 3TPQA 4DSLA 1SKRA 3DI6A 1QSYA 1EX4A 2OPRA 4CZIA 3TU5A 1VSEA 1LAVA 4NLBA 4BE2A 4GV3A 1Y64A 4JD2B 5TKYA 2OZSA 5JS2A 3WT0A 3CIPA 3QEIA 4I2PA 1QS4A 1TV6A 5M1QA 2O4IA 2ZJRL 1B9FA 1NK5A 4BG9A 4FJXA 1G15A 3ZEUB 3CCRN 3NCIA 3KHYA 3WXKA 5AQVA 1WLJA 3MDQA 1VQ9N 4CJ7A 1RBSA 2X6SA 1N8RO 4DR7K 4CFAA 1RDWX 2V7YA 1IG8A 3LM2A 4E7LA 1IG9A 4FOIA 4F4KA 4DUZK 4BRAA 1I39A 3OYEA 3C6UA 3QEPA 1WSGA 4CK3A 3G4SN 1Z05A 3C7NB 4FWRA 4PA1A 3EY1A 4H5NA 1KAZA 1W7AA 3NMUA 2O8FA 3CFPA 3ZLJA 4LY7A 3HK2A 3P31A 4ELUA 4AH9A 1J5EK 3FLCO 4K42A 3EO3A 4FJ7A 1A5XA 1YVNA 4O44A 2Q97A 4XH5A 4HVJA 2A42A 4CIGA 3O9SA 4CF8A 1EKEA 4DV5K 4H0YB 3VEWA 3R1XA 3QBWA 3D2FB 3MK6A 1ZC6A 3VF6A 1KFSA 4DTNA 3WEEA 2V51B 2E2OA 5EXWA 2IVNA 1VSLA 2Q2RA 3NVKA 4WCEL 1XC3A 3OYIA 1JL2A 4DQPA 3SPYA 2FXUA 2P9NA 3GE1A 3BP8A 4FCYA 1BOTO 4B1UB 4CK2A 2FBTA 4FO0A 4H5TA 1RT5A 3RMDA 1TYQA 4BRDA 3MEGA 4CJ3A 5KRTA 1ATRA 1S6QA 4CJFA 3CHWA 4CCHA 1YIJN 4AHTA 1FW6A 5AQIA 5AQFA 4OPHA 3IMXA 3O80A 5MLCQ 1VQ4N 3KK3A 1YVUA 1FJGK 3KVGA 4JKDA 3WXMB 4C8OA 3KK7A 1RT4A 3OS0A 3RMBA 1IKWA 3DAWA 1EO1A 2W6LA 3MCAB 2NUBA 2HNZA 1GLCG 1HX1A 4DU3A 1JXEA 1E4GT 3OY9A 1NG9A 2VYPA 5BN9A 1VQPN 4OVLA 2G8WA 1S6PA 4CZGA 4H4OA 4BR0A 1Q9YA 1TKZA 1RBUA 1TAQA 4YORA 4CJ4A 3EEQA 4JS5A 4YOUA 5C15A 1KD1O 3OYFA 5AQJA 3ISNC 5I42A 4BRLA 4DSEA 3DWLA 3Q7BA 3KJVA 1NGFA 2WUSA 4JKAA 4DTUA 1I94K 3A5OC 3TSPA 3LP1A 2A6AA 3CCVN 4OKJA 2QK9A 2RE2A 2OPPA 3LDQA 1YTAA 4LSNA 3DLLL 3ZSYA 3SPZA 5C24A 5AZIA 4CECA 1JLBA 4JI1K 1J6ZA 4CBXA 4JRPA 3HPGA 3E9OA 2Q0RA 3OYCA 5FPDA 4DR2K 2ZE2A 2B6AA 3UB5A 4M3WA 2E2QA 5AQMA 4CJRA 2HHUA 3L6QA 3ENOA 2ZD1A 1JLAA 3LALA 4LC9B 2P9SB 3O4QA 4Q0BA 4FW1A 4B8CA 2NRTA 2IC3A 3DLRA 3E66A 3F5TA 2OCEA 1HKGA 3ULEB 2LSNA 2HHXA 3OYLA 3CI5A 1DLOA 3RSEA 2F8SA 1K8KB 3QIOA 2FSKA 2E20A 4OPKA 4B9NA 3P5JA 3C95A 1YF5L 2A40A 1HYVA 5LJVA 4HCBA 3PIPL 2VG7A 1Q86O 2RN2A 2G8FA 2NRVA 1NK4A 4Z4FA 3R3LA 1XI1A 3EKSA 1GOCA 3O8MA 4AQYK 3T1HK 2G8IA 4W5RA 4FOEA 3O9UA 1TL1A 2HHTA 4AHUA 3HM8A 2NRXA 3VQEA 4B1WB 5KQDA 4DV0K 3NFAA 1QE1A 3OYMA 1G99A 2G8VA 3ZETB 3DLBA 2HHWA 5M1OA 1P8ZA 3EKUA 3VQCA 4CJEA 5HOOA 4BVPA 1U2VB 3DXMB 4NCGA 2F8TA 3HOTA 3A0IX 4O0JA 4JRQA 3MEEA 1TK5A 3KLEA 1VK0A 5C10A 4H4MA 4M3RA 1JKHA 2VGMA 3CJ1A 4HTLA 1NK9A 2O8CA 1JJ2M 1L3VA 3G6EN 4FPAA 1RTJA 1QVGM 4X65K 1QQMA 3I0SA 3AARA 1HJRA 4BR4A 1V4SA 4OPJA 4FWLA 4ID1A 4ELVA 2E5LK 2GUIA 1JLEA 4CEZA 4BR2A 1NU0A 5M1NA 3QBXA 1VSIA 3NDKA 3J8AA 1JLCA 3LPTA 3DLHA 2YNGA 4FLVA 3T1YK 3SNNA 1XNQK 1TUUA 1C1CA 5C12A 3L2RA 1C0UA 3FZMA 3M8QA 1KRPA 1NK6A 4Z4GA 4AM6A 3PY8A 4KPYA 1W0HA 4DHYA 2ETJA 4W5QA 2KLAA 2B5JA 4YOXA 1BA0A 2VGNA 3BF1A 5CY4A 1KVAA 2QWPA 5HRNA 4M3XA 1XWLA 4FXDA 1YI2N 2CGKA 1S1XA 3T3FA 3M3ZA 2IGIA 4LD0A 1N36K 4GKKK 4BACA 4RWTA 1ZBIA 1QQNA 2F4VK 3ZT0A 4M63C 3SMSA 4K41A 3MWTA 4GNIA 3I56N 2ZQBA 1C6VA 3U6FA 4FK2A 2F9TA 3MECA 3C6AA 5CZ1A 4EP5A 4YOYA 5M1PA 1ZBUA 3AAQA 3N4PA 2KTQA 5F0XA 4JHDA 4AHSA 2D1KA 4B9UA 4WFBL 1HNIA 2X6NA 1J53A 1M1KO 4LFCK 1VSMA 1HLUA 2F9WA 2P9KA 3HI0A 4CZLA 2PYJA 1K73O 3GL1A 3HVRA 3S3MA 4CHQA 4X62K 3DLGA 5AZJA 3QFUA 4JKGB 3KD1E 4F3TA 1HRHA 1IKVA 1RT6A 3WQTA 2Z1IA 3AO1A 3LWLA 4JS4A 3HP9A 4ISGA 4BE1A 1U49A 4E7IA 1RFQA 4DG1A 3CM6A 1JL1A 1T3VA 4IKFA 4I2QA 4CERA 3U3YA 1IBMK 2FLOA 1Z6RA 2Q0UA 2QWMA 3CJCA 2FBVA 4KHUA 3FR0A 1U04A 4KH5A 4U7BA 1NGAA 4B3OA 4XH1A 3CJ7A 4DF8A 1XQSC 3UIQA 4CHPA 3KTQA 2F7TA 1U4BA 3MCPA 3NF8A 3MMVA 4JKFA 1NJXA 3L3VA 4PUOA 4RG8A 3ZCMA 5HBMA 3WNEA 4M7XA 5BRHA 2A1RA 4B1XB 3VPZA 2CH5A 1Q82O 3E9PA 4CGJA 3KK2A 2O8DB 4L3QA 2HHQA 3KLGA 3G10A 4CK1A 5FLXO 1WN7A 5SWMA 3UKRB 4BC2A 4DTJA 1ASVA 4OGCA 4DQRA 2YI1A 1BIZA 3GG4A 4FYDA 4AHCA 3P39A 2OTJN 4LH4A 1QHAA 3FZKA 4CF9A 4UY8O
chains in the Genus database with same CATH topology
4DV3K 2UUCK 2UXDK 4LF5K 1XMQK 5A2QO 4JI5K 1IBKK 1N34K 1N36K 4GKKK 4X64K 2F4VK 5LL6Z 5IT9O 4KHPK 2VQFK 2UXBK 4DV7K 4DUYK 4YHHK 1FJGK 1HNWK 3J7YP 4JYAK 4JI6K 4AQYK 4V19S 3T1HK 4LF4K 3J81O 4DV4K 4B3TK 4LFCK 5LMUK 4LF8K 4DV0K 4JI3K 4B3SK 4GKJK 4X62K 4DV6K 4NXNK 4DR6K 1N33K 4LF7K 4DR7K 4DR1K 4LF9K 4JV5K 4K0KK 4DR5K 1I94K 4DUZK 1IBMK 4DR4K 4DV2K 3J7AP 2UU9K 4CW7B 4X65K 1HR0K 2UUBK 4LFAK 4YY3K 4B3MK 5LMNK 4JI1K 1HNZK 1XNRK 1J5EK 1XMOK 2E5LK 1IBLK 2VQEK 4DR2K 4JI8K 1N32K 3JAMO 4LF6K 4X66K 3T1YK 4DV5K 4JI7K 5IWAK 4DV1K 1XNQK 3J80O 4DR3K 4JI0K 2ZM6K 5BR8K 1HNXK 5FLXO 2UXCK 2UUAK 4OX9K 2HHHK 4NXMK 4JI2K 4LFBK 4B3RK 4JI4K 4CVNE 3OTOK 5AJ3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 K;  2UUC K;  2UXD K;  4LF5 K;  1XMQ K;  5A2Q O;  4JI5 K;  1IBK K;  1N34 K;  1N36 K;  4GKK K;  4X64 K;  2F4V K;  5LL6 Z;  5IT9 O;  4KHP K;  2VQF K;  2UXB K;  4DV7 K;  4DUY K;  4YHH K;  1FJG K;  1HNW K;  3J7Y P;  4JYA K;  4JI6 K;  4AQY K;  4V19 S;  3T1H K;  4LF4 K;  3J81 O;  4DV4 K;  4B3T K;  4LFC K;  5LMU K;  4LF8 K;  4DV0 K;  4JI3 K;  4B3S K;  4GKJ K;  4X62 K;  4DV6 K;  4NXN K;  4DR6 K;  1N33 K;  4LF7 K;  4DR7 K;  4DR1 K;  4LF9 K;  4JV5 K;  4K0K K;  4DR5 K;  1I94 K;  4DUZ K;  1IBM K;  4DR4 K;  4DV2 K;  3J7A P;  2UU9 K;  4CW7 B;  4X65 K;  1HR0 K;  2UUB K;  4LFA K;  4YY3 K;  4B3M K;  5LMN K;  4JI1 K;  1HNZ K;  1XNR K;  1J5E K;  1XMO K;  2E5L K;  1IBL K;  2VQE K;  4DR2 K;  4JI8 K;  1N32 K;  3JAM O;  4LF6 K;  4X66 K;  3T1Y K;  4DV5 K;  4JI7 K;  5IWA K;  4DV1 K;  1XNQ K;  3J80 O;  4DR3 K;  4JI0 K;  2ZM6 K;  5BR8 K;  1HNX K;  5FLX O;  2UXC K;  2UUA K;  4OX9 K;  2HHH K;  4NXM K;  4JI2 K;  4LFB K;  4B3R K;  4JI4 K;  4CVN E;  3OTO K;  5AJ3 K; 
#chains in the Genus database with same CATH topology
 1ESV A;  4W5O A;  2DFH A;  2Q3S A;  3M8R A;  3SUQ A;  3CCE N;  1BO5 O;  5KRS A;  3PX6 A;  3V9S A;  4DSJ A;  4B9Q A;  5E26 A;  2DPN A;  3VQ9 A;  4M42 A;  4JD2 A;  2VQF K;  2IVP A;  1MA9 B;  2PFU A;  5KI6 A;  1WSJ A;  3CPW M;  2QWN A;  2GWJ A;  4JYA K;  3KK1 A;  3J81 O;  2W40 A;  2NZT A;  1NKB A;  1DEJ A;  3OVN A;  2IOC A;  1ATS A;  1KSP A;  4DWI A;  4LF8 K;  3SV4 A;  4DMN A;  1KAY A;  1RT3 A;  4FVU A;  1NJI O;  1KCF A;  3AA5 X;  3HP6 A;  3L2W A;  4N47 A;  1TGO A;  3OYH A;  3ASM A;  4E1N A;  2XHB A;  2E2N A;  4RCH A;  4RW6 A;  1YJ9 N;  3D0P A;  3AY9 A;  4CHN A;  1VQM N;  2O8B B;  5GAE P;  3QIP A;  3CQ8 A;  3KKR A;  1BL3 A;  5T7B A;  1MWK A;  4DTX A;  1QZ5 A;  3L3U A;  1NWK A;  1NKE A;  3DXK B;  4FVM A;  4BDZ A;  3ATV A;  4C1N K;  4KAZ A;  2YV0 X;  1XMO K;  3D2F A;  1HQU A;  2ITM A;  3KIO A;  4Y1C A;  3V9X A;  4MLH A;  3E01 A;  3R8E A;  3NH0 A;  4KTZ A;  5LJW A;  3OBY A;  4N41 A;  4BDY A;  1W2B M;  3ATU A;  3BF3 A;  4CBW A;  4CED A;  2ZM6 K;  2P5G A;  3VQQ A;  1NGG A;  3P38 A;  1A5V A;  2OZM A;  1KVC A;  4ILH A;  1X9S A;  1TKT A;  4KHY A;  3QEV A;  4AHR A;  4GW6 A;  1GLJ O;  5GAG P;  3O9Q A;  4FSV A;  4FM1 A;  4NCA A;  3TAF A;  4CBU A;  3S9H A;  1T6C A;  4KKO A;  1IBK K;  3VQP A;  1S1U A;  1VRT A;  3FGU A;  4ELT A;  4WF9 L;  1XHX A;  4NYF A;  1MWM A;  1DTT A;  3SBT A;  2B4J A;  1SKW A;  3TSU A;  3WQU A;  3QLH A;  1XC9 A;  4V19 S;  3VQD A;  2GBZ A;  4JKH A;  2WFB A;  4IWV A;  3TAM A;  1Q18 A;  2BAN A;  1FK9 A;  3DRR A;  1W9H A;  4B3S K;  4YOT A;  1JCE A;  1GLF O;  2GV9 A;  3GOI A;  4RW4 A;  2YNH A;  2GEL A;  1ASW A;  4DR6 K;  2I5J A;  3EZW A;  4FWM A;  5C2D A;  2QEX N;  4AIL C;  4CFC A;  4J8F A;  4FW2 A;  2NRH A;  4YNQ A;  4JKB A;  4CFD A;  4JV5 K;  1U6Z A;  3THV A;  4ISE A;  4DR4 K;  4FWO A;  1BGX T;  2ZF5 O;  3FZH A;  2WON A;  3C94 A;  3Q7C A;  1TUY A;  2D0B A;  2R7Y A;  2WOM A;  4ILG B;  4BR9 A;  5H1S Q;  4YOW A;  5FRM A;  3KKS A;  1HNZ K;  2P9S A;  4PY5 A;  4KFB A;  3EE9 A;  5DMR A;  2W42 A;  4GMJ B;  1C0M A;  1JLQ A;  4K8X A;  5D3G A;  4FLY A;  2Q31 A;  4TSX A;  1RDC A;  2PZS A;  3T69 A;  3ULE A;  4DU4 A;  3HXM A;  3SUN A;  4JI0 K;  3UKU B;  4FLW A;  4DTM A;  4F3O A;  1K8K A;  4PKH A;  4RW8 A;  2E6M A;  4DCH A;  3LL3 A;  3A5N C;  1BHL A;  2YKN A;  4F8R A;  1WSF A;  2D0C A;  4BWM A;  1IKY A;  4HHT A;  3HO1 A;  2ATQ A;  2G8K A;  3H1V X;  4QS7 A;  4WQ5 A;  3P83 D;  4CZJ A;  4Y0W A;  1FKO A;  2BDP A;  3DYA A;  2E1Y A;  1RIL A;  3VES A;  3V1O A;  4FK0 A;  3ENH A;  3VET A;  2OTL N;  3RVC A;  3OW2 M;  4BG8 A;  1UWB A;  2WBN A;  2QA4 N;  4GY2 B;  3SJJ A;  2D0P A;  3OJU A;  5J2N A;  1U2V A;  1NK8 A;  3S3O A;  1LV5 A;  2HVI A;  1RNH A;  4GKJ K;  4MFB A;  3THW A;  4FL9 A;  2DTU A;  3AAP A;  3H46 O;  3QFP A;  4C8M A;  1CZ9 A;  1CXU A;  3AVL A;  2E1Z A;  4BRM A;  5AQH A;  3CCJ N;  5EY4 A;  3N4Q A;  3G71 N;  3O1W A;  3M8P A;  5EVZ A;  5DM6 L;  3EYZ A;  1RBR A;  1UAX A;  4HTU A;  3NGZ A;  4NB4 A;  2H3G X;  3QEW A;  4BC4 A;  1RGI A;  4CHO A;  1ASU A;  1NLV A;  2P1J A;  4ZTJ A;  3U8X A;  5LY3 A;  4IOA L;  3H45 C;  3HPH A;  3OHR A;  3P4I A;  5J2M A;  5CHI A;  4E3S A;  4FJ9 A;  1GLD G;  4JI8 K;  1N32 K;  4BRK A;  4KTQ A;  3CM5 A;  5IWA K;  3VGK A;  4Z4H A;  3SMP A;  2PY5 A;  4E0D A;  2XRI A;  1K6Y A;  3ZSV A;  2A3Z A;  4MO4 A;  3G25 A;  3HZ6 A;  5EOY A;  2AJQ A;  5AQW A;  3O08 A;  5AQN A;  3THY B;  1QVF M;  3DJC A;  1DT9 A;  4LFB K;  1VSF A;  4YOV A;  1RTH A;  4FLZ A;  4CIF A;  5AQS A;  1ITG A;  3BZC A;  3VQ7 A;  4H0P A;  4Z4I A;  3E9L A;  4GVE A;  1BQM A;  3HVT A;  1JXB A;  1IH7 A;  1B9D A;  3CPE A;  4CGI A;  1RT1 A;  1T6D A;  3OYB A;  1T7P A;  3P1G A;  1ZBS A;  4JAX A;  5AFU A;  2QWQ A;  1YJN N;  3WXI A;  2HVH A;  1GLB G;  1IKX A;  1HNW K;  2P9P B;  1CZB A;  4BRG A;  1C0T A;  3NE6 A;  2PAV A;  5FPM A;  3A2F A;  3QML A;  3MXI A;  3G0Z A;  4KV8 A;  1HNV A;  1XHZ A;  3VER A;  4WQ4 C;  4FJM A;  3OS2 A;  3AVI A;  4EIA A;  3VA3 A;  4L8R B;  1A5W A;  5CE3 A;  1WB9 A;  4LSL A;  1LW0 A;  4YDU A;  3K5M A;  1NGD A;  2HOE A;  4O55 A;  1JCF A;  2Y1J A;  4M3Y A;  4CEB A;  4DR5 K;  4IFY A;  1D5A A;  1L3S A;  4CD1 A;  2ZGY A;  5EU7 A;  4O4G A;  2O8F B;  3LAK A;  4KB1 A;  5JS1 A;  1SAZ A;  4FJH A;  4IDK A;  1EP4 A;  2HST A;  2OPQ A;  3VEZ A;  4M3Z A;  3SAF A;  3VF4 A;  3A5M C;  3B6O A;  3O5B A;  2UYT A;  1XNR K;  3DMJ A;  3ITH A;  4BQL A;  2YKM A;  2O8D A;  4NLC A;  1OH6 A;  4FLT A;  4J2D A;  1FXX A;  2XO7 A;  3WEE B;  3F73 A;  1KLM A;  4OLA A;  4I7F A;  1TKX A;  2P9U A;  2NRW A;  3M1F A;  4CZK A;  4DKW A;  5M1F A;  1J54 A;  3SQ1 A;  1SUQ A;  3OS1 A;  3ZX2 A;  3CCL N;  3ZT2 A;  4EP4 A;  1HJO A;  3CC2 N;  1TYQ B;  5ADX A;  2P9L B;  2YX6 A;  4KH4 A;  3ZX3 A;  4H03 B;  4DFK A;  1CLQ A;  1SQK A;  5AQU A;  1VQ5 N;  3LDN A;  4CZH A;  3EL2 A;  2D0A A;  1BUP A;  3OTO K;  3AA3 A;  2QI2 A;  3RWU A;  2FBX A;  3ZSR A;  2BH1 A;  2D4W A;  4EHU A;  3QER A;  4BRI A;  1VSK A;  3PIO L;  2O4G A;  4G9Z A;  4CJT A;  4KRE A;  4OJR A;  1NJZ A;  2D0O A;  4W5T A;  4QCL A;  3LAN A;  4X64 K;  2W6K A;  4IEE A;  1ZBH A;  1RBV A;  2GTD A;  2D5R A;  1HKC A;  3CJA A;  4JI6 K;  2OPS A;  3KWG A;  4ZTF A;  4A62 A;  3LZJ A;  3SZ2 A;  2HMP A;  3VOV A;  4O8U A;  2E8A A;  1Q81 O;  1IJJ A;  4DV6 K;  2O8B A;  3TAB A;  1GLE G;  1LW2 A;  4CEF A;  2WC9 A;  1U48 A;  2VG5 A;  1S22 A;  4G1Q A;  3PO5 A;  4CI6 A;  4NYN A;  3E1Y A;  1QQC A;  3VEX A;  3OYJ A;  3M8S A;  3SAG A;  5AZI B;  3SUP A;  3H08 A;  3JYT A;  3FE1 A;  3J7A P;  3K59 A;  5E84 A;  1TK8 A;  3L4Q A;  3MED A;  1KVB A;  4Z94 A;  4E89 A;  3CD6 N;  2BTF A;  1LWC A;  5HRS A;  4O0I A;  4FJN A;  3EN9 A;  4H0V B;  4DQI A;  3QIN A;  2IVO A;  1T03 A;  3W3D A;  3CC4 N;  3NF6 A;  4I6M B;  4KHN A;  1DGK N;  4BRE A;  1YJW N;  4B9L A;  1VAZ A;  4XH4 A;  4BR5 A;  4F9O A;  2E6L A;  2IIR A;  3CET A;  5JVG L;  1LOT B;  1Z26 A;  3VEO A;  3V4I A;  3A5L C;  2HF3 A;  3U3G A;  2IDO A;  1L3T A;  1HYZ A;  1SKS A;  2EX3 A;  3CCQ N;  1LWF A;  1TAU A;  3O4N A;  1SL1 A;  4PWD A;  4A59 A;  4BY9 C;  1N34 K;  3PSI A;  1NM1 A;  3ZSO A;  4DLE A;  4CJK A;  4A61 A;  4DSF A;  4JEP A;  5LL6 Z;  2P9I A;  1NOZ A;  1S1V A;  4RW9 A;  3B6P A;  3V9U A;  1KTQ A;  3VEY A;  5GAH P;  3J7Y P;  3SCX A;  1WSH A;  4Z0U A;  3AVJ A;  2FF3 B;  3O1B A;  3JS6 A;  4CJP A;  1YHQ N;  1JLF A;  4JI3 K;  4KBO A;  3SUO A;  1I3A A;  1HMV A;  3TTF A;  1VQN N;  5AR0 A;  4BQZ A;  3HM9 A;  2A1S A;  4NXN K;  4JKC A;  5M1K A;  3CQY A;  2YNI A;  3T1A A;  3VA0 A;  2HBM A;  3TAQ A;  3VF2 A;  3ULD A;  4DR1 K;  4LF9 K;  3M5R A;  3ZEU A;  1NGC A;  1QHT A;  4FJJ A;  2VWJ A;  4N56 A;  5B8H A;  1NKC A;  1XUP O;  1VQO N;  5AQR A;  1M90 O;  1Z25 A;  2NRZ A;  5C42 A;  4FLU A;  3AA4 A;  3GDQ A;  3ZT3 A;  3HTV A;  5LMN K;  3H1Q A;  4IZ9 A;  3K57 A;  3C7N A;  4M3T A;  4DTR A;  3SV3 A;  4CGD A;  3RR8 A;  4CJL A;  2CH6 A;  3JAM O;  3OA9 A;  4E7J A;  4X66 K;  2JWL A;  2FSN A;  3DOK A;  4B9T A;  4JI7 K;  4DV1 K;  2O8E B;  3RMC A;  2YHY A;  3J80 O;  2Q1N A;  1ILY A;  3CFO A;  3CG7 A;  4J2A A;  3BZK A;  5AQQ A;  4JK9 A;  3QEX A;  3O3F A;  2QKK A;  4FZZ A;  3T19 A;  3AO3 A;  1QSL A;  1KFD A;  4W5N A;  1O13 A;  2QWO A;  3MWP A;  4Z4C A;  5FRO A;  3D45 A;  4DS5 A;  1NMD A;  3CF5 L;  4J2E A;  1V4T A;  3SLC A;  4JHD B;  2RHK A;  4IXC A;  4WE1 A;  1T8E A;  1NGI A;  4KHP K;  4O5B A;  2GEM A;  1X9W A;  1FKP A;  3FFK B;  3SI6 A;  3THX B;  5KPT A;  5BPL A;  1NMN A;  2YHX A;  3MXM A;  2X78 A;  3C6T A;  4C8K A;  3CFR A;  2ZWH A;  4ZHR A;  5GAD P;  4CJ5 A;  4FWN A;  2QWL A;  4DU1 A;  2XY8 A;  2VWB A;  3NGI A;  4QOZ B;  3SBG A;  3IRX A;  2NRR A;  2HF4 A;  2CGL A;  4JLH A;  5AQX A;  3CJB A;  5F2R A;  3CCS N;  3ENB A;  3PLA A;  2E88 A;  5J2P A;  2KQ2 A;  4WFA L;  3KZB A;  4CFB A;  4DS4 A;  2BE2 A;  3K9J A;  3KLF A;  4LF7 K;  3F9M A;  3S41 A;  2FBY A;  4BRH A;  1ZBL A;  4K0K K;  3PUF A;  3QET A;  2Z1H A;  1BI4 B;  2KW4 A;  3LAM A;  4DSI A;  4GVM A;  3J7Z O;  4E7H A;  3CYM A;  3TI0 A;  1IO2 A;  3LP0 A;  3LPU A;  3HJF A;  5AQZ A;  4BGB A;  4PL8 A;  1U47 A;  3NHG A;  4B3M K;  3U9Z A;  4BRF A;  5HRR A;  2KZM A;  1ATN A;  4KH6 A;  3O9T A;  4WFN L;  2QXL A;  1GOB A;  2VQE K;  1WAF A;  1RT7 A;  3I0R A;  4FWP A;  3VGM A;  1SL0 A;  4CF1 A;  4J2B A;  3F9K A;  3LM9 A;  1NNE A;  2YCH A;  4LF6 K;  4H8K A;  4CHY A;  3THY A;  1X3N A;  3QES A;  3PO4 A;  3D2E B;  5JLF A;  4KO0 A;  2JLE A;  4C1N I;  5SZT A;  4IOX A;  1OH5 A;  1R0A A;  1BDG A;  1N6Q A;  1RDB A;  3SQ4 A;  1R59 O;  2HB5 A;  3IFR A;  3LP2 A;  3OYA A;  4AHV A;  3SAH A;  3AVH A;  4E19 A;  2BGG A;  3F2K A;  4OKE A;  5FPN A;  3U4L A;  5AFU H;  1YT3 A;  4BVO A;  2HBK A;  5AJ3 K;  3DOL A;  5BN8 A;  4JN4 A;  2P9P A;  3AVB A;  2EHG A;  3HPO A;  1JCG A;  5KGW A;  3EZ5 A;  3LP3 A;  3OYD A;  3RTV A;  1S5J A;  2E4L A;  1BWF O;  1KXP A;  4FWQ A;  1RBT A;  3K5N A;  4F2S A;  4H5R A;  2UXB K;  4IEI A;  4DUY K;  5JVH L;  3HRG A;  3VQ5 A;  4B9V A;  3K2P A;  4H5W A;  1VQL N;  4DV4 K;  4B3T K;  4OO1 J;  2A5X A;  3EE8 A;  1LCU A;  3DLK A;  1LAW A;  3ZX0 A;  1L3U A;  3AVN A;  5C0Y A;  4CIE A;  3NF9 A;  5HP1 A;  4KHW A;  1X1P A;  1WAJ A;  4HWI A;  3OYK A;  3V1R A;  2AP1 A;  5AQP A;  1Q9X A;  4IO9 L;  4CZM A;  3ZET A;  3FZL A;  3O3H A;  5EX5 A;  2HNY A;  2HND A;  4R79 A;  4FJK A;  3L2V A;  2QXF A;  5KPR A;  4FJ5 A;  2V52 B;  3VQ4 A;  1WBB A;  4CE9 A;  5AQL A;  4FPB A;  3DXM A;  3AA2 A;  5F1X A;  4CW7 B;  3QDK A;  1HR0 K;  2UUB K;  3OJS A;  2WTU A;  1REV A;  4UQG A;  3HYF A;  4R5P A;  4DFJ A;  1RDU A;  4BGA A;  1VQ7 N;  4KI4 A;  4Z4E A;  3DLE A;  2XY7 A;  3TWH A;  1JLG A;  1OH8 A;  1UA0 A;  1WSI A;  1OKJ A;  2FC0 A;  1HPM A;  3VQ8 A;  1WNS A;  4KI6 A;  4A2B A;  4H0O A;  4BC3 A;  2HHS A;  3IDH A;  2P9L A;  1SZ2 A;  5ADX H;  4PHT X;  1DTQ A;  5CYM A;  1C1B A;  1QTM A;  1RTI A;  3AO5 A;  3LDS A;  3TR8 A;  2OA8 A;  4CJV A;  2UXC K;  3MAQ A;  1QZ6 A;  3H3O B;  1BQN A;  1BG3 A;  4GV6 A;  4BRO A;  4HUE A;  5AQK A;  4JI2 K;  2XY6 A;  1RTD A;  5FRN A;  3B8A X;  4M45 A;  1TK0 A;  1Y97 A;  1X9M A;  3JXU A;  1YTU A;  4DV3 K;  1N5Y A;  4HUG A;  3C6H A;  4JI5 K;  3CCU N;  5DM7 L;  3AV9 A;  4PQU A;  4CJS A;  2F96 A;  3MX5 A;  4BR7 A;  4CEA A;  1LWE A;  5HRO A;  1TKD A;  3CQX A;  1NBW A;  3OYN A;  3IG1 A;  4N5S A;  3V9Z A;  3LWM A;  1RCH A;  3PX4 A;  5ELZ A;  1OVQ A;  5LMU K;  3TAR A;  2YNF A;  4U67 L;  1E3M A;  3K9K A;  3T7Z A;  4CF2 A;  2J4R A;  4HUF A;  4H5V A;  1GOA A;  2EWS A;  4JK8 A;  3NH2 A;  2ZJP L;  2RPI A;  4JKG A;  1ZXO A;  3ZSQ A;  2JWK A;  2GUP A;  1K8A O;  3L4I A;  4O8K A;  3WXJ A;  2DFF A;  4KHQ A;  3R6M A;  4IG3 A;  1VSD A;  3OYG A;  1BIS A;  2KFN A;  1VHX A;  4I6M A;  1S9G A;  1X9J A;  1HPZ A;  4M41 A;  3ID8 A;  4IFV A;  4MDB A;  3WNF A;  3C65 A;  3ZYY X;  3BUZ B;  5J1E A;  4JK7 A;  3WUH A;  5AQT A;  4AM7 A;  3MX2 A;  4BRN A;  1CZA N;  4DR3 K;  3PV8 A;  4NO7 A;  1WSE A;  1VQ6 N;  4CGF A;  5JIC A;  3C0B A;  4CGH A;  4E7K A;  4B1Y B;  2UUA K;  3O3G A;  2YJE A;  4ID5 A;  4OX9 K;  3MN5 A;  3ZSW A;  2Z1G A;  3VEV A;  5JLH A;  3ALY A;  4ICL A;  2Z1J A;  5HLF A;  4CGG A;  4IDH A;  3VQ6 A;  3TSQ A;  1TL3 A;  2YJF A;  3AVC A;  3RRH A;  2I7P A;  3UKR A;  2HMI A;  3VQB A;  1UA1 A;  3H3N O;  3AVA A;  1XMQ K;  3KWI A;  4JNE A;  1Q8I A;  2Y1I A;  2P9N B;  3D7E O;  1D8Y A;  4QS9 A;  3RMA A;  3WNH A;  4WYB A;  5E41 A;  4DFM A;  5KQ8 A;  5AQO A;  4DTO A;  3A8Y A;  3IS9 A;  3TTC A;  3QO9 A;  3O9R A;  4O5F A;  2NLX A;  1BU6 O;  4DQQ A;  4XIU A;  2FF6 A;  1X3M A;  2QWR A;  4LF4 K;  3THW B;  4DTS A;  4OKK A;  4CHZ A;  4EHT A;  2Q36 A;  5FDL A;  4IJA A;  4M7Y A;  2HHV A;  1YUW A;  4DF4 A;  4PKG A;  4WQ5 C;  4CF0 A;  3CJ9 A;  5C2F A;  3AVG A;  5GIP A;  1J5O A;  1N33 K;  1IV0 A;  2QKB A;  1S3X A;  3SJH A;  3AVM A;  3ZSX A;  3SQ2 A;  3NF7 A;  4M3U A;  1D4X A;  3I55 N;  1K9M O;  3VQA A;  5I9E B;  1YAG A;  2V7Z A;  2I7N A;  3R9P A;  2P51 A;  5CYQ A;  3LDL A;  3K5O A;  3V1Q A;  1CXQ A;  2ASM A;  5AQY A;  4A2A A;  1QQO A;  2HBJ A;  3I8B A;  3AVK A;  3D6R A;  5BPN A;  4OPA A;  1WUA A;  1C0F A;  3MXJ A;  1BA1 A;  4KB0 A;  2KHO A;  2ZJQ L;  1OVY A;  2A41 A;  2O8E A;  1E4F T;  4DSK A;  2GWK A;  2VG6 A;  3HBT A;  1EWQ A;  5TKW A;  3IUC A;  2FSJ A;  2G8H A;  3MN7 A;  3ID6 A;  3NGY A;  4H0X B;  4I9Q A;  3DXK A;  2G8U A;  4CEE A;  4IJN A;  1L5U A;  2AA4 A;  3HST B;  4DB3 A;  1UOC A;  3BDP A;  4NCB A;  4A5A A;  4B8A B;  2IS3 A;  2HW3 A;  3HOS A;  4QAG A;  4FJG A;  1T44 A;  2YHB A;  3TAN A;  3M6G A;  2HHH K;  1NGH A;  4C8N A;  1KQS M;  1NJY A;  4PL7 A;  5HRP A;  1Q7Y O;  3THX A;  1W97 L;  1HYS A;  4EAH D;  2RF2 A;  3BGR A;  1S72 N;  4N76 A;  2UXD K;  3VEN A;  2IAJ A;  3QB0 A;  1BCM A;  5A2Q O;  3CME N;  5BRD A;  1EXQ A;  4MO5 A;  1O1W A;  4FWS A;  1B92 A;  3NBP A;  3RSE B;  1QSS A;  2W41 A;  4B1Z A;  4DLG A;  3QNO A;  2QW9 A;  1YXQ A;  4A5B A;  5KPZ A;  3LDO A;  3MN6 A;  1NK0 A;  3O6W A;  4EZ9 A;  3ZT4 A;  2DY4 A;  2QM1 A;  4KRF A;  1SL2 A;  5BRF A;  3AGK A;  2KZZ A;  1EWR A;  4FWK A;  2ASO A;  3DM2 A;  3PSF A;  4KTW A;  1C1A A;  4AF1 A;  3HT3 A;  5BR9 A;  5AQG A;  4DFP A;  4BRC A;  3FZF A;  4GV9 A;  1HQE A;  1RDD A;  1BI4 A;  1YIT N;  1MU2 A;  4JKE A;  1KC8 O;  5GIO A;  3CER A;  3CXC M;  4IO8 A;  1T05 A;  3UE5 A;  4MLE A;  3I33 A;  2ITG A;  3VTH A;  4CEO A;  1GLA G;  1C0G A;  4I9L A;  4FZX C;  2P5O A;  1HUX A;  4DV2 K;  2PBD A;  1J9A A;  2UU9 K;  5GIN A;  3U9D A;  3WNG A;  2OAN A;  1NGB A;  3KLI A;  1EQY A;  3VN5 A;  3LZI A;  4LFA K;  5K14 A;  4YY3 K;  4IG0 A;  3K0S A;  3V81 A;  3SK3 A;  4YDU C;  2QTD A;  2VCP A;  4BRQ A;  3D2E A;  2KFZ A;  3JSM A;  4C8L A;  2P9U B;  1IBL K;  1DKG D;  2O8C B;  3SYZ A;  1U45 A;  4KHS A;  3BY5 A;  3RRG A;  4RW7 A;  1KAX A;  3TAP A;  1MDU B;  3TAG A;  5CZ2 A;  3NH1 A;  2JGU A;  1VSH A;  3DRS A;  3CMA N;  1HNX K;  2XY5 A;  4K43 A;  1NOY A;  5JMV A;  4NXM K;  3NAE A;  3QNN A;  3UKU A;  1VSJ A;  1NGJ A;  4A57 A;  3SQ0 A;  4K8Z A;  4C23 A;  5I3U A;  3V9W A;  4JI4 K;  3K5L A;  1SV5 A;  4IBN A;  3DRP A;  5BPM A;  4BE0 A;  4FZY A;  4LF5 K;  2YHA A;  5FPE A;  1S1W A;  4DQ8 A;  1BIU A;  1ZBF A;  2CGJ A;  5HL7 L;  1BCO A;  4EFH A;  1F21 A;  1D9F A;  3HSC A;  1RDA A;  4LH5 A;  4E1J A;  4IFE A;  3L2U A;  2PYL A;  4XEI A;  2KKZ A;  4YHH K;  4BC5 A;  3L2Q A;  1EET A;  4FK4 A;  4CJU A;  4QS8 A;  3WXL A;  1HKB A;  2OYQ A;  4FJL A;  4CJQ A;  3MN9 A;  4CEQ A;  4YFU A;  3K58 A;  3CCM N;  1S1T A;  4RTF D;  4B08 A;  1P90 A;  3ZT1 A;  1S9E A;  1KLN A;  3L0Q A;  4ISF A;  1NJW A;  4CJW A;  3KD5 E;  4CZE A;  4DQS A;  3TTD A;  4FJI A;  2DFE A;  3FFI A;  4CZF A;  4FLX A;  2P9K B;  1VRU A;  3AVF A;  4EZ6 A;  2ZGZ A;  1RT2 A;  4IOC L;  5AZJ B;  3NVM A;  4DTP A;  1NK7 A;  5BRE A;  4BRP A;  3LDP A;  1TVR A;  3IKM A;  4BDP A;  4K25 A;  3TAE A;  4FM2 A;  3ZSZ A;  3L8B A;  1VQK N;  2BUP A;  1VQ8 N;  1NGE A;  3AO4 A;  3BEX A;  3KLH A;  4CD3 A;  4ILJ A;  4OGE A;  5CR4 A;  4H0T B;  4E1M A;  2E2P A;  1ZYQ A;  4MQ3 A;  4B9S A;  3W0L A;  3VGL A;  3GBT A;  1SS6 A;  3I8D A;  4CES A;  3OBW A;  3S3N A;  4Q5V A;  1D9D A;  3RR7 A;  3IAY A;  5J2Q A;  4PKI A;  2GX9 A;  2RKI A;  3O4W A;  2HBL A;  5BR8 K;  5KTQ A;  1GLL O;  4Y1D A;  4B9M A;  4F2R A;  3PX0 A;  2X74 A;  2YHW A;  5KGX A;  4B1V A;  4FJ8 A;  3QIC A;  3AO2 A;  3VMF B;  4HCC A;  3H6E A;  1H1V A;  4B3R K;  3V6D A;  4CVN E;  2VWK A;  4OLB A;  3AGR A;  2P9I B;  2NNW A;  2UUC K;  4MDA A;  3VTI A;  1OH7 A;  5C25 A;  4WQ4 A;  4FM0 A;  3HL8 A;  1WBD A;  5DK5 A;  5IT9 O;  4BWJ A;  2ASP A;  4DV7 K;  1WOQ A;  3CC7 N;  3TPQ A;  4DSL A;  1SKR A;  3DI6 A;  1QSY A;  1EX4 A;  2OPR A;  4CZI A;  3TU5 A;  1VSE A;  1LAV A;  4NLB A;  4BE2 A;  4GV3 A;  1Y64 A;  4JD2 B;  5TKY A;  2OZS A;  5JS2 A;  3WT0 A;  3CIP A;  3QEI A;  4I2P A;  1QS4 A;  1TV6 A;  5M1Q A;  2O4I A;  2ZJR L;  1B9F A;  1NK5 A;  4BG9 A;  4FJX A;  1G15 A;  3ZEU B;  3CCR N;  3NCI A;  3KHY A;  3WXK A;  5AQV A;  1WLJ A;  3MDQ A;  1VQ9 N;  4CJ7 A;  1RBS A;  2X6S A;  1N8R O;  4DR7 K;  4CFA A;  1RDW X;  2V7Y A;  1IG8 A;  3LM2 A;  4E7L A;  1IG9 A;  4FOI A;  4F4K A;  4DUZ K;  4BRA A;  1I39 A;  3OYE A;  3C6U A;  3QEP A;  1WSG A;  4CK3 A;  3G4S N;  1Z05 A;  3C7N B;  4FWR A;  4PA1 A;  3EY1 A;  4H5N A;  1KAZ A;  1W7A A;  3NMU A;  2O8F A;  3CFP A;  3ZLJ A;  4LY7 A;  3HK2 A;  3P31 A;  4ELU A;  4AH9 A;  1J5E K;  3FLC O;  4K42 A;  3EO3 A;  4FJ7 A;  1A5X A;  1YVN A;  4O44 A;  2Q97 A;  4XH5 A;  4HVJ A;  2A42 A;  4CIG A;  3O9S A;  4CF8 A;  1EKE A;  4DV5 K;  4H0Y B;  3VEW A;  3R1X A;  3QBW A;  3D2F B;  3MK6 A;  1ZC6 A;  3VF6 A;  1KFS A;  4DTN A;  3WEE A;  2V51 B;  2E2O A;  5EXW A;  2IVN A;  1VSL A;  2Q2R A;  3NVK A;  4WCE L;  1XC3 A;  3OYI A;  1JL2 A;  4DQP A;  3SPY A;  2FXU A;  2P9N A;  3GE1 A;  3BP8 A;  4FCY A;  1BOT O;  4B1U B;  4CK2 A;  2FBT A;  4FO0 A;  4H5T A;  1RT5 A;  3RMD A;  1TYQ A;  4BRD A;  3MEG A;  4CJ3 A;  5KRT A;  1ATR A;  1S6Q A;  4CJF A;  3CHW A;  4CCH A;  1YIJ N;  4AHT A;  1FW6 A;  5AQI A;  5AQF A;  4OPH A;  3IMX A;  3O80 A;  5MLC Q;  1VQ4 N;  3KK3 A;  1YVU A;  1FJG K;  3KVG A;  4JKD A;  3WXM B;  4C8O A;  3KK7 A;  1RT4 A;  3OS0 A;  3RMB A;  1IKW A;  3DAW A;  1EO1 A;  2W6L A;  3MCA B;  2NUB A;  2HNZ A;  1GLC G;  1HX1 A;  4DU3 A;  1JXE A;  1E4G T;  3OY9 A;  1NG9 A;  2VYP A;  5BN9 A;  1VQP N;  4OVL A;  2G8W A;  1S6P A;  4CZG A;  4H4O A;  4BR0 A;  1Q9Y A;  1TKZ A;  1RBU A;  1TAQ A;  4YOR A;  4CJ4 A;  3EEQ A;  4JS5 A;  4YOU A;  5C15 A;  1KD1 O;  3OYF A;  5AQJ A;  3ISN C;  5I42 A;  4BRL A;  4DSE A;  3DWL A;  3Q7B A;  3KJV A;  1NGF A;  2WUS A;  4JKA A;  4DTU A;  1I94 K;  3A5O C;  3TSP A;  3LP1 A;  2A6A A;  3CCV N;  4OKJ A;  2QK9 A;  2RE2 A;  2OPP A;  3LDQ A;  1YTA A;  4LSN A;  3DLL L;  3ZSY A;  3SPZ A;  5C24 A;  5AZI A;  4CEC A;  1JLB A;  4JI1 K;  1J6Z A;  4CBX A;  4JRP A;  3HPG A;  3E9O A;  2Q0R A;  3OYC A;  5FPD A;  4DR2 K;  2ZE2 A;  2B6A A;  3UB5 A;  4M3W A;  2E2Q A;  5AQM A;  4CJR A;  2HHU A;  3L6Q A;  3ENO A;  2ZD1 A;  1JLA A;  3LAL A;  4LC9 B;  2P9S B;  3O4Q A;  4Q0B A;  4FW1 A;  4B8C A;  2NRT A;  2IC3 A;  3DLR A;  3E66 A;  3F5T A;  2OCE A;  1HKG A;  3ULE B;  2LSN A;  2HHX A;  3OYL A;  3CI5 A;  1DLO A;  3RSE A;  2F8S A;  1K8K B;  3QIO A;  2FSK A;  2E20 A;  4OPK A;  4B9N A;  3P5J A;  3C95 A;  1YF5 L;  2A40 A;  1HYV A;  5LJV A;  4HCB A;  3PIP L;  2VG7 A;  1Q86 O;  2RN2 A;  2G8F A;  2NRV A;  1NK4 A;  4Z4F A;  3R3L A;  1XI1 A;  3EKS A;  1GOC A;  3O8M A;  4AQY K;  3T1H K;  2G8I A;  4W5R A;  4FOE A;  3O9U A;  1TL1 A;  2HHT A;  4AHU A;  3HM8 A;  2NRX A;  3VQE A;  4B1W B;  5KQD A;  4DV0 K;  3NFA A;  1QE1 A;  3OYM A;  1G99 A;  2G8V A;  3ZET B;  3DLB A;  2HHW A;  5M1O A;  1P8Z A;  3EKU A;  3VQC A;  4CJE A;  5HOO A;  4BVP A;  1U2V B;  3DXM B;  4NCG A;  2F8T A;  3HOT A;  3A0I X;  4O0J A;  4JRQ A;  3MEE A;  1TK5 A;  3KLE A;  1VK0 A;  5C10 A;  4H4M A;  4M3R A;  1JKH A;  2VGM A;  3CJ1 A;  4HTL A;  1NK9 A;  2O8C A;  1JJ2 M;  1L3V A;  3G6E N;  4FPA A;  1RTJ A;  1QVG M;  4X65 K;  1QQM A;  3I0S A;  3AAR A;  1HJR A;  4BR4 A;  1V4S A;  4OPJ A;  4FWL A;  4ID1 A;  4ELV A;  2E5L K;  2GUI A;  1JLE A;  4CEZ A;  4BR2 A;  1NU0 A;  5M1N A;  3QBX A;  1VSI A;  3NDK A;  3J8A A;  1JLC A;  3LPT A;  3DLH A;  2YNG A;  4FLV A;  3T1Y K;  3SNN A;  1XNQ K;  1TUU A;  1C1C A;  5C12 A;  3L2R A;  1C0U A;  3FZM A;  3M8Q A;  1KRP A;  1NK6 A;  4Z4G A;  4AM6 A;  3PY8 A;  4KPY A;  1W0H A;  4DHY A;  2ETJ A;  4W5Q A;  2KLA A;  2B5J A;  4YOX A;  1BA0 A;  2VGN A;  3BF1 A;  5CY4 A;  1KVA A;  2QWP A;  5HRN A;  4M3X A;  1XWL A;  4FXD A;  1YI2 N;  2CGK A;  1S1X A;  3T3F A;  3M3Z A;  2IGI A;  4LD0 A;  1N36 K;  4GKK K;  4BAC A;  4RWT A;  1ZBI A;  1QQN A;  2F4V K;  3ZT0 A;  4M63 C;  3SMS A;  4K41 A;  3MWT A;  4GNI A;  3I56 N;  2ZQB A;  1C6V A;  3U6F A;  4FK2 A;  2F9T A;  3MEC A;  3C6A A;  5CZ1 A;  4EP5 A;  4YOY A;  5M1P A;  1ZBU A;  3AAQ A;  3N4P A;  2KTQ A;  5F0X A;  4JHD A;  4AHS A;  2D1K A;  4B9U A;  4WFB L;  1HNI A;  2X6N A;  1J53 A;  1M1K O;  4LFC K;  1VSM A;  1HLU A;  2F9W A;  2P9K A;  3HI0 A;  4CZL A;  2PYJ A;  1K73 O;  3GL1 A;  3HVR A;  3S3M A;  4CHQ A;  4X62 K;  3DLG A;  5AZJ A;  3QFU A;  4JKG B;  3KD1 E;  4F3T A;  1HRH A;  1IKV A;  1RT6 A;  3WQT A;  2Z1I A;  3AO1 A;  3LWL A;  4JS4 A;  3HP9 A;  4ISG A;  4BE1 A;  1U49 A;  4E7I A;  1RFQ A;  4DG1 A;  3CM6 A;  1JL1 A;  1T3V A;  4IKF A;  4I2Q A;  4CER A;  3U3Y A;  1IBM K;  2FLO A;  1Z6R A;  2Q0U A;  2QWM A;  3CJC A;  2FBV A;  4KHU A;  3FR0 A;  1U04 A;  4KH5 A;  4U7B A;  1NGA A;  4B3O A;  4XH1 A;  3CJ7 A;  4DF8 A;  1XQS C;  3UIQ A;  4CHP A;  3KTQ A;  2F7T A;  1U4B A;  3MCP A;  3NF8 A;  3MMV A;  4JKF A;  1NJX A;  3L3V A;  4PUO A;  4RG8 A;  3ZCM A;  5HBM A;  3WNE A;  4M7X A;  5BRH A;  2A1R A;  4B1X B;  3VPZ A;  2CH5 A;  1Q82 O;  3E9P A;  4CGJ A;  3KK2 A;  2O8D B;  4L3Q A;  2HHQ A;  3KLG A;  3G10 A;  4CK1 A;  5FLX O;  1WN7 A;  5SWM A;  3UKR B;  4BC2 A;  4DTJ A;  1ASV A;  4OGC A;  4DQR A;  2YI1 A;  1BIZ A;  3GG4 A;  4FYD A;  4AHC A;  3P39 A;  2OTJ N;  4LH4 A;  1QHA A;  3FZK A;  4CF9 A;  4UY8 O; 
#chains in the Genus database with same CATH homology
 4DV3 K;  2UUC K;  2UXD K;  4LF5 K;  1XMQ K;  5A2Q O;  4JI5 K;  1IBK K;  1N34 K;  1N36 K;  4GKK K;  4X64 K;  2F4V K;  5LL6 Z;  5IT9 O;  4KHP K;  2VQF K;  2UXB K;  4DV7 K;  4DUY K;  4YHH K;  1FJG K;  1HNW K;  3J7Y P;  4JYA K;  4JI6 K;  4AQY K;  4V19 S;  3T1H K;  4LF4 K;  3J81 O;  4DV4 K;  4B3T K;  4LFC K;  5LMU K;  4LF8 K;  4DV0 K;  4JI3 K;  4B3S K;  4GKJ K;  4X62 K;  4DV6 K;  4NXN K;  4DR6 K;  1N33 K;  4LF7 K;  4DR7 K;  4DR1 K;  4LF9 K;  4JV5 K;  4K0K K;  4DR5 K;  1I94 K;  4DUZ K;  1IBM K;  4DR4 K;  4DV2 K;  3J7A P;  2UU9 K;  4CW7 B;  4X65 K;  1HR0 K;  2UUB K;  4LFA K;  4YY3 K;  4B3M K;  5LMN K;  4JI1 K;  1HNZ K;  1XNR K;  1J5E K;  1XMO K;  2E5L K;  1IBL K;  2VQE K;  4DR2 K;  4JI8 K;  1N32 K;  3JAM O;  4LF6 K;  4X66 K;  3T1Y K;  4DV5 K;  4JI7 K;  5IWA K;  4DV1 K;  1XNQ K;  3J80 O;  4DR3 K;  4JI0 K;  2ZM6 K;  5BR8 K;  1HNX K;  5FLX O;  2UXC K;  2UUA K;  4OX9 K;  2HHH K;  4NXM K;  4JI2 K;  4LFB K;  4B3R K;  4JI4 K;  4CVN E;  3OTO K;  5AJ3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...