2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
4NLRA 1RT6A 4CJPA 3EYZA 1FKPB 4EBDA 3MXJA 1NNDA 3BSAA 4AILC 3M9MB 4ID1A 4IDKB 4O44A 4UQGA 4RW9B 1WNEA 2G8HA 1XI1A 4M3WA 3TANA 2ALZA 3O4QA 3DRRB 1TQLA 2IA6A 1B9FA 1NKCA 4ECTA 3HJFA 3H5UA 2OYQA 4Q8EA 4W5NA 2C22A 3TAFA 4E3SA 2IC3A 2IS3A 1ITGA 1WAJA 4DL4A 5KG3A 4FJNA 2I5JA 3I0SB 4GVMA 5KT5A 3TAMA 2AX1A 2BE2B 5C42A 1VSLA 1QAIA 1HQEB 3RRGA 5F9NA 2IGIA 2FVSA 2VG5B 2BRKA 4JS5A 4E7KA 4DTMA 2YKMA 4NLQA 3HYFA 4ED2A 2JC1A 3FQLA 5KT3A 4LH5A 4ICLB 4M41A 1BCOA 4H8KA 2YHAA 4FW2A 1ASVA 2YNFB 1GOCA 1T05A 3DI6B 1LWEB 3I5AA 3T5JA 1RDRA 2R2UA 4FK0A 3CIZA 1KRPA 5F9LA 2D41A 4Q43A 2HHXA 1VSFA 1DTQB 4ELVA 1IM4A 5T7BA 1JLCB 4IKAA 3VQ7A 1RA6A 4F3TA 3L2RA 2PZSA 1YT3A 4LSNB 4CF0A 3T5HA 3HHKA 4DSJA 3MXIA 3RMBA 4URSA 4WE1A 5KFDA 4OVLA 3AVGA 4I9QA 4K50A 1XHXA 1RBVA 3LP2B 1HYZA 3HP6A 5J2MA 4HCBA 5KGWA 4CGJA 2G8IA 4KB7A 2RDJA 4FJGA 2GBZA 1C2PA 3PW7A 3DRSB 1WNSA 1KFDA 2W42A 4O4GB 2R8KA 1XHZA 2B5JA 1GOBA 2GIRA 4KFBB 2I1RA 1SV5B 3DLBA 3KMSA 2EHGA 4ZVFA 4CHOA 1JX4A 1K1QA 4TYBA 1ZBHA 4X2BA 4JRPA 2FJVA 2FLNA 2XGQA 1NK0A 3MF5A 2OPSB 3DLHA 1HNIB 1C1BA 1RNHA 4FM2A 2ASJA 3NCIA 4ELTA 4CERA 3OY9A 4JLHA 2OPQB 5SWMA 4DLEA 1TVRA 4OLBA 1UWBB 2Z1JA 3ITHA 2VG6A 4AHCA 4K4UA 2ITGA 3DM2A 3SFGA 2R2RA 2V0NA 4CGFA 4EP4A 1KVBA 4QCLA 1EP4B 2W7OA 1K1SA 4NLDA 4O5BA 4B3OA 3V9SA 5FDLA 1RT7B 4FZXC 3QEXA 1O1WA 3PR4A 3AVIA 3PW4A 3RR7A 4YR2A 1SL0A 3VQ5A 1YVUA 4F50A 5KG1A 5KFXA 3QLHA 3JYTA 1S9EA 1XWLA 3CM6A 3CDUA 5C5JA 1TAUA 3M8PA 2CKWA 1VRUA 1VSIA 3C94A 1N5YB 3AVNA 4KRFA 1C0UA 3HPOA 3V81A 3IS9B 3O3GA 1NOYA 1RT1B 4CJFA 3KLFB 3MEEA 1GOAA 4CJKA 2ATQA 2G8VA 3U3GA 1S1WA 4J9MA 5KG0A 2HVIA 4I2PA 4MQ3A 4O3OA 3NDKA 5KFOA 3GV5B 3UR0A 4B9UA 2W9BB 1NK6A 2W8LA 1ZBLA 4DWIA 5KFEA 4RW7A 1SH3A 2IM0A 3O4NA 3KLGB 3V6HA 1VSEA 4WYWA 5DG8A 1D0EA 3AVJA 3DOKA 1QE1A 4CE9A 1TKXA 4K8ZA 4FM1A 5DK5A 5KFFA 4DTRA 5F8GA 4CIFA 4TYAA 4N41A 2WK4A 5KTQA 1VSJA 2R8HA 2UUWA 1WSHA 4E7JA 3SFUA 3V4IB 3AVBA 3BREA 4OJRA 4DEZA 5HBMB 4FLYA 1LV5A 2QKBA 4CIEA 3T3FA 3PW5A 3KD5E 5DG7A 2OA8A 1S6PB 2FBTA 4CJ4A 2ZD1A 3V6DA 4IRKA 3PY8A 3LAKA 3LDSA 1X9SA 2XCAA 2HHQA 2BANA 1TP7A 2HWIA 4K4XA 2YNGB 1TKTA 1DLOB 3UIQA 3SCXA 3AO2A 1J5OB 2YKNB 4PQUB 5DGAA 3I5BA 3QIPB 3T1AA 1IKXB 1MU2A 3AVHA 3KK1A 3QGGA 2WHOA 5JUMA 4FLVA 3OLAA 1Z25A 4BE0A 2HNZB 4JV1A 3LP0A 3AA2A 2IM2A 2BQUA 2V4RA 2UVVA 4KHUA 4DTNA 1VSDA 1NK5A 5J2PB 4ED8A 4K4SA 3VQCA 3NH1A 2GIQA 4ZVEA 1SL1A 4N76A 3TQ1A 1D1UA 3PHEA 2XC9A 4B8CA 5J2NA 4IR1A 1S1TA 4WFZA 3IRXA 4KI4A 1QTMA 3QEIA 1JLAA 3DLEA 4OPKA 1RT3A 4O44B 1RDBA 4CJ3A 3KK2B 4BWMA 4FCYA 4W5QA 4LSLB 4ELUA 2HHSA 3RBDA 4BDYA 1JKHA 3LZJA 4QWBA 1L3UA 1UAXA 4CFCA 4DTXA 1S1UA 3HVAA 4IKFA 3HVTA 3CJ4A 5KGXA 4IRDA 4IRCA 2IC3B 2C2RA 3SI8A 1B9DA 4R8UB 1Z4UA 4NCAA 3ZT3A 4RUCA 4LH4A 2I5JB 3V9UA 1JLFB 3TAMB 4E1MA 4ZTJA 3NAHA 2ETJA 4KHYA 3KLIA 4KTWA 4CJWA 2YKMB 4DF4A 4FJHA 3QNOA 4MH8A 4C8LA 3IGNA 4NLXA 2KFNA 4B9SA 3GIKA 2R8GA 1LAWA 4ECVA 3SQ1A 3AVCA 5EWEA 2KW4A 1KSPA 4E7IA 3RWUA 4NLPA 1TL3A 4E19A 5K14B 4K4ZA 3ZSYA 1JLEB 4TLRA 4DL5A 4IBNA 3S3OA 1CLQA 1JL2A 3OYHA 1IKWB 3NF6A 4YNQA 1F21A 1QUVA 2JLEA 2HHUA 4E7HA 4H4MB 2QKKA 4EO8A 4KV8A 3UDLA 1NKEA 3RMDA 1S5JA 3HPHA 4M3RA 4EP5A 3KJVA 3KLEA 4CCHA 4BWJA 4O4RA 1WSJA 3QGIA 5KG7A 4Q44A 1X1PA 3H5SA 4I7FA 3F9KA 2UVUA 4HUFA 1S49A 3TABA 3VQSA 5J2MB 4JUZA 4HUGA 4TY9A 4B9LA 3OJUA 4Q0BA 1XC9A 3UPFA 2HNYB 1NJYA 3ZSQA 4URGA 2AGOA 2B5JB 4XPCA 4NCGB 3OHAA 2Y1IA 2G8FA 3TARA 3PO5A 1RTJA 4DU1A 3BR9A 4PA1A 3QEVA 4Z4HA 1NJWA 4Y2CA 3KHHA 4E1NA 4CEOA 4I2QB 1U09A 5HROB 3VQBA 3DLKA 2BDPA 1JLBA 1JXBA 1C1BB 2C28A 5KT2A 1JL1A 4ZTFA 2HHWA 4YQWA 4AHSA 1RTDB 3VQPA 2DFEA 4PWDB 3LZIA 3C6UA 3RB4A 3QIDA 4ZPCA 1C1CA 2JEGA 3KKRA 2VG6B 2UVRA 3RAQA 1U48A 1L3SA 4J2AA 4FJ7A 3SNNA 3V1RA 3DM2B 4CJQA 5KG5A 4BDZA 2R8IA 5KRSA 1Q8IA 1YTAA 1NK7A 2AWZA 1LAVA 4HCCA 1JLQA 3AO1A 4DL6A 5KFQA 4NYNA 2EC0A 2XWYA 3SUQA 1RTHA 3ZSOA 4WFYA 4DTOA 5J1EA 2RKIA 4RW4A 1CSJA 4DTSA 3FSIA 1CZBA 4CEFA 1RILA 4DMNA 3T5KA 2HVHA 5FRNA 2W8KA 1S9EB 1QS4A 2FJWA 4O3NA 1G15A 3H5XA 2AX0A 4FK4A 3LWLA 1VRUB 4DG1B 2JC0A 5F8LA 4LQ3A 3NE6A 5C24A 1C0UB 5HP1A 3QIOA 3V81B 2YNIA 3IG1B 3P83D 4ECXA 1S1WB 3GYNA 3SYZA 1BISA 3OYCA 4CGIA 3QEWA 3PVXA 2JEJA 3MXMA 5F8NA 3QINA 1REVB 1XR6A 4ED6A 4XPEA 1RT4A 1VK0A 3OVNA 1QE1B 1TV6B 1TKXB 2E9TA 3ZSVA 3BSNA 4RNNA 3GIIA 2ILZA 4EEYA 3DDKA 3M8QB 1S6QB 1J53A 1T8EA 1BCMA 2VA2A 3HPGA 4RW8A 2YNHB 3S9HA 2OZMA 4ZMMA 3SUPA 4NLSA 1TL1A 5KFRA 4ZHRA 3V6DB 4B9MA 3PX0A 4CF2A 2IMWP 4AHVA 4FZYA 4M94A 5EWFA 4NLYA 4DQPA 4NYFA 1TKTB 3ZT0A 1LWFA 5C25A 3DMJA 5FRMA 2E6LA 2YHBA 4DFMA 4IFVA 4IQXA 3C6TA 2AU0A 4Y1CA 1KHWA 3B6PA 3KNAA 3LALA 3TAQA 2GUIA 3KK1B 5JS2A 2IAJB 2QK9A 5KT7A 3NF7A 2WTFA 5JXSA 4O55A 2E6MA 1HQUA 4FJMA 3LAMA 4KTZA 1HMVA 3L3UA 3H4DA 5D3GA 4CEAA 3G0ZA 1WSFA 4O3RA 3KKSA 5J2NB 1BIZA 1DTTA 3DLEB 1T7PA 2B4JA 1KLMB 1R0AA 5E41A 4NRUA 2EX3A 1RYSA 4FLZA 5CYQA 4WYLA 3ZT1A 4GW6A 4IG0B 2F8TA 2X6NA 4N47A 4Q45A 1C6VA 5KG4A 2B6AA 4TQRA 3HVTB 3AVLA 1SKSA 4J9KA 1S0MA 3GQCA 1D8YA 1RDAA 3AO5A 4MK9A 3LP3A 3DYAA 1UOCA 3CVKA 2IM3A 2ILYA 4RNOA 2KZMA 3NF8A 3QERA 4RNMA 1IH7A 1BQNA 1K6YA 2VG7A 1CXUA 4KHWA 4KO0B 3O3HA 2WCXA 1TL3B 3SJJA 4DTPA 3CWJA 3ZCMA 4NCBA 3MFHA 2O5DA 1FK9B 3DRPB 2WOMB 4R0EA 4N5SA 3I5CA 4R5PA 1SL2A 3CDWA 3OYKA 4IFYB 4K8XA 4ZP7A 3OYMA 4KV8B 1NJXA 4YR0A 4LY7A 4ZP9A 3MEDA 4DSIA 2OZSA 1S1XA 4OL8A 4ZPDA 3QO9A 1Y97A 3KJVB 3KLEB 4GMJB 1B92A 3OYEA 3OL6A 4KAZA 4WZMA 2XRIA 4J9OA 1S9GA 3HVWA 4I7FB 4RNFA 3OYAA 3QNNA 1BL3A 4F4WA 1S9FA 2FBVA 3S3NA 3L3VA 1D9DA 4Q0BB 3DLGA 4F2RA 3K5LA 4OPJA 1T94A 1A5VA 3VQ9A 5KFGA 4ECRA 4FLXA 1XR7A 5HRPA 3G6XA 4CFAA 1LW0A 2ZE2A 1ZTTA 2DPJA 5CY4A 3O3FA 3G6YA 1EXQA 3IAYA 2OPRA 4QAGA 4ID5B 2F8SA 3SV3A 3FFIA 1SH2A 4ZPAA 2D0BA 4FM0A 2PYLA 1I6JA 3ISNC 1JLBB 3NH2A 2Y1JA 3NFAA 2UUTA 3AO3A 2D7SA 3BGRA 3WNEA 3MEGA 3ZSXA 3C6UB 4ZP6A 1IG9A 2JGUA 1Q9YA 1D5AA 4YFUA 4FXDA 3HL8A 4CEZA 4K4WA 3KOAA 4TY8B 3LANA 2WRMA 5I42A 4C8NA 1JIHA 2OPPB 1JXEA 4Y1DA 1JLQB 3Q8RB 2P5OA 5F8IA 4FJXA 2HHVA 3WNFA 3ZT4A 2WB4A 4JS4A 1RTHB 2E9RX 3TI0A 2RKIB 4Q8FA 3V9WA 1RDCA 1EETB 3MECB 5HLFB 3BQ2A 4CJTA 5KFLA 3OYNA 4KB1A 5L1JA 4ED1A 3VQDA 4TSXA 3RMAA 3HVRA 2X74A 3QZ7A 1HYSA 3DOLA 4KKOA 1LW2A 1C0TB 4H54A 2PYJA 4BE2A 5CYMA 1FKPA 3KK3B 1JXLA 4FW1A 1RT5A 3E01A 1N6QB 4HHTA 2JEFA 1U49A 2AQ4A 3KIOA 1WSIA 4EZ6A 3DRRA 1BHLA 4KPYA 3FQKA 3OSPA 1KCFA 4ZVHA 4CHYA 4J9PA 4CEEA 1X9WA 3VQ6A 3I0RA 3I0SA 1S10A 1UA0A 2BR0A 4FZZA 2BE2A 3Q8PB 3AVMA 2HWHA 1HQEA 4IH5A 1RT6B 4CGHA 1SUQA 1HYVA 3OYGA 4I9LA 2RPIA 3N6NA 4ICLA 1W25A 3NBPA 5EDWA 4M3ZA 5KFIA 1HJRA 4WXOA 4OGEA 1D9FA 3VN5A 4FS2A 3GIMA 5SZTA 4ECSA 2V9WA 1U4BA 4RUAA 1DTQA 5F8MA 4KHMA 3A2FA 3CM5A 3G86A 5DGBA 5DG9A 3MAQA 5C42B 4CESA 4LSNA 1NJZA 3NGIA 1S0NA 4ZVGA 3QESA 2P51A 5KFBA 2BGGA 4HYKA 3KHRA 3M8RA 2OH2A 2G8KA 3RR8A 2BQ3A 1N4LA 4M3TA 4CJRA 5D3GB 1T05B 4M3XA 1NHUA 4RW6A 1X9MA 5CZ1A 1ASUA 1BQMA 2FLLA 1TAQA 2FJXA 4HVJA 3DRSA 1ZBFA 1VSMA 4O4GA 4DTUA 3OL8A 1R0AB 4FJ9A 4DSKA 4KFBA 1SV5A 5CYQB 1KFSA 3CJ2A 5KFHA 1TKZA 2FBYA 3SPZA 1RA7A 2B6AB 3ASMA 3PX6A 4WE1B 2OPSA 2QV6A 2Z1HA 1HNIA 1S48A 1L3TA 3FRZA 3VQ4A 4KAIA 2ZQBA 4CK3A 3TAEA 3OL9A 3DYAB 4YP3A 3AA4A 3V9XA 4DSLA 1UWBA 4TXSA 4RG8A 1BQNB 4EBEA 5KFYA 5CZ2A 2XGPA 2ASDA 3WNHA 1EP4A 4NLTA 2KZZA 4TQSA 2QE5A 3MR5A 3K58A 1HPZA 2IBKA 4E0DA 2QXFA 3K2PA 4J2DA 3GV8B 4MIBA 2VA3A 4FLUA 4R5PB 4G1QA 3NAEA 1RTIA 5KG6A 4C8KA 1TK5A 3SZ2A 1NK4A 4QWEA 3P1GA 3RMCA 4DQRA 1TVRB 5DLGA 1N5YA 3ITHB 1WN7A 2A1RA 1S1XB 3OL7A 4FLWA 3QO9B 4C8OA 1RBUA 3IS9A 4Y2AA 5KFTA 1RT1A 1LWCA 5KFVA 3OSNA 1SH0A 1S9GB 3U6FA 3KLHA 1TK8A 2J6UA 3ZSRA 4B3OB 2F96A 5FDLB 4KHSA 3AVFA 2XY5A 4JV2A 4NLGA 3DLGB 3NKYA 2C2EA 2ATLA 3HKWA 2DFFA 3ICLA 1LW0B 4DS5A 2ZE2B 3QLHB 3JYTB 4FJJA 5F8HA 3BDPA 1N48A 5F8JA 3M8PB 4YR3A 4PY5A 4IOBA 2R7YA 4KI6A 3UQSA 3V4IA 1CXQA 3MEEB 1J9AA 4Y34A 3RBEA 4EBCA 4I2PB 3CJ0A 1RT2A 4AHRA 3OS0A 3MEGB 3T19A 1RYRA 3H40A 4ZP8A 3C95A 4TN2A 5KRTA 4F2SA 4RW7B 4IG3A 5L1KA 3N6MA 2HAIA 1CZ9A 2E9ZA 3FDSA 5I42B 2YNGA 3SV4A 1S4FA 3DOKB 4JV0A 1DLOA 1S1VA 1J5OA 4ECUA 2CJQA 5L1IA 2YKNA 4OGCA 3MR3A 1BIUA 4OLAA 1IKXA 4Z4GA 5DMRA 1JLGA 4ED0A 4DU4A 5KFWA 4KSEB 2D0CA 1QSLA 4H4OA 3EZUA 3JSMA 3IN5A 1YTUA 3CFOA 3SQ2A 3SQ0A 2ZD1B 3D28A 4CF1A 3K5NA 5J2PA 5EUHA 1ZYQA 4DTJA 1EX4A 1RBSA 4E7LA 4OKKA 2BANB 4EYIB 4CK2A 1LW2B 1I39A 4O3SA 3EPIA 5CYMB 3NGYA 1VSKA 1J54A 3LP1A 2RF2A 4DSFA 1RT5B 2J6SA 4CJ5A 3G6VA 3E01B 1A5WA 3OYFA 3KK2A 1MU2B 4MK8A 1A5XA 4DU3A 3NGZA 4LSLA 1IKYA 4CIGA 1ASWA 4JRQA 1QAJA 1KVCA 4FS1A 4MIAA 5KFUA 5KFAA 3LP0B 3GV7B 5HRRA 2HNDA 4R8UA 5DQHA 4FJ5A 2HB5A 3I0RB 3KD1E 3H4BA 4B08A 1JLFA 4F4YA 1FKOA 3K5MA 4KHQA 4MFBA 1S1TB 2XI2A 2J6TA 1IO2A 1SUQB 4NLOA 2P5GA 3IRXB 4XIUA 5KFPA 4M3UA 5KT4A 1JLAB 5I3UA 2RDIA 3NH0A 1RT3B 1U47A 2KTQA 3NBPB 1KLNA 3PUFA 1XR5A 2ASLA 4F4ZA 3NL0A 4DF8A 3MR6A 3KHGA 2G8WA 4CEQA 4GC6A 4J9RA 1JKHB 3KTQA 1TK0A 5K14A 4ECYA 1KHVA 1S1UB 4M3YA 3NGDA 1EKEA 4LD0A 1JLEA 1IKWA 5KFNA 3ZT2A 4FVMA 3QZ8A 3CQ8A 4H4MA 5DQIA 4Q5VA 3NHGA 3KLIB 3VQ8A 3L2UA 4URQU 2W9CA 4BDPA 4AH9A 5KT6A 2DY4A 3V1QA 1IKVA 3CJ5A 3CYMA 4RW6B 3TWHA 5L1LA 1BQMB 4CHQA 2IM1A 4J9QA 2HNYA 1QSSA 4DSEA 4OKEA 4KHRA 3CFRA 3AA5X 1NK8A 4NZ0A 2FBXA 4FJLA 1HARA 4NCGA 4CEBA 4G3IA 2NUBA 3PW0A 4J9NA 1NOZA 1MMLA 1OS5A 2VWKA 1TKZB 4I2QA 4NYZA 5HROA 1RCHA 4J9LA 3D45A 2W7PA 5KFSA 3H98A 4CF8A 2BQRA 4FYDA 2D3UA 4NLWA 3T5LA 1RTDA 4F4KA 3SUNA 4PWDA 4ECQA 2B43A 4CECA 3ALYA 4AHTA 1WSEA 3ULDA 4BACA 4W5RA 3OS1A 3KMQA 3VA0A 5J2QA 1HNVA 4K4TA 1TKDA 1RTJB 1VSHA 2GV9A 5JS1A 3PJXA 1HPZB 4EYHB 2D0AA 3AO4A 2C2DA 3MFIA 3AV9A 4ED3A 4CJVA 3PO4A 3CDEA 3DLKB 1T03A 4G1QB 3VQQA 5DQGA 4KTQA 4CK1A 1RTIB 4CF9A 4PUOA 1L3VA 4DFPA 3OHBA 3TVKA 3QEPA 4B8AB 1C1CB 4DG1A 1SKWA 4K4YA 4IH7A 3NAIA 3KHLA 4Y3CA 3L2WA 2FVRA 4QW9A 1LWCB 1KVAA 3IG1A 3QGHA 1W9HA 3KLHB 3OYLA 1QSYA 4BE1A 3RB3A 3CO9A 5KFJA 3PW2A 2HMIA 4QW8A 3SI6A 3HT3A 5J1EB 1REVA 1BI4A 3ZSWA 4RW4B 4DLGA 2WONA 4QWAA 1TV6A 4M42A 3OJSA 2F8EX 3M8QA 1S6QA 5C24B 1FXXA 3HK2A 4RZRA 5HP1B 3CG7A 1VRTA 2YNIB 3OYIA 2YNHA 2IJFA 4B9NA 1RT2B 3V6JA 3OYBA 4IDKA 1BGXT 4QWDA 1NKBA 4RW9A 3MTKA 4XO0A 4IG3B 3RB6A 1RT4B 3H59A 3H08A 5T14A 3D5MA 4O3PA 1ZETA 1S1VB 2KFZA 4C8MA 4FK2A 3HM9A 4Z0UA 3H5YA 4FLTA 1ZBIA 3ISND 3M9OB 2FC0A 2ZKUA 4U7CA 2AJQA 2BRLA 1JLGB 1WAFA 4KBIA 1WSGA 4DFKA 2IAJA 4M45A 3Q8QB 3PR5B 3GIJA 2VG5A 4RW8B 2IJNA 4H4OB 3JSMB 2GC8A 4J2EA 4MK7A 1TL1B 4ZHRB 3PZPA 4W5OA 3S3MA 1NK9A 3NF9A 3F73A 1YVFA 3BSOA 5L9XA 3AVAA 3HXMA 2XY6A 2YNFA 3EZ5A 3DI6A 1LWEA 4CFBA 3SPYA 4QWCA 4FBUA 1LWFB 3ZSZA 5KFKA 5C25B 3DMJB 1C1AA 4KREA 5KFCA 3LP1B 2RF2B 4IFVB 4CHPA 2IOCA 3C6TB 2P1JA 1JLCA 1NHVA 1KLMA 4IR9A 4FJ8A 4FJIA 4O0IA 4CHZA 4EZ9A 5DLFA 4IG0A 4HUEA 1IKYB 3OYJA 3VA3A 4LQ9A 3BJYA 1HRHA 1RBTA 4CEDA 4CJLA 3HO1A 2HNDB 1QHTA 1HQUB 3RRHA 3PJWA 1HMVB 3LP2A 4MKAA 4HTUA 2HHTA 3HP9A 5EWGA 1TGOA 1FKOB 4MFBB 2RN2A 4MKBA 3TR8A 3LWMA 2FLPA 3L8BA 3PX4A 1DTTB 3NMAA 5I3UB 3BQ0A 5KFMA 2D5RA 3V9ZA 2XY8A 4KO0A 2O4GA 3AVKA 4CJSA 3TAPA 1S0OA 5FROA 4NLVA 2FVCA 1FK9A 3DRPA 1C0MA 2Z1IA 1L5UA 2WOMA 2KQ2A 1RDDA 3L2VA 4CHNA 3LPUA 3RB0A 3B6OA 2YV0X 1RAJA 3BSCA 4IFYA 2FVQA 2DFHA 1I3AA 2PY5A 2E4LA 1U04A 1UA1A 3PV8A 4Z4FA 3OLBA 2OPQA 4QPXA 2W9CB 1GX5A 2VG7B 5EU7A 4RU9A 2G8UA 3DLRA 3QETA 5HRSA 1IKVB 3D0PA 4L8RB 4DL7A 2FVPA 3Q8SB 4GC7A 4IH6A 1RT7A 4NLUA 3TAGA 3OYDA 4QOZB 4KHNA 1RBRA 4ZPBA 3BQ1A 3THVA 1ZTWA 5KFZA 4ID5A 1KTQA 2DPIA 3MEDB 3I8DA 2XY7A 4W5TA 5HRNA 2LSNA 4CFDA 3N6LA 2UVWA 3QYYA 3KLFA 4WFXA 5KG2A 4M95A 3OS2A 4ECZA 3V6KA 3L2QA 3MR2A 2D3ZA 4Z4IA 4B9VA 3E51A 2X78A 4AHUA 3H2LA 2R8JA 2Z1GA 3WNGA 1Q9XA 4KE5A 2W9BA 1U45A 3KLGA 3M8SA 3GILA 4TY8A 3EPGA 4F4XA 3EY1A 5J2QB 4DL3A 2OPPA 1HNVB 4DQIA 3RAXA 1ZBUA 4B9TA 2OPRB 4O3QA 4WXWA 2HW3A 4FBTA 3VQEA 3U3YA 4ED7A 3FFIB 2XO7A 4CJEA 4CJUA 2XI3A 5KI6A 4DL2A 3G10A 1T03B 3CJ3A 5HBMA 3K59A 1EETA 3MECA 5HLFA 4DFJA 4DS4A 4PUOB 2XCPA 3SUOA 3RTVA 2AGPA 2O4IA 1S6PA 3BGRB 3M9NB 4NRTA 1W0HA 3K57A 1GX6A 4Z4CA 2R2SA 4CGGA 2IDOA 3VQAA 2W9AA 4N56A 4O0JA 4DQQA 1C0TA 2AGQA 3SQ4A 3KK3A 3KLVA 4K4VA 2DTUA 1Z26A 4EO6A 4PQUA 1N56A 1T3NA 2HMIB 3K5OA 3QIPA 4WZQA 4J2BA 1N6QA 4RNHA 4KB0A 3AA3A 1BI4B 3V1OA 2WONB 3HSTB 1S97A 1QQCA 4J9SA 2Q3SA 3CFPA 1SKRA 2HNZA 2A1SA 3P5JA 4F3OA 2VWJA 3IGVA 2JEIA 2XHBA 3LPTA 4HKQA 4YMEA 4U6PA 2X6SA 2V4QA 4CGDA 4E89A 4FJKA 1HYSB 4DQSA 3DOLB 1WLJA 4Z4EA 2R2TA 4OKJA 4F8RA 4KKOB 1VRTB 4ECWA
chains in the Genus database with same CATH superfamily
4CJPA 3T1HK 4EBDA 4XEIA 3BSAA 3ULEB 2BE9B 3C15A 4JI7F 4PXCA 2G8HA 2ALZA 3G82B 2EEYA 3VEVA 2UUCF 1NKCA 2OYQA 2G13A 3HHLA 4Q8EA 4W5NA 5E7OB 3GSDA 4CNZA 2BX6A 2I5JA 4PG5A 2MLZA 4BC7A 2FVSA 2BRKA 4JS5A 4DTMA 1R59O 2YKMA 1LOUA 4ATNA 4ZN3A 4ED2A 4ZS6A 5KT3A 3PACA 4ICLB 3W9JA 4FVCA 2BMBA 1M5HA 4H8KA 2CNOB 3GMGA 3CJCA 1LWEB 3T5JA 1RDRA 3CIZA 4HWIA 4Q43A 1F5BA 2VOOA 2M4MA 4BVPA 1S3XA 1DTQB 1R31A 5T7BA 4IKAA 1RA6A 2ZH6A 4F25A 1YT3A 5B0CA 4LSNB 3T5HA 3HHKA 3I56S 1ZS6A 2G0CA 3RMBA 2CGKA 2C2MB 4A4JA 2ROPA 5KFDA 2NUHA 2XZWA 2VQFJ 3AVGA 5AQLA 1U6ZA 1NU0A 3L9ZA 2A3ZA 2OELA 4M7XA 3LP2B 2P9UB 5DRKA 4X64J 3OFGA 3ZO7A 1VQ9N 1HHSA 1AROP 1WNSA 2R8KA 2B5JA 1LOTB 4KFBB 2ZUGA 5CABA 1N33K 2FJEB 1HKCA 1K1QA 4TYBA 4M5KA 2ZGYA 3TRGA 2OPSB 2MEWA 1VQON 4BRCA 1UVIA 1HNIB 1GLEG 3HFVA 1RNHA 2ASJA 2K1RA 2FHKA 3EJMA 3DRXA 2JZ5A 3QJLA 4J9VA 4BCAA 1YZ7A 2VODA 3IM9A 1TVRA 2Z1JA 2VG6A 3S8SA 2V0NA 4CGFA 4OI1A 1JXVA 4O5BA 5M2RA 3HOSA 3ID6A 2JVOA 3V9SA 4DR1K 2E2PA 2DNKA 3UFCX 1RT7B 3K9KA 2WVDA 3N9UC 5BN9A 2M8DB 4U95A 1YVUA 1MNEA 3AAWB 4B3TJ 2BM0A 1S9EA 1XWLA 4E98A 2ZNYA 3BY5A 1JB0C 2CKWA 1VRUA 4L6V3 2UUBF 1PJ5A 3MN5A 2C3UA 1RABB 2OSQA 3TTFA 3GJTB 3U3GA 3UW1A 2O01C 3NOGA 4J9MA 1M90O 1M5KC 3SIPB 4JI3F 3FZKA 5L8RC 4AF1A 1NK6A 2W8LA 3AXKA 4RW7A 4KH5A 1VSEA 5HL7Q 1FRIA 3AVJA 3C7NB 3DOKA 1RTZA 4K8ZA 5G4DA 5DK5A 2UV8G 4CIFA 4TYAA 3D0HE 1VSJA 3ZYYX 2AMCB 2W6KA 2E2QA 4NA3A 2QYCA 2V2KA 1DQAA 4A8WA 3AVBA 4DV5J 3WQTA 2DK2A 1FDDA 2P9KA 4CIEA 4RWWA 2Z30B 2LU1A 2W2OP 2OA8A 1S6PB 4LT6A 2ZD1A 5HANA 3V6DA 1ATSA 3PIOL 2VF3A 9RUBA 3H90A 2XCAA 2HHQA 4DV7J 2W4DA 1DLOB 4H5RA 3K9JA 2FHJD 2PEBA 5MAOA 3SCXA 2BOAA 2HIYA 5DO2A 3FBEA 3K2YA 1MU2A 1IBMF 4AQYK 3CXCR 1RLDA 1VQ6S 4FLVA 3OLAA 1QTNB 4H0VB 4OPAA 4JV1A 2V8GA 3LP0A 3LDPA 2V4RA 4UZCA 1T3VA 4ZCKA 4DTNA 1SC1B 1FW6A 2P9SB 4IZ9A 1EZZB 3ZZTA 4DI6A 5J2PB 1ZM2A 3VQCA 5C12A 2GIQA 1SL1A 3TQ1A 1D1UA 1RBAA 2CWXA 5J2NA 4IR1A 2Z4PA 4JV5J 1RP5A 1HR0K 3DLEA 2GA7A 3RYLA 1URRA 1C4AA 1FNMA 4ELUA 2QSWA 1X60A 4BDYA 3TUIC 2B9EA 4QWBA 2K3KA 4P2FA 1S1UA 1QM9A 3IWXA 1KVIA 3KUEA 2IC3B 2PGCA 3SI8A 1QZ6A 3QT8A 4BC4A 4RUCA 2K8GA 5AZJB 2J9EA 3OA9A 2ZH9A 4C3LA 1GXTA 4KHYA 3KLIA 5B0DA 3BPDA 5AXNA 3QFUA 4NLXA 1UP1A 1U2FA 1LAWA 3SDEA 4ECVA 1XMOJ 4DPXA 1KSPA 1TL3A 5K14B 3C6HA 3G6ES 3HT0A 2QN6B 3MM9B 3R5DA 4K5SA 1F21A 1QUVA 2JLEA 4CT9A 2P6TA 3MM6A 1NKEA 2CDRB 2H65B 3WEEB 1S5JA 4JI1F 3RRKA 2E2OA 3KJVA 4BWJA 3WXJA 3CTRA 3QB0A 1WSJA 3AODA 1X1PA 4DR2J 4I7FA 2B7BB 1RADB 4HTJA 1T6CA 5J2MB 4X66J 1X3MA 4TY9A 2KM8C 3C66A 3UPFA 2HNYB 2KL8A 3ZSQA 4URGA 4IJAA 1B0PA 2Y1IA 3IWNC 2IVYA 1FDAA 2FZKB 4PQAA 4PA1A 3MURP 3U1MA 3IKMA 3KHHA 3V2UC 5HROB 1WG5A 1E6VB 1PIEA 2YY3A 4CWBA 4BS2A 2CQ2A 1JL1A 5AQPA 5FD1A 2ZC4A 3VF2A 4YQWA 3VQPA 2DFEA 1EX8A 5KQDA 3C6UA 2D4WA 2COLA 3KKRA 2HKEA 3SNNA 5KG5A 4BDZA 3NGKA 2R8IA 1IM6A 4CBWA 2HF3A 2ATCB 3AO1A 1HFEL 4K0KF 3U8XA 1RHMB 4WIQA 1FHTA 3ZSOA 4WFYA 5AQOA 2RKIA 4RW4A 1WEXA 4PXEA 4KT0C 1YX2A 1PC4A 3OR1B 1SI9A 1NDLA 1RILA 2X3DA 2RNEA 4JI5J 1BUPA 2HVHA 5FRNA 2FJWA 4PKGA 2KT3A 4DZDA 3LWLA 3NE6A 2DGSA 3NLCA 5HP1A 3QIOA 3V81B 2EK6A 5IQ6A 2DYAA 1GEHA 3IG1B 1GMWA 1HNZJ 3WX4A 1R3NA 3SYZA 1ILYA 3G8QA 3H3NO 5AXMA 2Q1NA 2QWMA 3QINA 1PYSB 3ATUA 2LA6A 5E26A 1HWUA 4GKKF 3FZMA 1JK9B 3MMBB 2QXLA 4EMDA 1RT4A 3RBZA 5M1PA 4DUZJ 4M5GA 3BSNA 1JJHA 3TSQA 2ASYA 4KHPK 5AQIA 3MCOA 1BCMA 5ETQA 5AQHA 3CJAA 2PFDA 2YNHB 4JD2A 4YOEA 3NOCA 3ID8A 4NLSA 2K06A 4Y0WA 4CF2A 2IMWP 3QFWA 2Q0UA 4AHVA 3PEJA 3CNQP 1V4TA 1NGAA 4F4AA 3ZT0A 1LWFA 4B3SK 2O8CB 1HWIA 1S0VA 2XMJA 3C6TA 2FZGB 2AU0A 1NGIA 3B6PA 3KNAA 3I55N 1Q5YA 2GIFA 1RAEB 2BUNA 4A48A 1FJ7A 2LEBA 5DETA 1FNOA 4FXVA 5GMDA 5IM0A 1VR6A 4ANDA 3SQOP 3SMSA 2E6MA 2HQGA 4IO8A 3LAMA 2RB7A 3GE9A 5DDRC 4O8KA 4CEAA 2DRDA 1GTEA 4UF4A 3L7OA 2MQLA 2P9IA 1BIZA 3EX7B 1F9FA 1RU2A 1R0AA 2XG8A 2YWHA 4C2MA 2JX2A 2EX3A 2ZH8A 4GW6A 4IG0B 3ZT1A 2LCWA 2KDOA 5LL6d 1U2VB 2D0PA 2LMIA 4TQRA 3CCTA 2LKZA 2DPNA 3CPWR 2AP6A 1SKSA 4JI4K 2IBOA 4LF6J 2NR0A 1RDAA 4Y28C 3OFFA 2RILA 4F36A 4MYUA 2NNWA 1B0VA 2ILYA 2KRBA 5CA5A 2KZMA 3QERA 2C3OA 3H2UB 1XMQF 5M1KA 2JNJA 4U7UD 1PBUA 1RGVA 4NEZA 1AZSA 3SJJA 4DTPA 2LQ8A 2A18A 3MFHA 1WC0A 1YHQN 3TUZC 4F02A 4H4KA 3GG1A 4DX7A 1SJFA 1M1KT 4BC2A 5EGYA 2H5JB 2Y0SD 2HS0A 5D15A 3FGVA 4CO4A 3OYMA 4BRPA 2E8AA 4USKA 4BGAA 2QT7A 4LY7A 3LW5C 3MEDA 1S1XA 2ZBRA 3IR7B 3R5GA 1Y97A 4GMJB 1OY6A 2Q79A 4KAZA 4RBTA 4WZMA 3ZZOA 4M1KA 2IVNA 5C2DA 3R6LB 2HHHK 1BOTO 3L3VA 5A2QU 1B0TA 2W25A 4XH1A 4DPUA 2VGMA 3GG4A 1A5VA 3VQ9A 4ECRA 5BN8A 4CFAA 4P2MA 4DN9A 2ZE2A 4ZKAA 1WTBA 2OPRA 4ID5B 4LFAK 2BJEA 2F8SA 2MKIA 5HVHA 2QGFB 4OX9J 1U8WA 1W2BM 4ZPAA 2EFQA 2D0BA 3AXMA 2Y1JA 4BRDA 4V1Ak 1FTRA 5F0XA 3FUYA 3L3CA 4NWBA 2J7WA 3U7JA 2XLKA 4ISGA 1IG9A 2ADBA 2VQFF 3EGWB 4CEZA 4I4BA 3KVGA 1JIHA 5ITHA 4X64F 4FJXA 1P8GA 5BR8F 1MW7A 4JS4A 3C14B 2YQ3A 4Q8FA 3V9WA 4DPWA 5M2PA 2Y8WA 5H9FK 3T7ZA 1RHUB 5KQ8A 2LA4A 1F3FA 2UXBK 2D69A 2WTUA 5GMKa 3HVRA 3QZ7A 2X74A 3VGLA 3SCKE 3PXGa 2J9DE 1CJTB 3THTA 1LW2A 5LM7E 5GMEA 4BE2A 2JFKA 5CYMA 4DBQA 1FKPA 2Q36A 3KK3B 1JXLA 5BJRA 1XNRJ 2V51B 4CD1A 1NGBA 4BR2A 3WUHA 1GT8A 4EZ6A 3J80O 3FQKA 2V6AA 4O0NA 4H03B 3R2DJ 2HVDA 3VF0B 1QVGM 2LP4A 2E88A 4J9PA 2AYEA 4CEEA 1X9WA 4K25A 3I0RA 2NCKL 3I0SA 1S10A 4JHDB 2BR0A 2O8BB 2EKNA 3Q8PB 1ZBSA 4B3TF 1HQEA 3TEGA 3QT6A 4ZIWA 1HYVA 2E5GA 2B51A 1N34J 1UETA 4OHYA 4EFHA 4JI0J 3NRBA 4IO9L 1W25A 4LRBA 2WC9A 3NBPA 1W7AA 3JAMY 4OGEA 3J81U 2MGZA 3WT0A 5LJ3Y 4WFNQ 4WIIA 4LIWA 4FS2A 3KK7A 3HHLB 2YCHA 3DN9A 4QPTA 2V9WA 5DGBA 2KFYA 2RQCA 3MAQA 5JVGL 3R7SB 2HMPA 3QESA 2DR7A 4CJ7A 3M8RA 4XDCA 3RR8A 4OJ1A 2BQ3A 5D0GA 1N4LA 3QMQA 3P45B 1NHUA 2AJ4A 4RW6A 1XC3A 4OLOA 5CZ1A 5HAOA 1TAQA 3M32A 2FJXA 2KB2A 1VSMA 4DTUA 4UZBA 3OL8A 3GU0A 2R7QA 4KGMA 4WWSA 2YX1A 3VEZA 1V3RA 4OYIA 5CYQB 2B9WA 1WJ9A 1UEUA 2FGCA 1D9AA 1TKZA 2FBYA 3SPZA 3ASMA 2MKJA 5DZ7A 2AEMA 3THYA 4U8YA 2Z1HA 3LPYA 2E7WA 8AT1B 3FRZA 3VQ4A 2QWRA 2QEXS 3V9XA 4TXSA 4C98A 4BGBA 1BQNB 1EP4A 4CZFA 4NYPA 3OBIA 1WELA 3MCSA 5EX3A 3K58A 4E0DA 3PYEA 5DM6L 4JV5F 4BRQA 4NXMK 5A8KA 5M1OA 1KC8T 3ZNUA 3NAEA 2HZCA 2W6LA 5KG6A 4C8KA 2ZBIA 3SZ2A 1NK4A 1MWZA 5BYSA 1RHJB 2ZHBA 1TVRB 1HNXF 1N5YA 4ANEA 4UUXA 3G96A 3QO9B 4C8OA 2G0JA 3E9OA 3M8ZA 2VBWA 1LWCA 5KFVA 3M2VA 4QS9A 1GLLO 3TUPA 3HX9A 1RB0A 3PNIA 2IDLA 4ZJLA 1IBLK 3SCLE 2CJKA 4JV2A 4NLGA 4X4PA 3DLGB 3A8JA 4DU7A 1F5AA 5IXUA 5LMNJ 2V7YA 1XMOF 4Q7AA 3NMRA 5BPMA 1S59A 1IV0A 4FJJA 4ER8A 2NZ4A 1MA9B 1XK8A 3BDPA 2RIJA 3VAKA 4RL1A 2MQNA 4OI2A 3Q0AA 3J7YI 1T9XA 2FZCB 1J9AA 1HI0P 3K0JA 3RBEA 3G9CA 5B8HA 3CJ0A 3T19A 4LR7A 1NZAA 1YZ6A 4ZP8A 3C95A 1CULA 1SIWB 2R9LA 1T11A 2AJ1A 4RW7B 4F04B 4DR2F 4IG3A 1LFWA 3N6MA 1X8DA 3GP9A 4QQBA 3DOKB 5HMXA 5DDPC 5DM7L 3KUGA 3AJ1A 2A41A 1I94K 1KVJA 1VQKS 1BIUA 1VQ8N 1IKXA 1SXLA 5DMRA 4Z4GA 4A8MP 4PKHA 1WEYA 4ED0A 4DU4A 5KFWA 4NXNJ 4FVUA 1Q86T 2FY1A 4KSEB 3JSMA 2GVDB 3IN5A 2DHHA 2RT3A 1HBNA 3SQ2A 1JJCB 2ZD1B 1ITPA 3D28A 3K5NA 4L3NA 3HDSA 4OKKA 2OD4A 4CK2A 2QFIA 5LMUF 5U47A 4N8NA 2V34A 4QYZK 5A0YB 2RF2A 2YKAA 4DSFA 2QSFA 2JRSA 3G6VA 3ZZUA 1P9QC 1NM2A 2AZ3A 1MU2B 4A47A 4MK8A 1A5XA 3OUYA 3NGZA 2R3VA 3ZNJ1 1ASWA 1KD1O 4FS1A 3B82A 3NGRA 4DN0A 2CVEA 3LP0B 1Y9OA 2QLFB 5DQHA 3ENAA 5E84A 1FA0A 2OO4A 4JI5F 2CQDA 2O8FB 2QFJA 3HFKA 1WSRA 2ZOFA 2RD5C 4D3HA 4XIUA 2DNPA 1JCGA 3NH0A 2N7CA 1U47A 2JLFA 4EFAC 4F4ZA 4H0XB 1E4GT 1HNZF 1NCLA 4J9RA 3HHEA 4YORA 5HSPA 1KHVA 1S1UB 4LD0A 1JLEA 5GAGU 5FPEA 1TU0B 2Y1RI 3MOZA 1RZMA 2POKA 3KLIB 4URQU 2DD8S 1WACA 1XJWB 2W9CA 3H8YA 5IWAK 4A5AA 3NGUA 3SDEB 1R7IA 2QA1A 2IIHA 4PG6A 3AOCA 2OMOA 5L1LA 4MT1A 2IM1A 1U26A 2QTDA 3CFRA 3AA5X 3CCLS 2FBXA 1HARA 4G3IA 1N5SA 4KBOA 3TVYA 2FC9A 2N4DA 1MMLA 1OS5A 3JXOA 2X1GA 3OTOF 1FEEA 4J9LA 2GWJA 3LM2A 1TR0A 4FYDA 4L73A 2PA8D 3LM9A 2JL9A 4FYWB 1HNWK 4LF2A 1G3OA 3ALYA 1WSEA 1SJQA 1IBKJ 3DXBA 3PCOB 4W5RA 1FTCA 1TKDA 1VSHA 3PJXA 1NAQA 1HPZB 1Y3KA 2D0AA 4IUFA 4JI6F 2J9CA 4CIOA 1GQEA 3MFIA 4DV2K 3SJHA 4G1QB 4KTQA 3OV7A 4DV1J 4CF9A 4PUOA 1L3VA 1N33F 1B3TA 5CE3A 4DG1A 4K4YA 2FF3B 4CO3A 3KHLA 4Y3CA 5MLCV 4HDHA 4LF6F 4LFBF 1KVAA 3TVZA 3SBGA 3OYLA 1KQKA 1X9JA 3CC2N 3ILLA 3MEKA 4FF2A 3PW2A 4QW8A 3SI6A 2YJFA 1BI4A 4RW4B 3LDLA 3AGRA 3MM7A 4ZLJA 1FRXA 4JOUA 2MQQA 3PHTA 4UY8O 3EUNA 3MAHA 1PG5B 2HRTA 2Q0RA 5D0EA 2UUAJ 3M8QA 3N79A 4MJKA 5HP1B 3CG7A 4FSVA 4NZ7A 4FN5A 3GTYX 5H9EK 4WK1A 4DMZA 1N5TA 1U1NA 1UPPA 5ETVA 3UE5A 2WBNA 2H4YB 3TWZA 3L4QA 3CJSA 3MDQA 3MTKA 2BEFA 1D09B 1RT4B 1DQ9A 2VPYB 2N3OA 4O3PA 2KFZA 4C8MA 4IDHA 4Z0UA 1TL7B 4ZVOB 3ISND 2FC0A 1WAFA 4DFKA 2MY8A 4QR0A 1VLOA 2VG5A 2RMLA 3W8GA 3MHYA 2V8HA 2H54B 4J2EA 5B7WA 1O51A 5AQTA 1NK9A 1N32J 2KJWA 5IT9Y 1YVFA 3H2VE 4GMKA 2BUPA 3T41A 2YNFA 3EZ5A 3DI6A 1F3VA 1N88A 3CW2C 4PG8A 1LWFB 3ZSZA 5KFKA 2RVJA 3ZZ0A 5KFCA 4CHPA 3MR7A 3C6TB 2P1JA 1WG4A 4O0IA 2CQIA 2W7AA 3TPQA 4LQ9A 3IUCA 2JWKA 1RBTA 3D6TB 3CJRA 5IM0B 4EHTA 1VQ4S 1HIYA 5CD4H 3HO1A 3F44A 1QHTA 3RRHA 3TA2A 1P8ZA 4HTUA 2JOQA 2UU9J 4OZNA 2F1FA 2HHTA 4AQYF 4ZPWR 2CPEA 1FKOB 4MFBB 1T6DA 2CNLB 2PFUA 1AA1B 4L75A 3HJVA 4KGZB 2P9IB 3JTNA 1Q82T 3L8BA 3PX4A 5I3UB 4DHYA 1V3ZA 3R6GB 4CP5A 2RS8A 1H0HB 4A5BA 1QY7A 3QWPA 2FVCA 5F2RA 1QVFR 1OSCA 2Z1IA 1RAHB 1L5UA 5GIOA 2KQ2A 2YPZA 1RDDA 4CHNA 2CH6A 4LRCA 2EK1A 4WYBA 2ZM6K 3FSYA 1FRHA 2AT1B 4Z4FA 5D4PA 5C2CA 1JNZB 3R6MA 3S41A 1X4EA 2AJ2A 1YJNN 5EU7A 2G8UA 1DHMA 2W01A 1IKVB 4DL7A 1N34F 3ISZA 3OYDA 2GCFA 4KHNA 3MD3A 1FD2A 3ENQA 3DWLA 1ZTWA 2ZJPQ 5KFZA 2EFVA 4LF7J 2CAJA 4ZCLA 1KTQA 2DPIA 1U1PA 3MEDB 3I8DA 5HATA 2ZUAA 2LSNA 3DXMB 1NNEA 2PO4A 3UDEA 3CEDA 3KLFA 5BRDA 4LF4K 1R8PA 4UOGA 3GJSB 4WFXA 2F65A 1O13A 1OY9A 3L2QA 1T95A 3MR2A 3MMJA 4B9VA 1NU4A 3E51A 3H2LA 3WNGA 2HIQA 3WX8A 1S72S 1VC6A 2VQEJ 2E5HA 5AQGA 1FWKA 2A2CA 2WAQD 3PTWA 1LWXA 4BRIA 4OX7A 5J2QB 4K5RA 4DL3A 1HNVB 1PYTA 3O2IA 4MDAA 4EHUA 2OPRB 4CTAB 5CCMA 3U3YA 2XO7A 4CJEA 2XI3A 4DL2A 3G10A 1T03B 5H1SV 1KWMA 3K59A 3MECA 1CLFA 4DFJA 2GHVC 2XCPA 3IFEA 1W0HA 4JI7K 1GX6A 2HRUA 4CGGA 2XS5A 3MMVA 3VQAA 2W9AA 4N56A 2UUCK 4HT5A 4DQQA 2KRRA 2A0FB 5CD4A 3QBXA 4YY3F 5LSOA 2DTUA 3MZIA 5J1NA 1Z26A 4EO6A 1IXKA 4F3QA 4RNHA 1C4CA 4CW7B 1FFWB 1QQCA 3A8IA 4K2JA 1VYAA 1QAYA 5HI7A 2HNZA 3QICA 5IT0A 1PJ6A 4OPHA 2E1MC 4BR4A 4JI8J 2VWJA 2DH7A 3VERA 3UCGA 3MM8A 2JEIA 4YMEA 1DKGD 3L7PA 4DQSA 3MD1A 4FZVA 2LFVA 2R2TA 2FLOA 2F4VJ 1VRTB 3J81j 3UNGC 2DXFA 2QA4S 3RGIA 3EYZA 1FKPB 4AILC 4QJVA 4IDKB 4O44A 1SJRA 4BRLA 2YWWA 4UQGA 2HFNA 1I5OB 3TANA 3O4QA 4C0BA 1HI8A 3MI7X 1EB0A 3NNAA 3SQGA 2LU2A 1FJGF 1T02A 2HGNA 2MYFA 1WAJA 5C7PA 5KG3A 4FJNA 3I0SB 4GVMA 5KT5A 1S5ZA 1UW9A 2ZGZA 5C42A 2R7XA 3M1VA 1VSLA 1HQEB 5F9NA 2YTCA 2IGIA 3O08A 2B4PA 4NLQA 1EWRA 1T9VA 3PRBA 4A61A 2ZJQQ 3CCQS 1RJJA 3ZFVA 1AB8A 1ASVA 4QIEA 2MGZB 1GOCA 1T05A 4KHPF 1YJRA 3CJQA 5K8MA 4FK0A 2HFVA 5F9LA 2E5LF 4FWLA 3PKMA 3CJKB 4ELVA 2PDAA 3VQ7A 3KJFB 5D4LA 2DH9A 4CF0A 3LQVA 2YWEA 4ETXA 3HULA 1YIJN 2DRAA 4K59A 4WQ4C 2B56A 1IR1A 4K50A 1XHXA 4JKBA 3AT1B 4ERDA 4YDDB 1HYZA 3H0PA 4HCBA 2HGLA 4KB7A 2NRVA 3M32B 1C2PA 4DR1J 2W42A 3LF0A 4YB7A 1BA1A 1ATRA 4OZ2A 3KMSA 4P9SA 3NEKA 5CYJA 4X2BA 3US5A 5K8PA 2FLNA 1O6XA 4ANCA 5AZIA 2XGQA 3W62A 3IMXA 4KR0B 2X7IA 2ROGA 4C11B 1DAXA 1UVNA 2BZ2A 2LECA 1C1BA 2ASPA 2V7ZA 3GBTA 3OY9A 3RAMA 4XTTA 2OPQB 2ZZTA 4DLEA 4AHCA 4DPTA 2A2DA 3SFGA 2AW0A 1KVBA 3WQUA 1EP4B 1K1SA 3DLJA 4NLDA 5M1QA 2Q2RA 5FDLA 1YBAA 4ZLNA 3QEXA 4FZXC 2QYGA 3V5RA 5A8KB 1Y5LB 1TTHB 3CCUS 4LF5F 4J5OA 2KN4A 5KG1A 1HHQA 1VQPS 3JYTA 1V5VA 4CBUA 1AFIA 2P9NA 2CUYA 5C5JA 3SSRA 1VSIA 3C94A 1N5YB 2MQPA 1DZ5A 3AVNA 1K0TA 1C0UA 3DDNA 2O8EA 3HPOA 4PHTX 3GSIA 1NOYA 4QZVB 3M2VB 2Z56B 1FXLA 3OFEA 3MEEA 1CG2A 3I82A 2ATQA 2HG4A 1NSQA 1GLJO 1HBMB 5LSLA 4MKYA 3CC4S 2FJBB 4WK3A 5KFOA 3GV5B 1RKIA 3O9TA 1IBMK 4GV9A 4B9UA 3UR0A 5D4NA 2W9BB 1IJEB 4TLQA 3O4NA 2YKOA 4AL5A 3V6HA 2Q66A 1KDNA 1I3OB 1TKXA 3M2UB 4FM1A 5KFFA 5F8GA 1HKBA 1S7IA 2WK4A 3L0QA 4YOWA 2HRYA 1RXOB 3FJ2A 4N77A 3G2XA 1X5TA 4E7JA 3SFUA 4HHJA 4PABA 4FLYA 1XNQF 4MYTA 2R7RA 2YJEA 4BG8A 4S0MA 1U1RA 3PW5A 4PKDB 5DG7A 4CJ4A 2KHCA 3FBFA 4LFAF 3LOUA 1VFJA 3LDSA 1X9SA 2HLTA 3BEGB 2BANA 1TP7A 5B0FA 1TKTA 3S6EA 1NGCA 3DLLQ 5JVHQ 3I56N 2KLAA 2VJVA 3UO0A 1X7VA 2H5IB 3AO2A 1RGIA 5DGAA 3QIPB 3AH6A 5JJBA 1IBKF 1IKXB 3P4IA 2YX6A 2WHOA 5JUMA 2E5JA 4BE0A 4FPIA 2K7JA 2UVVA 3TOQA 1RDUA 3WXLA 5FIIA 2KM8B 3SXLA 4H5WA 5ETNA 3CCWA 1X4FA 1RBLA 3DFEA 2L08A 4N76A 1UVKA 3PHEA 2AA4A 1S1TA 2C2OB 1YGYA 4WFZA 4KI4A 1QTMA 1JLAA 3A3NB 3MDFA 1RDBA 4KPCA 4CJ3A 4YUDA 2O8DA 1KQSR 2IDEA 4JI1K 3KG0A 1BQXA 1UPMB 1L3UA 1UAXA 4DTXA 4FOIA 3HVAA 1F2GA 3HVTA 5KGXA 4IRDA 3CI5A 4IRCA 2C2RA 1Z4UA 5K8OA 3DXSX 1F9HA 3IAS9 1F9EB 4FNHA 3TAMB 4ZTJA 3I4PA 3NAHA 4BQZA 4NPOA 1W2IA 4KTWA 3BGUA 4DF4A 4FJHA 2VFTA 3QNOA 3IGNA 3O6QA 4C3KA 2KFNA 4B9SA 3GIKA 4P71A 3R3TA 3SQ1A 1NPKA 1HWJA 4JK9A 5EHHA 3UCUP 1PC5A 3RWUA 4NLPA 3M8WA 3TZXA 3GG0A 4E19A 4IJNA 1SC3B 3J81Y 1PCAA 2JWLA 3ZSYA 4LRDA 2ALYB 1JLEB 4TLRA 4DL5A 4IBNA 3S3OA 3MOJB 1CLQA 4CT8A 1YUWA 3OYHA 4B3RJ 1KAZA 1NJIT 1VJQA 3CGIA 1LFPA 4C9DA 1W7WA 3WDOA 2QKKA 4EO8A 4Y65A 2DY9A 3P38A 2D3OR 5AQFA 3A1YG 4DQ8A 4B1ZA 1KTVA 3CCVS 3WXIA 4Q44A 3G8TA 3D0GE 1XEZA 3O9QA 3ZZRA 3VF6A 3F9KA 4HUFA 4KH4A 1T9TA 3TABA 3VQSA 1M1KO 2XSFA 2AYGA 4Q0BA 3ZZZA 3R9PA 2KJVA 5ETMA 2HBMA 5F3ZA 3QRRA 3OXFA 2JDJA 3OHAA 2G8FA 2BW7A 4DU1A 3HF5A 2UZAA 1APSA 4Z4HA 3QEVA 2VPWB 3A5OC 1WC4A 3EXYA 2EW9A 2RHKA 3VQBA 2MY7A 3DLKA 1BY9A 3O9UA 2L48A 5IT4A 3Q7CA 1JXBA 1LNQA 2Z8QA 4ZTFA 1FF2A 4YS2A 4AHSA 5A8RA 3LZIA 1Y0HA 4EI2A 3QIDA 4ZPCA 2M88A 5K9FA 2JEGA 4J2AA 3ENWA 3RAQA 4FJ7A 3JQMA 2MXYA 4I6MA 3DM2B 1GMWD 2ZBCA 1VBYA 4W90B 2CZ9A 2QG9B 1YTAA 1SPBP 1VQ6N 1LAVA 4HCCA 3AB4B 5LOQA 4DL6A 3NXZA 4CI0B 1LXJA 3X3UA 2EC0A 1H38A 2XWYA 4ITSA 5J1EA 1CSJA 4DTSA 3FSIA 1CZBA 4AD6A 3R3LA 1VK8A 4K2XA 2ASMA 3HZEA 2W8KA 4DV3K 4O3NA 2NRRA 2AYMA 2VJUA 1GLFO 4Q2LA 4ISFA 1NGJA 1BDGA 2AX0A 4F9OA 3CULA 2MLYA 3FZBA 4DG1B 3QJPA 2JC0A 5F8LA 1X4BA 3HSZA 4JKDA 3LA0A 5C24A 4NXMF 1R8AA 2ZVSA 4ENOA 1KOHA 1Y10A 1S1WB 2A6AA 3OYCA 4CGIA 1WHVA 2JEJA 4B3SJ 4DPYA 1XR6A 3P3DA 4XPEA 3OVNA 4O8UA 1QE1B 3SCIE 3VAFA 2E9TA 3CD6S 1KAXA 3GIIA 2KXFA 1VHIA 5A8WB 3C16B 3O5TB 4EEYA 4CO0A 2CZ4A 4ILRA 3DDKA 3M8QB 1U8SA 2KU7A 1J53A 2ZH5A 3T6BA 1R0CB 4JNEA 3GJQB 1T8EA 3JSBA 3R8EA 4R0JA 2VA2A 3ZEUA 2DT9A 3HPGA 3BF1A 4LF7F 4CQ1A 3GR0A 2OZMA 3R7BB 5KFRA 1TL1A 3G6EN 4B9MA 3PX0A 5BPLA 1R8BA 3EE8A 3BF4A 2OSRA 1SCJB 5D6GA 2ZJRL 3LDQA 5FLXO 5EXWA 4HT7A 4DQPA 1GNKA 3H46O 5M1FA 5C25A 4XDDA 2E6LA 3VCDA 2YHBA 4DFMA 1J5EF 4IQXA 1HW9A 4TU9A 4Y1CA 4Q2MA 3TAQA 4Z94A 4JI4J 3ZETA 2KG0A 2GUIA 3KK1B 1FWLA 7FDRA 1VJWA 2QK9A 1QQNA 3P8BB 3PFEA 2KHOA 1P1LA 4RO0A 3JS6A 5KT7A 3U9DA 2WTFA 5JXSA 4O55A 1XMQK 1WHYA 5B0GA 4FJMA 1PSDA 4KTZA 5DS7A 2ZZNA 2NRHA 4CI6A 2IYIA 4RPFA 2XNQA 5G0RB 3KKSA 4W98A 3D67A 1F1BB 1NGDA 4GVEA 3GOIA 1NMDA 2B4JA 4AL6A 5E41A 1ZM3A 4BR7A 2GO8A 2QX0A 2ZEJA 4FPRA 4JBCA 4B17A 1JMTA 1SZ2A 5KG4A 4FF3A 3TA0A 2IPOB 1X4GA 8ATCB 3E9LA 3FE1A 4Y00A 3SAHA 5L39A 1S0MA 3GQCA 3IR6B 3LP3A 3MUMP 2QI2A 3F56A 3MN9A 1UOCA 1MN7A 3CVKA 5AXLA 4RNOA 2HHHJ 2P9PA 4QIWD 4ZCMA 2VG7A 2DGOA 5A6WA 4DV0J 1CXUA 4BRMA 2F4VF 4F26A 3O3HA 4DUYJ 4QIVA 3VZHA 2VFVA 3ZCMA 1TUYA 4R0EA 1PGZA 3I5CA 4R5PA 1SL2A 2WFBA 3ETMA 1Q7YT 3S01A 4EUVA 4ES2A 3B4MA 4KV8B 1NJXA 4X84A 4DSIA 3Q8UA 2VQFK 3CXCM 4OL8A 1ZOTA 3KLEB 4DZ6A 1RAOA 4X64K 4J9OA 4L72B 1FDNA 2IRYA 4CVNE 1KC8O 3QNNA 1BL3A 5BR8K 4MLEA 1FVSA 2Z2ZA 1N36F 4F2RA 3K5LA 2XM3A 3G4SS 2E1CA 1IWGA 1T94A 4FLXA 5GAGI 1TYQA 2PA3A 4GVBA 1LW0A 3ZX0A 1NBEB 3KHYA 2CPYA 2DPJA 3O3FA 3G6YA 1Y11A 1EXQA 5H9FJ 2R7TA 3G87A 2UXBJ 3BV8A 4AXIA 3SV3A 3FFIA 4GKJJ 3O8WA 1Z05A 1JLBB 4QBUA 3AO3A 4GY2B 5J1PA 3WNEA 4ZP6A 3O1BA 4YFUA 5CZVA 2UXDJ 1HLUA 5JMVA 3LANA 4CZCA 2I8EA 3J7ZO 1JLQB 3Q8RB 2P5OA 3ET6A 2AJFE 3ZT4A 1YG0A 2CQ0A 2WB4A 1IJFB 1RTHB 2DJWA 3TI0A 1HNWF 2P2CB 4WQ4A 4CLWA 4B3TK 2NLXA 2GTDA 1YAGA 3JXUA 3MECB 1S4EA 4H0TB 1M0SA 4DCJB 4KB1A 2EWHA 5L1JA 2K2PA 1GLCG 1AT1B 2OIHA 4H5NA 3DOLA 1DQ8A 4F0HA 1N5QA 4KKOA 2DHXA 2KHDA 3JAMU 3GFHA 3MN7A 4FW1A 2FDNA 3CJ7A 1RT5A 2LXUA 2XS7A 4OQJA 1Q86O 2JEFA 1K8KA 3J80Y 1UZHA 3DRRA 2ZF5O 3AD8C 2AHOB 2CZVC 3DGVA 1KCFA 4LFCF 4CHYA 5TKWA 3B4DA 4DV5K 1X31C 4KGXB 3CJ9A 1OPZA 3A3PB 3AVMA 3W9HA 3ILJA 3AQOA 1SUQA 3PRVA 3N6NA 3THWB 4LF8J 4X62J 1YBTA 3DAWA 1Q79A 4M3ZA 1HJRA 4HL9A 4RTFD 1YJ9S 2E2NA 4NA2A 4CNYA 3GIMA 1VQLS 4KHMA 3A2FA 4P6QA 2OCEA 3FBCA 1QD1A 5DG9A 3KWIA 2ZKTA 2Q97A 5C42B 2C2NA 2EVZA 4WFBL 4I6YA 1NJZA 3HD2A 2B9YA 3KYLA 4OX8A 4ZVGA 2P51A 5KFBA 2PIIA 4HYKA 3KHRA 4BRFA 4PXBA 2OH2A 4RWTA 3M2RA 3AHPA 3QFHA 4CJRA 3N4WA 1OH7A 5D3GB 1T05B 2I7PA 4JV5K 4F0MA 1RUSA 2Y1LB 2V52B 3DRSA 3GYXB 2A3JA 4W4MA 4O4GA 1ROFA 1HPMA 2YXLA 4DR5J 2FC8A 4C3MA 2PSZA 4FJ9A 1PAEX 2XMTA 5ETLA 1CC7A 4ILGB 3K8WA 4RUBA 3CJ2A 5KFHA 4YOVA 2B6AB 3PX6A 1VAZA 2WW4A 4PWWA 2QV6A 2CXEA 2M7SA 2ASOA 1L3TA 2BJ9A 1REGX 2A5XA 1F2HA 3OL9A 3DYAB 4YP3A 4IOCL 4DSLA 2NQPA 4BY9C 2MZTA 1UWBA 3DCAA 4AXJA 4M5JA 4EBEA 1XMOK 5KFYA 4PWUA 3WNHA 2ASDA 4CH1A 1WSVA 3HM8A 2HFUA 4C6AA 2QA4G 1M5SA 4KJIA 2QE5A 3HSGA 2RQKA 4J2DA 1YWXA 4MIBA 5IV3A 5AZIB 1UWAA 1IR2A 1TZ0A 1WOQA 2GX8A 1Z6RA 3G71S 4IQMA 2ZDPA 4QWEA 2QWPA 1NSPA 2KT2A 2OTLS 3H1VX 3CF5L 3OL7A 4FLWA 4DR2K 2YX4A 1RBUA 4Y2AA 4DCOB 5KFTA 1M5VC 1V4SA 4V19J 1SH0A 1S9GB 3U6FA 3ZSRA 2LVWA 4MDBA 1P6TA 5FDLB 3CD5A 1MLAA 2WVFA 5AE3A 2DHSA 2ATLA 3ZXWA 3D68A 3GWCA 3ICLA 4DS5A 1ZM4A 2DH8A 2RS2A 3JYTB 3RJMB 2EI5A 2P9NB 1N48A 2NS1B 2XHWA 4HH0A 3QWUA 4HDGA 2R7YA 3FK4A 2O8EB 4JYAJ 5F1XA 5LMUK 3LDNA 3D2EB 3MEEB 2U2FA 4E2FB 2QWLA 5TKYA 4AHRA 3CPWM 2ZH7A 3MEGB 1RYRA 4J8FA 3JTOA 3H40A 1OPIA 1O0PA 1RAAB 1H98A 1S22A 2M9KA 1WB9A 1NHKL 3GFZA 5I42B 4F3MA 2MB0B 2XSJB 2W4CA 1QAXA 3T1YJ 1ZAWA 2CJQA 2YKNA 4OGCA 3UKRB 4JI5K 4KH1B 1YSJA 5M2UA 3O9RA 2O3DA 4H4OA 1LEOA 2CJXB 3AOBA 3EZUA 1YTUA 1I1GA 4U67L 3DHWC 3H42A 3RSEB 4CF1A 1GK8A 1Q7LB 1EX4A 2CYYA 1RBSA 4IOAL 1HNZK 2BANB 3DXKA 2XMVA 2V9KA 4G9ZA 1I39A 2Q43A 3KWMA 3C19A 2WUSA 1XMBA 2AV5A 1K47A 4NOHA 2J6SA 2F8HA 3E01B 2BVZA 5B08A 4FWPA 3GFYA 4DU3A 4DUZK 4PYDA 3O6WA 4RWXA 3A4TA 4CO1A 2QEXN 2QZ8A 4M63C 3EVWA 4R8UA 3HRGA 3EZWA 3MGJA 3KD1E 1Z2LA 1CJKA 2YVSA 3H4BA 4F4YA 1G1XA 3FNNA 4USWA 1S1TB 2J6TA 3BR8A 1BMQB 1IO2A 3MWTA 5AQYA 5KT4A 1JLAB 4GVLA 2RDIA 4GRSA 2KTQA 4B1YB 1U1MA 1RAGB 3NL0A 1YXQA 1U0HB 2R7WA 4GC6A 1RKJA 3SLCA 4KH6A 4B1XB 3OTOK 4CZHA 3KTQA 1TK0A 4ECYA 1R8CA 1OMSA 3BN4A 3NGDA 3ZTQA 2Y9HA 2C42A 5KFNA 4X4UA 1Q82O 3H3OB 4ZK7M 3IR5B 4Q5VA 4UOFA 3PIPL 3VQ8A 1HA1A 1JJ2R 1RWMB 3L2UA 3CCRS 2CJ9A 2XULA 4AH9A 1Q81O 3V1QA 2PN6A 2HSEB 4JKEA 2MSSA 2IY5B 3EVMA 3CDAA 1RWPB 4JI6K 3W2VA 1BQMB 1HKGA 4P72A 4J9QA 3BO4A 4J37A 3MMCA 3R1XA 3UI3A 5FPDA 4FJLA 4NCGA 2RJZA 4JP8A 4OJHA 1WOSA 1YJ7A 4CEBA 1WF0A 4J9NA 2YX7A 4PPZA 1NOZA 4X4QA 4WQ5C 3EMTA 5IZHA 4LF6K 1FD8A 4LFBK 1RCHA 2VZ9A 2W7PA 4B3MJ 1GTHA 1X0PA 3H98A 4CF8A 1Q0NA 3A8EA 4IXCA 3MK6A 5KAKA 4NLWA 3T5LA 2W2QP 4F4KA 3PLAA 5AJ3J 3C65A 4DX5A 4H0PA 4CECA 4AHTA 1SQEA 3J7AP 1VQKN 2HOEA 4QR1A 2MJNA 5GADI 5HMYA 1BD6A 5T7LB 4K4TA 4ID8A 4DCPB 1J6ZA 1CC8A 2F40A 2L41A 3VGMA 4FF4A 4ED3A 4FYVB 3DLKB 4DX8H 3VQQA 5DQGA 1V9OA 1RTIB 3SBMA 4QR2A 2E1AA 1E6YB 3OHBA 5A8RB 2DO0A 3TVKA 2E1ZA 3UDVA 4DJBA 1SKWA 2J0SD 1S57A 3I6PA 4I6MB 4FWQA 5C2FA 2PD1A 1QDUB 3K0SA 2HFSA 3WIUA 3E66A 3KLHB 5I3QA 2KYXA 5EX5A 3VHQA 2VKRA 1QSYA 4BE1A 3RB3A 4WFAQ 1FERA 5KFJA 3MMAA 5J1EB 2WONA 4DV0F 3CIMA 4ETZA 1NZ8A 4QWAA 5AQNA 4OMFG 4DUYF 3BZQA 1TV6A 4OX9K 2V2VA 4OJ3A 1YI2S 3IBWA 4UTGA 5C24B 3HK2A 4RZRA 4LR8A 3T9NA 3TP2A 2XMKA 2QWOA 4OZJA 1WUAA 1UKUA 4LBHA 2V5HG 3I8BA 3OYIA 5IT9U 2IJFA 1RT2B 2VYPA 2UXCF 1UEVA 3CHWA 4YOUA 4O23A 3GPAA 4XO0A 4I6WA 3G82A 1B7FA 2XWXA 3ENVA 2H3GX 3D1OA 3R27A 1EQMA 1S1VB 4XH5A 4FK2A 2XYPB 2RDDA 3HM9A 1FRMA 3ULHA 4CH7A 2H5EA 2ZKUA 1U02A 3R5CA 3VPZA 1JLGB 4KBIA 2IAJA 2Q3PA 3Q8QB 3ZEUB 2KYZA 1N0VC 2GC8A 1CQNA 3QRPA 3D3BJ 1TL1B 5E3RA 2A1BA 5AQKA 4XAKA 5L9XA 3CCLN 2CJYB 4EU0A 1LWEA 4CFBA 3UD5A 3KJQB 2BJDA 4FBUA 1XNRK 4Z2XA 2QL9B 5C25B 1ZAVA 3HSJA 2GW8A 3LP1B 4ZVQB 2IOCA 3FFKB 3A8YA 4IR9A 1JCEA 2UXDF 5DLFA 4CYUA 4HUEA 1IKYB 3VEYA 3BJYA 1VCTA 3J7YP 2MJUA 4CJLA 3DRYA 2JFDA 4PL7A 5A6PA 2HNDB 2LQJA 2FJAB 1Q16B 3LP2A 2RRBA 3HP9A 5EWGA 1TGOA 1N34K 5ETTA 3QAEA 2RN2A 3NG8A 2BV3A 2CQPA 4FO0A 1S99A 2F5GA 3TR8A 4CM2A 4U7BA 3NMAA 2F3JA 2CPZA 2GMJA 3BQ0A 2B3TB 1J27A 2P6SA 4CLSA 3PKYA 1JCFA 2XY8A 3AVKA 2OEMA 4CJSA 1YJTA 3A5LC 1KONA 3KG1A 4DR3F 2AD9A 1XERA 5FPNA 4RLEA 3GR1A 3DRPA 2MZRA 2D3O1 4OHWA 3B6OA 1Y64A 3FZFA 3AGKA 4IFYA 2DFHA 3SBTA 2I38A 2E4LA 3OXLA 2M70A 3OLBA 3O8MA 4QPXA 2GAGC 3MXHP 2V69A 3ZTPA 2P9PB 2BTFA 4O5FA 4HEA9 2GGPB 2V8PA 2VG7B 2ZFHA 2RH3A 5HRSA 1EJ7L 2NXCA 2DB1A 3IWLA 5A76A 2FVPA 3Q8SB 4IH6A 1RT7A 4NLUA 2XMAA 2BE7D 4CLLA 1WKLA 3MCNA 3D1QA 4LF8F 4X62F 1RISA 5I4MA 4BLGA 3FMWA 4NMXA 3BQ1A 4HVZA 4DV4F 4CLZA 1DBDA 4DV6J 4OYAA 2AF6A 5GINA 2GMLA 2B4OA 2HHPA 4W5TA 3WXKA 3N6LA 4PEOA 1X4CA 1YJVA 2JHEA 2OTJS 2UUCJ 4YY3K 1ELOA 4M95A 4QS8A 5ADXH 2D3ZA 4FWKA 4Z4IA 3O5BA 5D77A 2X78A 4AHUA 2R8JA 3A5MC 1Q9XA 2DGWA 3W7BA 5H1SQ 3GILA 2V67A 4GVBB 4F4XA 3EY1A 3C7NA 3IP0A 6FD1A 4YB1P 1VC5A 1ZBUA 3W5XA 4DB3A 1BO5O 3TTDA 2OFGX 1VIXA 2HW3A 3FFIB 2XEXA 1V5IB 2D0OA 3MWPA 5AT1B 5HLFA 2N4CA 4OZ3A 4WKRA 2V50A 1S6PA 4I69A 3M9NB 2BJ7A 1CPZA 3K57A 4Y0FA 1EQ0A 4Z4CA 1Q5VA 2R2SA 4WF9Q 2XQCA 4TU8A 1FJGK 1C0TA 3ZX2A 3ET6B 4M5IA 4K4VA 3VEOA 2W40A 2CRLA 1N56A 1VQ4N 2HMIB 4X4VA 3KDOA 1N6QA 1X3NA 4MO4A 3M6XA 2G2ZA 2FSKA 5EN1A 1SKRA 4YB6A 3OVAA 2A1SA 3P5JA 2NXJA 4NA1A 3IGVA 4DXLA 3LPTA 4HKQA 4U6PA 2X6SA 2V4QA 4CGDA 3NVKA 4YHHF 3DOLB 4Z4EA 1CJUA 3VEXA 2RU3A 4F8RA 4KKOB 2WVEA 1RT6A 2E5LK 4RR5A 3M9MB 3L4IA 4OHVA 4DV3F 2CQ3A 1TL4A 2B7CB 4RW9B 1WNEA 2RAQA 1K8KB 1XI1A 4M3WA 2GFFA 4LF9F 1BC6A 3FCVA 2Q6CA 3HZGA 4JB8B 3DRRB 1TQLA 2IA6A 4ECTA 1YLXA 2DR8A 2IVOA 4LMZA 3A3OB 3O80A 1MMDA 3HSCA 4WCEQ 2IC3A 1EKRA 2IS3A 3I9ZA 4DL4A 1LKZA 3THXA 4NXNK 2AX1A 2BKNA 1B7YB 3RRGA 4EK2A 5RUBA 2M2BA 3MAAA 1H2VZ 5GAHI 4DR4J 3FQLA 3BUZB 4LH5A 4C1NI 1CVJA 4M41A 2XO6A 4E8UA 3QNWB 1UJ4A 1KRPA 5BREA 3TX0A 4DR6J 2UUBJ 1VSFA 2O67A 1IM4A 3K17A 4NI2B 1JLCB 3L2RA 2PZSA 5ADXA 1U6FA 1BLUA 4GNIA 3GIRA 1FFGB 1S79A 1X4DA 3T1YF 2BABA 1KR4A 4URSA 1S72N 4JI3J 4OVLA 3M2RB 3MM5A 1P90A 3HP6A 5J2MA 5AQVA 1NJIO 3WBZA 1OQ6A 4FJGA 1MROB 4USVA 2GBZA 4LF5K 3PW7A 3DRSB 1KFDA 1OIAA 1T0TV 4O4GB 4X4SA 2ACMA 1XHZA 5HL7L 1GOBA 2XBPA 2I1RA 3DLBA 1PO6A 2FHMA 2E20A 3J7AN 1JX4A 4F67A 2QWQA 3GE1A 1VI7A 4ZN1A 1NK0A 4Y2IA 1DJ0A 2VUGA 3MF5A 4CZIA 5LJ5Y 5LY3A 3DLHA 1NDCA 3HOTA 2VDHA 2HS4A 3NCIA 4ELTA 4CERA 3RBXA 2SXLA 4JLHA 1QZ5A 2HK2A 5SWMA 3TJAA 3BKUA 1UWBB 1ZA1B 1YBUA 4K4UA 2J76E 2ITGA 2R2RA 1NDKA 3TO8A 2PEHA 5KPZA 2AEFA 2P9CA 4B3OA 3OW2R 3P31A 4ZPVR 3JQJA 2FJDB 2JWNA 2EC2A 1MSWD 4M63A 1O1WA 3RR7A 3UKUB 4YR2A 1XNQK 3G8SA 1SL0A 4KRWA 4F50A 3M30A 2QA4N 3CM6A 3OR2A 3M8PA 2QWNA 2NZCA 4KRFA 4B1UB 4PL8A 3V81A 3N5FA 5B0BA 3O3GA 2ZH1A 2KKZA 4LR9A 1GOAA 2ROEA 4CJKA 4CH0S 4RCHA 2HVIA 1BWVA 4I2PA 4MQ3A 4O3OA 4WP8A 3NDKA 1IBKK 3GLJA 2GMHA 1QQOA 4JKHA 1ZBLA 1L3KA 2IM0A 1MN9A 3KLGB 2LDIA 3MMBA 3VGVA 5DG8A 2YKQA 1D0EA 1XN9A 4CE9A 2DNRA 3CCSS 1NXIA 2R8HA 3CCQN 1TFYA 3MCAB 2IVMA 4NE9C 1WSHA 3BREA 2VGNA 3L6QA 4DEZA 5HBMB 1LV5A 1QVFM 3KD5E 2OI2A 2FBTA 4ZPTR 3VAMA 3EVOA 3M1FA 3PY8A 3LAKA 1WKJA 4OYMA 2HWIA 4K4XA 2PMWA 3MCMA 3CCES 3WIVA 3UIQA 2V8VA 2YHWA 2O8CA 4WQ5A 1AXQA 1A7GE 2YKNB 4PQUB 5IC4B 2Y0BB 2HQCA 3T1AA 3AVHA 2EBEA 1H6KX 3QGGA 1F0XA 1MWYA 2IYGA 1VRQC 2G9OA 3QMLA 1HX1A 1IQTA 2BJ3A 1Z25A 3EEQA 2FXUA 2DNMA 2IM2A 3N01A 2BQUA 4KHUA 1KD1T 1RDWX 3NH1A 1FX4A 3R5JB 5BRFA 4ED5A 1FRLA 3DXKB 2ZOGA 2XC9A 2FF6A 3E1YA 3MUVP 3PYFA 1DGKN 1O5JA 3EDRB 2CQCA 4OPKA 2DGUA 3C15B 4PG4A 2RUSA 2KVIA 3AB2B 4FCYA 3SSSA 4W5QA 3D0IE 2HHSA 2V8DA 3LL3A 1JKHA 4ISEA 3LZJA 2H51B 4GO7X 4M5DA 4IKFA 1KOOA 1AUDA 2HBZB 5HJXA 1Y4ZB 4R8UB 2DITA 4NCAA 3ZT3A 4LH4A 2I5JB 3V9UA 1YRTA 5CHCB 4OFZA 2ETJA 3GCXP 3TX8A 4K0KJ 3LTOA 3MX2A 4A62A 1U0SA 4CJWA 2YKMB 1N32K 1AW0A 4MH8A 4C8LA 4NLCA 3A13A 4FWNA 3DOMA 2R8GA 1WOOA 3CCUN 4OZ5A 1UFLA 3PIOQ 3TZWA 4DV5F 3CJBA 5EWEA 2KW4A 2J0QD 3I87A 1VQPN 3WXMB 1T9UA 4AL7A 1NB7A 2MQ8A 2MQOA 1YTYA 2D9PA 4DV7F 3KUHA 4BC5A 2HHUA 3D6RA 4UOCA 3UDLA 2IMOA 3K89A 5B0EA 2VB6A 1TUUA 3MUTP 3CC4N 1D3WA 3BZKA 2A6OA 4O4RA 4NASA 2E7XA 2E1PA 3H5SA 4GKKJ 4DR7J 3PM9A 2UVUA 3QATA 1S49A 4G6VB 2NXUA 1Q7YO 4HUGA 4B9LA 3H1QA 1XC9A 3QBCA 1NJYA 2AGOA 3MMCB 3M05A 2B5JB 5SUHA 2VBYA 2CVIA 4NCGB 1K73T 1ZC6A 1WI6A 1RTJA 3BR9A 1YITS 2E29A 4A57A 1NJWA 4QU7A 4Y2CA 2VC0A 4CEOA 1UMJA 4TNOA 2H3EB 1NG9A 4V19S 4ZVUB 2G0IA 4MO5A 2HHWA 2K1RB 4A8SA 3RB4A 3PSIA 2VG6B 2BXJA 1U48A 2UVRA 4P52A 4CJQA 5K5MA 5EVZA 5E3PA 1Q8IA 3FZLA 1NK7A 2AWZA 2YI1A 4P7VA 1VQSA 5THWA 3JB9k 3OVSA 1SJ1A 4BRNA 3SUQA 2BJ1A 2PI4A 1VQMS 3HFZB 4HLBA 5JLFA 4LF7K 1YVNA 4USUA 1S9EB 1QS4A 1G15A 3H5XA 1SAZA 1MG7A 2OKQA 3CCMS 1VRUB 2F9JA 2MQMA 2QJ3A 4LQ3A 3CPEA 2YWFA 2R42A 1NGFA 2YNIA 1CJTA 2C3MA 4H5TA 2MKSA 3OTEA 3GYNA 3HSDA 1J5EK 2VQEK 3QEWA 3PVXA 3TA1A 3MXMA 5F8NA 3M6VA 3MPWA 4ED6A 3I33A 4JI2J 4P74A 1UFKA 2KVQE 1VK0A 1UVLA 3BN7A 1TV6B 2C2ZB 4X66F 7AT1B 4RNNA 3R97A 2GJIA 1U2RA 4OLPA 2GV1A 4L76A 3LDOA 3PG9A 1XMQJ 1VS3A 2P9KB 1RACB 3VV2B 4DV6F 4WP3A 1NB2A 3S9HA 3LGMA 3C46A 1DEJA 3SUPA 5DJBA 3V6DB 1Z1ZA 1M5PC 2YPYA 2C3YA 2PFFB 4JN4A 5EWFA 5FLXY 3EO3A 5CH7B 3VQTA 4NYFA 4H0OA 5IOLA 1PAUB 1GLAG 2DCLA 1WC6A 4QIGA 4IFVA 1Q4RA 2CJBA 2JLGA 3CCVN 3A0IX 3LALA 2HS3A 5JS2A 2IAJB 4JI8K 3BEXA 1RQ0A 1SB6A 2XTJP 3UB5A 4K43A 2I2YA 3UR3C 3NF7A 2ITMA 5DZ6A 2F4VK 3FC9A 3L3UA 3KFWX 2FSNA 3LO3A 5J2NB 5AXKA 1SJ4P 1DTTA 3DLEB 1T7PA 3QGPA 4NRUA 1RYSA 5CYQA 4CYUB 2X6NA 4N47A 3FRYA 3R5BA 4JKAA 1C6VA 1DRZA 5D4OA 1MWQA 3AA8A 4J9KA 3HI9A 5B0AA 2KXNB 6AT1B 1WBDA 2X1BA 1N36K 1OYEA 3ZX3A 4DUZF 3AJ2A 4I64A 2L3MA 4TKTA 5BR8J 2IM3A 2JJ4D 1KKHA 3NF8A 2NRZA 1IH7A 1BQNA 1K6YA 1V6HA 3VTHA 2ERRA 1PILA 4KHWA 2ZNZA 1ESVA 2N7YA 1KEKA 1TL3B 2DGVA 2VFUA 3CWJA 1B99A 2F4FA 4NCBA 2O5DA 4CLTA 3DRPB 2HLUA 4JEPA 4N5SA 2GS8A 3CDWA 1BWFO 2QMXA 3OYKA 4IFYB 3TTCA 1R89A 3MM6B 1RWUA 3AD9C 4OYXA 3Q83A 2ZVIA 4ZP9A 1FDBA 2OZSA 5AQWA 1X5SA 3P4UB 4ZPDA 3QO9A 1X4AA 3KJVB 8RUCA 3WC0A 1K9MT 4J9UE 3OL6A 3J8AA 3HVWA 4I7FB 1WC5A 4BRKA 2DNZA 3BS9A 2XYHB 2CPDA 3C3LA 2FBVA 3S3NA 3CD6N 3UVJA 1TMMA 1RWVB 4DR4F 2P9EA 3DLGA 5FPMA 3A5NC 5CR4A 4FXWA 5ETPA 3NY0A 5KFGA 2VCPA 3AY0A 3G6XA 1ZTTA 3OTCA 2MZJA 1HUXA 4OI6A 4LC9B 3IAYA 3J7A1 4QAGA 3E9PA 2MZ1A 3AQPA 2IVFB 4DR6F 4OZ1A 1KQSM 1K8AT 3ADAC 3NFAA 2HGMA 2W24A 1UJ6A 4OHZA 3BGRA 1JQGA 1OYDA 4C23A 3ZSXA 3C6UB 1OH6A 3D6HB 2KXHA 2JGUA 3BYRA 4FXDA 1D5AA 3VENA 1HL6A 5A2QO 4WFNL 4K4WA 3CERA 2WRMA 3H25A 4LFCK 5HO4A 4Y1DA 1JXEA 3Q8VA 5GAEI 3D2FA 2HHVA 1DURA 2BJ8A 3J80U 2GX9A 2E9RX 2DEJA 2RKIB 2ZWPA 5CQGA 4JKGA 1FXDA 5HLFB 3TU5A 5KFLA 3OYNA 1RWWB 4AYBD 2GVDA 3OVBA 4ED1A 3VQDA 3RMAA 1SQGA 3M6UA 1Q8BA 3EE3A 1Z2ZA 1C0TB 4UQTA 1RLCL 2Z2LA 1N52B 4QS7A 3IDHA 5A0YA 2DGXA 2UP1A 2X3GA 3PDNA 3M8YA 4DDFA 1N6QB 3KIOA 1WSIA 4WKYA 1BHLA 4KPYA 1WBBA 4ZITA 3OSPA 3POTA 2DCUB 4H5VA 4EWTA 1MWKA 4I0WA 3VQ6A 5HMWA 1WTFA 2AEJA 1UA0A 1CJUB 4FZZA 2BE2A 2O8FA 4PAAA 1G2EA 4IH5A 1RT6B 4P73A 4CGHA 3KG4A 3NGTA 2Z2YB 5HK4A 4JD2B 3OYGA 2RPIA 4OX9F 2V4JA 3KXDA 2P5VA 2RHQB 2WBMA 2BM1A 5KFIA 2HBQB 4WXOA 4MAKA 5BXIA 2HSTA 1Y00A 4FWSA 3VN5A 2GQCA 2F9WA 4PYAA 1HNXJ 4RUAA 2WSCC 3THXB 3MN6A 4CESA 3OPKA 3SAFA 3I96A 3MAAB 2DIVA 4OYBA 1R6VA 1VBZA 3HCXA 3G4SN 2G8KA 3QQCD 2GJFA 1WOPA 2GJ2A 4ZDNA 3R7NB 3ZLJA 2XMMA 2QL5B 1X9MA 1ASUA 3J81O 5DDQC 4AUKA 2FLLA 3MX5A 4CDIA 5C0YA 3D7EO 3KKFA 4NLBA 3CT9A 1R0AB 3JSRA 1SV5A 4P10A 3VAJA 4ILMA 1YF5L 2GVZA 2DXDA 1QJHA 5F41A 3TEHB 1RA7A 2DR5A 1XNRF 1R27B 3U1LA 3MM5B 4HH1A 1HW8A 2ZQBA 3AA4A 4RU2A 2EFOA 1FWPA 3AY9A 1FT8A 2MDAA 4RG8A 1T9YA 2ACYA 5CZ2A 2XGPA 4IO9Q 5C10A 4AT1B 4NLTA 2KZZA 2Z2MA 3MR5A 1AZSB