2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
2BE2A 4PWDA 3SQ1A 3SPYA 3CM5A 3IS9B 3OLBA 3CG7A 4JRPA 4LSLB 4Y34A 2VG6A 4JV0A 2ASDA 3AVNA 2DFEA 3HHKA 4DQRA 2YKNB 1QE1B 1U4BA 2KFZA 4AHSA 3OYCA 2ZD1A 3RTVA 1ZBLA 4JV2A 1X9WA 3MR3A 1RYSA 4NLXA 1JLEA 4KI4A 2WONA 2HAIA 1NK4A 4DS4A 1L3VA 3HVWA 1S6PA 3JYTA 4G1QB 4PUOB 4Y2AA 1BIZA 2C28A 1D0EA 4KHMA 3QEPA 4ED1A 4CFCA 3QLHB 4I7FA 4FLXA 3HPHA 2CJQA 2HHXA 1KRPA 1NJWA 5FDLA 1JLGA 1Z4UA 2FJVA 2ZKUA 3C6UB 4DQSA 3OL7A 3MXJA 2XI3A 3DRSB 3UIQA 1VRUA 3VQDA 3V6DB 4RUAA 2OZSA 2C2DA 2F8SA 4B9UA 4LH4A 5I3UA 1JLAA 4CJ3A 5C24A 2FVRA 4ELUA 4N76A 1UA0A 3MTKA 4DL2A 3QIDA 4OKEA 3VQ6A 1X9SA 3U6FA 4QPXA 3RR8A 4BDPA 1TVRA 2XGPA 5HLFB 2OPSA 3MEEB 4IR9A 3DRPB 4NLRA 3TAPA 4AHUA 3S3NA 2RKIB 1SL0A 3V81A 1IM4A 5F8MA 1KVCA 4O44B 4CF2A 3PJWA 2OH2A 4HVJA 1BQNA 4QWDA 1X1PA 2FVSA 1XHXA 3TAMB 2D3ZA 3P1GA 3Q8SB 5J2QA 4NLDA 3VQPA 4ICLA 5EWFA 4M3UA 1ASVA 3PX4A 4NRTA 3BJYA 3WNEA 1RNHA 5DG8A 1NHVA 4KV8A 4ID5A 1VSFA 3AO3A 5J1EB 4FLTA 4R8UA 3RRHA 1TKXA 1GOBA 3TAFA 3K58A 2RF2A 4DL4A 3G10A 4Z4FA 1RTIB 2XRIA 3KJVA 1RAJA 4HUEA 5F8LA 1MMLA 4TXSA 5KFOA 1NOYA 3LZJA 4BWJA 2B4JA 3AA4A 1LW0B 2YHBA 2F96A 4MFBB 3EPIA 1BQMA 3G6XA 3LAMA 3N6NA 3HM9A 3ZSZA 4Y2CA 3ZSVA 5KFAA 3SUPA 2JEIA 4DQQA 1TKTB 1B9DA 5J2MA 1KFSA 4CF9A 3PX0A 2ILZA 3CJ2A 3C6TA 1HMVA 1UOCA 1RBUA 1RT5B 1XHZA 4FJNA 1S97A 2ETJA 1S9EA 1NJYA 1VSEA 3KK3A 3I8DA 3C94A 3PJXA 4MK7A 1WAJA 3AVHA 1NNDA 2W42A 1OS5A 2HW3A 2O4IA 3VQ9A 4DTXA 4CJEA 3T3FA 3V1QA 1N4LA 3MECA 3TQ1A 1GOAA 1REVA 1N6QA 3HT3A 4LSNB 4K50A 4DU4A 4DU3A 1BHLA 2A1RA 3TAQA 1SV5A 1HPZA 1RA6A 5J2PA 4TQSA 1RBRA 5KRTA 1NJZA 3QZ7A 1RT3A 1RT4B 5KG3A 3BSNA 3MEGB 1JX4A 4KFBB 4CJLA 4DTRA 3EYZA 3T5KA 4NCBA 2WRMA 3U3GA 2OA8A 3OJSA 1RT7A 4W5TA 3ASMA 3NDKA 4K4SA 2G8IA 4RW6B 1ZBUA 3WNFA 3I0SB 3QIPB 3SNNA 3H5UA 4K4VA 1C0MA 2V9WA 3QGHA 3P5JA 1IKWB 3NL0A 3PR5B 1LWFB 3IG1B 5C42B 4W5OA 1SL1A 4HKQA 3IRXA 3QIOA 4K8ZA 4DU1A 4DFJA 1K1QA 4DTSA 5KFXA 3C95A 5HP1A 3M8QB 1ZBHA 5KGXA 1IKYB 4FJIA 1JKHA 4EP4A 3AVAA 3RB3A 3AVKA 2W9BB 5C25A 1HQEB 2AQ4A 3TI0A 4IG0B 3IS9A 3RB4A 4CGHA 4MKBA 4FCYA 4OJRA 4DEZA 1D9DA 5KT7A 1JXEA 4JS5A 2YKNA 2I5JA 1QE1A 1T05B 5SWMA 2VG7B 2ASLA 2YKMB 1KVAA 1TQLA 3ZSRA 3L2RA 3ICLA 1FKOB 3NGYA 3RMAA 2KW4A 1ZYQA 4J9LA 4XPCA 3DOLB 4CGJA 3OL6A 2ZE2B 4G1QA 4PUOA 4CCHA 4DL6A 3HVRA 3DMJA 3FRZA 3QYYA 3BQ0A 4URGA 1ITGA 3NGIA 2IC3B 4ECZA 3OYFA 4F8RA 4FJXA 1ZBFA 3VN5A 3KNAA 1EKEA 4K4UA 5KG4A 4GC6A 3QETA 3C6UA 4CIGA 4FLUA 2ILYA 3DRSA 4DS5A 4M3WA 3M8RA 4NYNA 2O4GA 3QEXA 1C6VA 5KFUA 4FXDA 5KT2A 3OL8A 5L1KA 4IFVB 5L1JA 3CDUA 4FZXC 4ECTA 2XY5A 1NKEA 3OYEA 4Q0BA 4O4RA 5HLFA 2V4QA 3AVCA 2RKIA 3THVA 5EWGA 1TAQA 4EP5A 3LP2B 1QTMA 3L3UA 4K4ZA 3K5OA 4O44A 1BL3A 1T94A 3GIJA 3TAMA 1VK0A 3AA3A 2EX3A 4WZMA 1RDRA 4DG1B 3AA5X 1XC9A 4RNNA 3DLGB 3U3YA 1O1WA 4ZPCA 1LWCA 1JLQB 1VSMA 4GVMA 5DLFA 4FK4A 2G8FA 1TKZB 4AH9A 3OYDA 3SV4A 3CIZA 4CIFA 1G15A 2YNGB 1CZ9A 1HYVA 4PQUA 1HNIB 3F73A 5JXSA 3LALA 4KHRA 4QW8A 2AX0A 1NK5A 2J6SA 4EO8A 1WNSA 4ZPDA 2R8KA 3SUOA 4EO6A 5KTQA 2R8JA 2B6AB 2E9ZA 4J9QA 2QKBA 2BDPA 1CLQA 5KFPA 2OPPB 1TK8A 3N6LA 4QWCA 4C8MA 3LPTA 2W7PA 5KFTA 3VQQA 4KE5A 3DLKB 1S1TB 3MFHA 4W5NA 3PX6A 1WN7A 4R5PA 1JXBA 3PR4A 1WAFA 3AVIA 4DTUA 4K8XA 5KT3A 4JLHA 3SUNA 4B9SA 3AVMA 4FK0A 1WLJA 2F8EX 3ZCMA 4JRQA 2JC1A 1LW2B 4CESA 2HMIA 1S6QB 4FJ9A 1Q9XA 4RW9B 2HHQA 2D0BA 3PO5A 4B9VA 1RDDA 4LSNA 4IH6A 4FLWA 3NF8A 4Q44A 3GIIA 4F4WA 5DQGA 3ULDA 4ZP7A 5I42B 1RT4A 1D5AA 4DL7A 3NBPB 2UVWA 1EXQA 1GX5A 3KD5E 3T5JA 3MEGA 4YQWA 2BQRA 3RMDA 3KLGB 1TK5A 3SUQA 1HQUB 4NRUA 3QINA 4MK8A 2HNDB 3B6PA 2Z1GA 3I0SA 1RTDB 3QIPA 2KQ2A 3L3VA 5FRNA 1Q8IA 4ED8A 3T1AA 1KHWA 3G6YA 1IKWA 1LWFA 1TL3B 3O3HA 5J2NB 1S1WB 3DI6B 3IG1A 5DQIA 5C42A 3AVLA 4FS2A 1CXQA 1ASUA 4ID1A 4MK9A 3KHGA 5EU7A 4O3OA 4K4WA 2FVPA 3M8QA 3QNOA 4CHZA 4KHSA 3WNGA 2P51A 1IKYA 2XY8A 3OYGA 2KTQA 2DFFA 4CJFA 4KHQA 4FVMA 4F2SA 4NCGB 5HBMB 2WOMB 5T7BA 4N41A 2C2EA 4FLVA 4F50A 3NF7A 3H5XA 4ZVEA 2GUIA 3LPUA 4H8KA 4H54A 1VRTB 3OYBA 2P1JA 1YVFA 4E7HA 2YKMA 1UWBB 1I39A 4FW1A 4DTNA 3OYIA 2HNZB 1FKOA 4NLQA 4BE0A 3QESA 3TARA 3DOLA 1T03B 2GIQA 2ZE2A 1EETB 4NLOA 4HHTA 1RT6A 3H59A 4O55A 3CFOA 3V6JA 1SUQB 4KO0B 1WSFA 3L2QA 2IC3A 4N56A 2PYJA 4RW8B 5HROB 4ECQA 3SV3A 4OGCA 1RT2B 4H4MB 2VWJA 3NMAA 2F8TA 3JSMB 1S9GB 3NE6A 3KLEB 4IRKA 2J6UA 1QAJA 4O4GB 1C1CA 3K5MA 2JEFA 4CE9A 4KRFA 4O0IA 4R0EA 2J6TA 1YT3A 1IKVA 4RZRA 1HNVA 4TY8A 1TK0A 2E6MA 4QW9A 3IN5A 4DTOA 3BSOA 1JL2A 1YTAA 1DTQA 4CJVA 3RR7A 1I3AA 3E01B 4IFVA 3KK2B 4ZTFA 3V9ZA 3HP6A 2NUBA 4OL8A 4ZP8A 3LP1B 4KHYA 2HWHA 4DFKA 2QK9A 2B43A 1RTJB 4NZ0A 2W9CB 4CEOA 5DLGA 4NYFA 5F9LA 4HTUA 4B8AB 2ALZA 3FQKA 5F8NA 4BWMA 4F4XA 3PW5A 5KG1A 4Y3CA 3EZ5A 4B9MA 3LP2A 4WXWA 2BGGA 4KREA 1KVBA 1EP4B 1S1VB 4IG3A 1KTQA 1N5YB 3RBEA 4CHQA 3G0ZA 2GC8A 5KFVA 5C5JA 4CJWA 2HVHA 4CGDA 4B9TA 1B9FA 2B5JA 1WSGA 1BCMA 4CEQA 1JLBB 1JLQA 3ZT3A 5JS1A 1TKZA 3VQEA 3L2UA 2YNGA 4FZYA 1RDCA 1NK9A 1HNIA 1BI4A 4TYBA 5EDWA 1NJXA 4E3SA 4FZZA 3GIKA 1KLMB 1XWLA 4EYHB 2VG5B 3ZSYA 3GV5B 4CJKA 2IDOA 2ATQA 3ALYA 1HJRA 4O3PA 2FBXA 2B6AA 4ZVHA 3CQ8A 2ITGA 1S9FA 4OLBA 3HSTB 3Q8RB 1LAVA 3K59A 2OPPA 5K14B 4X2BA 4KI6A 2WK4A 4Q5VA 3E51A 4ZHRB 1S1TA 2CKWA 2E4LA 2WB4A 4QWBA 3CFPA 1DLOB 3V4IB 3ITHA 2JGUA 3PV8A 2JEGA 2A1SA 3MXIA 4C8KA 2EHGA 2PYLA 5EWEA 3KTQA 1S4FA 4E19A 3QGIA 2FLNA 3QGGA 3RB0A 4RW7B 4ED3A 2IGIA 4RW9A 1XR5A 5KFDA 5JS2A 4EZ6A 4MH8A 1Y97A 2X6NA 2YNFB 1RTHA 1Q9YA 2D0CA 4DTJA 1D1UA 4NYZA 4WE1B 3KIOA 4PY5A 3DRRA 5I42A 4CGFA 1LV5A 3ZSQA 3GILA 2IM0A 1TV6B 3V6KA 3OYLA 4ECSA 3FDSA 3NGDA 4KB0A 2HVIA 2D41A 1SH0A 1U47A 3KLGA 4E0DA 1HQUA 1FKPA 3NKYA 3HK2A 3V9WA 4ECYA 4W5QA 1L5UA 5FRMA 3I5BA 3KOAA 3H5SA 4URQU 3KHHA 3PY8A 4RNHA 5FROA 3HO1A 4CEFA 3ZT4A 4IOBA 4CK3A 4AHRA 1TL3A 4ECXA 5J2NA 4FLYA 3CJ0A 2FBYA 4OVLA 3DI6A 2DPJA 1LWEB 3H98A 3O4QA 1C1BB 1VSHA 3OS1A 4Z4GA 4U7CA 4OPJA 3H5YA 4TYAA 5L1LA 4KAIA 2EC0A 4YNQA 3OYJA 2R7YA 3VA3A 5KFGA 1QAIA 4DWIA 4LSLA 4TSXA 3EY1A 2BE2B 3L2VA 1U49A 5HBMA 4E7LA 3CM6A 4CJRA 2WOMA 3KLIB 3LP3A 1NHUA 2RDIA 3L8BA 2UUTA 2I1RA 2YNIB 1VRTA 4WFXA 4EBCA 5HRRA 4F4ZA 1WSEA 3CFRA 1J54A 2HWIA 5DGAA 5CZ2A 1UWBA 4RNOA 3NH1A 2HNZA 3V9SA 4EBEA 1T03A 4WZQA 4FS1A 4LQ9A 4C8LA 1S6PB 3QLHA 1EETA 3QO9B 1W0HA 5KG2A 3SJJA 4J2BA 4DSEA 1SUQA 4KO0A 3P83D 2YHAA 1GOCA 4RW8A 5HROA 1RT2A 4H4MA 1QHTA 2YNHB 1JXLA 1SKSA 3HPOA 4HUFA 1YTUA 3JSMA 3V6DA 1JLGB 1S9GA 3LAKA 2KZMA 2D7SA 4QWEA 3KLEA 2XGQA 2JEJA 1KFDA 4CFBA 1HYSB 4O4GA 3HVTB 3HVAA 4B8CA 1U48A 4CIEA 4CJ5A 5KFSA 3D45A 4BACA 4FBTA 3PW0A 3S9HA 4Q8EA 5KGWA 4TY9A 3SQ2A 5JUMA 5I3UB 3K5NA 5C24B 4KTZA 4DTPA 3KK2A 3IGVA 3DLEB 4B3OB 1SH2A 3VA0A 2D0AA 3MEEA 1W25A 3TAEA 3DRPA 4Q8FA 4KPYA 4CEBA 1S49A 1RTJA 2R8HA 3O4NA 3QEWA 1TVRB 4KTQA 4H4OB 3CWJA 1NKBA 1VSLA 1QSSA 2D5RA 4F3TA 2BRKA 1SKWA 4RNMA 4J9PA 3OYHA 4HCCA 3V81B 1S1VA 3QZ8A 4YR0A 3BGRB 2Z1IA 4DFPA 2P5OA 1L3SA 3PZPA 2BQUA 4IRCA 3PUFA 4ICLB 1TP7A 5J1EA 1WSJA 4FJ5A 3AA2A 4KV8B 1VSIA 1RTIA 4IFYB 3LWMA 4NLGA 2XCAA 4B9LA 3BR9A 4LY7A 4RW4B 2Y1JA 4FYDA 3H4DA 4E89A 2RPIA 3KJVB 3NAEA 1LW0A 2WHOA 4FM2A 4DSLA 4MFBA 2VG5A 4C8NA 2KZZA 4OKJA 4OGEA 3FFIB 3LZIA 2PZSA 2HHVA 2G8VA 3KKSA 2E9RX 3CJ4A 3CJ5A 3UQSA 3A2FA 3FSIA 4FK2A 4B9NA 4IKAA 4DSKA 1SKRA 3VQBA 1EX4A 2IJNA 2O5DA 4CHOA 4WXOA 1TKTA 3CJ3A 4KKOB 4ECWA 3CYMA 3OHAA 2P5GA 3S3OA 3EPGA 4DSIA 4ZHRA 5EUHA 1RT5A 2YV0X 4MIBA 4AHTA 3AVJA 3SI6A 4DQIA 3RAQA 3DM2B 2R8IA 4KHWA 1HMVB 3MR5A 1IH7A 3HJFA 3RMBA 4CGGA 4IBNA 1S9EB 1JLFB 2RDJA 3ZT0A 3KK3B 3M8PB 4Q45A 4RW7A 5KI6A 3KLHB 3NF9A 3MAQA 4ZPBA 4LH5A 4HUGA 2WTFA 4FLZA 1REVB 3AVBA 2JLEA 1N6QB 4NLPA 1A5XA 3BQ2A 2YNFA 3O3GA 4DL3A 4J2AA 2IM1A 3LP0B 5J2PB 3TR8A 4ED0A 4I2QB 4KFBA 2GIRA 4ZVFA 4NLTA 4FJGA 1RBTA 1RBSA 1DTTB 1JLCB 4YP3A 4CERA 4ED6A 3RWUA 4RW6A 5HRSA 2XC9A 4NLSA 2XO7A 5KFHA 4J2EA 3SZ2A 3OS0A 5DMRA 3ZSOA 3MEDB 1ZBIA 3RRGA 1RT1B 5KG0A 1S5JA 4NLVA 3OVNA 1JIHA 2BRLA 4JS4A 4FJLA 3H40A 3ZSXA 1TKDA 3ISNC 1LWEA 3BSCA 4ELTA 3KMQA 5L1IA 4BE2A 1C0TB 2D3UA 3K2PA 3DDKA 4J2DA 1C1BA 1S0MA 5SZTA 2W9BA 4XIUA 1WNEA 3VQ8A 4E1NA 1HQEA 2UVVA 4IG0A 1WSIA 3DYAB 4WYWA 4HCBA 4Y1CA 5KT5A 2WCXA 1MU2B 5CYQB 1S1UB 3LANA 2FBTA 1T7PA 2QE5A 5C25B 5F8GA 3QERA 1IKXB 4RNFA 3KLIA 4J9MA 1X9MA 1T05A 2VG7A 3BDPA 2R2UA 4CJQA 2AGQA 3BQ1A 5KT4A 2HNYB 2YNIA 5HRPA 2DPIA 3T19A 1U45A 4LQ3A 3KHLA 3HP9A 2I5JB 2UVUA 2JC0A 4CFAA 1KHVA 4M95A 3T5HA 3OYAA 4ED7A 2BR0A 3LDSA 3QO9A 5KFKA 2ATLA 1BISA 1RILA 2UUWA 2G8HA 4K4YA 3VQAA 4CEDA 3DMJB 4U6PA 3NCIA 1B92A 3GIMA 2Q3SA 4M42A 2FLPA 3OSNA 4B08A 4TQRA 2OPQB 4JV1A 2YNHA 3Q8PB 3ZSWA 4Y1DA 3D5MA 1S0NA 4FM1A 3BSAA 1HYSA 3CDEA 3HVTA 1FK9B 1RBVA 3H08A 1XI1A 3IGNA 1S1XB 1RCHA 4M45A 4ZP6A 3UPFA 5CYMB 2QV6A 4HYKA 3SQ4A 3OYKA 3AO1A 3NHGA 1VSKA 4EBDA 3DLEA 4B3OA 4KB7A 1NK6A 4CHNA 4CHYA 1TL1B 2UVRA 4N5SA 4FM0A 1ZETA 2G8WA 4C8OA 4Q0BB 3M9MB 4H4OA 1FXXA 1YVUA 2FLLA 3OL9A 3DLBA 4J9NA 4J9RA 3I5AA 4DG1A 3VQSA 4OPKA 4DL5A 3BGRA 1BCOA 4J9KA 3DLGA 4Z4HA 5KRSA 4FJ7A 4ED2A 4W5RA 1VSDA 3KMSA 3AVGA 3H2LA 2HB5A 3OSPA 2KFNA 1RDBA 4WFYA 3CVKA 4XPEA 1JL1A 2OPRB 4RU9A 3QNNA 3NAIA 1R0AB 1NK0A 3N6MA 1LWCB 3DOKB 4IFYA 3KK1B 4DQPA 1XR7A 1L3TA 2XY6A 4RW4A 4O0JA 3AV9A 4KBIA 2R8GA 3K57A 4ZTJA 5T14A 2AWZA 3NH0A 4PQUB 2C22A 3MXMA 3G86A 1A5WA 2HHTA 2FC0A 3Q8QB 3M9NB 3MR2A 4NLWA 3FFIA 2QKKA 2FJXA 4M94A 2DFHA 1IO2A 4J9OA 3NAHA 1A5VA 4I2PB 3OLAA 1S10A 4F4KA 4ELVA 3I5CA 4URSA 1BGXT 4I9QA 1ZTTA 3I0RB 3DLKA 4CHPA 3V9UA 4E7IA 1ZTWA 4KKOA 5D3GB 2AX1A 3OJUA 4LD0A 2BANB 3OHBA 3GV7B 4K4XA 3KLFB 1UA1A 4AHVA 4NCAA 4M41A 4R5PB 4ECRA 1C2PA 2HHSA 1LW2A 2X78A 3DM2A 3IAYA 4QCLA 5KFBA 1SL2A 4M3RA 1S6QA 3PHEA 1JLFA 5KFYA 1J5OB 3M8PA 4CF1A 2IMWP 2IS3A 2HMIB 2XY7A 3KLHA 3HPGA 2GBZA 3ISND 3QEVA 4CJUA 3DLHA 2W8KA 5DGBA 3FQLA 3HKWA 1GX6A 4ZMMA 4DMNA 4YR3A 3PW2A 3NBPA 2IAJB 4GW6A 3LP0A 3ZT1A 1WSHA 5L9XA 1QSYA 4I2QA 4IQXA 3AO4A 2GV9A 4M3XA 3MF5A 1I6JA 2G8KA 4O3RA 1TAUA 4CF8A 1DTTA 1JLCA 3GV8B 4I9LA 3K5LA 2HNDA 1KSPA 1UAXA 4OLAA 2XCPA 1RTDA 2ZQBA 3OYMA 4IDKB 1Z25A 2IBKA 4F2RA 5KFLA 2V0NA 2XHBA 2HHUA 1S1WA 3CDWA 5DG9A 4PA1A 3MEDA 1U09A 3MFIA 3DLRA 2AGOA 1RT1A 4DLEA 4M3YA 3TVKA 3SI8A 3NH2A 4QAGA 4IR1A 5KFCA 3L2WA 3T5LA 4IKFA 2DY4A 4ZPAA 4BE1A 4NLUA 1QS4A 2FVCA 1C0TA 3V9XA 1KLNA 3S3MA 4YMEA 1C0UB 1ASWA 1C1AA 3ZT2A 2IJFA 3KHRA 4PWDB 1QUVA 4E7KA 4NCGA 5KFFA 2W9AA 4DFMA 3DYAA 2VWKA 5DK5A 3V6HA 4MQ3A 1MU2A 5CYQA 3SCXA 1S1UA 1N48A 2VG6B 4Z4EA 3RAXA 1K6YA 4CEEA 5KFIA 3TABA 1IKXA 1TGOA 1VSJA 2Y1IA 3KKRA 2PY5A 4CEZA 4KHNA 1L3UA 1BIUA 2HNYA 2ZD1B 4Z0UA 4F3OA 4QWAA 1JLEB 2HHWA 2WONB 5KFRA 2E6LA 3JYTB 5KFWA 4AILC 4K4TA 1Z26A 4E1MA 3GYNA 2Z1JA 2OYQA 4IH7A 1F21A 3VQCA 5KFQA 4I7FB 4ECVA 3VQ5A 4ZVGA 4YR2A 1RT6B 4DF8A 3SFGA 5FDLB 2ASJA 4OKKA 2OPQA 2XWYA 3M9OB 2FJWA 2FVQA 1VRUB 4KTWA 2X6SA 1NK7A 4CF0A 1FK9A 1C1CB 2IOCA 5CY4A 5CZ1A 2DTUA 3NF6A 4CK2A 1RYRA 1JLAB 1S1XA 2FBVA 2LSNA 2W7OA 3E01A 4IH5A 5F9NA 5HRNA 1IKVB 2AU0A 1HNVB 4TY8B 5CYMA 1J9AA 3HL8A 3OY9A 2R2SA 3LP1A 4CJTA 4FJ8A 1DTQB 2AGPA 3OYNA 3SPZA 5DQHA 4CEAA 3TAGA 1RDAA 1SH3A 2W9CA 5DG7A 3TWHA 4KHUA 2OPSB 1TL1A 4EZ9A 4CECA 3PO4A 2IA6A 3F9KA 3RB6A 4TN2A 4GC7A 3MR6A 1EP4A 4Z4CA 4AHCA 1S0OA 3UDLA 1BQNB 1N5YA 2E9TA 3HYFA 5KFZA 3V1RA 4FJHA 4IG3B 5J2QB 4DSFA 3O3FA 3WNHA 4TLRA 2BQ3A 1T3NA 1JLBA 3D28A 3PW4A 1HRHA 3PW7A 2VA3A 4ID5B 4QOZB 2B5JB 2OPRA 4XO0A 4KB1A 4R8UB 4RG8A 4EEYA 4GMJB 1R0AA 3CO9A 2X74A 1TKXB 3HXMA 1D9FA 4CJSA 2RF2B 3DOKA 3KK1A 1XR6A 3BREA 4Q43A 4WFZA 1S48A 4CFDA 1KLMA 3RMCA 5KFNA 4DLGA 2W8LA 2RN2A 4O3NA 1QQCA 1BI4B 5KT6A 3QEIA 1N56A 3OS2A 3AVFA 3NGZA 1W9HA 3LWLA 5F8HA 1BQMB 2Z1HA 4I2PA 3B6OA 5K14A 3AO5A 4Z4IA 5KFEA 4O3QA 4M3ZA 4BDZA 4EYIB 3I0RA 5F8IA 4YFUA 3UR0A 4WYLA 3GQCA 1HYZA 5J2MB 1DLOA 5D3GA 1HARA 3V4IA 2BANA 4FJKA 3C6TB 5E41A 3KLFA 2R2RA 4UQGA 1RA7A 2R2TA 2QXFA 2AJQA 4NLYA 3ITHB 3SQ0A 4O3SA 1NKCA 1QSLA 4BDYA 3EZUA 4FJJA 1NOZA 1K1SA 1J5OA 3MECB 3KLVA 5KG6A 3D0PA 4MIAA 3AO2A 2XI2A 1SV5B 4L8RB 4KAZA 4F4YA 1HPZB 3PVXA 4WE1A 5KFJA 1LAWA 3SFUA 4DF4A 1TV6A 1RT3B 1RTHB 4IRDA 1NK8A 2IAJA 4CK1A 2VA2A 1CSJA 5KG5A 4N47A 4O5BA 3DRRB 5F8JA 4CJ4A 2OZMA 3SYZA 1RT7B 4G3IA 2IM2A 3M8SA 1D8YA 4J9SA 4ECUA 4FBUA 1FKPB 4FW2A 3NFAA 4IDKA 3H4BA 1CZBA 4MKAA 4ZP9A 5KG7A 4E7JA 4KSEB 3VQ7A 1U04A 1T8EA 4DSJA 4M3TA 1J53A 4JUZA 3RBDA 3VQ4A 3IRXB 5KFMA 4CJPA 4DTMA 2C2RA 4FJMA 3KD1E 2G8UA 4CGIA 3V1OA 3TANA 3G6VA 5HP1B 1CXUA 2V4RA 2IM3A 1JKHB 1C0UA 1KCFA 4RUCA 1IG9A
chains in the Genus database with same CATH superfamily
1WTFA 3LF0A 3CM5A 2QZ8A 4JRPA 2E1CA 5THWA 2YHWA 2NRHA 1R8AA 4ILLA 5IV3A 5LXYA 3VGMA 4LREA 3KDNA 3MUMP 1VQ6N 1U4BA 3OYCA 2ZD1A 4U9RA 3A0IX 4BY9C 4NLXA 1JLEA 5HMWA 2G0JA 1NK4A 2UUBF 3W9JA 4DPXA 4KHPJ 1K44A 3HVWA 1S6PA 4Y2AA 1X5PA 4BC5A 4ED1A 2DNZA 1WUUA 2R3VA 4Z2XA 4FLXA 1WKLA 4RBVA 2DHHA 3FEZA 1Z4UA 1F6TA 2ZBIA 3MM6A 3PIPQ 1MA9B 3PYDA 2W6KA 3J81j 1F5AA 1FRKA 3UIQA 3VQDA 5JVGL 1YDLA 3BGLA 3BEXA 3JB9k 4LH4A 5I3UA 1TYQB 1JLAA 5DRKA 4CJ3A 1YBUA 1UA0A 3TP2A 1YJWN 2EWHA 2V52B 2XHCA 5ETLA 3MTKA 3QIDA 4W92B 3CJQA 2MQNA 1PJ7A 1X9SA 1LK5A 2HBLA 5IOLA 3TEHB 4QPXA 4BDPA 1TVRA 1VBXA 2B51A 3MR7A 3MTJA 3TAPA 4CLWA 3S3NA 2RKIB 2GHPA 1ULRA 1SL0A 4I56A 3MPDA 3EZOA 5AQFA 2PO4A 1KVCA 4L3QA 2NXEA 4O44B 2Q6BA 1OWXA 2OH2A 1X1PA 2FVSA 2O66A 4GRSA 4OX8A 1CG2A 1AZSA 4ZVTB 2MMYA 2P9CA 4NLDA 3G25A 3PX4A 3WNEA 2ZUGA 4NXNF 2FY8A 1T95A 5K20B 5K8MA 4DV6K 1X4HA 3TSUA 3FZ2A 2P6TA 3PEJA 5J1EB 4FLTA 4R8UA 3JAMU 3O9SA 5F1XA 3R5AA 4DL4A 2FZCB 1Q7LB 1RAJA 2EBEA 2DB1A 1QDUB 2ROPA 3EDQB 4BWJA 3ZZPA 2B4JA 3THWA 2YHBA 5AQOA 4MFBB 1QTNB 3CNQP 3EPIA 3SEOA 1G4CA 3ID6A 3NVKA 2UUAF 3VETA 1S77D 3N6NA 3R1XA 5AE2A 4DU7A 2HVDA 2IHR1 1U6BA 4BCAA 1I5OB 5LJ5Y 5KFAA 3RBXA 3W9IA 4EK2A 2CJYB 4U8VA 4P74A 1FEHA 1KFSA 1RU2A 2OKQA 2MZ1A 3H45C 4JEPA 2ILZA 3CJ2A 3A8KA 1B7FA 2P9UB 3FCHA 1UOCA 4FJNA 3SXLA 4H03B 1VSEA 4R25A 1QVFR 5D4OA 5M1FA 1WAJA 2W42A 1HBMA 3OFEA 2C2MB 1NJIT 3WIUA 4LSNB 2OI2A 4K50A 1R8CA 4X4RA 2A1RA 2AJ1A 4X84A 4PWUA 2V8DA 1AW0A 1HPZA 3A5MC 4TQSA 5J2PA 2EPIA 4OJ3A 3WXMB 3ENQA 1NJZA 3QZ7A 4FSVA 3KNGA 5M2UA 1PO6A 2XM3A 4LF4K 3LA0A 2V8HA 2O8BA 3VGUA 4B02A 4BGBA 2WRMA 2OA8A 3MWBA 1BWFO 4W5TA 1OQ6A 3ASMA 5AJ3F 1ZBUA 3H5UA 4K4VA 2V9WA 2M52A 1Q1KA 1QJHA 1TUVA 2QFIA 1XC3A 5AQRA 2MKSA 3CCRS 2J7WA 3HFZB 4HKQA 3QIOA 1XQIA 2E1YA 4K8ZA 4KH0B 3I96A 2O8CA 2YKPA 3U4LA 1V9OA 2PFUA 1K1QA 5ETTA 2E8AA 2KXFA 2E20A 4A4JA 2PMHA 3AVKA 2DISA 3I33A 1VS3A 5GAHP 1Z2ZA 2YPZA 1M90T 1U2VA 4JK7A 3J7A1 2CZ9A 2RVJA 2NZCA 4DUYF 4LF9K 4JS5A 2BJEA 1NG9A 3FSYA 2VG7B 1NH7A 2ASLA 1KVAA 1A7GE 1TQLA 1N34F 4FKYA 3IC1A 1RADB 4JKBA 3RMAA 2YQ3A 3PHTA 2PA3A 3CJ8A 1UEKA 3CCJN 1YZ7A 3BQ0A 3GCWP 2OJ3A 4NL5A 5B0CA 3WT0A 3NGIA 1K8AT 3HHDA 2NRWA 1ZBFA 3VN5A 3KNAA 2Y3YA 3R5GA 1N0UA 1EKEA 4K4UA 4GC6A 1DAXA 1EIYB 2HAFA 3J7ZT 2F1FA 2QG9B 2O4GA 2DYAA 1TYQA 5KT2A 4DV5J 2VICA 3OL8A 2M4MA 3I6PA 3CDUA 4FZXC 1P8GA 1C4AA 4F7VA 2XY5A 2E1ZA 1C0GA 2H4WB 4Q0BA 2V4QA 3AVCA 3E9OA 4DU8A 2P9SB 2RKIA 1HNXJ 1R89A 1T3VA 1XEZA 3LP2B 3L3UA 1VQ7N 4K4ZA 4O44A 4LFAF 2F8MA 1T94A 2AP1A 2VF3A 1Y64A 1VK0A 3AA3A 2EX3A 1NGGA 3AA5X 1T9YA 4ES2A 5IT9O 1F9FA 3U3YA 1G7CB 4YHHK 1JLQB 2IFXA 4GVMA 4H0OA 5A2QY 1NGEA 4CIFA 4N77A 2YNGB 1CZ9A 3F73A 1HNIB 3J81U 2ZZTA 4DR5K 2MQLA 1S6UA 4NZ7A 4J9UE 3VCDA 2WW8A 4OHVA 4I6YA 2R8KA 3SUOA 5K8NA 1EO1A 1UZHA 4ILHA 5DO2A 4EUVA 2A10A 2VH7A 4J9QA 2VHGA 3N0VA 1TK8A 3OBWA 1I94J 1NLKL 3LPTA 2YX4A 2W7PA 4ZJQA 3CULA 4KE5A 1HWJA 4JI2K 2FGOA 2KO1A 4PKDB 1RXOB 3PX6A 2FJEB 3IBCB 1REGX 3DHXA 4BC9A 5KT3A 4BR0A 3CCMN 2KM8C 2P9UA 3KXDA 3AVMA 2XMKA 1WLJA 3R1HA 4P7VA 3ZCMA 3KG4A 4KJIA 1HPMA 4JRQA 1LW2B 4CESA 4FWKA 1KQFB 2C2NA 2LA6A 2HMIA 4FJ9A 2R7XA 5FLXO 4WQ5A 4OI4A 4LSNA 5EY4A 4FLWA 3VF0B 7FDRA 2LEBA 3NF8A 2AIRB 4DCJB 3GIIA 2ASOA 2CNKB 2XBPA 4X65J 4ZP7A 4DR6K 5D0HA 1RBOB 3AJ1A 2A2CA 2B8QA 2KVQE 3KD5E 2VBXA 4KIAA 2ZEJA 5E3AA 4G1PA 2AKWB 4LFCK 3QWPA 4GVLA 3VF6A 1HQUB 1KC8O 4C48A 5M1OA 3B6PA 3M8ZA 1RTDB 5FRNA 3BN4A 3W7BA 1Q8IA 5LJWA 3T1AA 3G6YA 2BJ7A 1KKHA 1TL3B 3O3HA 3B54A 3JSRA 1YJ9N 1HW8A 4IYQA 4RX6A 4NI2B 2X1BA 4BBYA 3PJ9A 2GZOA 1O6XA 4O3OA 3QNOA 5LJ3Y 5IV4A 1KP6A 3WNGA 1ZZFA 2XY8A 2HPUA 3VPZA 1ZZNA 4DPTA 2HS3A 1UFKA 5HBMB 3HZEA 2GTDA 5T7BA 1N5TA 2X1GA 1VQ9N 2UUCK 2P1JA 1DQ9A 2NUUG 2UV8A 1UWBB 3CCLS 5AQLA 4OJHA 3DHWC 2HNZB 1CQNA 3SQGB 2CQ4A 1F60B 1SI9A 3J7AN 4K42A 4NLOA 1RTZA 1RT6A 2GQCA 2YTCA 3H59A 3WXKA 2K2PA 3L2QA 3SV3A 2A2DA 4FPAA 1RT2B 4H4MB 4DX7A 4JI1J 2F8TA 4JI6K 3D4JA 5FPMA 1VIOA 2CQPA 2ZBCA 2J6UA 1QAJA 4F0MA 1C1CA 1F3FA 3VGLA 3QWUA 1FRIA 3NRBA 3PDNA 4DR7J 4R0EA 1UL3A 1HI1A 1IKVA 2BM0A 3EWGA 3D6TB 4TNOA 2UXBJ 1JL2A 3LPEA 1G6BA 4DR2K 1I3AA 3TVZA 4LT6A 2ZH3A 4ZTFA 2ROEA 4AYBD 3HP6A 4U8YA 2KG1A 1KAYA 4OL8A 4L76A 3LP1B 2X1AA 1HR0F 5LMUK 3DOMB 3C7NB 3IMXA 3KHYA 2LLZA 5DLGA 1JJCB 1GLAG 5IZHA 4NYFA 5GMDA 3E9LA 3VF4A 2P9SA 4F4XA 5KG1A 3AGRA 2HLTA 2HK2A 3LP2A 4WXWA 4ATNA 1RBAA 1XMOK 4JV5J 1BO5O 1HWLA 1KTQA 1TL4A 3G0ZA 3OW2M 5KFVA 1SXLA 3GSIA 4CJWA 4CGDA 2ZGZA 2B5JA 1YSJA 5AE3A 4GO5X 1RLCL 4KY3A 1JLQA 2KKHA 4RLEA 4K0KF 3SCKE 4DBQA 3L2UA 2MQOA 2YNGA 3H25A 4FZYA 3CJKB 4KGXB 1HNIA 1NK9A 2W41A 5EDWA 4HTJA 4FZZA 1KLMB 3U1NA 3GV5B 2V6AA 2YX7A 3CQ8A 3OQ2A 3Q8RB 3AXMA 1YBAA 4CZEA 4LF8F 4LR8A 4LBIA 2J9EA 2WK4A 3UDVA 2XMAA 4ZHRB 5B7WA 2E4LA 2BJ3A 2B0GA 2ZM6F 1WD6A 3PV8A 4IUFA 2Z0GA 2HBMA 1SC6A 4RW7B 2IGIA 3JS9A 3EICA 5KFDA 5JS2A 3SAFA 1UTAA 3MD1A 4CI0B 4I68A 4WIQA 5KPZA 1NJIO 2D0CA 2DITA 4DV3J 3WXJA 4WE1B 2MKYA 3KIOA 4JN4A 2PSZA 4MO4A 1TV6B 3M8YA 2YWEA 4ECSA 3OYLA 2WW4A 2VU5A 4LC9B 1YITN 2UZAA 1HQUA 1XJWB 1DJ0A 1L5UA 2E2NA 1BUPA 2MYFA 4KH4A 3O80A 1DARA 1CJTB 4PAAA 4URQU 4RNHA 4ID8A 2W2NP 4IOBA 4CK3A 3IR6B 1TL3A 4AHRA 4ILGB 2YI1A 1X4CA 2E1MC 3CJ0A 4QBUA 1LWEB 3QBXA 3H7HB 3HHNB 2GVDB 1Q7YT 4NI2A 3R8YA 1C1BB 1HLUA 3SAHA 2P8IA 3OS1A 4U7CA 2EC0A 2YWHA 4YNQA 2WBRA 2KJWA 3CJAA 3LM9A 1A9NB 5BR8K 4LSLA 3BBBA 4DX8H 3L2VA 1U49A 5HBMA 1IJFB 4BREA 3IM9A 1FFSB 2QMWA 4HTIA 2QA1A 2VKRA 2GJIA 2I1RA 1O51A 5HRRA 4F4ZA 1WSEA 3CFRA 1J54A 2HWIA 5DGAA 1UWBA 3NH1A 3UDCA 2HNZA 2IRXA 2W1BA 4B3TF 3SQGA 3C6AA 4EBEA 4LQ9A 4LF6J 3QO9B 2I0XA 2QWQA 4KH1B 1PAEX 4DSEA 3R6GB 3P83D 1GOCA 2RMLA 2CWKA 4ZPTR 1RT2A 4H4MA 4Z7CA 2OEMA 3FMBA 1SKSA 1YTUA 3OXLA 5JMVA 2P9NB 1K8AO 2JEJA 2RQ4A 1PBAA 2DGQA 3MCOA 4CNYA 2VBZA 4HLBA 3SQ2A 3BH6B 2IDLA 2PIIA 3K5NA 4IO9L 2LMIA 4AQYK 1BXNA 3C16A 3MM8A 1S72N 3AB4B 3DLEB 4B3OB 2MLYA 1S12A 3W65A 4AL6A 2D0AA 3MEEA 3ETOA 1Y4ZB 3DOMA 4C3MA 2XMMA 3K2YA 2Z4PA 3AOAA 1UPMB 1GXUA 3FUYA 1WBDA 3PCOB 1NBWA 2Z2ZA 2J4RA 4IOCL 3S7RA 4QR1A 3V81B 4K5SA 4DV7J 5B8HA 3GJSB 4LR9A 2P5OA 3PZPA 1K9MO 1AFIA 3KWGA 2VQFF 4OYXA 4IRCA 1WDDA 2KRRA 4RR5A 3SCJE 4NB4A 5C15A 3AA2A 4KV8B 1VISA 1YRXA 4NLGA 1VBYA 3FBCA 4DV2J 3BR9A 4RW4B 2XULA 1IJJA 1PYSB 3CJKA 3I56S 4JI8K 4WP9A 4E89A 5AFUH 2RPIA 3DN9A 1B70B 3QT7A 2MHNA 5BR9A 4DSLA 1XNRF 2CGKA 3V5RA 3MM9B 4C8NA 3DU5A 1FT8A 3KWMA 3TUIC 3CO0P 3FFIB 3LZIA 2C42A 2G8VA 3G71S 4H4KA 4TU8A 1FRJA 3A2FA 3FSIA 3MDQA 4IKAA 1FVQA 4WYBA 3M2UB 1MN9A 4WXOA 2VWBA 4KKOB 3OD2A 3TX8A 1K47A 4J7CA 2LQBA 2QL5B 3EPGA 4ZHRA 2V2VA 1ZPWX 1IJEB 2B4UA 3AGKA 2CNOB 3DM2B 2R8IA 4KHWA 3LDQA 8RUCA 3MR5A 1IH7A 1TZ0A 3HJFA 1VC0A 5GMEA 1RWXB 4CGGA 3TRGA 4C0OC 2RDJA 4Z94A 2OIHA 5K8PA 4DQ8A 5GINA 1VI7A 4RW7A 3QMLA 4ZPBA 4LH5A 3CF5Q 3TJ9A 2Z30B 1D9AA 5BYSA 2WTFA 3PM9A 1REVB 3AVBA 2FB0A 4J91A 4NLPA 1A5XA 4QR2A 2MEWA 2NLWA 2WTUA 4J2AA 3ADAC 5AQZA 4JD2A 2LDYA 3P5TL 1DTTB 4ED6A 4B3MJ 1F3VA 4H5VA 2XC9A 3O5TB 1MNEA 3I9ZA 2CGJA 1JCEA 2PMZD 1N33J 4QQBA 1ZBIA 2KXHA 1HNWF 5GAEI 4JAXA 2ZH8A 4JS4A 1GEHA 4EI2A 2QTDA 1LWEA 3KUHA 3KMQA 5L1IA 4A8KA 4BE2A 1C0TB 3CPEA 3K2PA 2GVDA 5TKWA 1HIYA 3DDKA 3CMAN 1EHWA 1C1BA 2VODA 3BGUA 2XMWA 2P9IB 1U1LA 1WSIA 3DYAB 4OIXA 5CYQB 4ZOSA 1S1UB 5C25B 2ACMA 1NB7A 3WC2A 1JWWA 2UUBK 5HRPA 4CQ1A 4ZVSB 2NXUA 1N32F 5A8WB 1VHIA 4IOAL 2UVUA 4ERDA 4B3RJ 1MMDA 1W2BR 2PAVA 3EL2A 3CJSA 2NNWA 4ED7A 1FCAA 2BR0A 5BRHA 3QO9A 3H90A 2XYPB 4C7QA 2OEJA 3EJMA 1RILA 3T41A 3DMJB 1VIXA 2GMJA 3NG8A 1U2CA 4JYAF 3D3CJ 4M42A 1WDTA 3M1VB 4MDBA 4TQRA 2LQ9A 3Q8PB 3ZSWA 2HGLA 3D5MA 2Q6CA 2P9NA 1RBVA 1XNQF 1XI1A 2F8HA 4M45A 2HFNA 2FDNA 1TUYA 1KBRA 1FRXA 2QV6A 1R43A 1U2FA 3HT0A 3OYKA 3ZNUA 1ROFA 3D2EB 2GX8A 4O8UA 1VGYA 3DLEA 4B3OA 5CCLA 2E1PA 2XLIA 4CHYA 1TL1B 1EKRA 1HHQA 1NDPA 4C8OA 4NE9C 1TFYA 1Y7PA 3PIOL 2BE9B 3DLBA 1WJ9A 3OTOF 4OI1A 2F7TA 2I7NA 4J9RA 3VQSA 1BCOA 1RWKB 4NXNK 4E2FB 3MM7A 3UNYA 1U1KA 4DZDA 2I38A 4Y2IA 3KMSA 4PZVA 3H2LA 2X1FA 3OSPA 4CDIA 4WFYA 5M2PA 4XPEA 2K1RA 2YY3A 2OPRB 3QNNA 2GGPB 1R0AB 5HMYA 2LQ5A 3DOKB 3KK1B 4OJGA 4RW4A 1H98A 2H3EB 1RHUB 1RHJB 4KBIA 1U1QA 4PQUB 2NPIA 1A5WA 2VZ9A 4F9OA 2IRYA 2DH8A 1LOTB 3M9NB 3FK4A 3MM9A 3MR2A 5HQMA 4BVOA 3FFIA 3PG9A 2UUAK 2QKKA 3I4HX 4JI4F 2NYHA 3ZTRA 2XHWA 2JX2A 4I2PB 3C3LA 2J8SA 1BGXT 4I9QA 3M2UA 2R42A 3JAMY 2GA7A 4KKOA 4DHVA 2UUBJ 1YJTA 5D3GB 3UW1A 3JQJA 3R9PA 2O8DB 3KLFB 4BRGA 2HFZA 5B0BA 2KT2A 4DMZA 4ECRA 1C2PA 4CO1A 3DM2A 5LL6Z 3G87A 1SL2A 4HDGA 5KFYA 2O67A 4FWPA 2IS3A 2V4JA 2CJAA 2XB2D 4ZVOB 2MKKA 4CJUA 1U8SA 5DGBA 2VPZB 3FQLA 4OLOA 2Y9HA 1SJ1A 1GX6A 1KXPA 3OTCA 2L9WA 4GW6A 1UJ6A 2GV9A 4CF8A 1DTTA 3HMJG 2UXCJ 2VQEF 4I9LA 1KN6A 4CBWA 5AJ3K 2HNDA 2DEJA 1W97L 4OLAA 3UVJA 2QL7B 4NYOA 2Y8WA 2HS0A 5KFLA 2V0NA 2XHBA 1VQ4S 5JVGQ 3U9DA 5DG9A 1U09A 3MFIA 2AGOA 2GFFA 3TVKA 3SI8A 4QIVA 4GKJJ 4IR1A 3NGTA 4NLUA 3CXCM 4MO5A 2D3O1 3NOCA 4CBUA 1C0TA 3ZEUB 1NWKA 3DXSX 3GG4A 1KLNA 4YMEA 2B3TB 2VONA 2P9IA 3UCGA 4PWDB 3R3TA 1Q7YO 4YB1P 5KFFA 3DYAA 2VWKA 3V6HA 2IVYA 4WU3A 2BUPA 5CYQA 4M5KA 4DUYK 4FNHA 1S1UA 1N48A 3O4WA 2VG6B 2JZ5A 3RAXA 4CEEA 5KFIA 1X8DA 2AP6A 2PY5A 1N34K 4M5DB 3J8AA 1BIUA 3EGVA 4XTTA 4WFNL 4Z0UA 3A5OC 4F3OA 1YZ6A 2HHWA 2WONB 2RAQA 5A8WA 2E6LA 3J80O 3Q89A 4AILC 4K4TA 1CC8A 1R8PA 2Z1JA 1FD8A 2YWWA 4IH7A 1VBKA 2GNKA 4OYBA 1DZ5A 4M5GA 1FDDA 3M1VA 1S7IA 2ERRA 2XWYA 1OVYA 2IY5B 1BA1A 5GAHU 1U0SA 3VGTA 5EX5A 5LSOA 4UQTA 3JS6A 2IOCA 5CY4A 2DTUA 4CK2A 4U95A 2LSNA 3BPDA 2H5JB 3C0BA 2RRNA 4IH5A 3SDEB 2E7XA 4M5NA 2AU0A 1HNVB 4TY8B 1WKJA 5HMXA 2HFVA 2XG8A 4HI2A 3PLAA 4DV0K 3J7YP 3OYNA 4YEAA 4CEAA 5CR4A 1X31C 5DG7A 4KHUA 2IVPA 1EARA 3W1YC 1TL1A 1VQMN 3I55N 4JI0J 1LFWA 3FMWA 5C10A 5CA5A 3FFKB 3H3NO 2VFSA 4TN2A 2JFDA 4LFAK 1NSPA 3CC2N 4ZPVR 2QN6B 1BQNB 1N5YA 2V2ZA 3R6LB 2Q1LA 4X4UA 4IWVA 4J90A 2N4DA 4FF3A 3GR0A 2XS5A 3WNHA 3WDOA 1T3NA 4DR3F 1XMQJ 4R79A 4EU0A 2AEFA 5T41A 2VA3A 2OPRA 2V5HG 3MAAB 2A41A 4KC5A 1R0AA 4PXCA 3DOKA 1NGDA 3UN2A 3KK1A 3BREA 5CXTA 3VERA 2MTLA 1XN9A 2RN2A 1OY9A 3NCQA 1N56A 4C0BA 3Q8UA 3OS2A 1JXVA 4ZVUB 3W9HA 1M5PC 4I2PA 4QOTA 3EE3A 4Z4IA 3CD6S 5KFEA 1DFDA 4BDZA 3B8HA 4GO7X 4WYLA 5IQQA 5M1NA 1RWUA 5D3GA 3J81Y 1NDCA 1PSDA 3QGPA 3KLFA 4UQGA 2MDAA 1IBKK 2QXFA 5GAGI 3Q2SC 5FJ4A 3NS6A 4E98A 4BDYA 1QY7A 3MOJB 1RK8A 5LSRA 3KLVA 5KG6A 1S5ZA 4YDUA 3WXIA 1B0VA 4UUXA 2CQHA 2DTJA 3N5BA 5KPTA 2HIQA 4F4YA 4C8ZA 3SFUA 4DF4A 3K0SA 3BKFA 1RT3B 3U1LA 4NXMK 2OHDA 4CK1A 2V7YA 2DNPA 3NS7B 2HBZB 3IWNC 3MPVA 4HHUA 1ICEB 3GSDA 2H48B 5AQPA 2OUGA 4DX5A 3M8SA 2G4BA 4QS9A 3CCUS 3K17A 4I1TA 3H4BA 1CZBA 4MKAA 5KG7A 5ETMA 4DSJA 2ZZMA 3G4SS 1YX2A 1ZAVA 3QBWA 1KNZA 2LXFA 1HWKA 4CGIA 4CW7B 1FE0A 3ZEUA 2V4RA 1JKHB 2MZJA 2KXNB 3D66A 2VGNA 2V8VA 2BE2A 4PWDA 2G1HA 3SPYA 2F4VF 7FD1A 4WF9L 3T6JA 3CG7A 2VG6A 3SBTA 3Q22A 3AVNA 4NWBA 5A8KA 4OX9J 1Q8BA 4M5DA 1QE1B 4ZLNA 1RGIA 3MZIA 4AHSA 3TOQA 1X9WA 4JV2A 1B7YB 2WFBA 2WONA 3CGIA 1PGZA 3OR2A 4DS4A 5AQKA 1GQEA 2RQMA 4G1QB 2GHVC 1F5CA 3EE8A 1SIWB 3QEPA 3RG6A 4ZCKA 5KQDA 1UWAA 4XH5A 4D3GA 3HTVA 3A13A 2HLUA 1JLGA 3WX8A 5FD1A 4ANDA 3C6UB 4X4SA 4GV6A 3MXJA 2XI3A 4WFBL 3DRSB 1K73T 3V6DB 4LSZB 2CH5A 2QTWA 2OZSA 2F8SA 5EN1A 1Y3KA 1X4GA 4OFZA 4B9UA 2CG8A 2AW0A 3SDEA 8AT1B 3PNIA 4CLTA 2CQ1A 1WOSA 3CCZA 3U9ZA 1HR0K 4DL2A 4I6MB 4OKEA 1V4SA 5CQGA 2XGPA 4IZ9A 3DRPB 4NLRA 4AHUA 2PMWA 1IM4A 2DNRA 1UEVA 4G65A 4AD6A 4OO1J 3PJWA 2PA8D 2NCKL 1BQNA 2DY9A 2A3ZA 2V9KA 3O1BA 2BZ2A 4UOHA 4K0KK 1NHVA 2QWOA 3MAAA 2UP1A 2FHMA 2AJ0A 3CSKA 4LF5F 3K58A 3VAHA 1RTIB 2K7KA 1WWHA 2RILA 1UAWA 3QJPA 5F8LA 1MMLA 3M6UA 2P9PB 1NOYA 3EKSA 4LF8K 2E5JA 1HBNB 1SB6A 4CIOA 3WQUA 1FTCA 3HM9A 3KJQB 4CZCA 3ZSZA 4F4AA 3GYGA 4UTGA 3VAFA 3CPWM 4DKWA 1SC1B 1WG5A 2JEIA 3SIPB 5I4MA 3G8QA 4CF9A 1I3OB 4EWTA 2DXDA 2V67A 1ZPVA 3N5FA 1XHZA 3ZZRA 3WIVA 1S9EA 4UT4A 4AT1B 3I8DA 4MK7A 2ZOGA 2BMBA 4YB7A 1WEXA 3CW2C 3V1QA 2MLXA 3TQ1A 4FWMA 3QFPA 1VQOS 4LBPA 3CCSN 4DU4A 3TAQA 2NREA 1LEOA 4JKFA 3EKUA 1RT3A 1RT4B 4OYZA 2WSCC 4LUBA 1RDWX 1JX4A 4KFBB 1VMBA 4DTRA 3T5KA 4KGKA 2OELA 5BPNA 1D3WA 2G8IA 1YTYA 4RW6B 1OQ3A 5AQJA 1EB0A 1C0MA 5E3PA 1IKWB 3VF2A 1SVDA 1NGAA 1SZ2A 4JI3K 5C42B 1WKKA 2AYEA 1WC6A 4YOUA 2GVZB 4ZA1A 4V19J 3D54A 3M8QB 5KGXA 4RUHA 1IKYB 4BC4A 1JKHA 2K7JA 2D3OR 3FSXA 1HQEB 4K59A 3TI0A 4IG0B 2FHKA 1DGKN 4FKXA 4CGHA 5C2DA 2WB1D 4A5AA 3TU5A 4DEZA 3UR3C 1ZH5A 5KT7A 1F1BB 1JXEA 3BS9A 5HATA 2I5JA 1QE1A 4YY3F 5SWMA 3D0IE 2HQ3A 2YKMB 1VQ8N 3ICLA 3FR0A 1FKOB 4Y6IA 1J5EJ 2BEFA 2KW4A 1ZYQA 3DOLB 3TSQA 4G1QA 5ELZA 4DZ6A 3FRZA 3QYYA 5IT9U 1ITGA 2PC6A 3FBEA 2B9EA 3OYFA 3B4MA 4BG9A 4G9ZA 1ZBSA 3G82A 3TSPA 3K7RA 3R7BB 1VYAA 2ZM6J 1FJEB 2UU9J 3DC2A 3C6UA 1S99A 4CIGA 3DRSA 4M3WA 3HZGA 4CBXA 5KAKA 3OVBA 3CETA 1FWPA 4NYNA 1FJGF 3DU6A 2DNNA 1C6VA 3SBMA 2CQIA 5KFUA 3VAMA 3OXGA 4Y28C 3H3OB 5L1JA 4OZJA 1PKUA 2XQCA 3G2XA 4ECTA 2A5XA 1NKEA 4CZFA 5A8RB 3T1HJ 4JI5F 1VQNN 3OYEA 2KHDA 5AQHA 1KVKA 1NUEA 3K8VA 4ZJLA 1ZS6A 3THVA 3NGUA 4OQJA 3K5OA 4ZPWR 2PEBA 4A8OA 1BL3A 2VQFK 1IN0A 1VC5A 3CC7N 4WZMA 1XC9A 1MN7A 2EW9A 3MMVA 1FERA 1LWCA 1VSMA 3EUNA 4ZLLA 1MWKA 1NU0A 3OYDA 2OSRA 3CIZA 3FRYA 3D3BJ 2HVZA 5D0RA 4CM0A 2GO8A 3ULHA 2IIHA 4USIA 4YHHF 1H7WA 4DV1J 3CJRA 4FWLA 2PFDA 4A61A 4LRDA 1NK5A 2P9PA 1NH8A 4A57A 1WNSA 4ZPDA 1IBMF 2LDIA 6FD1A 9RUBA 1X4EA 2LYVA 2MY7A 4PRFA 5HO4A 5KFPA 1UCNA 2E7VA 5F0WA 4C8MA 4QWCA 1BG3A 2W4CA 1GLFO 3DLKB 5LL6d 4B3TJ 4ZCLA 4MLHA 2V2KA 3L7OA 4R5PA 1P1TA 3PR4A 2RT3A 2GX9A 5L39A 3W5ZA 3SUNA 4B9SA 2BYCA 1ZM4A 4PXDA 3GP9A 1O0PA 4ANEA 2ZUAA 3L7UA 1S0VA 4NLCA 3BZQA 2CDRB 3MPYA 3KJNB 2C2KB 3LGNA 2A40A 5KOXA 1C0FA 4B9VA 1Q8LA 2C2OB 2B4OA 4GVEA 4PKIA 3MMCA 1RJJA 2BBEA 3IAM9 5I42B 2E2QA 3IMQJ 1RT4A 1D5AA 4IQMA 4C11B 3N79A 1KQSR 1EXQA 4X4OA 2DNKA 3RSEA 4DR6F 3SUQA 3VGKA 3MN7A 3NOGA 4MK8A 1RB0A 1YHQS 3MGJA 3SBGA 2A18A 1XK8A 4U67L 4OLPA 1KHWA 1IKWA 1N36F 1UJ5A 3VQTA 4FF2A 4B1ZA 5DQIA 5C42A 2R7SA 4FS2A 2J0WA 4CZJA 4IO9Q 3AD8C 2FVPA 4QIEA 3M8QA 4CHZA 1IKYA 1WF2A 3OYGA 2VFTA 3VR1A 2VPXB 2DFFA 4JI7K 2LU1A 4F2SA 4BROA 4C1NI 4A59A 2FTRA 4NCGB 2RSQA 5H9EK 1M5KC 2WOMB 4N41A 2H65B 3ZLJA 4F50A 3H5XA 4ZVEA 3LPUA 4H8KA 4H54A 4IOCQ 3AJDA 1VRTB 3ZETB 1XNRJ 1YVFA 3P5BP 2EVZA 3MN5A 1NPPA 2YKMA 1I39A 3EVOA 1FKOA 4HWIA 4X4NA 1I1GA 2UUCF 3TARA 1Q5YA 3QESA 3DOLA 1KONA 1BWVA 4DPWA 5EX3A 3CE8A 4HHTA 3HSDA 2A3JA 4JYAK 3CFOA 4KO0B 5HROB 3TZWA 2K3IA 4OGCA 1YUWA 2VWJA 2B9XA 2H9ZA 3GDQA 3JSMB 4IRKA 1XNQK 4O4GB 2BW7A 1ILYA 3BO4A 1XIQA 4CE9A 4KRFA 3LM2A 5HL7L 2XZTB 2NSCA 2OSQA 1K73O 1YTAA 1DTQA 1N8RT 4JKDA 3E01B 4WTOB 2NRVA 8ATCB 2VUGA 3V9ZA 3MN9A 2NUBA 3CC4N 1QVGM 4KHYA 5A8RA 4L75A 4DR2F 2B43A 3Q8VA 2JFKA 2K8GA 1P1LA 4NZ0A 2W9CB 1U7LA 5HQLA 5K9FA 4B8AB 2FHJA 3Q7CA 3FQKA 4RPFA 3OTOK 5M1KA 4USHA 3TVYA 4B1YB 4M1KA 3GTYX 2ADBA 2ZOMA 4B9MA 2ALYB 4IG3A 3KK7A 5CHIA 5EX0A 4CTAA 1CJUB 3MM5B 3O9UA 2B56A 3UNGC 3RBEA 5TKYA 2ROGA 5C5JA 3ZTQA 4CO5A 1ATRA 1HNWJ 1RACB 5D8HB 3UB5A 1BCMA 1FKAF 4CEQA 2LP4A 3JTPA 2EFQA 5JS1A 4CJ7A 3OFGA 3EGZA 1FDBA 3WC0A 5C12A 1PJ6A 4DR1J 1RDCA 1NMDA 2YVSA 4NMXA 1HI8A 1B3TA 3ET6B 4JI4K 2VG5B 2VCPA 2DGVA 3I4PA 3ALYA 3M8WA 3NLCA 1FESA 4ZVHA 1PYOB 3BKUA 3EVMA 2MB0B 1NB2A 3WZ0A 4DL0C 2RQCA 2M0GB 4BRFA 2QWLA 1N32J 5K14B 3IWXA 4UF4A 3E51A 1HBUB 1YXQA 1WC5A 1FD2A 2IJRA 1DLOB 3ITHA 3W3DA 1VDHA 2EWSA 4C8KA 2JEGA 2G1DA 2PYLA 1E4GT 2EFNA 3AY0A 2J8AA 2OD6A 4DR4J 2HIYA 2JH3A 3MMAA 4RU2A 3X1LB 1S4FA 4E19A 3QGGA 2DCLA 2FY1A 2HHHJ 1CLFA 1U1OA 1V3RA 3D0GE 3L95X 1RWMB 1XR5A 4B9QA 2Z2LA 4CYUB 2OAUA 1Y97A 2X6NA 1RWVB 1RTHA 2ABYA 3QFWA 4DTJA 1D1UA 1H74A 2EI5A 4OZ5A 1OH8A 4ZK7M 3NNCA 4IOAQ 3DRRA 5I42A 2ZBPA 1R31A 3DCAA 3D2FB 4C11A 1P90A 3U27A 2VQEK 3FDSA 2BUNA 4WBFA 2HVIA 2D41A 5GADU 1SH0A 3LH2S 4E0DA 3ENOA 2DGWA 1FKPA 3HK2A 3I82A 1RHMB 3V9WA 2DR7A 2HG4A 3GCXP 5F0UA 3BF3A 3W66A 1OO0B 3FZFA 3POTA 3H5SA 5EVZA 2OO4A 2QEXN 3PY8A 2MGZB 3PYEA 1RAFB 2Y1RI 3MWPA 5FROA 4CEFA 3FE1A 2KT3A 1WUAA 4FLYA 4OVLA 5IXUA 1ATNA 5IM0B 1T6CA 3H98A 3FEYB 4X66K 4NYPA 5HJYA 1VSHA 4Z4GA 4TYAA 4KAIA 3OYJA 3CCES 2F7VA 3ILIA 3OBIA 4EHUA 3T1YF 3TW0A 2GEMA 3VA3A 2VC1A 4C3LA 3MK6A 2PBDA 4E7LA 2WOMA 3KLIB 4L3NA 3PIOQ 3AOBA 4DV4K 3W8GA 2YNIB 1VRTA 3ZETA 1F5BA 4ZVQB 2HGNA 1KDNA 2F9JA 4X4TA 4CZGA 5BREA 2C3MA 4ISGA 3W61A 3V9SA 4N7TA 2LU2A 1RUSA 3U8XA 1S6PB 3QLHA 3QFUA 5KG2A 3SJJA 2B4PA 4KO0A 2FSKA 5HROA 2XEXA 2AYMA 1IQZA 1JXLA 1Z6RA 4X4VA 3JSMA 2RH3A 2KZMA 4V19S 3ENAA 4QWEA 2QWPA 3MM6B 1HYSB 4O4GA 3HVTB 4CIEA 4XK8C 2ITMA 2QLFB 5F3TA 3D45A 4FBTA 4Q8EA 2MZQA 3G9CA 5FPDA 1M1GA 4C6AA 5I3UB 4QYZJ 4GVBB 3Q8YA 3WEEB 3TZZA 1VC6A 4BRLA 1SH2A 2OTLS 3VA0A 2RB7A 4O23A 3TAEA 3ZO7A 4FOEA 2R8HA 4BRDA 3S1TA 1TVRB 3BDEA 2DIUA 2BM1A 3QRRA 1NKBA 5AQSA 2BRKA 1Q8KA 1V5VA 4J9PA 2E88A 4HCCA 2OTJN 2ZNZA 5IWAJ 4BRCA 2F9WA 4YR0A 1IBLF 3BGRB 4LFBK 3IDHA 5AR0A 4DR3K 4HI1A 3AHPA 1RAEB 1U2RA 3ILLA 4LF7J 3F44A 3RU0A 5DS7A 1BC6A 1QUPA 2NRXA 1FWKA 2FZGB 3BR8A 2QIFA 3GFHA 1RP5A 2M3DA 4FJ5A 3J7YU 4B9LA 4LY7A 2Y1JA 4FYDA 3H4DA 1YRTA 1CJVA 1LW0A 1OKJA 2WHOA 4GV3A 4KHPF 3AFGA 2VG5A 2F63A 2AEJA 3O8WA 3MCMA 4CD3A 2PZSA 2HHVA 4JI8F 3BO2A 4OI6A 3H6EA 2E7WA 4GMKA 3UQSA 3RVCA 4OZ2A 2O5DA 4JBCA 1TKTA 3CJ3A 4ECWA 1VQSA 1RWWB 4O0NA 3R2CJ 2P5GA 1HBUA 5EUHA 1RT5A 2YV0X 4AHTA 2GJ2A 3SI6A 4DUZJ 3W5XA 1YHQN 1GFWB 4RBTA 1C4CA 3MPUB 1WORA 4IBNA 1JLFB 3ZT0A 3M8PB 1HBMB 4H5TA 4JNEA 4FLZA 4WFNQ 4A2BA 1QAXA 4CYUA 5F3ZA 2JLEA 3O9QA 1YKWA 3BQ2A 1WEZA 2YXLA 2ZGYA 3LP0B 5J2PB 4ED0A 3ZXWA 4NA2A 4NLTA 3TO8A 4YP3A 3BY5A 1H72C 5AXMA 2O8BB 4WFAL 5HRSA 4P2FA 4NLSA 2XO7A 3PTWA 4J2EA 4CLYA 4CM2A 5DMRA 1BMQB 1BQXA 3IR5B 4IJAA 2DR9A 2MGZA 1RT1B 3O6WA 2YCHA 5F0XA 1QZ5A 4NLVA 3J7YI 3OVNA 1JIHA 4JKGB 3H40A 1YJNN 1TKDA 3ISNC 3BSCA 1PG5B 4GNIA 3A8IA 3A5LC 3UD4P 3PRVA 3VENA 1HD0A 4XIUA 2W9BA 2Q2RA 1WNEA 1UVNA 1JMTA 2B7CB 3IO1A 2HQIA 4ZN3A 3ULEA 4HCBA 3AA9A 1T7PA 2QE5A 5F8GA 3QERA 4RNFA 1U2VB 3KLIA 2RHSB 4PYDA 3RYLA 1T05A 1X9MA 3BDPA 2R2UA 2AGQA 2HNYB 2YNIA 2DNGA 1TR0A 3T19A 2OMOA 2FXUA 5E7OB 3NGKA 3NGSA 1NMNA 4CFAA 1KHVA 2CYYA 3T5HA 2HKEA 3EXCX 3CCQS 3LDSA 2ATLA 3EXYA 2R4FA 3VQAA 4CEDA 3RBZA 3CCWA 1B92A 4YN3B 2VC0A 2E1RA 2SXLA 5GMKa 2DGUA 2VJVA 3TTDA 3ZZZA 3DFEA 4FM1A 2KT5A 2CQBA 4FWRA 1HYSA 3HVTA 2C3UA 4ILJA 3EX7B 3IGNA 2W01A 3MCNA 4X64J 3UPFA 2E5LK 1VQPS 4GVBA 3OBYA 3NHGA 3WEEA 1VSKA 4RWTA 1SJQA 1U1MA 1NK6A 4CHNA 1N8RO 2EG1A 2UVRA 3QATA 4N5SA 3B6BA 2G8WA 3SMZA 4Q0BB 3M9MB 4X62J 1FXXA 3OL9A 5BPLA 4F04B 4OHZA 3WXLA 1OJ4A 4KH6A 4AXJA 4J9NA 2BJDA 5ITHA 4DG1A 1OH6A 4OPKA 3BGRA 4FYYB 4PWWA 3G6EN 3DLGA 4F3MA 4Z4HA 1HL6A 3D7SB 4W5RA 4IEEA 1VSDA 4CP5A 3UKUA 3TPQA 1ACMB 2H51B 2UXDJ 2OANA 2XMTA 4LF5K 3VAJA 5RUBA 3ENHA 3N6MA 4P10A 2W2MP 1L3TA 3EDRB 1G99A 1VCTA 4O0JA 3K57A 1VQLS 4QIWD 3MXMA 3G86A 5MLCV 2FC0A 1SQKA 3NWRA 2F4VJ 2DR6A 3Q8QB 3ZZOA 3EEQA 5DDOC 2FJXA 3A12A 1IO2A 1SKUB 1SC3B 2R7UA 1R8BA 4RJVA 4F4KA 4ELVA 4URSA 1KTVA 1GLJO 1HUXA 3I0RB 4E7IA 1ZTWA 3RW6A 3E2EA 3OJUA 3GV7B 4K4XA 1VAZA 1X3MA 2GUPA 2EK1A 5DDRC 4AHVA 4NCAA 4M41A 2QW9A 2YKAA 4PYAA 1GMWD 5U47A 3IAYA 2Q3PA 3M4XA 4QCLA 5A76A 5KFBA 1S6QA 2DH7A 2N4CA 3PHEA 4DV5F 4WF9Q 1JLFA 4FN5A 1WTBA 3LOUA 3M8PA 3PACA 2HMIB 2O3DA 3QEVA 1Q82T 4YDDB 3DLHA 3B8AX 3HKWA 5E2QA 1W7AA 3BM7A 1X3NA 3PW2A 3NBPA 4J9VA 1FFWB 2IAJB 4DX6A 4M63C 3LP0A 1WELA 3ZT1A 2QA4G 4P2XA 3AO4A 3H8YA 1I6JA 3I9V9 2VBWA 3BP8A 3R9LA 3K5LA 1RHQB 3QB0A 1YIJS 2XCPA 3FVYA 1WOOA 4F26A 4IDKB 1Z25A 2WSEC 4F2RA 3FKBA 4WFBQ 1UVMA 1S1WA 3LTOA 4DLEA 1RT1A 3NH2A 4QAGA 4JKGA 2DY4A 2DHSA 4CH1A 1WBBA 1C1AA 3ZT2A 1N5SA 3KHRA 1QUVA 4E7KA 3ZFVA 4PQAA 3SCXA 1W2IA 4Z4EA 4DV6J 4YOYA 2APOA 4YY3K 1TGOA 1VSJA 4USWA 3KKRA 1I94F 2B7BB 1L3UA 2HNYA 4QU6A 1ATSA 2DPNA 4A8MP 2OTLN 3JYTB 5KFWA 2KJVA 2HSTA 4ZN1A 4DCHA 3TTFA 2FSJA 1LNQA 1QVFM 1F21A 1SIZA 4Y0WA 5KFQA 3VQ5A 1JK9B 1RT6B 2ZJRL 3SFGA 3CMES 3LDOA 2ASJA 3CCVN 2FVQA 5JJBA 4HT7A 4KTWA 4WKRA 1FJGK 3VAIA 3VHQA 4X65F 3VEVA 4CF0A 1C1CB 1N54B 5CZ1A 2YH1A 5LMNF 4M7XA 1PCAA 5HJXA 1EJ7L 1IKVB 4MIWA 4IFEA 1Y11A 4L72B 3OY9A 2W2QP 2E2OA 5IT9Y 4QYRA 2R2SA 4CJTA 4JI5K 2AGPA 2IIRA 4A8QA 3AH6A 2F4FA 1RDAA 1SH3A 2OFHX 3QT8A 4P72A 3KG1A 2OPSB 3R5DA 2VV5A 4EZ9A 3PO4A 4DV0F 2P9LB 1PC4A 5ETOA 4IJNA 3RB6A 1M5VC 3RAMA 2DHAA 1EP4A 3L4QA 4AHCA 4Z7YA 3K9JA 4CZMA 5E26A 4LF4J 2E9TA 1RGVA 2KFYA 1K9MT 2E1AA 3Q0AA 5J2QB 2LQ8A 2RD5C 1UVJA 2ZJPL 2JHEA 1JLBA 2KVIA 3PW4A 4XEIA 3PW7A 1U25A 1ZC6A 1KD1T 4ID5B 2B5JB 4XO0A 4RG8A 5E84A 2X74A 1TKXB 4FYWB 1D9FA 4CJSA 1WC0A 3S8SA 3P4UB 4Q43A 4YDXA 4Y00A 4RBUA 2V2QA 4CFDA 3RMCA 5KFNA 4DLGA 1IBMK 4O3NA 2BOAA 2L9DA 5KT6A 1VQ5S 1KWMA 5DDQC 2E29A 5BRFA 5E0OA 2CVEA 4H0XB 2IYIA 3SSRA 4EYIB 5IFMA 1IG8A 1VQKS 3I0RA 3A8YA 3EMTA 2NXJA 5J2MB 3V4IA 1X4BA 4LF9J 5ADXA 4FJKA 2R2RA 5ETQA 3QT6A 1FXRA 1RA7A 2R2TA 5IC6B 4DR7F 5B08A 4NLYA 4CI6A 2HYIB 1FA0A 4ISFA 3SQ0A 3FBFA 2JVRA 3D6FB 3EZUA 1VK3A 3CT9A 3W2VB 1IBKF 2G13A 2D0PA 3CJ1A 4MIAA 2KLAA 4DPUA 4QZVB 2Q97A 3OA9A 2XI2A 2MY8A 4L8RB 2VBYA 2Q31A 5KFJA 3T9NA 1LAWA 4WCEL 4NMLA 4ANCA 4CO2A 4IRDA 2HQGA 2Y1LB 1NK8A 1K0VA 2IAJA 5KG5A 2QL9B 5F8JA 3MCPA 1FX4A 4UOFA 4CJ4A 3SYZA 3NXZA 3TJ8A 1AB8A 3UCZP 4NXMF 4J9SA 2YHYA 3H46O 2VFVA 1N36K 4IDKA 1XERA 3PSIA 3VZIA 3Q24A 4E7JA 2CVIA 4OHWA 3VQ7A 1T8EA 4M3TA 3MCSA 1RAOA 3FZMA 2DIVA 3QJLA 2C2RA 1Q79A 3MHYA 4USKA 2XYHB 2JWLA 1U24A 3G6VA 3O1LA 3QPIA 4B3SF 4DPYA 3CCTA 1NO8A 3OLBA 3VEXA 5DM6L 4LSLB 1VRQC 1YWXA 2RS2A 4M5HA 4YHHJ 4L73A 3ZTOA 4CVNE 2ASDA 3ILJA 3HHKA 1SCJB 5HI7A 4Q2MA 2KFZA 3AODA 3GZ7A 4J8FA 3RTVA 3LO3A 5M1QA 3HFKA 4DR5J 3JYTA 1GLCG 1BIZA 1B0PA 5T7LB 2ZITA 2J76E 4KHMA 1S3XA 3UI3A 4CFCA 2E2PA 2XLKA 2CJQA 4BRHA 1KRPA 3CHWA 1NJWA 3P3DA 1N0VC 1T0TV 4DQSA 3OL7A 4JI2J 4OX6A 1R59O 4RUAA 4DV3F 2C2DA 3CJCA 1U1NA 1MWQA 1DHMA 4G6VB 5C24A 7AT1B 2BKPA 2CZ4A 2YBVA 1X4DA 3OTDA 2G9OA 2FPHX 1E6YB 2RQKA 3T9ZA 4PKHA 3C16B 3VZHA 3MM8B 2ZH9A 1QQNA 2OPSA 4UUWA 2W24A 3MEEB 5IC4B 3FEXB 3MD3A 4IR9A 2P9LA 2H1YA 2CJBA 1WC1A 2XSFA 5F8MA 1CULB 4DR6J 1VLYA 2MKHA 1MROA 1X5OA 3TAMB 2D3ZA 3P1GA 4WQ4C 2ZWPA 3Q8SB 4GKKK 5EHHA 4LFCJ 5J2QA 4ICLA 4HH1A 4ITSA 2PI4A 1FXDA 2VJUA 3BJYA 1RNHA 1YJWS 3HKZD 5IT4A 1KQKA 2BJ9A 4ID5A 1VSFA 3AO3A 1WF1A 1K0TA 1TKXA 1GOBA 3G10A 4Z4FA 1OYDA 2XRIA 3KJVA 2D69A 1YAGA 2D4WA 1Q81T 2ZZNA 3MN6A 1G1XA 1VJQA 4CT8A 3M3ZA 2I8EA 4LF6F 1ZXOA 2JWNA 4U67Q 3C65A 3W2WA 3LAMA 2IYGA 5DDPC 3ZSVA 3SUPA 4DQQA 5AQXA 3P31A 2UUCJ 3A4TA 5J2MA 2IA0A 2H5EA 1DT9A 1HMVA 1GTHA 1S97A 3G96A 4E1JA 1FF2A 2XMJA 3KK3A 1HKBA 3GMGA 4H5RA 3JXUA 3GJTB 1FE4A 2O4IA 3W2VA 1N4LA 4YOEA 1PJ5A 2AEMA 1GOAA 3CCRN 1N6QA 5E33A 4DU3A 3D1QA 5C2FA 2KL8A 4JI6J 3NCPA 2HZVA 3OTEA 3V2UC 1VBZA 1Q82O 5KG3A 4RCHA 3FNNA 3MEGB 5DM7L 4CJLA 5CHCB 4JD2B 3EYZA 2QMXA 3AAQA 1FWLA 4DV7F 2WVCA 4DR2J 5LT5A 2CNLB 3NDKA 2MXYA 3THPA 3I0SB 2HBQB 3QIPB 3ZNJ1 5LMUJ 3P5JA 1BLUA 3NL0A 3PR5B 1LWFB 3ZZ0A 4DDFA 3BUZB 2X7IA 3IG1B 5AQTA 5HL7Q 4W5OA 1SL1A 4DV2F 2ZHBA 3PEHA 1R7IA 4XDDA 4DTSA 3T1YK 2HFSA 5KFXA 3C95A 2CIMA 1XMOJ 3A3OB 3L09A 1ZBHA 4JI3F 2OFGX 2FSNA 2QSWA 3AVAA 3GJQB 5D0EA 2VGMA 3CDBA 3ENVA 5BRDA 5K5MA 2RU9A 1CVJA 4I6AA 5H1SV 1OMSA 1U26A 2F9TA 1D9DA 1Q5VA 2NR0A 2DNQA 5BN8A 4A8XA 4OI0A 3NGYA 4CGJA 4XPCA 4N8OA 3OL6A 4BRQA 3PYFA 2ZE2B 4Y65A 4CCHA 4HH0A 5T7LA 4URGA 2IC3B 4F8RA 2ZBQA 5AXLA 3FCWA 3WX4A 2MQPA 5AXKA 5I9EB 5KG4A 3TQEA 3QETA 3QNWB 2ILYA 3C6HA 4DS5A 3Q23A 2GAGC 3QEXA 3Q86A 5GAEP 3D67A 1JJ2R 4BVPA 5L1KA 2GHWA 3VMFB 3RRKA 1E6YA 4B3MF 4LF2A 5A0YB 4USJC 3CD7A 1DQ8A 2DGTA 5EWGA 3KJFB 2CFXA 4EP5A 3HI9A 4PG7A 1IBLK 1CULA 4J5OA 3TAMA 3GG0A 4Q7AA 2JNJA 2KB2A 4RNNA 4OYMA 4I67A 1PYTA 3MM7B 4ZDNA 3ZTPA 4QIGA 4CLZA 4AH9A 3SV4A 2K1RB 3KWIA 2XLJA 1YG0A 2VDIA 3C8YA 3AOCA 3LUYA 4P2SA 4KHPK 1KD1O 4QW8A 4A8YA 1HA1A 2AX0A 2XO6A 3T1YJ 3GWCA 1IQTA 2J6SA 4EO8A 2XTJP 1DQAA 1VQ7S 3THXB 2ZH7A 5KTQA 5HVGA 1P8ZA 2A6AA 2R8JA 2B6AB 3P39A 2E5HA 5BR8J 1FW6A 5SUHA 2BDPA 1CLQA 2OPPB 3N6LA 4LIRA 2FZKB 2FC8A 2MKIA 3DLLL 4ZCIA 3W5YA 2BV3A 3TJAA 1JXBA 1KS2A 3AVIA 4BHQA 4JLHA 4K43A 4P75A 2DNHA 2V63A 4EGLA 2RJZA 2OLWA 4I4BA 3A3PB 1CEZA 5AZIA 3ATUA 1NGJA 3A8JA 1Q9XA 4OHXA 1M5SA 2MKCA 2OD4A 4RW9B 1RQ0A 1RBLA 1YVNA 1W7WA 3AB2B 3PO5A 1RDDA 1TUGB 2V4JB 2N3OA 3N4WA 2NYIA 4DI6A 2LCWA 2GMLA 2ZDOA 1E6VB 3MEGA 3KLGB 1GXLA 1Q78A 1Y5NB 5JVHL 1VR6A 3CCMS 5JLFA 1UVKA 3H2UB 4AQYJ 4NRUA 3QINA 2HNDB 4LVOP 5HN0A 3UVJB 2Z1GA 3I0SA 3QIPA 2KQ2A 4ED8A 4UY85 2DJWA 3CCLN 5HSPA 4NEZA 1LWFA 4BC7A 5HAOA 1IR1A 3IG1A 1X60A 5B0GA 3GB0A 1UETA 1WC3A 4ILRA 1AA1B 4WIIA 3L9ZA 1FFGB 5B09A 1QQMA 4KHSA 3WBZA 3IAS9 1GK8A 4MT1A 3G8TA 2P51A 4DB3A 1QHAA 2KTQA 4CJFA 3H42A 1XBWA 4FVMA 4KT0C 3HOTA 2EFVA 2C2EA 1SAZA 3NF7A 4HVZA 2MQQA 4JI7F 2ZWHA 3OYBA 2AF6A 1F9EB 4FF1A 3S01A 2EFOA 3HHLA 2XS7A 3OYIA 4JI8J 2ASMA 2W4PA 2CAJA 3K5PA 4BE0A 1YJ9S 1T03B 4F0KA 2KYZA 2ZE2A 2J7KA 1ZM3A 1JNZB 1EWRA 3HBTA 1WSFA 2IC3A 4N56A 2QA2A 2KHCA 4ECQA 1SQEA 2V8PA 1UVIA 3BEGB 2HWTA 1S9GB 4XAKA 3KLEB 2BOPA 5LSLA 2JEFA 4LJMA 4PXEA 1PBUA 3HRGA 1VQ9S 2BACA 4RZRA 4MYUA 1KAZA 3IA0A 1QAYA 2GV1A 2E6MA 1Q4RA 4QW9A 3GG1A 2DEIA 3BSOA 2QWRA 3QICA 3ONQA 2DD8S 3RR7A 1U6ZA 2WC9A 2UXCF 3GIRA 5A0YA 1GT8A 4R0JA 2V50A 2QK9A 1T9VA 2VPWB 1RTJB 3W62A 4CEOA 4OV6A 5HVHA 5KPRA 1NM2A 2RE2A 4HTUA 1WSRA 1WOPA 4GKJF 4BWMA 3PW5A 4KREA 1KVBA 2DNOA 1S1VB 3N01A 3AY9A 1N5YB 5GIPA 4I64A 2IMOA 1FRHA 4CZIA 4ZJOA 2GC8A 2RIJA 2HVHA 1QLNA 1B9FA 1WSGA 1YJUA 3AD9C 2G2YA 3ZT3A 3I32A 3VQEA 1HJOA 1BUXA 5IQ6A 1BI4A 1QD1A 4TYBA 4KYZA 3GIKA 4WFAQ 1XWLA 5L38A 1RU1A 1W2BM 2MKJA 3THXA 1VJWA 1HJRA 2YX1A 2FBXA 2WUSA 2B6AA 1Q81O 4CZHA 3HSTB 2Z8QA 3HOSA 4IOXA 3NVMA 1MMNA 5AQIA 2OPPA 2CPYA 5LOQA 2HEKA 1F2HA 4KI6A 1JCGA 3PFOA 2M8DB 2WB4A 4QWBA 3CFPA 1VOMA 5GADP 5B0DA 5LXRA 3GJRB 4U7BA 1OH5A 1XQSC 3EO3A 4DV5K 1RE1B 2ATCB 5EWEA 4JK8A 3QGIA 2FLNA 2HVEA 4PKGA 4RW9A 4YUDA 2QM1A 3P96A 4LRFA 4DJBA 3CUNA 1HNXK 2YWFA 4JI0F 3MUVP 2Q0UA 2D0OA 4NYZA 2ZH5A 3MWTA 3QRPA 5AXNA 2HF3A 3IFEA 4DOZA 1Y5IB 3HHLD 2CWXA 2VOPA 1OH7A 1E6VA 3UFCX 3EE9A 1WSVA 3Q7BA 3KLGA 2CQCA 3D1HA 3NKYA 2CNNB 4ECYA 3VEWA 5FRMA 3CD5A 1Q16B 2HSEB 2I6WA 3KOAA 3MX5A 1XMQF 4H0VB 3KHHA 2BE7D 2RE1A 3C19A 1GLBG 3ZT4A 2LXIA 1U1RA 1Q95G 2DNYA 3MAHA 5EXWA 3MMJA 3J80Y 3N4QA 2F3JA 3LL3A 3NNAA 3HI0A 1KOOA 4OPJA 4OZ3A 3H5YA 1Q53A 1RFQA 2R7YA 1R0CB 5KFGA 4NXNJ 1QAIA 1Q86O 4DWIA 1YITS 4X66F 2JSXA 5GAGP 3BBFA 3SCLE 4TSXA 2BE2B 1I94K 3KDOA 4CJRA 3HD1A 1NHUA 2RDIA 2ZFHA 4RKUC 2XNRA 3O2IA 4WFXA 3S6EA 5A8KB 2DO4A 3L6QA 2RUSA 2DT9A 4FWOA 4RNOA 2RDDA 1S22A 3N9UC 3QT5A 4DV4F 3OR2B 1T03A 4C8LA 3CERA 2NQPA 1W0HA 4WU2A 2UUAJ 4MAKA 2YQ0A 2A6OA 4GV9A 4J2BA 1T02A 1DKGD 2BJ1A 3C15B 2YNHB 1LKZA 3HPOA 1YRUA 1JLGB 1S9GA 4I0WA 4X65K 3KLEA 5LMNK 3PKYA 1AFJA 3W63A 1T9TA 5KQ8A 2ZH2A 5KFSA 3F5TA 2X3DA 3PW0A 1DBDA 1WHXA 4H5WA 3S9HA 4OPAA 2J9DA 4TY9A 2QRRA 5JUMA 1BOTO 2JOQA 3O6QA 4KTZA 3T6BA 4DTPA 5C2GA 2BVZA 4GY2B 3IRWP 1SJRA 1W25A 2U1AA 2LQJA 3BYPA 4Q8FA 4CEBA 1S49A 3I56N 1RTJA 3O4NA 3QEWA 1YI2S 1ZOTA 4KTQA 2GW8A 1QSSA 3L4IA 4RWWA 2D5RA 4F3TA 2CPHA 2B8PA 2GAHC 3OYHA 4ISEA 5D15A 1S1VA 3QZ8A 3G71N 3QRQA 2Z1IA 1FNOA 4DFPA 1L3SA 3FGUA 3T69A 2Y0SD 3KFWX 1NPKA 4NX9A 5AJ3J 4A62A 1TMJA 3PUFA 4CRJA 4OZNA 4FWQA 4LFBF 5J1EA 3M2RB 3PRBA 1GH8A 1S72S 4BGAA 2W25A 1VSIA 4PHTX 4AFFA 1D8ZA 2FQQB 4OX9F 3A1YG 3SQOP 1MW7A 3KG0A 1URRA 3I31A 4FM2A 3JXOA 3HZ6A 4MFBA 3MMBB 4OKJA 1YJVA 2DVIA 3W0LA 5MLCQ 1DRZA 4JI1K 2CGLA 4B9NA 4FVUA 4DSKA 3VQBA 2IJNA 4DUYJ 3N4PA 4PG5A 1WI6A 1X5SA 4CHOA 4CWBA 3TYTA 3CYMA 1OIAA 4DSIA 2V51B 3S3OA 4MKVA 4USUA 5A2QO 1HBOB 1N34J 2CADA 4DR7K 4ETZA 4U7UK 4MIBA 2AYBA 1M1HA 2L48A 1H3DA 2UXBK 3RAQA 1S7HA 1KEKA 2YKOA 5GAHI 2WVFA 3RMBA 1NSQA 1S9EB 2MZRA 1APSA 1E3MA 4Q45A 4L6V3 2PGCA 3MAQA 4HUGA 3NEKA 2CPJA 1T3OA 5DZ6A 5LMNJ 3O3GA 4DL3A 2K06A 2IM1A 2ZH1A 3TR8A 1FXLA 4JV5K 2L3MA 2CPIA 2N7YA 5BXIA 2MPUA 1RBSA 4QS7A 4CERA 2C1EB 2QJ3A 2ZJRQ 3A8EA 2W4DA 1M5OC 4DV0J 9ATCB 3C66A 4I69A 3M30B 3M6XA 2M8HA 1I51B 3MEDB 2EXUA