2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
4ZPBA 2G8UA 2QE5A 5F8JA 3HPOA 3OYNA 2B6AB 2KQ2A 2QXFA 4O3OA 3I5BA 3L2RA 4M3TA 3QLHB 2AGPA 3TANA 1WN7A 3V1OA 2WOMB 1Z4UA 4IH6A 3U3YA 3NAEA 3C6TB 1BI4B 3WNHA 2VWKA 1U45A 4NLTA 3JSMB 1ZBIA 4MK8A 4J9NA 4ECZA 5DLGA 1S48A 1VSLA 1MMLA 1U4BA 4Q5VA 2Z1GA 3ISNC 1NK6A 4HUFA 1LW2B 1S9EA 2W9AA 2G8WA 4KKOB 1QUVA 4RW6B 1VSKA 1UWBA 3QIPA 3FRZA 2D5RA 1EXQA 1HYSB 2C28A 3E01A 5F8HA 3V6HA 1S9FA 1D8YA 2HNDA 4CJLA 5KT2A 2VG7A 2OZMA 3OYLA 4F2RA 4IG0A 4K4XA 3S3OA 4KB1A 3SI8A 3DLGB 5F8IA 3V1RA 2JEIA 1KVCA 4ZVEA 1BHLA 2C22A 5EUHA 4EO6A 5KFGA 1Q8IA 5I42A 3LWMA 3MECA 5KT7A 3MFIA 4OLBA 1IH7A 1XI1A 1KRPA 4PUOB 4KTZA 4RNHA 1S1WB 1FXXA 3UIQA 2FLPA 3ZSOA 1TL1A 3KLEA 4CJSA 1N4LA 3GIIA 4NCGA 1IKXB 2BGGA 4CHQA 1NJWA 4IH7A 2A1RA 4DU1A 1RDDA 1S0OA 1NKEA 3I5AA 2ATQA 4KB7A 2QK9A 5K14A 3TQ1A 1BQNA 1UOCA 1SH3A 4GMJB 4FZXC 2BQRA 1WSIA 1JLCB 2YHBA 1KHVA 3PJWA 2FVQA 5DQHA 3HO1A 1BCMA 2FVPA 1A5VA 1U49A 2R8JA 2ZD1A 3PV8A 4FJHA 1ZBHA 4LH5A 3V4IB 1SKRA 4QAGA 3V9UA 4ZPCA 4RUCA 4WYWA 1S97A 2R8GA 3IAYA 4ZVGA 4NYZA 4H54A 3LP2B 3AVIA 1BIZA 3RMDA 3HYFA 4IOBA 3BJYA 3VQ8A 2P1JA 3FFIB 4B9SA 4CJVA 2A1SA 2RN2A 5KFLA 4DL4A 1FKPA 5HBMA 4HCBA 3BGRA 1NK7A 3OVNA 1IKWA 4J2BA 3VA0A 2AJQA 3M8PA 4XIUA 1XR6A 3B6OA 4FW2A 4FLYA 1N5YA 4DG1B 2WRMA 4FJ5A 4ELUA 1VSHA 1JLEA 4NLOA 5J2MB 4H8KA 4NYNA 5KFKA 4CJ5A 4FBTA 2IM2A 5HROB 3NKYA 1JLQB 3DLKA 2BE2A 4LQ9A 1JX4A 3HP9A 2FBVA 1SL2A 1RT7B 2AQ4A 4PQUA 1D5AA 4IKFA 1BGXT 5SZTA 3I0SA 1W0HA 3FSIA 4ED2A 4OKJA 1CZBA 3NHGA 4HVJA 4CEBA 2C2EA 3F73A 3PO4A 1ITGA 1LWEA 2RDJA 3VN5A 3VQPA 2Z1JA 3KMSA 3QESA 3NE6A 2OPQB 2HHVA 4RG8A 2VG6B 4HHTA 4IFYB 1YVFA 4KE5A 1NKCA 5JUMA 5KG4A 1S9GB 4KO0A 4BWJA 1IKVA 3CG7A 1UA1A 3I0RB 5KFDA 2DPIA 3RR7A 4RW9B 4OPJA 5EWGA 4M94A 4MIAA 3CDWA 4R8UB 1SV5B 3KKSA 3PO5A 5KFXA 1HQEA 3ZSVA 3AA4A 4ZP6A 1C0MA 4DFPA 3QO9A 4J2AA 4KI6A 2O4GA 3TAEA 1VRTB 3U6FA 4RNMA 3RMAA 4K8XA 1LWCB 4EZ6A 3OY9A 3QYYA 1T8EA 1W9HA 3NH2A 3VQEA 1ZYQA 2R2UA 1TAQA 4CFDA 2ASDA 3V6DA 4E0DA 3TAMB 4E7KA 3EYZA 2FC0A 4LY7A 4K4UA 2IA6A 5KFCA 5KFTA 3MFHA 1N56A 2WOMA 4I9LA 4Z4CA 3SQ1A 4O3SA 3TABA 4HTUA 2UVVA 3DRSA 3NBPA 3JSMA 3G6YA 1HMVA 4AHRA 2UVRA 1CZ9A 1XHXA 4OPKA 5DG9A 4OVLA 2PYJA 2CJQA 1DTQA 1SUQA 2IDOA 3DRRB 3TR8A 3VQAA 1N6QB 1Q9XA 3L3VA 4E3SA 4CHZA 4ZP7A 2UUTA 5CY4A 1LW2A 4DTNA 5J2NA 2F96A 4KKOA 3PJXA 1RTJA 3AO4A 3OYCA 1UWBB 3QIPB 4DF8A 3BSNA 3LZIA 1HJRA 3E01B 1S6PA 2DPJA 3DLGA 1CLQA 4Z4GA 2HNDB 4JRPA 3H5SA 4B8AB 2VG7B 4NRUA 2WONA 3SYZA 3O3FA 1JKHA 4ELVA 4E7LA 4ED3A 1QE1A 3LANA 4FBUA 2AX0A 3H40A 1S1WA 3G86A 5DMRA 3DYAA 1EETB 5L1LA 3MECB 4Z4HA 4NLGA 3HVTB 4L8RB 1JLGA 1IKXA 4ZPDA 4CHOA 1TKTB 4RNFA 3PW4A 3KK3B 1TL1B 3KLEB 4IFVB 2G8VA 1NHVA 4NCGB 4FVMA 3LDSA 4Z4EA 2D7SA 1UAXA 5KFQA 2PYLA 5KFWA 3LP0A 3N6MA 2W8KA 4NLWA 5K14B 2V4RA 2IM3A 4CHPA 1BQNB 2XI3A 1JLCA 4ECUA 4DTRA 1O1WA 3N6LA 3SUQA 2XWYA 4URSA 3T5LA 2BDPA 3WNGA 4F3TA 2XY5A 4BDPA 3I8DA 4JUZA 2XC9A 2ZD1B 1B92A 3OLAA 1VK0A 1VSMA 3KK2A 4FJJA 1G15A 1TK0A 3FFIA 3TARA 4TYAA 1HARA 5F9NA 4ELTA 1QTMA 4WZMA 3H5UA 1EX4A 3BREA 4NRTA 4J9PA 1Z26A 4JS5A 3D28A 1WNEA 3C95A 4TYBA 3SCXA 4G3IA 5HRRA 2UUWA 2BRKA 4DL3A 1REVB 4DG1A 4I2PB 3KIOA 4CJRA 4FLWA 2QKKA 4CEEA 3L2UA 4RNOA 3PW0A 4WZQA 3KLGA 5HROA 3M9OB 4ZP8A 1JLQA 2FVCA 3H59A 1SL0A 3AVAA 5KFVA 4RU9A 3DLKB 3GQCA 3KNAA 3V9XA 3AVJA 2KTQA 4FJLA 4O3RA 1TQLA 2OYQA 1RNHA 1D9FA 3EPIA 1KFDA 2W42A 4FM0A 2VG6A 4IFYA 1KVAA 4URGA 5HP1A 3ZCMA 1LWEB 1S9GA 4IRCA 3OL6A 1LAWA 3PX6A 3SUNA 5KFOA 4W5OA 5KFZA 3K58A 1S1UB 3T19A 4OLAA 3PW7A 4B08A 4CJPA 2D3UA 1JIHA 4EBDA 4MH8A 4RW9A 3OYHA 4DL2A 4RW4B 2HHWA 1KFSA 2JC0A 5KI6A 3ZT2A 4MK7A 1SH2A 5KFJA 1J54A 3CVKA 4OGEA 1L5UA 4ED1A 2X78A 5JS2A 1VRTA 4ED7A 1HQEB 4CEFA 2DFEA 4FLZA 4RNNA 3QO9B 3L2VA 4O0JA 3SUPA 3PW5A 3TAMA 1S5JA 3AVBA 3O4QA 2FBXA 3HK2A 5C42B 2O5DA 3DMJB 2C2DA 4CJWA 1JL2A 3V6DB 3HL8A 3KLHA 4DTMA 4Q8EA 2XHBA 4AHSA 2W9BA 3QEXA 3SPZA 5F8GA 3T3FA 1S49A 2HHUA 2B5JA 3IS9A 1ZBLA 4ECSA 3RB0A 3VA3A 1L3VA 4CERA 3N6NA 4KAZA 4Y2AA 4PWDA 5KG5A 4CK2A 4DTPA 4KHUA 3T5KA 3HSTB 5I3UA 1C1AA 3LWLA 2OPPA 3DRSB 3NBPB 4O44A 4KAIA 4NLSA 5KFMA 3DRRA 2YHAA 1HMVB 3NDKA 4Y2CA 2E9RX 1N6QA 4C8LA 3MR6A 3PUFA 5KFEA 4QWAA 1NNDA 3C94A 3NCIA 1DTQB 1SUQB 4DQPA 3T5JA 4Z4FA 2R7YA 4CFBA 4W5QA 4ED0A 5L1JA 1ZTWA 1T05B 3JYTB 3FQKA 4RUAA 3K5OA 5J2NB 2D0AA 1J9AA 3AV9A 3O4NA 1JL1A 1RTJB 1NOZA 3CDUA 3HHKA 4B8CA 1RBRA 4KFBA 4N47A 3SV3A 3HJFA 1RTIA 2D0BA 2YKMB 3CJ0A 1GOAA 3BQ2A 4ECVA 4LSNB 4LD0A 2JGUA 1FKOA 2XY6A 1S6PB 3H5YA 3OS0A 4QWDA 3D0PA 4DFMA 4FLUA 3K59A 2WONB 3CFOA 3MF5A 2OA8A 4K4ZA 1EETA 1JKHB 3PX0A 1JXLA 4DFKA 3HVTA 4CGJA 1RBSA 1TKTA 1QE1B 1K1SA 3F9KA 3PW2A 3MXIA 1R0AA 3EZ5A 3KK3A 4FS2A 3ZT4A 3DYAB 4IFVA 1JLGB 3MEEA 5DLFA 3SV4A 4FJNA 3THVA 3G10A 3CO9A 1C0UA 5KG2A 1Z25A 4N41A 4O4GA 4C8OA 1JXBA 3DRPB 5KG1A 3LP0B 3NFAA 1LV5A 3OYDA 1TV6B 3OHAA 1T94A 4EZ9A 2RKIA 4BE1A 1WSFA 3C6UB 1ASWA 1S6QA 1RYSA 3Q8RB 3DLRA 4OJRA 4B9MA 4O3NA 2FVRA 5KRTA 5DQIA 1RT2B 1K1QA 3SQ0A 3H5XA 4E7JA 3KK2B 1KSPA 1TGOA 1WLJA 3CJ2A 4WE1A 2OPSB 2D3ZA 1HRHA 1J5OB 4CGGA 1X9SA 3UR0A 3OL8A 4CK3A 1BCOA 1NJZA 1REVA 2IAJB 4I2PA 5C25B 5KT5A 3MTKA 1I3AA 1TK8A 3LAKA 2G8HA 4CGHA 5DGBA 2R8IA 1X1PA 4CHNA 2GIRA 1YT3A 3DOLA 2AU0A 3KLGB 4RZRA 5L1IA 1C2PA 2P5GA 4O55A 1ZTTA 5KFAA 4Q44A 2JEFA 3V9ZA 3AVMA 4HCCA 4LSLA 2FJVA 2YNFB 4KSEB 4ECRA 5KG7A 2EHGA 2ALZA 4CEOA 3RB3A 3AVFA 2UVWA 4E7HA 4WXWA 2B4JA 3RB4A 4DTOA 4FJMA 2DTUA 3BQ1A 3ITHA 2FJXA 3CDEA 4FK0A 4KTQA 5DG7A 1S1UA 2R2RA 5HP1B 3IRXA 3Q8SB 2ILZA 4CF0A 3HT3A 4RW4A 2I1RA 5FRMA 3D5MA 3SPYA 3KHHA 4HUEA 5T14A 4ECYA 4QWBA 5EU7A 4CF9A 4FCYA 1S10A 1BQMA 4CJKA 3RTVA 5KT4A 3DLEA 5FROA 4EP4A 5HRNA 5DGAA 4NLYA 4MIBA 3H08A 2JLEA 3V9WA 4CIGA 3G0ZA 3S3NA 1IKYA 3VQCA 4E1NA 2FLNA 4W5NA 2R8HA 2YNIA 1Y97A 3FQLA 4ZP9A 3OYMA 3CJ3A 2YKNA 4G1QA 2JC1A 1RT1A 4NCBA 4GVMA 3SI6A 3V1QA 4CF8A 4IH5A 2HVIA 2HNYB 3IGVA 3LPUA 4DEZA 4BDYA 5C42A 1RAJA 1U48A 3DMJA 3DDKA 3NL0A 4DSIA 5HLFA 4GC7A 2JEGA 2IS3A 4YR3A 3ZT1A 1D1UA 3HVRA 1S1XA 3OYJA 3KLHB 3LP3A 1BL3A 4NLRA 4DQRA 2W9BB 3VQ5A 4FZZA 5KRSA 1L3TA 2B5JB 3IS9B 4ICLB 4J9OA 2KFZA 3HKWA 1HNIB 3RR8A 3HVAA 4PWDB 5J2PA 1CSJA 4FJ7A 4FLTA 2WB4A 5I3UB 2OPPB 3BDPA 4M42A 1XR5A 4O44B 1JLAA 3OYEA 4TQRA 3SZ2A 1JLFA 4QPXA 3KLVA 4ZPAA 4DSJA 3V6JA 3V81A 3QEPA 1T05A 3JYTA 3KJVA 4KTWA 4M3WA 4DMNA 3MR5A 3V9SA 1YVUA 2XO7A 3BQ0A 2G8IA 1U09A 2HHXA 3IGNA 3O3HA 4CE9A 3MR2A 4B3OB 4M41A 4KREA 4KB0A 2YKMA 4DTSA 4Y34A 4Q8FA 4LSNA 4RW8A 3K2PA 3VQ7A 1B9DA 1RYRA 1KLMB 4KFBB 1QHTA 1RTIB 2HWHA 4AHCA 4ZHRA 1FKOB 1B9FA 1IO2A 4CHYA 1RILA 4N56A 3MEDA 3NF7A 3LZJA 3AA5X 5J1EA 4YR0A 1VSDA 2WTFA 4YP3A 5KGWA 1IM4A 3VQ4A 4ZVHA 1MU2A 4CEAA 3PVXA 3OJSA 4AHTA 3KLFB 1GX6A 3OYKA 1KHWA 3O3GA 3SNNA 2OZSA 4E1MA 3K57A 3M8QA 3ISND 1R0AB 1TKXA 4EYHB 3RBEA 4F4KA 1KLNA 2Z1HA 3MEEB 1DTTA 2ITGA 4H4OB 5KT6A 3KKRA 2QKBA 4J9SA 1C0UB 3DRPA 3DOKB 4KPYA 4O4GB 4C8NA 4DSKA 2XGQA 4AILC 2GC8A 2D0CA 1TV6A 3NF6A 1NK9A 3CFRA 1C6VA 1KVBA 3C6UA 4CIFA 4N76A 4Y1CA 1WNSA 2RKIB 4EEYA 3LP1B 5KTQA 1RDRA 1S0NA 1S6QB 4CJQA 4O3PA 1S4FA 4FK4A 1RT2A 3IG1A 3UDLA 4DL6A 4ECWA 4K4SA 2BQUA 5DK5A 4IRKA 5F9LA 4E19A 4FLXA 2OPSA 4DTUA 1XC9A 3EY1A 3TAPA 4PA1A 4J9RA 2HAIA 1J5OA 4DQSA 4ECQA 3QEVA 4O5BA 2IC3A 2R2TA 4DWIA 1TVRB 4EO8A 4WE1B 4CJTA 4CFAA 4HKQA 5FDLB 3HVWA 2IAJA 4F4YA 5C25A 1RCHA 3OYIA 5F8MA 4K4TA 4KHYA 4IQXA 4IR9A 5T7BA 4NLVA 4IKAA 4FXDA 3ZSXA 3BR9A 1QSLA 4YFUA 3NMAA 4CK1A 3NAHA 3LAMA 2IM0A 4FS1A 4IBNA 4CEQA 1RT3B 4CJ3A 1VSFA 4OL8A 3OLBA 3RBDA 3DOLB 2XY8A 2IM1A 4EBEA 4ID5B 2ZE2A 2YNFA 1NJYA 3OL9A 1TKZB 4DSLA 4W5RA 3SUOA 4LSLB 3DI6B 4CJ4A 1NK5A 4B9LA 3NF9A 3P5JA 4EBCA 4I9QA 3HXMA 4NLUA 4WFZA 5EDWA 4C8MA 1L3UA 4J9KA 4ZMMA 4NLPA 2RPIA 3RAQA 4KHQA 4URQU 3ITHB 3BSCA 3ZT0A 1HNVA 3E51A 4AH9A 4KBIA 2W7OA 4DSEA 4U7CA 3ZT3A 4KHWA 4M3ZA 3IRXB 4XPEA 3AO5A 4QW9A 4MK9A 4DU3A 5F8LA 1ZBFA 3L2WA 2YNGA 1EKEA 1RA6A 4CGFA 3OL7A 1WSJA 3ALYA 3VQQA 1BISA 3AVCA 4DTXA 4QWCA 3AO2A 1BQMB 2I5JB 5KG0A 3QZ7A 4BWMA 1K6YA 3DLEB 4OGCA 3UPFA 3TVKA 4KHMA 4W5TA 3I5CA 1IKYB 2FJWA 3SFUA 3S3MA 4ZVFA 3QIOA 3K5NA 3KHGA 2HNYA 2YNIB 3KK1B 4DTJA 2IBKA 1C1BB 5KFFA 2YKNB 4G1QB 2AGOA 4IDKB 4CFCA 1RT1B 1NK4A 1SH0A 3KTQA 5D3GB 2W7PA 2ATLA 5KFBA 5KG3A 5EWFA 1RDBA 4CGDA 3QNNA 5HLFB 3AVHA 4CEZA 3PR4A 1GOBA 3ZSYA 2RF2A 2C2RA 4F4XA 4JLHA 1S1XB 4BDZA 4ICLA 4KHRA 4CIEA 3QERA 1HNIA 2O4IA 4RW7A 3NH0A 2F8EX 4E89A 4CF1A 4TY8A 2IJNA 2XCAA 4CJEA 2AX1A 1W25A 5J2PB 4QCLA 4CCHA 3QETA 1IG9A 2D41A 4DS5A 4B9UA 1JLAB 2ZQBA 1JLFB 2XGPA 4ZTFA 3KD1E 3V81B 4I7FB 3AVKA 4I2QA 4JV0A 3G6VA 4UQGA 4FM1A 3KJVB 2E4LA 3CQ8A 1SKWA 2BR0A 1EP4A 4B3OA 3M9NB 4CJUA 2F8TA 2WCXA 4YMEA 2YV0X 3RRGA 1JLBA 4CF2A 3T5HA 1KLMA 2IJFA 1RA7A 1BIUA 4ED6A 1YTUA 4RW8B 1NKBA 5JS1A 2OPRA 1D9DA 4Z4IA 3KLIA 4HYKA 3K5LA 4ZHRB 5KFHA 1RBUA 3RAXA 3VQ9A 4HUGA 3QEIA 3SQ4A 3LALA 3M9MB 3MEDB 3KLFA 4NLQA 3H98A 5J1EB 3SQ2A 5JXSA 2IGIA 5CYQA 1MU2B 2G8FA 3MEGB 2UVUA 1I6JA 4KV8B 4MKBA 2NUBA 1T3NA 3M8QB 2GV9A 4X2BA 4H4OA 2F8SA 3DOKA 2J6SA 1TKXB 1C1CB 4J9QA 4FM2A 3AVLA 1DTTB 4IG3A 4U6PA 5KFSA 1UA0A 1RTHB 4TY9A 5EWEA 1LWFA 4CJFA 2KFNA 4DLEA 3GV7B 2ASLA 3LP1A 4JV2A 3ICLA 3OYGA 1DLOB 1VRUB 2ZKUA 2XRIA 1ZETA 3GYNA 2RDIA 4M3RA 1QS4A 3P83D 4EP5A 5L9XA 2IMWP 3VQBA 1T03A 4DFJA 3IG1B 5SWMA 2BRLA 4O3QA 2XCPA 1VSJA 1SL1A 2BANB 1NHUA 5KFUA 1S1TA 1TVRA 3ASMA 4DL7A 5FDLA 3NGZA 3QNOA 4J2DA 3CYMA 3MXMA 1S0MA 2IC3B 2VG5A 2YNHA 3RWUA 3S9HA 2W9CA 3BSOA 1RT6B 3AVNA 4YR2A 4QW8A 1LAVA 3NGIA 3QGIA 1D0EA 3OYBA 3SJJA 3UQSA 1TL3A 4JS4A 3PR5B 3OYFA 1RT3A 5DG8A 3OJUA 4WYLA 3CIZA 4M3XA 3OS2A 3G6XA 4YNQA 1RBTA 3CJ5A 4MQ3A 4M95A 4ID5A 2HW3A 4K8ZA 1TKZA 2XI2A 3B6PA 2PZSA 1RTDB 3DI6A 3NH1A 2ZE2B 4ID1A 5HRSA 3PY8A 2KZMA 2V4QA 2PY5A 2EC0A 3DM2B 1VSIA 2JEJA 2OH2A 3GIMA 4OKKA 2HNZA 1RT5A 3OYAA 1N48A 1NK0A 5C24A 3L3UA 5J2QA 1S1VA 3QGGA 4FK2A 3PX4A 4FJGA 1LW0A 3Q8QB 2X6NA 1HQUA 1NOYA 2DFFA 1WAJA 4F2SA 1HPZA 2IOCA 3TAFA 2WK4A 2CKWA 1HNVB 3QIDA 4BACA 4BE0A 5KFRA 1WAFA 4ED8A 1J53A 4NYFA 1SKSA 4FJIA 2I5JA 2YNGB 3EZUA 4H4MA 1FK9A 4O4RA 4EYIB 2Q3SA 4Q45A 4DU4A 2V9WA 3KHRA 3L2QA 1C0TA 3GIKA 5KGXA 4Y1DA 4FYDA 3KK1A 1U04A 1C1BA 1QSYA 4IDKA 4R5PA 2DY4A 3A2FA 1ZBUA 4CGIA 5CYMA 4MFBB 5D3GA 3Q8PB 2FVSA 3P1GA 3ZSZA 3CM6A 4TQSA 4CEDA 4PY5A 3MXJA 3AVGA 1YTAA 4MKAA 5KFPA 2KW4A 4Q0BB 4QWEA 3HP6A 1KCFA 2FBYA 2V0NA 4DSFA 3EPGA 3PZPA 4E7IA 2HMIA 2RF2B 5FRNA 4F4WA 5KG6A 1QQCA 1WSHA 1RT4A 1QSSA 2R8KA 4CESA 3TAQA 1RDCA 4RW7B 2B6AA 3VQSA 4Z0UA 2GUIA 4F50A 3QLHA 4J9LA 4TY8B 3DLBA 2E6LA 2ETJA 2AGQA 2WHOA 1XHZA 3KHLA 3C6TA 1BI4A 3WNFA 4I7FA 4DQQA 1WSGA 4FJXA 3QEWA 3WNEA 4Q43A 4AHUA 3HPGA 4I2QB 3MAQA 1VSEA 2HVHA 2E9ZA 4ECXA 3CFPA 1TKDA 1EP4B 3FDSA 2DFHA 4M3YA 3DLHA 4R0EA 1JLBB 2QV6A 1HYZA 2GIQA 4RW6A 4XPCA 2E6MA 3OS1A 4O0IA 1HYSA 4KRFA 2OPRB 1S9EB 3RMBA 3KLIB 1KTQA 3M8RA 2Z1IA 3NGDA 3TWHA 3AA3A 3L8BA 1NK8A 1A5XA 3GV5B 1RDAA 3OSNA 3MEGA 4LQ3A 1GOCA 4KV8A 4IG0B 1QAIA 5CYQB 3H2LA 5HRPA 2HHQA 1C1CA 2AWZA 5DQGA 5E41A 2FBTA 4B9NA 2HHTA 1XWLA 3KMQA 2LSNA 3D45A 4PUOA 3IN5A 3RB6A 5KFIA 1RTHA 4QOZB 4FLVA 4KI4A 5I42B 4J2EA 4JV1A 4K4WA 4IG3B 1CXQA 3QZ8A 1DLOA 1VRUA 4GW6A 2EX3A 1LWFB 2P51A 4WFXA 1GX5A 5KFYA 4ECTA 1X9MA 5C5JA 1RBVA 4BE2A 4IR1A 1TK5A 2VA2A 4AHVA 4FJKA 1T03B 2BANA 1NJXA 4J9MA 1X9WA 2J6UA 2HHSA 3AO1A 1S1TB 4NCAA 3V4IA 3GV8B 1RT6A 3ZSQA 4K4VA 2Y1JA 2X6SA 1HYVA 3LP2A 2VG5B 2YNHB 2X74A 4Y3CA 2W9CB 3NAIA 5F8NA 4JRQA 4WXOA 3AO3A 1TL3B 1I39A 4NZ0A 4GC6A 2W8LA 4WFYA 4OKEA 2G8KA 1FKPB 5HBMB 4CECA 4B9TA 3BGRB 3H4BA 1RTDA 1IKWB 1Q9YA 1RT4B 4FJ9A 3M8PB 3DM2A 4F3OA 5J2MA 3QGHA 2Y1IA 4B9VA 2P5OA 1TAUA 1N5YB 3T1AA 1T7PA 2E9TA 2VWJA 4FZYA 1JLEB 3U3GA 4DF4A 4F4ZA 3OHBA 2HNZB 1RT5B 1A5WA 1RT7A 5C24B 2HWIA 5J2QB 1S1VB 2XY7A 1LW0B 2BE2B 3KOAA 1HQUB 2FLLA 5CZ2A 4DLGA 3RMCA 4PQUB 3SFGA 3MR3A 4K50A 4YQWA 1HPZB 1F21A 3TI0A 3I0SB 4DS4A 3OSPA 1ASVA 5CZ1A 4C8KA 4KHSA 3AA2A 1XR7A 1U47A 3GILA 2OPQA 4KHNA 4NLXA 3K5MA 3CJ4A 2BQ3A 4DL5A 3VQDA 2R2SA 4FW1A 1OS5A 4TSXA 2B43A 4N5SA 4LH4A 3NF8A 4K4YA 3VQ6A 4TN2A 3NGYA 4H4MB 1FK9B 1L3SA 3I0RA 4XO0A 3M8SA 2VA3A 4KO0B 3LPTA 1IKVB 4M45A 5KFNA 2GBZA 1C0TB 3KD5E 4F8RA 4R8UA 1ASUA 1SV5A 1TP7A 4MFBA 3ZSRA 4R5PB 4TLRA 1QAJA 5L1KA 2HB5A 1CXUA 5CYMB 3HPHA 4ZTJA 5KT3A 2ASJA 4Q0BA 4IRDA 3V6KA 1LWCA 1WSEA 3RRHA 3HM9A 4FJ8A 3QINA 1JXEA 3ULDA 2J6TA 3TAGA 4NLDA 2KZZA 2ILYA 3GIJA 4DQIA 4M3UA 3CM5A 3CWJA 3ZSWA 2HMIB 3PHEA 3H4DA 3BSAA 4TXSA
chains in the Genus database with same CATH superfamily
1SI9A 4JI4J 3HPOA 2QA4S 2Q43A 1DQ9A 4M3TA 3D1OA 4KH1B 2ADBA 4I6YA 4FPBA 2RAQA 4PXDA 3V1OA 2WOMB 4JI4K 1Y11A 3SK3A 1UCNA 3C6TB 1BI4B 2LU2A 4LR9A 4Z37A 5GAGI 4NLTA 3NOCA 3FMBA 1T11A 2A6MA 2HSEB 4DCOB 1OMSA 4IOAL 1OIAA 4G1IA 3VGMA 3DHXA 5AFUH 3QGPA 1MMLA 4OI4A 1LCUA 4RL1A 4Q5VA 2CIMA 2BJ1A 1NK6A 4JOUA 1Q1KA 1Q86O 4WCEL 2V8DA 4KKOB 3W63A 4BC9A 4RW6B 2K2PA 2D5RA 2C28A 4BREA 5FD1A 1GK8A 2DNOA 1D8YA 5D4PA 5H1SQ 4K4XA 4IO9L 3SI8A 4LR7A 4CZJA 3HOSA 1WHVA 1RCXB 5BPLA 2RS8A 3HHNB 3UCZP 1CQNA 1OYDA 2HGLA 4WP3A 3V5RA 1FRXA 4M7XA 4OLBA 3WXMB 1YHQS 1XI1A 4PUOB 3UIQA 1SZ2A 4CJSA 1N4LA 4M5GA 4PKIA 1PYTA 4X66J 4IH7A 2A1RA 1U0HA 1UFWA 1XJWB 1S0OA 1NKEA 1NRKA 4CWBA 5I9EB 1FRIA 4DHVA 2ABYA 3SMSA 3W5YA 3D3CJ 1ZBTA 1UOCA 2ZUGA 1V4SA 2WVCA 4OX8A 3THYB 4XAKA 2DR7A 1WSIA 4H03B 1IBLJ 2V6AA 5K9FA 1JLCB 1BD6A 1RWUA 2FVQA 1IBMF 1VAZA 1BCMA 5IQQA 4PZVA 4CYUA 5DM7Q 5ETTA 1DFDA 1U49A 4I6MA 2ZD1A 1IBLK 2M2BA 1ZBHA 2C1EB 3OD2A 1K47A 2EBGA 4F3QA 4WIQA 3S1TA 4IOCQ 4BRKA 4NYZA 1DY3A 2MY8A 3HYFA 2CQ0A 2RN2A 4DL4A 1FKPA 2OTJN 2KFYA 1H3DA 2ROPA 2B56A 2ZBIA 3ID8A 1NK7A 3J7YP 4RPFA 4J2BA 1KDNA 5M1FA 5LT5A 2FZGB 4FW2A 1TMJA 3HFKA 4FLYA 2HYIB 4FNIA 1RWOB 4NYNA 4HI2A 2V34A 2QC3A 1X31C 2CVIA 5LOQA 4JV5F 3NKYA 4L3KA 1JLQB 5LMNJ 4LQ9A 3HP9A 2GX8A 3A8YA 1RB0A 1RT7B 2AQ4A 3UN3A 1D5AA 4IKFA 3DDNA 3UO0A 1J27A 2RQ4A 5LMNK 3ZETA 1HD0A 4ED2A 2XM3A 2W25A 2C2EA 1GLLO 2LECA 3QBCA 2KHOA 1LWEA 4B3SF 3VQPA 2CQPA 3NE6A 5T7LA 2E2QA 1NB7A 1S5ZA 4BC3A 1YVFA 1NKCA 5JUMA 5KG4A 4JD2B 1IKVA 3CG7A 1FA0A 5HN0A 3RR7A 3BYRA 4OPJA 2IVMA 2NLWA 4M94A 2XNRA 4R8UB 2XNQA 3ULEA 1UJ5A 3PO5A 5BN9A 3VGLA 1WEXA 4P74A 3ZSVA 2QXLA 1LFPA 2NYIA 2ZH2A 3AA4A 1YI2N 4ZP6A 4J2AA 4KI6A 2OD4A 5C12A 5AFUA 1D4XA 4NWBA 2W4CA 2DNYA 2LQJA 1W9HA 2WW4A 4CFDA 3HFZB 2ASDA 3V6DA 1FJ7A 4E0DA 1DQ8A 3EYZA 4YHHJ 3MTJA 1UZHA 2MHEA 3NNHA 4LY7A 4K4UA 3R1LA 3AB4B 3BM7A 3MFHA 2OI2A 2C2NA 1F5AA 4FWMA 2UVVA 1H72C 3UB5A 4MJKA 2UUBF 4PR6A 4LIRA 3ISZA 3ILOA 4HEA9 1P1LA 1XHXA 1SUQA 1CZAN 3DRRB 3TR8A 4L75A 4JI8J 4OI2A 1KEKA 2DBBA 2Y8YA 3QQCD 1OYEA 4UUXA 4JI8K 3LDOA 2FB0A 3OBIA 5ETOA 5IWAK 1VBKA 1VQ4N 3BSNA 3Q24A 4OYAA 2R7SA 4Y6IA 2QFJA 3L9ZA 3DLGA 3CERA 2BUPA 4EUVA 4PG7A 1OH5A 3CB4A 3A1YG 3THXA 2VH7A 1WTFA 2RUSA 4ELVA 2CQ2A 1WOQA 4E7LA 1QE1A 1IR2A 2AX0A 3H40A 3G86A 4NLGA 2HQ3A 4L8RB 3FZ2A 1IKXA 4ZPDA 4CHOA 3R6LB 5I3PA 3P31A 2J0QD 4RNFA 2ZBRA 3OVBA 2G8VA 1NHVA 2PGCA 4AE5A 4OI3A 1NSAA 3CMEN 1CJKB 5K20B 4Z4EA 3BN7A 2HOEA 1U0HB 2D7SA 1UAXA 5KFQA 1SJ1A 1FRLA 4AF1A 1A7GE 3N6MA 3SXLA 5HMZA 4CHPA 5DZ6A 2YQ3A 2XB2D 4W4MA 1VJQA 4NXNF 4DR2F 3P8BB 8ATCB 3CI5A 3KJNB 2PA8D 1T3OA 3R1HA 4YB7A 4URSA 3POTA 1QQMA 3WNGA 4CYUB 2XY5A 2VF3A 1IQZA 2DGXA 2ZD1B 4I6MB 1B92A 3OLAA 1VSMA 1SJFA 1W2BR 4K8RA 4USUA 1G15A 2YX1A 5F9NA 1MROB 4ELTA 4WZMA 3PIPL 4J9PA 3PJ9A 1WSRA 5HMXA 3D28A 3D4JA 1Q4RA 4TYBA 3G87A 1BC6A 4QJVA 2DGWA 3KIOA 4CJRA 3W66A 1N5TA 4RNOA 2E5LJ 4CO4A 4WZQA 3KLGA 2MXYA 2I2YA 1E4GT 2QYGA 3J81Y 3CC7N 3AHPA 1KC8O 2E5LK 1VISA 4ALZA 3H42A 1WHYA 1VC6A 2OHDA 5AQXA 4WPAA 2LXFA 3CCRN 1VMBA 5JICA 1RNHA 4LR8A 3EPIA 1KFDA 5EY4A 2NPFA 4LF7F 4U8VA 2VG6A 1YDLA 2V69A 1LWEB 1S9GA 2MLYA 3C46A 3HOTA 3G96A 1LAWA 5T7LB 3SUNA 5KFZA 2XMVA 4M5LA 3PW7A 2ZJRQ 3K7RA 2GEMA 3OYHA 4ZCMA 2GUPA 3CO0P 2HHWA 2YPYA 3J7YI 2E8AA 2QSFA 2E5IA 2RH3A 1J6ZA 1RBAA 2XLIA 3QWUA 3ZX2A 1N5QA 4YDXA 2F8MA 3PHTA 3GLJA 1VS3A 2BKNA 3N4WA 4OX6A 3TX8A 2EW9A 3RGIA 1WTBA 4JK9A 3O4QA 3F9MA 3ZEUA 4WU2A 1N8RO 2VC1A 3V6DB 3GU0A 4KJIA 3OR1A 2HQGA 4GV3A 2GMLA 3KK7A 4AHSA 2W9BA 3QEXA 4GMKA 3CPEA 1B99A 1S49A 2HHUA 1V4TA 1ZBLA 1L3VA 1F6TA 3GDQA 5KPTA 2CZ4A 4Y2AA 2R7TA 5GAEU 2CVEA 2CQ4A 2VQEF 4E2FB 3T5KA 1XMQF 5I3UA 2H5IB 5JMVA 2OGUA 3CETA 2EBEA 5KFMA 3MXHP 2YHAA 4DR3F 4Y2CA 1N6QA 3G82A 3W9HA 1SUQB 2LQ9A 1KQSR 1VQOS 2VWBA 1KS2A 2DY9A 3FNNA 4FO0A 1HWUA 1EAYC 3K5OA 1WJ9A 2GWKA 1Q82O 3L4BC 3AV9A 4I1TA 1B70B 1DKGD 2ITMA 2YCHA 4N47A 3SV3A 1R0CB 2YKMB 3CJ0A 5D4LA 4H0PA 3W8GA 3AD8C 3D9BA 4CLKA 2Z2MA 1T6DA 3D0PA 4CNZA 2F4VJ 4FLUA 1DZ5A 3CFOA 3THXB 2OA8A 1FDAA 1IUJA 3K0JA 3R3LA 3PX0A 3AJ2A 2GWJA 2HFZA 1RBSA 1FDDA 2F4VK 3EN9A 1QE1B 4GKJK 2DCUB 3IMQJ 3BO3A 3PW2A 1R0AA 3W60A 4WFBQ 4C8ZA 2GGPA 2O67A 3OXFA 3MEEA 2RB7A 5L9NA 2LMIA 1H0HB 4FJNA 2W2QP 3GFHA 1C0UA 5KG2A 4N41A 4E8UA 2CNNB 2IVPA 4OLPA 3NFAA 2KKHA 3VWSA 3OYDA 1TV6B 3G9CA 1NDCA 3MAHA 2GELA 4BE1A 4EHTA 4CZHA 1ASWA 3UD3P 3CJCA 2XZWA 1UEUA 3Q8RB 4OJRA 3ZTQA 4O3NA 1K1QA 2ZWHA 3ILLA 3CJ2A 2OPSB 1F9FA 2DY1A 4AT1B 4CGGA 4CRJA 2NXJA 2K1RA 4BRLA 1QAYA 1REVA 4H0VB 5KT5A 1XK8A 2YQ1A 1FX2A 3S41A 2IRXA 5AXLA 4NXMJ 1I3AA 1TK8A 3G71N 4JK7A 4CO5A 2V2ZA 3A8JA 3EXYA 1HBOA 3FR0A 2AYBA 4KGZB 4A2AA 4OZLA 4NXMK 3KLGB 1HW8A 4WJBA 3A5NC 2COLA 1RAGB 1DQAA 5GAGU 2NXEA 5L1IA 4O8UA 1C2PA 2P5GA 4WP8A 2QA2A 1VQPN 3CF5Q 1RLCL 3O9QA 5CH7B 1I1GA 3AQPA 1YWXA 2OAUA 2KXFA 3BQ1A 2P9IA 4BGBA 2FJXA 2FHJD 3MOJB 3MDFA 2DITA 2MQMA 4ZVPB 1S1UA 1KTVA 1T0TV 2PFFB 5A6PA 1UEKA 3MPUB 3HT3A 2I1RA 1E6VB 3PTWA 3SPYA 5T14A 2FXUA 4ECYA 1S10A 2HBQB 3VAFA 5FROA 5DGAA 4NLYA 1Q18A 3H08A 3FK4A 4EHUA 4W5NA 3T9ZA 2MKJA 4ZP9A 5AQTA 3CJ3A 2YKNA 2CJ9A 4ES2A 4LF9J 2NXCA 4CF8A 4AM6A 3DXBA 4P72A 3GYXB 2MKSA 3WX4A 4BDYA 5C42A 2AHOB 3EEQA 4LF9K 3PLAA 4DSIA 1KBRA 2VGNA 2JEGA 3MK6A 4YR3A 5A6WA 2HS0A 3OR1B 4AL7A 2VCPA 2ZWOA 1NPKA 5CQGA 2W9BB 3QFPA 1PJ5A 3CPWR 3BF4A 4B1VA 3O5TB 2KKZA 2KFZA 2QA1A 3RR8A 1HNIB 5J2PA 2IDLA 4PCQA 5HSPA 1S22A 4FLTA 2WB4A 2OTJS 3O9SA 5I3UB 3MMBB 2CWKA 5EOYA 4M42A 1JLAA 3OYEA 4CLUA 1Y4ZB 1JLFA 3A8IA 2PEHA 5BYRA 3G82B 1WI8A 5HVGA 1T05A 4DN9A 4QR2A 2OD6A 2UXBF 4DMNA 3V9SA 4PQAA 1YVUA 3RW6A 3BQ0A 1UW9A 1NDKA 2MZJA 3IGNA 2E2PA 1AT1B 1QD1A 3SQGA 3VQ7A 4CZIA 1RYRA 1QHTA 5EHHA 2DK2A 3W7BA 4JKCA 4ZHRA 1J2VA 6AT1B 1S57A 1TELA 2HRUA 2V67A 4YDDB 4HH1A 3DJCA 2RJZA 3HFVA 4TNOA 3C65A 1VSDA 4FVUA 3GG0A 5KGWA 4DJBA 4UY85 3OJSA 4R0JA 3SNNA 1KHWA 3O3GA 2OZSA 4E1MA 2ASYA 3M8QA 3ISND 1R0AB 1ZM9A 1TKXA 3QB0A 4V19S 3G8SA 2Z1HA 3MEEB 1F9HA 2B8PA 2BOPA 3KKRA 5KT6A 1C0UB 2VFTA 1KAZA 2MQ8A 2X1AA 3NF6A 2HF3A 4DV2J 4J7CA 1C6VA 5HL7L 1FEEA 1YI2S 2WSFC 1GLCG 1UPMB 1KVBA 4OI0A 1JNRB 3IKMA 4N76A 3Q7BA 2LEAA 3LP1B 4DV2K 1RDRA 1H2UX 1S0NA 3UDLA 2ZH9A 1OY8A 2RQCA 4BY9C 4WFAL 3AJ1A 3EY1A 1CBKA 3CCSN 2I7NA 4PA1A 4JBCA 1VQLS 3QEVA 1WELA 2R2TA 3VTIA 4KHPJ 1YJ7A 3BGOP 4EO8A 1S6UA 4HKQA 1HNZJ 1RCHA 2XSFA 1VHFA 2GO9A 3QFHA 2K1RB 4KHPK 4FXDA 3ZSXA 4YFUA 3G8QA 3NAHA 4Z7YA 3CMQA 4X4SA 2DRAA 3A5LC 2AYEA 4CJ3A 1VSFA 2V8HA 1HBOB 1T3VA 2NR0A 4EBEA 4HTLA 1ZAVA 1NJYA 5DETA 5IT9O 3S6EA 2OMLA 3TSUA 1NB2A 1ZPVA 1VQ4S 1S12A 4KGXB 1IBMK 3O08A 4A59A 1FXLA 4CZMA 4ZMMA 4NLPA 4UOFA 4DI6A 3E51A 2W7OA 4MO5A 3CULA 3E8OA 3ZT3A 1NGIA 4F7VA 1WC5A 2WW8A 1P9QC 4MK9A 3ULHA 3ADAC 2YNGA 1TUUA 3OL7A 1VIXA 4DCHA 1HHQA 1XUPO 2GHPA 1ZC6A 2X3DA 3VV2B 4OHWA 2YWHA 1X4HA 3TVKA 8RUCA 1HBMA 3TJ8A 3CMES 1ATSA 3KHGA 2HNYA 2JWKA 1V5VA 5KFFA 3LPEA 2YKNB 4FNHA 1X4DA 2YKPA 2IBOA 1EARA 4ZLNA 4W98A 3WC2A 2HFUA 1UTAA 2ATLA 3QJLA 2O8BA 2Z2LA 1Q8KA 2KH9A 3QNNA 1DRZA 3W5XA 3PR4A 2A41A 3HSZA 3ZSYA 2C2RA 4JLHA 3THTA 2EK6A 2XMWA 4JYAF 2G0CA 4BDZA 4M1KA 4KHRA 4CIEA 3QERA 2O4IA 1HA1A 1FFGB 3WQTA 4L6V3 1NGBA 4UW2A 2DNQA 4WF9L 2XCAA 4CJEA 5J2PB 1OH6A 2OCEA 1DHMA 3QETA 2XHWA 3G2XA 1VK8A 2D41A 1FRKA 1JLAB 3A8KA 1JLFB 1NGCA 2XGPA 3RSEA 4I7FB 4I2QA 3BB5A 3AODA 1M5PC 2FHKA 3F2KA 4F9OA 2WCXA 2DNMA 3AT1B 3QFUA 3T5HA 2CPYA 2IJFA 2RT3A 4RLEA 1BIUA 3ENHA 3FMWA 1U25A 4IOAQ 2OPRA 1GXUA 5C7PA 1WC0A 4Z4IA 3U7JA 1KP6A 3K5LA 4BRHA 4PHTX 4CT9A 4ZHRB 3RAXA 4USVA 3VQ9A 4HUGA 3SQ4A 3D1QA 2HS3A 4CO0A 2VJUA 1U2CA 4WCEQ 3NS5A 4PKHA 3SQ2A 2IGIA 4LRDA 1XNQF 2YH1A 2CH6A 4KV8B 3M8QB 4KQZA 1YZ6A 1VQ7N 1RWVB 3DOKA 1TKXB 2UUBK 4J9QA 1LWXA 4FM2A 5BR8F 5GAHP 5SUHA 2AZ3A 1WF1A 5E7OB 3VZHA 1K8AT 1LWFA 4RO0A 3RBZA 1BQXA 3GV7B 2ZKUA 4X65F 4CH7A 1ZETA 2NCKL 1U02A 4USHA 2N82B 2AP6A 3U9ZA 3J7ZO 1V9OA 3VF6A 3R7NB 3MZIA 4DFJA 1OQ3A 5EX0A 2RS2A 3I4HX 3M6WA 3MCAB 3EDRB 1N33F 3ASMA 4DL7A 1KKHA 3QNOA 3CYMA 4N8OA 4P52A 1S0MA 3BBBA 5K8PA 2VG5A 2RD5C 2ZGYA 2YNHA 2P9LA 3S9HA 3R8YA 3BSOA 3AVNA 2XEXA 1D0EA 1DAXA 3TZXA 4HACA 3D0HE 1TL3A 2ZZNA 2W24A 3NLCA 3HZGA 2M0GB 3OJUA 4FOIA 5EXWA 3OS2A 2BOAA 4K59A 3G6XA 4YNQA 1EWRA 4P2XA 3CJ5A 4MQ3A 4M95A 4K8ZA 3NNCA 3CEDA 1YJWN 4FL9A 1TKZA 3B6PA 3NH1A 2E5GA 3PY8A 2KZMA 4C1NI 1ZH5A 4OKKA 3OYAA 1N48A 4ZLPA 4NXNK 4DR2K 2HZCA 5CD4H 4FJGA 4BR5A 2D9PA 1NOYA 3FSYA 3HHLA 4F2SA 2Z58B 1FESA 2R7UA 3B6BA 3TAFA 2WK4A 2CKWA 2LKZA 1F9EB 3GP9A 1BWVA 1WG4A 4CBUA 3B78A 4ED8A 4JI1F 2I5JA 4Y65A 2YNGB 3EZUA 4HHUA 4JI3F 2CDQA 2Q3SA 1Q5YA 1Q8LA 1VBYA 2E7VA 3D6MB 2GNKA 3MHYA 3OPKA 3GIKA 4CQ1A 4Y1DA 3CMAS 5LMUF 4ZVTB 4ZVRB 3DN9A 4CLSA 4R5PA 3A2FA 3N4PA 2QM1A 5CCLA 2J9DE 1EB0A 4FWSA 3CM6A 3P45B 1RP5A 4CEDA 4H5TA 3K17A 3AVGA 1U2VB 4DV0F 1KCFA 4NOHA 2O8BB 2V0NA 1KWMA 2DXEA 4F02A 4HHHA 3MM6B 1J5EF 4E7IA 2HMIA 3TVYA 1HUXA 1F2GA 2ZDPA 1F0XA 1S79A 3OQ2A 2XO6A 1WSHA 5MLCQ 3MN6A 4LF7K 3W5ZA 3D7EO 3M3ZA 4Z0UA 2PA3A 1HKAA 4J9LA 1BO5O 3VEVA 5G4DA 3IR5B 2FC9A 2E6LA 2ETJA 4BRDA 4USJC 2V8VA 4TU9A 2HQDA 4YOXA 5MAOA 4FJXA 1FERA 2P6SA 3CD6N 4MKYA 3WNEA 4Q43A 4AHUA 4LFAF 3FZKA 3VGSA 4I2QB 5ETLA 2CPDA 2P9PB 2J7KA 4ECXA 3CC2N 1A6LA 3L7PA 3FDSA 4PAAA 2QSWA 3DLHA 4R0EA 1FJGJ 1VLOA 1RWXB 3MMCB 1TTHB 4A5AA 5FLXO 3M2RB 4OHXA 1ESVA 3OS1A 1HYSA 1FJGK 1B0VA 4OX9J 2OPRB 1S9EB 2V9KA 4M5MA 2FC8A 4OQJA 2QYCA 1JCEA 1LEOA 4ZIWA 3L8BA 3L09A 1B4SA 2KLAA 5B0AA 1GOCA 2XWXA 1QAIA 3PRBA 4DR3J 5DQGA 5E41A 1XWLA 3D45A 4DR6F 3LDLA 2RRBA 1BY9A 4DR3K 2JVOA 2MB0B 1WUAA 4K4WA 1S59A 2CJYB 5ETSA 2EX3A 3C14A 1LWFB 2P51A 3BDEA 2ROGA 2QA4G 3ZTPA 2XMAA 3VGUA 1B64A 1CEZA 4ECTA 5C5JA 3HBTA 3HCXA 3LDQA 1P90A 1YJNN 4ZCKA 1IJJA 2R9LA 2VA2A 4B17A 5D6GA 2APOA 4GY2B 2ZC3A 2ZNZA 5CD4A 4J9MA 5BYSA 1I94F 3GV8B 4NYPA 1IV0A 2Y1JA 1NBWA 1HYVA 3LP2A 3NVMA 2VG5B 2YNHB 5AQRA 2P9LB 5AJ3J 2X74A 1RU2A 2MJUA 3NAIA 5F8NA 3UWTA 2KDOA 3HMJG 3AO3A 2RU9A 4KGKA 3FZLA 1TL3B 4NZ0A 5AJ3K 3T69A 4WFYA 3KDOA 1YAGA 4RWXA 1Q79A 3R5AA 2RE1A 4B9TA 5GAHI 1GH8A 1IKWB 2EFNA 1R43A 1Q9YA 3M8PB 3DM2A 4USMA 5J2MA 4DX6A 1Q0NA 3H0PA 3W9JA 1T7PA 2LQ8A 3WDOA 2HMPA 4DXLA 4F4ZA 3OHBA 2ATCB 1ZAWA 2PFUA 2FLLA 3HHLB 3TO8A 1QUPA 2RILA 3WHIA 2QWRA 3VAMA 4DS4A 3CW2C 4KHSA 2XLKA 3MN9A 1YJVA 1YBTA 4ZDNA 2OPQA 2NNWA 1YZ7A 4P9SA 2N3LA 2RHSB 1BG3A 2ALYB 2R2SA 5K5MA 1FX4A 4OJ3A 5DDRC 2B43A 4N5SA 3QDKA 3R5BA 3MX5A 2B7CB 3NF8A 4H4KC 2P9KB 1QHAA 2KJVA 4DU7A 1L3SA 3I0RA 2HFNA 4KO0B 2DD8S 1ZA1B 3EGNA 5K8OA 4OYBA 5DDOC 1SV5A 1RHRB 3ZSRA 4R5PB 1H7WA 1HNXJ 1VLYA 4TLRA 2CQ3A 4AQYJ 3N28A 2AT1B 5M2RA 1CXUA 5KT3A 4Q0BA 1WD6A 3JB9k 2YHWA 3L0QA 1WSEA 1HNXK 1UL3A 1SS6A 2NPIA 4AQYK 4BRPA 3BUZB 4FJ8A 5IM0A 4N7TA 1EKSA 2N4CA 2KZZA 2HZAA 5L39A 3CM5A 2VICA 3MX2A 2HMIB 3QPIA 1P8GA 1D09B 3CXCM 4YDUA 1EZZB 2OELA 4C23A 3WT0A 4FYVB 5F8JA 2QTWA 3I5BA 2B9YA 3L2RA 5IV4A 2MZRA 3MWBA 3FRYA 1Z4UA 2Z4PA 4MDBA 3ZTOA 2V52B 3OTOJ 3WNHA 1IBKF 2VWKA 2DHXA 4OZ2A 1NMEB 3D2FB 5LM7E 4BRAA 2XYHB 1WDDA 3OTOK 4MK8A 1EIYB 5AZIB 4DV4F 1S48A 3J80U 1SXLA 1NO8A 2Q2RA 2Y0BB 1SJQA 2QZ8A 3CCLN 4HUFA 3MGJA 3AARA 1LW2B 4W90B 2PE8A 2W9AA 1QLNA 2G8WA 1VSKA 3QIPA 2GIFA 1HYSB 2QWQA 2W2OP 4DPOA 4DUYF 5F8HA 3BZQA 2PN6A 3TJ9A 2OZMA 4JKAA 2WB1D 4ERDA 5F8IA 5ETRA 2XS2A 3V1RA 5KOXA 2RU3A 1H73A 4ZVEA 3R5CA 2EFQA 3MM5B 1BHLA 2C22A 5EUHA 1Q8IA 4ZOSA 4JI2J 3MECA 1XQIA 5ITHA 2AYMA 5KT7A 1Q7YO 4BROA 4KTZA 1S1WB 4ZA1A 1RAOA 1YGYA 2UXBJ 4JI2K 4CHQA 1CS4A 4DU1A 3AAWB 2MSSA 3VTHA 3C14B 2ATQA 2UXBK 2B4VA 4AL6A 2QK9A 3TQ1A 4FZXC 2BQRA 3K9JA 4PWUA 5LXYA 3AD9C 1RFQA 3PJWA 3D2WA 5DQHA 4IOCL 4M63A 2IIRA 1TL7A 3G4SN 1N5SA 6FDRA 1K73O 5J1NA 3A12A 4RUCA 4WYWA 1S97A 3PSFA 2R8GA 2KRBA 2J76E 3TA1A 1VIOA 2J0XA 3LP2B 2R7RA 1BIZA 2X1FA 4LRCA 2VOPA 4IOBA 3VQ8A 3QAEA 3FFIB 4B9SA 1T02A 2FSJA 4HCBA 3BGRA 2RE2A 3SDEB 4NEYA 3B8HA 2J7UA 3VA0A 2VDIA 3CCES 4XIUA 3OFHA 3B6OA 2X3GA 3T1HF 2ZOFA 2YTCA 4P75A 1LKZA 4DG1B 4B3TJ 4K0KF 2LP4A 5AT1B 2F40A 5J2MB 3VVTA 3VALA 1S3XA 4B1WB 2BE2A 4B3TK 4DZDA 2FBVA 1VQ8N 4ZJOA 4PQUA 1CJUA 4B9QA 3I0SA 3LGMA 3AY9A 4OYWA 3HHLC 2IFXA 4DV3J 2E1RA 3NHGA 2QWMA 3Q83A 3F73A 1ITGA 4GKKF 4GO7X 1HR0J 1XNRJ 2XS7A 3VN5A 3FBEA 3QESA 2OPQB 4HHTA 4IFYB 4KE5A 4RBTA 5JVGQ 4BWJA 1HJOA 1HR0K 1XNRK 2H1YA 1NDPA 4TU7A 3I0RB 4R79A 5KFDA 5GMKa 2DH9A 3M8WA 4V19J 3MUTP 2YY3A 1IN0A 3BKUA 1SV5B 2M4MA 3RVCA 1NZ8A 5KFXA 2QLJB 4QS8A 1QZ5A 2JX2A 4Y2MA 2MY7A 1VHXA 3TTDA 3RMAA 4K8XA 2LDIA 3JQKA 4C48A 2W2PP 1VQMS 3CCJN 3Q23A 4FKXA 1T8EA 2Q1NA 3NH2A 5IM0B 1OY6A 1ZYQA 1M1KO 1TMMA 3TAMB 2M70A 2Q3PA 5KFTA 3AXKA 3M32A 1KXPA 4L76A 2YWFA 5HMYA 4O3SA 1Y3KA 3I55N 2HQIA 4NB4A 2CQIA 1ZOTA 1JQGA 2I0XA 4LFBJ 3JSMA 3G6YA 4BRMA 3P4UB 3EO3A 4OPKA 3I56N 4OVLA 2CJQA 2EK1A 2QI2A 2DGTA 5AQJA 5J1PA 5CY4A 1X5SA 3CTRA 4DTNA 4JI0J 4I0WA 2QL5B 4X66F 1KD1O 2A18A 1YKWA 4A8SA 4JI0K 4EU0A 2L3MA 3QIPB 2MKCA 4HR2A 5H9EK 4KH6A 3GIRA 1S6PA 2DPJA 1CLQA 1SJRA 4Z2XA 1IBLF 2QMXA 2WONA 2VFUA 4A62A 4DMZA 3HRGA 3O3FA 3TUIC 4EAHD 3D6RA 1K9MT 5M2UA 2MZQA 2ZJQQ 1NJIO 2P8IA 4MKVA 3DYAA 1EETB 4Z4HA 3MECB 4XDCA 3HVTB 2YWWA 1TKTB 3D6FB 1WORA 2BM0A 3KK3B 4IFVB 3SAGA 4JKDA 2FGOA 4RTFD 1VQ5N 4LF4F 1CS4B 3K8WA 1KVKA 5LJVA 3E1YA 3LP0A 4ZLJA 4CDIA 4NLWA 3TUJC 2W8KA 2IM3A 3U8XA 2BE9B 3CJ1A 4DTRA 4JI5J 1O1WA 2CQDA 3N6LA 3SUQA 1CJTA 1Y64A 3U9DA 2XWYA 2AEMA 5H1SV 3A3PB 3I31A 5HL7Q 4JI5K 3P39A 3I8DA 3TX0A 1TL7B 3DLLQ 1M90O 2UU9J 1XNQJ 2QLWA 3DXKA 3BS9A 4WU3A 1P8ZA 4WQ5A 4USKA 1GLJO 2OEJA 1Z26A 2UU9K 1XNQK 2QA4N 2OP5A 2I7PA 3TW0A 2WVDA 2C3MA 2A3JA 1E6YB 4WFAQ 3SCXA 4DR5J 2DXDA 1F2HA 5AE2A 2UUWA 2CQGA 2A6OA 4LF5F 4FKYA 4CEEA 5BR8K 1NM2A 3KNGA 2HAFA 3PW0A 4FOEA 4DR5K 2A2DA 1F5BA 2UYTA 5HROA 2FVCA 2RIJA 2RRNA 4X65K 4ILMA 5KFVA 3I96A 3Q89A 2Y1RI 3OFGA 4PG6A 2V51B 3MM7B 2VHGA 1CJUB 1RLDA 2N7CA 2CGJA 4RR5A 4BLGA 2GHVC 2DO4A 5B7WA 3KWIA 1RSCA 2ZJRL 2AIRB 1TU0B 4URGA 5HP1A 3OL6A 4D3HA 3LOUA 3AA8A 5KFOA 3K58A 4W5OA 4OLAA 4YHHF 4CJPA 3V4MA 1JIHA 2UZAA 4RW9A 4DL2A 2B7BB 2JC0A 1NH7A 2YPZA 2ZVIA 3PEHA 3ZT2A 3J81U 4OGEA 4K2JA 2ASPA 2OTLN 4YB5A 4A47A 3FE1A 2VOOA 1VRTA 4IUFA 4ED7A 3GONA 4CEFA 4FLZA 1Q86T 5HO4A 1UAWA 1HLWA 3L2VA 4LMZA 4GVEA 4O0JA 2NRXA 3SUPA 4JI8F 1ICEB 4NLBA 2O8CB 1S6OA 3HK2A 2OSRA 3DMJB 4CJWA 3HL8A 1FRJA 3KLHA 2E5HA 5KPZA 1W2BM 2NZTA 3PNIA 3SPZA 1NGGA 3M32B 4CW7B 2CGKA 1KAYA 1M5SA 3DOMA 2M8DB 1YITS 5ADZA 4JI3K 5LMUJ 1UEVA 3UN2A 4NLSA 1X7VA 1RAEB 4LC9B 4DZ6A 5KFEA 4QWAA 3C94A 3NCIA 4DQPA 5LMUK 4YY3J 3T5JA 4WF9Q 2BV3A 2R7YA 4CFBA 3ET6A 4XDDA 5LSLA 1SIWB 3FQKA 2IRUA 3C3LA 1RBOB 5AR0A 1U6FA 3O4NA 4FVCA 4O8KA 4B8CA 2GAGC 3HJFA 1VQNS 2UXCJ 5M1KA 4ECVA 4LD0A 2JGUA 2V63A 2XY6A 1S6PB 3H5YA 4QWDA 3A3NB 3NVKA 2OLWA 1RE1B 2NLXA 3WEEB 5GAEP 3CGIA 4WFBL 2W01A 2UXCK 2WONB 3GFYA 4Y00A 1OPIA 3MF5A 4K4ZA 2ZBCA 4K41A 4CGJA 5BXIA 3D54A 1K1SA 3HI0A 3ZT4A 4FS2A 3DYAB 1U1NA 2VC0A 5DLFA 3SV4A 3DWLA 3CCVS 1N88A 4QIWD 4C3MA 1Z25A 2Z8QA 1U1OA 1WDTA 2RHQB 3HJVA 4LFAK 1SPBP 4MIWA 3RAMA 1JXBA 3BKTA 4RU2A 3AH6A 5KG1A 3BN4A 3LP0B 1NXIA 2QLFB 3M30A 2RKIA 5FPMA 4GVBB 1VQ6S 3C6UB 1RYSA 3GJSB 2O01C 5AQUA 4B9MA 4LF8F 2FVRA 5KRTA 3AAPA 3AD7C 4USTA 1RT2B 2JH3A 1XBWA 2MKKA 4ZK7M 1AW0A 1EQ0A 4F04B 3DXKB 3J7AP 4WE1A 4QS7A 1WG5A 1J5OB 3OL8A 1BCOA 2QRRA 4I2PA 1URRA 2KJWA 3B4DA 3KKFA 1QAXA 4DR6K 2PIIA 1WC4A 3TQEA 5E3QA 2G8HA 1RWWB 2R8IA 1EQYA 2V2QA 4CHNA 2GIRA 1YT3A 3DOLA 2AU0A 1KQSM 1LNQA 2KRRA 3N0VA 4RZRA 5CE3A 4FSVA 4DPTA 2A3ZA 4O55A 4Q44A 5GIPA 5IS2A 4LSLA 3FZBA 4NA3A 3CCLS 2DNNA 1IM6A 2YNFB 4KSEB 2EHGA 1OJ4A 4CEOA 3AVFA 4CD3A 4E7HA 2MGZA 1U1QA 3RB4A 3NS6A 4LF6J 2QWLA 2DTUA 2CQHA 2HBLA 2HZVA 3QWPA 4ZLLA 4DCPB 3H90A 3KUEA 5HP1B 4XTTA 4TU8A 4FPRA 3VF0B 3Q8SB 4LF6K 2E66A 4CF0A 4RW4A 3D5MA 3K8VA 4DHYA 5E3AA 3KHHA 4HUEA 4DL0C 4RUHA 5EU7A 4FCYA 4LVOP 1WI6A 2RRAA 2Q0UA 3DDIA 2DTJA 4MIBA 4N77A 2JLEA 3V9WA 2YWGA 2FLNA 2R8HA 3BP8A 4BC4A 2KT5A 3FQLA 4P10A 2ZJPL 5EN1A 2JC1A 4EWTA 1NEEA 3SI6A 3V1QA 2HVIA 3IGVA 3LPUA 5LL6d 1FD2A 1U48A 3PFOA 3DDKA 3NL0A 4XH1A 4ZPTR 4KY3A 1KQGB 2GTDA 3ZT1A 1R6VA 4EK2A 3HVRA 1S1XA 3OYJA 3KLHB 3LP3A 4M5KA 4CTAB 1Q16B 2XTJP 1IBCB 3WIUA 4J9OA 3VESA 2BH1A 3HKWA 3HVAA 4M5DB 2HPUA 1NUEA 4ZCIA 4QU7A 4OFZA 1MWKA 2F4VF 2GW8A 2HS4A 1XR5A 1SC6A 2JZ5A 4TQRA 2XULA 3KLVA 4QPXA 3OHRA 4ZPAA 2F3JA 4CLZA 3V6JA 2MKHA 4ISFA 5AQQA 3DCAA 3JYTA 3HF5A 2OFHX 4YEAA 2LEBA 3ET6B 3MR5A 1PBUA 3W62A 2XO7A 1U09A 2HHXA 2Y0SD 4YS2A 1RAIB 3MR2A 3RUBL 4ES3A 1VQKS 4KREA 4KB0A 3JSRA 4DX7A 4YOUA 4Q8FA 4LSNA 4CLPA 4RW8A 2PMZD 3K2PA 3JAMY 1U1KA 3T9NA 3H2UB 3T41A 3CD7A 2F4FA 3TA2A 4JKGA 4I69A 1WF2A 4I67A 5CR4A 3UKRB 3OR2A 3J81j 4LRFA 1NPRA 2DR5A 4A61A 3NF7A 2FGCA 1NGEA 3LZJA 1YXQA 5J1EA 2QT7A 2ZNYA 4YR0A 2WTFA 5IZHA 2MEWA 2MQPA 2VASA 2DO0A 4ZVHA 1MU2A 4YN3B 1RAFB 4F0HA 4O0NA 1TYQA 4K43A 3RBEA 3LQVA 4DR4J 3DGPA 5LL6Z 2VODA 3U02A 1Y0HA 2ITGA 3DRPA 1RHQB 3F44A 4DSKA 1KC8T 1MN7A 4AILC 2GC8A 2O3DA 4DR4K 3CFRA 4ITSA 4DV4K 4NXMF 1XMOJ 3UVJA 3LTOA 3SJHA 2Y1LB 4KPCA 3EGZA 2GJ2A 4Y1CA 3M30B 2RKIB 4C6AA 4O3PA 4FK4A 3IC1A 2FQQB 4ECWA 5DK5A 5F9LA 2YWEA 2BJEA 4X4PA 4DTUA 3TAPA 3B4MA 2YXLA 4DWIA 5GAEI 1K8KA 3CPWM 1TVRB 4WE1B 1RGVA 1X5PA 2IAJA 2MDAA 3WQPA 5C25A 2V7ZA 3I55S 4WQ5C 5F8MA 4BS2A 2GA7A 4IKAA 1QSLA 4DUZJ 2ZOMA 4WKYA 2IM0A 1LFWA 4DV6J 4CEQA 2JDJA 3OLBA 3DOLB 4DUZK 3N79A 4IOXA 4BG8A 3GMGA 2IM1A 2GVDA 1T9VA 3PDNA 4QS9A 1SIZA 1R31A 3H1QA 4W5RA 3SUOA 4LSLB 1FXDA 3DI6B 4K5SA 2HBRB 4FYXB 1N8RT 3ZNUA 4NLUA 5EDWA 2MGZB 4ILRA 2RPIA 1B0TA 2EXUA 4LFCJ 4DSEA 2BZ2A 3W61A 4QIFA 4KHWA 4M3ZA 3AO5A 1IR1A 2RSQA 5D4OA 4QW9A 3C66A 2FDNA 4LFCK 1ZBFA 4HI1A 1VGYA 2RQKA 1RA6A 1EKEA 3SMZA 3VQQA 1WOOA 1BISA 3W0LA 4QWCA 3AO2A 5A8WA 5KG0A 4CZLA 1S72N 4E98A 4OGCA 1GQEA 1FE4A 3UPFA 3EE3A 2C3UA 4KHMA 1JXVA 3I5CA 4W5TA 1ZXOA 1FF2A 3S3MA 3QIOA 3JQJA 2EKNA 1Q82T 3KK1B 4NEZA 1C1BB 1FTRA 4K0KK 1X4EA 2HHHJ 5HVHA 4CFCA 4IDKB 2K06A 1FWLA 3BEGB 3SIPB 1SH0A 5K8NA 4BR7A 1M5KC 1R59O 4RWWA 1WC3A 2W7PA 2DVIA 2HHHK 3R5DA 5D0EA 2FYXA 2HK2A 1RDBA 3KDNA 3AVHA 2XSJA 3PRDA 2RF2A 4L72B 5LSRA 3SEOA 1S1XB 1GMWD 1RWKB 4ICLA 4CM2A 1AUDA 4RW7A 3NH0A 3TR5A 3GJQB 4CF1A 5AE3A 2IJNA 2AX1A 4C9DA 2ZHOA 1ATNA 1BA1A 4CZEA 5AZJA 2JVRA 3AOCA 3BBFA 1DEJA 1HI8A 4J8FA 1P9YA 4ZTFA 3KD1E 3NGRA 1B7YB 4UQGA 4FM1A 2HBJA 4OPHA 1FJEB 2HG4A 1EP4A 5I4MA 1Q7LB 4B3OA 2ZH3A 4CJUA 4J5OA 5CAAA 3SCJE 3HSJA 1KLMA 1MMNA 3UR3C 4DV2F 4RW8B 1NKBA 5JS1A 1UVKA 1O8BA 1D9DA 1AZSA 4JKGB 2U2FA 1MSWD 2M88A 2YI1A 3THWA 2WVEA 3DU6A 3OR2B 3ZZYA 3LALA 3KLFA 3W1YC 4NLQA 4NA1A 2AW0A 5J1EB 5JXSA 2P5VA 1MU2B 1BWEA 1FKAF 5JVHL 2NUUG 1U8WA 9RUBA 1T3NA 4X2BA 4H4OA 3BBCA 4KHPF 1OSDA 1LXNA 1C1CB 3GJTB 3OXLA 2XZTB 1UPPA 1HNZF 3S7RA 2EFVA 3M2UB 4FWOA 2MLXA 1UA0A 2M5YA 3QFWA 1RTHB 2OTLS 5KOWA 3LL3A 4RBUA 2KFNA 2IJRA 4ANDA 4J90A 1G3OA 2A6AA 3OYGA 3D1HA 3GYNA 1URNA 1KAXA 2Z30B 3KVGA 4G9ZA 4X66K 2FJDB 3VQBA 2E7WA 4OZ0A 3K2YA 2XCPA 1T9WA 2BW7A 1SL1A 2BANB 1NHUA 1TUVA 3C19A 3RYLA 5FDLA 4J2DA 3MXMA 1K8KB 3OVAA 2W9CA 1RT6B 4DV5J 2OUGA 1L3KA 2DB1A 3QGIA 3UQSA 4JS4A 2BM1A 3PR5B 2EG1A 3FJ2A 1RT3A 5DG8A 3MD3A 2V5HG 4F4AA 4LF4J 3LM2A 1X0PA 1PYOB 2O1PA 3C6HA 2M52A 4ID5A 4OV1A 1RAAB 2IMOA 4LF4K 1T44A 1VHIA 3MMAA 2XI2A 2PZSA 3DRYA 5EGYA 2PFDA 3DC2A 5E5NA 5HRSA 2DCLA 2EC0A 2MQOA 3GIMA 2HNZA 1G4CA 5J2QA 2XQCA 2Q6BA 4FK2A 1NZAA 3P4IA 1FNMA 3NEKA 3Q8QB 3W8PA 4CZFA 2IOCA 3CCWA 1D9AA 2RDDA 3DLJA 5C15A 4X64J 4FXVA 2EEYA 1PGZA 4DDFA 4ILJA 3A3OB 3PRVA 1J53A 1SKSA 4BQLA 3MM9A 5CABA 5CHIA 4A48A 4X64K 2ZZMA 1YSJA 4LF5J 4H4MA 1FK9A 2I8EA 2V9WA 3KHRA 2DGVA 5BRFA 3L2QA 4OYIA 4U7UD 3O9TA 4LF5K 3CJQA 1U04A 4TKTA 3O8MA 2DY4A 1ZBUA 3W3DA 4JKEA 5CYMA 4MFBB 5D3GA 2W7AA 3Q8PB 3S8SA 4JI6J 3I6PA 3P1GA 3DXSX 3MXJA 1YTAA 3TOQA 3HP6A 2FBYA 4JI6K 3IXQA 3P96A 4DSFA 4C11A 5FRNA 2RF2B 1N54B 2WVBA 3M2VB 4F4WA 5HVFA 1VBZA 1RT4A 4P2SA 1QSSA 3TZZA 2HFOA 2R8KA 4RW7B 2B6AA 1HNWJ 1RWPB 3AA9A 1VQLN 3W2VA 3DLBA 4YHHK 1PSDA 1WSGA 1P1TA 5AZJB 2VFRA 3SBGA 4YOTA 2O8EA 3MCOA 3D0IE 4DV7J 1YIJS 1NMNA 5D15A 1VSEA 1RHJB 4FPIA 2E9ZA 1S7HA 5ETQA 5CHCB 1H98A 4NZ7A 3CFPA 4DV7K 1EP4B 4PG5A 2DFHA 4M3YA 2EFGA 3MPVA 5AQNA 3W65A 1AFJA 2MHNA 1N36J 3T6BA 2E6MA 3QAUA 2B9EA 1GTEA 2GV1A 3D68A 1KTQA 4MYTA 1SVDA 1N36K 2Z1IA 3NGDA 3GE9A 3TWHA 3THWB 4NLCA 2P9SA 3OSNA 2RHKA 3MEGA 4CO1A 4PKGA 1GEHA 1OPZA 4BCAA 2HHQA 2NRHA 2CPHA 1S76D 2FBTA 2HHTA 2V94A 3KMQA 2LSNA 1GMUA 5KPRA 3IN5A 5KFIA 3QRQA 5D0RA 4FLVA 4J2EA 2MKYA 4CLWA 1R27B 1GT8A 5AQHA 3QZ8A 1DLOA 1VRUA 4DCJB 3ENVA 3MCMA 1GX5A 5KFYA 2Q79A 4GO5X 2E1ZA 3IP0A 2G1HA 1VBXA 4BE2A 4OI6A 4F26A 3KG0A 1TL4A 3KZBA 1VDHA 4YOEA 3J7A1 1NJXA 4Y0WA 2J6UA 3AO1A 1WF0A 4HDGA 4K4VA 3Q2TC 1YF5L 3NMRA 1IXKA 1T6CA 3M1VA 2W9CB 3I9V9 2DNHA 4JRQA 2WFBA 4FWKA 2FPHX 1YX2A 2W8LA 3TUPA 2G8KA 3AFGA 5AQPA 3K89A 1FKPB 2OEMA 2MQLA 2ACMA 2XS5A 1RTDA 4C98A 3EICA 1N52B 3MMAB 3QGHA 3H2VE 4B9VA 1TAUA 1DARA 1UVNA 3UKUA 2E1YA 2E9TA 2BE7D 4RUBA 3U3GA 1BLUA 2AD9A 4LF8J 5EVZA 2HNZB 3VF4A 4W92B 4B1ZA 5B0FA 4HT7A 5J2QB 2LA6A 2YHYA 4H5NA 3KOAA 2KG0A 3IRWP 4LF8K 2OMOA 1JCGA 5CZ2A 2BA9A 2NXUA 3SFGA 4YQWA 5CZ1A 4ZITA 3MM8A 4DPWA 4FF1A 3ZETB 3GILA 4AXJA 4KHNA 4AYBD 1R8HA 1R3NA 5HQLA 1B0PA 1TFYA 1JJHA 3MM9B 3TYTA 3EM1A 3MOZA 3VGKA 4K4YA 3FC9A 4TN2A 4H4MB 1FK9B 2Q36A 1BE4A 3LPTA 1IKVB 2GBZA 3KD5E 4BRQA 2ZM6F 2W6KA 3H46O 1TP7A 4XH5A 3O6QA 2D1CA 4DN0A 2XMMA 3I9ZA 4K5RA 4IDHA 2VBZA 4NMXA 5CYMB 1Q78A 4ZTJA 3ULEB 3P49B 3AGKA 3TNVA 2BJ3A 1HQ2A 2MZSA 2NREA 2VGMA 3QINA 1WHXA 2FF3B 4WQ4C 3TAGA 4NLDA 4TLQA 3GIJA 4DQIA 3MUMP 1FJGF 4BR2A 4C3LA 3LA0A 3OUYA 1RT4B 3FUYA 1F3FA 3K5PA 1T9TA 2B6AB 4OX9F 1NG9A 2KYZA 4OJGA 1CJVA 3W2VB 1S7IA 4ATNA 3GL1A 4IH6A 1UJ6A 5ETNA 3U3YA 2E5JA 3O9RA 1R7IA 3Q0AA 1HHSA 2P9GA 3GG1A 4G65A 1X3MA 3FFKB 1ZBIA 2DR6A 2Q1LA 1SQFA 4J9NA 4ANCA 4ECZA 1GNKA 3J7ZT 4WWSA 1VSLA 3ZZTA 4J37A 1HBNA 5L38A 2HLUA 2JLFA 3CJBA 3LGHA 4L73A 5BPNA 1QUVA 5LJ3Y 5MLCV 4UOHA 3E01A 3VEWA 4J9VA 3V6HA 3GBTA 3O6WA 4FYYB 2HNDA 5KT2A 4WKRA 4F2RA 4IG0A 3DLGB 3VETA 2JEIA 1RWNB 3HSGA 4ZKAA 4PYDA 2FUG9 4EO6A 5KFGA 1U2RA 5I42A 3LWMA 3Q2SC 1HLUA 4HVZA 3MFIA 1S72S 2YH0A 1TUWA 3CQYA 1FXXA 5AJ3F 2FLPA 2WSCC 3ZSOA 1TL1A 3KLEA 1LQ9A 1D8ZA 1GMVA 3GIIA 2AP1A 1IKXB 1NJWA 1EX8A 1G1XA 4JAXA 3IUCA 3CMAN 3I5AA 3FEZA 5B08A 2HFSA 4KB7A 3UDVA 2XG8A 1BQNA 1Y00A 4GMJB 4FF2A 3O5BA 2CJKA 3FGUA 2FY8A 1S99A 3NRBA 4LT6A 3W9IA 1KHVA 1JMTA 2GZOA 1M1GA 3IBWA 2ZH8A 3HO1A 2VQFJ 2FVPA 3RBXA 3TRGA 2N7YA 2VD3A 3POTB 3IFRA 2G4BA 2B4OA 3JAMO 5BN8A 3MMJA 1SKRA 3CCZA 4ZPCA 2O66A 1BU6O 3EJMA 3IAYA 3D67A 3PFEA 3QT6A 2DNPA 2KYXA 3AVIA 3M1VB 3RMDA 2MPUA 2ZC4A 2HF4A 3DAWA 4BR9A 1V6HA 2V4JA 3CCUS 5HBMA 4YB1P 3O9UA 2FIUA 3OVNA 2F9DA 4I6AA 2MSTA 2QX0A 3TSPA 3MAAA 3FZHA 1N5YA 5FIIA 2W1BA 2KI2A 2F5GA 4ELUA 4OPAA 1JLEA 4NLOA 3L95X 2O8DA 3UKUB 4CJ5A 2D3O1 3CC4S 3C16A 2IM2A 2DGOA 4ZVQB 2YVSA 1U1RA 2DR8A 2MQNA 1JX4A 1MNEA 4ZJQA 3D2EA 1SL2A 1HNXF 3EWGA 3U4LA 4AQYF 1BGXT 5SZTA 3NCPA 2A10A 3Q8VA 5JVGL 2IDEA 3IBFB 4OZNA 4CEBA 3ZTSA 3BR8A 3E3XA 3PO4A 3MM8B 3UCUP 5AQLA 2RDJA 2ZHBA 2HHVA 3QNWB 1ZAXA 2VG6B 1FXRA 2XYGB 2FJAB 1F5CA 4OJHA 1S9GB 1OY9A 3P5TL 4DU8A 3QT5A 2DPIA 1X4GA 1QY7A 2YJFA 2AEJA 3SLCA 3CDWA 3H20A 4EIAA 2QTDA 2KO1A 1B3TA 3OTOF 1HQEA 3S01A 1FRMA 3N4QA 4A8MP 4DFPA 1C0MA 3QO9A 3Q8UA 1NGHA 2O4GA 3TAEA 3U6FA 4EZ6A 2QJ3A 3QYYA 3VQEA 1BUXA 2ZF5O 2VYPA 5B8HA 3GCWP 2CG4A 3KWGA 2B0GA 2ZJPQ 2IA6A 1N0VC 3ZEUB 2J9CA 5KFCA 3OUYB 3IO1A 3GYGA 4B02A 1QQOA 2C42A 2WOMA 4I9LA 1LOUA 2XYPB 3N01A 3SQ1A 3KJQB 4I68A 1Q95G 3DRSA 1YQHA 2PDAA 4LRBA 2KM8B 5AQKA 1BA0A 2DIUA 2R7OA 2UVRA 1U1MA 2IDOA 2J0WA 2MMYA 2VJVA 1N6QB 1WOPA 4JI2F 3VOVA 4JKFA 3L3VA 4E3SA 1SC4B 4KT0C 4CHZA 3HULA 3EUNA 3GSIA 5J2NA 2OANA 4KKOA 1HBNB 4OYXA 4XK8C 5AQMA 4DQ8A 4NASA 2WSEC 5M1PA 5ETPA 2VU5A 4DBQA 4J91A 4U67L 1HJRA 4H0YB 3E01B 3FEXB 2ZJQL 2HNDB 4JRPA 3H5SA 4B8AB 3J80O 2CDRB 4NRUA 3NMUA 2QIFA 4C97A 1JCFA 4M5NA 1JKHA 3PG9A 3LANA 4FBUA 3CSKA 5DMRA 3WXJA 4WK1A 1HFEL 2YKOA 3GSDA 3VAGA 2C2MB 2XMUA 1TL1B 3KLEB 1Z05A 2GGPB 4IWVA 4FVMA 4UTGA 1JJ2R 2PYLA 2V4RA 1BQNB 5AQVA 1JLCA 3MUVP 3Q22A 3EKUA 4ECUA 4DR1J 3DLLL 1YTYA 3ZXWA 1YJ9N 1UFKA 3NGTA 4B3TF 2B51A 2E29A 1MW7A 2GQCA 2BDPA 4FDFA 4JUZA 4P2MA 2YX7A 1VK0A 3G25A 1PCAA 1U6BA 3TARA 2ROEA 1G7CB 4TYAA 1HARA 1Z2LA 2N3OA 3PCOB 1QTMA 3WUHA 3EMTA 1EX4A 3BREA 4NRTA 3SBMA 1RI7A 1WKLA 4JS5A 4DV3F 1FFSB 2UP1A 1WNEA 3C95A 2BJDA 2KVIA 1OKJA 1HR0F 1XNRF 2A42A 2CH5A 5HRRA 2DR9A 1REVB 1UVLA 1UMJA 3NCRA 1HNZK 5C0YA 3IM9A 3MAAB 2HIQA 1U6ZA 2QWOA 2B4UA 3NY0A 1JLQA 3H59A 3AOBA 1SL0A 2O8DB 3AVAA 5AE1A 3CNQP 3C16B 3GCXP 1Y5NB 3GQCA 3D2EB 1HKBA 3SQOP 5B0EA 1QVGR 2KG1A 4X4VA 3AVJA 2KTQA 1VYAA 4PL7A 3MPDA 4UY8O 3JS9A 4FM0A 3RZAA 2NYHA 5B0CA 2VIHA 1KVAA 2P9IB 3ZCMA 2DPNA 3NG8A 4IRCA 1OH7A 1Q81T 2KXNB 3HTVA 3PX6A 3R1XA 2NS1B 5E2QA 1S1UB 2JL9A 2Q0RA 4B08A 5GADP 4O5FA 2D3UA 4EBDA 1U0SA 3UD4P 3RJMB 3FZMA 3HKZD 5KI6A 3CDAA 1SH2A 5KFJA 1T9YA 4I56A 3ENAA 1J54A 4FWRA 4C8YA 4M7YA 3CVKA 3BKFA 3M6UA 3BO2A 3EVOA 1FI4A 3OBYA 2G2OA 4ED1A 4LFBF 2X78A 2CYYA 1HQEB 4ED5A 3O1BA 1OVQA 3QO9B 3IWNC 3VEZA 2ASOA 4UQTA 5C2FA 3B54A 3R6GB 3EE9A 5IC4B 2A0FB 3LUYA 4BBYA 5IT0A 3C2PA 5C42B 2O5DA 4JI0F 2C2DA 1JL2A 4Q8EA 2XHBA 2VBWA 5F8GA 4NO7A 2B5JA 2WZ1A 2J0SD 3RB0A 7FDRA 2MJNA 4CERA 3N6NA 1Q7YT 3ENOA 2HBKA 4KAZA 4CK2A 5KG5A 4QZVB 1TR0A 1SJ3P 3LWLA 2OPPA 1C1AA 3DRSB 4O44A 4KAIA 3D3BJ 4CH0S 3DRRA 2KM8C 3EVMA 2E9RX 2G0JA 3AOAA 4C8LA 1VCTA 2UXDJ 3PUFA 4FWNA 3CIMA 4C7QA 3CCEN 3CCQS 4W5QA 4UF4A 1M5HA 1T05B 3I8BA 5DJBA 2UXDK 5J2NB 2D0AA 5IQ6A 4MLEA 4QBUA 4PYAA 1RBRA 2F8HA 1K73T 4KFBA 5G0RA 1H2VZ 2DEIA 3BQ2A 4GV9A 1RGIA 3SQGB 1YG0A 2UUCJ 1FD8A 4JI5F 1O13A 1EKRA 4Q2MA 2W6LA 3KHYA 3K59A 2IVOA 1UZDA 2YHXA 2UUCK 1JKHB 4EI2A 1JXLA 4DFKA 2JNJA 3F9KA 4KH5A 2UU9F 2PT0A 5HOOA 3MXIA 3H8YA 1X4AA 3HHDA 1JWWA 3CJAA 4LREA 1R8PA 2F9JA 3KG4A 1NMDA 1CJKA 3BPSP 3THVA 5KAKA 2CA9A 4KR0B 5IT9Y 4MMOA 4F0KA 4O4GA 4G6VB 4IO1A 5LJWA 1X9JA 1SCJB 4C8OA 3JTNA 5JVHQ 4DR5F 5AQSA 1U24A 2G2YA 3SCIE 1T94A 3ZO7A 2ZH4A 1WSFA 1S6QA 2CG8A 3W2WA 1G99A 1JB0C 5EX3A 1VQMN 5DQIA 2HK3A 3UDEA 2DGQA 3SQ0A 2E1MC 3B82A 1MROA 3H5XA 2AV5A 1Y10A 4E7JA 1KSPA 2QG9B 3QMLA 2D3ZA 4XEIA 1RK8A 3O3LA 5C2GA 3TZYA 1HRHA 2F7TA 1K44A 1Z2ZA 3UR0A 4CK3A 3WXKA 4FP9A 1WBBA 2BMBA 4C0BA 3MTKA 2ZITA 3OBWA 4AXIA 3LAKA 5DGBA 1X1PA 2PAVA 2R7QA 1CPZA 4F25A 3L6QA 1I51B 3JTPA 1W97L 2Z2YB 4NZ6A 1ZTTA 2HRTA 2JEFA 3V9ZA 3AVMA 1M1KT 3D6HB 5KG7A 1QVFR 3RB3A 4OIXA 2UVWA 2CPEA 3IAM9 2B4JA 1JJ4A 4FJMA 2YX4A 5LJ5Y 3ITHA 2CUYA 1CC8A 2DJWA 4KTQA 5DG7A 2RUGA 2E1PA 2L41A 2R2RA 3IAS9 3IRXA 2XZDB 4HDHA 5E0OA 4E1JA 2QEXS 4UZBA 1LK5A 5FRMA 1X3NA 3VEYA 5DRKA 3OFFA 4CF9A 1UKUA 3RTVA 2C2ZB 2BACA 5KT4A 2JJ4D 3DLEA 4ILLA 3BF3A 5HRNA 1KOHA 4K2XA 1HWIA 3G0ZA 1HBUA 2D9OA 3GOIA 4WFNL 1ZM3A 2RMLA 2HBZB 1KD1T 1HBMB 3OYMA 4G1QA 2ZH1A 5AQFA 1RT1A 4NCBA 3SSRA 4GVMA 4PG8A 5AXNA 2HNYB 5LXRA 1HX1A 4YY3F 1RAJA 3EDQB 5HLFA 2G2ZA 3J81O 2ACYA 3UE2A 1GLFO 3N5BA 7AT1B 4FN5A 4PG4A 2KU7A 1KVIA 1BL3A 4M5IA 1NJIT 4DQRA 2EWHA 1L3TA 2B5JB 2EKYA 3VF2A 2UXCF 5AQWA 1ILYA 2QO3A 3MCNA 1HKCA 1T95A 3A5OC 4FJ7A 5GADI 1PO6A 2ZM6J 2CPZA 1JK9B 2OPPB 4A8KA 3BDPA 4O44B 3EVWA 4OHYA 4DSJA 3VENA 1IQTA 3LH2S 3A13A 3QEPA 2ZM6K 3NWGA 5IWAJ 4Z7CA 4QR0A 2AZ1A 3RSEB 4KTWA 4NA2A 2F9WA 1FNOA 2Z2ZA 1H74A 4B3MJ 2UUAJ 4HH0A 2G8IA 4IZ9A 5E3CA 4CE9A 4WYBA 3IWLA 4M41A 3M1FA 5C2CA 3OTEA 4B3MK 3JSBA 2YKMA 4DTSA 2UUAK 4Y34A 4L74A 3IDHA 1M90T 3CD5A 4KFBB 5G0RB 2HWHA 4ZPWR 1AXQA 4TVAB 4JP8A 3T7ZA 2D3OR 1PC5A 1RILA 3MEDA 1XTZA 1UJ4A 3MD1A 3TEHB 3AA5X 2E2NA 4YP3A 1IM4A 4A4JA 3VQ4A 4OX9K 4CEAA 4AHTA 2GX9A 1GX6A 5F0WA 3OYKA 3K57A 1WEYA 1SQEA 2V68A 1NGAA 4EYHB 3ZLJA 3FLCO 1NSQA 4F4KA 1KLNA 3ZX3A 4DUTA 4JN4A 2QKBA 4J9SA 3L4QA 3DOKB 3D6TB 4O4GB 4C8NA 4F36A 1EJ7L 3ELHA 2D0CA 1TV6A 1MWMA 1F60B 1KOOA 3C7NA 2FZKB 1HL6A 3JAMU 1WNSA 5IC6B 5M1OA 3WIVA 3E2EA 1S6QB 4CJQA 3IG1A 3W2WB 3CJ9A 2HGMA 4K4SA 3IBCB 2FY1A 2H65B 4IRKA 5F3TA 3HDSA 3NCQA