2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
3UIQA 2DTUA 4YNQA 3QIPA 3KHRA 2R8IA 3SV4A 4FVMA 3MR6A 3VQ5A 4IRDA 3QERA 4TY9A 4GVMA 4M42A 1Z4UA 1QSSA 5L9XA 1IKVA 5KTQA 3DLKB 4N56A 2P5OA 1L3TA 3OHAA 4K4VA 1ASUA 3QEVA 3AVLA 3TI0A 3DLRA 4FLZA 4O4GA 4DSLA 4EP5A 3T5KA 4FK2A 1C1CA 4QWEA 4ED3A 1UA1A 4KI4A 2FLPA 3RB0A 3GIMA 3DLEB 2IDOA 1MU2B 4IR1A 3ZT4A 4I2PB 3N6LA 3NE6A 1LW0A 4ED2A 4FJLA 1KRPA 4K4YA 4E1MA 1S1XB 3KMSA 4CJPA 3LP3A 1D1UA 3ZT3A 1S4FA 4GC7A 1UAXA 4EZ9A 4KSEB 1CZBA 4XPEA 3AO5A 1ZBUA 1D9DA 3GIIA 4I2QB 5SZTA 4MQ3A 4BACA 4CF0A 4B8CA 5KG5A 4FS2A 1HARA 3K59A 1Q9XA 3OYAA 3DI6B 2VG6B 3IAYA 2YNFB 5KT4A 4LSLB 5EWGA 1WSJA 2VWKA 3KIOA 1LAVA 1K6YA 2C2DA 3D28A 1MMLA 3EPGA 2XWYA 4CHZA 4UQGA 4AHVA 4OGEA 5HRPA 1VRTB 1SKWA 1HYSA 3NHGA 2GV9A 3CJ3A 3ZSVA 3VN5A 1DTQA 1U48A 1JLEB 3KLGA 2X6NA 2ATLA 4FBUA 3DRSA 5J2PA 2HWHA 1LAWA 2ZD1A 2BRLA 3BSCA 4FJKA 4CIGA 5C42A 3KKRA 3VQ6A 4F8RA 3K5NA 4DMNA 1S9GB 3GIKA 4F2SA 3BJYA 4MIBA 2FJXA 2J6SA 2OZSA 3IG1A 1WNEA 2XC9A 4O3OA 3T5HA 4CK1A 4NYZA 1QS4A 4ECUA 2YV0X 3NAEA 4B08A 3Q8QB 4KHQA 5FDLB 3PW4A 4R8UB 3LWLA 3V4IA 4DS5A 2HVHA 2Z1JA 1JLGB 3M8SA 3KLIA 1HQEA 4CF9A 2LSNA 3N6MA 2YNIB 3FRZA 4FJ7A 4O4RA 2DFHA 4NYFA 2E9RX 1HNIB 1VRUB 3QEWA 1IKXB 1U4BA 1S49A 1B9FA 4IFVB 3E51A 4DTNA 1NJYA 3G6XA 5KFHA 1N4LA 4DTUA 4FJXA 3ZSOA 4YR3A 3TQ1A 4EYHB 3L2VA 4G1QB 3PHEA 4KO0A 2XGPA 2I5JA 2WK4A 2W9BB 4CHQA 4WYWA 4G3IA 5KT7A 3RMBA 5KFYA 1S1VB 2P1JA 1KVCA 4QWDA 2GIQA 3CJ4A 3M8RA 3I5CA 3B6OA 3HJFA 4IG3B 4WYLA 3SUPA 4HUGA 4OPJA 1DTTA 1YTUA 1SUQA 3PZPA 4EEYA 3K57A 4ZVGA 4NZ0A 3QZ7A 2D7SA 2YNGA 2ZE2B 2ZQBA 4DTMA 5JS2A 5C25A 4Z0UA 1S1TA 3ICLA 3NF6A 3M8PB 3TAEA 1IKXA 1ZBFA 3QETA 5FRNA 1N6QB 4OKKA 1RTIA 1Z26A 2RDJA 5CYQB 5J1EB 5KG4A 2V4RA 4FJ9A 3DYAA 3CQ8A 4RW4A 3AVFA 3K5LA 3KHHA 3I0RB 4AHSA 5C25B 2BE2A 3OLAA 2G8FA 1ITGA 1RTJB 3SFUA 3RB4A 3EYZA 5KFQA 4RW6B 3B6PA 4IKFA 2YNGB 4JS5A 1C6VA 5D3GA 4HTUA 5KFDA 4Z4IA 1C0UA 4FM1A 2HAIA 2KW4A 1C1CB 3PY8A 4DLGA 4EYIB 3IRXA 4J9NA 2FVPA 4F3OA 2AGQA 3HPOA 5DQIA 4O55A 3PX4A 3BR9A 5DG7A 2HNYB 1TKTB 1FKOB 4Y34A 4QPXA 2RPIA 1NKBA 1BCMA 4DLEA 3HKWA 4KTZA 2QK9A 1VSEA 4FZZA 3PW0A 3FQLA 1BQNB 2XGQA 1ASVA 1S48A 2FVRA 4IRKA 4KB0A 5CZ1A 2QKBA 3OL7A 4CCHA 3DI6A 3KOAA 1SH0A 4ZPBA 1S0OA 4Z4GA 4CJSA 3CFOA 4ED8A 2BDPA 2QE5A 1YTAA 3P1GA 4E1NA 2FJVA 1IKWA 3Q8PB 3ZSYA 1Z25A 4BDPA 3SQ2A 1B9DA 4Y2AA 1X9MA 4PUOA 3RR7A 3OJUA 1IKYA 5K14B 3NH2A 4RNOA 3MEGA 2FLLA 1JL2A 4K4SA 3OYIA 1RBTA 2P51A 3NDKA 4DTOA 2AJQA 1R0AA 2C22A 1KFSA 1NJWA 3AVGA 1JLCA 4RW9B 1QAIA 3WNEA 4DF8A 1WLJA 4DFJA 4O0IA 1ZBIA 1QTMA 3U3GA 1Q8IA 5KFPA 2C2RA 3TAFA 3DLBA 1JIHA 3G0ZA 3OL9A 4ZP6A 3K58A 4LD0A 4DSKA 1LV5A 1LWEA 3VQBA 3PO5A 2HVIA 3UDLA 3LP1B 3AA4A 4CEEA 1ZYQA 1C0UB 1GOAA 3CO9A 4KREA 2XO7A 3SPYA 1C1BA 3H5XA 3FDSA 4H4MB 2W8KA 1RT7B 4JUZA 3KJVA 5KFBA 3QNOA 3H98A 4CJ4A 4LSLA 3LZJA 3M8QA 4N47A 1TGOA 1R0AB 2O5DA 2GUIA 2ITGA 3FSIA 1VRUA 3I0SA 4CFDA 4E89A 3CDEA 1FKPB 1NK9A 5K14A 1LWFB 3HL8A 4CK3A 3EZUA 3CM6A 1JKHB 4DQIA 5L1IA 4ZVEA 5F8MA 3QO9B 4DFMA 1NK8A 5KFXA 1WSHA 3IG1B 1RBVA 4QCLA 3H2LA 3LP2B 4J2BA 4XPCA 2D0BA 3NL0A 3C6TA 4I2PA 4IQXA 3VQ7A 3CDWA 4CJ3A 2UUWA 1TV6A 5HP1A 4WZMA 3TAPA 4ELTA 3DRSB 5J2PB 1EX4A 1RBRA 4CIFA 2AX0A 3AVCA 3JYTA 5F8GA 4B9LA 1CXQA 1S9GA 3AO2A 3WNGA 4R0EA 1CZ9A 1T03A 4DTRA 5I42B 1EKEA 3Q8SB 2AWZA 2BR0A 4CIEA 1EETB 4H4OA 5HBMA 4J9LA 4PA1A 3MFIA 4KI6A 2IJFA 1VSMA 2R2RA 3RBEA 4O44A 4J9PA 3QLHB 1W0HA 4JS4A 4FLTA 2HHSA 3RB3A 4ZVHA 4LY7A 4W5TA 4ZVFA 1D8YA 4EO6A 4KHNA 5KG6A 2YNIA 4F4ZA 3HP9A 1RBUA 4B9NA 4M3RA 1T03B 4CJUA 4RW7B 3QO9A 4HKQA 2R8HA 3SNNA 2FBXA 4W5NA 5J2NA 1HNVA 3ZSXA 1LWCB 3TARA 2HHVA 1KLMB 3E01A 5JXSA 4RNNA 3MAQA 3HM9A 3CJ0A 3MTKA 4Z4EA 5KFMA 5F8IA 4O3RA 4W5OA 5EDWA 1C0TB 4ELUA 3WNHA 1U45A 4RUAA 3PVXA 4WZQA 4EZ6A 1BI4A 3NGIA 1JXEA 3I0SB 2ILYA 2DPIA 1JLQB 4ECTA 2OPRA 4DF4A 4K8XA 3DMJA 3NF7A 5KFFA 4ZHRB 3SCXA 1JLFA 3NAIA 4TSXA 5DGBA 3LP2A 1F21A 4I7FA 1RTJA 4R5PB 5CZ2A 4KAZA 1QAJA 1RT6B 2R2SA 1W9HA 3OYLA 3HYFA 3AVAA 4BE0A 4J9MA 4AHCA 1GX6A 3QEXA 3ZT0A 1VSKA 4PY5A 1JLBA 4KHUA 4I2QA 3KLHA 1KTQA 1GOBA 1HQEB 4BDZA 4FBTA 2D3UA 1WAJA 4CGHA 5KFLA 2OPQA 1HPZB 4Z4HA 1S10A 3AVJA 3KJVB 4NCAA 4WE1A 4IDKB 2B5JB 3ZCMA 1DTTB 2IAJB 4O5BA 1BQNA 3T3FA 4ED7A 5KFJA 1VSHA 5EU7A 4EP4A 3V6HA 3M9NB 1TP7A 4TY8A 2JEJA 1RT5B 4F4KA 4OGCA 4CEDA 3Q8RB 1J9AA 3QEIA 1NKCA 4WXOA 1S9FA 4L8RB 4OPKA 1C0TA 3EZ5A 4RW9A 1KSPA 3GV8B 3V6DB 3CM5A 3ZSRA 2XCAA 4O3PA 4E3SA 2ALZA 3QGIA 1SV5A 5F9LA 3VQ4A 4QOZB 1RYRA 3L2QA 5EWFA 2C28A 5KFVA 2JC1A 1LWCA 4DTSA 3H4DA 2CJQA 1NK0A 4JV1A 1HJRA 3BQ1A 3S3OA 1VK0A 4I9QA 2B4JA 4KBIA 4K50A 3SQ0A 4NLXA 3H08A 1ZBHA 2X78A 4J2EA 1TV6B 5HP1B 4CEFA 4KB1A 4Y2CA 4QWAA 4ECSA 1BGXT 2OPPB 5KFRA 3OYNA 1DLOA 5DLFA 4CGJA 4DFPA 4OKJA 2BQUA 4CF1A 3MECB 2XI3A 1BCOA 4EBEA 3L2UA 5HBMB 1W25A 3DLGB 1FKOA 2YNHB 1NKEA 1JXLA 4FJMA 4DSFA 2X74A 5DLGA 4CF8A 1RT6A 4CGIA 4O4GB 5KFUA 5KT5A 5F8NA 2IAJA 1GOCA 4O3NA 2EHGA 2W8LA 2B43A 1UWBA 3MR3A 2IC3A 3C94A 3VQQA 3HPGA 4IFVA 3RBDA 2OPRB 4IKAA 2HHQA 3NF8A 4QAGA 4XO0A 5KI6A 2DY4A 4IDKA 2D3ZA 3ISND 3TAMB 4RW8B 3RWUA 4FZYA 4NRUA 3KK1B 3A2FA 3NAHA 3MEEA 1S1TB 4GW6A 3PR4A 3TVKA 5KT3A 5J2MA 1T3NA 4IRCA 3M9MB 1NJZA 1UWBB 3CFRA 3PJXA 4I7FB 4R5PA 3IS9A 1Q9YA 1HNIA 1N5YB 4WXWA 4M3XA 1B92A 3CG7A 3ZSQA 3ZSZA 3OY9A 1S1WA 4CHYA 5KFCA 3K2PA 5C24B 4Y3CA 3RMAA 4NLDA 4CJFA 3OS1A 3RMCA 3C6UA 4CECA 3KKSA 3HT3A 3DOKA 4AHRA 4N5SA 4J2DA 2XHBA 1S9EB 3KLGB 3ISNC 3DOLA 4BE2A 3G6VA 2JEFA 2Z1GA 2W42A 2A1SA 4FJJA 2YHBA 3KLEA 2W7OA 1OS5A 1RT3A 4KHWA 3E01B 2HHUA 4KKOB 4TYBA 1DLOB 1XR5A 5KFIA 4F4XA 1RDDA 2NUBA 1RNHA 4CEBA 5KFTA 3RTVA 1S0MA 1RYSA 4RW7A 3KD5E 3DRRB 2FC0A 3HPHA 4CJKA 3ITHB 1NHVA 3OS0A 1SL2A 3QGHA 4OJRA 4TN2A 2XCPA 2ILZA 5I3UB 4FYDA 3O3HA 4IBNA 3OYFA 2OPSA 3NH1A 1LW2A 3OHBA 3U6FA 4O44B 3UR0A 1FK9B 3SUOA 3LZIA 4B3OA 4CGFA 4RW8A 3OL8A 4YQWA 4C8LA 1S0NA 1FKPA 1DTQB 3DRRA 5I42A 4ZMMA 2GBZA 4NLUA 3BSAA 1K1SA 4DL4A 2E6LA 3TWHA 2HMIA 4MIAA 2IC3B 1FXXA 2UVVA 4ZP7A 1HYVA 4J9KA 4IR9A 1NOZA 4B9TA 4KKOA 3KK3B 3BSOA 1L3VA 3DRPA 3TANA 3QINA 4CERA 4EBDA 4LQ3A 3AA3A 2UVUA 1C2PA 4DS4A 3SFGA 2W9CA 3PUFA 2WONA 4NLYA 2VA2A 4DEZA 4KB7A 3JYTB 2HW3A 3H5YA 2X6SA 3FFIA 3AO1A 5J1EA 4CK2A 5L1LA 2HNZB 1RDBA 2HNDA 4WFZA 1ZBLA 1D5AA 4FS1A 1D0EA 5KT6A 3QZ8A 1TKZB 3OYBA 1VSJA 3OYCA 4URSA 5HLFA 3L3UA 5DMRA 1JLCB 1RA7A 3CDUA 4C8KA 2R8KA 4B8AB 3EPIA 1N56A 4E7IA 1LW0B 2RF2A 5CY4A 3PW2A 4IG3A 2KQ2A 4YR2A 1CXUA 5F8JA 2HB5A 5C42B 2XY6A 1XHZA 1C0MA 1RTDB 1YVUA 5KFGA 3DLKA 5KFZA 4K4WA 3FFIB 4NCBA 3OYJA 5FROA 1QSYA 4MK9A 5KG2A 4CGGA 2GIRA 3PJWA 4CJWA 4M3ZA 4DFKA 2O4IA 3V81B 1NK7A 4KHMA 5J2QB 4CJRA 5DG9A 1SH3A 4ECYA 3MF5A 2KTQA 4FM2A 5E41A 2F8EX 1VRTA 4CF2A 1KCFA 1TL3A 2RKIA 2HHTA 2IS3A 4JRPA 4TY8B 3GILA 4IH5A 3V4IB 4Y1CA 5KRSA 1WNSA 4DTPA 1XI1A 4DQSA 2IGIA 4CFAA 2QV6A 1RBSA 1JLAA 3MEDB 4Q43A 5T7BA 3C6TB 2DPJA 4K4TA 3S9HA 4ID1A 2G8UA 5KGXA 1IKWB 2BE2B 5KG7A 4FK4A 3NFAA 4Z4FA 1TK8A 2D5RA 4NCGB 3EY1A 4HUFA 3AA2A 2YKNB 2RKIB 4PQUA 3KLVA 3HP6A 3THVA 3K5MA 1HQUA 1XHXA 1TKTA 1O1WA 4Q0BA 1I3AA 1RT3B 4DU3A 3V9ZA 3SYZA 3H59A 3CJ2A 3BQ2A 4IG0A 5J2QA 4RZRA 3AVNA 1RT2B 1Y97A 1NJXA 5C5JA 4K4ZA 1S97A 4WFXA 4BDYA 1RT7A 4CFCA 2OZMA 4CHNA 2ZE2A 2IJNA 4PWDB 1IKVB 1JLFB 1L5UA 3BGRA 3SUNA 3DM2B 1KHVA 1RTHA 1S1UA 5C24A 2IBKA 2JC0A 2V4QA 3AVIA 2IM2A 1TL1A 4PQUB 3HVWA 3DLHA 1T7PA 4Q44A 1NHUA 1X1PA 3PX0A 3KLFA 1RTIB 1T8EA 4J2AA 1HQUB 2YNHA 2IA6A 5D3GB 3DLGA 3HVRA 3MR5A 4CEQA 3M8PA 3GIJA 3NKYA 5EUHA 2G8HA 1RA6A 3T5JA 1U09A 3VQAA 3ASMA 1HPZA 3AO4A 4NLPA 5CYQA 2O4GA 2B6AB 1J53A 4ECXA 4QWBA 2E4LA 3KD1E 5J2NB 1BQMB 3OS2A 4J9RA 1NOYA 5F8LA 4FM0A 4E0DA 3CWJA 5KFAA 3O3FA 5DGAA 4HYKA 3QIOA 2AU0A 4B9SA 2Z1IA 3L3VA 4TXSA 1XR6A 1TL3B 3NBPA 1TL1B 2WTFA 3TAGA 1KVAA 4H54A 4AHUA 4NLGA 1LWEB 4FCYA 3WNFA 5DQGA 3AVMA 3IGVA 3LAMA 1JXBA 3BDPA 4I9LA 3PW7A 5HRRA 4BWJA 3OYMA 2FBVA 2ZD1B 3NMAA 2FVCA 2G8VA 2VG7A 5JS1A 4IG0B 1WSGA 4ECVA 1JLEA 3O3GA 4CEOA 2JEIA 2XRIA 3MFHA 3VQDA 4BWMA 4ECQA 2E9TA 2RF2B 4DQPA 3CIZA 2YKNA 3QGGA 4E19A 2B5JA 2FBTA 1QE1A 4U6PA 4FLWA 4IFYB 1LW2B 4W5QA 1XWLA 4DSIA 4KV8A 3AO3A 3V6KA 1KLMA 2VG5B 3L2WA 3OYEA 3KHGA 2VG6A 4TLRA 4ID5A 1SKRA 4AH9A 4QW9A 5HRNA 5CYMB 2BQRA 1UA0A 2PYJA 5HROA 3NGZA 3DM2A 4MK7A 4MK8A 3O4QA 2W9CB 3TAQA 4CJ5A 2G8KA 4F3TA 1N48A 4ELVA 3H5SA 2UUTA 2HWIA 4DSJA 1L3SA 2V0NA 1K1QA 1SV5B 3GV5B 4JLHA 2ASDA 3V9SA 1BHLA 5KFNA 3V6DA 5SWMA 3AVKA 3QLHA 3V9WA 1S6PB 4FJ8A 3LP1A 1J54A 4DU1A 5CYMA 3NBPB 3PR5B 1HYSB 4B3OB 3G6YA 2A1RA 1N5YA 3AV9A 4NLVA 2XY7A 4E7KA 4KE5A 3CFPA 3QYYA 4BE1A 1RILA 3MXIA 2AQ4A 1A5WA 3MR2A 4ECRA 3VQPA 2KZMA 1FK9A 3I0RA 3VQSA 2YNFA 4CJTA 4FJNA 4M45A 1ZTWA 3SV3A 3GYNA 5KFOA 4QW8A 3MEGB 3PO4A 1NNDA 4FXDA 4RNFA 2WOMB 4ZP9A 5KG0A 4AILC 2OPQB 3M8QB 3LWMA 2OYQA 4O0JA 2Q3SA 3PW5A 5DK5A 2VWJA 2WONB 1CSJA 1I39A 4FJGA 3VQEA 1S6PA 4CEZA 4M3TA 4DQQA 4OVLA 1C1BB 3OYHA 3PV8A 3RR8A 2F96A 2IMWP 1TKDA 3BSNA 3LALA 2KFZA 3SZ2A 3DOLB 3V1OA 2AX1A 4ZHRA 4MKBA 2FBYA 2OH2A 3QIPB 3NF9A 2QKKA 3KHLA 2BQ3A 5HROB 2PYLA 2E9ZA 3LPTA 2D0AA 3V1RA 3VA3A 1QUVA 3CJ5A 3V9UA 3LAKA 1NK5A 4ID5B 1RT4B 1BQMA 3RAXA 4LSNB 3T5LA 2AGOA 1S1WB 3SQ4A 5L1JA 4CE9A 1QE1B 2KZZA 1L3UA 2W9AA 2J6UA 1RCHA 1WN7A 3SUQA 2YHAA 1REVB 4M3UA 5DG8A 1UOCA 1X9SA 1J5OB 1VSLA 4N76A 1T94A 2UVWA 3IS9B 1TKZA 4F4WA 2OPSB 4LQ9A 4NLTA 4RG8A 4C8MA 3S3NA 3AVHA 4KHYA 1IKYB 2GC8A 5FRMA 3KLFB 3MEEB 2PY5A 3NGYA 1IM4A 3T1AA 3AA5X 2VA3A 1LWFA 3GQCA 4M3YA 1NK6A 3KMQA 4KFBB 5F8HA 1S1UB 4LSNA 1ZETA 1JX4A 2CKWA 4DL6A 5KFWA 4B9UA 4MFBB 3I5AA 3V9XA 4IH7A 2W7PA 2VG7B 4ICLB 2I1RA 4CJQA 1SL1A 2ATQA 1U04A 3I8DA 4KHSA 2OA8A 2AGPA 5KGWA 1C1AA 1WSIA 2BRKA 3KNAA 3KLEB 4URQU 1MU2A 4DL7A 3D0PA 1TKXB 2R2UA 2ETJA 1HYZA 1XC9A 3IRXB 1SKSA 2FVQA 3O4NA 1EETA 2WCXA 2WHOA 1EP4A 3HVTA 1QSLA 2EX3A 3SI6A 4KV8B 1I6JA 4KAIA 1IO2A 1S5JA 4TYAA 4FJIA 1SL0A 3PX6A 2IM3A 3H4BA 3OLBA 4OLAA 3MXJA 2FLNA 1VSIA 2PZSA 4C8NA 4ED1A 1BIZA 4DTJA 4W5RA 3U3YA 3DLEA 4PUOB 1CLQA 3H5UA 4M95A 4CJEA 2E6MA 4RW4B 3OVNA 3OYGA 2JEGA 1VSDA 4DSEA 2JGUA 4Q8EA 4R8UA 5KG3A 3VA0A 3JSMB 1S1XA 1NK4A 3DRPB 4YP3A 1KFDA 3I5BA 3OYDA 4MKAA 1S9EA 1S1VA 4ZPAA 4N41A 2HHWA 4OKEA 4K8ZA 3HSTB 1TK0A 3S3MA 4FW1A 5T14A 4QWCA 2J6TA 4Q45A 3C6UB 4NLQA 5KFKA 3ZT2A 3H40A 3JSMA 2WB4A 2P5GA 3DDKA 4MFBA 4F2RA 1ZTTA 3DMJB 4DG1A 2HNYA 3ALYA 4Q0BB 5KT2A 4Y1DA 5KRTA 2C2EA 3RMDA 4RUCA 4DL3A 4KTWA 4WE1B 4IOBA 1A5XA 4ZPCA 2KFNA 3L8BA 3K5OA 4NCGA 3C95A 4ZTFA 4ICLA 2ZKUA 5HLFB 4JV0A 4DL5A 3LP0B 1X9WA 3MECA 1HRHA 4ZTJA 3IN5A 3RRGA 2D41A 1IH7A 2YKMA 1S6QA 4FW2A 1RDCA 1JLBB 3MEDA 4CFBA 3KLIB 1HMVB 3UPFA 4CHPA 3P5JA 1T05A 1N6QA 1RTHB 2R7YA 3CYMA 4HHTA 4B9VA 1QQCA 3RB6A 3LP0A 4Q8FA 3HXMA 3V81A 4OLBA 3RRHA 4DQRA 4WFYA 3HHKA 4FK0A 4CESA 4ECZA 4M94A 1RTDA 3M9OB 1RT1B 3OL6A 4CGDA 2D0CA 4KFBA 1RT4A 4J9QA 4IH6A 3TR8A 1HMVA 3G86A 1A5VA 1RT5A 1U49A 4U7CA 4DWIA 3NGDA 4KO0B 1WSEA 1S6QB 3SI8A 2YKMB 1EXQA 2G8WA 4RW6A 4FJ5A 3OSPA 4KPYA 1J5OA 4EO8A 4TQRA 3P83D 3QIDA 5I3UA 4CJVA 3V6JA 1T05B 4J9OA 4XIUA 3DYAB 5JUMA 5F9NA 4F4YA 3L2RA 3V1QA 2HNDB 4DL2A 1U47A 1RDAA 1HNVB 3LPUA 4URGA 4YMEA 2EC0A 2DFEA 1JLGA 1JKHA 3KK1A 4FLYA 3SPZA 3VQ9A 4TQSA 4JV2A 2QXFA 3IGNA 5HRSA 5FDLA 2G8IA 1BIUA 4Z4CA 1TVRA 1SUQB 1TAUA 4MH8A 3SQ1A 2ASLA 1GX5A 4K4XA 3NH0A 1BL3A 4DG1B 3BGRB 2R8GA 1G15A 4Q5VA 2HMIB 4AHTA 3QNNA 4NLRA 4M3WA 4B9MA 4PWDA 5EWEA 3KK3A 3HK2A 2I5JB 1SH2A 2W9BA 2HHXA 3ZSWA 1RDRA 4KHRA 4O3SA 4H4OB 3SJJA 4FLVA 4FZXC 2Z1HA 2F8SA 1IG9A 2WRMA 1JLQA 1TAQA 2WOMA 1RAJA 2F8TA 1BISA 4YFUA 3CVKA 3HVAA 1TVRB 4RU9A 4M41A 3F73A 3KTQA 3RAQA 2VG5A 3UQSA 3GV7B 3OJSA 2FVSA 2R2TA 4ZPDA 4KRFA 3N6NA 3KK2A 3ITHA 1JL1A 4IFYA 3KLHB 1KVBA 4ECWA 1D9FA 2OPPA 1WSFA 3ZT1A 1EP4B 3HVTB 2RN2A 3T19A 4GMJB 1WAFA 4NRTA 4CHOA 1TKXA 2XI2A 4GC6A 1YVFA 1RT1A 4RNMA 3NCIA 4OL8A 2IOCA 3KK2B 4LH5A 4J9SA 2UVRA 2R8JA 2DFFA 2Y1JA 3FQKA 4DU4A 3AVBA 2FJWA 2IM1A 1RT2A 3DOKB 4NLOA 4O3QA 3QEPA 4HVJA 4HCCA 4ED6A 4X2BA 4LH4A 2BANA 2BGGA 1BI4B 2RDIA 3VQ8A 2XY8A 2V9WA 5L1KA 1QHTA 1TK5A 4FJHA 2BANB 4DTXA 4YR0A 3OYKA 5KG1A 4G1QA 4NYNA 2IM0A 3F9KA 4E7HA 3OSNA 4KTQA 5KFSA 4FLXA 3MXMA 2Y1IA 3D5MA 1REVA 1ASWA 1YT3A 4E7JA 1JLAB 4CJLA 1VSFA 2ASJA 3TABA 3TAMA 4K4UA 2JLEA 3BQ0A 3BREA 3ULDA 4FLUA 4HCBA 1KHWA 4ED0A 4JRQA 1TQLA 3LDSA 5J2MB 4E7LA 4H8KA 4F50A 4NLWA 3G10A 4ZP8A 5KFEA 2XY5A 3D45A 4HUEA 4EBCA 4C8OA 3QESA 3VQCA 4RNHA 5DQHA 1XR7A 4H4MA 4CEAA 2HNZA 3LANA 2B6AA 1KLNA 3HO1A 4NLSA
chains in the Genus database with same CATH superfamily
2DTUA 4YNQA 3KHRA 2PEHA 3MR6A 3WXLA 1S79A 4GVMA 2DGTA 1R8AA 4M42A 1Z4UA 2XSJA 5IFMA 2WTUA 5KTQA 4BQLA 3DLKB 2IRYA 4OJ1A 1L3TA 3OHAA 1D3WA 1NB2A 5AXLA 2HMPA 3QEVA 4OFZA 1KQFB 4AFFA 1HLUA 4O4GA 1VQON 4M5MA 3W60A 4FK2A 2RDDA 2BM1A 2Y9HA 3A4TA 1VDHA 2IDOA 3D2EA 1MU2B 3TEGA 2W25A 4IR1A 3ZT4A 2BOAA 4I2PB 3N6LA 3NE6A 1RJJA 1LW0A 3LW5C 4FJLA 1JJCB 1QVGR 2KRBA 1SJ1A 4E1MA 4CJPA 3LP3A 1D1UA 1PCAA 3ZT3A 4KSEB 3LDLA 1BWFO 5CZVA 3AO5A 4LF5J 3THTA 3SAFA 4USWA 5B0AA 2MZRA 5M2PA 4YY3J 5ADXA 4BACA 4NLCA 3DGPB 3HSZA 3JQKA 3DI6B 1WSJA 5BYRA 5F3TA 2F3JA 4JNEA 1I94F 3D28A 1DQ8A 3D1QA 2XWYA 4UQGA 4AHVA 2YKPA 3MCMA 5HRPA 1N88A 1VRTB 2HHPA 2HBKA 1SKWA 4NE9C 3HX9A 4FSVA 3R5CA 1RFQA 1NBEB 4X66F 2GCFA 1P1LA 1W7AA 3VN5A 2VCPA 3IDHA 1CEZA 2F4VK 1WI8A 1JLEB 2ZVSA 3UN3A 2ATLA 4M7YA 2HWHA 4GV3A 5AE1A 1U2RA 2G1DA 4Y28C 3GIKA 3I8BA 4F2SA 3BGUA 4MIBA 1ILYA 2OZSA 4R0JA 2HYIB 1VQOS 2CADA 5B0GA 3ZTPA 3MM9B 3Q8QB 3FNNA 3R8EA 4KHQA 3V4IA 3VOVA 3PYEA 3HZGA 1NMEB 2Z1JA 4A2BA 1JLGB 1UFWA 4IFEA 4NYPA 2YNIB 3FRZA 4FN5A 4A8YA 2DFHA 4N8OA 2GVZB 2KHDA 3FFKB 2ROGA 3E51A 4DTNA 6FD1A 2UXDJ 4ZKAA 2QYGA 3AQOA 1R8HA 2YHYA 1N32J 3TQ1A 4AYBD 5A8RA 3PHEA 4KO0A 2VDHA 3L4IA 4NL5A 1WOOA 5KT7A 2NZTA 4B3SJ 1AROP 1RK8A 5EY4A 2P1JA 1KVCA 4QWDA 3HJFA 1LOTB 4WYLA 3SUPA 4C3LA 2NCKL 3PRDA 1DTTA 2E5LF 2YNGA 3BN4A 2AW0A 4H4KC 2Q43A 2DGVA 1JCGA 4EI2A 1YI2S 2CQGA 1S1TA 3P4IA 1RAGB 2EFQA 4ZVTB 2DY9A 3B8AX 1B7YB 1YJUA 1NJIT 4JI5K 4YHHK 3O4WA 5KG4A 4FJ9A 1X0PA 4K0KK 4YB6A 2ZNYA 3K5LA 4AHSA 2BE2A 4ZDNA 1RTJB 3SFUA 4Q7AA 3EYZA 3N5BA 1M5SA 3J7YP 3LGNA 4JBCA 4HTUA 4Z4IA 1C0UA 4OHWA 4LF4J 4DLGA 3OBWA 3BKUA 1TUYA 4FF1A 5DG7A 2OHDA 2QA4S 3A8JA 2BACA 1YJNN 2DH7A 3GYGA 3NNAA 3ZX0A 1F0XA 4QPXA 2MQLA 2RPIA 3G82B 3G96A 4DKWA 4FZZA 3VV2B 3JTOA 2KKHA 4IOXA 3TSPA 2XGQA 2FVRA 4F3MA 5CZ1A 5E7OB 4BS2A 2DHSA 1S7HA 4CCHA 1GTEA 3J80U 3DI6A 4IQMA 3KOAA 3QWUA 5JJBA 3M2UB 1S0OA 1CJUA 3CFOA 3OXGA 4ED8A 2ZUAA 4E1NA 1I1GA 5DM7Q 2FJVA 1IKWA 4NXMF 3SQ2A 1B9DA 2QLFB 3RR7A 3OJUA 3J7ZO 5K14B 4RNOA 1CQNA 1NGAA 4OLOA 1HR0F 4A5BA 3OYIA 3PFEA 2AJQA 2HGNA 2QWPA 1NJWA 4BRDA 1RISA 1JLCA 3NGUA 3DLJA 1WLJA 3I4HX 1QTMA 4OV1A 3DXMA 5AT1B 1Q8IA 2MPUA 3TAFA 1JIHA 3THPA 4WKRA 3G0ZA 5B8HA 2D4WA 4ZP6A 2OLWA 1LWEA 2GWJA 3VQBA 3C16A 2HVIA 4JK9A 1WB9A 4CEEA 1GOAA 4J9VA 4KREA 2XO7A 3SPYA 4HHUA 4DV6J 3CGIA 1RT7B 2FSJA 5T41A 4WF9Q 2JVRA 1FRLA 2DNRA 4EGLA 2R7XA 4YHHF 3W63A 1TGOA 1R0AB 2ITGA 1NHKL 2VD3A 3C15A 2QWOA 1VRUA 3I0SA 2R7QA 4L74A 3ATUA 3SLCA 4G9ZA 1NK9A 4H5VA 2VBXA 4DUYF 3D1HA 1HR0K 2DXDA 3QDKA 3CCWA 2BH1A 5F8MA 1RBVA 3H2LA 2XYGB 3MCAB 5DJBA 3C6TA 3VQ7A 3GG0A 3CDWA 1RWPB 2VL1A 1TV6A 5HP1A 5J2PB 2JH3A 1RBRA 4JI0K 1EQ0A 1ZS6A 4Y2KA 5IM0B 3WNGA 1CZ9A 3HULA 3CCLN 1U2CA 3G9CA 1EQMA 1HIYA 3UCUP 4CZHA 3VEOA 2LFVA 5HMWA 4CO3A 5BRHA 2ZM6J 2DNZA 3DNCA 4PA1A 2QWNA 4KI6A 3IFEA 4LF9K 4O44A 3UN5A 5AE3A 4RX6A 4JS4A 2HHSA 3O44A 4RTFD 2R7UA 4KHNA 1ZOTA 5KG6A 2HS3A 2YNIA 4F4ZA 1HNXK 2MY7A 1ACMB 4B9NA 4FL9A 3OFGA 2D69A 1T03B 1S6UA 1H73A 4RW7B 3SNNA 1WOQA 2FBXA 4W5NA 1SJQA 2D1CA 3GSIA 4PQAA 4NEZA 1RU2A 2VODA 1LWCB 4NZ6A 4EWTA 1ZM9A 2E1RA 4X64F 3EN9A 4A5AA 1MSWD 2E7WA 4KH4A 4MKYA 1XERA 4H5NA 2AJ0A 4O3RA 1C0TB 2DEJA 3D68A 3PVXA 1BI4A 4BRLA 3QT8A 3BBCA 2PBDA 3U8XA 5EVZA 3NGIA 1IQZA 4FPBA 1JLQB 2OPRA 4ES1A 3U27A 1IR2A 3D2FB 4FNHA 4ZHRB 3FGVA 3QRQA 5GVQA 5GAHI 3N9UC 4UF4A 2WUSA 5L46A 1R0BG 3CJ9A 3LP2A 1TUUA 4DPYA 1UCNA 3LOUA 5LM7E 3VEZA 1WORA 2KLAA 4FO0A 4KAZA 2WSFC 1RT6B 3KFWX 3OYLA 3NS5A 3HYFA 2YQ1A 4AHCA 1GX6A 3TNVA 1WDDA 4JI1J 2OEJA 2Q1NA 2A3JA 3MCSA 4I2QA 4WQ4A 1KTQA 4F0KA 1NPKA 2P9IA 4DV5K 3CCSS 4BDZA 1WAJA 5KFLA 4BY9C 1HPZB 3AY9A 4B02A 1S10A 3OV7A 1G3OA 2DJWA 1HKAA 2C3YA 3SSQA 2HWTA 4O5BA 3NS6A 3T3FA 2QL9B 3P6YC 3O6QA 3I9V9 4TY8A 2JEJA 3I6PA 4I1TA 2E7XA 3MWBA 4OGCA 4CEDA 4NI2B 1WHVA 1J9AA 3JTNA 5MLCQ 3O5TB 1NH8A 3OHRA 3A8YA 3ZSRA 2G9OA 2ALZA 3D1OA 4LRFA 5F9LA 5FLXU 3L2QA 4RWWA 5KFVA 2JC1A 4L3QA 4DTSA 1GLJO 1IXKA 3VAHA 3MM5B 1HJRA 1IN0A 3RSEB 1J6ZA 2KKZA 2KXFA 3C0BA 2F4VJ 4K50A 1RBAA 3SQ0A 2B9EA 2UUAJ 1ZBHA 2R7WA 1TV6B 5HP1B 2GS8A 4WTOB 1DLOA 3DC2A 5IWAK 4M1KA 2YCHA 2CXEA 5ETRA 3FCVA 4DFPA 4OKJA 1NGDA 3MMAA 2JFDA 3AB4B 4ZLPA 4EBEA 3HSGA 3G82A 1NWKA 3MAAA 3D3CJ 3L2UA 1OY9A 1RLCL 1W25A 2NUHA 4JB8B 2G1HA 1QQMA 2DNLA 1YBTA 4CLUA 2E1AA 3DXBA 4OZLA 1FTCA 1KVIA 4O4GB 4M5GA 5KT5A 1MN9A 5F8NA 4O3NA 1HWJA 4AL6A 3K9KA 1DURA 2QC3A 4QOTA 2VFSA 2ZDOA 4U7UK 3NNCA 1T9TA 3C19A 1JQGA 3HPGA 4IFVA 3RBDA 2RH3A 4IKAA 1N5TA 4LT6A 3T69A 1LFPA 3H90A 1WWHA 3D3BJ 4FZYA 3A2FA 3NAHA 4GW6A 1S1TB 4ZPVR 1UWBB 4DR1J 2CH6A 1DARA 3IS9A 1NU0A 1HNXJ 4X4QA 4CVNE 3N01A 1N5YB 4EAHD 2L3MA 3CG7A 3ZSQA 1T0TV 4GO5X 1PJ6A 1XEZA 5L9NA 1HNXF 5D8HB 2IVPA 4CJFA 3OS1A 3RMCA 3C6UA 4OYWA 3DOKA 2N3LA 3M2UA 4N5SA 2PI4A 4A62A 2CWXA 1S9EB 4X62K 4BE2A 2EG1A 3G6VA 2QMXA 1UPMB 2P6TA 3V4MA 2YHBA 1N34F 2W7OA 4ANEA 3R5BA 3W65A 2FGOA 1XR5A 2N3OA 1IBLK 4AL7A 2YWHA 3RTVA 3AAWB 1S0MA 2Z58B 3DRRB 4LRAA 4BROA 1XTZA 5B0BA 2GUPA 4UOGA 2R7OA 4USVA 1NHVA 4OLPA 1SL2A 4FNIA 4MDAA 3O3HA 2AJ4A 2OPSA 1NGIA 1HNZJ 2ZGZA 3UR0A 1AFIA 1ELOA 3CC2N 4B3OA 4A8KA 5T7LB 2I7NA 2ZVIA 4YQWA 1BU6O 2VJVA 3EJMA 1FKPA 1HNZF 3DRRA 4HHJA 3T7ZA 4ZMMA 2PEBA 1K1SA 2RE1A 4LF6J 2E6LA 4KY3A 2UVVA 4ZP7A 1HYVA 5HQLA 4J9KA 4IR9A 4K5SA 4C11B 4KKOA 3FJ2A 3BSOA 5HQ8A 1G2EA 3DRPA 3TANA 3MOZA 1N54B 2BKOA 3RW7A 3UCZP 2HBRB 4LQ3A 3T41A 2ZJPL 2XNQA 3SSRA 3THXA 3IM8A 5BYQA 4C4WA 4DV3F 2VA2A 1K73T 2FGCA 3HHLC 2HOEA 3T9ZA 3FFIA 4A57A 3AO1A 5J1EA 2CNKB 5L1LA 5DO2A 2VOPA 2HNZB 5BXIA 3A0IX 4WFZA 1ZBLA 2DH9A 4NB4A 1TKZB 4I6WA 3CCUN 1VSJA 3OYCA 3FMBA 1AUSL 3NMRA 4QJVA 2YVSA 4WFNL 4GVLA 3UWTA 3VGSA 4ID8A 1LW0B 3O9TA 1VQNN 1B7FA 3HFZB 4I6MA 1RTDB 1GLDG 2FY8A 1YRXA 4L75A 3DLKA 4K4WA 4PXEA 3OYJA 5FROA 2PFUA 1WKLA 2N82B 3I33A 1VQMS 3TZWA 1U1QA 1VC0A 3MEKA 1KXPA 1TYQA 4BREA 3Q89A 2KTQA 3UVJB 2F8EX 3N79A 2OEMA 1VRTA 2CRLA 1AZSA 4B1VA 4X62F 2HHTA 4W92B 3Q22A 1ZBTA 4YOUA 4NX9A 1U26A 2DNHA 3P5BP 3QAEA 4CFAA 2J4RA 2QV6A 2GO8A 1Z2LA 1S72S 3POTA 2DPJA 4K4TA 2MSSA 3I32A 4ID1A 2G8UA 3VGLA 2P9KB 5DS7A 4FK4A 4V19S 1HA1A 4Z4FA 1TK8A 3S01A 2YKNB 4UUWA 3QFPA 4NXNK 3A12A 3JXOA 4GKJJ 5IT9Y 1DQ9A 1U2VA 2VBWA 1RT3B 1S72N 3MN5A 3MPDA 5J2QA 4IEEA 1YRTA 4CBXA 4ZVOB 2HHHK 1RT7A 4CFCA 3GMGA 1VQ5N 1JLFB 3SSSA 4JKBA 1L5UA 3T1YF 3E9PA 4ENOA 3BGRA 3SUNA 3DM2B 3TEHB 4WP9A 4L72B 2QWRA 4Y2IA 2JC0A 3ZZ0A 2AF6A 1RDWX 2Y0SD 2IM2A 3DLHA 1UVIA 3E8OA 4Y2MA 1NHUA 4Q44A 3KLFA 1T8EA 1U2VB 4J2AA 2V8DA 3K2YA 3BYRA 3HVRA 3DOMA 5IV3A 3QFUA 2G8HA 4DX7A 2FF6A 2F9TA 2X1FA 1DHMA 3AO4A 4NLPA 2LU1A 2NRXA 4OI1A 5GMDA 3VEYA 1Y4ZB 3AH6A 4K8RA 3I4PA 1U1MA 2VASA 4BRAA 1EJ7L 4PG7A 3KD1E 4MYTA 5J2NB 4QS8A 3AAQA 2RQCA 2WVEA 1R27B 4E0DA 4FM0A 4BRPA 2HF4A 5DGAA 1FDNA 3CEDA 2YX6A 4HYKA 2AU0A 1IBLJ 2ITMA 3VF6A 1XR6A 2QSFA 1AZSB 3B8HA 2ZH3A 4MDBA 1QTNB 2CJXB 1YWXA 4RPFA 4FCYA 3AVMA 1K8AT 3BDPA 1JXBA 1U24A 2YY3A 4I9LA 1IJFB 2NXNA 3OYMA 3KUHA 2Q0RA 1YZ7A 2FVCA 2VG7A 2H51B 2F4VF 2N7YA 1WSGA 2BVZA 1ZC6A 2YQ0A 2XRIA 3VF0B 2CYYA 4BWMA 2RF2B 1KEKA 2OD4A 1HKCA 5ETVA 4LF8K 3AFGA 2FBTA 2AKWB 4LF4K 4U6PA 2G0JA 1ROFA 2YKAA 4IFYB 2MKJA 4QR0A 1XWLA 4KV8A 3V6KA 9RUBA 2FHJA 2GJIA 5FLXO 4LBIA 2VG5B 1NZAA 3OYEA 5DDQC 3MN6A 1U1RA 2DNNA 5K9FA 5HRNA 2XMTA 3UNYA 2H5JB 4Z7CA 2GZOA 2UXBJ 2BM0A 3Q2SC 3AD9C 4PAAA 2LKZA 4O8KA 4DR6J 3HD1A 3MOJB 1OY6A 3VMFB 2UUTA 4H5RA 1UAWA 5G4DA 2V0NA 3BS9A 2XLKA 3CC4N 5B0CA 3AQPA 2Z2MA 3MTJA 1ZZNA 2CQ0A 1ZA1B 1H72C 3G6YA 2A1RA 1N5YA 4DCPB 4DV7F 2DVIA 3AV9A 4E7KA 3SDEA 1M90T 1LFWA 4B1XB 2QT7A 3VQPA 3QRRA 2F8HA 1FK9A 4JKHA 3I0RA 1RWWB 4ER8A 4PL8A 1ZTWA 1EWRA 4M45A 5KFOA 2X1BA 1B0TA 1X4AA 3CSKA 1CJTA 4QW8A 1SQFA 3MEGB 3G71N 4FXDA 4AILC 3MM8B 2MB0B 4PG4A 2O8CA 4AF1A 4O0JA 2GHWA 2VWJA 3EKSA 1I39A 4FJGA 3R2CJ 2B56A 4M3TA 4XEIA 5I4MA 2A6AA 3OYHA 1VCTA 1S76D 6AT1B 4JI8K 3BKFA 3UB5A 3DOLB 1HBMA 4A48A 5AQTA 2LCWA 2QKKA 3CQYA 4H5WA 2CG8A 2UZAA 1ZPWX 4OZ1A 1S6OA 1N33K 2E9ZA 3CMAN 1OKJA 5GADI 3V1RA 1G99A 3W62A 3VPZA 3LAKA 1LKZA 2D0OA 3UD5A 4IWVA 3R6GB 4PWWA 2AGOA 4PEOA 4DV4K 2NREA 3JQJA 4ED5A 4DR6K 4HHHA 5L1JA 2B4VA 2FZGB 3LM9A 1QE1B 2KZZA 3PRBA 5HATA 4H5TA 4DR3J 2X1AA 2YBVA 1X9SA 1VSLA 5E26A 2HFOA 4P2MA 1TKZA 3NNHA 4RG8A 3S3NA 5F2RA 2HBLA 2LQ5A 2NZ4A 3MEEB 2M8DB 2EFVA 1L3KA 3AA5X 2DGUA 1JNZB 4M3YA 4KFBB 5F8HA 1S57A 4BR2A 2CKWA 5KFWA 3FZ2A 4DV2F 1XC3A 4D3HA 1RHRB 2W7PA 1X7VA 4ICLB 5AR0A 2CPIA 1X31C 1SL1A 1HNWF 2EEYA 3LGHA 4USHA 2ZH6A 2CQ1A 1RLDA 1MNEA 3KNAA 1OSCA 1F3VA 4URQU 2QLJB 2KDOA 3NOCA 2ZEJA 2P9SB 1TKXB 1DFDA 3NLCA 2HIQA 2Z2ZA 3ENWA 4WCEQ 2QG9B 3J81O 2KYZA 4PKDB 1HNWJ 3M1FA 2FVQA 1FRIA 2N4CA 1B0VA 5AQXA 1EP4A 1TL4A 3OVBA 1B0PA 1MG7A 4TU8A 1KN6A 1DJ0A 3MM8A 2DHXA 1M5KC 2F9JA 3W61A 2VQFF 4P74A 4DV3J 3EWGA 2BW7A 4WQ4C 5CH7B 4OLAA 3MXJA 1N5SA 4OYBA 1BIZA 3DLEA 2CQ4A 4M95A 2AJFE 4CO2A 3D0GE 2KJVA 2JEGA 1QHAA 5K8MA 1CZAN 2VB6A 5CR4A 4AM6A 2DKOB 1NK4A 4PPDA 1CULB 2IBOA 3DRPB 1WBBA 3M05A 3B82A 2NQPA 5AQZA 1U02A 2JX2A 1CJVA 4BC7A 1S9EA 5K8PA 3CDAA 2V8VA 3S3MA 4QR2A 4FW1A 2L48A 1IBCB 4OYMA 3H40A 4F9OA 2WB4A 2CVEA 2YXLA 2XHWA 3RUBL 3DMJB 3EE9A 2HNYA 3OR1B 5KT2A 4Y1DA 4EIAA 2Z2YB 4DL3A 2LU2A 4RR5A 2HQFA 8AT1B 2MZSA 1YSJA 3KWGA 3K5OA 4NCGA 4ZTFA 2JSXA 3OTOF 4JV0A 4DL5A 1X9WA 2W2MP 4I0WA 2D41A 2XULA 5L39A 3M2RB 4AM7A 4U9RA 1Q53A 3HZ6A 1KAYA 3O1WA 5LXYA 1IVZA 1KQGB 1AXQA 1HW9A 1X4CA 4JI8J 4CHPA 2HBZB 1C4CA 4LFAK 2R7YA 1Q81O 3LP0A 3SMPA 2MYFA 2MQOA 3SQGA 3HXMA 2AEJA 3HT0A 4OLBA 3M32B 2CA9A 2NZCA 1MMNA 4K43A 3ZZUA 4DQRA 4ECZA 2A2DA 4M94A 2G2ZA 4KGXB 1SJ4P 4JAXA 1RT1B 4FWMA 3OL6A 4KFBA 4J9QA 4IH6A 2IVFB 4ZIWA 1HMVA 3F44A 1QQOA 5LOQA 3AY0A 3US5A 3T6JA 4U7CA 2YTCA 1JJ2M 4DWIA 2E1MC 3NGDA 4KO0B 1WSEA 2UU9K 4ALZA 3SI8A 3L09A 3M8YA 3ZO7A 3E9OA 2WZ1A 5I3UA 3JXUA 4YDUC 5D4LA 1KOHA 3B78A 5F9NA 4RWTA 2HNDB 3EM1A 1U47A 2KL8A 1J27A 4KC5A 2DFEA 2Q66A 1JKHA 2R9LA 1U0SA 4DU7A 5E3QA 1LWXA 3IGNA 5FDLA 2AJ1A 2G8IA 1N8RT 1H7WA 4Z4CA 3DWLA 1TAUA 2GMHA 2F5GA 4WK1A 1TYQB 1UEVA 4TVAB 4IOAL 3VF4A 3BGRB 1KC8O 4Q5VA 1TFWA 4BRFA 3ET6A 2NSCA 4PWDA 3JTPA 4WWSA 2KB2A 4L3NA 3CJAA 3H0PA 2MGZB 2HK3A 2ROPA 1OVQA 3ZZRA 3GJTB 2K3KA 2KG1A 2ZOFA 2LECA 1IG9A 4Z2XA 3BGLA 4O8UA 3JB9k 2NYIA 1T6DA 3AD7C 3HVAA 4M41A 4DR2K 1RWUA 3KTQA 2O01C 2CNOB 4WYBA 2HVDA 2VFTA 3IBCB 3L7PA 4ZPDA 4KRFA 3N6NA 3J7A1 5JVGQ 3RW6A 2HGMA 2J9DA 3C2PA 3W8GA 5HN0A 4V19J 4GC6A 1RT1A 2CPFA 4LRDA 4LH5A 1Y5NB 3LPEA 3BO2A 2ZBRA 2DFFA 3AJ1A 1FHTA 2Y1JA 4DU4A 3BB5A 1IBKK 1RT2A 4NLOA 5GADP 1JJHA 1GLCG 2HRUA 2F40A 4HVJA 4PWUA 3FSXA 1EO1A 2V2VA 3UW1A 4HR2A 1CS4B 2MQMA 3ETMA 1U1OA 4FJHA 2BANB 4G1QA 3D7EO 4E7HA 3V2UC 4YS2A 4DR5K 4DX5A 3MXMA 3ULEA 3MZIA 3KUGA 3BDEA 1JLAB 4CJLA 1YITN 3TAMA 4JI2F 3BQ0A 3CD6N 3BREA 3ULDA 4HCBA 3M1VB 5B08A 4DUYK 2XMMA 1TQLA 5G0RB 1S77D 5IT9U 4X4RA 3VAIA 2ZWHA 4H0TB 5A6WA 4H4MA 2HNZA 2B6AA 1KLNA 4NLSA 3UIQA 4YY3K 4CLFA 2R8IA 2D74B 4FVMA 4PXBA 4ZPTR 3QERA 2PDAA 3HKZD 5C2FA 2UYTA 3MCPA 3TQEA 1H74A 2P8IA 1Q79A 3AVLA 1B4SA 3DLRA 4FLZA 1Q5YA 3R7NB 4OZ5A 2JDJA 1VLOA 4BRMA 3M6XA 4UOFA 2ZH5A 1UA1A 3BZKA 3GIMA 2EK6A 3DLEB 3KJFB 3CNQP 2NPIA 4FPIA 4UY85 3ZEUA 5HO4A 2E2PA 4K4YA 2NR0A 3IR5B 3KG0A 1NJIO 3EGNA 4EZ9A 1XNQJ 3FBBA 1WHXA 1U1PA 1T11A 3GIIA 4MQ3A 4I6YA 4FS2A 3QT5A 1HARA 2OP5A 4LRCA 2VWKA 5EWGA 3KIOA 1IR0A 1K6YA 3MCOA 2C2DA 1XNQK 1N32K 3EDQB 4JKAA 4B1YB 3J8AA 4OGEA 3A8KA 2MQQA 5IWAJ 4JKDA 2GHVC 3NHGA 2GV9A 2NRRA 1LEOA 2ABYA 2JWLA 1XQSC 1U48A 1OPZA 4C9DA 3DRSA 4CWBA 3QJLA 2BRLA 1U1KA 1KQSR 5C42A 1S9GB 4CH0S 4GVBA 1SC4B 1Y10A 3QT6A 4WJBA 4JHDA 3T6BA 2YWEA 1XNQF 4WQ5C 4ECUA 1LK5A 3FEYB 2YV0X 3IUCA 4P2SA 2Q6CA 3UE2A 3PW4A 1BHNA 2UP1A 4OX9J 2HVHA 3L95X 2CPEA 2J0XA 4DV1K 3QBWA 4UTGA 2LSNA 3CMQA 1HD0A 2E1CA 2M9KA 2E9RX 3QEWA 1IKXB 1KC8T 5JLHA 4OX9F 3EEQA 2XZWA 3G6XA 4DJBA 4DTUA 5C10A 3F2KA 4YR3A 2XMUA 4EYHB 4ERDA 3QBXA 1VQNS 3O1BA 2W9BB 3WX8A 4CHQA 2YWWA 3RMBA 5KFYA 1VI7A 1DGKN 1R8BA 3CJ4A 3I5CA 3RJMB 4ZVSB 1PAUB 5AQRA 2LLZA 2XS2A 1SUQA 3PZPA 3K57A 1GMWA 2ZE2B 3H1VX 4DTMA 1HL6A 1WACA 5EOYA 2Y3YA 3WEEA 1TELA 4HL9A 3M8PB 5AQFA 1IKXA 3CD0A 4DBQA 1VHFA 1ZBFA 3QETA 4U7UD 3SBTA 2AP6A 4HH1A 2FSKA 2YPZA 1RTIA 4YHHJ 1Z26A 2CIMA 5CYQB 5J1EB 3NWRA 4RW4A 4CZEA 3QPIA 3I0RB 1C0GA 5C25B 3RB4A 3R5AA 3KWIA 3QQCD 4RW6B 2BW2A 2RQMA 3FEZA 3PACA 5D3GA 2ACMA 5BR8F 2QA2A 2I7PA 3LH2S 4FM1A 5LMNJ 2WAQD 3MPUB 5EN1A 3VGKA 3ZNJ1 1C1CB 4I56A 2JOQA 2FVPA 4F3OA 4LF5K 1VIXA 3NGRA 4BRKA 2YWFA 1C0FA 5BJRA 4DLEA 1ATNA 3TUZC 1NSPA 3PW0A 2RRBA 3FQLA 2GVZA 4ZCLA 2P2CB 1IBMJ 1FNMA 1QUPA 1S48A 1ASVA 2VYPA 2QKBA 2B9XA 2M2BA 3OL7A 5F0XA 1IUJA 1SH0A 4JI5J 4Z4GA 1FXLA 2BDPA 2I6WA 2QE5A 1FESA 3CCVN 4IO9Q 5LJ3Y 4JKGA 1WG1A 5I3QA 3ZSYA 1Q0NA 1Z25A 3HSDA 4FZVA 3IO1A 4B17A 3DGVA 2ZC3A 4DR7J 2DHAA 4C97A 4ISGA 5RUBA 3NH2A 1IJJA 2FJBB 3VENA 2IA0A 2MZ1A 4A8FA 1KFSA 2YKOA 2XB2D 4O0IA 1H2UX 1ZBIA 1Z2ZA 2UU9J 2C2RA 3O80A 2QN6B 3DLBA 1O0PA 1UKUA 1VGYA 3QB0A 1QDUB 1QY7A 2C3UA 4DX6A 4CI0B 2DBBA 3K58A 1BE4A 4DSKA 1LV5A 2L9WA 2LP4A 1ZZFA 3FZMA 3UDLA 1ZYQA 2CJ9A 2CPXA 3U1NA 3I9ZA 3SBGA 4JUZA 2OJ3A 2VPYB 3D2FA 4Z7YA 4FVCA 1YJ9N 1UW9A 3EL2A 3FSIA 1S5ZA 1BXNA 5EX5A 3CDEA 3OXFA 1MMDA 3MDQA 1UFKA 3CM6A 2POKA 3VAMA 1Q18A 4DR4K 2HKEA 3QO9B 1X4DA 5K20B 4DFMA 2X1GA 1VQKN 1FVQA 4ZLNA 4J2BA 2DT9A 4OYXA 1MW7A 2VPXB 4UUXA 3O5BA 1SJFA 4MO5A 4GV6A 4CJ3A 3KJNB 1BWEA 2B7CB 4X4NA 4F25A 2DRBA 2AX0A 3JYTA 4OZNA 2R7RA 1CXQA 2M88A 4R0EA 2IDEA 1T03A 1NPRA 1EKEA 3ENOA 2BR0A 2V5HG 3CCES 2PD1A 4P6QA 1AFJA 3MFIA 3C14B 2IJFA 1VSMA 4G1PA 2ZJPQ 4JI4J 4J9PA 3ZYYX 3QLHB 2V63A 1GTHA 2SXLA 1W0HA 4DV7J 4FLTA 1E4GT 4ZVHA 3TA0A 2VPZB 1BDGA 1HHTP 4EO6A 3H3OB 3HP9A 2ACYA 4TU7A 4ZJQA 2GX8A 2Z0GA 1YHQN 3CCQS 2VONA 5J2NA 1RGVA 1HNVA 5LMNK 5AQNA 5E3CA 3TARA 1VK3A 1Y9OA 3HM9A 2QYCA 3VVTA 3L9ZA 2FB0A 1JB0C 1GNKA 1YJVA 3C66A 1DAXA 3R97A 4L3KA 2CZVC 4ELUA 1YDLA 4WZQA 2Y8YA 3QAUA 1HX1A 5HSPA 4ATNA 4LFAJ 3I0SB 1AYEA 3P39A 2F8MA 4CLTA 5KFFA 3NF7A 2P9NA 3CERA 4BRIA 1JLFA 3NAIA 4TSXA 1EAYC 1P90A 1K0TA 3OTBA 5DGBA 1WKKA 4DX8H 4KH6A 4I7FA 1F2HA 4CZJA 5AFUA 4DR3F 1U25A 3AVAA 5AZIA 4FF3A 2WBRA 3QEXA 3CCJN 4KHUA 1R59O 3KLHA 3TU5A 1F9EB 3EMTA 4CGHA 4JI2J 4FWRA 2C3OA 3TSQA 5B0FA 3J80O 1LQ9A 3AVJA 1CJTB 3KJQB 2G2OA 5IWAF 4NCAA 1XMOF 3ZCMA 2MJNA 2IAJB 5I3PA 4LFCJ 1BQNA 1HBUA 2LQBA 4CRJA 2CDRB 4F0MA 3NWGA 5KFJA 1VSHA 5EU7A 3M9NB 2ZDPA 1TP7A 3CF5Q 5BRDA 1RT5B 4FWOA 4F4KA 1N0UA 3QMQA 1NG9A 3Q8RB 4Q2MA 1IM6A 3O8WA 8RUCA 4OPKA 1C0TA 5DETA 3EZ5A 2GIFA 1HR0J 3CM5A 2IIHA 5E5NA 4E3SA 4DR7K 1VBZA 1SV5A 3VQ4A 3IM9A 2WVBA 4QOZB 1RYRA 5EX0A 5EWFA 1D8ZA 3G2XA 2XYPB 2QFJA 3CJRA 1T95A 5ETNA 3BQ1A 1VK0A 3SIPB 2B4JA 4USUA 4IO8A 3GZ7A 3WIVA 2PC6A 4XDDA 2EWHA 4DPTA 4CEFA 2E2OA 4KB1A 2WW8A 3ZFVA 4CGJA 3S7RA 4YOYA 1XMOJ 1BCOA 1HQ2A 5AQGA 2DGQA 5F41A 3K8WA 4GV9A 4KQZA 2HQDA 5HVGA 3DLGB 2YNHB 1IQTA 1JXLA 2BJ1A 5DLGA 2FD2A 4CF8A 4CGIA 5A6PA 1X5OA 3TZYA 3W2VA 2PA3A 1GOCA 1VQ8N 1LCUA 1FVSA 1R8CA 2EHGA 2CQ3A 2B43A 2IYGA 1UWBA 3IR7B 4CM0A 2HG4A 2O66A 3C94A 4YOVA 3LGMA 5D78A 1TMJA 1NGBA 3Q8UA 3SK3A 4QAGA 5KI6A 2D3ZA 4ZN3A 4F3QA 1RDUA 3TAMB 4RW8B 3IBWA 3MMCA 4NRUA 3KK1B 4K2XA 2BV3A 1Y0HA 2D9OA 3OW2R 3PR4A 5FLXY 1KQSM 3W2WB 2ZWPA 1RWNB 2VQFJ 3WQTA 3PJXA 4X64K 4I7FB 2V2ZA 2IY5B 4CBWA 3ZTOA 3QRPA 1Q9YA 2XQCA 4MT1A 1UP1A 4DUYJ 3BUZB 3ZSZA 4BHQA 2P9NB 3OY9A 2QRRA 4ITSA 5D0HA 1OIAA 4X65K 3MWPA 3K2PA 2FJDB 2A40A 3GJSB 3CC7S 2O8EA 4YB5A 3CJKA 1FDDA 2VU5A 3P3DA 5SUHA 1WHWA 2CPDA 3DXMB 1CC7A 4NA3A 4CH1A 3H2UB 2A1SA 3BBFA 1HNZK 1U6BA 2B9WA 5KFIA 4CT9A 3M30A 4F4XA 2NXUA 1FWKA 1K9MT 5GAGP 5IC4B 1Q78A 3WXJA 4C0BA 5AQKA 2R7SA 3RVCA 3VAFA 3KVGA 4CLYA 2LA4A 3D9BA 3QGHA 2QFIA 3CJQA 2ILZA 2OTJS 4QS7A 1KNZA 5I3UB 2Q0UA 3M6UA 2A3ZA 3OYFA 4DUZJ 4LFCK 4F67A 3THYB 1T9VA 3OHBA 1GLEG 1HWKA 3EGWB 2FIUA 1X4EA 3LM2A 3PLAA 2GMJA 3M8ZA 4RWXA 5E3PA 5F0UA 3TTFA 1YJ9S 1HWLA 1Q8LA 2HMIA 4MIAA 4AQYF 3ENBA 1NOZA 2QLXA 3KK3B 2QWLA 3VERA 1VC5A 4EBDA 3OFFA 2KXHA 2Y1LB 1C2PA 4J90A 1RTZA 2DEIA 2X6SA 1LOUA 5IT4A 3VGTA 3ZETB 1IBMF 3DXKA 2VFUA 4BG9A 2LDYA 1A0OB 4I6MB 1YJ7A 5BPLA 4JI4K 1D5AA 1RKJA 5H9FJ 2ADCA 3CCRS 2QSWA 1Q7YO 1JLCB 4C8KA 2RS2A 4B8AB 3EPIA 2P9UB 2OANA 3TZZA 2ZC4A 5CY4A 4NXMK 2Z2LA 3PW2A 5F1XA 1R3NA 1SVDA 4Y00A 5C42B 2J9EA 3KKFA 4ZCMA 1YVUA 2BA9A 2G0CA 1BUXA 3M30B 1V3RA 4MK9A 1WEYA 2HBQB 1IBLF 1N5VA 4DFKA 4H4KA 3V81B 1CVJA 1NK7A 1NM1A 3A8IA 4JD2B 2DR7A 2B7BB 4J37A 3WBZA 3GP9A 4DN9A 2RS8A 1KCFA 5LMUK 3D6HB 2FPHX 4KGZB 3ZX2A 5T7LA 2IS3A 2ZM6K 4TY8B 3Q23A 3VETA 3MPVA 3ZTRA 1WNSA 3RRKA 3S41A 1XI1A 3EICA 1JLAA 4E1JA 1S7IA 3MPYA 3BN7A 5AQOA 2VPWB 3DDNA 3S9HA 5LT5A 4LF8F 3R3LA 2EFOA 3BGFA 2BE2B 2C1EB 5KG7A 3NFAA 4P71A 3EY1A 2E5LJ 2HLUA 3OTCA 3ZZZA 4JYAK 1GMVA 5HI7A 1I3AA 4DU3A 3V9ZA 1Q7LB 4IOAQ 3H59A 2PMWA 3HM8A 2JZ5A 1K9MO 3CF5L 4CTAB 1NJXA 4BDYA 4WFXA 2J5AA 4H0XB 1M5HA 1K73O 3QICA 3GLJA 4ETZA 4BC2A 2AJ2A 4KGVB 3WHIA 1XK8A 1VQMN 4B1ZA 3A1YG 1S1UA 3ETOA 1N32F 4PQUB 1BY9A 1CULA 1BA1A 4QBUA 4B3SF 4PXDA 2I0XA 2FJAB 2AA4A 2IA6A 5D3GB 3DLGA 3IMQJ 1WC3A 2EFNA 3GDQA 5EUHA 5TKYA 1N36K 1U09A 3ASMA 4N77A 3B4DA 4NMXA 2OTLS 2W2PP 2VWBA 4ZVRB 3D6FB 2Z4PA 3KDOA 1VIOA 3DXKB 1YJRA 3D6RA 2V6AA 3OS2A 4DOZA 4J9RA 2CPJA 1NOYA 2Q97A 2KH9A 3W9HA 1TL3B 3NBPA 3AOAA 1TL1B 4EHUA 1FFGB 1KVAA 1QAXA 1WOPA 4H54A 4AHUA 1XUPO 1GAOA 1LWEB 2YH0A 2ZD1B 2W01A 2G8VA 3NEKA 2CJBA 4DV2J 1SZ2A 5JS1A 4ECVA 1TR0A 5E2QA 1JLEA 4BC3A 2QL7B 3O3GA 4CBUA 3HZEA 4LF1A 1MDUB 1HI0P 5IQQA 4B3MF 3ZZTA 3E9LA 4FOEA 4PPZA 4BRGA 2FHJD 3FZFA 3G8TA 2ZBPA 4E19A 1QE1A 4HH0A 1RAOA 3MX2A 3RAMA 1LW2B 4W5QA 4DV7K 5AQYA 2IVNA 4DPUA 4EFAC 1ZM3A 3VR1A 2VG6A 4TLRA 4ID5A 4FF2A 1SKRA 2OFHX 3NGZA 2QA4G 5LMUF 4CZCA 1K8KA 1QD1A 3O4QA 2G8KA 4J8FA 4F3TA 4OI6A 4ELVA 3GV5B 3D2WA 2EPIA 1SJ3P 1RCOB 5SWMA 3AVKA 5HQMA 2ZJQL 2OMLA 3V9WA 2RHQB 2ZHAA 2E7VA 4WPAA 4LBPA 3NVKA 1WC4A 3FC9A 1E3MA 2RHSB 5CYMA 4TLQA 2LQ8A 3W64A 1NM2A 5AXNA 2MGZA 4J7CA 2HBJA 3CFPA 2VZ9A 4BE1A 2HS4A 2VV5A 1A5WA 3MR2A 2NRWA 1N36J 3CHWA 4J5OA 5LXRA 3VQSA 4FJNA 2VQEJ 4DL0C 4V1Ak 3QGPA 3LDOA 4LF6K 2YPYA 4HVZA 3D6MB 3PO4A 5KG0A 2H5IB 2H65B 4AXJA 5LMNF 3LWMA 5DK5A 3ISZA 2WONB 4OIXA 1S6PA 3LUYA 4OVLA 4JD2A 3UD4P 3PV8A 2O67A 1K8AO 3NGKA 1TKDA 3ILOA 3LALA 3HHLA 4QIGA 3GSDA 2KFZA 1HKBA 3V1OA 4ES2A 1H2TZ 4MKBA 2FTRA 4K7QA 1VMBA 3C6HA 2KI2A 3KHLA 4NXNJ 1U1LA 1YJWN 1O51A 1EQYA 2PYLA 5THWA 2B9YA 2D0AA 3VA3A 2GHPA 3CJ5A 5HK4A 1NK5A 1M1GA 4HWIA 4PHTX 4RBTA 3LO3A 2ZITA 4GKJF 2ZH4A 4LSNB 2QO3A 5KPTA 3Q86A 2ZZMA 1FA0A 4OYIA 4U8YA 1JJ4A 4CE9A 3K17A 4KYZA 5IXUA 1L3UA 2W9AA 2E5IA 1N36F 1Q86O 2J6UA 1RCHA 4OZ0A 3SUQA 1FT8A 4N7TA 5DG8A 4X62J 5C12A 3SQGB 3T9NA 1PIEA 2V8HA 4F4WA 3MX5A 4CM2A 1HHQA 2QEXN 4NLTA 2DNOA 2X51A 2J76E 4KHYA 2KM8B 1IKYB 5DDPC 3PCOB 5FRMA 1R43A 3X1LB 2PY5A 1LWFA 2CQBA 1NK6A 5CD4A 2V4JB 4LSNA 4B9UA 3KNGA 4RCHA 5K8OA 5BREA 1HD1A 3UKRA 4MFBB 1NLKL 3PIOQ 3PIPQ 2VG7B 4ZVPB 4OZ3A 4DR7F 1P9QC 2ATQA 3I8DA 4KHSA 2OA8A 1RHKB 2LEPA 1C1AA 3IAM9 2ASPA 3K7RA 3KLEB 3HHLD 4NXNF 2VH7A 4M5NA 5FPMA 3D0PA 4CLSA 1VQ4N 1PYSB 2ETJA 4UQTA 1S0VA 1HYZA 3HHNB 3O4NA 2O8FB 1SPBP 4X65F 5BPMA 1OJ4A 1QSLA 2EX3A 1BD6A 4FKYA 3SI6A 1I6JA 3P45B 3UFCX 3O9RA 2YJEA 1KP6A 3NGTA 4FJIA 2CQPA 2QTWA 1GLAG 3S8SA 1H2VZ 3PX6A 2IM3A 3TZXA 2E44A 2BOPA 3H4BA 2PZSA 3DXSX 2O3DA 2ATCB 4WK3A 3J7AP 3C15B 1CPZA 1FERA 3CMEN 4YOTA 4RW4B 1N8RO 2IVYA 4G1IA 3OYGA 4WQ5A 5A2QU 5CHIA 2JGUA 2VKRA 4Q8EA 4XH4A 3VA0A 3JSMB 2W41A 3P38A 2LEAA 1NH7A 4B3SK 4YP3A 4NASA 2NPFA 2H3GX 1FJCA 4GNIA 1HHSA 3THWB 4C7QA 2UU9F 4ZPAA 4N41A 2HHWA 4OKEA 4ZJOA 4K8ZA 4X4TA 3R8YA 1TK0A 4ZVQB 3GWCA 2UUAK 2CJYB 4QWCA 1CJKB 1KDNA 1PSDA 4Q45A 1QM9A 2DISA 5DZ7A 2O8BA 1RHJB 5AJ3J 1AUDA 4CZMA 3CETA 4XTTA 4P7TA 1AW0A 2QMWA 3JAMO 4X65J 1PO6A 3ALYA 2HK2A 1VBYA 4OX9K 2QTDA 4LF7F 4DV1J 1UMJA 4KHPJ 1VQ7N 4B3TK 4ZPCA 3R5GA 3C95A 4ICLA 2H3EB 1BLUA 2ZKUA 5HLFB 1EX8A 2VQFK 4WFBL 3MECA 4ZTJA 2DHHA 3IN5A 2HFNA 2YKMA 2P9LB 3DJCA 4FW2A 1RDCA 3MEDA 4AXIA 2ADBA 5HANA 2CNLB 3S6EA 3KLIB 1GT8A 1HMVB 3UPFA 4FDFA 3CDBA 1NMDA 2PFDA 4A4JA 1N6QA 4HT5A 4HHTA 1W2BM 3FMWA 2DB1A 3E66A 1HI8A 4CO0A 4C2MA 3R1HA 3HHKA 4BC4A 4FK0A 4CESA 3QJPA 5HMZA 4A8XA 4CGDA 2HEKA 3ZTSA 5KAKA 5HJYA 4USMA 4J9UE 5AQMA 1V9OA 1S6QB 3M2RA 3FSYA 4HTJA 4UY8O 1SAZA 1H0HB 2H54B 3CULA 1Y3KA 3W3DA 1J5OA 3R7SB 3QIDA 1T05B 4IOCQ 2GJFA 2QI2A 2QM1A 2FYXA 3EGVA 1W26A 3CI5A 3L2RA 3CT9A 3V1QA 1M5VC 4DL2A 2H4WB 3JSRA 1RDAA 4P52A 4BR0A 3LPUA 5GAEU 5GINA 3ZZPA 2EC0A 3KK1A 3VQ9A 4TQSA 4HI2A 2UUBK 4DR3K 2QXFA 3EVOA 1BIUA 3LA0A 2JJ4D 1TVRA 3AXKA 3CJBA 4CZGA 1NGCA 1ZAWA 3SQ1A 4U96A 2ASLA 3F0NA 3L7UA 2GWKA 4GVBB 5MAOA 4F02A 4AHTA 4BR4A 4M3WA 4B9MA 4WCEL 3E3XA 3QWPA 1SH2A 2QLWA 3BZCA 3ZSWA 2HSTA 3A3NB 2A6MA 4IJNA 1OWXA 2Z1HA 4FZXC 2E5JA 4BR5A 1B99A 1RAJA 3TWZA 1F2GA 1T44A 4CYUA 1FE4A 1BISA 4YFUA 1TVRB 4RU9A 5A0YA 4JV5F 3RAQA 4LF9J 2VG5A 3OJSA 4OHXA 3KK2A 1E6YB 4EK2A 3JAMY 2F1FA 1JL1A 3KLHB 1KVBA 2GNKA 4Y0WA 3ZLJA 2MZQA 2OPPA 1YHQS 3ZT1A 5AZIB 4GMJB 4WBFA 1WAFA 3NRBA 4NRTA 2JWKA 1TKXA 4JKGB 1K47A 3HRGA 2AYBA 1WF1A 2XEXA 4A8WA 2KT3A 3P5TL 3IWNC 2R8JA 5AQVA 4ED4A 3AVBA 2FJWA 3G25A 1NXIA 2R7TA 4P73A 4FPRA 3EX7B 5A8KB 1BC6A 5A8WA 3DOKB 3C7NB 2IVMA 1CS4A 4O3QA 4GKJK 1UZHA 3JS9A 1E4FT 2J0WA 4LH4A 2BANA 1G7CB 1YJNS 3DN9A 3FEXB 1WF0A 2CGJA 3CXCM 5L1KA 1QHTA 3NVMA 5KG1A 4NYNA 2IM0A 3DHWC 3F9KA 4KTQA 2X3GA 5KFSA 5A76A 2Y1IA 3D5MA 2JLGA 2EG2A 3PSIA 2VQEF 5FIIA 3QJJA 4E7JA 1I51B 1RB0A 2ZF5O 3LQVA 2BABA 1W7WA 2YHWA 5CAAA 2F63A 2P9CA 1YLXA 2U2FA 4FLUA 2ZZTA 3BBBA 4JRQA 4WP8A 4X66J 5BPNA 4E7LA 4NLWA 4RUHA 4L76A 2XZTB 4CEAA 1NSKL 4JKEA 3LANA 2RRAA 2FC9A 1RP5A 1TUWA 1T02A 3QIPA 3SV4A 4YUDA 1GK8A 3VEVA 4B3RF 4U67Q 1QSSA 4OYOA 1IKVA 4QQBA 4N56A 2P5OA 4K4VA 3EZWA 4PL7A 3T5KA 2YKQA 1SIZA 4ED3A 2E20A 4C3MA 2FLPA 4KI4A 3RB0A 4DXLA 1NGGA 2DH8A 3N28A 3C3LA 3PKYA 4JI7F 3AJDA 1XBWA 1RAHB 2OSQA 1N52B 4A8OA 1SC6A 1S1XB 3KMSA 3LF0A 1I3OB 1S4FA 4GC7A 1UAXA 1CZBA 4XPEA 2W2NP 3VALA 4I2QB 5KG5A 3K59A 3O3LA 2AYEA 2VG6B 2YNFB 5KT4A 4LSLB 3IBFB 2HLTA 1LAVA 1X4HA 4LIRA 1DQAA 4KT0C 2UXCK 1HYSA 4B3RJ 3WX4A 4DQ8A 5BR8J 3TO8A 1X9JA 1V4SA 4YB7A 1DTQA 2X6NA 3TR5A 1VHIA 1YGYA 4OYAA 1LAWA 1REGX 3FE1A 2ZD1A 5AXKA 4F8RA 3KKRA 3VQ6A 3MUTP 1MROA 3P8BB 4LBHA 2UV8A 1O13A 5LSRA 1WNEA 3KWMA 4IEIA 4BG8A 4KR0B 3VESA 2XC9A 3T5HA 4CK1A 4NYZA 1QS4A 1ZAXA 1FRMA 3AA8A 4QYZJ 5FDLB 4K42A 1S4EA 1MLAA 1NNEA 1X4GA 4JI5F 1KR4A 4KHPK 1HQEA 4CF9A 2KT5A 3N6MA 2BJEA 2XZDB 1WTFA 4O4RA 1PGZA 4NYFA 4DV5F 4DUZF 1U4BA 2MQNA 2HF3A 3D0IE 3CJ7A 1B9FA 1NJYA 3KYLA 3B54A 5D15A 4U67L 1V3SA 2IDLA 1N4LA 3WXKA 4FJXA 4JI7K 3G87A 1VQ9S 2I5JA 4ILLA 4G3IA 1VFJA 2LEBA 1S1VB 1ZH5A 2IHR1 2GIQA 3B6OA 5FPNA 4XAKA 2BUPA 4HUGA 3TX0A 3CCRN 4EEYA 4ZVGA 3QZ7A 2V68A 4ES3A 4JYAJ 5M1FA 2BZ2A 3OTDA 5JS2A 1LNQA 2ZH8A 5C25A 2D1KA 2CPHA 4OQJA 3N4QA 2I38A 1P6TA 1F9HA 2K8GA 3ICLA 3NF6A 3DOMB 3TAEA 3F9MA 4ILGB 3CJTA 5FRNA 2WVDA 4OKKA 3FZHA 4KIAA 2P5VA 1QAYA 5AQPA 5GAGI 5EHHA 5KOWA 5D6GA 1WG4A 1JMTA 2VICA 1VJWA 3OLAA 5KFQA 1C6VA 2C2NA 2Q3PA 3NXZA 5KFDA 1GLFO 2HAIA 2KW4A 2V7ZA 3PY8A 1RZMA 4EYIB 3IRXA 4LIWA 4XK8C 5HL7L 2AGQA 5DQIA 4FWSA 1GFWB 3BR9A 3CPWR 3H25A 2HNYB 1O8BA 1TKTB 2XMAA 3CO0P 1KKHA 4Y34A 1TL7B 4IZ9A 1FW6A 2XWXA 1NKBA 3P31A 1BCMA 1PYTA 4KTZA 5AJ3F 2WSCC 2QK9A 2O1PA 3MMAB 1BQNB 4KB0A 2QW9A 4I68A 1RWOB 1HWIA 1OYDA 4CJSA 4LFBK 2OO4A 1YTAA 3GR0A 1OH6A 3OT9A 3P1GA 4HI1A 4BDPA 3AARA 1FRKA 4HT7A 4PUOA 4DR4F 2FLLA 1JL2A 1RBTA 1DT9A 2J8AA 3NDKA 1R0AA 3DRYA 2C22A 4K2JA 3AVGA 4RW9B 3OQ2A 1QAIA 1C4AA 1GMUA 2B3TB 8ATCB 3NCRA 3U3GA 3HOSA 5KFPA 4DR1F 3N4WA 3AOBA 3J7YU 1IJEB 4UOCA 2Y0BB 3RG6A 3MHYA 1RI7A 3HOTA 5BN8A 1Q5VA 3OL9A 1QVFM 2XMWA 2RD5C 1NGJA 2P9SA 4LVNP 5CABA 1C0UB 3WIUA 1P27B 2DNGA 3DLLQ 3CJCA 3CO9A 4ZJLA 1C1BA 1UEUA 1RSCA 3FDSA 2W8KA 2G2YA 3KJVA 4RU2A 5KFBA 5CYJA 1XJWB 3QNOA 3H98A 3LZJA 3M8QA 2CQHA 5IT0A 2O5DA 4X4SA 2GUIA 1NDLA 4E89A 2I8EA 5K14A 2ZUGA 3HL8A 3OPKA 4CK3A 1B3TA 2NSBA 3EZUA 4QS9A 1JKHB 2W1BA 5L1IA 2HBYB 4ZVEA 2NRVA 5KFXA 1WSHA 3IG1B 2JRSA 2HBMA 2ASYA 3G8QA 7FDRA 3LP2B 2E5LK 4XPCA 2D0BA 3KDNA 2PGCA 4NA1A 2OFGX 4ELTA 1YTYA 3DRSB 2OMOA 3MUMP 3AVCA 3I56S 2BUNA 3VZHA 4OO1J 1S9GA 3AO2A 4V19X 4NWBA 3TA2A 3ZX3A 4ZOSA 1F5CA 4DTRA 3D66A 4W4MA 5AJ3K 2E66A 4LVOP 4DMZA 1EETB 3H7HB 3UR3C 3Q8YA 5A8KA 4H4OA 4CLWA 1Y11A 5HBMA 1VQ7S 1XMQJ 2K2PA 3WUHA 2DIUA 3RBEA 2GTDA 3U9DA 3MDFA 3R2DJ 3ENAA 3IFRA 3UKRB 1WEXA 4JI1K 3CW2C 4LY7A 2K1RB 4W5TA 4ZVFA 1D8YA 4TKTA 3UKUA 5AQHA 1RBUA 3CJKB 3CIPA 1YBAA 2FHMA 3QO9A 4HKQA 2R8HA 3OFEA 2OI2A 3ZSXA 1VQKS 2HHVA 1KLMB 3E01A 3MAQA 1HBOA 5KPZA 1HUXA 3MTKA 4ZLJA 1WG5A 3CMES 5EDWA 1ZAVA 2EC2A 4RUAA 3QT7A 3O1LA 2ILYA 4ECTA 4DF4A 4DU8A 4K8XA 4M5JA 3DMJA 1OYEA 1G1XA 3WQPA 5D0EA 4AD6A 3VGVA 2BJ8A 3HHLB 3PDNA 4I4BA 2UUAF 2OAUA 1A7GE 4PABA 3R9LA 2J7KA 1RE1B 2W4PA 1FCAA 2HFVA 1ATSA 5IT9O 4EU0A 4ILHA 2C2MB 1V5VA 4M63C 2RQ4A 5CZ2A 1VQ4S 2W2QP 3CTRA 2R2SA 4P2XA 3SCKE 1X4FA 1NB7A 4J9MA 4JK7A 1DY3A 3PYDA 3ZT0A 4PY5A 1JLBA 3W5ZA 4U7BA 1HQEB 2OPQA 1Z6RA 1UVJA 2VFVA 3CJ1A 2WVFA 1PJ7A 3KJVB 2CGKA 1RACB 2Q1LA 1GLLO 2R4FA 1GXUA 4IDKB 3BEGB 2KU7A 2QWQA 3VHQA 3MMVA 3CCVS 4ED7A 5B0EA 5E3RA 4EP4A 3V6HA 4B3MK 4J91A 3EDRB 1OQ3A 1IV0A 1HW8A 4A46A 5DDRC 1NKCA 4WXOA 1S9FA 4ZA1A 5AQSA 1H98A 3TRGA 2R3VA 4LR7A 4RW9A 3GV8B 2GA7A 3F56A 2J8SA 4O3PA 2XCAA 1B70B 1VQSA 3QGIA 3P4UB 1U0HA 2RU3A 2C28A 4M5DA 3VQTA 4YOEA 3H4DA 1NK0A 1BO5O 2V8PA 4JV1A 1WUUA 4I9QA 4DV6K 2JHEA 2V9KA 2QMUB 2ZH7A 5IM0A 4NLXA 2IFXA 3H08A 5CCLA 4J2EA 3A5OC 2DGWA 2WB1D 4QWAA 3A3OB 4ECSA 1P8GA 1FXDA 2HRTA 3OYNA 4AUKA 1R7IA 1KQKA 3A5MC 3FKBA 4CF1A 2ZBIA 3GTYX 4ZN1A 2NRTA 3MECB 1VOMA 2XI3A 1NAQA 2NYHA 3GFZA 1OH7A 4LF7K 5BYSA 3G4SN 5B7WA 1NKEA 4FJMA 1U0HB 3A5NC 1SC3B 2ZHOA 3ZETA 2X74A 3AOCA 5DZ6A 1N5QA 2P9GA 3WEEB 4WFAQ 2HIYA 3AGKA 3M32A 2EWSA 3GG1A 1TUGB 1DZ5A 4WFBQ 4MJKA 2H9ZA 1HLWA 3VQQA 2Y8WA 2WW4A 2GJ2A 2HHQA 3NF8A 1YVNA 4XO0A 2DY4A 4IDKA 1FEHA 2CPZA 3MEEA 3A8EA 4UZCA 3TVKA 5J2MA 5KT3A 2HFSA 4IRCA 4JYAF 2MKHA 1NJZA 4BRCA 3CFRA 2R7VA 1CC8A 5GAHU 1HNIA 1JNRB 2PMHA 1BMQB 4WXWA 2BE9B 4M3XA 1ZM2A 1B92A 2IMOA 1R6VA 2CJKA 2A2CA 4P9SA 2NXEA 4TNOA 3RMAA 5U47A 3AAPA 3PRVA 3KKSA 3SAHA 3HT3A 1UZDA 4C1NI 3HBTA 2XHBA 1ZXOA 3KLGB 1XNRK 1F1BB 5GMEA 3MI7X 2W42A 4CTAA 3VZIA 4FJJA 1NLVA 3KLEA 5ETSA 1FWLA 3E01B 2FHKA 4KKOB 2HHUA 2O8DB 2M70A 3D54A 1V3ZA 1TMMA 1RDDA 2NUBA 1RNHA 3G6EN 4CEBA 2B0GA 1KAZA 3RU0A 2OUGA 4ZIVA 4RW7A 4OZ2A 2Z30B 2FC0A 1KVKA 7FD1A 4CJKA 4DR4J 2GAGC 3VF2A 2MLXA 1UETA 3DHXA 3CCEN 3L0QA 3PEHA 4TN2A 2XCPA 1TUVA 3GONA 4FYDA 1NRKA 3OR2B 4PR6A 2VF3A 3NH1A 4O44B 1FK9B 3SUOA 2AEFA 3LZIA 4CGFA 4OX8A 3EUNA 4XH1A 4RW8A 4C8LA 2RAQA 4PG5A 5IZHA 2DGOA 1DTQB 2ASMA 3U7JA 3JQMA 1N34K 2GBZA 2FC8A 3BSAA 5GAEI 4DL4A 3TWHA 2GMLA 2IC3B 1FXXA 2HSEB 3ZXWA 3UDCA 1CJVB 1D9AA 1OQ6A 3ILJA 1L3VA 4A59A 4DR2J 3PYGA 3AA3A 2UVUA 4DS4A 4YDXA 2W24A 2W9CA 2WONA 4NLYA 4DPWA 1WTBA 3PUFA 4DEZA 4KB7A 2HW3A 3H5YA 4Y0FA 4CNZA 1R6YA 3QMLA 4CZIA 2J0SD 4CK2A 3HI0A 2QX0A 4OJHA 1RDBA 3DGPA 3BF4A 2WBMA 4JI3F 4ANCA 1EKRA 1WSRA 2FY1A 1D0EA 2DNPA 3OYBA 2P9PB 2H1YA 2UUBF 1SBRA 3ZC4A 5HLFA 3L3UA 5DMRA 2NRHA 3CDUA 2R8KA 4K0KJ 2JL9A 2AMCB 1N56A 2HVZA 1EHWA 2KYXA 1UW4A 2BMBA 1SXLA 3CCTA 2FZCB 4IG3A 3O9UA 3H46O 4LRBA 2KQ2A 4B9QA 3QFHA 1MWZA 4NPOA 2GFFA 4LFBF 2XY6A 1X0FA 5KFGA 3R5JB 1Q82O 4NCBA 4ZCKA 1ULRA 5KG2A 2GIRA 3PJWA 3PHTA 3JAMU 2VGMA 3THWA 1VQPN 4M3ZA 2R42A 1UVKA 2O4IA 2DTJA 2DR9A 4KHMA 5J2QB 3R1LA 2QWMA 5DG9A 3H45C 4ECYA 3MF5A 2E29A 4FM2A 5E41A 2MTLA 2FLOA 1CBKA 4LF5F 4LR8A 3ILIA 5ELZA 2KO1A 4JRPA 4LREA 2XM3A 3GILA 1WELA 4IH5A 1XMQF 3GE9A 4ZCIA 4DV0K 3EXCX 3HCXA 1WC0A 3W7BA 3VEWA 2IGIA 3CCQN 2D9PA 3BP8A 3DCAA 3MEDB 5ADXH 3C6TB 2XLJA 3W66A 3KXDA 3MK6A 4E2FB 3MMJA 5KGXA 2V34A 1IKWB 4IDHA 4USIA 2D5RA 3RSEA 3AA2A 2V67A 1SJRA 4BRNA 4PQUA 3J81j 5D0RA 3KLVA 3HP6A 3K5MA 1XHXA 4B3TF 3Q83A 1TKTA 1S99A 3L3CA 1O1WA 4Q0BA 1OO0B 1UVMA 2EXUA