2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
1IM4A 3QO9B 5HRNA 4N41A 4K4SA 4AHSA 3H59A 4DFMA 4BE1A 3MTKA 4NRUA 4QWCA 2OH2A 1HJRA 3OYKA 3NAIA 2OPPB 4CF9A 1SL0A 3VQAA 3T5HA 1D5AA 3CO9A 1LW2A 1WSGA 4IBNA 3GIJA 4CJTA 4C8OA 3FSIA 5HRPA 3RR7A 4DTNA 4J2DA 3MXJA 3DMJA 3O3GA 3LPTA 3CJ2A 3AVJA 4MIAA 3RB6A 1U49A 4B9LA 4DTXA 3SUQA 1T8EA 3NF7A 4URSA 4OVLA 1KTQA 3PR5B 1VSLA 2D0CA 1JXLA 3GQCA 3GYNA 1RBUA 3HO1A 3VQQA 4E7JA 4CFCA 3TAMA 1YT3A 1SL1A 5J1EA 3OYGA 4KTWA 3MR2A 3BSNA 4ECUA 4DTJA 1UWBA 3BGRB 3M8QB 2B5JA 3THVA 1NK6A 3AVMA 4NCBA 4Z4HA 1NJWA 1RTIB 4FLVA 5EWEA 2ASLA 2YKNA 2R2UA 2B5JB 3DLRA 3DLGA 2E6LA 1HNIB 5KFFA 2JEJA 3OYDA 4ZMMA 4FJMA 4YQWA 1KVAA 3MR5A 3G6VA 3K5MA 3V6JA 3UDLA 3DLGB 2VG5A 5SWMA 4K4VA 4E0DA 1W0HA 4BACA 3VQ4A 1QQCA 1YTUA 5HBMB 2RDIA 2HHXA 3I5AA 1W9HA 4FK2A 4AHRA 2Q3SA 3NKYA 3IS9B 3KLGA 4DTOA 4F4ZA 5KFQA 1RT6B 3HK2A 2FLNA 1JLBB 5KFIA 4Q5VA 3BR9A 2WCXA 3HVWA 2XI2A 1TGOA 5KT5A 1RT5A 4LQ9A 2YNGA 5F8NA 3SUOA 1QUVA 5KFMA 2QE5A 5KFWA 3QLHB 2VA2A 3AVLA 4CGHA 4ZVGA 3DI6B 4C8KA 1JLQA 5EUHA 4ECQA 2XY6A 4DFKA 3L8BA 1N5YA 4WFXA 4K4ZA 1Z25A 4AHCA 1U04A 4TY9A 1BL3A 3RWUA 3QNOA 4M3RA 4DU4A 2PYJA 2BQ3A 3G10A 1J9AA 2XY5A 2I5JA 1JLGB 3MXIA 4J2AA 1CZBA 1IKWB 1WN7A 2DFHA 4FS1A 4W5RA 3PR4A 2WONA 3M9NB 4ECZA 2UVUA 1U4BA 1C6VA 4B9UA 3CM6A 4J2EA 3EZUA 1RCHA 2CJQA 4CEZA 1CXUA 5KG3A 4O4GA 4DQSA 1KCFA 2DFEA 4DSIA 2I5JB 3VQDA 5K14A 3Q8PB 4ICLA 4B8AB 3VQ7A 5L1JA 3HVTB 3QEIA 2FLPA 2QXFA 3QLHA 4YMEA 4WE1B 2IGIA 1L5UA 3HT3A 1C1CA 3EYZA 4WXWA 3N6MA 4IR1A 1ZBFA 1WAFA 3DLEB 3V1QA 1T7PA 5HBMA 4Q0BB 1T03B 1ZBHA 1SUQA 4U7CA 1TV6A 1B92A 4RNNA 4JRPA 3SNNA 4GVMA 4N56A 2ASJA 3IN5A 3UQSA 1YTAA 3H5UA 3ZSYA 4FJKA 5KGWA 3TWHA 5HROA 2E4LA 3QGHA 2OPSA 2FJVA 1FKOB 4N5SA 2D5RA 4CJ3A 4Z4IA 5I42A 2KZZA 3S3NA 4CHQA 3OSNA 1NJZA 1JXBA 1QSSA 4FM1A 2V4RA 3MEDA 3QESA 4M42A 4H54A 1S1UA 3RB4A 2OPRA 4CGJA 3DLHA 3VQ6A 3G86A 2D0AA 4W5QA 2IBKA 3DRSA 1SH0A 4G3IA 4CFBA 4HVJA 5F8MA 1FK9B 3OYHA 1RTJA 4DTMA 2WOMA 1WNSA 4O0JA 4DTUA 2R8HA 1T3NA 4FJNA 4ZPCA 4NCGB 4ECVA 1LWCB 1TQLA 4NYZA 3HVTA 3EPIA 1N48A 2WK4A 1NK9A 4FJ5A 4ZPBA 4G1QA 1KHVA 3OHBA 4K4XA 3CYMA 4E1MA 3LWMA 3JSMA 1DTQB 1JKHA 4HUFA 1KFSA 2ALZA 2G8IA 4Q44A 2BE2B 4ED2A 5CZ2A 5CZ1A 4RNOA 1J54A 3F9KA 4H4OA 4KKOA 3LP0A 3M8RA 2OPPA 3GIKA 2IMWP 4QW9A 4CEAA 3HP9A 1ASWA 3OY9A 1BQNB 3NL0A 2KQ2A 4DL5A 4FBTA 5DG7A 4DL7A 3KLIB 3AA5X 2YNHA 4MK9A 4RW7A 4ZP8A 3AA2A 4ELVA 3C94A 3TAQA 3D5MA 2DY4A 1EETB 1JLAB 3QEVA 3V9UA 4IG0B 3FRZA 3E51A 5DQGA 1HQUA 3JYTB 2DPJA 4DQIA 4FJ9A 3DLBA 1KSPA 2W9BB 4BDZA 4G1QB 3NHGA 2CKWA 4CEQA 2UUWA 4B08A 3M8PA 2ZQBA 4MFBA 4CGDA 2BRKA 4O3RA 1JKHB 4FS2A 3CQ8A 4PUOB 3LZJA 2EX3A 2RF2B 2LSNA 5DGBA 4OKJA 2D7SA 4H4OB 4FW2A 3K58A 2YKMA 1RTDA 4FLYA 3BSOA 5KRTA 4CHNA 2B6AB 1EKEA 1WLJA 1NHVA 4K8XA 5L9XA 2FBVA 3OL8A 4B3OB 2Z1JA 2B6AA 1S6QA 1UA0A 5DK5A 2Y1IA 3H5YA 4CIFA 1RT2A 1U47A 4KHWA 1LWCA 2HW3A 4WFYA 4IH6A 4ELUA 2G8HA 2YKNB 3GIMA 1S0NA 3OYCA 5I3UA 1CZ9A 5KFBA 5FDLB 1TP7A 3NMAA 1S6PB 2G8KA 2IM2A 2C22A 4CHYA 3O3HA 1SL2A 4CF1A 4KBIA 1BCOA 2GIRA 3RMCA 4CEOA 3H5SA 5KFLA 4J9KA 4NLUA 1LW2B 3HPHA 2UVRA 4ZHRB 4CF2A 1TL1A 4CF8A 3V9XA 4LSLA 4CJFA 3T5LA 1HRHA 1JLBA 1S1TB 1HMVB 1RILA 4IDKA 4DTRA 4F3OA 4WE1A 2AGPA 4UQGA 1WSHA 1YVFA 3MEGA 4DL3A 3CG7A 4DL4A 4H8KA 3CM5A 2BANA 1WSIA 1BCMA 1RBRA 2GC8A 3OYFA 1N6QA 3V6KA 3PW2A 4EBCA 1GOBA 4C8LA 1KVCA 3UPFA 3ZSRA 4HUGA 1TKDA 2R2RA 2KW4A 1Z26A 3KLEB 1JLCA 4JUZA 3KK3A 4TY8B 3V4IA 1ASVA 2R2TA 4DL6A 1HYSB 2FVCA 5DG8A 2RN2A 4CJLA 4KI4A 3QIDA 5L1LA 4KKOB 2FJXA 3OYEA 3SQ2A 1IKVA 4ED7A 4ZTJA 3NFAA 2ZE2A 4HCCA 1MU2B 3V81B 3KMSA 3KHHA 3HYFA 1RT6A 3C6TB 5DLFA 3LALA 1Y97A 3QERA 4EZ9A 2G8UA 1RA7A 2IAJB 2ZD1B 1S1TA 3U3GA 1WSEA 4IDKB 4MKAA 2JGUA 4CHOA 3NDKA 1JL2A 3CFPA 4FLTA 2AU0A 3OYAA 5J2QB 4NYFA 1JL1A 3RR8A 3L2UA 3NAHA 1T05B 4WYWA 3PX6A 3KD5E 3E01B 4RW4A 2XRIA 4ED6A 1QHTA 2HNYA 3MEEA 2KZMA 4M3XA 3LDSA 1S1WB 5KG0A 1NK7A 4H4MB 5KFPA 2P5GA 4FZYA 3KJVB 5HRRA 4DLGA 5J2NB 1VSKA 3P1GA 3OS0A 3RMDA 3N6NA 4BDYA 4CJKA 3L2RA 3SCXA 3KHGA 1CSJA 4NCAA 3RMBA 5L1IA 4E19A 3H5XA 3U6FA 4Q43A 1NHUA 2OPQB 4IG3B 4M95A 4NLSA 3ZCMA 2XCAA 3PX4A 3CDWA 1U45A 5KFOA 1KVBA 3KLVA 1WSFA 2RPIA 3LP2B 3CFOA 4E7LA 2W8KA 2JC0A 3I5BA 3D0PA 1S0MA 3SUNA 1TAUA 5C24A 3G0ZA 1KLMB 2JLEA 1BIUA 2X6SA 3MEEB 1L3TA 5KT6A 3OS2A 1T94A 5F8IA 2FBXA 1NKEA 2B43A 3DRPB 4DL2A 3CJ5A 4RUAA 4GW6A 3HPGA 4ECXA 2AQ4A 2QK9A 4RW6A 3DRRA 1S1WA 4ZP9A 2VA3A 2ETJA 5SZTA 2IC3B 4DQQA 2FVRA 3AVIA 2WHOA 1BHLA 4FJLA 4I9QA 5F8JA 2BR0A 3P83D 5C42A 5DGAA 4Y2CA 3PJWA 1LV5A 1VRTB 4NLOA 1TKXA 3OL9A 3HP6A 1MU2A 5DMRA 3NH0A 3SQ1A 4RW9A 4O44B 4J9RA 1RT3A 4KAZA 2UUTA 4FLXA 3TABA 5DQIA 1JLCB 3HL8A 2YNIA 3MXMA 5D3GA 2ITGA 1JIHA 1RNHA 4DFJA 1TKZB 4QWAA 1LWFB 5KFJA 3QEXA 4PY5A 4CJ5A 3CJ3A 2JEGA 1TKTA 4EBEA 1S1UB 4QW8A 2KFZA 3Q8RB 5DLGA 3TAFA 2HHWA 3ZSZA 1G15A 4CCHA 3C6UB 3ASMA 3K57A 3CWJA 4X2BA 1R0AB 1KHWA 3LP0B 3PW7A 4O3OA 4AH9A 4CEDA 2HVIA 4R0EA 4IR9A 3HPOA 3DRPA 4GMJB 2O4GA 2XC9A 2R8JA 4I2QB 4BE0A 5KG6A 2BANB 1KFDA 4KHNA 1NKCA 1GOAA 4JRQA 2GBZA 3H08A 1NNDA 4GC7A 3B6OA 4NCGA 2KFNA 4DMNA 4FM2A 3VQCA 1A5VA 3PY8A 2P5OA 1K1QA 3ZSWA 2ASDA 2F8EX 3MR6A 4DS5A 3FDSA 4KHSA 2FBTA 5FRNA 1S9EB 2WRMA 1BIZA 5KFTA 3D28A 1RYRA 3L2WA 5KG7A 3T5JA 1HPZB 4J9MA 3KLFB 2XCPA 4FBUA 1RDDA 3QEPA 1JLEB 3NCIA 3KD1E 1REVB 3OYLA 1TK5A 4ZPDA 4RW7B 2R8GA 4FJ8A 4XIUA 2OPRB 1NOZA 2HB5A 3KTQA 4M3YA 4CGFA 4OL8A 4B9TA 2AGQA 2AGOA 4XO0A 4I9LA 3SV3A 1C2PA 1IG9A 1LWEB 2D3UA 4JS5A 3M9MB 4LH4A 3H4BA 1RT1B 2HWHA 3K5OA 3K2PA 1XWLA 1VK0A 3RRGA 2VWKA 4R8UB 4CGGA 3SQ0A 4YFUA 4AHTA 4J9LA 5JS2A 4RNMA 4IRDA 1C1AA 3AO2A 3AV9A 3FFIB 4FCYA 3RMAA 4E1NA 2R8KA 4F2SA 3VQ5A 3IAYA 1SH3A 5KG5A 1S1XB 3PW4A 3FQKA 3JYTA 1VSJA 4LSNA 3DLKB 1DTTA 3KK3B 3OYNA 2EC0A 3C6UA 3M8PB 4FLUA 2YNHB 4WFZA 5DG9A 3OYMA 2W9CA 2J6SA 1N6QB 4ECTA 4DFPA 2W7PA 3GILA 4DQRA 2QKKA 2IOCA 4IFVB 1HQUB 1QE1A 1S1VB 2AJQA 1L3VA 1NK0A 4E7HA 3CDUA 1XR7A 5KT2A 5KGXA 1C0TA 4O3NA 1TL3B 1JXEA 3MECA 3PVXA 4HHTA 1HYSA 5KFHA 4J9OA 2WB4A 4NZ0A 4JS4A 3DYAA 3KMQA 3TAPA 4W5TA 3PZPA 4CEEA 2YNFA 5CYMB 3UR0A 4NLQA 4L8RB 3V6DA 4WYLA 3OL7A 1BI4A 3AVGA 1S48A 3IGNA 2HNDB 1Z4UA 2DFFA 4CE9A 3SZ2A 1J5OB 3AVKA 4B8CA 1HNIA 4ECYA 2HHQA 4WZQA 5KFVA 3GV8B 4K50A 1RT1A 4F2RA 1LW0B 4CECA 3M8SA 1C0UB 4MQ3A 1RT7A 3MR3A 2HWIA 2E6MA 1RDCA 1HMVA 2X74A 3CIZA 1K1SA 1BQNA 1VSFA 4DSEA 2AX1A 1CXQA 4K4TA 4JLHA 3RAXA 2UVWA 5CYQB 4OGCA 4K4YA 3MECB 4B9VA 1IKYB 2R2SA 3H98A 4K4WA 4ZTFA 2D0BA 4PQUA 1WNEA 5KFZA 3AA4A 5I3UB 4CESA 2HHSA 3NH2A 3TAMB 3QEWA 4Z4EA 3IRXB 2O5DA 3QGIA 5FRMA 1TK8A 2HNZA 5KFGA 1IO2A 4CIGA 1RTHB 5KFYA 4RU9A 2W9AA 1XHZA 2AX0A 4M3WA 3NAEA 3GV5B 3N6LA 4NRTA 4DSLA 1IKWA 3DMJB 4XPEA 5T7BA 2XI3A 4RW8A 3HHKA 3H40A 1C0MA 4TXSA 1NOYA 4HTUA 4FJXA 1RT2B 1XR6A 4EBDA 4KI6A 4EYIB 2FC0A 3KK1B 2GIQA 1W25A 2ZE2B 3U3YA 4F4WA 4CJUA 4QWBA 3LP3A 5F9LA 2BQUA 3LP1B 2FVPA 4CK2A 4Q8FA 1JLFA 1RT7B 4KFBA 1RA6A 2YNFB 4TLRA 1VSMA 1JLQB 4CIEA 4J9SA 3LAMA 3LANA 1RDAA 5KFKA 1VSEA 1ZBLA 3SPZA 4KHRA 4FYDA 4PWDA 3SFUA 3RAQA 1RT3B 3IRXA 3SI8A 2YNGB 4YR0A 3ZSVA 1CLQA 2HVHA 2XHBA 4O4RA 4DU3A 3V6DB 5JXSA 4KHYA 4Y3CA 3KLEA 2FLLA 4KV8A 3PO4A 1U48A 3GIIA 2DTUA 1VRUA 1J5OA 2FVQA 2YV0X 1DTQA 4FLWA 3VQPA 4CGIA 1ITGA 4MIBA 4DU1A 4FZZA 4IRKA 3EZ5A 4NYNA 1C0UA 4FK0A 2QKBA 1D9DA 1LWFA 3RBEA 3QGGA 4CF0A 3RB3A 3HVRA 4PQUB 1DLOA 4EO6A 4KO0A 3WNGA 3OS1A 4F8RA 1O1WA 3OVNA 3UIQA 3PHEA 2HNDA 3QETA 1QE1B 1RT5B 1S1VA 4TYAA 1C1CB 3TAGA 2VG6B 4ID5B 4JV0A 4CJEA 4KHUA 4NLDA 1TKXB 3V9WA 2XY8A 2GUIA 3BDPA 3V1RA 1IKXB 4FXDA 4IRCA 4KFBB 3TQ1A 2J6TA 2ATLA 3TVKA 5CY4A 3T3FA 4YR3A 1ZTWA 4EZ6A 3AO3A 1Q8IA 1X9MA 4RW6B 2OPQA 4IG3A 3DRRB 4AILC 4KRFA 2ATQA 2R8IA 3WNFA 3BJYA 2X78A 4CJ4A 5I42B 1WSJA 1R0AA 3H2LA 1GOCA 4LSLB 1XR5A 5E41A 1RT4B 3AA3A 1S1XA 1SH2A 5C24B 3SV4A 4CJRA 4DTSA 4NLPA 4DS4A 4EYHB 4IQXA 3NGIA 1JLFB 3OYBA 2Z1IA 3VQEA 1T03A 1X9WA 1REVA 1FK9A 4IKAA 4BDPA 5KRSA 1EXQA 4PWDB 5F8GA 2UVVA 4OLBA 3QZ7A 1S9GB 2Z1HA 1L3SA 1K6YA 3IGVA 3LP1A 3SI6A 1I3AA 4WXOA 3CDEA 4KAIA 5J2PA 3QYYA 3O4NA 4TQSA 5KFRA 3ALYA 2PZSA 3ISNC 2C2EA 1VRTA 3PW0A 2F8SA 3AO1A 4DLEA 4FZXC 4HCBA 4KB7A 4O4GB 1UAXA 5T14A 1TV6B 1RBSA 2IM0A 3QINA 3HM9A 4IFYB 3T5KA 4KTZA 1S9FA 3S3OA 1SKWA 4QWDA 3PX0A 1VSIA 4ID1A 3AVAA 4QCLA 2OZSA 2RF2A 3H4DA 2F8TA 1A5WA 3OHAA 3O4QA 4RNHA 3DDKA 4Z4FA 1HNVA 1BQMA 1LW0A 3V1OA 3PJXA 1SKSA 5KT3A 2YNIB 2E9RX 4O55A 3KIOA 4KSEB 1X9SA 3S9HA 1DTTB 1NK8A 1EP4B 3DYAB 4FJJA 1YVUA 1RT4A 3AVCA 2P1JA 4LQ3A 4BWMA 3A2FA 3LP2A 1FXXA 4NLRA 4CJWA 4LD0A 2W9CB 5KG4A 4M45A 3NF9A 5L1KA 2OA8A 3DOLB 2WONB 1RDBA 3TR8A 3MFHA 1TKTB 3JSMB 5HLFA 4Y1CA 2IM3A 1N5YB 3AVFA 5C25B 3QIPB 4KO0B 2G8WA 3BSCA 3PO5A 5D3GB 4NLTA 4LY7A 5HP1B 1S97A 1LWEA 3AO5A 2QV6A 1S5JA 4J2BA 5KFNA 4DG1A 3NBPA 3I8DA 3LPUA 2HAIA 1ZYQA 3QNNA 2WOMB 3VQSA 3BREA 2WTFA 4I2PA 2HMIB 1HNVB 4TSXA 2R7YA 1KLNA 3SJJA 5KI6A 3MF5A 4IKFA 4OJRA 3ZSQA 1I6JA 4JV1A 3DOKA 1C1BB 1RDRA 4IH7A 2IM1A 3TANA 4NLVA 1S6QB 3KOAA 4OPKA 4F4YA 4AHVA 4IFYA 2XGPA 3EY1A 1BGXT 1GX6A 4RZRA 1RTIA 2OPSB 2YHBA 1NJXA 4HUEA 2RDJA 4E89A 3AVBA 4R8UA 4OKEA 5C42B 3ICLA 1MMLA 4OLAA 3AVNA 4F4KA 4TQRA 4O5BA 4N47A 5DQHA 1SV5B 4O3QA 1S9GA 1S49A 4DTPA 4MK8A 1SV5A 3PW5A 1J53A 4DF8A 4IG0A 3KLFA 4AHUA 2F96A 4FJ7A 2W8LA 2IAJA 2ZD1A 3MFIA 1KLMA 3CFRA 3EPGA 3G6XA 2PY5A 2A1RA 2HNZB 3NF6A 4DG1B 1ZTTA 4YP3A 1HYZA 3F73A 2XGQA 4ZP7A 4CERA 4RW4B 5KFEA 1NK5A 3DM2A 1EETA 3HSTB 1U09A 5HP1A 1N56A 3KNAA 3PUFA 4CHZA 3NGDA 4EEYA 3G6YA 4IOBA 3ZT1A 3ZT2A 3CJ4A 1ASUA 2HHTA 4FJGA 4Y34A 3V81A 1JLEA 5KG1A 4ZP6A 3OYIA 5J2NA 3HXMA 1QSLA 3DLEA 3KLIA 2YHAA 1S6PA 4CEBA 3K5LA 3O3FA 1XC9A 4LSNB 3BQ0A 1ZBIA 2V4QA 2D3ZA 1HQEB 4E7KA 3L2VA 4F3TA 3IG1A 4I7FA 4EP5A 4FLZA 1TKZA 4B9MA 2JC1A 2IDOA 3IS9A 3KLGB 1GX5A 4ICLB 2B4JA 2W42A 2HHVA 4DEZA 4MK7A 3KK2A 1QSYA 4RW8B 3DM2B 1Q9YA 2W7OA 4DWIA 4B3OA 3HVAA 2G8VA 2BDPA 1VRUB 5J2MA 2XWYA 5KFDA 1S0OA 3WNHA 3ZT0A 3NGZA 3S3MA 1DLOB 4RUCA 2C28A 4BE2A 4E7IA 1QS4A 3OLAA 3QIOA 4I7FB 5F9NA 4CFAA 5EU7A 4PA1A 2NUBA 4J9NA 3SFGA 4ECWA 2VG5B 1D1UA 3L2QA 4URGA 3KK1A 5CYQA 1TL3A 1IKXA 1D0EA 4W5OA 4CHPA 2X6NA 4N76A 1HQEA 4XPCA 3I5CA 3ISND 3T1AA 3TARA 2OYQA 4RW9B 5KFUA 5HRSA 3QZ8A 2V0NA 4M3TA 4MKBA 4ZVEA 5KFAA 3ITHA 4ED8A 4CJSA 1EP4A 2C2DA 5EWGA 1RTHA 3BSAA 1RBVA 2DPIA 4ECSA 4CJQA 3TAEA 2C2RA 5FDLA 4B9SA 1TVRA 4ELTA 4EO8A 1T05A 1SUQB 3Q8SB 1HYVA 4ZVFA 3VQ9A 3DRSB 2VWJA 1FKOA 1UWBB 3BGRA 3M8QA 3OJUA 3B6PA 4TN2A 2JEIA 1S9EA 3Q8QB 2FVSA 4URQU 1D8YA 2P51A 2ZKUA 2PYLA 2I1RA 4Z0UA 4U6PA 4I2QA 2IS3A 1TVRB 4K8ZA 1NKBA 4NLXA 3SQ4A 4CJPA 1Q9XA 4C8MA 5KFSA 3NGYA 1LAVA 3KJVA 4CJVA 3MEDB 1UOCA 5JS1A 1XHXA 2Y1JA 3L3UA 3NBPB 2J6UA 1JX4A 4Q45A 1UA1A 4O0IA 4M41A 1LAWA 3WNEA 4Q8EA 4FW1A 1FKPA 4J9PA 4R5PA 1BISA 4QAGA 3NH1A 4M3ZA 3LAKA 4J9QA 4CFDA 4KHMA 1RYSA 4O3SA 4OKKA 3C6TA 3KHRA 1S4FA 4B9NA 4NLGA 4ID5A 4TYBA 4DQPA 3E01A 4KE5A 4PUOA 4TY8A 5EDWA 3NF8A 1JLGA 1EX4A 4Q0BA 3PV8A 4F4XA 4W5NA 3FQLA 5K14B 4HKQA 3ZSXA 3HJFA 5C5JA 4Y1DA 3ZT3A 2XO7A 3HKWA 4DSFA 1XI1A 4DF4A 2G8FA 2A1SA 3ULDA 3K5NA 3OYJA 4BWJA 1ZETA 1C1BA 3VQBA 4IFVA 4CK3A 4O44A 2IA6A 2HNYB 1D9FA 3CVKA 4O3PA 1KRPA 4QOZB 2HMIA 2XY7A 1C0TB 3BQ1A 3KKRA 1RTDB 5KT7A 3AO4A 3OJSA 2IJFA 2VG6A 3V9SA 2VG7A 1IKVB 2IC3A 1A5XA 1ZBUA 3D45A 1HARA 1WAJA 4FK4A 4EP4A 4E3SA 4ZPAA 4FM0A 3VA3A 3OLBA 2BGGA 3RTVA 3QIPA 3V6HA 1FKPB 4FJIA 1I39A 5HROB 3DLKA 3RB0A 1QAIA 3P5JA 4ZVHA 1RTJB 4YR2A 4R5PB 3I0SA 4MH8A 4ED3A 3SPYA 2D41A 3KKSA 4QPXA 4KB1A 5F8HA 1F21A 4C8NA 3LWLA 3I0RB 3RRHA 4CK1A 4Z4CA 4F50A 4H4MA 2ILZA 3NE6A 1TK0A 4KB0A 3KLHB 2AWZA 2RKIA 5J2PB 2GV9A 4NLWA 2FJWA 4IH5A 3ZSOA 1BQMB 4Z4GA 1TL1B 4DSJA 3VN5A 4RNFA 3I0SB 5FROA 5KTQA 2YKMB 4FVMA 1IH7A 3VA0A 5J1EB 3I0RA 1L3UA 1QAJA 4KHQA 3C95A 1BI4B 2Z1GA 3FFIA 4ECRA 2FBYA 5KG2A 3ZT4A 2V9WA 1B9DA 4YNQA 2RKIB 4GC6A 4ZHRA 3T19A 3OL6A 2E9ZA 2HHUA 3MAQA 1TAQA 1QTMA 4Y2AA 4OPJA 5J2QA 4CEFA 1IKYA 4OGEA 3OSPA 2W9BA 3BQ2A 5EWFA 3SUPA 3ITHB 3V9ZA 1S10A 4KPYA 1JLAA 1X1PA 1HPZA 2ILYA 1OS5A 1VSDA 4WZMA 3KLHA 4KREA 3CJ0A 1NJYA 5CYMA 4KTQA 4HYKA 3KHLA 4M94A 2EHGA 4FJHA 3VQ8A 2KTQA 3IG1B 3K59A 2VG7B 3TI0A 1SKRA 3SYZA 4NLYA 3KK2B 3GV7B 1NK4A 3AVHA 3MEGB 3DOLA 4DSKA 5JUMA 4I2PB 4ED0A 2O4IA 5J2MB 2OZMA 3QO9A 3M9OB 4QWEA 5KFXA 5HLFB 4ED1A 2BRLA 3L3VA 1B9FA 3V4IB 2IJNA 4M3UA 4KV8B 4MFBB 1RAJA 4JV2A 3LZIA 4RG8A 2BE2A 2E9TA 3DI6A 5KFCA 1N4LA 1VSHA 1RBTA 2BQRA 5F8LA 3RBDA 3DOKB 2JEFA 5C25A 4LH5A 5KT4A 4K4UA
chains in the Genus database with same CATH superfamily
5AJ3F 4JKBA 2I7NA 2Q97A 1NDPA 5GAGI 3H59A 4DFMA 1WG5A 4AXIA 3Q23A 2JSXA 2V34A 5BREA 4NRUA 2OH2A 5LOQA 2XM3A 3OYKA 1SL0A 2JJ4D 3A3PB 4CJTA 3GIJA 4CLFA 5KPRA 3RR7A 1WBDA 3QT8A 3CJ2A 3AVJA 2QWRA 4GKJF 3SUQA 4JI7K 3NNCA 1UVMA 1DGKN 4ERDA 2JWKA 3GQCA 3MGJA 4C4WA 2KM8C 3VQQA 4CFCA 4A5BA 1B0PA 1FWPA 3L09A 4ZCIA 4B3RK 3BSNA 3VWSA 4A47A 2GAGC 4DTJA 1WC0A 2F40A 5E84A 3BGRB 1PYTA 1N36K 3DDNA 4PHTX 4NCBA 3L6QA 4Z4HA 3CSKA 3DU6A 2N4CA 4ATNA 4P74A 3M6XA 1WB9A 4A8SA 3T1YK 4M5DA 4FJMA 4OYXA 4LT6A 4ETZA 3MR5A 2CPJA 4FYVB 4PL8A 1YJVA 4E0DA 2RQCA 2MZ1A 3VQ4A 5HBMB 3CEDA 2W4DA 3VTIA 2Q3SA 2YWFA 4DTOA 2FXUA 2FLNA 1JLBB 3EE3A 3HVWA 1RCOB 5DM6L 1TGOA 3ZZTA 2KFYA 5KFMA 4LRDA 2I2YA 1ELOA 4ILJA 2VA2A 3ZX0A 2VPYB 2AEFA 2ZJRQ 2X1AA 1FXLA 5EUHA 4NYPA 2IFXA 3MWBA 2PFFB 1SJFA 4F0KA 2NXUA 2C2OB 4K4ZA 2YKQA 3FCVA 3MDQA 5T41A 2BQ3A 1IBKK 2YWEA 5DM7L 3MM6B 4UOHA 1VQON 2XY5A 3UKRB 3K7RA 4J2AA 1CZBA 3BO3A 1YKWA 4W5RA 3RBZA 1U7LA 2HLTA 3M6GA 2NYIA 3M9NB 4ECZA 2L9NA 4B9UA 5FPEA 5JICA 3DGVA 1OO0B 2DK2A 1RCHA 2KB2A 2FHJD 4L6V3 5KG3A 3SAGA 4O4GA 1ULRA 2DFEA 3MN6A 4QOTA 3PLAA 3KUGA 5L1JA 3C6AA 1T9WA 4KGMA 3QEIA 1IBLK 3W8PA 2E88A 2ZC3A 2H3GX 4WE1B 3CMAS 1S77D 1FNOA 4JI3K 1YBUA 2ASOA 3HT3A 5BRDA 4NOHA 1C1CA 4PCQA 2ZJPL 3MAAA 4IR1A 4NPOA 5BR8F 2Y8WA 3U1NA 1T7PA 4P73A 5MLCQ 4OI3A 3GFYA 3HZGA 1K8AT 1TV6A 3DJCA 1IBKF 5BPMA 1B92A 2CWXA 4GVMA 2OD4A 2HYIB 3I9V9 2FF6A 3QGHA 2OPSA 1FKOB 4CJ3A 4Z4IA 5MLCV 2F9TA 3S3NA 5JLHA 2DNKA 3OSNA 2DXFA 2VUGA 3TEGA 1QSSA 4BRIA 2AKWB 4CZIA 3N79A 4CGJA 1DY3A 3VQ6A 2H3EB 2D0AA 5CR4A 1IJEB 3CETA 1VHXA 3AXMA 4W5QA 1SH0A 3D6FB 4LF6K 4WQ5C 2NUUG 5B0DA 4H0YB 4OJ1A 4DTMA 2WOMA 1WNSA 3DLLL 5AQLA 1Q81O 2R8HA 1T3NA 4FJNA 4ZPCA 4ECVA 3QPIA 2FZCB 2NRHA 2WK4A 2KT5A 4FJ5A 5GVQA 5DETA 1X9JA 4G1QA 3OHBA 1V6HA 3P6YC 4ZKAA 2XZWA 1CJTA 2UUBJ 1JKHA 2G8IA 3B4MA 2J7UA 3O9UA 2FYXA 1CG2A 5HVGA 2MKYA 4KQZA 5CZ1A 1J54A 4H4OA 4KKOA 4DN0A 2AZ1A 3LP0A 3QMLA 3CPEA 2D74B 2JRSA 4CEAA 3HP9A 1ASWA 4GKKF 3FZLA 3D7SB 4FBTA 1VBXA 2RSQA 5GAEP 3HOSA 3AA5X 2DBBA 4MK9A 3R2DJ 2QX0A 1QJHA 4BC7A 2A1BA 4OX9K 1VJQA 1Y3JA 3V9UA 2DD8S 3A5LC 3VGLA 2DPJA 4FJ9A 2W9BB 2PEHA 4BDZA 4XH5A 3K0JA 1HNXK 4PUOB 2I8EA 1YRTA 1H38A 2YX6A 1TL7B 3WXIA 2C3YA 2OMLA 2XHWA 1RQ0A 1NHVA 3ZYYX 2HVDA 1DZ5A 2Z4PA 3CMEN 1BA1A 3O1WA 4AM6A 3N28A 3FGUA 4DPOA 3HMJG 3SAFA 1S6QA 4USJC 4YOVA 2ZVIA 4YB5A 1J27A 1QDUB 4Q2LA 3OYCA 1CZ9A 5KFBA 2E5IA 2QYGA 2N7YA 1PGZA 4CM0A 3JSBA 3U1MA 2IM2A 2C22A 3EMTA 2G8KA 4CZGA 5JLFA 4FKXA 1OQ6A 4KBIA 1BCOA 3UDCA 3SMPA 1FJGK 5KFLA 5B0CA 1LW2B 3BB5A 2MKSA 5GAGU 1VQMN 4LF7J 2UVRA 5E3RA 3RW6A 2VASA 1TL1A 4CF8A 4ER8A 3V9XA 4CJFA 5HK4A 1DQ9A 3T5LA 2FJDB 1RILA 4DTRA 5ETSA 2DRDA 1NZAA 4CLPA 1R8HA 3TTDA 2VQEF 3MEGA 2K1RB 3CG7A 3MMAB 4E98A 3NMUA 1BCMA 5GAGP 2GC8A 2LXUA 4RBVA 3PW2A 3CXCR 1AFJA 4C8LA 3D67A 2NCKL 4NLCA 4HUGA 3FEYB 3BF3A 2R9LA 2R2RA 1N5TA 2YQ0A 4WF9Q 3KLEB 1IG8A 3V4IA 3GFXA 1WHVA 1N32K 4J5OA 4HACA 3W3DA 3P39A 2FVCA 2CFXA 3MM6A 3QIDA 1YIJS 1Q53A 2PIIA 3P96A 3CDAA 4A59A 4BR9A 4WU3A 3NFAA 3VAFA 4DV4K 3KMSA 3V81B 4MMOA 2QSWA 2CG4A 1RT6A 3C6TB 5DLFA 4EZ9A 2W40A 2HBYB 1Q16B 1LKZA 4IDKB 2IVYA 2ZH3A 4PEOA 3CCES 1VQ4S 1JCGA 3NGTA 4YN3B 4OV1A 1MN9A 2EI5A 4UZCA 3LPYA 4NXMJ 1X31C 1T9UA 4FLTA 2E1AA 3OR1B 1N8RT 2QTDA 1QVGR 1LXNA 3EDRB 4BREA 2V2KA 4C11B 1R8CA 2FTRA 1PAUB 3TSUA 3VERA 3KD5E 4RW4A 4AM7A 2XRIA 1VLOA 2F4FA 4LFCF 2KHCA 3CCTA 4TVAB 4M5LA 5KFPA 3VV2B 4FZYA 3KJVB 4KBOA 5HRRA 4DLGA 3P1GA 1H2VZ 2LDIA 4HVZA 3TZXA 3SCXA 5LMNK 4WFBQ 4X4QA 1EO1A 4NCAA 4PKDB 3RMBA 1R27B 5IC6B 4Q43A 4KH6A 4M95A 3ZCMA 4CVNE 4B3MK 2XWXA 2RAQA 2XCAA 1RHKB 4A2BA 5KFOA 5HL7L 3MUVP 3KLVA 4DX6A 2LU2A 1R0BG 4E7LA 1RACB 2MB0B 2JC0A 5LSRA 1GH8A 4JKFA 1S0MA 3DXBA 2EKYA 1KLMB 2Y3YA 2JLEA 1FDAA 3MEEB 2MHNA 4RUBA 2XQCA 1YG0A 1HBUB 1OKJA 1T94A 3T69A 1ILYA 1NKEA 2B43A 4R79A 4DL2A 1Q81T 3CJ5A 3LDQA 5EGYA 4GW6A 2KJVA 4UY8T 4ECXA 2AQ4A 4ZP9A 2VA3A 3VCDA 3L4BC 2MZRA 3AVIA 3CCLS 1VBYA 3GDQA 2YPZA 5DGAA 2RB7A 1X3NA 2Y0BB 5HQMA 5H1SV 1VRTB 2ATCB 4RBUA 4KAZA 2GVZB 1U25A 3AJDA 4UF4A 1FDDA 3HL8A 2K3KA 1JIHA 4DFJA 4J9VA 3G82A 5KFJA 3CJ3A 1TKTA 2OMOA 4A61A 3Q8RB 5LMUF 1MSWD 4FWLA 4ISFA 1E3MA 3TZZA 1KR4A 1WACA 2UUBK 3RRKA 2P6SA 2JHEA 3FGVA 2CRLA 3CI5A 4CTAA 4TKTA 3EICA 2NRRA 5LJ3Y 2GIFA 3HULA 4ZK7M 3B6BA 3DRPA 4GMJB 2NLXA 2ZZMA 1A7GE 2R8JA 2KKHA 1HR0K 3SBGA 4BE0A 5KG6A 4UOCA 1SQKA 1KFDA 2V5HG 1MWZA 2W4CA 1NKCA 2NLWA 2MQPA 2BYCA 4DU8A 3TUJC 4LFBJ 2ZGYA 4HH0A 4GC7A 3B6OA 3CJSA 2V2ZA 4QPTA 2KFNA 4CH1A 4DMNA 2MSTA 4H0XB 4DS5A 3MR6A 1XQSC 1MROA 2Z56B 1WOQA 1X4GA 4OO1J 2DNMA 4ED4A 5FRNA 4FNHA 1NMDA 1RYRA 1UEVA 4DUTA 4UY8O 2Q43A 1G4CA 2XCPA 1JLEB 1IBCB 4QYZJ 2IJRA 2HQDA 3H3OB 1S72S 5A2QU 1TK5A 1GLAG 4ZPDA 5A0YB 2R8GA 4YDUA 4XIUA 1NWKA 3S41A 2A40A 2PD1A 1KN6A 2VONA 3M2UB 3PHTA 1AZSB 1SIWB 3I4HX 3D2FB 4XO0A 2L9DA 3OTDA 4O23A 1HUXA 2HWHA 5EOYA 3K5OA 2F7VA 3O1LA 5KOWA 3SQ0A 1EX8A 1BUXA 2MKJA 4ZVUB 3T1YF 5JS2A 4RNMA 3VAHA 2C3MA 1BG3A 2E20A 1NBEB 2DNRA 5CA5A 2G9OA 2F9JA 1XMOK 4F2SA 4ZJOA 2A6AA 4LFAK 1S1XB 3VZIA 3PW4A 3JYTA 4QYRA 4CZKA 2F9DA 2GO8A 3OYNA 4ZA1A 2GEMA 3M8PB 2YNHB 5DG9A 2W9CA 1OY8A 5HMWA 5EHHA 3BR8A 5E3QA 1X7VA 1GMWA 1HQUB 3SSRA 4GKJK 4IXCA 4MDAA 2NRZA 1YUWA 3QB0A 3MEKA 1ZM9A 3NS7B 2G1DA 3HI0A 3CDUA 3HHNB 2RRBA 2N4DA 1JXEA 1EKSA 2IBOA 1XNQF 4NA2A 4JS4A 5F0UA 4BRQA 4W5TA 4GY2B 3TQEA 4OYBA 1HBOA 2XMUA 1WEYA 3UR0A 5H9FJ 3AJ2A 1VI7A 3W5XA 2MKCA 5ETTA 1EQ0A 3THWA 2VODA 5JMNA 4M5GA 4UW2A 2DFFA 4CE9A 3AVKA 1HNIA 2HHQA 4Z94A 5KFVA 4K50A 2ASYA 1LW0B 1Z05A 1SJRA 1RT7A 2HWIA 2VWBA 1ZM2A 1BQNA 1VSFA 4DSEA 2AX1A 3CCEN 3BGOP 4K4TA 3RAXA 2UVWA 4OGCA 1IKYB 1KXPA 2R2SA 4ZTFA 4NZ7A 2CGJA 3JTPA 5KFZA 1CPZA 4CESA 1HA1A 3WT0A 2HHSA 3M2VA 3TAMB 1RB0A 4Z4EA 3IRXB 2MY7A 5A76A 2P9IA 2YWWA 3FEXB 3KHYA 1TK8A 5KFGA 1IO2A 2G0CA 2CPDA 2W9AA 2AX0A 2QWQA 4DR3K 1CULA 3NAEA 3GV5B 4DSLA 1IKWA 4NMXA 4YHHK 3DMJB 3GWCA 2XI3A 4RW8A 1C0MA 4OLOA 3ISZA 3AAQA 2FHKA 3CCSN 2OGUA 2R7QA 4KI6A 2IMOA 4KGZB 4X64K 2GIQA 1W25A 3IDHA 3CC7N 1S57A 3R9PA 2VFTA 3UNGC 2AJ1A 4FWMA 3U4LA 3MK6A 4CJUA 2BM0A 2Q0RA 3W7BA 1TYQB 1JLFA 1RT7B 1RA6A 2YNFB 4TLRA 2BMBA 2O8FB 1AB8A 3LAMA 3LANA 1GMVA 1V9OA 2ACMA 3SPZA 3SCLE 3SFUA 1WG1A 5E0OA 2YNGB 5IQ6A 2P9PB 3QSYB 2HVHA 4O4RA 1H0HB 3OTOJ 3B4DA 4USMA 1BD6A 3PO4A 2YV0X 1DTQA 4ZS6A 4FLWA 4CZJA 3R5BA 4DU1A 3LUYA 4JD2A 4NYNA 2GJ2A 2QKBA 3RBEA 4ITSA 3P45B 1KQSR 2H5EA 3OT9A 1RT5B 1HQ2A 4W90B 3BBCA 3MM8B 4RBTA 1HWLA 5IFMA 5LJWA 4JN4A 5BPLA 2KDOA 2GUIA 1KVKA 3EJMA 3ZETB 2RVJA 1UEKA 1IKXB 1SC3B 3CCVS 2VF3A 3VF2A 5B0EA 2YI1A 4NO7A 4CO1A 1ZTWA 2IVNA 2CZ9A 1X9MA 1LOUA 1GEHA 2ATQA 4H0VB 3R6GB 3SSSA 3BJYA 4ZLPA 2EBGA 4Y0WA 4AT1B 2KXNB 4HLBA 3ZTRA 1R0AA 4JKHA 4HI1A 1WUAA 5E41A 4DTSA 3ZEUA 3D4JA 4ZVTB 2O8EA 4JAXA 4JKCA 1N33J 4FF4A 3M1FA 3FJ2A 3TW0A 4IKAA 2AW0A 4IWVA 2LQJA 5GAHI 2RH3A 2MZSA 2VGNA 2HHHJ 3CCQN 4OLBA 1YBTA 1K6YA 1FDNA 5HVHA 2B3TB 4OI6A 4OX9F 5AQZA 4ZCMA 2CQ1A 1WKKA 2MDAA 3CJ1A 2C2EA 4LSZB 1VRQC 1R7IA 1GK8A 1XUPO 2NREA 4FZXC 4BBYA 3ZZUA 4KB7A 3VHQA 2ZBPA 1UAXA 5AQKA 1TV6B 1H2UX 3OPKA 3W5ZA 4IFYB 3T5KA 3G6EN 5CAAA 4DR4K 4FXWA 3KWGA 4C2MA 4A57A 3M6WA 4ZVPB 2GHWA 3OBIA 3PX0A 3J8AA 2KHDA 5LXRA 1RU1A 3H4DA 1GAOA 4NXNF 3DDKA 4Z4FA 3V1OA 4HWIA 4FOEA 4O55A 3I56N 3KIOA 4IEIA 4KSEB 4KH0B 3TTFA 3DYAB 1YVUA 1QQNA 1C0GA 3UE5A 4NLRA 2OKQA 1OSDA 3NCQA 4CJWA 2W9CB 5L1KA 2BM1A 2OA8A 4RL1A 3DOLB 4U96A 1GLEG 2XBPA 3TR8A 2UU9J 3MFHA 1TKTB 4H4KC 4FO0A 4Y1CA 3POTB 1HKGA 3DDIA 1N5YB 4LFCJ 4C23A 1LQ9A 4JI5F 2NNWA 2G8WA 3PO5A 4NLTA 1S97A 4BY9C 1AA1B 2QV6A 5D4PA 2OI2A 4CM2A 1YF5L 1T44A 3LPUA 1CJKA 3LGHA 1ZYQA 1E6VA 1F5CA 1RBLA 4NB4A 3C46A 2YQ1A 2CQBA 5KI6A 5LMNJ 1SIZA 3DU5A 1XEZA 5JVGQ 1VISA 5BR8K 3MMCB 2CXEA 4F4YA 4AHVA 2O3DA 2PO4A 4IFYA 4YS2A 1GX6A 1S79A 1OH8A 3LDLA 3WXLA 1K9MT 1RTIA 4CO5A 2NRXA 2YHBA 4KH5A 1NJXA 2IVOA 3AVBA 5C42B 2J9EA 4LF4J 2UUBF 5AQQA 1ATRA 3DNCA 4A8MP 3C7NA 1S7HA 4ZVQB 2GELA 4Y00A 1D8ZA 4O5BA 2B9WA 5GADP 4N47A 5DQHA 3I56S 4O3QA 2XSJA 1Y5LB 4LRBA 2VBZA 4DTPA 3QWUA 1SV5A 1RGIA 3MWPA 1GLJO 4PG5A 4AHUA 1QY7A 4JI2J 2JZ5A 1IR1A 3MFIA 3EPGA 3MX5A 2PY5A 2OEMA 2FJAB 1VQKN 2QI2A 2GGPB 2AEMA 1HYZA 4KGVB 2XGQA 4CERA 4RW4B 1NK5A 3GPAA 2HHPA 4BRKA 3KNAA 4RU2A 3JAMO 5AQXA 3DLJA 3ZT1A 3CJ4A 1RE1B 4USKA 2HHTA 4FJGA 3G71N 2DNLA 5A2QY 3SXLA 4IJAA 3C15A 2IDEA 5T7LA 5J2NA 3KDNA 4FVUA 2FGCA 1TL7A 3NGUA 2UP1A 3PRVA 3O3FA 3WQPA 2F8HA 4JV5F 3EE8A 1X4AA 3CCRS 5C10A 2OTLS 4JP8A 8RUCA 1HQEB 2UUCK 2UYTA 2J8SA 4FLZA 1G99A 1TKZA 3W2WB 2UV8G 2VJUA 2JC1A 5IQQA 3IS9A 3KLGB 4LBPA 3O9SA 1GX5A 3AOBA 1D9AA 2W42A 4B3MF 2HHVA 3KK2A 4RW8B 3R6MA 1J5EK 5AZJA 5KFDA 3WNHA 3NGZA 1VQPN 4RUCA 1HWUA 2HVZA 3D2EA 4IEEA 4I7FB 3OHRA 4F3MA 2VG5B 5IWAJ 2Z30B 1D1UA 1X3MA 2ZGZA 3KK1A 1M5HA 2MLZA 4H5WA 1IKXA 2E2NA 1MW7A 3VAKA 3B8HA 2RHQB 3ISND 3G8SA 4YUDA 5KFUA 2UUAK 2V0NA 4ZVEA 5KFAA 4EUVA 1QVFR 1RI7A 4IYQA 4USUA 2D3OR 5EWGA 3SQOP 1RTHA 4ECSA 4CJQA 5ETRA 5GAHP 5FDLA 4WYBA 2B7CB 2XYPB 2X1FA 4AQYF 3VGMA 4EO8A 1T05A 3OBWA 2IRXA 1BXNA 3Q8SB 1MDUB 1VMBA 3DRSB 1F9FA 2XS7A 3BGRA 3MM9B 5EX3A 4U95A 1HHSA 1BC6A 3Q8QB 5ITHA 5ETOA 3OXLA 2DNGA 5D4LA 4Z0UA 4I2QA 4MKYA 4K8ZA 2R7VA 3WDOA 2QL7B 4CJPA 3CCUS 1RU2A 1LAVA 4CJVA 5JS1A 2HQCA 4BR5A 1KC8O 2BJ9A 4K43A 2CH6A 5F1XA 5M1FA 3L3UA 1JX4A 2V8VA 3PTWA 3UCGA 1RJJA 5F3ZA 4R5PA 3W5YA 5M1KA 4Y0FA 4M3ZA 1HR0J 1YI2N 4YY3K 4KHMA 3DOMA 3C6TA 3KHRA 4X4TA 4NLGA 4TYBA 4JKGA 3E01A 2A0FB 3T41A 4PUOA 5EDWA 1EX4A 1F1BB 2ZOGA 3PV8A 5G0RA 3VESA 4FPIA 2F4VF 3FQLA 2DNPA 1CVJA 3ZSXA 4AQYJ 2DHXA 4HT5A 1FJGF 3JTOA 5K5MA 5B0GA 3ULDA 4CJ7A 2PAVA 3OYJA 3GR1A 3BYPA 1C1BA 3VQBA 1RDWX 1OH5A 3UD5A 5C2GA 1D9FA 2UXBF 3FK4A 1IM6A 2HMIA 2QT7A 3F9MA 4ZLJA 3J7Z5 3CD7A 3VEOA 2IJFA 4BRDA 3V9SA 1BO5O 1IKVB 2IC3A 4IO1A 1F6TA 3D45A 5AQTA 1PO6A 2CNLB 4C7QA 5AQGA 4NMLA 2V4JA 1FNMA 3F2KA 3DKDA 2H1YA 3AAWB 5B0AA 3RB0A 2B9XA 1FW6A 1HNXF 2F63A 5E7OB 2GTDA 4CLSA 4ED3A 2D41A 5F8HA 3I0RB 3RRHA 1Q8KA 5LJ5Y 2QSFA 4H4MA 2ILZA 1DFDA 1TK0A 2DRBA 1RWUA 1LEOA 1V3RA 1M1KT 3QFPA 3ZSOA 1BQMB 1QD1A 4F36A 3RJMB 1WI8A 2M9KA 4DV0K 2CPIA 3D7EO 1IH7A 2P9UB 3KWIA 3I0RA 3FZKA 2ADCA 3BKFA 2EC2A 3DC2A 1QAJA 2F65A 3LDNA 4B1YB 5KG2A 3NGKA 1KP6A 1B9DA 2A42A 4YNQA 5DJBA 1VQSA 3NG8A 1F9HA 2E2OA 4PG6A 5RUBA 4U9RA 1CZAN 2QWMA 2MYFA 1FEHA 4X4PA 3A3OB 2HZCA 2XMJA 1IKYA 4OGEA 4Z2XA 2W2NP 3SUPA 1HHQA 5E3CA 4LF4F 1Q78A 2ILYA 4WZMA 4KREA 4PR6A 2P9LB 5CYMA 1DQAA 3M7VA 3KHLA 5B7WA 3B8AX 1U8SA 3VQ8A 4LVNP 2VL1A 4GKKJ 3MURP 1KAYA 1TUVA 3QFUA 4NLYA 3FLCO 3U02A 3MCMA 4DSKA 4ZPTR 2O4IA 5AZJB 1KD1O 4DR6F 5KFXA 2DEJA 1WTBA 4ED1A 3A8EA 3F5TA 1P8ZA 4D3HA 4MFBB 3GG1A 2BE9B 1U2VB 4FWKA 4JV2A 2IIRA 1VK3A 4DR7J 2BE2A 1TUYA 4PKHA 2P9SB 2X1BA 4ILRA 3EUNA 2JEFA 4LH5A 4DR2F 3VGKA 4K4UA 5FRMA 2KLAA 3QO9B 3HKZD 2IVFB 5C2DA 4IOCL 4K25A 5HRNA 1T95A 4AHSA 2IVPA 4OYAA 4BE1A 4DV6J 3MTKA 2P9LA 4DX7A 1PAEX 4I1TA 3AD8C 1HFEL 4OJGA 1O51A 1ACMB 3IBWA 4CF9A 4EI2A 2CQ4A 3Q22A 3TJ8A 3T5HA 1RFQA 2NS1B 3CO9A 5ETKA 3TX0A 4IDHA 3VEVA 1WSGA 3FSIA 4DTNA 4J2DA 3A8KA 2QIFA 4DV2K 2OFHX 4B9LA 4L73A 3H7HB 4OVLA 3SIPB 4R25A 2QC3A 3PR5B 4AD6A 4CNZA 3IR6B 3GYNA 3I96A 3TAMA 2YVSA 2QEXS 3IP0A 4WTOB 2VKZG 3MR2A 4FWRA 4ANCA 3EGWB 2HQIA 1UWBA 3M8QB 2B56A 3IR5B 3AVMA 2NRVA 1NJWA 2MQNA 3R7BB 2ZBQA 1XN9A 4LR9A 3MPUB 3V5RA 2B5JB 3N0VA 2G13A 4L74A 1XQIA 2UZAA 2E6LA 4JI4K 5KFFA 3O9QA 4YQWA 3OR1A 2Q31A 1U26A 2H54B 3K5MA 1HNWJ 3UDLA 2VG5A 2UUCJ 4K4VA 1A9NB 4PZVA 1W0HA 1YTUA 2HHXA 3I5AA 1W9HA 4FK2A 4UUWA 4AHRA 1I94K 1PJ7A 1UVKA 3G9CA 2H4YB 4F4ZA 1RT6B 4DV3K 5KFIA 3QBCA 3OTOF 3E66A 1RT5A 4LQ9A 5F8NA 3SUOA 2YHYA 1X60A 2DXEA 2QE5A 5KFWA 3QLHB 4CGHA 1ATNA 3DI6B 4C8KA 2DGVA 2QO3A 1UMJA 2FF3B 1UPMB 1IR0A 4M5NA 4AHCA 4F3QA 1U04A 3W0LA 4OX6A 3VETA 3O2IA 1VQ6S 4A8QA 1BE4A 4DU4A 2PYJA 2AYEA 3SAHA 5LM7E 4EFHA 3AA9A 1J9AA 2PBDA 3MM7A 3MMVA 3HFKA 2I5JA 1AW0A 3N5BA 1U1NA 1RHJB 2KYXA 1WORA 1HLUA 3NMRA 3MMAA 4NXMF 3MUMP 4RWTA 2RJZA 1ZS6A 4QR1A 1XERA 1QTNB 1C6VA 4J2EA 2QA1A 2A3JA 3EZUA 2CNKB 1V4SA 1WC1A 4JKAA 4CO4A 4X65F 4J9UE 3VQDA 3R5CA 3Q8PB 4CRJA 1XC3A 4WJBA 3VAGA 4B8AB 5DM6Q 2FLPA 2QXFA 3QLHA 4YMEA 2O8CA 2IGIA 2W41A 2IY5B 5AJ3K 5I3QA 1V5IB 4YDUC 1TR0A 5IZHA 2ZHAA 4A48A 3TOQA 4WXWA 4U67Q 3N6MA 2EPIA 2Z2MA 1T03B 3BEXA 4FZVA 4RNNA 4JRPA 4N56A 4IZ9A 4CIOA 3ZSYA 1H73A 4QIFA 5HROA 2FJVA 5ETQA 4LF5K 3AOAA 1EIYB 2Z57B 5D0RA 1JXBA 5HO4A 5LJVA 3MEDA 4M42A 4FPRA 4JI3J 4LF6J 2VD3A 1QUPA 3TZYA 3ILJA 2VH7A 4L3KA 1N33F 3G86A 5ETMA 1Q86T 3SJHA 3DRSA 2BJ7A 1UFLA 1MNEA 1FK9B 1U2CA 3QT5A 3T1HK 2O8BA 4P2MA 2FJBB 3MAAB 4E2FB 1JB0C 2WW4A 2RUSA 5B8HA 2BOPA 1HHTP 1TQLA 2H5IB 4NYZA 1CC8A 5AFUA 1KHVA 4EIAA 3LWMA 2V51B 3J7ZT 1O8BA 4DUZF 1KFSA 4X4SA 2ALZA 4IQMA 1DAXA 2DCLA 3F9KA 3MN9A 1YJNS 3M8RA 2OPPA 2XS5A 4FPBA 3OXGA 4DV1J 3NL0A 3UN3A 4O8KA 2BH1A 3IAS9 4DL5A 4DL7A 4OHWA 3UR3C 4P6QA 4WFAQ 5E33A 3A4TA 3C94A 1JLAB 4FWPA 1YJ9S 4IOXA 1HQUA 5CHIA 2B51A 4J37A 4DQIA 2JVRA 1KSPA 3HJVA 2ZH7A 3NHGA 2VICA 2CKWA 2CZVC 3O4WA 2UUWA 4FNIA 4H03B 1RWWB 3M8PA 3D0HE 4CGDA 1M0SA 3CQ8A 3DXKA 5KOXA 5DGBA 3A5NC 2D7SA 3W62A 3F41A 4H4OB 5GMKa 3D2EB 3BSOA 2B4VA 1RSCA 3VALA 1EKEA 2QLJB 1NGAA 1ZBTA 3QBWA 4K8XA 3JTNA 4X4OA 2G2ZA 1IBMK 2Z1JA 1WF2A 2Z2LA 3R1XA 3KJQB 5DK5A 4CWBA 1RT2A 4KR0B 4ELUA 2V8HA 2YKNB 4DR7F 1S0NA 5I3UA 3PYGA 4EHTA 2NR0A 5FDLB 1TP7A 1YZ7A 5E2QA 2C2KB 3NS5A 4I6MB 4DV2J 1FWKA 5BYRA 1N0UA 2P2CB 1G7CB 4DZDA 3CC2N 2KG1A 3BY5A 2GIRA 3RMCA 5D8HB 2UV8A 5M2RA 2FIUA 3ENWA 2E29A 3CJCA 1MWKA 3ENVA 1UJ4A 1YITN 1HRHA 1JLBA 1S1TB 4IDKA 3RU0A 4UQGA 1YVFA 2BOAA 4DL4A 4ENOA 3TSPA 3CM5A 4DR5K 1WSIA 1RBRA 4QS7A 4CLZA 3V6KA 4ZOSA 3QRPA 4OX7A 4EBCA 4DR7K 1OQ3A 4MYUA 4OLPA 2E1RA 2KW4A 1Z26A 4JUZA 1CJKB 3B82A 3FBFA 3IR7B 4TY8B 1ASVA 4NA3A 2P6TA 1Q95G 1Q8LA 3AQPA 3HBTA 1KNZA 2RN2A 1JJ2R 5C7PA 3D1QA 4CJLA 4KI4A 1WDDA 5BRFA 2DHGA 3B78A 3IC1A 3SQ2A 2VBYA 1F2GA 1NGCA 2E5LK 4P9SA 1IKVA 1J6ZA 4ZTJA 5L8RC 5AQRA 4JI2K 5GADI 1T9TA 2QG9B 4LF9F 3QERA 1GLDG 2G8UA 1RA7A 1A0OB 1S1TA 1Q1KA 2CPYA 3LDOA 5DS7A 1BDGA 2BXJA 4WFNQ 2JGUA 1RWXB 4F7VA 1JL2A 2G1HA 3RR8A 4ALZA 1FJCA 4H5NA 3L2UA 1ZZFA 1X4FA 2HNYA 3GL1A 3LDSA 4ISEA 2DY1A 2P5GA 4LF8K 4BR4A 5HMYA 5B0FA 3UKUA 4RJVA 1YHQS 3RMDA 2XLJA 4ZCLA 4K7QA 3L2RA 3J7YP 2F9WA 4JI4J 1CSJA 9ATCB 5L1IA 1SS6A 2QXLA 1NHUA 2XMWA 2OIHA 3PX4A 2D9PA 1U45A 2MHEA 4CQ1A 4BROA 1GTEA 4CBWA 3VZHA 5HAOA 1R6VA 4WF9L 3GCXP 3CFOA 3CJ8A 3I31A 4OQJA 1TAUA 5C24A 1XNRJ 4J91A 2Y1RI 2X6SA 3OS2A 3K89A 5F8IA 2FBXA 2QM1A 1NPRA 3KYLA 3V2UC 2EK6A 1F5BA 1T9YA 3DRRA 3PRDA 2QJ3A 2FVRA 4GVEA 5FLXO 1SQGA 2WHOA 4I9QA 2W4PA 4WU2A 3MZIA 4ZIVA 1JK9B 1XNQJ 2WVFA 4DV0J 4C11A 2DHSA 4Y2CA 5IT9U 3GE9A 1EHWA 4NLOA 2O8DA 1MU2A 4HL9A 3DFEA 5LSOA 3WZ0A 2BE7D 2CNNB 3AD9C 4DR1K 4EAHD 4B3TF 4PPDA 2FJEB 2COLA 3AY0A 1JLCB 2WVEA 3MXMA 5D3GA 3GB0A 2ITGA 1RNHA 4I67A 4DR2J 2XZTB 4NI2A 5AE2A 1LWFB 1WHYA 3QEXA 1FD2A 1I3OB 1REGX 3NS6A 2JEGA 4FWQA 1NM1A 2MKHA 2RNEA 3QJLA 2YWHA 1S1UB 3J7YU 4KJIA 4FF2A 3C6UB 2MLXA 4EGLA 4AQYK 2J76E 3O80A 2OEKA 4X2BA 5KQ8A 1R0AB 5B08A 5AXMA 2EWSA 2O8BB 1BHNA 1YJRA 4DN9A 5FIIA 4R0EA 2ZH4A 1PKUA 1YRXA 2O4GA 2UXCJ 2Y1LB 1G3OA 2VFRA 1T02A 1RP5A 3AY9A 4ZVSB 3BPSP 4KHNA 2YJFA 1UW9A 2ZEJA 4JRQA 2PA3A 3D68A 4QZVB 4AFFA 5C0YA 2K06A 4U7UK 3H08A 1NNDA 2VHGA 4NCGA 3PM9A 2P5OA 1RBAA 3ZSWA 3EZOA 2CH5A 3VF0B 1S9EB 5AQOA 1MROB 5KFTA 1ZZNA 2HBLA 1RBOB 3T5JA 1HPZB 3BO4A 4J9MA 3KLFB 1RDDA 3O3LA 3HTVA 4RW7B 4PXDA 4FJ8A 2OPRB 1NOZA 3OTOK 4X66F 4M3YA 3KG0A 3VQTA 2JFDA 4DV7K 1YX2A 2CQCA 2AGQA 1IG9A 3E9LA 3OW2M 1T0TV 1NM2A 3H4BA 2BVZA 3GMGA 3K2PA 2GV1A 3MM5A 4B3TK 4B1XB 4R8UB 2GUPA 2CJKA 4JI4F 2IRYA 4F67A 3HD2A 1C1AA 3AO2A 3FFIB 1DQ8A 3N9UC 2Q2RA 3DLLQ 2KU7A 3RMAA 1YJUA 2UXDF 2V8DA 3R3TA 3CCUN 5KG5A 4X4VA 3JAMU 4JBCA 3QATA 4LSNA 1TMMA 3GONA 1SI9A 2HS3A 4DUYF 3KK3B 2V52B 2EC0A 2LQBA 3GFHA 4FLUA 5IXUA 4KT0C 3SK3A 1RGVA 1FHTA 3GLJA 5C15A 2J6SA 4YB1P 4IFVB 2ITMA 2ZHOA 1S1VB 5FJ4A 3TP2A 3CJRA 4PXCA 1HNZJ 3MPVA 5AR0A 5KT2A 1C0TA 1TL3B 3PVXA 4TU7A 3LQVA 3H45C 2MKIA 2EFOA 4WQ4C 3M2UA 3P31A 2XNQA 3THPA 1WKLA 3NOGA 4DR1J 2ROPA 4NLQA 4L8RB 3U8XA 4C3LA 3V6DA 2FD2A 1Y11A 3AVGA 5AQSA 3JSRA 3SZ2A 3ET6B 1RT1A 1P9YA 3M8SA 4CECA 1C0UB 4MQ3A 2ZKTA 1WBBA 1HMVA 1Y4ZB 3HZ6A 1K1SA 1CXQA 4H5RA 4UZBA 4O8UA 2HFSA 2ZJQQ 4K4YA 2D1CA 4B9VA 3H98A 2D0BA 4PQUA 1WNEA 5I3UB 4USTA 4AL7A 3SEOA 3NH2A 3H90A 3AODA 3VGVA 1U0HB 2FGOA 3R6LB 3BZKA 4CIGA 1RTHB 4RU9A 1XHZA 4M3WA 3BN4A 1NBWA 1WF0A 4N77A 3N6LA 2QWLA 4QS8A 4ZVOB 2NPFA 4GV3A 2E5LF 3Q86A 1O5JA 3HHKA 1BUPA 4LF4K 7FD1A 3FFKB 4YOUA 3CJ9A 3FUYA 3KK1B 2AYMA 2GMLA 5CXTA 1PIEA 4GVLA 1DURA 1Q7LB 2LVWA 3CB4A 3QJJA 4F4WA 2XYGB 3LP3A 5F9LA 2BQUA 2FVPA 4CK2A 1HNWF 3ZFVA 2ADBA 4XH1A 4I6MA 1JLQB 3SQGA 1VSEA 2AYGA 2HF4A 1VQ9S 1VR6A 3HSCA 4KYZA 1HNWK 1CLQA 2AP1A 2CZ4A 2ZC4A 3S7RA 4MIWA 5D0GA 1U48A 2LEBA 2DTUA 1J5OA 3MR7A 4EK2A 2XG8A 3I55S 4ZPVR 4CGIA 1NDLA 1ITGA 4DV6K 4IRKA 3MOZA 1C0UA 4FK0A 2W01A 1LWFA 1NGJA 2BA9A 2GHVC 2HLUA 3KNGA 3WNGA 3OS1A 4F8RA 1CS4A 1O1WA 3PHEA 1QE1B 2DHAA 4BRHA 4ID5B 3ATUA 2YXLA 1CBKA 4KHUA 1NB2A 1CS4B 4M63C 1TTHB 1DARA 1NGHA 2E8AA 3G4SN 3V1RA 2NSCA 1FCAA 3ENQA 4KFBB 1W2IA 4PG4A 3W66A 2ZNZA 2ATLA 3TVKA 1NPPA 1Q7YT 3IBCB 2GGPA 3AO3A 3M8ZA 1Q8IA 4RW6B 4AL6A 4JI8K 2LEPA 3DRRB 3R7NB 4USWA 1GMUA 3WNFA 4NX9A 2X78A 2GX9A 5I42B 3H46O 3H2LA 4LSLB 4JYAF 1RT4B 2ZOMA 2N3LA 4IQXA 1Q82T 3NGIA 1TL4A 1ZPWX 3VF6A 2Z1IA 3VQEA 5ELZA 4K41A 4BDPA 2N7CA 1EQYA 2UXBK 1EXQA 3WUHA 1P9QC 4LF7K 3GU0A 3JQJA 2KYZA 4K2XA 1S9GB 1SJQA 3VR1A 2X3GA 1Z6RA 1FERA 2Q3PA 1SKUB 3R97A 1PYOB 3ALYA 3J7YI 1VHIA 4BC2A 1VRTA 3PW0A 2R7SA 3AO1A 2ZH8A 3ZZPA 1FX4A 1DT9A 3J7ZO 3N4WA 1RBSA 2POKA 2IM0A 3OTBA 4DUYK 3HM9A 4P2FA 5AQPA 3QT7A 3J80U 5L46A 5D4NA 1D4XA 1S9FA 2KT3A 4QWDA 1FE4A 3IMXA 1URNA 1VSIA 4QCLA 2AJ0A 2F8TA 2RMLA 3NY0A 3OR2A 1BQMA 1S12A 5AQJA 1KQGB 1NGEA 2NZCA 2ZH5A 1SKSA 2YNIB 2E9RX 1URRA 2MQQA 1E4GT 3FCHA 3TJ9A 1U6BA 2P9PA 4FJJA 1FNXH 1X4HA 3LM2A 2P1JA 4LQ3A 2EEYA 1WDTA 1FXXA 1R43A 4DOZA 1H72C 4M45A 5GAEU 1NU0A 4DX8H 3T1HF 1RDBA 4ZLLA 1U2RA 1HD1A 2YX1A 5CH7B 3UCUP 3W65A 2L48A 1CJTB 3PNIA 1N33K 5K9FA 3CF5Q 3BBFA 1JQGA 3CC4N 3AVFA 3LO3A 4P2SA 2KHOA 3QIPB 5AQHA 2MZQA 3JXOA 4N7TA 1OPIA 1GXUA 4LY7A 5LXYA 1S5JA 5LL6Z 1VQ5S 2XMMA 3M3ZA 4J2BA 4DG1A 3NBPA 5IT9Y 2MJUA 4OYPA 4B9QA 3D0IE 3DHXA 2WOMB 2HWTA 1H3DA 4G65A 1HNVB 1TFYA 5BRHA 4QIEA 2MQ8A 2CQPA 2CVEA 4ES1A 2H51B 1KLNA 3H25A 3MF5A 1N5QA 4OJRA 3ZSQA 1NG9A 4JV1A 5AQUA 3DOKA 1B70B 1NUEA 1OY6A 5B0BA 2IM1A 2FSNA 4A62A 1S6QB 4F02A 3MUTP 1T6CA 3HSJA 3EY1A 1BGXT 3GJQB 4RZRA 3H20A 1RLDA 2OPSB 3FEZA 5FD1A 4ES3A 1B3TA 1VQMS 4XDDA 1LFWA 1YTYA 4R8UA 1NJIO 3T1HJ 3ICLA 1FRKA 3O5TB 4DCJB 1YJWS 1VQ7S 2D0OA 3AVNA 1X0PA 2UUCF 4OX9J 3VF4A 4P7VA 4OPAA 2VQEJ 3CXCM 2PMHA 4MK8A 3A3NB 4B3MJ 5EX5A 1YITS 2BJ3A 4DXLA 3KLFA 1FFWB 2W8LA 5CZVA 2IAJA 2ZD1A 3Q0AA 2CJBA 3FRYA 1RDUA 1VIXA 2A1RA 2HNZB 3NF6A 1B99A 1OVQA 3DXKB 5KFEA 2DYAA 1XK8A 3DM2A 1EETA 4MLEA 4WQ4A 1N56A 2FZGB 2HRUA 1F3VA 4FP9A 7AT1B 1A6LA 3BYRA 3V81A 1Y00A 2XULA 2A3ZA 3GP9A 4ZP6A 1R8BA 3OYIA 3RSEA 3RZAA 1FFGB 3E8OA 1VGYA 5DZ6A 5TKWA 2E44A 2X3DA 1QVGM 4C0OC 4CEBA 4IOAL 3FMBA 3GYGA 3CCJN 1WELA 4F3TA 4B9MA 4H5VA 3FNNA 4C98A 2DO0A 1QSYA 2E1CA 1Q9YA 2W7OA 4DWIA 1HWKA 3F0NA 2G8VA 1VRUB 3W2VA 5H9EJ 3ZT0A 1OPZA 1Q4RA 3S3MA 2FDNA 1DLOB 3A13A 3WIVA 4MO4A 2C28A 2PI5A 1QS4A 5D0EA 3OLAA 4CFAA 4LF8F 5EU7A 2R7RA 3BM7A 2NUBA 4ECWA 2RE2A 2JFKA 4URGA 3R5DA 5I4MA 1TL3A 1HR0F 1PJ5A 4W5OA 3TNVA 4P7TA 4CHPA 3THYB 1JJHA 2FSJA 3I5CA 4ZJLA 2VOOA 3T1AA 4RKUC 3TARA 5HRSA 3QZ8A 2BKOA 4ED8A 1EP4A 1UETA 3FZBA 3C14A 2C2DA 3NNHA 3BSAA 4A8OA 2DPIA 4B9SA 1UVIA 3TAEA 1TVRA 1QHAA 1P8GA 5M1QA 2WW8A 2MQOA 2L41A 2KN4A 3H2UB 3HT0A 4JK8A 4JI5K 1DBDA 2QMXA 1SUQB 1X0FA 1GFWB 2HBJA 2VV5A 3B6PA 2JEIA 1CQMA 1S9EA 3ULEA 4BRLA 1D8YA 2P51A 2ZKUA 3H6EA 1WI6A 1RWPB 3MAHA 1CC7A 5JJBA 1NKBA 1XMOJ 3TX8A 1VQNN 2DIVA 3RUBL 3WIUA 4YHHJ 4DV5J 2J6UA 1GMWD 4Q45A 4O0IA 2XLIA 4M41A 2RU3A 2AD9A 1HBMA 5ADZA 1CJVB 3WNEA 3UKRA 1RKIA 1FKPA 3ENHA 3HFZB 3QRRA 3NH1A 3LAKA 4YDXA 4DR5F 3QJPA 2WBNA 1FA0A 2DNYA 1S4FA 4B9NA 4FSVA 4USHA 4HHHA 4YOWA 2O01C 4OZ1A 4KE5A 3NF8A 4TY8A 1JLGA 3TSQA 4Y2MA 4PG7A 2HVEA 2FC9A 2KXHA 4E1JA 4HHJA 4W5NA 3U9ZA 2QLWA 3BP8A 1T11A 1Q79A 5C5JA 2Y0SD 2DGQA 1KOHA 1HI1A 4Y1DA 2DNHA 3I32A 5AQYA 3ZT3A 2XO7A 3HKWA 1VQ8N 1WSRA 2G8FA 1VBZA 4BQLA 2HGLA 2HMPA 4JI1K 3PIOQ 3W1YC 4LF5J 4WIIA 1SC1B 2KM8B 1KRPA 4AE5A 2XY7A 1C0TB 3BQ1A 5LL6d 3KKRA 1HD0A 5LMNF 2DGXA 1TUGB 2FY1A 4LF2A 2VG6A 2DR6A 2FPHX 5DDOC 1HNZK 2VDIA 3U27A 3OVBA 1XNRF 1C0FA 1WAJA 4FK4A 4EP4A 4E3SA 4FM0A 3VA3A 4LFCK 2BGGA 3QIPA 3V6HA 1FKPB 2R7OA 3CDBA 4DCOB 3D9BA 2Q1NA 4OZ2A 2F3JA 1QAIA 2LQ9A 4ANDA 3A8JA 2L08A 4ZVHA 4OI2A 2O67A 4ZVRB 4YR2A 4R5PB 3C15B 3NLCA 3W61A 3KKSA 4KB1A 1F21A 3LWLA 4Z4CA 5AQVA 4W4MA 2AWZA 2RKIA 2I0XA 5J2PB 4Z4GA 1TL1B 3VN5A 2VGMA 3W8GA 3VEYA 1WSVA 2YKMB 3I87A 1YWXA 4PKIA 3KWMA 1L3UA 1KONA 4CLWA 3C95A 1BI4B 2LA6A 4WWSA 4OIXA 2OEJA 4ECRA 2PMWA 2VFUA 5CZXA 2V4JB 2RKIB 1VQOS 2XB2D 4JI5J 5FPDA 3ZLJA 4ZHRA 2J7WA 5H9FK 3ZX3A 3T19A 3SDEB 5D78A 2E9ZA 1GNKA 1MMNA 4EMDA 2FLOA 4DPWA 3MAQA 4HTIA 4NE9C 1OY9A 3ET6A 2IA0A 3EEQA 4X64F 2GQQA 3OSPA 5EWFA 4I0WA 3ITHB 4DI6A 4UOFA 2L9WA 3PFOA 3VAIA 4KPYA 1X1PA 1OS5A 1W2BR 3KLHA 1NJYA 4YHHF 3MMCA 3EE9A 5IS2A 1RAHB 2KTQA 2VG7B 4ZLNA 1O6XA 2GW8A 2A5XA 3N4QA 4YY3F 3KK2B 4FF1A 3AVHA 3AHPA 2KJWA 5JUMA 4I2PB 1U1KA 4XAKA 4ED0A 2GMJA 5J2MB 4QIVA 2KL8A 3RSEB 1YAGA 2OZMA 3M9OB 1UWAA 2JX2A 2PT0A 2BRLA 2MJNA 3V4IB 2YKAA 1UFKA 1YVNA 3E3XA 2E7WA 3WQTA 2HQGA 1OWXA 2G2YA 4WP3A 4X4UA 3QDKA 2E9TA 5KFCA 1VSHA 3K17A 5F8LA 3DOKB 1XTZA 5C25A 2B7BB 5EY4A 3MX2A 2PEBA 5KT4A 3L4IA 3WQUA 4K4SA 1DHMA 2W6LA 4CNYA 2F7TA 1VC0A 2WVBA 5ETNA 3NAIA 4X65K 4F0MA 2X51A 3VQAA 1VQ9N 1VIOA 1HBNA 1LW2A 4IBNA 5HRPA 3MM9A 1OJ4A 2XNRA 2LMIA 3J81O 3DMJA 3O3GA 2FHOB 4MIAA 3RB6A 1U49A 1YJNN 4DTXA 4A8YA 1T8EA 3FZHA 4URSA 3W9JA 4K42A 1KTQA 5AXLA 4YOEA 1NGDA 1VSLA 2D0CA 4UQTA 4GKKK 2J8AA 2VIHA 1VQLN 4F4AA 1Y10A 4E7JA 2GZOA 1YT3A 1SJ3P 1SL1A 4FYYB 3GJTB 1ITPA 4KTWA 4YORA 1KS2A 1ZA1B 1S6OA 2B5JA 3THVA 1RTZA 5CCLA 5HI7A 1RTIB 3QWPA 3VEZA 2ASLA 3VTHA 1Q5VA 2R2UA 2PDAA 4Y65A 3DLRA 2EWHA 1O0PA 2ZZNA 1HNIB 4ZMMA 2ZVSA 4O5FA 3ZTOA 3V6JA 4LBIA 4GVBA 2X1GA 4GRSA 3DLGB 3VGTA 1YGYA 4BACA 2RDIA 2O8EB 1U6FA 1EB0A 3IS9B 3KLGA 3NKYA 3HK2A 4Q5VA 1YI2S 2MEWA 3K8WA 3LOUA 2XI2A 2PFDA 1KDNA 5KT5A 1QUVA 1MLAA 1N52B 3U1LA 1SBRA 3AVLA 4UTGA 2B0GA 2DNNA 3E9PA 1JLQA 3A0IX 5F0XA 3M2RB 1Z2LA 2XY6A 2X7IA 1N5YA 4WFXA 3C16A 4TY9A 4C8ZA 2YH0A 3RWUA 3QNOA 3M2RA 3LH2S 4M3RA 3Q8VA 4I69A 4V19S 1UZHA 2LXFA 1FD8A 2IPOB 2HS0A 3UE2A 2Z58B 2VC1A 3T6BA 3MXIA 1B4SA 2UXBJ 1WN7A 4PABA 1T9VA 2WONA 2Q1LA 1U4BA 3CM6A 2GCFA 4BRAA 4CEZA 1CXUA 4P10A 2HSTA 4DQSA 1QZ6A 2DGTA 1IBLF 2QN6B 1KCFA 3MN7A 3HD1A 3HSDA 5K14A 1NEEA 2OTJN 3QT6A 3VQ7A 2EXUA 5BJRA 1PCAA 3CMAN 3D2FA 1X5PA 3EYZA 2VU5A 4A8FA 4LUBA 2V8GA 2CG8A 1WAFA 3DLEB 3V1QA 4BR7A 1RWMB 2ZUGA 1P27B 5HBMA 3AB2B 3H1QA 2DCUB 1E4FT 2BJDA 4Q0BB 3ZNUA 4U7CA 5JVHL 4CO2A 1R8AA 3AOCA 3EVWA 3PYFA 1JWWA 5FLXY 2ASJA 3IN5A 4WP8A 3QMQA 2MPUA 1S3XA 3ZNJ1 1NZ8A 4FJKA 1FX2A 5KGWA 4OZLA 2MY8A 2D5RA 2Z0GA 1JJ4A 5I42A 2KZZA 4CHQA 4HI2A 1NJZA 3BKUA 4FM1A 2V4RA 3RB4A 2OPRA 1NGBA 1CLFA 1FI4A 2V7YA 4V19X 4CFBA 5EVZA 5F8MA 3OYHA 4AXJA 5C12A 1RTJA 5CD4A 2JWLA 4ZDNA 4O0JA 3O08A 1UFWA 1ZAWA 3G8QA 1FXRA 4JKEA 3FR0A 2IYGA 4NCGB 2LXIA 5GADU 5H9EK 1LWCB 3HVTA 1N48A 2JVOA 4XDCA 4TU8A 5M1OA 4YY3J 2YCHA 3W64A 3D6RA 3PSFA 3CYMA 1U24A 3TO8A 3CC7S 4KH1B 4E1MA 4NXNK 3JSMA 4KIAA 3D2WA 1RAIB 2BE2B 1ZPVA 4ED2A 1VQ8S 3AGRA 5CZ2A 2XTJP 4RNOA 2I6WA 2GVZA 4U7BA 3PEJA 3GIKA 2IMWP 3OY9A 1RHUB 4K0KF 4CO0A 4B3SJ 1N34F 5DG7A 4IO9Q 1M1HA 3MCPA 4RW7A 4ZP8A 3AA2A 4ELVA 1B7FA 3LW5C 3D5MA 5CHCB 2DY4A 3BF4A 3QEVA 4LFBK 1NDKA 2QWOA 3J80O 1FT8A 2QWPA 1SQEA 3M30B 2FC8A 1M1KO 1I51B 2CPEA 1F60B 1ICEB 2BRKA 4O3RA 1JKHB 4FS2A 3PEHA 2RF2B 4OKJA 4PYAA 2C2ZB 1VQYA 3SDEA 4FW2A 3K58A 1RTDA 4FLYA 5DO2A 1FRJA 5KRTA 4CHNA 4A2AA 2B6AB 1UP1A 1WC6A 2H48B 5L9XA 1EKRA 1RHRB 2D9OA 2OHDA 1YXQA 4QR2A 2E7XA 2Y1IA 2GVDA 3H5YA 3UN5A 2HW3A 1AUSL 4YEAA 2HFZA 3QFHA 3GIMA 3DXMA 3GZ7A 2YWKA 1S22A 3TR5A 3LPEA 3P49B 5HN0A 5IV4A 1SL2A 3O3HA 1SZ2A 2CQ3A 4CF1A 4DCPB 4CEOA 3H5SA 3TUIC 3T7ZA 3THXA 4NLUA 2VC0A 2GS8A 4KGXB 3HPHA 5AZIA 4ZHRB 4CZMA 4KHPK 3AH6A 2KI2A 3IUCA 4OHXA 1OYDA 3R5JB 1JCFA 3W63A 3CCJS 3G2XA 1VC5A 4LSLA 1YDLA 3THWB 2Y9HA 2P9NA 2AGPA 4GNIA 2P9SA 1WSHA 2QTWA 3WXJA 3NEKA 1E6VB 2OP5A 2VFSA 1VYAA 2BANA 4A8KA 3W9IA 1N6QA 3MCAB 1GOBA 3A8IA 4H0PA 3M8YA 3UPFA 4Z37A 1P1TA 3UD4P 2FUG9 5A8KB 2P9NB 3KK3A 8AT1B 1DKGD 1CQNA 1WF1A 1W7AA 2R2TA 2VB6A 5AXKA 5DG8A 5U47A 4A8WA 5L1LA 4KKOB 3UVJA 5DDPC 2KRRA 5CE3A 3IWNC 2HG4A 3O6WA 1CJUA 4HCCA 1MU2B 1U1LA 3HYFA 1NAQA 2BJEA 2DY9A 1Y97A 3IM8A 4I4BA 2IAJB 2ZD1B 2MXYA 3U3GA 1WSEA 2YBVA 4CD3A 2NZ4A 2VQFF 3GYXB 4MDBA 1D09B 4QU7A 3JQMA 3NDKA 3CFPA 4WBFA 2HBRB 3EXYA 4U8YA 3OYAA 5J2QB 1JL1A 3FMWA 1W26A 1IN0A 3US5A 2HS4A 3ZZZA 1T05B 1N34K 4RLEA 2WB1D 3PX6A 3E01B 2MGZA 4CBXA 4KHPJ 2HZAA 2KZMA 3H3NO 3EKSA 5KG0A 3DOMB 3EM1A 3IO1A 2LP4A 2ZM6J 1HNZF 2J9DE 5J2NB 4L75A 1VQPS 1VSKA 3OS0A 2M2BA 1WOPA 3N6NA 4BDYA 2HEKA 2OO4A 2YHXA 2BEFA 1TELA 4W92B 1M5KC 1JJCB 1TU0B 3G87A 3PIOL 2W2QP 1FE0A 4E19A 1RWKB 2RS2A 3FSXA 3H5XA 3U6FA 4CP5A 3ULEB 4NLSA 3WXMB 4PWWA 2APOA 5I9EB 1K0TA 3EN9A 2QA2A 1KVBA 3ZTPA 1GXLA 1UJ5A 2W8KA 2U2FA 1EAYC 5IOLA 3M5RA 2CGKA 3D0PA 4K59A 3SUNA 3PJ9A 2V94A 4XTTA 3Q7CA 4L76A 4BR0A 3JS6A 3Q7BA 1BIUA 2NXEA 3FE1A 1UVLA 4DR5J 3DRPB 3IAM9 2F1FA 3P38A 1T3OA 4F0HA 3BDEA 2LQ8A 4RW6A 3LDPA 1K8KB 2U1AA 3L3CA 2ETJA 5SZTA 2IC3B 2M0GB 1BWEA 4LRAA 2HBZB 2LECA 1BHLA 3CCWA 1XMOF 2HHHF 1OSCA 2BR0A 3P83D 5C42A 3PJWA 1LV5A 1FJGJ 3OL9A 5DM7Q 4J9RA 2UUTA 3D1OA 2YHWA 3G82B 2NSBA 4HTJA 2YNIA 3CGIA 3RBXA 3D3CJ 1QZ5A 1PC4A 4PY5A 3CJ7A 4CJ5A 4G9ZA 2R7TA 4ZN3A 2JL9A 5CCMA 4U8VA 3FBEA 4Y2IA 4JI3F 2HKEA 4LRFA 3HHEA 4EBEA 1IJJA 2HAFA 3EGVA 2HHWA 4M5MA 3ZSZA 4CCHA 4C0HA 5GINA 3RAMA 1U8WA 3KVGA 3ASMA 4M5IA 2QMWA 3CWJA 4I6YA 1E6YA 3O5BA 4I6AA 1BLUA 4O3OA 4AH9A 1R89A 3UW1A 1FRMA 3C16B 3BGUA 2HQ3A 1JMTA 2IIHA 1GOAA 3L9ZA 5HJYA 3CJBA 2EFQA 1WOOA 4LC9B 1S7IA 2O1PA 4FM2A 1GTHA 3VQCA 3CCVN 1A5VA 1NU4A 1K1QA 3WXKA 2F8EX 4BS2A 4JB8B 2A2DA 1U0SA 5K20B 1BIZA 3D28A 3L2WA 3TPQA 1YIJN 1T6DA 3PDNA 4FBUA 1OMSA 5BN9A 3KD1E 4JKGB 5A2QO 2BJ8A 4CLUA 4DL0C 2DGSA 1GLCG 2XSJB 1B0VA 1FRHA 2PN6A 4OL8A 4B9TA 4BRMA 2BX6A 3SV3A 2AGOA 4I9LA 1HKBA 2WVCA 2D3UA 4LH4A 1RT1B 5K8NA 2DR8A 1RCXB 4DPTA 1LNQA 3C2PA 1VK0A 2VWKA 1YJTA 4YFUA 4AHTA 4J9LA 4IRDA 4CT9A 4FCYA 3CCLN 3PACA 3P4UB 1N36F 1Z1ZA 3VQ5A 3J81U 3BGLA 1E6YB 7FDRA 5A6WA 3R8YA 1BQXA 3C66A 4DR3J 1EQMA 2DGUA 3C6UA 2QA4S 2BBEA 4JI6F 4WFZA 3OYMA 1N6QB 4ECTA 4DFPA 2W7AA 4MO5A 2HK2A 2E7VA 4JI7F 3GILA 1KEKA 4PWUA 1L3VA 2ZNYA 4GO5X 1NK0A 4NI2B 2QLXA 1XR7A 4MLHA 5BR8J 4O3NA 4TNOA 3CD0A 2W1BA 4G6VB 4HHTA 1HYSA 3L0QA 2WB4A 4NZ0A 1U1RA 3ZTSA 2CQ2A 4WP9A 4DPUA 3TAPA 3G96A 3TA1A 3PZPA 2R7UA 2J5AA 3K2YA 2YNFA 1RAGB 5CYMB 2OSRA 2JLFA 2DO4A 4WYLA 3OL7A 3Q8UA 5DDRC 1S48A 3FZ2A 3ELHA 1Z4UA 1J5OB 1LK5A 2ZM6K 1SXLA 3W2WA 4F2RA 2LCWA 3MR3A 4DR6J 1RDCA 2X74A 3DRXA 2GAHC 4JLHA 5CYQB 3G71S 3MECB 2C3UA 1W2BM 4CZEA 2JNJA 2GQ2A 1HLWA 4FDFA 3BF1A 3QEWA 1WC4A 3BH6B 2UUAJ 2HNZA 1TMJA 4EWTA 2BV3A 2DNOA 5KFYA 1R8PA 3O6QA 4LJMA 2F4VJ 4Y2KA 4DV4F 1TYQA 2EK1A 4NRTA 3QRQA 5THWA 4XPEA 4LF9J 5T7BA 5L9NA 3Q2SC 4P71A 3H40A 1UAWA 1VOMA 4HTUA 1XR6A 3HF5A 2PA8D 3H42A 4EYIB 3MM8A 2GA7A 3N4PA 4B1ZA 1N32F 3BEGB 4QWBA 1GLLO 2OFGX 2RDDA 4B3SF 4Q8FA 4JI7J 1HBNB 4J9SA 1RDAA 2Q36A 3C14B 4QYZK 2K3IA 2I38A 1ZBLA 4FYDA 4PWDA 1Y5IB 3RAQA 4ZPWR 1RT3B 3IRXA 3SI8A 4FYXB 1SCJB 3ZSVA 4N8OA 4B3SK 3C19A 5GMDA 4DU3A 5JXSA 4Y3CA 1K73T 3KLEA 3D0GE 4KV8A 2QMUB 1S0VA 1K9MO 1KAZA 2ZBRA 3ADAC 3A12A 3VQPA 4FZZA 1ZA2B 1D9DA 2DHHA 3QGGA 3RB3A