2IC3A

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with nonnucleoside inhibitor hby 097
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Clinically Relevant Lys103Asn/Tyr181Cys Double Mutant HIV-1 Reverse Transcriptase in Complexes with ATP and Non-nucleoside Inhibitor HBY 097.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H (p66 RT)
total genus 113
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ic3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ic3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ic3A05
4R5PB 4GMJB 4I2QA 5KFWA 2VWKA 3GIMA 4ED0A 1TGOA 5J2QB 4OGEA 1UAXA 3V9SA 1C1BA 2QV6A 1VSFA 4RNNA 4Y2AA 5CYQA 4CF0A 2VG5A 4ELTA 4E7JA 1N56A 3G6VA 4CHNA 4O4GB 5KG6A 4DSJA 1NHVA 1RBVA 3KTQA 3RB6A 1KLNA 1WNSA 4M3XA 2XY8A 1HNIA 2VWJA 4F4ZA 4EO8A 4ECSA 4F3TA 5FDLA 4DQIA 1KLMB 1MU2A 4Q44A 4F4WA 1IKVA 1UA1A 1ZYQA 1HQEB 1KHWA 1LW2B 4HCBA 3TAMB 4FJHA 4ECXA 3V81A 2FVRA 1VSJA 4CIEA 4FJXA 3MEDA 1HYSB 3ALYA 3RMDA 1L3TA 2FBYA 4IFYA 2FLNA 2IMWP 4IG3A 1WSIA 3SUNA 2IJFA 1IKWB 3CDUA 3N6MA 2V4RA 5F8HA 3RBDA 1ASUA 4QW9A 2AGOA 3PO4A 3KLHB 1NJYA 2ASDA 3RMCA 4RUCA 3FRZA 2RPIA 1SH0A 1NOYA 1HARA 3KLGB 2E9RX 1CSJA 5KT2A 4CHZA 4Z4GA 3ZSWA 4CF9A 1FKPB 4KBIA 2BRLA 3V6KA 1S1TA 1BHLA 3SI8A 1BI4A 1IKYB 3VQ7A 5CY4A 4NCGB 3QGGA 1HQUA 3KK3B 1SUQA 3LPTA 2G8WA 4DF8A 4NLVA 3PHEA 3KHLA 1HNVA 1U47A 3OYIA 2W42A 2IDOA 5HRRA 4YR0A 4DQQA 1S97A 3G6YA 4FJJA 4IKAA 2E4LA 3SNNA 2FVSA 4FW1A 4BE0A 4F4KA 1XHXA 3C6UB 5KFQA 3KLIA 1UWBB 2G8KA 4ZHRB 1REVB 2RF2A 2FVQA 3MFHA 5KT4A 4OL8A 4EP5A 1K1QA 3AO1A 4MK9A 4FLWA 1RTHA 1DLOA 4NLWA 2XY5A 3IRXA 3MFIA 3NE6A 1Q9YA 4EP4A 5J1EA 3BJYA 3QEIA 2QXFA 4KO0B 3DLKA 4EZ6A 3HVAA 4H54A 2YV0X 5HBMA 4CJFA 2FJXA 4J9SA 1TL3A 1ZETA 1T05B 4I7FB 1S10A 1SL2A 4WE1A 3TVKA 1HYSA 4O3SA 4M3WA 3IRXB 4FLZA 1T8EA 4O3OA 4E7IA 1HMVB 3RR8A 2XI3A 3MTKA 3KLEA 1S0NA 4CFBA 4RNOA 5KFKA 5DG7A 1YVFA 4CJPA 2RF2B 4RW6A 1NKEA 4KTWA 3OSPA 4DSIA 3E01A 3AV9A 1ASWA 2D0AA 4CEAA 4WYWA 2VA3A 4B9UA 3VQPA 1RTJB 3SV3A 1WSJA 4CIGA 2HNDA 3RB4A 5DQHA 2I5JA 1WNEA 4ID5A 4WZQA 2KW4A 3TAGA 1UOCA 2XGPA 3QEVA 2V0NA 4CJSA 3ZT2A 3VQEA 1SL1A 3AA5X 4FZYA 4DQSA 4I2PB 4ED3A 3V1RA 4ZP8A 1BI4B 2E6MA 3QINA 1XI1A 2PZSA 2W7OA 3NCIA 4B9NA 3U3YA 2YNFA 1RT4B 2IM3A 2W7PA 4KI6A 1WSHA 4CHOA 3RRGA 3OY9A 2BANB 4NLDA 3ICLA 4O44B 1JLBB 4PWDA 3AO2A 3C6TB 2B4JA 2ATLA 2D0BA 3NH1A 3A2FA 4QWCA 3BR9A 4DTRA 3RAXA 1LWFB 4CJ4A 4MIBA 4O44A 2ASLA 3C94A 4ID5B 2UVRA 5I42A 3H5YA 4CEFA 1HPZB 3MR2A 2W8LA 4BE1A 4LSNB 2VG6B 1S9GB 3PR5B 4OVLA 3LZJA 3LPUA 1VRUB 4K8ZA 3K59A 3T1AA 3L3UA 2C2RA 4MFBA 3V6JA 3FQLA 2JEIA 4C8LA 3EZUA 1RT2B 4TQRA 1SKWA 2OPPA 3LP2A 4DLGA 4OKKA 2R8JA 1IKVB 4J2BA 3FFIB 5KRSA 4DF4A 3SFUA 2KQ2A 1RBRA 4K4TA 1GOCA 4DTSA 1SL0A 4IBNA 3DLKB 4F3OA 3LP2B 3E01B 4CGFA 3KLFB 4KHQA 1RT6B 3QLHB 4ZVHA 5CYQB 1JX4A 2RDJA 1L3SA 3LANA 3OYJA 4JS5A 2QK9A 4KB7A 3HVWA 1RTIB 4RW8B 2G8IA 1RT5A 3LALA 3LP1A 1A5WA 4PY5A 4RG8A 3KLIB 1T7PA 1VK0A 5I42B 3PW0A 3HYFA 1BGXT 4M45A 4WFXA 3RRHA 5DG9A 3NH0A 2FLLA 4TN2A 4CHPA 4CK1A 4NLUA 1JLBA 1RBUA 5HRPA 4HUEA 3CJ3A 3L2UA 1NNDA 3HJFA 3OS1A 1REVA 3CJ4A 4MKAA 2ZQBA 4NLXA 3I0SB 2RDIA 4DFJA 2Q3SA 4CE9A 3PUFA 3N6NA 1JLGB 1BQMA 4NLTA 1TL1A 4QW8A 1XR7A 3DDKA 5C25A 4ECUA 1RDAA 2GIQA 4Y1DA 4ZTFA 5T7BA 2FVCA 4ECRA 3TR8A 3OS0A 3LWMA 1VSMA 5C24A 1LAVA 4FBUA 2XY6A 1X9MA 1WSFA 1WAFA 3N6LA 1U45A 1RTJA 4MIAA 2YKNB 4Q0BA 2ZE2A 4TXSA 1IG9A 1X9WA 2DPJA 3CFOA 1NJZA 1U4BA 4M3RA 4KHNA 1TVRB 3THVA 4DS5A 4CECA 3NBPA 1J5OB 1N5YA 1LW2A 4FJ7A 4WE1B 3KK1A 1EKEA 2GC8A 2PYLA 3UR0A 4OPJA 3SUPA 3KKRA 4W5TA 3MEEA 2FVPA 1QUVA 2R8HA 1YVUA 3FFIA 3NAIA 4CEEA 1RT7A 1W9HA 2JEGA 3SJJA 4E7HA 1S9FA 1JKHB 3AA2A 2UVUA 4FK2A 1C1BB 3CWJA 2AX1A 4KHWA 4NCBA 1S9GA 1NJXA 3IG1A 1JXBA 3KK2A 2JEJA 5KFXA 4ED8A 1JLEB 1JLQA 2ITGA 5KFJA 4AHTA 5F8IA 4NLYA 2J6UA 1HNVB 3AO3A 3NF7A 5KFLA 2OPSB 1O1WA 3DI6B 4IH5A 1ITGA 3ISND 3HP6A 1U49A 3OL6A 2BANA 4K4ZA 3BSOA 4FK0A 3PO5A 1Z25A 2XY7A 3O4NA 1L3VA 1BCMA 3NMAA 4LY7A 4RW4B 2ILZA 1HRHA 4I2PA 3QNOA 1RT3A 4YR2A 3MF5A 2Z1IA 5KI6A 2JEFA 1KSPA 3OYEA 4FK4A 3DLRA 3K5LA 5HP1A 3DMJA 1XHZA 2J6SA 5KFZA 4JRQA 3AVFA 4CF2A 3SPZA 3IS9A 4F50A 2OZMA 2ZKUA 5KG2A 3QIDA 4KB0A 4QAGA 4IG3B 3KK2B 3O3FA 3QETA 4QPXA 4OKEA 3P83D 2BE2B 1VSKA 4UQGA 4E0DA 1T3NA 3I5AA 4K4XA 4U7CA 4ZPDA 3V81B 1U48A 4CJ3A 4F8RA 4QOZB 1NK7A 2WTFA 4NLPA 2F96A 3G10A 4NYZA 3LAMA 3H4BA 3GYNA 2Z1GA 1ZBIA 1I6JA 4HCCA 4ZPBA 5KFFA 5FRNA 3GQCA 2J6TA 5JS1A 2OPQB 4HTUA 2GIRA 1KFDA 1SKRA 3ZT0A 4DTMA 1RT1A 2CJQA 1FK9B 2DPIA 2E9TA 2YKMA 2AX0A 3JYTB 1BIZA 5FROA 5KFCA 4O3QA 2OA8A 3BGRA 4ZPCA 4ECQA 5KFEA 4DL7A 1ZTTA 4M94A 1EXQA 2PYJA 1RILA 3QGHA 4YP3A 2ZE2B 2OYQA 2HNYA 1TK5A 5KGXA 4RW7B 3NKYA 3KK1B 4QWAA 3VQ4A 3G86A 3RTVA 1FXXA 3VQ6A 4F2RA 4O3PA 3CFRA 3ISNC 1ZBHA 4H4MA 4FJLA 4CCHA 1RBSA 3M9NB 3OLBA 1BQMB 1J54A 1FKOB 4Y1CA 4FJGA 4H4OB 2FC0A 1N4LA 3WNHA 3DRRB 1ZBFA 4FM0A 1S1TB 4K4WA 5F8MA 3H08A 2HHSA 3PW4A 4AH9A 3DRSB 1JIHA 3V6DA 2HHXA 3DLGB 2V4QA 3K5OA 4ECYA 4TY8A 1S6PB 4K50A 1JXEA 4J9LA 3AVHA 1I39A 4Y2CA 4NLOA 5KG3A 5CZ2A 2Z1HA 3DOLB 3KLHA 3T5JA 3NFAA 4O55A 3KHRA 3DLEB 1NK8A 4W5QA 4NCGA 3QZ7A 3K2PA 3VQSA 3RBEA 2FLPA 5L1IA 2KZMA 5D3GA 2IAJA 1CXQA 3H5SA 3E51A 2IC3A 3KLGA 2WOMA 2XRIA 2AWZA 1R0AA 2ALZA 4ZPAA 3VN5A 1VRTB 2VG7A 3HL8A 5KG4A 2I1RA 1RT1B 4I9LA 3ZSYA 4PQUA 2CKWA 2XWYA 3H98A 1EETA 4URSA 1J9AA 4LQ3A 3ZSZA 3TAQA 4U6PA 1JLAB 1A5VA 4IFYB 2P1JA 3BGRB 4CEDA 5KFUA 1DTTA 3KD5E 4Z4FA 1D9FA 3BQ0A 3RAQA 3JYTA 1RT2A 4BDPA 3V4IB 3TAMA 3M8QA 3H59A 4QWBA 4FW2A 4MFBB 5DLGA 3SZ2A 3DYAB 5F9LA 4AHRA 2W9AA 4N76A 3T5HA 2R7YA 1NKCA 1WN7A 3ITHA 4CGHA 4FLVA 4ED7A 3L8BA 3I5BA 3LZIA 3V9WA 4XPEA 2HNZA 4KTZA 3B6PA 4ECVA 4W5RA 1RDCA 2VA2A 4O4GA 4KSEB 3GV7B 4F4YA 3V1QA 2W9CB 3K57A 1DTQB 3C6TA 3AVBA 4FS2A 2AQ4A 5KRTA 4EEYA 4OLBA 3NH2A 2YHBA 4FVMA 3AVMA 3OLAA 4E7KA 4AHCA 2BE2A 2YNFB 4PA1A 3VQDA 3LP3A 4WFZA 3ZT3A 5KG5A 1LV5A 3OYCA 4FJ8A 1S1VB 2IM2A 3OVNA 3CM6A 3ZCMA 3M8PB 1D9DA 3EY1A 3L2VA 3DMJB 2BQUA 1S6QA 3CJ2A 5KTQA 3HSTB 3TARA 2WONB 5J2NA 2X78A 3MXMA 4DL3A 3RB3A 3GIIA 1JLQB 1S1VA 5EDWA 1X9SA 4HYKA 4WXWA 1C2PA 4Z4IA 2G8VA 1C1CB 4DTJA 4RZRA 1S9EB 5KT5A 2QKBA 2ATQA 5KFAA 3PW5A 3Q8RB 4CK2A 3D0PA 4IR1A 2DTUA 4RW9A 3T5LA 3RWUA 4Z4HA 4CJKA 3K5NA 3VA0A 1JLCB 1DTTB 3F73A 3SQ0A 4CFCA 5DQGA 2GBZA 5HLFA 4I7FA 1JLAA 4IG0A 3QGIA 1TKXB 3OHBA 5SZTA 4EBDA 4TQSA 4ICLB 2HWHA 3CVKA 1F21A 3KKSA 4CGGA 3I5CA 3CDEA 3VA3A 1N5YB 3QIOA 4KB1A 3NBPB 1J5OA 3AVAA 1DLOB 3U3GA 4KPYA 1RTHB 3PVXA 3LP0B 3VQ8A 1S4FA 4FBTA 3SQ1A 4FCYA 1B92A 3NF8A 2KTQA 3PZPA 3FSIA 1WSGA 3O4QA 1KTQA 4CGJA 1C0UA 5KG7A 4BDZA 3QERA 4OJRA 3U6FA 1IKXB 1RAJA 3DRPB 3NAHA 3NAEA 3TABA 4KKOA 2ETJA 3SPYA 3CO9A 4NYFA 4TYAA 1WSEA 4J9RA 2D5RA 1TKZB 2WOMB 4QWEA 2XGQA 3OS2A 4JV0A 3AVGA 1S1XB 4AHSA 2OPRA 1YT3A 3QIPB 3SI6A 3S3NA 4F2SA 4G1QA 5F9NA 1LWEB 5DGAA 3CG7A 4ZVFA 3RR7A 1NK0A 2D3UA 4KFBB 4YMEA 4ECWA 4Y3CA 1N48A 4H4OA 1NK6A 3B6OA 4FJNA 3DLHA 1RTDB 4WZMA 3OYDA 3L2WA 2NUBA 3TI0A 4CERA 4TY8B 3OL9A 4KKOB 3CQ8A 2UUTA 2X74A 4O5BA 4DU4A 4MQ3A 4RW7A 2G8UA 4MKBA 1IKXA 1KCFA 3QEXA 5KFPA 2HNYB 1CZ9A 3LP1B 5JXSA 3QNNA 4J2AA 2FJVA 4WYLA 4E1MA 4C8NA 2HHTA 5J2PB 4FLUA 4CEBA 1GOAA 1RDBA 1IM4A 3V6HA 3OYFA 1S0MA 1QAIA 1TKZA 1S1WB 3NDKA 3KJVB 2WCXA 1NOZA 3V9UA 4JLHA 3TAFA 2Y1JA 4IRCA 4ZVEA 2BGGA 4TYBA 3KD1E 1S1UA 4CGDA 1U04A 4J2EA 2HNZB 1KLMA 4CJLA 1C0UB 4RU9A 5F8LA 4E3SA 5HLFB 2WB4A 1HNIB 4NLGA 3DYAA 1RCHA 4DFPA 4K4VA 5HROB 2GV9A 3OJUA 1RT6A 4XO0A 5EWEA 1SV5B 3ZT4A 2C22A 4Z4CA 2D41A 4OGCA 1MMLA 1TP7A 3MXJA 4R8UB 2R8IA 2XO7A 4X2BA 1Q8IA 3RMAA 4LSLB 3PJXA 2R8KA 3QESA 4IG0B 4CHYA 4I9QA 4DSFA 3M9OB 4BACA 1RYRA 3L2RA 5F8JA 2IJNA 4B8AB 3HKWA 3KOAA 3NGZA 5C42B 4FJ5A 2C28A 3CDWA 4GVMA 1RYSA 1S1WA 3ZSQA 5KFOA 4W5OA 1CLQA 2ZD1B 3IGVA 4IDKB 4DTXA 5J2PA 4RUAA 5C5JA 3H4DA 4ECTA 4DL5A 1YTUA 3AVJA 2IAJB 4J9MA 4LSNA 4TSXA 5D3GB 2A1RA 2XHBA 3EPIA 4K4UA 4M3ZA 4EZ9A 2F8TA 3VQBA 2UUWA 4KV8B 5I3UA 1JL2A 4NRTA 3BSNA 2G8FA 1DTQA 4NZ0A 2AU0A 1TK8A 4FZXC 3UIQA 4O0JA 4PWDB 1LWCB 2YNGA 3EZ5A 4KE5A 3LDSA 4N56A 1TV6B 2HHUA 4ED2A 4XIUA 4M41A 1JLFA 3ULDA 3OHAA 2WK4A 1LWEA 1C1AA 3LAKA 1ZBLA 4O3RA 4EYIB 4CEQA 4M3YA 4J9OA 3DI6A 4RW6B 2RN2A 2IGIA 2XCPA 1CXUA 3PX0A 3AO5A 3DOKA 4YQWA 1KHVA 4LH5A 4MK7A 2BR0A 3NF9A 5EU7A 3KLEB 5KFIA 2W9BA 4ZP7A 4CJVA 2O4GA 2HWIA 1JLEA 1C6VA 1HJRA 2HNDB 3ITHB 3BQ2A 4JV2A 4BWMA 4B8CA 4OKJA 2DY4A 4PQUB 3CYMA 3BSAA 3MAQA 1EX4A 5K14A 3EYZA 3BSCA 1QTMA 4F4XA 3OL7A 4J9PA 1Z26A 3PW2A 3KJVA 4DQPA 1RT7B 2R2RA 4CJ5A 3KHHA 1Q9XA 3NGDA 1RNHA 2UVWA 1T05A 3HK2A 5KFBA 3C6UA 3ZSXA 4M95A 3OYAA 4KAZA 2BQ3A 1TKXA 3VQAA 1JLFB 2OPQA 4CK3A 3WNFA 1SKSA 4B9LA 5DG8A 3PR4A 2YHAA 4IQXA 3HPOA 1QSSA 2HW3A 1S6PA 4DTUA 1NK4A 4GC7A 4N47A 2YNHB 3QO9A 3RMBA 4FZZA 3DRSA 1UWBA 5FRMA 1D8YA 3V1OA 3PJWA 5KFTA 1JL1A 4HVJA 2GUIA 2YKNA 3AVNA 4CJUA 2FBXA 1NHUA 1FKOA 2UVVA 4QWDA 3I0RA 3PX4A 2HHVA 3DM2A 1L3UA 3AVKA 3GIJA 4FM2A 3HPGA 4GC6A 3ZSRA 1QQCA 2EC0A 2YNGB 2YNIA 3HVTB 3QEWA 5DK5A 1RT3B 2F8EX 3ASMA 1RT5B 4BDYA 3MEDB 1BQNA 4C8MA 4CHQA 1RA6A 2BDPA 4CJRA 4J9KA 2KFZA 4CJQA 3CJ5A 3AA4A 2HB5A 4JUZA 4ZTJA 4M3TA 1IKWA 4J9QA 4B9MA 3KLVA 4NYNA 3MR3A 5KFNA 3AVCA 5KFMA 1NK9A 4RNFA 3K58A 4NLRA 2W9BB 1KVCA 3L2QA 1JXLA 1I3AA 1A5XA 2O5DA 1FK9A 1VSDA 3M8SA 3HHKA 2IA6A 4E19A 3O3HA 1VSLA 1TAUA 1RDDA 5J2QA 3MEEB 1XR5A 3QZ8A 1TKDA 5KFDA 4J2DA 3JSMB 4DEZA 2IS3A 3KMSA 3PV8A 2WONA 5J2NB 3SQ4A 4OPKA 5KG1A 5HP1B 1X1PA 4Y34A 1WAJA 1QAJA 4PUOB 4DSKA 2A1SA 2OZSA 2IC3B 3WNGA 4FJKA 1BQNB 3T19A 4LH4A 3P5JA 3Q8SB 4DSLA 3GILA 4KFBA 3G6XA 4JS4A 4YFUA 1SH2A 1NK5A 3CM5A 4LD0A 1SH3A 3DLEA 5JS2A 3OL8A 3S9HA 1B9FA 2W9CA 4IFVB 4DL2A 1T03B 1TKTB 4KRFA 1S0OA 3BDPA 5F8NA 4ZMMA 3SQ2A 3H5UA 3SFGA 4W5NA 2I5JB 3DLGA 1YTAA 3V6DB 1CZBA 1K1SA 5CYMB 2G8HA 3RB0A 1Y97A 3ZT1A 4DG1B 3LWLA 4J9NA 3MXIA 2V9WA 1LAWA 3BQ1A 4FJIA 2HMIA 3BREA 1IO2A 3SUOA 5DQIA 4IRDA 3VQQA 1EP4B 2OPRB 4TY9A 1BISA 1B9DA 4H4MB 3V4IA 2QE5A 1QS4A 2BRKA 2B5JB 2R8GA 4RNMA 5KFHA 4B9VA 4CESA 2HHWA 4ZP6A 4IH7A 4FYDA 4CGIA 1XC9A 1RBTA 1S48A 2BQRA 1QHTA 3TAPA 4DU3A 1EETB 2IOCA 4KTQA 4KI4A 3NGYA 4KO0A 3SYZA 4CFAA 4DS4A 1W25A 4RW8A 3MEGB 5DLFA 4KREA 3OJSA 4Q8EA 3MECB 4ZVGA 3HVRA 3D28A 4MH8A 2X6NA 1ZBUA 4E1NA 3LP0A 4CF8A 4N41A 2AGPA 3MECA 3DOKB 3GV5B 1OS5A 4N5SA 1NJWA 4NCAA 4ZHRA 2D0CA 4BWJA 2XI2A 2LSNA 2R2UA 4Q0BB 4IH6A 4ICLA 4DLEA 3Q8QB 2IM0A 4CJTA 2HVHA 3P1GA 2Z1JA 4K8XA 3AO4A 4KHSA 4FJMA 3SCXA 3HPHA 3PW7A 1VSHA 1JLCA 1NKBA 2HAIA 1C0TA 5KFVA 2KFNA 1RTDA 2WRMA 4ZP9A 1JLGA 3IAYA 1SUQB 1RDRA 3H40A 4FLYA 2HMIB 4AHUA 3M8PA 3L3VA 1VRUA 2XCAA 3OYLA 2KZZA 3I8DA 5EWGA 1BIUA 1TQLA 3GIKA 4DTOA 2FBTA 3HP9A 4B08A 4TLRA 4IDKA 3HXMA 2EX3A 3OYNA 4DU1A 5C25B 1LWFA 4B3OA 1S6QB 4JV1A 3AA3A 1Z4UA 4IFVA 4KHUA 4IR9A 1QSLA 3DRPA 4AHVA 2WHOA 3MR5A 1IKYA 2B6AB 4FM1A 1GX5A 4L8RB 5E41A 4DFMA 5KGWA 5J2MB 1RTIA 4CJEA 5KFYA 5DGBA 1QSYA 4ED6A 4R8UA 3HO1A 2RKIA 1S5JA 3HT3A 2JC1A 3KIOA 1SV5A 2OPSA 3H2LA 4YNQA 3AVLA 4C8OA 1UA0A 5C42A 3M8QB 4WXOA 4KAIA 3NL0A 4E89A 3PX6A 1MU2B 3SUQA 3JSMA 4RNHA 2P5GA 2HHQA 3F9KA 2FJWA 4FLTA 2AGQA 3SV4A 4MK8A 4LSLA 3FDSA 1J53A 5SWMA 3S3MA 4M42A 4DFKA 4E7LA 4HUGA 1WLJA 4DQRA 1W0HA 4ECZA 3M9MB 4CEZA 3QLHA 2Y1IA 3AVIA 5HROA 2VG7B 4DL6A 4CF1A 5EWFA 4FXDA 1R0AB 1U09A 2RKIB 4EO6A 4EBEA 4FS1A 2DFHA 4C8KA 1IH7A 4M3UA 5KT6A 5JUMA 4URQU 2B43A 4I2QB 4R5PA 2B6AA 4FLXA 5KFSA 3KHGA 2D3ZA 4DTNA 2OPPB 2P5OA 1S1UB 3V9XA 4CJWA 3NF6A 5J1EB 3HVTA 4DSEA 1VSEA 2VG5B 3UPFA 4Q43A 5L9XA 4IRKA 1TVRA 4IKFA 1RT4A 2JC0A 1D1UA 3I0RB 3EPGA 5J2MA 1VSIA 4ELVA 2VG6A 4IOBA 4K4SA 2IM1A 5KFGA 5F8GA 1L5UA 1HPZA 3Q8PB 3OYBA 4XPCA 4CFDA 3DRRA 4YR3A 4GW6A 3T5KA 1KVAA 4WFYA 3D5MA 3QIPA 1N6QB 5C24B 3OYGA 3M8RA 3NHGA 2FBVA 4H8KA 3DOLA 1TK0A 4B3OB 3GV8B 2YNIB 3VQ5A 1C0TB 4HUFA 5KFRA 1LW0A 3DM2B 4Z0UA 3QYYA 3IGNA 2C2EA 1HYVA 2X6SA 3WNEA 3IG1B 4DTPA 4FJ9A 3ZSOA 4B9TA 2DFEA 1BCOA 1K6YA 2IBKA 1GX6A 2E9ZA 1KRPA 5KG0A 1FKPA 4G1QB 4HKQA 2W8KA 2JGUA 2YNHA 3QO9B 3H5XA 1QE1B 1JKHA 3D45A 2ILYA 1S1XA 4ELUA 3MR6A 1C0MA 4HHTA 4Q5VA 4EYHB 4NRUA 5HRNA 4DL4A 2PY5A 2YKMB 2XC9A 3TWHA 3HM9A 5DMRA 4KHYA 1TL3B 3V9ZA 1TAQA 3ZSVA 1T94A 1BL3A 4R0EA 2DFFA 5L1LA 4K4YA 3OYKA 2AJQA 2ASJA 3VQCA 4QCLA 1GOBA 1ASVA 3NGIA 3CFPA 5L1KA 4O4RA 4CEOA 2B5JA 3G0ZA 3TAEA 4O3NA 4ID1A 5L1JA 1VRTA 2D7SA 1HMVA 3CIZA 3T3FA 4NLQA 4RW9B 1D0EA 1XWLA 5KT7A 3QEPA 3TANA 5CZ1A 5EUHA 3MEGA 1QE1A 1KFSA 5K14B 3CJ0A 1G15A 4BE2A 4Q45A 3KLFA 1HQEA 4URGA 3K5MA 1XR6A 5HBMB 4OLAA 1C1CA 4KHRA 3OYMA 4DG1A 5FDLB 4DWIA 3DLBA 3IN5A 4G3IA 3O3GA 4JRPA 1TV6A 1LW0B 2C2DA 4B9SA 4NLSA 4O0IA 1LWCA 4KHMA 3UDLA 3OYHA 2R2SA 1TKTA 1TL1B 2EHGA 1T03A 3KNAA 1EP4A 3VQ9A 5HRSA 1S9EA 1D5AA 3S3OA 4KV8A 5I3UB 4ED1A 3FQKA 2P51A 2E6LA 4Q8FA 3I0SA 5CYMA 2F8SA 4DMNA 2OH2A 4AILC 2ZD1A 3C95A 3IS9B 1ZTWA 1HYZA 2QKKA 4EBCA 4Z4EA 1S49A 4PUOA 2HVIA 3KMQA 4CIFA 3OSNA 1KVBA 3TQ1A 1N6QA 2JLEA 3PY8A 3UQSA 5T14A 5KT3A 2R2TA 1HQUB 3KK3A 1RA7A 4LQ9A 4RW4A 2O4IA
chains in the Genus database with same CATH superfamily
4X4TA 2GMLA 4GMJB 1B3TA 3L7OA 1TUUA 4JI3K 2EPIA 4OJHA 1Q4RA 1VQ5S 4OGEA 1U6FA 4RNNA 2A42A 4Y2AA 2VJVA 2VG5A 1JCGA 3CI5A 5E3RA 3T1HK 2AJ1A 3UN3A 3CC4S 4Y00A 4U7UD 3MMAB 1RBVA 1XUPO 3KTQA 1Y4ZB 5FD1A 4TLQA 4IOAQ 4M3XA 1HNIA 1VQ4N 1J27A 1KLMB 1MU2A 3ZTPA 3IO1A 1IKVA 1ZYQA 3B6BA 3D2FA 4DV4K 2XNQA 3C3LA 3TAMB 4OV6A 3V81A 4CI6A 3ENQA 4EHUA 2FVRA 2VYPA 4FJXA 1HYSB 2FBYA 4IFYA 3B4MA 3VWSA 3W60A 1N8RT 1SQEA 2VQEF 1X5OA 4LSZB 5F8HA 3G82B 3RBDA 3WZ0A 1NJYA 4C11B 2HQCA 3W2VA 3HZGA 4JI3F 1HARA 2YJFA 2GEMA 2HFSA 2M88A 4OX9F 3EDQB 3ZTQA 2XG8A 3ZSWA 2BRLA 4FYXB 3V6KA 1S1TA 5CY4A 2F9DA 3QGGA 2B8PA 1LFWA 3NNAA 3W8GA 2G8WA 1PYTA 4JKGB 4NLVA 2OANA 2L9WA 1HNVA 2MLYA 4KH5A 2COLA 1B99A 5HRRA 3OR2B 2M3DA 4DQQA 3G6YA 2E4LA 2BH1A 1WEXA 5ETSA 2D0OA 2B9WA 3VETA 2PT0A 3W3DA 3HKZD 1YX2A 1QHAA 3CCRN 1LOUA 3IWXA 2G8KA 4ZHRB 4OHYA 2FVQA 3MFHA 1APSA 1K1QA 1DLOA 1TYQA 2XY5A 1Q9YA 4EP4A 5J1EA 3BJYA 4NASA 1SJ4P 1S57A 1K44A 2ZM6K 3M30B 1VR6A 3HVAA 1AUDA 1R8PA 1S10A 1SL2A 3EGWB 3TUIC 2BMBA 1ZA2B 4LF6K 4O3OA 2MJUA 1S0NA 3KLEA 1AA1B 3TTFA 2ZH3A 5KFKA 2CNKB 1HLUA 4CJPA 1NKEA 2W41A 2D0AA 1Q7YO 3CCJS 1IWAA 4E98A 3KJFB 3C0BA 1EHWA 3FSYA 4IOCL 2PIIA 1Q5YA 1R8CA 1NZAA 2DGQA 2HBRB 4A8FA 2VPYB 4AL7A 2DNLA 2XMJA 1C4CA 4FN5A 2YI1A 1GMVA 3WQTA 1IR0A 2P9KB 2KDOA 1HNZJ 1E4FT 4CJSA 1SL1A 3VQEA 3AA5X 1RI7A 1M1GA 3M32A 5TKWA 2R7XA 4NZ6A 1PC5A 4FF1A 1HNXF 4PXEA 2LLZA 4CLTA 2L08A 3V1RA 1BI4B 1BLUA 2E6MA 3NCPA 2QFJA 1XI1A 1VIOA 3T1YK 3GOIA 3KDNA 1ITPA 3THYA 4FWNA 1ICEB 1JLBB 4PWDA 1U2CA 3RAXA 1DT9A 2ASLA 3C94A 4MMOA 4CZGA 5I42A 3H5YA 5B0BA 4LF6F 3HSCA 4LSNB 1S9GB 3SCJE 3PR5B 4OVLA 1V6HA 4NXMJ 3LPUA 2AYBA 3K59A 3T1AA 4JI2K 3L3UA 2C2RA 3HSGA 1U2VA 2ZEJA 4BGBA 4ES3A 2JEIA 1QVFR 5LMNJ 3EEQA 5IQ6A 2GHVC 3UKUA 2DEJA 2CGLA 3EZUA 3KFWX 1RT2B 5T41A 3LP2A 2QSFA 2KM8C 2UUCJ 4V19X 2HK2A 2UV8A 2J7KA 3M2VB 3SMSA 3C6AA 2I7NA 1HBNB 4IBNA 1YGYA 4CGFA 4A59A 4DR2K 4UY85 3QLHB 3LANA 3G25A 4QIWD 3ENVA 4KB7A 3HVWA 1N32K 4ZVRB 3FEXB 5IM0A 3KLIB 3OA9A 3PW0A 2OP5A 4M45A 2NYIA 2A40A 3RRHA 1EQYA 3CD0A 1SXLA 3IWNC 2UU9K 6FDRA 1FHTA 2P9IB 2DGVA 2KYZA 3SAGA 1TFYA 2BVZA 3HJFA 2HQFA 3CJ4A 4MKAA 3R27A 1DFDA 4JKDA 2V7ZA 2B9EA 1BQMA 1HW9A 1TL1A 1MWQA 1XR7A 6FD1A 3DDKA 4ECUA 4TU8A 3CJAA 2FVCA 1R31A 3MAAA 3LWMA 1WG4A 1LAVA 5AQGA 3L0QA 3K17A 4DV4J 4EUVA 3LA0A 2KL8A 2BYCA 2DPJA 2CJBA 4CW7B 4GO5X 4HLBA 5M1QA 2UXBF 1AROP 1AB8A 1J5OB 1KKHA 1N5YA 4NLCA 1LW2A 1WC0A 3IR6B 4DV7K 4WE1B 4HHHA 4JI7K 3KK1A 4NXMF 4M5DB 4JI0J 2GC8A 2XNRA 3SUPA 4QS8A 3M2VA 1GK8A 4LFAK 1O5JA 1WOSA 2R8HA 3FFIA 3NAIA 5CXTA 3A8YA 1HKBA 2JEGA 3A0IX 2MSSA 1HX1A 1JKHB 1MDUB 3AA2A 1VYAA 2UVUA 1XC3A 4X4QA 3PTWA 3DXMA 4CO2A 2E1MC 4TU9A 3CWJA 2AP6A 4K42A 4BRFA 3IG1A 1JXBA 4A46A 2FSNA 1KTVA 2ZBCA 2IHR1 5KFJA 3MOJB 4NLYA 5L46A 2KU7A 1RXOB 5KFLA 5CYJA 4LF9K 3MTJA 1KQGB 2OD4A 1GTEA 3AOBA 3KXDA 5LSOA 2XMUA 4B1VA 5M1KA 2KXNB 1AW0A 4JI4K 3VAKA 3CCVN 2XY7A 3W62A 3NMAA 2IVYA 1HRHA 4I2PA 4MYTA 1RT3A 4YR2A 3MF5A 1AFJA 2FDNA 2Z1IA 4CH7A 1CVJA 2F4FA 2CUYA 2IIRA 3Q89A 3CCUN 3SPZA 4F50A 3IWLA 2V8VA 3T7ZA 2EBEA 2Q1NA 3MWTA 4IG3B 4OQJA 4QPXA 4B1UB 3P83D 1X5TA 3VV2B 3ZZZA 2ZC3A 4UQGA 4U7CA 3V81B 4UOGA 4QOZB 4AT1B 4K0KK 2NREA 4JAXA 3NP5A 3H4BA 3GYNA 1T02A 1I6JA 5FRNA 2PFFB 1NCLA 1N5TA 5AFUH 1HWUA 2GIRA 1KFDA 5CA5A 3AAWB 4GRSA 5MAOA 1R27B 5AE3A 4DTMA 1PJ7A 1FCAA 2ZVIA 5ITHA 2RRNA 3AJDA 3P39A 4YY3K 2YKMA 1KP6A 1WB9A 2NR0A 5FROA 2BJ7A 5KFCA 3BGRA 3W63A 3GIRA 4ZPCA 2PYJA 4JYAJ 2JNJA 3ETMA 1NSQA 4YP3A 3TUPA 3PM9A 3K9KA 2CWXA 1TK5A 4RW7B 2DO0A 1R59O 2VODA 3BEGB 3VQ4A 1DBDA 1DKGD 3RTVA 4LF4F 3QATA 4YOXA 1B4SA 2GQCA 4O3PA 1B0PA 2Q31A 3VEVA 2EI5A 2NUUG 3I8BA 2HLTA 2QTWA 4PAAA 3MMBB 1J54A 3OLBA 1SB6A 4FJGA 4H4OB 1NGFA 2CPIA 5CAAA 2BW7A 3WNHA 4FM0A 1X4GA 4K4WA 5F8MA 3PW4A 1JIHA 2WZ1A 1IG8A 2UP1A 4AL6A 3DLGB 2V4QA 4ECYA 1BE4A 2DNMA 3OQ2A 2LQBA 1ATSA 1SJRA 3AVHA 4I6MA 4NLOA 1VQPN 3T5JA 3NFAA 4IO1A 3UD3P 2PMZD 3LF0A 1Q81T 1HR0F 1X0FA 1N52B 4U95A 4KQZA 2PC6A 2CJXB 3QZ7A 3K2PA 4DKWA 2FHMA 2FLPA 4OLOA 1JJCB 1J6ZA 4FWSA 2ZOFA 2IC3A 4QR1A 5KOXA 4ZPAA 1H98A 2KFYA 4K5RA 3HL8A 2ZH9A 5KG4A 4FF2A 3QPIA 3H46O 4UUWA 1RT1B 2GAHC 4PQUA 1CBKA 3K0SA 2V50A 4BC2A 2OIHA 2CJKA 4JI6F 3ZSZA 4JHDA 1VK3A 1JLAB 2W2PP 2P1JA 3PYGA 2E66A 3QRRA 4NOHA 4Z4FA 2GO9A 3JYTA 1RT2A 4BDPA 2ASOA 1EZZB 4X4UA 3H59A 4DN0A 5K8PA 1NMEB 5DLGA 3RBXA 5F9LA 5GAEI 4R25A 2W9AA 4NWBA 2LDIA 2CQBA 2R7YA 1WN7A 4E8UA 4CGHA 4ED7A 3D1QA 1MWKA 3L8BA 4J5OA 2HNZA 3K0JA 4KTZA 4ECVA 5K20B 2ZGZA 1V9OA 1RJJA 2VA2A 3LDLA 4A61A 3L9ZA 2F7VA 1SJFA 4ZJOA 4F4YA 2HWTA 2W9CB 1YRTA 1F9HA 2AQ4A 2ZZTA 2MQQA 4U8YA 3NH2A 4USJC 2FZGB 1UKUA 4E7KA 3ZT3A 1M5SA 2FJBB 2E1ZA 1GLLO 3H0PA 1HWLA 2EK6A 3C16A 4DV6F 1D9DA 3QQCD 5I3QA 4H03B 2U1AA 1T9YA 1RHMB 3MM6A 1XNQF 2BQUA 3CJ2A 1YWXA 4N8NA 4JYAK 2WONB 4UOCA 1GXUA 3NWRA 1VQLS 3NS6A 2P9PA 4WXWA 1C2PA 1JB0C 3MN5A 4Z4IA 4EU0A 1F2HA 1F1BB 2C3PA 4QU6A 4DR4K 3HBTA 2ASYA 1EKRA 1S9EB 5KT5A 2RQCA 2ATQA 5KFAA 5LXYA 3PW5A 1CJKA 3D0PA 5LXRA 2VOOA 2L48A 4CJKA 1K0TA 4BR7A 4CFCA 5HLFA 3MN7A 4C23A 4I7FA 1JLAA 2EFPA 5SZTA 4UZBA 1RADB 5E5NA 3CDEA 3OUYB 2CNOB 2FC9A 2JJ4D 3VA3A 2ACMA 3QT6A 1J5OA 1NUEA 3AVAA 1DLOB 3CJCA 2KTQA 1WSGA 2QGFB 5JMVA 4JI5F 3BF3A 4CGJA 3PKYA 4OJRA 3NAHA 2GWJA 1BMQB 3RAMA 2MQMA 2QZ8A 1K8AO 4FOEA 2ETJA 3SPYA 4M5JA 4TYAA 1WSEA 3HHLC 3WDOA 4CYUB 2J0WA 3U4LA 2WOMB 3OS2A 3MD1A 1U6ZA 1Y3JA 5EVZA 1FD2A 4DV3J 3IKMA 5AZJB 4U7UK 4ZLNA 5DGAA 1VQSA 2YWKA 3DCAA 4M63A 3I9ZA 1RTDB 3SMZA 3OR2A 4Z37A 3OYDA 2LDYA 2CQDA 1FXDA 1Q16B 3OL9A 2UUTA 4DU4A 4CWBA 1IKXA 5C2GA 1VBKA 3C16B 3HSZA 4X66K 2W6LA 1CZ9A 2V9KA 2BJEA 3QNNA 2FHKA 1T95A 4E1MA 4C8NA 3IAS9 1S0MA 4LRCA 3NDKA 4FXVA 2WCXA 4JLHA 4NO7A 2P9IA 3PIPL 4MKVA 3CIPA 3DXSX 4CGDA 1OVYA 3KJQB 2YWFA 5CABA 1WD6A 3KWIA 2HNZB 2F9JA 1C0UB 2C3OA 3BZQA 4RU9A 1VHIA 5HLFB 1GT8A 4C48A 4NLGA 2G4BA 1T3OA 2QWLA 2G1DA 1OYDA 4KRWA 1VQMN 4DFPA 5IQQA 4GV9A 3UD4P 4YOTA 1N0UA 3C6HA 3ZT4A 4Z4CA 3A3NB 1BG3A 4OGCA 3QRPA 1MMLA 5FIIA 2XO7A 3WXJA 4LSLB 2DYAA 3PJXA 3QESA 3MM9A 5GAGU 4CZKA 4DQ8A 4OYOA 4IJAA 2LEPA 3M9OB 1I94F 1RYRA 3K2YA 3L2RA 1BC6A 1Y11A 4B8AB 1NB2A 4DR5J 1CZAN 2XWXA 3NGZA 1X7VA 1E6YA 4DXLA 2MKYA 3JAMY 1HKGA 4MIWA 2YWHA 3POTB 4DTXA 4IDKB 3EE9A 1OPZA 5C5JA 1LXNA 3AVJA 2IAJB 3CD7A 3U7JA 2A1RA 4FNHA 2XHBA 5LMUK 3HTVA 1VCTA 1FNOA 3CCWA 3VQBA 5KQ8A 4QBUA 3D6HB 3BSNA 2G8FA 4H4KA 1DTQA 3CJKA 3KK7A 5ETNA 2KI2A 4YHHJ 4O0JA 1LWCB 1Y9OA 4USVA 2ZJQQ 2DNYA 2QL7B 1UVLA 3ENWA 4N56A 3LDSA 3FZLA 5H1SQ 3R5AA 3VPZA 4F0KA 4AQYK 1D9AA 4NA1A 3OFEA 4WFAL 2V2VA 3LAKA 4O3RA 4PG5A 1PSDA 1T6CA 2EC2A 4RW6B 3O4WA 3J81U 2R3VA 1CXUA 3NCRA 3DOKA 4YQWA 4H5RA 2HBLA 4LH5A 4MK7A 4YEAA 1T11A 4A8SA 5KFIA 1Q8BA 5A2QO 2MQLA 4X65J 2HWIA 1FRJA 2IVOA 5FPMA 1VMBA 1UVKA 4B8CA 1Q86O 1RAGB 2F4VK 4F4AA 5F1XA 4AD6A 4PQUB 2HFUA 2LCWA 2QMUB 1NLKL 3BSCA 1P6TA 1QTMA 4F4XA 3NVMA 5CZVA 1NM2A 4FYYB 3KJVA 1Q82T 2Z58B 2I7PA 2R2RA 1OSDA 1WEYA 2O67A 2MJNA 3A13A 3WQPA 1T05A 4CT9A 2WBNA 3C6UA 4A8WA 1YZ6A 1PO6A 1GLFO 2OPQA 1HNXK 1FF2A 1SKSA 3WNFA 4B9LA 2C2KB 4JI0F 2J0SD 5DG8A 2E5LJ 2YHAA 3IP0A 1WDTA 3HPOA 1QSSA 3N4WA 3UO0A 3HULA 2CQGA 4GC7A 2J4RA 3QO9A 4JKGA 1OYEA 2BM0A 3DRSA 1I3OB 1UWBA 2ZNYA 3G8SA 2A10A 2AYGA 3ZXWA 1FKOA 2UVVA 5HI7A 2DGTA 4QWDA 3PX4A 2HHVA 2IY5B 3DM2A 1JNRB 2BM1A 3HPGA 2FHOB 2A6MA 1EQ0A 3HVTB 2VGMA 3M8ZA 5D0HA 2B9YA 3CJKB 1RT3B 5I3PA 3OXLA 3ZTRA 3Q0AA 3MHYA 3GPAA 4FF3A 2ZVSA 4HTLA 1AXQA 2EKNA 1Q18A 4CHQA 2E2PA 2NPFA 3UD5A 3R7SB 4F3MA 1NPKA 2ZM6J 4CJRA 1RCOB 2EFQA 3LPYA 4J9KA 3UVJA 1AYEA 1H2TZ 3QJJA 3AA4A 4QIFA 2V8GA 1FVQA 3AVCA 1VQMS 3CCJN 4OI2A 4RNFA 3CD6N 3K58A 2G0IA 1JCFA 3R5BA 2HZAA 3L2QA 3FZFA 2O8CB 2IJRA 1VSDA 3HHKA 4E19A 3KG0A 4BR4A 1TAUA 2VWBA 2R9LA 5D77A 3CETA 4C1NK 4ZPWR 4CZLA 3JSMB 1BQXA 4DEZA 3ZZOA 2DCUB 2Q43A 3PYFA 3PV8A 4WYBA 4USTA 2WONA 4OI0A 1YIJS 3ZYYX 1X1PA 3CJSA 1V3ZA 2KKHA 1WAJA 4PUOB 2VFTA 2CVEA 4QR0A 2DGSA 1H74A 7FDRA 1BQNB 8RUCA 4IWVA 5F3TA 3P5JA 1QM9A 3Q8SB 3NVKA 3GILA 4PYAA 1NK5A 4LD0A 2EFNA 2DGOA 4BRMA 2HGNA 5JS2A 1T9VA 4JI0K 4IFVB 3PYDA 2CWKA 4JKCA 2ROEA 3RYLA 1K9MT 2IRYA 4CNYA 4S0MA 1P1TA 3BGLA 2VONA 4FL9A 2IMOA 3DLGA 4K43A 4DR6K 5BYQA 2LXUA 2C42A 1K1SA 1Y97A 3MM9B 1I51B 4DG1B 5C12A 3AA8A 1LAWA 2HMIA 1IO2A 3SUOA 3VQQA 1DJ0A 1EP4B 4GVLA 4PG4A 1NNEA 1H3DA 2QE5A 2BRKA 1GXLA 5FPDA 2R8GA 2NNWA 3M8WA 3ONQA 2YXLA 4CESA 2HHWA 5LSRA 4IH7A 1VIXA 3RGIA 3FBBA 3OUYA 1X0PA 2ZBQA 1WJ9A 3TAPA 4DU3A 3TZZA 3A5LC 3NGYA 2B4VA 3J7AP 3HI9A 3SYZA 4DS4A 3MEGB 3BP8A 4PL8A 4KREA 3CPWR 3ZEUA 3MECB 2B4OA 4ZVGA 1S6OA 2J8AA 4P74A 3C19A 4CF8A 4WF9Q 2HS4A 4PG7A 3TR5A 4NA2A 1DRZA 3CF5Q 1NJWA 4ZHRA 4BWJA 2FXUA 3ZFVA 4ICLA 1R89A 3VGLA 1T9WA 2KT3A 2CQ1A 1HNZF 4K8XA 2FJEB 3AO4A 4FJMA 4X4NA 4HEA9 4JKEA 1QY7A 3PW7A 1JLCA 2QSWA 4L74A 2C1EB 1RTDA 3GE1A 5J1NA 1U2VB 5B8HA 4K25A 3J80Y 2HSTA 4A8YA 2VUGA 3WXIA 2RAQA 1U02A 4IDKA 1WUUA 3J7AN 1SJQA 4OYIA 1TU0B 2KH9A 1Z4UA 4IFVA 2HGMA 2B0GA 4IR9A 4AHVA 2E1YA 2VCPA 2H5IB 1PC4A 2B6AB 4OV1A 1GX5A 2W01A 3G87A 3FCHA 4CJEA 4LVNP 2U2FA 3P5TL 3HO1A 3MMVA 3BGFA 4CDIA 3OVAA 4FWKA 2OPSA 2B56A 3AH6A 2O8FA 2L3MA 5BR8F 2NXEA 4WXOA 3TX8A 5M1NA 1WI6A 3IM9A 5BRHA 1M5OC 2D9OA 3FUYA 3I55N 4RNHA 3DAWA 3F9KA 3IUCA 1UTAA 3SV4A 4FLTA 1SIWB 4MK8A 5IT9O 3E1YA 4LSLA 1J53A 1IBLK 4CO4A 5JVHL 3S3MA 4HUGA 4AXJA 1WLJA 3ENBA 3HMJG 1VQ9S 1RU1A 1Q8KA 3DWLA 3K9JA 3LL3A 3G4SS 4LIWA 2C2OB 1HBUA 5BRFA 1JJ4A 4YB7A 1R0AB 3GP9A 1M90T 3KWMA 5BPLA 2DFHA 3ILJA 3GCXP 4C4WA 3OW2M 4M3UA 5KT6A 4DMZA 2J0XA 3GFHA 5BJRA 1CS4B 2FC8A 1Z1ZA 3KHGA 1YTYA 1YIJN 3CD5A 2RSQA 4P2FA 3CHWA 3P8BB 3NF6A 2IPOB 2E44A 2DKOB 1VSEA 4P7TA 5RUBA 2DNQA 7FD1A 1SCJB 2RJZA 1ZXOA 2JC0A 1D1UA 1XBWA 5GAHU 4NZ7A 4IOBA 1CLFA 1L5UA 3Q8PB 3OYBA 4XPCA 4CFDA 1F5AA 3GCWP 4P52A 4WFYA 3KG4A 2HRTA 2V5HG 1Q7YT 3D5MA 3QIPA 1N6QB 2HFVA 1UJ6A 1S12A 4H8KA 1TK0A 4B3OB 3S41A 2H48B 5K5MA 1WORA 3CCTA 3DM2B 4X65K 4KJIA 3IGNA 3DRYA 1ZA1B 4BBYA 2XZDB 3WNEA 2UXBJ 4YOVA 3BV8A 4BREA 3BBCA 1KRPA 5AZJA 2W8KA 3EGZA 3VZIA 4C8ZA 1QE1B 4HVZA 1JKHA 3D45A 3MR6A 4DR1K 1RBLA 4C0BA 4Q5VA 3BPDA 4NRUA 1NPRA 2V52B 1BU6O 3PG9A 2CPEA 4FYVB 1PBAA 3W9IA 1UVNA 1BL3A 4R0EA 3IMQJ 4K4YA 5ADXA 5LJWA 2ASJA 2CNLB 1QUPA 2CPHA 3UW1A 4IXCA 2N4DA 5GAHP 2B5JA 1Q79A 2MZJA 4CLSA 3G0ZA 5CCMA 5L1JA 4ETZA 4USIA 5IFMA 2D7SA 4RW9B 1D0EA 2VKRA 5KT7A 1QE1A 2AF6A 4Q45A 2A41A 1XR6A 3HDSA 4ERDA 3B4DA 4DG1A 1TMMA 4UUXA 2HBMA 4PXBA 3R9PA 4JRPA 2WVEA 1HKCA 1LW0B 1ZM2A 4QS7A 2AIRB 4P72A 3UDLA 4XH1A 3RW6A 1RAEB 3VQ9A 2VFVA 1GMUA 3O9TA 5C10A 4KV8A 3VGSA 1RP5A 4DR1F 4I0WA 4DMNA 2KJWA 4QIVA 4E1JA 3IS9B 4QPTA 4EBCA 1U26A 4PUOA 4DOZA 3OSNA 4C11A 3TQ1A 4K7QA 4DR4F 3G8QA 1N6QA 4P71A 3LTOA 1RHJB 3FBEA 4RW4A 2MGZB 2O4IA 3PIOL 4I2QA 5KFWA 2OEJA 1IBLJ 3V9SA 1C1BA 2QV6A 4OZ0A 1ZH5A 4CLPA 4CM2A 4E7JA 5MLCV 1N56A 2FGOA 1PYOB 4QS9A 1ZS6A 4O4GB 5KG6A 4XH4A 2XSFA 3BN4A 1KLNA 1WNSA 1GXTA 1N34J 2R7RA 4EO8A 4KYZA 3VZHA 3MUMP 4DQIA 3IAM9 2E5JA 4ATNA 5HQMA 3W0LA 3ZNJ1 3J80U 4JI5K 2P9LA 3HSJA 4ECXA 4ILHA 1FNXH 1YITN 4DCJB 2E7VA 2QA4N 1HQ2A 3VAMA 2FLNA 4YUDA 3OBWA 4IG3A 1WSIA 5T7LA 4DPYA 2J9DA 4I69A 1IKWB 3CDUA 2M5YA 4DV4F 1WI8A 3RMCA 1RWOB 3FRZA 1SH0A 2QWOA 3R5GA 1YJWN 3KLGB 1ZAXA 2E9RX 1CC8A 1Q5VA 1VQ7S 3NXZA 4CHZA 3FGUA 3PSFA 3UCZP 4UOHA 4KBIA 3CT9A 3Q2SC 4LF5K 1BI4A 5AE1A 1IKYB 1GLCG 3OVSA 1YJUA 2BW2A 1TL5A 4MO5A 4D3HA 1OY9A 3PHEA 1U8WA 2VDIA 4A8XA 5ADZA 3W8PA 5FLXO 2CNNB 1VQKS 4CYUA 4WIIA 4DR7K 2I38A 2E5LF 4FJJA 2F9TA 1X4CA 3R6GB 4FW1A 4BE0A 3NMUA 1M5KC 2BJ3A 1QQMA 1XHXA 3BDEA 1UVIA 1YSJA 4IDHA 1P9YA 4PPDA 1REVB 1WBDA 1PJ5A 2RF2A 1RE1B 2EFOA 4DR4J 5KT4A 2JL9A 2UUAJ 3AO1A 4DUYJ 3EVOA 1CQNA 4DR3K 3R1HA 2ASPA 3NNHA 3IFRA 2V94A 1K73O 2MZRA 4MO4A 3UB5A 3MFIA 2ZH8A 3SAFA 2HAFA 3CMQA 3QEIA 2QXFA 5AZIB 3DLKA 4EZ6A 3C2PA 4B3RJ 2YV0X 4CJFA 5E33A 4J9SA 3EGNA 3VERA 2RHKA 2Z2ZA 1T05B 1KQSR 2K3KA 3QB0A 1KOHA 3TVKA 2RNEA 4M3WA 3IRXB 4FLZA 4LF8F 3D67A 4RUHA 4E7IA 1RWUA 4BC9A 1RDWX 4ENOA 2DVIA 1NJIT 1HPMA 2CPFA 3ENAA 4RNOA 5K8MA 1SJ1A 1YVFA 2RF2B 4UY8O 3ULHA 3OSPA 4WKRA 3D4JA 3AV9A 1P8GA 4FVUA 3LW5C 3MDQA 2MZSA 2ZM6F 4WYWA 2VA3A 3HX9A 3SQGA 1RTJB 3H2UB 3SV3A 4K5SA 1MNEA 4CIGA 4U67L 4EAHD 4ZVQB 2IDEA 2HNDA 3C14B 2RU9A 2E5LK 1WNEA 4ID5A 5D0RA 5H9FK 1UOCA 2QWPA 1KBRA 4DUZF 4DV6J 4FZYA 4DQSA 1RQ0A 1S7IA 1BWEA 3QINA 1LCUA 2PZSA 5HK4A 4JI1K 4KH6A 2XTJP 3J7ZO 2YNFA 1NGIA 2W7PA 5E3QA 3RRGA 3GR1A 4LFCK 2L9NA 4NLDA 8ATCB 2BE7D 4K2XA 2D0BA 3CCLN 3A2FA 4QWCA 5CD4A 1U1QA 1TFWA 4CBXA 4WFBQ 4DTRA 4CJ4A 4O44A 3AHPA 3IR7B 3MM5B 2XLIA 2MY8A 5LSLA 4ID5B 5GMKa 1QZ5A 2IBOA 3CSKA 4ZVOB 1ROFA 1BOTO 4WTOB 4F36A 2HIYA 4WBFA 1KAXA 4MFBA 4BR2A 3FQLA 3G71S 3WBZA 2RILA 2CZVC 1KAZA 4G65A 4M8LA 1IKVB 5KRSA 3CERA 3H1VX 5ETRA 3R7BB 1HBNA 1YITS 4OZ2A 4ZOSA 3CCRS 3THXB 1YAGA 4DTSA 1UFKA 1SL0A 4D3GA 2UUAF 4CO5A 1Q0NA 4AFFA 4DUZK 3DLKB 5IT0A 3C8YA 3E01B 3KLFB 2OGUA 3B78A 4JI5J 5DM6L 4F26A 3HFKA 2EBGA 4ZVHA 1M5HA 4BRAA 1JX4A 2RDJA 5ETPA 5I4MA 1UEVA 1UPMB 1IBCB 5GINA 2Z0GA 1N34K 4RW8B 3AARA 4Y0WA 1RWWB 1YLXA 4JBCA 1VK0A 1WDDA 1BGXT 4QIEA 3HD1A 2BZ2A 5DG9A 1V5IB 1UFWA 1HR0J 4FOIA 3CCUS 4TN2A 4CLWA 4LF8K 4NLUA 2P8IA 1RBUA 4OJ3A 3E9LA 1NNDA 3OS1A 3P5BP 1REVA 1YJ9N 1JJ2M 1E6VA 1O51A 4JKFA 4Z7YA 2YQ1A 2YKPA 1HFEL 2Q3SA 3CJQA 2RMLA 4N8OA 3N6NA 3ID6A 1VQKN 5CCLA 4JI6J 1NGJA 1Y00A 3OS0A 5KPZA 3DU6A 3MWBA 3MWPA 3VF0B 4KT0C 1EIYB 1X9MA 1WAFA 2RQMA 1U45A 2O66A 1G6BA 2DRDA 4Q0BA 2NLWA 2CQ4A 4W4MA 3AGRA 1OO0B 1NJZA 4JI8K 5ETLA 1U4BA 2XO6A 5B0GA 1BWVA 2HK3A 4WWSA 4DS5A 1QAYA 2ZJRQ 3NBPA 4FJ7A 1HW8A 1RUSA 3L4QA 1WTFA 4BRDA 4E2FB 2A1BA 5F0WA 1FXLA 1WHXA 4Z7CA 1DQAA 3NOCA 1N33F 3QWUA 1W9HA 4RO0A 3SJJA 2A18A 1T9TA 2BKNA 1F6TA 1BA0A 4WF9L 2AX1A 4NCBA 4YB6A 1HBMA 1HWJA 5KFXA 3CDAA 4FXWA 3CMAS 2H1YA 1MG7A 2B3TB 4J8FA 2KJVA 4AHTA 2JWLA 1FX4A 3N9UC 3SBMA 2J6UA 1PGZA 4BC4A 2P9UA 3NF7A 1ZBSA 2I9SA 3DI6B 2HZVA 3CCLS 1HNZK 1U49A 4DZDA 3BKFA 2Q97A 1NU0A 4HDGA 1Z25A 1L3VA 2Q2RA 4RW4B 3THPA 2RUSA 3QNOA 2M8DB 4BG8A 4OYZA 4U67Q 5KI6A 4OJ1A 3OYEA 4FK4A 3DLRA 3K5LA 5FLXY 5KFZA 2N4CA 4AQYJ 3AVFA 4CF2A 2Z8QA 1L3KA 3C15A 4QAGA 3O3FA 1SAZA 3QETA 4OKEA 1AZSA 1H72C 1U25A 1RHUB 1X4BA 3I5AA 5DDOC 3TP2A 3CCES 1VQOS 1YVNA 3RRKA 2LXFA 2EFGA 3O3LA 4F8RA 2P9KA 3WIVA 1UWAA 3VGVA 2WTFA 4NXNK 3G10A 2F96A 3I96A 4NYZA 3MUVP 3R5CA 5C15A 2FZKB 1RLCL 2UYTA 4HCCA 1VQPS 5KFFA 2J6TA 5JS1A 2OPQB 3I4HX 2EW9A 3I4PA 1SKRA 2UV8G 3O5BA 2ZC4A 1P9QC 1RT1A 3V5RA 3AB4B 2E9TA 2CQIA 4DV5K 3JYTB 1QTNB 2NZTA 3ZNUA 3TVYA 4K2JA 2FJAB 5DZ7A 3CW2C 4EFHA 1VJQA 1NSPA 2W40A 3C7NB 5BPNA 1RILA 3QGHA 2ZE2B 5A2QU 2OYQA 2MGZA 4GKKJ 2LQJA 1ATNA 1XJWB 2DCLA 4FSVA 3D6MB 4ZCMA 2IYGA 2BOAA 4J37A 4BRPA 5B0EA 2W4PA 4M1KA 1XNQK 2CQ0A 8AT1B 2NRRA 1FXXA 4F2RA 4OHVA 2BOPA 2DB1A 2XSJA 5IC6B 2Z56B 1DQ9A 1N32J 4H4MA 4FJLA 4P10A 5AE2A 1RBSA 1BQMB 1YI2N 5EOYA 4CRJA 1UETA 1N4LA 3GONA 2FC0A 1TUGB 2XMKA 2DNGA 4BCAA 3MPYA 1S1TB 4C3MA 2HHSA 3H08A 4BY9C 4AH9A 2WUSA 1MWMA 2HHXA 3LDPA 1JXEA 2CADA 3DOLB 3KLHA 4O55A 2UZAA 4W5QA 4NCGA 2RUGA 3BEXA 1NGDA 3CEDA 5T7LB 5D3GA 3Q22A 1CXQA 2FF3B 5AQTA 4DR1J 3KLGA 2WOMA 1R0AA 1KVKA 3NMRA 1VRTB 2AZ1A 4KHPF 4B1WB 1EWQA 2M7SA 4ZPTR 2UXDF 1FRLA 3FGVA 2I1RA 2N3LA 1UZDA 3ZSYA 3NCQA 3BH7B 1V4SA 2XWYA 2PFUA 5LJ3Y 3JAMU 3O2IA 4LQ3A 3TAQA 4U6PA 5KOWA 2H9ZA 3SLCA 2EWSA 3A3OB 9RUBA 1HHTP 4RTFD 4CEDA 4DV0J 4DR6F 2BJ8A 1D9FA 1F3FA 2E29A 2E20A 3DDNA 4FW2A 2HGLA 5GVQA 3DYAB 3NG8A 2UU9F 1WG5A 3A8JA 4CH0S 3MCMA 5ETVA 5E7OB 3F9MA 4FWQA 2DITA 2H54B 1WELA 3ITHA 1UL3A 3I5BA 3LZIA 1UVJA 1UZHA 4XPEA 2R42A 3IM8A 4JKHA 5KAKA 2J76E 2YY3A 3GV7B 3V1QA 4GO7X 3AVBA 5KRTA 3M6GA 4GKKF 3CMES 3OLAA 2BE2A 2YNFB 4PA1A 3VQDA 1NLVA 1FJGJ 1LV5A 2B7BB 3OYCA 2CQCA 3AXMA 2P9PB 4X65F 4CBWA 5JMNA 3L2VA 2XULA 3DMJB 4IFEA 1TL4A 3TARA 1RAFB 2X78A 2VDHA 5M2UA 2UUBK 1Z2LA 5EDWA 4Z94A 4LMZA 5CR4A 1LKZA 4CM0A 2X3GA 4BQZA 3BBFA 5B0AA 2CZ4A 4ZJQA 2HHHJ 1QVGR 4YHHK 1C1CB 3IRWP 3RVCA 3ILOA 1VQ6S 5G4DA 1WEZA 4IR1A 4Z4HA 3K5NA 1JLCB 3JTOA 2W4CA 2Y1RI 3D0HE 1PYSB 5AQVA 3UKRA 5IV4A 2GBZA 3TPQA 2ZH2A 4IG0A 1DY3A 3BYRA 1TKXB 3I9V9 4EBDA 2O8BA 4TQSA 4CGGA 2QC3A 4DX7A 2AJ4A 2VBXA 2UXDJ 2RVJA 1N5YB 3NBPB 2WW8A 3U3GA 3LP0B 3VQ8A 1WOPA 1S4FA 3SQ1A 1B92A 2HSEB 3FSIA 3A8EA 1CULA 2XYPB 1VJWA 1KTQA 2DR7A 3H45C 1C0UA 2PA8D 5KG7A 4BDZA 1NSKL 3BBBA 3NAEA 3MK6A 1FA0A 3L7PA 2C3MA 3RW7A 2ZJQL 3UKRB 4KKOA 5G0RB 3JAMO 4ZVPB 4J9RA 2D5RA 1TKZB 4GV3A 1Y7PA 1URNA 4JV0A 1S1XB 3TZXA 2OPRA 2YX1A 3A8KA 3QIPB 3SI6A 3LO3A 4B3SK 3K5PA 4QYRA 3CG7A 4WP3A 4ZVFA 2CJYB 1KR4A 1YJNN 1N48A 1VC6A 1FWLA 4WZMA 2GVZA 2P9EA 5IOLA 5A8KB 3K8WA 2GX8A 2XMWA 3L2WA 2GQQA 2NUBA 3VGKA 5BR8K 4TY8B 4KKOB 3CQ8A 2W2OP 1U1NA 4G1IA 2DBBA 3CJ1A 4DCPB 3AJ1A 3S7RA 4KC5A 1Y5IB 2QXLA 4DDFA 2F5GA 2FJVA 2LFVA 2HHTA 4FLUA 1GOAA 2Z57B 3MDFA 1RDBA 3OYFA 3LDOA 1TKZA 1S1WB 1FW6A 3NRBA 4X4OA 5A2QY 1VISA 2J7WA 2FD2A 3WEEB 3HFVA 2BGGA 3AAQA 4LF5J 2ZUAA 2P9SA 1U04A 1U24A 4KBOA 5GAGP 2WB4A 1H2UX 2KXFA 3L7UA 5K8OA 3US5A 3AY0A 2VBZA 4K4VA 2V8HA 3M1FA 3TUZC 1SVDA 1CJKB 2F65A 3OJUA 1RT6A 4XO0A 2C22A 2IDLA 3MXJA 2QMWA 2R8KA 4BS2A 2ZZMA 3PRDA 3O8MA 4I9QA 4HR2A 1NGGA 4BACA 2OSRA 4WK3A 2QRRA 5DZ6A 1VOMA 4JI4J 4Q2MA 2ZHAA 3WEEA 5C42B 4NMXA 4FJ5A 2MZQA 4JKAA 3MX5A 2GA7A 2C28A 1K8AT 3CDWA 4HTIA 4XAKA 5KFOA 2CQPA 3ZSQA 2EKYA 4OX6A 2H51B 5J2PA 4RUAA 4ECTA 3H4DA 3L3CA 2RQKA 4LFBJ 4TSXA 2OMOA 4X4VA 3MX2A 4EZ9A 4M5KA 2NRHA 4IEIA 4KV8B 1JL2A 2WC9A 5I9EB 1P27B 2ZJPQ 1G4CA 2AU0A 3M2UA 3CJRA 4FZXC 3UIQA 4PWDB 4C98A 2GVZB 2D1CA 3OV7A 5JLHA 2QEXN 3VGMA 2HHUA 4XIUA 3GFXA 4M41A 1JLFA 2VFUA 2D3OR 3TUJC 3LUYA 3QGPA 2LQ8A 2WK4A 1ZBLA 4IOAL 4HI1A 2MLZA 4GVBA 2FSKA 1NGAA 2ADCA 3CC7S 3DI6A 5AQIA 2QN6B 4Y0FA 2V2QA 3MMBA 2XCPA 1KHVA 3SJHA 5EU7A 3KLEB 4NMLA 2IVPA 2XS7A 2O4GA 5KQDA 1FJGK 5IT9U 2HNDB 3S1TA 4AM7A 3BQ2A 5JVGQ 3MN6A 1XIQA 2F40A 4OKJA 4PG8A 1RHQB 2DY4A 2ZGYA 3CYMA 1RAIB 5K14A 2ZKTA 5JJBA 1Z26A 4IZ9A 5HANA 1UEKA 4CJ5A 3V2UC 4W90B 3NGDA 3FEYB 2YWGA 2P9NA 1ZM9A 2J8SA 5EX0A 5HO4A 2E1AA 3PCOB 4AM6A 2QFIA 4BC5A 3ZSXA 2GELA 4NYPA 1TKXA 4PWWA 4C97A 3EUNA 1UW4A 3CC4N 3TSQA 1ELOA 4ZIVA 5CH7B 2DTJA 1N33J 4DTUA 3MXHP 1RWPB 1NK4A 2IIHA 4N47A 4LFCF 1WC5A 2W24A 4FZZA 2VQFJ 2QIFA 1R43A 5FRMA 3WXMB 2GVDB 5KFTA 4HVJA 2NXNA 2YKNA 4CJUA 4H0VB 3DN9A 1XMQK 2KVIA 3NY0A 2GZOA 3UCGA 4GNIA 5IWAK 3L09A 4MKYA 1WOOA 3O1LA 4IEEA 3SBGA 3POTA 2MY7A 3W2VB 1XMQJ 4FM2A 4FZVA 4DV1F 3M2UB 4AF1A 3N01A 1YK9A 5EX3A 1FFSB 1EWRA 2H65B 2ZWPA 2OEMA 2F8EX 4AUKA 3MPDA 2DHXA 1BUPA 1GLAG 4BDYA 3MEDB 2DNOA 2CGJA 2XSJB 4R79A 3N4QA 3MPVA 3O9SA 2BDPA 2ADBA 4BRHA 3OVBA 1W2BR 4OYMA 4Z2XA 1UMJA 1X4EA 2K3IA 4C3KA 3F44A 3M5RA 4CJQA 2HB5A 1YJNS 4ZTJA 3D0GE 4M3TA 1IKWA 4J9QA 4NYNA 2RS8A 3MR3A 4HL9A 1MSWD 4FP9A 4NLRA 3VEXA 2IVFB 4UY8T 1KVCA 2PDAA 2GS8A 4K0KF 1A5XA 2O5DA 1FK9A 4CZJA 4TVAB 3M8SA 1F5CA 3TA2A 2IA6A 2WVDA 3ZX3A 3KHYA 4OZNA 5IWAF 3VHQA 4CZCA 1RDDA 1FERA 2PMHA 4OI4A 2PE8A 3UE5A 1TKDA 2O8EA 3FZBA 3THXA 3VEZA 5KFDA 1Y5NB 5E3AA 2IS3A 3KMSA 5KG1A 5HP1B 2DR8A 4YORA 4Y34A 1J5EK 3MM8B 1QAJA 4DR7F 4DB3A 5DETA 2IC3B 3WNGA 3RU0A 1VI7A 3T19A 4LH4A 3H1QA 4A62A 4XH5A 3VCDA 3G6XA 1M5PC 4YFUA 4I68A 2P6TA 1SH3A 5LMNF 1TUWA 3CJ9A 3DLEA 3M6WA 2DEIA 4ZN3A 1TKTB 3BPSP 5HL7Q 5AXNA 2DXEA 3BDPA 2FZCB 5F8NA 4ZMMA 3H5UA 3SFGA 1DHMA 3V6DB 1CZBA 4ILGB 5CYMB 3ZT1A 1RISA 3LWLA 4FPBA 3EICA 3BQ1A 4FJIA 3L6QA 5DQIA 4IRDA 1PAEX 4ID8A 4ANEA 2P9NB 4TY9A 1B9DA 3V4IA 1X5SA 5FJ4A 3K7RA 4GY2B 4ZP6A 3LOUA 5IV3A 3U02A 3R5JB 1RBTA 4JV5F 4KTQA 4YHHF 3G96A 4KO0A 2Y0BB 3DXMB 3Q83A 4RW8A 5DLFA 1TUYA 4RBVA 2P5VA 4OMFG 1UW9A 2X6NA 1QD1A 4E1NA 1ZZNA 3GV5B 2MLXA 1F9EB 3KUEA 3BM7A 2XI2A 5D0EA 4ZLJA 3FVYA 4OI6A 1CJVA 3O44A 4ZKAA 4FYWB 4CJTA 3VGUA 3P1GA 2HBZB 4KHSA 4LIRA 2ABYA 2H3GX 2K1RB 2J9DE 3HPHA 3RUBL 4PL7A 1C0TA 3EN9A 4PKIA 2OI2A 2HKEA 3TZWA 3FRYA 4ZP9A 1JCEA 1S77D 3IAYA 1SUQB 2RH3A 4QIGA 2QM1A 2HMIB 3M8PA 3HSDA 2CG8A 2QWNA 3OYLA 1SQGA 3H42A 3I8DA 3SEOA 1TQLA 4DTOA 3ZTOA 3HP9A 1G1XA 1U1MA 4DV3F 4DPXA 1N34F 2H4YB 4DU1A 1W97L 1SI9A 1H73A 2A3JA 4JK8A 1LWFA 4B3OA 3ISZA 1S6QB 1ESVA 2FGCA 3NOGA 3DRPA 2DJWA 4B3SJ 2C2NA 1DAXA 4HDHA 1BDGA 1VQ5N 2ZBIA 2E1PA 2OTLS 4HI2A 2UUAK 2J9CA 2GMHA 1QSYA 4HTJA 4ED6A 2JFDA 2OLWA 1S5JA 4OZLA 4GKJK 2NUHA 2JC1A 3AVLA 3M8QB 1OY6A 1OPIA 3EKUA 2Y3YA 4E89A 2BXJA 4BLGA 2DGXA 2V7YA 1MU2B 3SUQA 4X4SA 2X1AA 1VLYA 1BWFO 2HHQA 4P2SA 3MCPA 2FJWA 1P8ZA 2UXDK 3OXGA 1Z2ZA 1HI1A 2YX7A 3O08A 3M9MB 2V6AA 4OPHA 3W2WA 3AVIA 2VG7B 4CF1A 4L76A 4OPAA 4LF9J 5A6WA 4U8VA 5EGYA 4NYOA 4C8KA 1T44A 4ILMA 2CVIA 5JUMA 1A9NB 4URQU 1NRKA 4M5MA 4BRLA 4DHVA 3R6LB 2NSCA 2AYMA 2P5OA 1ZOTA 3V9XA 4CJWA 2HHHK 1IBMF 3HVTA 2VG5B 3H2VE 2B9XA 1I94J 5L9XA 5BN9A 4A4JA 2H5EA 3I0RB 4ELVA 1VSIA 3WX8A 2VG6A 2UUBJ 4K4SA 2IM1A 5F8GA 4YR3A 1FRHA 4TU7A 3OYGA 3NHGA 2FBVA 3RBZA 1YKWA 2PI5A 5M1PA 3W3SA 1FX2A 1VDHA 4Z0UA 1CJUA 1NM1A 4WIQA 2X6SA 2XZTB 1URRA 1PBUA 1NO8A 4DPOA 2DFEA 2LP4A 3O5TB 1KNZA 2IBKA 1GX6A 5KG0A 2DY9A 4HKQA 3ADAC 3PFEA 2YNHA 3O9QA 4LRBA 4OI3A 4ELUA 2I0XA 1UEUA 4QJVA 4JI1J 1RSCA 3TWHA 5GADI 4F25A 1VK8A 2GW8A 4NEZA 3ZSVA 2BBEA 2JZ5A 2AJQA 3VQCA 4QCLA 1ASVA 3NGIA 4RBUA 5L1KA 3CDBA 4O4RA 3WXKA 4BVOA 1UJ4A 1QQNA 4DV0K 1V3SA 4CEOA 2SXLA 5B0CA 2KT2A 1VRTA 2X1GA 4NLQA 3TANA 1XMOF 2Z2LA 5CZ1A 1LK7A 1KFSA 1MN9A 3CJ0A 2HBQB 1W2BM 5F3ZA 3KLFA 4MYUA 3GWCA 2P9LB 4URGA 3K5MA 5HBMB 4OLAA 2Y9HA 3KZBA 1C1CA 4KHRA 2NRXA 2VHGA 1EJ7L 2GGPB 1Q95G 3DLBA 3FEZA 3IN5A 4I4BA 1Z6RA 2D69A 3BO4A 5TKYA 3EXYA 2NXUA 4NLSA 1LWCA 4KHMA 5GIOA 3CCEN 2F4VJ 2EHGA 1T03A 4L3QA 2PN6A 1EP4A 3BS9A 3NNCA 3CB4A 3VAGA 1S9EA 3NGSA 2CRLA 5I3UB 3FQKA 2P51A 2DHSA 4Q8FA 2P6SA 3I0SA 4DCOB 4DPWA 4L72B 2BE9B 2OH2A 1HD0A 4AILC 4WQ5C 2W1BA 4BROA 4RWWA 4Z4EA 1ULRA 1VQ7N 2IA0A 3OD2A 1H6KX 3KMQA 4CIFA 4QYZK 2V67A 3UI3A 3T1HF 4I56A 1WTBA 3PY8A 2NRVA 2OTJS 1RCXB 3IBFB 2OFGX 4R5PB 3M1VB 2VWKA 2YX6A 1NJIO 3QNWB 1TGOA 5J2QB 3I32A 1VSFA 1FRIA 5CHCB 4CF0A 2DH8A 4LBPA 5ADXH 4CHNA 4DSJA 1NHVA 3HJVA 1IM6A 3RB6A 1V4TA 4F9OA 4CLKA 2LQ9A 1NBEB 4F4ZA 1VQLN 4ECSA 4F3TA 5FDLA 3H7HB 1SS6A 4B02A 4DV5J 4F4WA 5AJ3F 5A0YA 2ZWHA 4KGKA 3K89A 3PKMA 4ZVUB 3M2RA 1KHWA 2GTDA 1WKLA 4DR5K 1LW2B 2GCFA 4FJHA 2O8CA 4WQ5A 1VQ8S 4CIOA 4FPAA 3ZTSA 3I82A 4CLZA 4CIEA 1AZSB 4B3MF 3P6YC 3MEDA 3ALYA 3RMDA 2HFNA 2IMWP 1BXNA 3E8OA 2CJAA 3CMEN 4NXNJ 2KHDA 2YH0A 4BC3A 1G3OA 2BEFA 3KKFA 4HACA 4FWPA 3PO4A 3KLHB 4BC7A 2O8FB 1DURA 2ASDA 3X1LB 2RPIA 1NOYA 2BJDA 1IVZA 3GG0A 5KT2A 2L41A 4YOUA 1A6LA 5GMEA 4CF9A 3CXCM 3MPWA 5AT1B 2V8DA 4X62J 2BUNA 3A5OC 1KOOA 3VQ7A 2F1FA 1R6VA 2V4JB 2V51B 4MLHA 5C2FA 1HQUA 3KK3B 1SUQA 2DT9A 1S5ZA 3LPTA 4DF8A 2QEXS 4LFAJ 2MHNA 1U47A 4KHPK 2IDOA 1S97A 2KRBA 1U0SA 4IKAA 2QLXA 4USKA 3L4IA 2FVSA 1RAHB 1UJ5A 4H5WA 4F4KA 3KLIA 1UWBB 2KG1A 1XEZA 2FYXA 4OL8A 1JXVA 6AT1B 4MK9A 5L8RC 1RTHA 3DXKA 3S6EA 1IBKK 3Q23A 2A3ZA 2QL9B 1WUAA 4LFBK 3IRXA 2W6KA 3R2DJ 1JQGA 5BXIA 4KO0B 4PQAA 2A2DA 2GHPA 4H54A 3W9HA 5CZXA 2OTJN 2R4FA 5HBMA 1PCAA 1TL3A 2VGNA 4I7FB 4O3SA 4WK1A 2OUGA 1T8EA 1AT1B 2VIHA 1HMVB 4RCHA 3S01A 2QG9B 3GJQB 3MTKA 4DR3F 4CFBA 5ETOA 5DG7A 4KTWA 4DSIA 3E01A 4FWRA 3CD6S 2QW9A 4CEAA 4B9UA 5DQHA 5THWA 5AQHA 1RHRB 2VASA 2QWRA 2HS3A 4QU7A 1U8SA 5E3CA 3WC2A 1HIYA 2I6WA 2V0NA 4DV2F 3ZT2A 1RTZA 3QJLA 5LJ5Y 4I2PB 2HPUA 5C2CA 3KWGA 5HVGA 2NCKL 2WVFA 4KI6A 2LVWA 2RRBA 4CHOA 3OY9A 2CAJA 4B9QA 2BANB 3ICLA 2B4JA 3C6TB 3N5FA 2ATLA 4OX9J 2LU2A 1FTCA 2N82B 1MMNA 1VAZA 1HNWF 3MR2A 2BA9A 3DRXA 4DR7J 2W8LA 4BE1A 4C9DA 1I1GA 4PCQA 3LZJA 5C0YA 4K8ZA 1HR0K 1KS2A 4JK9A 1HHSA 4C8LA 3M2RB 2E2NA 1XNRF 1TUVA 1SKWA 1S72S 2OPPA 4DLGA 4OKKA 1W7AA 4J2BA 4DF4A 3D66A 2KQ2A 5B7WA 1RBRA 2DNHA 3CCQS 4K4TA 1GOCA 3MCSA 3TU5A 3OW2R 5F41A 5GAEU 1HKAA 2ZBPA 3P3DA 4FWOA 4LT6A 3FZ2A 4WKYA 1P1LA 4F0HA 1LFPA 1RT6B 3U1MA 3L4BC 5M1FA 3QJPA 5LL6Z 1CJTA 1L3SA 4JS5A 2ZH6A 2YWEA 4ILJA 2CA9A 1YJVA 4FNIA 2Z30B 2HEKA 5BYRA 1A5WA 4PY5A 5LMUF 4ZDNA 4B1ZA 5I42B 4WFXA 4CT8A 4EK2A 1SZ2A 3MCOA 2HVDA 1BD6A 3KDOA 2G2OA 4CK1A 1JLBA 3HZ6A 3HHLB 3VVUA 1K0VA 1YDLA 2OHDA 1SQKA 3HFZB 4NLXA 3I0SB 2RDIA 4DFJA 4DL0C 1QAXA 1LNQA 4BRQA 4KGVB 1RKJA 4NLTA 3QAUA 4QW8A 5C25A 1H7WA 2GIQA 3TEGA 2VFRA 3W1YC 4ECRA 4DV6K 1VSMA 5C24A 4JOUA 1WSFA 4LJMA 3N6LA 4CZHA 2YKNB 2OEKA 4TXSA 1IG9A 3D3CJ 1HHQA 4M3RA 1H38A 1A0OB 4KHNA 3F41A 3VR1A 3THVA 7AT1B 4WFNQ 4CECA 5GAGI 1LQ9A 1KC8O 3G9CA 1EKEA 4X64F 1BA1A 2DY1A 3UR0A 4OPJA 1K9MO 2N3OA 3KKRA 4UZCA 1YJ9S 2YWWA 3MEEA 4ES2A 4YS2A 1QUVA 4CI0B 5DM7Q 2MPUA 4CEEA 3WHIA 3ENHA 2JLFA 1S79A 2Q0UA 3UKUB 3ZEUB 1HI8A 1S9FA 3W64A 1YJTA 4FK2A 4OIXA 4WQ4C 5DM6Q 1ZC6A 5HL7L 1HA1A 4JI4F 3CC7N 4KHWA 1S9GA 1B70B 2JEJA 1K47A 2HIQA 4DUYK 4YY3J 2EFVA 3BYPA 3WUHA 4I6AA 1VQNS 5F8IA 4OYXA 1X3NA 1HNVB 3AO3A 2MDAA 1IR2A 1O1WA 5GMDA 4IH5A 1RGIA 3ISND 3HP6A 1R3NA 4FK0A 3W7BA 3VF2A 1S76D 3PO5A 1R7IA 3C46A 3PEJA 3CGIA 3O4NA 4LY7A 1TMJA 4KH0B 4IQMA 2JEFA 4PXCA 4RBTA 3R97A 5HP1A 3TEHB 2J6SA 1X60A 2AW0A 1N33K 4DV3K 4DHYA 2OZMA 4KB0A 3J81Y 1U2FA 4WP9A 3HCXA 1FE4A 4IO8A 2BE2B 2ZHOA 1T3NA 2PSZA 4K4XA 3UN2A 3O6WA 2BTFA 3GB0A 3ETOA 2W2QP 1U48A 4CJ3A 3THTA 5A8RB 4BR9A 1NK7A 1UFLA 4NLPA 1ZBTA 3LAMA 4LRDA 1RWXB 2CPYA 3MCAB 2A0FB 2VPXB 1IQZA 4A2BA 1X4HA 3QFPA 4H4KC 3BZCA 4BRKA 1FDBA 5L9NA 3NEKA 2A2CA 3TSUA 3ZT0A 1YHQS 3N5BA 3T41A 1FK9B 1IWGA 1LK5A 5LY3A 1SQFA 4R0JA 1EO1A 3HD2A 2LU1A 4O3QA 2OA8A 4ECQA 4RWTA 5KFEA 3JS6A 1EXQA 1J2VA 4MLEA 1WG1A 4X64K 4ZIWA 4JNEA 2HNYA 5IXUA 2MQOA 4OFZA 2VZ9A 5KGXA 3NKYA 3KK1B 4QWAA 1OJ4A 1FJ7A 3G86A 1X4AA 5ETTA 3A3PB 2CIMA 1EAYC 4B3TJ 3VQ6A 2R7UA 1RAOA 3OR1A 3EVWA 3GBTA 3ISNC 5FPEA 1VQ6N 5CD4H 3MN9A 2HQDA 1FKOB 4A8MP 3O1BA 2DK2A 4EMDA 2AZ3A 3N28A 1NDCA 5SUHA 3HT0A 3V6DA 3K5OA 4UW2A 4PKHA 1S6PB 5HN0A 3SQOP 4K50A 4LF4K 1YZ7A 4J9LA 1I39A 1IV0A 5KG3A 3SSQA 1VQNN 2Q79A 2CH6A 1YBAA 2YVSA 2ZH5A 2MSTA 3KHRA 3FZMA 5AQOA 3Q8VA 1F3VA 4WP8A 2HG4A 3VQSA 3RBEA 3CCMN 5L1IA 4WFBL 3P4UB 2IAJA 2NLXA 1VC0A 2W2NP 4LF7F 3E51A 4QOTA 2AWZA 3VN5A 2AA4A 3OR1B 4DPTA 2C3YA 1EB0A 1RWKB 2Q6CA 1ZAVA 2CKWA 4URSA 2D3O1 2DRAA 1FWPA 1A5VA 4I64A 4IFYB 3KJNB 5FLXU 2DH7A 4MJKA 4YDUA 4OHXA 3KD5E 1N54B 2C3UA 5BREA 3BQ0A 2N7CA 1YJWS 2FY8A 1ZPWX 3M8QA 4QWBA 4Y65A 4MFBB 1H0HB 3ET6B 4I6YA 4OO1J 3SZ2A 4JP8A 1HWIA 4AHRA 1BHNA 2QA4G 2ZITA 4JI6K 1NKCA 1B7FA 4FLVA 1OH8A 2HF3A 2WVCA 2Y0SD 3U1NA 3CJ8A 4W5RA 1WHWA 1RZMA 4O4GA 4YB1P 2P9SB 3FNNA 5FPNA 4JYAF 1DTQB 3C6TA 4FS2A 2WVBA 3DNCA 3HHNB 2VQFK 4XEIA 2PGCA 4FVMA 4DCHA 3AVMA 2EG1A 1K8KA 3LP3A 4WFZA 1WBBA 2QA4S 2APOA 2ZJRL 4B3MJ 5DO2A 3J7YU 3EM1A 3OVNA 4B3TF 5IT9Y 3CM6A 3M8PB 1XQIA 2OMLA 3JQJA 4CZEA 3GMGA 3EGVA 4O0NA 1S6QA 5KTQA 4CZFA 5J2NA 4KPCA 3MXMA 5D15A 4DL3A 3RB3A 4PABA 1HWKA 4JI8F 1JMTA 1S1VA 2WB1D 4HYKA 2LECA 1CS4A 2O8EB 2G8VA 4BRGA 3UCUP 2XHCA 1NPPA 3QBXA 3JXUA 1KN6A 2V8PA 1JK9B 2DTUA 4RW9A 3T5LA 3RWUA 3JTPA 3R8EA 2GAGC 4PR6A 3VA0A 1DTTB 3F73A 4LFAF 2ZJPL 3SQ0A 2OSQA 5DQGA 1RFQA 3OHBA 1MWYA 4ICLB 3CVKA 3KKSA 2CPZA 3I5CA 1D09B 3O6QA 2VQFF 3UDVA 2ZOGA 5E84A 4F02A 1S4EA 2NZCA 3QIOA 3FKBA 3ZZYA 4CD1A 4KPYA 1RTHB 3PVXA 3DXKB 4DX8H 2XLKA 3DGVA 4ILLA 4FCYA 3NF8A 3PZPA 2KB2A 3MM7A 3E9OA 1SIZA 3VAJA 3AD8C 3TA1A 2NPIA 3U6FA 2N7YA 3OHRA 1RAJA 3DRPB 3BGUA 1R0BG 2VV5A 4NYFA 3RG6A 4QWEA 3AVGA 3MAHA 3S3NA 4JI2F 4G1QA 4IOCQ 5AQSA 1Q8LA 3G8TA 3GL1A 1FFGB 4CQ1A 1LWEB 1GLJO 3F2KA 2XMMA 4YMEA 4H4OA 3JTNA 1MMDA 3MI7X 1NK6A 3B6OA 2D74B 5H9EK 3PEHA 4FJNA 1LXJA 3ZX0A 5ETQA 4OZ5A 2IRUA 3H3NO 2ZWOA 4Q2LA 4KIAA 2IYIA 1AUSL 4X66J 2X74A 2G8UA 2XHWA 4MKBA 2VC0A 3QEXA 3MCNA 1ZAWA 3J81O 3T1YF 4J2AA 4WYLA 3IDHA 1N32F 1QAIA 4DPUA 3KJVB 1NOZA 1QDUB 4C3LA 1HBUB 2FHJA 5AJ3K 3I56N 2FTRA 1S1UA 2KXHA 4G9ZA 4J2EA 1FD8A 1KLMA 5KPTA 3NGUA 4YDUC 2KLAA 4JKBA 4E3SA 2YPZA 3DDIA 3EMTA 1M90O 1HNIB 2X1FA 2BABA 3B54A 4B3MK 3H25A 3CQXA 3DYAA 3DLLL 5HROB 2CYYA 2Z2MA 2YHYA 2GV9A 1OY8A 5EWEA 3OBYA 2CG4A 3D2FB 5AQPA 2D41A 2XM3A 4EIAA 2R8IA 4X2BA 1Q8IA 3RMAA 4MT1A 3FMWA 3U9DA 3BUZB 2AEJA 5B09A 1T9XA