2NRHA

Crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
192
Chain Sequence
b'LLLCDIGNSNANFLDKYFTLNIDQFLEFIFYINVNEHLKEHLKNQKNFINLEPYFLFDTIYQGLGIDRIAACYTIEDGVVVDAGSAITIDIIHLGGFILPGIANYKKIYSHISPFNTQVSLDAFPQKTMDALSYGVFKGIYLLIKDAAQNKKLYFTGGDGQFLANYFDHAIYDKLLIFRGMKKIIKENPNLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator, putative, Baf family
publication title Crystal structure of conserved putative Baf family transcriptional activator from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Structural genomics, unknown function
total genus 59
structure length 192
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA01
3VGMA 3ULEA 4RCHA 1X3MA 3CJCA 2IIRA 4IZ9A 2Q1NA 1S22A 4IJAA 3ID8A 4HTLA 3IDHA 4PL8A 2IVNA 3VF2A 3CJBA 1IJJA 1BO5O 1NM1A 4B1VA 2P9PB 3HM8A 1HJOA 3EO3A 3VEZA 1GLLO 2Q31A 3KVGA 3J8AA 1SZ2A 4CZHA 4BG9A 5BRDA 3EZWA 5AZIB 3RSEB 2YHXA 4BRAA 2YJFA 3IMXA 3WXLA 3AARA 2ZWHA 5AQUA 4BC2A 3U9ZA 1QHAA 4JHDB 5AZJB 3C7NB 1QZ6A 2DPNA 2NLXA 2E8AA 3QBXA 4XH5A 1NGAA 1JCFA 3O5BA 2FSNA 4H5WA 3CJ9A 1G99A 1LCUA 3A5OC 4BVPA 3H45C 1TYQA 4EFHA 3ENOA 4BRHA 1Z6RA 3G25A 1OKJA 4PKIA 5AFUA 1Q18A 3VEVA 3MN6A 1Y64A 3SK3A 3VPZA 4BRDA 2GTDA 2CH5A 2QW9A 3HBTA 4O5FA 4BRCA 1IG8A 1KAYA 3DXMB 4BREA 4AM6A 1GLFO 1NMDA 1P8ZA 3D2FB 1HKCA 4B9QA 1C0GA 3UKUB 3WXJA 4EIAA 3H1VX 4FWKA 4K42A 1ATSA 3CQXA 4B1ZA 4XEIA 4H5VA 1U2VA 3QBWA 2Q0UA 4RTFD 4B1XB 3TPQA 4FWMA 2V7ZA 2QWNA 1QQMA 3GDQA 3RSEA 4BC3A 3IFRA 4H5NA 4A61A 3BP8A 3ULEB 5AQHA 4IO8A 4JHDA 5AQVA 3KHYA 3VGKA 5AZJA 1NGGA 2Q36A 2E2QA 2FSJA 2PAVA 2V7YA 2NZTA 2VCPA 3UB5A 3WXKA 4BRQA 1BG3A 1BA1A 3CI5A 3DXKA 2Q0RA 3HSCA 4PL7A 4BC5A 4CBUA 4CZGA 2ASPA 3W3DA 3CERA 2ASMA 3LDQA 1X3NA 2NRHA 4CJ7A 1NGHA 3H3OB 2H3GX 1S3XA 2UYTA 1BDGA 1R59O 4BR0A 5F1XA 5FPMA 4H0XB 1X9JA 2QWLA 3H1QA 5JICA 3EKSA 4A2BA 4JAXA 5AQGA 3A0IX 2P9NB 4IXCA 2GEMA 4JD2A 1TYQB 4LC9B 1XC3A 2PBDA 1BOTO 5E26A 3ATUA 1GLDG 1SQKA 1J6ZA 2P9UA 3FLCO 1GLEG 4XH1A 5AQJA 3LDLA 3CJ7A 3AY9A 2CGKA 3U9DA 2HOEA 5ADXA 4BROA 2IVPA 3DJCA 4KBOA 5BN9A 2F9WA 3GL1A 3FFKB 2VWBA 5AQLA 3BF1A 1QZ5A 1GLJO 4FSVA 1DEJA 3MK6A 1NGJA 2A40A 4YDUC 1ATNA 4BRGA 1NGDA 4FPBA 5BPMA 3O1WA 2VYPA 3W0LA 1TUYA 3AAPA 3M3ZA 1U2VB 2YI1A 5BPLA 4CZJA 1GLAG 5KQDA 5F0XA 4EAHD 4FO0A 4DB3A 3QB0A 2E20A 5KQ8A 2E2PA 1HKGA 2Q2RA 2HMPA 3LDOA 4IWVA 2A3ZA 2ASOA 5EVZA 2CH6A 2GUPA 3FZHA 5AQFA 2P9NA 4FPAA 3VGLA 1KAZA 1MA9B 3QFPA 3WQTA 3DXKB 3SLCA 2FF3B 3CJAA 5AQWA 4CBXA 2A5XA 3LL3A 4C23A 5JMVA 3VETA 4BQZA 1TUUA 5LY3A 2P9KB 2KHOA 5AQXA 2GWJA 4WQ5A 4M7YA 3ZEUA 4WQ4C 4ISFA 1HX1A 3ENHA 1YVNA 2E1YA 3LDPA 5BREA 2CGLA 1KXPA 1JCGA 4QS8A 4CD1A 3MN5A 4BC4A 5FPDA 5EOYA 4JD2B 3EL2A 2ITMA 3A5LC 3L6QA 4BRMA 5LJWA 3FZFA 4L3QA 2D0OA 2YJEA 2V52B 2GWKA 1LOTB 3I33A 4MO5A 2P9UB 5EY4A 2IVOA 5KPRA 5AQPA 3F9MA 3HI0A 3WEEB 3L4IA 2AA4A 3QFUA 2F9TA 4CZMA 2ZF5O 4BQLA 4PKGA 3WUHA 1QQNA 2YHYA 1NGCA 4M7XA 3WQUA 1V4TA 3S41A 5AQYA 3BEXA 3DWLA 2E1ZA 3MN7A 4BRNA 4CI6A 3ATVA 4JNEA 5ELZA 2W40A 2BUPA 3R8EA 2P9KA 4E1JA 3EKUA 3HZ6A 3SJHA 4FWRA 3VF4A 3VEWA 2FLOA 3JS6A 1YAGA 3ZX2A 2AP1A 3IUCA 1GLCG 4DCHA 1KAXA 3WT0A 1HKBA 4EHUA 1NGBA 1XQSC 4FWOA 5BRFA 2W41A 3M1FA 1ESVA 3O4WA 4H0OA 5AQMA 3R9PA 4H03B 1ZC6A 4CZLA 3A5NC 3CIPA 3MMVA 4HWIA 2D0PA 3BF3A 4K43A 5BR9A 3FGUA 3UKRA 2FSKA 5F2RA 3WEEA 3FE1A 2Q97A 3ZEUB 1K8KA 5AQNA 4FWQA 3CHWA 1NWKA 5CE3A 1Z05A 3FZLA 4H0YB 4I6MA 3UE5A 1ATRA 3L0QA 5AQSA 2E2OA 4BRFA 2J4RA 3HTVA 5EX5A 3D2EA 1NLVA 2GELA 3DAWA 3BUZB 4BR5A 5BN8A 3ZETA 4H5TA 3A5MC 5AFUH 4AM7A 2P9LA 3WXIA 2QWRA 1U6ZA 1BUPA 1YUWA 1QQOA 4H5RA 1NGFA 4MO4A 4NO7A 4BR9A 2QM1A 3VEXA 4CD3A 3KZBA 5BRHA 1BU6O 2FF6A 1HPMA 3MDQA 3VENA 2QWQA 1ZXOA 3O1BA 3FR0A 2V51B 2D4WA 4GNIA 5JLHA 1C0FA 2P9SA 4WYBA 4J8FA 4MLEA 3VERA 4BVOA 3GBTA 3I8BA 4FWSA 1RDWX 3VF6A 4FL9A 1NGIA 4QS7A 3GE1A 4K25A 5E84A 2D1KA 2FXUA 3LDNA 5AQQA 5I9EB 2P9IA 4ISEA 1WOQA 5FPEA 3O08A 4B1YB 4QS9A 3CQYA 3C0BA 3MN9A 3VESA 4BGBA 4CZKA 3LM2A 4CZIA 5AQZA 2HF3A 3ZX3A 3QDKA 1T44A 1RFQA 3CJ1A 3FZMA 4CBWA 2YCHA 2QXLA 4DQ8A 1YXQA 3B8AX 2QWPA 3GG4A 5AQRA 3JXUA 2I7NA 1HLUA 4BRPA 2A42A 1BWFO 2WUSA 5AR0A 3U4LA 1MDUB 4YDUA 1RGIA 4H0TB 5AQKA 4IJNA 3D7EO 2OANA 4BR7A 4XH4A 2CGJA 3R6MA 3H3NO 4FWNA 3H6EA 4A2AA 4CZEA 3U8XA 3UKRB 3EN9A 3OHRA 1K8KB 1E4GT 3TU5A 1DKGD 5BPNA 4BR2A 4I6MB 3VOVA 5AQOA 2QWMA 2YHWA 2I7PA 1GLBG 4RWTA 5FPNA 1NGEA 4MLHA 4H0VB 1CZAN 2P9PA 1DGKN 3D2EB 4FWPA 4BRKA 2QWOA 3CETA 4ISGA 4BG8A 3O6WA 2BTFA 3ZETB 1JCEA 3SMPA 5EXWA 4BR4A 4FOIA 3LM9A 4JN4A 2P9LB 5AZIA 3M6GA 4M63C 4CZFA 3GOIA 1T6DA 5ADXH 3C7NA 3FZKA 4K41A 3VEOA 1D4XA 1MWKA 4WQ4A 2P9SB 2E2NA 3QMLA 3MCPA 1SAZA 5JLFA 1BA0A 4H0PA 2ZGZA 5TKYA 3ZX0A 4FOEA 3SMSA 2P9IB 5AQTA 4PKHA 2EWSA 3DXMA 1HUXA 5KPZA 5LJVA 4A62A 3P4IA 3AAQA 3H46O 3D2FA 1EQYA 1NBWA 2ZGYA 1E4FT 1MWMA 5KPTA 4BRIA 3UKUA 2HF4A 4B1UB 4GY2B 2A41A 5B8HA 1T6CA 4B1WB 4F9OA 4DHYA 4Z94A 2E88A 4NB4A 4O8KA 4BRLA 4Y0WA 1V4SA 3A8YA 4BGAA 1ZBSA 5AQIA 3VEYA 4FWLA 4EHTA 3QICA 1WUAA 4WQ5C 3O8MA 1XUPO 2A6AA 3O80A 1H1VA
chains in the Genus database with same CATH superfamily
3VGMA 3KKRA 3AVBA 4Z4IA 1OVYA 2Q1NA 2KZMA 2HHXA 4ILGB 4E7HA 4PL8A 3IDHA 4FJNA 1Q7YO 5KRSA 4DV4K 1BQMA 1NM1A 3N4PA 4EP4A 4FK2A 3CCLN 1W9HA 4B1VA 2QKKA 1HJOA 3EO3A 3I0SA 4WF9L 1HNIA 1DLOA 3QIPA 4O0JA 3THXB 4CZHA 3ZLJA 2RPIA 3O3GA 4DWIA 1VSLA 4DQQA 1C6VA 3T7ZA 1XHXA 3AARA 3V1QA 4Q5VA 2DFHA 3AVFA 3U9ZA 2XY5A 1QHAA 3LP1A 3LALA 1JXBA 4OKKA 1LW2A 3AVHA 4QOZB 1KVCA 4DV5K 4BRHA 4CFBA 2IC3A 4CGDA 1YT3A 3VEVA 3MWPA 3SK3A 4O8UA 4LF7K 3LP2A 1ZYQA 1T7PA 2X6SA 2OCEA 4BE0A 1GOAA 1GLFO 4JI6K 5C42A 4K0KK 4DR4K 4PWDA 3L2WA 2HHWA 4DR3K 1UOCA 3CYMA 4CGGA 4AH9A 3OYNA 3RRGA 1RT5A 3WXJA 3ZCMA 4EIAA 3CCSN 3DOKA 5KRTA 4MQ3A 4H5VA 3ZSYA 1RTJA 4B1XB 1K6YA 3QEIA 3MCAB 1A5WA 4FWMA 3RSEA 4OKJA 1CXUA 3DLLL 1RNHA 4IO8A 4XIUA 1NGGA 4LF9K 1YHQN 3UB5A 4R79A 1BG3A 1XMQK 3HSCA 4C8KA 3C6TA 4AF1A 3BZKA 3OBYA 4CZGA 1QSSA 3CERA 3CCQN 1X3NA 2IGIA 4CJ7A 2O4GA 5F1XA 2UXDK 1O13A 3AVGA 3QERA 2QEXN 3DRPA 4JKGB 1XNQK 2F4VK 3OS1A 1L3VA 4IOCL 1X9JA 2KFZA 2QWLA 2UXBK 5CYMA 2G8FA 4BWJA 3EKSA 5JICA 5AQGA 2XHBA 2P9NB 4JI8K 3HL8A 1FKPA 4JD2A 4A5AA 3K2PA 4C1NK 3HT3A 4CEQA 1XC3A 5I3UA 2WFBA 3L2RA 1NK5A 4CCHA 4KI6A 3ATUA 3FLCO 2P1JA 1WLJA 4XH1A 5AQJA 3LDLA 3SUPA 2CGKA 4JKFA 4BROA 4KHSA 4KBOA 2F9WA 3SQ4A 4LF4K 2A1SA 2GUIA 5BPMA 1TL3A 1TUYA 3ZT2A 5BPLA 4N5SA 4J2AA 4CF1A 5GAEP 4N56A 2QK9A 3QB0A 3CCMN 1NJXA 2HNYA 3M8SA 2XY6A 3SBGA 3FZHA 5AQFA 4FJ7A 4KH6A 3RMCA 3WQTA 4MDAA 3SLCA 4CBXA 1QSLA 4I9LA 2A1RA 5J1EA 5JMVA 2E6MA 4BQZA 1WAFA 1TAQA 4WFAL 4U7BA 4WQ4C 1YF5L 4FLVA 1K9MO 1S1VA 4DTXA 3M8PA 2HBJA 3P5JA 4CJTA 1X9MA 4B9NA 4BC4A 3DLHA 3QEXA 1YI2N 3EE8A 4MO5A 4FLYA 1RDUA 4DV1K 4EZ6A 5AQPA 1HNWK 1NKEA 4FLTA 3J7AP 3WEEB 2NRRA 4N76A 1REVA 2AA4A 3QFUA 2F9TA 2ZF5O 4JKDA 4BQLA 3MEEA 4O4GA 3IAYA 2X78A 5TKWA 3WUHA 1QQNA 1WB9A 2D0CA 4M7XA 3RVCA 4E0DA 2EX3A 3BEXA 2DFEA 1Z25A 3DWLA 1JLAA 3MN7A 1LV5A 2HHQA 2BUPA 3EKUA 2WOMA 1DT9A 2FLOA 1KFDA 3ZX2A 1GLCG 3P39A 1EXQA 4EHUA 1NGBA 1XQSC 1TGOA 3SV4A 2W41A 3SPZA 4IDHA 5AQMA 4CGHA 4H03B 2YNIA 3A5NC 3CIPA 4C1NI 2D0PA 3MAQA 1QTMA 4PHTX 4KB0A 4K43A 4IG3A 5HROA 3LANA 5BR9A 5IWAK 3FGUA 5C10A 3VQAA 4DS4A 4B9SA 3UKRA 4RW9A 5JVHL 3M5RA 4BDPA 1K8KA 4FWQA 4LFAK 3MXIA 4I6MA 4H0YB 3L0QA 4KFBA 1VSDA 3HTVA 2XY7A 3NE6A 1NLVA 3DAWA 4KHNA 5IT9O 4DF8A 3L2UA 1BIZA 2ETJA 3WXIA 1U6ZA 4O5BA 1RTHA 4BR9A 3DOLA 4DG1A 4DQRA 4E19A 3KZBA 3TAEA 5HL7L 1C1CA 2FF6A 1JLFA 4FLUA 2JGUA 3Q7CA 4DV2K 2BDPA 3FR0A 4JKHA 4Z4HA 2V51B 4GNIA 3SUNA 1ZBHA 3RMAA 3OS2A 3GBTA 1NGIA 1HJRA 4DTPA 4WCEL 4IOXA 3E9OA 1Y97A 2P9IA 1WOQA 3O08A 3AVIA 4IOAL 1ZBFA 1SV5A 4DTUA 3R1XA 3PO4A 1WBDA 3PUFA 4DMNA 3TTFA 3ZX3A 1RFQA 3HYFA 2ZJPL 1L3UA 4ZHRA 3MXMA 1JJ2M 2O8FA 2KLAA 4YY3K 1DTTA 3A2FA 1SL1A 3HOSA 4IJNA 1YJNN 4LF8K 4BR7A 4DTMA 5CY4A 2HW3A 3HPHA 3H6EA 4CZEA 4YOWA 1JLBA 2UUCK 3OHRA 5KI6A 4BR2A 2AJQA 1S5JA 3J7YP 1W97L 4GV9A 5C2FA 4JRPA 5CR4A 3D2EB 4FK0A 3PX6A 3CETA 4ISGA 4BG8A 3O6WA 1ZBUA 3KIOA 3PIOL 1Q9XA 4BR4A 5EXWA 2VGMA 3KK1A 4FOIA 3THXA 3LM9A 1HQEA 1S1WA 2O8DB 3ZSRA 3M6GA 1KLNA 4M63C 3GOIA 3DLBA 4OKEA 3V1RA 3I55N 2RF2A 3NF6A 3TAQA 3THYB 4UY8O 1B9DA 4NXMK 2F7TA 4DFKA 2G8IA 4W5QA 3QMLA 4CF2A 1SAZA 5JLFA 2OPRA 4IEEA 1RBTA 4J2EA 4E7JA 4FOEA 4JI1K 2EWSA 2E5LK 2O8CB 1NBWA 4JS5A 3AO4A 4JI0K 1WSHA 3PSFA 4OJRA 3K0SA 1JLQA 3LPUA 1IKYA 1N8RO 2HF4A 3VQ7A 4GY2B 5B8HA 4W5TA 2XO7A 4DHYA 2OPSA 3V1OA 4YFUA 2XY8A 5E41A 4NB4A 4Y0WA 2E6LA 1RT3A 4BGAA 1ZBSA 5AQIA 2YKMA 4AHSA 3VQBA 3M8RA 4FWLA 2NRZA 3VQ5A 4EHTA 1WUAA 1IKXA 3KD5E 4CK1A 3OYBA 1FXXA 3O80A 5C12A 2NRXA 3EEQA 1IH7A 4RCHA 3J81O 1I39A 4CK3A 4B3TK 2W6LA 3CJCA 2HBKA 1S22A 1FW6A 1TV6A 4HTLA 3C94A 4B9VA 2IVNA 3VF2A 4DSEA 3CJBA 3O9TA 3JSMA 2VG5A 2P9PB 3VEZA 4OGEA 1NK6A 2Q31A 4RW4A 5KTQA 4DU4A 4BG9A 4JKGA 2YJFA 3WXLA 3TABA 3DYAA 4QCLA 4JHDB 4FM0A 1NOZA 2NLXA 2E8AA 1J5EK 3CD6N 2YNFA 4CJUA 4DV7K 1JCFA 1WSEA 1LCUA 3H45C 3KTQA 1Z6RA 5M1KA 1TK8A 4PKIA 1EO1A 3MN6A 1Y64A 3F5TA 3SAHA 4BRDA 5C0YA 1BGXT 4O5FA 3NHGA 1KAYA 1U04A 3DMJA 5C2DA 4UQGA 3RRHA 4DSIA 1NMDA 1WNSA 1HKCA 1W7AA 3V9WA 4FZZA 5K14A 2HNDA 3HOTA 2O4IA 4CIGA 2ZD1A 3O9QA 3L3VA 1QS4A 1ATSA 4BACA 4FVMA 3E01A 2KZZA 3U3GA 5C24A 3QO9A 4BDZA 4DFPA 2V7ZA 1WBBA 4DR5K 4C8OA 4GVMA 3ULEB 1I3AA 2BANA 5AQHA 3KHYA 5AZJA 3QINA 2Q36A 5LMNK 2PAVA 2VCPA 3T1AA 1KC8O 1BA1A 3CI5A 3CPEA 2Q0RA 1OH5A 2Z1HA 4J2DA 4FCYA 1VQ8N 3G0ZA 4AHUA 1G15A 3H3OB 4JKAA 2H3GX 2UYTA 1R59O 1Z26A 4FVUA 3VTHA 4LF5K 2ZJRL 4FJIA 4H0XB 3QETA 4KRFA 1VQKN 2JLEA 3H1QA 5M1FA 4A2BA 3A0IX 4IXCA 2D5RA 2GEMA 4GKJK 4NYNA 4LC9B 4Q0BA 4C8LA 3S9HA 3V9SA 3O4NA 5M1QA 3TARA 3ALYA 3JYTA 3HK2A 1HRHA 3CC2N 3T69A 3U9DA 5ADXA 4OPKA 3NF7A 2VWBA 1Q9YA 1S72N 5AQLA 3BF1A 4DU3A 1M90O 3V9XA 4FSVA 3B6OA 3HP6A 4DU1A 4AILC 2KW4A 1JLEA 3U3YA 4ZTFA 4B3OA 4F8RA 1RDCA 5J2QA 4LFBK 1DEJA 4YDUC 3MK6A 2A40A 4DQPA 5HBMA 2YI1A 4I7FA 4IO9L 3L8BA 1GLAG 1KSPA 3HJFA 3ZT4A 4FLZA 4AHVA 4CJRA 1OH7A 1HKGA 4ELVA 2YKNA 1VSHA 2YHAA 5EVZA 1VQ6N 2CH6A 2GUPA 3AVLA 4IDKA 4KH4A 1KAZA 3QFPA 2FBXA 3O9RA 3CJAA 5AQWA 1YJ9N 2A5XA 3LL3A 1VQON 4KHQA 4C23A 3CMAN 4DV0K 5CZ2A 5LY3A 5M1PA 5AQXA 3CC7N 3I8DA 3ZT0A 1HX1A 3ENHA 1JL1A 1YVNA 3KK3A 4V19S 2E1YA 3LDPA 4NCGA 3LDSA 5KGXA 4CD1A 3MN5A 1WSJA 2HVIA 4E89A 4CJLA 3V6DA 3RR8A 5FPDA 3OYIA 1NJYA 3EL2A 2IDOA 3L6QA 2HMIA 2D0OA 3E1YA 1S9EA 2RE2A 1XMOK 3HO1A 2VG6A 2R7YA 3HI0A 3K5LA 2D0AA 5HRRA 3OYMA 4JI4K 4JS4A 3TAFA 3NH1A 4CEAA 3LPTA 1N33K 3V9UA 3K58A 4DS5A 4GV6A 2UUBK 3AVMA 1M1KO 1SKSA 4CI6A 5ELZA 3CMEN 4CF9A 2G8VA 2P9KA 3P83D 3HZ6A 3ENBA 1RT2A 3VEWA 2X6NA 3UIQA 1YAGA 2GV9A 3IUCA 1ZBLA 4DTSA 3H08A 4PQUA 4CESA 1HKBA 3O4WA 4CJVA 4H0OA 2IOCA 1ZC6A 3MMVA 4HWIA 4GKKK 5J2NA 2FSKA 1ASUA 4CF0A 2Q97A 3ZEUB 1NOYA 4IEIA 2UU9K 1SL2A 5DMRA 3UE5A 4CJPA 2E2OA 3NF9A 3KLEA 2J4RA 3D2EA 3PX0A 3BUZB 3TTCA 3MEGA 5AFUH 1IBLK 2O8DA 3HRGA 1BUPA 1YUWA 1QQOA 4MO4A 1NGFA 4NO7A 3NH0A 1NK4A 3THYA 1BU6O 3MDQA 3VENA 1EWRA 2D4WA 4AHRA 4CK2A 4X62K 1BHLA 4WYBA 4LSNA 3I8BA 1NKCA 1CZBA 4M45A 4CHYA 1T3VA 5AJ3K 1CLQA 3GE1A 1O1WA 4K25A 2D1KA 5I9EB 2O8BB 3J7ZO 3CPWM 4CJ4A 2RHKA 4JKEA 1L3TA 4DSFA 3ZYYX 1KD1O 2O8CA 3OBWA 4HHTA 4BGBA 2NRVA 4CZKA 4OLAA 4W5RA 4A5BA 2VQEK 2HF3A 3T1HK 4H4OA 3CJ1A 4KI4A 1KCFA 2UXCK 2VWKA 2YCHA 1YVUA 2QWPA 1I94K 3GG4A 1TVRA 2I7NA 2ATQA 5GIOA 1BWFO 2OPPA 3AVKA 3RMBA 1D5AA 3HVRA 4B9TA 5AR0A 4FM2A 3TR8A 3U4LA 3L2VA 1ILYA 1XNRK 5AQKA 4OPAA 3OYGA 4ELUA 4BDYA 3OS0A 4AHCA 1CZ9A 3HXMA 3EN9A 3EE9A 1OH6A 1DKGD 5BPNA 1K73O 3VOVA 4M3ZA 4RWTA 3OJUA 1NGEA 2O8EB 4X65K 4NCBA 1VRTA 2P9PA 2DFFA 3QNOA 2QWOA 4Y1CA 2BTFA 3ZETB 3SMPA 4ID1A 4CEDA 4CHZA 2P9LB 4CZFA 3G71N 3KKSA 1EX4A 1SS6A 1T6DA 3TTDA 1HYVA 2PFUA 2B6AA 3FZKA 4PA1A 4FJ8A 3VEOA 1D4XA 1MWKA 4WQ4A 3HSTB 3C6UA 3SQ2A 2E2NA 3MCPA 2FBTA 1T05A 3RMDA 1N5YA 1RT1A 1JXEA 3SJJA 5AQTA 4PKHA 5LJVA 5JS1A 3QEWA 3Q7BA 3EZ5A 4LF6K 4A62A 3P4IA 3AAQA 4DKWA 1VHXA 3VMFB 2ZGYA 1E4FT 1MWMA 4DV6K 5KPTA 1RCHA 5GINA 1T6CA 4F9OA 1JL2A 2JWKA 1MU2A 1V4SA 5CYQA 4FJ9A 4CHPA 2G8KA 1NMNA 3VEYA 3TSPA 1BQNA 4DF4A 1VQLN 1KFSA 4FJMA 4WQ5C 2P5OA 2A6AA 3THWA 4NLCA 1U45A 4H8KA 4HVJA 3ULEA 1X3MA 3NAEA 5HRSA 1WSFA 2IIRA 4IZ9A 4DTRA 4DQSA 4IJAA 3SQ1A 4CE9A 4KTQA 3HM9A 4LY7A 2ZM6K 4ICLA 1IJJA 1BI4B 5DM6L 4CEOA 1SZ2A 3SZ2A 1BCOA 5HRNA 5BRDA 1OVQA 5AZIB 3RSEB 4CECA 3CG7A 3F73A 3IMXA 4G1QA 2ZWHA 1XC9A 1VQPN 2DPNA 3WNHA 3C6HA 1NGAA 3O5BA 3CJ9A 3A5OC 1RTDA 4EFHA 3ENOA 2KFNA 3EY1A 1Q18A 1W2BM 4CGJA 2GTDA 3AA5X 3HBTA 4NXNK 4JYAK 4LH5A 4IFVA 2IS3A 1KRPA 2WONA 3DRSA 4E3SA 4FJ5A 1VK0A 4B9QA 5LMUK 1C0GA 4CEEA 4CGFA 4CEFA 4LD0A 1NJWA 4KH5A 1RT4A 4FWKA 1YIJN 4K42A 4JRQA 4FJLA 3QBWA 4EZ9A 1VSKA 3DI6A 3TPQA 5JVGL 1XI1A 2PY5A 3VQ6A 2QWNA 4HTUA 3GDQA 3IFRA 4B9LA 4IFEA 1Q82O 4O0IA 5C25A 4H5NA 3S3OA 3BP8A 3B6PA 3SI6A 3CC4N 5AQVA 3ITHA 1VQ4N 3VGKA 1KVBA 1QVGM 3SPYA 2E2QA 2FSJA 4BRQA 3WXKA 4X64K 4RW7A 2Y1JA 4PL7A 4MFBA 1P90A 2ASMA 3LDQA 2NRHA 3NFAA 1NU0A 3P38A 4ILHA 3CCJN 1T03A 1NGHA 4DSKA 1S3XA 2BGGA 4JK9A 2OTLN 1RT7A 5FPMA 2HNZA 4ILJA 3M8QA 2HBLA 4JAXA 1FKOA 1JKHA 4A57A 4CGIA 4CJ3A 1TYQB 5M1OA 1LWFA 2PBDA 2F8SA 3PO5A 2OZMA 3DRRA 3PLAA 2X74A 3AY9A 3O9UA 2HOEA 3KWGA 5BN9A 1Q86O 2XRIA 2OA8A 2E4LA 3MXJA 5SWMA 3VA3A 3CXCM 5GAHP 3J80O 5HLFA 3IG1A 3SYZA 1NGJA 4BRGA 1ATNA 1NGDA 2YV0X 3L3UA 3O1WA 3W0LA 2YNHA 3AAPA 4DUZK 1U2VB 3AO1A 3AVCA 3PY8A 2HHVA 1UAXA 4FLWA 4HCCA 3OYCA 4EAHD 4FO0A 4DB3A 1KQSM 1B9FA 4NLBA 2Q2RA 3EYZA 3LDOA 2P51A 5KGWA 3SV3A 2P9NA 3VGLA 1NG9A 3DXKB 1HPZA 4G9ZA 3HVTA 1VQNN 1JLGA 4EP5A 3DLEA 3VETA 3CFRA 1TUUA 1VQ9N 4M3RA 4KO0A 4KHPK 2KHOA 2GWJA 3OYFA 3K5NA 4M7YA 3ZEUA 3OYLA 4K8XA 4ISFA 5FLXO 3KLHA 1QSYA 1VSEA 4NYFA 3WNFA 4YOYA 5I42A 3QLHA 1KXPA 1JCGA 1ASWA 2KKZA 2NNWA 4BWMA 1C0TA 1VSFA 2ITMA 3ZSXA 4BRMA 5LJWA 3FZFA 4L3QA 4DLGA 2YJEA 4M3XA 1S6PA 2P9UB 5EY4A 5HRPA 4YOVA 2KQ2A 1EKEA 3F9MA 3ZT3A 1KVAA 3TAGA 2Z1JA 5LL6Z 3IKMA 1S1TA 5HP1A 4PKGA 5FDLA 3AGRA 4JI7K 2PZSA 3PX4A 1GOCA 4DTJA 3RTVA 4E7IA 4M3YA 4ELTA 4O44A 5AQYA 4Z4FA 1F21A 1J9AA 4DR2K 2UUAK 4F3TA 2E1ZA 2O8BA 2B5JA 3JAMO 3U6FA 1HNXK 3NF8A 2W40A 2FBVA 3R8EA 4W5OA 3FFIA 3P31A 4M3WA 4JV5K 2QI2A 4J2BA 1YTUA 3WNGA 1N34K 4DCHA 1KAXA 1EETA 1JLCA 5BRFA 4OO1J 3M1FA 4CF8A 4OLBA 3WNEA 3R9PA 3ID6A 2QTDA 4OPHA 3BF3A 3E9PA 3QIOA 1NJIO 4YOXA 1DTQA 3VQ8A 4DV3K 5CHIA 4JI5K 1C0MA 3MX2A 3WEEA 3FE1A 1J53A 3LZJA 3VQDA 5AQNA 1FK9A 3LAKA 1Z05A 2OYQA 1BISA 5AQSA 4BRFA 3BY5A 1WAJA 3MX5A 4QAGA 4BY9C 2O8EA 3ZT1A 2OZSA 4GW6A 5JS2A 5T7BA 4BR5A 3ZETA 3O3FA 2O8FB 4AM7A 2P9LA 4U67L 4H5RA 4B3MK 1UA0A 4OX9K 3O1BA 5M1NA 4Z4EA 1HQUA 4MLEA 4BVOA 2DTUA 3VF6A 2YHBA 4FL9A 4IFYA 1NK7A 1HNZK 3OYDA 4JI2K 1EWQA 1RBSA 2FXUA 3LDNA 5AQQA 2F8TA 3ZSOA 2ZE2A 2VGNA 3OVNA 3T1YK 2I5JA 3K57A 4QS9A 5FRNA 3CQYA 3TSUA 1ASVA 2QKBA 4E7LA 3MN9A 3VESA 3LM2A 1S1XA 4DFMA 3THVA 5AQZA 2BE2A 3FZMA 3BDPA 1RBVA 4DQ8A 3JXUA 1HLUA 1HMVA 4BRPA 2HHHK 2A42A 4B9MA 4LFCK 2WUSA 3CM5A 4RW8A 3OW2M 1MDUB 4YDUA 3S3NA 4H0TB 3KK7A 3ISNC 2OANA 2OTJN 3R6MA 3ZSQA 4FWNA 3ULDA 4A2AA 4F3OA 1TK0A 3N4QA 2D0BA 1E4GT 1TKZA 3K9JA 2QWMA 4DSJA 1IKVA 3SAFA 5FPNA 4FLXA 1L5UA 1KTQA 4MLHA 4YORA 4H0VB 1BI4A 1CZAN 4DTNA 4HUEA 1SL0A 4FK4A 1A5VA 4JN4A 5AZIA 4FJHA 2F96A 3MECA 4OPJA 2HSTA 3V4IA 4WFNL 3WXMB 4CFCA 3IS9A 1NK9A 2P9SB 4OVLA 1U49A 1SKWA 4H0PA 4JKCA 3T3FA 1LWCA 3C6AA 4CJWA 4FJJA 3SMSA 1N36K 5KPZA 3NGZA 1RILA 3H46O 1EQYA 1TKDA 4BRIA 3O3HA 5CZ1A 1C0UA 4B1WB 1LAWA 1QHTA 4A59A 2JWLA 2E88A 4O8KA 4BRLA 4IBNA 3A8YA 5DK5A 4B3RK 4IKFA 1YJWN 4DLEA 3DLRA 1VSJA 4HCBA 1BIUA 1H1VA 3G10A 1QQCA 4JLHA 1T8EA 2VG7A 4PUOA 1LAVA 3O9SA 4Y1DA 3CQ8A 4AQYK 3CCEN 3ID8A 4B9UA 5HOOA 4YNQA 2OPQA 3NVKA 1BO5O 1QE1A 5C15A 3E9LA 3HM8A 3KD1E 4CJSA 1GLLO 3SUQA 4HUFA 3PV8A 3KVGA 3LAMA 3J8AA 4KV8A 3EZWA 2YHXA 4BRAA 4DSLA 4CJFA 3HPOA 5J2MA 3AVNA 3IRXA 4WE1A 2WTUA 5AQUA 4CIEA 4BC2A 2HHSA 3MWTA 5AZJB 3C7NB 1QZ6A 4HUGA 1S9GA 3QBXA 4Z0UA 4XH5A 1VQMN 4H5WA 2FSNA 2HHUA 4I2QA 1G99A 4BVPA 2RN2A 1GOBA 1TYQA 2GX9A 4E7KA 3G25A 1OKJA 5AFUA 3VPZA 1X9WA 1RT6A 2CH5A 2QW9A 3G4SN 1BCMA 4BRCA 1IG8A 3TSQA 3LWMA 4NCAA 3DXMB 2FBYA 4TSXA 4BREA 1RBUA 4AM6A 3NGIA 3D2FB 1P8ZA 4MDBA 3VQ9A 4JEPA 3UKUB 1C1AA 3H1VX 1BL3A 4CHOA 4CW7B 1VRUA 2NRWA 3CQXA 2NRTA 4B1ZA 4OGCA 4XEIA 1U2VA 2Q0UA 3VN5A 4RTFD 2VQFK 1QQMA 4BC3A 4Z4GA 3RR7A 3TI0A 4A61A 3P1GA 3C65A 4JHDA 3S3MA 3AV9A 3C95A 4F4KA 1X1PA 1IKWA 2V7YA 2NZTA 4CIFA 1NJZA 3DXKA 4M3UA 4BC5A 4CBUA 2ASPA 3W3DA 3TAPA 3K5MA 3QEPA 3HPGA 4BR0A 1BDGA 3VA0A 3VQPA 4M3TA 3NH2A 3MEDA 4DR6K 2PYLA 1Q81O 2HB5A 3KLIA 4FM1A 1VSIA 3NBPA 2VWJA 1RBRA 2HVHA 3AO3A 1SKRA 4DR7K 1KLMA 4CVNE 1BOTO 4YOTA 5E26A 3OYAA 1GLDG 1SQKA 1J6ZA 1WSIA 2P9UA 3KK2A 1GLEG 3ASMA 4B8CA 1RDDA 3CJ7A 1TL1A 4RW6A 2IVPA 3DJCA 1S1UA 1L3SA 4FW1A 1TKTA 4GVEA 3GL1A 3FFKB 2ZQBA 1QZ5A 1GLJO 4YHHK 3NCIA 1IV0A 4KTWA 4FPBA 2NUBA 1EP4A 2VYPA 3M3ZA 1HNVA 3NVMA 4JK8A 4CHQA 4CZJA 3NDKA 3K9KA 5KQDA 5F0XA 3L2QA 4CFAA 1NKBA 1VQ7N 2HHTA 2E20A 5KQ8A 2WC9A 2E2PA 2HMPA 2KTQA 4IWVA 2A3ZA 2ASOA 1D8YA 4CJKA 4FPAA 2Y1IA 4C8MA 1WN7A 1RDAA 1HYSA 3HP9A 1MA9B 2P5GA 1IBMK 4DTOA 1K8AO 4JI3K 2FF3B 2EHGA 4LH4A 3QEVA 4FJGA 1FJGK 2QXFA 3OYJA 2P9KB 4WQ5A 4KKOA 5BREA 2CGLA 1J5OA 4QS8A 3PSIA 3K59A 2Q3SA 4CJEA 2YNGA 2IAJA 5EOYA 4JD2B 1S6QA 1IO2A 4AHTA 1QVFM 1D9DA 3A5LC 1IG9A 3SNNA 2V52B 2GWKA 4ID5A 1LOTB 3I33A 3SBTA 2IVOA 5KPRA 3AA2A 3R3LA 3AA3A 3L4QA 3L4IA 3ZSWA 4M41A 4CZMA 4GV3A 3T19A 3CFOA 3LP0A 2BH1A 1RDBA 3VQ4A 2YHYA 1NGCA 4R5PA 1ITGA 3AVAA 3WQUA 1E3MA 1V4TA 3CF5L 3S41A 1HR0K 5J2PA 1WSGA 4KAZA 3SUOA 4BRNA 4YOUA 3SCXA 4FW2A 3ATVA 4F2RA 4JNEA 3QESA 1CXQA 2FC0A 4E1JA 4PY5A 2YX6A 3SJHA 4FWRA 3O4QA 3VF4A 4KPYA 3JS6A 1W0HA 4M42A 2AP1A 1A5XA 4N41A 4FZYA 3WT0A 3OTOK 3TWHA 1X9SA 4FWOA 1ESVA 3AA4A 4BE2A 3SAGA 5SZTA 4CZLA 4I9QA 1VAZA 3AO5A 4BE1A 3KLGA 3VQEA 4GMJB 4CEZA 3TAMA 4CFDA 4WFBL 1C1BA 2B4JA 5FROA 5F2RA 3AGKA 4B08A 3OY9A 1XHZA 3CCUN 4FYDA 3CHWA 3TANA 1NWKA 5CE3A 3KWIA 3FZLA 1ATRA 1N32K 1LW0A 1U4BA 2W6KA 4ZTJA 5EX5A 2GELA 3D45A 3ZSZA 3SQ0A 3VTIA 5BN8A 4H5TA 3ZSVA 3A5MC 1YTAA 4LSLA 4CJQA 4W5NA 2QWRA 1VSMA 3OA9A 3DLKA 3K5OA 2QM1A 3VEXA 5DM7L 4CD3A 2DY4A 2G8WA 5BRHA 1HPMA 2QWQA 1ZXOA 1SUQA 4X66K 1TAUA 1TKXA 5JLHA 1C0FA 2P9SA 4L8RB 4J8FA 3VERA 1OH8A 4FWSA 1RDWX 2ITGA 5GAGP 4QS7A 1ZBIA 5E84A 5EU7A 4H4MA 1J54A 3I56N 3KLFA 1HYZA 4ISEA 5FPEA 2Z1GA 4B1YB 3OYEA 1TK5A 3C0BA 3CFPA 4CJ5A 1U47A 3F9KA 4CZIA 1NK0A 2HBMA 2WBNA 4IG0A 3QDKA 1T44A 4KHUA 3D6RA 4CBWA 2QXLA 3I0RA 1YXQA 3B8AX 4B3SK 5AQRA 3OYKA 5GADP 4KTZA 4F2SA 5A2QO 2G8HA 4FJXA 3KJVA 1LWEA 1RGIA 3LWLA 2RKIA 3D7EO 4B8AB 4XH4A 2CGJA 3LZIA 2LSNA 3H3NO 5MLCQ 3U8XA 3OYHA 3UKRB 3DM2A 3OJSA 1UA1A 1K8KB 4DUYK 3TU5A 4FZXC 4CEBA 3DLGA 4KB1A 4I6MB 5AQOA 5FRMA 2YHWA 2I7PA 1GLBG 4RG8A 4KHWA 3VQCA 2ZJQL 4FWPA 1DGKN 3BGRA 4BRKA 4I2PA 1JCEA 3D0PA 1NK8A 4C8NA 1R0AA 2GBZA 3THWB 1NNEA 3E66A 4KREA 5ADXH 1XWLA 4O55A 3C7NA 4K41A 4E1MA 4DFJA 4E1NA 2G8UA 1UWBA 4CHNA 5GIPA 4DQIA 1BA0A 4CERA 3V81A 2ZGZA 3LP3A 5TKYA 3QNNA 5D3GA 4DR1K 3ZX0A 1VQ5N 2P9IB 1YITN 3DXMA 1HUXA 3G6EN 1D9FA 4N47A 1N6QA 4Z4CA 3RWUA 4KHYA 5H1SQ 3D2FA 4FXDA 3NMUA 2QA4N 3CM6A 3CCRN 3UKUA 1B92A 2PYJA 4B1UB 3PIPL 2Z1IA 2A41A 4JKBA 4JK7A 4FJKA 1RTIA 4Z94A 1U48A 2W42A 3V9ZA 4K8ZA 3F2KA 5BR8K 3QICA 3AO2A 3VQQA 3O8MA 1XUPO 3AVJA 3CCVN 3BZCA 1IBKK 1Q8IA 3NGYA
chains in the Genus database with same CATH topology
3VGMA 3ULEA 4RCHA 1X3MA 3CJCA 2IIRA 4IZ9A 1OVYA 3O9SA 2HBKA 2Q1NA 1S22A 3CCEN 4IJAA 4ILGB 3ID8A 4HTLA 3IDHA 4PL8A 5HOOA 2IVNA 3VF2A 3CJBA 3O9TA 1Q7YO 3NVKA 1IJJA 1BO5O 1NM1A 3N4PA 5C15A 3CCLN 4B1VA 2P9PB 3E9LA 3HM8A 1HJOA 3EO3A 5DM6L 3VEZA 1GLLO 4WF9L 2Q31A 3KVGA 3J8AA 1SZ2A 4CZHA 4BG9A 5BRDA 3EZWA 5AZIB 3RSEB 2YHXA 4JKGA 4BRAA 2YJFA 3IMXA 3T7ZA 3AARA 3WXLA 2ZWHA 5AQUA 4BC2A 3U9ZA 1QHAA 4JHDB 3MWTA 5AZJB 3C7NB 1QZ6A 2DPNA 1VQPN 2NLXA 2E8AA 3C6HA 3QBXA 3CD6N 4XH5A 1VQMN 1NGAA 1JCFA 3O5BA 2FSNA 4H5WA 3CJ9A 1G99A 1LCUA 3A5OC 4BVPA 3H45C 1TYQA 2GX9A 4EFHA 3ENOA 4BRHA 1Z6RA 5M1KA 3G25A 1OKJA 4PKIA 5AFUA 1Q18A 3VEVA 3MN6A 1Y64A 3MWPA 1EO1A 3SK3A 4O8UA 3VPZA 3F5TA 1W2BM 3SAHA 4BRDA 2GTDA 5C0YA 2CH5A 2QW9A 3HBTA 3G4SN 4O5FA 4BRCA 1IG8A 3TSQA 1KAYA 5C2DA 3DXMB 4BREA 4AM6A 1GLFO 1NMDA 1P8ZA 3D2FB 4MDBA 1HKCA 4B9QA 4JEPA 1C0GA 3UKUB 4KH5A 3HOTA 3WXJA 4EIAA 3H1VX 4FWKA 1YIJN 3CCSN 3O9QA 4K42A 1ATSA 2NRWA 3CQXA 2NRTA 4B1ZA 4XEIA 4H5VA 1U2VA 3QBWA 2Q0UA 4RTFD 4B1XB 5JVGL 3MCAB 3TPQA 4FWMA 2V7ZA 2QWNA 1QQMA 3GDQA 3RSEA 4BC3A 3IFRA 4IFEA 1Q82O 4H5NA 4A61A 3BP8A 3ULEB 3DLLL 3CC4N 5AQHA 4IO8A 3C65A 4JHDA 3KHYA 5AQVA 3VGKA 5AZJA 1NGGA 1VQ4N 1YHQN 1QVGM 2Q36A 2E2QA 2FSJA 2PAVA 2V7YA 2NZTA 2VCPA 3UB5A 3WXKA 4BRQA 1BG3A 4R79A 1KC8O 1BA1A 3CI5A 3CPEA 3DXKA 2Q0RA 3HSCA 4AF1A 4PL7A 3OBYA 4BC5A 4CBUA 4CZGA 2ASPA 3W3DA 3CERA 3CCQN 1P90A 2ASMA 3LDQA 1X3NA 2NRHA 1VQ8N 3P38A 3CCJN 4ILHA 4CJ7A 1NGHA 3H3OB 4JKAA 2H3GX 1S3XA 2UYTA 1BDGA 1R59O 4BR0A 5F1XA 1O13A 2QEXN 4JKGB 4JK9A 3VTHA 4FVUA 2ZJRL 2OTLN 5FPMA 4H0XB 1X9JA 4IOCL 1VQKN 2QWLA 3H1QA 5M1FA 5JICA 3EKSA 4A2BA 4ILJA 1Q81O 2HBLA 4JAXA 3A0IX 5AQGA 2P9NB 4A57A 4IXCA 2GEMA 4JD2A 4A5AA 1TYQB 5M1OA 4LC9B 4C1NK 1XC3A 2PBDA 2WFBA 1BOTO 4YOTA 5E26A 3ATUA 5M1QA 1GLDG 1SQKA 1J6ZA 2P9UA 3FLCO 1GLEG 4XH1A 5AQJA 3PLAA 3LDLA 3CJ7A 3AY9A 3O9UA 2CGKA 4JKFA 3CC2N 3T69A 3U9DA 2HOEA 5ADXA 4BROA 2IVPA 3DJCA 3KWGA 4KBOA 4GVEA 5BN9A 2F9WA 3GL1A 3FFKB 1Q86O 2VWBA 1S72N 5AQLA 3BF1A 1M90O 1QZ5A 1GLJO 4FSVA 3CXCM 5GAHP 1DEJA 3MK6A 1NGJA 2A40A 4YDUC 1ATNA 4BRGA 1NGDA 4FPBA 5BPMA 3O1WA 2VYPA 3W0LA 1TUYA 3AAPA 3M3ZA 3NVMA 1U2VB 2YI1A 4JK8A 5BPLA 4CZJA 4IO9L 1GLAG 3K9KA 5GAEP 5KQDA 5F0XA 4EAHD 4FO0A 4DB3A 1VQ7N 3QB0A 1KQSM 2E20A 4NLBA 5KQ8A 2WC9A 2E2PA 1HKGA 2Q2RA 3CCMN 2HMPA 3LDOA 4IWVA 3SBGA 2A3ZA 2ASOA 5EVZA 1VQ6N 2CH6A 2GUPA 3FZHA 5AQFA 4KH6A 2P9NA 4FPAA 4KH4A 3VGLA 1KAZA 1MA9B 3QFPA 3O9RA 3DXKB 4MDAA 3SLCA 2FF3B 3CJAA 5AQWA 3WQTA 4CBXA 1K8AO 1VQNN 4G9ZA 1YJ9N 2A5XA 3LL3A 1VQON 4C23A 5JMVA 3CMAN 3VETA 4BQZA 1TUUA 5LY3A 1VQ9N 2P9KB 5M1PA 2KHOA 4WFAL 5AQXA 2GWJA 4WQ5A 3CC7N 4U7BA 4M7YA 3ZEUA 4WQ4C 4ISFA 1HX1A 1YF5L 1K9MO 3ENHA 1YVNA 4YOYA 2E1YA 3LDPA 5BREA 2CGLA 1KXPA 1JCGA 4QS8A 2HBJA 4CD1A 3MN5A 2KKZA 2NNWA 4BC4A 5FPDA 5EOYA 4JD2B 1YI2N 1QVFM 3EL2A 2ITMA 3A5LC 3L6QA 3EE8A 4BRMA 3FZFA 4L3QA 5LJWA 2D0OA 2YJEA 2V52B 2GWKA 3E1YA 1LOTB 3I33A 3SBTA 4MO5A 2P9UB 5EY4A 2IVOA 4YOVA 5KPRA 1RDUA 2RE2A 5AQPA 3F9MA 3R3LA 3HI0A 3WEEB 2NRRA 3L4QA 3L4IA 2AA4A 3QFUA 2F9TA 4CZMA 4GV3A 3IKMA 2ZF5O 4JKDA 4BQLA 4PKGA 5TKWA 2BH1A 3AGRA 3WUHA 1QQNA 2YHYA 1NGCA 4M7XA 3RVCA 3WQUA 1V4TA 3CF5L 3S41A 4GV6A 5AQYA 3BEXA 3DWLA 2E1ZA 3MN7A 1M1KO 4BRNA 4YOUA 4CI6A 3ATVA 4JNEA 5ELZA 2W40A 3CMEN 2BUPA 3R8EA 2P9KA 4E1JA 3EKUA 3HZ6A 2YX6A 3P31A 4FWRA 3ENBA 3SJHA 3VF4A 1DT9A 2QI2A 3VEWA 2FLOA 3JS6A 1YAGA 3ZX2A 2AP1A 3IUCA 1GLCG 3P39A 4DCHA 1KAXA 1H1VA 3WT0A 1HKBA 4EHUA 1NGBA 1XQSC 4FWOA 5BRFA 4OO1J 2W41A 3M1FA 1ESVA 3O4WA 4H0OA 3ID6A 4IDHA 5AQMA 3R9PA 4H03B 3SAGA 1ZC6A 2QTDA 4C1NI 3A5NC 1VAZA 3CIPA 4CZLA 4OPHA 3MMVA 4HWIA 2D0PA 3BF3A 4PHTX 4K43A 3E9PA 5BR9A 4YOXA 1NJIO 4WFBL 3FGUA 5C10A 5CHIA 3MX2A 3UKRA 2FSKA 5F2RA 3WEEA 3AGKA 3FE1A 2Q97A 3M5RA 3ZEUB 5JVHL 1K8KA 5AQNA 3CCUN 4FWQA 3CHWA 4IEIA 1NWKA 5CE3A 1Z05A 3FZLA 3KWIA 4H0YB 4I6MA 3UE5A 1ATRA 3L0QA 5AQSA 2E2OA 4BRFA 3MX5A 4BY9C 2J4RA 3HTVA 5EX5A 3D2EA 1NLVA 2GELA 3DAWA 3BUZB 3VTIA 4BR5A 5BN8A 3ZETA 4H5TA 3A5MC 3TTCA 5AFUH 4AM7A 2P9LA 3WXIA 4U67L 2QWRA 1U6ZA 3HRGA 3OA9A 1BUPA 1YUWA 1QQOA 4H5RA 1NGFA 4MO4A 4NO7A 4BR9A 2QM1A 3VEXA 5DM7L 4CD3A 3KZBA 5BRHA 5HL7L 1BU6O 2FF6A 1HPMA 3MDQA 3VENA 3Q7CA 2QWQA 1ZXOA 3O1BA 3FR0A 4JKHA 2V51B 2D4WA 4GNIA 5JLHA 5M1NA 1C0FA 2P9SA 4WYBA 4J8FA 4MLEA 3VERA 4BVOA 3GBTA 3I8BA 4FWSA 1RDWX 3VF6A 4FL9A 1T3VA 5GAGP 1NGIA 4QS7A 3GE1A 4K25A 5E84A 4WCEL 4IOXA 2D1KA 2FXUA 3E9OA 3LDNA 5AQQA 5I9EB 3J7ZO 3I56N 2P9IA 4ISEA 1WOQA 5FPEA 3CPWM 2VGNA 2RHKA 3O08A 4JKEA 4QS9A 4B1YB 4IOAL 3CQYA 3TSUA 3ZYYX 1KD1O 3C0BA 3OBWA 3R1XA 3MN9A 3VESA 2NRVA 4BGBA 3LM2A 4CZKA 4CZIA 2HBMA 4A5BA 2WBNA 5AQZA 2HF3A 3TTFA 3ZX3A 3QDKA 1T44A 1RFQA 3CJ1A 3FZMA 3D6RA 4CBWA 2YCHA 2QXLA 4DQ8A 1YXQA 3B8AX 2QWPA 2ZJPL 3GG4A 5AQRA 3JXUA 2I7NA 1HLUA 4BRPA 5GIOA 2A42A 5GADP 1BWFO 2WUSA 1JJ2M 2KLAA 5AR0A 3OW2M 3U4LA 1MDUB 4YDUA 1RGIA 1ILYA 4H0TB 5AQKA 3HOSA 4IJNA 3D7EO 3KK7A 4OPAA 2OANA 4BR7A 4XH4A 2CGJA 1YJNN 2OTJN 3R6MA 3H3NO 4FWNA 3H6EA 4A2AA 4CZEA 3U8XA 5MLCQ 3N4QA 4YOWA 3UKRB 3EN9A 3OHRA 1K8KB 3EE9A 1E4GT 3TU5A 1DKGD 5BPNA 1K73O 4BR2A 3K9JA 4I6MB 5AQOA 2QWMA 3VOVA 2YHWA 1W97L 4GV9A 2I7PA 1GLBG 4RWTA 3SAFA 2ZJQL 5FPNA 1NGEA 4MLHA 4YORA 5C2FA 5CR4A 4H0VB 1CZAN 2P9PA 1DGKN 3D2EB 4FWPA 4BRKA 2QWOA 3CETA 4ISGA 4BG8A 3O6WA 2BTFA 3ZETB 1JCEA 3PIOL 3SMPA 5EXWA 2VGMA 4BR4A 4FOIA 3LM9A 4JN4A 2P9LB 5AZIA 3M6GA 4M63C 4CZFA 3G71N 3GOIA 2HSTA 1SS6A 4WFNL 1T6DA 3E66A 3I55N 4UY8O 3TTDA 5ADXH 2PFUA 3C7NA 3FZKA 4K41A 2F7TA 3VEOA 3WXMB 1D4XA 1MWKA 4WQ4A 2P9SB 2E2NA 3QMLA 3MCPA 5GIPA 1SAZA 5JLFA 1BA0A 4H0PA 4IEEA 2ZGZA 5TKYA 4JKCA 3C6AA 3ZX0A 1VQ5N 4FOEA 3SMSA 2P9IB 1YITN 5AQTA 4PKHA 2EWSA 3DXMA 1HUXA 3Q7BA 5KPZA 5LJVA 4A62A 3G6EN 3P4IA 3AAQA 4DKWA 3VMFB 3H46O 3D2FA 1EQYA 1NBWA 2ZGYA 5H1SQ 2QA4N 1E4FT 3NMUA 1MWMA 5KPTA 4BRIA 1N8RO 3CCRN 3UKUA 2HF4A 4B1UB 5GINA 3PIPL 4GY2B 2A41A 5B8HA 1T6CA 4JKBA 4B1WB 4JK7A 4F9OA 4DHYA 4A59A 2JWKA 4Z94A 2JWLA 2E88A 4NB4A 4O8KA 4BRLA 4Y0WA 1V4SA 3A8YA 4BGAA 1ZBSA 5AQIA 1YJWN 3F2KA 3VEYA 3TSPA 4FWLA 2NRZA 4EHTA 3QICA 1VQLN 1WUAA 4WQ5C 3O8MA 1XUPO 2A6AA 4NLCA 3O80A 3CCVN 5C12A 2NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGM A;  3ULE A;  4RCH A;  1X3M A;  3CJC A;  2IIR A;  4IZ9 A;  2Q1N A;  1S22 A;  4IJA A;  3ID8 A;  4HTL A;  3IDH A;  4PL8 A;  2IVN A;  3VF2 A;  3CJB A;  1IJJ A;  1BO5 O;  1NM1 A;  4B1V A;  2P9P B;  3HM8 A;  1HJO A;  3EO3 A;  3VEZ A;  1GLL O;  2Q31 A;  3KVG A;  3J8A A;  1SZ2 A;  4CZH A;  4BG9 A;  5BRD A;  3EZW A;  5AZI B;  3RSE B;  2YHX A;  4BRA A;  2YJF A;  3IMX A;  3WXL A;  3AAR A;  2ZWH A;  5AQU A;  4BC2 A;  3U9Z A;  1QHA A;  4JHD B;  5AZJ B;  3C7N B;  1QZ6 A;  2DPN A;  2NLX A;  2E8A A;  3QBX A;  4XH5 A;  1NGA A;  1JCF A;  3O5B A;  2FSN A;  4H5W A;  3CJ9 A;  1G99 A;  1LCU A;  3A5O C;  4BVP A;  3H45 C;  1TYQ A;  4EFH A;  3ENO A;  4BRH A;  1Z6R A;  3G25 A;  1OKJ A;  4PKI A;  5AFU A;  1Q18 A;  3VEV A;  3MN6 A;  1Y64 A;  3SK3 A;  3VPZ A;  4BRD A;  2GTD A;  2CH5 A;  2QW9 A;  3HBT A;  4O5F A;  4BRC A;  1IG8 A;  1KAY A;  3DXM B;  4BRE A;  4AM6 A;  1GLF O;  1NMD A;  1P8Z A;  3D2F B;  1HKC A;  4B9Q A;  1C0G A;  3UKU B;  3WXJ A;  4EIA A;  3H1V X;  4FWK A;  4K42 A;  1ATS A;  3CQX A;  4B1Z A;  4XEI A;  4H5V A;  1U2V A;  3QBW A;  2Q0U A;  4RTF D;  4B1X B;  3TPQ A;  4FWM A;  2V7Z A;  2QWN A;  1QQM A;  3GDQ A;  3RSE A;  4BC3 A;  3IFR A;  4H5N A;  4A61 A;  3BP8 A;  3ULE B;  5AQH A;  4IO8 A;  4JHD A;  5AQV A;  3KHY A;  3VGK A;  5AZJ A;  1NGG A;  2Q36 A;  2E2Q A;  2FSJ A;  2PAV A;  2V7Y A;  2NZT A;  2VCP A;  3UB5 A;  3WXK A;  4BRQ A;  1BG3 A;  1BA1 A;  3CI5 A;  3DXK A;  2Q0R A;  3HSC A;  4PL7 A;  4BC5 A;  4CBU A;  4CZG A;  2ASP A;  3W3D A;  3CER A;  2ASM A;  3LDQ A;  1X3N A;  2NRH A;  4CJ7 A;  1NGH A;  3H3O B;  2H3G X;  1S3X A;  2UYT A;  1BDG A;  1R59 O;  4BR0 A;  5F1X A;  5FPM A;  4H0X B;  1X9J A;  2QWL A;  3H1Q A;  5JIC A;  3EKS A;  4A2B A;  4JAX A;  5AQG A;  3A0I X;  2P9N B;  4IXC A;  2GEM A;  4JD2 A;  1TYQ B;  4LC9 B;  1XC3 A;  2PBD A;  1BOT O;  5E26 A;  3ATU A;  1GLD G;  1SQK A;  1J6Z A;  2P9U A;  3FLC O;  1GLE G;  4XH1 A;  5AQJ A;  3LDL A;  3CJ7 A;  3AY9 A;  2CGK A;  3U9D A;  2HOE A;  5ADX A;  4BRO A;  2IVP A;  3DJC A;  4KBO A;  5BN9 A;  2F9W A;  3GL1 A;  3FFK B;  2VWB A;  5AQL A;  3BF1 A;  1QZ5 A;  1GLJ O;  4FSV A;  1DEJ A;  3MK6 A;  1NGJ A;  2A40 A;  4YDU C;  1ATN A;  4BRG A;  1NGD A;  4FPB A;  5BPM A;  3O1W A;  2VYP A;  3W0L A;  1TUY A;  3AAP A;  3M3Z A;  1U2V B;  2YI1 A;  5BPL A;  4CZJ A;  1GLA G;  5KQD A;  5F0X A;  4EAH D;  4FO0 A;  4DB3 A;  3QB0 A;  2E20 A;  5KQ8 A;  2E2P A;  1HKG A;  2Q2R A;  2HMP A;  3LDO A;  4IWV A;  2A3Z A;  2ASO A;  5EVZ A;  2CH6 A;  2GUP A;  3FZH A;  5AQF A;  2P9N A;  4FPA A;  3VGL A;  1KAZ A;  1MA9 B;  3QFP A;  3WQT A;  3DXK B;  3SLC A;  2FF3 B;  3CJA A;  5AQW A;  4CBX A;  2A5X A;  3LL3 A;  4C23 A;  5JMV A;  3VET A;  4BQZ A;  1TUU A;  5LY3 A;  2P9K B;  2KHO A;  5AQX A;  2GWJ A;  4WQ5 A;  4M7Y A;  3ZEU A;  4WQ4 C;  4ISF A;  1HX1 A;  3ENH A;  1YVN A;  2E1Y A;  3LDP A;  5BRE A;  2CGL A;  1KXP A;  1JCG A;  4QS8 A;  4CD1 A;  3MN5 A;  4BC4 A;  5FPD A;  5EOY A;  4JD2 B;  3EL2 A;  2ITM A;  3A5L C;  3L6Q A;  4BRM A;  5LJW A;  3FZF A;  4L3Q A;  2D0O A;  2YJE A;  2V52 B;  2GWK A;  1LOT B;  3I33 A;  4MO5 A;  2P9U B;  5EY4 A;  2IVO A;  5KPR A;  5AQP A;  3F9M A;  3HI0 A;  3WEE B;  3L4I A;  2AA4 A;  3QFU A;  2F9T A;  4CZM A;  2ZF5 O;  4BQL A;  4PKG A;  3WUH A;  1QQN A;  2YHY A;  1NGC A;  4M7X A;  3WQU A;  1V4T A;  3S41 A;  5AQY A;  3BEX A;  3DWL A;  2E1Z A;  3MN7 A;  4BRN A;  4CI6 A;  3ATV A;  4JNE A;  5ELZ A;  2W40 A;  2BUP A;  3R8E A;  2P9K A;  4E1J A;  3EKU A;  3HZ6 A;  3SJH A;  4FWR A;  3VF4 A;  3VEW A;  2FLO A;  3JS6 A;  1YAG A;  3ZX2 A;  2AP1 A;  3IUC A;  1GLC G;  4DCH A;  1KAX A;  3WT0 A;  1HKB A;  4EHU A;  1NGB A;  1XQS C;  4FWO A;  5BRF A;  2W41 A;  3M1F A;  1ESV A;  3O4W A;  4H0O A;  5AQM A;  3R9P A;  4H03 B;  1ZC6 A;  4CZL A;  3A5N C;  3CIP A;  3MMV A;  4HWI A;  2D0P A;  3BF3 A;  4K43 A;  5BR9 A;  3FGU A;  3UKR A;  2FSK A;  5F2R A;  3WEE A;  3FE1 A;  2Q97 A;  3ZEU B;  1K8K A;  5AQN A;  4FWQ A;  3CHW A;  1NWK A;  5CE3 A;  1Z05 A;  3FZL A;  4H0Y B;  4I6M A;  3UE5 A;  1ATR A;  3L0Q A;  5AQS A;  2E2O A;  4BRF A;  2J4R A;  3HTV A;  5EX5 A;  3D2E A;  1NLV A;  2GEL A;  3DAW A;  3BUZ B;  4BR5 A;  5BN8 A;  3ZET A;  4H5T A;  3A5M C;  5AFU H;  4AM7 A;  2P9L A;  3WXI A;  2QWR A;  1U6Z A;  1BUP A;  1YUW A;  1QQO A;  4H5R A;  1NGF A;  4MO4 A;  4NO7 A;  4BR9 A;  2QM1 A;  3VEX A;  4CD3 A;  3KZB A;  5BRH A;  1BU6 O;  2FF6 A;  1HPM A;  3MDQ A;  3VEN A;  2QWQ A;  1ZXO A;  3O1B A;  3FR0 A;  2V51 B;  2D4W A;  4GNI A;  5JLH A;  1C0F A;  2P9S A;  4WYB A;  4J8F A;  4MLE A;  3VER A;  4BVO A;  3GBT A;  3I8B A;  4FWS A;  1RDW X;  3VF6 A;  4FL9 A;  1NGI A;  4QS7 A;  3GE1 A;  4K25 A;  5E84 A;  2D1K A;  2FXU A;  3LDN A;  5AQQ A;  5I9E B;  2P9I A;  4ISE A;  1WOQ A;  5FPE A;  3O08 A;  4B1Y B;  4QS9 A;  3CQY A;  3C0B A;  3MN9 A;  3VES A;  4BGB A;  4CZK A;  3LM2 A;  4CZI A;  5AQZ A;  2HF3 A;  3ZX3 A;  3QDK A;  1T44 A;  1RFQ A;  3CJ1 A;  3FZM A;  4CBW A;  2YCH A;  2QXL A;  4DQ8 A;  1YXQ A;  3B8A X;  2QWP A;  3GG4 A;  5AQR A;  3JXU A;  2I7N A;  1HLU A;  4BRP A;  2A42 A;  1BWF O;  2WUS A;  5AR0 A;  3U4L A;  1MDU B;  4YDU A;  1RGI A;  4H0T B;  5AQK A;  4IJN A;  3D7E O;  2OAN A;  4BR7 A;  4XH4 A;  2CGJ A;  3R6M A;  3H3N O;  4FWN A;  3H6E A;  4A2A A;  4CZE A;  3U8X A;  3UKR B;  3EN9 A;  3OHR A;  1K8K B;  1E4G T;  3TU5 A;  1DKG D;  5BPN A;  4BR2 A;  4I6M B;  3VOV A;  5AQO A;  2QWM A;  2YHW A;  2I7P A;  1GLB G;  4RWT A;  5FPN A;  1NGE A;  4MLH A;  4H0V B;  1CZA N;  2P9P A;  1DGK N;  3D2E B;  4FWP A;  4BRK A;  2QWO A;  3CET A;  4ISG A;  4BG8 A;  3O6W A;  2BTF A;  3ZET B;  1JCE A;  3SMP A;  5EXW A;  4BR4 A;  4FOI A;  3LM9 A;  4JN4 A;  2P9L B;  5AZI A;  3M6G A;  4M63 C;  4CZF A;  3GOI A;  1T6D A;  5ADX H;  3C7N A;  3FZK A;  4K41 A;  3VEO A;  1D4X A;  1MWK A;  4WQ4 A;  2P9S B;  2E2N A;  3QML A;  3MCP A;  1SAZ A;  5JLF A;  1BA0 A;  4H0P A;  2ZGZ A;  5TKY A;  3ZX0 A;  4FOE A;  3SMS A;  2P9I B;  5AQT A;  4PKH A;  2EWS A;  3DXM A;  1HUX A;  5KPZ A;  5LJV A;  4A62 A;  3P4I A;  3AAQ A;  3H46 O;  3D2F A;  1EQY A;  1NBW A;  2ZGY A;  1E4F T;  1MWM A;  5KPT A;  4BRI A;  3UKU A;  2HF4 A;  4B1U B;  4GY2 B;  2A41 A;  5B8H A;  1T6C A;  4B1W B;  4F9O A;  4DHY A;  4Z94 A;  2E88 A;  4NB4 A;  4O8K A;  4BRL A;  4Y0W A;  1V4S A;  3A8Y A;  4BGA A;  1ZBS A;  5AQI A;  3VEY A;  4FWL A;  4EHT A;  3QIC A;  1WUA A;  4WQ5 C;  3O8M A;  1XUP O;  2A6A A;  3O80 A;  1H1V A; 
#chains in the Genus database with same CATH topology
 3VGM A;  3KKR A;  3AVB A;  4Z4I A;  1OVY A;  2Q1N A;  2KZM A;  2HHX A;  4ILG B;  4E7H A;  4PL8 A;  3IDH A;  4FJN A;  1Q7Y O;  5KRS A;  4DV4 K;  1BQM A;  1NM1 A;  3N4P A;  4EP4 A;  4FK2 A;  3CCL N;  1W9H A;  4B1V A;  2QKK A;  1HJO A;  3EO3 A;  3I0S A;  4WF9 L;  1HNI A;  1DLO A;  3QIP A;  4O0J A;  3THX B;  4CZH A;  3ZLJ A;  2RPI A;  3O3G A;  4DWI A;  1VSL A;  4DQQ A;  1C6V A;  3T7Z A;  1XHX A;  3AAR A;  3V1Q A;  4Q5V A;  2DFH A;  3AVF A;  3U9Z A;  2XY5 A;  1QHA A;  3LP1 A;  3LAL A;  1JXB A;  4OKK A;  1LW2 A;  3AVH A;  4QOZ B;  1KVC A;  4DV5 K;  4BRH A;  4CFB A;  2IC3 A;  4CGD A;  1YT3 A;  3VEV A;  3MWP A;  3SK3 A;  4O8U A;  4LF7 K;  3LP2 A;  1ZYQ A;  1T7P A;  2X6S A;  2OCE A;  4BE0 A;  1GOA A;  1GLF O;  4JI6 K;  5C42 A;  4K0K K;  4DR4 K;  4PWD A;  3L2W A;  2HHW A;  4DR3 K;  1UOC A;  3CYM A;  4CGG A;  4AH9 A;  3OYN A;  3RRG A;  1RT5 A;  3WXJ A;  3ZCM A;  4EIA A;  3CCS N;  3DOK A;  5KRT A;  4MQ3 A;  4H5V A;  3ZSY A;  1RTJ A;  4B1X B;  1K6Y A;  3QEI A;  3MCA B;  1A5W A;  4FWM A;  3RSE A;  4OKJ A;  1CXU A;  3DLL L;  1RNH A;  4IO8 A;  4XIU A;  1NGG A;  4LF9 K;  1YHQ N;  3UB5 A;  4R79 A;  1BG3 A;  1XMQ K;  3HSC A;  4C8K A;  3C6T A;  4AF1 A;  3BZK A;  3OBY A;  4CZG A;  1QSS A;  3CER A;  3CCQ N;  1X3N A;  2IGI A;  4CJ7 A;  2O4G A;  5F1X A;  2UXD K;  1O13 A;  3AVG A;  3QER A;  2QEX N;  3DRP A;  4JKG B;  1XNQ K;  2F4V K;  3OS1 A;  1L3V A;  4IOC L;  1X9J A;  2KFZ A;  2QWL A;  2UXB K;  5CYM A;  2G8F A;  4BWJ A;  3EKS A;  5JIC A;  5AQG A;  2XHB A;  2P9N B;  4JI8 K;  3HL8 A;  1FKP A;  4JD2 A;  4A5A A;  3K2P A;  4C1N K;  3HT3 A;  4CEQ A;  1XC3 A;  5I3U A;  2WFB A;  3L2R A;  1NK5 A;  4CCH A;  4KI6 A;  3ATU A;  3FLC O;  2P1J A;  1WLJ A;  4XH1 A;  5AQJ A;  3LDL A;  3SUP A;  2CGK A;  4JKF A;  4BRO A;  4KHS A;  4KBO A;  2F9W A;  3SQ4 A;  4LF4 K;  2A1S A;  2GUI A;  5BPM A;  1TL3 A;  1TUY A;  3ZT2 A;  5BPL A;  4N5S A;  4J2A A;  4CF1 A;  5GAE P;  4N56 A;  2QK9 A;  3QB0 A;  3CCM N;  1NJX A;  2HNY A;  3M8S A;  2XY6 A;  3SBG A;  3FZH A;  5AQF A;  4FJ7 A;  4KH6 A;  3RMC A;  3WQT A;  4MDA A;  3SLC A;  4CBX A;  1QSL A;  4I9L A;  2A1R A;  5J1E A;  5JMV A;  2E6M A;  4BQZ A;  1WAF A;  1TAQ A;  4WFA L;  4U7B A;  4WQ4 C;  1YF5 L;  4FLV A;  1K9M O;  1S1V A;  4DTX A;  3M8P A;  2HBJ A;  3P5J A;  4CJT A;  1X9M A;  4B9N A;  4BC4 A;  3DLH A;  3QEX A;  1YI2 N;  3EE8 A;  4MO5 A;  4FLY A;  1RDU A;  4DV1 K;  4EZ6 A;  5AQP A;  1HNW K;  1NKE A;  4FLT A;  3J7A P;  3WEE B;  2NRR A;  4N76 A;  1REV A;  2AA4 A;  3QFU A;  2F9T A;  2ZF5 O;  4JKD A;  4BQL A;  3MEE A;  4O4G A;  3IAY A;  2X78 A;  5TKW A;  3WUH A;  1QQN A;  1WB9 A;  2D0C A;  4M7X A;  3RVC A;  4E0D A;  2EX3 A;  3BEX A;  2DFE A;  1Z25 A;  3DWL A;  1JLA A;  3MN7 A;  1LV5 A;  2HHQ A;  2BUP A;  3EKU A;  2WOM A;  1DT9 A;  2FLO A;  1KFD A;  3ZX2 A;  1GLC G;  3P39 A;  1EXQ A;  4EHU A;  1NGB A;  1XQS C;  1TGO A;  3SV4 A;  2W41 A;  3SPZ A;  4IDH A;  5AQM A;  4CGH A;  4H03 B;  2YNI A;  3A5N C;  3CIP A;  4C1N I;  2D0P A;  3MAQ A;  1QTM A;  4PHT X;  4KB0 A;  4K43 A;  4IG3 A;  5HRO A;  3LAN A;  5BR9 A;  5IWA K;  3FGU A;  5C10 A;  3VQA A;  4DS4 A;  4B9S A;  3UKR A;  4RW9 A;  5JVH L;  3M5R A;  4BDP A;  1K8K A;  4FWQ A;  4LFA K;  3MXI A;  4I6M A;  4H0Y B;  3L0Q A;  4KFB A;  1VSD A;  3HTV A;  2XY7 A;  3NE6 A;  1NLV A;  3DAW A;  4KHN A;  5IT9 O;  4DF8 A;  3L2U A;  1BIZ A;  2ETJ A;  3WXI A;  1U6Z A;  4O5B A;  1RTH A;  4BR9 A;  3DOL A;  4DG1 A;  4DQR A;  4E19 A;  3KZB A;  3TAE A;  5HL7 L;  1C1C A;  2FF6 A;  1JLF A;  4FLU A;  2JGU A;  3Q7C A;  4DV2 K;  2BDP A;  3FR0 A;  4JKH A;  4Z4H A;  2V51 B;  4GNI A;  3SUN A;  1ZBH A;  3RMA A;  3OS2 A;  3GBT A;  1NGI A;  1HJR A;  4DTP A;  4WCE L;  4IOX A;  3E9O A;  1Y97 A;  2P9I A;  1WOQ A;  3O08 A;  3AVI A;  4IOA L;  1ZBF A;  1SV5 A;  4DTU A;  3R1X A;  3PO4 A;  1WBD A;  3PUF A;  4DMN A;  3TTF A;  3ZX3 A;  1RFQ A;  3HYF A;  2ZJP L;  1L3U A;  4ZHR A;  3MXM A;  1JJ2 M;  2O8F A;  2KLA A;  4YY3 K;  1DTT A;  3A2F A;  1SL1 A;  3HOS A;  4IJN A;  1YJN N;  4LF8 K;  4BR7 A;  4DTM A;  5CY4 A;  2HW3 A;  3HPH A;  3H6E A;  4CZE A;  4YOW A;  1JLB A;  2UUC K;  3OHR A;  5KI6 A;  4BR2 A;  2AJQ A;  1S5J A;  3J7Y P;  1W97 L;  4GV9 A;  5C2F A;  4JRP A;  5CR4 A;  3D2E B;  4FK0 A;  3PX6 A;  3CET A;  4ISG A;  4BG8 A;  3O6W A;  1ZBU A;  3KIO A;  3PIO L;  1Q9X A;  4BR4 A;  5EXW A;  2VGM A;  3KK1 A;  4FOI A;  3THX A;  3LM9 A;  1HQE A;  1S1W A;  2O8D B;  3ZSR A;  3M6G A;  1KLN A;  4M63 C;  3GOI A;  3DLB A;  4OKE A;  3V1R A;  3I55 N;  2RF2 A;  3NF6 A;  3TAQ A;  3THY B;  4UY8 O;  1B9D A;  4NXM K;  2F7T A;  4DFK A;  2G8I A;  4W5Q A;  3QML A;  4CF2 A;  1SAZ A;  5JLF A;  2OPR A;  4IEE A;  1RBT A;  4J2E A;  4E7J A;  4FOE A;  4JI1 K;  2EWS A;  2E5L K;  2O8C B;  1NBW A;  4JS5 A;  3AO4 A;  4JI0 K;  1WSH A;  3PSF A;  4OJR A;  3K0S A;  1JLQ A;  3LPU A;  1IKY A;  1N8R O;  2HF4 A;  3VQ7 A;  4GY2 B;  5B8H A;  4W5T A;  2XO7 A;  4DHY A;  2OPS A;  3V1O A;  4YFU A;  2XY8 A;  5E41 A;  4NB4 A;  4Y0W A;  2E6L A;  1RT3 A;  4BGA A;  1ZBS A;  5AQI A;  2YKM A;  4AHS A;  3VQB A;  3M8R A;  4FWL A;  2NRZ A;  3VQ5 A;  4EHT A;  1WUA A;  1IKX A;  3KD5 E;  4CK1 A;  3OYB A;  1FXX A;  3O80 A;  5C12 A;  2NRX A;  3EEQ A;  1IH7 A;  4RCH A;  3J81 O;  1I39 A;  4CK3 A;  4B3T K;  2W6L A;  3CJC A;  2HBK A;  1S22 A;  1FW6 A;  1TV6 A;  4HTL A;  3C94 A;  4B9V A;  2IVN A;  3VF2 A;  4DSE A;  3CJB A;  3O9T A;  3JSM A;  2VG5 A;  2P9P B;  3VEZ A;  4OGE A;  1NK6 A;  2Q31 A;  4RW4 A;  5KTQ A;  4DU4 A;  4BG9 A;  4JKG A;  2YJF A;  3WXL A;  3TAB A;  3DYA A;  4QCL A;  4JHD B;  4FM0 A;  1NOZ A;  2NLX A;  2E8A A;  1J5E K;  3CD6 N;  2YNF A;  4CJU A;  4DV7 K;  1JCF A;  1WSE A;  1LCU A;  3H45 C;  3KTQ A;  1Z6R A;  5M1K A;  1TK8 A;  4PKI A;  1EO1 A;  3MN6 A;  1Y64 A;  3F5T A;  3SAH A;  4BRD A;  5C0Y A;  1BGX T;  4O5F A;  3NHG A;  1KAY A;  1U04 A;  3DMJ A;  5C2D A;  4UQG A;  3RRH A;  4DSI A;  1NMD A;  1WNS A;  1HKC A;  1W7A A;  3V9W A;  4FZZ A;  5K14 A;  2HND A;  3HOT A;  2O4I A;  4CIG A;  2ZD1 A;  3O9Q A;  3L3V A;  1QS4 A;  1ATS A;  4BAC A;  4FVM A;  3E01 A;  2KZZ A;  3U3G A;  5C24 A;  3QO9 A;  4BDZ A;  4DFP A;  2V7Z A;  1WBB A;  4DR5 K;  4C8O A;  4GVM A;  3ULE B;  1I3A A;  2BAN A;  5AQH A;  3KHY A;  5AZJ A;  3QIN A;  2Q36 A;  5LMN K;  2PAV A;  2VCP A;  3T1A A;  1KC8 O;  1BA1 A;  3CI5 A;  3CPE A;  2Q0R A;  1OH5 A;  2Z1H A;  4J2D A;  4FCY A;  1VQ8 N;  3G0Z A;  4AHU A;  1G15 A;  3H3O B;  4JKA A;  2H3G X;  2UYT A;  1R59 O;  1Z26 A;  4FVU A;  3VTH A;  4LF5 K;  2ZJR L;  4FJI A;  4H0X B;  3QET A;  4KRF A;  1VQK N;  2JLE A;  3H1Q A;  5M1F A;  4A2B A;  3A0I X;  4IXC A;  2D5R A;  2GEM A;  4GKJ K;  4NYN A;  4LC9 B;  4Q0B A;  4C8L A;  3S9H A;  3V9S A;  3O4N A;  5M1Q A;  3TAR A;  3ALY A;  3JYT A;  3HK2 A;  1HRH A;  3CC2 N;  3T69 A;  3U9D A;  5ADX A;  4OPK A;  3NF7 A;  2VWB A;  1Q9Y A;  1S72 N;  5AQL A;  3BF1 A;  4DU3 A;  1M90 O;  3V9X A;  4FSV A;  3B6O A;  3HP6 A;  4DU1 A;  4AIL C;  2KW4 A;  1JLE A;  3U3Y A;  4ZTF A;  4B3O A;  4F8R A;  1RDC A;  5J2Q A;  4LFB K;  1DEJ A;  4YDU C;  3MK6 A;  2A40 A;  4DQP A;  5HBM A;  2YI1 A;  4I7F A;  4IO9 L;  3L8B A;  1GLA G;  1KSP A;  3HJF A;  3ZT4 A;  4FLZ A;  4AHV A;  4CJR A;  1OH7 A;  1HKG A;  4ELV A;  2YKN A;  1VSH A;  2YHA A;  5EVZ A;  1VQ6 N;  2CH6 A;  2GUP A;  3AVL A;  4IDK A;  4KH4 A;  1KAZ A;  3QFP A;  2FBX A;  3O9R A;  3CJA A;  5AQW A;  1YJ9 N;  2A5X A;  3LL3 A;  1VQO N;  4KHQ A;  4C23 A;  3CMA N;  4DV0 K;  5CZ2 A;  5LY3 A;  5M1P A;  5AQX A;  3CC7 N;  3I8D A;  3ZT0 A;  1HX1 A;  3ENH A;  1JL1 A;  1YVN A;  3KK3 A;  4V19 S;  2E1Y A;  3LDP A;  4NCG A;  3LDS A;  5KGX A;  4CD1 A;  3MN5 A;  1WSJ A;  2HVI A;  4E89 A;  4CJL A;  3V6D A;  3RR8 A;  5FPD A;  3OYI A;  1NJY A;  3EL2 A;  2IDO A;  3L6Q A;  2HMI A;  2D0O A;  3E1Y A;  1S9E A;  2RE2 A;  1XMO K;  3HO1 A;  2VG6 A;  2R7Y A;  3HI0 A;  3K5L A;  2D0A A;  5HRR A;  3OYM A;  4JI4 K;  4JS4 A;  3TAF A;  3NH1 A;  4CEA A;  3LPT A;  1N33 K;  3V9U A;  3K58 A;  4DS5 A;  4GV6 A;  2UUB K;  3AVM A;  1M1K O;  1SKS A;  4CI6 A;  5ELZ A;  3CME N;  4CF9 A;  2G8V A;  2P9K A;  3P83 D;  3HZ6 A;  3ENB A;  1RT2 A;  3VEW A;  2X6N A;  3UIQ A;  1YAG A;  2GV9 A;  3IUC A;  1ZBL A;  4DTS A;  3H08 A;  4PQU A;  4CES A;  1HKB A;  3O4W A;  4CJV A;  4H0O A;  2IOC A;  1ZC6 A;  3MMV A;  4HWI A;  4GKK K;  5J2N A;  2FSK A;  1ASU A;  4CF0 A;  2Q97 A;  3ZEU B;  1NOY A;  4IEI A;  2UU9 K;  1SL2 A;  5DMR A;  3UE5 A;  4CJP A;  2E2O A;  3NF9 A;  3KLE A;  2J4R A;  3D2E A;  3PX0 A;  3BUZ B;  3TTC A;  3MEG A;  5AFU H;  1IBL K;  2O8D A;  3HRG A;  1BUP A;  1YUW A;  1QQO A;  4MO4 A;  1NGF A;  4NO7 A;  3NH0 A;  1NK4 A;  3THY A;  1BU6 O;  3MDQ A;  3VEN A;  1EWR A;  2D4W A;  4AHR A;  4CK2 A;  4X62 K;  1BHL A;  4WYB A;  4LSN A;  3I8B A;  1NKC A;  1CZB A;  4M45 A;  4CHY A;  1T3V A;  5AJ3 K;  1CLQ A;  3GE1 A;  1O1W A;  4K25 A;  2D1K A;  5I9E B;  2O8B B;  3J7Z O;  3CPW M;  4CJ4 A;  2RHK A;  4JKE A;  1L3T A;  4DSF A;  3ZYY X;  1KD1 O;  2O8C A;  3OBW A;  4HHT A;  4BGB A;  2NRV A;  4CZK A;  4OLA A;  4W5R A;  4A5B A;  2VQE K;  2HF3 A;  3T1H K;  4H4O A;  3CJ1 A;  4KI4 A;  1KCF A;  2UXC K;  2VWK A;  2YCH A;  1YVU A;  2QWP A;  1I94 K;  3GG4 A;  1TVR A;  2I7N A;  2ATQ A;  5GIO A;  1BWF O;  2OPP A;  3AVK A;  3RMB A;  1D5A A;  3HVR A;  4B9T A;  5AR0 A;  4FM2 A;  3TR8 A;  3U4L A;  3L2V A;  1ILY A;  1XNR K;  5AQK A;  4OPA A;  3OYG A;  4ELU A;  4BDY A;  3OS0 A;  4AHC A;  1CZ9 A;  3HXM A;  3EN9 A;  3EE9 A;  1OH6 A;  1DKG D;  5BPN A;  1K73 O;  3VOV A;  4M3Z A;  4RWT A;  3OJU A;  1NGE A;  2O8E B;  4X65 K;  4NCB A;  1VRT A;  2P9P A;  2DFF A;  3QNO A;  2QWO A;  4Y1C A;  2BTF A;  3ZET B;  3SMP A;  4ID1 A;  4CED A;  4CHZ A;  2P9L B;  4CZF A;  3G71 N;  3KKS A;  1EX4 A;  1SS6 A;  1T6D A;  3TTD A;  1HYV A;  2PFU A;  2B6A A;  3FZK A;  4PA1 A;  4FJ8 A;  3VEO A;  1D4X A;  1MWK A;  4WQ4 A;  3HST B;  3C6U A;  3SQ2 A;  2E2N A;  3MCP A;  2FBT A;  1T05 A;  3RMD A;  1N5Y A;  1RT1 A;  1JXE A;  3SJJ A;  5AQT A;  4PKH A;  5LJV A;  5JS1 A;  3QEW A;  3Q7B A;  3EZ5 A;  4LF6 K;  4A62 A;  3P4I A;  3AAQ A;  4DKW A;  1VHX A;  3VMF B;  2ZGY A;  1E4F T;  1MWM A;  4DV6 K;  5KPT A;  1RCH A;  5GIN A;  1T6C A;  4F9O A;  1JL2 A;  2JWK A;  1MU2 A;  1V4S A;  5CYQ A;  4FJ9 A;  4CHP A;  2G8K A;  1NMN A;  3VEY A;  3TSP A;  1BQN A;  4DF4 A;  1VQL N;  1KFS A;  4FJM A;  4WQ5 C;  2P5O A;  2A6A A;  3THW A;  4NLC A;  1U45 A;  4H8K A;  4HVJ A;  3ULE A;  1X3M A;  3NAE A;  5HRS A;  1WSF A;  2IIR A;  4IZ9 A;  4DTR A;  4DQS A;  4IJA A;  3SQ1 A;  4CE9 A;  4KTQ A;  3HM9 A;  4LY7 A;  2ZM6 K;  4ICL A;  1IJJ A;  1BI4 B;  5DM6 L;  4CEO A;  1SZ2 A;  3SZ2 A;  1BCO A;  5HRN A;  5BRD A;  1OVQ A;  5AZI B;  3RSE B;  4CEC A;  3CG7 A;  3F73 A;  3IMX A;  4G1Q A;  2ZWH A;  1XC9 A;  1VQP N;  2DPN A;  3WNH A;  3C6H A;  1NGA A;  3O5B A;  3CJ9 A;  3A5O C;  1RTD A;  4EFH A;  3ENO A;  2KFN A;  3EY1 A;  1Q18 A;  1W2B M;  4CGJ A;  2GTD A;  3AA5 X;  3HBT A;  4NXN K;  4JYA K;  4LH5 A;  4IFV A;  2IS3 A;  1KRP A;  2WON A;  3DRS A;  4E3S A;  4FJ5 A;  1VK0 A;  4B9Q A;  5LMU K;  1C0G A;  4CEE A;  4CGF A;  4CEF A;  4LD0 A;  1NJW A;  4KH5 A;  1RT4 A;  4FWK A;  1YIJ N;  4K42 A;  4JRQ A;  4FJL A;  3QBW A;  4EZ9 A;  1VSK A;  3DI6 A;  3TPQ A;  5JVG L;  1XI1 A;  2PY5 A;  3VQ6 A;  2QWN A;  4HTU A;  3GDQ A;  3IFR A;  4B9L A;  4IFE A;  1Q82 O;  4O0I A;  5C25 A;  4H5N A;  3S3O A;  3BP8 A;  3B6P A;  3SI6 A;  3CC4 N;  5AQV A;  3ITH A;  1VQ4 N;  3VGK A;  1KVB A;  1QVG M;  3SPY A;  2E2Q A;  2FSJ A;  4BRQ A;  3WXK A;  4X64 K;  4RW7 A;  2Y1J A;  4PL7 A;  4MFB A;  1P90 A;  2ASM A;  3LDQ A;  2NRH A;  3NFA A;  1NU0 A;  3P38 A;  4ILH A;  3CCJ N;  1T03 A;  1NGH A;  4DSK A;  1S3X A;  2BGG A;  4JK9 A;  2OTL N;  1RT7 A;  5FPM A;  2HNZ A;  4ILJ A;  3M8Q A;  2HBL A;  4JAX A;  1FKO A;  1JKH A;  4A57 A;  4CGI A;  4CJ3 A;  1TYQ B;  5M1O A;  1LWF A;  2PBD A;  2F8S A;  3PO5 A;  2OZM A;  3DRR A;  3PLA A;  2X74 A;  3AY9 A;  3O9U A;  2HOE A;  3KWG A;  5BN9 A;  1Q86 O;  2XRI A;  2OA8 A;  2E4L A;  3MXJ A;  5SWM A;  3VA3 A;  3CXC M;  5GAH P;  3J80 O;  5HLF A;  3IG1 A;  3SYZ A;  1NGJ A;  4BRG A;  1ATN A;  1NGD A;  2YV0 X;  3L3U A;  3O1W A;  3W0L A;  2YNH A;  3AAP A;  4DUZ K;  1U2V B;  3AO1 A;  3AVC A;  3PY8 A;  2HHV A;  1UAX A;  4FLW A;  4HCC A;  3OYC A;  4EAH D;  4FO0 A;  4DB3 A;  1KQS M;  1B9F A;  4NLB A;  2Q2R A;  3EYZ A;  3LDO A;  2P51 A;  5KGW A;  3SV3 A;  2P9N A;  3VGL A;  1NG9 A;  3DXK B;  1HPZ A;  4G9Z A;  3HVT A;  1VQN N;  1JLG A;  4EP5 A;  3DLE A;  3VET A;  3CFR A;  1TUU A;  1VQ9 N;  4M3R A;  4KO0 A;  4KHP K;  2KHO A;  2GWJ A;  3OYF A;  3K5N A;  4M7Y A;  3ZEU A;  3OYL A;  4K8X A;  4ISF A;  5FLX O;  3KLH A;  1QSY A;  1VSE A;  4NYF A;  3WNF A;  4YOY A;  5I42 A;  3QLH A;  1KXP A;  1JCG A;  1ASW A;  2KKZ A;  2NNW A;  4BWM A;  1C0T A;  1VSF A;  2ITM A;  3ZSX A;  4BRM A;  5LJW A;  3FZF A;  4L3Q A;  4DLG A;  2YJE A;  4M3X A;  1S6P A;  2P9U B;  5EY4 A;  5HRP A;  4YOV A;  2KQ2 A;  1EKE A;  3F9M A;  3ZT3 A;  1KVA A;  3TAG A;  2Z1J A;  5LL6 Z;  3IKM A;  1S1T A;  5HP1 A;  4PKG A;  5FDL A;  3AGR A;  4JI7 K;  2PZS A;  3PX4 A;  1GOC A;  4DTJ A;  3RTV A;  4E7I A;  4M3Y A;  4ELT A;  4O44 A;  5AQY A;  4Z4F A;  1F21 A;  1J9A A;  4DR2 K;  2UUA K;  4F3T A;  2E1Z A;  2O8B A;  2B5J A;  3JAM O;  3U6F A;  1HNX K;  3NF8 A;  2W40 A;  2FBV A;  3R8E A;  4W5O A;  3FFI A;  3P31 A;  4M3W A;  4JV5 K;  2QI2 A;  4J2B A;  1YTU A;  3WNG A;  1N34 K;  4DCH A;  1KAX A;  1EET A;  1JLC A;  5BRF A;  4OO1 J;  3M1F A;  4CF8 A;  4OLB A;  3WNE A;  3R9P A;  3ID6 A;  2QTD A;  4OPH A;  3BF3 A;  3E9P A;  3QIO A;  1NJI O;  4YOX A;  1DTQ A;  3VQ8 A;  4DV3 K;  5CHI A;  4JI5 K;  1C0M A;  3MX2 A;  3WEE A;  3FE1 A;  1J53 A;  3LZJ A;  3VQD A;  5AQN A;  1FK9 A;  3LAK A;  1Z05 A;  2OYQ A;  1BIS A;  5AQS A;  4BRF A;  3BY5 A;  1WAJ A;  3MX5 A;  4QAG A;  4BY9 C;  2O8E A;  3ZT1 A;  2OZS A;  4GW6 A;  5JS2 A;  5T7B A;  4BR5 A;  3ZET A;  3O3F A;  2O8F B;  4AM7 A;  2P9L A;  4U67 L;  4H5R A;  4B3M K;  1UA0 A;  4OX9 K;  3O1B A;  5M1N A;  4Z4E A;  1HQU A;  4MLE A;  4BVO A;  2DTU A;  3VF6 A;  2YHB A;  4FL9 A;  4IFY A;  1NK7 A;  1HNZ K;  3OYD A;  4JI2 K;  1EWQ A;  1RBS A;  2FXU A;  3LDN A;  5AQQ A;  2F8T A;  3ZSO A;  2ZE2 A;  2VGN A;  3OVN A;  3T1Y K;  2I5J A;  3K57 A;  4QS9 A;  5FRN A;  3CQY A;  3TSU A;  1ASV A;  2QKB A;  4E7L A;  3MN9 A;  3VES A;  3LM2 A;  1S1X A;  4DFM A;  3THV A;  5AQZ A;  2BE2 A;  3FZM A;  3BDP A;  1RBV A;  4DQ8 A;  3JXU A;  1HLU A;  1HMV A;  4BRP A;  2HHH K;  2A42 A;  4B9M A;  4LFC K;  2WUS A;  3CM5 A;  4RW8 A;  3OW2 M;  1MDU B;  4YDU A;  3S3N A;  4H0T B;  3KK7 A;  3ISN C;  2OAN A;  2OTJ N;  3R6M A;  3ZSQ A;  4FWN A;  3ULD A;  4A2A A;  4F3O A;  1TK0 A;  3N4Q A;  2D0B A;  1E4G T;  1TKZ A;  3K9J A;  2QWM A;  4DSJ A;  1IKV A;  3SAF A;  5FPN A;  4FLX A;  1L5U A;  1KTQ A;  4MLH A;  4YOR A;  4H0V B;  1BI4 A;  1CZA N;  4DTN A;  4HUE A;  1SL0 A;  4FK4 A;  1A5V A;  4JN4 A;  5AZI A;  4FJH A;  2F96 A;  3MEC A;  4OPJ A;  2HST A;  3V4I A;  4WFN L;  3WXM B;  4CFC A;  3IS9 A;  1NK9 A;  2P9S B;  4OVL A;  1U49 A;  1SKW A;  4H0P A;  4JKC A;  3T3F A;  1LWC A;  3C6A A;  4CJW A;  4FJJ A;  3SMS A;  1N36 K;  5KPZ A;  3NGZ A;  1RIL A;  3H46 O;  1EQY A;  1TKD A;  4BRI A;  3O3H A;  5CZ1 A;  1C0U A;  4B1W B;  1LAW A;  1QHT A;  4A59 A;  2JWL A;  2E88 A;  4O8K A;  4BRL A;  4IBN A;  3A8Y A;  5DK5 A;  4B3R K;  4IKF A;  1YJW N;  4DLE A;  3DLR A;  1VSJ A;  4HCB A;  1BIU A;  1H1V A;  3G10 A;  1QQC A;  4JLH A;  1T8E A;  2VG7 A;  4PUO A;  1LAV A;  3O9S A;  4Y1D A;  3CQ8 A;  4AQY K;  3CCE N;  3ID8 A;  4B9U A;  5HOO A;  4YNQ A;  2OPQ A;  3NVK A;  1BO5 O;  1QE1 A;  5C15 A;  3E9L A;  3HM8 A;  3KD1 E;  4CJS A;  1GLL O;  3SUQ A;  4HUF A;  3PV8 A;  3KVG A;  3LAM A;  3J8A A;  4KV8 A;  3EZW A;  2YHX A;  4BRA A;  4DSL A;  4CJF A;  3HPO A;  5J2M A;  3AVN A;  3IRX A;  4WE1 A;  2WTU A;  5AQU A;  4CIE A;  4BC2 A;  2HHS A;  3MWT A;  5AZJ B;  3C7N B;  1QZ6 A;  4HUG A;  1S9G A;  3QBX A;  4Z0U A;  4XH5 A;  1VQM N;  4H5W A;  2FSN A;  2HHU A;  4I2Q A;  1G99 A;  4BVP A;  2RN2 A;  1GOB A;  1TYQ A;  2GX9 A;  4E7K A;  3G25 A;  1OKJ A;  5AFU A;  3VPZ A;  1X9W A;  1RT6 A;  2CH5 A;  2QW9 A;  3G4S N;  1BCM A;  4BRC A;  1IG8 A;  3TSQ A;  3LWM A;  4NCA A;  3DXM B;  2FBY A;  4TSX A;  4BRE A;  1RBU A;  4AM6 A;  3NGI A;  3D2F B;  1P8Z A;  4MDB A;  3VQ9 A;  4JEP A;  3UKU B;  1C1A A;  3H1V X;  1BL3 A;  4CHO A;  4CW7 B;  1VRU A;  2NRW A;  3CQX A;  2NRT A;  4B1Z A;  4OGC A;  4XEI A;  1U2V A;  2Q0U A;  3VN5 A;  4RTF D;  2VQF K;  1QQM A;  4BC3 A;  4Z4G A;  3RR7 A;  3TI0 A;  4A61 A;  3P1G A;  3C65 A;  4JHD A;  3S3M A;  3AV9 A;  3C95 A;  4F4K A;  1X1P A;  1IKW A;  2V7Y A;  2NZT A;  4CIF A;  1NJZ A;  3DXK A;  4M3U A;  4BC5 A;  4CBU A;  2ASP A;  3W3D A;  3TAP A;  3K5M A;  3QEP A;  3HPG A;  4BR0 A;  1BDG A;  3VA0 A;  3VQP A;  4M3T A;  3NH2 A;  3MED A;  4DR6 K;  2PYL A;  1Q81 O;  2HB5 A;  3KLI A;  4FM1 A;  1VSI A;  3NBP A;  2VWJ A;  1RBR A;  2HVH A;  3AO3 A;  1SKR A;  4DR7 K;  1KLM A;  4CVN E;  1BOT O;  4YOT A;  5E26 A;  3OYA A;  1GLD G;  1SQK A;  1J6Z A;  1WSI A;  2P9U A;  3KK2 A;  1GLE G;  3ASM A;  4B8C A;  1RDD A;  3CJ7 A;  1TL1 A;  4RW6 A;  2IVP A;  3DJC A;  1S1U A;  1L3S A;  4FW1 A;  1TKT A;  4GVE A;  3GL1 A;  3FFK B;  2ZQB A;  1QZ5 A;  1GLJ O;  4YHH K;  3NCI A;  1IV0 A;  4KTW A;  4FPB A;  2NUB A;  1EP4 A;  2VYP A;  3M3Z A;  1HNV A;  3NVM A;  4JK8 A;  4CHQ A;  4CZJ A;  3NDK A;  3K9K A;  5KQD A;  5F0X A;  3L2Q A;  4CFA A;  1NKB A;  1VQ7 N;  2HHT A;  2E20 A;  5KQ8 A;  2WC9 A;  2E2P A;  2HMP A;  2KTQ A;  4IWV A;  2A3Z A;  2ASO A;  1D8Y A;  4CJK A;  4FPA A;  2Y1I A;  4C8M A;  1WN7 A;  1RDA A;  1HYS A;  3HP9 A;  1MA9 B;  2P5G A;  1IBM K;  4DTO A;  1K8A O;  4JI3 K;  2FF3 B;  2EHG A;  4LH4 A;  3QEV A;  4FJG A;  1FJG K;  2QXF A;  3OYJ A;  2P9K B;  4WQ5 A;  4KKO A;  5BRE A;  2CGL A;  1J5O A;  4QS8 A;  3PSI A;  3K59 A;  2Q3S A;  4CJE A;  2YNG A;  2IAJ A;  5EOY A;  4JD2 B;  1S6Q A;  1IO2 A;  4AHT A;  1QVF M;  1D9D A;  3A5L C;  1IG9 A;  3SNN A;  2V52 B;  2GWK A;  4ID5 A;  1LOT B;  3I33 A;  3SBT A;  2IVO A;  5KPR A;  3AA2 A;  3R3L A;  3AA3 A;  3L4Q A;  3L4I A;  3ZSW A;  4M41 A;  4CZM A;  4GV3 A;  3T19 A;  3CFO A;  3LP0 A;  2BH1 A;  1RDB A;  3VQ4 A;  2YHY A;  1NGC A;  4R5P A;  1ITG A;  3AVA A;  3WQU A;  1E3M A;  1V4T A;  3CF5 L;  3S41 A;  1HR0 K;  5J2P A;  1WSG A;  4KAZ A;  3SUO A;  4BRN A;  4YOU A;  3SCX A;  4FW2 A;  3ATV A;  4F2R A;  4JNE A;  3QES A;  1CXQ A;  2FC0 A;  4E1J A;  4PY5 A;  2YX6 A;  3SJH A;  4FWR A;  3O4Q A;  3VF4 A;  4KPY A;  3JS6 A;  1W0H A;  4M42 A;  2AP1 A;  1A5X A;  4N41 A;  4FZY A;  3WT0 A;  3OTO K;  3TWH A;  1X9S A;  4FWO A;  1ESV A;  3AA4 A;  4BE2 A;  3SAG A;  5SZT A;  4CZL A;  4I9Q A;  1VAZ A;  3AO5 A;  4BE1 A;  3KLG A;  3VQE A;  4GMJ B;  4CEZ A;  3TAM A;  4CFD A;  4WFB L;  1C1B A;  2B4J A;  5FRO A;  5F2R A;  3AGK A;  4B08 A;  3OY9 A;  1XHZ A;  3CCU N;  4FYD A;  3CHW A;  3TAN A;  1NWK A;  5CE3 A;  3KWI A;  3FZL A;  1ATR A;  1N32 K;  1LW0 A;  1U4B A;  2W6K A;  4ZTJ A;  5EX5 A;  2GEL A;  3D45 A;  3ZSZ A;  3SQ0 A;  3VTI A;  5BN8 A;  4H5T A;  3ZSV A;  3A5M C;  1YTA A;  4LSL A;  4CJQ A;  4W5N A;  2QWR A;  1VSM A;  3OA9 A;  3DLK A;  3K5O A;  2QM1 A;  3VEX A;  5DM7 L;  4CD3 A;  2DY4 A;  2G8W A;  5BRH A;  1HPM A;  2QWQ A;  1ZXO A;  1SUQ A;  4X66 K;  1TAU A;  1TKX A;  5JLH A;  1C0F A;  2P9S A;  4L8R B;  4J8F A;  3VER A;  1OH8 A;  4FWS A;  1RDW X;  2ITG A;  5GAG P;  4QS7 A;  1ZBI A;  5E84 A;  5EU7 A;  4H4M A;  1J54 A;  3I56 N;  3KLF A;  1HYZ A;  4ISE A;  5FPE A;  2Z1G A;  4B1Y B;  3OYE A;  1TK5 A;  3C0B A;  3CFP A;  4CJ5 A;  1U47 A;  3F9K A;  4CZI A;  1NK0 A;  2HBM A;  2WBN A;  4IG0 A;  3QDK A;  1T44 A;  4KHU A;  3D6R A;  4CBW A;  2QXL A;  3I0R A;  1YXQ A;  3B8A X;  4B3S K;  5AQR A;  3OYK A;  5GAD P;  4KTZ A;  4F2S A;  5A2Q O;  2G8H A;  4FJX A;  3KJV A;  1LWE A;  1RGI A;  3LWL A;  2RKI A;  3D7E O;  4B8A B;  4XH4 A;  2CGJ A;  3LZI A;  2LSN A;  3H3N O;  5MLC Q;  3U8X A;  3OYH A;  3UKR B;  3DM2 A;  3OJS A;  1UA1 A;  1K8K B;  4DUY K;  3TU5 A;  4FZX C;  4CEB A;  3DLG A;  4KB1 A;  4I6M B;  5AQO A;  5FRM A;  2YHW A;  2I7P A;  1GLB G;  4RG8 A;  4KHW A;  3VQC A;  2ZJQ L;  4FWP A;  1DGK N;  3BGR A;  4BRK A;  4I2P A;  1JCE A;  3D0P A;  1NK8 A;  4C8N A;  1R0A A;  2GBZ A;  3THW B;  1NNE A;  3E66 A;  4KRE A;  5ADX H;  1XWL A;  4O55 A;  3C7N A;  4K41 A;  4E1M A;  4DFJ A;  4E1N A;  2G8U A;  1UWB A;  4CHN A;  5GIP A;  4DQI A;  1BA0 A;  4CER A;  3V81 A;  2ZGZ A;  3LP3 A;  5TKY A;  3QNN A;  5D3G A;  4DR1 K;  3ZX0 A;  1VQ5 N;  2P9I B;  1YIT N;  3DXM A;  1HUX A;  3G6E N;  1D9F A;  4N47 A;  1N6Q A;  4Z4C A;  3RWU A;  4KHY A;  5H1S Q;  3D2F A;  4FXD A;  3NMU A;  2QA4 N;  3CM6 A;  3CCR N;  3UKU A;  1B92 A;  2PYJ A;  4B1U B;  3PIP L;  2Z1I A;  2A41 A;  4JKB A;  4JK7 A;  4FJK A;  1RTI A;  4Z94 A;  1U48 A;  2W42 A;  3V9Z A;  4K8Z A;  3F2K A;  5BR8 K;  3QIC A;  3AO2 A;  3VQQ A;  3O8M A;  1XUP O;  3AVJ A;  3CCV N;  3BZC A;  1IBK K;  1Q8I A;  3NGY A; 
#chains in the Genus database with same CATH homology
 3VGM A;  3ULE A;  4RCH A;  1X3M A;  3CJC A;  2IIR A;  4IZ9 A;  1OVY A;  3O9S A;  2HBK A;  2Q1N A;  1S22 A;  3CCE N;  4IJA A;  4ILG B;  3ID8 A;  4HTL A;  3IDH A;  4PL8 A;  5HOO A;  2IVN A;  3VF2 A;  3CJB A;  3O9T A;  1Q7Y O;  3NVK A;  1IJJ A;  1BO5 O;  1NM1 A;  3N4P A;  5C15 A;  3CCL N;  4B1V A;  2P9P B;  3E9L A;  3HM8 A;  1HJO A;  3EO3 A;  5DM6 L;  3VEZ A;  1GLL O;  4WF9 L;  2Q31 A;  3KVG A;  3J8A A;  1SZ2 A;  4CZH A;  4BG9 A;  5BRD A;  3EZW A;  5AZI B;  3RSE B;  2YHX A;  4JKG A;  4BRA A;  2YJF A;  3IMX A;  3T7Z A;  3AAR A;  3WXL A;  2ZWH A;  5AQU A;  4BC2 A;  3U9Z A;  1QHA A;  4JHD B;  3MWT A;  5AZJ B;  3C7N B;  1QZ6 A;  2DPN A;  1VQP N;  2NLX A;  2E8A A;  3C6H A;  3QBX A;  3CD6 N;  4XH5 A;  1VQM N;  1NGA A;  1JCF A;  3O5B A;  2FSN A;  4H5W A;  3CJ9 A;  1G99 A;  1LCU A;  3A5O C;  4BVP A;  3H45 C;  1TYQ A;  2GX9 A;  4EFH A;  3ENO A;  4BRH A;  1Z6R A;  5M1K A;  3G25 A;  1OKJ A;  4PKI A;  5AFU A;  1Q18 A;  3VEV A;  3MN6 A;  1Y64 A;  3MWP A;  1EO1 A;  3SK3 A;  4O8U A;  3VPZ A;  3F5T A;  1W2B M;  3SAH A;  4BRD A;  2GTD A;  5C0Y A;  2CH5 A;  2QW9 A;  3HBT A;  3G4S N;  4O5F A;  4BRC A;  1IG8 A;  3TSQ A;  1KAY A;  5C2D A;  3DXM B;  4BRE A;  4AM6 A;  1GLF O;  1NMD A;  1P8Z A;  3D2F B;  4MDB A;  1HKC A;  4B9Q A;  4JEP A;  1C0G A;  3UKU B;  4KH5 A;  3HOT A;  3WXJ A;  4EIA A;  3H1V X;  4FWK A;  1YIJ N;  3CCS N;  3O9Q A;  4K42 A;  1ATS A;  2NRW A;  3CQX A;  2NRT A;  4B1Z A;  4XEI A;  4H5V A;  1U2V A;  3QBW A;  2Q0U A;  4RTF D;  4B1X B;  5JVG L;  3MCA B;  3TPQ A;  4FWM A;  2V7Z A;  2QWN A;  1QQM A;  3GDQ A;  3RSE A;  4BC3 A;  3IFR A;  4IFE A;  1Q82 O;  4H5N A;  4A61 A;  3BP8 A;  3ULE B;  3DLL L;  3CC4 N;  5AQH A;  4IO8 A;  3C65 A;  4JHD A;  3KHY A;  5AQV A;  3VGK A;  5AZJ A;  1NGG A;  1VQ4 N;  1YHQ N;  1QVG M;  2Q36 A;  2E2Q A;  2FSJ A;  2PAV A;  2V7Y A;  2NZT A;  2VCP A;  3UB5 A;  3WXK A;  4BRQ A;  1BG3 A;  4R79 A;  1KC8 O;  1BA1 A;  3CI5 A;  3CPE A;  3DXK A;  2Q0R A;  3HSC A;  4AF1 A;  4PL7 A;  3OBY A;  4BC5 A;  4CBU A;  4CZG A;  2ASP A;  3W3D A;  3CER A;  3CCQ N;  1P90 A;  2ASM A;  3LDQ A;  1X3N A;  2NRH A;  1VQ8 N;  3P38 A;  3CCJ N;  4ILH A;  4CJ7 A;  1NGH A;  3H3O B;  4JKA A;  2H3G X;  1S3X A;  2UYT A;  1BDG A;  1R59 O;  4BR0 A;  5F1X A;  1O13 A;  2QEX N;  4JKG B;  4JK9 A;  3VTH A;  4FVU A;  2ZJR L;  2OTL N;  5FPM A;  4H0X B;  1X9J A;  4IOC L;  1VQK N;  2QWL A;  3H1Q A;  5M1F A;  5JIC A;  3EKS A;  4A2B A;  4ILJ A;  1Q81 O;  2HBL A;  4JAX A;  3A0I X;  5AQG A;  2P9N B;  4A57 A;  4IXC A;  2GEM A;  4JD2 A;  4A5A A;  1TYQ B;  5M1O A;  4LC9 B;  4C1N K;  1XC3 A;  2PBD A;  2WFB A;  1BOT O;  4YOT A;  5E26 A;  3ATU A;  5M1Q A;  1GLD G;  1SQK A;  1J6Z A;  2P9U A;  3FLC O;  1GLE G;  4XH1 A;  5AQJ A;  3PLA A;  3LDL A;  3CJ7 A;  3AY9 A;  3O9U A;  2CGK A;  4JKF A;  3CC2 N;  3T69 A;  3U9D A;  2HOE A;  5ADX A;  4BRO A;  2IVP A;  3DJC A;  3KWG A;  4KBO A;  4GVE A;  5BN9 A;  2F9W A;  3GL1 A;  3FFK B;  1Q86 O;  2VWB A;  1S72 N;  5AQL A;  3BF1 A;  1M90 O;  1QZ5 A;  1GLJ O;  4FSV A;  3CXC M;  5GAH P;  1DEJ A;  3MK6 A;  1NGJ A;  2A40 A;  4YDU C;  1ATN A;  4BRG A;  1NGD A;  4FPB A;  5BPM A;  3O1W A;  2VYP A;  3W0L A;  1TUY A;  3AAP A;  3M3Z A;  3NVM A;  1U2V B;  2YI1 A;  4JK8 A;  5BPL A;  4CZJ A;  4IO9 L;  1GLA G;  3K9K A;  5GAE P;  5KQD A;  5F0X A;  4EAH D;  4FO0 A;  4DB3 A;  1VQ7 N;  3QB0 A;  1KQS M;  2E20 A;  4NLB A;  5KQ8 A;  2WC9 A;  2E2P A;  1HKG A;  2Q2R A;  3CCM N;  2HMP A;  3LDO A;  4IWV A;  3SBG A;  2A3Z A;  2ASO A;  5EVZ A;  1VQ6 N;  2CH6 A;  2GUP A;  3FZH A;  5AQF A;  4KH6 A;  2P9N A;  4FPA A;  4KH4 A;  3VGL A;  1KAZ A;  1MA9 B;  3QFP A;  3O9R A;  3DXK B;  4MDA A;  3SLC A;  2FF3 B;  3CJA A;  5AQW A;  3WQT A;  4CBX A;  1K8A O;  1VQN N;  4G9Z A;  1YJ9 N;  2A5X A;  3LL3 A;  1VQO N;  4C23 A;  5JMV A;  3CMA N;  3VET A;  4BQZ A;  1TUU A;  5LY3 A;  1VQ9 N;  2P9K B;  5M1P A;  2KHO A;  4WFA L;  5AQX A;  2GWJ A;  4WQ5 A;  3CC7 N;  4U7B A;  4M7Y A;  3ZEU A;  4WQ4 C;  4ISF A;  1HX1 A;  1YF5 L;  1K9M O;  3ENH A;  1YVN A;  4YOY A;  2E1Y A;  3LDP A;  5BRE A;  2CGL A;  1KXP A;  1JCG A;  4QS8 A;  2HBJ A;  4CD1 A;  3MN5 A;  2KKZ A;  2NNW A;  4BC4 A;  5FPD A;  5EOY A;  4JD2 B;  1YI2 N;  1QVF M;  3EL2 A;  2ITM A;  3A5L C;  3L6Q A;  3EE8 A;  4BRM A;  3FZF A;  4L3Q A;  5LJW A;  2D0O A;  2YJE A;  2V52 B;  2GWK A;  3E1Y A;  1LOT B;  3I33 A;  3SBT A;  4MO5 A;  2P9U B;  5EY4 A;  2IVO A;  4YOV A;  5KPR A;  1RDU A;  2RE2 A;  5AQP A;  3F9M A;  3R3L A;  3HI0 A;  3WEE B;  2NRR A;  3L4Q A;  3L4I A;  2AA4 A;  3QFU A;  2F9T A;  4CZM A;  4GV3 A;  3IKM A;  2ZF5 O;  4JKD A;  4BQL A;  4PKG A;  5TKW A;  2BH1 A;  3AGR A;  3WUH A;  1QQN A;  2YHY A;  1NGC A;  4M7X A;  3RVC A;  3WQU A;  1V4T A;  3CF5 L;  3S41 A;  4GV6 A;  5AQY A;  3BEX A;  3DWL A;  2E1Z A;  3MN7 A;  1M1K O;  4BRN A;  4YOU A;  4CI6 A;  3ATV A;  4JNE A;  5ELZ A;  2W40 A;  3CME N;  2BUP A;  3R8E A;  2P9K A;  4E1J A;  3EKU A;  3HZ6 A;  2YX6 A;  3P31 A;  4FWR A;  3ENB A;  3SJH A;  3VF4 A;  1DT9 A;  2QI2 A;  3VEW A;  2FLO A;  3JS6 A;  1YAG A;  3ZX2 A;  2AP1 A;  3IUC A;  1GLC G;  3P39 A;  4DCH A;  1KAX A;  1H1V A;  3WT0 A;  1HKB A;  4EHU A;  1NGB A;  1XQS C;  4FWO A;  5BRF A;  4OO1 J;  2W41 A;  3M1F A;  1ESV A;  3O4W A;  4H0O A;  3ID6 A;  4IDH A;  5AQM A;  3R9P A;  4H03 B;  3SAG A;  1ZC6 A;  2QTD A;  4C1N I;  3A5N C;  1VAZ A;  3CIP A;  4CZL A;  4OPH A;  3MMV A;  4HWI A;  2D0P A;  3BF3 A;  4PHT X;  4K43 A;  3E9P A;  5BR9 A;  4YOX A;  1NJI O;  4WFB L;  3FGU A;  5C10 A;  5CHI A;  3MX2 A;  3UKR A;  2FSK A;  5F2R A;  3WEE A;  3AGK A;  3FE1 A;  2Q97 A;  3M5R A;  3ZEU B;  5JVH L;  1K8K A;  5AQN A;  3CCU N;  4FWQ A;  3CHW A;  4IEI A;  1NWK A;  5CE3 A;  1Z05 A;  3FZL A;  3KWI A;  4H0Y B;  4I6M A;  3UE5 A;  1ATR A;  3L0Q A;  5AQS A;  2E2O A;  4BRF A;  3MX5 A;  4BY9 C;  2J4R A;  3HTV A;  5EX5 A;  3D2E A;  1NLV A;  2GEL A;  3DAW A;  3BUZ B;  3VTI A;  4BR5 A;  5BN8 A;  3ZET A;  4H5T A;  3A5M C;  3TTC A;  5AFU H;  4AM7 A;  2P9L A;  3WXI A;  4U67 L;  2QWR A;  1U6Z A;  3HRG A;  3OA9 A;  1BUP A;  1YUW A;  1QQO A;  4H5R A;  1NGF A;  4MO4 A;  4NO7 A;  4BR9 A;  2QM1 A;  3VEX A;  5DM7 L;  4CD3 A;  3KZB A;  5BRH A;  5HL7 L;  1BU6 O;  2FF6 A;  1HPM A;  3MDQ A;  3VEN A;  3Q7C A;  2QWQ A;  1ZXO A;  3O1B A;  3FR0 A;  4JKH A;  2V51 B;  2D4W A;  4GNI A;  5JLH A;  5M1N A;  1C0F A;  2P9S A;  4WYB A;  4J8F A;  4MLE A;  3VER A;  4BVO A;  3GBT A;  3I8B A;  4FWS A;  1RDW X;  3VF6 A;  4FL9 A;  1T3V A;  5GAG P;  1NGI A;  4QS7 A;  3GE1 A;  4K25 A;  5E84 A;  4WCE L;  4IOX A;  2D1K A;  2FXU A;  3E9O A;  3LDN A;  5AQQ A;  5I9E B;  3J7Z O;  3I56 N;  2P9I A;  4ISE A;  1WOQ A;  5FPE A;  3CPW M;  2VGN A;  2RHK A;  3O08 A;  4JKE A;  4QS9 A;  4B1Y B;  4IOA L;  3CQY A;  3TSU A;  3ZYY X;  1KD1 O;  3C0B A;  3OBW A;  3R1X A;  3MN9 A;  3VES A;  2NRV A;  4BGB A;  3LM2 A;  4CZK A;  4CZI A;  2HBM A;  4A5B A;  2WBN A;  5AQZ A;  2HF3 A;  3TTF A;  3ZX3 A;  3QDK A;  1T44 A;  1RFQ A;  3CJ1 A;  3FZM A;  3D6R A;  4CBW A;  2YCH A;  2QXL A;  4DQ8 A;  1YXQ A;  3B8A X;  2QWP A;  2ZJP L;  3GG4 A;  5AQR A;  3JXU A;  2I7N A;  1HLU A;  4BRP A;  5GIO A;  2A42 A;  5GAD P;  1BWF O;  2WUS A;  1JJ2 M;  2KLA A;  5AR0 A;  3OW2 M;  3U4L A;  1MDU B;  4YDU A;  1RGI A;  1ILY A;  4H0T B;  5AQK A;  3HOS A;  4IJN A;  3D7E O;  3KK7 A;  4OPA A;  2OAN A;  4BR7 A;  4XH4 A;  2CGJ A;  1YJN N;  2OTJ N;  3R6M A;  3H3N O;  4FWN A;  3H6E A;  4A2A A;  4CZE A;  3U8X A;  5MLC Q;  3N4Q A;  4YOW A;  3UKR B;  3EN9 A;  3OHR A;  1K8K B;  3EE9 A;  1E4G T;  3TU5 A;  1DKG D;  5BPN A;  1K73 O;  4BR2 A;  3K9J A;  4I6M B;  5AQO A;  2QWM A;  3VOV A;  2YHW A;  1W97 L;  4GV9 A;  2I7P A;  1GLB G;  4RWT A;  3SAF A;  2ZJQ L;  5FPN A;  1NGE A;  4MLH A;  4YOR A;  5C2F A;  5CR4 A;  4H0V B;  1CZA N;  2P9P A;  1DGK N;  3D2E B;  4FWP A;  4BRK A;  2QWO A;  3CET A;  4ISG A;  4BG8 A;  3O6W A;  2BTF A;  3ZET B;  1JCE A;  3PIO L;  3SMP A;  5EXW A;  2VGM A;  4BR4 A;  4FOI A;  3LM9 A;  4JN4 A;  2P9L B;  5AZI A;  3M6G A;  4M63 C;  4CZF A;  3G71 N;  3GOI A;  2HST A;  1SS6 A;  4WFN L;  1T6D A;  3E66 A;  3I55 N;  4UY8 O;  3TTD A;  5ADX H;  2PFU A;  3C7N A;  3FZK A;  4K41 A;  2F7T A;  3VEO A;  3WXM B;  1D4X A;  1MWK A;  4WQ4 A;  2P9S B;  2E2N A;  3QML A;  3MCP A;  5GIP A;  1SAZ A;  5JLF A;  1BA0 A;  4H0P A;  4IEE A;  2ZGZ A;  5TKY A;  4JKC A;  3C6A A;  3ZX0 A;  1VQ5 N;  4FOE A;  3SMS A;  2P9I B;  1YIT N;  5AQT A;  4PKH A;  2EWS A;  3DXM A;  1HUX A;  3Q7B A;  5KPZ A;  5LJV A;  4A62 A;  3G6E N;  3P4I A;  3AAQ A;  4DKW A;  3VMF B;  3H46 O;  3D2F A;  1EQY A;  1NBW A;  2ZGY A;  5H1S Q;  2QA4 N;  1E4F T;  3NMU A;  1MWM A;  5KPT A;  4BRI A;  1N8R O;  3CCR N;  3UKU A;  2HF4 A;  4B1U B;  5GIN A;  3PIP L;  4GY2 B;  2A41 A;  5B8H A;  1T6C A;  4JKB A;  4B1W B;  4JK7 A;  4F9O A;  4DHY A;  4A59 A;  2JWK A;  4Z94 A;  2JWL A;  2E88 A;  4NB4 A;  4O8K A;  4BRL A;  4Y0W A;  1V4S A;  3A8Y A;  4BGA A;  1ZBS A;  5AQI A;  1YJW N;  3F2K A;  3VEY A;  3TSP A;  4FWL A;  2NRZ A;  4EHT A;  3QIC A;  1VQL N;  1WUA A;  4WQ5 C;  3O8M A;  1XUP O;  2A6A A;  4NLC A;  3O80 A;  3CCV N;  5C12 A;  2NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...