2NRHA

Crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
192
Chain Sequence
LLLCDIGNSNANFLDKYFTLNIDQFLEFIFYINVNEHLKEHLKNQKNFINLEPYFLFDTIYQGLGIDRIAACYTIEDGVVVDAGSAITIDIIHLGGFILPGIANYKKIYSHISPFNTQVSLDAFPQKTMDALSYGVFKGIYLLIKDAAQNKKLYFTGGDGQFLANYFDHAIYDKLLIFRGMKKIIKENPNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator, putative, Baf family
publication title Crystal structure of conserved putative Baf family transcriptional activator from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Structural genomics, unknown function
total genus 59
structure length 192
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA01
3CIPA 4FL9A 3HSCA 1Q18A 4BREA 3GE1A 2P9SA 4K41A 3LDNA 2YJEA 3VOVA 3HI0A 3CHWA 4CZHA 2QWPA 4EHTA 1ZC6A 1X3MA 4BRQA 5FPEA 4CZKA 4FPBA 5BPMA 3RSEB 3DWLA 2FF3B 2IIRA 5BN8A 4PKIA 3FZMA 2V7YA 4MLEA 2YHWA 1DEJA 1BO5O 4I6MB 5ADXA 3R9PA 3LDOA 3MDQA 4FSVA 2W41A 1XQSC 4XEIA 4HWIA 3C7NA 1U2VA 2I7PA 4XH4A 2FSNA 1KXPA 1X9JA 3WXKA 5BPNA 3VGMA 2P9LB 3H3NO 5AQOA 4GNIA 3UKRA 1QQMA 4EAHD 4PKGA 4EHUA 1XUPO 2ZGZA 4FWNA 2D1KA 3CJ9A 1XC3A 3QB0A 4QS7A 3AAPA 2IVPA 4IWVA 5TKYA 2VWBA 3WQUA 5AR0A 1P8ZA 2YHYA 3GOIA 4BRNA 4DHYA 3O80A 3BP8A 3D2FA 3D2EA 3H6EA 3KZBA 2D0PA 3FFKB 3A5LC 4Y0WA 2KHOA 5AZIA 4ISFA 3VF6A 4JNEA 1NGIA 4MO5A 1NGBA 3BF1A 3A5NC 2E2PA 1HUXA 5AQSA 2W40A 4BR9A 2HF3A 1T44A 4BRHA 3ZX2A 5CE3A 5AQGA 3FZFA 1QZ5A 2DPNA 2NZTA 2V7ZA 3AY9A 3CI5A 4WQ4A 3VENA 4B1VA 4IJAA 1YAGA 1NLVA 4FOIA 1D4XA 4FWMA 1NBWA 3U4LA 4F9OA 3DXMB 1X3NA 1V4TA 3EO3A 3WT0A 4M7YA 4NB4A 3DXKB 4EIAA 1HKGA 1NMDA 4BQZA 4DB3A 5AQRA 3A8YA 2F9WA 2GUPA 1LOTB 4PKHA 1ZXOA 2E20A 3OHRA 4CBUA 2E2OA 1QQNA 2QWQA 3EZWA 3AAQA 3VEOA 1Y64A 1KAXA 4RTFD 3FR0A 4CI6A 3FGUA 3FZKA 5E26A 3HZ6A 2A3ZA 4H0PA 3VERA 1BA1A 5AQMA 4CZJA 3LDLA 5AQWA 1C0FA 2P9IA 2QWLA 1J6ZA 1ATRA 4CZFA 2VCPA 5AQZA 3I8BA 2P9KA 5BPLA 4PL8A 1T6CA 2PBDA 1GLCG 2FF6A 3L0QA 4O5FA 2NLXA 3ZX0A 3O8MA 4WQ4C 3U9DA 2P9UB 3A0IX 5KQDA 3L4IA 4LC9B 4BVOA 2Q1NA 1S3XA 1WOQA 1E4FT 2GWJA 4L3QA 2OANA 3ZX3A 2YCHA 1TYQA 4BROA 2A6AA 3GG4A 2E2NA 2YJFA 3IMXA 3ZETB 5LJVA 1GLBG 2CH5A 4XH1A 4CJ7A 2QWOA 1QZ6A 3ATUA 4ISEA 4KBOA 5F0XA 4B1UB 4AM7A 2QWRA 5AFUH 1NM1A 4WQ5C 3H1QA 1GLAG 1GLEG 4B1ZA 4CZEA 1HKCA 3ID8A 1MWKA 4JHDA 5AQFA 5JLFA 3B8AX 2I7NA 2Q31A 3TPQA 2E8AA 3UE5A 1HX1A 1K8KA 3EN9A 3TU5A 3ZEUA 3H46O 2ASPA 3UKUA 5KPTA 2ASMA 4FWPA 1U2VB 1NGGA 5B8HA 1ATNA 1RDWX 2NRHA 4CZGA 1YXQA 2YHXA 2HF4A 2V51B 4JN4A 4BR7A 4C23A 2VYPA 2Q2RA 1H1VA 2J4RA 2HOEA 3QFPA 4BC4A 1OKJA 4ISGA 5BRDA 2E1ZA 1NWKA 3HTVA 3P4IA 2EWSA 3EL2A 3O1WA 3O6WA 3W0LA 2QM1A 4YDUA 4CBWA 2P9LA 2QXLA 3LDQA 3MK6A 5KQ8A 2QW9A 3D7EO 2A42A 3DJCA 1C0GA 5E84A 4BRGA 3H1VX 1ATSA 4BVPA 3ENOA 4H5WA 3O1BA 5AQXA 3D2FB 1G99A 3D2EB 4Z94A 3SJHA 5AZJA 3IUCA 3CQXA 5AZIB 2AP1A 3ULEB 2Q0RA 1MWMA 2ZF5O 1ESVA 3IDHA 4E1JA 4BRMA 3CJ7A 1JCGA 3VF4A 2GWKA 2IVNA 2A40A 1BG3A 3SK3A 3WQTA 2CH6A 4H03B 3WEEA 2QWMA 3QMLA 2H3GX 5AQYA 1SZ2A 1BU6O 4H5RA 3SMPA 4IXCA 1SQKA 4J8FA 4H5VA 4A2AA 2GEMA 1Z05A 4BRPA 4BC5A 4H5NA 5BREA 3MN6A 3L6QA 4MO4A 2BUPA 1ZBSA 1KAYA 4BR4A 4H0OA 4K42A 4IZ9A 4M7XA 4B1YB 4FWQA 3M1FA 4XH5A 3VEXA 4CZMA 5FPNA 2P9PA 4BR2A 1TUUA 4FWRA 4BG9A 3W3DA 3WXIA 3GL1A 4CD3A 1R59O 5JMVA 4H0TB 4BC2A 5JICA 4FWSA 1IJJA 3R6MA 5BN9A 1EQYA 5AQLA 3CJ1A 1JCFA 3MN9A 3FZHA 4QS9A 3DAWA 5EY4A 4GY2B 3EKSA 3U8XA 4H0XB 4MLHA 2E88A 4JD2B 3ENHA 3VEZA 4BGBA 1BDGA 2P9KB 2P9SB 1SAZA 5ADXH 2ZWHA 3EKUA 5KPRA 3VETA 1BA0A 3QBXA 3QFUA 4B1WB 3JXUA 4BC3A 5AQJA 1YUWA 3O5BA 2P9NA 1KAZA 3SLCA 2ASOA 3GDQA 2HMPA 3BF3A 2CGJA 1TYQB 3MN7A 3CJBA 3VESA 1RFQA 2P9UA 3BEXA 4O8KA 4BRDA 2FSKA 2FSJA 5EXWA 3J8AA 4K25A 2Q36A 3CQYA 4BG8A 1V4SA 3VEVA 1GLJO 5BR9A 3M6GA 2UYTA 3HBTA 4BRIA 3RSEA 4JHDB 3AARA 5AQKA 3ZETA 1HJOA 3IFRA 4B9QA 4BRKA 1NGEA 1HKBA 2V52B 4BR5A 3C7NB 4H5TA 4CD1A 1K8KB 3ZEUB 3UKUB 5BRFA 1TUYA 4FPAA 4I6MA 3I33A 5AQVA 4CZLA 5AQNA 5AQTA 3WUHA 3R8EA 3UKRB 3VEYA 1BWFO 2GTDA 5ELZA 3FE1A 3VEWA 3MN5A 1QHAA 3C0BA 1BUPA 4A62A 1IG8A 2FXUA 2A41A 3CETA 4FOEA 5FPMA 3VPZA 5KPZA 4QS8A 3S41A 3A5MC 3KVGA 5AFUA 3GBTA 1DGKN 2Q0UA 1JCEA 3CJCA 3HM8A 5EX5A 4A61A 4FO0A 2Q97A 1U6ZA 4PL7A 5F2RA 4NO7A 1NGFA 3ATVA 5AZJB 4BQLA 4EFHA 1HLUA 2CGLA 3O4WA 1DKGD 4A2BA 4B1XB 1MDUB 3FZLA 1NGDA 4BRAA 1MA9B 3FLCO 3MMVA 3VGKA 5F1XA 1CZAN 3G25A 1NGJA 4BRLA 3ULEA 2FLOA 5LY3A 4HTLA 4RWTA 3WEEB 3KHYA 2QWNA 2A5XA 2AA4A 3H3OB 4WYBA 4CBXA 1GLLO 1NGAA 1BOTO 1E4GT 1T6DA 3CJAA 5AQHA 4BGAA 3SMSA 5I9EB 4FWLA 5EVZA 3M3ZA 1NGCA 4BRFA 4H0VB 2ITMA 4FWOA 3U9ZA 4AM6A 2BTFA 2ZGYA 5AQQA 4H0YB 2E2QA 4CZIA 4YDUC 1YVNA 3JS6A 3DXMA 3LDPA 1GLFO 2IVOA 3LM9A 3MCPA 5LJWA 3DXKA 2P9PB 4M63C 5AQPA 4FWKA 2F9TA 3QDKA 1Z6RA 4RCHA 4WQ5A 2WUSA 3QICA 2YI1A 1LCUA 2D0OA 2PAVA 3LL3A 1QQOA 5AQUA 3F9MA 4BRCA 1NGHA 3LM2A 1WUAA 3QBWA 4DQ8A 2P9IB 2D4WA 4IO8A 3VF2A 5AQIA 3BUZB 5EOYA 3VGLA 4K43A 4BR0A 1S22A 2GELA 4DCHA 4JAXA 1GLDG 5JLHA 1HPMA 5FPDA 3A5OC 4IJNA 3CERA 3H45C 3WXJA 3WXLA 2P9NB 3UB5A 2CGKA 5BRHA 3O08A 1RGIA 4JD2A 2E1YA
chains in the Genus database with same CATH superfamily
4I7FA 3HSCA 4CJ4A 1P90A 1QQCA 4A5AA 2HHTA 2YX6A 3VOVA 5M1PA 4X62K 3HI0A 4EHTA 4ZTJA 4B3RK 4H8KA 5C2FA 2UUAK 4OX9K 4Z4HA 5BPMA 1EP4A 4FPBA 4JI5K 2IAJA 3WNHA 2FF3B 4DUZK 5T7BA 5BN8A 3FZMA 2PFUA 3C94A 4I6MB 5ADXA 1G15A 4E19A 4FJLA 3LDOA 4KHYA 3ZSOA 3O3FA 3RRGA 1S1WA 2O4IA 2HBLA 2KKZA 4CJFA 3DI6A 3C7NA 2I7PA 3D0PA 4PUOA 2KFNA 2FSNA 1KXPA 4DV4K 4KKOA 3VGMA 4MDBA 2OYQA 5AQOA 3TR8A 1RILA 3UKRA 3CCMN 4DU4A 2GV9A 3IG1A 1XUPO 1NK6A 3M5RA 2ZGZA 4M3WA 4FVMA 4FWNA 2D1KA 3AGRA 1TKZA 4W5QA 4JLHA 1Q82O 4QCLA 4QS7A 3AAPA 2IVPA 4IWVA 4KHQA 5AR0A 4GKKK 2OPSA 5GIPA 2P5GA 3BP8A 4OPJA 2KW4A 2D0PA 3RWUA 4U67L 4ISFA 3BZCA 4CEQA 3AO1A 4MO5A 4AHVA 3QEXA 4DSJA 2W6KA 1XNRK 1HUXA 3ZSXA 2ZD1A 2HF3A 1T44A 3FZFA 2OPRA 4I9LA 3CYMA 3CCVN 3DRPA 1QVFM 1D4XA 4E1NA 4FK0A 4CF8A 1RCHA 3AA2A 3NMUA 1YJWN 4F9OA 1BIZA 3DXMB 1X3NA 1VAZA 3AVFA 3THYA 3O9QA 1HKGA 1NMDA 1S72N 4BQZA 2JGUA 4I2PA 3RR7A 2GUPA 5GAHP 1ZXOA 4C1NK 3DOKA 2ZE2A 3DRSA 1XWLA 4WE1A 1QQNA 2QWQA 3EZWA 1Y64A 1KAXA 3TTCA 3MX2A 3FZKA 3J7AP 2ZQBA 4OKJA 5E26A 3HZ6A 5HLFA 3VERA 3C65A 5AQMA 1NKCA 4DTOA 4IFYA 5CZ2A 3SJJA 2P9IA 1Q81O 1VK0A 3N4PA 2P9KA 1RT5A 3L0QA 3CM6A 2NLXA 4C8KA 1KCFA 5KQDA 4BVOA 3VQDA 2IGIA 1WSGA 3L2RA 4E3SA 3JAMO 3ZX3A 2YCHA 1TYQA 3HP6A 1TGOA 2O8DB 2E2NA 4CK3A 1I94K 1GLBG 4M3RA 3AO5A 4B1UB 2QWRA 3O4QA 3VQAA 4IFEA 1GLAG 3K5MA 1GLEG 4FZXC 4ILHA 3OS1A 4JKGB 2YHBA 3D6RA 5J2PA 4JHDA 5JLFA 3B8AX 2I7NA 3TAQA 2D0CA 5CR4A 3AGKA 3G71N 1K73O 1HRHA 3OYDA 1BISA 4FK4A 1BGXT 4DQPA 1HX1A 2YNIA 1K8KA 3EN9A 3TU5A 5KPTA 3KLEA 2ASMA 4FWPA 3TAFA 3JSMA 5I3UA 2NRHA 4CEEA 1UWBA 5CY4A 4C23A 1O1WA 3OYKA 2VYPA 2Q2RA 4N41A 2J4RA 3HRGA 2KFZA 1BQMA 4BC4A 4OLBA 2PY5A 3OS2A 4KHWA 2E1ZA 4ZTFA 4HUEA 1TKDA 5KGXA 4DFJA 2QM1A 4QOZB 4CBWA 3L3VA 5M1QA 2QXLA 4FLTA 4BE1A 3D7EO 1J5EK 5E84A 4BRGA 4CECA 4BVPA 3THWA 3D2EB 4FJ9A 5AZJA 4J2BA 3IUCA 5K14A 4AHTA 1NK8A 1MWMA 4CIFA 2RE2A 2ZF5O 1RT6A 4E1JA 1KD1O 1HR0K 1TVRA 2GWKA 2IVNA 1XC9A 4DTUA 2QTDA 2ATQA 2CH6A 1ILYA 1A5XA 3QMLA 3VQBA 4CGHA 3WNFA 2VG7A 4J8FA 3V6DA 5HBMA 4KI6A 1JXEA 3ZLJA 3ENBA 4FXDA 3LP0A 1CZBA 4Y1CA 1X9SA 4DFKA 4IZ9A 4NLCA 1L5UA 4OPHA 1NK4A 4KHSA 1W0HA 3W3DA 1KLNA 5JMVA 4A59A 2ZJPL 1IH7A 1IKWA 3SUPA 4HTUA 4FWSA 4E0DA 3R6MA 3CJ1A 1JCFA 4ELVA 1IBKK 3U8XA 3NHGA 2KTQA 3QNOA 4H0XB 3NF6A 3HYFA 4FM2A 2NRRA 4M45A 2DY4A 3VEZA 2OTJN 5ADXH 2ZWHA 3VETA 1BA0A 1BL3A 1YIJN 2OZMA 4QAGA 3JXUA 2D5RA 4DTRA 4JI3K 2F7TA 1WSEA 3SLCA 2ASOA 4F8RA 2HMPA 3I55N 4B8AB 3BF3A 4E7HA 3ZT3A 1T7PA 1DLOA 1RFQA 1GOAA 2Z1IA 4BRDA 3CFRA 1Q8IA 2FSKA 2KLAA 2FSJA 2W6LA 3AA5X 2Q36A 3CQYA 4BG8A 1GLJO 3M6GA 4JI1K 2QK9A 4FM1A 5AQKA 4C8NA 3IFRA 4BRKA 4W5TA 1HKBA 2V52B 3C7NB 4H5TA 2JLEA 3NE6A 4CFAA 1KVAA 1S5JA 4FPAA 4I6MA 3I33A 5J1EA 4LFCK 1HQUA 1JLQA 3UKRB 3VQ9A 2NRXA 4JRPA 5HP1A 3MN5A 1LW2A 1IG8A 3CETA 5FPMA 3ULDA 2E4LA 4N47A 3A5MC 1YTAA 3LP3A 4DQQA 4FM0A 3CJCA 4LFBK 4KH4A 2R7YA 3HM8A 4KPYA 4A61A 3KTQA 1VHXA 3KD1E 4JK8A 1TK8A 1OH8A 3NGYA 3ZT0A 1QTMA 3HT3A 2CGLA 4DR2K 1DKGD 3CFOA 1Q9YA 4IBNA 4CE9A 4JYAK 4CEAA 4JS4A 4DR1K 1UOCA 2AJQA 3HM9A 1YVUA 2F8TA 1NGJA 4DG1A 4W5NA 4OLAA 4BRLA 1HNWK 2BE2A 5LY3A 3ZSZA 4RWTA 3KHYA 2WONA 3NBPA 3OJUA 1VQLN 4LF9K 1A5WA 1O13A 2A5XA 4OKKA 1T6DA 1GLLO 5I9EB 3SMSA 3G4SN 1NGCA 2XY8A 4H0VB 2ITMA 3THYB 3U9ZA 4LFAK 4E1MA 3ZSRA 4GV9A 2BTFA 5AQQA 4H0YB 1L3VA 1TL3A 4UQGA 3KKRA 4CZIA 4X66K 4YDUC 3K59A 3O3HA 3DXMA 3HP9A 3MCPA 3NGIA 1X9WA 2EX3A 1RBVA 5AQPA 3ISNC 3NF8A 2F9TA 4Z0UA 1Z6RA 4GV6A 3MWPA 1RTDA 4OO1J 3QICA 4DR3K 4DTSA 1NKBA 1HNXK 2D0OA 1BQNA 3HOSA 1QQOA 4OPKA 2NRTA 1YT3A 3F9MA 1WUAA 3L2QA 1HYSA 4LF7K 2P9IB 1K8AO 3VQ4A 1T3VA 5AQIA 1HYZA 3V81A 3SBTA 3KK7A 3T1YK 4BR0A 2GELA 2X6NA 4JI2K 5LMNK 3AA4A 5JLHA 1T03A 1Z25A 1WN7A 1HPMA 2OCEA 3SUOA 4O4GA 3OVNA 1UA0A 3WXLA 5HRSA 2P9NB 2CGKA 4FZYA 4JI6K 1RGIA 1RT3A 2D0AA 4CHYA 3KWIA 1Q18A 3DOLA 3ITHA 4BREA 4NXNK 3SQ2A 3OBYA 4LY7A 1EXQA 4CGDA 1U47A 1KQSM 4GVMA 4BRQA 5IWAK 4M3UA 3NH0A 1FW6A 1RTJA 4PKIA 4JI0K 3HJFA 2Y1JA 1VSDA 1JLGA 4JKGA 3MXIA 3QINA 1KSPA 2IC3A 1DEJA 3S3OA 4XIUA 1ZBLA 4DV3K 1L3TA 3R9PA 3THXB 2PYJA 4KHNA 4HWIA 4DF4A 3BY5A 3OS0A 3AVLA 2FBXA 4XH4A 1VSMA 3WXKA 1HYVA 4ID1A 3H3NO 2NUBA 2IDOA 4GNIA 3SV3A 2A1SA 1QQMA 4PKGA 3PO5A 4EHUA 1HMVA 3IRXA 3NF9A 3I56N 3MECA 3IAYA 3THWB 3F2KA 1WSHA 1XC3A 3QB0A 2E5LK 5TKYA 2VWBA 3GOIA 4HHTA 3OYIA 3LANA 3PUFA 4CJ3A 3D2EA 3THVA 4FLXA 5HL7L 3A5LC 3HL8A 5JS2A 1VSLA 4IFVA 3VF6A 5I42A 4PQUA 4O8UA 1U49A 3BF1A 2IS3A 2WTUA 2E2PA 1XHXA 4BR9A 3KLHA 1LV5A 1IBLK 3ZX2A 4AH9A 5CE3A 4M3TA 4IEEA 1QZ5A 2G8IA 2WOMA 2NZTA 4CEZA 4K8ZA 4BDZA 4IJAA 4X65K 1YAGA 1JLBA 1VQPN 2HHUA 1S9GA 4JKBA 2ZM6K 4CJSA 3NVMA 3EO3A 4EIAA 4KTWA 1JLEA 5JVGL 5AQRA 3TABA 2UXBK 1Q86O 4FW2A 4PKHA 2YNFA 3P1GA 3SQ0A 1W97L 2KQ2A 3VEOA 4W5RA 3K5OA 3FGUA 4IOAL 2HW3A 4H0PA 3SAHA 1BA1A 2OZSA 5E41A 1QSSA 4CZJA 1LWFA 1D9FA 4HCCA 5AQWA 1OVYA 2QWLA 1ATRA 5AQZA 5CYQA 1JL1A 1GLCG 3O8MA 3L2WA 4YOXA 1NK5A 1E4FT 3ALYA 1RT4A 3DLBA 2A6AA 4LSNA 5LJVA 3ZT1A 4CJ7A 2XY5A 4OVLA 2QWOA 1QZ6A 3ATUA 4ISEA 1C0MA 1VQON 3J7YP 1SUQA 5M1KA 4KTQA 2VG5A 3ID8A 4ZHRA 1HQEA 3TANA 1YTUA 1WLJA 1CXQA 2E8AA 3SAGA 4FJ8A 2F96A 3VQ8A 1EO1A 1YITN 4CFBA 2ASPA 5CYMA 3RVCA 1U2VB 1NGGA 5B8HA 5TKWA 1ATNA 2HF4A 2V51B 3D45A 1DT9A 5KTQA 4DR7K 4CEDA 4CESA 1S1VA 3HTVA 3ZCMA 4CJUA 4CF2A 2EWSA 4GKJK 3O6WA 3W0LA 3NAEA 4F2SA 3LDQA 3DJCA 1C0GA 3H1VX 1ATSA 1G99A 1GOBA 4OPAA 4AILC 2Q0RA 3SI6A 1K6YA 1ESVA 3IDHA 3TWHA 4B08A 2RPIA 4BRMA 3LP1A 3CJ7A 3QNNA 1JCGA 1TKTA 1WNSA 1REVA 2HNDA 3SK3A 2O8CA 4KH5A 1F21A 1QE1A 4M3XA 2QWMA 2YHAA 2H3GX 3B6PA 4HUGA 4JK9A 1DTQA 3DLGA 4HUFA 4F3TA 3S3NA 1RT7A 1NK0A 3BGRA 3HVRA 1Z05A 3MEGA 4H5NA 4FCYA 3MN6A 3E9LA 1QVGM 4KHPK 1ZBSA 3PIOL 1IG9A 4BY9C 4H0OA 3O9SA 4K42A 1JXBA 4NYFA 5C42A 2A1RA 4LF6K 4FW1A 2E6MA 4FWQA 4XH5A 5FPNA 5HRRA 4JRQA 4BG9A 4Q0BA 3CXCM 3HSTB 5JICA 3K5NA 1IJJA 5BR8K 4WFAL 4CCHA 3UIQA 3CPWM 1LW0A 4GY2B 5HOOA 1Z26A 3LP2A 4BGBA 2OPPA 3MEEA 3CCUN 2QKKA 3EE8A 3BZKA 3EKUA 2HHWA 5AQJA 4DSEA 2HHXA 3VQ6A 2P9NA 1QHTA 3AVGA 2O8EA 2BANA 2JWLA 1VRUA 2RKIA 1VQ9N 1B92A 1BIUA 2P9UA 2EHGA 1D8YA 1W9HA 3J8AA 4L8RB 1NOZA 2UYTA 1X1PA 3QEWA 1WSJA 5HRNA 3OA9A 4ILJA 4CJRA 3LALA 1U04A 4JI4K 2VWJA 4NXMK 4DR4K 1VQMN 3ZEUB 3UKUB 5BRFA 1IO2A 4O0JA 5AQVA 3V1OA 1ZBIA 3OYBA 4JEPA 3OYFA 5J2QA 3WUHA 3THXA 3VTIA 4M42A 3T3FA 1BWFO 4HVJA 3VEWA 3DRRA 1SL1A 1QHAA 4IO9L 1VQ8N 4A62A 3OYEA 4FZZA 1QS4A 2A41A 4FOEA 4KRFA 3EZ5A 4CFDA 5GINA 1VQNN 4BE0A 3S41A 1W7AA 1J54A 5AFUA 1LAWA 2HHHK 1DGKN 2E6LA 4F2RA 1JCEA 3V4IA 3KLIA 4X64K 1X9MA 5EX5A 3RMCA 4FO0A 2Q97A 1WBBA 3K9KA 4CJKA 4B3SK 4RW7A 2QI2A 1SV5A 1SL0A 4B1XB 3R3LA 4KO0A 1MDUB 4EZ6A 3V9ZA 3FZLA 4I9QA 1KC8O 3OW2M 3MMVA 3VGKA 3G25A 4IEIA 4B9SA 4LF5K 3SUQA 3VA3A 4HTLA 2BDPA 1ZBFA 5J2NA 1S6PA 2P1JA 2QWNA 4F3OA 3V9XA 2Y1IA 4O55A 4WYBA 4BGAA 4GW6A 1E4GT 4CBXA 2P5OA 2YKNA 2QEXN 4FWOA 3F73A 3AVIA 4B9LA 2QKBA 3AVNA 2ZGYA 4DTNA 5IT9O 5J2MA 4DU1A 2HMIA 5AJ3K 3MAQA 5LMUK 4E7KA 2W42A 3LDPA 4JKCA 4O0IA 1VSJA 1ASUA 2P9PB 4M63C 1FXXA 1NJYA 4B9VA 3QDKA 3V1RA 1U4BA 1S1XA 3CCSN 4WQ5A 3DM2A 2WUSA 4IDKA 1J9AA 1LCUA 3AA3A 5GAEP 3LM2A 3TARA 4LF4K 4DQ8A 4FLVA 4FLYA 3F5TA 1YI2N 3U3GA 3VF2A 5A2QO 4FJKA 2FBTA 3VGLA 3P31A 1S22A 4DCHA 4V19S 3PX4A 2ZJQL 1D9DA 2FC0A 3M8SA 4BWJA 4OGEA 1WB9A 4FJHA 4E7IA 3WXJA 4WF9L 1XI1A 5DK5A 3ZSWA 3O08A 1IBMK 3KLFA 4FL9A 3GE1A 2FBYA 4K41A 3LDNA 3CQ8A 1S1UA 3DYAA 4FJXA 1X3MA 1OH5A 5FPEA 4MQ3A 4CZKA 3QETA 3RSEB 3AVKA 1U48A 2KZZA 1N36K 3AO3A 3R1XA 4MLEA 2YHWA 2I5JA 4FK2A 1NJXA 4CJQA 1RBTA 4CJWA 4MFBA 2XRIA 3MDQA 1N33K 1XQSC 1BI4A 4XEIA 2B6AA 1U2VA 4O44A 3E9PA 3TAGA 4FYDA 1X9JA 1FKPA 3FFIA 2B4JA 4KI4A 4EAHD 4DSFA 4M41A 3WNGA 1T05A 1VQKN 4Y1DA 1NU0A 3OTOK 4DSLA 4RW8A 2UXCK 2WFBA 1HNIA 4B3OA 1NK9A 1QSYA 5FDLA 5SZTA 4DKWA 3K2PA 4NCAA 4BRNA 4DHYA 3O80A 5DM7L 3G0ZA 3MXJA 4Y0WA 2X78A 4CHPA 2KHOA 4CW7B 2O8CB 4W5OA 3P83D 4JNEA 3KK3A 3J80O 3OYJA 5GAGP 3A5NC 5FRNA 3HK2A 4Q5VA 4BRHA 4GMJB 3CI5A 3AY9A 5M1OA 4WQ4A 3VENA 4B1VA 4IOCL 2RHKA 1M90O 4FWMA 4J2AA 2HHQA 4KH6A 1Q9XA 1VSKA 3CCLN 3PIPL 3OBWA 2Z1HA 1V4TA 1KFSA 4M7YA 4NB4A 3DXKB 4YFUA 2ITGA 3C6TA 4DB3A 2NRZA 3ID6A 1LOTB 3C6HA 2E20A 1VQ7N 3P39A 1HNVA 2E2OA 1VQ6N 3L8BA 1JLFA 3EEQA 4N76A 5FRMA 5C25A 2A3ZA 3A2FA 1J53A 4CGGA 4BDPA 1C0FA 4M3YA 4CFCA 3I8BA 2O8EB 4PL8A 1T6CA 2PBDA 3M8PA 4O5FA 1FK9A 3I0RA 2OA8A 4WQ4C 3U9DA 2P9UB 3L4IA 4LC9B 2ETJA 2Q1NA 1S3XA 2GWJA 4LH5A 1VRTA 2OANA 4L3QA 5MLCQ 3IMXA 5C10A 2CH5A 4JI8K 4KBOA 5F0XA 2G8HA 5AFUH 1R0AA 1VQ4N 4GVEA 4B1ZA 4CZEA 4N56A 3LPTA 5AQFA 5FLXO 3TPQA 1BCOA 2HBJA 5FROA 3UE5A 4NLBA 3DLLL 3ZEUA 3H46O 3UKUA 4Z4CA 4G9ZA 1WSFA 3T7ZA 3CC7N 1RDWX 3SZ2A 2G8WA 4CZGA 4JKDA 1NG9A 4JN4A 2UU9K 1D5AA 4BR7A 4CGFA 3F9KA 4PHTX 4DV2K 4FJGA 1C1CA 4DFMA 3E01A 1OKJA 4ISGA 3NDKA 2HBKA 4CVNE 1RDAA 2HBMA 4PY5A 2P51A 1C6VA 3QEIA 2P9LA 1E3MA 5KQ8A 3MK6A 4YY3K 2NRWA 1NJWA 2A42A 2XO7A 4B8CA 3OYMA 3ENOA 4H5WA 3O1BA 3D2FB 4ILGB 4Z94A 5C2DA 4IKFA 4U7BA 3CQXA 3VQPA 5AZIB 4FLUA 3ASMA 4B3MK 5JS1A 3AVHA 3CMEN 4DQIA 3B6OA 3WXMB 1KVCA 3KD5E 3L2UA 2F8SA 3WQTA 4KTZA 3HPHA 3SQ1A 4EP5A 3SAFA 2RN2A 3Q7CA 4E7JA 4DTXA 1SZ2A 1BU6O 4CF1A 1WBDA 4IXCA 1SQKA 4H5VA 2QA4N 4BRPA 4JKEA 5GIOA 1KTQA 5BREA 3L6QA 3SPZA 3PSFA 4DTMA 4BR4A 3VQQA 3M8QA 4JKHA 4M7XA 4B1YB 3M1FA 3AVAA 1YJNN 4CZMA 2P9PA 2O8BB 4BR2A 4A57A 1TUUA 3WXIA 1RBSA 3TAEA 1EX4A 4CD3A 3K57A 4H0TB 3SYZA 2XHBA 4BC2A 5EU7A 3HOTA 4RW4A 1S9EA 3FZHA 4QS9A 3S9HA 2F4VK 1RDCA 1TAQA 3EKSA 1QSLA 1ASWA 4MLHA 3WNEA 1JLCA 2D0BA 2G8FA 2E88A 3ENHA 4LD0A 2X74A 4Z4GA 3KK1A 5KPRA 1VQ5N 3O9UA 3QBXA 3QFUA 3DLHA 4B1WB 2UXDK 4TSXA 4BC3A 1CLQA 3E9OA 1KAZA 1DTTA 4CK1A 3TAMA 3MN7A 3G6EN 3CJBA 1IKVA 3TSUA 3QERA 4FLWA 2DFEA 3VESA 2VQFK 4PWDA 4AF1A 1LAVA 1V4SA 1KFDA 3HBTA 4AHCA 4DS4A 1A5VA 4DV6K 3RSEA 3ZETA 1BI4B 4C8LA 5KRTA 5D3GA 4CD1A 3QIPA 2YNHA 1TUYA 3V9SA 4DWIA 5H1SQ 2GBZA 3VEYA 2GTDA 4CJPA 3FE1A 1WAJA 3VQ5A 1TK5A 3SBGA 3OJSA 1TL1A 3AVBA 4J2DA 1N32K 2YNGA 3SUNA 4DUYK 1CZ9A 3EE9A 3PY8A 2ZJRL 4LF8K 4CIGA 3QO9A 4A5BA 4YHHK 3AVMA 3PX6A 4PL7A 3CCQN 3ZT2A 4NO7A 4DMNA 1GOCA 3PX0A 3ATVA 4BQLA 4NYNA 1HLUA 1RT2A 4AQYK 4A2BA 4BRAA 4DV0K 2B5JA 1MA9B 1CZAN 3ULEA 2FLOA 1B9FA 3ZT4A 4G1QA 3KLGA 3WEEB 2DFFA 3QEVA 3AO2A 4DQRA 5AQHA 1BOTO 1NGAA 3CJAA 4FWLA 5EVZA 4R79A 4YOUA 1J5OA 4BE2A 1RTIA 3QLHA 2FBVA 1YF5L 2VQEK 3E66A 2E2QA 3PSIA 4CHZA 3JS6A 2NRVA 3E1YA 4DR5K 1GLFO 3CFPA 2IVOA 2Z1JA 4O5BA 2XY7A 1Q7YO 3DXKA 1EKEA 4B9TA 4FWKA 3PO4A 4RCHA 3HXMA 1VSEA 3I8DA 4DSKA 2YI1A 2PAVA 4IOXA 4CJLA 2O8FB 3J7ZO 5AQUA 4BRCA 1NGHA 1RT1A 4DLEA 4KB0A 2HNYA 3MEDA 4K43A 4JS5A 4ICLA 4JAXA 1GLDG 5LL6Z 4R5PA 3CC2N 3SPYA 4IJNA 3VMFB 1CXUA 3C6AA 3VA0A 3T1HK 3RTVA 5BRHA 4WCEL 1SKRA 4JD2A 4UY8O 1C1BA 3SCXA 3C95A 3CIPA 3IKMA 3LPUA 2P9SA 3ZSYA 2YJEA 4MDAA 5C15A 3CHWA 4CZHA 2QWPA 5M1NA 3BDPA 3VQ7A 4WFBL 1ZC6A 3CMAN 2X6SA 3DWLA 4E89A 4DV1K 1VSIA 2IIRA 4BDYA 2V7YA 5C0YA 1I39A 1BO5O 2O4GA 1RDUA 4KV8A 4B9UA 1C1AA 4FSVA 4Z4EA 1I3AA 2W41A 3OYNA 4K0KK 3OYHA 4AHSA 4DTPA 1XMOK 2JWKA 2UUCK 3DMJA 5BPNA 2P9LB 3L2VA 2NNWA 3LWLA 1N5YA 2YKMA 3CF5L 4FJ7A 2HHVA 1K9MO 3KJVA 3L3UA 5CZ1A 3N4QA 3CJ9A 4CF9A 1ZYQA 1YJ9N 1FKOA 3G10A 3KIOA 3WQUA 1P8ZA 2YHYA 3CCRN 1XMQK 4EP4A 3D2FA 3H6EA 3KZBA 3FFKB 3LDSA 1RDDA 4BWMA 5AZIA 4KFBA 4CGIA 1ASVA 1NGIA 1S1TA 3CG7A 1NGBA 1HPZA 1EWRA 5AQSA 3SV4A 2W40A 3OYCA 1MU2A 4ELTA 5AQGA 2DPNA 2V7ZA 4YOYA 3U6FA 3MX5A 4DSIA 1NLVA 2HB5A 4FOIA 3TAPA 3P38A 1NBWA 3U4LA 4DTJA 1JKHA 3V9UA 3O9RA 4CJ5A 3WT0A 1YHQN 1KVBA 4DLGA 1EWQA 2VGNA 4JI7K 3A8YA 3I0SA 2F9WA 1W2BM 2PZSA 1NOYA 3CCJN 3KWGA 3S3MA 1T8EA 4CBUA 3L4QA 3OHRA 4CEOA 3DLKA 3H08A 2O8BA 3AV9A 1L3SA 4DV7K 5DM6L 3AAQA 4KAZA 4FJJA 4RTFD 3FR0A 4CI6A 1XHZA 4FJNA 3O3GA 1SKSA 3VTHA 3TTFA 3LZIA 3VQEA 1NKEA 3LDLA 4CZFA 4K8XA 1J6ZA 2VCPA 2RF2A 3K0SA 4C1NI 5BPLA 3ZX0A 4FJMA 2FF6A 2G8KA 3VQCA 3A0IX 4CEBA 2XY6A 3QESA 1WOQA 3RMDA 5KGWA 4BROA 1LWCA 2HHSA 3GG4A 1VSFA 2YJFA 3ZETB 1NJZA 3ZSVA 4XH1A 3JYTA 1HJRA 4AM7A 4DV5K 1NM1A 1RNHA 4WQ5C 3H1QA 3LAMA 3HPOA 4CK2A 4EZ9A 1HKCA 4CHQA 5HROA 1MWKA 2Q31A 2OTLN 3NGZA 4I2QA 3KK2A 4FJ5A 4KHUA 4LH4A 1RBUA 1Y97A 3IS9A 1JL2A 3V1QA 4WFNL 4FJIA 3LAKA 1YXQA 2YHXA 2Z1GA 2VGMA 4YOTA 1H1VA 4Z4FA 4F4KA 2HOEA 3QFPA 5BRDA 3MXMA 3QEPA 4M3ZA 1NWKA 3AVCA 3P4IA 3EL2A 3O1WA 4ID5A 4AHRA 3AO4A 4YDUA 4DR6K 3P5JA 2DTUA 2QW9A 4DFPA 3NH2A 5AQXA 2GUIA 3OY9A 5CHIA 3SJHA 1EETA 1UAXA 2AP1A 3ULEB 4CHNA 4DS5A 1B9DA 1TK0A 3TTDA 1HNZK 2HSTA 1UA1A 3LZJA 1WSIA 3CCEN 3VF4A 3T1AA 3SQ4A 2A40A 1BG3A 4RG8A 3NVKA 1RTHA 3C6UA 1N34K 4KB1A 4H03B 3WEEA 1RDBA 5DMRA 5AQYA 3NCIA 1LWEA 3DLRA 3EY1A 3T19A 4H5RA 3SMPA 3T69A 2G8VA 3OYGA 4A2AA 2GEMA 4N5SA 1C0UA 1BHLA 4BC5A 4MO4A 2BUPA 2VWKA 4BACA 1KAYA 1TV6A 4JK7A 3K58A 4HCBA 2KZMA 3KKSA 3Q7BA 4DF8A 4IDHA 4H4OA 1OVQA 3VEXA 5C24A 4FWRA 4B9MA 3GL1A 1R59O 3OYLA 1SKWA 5BN9A 1EQYA 5AQLA 4YNQA 4FLZA 4CF0A 4Z4IA 2O8FA 3MN9A 3NF7A 2HVIA 3DAWA 5EY4A 3CC4N 2PYLA 2G8UA 3SNNA 3QIOA 4JD2B 4IG0A 1BDGA 2P9KB 2QXFA 2P9SB 3K9JA 1SAZA 1ITGA 1NNEA 3PLAA 1YUWA 3O5BA 3MWTA 3GDQA 2CGJA 1JLAA 1TYQB 1OH7A 1M1KO 4B3TK 4CJEA 3ZSQA 4CJVA 1VSHA 3BEXA 4O8KA 4C8OA 4AHUA 1XNQK 5EXWA 2HVHA 4K25A 3RRHA 2OPQA 3VEVA 2DFHA 4RW9A 5BR9A 3HO1A 4BRIA 4KREA 4JHDB 2O8DA 3AARA 1HJOA 5JVHL 4B9QA 4FVUA 3EYZA 4OJRA 1NGEA 4BR5A 4CJTA 3MCAB 1KRPA 3DLEA 1K8KB 4RW6A 4B9NA 4J2EA 1U45A 5SWMA 4CZLA 5AQNA 1WAFA 1N6QA 1NMNA 4CGJA 5AQTA 3V9WA 3R8EA 3TSQA 5ELZA 2VG6A 2LSNA 3C0BA 1BUPA 2UUBK 4CERA 2FXUA 3VPZA 3K5LA 5KPZA 4QS8A 3NH1A 4JKFA 4YORA 3KVGA 4PA1A 3GBTA 1OH6A 4DU3A 4JKAA 2Q3SA 1NJIO 2Q0UA 1SS6A 1U6ZA 5C12A 1IV0A 3ZYYX 5F2RA 4CEFA 1NGFA 1L3UA 5AZJB 4EFHA 3RMBA 1BCMA 4ELUA 3O4WA 3OYAA 5GADP 2WBNA 4DQSA 3HPGA 3CM5A 1NGDA 2YV0X 3FLCO 2WC9A 5F1XA 1NK7A 3M8RA 2BH1A 1SL2A 4LSLA 3U3YA 3HVTA 1IKXA 2AA4A 1N8RO 3H3OB 4E7LA 4OGCA 5HRPA 2GX9A 3M3ZA 4BRFA 4CIEA 4C8MA 2BGGA 3J81O 4AM6A 4GV3A 4YOVA 1FJGK 5KRSA 1YVNA 1ZBHA 3O9TA 3AVJA 3LM9A 5LJWA 4NCGA 1JJ2M 4JV5K 3TSPA 4OKEA 1RBRA 3PV8A 1TKXA 3TI0A 3LL3A 3CPEA 3QBWA 2IOCA 5M1FA 2HNZA 2D4WA 1ZBUA 4IG3A 3RR8A 4IO8A 3O4NA 3NFAA 3BUZB 5EOYA 1C0TA 4NCBA 4CHOA 1S6QA 1KLMA 4YOWA 5KI6A 3LWMA 5FPDA 3A5OC 3CD6N 1IKYA 3RMAA 3CERA 3H45C 3UB5A 4H4MA 1TAUA 3VN5A 2E1YA
chains in the Genus database with same CATH topology
3CIPA 3KWIA 4FL9A 3HSCA 3IKMA 1P90A 1Q18A 3GE1A 4A5AA 2P9SA 4BREA 4K41A 3OBYA 2YX6A 3LDNA 2YJEA 4MDAA 3VOVA 5M1PA 3HI0A 5C15A 3CHWA 4CZHA 2QWPA 4EHTA 5M1NA 1KQSM 4WFBL 1ZC6A 1X3MA 5C2FA 4BRQA 5FPEA 3CMAN 4CZKA 4FPBA 5BPMA 3RSEB 3DWLA 2FF3B 2IIRA 5BN8A 4PKIA 3R1XA 3FZMA 2PFUA 2V7YA 4JKGA 4MLEA 2YHWA 1DEJA 5C0YA 1BO5O 4I6MB 5ADXA 1RDUA 3R9PA 3LDOA 3MDQA 1Q81O 4FSVA 2W41A 2HBLA 1XQSC 2KKZA 4XEIA 4HWIA 3C7NA 1U2VA 2I7PA 3E9PA 4XH4A 2FSNA 1KXPA 2JWKA 1X9JA 3WXKA 5BPNA 3VGMA 2P9LB 4MDBA 3H3NO 5AQOA 2NNWA 4GNIA 3CCMN 3UKRA 1QQMA 4EAHD 4PKGA 4EHUA 1VQKN 3CF5L 1XUPO 3I56N 1K9MO 3M5RA 2ZGZA 3F2KA 4FWNA 2D1KA 3AGRA 3N4QA 3CJ9A 2WFBA 1XC3A 3QB0A 1YJ9N 1Q82O 4QS7A 3AAPA 2IVPA 4IWVA 5TKYA 4DKWA 2VWBA 3WQUA 5AR0A 1P8ZA 2YHYA 3GOIA 4BRNA 4DHYA 5GIPA 3CCRN 3O80A 5DM7L 3BP8A 3D2FA 3D2EA 3H6EA 3KZBA 2D0PA 3FFKB 3A5LC 4Y0WA 5HL7L 4U67L 2KHOA 5AZIA 4ISFA 3VF6A 4JNEA 1NGIA 4O8UA 5GAGP 4MO5A 1NGBA 3BF1A 3A5NC 2E2PA 1HUXA 5AQSA 2W40A 4BR9A 2HF3A 1T44A 4BRHA 3ZX2A 5CE3A 4IEEA 1QZ5A 3FZFA 2DPNA 5AQGA 4UY8O 2NZTA 2V7ZA 3AY9A 3CI5A 4WQ4A 5M1OA 3VENA 4B1VA 4YOYA 4IOCL 4IJAA 3MX5A 2RHKA 3CCVN 1YAGA 1NLVA 1QVFM 4FOIA 1D4XA 4FWMA 1VQPN 1M90O 3P38A 1NBWA 4KH6A 3U4LA 3NMUA 3O9RA 1YJWN 4JKBA 4F9OA 3DXMB 3PIPL 3CCLN 1X3NA 3OBWA 1VAZA 1V4TA 3NVMA 3EO3A 3WT0A 4M7YA 4NB4A 3DXKB 4EIAA 1YHQN 3O9QA 1HKGA 1NMDA 1S72N 4BQZA 4DB3A 2NRZA 2VGNA 3ID6A 5JVGL 5AQRA 3A8YA 2F9WA 1W2BM 3CCJN 2GUPA 5GAHP 3KWGA 1Q86O 1LOTB 4PKHA 3C6HA 1ZXOA 2E20A 3L4QA 3OHRA 4C1NK 3P39A 4CBUA 1VQ7N 1VQ6N 2E2OA 1QQNA 1W97L 2QWQA 5DM6L 3EZWA 3AAQA 3VEOA 1Y64A 1KAXA 3TTCA 4RTFD 3MX2A 3FR0A 4CI6A 3FGUA 3FZKA 4IOAL 5E26A 3VTHA 3HZ6A 2A3ZA 4H0PA 3TTFA 3SAHA 3VERA 1BA1A 3C65A 5AQMA 4CZJA 3LDLA 5AQWA 1C0FA 1OVYA 2P9IA 1J6ZA 1ATRA 2QWLA 2VCPA 3N4PA 5AQZA 4CZFA 3I8BA 2P9KA 4C1NI 5BPLA 1YITN 4PL8A 1T6CA 2PBDA 1GLCG 2FF6A 3L0QA 4O5FA 2NLXA 3ZX0A 3O8MA 4WQ4C 3U9DA 2P9UB 3A0IX 5KQDA 3L4IA 4LC9B 4BVOA 4YOXA 2Q1NA 1S3XA 1WOQA 1E4FT 2GWJA 4L3QA 2OANA 3ZX3A 2YCHA 1TYQA 4BROA 2A6AA 5MLCQ 3GG4A 2E2NA 2YJFA 3IMXA 3ZETB 5C10A 5LJVA 1GLBG 2CH5A 4XH1A 4CJ7A 2QWOA 1QZ6A 3ATUA 4ISEA 4KBOA 5F0XA 4B1UB 4AM7A 1VQON 2QWRA 5AFUH 1NM1A 4WQ5C 3H1QA 4IFEA 1GLAG 1GLEG 1VQ4N 4GVEA 4ILHA 4B1ZA 1HKCA 4CZEA 4JKGB 5M1KA 3ID8A 3D6RA 1MWKA 4JHDA 5AQFA 5JLFA 3B8AX 2I7NA 2Q31A 2OTLN 3TPQA 5CR4A 3AGKA 3G71N 1K73O 2E8AA 2HBJA 3SAGA 3UE5A 1HX1A 4NLBA 1EO1A 1K8KA 3EN9A 3TU5A 3DLLL 3ZEUA 3H46O 2ASPA 3UKUA 5KPTA 2ASMA 4FWPA 3RVCA 1U2VB 1NGGA 4G9ZA 4WFNL 5B8HA 3T7ZA 5TKWA 3CC7N 1ATNA 1RDWX 2NRHA 4CZGA 1YXQA 2YHXA 2HF4A 2V51B 4JKDA 4JN4A 2VGMA 4BR7A 4C23A 4PHTX 2VYPA 2Q2RA 4YOTA 1H1VA 2J4RA 3HRGA 1DT9A 2HOEA 3QFPA 4BC4A 1OKJA 4ISGA 5BRDA 2HBKA 2E1ZA 1NWKA 3HTVA 3P4IA 2EWSA 3EL2A 2HBMA 3O1WA 3O6WA 3W0LA 2QM1A 4YDUA 4CBWA 2P9LA 5M1QA 2QXLA 3LDQA 3MK6A 5KQ8A 2QW9A 3D7EO 2NRWA 2A42A 3DJCA 1C0GA 5E84A 4BRGA 3H1VX 1ATSA 4BVPA 3ENOA 4H5WA 3O1BA 5AQXA 3D2FB 1G99A 3D2EB 4ILGB 4Z94A 5C2DA 3SJHA 5AZJA 4OPAA 3IUCA 5CHIA 4U7BA 3CQXA 5AZIB 2AP1A 3ULEB 2Q0RA 1MWMA 2RE2A 2ZF5O 3TTDA 1ESVA 3CMEN 3IDHA 2HSTA 4E1JA 4BRMA 1KD1O 3WXMB 3CJ7A 3CCEN 1JCGA 3VF4A 2GWKA 2IVNA 2A40A 1BG3A 3NVKA 2QTDA 3SK3A 2CH6A 3WQTA 4KH5A 1ILYA 3SAFA 4H03B 3WEEA 3Q7CA 2QWMA 3QMLA 2H3GX 5AQYA 1SZ2A 1BU6O 4H5RA 4JK9A 3SMPA 4IXCA 3T69A 1SQKA 4J8FA 4H5VA 4A2AA 2GEMA 2QA4N 1Z05A 4JKEA 4BRPA 5GIOA 4BC5A 4H5NA 5BREA 3ENBA 3E9LA 3L6QA 3MN6A 4MO4A 1QVGM 2BUPA 1ZBSA 3PIOL 1KAYA 4BR4A 4JK7A 4BY9C 4H0OA 3O9SA 4K42A 4IZ9A 3Q7BA 4IDHA 4JKHA 4M7XA 4NLCA 4B1YB 4FWQA 3M1FA 4XH5A 1YJNN 3VEXA 4OPHA 4CZMA 5FPNA 2P9PA 4BR2A 4A57A 1TUUA 4FWRA 4BG9A 3W3DA 3WXIA 3CXCM 3GL1A 4CD3A 1R59O 5JMVA 4A59A 4H0TB 2ZJPL 4BC2A 5JICA 4FWSA 1IJJA 3R6MA 5BN9A 1EQYA 5AQLA 3CJ1A 1JCFA 4WFAL 3HOTA 3MN9A 3CPWM 3FZHA 4QS9A 3DAWA 5EY4A 3CC4N 4GY2B 3EKSA 5HOOA 3U8XA 4H0XB 4MLHA 2E88A 2NRRA 4JD2B 3ENHA 3VEZA 4BGBA 1BDGA 2P9KB 2P9SB 3K9JA 3CCUN 1SAZA 3EE8A 5ADXH 2OTJN 2ZWHA 3EKUA 5KPRA 3VETA 1VQ5N 1BA0A 3O9UA 3QBXA 1YIJN 3QFUA 4B1WB 3JXUA 4BC3A 3E9OA 2F7TA 1YUWA 3O5BA 5AQJA 3PLAA 2P9NA 1KAZA 3MWTA 3SLCA 2ASOA 3GDQA 2HMPA 3I55N 3BF3A 2CGJA 1TYQB 3MN7A 3G6EN 1M1KO 3CJBA 3TSUA 2JWLA 1VQ9N 3VESA 1RFQA 2P9UA 3BEXA 4O8KA 4AF1A 2FSKA 4BRDA 2KLAA 2FSJA 5EXWA 3J8AA 4K25A 2Q36A 3CQYA 4BG8A 1V4SA 3VEVA 1GLJO 5BR9A 3M6GA 2UYTA 3HBTA 4BRIA 3RSEA 4JHDB 3AARA 5AQKA 3ZETA 1HJOA 3OA9A 4ILJA 5JVHL 3IFRA 4B9QA 4FVUA 4BRKA 1NGEA 1HKBA 2V52B 4BR5A 3C7NB 4H5TA 3MCAB 4CD1A 1K8KB 1VQMN 3ZEUB 3UKUB 5BRFA 1TUYA 4FPAA 4I6MA 3I33A 5AQVA 5H1SQ 4CZLA 5AQNA 4JEPA 5AQTA 3WUHA 3R8EA 3UKRB 3VEYA 1BWFO 2GTDA 3VTIA 3TSQA 5ELZA 2NRXA 3FE1A 3VEWA 3MN5A 1QHAA 3SBGA 4IO9L 1VQ8N 3C0BA 1BUPA 4A62A 1IG8A 2FXUA 2A41A 3CETA 4FOEA 5FPMA 3VPZA 5KPZA 5GINA 4QS8A 3EE9A 4JKFA 1VQNN 4YORA 3S41A 3A5MC 2ZJRL 3KVGA 5AFUA 3GBTA 1DGKN 4JKAA 4A5BA 1NJIO 2Q0UA 1JCEA 3CJCA 4KH4A 3HM8A 5EX5A 4A61A 4FO0A 2Q97A 1SS6A 1U6ZA 5C12A 4PL7A 4JK8A 3CCQN 3ZYYX 5F2RA 4NO7A 1NGFA 3ATVA 5AZJB 4BQLA 4EFHA 3K9KA 1HLUA 2CGLA 2QI2A 3O4WA 5GADP 1DKGD 4A2BA 2WBNA 4B1XB 3R3LA 1MDUB 3FZLA 1NGDA 4BRAA 1KC8O 3OW2M 1MA9B 3FLCO 3MMVA 3VGKA 2WC9A 5F1XA 1CZAN 3G25A 4IEIA 1NGJA 2BH1A 4BRLA 3ULEA 2FLOA 5LY3A 4HTLA 4RWTA 3WEEB 3KHYA 2QWNA 1VQLN 2A5XA 1O13A 2AA4A 1N8RO 3H3OB 4WYBA 4CBXA 1GLLO 1NGAA 1BOTO 1E4GT 1T6DA 3CJAA 5AQHA 4BGAA 3SMSA 5I9EB 4FWLA 2GX9A 3M3ZA 1NGCA 4YOUA 5EVZA 4BRFA 4R79A 4H0VB 2ITMA 4FWOA 3G4SN 3U9ZA 2QEXN 1YF5L 4GV9A 4AM6A 2BTFA 2ZGYA 5AQQA 4H0YB 4GV3A 4YOVA 3E66A 2E2QA 4CZIA 4YDUC 1YVNA 3JS6A 3DXMA 3LDPA 2NRVA 3E1YA 4JKCA 1GLFO 3O9TA 2IVOA 3LM9A 3MCPA 5LJWA 1Q7YO 3DXKA 1JJ2M 2P9PB 4M63C 5AQPA 4FWKA 3TSPA 2F9TA 3QDKA 1Z6RA 4GV6A 3MWPA 4RCHA 3CCSN 4OO1J 4WQ5A 2WUSA 3QICA 2YI1A 1LCUA 2D0OA 2PAVA 3LL3A 4IOXA 3HOSA 1QQOA 3CPEA 2NRTA 3J7ZO 5AQUA 3F9MA 4BRCA 1NGHA 5GAEP 3LM2A 1WUAA 3QBWA 4DQ8A 5M1FA 2P9IB 1K8AO 2D4WA 3F5TA 1T3VA 1YI2N 4IO8A 3VF2A 5AQIA 3BUZB 5EOYA 3SBTA 3VGLA 3KK7A 4K43A 3P31A 1S22A 2GELA 4BR0A 4DCHA 4JAXA 1GLDG 5JLHA 2ZJQL 4YOWA 1HPMA 3CC2N 5FPDA 3A5OC 3CD6N 4IJNA 3VMFB 3C6AA 3CERA 3H45C 3WXJA 3WXLA 4WF9L 2P9NB 3UB5A 2CGKA 5BRHA 3O08A 1RGIA 4WCEL 4JD2A 2E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIP A;  4FL9 A;  3HSC A;  1Q18 A;  4BRE A;  3GE1 A;  2P9S A;  4K41 A;  3LDN A;  2YJE A;  3VOV A;  3HI0 A;  3CHW A;  4CZH A;  2QWP A;  4EHT A;  1ZC6 A;  1X3M A;  4BRQ A;  5FPE A;  4CZK A;  4FPB A;  5BPM A;  3RSE B;  3DWL A;  2FF3 B;  2IIR A;  5BN8 A;  4PKI A;  3FZM A;  2V7Y A;  4MLE A;  2YHW A;  1DEJ A;  1BO5 O;  4I6M B;  5ADX A;  3R9P A;  3LDO A;  3MDQ A;  4FSV A;  2W41 A;  1XQS C;  4XEI A;  4HWI A;  3C7N A;  1U2V A;  2I7P A;  4XH4 A;  2FSN A;  1KXP A;  1X9J A;  3WXK A;  5BPN A;  3VGM A;  2P9L B;  3H3N O;  5AQO A;  4GNI A;  3UKR A;  1QQM A;  4EAH D;  4PKG A;  4EHU A;  1XUP O;  2ZGZ A;  4FWN A;  2D1K A;  3CJ9 A;  1XC3 A;  3QB0 A;  4QS7 A;  3AAP A;  2IVP A;  4IWV A;  5TKY A;  2VWB A;  3WQU A;  5AR0 A;  1P8Z A;  2YHY A;  3GOI A;  4BRN A;  4DHY A;  3O80 A;  3BP8 A;  3D2F A;  3D2E A;  3H6E A;  3KZB A;  2D0P A;  3FFK B;  3A5L C;  4Y0W A;  2KHO A;  5AZI A;  4ISF A;  3VF6 A;  4JNE A;  1NGI A;  4MO5 A;  1NGB A;  3BF1 A;  3A5N C;  2E2P A;  1HUX A;  5AQS A;  2W40 A;  4BR9 A;  2HF3 A;  1T44 A;  4BRH A;  3ZX2 A;  5CE3 A;  5AQG A;  3FZF A;  1QZ5 A;  2DPN A;  2NZT A;  2V7Z A;  3AY9 A;  3CI5 A;  4WQ4 A;  3VEN A;  4B1V A;  4IJA A;  1YAG A;  1NLV A;  4FOI A;  1D4X A;  4FWM A;  1NBW A;  3U4L A;  4F9O A;  3DXM B;  1X3N A;  1V4T A;  3EO3 A;  3WT0 A;  4M7Y A;  4NB4 A;  3DXK B;  4EIA A;  1HKG A;  1NMD A;  4BQZ A;  4DB3 A;  5AQR A;  3A8Y A;  2F9W A;  2GUP A;  1LOT B;  4PKH A;  1ZXO A;  2E20 A;  3OHR A;  4CBU A;  2E2O A;  1QQN A;  2QWQ A;  3EZW A;  3AAQ A;  3VEO A;  1Y64 A;  1KAX A;  4RTF D;  3FR0 A;  4CI6 A;  3FGU A;  3FZK A;  5E26 A;  3HZ6 A;  2A3Z A;  4H0P A;  3VER A;  1BA1 A;  5AQM A;  4CZJ A;  3LDL A;  5AQW A;  1C0F A;  2P9I A;  2QWL A;  1J6Z A;  1ATR A;  4CZF A;  2VCP A;  5AQZ A;  3I8B A;  2P9K A;  5BPL A;  4PL8 A;  1T6C A;  2PBD A;  1GLC G;  2FF6 A;  3L0Q A;  4O5F A;  2NLX A;  3ZX0 A;  3O8M A;  4WQ4 C;  3U9D A;  2P9U B;  3A0I X;  5KQD A;  3L4I A;  4LC9 B;  4BVO A;  2Q1N A;  1S3X A;  1WOQ A;  1E4F T;  2GWJ A;  4L3Q A;  2OAN A;  3ZX3 A;  2YCH A;  1TYQ A;  4BRO A;  2A6A A;  3GG4 A;  2E2N A;  2YJF A;  3IMX A;  3ZET B;  5LJV A;  1GLB G;  2CH5 A;  4XH1 A;  4CJ7 A;  2QWO A;  1QZ6 A;  3ATU A;  4ISE A;  4KBO A;  5F0X A;  4B1U B;  4AM7 A;  2QWR A;  5AFU H;  1NM1 A;  4WQ5 C;  3H1Q A;  1GLA G;  1GLE G;  4B1Z A;  4CZE A;  1HKC A;  3ID8 A;  1MWK A;  4JHD A;  5AQF A;  5JLF A;  3B8A X;  2I7N A;  2Q31 A;  3TPQ A;  2E8A A;  3UE5 A;  1HX1 A;  1K8K A;  3EN9 A;  3TU5 A;  3ZEU A;  3H46 O;  2ASP A;  3UKU A;  5KPT A;  2ASM A;  4FWP A;  1U2V B;  1NGG A;  5B8H A;  1ATN A;  1RDW X;  2NRH A;  4CZG A;  1YXQ A;  2YHX A;  2HF4 A;  2V51 B;  4JN4 A;  4BR7 A;  4C23 A;  2VYP A;  2Q2R A;  1H1V A;  2J4R A;  2HOE A;  3QFP A;  4BC4 A;  1OKJ A;  4ISG A;  5BRD A;  2E1Z A;  1NWK A;  3HTV A;  3P4I A;  2EWS A;  3EL2 A;  3O1W A;  3O6W A;  3W0L A;  2QM1 A;  4YDU A;  4CBW A;  2P9L A;  2QXL A;  3LDQ A;  3MK6 A;  5KQ8 A;  2QW9 A;  3D7E O;  2A42 A;  3DJC A;  1C0G A;  5E84 A;  4BRG A;  3H1V X;  1ATS A;  4BVP A;  3ENO A;  4H5W A;  3O1B A;  5AQX A;  3D2F B;  1G99 A;  3D2E B;  4Z94 A;  3SJH A;  5AZJ A;  3IUC A;  3CQX A;  5AZI B;  2AP1 A;  3ULE B;  2Q0R A;  1MWM A;  2ZF5 O;  1ESV A;  3IDH A;  4E1J A;  4BRM A;  3CJ7 A;  1JCG A;  3VF4 A;  2GWK A;  2IVN A;  2A40 A;  1BG3 A;  3SK3 A;  3WQT A;  2CH6 A;  4H03 B;  3WEE A;  2QWM A;  3QML A;  2H3G X;  5AQY A;  1SZ2 A;  1BU6 O;  4H5R A;  3SMP A;  4IXC A;  1SQK A;  4J8F A;  4H5V A;  4A2A A;  2GEM A;  1Z05 A;  4BRP A;  4BC5 A;  4H5N A;  5BRE A;  3MN6 A;  3L6Q A;  4MO4 A;  2BUP A;  1ZBS A;  1KAY A;  4BR4 A;  4H0O A;  4K42 A;  4IZ9 A;  4M7X A;  4B1Y B;  4FWQ A;  3M1F A;  4XH5 A;  3VEX A;  4CZM A;  5FPN A;  2P9P A;  4BR2 A;  1TUU A;  4FWR A;  4BG9 A;  3W3D A;  3WXI A;  3GL1 A;  4CD3 A;  1R59 O;  5JMV A;  4H0T B;  4BC2 A;  5JIC A;  4FWS A;  1IJJ A;  3R6M A;  5BN9 A;  1EQY A;  5AQL A;  3CJ1 A;  1JCF A;  3MN9 A;  3FZH A;  4QS9 A;  3DAW A;  5EY4 A;  4GY2 B;  3EKS A;  3U8X A;  4H0X B;  4MLH A;  2E88 A;  4JD2 B;  3ENH A;  3VEZ A;  4BGB A;  1BDG A;  2P9K B;  2P9S B;  1SAZ A;  5ADX H;  2ZWH A;  3EKU A;  5KPR A;  3VET A;  1BA0 A;  3QBX A;  3QFU A;  4B1W B;  3JXU A;  4BC3 A;  5AQJ A;  1YUW A;  3O5B A;  2P9N A;  1KAZ A;  3SLC A;  2ASO A;  3GDQ A;  2HMP A;  3BF3 A;  2CGJ A;  1TYQ B;  3MN7 A;  3CJB A;  3VES A;  1RFQ A;  2P9U A;  3BEX A;  4O8K A;  4BRD A;  2FSK A;  2FSJ A;  5EXW A;  3J8A A;  4K25 A;  2Q36 A;  3CQY A;  4BG8 A;  1V4S A;  3VEV A;  1GLJ O;  5BR9 A;  3M6G A;  2UYT A;  3HBT A;  4BRI A;  3RSE A;  4JHD B;  3AAR A;  5AQK A;  3ZET A;  1HJO A;  3IFR A;  4B9Q A;  4BRK A;  1NGE A;  1HKB A;  2V52 B;  4BR5 A;  3C7N B;  4H5T A;  4CD1 A;  1K8K B;  3ZEU B;  3UKU B;  5BRF A;  1TUY A;  4FPA A;  4I6M A;  3I33 A;  5AQV A;  4CZL A;  5AQN A;  5AQT A;  3WUH A;  3R8E A;  3UKR B;  3VEY A;  1BWF O;  2GTD A;  5ELZ A;  3FE1 A;  3VEW A;  3MN5 A;  1QHA A;  3C0B A;  1BUP A;  4A62 A;  1IG8 A;  2FXU A;  2A41 A;  3CET A;  4FOE A;  5FPM A;  3VPZ A;  5KPZ A;  4QS8 A;  3S41 A;  3A5M C;  3KVG A;  5AFU A;  3GBT A;  1DGK N;  2Q0U A;  1JCE A;  3CJC A;  3HM8 A;  5EX5 A;  4A61 A;  4FO0 A;  2Q97 A;  1U6Z A;  4PL7 A;  5F2R A;  4NO7 A;  1NGF A;  3ATV A;  5AZJ B;  4BQL A;  4EFH A;  1HLU A;  2CGL A;  3O4W A;  1DKG D;  4A2B A;  4B1X B;  1MDU B;  3FZL A;  1NGD A;  4BRA A;  1MA9 B;  3FLC O;  3MMV A;  3VGK A;  5F1X A;  1CZA N;  3G25 A;  1NGJ A;  4BRL A;  3ULE A;  2FLO A;  5LY3 A;  4HTL A;  4RWT A;  3WEE B;  3KHY A;  2QWN A;  2A5X A;  2AA4 A;  3H3O B;  4WYB A;  4CBX A;  1GLL O;  1NGA A;  1BOT O;  1E4G T;  1T6D A;  3CJA A;  5AQH A;  4BGA A;  3SMS A;  5I9E B;  4FWL A;  5EVZ A;  3M3Z A;  1NGC A;  4BRF A;  4H0V B;  2ITM A;  4FWO A;  3U9Z A;  4AM6 A;  2BTF A;  2ZGY A;  5AQQ A;  4H0Y B;  2E2Q A;  4CZI A;  4YDU C;  1YVN A;  3JS6 A;  3DXM A;  3LDP A;  1GLF O;  2IVO A;  3LM9 A;  3MCP A;  5LJW A;  3DXK A;  2P9P B;  4M63 C;  5AQP A;  4FWK A;  2F9T A;  3QDK A;  1Z6R A;  4RCH A;  4WQ5 A;  2WUS A;  3QIC A;  2YI1 A;  1LCU A;  2D0O A;  2PAV A;  3LL3 A;  1QQO A;  5AQU A;  3F9M A;  4BRC A;  1NGH A;  3LM2 A;  1WUA A;  3QBW A;  4DQ8 A;  2P9I B;  2D4W A;  4IO8 A;  3VF2 A;  5AQI A;  3BUZ B;  5EOY A;  3VGL A;  4K43 A;  4BR0 A;  1S22 A;  2GEL A;  4DCH A;  4JAX A;  1GLD G;  5JLH A;  1HPM A;  5FPD A;  3A5O C;  4IJN A;  3CER A;  3H45 C;  3WXJ A;  3WXL A;  2P9N B;  3UB5 A;  2CGK A;  5BRH A;  3O08 A;  1RGI A;  4JD2 A;  2E1Y A; 
#chains in the Genus database with same CATH topology
 4I7F A;  3HSC A;  4CJ4 A;  1P90 A;  1QQC A;  4A5A A;  2HHT A;  2YX6 A;  3VOV A;  5M1P A;  4X62 K;  3HI0 A;  4EHT A;  4ZTJ A;  4B3R K;  4H8K A;  5C2F A;  2UUA K;  4OX9 K;  4Z4H A;  5BPM A;  1EP4 A;  4FPB A;  4JI5 K;  2IAJ A;  3WNH A;  2FF3 B;  4DUZ K;  5T7B A;  5BN8 A;  3FZM A;  2PFU A;  3C94 A;  4I6M B;  5ADX A;  1G15 A;  4E19 A;  4FJL A;  3LDO A;  4KHY A;  3ZSO A;  3O3F A;  3RRG A;  1S1W A;  2O4I A;  2HBL A;  2KKZ A;  4CJF A;  3DI6 A;  3C7N A;  2I7P A;  3D0P A;  4PUO A;  2KFN A;  2FSN A;  1KXP A;  4DV4 K;  4KKO A;  3VGM A;  4MDB A;  2OYQ A;  5AQO A;  3TR8 A;  1RIL A;  3UKR A;  3CCM N;  4DU4 A;  2GV9 A;  3IG1 A;  1XUP O;  1NK6 A;  3M5R A;  2ZGZ A;  4M3W A;  4FVM A;  4FWN A;  2D1K A;  3AGR A;  1TKZ A;  4W5Q A;  4JLH A;  1Q82 O;  4QCL A;  4QS7 A;  3AAP A;  2IVP A;  4IWV A;  4KHQ A;  5AR0 A;  4GKK K;  2OPS A;  5GIP A;  2P5G A;  3BP8 A;  4OPJ A;  2KW4 A;  2D0P A;  3RWU A;  4U67 L;  4ISF A;  3BZC A;  4CEQ A;  3AO1 A;  4MO5 A;  4AHV A;  3QEX A;  4DSJ A;  2W6K A;  1XNR K;  1HUX A;  3ZSX A;  2ZD1 A;  2HF3 A;  1T44 A;  3FZF A;  2OPR A;  4I9L A;  3CYM A;  3CCV N;  3DRP A;  1QVF M;  1D4X A;  4E1N A;  4FK0 A;  4CF8 A;  1RCH A;  3AA2 A;  3NMU A;  1YJW N;  4F9O A;  1BIZ A;  3DXM B;  1X3N A;  1VAZ A;  3AVF A;  3THY A;  3O9Q A;  1HKG A;  1NMD A;  1S72 N;  4BQZ A;  2JGU A;  4I2P A;  3RR7 A;  2GUP A;  5GAH P;  1ZXO A;  4C1N K;  3DOK A;  2ZE2 A;  3DRS A;  1XWL A;  4WE1 A;  1QQN A;  2QWQ A;  3EZW A;  1Y64 A;  1KAX A;  3TTC A;  3MX2 A;  3FZK A;  3J7A P;  2ZQB A;  4OKJ A;  5E26 A;  3HZ6 A;  5HLF A;  3VER A;  3C65 A;  5AQM A;  1NKC A;  4DTO A;  4IFY A;  5CZ2 A;  3SJJ A;  2P9I A;  1Q81 O;  1VK0 A;  3N4P A;  2P9K A;  1RT5 A;  3L0Q A;  3CM6 A;  2NLX A;  4C8K A;  1KCF A;  5KQD A;  4BVO A;  3VQD A;  2IGI A;  1WSG A;  3L2R A;  4E3S A;  3JAM O;  3ZX3 A;  2YCH A;  1TYQ A;  3HP6 A;  1TGO A;  2O8D B;  2E2N A;  4CK3 A;  1I94 K;  1GLB G;  4M3R A;  3AO5 A;  4B1U B;  2QWR A;  3O4Q A;  3VQA A;  4IFE A;  1GLA G;  3K5M A;  1GLE G;  4FZX C;  4ILH A;  3OS1 A;  4JKG B;  2YHB A;  3D6R A;  5J2P A;  4JHD A;  5JLF A;  3B8A X;  2I7N A;  3TAQ A;  2D0C A;  5CR4 A;  3AGK A;  3G71 N;  1K73 O;  1HRH A;  3OYD A;  1BIS A;  4FK4 A;  1BGX T;  4DQP A;  1HX1 A;  2YNI A;  1K8K A;  3EN9 A;  3TU5 A;  5KPT A;  3KLE A;  2ASM A;  4FWP A;  3TAF A;  3JSM A;  5I3U A;  2NRH A;  4CEE A;  1UWB A;  5CY4 A;  4C23 A;  1O1W A;  3OYK A;  2VYP A;  2Q2R A;  4N41 A;  2J4R A;  3HRG A;  2KFZ A;  1BQM A;  4BC4 A;  4OLB A;  2PY5 A;  3OS2 A;  4KHW A;  2E1Z A;  4ZTF A;  4HUE A;  1TKD A;  5KGX A;  4DFJ A;  2QM1 A;  4QOZ B;  4CBW A;  3L3V A;  5M1Q A;  2QXL A;  4FLT A;  4BE1 A;  3D7E O;  1J5E K;  5E84 A;  4BRG A;  4CEC A;  4BVP A;  3THW A;  3D2E B;  4FJ9 A;  5AZJ A;  4J2B A;  3IUC A;  5K14 A;  4AHT A;  1NK8 A;  1MWM A;  4CIF A;  2RE2 A;  2ZF5 O;  1RT6 A;  4E1J A;  1KD1 O;  1HR0 K;  1TVR A;  2GWK A;  2IVN A;  1XC9 A;  4DTU A;  2QTD A;  2ATQ A;  2CH6 A;  1ILY A;  1A5X A;  3QML A;  3VQB A;  4CGH A;  3WNF A;  2VG7 A;  4J8F A;  3V6D A;  5HBM A;  4KI6 A;  1JXE A;  3ZLJ A;  3ENB A;  4FXD A;  3LP0 A;  1CZB A;  4Y1C A;  1X9S A;  4DFK A;  4IZ9 A;  4NLC A;  1L5U A;  4OPH A;  1NK4 A;  4KHS A;  1W0H A;  3W3D A;  1KLN A;  5JMV A;  4A59 A;  2ZJP L;  1IH7 A;  1IKW A;  3SUP A;  4HTU A;  4FWS A;  4E0D A;  3R6M A;  3CJ1 A;  1JCF A;  4ELV A;  1IBK K;  3U8X A;  3NHG A;  2KTQ A;  3QNO A;  4H0X B;  3NF6 A;  3HYF A;  4FM2 A;  2NRR A;  4M45 A;  2DY4 A;  3VEZ A;  2OTJ N;  5ADX H;  2ZWH A;  3VET A;  1BA0 A;  1BL3 A;  1YIJ N;  2OZM A;  4QAG A;  3JXU A;  2D5R A;  4DTR A;  4JI3 K;  2F7T A;  1WSE A;  3SLC A;  2ASO A;  4F8R A;  2HMP A;  3I55 N;  4B8A B;  3BF3 A;  4E7H A;  3ZT3 A;  1T7P A;  1DLO A;  1RFQ A;  1GOA A;  2Z1I A;  4BRD A;  3CFR A;  1Q8I A;  2FSK A;  2KLA A;  2FSJ A;  2W6L A;  3AA5 X;  2Q36 A;  3CQY A;  4BG8 A;  1GLJ O;  3M6G A;  4JI1 K;  2QK9 A;  4FM1 A;  5AQK A;  4C8N A;  3IFR A;  4BRK A;  4W5T A;  1HKB A;  2V52 B;  3C7N B;  4H5T A;  2JLE A;  3NE6 A;  4CFA A;  1KVA A;  1S5J A;  4FPA A;  4I6M A;  3I33 A;  5J1E A;  4LFC K;  1HQU A;  1JLQ A;  3UKR B;  3VQ9 A;  2NRX A;  4JRP A;  5HP1 A;  3MN5 A;  1LW2 A;  1IG8 A;  3CET A;  5FPM A;  3ULD A;  2E4L A;  4N47 A;  3A5M C;  1YTA A;  3LP3 A;  4DQQ A;  4FM0 A;  3CJC A;  4LFB K;  4KH4 A;  2R7Y A;  3HM8 A;  4KPY A;  4A61 A;  3KTQ A;  1VHX A;  3KD1 E;  4JK8 A;  1TK8 A;  1OH8 A;  3NGY A;  3ZT0 A;  1QTM A;  3HT3 A;  2CGL A;  4DR2 K;  1DKG D;  3CFO A;  1Q9Y A;  4IBN A;  4CE9 A;  4JYA K;  4CEA A;  4JS4 A;  4DR1 K;  1UOC A;  2AJQ A;  3HM9 A;  1YVU A;  2F8T A;  1NGJ A;  4DG1 A;  4W5N A;  4OLA A;  4BRL A;  1HNW K;  2BE2 A;  5LY3 A;  3ZSZ A;  4RWT A;  3KHY A;  2WON A;  3NBP A;  3OJU A;  1VQL N;  4LF9 K;  1A5W A;  1O13 A;  2A5X A;  4OKK A;  1T6D A;  1GLL O;  5I9E B;  3SMS A;  3G4S N;  1NGC A;  2XY8 A;  4H0V B;  2ITM A;  3THY B;  3U9Z A;  4LFA K;  4E1M A;  3ZSR A;  4GV9 A;  2BTF A;  5AQQ A;  4H0Y B;  1L3V A;  1TL3 A;  4UQG A;  3KKR A;  4CZI A;  4X66 K;  4YDU C;  3K59 A;  3O3H A;  3DXM A;  3HP9 A;  3MCP A;  3NGI A;  1X9W A;  2EX3 A;  1RBV A;  5AQP A;  3ISN C;  3NF8 A;  2F9T A;  4Z0U A;  1Z6R A;  4GV6 A;  3MWP A;  1RTD A;  4OO1 J;  3QIC A;  4DR3 K;  4DTS A;  1NKB A;  1HNX K;  2D0O A;  1BQN A;  3HOS A;  1QQO A;  4OPK A;  2NRT A;  1YT3 A;  3F9M A;  1WUA A;  3L2Q A;  1HYS A;  4LF7 K;  2P9I B;  1K8A O;  3VQ4 A;  1T3V A;  5AQI A;  1HYZ A;  3V81 A;  3SBT A;  3KK7 A;  3T1Y K;  4BR0 A;  2GEL A;  2X6N A;  4JI2 K;  5LMN K;  3AA4 A;  5JLH A;  1T03 A;  1Z25 A;  1WN7 A;  1HPM A;  2OCE A;  3SUO A;  4O4G A;  3OVN A;  1UA0 A;  3WXL A;  5HRS A;  2P9N B;  2CGK A;  4FZY A;  4JI6 K;  1RGI A;  1RT3 A;  2D0A A;  4CHY A;  3KWI A;  1Q18 A;  3DOL A;  3ITH A;  4BRE A;  4NXN K;  3SQ2 A;  3OBY A;  4LY7 A;  1EXQ A;  4CGD A;  1U47 A;  1KQS M;  4GVM A;  4BRQ A;  5IWA K;  4M3U A;  3NH0 A;  1FW6 A;  1RTJ A;  4PKI A;  4JI0 K;  3HJF A;  2Y1J A;  1VSD A;  1JLG A;  4JKG A;  3MXI A;  3QIN A;  1KSP A;  2IC3 A;  1DEJ A;  3S3O A;  4XIU A;  1ZBL A;  4DV3 K;  1L3T A;  3R9P A;  3THX B;  2PYJ A;  4KHN A;  4HWI A;  4DF4 A;  3BY5 A;  3OS0 A;  3AVL A;  2FBX A;  4XH4 A;  1VSM A;  3WXK A;  1HYV A;  4ID1 A;  3H3N O;  2NUB A;  2IDO A;  4GNI A;  3SV3 A;  2A1S A;  1QQM A;  4PKG A;  3PO5 A;  4EHU A;  1HMV A;  3IRX A;  3NF9 A;  3I56 N;  3MEC A;  3IAY A;  3THW B;  3F2K A;  1WSH A;  1XC3 A;  3QB0 A;  2E5L K;  5TKY A;  2VWB A;  3GOI A;  4HHT A;  3OYI A;  3LAN A;  3PUF A;  4CJ3 A;  3D2E A;  3THV A;  4FLX A;  5HL7 L;  3A5L C;  3HL8 A;  5JS2 A;  1VSL A;  4IFV A;  3VF6 A;  5I42 A;  4PQU A;  4O8U A;  1U49 A;  3BF1 A;  2IS3 A;  2WTU A;  2E2P A;  1XHX A;  4BR9 A;  3KLH A;  1LV5 A;  1IBL K;  3ZX2 A;  4AH9 A;  5CE3 A;  4M3T A;  4IEE A;  1QZ5 A;  2G8I A;  2WOM A;  2NZT A;  4CEZ A;  4K8Z A;  4BDZ A;  4IJA A;  4X65 K;  1YAG A;  1JLB A;  1VQP N;  2HHU A;  1S9G A;  4JKB A;  2ZM6 K;  4CJS A;  3NVM A;  3EO3 A;  4EIA A;  4KTW A;  1JLE A;  5JVG L;  5AQR A;  3TAB A;  2UXB K;  1Q86 O;  4FW2 A;  4PKH A;  2YNF A;  3P1G A;  3SQ0 A;  1W97 L;  2KQ2 A;  3VEO A;  4W5R A;  3K5O A;  3FGU A;  4IOA L;  2HW3 A;  4H0P A;  3SAH A;  1BA1 A;  2OZS A;  5E41 A;  1QSS A;  4CZJ A;  1LWF A;  1D9F A;  4HCC A;  5AQW A;  1OVY A;  2QWL A;  1ATR A;  5AQZ A;  5CYQ A;  1JL1 A;  1GLC G;  3O8M A;  3L2W A;  4YOX A;  1NK5 A;  1E4F T;  3ALY A;  1RT4 A;  3DLB A;  2A6A A;  4LSN A;  5LJV A;  3ZT1 A;  4CJ7 A;  2XY5 A;  4OVL A;  2QWO A;  1QZ6 A;  3ATU A;  4ISE A;  1C0M A;  1VQO N;  3J7Y P;  1SUQ A;  5M1K A;  4KTQ A;  2VG5 A;  3ID8 A;  4ZHR A;  1HQE A;  3TAN A;  1YTU A;  1WLJ A;  1CXQ A;  2E8A A;  3SAG A;  4FJ8 A;  2F96 A;  3VQ8 A;  1EO1 A;  1YIT N;  4CFB A;  2ASP A;  5CYM A;  3RVC A;  1U2V B;  1NGG A;  5B8H A;  5TKW A;  1ATN A;  2HF4 A;  2V51 B;  3D45 A;  1DT9 A;  5KTQ A;  4DR7 K;  4CED A;  4CES A;  1S1V A;  3HTV A;  3ZCM A;  4CJU A;  4CF2 A;  2EWS A;  4GKJ K;  3O6W A;  3W0L A;  3NAE A;  4F2S A;  3LDQ A;  3DJC A;  1C0G A;  3H1V X;  1ATS A;  1G99 A;  1GOB A;  4OPA A;  4AIL C;  2Q0R A;  3SI6 A;  1K6Y A;  1ESV A;  3IDH A;  3TWH A;  4B08 A;  2RPI A;  4BRM A;  3LP1 A;  3CJ7 A;  3QNN A;  1JCG A;  1TKT A;  1WNS A;  1REV A;  2HND A;  3SK3 A;  2O8C A;  4KH5 A;  1F21 A;  1QE1 A;  4M3X A;  2QWM A;  2YHA A;  2H3G X;  3B6P A;  4HUG A;  4JK9 A;  1DTQ A;  3DLG A;  4HUF A;  4F3T A;  3S3N A;  1RT7 A;  1NK0 A;  3BGR A;  3HVR A;  1Z05 A;  3MEG A;  4H5N A;  4FCY A;  3MN6 A;  3E9L A;  1QVG M;  4KHP K;  1ZBS A;  3PIO L;  1IG9 A;  4BY9 C;  4H0O A;  3O9S A;  4K42 A;  1JXB A;  4NYF A;  5C42 A;  2A1R A;  4LF6 K;  4FW1 A;  2E6M A;  4FWQ A;  4XH5 A;  5FPN A;  5HRR A;  4JRQ A;  4BG9 A;  4Q0B A;  3CXC M;  3HST B;  5JIC A;  3K5N A;  1IJJ A;  5BR8 K;  4WFA L;  4CCH A;  3UIQ A;  3CPW M;  1LW0 A;  4GY2 B;  5HOO A;  1Z26 A;  3LP2 A;  4BGB A;  2OPP A;  3MEE A;  3CCU N;  2QKK A;  3EE8 A;  3BZK A;  3EKU A;  2HHW A;  5AQJ A;  4DSE A;  2HHX A;  3VQ6 A;  2P9N A;  1QHT A;  3AVG A;  2O8E A;  2BAN A;  2JWL A;  1VRU A;  2RKI A;  1VQ9 N;  1B92 A;  1BIU A;  2P9U A;  2EHG A;  1D8Y A;  1W9H A;  3J8A A;  4L8R B;  1NOZ A;  2UYT A;  1X1P A;  3QEW A;  1WSJ A;  5HRN A;  3OA9 A;  4ILJ A;  4CJR A;  3LAL A;  1U04 A;  4JI4 K;  2VWJ A;  4NXM K;  4DR4 K;  1VQM N;  3ZEU B;  3UKU B;  5BRF A;  1IO2 A;  4O0J A;  5AQV A;  3V1O A;  1ZBI A;  3OYB A;  4JEP A;  3OYF A;  5J2Q A;  3WUH A;  3THX A;  3VTI A;  4M42 A;  3T3F A;  1BWF O;  4HVJ A;  3VEW A;  3DRR A;  1SL1 A;  1QHA A;  4IO9 L;  1VQ8 N;  4A62 A;  3OYE A;  4FZZ A;  1QS4 A;  2A41 A;  4FOE A;  4KRF A;  3EZ5 A;  4CFD A;  5GIN A;  1VQN N;  4BE0 A;  3S41 A;  1W7A A;  1J54 A;  5AFU A;  1LAW A;  2HHH K;  1DGK N;  2E6L A;  4F2R A;  1JCE A;  3V4I A;  3KLI A;  4X64 K;  1X9M A;  5EX5 A;  3RMC A;  4FO0 A;  2Q97 A;  1WBB A;  3K9K A;  4CJK A;  4B3S K;  4RW7 A;  2QI2 A;  1SV5 A;  1SL0 A;  4B1X B;  3R3L A;  4KO0 A;  1MDU B;  4EZ6 A;  3V9Z A;  3FZL A;  4I9Q A;  1KC8 O;  3OW2 M;  3MMV A;  3VGK A;  3G25 A;  4IEI A;  4B9S A;  4LF5 K;  3SUQ A;  3VA3 A;  4HTL A;  2BDP A;  1ZBF A;  5J2N A;  1S6P A;  2P1J A;  2QWN A;  4F3O A;  3V9X A;  2Y1I A;  4O55 A;  4WYB A;  4BGA A;  4GW6 A;  1E4G T;  4CBX A;  2P5O A;  2YKN A;  2QEX N;  4FWO A;  3F73 A;  3AVI A;  4B9L A;  2QKB A;  3AVN A;  2ZGY A;  4DTN A;  5IT9 O;  5J2M A;  4DU1 A;  2HMI A;  5AJ3 K;  3MAQ A;  5LMU K;  4E7K A;  2W42 A;  3LDP A;  4JKC A;  4O0I A;  1VSJ A;  1ASU A;  2P9P B;  4M63 C;  1FXX A;  1NJY A;  4B9V A;  3QDK A;  3V1R A;  1U4B A;  1S1X A;  3CCS N;  4WQ5 A;  3DM2 A;  2WUS A;  4IDK A;  1J9A A;  1LCU A;  3AA3 A;  5GAE P;  3LM2 A;  3TAR A;  4LF4 K;  4DQ8 A;  4FLV A;  4FLY A;  3F5T A;  1YI2 N;  3U3G A;  3VF2 A;  5A2Q O;  4FJK A;  2FBT A;  3VGL A;  3P31 A;  1S22 A;  4DCH A;  4V19 S;  3PX4 A;  2ZJQ L;  1D9D A;  2FC0 A;  3M8S A;  4BWJ A;  4OGE A;  1WB9 A;  4FJH A;  4E7I A;  3WXJ A;  4WF9 L;  1XI1 A;  5DK5 A;  3ZSW A;  3O08 A;  1IBM K;  3KLF A;  4FL9 A;  3GE1 A;  2FBY A;  4K41 A;  3LDN A;  3CQ8 A;  1S1U A;  3DYA A;  4FJX A;  1X3M A;  1OH5 A;  5FPE A;  4MQ3 A;  4CZK A;  3QET A;  3RSE B;  3AVK A;  1U48 A;  2KZZ A;  1N36 K;  3AO3 A;  3R1X A;  4MLE A;  2YHW A;  2I5J A;  4FK2 A;  1NJX A;  4CJQ A;  1RBT A;  4CJW A;  4MFB A;  2XRI A;  3MDQ A;  1N33 K;  1XQS C;  1BI4 A;  4XEI A;  2B6A A;  1U2V A;  4O44 A;  3E9P A;  3TAG A;  4FYD A;  1X9J A;  1FKP A;  3FFI A;  2B4J A;  4KI4 A;  4EAH D;  4DSF A;  4M41 A;  3WNG A;  1T05 A;  1VQK N;  4Y1D A;  1NU0 A;  3OTO K;  4DSL A;  4RW8 A;  2UXC K;  2WFB A;  1HNI A;  4B3O A;  1NK9 A;  1QSY A;  5FDL A;  5SZT A;  4DKW A;  3K2P A;  4NCA A;  4BRN A;  4DHY A;  3O80 A;  5DM7 L;  3G0Z A;  3MXJ A;  4Y0W A;  2X78 A;  4CHP A;  2KHO A;  4CW7 B;  2O8C B;  4W5O A;  3P83 D;  4JNE A;  3KK3 A;  3J80 O;  3OYJ A;  5GAG P;  3A5N C;  5FRN A;  3HK2 A;  4Q5V A;  4BRH A;  4GMJ B;  3CI5 A;  3AY9 A;  5M1O A;  4WQ4 A;  3VEN A;  4B1V A;  4IOC L;  2RHK A;  1M90 O;  4FWM A;  4J2A A;  2HHQ A;  4KH6 A;  1Q9X A;  1VSK A;  3CCL N;  3PIP L;  3OBW A;  2Z1H A;  1V4T A;  1KFS A;  4M7Y A;  4NB4 A;  3DXK B;  4YFU A;  2ITG A;  3C6T A;  4DB3 A;  2NRZ A;  3ID6 A;  1LOT B;  3C6H A;  2E20 A;  1VQ7 N;  3P39 A;  1HNV A;  2E2O A;  1VQ6 N;  3L8B A;  1JLF A;  3EEQ A;  4N76 A;  5FRM A;  5C25 A;  2A3Z A;  3A2F A;  1J53 A;  4CGG A;  4BDP A;  1C0F A;  4M3Y A;  4CFC A;  3I8B A;  2O8E B;  4PL8 A;  1T6C A;  2PBD A;  3M8P A;  4O5F A;  1FK9 A;  3I0R A;  2OA8 A;  4WQ4 C;  3U9D A;  2P9U B;  3L4I A;  4LC9 B;  2ETJ A;  2Q1N A;  1S3X A;  2GWJ A;  4LH5 A;  1VRT A;  2OAN A;  4L3Q A;  5MLC Q;  3IMX A;  5C10 A;  2CH5 A;  4JI8 K;  4KBO A;  5F0X A;  2G8H A;  5AFU H;  1R0A A;  1VQ4 N;  4GVE A;  4B1Z A;  4CZE A;  4N56 A;  3LPT A;  5AQF A;  5FLX O;  3TPQ A;  1BCO A;  2HBJ A;  5FRO A;  3UE5 A;  4NLB A;  3DLL L;  3ZEU A;  3H46 O;  3UKU A;  4Z4C A;  4G9Z A;  1WSF A;  3T7Z A;  3CC7 N;  1RDW X;  3SZ2 A;  2G8W A;  4CZG A;  4JKD A;  1NG9 A;  4JN4 A;  2UU9 K;  1D5A A;  4BR7 A;  4CGF A;  3F9K A;  4PHT X;  4DV2 K;  4FJG A;  1C1C A;  4DFM A;  3E01 A;  1OKJ A;  4ISG A;  3NDK A;  2HBK A;  4CVN E;  1RDA A;  2HBM A;  4PY5 A;  2P51 A;  1C6V A;  3QEI A;  2P9L A;  1E3M A;  5KQ8 A;  3MK6 A;  4YY3 K;  2NRW A;  1NJW A;  2A42 A;  2XO7 A;  4B8C A;  3OYM A;  3ENO A;  4H5W A;  3O1B A;  3D2F B;  4ILG B;  4Z94 A;  5C2D A;  4IKF A;  4U7B A;  3CQX A;  3VQP A;  5AZI B;  4FLU A;  3ASM A;  4B3M K;  5JS1 A;  3AVH A;  3CME N;  4DQI A;  3B6O A;  3WXM B;  1KVC A;  3KD5 E;  3L2U A;  2F8S A;  3WQT A;  4KTZ A;  3HPH A;  3SQ1 A;  4EP5 A;  3SAF A;  2RN2 A;  3Q7C A;  4E7J A;  4DTX A;  1SZ2 A;  1BU6 O;  4CF1 A;  1WBD A;  4IXC A;  1SQK A;  4H5V A;  2QA4 N;  4BRP A;  4JKE A;  5GIO A;  1KTQ A;  5BRE A;  3L6Q A;  3SPZ A;  3PSF A;  4DTM A;  4BR4 A;  3VQQ A;  3M8Q A;  4JKH A;  4M7X A;  4B1Y B;  3M1F A;  3AVA A;  1YJN N;  4CZM A;  2P9P A;  2O8B B;  4BR2 A;  4A57 A;  1TUU A;  3WXI A;  1RBS A;  3TAE A;  1EX4 A;  4CD3 A;  3K57 A;  4H0T B;  3SYZ A;  2XHB A;  4BC2 A;  5EU7 A;  3HOT A;  4RW4 A;  1S9E A;  3FZH A;  4QS9 A;  3S9H A;  2F4V K;  1RDC A;  1TAQ A;  3EKS A;  1QSL A;  1ASW A;  4MLH A;  3WNE A;  1JLC A;  2D0B A;  2G8F A;  2E88 A;  3ENH A;  4LD0 A;  2X74 A;  4Z4G A;  3KK1 A;  5KPR A;  1VQ5 N;  3O9U A;  3QBX A;  3QFU A;  3DLH A;  4B1W B;  2UXD K;  4TSX A;  4BC3 A;  1CLQ A;  3E9O A;  1KAZ A;  1DTT A;  4CK1 A;  3TAM A;  3MN7 A;  3G6E N;  3CJB A;  1IKV A;  3TSU A;  3QER A;  4FLW A;  2DFE A;  3VES A;  2VQF K;  4PWD A;  4AF1 A;  1LAV A;  1V4S A;  1KFD A;  3HBT A;  4AHC A;  4DS4 A;  1A5V A;  4DV6 K;  3RSE A;  3ZET A;  1BI4 B;  4C8L A;  5KRT A;  5D3G A;  4CD1 A;  3QIP A;  2YNH A;  1TUY A;  3V9S A;  4DWI A;  5H1S Q;  2GBZ A;  3VEY A;  2GTD A;  4CJP A;  3FE1 A;  1WAJ A;  3VQ5 A;  1TK5 A;  3SBG A;  3OJS A;  1TL1 A;  3AVB A;  4J2D A;  1N32 K;  2YNG A;  3SUN A;  4DUY K;  1CZ9 A;  3EE9 A;  3PY8 A;  2ZJR L;  4LF8 K;  4CIG A;  3QO9 A;  4A5B A;  4YHH K;  3AVM A;  3PX6 A;  4PL7 A;  3CCQ N;  3ZT2 A;  4NO7 A;  4DMN A;  1GOC A;  3PX0 A;  3ATV A;  4BQL A;  4NYN A;  1HLU A;  1RT2 A;  4AQY K;  4A2B A;  4BRA A;  4DV0 K;  2B5J A;  1MA9 B;  1CZA N;  3ULE A;  2FLO A;  1B9F A;  3ZT4 A;  4G1Q A;  3KLG A;  3WEE B;  2DFF A;  3QEV A;  3AO2 A;  4DQR A;  5AQH A;  1BOT O;  1NGA A;  3CJA A;  4FWL A;  5EVZ A;  4R79 A;  4YOU A;  1J5O A;  4BE2 A;  1RTI A;  3QLH A;  2FBV A;  1YF5 L;  2VQE K;  3E66 A;  2E2Q A;  3PSI A;  4CHZ A;  3JS6 A;  2NRV A;  3E1Y A;  4DR5 K;  1GLF O;  3CFP A;  2IVO A;  2Z1J A;  4O5B A;  2XY7 A;  1Q7Y O;  3DXK A;  1EKE A;  4B9T A;  4FWK A;  3PO4 A;  4RCH A;  3HXM A;  1VSE A;  3I8D A;  4DSK A;  2YI1 A;  2PAV A;  4IOX A;  4CJL A;  2O8F B;  3J7Z O;  5AQU A;  4BRC A;  1NGH A;  1RT1 A;  4DLE A;  4KB0 A;  2HNY A;  3MED A;  4K43 A;  4JS5 A;  4ICL A;  4JAX A;  1GLD G;  5LL6 Z;  4R5P A;  3CC2 N;  3SPY A;  4IJN A;  3VMF B;  1CXU A;  3C6A A;  3VA0 A;  3T1H K;  3RTV A;  5BRH A;  4WCE L;  1SKR A;  4JD2 A;  4UY8 O;  1C1B A;  3SCX A;  3C95 A;  3CIP A;  3IKM A;  3LPU A;  2P9S A;  3ZSY A;  2YJE A;  4MDA A;  5C15 A;  3CHW A;  4CZH A;  2QWP A;  5M1N A;  3BDP A;  3VQ7 A;  4WFB L;  1ZC6 A;  3CMA N;  2X6S A;  3DWL A;  4E89 A;  4DV1 K;  1VSI A;  2IIR A;  4BDY A;  2V7Y A;  5C0Y A;  1I39 A;  1BO5 O;  2O4G A;  1RDU A;  4KV8 A;  4B9U A;  1C1A A;  4FSV A;  4Z4E A;  1I3A A;  2W41 A;  3OYN A;  4K0K K;  3OYH A;  4AHS A;  4DTP A;  1XMO K;  2JWK A;  2UUC K;  3DMJ A;  5BPN A;  2P9L B;  3L2V A;  2NNW A;  3LWL A;  1N5Y A;  2YKM A;  3CF5 L;  4FJ7 A;  2HHV A;  1K9M O;  3KJV A;  3L3U A;  5CZ1 A;  3N4Q A;  3CJ9 A;  4CF9 A;  1ZYQ A;  1YJ9 N;  1FKO A;  3G10 A;  3KIO A;  3WQU A;  1P8Z A;  2YHY A;  3CCR N;  1XMQ K;  4EP4 A;  3D2F A;  3H6E A;  3KZB A;  3FFK B;  3LDS A;  1RDD A;  4BWM A;  5AZI A;  4KFB A;  4CGI A;  1ASV A;  1NGI A;  1S1T A;  3CG7 A;  1NGB A;  1HPZ A;  1EWR A;  5AQS A;  3SV4 A;  2W40 A;  3OYC A;  1MU2 A;  4ELT A;  5AQG A;  2DPN A;  2V7Z A;  4YOY A;  3U6F A;  3MX5 A;  4DSI A;  1NLV A;  2HB5 A;  4FOI A;  3TAP A;  3P38 A;  1NBW A;  3U4L A;  4DTJ A;  1JKH A;  3V9U A;  3O9R A;  4CJ5 A;  3WT0 A;  1YHQ N;  1KVB A;  4DLG A;  1EWQ A;  2VGN A;  4JI7 K;  3A8Y A;  3I0S A;  2F9W A;  1W2B M;  2PZS A;  1NOY A;  3CCJ N;  3KWG A;  3S3M A;  1T8E A;  4CBU A;  3L4Q A;  3OHR A;  4CEO A;  3DLK A;  3H08 A;  2O8B A;  3AV9 A;  1L3S A;  4DV7 K;  5DM6 L;  3AAQ A;  4KAZ A;  4FJJ A;  4RTF D;  3FR0 A;  4CI6 A;  1XHZ A;  4FJN A;  3O3G A;  1SKS A;  3VTH A;  3TTF A;  3LZI A;  3VQE A;  1NKE A;  3LDL A;  4CZF A;  4K8X A;  1J6Z A;  2VCP A;  2RF2 A;  3K0S A;  4C1N I;  5BPL A;  3ZX0 A;  4FJM A;  2FF6 A;  2G8K A;  3VQC A;  3A0I X;  4CEB A;  2XY6 A;  3QES A;  1WOQ A;  3RMD A;  5KGW A;  4BRO A;  1LWC A;  2HHS A;  3GG4 A;  1VSF A;  2YJF A;  3ZET B;  1NJZ A;  3ZSV A;  4XH1 A;  3JYT A;  1HJR A;  4AM7 A;  4DV5 K;  1NM1 A;  1RNH A;  4WQ5 C;  3H1Q A;  3LAM A;  3HPO A;  4CK2 A;  4EZ9 A;  1HKC A;  4CHQ A;  5HRO A;  1MWK A;  2Q31 A;  2OTL N;  3NGZ A;  4I2Q A;  3KK2 A;  4FJ5 A;  4KHU A;  4LH4 A;  1RBU A;  1Y97 A;  3IS9 A;  1JL2 A;  3V1Q A;  4WFN L;  4FJI A;  3LAK A;  1YXQ A;  2YHX A;  2Z1G A;  2VGM A;  4YOT A;  1H1V A;  4Z4F A;  4F4K A;  2HOE A;  3QFP A;  5BRD A;  3MXM A;  3QEP A;  4M3Z A;  1NWK A;  3AVC A;  3P4I A;  3EL2 A;  3O1W A;  4ID5 A;  4AHR A;  3AO4 A;  4YDU A;  4DR6 K;  3P5J A;  2DTU A;  2QW9 A;  4DFP A;  3NH2 A;  5AQX A;  2GUI A;  3OY9 A;  5CHI A;  3SJH A;  1EET A;  1UAX A;  2AP1 A;  3ULE B;  4CHN A;  4DS5 A;  1B9D A;  1TK0 A;  3TTD A;  1HNZ K;  2HST A;  1UA1 A;  3LZJ A;  1WSI A;  3CCE N;  3VF4 A;  3T1A A;  3SQ4 A;  2A40 A;  1BG3 A;  4RG8 A;  3NVK A;  1RTH A;  3C6U A;  1N34 K;  4KB1 A;  4H03 B;  3WEE A;  1RDB A;  5DMR A;  5AQY A;  3NCI A;  1LWE A;  3DLR A;  3EY1 A;  3T19 A;  4H5R A;  3SMP A;  3T69 A;  2G8V A;  3OYG A;  4A2A A;  2GEM A;  4N5S A;  1C0U A;  1BHL A;  4BC5 A;  4MO4 A;  2BUP A;  2VWK A;  4BAC A;  1KAY A;  1TV6 A;  4JK7 A;  3K58 A;  4HCB A;  2KZM A;  3KKS A;  3Q7B A;  4DF8 A;  4IDH A;  4H4O A;  1OVQ A;  3VEX A;  5C24 A;  4FWR A;  4B9M A;  3GL1 A;  1R59 O;  3OYL A;  1SKW A;  5BN9 A;  1EQY A;  5AQL A;  4YNQ A;  4FLZ A;  4CF0 A;  4Z4I A;  2O8F A;  3MN9 A;  3NF7 A;  2HVI A;  3DAW A;  5EY4 A;  3CC4 N;  2PYL A;  2G8U A;  3SNN A;  3QIO A;  4JD2 B;  4IG0 A;  1BDG A;  2P9K B;  2QXF A;  2P9S B;  3K9J A;  1SAZ A;  1ITG A;  1NNE A;  3PLA A;  1YUW A;  3O5B A;  3MWT A;  3GDQ A;  2CGJ A;  1JLA A;  1TYQ B;  1OH7 A;  1M1K O;  4B3T K;  4CJE A;  3ZSQ A;  4CJV A;  1VSH A;  3BEX A;  4O8K A;  4C8O A;  4AHU A;  1XNQ K;  5EXW A;  2HVH A;  4K25 A;  3RRH A;  2OPQ A;  3VEV A;  2DFH A;  4RW9 A;  5BR9 A;  3HO1 A;  4BRI A;  4KRE A;  4JHD B;  2O8D A;  3AAR A;  1HJO A;  5JVH L;  4B9Q A;  4FVU A;  3EYZ A;  4OJR A;  1NGE A;  4BR5 A;  4CJT A;  3MCA B;  1KRP A;  3DLE A;  1K8K B;  4RW6 A;  4B9N A;  4J2E A;  1U45 A;  5SWM A;  4CZL A;  5AQN A;  1WAF A;  1N6Q A;  1NMN A;  4CGJ A;  5AQT A;  3V9W A;  3R8E A;  3TSQ A;  5ELZ A;  2VG6 A;  2LSN A;  3C0B A;  1BUP A;  2UUB K;  4CER A;  2FXU A;  3VPZ A;  3K5L A;  5KPZ A;  4QS8 A;  3NH1 A;  4JKF A;  4YOR A;  3KVG A;  4PA1 A;  3GBT A;  1OH6 A;  4DU3 A;  4JKA A;  2Q3S A;  1NJI O;  2Q0U A;  1SS6 A;  1U6Z A;  5C12 A;  1IV0 A;  3ZYY X;  5F2R A;  4CEF A;  1NGF A;  1L3U A;  5AZJ B;  4EFH A;  3RMB A;  1BCM A;  4ELU A;  3O4W A;  3OYA A;  5GAD P;  2WBN A;  4DQS A;  3HPG A;  3CM5 A;  1NGD A;  2YV0 X;  3FLC O;  2WC9 A;  5F1X A;  1NK7 A;  3M8R A;  2BH1 A;  1SL2 A;  4LSL A;  3U3Y A;  3HVT A;  1IKX A;  2AA4 A;  1N8R O;  3H3O B;  4E7L A;  4OGC A;  5HRP A;  2GX9 A;  3M3Z A;  4BRF A;  4CIE A;  4C8M A;  2BGG A;  3J81 O;  4AM6 A;  4GV3 A;  4YOV A;  1FJG K;  5KRS A;  1YVN A;  1ZBH A;  3O9T A;  3AVJ A;  3LM9 A;  5LJW A;  4NCG A;  1JJ2 M;  4JV5 K;  3TSP A;  4OKE A;  1RBR A;  3PV8 A;  1TKX A;  3TI0 A;  3LL3 A;  3CPE A;  3QBW A;  2IOC A;  5M1F A;  2HNZ A;  2D4W A;  1ZBU A;  4IG3 A;  3RR8 A;  4IO8 A;  3O4N A;  3NFA A;  3BUZ B;  5EOY A;  1C0T A;  4NCB A;  4CHO A;  1S6Q A;  1KLM A;  4YOW A;  5KI6 A;  3LWM A;  5FPD A;  3A5O C;  3CD6 N;  1IKY A;  3RMA A;  3CER A;  3H45 C;  3UB5 A;  4H4M A;  1TAU A;  3VN5 A;  2E1Y A; 
#chains in the Genus database with same CATH homology
 3CIP A;  3KWI A;  4FL9 A;  3HSC A;  3IKM A;  1P90 A;  1Q18 A;  3GE1 A;  4A5A A;  2P9S A;  4BRE A;  4K41 A;  3OBY A;  2YX6 A;  3LDN A;  2YJE A;  4MDA A;  3VOV A;  5M1P A;  3HI0 A;  5C15 A;  3CHW A;  4CZH A;  2QWP A;  4EHT A;  5M1N A;  1KQS M;  4WFB L;  1ZC6 A;  1X3M A;  5C2F A;  4BRQ A;  5FPE A;  3CMA N;  4CZK A;  4FPB A;  5BPM A;  3RSE B;  3DWL A;  2FF3 B;  2IIR A;  5BN8 A;  4PKI A;  3R1X A;  3FZM A;  2PFU A;  2V7Y A;  4JKG A;  4MLE A;  2YHW A;  1DEJ A;  5C0Y A;  1BO5 O;  4I6M B;  5ADX A;  1RDU A;  3R9P A;  3LDO A;  3MDQ A;  1Q81 O;  4FSV A;  2W41 A;  2HBL A;  1XQS C;  2KKZ A;  4XEI A;  4HWI A;  3C7N A;  1U2V A;  2I7P A;  3E9P A;  4XH4 A;  2FSN A;  1KXP A;  2JWK A;  1X9J A;  3WXK A;  5BPN A;  3VGM A;  2P9L B;  4MDB A;  3H3N O;  5AQO A;  2NNW A;  4GNI A;  3CCM N;  3UKR A;  1QQM A;  4EAH D;  4PKG A;  4EHU A;  1VQK N;  3CF5 L;  1XUP O;  3I56 N;  1K9M O;  3M5R A;  2ZGZ A;  3F2K A;  4FWN A;  2D1K A;  3AGR A;  3N4Q A;  3CJ9 A;  2WFB A;  1XC3 A;  3QB0 A;  1YJ9 N;  1Q82 O;  4QS7 A;  3AAP A;  2IVP A;  4IWV A;  5TKY A;  4DKW A;  2VWB A;  3WQU A;  5AR0 A;  1P8Z A;  2YHY A;  3GOI A;  4BRN A;  4DHY A;  5GIP A;  3CCR N;  3O80 A;  5DM7 L;  3BP8 A;  3D2F A;  3D2E A;  3H6E A;  3KZB A;  2D0P A;  3FFK B;  3A5L C;  4Y0W A;  5HL7 L;  4U67 L;  2KHO A;  5AZI A;  4ISF A;  3VF6 A;  4JNE A;  1NGI A;  4O8U A;  5GAG P;  4MO5 A;  1NGB A;  3BF1 A;  3A5N C;  2E2P A;  1HUX A;  5AQS A;  2W40 A;  4BR9 A;  2HF3 A;  1T44 A;  4BRH A;  3ZX2 A;  5CE3 A;  4IEE A;  1QZ5 A;  3FZF A;  2DPN A;  5AQG A;  4UY8 O;  2NZT A;  2V7Z A;  3AY9 A;  3CI5 A;  4WQ4 A;  5M1O A;  3VEN A;  4B1V A;  4YOY A;  4IOC L;  4IJA A;  3MX5 A;  2RHK A;  3CCV N;  1YAG A;  1NLV A;  1QVF M;  4FOI A;  1D4X A;  4FWM A;  1VQP N;  1M90 O;  3P38 A;  1NBW A;  4KH6 A;  3U4L A;  3NMU A;  3O9R A;  1YJW N;  4JKB A;  4F9O A;  3DXM B;  3PIP L;  3CCL N;  1X3N A;  3OBW A;  1VAZ A;  1V4T A;  3NVM A;  3EO3 A;  3WT0 A;  4M7Y A;  4NB4 A;  3DXK B;  4EIA A;  1YHQ N;  3O9Q A;  1HKG A;  1NMD A;  1S72 N;  4BQZ A;  4DB3 A;  2NRZ A;  2VGN A;  3ID6 A;  5JVG L;  5AQR A;  3A8Y A;  2F9W A;  1W2B M;  3CCJ N;  2GUP A;  5GAH P;  3KWG A;  1Q86 O;  1LOT B;  4PKH A;  3C6H A;  1ZXO A;  2E20 A;  3L4Q A;  3OHR A;  4C1N K;  3P39 A;  4CBU A;  1VQ7 N;  1VQ6 N;  2E2O A;  1QQN A;  1W97 L;  2QWQ A;  5DM6 L;  3EZW A;  3AAQ A;  3VEO A;  1Y64 A;  1KAX A;  3TTC A;  4RTF D;  3MX2 A;  3FR0 A;  4CI6 A;  3FGU A;  3FZK A;  4IOA L;  5E26 A;  3VTH A;  3HZ6 A;  2A3Z A;  4H0P A;  3TTF A;  3SAH A;  3VER A;  1BA1 A;  3C65 A;  5AQM A;  4CZJ A;  3LDL A;  5AQW A;  1C0F A;  1OVY A;  2P9I A;  1J6Z A;  1ATR A;  2QWL A;  2VCP A;  3N4P A;  5AQZ A;  4CZF A;  3I8B A;  2P9K A;  4C1N I;  5BPL A;  1YIT N;  4PL8 A;  1T6C A;  2PBD A;  1GLC G;  2FF6 A;  3L0Q A;  4O5F A;  2NLX A;  3ZX0 A;  3O8M A;  4WQ4 C;  3U9D A;  2P9U B;  3A0I X;  5KQD A;  3L4I A;  4LC9 B;  4BVO A;  4YOX A;  2Q1N A;  1S3X A;  1WOQ A;  1E4F T;  2GWJ A;  4L3Q A;  2OAN A;  3ZX3 A;  2YCH A;  1TYQ A;  4BRO A;  2A6A A;  5MLC Q;  3GG4 A;  2E2N A;  2YJF A;  3IMX A;  3ZET B;  5C10 A;  5LJV A;  1GLB G;  2CH5 A;  4XH1 A;  4CJ7 A;  2QWO A;  1QZ6 A;  3ATU A;  4ISE A;  4KBO A;  5F0X A;  4B1U B;  4AM7 A;  1VQO N;  2QWR A;  5AFU H;  1NM1 A;  4WQ5 C;  3H1Q A;  4IFE A;  1GLA G;  1GLE G;  1VQ4 N;  4GVE A;  4ILH A;  4B1Z A;  1HKC A;  4CZE A;  4JKG B;  5M1K A;  3ID8 A;  3D6R A;  1MWK A;  4JHD A;  5AQF A;  5JLF A;  3B8A X;  2I7N A;  2Q31 A;  2OTL N;  3TPQ A;  5CR4 A;  3AGK A;  3G71 N;  1K73 O;  2E8A A;  2HBJ A;  3SAG A;  3UE5 A;  1HX1 A;  4NLB A;  1EO1 A;  1K8K A;  3EN9 A;  3TU5 A;  3DLL L;  3ZEU A;  3H46 O;  2ASP A;  3UKU A;  5KPT A;  2ASM A;  4FWP A;  3RVC A;  1U2V B;  1NGG A;  4G9Z A;  4WFN L;  5B8H A;  3T7Z A;  5TKW A;  3CC7 N;  1ATN A;  1RDW X;  2NRH A;  4CZG A;  1YXQ A;  2YHX A;  2HF4 A;  2V51 B;  4JKD A;  4JN4 A;  2VGM A;  4BR7 A;  4C23 A;  4PHT X;  2VYP A;  2Q2R A;  4YOT A;  1H1V A;  2J4R A;  3HRG A;  1DT9 A;  2HOE A;  3QFP A;  4BC4 A;  1OKJ A;  4ISG A;  5BRD A;  2HBK A;  2E1Z A;  1NWK A;  3HTV A;  3P4I A;  2EWS A;  3EL2 A;  2HBM A;  3O1W A;  3O6W A;  3W0L A;  2QM1 A;  4YDU A;  4CBW A;  2P9L A;  5M1Q A;  2QXL A;  3LDQ A;  3MK6 A;  5KQ8 A;  2QW9 A;  3D7E O;  2NRW A;  2A42 A;  3DJC A;  1C0G A;  5E84 A;  4BRG A;  3H1V X;  1ATS A;  4BVP A;  3ENO A;  4H5W A;  3O1B A;  5AQX A;  3D2F B;  1G99 A;  3D2E B;  4ILG B;  4Z94 A;  5C2D A;  3SJH A;  5AZJ A;  4OPA A;  3IUC A;  5CHI A;  4U7B A;  3CQX A;  5AZI B;  2AP1 A;  3ULE B;  2Q0R A;  1MWM A;  2RE2 A;  2ZF5 O;  3TTD A;  1ESV A;  3CME N;  3IDH A;  2HST A;  4E1J A;  4BRM A;  1KD1 O;  3WXM B;  3CJ7 A;  3CCE N;  1JCG A;  3VF4 A;  2GWK A;  2IVN A;  2A40 A;  1BG3 A;  3NVK A;  2QTD A;  3SK3 A;  2CH6 A;  3WQT A;  4KH5 A;  1ILY A;  3SAF A;  4H03 B;  3WEE A;  3Q7C A;  2QWM A;  3QML A;  2H3G X;  5AQY A;  1SZ2 A;  1BU6 O;  4H5R A;  4JK9 A;  3SMP A;  4IXC A;  3T69 A;  1SQK A;  4J8F A;  4H5V A;  4A2A A;  2GEM A;  2QA4 N;  1Z05 A;  4JKE A;  4BRP A;  5GIO A;  4BC5 A;  4H5N A;  5BRE A;  3ENB A;  3E9L A;  3L6Q A;  3MN6 A;  4MO4 A;  1QVG M;  2BUP A;  1ZBS A;  3PIO L;  1KAY A;  4BR4 A;  4JK7 A;  4BY9 C;  4H0O A;  3O9S A;  4K42 A;  4IZ9 A;  3Q7B A;  4IDH A;  4JKH A;  4M7X A;  4NLC A;  4B1Y B;  4FWQ A;  3M1F A;  4XH5 A;  1YJN N;  3VEX A;  4OPH A;  4CZM A;  5FPN A;  2P9P A;  4BR2 A;  4A57 A;  1TUU A;  4FWR A;  4BG9 A;  3W3D A;  3WXI A;  3CXC M;  3GL1 A;  4CD3 A;  1R59 O;  5JMV A;  4A59 A;  4H0T B;  2ZJP L;  4BC2 A;  5JIC A;  4FWS A;  1IJJ A;  3R6M A;  5BN9 A;  1EQY A;  5AQL A;  3CJ1 A;  1JCF A;  4WFA L;  3HOT A;  3MN9 A;  3CPW M;  3FZH A;  4QS9 A;  3DAW A;  5EY4 A;  3CC4 N;  4GY2 B;  3EKS A;  5HOO A;  3U8X A;  4H0X B;  4MLH A;  2E88 A;  2NRR A;  4JD2 B;  3ENH A;  3VEZ A;  4BGB A;  1BDG A;  2P9K B;  2P9S B;  3K9J A;  3CCU N;  1SAZ A;  3EE8 A;  5ADX H;  2OTJ N;  2ZWH A;  3EKU A;  5KPR A;  3VET A;  1VQ5 N;  1BA0 A;  3O9U A;  3QBX A;  1YIJ N;  3QFU A;  4B1W B;  3JXU A;  4BC3 A;  3E9O A;  2F7T A;  1YUW A;  3O5B A;  5AQJ A;  3PLA A;  2P9N A;  1KAZ A;  3MWT A;  3SLC A;  2ASO A;  3GDQ A;  2HMP A;  3I55 N;  3BF3 A;  2CGJ A;  1TYQ B;  3MN7 A;  3G6E N;  1M1K O;  3CJB A;  3TSU A;  2JWL A;  1VQ9 N;  3VES A;  1RFQ A;  2P9U A;  3BEX A;  4O8K A;  4AF1 A;  2FSK A;  4BRD A;  2KLA A;  2FSJ A;  5EXW A;  3J8A A;  4K25 A;  2Q36 A;  3CQY A;  4BG8 A;  1V4S A;  3VEV A;  1GLJ O;  5BR9 A;  3M6G A;  2UYT A;  3HBT A;  4BRI A;  3RSE A;  4JHD B;  3AAR A;  5AQK A;  3ZET A;  1HJO A;  3OA9 A;  4ILJ A;  5JVH L;  3IFR A;  4B9Q A;  4FVU A;  4BRK A;  1NGE A;  1HKB A;  2V52 B;  4BR5 A;  3C7N B;  4H5T A;  3MCA B;  4CD1 A;  1K8K B;  1VQM N;  3ZEU B;  3UKU B;  5BRF A;  1TUY A;  4FPA A;  4I6M A;  3I33 A;  5AQV A;  5H1S Q;  4CZL A;  5AQN A;  4JEP A;  5AQT A;  3WUH A;  3R8E A;  3UKR B;  3VEY A;  1BWF O;  2GTD A;  3VTI A;  3TSQ A;  5ELZ A;  2NRX A;  3FE1 A;  3VEW A;  3MN5 A;  1QHA A;  3SBG A;  4IO9 L;  1VQ8 N;  3C0B A;  1BUP A;  4A62 A;  1IG8 A;  2FXU A;  2A41 A;  3CET A;  4FOE A;  5FPM A;  3VPZ A;  5KPZ A;  5GIN A;  4QS8 A;  3EE9 A;  4JKF A;  1VQN N;  4YOR A;  3S41 A;  3A5M C;  2ZJR L;  3KVG A;  5AFU A;  3GBT A;  1DGK N;  4JKA A;  4A5B A;  1NJI O;  2Q0U A;  1JCE A;  3CJC A;  4KH4 A;  3HM8 A;  5EX5 A;  4A61 A;  4FO0 A;  2Q97 A;  1SS6 A;  1U6Z A;  5C12 A;  4PL7 A;  4JK8 A;  3CCQ N;  3ZYY X;  5F2R A;  4NO7 A;  1NGF A;  3ATV A;  5AZJ B;  4BQL A;  4EFH A;  3K9K A;  1HLU A;  2CGL A;  2QI2 A;  3O4W A;  5GAD P;  1DKG D;  4A2B A;  2WBN A;  4B1X B;  3R3L A;  1MDU B;  3FZL A;  1NGD A;  4BRA A;  1KC8 O;  3OW2 M;  1MA9 B;  3FLC O;  3MMV A;  3VGK A;  2WC9 A;  5F1X A;  1CZA N;  3G25 A;  4IEI A;  1NGJ A;  2BH1 A;  4BRL A;  3ULE A;  2FLO A;  5LY3 A;  4HTL A;  4RWT A;  3WEE B;  3KHY A;  2QWN A;  1VQL N;  2A5X A;  1O13 A;  2AA4 A;  1N8R O;  3H3O B;  4WYB A;  4CBX A;  1GLL O;  1NGA A;  1BOT O;  1E4G T;  1T6D A;  3CJA A;  5AQH A;  4BGA A;  3SMS A;  5I9E B;  4FWL A;  2GX9 A;  3M3Z A;  1NGC A;  4YOU A;  5EVZ A;  4BRF A;  4R79 A;  4H0V B;  2ITM A;  4FWO A;  3G4S N;  3U9Z A;  2QEX N;  1YF5 L;  4GV9 A;  4AM6 A;  2BTF A;  2ZGY A;  5AQQ A;  4H0Y B;  4GV3 A;  4YOV A;  3E66 A;  2E2Q A;  4CZI A;  4YDU C;  1YVN A;  3JS6 A;  3DXM A;  3LDP A;  2NRV A;  3E1Y A;  4JKC A;  1GLF O;  3O9T A;  2IVO A;  3LM9 A;  3MCP A;  5LJW A;  1Q7Y O;  3DXK A;  1JJ2 M;  2P9P B;  4M63 C;  5AQP A;  4FWK A;  3TSP A;  2F9T A;  3QDK A;  1Z6R A;  4GV6 A;  3MWP A;  4RCH A;  3CCS N;  4OO1 J;  4WQ5 A;  2WUS A;  3QIC A;  2YI1 A;  1LCU A;  2D0O A;  2PAV A;  3LL3 A;  4IOX A;  3HOS A;  1QQO A;  3CPE A;  2NRT A;  3J7Z O;  5AQU A;  3F9M A;  4BRC A;  1NGH A;  5GAE P;  3LM2 A;  1WUA A;  3QBW A;  4DQ8 A;  5M1F A;  2P9I B;  1K8A O;  2D4W A;  3F5T A;  1T3V A;  1YI2 N;  4IO8 A;  3VF2 A;  5AQI A;  3BUZ B;  5EOY A;  3SBT A;  3VGL A;  3KK7 A;  4K43 A;  3P31 A;  1S22 A;  2GEL A;  4BR0 A;  4DCH A;  4JAX A;  1GLD G;  5JLH A;  2ZJQ L;  4YOW A;  1HPM A;  3CC2 N;  5FPD A;  3A5O C;  3CD6 N;  4IJN A;  3VMF B;  3C6A A;  3CER A;  3H45 C;  3WXJ A;  3WXL A;  4WF9 L;  2P9N B;  3UB5 A;  2CGK A;  5BRH A;  3O08 A;  1RGI A;  4WCE L;  4JD2 A;  2E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...