2NRHA

Crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
192
Chain Sequence
LLLCDIGNSNANFLDKYFTLNIDQFLEFIFYINVNEHLKEHLKNQKNFINLEPYFLFDTIYQGLGIDRIAACYTIEDGVVVDAGSAITIDIIHLGGFILPGIANYKKIYSHISPFNTQVSLDAFPQKTMDALSYGVFKGIYLLIKDAAQNKKLYFTGGDGQFLANYFDHAIYDKLLIFRGMKKIIKENPNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator, putative, Baf family
publication title Crystal structure of conserved putative Baf family transcriptional activator from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Structural genomics, unknown function
total genus 59
structure length 192
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrhA01
5E84A 1C0GA 5AQMA 3U9ZA 4I6MB 1LCUA 3SLCA 3AAPA 2ZGYA 1NGAA 1QHAA 3FZLA 1K8KA 3BF1A 3VETA 5AZJA 3HM8A 1S3XA 4WQ5C 2FXUA 4H5VA 2GELA 3O80A 2QWMA 1X9JA 4MLEA 4BR2A 2ITMA 3FLCO 4CZEA 4DCHA 4LC9B 3JXUA 2GUPA 2A42A 5ELZA 5E26A 1ATSA 2Q1NA 3CQXA 3EL2A 4CBXA 1NM1A 1QZ6A 4H0OA 1TUYA 3HBTA 1JCGA 2QWQA 4H5TA 4FOIA 2A40A 4M63C 2GEMA 5FPMA 4B1YB 3IUCA 5LY3A 4BRQA 3VEXA 1YVNA 4J8FA 3JS6A 2FLOA 3TPQA 1U2VB 5AQIA 3W3DA 3U9DA 4EAHD 2P9NB 2VWBA 5AQYA 3D2FA 2IVOA 1BG3A 1KAYA 2GWJA 4HTLA 4MLHA 3BEXA 5I9EB 1GLFO 3IMXA 3QFPA 2QWOA 3FZHA 5BPLA 3GBTA 2ZF5O 3UKRA 3VOVA 3EO3A 3ZETB 2HF4A 5FPDA 1NGFA 2V7YA 5KQDA 1C0FA 4FOEA 4BC3A 2QXLA 4JHDA 4H0YB 1HKBA 3U4LA 3WXJA 1Y64A 1NGJA 5EY4A 2QWPA 1QZ5A 1ATNA 2NRHA 2P9UB 3WT0A 3R6MA 3VF4A 3QDKA 2Q97A 3MN9A 3A5LC 4JN4A 3L6QA 2Q36A 1MDUB 5AQZA 1TYQB 4MO5A 4JD2B 1X3NA 1JCFA 2A41A 5AZIB 1MWKA 4WYBA 3BUZB 3MK6A 2ZGZA 4M7YA 4I6MA 4CBWA 3SK3A 4BRKA 5BRHA 2QW9A 4GNIA 1EQYA 1YUWA 3DJCA 3H3OB 3LDQA 1NGDA 3LDNA 1GLBG 4Z94A 1NLVA 4H5WA 1QQOA 5TKYA 3FR0A 3I8BA 3LM2A 5BR9A 3QMLA 1G99A 1YAGA 3HTVA 5AQGA 1BOTO 3C7NB 3KHYA 3I33A 5AQNA 1IG8A 2YI1A 3FGUA 1E4GT 3L4IA 3QBXA 2FF6A 2P9LB 3O4WA 3W0LA 3CJAA 3M1FA 1U2VA 4BR7A 1OKJA 1YXQA 3B8AX 1HX1A 1GLCG 4PL8A 4PKIA 2HMPA 2P9NA 2W40A 4O5FA 1X3MA 3CETA 1JCEA 2QWRA 2W41A 1ATRA 4JAXA 5BN8A 4FWRA 3WEEB 3GL1A 3CJBA 4FWPA 4K43A 3CQYA 3UE5A 4PL7A 1BWFO 3SMSA 3DWLA 4B1ZA 4BRCA 1RDWX 4EFHA 4ISEA 3A5OC 3ZETA 2ZWHA 3LDPA 3DAWA 2KHOA 2PAVA 4BQLA 5AQUA 3MN5A 3VERA 2A6AA 2P9UA 4FWMA 3S41A 5KPRA 4QS9A 1NBWA 2AP1A 3H1QA 3D2EA 4WQ4A 4XH1A 4B1VA 2ASMA 2DPNA 1TYQA 5AQOA 5KPZA 3VF2A 3FZMA 4CI6A 4FWKA 2I7PA 4B1XB 4BRNA 4C23A 1ZBSA 2D4WA 3ULEB 4RWTA 3VEYA 3EKUA 1BO5O 2Q2RA 3LL3A 2D1KA 2P9KB 4CZJA 2BUPA 3FFKB 5B8HA 4NO7A 3O5BA 3O8MA 1GLEG 3FZKA 3GG4A 1NGEA 1P8ZA 4KBOA 1MWMA 1H1VA 3H1VX 2P9IB 3WQTA 4BRFA 2YHYA 4BRGA 4NB4A 4FWQA 3CHWA 4ISFA 2A3ZA 3C7NA 3RSEB 2ASPA 1BDGA 3ATUA 1QQNA 4CZMA 2P9LA 2Q0RA 1HKCA 4BC5A 2E8AA 1D4XA 3VEOA 1RFQA 3UKUB 4BGAA 2P9SB 5BREA 4BR9A 5EXWA 2VYPA 2E2QA 2Q31A 1GLDG 1ZXOA 3MDQA 1NGCA 4XEIA 4BROA 4FWOA 1RGIA 4XH4A 1LOTB 2BTFA 3WEEA 3H3NO 4CZLA 1ESVA 1GLAG 2CH6A 5AQQA 2A5XA 4FWNA 3L0QA 4K42A 4A62A 4DB3A 1BU6O 3J8AA 2F9TA 3EKSA 1KXPA 5ADXA 3O1BA 1HJOA 4JNEA 2E20A 4Y0WA 3VEVA 2NLXA 3CIPA 3CJ9A 3DXKB 4BR5A 3U8XA 3ID8A 3HSCA 3IFRA 3KZBA 2V7ZA 4M7XA 1XC3A 2NZTA 3HI0A 3MN7A 5JLHA 4BVPA 3DXMB 4ISGA 3A5MC 1T6DA 3GDQA 5FPEA 4GY2B 3SJHA 3MCPA 3O1WA 1U6ZA 2I7NA 3ULEA 3D7EO 3LDOA 4H5NA 3AY9A 3R9PA 5BRDA 3ZEUB 3VGMA 4MO4A 1NWKA 4BRLA 2P9KA 2CH5A 3AAQA 4H0XB 3UKRB 4BVOA 3GOIA 2UYTA 5KPTA 5AQKA 5JLFA 4WQ4C 1T6CA 3BP8A 3TU5A 4B1UB 2Q0UA 5AQLA 3WXKA 4BR0A 4PKHA 4BQZA 1ZC6A 2YCHA 1SQKA 3MN6A 4BC2A 4CD3A 4RCHA 1SAZA 4EHTA 4B1WB 5BPNA 2FF3B 4AM7A 4A2AA 4AM6A 3VESA 3ZX3A 4DHYA 4YDUC 3QB0A 3WQUA 4H5RA 3UKUA 2GWKA 2P9SA 3LDLA 5LJVA 5AQSA 2V51B 4BRMA 5F1XA 5AQWA 5AQFA 2IVNA 4BRIA 4CZIA 3ENOA 3EZWA 4JD2A 4RTFD 3P4IA 3QBWA 4A2BA 4CBUA 5AZIA 4H03B 4A61A 2E88A 2CGKA 2P9PB 1BA0A 4B9QA 4BRAA 4IJAA 1NGGA 3O6WA 5F2RA 4QS8A 4YDUA 5JMVA 3UB5A 2J4RA 4CZGA 1DKGD 1NGHA 1S22A 3EN9A 5AQJA 3DXKA 1V4TA 2YJEA 1TUUA 2FSKA 1KAXA 2VCPA 3M3ZA 5AQXA 3QFUA 4H0PA 4BG9A 3QICA 1V4SA 2F9WA 3IDHA 3DXMA 1GLJO 4F9OA 4XH5A 1NMDA 3VEZA 3FE1A 4BRPA 4WQ5A 3VENA 3ATVA 2CGJA 1J6ZA 1WUAA 1XUPO 5FPNA 4IJNA 4CZKA 5EX5A 5AQPA 1NGBA 4FPBA 2HF3A 3ZX2A 4K25A 4IZ9A 2QWLA 4FL9A 2IVPA 3ZX0A 3O08A 2OANA 3ZEUA 4EHUA 1R59O 3A0IX 3SMPA 2D0PA 2E1YA 2QWNA 5AQHA 4IO8A 4FSVA 3CI5A 1Z6RA 4FPAA 2V52B 5AQVA 2CGLA 3WUHA 1WOQA 2ASOA 1K8KB 5AZJB 4BREA 4BC4A 1SZ2A 4BG8A 4FWLA 4PKGA 4DQ8A 3R8EA 1HKGA 2HOEA 3WXIA 3VF6A 5CE3A 4E1JA 1IJJA 5ADXH 3ENHA 1BA1A 1HLUA 3A8YA 5AQTA 2PBDA 3D2EB 4BRHA 4BRDA 4O8KA 1E4FT 1MA9B 5LJWA 2YHXA 4HWIA 4H0TB 2D0OA 3CJ7A 1HPMA 5F0XA 3BF3A 3VGKA 2YJFA 4BR4A 3FZFA 1GLLO 2FSJA 4FO0A 3C0BA 3A5NC 3LM9A 1HUXA 5AFUH 2H3GX 1KAZA 2P9PA 5AFUA 2EWSA 5BRFA 5JICA 2E2NA 3D2FB 4BGBA 3M6GA 3HZ6A 2E2OA 3AARA 3H45C 4IXCA 3KVGA 4EIAA 2QM1A 2YHWA 2GTDA 3H46O 4CD1A 3G25A 2AA4A 5BPMA 2FSNA 4CJ7A 1XQSC 1NGIA 5AQRA 4L3QA 1Q18A 4FWSA 5BN9A 3VPZA 3CERA 2E2PA 3F9MA 4CZFA 4IWVA 3OHRA 3VEWA 4JHDB 3VGLA 2P9IA 1DGKN 4CZHA 5EVZA 4H0VB 1BUPA 5KQ8A 3MMVA 3RSEA 4QS7A 2IIRA 2WUSA 3CJCA 1DEJA 1CZAN 3CJ1A 5AR0A 3WXLA 2E1ZA 5EOYA 3GE1A 4K41A 1QQMA 1T44A 1Z05A 3H6EA
chains in the Genus database with same CATH superfamily
3QNNA 3V9SA 3KK2A 4CJTA 1LCUA 2FC0A 4FJXA 2O8FB 4M3XA 2ZGYA 3QERA 3DLGA 4CEDA 3AV9A 3BF1A 4BE1A 4CF2A 2GELA 3O80A 2XHBA 3AVAA 4DR3K 1VQ8N 4MLEA 4IDHA 4RW7A 4LC9B 4GMJB 5M1FA 1EWQA 3CQXA 3EL2A 4CIEA 3OY9A 1VRTA 1JCGA 4DV7K 1IKYA 1TKTA 3CG7A 4FOIA 4WFAL 1RBSA 2DFEA 4M63C 2F7TA 3ZLJA 3NF9A 1U04A 4BRQA 2HVHA 4NYNA 2ITGA 3JS6A 1L3VA 2IDOA 4B3SK 3W3DA 2HBJA 3CCMN 3I0RA 2FBVA 4DTSA 4Z4CA 1SV5A 3ZSYA 3P38A 1ASUA 4C8KA 3D2FA 1HPZA 2ZE2A 2JWLA 4MLHA 4DLEA 1OH8A 4DU3A 3QFPA 4CK2A 2QWOA 4FCYA 2IS3A 1SKSA 1JLBA 4BWMA 3RMAA 3RVCA 4IOAL 3OYMA 1Q81O 5I42A 3AA2A 2V7YA 4FOEA 3VQ4A 4JHDA 3U4LA 3AVJA 5EY4A 2HHHK 4LSNA 1TAQA 2NRHA 3TTFA 3N4PA 1YIJN 2ZJPL 4M3WA 5D3GA 4B9TA 4JN4A 3L6QA 2VQEK 1MDUB 1TYQB 2KFZA 1X3NA 4B9SA 2A41A 1MWKA 4IEEA 4KFBA 4M7YA 4CBWA 3O4QA 2O8FA 1EX4A 2HNYA 4DLGA 5BRHA 2QW9A 4GNIA 3H3OB 4I2PA 4IOXA 4FLXA 1BIZA 3ZSQA 4DTMA 5CZ1A 4CJWA 2HSTA 1EP4A 1NLVA 1RBRA 5GAGP 1WN7A 4E7LA 3CCSN 4KO0A 5BR9A 2QI2A 4HUGA 3MXIA 1WSEA 4CIGA 3I33A 4R5PA 1IG8A 2Y1JA 1YHQN 4B3OA 3QEWA 3FGUA 3L4IA 5SZTA 3VQPA 2P9LB 1S72N 2UXBK 3M1FA 3L2QA 4JV5K 4BR7A 1OKJA 3B8AX 2JWKA 4PL8A 4PKIA 4G9ZA 2HMPA 4AH9A 5SWMA 4KB0A 2W40A 1HQUA 4O5FA 3CMEN 3OYDA 3MWPA 3QLHA 1RT3A 2QWRA 4LSLA 4JAXA 4JKCA 4FWRA 4CJQA 5GAEP 3HPOA 3SMSA 4B1ZA 1RDWX 3HL8A 4CHOA 1XMOK 2VGMA 3DAWA 1XNQK 4W5NA 2PAVA 5AQUA 3L2WA 1NKCA 4JYAK 2NRRA 2AP1A 3H1QA 2W6LA 4O0JA 1TYQA 4DS4A 4FLVA 3E01A 3VF2A 3DOLA 4DV6K 3FZMA 4CI6A 5BR8K 4FWKA 2I7PA 2B4JA 4C23A 4X64K 3S9HA 1DTQA 2D4WA 3ULEB 1IV0A 2BH1A 3EKUA 3HOTA 3ZT1A 1S1XA 4QOZB 4CZJA 3FFKB 3LAKA 3JYTA 4J2BA 3SNNA 1LWEA 1RBTA 3GG4A 3OA9A 3K58A 4KBOA 4B8AB 1MWMA 1TKXA 2P9IB 3WQTA 4BRFA 4CGJA 2O8EA 3CHWA 1D8YA 4ISFA 1D5AA 5EU7A 4LF9K 4CEBA 3SJJA 3C65A 1A5XA 3H08A 1BDGA 3ATUA 3PSFA 3VQ5A 2P9LA 1N34K 3ZT4A 4KTQA 4RW9A 1D4XA 3VEOA 3L2UA 5GAHP 3WXMB 5BREA 1U4BA 4MDBA 2X74A 3E66A 2E2QA 1C0MA 1NGCA 4XEIA 1WSHA 4XH4A 2BTFA 4I9QA 1XHZA 1W97L 1U47A 3TAFA 4IO9L 3E1YA 4CZLA 4KAZA 3SQ4A 4K42A 3CFOA 2O8CB 2F9TA 3EKSA 4YFUA 3VQAA 1OH6A 4JI3K 4JKGB 4Y0WA 2NLXA 3ZCMA 3DXKB 4O8UA 1UA1A 3RMBA 2VG6A 1JLGA 1JXBA 2RF2A 1R0AA 1VSKA 2NZTA 3IAYA 3HI0A 2UUCK 5JLHA 4B8CA 3DXMB 5C12A 4ISGA 1GOBA 2I5JA 4CJ3A 4KHPK 3GDQA 5FPEA 1RTJA 4M3UA 3J7YP 3BZKA 5DK5A 4CFAA 3KWGA 3SJHA 3MCPA 4FLUA 3SUPA 1OH7A 3TANA 3ULEA 4B3TK 3LDOA 2ATQA 1JLAA 3ZEUB 4W5QA 1DT9A 3AA4A 3NCIA 4CK1A 4OVLA 1JLFA 3TAPA 1J5EK 2W42A 2UXCK 4H0XB 3UKRB 3NF7A 3HRGA 5C0YA 3CCJN 4BE0A 2HHSA 1HNVA 2D5RA 5KI6A 4Y1CA 4ZHRA 2YCHA 3MN6A 4CJVA 1CXUA 1T03A 1SAZA 4EHTA 5BPNA 1JJ2M 2HW3A 4JI4K 2HHVA 2GWKA 3CFPA 4OKKA 3LWLA 1VQ9N 3ZSOA 4BRMA 2UU9K 5HRNA 5FRNA 1LWCA 5KRTA 4RTFD 4A2BA 2JGUA 1WBBA 5AZIA 2E88A 2KKZA 2FBTA 1TAUA 1BA0A 5FDLA 5M1OA 3M5RA 3O6WA 3T1YK 4IOCL 3LZIA 1S22A 1FKOA 4JKGA 3CC2N 1Y97A 3DXKA 2YJEA 3OVNA 5JS2A 2VCPA 1I39A 3QFUA 3T3FA 1ASWA 3KK3A 3IDHA 1K8AO 3E9OA 3DXMA 2O4IA 3EE9A 3DOKA 4DF4A 4XH5A 4RW4A 1S9GA 1HNXK 2G8HA 4LFBK 1Z25A 4DTPA 3BDPA 1VQMN 1J6ZA 1G15A 3P39A 4JI2K 1XUPO 4I2QA 4JK7A 4CGFA 3D0PA 1NGBA 4FVMA 4CHZA 3THXB 4K25A 4FL9A 3OTOK 1BISA 2OANA 3ZEUA 3AVHA 2D0PA 3NMUA 4HCBA 5C25A 1K73O 1WLJA 3WUHA 4YORA 1XMQK 4KTWA 5AZJB 1SZ2A 4DTRA 4DQ8A 4J2AA 4KHSA 1HKGA 1KD1O 2UXDK 5HRRA 3TSPA 4HHTA 4CGGA 3AVKA 4F3TA 3D2EB 4LD0A 4BRDA 3U3YA 5LJWA 4BDZA 4GKJK 3V6DA 4RW8A 1ZBLA 2HB5A 3LPUA 3QO9A 2YX6A 1YI2N 3MEDA 3CCRN 3CJ7A 3HVRA 4FJIA 5JVGL 4N41A 1TL3A 1F21A 4FO0A 1HNWK 1ILYA 3PV8A 2EWSA 2E2NA 4JEPA 1NK4A 3M8RA 4WF9L 3MXMA 4EIAA 2GTDA 5LMUK 3KD1E 3VQCA 2FSNA 4CJ7A 3QESA 3DLBA 3MX5A 5KQ8A 3DM2A 2R7YA 2GUIA 2XO7A 2Z1HA 4CFCA 3WXLA 4DR6K 4K41A 3THXA 1QQMA 4KKOA 1Z05A 1NNEA 2D0CA 1UOCA 5AQMA 4AHVA 3ITHA 4ZTJA 1HQEA 3NGIA 3AAPA 3FZLA 3SAFA 5AZJA 3J7ZO 2FXUA 4JI1K 3SV3A 4DQIA 1X9JA 4BR2A 4NLBA 2NRZA 4DCHA 1S1WA 1X9SA 3SPZA 1ATSA 4JI6K 4CBXA 4FJNA 1KFDA 2WBNA 4H0OA 3AVMA 1VSMA 4H5TA 3O3HA 3DLEA 3AO4A 4CHQA 3IUCA 4E7IA 1IKXA 1YVNA 1U2VB 2BDPA 3J7AP 5AQIA 3NDKA 3RMDA 2VWBA 5AQYA 3OYAA 1BG3A 3OYLA 4HTLA 3BEXA 3G6EN 3KK7A 3TTDA 3GBTA 3CPWM 3E9PA 4FM2A 3VMFB 1FW6A 3BZCA 5C2DA 2ZF5O 4E1NA 2VGNA 4O5BA 1K6YA 2XY7A 1SKRA 1KVCA 5KQDA 4BC3A 3WXJA 3AO1A 4WFNL 3VA3A 1Y64A 2ZM6K 4CHNA 1VRUA 3TR8A 3OYCA 4WFBL 4DV4K 3WT0A 3DLLL 3KLEA 4DV5K 4CGHA 4JRPA 4NYFA 3PIOL 3MN9A 3A5LC 2WONA 5GIPA 4MO5A 1NK5A 3NFAA 3T69A 4WYBA 4FK0A 3CC4N 1L3SA 3I56N 1QS4A 3SK3A 4BDYA 4BRKA 5HRSA 2G8FA 3G4SN 1EQYA 1YUWA 3DJCA 5TKWA 1NGDA 3HM9A 1HYZA 3LDNA 4YHHK 4OX9K 4CJSA 4Z94A 3VTHA 4M41A 3KLIA 1YITN 5CYMA 1KRPA 3FR0A 3CD6N 4GV6A 3L2RA 5H1SQ 3QMLA 1G99A 1TKZA 4H4OA 4KHNA 1BOTO 3C7NB 5AQNA 4UQGA 2YI1A 5CZ2A 3F73A 4LF4K 2FF6A 3O4WA 3CJAA 2DFFA 1U2VA 3O9SA 2GX9A 1HX1A 1GLCG 1DLOA 2DY4A 4A59A 1X3MA 4M3TA 3CETA 2W41A 1ATRA 5BN8A 3CCQN 3WEEB 3GL1A 1UAXA 4R79A 1BWFO 1JKHA 4BRCA 5DM6L 1KFSA 4EFHA 4ISEA 1X9WA 4ELUA 2NRTA 3A5OC 3F5TA 3AVGA 4TSXA 2PZSA 3LDPA 3LP1A 1YJ9N 3VERA 5DM7L 2A6AA 4B3MK 3V81A 4A57A 4FJMA 3THYB 4YOYA 3IS9A 4FLTA 2DPNA 4CFDA 3DYAA 3SQ2A 4B1XB 3P31A 4CJ4A 2YNHA 4B9UA 4RWTA 5GINA 2EHGA 3ZSXA 4CCHA 4CK3A 4MQ3A 2P9KB 2BUPA 3B6OA 4YOVA 1QVGM 5B8HA 3AGRA 1HRHA 3O9TA 4DQSA 1GLEG 3FZKA 1C0TA 1P8ZA 4LH5A 4YNQA 1S5JA 4LY7A 4NB4A 4E3SA 4O55A 3MCAB 4FWQA 3K59A 2Z1IA 2WC9A 1VK0A 3C7NA 2ASPA 5GADP 1NJZA 3AVLA 1CZBA 1QQNA 4U67L 1HKCA 4BC5A 4L8RB 1J53A 2UUBK 2VWKA 1EETA 2P51A 2HHWA 5EXWA 4B3RK 4CFBA 1ZXOA 1RNHA 3MDQA 5IT9O 4BROA 1N5YA 1QQCA 1LOTB 3PLAA 4FZXC 1VAZA 1XNRK 3WEEA 5M1NA 4FLZA 4GKKK 1GLAG 2CH6A 1FK9A 2A5XA 3KJVA 3L0QA 4RG8A 4FJ7A 1NOYA 4DB3A 1BU6O 1K9MO 2EX3A 3V1OA 3O1BA 1WB9A 3NH2A 4IFYA 4BR5A 3U8XA 4BDPA 3IFRA 4NLCA 3LDSA 3V1RA 3J81O 4BVPA 3THYA 4DV2K 3A5MC 5CHIA 1VSIA 1KSPA 4CGIA 3CCVN 1IKVA 1U48A 3HVTA 1D9DA 1N36K 4CJKA 4ICLA 4DSIA 3PX4A 4DUZK 4JS4A 5FROA 2D0BA 3MXJA 3LP3A 4OLAA 3SUNA 1TKDA 1TK0A 4DTJA 1LW0A 4A5AA 4BRLA 2P9KA 4DR7K 4KH6A 3KIOA 3QETA 4Q5VA 2QA4N 1VQ6N 1SL2A 2UYTA 4YOXA 1YVUA 5JLFA 4WQ4C 4B1UB 5J2NA 2E6MA 4ZTFA 4PKHA 4BQZA 3AA3A 1ZYQA 4BC2A 4LF5K 4CD3A 4UY8O 1BCMA 4G1QA 4B1WB 2FF3B 4ELTA 4N5SA 4NCAA 4AM7A 4A2AA 3OJUA 4DHYA 3QB0A 4KH5A 1REVA 3CQ8A 1TVRA 4IBNA 1WSIA 5F1XA 5AQWA 5AQFA 3O9QA 4BRIA 4CZIA 2O8DB 3EZWA 4FZZA 1C1CA 1OVYA 4H03B 3V9WA 2ETJA 1VQPN 2CGKA 2OPPA 2P9PB 1RDBA 3TAEA 4DTOA 5F2RA 4QS8A 4YDUA 5JMVA 3K5NA 4CF8A 2Y1IA 2XY8A 3THVA 5AQJA 4GV9A 1V4TA 2FSKA 3AVCA 4EZ9A 1GOAA 1B92A 4FM0A 3QICA 1W2BM 4CESA 1N6QA 3SUQA 1GLJO 4F9OA 2KQ2A 3VEZA 4BRPA 3VENA 3ATVA 2CGJA 4AQYK 1WUAA 2F4VK 4IJNA 4CZKA 1QSLA 5AQPA 4DQPA 3SYZA 1EXQA 3I0SA 3MEGA 4QAGA 4JKDA 1RBUA 4K0KK 4DSJA 4FYDA 4DR2K 4OKJA 3OYFA 1MU2A 3OYGA 3O08A 3K5MA 1RCHA 3SMPA 3AO3A 3ZSZA 4DQRA 2YNGA 5AQHA 4DFMA 4IO8A 1WAFA 4FPAA 5AQVA 3MAQA 2OCEA 1YJWN 1WOQA 1ITGA 1VHXA 4BC4A 3HP9A 4FWLA 4ILJA 3SAGA 1WSFA 3V4IA 4E1JA 1M90O 4QCLA 5KGXA 3ENHA 1HLUA 3A8YA 4BE2A 3P1GA 4OJRA 1BIUA 2PBDA 3LWMA 4DR5K 4HVJA 4H0TB 1BGXT 1RT7A 2PYJA 3PSIA 3G10A 1HPMA 3RRHA 2G8IA 3VGKA 2YJFA 3QNOA 4BR4A 3FZFA 1RDDA 1WBDA 2O8DA 1VQ5N 3C0BA 2RHKA 3OBWA 5AFUH 2RE2A 2DTUA 3DRSA 3OYHA 2P9PA 2HBKA 5BRFA 3NH0A 3M6GA 2E2OA 2NRVA 4N76A 1JLQA 1HR0K 1NK7A 2Z1GA 1S1TA 3EE8A 3G25A 4Y1DA 3ISNC 4CD1A 1YF5L 1QHTA 4L3QA 2A1SA 4JK8A 1JLCA 3SQ0A 1LAVA 2E2PA 3F9MA 4CZFA 2BE2A 4IWVA 1FKPA 2P9IA 2OZSA 1HYSA 4LF8K 4CZHA 1HNZK 3IKMA 3MMVA 4QS7A 2IIRA 2WUSA 3V9XA 2E1ZA 2HNZA 3OS2A 3GE1A 3JAMO 1RTDA 1T44A 1TV6A 2E5LK 3QIOA 1UA0A 4JLHA 4X62K 3AO2A 3U9ZA 1IH7A 3CXCM 4I6MB 3SLCA 4CEAA 2VG5A 4C8LA 1QHAA 4J2EA 1S3XA 4WQ5C 4F3OA 4Q0BA 2ITMA 5JVHL 4LF7K 1JXEA 4V19S 2O8CA 2GUPA 5ELZA 3PY8A 1IBMK 5KRSA 2HHUA 1TUYA 3HBTA 2QWQA 4KH4A 4DR4K 2GEMA 1O13A 5LY3A 4DSLA 2RPIA 2B6AA 2QXFA 2A1RA 3QINA 1RBVA 3U9DA 2HBMA 3VTIA 2P9NB 2PY5A 4Z0UA 2IVOA 2VWJA 4H8KA 3KLHA 2RN2A 3DMJA 2GWJA 1KCFA 1VQNN 1GLFO 3IMXA 4PA1A 3DI6A 3CPEA 3UKRA 3VOVA 3F2KA 4OLBA 3C6HA 4H4MA 4JK9A 4JRQA 1NGFA 3AA5X 4NXMK 4OPKA 4W5TA 1SUQA 2QXLA 2ZJQL 1NGJA 2QWPA 1ATNA 3HJFA 2P9UB 4K8XA 4KHUA 3R6MA 2HBLA 4FW2A 3QDKA 2XY5A 1FJGK 1S6PA 4GV3A 4F2SA 3HK2A 5M1QA 2WTUA 2AJQA 5AQZA 4JD2B 3LALA 1JCFA 3BUZB 3MK6A 3DLHA 4I6MA 2YHBA 4DUYK 1JLEA 4CVNE 1ZBHA 2XRIA 4ID5A 1KLMA 3OS0A 4F8RA 3ZT2A 4DTUA 1Q9YA 2O8BB 2KZZA 3JSMA 2ZJRL 1Q86O 1YTAA 3SV4A 4WE1A 4DTXA 2QEXN 3OS1A 1QQOA 3WNHA 4KB1A 3I8BA 4NCGA 4FJ8A 2UUAK 1OH5A 4KPYA 4CF0A 3HTVA 5HRPA 2X6SA 3CCLN 3SZ2A 1RT4A 5J1EA 3QBXA 1A5WA 3NGYA 5FLXO 1VSHA 3W0LA 3EYZA 1D9FA 3J80O 3L3VA 3PO5A 1YXQA 2KFNA 2P9NA 4XIUA 3VQBA 3ID6A 3LP2A 3NVKA 3CJBA 4Z4FA 1VSFA 5DMRA 4KV8A 3UE5A 4DQQA 4DU4A 1QSYA 3PX6A 2ZWHA 1L5UA 2KHOA 2P9UA 3RR7A 4FWMA 5KPRA 3I55N 4QS9A 1WAJA 2KLAA 1QVFM 2VG7A 3D2EA 1JL1A 4GVEA 4XH1A 1O1WA 3TI0A 2ASMA 2G8KA 5KPZA 3KKRA 4E0DA 4CW7B 4BRNA 2OTLN 2KTQA 4JKBA 1ZBSA 3VEYA 4DTNA 4DV1K 3C6AA 1BO5O 2Q2RA 4CEOA 3TARA 1T05A 1ASVA 3FFIA 3TSUA 3E9LA 1WSJA 4OGCA 3AO5A 4NO7A 3PO4A 1S6QA 3ZT0A 3VQ8A 1W9HA 1VQ4N 1NGEA 4CERA 4CJPA 3H1VX 4E7KA 2YHYA 4BRGA 4I9LA 1ZBUA 4OPAA 4MFBA 2A3ZA 3RSEB 3OJSA 4Z4HA 4FVUA 3OYIA 2NUBA 1T7PA 1C1BA 3SAHA 1S1UA 5C42A 2E8AA 1B9DA 4GW6A 3THWB 1RFQA 3DLRA 4BGAA 2ZQBA 4PQUA 4BR9A 4CJEA 3SCXA 4IG3A 3SPYA 4IKFA 2Q31A 1GLDG 3AGKA 4M3RA 4B9NA 4KRFA 2O4GA 3N4QA 4BY9C 4FJGA 3DLKA 3H3NO 1HNIA 5AQQA 3RRGA 1S1VA 4CEZA 5LL6Z 4LFAK 3CFRA 3M8PA 4IEIA 1KXPA 1SS6A 3VEVA 3CIPA 3CJ9A 1EKEA 1NJWA 3HSCA 1X1PA 3KZBA 2V7ZA 4M7XA 3CM5A 3MN7A 4CJRA 1RT5A 3L8BA 1T6DA 1ZBIA 1KTQA 1NKEA 4AHSA 4Z4EA 5KTQA 2HHTA 3O1WA 4DWIA 4E7HA 1U6ZA 3AY9A 5BRDA 1NJXA 1DTTA 1NWKA 3DRPA 3WNGA 5HBMA 3AAQA 3O9UA 4LF6K 5KPTA 2OPRA 3GOIA 5AQKA 1T6CA 3TU5A 5E41A 2G8WA 5AQLA 3WXKA 4BR0A 5HL7L 1ZC6A 3PUFA 3MX2A 3KK1A 2QKKA 3RR8A 4X66K 3LZJA 1NK0A 1FXXA 1NK9A 1I94K 4AM6A 3VESA 3ZX3A 4YDUC 3WQUA 4H5RA 3HYFA 4JKAA 2VQFK 3LDLA 5LJVA 2V51B 1TGOA 3ENOA 4C1NI 2FBXA 3P4IA 2G8VA 3VQDA 4BRAA 1EWRA 4CJLA 1NGGA 2GV9A 3SUOA 3UB5A 3M8SA 2J4RA 4CZGA 4FZYA 3V9UA 4BACA 3K5LA 1KC8O 1QSSA 1VQ7N 2PYLA 5AQXA 3RWUA 4BG9A 1NMNA 4DKWA 2F9WA 4HUFA 1XC9A 4CEQA 3P5JA 4YOWA 2YKNA 3NGZA 4J2DA 5FPNA 5EX5A 3S3OA 1C1AA 3SBGA 3T19A 3S3MA 2IAJA 2HHXA 2HF3A 4OKEA 4KI4A 2IVPA 3HO1A 4AILC 4EHUA 4W5OA 4CJUA 4EP4A 2E1YA 3VQQA 4FSVA 3CI5A 1Z6RA 5I3UA 2F8SA 4KHWA 2V52B 4JI0K 2ASOA 1K8KB 3WNFA 2KW4A 2JLEA 4BREA 4CF1A 4PKGA 2HOEA 3WXIA 5M1PA 3VF6A 5CE3A 3PX0A 5KGWA 1BA1A 4BRHA 4LH4A 4O8KA 3VA0A 2E4LA 4B9LA 1Z26A 2BGGA 3NH1A 2YHXA 4CJFA 4FK2A 5J2QA 4OO1J 4AF1A 1W7AA 2D0OA 4PY5A 3BF3A 3EEQA 3CM6A 4FLWA 4C8OA 3U6FA 5M1KA 3A5NC 4FXDA 3D6RA 1KLNA 2H3GX 4FJ9A 1KAZA 3BY5A 5AFUA 4NXNK 2HVIA 3TAMA 1P90A 1HYVA 4HTUA 3AARA 3HXMA 2QK9A 1LV5A 3H45C 4IXCA 3KVGA 1RT6A 2KZMA 2YHWA 5A2QO 3H46O 5BPMA 1HJRA 3T7ZA 1XQSC 1NGIA 5C10A 2O8EB 1Q18A 1LWFA 2ZD1A 3P83D 2HNDA 4FW1A 4FWSA 4ILHA 3VPZA 3VEWA 3OHRA 4O44A 2RKIA 3VQ7A 2P5OA 1U45A 4H0VB 1BUPA 4DFPA 1YT3A 2OZMA 5CYQA 4JI5K 1WSGA 1NJYA 5AR0A 4C8MA 3T1HK 3CMAN 5E84A 4DFJA 3VQ9A 1C0GA 3F9KA 3NF6A 4YOUA 4CJ5A 1J9AA 4DMNA 1NGAA 1K8KA 3VETA 1C6VA 3HM8A 4H5VA 3S3NA 3TTCA 4DSEA 2QWMA 3EY1A 3FLCO 4FM1A 4DSFA 3ZYYX 3K0SA 4CZEA 4OPJA 3BGRA 2F8TA 3Q7CA 3JXUA 3KLGA 2A42A 2PFUA 5E26A 1NG9A 2Q1NA 1NM1A 4MDAA 1QZ6A 1NKBA 2OTJN 2X78A 4JI7K 4DSKA 4DV3K 2A40A 1QE1A 5FPMA 4B1YB 1BHLA 3R1XA 3VEXA 4LFCK 1VQLN 2XY6A 3HOSA 4J8FA 5MLCQ 3NF8A 2FLOA 5CR4A 2NRXA 4JKFA 3TPQA 4U7BA 3OYNA 4EAHD 3LANA 1RDUA 1B9FA 1KAYA 1N8RO 1M1KO 5I9EB 3AVNA 4FJHA 3FZHA 3R3LA 5BPLA 3G71N 1SL1A 4CE9A 5J2MA 4JKEA 3TABA 1N32K 1EO1A 3EO3A 2QTDA 4M3ZA 3ZETB 2HF4A 5FPDA 3K57A 3O3GA 1C0FA 4H0YB 1HKBA 3O3FA 1QZ5A 3VF4A 4KI6A 2Q97A 1KVAA 3ALYA 1Q8IA 3KLFA 2Q36A 1RDAA 3KD5E 2G8UA 5AZIB 2ZGZA 3KTQA 1NK6A 2E6LA 4IDKA 5LMNK 4EZ6A 1GOCA 3LDQA 2B5JA 1GLBG 4JI8K 3AVBA 1VQKN 1S9EA 3EZ5A 4CHPA 4H5WA 4FJ5A 5TKYA 3CCEN 1XI1A 3LM2A 4YY3K 4FK4A 3CYMA 4AHCA 1YAGA 5J2PA 5AJ3K 5AQGA 3KHYA 4DS5A 4N56A 1E4GT 1IBKK 1BQNA 3D45A 2DFHA 5FRMA 5IWAK 2Z1JA 1JCEA 3V9ZA 3QEVA 4FJKA 4HUEA 4FWPA 4K43A 3VN5A 3LP0A 3CQYA 1BI4B 4PL7A 2WFBA 3DWLA 1VQON 4X65K 3ZETA 1IO2A 2YNFA 4BQLA 3IG1A 3MN5A 4DG1A 2P1JA 2NRWA 3S41A 1NBWA 1XHXA 1X9MA 1IKWA 3O4NA 4WQ4A 1IG9A 4KHQA 2FBYA 4B1VA 1CXQA 3IRXA 5AQOA 3L4QA 4AHUA 4Z4IA 1SKWA 3NHGA 1CLQA 2YKMA 1J54A 4E89A 4EP5A 2OPQA 3LL3A 3PIPL 4GVMA 2D1KA 4W5RA 1HMVA 1OVQA 2X6NA 5HLFA 4O4GA 3CC7N 3LAMA 3K9JA 4M45A 3O5BA 3O8MA 3HP6A 3OYKA 4CGDA 1I3AA 1H1VA 2IGIA 4CIFA 3I8DA 3TWHA 3KWIA 4N47A 4DU1A 2OA8A 3ZSVA 2HHQA 4M42A 4JKHA 3K2PA 3SI6A 3HPHA 4CF9A 3U3GA 4CZMA 2Q0RA 2YV0X 4JS5A 4M3YA 4YOTA 3UKUB 4CHYA 2P9SB 1NOZA 4O0IA 2VYPA 3VQ6A 4IFVA 1T3VA 1LAWA 4FWOA 1RGIA 4CEEA 1JL2A 1KVBA 1ESVA 1BI4A 2NNWA 2YNIA 3SQ1A 4FWNA 1T8EA 4A62A 5HP1A 4ILGB 3J8AA 4DR1K 4HCCA 5ADXA 1CZ9A 1HJOA 3C95A 2E20A 4JNEA 1Q7YO 1IBLK 3ID8A 1L3UA 4A5BA 1YTUA 1XC3A 2P5GA 1RT2A 2OYQA 3QIPA 1W0HA 3M8QA 1TK8A 2Q3SA 3ZT3A 5HOOA 4PUOA 4GY2B 4Z4GA 3V1QA 3DRRA 4FLYA 2I7NA 4KREA 3D7EO 4H5NA 3R9PA 3TAQA 4CECA 1YJNN 3VGMA 4MO4A 4DF8A 1VSEA 4C8NA 1VSJA 3QEIA 2CH5A 1NK8A 3ZSRA 4BVOA 3K9KA 4PHTX 1UWBA 4C1NK 2IC3A 1KQSM 3BP8A 3UIQA 1QTMA 4F4KA 2Q0UA 3L2VA 2QKBA 3ZSWA 4E7JA 1LW2A 3B6PA 1SQKA 3LPTA 2WOMA 4RCHA 5K14A 1E3MA 3HT3A 2GBZA 3C6TA 5T7BA 5C15A 4IG0A 3UKUA 3OYBA 3ENBA 2P9SA 4B9VA 3QEPA 5AQSA 2IVNA 2W6KA 1TL1A 4JD2A 4CBUA 1XWLA 3QBWA 4OPHA 1U49A 1TK5A 1BQMA 5HROA 4A61A 1Q82O 3NE6A 4B9QA 3O9RA 4NCBA 4IJAA 2O8BA 4AHRA 2IOCA 4BWJA 3RMCA 1L3TA 3T1AA 5JS1A 3KKSA 1DKGD 1NGHA 4KTZA 3EN9A 2F96A 4F2RA 3ULDA 4RW6A 1TUUA 4FJLA 1KAXA 5GIOA 3M3ZA 3SBTA 4H0PA 1RTIA 1V4SA 3MECA 3NVMA 1NMDA 3FE1A 2D0AA 4WQ5A 1NJIO 4B9MA 5C24A 3L3UA 3OBYA 1C0UA 4FPBA 3ZX2A 4IZ9A 2QWLA 3ZX0A 1BL3A 3Q7BA 1R59O 3A0IX 2QWNA 4KHYA 1J5OA 3HSTB 1NU0A 4B08A 2CGLA 3A2FA 3RTVA 4E1MA 4BG8A 3C94A 3R8EA 5CY4A 1IJJA 5ADXH 3OYJA 3CF5L 1RTHA 5C2FA 2BANA 5AQTA 3MEEA 1E4FT 3MWTA 1MA9B 1N33K 4DFKA 4K8ZA 4HWIA 3VQEA 3G0ZA 2LSNA 3TSQA 4DV0K 4E19A 5F0XA 1RT1A 1GLLO 2FSJA 3WNEA 1RILA 3LM9A 1HUXA 2YHAA 4WCEL 1Q9XA 3CCUN 5JICA 3HPGA 3D2FB 4OGEA 4BGBA 3HZ6A 3K5OA 3NBPA 4FJJA 3ASMA 4I7FA 2HMIA 2QM1A 4ELVA 1VSLA 2AA4A 4PWDA 3AVIA 1VSDA 5AQRA 1RDCA 4ID1A 3TAGA 4CEFA 1SL0A 5BN9A 3CERA 2OPSA 4JHDB 3VGLA 1DGKN 5EVZA 1WNSA 3QEXA 3OYEA 3RSEA 3CJCA 1DEJA 4IFEA 1CZAN 3CJ1A 5EOYA 1BCOA 1A5VA 1ZBFA 3OW2M 3AVFA 3C6UA 3H6EA 4AHTA 3THWA 3NAEA
chains in the Genus database with same CATH topology
5E84A 1C0GA 5AQMA 3U9ZA 3CXCM 4YOUA 4I6MB 1LCUA 3SLCA 3AAPA 2ZGYA 1NGAA 1QHAA 3FZLA 3SAFA 1K8KA 3BF1A 3VETA 5AZJA 3J7ZO 3HM8A 1S3XA 4WQ5C 2FXUA 4H5VA 3TTCA 2GELA 3O80A 2QWMA 1X9JA 1VQ8N 4MLEA 4IDHA 4NLBA 2ITMA 3FLCO 4BR2A 2NRZA 5JVHL 3ZYYX 4CZEA 4DCHA 4LC9B 3Q7CA 3JXUA 2GUPA 2A42A 2PFUA 5E26A 5ELZA 5M1FA 1ATSA 2Q1NA 3CQXA 3EL2A 4CBXA 1NM1A 4MDAA 2WBNA 1QZ6A 4H0OA 2OTJN 1TUYA 3HBTA 1JCGA 2QWQA 4KH4A 4H5TA 4FOIA 2A40A 4WFAL 4M63C 2GEMA 5FPMA 2F7TA 4B1YB 3IUCA 1O13A 3R1XA 4BRQA 5LY3A 3VEXA 1VQLN 1YVNA 3HOSA 4J8FA 5MLCQ 3JS6A 2FLOA 5CR4A 2NRXA 4JKFA 3TPQA 1U2VB 5AQIA 3W3DA 3U9DA 4U7BA 2HBJA 3CCMN 2HBMA 4EAHD 3VTIA 1RDUA 2P9NB 2VWBA 3P38A 5AQYA 3D2FA 2IVOA 1BG3A 1KAYA 1N8RO 1M1KO 2GWJA 2JWLA 4HTLA 4MLHA 3BEXA 5I9EB 1VQNN 1GLFO 3G6EN 3IMXA 3KK7A 3QFPA 2QWOA 3FZHA 3R3LA 3TTDA 3GBTA 5BPLA 3E9PA 3G71N 3CPWM 3VMFB 4JKEA 3CPEA 5C2DA 2ZF5O 3UKRA 3VOVA 1EO1A 2VGNA 3EO3A 3F2KA 3RVCA 2QTDA 4IOAL 1Q81O 3ZETB 3C6HA 4JK9A 2HF4A 5FPDA 1NGFA 2V7YA 5KQDA 1C0FA 4FOEA 4BC3A 2QXLA 4JHDA 4H0YB 1HKBA 3U4LA 3WXJA 4WFNL 2ZJQL 1Y64A 1NGJA 5EY4A 2QWPA 1QZ5A 4WFBL 1ATNA 2NRHA 2P9UB 3TTFA 3N4PA 3WT0A 3DLLL 3R6MA 3VF4A 1YIJN 2HBLA 3QDKA 2ZJPL 3PIOL 4GV3A 2Q97A 3MN9A 5M1QA 3A5LC 4JN4A 3L6QA 2Q36A 1MDUB 5AQZA 1TYQB 4MO5A 5GIPA 4JD2B 1X3NA 3T69A 1JCFA 2A41A 5AZIB 1MWKA 4IEEA 4WYBA 3BUZB 3MK6A 2ZGZA 3CC4N 4M7YA 4I6MA 4CBWA 3I56N 3SK3A 4BRKA 3G4SN 5BRHA 2QW9A 4GNIA 1EQYA 1YUWA 3DJCA 3H3OB 3LDQA 4IOXA 5TKWA 2ZJRL 1NGDA 3LDNA 1GLBG 2HSTA 1Q86O 4Z94A 1VQKN 3VTHA 1NLVA 5GAGP 1YITN 4H5WA 2QEXN 1QQOA 3CCSN 5TKYA 3FR0A 3I8BA 3CCEN 3LM2A 5BR9A 3CD6N 4GV6A 2QI2A 5H1SQ 3QMLA 1G99A 1YAGA 3HTVA 5AQGA 1BOTO 3C7NB 3KHYA 3I33A 3CCLN 5AQNA 1IG8A 2YI1A 1YHQN 3FGUA 1E4GT 3L4IA 3QBXA 2FF6A 2P9LB 3O4WA 3W0LA 1S72N 3CJAA 3M1FA 1U2VA 4BR7A 3O9SA 1OKJA 1YXQA 2GX9A 3B8AX 1HX1A 2JWKA 1GLCG 4PL8A 4PKIA 4G9ZA 2HMPA 2P9NA 2W40A 4O5FA 4A59A 3CMEN 1X3MA 3ID6A 3MWPA 3CETA 1JCEA 3NVKA 2QWRA 2W41A 1ATRA 4JAXA 5BN8A 4JKCA 4FWRA 3WEEB 3GL1A 3CJBA 4FWPA 3CCQN 4K43A 4R79A 5GAEP 3CQYA 3UE5A 4PL7A 1BWFO 2WFBA 3DWLA 3SMSA 4B1ZA 4BRCA 5DM6L 1VQON 1RDWX 1Q7YO 4EFHA 4ISEA 2NRTA 3A5OC 3F5TA 3ZETA 2VGMA 2ZWHA 3DAWA 3LDPA 1YJ9N 2KHOA 2PAVA 4BQLA 5AQUA 3MN5A 3VERA 5DM7L 2A6AA 2P9UA 4FWMA 4A57A 2NRWA 3S41A 5KPRA 3I55N 4QS9A 1NBWA 2AP1A 2KLAA 2NRRA 3H1QA 1QVFM 3D2EA 4YOYA 4WQ4A 4GVEA 4XH1A 4B1VA 2ASMA 2DPNA 1TYQA 5AQOA 5KPZA 3VF2A 3L4QA 3FZMA 4CI6A 4FWKA 2I7PA 4B1XB 4BRNA 3P31A 2OTLN 4C23A 4JKBA 1ZBSA 2D4WA 3ULEB 4RWTA 5GINA 3VEYA 2BH1A 3C6AA 3EKUA 1BO5O 3HOTA 2Q2RA 3PIPL 3LL3A 2D1KA 2P9KB 4CZJA 3TSUA 2BUPA 3E9LA 3CC7N 4YOVA 3FFKB 1QVGM 5B8HA 3K9JA 3AGRA 4NO7A 3O9TA 3O5BA 3O8MA 1GLEG 3FZKA 1VQ4N 3GG4A 1NGEA 1P8ZA 3OA9A 4KBOA 1MWMA 1H1VA 3H1VX 2P9IB 3WQTA 4BRFA 2YHYA 4BRGA 4NB4A 3MCAB 4OPAA 3KWIA 3CHWA 4FWQA 4ISFA 2WC9A 2A3ZA 3C7NA 3RSEB 2ASPA 5GADP 3C65A 4FVUA 1BDGA 3ATUA 4JKHA 1QQNA 4U67L 3SAHA 4CZMA 2P9LA 2Q0RA 1HKCA 4BC5A 2E8AA 1D4XA 4YOTA 3VEOA 1RFQA 3UKUB 4BGAA 5GAHP 2P9SB 3WXMB 5BREA 4BR9A 4MDBA 5EXWA 2VYPA 3E66A 2E2QA 2Q31A 1T3VA 1GLDG 3AGKA 1ZXOA 3MDQA 1NGCA 4XEIA 4BROA 4FWOA 1RGIA 4XH4A 1LOTB 3PLAA 2BTFA 3N4QA 1VAZA 4BY9C 3WEEA 1W97L 5M1NA 4IO9L 3E1YA 3H3NO 4CZLA 1ESVA 1GLAG 2CH6A 2NNWA 5AQQA 2A5XA 4FWNA 3L0QA 4K42A 4A62A 4DB3A 1BU6O 4ILGB 3J8AA 1K9MO 2F9TA 3EKSA 4IEIA 1KXPA 5ADXA 3O1BA 1HJOA 1SS6A 4JKGB 2E20A 4JNEA 4Y0WA 2NLXA 3VEVA 3CIPA 3CJ9A 3DXKB 4O8UA 4BR5A 3U8XA 3ID8A 3HSCA 3IFRA 3KZBA 2V7ZA 4M7XA 4NLCA 4A5BA 1XC3A 2NZTA 3HI0A 3MN7A 5JLHA 4BVPA 3DXMB 5C12A 4ISGA 3A5MC 5CHIA 1T6DA 3CCVN 3GDQA 5FPEA 3KWGA 5HOOA 4GY2B 3SJHA 3MCPA 3O1WA 1U6ZA 2I7NA 3ULEA 3D7EO 3LDOA 4H5NA 3AY9A 3R9PA 5BRDA 1YJNN 3ZEUB 3VGMA 4MO4A 1DT9A 1NWKA 4A5AA 4BRLA 2P9KA 4KH6A 2CH5A 3AAQA 2QA4N 1VQ6N 4H0XB 3O9UA 3UKRB 4BVOA 3GOIA 2UYTA 3K9KA 4PHTX 5KPTA 4YOXA 4C1NK 5AQKA 5JLFA 1KQSM 4WQ4C 1T6CA 3BP8A 3HRGA 3TU5A 4B1UB 5C0YA 2Q0UA 3CCJN 5AQLA 3WXKA 4BR0A 4PKHA 4BQZA 5HL7L 1ZC6A 3MX2A 2YCHA 1SQKA 3MN6A 4BC2A 4CD3A 4UY8O 4RCHA 1SAZA 4EHTA 4B1WB 5BPNA 2FF3B 4AM7A 4A2AA 4AM6A 1JJ2M 5C15A 3VESA 3ZX3A 4DHYA 4YDUC 3QB0A 3WQUA 4H5RA 3UKUA 4KH5A 2GWKA 3ENBA 2P9SA 4JKAA 3LDLA 1VQ9N 5LJVA 5AQSA 2V51B 4BRMA 5F1XA 5AQWA 5AQFA 2IVNA 3O9QA 4BRIA 4CZIA 3ENOA 3EZWA 4JD2A 4RTFD 3P4IA 3QBWA 4OPHA 4A2BA 4C1NI 4CBUA 5AZIA 1OVYA 4H03B 4A61A 2E88A 1Q82O 1VQPN 2CGKA 2KKZA 2P9PB 1BA0A 5M1OA 4B9QA 3O9RA 4BRAA 3M5RA 4IJAA 1NGGA 3O6WA 5F2RA 4QS8A 4IOCL 4YDUA 5JMVA 3UB5A 2J4RA 4CZGA 1DKGD 1NGHA 1S22A 3EN9A 4JKGA 5AQJA 3CC2N 3DXKA 1V4TA 4GV9A 2YJEA 1TUUA 2FSKA 1KAXA 1KC8O 1VQ7N 2VCPA 3M3ZA 5AQXA 3SBTA 5GIOA 3QFUA 4H0PA 4BG9A 3QICA 1V4SA 4DKWA 1W2BM 2F9WA 3IDHA 1K8AO 3E9OA 3DXMA 3EE9A 1GLJO 4F9OA 4YOWA 4XH5A 3NVMA 1NMDA 3VEZA 3FE1A 4BRPA 4WQ5A 3VENA 3ATVA 1NJIO 2CGJA 1VQMN 1J6ZA 1WUAA 1XUPO 3P39A 4JK7A 4IJNA 5FPNA 5EX5A 4CZKA 5AQPA 3SBGA 1NGBA 3OBYA 4JKDA 4FPBA 2HF3A 3ZX2A 4K25A 4IZ9A 2QWLA 4FL9A 2IVPA 3ZX0A 3Q7BA 3O08A 2OANA 3ZEUA 4EHUA 1R59O 3A0IX 3SMPA 2D0PA 2E1YA 2QWNA 5AQHA 3NMUA 4IO8A 4FSVA 3CI5A 1Z6RA 4FPAA 1K73O 2V52B 5AQVA 2CGLA 3WUHA 4YORA 1YJWN 1WOQA 2ASOA 1K8KB 5AZJB 4BREA 4BC4A 1SZ2A 4BG8A 4FWLA 4PKGA 4DQ8A 3R8EA 1HKGA 2HOEA 4ILJA 5M1PA 3VF6A 3WXIA 5CE3A 3SAGA 1M90O 4E1JA 1KD1O 1IJJA 5ADXH 3CF5L 3TSPA 3ENHA 1BA1A 1HLUA 3A8YA 5C2FA 5AQTA 2PBDA 3D2EB 4BRHA 4BRDA 4O8KA 1E4FT 3MWTA 1MA9B 5LJWA 2YHXA 4HWIA 4OO1J 4H0TB 4AF1A 3TSQA 2YX6A 1YI2N 2D0OA 3CCRN 3CJ7A 1HPMA 5F0XA 3BF3A 3VGKA 2YJFA 5JVGL 4BR4A 3FZFA 1GLLO 2FSJA 5M1KA 4FO0A 1VQ5N 3C0BA 2RHKA 3A5NC 3OBWA 3LM9A 1HUXA 5AFUH 3D6RA 2RE2A 2H3GX 4WCEL 1ILYA 1KAZA 2P9PA 5AFUA 2HBKA 2EWSA 5BRFA 5JICA 2E2NA 3D2FB 1P90A 4BGBA 3M6GA 3HZ6A 3CCUN 2E2OA 4JEPA 3AARA 2NRVA 3H45C 4IXCA 4WF9L 3KVGA 4EIAA 2QM1A 2YHWA 2GTDA 3H46O 3EE8A 4CD1A 3G25A 2AA4A 5BPMA 1YF5L 2FSNA 3T7ZA 1XQSC 1NGIA 5AQRA 4L3QA 1Q18A 4CJ7A 5C10A 4JK8A 4FWSA 4ILHA 5BN9A 3VPZA 3CERA 2E2PA 3F9MA 4CZFA 4IWVA 3OHRA 3VEWA 4JHDB 3VGLA 2P9IA 1DGKN 4CZHA 5EVZA 3MX5A 4H0VB 1BUPA 5KQ8A 3IKMA 3MMVA 3RSEA 4QS7A 2IIRA 2WUSA 3CJCA 1DEJA 4IFEA 1CZAN 3CJ1A 5AR0A 3WXLA 2E1ZA 5EOYA 3GE1A 4K41A 1QQMA 1T44A 3OW2M 1Z05A 3H6EA 3CMAN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E84 A;  1C0G A;  5AQM A;  3U9Z A;  4I6M B;  1LCU A;  3SLC A;  3AAP A;  2ZGY A;  1NGA A;  1QHA A;  3FZL A;  1K8K A;  3BF1 A;  3VET A;  5AZJ A;  3HM8 A;  1S3X A;  4WQ5 C;  2FXU A;  4H5V A;  2GEL A;  3O80 A;  2QWM A;  1X9J A;  4MLE A;  4BR2 A;  2ITM A;  3FLC O;  4CZE A;  4DCH A;  4LC9 B;  3JXU A;  2GUP A;  2A42 A;  5ELZ A;  5E26 A;  1ATS A;  2Q1N A;  3CQX A;  3EL2 A;  4CBX A;  1NM1 A;  1QZ6 A;  4H0O A;  1TUY A;  3HBT A;  1JCG A;  2QWQ A;  4H5T A;  4FOI A;  2A40 A;  4M63 C;  2GEM A;  5FPM A;  4B1Y B;  3IUC A;  5LY3 A;  4BRQ A;  3VEX A;  1YVN A;  4J8F A;  3JS6 A;  2FLO A;  3TPQ A;  1U2V B;  5AQI A;  3W3D A;  3U9D A;  4EAH D;  2P9N B;  2VWB A;  5AQY A;  3D2F A;  2IVO A;  1BG3 A;  1KAY A;  2GWJ A;  4HTL A;  4MLH A;  3BEX A;  5I9E B;  1GLF O;  3IMX A;  3QFP A;  2QWO A;  3FZH A;  5BPL A;  3GBT A;  2ZF5 O;  3UKR A;  3VOV A;  3EO3 A;  3ZET B;  2HF4 A;  5FPD A;  1NGF A;  2V7Y A;  5KQD A;  1C0F A;  4FOE A;  4BC3 A;  2QXL A;  4JHD A;  4H0Y B;  1HKB A;  3U4L A;  3WXJ A;  1Y64 A;  1NGJ A;  5EY4 A;  2QWP A;  1QZ5 A;  1ATN A;  2NRH A;  2P9U B;  3WT0 A;  3R6M A;  3VF4 A;  3QDK A;  2Q97 A;  3MN9 A;  3A5L C;  4JN4 A;  3L6Q A;  2Q36 A;  1MDU B;  5AQZ A;  1TYQ B;  4MO5 A;  4JD2 B;  1X3N A;  1JCF A;  2A41 A;  5AZI B;  1MWK A;  4WYB A;  3BUZ B;  3MK6 A;  2ZGZ A;  4M7Y A;  4I6M A;  4CBW A;  3SK3 A;  4BRK A;  5BRH A;  2QW9 A;  4GNI A;  1EQY A;  1YUW A;  3DJC A;  3H3O B;  3LDQ A;  1NGD A;  3LDN A;  1GLB G;  4Z94 A;  1NLV A;  4H5W A;  1QQO A;  5TKY A;  3FR0 A;  3I8B A;  3LM2 A;  5BR9 A;  3QML A;  1G99 A;  1YAG A;  3HTV A;  5AQG A;  1BOT O;  3C7N B;  3KHY A;  3I33 A;  5AQN A;  1IG8 A;  2YI1 A;  3FGU A;  1E4G T;  3L4I A;  3QBX A;  2FF6 A;  2P9L B;  3O4W A;  3W0L A;  3CJA A;  3M1F A;  1U2V A;  4BR7 A;  1OKJ A;  1YXQ A;  3B8A X;  1HX1 A;  1GLC G;  4PL8 A;  4PKI A;  2HMP A;  2P9N A;  2W40 A;  4O5F A;  1X3M A;  3CET A;  1JCE A;  2QWR A;  2W41 A;  1ATR A;  4JAX A;  5BN8 A;  4FWR A;  3WEE B;  3GL1 A;  3CJB A;  4FWP A;  4K43 A;  3CQY A;  3UE5 A;  4PL7 A;  1BWF O;  3SMS A;  3DWL A;  4B1Z A;  4BRC A;  1RDW X;  4EFH A;  4ISE A;  3A5O C;  3ZET A;  2ZWH A;  3LDP A;  3DAW A;  2KHO A;  2PAV A;  4BQL A;  5AQU A;  3MN5 A;  3VER A;  2A6A A;  2P9U A;  4FWM A;  3S41 A;  5KPR A;  4QS9 A;  1NBW A;  2AP1 A;  3H1Q A;  3D2E A;  4WQ4 A;  4XH1 A;  4B1V A;  2ASM A;  2DPN A;  1TYQ A;  5AQO A;  5KPZ A;  3VF2 A;  3FZM A;  4CI6 A;  4FWK A;  2I7P A;  4B1X B;  4BRN A;  4C23 A;  1ZBS A;  2D4W A;  3ULE B;  4RWT A;  3VEY A;  3EKU A;  1BO5 O;  2Q2R A;  3LL3 A;  2D1K A;  2P9K B;  4CZJ A;  2BUP A;  3FFK B;  5B8H A;  4NO7 A;  3O5B A;  3O8M A;  1GLE G;  3FZK A;  3GG4 A;  1NGE A;  1P8Z A;  4KBO A;  1MWM A;  1H1V A;  3H1V X;  2P9I B;  3WQT A;  4BRF A;  2YHY A;  4BRG A;  4NB4 A;  4FWQ A;  3CHW A;  4ISF A;  2A3Z A;  3C7N A;  3RSE B;  2ASP A;  1BDG A;  3ATU A;  1QQN A;  4CZM A;  2P9L A;  2Q0R A;  1HKC A;  4BC5 A;  2E8A A;  1D4X A;  3VEO A;  1RFQ A;  3UKU B;  4BGA A;  2P9S B;  5BRE A;  4BR9 A;  5EXW A;  2VYP A;  2E2Q A;  2Q31 A;  1GLD G;  1ZXO A;  3MDQ A;  1NGC A;  4XEI A;  4BRO A;  4FWO A;  1RGI A;  4XH4 A;  1LOT B;  2BTF A;  3WEE A;  3H3N O;  4CZL A;  1ESV A;  1GLA G;  2CH6 A;  5AQQ A;  2A5X A;  4FWN A;  3L0Q A;  4K42 A;  4A62 A;  4DB3 A;  1BU6 O;  3J8A A;  2F9T A;  3EKS A;  1KXP A;  5ADX A;  3O1B A;  1HJO A;  4JNE A;  2E20 A;  4Y0W A;  3VEV A;  2NLX A;  3CIP A;  3CJ9 A;  3DXK B;  4BR5 A;  3U8X A;  3ID8 A;  3HSC A;  3IFR A;  3KZB A;  2V7Z A;  4M7X A;  1XC3 A;  2NZT A;  3HI0 A;  3MN7 A;  5JLH A;  4BVP A;  3DXM B;  4ISG A;  3A5M C;  1T6D A;  3GDQ A;  5FPE A;  4GY2 B;  3SJH A;  3MCP A;  3O1W A;  1U6Z A;  2I7N A;  3ULE A;  3D7E O;  3LDO A;  4H5N A;  3AY9 A;  3R9P A;  5BRD A;  3ZEU B;  3VGM A;  4MO4 A;  1NWK A;  4BRL A;  2P9K A;  2CH5 A;  3AAQ A;  4H0X B;  3UKR B;  4BVO A;  3GOI A;  2UYT A;  5KPT A;  5AQK A;  5JLF A;  4WQ4 C;  1T6C A;  3BP8 A;  3TU5 A;  4B1U B;  2Q0U A;  5AQL A;  3WXK A;  4BR0 A;  4PKH A;  4BQZ A;  1ZC6 A;  2YCH A;  1SQK A;  3MN6 A;  4BC2 A;  4CD3 A;  4RCH A;  1SAZ A;  4EHT A;  4B1W B;  5BPN A;  2FF3 B;  4AM7 A;  4A2A A;  4AM6 A;  3VES A;  3ZX3 A;  4DHY A;  4YDU C;  3QB0 A;  3WQU A;  4H5R A;  3UKU A;  2GWK A;  2P9S A;  3LDL A;  5LJV A;  5AQS A;  2V51 B;  4BRM A;  5F1X A;  5AQW A;  5AQF A;  2IVN A;  4BRI A;  4CZI A;  3ENO A;  3EZW A;  4JD2 A;  4RTF D;  3P4I A;  3QBW A;  4A2B A;  4CBU A;  5AZI A;  4H03 B;  4A61 A;  2E88 A;  2CGK A;  2P9P B;  1BA0 A;  4B9Q A;  4BRA A;  4IJA A;  1NGG A;  3O6W A;  5F2R A;  4QS8 A;  4YDU A;  5JMV A;  3UB5 A;  2J4R A;  4CZG A;  1DKG D;  1NGH A;  1S22 A;  3EN9 A;  5AQJ A;  3DXK A;  1V4T A;  2YJE A;  1TUU A;  2FSK A;  1KAX A;  2VCP A;  3M3Z A;  5AQX A;  3QFU A;  4H0P A;  4BG9 A;  3QIC A;  1V4S A;  2F9W A;  3IDH A;  3DXM A;  1GLJ O;  4F9O A;  4XH5 A;  1NMD A;  3VEZ A;  3FE1 A;  4BRP A;  4WQ5 A;  3VEN A;  3ATV A;  2CGJ A;  1J6Z A;  1WUA A;  1XUP O;  5FPN A;  4IJN A;  4CZK A;  5EX5 A;  5AQP A;  1NGB A;  4FPB A;  2HF3 A;  3ZX2 A;  4K25 A;  4IZ9 A;  2QWL A;  4FL9 A;  2IVP A;  3ZX0 A;  3O08 A;  2OAN A;  3ZEU A;  4EHU A;  1R59 O;  3A0I X;  3SMP A;  2D0P A;  2E1Y A;  2QWN A;  5AQH A;  4IO8 A;  4FSV A;  3CI5 A;  1Z6R A;  4FPA A;  2V52 B;  5AQV A;  2CGL A;  3WUH A;  1WOQ A;  2ASO A;  1K8K B;  5AZJ B;  4BRE A;  4BC4 A;  1SZ2 A;  4BG8 A;  4FWL A;  4PKG A;  4DQ8 A;  3R8E A;  1HKG A;  2HOE A;  3WXI A;  3VF6 A;  5CE3 A;  4E1J A;  1IJJ A;  5ADX H;  3ENH A;  1BA1 A;  1HLU A;  3A8Y A;  5AQT A;  2PBD A;  3D2E B;  4BRH A;  4BRD A;  4O8K A;  1E4F T;  1MA9 B;  5LJW A;  2YHX A;  4HWI A;  4H0T B;  2D0O A;  3CJ7 A;  1HPM A;  5F0X A;  3BF3 A;  3VGK A;  2YJF A;  4BR4 A;  3FZF A;  1GLL O;  2FSJ A;  4FO0 A;  3C0B A;  3A5N C;  3LM9 A;  1HUX A;  5AFU H;  2H3G X;  1KAZ A;  2P9P A;  5AFU A;  2EWS A;  5BRF A;  5JIC A;  2E2N A;  3D2F B;  4BGB A;  3M6G A;  3HZ6 A;  2E2O A;  3AAR A;  3H45 C;  4IXC A;  3KVG A;  4EIA A;  2QM1 A;  2YHW A;  2GTD A;  3H46 O;  4CD1 A;  3G25 A;  2AA4 A;  5BPM A;  2FSN A;  4CJ7 A;  1XQS C;  1NGI A;  5AQR A;  4L3Q A;  1Q18 A;  4FWS A;  5BN9 A;  3VPZ A;  3CER A;  2E2P A;  3F9M A;  4CZF A;  4IWV A;  3OHR A;  3VEW A;  4JHD B;  3VGL A;  2P9I A;  1DGK N;  4CZH A;  5EVZ A;  4H0V B;  1BUP A;  5KQ8 A;  3MMV A;  3RSE A;  4QS7 A;  2IIR A;  2WUS A;  3CJC A;  1DEJ A;  1CZA N;  3CJ1 A;  5AR0 A;  3WXL A;  2E1Z A;  5EOY A;  3GE1 A;  4K41 A;  1QQM A;  1T44 A;  1Z05 A;  3H6E A; 
#chains in the Genus database with same CATH topology
 3QNN A;  3V9S A;  3KK2 A;  4CJT A;  1LCU A;  2FC0 A;  4FJX A;  2O8F B;  4M3X A;  2ZGY A;  3QER A;  3DLG A;  4CED A;  3AV9 A;  3BF1 A;  4BE1 A;  4CF2 A;  2GEL A;  3O80 A;  2XHB A;  3AVA A;  4DR3 K;  1VQ8 N;  4MLE A;  4IDH A;  4RW7 A;  4LC9 B;  4GMJ B;  5M1F A;  1EWQ A;  3CQX A;  3EL2 A;  4CIE A;  3OY9 A;  1VRT A;  1JCG A;  4DV7 K;  1IKY A;  1TKT A;  3CG7 A;  4FOI A;  4WFA L;  1RBS A;  2DFE A;  4M63 C;  2F7T A;  3ZLJ A;  3NF9 A;  1U04 A;  4BRQ A;  2HVH A;  4NYN A;  2ITG A;  3JS6 A;  1L3V A;  2IDO A;  4B3S K;  3W3D A;  2HBJ A;  3CCM N;  3I0R A;  2FBV A;  4DTS A;  4Z4C A;  1SV5 A;  3ZSY A;  3P38 A;  1ASU A;  4C8K A;  3D2F A;  1HPZ A;  2ZE2 A;  2JWL A;  4MLH A;  4DLE A;  1OH8 A;  4DU3 A;  3QFP A;  4CK2 A;  2QWO A;  4FCY A;  2IS3 A;  1SKS A;  1JLB A;  4BWM A;  3RMA A;  3RVC A;  4IOA L;  3OYM A;  1Q81 O;  5I42 A;  3AA2 A;  2V7Y A;  4FOE A;  3VQ4 A;  4JHD A;  3U4L A;  3AVJ A;  5EY4 A;  2HHH K;  4LSN A;  1TAQ A;  2NRH A;  3TTF A;  3N4P A;  1YIJ N;  2ZJP L;  4M3W A;  5D3G A;  4B9T A;  4JN4 A;  3L6Q A;  2VQE K;  1MDU B;  1TYQ B;  2KFZ A;  1X3N A;  4B9S A;  2A41 A;  1MWK A;  4IEE A;  4KFB A;  4M7Y A;  4CBW A;  3O4Q A;  2O8F A;  1EX4 A;  2HNY A;  4DLG A;  5BRH A;  2QW9 A;  4GNI A;  3H3O B;  4I2P A;  4IOX A;  4FLX A;  1BIZ A;  3ZSQ A;  4DTM A;  5CZ1 A;  4CJW A;  2HST A;  1EP4 A;  1NLV A;  1RBR A;  5GAG P;  1WN7 A;  4E7L A;  3CCS N;  4KO0 A;  5BR9 A;  2QI2 A;  4HUG A;  3MXI A;  1WSE A;  4CIG A;  3I33 A;  4R5P A;  1IG8 A;  2Y1J A;  1YHQ N;  4B3O A;  3QEW A;  3FGU A;  3L4I A;  5SZT A;  3VQP A;  2P9L B;  1S72 N;  2UXB K;  3M1F A;  3L2Q A;  4JV5 K;  4BR7 A;  1OKJ A;  3B8A X;  2JWK A;  4PL8 A;  4PKI A;  4G9Z A;  2HMP A;  4AH9 A;  5SWM A;  4KB0 A;  2W40 A;  1HQU A;  4O5F A;  3CME N;  3OYD A;  3MWP A;  3QLH A;  1RT3 A;  2QWR A;  4LSL A;  4JAX A;  4JKC A;  4FWR A;  4CJQ A;  5GAE P;  3HPO A;  3SMS A;  4B1Z A;  1RDW X;  3HL8 A;  4CHO A;  1XMO K;  2VGM A;  3DAW A;  1XNQ K;  4W5N A;  2PAV A;  5AQU A;  3L2W A;  1NKC A;  4JYA K;  2NRR A;  2AP1 A;  3H1Q A;  2W6L A;  4O0J A;  1TYQ A;  4DS4 A;  4FLV A;  3E01 A;  3VF2 A;  3DOL A;  4DV6 K;  3FZM A;  4CI6 A;  5BR8 K;  4FWK A;  2I7P A;  2B4J A;  4C23 A;  4X64 K;  3S9H A;  1DTQ A;  2D4W A;  3ULE B;  1IV0 A;  2BH1 A;  3EKU A;  3HOT A;  3ZT1 A;  1S1X A;  4QOZ B;  4CZJ A;  3FFK B;  3LAK A;  3JYT A;  4J2B A;  3SNN A;  1LWE A;  1RBT A;  3GG4 A;  3OA9 A;  3K58 A;  4KBO A;  4B8A B;  1MWM A;  1TKX A;  2P9I B;  3WQT A;  4BRF A;  4CGJ A;  2O8E A;  3CHW A;  1D8Y A;  4ISF A;  1D5A A;  5EU7 A;  4LF9 K;  4CEB A;  3SJJ A;  3C65 A;  1A5X A;  3H08 A;  1BDG A;  3ATU A;  3PSF A;  3VQ5 A;  2P9L A;  1N34 K;  3ZT4 A;  4KTQ A;  4RW9 A;  1D4X A;  3VEO A;  3L2U A;  5GAH P;  3WXM B;  5BRE A;  1U4B A;  4MDB A;  2X74 A;  3E66 A;  2E2Q A;  1C0M A;  1NGC A;  4XEI A;  1WSH A;  4XH4 A;  2BTF A;  4I9Q A;  1XHZ A;  1W97 L;  1U47 A;  3TAF A;  4IO9 L;  3E1Y A;  4CZL A;  4KAZ A;  3SQ4 A;  4K42 A;  3CFO A;  2O8C B;  2F9T A;  3EKS A;  4YFU A;  3VQA A;  1OH6 A;  4JI3 K;  4JKG B;  4Y0W A;  2NLX A;  3ZCM A;  3DXK B;  4O8U A;  1UA1 A;  3RMB A;  2VG6 A;  1JLG A;  1JXB A;  2RF2 A;  1R0A A;  1VSK A;  2NZT A;  3IAY A;  3HI0 A;  2UUC K;  5JLH A;  4B8C A;  3DXM B;  5C12 A;  4ISG A;  1GOB A;  2I5J A;  4CJ3 A;  4KHP K;  3GDQ A;  5FPE A;  1RTJ A;  4M3U A;  3J7Y P;  3BZK A;  5DK5 A;  4CFA A;  3KWG A;  3SJH A;  3MCP A;  4FLU A;  3SUP A;  1OH7 A;  3TAN A;  3ULE A;  4B3T K;  3LDO A;  2ATQ A;  1JLA A;  3ZEU B;  4W5Q A;  1DT9 A;  3AA4 A;  3NCI A;  4CK1 A;  4OVL A;  1JLF A;  3TAP A;  1J5E K;  2W42 A;  2UXC K;  4H0X B;  3UKR B;  3NF7 A;  3HRG A;  5C0Y A;  3CCJ N;  4BE0 A;  2HHS A;  1HNV A;  2D5R A;  5KI6 A;  4Y1C A;  4ZHR A;  2YCH A;  3MN6 A;  4CJV A;  1CXU A;  1T03 A;  1SAZ A;  4EHT A;  5BPN A;  1JJ2 M;  2HW3 A;  4JI4 K;  2HHV A;  2GWK A;  3CFP A;  4OKK A;  3LWL A;  1VQ9 N;  3ZSO A;  4BRM A;  2UU9 K;  5HRN A;  5FRN A;  1LWC A;  5KRT A;  4RTF D;  4A2B A;  2JGU A;  1WBB A;  5AZI A;  2E88 A;  2KKZ A;  2FBT A;  1TAU A;  1BA0 A;  5FDL A;  5M1O A;  3M5R A;  3O6W A;  3T1Y K;  4IOC L;  3LZI A;  1S22 A;  1FKO A;  4JKG A;  3CC2 N;  1Y97 A;  3DXK A;  2YJE A;  3OVN A;  5JS2 A;  2VCP A;  1I39 A;  3QFU A;  3T3F A;  1ASW A;  3KK3 A;  3IDH A;  1K8A O;  3E9O A;  3DXM A;  2O4I A;  3EE9 A;  3DOK A;  4DF4 A;  4XH5 A;  4RW4 A;  1S9G A;  1HNX K;  2G8H A;  4LFB K;  1Z25 A;  4DTP A;  3BDP A;  1VQM N;  1J6Z A;  1G15 A;  3P39 A;  4JI2 K;  1XUP O;  4I2Q A;  4JK7 A;  4CGF A;  3D0P A;  1NGB A;  4FVM A;  4CHZ A;  3THX B;  4K25 A;  4FL9 A;  3OTO K;  1BIS A;  2OAN A;  3ZEU A;  3AVH A;  2D0P A;  3NMU A;  4HCB A;  5C25 A;  1K73 O;  1WLJ A;  3WUH A;  4YOR A;  1XMQ K;  4KTW A;  5AZJ B;  1SZ2 A;  4DTR A;  4DQ8 A;  4J2A A;  4KHS A;  1HKG A;  1KD1 O;  2UXD K;  5HRR A;  3TSP A;  4HHT A;  4CGG A;  3AVK A;  4F3T A;  3D2E B;  4LD0 A;  4BRD A;  3U3Y A;  5LJW A;  4BDZ A;  4GKJ K;  3V6D A;  4RW8 A;  1ZBL A;  2HB5 A;  3LPU A;  3QO9 A;  2YX6 A;  1YI2 N;  3MED A;  3CCR N;  3CJ7 A;  3HVR A;  4FJI A;  5JVG L;  4N41 A;  1TL3 A;  1F21 A;  4FO0 A;  1HNW K;  1ILY A;  3PV8 A;  2EWS A;  2E2N A;  4JEP A;  1NK4 A;  3M8R A;  4WF9 L;  3MXM A;  4EIA A;  2GTD A;  5LMU K;  3KD1 E;  3VQC A;  2FSN A;  4CJ7 A;  3QES A;  3DLB A;  3MX5 A;  5KQ8 A;  3DM2 A;  2R7Y A;  2GUI A;  2XO7 A;  2Z1H A;  4CFC A;  3WXL A;  4DR6 K;  4K41 A;  3THX A;  1QQM A;  4KKO A;  1Z05 A;  1NNE A;  2D0C A;  1UOC A;  5AQM A;  4AHV A;  3ITH A;  4ZTJ A;  1HQE A;  3NGI A;  3AAP A;  3FZL A;  3SAF A;  5AZJ A;  3J7Z O;  2FXU A;  4JI1 K;  3SV3 A;  4DQI A;  1X9J A;  4BR2 A;  4NLB A;  2NRZ A;  4DCH A;  1S1W A;  1X9S A;  3SPZ A;  1ATS A;  4JI6 K;  4CBX A;  4FJN A;  1KFD A;  2WBN A;  4H0O A;  3AVM A;  1VSM A;  4H5T A;  3O3H A;  3DLE A;  3AO4 A;  4CHQ A;  3IUC A;  4E7I A;  1IKX A;  1YVN A;  1U2V B;  2BDP A;  3J7A P;  5AQI A;  3NDK A;  3RMD A;  2VWB A;  5AQY A;  3OYA A;  1BG3 A;  3OYL A;  4HTL A;  3BEX A;  3G6E N;  3KK7 A;  3TTD A;  3GBT A;  3CPW M;  3E9P A;  4FM2 A;  3VMF B;  1FW6 A;  3BZC A;  5C2D A;  2ZF5 O;  4E1N A;  2VGN A;  4O5B A;  1K6Y A;  2XY7 A;  1SKR A;  1KVC A;  5KQD A;  4BC3 A;  3WXJ A;  3AO1 A;  4WFN L;  3VA3 A;  1Y64 A;  2ZM6 K;  4CHN A;  1VRU A;  3TR8 A;  3OYC A;  4WFB L;  4DV4 K;  3WT0 A;  3DLL L;  3KLE A;  4DV5 K;  4CGH A;  4JRP A;  4NYF A;  3PIO L;  3MN9 A;  3A5L C;  2WON A;  5GIP A;  4MO5 A;  1NK5 A;  3NFA A;  3T69 A;  4WYB A;  4FK0 A;  3CC4 N;  1L3S A;  3I56 N;  1QS4 A;  3SK3 A;  4BDY A;  4BRK A;  5HRS A;  2G8F A;  3G4S N;  1EQY A;  1YUW A;  3DJC A;  5TKW A;  1NGD A;  3HM9 A;  1HYZ A;  3LDN A;  4YHH K;  4OX9 K;  4CJS A;  4Z94 A;  3VTH A;  4M41 A;  3KLI A;  1YIT N;  5CYM A;  1KRP A;  3FR0 A;  3CD6 N;  4GV6 A;  3L2R A;  5H1S Q;  3QML A;  1G99 A;  1TKZ A;  4H4O A;  4KHN A;  1BOT O;  3C7N B;  5AQN A;  4UQG A;  2YI1 A;  5CZ2 A;  3F73 A;  4LF4 K;  2FF6 A;  3O4W A;  3CJA A;  2DFF A;  1U2V A;  3O9S A;  2GX9 A;  1HX1 A;  1GLC G;  1DLO A;  2DY4 A;  4A59 A;  1X3M A;  4M3T A;  3CET A;  2W41 A;  1ATR A;  5BN8 A;  3CCQ N;  3WEE B;  3GL1 A;  1UAX A;  4R79 A;  1BWF O;  1JKH A;  4BRC A;  5DM6 L;  1KFS A;  4EFH A;  4ISE A;  1X9W A;  4ELU A;  2NRT A;  3A5O C;  3F5T A;  3AVG A;  4TSX A;  2PZS A;  3LDP A;  3LP1 A;  1YJ9 N;  3VER A;  5DM7 L;  2A6A A;  4B3M K;  3V81 A;  4A57 A;  4FJM A;  3THY B;  4YOY A;  3IS9 A;  4FLT A;  2DPN A;  4CFD A;  3DYA A;  3SQ2 A;  4B1X B;  3P31 A;  4CJ4 A;  2YNH A;  4B9U A;  4RWT A;  5GIN A;  2EHG A;  3ZSX A;  4CCH A;  4CK3 A;  4MQ3 A;  2P9K B;  2BUP A;  3B6O A;  4YOV A;  1QVG M;  5B8H A;  3AGR A;  1HRH A;  3O9T A;  4DQS A;  1GLE G;  3FZK A;  1C0T A;  1P8Z A;  4LH5 A;  4YNQ A;  1S5J A;  4LY7 A;  4NB4 A;  4E3S A;  4O55 A;  3MCA B;  4FWQ A;  3K59 A;  2Z1I A;  2WC9 A;  1VK0 A;  3C7N A;  2ASP A;  5GAD P;  1NJZ A;  3AVL A;  1CZB A;  1QQN A;  4U67 L;  1HKC A;  4BC5 A;  4L8R B;  1J53 A;  2UUB K;  2VWK A;  1EET A;  2P51 A;  2HHW A;  5EXW A;  4B3R K;  4CFB A;  1ZXO A;  1RNH A;  3MDQ A;  5IT9 O;  4BRO A;  1N5Y A;  1QQC A;  1LOT B;  3PLA A;  4FZX C;  1VAZ A;  1XNR K;  3WEE A;  5M1N A;  4FLZ A;  4GKK K;  1GLA G;  2CH6 A;  1FK9 A;  2A5X A;  3KJV A;  3L0Q A;  4RG8 A;  4FJ7 A;  1NOY A;  4DB3 A;  1BU6 O;  1K9M O;  2EX3 A;  3V1O A;  3O1B A;  1WB9 A;  3NH2 A;  4IFY A;  4BR5 A;  3U8X A;  4BDP A;  3IFR A;  4NLC A;  3LDS A;  3V1R A;  3J81 O;  4BVP A;  3THY A;  4DV2 K;  3A5M C;  5CHI A;  1VSI A;  1KSP A;  4CGI A;  3CCV N;  1IKV A;  1U48 A;  3HVT A;  1D9D A;  1N36 K;  4CJK A;  4ICL A;  4DSI A;  3PX4 A;  4DUZ K;  4JS4 A;  5FRO A;  2D0B A;  3MXJ A;  3LP3 A;  4OLA A;  3SUN A;  1TKD A;  1TK0 A;  4DTJ A;  1LW0 A;  4A5A A;  4BRL A;  2P9K A;  4DR7 K;  4KH6 A;  3KIO A;  3QET A;  4Q5V A;  2QA4 N;  1VQ6 N;  1SL2 A;  2UYT A;  4YOX A;  1YVU A;  5JLF A;  4WQ4 C;  4B1U B;  5J2N A;  2E6M A;  4ZTF A;  4PKH A;  4BQZ A;  3AA3 A;  1ZYQ A;  4BC2 A;  4LF5 K;  4CD3 A;  4UY8 O;  1BCM A;  4G1Q A;  4B1W B;  2FF3 B;  4ELT A;  4N5S A;  4NCA A;  4AM7 A;  4A2A A;  3OJU A;  4DHY A;  3QB0 A;  4KH5 A;  1REV A;  3CQ8 A;  1TVR A;  4IBN A;  1WSI A;  5F1X A;  5AQW A;  5AQF A;  3O9Q A;  4BRI A;  4CZI A;  2O8D B;  3EZW A;  4FZZ A;  1C1C A;  1OVY A;  4H03 B;  3V9W A;  2ETJ A;  1VQP N;  2CGK A;  2OPP A;  2P9P B;  1RDB A;  3TAE A;  4DTO A;  5F2R A;  4QS8 A;  4YDU A;  5JMV A;  3K5N A;  4CF8 A;  2Y1I A;  2XY8 A;  3THV A;  5AQJ A;  4GV9 A;  1V4T A;  2FSK A;  3AVC A;  4EZ9 A;  1GOA A;  1B92 A;  4FM0 A;  3QIC A;  1W2B M;  4CES A;  1N6Q A;  3SUQ A;  1GLJ O;  4F9O A;  2KQ2 A;  3VEZ A;  4BRP A;  3VEN A;  3ATV A;  2CGJ A;  4AQY K;  1WUA A;  2F4V K;  4IJN A;  4CZK A;  1QSL A;  5AQP A;  4DQP A;  3SYZ A;  1EXQ A;  3I0S A;  3MEG A;  4QAG A;  4JKD A;  1RBU A;  4K0K K;  4DSJ A;  4FYD A;  4DR2 K;  4OKJ A;  3OYF A;  1MU2 A;  3OYG A;  3O08 A;  3K5M A;  1RCH A;  3SMP A;  3AO3 A;  3ZSZ A;  4DQR A;  2YNG A;  5AQH A;  4DFM A;  4IO8 A;  1WAF A;  4FPA A;  5AQV A;  3MAQ A;  2OCE A;  1YJW N;  1WOQ A;  1ITG A;  1VHX A;  4BC4 A;  3HP9 A;  4FWL A;  4ILJ A;  3SAG A;  1WSF A;  3V4I A;  4E1J A;  1M90 O;  4QCL A;  5KGX A;  3ENH A;  1HLU A;  3A8Y A;  4BE2 A;  3P1G A;  4OJR A;  1BIU A;  2PBD A;  3LWM A;  4DR5 K;  4HVJ A;  4H0T B;  1BGX T;  1RT7 A;  2PYJ A;  3PSI A;  3G10 A;  1HPM A;  3RRH A;  2G8I A;  3VGK A;  2YJF A;  3QNO A;  4BR4 A;  3FZF A;  1RDD A;  1WBD A;  2O8D A;  1VQ5 N;  3C0B A;  2RHK A;  3OBW A;  5AFU H;  2RE2 A;  2DTU A;  3DRS A;  3OYH A;  2P9P A;  2HBK A;  5BRF A;  3NH0 A;  3M6G A;  2E2O A;  2NRV A;  4N76 A;  1JLQ A;  1HR0 K;  1NK7 A;  2Z1G A;  1S1T A;  3EE8 A;  3G25 A;  4Y1D A;  3ISN C;  4CD1 A;  1YF5 L;  1QHT A;  4L3Q A;  2A1S A;  4JK8 A;  1JLC A;  3SQ0 A;  1LAV A;  2E2P A;  3F9M A;  4CZF A;  2BE2 A;  4IWV A;  1FKP A;  2P9I A;  2OZS A;  1HYS A;  4LF8 K;  4CZH A;  1HNZ K;  3IKM A;  3MMV A;  4QS7 A;  2IIR A;  2WUS A;  3V9X A;  2E1Z A;  2HNZ A;  3OS2 A;  3GE1 A;  3JAM O;  1RTD A;  1T44 A;  1TV6 A;  2E5L K;  3QIO A;  1UA0 A;  4JLH A;  4X62 K;  3AO2 A;  3U9Z A;  1IH7 A;  3CXC M;  4I6M B;  3SLC A;  4CEA A;  2VG5 A;  4C8L A;  1QHA A;  4J2E A;  1S3X A;  4WQ5 C;  4F3O A;  4Q0B A;  2ITM A;  5JVH L;  4LF7 K;  1JXE A;  4V19 S;  2O8C A;  2GUP A;  5ELZ A;  3PY8 A;  1IBM K;  5KRS A;  2HHU A;  1TUY A;  3HBT A;  2QWQ A;  4KH4 A;  4DR4 K;  2GEM A;  1O13 A;  5LY3 A;  4DSL A;  2RPI A;  2B6A A;  2QXF A;  2A1R A;  3QIN A;  1RBV A;  3U9D A;  2HBM A;  3VTI A;  2P9N B;  2PY5 A;  4Z0U A;  2IVO A;  2VWJ A;  4H8K A;  3KLH A;  2RN2 A;  3DMJ A;  2GWJ A;  1KCF A;  1VQN N;  1GLF O;  3IMX A;  4PA1 A;  3DI6 A;  3CPE A;  3UKR A;  3VOV A;  3F2K A;  4OLB A;  3C6H A;  4H4M A;  4JK9 A;  4JRQ A;  1NGF A;  3AA5 X;  4NXM K;  4OPK A;  4W5T A;  1SUQ A;  2QXL A;  2ZJQ L;  1NGJ A;  2QWP A;  1ATN A;  3HJF A;  2P9U B;  4K8X A;  4KHU A;  3R6M A;  2HBL A;  4FW2 A;  3QDK A;  2XY5 A;  1FJG K;  1S6P A;  4GV3 A;  4F2S A;  3HK2 A;  5M1Q A;  2WTU A;  2AJQ A;  5AQZ A;  4JD2 B;  3LAL A;  1JCF A;  3BUZ B;  3MK6 A;  3DLH A;  4I6M A;  2YHB A;  4DUY K;  1JLE A;  4CVN E;  1ZBH A;  2XRI A;  4ID5 A;  1KLM A;  3OS0 A;  4F8R A;  3ZT2 A;  4DTU A;  1Q9Y A;  2O8B B;  2KZZ A;  3JSM A;  2ZJR L;  1Q86 O;  1YTA A;  3SV4 A;  4WE1 A;  4DTX A;  2QEX N;  3OS1 A;  1QQO A;  3WNH A;  4KB1 A;  3I8B A;  4NCG A;  4FJ8 A;  2UUA K;  1OH5 A;  4KPY A;  4CF0 A;  3HTV A;  5HRP A;  2X6S A;  3CCL N;  3SZ2 A;  1RT4 A;  5J1E A;  3QBX A;  1A5W A;  3NGY A;  5FLX O;  1VSH A;  3W0L A;  3EYZ A;  1D9F A;  3J80 O;  3L3V A;  3PO5 A;  1YXQ A;  2KFN A;  2P9N A;  4XIU A;  3VQB A;  3ID6 A;  3LP2 A;  3NVK A;  3CJB A;  4Z4F A;  1VSF A;  5DMR A;  4KV8 A;  3UE5 A;  4DQQ A;  4DU4 A;  1QSY A;  3PX6 A;  2ZWH A;  1L5U A;  2KHO A;  2P9U A;  3RR7 A;  4FWM A;  5KPR A;  3I55 N;  4QS9 A;  1WAJ A;  2KLA A;  1QVF M;  2VG7 A;  3D2E A;  1JL1 A;  4GVE A;  4XH1 A;  1O1W A;  3TI0 A;  2ASM A;  2G8K A;  5KPZ A;  3KKR A;  4E0D A;  4CW7 B;  4BRN A;  2OTL N;  2KTQ A;  4JKB A;  1ZBS A;  3VEY A;  4DTN A;  4DV1 K;  3C6A A;  1BO5 O;  2Q2R A;  4CEO A;  3TAR A;  1T05 A;  1ASV A;  3FFI A;  3TSU A;  3E9L A;  1WSJ A;  4OGC A;  3AO5 A;  4NO7 A;  3PO4 A;  1S6Q A;  3ZT0 A;  3VQ8 A;  1W9H A;  1VQ4 N;  1NGE A;  4CER A;  4CJP A;  3H1V X;  4E7K A;  2YHY A;  4BRG A;  4I9L A;  1ZBU A;  4OPA A;  4MFB A;  2A3Z A;  3RSE B;  3OJS A;  4Z4H A;  4FVU A;  3OYI A;  2NUB A;  1T7P A;  1C1B A;  3SAH A;  1S1U A;  5C42 A;  2E8A A;  1B9D A;  4GW6 A;  3THW B;  1RFQ A;  3DLR A;  4BGA A;  2ZQB A;  4PQU A;  4BR9 A;  4CJE A;  3SCX A;  4IG3 A;  3SPY A;  4IKF A;  2Q31 A;  1GLD G;  3AGK A;  4M3R A;  4B9N A;  4KRF A;  2O4G A;  3N4Q A;  4BY9 C;  4FJG A;  3DLK A;  3H3N O;  1HNI A;  5AQQ A;  3RRG A;  1S1V A;  4CEZ A;  5LL6 Z;  4LFA K;  3CFR A;  3M8P A;  4IEI A;  1KXP A;  1SS6 A;  3VEV A;  3CIP A;  3CJ9 A;  1EKE A;  1NJW A;  3HSC A;  1X1P A;  3KZB A;  2V7Z A;  4M7X A;  3CM5 A;  3MN7 A;  4CJR A;  1RT5 A;  3L8B A;  1T6D A;  1ZBI A;  1KTQ A;  1NKE A;  4AHS A;  4Z4E A;  5KTQ A;  2HHT A;  3O1W A;  4DWI A;  4E7H A;  1U6Z A;  3AY9 A;  5BRD A;  1NJX A;  1DTT A;  1NWK A;  3DRP A;  3WNG A;  5HBM A;  3AAQ A;  3O9U A;  4LF6 K;  5KPT A;  2OPR A;  3GOI A;  5AQK A;  1T6C A;  3TU5 A;  5E41 A;  2G8W A;  5AQL A;  3WXK A;  4BR0 A;  5HL7 L;  1ZC6 A;  3PUF A;  3MX2 A;  3KK1 A;  2QKK A;  3RR8 A;  4X66 K;  3LZJ A;  1NK0 A;  1FXX A;  1NK9 A;  1I94 K;  4AM6 A;  3VES A;  3ZX3 A;  4YDU C;  3WQU A;  4H5R A;  3HYF A;  4JKA A;  2VQF K;  3LDL A;  5LJV A;  2V51 B;  1TGO A;  3ENO A;  4C1N I;  2FBX A;  3P4I A;  2G8V A;  3VQD A;  4BRA A;  1EWR A;  4CJL A;  1NGG A;  2GV9 A;  3SUO A;  3UB5 A;  3M8S A;  2J4R A;  4CZG A;  4FZY A;  3V9U A;  4BAC A;  3K5L A;  1KC8 O;  1QSS A;  1VQ7 N;  2PYL A;  5AQX A;  3RWU A;  4BG9 A;  1NMN A;  4DKW A;  2F9W A;  4HUF A;  1XC9 A;  4CEQ A;  3P5J A;  4YOW A;  2YKN A;  3NGZ A;  4J2D A;  5FPN A;  5EX5 A;  3S3O A;  1C1A A;  3SBG A;  3T19 A;  3S3M A;  2IAJ A;  2HHX A;  2HF3 A;  4OKE A;  4KI4 A;  2IVP A;  3HO1 A;  4AIL C;  4EHU A;  4W5O A;  4CJU A;  4EP4 A;  2E1Y A;  3VQQ A;  4FSV A;  3CI5 A;  1Z6R A;  5I3U A;  2F8S A;  4KHW A;  2V52 B;  4JI0 K;  2ASO A;  1K8K B;  3WNF A;  2KW4 A;  2JLE A;  4BRE A;  4CF1 A;  4PKG A;  2HOE A;  3WXI A;  5M1P A;  3VF6 A;  5CE3 A;  3PX0 A;  5KGW A;  1BA1 A;  4BRH A;  4LH4 A;  4O8K A;  3VA0 A;  2E4L A;  4B9L A;  1Z26 A;  2BGG A;  3NH1 A;  2YHX A;  4CJF A;  4FK2 A;  5J2Q A;  4OO1 J;  4AF1 A;  1W7A A;  2D0O A;  4PY5 A;  3BF3 A;  3EEQ A;  3CM6 A;  4FLW A;  4C8O A;  3U6F A;  5M1K A;  3A5N C;  4FXD A;  3D6R A;  1KLN A;  2H3G X;  4FJ9 A;  1KAZ A;  3BY5 A;  5AFU A;  4NXN K;  2HVI A;  3TAM A;  1P90 A;  1HYV A;  4HTU A;  3AAR A;  3HXM A;  2QK9 A;  1LV5 A;  3H45 C;  4IXC A;  3KVG A;  1RT6 A;  2KZM A;  2YHW A;  5A2Q O;  3H46 O;  5BPM A;  1HJR A;  3T7Z A;  1XQS C;  1NGI A;  5C10 A;  2O8E B;  1Q18 A;  1LWF A;  2ZD1 A;  3P83 D;  2HND A;  4FW1 A;  4FWS A;  4ILH A;  3VPZ A;  3VEW A;  3OHR A;  4O44 A;  2RKI A;  3VQ7 A;  2P5O A;  1U45 A;  4H0V B;  1BUP A;  4DFP A;  1YT3 A;  2OZM A;  5CYQ A;  4JI5 K;  1WSG A;  1NJY A;  5AR0 A;  4C8M A;  3T1H K;  3CMA N;  5E84 A;  4DFJ A;  3VQ9 A;  1C0G A;  3F9K A;  3NF6 A;  4YOU A;  4CJ5 A;  1J9A A;  4DMN A;  1NGA A;  1K8K A;  3VET A;  1C6V A;  3HM8 A;  4H5V A;  3S3N A;  3TTC A;  4DSE A;  2QWM A;  3EY1 A;  3FLC O;  4FM1 A;  4DSF A;  3ZYY X;  3K0S A;  4CZE A;  4OPJ A;  3BGR A;  2F8T A;  3Q7C A;  3JXU A;  3KLG A;  2A42 A;  2PFU A;  5E26 A;  1NG9 A;  2Q1N A;  1NM1 A;  4MDA A;  1QZ6 A;  1NKB A;  2OTJ N;  2X78 A;  4JI7 K;  4DSK A;  4DV3 K;  2A40 A;  1QE1 A;  5FPM A;  4B1Y B;  1BHL A;  3R1X A;  3VEX A;  4LFC K;  1VQL N;  2XY6 A;  3HOS A;  4J8F A;  5MLC Q;  3NF8 A;  2FLO A;  5CR4 A;  2NRX A;  4JKF A;  3TPQ A;  4U7B A;  3OYN A;  4EAH D;  3LAN A;  1RDU A;  1B9F A;  1KAY A;  1N8R O;  1M1K O;  5I9E B;  3AVN A;  4FJH A;  3FZH A;  3R3L A;  5BPL A;  3G71 N;  1SL1 A;  4CE9 A;  5J2M A;  4JKE A;  3TAB A;  1N32 K;  1EO1 A;  3EO3 A;  2QTD A;  4M3Z A;  3ZET B;  2HF4 A;  5FPD A;  3K57 A;  3O3G A;  1C0F A;  4H0Y B;  1HKB A;  3O3F A;  1QZ5 A;  3VF4 A;  4KI6 A;  2Q97 A;  1KVA A;  3ALY A;  1Q8I A;  3KLF A;  2Q36 A;  1RDA A;  3KD5 E;  2G8U A;  5AZI B;  2ZGZ A;  3KTQ A;  1NK6 A;  2E6L A;  4IDK A;  5LMN K;  4EZ6 A;  1GOC A;  3LDQ A;  2B5J A;  1GLB G;  4JI8 K;  3AVB A;  1VQK N;  1S9E A;  3EZ5 A;  4CHP A;  4H5W A;  4FJ5 A;  5TKY A;  3CCE N;  1XI1 A;  3LM2 A;  4YY3 K;  4FK4 A;  3CYM A;  4AHC A;  1YAG A;  5J2P A;  5AJ3 K;  5AQG A;  3KHY A;  4DS5 A;  4N56 A;  1E4G T;  1IBK K;  1BQN A;  3D45 A;  2DFH A;  5FRM A;  5IWA K;  2Z1J A;  1JCE A;  3V9Z A;  3QEV A;  4FJK A;  4HUE A;  4FWP A;  4K43 A;  3VN5 A;  3LP0 A;  3CQY A;  1BI4 B;  4PL7 A;  2WFB A;  3DWL A;  1VQO N;  4X65 K;  3ZET A;  1IO2 A;  2YNF A;  4BQL A;  3IG1 A;  3MN5 A;  4DG1 A;  2P1J A;  2NRW A;  3S41 A;  1NBW A;  1XHX A;  1X9M A;  1IKW A;  3O4N A;  4WQ4 A;  1IG9 A;  4KHQ A;  2FBY A;  4B1V A;  1CXQ A;  3IRX A;  5AQO A;  3L4Q A;  4AHU A;  4Z4I A;  1SKW A;  3NHG A;  1CLQ A;  2YKM A;  1J54 A;  4E89 A;  4EP5 A;  2OPQ A;  3LL3 A;  3PIP L;  4GVM A;  2D1K A;  4W5R A;  1HMV A;  1OVQ A;  2X6N A;  5HLF A;  4O4G A;  3CC7 N;  3LAM A;  3K9J A;  4M45 A;  3O5B A;  3O8M A;  3HP6 A;  3OYK A;  4CGD A;  1I3A A;  1H1V A;  2IGI A;  4CIF A;  3I8D A;  3TWH A;  3KWI A;  4N47 A;  4DU1 A;  2OA8 A;  3ZSV A;  2HHQ A;  4M42 A;  4JKH A;  3K2P A;  3SI6 A;  3HPH A;  4CF9 A;  3U3G A;  4CZM A;  2Q0R A;  2YV0 X;  4JS5 A;  4M3Y A;  4YOT A;  3UKU B;  4CHY A;  2P9S B;  1NOZ A;  4O0I A;  2VYP A;  3VQ6 A;  4IFV A;  1T3V A;  1LAW A;  4FWO A;  1RGI A;  4CEE A;  1JL2 A;  1KVB A;  1ESV A;  1BI4 A;  2NNW A;  2YNI A;  3SQ1 A;  4FWN A;  1T8E A;  4A62 A;  5HP1 A;  4ILG B;  3J8A A;  4DR1 K;  4HCC A;  5ADX A;  1CZ9 A;  1HJO A;  3C95 A;  2E20 A;  4JNE A;  1Q7Y O;  1IBL K;  3ID8 A;  1L3U A;  4A5B A;  1YTU A;  1XC3 A;  2P5G A;  1RT2 A;  2OYQ A;  3QIP A;  1W0H A;  3M8Q A;  1TK8 A;  2Q3S A;  3ZT3 A;  5HOO A;  4PUO A;  4GY2 B;  4Z4G A;  3V1Q A;  3DRR A;  4FLY A;  2I7N A;  4KRE A;  3D7E O;  4H5N A;  3R9P A;  3TAQ A;  4CEC A;  1YJN N;  3VGM A;  4MO4 A;  4DF8 A;  1VSE A;  4C8N A;  1VSJ A;  3QEI A;  2CH5 A;  1NK8 A;  3ZSR A;  4BVO A;  3K9K A;  4PHT X;  1UWB A;  4C1N K;  2IC3 A;  1KQS M;  3BP8 A;  3UIQ A;  1QTM A;  4F4K A;  2Q0U A;  3L2V A;  2QKB A;  3ZSW A;  4E7J A;  1LW2 A;  3B6P A;  1SQK A;  3LPT A;  2WOM A;  4RCH A;  5K14 A;  1E3M A;  3HT3 A;  2GBZ A;  3C6T A;  5T7B A;  5C15 A;  4IG0 A;  3UKU A;  3OYB A;  3ENB A;  2P9S A;  4B9V A;  3QEP A;  5AQS A;  2IVN A;  2W6K A;  1TL1 A;  4JD2 A;  4CBU A;  1XWL A;  3QBW A;  4OPH A;  1U49 A;  1TK5 A;  1BQM A;  5HRO A;  4A61 A;  1Q82 O;  3NE6 A;  4B9Q A;  3O9R A;  4NCB A;  4IJA A;  2O8B A;  4AHR A;  2IOC A;  4BWJ A;  3RMC A;  1L3T A;  3T1A A;  5JS1 A;  3KKS A;  1DKG D;  1NGH A;  4KTZ A;  3EN9 A;  2F96 A;  4F2R A;  3ULD A;  4RW6 A;  1TUU A;  4FJL A;  1KAX A;  5GIO A;  3M3Z A;  3SBT A;  4H0P A;  1RTI A;  1V4S A;  3MEC A;  3NVM A;  1NMD A;  3FE1 A;  2D0A A;  4WQ5 A;  1NJI O;  4B9M A;  5C24 A;  3L3U A;  3OBY A;  1C0U A;  4FPB A;  3ZX2 A;  4IZ9 A;  2QWL A;  3ZX0 A;  1BL3 A;  3Q7B A;  1R59 O;  3A0I X;  2QWN A;  4KHY A;  1J5O A;  3HST B;  1NU0 A;  4B08 A;  2CGL A;  3A2F A;  3RTV A;  4E1M A;  4BG8 A;  3C94 A;  3R8E A;  5CY4 A;  1IJJ A;  5ADX H;  3OYJ A;  3CF5 L;  1RTH A;  5C2F A;  2BAN A;  5AQT A;  3MEE A;  1E4F T;  3MWT A;  1MA9 B;  1N33 K;  4DFK A;  4K8Z A;  4HWI A;  3VQE A;  3G0Z A;  2LSN A;  3TSQ A;  4DV0 K;  4E19 A;  5F0X A;  1RT1 A;  1GLL O;  2FSJ A;  3WNE A;  1RIL A;  3LM9 A;  1HUX A;  2YHA A;  4WCE L;  1Q9X A;  3CCU N;  5JIC A;  3HPG A;  3D2F B;  4OGE A;  4BGB A;  3HZ6 A;  3K5O A;  3NBP A;  4FJJ A;  3ASM A;  4I7F A;  2HMI A;  2QM1 A;  4ELV A;  1VSL A;  2AA4 A;  4PWD A;  3AVI A;  1VSD A;  5AQR A;  1RDC A;  4ID1 A;  3TAG A;  4CEF A;  1SL0 A;  5BN9 A;  3CER A;  2OPS A;  4JHD B;  3VGL A;  1DGK N;  5EVZ A;  1WNS A;  3QEX A;  3OYE A;  3RSE A;  3CJC A;  1DEJ A;  4IFE A;  1CZA N;  3CJ1 A;  5EOY A;  1BCO A;  1A5V A;  1ZBF A;  3OW2 M;  3AVF A;  3C6U A;  3H6E A;  4AHT A;  3THW A;  3NAE A; 
#chains in the Genus database with same CATH homology
 5E84 A;  1C0G A;  5AQM A;  3U9Z A;  3CXC M;  4YOU A;  4I6M B;  1LCU A;  3SLC A;  3AAP A;  2ZGY A;  1NGA A;  1QHA A;  3FZL A;  3SAF A;  1K8K A;  3BF1 A;  3VET A;  5AZJ A;  3J7Z O;  3HM8 A;  1S3X A;  4WQ5 C;  2FXU A;  4H5V A;  3TTC A;  2GEL A;  3O80 A;  2QWM A;  1X9J A;  1VQ8 N;  4MLE A;  4IDH A;  4NLB A;  2ITM A;  3FLC O;  4BR2 A;  2NRZ A;  5JVH L;  3ZYY X;  4CZE A;  4DCH A;  4LC9 B;  3Q7C A;  3JXU A;  2GUP A;  2A42 A;  2PFU A;  5E26 A;  5ELZ A;  5M1F A;  1ATS A;  2Q1N A;  3CQX A;  3EL2 A;  4CBX A;  1NM1 A;  4MDA A;  2WBN A;  1QZ6 A;  4H0O A;  2OTJ N;  1TUY A;  3HBT A;  1JCG A;  2QWQ A;  4KH4 A;  4H5T A;  4FOI A;  2A40 A;  4WFA L;  4M63 C;  2GEM A;  5FPM A;  2F7T A;  4B1Y B;  3IUC A;  1O13 A;  3R1X A;  4BRQ A;  5LY3 A;  3VEX A;  1VQL N;  1YVN A;  3HOS A;  4J8F A;  5MLC Q;  3JS6 A;  2FLO A;  5CR4 A;  2NRX A;  4JKF A;  3TPQ A;  1U2V B;  5AQI A;  3W3D A;  3U9D A;  4U7B A;  2HBJ A;  3CCM N;  2HBM A;  4EAH D;  3VTI A;  1RDU A;  2P9N B;  2VWB A;  3P38 A;  5AQY A;  3D2F A;  2IVO A;  1BG3 A;  1KAY A;  1N8R O;  1M1K O;  2GWJ A;  2JWL A;  4HTL A;  4MLH A;  3BEX A;  5I9E B;  1VQN N;  1GLF O;  3G6E N;  3IMX A;  3KK7 A;  3QFP A;  2QWO A;  3FZH A;  3R3L A;  3TTD A;  3GBT A;  5BPL A;  3E9P A;  3G71 N;  3CPW M;  3VMF B;  4JKE A;  3CPE A;  5C2D A;  2ZF5 O;  3UKR A;  3VOV A;  1EO1 A;  2VGN A;  3EO3 A;  3F2K A;  3RVC A;  2QTD A;  4IOA L;  1Q81 O;  3ZET B;  3C6H A;  4JK9 A;  2HF4 A;  5FPD A;  1NGF A;  2V7Y A;  5KQD A;  1C0F A;  4FOE A;  4BC3 A;  2QXL A;  4JHD A;  4H0Y B;  1HKB A;  3U4L A;  3WXJ A;  4WFN L;  2ZJQ L;  1Y64 A;  1NGJ A;  5EY4 A;  2QWP A;  1QZ5 A;  4WFB L;  1ATN A;  2NRH A;  2P9U B;  3TTF A;  3N4P A;  3WT0 A;  3DLL L;  3R6M A;  3VF4 A;  1YIJ N;  2HBL A;  3QDK A;  2ZJP L;  3PIO L;  4GV3 A;  2Q97 A;  3MN9 A;  5M1Q A;  3A5L C;  4JN4 A;  3L6Q A;  2Q36 A;  1MDU B;  5AQZ A;  1TYQ B;  4MO5 A;  5GIP A;  4JD2 B;  1X3N A;  3T69 A;  1JCF A;  2A41 A;  5AZI B;  1MWK A;  4IEE A;  4WYB A;  3BUZ B;  3MK6 A;  2ZGZ A;  3CC4 N;  4M7Y A;  4I6M A;  4CBW A;  3I56 N;  3SK3 A;  4BRK A;  3G4S N;  5BRH A;  2QW9 A;  4GNI A;  1EQY A;  1YUW A;  3DJC A;  3H3O B;  3LDQ A;  4IOX A;  5TKW A;  2ZJR L;  1NGD A;  3LDN A;  1GLB G;  2HST A;  1Q86 O;  4Z94 A;  1VQK N;  3VTH A;  1NLV A;  5GAG P;  1YIT N;  4H5W A;  2QEX N;  1QQO A;  3CCS N;  5TKY A;  3FR0 A;  3I8B A;  3CCE N;  3LM2 A;  5BR9 A;  3CD6 N;  4GV6 A;  2QI2 A;  5H1S Q;  3QML A;  1G99 A;  1YAG A;  3HTV A;  5AQG A;  1BOT O;  3C7N B;  3KHY A;  3I33 A;  3CCL N;  5AQN A;  1IG8 A;  2YI1 A;  1YHQ N;  3FGU A;  1E4G T;  3L4I A;  3QBX A;  2FF6 A;  2P9L B;  3O4W A;  3W0L A;  1S72 N;  3CJA A;  3M1F A;  1U2V A;  4BR7 A;  3O9S A;  1OKJ A;  1YXQ A;  2GX9 A;  3B8A X;  1HX1 A;  2JWK A;  1GLC G;  4PL8 A;  4PKI A;  4G9Z A;  2HMP A;  2P9N A;  2W40 A;  4O5F A;  4A59 A;  3CME N;  1X3M A;  3ID6 A;  3MWP A;  3CET A;  1JCE A;  3NVK A;  2QWR A;  2W41 A;  1ATR A;  4JAX A;  5BN8 A;  4JKC A;  4FWR A;  3WEE B;  3GL1 A;  3CJB A;  4FWP A;  3CCQ N;  4K43 A;  4R79 A;  5GAE P;  3CQY A;  3UE5 A;  4PL7 A;  1BWF O;  2WFB A;  3DWL A;  3SMS A;  4B1Z A;  4BRC A;  5DM6 L;  1VQO N;  1RDW X;  1Q7Y O;  4EFH A;  4ISE A;  2NRT A;  3A5O C;  3F5T A;  3ZET A;  2VGM A;  2ZWH A;  3DAW A;  3LDP A;  1YJ9 N;  2KHO A;  2PAV A;  4BQL A;  5AQU A;  3MN5 A;  3VER A;  5DM7 L;  2A6A A;  2P9U A;  4FWM A;  4A57 A;  2NRW A;  3S41 A;  5KPR A;  3I55 N;  4QS9 A;  1NBW A;  2AP1 A;  2KLA A;  2NRR A;  3H1Q A;  1QVF M;  3D2E A;  4YOY A;  4WQ4 A;  4GVE A;  4XH1 A;  4B1V A;  2ASM A;  2DPN A;  1TYQ A;  5AQO A;  5KPZ A;  3VF2 A;  3L4Q A;  3FZM A;  4CI6 A;  4FWK A;  2I7P A;  4B1X B;  4BRN A;  3P31 A;  2OTL N;  4C23 A;  4JKB A;  1ZBS A;  2D4W A;  3ULE B;  4RWT A;  5GIN A;  3VEY A;  2BH1 A;  3C6A A;  3EKU A;  1BO5 O;  3HOT A;  2Q2R A;  3PIP L;  3LL3 A;  2D1K A;  2P9K B;  4CZJ A;  3TSU A;  2BUP A;  3E9L A;  3CC7 N;  4YOV A;  3FFK B;  1QVG M;  5B8H A;  3K9J A;  3AGR A;  4NO7 A;  3O9T A;  3O5B A;  3O8M A;  1GLE G;  3FZK A;  1VQ4 N;  3GG4 A;  1NGE A;  1P8Z A;  3OA9 A;  4KBO A;  1MWM A;  1H1V A;  3H1V X;  2P9I B;  3WQT A;  4BRF A;  2YHY A;  4BRG A;  4NB4 A;  3MCA B;  4OPA A;  3KWI A;  3CHW A;  4FWQ A;  4ISF A;  2WC9 A;  2A3Z A;  3C7N A;  3RSE B;  2ASP A;  5GAD P;  3C65 A;  4FVU A;  1BDG A;  3ATU A;  4JKH A;  1QQN A;  4U67 L;  3SAH A;  4CZM A;  2P9L A;  2Q0R A;  1HKC A;  4BC5 A;  2E8A A;  1D4X A;  4YOT A;  3VEO A;  1RFQ A;  3UKU B;  4BGA A;  5GAH P;  2P9S B;  3WXM B;  5BRE A;  4BR9 A;  4MDB A;  5EXW A;  2VYP A;  3E66 A;  2E2Q A;  2Q31 A;  1T3V A;  1GLD G;  3AGK A;  1ZXO A;  3MDQ A;  1NGC A;  4XEI A;  4BRO A;  4FWO A;  1RGI A;  4XH4 A;  1LOT B;  3PLA A;  2BTF A;  3N4Q A;  1VAZ A;  4BY9 C;  3WEE A;  1W97 L;  5M1N A;  4IO9 L;  3E1Y A;  3H3N O;  4CZL A;  1ESV A;  1GLA G;  2CH6 A;  2NNW A;  5AQQ A;  2A5X A;  4FWN A;  3L0Q A;  4K42 A;  4A62 A;  4DB3 A;  1BU6 O;  4ILG B;  3J8A A;  1K9M O;  2F9T A;  3EKS A;  4IEI A;  1KXP A;  5ADX A;  3O1B A;  1HJO A;  1SS6 A;  4JKG B;  2E20 A;  4JNE A;  4Y0W A;  2NLX A;  3VEV A;  3CIP A;  3CJ9 A;  3DXK B;  4O8U A;  4BR5 A;  3U8X A;  3ID8 A;  3HSC A;  3IFR A;  3KZB A;  2V7Z A;  4M7X A;  4NLC A;  4A5B A;  1XC3 A;  2NZT A;  3HI0 A;  3MN7 A;  5JLH A;  4BVP A;  3DXM B;  5C12 A;  4ISG A;  3A5M C;  5CHI A;  1T6D A;  3CCV N;  3GDQ A;  5FPE A;  3KWG A;  5HOO A;  4GY2 B;  3SJH A;  3MCP A;  3O1W A;  1U6Z A;  2I7N A;  3ULE A;  3D7E O;  3LDO A;  4H5N A;  3AY9 A;  3R9P A;  5BRD A;  1YJN N;  3ZEU B;  3VGM A;  4MO4 A;  1DT9 A;  1NWK A;  4A5A A;  4BRL A;  2P9K A;  4KH6 A;  2CH5 A;  3AAQ A;  2QA4 N;  1VQ6 N;  4H0X B;  3O9U A;  3UKR B;  4BVO A;  3GOI A;  2UYT A;  3K9K A;  4PHT X;  5KPT A;  4YOX A;  4C1N K;  5AQK A;  5JLF A;  1KQS M;  4WQ4 C;  1T6C A;  3BP8 A;  3HRG A;  3TU5 A;  4B1U B;  5C0Y A;  2Q0U A;  3CCJ N;  5AQL A;  3WXK A;  4BR0 A;  4PKH A;  4BQZ A;  5HL7 L;  1ZC6 A;  3MX2 A;  2YCH A;  1SQK A;  3MN6 A;  4BC2 A;  4CD3 A;  4UY8 O;  4RCH A;  1SAZ A;  4EHT A;  4B1W B;  5BPN A;  2FF3 B;  4AM7 A;  4A2A A;  4AM6 A;  1JJ2 M;  5C15 A;  3VES A;  3ZX3 A;  4DHY A;  4YDU C;  3QB0 A;  3WQU A;  4H5R A;  3UKU A;  4KH5 A;  2GWK A;  3ENB A;  2P9S A;  4JKA A;  3LDL A;  1VQ9 N;  5LJV A;  5AQS A;  2V51 B;  4BRM A;  5F1X A;  5AQW A;  5AQF A;  2IVN A;  3O9Q A;  4BRI A;  4CZI A;  3ENO A;  3EZW A;  4JD2 A;  4RTF D;  3P4I A;  3QBW A;  4OPH A;  4A2B A;  4C1N I;  4CBU A;  5AZI A;  1OVY A;  4H03 B;  4A61 A;  2E88 A;  1Q82 O;  1VQP N;  2CGK A;  2KKZ A;  2P9P B;  1BA0 A;  5M1O A;  4B9Q A;  3O9R A;  4BRA A;  3M5R A;  4IJA A;  1NGG A;  3O6W A;  5F2R A;  4QS8 A;  4IOC L;  4YDU A;  5JMV A;  3UB5 A;  2J4R A;  4CZG A;  1DKG D;  1NGH A;  1S22 A;  3EN9 A;  4JKG A;  5AQJ A;  3CC2 N;  3DXK A;  1V4T A;  4GV9 A;  2YJE A;  1TUU A;  2FSK A;  1KAX A;  1KC8 O;  1VQ7 N;  2VCP A;  3M3Z A;  5AQX A;  3SBT A;  5GIO A;  3QFU A;  4H0P A;  4BG9 A;  3QIC A;  1V4S A;  4DKW A;  1W2B M;  2F9W A;  3IDH A;  1K8A O;  3E9O A;  3DXM A;  3EE9 A;  1GLJ O;  4F9O A;  4YOW A;  4XH5 A;  3NVM A;  1NMD A;  3VEZ A;  3FE1 A;  4BRP A;  4WQ5 A;  3VEN A;  3ATV A;  1NJI O;  2CGJ A;  1VQM N;  1J6Z A;  1WUA A;  1XUP O;  3P39 A;  4JK7 A;  4IJN A;  5FPN A;  5EX5 A;  4CZK A;  5AQP A;  3SBG A;  1NGB A;  3OBY A;  4JKD A;  4FPB A;  2HF3 A;  3ZX2 A;  4K25 A;  4IZ9 A;  2QWL A;  4FL9 A;  2IVP A;  3ZX0 A;  3Q7B A;  3O08 A;  2OAN A;  3ZEU A;  4EHU A;  1R59 O;  3A0I X;  3SMP A;  2D0P A;  2E1Y A;  2QWN A;  5AQH A;  3NMU A;  4IO8 A;  4FSV A;  3CI5 A;  1Z6R A;  4FPA A;  1K73 O;  2V52 B;  5AQV A;  2CGL A;  3WUH A;  4YOR A;  1YJW N;  1WOQ A;  2ASO A;  1K8K B;  5AZJ B;  4BRE A;  4BC4 A;  1SZ2 A;  4BG8 A;  4FWL A;  4PKG A;  4DQ8 A;  3R8E A;  1HKG A;  2HOE A;  4ILJ A;  5M1P A;  3VF6 A;  3WXI A;  5CE3 A;  3SAG A;  1M90 O;  4E1J A;  1KD1 O;  1IJJ A;  5ADX H;  3CF5 L;  3TSP A;  3ENH A;  1BA1 A;  1HLU A;  3A8Y A;  5C2F A;  5AQT A;  2PBD A;  3D2E B;  4BRH A;  4BRD A;  4O8K A;  1E4F T;  3MWT A;  1MA9 B;  5LJW A;  2YHX A;  4HWI A;  4OO1 J;  4H0T B;  4AF1 A;  3TSQ A;  2YX6 A;  1YI2 N;  2D0O A;  3CCR N;  3CJ7 A;  1HPM A;  5F0X A;  3BF3 A;  3VGK A;  2YJF A;  5JVG L;  4BR4 A;  3FZF A;  1GLL O;  2FSJ A;  5M1K A;  4FO0 A;  1VQ5 N;  3C0B A;  2RHK A;  3A5N C;  3OBW A;  3LM9 A;  1HUX A;  5AFU H;  3D6R A;  2RE2 A;  2H3G X;  4WCE L;  1ILY A;  1KAZ A;  2P9P A;  5AFU A;  2HBK A;  2EWS A;  5BRF A;  5JIC A;  2E2N A;  3D2F B;  1P90 A;  4BGB A;  3M6G A;  3HZ6 A;  3CCU N;  2E2O A;  4JEP A;  3AAR A;  2NRV A;  3H45 C;  4IXC A;  4WF9 L;  3KVG A;  4EIA A;  2QM1 A;  2YHW A;  2GTD A;  3H46 O;  3EE8 A;  4CD1 A;  3G25 A;  2AA4 A;  5BPM A;  1YF5 L;  2FSN A;  3T7Z A;  1XQS C;  1NGI A;  5AQR A;  4L3Q A;  1Q18 A;  4CJ7 A;  5C10 A;  4JK8 A;  4FWS A;  4ILH A;  5BN9 A;  3VPZ A;  3CER A;  2E2P A;  3F9M A;  4CZF A;  4IWV A;  3OHR A;  3VEW A;  4JHD B;  3VGL A;  2P9I A;  1DGK N;  4CZH A;  5EVZ A;  3MX5 A;  4H0V B;  1BUP A;  5KQ8 A;  3IKM A;  3MMV A;  3RSE A;  4QS7 A;  2IIR A;  2WUS A;  3CJC A;  1DEJ A;  4IFE A;  1CZA N;  3CJ1 A;  5AR0 A;  3WXL A;  2E1Z A;  5EOY A;  3GE1 A;  4K41 A;  1QQM A;  1T44 A;  3OW2 M;  1Z05 A;  3H6E A;  3CMA N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...