2ITGA

Catalytic domain of hiv-1 integrase: ordered active site in the f185h construct
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
160
Chain Sequence
HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS-1 INTEGRASE
publication title The catalytic domain of human immunodeficiency virus integrase: ordered active site in the F185H mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 37
structure length 160
sequence length 160
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2itgA00
3P1GA 3OYKA 4DQSA 3TARA 4ZTFA 3KTQA 3KLEA 2R7YA 2OPSA 1HRHA 1N6QA 4DSLA 2A1RA 4FLYA 1VRUA 4GMJB 4CGDA 4KFBA 4UQGA 3NBPA 4DF8A 3HL8A 1HMVA 1RDDA 1X1PA 3VN5A 3WNEA 1KLNA 5K14A 1U49A 2BE2A 4CIEA 4GW6A 1JLFA 3DLBA 4K8XA 4KHWA 3HVRA 3LWLA 1D5AA 4IG3A 4E0DA 4IBNA 4B9TA 3G10A 3HPGA 1SV5A 3QIPA 4MQ3A 4CF0A 4E7KA 2X78A 1TKDA 3P83D 4GVMA 2KFNA 2IDOA 4O0JA 2HNZA 4BWMA 1RDCA 3K2PA 3OYHA 3V9ZA 4DTNA 3SJJA 1RTJA 3LAKA 1QSSA 4YFUA 4DS4A 4CF2A 4B9UA 4FZZA 3AVNA 5HRNA 3F9KA 4B9VA 3KD1E 1GOBA 3LP0A 3K59A 1NK9A 1HQUA 1HNIA 3M8QA 1DTQA 1YT3A 4AHRA 2HNDA 1RTDA 1RT7A 4FW1A 3QEXA 3RRHA 4IG0A 3CYMA 5J2MA 3ZSOA 4HCCA 4BDYA 4DTRA 4E89A 5C42A 3SV3A 4OGCA 1IH7A 2BGGA 3D0PA 2Z1IA 4Z4IA 2HW3A 3CFOA 1GOAA 1BGXT 1BHLA 2XRIA 1LWFA 1NJWA 1TK8A 4KB0A 4KHUA 4AILC 2Y1JA 2DFFA 2IGIA 3I0SA 2X6SA 3CM5A 4RG8A 3EY1A 1WSJA 2BDPA 4CJUA 1KVCA 1ITGA 1Z26A 3QNOA 4KTWA 3L2VA 4DS5A 3S9HA 1A5VA 1YTUA 3AA5X 3PUFA 1RBVA 4CGFA 4AH9A 3NFAA 2LSNA 2B6AA 3ZSWA 4E1NA 3K57A 3TANA 1BQMA 2QKKA 4M3UA 4RW8A 2EX3A 2FBYA 4F2RA 4YNQA 3HM9A 5FDLA 3I8DA 4CJRA 1C1BA 1HYVA 4FZXC 3L3VA 1C1AA 1S1TA 2WOMA 3T1AA 3LP3A 3MECA 3P5JA 3DLRA 4OKEA 1TKZA 4LH5A 3AVBA 4AHVA 1JLQA 3DLEA 2P5GA 1A5WA 3DI6A 1ZBIA 3V9WA 4HTUA 5FROA 3MXJA 3V81A 1WNSA 4B08A 3PO5A 2KZMA 2XY5A 2PY5A 4FJKA 5I42A 3LAMA 2OZMA 4DTXA 1BIZA 1TL1A 3RMAA 1C0MA 3LP1A 3U3GA 1X9WA 3AVHA 2OPQA 1L3UA 2QK9A 1X9MA 4AHTA 1RT1A 1ZBUA 5HBMA 1I39A 1KFDA 1NJZA 3AV9A 2YHAA 4Q5VA 3O3HA 2HNYA 3SI6A 3ZSZA 3V1QA 3DRRA 4CHPA 3OYDA 3NHGA 3DLKA 1RNHA 3QO9A 1S5JA 1KTQA 4DWIA 1NJYA 4OLAA 3FFIA 4B9MA 5T7BA 1VSHA 4DFJA 3HJFA 1TV6A 3LPTA 1S1VA 1WSIA 3WNFA 2YKNA 3DOKA 3IG1A 3TR8A 3QESA 4W5RA 1ZBLA 3DRPA 2Y1IA 4PY5A 2Z1JA 3AA4A 3KLIA 4I7FA 4FJ7A 3MEGA 4CJFA 3QEIA 4HUEA 1JLGA 4I2PA 3VQ7A 2OPRA 4CGJA 3QEWA 2DTUA 3HYFA 4KHSA 4F3TA 4BACA 4H4OA 1S1UA 1CLQA 1RDAA 1UOCA 3K5MA 2G8HA 4FJJA 1NKBA 3T3FA 1FKPA 4CJ5A 1WSHA 3NF8A 1NKEA 1RBTA 2G8WA 2KTQA 1S9GA 1QQCA 3TI0A 5HLFA 3ZSYA 1FK9A 4E7IA 4F8RA 3HP9A 3HVTA 1KLMA 3C95A 4M45A 3F73A 1QS4A 1B92A 3MXIA 3M8SA 1L3SA 1RDBA 5CYQA 4E19A 4NCAA 3O4QA 1JL2A 1Q9YA 4C8LA 4G1QA 1J53A 3AVLA 1C1CA 3AA3A 2IC3A 3SNNA 4ICLA 4CHYA 2GBZA 1LWCA 5KGWA 1EETA 3OYIA 1S6QA 1BISA 3OYBA 1JLAA 4BE1A 3SUNA 3AVIA 4N76A 3OYJA 1TL3A 2D5RA 3NF7A 3O3GA 1T03A 3LWMA 4HVJA 4NCGA 3AVMA 4Y1CA 3NF9A 4FLWA 3AVJA 2IOCA 1TAQA 4M3ZA 2HHXA 1KVBA 2RPIA 4O55A 1VSDA 1BCMA 4Z4GA 4Z4FA 4DTUA 4KPYA 1ASVA 3LANA 5DK5A 3OYGA 2HHSA 4PQUA 1RT5A 4DSIA 4FM2A 5CZ1A 1DTTA 4DFKA 4W5OA 1WAJA 3G0ZA 4J2AA 4M3YA 4FXDA 5KI6A 4L8RB 4QCLA 1NK7A 1UAXA 1QHTA 2VWJA 1SL2A 3SZ2A 5KRTA 1JXBA 2E4LA 1BI4B 4CIFA 1T05A 4N41A 3C6TA 3WNGA 1RT4A 1U04A 4MFBA 2IAJA 5C25A 2NUBA 3NF6A 1LWEA 1HQEA 3OJUA 4CEOA 1NOYA 2DY4A 3C94A 3RR8A 2B4JA 3ZSVA 4BE0A 4DFMA 1NK8A 1NK0A 3SV4A 5C24A 1ZBHA 3ZT2A 3ZSXA 1U48A 3OYMA 2DFEA 4RW4A 3LPUA 4CK3A 3WNHA 2EHGA 3VQBA 3OYCA 3OYAA 3NH1A 3MEEA 2DFHA 2JLEA 2VWKA 3L2UA 3O4NA 3MAQA 2QKBA 3RWUA 1Y97A 3VQAA 3DLHA 1HYZA 3KKRA 4CJTA 3AVKA 2OPPA 4KHNA 4CEQA 3KLHA 4FLUA 4B9NA 3KK2A 1XHXA 3VQ6A 4BDPA 3OJSA 4DTSA 4DLEA 3SPYA 1QE1A 4OVLA 3T19A 3QINA 1N5YA 2KQ2A 3CFRA 1O1WA 4CFBA 1C6VA 3L2RA 3RMDA 1EP4A 3SYZA 4O0IA 4B8CA 1JL1A 1XWLA 4CEDA 4RW9A 5HP1A 4CEEA 4IDKA 1IO2A 3IRXA 4AHSA 2XY7A 4OLBA 3TABA 1TGOA 5J1EA 1FXXA 3ITHA 2XHBA 1L3TA 3PO4A 3KD5E 1U47A 4HCBA 2PYJA 4I9QA 2F8SA 3TWHA 4JS5A 3QNNA 3ALYA 3KK1A 4CGHA 3AO5A 1MU2A 1SKSA 4Q0BA 4FJ8A 4DTJA 4DSEA 3SQ4A 1QTMA 2G8IA 3B6PA 4CEBA 4FLVA 1G15A 3NGZA 3OYFA 1NKCA 5HROA 2G8FA 1QSYA 2XY6A 3SUOA 4EP5A 4DQIA 4ELTA 3LZIA 4EP4A 1NJXA 3OYLA 2O4GA 2ZQBA 3RMBA 4CFAA 5I3UA 1T8EA 1LW0A 1VSJA 1CXUA 5DMRA 1RBSA 1S1XA 5HRSA 1XC9A 3OS2A 1J54A 1RBUA 2YHBA 1REVA 1VSLA 3VA3A 2OA8A 1XI1A 2D0BA 1KFSA 3JYTA 4ZTJA 1WSGA 4Z0UA 3PY8A 3NDKA 5CYMA 4XIUA 4DF4A 3RR7A 1W9HA 1S1WA 2A1SA 5CY4A 4B8AB 4CF8A 5KRSA 1L5UA 2HHVA 1TKXA 2VG7A 1WSFA 2ITGA 3QLHA 4KRFA 4KTZA 1UA0A 2XY8A 3ZSRA 2G8UA 4EZ6A 3AO2A 1IG9A 1BIUA 3PX4A 4FM1A 3KLFA 1WAFA 1EX4A 1LV5A 4HHTA 1BQNA 1RT6A 2E6MA 1IKWA 4KAZA 4I2QA 4AHUA 2YNHA 4BE2A 3DRSA 1YVUA 4J2EA 5SZTA 2E6LA 4DLGA 5EU7A 4H8KA 1VSKA 2X6NA 3ISNC 1R0AA 1CZBA 2Z1GA 1C0UA 2P5OA 2HHTA 2G8KA 3VQEA 1SL1A 3DM2A 3L2QA 3TAGA 1Q8IA 2PZSA 4C8NA 1U4BA 3HK2A 2RF2A 1IKYA 1VSIA 2QXFA 2YNFA 3CQ8A 4BDZA 4DG1A 3ASMA 2ZD1A 1JXEA 3QEVA 1TAUA 2VG6A 1RBRA 4KV8A 4CEZA 4FJIA 4RW7A 1TK5A 1KVAA 2P1JA 4RW6A 3K5NA 3S3NA 3NE6A 4Z4CA 4CEFA 4M42A 1ZBFA 3NCIA 3L8BA 4H4MA 2KZZA 3HPOA 2OYQA 3SUPA 3CG7A 3KIOA 3B6OA 4LSLA 4OPJA 4O44A 3KLGA 3TAEA 1RTIA 4CJ3A 4CERA 4WE1A 1KCFA 1IKXA 1BCOA 4NYNA 4E3SA 4CGIA 3U3YA 1DLOA 2ZE2A 4CHQA 3L2WA 4FJXA 2HVHA 2PYLA 1EXQA 1HPZA 1IKVA 3AO3A 3M8RA 4E7HA 1EKEA 3DMJA 1YTAA 3AVFA 3PX6A 1J5OA 4CJQA 4KHYA 3V6DA 2FBXA 4JLHA 3SUQA 2HB5A 4CFDA 3ZT1A 4DU4A 3SCXA 1SUQA 4JS4A 4KHQA 2G8VA 1A5XA 4DQRA 3AVAA 3VQ4A 3EYZA 4FLZA 3THVA 1JLBA 2GUIA 2VG5A 2YKMA 5HRPA 3NAEA 3TAMA 1HJRA 4O5BA 4OPKA 3S3MA 5JS1A 4FLTA 3ZT0A 1KRPA 1RCHA 4CJWA 4F4KA 3VQCA 5J2PA 3RRGA 3V9UA 4C8OA 2Q3SA 1S9EA 4I9LA 4E7JA 4DU3A 4BWJA 4FJ5A 3VQPA 3BGRA 4PA1A 3VQ5A 2B5JA 4B9SA 4KB1A 1B9FA 4DFPA 3AO4A 4TSXA 4QOZB 3VA0A 3QIOA 3TAQA 4FJLA 1HNVA 4NYFA 2YNGA 4M3RA 3TAPA 3OS0A 1QSLA 4J2DA 1ASWA 4N47A 4EZ9A 3TAFA 4CHOA 4DSFA 1Q9XA 3QERA 1U45A 4FW2A 4CJKA 4HUGA 2F8TA 4Z4HA 4C8MA 4AHCA 4IKFA 3HSTB 2WONA 3MEDA 4W5QA 4ID5A 2YNIA 2W42A 3RMCA 2OZSA 4CJEA 1XHZA 4FJ9A 3AVCA 3V1OA 3OY9A 1LAWA 1FKOA 1KSPA 2JGUA 1S6PA 5J2NA 5HRRA 4K8ZA 4PUOA 4KI6A 4KO0A 4M3XA 4NCBA 3RTVA 4JRQA 2KW4A 3ZCMA 3QETA 3QEPA 4C8KA 2HVIA 4KREA 2FBTA 3IS9A 4HUFA 1VSEA 3VQDA 3LDSA 3PX0A 3UIQA 3IAYA 4DSJA 3ZSQA 2GV9A 2YV0X 1JKHA 3EZ5A 4ID1A 3LZJA 4DU1A 3LALA 4JRPA 4OJRA 5CZ2A 1VRTA 1J9AA 2Z1HA 3NH2A 1GOCA 3V4IA 3KJVA 1BL3A 1RILA 1BI4A 4DQPA 2I5JA 3BDPA 3HO1A 2HHQA 3CFPA 4CJLA 4CFCA 4N56A 4M3TA 1TVRA 1NOZA 1JLCA 1X9SA 4FJMA 5E41A 1F21A 4FK0A 4F3OA 1WN7A 4FZYA 1L3VA 5KTQA 3AVGA 4FK4A 4LSNA 3KKSA 4LH4A 3LP2A 4LY7A 4Z4EA 1NK6A 4N5SA 3V9XA 2AJQA 1VSMA 4OGEA 3K5LA 1ZYQA 2RN2A 1LAVA 1D9FA 4DTMA 2KFZA 1SL0A 2P51A 5FRMA 1TKTA 1ASUA 3U6FA 3OYEA 2HMIA 4CHZA 4FJGA 4LD0A 3V9SA 4DSKA 3ZT4A 4CJSA 3S3OA 4W5NA 4CE9A 3V1RA 4FJNA 3ULDA 4DTPA 4KI4A 4ELVA 2D0AA 1UWBA 4Y1DA 4DQQA 4FM0A 3VQ8A 1I3AA 3OVNA 1VSFA 4E1MA 1RT2A 1CZ9A 4FYDA 4CCHA 3VQ9A 1LW2A 4CECA 2ETJA 4DTOA 3PV8A 1HYSA 4ZHRA 1D9DA 2BANA 4FCYA 4CJ4A 3VQQA 3SQ1A 1RTHA 1CXQA 4CHNA 3HP6A 3AO1A 3NGYA 3CM6A 3A2FA 4CIGA 5KGXA 4IFVA 2FBVA 2HHUA 2O4IA 4M41A 3NGIA 4R5PA 3DYAA 4OKKA 5SWMA 3JSMA 5FRNA 5JS2A 3L3UA 2D0CA 4PWDA 1K6YA 1NK5A 1RT3A 4IFYA 3SPZA 2RKIA 1WSEA 4CEAA 4CK2A 2F96A 4CJVA 4DMNA 4FVMA 1C0TA 1W0HA 3E01A 3AA2A 4CJPA 1JLEA 4CF1A 3OYNA 4FLXA 3SQ0A 2IS3A 1SKWA 4F2SA 3H08A 2HHWA 1VK0A 3I0RA 4QAGA 3ZT3A 4CK1A 3C6UA 2XO7A 2ATQA 3O3FA 4W5TA 3MXMA 1NK4A 4KKOA 2FC0A 3M8PA 3K5OA 1SKRA 4B3OA 3HPHA 2X74A 3K58A 4M3WA 4ELUA 4J2BA 3HXMA 3NH0A 4FJHA 4KTQA 5J2QA 3DOLA 1WLJA 1TK0A 1T7PA 4CGGA 3HT3A 3OS1A 4E7LA 3D45A 4O4GA 4CESA 1UA1A 4B9LA 3KK3A 4CF9A 5D3GA 1Z25A 4OKJA 1B9DA 4FK2A 3DLGA 1D8YA 3SQ2A
chains in the Genus database with same CATH superfamily
3AGKA 4B3RK 3P1GA 3TARA 4DQSA 2WBNA 2Q0UA 1HRHA 3OHRA 4KFBA 3HL8A 1X1PA 1KLNA 2V51B 2P9KB 1KAXA 4IG3A 4IBNA 4B9TA 3HPGA 2HOEA 1E4GT 4CF0A 3ZYYX 1TKDA 3P83D 3F9MA 4GVEA 1NGHA 4BWMA 3K2PA 4DTNA 3V9ZA 3BZCA 4BRPA 1QSSA 4H5NA 1GOBA 5GAEP 1OVQA 3K59A 1HQUA 3M8QA 1DTQA 5C12A 5FPMA 4K43A 1IH7A 4BC5A 3D0PA 4Z4IA 3J7ZO 1VQON 3ULEA 1RFQA 1ATRA 4DV2K 5MLCQ 1S3XA 3CD6N 3HTVA 2DFFA 4EIAA 3VEYA 3CM5A 4IDHA 2Q0RA 2BDPA 5LJWA 2Q97A 4AM7A 3QNOA 4V19S 5C15A 4DS5A 4CZEA 3E9OA 1RBVA 4M7XA 2LSNA 2B6AA 4E1NA 3K57A 4RW8A 3ZX0A 4H03B 1JCFA 2WOMA 1EO1A 3BUZB 3MECA 3CCQN 4OKEA 4WFAL 1TKZA 4LH5A 5FPDA 4AHVA 1JLQA 1NGFA 3DI6A 5HL7L 3PO5A 2PY5A 4DTXA 1TL1A 1TUYA 3U3GA 1L3UA 3K0SA 4AHTA 3VESA 5GINA 2GTDA 4JYAK 3GBTA 3NHGA 3V1QA 3CI5A 1RNHA 1S5JA 3R1XA 4BR0A 4IJAA 4DFJA 1TV6A 1KD1O 3WNFA 1HNZK 1VQ6N 3IG1A 3QESA 2Y1IA 2Z1JA 5M1KA 3AA4A 3IKMA 3KLIA 3MEGA 4HUEA 1JLGA 5AQOA 2FXUA 4I2PA 3VQ7A 5LL6Z 4CBXA 1OKJA 4H4OA 4CZMA 4CVNE 3K5MA 2G8HA 4FJJA 1NKEA 1FKPA 4CJ5A 1RBTA 2HBKA 1N34K 4OX9K 3CPEA 4F8RA 3U9DA 3SK3A 3C95A 1VQKN 3ZLJA 1LCUA 1B92A 4E1JA 3M8SA 1RGIA 4C8LA 4G1QA 1J53A 4FSVA 1C1CA 5FLXO 1LWCA 3E1YA 2BTFA 3OYBA 4BQLA 2E2OA 2J4RA 4L3QA 3HZ6A 3SAFA 1GLFO 4Y1CA 5C2FA 3AVJA 3WUHA 4DB3A 4BVPA 1VQ7N 1BCMA 4JKGA 4Z4GA 3IFRA 3LANA 1BO5O 3I56N 3VEVA 4PQUA 1RT5A 4KBOA 4DSIA 4BVOA 4W5OA 1WAJA 4J2AA 4QCLA 4L8RB 1NK7A 1UAXA 1QHTA 5KRTA 2O8FA 2E4LA 2ZM6K 3WNGA 5C25A 3OJUA 4CEOA 3IMXA 2O8BB 1NK0A 3SV4A 4BR7A 5AFUA 2DFEA 3LPUA 4IJNA 3OYCA 5AQYA 3MEEA 2JLEA 4ISGA 3KKRA 4CJTA 3D7EO 4KHNA 3KLHA 2NRZA 4FLUA 1YUWA 4IEIA 5AFUH 3UKRA 4DTSA 5A2QO 3SPYA 1N5YA 4CFBA 3RMDA 3SYZA 4CEEA 3ENHA 5J1EA 5GIOA 3ITHA 4PL7A 3CCSN 1U47A 3THXB 4JS5A 3QNNA 4WQ4A 4CJ7A 4DSEA 2ASOA 1S72N 1NKCA 1T3VA 3NGZA 3HO1A 5HROA 2XY6A 3J80O 5DM7L 3IUCA 3RMBA 1IV0A 5AQMA 3WXKA 1LW0A 1NNEA 1MWKA 1VSJA 4KH6A 1CXUA 4A61A 5HRSA 1XC9A 3WEEB 3MX2A 1J54A 4EHTA 2YHBA 1REVA 1VSLA 2OA8A 4ZTJA 3VEZA 3KWIA 4DF4A 1EWQA 1EWRA 1S1WA 4B8AB 4CF8A 4B1UB 2ZGYA 4KTZA 3ZSRA 1NGJA 1C0FA 2YHXA 4O8KA 3VOVA 4KAZA 5AQHA 2E6MA 1OH7A 4A62A 2NNWA 4IOAL 1CZBA 2Z1GA 1C0UA 2P5OA 3VQEA 3CC7N 3L2QA 1Q8IA 1IKYA 2YNFA 2UXBK 2GEMA 2VG6A 4CEZA 3VMFB 3H1VX 3S3NA 3NE6A 2KZZA 3SUPA 4OPJA 1W97L 5JMVA 3EKSA 4NXMK 1RTIA 3DAWA 1E3MA 1DLOA 2ZE2A 5M1PA 2PYLA 1HPZA 3M8RA 3PX6A 3AVFA 5BPMA 5KQ8A 2DPNA 4CJQA 2FBXA 1YJNN 3QBWA 4DU4A 3FZMA 4CZGA 1BG3A 1GLDG 4DQRA 3W0LA 3VQ4A 4DR7K 2YKMA 3EE8A 5HRPA 4OPKA 3NAEA 3S3MA 1N32K 1NGEA 4FLTA 3ZT0A 1KRPA 4MDBA 4PA1A 4XEIA 4KB1A 3J81O 3TAQA 4FJLA 4MO4A 4NYFA 4DHYA 3OS0A 4J2DA 4CHOA 1Q9XA 1QHAA 3A5OC 4DV5K 4KHPK 4HUGA 4B1VA 4FWLA 4W5QA 2W42A 3FLCO 3WQTA 3Q7CA 3OY9A 2A42A 2QWNA 4LF7K 5AZJB 1S6PA 5J2NA 5TKYA 4K8ZA 3H3OB 4NCBA 3PSFA 1HLUA 2KW4A 4JRQA 4AM6A 3AAQA 3PX0A 4HUFA 3PLAA 2HBJA 3UIQA 3IAYA 5AQQA 2GV9A 3S41A 4JRPA 4OJRA 1XNRK 1VRTA 3THWA 5BN8A 2JWKA 3KJVA 1RILA 1K8AO 3VETA 5DM6L 3BDPA 4N56A 4M3TA 3QFPA 4DV1K 1WN7A 4FZYA 1L3VA 1GLLO 4LH4A 3E9LA 4N5SA 3GDQA 4JKFA 1SL0A 3O9RA 1J5EK 2P51A 5FRMA 3U6FA 3CJCA 4FJGA 4IFEA 3V9SA 2ZJPL 4JK7A 4CJSA 4JI3K 1X9JA 4CE9A 4FJNA 4DTPA 4IWVA 4Y1DA 4IO9L 4DQQA 3NMUA 1RT2A 4FYDA 1SAZA 3ATVA 1D9DA 3VF2A 4CJ4A 5B8HA 4CHNA 2Q31A 2E2QA 4BGAA 3THXA 5KGXA 3MMVA 4IFVA 2O4IA 3CCVN 3A5MC 1K6YA 4IFYA 2RKIA 1WSEA 4CK2A 4CJVA 1C0TA 4FJ5A 3AA2A 1SKWA 3CMEN 2IS3A 3TPQA 1U2VB 5AQGA 3ZT3A 4WFNL 2NRHA 2XO7A 4WQ4C 3WEEA 3MXMA 2Q2RA 1NK4A 2P9IB 4B3OA 2X74A 4IXCA 3HXMA 1KC8O 1XUPO 4KTQA 3CHWA 1TK0A 3DWLA 4GKJK 1OVYA 3I8BA 4CGGA 3OS1A 4BRLA 3HT3A 4O4GA 4E7LA 3O5BA 3KK3A 3ID6A 3LDQA 2W40A 4A2AA 3KLEA 4GV9A 4FWQA 4NXNK 2NRVA 4FLYA 1VRUA 4GMJB 4CGDA 4DF8A 3WNEA 1HMVA 1RDDA 1H1VA 3WQUA 3DLBA 4KHWA 3HVRA 3G10A 2O8EA 1SV5A 4MQ3A 4FOEA 2X78A 3WT0A 2ZJQL 1GLCG 2HNZA 3LAKA 4B9UA 4B9VA 3EEQA 4NB4A 3KD1E 1HNIA 4AHRA 1YT3A 1RTDA 3EN9A 4BRDA 3QEXA 4IG0A 4HCCA 4E89A 2WTUA 3CF5L 1YJ9N 2Z1IA 3CFOA 2YJEA 1BGXT 2XRIA 1LWFA 3PSIA 4KB0A 4AILC 2Y1JA 3CC4N 3D2FA 3I0SA 4KTWA 3L2VA 2P9PA 3S9HA 1A5VA 2D0OA 3AA5X 2YCHA 4M3UA 3D2EB 2QKKA 1BQMA 3U9ZA 2FBYA 3HM9A 5FDLA 2QWMA 3P31A 2H3GX 3T1AA 4LF5K 4PL8A 3AAPA 4JHDA 1YF5L 4ILHA 3SBTA 3C65A 4JV5K 3DLRA 2P9UB 3AVBA 1ZBIA 4FWPA 1VAZA 3V9WA 4HTUA 2ZWHA 3MXJA 1BOTO 3V81A 4CZLA 4CZKA 5EXWA 3E66A 4FJKA 3LAMA 1IJJA 1BIZA 3LP1A 4JN4A 3H3NO 3AVHA 2NRWA 3FGUA 1I39A 2VQEK 2QTDA 2F9TA 4GKKK 3O4WA 3AV9A 2WC9A 4A5BA 3O3HA 3SI6A 3ZSZA 3W3DA 3L4IA 3DLKA 3QO9A 5AZJA 2W6LA 1NJYA 4OLAA 5T7BA 1U6ZA 2QWRA 3M3ZA 5AQSA 4DKWA 1WSIA 5KPZA 3DOKA 3CJBA 4ISFA 1YITN 4H5TA 3QEIA 1KAZA 4A2BA 4CGJA 3QEWA 3HYFA 4BACA 2GWKA 1RDAA 3T3FA 1GLEG 5HLFA 3HP9A 2P9SB 4M45A 1QS4A 1L3SA 5LMUK 2ZF5O 3VGMA 1JL2A 3HOTA 4FWMA 4LF8K 2IC3A 2VGNA 4ICLA 4CHYA 5KGWA 1EETA 3OYIA 3SUNA 3AVIA 4KH5A 4UY8O 2P9LB 5AQUA 3NF9A 1TAQA 5CHIA 2YI1A 2HHXA 2RPIA 1VSDA 3DJCA 4K25A 4JI2K 3G0ZA 3SMPA 4FXDA 5KI6A 1K8KB 1NGDA 4BREA 2VWJA 1C0GA 3EE9A 1BI4B 4CIFA 3ENOA 4BROA 1RT4A 1ZXOA 1U04A 4MFBA 4JI1K 1QVGM 2DY4A 3NF6A 1LWEA 1HQEA 4BRKA 3C94A 2B4JA 3ZSVA 1U2VA 1NK8A 2KKZA 1Z05A 3ZT2A 1YI2N 3FZHA 3L0QA 2P9IA 1GLAG 2EHGA 3VQBA 3CC2N 2DFHA 5ELZA 3O4NA 1WB9A 1YVNA 1Y97A 3RWUA 3AVKA 2OPPA 3QDKA 4JD2B 4B9NA 4BDPA 5E26A 3VEXA 4DLEA 1TYQA 3T19A 3G4SN 2BH1A 1Q81O 1C6VA 4CEDA 3SJHA 4IDKA 3O6WA 3ZETB 3TABA 3OTOK 1FXXA 3PO4A 4I9QA 4F9OA 2PYJA 3GL1A 3KZBA 4Q0BA 1MU2A 5BRFA 2G8IA 4DTJA 3SQ4A 1XQSC 1G15A 4H0XB 3OYFA 4OPHA 5AQZA 1QSYA 2GWJA 2O4GA 4CFAA 1XNQK 3O9TA 1HNWK 4CBWA 3OS2A 2GUPA 2OCEA 1WSGA 4Z0UA 3NDKA 5CYMA 2UUAK 4JI5K 2P9NB 2VG7A 3EZWA 5AQXA 3DXKB 4YOUA 3AO2A 1IG9A 3PX4A 4FM1A 2YX6A 1WAFA 3KLFA 1LV5A 4HHTA 1BQNA 1IKWA 4I2QA 2IVNA 4AHUA 4DR3K 1YVUA 2E6LA 3D2EA 4YY3K 3H1QA 3CCUN 2X6NA 3ISNC 4NLBA 1R0AA 5M1NA 2G8KA 3R6MA 5BPNA 3ATUA 3EKUA 3TAGA 3CQ8A 1YHQN 4YHHK 2P9UA 3LDNA 2W41A 1JXEA 1TAUA 1VQPN 1KVAA 3K5NA 1X3MA 4FWNA 4H4MA 2E2NA 2OYQA 4EFHA 3CG7A 3BEXA 1Q7YO 4CJ3A 4CERA 4YDUA 1IKXA 1MA9B 4H0TB 1BCOA 5AQPA 4E3SA 4CGIA 2ZJRL 3U3YA 1N36K 2HVHA 3L2WA 4LFBK 4A59A 3AO3A 4E7HA 3CPWM 4JI4K 4X62K 3I33A 3SUQA 3O9UA 2UUBK 2G8VA 1A5XA 5M1QA 3EYZA 4FLZA 2VG5A 3TAMA 3DLLL 5JS1A 1HKCA 1ATSA 1MDUB 4O8UA 3V9UA 2Q3SA 1S9EA 4I9LA 3RSEB 4E7JA 4DU3A 5M1FA 4JKDA 3BGRA 3VQ5A 2B5JA 3P38A 3AO4A 2BUPA 4TSXA 4DR2K 3QIOA 2P9SA 1ILYA 4M3RA 3TAPA 5GAGP 4EZ9A 1Z6RA 2E1ZA 3LDPA 2KLAA 3LDLA 4C8MA 1P8ZA 1E4FT 4OO1J 3V1OA 2P9LA 1LAWA 2PBDA 4YOWA 3OW2M 5CE3A 3JXUA 4G9ZA 3RTVA 4C8KA 2P9KA 5BRDA 2FBTA 3IS9A 1VSEA 3LDSA 3A5NC 4JKAA 2QEXN 4FWOA 3ZSQA 5KQDA 2YV0X 4DU1A 4RTFD 1K8KA 1XMQK 2Z1HA 4FWSA 1BI4A 4DQPA 2I5JA 5C2DA 3MWPA 4CFCA 3LDOA 1TVRA 1JLCA 2VWBA 1F21A 4FK0A 4F3OA 5KTQA 1HKGA 4FPAA 4LY7A 4MLHA 2AJQA 1VSMA 4OGEA 5BR8K 1ZYQA 1ESVA 3QFUA 2IVOA 4LD0A 3ZT4A 4JD2A 2D0AA 3KHYA 3VQ8A 1VSFA 4E1MA 4CCHA 2E8AA 4OPAA 2CGKA 3VQ9A 2E5LK 2ETJA 4DR1K 4ZHRA 4FCYA 3QB0A 4BRQA 3SQ1A 3ZETA 4BRCA 3AO1A 3NGYA 2QWPA 3MX5A 3K9JA 4CIGA 3UKUB 3VEWA 2QWLA 3CQXA 3NGIA 3DYAA 4OKKA 4B3TK 5FRNA 1GLBG 1NK5A 2OANA 4M3YA 4ILGB 4H5VA 3H08A 1VK0A 3I0RA 3P39A 2V7ZA 2A41A 5HOOA 4W5TA 1K73O 3A0IX 3O1BA 1Q82O 3K58A 4M3WA 4ELUA 4J2BA 3NH0A 4BRFA 1TUUA 1YIJN 1WLJA 4X65K 4K0KK 1UA1A 4B9LA 3DXKA 5D3GA 4FK2A 5F2RA 1D8YA 4C1NK 3F5TA 2F7TA 5C0YA 3CCLN 3TSPA 1HKBA 4ZTFA 3KTQA 2UUCK 2OPSA 3UE5A 1N6QA 4X66K 2GELA 3NBPA 4UQGA 3KK7A 3I55N 3O80A 2BE2A 5AQVA 4CIEA 4A57A 4K8XA 1D5AA 4E0DA 4GNIA 3CIPA 2KFNA 4GVMA 1NGBA 3VTHA 3VENA 4O0JA 4BR2A 3HM8A 4LF6K 3OYHA 3QMLA 4YFUA 4DS4A 4CF2A 3F9KA 3LP0A 3TSQA 1NK9A 4LFAK 1RDUA 2HNDA 4JAXA 3RRHA 5J2MA 1FJGK 3ZSOA 4DTRA 1QVFM 3SV3A 2BGGA 4BRMA 3R9PA 1GOAA 1YJWN 4BC4A 2PAVA 3CCRN 4DCHA 2IGIA 4RG8A 3EY1A 1WSJA 4CJUA 3HRGA 1KVCA 1ITGA 1Z26A 4YDUC 3H46O 5AQLA 2FSNA 2FF6A 3CERA 4PHTX 4CGFA 4JI7K 4AH9A 1VQLN 3G71N 2EX3A 4YNQA 4BRAA 3I8DA 1S1TA 4CZFA 2O8BA 3P5JA 3L4QA 3T1YK 5M1OA 3DLEA 3PIOL 1WNSA 2XY5A 2OZMA 4YOVA 5IWAK 2NRTA 3RMAA 5JVHL 2OPQA 5I9EB 1X9MA 4JK8A 3RVCA 1RT1A 1ZBUA 5HBMA 1HUXA 4WCEL 1NJZA 2YHAA 4H0PA 1WBDA 3DRRA 1CZAN 4CHPA 5GAHP 5EY4A 1KTQA 4CW7B 3FFIA 4B9MA 3N4QA 3HJFA 3LPTA 1S1VA 5F1XA 4H5WA 3TR8A 3DRPA 4FO0A 4JKBA 4GV6A 1VQ5N 4I7FA 4FJ7A 3F2KA 4CJFA 2DTUA 4JI8K 1SZ2A 5IT9O 1S1UA 1UOCA 4CD3A 4WQ5A 1NKBA 3C7NB 2KTQA 1G99A 1S9GA 1QQCA 3TI0A 1NWKA 3BF1A 4E7IA 3HVTA 1KLMA 3ZEUB 3F73A 1RDBA 3O4QA 1NJIO 4DV4K 3AA3A 3SNNA 1JCEA 4B1XB 4QS8A 4BE1A 1S6QA 1BISA 2FSKA 1JLAA 1QQOA 1OH6A 5EVZA 2D5RA 1T03A 5H1SQ 4HVJA 4NCGA 4K41A 4FLWA 4K42A 4M3ZA 2QXLA 3ULEB 4O55A 4DTUA 4KPYA 1Q86O 2HHSA 4FM2A 1V4SA 5CZ1A 1DTTA 3TSUA 3UKUA 3SZ2A 1JXBA 2E20A 2IAJA 5AQJA 4BE0A 1VQ8N 4DFMA 3WXJA 4FWRA 1RDWX 2HMPA 2QW9A 3O1WA 2FLOA 3ZSXA 3OYMA 5LMNK 3EO3A 4PKHA 3WNHA 4DR5K 3L2UA 3NH1A 3MAQA 2VWKA 4LFCK 2QKBA 4IEEA 3VQAA 3DLHA 2UYTA 4CEQA 2NRXA 1N8RO 2FSJA 3KK2A 1BUPA 1XHXA 2IVPA 3CCEN 1ZC6A 1GLJO 3MN5A 3H6EA 3QINA 3CFRA 1EP4A 1JL1A 4AF1A 5HP1A 4RW9A 5AQWA 4AHSA 2XY7A 3MCAB 1KQSM 2XHBA 4BRHA 2F8SA 2HSTA 4HCBA 3TWHA 3ALYA 4A5AA 3KK1A 3Q7BA 4FJ8A 1J6ZA 2HF3A 5AQTA 4CEBA 1HJOA 2G8FA 2HF4A 1BU6O 4ELTA 3LZIA 3OYLA 2ZQBA 4B3MK 4MDAA 5DMRA 1RBSA 4X64K 1RBUA 3PIPL 2D4WA 2ASPA 5TKWA 3HI0A 4O5FA 4M63C 3VF4A 3RR7A 5JVGL 3BY5A 2A1SA 3OA9A 2HHVA 5KRSA 3B8AX 4EZ6A 2G8UA 3T7ZA 4JKEA 4BRNA 5KPTA 3MN7A 3C6AA 3JAMO 3ZX2A 4J2EA 5AQIA 3TTCA 4BG9A 1VSKA 1D4XA 1BDGA 1HR0K 2HHTA 4FWKA 1SL1A 5AQFA 2QXFA 1VSIA 2QM1A 4BDZA 5F0XA 1WUAA 1RBRA 4C23A 2O8FB 4FVUA 4FJIA 2P1JA 4RW6A 4M42A 4BGBA 1ZBFA 3L8BA 4DR6K 3HPOA 3NVKA 5LY3A 4O44A 3KLGA 4PKIA 4BR9A 1QQNA 1KCFA 4CZIA 4NYNA 4CHQA 4FJXA 2AA4A 1EXQA 4DUZK 3G25A 3MN6A 3DMJA 1J5OA 1JCGA 4ILJA 4KHYA 4JNEA 1NGCA 3V6DA 4EHUA 2O8CB 4JLHA 2HB5A 5JLHA 1SUQA 3VGLA 3AVAA 1JLBA 2GUIA 3AY9A 3GG4A 4O5BA 2KHOA 3VQCA 5J2PA 3HBTA 4C8OA 3C7NA 4DFPA 4B9QA 3VA0A 1N33K 1HNVA 3ZEUA 4JEPA 1ASWA 3M6GA 4WQ5C 2O8DB 3QERA 3SAHA 1U45A 4FW2A 4CJKA 1NG9A 4Z4HA 4BR4A 3O9QA 1T6DA 1W7AA 3OBYA 2WONA 2GX9A 3RMCA 4ID5A 4CJEA 1XHZA 4FJ9A 3AVCA 3CMAN 1FKOA 1BA0A 2JGUA 3TTFA 1VQMN 4PUOA 4KI6A 4M3XA 4KO0A 5BRHA 5BPLA 3ZCMA 2RE2A 2A6AA 2YJFA 1WBBA 4RWTA 3CJAA 3ENBA 4CZJA 4FL9A 4DSJA 3CCMN 3R3LA 3DXMB 1JKHA 3EZ5A 3LZJA 4BC2A 5CZ2A 3VERA 5KPRA 1NGAA 2VQFK 3CFPA 1MWMA 3LM9A 3SAGA 5E41A 2UU9K 3AVGA 4LSNA 3KKSA 3LP2A 3WXLA 4Z4EA 1NM1A 5AJ3K 2KFZA 3SMSA 3CQYA 1ASUA 2VCPA 5BREA 3S3OA 2WFBA 4W5NA 1Q18A 3V1RA 3ULDA 1UWBA 4R79A 4FM0A 1I3AA 3OVNA 4DV7K 1CZ9A 3KWGA 2UXDK 3MCPA 4DTOA 1LW2A 1Y64A 4DR4K 3K9KA 1CXQA 3HP6A 2A3ZA 3CM6A 4BRGA 3UB5A 4CD1A 3TTDA 3JSMA 5JS2A 3L3UA 2D0CA 4H0VB 4BG8A 1JJ2M 2F96A 4FVMA 1W0HA 3E01A 4CJPA 1QZ6A 1JLEA 4CF1A 3SQ0A 2OTJN 4QAGA 4CK1A 5AQKA 4JI6K 3C6UA 2ATQA 3FZLA 3O3FA 3M1FA 4KKOA 3M8PA 3FR0A 5EOYA 5J2QA 3DOLA 1T7PA 1P90A 5GADP 3WXIA 3D45A 4CESA 2FF3B 4CF9A 1Z25A 1B9DA 1VQ9N 3SQ2A 4DV3K 1DEJA 2AP1A 1ATNA 3OYKA 2E1YA 4IO8A 4PKGA 2R7YA 4GV3A 4DSLA 2A1RA 2E2PA 1FW6A 1KAYA 3ID8A 3VN5A 2HHQA 5K14A 1U49A 4GW6A 1JLFA 3ZX3A 3LWLA 5AQRA 1IBKK 3QIPA 2PFUA 4E7KA 4DQ8A 1M90O 4IZ9A 3OBWA 2IDOA 1RDCA 3THWB 3SJJA 1RTJA 4FZZA 3AVNA 5HRNA 3HOSA 3J7YP 1YAGA 4Z94A 2ITMA 2EWSA 1XMOK 1RT7A 4QS7A 3O8MA 4FW1A 4B1WB 3CYMA 5GIPA 3M5RA 4BDYA 5C42A 5AZIB 4OGCA 3U4LA 4HTLA 2HW3A 1HX1A 1BHLA 1NJWA 1TK8A 1OH5A 4KHUA 3SLCA 1DT9A 2X6SA 4KH4A 2O8CA 1HPMA 2CH5A 4XH1A 1YTUA 3PUFA 1NMNA 3TANA 3NFAA 3ZSWA 3MK6A 2VYPA 4F2RA 3KVGA 4I6MB 5BR9A 4CJRA 1C1BA 1HYVA 4FZXC 3BP8A 1C1AA 3L3VA 2Q1NA 3LP3A 1X3NA 2VGMA 4DUYK 1EQYA 1BA1A 3JS6A 2P5GA 1A5WA 2I7NA 3VEOA 5FROA 4GY2B 2KZMA 4B08A 4U7BA 5I42A 1C0MA 3CCJN 1X9WA 2O8DA 1IBMK 2QK9A 5AQNA 1KFDA 4Q5VA 2HNYA 4MO5A 3OYDA 3T69A 3IDHA 3WXMB 4DWIA 3LL3A 4B1YB 1VSHA 5FPNA 2F9WA 2YKNA 1ZBLA 4W5RA 3THYB 4PY5A 1QZ5A 2D0PA 3DXMA 4H0OA 3MWTA 2OPRA 3AARA 4BR5A 4KHSA 4F3TA 1CLQA 2F4VK 1WSHA 3NF8A 2G8WA 5JLFA 3ZSYA 1FK9A 2HBLA 4B3SK 2O8EB 1W2BM 5EX5A 3MXIA 5CYQA 4NO7A 4E19A 2HHHK 4NCAA 2I7PA 1Q9YA 3AVLA 2P9NA 4WFBL 2GBZA 4FOIA 2NLXA 4N76A 5AR0A 4CZHA 3OYJA 1TL3A 3J8AA 3NF7A 1T6CA 3O3GA 3LWMA 2NRRA 3AVMA 4CI6A 2QA4N 2IOCA 4LF9K 1KVBA 3BF3A 4Z4FA 1ASVA 5DK5A 1NMDA 3CJ9A 3OYGA 3D2FB 3A5LC 4DFKA 3O08A 3CETA 2V52B 1K9MO 2ZGZA 1KXPA 2P9PB 1SL2A 1SS6A 3H45C 1T05A 4N41A 3C6TA 1NOYA 2NUBA 3RR8A 4JHDB 5C24A 1ZBHA 1U48A 4JK9A 4RW4A 4CK3A 2OZSA 3OYAA 1HYZA 4QS9A 2CGJA 3VQ6A 3SBGA 3OJSA 1QE1A 4OVLA 3NVMA 2KQ2A 4Y0WA 1O1WA 4BRIA 1O13A 3L2RA 4O0IA 3U8XA 1XWLA 4B8CA 1OH8A 1IO2A 3IRXA 1S22A 4OLBA 1TGOA 3RSEA 1L3TA 3KD5E 2JWLA 1LOTB 1BWFO 1R59O 2IIRA 3AO5A 4CGHA 1SKSA 1QTMA 3B6PA 4FLVA 4MLEA 3SUOA 4DQIA 4EP5A 4EP4A 4B1ZA 1NJXA 5I3UA 1IG8A 1T8EA 2CH6A 1S1XA 4YOTA 3N4PA 2A40A 3VA3A 1XI1A 2D0BA 1KFSA 3JYTA 3PY8A 5AZIA 4XIUA 1W9HA 5CY4A 3L6QA 2V7YA 1L5UA 4AQYK 1TKXA 3QLHA 1WSFA 2ITGA 4BY9C 3QICA 4KRFA 1UA0A 2XY8A 1YXQA 3O9SA 3P4IA 5JICA 1BIUA 4LF4K 2HBMA 1EX4A 1RT6A 1VQ4N 2QWQA 2YNHA 4BE2A 3DRSA 5SZTA 4DLGA 1VHXA 4H8KA 5EU7A 4I6MA 2WUSA 2Q36A 5CR4A 3DM2A 5LJVA 1HNXK 2PZSA 1T44A 3C0BA 4C8NA 1U4BA 3HK2A 2RF2A 4DG1A 3ASMA 2ZD1A 3QEVA 4KV8A 4RW7A 1TK5A 4Z4CA 4CEFA 4CBUA 3VTIA 4ISEA 3FZFA 5ADXA 3NCIA 3VF6A 4WYBA 2OTLN 3KIOA 3B6OA 4LSLA 3TAEA 3D6RA 3CJ1A 4WE1A 1XC3A 3AGRA 4M7YA 5BN9A 4JKCA 2YHWA 1IKVA 5ADXH 1EKEA 1YTAA 3BZKA 3TU5A 2QWOA 4YOYA 4CFDA 2UXCK 3ZT1A 3R8EA 3SCXA 3THYA 4JS4A 4KHQA 3EL2A 2E88A 3C6HA 4WF9L 3THVA 5E84A 1TYQB 1M1KO 1HJRA 4FPBA 5C10A 2ASMA 1RCHA 4CJWA 3A8YA 4F4KA 3RRGA 3G6EN 4RCHA 4BC3A 1NBWA 1IBLK 4BWJA 1ZBSA 3VQPA 2YHYA 4B9SA 1B9FA 4QOZB 3FFKB 3FE1A 2YNGA 3GOIA 1QSLA 4N47A 4HWIA 4EAHD 3E9PA 4DV0K 3TAFA 1DKGD 4DSFA 2D1KA 1NU0A 2F8TA 4DV6K 4AHCA 4IKFA 3HSTB 3MEDA 2YNIA 3GE1A 1KSPA 1NGGA 5HRRA 3CJ7A 2QI2A 1VQNN 3QETA 3QEPA 2HVIA 4KREA 3VQDA 4ID1A 3LALA 3NH2A 1J9AA 3V4IA 1GOCA 1BL3A 4JI0K 4H0YB 4NLCA 4CJLA 1QQMA 1NOZA 1X9SA 4FJMA 2W6KA 4YORA 4FK4A 3QBXA 1NK6A 3V9XA 3K5LA 2RN2A 1LAVA 3VGKA 4DTMA 1D9FA 5FPEA 1TKTA 3MN9A 3OYEA 3LM2A 2HMIA 4CHZA 3HSCA 4DSKA 1WOQA 4KI4A 4BQZA 4ELVA 1V4TA 4YOXA 4CECA 1HYSA 3PV8A 2BANA 4JKGB 3VQQA 1RTHA 4IOCL 3A2FA 1SQKA 2FBVA 1NLVA 2HHUA 4M41A 4R5PA 5SWMA 4XH4A 4PWDA 1RT3A 3SPZA 4DMNA 4CEAA 4U67L 3OYNA 4FLXA 4F2SA 4IOXA 2HHWA 1I94K 2NZTA 4H5RA 4LC9B 3CXCM 2FC0A 3K5OA 1SKRA 3HPHA 4XH5A 1NGIA 2RHKA 4C1NI 3MDQA 3J7AP 4FJHA 2CGLA 4J8FA 2A5XA 4OKJA 3T1HK 3DLGA 4JKHA 3UKRB 3VPZA 3FZKA 1DGKN
chains in the Genus database with same CATH topology
3P1GA 3OYKA 4DQSA 3TARA 4ZTFA 3KTQA 3KLEA 2R7YA 2OPSA 1HRHA 1N6QA 4DSLA 2A1RA 4FLYA 1VRUA 4GMJB 4CGDA 4KFBA 4UQGA 3NBPA 4DF8A 3HL8A 1HMVA 1RDDA 1X1PA 3VN5A 3WNEA 1KLNA 5K14A 1U49A 2BE2A 4CIEA 4GW6A 1JLFA 3DLBA 4K8XA 4KHWA 3HVRA 3LWLA 1D5AA 4IG3A 4E0DA 4IBNA 4B9TA 3G10A 3HPGA 1SV5A 3QIPA 4MQ3A 4CF0A 4E7KA 2X78A 1TKDA 3P83D 4GVMA 2KFNA 2IDOA 4O0JA 2HNZA 4BWMA 1RDCA 3K2PA 3OYHA 3V9ZA 4DTNA 3SJJA 1RTJA 3LAKA 1QSSA 4YFUA 4DS4A 4CF2A 4B9UA 4FZZA 3AVNA 5HRNA 3F9KA 4B9VA 3KD1E 1GOBA 3LP0A 3K59A 1NK9A 1HQUA 1HNIA 3M8QA 1DTQA 1YT3A 4AHRA 2HNDA 1RTDA 1RT7A 4FW1A 3QEXA 3RRHA 4IG0A 3CYMA 5J2MA 3ZSOA 4HCCA 4BDYA 4DTRA 4E89A 5C42A 3SV3A 4OGCA 1IH7A 2BGGA 3D0PA 2Z1IA 4Z4IA 2HW3A 3CFOA 1GOAA 1BGXT 1BHLA 2XRIA 1LWFA 1NJWA 1TK8A 4KB0A 4KHUA 4AILC 2Y1JA 2DFFA 2IGIA 3I0SA 2X6SA 3CM5A 4RG8A 3EY1A 1WSJA 2BDPA 4CJUA 1KVCA 1ITGA 1Z26A 3QNOA 4KTWA 3L2VA 4DS5A 3S9HA 1A5VA 1YTUA 3AA5X 3PUFA 1RBVA 4CGFA 4AH9A 3NFAA 2LSNA 2B6AA 3ZSWA 4E1NA 3K57A 3TANA 1BQMA 2QKKA 4M3UA 4RW8A 2EX3A 2FBYA 4F2RA 4YNQA 3HM9A 5FDLA 3I8DA 4CJRA 1C1BA 1HYVA 4FZXC 3L3VA 1C1AA 1S1TA 2WOMA 3T1AA 3LP3A 3MECA 3P5JA 3DLRA 4OKEA 1TKZA 4LH5A 3AVBA 4AHVA 1JLQA 3DLEA 2P5GA 1A5WA 3DI6A 1ZBIA 3V9WA 4HTUA 5FROA 3MXJA 3V81A 1WNSA 4B08A 3PO5A 2KZMA 2XY5A 2PY5A 4FJKA 5I42A 3LAMA 2OZMA 4DTXA 1BIZA 1TL1A 3RMAA 1C0MA 3LP1A 3U3GA 1X9WA 3AVHA 2OPQA 1L3UA 2QK9A 1X9MA 4AHTA 1RT1A 1ZBUA 5HBMA 1I39A 1KFDA 1NJZA 3AV9A 2YHAA 4Q5VA 3O3HA 2HNYA 3SI6A 3ZSZA 3V1QA 3DRRA 4CHPA 3OYDA 3NHGA 3DLKA 1RNHA 3QO9A 1S5JA 1KTQA 4DWIA 1NJYA 4OLAA 3FFIA 4B9MA 5T7BA 1VSHA 4DFJA 3HJFA 1TV6A 3LPTA 1S1VA 1WSIA 3WNFA 2YKNA 3DOKA 3IG1A 3TR8A 3QESA 4W5RA 1ZBLA 3DRPA 2Y1IA 4PY5A 2Z1JA 3AA4A 3KLIA 4I7FA 4FJ7A 3MEGA 4CJFA 3QEIA 4HUEA 1JLGA 4I2PA 3VQ7A 2OPRA 4CGJA 3QEWA 2DTUA 3HYFA 4KHSA 4F3TA 4BACA 4H4OA 1S1UA 1CLQA 1RDAA 1UOCA 3K5MA 2G8HA 4FJJA 1NKBA 3T3FA 1FKPA 4CJ5A 1WSHA 3NF8A 1NKEA 1RBTA 2G8WA 2KTQA 1S9GA 1QQCA 3TI0A 5HLFA 3ZSYA 1FK9A 4E7IA 4F8RA 3HP9A 3HVTA 1KLMA 3C95A 4M45A 3F73A 1QS4A 1B92A 3MXIA 3M8SA 1L3SA 1RDBA 5CYQA 4E19A 4NCAA 3O4QA 1JL2A 1Q9YA 4C8LA 4G1QA 1J53A 3AVLA 1C1CA 3AA3A 2IC3A 3SNNA 4ICLA 4CHYA 2GBZA 1LWCA 5KGWA 1EETA 3OYIA 1S6QA 1BISA 3OYBA 1JLAA 4BE1A 3SUNA 3AVIA 4N76A 3OYJA 1TL3A 2D5RA 3NF7A 3O3GA 1T03A 3LWMA 4HVJA 4NCGA 3AVMA 4Y1CA 3NF9A 4FLWA 3AVJA 2IOCA 1TAQA 4M3ZA 2HHXA 1KVBA 2RPIA 4O55A 1VSDA 1BCMA 4Z4GA 4Z4FA 4DTUA 4KPYA 1ASVA 3LANA 5DK5A 3OYGA 2HHSA 4PQUA 1RT5A 4DSIA 4FM2A 5CZ1A 1DTTA 4DFKA 4W5OA 1WAJA 3G0ZA 4J2AA 4M3YA 4FXDA 5KI6A 4L8RB 4QCLA 1NK7A 1UAXA 1QHTA 2VWJA 1SL2A 3SZ2A 5KRTA 1JXBA 2E4LA 1BI4B 4CIFA 1T05A 4N41A 3C6TA 3WNGA 1RT4A 1U04A 4MFBA 2IAJA 5C25A 2NUBA 3NF6A 1LWEA 1HQEA 3OJUA 4CEOA 1NOYA 2DY4A 3C94A 3RR8A 2B4JA 3ZSVA 4BE0A 4DFMA 1NK8A 1NK0A 3SV4A 5C24A 1ZBHA 3ZT2A 3ZSXA 1U48A 3OYMA 2DFEA 4RW4A 3LPUA 4CK3A 3WNHA 2EHGA 3VQBA 3OYCA 3OYAA 3NH1A 3MEEA 2DFHA 2JLEA 2VWKA 3L2UA 3O4NA 3MAQA 2QKBA 3RWUA 1Y97A 3VQAA 3DLHA 1HYZA 3KKRA 4CJTA 3AVKA 2OPPA 4KHNA 4CEQA 3KLHA 4FLUA 4B9NA 3KK2A 1XHXA 3VQ6A 4BDPA 3OJSA 4DTSA 4DLEA 3SPYA 1QE1A 4OVLA 3T19A 3QINA 1N5YA 2KQ2A 3CFRA 1O1WA 4CFBA 1C6VA 3L2RA 3RMDA 1EP4A 3SYZA 4O0IA 4B8CA 1JL1A 1XWLA 4CEDA 4RW9A 5HP1A 4CEEA 4IDKA 1IO2A 3IRXA 4AHSA 2XY7A 4OLBA 3TABA 1TGOA 5J1EA 1FXXA 3ITHA 2XHBA 1L3TA 3PO4A 3KD5E 1U47A 4HCBA 2PYJA 4I9QA 2F8SA 3TWHA 4JS5A 3QNNA 3ALYA 3KK1A 4CGHA 3AO5A 1MU2A 1SKSA 4Q0BA 4FJ8A 4DTJA 4DSEA 3SQ4A 1QTMA 2G8IA 3B6PA 4CEBA 4FLVA 1G15A 3NGZA 3OYFA 1NKCA 5HROA 2G8FA 1QSYA 2XY6A 3SUOA 4EP5A 4DQIA 4ELTA 3LZIA 4EP4A 1NJXA 3OYLA 2O4GA 2ZQBA 3RMBA 4CFAA 5I3UA 1T8EA 1LW0A 1VSJA 1CXUA 5DMRA 1RBSA 1S1XA 5HRSA 1XC9A 3OS2A 1J54A 1RBUA 2YHBA 1REVA 1VSLA 3VA3A 2OA8A 1XI1A 2D0BA 1KFSA 3JYTA 4ZTJA 1WSGA 4Z0UA 3PY8A 3NDKA 5CYMA 4XIUA 4DF4A 3RR7A 1W9HA 1S1WA 2A1SA 5CY4A 4B8AB 4CF8A 5KRSA 1L5UA 2HHVA 1TKXA 2VG7A 1WSFA 2ITGA 3QLHA 4KRFA 4KTZA 1UA0A 2XY8A 3ZSRA 2G8UA 4EZ6A 3AO2A 1IG9A 1BIUA 3PX4A 4FM1A 3KLFA 1WAFA 1EX4A 1LV5A 4HHTA 1BQNA 1RT6A 2E6MA 1IKWA 4KAZA 4I2QA 4AHUA 2YNHA 4BE2A 3DRSA 1YVUA 4J2EA 5SZTA 2E6LA 4DLGA 5EU7A 4H8KA 1VSKA 2X6NA 3ISNC 1R0AA 1CZBA 2Z1GA 1C0UA 2P5OA 2HHTA 2G8KA 3VQEA 1SL1A 3DM2A 3L2QA 3TAGA 1Q8IA 2PZSA 4C8NA 1U4BA 3HK2A 2RF2A 1IKYA 1VSIA 2QXFA 2YNFA 3CQ8A 4BDZA 4DG1A 3ASMA 2ZD1A 1JXEA 3QEVA 1TAUA 2VG6A 1RBRA 4KV8A 4CEZA 4FJIA 4RW7A 1TK5A 1KVAA 2P1JA 4RW6A 3K5NA 3S3NA 3NE6A 4Z4CA 4CEFA 4M42A 1ZBFA 3NCIA 3L8BA 4H4MA 2KZZA 3HPOA 2OYQA 3SUPA 3CG7A 3KIOA 3B6OA 4LSLA 4OPJA 4O44A 3KLGA 3TAEA 1RTIA 4CJ3A 4CERA 4WE1A 1KCFA 1IKXA 1BCOA 4NYNA 4E3SA 4CGIA 3U3YA 1DLOA 2ZE2A 4CHQA 3L2WA 4FJXA 2HVHA 2PYLA 1EXQA 1HPZA 1IKVA 3AO3A 3M8RA 4E7HA 1EKEA 3DMJA 1YTAA 3AVFA 3PX6A 1J5OA 4CJQA 4KHYA 3V6DA 2FBXA 4JLHA 3SUQA 2HB5A 4CFDA 3ZT1A 4DU4A 3SCXA 1SUQA 4JS4A 4KHQA 2G8VA 1A5XA 4DQRA 3AVAA 3VQ4A 3EYZA 4FLZA 3THVA 1JLBA 2GUIA 2VG5A 2YKMA 5HRPA 3NAEA 3TAMA 1HJRA 4O5BA 4OPKA 3S3MA 5JS1A 4FLTA 3ZT0A 1KRPA 1RCHA 4CJWA 4F4KA 3VQCA 5J2PA 3RRGA 3V9UA 4C8OA 2Q3SA 1S9EA 4I9LA 4E7JA 4DU3A 4BWJA 4FJ5A 3VQPA 3BGRA 4PA1A 3VQ5A 2B5JA 4B9SA 4KB1A 1B9FA 4DFPA 3AO4A 4TSXA 4QOZB 3VA0A 3QIOA 3TAQA 4FJLA 1HNVA 4NYFA 2YNGA 4M3RA 3TAPA 3OS0A 1QSLA 4J2DA 1ASWA 4N47A 4EZ9A 3TAFA 4CHOA 4DSFA 1Q9XA 3QERA 1U45A 4FW2A 4CJKA 4HUGA 2F8TA 4Z4HA 4C8MA 4AHCA 4IKFA 3HSTB 2WONA 3MEDA 4W5QA 4ID5A 2YNIA 2W42A 3RMCA 2OZSA 4CJEA 1XHZA 4FJ9A 3AVCA 3V1OA 3OY9A 1LAWA 1FKOA 1KSPA 2JGUA 1S6PA 5J2NA 5HRRA 4K8ZA 4PUOA 4KI6A 4KO0A 4M3XA 4NCBA 3RTVA 4JRQA 2KW4A 3ZCMA 3QETA 3QEPA 4C8KA 2HVIA 4KREA 2FBTA 3IS9A 4HUFA 1VSEA 3VQDA 3LDSA 3PX0A 3UIQA 3IAYA 4DSJA 3ZSQA 2GV9A 2YV0X 1JKHA 3EZ5A 4ID1A 3LZJA 4DU1A 3LALA 4JRPA 4OJRA 5CZ2A 1VRTA 1J9AA 2Z1HA 3NH2A 1GOCA 3V4IA 3KJVA 1BL3A 1RILA 1BI4A 4DQPA 2I5JA 3BDPA 3HO1A 2HHQA 3CFPA 4CJLA 4CFCA 4N56A 4M3TA 1TVRA 1NOZA 1JLCA 1X9SA 4FJMA 5E41A 1F21A 4FK0A 4F3OA 1WN7A 4FZYA 1L3VA 5KTQA 3AVGA 4FK4A 4LSNA 3KKSA 4LH4A 3LP2A 4LY7A 4Z4EA 1NK6A 4N5SA 3V9XA 2AJQA 1VSMA 4OGEA 3K5LA 1ZYQA 2RN2A 1LAVA 1D9FA 4DTMA 2KFZA 1SL0A 2P51A 5FRMA 1TKTA 1ASUA 3U6FA 3OYEA 2HMIA 4CHZA 4FJGA 4LD0A 3V9SA 4DSKA 3ZT4A 4CJSA 3S3OA 4W5NA 4CE9A 3V1RA 4FJNA 3ULDA 4DTPA 4KI4A 4ELVA 2D0AA 1UWBA 4Y1DA 4DQQA 4FM0A 3VQ8A 1I3AA 3OVNA 1VSFA 4E1MA 1RT2A 1CZ9A 4FYDA 4CCHA 3VQ9A 1LW2A 4CECA 2ETJA 4DTOA 3PV8A 1HYSA 4ZHRA 1D9DA 2BANA 4FCYA 4CJ4A 3VQQA 3SQ1A 1RTHA 1CXQA 4CHNA 3HP6A 3AO1A 3NGYA 3CM6A 3A2FA 4CIGA 5KGXA 4IFVA 2FBVA 2HHUA 2O4IA 4M41A 3NGIA 4R5PA 3DYAA 4OKKA 5SWMA 3JSMA 5FRNA 5JS2A 3L3UA 2D0CA 4PWDA 1K6YA 1NK5A 1RT3A 4IFYA 3SPZA 2RKIA 1WSEA 4CEAA 4CK2A 2F96A 4CJVA 4DMNA 4FVMA 1C0TA 1W0HA 3E01A 3AA2A 4CJPA 1JLEA 4CF1A 3OYNA 4FLXA 3SQ0A 2IS3A 1SKWA 4F2SA 3H08A 2HHWA 1VK0A 3I0RA 4QAGA 3ZT3A 4CK1A 3C6UA 2XO7A 2ATQA 3O3FA 4W5TA 3MXMA 1NK4A 4KKOA 2FC0A 3M8PA 3K5OA 1SKRA 4B3OA 3HPHA 2X74A 3K58A 4M3WA 4ELUA 4J2BA 3HXMA 3NH0A 4FJHA 4KTQA 5J2QA 3DOLA 1WLJA 1TK0A 1T7PA 4CGGA 3HT3A 3OS1A 4E7LA 3D45A 4O4GA 4CESA 1UA1A 4B9LA 3KK3A 4CF9A 5D3GA 1Z25A 4OKJA 1B9DA 4FK2A 3DLGA 1D8YA 3SQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1G A;  3OYK A;  4DQS A;  3TAR A;  4ZTF A;  3KTQ A;  3KLE A;  2R7Y A;  2OPS A;  1HRH A;  1N6Q A;  4DSL A;  2A1R A;  4FLY A;  1VRU A;  4GMJ B;  4CGD A;  4KFB A;  4UQG A;  3NBP A;  4DF8 A;  3HL8 A;  1HMV A;  1RDD A;  1X1P A;  3VN5 A;  3WNE A;  1KLN A;  5K14 A;  1U49 A;  2BE2 A;  4CIE A;  4GW6 A;  1JLF A;  3DLB A;  4K8X A;  4KHW A;  3HVR A;  3LWL A;  1D5A A;  4IG3 A;  4E0D A;  4IBN A;  4B9T A;  3G10 A;  3HPG A;  1SV5 A;  3QIP A;  4MQ3 A;  4CF0 A;  4E7K A;  2X78 A;  1TKD A;  3P83 D;  4GVM A;  2KFN A;  2IDO A;  4O0J A;  2HNZ A;  4BWM A;  1RDC A;  3K2P A;  3OYH A;  3V9Z A;  4DTN A;  3SJJ A;  1RTJ A;  3LAK A;  1QSS A;  4YFU A;  4DS4 A;  4CF2 A;  4B9U A;  4FZZ A;  3AVN A;  5HRN A;  3F9K A;  4B9V A;  3KD1 E;  1GOB A;  3LP0 A;  3K59 A;  1NK9 A;  1HQU A;  1HNI A;  3M8Q A;  1DTQ A;  1YT3 A;  4AHR A;  2HND A;  1RTD A;  1RT7 A;  4FW1 A;  3QEX A;  3RRH A;  4IG0 A;  3CYM A;  5J2M A;  3ZSO A;  4HCC A;  4BDY A;  4DTR A;  4E89 A;  5C42 A;  3SV3 A;  4OGC A;  1IH7 A;  2BGG A;  3D0P A;  2Z1I A;  4Z4I A;  2HW3 A;  3CFO A;  1GOA A;  1BGX T;  1BHL A;  2XRI A;  1LWF A;  1NJW A;  1TK8 A;  4KB0 A;  4KHU A;  4AIL C;  2Y1J A;  2DFF A;  2IGI A;  3I0S A;  2X6S A;  3CM5 A;  4RG8 A;  3EY1 A;  1WSJ A;  2BDP A;  4CJU A;  1KVC A;  1ITG A;  1Z26 A;  3QNO A;  4KTW A;  3L2V A;  4DS5 A;  3S9H A;  1A5V A;  1YTU A;  3AA5 X;  3PUF A;  1RBV A;  4CGF A;  4AH9 A;  3NFA A;  2LSN A;  2B6A A;  3ZSW A;  4E1N A;  3K57 A;  3TAN A;  1BQM A;  2QKK A;  4M3U A;  4RW8 A;  2EX3 A;  2FBY A;  4F2R A;  4YNQ A;  3HM9 A;  5FDL A;  3I8D A;  4CJR A;  1C1B A;  1HYV A;  4FZX C;  3L3V A;  1C1A A;  1S1T A;  2WOM A;  3T1A A;  3LP3 A;  3MEC A;  3P5J A;  3DLR A;  4OKE A;  1TKZ A;  4LH5 A;  3AVB A;  4AHV A;  1JLQ A;  3DLE A;  2P5G A;  1A5W A;  3DI6 A;  1ZBI A;  3V9W A;  4HTU A;  5FRO A;  3MXJ A;  3V81 A;  1WNS A;  4B08 A;  3PO5 A;  2KZM A;  2XY5 A;  2PY5 A;  4FJK A;  5I42 A;  3LAM A;  2OZM A;  4DTX A;  1BIZ A;  1TL1 A;  3RMA A;  1C0M A;  3LP1 A;  3U3G A;  1X9W A;  3AVH A;  2OPQ A;  1L3U A;  2QK9 A;  1X9M A;  4AHT A;  1RT1 A;  1ZBU A;  5HBM A;  1I39 A;  1KFD A;  1NJZ A;  3AV9 A;  2YHA A;  4Q5V A;  3O3H A;  2HNY A;  3SI6 A;  3ZSZ A;  3V1Q A;  3DRR A;  4CHP A;  3OYD A;  3NHG A;  3DLK A;  1RNH A;  3QO9 A;  1S5J A;  1KTQ A;  4DWI A;  1NJY A;  4OLA A;  3FFI A;  4B9M A;  5T7B A;  1VSH A;  4DFJ A;  3HJF A;  1TV6 A;  3LPT A;  1S1V A;  1WSI A;  3WNF A;  2YKN A;  3DOK A;  3IG1 A;  3TR8 A;  3QES A;  4W5R A;  1ZBL A;  3DRP A;  2Y1I A;  4PY5 A;  2Z1J A;  3AA4 A;  3KLI A;  4I7F A;  4FJ7 A;  3MEG A;  4CJF A;  3QEI A;  4HUE A;  1JLG A;  4I2P A;  3VQ7 A;  2OPR A;  4CGJ A;  3QEW A;  2DTU A;  3HYF A;  4KHS A;  4F3T A;  4BAC A;  4H4O A;  1S1U A;  1CLQ A;  1RDA A;  1UOC A;  3K5M A;  2G8H A;  4FJJ A;  1NKB A;  3T3F A;  1FKP A;  4CJ5 A;  1WSH A;  3NF8 A;  1NKE A;  1RBT A;  2G8W A;  2KTQ A;  1S9G A;  1QQC A;  3TI0 A;  5HLF A;  3ZSY A;  1FK9 A;  4E7I A;  4F8R A;  3HP9 A;  3HVT A;  1KLM A;  3C95 A;  4M45 A;  3F73 A;  1QS4 A;  1B92 A;  3MXI A;  3M8S A;  1L3S A;  1RDB A;  5CYQ A;  4E19 A;  4NCA A;  3O4Q A;  1JL2 A;  1Q9Y A;  4C8L A;  4G1Q A;  1J53 A;  3AVL A;  1C1C A;  3AA3 A;  2IC3 A;  3SNN A;  4ICL A;  4CHY A;  2GBZ A;  1LWC A;  5KGW A;  1EET A;  3OYI A;  1S6Q A;  1BIS A;  3OYB A;  1JLA A;  4BE1 A;  3SUN A;  3AVI A;  4N76 A;  3OYJ A;  1TL3 A;  2D5R A;  3NF7 A;  3O3G A;  1T03 A;  3LWM A;  4HVJ A;  4NCG A;  3AVM A;  4Y1C A;  3NF9 A;  4FLW A;  3AVJ A;  2IOC A;  1TAQ A;  4M3Z A;  2HHX A;  1KVB A;  2RPI A;  4O55 A;  1VSD A;  1BCM A;  4Z4G A;  4Z4F A;  4DTU A;  4KPY A;  1ASV A;  3LAN A;  5DK5 A;  3OYG A;  2HHS A;  4PQU A;  1RT5 A;  4DSI A;  4FM2 A;  5CZ1 A;  1DTT A;  4DFK A;  4W5O A;  1WAJ A;  3G0Z A;  4J2A A;  4M3Y A;  4FXD A;  5KI6 A;  4L8R B;  4QCL A;  1NK7 A;  1UAX A;  1QHT A;  2VWJ A;  1SL2 A;  3SZ2 A;  5KRT A;  1JXB A;  2E4L A;  1BI4 B;  4CIF A;  1T05 A;  4N41 A;  3C6T A;  3WNG A;  1RT4 A;  1U04 A;  4MFB A;  2IAJ A;  5C25 A;  2NUB A;  3NF6 A;  1LWE A;  1HQE A;  3OJU A;  4CEO A;  1NOY A;  2DY4 A;  3C94 A;  3RR8 A;  2B4J A;  3ZSV A;  4BE0 A;  4DFM A;  1NK8 A;  1NK0 A;  3SV4 A;  5C24 A;  1ZBH A;  3ZT2 A;  3ZSX A;  1U48 A;  3OYM A;  2DFE A;  4RW4 A;  3LPU A;  4CK3 A;  3WNH A;  2EHG A;  3VQB A;  3OYC A;  3OYA A;  3NH1 A;  3MEE A;  2DFH A;  2JLE A;  2VWK A;  3L2U A;  3O4N A;  3MAQ A;  2QKB A;  3RWU A;  1Y97 A;  3VQA A;  3DLH A;  1HYZ A;  3KKR A;  4CJT A;  3AVK A;  2OPP A;  4KHN A;  4CEQ A;  3KLH A;  4FLU A;  4B9N A;  3KK2 A;  1XHX A;  3VQ6 A;  4BDP A;  3OJS A;  4DTS A;  4DLE A;  3SPY A;  1QE1 A;  4OVL A;  3T19 A;  3QIN A;  1N5Y A;  2KQ2 A;  3CFR A;  1O1W A;  4CFB A;  1C6V A;  3L2R A;  3RMD A;  1EP4 A;  3SYZ A;  4O0I A;  4B8C A;  1JL1 A;  1XWL A;  4CED A;  4RW9 A;  5HP1 A;  4CEE A;  4IDK A;  1IO2 A;  3IRX A;  4AHS A;  2XY7 A;  4OLB A;  3TAB A;  1TGO A;  5J1E A;  1FXX A;  3ITH A;  2XHB A;  1L3T A;  3PO4 A;  3KD5 E;  1U47 A;  4HCB A;  2PYJ A;  4I9Q A;  2F8S A;  3TWH A;  4JS5 A;  3QNN A;  3ALY A;  3KK1 A;  4CGH A;  3AO5 A;  1MU2 A;  1SKS A;  4Q0B A;  4FJ8 A;  4DTJ A;  4DSE A;  3SQ4 A;  1QTM A;  2G8I A;  3B6P A;  4CEB A;  4FLV A;  1G15 A;  3NGZ A;  3OYF A;  1NKC A;  5HRO A;  2G8F A;  1QSY A;  2XY6 A;  3SUO A;  4EP5 A;  4DQI A;  4ELT A;  3LZI A;  4EP4 A;  1NJX A;  3OYL A;  2O4G A;  2ZQB A;  3RMB A;  4CFA A;  5I3U A;  1T8E A;  1LW0 A;  1VSJ A;  1CXU A;  5DMR A;  1RBS A;  1S1X A;  5HRS A;  1XC9 A;  3OS2 A;  1J54 A;  1RBU A;  2YHB A;  1REV A;  1VSL A;  3VA3 A;  2OA8 A;  1XI1 A;  2D0B A;  1KFS A;  3JYT A;  4ZTJ A;  1WSG A;  4Z0U A;  3PY8 A;  3NDK A;  5CYM A;  4XIU A;  4DF4 A;  3RR7 A;  1W9H A;  1S1W A;  2A1S A;  5CY4 A;  4B8A B;  4CF8 A;  5KRS A;  1L5U A;  2HHV A;  1TKX A;  2VG7 A;  1WSF A;  2ITG A;  3QLH A;  4KRF A;  4KTZ A;  1UA0 A;  2XY8 A;  3ZSR A;  2G8U A;  4EZ6 A;  3AO2 A;  1IG9 A;  1BIU A;  3PX4 A;  4FM1 A;  3KLF A;  1WAF A;  1EX4 A;  1LV5 A;  4HHT A;  1BQN A;  1RT6 A;  2E6M A;  1IKW A;  4KAZ A;  4I2Q A;  4AHU A;  2YNH A;  4BE2 A;  3DRS A;  1YVU A;  4J2E A;  5SZT A;  2E6L A;  4DLG A;  5EU7 A;  4H8K A;  1VSK A;  2X6N A;  3ISN C;  1R0A A;  1CZB A;  2Z1G A;  1C0U A;  2P5O A;  2HHT A;  2G8K A;  3VQE A;  1SL1 A;  3DM2 A;  3L2Q A;  3TAG A;  1Q8I A;  2PZS A;  4C8N A;  1U4B A;  3HK2 A;  2RF2 A;  1IKY A;  1VSI A;  2QXF A;  2YNF A;  3CQ8 A;  4BDZ A;  4DG1 A;  3ASM A;  2ZD1 A;  1JXE A;  3QEV A;  1TAU A;  2VG6 A;  1RBR A;  4KV8 A;  4CEZ A;  4FJI A;  4RW7 A;  1TK5 A;  1KVA A;  2P1J A;  4RW6 A;  3K5N A;  3S3N A;  3NE6 A;  4Z4C A;  4CEF A;  4M42 A;  1ZBF A;  3NCI A;  3L8B A;  4H4M A;  2KZZ A;  3HPO A;  2OYQ A;  3SUP A;  3CG7 A;  3KIO A;  3B6O A;  4LSL A;  4OPJ A;  4O44 A;  3KLG A;  3TAE A;  1RTI A;  4CJ3 A;  4CER A;  4WE1 A;  1KCF A;  1IKX A;  1BCO A;  4NYN A;  4E3S A;  4CGI A;  3U3Y A;  1DLO A;  2ZE2 A;  4CHQ A;  3L2W A;  4FJX A;  2HVH A;  2PYL A;  1EXQ A;  1HPZ A;  1IKV A;  3AO3 A;  3M8R A;  4E7H A;  1EKE A;  3DMJ A;  1YTA A;  3AVF A;  3PX6 A;  1J5O A;  4CJQ A;  4KHY A;  3V6D A;  2FBX A;  4JLH A;  3SUQ A;  2HB5 A;  4CFD A;  3ZT1 A;  4DU4 A;  3SCX A;  1SUQ A;  4JS4 A;  4KHQ A;  2G8V A;  1A5X A;  4DQR A;  3AVA A;  3VQ4 A;  3EYZ A;  4FLZ A;  3THV A;  1JLB A;  2GUI A;  2VG5 A;  2YKM A;  5HRP A;  3NAE A;  3TAM A;  1HJR A;  4O5B A;  4OPK A;  3S3M A;  5JS1 A;  4FLT A;  3ZT0 A;  1KRP A;  1RCH A;  4CJW A;  4F4K A;  3VQC A;  5J2P A;  3RRG A;  3V9U A;  4C8O A;  2Q3S A;  1S9E A;  4I9L A;  4E7J A;  4DU3 A;  4BWJ A;  4FJ5 A;  3VQP A;  3BGR A;  4PA1 A;  3VQ5 A;  2B5J A;  4B9S A;  4KB1 A;  1B9F A;  4DFP A;  3AO4 A;  4TSX A;  4QOZ B;  3VA0 A;  3QIO A;  3TAQ A;  4FJL A;  1HNV A;  4NYF A;  2YNG A;  4M3R A;  3TAP A;  3OS0 A;  1QSL A;  4J2D A;  1ASW A;  4N47 A;  4EZ9 A;  3TAF A;  4CHO A;  4DSF A;  1Q9X A;  3QER A;  1U45 A;  4FW2 A;  4CJK A;  4HUG A;  2F8T A;  4Z4H A;  4C8M A;  4AHC A;  4IKF A;  3HST B;  2WON A;  3MED A;  4W5Q A;  4ID5 A;  2YNI A;  2W42 A;  3RMC A;  2OZS A;  4CJE A;  1XHZ A;  4FJ9 A;  3AVC A;  3V1O A;  3OY9 A;  1LAW A;  1FKO A;  1KSP A;  2JGU A;  1S6P A;  5J2N A;  5HRR A;  4K8Z A;  4PUO A;  4KI6 A;  4KO0 A;  4M3X A;  4NCB A;  3RTV A;  4JRQ A;  2KW4 A;  3ZCM A;  3QET A;  3QEP A;  4C8K A;  2HVI A;  4KRE A;  2FBT A;  3IS9 A;  4HUF A;  1VSE A;  3VQD A;  3LDS A;  3PX0 A;  3UIQ A;  3IAY A;  4DSJ A;  3ZSQ A;  2GV9 A;  2YV0 X;  1JKH A;  3EZ5 A;  4ID1 A;  3LZJ A;  4DU1 A;  3LAL A;  4JRP A;  4OJR A;  5CZ2 A;  1VRT A;  1J9A A;  2Z1H A;  3NH2 A;  1GOC A;  3V4I A;  3KJV A;  1BL3 A;  1RIL A;  1BI4 A;  4DQP A;  2I5J A;  3BDP A;  3HO1 A;  2HHQ A;  3CFP A;  4CJL A;  4CFC A;  4N56 A;  4M3T A;  1TVR A;  1NOZ A;  1JLC A;  1X9S A;  4FJM A;  5E41 A;  1F21 A;  4FK0 A;  4F3O A;  1WN7 A;  4FZY A;  1L3V A;  5KTQ A;  3AVG A;  4FK4 A;  4LSN A;  3KKS A;  4LH4 A;  3LP2 A;  4LY7 A;  4Z4E A;  1NK6 A;  4N5S A;  3V9X A;  2AJQ A;  1VSM A;  4OGE A;  3K5L A;  1ZYQ A;  2RN2 A;  1LAV A;  1D9F A;  4DTM A;  2KFZ A;  1SL0 A;  2P51 A;  5FRM A;  1TKT A;  1ASU A;  3U6F A;  3OYE A;  2HMI A;  4CHZ A;  4FJG A;  4LD0 A;  3V9S A;  4DSK A;  3ZT4 A;  4CJS A;  3S3O A;  4W5N A;  4CE9 A;  3V1R A;  4FJN A;  3ULD A;  4DTP A;  4KI4 A;  4ELV A;  2D0A A;  1UWB A;  4Y1D A;  4DQQ A;  4FM0 A;  3VQ8 A;  1I3A A;  3OVN A;  1VSF A;  4E1M A;  1RT2 A;  1CZ9 A;  4FYD A;  4CCH A;  3VQ9 A;  1LW2 A;  4CEC A;  2ETJ A;  4DTO A;  3PV8 A;  1HYS A;  4ZHR A;  1D9D A;  2BAN A;  4FCY A;  4CJ4 A;  3VQQ A;  3SQ1 A;  1RTH A;  1CXQ A;  4CHN A;  3HP6 A;  3AO1 A;  3NGY A;  3CM6 A;  3A2F A;  4CIG A;  5KGX A;  4IFV A;  2FBV A;  2HHU A;  2O4I A;  4M41 A;  3NGI A;  4R5P A;  3DYA A;  4OKK A;  5SWM A;  3JSM A;  5FRN A;  5JS2 A;  3L3U A;  2D0C A;  4PWD A;  1K6Y A;  1NK5 A;  1RT3 A;  4IFY A;  3SPZ A;  2RKI A;  1WSE A;  4CEA A;  4CK2 A;  2F96 A;  4CJV A;  4DMN A;  4FVM A;  1C0T A;  1W0H A;  3E01 A;  3AA2 A;  4CJP A;  1JLE A;  4CF1 A;  3OYN A;  4FLX A;  3SQ0 A;  2IS3 A;  1SKW A;  4F2S A;  3H08 A;  2HHW A;  1VK0 A;  3I0R A;  4QAG A;  3ZT3 A;  4CK1 A;  3C6U A;  2XO7 A;  2ATQ A;  3O3F A;  4W5T A;  3MXM A;  1NK4 A;  4KKO A;  2FC0 A;  3M8P A;  3K5O A;  1SKR A;  4B3O A;  3HPH A;  2X74 A;  3K58 A;  4M3W A;  4ELU A;  4J2B A;  3HXM A;  3NH0 A;  4FJH A;  4KTQ A;  5J2Q A;  3DOL A;  1WLJ A;  1TK0 A;  1T7P A;  4CGG A;  3HT3 A;  3OS1 A;  4E7L A;  3D45 A;  4O4G A;  4CES A;  1UA1 A;  4B9L A;  3KK3 A;  4CF9 A;  5D3G A;  1Z25 A;  4OKJ A;  1B9D A;  4FK2 A;  3DLG A;  1D8Y A;  3SQ2 A; 
#chains in the Genus database with same CATH topology
 3AGK A;  4B3R K;  3P1G A;  3TAR A;  4DQS A;  2WBN A;  2Q0U A;  1HRH A;  3OHR A;  4KFB A;  3HL8 A;  1X1P A;  1KLN A;  2V51 B;  2P9K B;  1KAX A;  4IG3 A;  4IBN A;  4B9T A;  3HPG A;  2HOE A;  1E4G T;  4CF0 A;  3ZYY X;  1TKD A;  3P83 D;  3F9M A;  4GVE A;  1NGH A;  4BWM A;  3K2P A;  4DTN A;  3V9Z A;  3BZC A;  4BRP A;  1QSS A;  4H5N A;  1GOB A;  5GAE P;  1OVQ A;  3K59 A;  1HQU A;  3M8Q A;  1DTQ A;  5C12 A;  5FPM A;  4K43 A;  1IH7 A;  4BC5 A;  3D0P A;  4Z4I A;  3J7Z O;  1VQO N;  3ULE A;  1RFQ A;  1ATR A;  4DV2 K;  5MLC Q;  1S3X A;  3CD6 N;  3HTV A;  2DFF A;  4EIA A;  3VEY A;  3CM5 A;  4IDH A;  2Q0R A;  2BDP A;  5LJW A;  2Q97 A;  4AM7 A;  3QNO A;  4V19 S;  5C15 A;  4DS5 A;  4CZE A;  3E9O A;  1RBV A;  4M7X A;  2LSN A;  2B6A A;  4E1N A;  3K57 A;  4RW8 A;  3ZX0 A;  4H03 B;  1JCF A;  2WOM A;  1EO1 A;  3BUZ B;  3MEC A;  3CCQ N;  4OKE A;  4WFA L;  1TKZ A;  4LH5 A;  5FPD A;  4AHV A;  1JLQ A;  1NGF A;  3DI6 A;  5HL7 L;  3PO5 A;  2PY5 A;  4DTX A;  1TL1 A;  1TUY A;  3U3G A;  1L3U A;  3K0S A;  4AHT A;  3VES A;  5GIN A;  2GTD A;  4JYA K;  3GBT A;  3NHG A;  3V1Q A;  3CI5 A;  1RNH A;  1S5J A;  3R1X A;  4BR0 A;  4IJA A;  4DFJ A;  1TV6 A;  1KD1 O;  3WNF A;  1HNZ K;  1VQ6 N;  3IG1 A;  3QES A;  2Y1I A;  2Z1J A;  5M1K A;  3AA4 A;  3IKM A;  3KLI A;  3MEG A;  4HUE A;  1JLG A;  5AQO A;  2FXU A;  4I2P A;  3VQ7 A;  5LL6 Z;  4CBX A;  1OKJ A;  4H4O A;  4CZM A;  4CVN E;  3K5M A;  2G8H A;  4FJJ A;  1NKE A;  1FKP A;  4CJ5 A;  1RBT A;  2HBK A;  1N34 K;  4OX9 K;  3CPE A;  4F8R A;  3U9D A;  3SK3 A;  3C95 A;  1VQK N;  3ZLJ A;  1LCU A;  1B92 A;  4E1J A;  3M8S A;  1RGI A;  4C8L A;  4G1Q A;  1J53 A;  4FSV A;  1C1C A;  5FLX O;  1LWC A;  3E1Y A;  2BTF A;  3OYB A;  4BQL A;  2E2O A;  2J4R A;  4L3Q A;  3HZ6 A;  3SAF A;  1GLF O;  4Y1C A;  5C2F A;  3AVJ A;  3WUH A;  4DB3 A;  4BVP A;  1VQ7 N;  1BCM A;  4JKG A;  4Z4G A;  3IFR A;  3LAN A;  1BO5 O;  3I56 N;  3VEV A;  4PQU A;  1RT5 A;  4KBO A;  4DSI A;  4BVO A;  4W5O A;  1WAJ A;  4J2A A;  4QCL A;  4L8R B;  1NK7 A;  1UAX A;  1QHT A;  5KRT A;  2O8F A;  2E4L A;  2ZM6 K;  3WNG A;  5C25 A;  3OJU A;  4CEO A;  3IMX A;  2O8B B;  1NK0 A;  3SV4 A;  4BR7 A;  5AFU A;  2DFE A;  3LPU A;  4IJN A;  3OYC A;  5AQY A;  3MEE A;  2JLE A;  4ISG A;  3KKR A;  4CJT A;  3D7E O;  4KHN A;  3KLH A;  2NRZ A;  4FLU A;  1YUW A;  4IEI A;  5AFU H;  3UKR A;  4DTS A;  5A2Q O;  3SPY A;  1N5Y A;  4CFB A;  3RMD A;  3SYZ A;  4CEE A;  3ENH A;  5J1E A;  5GIO A;  3ITH A;  4PL7 A;  3CCS N;  1U47 A;  3THX B;  4JS5 A;  3QNN A;  4WQ4 A;  4CJ7 A;  4DSE A;  2ASO A;  1S72 N;  1NKC A;  1T3V A;  3NGZ A;  3HO1 A;  5HRO A;  2XY6 A;  3J80 O;  5DM7 L;  3IUC A;  3RMB A;  1IV0 A;  5AQM A;  3WXK A;  1LW0 A;  1NNE A;  1MWK A;  1VSJ A;  4KH6 A;  1CXU A;  4A61 A;  5HRS A;  1XC9 A;  3WEE B;  3MX2 A;  1J54 A;  4EHT A;  2YHB A;  1REV A;  1VSL A;  2OA8 A;  4ZTJ A;  3VEZ A;  3KWI A;  4DF4 A;  1EWQ A;  1EWR A;  1S1W A;  4B8A B;  4CF8 A;  4B1U B;  2ZGY A;  4KTZ A;  3ZSR A;  1NGJ A;  1C0F A;  2YHX A;  4O8K A;  3VOV A;  4KAZ A;  5AQH A;  2E6M A;  1OH7 A;  4A62 A;  2NNW A;  4IOA L;  1CZB A;  2Z1G A;  1C0U A;  2P5O A;  3VQE A;  3CC7 N;  3L2Q A;  1Q8I A;  1IKY A;  2YNF A;  2UXB K;  2GEM A;  2VG6 A;  4CEZ A;  3VMF B;  3H1V X;  3S3N A;  3NE6 A;  2KZZ A;  3SUP A;  4OPJ A;  1W97 L;  5JMV A;  3EKS A;  4NXM K;  1RTI A;  3DAW A;  1E3M A;  1DLO A;  2ZE2 A;  5M1P A;  2PYL A;  1HPZ A;  3M8R A;  3PX6 A;  3AVF A;  5BPM A;  5KQ8 A;  2DPN A;  4CJQ A;  2FBX A;  1YJN N;  3QBW A;  4DU4 A;  3FZM A;  4CZG A;  1BG3 A;  1GLD G;  4DQR A;  3W0L A;  3VQ4 A;  4DR7 K;  2YKM A;  3EE8 A;  5HRP A;  4OPK A;  3NAE A;  3S3M A;  1N32 K;  1NGE A;  4FLT A;  3ZT0 A;  1KRP A;  4MDB A;  4PA1 A;  4XEI A;  4KB1 A;  3J81 O;  3TAQ A;  4FJL A;  4MO4 A;  4NYF A;  4DHY A;  3OS0 A;  4J2D A;  4CHO A;  1Q9X A;  1QHA A;  3A5O C;  4DV5 K;  4KHP K;  4HUG A;  4B1V A;  4FWL A;  4W5Q A;  2W42 A;  3FLC O;  3WQT A;  3Q7C A;  3OY9 A;  2A42 A;  2QWN A;  4LF7 K;  5AZJ B;  1S6P A;  5J2N A;  5TKY A;  4K8Z A;  3H3O B;  4NCB A;  3PSF A;  1HLU A;  2KW4 A;  4JRQ A;  4AM6 A;  3AAQ A;  3PX0 A;  4HUF A;  3PLA A;  2HBJ A;  3UIQ A;  3IAY A;  5AQQ A;  2GV9 A;  3S41 A;  4JRP A;  4OJR A;  1XNR K;  1VRT A;  3THW A;  5BN8 A;  2JWK A;  3KJV A;  1RIL A;  1K8A O;  3VET A;  5DM6 L;  3BDP A;  4N56 A;  4M3T A;  3QFP A;  4DV1 K;  1WN7 A;  4FZY A;  1L3V A;  1GLL O;  4LH4 A;  3E9L A;  4N5S A;  3GDQ A;  4JKF A;  1SL0 A;  3O9R A;  1J5E K;  2P51 A;  5FRM A;  3U6F A;  3CJC A;  4FJG A;  4IFE A;  3V9S A;  2ZJP L;  4JK7 A;  4CJS A;  4JI3 K;  1X9J A;  4CE9 A;  4FJN A;  4DTP A;  4IWV A;  4Y1D A;  4IO9 L;  4DQQ A;  3NMU A;  1RT2 A;  4FYD A;  1SAZ A;  3ATV A;  1D9D A;  3VF2 A;  4CJ4 A;  5B8H A;  4CHN A;  2Q31 A;  2E2Q A;  4BGA A;  3THX A;  5KGX A;  3MMV A;  4IFV A;  2O4I A;  3CCV N;  3A5M C;  1K6Y A;  4IFY A;  2RKI A;  1WSE A;  4CK2 A;  4CJV A;  1C0T A;  4FJ5 A;  3AA2 A;  1SKW A;  3CME N;  2IS3 A;  3TPQ A;  1U2V B;  5AQG A;  3ZT3 A;  4WFN L;  2NRH A;  2XO7 A;  4WQ4 C;  3WEE A;  3MXM A;  2Q2R A;  1NK4 A;  2P9I B;  4B3O A;  2X74 A;  4IXC A;  3HXM A;  1KC8 O;  1XUP O;  4KTQ A;  3CHW A;  1TK0 A;  3DWL A;  4GKJ K;  1OVY A;  3I8B A;  4CGG A;  3OS1 A;  4BRL A;  3HT3 A;  4O4G A;  4E7L A;  3O5B A;  3KK3 A;  3ID6 A;  3LDQ A;  2W40 A;  4A2A A;  3KLE A;  4GV9 A;  4FWQ A;  4NXN K;  2NRV A;  4FLY A;  1VRU A;  4GMJ B;  4CGD A;  4DF8 A;  3WNE A;  1HMV A;  1RDD A;  1H1V A;  3WQU A;  3DLB A;  4KHW A;  3HVR A;  3G10 A;  2O8E A;  1SV5 A;  4MQ3 A;  4FOE A;  2X78 A;  3WT0 A;  2ZJQ L;  1GLC G;  2HNZ A;  3LAK A;  4B9U A;  4B9V A;  3EEQ A;  4NB4 A;  3KD1 E;  1HNI A;  4AHR A;  1YT3 A;  1RTD A;  3EN9 A;  4BRD A;  3QEX A;  4IG0 A;  4HCC A;  4E89 A;  2WTU A;  3CF5 L;  1YJ9 N;  2Z1I A;  3CFO A;  2YJE A;  1BGX T;  2XRI A;  1LWF A;  3PSI A;  4KB0 A;  4AIL C;  2Y1J A;  3CC4 N;  3D2F A;  3I0S A;  4KTW A;  3L2V A;  2P9P A;  3S9H A;  1A5V A;  2D0O A;  3AA5 X;  2YCH A;  4M3U A;  3D2E B;  2QKK A;  1BQM A;  3U9Z A;  2FBY A;  3HM9 A;  5FDL A;  2QWM A;  3P31 A;  2H3G X;  3T1A A;  4LF5 K;  4PL8 A;  3AAP A;  4JHD A;  1YF5 L;  4ILH A;  3SBT A;  3C65 A;  4JV5 K;  3DLR A;  2P9U B;  3AVB A;  1ZBI A;  4FWP A;  1VAZ A;  3V9W A;  4HTU A;  2ZWH A;  3MXJ A;  1BOT O;  3V81 A;  4CZL A;  4CZK A;  5EXW A;  3E66 A;  4FJK A;  3LAM A;  1IJJ A;  1BIZ A;  3LP1 A;  4JN4 A;  3H3N O;  3AVH A;  2NRW A;  3FGU A;  1I39 A;  2VQE K;  2QTD A;  2F9T A;  4GKK K;  3O4W A;  3AV9 A;  2WC9 A;  4A5B A;  3O3H A;  3SI6 A;  3ZSZ A;  3W3D A;  3L4I A;  3DLK A;  3QO9 A;  5AZJ A;  2W6L A;  1NJY A;  4OLA A;  5T7B A;  1U6Z A;  2QWR A;  3M3Z A;  5AQS A;  4DKW A;  1WSI A;  5KPZ A;  3DOK A;  3CJB A;  4ISF A;  1YIT N;  4H5T A;  3QEI A;  1KAZ A;  4A2B A;  4CGJ A;  3QEW A;  3HYF A;  4BAC A;  2GWK A;  1RDA A;  3T3F A;  1GLE G;  5HLF A;  3HP9 A;  2P9S B;  4M45 A;  1QS4 A;  1L3S A;  5LMU K;  2ZF5 O;  3VGM A;  1JL2 A;  3HOT A;  4FWM A;  4LF8 K;  2IC3 A;  2VGN A;  4ICL A;  4CHY A;  5KGW A;  1EET A;  3OYI A;  3SUN A;  3AVI A;  4KH5 A;  4UY8 O;  2P9L B;  5AQU A;  3NF9 A;  1TAQ A;  5CHI A;  2YI1 A;  2HHX A;  2RPI A;  1VSD A;  3DJC A;  4K25 A;  4JI2 K;  3G0Z A;  3SMP A;  4FXD A;  5KI6 A;  1K8K B;  1NGD A;  4BRE A;  2VWJ A;  1C0G A;  3EE9 A;  1BI4 B;  4CIF A;  3ENO A;  4BRO A;  1RT4 A;  1ZXO A;  1U04 A;  4MFB A;  4JI1 K;  1QVG M;  2DY4 A;  3NF6 A;  1LWE A;  1HQE A;  4BRK A;  3C94 A;  2B4J A;  3ZSV A;  1U2V A;  1NK8 A;  2KKZ A;  1Z05 A;  3ZT2 A;  1YI2 N;  3FZH A;  3L0Q A;  2P9I A;  1GLA G;  2EHG A;  3VQB A;  3CC2 N;  2DFH A;  5ELZ A;  3O4N A;  1WB9 A;  1YVN A;  1Y97 A;  3RWU A;  3AVK A;  2OPP A;  3QDK A;  4JD2 B;  4B9N A;  4BDP A;  5E26 A;  3VEX A;  4DLE A;  1TYQ A;  3T19 A;  3G4S N;  2BH1 A;  1Q81 O;  1C6V A;  4CED A;  3SJH A;  4IDK A;  3O6W A;  3ZET B;  3TAB A;  3OTO K;  1FXX A;  3PO4 A;  4I9Q A;  4F9O A;  2PYJ A;  3GL1 A;  3KZB A;  4Q0B A;  1MU2 A;  5BRF A;  2G8I A;  4DTJ A;  3SQ4 A;  1XQS C;  1G15 A;  4H0X B;  3OYF A;  4OPH A;  5AQZ A;  1QSY A;  2GWJ A;  2O4G A;  4CFA A;  1XNQ K;  3O9T A;  1HNW K;  4CBW A;  3OS2 A;  2GUP A;  2OCE A;  1WSG A;  4Z0U A;  3NDK A;  5CYM A;  2UUA K;  4JI5 K;  2P9N B;  2VG7 A;  3EZW A;  5AQX A;  3DXK B;  4YOU A;  3AO2 A;  1IG9 A;  3PX4 A;  4FM1 A;  2YX6 A;  1WAF A;  3KLF A;  1LV5 A;  4HHT A;  1BQN A;  1IKW A;  4I2Q A;  2IVN A;  4AHU A;  4DR3 K;  1YVU A;  2E6L A;  3D2E A;  4YY3 K;  3H1Q A;  3CCU N;  2X6N A;  3ISN C;  4NLB A;  1R0A A;  5M1N A;  2G8K A;  3R6M A;  5BPN A;  3ATU A;  3EKU A;  3TAG A;  3CQ8 A;  1YHQ N;  4YHH K;  2P9U A;  3LDN A;  2W41 A;  1JXE A;  1TAU A;  1VQP N;  1KVA A;  3K5N A;  1X3M A;  4FWN A;  4H4M A;  2E2N A;  2OYQ A;  4EFH A;  3CG7 A;  3BEX A;  1Q7Y O;  4CJ3 A;  4CER A;  4YDU A;  1IKX A;  1MA9 B;  4H0T B;  1BCO A;  5AQP A;  4E3S A;  4CGI A;  2ZJR L;  3U3Y A;  1N36 K;  2HVH A;  3L2W A;  4LFB K;  4A59 A;  3AO3 A;  4E7H A;  3CPW M;  4JI4 K;  4X62 K;  3I33 A;  3SUQ A;  3O9U A;  2UUB K;  2G8V A;  1A5X A;  5M1Q A;  3EYZ A;  4FLZ A;  2VG5 A;  3TAM A;  3DLL L;  5JS1 A;  1HKC A;  1ATS A;  1MDU B;  4O8U A;  3V9U A;  2Q3S A;  1S9E A;  4I9L A;  3RSE B;  4E7J A;  4DU3 A;  5M1F A;  4JKD A;  3BGR A;  3VQ5 A;  2B5J A;  3P38 A;  3AO4 A;  2BUP A;  4TSX A;  4DR2 K;  3QIO A;  2P9S A;  1ILY A;  4M3R A;  3TAP A;  5GAG P;  4EZ9 A;  1Z6R A;  2E1Z A;  3LDP A;  2KLA A;  3LDL A;  4C8M A;  1P8Z A;  1E4F T;  4OO1 J;  3V1O A;  2P9L A;  1LAW A;  2PBD A;  4YOW A;  3OW2 M;  5CE3 A;  3JXU A;  4G9Z A;  3RTV A;  4C8K A;  2P9K A;  5BRD A;  2FBT A;  3IS9 A;  1VSE A;  3LDS A;  3A5N C;  4JKA A;  2QEX N;  4FWO A;  3ZSQ A;  5KQD A;  2YV0 X;  4DU1 A;  4RTF D;  1K8K A;  1XMQ K;  2Z1H A;  4FWS A;  1BI4 A;  4DQP A;  2I5J A;  5C2D A;  3MWP A;  4CFC A;  3LDO A;  1TVR A;  1JLC A;  2VWB A;  1F21 A;  4FK0 A;  4F3O A;  5KTQ A;  1HKG A;  4FPA A;  4LY7 A;  4MLH A;  2AJQ A;  1VSM A;  4OGE A;  5BR8 K;  1ZYQ A;  1ESV A;  3QFU A;  2IVO A;  4LD0 A;  3ZT4 A;  4JD2 A;  2D0A A;  3KHY A;  3VQ8 A;  1VSF A;  4E1M A;  4CCH A;  2E8A A;  4OPA A;  2CGK A;  3VQ9 A;  2E5L K;  2ETJ A;  4DR1 K;  4ZHR A;  4FCY A;  3QB0 A;  4BRQ A;  3SQ1 A;  3ZET A;  4BRC A;  3AO1 A;  3NGY A;  2QWP A;  3MX5 A;  3K9J A;  4CIG A;  3UKU B;  3VEW A;  2QWL A;  3CQX A;  3NGI A;  3DYA A;  4OKK A;  4B3T K;  5FRN A;  1GLB G;  1NK5 A;  2OAN A;  4M3Y A;  4ILG B;  4H5V A;  3H08 A;  1VK0 A;  3I0R A;  3P39 A;  2V7Z A;  2A41 A;  5HOO A;  4W5T A;  1K73 O;  3A0I X;  3O1B A;  1Q82 O;  3K58 A;  4M3W A;  4ELU A;  4J2B A;  3NH0 A;  4BRF A;  1TUU A;  1YIJ N;  1WLJ A;  4X65 K;  4K0K K;  1UA1 A;  4B9L A;  3DXK A;  5D3G A;  4FK2 A;  5F2R A;  1D8Y A;  4C1N K;  3F5T A;  2F7T A;  5C0Y A;  3CCL N;  3TSP A;  1HKB A;  4ZTF A;  3KTQ A;  2UUC K;  2OPS A;  3UE5 A;  1N6Q A;  4X66 K;  2GEL A;  3NBP A;  4UQG A;  3KK7 A;  3I55 N;  3O80 A;  2BE2 A;  5AQV A;  4CIE A;  4A57 A;  4K8X A;  1D5A A;  4E0D A;  4GNI A;  3CIP A;  2KFN A;  4GVM A;  1NGB A;  3VTH A;  3VEN A;  4O0J A;  4BR2 A;  3HM8 A;  4LF6 K;  3OYH A;  3QML A;  4YFU A;  4DS4 A;  4CF2 A;  3F9K A;  3LP0 A;  3TSQ A;  1NK9 A;  4LFA K;  1RDU A;  2HND A;  4JAX A;  3RRH A;  5J2M A;  1FJG K;  3ZSO A;  4DTR A;  1QVF M;  3SV3 A;  2BGG A;  4BRM A;  3R9P A;  1GOA A;  1YJW N;  4BC4 A;  2PAV A;  3CCR N;  4DCH A;  2IGI A;  4RG8 A;  3EY1 A;  1WSJ A;  4CJU A;  3HRG A;  1KVC A;  1ITG A;  1Z26 A;  4YDU C;  3H46 O;  5AQL A;  2FSN A;  2FF6 A;  3CER A;  4PHT X;  4CGF A;  4JI7 K;  4AH9 A;  1VQL N;  3G71 N;  2EX3 A;  4YNQ A;  4BRA A;  3I8D A;  1S1T A;  4CZF A;  2O8B A;  3P5J A;  3L4Q A;  3T1Y K;  5M1O A;  3DLE A;  3PIO L;  1WNS A;  2XY5 A;  2OZM A;  4YOV A;  5IWA K;  2NRT A;  3RMA A;  5JVH L;  2OPQ A;  5I9E B;  1X9M A;  4JK8 A;  3RVC A;  1RT1 A;  1ZBU A;  5HBM A;  1HUX A;  4WCE L;  1NJZ A;  2YHA A;  4H0P A;  1WBD A;  3DRR A;  1CZA N;  4CHP A;  5GAH P;  5EY4 A;  1KTQ A;  4CW7 B;  3FFI A;  4B9M A;  3N4Q A;  3HJF A;  3LPT A;  1S1V A;  5F1X A;  4H5W A;  3TR8 A;  3DRP A;  4FO0 A;  4JKB A;  4GV6 A;  1VQ5 N;  4I7F A;  4FJ7 A;  3F2K A;  4CJF A;  2DTU A;  4JI8 K;  1SZ2 A;  5IT9 O;  1S1U A;  1UOC A;  4CD3 A;  4WQ5 A;  1NKB A;  3C7N B;  2KTQ A;  1G99 A;  1S9G A;  1QQC A;  3TI0 A;  1NWK A;  3BF1 A;  4E7I A;  3HVT A;  1KLM A;  3ZEU B;  3F73 A;  1RDB A;  3O4Q A;  1NJI O;  4DV4 K;  3AA3 A;  3SNN A;  1JCE A;  4B1X B;  4QS8 A;  4BE1 A;  1S6Q A;  1BIS A;  2FSK A;  1JLA A;  1QQO A;  1OH6 A;  5EVZ A;  2D5R A;  1T03 A;  5H1S Q;  4HVJ A;  4NCG A;  4K41 A;  4FLW A;  4K42 A;  4M3Z A;  2QXL A;  3ULE B;  4O55 A;  4DTU A;  4KPY A;  1Q86 O;  2HHS A;  4FM2 A;  1V4S A;  5CZ1 A;  1DTT A;  3TSU A;  3UKU A;  3SZ2 A;  1JXB A;  2E20 A;  2IAJ A;  5AQJ A;  4BE0 A;  1VQ8 N;  4DFM A;  3WXJ A;  4FWR A;  1RDW X;  2HMP A;  2QW9 A;  3O1W A;  2FLO A;  3ZSX A;  3OYM A;  5LMN K;  3EO3 A;  4PKH A;  3WNH A;  4DR5 K;  3L2U A;  3NH1 A;  3MAQ A;  2VWK A;  4LFC K;  2QKB A;  4IEE A;  3VQA A;  3DLH A;  2UYT A;  4CEQ A;  2NRX A;  1N8R O;  2FSJ A;  3KK2 A;  1BUP A;  1XHX A;  2IVP A;  3CCE N;  1ZC6 A;  1GLJ O;  3MN5 A;  3H6E A;  3QIN A;  3CFR A;  1EP4 A;  1JL1 A;  4AF1 A;  5HP1 A;  4RW9 A;  5AQW A;  4AHS A;  2XY7 A;  3MCA B;  1KQS M;  2XHB A;  4BRH A;  2F8S A;  2HST A;  4HCB A;  3TWH A;  3ALY A;  4A5A A;  3KK1 A;  3Q7B A;  4FJ8 A;  1J6Z A;  2HF3 A;  5AQT A;  4CEB A;  1HJO A;  2G8F A;  2HF4 A;  1BU6 O;  4ELT A;  3LZI A;  3OYL A;  2ZQB A;  4B3M K;  4MDA A;  5DMR A;  1RBS A;  4X64 K;  1RBU A;  3PIP L;  2D4W A;  2ASP A;  5TKW A;  3HI0 A;  4O5F A;  4M63 C;  3VF4 A;  3RR7 A;  5JVG L;  3BY5 A;  2A1S A;  3OA9 A;  2HHV A;  5KRS A;  3B8A X;  4EZ6 A;  2G8U A;  3T7Z A;  4JKE A;  4BRN A;  5KPT A;  3MN7 A;  3C6A A;  3JAM O;  3ZX2 A;  4J2E A;  5AQI A;  3TTC A;  4BG9 A;  1VSK A;  1D4X A;  1BDG A;  1HR0 K;  2HHT A;  4FWK A;  1SL1 A;  5AQF A;  2QXF A;  1VSI A;  2QM1 A;  4BDZ A;  5F0X A;  1WUA A;  1RBR A;  4C23 A;  2O8F B;  4FVU A;  4FJI A;  2P1J A;  4RW6 A;  4M42 A;  4BGB A;  1ZBF A;  3L8B A;  4DR6 K;  3HPO A;  3NVK A;  5LY3 A;  4O44 A;  3KLG A;  4PKI A;  4BR9 A;  1QQN A;  1KCF A;  4CZI A;  4NYN A;  4CHQ A;  4FJX A;  2AA4 A;  1EXQ A;  4DUZ K;  3G25 A;  3MN6 A;  3DMJ A;  1J5O A;  1JCG A;  4ILJ A;  4KHY A;  4JNE A;  1NGC A;  3V6D A;  4EHU A;  2O8C B;  4JLH A;  2HB5 A;  5JLH A;  1SUQ A;  3VGL A;  3AVA A;  1JLB A;  2GUI A;  3AY9 A;  3GG4 A;  4O5B A;  2KHO A;  3VQC A;  5J2P A;  3HBT A;  4C8O A;  3C7N A;  4DFP A;  4B9Q A;  3VA0 A;  1N33 K;  1HNV A;  3ZEU A;  4JEP A;  1ASW A;  3M6G A;  4WQ5 C;  2O8D B;  3QER A;  3SAH A;  1U45 A;  4FW2 A;  4CJK A;  1NG9 A;  4Z4H A;  4BR4 A;  3O9Q A;  1T6D A;  1W7A A;  3OBY A;  2WON A;  2GX9 A;  3RMC A;  4ID5 A;  4CJE A;  1XHZ A;  4FJ9 A;  3AVC A;  3CMA N;  1FKO A;  1BA0 A;  2JGU A;  3TTF A;  1VQM N;  4PUO A;  4KI6 A;  4M3X A;  4KO0 A;  5BRH A;  5BPL A;  3ZCM A;  2RE2 A;  2A6A A;  2YJF A;  1WBB A;  4RWT A;  3CJA A;  3ENB A;  4CZJ A;  4FL9 A;  4DSJ A;  3CCM N;  3R3L A;  3DXM B;  1JKH A;  3EZ5 A;  3LZJ A;  4BC2 A;  5CZ2 A;  3VER A;  5KPR A;  1NGA A;  2VQF K;  3CFP A;  1MWM A;  3LM9 A;  3SAG A;  5E41 A;  2UU9 K;  3AVG A;  4LSN A;  3KKS A;  3LP2 A;  3WXL A;  4Z4E A;  1NM1 A;  5AJ3 K;  2KFZ A;  3SMS A;  3CQY A;  1ASU A;  2VCP A;  5BRE A;  3S3O A;  2WFB A;  4W5N A;  1Q18 A;  3V1R A;  3ULD A;  1UWB A;  4R79 A;  4FM0 A;  1I3A A;  3OVN A;  4DV7 K;  1CZ9 A;  3KWG A;  2UXD K;  3MCP A;  4DTO A;  1LW2 A;  1Y64 A;  4DR4 K;  3K9K A;  1CXQ A;  3HP6 A;  2A3Z A;  3CM6 A;  4BRG A;  3UB5 A;  4CD1 A;  3TTD A;  3JSM A;  5JS2 A;  3L3U A;  2D0C A;  4H0V B;  4BG8 A;  1JJ2 M;  2F96 A;  4FVM A;  1W0H A;  3E01 A;  4CJP A;  1QZ6 A;  1JLE A;  4CF1 A;  3SQ0 A;  2OTJ N;  4QAG A;  4CK1 A;  5AQK A;  4JI6 K;  3C6U A;  2ATQ A;  3FZL A;  3O3F A;  3M1F A;  4KKO A;  3M8P A;  3FR0 A;  5EOY A;  5J2Q A;  3DOL A;  1T7P A;  1P90 A;  5GAD P;  3WXI A;  3D45 A;  4CES A;  2FF3 B;  4CF9 A;  1Z25 A;  1B9D A;  1VQ9 N;  3SQ2 A;  4DV3 K;  1DEJ A;  2AP1 A;  1ATN A;  3OYK A;  2E1Y A;  4IO8 A;  4PKG A;  2R7Y A;  4GV3 A;  4DSL A;  2A1R A;  2E2P A;  1FW6 A;  1KAY A;  3ID8 A;  3VN5 A;  2HHQ A;  5K14 A;  1U49 A;  4GW6 A;  1JLF A;  3ZX3 A;  3LWL A;  5AQR A;  1IBK K;  3QIP A;  2PFU A;  4E7K A;  4DQ8 A;  1M90 O;  4IZ9 A;  3OBW A;  2IDO A;  1RDC A;  3THW B;  3SJJ A;  1RTJ A;  4FZZ A;  3AVN A;  5HRN A;  3HOS A;  3J7Y P;  1YAG A;  4Z94 A;  2ITM A;  2EWS A;  1XMO K;  1RT7 A;  4QS7 A;  3O8M A;  4FW1 A;  4B1W B;  3CYM A;  5GIP A;  3M5R A;  4BDY A;  5C42 A;  5AZI B;  4OGC A;  3U4L A;  4HTL A;  2HW3 A;  1HX1 A;  1BHL A;  1NJW A;  1TK8 A;  1OH5 A;  4KHU A;  3SLC A;  1DT9 A;  2X6S A;  4KH4 A;  2O8C A;  1HPM A;  2CH5 A;  4XH1 A;  1YTU A;  3PUF A;  1NMN A;  3TAN A;  3NFA A;  3ZSW A;  3MK6 A;  2VYP A;  4F2R A;  3KVG A;  4I6M B;  5BR9 A;  4CJR A;  1C1B A;  1HYV A;  4FZX C;  3BP8 A;  1C1A A;  3L3V A;  2Q1N A;  3LP3 A;  1X3N A;  2VGM A;  4DUY K;  1EQY A;  1BA1 A;  3JS6 A;  2P5G A;  1A5W A;  2I7N A;  3VEO A;  5FRO A;  4GY2 B;  2KZM A;  4B08 A;  4U7B A;  5I42 A;  1C0M A;  3CCJ N;  1X9W A;  2O8D A;  1IBM K;  2QK9 A;  5AQN A;  1KFD A;  4Q5V A;  2HNY A;  4MO5 A;  3OYD A;  3T69 A;  3IDH A;  3WXM B;  4DWI A;  3LL3 A;  4B1Y B;  1VSH A;  5FPN A;  2F9W A;  2YKN A;  1ZBL A;  4W5R A;  3THY B;  4PY5 A;  1QZ5 A;  2D0P A;  3DXM A;  4H0O A;  3MWT A;  2OPR A;  3AAR A;  4BR5 A;  4KHS A;  4F3T A;  1CLQ A;  2F4V K;  1WSH A;  3NF8 A;  2G8W A;  5JLF A;  3ZSY A;  1FK9 A;  2HBL A;  4B3S K;  2O8E B;  1W2B M;  5EX5 A;  3MXI A;  5CYQ A;  4NO7 A;  4E19 A;  2HHH K;  4NCA A;  2I7P A;  1Q9Y A;  3AVL A;  2P9N A;  4WFB L;  2GBZ A;  4FOI A;  2NLX A;  4N76 A;  5AR0 A;  4CZH A;  3OYJ A;  1TL3 A;  3J8A A;  3NF7 A;  1T6C A;  3O3G A;  3LWM A;  2NRR A;  3AVM A;  4CI6 A;  2QA4 N;  2IOC A;  4LF9 K;  1KVB A;  3BF3 A;  4Z4F A;  1ASV A;  5DK5 A;  1NMD A;  3CJ9 A;  3OYG A;  3D2F B;  3A5L C;  4DFK A;  3O08 A;  3CET A;  2V52 B;  1K9M O;  2ZGZ A;  1KXP A;  2P9P B;  1SL2 A;  1SS6 A;  3H45 C;  1T05 A;  4N41 A;  3C6T A;  1NOY A;  2NUB A;  3RR8 A;  4JHD B;  5C24 A;  1ZBH A;  1U48 A;  4JK9 A;  4RW4 A;  4CK3 A;  2OZS A;  3OYA A;  1HYZ A;  4QS9 A;  2CGJ A;  3VQ6 A;  3SBG A;  3OJS A;  1QE1 A;  4OVL A;  3NVM A;  2KQ2 A;  4Y0W A;  1O1W A;  4BRI A;  1O13 A;  3L2R A;  4O0I A;  3U8X A;  1XWL A;  4B8C A;  1OH8 A;  1IO2 A;  3IRX A;  1S22 A;  4OLB A;  1TGO A;  3RSE A;  1L3T A;  3KD5 E;  2JWL A;  1LOT B;  1BWF O;  1R59 O;  2IIR A;  3AO5 A;  4CGH A;  1SKS A;  1QTM A;  3B6P A;  4FLV A;  4MLE A;  3SUO A;  4DQI A;  4EP5 A;  4EP4 A;  4B1Z A;  1NJX A;  5I3U A;  1IG8 A;  1T8E A;  2CH6 A;  1S1X A;  4YOT A;  3N4P A;  2A40 A;  3VA3 A;  1XI1 A;  2D0B A;  1KFS A;  3JYT A;  3PY8 A;  5AZI A;  4XIU A;  1W9H A;  5CY4 A;  3L6Q A;  2V7Y A;  1L5U A;  4AQY K;  1TKX A;  3QLH A;  1WSF A;  2ITG A;  4BY9 C;  3QIC A;  4KRF A;  1UA0 A;  2XY8 A;  1YXQ A;  3O9S A;  3P4I A;  5JIC A;  1BIU A;  4LF4 K;  2HBM A;  1EX4 A;  1RT6 A;  1VQ4 N;  2QWQ A;  2YNH A;  4BE2 A;  3DRS A;  5SZT A;  4DLG A;  1VHX A;  4H8K A;  5EU7 A;  4I6M A;  2WUS A;  2Q36 A;  5CR4 A;  3DM2 A;  5LJV A;  1HNX K;  2PZS A;  1T44 A;  3C0B A;  4C8N A;  1U4B A;  3HK2 A;  2RF2 A;  4DG1 A;  3ASM A;  2ZD1 A;  3QEV A;  4KV8 A;  4RW7 A;  1TK5 A;  4Z4C A;  4CEF A;  4CBU A;  3VTI A;  4ISE A;  3FZF A;  5ADX A;  3NCI A;  3VF6 A;  4WYB A;  2OTL N;  3KIO A;  3B6O A;  4LSL A;  3TAE A;  3D6R A;  3CJ1 A;  4WE1 A;  1XC3 A;  3AGR A;  4M7Y A;  5BN9 A;  4JKC A;  2YHW A;  1IKV A;  5ADX H;  1EKE A;  1YTA A;  3BZK A;  3TU5 A;  2QWO A;  4YOY A;  4CFD A;  2UXC K;  3ZT1 A;  3R8E A;  3SCX A;  3THY A;  4JS4 A;  4KHQ A;  3EL2 A;  2E88 A;  3C6H A;  4WF9 L;  3THV A;  5E84 A;  1TYQ B;  1M1K O;  1HJR A;  4FPB A;  5C10 A;  2ASM A;  1RCH A;  4CJW A;  3A8Y A;  4F4K A;  3RRG A;  3G6E N;  4RCH A;  4BC3 A;  1NBW A;  1IBL K;  4BWJ A;  1ZBS A;  3VQP A;  2YHY A;  4B9S A;  1B9F A;  4QOZ B;  3FFK B;  3FE1 A;  2YNG A;  3GOI A;  1QSL A;  4N47 A;  4HWI A;  4EAH D;  3E9P A;  4DV0 K;  3TAF A;  1DKG D;  4DSF A;  2D1K A;  1NU0 A;  2F8T A;  4DV6 K;  4AHC A;  4IKF A;  3HST B;  3MED A;  2YNI A;  3GE1 A;  1KSP A;  1NGG A;  5HRR A;  3CJ7 A;  2QI2 A;  1VQN N;  3QET A;  3QEP A;  2HVI A;  4KRE A;  3VQD A;  4ID1 A;  3LAL A;  3NH2 A;  1J9A A;  3V4I A;  1GOC A;  1BL3 A;  4JI0 K;  4H0Y B;  4NLC A;  4CJL A;  1QQM A;  1NOZ A;  1X9S A;  4FJM A;  2W6K A;  4YOR A;  4FK4 A;  3QBX A;  1NK6 A;  3V9X A;  3K5L A;  2RN2 A;  1LAV A;  3VGK A;  4DTM A;  1D9F A;  5FPE A;  1TKT A;  3MN9 A;  3OYE A;  3LM2 A;  2HMI A;  4CHZ A;  3HSC A;  4DSK A;  1WOQ A;  4KI4 A;  4BQZ A;  4ELV A;  1V4T A;  4YOX A;  4CEC A;  1HYS A;  3PV8 A;  2BAN A;  4JKG B;  3VQQ A;  1RTH A;  4IOC L;  3A2F A;  1SQK A;  2FBV A;  1NLV A;  2HHU A;  4M41 A;  4R5P A;  5SWM A;  4XH4 A;  4PWD A;  1RT3 A;  3SPZ A;  4DMN A;  4CEA A;  4U67 L;  3OYN A;  4FLX A;  4F2S A;  4IOX A;  2HHW A;  1I94 K;  2NZT A;  4H5R A;  4LC9 B;  3CXC M;  2FC0 A;  3K5O A;  1SKR A;  3HPH A;  4XH5 A;  1NGI A;  2RHK A;  4C1N I;  3MDQ A;  3J7A P;  4FJH A;  2CGL A;  4J8F A;  2A5X A;  4OKJ A;  3T1H K;  3DLG A;  4JKH A;  3UKR B;  3VPZ A;  3FZK A;  1DGK N; 
#chains in the Genus database with same CATH homology
 3P1G A;  3OYK A;  4DQS A;  3TAR A;  4ZTF A;  3KTQ A;  3KLE A;  2R7Y A;  2OPS A;  1HRH A;  1N6Q A;  4DSL A;  2A1R A;  4FLY A;  1VRU A;  4GMJ B;  4CGD A;  4KFB A;  4UQG A;  3NBP A;  4DF8 A;  3HL8 A;  1HMV A;  1RDD A;  1X1P A;  3VN5 A;  3WNE A;  1KLN A;  5K14 A;  1U49 A;  2BE2 A;  4CIE A;  4GW6 A;  1JLF A;  3DLB A;  4K8X A;  4KHW A;  3HVR A;  3LWL A;  1D5A A;  4IG3 A;  4E0D A;  4IBN A;  4B9T A;  3G10 A;  3HPG A;  1SV5 A;  3QIP A;  4MQ3 A;  4CF0 A;  4E7K A;  2X78 A;  1TKD A;  3P83 D;  4GVM A;  2KFN A;  2IDO A;  4O0J A;  2HNZ A;  4BWM A;  1RDC A;  3K2P A;  3OYH A;  3V9Z A;  4DTN A;  3SJJ A;  1RTJ A;  3LAK A;  1QSS A;  4YFU A;  4DS4 A;  4CF2 A;  4B9U A;  4FZZ A;  3AVN A;  5HRN A;  3F9K A;  4B9V A;  3KD1 E;  1GOB A;  3LP0 A;  3K59 A;  1NK9 A;  1HQU A;  1HNI A;  3M8Q A;  1DTQ A;  1YT3 A;  4AHR A;  2HND A;  1RTD A;  1RT7 A;  4FW1 A;  3QEX A;  3RRH A;  4IG0 A;  3CYM A;  5J2M A;  3ZSO A;  4HCC A;  4BDY A;  4DTR A;  4E89 A;  5C42 A;  3SV3 A;  4OGC A;  1IH7 A;  2BGG A;  3D0P A;  2Z1I A;  4Z4I A;  2HW3 A;  3CFO A;  1GOA A;  1BGX T;  1BHL A;  2XRI A;  1LWF A;  1NJW A;  1TK8 A;  4KB0 A;  4KHU A;  4AIL C;  2Y1J A;  2DFF A;  2IGI A;  3I0S A;  2X6S A;  3CM5 A;  4RG8 A;  3EY1 A;  1WSJ A;  2BDP A;  4CJU A;  1KVC A;  1ITG A;  1Z26 A;  3QNO A;  4KTW A;  3L2V A;  4DS5 A;  3S9H A;  1A5V A;  1YTU A;  3AA5 X;  3PUF A;  1RBV A;  4CGF A;  4AH9 A;  3NFA A;  2LSN A;  2B6A A;  3ZSW A;  4E1N A;  3K57 A;  3TAN A;  1BQM A;  2QKK A;  4M3U A;  4RW8 A;  2EX3 A;  2FBY A;  4F2R A;  4YNQ A;  3HM9 A;  5FDL A;  3I8D A;  4CJR A;  1C1B A;  1HYV A;  4FZX C;  3L3V A;  1C1A A;  1S1T A;  2WOM A;  3T1A A;  3LP3 A;  3MEC A;  3P5J A;  3DLR A;  4OKE A;  1TKZ A;  4LH5 A;  3AVB A;  4AHV A;  1JLQ A;  3DLE A;  2P5G A;  1A5W A;  3DI6 A;  1ZBI A;  3V9W A;  4HTU A;  5FRO A;  3MXJ A;  3V81 A;  1WNS A;  4B08 A;  3PO5 A;  2KZM A;  2XY5 A;  2PY5 A;  4FJK A;  5I42 A;  3LAM A;  2OZM A;  4DTX A;  1BIZ A;  1TL1 A;  3RMA A;  1C0M A;  3LP1 A;  3U3G A;  1X9W A;  3AVH A;  2OPQ A;  1L3U A;  2QK9 A;  1X9M A;  4AHT A;  1RT1 A;  1ZBU A;  5HBM A;  1I39 A;  1KFD A;  1NJZ A;  3AV9 A;  2YHA A;  4Q5V A;  3O3H A;  2HNY A;  3SI6 A;  3ZSZ A;  3V1Q A;  3DRR A;  4CHP A;  3OYD A;  3NHG A;  3DLK A;  1RNH A;  3QO9 A;  1S5J A;  1KTQ A;  4DWI A;  1NJY A;  4OLA A;  3FFI A;  4B9M A;  5T7B A;  1VSH A;  4DFJ A;  3HJF A;  1TV6 A;  3LPT A;  1S1V A;  1WSI A;  3WNF A;  2YKN A;  3DOK A;  3IG1 A;  3TR8 A;  3QES A;  4W5R A;  1ZBL A;  3DRP A;  2Y1I A;  4PY5 A;  2Z1J A;  3AA4 A;  3KLI A;  4I7F A;  4FJ7 A;  3MEG A;  4CJF A;  3QEI A;  4HUE A;  1JLG A;  4I2P A;  3VQ7 A;  2OPR A;  4CGJ A;  3QEW A;  2DTU A;  3HYF A;  4KHS A;  4F3T A;  4BAC A;  4H4O A;  1S1U A;  1CLQ A;  1RDA A;  1UOC A;  3K5M A;  2G8H A;  4FJJ A;  1NKB A;  3T3F A;  1FKP A;  4CJ5 A;  1WSH A;  3NF8 A;  1NKE A;  1RBT A;  2G8W A;  2KTQ A;  1S9G A;  1QQC A;  3TI0 A;  5HLF A;  3ZSY A;  1FK9 A;  4E7I A;  4F8R A;  3HP9 A;  3HVT A;  1KLM A;  3C95 A;  4M45 A;  3F73 A;  1QS4 A;  1B92 A;  3MXI A;  3M8S A;  1L3S A;  1RDB A;  5CYQ A;  4E19 A;  4NCA A;  3O4Q A;  1JL2 A;  1Q9Y A;  4C8L A;  4G1Q A;  1J53 A;  3AVL A;  1C1C A;  3AA3 A;  2IC3 A;  3SNN A;  4ICL A;  4CHY A;  2GBZ A;  1LWC A;  5KGW A;  1EET A;  3OYI A;  1S6Q A;  1BIS A;  3OYB A;  1JLA A;  4BE1 A;  3SUN A;  3AVI A;  4N76 A;  3OYJ A;  1TL3 A;  2D5R A;  3NF7 A;  3O3G A;  1T03 A;  3LWM A;  4HVJ A;  4NCG A;  3AVM A;  4Y1C A;  3NF9 A;  4FLW A;  3AVJ A;  2IOC A;  1TAQ A;  4M3Z A;  2HHX A;  1KVB A;  2RPI A;  4O55 A;  1VSD A;  1BCM A;  4Z4G A;  4Z4F A;  4DTU A;  4KPY A;  1ASV A;  3LAN A;  5DK5 A;  3OYG A;  2HHS A;  4PQU A;  1RT5 A;  4DSI A;  4FM2 A;  5CZ1 A;  1DTT A;  4DFK A;  4W5O A;  1WAJ A;  3G0Z A;  4J2A A;  4M3Y A;  4FXD A;  5KI6 A;  4L8R B;  4QCL A;  1NK7 A;  1UAX A;  1QHT A;  2VWJ A;  1SL2 A;  3SZ2 A;  5KRT A;  1JXB A;  2E4L A;  1BI4 B;  4CIF A;  1T05 A;  4N41 A;  3C6T A;  3WNG A;  1RT4 A;  1U04 A;  4MFB A;  2IAJ A;  5C25 A;  2NUB A;  3NF6 A;  1LWE A;  1HQE A;  3OJU A;  4CEO A;  1NOY A;  2DY4 A;  3C94 A;  3RR8 A;  2B4J A;  3ZSV A;  4BE0 A;  4DFM A;  1NK8 A;  1NK0 A;  3SV4 A;  5C24 A;  1ZBH A;  3ZT2 A;  3ZSX A;  1U48 A;  3OYM A;  2DFE A;  4RW4 A;  3LPU A;  4CK3 A;  3WNH A;  2EHG A;  3VQB A;  3OYC A;  3OYA A;  3NH1 A;  3MEE A;  2DFH A;  2JLE A;  2VWK A;  3L2U A;  3O4N A;  3MAQ A;  2QKB A;  3RWU A;  1Y97 A;  3VQA A;  3DLH A;  1HYZ A;  3KKR A;  4CJT A;  3AVK A;  2OPP A;  4KHN A;  4CEQ A;  3KLH A;  4FLU A;  4B9N A;  3KK2 A;  1XHX A;  3VQ6 A;  4BDP A;  3OJS A;  4DTS A;  4DLE A;  3SPY A;  1QE1 A;  4OVL A;  3T19 A;  3QIN A;  1N5Y A;  2KQ2 A;  3CFR A;  1O1W A;  4CFB A;  1C6V A;  3L2R A;  3RMD A;  1EP4 A;  3SYZ A;  4O0I A;  4B8C A;  1JL1 A;  1XWL A;  4CED A;  4RW9 A;  5HP1 A;  4CEE A;  4IDK A;  1IO2 A;  3IRX A;  4AHS A;  2XY7 A;  4OLB A;  3TAB A;  1TGO A;  5J1E A;  1FXX A;  3ITH A;  2XHB A;  1L3T A;  3PO4 A;  3KD5 E;  1U47 A;  4HCB A;  2PYJ A;  4I9Q A;  2F8S A;  3TWH A;  4JS5 A;  3QNN A;  3ALY A;  3KK1 A;  4CGH A;  3AO5 A;  1MU2 A;  1SKS A;  4Q0B A;  4FJ8 A;  4DTJ A;  4DSE A;  3SQ4 A;  1QTM A;  2G8I A;  3B6P A;  4CEB A;  4FLV A;  1G15 A;  3NGZ A;  3OYF A;  1NKC A;  5HRO A;  2G8F A;  1QSY A;  2XY6 A;  3SUO A;  4EP5 A;  4DQI A;  4ELT A;  3LZI A;  4EP4 A;  1NJX A;  3OYL A;  2O4G A;  2ZQB A;  3RMB A;  4CFA A;  5I3U A;  1T8E A;  1LW0 A;  1VSJ A;  1CXU A;  5DMR A;  1RBS A;  1S1X A;  5HRS A;  1XC9 A;  3OS2 A;  1J54 A;  1RBU A;  2YHB A;  1REV A;  1VSL A;  3VA3 A;  2OA8 A;  1XI1 A;  2D0B A;  1KFS A;  3JYT A;  4ZTJ A;  1WSG A;  4Z0U A;  3PY8 A;  3NDK A;  5CYM A;  4XIU A;  4DF4 A;  3RR7 A;  1W9H A;  1S1W A;  2A1S A;  5CY4 A;  4B8A B;  4CF8 A;  5KRS A;  1L5U A;  2HHV A;  1TKX A;  2VG7 A;  1WSF A;  2ITG A;  3QLH A;  4KRF A;  4KTZ A;  1UA0 A;  2XY8 A;  3ZSR A;  2G8U A;  4EZ6 A;  3AO2 A;  1IG9 A;  1BIU A;  3PX4 A;  4FM1 A;  3KLF A;  1WAF A;  1EX4 A;  1LV5 A;  4HHT A;  1BQN A;  1RT6 A;  2E6M A;  1IKW A;  4KAZ A;  4I2Q A;  4AHU A;  2YNH A;  4BE2 A;  3DRS A;  1YVU A;  4J2E A;  5SZT A;  2E6L A;  4DLG A;  5EU7 A;  4H8K A;  1VSK A;  2X6N A;  3ISN C;  1R0A A;  1CZB A;  2Z1G A;  1C0U A;  2P5O A;  2HHT A;  2G8K A;  3VQE A;  1SL1 A;  3DM2 A;  3L2Q A;  3TAG A;  1Q8I A;  2PZS A;  4C8N A;  1U4B A;  3HK2 A;  2RF2 A;  1IKY A;  1VSI A;  2QXF A;  2YNF A;  3CQ8 A;  4BDZ A;  4DG1 A;  3ASM A;  2ZD1 A;  1JXE A;  3QEV A;  1TAU A;  2VG6 A;  1RBR A;  4KV8 A;  4CEZ A;  4FJI A;  4RW7 A;  1TK5 A;  1KVA A;  2P1J A;  4RW6 A;  3K5N A;  3S3N A;  3NE6 A;  4Z4C A;  4CEF A;  4M42 A;  1ZBF A;  3NCI A;  3L8B A;  4H4M A;  2KZZ A;  3HPO A;  2OYQ A;  3SUP A;  3CG7 A;  3KIO A;  3B6O A;  4LSL A;  4OPJ A;  4O44 A;  3KLG A;  3TAE A;  1RTI A;  4CJ3 A;  4CER A;  4WE1 A;  1KCF A;  1IKX A;  1BCO A;  4NYN A;  4E3S A;  4CGI A;  3U3Y A;  1DLO A;  2ZE2 A;  4CHQ A;  3L2W A;  4FJX A;  2HVH A;  2PYL A;  1EXQ A;  1HPZ A;  1IKV A;  3AO3 A;  3M8R A;  4E7H A;  1EKE A;  3DMJ A;  1YTA A;  3AVF A;  3PX6 A;  1J5O A;  4CJQ A;  4KHY A;  3V6D A;  2FBX A;  4JLH A;  3SUQ A;  2HB5 A;  4CFD A;  3ZT1 A;  4DU4 A;  3SCX A;  1SUQ A;  4JS4 A;  4KHQ A;  2G8V A;  1A5X A;  4DQR A;  3AVA A;  3VQ4 A;  3EYZ A;  4FLZ A;  3THV A;  1JLB A;  2GUI A;  2VG5 A;  2YKM A;  5HRP A;  3NAE A;  3TAM A;  1HJR A;  4O5B A;  4OPK A;  3S3M A;  5JS1 A;  4FLT A;  3ZT0 A;  1KRP A;  1RCH A;  4CJW A;  4F4K A;  3VQC A;  5J2P A;  3RRG A;  3V9U A;  4C8O A;  2Q3S A;  1S9E A;  4I9L A;  4E7J A;  4DU3 A;  4BWJ A;  4FJ5 A;  3VQP A;  3BGR A;  4PA1 A;  3VQ5 A;  2B5J A;  4B9S A;  4KB1 A;  1B9F A;  4DFP A;  3AO4 A;  4TSX A;  4QOZ B;  3VA0 A;  3QIO A;  3TAQ A;  4FJL A;  1HNV A;  4NYF A;  2YNG A;  4M3R A;  3TAP A;  3OS0 A;  1QSL A;  4J2D A;  1ASW A;  4N47 A;  4EZ9 A;  3TAF A;  4CHO A;  4DSF A;  1Q9X A;  3QER A;  1U45 A;  4FW2 A;  4CJK A;  4HUG A;  2F8T A;  4Z4H A;  4C8M A;  4AHC A;  4IKF A;  3HST B;  2WON A;  3MED A;  4W5Q A;  4ID5 A;  2YNI A;  2W42 A;  3RMC A;  2OZS A;  4CJE A;  1XHZ A;  4FJ9 A;  3AVC A;  3V1O A;  3OY9 A;  1LAW A;  1FKO A;  1KSP A;  2JGU A;  1S6P A;  5J2N A;  5HRR A;  4K8Z A;  4PUO A;  4KI6 A;  4KO0 A;  4M3X A;  4NCB A;  3RTV A;  4JRQ A;  2KW4 A;  3ZCM A;  3QET A;  3QEP A;  4C8K A;  2HVI A;  4KRE A;  2FBT A;  3IS9 A;  4HUF A;  1VSE A;  3VQD A;  3LDS A;  3PX0 A;  3UIQ A;  3IAY A;  4DSJ A;  3ZSQ A;  2GV9 A;  2YV0 X;  1JKH A;  3EZ5 A;  4ID1 A;  3LZJ A;  4DU1 A;  3LAL A;  4JRP A;  4OJR A;  5CZ2 A;  1VRT A;  1J9A A;  2Z1H A;  3NH2 A;  1GOC A;  3V4I A;  3KJV A;  1BL3 A;  1RIL A;  1BI4 A;  4DQP A;  2I5J A;  3BDP A;  3HO1 A;  2HHQ A;  3CFP A;  4CJL A;  4CFC A;  4N56 A;  4M3T A;  1TVR A;  1NOZ A;  1JLC A;  1X9S A;  4FJM A;  5E41 A;  1F21 A;  4FK0 A;  4F3O A;  1WN7 A;  4FZY A;  1L3V A;  5KTQ A;  3AVG A;  4FK4 A;  4LSN A;  3KKS A;  4LH4 A;  3LP2 A;  4LY7 A;  4Z4E A;  1NK6 A;  4N5S A;  3V9X A;  2AJQ A;  1VSM A;  4OGE A;  3K5L A;  1ZYQ A;  2RN2 A;  1LAV A;  1D9F A;  4DTM A;  2KFZ A;  1SL0 A;  2P51 A;  5FRM A;  1TKT A;  1ASU A;  3U6F A;  3OYE A;  2HMI A;  4CHZ A;  4FJG A;  4LD0 A;  3V9S A;  4DSK A;  3ZT4 A;  4CJS A;  3S3O A;  4W5N A;  4CE9 A;  3V1R A;  4FJN A;  3ULD A;  4DTP A;  4KI4 A;  4ELV A;  2D0A A;  1UWB A;  4Y1D A;  4DQQ A;  4FM0 A;  3VQ8 A;  1I3A A;  3OVN A;  1VSF A;  4E1M A;  1RT2 A;  1CZ9 A;  4FYD A;  4CCH A;  3VQ9 A;  1LW2 A;  4CEC A;  2ETJ A;  4DTO A;  3PV8 A;  1HYS A;  4ZHR A;  1D9D A;  2BAN A;  4FCY A;  4CJ4 A;  3VQQ A;  3SQ1 A;  1RTH A;  1CXQ A;  4CHN A;  3HP6 A;  3AO1 A;  3NGY A;  3CM6 A;  3A2F A;  4CIG A;  5KGX A;  4IFV A;  2FBV A;  2HHU A;  2O4I A;  4M41 A;  3NGI A;  4R5P A;  3DYA A;  4OKK A;  5SWM A;  3JSM A;  5FRN A;  5JS2 A;  3L3U A;  2D0C A;  4PWD A;  1K6Y A;  1NK5 A;  1RT3 A;  4IFY A;  3SPZ A;  2RKI A;  1WSE A;  4CEA A;  4CK2 A;  2F96 A;  4CJV A;  4DMN A;  4FVM A;  1C0T A;  1W0H A;  3E01 A;  3AA2 A;  4CJP A;  1JLE A;  4CF1 A;  3OYN A;  4FLX A;  3SQ0 A;  2IS3 A;  1SKW A;  4F2S A;  3H08 A;  2HHW A;  1VK0 A;  3I0R A;  4QAG A;  3ZT3 A;  4CK1 A;  3C6U A;  2XO7 A;  2ATQ A;  3O3F A;  4W5T A;  3MXM A;  1NK4 A;  4KKO A;  2FC0 A;  3M8P A;  3K5O A;  1SKR A;  4B3O A;  3HPH A;  2X74 A;  3K58 A;  4M3W A;  4ELU A;  4J2B A;  3HXM A;  3NH0 A;  4FJH A;  4KTQ A;  5J2Q A;  3DOL A;  1WLJ A;  1TK0 A;  1T7P A;  4CGG A;  3HT3 A;  3OS1 A;  4E7L A;  3D45 A;  4O4G A;  4CES A;  1UA1 A;  4B9L A;  3KK3 A;  4CF9 A;  5D3G A;  1Z25 A;  4OKJ A;  1B9D A;  4FK2 A;  3DLG A;  1D8Y A;  3SQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...