2ITGA

Catalytic domain of hiv-1 integrase: ordered active site in the f185h construct
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
160
Chain Sequence
HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS-1 INTEGRASE
publication title The catalytic domain of human immunodeficiency virus integrase: ordered active site in the F185H mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 160
sequence length 160
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2itgA00
3CM5A 4Z4CA 1NK4A 4OVLA 3BDPA 1C1BA 4CF1A 2B6AA 4OPKA 3L2WA 3F73A 3FFIA 1Y97A 2FBTA 1REVA 1RT6A 4CFAA 4F4KA 4HCBA 3VA3A 3VQEA 3EY1A 3QEIA 3V4IA 4KI4A 4CEDA 1DTQA 1T03A 1J5OA 1YT3A 2DFHA 1K6YA 2F8SA 2KFNA 4HUGA 3WNGA 4CK3A 4C8OA 1TKZA 2FBVA 4LSNA 4FJIA 1NOZA 3V9XA 2XY7A 3B6OA 4BWMA 1FKOA 1KTQA 4CJTA 4E7IA 4LD0A 4B8CA 4DSEA 4KHUA 3HO1A 1LWEA 3RR7A 3C95A 5J2NA 2Y1IA 5HRSA 3I0SA 1NJYA 4FK0A 3AVNA 3MXIA 2G8HA 3VN5A 1ZBHA 4FJ7A 2ETJA 4PWDA 3SUQA 5HRRA 4FJMA 3DLBA 2RF2A 3RMDA 2EHGA 4AHRA 3L8BA 1F21A 2RPIA 4FZZA 3V1QA 1QS4A 1X9WA 2FBYA 3DM2A 3AVLA 3TAMA 4OKJA 4O0IA 4BE1A 3KKRA 4NCAA 3O3FA 4J2EA 1CZ9A 3LWLA 2G8UA 3KLFA 4AILC 4G1QA 2ZE2A 4CEZA 4AHTA 1T7PA 2KFZA 3K57A 2VG6A 3K58A 2O4GA 3S3MA 1LWFA 1MU2A 2OPQA 3L2QA 2HNYA 4CGJA 4EP5A 3T3FA 5CYQA 4DTXA 2HW3A 3SYZA 3OS0A 1TKTA 4E1MA 1NK6A 3ITHA 4JRPA 3RTVA 5KGXA 3HP9A 5D3GA 2R7YA 1QE1A 1TKDA 1BGXT 3KK1A 4YFUA 5E41A 4RW8A 1HYVA 4E89A 3H08A 1ITGA 4K8ZA 2IDOA 3HVRA 3DLEA 3OYCA 2BDPA 2LSNA 4HTUA 3SQ4A 3SUPA 1HYZA 4Y1CA 1EX4A 2OA8A 1O1WA 2VWKA 1S1UA 4N47A 3VQ6A 3KJVA 4FJLA 4QOZB 3NBPA 4DTOA 2G8VA 4FZXC 4CHZA 3QEXA 4CJPA 2A1SA 2GUIA 3LZIA 2D5RA 4AHSA 3AV9A 4KTQA 4CJUA 4KHYA 4LH5A 4QCLA 1J53A 2D0CA 1TVRA 3BGRA 3AA5X 3V9UA 4FYDA 4CEBA 1BHLA 4OKKA 1C0MA 3AA2A 4BE2A 1FK9A 4O5BA 1IKYA 4DQQA 1WSGA 3AO2A 4FJJA 4C8NA 4W5RA 5J2MA 2PZSA 3KD1E 1EETA 1VSKA 1VSEA 4EZ6A 3DLKA 2G8WA 4N41A 4AHUA 3SNNA 4Q5VA 4BACA 4M42A 3ULDA 5HP1A 1TL3A 1QQCA 3U6FA 2HNDA 5CYMA 1FXXA 1RNHA 2WONA 3OYBA 3LPTA 3KK3A 4J2DA 1DTTA 1QSSA 4DTPA 5KI6A 4B9LA 1BISA 4M3XA 3OS2A 1BCMA 1NK5A 1CXQA 2OZSA 4KHSA 3TAEA 3IAYA 5JS2A 4RW6A 1BCOA 2YNHA 3VQ9A 4DTMA 1R0AA 3VQQA 4FJNA 3ZSQA 4L8RB 3B6PA 3SI6A 1HRHA 2DFEA 4KO0A 1HMVA 2KZMA 3SUNA 1L3UA 4CESA 4FLZA 3HPOA 3IRXA 4B3OA 5KRTA 4ID1A 1ZYQA 2DY4A 4TSXA 3TAPA 4DF4A 3V6DA 5SWMA 4E7HA 3ZT2A 2I5JA 2XHBA 3KK2A 4JS5A 3RRHA 3NCIA 3QEPA 1D8YA 1CLQA 3U3GA 1BL3A 3OYIA 1GOAA 3VQ7A 4B9SA 1WAJA 3JYTA 1UA0A 4IG3A 4B9NA 4M3YA 2Z1HA 3IG1A 1JLAA 3LALA 2B4JA 1S9EA 3AO5A 4FM2A 1WN7A 3OYFA 1N6QA 5FROA 2F96A 3C6UA 2YNGA 4CGHA 2DTUA 3ZSRA 1VSFA 2YKMA 4KTZA 1JL2A 4E7JA 3QINA 1KCFA 3F9KA 3G0ZA 1RT1A 3HXMA 2HHXA 3AVGA 4B8AB 1QSLA 1SUQA 3PX0A 2HHTA 3HT3A 3NHGA 1SL2A 2HHQA 3ZSYA 3KKSA 4CEEA 4CJSA 4H4MA 2EX3A 3ALYA 3M8QA 3DYAA 1RTJA 4ICLA 4NYFA 4O44A 4RW7A 1KSPA 4DLGA 2HHWA 2X78A 3OYDA 1BQNA 4FJ5A 1D5AA 4HUFA 1Q9YA 1JL1A 1S1WA 3CM6A 4BWJA 4ZTFA 1NK7A 4E19A 3LDSA 2Q3SA 3L2VA 4M3ZA 1GOCA 1QHTA 4CHNA 3HJFA 3RMAA 3WNFA 4YNQA 3LZJA 4EP4A 1X1PA 4CGDA 1VSLA 3AO3A 4KKOA 1T05A 3PO4A 4PUOA 1JKHA 3LAKA 4FZYA 4M45A 1U49A 1HNIA 2X6NA 1JLQA 4IG0A 3DLHA 2OPPA 3V9SA 4FW2A 3HK2A 3CYMA 5I3UA 1C1AA 1J9AA 3DMJA 3CQ8A 3C94A 3LP1A 2IGIA 4ID5A 2QXFA 3OJUA 1HQEA 2BANA 3MEEA 3M8RA 1NJWA 1LV5A 1WNSA 3RWUA 2F8TA 3AVKA 4AHCA 2XY5A 1G15A 2ZD1A 4IDKA 4ELVA 4WE1A 4M3WA 4CHQA 4KI6A 4GVMA 3T1AA 3TI0A 2G8FA 4PY5A 1XWLA 1JLEA 2VG7A 4CF9A 4MFBA 3EZ5A 3V9ZA 2QKKA 1VSMA 4LH4A 2OPRA 3TR8A 2RN2A 3SQ0A 5CZ1A 3NF7A 3OYNA 4FJGA 4DU1A 4CGFA 4Z4EA 3SPYA 3P1GA 1S1VA 3ZT3A 4OGEA 3ZSOA 4FLYA 1IO2A 1RBUA 1C1CA 3ZCMA 4CJ4A 3QNNA 3OYKA 3NGZA 2E6MA 4DFKA 4B9MA 1KVCA 1W9HA 4DQRA 1RT4A 4CIGA 4O0JA 1U4BA 3TAFA 3SPZA 2JLEA 3MEDA 3OYGA 5HLFA 2HHUA 2BE2A 1JXEA 3HPGA 4DFJA 4OKEA 4R5PA 1LW2A 1S5JA 3G10A 1TAUA 3NH1A 1D9DA 3LPUA 3NE6A 1RDDA 1IKWA 4CEFA 1RTDA 1IH7A 2X74A 2KQ2A 3NGYA 4JRQA 3TWHA 4FLVA 2KZZA 1LAWA 1LWCA 3TABA 4DTJA 4BE0A 1KFSA 4I9LA 5FDLA 4KREA 3VQDA 3L3UA 3CG7A 4W5TA 1HNVA 4ZHRA 1ASWA 1TL1A 1Q9XA 3AO4A 4OGCA 1VSHA 3ZT0A 5JS1A 4CHPA 2G8KA 4BDPA 4DTUA 3AO1A 1SKSA 5FRMA 5HRNA 4CECA 2P5GA 4W5QA 2YNFA 1S1TA 1B9DA 3D45A 4FXDA 3AVBA 3SQ2A 2XY8A 3QERA 1L3TA 1I39A 1QTMA 1L5UA 1TKXA 4DQPA 2YV0X 1YTAA 3NH0A 4E1NA 4CJLA 4N56A 3WNHA 4CK1A 1JXBA 4E0DA 2KTQA 3AVIA 2GBZA 4N5SA 4HVJA 4CERA 1ASVA 3NF8A 4KV8A 2BGGA 2IC3A 2YHAA 5HBMA 4KHWA 3K5OA 3AVJA 2P51A 2WOMA 3M8PA 4MQ3A 4C8KA 4H4OA 1JLFA 5CZ2A 4RG8A 1N5YA 2G8IA 4FW1A 5HRPA 3OYMA 3PO5A 1XHXA 4Z4GA 3HPHA 3LP0A 4CFBA 3HM9A 4CIEA 4C8MA 1VK0A 4FM0A 1W0HA 1JLCA 4JLHA 3ZSZA 4DSFA 3SJJA 3TAGA 2YHBA 4AH9A 1TK8A 1SKRA 4DF8A 4F3OA 4N76A 3K5NA 1EXQA 3THVA 3OS1A 2NUBA 4IKFA 3RRGA 3KLIA 4CEAA 1VRTA 1C6VA 3VQBA 3OY9A 4DWIA 1WLJA 1BIUA 1RBVA 1RT5A 3NGIA 3HYFA 5I42A 3SUOA 4KTWA 2E4LA 1ASUA 3VQPA 3K5MA 4DFPA 3ZT4A 3MXMA 4B9TA 1D9FA 1EKEA 1FKPA 3ZT1A 3E01A 4JS4A 3AVAA 4NCGA 4CFDA 4DTSA 1U47A 1XC9A 2OZMA 1VSDA 4DTRA 4ELTA 4DSLA 4CJFA 2GV9A 1CZBA 3DRRA 4GW6A 4OPJA 4DSKA 4NCBA 4FJHA 3JSMA 4FK4A 3LWMA 3AA3A 2FC0A 4FM1A 4FLUA 1JLBA 4CK2A 5DMRA 4CJEA 1SV5A 3O3GA 3SZ2A 2X6SA 2DFFA 4CEOA 2PY5A 4E7KA 3CFPA 1A5XA 4QAGA 1Z26A 3SV3A 3PUFA 3MXJA 3V9WA 3K5LA 1DLOA 4CJ5A 3QIOA 4FLXA 1L3VA 3V1OA 4CJ3A 1U48A 3AVHA 4BDZA 2O4IA 4CJWA 3K59A 3DOLA 1XHZA 3ZSWA 4F2SA 3SQ1A 1L3SA 3VA0A 3KTQA 3V81A 3QEWA 4DU3A 4RW9A 4FK2A 4CEQA 1WSIA 3DLGA 4DLEA 4FLWA 4DU4A 1ZBLA 4KHNA 4DTNA 2HHVA 1S9GA 4DS5A 1KFDA 3P83D 1KRPA 1RBTA 4I7FA 4PQUA 2AJQA 3S9HA 1RTIA 4CJQA 4K8XA 1LAVA 2YKNA 4LY7A 1KLMA 4H8KA 1RCHA 4HHTA 1VRUA 3C6TA 4I2PA 1T8EA 3RR8A 4HCCA 2QKBA 1BI4A 5J2PA 3AVMA 1TV6A 4DQSA 4FCYA 3ZSVA 1WSHA 3OYLA 3L2UA 2P5OA 4FJ9A 5K14A 4Q0BA 4IBNA 1NKEA 4KB1A 3EYZA 3D0PA 1BQMA 1ZBIA 4O4GA 1S6PA 3ISNC 1WSJA 4B08A 1ZBFA 4ZTJA 1WAFA 2QK9A 1HJRA 3OYHA 5SZTA 3QESA 2VG5A 2OYQA 5J2QA 2IS3A 3RMBA 2ZQBA 1UOCA 1X9MA 1TK0A 1RT2A 1VSIA 4F8RA 3DRSA 4M3TA 4Z0UA 1NOYA 5KRSA 2YNIA 4E3SA 3NFAA 3PV8A 3QO9A 1WSFA 4M3UA 1RTHA 1JLGA 3AVFA 3S3NA 1NJXA 2OPSA 5EU7A 3QNOA 4FLTA 2IOCA 1GOBA 3OYJA 4LSLA 4CCHA 3DRPA 2HVHA 4CE9A 1YVUA 3T19A 1VSJA 5DK5A 3QLHA 3S3OA 4CGGA 4CIFA 5CY4A 1UA1A 1NK9A 4Z4IA 1UAXA 2ATQA 3HP6A 1BI4B 1NK8A 1IKXA 3RMCA 2RKIA 4DMNA 3QEVA 1EP4A 4FJKA 4ELUA 3O4QA 2HVIA 1NK0A 4O55A 4FJXA 2ITGA 3AVCA 3P5JA 1RBRA 4I2QA 2B5JA 2D0AA 3ASMA 1S6QA 3MEGA 4E7LA 2XRIA 3KIOA 4M3RA 5KGWA 1LW0A 1ZBUA 4FVMA 3PX4A 4KRFA 4IFVA 1A5WA 4CJRA 4DS4A 4FJ8A 3KD5E 3L2RA 3K2PA 3I0RA 3QETA 5KTQA 4J2AA 3OJSA 2PYJA 3WNEA 4DFMA 1TK5A 2Z1GA 4KFBA 2A1RA 3PY8A 2HHSA 2XY6A 1IKVA 1Z25A 4OJRA 3TANA 3V1RA 3MAQA 3SCXA 4W5NA 3AA4A 4UQGA 3NDKA 2Y1JA 1C0TA 1IG9A 5T7BA 1RDAA 1RT7A 4CHYA 4CF0A 3CFRA 4B9VA 1YTUA 3LP2A 4EZ9A 1B9FA 3DOKA 2IAJA 4DG1A 5C25A 1U45A 4C8LA 3OVNA 1SL0A 3M8SA 1RDCA 3KLHA 3OYAA 1QSYA 4CHOA 3VQ4A 3NH2A 2HB5A 3PX6A 2Z1JA 1WSEA 3A2FA 3VQCA 4CJVA 3SV4A 4OLBA 3LANA 4GMJB 2PYLA 4B9UA 2FBXA 1TGOA 3TAQA 4F2RA 4KAZA 5C42A 3OYEA 4DQIA 4CFCA 1NKBA 1HQUA 3ZSXA 3HVTA 1X9SA 1HPZA 3NF6A 4XIUA 4BDYA 1A5VA 1TAQA 2E6LA 3QIPA 4PA1A 5C24A 4AHVA 1HYSA 3DLRA 3O3HA 3LAMA 4F3TA 3IS9A 3KLEA 1BIZA 1KVAA 3O4NA 4CF8A 4HUEA 1B92A 1UWBA 3HL8A 4Z4HA 1NJZA 4J2BA 4KPYA 3U3YA 1NKCA 4CGIA 4CF2A 1CXUA 4KHQA 4I9QA 4KB0A 1RILA 1KLNA 4Y1DA 4DSIA 2KW4A 4RW4A 3CFOA 3TARA 1KVBA 2W42A 3NAEA 4DSJA 4NYNA 1S1XA 5HROA 4M41A 4OLAA 3VQ5A 3I8DA 3VQAA 4CJKA 1RT3A 5J1EA 4W5OA 2HMIA 2Z1IA 3L3VA 3NF9A 2XO7A 3UIQA 1J54A 4IFYA 4Z4FA 1I3AA 3VQ8A 1SKWA 3DI6A 1RBSA 2P1JA 1XI1A 1RDBA 5FRNA 1SL1A 1Q8IA 3KLGA 3HSTB 3LP3A 1C0UA 2VWJA 1U04A 3MECA 2D0BA 2HNZA 2JGUA
chains in the Genus database with same CATH superfamily
1NBWA 1YJ9N 3BDPA 3VESA 4H0PA 5AQWA 2B6AA 2P9KA 3L2WA 1QZ6A 2FBTA 1RT6A 4CFAA 2VCPA 3AY9A 1J5EK 3CIPA 4CEDA 1T03A 3N4PA 1NOZA 4JKFA 3TSQA 5EXWA 3FZKA 4LD0A 4B8CA 3ZEUA 2Y1IA 3I0SA 1ZBHA 4WQ5C 5JLHA 2WTUA 4OPAA 2HBJA 4H0VB 2NNWA 2IIRA 3V1QA 1X9WA 3AVLA 4O0IA 3O3FA 4DUZK 1CZ9A 2G8UA 4Y0WA 4DV2K 1KAZA 4A5AA 4CBXA 2P9KB 4LFBK 3K58A 3S3MA 4FL9A 4DV0K 4FPAA 4M7YA 5AQNA 3ZLJA 3FE1A 1MWMA 4IXCA 3RTVA 1RDWX 1QE1A 3NVMA 1BGXT 3KK1A 2UUCK 3ZEUB 1WOQA 1HYVA 3SAGA 3H6EA 4K8ZA 3HVRA 3DLEA 4HTUA 3SQ4A 3OHRA 1O1WA 2VWKA 1S1UA 3KJVA 2G8VA 3THYA 3TU5A 3QEXA 4CJPA 2GUIA 2A40A 3R1XA 4CJUA 1V4SA 4LH5A 1T6DA 4LF6K 2D0CA 1TVRA 3BGRA 3AA5X 1W2BM 3AA2A 4BRMA 1WSGA 4KHWA 5J2MA 1ATNA 1VSKA 4EZ6A 3BF3A 4AHUA 4N41A 3SNNA 3KZBA 3ULDA 5HP1A 5M1NA 5CYMA 1FXXA 3KK3A 3VENA 4B9LA 1XUPO 4V19S 2A6AA 5AZJA 1BCMA 1NK5A 1CXQA 5JS2A 3A8YA 1BCOA 2YNHA 4DTMA 3GG4A 3THYB 3SUNA 4JK8A 4X65K 4CZKA 4FLZA 5KRTA 4ID1A 3EKSA 1NG9A 4TSXA 4BR5A 4E7HA 3KK2A 4JS5A 3L0QA 2YHYA 3VQ7A 4B9SA 3JYTA 4WYBA 4M3YA 3LALA 1WN7A 5FROA 3C6UA 5AZIA 4CGHA 5AQVA 1KD1O 2DTUA 4E7JA 4JI3K 2E2NA 1JL2A 4YOTA 2HHXA 1SUQA 3PX0A 2HMPA 2HHTA 4H0TB 3KKSA 4H4MA 2EX3A 1VHXA 4BRAA 4X66K 2QWMA 4FJ5A 4HUFA 1S1WA 3CM6A 2A5XA 4M3ZA 3HJFA 4YNQA 2FF6A 3OBWA 3NVKA 1X1PA 4CGDA 1VSLA 5AQXA 1T05A 3LAKA 4FZYA 1IV0A 3DLHA 3B8AX 3V9SA 4M7XA 4DCHA 5I3UA 1J9AA 3CQ8A 4ID5A 2QXFA 4QCLA 5AZIB 1ILYA 4YOYA 3AVKA 4AHCA 3TPQA 2XY5A 4IDKA 4BGAA 3CC4N 3O6WA 4GVMA 4PY5A 1GLAG 3ENBA 2P9UA 2VG7A 3SJHA 4LH4A 2OPRA 2E88A 2RN2A 3HI0A 4FJGA 4DU1A 3O9UA 3SPYA 3P1GA 3OW2M 4OGEA 3ZSOA 4FLYA 1KAXA 4JEPA 3QNNA 5C15A 5CE3A 2P9NA 4DQRA 5F2RA 4CIGA 3TAFA 4YOUA 4OKEA 4R5PA 1LW2A 1D9DA 1NWKA 1RTDA 2D0PA 2KQ2A 3TWHA 3AGKA 4FLVA 2KZZA 4BE0A 3CCLN 3L6QA 4OGCA 1VSHA 3ZX3A 4KBOA 5LMUK 3MWPA 4DTUA 3J80O 1WB9A 5FRMA 5KPRA 1S1TA 1B9DA 1VQPN 4FXDA 3LM9A 5KQDA 1I39A 2FSKA 1L5UA 3GL1A 3NH0A 4E1NA 2P9NB 1JXBA 2CGJA 3D7EO 3AVJA 3KK7A 4YOXA 2RE2A 4C8KA 4FOIA 3O8MA 4RG8A 1N5YA 3OYMA 3BF1A 4CFBA 2QM1A 4C8MA 4DSFA 4ELTA 1W0HA 4DSKA 1GLDG 3ZSZA 4QS7A 4AM7A 4DSLA 4DF8A 3THVA 5B8HA 1U6ZA 2NUBA 1RBVA 3T1YK 1JCGA 2E4LA 1ASUA 4B9TA 3MXMA 5E84A 3ZT1A 3CMEN 1XC9A 1VSDA 4DTRA 4YORA 3DRRA 5FPNA 4WFBL 5C12A 5GAGP 4FM1A 3O3GA 1SV5A 1TUYA 3FZFA 4IOXA 4NLCA 4CEOA 3CFPA 4BR7A 4E7KA 1A5XA 3RSEA 4QAGA 1Z26A 3V9WA 4DV5K 4DR4K 4B3RK 4PHTX 4IO8A 4JKBA 3O9TA 3ZSWA 1NLVA 4F2SA 4DU3A 3HTVA 2F7TA 3WEEB 1JCEA 2ZF5O 3W3DA 4DTNA 2HHVA 5AQJA 4H5TA 2GWJA 4IWVA 4PQUA 3QB0A 4K8XA 1K8KB 2YKNA 1KLMA 4H8KA 3O9QA 4HCCA 3L4IA 3AVMA 3SBGA 5DM7L 4DQSA 2GUPA 3FFKB 3OYLA 4Z94A 3L2UA 5K14A 3WXIA 3RSEB 4Q0BA 4IBNA 3O4WA 4JYAK 1D4XA 1WSJA 1ZBFA 1WAFA 2Q1NA 4JK9A 3C6AA 3RVCA 5SZTA 3OYHA 3QESA 5J2QA 2IS3A 1TK0A 1VSIA 3DWLA 4Z0UA 1NOYA 5KRSA 4RWTA 4LF9K 1VQ5N 2QEXN 1WSFA 3AVFA 3S3NA 5F1XA 1ZBSA 4CCHA 1GOBA 3MN7A 4LSLA 1NMNA 3DRPA 4CE9A 1P90A 4DHYA 5AQPA 4ISFA 3QLHA 1NGDA 4CGGA 4DR2K 5CY4A 1UA1A 4Z4IA 3MN9A 1NM1A 3QEVA 3QMLA 1NK0A 4NO7A 1OVQA 3P5JA 5LMNK 5MLCQ 4I2QA 2B5JA 2D0AA 1IBLK 2IVPA 3T1HK 2XRIA 4H03B 5KGWA 4DS4A 3K2PA 3QETA 5KTQA 4J2AA 3OJSA 2PYJA 4JI0K 2JWKA 1Q18A 4KFBA 3VTHA 3PY8A 3CPEA 2XY6A 3AAPA 1XMOK 4OX9K 3MAQA 1XMQK 2Y1JA 1IG9A 1RT7A 4CHYA 3VF6A 2UXCK 4DG1A 5C25A 1I94K 4BRPA 1WBBA 5FPEA 3K9JA 3NH2A 4OLBA 5F0XA 2WFBA 2PYLA 3TAQA 5GAEP 1YHQN 3NF6A 5C24A 1TAQA 1W97L 3QIPA 5IWAK 4AHVA 4HTLA 4IEIA 3DLRA 3LAMA 1RDUA 3KLEA 1BIZA 3O4NA 4B1ZA 4DR7K 3H3NO 1B92A 1UWBA 3U8XA 1S3XA 3U3YA 4CGIA 4KB0A 4WCEL 4C1NK 4YDUC 1OH5A 2YHWA 1SAZA 5AQQA 1HNXK 1BA0A 4BREA 5HROA 3PIOL 3AGRA 4DV1K 3PSIA 3GOIA 4W5OA 2HMIA 3L3VA 4MDAA 1J54A 1QQNA 3VQ8A 2YHXA 4WFAL 1XI1A 1SKWA 3HBTA 3FR0A 3HSTB 2D0BA 3CM5A 1NK4A 4OPKA 5M1FA 2KKZA 3F73A 1REVA 1BA1A 4MLHA 4B9QA 4HCBA 1N8RO 1YI2N 1YF5L 2DFHA 1K6YA 1QZ5A 2F8SA 4HUGA 4CK3A 2FBVA 1EWRA 3B6OA 4BROA 4DSEA 3LDNA 3HO1A 1LWEA 3VGMA 3RR7A 4FWNA 5J2NA 3E9PA 3AVNA 4PWDA 3VN5A 2ETJA 4FJMA 3RMDA 3L8BA 4FZZA 1QS4A 4GY2B 2QWLA 3TSPA 1RFQA 3KKRA 4NCAA 4ILHA 5AQYA 4DQ8A 4AILC 4CEZA 3K57A 1VQ7N 3Q7CA 3TSUA 4H0OA 4CGJA 4EP5A 3T3FA 4LF5K 3MWTA 2NRTA 3A5LC 1TKTA 3ITHA 2ITMA 4JRPA 4BR4A 5D3GA 2R7YA 5E41A 2VQEK 1VQON 1S72N 4E89A 1ESVA 1C0FA 2FLOA 3OYCA 2GELA 4BRFA 3SUPA 1NGCA 4FWRA 1HYZA 2Q36A 4N47A 4QOZB 4DTOA 4CHZA 1YAGA 3LZIA 3AV9A 2UUBK 3WXJA 3O9RA 4LC9B 4RCHA 4CEBA 4BE2A 4OKKA 4FJJA 2OCEA 3A5MC 4CZFA 3AO2A 4C8NA 3DLKA 1MDUB 4H0XB 1O13A 3TTFA 4M42A 1QHAA 3G71N 3U6FA 3CD6N 3EL2A 3I33A 3EO3A 3OYBA 4J2DA 1QSSA 1BISA 5CR4A 3CCQN 4DV7K 2OZSA 4NB4A 3ATVA 2E2QA 4YOWA 1R0AA 2NRZA 2QWQA 4AF1A 4L8RB 2W6KA 1HRHA 2DFEA 4H0YB 3HPOA 2NZTA 4DF4A 3IFRA 3V6DA 3ZT2A 2I5JA 1CLQA 3OYIA 3DXKA 3I56N 3PSFA 2Z1HA 3IG1A 1JLAA 1S9EA 4FM2A 1S22A 1VQ8N 1WUAA 1X3NA 2YKMA 3FZHA 3O80A 3F9KA 3G0ZA 1RT1A 3HXMA 1NMDA 3WQTA 4B8AB 1QSLA 4DR1K 3HOTA 4L3QA 2ZGZA 4CD1A 2HHQA 5LL6Z 3ZYYX 4JKGA 4CEEA 3J7ZO 4NYFA 4XEIA 3DYAA 1KSPA 4ICLA 3QDKA 2Q97A 1HKBA 1NK7A 1QQMA 1GOCA 1QHTA 3VEWA 4LFAK 4WF9L 5EY4A 4PUOA 2QA4N 1Y64A 5BPNA 1V4TA 1U49A 2X6NA 3DXKB 1XNQK 4IG0A 1IBMK 2OPPA 2A3ZA 3E9LA 5HL7L 3C94A 1LV5A 2BANA 5H1SQ 4U7BA 2ZD1A 4WE1A 1BDGA 4M3WA 4KI6A 2G8FA 1XWLA 3EZ5A 4A2AA 4JKGB 3CI5A 3OYNA 4CJ7A 3F5TA 4DUYK 2WC9A 4NXMK 3VGLA 4I6MA 4B9MA 1KVCA 1W9HA 5BN8A 5AQZA 2P9PA 2QWOA 1U4BA 3G25A 3OYGA 3P31A 3CCRN 4BC5A 1EO1A 3NE6A 1RDDA 1IH7A 4JRQA 1YIJN 1LAWA 1LWCA 4DTJA 3QICA 1KFSA 4I9LA 5FDLA 4MO4A 3VQDA 4X62K 1E4GT 5KPZA 2YJFA 5JS1A 2FF3B 4CHPA 3S41A 3KHYA 4BDPA 4CVNE 4B1VA 2E20A 4CECA 1C0GA 3R6MA 2P9SA 3D45A 3AVBA 3CPWM 2XY8A 3VETA 3SQ2A 1QTMA 4I6MB 2YV0X 2ZWHA 4CJLA 4CK1A 3ENOA 3AVIA 2GBZA 2P9PB 5KQ8A 2YHAA 3K5OA 1KAYA 3E9OA 1JLFA 4Z4GA 3LP0A 2V51B 4FM0A 1JLCA 3VOVA 4F3OA 4FK2A 4N76A 4AH9A 4FO0A 4CEAA 3VQBA 1C6VA 2YX6A 5C2FA 4DWIA 1BIUA 5I42A 3ZT4A 1EKEA 4DTSA 4JS4A 5FLXO 3AVAA 4NCGA 2P9SB 3L4QA 5A2QO 2E2OA 4JKHA 3SZ2A 5AQFA 3CCJN 2PY5A 3FZMA 3MXJA 3TTDA 3H45C 3CJCA 4CJ5A 3QIOA 3CCEN 3V1OA 2O4IA 2E5LK 1HLUA 3HOSA 3V81A 3WUHA 1KXPA 4CEQA 2O8FA 1WSIA 1YUWA 4K42A 5AFUA 4DS5A 2QWNA 1KFDA 4FSVA 1RBTA 4I7FA 3CMAN 3AARA 1RTIA 4CJQA 4BRGA 2QKBA 3AAQA 5J2PA 2CGLA 1TV6A 3HZ6A 3ZETB 4HWIA 2P5OA 1NKEA 3EYZA 3D0PA 3U9DA 4DV3K 5KPTA 4O4GA 1S6PA 2O8CA 2OTLN 1HJRA 2ZQBA 4DKWA 3H3OB 5GIOA 4IOCL 1RT2A 1X9MA 4F8RA 2O8FB 3DRSA 2Q0RA 4O8KA 3QO9A 2OTJN 4KH4A 3JXUA 1NJXA 4GVEA 4M63C 2P9IA 2QWPA 1HJOA 3SK3A 3S3OA 2VQFK 1NK9A 2UXDK 1NK8A 4JKEA 3SAHA 1DGKN 4DMNA 4U67L 4IDHA 4ELUA 2HVIA 4O55A 4FJXA 5AQLA 2O8CB 3MEGA 4E7LA 4F9OA 1LW0A 4FVMA 3VGKA 4PL7A 5AQMA 1A5WA 4FJ8A 3KD5E 3EEQA 3I0RA 3VEXA 2UU9K 2E2PA 1QVFM 4DR3K 4DFMA 2Z1GA 2A1RA 2P9IB 2HHSA 1IKVA 1Z25A 3SCXA 2RHKA 4UQGA 4IJAA 4K43A 5T7BA 1RDAA 1XNRK 4CZGA 3CFRA 2NRVA 1BO5O 5AQTA 1U45A 2ZM6K 1Q7YO 3WEEA 2YI1A 2O8EA 2Z1JA 3A2FA 1MA9B 3C0BA 4JKCA 3NMUA 4ILGB 3WXKA 4KAZA 3A5NC 1K8KA 1JCFA 4A61A 2A42A 3HVTA 3VF2A 1HPZA 1X9SA 5AQUA 4J8FA 2FSJA 3P38A 4F3TA 4JNEA 3MDQA 2YJEA 1KVAA 1X3MA 4A62A 3VEOA 4J2BA 3HL8A 3ZX2A 4CF2A 4LFCK 4LF8K 1RILA 4DSIA 2KW4A 3R8EA 1EWQA 4E1JA 5AFUH 4DSJA 1S1XA 5JVGL 3I8DA 3VQAA 1RT3A 1R59O 4BC3A 2Z1IA 4Z4FA 2O8EB 4IFYA 4AQYK 3H46O 3DI6A 1HNWK 1Q8IA 3DJCA 3KLGA 3M5RA 2W6LA 3J7YP 3LP3A 5GIPA 1E4FT 3TTCA 4JI7K 4Z4CA 4JI8K 4OVLA 1C1BA 3K0SA 3FFIA 4B3MK 3EKUA 4F4KA 3CF5L 1MWKA 3VQEA 3EY1A 4H5WA 3QEIA 4KI4A 1DTQA 2QWRA 1J5OA 1YT3A 3DLLL 4CD3A 1KC8O 4C8OA 1TKZA 3V9XA 2XY7A 1FKOA 1KTQA 2NRHA 4CZLA 4KHUA 5AQSA 2IVNA 3C95A 2ZJPL 5HRSA 1NJYA 2D1KA 4B1XB 3MCAB 3D2FA 4FOEA 3DLBA 2RF2A 2EHGA 4AHRA 2RPIA 3JAMO 2FBYA 3DM2A 3TAMA 4BE1A 3P4IA 2HF3A 3KLFA 2ZE2A 2KFZA 4AHTA 1T7PA 2VG6A 2O4GA 1LWFA 4IZ9A 1MU2A 4JI4K 2NRXA 1WBDA 2HNYA 5CYQA 1ATRA 4PL8A 3OS0A 4E1MA 1NGAA 1YJWN 1VAZA 3HP9A 5IT9O 1HKGA 4RW8A 3CQXA 3H08A 2BDPA 2LSNA 4Y1CA 3D2FB 3NBPA 1TYQA 3CJBA 5JMVA 4FZXC 2CH6A 4JI6K 2D5RA 4AHSA 4KTQA 1XC3A 4BVOA 1KQSM 4FYDA 1K9MO 1FK9A 4O5BA 4DQQA 4NCBA 4W5RA 3KD1E 2PZSA 1EETA 4BR2A 4FVUA 1SQKA 4Q5VA 4A57A 2ZGYA 5I9EB 1RNHA 3G6EN 1N36K 1W7AA 4DTPA 5KI6A 3W0LA 4M3XA 4EIAA 4KHSA 3TAEA 1VQKN 4K41A 3A5OC 3DAWA 1YJNN 1EQYA 3ZSQA 1FW6A 4JHDA 3B6PA 1TYQB 3LL3A 3SI6A 3D6RA 3UB5A 4CESA 3DXMA 4BC2A 5AQGA 1ZYQA 4O5FA 3M6GA 3CCUN 2JWLA 3I55N 2F9TA 5GAHP 3QBWA 2XHBA 1D8YA 4JN4A 3RRHA 3QEPA 1BL3A 1GOAA 5BREA 4IG3A 3AO5A 3OYFA 1N6QA 2YNGA 4KHPK 3ZSRA 1VSFA 1KCFA 3U9ZA 3PIPL 3AVGA 4G9ZA 3NHGA 2V52B 3THXB 1CZAN 4EFHA 3LM2A 4JD2A 4BWJA 4JHDB 3OTOK 4RW7A 1FJGK 4O44A 1NGIA 4DLGA 2X78A 4BRDA 1D5AA 3DXMB 1JL1A 2OANA 4E19A 2VWBA 5FPMA 4CHNA 3WNFA 3LZJA 3HSCA 4EP4A 1VQMN 2O8BB 4KKOA 2BH1A 3PO4A 1JKHA 1YVNA 1HNIA 1JLQA 4JI1K 1OVYA 4FW2A 2QTDA 3CYMA 2W41A 3CCSN 3DMJA 3LP1A 1K73O 3OJUA 3IKMA 1HQEA 3MEEA 1NJWA 3RWUA 2F8TA 1WNSA 1XQSC 1G15A 4BRCA 4CHQA 3KVGA 3T1AA 4DR6K 1HR0K 5BRDA 1VSMA 4KH5A 3TR8A 4B1UB 4JD2B 3SQ0A 1QQOA 3NF7A 3A0IX 4Z4EA 4C23A 1S1VA 3ZT3A 3U4LA 1IO2A 2PBDA 4EAHD 1C1CA 3ZCMA 3P39A 4CJ4A 3OYKA 2HBLA 2E6MA 4BC4A 4O0JA 3SPZA 2PAVA 3SLCA 2HF4A 2H3GX 1IG8A 2BE2A 1JXEA 3HPGA 4FWKA 5AQKA 3VEYA 4DFJA 4GV9A 1S5JA 3NH1A 3LPUA 2X74A 3NGYA 4GV3A 4JI5K 4KREA 3L3UA 3CG7A 1M1KO 1HNVA 3FZLA 1ASWA 1TL1A 4IFEA 4EHUA 4ZHRA 2VGMA 3ZT0A 4RTFD 4OO1J 1SKSA 4W5QA 2YNFA 1BG3A 1L3TA 1BUPA 4DQPA 1TKXA 1YTAA 1OH6A 5JICA 4N56A 4DB3A 4E0DA 4FWPA 4B1WB 4N5SA 1ASVA 4KV8A 2BGGA 4WFNL 1M90O 2P51A 4MQ3A 1GLCG 4XH4A 5CZ2A 3CXCM 2G8IA 3F2KA 4FW1A 5HRPA 1XHXA 4CIEA 1VK0A 4JLHA 1TK8A 3TAGA 1J6ZA 2YHBA 3CJ1A 4IKFA 1NGHA 3KLIA 1VRTA 1RT5A 3NGIA 3HYFA 4K25A 4DFPA 3K5MA 3VQPA 1D9FA 1FKPA 3HRGA 3ZX0A 1U47A 4A2BA 4A59A 4CZHA 3OA9A 4FWQA 2GV9A 4GW6A 4OPJA 4FK4A 2NRRA 5FPDA 4CK2A 4CJEA 5CHIA 2HBKA 4FPBA 1DLOA 4B1YB 1L3VA 1U48A 4CJWA 3K59A 3DOLA 3R9PA 1Q82O 3KTQA 3QEWA 4RW9A 5LJWA 3DLGA 2VYPA 4JKAA 4DLEA 1ZBLA 1S9GA 1E3MA 1KRPA 3O1WA 2HHHK 4LY7A 3QFUA 4CBWA 4C1NI 1VRUA 3C6TA 1ZXOA 1BI4A 4BG8A 2ZJRL 3QBXA 4BRQA 3MMVA 4FWSA 3LDOA 3SBTA 2AA4A 3ZSVA 4FJ9A 1DT9A 2Q2RA 3EN9A 4KB1A 1BQMA 2WUSA 1BWFO 1HUXA 3ISNC 2F4VK 5AR0A 2OYQA 3RMBA 4M3TA 2AP1A 2ASOA 2YNIA 4E3SA 3NFAA 4M3UA 1IBKK 4JV5K 2W40A 4FWOA 3QNOA 1QVGM 2IOCA 2EWSA 1NGBA 4BR9A 1VSJA 3D2EA 3CERA 1OH8A 1SZ2A 4CIFA 1UAXA 2ATQA 1BI4B 1NGGA 1IKXA 3RMCA 2RKIA 4CI6A 3CJ7A 3O4QA 4FWLA 5AQIA 2ITGA 4CZMA 1P8ZA 1YITN 3ASMA 4M3RA 1ZBUA 1GLEG 4KRFA 3PX4A 3MK6A 4CJRA 1GLLO 4GV6A 3SAFA 3WNEA 5BPLA 1TK5A 4OJRA 3TANA 3V1RA 4W5NA 3NDKA 1N32K 1C0TA 3D2EB 5E26A 2CH5A 3THWA 4B9VA 4EZ9A 1B9FA 1BU6O 4IOAL 3OBYA 1RDCA 1QSYA 3OYAA 3VQ4A 2HB5A 1WSEA 3C7NA 2D0OA 3LANA 4B9UA 2FBXA 4F2RA 5C42A 3E1YA 3OYEA 2E8AA 3ZSXA 4BDYA 4XIUA 4PA1A 3O3HA 1H1VA 1HKCA 4MO5A 3G4SN 3J7AP 3BZKA 4CF8A 3ZETA 3M1FA 3C6HA 4Z4HA 4KPYA 3WXLA 1NU0A 2F9WA 1CXUA 4KHQA 3ULEA 1KLNA 3MCPA 4MDBA 3CFOA 3THWB 3TARA 2W42A 3NAEA 4M41A 4PKHA 4OLAA 3VQ5A 3QFPA 4WQ4A 5BPMA 5J1EA 3UIQA 2XO7A 3C7NB 1RBSA 2P1JA 1BOTO 1NNEA 2O8DA 4B3SK 5AZJB 1OKJA 4NXNK 2VWJA 1U04A 3MECA 2JGUA 3O5BA 4CF1A 1Y97A 3VA3A 3V4IA 4CW7B 5C0YA 2KFNA 4XH5A 3VF4A 3WNGA 4FJIA 4LSNA 1Z05A 1HX1A 4BWMA 4CJTA 3ULEB 4E7IA 2KLAA 3GE1A 3BEXA 5AJ3K 3LDPA 4FK0A 3MXIA 2G8HA 4FJ7A 3BY5A 4H5RA 3SUQA 1GLJO 5HRRA 3C65A 1F21A 4H5VA 2O8DB 4BG9A 4OKJA 1GLFO 4J2EA 3LWLA 3M3ZA 4G1QA 3O9SA 3SMSA 4WQ5A 2OPQA 3L2QA 2HW3A 4DTXA 3SYZA 2P9LA 1NK6A 1HNZK 1X9JA 5KGXA 1TKDA 2HSTA 4YFUA 5JVHL 1ITGA 4GKKK 2IDOA 4QS8A 3ID8A 1EX4A 2OA8A 4FJLA 3VQ6A 4JAXA 3MX5A 2A1SA 4KHYA 1VQLN 1J53A 5TKWA 2GEMA 3V9UA 4BRLA 1BHLA 1C0MA 2P9UB 4BRHA 3T7ZA 1IKYA 3CETA 5TKYA 1VSEA 3H1QA 2G8WA 4OPHA 4ISGA 4BACA 1TL3A 1QQCA 5M1QA 2HNDA 2P9LB 2WONA 3LPTA 4A5BA 1DTTA 3GBTA 4R79A 1YXQA 2NLXA 3OS2A 4UY8O 3IAYA 4RW6A 2VGNA 3VQ9A 3VQQA 4FJNA 4IEEA 5M1KA 1NJIO 4CBUA 4KO0A 1HMVA 2KZMA 1L3UA 2Q31A 3CJ9A 3VPZA 5BN9A 3IRXA 4B3OA 2DY4A 3TAPA 4BR0A 2CGKA 5SWMA 2UUAK 3MN5A 3NCIA 3U3GA 5ADXA 1WAJA 3BP8A 1UA0A 4B9NA 4YOVA 2B4JA 2F96A 1GLBG 3WT0A 1T3VA 2IVOA 4KTZA 3WXMB 3QINA 3T69A 3ENHA 1Q86O 3FGUA 5AQHA 1VQ9N 3CC7N 5EVZA 3HT3A 1SL2A 3ZSYA 5JLFA 4CJSA 3ALYA 3M8QA 2Q0UA 1RTJA 2HHWA 4PKGA 5LJVA 3OYDA 1BQNA 1Q9YA 2FXUA 1DEJA 4ZTFA 5BR9A 3LDSA 2Q3SA 3L2VA 4KH6A 3VMFB 3RMAA 3AO3A 1Q81O 4MLEA 1TUUA 4M45A 4IJNA 4DR5K 3HK2A 1C1AA 3UE5A 5LY3A 1N34K 2BTFA 2IGIA 3M8RA 1LOTB 4X64K 2HBMA 4ELVA 3TI0A 4BRKA 1JLEA 4CF9A 4MFBA 5M1PA 4CZIA 3V9ZA 2QKKA 5CZ1A 2E1ZA 3K9KA 4LF4K 4JKDA 2DPNA 2UYTA 4CGFA 4BQZA 1K8AO 1RBUA 5BRFA 4DFKA 3NGZA 5EX5A 4K0KK 1RT4A 2JLEA 3MEDA 5HLFA 3WQUA 2ASPA 1TAUA 3G10A 2HOEA 1IKWA 1T44A 1N33K 2GWKA 4CEFA 4ISEA 3VERA 5HOOA 3TABA 3CHWA 3IUCA 4W5TA 1U2VA 5AQRA 3JS6A 1Q9XA 3AO4A 3EE8A 2G8KA 2I7PA 3EZWA 3AO1A 3CCVN 5HRNA 4GKJK 2P5GA 4QS9A 3J81O 3VEVA 3MX2A 3KWIA 4B3TK 4BRNA 3QERA 3WNHA 1JJ2M 2KTQA 3N4QA 3VTIA 4HVJA 4CERA 3NF8A 2I7NA 2IC3A 5HBMA 3THXA 3O08A 2WOMA 3M8PA 4H4OA 3LDLA 3PO5A 3HPHA 3HM9A 3GDQA 4NLBA 1HPMA 3SJJA 1SKRA 4BY9C 5ADXH 1EXQA 1U2VB 5BR8K 3K5NA 3OS1A 3RRGA 2V7YA 3E66A 3OY9A 1VQNN 2O8BA 1WLJA 2PFUA 3SUOA 4KTWA 3UKRA 3E01A 2OZMA 4CFDA 1NGJA 4CJFA 1CZBA 4LF7K 2HHUA 4FJHA 3JSMA 3LWMA 3AA3A 2ASMA 2FC0A 4FLUA 1JLBA 1ATSA 3VEZA 5DMRA 4FWMA 2QXLA 2X6SA 2DFFA 3SV3A 3PUFA 3BUZB 3K5LA 4FLXA 4CJ3A 1DKGD 3AVHA 4BDZA 4ILJA 1XHZA 3SMPA 4H5NA 3SQ1A 1L3SA 3VA0A 5AQOA 4YY3K 4YHHK 2QI2A 3BZCA 4DU4A 4FLWA 1G99A 4KHNA 5C10A 4BRIA 3P83D 2KHOA 2AJQA 3S9HA 3UKRB 1LAVA 1RCHA 3LDQA 4HHTA 4I2PA 1T8EA 3RR8A 3IMXA 3CC2N 4FCYA 4CZJA 1WSHA 3CQYA 5M1OA 3EE9A 1ZBIA 4BGBA 3I8BA 4B08A 4ZTJA 2QK9A 2NRWA 3HM8A 3O1BA 2VG5A 1UOCA 4PKIA 3PV8A 1RTHA 1JLGA 2OPSA 5EU7A 4FLTA 3OYJA 3PLAA 2HVHA 1NGFA 1YVUA 3T19A 2D4WA 4JK7A 5DK5A 3UKUA 2WBNA 2A41A 2E1YA 2BUPA 2UXBK 3HP6A 1ZC6A 4CZEA 1EP4A 4FJKA 2J4RA 3ATUA 3CJAA 3AVCA 1RBRA 3Q7BA 5DM6L 4O8UA 5GADP 1S6QA 2GX9A 4GNIA 3KIOA 4DV6K 4EHTA 4IFVA 4BVPA 3L2RA 2ZJQL 5EOYA 3J8AA 4DV4K 4AM6A 3ID6A 5ELZA 5GINA 3AA4A 3UKUB 1IJJA 4CF0A 1YTUA 3LP2A 3DOKA 2IAJA 4XH1A 4C8LA 3OVNA 3FLCO 1SS6A 3M8SA 1SL0A 3KLHA 4CHOA 3IDHA 3PX6A 4BQLA 3VQCA 2FSNA 3MN6A 4CJVA 3SV4A 3CCMN 4GMJB 1OH7A 1TGOA 2GTDA 5BRHA 4DQIA 4CFCA 1NKBA 1HQUA 2QW9A 3H1VX 4JI2K 1A5VA 2E6LA 1HYSA 4WQ4C 3IS9A 4HUEA 1NGEA 1NJZA 1NKCA 4I9QA 3F9MA 4Y1DA 5C2DA 2V7ZA 4RW4A 3KWGA 1KVBA 1RGIA 1VQ6N 4NYNA 1LCUA 1Z6RA 4IO9L 4CJKA 2YCHA 3NF9A 1I3AA 1RDBA 3R3LA 1SL1A 5FRNA 1T6CA 1C0UA 1VQ4N 2HNZA 4YDUA
chains in the Genus database with same CATH topology
3CM5A 4Z4CA 1NK4A 4OVLA 3BDPA 1C1BA 4CF1A 2B6AA 4OPKA 3L2WA 3F73A 3FFIA 1Y97A 2FBTA 1REVA 1RT6A 4CFAA 4F4KA 4HCBA 3VA3A 3VQEA 3EY1A 3QEIA 3V4IA 4KI4A 4CEDA 1DTQA 1T03A 1J5OA 1YT3A 2DFHA 1K6YA 2F8SA 2KFNA 4HUGA 3WNGA 4CK3A 4C8OA 1TKZA 2FBVA 4LSNA 4FJIA 1NOZA 3V9XA 2XY7A 3B6OA 4BWMA 1FKOA 1KTQA 4CJTA 4E7IA 4LD0A 4B8CA 4DSEA 4KHUA 3HO1A 1LWEA 3RR7A 3C95A 5J2NA 2Y1IA 5HRSA 3I0SA 1NJYA 4FK0A 3AVNA 3MXIA 2G8HA 3VN5A 1ZBHA 4FJ7A 2ETJA 4PWDA 3SUQA 5HRRA 4FJMA 3DLBA 2RF2A 3RMDA 2EHGA 4AHRA 3L8BA 1F21A 2RPIA 4FZZA 3V1QA 1QS4A 1X9WA 2FBYA 3DM2A 3AVLA 3TAMA 4OKJA 4O0IA 4BE1A 3KKRA 4NCAA 3O3FA 4J2EA 1CZ9A 3LWLA 2G8UA 3KLFA 4AILC 4G1QA 2ZE2A 4CEZA 4AHTA 1T7PA 2KFZA 3K57A 2VG6A 3K58A 2O4GA 3S3MA 1LWFA 1MU2A 2OPQA 3L2QA 2HNYA 4CGJA 4EP5A 3T3FA 5CYQA 4DTXA 2HW3A 3SYZA 3OS0A 1TKTA 4E1MA 1NK6A 3ITHA 4JRPA 3RTVA 5KGXA 3HP9A 5D3GA 2R7YA 1QE1A 1TKDA 1BGXT 3KK1A 4YFUA 5E41A 4RW8A 1HYVA 4E89A 3H08A 1ITGA 4K8ZA 2IDOA 3HVRA 3DLEA 3OYCA 2BDPA 2LSNA 4HTUA 3SQ4A 3SUPA 1HYZA 4Y1CA 1EX4A 2OA8A 1O1WA 2VWKA 1S1UA 4N47A 3VQ6A 3KJVA 4FJLA 4QOZB 3NBPA 4DTOA 2G8VA 4FZXC 4CHZA 3QEXA 4CJPA 2A1SA 2GUIA 3LZIA 2D5RA 4AHSA 3AV9A 4KTQA 4CJUA 4KHYA 4LH5A 4QCLA 1J53A 2D0CA 1TVRA 3BGRA 3AA5X 3V9UA 4FYDA 4CEBA 1BHLA 4OKKA 1C0MA 3AA2A 4BE2A 1FK9A 4O5BA 1IKYA 4DQQA 1WSGA 3AO2A 4FJJA 4C8NA 4W5RA 5J2MA 2PZSA 3KD1E 1EETA 1VSKA 1VSEA 4EZ6A 3DLKA 2G8WA 4N41A 4AHUA 3SNNA 4Q5VA 4BACA 4M42A 3ULDA 5HP1A 1TL3A 1QQCA 3U6FA 2HNDA 5CYMA 1FXXA 1RNHA 2WONA 3OYBA 3LPTA 3KK3A 4J2DA 1DTTA 1QSSA 4DTPA 5KI6A 4B9LA 1BISA 4M3XA 3OS2A 1BCMA 1NK5A 1CXQA 2OZSA 4KHSA 3TAEA 3IAYA 5JS2A 4RW6A 1BCOA 2YNHA 3VQ9A 4DTMA 1R0AA 3VQQA 4FJNA 3ZSQA 4L8RB 3B6PA 3SI6A 1HRHA 2DFEA 4KO0A 1HMVA 2KZMA 3SUNA 1L3UA 4CESA 4FLZA 3HPOA 3IRXA 4B3OA 5KRTA 4ID1A 1ZYQA 2DY4A 4TSXA 3TAPA 4DF4A 3V6DA 5SWMA 4E7HA 3ZT2A 2I5JA 2XHBA 3KK2A 4JS5A 3RRHA 3NCIA 3QEPA 1D8YA 1CLQA 3U3GA 1BL3A 3OYIA 1GOAA 3VQ7A 4B9SA 1WAJA 3JYTA 1UA0A 4IG3A 4B9NA 4M3YA 2Z1HA 3IG1A 1JLAA 3LALA 2B4JA 1S9EA 3AO5A 4FM2A 1WN7A 3OYFA 1N6QA 5FROA 2F96A 3C6UA 2YNGA 4CGHA 2DTUA 3ZSRA 1VSFA 2YKMA 4KTZA 1JL2A 4E7JA 3QINA 1KCFA 3F9KA 3G0ZA 1RT1A 3HXMA 2HHXA 3AVGA 4B8AB 1QSLA 1SUQA 3PX0A 2HHTA 3HT3A 3NHGA 1SL2A 2HHQA 3ZSYA 3KKSA 4CEEA 4CJSA 4H4MA 2EX3A 3ALYA 3M8QA 3DYAA 1RTJA 4ICLA 4NYFA 4O44A 4RW7A 1KSPA 4DLGA 2HHWA 2X78A 3OYDA 1BQNA 4FJ5A 1D5AA 4HUFA 1Q9YA 1JL1A 1S1WA 3CM6A 4BWJA 4ZTFA 1NK7A 4E19A 3LDSA 2Q3SA 3L2VA 4M3ZA 1GOCA 1QHTA 4CHNA 3HJFA 3RMAA 3WNFA 4YNQA 3LZJA 4EP4A 1X1PA 4CGDA 1VSLA 3AO3A 4KKOA 1T05A 3PO4A 4PUOA 1JKHA 3LAKA 4FZYA 4M45A 1U49A 1HNIA 2X6NA 1JLQA 4IG0A 3DLHA 2OPPA 3V9SA 4FW2A 3HK2A 3CYMA 5I3UA 1C1AA 1J9AA 3DMJA 3CQ8A 3C94A 3LP1A 2IGIA 4ID5A 2QXFA 3OJUA 1HQEA 2BANA 3MEEA 3M8RA 1NJWA 1LV5A 1WNSA 3RWUA 2F8TA 3AVKA 4AHCA 2XY5A 1G15A 2ZD1A 4IDKA 4ELVA 4WE1A 4M3WA 4CHQA 4KI6A 4GVMA 3T1AA 3TI0A 2G8FA 4PY5A 1XWLA 1JLEA 2VG7A 4CF9A 4MFBA 3EZ5A 3V9ZA 2QKKA 1VSMA 4LH4A 2OPRA 3TR8A 2RN2A 3SQ0A 5CZ1A 3NF7A 3OYNA 4FJGA 4DU1A 4CGFA 4Z4EA 3SPYA 3P1GA 1S1VA 3ZT3A 4OGEA 3ZSOA 4FLYA 1IO2A 1RBUA 1C1CA 3ZCMA 4CJ4A 3QNNA 3OYKA 3NGZA 2E6MA 4DFKA 4B9MA 1KVCA 1W9HA 4DQRA 1RT4A 4CIGA 4O0JA 1U4BA 3TAFA 3SPZA 2JLEA 3MEDA 3OYGA 5HLFA 2HHUA 2BE2A 1JXEA 3HPGA 4DFJA 4OKEA 4R5PA 1LW2A 1S5JA 3G10A 1TAUA 3NH1A 1D9DA 3LPUA 3NE6A 1RDDA 1IKWA 4CEFA 1RTDA 1IH7A 2X74A 2KQ2A 3NGYA 4JRQA 3TWHA 4FLVA 2KZZA 1LAWA 1LWCA 3TABA 4DTJA 4BE0A 1KFSA 4I9LA 5FDLA 4KREA 3VQDA 3L3UA 3CG7A 4W5TA 1HNVA 4ZHRA 1ASWA 1TL1A 1Q9XA 3AO4A 4OGCA 1VSHA 3ZT0A 5JS1A 4CHPA 2G8KA 4BDPA 4DTUA 3AO1A 1SKSA 5FRMA 5HRNA 4CECA 2P5GA 4W5QA 2YNFA 1S1TA 1B9DA 3D45A 4FXDA 3AVBA 3SQ2A 2XY8A 3QERA 1L3TA 1I39A 1QTMA 1L5UA 1TKXA 4DQPA 2YV0X 1YTAA 3NH0A 4E1NA 4CJLA 4N56A 3WNHA 4CK1A 1JXBA 4E0DA 2KTQA 3AVIA 2GBZA 4N5SA 4HVJA 4CERA 1ASVA 3NF8A 4KV8A 2BGGA 2IC3A 2YHAA 5HBMA 4KHWA 3K5OA 3AVJA 2P51A 2WOMA 3M8PA 4MQ3A 4C8KA 4H4OA 1JLFA 5CZ2A 4RG8A 1N5YA 2G8IA 4FW1A 5HRPA 3OYMA 3PO5A 1XHXA 4Z4GA 3HPHA 3LP0A 4CFBA 3HM9A 4CIEA 4C8MA 1VK0A 4FM0A 1W0HA 1JLCA 4JLHA 3ZSZA 4DSFA 3SJJA 3TAGA 2YHBA 4AH9A 1TK8A 1SKRA 4DF8A 4F3OA 4N76A 3K5NA 1EXQA 3THVA 3OS1A 2NUBA 4IKFA 3RRGA 3KLIA 4CEAA 1VRTA 1C6VA 3VQBA 3OY9A 4DWIA 1WLJA 1BIUA 1RBVA 1RT5A 3NGIA 3HYFA 5I42A 3SUOA 4KTWA 2E4LA 1ASUA 3VQPA 3K5MA 4DFPA 3ZT4A 3MXMA 4B9TA 1D9FA 1EKEA 1FKPA 3ZT1A 3E01A 4JS4A 3AVAA 4NCGA 4CFDA 4DTSA 1U47A 1XC9A 2OZMA 1VSDA 4DTRA 4ELTA 4DSLA 4CJFA 2GV9A 1CZBA 3DRRA 4GW6A 4OPJA 4DSKA 4NCBA 4FJHA 3JSMA 4FK4A 3LWMA 3AA3A 2FC0A 4FM1A 4FLUA 1JLBA 4CK2A 5DMRA 4CJEA 1SV5A 3O3GA 3SZ2A 2X6SA 2DFFA 4CEOA 2PY5A 4E7KA 3CFPA 1A5XA 4QAGA 1Z26A 3SV3A 3PUFA 3MXJA 3V9WA 3K5LA 1DLOA 4CJ5A 3QIOA 4FLXA 1L3VA 3V1OA 4CJ3A 1U48A 3AVHA 4BDZA 2O4IA 4CJWA 3K59A 3DOLA 1XHZA 3ZSWA 4F2SA 3SQ1A 1L3SA 3VA0A 3KTQA 3V81A 3QEWA 4DU3A 4RW9A 4FK2A 4CEQA 1WSIA 3DLGA 4DLEA 4FLWA 4DU4A 1ZBLA 4KHNA 4DTNA 2HHVA 1S9GA 4DS5A 1KFDA 3P83D 1KRPA 1RBTA 4I7FA 4PQUA 2AJQA 3S9HA 1RTIA 4CJQA 4K8XA 1LAVA 2YKNA 4LY7A 1KLMA 4H8KA 1RCHA 4HHTA 1VRUA 3C6TA 4I2PA 1T8EA 3RR8A 4HCCA 2QKBA 1BI4A 5J2PA 3AVMA 1TV6A 4DQSA 4FCYA 3ZSVA 1WSHA 3OYLA 3L2UA 2P5OA 4FJ9A 5K14A 4Q0BA 4IBNA 1NKEA 4KB1A 3EYZA 3D0PA 1BQMA 1ZBIA 4O4GA 1S6PA 3ISNC 1WSJA 4B08A 1ZBFA 4ZTJA 1WAFA 2QK9A 1HJRA 3OYHA 5SZTA 3QESA 2VG5A 2OYQA 5J2QA 2IS3A 3RMBA 2ZQBA 1UOCA 1X9MA 1TK0A 1RT2A 1VSIA 4F8RA 3DRSA 4M3TA 4Z0UA 1NOYA 5KRSA 2YNIA 4E3SA 3NFAA 3PV8A 3QO9A 1WSFA 4M3UA 1RTHA 1JLGA 3AVFA 3S3NA 1NJXA 2OPSA 5EU7A 3QNOA 4FLTA 2IOCA 1GOBA 3OYJA 4LSLA 4CCHA 3DRPA 2HVHA 4CE9A 1YVUA 3T19A 1VSJA 5DK5A 3QLHA 3S3OA 4CGGA 4CIFA 5CY4A 1UA1A 1NK9A 4Z4IA 1UAXA 2ATQA 3HP6A 1BI4B 1NK8A 1IKXA 3RMCA 2RKIA 4DMNA 3QEVA 1EP4A 4FJKA 4ELUA 3O4QA 2HVIA 1NK0A 4O55A 4FJXA 2ITGA 3AVCA 3P5JA 1RBRA 4I2QA 2B5JA 2D0AA 3ASMA 1S6QA 3MEGA 4E7LA 2XRIA 3KIOA 4M3RA 5KGWA 1LW0A 1ZBUA 4FVMA 3PX4A 4KRFA 4IFVA 1A5WA 4CJRA 4DS4A 4FJ8A 3KD5E 3L2RA 3K2PA 3I0RA 3QETA 5KTQA 4J2AA 3OJSA 2PYJA 3WNEA 4DFMA 1TK5A 2Z1GA 4KFBA 2A1RA 3PY8A 2HHSA 2XY6A 1IKVA 1Z25A 4OJRA 3TANA 3V1RA 3MAQA 3SCXA 4W5NA 3AA4A 4UQGA 3NDKA 2Y1JA 1C0TA 1IG9A 5T7BA 1RDAA 1RT7A 4CHYA 4CF0A 3CFRA 4B9VA 1YTUA 3LP2A 4EZ9A 1B9FA 3DOKA 2IAJA 4DG1A 5C25A 1U45A 4C8LA 3OVNA 1SL0A 3M8SA 1RDCA 3KLHA 3OYAA 1QSYA 4CHOA 3VQ4A 3NH2A 2HB5A 3PX6A 2Z1JA 1WSEA 3A2FA 3VQCA 4CJVA 3SV4A 4OLBA 3LANA 4GMJB 2PYLA 4B9UA 2FBXA 1TGOA 3TAQA 4F2RA 4KAZA 5C42A 3OYEA 4DQIA 4CFCA 1NKBA 1HQUA 3ZSXA 3HVTA 1X9SA 1HPZA 3NF6A 4XIUA 4BDYA 1A5VA 1TAQA 2E6LA 3QIPA 4PA1A 5C24A 4AHVA 1HYSA 3DLRA 3O3HA 3LAMA 4F3TA 3IS9A 3KLEA 1BIZA 1KVAA 3O4NA 4CF8A 4HUEA 1B92A 1UWBA 3HL8A 4Z4HA 1NJZA 4J2BA 4KPYA 3U3YA 1NKCA 4CGIA 4CF2A 1CXUA 4KHQA 4I9QA 4KB0A 1RILA 1KLNA 4Y1DA 4DSIA 2KW4A 4RW4A 3CFOA 3TARA 1KVBA 2W42A 3NAEA 4DSJA 4NYNA 1S1XA 5HROA 4M41A 4OLAA 3VQ5A 3I8DA 3VQAA 4CJKA 1RT3A 5J1EA 4W5OA 2HMIA 2Z1IA 3L3VA 3NF9A 2XO7A 3UIQA 1J54A 4IFYA 4Z4FA 1I3AA 3VQ8A 1SKWA 3DI6A 1RBSA 2P1JA 1XI1A 1RDBA 5FRNA 1SL1A 1Q8IA 3KLGA 3HSTB 3LP3A 1C0UA 2VWJA 1U04A 3MECA 2D0BA 2HNZA 2JGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CM5 A;  4Z4C A;  1NK4 A;  4OVL A;  3BDP A;  1C1B A;  4CF1 A;  2B6A A;  4OPK A;  3L2W A;  3F73 A;  3FFI A;  1Y97 A;  2FBT A;  1REV A;  1RT6 A;  4CFA A;  4F4K A;  4HCB A;  3VA3 A;  3VQE A;  3EY1 A;  3QEI A;  3V4I A;  4KI4 A;  4CED A;  1DTQ A;  1T03 A;  1J5O A;  1YT3 A;  2DFH A;  1K6Y A;  2F8S A;  2KFN A;  4HUG A;  3WNG A;  4CK3 A;  4C8O A;  1TKZ A;  2FBV A;  4LSN A;  4FJI A;  1NOZ A;  3V9X A;  2XY7 A;  3B6O A;  4BWM A;  1FKO A;  1KTQ A;  4CJT A;  4E7I A;  4LD0 A;  4B8C A;  4DSE A;  4KHU A;  3HO1 A;  1LWE A;  3RR7 A;  3C95 A;  5J2N A;  2Y1I A;  5HRS A;  3I0S A;  1NJY A;  4FK0 A;  3AVN A;  3MXI A;  2G8H A;  3VN5 A;  1ZBH A;  4FJ7 A;  2ETJ A;  4PWD A;  3SUQ A;  5HRR A;  4FJM A;  3DLB A;  2RF2 A;  3RMD A;  2EHG A;  4AHR A;  3L8B A;  1F21 A;  2RPI A;  4FZZ A;  3V1Q A;  1QS4 A;  1X9W A;  2FBY A;  3DM2 A;  3AVL A;  3TAM A;  4OKJ A;  4O0I A;  4BE1 A;  3KKR A;  4NCA A;  3O3F A;  4J2E A;  1CZ9 A;  3LWL A;  2G8U A;  3KLF A;  4AIL C;  4G1Q A;  2ZE2 A;  4CEZ A;  4AHT A;  1T7P A;  2KFZ A;  3K57 A;  2VG6 A;  3K58 A;  2O4G A;  3S3M A;  1LWF A;  1MU2 A;  2OPQ A;  3L2Q A;  2HNY A;  4CGJ A;  4EP5 A;  3T3F A;  5CYQ A;  4DTX A;  2HW3 A;  3SYZ A;  3OS0 A;  1TKT A;  4E1M A;  1NK6 A;  3ITH A;  4JRP A;  3RTV A;  5KGX A;  3HP9 A;  5D3G A;  2R7Y A;  1QE1 A;  1TKD A;  1BGX T;  3KK1 A;  4YFU A;  5E41 A;  4RW8 A;  1HYV A;  4E89 A;  3H08 A;  1ITG A;  4K8Z A;  2IDO A;  3HVR A;  3DLE A;  3OYC A;  2BDP A;  2LSN A;  4HTU A;  3SQ4 A;  3SUP A;  1HYZ A;  4Y1C A;  1EX4 A;  2OA8 A;  1O1W A;  2VWK A;  1S1U A;  4N47 A;  3VQ6 A;  3KJV A;  4FJL A;  4QOZ B;  3NBP A;  4DTO A;  2G8V A;  4FZX C;  4CHZ A;  3QEX A;  4CJP A;  2A1S A;  2GUI A;  3LZI A;  2D5R A;  4AHS A;  3AV9 A;  4KTQ A;  4CJU A;  4KHY A;  4LH5 A;  4QCL A;  1J53 A;  2D0C A;  1TVR A;  3BGR A;  3AA5 X;  3V9U A;  4FYD A;  4CEB A;  1BHL A;  4OKK A;  1C0M A;  3AA2 A;  4BE2 A;  1FK9 A;  4O5B A;  1IKY A;  4DQQ A;  1WSG A;  3AO2 A;  4FJJ A;  4C8N A;  4W5R A;  5J2M A;  2PZS A;  3KD1 E;  1EET A;  1VSK A;  1VSE A;  4EZ6 A;  3DLK A;  2G8W A;  4N41 A;  4AHU A;  3SNN A;  4Q5V A;  4BAC A;  4M42 A;  3ULD A;  5HP1 A;  1TL3 A;  1QQC A;  3U6F A;  2HND A;  5CYM A;  1FXX A;  1RNH A;  2WON A;  3OYB A;  3LPT A;  3KK3 A;  4J2D A;  1DTT A;  1QSS A;  4DTP A;  5KI6 A;  4B9L A;  1BIS A;  4M3X A;  3OS2 A;  1BCM A;  1NK5 A;  1CXQ A;  2OZS A;  4KHS A;  3TAE A;  3IAY A;  5JS2 A;  4RW6 A;  1BCO A;  2YNH A;  3VQ9 A;  4DTM A;  1R0A A;  3VQQ A;  4FJN A;  3ZSQ A;  4L8R B;  3B6P A;  3SI6 A;  1HRH A;  2DFE A;  4KO0 A;  1HMV A;  2KZM A;  3SUN A;  1L3U A;  4CES A;  4FLZ A;  3HPO A;  3IRX A;  4B3O A;  5KRT A;  4ID1 A;  1ZYQ A;  2DY4 A;  4TSX A;  3TAP A;  4DF4 A;  3V6D A;  5SWM A;  4E7H A;  3ZT2 A;  2I5J A;  2XHB A;  3KK2 A;  4JS5 A;  3RRH A;  3NCI A;  3QEP A;  1D8Y A;  1CLQ A;  3U3G A;  1BL3 A;  3OYI A;  1GOA A;  3VQ7 A;  4B9S A;  1WAJ A;  3JYT A;  1UA0 A;  4IG3 A;  4B9N A;  4M3Y A;  2Z1H A;  3IG1 A;  1JLA A;  3LAL A;  2B4J A;  1S9E A;  3AO5 A;  4FM2 A;  1WN7 A;  3OYF A;  1N6Q A;  5FRO A;  2F96 A;  3C6U A;  2YNG A;  4CGH A;  2DTU A;  3ZSR A;  1VSF A;  2YKM A;  4KTZ A;  1JL2 A;  4E7J A;  3QIN A;  1KCF A;  3F9K A;  3G0Z A;  1RT1 A;  3HXM A;  2HHX A;  3AVG A;  4B8A B;  1QSL A;  1SUQ A;  3PX0 A;  2HHT A;  3HT3 A;  3NHG A;  1SL2 A;  2HHQ A;  3ZSY A;  3KKS A;  4CEE A;  4CJS A;  4H4M A;  2EX3 A;  3ALY A;  3M8Q A;  3DYA A;  1RTJ A;  4ICL A;  4NYF A;  4O44 A;  4RW7 A;  1KSP A;  4DLG A;  2HHW A;  2X78 A;  3OYD A;  1BQN A;  4FJ5 A;  1D5A A;  4HUF A;  1Q9Y A;  1JL1 A;  1S1W A;  3CM6 A;  4BWJ A;  4ZTF A;  1NK7 A;  4E19 A;  3LDS A;  2Q3S A;  3L2V A;  4M3Z A;  1GOC A;  1QHT A;  4CHN A;  3HJF A;  3RMA A;  3WNF A;  4YNQ A;  3LZJ A;  4EP4 A;  1X1P A;  4CGD A;  1VSL A;  3AO3 A;  4KKO A;  1T05 A;  3PO4 A;  4PUO A;  1JKH A;  3LAK A;  4FZY A;  4M45 A;  1U49 A;  1HNI A;  2X6N A;  1JLQ A;  4IG0 A;  3DLH A;  2OPP A;  3V9S A;  4FW2 A;  3HK2 A;  3CYM A;  5I3U A;  1C1A A;  1J9A A;  3DMJ A;  3CQ8 A;  3C94 A;  3LP1 A;  2IGI A;  4ID5 A;  2QXF A;  3OJU A;  1HQE A;  2BAN A;  3MEE A;  3M8R A;  1NJW A;  1LV5 A;  1WNS A;  3RWU A;  2F8T A;  3AVK A;  4AHC A;  2XY5 A;  1G15 A;  2ZD1 A;  4IDK A;  4ELV A;  4WE1 A;  4M3W A;  4CHQ A;  4KI6 A;  4GVM A;  3T1A A;  3TI0 A;  2G8F A;  4PY5 A;  1XWL A;  1JLE A;  2VG7 A;  4CF9 A;  4MFB A;  3EZ5 A;  3V9Z A;  2QKK A;  1VSM A;  4LH4 A;  2OPR A;  3TR8 A;  2RN2 A;  3SQ0 A;  5CZ1 A;  3NF7 A;  3OYN A;  4FJG A;  4DU1 A;  4CGF A;  4Z4E A;  3SPY A;  3P1G A;  1S1V A;  3ZT3 A;  4OGE A;  3ZSO A;  4FLY A;  1IO2 A;  1RBU A;  1C1C A;  3ZCM A;  4CJ4 A;  3QNN A;  3OYK A;  3NGZ A;  2E6M A;  4DFK A;  4B9M A;  1KVC A;  1W9H A;  4DQR A;  1RT4 A;  4CIG A;  4O0J A;  1U4B A;  3TAF A;  3SPZ A;  2JLE A;  3MED A;  3OYG A;  5HLF A;  2HHU A;  2BE2 A;  1JXE A;  3HPG A;  4DFJ A;  4OKE A;  4R5P A;  1LW2 A;  1S5J A;  3G10 A;  1TAU A;  3NH1 A;  1D9D A;  3LPU A;  3NE6 A;  1RDD A;  1IKW A;  4CEF A;  1RTD A;  1IH7 A;  2X74 A;  2KQ2 A;  3NGY A;  4JRQ A;  3TWH A;  4FLV A;  2KZZ A;  1LAW A;  1LWC A;  3TAB A;  4DTJ A;  4BE0 A;  1KFS A;  4I9L A;  5FDL A;  4KRE A;  3VQD A;  3L3U A;  3CG7 A;  4W5T A;  1HNV A;  4ZHR A;  1ASW A;  1TL1 A;  1Q9X A;  3AO4 A;  4OGC A;  1VSH A;  3ZT0 A;  5JS1 A;  4CHP A;  2G8K A;  4BDP A;  4DTU A;  3AO1 A;  1SKS A;  5FRM A;  5HRN A;  4CEC A;  2P5G A;  4W5Q A;  2YNF A;  1S1T A;  1B9D A;  3D45 A;  4FXD A;  3AVB A;  3SQ2 A;  2XY8 A;  3QER A;  1L3T A;  1I39 A;  1QTM A;  1L5U A;  1TKX A;  4DQP A;  2YV0 X;  1YTA A;  3NH0 A;  4E1N A;  4CJL A;  4N56 A;  3WNH A;  4CK1 A;  1JXB A;  4E0D A;  2KTQ A;  3AVI A;  2GBZ A;  4N5S A;  4HVJ A;  4CER A;  1ASV A;  3NF8 A;  4KV8 A;  2BGG A;  2IC3 A;  2YHA A;  5HBM A;  4KHW A;  3K5O A;  3AVJ A;  2P51 A;  2WOM A;  3M8P A;  4MQ3 A;  4C8K A;  4H4O A;  1JLF A;  5CZ2 A;  4RG8 A;  1N5Y A;  2G8I A;  4FW1 A;  5HRP A;  3OYM A;  3PO5 A;  1XHX A;  4Z4G A;  3HPH A;  3LP0 A;  4CFB A;  3HM9 A;  4CIE A;  4C8M A;  1VK0 A;  4FM0 A;  1W0H A;  1JLC A;  4JLH A;  3ZSZ A;  4DSF A;  3SJJ A;  3TAG A;  2YHB A;  4AH9 A;  1TK8 A;  1SKR A;  4DF8 A;  4F3O A;  4N76 A;  3K5N A;  1EXQ A;  3THV A;  3OS1 A;  2NUB A;  4IKF A;  3RRG A;  3KLI A;  4CEA A;  1VRT A;  1C6V A;  3VQB A;  3OY9 A;  4DWI A;  1WLJ A;  1BIU A;  1RBV A;  1RT5 A;  3NGI A;  3HYF A;  5I42 A;  3SUO A;  4KTW A;  2E4L A;  1ASU A;  3VQP A;  3K5M A;  4DFP A;  3ZT4 A;  3MXM A;  4B9T A;  1D9F A;  1EKE A;  1FKP A;  3ZT1 A;  3E01 A;  4JS4 A;  3AVA A;  4NCG A;  4CFD A;  4DTS A;  1U47 A;  1XC9 A;  2OZM A;  1VSD A;  4DTR A;  4ELT A;  4DSL A;  4CJF A;  2GV9 A;  1CZB A;  3DRR A;  4GW6 A;  4OPJ A;  4DSK A;  4NCB A;  4FJH A;  3JSM A;  4FK4 A;  3LWM A;  3AA3 A;  2FC0 A;  4FM1 A;  4FLU A;  1JLB A;  4CK2 A;  5DMR A;  4CJE A;  1SV5 A;  3O3G A;  3SZ2 A;  2X6S A;  2DFF A;  4CEO A;  2PY5 A;  4E7K A;  3CFP A;  1A5X A;  4QAG A;  1Z26 A;  3SV3 A;  3PUF A;  3MXJ A;  3V9W A;  3K5L A;  1DLO A;  4CJ5 A;  3QIO A;  4FLX A;  1L3V A;  3V1O A;  4CJ3 A;  1U48 A;  3AVH A;  4BDZ A;  2O4I A;  4CJW A;  3K59 A;  3DOL A;  1XHZ A;  3ZSW A;  4F2S A;  3SQ1 A;  1L3S A;  3VA0 A;  3KTQ A;  3V81 A;  3QEW A;  4DU3 A;  4RW9 A;  4FK2 A;  4CEQ A;  1WSI A;  3DLG A;  4DLE A;  4FLW A;  4DU4 A;  1ZBL A;  4KHN A;  4DTN A;  2HHV A;  1S9G A;  4DS5 A;  1KFD A;  3P83 D;  1KRP A;  1RBT A;  4I7F A;  4PQU A;  2AJQ A;  3S9H A;  1RTI A;  4CJQ A;  4K8X A;  1LAV A;  2YKN A;  4LY7 A;  1KLM A;  4H8K A;  1RCH A;  4HHT A;  1VRU A;  3C6T A;  4I2P A;  1T8E A;  3RR8 A;  4HCC A;  2QKB A;  1BI4 A;  5J2P A;  3AVM A;  1TV6 A;  4DQS A;  4FCY A;  3ZSV A;  1WSH A;  3OYL A;  3L2U A;  2P5O A;  4FJ9 A;  5K14 A;  4Q0B A;  4IBN A;  1NKE A;  4KB1 A;  3EYZ A;  3D0P A;  1BQM A;  1ZBI A;  4O4G A;  1S6P A;  3ISN C;  1WSJ A;  4B08 A;  1ZBF A;  4ZTJ A;  1WAF A;  2QK9 A;  1HJR A;  3OYH A;  5SZT A;  3QES A;  2VG5 A;  2OYQ A;  5J2Q A;  2IS3 A;  3RMB A;  2ZQB A;  1UOC A;  1X9M A;  1TK0 A;  1RT2 A;  1VSI A;  4F8R A;  3DRS A;  4M3T A;  4Z0U A;  1NOY A;  5KRS A;  2YNI A;  4E3S A;  3NFA A;  3PV8 A;  3QO9 A;  1WSF A;  4M3U A;  1RTH A;  1JLG A;  3AVF A;  3S3N A;  1NJX A;  2OPS A;  5EU7 A;  3QNO A;  4FLT A;  2IOC A;  1GOB A;  3OYJ A;  4LSL A;  4CCH A;  3DRP A;  2HVH A;  4CE9 A;  1YVU A;  3T19 A;  1VSJ A;  5DK5 A;  3QLH A;  3S3O A;  4CGG A;  4CIF A;  5CY4 A;  1UA1 A;  1NK9 A;  4Z4I A;  1UAX A;  2ATQ A;  3HP6 A;  1BI4 B;  1NK8 A;  1IKX A;  3RMC A;  2RKI A;  4DMN A;  3QEV A;  1EP4 A;  4FJK A;  4ELU A;  3O4Q A;  2HVI A;  1NK0 A;  4O55 A;  4FJX A;  2ITG A;  3AVC A;  3P5J A;  1RBR A;  4I2Q A;  2B5J A;  2D0A A;  3ASM A;  1S6Q A;  3MEG A;  4E7L A;  2XRI A;  3KIO A;  4M3R A;  5KGW A;  1LW0 A;  1ZBU A;  4FVM A;  3PX4 A;  4KRF A;  4IFV A;  1A5W A;  4CJR A;  4DS4 A;  4FJ8 A;  3KD5 E;  3L2R A;  3K2P A;  3I0R A;  3QET A;  5KTQ A;  4J2A A;  3OJS A;  2PYJ A;  3WNE A;  4DFM A;  1TK5 A;  2Z1G A;  4KFB A;  2A1R A;  3PY8 A;  2HHS A;  2XY6 A;  1IKV A;  1Z25 A;  4OJR A;  3TAN A;  3V1R A;  3MAQ A;  3SCX A;  4W5N A;  3AA4 A;  4UQG A;  3NDK A;  2Y1J A;  1C0T A;  1IG9 A;  5T7B A;  1RDA A;  1RT7 A;  4CHY A;  4CF0 A;  3CFR A;  4B9V A;  1YTU A;  3LP2 A;  4EZ9 A;  1B9F A;  3DOK A;  2IAJ A;  4DG1 A;  5C25 A;  1U45 A;  4C8L A;  3OVN A;  1SL0 A;  3M8S A;  1RDC A;  3KLH A;  3OYA A;  1QSY A;  4CHO A;  3VQ4 A;  3NH2 A;  2HB5 A;  3PX6 A;  2Z1J A;  1WSE A;  3A2F A;  3VQC A;  4CJV A;  3SV4 A;  4OLB A;  3LAN A;  4GMJ B;  2PYL A;  4B9U A;  2FBX A;  1TGO A;  3TAQ A;  4F2R A;  4KAZ A;  5C42 A;  3OYE A;  4DQI A;  4CFC A;  1NKB A;  1HQU A;  3ZSX A;  3HVT A;  1X9S A;  1HPZ A;  3NF6 A;  4XIU A;  4BDY A;  1A5V A;  1TAQ A;  2E6L A;  3QIP A;  4PA1 A;  5C24 A;  4AHV A;  1HYS A;  3DLR A;  3O3H A;  3LAM A;  4F3T A;  3IS9 A;  3KLE A;  1BIZ A;  1KVA A;  3O4N A;  4CF8 A;  4HUE A;  1B92 A;  1UWB A;  3HL8 A;  4Z4H A;  1NJZ A;  4J2B A;  4KPY A;  3U3Y A;  1NKC A;  4CGI A;  4CF2 A;  1CXU A;  4KHQ A;  4I9Q A;  4KB0 A;  1RIL A;  1KLN A;  4Y1D A;  4DSI A;  2KW4 A;  4RW4 A;  3CFO A;  3TAR A;  1KVB A;  2W42 A;  3NAE A;  4DSJ A;  4NYN A;  1S1X A;  5HRO A;  4M41 A;  4OLA A;  3VQ5 A;  3I8D A;  3VQA A;  4CJK A;  1RT3 A;  5J1E A;  4W5O A;  2HMI A;  2Z1I A;  3L3V A;  3NF9 A;  2XO7 A;  3UIQ A;  1J54 A;  4IFY A;  4Z4F A;  1I3A A;  3VQ8 A;  1SKW A;  3DI6 A;  1RBS A;  2P1J A;  1XI1 A;  1RDB A;  5FRN A;  1SL1 A;  1Q8I A;  3KLG A;  3HST B;  3LP3 A;  1C0U A;  2VWJ A;  1U04 A;  3MEC A;  2D0B A;  2HNZ A;  2JGU A; 
#chains in the Genus database with same CATH topology
 1NBW A;  1YJ9 N;  3BDP A;  3VES A;  4H0P A;  5AQW A;  2B6A A;  2P9K A;  3L2W A;  1QZ6 A;  2FBT A;  1RT6 A;  4CFA A;  2VCP A;  3AY9 A;  1J5E K;  3CIP A;  4CED A;  1T03 A;  3N4P A;  1NOZ A;  4JKF A;  3TSQ A;  5EXW A;  3FZK A;  4LD0 A;  4B8C A;  3ZEU A;  2Y1I A;  3I0S A;  1ZBH A;  4WQ5 C;  5JLH A;  2WTU A;  4OPA A;  2HBJ A;  4H0V B;  2NNW A;  2IIR A;  3V1Q A;  1X9W A;  3AVL A;  4O0I A;  3O3F A;  4DUZ K;  1CZ9 A;  2G8U A;  4Y0W A;  4DV2 K;  1KAZ A;  4A5A A;  4CBX A;  2P9K B;  4LFB K;  3K58 A;  3S3M A;  4FL9 A;  4DV0 K;  4FPA A;  4M7Y A;  5AQN A;  3ZLJ A;  3FE1 A;  1MWM A;  4IXC A;  3RTV A;  1RDW X;  1QE1 A;  3NVM A;  1BGX T;  3KK1 A;  2UUC K;  3ZEU B;  1WOQ A;  1HYV A;  3SAG A;  3H6E A;  4K8Z A;  3HVR A;  3DLE A;  4HTU A;  3SQ4 A;  3OHR A;  1O1W A;  2VWK A;  1S1U A;  3KJV A;  2G8V A;  3THY A;  3TU5 A;  3QEX A;  4CJP A;  2GUI A;  2A40 A;  3R1X A;  4CJU A;  1V4S A;  4LH5 A;  1T6D A;  4LF6 K;  2D0C A;  1TVR A;  3BGR A;  3AA5 X;  1W2B M;  3AA2 A;  4BRM A;  1WSG A;  4KHW A;  5J2M A;  1ATN A;  1VSK A;  4EZ6 A;  3BF3 A;  4AHU A;  4N41 A;  3SNN A;  3KZB A;  3ULD A;  5HP1 A;  5M1N A;  5CYM A;  1FXX A;  3KK3 A;  3VEN A;  4B9L A;  1XUP O;  4V19 S;  2A6A A;  5AZJ A;  1BCM A;  1NK5 A;  1CXQ A;  5JS2 A;  3A8Y A;  1BCO A;  2YNH A;  4DTM A;  3GG4 A;  3THY B;  3SUN A;  4JK8 A;  4X65 K;  4CZK A;  4FLZ A;  5KRT A;  4ID1 A;  3EKS A;  1NG9 A;  4TSX A;  4BR5 A;  4E7H A;  3KK2 A;  4JS5 A;  3L0Q A;  2YHY A;  3VQ7 A;  4B9S A;  3JYT A;  4WYB A;  4M3Y A;  3LAL A;  1WN7 A;  5FRO A;  3C6U A;  5AZI A;  4CGH A;  5AQV A;  1KD1 O;  2DTU A;  4E7J A;  4JI3 K;  2E2N A;  1JL2 A;  4YOT A;  2HHX A;  1SUQ A;  3PX0 A;  2HMP A;  2HHT A;  4H0T B;  3KKS A;  4H4M A;  2EX3 A;  1VHX A;  4BRA A;  4X66 K;  2QWM A;  4FJ5 A;  4HUF A;  1S1W A;  3CM6 A;  2A5X A;  4M3Z A;  3HJF A;  4YNQ A;  2FF6 A;  3OBW A;  3NVK A;  1X1P A;  4CGD A;  1VSL A;  5AQX A;  1T05 A;  3LAK A;  4FZY A;  1IV0 A;  3DLH A;  3B8A X;  3V9S A;  4M7X A;  4DCH A;  5I3U A;  1J9A A;  3CQ8 A;  4ID5 A;  2QXF A;  4QCL A;  5AZI B;  1ILY A;  4YOY A;  3AVK A;  4AHC A;  3TPQ A;  2XY5 A;  4IDK A;  4BGA A;  3CC4 N;  3O6W A;  4GVM A;  4PY5 A;  1GLA G;  3ENB A;  2P9U A;  2VG7 A;  3SJH A;  4LH4 A;  2OPR A;  2E88 A;  2RN2 A;  3HI0 A;  4FJG A;  4DU1 A;  3O9U A;  3SPY A;  3P1G A;  3OW2 M;  4OGE A;  3ZSO A;  4FLY A;  1KAX A;  4JEP A;  3QNN A;  5C15 A;  5CE3 A;  2P9N A;  4DQR A;  5F2R A;  4CIG A;  3TAF A;  4YOU A;  4OKE A;  4R5P A;  1LW2 A;  1D9D A;  1NWK A;  1RTD A;  2D0P A;  2KQ2 A;  3TWH A;  3AGK A;  4FLV A;  2KZZ A;  4BE0 A;  3CCL N;  3L6Q A;  4OGC A;  1VSH A;  3ZX3 A;  4KBO A;  5LMU K;  3MWP A;  4DTU A;  3J80 O;  1WB9 A;  5FRM A;  5KPR A;  1S1T A;  1B9D A;  1VQP N;  4FXD A;  3LM9 A;  5KQD A;  1I39 A;  2FSK A;  1L5U A;  3GL1 A;  3NH0 A;  4E1N A;  2P9N B;  1JXB A;  2CGJ A;  3D7E O;  3AVJ A;  3KK7 A;  4YOX A;  2RE2 A;  4C8K A;  4FOI A;  3O8M A;  4RG8 A;  1N5Y A;  3OYM A;  3BF1 A;  4CFB A;  2QM1 A;  4C8M A;  4DSF A;  4ELT A;  1W0H A;  4DSK A;  1GLD G;  3ZSZ A;  4QS7 A;  4AM7 A;  4DSL A;  4DF8 A;  3THV A;  5B8H A;  1U6Z A;  2NUB A;  1RBV A;  3T1Y K;  1JCG A;  2E4L A;  1ASU A;  4B9T A;  3MXM A;  5E84 A;  3ZT1 A;  3CME N;  1XC9 A;  1VSD A;  4DTR A;  4YOR A;  3DRR A;  5FPN A;  4WFB L;  5C12 A;  5GAG P;  4FM1 A;  3O3G A;  1SV5 A;  1TUY A;  3FZF A;  4IOX A;  4NLC A;  4CEO A;  3CFP A;  4BR7 A;  4E7K A;  1A5X A;  3RSE A;  4QAG A;  1Z26 A;  3V9W A;  4DV5 K;  4DR4 K;  4B3R K;  4PHT X;  4IO8 A;  4JKB A;  3O9T A;  3ZSW A;  1NLV A;  4F2S A;  4DU3 A;  3HTV A;  2F7T A;  3WEE B;  1JCE A;  2ZF5 O;  3W3D A;  4DTN A;  2HHV A;  5AQJ A;  4H5T A;  2GWJ A;  4IWV A;  4PQU A;  3QB0 A;  4K8X A;  1K8K B;  2YKN A;  1KLM A;  4H8K A;  3O9Q A;  4HCC A;  3L4I A;  3AVM A;  3SBG A;  5DM7 L;  4DQS A;  2GUP A;  3FFK B;  3OYL A;  4Z94 A;  3L2U A;  5K14 A;  3WXI A;  3RSE B;  4Q0B A;  4IBN A;  3O4W A;  4JYA K;  1D4X A;  1WSJ A;  1ZBF A;  1WAF A;  2Q1N A;  4JK9 A;  3C6A A;  3RVC A;  5SZT A;  3OYH A;  3QES A;  5J2Q A;  2IS3 A;  1TK0 A;  1VSI A;  3DWL A;  4Z0U A;  1NOY A;  5KRS A;  4RWT A;  4LF9 K;  1VQ5 N;  2QEX N;  1WSF A;  3AVF A;  3S3N A;  5F1X A;  1ZBS A;  4CCH A;  1GOB A;  3MN7 A;  4LSL A;  1NMN A;  3DRP A;  4CE9 A;  1P90 A;  4DHY A;  5AQP A;  4ISF A;  3QLH A;  1NGD A;  4CGG A;  4DR2 K;  5CY4 A;  1UA1 A;  4Z4I A;  3MN9 A;  1NM1 A;  3QEV A;  3QML A;  1NK0 A;  4NO7 A;  1OVQ A;  3P5J A;  5LMN K;  5MLC Q;  4I2Q A;  2B5J A;  2D0A A;  1IBL K;  2IVP A;  3T1H K;  2XRI A;  4H03 B;  5KGW A;  4DS4 A;  3K2P A;  3QET A;  5KTQ A;  4J2A A;  3OJS A;  2PYJ A;  4JI0 K;  2JWK A;  1Q18 A;  4KFB A;  3VTH A;  3PY8 A;  3CPE A;  2XY6 A;  3AAP A;  1XMO K;  4OX9 K;  3MAQ A;  1XMQ K;  2Y1J A;  1IG9 A;  1RT7 A;  4CHY A;  3VF6 A;  2UXC K;  4DG1 A;  5C25 A;  1I94 K;  4BRP A;  1WBB A;  5FPE A;  3K9J A;  3NH2 A;  4OLB A;  5F0X A;  2WFB A;  2PYL A;  3TAQ A;  5GAE P;  1YHQ N;  3NF6 A;  5C24 A;  1TAQ A;  1W97 L;  3QIP A;  5IWA K;  4AHV A;  4HTL A;  4IEI A;  3DLR A;  3LAM A;  1RDU A;  3KLE A;  1BIZ A;  3O4N A;  4B1Z A;  4DR7 K;  3H3N O;  1B92 A;  1UWB A;  3U8X A;  1S3X A;  3U3Y A;  4CGI A;  4KB0 A;  4WCE L;  4C1N K;  4YDU C;  1OH5 A;  2YHW A;  1SAZ A;  5AQQ A;  1HNX K;  1BA0 A;  4BRE A;  5HRO A;  3PIO L;  3AGR A;  4DV1 K;  3PSI A;  3GOI A;  4W5O A;  2HMI A;  3L3V A;  4MDA A;  1J54 A;  1QQN A;  3VQ8 A;  2YHX A;  4WFA L;  1XI1 A;  1SKW A;  3HBT A;  3FR0 A;  3HST B;  2D0B A;  3CM5 A;  1NK4 A;  4OPK A;  5M1F A;  2KKZ A;  3F73 A;  1REV A;  1BA1 A;  4MLH A;  4B9Q A;  4HCB A;  1N8R O;  1YI2 N;  1YF5 L;  2DFH A;  1K6Y A;  1QZ5 A;  2F8S A;  4HUG A;  4CK3 A;  2FBV A;  1EWR A;  3B6O A;  4BRO A;  4DSE A;  3LDN A;  3HO1 A;  1LWE A;  3VGM A;  3RR7 A;  4FWN A;  5J2N A;  3E9P A;  3AVN A;  4PWD A;  3VN5 A;  2ETJ A;  4FJM A;  3RMD A;  3L8B A;  4FZZ A;  1QS4 A;  4GY2 B;  2QWL A;  3TSP A;  1RFQ A;  3KKR A;  4NCA A;  4ILH A;  5AQY A;  4DQ8 A;  4AIL C;  4CEZ A;  3K57 A;  1VQ7 N;  3Q7C A;  3TSU A;  4H0O A;  4CGJ A;  4EP5 A;  3T3F A;  4LF5 K;  3MWT A;  2NRT A;  3A5L C;  1TKT A;  3ITH A;  2ITM A;  4JRP A;  4BR4 A;  5D3G A;  2R7Y A;  5E41 A;  2VQE K;  1VQO N;  1S72 N;  4E89 A;  1ESV A;  1C0F A;  2FLO A;  3OYC A;  2GEL A;  4BRF A;  3SUP A;  1NGC A;  4FWR A;  1HYZ A;  2Q36 A;  4N47 A;  4QOZ B;  4DTO A;  4CHZ A;  1YAG A;  3LZI A;  3AV9 A;  2UUB K;  3WXJ A;  3O9R A;  4LC9 B;  4RCH A;  4CEB A;  4BE2 A;  4OKK A;  4FJJ A;  2OCE A;  3A5M C;  4CZF A;  3AO2 A;  4C8N A;  3DLK A;  1MDU B;  4H0X B;  1O13 A;  3TTF A;  4M42 A;  1QHA A;  3G71 N;  3U6F A;  3CD6 N;  3EL2 A;  3I33 A;  3EO3 A;  3OYB A;  4J2D A;  1QSS A;  1BIS A;  5CR4 A;  3CCQ N;  4DV7 K;  2OZS A;  4NB4 A;  3ATV A;  2E2Q A;  4YOW A;  1R0A A;  2NRZ A;  2QWQ A;  4AF1 A;  4L8R B;  2W6K A;  1HRH A;  2DFE A;  4H0Y B;  3HPO A;  2NZT A;  4DF4 A;  3IFR A;  3V6D A;  3ZT2 A;  2I5J A;  1CLQ A;  3OYI A;  3DXK A;  3I56 N;  3PSF A;  2Z1H A;  3IG1 A;  1JLA A;  1S9E A;  4FM2 A;  1S22 A;  1VQ8 N;  1WUA A;  1X3N A;  2YKM A;  3FZH A;  3O80 A;  3F9K A;  3G0Z A;  1RT1 A;  3HXM A;  1NMD A;  3WQT A;  4B8A B;  1QSL A;  4DR1 K;  3HOT A;  4L3Q A;  2ZGZ A;  4CD1 A;  2HHQ A;  5LL6 Z;  3ZYY X;  4JKG A;  4CEE A;  3J7Z O;  4NYF A;  4XEI A;  3DYA A;  1KSP A;  4ICL A;  3QDK A;  2Q97 A;  1HKB A;  1NK7 A;  1QQM A;  1GOC A;  1QHT A;  3VEW A;  4LFA K;  4WF9 L;  5EY4 A;  4PUO A;  2QA4 N;  1Y64 A;  5BPN A;  1V4T A;  1U49 A;  2X6N A;  3DXK B;  1XNQ K;  4IG0 A;  1IBM K;  2OPP A;  2A3Z A;  3E9L A;  5HL7 L;  3C94 A;  1LV5 A;  2BAN A;  5H1S Q;  4U7B A;  2ZD1 A;  4WE1 A;  1BDG A;  4M3W A;  4KI6 A;  2G8F A;  1XWL A;  3EZ5 A;  4A2A A;  4JKG B;  3CI5 A;  3OYN A;  4CJ7 A;  3F5T A;  4DUY K;  2WC9 A;  4NXM K;  3VGL A;  4I6M A;  4B9M A;  1KVC A;  1W9H A;  5BN8 A;  5AQZ A;  2P9P A;  2QWO A;  1U4B A;  3G25 A;  3OYG A;  3P31 A;  3CCR N;  4BC5 A;  1EO1 A;  3NE6 A;  1RDD A;  1IH7 A;  4JRQ A;  1YIJ N;  1LAW A;  1LWC A;  4DTJ A;  3QIC A;  1KFS A;  4I9L A;  5FDL A;  4MO4 A;  3VQD A;  4X62 K;  1E4G T;  5KPZ A;  2YJF A;  5JS1 A;  2FF3 B;  4CHP A;  3S41 A;  3KHY A;  4BDP A;  4CVN E;  4B1V A;  2E20 A;  4CEC A;  1C0G A;  3R6M A;  2P9S A;  3D45 A;  3AVB A;  3CPW M;  2XY8 A;  3VET A;  3SQ2 A;  1QTM A;  4I6M B;  2YV0 X;  2ZWH A;  4CJL A;  4CK1 A;  3ENO A;  3AVI A;  2GBZ A;  2P9P B;  5KQ8 A;  2YHA A;  3K5O A;  1KAY A;  3E9O A;  1JLF A;  4Z4G A;  3LP0 A;  2V51 B;  4FM0 A;  1JLC A;  3VOV A;  4F3O A;  4FK2 A;  4N76 A;  4AH9 A;  4FO0 A;  4CEA A;  3VQB A;  1C6V A;  2YX6 A;  5C2F A;  4DWI A;  1BIU A;  5I42 A;  3ZT4 A;  1EKE A;  4DTS A;  4JS4 A;  5FLX O;  3AVA A;  4NCG A;  2P9S B;  3L4Q A;  5A2Q O;  2E2O A;  4JKH A;  3SZ2 A;  5AQF A;  3CCJ N;  2PY5 A;  3FZM A;  3MXJ A;  3TTD A;  3H45 C;  3CJC A;  4CJ5 A;  3QIO A;  3CCE N;  3V1O A;  2O4I A;  2E5L K;  1HLU A;  3HOS A;  3V81 A;  3WUH A;  1KXP A;  4CEQ A;  2O8F A;  1WSI A;  1YUW A;  4K42 A;  5AFU A;  4DS5 A;  2QWN A;  1KFD A;  4FSV A;  1RBT A;  4I7F A;  3CMA N;  3AAR A;  1RTI A;  4CJQ A;  4BRG A;  2QKB A;  3AAQ A;  5J2P A;  2CGL A;  1TV6 A;  3HZ6 A;  3ZET B;  4HWI A;  2P5O A;  1NKE A;  3EYZ A;  3D0P A;  3U9D A;  4DV3 K;  5KPT A;  4O4G A;  1S6P A;  2O8C A;  2OTL N;  1HJR A;  2ZQB A;  4DKW A;  3H3O B;  5GIO A;  4IOC L;  1RT2 A;  1X9M A;  4F8R A;  2O8F B;  3DRS A;  2Q0R A;  4O8K A;  3QO9 A;  2OTJ N;  4KH4 A;  3JXU A;  1NJX A;  4GVE A;  4M63 C;  2P9I A;  2QWP A;  1HJO A;  3SK3 A;  3S3O A;  2VQF K;  1NK9 A;  2UXD K;  1NK8 A;  4JKE A;  3SAH A;  1DGK N;  4DMN A;  4U67 L;  4IDH A;  4ELU A;  2HVI A;  4O55 A;  4FJX A;  5AQL A;  2O8C B;  3MEG A;  4E7L A;  4F9O A;  1LW0 A;  4FVM A;  3VGK A;  4PL7 A;  5AQM A;  1A5W A;  4FJ8 A;  3KD5 E;  3EEQ A;  3I0R A;  3VEX A;  2UU9 K;  2E2P A;  1QVF M;  4DR3 K;  4DFM A;  2Z1G A;  2A1R A;  2P9I B;  2HHS A;  1IKV A;  1Z25 A;  3SCX A;  2RHK A;  4UQG A;  4IJA A;  4K43 A;  5T7B A;  1RDA A;  1XNR K;  4CZG A;  3CFR A;  2NRV A;  1BO5 O;  5AQT A;  1U45 A;  2ZM6 K;  1Q7Y O;  3WEE A;  2YI1 A;  2O8E A;  2Z1J A;  3A2F A;  1MA9 B;  3C0B A;  4JKC A;  3NMU A;  4ILG B;  3WXK A;  4KAZ A;  3A5N C;  1K8K A;  1JCF A;  4A61 A;  2A42 A;  3HVT A;  3VF2 A;  1HPZ A;  1X9S A;  5AQU A;  4J8F A;  2FSJ A;  3P38 A;  4F3T A;  4JNE A;  3MDQ A;  2YJE A;  1KVA A;  1X3M A;  4A62 A;  3VEO A;  4J2B A;  3HL8 A;  3ZX2 A;  4CF2 A;  4LFC K;  4LF8 K;  1RIL A;  4DSI A;  2KW4 A;  3R8E A;  1EWQ A;  4E1J A;  5AFU H;  4DSJ A;  1S1X A;  5JVG L;  3I8D A;  3VQA A;  1RT3 A;  1R59 O;  4BC3 A;  2Z1I A;  4Z4F A;  2O8E B;  4IFY A;  4AQY K;  3H46 O;  3DI6 A;  1HNW K;  1Q8I A;  3DJC A;  3KLG A;  3M5R A;  2W6L A;  3J7Y P;  3LP3 A;  5GIP A;  1E4F T;  3TTC A;  4JI7 K;  4Z4C A;  4JI8 K;  4OVL A;  1C1B A;  3K0S A;  3FFI A;  4B3M K;  3EKU A;  4F4K A;  3CF5 L;  1MWK A;  3VQE A;  3EY1 A;  4H5W A;  3QEI A;  4KI4 A;  1DTQ A;  2QWR A;  1J5O A;  1YT3 A;  3DLL L;  4CD3 A;  1KC8 O;  4C8O A;  1TKZ A;  3V9X A;  2XY7 A;  1FKO A;  1KTQ A;  2NRH A;  4CZL A;  4KHU A;  5AQS A;  2IVN A;  3C95 A;  2ZJP L;  5HRS A;  1NJY A;  2D1K A;  4B1X B;  3MCA B;  3D2F A;  4FOE A;  3DLB A;  2RF2 A;  2EHG A;  4AHR A;  2RPI A;  3JAM O;  2FBY A;  3DM2 A;  3TAM A;  4BE1 A;  3P4I A;  2HF3 A;  3KLF A;  2ZE2 A;  2KFZ A;  4AHT A;  1T7P A;  2VG6 A;  2O4G A;  1LWF A;  4IZ9 A;  1MU2 A;  4JI4 K;  2NRX A;  1WBD A;  2HNY A;  5CYQ A;  1ATR A;  4PL8 A;  3OS0 A;  4E1M A;  1NGA A;  1YJW N;  1VAZ A;  3HP9 A;  5IT9 O;  1HKG A;  4RW8 A;  3CQX A;  3H08 A;  2BDP A;  2LSN A;  4Y1C A;  3D2F B;  3NBP A;  1TYQ A;  3CJB A;  5JMV A;  4FZX C;  2CH6 A;  4JI6 K;  2D5R A;  4AHS A;  4KTQ A;  1XC3 A;  4BVO A;  1KQS M;  4FYD A;  1K9M O;  1FK9 A;  4O5B A;  4DQQ A;  4NCB A;  4W5R A;  3KD1 E;  2PZS A;  1EET A;  4BR2 A;  4FVU A;  1SQK A;  4Q5V A;  4A57 A;  2ZGY A;  5I9E B;  1RNH A;  3G6E N;  1N36 K;  1W7A A;  4DTP A;  5KI6 A;  3W0L A;  4M3X A;  4EIA A;  4KHS A;  3TAE A;  1VQK N;  4K41 A;  3A5O C;  3DAW A;  1YJN N;  1EQY A;  3ZSQ A;  1FW6 A;  4JHD A;  3B6P A;  1TYQ B;  3LL3 A;  3SI6 A;  3D6R A;  3UB5 A;  4CES A;  3DXM A;  4BC2 A;  5AQG A;  1ZYQ A;  4O5F A;  3M6G A;  3CCU N;  2JWL A;  3I55 N;  2F9T A;  5GAH P;  3QBW A;  2XHB A;  1D8Y A;  4JN4 A;  3RRH A;  3QEP A;  1BL3 A;  1GOA A;  5BRE A;  4IG3 A;  3AO5 A;  3OYF A;  1N6Q A;  2YNG A;  4KHP K;  3ZSR A;  1VSF A;  1KCF A;  3U9Z A;  3PIP L;  3AVG A;  4G9Z A;  3NHG A;  2V52 B;  3THX B;  1CZA N;  4EFH A;  3LM2 A;  4JD2 A;  4BWJ A;  4JHD B;  3OTO K;  4RW7 A;  1FJG K;  4O44 A;  1NGI A;  4DLG A;  2X78 A;  4BRD A;  1D5A A;  3DXM B;  1JL1 A;  2OAN A;  4E19 A;  2VWB A;  5FPM A;  4CHN A;  3WNF A;  3LZJ A;  3HSC A;  4EP4 A;  1VQM N;  2O8B B;  4KKO A;  2BH1 A;  3PO4 A;  1JKH A;  1YVN A;  1HNI A;  1JLQ A;  4JI1 K;  1OVY A;  4FW2 A;  2QTD A;  3CYM A;  2W41 A;  3CCS N;  3DMJ A;  3LP1 A;  1K73 O;  3OJU A;  3IKM A;  1HQE A;  3MEE A;  1NJW A;  3RWU A;  2F8T A;  1WNS A;  1XQS C;  1G15 A;  4BRC A;  4CHQ A;  3KVG A;  3T1A A;  4DR6 K;  1HR0 K;  5BRD A;  1VSM A;  4KH5 A;  3TR8 A;  4B1U B;  4JD2 B;  3SQ0 A;  1QQO A;  3NF7 A;  3A0I X;  4Z4E A;  4C23 A;  1S1V A;  3ZT3 A;  3U4L A;  1IO2 A;  2PBD A;  4EAH D;  1C1C A;  3ZCM A;  3P39 A;  4CJ4 A;  3OYK A;  2HBL A;  2E6M A;  4BC4 A;  4O0J A;  3SPZ A;  2PAV A;  3SLC A;  2HF4 A;  2H3G X;  1IG8 A;  2BE2 A;  1JXE A;  3HPG A;  4FWK A;  5AQK A;  3VEY A;  4DFJ A;  4GV9 A;  1S5J A;  3NH1 A;  3LPU A;  2X74 A;  3NGY A;  4GV3 A;  4JI5 K;  4KRE A;  3L3U A;  3CG7 A;  1M1K O;  1HNV A;  3FZL A;  1ASW A;  1TL1 A;  4IFE A;  4EHU A;  4ZHR A;  2VGM A;  3ZT0 A;  4RTF D;  4OO1 J;  1SKS A;  4W5Q A;  2YNF A;  1BG3 A;  1L3T A;  1BUP A;  4DQP A;  1TKX A;  1YTA A;  1OH6 A;  5JIC A;  4N56 A;  4DB3 A;  4E0D A;  4FWP A;  4B1W B;  4N5S A;  1ASV A;  4KV8 A;  2BGG A;  4WFN L;  1M90 O;  2P51 A;  4MQ3 A;  1GLC G;  4XH4 A;  5CZ2 A;  3CXC M;  2G8I A;  3F2K A;  4FW1 A;  5HRP A;  1XHX A;  4CIE A;  1VK0 A;  4JLH A;  1TK8 A;  3TAG A;  1J6Z A;  2YHB A;  3CJ1 A;  4IKF A;  1NGH A;  3KLI A;  1VRT A;  1RT5 A;  3NGI A;  3HYF A;  4K25 A;  4DFP A;  3K5M A;  3VQP A;  1D9F A;  1FKP A;  3HRG A;  3ZX0 A;  1U47 A;  4A2B A;  4A59 A;  4CZH A;  3OA9 A;  4FWQ A;  2GV9 A;  4GW6 A;  4OPJ A;  4FK4 A;  2NRR A;  5FPD A;  4CK2 A;  4CJE A;  5CHI A;  2HBK A;  4FPB A;  1DLO A;  4B1Y B;  1L3V A;  1U48 A;  4CJW A;  3K59 A;  3DOL A;  3R9P A;  1Q82 O;  3KTQ A;  3QEW A;  4RW9 A;  5LJW A;  3DLG A;  2VYP A;  4JKA A;  4DLE A;  1ZBL A;  1S9G A;  1E3M A;  1KRP A;  3O1W A;  2HHH K;  4LY7 A;  3QFU A;  4CBW A;  4C1N I;  1VRU A;  3C6T A;  1ZXO A;  1BI4 A;  4BG8 A;  2ZJR L;  3QBX A;  4BRQ A;  3MMV A;  4FWS A;  3LDO A;  3SBT A;  2AA4 A;  3ZSV A;  4FJ9 A;  1DT9 A;  2Q2R A;  3EN9 A;  4KB1 A;  1BQM A;  2WUS A;  1BWF O;  1HUX A;  3ISN C;  2F4V K;  5AR0 A;  2OYQ A;  3RMB A;  4M3T A;  2AP1 A;  2ASO A;  2YNI A;  4E3S A;  3NFA A;  4M3U A;  1IBK K;  4JV5 K;  2W40 A;  4FWO A;  3QNO A;  1QVG M;  2IOC A;  2EWS A;  1NGB A;  4BR9 A;  1VSJ A;  3D2E A;  3CER A;  1OH8 A;  1SZ2 A;  4CIF A;  1UAX A;  2ATQ A;  1BI4 B;  1NGG A;  1IKX A;  3RMC A;  2RKI A;  4CI6 A;  3CJ7 A;  3O4Q A;  4FWL A;  5AQI A;  2ITG A;  4CZM A;  1P8Z A;  1YIT N;  3ASM A;  4M3R A;  1ZBU A;  1GLE G;  4KRF A;  3PX4 A;  3MK6 A;  4CJR A;  1GLL O;  4GV6 A;  3SAF A;  3WNE A;  5BPL A;  1TK5 A;  4OJR A;  3TAN A;  3V1R A;  4W5N A;  3NDK A;  1N32 K;  1C0T A;  3D2E B;  5E26 A;  2CH5 A;  3THW A;  4B9V A;  4EZ9 A;  1B9F A;  1BU6 O;  4IOA L;  3OBY A;  1RDC A;  1QSY A;  3OYA A;  3VQ4 A;  2HB5 A;  1WSE A;  3C7N A;  2D0O A;  3LAN A;  4B9U A;  2FBX A;  4F2R A;  5C42 A;  3E1Y A;  3OYE A;  2E8A A;  3ZSX A;  4BDY A;  4XIU A;  4PA1 A;  3O3H A;  1H1V A;  1HKC A;  4MO5 A;  3G4S N;  3J7A P;  3BZK A;  4CF8 A;  3ZET A;  3M1F A;  3C6H A;  4Z4H A;  4KPY A;  3WXL A;  1NU0 A;  2F9W A;  1CXU A;  4KHQ A;  3ULE A;  1KLN A;  3MCP A;  4MDB A;  3CFO A;  3THW B;  3TAR A;  2W42 A;  3NAE A;  4M41 A;  4PKH A;  4OLA A;  3VQ5 A;  3QFP A;  4WQ4 A;  5BPM A;  5J1E A;  3UIQ A;  2XO7 A;  3C7N B;  1RBS A;  2P1J A;  1BOT O;  1NNE A;  2O8D A;  4B3S K;  5AZJ B;  1OKJ A;  4NXN K;  2VWJ A;  1U04 A;  3MEC A;  2JGU A;  3O5B A;  4CF1 A;  1Y97 A;  3VA3 A;  3V4I A;  4CW7 B;  5C0Y A;  2KFN A;  4XH5 A;  3VF4 A;  3WNG A;  4FJI A;  4LSN A;  1Z05 A;  1HX1 A;  4BWM A;  4CJT A;  3ULE B;  4E7I A;  2KLA A;  3GE1 A;  3BEX A;  5AJ3 K;  3LDP A;  4FK0 A;  3MXI A;  2G8H A;  4FJ7 A;  3BY5 A;  4H5R A;  3SUQ A;  1GLJ O;  5HRR A;  3C65 A;  1F21 A;  4H5V A;  2O8D B;  4BG9 A;  4OKJ A;  1GLF O;  4J2E A;  3LWL A;  3M3Z A;  4G1Q A;  3O9S A;  3SMS A;  4WQ5 A;  2OPQ A;  3L2Q A;  2HW3 A;  4DTX A;  3SYZ A;  2P9L A;  1NK6 A;  1HNZ K;  1X9J A;  5KGX A;  1TKD A;  2HST A;  4YFU A;  5JVH L;  1ITG A;  4GKK K;  2IDO A;  4QS8 A;  3ID8 A;  1EX4 A;  2OA8 A;  4FJL A;  3VQ6 A;  4JAX A;  3MX5 A;  2A1S A;  4KHY A;  1VQL N;  1J53 A;  5TKW A;  2GEM A;  3V9U A;  4BRL A;  1BHL A;  1C0M A;  2P9U B;  4BRH A;  3T7Z A;  1IKY A;  3CET A;  5TKY A;  1VSE A;  3H1Q A;  2G8W A;  4OPH A;  4ISG A;  4BAC A;  1TL3 A;  1QQC A;  5M1Q A;  2HND A;  2P9L B;  2WON A;  3LPT A;  4A5B A;  1DTT A;  3GBT A;  4R79 A;  1YXQ A;  2NLX A;  3OS2 A;  4UY8 O;  3IAY A;  4RW6 A;  2VGN A;  3VQ9 A;  3VQQ A;  4FJN A;  4IEE A;  5M1K A;  1NJI O;  4CBU A;  4KO0 A;  1HMV A;  2KZM A;  1L3U A;  2Q31 A;  3CJ9 A;  3VPZ A;  5BN9 A;  3IRX A;  4B3O A;  2DY4 A;  3TAP A;  4BR0 A;  2CGK A;  5SWM A;  2UUA K;  3MN5 A;  3NCI A;  3U3G A;  5ADX A;  1WAJ A;  3BP8 A;  1UA0 A;  4B9N A;  4YOV A;  2B4J A;  2F96 A;  1GLB G;  3WT0 A;  1T3V A;  2IVO A;  4KTZ A;  3WXM B;  3QIN A;  3T69 A;  3ENH A;  1Q86 O;  3FGU A;  5AQH A;  1VQ9 N;  3CC7 N;  5EVZ A;  3HT3 A;  1SL2 A;  3ZSY A;  5JLF A;  4CJS A;  3ALY A;  3M8Q A;  2Q0U A;  1RTJ A;  2HHW A;  4PKG A;  5LJV A;  3OYD A;  1BQN A;  1Q9Y A;  2FXU A;  1DEJ A;  4ZTF A;  5BR9 A;  3LDS A;  2Q3S A;  3L2V A;  4KH6 A;  3VMF B;  3RMA A;  3AO3 A;  1Q81 O;  4MLE A;  1TUU A;  4M45 A;  4IJN A;  4DR5 K;  3HK2 A;  1C1A A;  3UE5 A;  5LY3 A;  1N34 K;  2BTF A;  2IGI A;  3M8R A;  1LOT B;  4X64 K;  2HBM A;  4ELV A;  3TI0 A;  4BRK A;  1JLE A;  4CF9 A;  4MFB A;  5M1P A;  4CZI A;  3V9Z A;  2QKK A;  5CZ1 A;  2E1Z A;  3K9K A;  4LF4 K;  4JKD A;  2DPN A;  2UYT A;  4CGF A;  4BQZ A;  1K8A O;  1RBU A;  5BRF A;  4DFK A;  3NGZ A;  5EX5 A;  4K0K K;  1RT4 A;  2JLE A;  3MED A;  5HLF A;  3WQU A;  2ASP A;  1TAU A;  3G10 A;  2HOE A;  1IKW A;  1T44 A;  1N33 K;  2GWK A;  4CEF A;  4ISE A;  3VER A;  5HOO A;  3TAB A;  3CHW A;  3IUC A;  4W5T A;  1U2V A;  5AQR A;  3JS6 A;  1Q9X A;  3AO4 A;  3EE8 A;  2G8K A;  2I7P A;  3EZW A;  3AO1 A;  3CCV N;  5HRN A;  4GKJ K;  2P5G A;  4QS9 A;  3J81 O;  3VEV A;  3MX2 A;  3KWI A;  4B3T K;  4BRN A;  3QER A;  3WNH A;  1JJ2 M;  2KTQ A;  3N4Q A;  3VTI A;  4HVJ A;  4CER A;  3NF8 A;  2I7N A;  2IC3 A;  5HBM A;  3THX A;  3O08 A;  2WOM A;  3M8P A;  4H4O A;  3LDL A;  3PO5 A;  3HPH A;  3HM9 A;  3GDQ A;  4NLB A;  1HPM A;  3SJJ A;  1SKR A;  4BY9 C;  5ADX H;  1EXQ A;  1U2V B;  5BR8 K;  3K5N A;  3OS1 A;  3RRG A;  2V7Y A;  3E66 A;  3OY9 A;  1VQN N;  2O8B A;  1WLJ A;  2PFU A;  3SUO A;  4KTW A;  3UKR A;  3E01 A;  2OZM A;  4CFD A;  1NGJ A;  4CJF A;  1CZB A;  4LF7 K;  2HHU A;  4FJH A;  3JSM A;  3LWM A;  3AA3 A;  2ASM A;  2FC0 A;  4FLU A;  1JLB A;  1ATS A;  3VEZ A;  5DMR A;  4FWM A;  2QXL A;  2X6S A;  2DFF A;  3SV3 A;  3PUF A;  3BUZ B;  3K5L A;  4FLX A;  4CJ3 A;  1DKG D;  3AVH A;  4BDZ A;  4ILJ A;  1XHZ A;  3SMP A;  4H5N A;  3SQ1 A;  1L3S A;  3VA0 A;  5AQO A;  4YY3 K;  4YHH K;  2QI2 A;  3BZC A;  4DU4 A;  4FLW A;  1G99 A;  4KHN A;  5C10 A;  4BRI A;  3P83 D;  2KHO A;  2AJQ A;  3S9H A;  3UKR B;  1LAV A;  1RCH A;  3LDQ A;  4HHT A;  4I2P A;  1T8E A;  3RR8 A;  3IMX A;  3CC2 N;  4FCY A;  4CZJ A;  1WSH A;  3CQY A;  5M1O A;  3EE9 A;  1ZBI A;  4BGB A;  3I8B A;  4B08 A;  4ZTJ A;  2QK9 A;  2NRW A;  3HM8 A;  3O1B A;  2VG5 A;  1UOC A;  4PKI A;  3PV8 A;  1RTH A;  1JLG A;  2OPS A;  5EU7 A;  4FLT A;  3OYJ A;  3PLA A;  2HVH A;  1NGF A;  1YVU A;  3T19 A;  2D4W A;  4JK7 A;  5DK5 A;  3UKU A;  2WBN A;  2A41 A;  2E1Y A;  2BUP A;  2UXB K;  3HP6 A;  1ZC6 A;  4CZE A;  1EP4 A;  4FJK A;  2J4R A;  3ATU A;  3CJA A;  3AVC A;  1RBR A;  3Q7B A;  5DM6 L;  4O8U A;  5GAD P;  1S6Q A;  2GX9 A;  4GNI A;  3KIO A;  4DV6 K;  4EHT A;  4IFV A;  4BVP A;  3L2R A;  2ZJQ L;  5EOY A;  3J8A A;  4DV4 K;  4AM6 A;  3ID6 A;  5ELZ A;  5GIN A;  3AA4 A;  3UKU B;  1IJJ A;  4CF0 A;  1YTU A;  3LP2 A;  3DOK A;  2IAJ A;  4XH1 A;  4C8L A;  3OVN A;  3FLC O;  1SS6 A;  3M8S A;  1SL0 A;  3KLH A;  4CHO A;  3IDH A;  3PX6 A;  4BQL A;  3VQC A;  2FSN A;  3MN6 A;  4CJV A;  3SV4 A;  3CCM N;  4GMJ B;  1OH7 A;  1TGO A;  2GTD A;  5BRH A;  4DQI A;  4CFC A;  1NKB A;  1HQU A;  2QW9 A;  3H1V X;  4JI2 K;  1A5V A;  2E6L A;  1HYS A;  4WQ4 C;  3IS9 A;  4HUE A;  1NGE A;  1NJZ A;  1NKC A;  4I9Q A;  3F9M A;  4Y1D A;  5C2D A;  2V7Z A;  4RW4 A;  3KWG A;  1KVB A;  1RGI A;  1VQ6 N;  4NYN A;  1LCU A;  1Z6R A;  4IO9 L;  4CJK A;  2YCH A;  3NF9 A;  1I3A A;  1RDB A;  3R3L A;  1SL1 A;  5FRN A;  1T6C A;  1C0U A;  1VQ4 N;  2HNZ A;  4YDU A; 
#chains in the Genus database with same CATH homology
 3CM5 A;  4Z4C A;  1NK4 A;  4OVL A;  3BDP A;  1C1B A;  4CF1 A;  2B6A A;  4OPK A;  3L2W A;  3F73 A;  3FFI A;  1Y97 A;  2FBT A;  1REV A;  1RT6 A;  4CFA A;  4F4K A;  4HCB A;  3VA3 A;  3VQE A;  3EY1 A;  3QEI A;  3V4I A;  4KI4 A;  4CED A;  1DTQ A;  1T03 A;  1J5O A;  1YT3 A;  2DFH A;  1K6Y A;  2F8S A;  2KFN A;  4HUG A;  3WNG A;  4CK3 A;  4C8O A;  1TKZ A;  2FBV A;  4LSN A;  4FJI A;  1NOZ A;  3V9X A;  2XY7 A;  3B6O A;  4BWM A;  1FKO A;  1KTQ A;  4CJT A;  4E7I A;  4LD0 A;  4B8C A;  4DSE A;  4KHU A;  3HO1 A;  1LWE A;  3RR7 A;  3C95 A;  5J2N A;  2Y1I A;  5HRS A;  3I0S A;  1NJY A;  4FK0 A;  3AVN A;  3MXI A;  2G8H A;  3VN5 A;  1ZBH A;  4FJ7 A;  2ETJ A;  4PWD A;  3SUQ A;  5HRR A;  4FJM A;  3DLB A;  2RF2 A;  3RMD A;  2EHG A;  4AHR A;  3L8B A;  1F21 A;  2RPI A;  4FZZ A;  3V1Q A;  1QS4 A;  1X9W A;  2FBY A;  3DM2 A;  3AVL A;  3TAM A;  4OKJ A;  4O0I A;  4BE1 A;  3KKR A;  4NCA A;  3O3F A;  4J2E A;  1CZ9 A;  3LWL A;  2G8U A;  3KLF A;  4AIL C;  4G1Q A;  2ZE2 A;  4CEZ A;  4AHT A;  1T7P A;  2KFZ A;  3K57 A;  2VG6 A;  3K58 A;  2O4G A;  3S3M A;  1LWF A;  1MU2 A;  2OPQ A;  3L2Q A;  2HNY A;  4CGJ A;  4EP5 A;  3T3F A;  5CYQ A;  4DTX A;  2HW3 A;  3SYZ A;  3OS0 A;  1TKT A;  4E1M A;  1NK6 A;  3ITH A;  4JRP A;  3RTV A;  5KGX A;  3HP9 A;  5D3G A;  2R7Y A;  1QE1 A;  1TKD A;  1BGX T;  3KK1 A;  4YFU A;  5E41 A;  4RW8 A;  1HYV A;  4E89 A;  3H08 A;  1ITG A;  4K8Z A;  2IDO A;  3HVR A;  3DLE A;  3OYC A;  2BDP A;  2LSN A;  4HTU A;  3SQ4 A;  3SUP A;  1HYZ A;  4Y1C A;  1EX4 A;  2OA8 A;  1O1W A;  2VWK A;  1S1U A;  4N47 A;  3VQ6 A;  3KJV A;  4FJL A;  4QOZ B;  3NBP A;  4DTO A;  2G8V A;  4FZX C;  4CHZ A;  3QEX A;  4CJP A;  2A1S A;  2GUI A;  3LZI A;  2D5R A;  4AHS A;  3AV9 A;  4KTQ A;  4CJU A;  4KHY A;  4LH5 A;  4QCL A;  1J53 A;  2D0C A;  1TVR A;  3BGR A;  3AA5 X;  3V9U A;  4FYD A;  4CEB A;  1BHL A;  4OKK A;  1C0M A;  3AA2 A;  4BE2 A;  1FK9 A;  4O5B A;  1IKY A;  4DQQ A;  1WSG A;  3AO2 A;  4FJJ A;  4C8N A;  4W5R A;  5J2M A;  2PZS A;  3KD1 E;  1EET A;  1VSK A;  1VSE A;  4EZ6 A;  3DLK A;  2G8W A;  4N41 A;  4AHU A;  3SNN A;  4Q5V A;  4BAC A;  4M42 A;  3ULD A;  5HP1 A;  1TL3 A;  1QQC A;  3U6F A;  2HND A;  5CYM A;  1FXX A;  1RNH A;  2WON A;  3OYB A;  3LPT A;  3KK3 A;  4J2D A;  1DTT A;  1QSS A;  4DTP A;  5KI6 A;  4B9L A;  1BIS A;  4M3X A;  3OS2 A;  1BCM A;  1NK5 A;  1CXQ A;  2OZS A;  4KHS A;  3TAE A;  3IAY A;  5JS2 A;  4RW6 A;  1BCO A;  2YNH A;  3VQ9 A;  4DTM A;  1R0A A;  3VQQ A;  4FJN A;  3ZSQ A;  4L8R B;  3B6P A;  3SI6 A;  1HRH A;  2DFE A;  4KO0 A;  1HMV A;  2KZM A;  3SUN A;  1L3U A;  4CES A;  4FLZ A;  3HPO A;  3IRX A;  4B3O A;  5KRT A;  4ID1 A;  1ZYQ A;  2DY4 A;  4TSX A;  3TAP A;  4DF4 A;  3V6D A;  5SWM A;  4E7H A;  3ZT2 A;  2I5J A;  2XHB A;  3KK2 A;  4JS5 A;  3RRH A;  3NCI A;  3QEP A;  1D8Y A;  1CLQ A;  3U3G A;  1BL3 A;  3OYI A;  1GOA A;  3VQ7 A;  4B9S A;  1WAJ A;  3JYT A;  1UA0 A;  4IG3 A;  4B9N A;  4M3Y A;  2Z1H A;  3IG1 A;  1JLA A;  3LAL A;  2B4J A;  1S9E A;  3AO5 A;  4FM2 A;  1WN7 A;  3OYF A;  1N6Q A;  5FRO A;  2F96 A;  3C6U A;  2YNG A;  4CGH A;  2DTU A;  3ZSR A;  1VSF A;  2YKM A;  4KTZ A;  1JL2 A;  4E7J A;  3QIN A;  1KCF A;  3F9K A;  3G0Z A;  1RT1 A;  3HXM A;  2HHX A;  3AVG A;  4B8A B;  1QSL A;  1SUQ A;  3PX0 A;  2HHT A;  3HT3 A;  3NHG A;  1SL2 A;  2HHQ A;  3ZSY A;  3KKS A;  4CEE A;  4CJS A;  4H4M A;  2EX3 A;  3ALY A;  3M8Q A;  3DYA A;  1RTJ A;  4ICL A;  4NYF A;  4O44 A;  4RW7 A;  1KSP A;  4DLG A;  2HHW A;  2X78 A;  3OYD A;  1BQN A;  4FJ5 A;  1D5A A;  4HUF A;  1Q9Y A;  1JL1 A;  1S1W A;  3CM6 A;  4BWJ A;  4ZTF A;  1NK7 A;  4E19 A;  3LDS A;  2Q3S A;  3L2V A;  4M3Z A;  1GOC A;  1QHT A;  4CHN A;  3HJF A;  3RMA A;  3WNF A;  4YNQ A;  3LZJ A;  4EP4 A;  1X1P A;  4CGD A;  1VSL A;  3AO3 A;  4KKO A;  1T05 A;  3PO4 A;  4PUO A;  1JKH A;  3LAK A;  4FZY A;  4M45 A;  1U49 A;  1HNI A;  2X6N A;  1JLQ A;  4IG0 A;  3DLH A;  2OPP A;  3V9S A;  4FW2 A;  3HK2 A;  3CYM A;  5I3U A;  1C1A A;  1J9A A;  3DMJ A;  3CQ8 A;  3C94 A;  3LP1 A;  2IGI A;  4ID5 A;  2QXF A;  3OJU A;  1HQE A;  2BAN A;  3MEE A;  3M8R A;  1NJW A;  1LV5 A;  1WNS A;  3RWU A;  2F8T A;  3AVK A;  4AHC A;  2XY5 A;  1G15 A;  2ZD1 A;  4IDK A;  4ELV A;  4WE1 A;  4M3W A;  4CHQ A;  4KI6 A;  4GVM A;  3T1A A;  3TI0 A;  2G8F A;  4PY5 A;  1XWL A;  1JLE A;  2VG7 A;  4CF9 A;  4MFB A;  3EZ5 A;  3V9Z A;  2QKK A;  1VSM A;  4LH4 A;  2OPR A;  3TR8 A;  2RN2 A;  3SQ0 A;  5CZ1 A;  3NF7 A;  3OYN A;  4FJG A;  4DU1 A;  4CGF A;  4Z4E A;  3SPY A;  3P1G A;  1S1V A;  3ZT3 A;  4OGE A;  3ZSO A;  4FLY A;  1IO2 A;  1RBU A;  1C1C A;  3ZCM A;  4CJ4 A;  3QNN A;  3OYK A;  3NGZ A;  2E6M A;  4DFK A;  4B9M A;  1KVC A;  1W9H A;  4DQR A;  1RT4 A;  4CIG A;  4O0J A;  1U4B A;  3TAF A;  3SPZ A;  2JLE A;  3MED A;  3OYG A;  5HLF A;  2HHU A;  2BE2 A;  1JXE A;  3HPG A;  4DFJ A;  4OKE A;  4R5P A;  1LW2 A;  1S5J A;  3G10 A;  1TAU A;  3NH1 A;  1D9D A;  3LPU A;  3NE6 A;  1RDD A;  1IKW A;  4CEF A;  1RTD A;  1IH7 A;  2X74 A;  2KQ2 A;  3NGY A;  4JRQ A;  3TWH A;  4FLV A;  2KZZ A;  1LAW A;  1LWC A;  3TAB A;  4DTJ A;  4BE0 A;  1KFS A;  4I9L A;  5FDL A;  4KRE A;  3VQD A;  3L3U A;  3CG7 A;  4W5T A;  1HNV A;  4ZHR A;  1ASW A;  1TL1 A;  1Q9X A;  3AO4 A;  4OGC A;  1VSH A;  3ZT0 A;  5JS1 A;  4CHP A;  2G8K A;  4BDP A;  4DTU A;  3AO1 A;  1SKS A;  5FRM A;  5HRN A;  4CEC A;  2P5G A;  4W5Q A;  2YNF A;  1S1T A;  1B9D A;  3D45 A;  4FXD A;  3AVB A;  3SQ2 A;  2XY8 A;  3QER A;  1L3T A;  1I39 A;  1QTM A;  1L5U A;  1TKX A;  4DQP A;  2YV0 X;  1YTA A;  3NH0 A;  4E1N A;  4CJL A;  4N56 A;  3WNH A;  4CK1 A;  1JXB A;  4E0D A;  2KTQ A;  3AVI A;  2GBZ A;  4N5S A;  4HVJ A;  4CER A;  1ASV A;  3NF8 A;  4KV8 A;  2BGG A;  2IC3 A;  2YHA A;  5HBM A;  4KHW A;  3K5O A;  3AVJ A;  2P51 A;  2WOM A;  3M8P A;  4MQ3 A;  4C8K A;  4H4O A;  1JLF A;  5CZ2 A;  4RG8 A;  1N5Y A;  2G8I A;  4FW1 A;  5HRP A;  3OYM A;  3PO5 A;  1XHX A;  4Z4G A;  3HPH A;  3LP0 A;  4CFB A;  3HM9 A;  4CIE A;  4C8M A;  1VK0 A;  4FM0 A;  1W0H A;  1JLC A;  4JLH A;  3ZSZ A;  4DSF A;  3SJJ A;  3TAG A;  2YHB A;  4AH9 A;  1TK8 A;  1SKR A;  4DF8 A;  4F3O A;  4N76 A;  3K5N A;  1EXQ A;  3THV A;  3OS1 A;  2NUB A;  4IKF A;  3RRG A;  3KLI A;  4CEA A;  1VRT A;  1C6V A;  3VQB A;  3OY9 A;  4DWI A;  1WLJ A;  1BIU A;  1RBV A;  1RT5 A;  3NGI A;  3HYF A;  5I42 A;  3SUO A;  4KTW A;  2E4L A;  1ASU A;  3VQP A;  3K5M A;  4DFP A;  3ZT4 A;  3MXM A;  4B9T A;  1D9F A;  1EKE A;  1FKP A;  3ZT1 A;  3E01 A;  4JS4 A;  3AVA A;  4NCG A;  4CFD A;  4DTS A;  1U47 A;  1XC9 A;  2OZM A;  1VSD A;  4DTR A;  4ELT A;  4DSL A;  4CJF A;  2GV9 A;  1CZB A;  3DRR A;  4GW6 A;  4OPJ A;  4DSK A;  4NCB A;  4FJH A;  3JSM A;  4FK4 A;  3LWM A;  3AA3 A;  2FC0 A;  4FM1 A;  4FLU A;  1JLB A;  4CK2 A;  5DMR A;  4CJE A;  1SV5 A;  3O3G A;  3SZ2 A;  2X6S A;  2DFF A;  4CEO A;  2PY5 A;  4E7K A;  3CFP A;  1A5X A;  4QAG A;  1Z26 A;  3SV3 A;  3PUF A;  3MXJ A;  3V9W A;  3K5L A;  1DLO A;  4CJ5 A;  3QIO A;  4FLX A;  1L3V A;  3V1O A;  4CJ3 A;  1U48 A;  3AVH A;  4BDZ A;  2O4I A;  4CJW A;  3K59 A;  3DOL A;  1XHZ A;  3ZSW A;  4F2S A;  3SQ1 A;  1L3S A;  3VA0 A;  3KTQ A;  3V81 A;  3QEW A;  4DU3 A;  4RW9 A;  4FK2 A;  4CEQ A;  1WSI A;  3DLG A;  4DLE A;  4FLW A;  4DU4 A;  1ZBL A;  4KHN A;  4DTN A;  2HHV A;  1S9G A;  4DS5 A;  1KFD A;  3P83 D;  1KRP A;  1RBT A;  4I7F A;  4PQU A;  2AJQ A;  3S9H A;  1RTI A;  4CJQ A;  4K8X A;  1LAV A;  2YKN A;  4LY7 A;  1KLM A;  4H8K A;  1RCH A;  4HHT A;  1VRU A;  3C6T A;  4I2P A;  1T8E A;  3RR8 A;  4HCC A;  2QKB A;  1BI4 A;  5J2P A;  3AVM A;  1TV6 A;  4DQS A;  4FCY A;  3ZSV A;  1WSH A;  3OYL A;  3L2U A;  2P5O A;  4FJ9 A;  5K14 A;  4Q0B A;  4IBN A;  1NKE A;  4KB1 A;  3EYZ A;  3D0P A;  1BQM A;  1ZBI A;  4O4G A;  1S6P A;  3ISN C;  1WSJ A;  4B08 A;  1ZBF A;  4ZTJ A;  1WAF A;  2QK9 A;  1HJR A;  3OYH A;  5SZT A;  3QES A;  2VG5 A;  2OYQ A;  5J2Q A;  2IS3 A;  3RMB A;  2ZQB A;  1UOC A;  1X9M A;  1TK0 A;  1RT2 A;  1VSI A;  4F8R A;  3DRS A;  4M3T A;  4Z0U A;  1NOY A;  5KRS A;  2YNI A;  4E3S A;  3NFA A;  3PV8 A;  3QO9 A;  1WSF A;  4M3U A;  1RTH A;  1JLG A;  3AVF A;  3S3N A;  1NJX A;  2OPS A;  5EU7 A;  3QNO A;  4FLT A;  2IOC A;  1GOB A;  3OYJ A;  4LSL A;  4CCH A;  3DRP A;  2HVH A;  4CE9 A;  1YVU A;  3T19 A;  1VSJ A;  5DK5 A;  3QLH A;  3S3O A;  4CGG A;  4CIF A;  5CY4 A;  1UA1 A;  1NK9 A;  4Z4I A;  1UAX A;  2ATQ A;  3HP6 A;  1BI4 B;  1NK8 A;  1IKX A;  3RMC A;  2RKI A;  4DMN A;  3QEV A;  1EP4 A;  4FJK A;  4ELU A;  3O4Q A;  2HVI A;  1NK0 A;  4O55 A;  4FJX A;  2ITG A;  3AVC A;  3P5J A;  1RBR A;  4I2Q A;  2B5J A;  2D0A A;  3ASM A;  1S6Q A;  3MEG A;  4E7L A;  2XRI A;  3KIO A;  4M3R A;  5KGW A;  1LW0 A;  1ZBU A;  4FVM A;  3PX4 A;  4KRF A;  4IFV A;  1A5W A;  4CJR A;  4DS4 A;  4FJ8 A;  3KD5 E;  3L2R A;  3K2P A;  3I0R A;  3QET A;  5KTQ A;  4J2A A;  3OJS A;  2PYJ A;  3WNE A;  4DFM A;  1TK5 A;  2Z1G A;  4KFB A;  2A1R A;  3PY8 A;  2HHS A;  2XY6 A;  1IKV A;  1Z25 A;  4OJR A;  3TAN A;  3V1R A;  3MAQ A;  3SCX A;  4W5N A;  3AA4 A;  4UQG A;  3NDK A;  2Y1J A;  1C0T A;  1IG9 A;  5T7B A;  1RDA A;  1RT7 A;  4CHY A;  4CF0 A;  3CFR A;  4B9V A;  1YTU A;  3LP2 A;  4EZ9 A;  1B9F A;  3DOK A;  2IAJ A;  4DG1 A;  5C25 A;  1U45 A;  4C8L A;  3OVN A;  1SL0 A;  3M8S A;  1RDC A;  3KLH A;  3OYA A;  1QSY A;  4CHO A;  3VQ4 A;  3NH2 A;  2HB5 A;  3PX6 A;  2Z1J A;  1WSE A;  3A2F A;  3VQC A;  4CJV A;  3SV4 A;  4OLB A;  3LAN A;  4GMJ B;  2PYL A;  4B9U A;  2FBX A;  1TGO A;  3TAQ A;  4F2R A;  4KAZ A;  5C42 A;  3OYE A;  4DQI A;  4CFC A;  1NKB A;  1HQU A;  3ZSX A;  3HVT A;  1X9S A;  1HPZ A;  3NF6 A;  4XIU A;  4BDY A;  1A5V A;  1TAQ A;  2E6L A;  3QIP A;  4PA1 A;  5C24 A;  4AHV A;  1HYS A;  3DLR A;  3O3H A;  3LAM A;  4F3T A;  3IS9 A;  3KLE A;  1BIZ A;  1KVA A;  3O4N A;  4CF8 A;  4HUE A;  1B92 A;  1UWB A;  3HL8 A;  4Z4H A;  1NJZ A;  4J2B A;  4KPY A;  3U3Y A;  1NKC A;  4CGI A;  4CF2 A;  1CXU A;  4KHQ A;  4I9Q A;  4KB0 A;  1RIL A;  1KLN A;  4Y1D A;  4DSI A;  2KW4 A;  4RW4 A;  3CFO A;  3TAR A;  1KVB A;  2W42 A;  3NAE A;  4DSJ A;  4NYN A;  1S1X A;  5HRO A;  4M41 A;  4OLA A;  3VQ5 A;  3I8D A;  3VQA A;  4CJK A;  1RT3 A;  5J1E A;  4W5O A;  2HMI A;  2Z1I A;  3L3V A;  3NF9 A;  2XO7 A;  3UIQ A;  1J54 A;  4IFY A;  4Z4F A;  1I3A A;  3VQ8 A;  1SKW A;  3DI6 A;  1RBS A;  2P1J A;  1XI1 A;  1RDB A;  5FRN A;  1SL1 A;  1Q8I A;  3KLG A;  3HST B;  3LP3 A;  1C0U A;  2VWJ A;  1U04 A;  3MEC A;  2D0B A;  2HNZ A;  2JGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...