2ITGA

Catalytic domain of hiv-1 integrase: ordered active site in the f185h construct
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
160
Chain Sequence
b'HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS-1 INTEGRASE
publication title The catalytic domain of human immunodeficiency virus integrase: ordered active site in the F185H mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 37
structure length 160
sequence length 160
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2itgA00
2HHSA 4EP5A 4CESA 1RNHA 3HM9A 4B3OA 3DRRA 4CGGA 2HNDA 4IG3A 1K6YA 5HROA 4LSNA 3PX0A 4WE1A 5CYMA 1IG9A 3KD1E 3U3GA 1RBVA 1VRTA 1SUQA 1C0TA 3NH0A 3OS0A 1KFSA 3DLGA 4CJ3A 5CZ2A 3NE6A 1T03A 3KKRA 2G8WA 5DMRA 1VSJA 1NK0A 3LWMA 3JYTA 3L3VA 5T7BA 1HQEA 4B8AB 3KK1A 4DTOA 4FJNA 1YT3A 3NGYA 3ZSZA 2IDOA 3M8QA 3G0ZA 3KJVA 1CZ9A 1J5OA 4LH5A 3MEDA 4HCCA 3OS1A 4FCYA 3V81A 3QEPA 3ZCMA 4O4GA 2W42A 4B9UA 3OYAA 3KLHA 1B9DA 1I39A 2BGGA 4DTNA 3TABA 3FFIA 4CEOA 1DTQA 4HCBA 4KB1A 4JS5A 2KQ2A 2KZZA 2YNIA 3OYCA 4KHSA 4FZYA 5CY4A 1WAJA 1SL0A 4CGIA 3M8PA 3KK2A 5SWMA 4HUEA 4DFMA 2OPRA 3ZSRA 1L3TA 1RBSA 4ZTFA 2QKBA 1RTJA 1RTIA 1VSFA 2HHXA 1BL3A 4FXDA 4FJHA 1SL2A 3QEIA 3V6DA 3NHGA 3SQ2A 3QINA 4ELVA 3OYKA 4FK2A 4CF0A 1NK8A 4JLHA 3ZT3A 5K14A 3ULDA 1T8EA 3PO4A 3AVKA 1KVAA 4O55A 3DOLA 2PZSA 1TAUA 2P51A 1HQUA 1XC9A 4OLBA 5HRRA 1QS4A 3SCXA 2HHQA 1WN7A 4CJEA 4CJVA 4F2SA 3D0PA 3TR8A 2ITGA 2VWJA 3NFAA 4AILC 4CJLA 5EU7A 4NCBA 3F73A 1W9HA 4FM2A 3QEXA 1UAXA 1VK0A 5J2QA 1RT2A 2E6LA 1FKOA 2F8SA 3L2UA 3C6TA 4C8OA 2OPQA 5KTQA 1ZBUA 3CYMA 4AHSA 4E89A 3OYLA 1TK5A 2HNZA 3AA2A 3AVIA 3O3HA 3LP1A 2OPPA 3HVTA 3DYAA 3F9KA 3KLEA 2G8HA 1XWLA 4Z4FA 4OLAA 1WAFA 3BDPA 3M8SA 3RRGA 1HNVA 2D0AA 3O4NA 3HT3A 4DQRA 3RMBA 1Q9YA 1S1VA 2FBYA 4CK2A 3RMDA 3MXMA 1CZBA 3CQ8A 1QTMA 4N5SA 3TAPA 4BWJA 5KGXA 4FLTA 3AO3A 3V1OA 3ISNC 1XHXA 1BQNA 4K8XA 3NF8A 2VWKA 4CIGA 3T19A 3CG7A 4KV8A 3LPTA 4IFVA 4CHNA 3PX4A 1U47A 1S1UA 2FBXA 4UQGA 1W0HA 3TARA 4YNQA 4FLYA 4N41A 4PA1A 4EZ9A 1IO2A 1L3VA 4AHCA 3A2FA 3AA5X 1WSFA 4HHTA 4QOZB 1LWFA 3CM5A 4IFYA 4M3XA 2HB5A 5J2MA 4B9SA 4GW6A 4E7HA 3RRHA 1C1BA 1RDCA 1S6PA 3H08A 1HJRA 4G1QA 4ID5A 3SUNA 1RTDA 1Y97A 3OY9A 1KTQA 1VRUA 1EX4A 3VQQA 3LPUA 4ID1A 4CEFA 3NDKA 3LP2A 2ATQA 3P5JA 2OZMA 1C1AA 4RW7A 4B9TA 4DF8A 2GBZA 4FLVA 3C6UA 4DS5A 5FRNA 3HP9A 2HHUA 1TKTA 3T1AA 1LW2A 4NYNA 3TWHA 4DSLA 3OYMA 4FM1A 4B9LA 5FRMA 4J2BA 4KHNA 4FK4A 4F8RA 3AVAA 4EP4A 4IG0A 4OKEA 4CFCA 3KKSA 1U45A 4Q0BA 4DF4A 1VSDA 2KZMA 1LV5A 4FJMA 4CHPA 1TAQA 4FYDA 1NKEA 3MEGA 4DS4A 2NUBA 3LZJA 4AH9A 2OA8A 3OS2A 2O4IA 1LW0A 1YTAA 2XHBA 4OKKA 4CECA 1NKCA 4M3UA 1J9AA 1RDAA 4DTJA 4IBNA 4CF1A 5JS1A 1LWCA 3CFRA 4DWIA 4FJ7A 2JLEA 1JKHA 4E7JA 3LDSA 2P5OA 3ALYA 3AVCA 3E01A 1CXQA 1RCHA 3SJJA 1ZYQA 4CGDA 4FW2A 2VG5A 4C8KA 1XI1A 4N47A 3UIQA 1CLQA 1JLQA 3ZSQA 4CK3A 1Q9XA 1KVBA 4CEEA 4CJFA 3OYBA 3ZSVA 3S3MA 2RPIA 4CEDA 4DG1A 4W5RA 3NGZA 3V9UA 4F4KA 1WSJA 4OPJA 4CIFA 3TANA 4DFPA 4N76A 4BDYA 3QEVA 1XHZA 4FLZA 4I7FA 3AO2A 4M3ZA 5JS2A 5I3UA 1JL2A 3TAEA 4KHYA 3KIOA 3PX6A 2RF2A 3DM2A 5FDLA 3DLBA 2DFHA 2EX3A 2YNHA 4IDKA 4E19A 4DSIA 4E7LA 2FBTA 3PUFA 1L5UA 2WOMA 1TKXA 1B92A 2P1JA 5C24A 4DQIA 1C0MA 2IAJA 1TL1A 3ZSOA 3SUOA 1HYZA 3OYHA 3AVLA 4EZ6A 2BANA 3P1GA 1NOYA 3L2RA 1RTHA 2OZSA 3LP3A 4KAZA 1J53A 1UWBA 1JLFA 2X6SA 3ITHA 2KFNA 4DLGA 3V1RA 3OYGA 1L3SA 3LP0A 3AVJA 1RBRA 3SPYA 1DLOA 1WSEA 3NBPA 3TAMA 4CFBA 4C8LA 5CYQA 3V4IA 4FW1A 1C0UA 4E1NA 2P5GA 1RT4A 4BACA 2XY6A 1FK9A 4Y1DA 4L8RB 3VQ5A 3AO4A 2EHGA 2OPSA 4CGJA 2KW4A 4M3WA 2ETJA 1HRHA 2FBVA 4CERA 3LWLA 1T05A 3K5NA 4Z4EA 2HVHA 3HYFA 1LAWA 1TK0A 4CJTA 2QK9A 3RTVA 2G8KA 3MECA 4CHQA 2PYLA 3VQ8A 4CHOA 1ZBFA 2QXFA 1S5JA 4M41A 4TSXA 2XY5A 3NF7A 1VSHA 3P83D 4GMJB 1NK5A 1VSLA 5KRTA 4KKOA 3DLHA 4DU3A 2FC0A 4JRQA 4M3TA 3ASMA 3V9XA 1JLEA 3C95A 4GVMA 4ZTJA 1ASUA 4FZXC 1NOZA 1RT1A 2YHAA 3MXJA 3NF9A 1TV6A 1U04A 4CIEA 3QIPA 2R7YA 4FJJA 3U6FA 1QE1A 3ZSYA 4E3SA 1JXEA 1Z25A 1ITGA 2Z1IA 3S3OA 4FVMA 4Y1CA 1BIZA 4DSFA 1NJZA 2YV0X 3D45A 1REVA 4HVJA 2YKNA 4PUOA 2YKMA 5E41A 1S1WA 3KLIA 4DTSA 4BE1A 3DLEA 3AV9A 5FROA 1HYVA 4DSKA 1JLCA 4CJPA 3VQ4A 3SV4A 3HO1A 4CHZA 1RT5A 3B6PA 4KFBA 1SKSA 3LANA 2O4GA 2HNYA 3TI0A 3V9SA 3S3NA 4AHUA 2IOCA 3KK3A 4FJLA 2JGUA 5KGWA 4HTUA 4JRPA 3VA3A 4C8MA 3SPZA 2BDPA 4RW6A 4CJQA 1RDDA 1U48A 4FJGA 2DY4A 3K58A 2B4JA 4M3RA 1B9FA 1Q8IA 4KTWA 4DMNA 3QIOA 4H4OA 3V1QA 3L2QA 1X1PA 1IKWA 2D0CA 3WNHA 1F21A 4CEQA 4PWDA 1NJWA 1FXXA 4Z0UA 3IAYA 4OPKA 1D9DA 4O0IA 3VQPA 4MFBA 3ZT2A 3LALA 4C8NA 4FLWA 3RMCA 4F3OA 1SV5A 1YTUA 3AVNA 3HPHA 4AHTA 4AHRA 1LAVA 4KREA 3RR7A 2YHBA 1RT6A 4RG8A 3AVBA 3WNFA 1O1WA 1TGOA 4CK1A 4DLEA 1ZBLA 4KTQA 3RMAA 3HVRA 2A1RA 1C6VA 1S9EA 3SQ1A 1RILA 4FJ8A 1Z26A 2WONA 3NH1A 4KPYA 4DSEA 3B6OA 3NGIA 3QNNA 1N6QA 2DFFA 2G8FA 4F3TA 1ZBIA 1N5YA 3SYZA 3IS9A 2VG6A 3DI6A 4E7KA 4KRFA 1BCOA 4LH4A 4KO0A 1HMVA 3VQEA 5KRSA 3HPOA 2AJQA 3AA3A 1LWEA 4FZZA 1IKYA 3QEWA 3DRSA 1IKVA 3NAEA 2IGIA 5J2NA 4E0DA 4KI6A 1QSLA 1G15A 2Z1GA 3HK2A 2ZD1A 3OJUA 4LD0A 3L2WA 2E4LA 3K57A 2Q3SA 1C1CA 1JL1A 3TAGA 3K2PA 4CEBA 2ZE2A 1I3AA 1X9WA 1EP4A 4KHQA 1JXBA 1TKZA 2YNFA 3TAFA 2KFZA 3V9ZA 4H8KA 1JLAA 1S1XA 3SQ4A 4DQQA 1EETA 4QAGA 4KHWA 2HMIA 3MXIA 1VSIA 2HHVA 2D0BA 3QLHA 4Z4HA 2DFEA 3HP6A 1NK6A 2PY5A 4NCAA 4FLUA 5DK5A 3ZT0A 1UA0A 5CZ1A 1BISA 2XO7A 4FLXA 1KCFA 4HUGA 2IC3A 3RR8A 1EXQA 5HRNA 4DQSA 2IS3A 5HRPA 1RT3A 3KLFA 1TK8A 1D8YA 4B8CA 4DQPA 1SL1A 4ELTA 3AVFA 3QNOA 4CCHA 1QSYA 3DLKA 1T7PA 4B9VA 4KI4A 4M42A 4I2QA 4OKJA 3O3FA 4J2DA 1S1TA 5J1EA 5D3GA 3LZIA 4B9MA 3VQ9A 3AVHA 1WSIA 3I0RA 1IKXA 2XRIA 1VSKA 1TVRA 1ASVA 1TL3A 3OYDA 4DTMA 4FJKA 4E7IA 3SV3A 4J2EA 3DOKA 5J2PA 3PV8A 1VSEA 1KSPA 1BCMA 1BQMA 3SI6A 3VQDA 3QESA 2BE2A 4E1MA 4F2RA 1SKRA 1S9GA 3VA0A 3IRXA 4O5BA 3G10A 5HBMA 3LAMA 2XY7A 4ELUA 3HXMA 1HPZA 4CGFA 4CGHA 4ZHRA 3ZT1A 1NJYA 3DMJA 4BDPA 3VQ6A 4Z4CA 2QKKA 4W5QA 5C25A 3K59A 2B6AA 5HP1A 1EKEA 3MAQA 1UA1A 3PY8A 4RW9A 4CJRA 1J54A 3AVMA 5SZTA 4DFKA 4DSJA 2B5JA 2RN2A 4CEAA 4QCLA 2HHTA 1FKPA 2G8VA 4Z4GA 3AA4A 2HW3A 3WNGA 3VQBA 1D5AA 3VQCA 1ASWA 1QSSA 3IG1A 4PQUA 2PYJA 4DTXA 3TAQA 1A5WA 2YNGA 3CM6A 4B08A 2DTUA 1BI4B 1RBUA 3HSTB 1BHLA 3K5OA 4OGCA 4CFDA 4YFUA 4W5TA 3K5LA 3KTQA 1L3UA 3VN5A 1U4BA 2X74A 3EY1A 5I42A 1A5XA 3EZ5A 1GOBA 3L2VA 1WSHA 4BE2A 3QETA 3SUPA 4DTPA 3OYNA 2G8UA 3C94A 4B9NA 5KI6A 4N56A 4MQ3A 4W5OA 4J2AA 2VG7A 1NK9A 4CJ4A 3K5MA 2E6MA 2GV9A 3VQ7A 1JLGA 4BWMA 4CFAA 4CJ5A 4BE0A 4FM0A 3THVA 3DLRA 3ZSWA 5HLFA 2HVIA 3OVNA 4W5NA 3NF6A 2Y1JA 1KVCA 4DU4A 1ZBHA 1SKWA 4OGEA 3AO1A 2A1SA 2F96A 4O44A 3NH2A 3I8DA 1D9FA 4CF2A 2D5RA 2G8IA 3HPGA 1A5VA 4M45A 1JLBA 4FJIA 2KTQA 1R0AA 4DTRA 4NCGA 3BGRA 1RT7A 3O3GA 2Y1IA 4CJKA 4OVLA 1KLMA 4BDZA 1IH7A 2XY8A 3QERA 3U3YA 3SNNA 4LSLA 5HRSA 3NCIA 1BGXT 1NJXA 4I9QA 3SUQA 3ZSXA 3OJSA 3L8BA 4NYFA 4FJ5A 1QQCA 3QO9A 4CJUA 3S9HA 3L3UA 3CFPA 1X9SA 4I2PA 4K8ZA 4RW4A 4CJWA 3OYFA 1X9MA 4LY7A 2OYQA 1TKDA 4DU1A 3WNEA 4CF9A 4CEZA 1UOCA 2Z1HA 4CF8A 1HNIA 4I9LA 4ICLA 4KHUA 3SZ2A 3SQ0A 2Z1JA 1GOAA 1QHTA 5C42A 3VQAA 4DFJA 2RKIA 1KLNA 4Z4IA 1VSMA 1S6QA 3LAKA 1KFDA 3HL8A 3KD5E 1U49A 2ZQBA 2F8TA 3HJFA 1NKBA 2X78A 3RWUA 3DRPA 4H4MA 3M8RA 4IKFA 1WNSA 4CHYA 3OYIA 4HUFA 3AO5A 3OYEA 4Q5VA 1WSGA 3I0SA 4CE9A 3KLGA 4AHVA 3PO5A 1BIUA 1NK4A 4RW8A 3EYZA 3JSMA 4FJXA 4XIUA 1KRPA 4FJ9A 1MU2A 4JS4A 1RBTA 4KB0A 3ZT4A 3MEEA 3T3FA 3V9WA 4O0JA 2HHWA 4CJSA 1WLJA 1GOCA 2LSNA 4FK0A 1BI4A 2X6NA 4R5PA 1NK7A 1RDBA 4KTZA 3O4QA 4M3YA 1HYSA 4PY5A 1YVUA 4DTUA 4OJRA 1CXUA 1DTTA 2GUIA 3OYJA 3CFOA 3AVGA 2I5JA
chains in the Genus database with same CATH superfamily
4EP5A 5AQSA 4CESA 4CGGA 2G8WA 1NGGA 1OVQA 5CYMA 3G4SN 3U3GA 1J5EK 1C0TA 3NH0A 3C6AA 1KFSA 5CZ2A 3VEZA 1KC8O 1NK0A 3LWMA 1VQ9N 3L3VA 5T7BA 4DR5K 5EVZA 4FJNA 5GADP 3M8QA 4LH5A 4HCCA 3V81A 3QEPA 3ZLJA 3OYAA 4JHDB 3KLHA 4BGAA 4IJNA 1YIJN 4B3RK 3FFIA 2FF3B 1Q86O 4JK9A 1S3XA 3OYCA 2ASPA 3M3ZA 3SBTA 4CGIA 1RBSA 4ZTFA 2HBKA 1RTJA 4CZIA 1BL3A 4DV4K 1SL2A 2H3GX 3SQ2A 4ELVA 3OYKA 2WTUA 2PZSA 4OLBA 4JD2A 3SCXA 4OO1J 1WN7A 4CJVA 2ITGA 4AILC 3BF3A 5J2QA 1VK0A 4G9ZA 3EKSA 3BZKA 1VQ7N 3C6TA 3CJCA 4C8OA 2OPQA 1ZBUA 3HSCA 3TPQA 3VF6A 3O3HA 3LP1A 4NLBA 3F9KA 3E1YA 2G8HA 1XWLA 1WAFA 3BDPA 4CD3A 3RRGA 2O8EA 1HNVA 3RMBA 1CZAN 1S1VA 2FBYA 4FWKA 4GV3A 3MXMA 3WQTA 1Q18A 4BWJA 3ISNC 4K8XA 3NF8A 2VWKA 4CIGA 2E2QA 3CG7A 3LPTA 3CJBA 4UQGA 1XC3A 2IIRA 4LF8K 1LWFA 4IFYA 4BR9A 1HJOA 4B9SA 4JHDA 1S6PA 3H08A 4G1QA 4ID5A 3MX5A 5AQOA 1EX4A 3KZBA 3EZWA 2P9PA 4ID1A 3NDKA 4JI7K 3THYB 5BRDA 1C1AA 5AQNA 2GBZA 4DS5A 2NRHA 5C2DA 3HP9A 2ZM6K 1N34K 1TKTA 3N4PA 4J2BA 3J80O 3ZEUA 5EOYA 4CFCA 3KKSA 4Q0BA 4DF4A 2KZMA 1DKGD 1GLCG 1LV5A 4FJMA 3ZX3A 4BRLA 1QQMA 2NUBA 4AH9A 2XHBA 1J9AA 4CF1A 4LF5K 5B8HA 4E7JA 1XQSC 4BRNA 3QBWA 4NB4A 3ALYA 4V19S 3E01A 1RCHA 3PSFA 4BR4A 4B1VA 4AM6A 3UIQA 3OYBA 2DPNA 4FPAA 4F4KA 3TTFA 4BC3A 4DFPA 4BDYA 3TSQA 3MK6A 2JWLA 1NGFA 4KHYA 5F1XA 3DM2A 5MLCQ 3DLBA 4DSIA 3PUFA 1TKXA 2P1JA 3TTCA 5C24A 1NNEA 3ZSOA 3C7NA 2CGJA 3P1GA 3L2RA 3FZLA 3LP3A 4KAZA 2X6SA 3ITHA 2KFNA 4DLGA 3AGRA 4FWPA 1GLFO 3LP0A 5AQXA 5TKWA 3E9OA 3TAMA 1C0UA 4QS8A 4Y1DA 3AAQA 1NGCA 3LM9A 2Q1NA 5F2RA 2KW4A 1HRHA 2F7TA 2P9IB 4YDUC 4Z4EA 4CJTA 2QK9A 1ILYA 2HSTA 3MN6A 4H0PA 1JLEA 3C95A 1XNQK 2HBJA 5JLFA 1TV6A 3QIPA 3BUZB 2R7YA 4FJJA 4H0TB 3O1WA 4E3SA 1Z25A 1WOQA 4FVMA 2YV0X 3CMEN 4PUOA 4BE1A 3DLEA 1K8KB 1HYVA 4WCEL 3SV4A 2HBMA 3D6RA 4CHZA 1GLJO 4KFBA 5BPNA 1S72N 1YVNA 1DT9A 1TYQB 2HNYA 1ESVA 3V9SA 3S3NA 2IOCA 1NWKA 3CF5L 1Q7YO 2JGUA 5KGWA 4X62K 4JRPA 3SPZA 4RW6A 4MLHA 4H0OA 5AQRA 3HOSA 4FJGA 4H5RA 4LC9B 3THXB 2A42A 3K58A 4RWTA 3O8MA 1OVYA 3QIOA 3V1QA 1X1PA 2UU9K 1E3MA 2WUSA 4CEQA 5AQUA 2WBNA 4O0IA 4MFBA 4FLWA 4C8NA 4F3OA 1ZC6A 4JK8A 3HPHA 2F4VK 2P9UB 2HHHK 3WNFA 1W2BM 4JAXA 1TGOA 1ZBLA 4KTQA 3RMAA 3HVRA 1BOTO 1C6VA 4FJ8A 2WONA 1P90A 4JI5K 4DV6K 1Q81O 3TSUA 3D7EO 5AQPA 3QNNA 2G8FA 3SYZA 3IS9A 2VG6A 5CHIA 1BCOA 3VF4A 1HX1A 5KRSA 2QA4N 4DR3K 3DRSA 1IKVA 4KI6A 2IGIA 3HK2A 4E0DA 3K57A 2E4LA 2Q3SA 1C1CA 1JL1A 2E2NA 3H46O 3VGKA 4JYAK 5BPMA 4KHQA 3CC4N 2KFZA 4M7YA 1JLAA 3M5RA 1EETA 3LM2A 2HMIA 3QICA 4MO5A 2PY5A 3B8AX 5FPEA 4FLUA 3G71N 3J7AP 4U7BA 1EXQA 1TK8A 1D8YA 5AZJA 5HRPA 1MWKA 4DQ8A 3PSIA 3QNOA 4B1UB 3IMXA 4B9VA 3P38A 4ILHA 1NMDA 5J1EA 3AVHA 3VPZA 1WSIA 2FF6A 2XRIA 5H1SQ 1TVRA 1ASVA 4JKBA 1DGKN 1U2VA 2GUPA 3ATUA 1VSEA 3F9MA 3TTDA 3FE1A 1BCMA 2BE2A 4K42A 5AQKA 1S9GA 1GLAG 4CZEA 3VA0A 4BGBA 3P4IA 4CGFA 4CGHA 4BDPA 2Q0RA 3HOTA 5C25A 1C0GA 3OTOK 4RW9A 2O8CA 3AVMA 4DFKA 5AQQA 1YXQA 3VQCA 4H03B 2PYJA 3O9TA 4BG9A 4EFHA 4QS7A 2YNGA 4B08A 3E66A 1BI4B 3K5OA 4W5TA 3EY1A 1A5XA 3EZ5A 2QWQA 4BE2A 4RTFD 2G8UA 1G99A 4N56A 4W5OA 2VG7A 3VQ7A 4BWMA 4BE0A 4FM0A 3CC7N 2HVIA 1T6DA 3OVNA 3VEYA 4MLEA 2Y1JA 1SKWA 1D4XA 1QQNA 1TUUA 2D5RA 4WFNL 1JLBA 4YHHK 4BR5A 2HOEA 1RT7A 4BDZA 3QERA 3L4IA 4LSLA 3NCIA 1NJXA 1YF5L 2ITMA 3QO9A 4OPAA 4CJUA 4K8ZA 3J7YP 4I2PA 4RW4A 1X9MA 4LY7A 1TKDA 1BA1A 4PHTX 4KHUA 4DR2K 1VQLN 3SQ0A 3CCQN 1KLNA 4DFJA 3E9PA 3KD5E 3K9JA 2QI2A 1WNSA 4CHYA 4Q5VA 2GWJA 2VGMA 3I0SA 3G25A 4EAHD 5JLHA 4CZMA 5LMNK 1RBTA 4KB0A 1MWMA 3V9WA 1BI4A 3T1YK 1BO5O 1RDBA 4DKWA 3O4QA 1CXUA 2GUIA 5JVGL 3L2WA 3CFOA 3R1XA 4W5QA 2OTJN 3QFUA 3HM9A 1YAGA 2HNDA 4IG3A 5HROA 4LSNA 1IG9A 4WE1A 3JXUA 3VERA 1RBVA 4Z94A 1SUQA 3OS0A 5EXWA 2UXBK 4CJ3A 3JYTA 4NXNK 1HQEA 5AQIA 4DTOA 4A2BA 4WF9L 2UXCK 1CZ9A 2QWRA 1J5OA 3OS1A 3CCMN 1RDWX 2BTFA 2W42A 1S22A 4YORA 4AF1A 3MN5A 3DLLL 5JMVA 1I39A 4DTNA 4C23A 1FJGK 4HCBA 4KB1A 4JS5A 2KQ2A 2ZWHA 4EIAA 2YNIA 4KHPK 3CJ7A 1WAJA 1SL0A 3CIPA 4DFMA 5SWMA 4HUEA 3IFRA 1L3TA 2QKBA 1RFQA 1IBKK 4F9OA 2O8DA 3NHGA 3RSEA 3SAGA 1NK8A 3ZT3A 4BR2A 5K14A 2VCPA 3ULDA 3DOLA 2P51A 1XC9A 4K43A 5HRRA 2GX9A 1NG9A 2GTDA 4CJEA 3MWPA 3BZCA 5M1OA 3D0PA 3NFAA 2P9LB 3F73A 1UAXA 1RT2A 1FKOA 4MO4A 3THWA 5GAHP 4CBXA 5IWAK 2GWKA 1TK5A 4GKJK 3AVIA 3UB5A 1WUAA 3MWTA 3M8SA 2KLAA 3HT3A 4DQRA 4CK2A 3RMDA 1CZBA 3ULEA 1ATRA 4ILJA 3CPEA 3MN9A 5FPDA 3T19A 4JN4A 1U47A 2OTLN 3WXKA 5GAGP 5BN8A 2A40A 4YNQA 4FLYA 4PA1A 3SJHA 4AHCA 3AA5X 4HHTA 2A6AA 2HB5A 3LL3A 4GW6A 5AFUH 1GLEG 3HTVA 1RTDA 4BC5A 3LPUA 1QQOA 4YOXA 2ATQA 4RCHA 4B9TA 5BPLA 3FLCO 1MDUB 3T1AA 2W6LA 1O13A 5BN9A 4DSLA 4JD2B 3OYMA 4FM1A 2E88A 4F8RA 4EP4A 4FWMA 2CGKA 3CJ9A 4FWQA 3LZJA 2WC9A 3O9QA 3OS2A 1LW0A 1YTAA 5AQFA 2E1YA 3K9KA 2AP1A 2O8EB 3CFRA 4DWIA 4YOTA 1IBMK 4FJ7A 2HMPA 4O8UA 3AVCA 2Q0UA 1HKBA 2D0PA 2YHWA 1XI1A 3HI0A 3ZSQA 1EWQA 1Q9XA 4CEEA 4BY9C 4CEDA 4W5RA 4WQ4C 1WSJA 3TANA 2CGLA 1YJNN 1RGIA 1JL2A 1E4GT 3PX6A 4DB3A 1NGAA 4IXCA 1NGDA 4DCHA 1Q82O 4MDBA 2FBTA 2P9PB 1NJIO 1L5UA 1B92A 5IT9O 1TL1A 4WQ5A 3HBTA 3PIPL 4EZ6A 1JJ2M 1NOYA 1RTHA 4YY3K 4XH4A 1J53A 1UWBA 1JLFA 5BREA 5CR4A 4K25A 1RBRA 4JI4K 3ZEUB 4BRGA 5CYQA 2ASMA 3V4IA 4BRCA 5TKYA 1RT4A 4BACA 3CCSN 3VQ5A 5CE3A 2OPSA 3LWLA 1Z6RA 3KHYA 5C12A 2G8KA 4DV3K 3VQ8A 4M41A 2QXFA 4FWOA 2XY5A 2RHKA 1VSHA 4GMJB 1NK5A 5KRTA 4KKOA 5ADXH 3A5OC 3DLHA 2E8AA 4JRQA 1BWFO 1KQSM 3VEWA 4M3TA 5AZIA 4H0VB 3V9XA 3SMSA 2YHAA 2W40A 3NF9A 4I6MA 3ZX2A 4PL7A 4CIEA 1ZBSA 3CD6N 3E9LA 3SLCA 3PLAA 1QE1A 1N8RO 1ITGA 1BIZA 4DR4K 1REVA 2YKNA 5E41A 3KLIA 1NU0A 3HO1A 1JLCA 2GELA 1RT5A 3B6PA 3O80A 2W6KA 3C7NB 4AHUA 4FJLA 4HTUA 4C8MA 4FPBA 1IV0A 2QWLA 1U48A 2RE2A 1W7AA 4JKCA 1B9FA 1Q8IA 3O9RA 4DMNA 4ISEA 2D0CA 3WNHA 4K41A 1R59O 3ZT2A 1KXPA 3FR0A 1SV5A 3AVNA 4AHTA 4DHYA 1LAVA 2YHBA 1RT6A 4BR0A 2ZGYA 1O1WA 4LFBK 2O4IA 2A1RA 5AFUA 3SQ1A 4YDUA 3ID8A 2ASOA 3NH1A 3B6OA 3NGIA 3CQYA 1ZBIA 4IZ9A 3DI6A 2A3ZA 4IWVA 4KRFA 3VQEA 4KO0A 1HMVA 1IKYA 3RVCA 3NAEA 5J2NA 1G15A 4O5FA 4FOEA 3TAGA 3K2PA 3A5MC 3GBTA 4CEBA 1X9WA 1EP4A 1JXBA 1S1XA 4PKHA 1V4SA 2D0BA 3HP6A 5M1NA 1TUYA 4BRMA 5M1PA 1XUPO 3ZT0A 1YITN 4GKKK 1BISA 2IVOA 2Q2RA 2UXDK 4HUGA 2IC3A 4KBOA 3DWLA 1RT3A 1GLDG 1QSYA 4I2QA 4IOAL 3WXLA 2Q31A 2UYTA 4JKEA 3OYDA 4DTMA 4FJKA 4U67L 3SV3A 2YJFA 2E1ZA 1KAZA 1X3MA 4DR7K 1KSPA 2ZGZA 4BRAA 1BQMA 5BR8K 4CZLA 3QESA 3NVKA 4F2RA 4CBWA 4CW7B 3ZYYX 3MN7A 4B9QA 4YOUA 3DMJA 1VQ5N 4Z4CA 2QKKA 4H0YB 3MAQA 1VQ8N 1UA1A 4DSJA 2HF4A 2B5JA 2RN2A 4CEAA 4QCLA 3VGLA 1FKPA 3CETA 3VQBA 1D5AA 1ASWA 1QSSA 3IG1A 4PQUA 3BEXA 3W0LA 1C0FA 3CM6A 5I9EB 4DV7K 2DTUA 1RBUA 2KHOA 3HSTB 4OGCA 3VN5A 4X65K 4BRQA 1GOBA 1WSHA 5ADXA 5AZJB 3SUPA 4DTPA 4B9NA 1NK9A 3K5MA 4A5BA 2GV9A 4CFAA 3MDQA 4CJ5A 2FXUA 4DV0K 1NGJA 2HF3A 4M63C 1SZ2A 5ELZA 1ZBHA 3J7ZO 1U2VB 4OGEA 3AO1A 2P9KA 3L6QA 1QVFM 2F9WA 1A5VA 4M45A 4FJIA 2KTQA 2IVNA 2CH5A 4NCGA 2XY8A 4GY2B 1BGXT 2BUPA 3FFKB 3ZSXA 4L3QA 3L8BA 4NYFA 2UUAK 3F2KA 1QQCA 4FJ5A 3L3UA 3CFPA 4CJWA 3OYFA 3JAMO 1K8AO 3CHWA 2A41A 2Z1HA 3NMUA 4DR6K 2P9NB 3SZ2A 2O8CB 1HR0K 4Z4IA 3VQAA 1VSMA 1S6QA 5HL7L 2F8TA 1KFDA 3HL8A 5JVHL 1EWRA 2ZQBA 1HNWK 3HJFA 2QXLA 1FW6A 4IKFA 4WFBL 3T7ZA 1WSGA 4BQZA 2VQFK 3KLGA 3OHRA 4XH5A 5HOOA 4FJXA 4LF9K 1KRPA 1MU2A 3MEEA 1T6CA 1VHXA 4IO8A 1WLJA 3A8YA 4FK0A 3EL2A 3KVGA 4OJRA 3OYJA 4B3OA 1RNHA 2JWKA 3KD1E 1VRTA 4CZKA 5AR0A 5KQ8A 2P9SA 1GLBG 3MCAB 4LFAK 3KKRA 1NGBA 1VSJA 3ZETA 3KK1A 4B8AB 1YT3A 2EWSA 3NGYA 2IDOA 5C15A 3CCEN 3QMLA 4FCYA 3ZCMA 4O4GA 1YJWN 4BG8A 5M1FA 1NMNA 2BGGA 1QZ6A 2D0OA 4YOYA 4KHSA 3GE1A 4FZYA 2E2PA 4DR1K 1QHAA 2OPRA 3ZSRA 1RTIA 2P9NA 4FXDA 4FJHA 3V6DA 3L4QA 3DXMA 4CF0A 1N36K 4JLHA 1OH6A 5EX5A 3AVKA 1KVAA 4O55A 1OH5A 1QS4A 1WBBA 3ENOA 4H5TA 4CJ7A 3TR8A 2VWJA 3P31A 1OH7A 3QDKA 4CJLA 5EU7A 1W9HA 3QEXA 1VQON 2E6LA 4NXMK 1RDUA 4ILGB 2WFBA 3CYMA 4E89A 3HVTA 3DYAA 3GDQA 5AQLA 4Z4FA 4OLAA 2D0AA 1T44A 3O4NA 3CQ8A 1QTMA 4N5SA 3TAPA 3UKRB 3I55N 5KGXA 3CI5A 1BQNA 4JKGA 4KV8A 3FZMA 3PX4A 4FO0A 1ATSA 3I8BA 3SK3A 3TARA 1LOTB 3GOIA 3EO3A 4EZ9A 1IO2A 5A2QO 3IKMA 5LMUK 2FSJA 4QOZB 4M3XA 3DJCA 4PKIA 5J2MA 4E7HA 4GV9A 3RRHA 1C1BA 1RDCA 3SUNA 1HJRA 1VAZA 1Y97A 5C0YA 1KTQA 1VRUA 3D2FB 1QZ5A 3VQQA 4MDAA 3Q7CA 4CZHA 2O8DB 3LP2A 3P5JA 3RSEB 4BVPA 2OZMA 3LDLA 1BA0A 1X9JA 3CCVN 1LW2A 5FPNA 4CZFA 4B9LA 4BR7A 5FRMA 1YUWA 2GEMA 4OKEA 2QWNA 1VSDA 3THWB 3VEXA 4CHPA 1TAQA 1DEJA 4FYDA 1NKEA 3MEGA 4DS4A 5KPTA 2OA8A 3BY5A 1HPMA 4OKKA 4M3UA 4CBUA 4DTJA 5JS1A 5LY3A 1NLVA 1SQKA 2NRXA 2D4WA 3ULEB 3VTHA 3SBGA 4B1YB 3LDSA 1CXQA 1ZYQA 3VESA 1T3VA 2VG5A 1CLQA 1JLQA 4CK3A 3S3MA 3NGZA 4OPJA 4CIFA 3QEVA 4I7FA 3UKRA 3DAWA 4M3ZA 2V51B 5JS2A 4A2AA 3KIOA 4CZJA 5GINA 3H45C 2RF2A 3N4QA 2NRVA 4C1NI 1I94K 2EX3A 2YNHA 4IDKA 4E7LA 2ZJPL 3WEEA 4A61A 2ZF5O 2WOMA 4DQIA 2IAJA 1JCEA 4FSVA 3Q7BA 3OYHA 3SUOA 2BANA 1YHQN 3A5LC 2OZSA 1MA9B 3H1VX 3V1RA 3OYGA 1WB9A 3D2FA 3SPYA 3NBPA 4CFBA 1HLUA 4FW1A 4BVOA 4E1NA 4L8RB 3AO4A 2Q97A 4CGJA 4M3WA 1T05A 4JK7A 3HYFA 4X66K 3RTVA 2PYLA 4CHOA 4EHUA 4HWIA 1J6ZA 3NF7A 3CJ1A 3ENHA 4FZXC 4JI8K 1NOZA 1U04A 3U6FA 3U8XA 4OPHA 1XMQK 4DSFA 1JCFA 4HVJA 2QWMA 4DTSA 4WQ4A 3DXKA 3O9UA 3VQ4A 3LANA 2O4GA 3TI0A 3AY9A 3JS6A 3WXMB 3KK3A 2FSNA 1NBWA 2BDPA 1RDDA 2DY4A 2B4JA 3CCJN 4M3RA 3I56N 1IBLK 4H4OA 5GIOA 1IKWA 1H1VA 1NJWA 1FXXA 4Z0UA 4OPKA 3LALA 2VYPA 4KREA 4RG8A 3AVBA 3VMFB 4CK1A 5AZIB 1RILA 1Z26A 4JKDA 1KAYA 4KPYA 3OBWA 2O8BA 4I6MB 3SAFA 4F3TA 2ZJQL 4E7KA 3WXJA 3AA3A 5AQYA 4E1JA 3R9PA 1QSLA 2Z1GA 3ATVA 2ZD1A 3OJUA 4LD0A 1VQ4N 1YJ9N 1I3AA 1TKZA 3TAFA 3K0SA 1SS6A 1X3NA 3O9SA 3UKUA 3SQ4A 4KHWA 3FZKA 1VSIA 3QLHA 4Z4HA 2DFEA 1NK6A 2V7ZA 5M1QA 1UA0A 5CZ1A 2XO7A 4FLXA 1KCFA 3KLFA 3G6EN 4B8CA 4BREA 1SL1A 3AVFA 4CCHA 3DLKA 1T7PA 4M42A 5AQTA 3O3FA 1S1TA 4J2DA 5D3GA 3LZIA 4B9MA 3O6WA 3GG4A 1IKXA 2IVPA 4BC2A 3EE9A 4J2EA 3CQXA 5J2PA 3PV8A 3IUCA 4LF4K 2FSKA 3KK7A 4A57A 3SI6A 3VQDA 4CI6A 4E1MA 3IRXA 3LAMA 2OCEA 1HPZA 1VQNN 4ZHRA 1NJYA 3ZT1A 4C1NK 4BROA 2O8FA 3K59A 2B6AA 1E4FT 1EKEA 2FLOA 3FGUA 4BRIA 1VQ6N 5KPZA 3PY8A 4CJRA 1J54A 5SZTA 1VQMN 4OX9K 1BUPA 2F9TA 5C10A 4Z4GA 1ZXOA 5DM6L 4IEEA 3VTIA 3TAQA 3WXIA 3BF1A 4CFDA 5AQZA 4XEIA 3KTQA 1HUXA 1V4TA 1L3UA 3U4LA 2PFUA 2YJEA 2X74A 3A5NC 3QETA 3OYNA 3C94A 4J2AA 4MQ3A 5E84A 3EEQA 3H3OB 4FWSA 2E6MA 1JLGA 2BH1A 3DLRA 4W5NA 3NF6A 4O8KA 1KVCA 3NH2A 2A1SA 2F96A 4O44A 3HZ6A 3QFPA 3I8DA 2G8IA 3CERA 4DTRA 2Y1IA 3O3GA 4CJKA 4OVLA 5M1KA 4IO9L 1K9MO 3SNNA 4FWRA 3LDQA 4I9QA 4WQ5C 1X9SA 5JICA 2OYQA 4DU1A 4CF9A 2E20A 4I9LA 2Z1JA 5C42A 3ID6A 3CC2N 5BR9A 4GV6A 1U49A 1SAZA 1NKBA 3RWUA 3M8RA 3TSPA 4HUFA 3LDPA 3OYEA 3PO5A 1BIUA 3HM8A 1NK4A 4H5VA 4RW8A 3EYZA 4FJ9A 4XIUA 4X64K 1IJJA 3ZT4A 3FZHA 3T3FA 2HHWA 1EQYA 2NRTA 1BU6O 2X6NA 1NK7A 4KTZA 4M3YA 1HYSA 4PY5A 2PAVA 3OA9A 4DTUA 1DTTA 3SJJA 3M8PA 3A0IX 2I5JA 3MX2A 2HHSA 3DRRA 1K6YA 5LJVA 3PX0A 2P9KB 5F0XA 2VQEK 4BQLA 3DLGA 3O4WA 1Z05A 3NE6A 1T03A 1N33K 5DMRA 2QTDA 3EKUA 2J4RA 3ZSZA 3G0ZA 4B1XB 3KJVA 4GNIA 3MEDA 3I33A 4A59A 4GVEA 1B9DA 4YOVA 2YI1A 2VGNA 3TABA 4CEOA 1DTQA 1HNXK 2KZZA 1JCGA 5CY4A 2QWOA 1U6ZA 3KK2A 4BRPA 4EHTA 1VSFA 3PIOL 2HHXA 4B3MK 3LDNA 3QEIA 2UUBK 3QINA 1Y64A 4FK2A 3THYA 3KWIA 5EY4A 1T8EA 3PO4A 1TAUA 1HQUA 4JKFA 2HHQA 4F2SA 4JKHA 4KH4A 4NCBA 4FM2A 3O5BA 3CXCM 1WBDA 2F8SA 3L2UA 1OKJA 4H5WA 5KTQA 2V7YA 4AHSA 3OYLA 2HNZA 3AA2A 2UUCK 2OPPA 1EO1A 3ZX0A 3KLEA 2QEXN 2P9SB 1Q9YA 5LL6Z 4A5AA 3R8EA 3VEVA 3ZETB 3T69A 2NRRA 4FLTA 3AO3A 3V1OA 3VOVA 1XHXA 3F5TA 1NM1A 4CHNA 4IFVA 1S1UA 2YX6A 2FBXA 1W0HA 4N41A 1NGHA 3H6EA 1L3VA 3MMVA 3A2FA 1WSFA 3CM5A 4LF7K 3C65A 3OY9A 4NLCA 4CEFA 4IJAA 3DXMB 4JI0K 5GIPA 4RW7A 4DF8A 5FRNA 4FLVA 3C6UA 2HHUA 3TWHA 2KKZA 4NYNA 4KHNA 4FK4A 3O1BA 3AVAA 4IOCL 3EE8A 4IG0A 1U45A 2NRWA 4PKGA 5E26A 2P9IA 2QW9A 4CECA 1NKCA 2NNWA 1RDAA 4IBNA 2D1KA 1LWCA 2JLEA 1JKHA 1KAXA 3LDOA 2YCHA 4B1ZA 2P5OA 4CGDA 4FW2A 4C8KA 4N47A 3QBXA 1KVBA 4CJFA 3ZSVA 2RPIA 4JKGB 5DM7L 4DG1A 3V9UA 4FL9A 4N76A 1XHZA 4FLZA 3AO2A 5AQMA 5I3UA 3TAEA 3WT0A 3VENA 4JKAA 5FDLA 4JI1K 3R3LA 1K8KA 2DFHA 4E19A 3W3DA 1TYQA 1C0MA 1HYZA 3AVLA 3C0BA 1IG8A 4AM7A 2ZJRL 4K0KK 3M1FA 3OW2M 3EN9A 3SMPA 4BRDA 1L3SA 3THXA 2I7NA 3AVJA 1M1KO 4B3SK 4C8LA 1DLOA 1WSEA 2W41A 3KWGA 2P5GA 2XY6A 1FK9A 2EHGA 3UE5A 2ETJA 2FBVA 4CERA 3K5NA 2HVHA 5AQVA 1LAWA 1TK0A 3H3NO 3MECA 4CHQA 4FWLA 1ATNA 1ZBFA 1S5JA 2P9UA 4TSXA 3CCRN 3P83D 5BRFA 1VSLA 3O08A 3SAHA 1NGEA 4DU3A 2FC0A 3ASMA 5AJ3K 4GVMA 3J81O 4ZTJA 3M6GA 5AQHA 1ASUA 3HRGA 1RT1A 3MXJA 5KPRA 1KD1O 1M90O 2V52B 3ZSYA 2E2OA 1JXEA 2Z1IA 3S3OA 4Y1CA 1NJZA 3D45A 2NRZA 1P8ZA 4WFAL 2YKMA 1S1WA 5LJWA 2QWPA 3D2EB 5FROA 3AV9A 3S41A 4DSKA 4CJPA 3WEEB 4DUYK 1SKSA 1GLLO 2A5XA 4DV1K 3TU5A 3VA3A 1HNZK 4WYBA 4CJQA 5AQWA 2CH6A 3NVMA 4H5NA 5FLXO 5BRHA 4KTWA 3L2QA 1VQPN 3OBYA 1F21A 4PWDA 4FVUA 3IAYA 1D9DA 4B3TK 4LF6K 3VQPA 3RMCA 1YTUA 2NLXA 4AHRA 4A62A 3AGKA 3RR7A 4DLEA 1HKGA 4DV5K 1S9EA 4JI3K 3FZFA 4DSEA 1N6QA 2DFFA 3CPWM 4FOIA 1N5YA 1W97L 4BC4A 4LH4A 3HPOA 3QB0A 2AJQA 3CMAN 4JV5K 1LWEA 4LFCK 4FZZA 3QEWA 4J8FA 1YI2N 5C2FA 4JNEA 2ZE2A 2YNFA 4ISGA 3V9ZA 4H8KA 3DXKB 3P39A 4QAGA 4DQQA 3MXIA 5FPMA 2HHVA 3C6HA 1BG3A 3L0QA 4NCAA 2I7PA 5DK5A 4JI2K 5AQGA 4CZGA 3RR8A 3D2EA 5HRNA 4DQSA 2IS3A 3CCLN 3CCUN 4DQPA 3AARA 4ELTA 4BRKA 3BP8A 3H1QA 1K73O 2QM1A 4KI4A 3T1HK 2YHYA 4YOWA 5KQDA 4OKJA 3VQ9A 3I0RA 1VSKA 1TL3A 4E7IA 3DOKA 4Y0WA 2AA4A 1SKRA 1XMOK 4O5BA 2XY7A 3G10A 5HBMA 2O8BB 1VQKN 3HXMA 4ELUA 3VQ6A 3U9DA 5HP1A 2VWBA 3AAPA 4JI6K 5AQJA 1HKCA 3VEOA 2HHTA 2G8VA 2HW3A 3AA4A 4IEIA 4XH1A 3WNGA 2YHXA 4UY8O 3UKUB 4DTXA 1A5WA 4ISFA 4B9UA 1BHLA 4IFEA 4YFUA 3K5LA 1N32K 3VGMA 2Q36A 1U4BA 4DUZK 5I42A 2NZTA 4DV2K 3L2VA 3WQUA 5KI6A 4CJ4A 3THVA 3ZSWA 5HLFA 4IDHA 4DU4A 4CD1A 3J8AA 1D9FA 4CF2A 4KH5A 3HPGA 3MCPA 3R6MA 1R0AA 3BGRA 2OANA 1KLMA 1IH7A 3ENBA 2E5LK 1NGIA 3U3YA 5HRSA 4BRHA 3SUQA 4NO7A 3OJSA 3S9HA 4M7XA 3CJAA 4H0XB 1OH8A 2O8FB 3WNEA 4CEZA 1UOCA 4CF8A 4IOXA 1HNIA 4ICLA 5GAEP 1GOAA 1QHTA 1BDGA 2RKIA 3GL1A 4B1WB 3LAKA 1QVGM 2X78A 1LCUA 3DRPA 4H4MA 3OYIA 3VF2A 3AO5A 3WUHA 4CE9A 3VETA 2HBLA 4AHVA 4QS9A 4KH6A 4CVNE 4JEPA 3U9ZA 3JSMA 4JS4A 1XNRK 4AQYK 4PL8A 4O0JA 4CJSA 3IDHA 1GOCA 2LSNA 2P9LA 4FWNA 4R5PA 4HTLA 1YVUA 2PBDA 4BRFA 3AVGA 4R79A
chains in the Genus database with same CATH topology
2HHSA 4EP5A 4CESA 1RNHA 3HM9A 4B3OA 3DRRA 4CGGA 2HNDA 4IG3A 1K6YA 5HROA 4LSNA 3PX0A 4WE1A 5CYMA 1IG9A 3KD1E 3U3GA 1RBVA 1VRTA 1SUQA 1C0TA 3NH0A 3OS0A 1KFSA 3DLGA 4CJ3A 5CZ2A 3NE6A 1T03A 3KKRA 2G8WA 5DMRA 1VSJA 1NK0A 3LWMA 3JYTA 3L3VA 5T7BA 1HQEA 4B8AB 3KK1A 4DTOA 4FJNA 1YT3A 3NGYA 3ZSZA 2IDOA 3M8QA 3G0ZA 3KJVA 1CZ9A 1J5OA 4LH5A 3MEDA 4HCCA 3OS1A 4FCYA 3V81A 3QEPA 3ZCMA 4O4GA 2W42A 4B9UA 3OYAA 3KLHA 1B9DA 1I39A 2BGGA 4DTNA 3TABA 3FFIA 4CEOA 1DTQA 4HCBA 4KB1A 4JS5A 2KQ2A 2KZZA 2YNIA 3OYCA 4KHSA 4FZYA 5CY4A 1WAJA 1SL0A 4CGIA 3M8PA 3KK2A 5SWMA 4HUEA 4DFMA 2OPRA 3ZSRA 1L3TA 1RBSA 4ZTFA 2QKBA 1RTJA 1RTIA 1VSFA 2HHXA 1BL3A 4FXDA 4FJHA 1SL2A 3QEIA 3V6DA 3NHGA 3SQ2A 3QINA 4ELVA 3OYKA 4FK2A 4CF0A 1NK8A 4JLHA 3ZT3A 5K14A 3ULDA 1T8EA 3PO4A 3AVKA 1KVAA 4O55A 3DOLA 2PZSA 1TAUA 2P51A 1HQUA 1XC9A 4OLBA 5HRRA 1QS4A 3SCXA 2HHQA 1WN7A 4CJEA 4CJVA 4F2SA 3D0PA 3TR8A 2ITGA 2VWJA 3NFAA 4AILC 4CJLA 5EU7A 4NCBA 3F73A 1W9HA 4FM2A 3QEXA 1UAXA 1VK0A 5J2QA 1RT2A 2E6LA 1FKOA 2F8SA 3L2UA 3C6TA 4C8OA 2OPQA 5KTQA 1ZBUA 3CYMA 4AHSA 4E89A 3OYLA 1TK5A 2HNZA 3AA2A 3AVIA 3O3HA 3LP1A 2OPPA 3HVTA 3DYAA 3F9KA 3KLEA 2G8HA 1XWLA 4Z4FA 4OLAA 1WAFA 3BDPA 3M8SA 3RRGA 1HNVA 2D0AA 3O4NA 3HT3A 4DQRA 3RMBA 1Q9YA 1S1VA 2FBYA 4CK2A 3RMDA 3MXMA 1CZBA 3CQ8A 1QTMA 4N5SA 3TAPA 4BWJA 5KGXA 4FLTA 3AO3A 3V1OA 3ISNC 1XHXA 1BQNA 4K8XA 3NF8A 2VWKA 4CIGA 3T19A 3CG7A 4KV8A 3LPTA 4IFVA 4CHNA 3PX4A 1U47A 1S1UA 2FBXA 4UQGA 1W0HA 3TARA 4YNQA 4FLYA 4N41A 4PA1A 4EZ9A 1IO2A 1L3VA 4AHCA 3A2FA 3AA5X 1WSFA 4HHTA 4QOZB 1LWFA 3CM5A 4IFYA 4M3XA 2HB5A 5J2MA 4B9SA 4GW6A 4E7HA 3RRHA 1C1BA 1RDCA 1S6PA 3H08A 1HJRA 4G1QA 4ID5A 3SUNA 1RTDA 1Y97A 3OY9A 1KTQA 1VRUA 1EX4A 3VQQA 3LPUA 4ID1A 4CEFA 3NDKA 3LP2A 2ATQA 3P5JA 2OZMA 1C1AA 4RW7A 4B9TA 4DF8A 2GBZA 4FLVA 3C6UA 4DS5A 5FRNA 3HP9A 2HHUA 1TKTA 3T1AA 1LW2A 4NYNA 3TWHA 4DSLA 3OYMA 4FM1A 4B9LA 5FRMA 4J2BA 4KHNA 4FK4A 4F8RA 3AVAA 4EP4A 4IG0A 4OKEA 4CFCA 3KKSA 1U45A 4Q0BA 4DF4A 1VSDA 2KZMA 1LV5A 4FJMA 4CHPA 1TAQA 4FYDA 1NKEA 3MEGA 4DS4A 2NUBA 3LZJA 4AH9A 2OA8A 3OS2A 2O4IA 1LW0A 1YTAA 2XHBA 4OKKA 4CECA 1NKCA 4M3UA 1J9AA 1RDAA 4DTJA 4IBNA 4CF1A 5JS1A 1LWCA 3CFRA 4DWIA 4FJ7A 2JLEA 1JKHA 4E7JA 3LDSA 2P5OA 3ALYA 3AVCA 3E01A 1CXQA 1RCHA 3SJJA 1ZYQA 4CGDA 4FW2A 2VG5A 4C8KA 1XI1A 4N47A 3UIQA 1CLQA 1JLQA 3ZSQA 4CK3A 1Q9XA 1KVBA 4CEEA 4CJFA 3OYBA 3ZSVA 3S3MA 2RPIA 4CEDA 4DG1A 4W5RA 3NGZA 3V9UA 4F4KA 1WSJA 4OPJA 4CIFA 3TANA 4DFPA 4N76A 4BDYA 3QEVA 1XHZA 4FLZA 4I7FA 3AO2A 4M3ZA 5JS2A 5I3UA 1JL2A 3TAEA 4KHYA 3KIOA 3PX6A 2RF2A 3DM2A 5FDLA 3DLBA 2DFHA 2EX3A 2YNHA 4IDKA 4E19A 4DSIA 4E7LA 2FBTA 3PUFA 1L5UA 2WOMA 1TKXA 1B92A 2P1JA 5C24A 4DQIA 1C0MA 2IAJA 1TL1A 3ZSOA 3SUOA 1HYZA 3OYHA 3AVLA 4EZ6A 2BANA 3P1GA 1NOYA 3L2RA 1RTHA 2OZSA 3LP3A 4KAZA 1J53A 1UWBA 1JLFA 2X6SA 3ITHA 2KFNA 4DLGA 3V1RA 3OYGA 1L3SA 3LP0A 3AVJA 1RBRA 3SPYA 1DLOA 1WSEA 3NBPA 3TAMA 4CFBA 4C8LA 5CYQA 3V4IA 4FW1A 1C0UA 4E1NA 2P5GA 1RT4A 4BACA 2XY6A 1FK9A 4Y1DA 4L8RB 3VQ5A 3AO4A 2EHGA 2OPSA 4CGJA 2KW4A 4M3WA 2ETJA 1HRHA 2FBVA 4CERA 3LWLA 1T05A 3K5NA 4Z4EA 2HVHA 3HYFA 1LAWA 1TK0A 4CJTA 2QK9A 3RTVA 2G8KA 3MECA 4CHQA 2PYLA 3VQ8A 4CHOA 1ZBFA 2QXFA 1S5JA 4M41A 4TSXA 2XY5A 3NF7A 1VSHA 3P83D 4GMJB 1NK5A 1VSLA 5KRTA 4KKOA 3DLHA 4DU3A 2FC0A 4JRQA 4M3TA 3ASMA 3V9XA 1JLEA 3C95A 4GVMA 4ZTJA 1ASUA 4FZXC 1NOZA 1RT1A 2YHAA 3MXJA 3NF9A 1TV6A 1U04A 4CIEA 3QIPA 2R7YA 4FJJA 3U6FA 1QE1A 3ZSYA 4E3SA 1JXEA 1Z25A 1ITGA 2Z1IA 3S3OA 4FVMA 4Y1CA 1BIZA 4DSFA 1NJZA 2YV0X 3D45A 1REVA 4HVJA 2YKNA 4PUOA 2YKMA 5E41A 1S1WA 3KLIA 4DTSA 4BE1A 3DLEA 3AV9A 5FROA 1HYVA 4DSKA 1JLCA 4CJPA 3VQ4A 3SV4A 3HO1A 4CHZA 1RT5A 3B6PA 4KFBA 1SKSA 3LANA 2O4GA 2HNYA 3TI0A 3V9SA 3S3NA 4AHUA 2IOCA 3KK3A 4FJLA 2JGUA 5KGWA 4HTUA 4JRPA 3VA3A 4C8MA 3SPZA 2BDPA 4RW6A 4CJQA 1RDDA 1U48A 4FJGA 2DY4A 3K58A 2B4JA 4M3RA 1B9FA 1Q8IA 4KTWA 4DMNA 3QIOA 4H4OA 3V1QA 3L2QA 1X1PA 1IKWA 2D0CA 3WNHA 1F21A 4CEQA 4PWDA 1NJWA 1FXXA 4Z0UA 3IAYA 4OPKA 1D9DA 4O0IA 3VQPA 4MFBA 3ZT2A 3LALA 4C8NA 4FLWA 3RMCA 4F3OA 1SV5A 1YTUA 3AVNA 3HPHA 4AHTA 4AHRA 1LAVA 4KREA 3RR7A 2YHBA 1RT6A 4RG8A 3AVBA 3WNFA 1O1WA 1TGOA 4CK1A 4DLEA 1ZBLA 4KTQA 3RMAA 3HVRA 2A1RA 1C6VA 1S9EA 3SQ1A 1RILA 4FJ8A 1Z26A 2WONA 3NH1A 4KPYA 4DSEA 3B6OA 3NGIA 3QNNA 1N6QA 2DFFA 2G8FA 4F3TA 1ZBIA 1N5YA 3SYZA 3IS9A 2VG6A 3DI6A 4E7KA 4KRFA 1BCOA 4LH4A 4KO0A 1HMVA 3VQEA 5KRSA 3HPOA 2AJQA 3AA3A 1LWEA 4FZZA 1IKYA 3QEWA 3DRSA 1IKVA 3NAEA 2IGIA 5J2NA 4E0DA 4KI6A 1QSLA 1G15A 2Z1GA 3HK2A 2ZD1A 3OJUA 4LD0A 3L2WA 2E4LA 3K57A 2Q3SA 1C1CA 1JL1A 3TAGA 3K2PA 4CEBA 2ZE2A 1I3AA 1X9WA 1EP4A 4KHQA 1JXBA 1TKZA 2YNFA 3TAFA 2KFZA 3V9ZA 4H8KA 1JLAA 1S1XA 3SQ4A 4DQQA 1EETA 4QAGA 4KHWA 2HMIA 3MXIA 1VSIA 2HHVA 2D0BA 3QLHA 4Z4HA 2DFEA 3HP6A 1NK6A 2PY5A 4NCAA 4FLUA 5DK5A 3ZT0A 1UA0A 5CZ1A 1BISA 2XO7A 4FLXA 1KCFA 4HUGA 2IC3A 3RR8A 1EXQA 5HRNA 4DQSA 2IS3A 5HRPA 1RT3A 3KLFA 1TK8A 1D8YA 4B8CA 4DQPA 1SL1A 4ELTA 3AVFA 3QNOA 4CCHA 1QSYA 3DLKA 1T7PA 4B9VA 4KI4A 4M42A 4I2QA 4OKJA 3O3FA 4J2DA 1S1TA 5J1EA 5D3GA 3LZIA 4B9MA 3VQ9A 3AVHA 1WSIA 3I0RA 1IKXA 2XRIA 1VSKA 1TVRA 1ASVA 1TL3A 3OYDA 4DTMA 4FJKA 4E7IA 3SV3A 4J2EA 3DOKA 5J2PA 3PV8A 1VSEA 1KSPA 1BCMA 1BQMA 3SI6A 3VQDA 3QESA 2BE2A 4E1MA 4F2RA 1SKRA 1S9GA 3VA0A 3IRXA 4O5BA 3G10A 5HBMA 3LAMA 2XY7A 4ELUA 3HXMA 1HPZA 4CGFA 4CGHA 4ZHRA 3ZT1A 1NJYA 3DMJA 4BDPA 3VQ6A 4Z4CA 2QKKA 4W5QA 5C25A 3K59A 2B6AA 5HP1A 1EKEA 3MAQA 1UA1A 3PY8A 4RW9A 4CJRA 1J54A 3AVMA 5SZTA 4DFKA 4DSJA 2B5JA 2RN2A 4CEAA 4QCLA 2HHTA 1FKPA 2G8VA 4Z4GA 3AA4A 2HW3A 3WNGA 3VQBA 1D5AA 3VQCA 1ASWA 1QSSA 3IG1A 4PQUA 2PYJA 4DTXA 3TAQA 1A5WA 2YNGA 3CM6A 4B08A 2DTUA 1BI4B 1RBUA 3HSTB 1BHLA 3K5OA 4OGCA 4CFDA 4YFUA 4W5TA 3K5LA 3KTQA 1L3UA 3VN5A 1U4BA 2X74A 3EY1A 5I42A 1A5XA 3EZ5A 1GOBA 3L2VA 1WSHA 4BE2A 3QETA 3SUPA 4DTPA 3OYNA 2G8UA 3C94A 4B9NA 5KI6A 4N56A 4MQ3A 4W5OA 4J2AA 2VG7A 1NK9A 4CJ4A 3K5MA 2E6MA 2GV9A 3VQ7A 1JLGA 4BWMA 4CFAA 4CJ5A 4BE0A 4FM0A 3THVA 3DLRA 3ZSWA 5HLFA 2HVIA 3OVNA 4W5NA 3NF6A 2Y1JA 1KVCA 4DU4A 1ZBHA 1SKWA 4OGEA 3AO1A 2A1SA 2F96A 4O44A 3NH2A 3I8DA 1D9FA 4CF2A 2D5RA 2G8IA 3HPGA 1A5VA 4M45A 1JLBA 4FJIA 2KTQA 1R0AA 4DTRA 4NCGA 3BGRA 1RT7A 3O3GA 2Y1IA 4CJKA 4OVLA 1KLMA 4BDZA 1IH7A 2XY8A 3QERA 3U3YA 3SNNA 4LSLA 5HRSA 3NCIA 1BGXT 1NJXA 4I9QA 3SUQA 3ZSXA 3OJSA 3L8BA 4NYFA 4FJ5A 1QQCA 3QO9A 4CJUA 3S9HA 3L3UA 3CFPA 1X9SA 4I2PA 4K8ZA 4RW4A 4CJWA 3OYFA 1X9MA 4LY7A 2OYQA 1TKDA 4DU1A 3WNEA 4CF9A 4CEZA 1UOCA 2Z1HA 4CF8A 1HNIA 4I9LA 4ICLA 4KHUA 3SZ2A 3SQ0A 2Z1JA 1GOAA 1QHTA 5C42A 3VQAA 4DFJA 2RKIA 1KLNA 4Z4IA 1VSMA 1S6QA 3LAKA 1KFDA 3HL8A 3KD5E 1U49A 2ZQBA 2F8TA 3HJFA 1NKBA 2X78A 3RWUA 3DRPA 4H4MA 3M8RA 4IKFA 1WNSA 4CHYA 3OYIA 4HUFA 3AO5A 3OYEA 4Q5VA 1WSGA 3I0SA 4CE9A 3KLGA 4AHVA 3PO5A 1BIUA 1NK4A 4RW8A 3EYZA 3JSMA 4FJXA 4XIUA 1KRPA 4FJ9A 1MU2A 4JS4A 1RBTA 4KB0A 3ZT4A 3MEEA 3T3FA 3V9WA 4O0JA 2HHWA 4CJSA 1WLJA 1GOCA 2LSNA 4FK0A 1BI4A 2X6NA 4R5PA 1NK7A 1RDBA 4KTZA 3O4QA 4M3YA 1HYSA 4PY5A 1YVUA 4DTUA 4OJRA 1CXUA 1DTTA 2GUIA 3OYJA 3CFOA 3AVGA 2I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHS A;  4EP5 A;  4CES A;  1RNH A;  3HM9 A;  4B3O A;  3DRR A;  4CGG A;  2HND A;  4IG3 A;  1K6Y A;  5HRO A;  4LSN A;  3PX0 A;  4WE1 A;  5CYM A;  1IG9 A;  3KD1 E;  3U3G A;  1RBV A;  1VRT A;  1SUQ A;  1C0T A;  3NH0 A;  3OS0 A;  1KFS A;  3DLG A;  4CJ3 A;  5CZ2 A;  3NE6 A;  1T03 A;  3KKR A;  2G8W A;  5DMR A;  1VSJ A;  1NK0 A;  3LWM A;  3JYT A;  3L3V A;  5T7B A;  1HQE A;  4B8A B;  3KK1 A;  4DTO A;  4FJN A;  1YT3 A;  3NGY A;  3ZSZ A;  2IDO A;  3M8Q A;  3G0Z A;  3KJV A;  1CZ9 A;  1J5O A;  4LH5 A;  3MED A;  4HCC A;  3OS1 A;  4FCY A;  3V81 A;  3QEP A;  3ZCM A;  4O4G A;  2W42 A;  4B9U A;  3OYA A;  3KLH A;  1B9D A;  1I39 A;  2BGG A;  4DTN A;  3TAB A;  3FFI A;  4CEO A;  1DTQ A;  4HCB A;  4KB1 A;  4JS5 A;  2KQ2 A;  2KZZ A;  2YNI A;  3OYC A;  4KHS A;  4FZY A;  5CY4 A;  1WAJ A;  1SL0 A;  4CGI A;  3M8P A;  3KK2 A;  5SWM A;  4HUE A;  4DFM A;  2OPR A;  3ZSR A;  1L3T A;  1RBS A;  4ZTF A;  2QKB A;  1RTJ A;  1RTI A;  1VSF A;  2HHX A;  1BL3 A;  4FXD A;  4FJH A;  1SL2 A;  3QEI A;  3V6D A;  3NHG A;  3SQ2 A;  3QIN A;  4ELV A;  3OYK A;  4FK2 A;  4CF0 A;  1NK8 A;  4JLH A;  3ZT3 A;  5K14 A;  3ULD A;  1T8E A;  3PO4 A;  3AVK A;  1KVA A;  4O55 A;  3DOL A;  2PZS A;  1TAU A;  2P51 A;  1HQU A;  1XC9 A;  4OLB A;  5HRR A;  1QS4 A;  3SCX A;  2HHQ A;  1WN7 A;  4CJE A;  4CJV A;  4F2S A;  3D0P A;  3TR8 A;  2ITG A;  2VWJ A;  3NFA A;  4AIL C;  4CJL A;  5EU7 A;  4NCB A;  3F73 A;  1W9H A;  4FM2 A;  3QEX A;  1UAX A;  1VK0 A;  5J2Q A;  1RT2 A;  2E6L A;  1FKO A;  2F8S A;  3L2U A;  3C6T A;  4C8O A;  2OPQ A;  5KTQ A;  1ZBU A;  3CYM A;  4AHS A;  4E89 A;  3OYL A;  1TK5 A;  2HNZ A;  3AA2 A;  3AVI A;  3O3H A;  3LP1 A;  2OPP A;  3HVT A;  3DYA A;  3F9K A;  3KLE A;  2G8H A;  1XWL A;  4Z4F A;  4OLA A;  1WAF A;  3BDP A;  3M8S A;  3RRG A;  1HNV A;  2D0A A;  3O4N A;  3HT3 A;  4DQR A;  3RMB A;  1Q9Y A;  1S1V A;  2FBY A;  4CK2 A;  3RMD A;  3MXM A;  1CZB A;  3CQ8 A;  1QTM A;  4N5S A;  3TAP A;  4BWJ A;  5KGX A;  4FLT A;  3AO3 A;  3V1O A;  3ISN C;  1XHX A;  1BQN A;  4K8X A;  3NF8 A;  2VWK A;  4CIG A;  3T19 A;  3CG7 A;  4KV8 A;  3LPT A;  4IFV A;  4CHN A;  3PX4 A;  1U47 A;  1S1U A;  2FBX A;  4UQG A;  1W0H A;  3TAR A;  4YNQ A;  4FLY A;  4N41 A;  4PA1 A;  4EZ9 A;  1IO2 A;  1L3V A;  4AHC A;  3A2F A;  3AA5 X;  1WSF A;  4HHT A;  4QOZ B;  1LWF A;  3CM5 A;  4IFY A;  4M3X A;  2HB5 A;  5J2M A;  4B9S A;  4GW6 A;  4E7H A;  3RRH A;  1C1B A;  1RDC A;  1S6P A;  3H08 A;  1HJR A;  4G1Q A;  4ID5 A;  3SUN A;  1RTD A;  1Y97 A;  3OY9 A;  1KTQ A;  1VRU A;  1EX4 A;  3VQQ A;  3LPU A;  4ID1 A;  4CEF A;  3NDK A;  3LP2 A;  2ATQ A;  3P5J A;  2OZM A;  1C1A A;  4RW7 A;  4B9T A;  4DF8 A;  2GBZ A;  4FLV A;  3C6U A;  4DS5 A;  5FRN A;  3HP9 A;  2HHU A;  1TKT A;  3T1A A;  1LW2 A;  4NYN A;  3TWH A;  4DSL A;  3OYM A;  4FM1 A;  4B9L A;  5FRM A;  4J2B A;  4KHN A;  4FK4 A;  4F8R A;  3AVA A;  4EP4 A;  4IG0 A;  4OKE A;  4CFC A;  3KKS A;  1U45 A;  4Q0B A;  4DF4 A;  1VSD A;  2KZM A;  1LV5 A;  4FJM A;  4CHP A;  1TAQ A;  4FYD A;  1NKE A;  3MEG A;  4DS4 A;  2NUB A;  3LZJ A;  4AH9 A;  2OA8 A;  3OS2 A;  2O4I A;  1LW0 A;  1YTA A;  2XHB A;  4OKK A;  4CEC A;  1NKC A;  4M3U A;  1J9A A;  1RDA A;  4DTJ A;  4IBN A;  4CF1 A;  5JS1 A;  1LWC A;  3CFR A;  4DWI A;  4FJ7 A;  2JLE A;  1JKH A;  4E7J A;  3LDS A;  2P5O A;  3ALY A;  3AVC A;  3E01 A;  1CXQ A;  1RCH A;  3SJJ A;  1ZYQ A;  4CGD A;  4FW2 A;  2VG5 A;  4C8K A;  1XI1 A;  4N47 A;  3UIQ A;  1CLQ A;  1JLQ A;  3ZSQ A;  4CK3 A;  1Q9X A;  1KVB A;  4CEE A;  4CJF A;  3OYB A;  3ZSV A;  3S3M A;  2RPI A;  4CED A;  4DG1 A;  4W5R A;  3NGZ A;  3V9U A;  4F4K A;  1WSJ A;  4OPJ A;  4CIF A;  3TAN A;  4DFP A;  4N76 A;  4BDY A;  3QEV A;  1XHZ A;  4FLZ A;  4I7F A;  3AO2 A;  4M3Z A;  5JS2 A;  5I3U A;  1JL2 A;  3TAE A;  4KHY A;  3KIO A;  3PX6 A;  2RF2 A;  3DM2 A;  5FDL A;  3DLB A;  2DFH A;  2EX3 A;  2YNH A;  4IDK A;  4E19 A;  4DSI A;  4E7L A;  2FBT A;  3PUF A;  1L5U A;  2WOM A;  1TKX A;  1B92 A;  2P1J A;  5C24 A;  4DQI A;  1C0M A;  2IAJ A;  1TL1 A;  3ZSO A;  3SUO A;  1HYZ A;  3OYH A;  3AVL A;  4EZ6 A;  2BAN A;  3P1G A;  1NOY A;  3L2R A;  1RTH A;  2OZS A;  3LP3 A;  4KAZ A;  1J53 A;  1UWB A;  1JLF A;  2X6S A;  3ITH A;  2KFN A;  4DLG A;  3V1R A;  3OYG A;  1L3S A;  3LP0 A;  3AVJ A;  1RBR A;  3SPY A;  1DLO A;  1WSE A;  3NBP A;  3TAM A;  4CFB A;  4C8L A;  5CYQ A;  3V4I A;  4FW1 A;  1C0U A;  4E1N A;  2P5G A;  1RT4 A;  4BAC A;  2XY6 A;  1FK9 A;  4Y1D A;  4L8R B;  3VQ5 A;  3AO4 A;  2EHG A;  2OPS A;  4CGJ A;  2KW4 A;  4M3W A;  2ETJ A;  1HRH A;  2FBV A;  4CER A;  3LWL A;  1T05 A;  3K5N A;  4Z4E A;  2HVH A;  3HYF A;  1LAW A;  1TK0 A;  4CJT A;  2QK9 A;  3RTV A;  2G8K A;  3MEC A;  4CHQ A;  2PYL A;  3VQ8 A;  4CHO A;  1ZBF A;  2QXF A;  1S5J A;  4M41 A;  4TSX A;  2XY5 A;  3NF7 A;  1VSH A;  3P83 D;  4GMJ B;  1NK5 A;  1VSL A;  5KRT A;  4KKO A;  3DLH A;  4DU3 A;  2FC0 A;  4JRQ A;  4M3T A;  3ASM A;  3V9X A;  1JLE A;  3C95 A;  4GVM A;  4ZTJ A;  1ASU A;  4FZX C;  1NOZ A;  1RT1 A;  2YHA A;  3MXJ A;  3NF9 A;  1TV6 A;  1U04 A;  4CIE A;  3QIP A;  2R7Y A;  4FJJ A;  3U6F A;  1QE1 A;  3ZSY A;  4E3S A;  1JXE A;  1Z25 A;  1ITG A;  2Z1I A;  3S3O A;  4FVM A;  4Y1C A;  1BIZ A;  4DSF A;  1NJZ A;  2YV0 X;  3D45 A;  1REV A;  4HVJ A;  2YKN A;  4PUO A;  2YKM A;  5E41 A;  1S1W A;  3KLI A;  4DTS A;  4BE1 A;  3DLE A;  3AV9 A;  5FRO A;  1HYV A;  4DSK A;  1JLC A;  4CJP A;  3VQ4 A;  3SV4 A;  3HO1 A;  4CHZ A;  1RT5 A;  3B6P A;  4KFB A;  1SKS A;  3LAN A;  2O4G A;  2HNY A;  3TI0 A;  3V9S A;  3S3N A;  4AHU A;  2IOC A;  3KK3 A;  4FJL A;  2JGU A;  5KGW A;  4HTU A;  4JRP A;  3VA3 A;  4C8M A;  3SPZ A;  2BDP A;  4RW6 A;  4CJQ A;  1RDD A;  1U48 A;  4FJG A;  2DY4 A;  3K58 A;  2B4J A;  4M3R A;  1B9F A;  1Q8I A;  4KTW A;  4DMN A;  3QIO A;  4H4O A;  3V1Q A;  3L2Q A;  1X1P A;  1IKW A;  2D0C A;  3WNH A;  1F21 A;  4CEQ A;  4PWD A;  1NJW A;  1FXX A;  4Z0U A;  3IAY A;  4OPK A;  1D9D A;  4O0I A;  3VQP A;  4MFB A;  3ZT2 A;  3LAL A;  4C8N A;  4FLW A;  3RMC A;  4F3O A;  1SV5 A;  1YTU A;  3AVN A;  3HPH A;  4AHT A;  4AHR A;  1LAV A;  4KRE A;  3RR7 A;  2YHB A;  1RT6 A;  4RG8 A;  3AVB A;  3WNF A;  1O1W A;  1TGO A;  4CK1 A;  4DLE A;  1ZBL A;  4KTQ A;  3RMA A;  3HVR A;  2A1R A;  1C6V A;  1S9E A;  3SQ1 A;  1RIL A;  4FJ8 A;  1Z26 A;  2WON A;  3NH1 A;  4KPY A;  4DSE A;  3B6O A;  3NGI A;  3QNN A;  1N6Q A;  2DFF A;  2G8F A;  4F3T A;  1ZBI A;  1N5Y A;  3SYZ A;  3IS9 A;  2VG6 A;  3DI6 A;  4E7K A;  4KRF A;  1BCO A;  4LH4 A;  4KO0 A;  1HMV A;  3VQE A;  5KRS A;  3HPO A;  2AJQ A;  3AA3 A;  1LWE A;  4FZZ A;  1IKY A;  3QEW A;  3DRS A;  1IKV A;  3NAE A;  2IGI A;  5J2N A;  4E0D A;  4KI6 A;  1QSL A;  1G15 A;  2Z1G A;  3HK2 A;  2ZD1 A;  3OJU A;  4LD0 A;  3L2W A;  2E4L A;  3K57 A;  2Q3S A;  1C1C A;  1JL1 A;  3TAG A;  3K2P A;  4CEB A;  2ZE2 A;  1I3A A;  1X9W A;  1EP4 A;  4KHQ A;  1JXB A;  1TKZ A;  2YNF A;  3TAF A;  2KFZ A;  3V9Z A;  4H8K A;  1JLA A;  1S1X A;  3SQ4 A;  4DQQ A;  1EET A;  4QAG A;  4KHW A;  2HMI A;  3MXI A;  1VSI A;  2HHV A;  2D0B A;  3QLH A;  4Z4H A;  2DFE A;  3HP6 A;  1NK6 A;  2PY5 A;  4NCA A;  4FLU A;  5DK5 A;  3ZT0 A;  1UA0 A;  5CZ1 A;  1BIS A;  2XO7 A;  4FLX A;  1KCF A;  4HUG A;  2IC3 A;  3RR8 A;  1EXQ A;  5HRN A;  4DQS A;  2IS3 A;  5HRP A;  1RT3 A;  3KLF A;  1TK8 A;  1D8Y A;  4B8C A;  4DQP A;  1SL1 A;  4ELT A;  3AVF A;  3QNO A;  4CCH A;  1QSY A;  3DLK A;  1T7P A;  4B9V A;  4KI4 A;  4M42 A;  4I2Q A;  4OKJ A;  3O3F A;  4J2D A;  1S1T A;  5J1E A;  5D3G A;  3LZI A;  4B9M A;  3VQ9 A;  3AVH A;  1WSI A;  3I0R A;  1IKX A;  2XRI A;  1VSK A;  1TVR A;  1ASV A;  1TL3 A;  3OYD A;  4DTM A;  4FJK A;  4E7I A;  3SV3 A;  4J2E A;  3DOK A;  5J2P A;  3PV8 A;  1VSE A;  1KSP A;  1BCM A;  1BQM A;  3SI6 A;  3VQD A;  3QES A;  2BE2 A;  4E1M A;  4F2R A;  1SKR A;  1S9G A;  3VA0 A;  3IRX A;  4O5B A;  3G10 A;  5HBM A;  3LAM A;  2XY7 A;  4ELU A;  3HXM A;  1HPZ A;  4CGF A;  4CGH A;  4ZHR A;  3ZT1 A;  1NJY A;  3DMJ A;  4BDP A;  3VQ6 A;  4Z4C A;  2QKK A;  4W5Q A;  5C25 A;  3K59 A;  2B6A A;  5HP1 A;  1EKE A;  3MAQ A;  1UA1 A;  3PY8 A;  4RW9 A;  4CJR A;  1J54 A;  3AVM A;  5SZT A;  4DFK A;  4DSJ A;  2B5J A;  2RN2 A;  4CEA A;  4QCL A;  2HHT A;  1FKP A;  2G8V A;  4Z4G A;  3AA4 A;  2HW3 A;  3WNG A;  3VQB A;  1D5A A;  3VQC A;  1ASW A;  1QSS A;  3IG1 A;  4PQU A;  2PYJ A;  4DTX A;  3TAQ A;  1A5W A;  2YNG A;  3CM6 A;  4B08 A;  2DTU A;  1BI4 B;  1RBU A;  3HST B;  1BHL A;  3K5O A;  4OGC A;  4CFD A;  4YFU A;  4W5T A;  3K5L A;  3KTQ A;  1L3U A;  3VN5 A;  1U4B A;  2X74 A;  3EY1 A;  5I42 A;  1A5X A;  3EZ5 A;  1GOB A;  3L2V A;  1WSH A;  4BE2 A;  3QET A;  3SUP A;  4DTP A;  3OYN A;  2G8U A;  3C94 A;  4B9N A;  5KI6 A;  4N56 A;  4MQ3 A;  4W5O A;  4J2A A;  2VG7 A;  1NK9 A;  4CJ4 A;  3K5M A;  2E6M A;  2GV9 A;  3VQ7 A;  1JLG A;  4BWM A;  4CFA A;  4CJ5 A;  4BE0 A;  4FM0 A;  3THV A;  3DLR A;  3ZSW A;  5HLF A;  2HVI A;  3OVN A;  4W5N A;  3NF6 A;  2Y1J A;  1KVC A;  4DU4 A;  1ZBH A;  1SKW A;  4OGE A;  3AO1 A;  2A1S A;  2F96 A;  4O44 A;  3NH2 A;  3I8D A;  1D9F A;  4CF2 A;  2D5R A;  2G8I A;  3HPG A;  1A5V A;  4M45 A;  1JLB A;  4FJI A;  2KTQ A;  1R0A A;  4DTR A;  4NCG A;  3BGR A;  1RT7 A;  3O3G A;  2Y1I A;  4CJK A;  4OVL A;  1KLM A;  4BDZ A;  1IH7 A;  2XY8 A;  3QER A;  3U3Y A;  3SNN A;  4LSL A;  5HRS A;  3NCI A;  1BGX T;  1NJX A;  4I9Q A;  3SUQ A;  3ZSX A;  3OJS A;  3L8B A;  4NYF A;  4FJ5 A;  1QQC A;  3QO9 A;  4CJU A;  3S9H A;  3L3U A;  3CFP A;  1X9S A;  4I2P A;  4K8Z A;  4RW4 A;  4CJW A;  3OYF A;  1X9M A;  4LY7 A;  2OYQ A;  1TKD A;  4DU1 A;  3WNE A;  4CF9 A;  4CEZ A;  1UOC A;  2Z1H A;  4CF8 A;  1HNI A;  4I9L A;  4ICL A;  4KHU A;  3SZ2 A;  3SQ0 A;  2Z1J A;  1GOA A;  1QHT A;  5C42 A;  3VQA A;  4DFJ A;  2RKI A;  1KLN A;  4Z4I A;  1VSM A;  1S6Q A;  3LAK A;  1KFD A;  3HL8 A;  3KD5 E;  1U49 A;  2ZQB A;  2F8T A;  3HJF A;  1NKB A;  2X78 A;  3RWU A;  3DRP A;  4H4M A;  3M8R A;  4IKF A;  1WNS A;  4CHY A;  3OYI A;  4HUF A;  3AO5 A;  3OYE A;  4Q5V A;  1WSG A;  3I0S A;  4CE9 A;  3KLG A;  4AHV A;  3PO5 A;  1BIU A;  1NK4 A;  4RW8 A;  3EYZ A;  3JSM A;  4FJX A;  4XIU A;  1KRP A;  4FJ9 A;  1MU2 A;  4JS4 A;  1RBT A;  4KB0 A;  3ZT4 A;  3MEE A;  3T3F A;  3V9W A;  4O0J A;  2HHW A;  4CJS A;  1WLJ A;  1GOC A;  2LSN A;  4FK0 A;  1BI4 A;  2X6N A;  4R5P A;  1NK7 A;  1RDB A;  4KTZ A;  3O4Q A;  4M3Y A;  1HYS A;  4PY5 A;  1YVU A;  4DTU A;  4OJR A;  1CXU A;  1DTT A;  2GUI A;  3OYJ A;  3CFO A;  3AVG A;  2I5J A; 
#chains in the Genus database with same CATH topology
 4EP5 A;  5AQS A;  4CES A;  4CGG A;  2G8W A;  1NGG A;  1OVQ A;  5CYM A;  3G4S N;  3U3G A;  1J5E K;  1C0T A;  3NH0 A;  3C6A A;  1KFS A;  5CZ2 A;  3VEZ A;  1KC8 O;  1NK0 A;  3LWM A;  1VQ9 N;  3L3V A;  5T7B A;  4DR5 K;  5EVZ A;  4FJN A;  5GAD P;  3M8Q A;  4LH5 A;  4HCC A;  3V81 A;  3QEP A;  3ZLJ A;  3OYA A;  4JHD B;  3KLH A;  4BGA A;  4IJN A;  1YIJ N;  4B3R K;  3FFI A;  2FF3 B;  1Q86 O;  4JK9 A;  1S3X A;  3OYC A;  2ASP A;  3M3Z A;  3SBT A;  4CGI A;  1RBS A;  4ZTF A;  2HBK A;  1RTJ A;  4CZI A;  1BL3 A;  4DV4 K;  1SL2 A;  2H3G X;  3SQ2 A;  4ELV A;  3OYK A;  2WTU A;  2PZS A;  4OLB A;  4JD2 A;  3SCX A;  4OO1 J;  1WN7 A;  4CJV A;  2ITG A;  4AIL C;  3BF3 A;  5J2Q A;  1VK0 A;  4G9Z A;  3EKS A;  3BZK A;  1VQ7 N;  3C6T A;  3CJC A;  4C8O A;  2OPQ A;  1ZBU A;  3HSC A;  3TPQ A;  3VF6 A;  3O3H A;  3LP1 A;  4NLB A;  3F9K A;  3E1Y A;  2G8H A;  1XWL A;  1WAF A;  3BDP A;  4CD3 A;  3RRG A;  2O8E A;  1HNV A;  3RMB A;  1CZA N;  1S1V A;  2FBY A;  4FWK A;  4GV3 A;  3MXM A;  3WQT A;  1Q18 A;  4BWJ A;  3ISN C;  4K8X A;  3NF8 A;  2VWK A;  4CIG A;  2E2Q A;  3CG7 A;  3LPT A;  3CJB A;  4UQG A;  1XC3 A;  2IIR A;  4LF8 K;  1LWF A;  4IFY A;  4BR9 A;  1HJO A;  4B9S A;  4JHD A;  1S6P A;  3H08 A;  4G1Q A;  4ID5 A;  3MX5 A;  5AQO A;  1EX4 A;  3KZB A;  3EZW A;  2P9P A;  4ID1 A;  3NDK A;  4JI7 K;  3THY B;  5BRD A;  1C1A A;  5AQN A;  2GBZ A;  4DS5 A;  2NRH A;  5C2D A;  3HP9 A;  2ZM6 K;  1N34 K;  1TKT A;  3N4P A;  4J2B A;  3J80 O;  3ZEU A;  5EOY A;  4CFC A;  3KKS A;  4Q0B A;  4DF4 A;  2KZM A;  1DKG D;  1GLC G;  1LV5 A;  4FJM A;  3ZX3 A;  4BRL A;  1QQM A;  2NUB A;  4AH9 A;  2XHB A;  1J9A A;  4CF1 A;  4LF5 K;  5B8H A;  4E7J A;  1XQS C;  4BRN A;  3QBW A;  4NB4 A;  3ALY A;  4V19 S;  3E01 A;  1RCH A;  3PSF A;  4BR4 A;  4B1V A;  4AM6 A;  3UIQ A;  3OYB A;  2DPN A;  4FPA A;  4F4K A;  3TTF A;  4BC3 A;  4DFP A;  4BDY A;  3TSQ A;  3MK6 A;  2JWL A;  1NGF A;  4KHY A;  5F1X A;  3DM2 A;  5MLC Q;  3DLB A;  4DSI A;  3PUF A;  1TKX A;  2P1J A;  3TTC A;  5C24 A;  1NNE A;  3ZSO A;  3C7N A;  2CGJ A;  3P1G A;  3L2R A;  3FZL A;  3LP3 A;  4KAZ A;  2X6S A;  3ITH A;  2KFN A;  4DLG A;  3AGR A;  4FWP A;  1GLF O;  3LP0 A;  5AQX A;  5TKW A;  3E9O A;  3TAM A;  1C0U A;  4QS8 A;  4Y1D A;  3AAQ A;  1NGC A;  3LM9 A;  2Q1N A;  5F2R A;  2KW4 A;  1HRH A;  2F7T A;  2P9I B;  4YDU C;  4Z4E A;  4CJT A;  2QK9 A;  1ILY A;  2HST A;  3MN6 A;  4H0P A;  1JLE A;  3C95 A;  1XNQ K;  2HBJ A;  5JLF A;  1TV6 A;  3QIP A;  3BUZ B;  2R7Y A;  4FJJ A;  4H0T B;  3O1W A;  4E3S A;  1Z25 A;  1WOQ A;  4FVM A;  2YV0 X;  3CME N;  4PUO A;  4BE1 A;  3DLE A;  1K8K B;  1HYV A;  4WCE L;  3SV4 A;  2HBM A;  3D6R A;  4CHZ A;  1GLJ O;  4KFB A;  5BPN A;  1S72 N;  1YVN A;  1DT9 A;  1TYQ B;  2HNY A;  1ESV A;  3V9S A;  3S3N A;  2IOC A;  1NWK A;  3CF5 L;  1Q7Y O;  2JGU A;  5KGW A;  4X62 K;  4JRP A;  3SPZ A;  4RW6 A;  4MLH A;  4H0O A;  5AQR A;  3HOS A;  4FJG A;  4H5R A;  4LC9 B;  3THX B;  2A42 A;  3K58 A;  4RWT A;  3O8M A;  1OVY A;  3QIO A;  3V1Q A;  1X1P A;  2UU9 K;  1E3M A;  2WUS A;  4CEQ A;  5AQU A;  2WBN A;  4O0I A;  4MFB A;  4FLW A;  4C8N A;  4F3O A;  1ZC6 A;  4JK8 A;  3HPH A;  2F4V K;  2P9U B;  2HHH K;  3WNF A;  1W2B M;  4JAX A;  1TGO A;  1ZBL A;  4KTQ A;  3RMA A;  3HVR A;  1BOT O;  1C6V A;  4FJ8 A;  2WON A;  1P90 A;  4JI5 K;  4DV6 K;  1Q81 O;  3TSU A;  3D7E O;  5AQP A;  3QNN A;  2G8F A;  3SYZ A;  3IS9 A;  2VG6 A;  5CHI A;  1BCO A;  3VF4 A;  1HX1 A;  5KRS A;  2QA4 N;  4DR3 K;  3DRS A;  1IKV A;  4KI6 A;  2IGI A;  3HK2 A;  4E0D A;  3K57 A;  2E4L A;  2Q3S A;  1C1C A;  1JL1 A;  2E2N A;  3H46 O;  3VGK A;  4JYA K;  5BPM A;  4KHQ A;  3CC4 N;  2KFZ A;  4M7Y A;  1JLA A;  3M5R A;  1EET A;  3LM2 A;  2HMI A;  3QIC A;  4MO5 A;  2PY5 A;  3B8A X;  5FPE A;  4FLU A;  3G71 N;  3J7A P;  4U7B A;  1EXQ A;  1TK8 A;  1D8Y A;  5AZJ A;  5HRP A;  1MWK A;  4DQ8 A;  3PSI A;  3QNO A;  4B1U B;  3IMX A;  4B9V A;  3P38 A;  4ILH A;  1NMD A;  5J1E A;  3AVH A;  3VPZ A;  1WSI A;  2FF6 A;  2XRI A;  5H1S Q;  1TVR A;  1ASV A;  4JKB A;  1DGK N;  1U2V A;  2GUP A;  3ATU A;  1VSE A;  3F9M A;  3TTD A;  3FE1 A;  1BCM A;  2BE2 A;  4K42 A;  5AQK A;  1S9G A;  1GLA G;  4CZE A;  3VA0 A;  4BGB A;  3P4I A;  4CGF A;  4CGH A;  4BDP A;  2Q0R A;  3HOT A;  5C25 A;  1C0G A;  3OTO K;  4RW9 A;  2O8C A;  3AVM A;  4DFK A;  5AQQ A;  1YXQ A;  3VQC A;  4H03 B;  2PYJ A;  3O9T A;  4BG9 A;  4EFH A;  4QS7 A;  2YNG A;  4B08 A;  3E66 A;  1BI4 B;  3K5O A;  4W5T A;  3EY1 A;  1A5X A;  3EZ5 A;  2QWQ A;  4BE2 A;  4RTF D;  2G8U A;  1G99 A;  4N56 A;  4W5O A;  2VG7 A;  3VQ7 A;  4BWM A;  4BE0 A;  4FM0 A;  3CC7 N;  2HVI A;  1T6D A;  3OVN A;  3VEY A;  4MLE A;  2Y1J A;  1SKW A;  1D4X A;  1QQN A;  1TUU A;  2D5R A;  4WFN L;  1JLB A;  4YHH K;  4BR5 A;  2HOE A;  1RT7 A;  4BDZ A;  3QER A;  3L4I A;  4LSL A;  3NCI A;  1NJX A;  1YF5 L;  2ITM A;  3QO9 A;  4OPA A;  4CJU A;  4K8Z A;  3J7Y P;  4I2P A;  4RW4 A;  1X9M A;  4LY7 A;  1TKD A;  1BA1 A;  4PHT X;  4KHU A;  4DR2 K;  1VQL N;  3SQ0 A;  3CCQ N;  1KLN A;  4DFJ A;  3E9P A;  3KD5 E;  3K9J A;  2QI2 A;  1WNS A;  4CHY A;  4Q5V A;  2GWJ A;  2VGM A;  3I0S A;  3G25 A;  4EAH D;  5JLH A;  4CZM A;  5LMN K;  1RBT A;  4KB0 A;  1MWM A;  3V9W A;  1BI4 A;  3T1Y K;  1BO5 O;  1RDB A;  4DKW A;  3O4Q A;  1CXU A;  2GUI A;  5JVG L;  3L2W A;  3CFO A;  3R1X A;  4W5Q A;  2OTJ N;  3QFU A;  3HM9 A;  1YAG A;  2HND A;  4IG3 A;  5HRO A;  4LSN A;  1IG9 A;  4WE1 A;  3JXU A;  3VER A;  1RBV A;  4Z94 A;  1SUQ A;  3OS0 A;  5EXW A;  2UXB K;  4CJ3 A;  3JYT A;  4NXN K;  1HQE A;  5AQI A;  4DTO A;  4A2B A;  4WF9 L;  2UXC K;  1CZ9 A;  2QWR A;  1J5O A;  3OS1 A;  3CCM N;  1RDW X;  2BTF A;  2W42 A;  1S22 A;  4YOR A;  4AF1 A;  3MN5 A;  3DLL L;  5JMV A;  1I39 A;  4DTN A;  4C23 A;  1FJG K;  4HCB A;  4KB1 A;  4JS5 A;  2KQ2 A;  2ZWH A;  4EIA A;  2YNI A;  4KHP K;  3CJ7 A;  1WAJ A;  1SL0 A;  3CIP A;  4DFM A;  5SWM A;  4HUE A;  3IFR A;  1L3T A;  2QKB A;  1RFQ A;  1IBK K;  4F9O A;  2O8D A;  3NHG A;  3RSE A;  3SAG A;  1NK8 A;  3ZT3 A;  4BR2 A;  5K14 A;  2VCP A;  3ULD A;  3DOL A;  2P51 A;  1XC9 A;  4K43 A;  5HRR A;  2GX9 A;  1NG9 A;  2GTD A;  4CJE A;  3MWP A;  3BZC A;  5M1O A;  3D0P A;  3NFA A;  2P9L B;  3F73 A;  1UAX A;  1RT2 A;  1FKO A;  4MO4 A;  3THW A;  5GAH P;  4CBX A;  5IWA K;  2GWK A;  1TK5 A;  4GKJ K;  3AVI A;  3UB5 A;  1WUA A;  3MWT A;  3M8S A;  2KLA A;  3HT3 A;  4DQR A;  4CK2 A;  3RMD A;  1CZB A;  3ULE A;  1ATR A;  4ILJ A;  3CPE A;  3MN9 A;  5FPD A;  3T19 A;  4JN4 A;  1U47 A;  2OTL N;  3WXK A;  5GAG P;  5BN8 A;  2A40 A;  4YNQ A;  4FLY A;  4PA1 A;  3SJH A;  4AHC A;  3AA5 X;  4HHT A;  2A6A A;  2HB5 A;  3LL3 A;  4GW6 A;  5AFU H;  1GLE G;  3HTV A;  1RTD A;  4BC5 A;  3LPU A;  1QQO A;  4YOX A;  2ATQ A;  4RCH A;  4B9T A;  5BPL A;  3FLC O;  1MDU B;  3T1A A;  2W6L A;  1O13 A;  5BN9 A;  4DSL A;  4JD2 B;  3OYM A;  4FM1 A;  2E88 A;  4F8R A;  4EP4 A;  4FWM A;  2CGK A;  3CJ9 A;  4FWQ A;  3LZJ A;  2WC9 A;  3O9Q A;  3OS2 A;  1LW0 A;  1YTA A;  5AQF A;  2E1Y A;  3K9K A;  2AP1 A;  2O8E B;  3CFR A;  4DWI A;  4YOT A;  1IBM K;  4FJ7 A;  2HMP A;  4O8U A;  3AVC A;  2Q0U A;  1HKB A;  2D0P A;  2YHW A;  1XI1 A;  3HI0 A;  3ZSQ A;  1EWQ A;  1Q9X A;  4CEE A;  4BY9 C;  4CED A;  4W5R A;  4WQ4 C;  1WSJ A;  3TAN A;  2CGL A;  1YJN N;  1RGI A;  1JL2 A;  1E4G T;  3PX6 A;  4DB3 A;  1NGA A;  4IXC A;  1NGD A;  4DCH A;  1Q82 O;  4MDB A;  2FBT A;  2P9P B;  1NJI O;  1L5U A;  1B92 A;  5IT9 O;  1TL1 A;  4WQ5 A;  3HBT A;  3PIP L;  4EZ6 A;  1JJ2 M;  1NOY A;  1RTH A;  4YY3 K;  4XH4 A;  1J53 A;  1UWB A;  1JLF A;  5BRE A;  5CR4 A;  4K25 A;  1RBR A;  4JI4 K;  3ZEU B;  4BRG A;  5CYQ A;  2ASM A;  3V4I A;  4BRC A;  5TKY A;  1RT4 A;  4BAC A;  3CCS N;  3VQ5 A;  5CE3 A;  2OPS A;  3LWL A;  1Z6R A;  3KHY A;  5C12 A;  2G8K A;  4DV3 K;  3VQ8 A;  4M41 A;  2QXF A;  4FWO A;  2XY5 A;  2RHK A;  1VSH A;  4GMJ B;  1NK5 A;  5KRT A;  4KKO A;  5ADX H;  3A5O C;  3DLH A;  2E8A A;  4JRQ A;  1BWF O;  1KQS M;  3VEW A;  4M3T A;  5AZI A;  4H0V B;  3V9X A;  3SMS A;  2YHA A;  2W40 A;  3NF9 A;  4I6M A;  3ZX2 A;  4PL7 A;  4CIE A;  1ZBS A;  3CD6 N;  3E9L A;  3SLC A;  3PLA A;  1QE1 A;  1N8R O;  1ITG A;  1BIZ A;  4DR4 K;  1REV A;  2YKN A;  5E41 A;  3KLI A;  1NU0 A;  3HO1 A;  1JLC A;  2GEL A;  1RT5 A;  3B6P A;  3O80 A;  2W6K A;  3C7N B;  4AHU A;  4FJL A;  4HTU A;  4C8M A;  4FPB A;  1IV0 A;  2QWL A;  1U48 A;  2RE2 A;  1W7A A;  4JKC A;  1B9F A;  1Q8I A;  3O9R A;  4DMN A;  4ISE A;  2D0C A;  3WNH A;  4K41 A;  1R59 O;  3ZT2 A;  1KXP A;  3FR0 A;  1SV5 A;  3AVN A;  4AHT A;  4DHY A;  1LAV A;  2YHB A;  1RT6 A;  4BR0 A;  2ZGY A;  1O1W A;  4LFB K;  2O4I A;  2A1R A;  5AFU A;  3SQ1 A;  4YDU A;  3ID8 A;  2ASO A;  3NH1 A;  3B6O A;  3NGI A;  3CQY A;  1ZBI A;  4IZ9 A;  3DI6 A;  2A3Z A;  4IWV A;  4KRF A;  3VQE A;  4KO0 A;  1HMV A;  1IKY A;  3RVC A;  3NAE A;  5J2N A;  1G15 A;  4O5F A;  4FOE A;  3TAG A;  3K2P A;  3A5M C;  3GBT A;  4CEB A;  1X9W A;  1EP4 A;  1JXB A;  1S1X A;  4PKH A;  1V4S A;  2D0B A;  3HP6 A;  5M1N A;  1TUY A;  4BRM A;  5M1P A;  1XUP O;  3ZT0 A;  1YIT N;  4GKK K;  1BIS A;  2IVO A;  2Q2R A;  2UXD K;  4HUG A;  2IC3 A;  4KBO A;  3DWL A;  1RT3 A;  1GLD G;  1QSY A;  4I2Q A;  4IOA L;  3WXL A;  2Q31 A;  2UYT A;  4JKE A;  3OYD A;  4DTM A;  4FJK A;  4U67 L;  3SV3 A;  2YJF A;  2E1Z A;  1KAZ A;  1X3M A;  4DR7 K;  1KSP A;  2ZGZ A;  4BRA A;  1BQM A;  5BR8 K;  4CZL A;  3QES A;  3NVK A;  4F2R A;  4CBW A;  4CW7 B;  3ZYY X;  3MN7 A;  4B9Q A;  4YOU A;  3DMJ A;  1VQ5 N;  4Z4C A;  2QKK A;  4H0Y B;  3MAQ A;  1VQ8 N;  1UA1 A;  4DSJ A;  2HF4 A;  2B5J A;  2RN2 A;  4CEA A;  4QCL A;  3VGL A;  1FKP A;  3CET A;  3VQB A;  1D5A A;  1ASW A;  1QSS A;  3IG1 A;  4PQU A;  3BEX A;  3W0L A;  1C0F A;  3CM6 A;  5I9E B;  4DV7 K;  2DTU A;  1RBU A;  2KHO A;  3HST B;  4OGC A;  3VN5 A;  4X65 K;  4BRQ A;  1GOB A;  1WSH A;  5ADX A;  5AZJ B;  3SUP A;  4DTP A;  4B9N A;  1NK9 A;  3K5M A;  4A5B A;  2GV9 A;  4CFA A;  3MDQ A;  4CJ5 A;  2FXU A;  4DV0 K;  1NGJ A;  2HF3 A;  4M63 C;  1SZ2 A;  5ELZ A;  1ZBH A;  3J7Z O;  1U2V B;  4OGE A;  3AO1 A;  2P9K A;  3L6Q A;  1QVF M;  2F9W A;  1A5V A;  4M45 A;  4FJI A;  2KTQ A;  2IVN A;  2CH5 A;  4NCG A;  2XY8 A;  4GY2 B;  1BGX T;  2BUP A;  3FFK B;  3ZSX A;  4L3Q A;  3L8B A;  4NYF A;  2UUA K;  3F2K A;  1QQC A;  4FJ5 A;  3L3U A;  3CFP A;  4CJW A;  3OYF A;  3JAM O;  1K8A O;  3CHW A;  2A41 A;  2Z1H A;  3NMU A;  4DR6 K;  2P9N B;  3SZ2 A;  2O8C B;  1HR0 K;  4Z4I A;  3VQA A;  1VSM A;  1S6Q A;  5HL7 L;  2F8T A;  1KFD A;  3HL8 A;  5JVH L;  1EWR A;  2ZQB A;  1HNW K;  3HJF A;  2QXL A;  1FW6 A;  4IKF A;  4WFB L;  3T7Z A;  1WSG A;  4BQZ A;  2VQF K;  3KLG A;  3OHR A;  4XH5 A;  5HOO A;  4FJX A;  4LF9 K;  1KRP A;  1MU2 A;  3MEE A;  1T6C A;  1VHX A;  4IO8 A;  1WLJ A;  3A8Y A;  4FK0 A;  3EL2 A;  3KVG A;  4OJR A;  3OYJ A;  4B3O A;  1RNH A;  2JWK A;  3KD1 E;  1VRT A;  4CZK A;  5AR0 A;  5KQ8 A;  2P9S A;  1GLB G;  3MCA B;  4LFA K;  3KKR A;  1NGB A;  1VSJ A;  3ZET A;  3KK1 A;  4B8A B;  1YT3 A;  2EWS A;  3NGY A;  2IDO A;  5C15 A;  3CCE N;  3QML A;  4FCY A;  3ZCM A;  4O4G A;  1YJW N;  4BG8 A;  5M1F A;  1NMN A;  2BGG A;  1QZ6 A;  2D0O A;  4YOY A;  4KHS A;  3GE1 A;  4FZY A;  2E2P A;  4DR1 K;  1QHA A;  2OPR A;  3ZSR A;  1RTI A;  2P9N A;  4FXD A;  4FJH A;  3V6D A;  3L4Q A;  3DXM A;  4CF0 A;  1N36 K;  4JLH A;  1OH6 A;  5EX5 A;  3AVK A;  1KVA A;  4O55 A;  1OH5 A;  1QS4 A;  1WBB A;  3ENO A;  4H5T A;  4CJ7 A;  3TR8 A;  2VWJ A;  3P31 A;  1OH7 A;  3QDK A;  4CJL A;  5EU7 A;  1W9H A;  3QEX A;  1VQO N;  2E6L A;  4NXM K;  1RDU A;  4ILG B;  2WFB A;  3CYM A;  4E89 A;  3HVT A;  3DYA A;  3GDQ A;  5AQL A;  4Z4F A;  4OLA A;  2D0A A;  1T44 A;  3O4N A;  3CQ8 A;  1QTM A;  4N5S A;  3TAP A;  3UKR B;  3I55 N;  5KGX A;  3CI5 A;  1BQN A;  4JKG A;  4KV8 A;  3FZM A;  3PX4 A;  4FO0 A;  1ATS A;  3I8B A;  3SK3 A;  3TAR A;  1LOT B;  3GOI A;  3EO3 A;  4EZ9 A;  1IO2 A;  5A2Q O;  3IKM A;  5LMU K;  2FSJ A;  4QOZ B;  4M3X A;  3DJC A;  4PKI A;  5J2M A;  4E7H A;  4GV9 A;  3RRH A;  1C1B A;  1RDC A;  3SUN A;  1HJR A;  1VAZ A;  1Y97 A;  5C0Y A;  1KTQ A;  1VRU A;  3D2F B;  1QZ5 A;  3VQQ A;  4MDA A;  3Q7C A;  4CZH A;  2O8D B;  3LP2 A;  3P5J A;  3RSE B;  4BVP A;  2OZM A;  3LDL A;  1BA0 A;  1X9J A;  3CCV N;  1LW2 A;  5FPN A;  4CZF A;  4B9L A;  4BR7 A;  5FRM A;  1YUW A;  2GEM A;  4OKE A;  2QWN A;  1VSD A;  3THW B;  3VEX A;  4CHP A;  1TAQ A;  1DEJ A;  4FYD A;  1NKE A;  3MEG A;  4DS4 A;  5KPT A;  2OA8 A;  3BY5 A;  1HPM A;  4OKK A;  4M3U A;  4CBU A;  4DTJ A;  5JS1 A;  5LY3 A;  1NLV A;  1SQK A;  2NRX A;  2D4W A;  3ULE B;  3VTH A;  3SBG A;  4B1Y B;  3LDS A;  1CXQ A;  1ZYQ A;  3VES A;  1T3V A;  2VG5 A;  1CLQ A;  1JLQ A;  4CK3 A;  3S3M A;  3NGZ A;  4OPJ A;  4CIF A;  3QEV A;  4I7F A;  3UKR A;  3DAW A;  4M3Z A;  2V51 B;  5JS2 A;  4A2A A;  3KIO A;  4CZJ A;  5GIN A;  3H45 C;  2RF2 A;  3N4Q A;  2NRV A;  4C1N I;  1I94 K;  2EX3 A;  2YNH A;  4IDK A;  4E7L A;  2ZJP L;  3WEE A;  4A61 A;  2ZF5 O;  2WOM A;  4DQI A;  2IAJ A;  1JCE A;  4FSV A;  3Q7B A;  3OYH A;  3SUO A;  2BAN A;  1YHQ N;  3A5L C;  2OZS A;  1MA9 B;  3H1V X;  3V1R A;  3OYG A;  1WB9 A;  3D2F A;  3SPY A;  3NBP A;  4CFB A;  1HLU A;  4FW1 A;  4BVO A;  4E1N A;  4L8R B;  3AO4 A;  2Q97 A;  4CGJ A;  4M3W A;  1T05 A;  4JK7 A;  3HYF A;  4X66 K;  3RTV A;  2PYL A;  4CHO A;  4EHU A;  4HWI A;  1J6Z A;  3NF7 A;  3CJ1 A;  3ENH A;  4FZX C;  4JI8 K;  1NOZ A;  1U04 A;  3U6F A;  3U8X A;  4OPH A;  1XMQ K;  4DSF A;  1JCF A;  4HVJ A;  2QWM A;  4DTS A;  4WQ4 A;  3DXK A;  3O9U A;  3VQ4 A;  3LAN A;  2O4G A;  3TI0 A;  3AY9 A;  3JS6 A;  3WXM B;  3KK3 A;  2FSN A;  1NBW A;  2BDP A;  1RDD A;  2DY4 A;  2B4J A;  3CCJ N;  4M3R A;  3I56 N;  1IBL K;  4H4O A;  5GIO A;  1IKW A;  1H1V A;  1NJW A;  1FXX A;  4Z0U A;  4OPK A;  3LAL A;  2VYP A;  4KRE A;  4RG8 A;  3AVB A;  3VMF B;  4CK1 A;  5AZI B;  1RIL A;  1Z26 A;  4JKD A;  1KAY A;  4KPY A;  3OBW A;  2O8B A;  4I6M B;  3SAF A;  4F3T A;  2ZJQ L;  4E7K A;  3WXJ A;  3AA3 A;  5AQY A;  4E1J A;  3R9P A;  1QSL A;  2Z1G A;  3ATV A;  2ZD1 A;  3OJU A;  4LD0 A;  1VQ4 N;  1YJ9 N;  1I3A A;  1TKZ A;  3TAF A;  3K0S A;  1SS6 A;  1X3N A;  3O9S A;  3UKU A;  3SQ4 A;  4KHW A;  3FZK A;  1VSI A;  3QLH A;  4Z4H A;  2DFE A;  1NK6 A;  2V7Z A;  5M1Q A;  1UA0 A;  5CZ1 A;  2XO7 A;  4FLX A;  1KCF A;  3KLF A;  3G6E N;  4B8C A;  4BRE A;  1SL1 A;  3AVF A;  4CCH A;  3DLK A;  1T7P A;  4M42 A;  5AQT A;  3O3F A;  1S1T A;  4J2D A;  5D3G A;  3LZI A;  4B9M A;  3O6W A;  3GG4 A;  1IKX A;  2IVP A;  4BC2 A;  3EE9 A;  4J2E A;  3CQX A;  5J2P A;  3PV8 A;  3IUC A;  4LF4 K;  2FSK A;  3KK7 A;  4A57 A;  3SI6 A;  3VQD A;  4CI6 A;  4E1M A;  3IRX A;  3LAM A;  2OCE A;  1HPZ A;  1VQN N;  4ZHR A;  1NJY A;  3ZT1 A;  4C1N K;  4BRO A;  2O8F A;  3K59 A;  2B6A A;  1E4F T;  1EKE A;  2FLO A;  3FGU A;  4BRI A;  1VQ6 N;  5KPZ A;  3PY8 A;  4CJR A;  1J54 A;  5SZT A;  1VQM N;  4OX9 K;  1BUP A;  2F9T A;  5C10 A;  4Z4G A;  1ZXO A;  5DM6 L;  4IEE A;  3VTI A;  3TAQ A;  3WXI A;  3BF1 A;  4CFD A;  5AQZ A;  4XEI A;  3KTQ A;  1HUX A;  1V4T A;  1L3U A;  3U4L A;  2PFU A;  2YJE A;  2X74 A;  3A5N C;  3QET A;  3OYN A;  3C94 A;  4J2A A;  4MQ3 A;  5E84 A;  3EEQ A;  3H3O B;  4FWS A;  2E6M A;  1JLG A;  2BH1 A;  3DLR A;  4W5N A;  3NF6 A;  4O8K A;  1KVC A;  3NH2 A;  2A1S A;  2F96 A;  4O44 A;  3HZ6 A;  3QFP A;  3I8D A;  2G8I A;  3CER A;  4DTR A;  2Y1I A;  3O3G A;  4CJK A;  4OVL A;  5M1K A;  4IO9 L;  1K9M O;  3SNN A;  4FWR A;  3LDQ A;  4I9Q A;  4WQ5 C;  1X9S A;  5JIC A;  2OYQ A;  4DU1 A;  4CF9 A;  2E20 A;  4I9L A;  2Z1J A;  5C42 A;  3ID6 A;  3CC2 N;  5BR9 A;  4GV6 A;  1U49 A;  1SAZ A;  1NKB A;  3RWU A;  3M8R A;  3TSP A;  4HUF A;  3LDP A;  3OYE A;  3PO5 A;  1BIU A;  3HM8 A;  1NK4 A;  4H5V A;  4RW8 A;  3EYZ A;  4FJ9 A;  4XIU A;  4X64 K;  1IJJ A;  3ZT4 A;  3FZH A;  3T3F A;  2HHW A;  1EQY A;  2NRT A;  1BU6 O;  2X6N A;  1NK7 A;  4KTZ A;  4M3Y A;  1HYS A;  4PY5 A;  2PAV A;  3OA9 A;  4DTU A;  1DTT A;  3SJJ A;  3M8P A;  3A0I X;  2I5J A;  3MX2 A;  2HHS A;  3DRR A;  1K6Y A;  5LJV A;  3PX0 A;  2P9K B;  5F0X A;  2VQE K;  4BQL A;  3DLG A;  3O4W A;  1Z05 A;  3NE6 A;  1T03 A;  1N33 K;  5DMR A;  2QTD A;  3EKU A;  2J4R A;  3ZSZ A;  3G0Z A;  4B1X B;  3KJV A;  4GNI A;  3MED A;  3I33 A;  4A59 A;  4GVE A;  1B9D A;  4YOV A;  2YI1 A;  2VGN A;  3TAB A;  4CEO A;  1DTQ A;  1HNX K;  2KZZ A;  1JCG A;  5CY4 A;  2QWO A;  1U6Z A;  3KK2 A;  4BRP A;  4EHT A;  1VSF A;  3PIO L;  2HHX A;  4B3M K;  3LDN A;  3QEI A;  2UUB K;  3QIN A;  1Y64 A;  4FK2 A;  3THY A;  3KWI A;  5EY4 A;  1T8E A;  3PO4 A;  1TAU A;  1HQU A;  4JKF A;  2HHQ A;  4F2S A;  4JKH A;  4KH4 A;  4NCB A;  4FM2 A;  3O5B A;  3CXC M;  1WBD A;  2F8S A;  3L2U A;  1OKJ A;  4H5W A;  5KTQ A;  2V7Y A;  4AHS A;  3OYL A;  2HNZ A;  3AA2 A;  2UUC K;  2OPP A;  1EO1 A;  3ZX0 A;  3KLE A;  2QEX N;  2P9S B;  1Q9Y A;  5LL6 Z;  4A5A A;  3R8E A;  3VEV A;  3ZET B;  3T69 A;  2NRR A;  4FLT A;  3AO3 A;  3V1O A;  3VOV A;  1XHX A;  3F5T A;  1NM1 A;  4CHN A;  4IFV A;  1S1U A;  2YX6 A;  2FBX A;  1W0H A;  4N41 A;  1NGH A;  3H6E A;  1L3V A;  3MMV A;  3A2F A;  1WSF A;  3CM5 A;  4LF7 K;  3C65 A;  3OY9 A;  4NLC A;  4CEF A;  4IJA A;  3DXM B;  4JI0 K;  5GIP A;  4RW7 A;  4DF8 A;  5FRN A;  4FLV A;  3C6U A;  2HHU A;  3TWH A;  2KKZ A;  4NYN A;  4KHN A;  4FK4 A;  3O1B A;  3AVA A;  4IOC L;  3EE8 A;  4IG0 A;  1U45 A;  2NRW A;  4PKG A;  5E26 A;  2P9I A;  2QW9 A;  4CEC A;  1NKC A;  2NNW A;  1RDA A;  4IBN A;  2D1K A;  1LWC A;  2JLE A;  1JKH A;  1KAX A;  3LDO A;  2YCH A;  4B1Z A;  2P5O A;  4CGD A;  4FW2 A;  4C8K A;  4N47 A;  3QBX A;  1KVB A;  4CJF A;  3ZSV A;  2RPI A;  4JKG B;  5DM7 L;  4DG1 A;  3V9U A;  4FL9 A;  4N76 A;  1XHZ A;  4FLZ A;  3AO2 A;  5AQM A;  5I3U A;  3TAE A;  3WT0 A;  3VEN A;  4JKA A;  5FDL A;  4JI1 K;  3R3L A;  1K8K A;  2DFH A;  4E19 A;  3W3D A;  1TYQ A;  1C0M A;  1HYZ A;  3AVL A;  3C0B A;  1IG8 A;  4AM7 A;  2ZJR L;  4K0K K;  3M1F A;  3OW2 M;  3EN9 A;  3SMP A;  4BRD A;  1L3S A;  3THX A;  2I7N A;  3AVJ A;  1M1K O;  4B3S K;  4C8L A;  1DLO A;  1WSE A;  2W41 A;  3KWG A;  2P5G A;  2XY6 A;  1FK9 A;  2EHG A;  3UE5 A;  2ETJ A;  2FBV A;  4CER A;  3K5N A;  2HVH A;  5AQV A;  1LAW A;  1TK0 A;  3H3N O;  3MEC A;  4CHQ A;  4FWL A;  1ATN A;  1ZBF A;  1S5J A;  2P9U A;  4TSX A;  3CCR N;  3P83 D;  5BRF A;  1VSL A;  3O08 A;  3SAH A;  1NGE A;  4DU3 A;  2FC0 A;  3ASM A;  5AJ3 K;  4GVM A;  3J81 O;  4ZTJ A;  3M6G A;  5AQH A;  1ASU A;  3HRG A;  1RT1 A;  3MXJ A;  5KPR A;  1KD1 O;  1M90 O;  2V52 B;  3ZSY A;  2E2O A;  1JXE A;  2Z1I A;  3S3O A;  4Y1C A;  1NJZ A;  3D45 A;  2NRZ A;  1P8Z A;  4WFA L;  2YKM A;  1S1W A;  5LJW A;  2QWP A;  3D2E B;  5FRO A;  3AV9 A;  3S41 A;  4DSK A;  4CJP A;  3WEE B;  4DUY K;  1SKS A;  1GLL O;  2A5X A;  4DV1 K;  3TU5 A;  3VA3 A;  1HNZ K;  4WYB A;  4CJQ A;  5AQW A;  2CH6 A;  3NVM A;  4H5N A;  5FLX O;  5BRH A;  4KTW A;  3L2Q A;  1VQP N;  3OBY A;  1F21 A;  4PWD A;  4FVU A;  3IAY A;  1D9D A;  4B3T K;  4LF6 K;  3VQP A;  3RMC A;  1YTU A;  2NLX A;  4AHR A;  4A62 A;  3AGK A;  3RR7 A;  4DLE A;  1HKG A;  4DV5 K;  1S9E A;  4JI3 K;  3FZF A;  4DSE A;  1N6Q A;  2DFF A;  3CPW M;  4FOI A;  1N5Y A;  1W97 L;  4BC4 A;  4LH4 A;  3HPO A;  3QB0 A;  2AJQ A;  3CMA N;  4JV5 K;  1LWE A;  4LFC K;  4FZZ A;  3QEW A;  4J8F A;  1YI2 N;  5C2F A;  4JNE A;  2ZE2 A;  2YNF A;  4ISG A;  3V9Z A;  4H8K A;  3DXK B;  3P39 A;  4QAG A;  4DQQ A;  3MXI A;  5FPM A;  2HHV A;  3C6H A;  1BG3 A;  3L0Q A;  4NCA A;  2I7P A;  5DK5 A;  4JI2 K;  5AQG A;  4CZG A;  3RR8 A;  3D2E A;  5HRN A;  4DQS A;  2IS3 A;  3CCL N;  3CCU N;  4DQP A;  3AAR A;  4ELT A;  4BRK A;  3BP8 A;  3H1Q A;  1K73 O;  2QM1 A;  4KI4 A;  3T1H K;  2YHY A;  4YOW A;  5KQD A;  4OKJ A;  3VQ9 A;  3I0R A;  1VSK A;  1TL3 A;  4E7I A;  3DOK A;  4Y0W A;  2AA4 A;  1SKR A;  1XMO K;  4O5B A;  2XY7 A;  3G10 A;  5HBM A;  2O8B B;  1VQK N;  3HXM A;  4ELU A;  3VQ6 A;  3U9D A;  5HP1 A;  2VWB A;  3AAP A;  4JI6 K;  5AQJ A;  1HKC A;  3VEO A;  2HHT A;  2G8V A;  2HW3 A;  3AA4 A;  4IEI A;  4XH1 A;  3WNG A;  2YHX A;  4UY8 O;  3UKU B;  4DTX A;  1A5W A;  4ISF A;  4B9U A;  1BHL A;  4IFE A;  4YFU A;  3K5L A;  1N32 K;  3VGM A;  2Q36 A;  1U4B A;  4DUZ K;  5I42 A;  2NZT A;  4DV2 K;  3L2V A;  3WQU A;  5KI6 A;  4CJ4 A;  3THV A;  3ZSW A;  5HLF A;  4IDH A;  4DU4 A;  4CD1 A;  3J8A A;  1D9F A;  4CF2 A;  4KH5 A;  3HPG A;  3MCP A;  3R6M A;  1R0A A;  3BGR A;  2OAN A;  1KLM A;  1IH7 A;  3ENB A;  2E5L K;  1NGI A;  3U3Y A;  5HRS A;  4BRH A;  3SUQ A;  4NO7 A;  3OJS A;  3S9H A;  4M7X A;  3CJA A;  4H0X B;  1OH8 A;  2O8F B;  3WNE A;  4CEZ A;  1UOC A;  4CF8 A;  4IOX A;  1HNI A;  4ICL A;  5GAE P;  1GOA A;  1QHT A;  1BDG A;  2RKI A;  3GL1 A;  4B1W B;  3LAK A;  1QVG M;  2X78 A;  1LCU A;  3DRP A;  4H4M A;  3OYI A;  3VF2 A;  3AO5 A;  3WUH A;  4CE9 A;  3VET A;  2HBL A;  4AHV A;  4QS9 A;  4KH6 A;  4CVN E;  4JEP A;  3U9Z A;  3JSM A;  4JS4 A;  1XNR K;  4AQY K;  4PL8 A;  4O0J A;  4CJS A;  3IDH A;  1GOC A;  2LSN A;  2P9L A;  4FWN A;  4R5P A;  4HTL A;  1YVU A;  2PBD A;  4BRF A;  3AVG A;  4R79 A; 
#chains in the Genus database with same CATH homology
 2HHS A;  4EP5 A;  4CES A;  1RNH A;  3HM9 A;  4B3O A;  3DRR A;  4CGG A;  2HND A;  4IG3 A;  1K6Y A;  5HRO A;  4LSN A;  3PX0 A;  4WE1 A;  5CYM A;  1IG9 A;  3KD1 E;  3U3G A;  1RBV A;  1VRT A;  1SUQ A;  1C0T A;  3NH0 A;  3OS0 A;  1KFS A;  3DLG A;  4CJ3 A;  5CZ2 A;  3NE6 A;  1T03 A;  3KKR A;  2G8W A;  5DMR A;  1VSJ A;  1NK0 A;  3LWM A;  3JYT A;  3L3V A;  5T7B A;  1HQE A;  4B8A B;  3KK1 A;  4DTO A;  4FJN A;  1YT3 A;  3NGY A;  3ZSZ A;  2IDO A;  3M8Q A;  3G0Z A;  3KJV A;  1CZ9 A;  1J5O A;  4LH5 A;  3MED A;  4HCC A;  3OS1 A;  4FCY A;  3V81 A;  3QEP A;  3ZCM A;  4O4G A;  2W42 A;  4B9U A;  3OYA A;  3KLH A;  1B9D A;  1I39 A;  2BGG A;  4DTN A;  3TAB A;  3FFI A;  4CEO A;  1DTQ A;  4HCB A;  4KB1 A;  4JS5 A;  2KQ2 A;  2KZZ A;  2YNI A;  3OYC A;  4KHS A;  4FZY A;  5CY4 A;  1WAJ A;  1SL0 A;  4CGI A;  3M8P A;  3KK2 A;  5SWM A;  4HUE A;  4DFM A;  2OPR A;  3ZSR A;  1L3T A;  1RBS A;  4ZTF A;  2QKB A;  1RTJ A;  1RTI A;  1VSF A;  2HHX A;  1BL3 A;  4FXD A;  4FJH A;  1SL2 A;  3QEI A;  3V6D A;  3NHG A;  3SQ2 A;  3QIN A;  4ELV A;  3OYK A;  4FK2 A;  4CF0 A;  1NK8 A;  4JLH A;  3ZT3 A;  5K14 A;  3ULD A;  1T8E A;  3PO4 A;  3AVK A;  1KVA A;  4O55 A;  3DOL A;  2PZS A;  1TAU A;  2P51 A;  1HQU A;  1XC9 A;  4OLB A;  5HRR A;  1QS4 A;  3SCX A;  2HHQ A;  1WN7 A;  4CJE A;  4CJV A;  4F2S A;  3D0P A;  3TR8 A;  2ITG A;  2VWJ A;  3NFA A;  4AIL C;  4CJL A;  5EU7 A;  4NCB A;  3F73 A;  1W9H A;  4FM2 A;  3QEX A;  1UAX A;  1VK0 A;  5J2Q A;  1RT2 A;  2E6L A;  1FKO A;  2F8S A;  3L2U A;  3C6T A;  4C8O A;  2OPQ A;  5KTQ A;  1ZBU A;  3CYM A;  4AHS A;  4E89 A;  3OYL A;  1TK5 A;  2HNZ A;  3AA2 A;  3AVI A;  3O3H A;  3LP1 A;  2OPP A;  3HVT A;  3DYA A;  3F9K A;  3KLE A;  2G8H A;  1XWL A;  4Z4F A;  4OLA A;  1WAF A;  3BDP A;  3M8S A;  3RRG A;  1HNV A;  2D0A A;  3O4N A;  3HT3 A;  4DQR A;  3RMB A;  1Q9Y A;  1S1V A;  2FBY A;  4CK2 A;  3RMD A;  3MXM A;  1CZB A;  3CQ8 A;  1QTM A;  4N5S A;  3TAP A;  4BWJ A;  5KGX A;  4FLT A;  3AO3 A;  3V1O A;  3ISN C;  1XHX A;  1BQN A;  4K8X A;  3NF8 A;  2VWK A;  4CIG A;  3T19 A;  3CG7 A;  4KV8 A;  3LPT A;  4IFV A;  4CHN A;  3PX4 A;  1U47 A;  1S1U A;  2FBX A;  4UQG A;  1W0H A;  3TAR A;  4YNQ A;  4FLY A;  4N41 A;  4PA1 A;  4EZ9 A;  1IO2 A;  1L3V A;  4AHC A;  3A2F A;  3AA5 X;  1WSF A;  4HHT A;  4QOZ B;  1LWF A;  3CM5 A;  4IFY A;  4M3X A;  2HB5 A;  5J2M A;  4B9S A;  4GW6 A;  4E7H A;  3RRH A;  1C1B A;  1RDC A;  1S6P A;  3H08 A;  1HJR A;  4G1Q A;  4ID5 A;  3SUN A;  1RTD A;  1Y97 A;  3OY9 A;  1KTQ A;  1VRU A;  1EX4 A;  3VQQ A;  3LPU A;  4ID1 A;  4CEF A;  3NDK A;  3LP2 A;  2ATQ A;  3P5J A;  2OZM A;  1C1A A;  4RW7 A;  4B9T A;  4DF8 A;  2GBZ A;  4FLV A;  3C6U A;  4DS5 A;  5FRN A;  3HP9 A;  2HHU A;  1TKT A;  3T1A A;  1LW2 A;  4NYN A;  3TWH A;  4DSL A;  3OYM A;  4FM1 A;  4B9L A;  5FRM A;  4J2B A;  4KHN A;  4FK4 A;  4F8R A;  3AVA A;  4EP4 A;  4IG0 A;  4OKE A;  4CFC A;  3KKS A;  1U45 A;  4Q0B A;  4DF4 A;  1VSD A;  2KZM A;  1LV5 A;  4FJM A;  4CHP A;  1TAQ A;  4FYD A;  1NKE A;  3MEG A;  4DS4 A;  2NUB A;  3LZJ A;  4AH9 A;  2OA8 A;  3OS2 A;  2O4I A;  1LW0 A;  1YTA A;  2XHB A;  4OKK A;  4CEC A;  1NKC A;  4M3U A;  1J9A A;  1RDA A;  4DTJ A;  4IBN A;  4CF1 A;  5JS1 A;  1LWC A;  3CFR A;  4DWI A;  4FJ7 A;  2JLE A;  1JKH A;  4E7J A;  3LDS A;  2P5O A;  3ALY A;  3AVC A;  3E01 A;  1CXQ A;  1RCH A;  3SJJ A;  1ZYQ A;  4CGD A;  4FW2 A;  2VG5 A;  4C8K A;  1XI1 A;  4N47 A;  3UIQ A;  1CLQ A;  1JLQ A;  3ZSQ A;  4CK3 A;  1Q9X A;  1KVB A;  4CEE A;  4CJF A;  3OYB A;  3ZSV A;  3S3M A;  2RPI A;  4CED A;  4DG1 A;  4W5R A;  3NGZ A;  3V9U A;  4F4K A;  1WSJ A;  4OPJ A;  4CIF A;  3TAN A;  4DFP A;  4N76 A;  4BDY A;  3QEV A;  1XHZ A;  4FLZ A;  4I7F A;  3AO2 A;  4M3Z A;  5JS2 A;  5I3U A;  1JL2 A;  3TAE A;  4KHY A;  3KIO A;  3PX6 A;  2RF2 A;  3DM2 A;  5FDL A;  3DLB A;  2DFH A;  2EX3 A;  2YNH A;  4IDK A;  4E19 A;  4DSI A;  4E7L A;  2FBT A;  3PUF A;  1L5U A;  2WOM A;  1TKX A;  1B92 A;  2P1J A;  5C24 A;  4DQI A;  1C0M A;  2IAJ A;  1TL1 A;  3ZSO A;  3SUO A;  1HYZ A;  3OYH A;  3AVL A;  4EZ6 A;  2BAN A;  3P1G A;  1NOY A;  3L2R A;  1RTH A;  2OZS A;  3LP3 A;  4KAZ A;  1J53 A;  1UWB A;  1JLF A;  2X6S A;  3ITH A;  2KFN A;  4DLG A;  3V1R A;  3OYG A;  1L3S A;  3LP0 A;  3AVJ A;  1RBR A;  3SPY A;  1DLO A;  1WSE A;  3NBP A;  3TAM A;  4CFB A;  4C8L A;  5CYQ A;  3V4I A;  4FW1 A;  1C0U A;  4E1N A;  2P5G A;  1RT4 A;  4BAC A;  2XY6 A;  1FK9 A;  4Y1D A;  4L8R B;  3VQ5 A;  3AO4 A;  2EHG A;  2OPS A;  4CGJ A;  2KW4 A;  4M3W A;  2ETJ A;  1HRH A;  2FBV A;  4CER A;  3LWL A;  1T05 A;  3K5N A;  4Z4E A;  2HVH A;  3HYF A;  1LAW A;  1TK0 A;  4CJT A;  2QK9 A;  3RTV A;  2G8K A;  3MEC A;  4CHQ A;  2PYL A;  3VQ8 A;  4CHO A;  1ZBF A;  2QXF A;  1S5J A;  4M41 A;  4TSX A;  2XY5 A;  3NF7 A;  1VSH A;  3P83 D;  4GMJ B;  1NK5 A;  1VSL A;  5KRT A;  4KKO A;  3DLH A;  4DU3 A;  2FC0 A;  4JRQ A;  4M3T A;  3ASM A;  3V9X A;  1JLE A;  3C95 A;  4GVM A;  4ZTJ A;  1ASU A;  4FZX C;  1NOZ A;  1RT1 A;  2YHA A;  3MXJ A;  3NF9 A;  1TV6 A;  1U04 A;  4CIE A;  3QIP A;  2R7Y A;  4FJJ A;  3U6F A;  1QE1 A;  3ZSY A;  4E3S A;  1JXE A;  1Z25 A;  1ITG A;  2Z1I A;  3S3O A;  4FVM A;  4Y1C A;  1BIZ A;  4DSF A;  1NJZ A;  2YV0 X;  3D45 A;  1REV A;  4HVJ A;  2YKN A;  4PUO A;  2YKM A;  5E41 A;  1S1W A;  3KLI A;  4DTS A;  4BE1 A;  3DLE A;  3AV9 A;  5FRO A;  1HYV A;  4DSK A;  1JLC A;  4CJP A;  3VQ4 A;  3SV4 A;  3HO1 A;  4CHZ A;  1RT5 A;  3B6P A;  4KFB A;  1SKS A;  3LAN A;  2O4G A;  2HNY A;  3TI0 A;  3V9S A;  3S3N A;  4AHU A;  2IOC A;  3KK3 A;  4FJL A;  2JGU A;  5KGW A;  4HTU A;  4JRP A;  3VA3 A;  4C8M A;  3SPZ A;  2BDP A;  4RW6 A;  4CJQ A;  1RDD A;  1U48 A;  4FJG A;  2DY4 A;  3K58 A;  2B4J A;  4M3R A;  1B9F A;  1Q8I A;  4KTW A;  4DMN A;  3QIO A;  4H4O A;  3V1Q A;  3L2Q A;  1X1P A;  1IKW A;  2D0C A;  3WNH A;  1F21 A;  4CEQ A;  4PWD A;  1NJW A;  1FXX A;  4Z0U A;  3IAY A;  4OPK A;  1D9D A;  4O0I A;  3VQP A;  4MFB A;  3ZT2 A;  3LAL A;  4C8N A;  4FLW A;  3RMC A;  4F3O A;  1SV5 A;  1YTU A;  3AVN A;  3HPH A;  4AHT A;  4AHR A;  1LAV A;  4KRE A;  3RR7 A;  2YHB A;  1RT6 A;  4RG8 A;  3AVB A;  3WNF A;  1O1W A;  1TGO A;  4CK1 A;  4DLE A;  1ZBL A;  4KTQ A;  3RMA A;  3HVR A;  2A1R A;  1C6V A;  1S9E A;  3SQ1 A;  1RIL A;  4FJ8 A;  1Z26 A;  2WON A;  3NH1 A;  4KPY A;  4DSE A;  3B6O A;  3NGI A;  3QNN A;  1N6Q A;  2DFF A;  2G8F A;  4F3T A;  1ZBI A;  1N5Y A;  3SYZ A;  3IS9 A;  2VG6 A;  3DI6 A;  4E7K A;  4KRF A;  1BCO A;  4LH4 A;  4KO0 A;  1HMV A;  3VQE A;  5KRS A;  3HPO A;  2AJQ A;  3AA3 A;  1LWE A;  4FZZ A;  1IKY A;  3QEW A;  3DRS A;  1IKV A;  3NAE A;  2IGI A;  5J2N A;  4E0D A;  4KI6 A;  1QSL A;  1G15 A;  2Z1G A;  3HK2 A;  2ZD1 A;  3OJU A;  4LD0 A;  3L2W A;  2E4L A;  3K57 A;  2Q3S A;  1C1C A;  1JL1 A;  3TAG A;  3K2P A;  4CEB A;  2ZE2 A;  1I3A A;  1X9W A;  1EP4 A;  4KHQ A;  1JXB A;  1TKZ A;  2YNF A;  3TAF A;  2KFZ A;  3V9Z A;  4H8K A;  1JLA A;  1S1X A;  3SQ4 A;  4DQQ A;  1EET A;  4QAG A;  4KHW A;  2HMI A;  3MXI A;  1VSI A;  2HHV A;  2D0B A;  3QLH A;  4Z4H A;  2DFE A;  3HP6 A;  1NK6 A;  2PY5 A;  4NCA A;  4FLU A;  5DK5 A;  3ZT0 A;  1UA0 A;  5CZ1 A;  1BIS A;  2XO7 A;  4FLX A;  1KCF A;  4HUG A;  2IC3 A;  3RR8 A;  1EXQ A;  5HRN A;  4DQS A;  2IS3 A;  5HRP A;  1RT3 A;  3KLF A;  1TK8 A;  1D8Y A;  4B8C A;  4DQP A;  1SL1 A;  4ELT A;  3AVF A;  3QNO A;  4CCH A;  1QSY A;  3DLK A;  1T7P A;  4B9V A;  4KI4 A;  4M42 A;  4I2Q A;  4OKJ A;  3O3F A;  4J2D A;  1S1T A;  5J1E A;  5D3G A;  3LZI A;  4B9M A;  3VQ9 A;  3AVH A;  1WSI A;  3I0R A;  1IKX A;  2XRI A;  1VSK A;  1TVR A;  1ASV A;  1TL3 A;  3OYD A;  4DTM A;  4FJK A;  4E7I A;  3SV3 A;  4J2E A;  3DOK A;  5J2P A;  3PV8 A;  1VSE A;  1KSP A;  1BCM A;  1BQM A;  3SI6 A;  3VQD A;  3QES A;  2BE2 A;  4E1M A;  4F2R A;  1SKR A;  1S9G A;  3VA0 A;  3IRX A;  4O5B A;  3G10 A;  5HBM A;  3LAM A;  2XY7 A;  4ELU A;  3HXM A;  1HPZ A;  4CGF A;  4CGH A;  4ZHR A;  3ZT1 A;  1NJY A;  3DMJ A;  4BDP A;  3VQ6 A;  4Z4C A;  2QKK A;  4W5Q A;  5C25 A;  3K59 A;  2B6A A;  5HP1 A;  1EKE A;  3MAQ A;  1UA1 A;  3PY8 A;  4RW9 A;  4CJR A;  1J54 A;  3AVM A;  5SZT A;  4DFK A;  4DSJ A;  2B5J A;  2RN2 A;  4CEA A;  4QCL A;  2HHT A;  1FKP A;  2G8V A;  4Z4G A;  3AA4 A;  2HW3 A;  3WNG A;  3VQB A;  1D5A A;  3VQC A;  1ASW A;  1QSS A;  3IG1 A;  4PQU A;  2PYJ A;  4DTX A;  3TAQ A;  1A5W A;  2YNG A;  3CM6 A;  4B08 A;  2DTU A;  1BI4 B;  1RBU A;  3HST B;  1BHL A;  3K5O A;  4OGC A;  4CFD A;  4YFU A;  4W5T A;  3K5L A;  3KTQ A;  1L3U A;  3VN5 A;  1U4B A;  2X74 A;  3EY1 A;  5I42 A;  1A5X A;  3EZ5 A;  1GOB A;  3L2V A;  1WSH A;  4BE2 A;  3QET A;  3SUP A;  4DTP A;  3OYN A;  2G8U A;  3C94 A;  4B9N A;  5KI6 A;  4N56 A;  4MQ3 A;  4W5O A;  4J2A A;  2VG7 A;  1NK9 A;  4CJ4 A;  3K5M A;  2E6M A;  2GV9 A;  3VQ7 A;  1JLG A;  4BWM A;  4CFA A;  4CJ5 A;  4BE0 A;  4FM0 A;  3THV A;  3DLR A;  3ZSW A;  5HLF A;  2HVI A;  3OVN A;  4W5N A;  3NF6 A;  2Y1J A;  1KVC A;  4DU4 A;  1ZBH A;  1SKW A;  4OGE A;  3AO1 A;  2A1S A;  2F96 A;  4O44 A;  3NH2 A;  3I8D A;  1D9F A;  4CF2 A;  2D5R A;  2G8I A;  3HPG A;  1A5V A;  4M45 A;  1JLB A;  4FJI A;  2KTQ A;  1R0A A;  4DTR A;  4NCG A;  3BGR A;  1RT7 A;  3O3G A;  2Y1I A;  4CJK A;  4OVL A;  1KLM A;  4BDZ A;  1IH7 A;  2XY8 A;  3QER A;  3U3Y A;  3SNN A;  4LSL A;  5HRS A;  3NCI A;  1BGX T;  1NJX A;  4I9Q A;  3SUQ A;  3ZSX A;  3OJS A;  3L8B A;  4NYF A;  4FJ5 A;  1QQC A;  3QO9 A;  4CJU A;  3S9H A;  3L3U A;  3CFP A;  1X9S A;  4I2P A;  4K8Z A;  4RW4 A;  4CJW A;  3OYF A;  1X9M A;  4LY7 A;  2OYQ A;  1TKD A;  4DU1 A;  3WNE A;  4CF9 A;  4CEZ A;  1UOC A;  2Z1H A;  4CF8 A;  1HNI A;  4I9L A;  4ICL A;  4KHU A;  3SZ2 A;  3SQ0 A;  2Z1J A;  1GOA A;  1QHT A;  5C42 A;  3VQA A;  4DFJ A;  2RKI A;  1KLN A;  4Z4I A;  1VSM A;  1S6Q A;  3LAK A;  1KFD A;  3HL8 A;  3KD5 E;  1U49 A;  2ZQB A;  2F8T A;  3HJF A;  1NKB A;  2X78 A;  3RWU A;  3DRP A;  4H4M A;  3M8R A;  4IKF A;  1WNS A;  4CHY A;  3OYI A;  4HUF A;  3AO5 A;  3OYE A;  4Q5V A;  1WSG A;  3I0S A;  4CE9 A;  3KLG A;  4AHV A;  3PO5 A;  1BIU A;  1NK4 A;  4RW8 A;  3EYZ A;  3JSM A;  4FJX A;  4XIU A;  1KRP A;  4FJ9 A;  1MU2 A;  4JS4 A;  1RBT A;  4KB0 A;  3ZT4 A;  3MEE A;  3T3F A;  3V9W A;  4O0J A;  2HHW A;  4CJS A;  1WLJ A;  1GOC A;  2LSN A;  4FK0 A;  1BI4 A;  2X6N A;  4R5P A;  1NK7 A;  1RDB A;  4KTZ A;  3O4Q A;  4M3Y A;  1HYS A;  4PY5 A;  1YVU A;  4DTU A;  4OJR A;  1CXU A;  1DTT A;  2GUI A;  3OYJ A;  3CFO A;  3AVG A;  2I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...