1S9EA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 142
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9eA05
3V6KA 1JLQB 4B9LA 4CFDA 3OSNA 3RMAA 5KFXA 1VRUA 4C8MA 2R8GA 5T7BA 1X9WA 2W8LA 1EP4B 3V81A 4ECUA 2YHBA 3GQCA 1C0MA 3O3FA 4FJJA 4NLTA 4AHCA 1JLBB 4PQUA 4K4XA 1B92A 4IG3B 3M8SA 3H5SA 3MTKA 3DOLA 2BDPA 4J9MA 4E0DA 4MH8A 4KFBB 2YNFA 4JV1A 2YKNA 2FVSA 1K1QA 3V9ZA 3SJJA 1TKDA 1L3UA 1X9MA 4KE5A 4WE1A 3AVKA 5CZ2A 2D3ZA 2F8TA 2J6UA 3KK3A 4E7JA 1W0HA 4HTUA 5KFFA 4H4OA 3HVTB 4DF8A 3KLHA 5KFKA 4DTSA 5E41A 5F8NA 1FKPA 3I5CA 2ASLA 3AVJA 3TANA 4LY7A 4O3QA 1ZBHA 1RTIA 3NAIA 2RDJA 3C6UB 1LW2B 3Q8RB 1EETB 4OJRA 4H4MB 4GMJB 4I2QA 5L1IA 3CM6A 4Q0BA 3MECA 4L8RB 4O4GB 1IM4A 3H40A 4FZZA 4XO0A 3H5UA 4ZVHA 4FJXA 2GIRA 3KJVB 2HHXA 1RBUA 1C1CA 3C6TB 4NLQA 4BDYA 5HRPA 4J9OA 5HROA 3NF6A 4ZHRB 3CDUA 3VQ6A 3MXIA 3V6HA 3IGVA 4CECA 1LWFA 3DM2A 4Y2AA 4J9QA 4FLUA 4DTRA 1QSLA 4F4KA 1WSJA 4KBIA 4IKAA 1A5XA 5C25B 4Q43A 3OJSA 1TAUA 2YNGB 4Z4FA 1S0OA 3KLEB 3ZSRA 4DS5A 3RB6A 3NKYA 3SUNA 4ECZA 1N6QA 1WSGA 1NK6A 1LWEA 4DEZA 3QEVA 1SUQA 1WAFA 4KHSA 3FDSA 3KTQA 4FJGA 4URQU 4UQGA 4Z4EA 4M42A 4AHVA 1JLFA 5KT7A 4JRPA 4B8AB 1W25A 4FS2A 3RTVA 5DGAA 2EX3A 1JLCB 2AX1A 2ZE2A 1L3VA 3TAMA 2I1RA 4FVMA 4URGA 2W9AA 3VQCA 4DSFA 5CYQA 4OKJA 1W9HA 3JSMA 3CFRA 4KHQA 1S97A 3MR2A 3SQ2A 4LH5A 4R5PA 5KG1A 4Q0BB 5KFNA 3PW4A 4AHTA 3K2PA 5D3GB 4E1NA 1Y97A 5DMRA 3JYTA 2ZQBA 2XC9A 4CGGA 2X78A 4HUEA 3KLIA 4U6PA 4F50A 3I0RA 2IM0A 1R0AA 3NH0A 2R7YA 1VRTB 5J2PA 4LH4A 3BSAA 1JXEA 1RT3B 1CXQA 3IRXA 4TXSA 2E4LA 2ASDA 3FFIB 5HRSA 1D9DA 2FBVA 2DFEA 3EZUA 4AHUA 1SH0A 4J2BA 4NLGA 1Z4UA 4CJRA 4ID1A 4CGJA 3WNFA 3HO1A 3HP9A 4FK4A 3RR7A 3DMJA 4MQ3A 2BANB 3RBDA 1SV5A 1REVB 1XHXA 4ICLB 4IRCA 4J9LA 3KKSA 4ZMMA 2OPQA 5FRMA 3OL6A 3NBPA 2FLPA 2IC3B 3L2WA 3ZT2A 4CGIA 3OL8A 3DRSA 1YVFA 4K4SA 1FK9A 4NLOA 3HM9A 1J5OB 3CWJA 2Z1HA 5HP1A 4RW8B 2P5GA 1RTJA 2FJVA 1J54A 1YVUA 5J2MB 2HNYA 2BQUA 4CEQA 3PZPA 3K5OA 2DTUA 3D28A 5C42B 4WFXA 1S1UA 3KLGA 1T03B 1CZ9A 4ZTFA 4FJLA 4K4ZA 1VSJA 5KFMA 3SQ1A 4FS1A 4BACA 4J9SA 3KOAA 4RW7A 1HARA 1KFDA 3V1OA 1RTDA 3NHGA 4TN2A 3BR9A 4NYZA 1UAXA 3KK1B 3MEGB 1SKSA 4YMEA 2FBXA 5J2QB 1HQEB 5KT5A 2R8JA 3DLBA 4WXWA 1TK5A 5DQHA 5KI6A 4ED0A 3KLFA 3RB3A 2I5JB 3VQ8A 4J9PA 4ECYA 3DRRB 1BCOA 2QKKA 2VG5A 1ASUA 1TGOA 4FJ8A 3BQ2A 4KKOB 3QESA 3O3GA 3SUQA 1XC9A 1VSIA 2UVRA 2GBZA 3PVXA 1VSLA 4E7LA 4CEZA 4LSNB 4IRDA 2VG7B 3MXMA 1NK0A 3L8BA 4FM2A 1KLNA 5F8LA 3DDKA 3SUOA 1RT6A 4KB7A 1ZTTA 2JEIA 1TL3A 1TKZB 4QWCA 2YNHB 4MIAA 1BGXT 3AVIA 1RAJA 2W9CB 2W7OA 1IO2A 5KFPA 3ZSXA 3I0SB 4F4XA 2B6AA 4CJQA 4FLXA 4DTNA 4HYKA 1U45A 4DSIA 3GIKA 3LANA 5FROA 1Q9YA 3LZJA 2RF2B 2KQ2A 5KFBA 1TVRA 4Z4GA 1B9DA 3ULDA 4W5QA 4M41A 4DU1A 4NLSA 3V1QA 3CJ0A 1WN7A 2IDOA 1ZYQA 4RNMA 4MK8A 1RT2B 2WB4A 3OSPA 2WOMA 4EO6A 1DLOB 3GIMA 4FJ9A 1TL1B 4Z4CA 2XI2A 4GW6A 3MR6A 2GIQA 4FLVA 5KFDA 1TKXA 4B9UA 2X74A 4M3ZA 3SYZA 3GV8B 3IAYA 2VG6A 4FBUA 4LD0A 3AVGA 3HT3A 4CEAA 1HQUB 3CJ5A 2FVCA 4ECTA 3NL0A 1TP7A 1S1TB 3L3VA 2FC0A 2HMIA 3BGRB 4CFBA 1U09A 1S1XA 3HSTB 5KFRA 1BL3A 3DLGA 5CZ1A 2YKMB 2OPRB 1EKEA 2AQ4A 3KNAA 3M8QB 1TV6A 5HBMA 4CEOA 5KGXA 5HRNA 4ELVA 3AO2A 1NK9A 3HPGA 5KFLA 3T5JA 1WSFA 4NLPA 4ZPCA 4IDKB 2QXFA 3NMAA 3NDKA 3LDSA 1WAJA 1QUVA 1BQMA 4K50A 2R2RA 2ASJA 1HYVA 2J6SA 4HUGA 1JLAA 3HPOA 5L1LA 3V1RA 3ITHB 1RILA 3UR0A 4M3RA 2WONA 2G8VA 1DTQA 4KTWA 4TLRA 1T05B 4JV0A 1A5WA 2WCXA 2AX0A 2OPSB 5F8IA 3H98A 3DOKA 2V4RA 3S3OA 2R2UA 1IKVB 5KFOA 3CG7A 1YT3A 3CO9A 4CJ4A 3GIJA 3AVMA 3B6PA 3PX6A 3NH2A 4NCGA 1OS5A 1KSPA 3BDPA 4G1QB 1BIZA 4TQSA 3B6OA 4KHNA 2FVQA 3NGIA 5I3UA 2XHBA 2VWJA 3QLHA 3I8DA 3HK2A 2E9TA 5KFQA 3AO1A 5DG7A 3QNNA 4CJTA 4W5NA 3MEEA 2IM2A 1D9FA 2FBTA 4DFPA 2UVWA 3V9WA 4IBNA 3WNEA 3KHHA 1RTHB 2OPPA 1XR5A 5L1JA 5EDWA 3M9OB 4CJ3A 4DSKA 4J2AA 1X9SA 4EYHB 4F3OA 2JEFA 1HPZA 4KAZA 4OVLA 4J2DA 3L2QA 3QIPB 4JV2A 3MAQA 5KRSA 5J2NA 4EEYA 4KO0A 3M9MB 4OL8A 4LSLB 1Z26A 3RBEA 2XCAA 3RB0A 1S9GA 4CFAA 3QEWA 4RW6A 4DTMA 2BQRA 3L2VA 4E3SA 4RNOA 3Q8SB 1JXBA 1QTMA 4IH6A 4NLUA 2BRLA 1QE1A 4W5TA 4RW9A 5JS2A 3DYAB 4N41A 2XY8A 4FW2A 4E7IA 4O5BA 1SKWA 1DTTA 1UWBA 3BJYA 1CSJA 4B3OB 2P5OA 3SQ0A 4PWDB 1ITGA 3OS0A 4FJ5A 2HHVA 3DI6B 4TY9A 4ECVA 3QNOA 1C1BB 4RZRA 4QW9A 5JXSA 2Z1GA 1K6YA 1MU2B 1LAWA 4DWIA 2W42A 4KREA 2J6TA 4DTXA 1LWCB 2XI3A 3QO9B 5KG5A 1JIHA 2XY7A 3SV4A 4NZ0A 1C0TA 2FVRA 2QK9A 1C6VA 1RDCA 3CJ4A 4JUZA 4TSXA 3ISND 3V4IB 3LP2B 4WYLA 3TQ1A 1RBTA 2HHTA 2DFFA 4ZPAA 3IGNA 3PW2A 2RKIB 2PZSA 4IFVA 3S3NA 4DTUA 3NGDA 4NYFA 5I42B 1HYSA 3SQ4A 1ZBFA 2HW3A 4MIBA 3KLVA 4KRFA 1T8EA 3LALA 1KCFA 3DRPB 4CEFA 3OYKA 3SUPA 3T5LA 3OS2A 4TQRA 4MFBB 1N48A 4C8NA 4DG1B 3G86A 1SL1A 2IAJB 3LP3A 4OLAA 3GV7B 2PYLA 4DL6A 2C2EA 3EY1A 2IM1A 4ZVEA 3RAQA 4ECRA 5F9LA 2B5JA 4ED8A 1RA7A 2RPIA 2E6LA 3OYBA 5J1EA 3AO5A 1VRUB 3RRGA 2V9WA 5SWMA 1I3AA 3OYFA 4J2EA 3V81B 4CHQA 4I2PA 4Z4HA 4GC6A 4NCAA 4IFYA 2W9BA 3EZ5A 4DTPA 4XPEA 3QEPA 2XWYA 3AV9A 4J9RA 4DSJA 3FQLA 1N4LA 2G8HA 4PQUB 3K5MA 2R8KA 3DOLB 4CJEA 1QAIA 3QINA 2YNFB 2YKNB 3SFUA 4G3IA 1S9EA 3ISNC 4WE1B 3IG1A 4ZPBA 3CQ8A 2XCPA 4O0JA 3OYJA 3KK3B 3U6FA 4PUOA 4EYIB 4ZP6A 4Q8EA 4JLHA 5HLFA 1C1AA 4NRUA 4H4OB 4DL2A 3LP0A 4KI4A 3HVRA 3KLHB 1FKPB 1RT5A 1I39A 1RCHA 5FDLA 3OYAA 1RTIB 1HJRA 4CF2A 3GILA 5KFSA 3K57A 4I2QB 1RDBA 4KHUA 4CHYA 3MECB 5CYMA 1SH3A 2KZZA 4EZ6A 3OYIA 4AH9A 2E9RX 3ZT3A 3U3YA 1T94A 3CFPA 4YNQA 1C1CB 3GIIA 2PYJA 4CK1A 3UIQA 5HROB 3OHAA 1XHZA 2BE2A 4TYAA 1WNSA 1U04A 3AA4A 3K5LA 4KV8A 4IG0A 4DMNA 4EBDA 1VSHA 1LWFB 3DM2B 1S48A 4Y2CA 4O3OA 4CF1A 5DLGA 1JLGA 4FLZA 3DLKA 1L3TA 2HHQA 3Q8PB 4NLWA 4KHMA 2LSNA 4F4YA 3NAHA 1NK8A 2Q3SA 4K8ZA 5KFIA 2HVHA 3KHRA 4WZMA 3SV3A 2FVPA 1N6QB 3VA0A 4DL4A 5K14A 1LWEB 3N6NA 3CM5A 1SUQB 4DFJA 3BSCA 3LPTA 4DSEA 1F21A 2Z1IA 1NNDA 2JEGA 5CY4A 2HHSA 3QGGA 3VQSA 1KHWA 4YFUA 3D0PA 2DFHA 3KIOA 1JLFB 1BI4A 4TYBA 5HRRA 1BCMA 2R8IA 2ZE2B 3TAMB 4KHYA 3VQAA 1N5YA 5CYQB 1O1WA 3VQPA 5KFCA 3I5BA 3QGHA 4QWDA 1VSKA 1LAVA 3JSMB 3T3FA 1IKXA 1JLEA 4DFMA 1NOZA 1TKTA 2C2RA 3KK2A 4F8RA 1WSEA 4R5PB 3V6DA 2D41A 4CJUA 1RBSA 2YNIA 3JYTB 2W8KA 1TK8A 3PV8A 1RT1A 1KVBA 3SI6A 1S1VA 5KFAA 3KLIB 5KFYA 5L1KA 1L3SA 3I0RB 2HNZA 3PR5B 5KFWA 4O44A 1R0AB 5J2PB 4CJFA 4NRTA 2BR0A 4NCBA 3VQQA 4F2SA 3IRXB 1NK7A 3ICLA 3AA2A 3IS9A 2XO7A 4TY8A 3HYFA 4OGCA 2YHAA 1BQNA 4J9KA 4RW4A 3BQ1A 3PW0A 4E7KA 3DMJB 1ZETA 4KPYA 3SPYA 4M3XA 3K58A 2A1SA 1SV5B 3IN5A 3FSIA 3SNNA 4J9NA 4CFCA 1IKWA 5KFVA 4CJPA 3C95A 1S1WA 1HMVA 3I5AA 2OPQB 3RRHA 3NBPB 1NJYA 5KG4A 5KT6A 3DRSB 3VQEA 1FK9B 3AVHA 2ILZA 3RAXA 3M8PA 4U7CA 4NYNA 3OYHA 4R0EA 5HP1B 1RTJB 2ATQA 4FYDA 2HNYB 1NHVA 4HHTA 4E7HA 3KHLA 4KTQA 4Q45A 2BQ3A 2JC0A 1S1UB 4BWMA 3KLGB 4DLGA 3GYNA 1TAQA 2OZMA 3LP1A 3OHBA 1EXQA 1WNEA 4RW7B 1XR7A 5F8GA 1GOCA 3DLEA 1RTDB 4CE9A 2BGGA 3G0ZA 2GC8A 4ECQA 4KAIA 5L9XA 2HHUA 1NOYA 3MEDA 4I7FA 4FW1A 2C2DA 4CERA 5FRNA 4YP3A 2O5DA 4KHRA 2E6MA 4CHNA 2R2SA 3HVWA 4C8LA 4E19A 1RT7A 3HHKA 1HNIA 4W5RA 1S6QA 3KLFB 4ED3A 3ZSQA 4AHSA 2HNDA 4NLDA 3NF8A 3E01A 3OYGA 5DG8A 1LW0A 2VG5B 3P83D 4FBTA 3PUFA 4YQWA 2X6SA 1IKYA 4ZP8A 1UA0A 3LWMA 4CCHA 4ELTA 2KZMA 1RT6B 3PJXA 1TL3B 4KTZA 4FXDA 2HAIA 3AA3A 4CF8A 1D0EA 1HNVA 5KG6A 3OJUA 3ZCMA 4Z4IA 4OPKA 3O4NA 4FJHA 1RT4A 4ED1A 4FJNA 5C24A 2B6AB 3QZ8A 4EZ9A 3ZSWA 4ED7A 4DS4A 4XPCA 1NJXA 4BE0A 1TVRB 3QEIA 4K4UA 3SI8A 1NKEA 2HWHA 4I9QA 3O3HA 3T5HA 1TQLA 3OYEA 4IRKA 2ZD1A 2QV6A 3CVKA 3NE6A 1S6PA 1U4BA 2ILYA 2UUWA 2QKBA 2AGPA 4DL5A 4NLVA 4CIGA 1RBVA 1JKHA 3CDWA 2C22A 1KLMA 1RBRA 2WOMB 4BWJA 4FJMA 3SFGA 1ZTWA 2WRMA 3S3MA 4WFYA 3BREA 4DFKA 4O3NA 4N56A 3OYNA 1JLQA 2ETJA 3KD5E 4BDPA 4EP4A 2AU0A 3LAKA 2HHWA 3MR5A 3VQ9A 1TKXB 3THVA 1EP4A 4ECXA 2WK4A 3AVFA 2VG6B 1U47A 4QWBA 1S6QB 3TABA 1JLBA 4IG3A 4C8OA 5T14A 5DQGA 4FK2A 4N5SA 5C5JA 3PO4A 1RDRA 3KMQA 1NJZA 2HB5A 4FM0A 2ITGA 4KFBA 1RA6A 4FJKA 3NH1A 2HMIB 1S1XB 4M3YA 4MKBA 3DLGB 1BIUA 4LQ3A 5KGWA 2CKWA 1TV6B 4KSEB 5HBMB 3KMSA 4K4VA 4Y3CA 3P5JA 3HVTA 4PY5A 5KG2A 3RWUA 2XY5A 2RDIA 4XIUA 3ZT0A 4E1MA 4DU4A 1BQMB 3C6UA 1LW2A 1Q8IA 4CHOA 2A1RA 1EETA 4H4MA 2GUIA 3NF9A 1JLAB 2ZKUA 1VSMA 3GV5B 1JL2A 2WONB 4FCYA 4O4GA 1S9FA 1DTQB 1S10A 5DG9A 2F96A 3G10A 2ZD1B 3H59A 4PA1A 1K1SA 3OL9A 3KJVA 4IR1A 1C0UA 3DOKB 4W5OA 4WXOA 3C6TA 4ID5A 3TAQA 2OA8A 3AO4A 4ZHRA 3TVKA 2VA2A 3HJFA 2B43A 4NCGB 5KG0A 3DLRA 4QOZB 2AWZA 3NCIA 3OLBA 1IG9A 4R8UA 1S0NA 2O4IA 2KFZA 4ELUA 2RN2A 1KTQA 5I3UB 3H4BA 2G8IA 5C25A 3QEXA 3MR3A 2YNGA 3SCXA 3KLEA 3QLHB 3OYDA 2QE5A 3OLAA 4EBCA 2D3UA 1SKRA 4O0IA 3OYCA 3RB4A 2IM3A 4O3SA 3MEEB 4ZPDA 3T1AA 3RR8A 4CESA 5KT3A 4CEDA 2R8HA 2AGQA 3D45A 3H08A 2OPPB 2IS3A 4B8CA 3RMBA 4M94A 5F8MA 3VQBA 3CDEA 1HPZB 5F8JA 3V9UA 2G8UA 3OY9A 3BSNA 1KHVA 1JLCA 5KTQA 5EUHA 5J2NB 4KO0B 4OLBA 2XRIA 2IOCA 4E89A 2O4GA 1S9GB 4RW6B 2W7PA 4RNHA 4ED6A 2UVVA 3D5MA 2EHGA 4RU9A 2VA3A 1NJWA 3T5KA 3LWLA 4QWEA 5D3GA 1QE1B 3A2FA 4X2BA 4RW9B 1KFSA 3QGIA 1I6JA 1C0UB 1RYSA 3MFHA 2IBKA 4F3TA 1VSEA 1EX4A 3FRZA 4ID5B 1DTTB 3VQ7A 3NAEA 4JRQA 1UWBB 3TARA 1D1UA 3PW5A 4CGFA 5KT2A 1TK0A 3KHGA 4FM1A 3SPZA 2G8KA 1S0MA 1VRTA 4ED2A 3BQ0A 4R8UB 4M95A 1RT3A 1ASWA 1GOAA 4ZVFA 3FFIA 4NLRA 4C8KA 3G6YA 1GX6A 5DLFA 4ECWA 3TAFA 4IH7A 3TAGA 3NF7A 1C0TB 3U3GA 4ZVGA 2BANA 1KVAA 1UA1A 3N6LA 3BSOA 1REVA 4CF9A 1CZBA 4ICLA 5DQIA 2WHOA 5EWGA 4B9TA 5KFGA 3AVNA 2IC3A 4IFVB 3EPIA 2XY6A 3AVAA 1U49A 1HYSB 1FXXA 5KG3A 3ZT4A 2Y1JA 4M3WA 1D5AA 3K59A 1J5OA 3MXJA 3L3UA 3KD1E 4F2RA 5KFHA 4K4YA 2G8FA 3HVAA 4RW8A 2UVUA 2JC1A 4QAGA 4IH5A 2AGOA 5J2MA 3VQDA 3EYZA 1HYZA 4CJWA 1ASVA 4OPJA 1IH7A 5C42A 2B5JB 1T03A 5J1EB 3PJWA 4HCCA 4HUFA 3NGYA 4RUCA 2VWKA 4Y34A 4K8XA 1XI1A 3M8RA 4QWAA 4I2PB 1QSYA 4ZP7A 3KK1A 3MEGA 1J9AA 4IFYB 2W9BB 4KB1A 2ATLA 5KFEA 3PX4A 5J2QA 1HQEA 1S5JA 4DL7A 1BHLA 3ZSVA 3CIZA 1S9EB 1NHUA 1RNHA 2I5JA 3IG1B 4NLYA 3QZ7A 4F4WA 4CGDA 3S9HA 3DRRA 2JGUA 1JXLA 4Y1DA 4BDZA 2FJXA 4PUOB 4FJ7A 4KKOA 4WZQA 4MKAA 2E9ZA 3HL8A 2D5RA 5HLFB 1WSIA 3PO5A 4KI6A 3LP0B 3C94A 3OYMA 4AILC 4LSNA 2VG7A 2Z1JA 4FLYA 1RT5B 3G6XA 5FDLB 2DY4A 4DQPA 1TKZA 4O55A 3SZ2A 3CFOA 2YNHA 1JX4A 4RG8A 4BE2A 3PW7A 4N47A 2HVIA 1D8YA 2W9CA 4CIFA 1YTUA 5CYMB 3I0SA 1QS4A 3CJ2A 5EU7A 3O4QA 3WNHA 3TI0A 3CJ3A 2RF2A 5KFTA 3F9KA 3NFAA 1WLJA 5KRTA 4OKEA 2BE2B 3OS1A 1LV5A 5EWFA 4KV8B 3OVNA 1ZBUA 3RMDA 4IG0B 4CJVA 2R2TA 4MK9A 1C2PA 4EO8A 1L5UA 3AA5X 1JLGB 2F8EX 3CYMA 3DLKB 1RT2A 3ZT1A 4CHPA 2FLNA 1DLOA 3ALYA 3MFIA 4EBEA 3VN5A 1KRPA 1TL1A 4HKQA 3TWHA 5K14B 1QSSA 4RNNA 2UUTA 1WSHA 3VQ4A 1S49A 4DL3A 1G15A 3EPGA 3L2UA 2WTFA 3E51A 3AVBA 3AVCA 2DPJA 3ZSYA 1VSFA 1HQUA 4K4TA 2IA6A 4BE1A 3V9XA 4EP5A 1BI4B 4MK7A 4Q5VA 2P51A 4CJSA 1S1TA 4H8KA 4FLWA 1VK0A 3BGRA 3H5XA 2HWIA 4GC7A 2YKMA 4JS4A 2OPRA 1N5YB 3TR8A 5SZTA 3UPFA 3M8QA 3QIDA 3WNGA 3NGZA 3K5NA 2XGPA 2FJWA 2X6NA 3VQ5A 4AHRA 1NK5A 4Q44A 4B08A 3F73A 2KTQA 4LQ9A 3AVLA 1IKXB 1JLEB 3Q8QB 1TKTB 4QPXA 3KK2B 3V6DB 3ZSZA 3KKRA 4IDKA 1GX5A 3AO3A 2FLLA 1XWLA 2YNIB 1RT1B 2CJQA 1S1VB 4KHWA 4H54A 3ITHA 2HNZB 3HPHA 3PR4A 4O44B 3ZSOA 1GOBA 4CGHA 1T05A 5KFZA 3HXMA 3FQKA 2OPSA 1J53A 3HKWA 4IOBA 4I9LA 4B9VA 3ASMA 2IGIA 4M3TA 4FK0A 1IKVA 5F9NA 3IS9B 1SL0A 4TY8B 4YR3A 3TAPA 1BQNB 4G1QA 4QW8A 4RW4B 4O3RA 1XR6A 4F4ZA 1T3NA 2D7SA 2JEJA 4CEEA 3QIOA 1IKWB 1SH2A 4HVJA 3P1GA 4OKKA 1S1WB 1HMVB 4RUAA 4B9MA 4DQIA 3LPUA 4ECSA 4HCBA 3H2LA 5F8HA 1S4FA 4CIEA 4JS5A 2C28A 2P1JA 3HP6A 5JUMA 1QHTA 1Z25A 1UOCA 5JS1A 3QYYA 1RTHA 4K4WA 1RYRA 3V6JA 5EWEA 4KB0A 3M8PB 1B9FA 2D0AA 2OZSA 5KG7A 4FLTA 3QIPA 1FKOA 5DGBA 1ZBLA 3PX0A 4YR2A 2F8SA 2PY5A 4LSLA 4URSA 4WYWA 4DSLA 4M3UA 2KW4A 4GVMA 3OL7A 3LP1B 3N6MA 3QETA 1MMLA 4B9SA 3DLEB 2JLEA 2D0BA 2KFNA 2V0NA 4IKFA 4YR0A 4DQQA 1U48A 3DYAA 1SL2A 3MEDB 4I7FB 4CHZA 1X1PA 2NUBA 3L2RA 1NKCA 2FBYA 4DLEA 1YTAA 4B3OA 4Z0UA 4PWDA 1NKBA 1BISA 1RT7B 1HNIB 1HRHA 3DI6A 3LZIA 3V9SA 4WFZA 4DTOA 1T7PA 1C1BA 2D0CA 2HNDB 1CLQA 3E01B 4DF4A 1LW0B 4OGEA 4DTJA 1MU2A 3G6VA 2IMWP 4FJIA 4B9NA 2OH2A 4NLXA 4FZYA 1IKYB 4CEBA 2B4JA 1LWCA 3QO9A 4DQRA 4CK2A 4CJ5A 3M9NB 1JL1A 2Y1IA 3DLHA 4RNFA 2XGQA 3PHEA 4DU3A 3UQSA 3OYLA 3T19A 1ZBIA 4M45A 1CXUA 2ALZA 1HNVB 3UDLA 3V4IA 3LP2A 5KFUA 2IJNA 1N56A 2YV0X 1RT4B 2IJFA 5C24B 3H4DA 3H5YA 1VSDA 2AJQA 2V4QA 2RKIA 2EC0A 4CK3A 2OYQA 5I42A 3QERA 1A5VA 4ZP9A 1FKOB 5DK5A 1RDAA 4ZTJA 2DPIA 4QCLA 2BRKA 4CJLA 4Y1CA 3DRPA 4DQSA 4CF0A 1Q9XA 4O4RA 2G8WA 4IQXA 1KVCA 4FZXC 1QAJA 4IR9A 3LAMA 1S6PB 1NK4A 4O3PA 4MFBA 3PY8A 4Q8FA 1JKHB 4DG1A 4N76A 2IAJA 3VA3A 1KLMB 3TAEA 1RDDA 4CJKA 5KFJA 5KT4A 2GV9A 3RMCA 3MF5A 1QQCA
chains in the Genus database with same CATH superfamily
1IJFB 1JLQB 1Q8KA 1O51A 3GDQA 3HHDA 2DYAA 4HACB 1C0MA 4FJJA 5AZIB 4NLTA 3CC7N 5B0AA 2DXFA 1AUDA 3SXLA 1B92A 3M8SA 3DOLA 2WW4A 2NXJA 1BDGA 4J9MA 4E0DA 4FWSA 1TKDA 4CZGA 1K1QA 4OX6A 2D0OA 1GLFO 3EGVA 4WE1A 2XNQA 2D3ZA 2F8TA 3QMQA 2ZJPQ 2GUPA 3F0NA 2MZJA 5F8NA 3I5CA 3BO2A 3AVJA 1NSKL 3MMBA 1ZBHA 5SUHA 1HKBA 2HS3A 3J7Z5 1EETB 4GMJB 5K20B 2EFOA 1PC5A 4Q0BA 3MECA 4O4GB 1KQSM 3NG8A 2NRZA 3B4MA 3H40A 4FZZA 4XO0A 3THYA 4ZVHA 4CW7B 3D1QA 3L09A 5D0RA 5ITHA 2HHXA 1J5EJ 1C1CA 4NLQA 4BDYA 3DXBA 5HRPA 2MKCA 1ZAXA 5L46A 4GNIA 1NMNA 3HFZB 2PO4A 5HJXA 1DEJA 2Q1LA 3IGVA 2YH1A 1UEKA 1X5TA 4X84A 4F4KA 2QA4S 5C25B 4NEYA 1ZPWX 4Q43A 1TAUA 1F9EB 4Z4FA 1S0OA 3KLEB 4A8KA 1KAYA 2M88A 1GTEA 3NKYA 2VH7A 1FRHA 4ECZA 1N6QA 1WSGA 3BP8A 4BQLA 1NMDA 3CTRA 3KTQA 3CMAN 1T95A 1KC8T 1H2UX 1NGIA 2ZHBA 2LLZA 1JLFA 2BM0A 3O2IA 4BR7A 4JI0J 2HVDA 4NZ6A 4JRPA 4DPXA 4FS2A 1I51B 2EX3A 2CVIA 1L3VA 3TAMA 3IUCA 4LIWA 3VQCA 5CYQA 1TL7B 3VEYA 4FWQA 3FKBA 3CJCA 4KH1B 1N33J 2A42A 3EM1A 3MR2A 4XEIA 4LH5A 4R5PA 4I56A 4Q0BB 4DUYJ 2IRUA 3JYTA 2MKJA 2AEFA 2ZQBA 4CGGA 2KLAA 4XK8C 4HUEA 3TPQA 1LWXA 3U7JA 2EI5A 3P4IA 5EY4A 3CHWA 2IM0A 2XLIA 5KAKA 2A0FB 2OEMA 5ETOA 2E1PA 2DTJA 1IV0A 1RT3B 2E4LA 3K9JA 1FEEA 2CQ0A 4RL1A 5AQJA 3D1OA 1TYQB 1YHQS 4ID1A 2E44A 4CGJA 1JK9B 4FK4A 3RR7A 3DMJA 1AROP 2BANB 3Q83A 5LXYA 1SV5A 3SSQA 2MZ1A 4DB3A 1XHXA 4J9LA 1KS2A 3SMZA 4MTPA 3MEKA 1TUGB 2I0XA 2AF6A 2RRAA 2FLPA 4MAKA 2D3OR 4CGIA 3OL8A 3DRSA 3FNNA 2B8QA 4OYAA 4JI2F 1N0UA 2C3YA 2ZUGA 1RXOB 1VQKN 2Z2YB 3HT0A 4FPBA 4UY8O 2MY8A 3CWJA 1RTJA 1X9JA 2HNYA 3L4IA 3T1HK 5CH7B 1F60B 2MKHA 2PA3A 4X4VA 1VMBA 1T03B 3UCGA 5H9FK 5KFMA 5AJ3K 3E9PA 1HARA 1KFDA 5BREA 3NHGA 1CULA 2VKRA 4LF7K 2JWLA 1O6XA 1UAXA 3MEGB 1A0OB 2E7XA 4YMEA 2R42A 3FE1A 3LDLA 2RMLA 5AXMA 3ENOA 3W3SA 5KT5A 2RILA 2R8JA 3DLBA 1SJ3P 3CD6S 2LA4A 4LF5F 3AQOA 4ED0A 4DHVA 3RB3A 3C0BA 2CIMA 5M2UA 5HO4A 3QESA 2DPNA 1XC9A 1TFYA 1S59A 3VAIA 1X60A 3ZETB 2BJ7A 3VAMA 4FO0A 2HBMA 4E7LA 1GMWA 4LSNB 2VG7B 1HBNB 4FM2A 1KLNA 2AA4A 1QQNA 1RT6A 2JEIA 1TL3A 4QWCA 1HI8A 4U7BA 4HTLA 2W2QP 5CXTA 1TFWA 2QMUB 2ZKTA 5KFPA 1WORA 4F4XA 2EFPA 4DTNA 1U45A 4DR2J 4BC4A 3CCVN 3I56S 3C15A 3UE2A 3O5TB 4A5BA 2GZOA 1B9DA 3ULDA 1VDHA 1EHWA 4B1WB 5THWA 1RAOA 4BBYA 2ZM6J 4JI3K 3CJ0A 4WU3A 2XLJA 3F5TA 1S79A 5FLXO 2C2OB 4DCPB 4RNMA 1RT2B 1HX1A 2WOMA 4G9ZA 1HUXA 3BBBA 1CULB 3ELHA 4UZBA 3GIMA 3A8KA 3AY0A 1KDNA 2D9PA 3HOSA 1B3TA 5KFDA 1TKXA 4OO1J 4PXCA 4PHTX 2VG6A 3AVGA 2FDNA 1WOPA 2RU3A 5CR4A 2D74B 2OTJS 3TZYA 4MIWA 4ECTA 3DWLA 3TEGA 3NL0A 2HGNA 2VODA 4CRJA 1YRTA 2FC0A 2HMIA 2Z57B 3W2WA 3HSTB 1TV6A 2H54B 2XMWA 5A76A 4X4OA 3PEJA 2B56A 5KGXA 5GMKa 5HRNA 1F5BA 2BV3A 4DV5J 3HPGA 3IM9A 3JSYA 1RHKB 3C2PA 4IDKB 2HFVA 3NMAA 4DV0K 2VQFK 3LDSA 1FDNA 1BQMA 1QUVA 2ASJA 4FWPA 4QYRA 4P52A 2LXUA 3HPOA 5L1LA 3SDEA 3THXB 3UR0A 2G8VA 1DTQA 3CDAA 1PBUA 4TLRA 4V19J 1T05B 5FPMA 4LMZA 2DGXA 4UZCA 5AQOA 2AX0A 3UN5A 3HHLB 2V4RA 3FJ2A 4V19X 3AVMA 5GVQA 3BH7B 2R7XA 3M4XA 1YDLA 3GCWP 2L9WA 2L9DA 3BDPA 1GT8A 4KHNA 1X4BA 4WU2A 1OPZA 1HWLA 2BOPA 2IA0A 2KXHA 1M1KO 2VWJA 3I4PA 3QLHA 4I67A 2AEJA 3HK2A 1EQYA 4BRCA 4FP9A 1R0CB 5KFQA 3AO1A 1NAQA 4HTIA 3KG0A 4YDUA 4P71A 1CQMA 3TX8A 3MEEA 2CDRB 2FBTA 3TSQA 1VQ4N 2UVWA 4IBNA 3KHHA 4DV6F 2OGUA 3D3BJ 3MCPA 2V67A 3F41A 4CJ3A 1X9SA 4EMDA 1ZZNA 3FMWA 4F7VA 3L2QA 2QLBB 5A8WA 2NCKL 2E5IA 3CCLN 4KO0A 4LSLB 1Z26A 1NGDA 3RBEA 5EX5A 1NM2A 2PDAA 3DXMB 3LGNA 8AT1B 2P2CB 4E3SA 1FJEB 2GWKA 2G4BA 1JXBA 1NLVA 2DHXA 2F3JA 4IO9Q 5JS2A 3US5A 5ETSA 2XY8A 5IWAJ 4WCEQ 4RX6A 3CPWM 4O5BA 5LMNF 2ASYA 3SMPA 4B3OB 2P5OA 3SQ0A 2QL7B 2CRLA 3OS0A 4ECVA 3QNOA 1C1BB 1YKWA 4RZRA 2MQLA 1XEZA 1K6YA 1LAWA 5MAOA 2DJWA 3QRPA 3OFFA 3J7A1 1LWCB 4DPUA 4OI3A 5LSOA 1C0TA 1M1HA 3C14A 1MLAA 3CXCM 3CJ4A 3NNHA 3ISND 3EJMA 3LP2B 3TQ1A 3BF3A 3BY5A 3M2VA 3H45C 5HOOA 2N7YA 4JI1J 1MWMA 1IBLF 2PZSA 2W01A 3S3NA 4DTUA 3W5XA 3ZX3A 1PJ7A 3AJ2A 3IDHA 4M63C 4MIBA 3KLVA 1VGYA 4KRFA 1H7XA 3ZTPA 3EWGA 3DRPB 1EAYC 3OYKA 1JNRB 3FSXA 4MFBB 1FO1A 2CJ9A 4YS2A 3L0QA 3ZZYA 3RAQA 4ECRA 3LDOA 1VRUB 3O8MA 1JJ2R 2V9WA 2HURA 4J2EA 3V81B 4Z4HA 4GC6A 2FHJA 5D8HB 4J9RA 4PQUB 4DV7J 1KN6A 2RHSB 2R8KA 4CJEA 3HULA 3GONA 4WTOB 2G0JA 1AUSL 1SJQA 4GO7X 1PJ5A 5D77A 1S9EA 3O3LA 4JI2K 5AZJA 5LJWA 3HBTA 5B09A 4ZPBA 1QVFM 4O0JA 5C12A 3OYJA 4DV4F 4PUOA 1NEEA 4BVPA 1RHJB 5HLFA 4H4OB 4DL2A 4A8YA 2C3OA 4JI8J 2IDEA 2J0WA 1VOMA 4FYWB 1RTIB 2VZ9A 2ZDPA 1KTVA 1BY9A 1DQ8A 2O8EA 4DR3F 3OQ2A 4I2QB 4O8UA 1RHQB 1S76D 1TZ0A 2E9RX 1T94A 2B8PA 3IA0A 4O5FA 2PYJA 3DU6A 3CNQP 2DHHA 4FN5A 4QBUA 4EGLA 4K8RA 2ATCB 3Q8UA 2BE2A 4FYVB 4TYAA 5HJYA 1XHZA 2W40A 1Z2LA 4LF5K 4KV8A 4EBDA 1JCEA 1YQHA 4OYWA 3VGSA 5AQKA 3QWPA 3KWIA 2HHQA 1EZZB 5JMVA 4NLWA 3O9RA 2MLZA 2LSNA 4C8ZA 2Q3SA 3KHRA 2DGTA 2B7BB 4WZMA 2BXJA 4DR7F 3CERA 3VA0A 4KH4A 2V34A 4DFJA 2H3EB 2A6MA 2JRSA 4CH1A 2RRNA 1NJIO 3BZQA 4DSEA 3D9BA 2MGZA 1NNDA 1FCAA 4ANDA 1YJ9S 4N77A 4YFUA 3MMJA 3IFEA 3JAMY 5H1SV 2FB0A 3HHNB 3MCSA 1BCMA 1Y00A 1TUUA 1UJ4A 1N5YA 1O1WA 3RYLA 4H0YB 3I5BA 4QWDA 5K5MA 1VSKA 4QU6A 4F8RA 9ATCB 2FJDB 3MDFA 4OZNA 1T6CA 3ZZTA 2D41A 3H7HB 4DR5J 1TK8A 1X0PA 2M52A 3SI6A 3FZHA 2HNZA 1KXPA 1X4CA 3PR5B 5KPZA 5KFWA 4O44A 4PXEA 1NSAA 5J2PB 2HKEA 2UUAJ 4HT7A 1QLNA 1NK7A 3AA2A 3IS9A 1ROFA 1DKGD 4WFBL 2DHSA 3GU0A 4OGCA 3OUYA 4K0KK 1AW0A 4HVZA 1MG7A 4K5RA 2G2YA 3GFZA 4FF2A 4M3XA 1UZHA 3K58A 4GKKJ 4G1IA 3VALA 4CFCA 2PE8A 1J27A 5IS2A 3RRHA 1U0HA 3OVSA 4DUZJ 3CC2N 2CZ4A 1VQ7S 5KT6A 4GV9A 2XZDB 3A1YG 2KG1A 3CEDA 5A2QO 3M7VA 2CUYA 4RUBA 4NXNJ 3AVHA 1XUPO 3R7NB 2NREA 2WVBA 3H1VX 3M8PA 1XQIA 4NLCA 2HF3A 4NYNA 4R0EA 2Q6CA 3VETA 3A8YA 2HFOA 1WG5A 2FHMA 2YKQA 4FF1A 1S1UB 1I5OB 1TAQA 3GYNA 3LP1A 5CHIA 4OMFG 3OHBA 3M6VA 1WNEA 5F8GA 1X4AA 2YX6A 2UU9J 2BGGA 2GC8A 2K3KA 3B78A 5B0EA 4ILRA 3MEDA 3CCEN 4EU0A 4CERA 2QSFA 5FRNA 1QHAA 2O5DA 4CQ1A 2R2SA 5BRFA 3D2FB 4DV6K 3EXCX 3KLFB 4AHSA 4WTYA 1M1GA 2VG5B 1U0SA 4OV6A 3CD7A 3G8SA 3H42A 1YG0A 3LWMA 3SEOA 4EHUA 3O4WA 3ZCMA 2A41A 5B0CA 4OPKA 2D3O1 3T1YK 3FEXB 4FJHA 1FTCA 4ED1A 4FJNA 2EWSA 5D0HA 1M90T 1S6UA 2O67A 3QZ8A 2AYBA 4EZ9A 3I87A 1PAUB 4ZCKA 2V50A 4ED7A 4XPCA 2GELA 4BE0A 5LMNK 2QEXN 1YJVA 3ILIA 2WBMA 4LF6J 3HD2A 4I9QA 3T5HA 3OYEA 4IRKA 3IP0A 5GAHP 2GTDA 1S6PA 2ILYA 4NLVA 1JKHA 3PRVA 5AQUA 4BWJA 1ZTWA 4WFYA 4WFNL 7AT1B 1HNZF 1IWGA 2IIRA 2P9NA 2ZVSA 2EK6A 3MR5A 3VQ9A 3THVA 2QA4G 2QWPA 4ECXA 2WK4A 4YN3B 4U9RA 2GNKA 3ZEUB 1IBLK 2P9PA 3A13A 4IG3A 5DQGA 4FK2A 5FD1A 5C5JA 4OLOA 1SC6A 4KFBA 5AXNA 2RAQA 3HLUA 4PQAA 3NH1A 4BRAA 3EVOA 1S1XB 1UKUA 4F0HA 3DLGB 4LQ3A 2CKWA 2O8BA 2MLXA 3KMSA 1LKZA 1OQ6A 4DDFA 4LF1A 4DPTA 3C66A 4GV3A 2DO4A 5DM6Q 5KG2A 1YWXA 1HNXF 3N5BA 3X3UA 2RDIA 4FXVA 3ZT0A 4E1MA 2EFGA 4P2SA 1YIJN 3C6UA 4H5TA 1I94J 1LW2A 5AE1A 1VSMA 5T41A 2Q36A 2J7UA 4U95A 4FCYA 1FJGF 3H1QA 5DG9A 2F96A 3G10A 3NWRA 3R9LA 1AFJA 2IY5B 3OL9A 4DX6A 2F9JA 3KJVA 1F5CA 1C0UA 3DOKB 4W5OA 3W9IA 4ID5A 3AH6A 1XTZA 3ZLJA 3VEXA 3HJFA 2B43A 2YWFA 4MYUA 4YB7A 2P9KB 4ZOSA 5GIOA 2PD1A 3QSIA 1APSA 2QIFA 1HBOB 2G8IA 2W1BA 5LJVA 3SCXA 4LR9A 3IFRA 1RWOB 2CFXA 5B0GA 4USWA 5IT4A 1SKRA 2L08A 3RB4A 2IM3A 4FZVA 4BRDA 2Y0BB 2BJDA 4CEDA 4HT5A 3D45A 4AQYK 4ERDA 3MOJB 2OPPB 2QG9B 4X4TA 3VQBA 3WIUA 4YHHF 4B3TF 5F8JA 3V9UA 4AFFA 3HFKA 1LXNA 1JLCA 5KTQA 1H2TZ 5EUHA 4ANEA 1H72C 2SXLA 4NA1A 4OLBA 2J9CA 3Q7BA 2YH0A 2W7PA 4RNHA 3FZKA 4ED6A 2EHGA 4A61A 3UCZP 2I8EA 3M6XA 3HHLC 3LWLA 3W1YC 5HL7Q 3FCHA 5D3GA 1QE1B 3PIOL 4RW9B 2F65A 2QTWA 1KFSA 4KPCA 1C0UB 2YHWA 1RYSA 2UV8G 4CO3A 2D69A 4ID5B 3AT1B 3VQ7A 4FWNA 1UWBB 3PRDA 1IQZA 3MM8A 4LRCA 3KJFB 1RGIA 4YOUA 3MOZA 3BQ0A 2QZ8A 2BH1A 4IOCL 5A6PA 4C8KA 3G6YA 3CULA 5KPRA 2XG8A 2C3MA 1KD1T 2DHGA 3TAFA 1R8HA 3TAGA 1LOTB 2ALYB 1N32F 1IBKF 4A8SA 3BSOA 1REVA 2GO8A 1P9QC 2HLTA 3UN2A 1B99A 2QA2A 2VV5A 1HLUA 4B9TA 2QW9A 3AVNA 1ZM9A 4IFVB 3EPIA 3ULEB 3AVAA 1RQ0A 2DIVA 3JB9k 4F04B 5CABA 3SCKE 1J5OA 1F0XA 3A0IX 4KHPF 3MXJA 3L3UA 4K2XA 3MMCA 2BUPA 2VBZA 4NO7A 1H7WA 2YPZA 5DZ7A 3CF5Q 2JC1A 2BBEA 3JS9A 5J2MA 3G8TA 4L6V3 1HYZA 4CJWA 3T1HJ 2LKZA 4OPJA 3LM2A 3QAUA 4ZPWR 1NLKL 3G82A 5AJ3J 4HCCA 4HDGA 3SQOP 1WACA 5ETQA 4LF7J 2ROGA 3QJPA 4QWAA 2XSJA 4ZP7A 3DAWA 3KK1A 4EUVA 1R8PA 4IFYB 3PX4A 2PT0A 1S5JA 4YDUC 3MPYA 5JVGQ 3PIPQ 1MMDA 2LEAA 1PKUA 3CMQA 1QAYA 1RNHA 4OZ1A 4IEIA 3IG1B 1KOOA 4CGDA 3DRRA 4YOVA 2U1AA 2BW7A 3VEOA 3IR6B 3HL8A 2HHHF 1WSIA 3LP0B 4AILC 2KYZA 2NLWA 4QYZJ 4B3SJ 2XS2A 4IQMA 2DY4A 1Q8BA 3J81j 2AZ1A 1JX4A 2HVIA 2W9CA 3O8WA 1YTUA 2RVJA 3CETA 1YJWS 3O4QA 3TI0A 1S6OA 2X3GA 2CPDA 5KFTA 3F9KA 4C0HA 1H73A 1S77D 3QBXA 2UV8A 4BRPA 4IG0B 3TTFA 3UNYA 5GMDA 3DLLL 4CO2A 3DDNA 2B4PA 3AA5X 1HI1A 2F8EX 3DLKB 1K9MO 4CI6A 3ZT1A 3MAAB 1U1NA 5JJBA 2UUCF 2BKPA 2HQGA 2OTLS 1EX8A 1X5PA 2I7NA 5MLCV 2MKYA 3EPGA 2E1CA 3E51A 3AVCA 2V2ZA 4C8YA 2DPJA 4K4TA 4KGZB 3QB0A 3QT5A 2XS7A 2OUGA 4ZVOB 2ZBRA 2DR6A 4H8KA 3D0IE 1VK0A 2NRWA 4JS4A 1CJUA 3TR8A 3TO8A 4AXJA 3GWCA 5BR8K 1S7IA 3N01A 1LQ9A 2EBEA 3VQ5A 1JMTA 3G71N 1SIZA 3AD8C 3AVLA 2WZ1A 4P6QA 3Q8QB 1TKTB 3KK2B 3ZSZA 4JEPA 2CQCA 3EVMA 3H8YA 3AO3A 2QN6B 3VF0B 3GBTA 3O6QA 3AOBA 2HQCA 1IM6A 4B3MF 1QVGM 2ZITA 3K7RA 2C42A 1SQFA 1QQOA 5JLFA 3WC0A 1OH6A 3HPHA 3ZSOA 4UTGA 1VJWA 3IC1A 1E6YA 4DV2K 5KFZA 5ETTA 3FQKA 3MD3A 1H1VA 3FZFA 4IOBA 2IGIA 3ID6A 1IKVA 1SL0A 5K8OA 1H98A 4I6MB 3EGZA 1Q95G 3T69A 1BQNB 4O3RA 1CJVB 4ZJOA 4WF9L 2M8HA 2CGLA 3QIOA 3B82A 3EKSA 1SH2A 3P1GA 1S1WB 2N3LA 3ENAA 4B9MA 4ENOA 3POTA 3W63A 5F8HA 3VWSA 2A18A 3A5LC 4CIEA 4JS5A 3HP6A 2C28A 5JUMA 3TVZA 2OIHA 2G2OA 2NPFA 1RTHA 3CJQA 5EWEA 1B9FA 1FFWB 4F0KA 5KG7A 4FLTA 3RRKA 4IJAA 4YY3F 4I0WA 1HHTP 3ZYYX 2QLJB 2PY5A 4URSA 3D68A 1K8KB 2Y3YA 2KKZA 4CLWA 4JHDB 2C2NA 3E9LA 5MLCQ 2G1HA 4J8FA 3ZXWA 2NYHA 1KR4A 3UKUB 4HWIA 2VGNA 5IXUA 4HI1A 2D0BA 2KFNA 3UWTA 4IKFA 4DQQA 2FF6A 1FXRA 1HBMB 4I7FB 4OHZA 3VGVA 4UQTA 2NUBA 1HL6A 3L2RA 5BN9A 2MQMA 1E4GT 2KU7A 3CCZA 2DISA 3BO4A 4IO8A 1RHRB 3J81U 2UUBK 1YGYA 2WC9A 4DTOA 2HNDB 3NCRA 3H3NO 4YHHK 3G6ES 1LW0B 1RBAA 4OGEA 4B3TK 1MU2A 3WDOA 2XMMA 4Z37A 2IPOB 4BCAA 3THTA 1KAZA 4DQRA 4CK2A 2FTRA 2XGQA 3OYLA 3AGKA 1FRKA 3D1HA 1CXUA 4BR0A 3UDLA 1RWNB 2UXCF 2IJNA 2YV0X 3M2RB 1H2VZ 2UYTA 2DRAA 3PRBA 2YHYA 4M7XA 2V4QA 3VAGA 2DGWA 4PWWA 1WC0A 3VF4A 3MMAB 1RDAA 4QCLA 2LFVA 4Y1CA 1VQ5S 2RQKA 1KVCA 3DDIA 1R8AA 3LAMA 3OBWA 2XMUA 4N76A 4LF8F 3VA3A 1KLMB 2GJIA 3VAHA 5KT4A 3TQEA 3CB4A 4JKBA 2KRBA 1BOTO 3GE1A 3P38A 1HW8A 4CFDA 2IHR1 3RMAA 5U47A 1SZ2A 1VIXA 4WQ4A 1IBKK 5GAGP 5ETRA 3I9V9 1VQLS 1KNZA 1IUJA 2W8LA 2A6AA 1EP4B 1UJ6A 1X5OA 1NH7A 2Q66A 4OJGA 4K4XA 3MTKA 1WDTA 1U6BA 4GVBB 1SI9A 3DGPA 1IBMK 2YNFA 3V9ZA 2YKNA 3SBGA 1L3UA 2DGQA 3EE3A 4KE5A 4JI7F 2YWGA 1G2EA 3QPIA 3AVKA 4KHPK 2Q97A 4Q2LA 2J6UA 4M7YA 5LMUF 1W0HA 3LDQA 4E7JA 4KGKA 5E33A 4HTUA 1BE4A 1GMVA 4DHYA 4DF8A 2O8DB 5E41A 1N8RO 1FKPA 2ASLA 2GHVC 3TANA 3N4QA 2MZRA 4LY7A 1VQMN 4MDAA 3G9CA 1FD8A 1RBLA 4OJRA 4H4MB 4A8MP 3CM6A 2WFBA 4L8RB 5M2RA 5GAHU 4ZLJA 4HH1A 1RBUA 5DM7Q 2CXEA 4P10A 3CJ8A 1HKGA 3MXIA 4GKJK 5AQYA 4Y2AA 2G13A 2MEWA 4J9QA 3L4QA 2C2MB 2HHPA 1WSJA 2XYGB 3AODA 3QSYB 2CQ1A 2YNGB 4OV1A 4DS5A 3RB6A 1CS4B 3SUNA 4H5NA 1NK6A 4C23A 2PMZD 4KHSA 3D2WA 1GLJO 1HA1A 3W5ZA 2V7ZA 5RUBA 4UQGA 3NOGA 2GHPA 3CE8A 3OR1B 1Q7LB 1C4CA 5AR0A 3UE5A 3TRGA 3D0HE 2XZTB 3Q86A 5CZVA 5KT7A 1E4FT 1W25A 3RTVA 1U8WA 4I6AA 1WC4A 3J7YI 2AX1A 2ZE2A 2I1RA 4IUFA 5T7LA 4PYDA 1K73O 2YX4A 4A62A 3PKMA 1WTBA 4AT1B 1S3XA 3SQ2A 2H1YA 2RJZA 1H6KX 4MO4A 3K2PA 3NS6A 6AT1B 1NGEA 1Y97A 2UUCK 2ZH8A 3BBFA 1B70B 3KLIA 3ET6B 2HZAA 3I0RA 2WW8A 3BEXA 3ZZZA 4BRKA 3O9QA 1OSCA 2R7YA 1T3VA 2ZH4A 1JXEA 2BYCA 3IRXA 3W7BA 1F1BB 2FBVA 3HKZD 4K0KJ 3NEKA 1F9HA 1JCGA 1Z4UA 4YOTA 3KYLA 2LEBA 2P9IA 3KKSA 4C11A 1DGKN 3KG1A 2IC3B 1T9WA 3L2WA 5DDPC 1YVFA 1FX4A 4K4SA 2HFZA 3K89A 2MJNA 1PYTA 2MDAA 2XYPB 5HP1A 3BZCA 2P5GA 3FBBA 2FJVA 1X5SA 1J54A 1YVUA 1JB0C 3VGTA 1KVJA 3MM7A 3IKMA 3KLGA 4ZTFA 1VSJA 1ZA1B 3SQ1A 2V68A 4B3RF 2ADCA 3UDCA 2DNLA 2ZBCA 2P9LB 2H48B 2QGFB 1UFKA 4TN2A 1Y0HA 3K2YA 5C10A 3W65A 4FWKA 2H5EA 1SKSA 1GK8A 4CT8A 2FBXA 1J2VA 5J2QB 1HQEB 4UOHA 4MYTA 2VHGA 1SBRA 1UEVA 4JK7A 3PKYA 2AZ3A 5DQHA 5KI6A 1JCFA 2I5JB 5ADXH 4RR5A 4J9PA 2XSFA 3OTDA 5F41A 2YX1A 2X3DA 2QKKA 3D66A 2DR9A 3BQ2A 4KKOB 5E3CA 2MKKA 3O3GA 3SUQA 4FSVA 1VSIA 2I2YA 3R7SB 3GYXB 1S0VA 3M6GA 1VSLA 1MN9A 4CEZA 4C11B 1QZ5A 1U2VB 3MXMA 5GADP 3L8BA 2ZJQQ 3SUOA 2Q31A 4KB7A 1ZTTA 1TKZB 2BJ9A 5TKWA 2YJEA 4BR2A 3T1YJ 4JN4A 4EHTA 4KGXB 1RZMA 1RAJA 4DUTA 2W7OA 4YOXA 5L39A 3W9JA 4X65K 2P9EA 2Y0SD 4DSIA 3GIKA 2V52B 1N36K 4A8XA 3IWXA 1Q9YA 2RF2B 5IT0A 3CI5A 2YX7A 4AL5A 3AAQA 3I4HX 1FD2A 4USHA 4DL0C 4E98A 4W5QA 3CMES 4MO5A 4U96A 5I3QA 2LQBA 3P3DA 1WN7A 3TNVA 1CJTA 2WB4A 3OSPA 1NWKA 4KRWA 2CADA 4ER8A 1FF2A 3G4SS 1CBKA 2HQFA 2NR0A 1OJ4A 1WKJA 4PG6A 2YKPA 1G3OA 1ULRA 2V8HA 1VQPN 3L3CA 4GW6A 4FLVA 2A2CA 2UXCK 4M3ZA 1K0VA 2KXNB 4ZJLA 3TJ8A 4FBUA 3C19A 4CO4A 3HT3A 3O1BA 4XH1A 2DD8S 2YTCA 3UCUP 4WQ5A 3GCXP 1XMBA 1UL3A 1YJNN 2P9SA 1QUPA 3D7EO 3CCMN 1S1TB 3L3VA 4Y2MA 3BGRB 1T11A 5HBMA 3I55S 1N52B 2YKAA 2J0XA 4ELVA 2NNWA 3T5JA 2LXFA 3BKTA 4ZPCA 3MM6B 4LC9B 3CJTA 3WEEA 2R2RA 4DU7A 1HYVA 5EOYA 2V8VA 2MQQA 2B9YA 4HUGA 3VEWA 1SC3B 2DNQA 2E2NA 2HYIB 1HD0A 3BYPA 3C46A 5EGYA 1XMOJ 4IWVA 4KTWA 2HRUA 3S01A 4FYYB 3MXHP 1A5WA 3L7UA 2OPSB 1UJ5A 4RBUA 3H98A 3ILLA 3OTEA 3S3OA 2R2UA 2RE1A 1Y9OA 2ZH1A 4LRDA 1YT3A 2VC1A 4NCGA 1HWUA 2LDYA 2H3GX 3OXLA 1BIZA 5LMUK 3NGIA 2AKWB 3SAFA 1RUSA 2PEBA 2XHBA 2BOAA 2RB7A 4JI6J 5J1PA 3X1LB 3OR2B 3I8DA 4LFCF 1VQSA 5DG7A 4CJTA 4AQYJ 1D9FA 4ZJQA 1FVQA 3WNEA 2O01C 1NZAA 2O8CA 1OY8A 2RU9A 4JKGB 3VAKA 1YAGA 2GVDA 4P7VA 4KAZA 2UXDK 1RABB 4OVLA 3CD0A 4I64A 4JV2A 1WBDA 5E3PA 5J2NA 1ESVA 3K8VA 1DJ0A 4OL8A 4USTA 3KUEA 1S9GA 5C0YA 2E5LF 1RCOB 4OHVA 1X4GA 3OA9A 1XMQJ 1HR0J 4LFAF 2YWHA 5E7OB 4RNOA 4DV3F 1ZXOA 3D67A 4HL9A 1F9FA 1MMNA 1YJRA 2CG4A 3HHLD 3I9ZA 4FW2A 4UOGA 4CP5A 4JI4F 2CGKA 1DTTA 3DN9A 4DV1F 3JS6A 2AHOB 1R27B 4LJMA 2AJ0A 2B4VA 4ZVUB 4TU8A 3L7OA 1KKHA 3HSDA 4DZ6A 2GFFA 2NSCA 5K8MA 2X7IA 4FJ5A 5B08A 3DI6B 1S99A 4TY9A 3GLJA 4OX9K 4DR6K 3PFOA 1K44A 4QW9A 4V19S 3AQPA 4DWIA 3TZWA 3Q23A 1VQOS 1FEHA 1WF1A 4QR0A 2XHWA 1Y5IB 2FVRA 2QK9A 3ILOA 1NGHA 4F3QA 1GXTA 3V4IB 1URNA 1RBTA 2QYGA 3GJTB 3CCRS 3CGIA 1Z6RA 4ZPAA 4CYUB 4NA3A 2KRRA 1HYSA 1ZBFA 2HW3A 4CTAB 3LALA 5KOWA 2LMIA 2R7SA 4HHUA 1KCFA 2XLKA 1AZSA 5E3QA 3M32A 4NZ7A 5L8RC 3SUPA 3HI9A 1NBEB 3GB0A 1XN9A 3SJHA 5G0RB 3U27A 4HR2A 2DH9A 1HBUB 3G86A 1SL1A 2IAJB 3GV7B 2P9UB 3ENBA 4I1TA 3J80U 3EY1A 2IM1A 4BLGA 5BYQA 2B5JA 2PA8D 1RA7A 2FYXA 5K9FA 4JK8A 4BVOA 3MK6A 4ILHA 2HIQA 2ASOA 4I2PA 1PSDA 2BACA 3LGHA 1VQ9S 2W9BA 4EI2A 2G8HA 4UUXA 2NXUA 3GYGA 1V3RA 2A10A 4G3IA 1GXLA 1MWYA 2HEKA 1Y64A 4BRLA 3ISNC 1VBZA 3Q0AA 1D9AA 4JYAF 5AFUA 3KK3B 2HVZA 3EUNA 3U6FA 4U7UK 4DR4F 4EYIB 3JSBA 2PMWA 4Q8EA 1IR0A 4JLHA 2ZWHA 3KLHB 3MURP 2HAFA 1RB0A 4F3MA 1RT5A 1I39A 4FNHA 1VYAA 2YCHA 3K57A 3D6FB 4CZMA 3B8AX 4CHYA 1IXKA 5CYMA 4BY9C 2KZZA 3OYIA 3PHTA 4AH9A 3P6YC 1B0PA 1D3WA 2X51A 3GIIA 1K8AO 2JJ4D 5HROB 3P4UB 4FPRA 2GMHA 3QFWA 4DR1F 1DT9A 1U04A 3K5LA 4PXDA 2G9OA 4DPWA 1LWFB 3DM2B 1S48A 4LF4J 4K41A 4O0NA 4O3OA 2P8IA 4CF1A 3Q89A 5DLGA 3GL1A 5GAGU 4ZKAA 1L3TA 4OHWA 3Q8PB 2KT3A 1UVLA 3NS7B 2E20A 4IDHA 3P8BB 1YRUA 3SV3A 4UOFA 5B0FA 2FVPA 4DL4A 5K14A 1LWEB 1SUQB 2KT5A 1YXQA 1F21A 2HHSA 1YZ7A 1KHWA 3QT7A 3P31A 5AQQA 2F4VK 1PAEX 1HI0P 1VK3A 2GEMA 4TYBA 2R8IA 3PYEA 1ZAVA 2CWXA 3MM9A 5BR8J 5HMZA 3VQPA 3CC4N 4PL7A 2PAVA 3C65A 1Y11A 2IYIA 1VQ8S 3JSMB 3T3FA 1IKXA 4DFMA 1W7WA 2O8FA 3V6DA 2DGOA 2W4PA 4CJUA 2ZZTA 5ETPA 1ZA2B 3BGLA 2RS8A 2MSSA 1S1VA 5L1KA 4KH5A 3HZEA 1RWWB 1RK8A 4WQ4C 4DV2J 4NI2A 1R0AB 3GSIA 2ZJPL 2YWKA 4CJFA 2BR0A 2J8AA 4JD2B 4NCBA 3T6BA 1J5EF 4JBCA 5CQGA 3RBXA 1H3DA 3BO3A 1RWMB 4BC5A 4TY8A 2CPYA 1SKUB 2QI2A 4CLZA 4RW4A 3UVJA 3BQ1A 3WZ0A 3W62A 4E7KA 4KQZA 1HKCA 2ZH5A 1TU0B 5AQVA 2A1SA 1FRLA 3J7AP 3FSIA 2KO1A 1HMVA 3RSEA 2OPQB 3EO3A 3J7AN 5B0DA 2Q6BA 3NBPB 3D2EB 1YZ6A 3NP5A 1KWMA 1FK9B 1OH7A 4OZ0A 3KJQB 3EE9A 2M70A 4K5SA 4OX8A 1WELA 1YITN 3K8WA 4U67Q 5D78A 1OO0B 2HQ3A 4JI0F 2ATQA 2E1ZA 3TUJC 4FYDA 4XTTA 1ZPVA 2BJ8A 1O8BA 1CJKA 3UD3P 3QICA 4Q45A 5AFUH 2X1BA 2DY1A 1XNRJ 2WBRA 1EXQA 4RW7B 1GOCA 2F7TA 1RTDB 1N33F 2FJAB 3AARA 1HW9A 3A4TA 3PDNA 4DUYF 3PM9A 1HFEL 2MHEA 3HZGA 2V9KA 4FW1A 3AA8A 3WUHA 1NU0A 1CZAN 3UKRB 4KHRA 1YK9A 1F6TA 2QFIA 3W3DA 3RG6A 2KYXA 2UUBJ 4E19A 1RT7A 1NB7A 1S6QA 4CZIA 3NF8A 3E01A 2VQEJ 2X6SA 5C2DA 1IKYA 1UA0A 2V8PA 3Q2TC 1BWEA 1YJUA 1YI2N 5FPEA 4CCHA 3NCQA 3PJXA 2IVYA 3R8EA 2K2PA 2E5LK 2HAIA 4UUWA 4Z4IA 1EO1A 4LFAK 3C7NA 2G2ZA 1WJ9A 4DV3K 4JKHA 4IOCQ 5C24A 4PEOA 4DPOA 2B6AB 4H4KA 4YDXA 4A47A 3M2UA 4NA2A 4OYZA 2AT1B 1IVZA 3R2DJ 4DS4A 3OXGA 1NJXA 4JI4K 4C0BA 1TVRB 3CJBA 5E26A 3QEIA 3SI8A 2CJKA 4PXBA 3O3HA 1H74A 2PBDA 2P6TA 3BEGB 2ASPA 1CEZA 4CZHA 1OKJA 2UUWA 4QOTA 3EKUA 4EK2A 2QKBA 2AGPA 1Q7YT 4CDIA 3IMXA 3CDWA 3W66A 4C1NK 3IM8A 3R8YA 1B64A 1KAXA 4FYXB 3BREA 2ERRA 3AD9C 4ILMA 4H03B 1JLQA 3ADAC 5LJ5Y 2VD3A 2AEMA 1RFQA 2HK2A 3PJ9A 1HHSA 2B9WA 3OTCA 4HACA 1U47A 1HKAA 1S6QB 4FL9A 5AZIA 4HHJA 5E5NA 1LK5A 4X62J 3WQPA 2PSZA 3TABA 4ZLPA 2FLOA 1IBMJ 2KL8A 3PO4A 1RDRA 3KMQA 4CD3A 3A12A 4LSZB 2HB5A 2ITGA 4FJKA 5KPTA 3O44A 4WJBA 5GADU 2IDLA 1KC8O 4KSEB 4CBWA 4K4VA 3P5JA 3NWGA 4P7TA 2IIHA 4PY5A 1T9UA 4USJC 4Z7CA 2XY5A 2KVQE 4DU4A 1K47A 4XH4A 1Q8IA 1EETA 3O80A 4B02A 2GUIA 3NF9A 1JLAB 2ZKUA 4PPZA 3HSCA 2WONB 4O4GA 3K9KA 2KM8B 3TZXA 4CO5A 4W4MA 4DR2F 4IO1A 4ZIVA 3Q8VA 3AO4A 4QOZB 4GKJJ 3J81O 4OZLA 3CCJS 4BRNA 1VQNS 2ZM6F 1Q86O 2KFZA 1NRKA 4ELUA 1XQSC 3NVKA 5I3UB 2U2FA 3OVAA 3H4BA 5C25A 3QEXA 3SIPB 3KLEA 3B54A 2VBXA 2QE5A 2MY7A 1AFIA 4QU7A 4O3SA 2EW9A 5LM7E 3T1AA 3RR8A 2R7VA 4CESA 3CCSN 4RBTA 5IOLA 2R8HA 4P72A 4OPAA 2ROPA 3LGMA 1BU6O 3H08A 1U1LA 5IM0B 3CJKB 4M94A 1G1XA 2JZ5A 1HPZB 3I6PA 2ZBQA 3BSNA 2RUSA 1FNXH 4DR1K 5FPNA 2KB2A 1BLUA 2Z2LA 2LQ8A 2O4GA 2MSTA 4RW6B 1TL7A 3BYRA 2DBBA 1VQ9N 2AJFE 3D5MA 1N34J 5CD4A 4DV5F 3M3ZA 3F9MA 4QWEA 4B9QA 3A2FA 2DT9A 2VFVA 2QO3A 1RADB 3R5JB 2DNKA 4Y2KA 1IJEB 1VSEA 1U1MA 1S12A 1WHYA 4CIOA 3TARA 2BZ2A 3WBZA 3KHGA 4FM1A 1U26A 2M5YA 5IC4B 2NZTA 2G8KA 1S0MA 3VVTA 4ED2A 1VLYA 3CO0P 3JTNA 5AQZA 4M95A 1RT3A 1W97L 2FSNA 1GOAA 3TJAA 1V5VA 4NLRA 4WQ5C 2W2MP 1GX6A 5DLFA 1TYQA 2RDDA 3KXDA 2DNYA 4ZVGA 4QIEA 3ZTRA 2BANA 5BYRA 2DCLA 1EQ0A 5L38A 3ATUA 4FWLA 2WHOA 3MUMP 2IYGA 3JAMU 3CSKA 5KG3A 2WBNA 3H2UB 3ZT4A 3SQGB 4M3WA 3M30B 1F3VA 1ICEB 2VONA 4JV5K 4YORA 1ZAWA 5KFHA 2J9EA 4BR5A 1UCNA 3TU5A 1J5EK 4QAGA 1L3KA 4XDDA 3J80Y 4WKYA 5LOQA 2IJRA 2E1RA 5D15A 1T03A 1BMQB 4PCQA 5J1EB 3PJWA 1NBWA 1RBOB 2K06A 3E2EA 2V51B 1QSYA 1VS3A 1P90A 3MEGA 1J9AA 2CGJA 1RKIA 3ZNUA 2ATLA 3OTOJ 4X66J 5IWAF 4BC2A 4DL7A 1BUPA 3I31A 4CZCA 2CQ2A 2DNOA 3NCPA 4NLYA 2JGUA 2W4DA 3QQCD 2GHWA 3FK4A 4JKDA 1RI7A 3R97A 3OXFA 2ZDOA 1N8RT 4JI0K 2HRYA 5IT9Y 4IO9L 3O5BA 3ZETA 3QJJA 4WCEL 1B0TA 4LSNA 2VG7A 1HBNA 2GQCA 3QFPA 4FLYA 1EJ7L 5FDLB 5CZXA 2OO4A 3N0VA 2R7QA 2LP4A 1V3SA 1D8YA 4CZLA 2H65B 1N33K 4X65J 1QS4A 3I96A 1N36J 4JI1F 5LL6Z 2ZJRL 4LRFA 2WSEC 4DUYK 3KG4A 3Q22A 3NFAA 4W90B 1WLJA 5KRTA 5GAEI 4OKEA 2GO9A 3OS1A 4DX8H 3AJ1A 3EEQA 2R2TA 1RWPB 2EVZA 2V6AA 1C2PA 3KVGA 1JLGB 1WTFA 1RT2A 4ZPVR 4DPYA 4DU8A 2VDHA 4CBXA 3MFIA 4EBEA 2R4FA 2PMHA 3TWHA 1VHIA 3HCXA 3THWB 5CD4H 4OHXA 1WSHA 2VFRA 1X4FA 4DL3A 1Q81O 3LUYA 3L2UA 2WTFA 4PKDB 2AJ4A 3AVBA 3CIMA 4UT4A 4BE1A 4MKVA 3ENQA 1DURA 1WEYA 1BI4B 4MK7A 4DV7F 4ZDNA 2NYIA 5CE3A 2F7VA 1R6VA 4Q5VA 3H90A 3H5XA 2AMCB 1MROB 2HFSA 4DQ8A 2FJWA 3DU5A 2X6NA 1VC5A 3L6QA 2V4JB 3MDQA 4LQ9A 1JLEB 2DR5A 3MPWA 3R1XA 4LF9J 4IDKA 4ETXA 2UXBJ 4JI8F 1LK7A 1XWLA 3DFEA 3VAJA 2YNIB 4NB4A 1RT1B 4KY3A 4I6YA 2CJQA 3BS9A 4KHWA 3LTOA 4OI0A 3W64A 4H54A 3THXA 1GOBA 4CGHA 3EXYA 1T05A 3HKWA 3ASMA 3HHLA 4M3TA 4FK0A 3E8OA 3NGUA 1OVQA 4H0TB 2XMVA 3K5PA 3VMFB 1J6ZA 2VFSA 4JI5J 4KT0C 1UAWA 3QWUA 1Q5VA 2JEJA 2D7SA 2FC8A 4CEEA 1FVSA 2VASA 1IKWB 3A8JA 3UD4P 4HVJA 3CCWA 4RUAA 3LPUA 4HCBA 3H2LA 1S72S 1RU1A 3ILJA 1YBUA 3I32A 3LOUA 5LY3A 1WBBA 2LQJA 1RYRA 3V6JA 2Y1RI 1G4CA 2UXDJ 2YI1A 2OZSA 4RCHA 1WSVA 4K2JA 3NXZA 3PX0A 4A4JA 1YBAA 2O3DA 1GLDG 3RW7A 4LSLA 3IBCB 4WYWA 4DSLA 2KN4A 2QA1A 3DXMA 2CJXB 3AJDA 4GVMA 3OL7A 3HSGA 1VK8A 3N6MA 3KHYA 4NYPA 2A2DA 4B9SA 2VL1A 3DLEB 2JLEA 2ZGZA 4X4RA 4CZKA 2V0NA 1HHQA 2QMXA 3W9HA 4GO5X 1SL2A 2OJ3A 4DR5F 3CQXA 4EFAC 2CQBA 2FBYA 1FJ7A 4DLEA 4B3OA 1RISA 2NRXA 1W2IA 1LOUA 1BISA 4OX9J 2N4CA 4DR6J 1HNIB 1DQ9A 1HRHA 4FWMA 4LFBJ 4WFZA 1T7PA 1C1BA 2D0CA 4KH0B 4DF4A 4DTJA 4L3QA 4C4WA 3G6VA 3HJVA 2IMWP 2V8DA 2UUAF 2OH2A 3T9ZA 4FZYA 2ZBIA 4DXLA 1URRA 1LWCA 2B4JA 4MKYA 4W92B 1T9XA 4RNFA 4A2AA 4DU3A 3UQSA 1TR0A 1ZBIA 3VOVA 1HNVB 4GKKF 3LP2A 4M1KA 1N56A 1RT4B 3LH2S 1U1OA 2KDOA 2AJQA 1UVIA 4V1Ak 1K0TA 4DUZF 1VQ6N 4ANCA 5M1QA 1A5VA 2YBVA 5DK5A 2HS4A 2BRKA 4NXNF 3DRPA 2DNMA 2HBLA 2QLXA 4O4RA 2DCUB 2G8WA 3C6HA 4IQXA 4FZXC 1QAJA 4IR9A 3FFKB 5DO2A 4BR9A 4O3PA 4MFBA 4PABA 4Y00A 3CCUS 2XULA 3TAEA 2J8SA 4PR6A 5FJ4A 2GAGC 4CJKA 2GV9A 2W6LA 3RMCA 3V6KA 5JVHQ 4B9LA 2DK2A 3OSNA 5KFXA 1VRUA 5EHHA 1U25A 2R8GA 4E8UA 1YTYA 3C16B 1XK8A 1X9WA 2UU9F 3V81A 3G87A 2YHBA 2GCFA 1JLBB 4PQUA 3H5SA 4G65A 1Q82T 2WVEA 4OI4A 2BDPA 4JV1A 2FVSA 3QT6A 1UMJA 1QTNB 1HNWJ 3TA0A 3GR0A 1IG8A 3KK7A 3K0SA 3AA9A 1VBYA 1FRXA 3PNIA 3SCIE 4GV6A 4H4OA 3HVTB 3CC7S 4X64J 1O5JA 5AQGA 3AD7C 1FRMA 4RJVA 1AB8A 2FUG9 3V2UC 4O3QA 1RTIA 3NAIA 2RDJA 3QDKA 2JHEA 2MTLA 3FC9A 1QZ6A 4F02A 3QFUA 4I2QA 4OZ5A 4L3KA 5L1IA 2VPYB 1IM4A 2QA4N 3H5UA 2NUUG 3MCAB 2V5HG 2ITMA 3BGUA 3D7SB 3C6TB 1NSPA 5IWAK 4R79A 4L72B 4M5NA 2ZGYA 4ZHRB 4LF6F 3VQ6A 1RWVB 3TA2A 3V6HA 4QR1A 4CECA 2QWLA 4AM7A 4LR8A 4KBIA 2F40A 3G25A 4M5DB 3HF5A 2VPXB 3ZSRA 2CPFA 2NRTA 2CQGA 4EAHD 3F44A 3BKUA 2DEIA 2NZCA 4F67A 3FDSA 4FJGA 1XNQJ 2BX6A 2F4VJ 4JI1K 2E1MC 3O1WA 1FDAA 2D9OA 1UTAA 2FHOB 4H4KC 4QS7A 3UFCX 2Z2MA 1JJ2M 1FNMA 2EC2A 3EICA 3MD1A 2KM8C 4L73A 3CMAS 1OWXA 5F3ZA 2N7CA 3MM5B 1W9HA 2E5HA 1RAHB 4ZVTB 3J80O 4KHQA 1S97A 3PW4A 4AHTA 4P74A 3VQTA 4EWTA 4X4QA 3BF1A 2BKOA 4E1NA 2MQNA 2FXUA 2XC9A 1YHQN 4KC5A 1I94F 4U6PA 2MPUA 4F50A 1MWQA 1NGGA 1RAAB 1YSJA 3MPDA 2RQ4A 3ZO7A 3KNGA 1VRTB 5J2PA 3NVMA 4LH4A 2EFNA 5LXRA 5DM6L 2CPZA 2J76E 4C0OC 3FFIB 4DV7K 1M5HA 1JJHA 3N9UC 4JNEA 1D9DA 2DFEA 3EZUA 4ED5A 4AHUA 4LT6A 2QWQA 1SH0A 1RHUB 4I6WA 3VPZA 3WNFA 2KJWA 1RP5A 4JK9A 3CJAA 2QC3A 2I9SA 4A5AA 4MQ3A 3NY0A 1WEZA 3RBDA 1M0SA 4ICLB 3PXGa 4HHHA 4B17A 4BR4A 1OH5A 2RRBA 3HDSA 3IXQA 1Y4ZB 3IO1A 4ZMMA 5FRMA 1W2BM 1KBRA 3ZT2A 2VWBA 4HEA9 3EGNA 2KHOA 3S1TA 3W2VB 3HM9A 2JH3A 4LRAA 1JWWA 2N4DA 4NXMJ 2Z1HA 1M90O 4RW8B 3DRXA 3AOCA 4B1YB 3AXKA 2E8AA 4OX7A 4CEQA 5KQ8A 4ZK7M 2DTUA 3D28A 3R1HA 3CD6N 1WD6A 5C42B 4WFXA 2IRYA 1S1UA 5DS7A 3E9OA 5HMWA 4YB1P 4K4ZA 1VHXA 1T02A 2RE2A 2HWTA 4BACA 3KOAA 1VQKS 3BR9A 2ZNYA 5D0EA 1TELA 2CH6A 4WFAQ 3SAGA 4DX7A 3SSSA 4NWBA 5JICA 2HS0A 2C2KB 1O0PA 1IR2A 1SB6A 3D2FA 1Q5YA 3FEYB 5B7WA 3CCQS 3MHYA 2NRRA 3KLFA 2IFXA 3ZTQA 2PN6A 4ECYA 2OSQA 3EE8A 2EBGA 2F8HA 2OMOA 4YOYA 2VG5A 1ASUA 1TGOA 4FJ8A 1R6YA 5HL7L 2UVRA 3TOQA 5B0BA 5HSPA 4NEZA 2GBZA 3PVXA 2M3DA 3DHWC 4IRDA 1NK0A 3I56N 2DH7A 3RW6A 2YNHB 3AVIA 2Q1NA 1Y3KA 3VTHA 3I0SB 3MN9A 3SAHA 2F63A 4ZN1A 2QL5B 4HYKA 1K8AT 4ITSA 2MKSA 2EXUA 5HQMA 1YUWA 5FROA 4DR5K 3LZJA 2KQ2A 5KFBA 1FA0A 5GIPA 1U2RA 1VR6A 2VUGA 2DGSA 5HI7A 3NLCA 4NMXA 2NRVA 4DU1A 4NLSA 3V1QA 5AXKA 1UVMA 5LL6d 1ZBTA 5FLXY 1ZYQA 4MK8A 1E6VB 2OTJN 4WWSA 2WAQD 2VOOA 3T1HF 1DLOB 3CCVS 5H1SQ 2LCWA 2AP6A 1BA0A 1NDCA 4FJ9A 2F4FA 1TL1B 5AJ3F 4Z4CA 1YVNA 3Q8YA 2CJBA 2N82B 2GIQA 1NM1A 4GKKK 2PI4A 2MQ8A 4LF7F 1NU4A 1WI6A 4J9VA 3GV8B 3IAYA 4LD0A 3ZEUA 3BH6B 3M1VB 3DXKB 1HQUB 2FVCA 1WHVA 4DUZK 4K42A 4HDHA 2AYMA 4UF4A 2H5IB 4CZJA 3NGSA 1U09A 1LFWA 1S1XA 5KFRA 1BL3A 3DLGA 3MUVP 2YKMB 2OPRB 2AQ4A 3KNAA 1UW4A 3M8QB 1SQGA 5A0YB 4CEOA 2HBRB 1NK9A 3UW1A 2EKYA 5KFLA 4KBOA 2XTJP 4NLPA 1DAXA 3VESA 3NDKA 2J0QD 4B3SF 5JVGL 1WAJA 1JJ4A 3ITHB 2RQMA 1NDPA 1RILA 2MQPA 2UU9K 1Y5LB 4D3HA 2KXFA 2B0GA 4JV0A 2WCXA 4FXWA 2W41A 3DOKA 2RS2A 1RAFB 3CG7A 3BPDA 3CO9A 4CJ4A 3GIJA 3B6PA 4MJKA 3PX6A 3NH2A 3DRYA 2P9KA 5I9EB 3UN3A 1KSPA 5A6WA 3THPA 4G1QB 2R7TA 2LQ9A 3B6OA 1IN0A 3PLAA 1KVIA 3QNWB 1HBOA 1U02A 2AV5A 1NCLA 1NPKA 1BG3A 2FZGB 4J90A 1KD1O 3QNNA 4W5NA 1VLOA 3AAPA 2YQ1A 2RIJA 4F36A 2IVPA 1O13A 3V9WA 2OPPA 5EDWA 4EYHB 1B7YB 3K0JA 4J2DA 3QIPB 3MAQA 2NS1B 5KRSA 4AD6A 4WK3A 5D4OA 2O66A 2XCAA 3QEWA 4CFAA 4PAAA 1VQ4S 1BWFO 3GIRA 3KFWX 2BQRA 2OFGX 1WOSA 2OAUA 2IRXA 3ZTSA 5A8RB 1SCJB 1QTMA 4IH6A 3S41A 5HN0A 2FHKA 3VCDA 1QE1A 4W5TA 4RW9A 3DYAB 4E7IA 3CCLS 2XYHB 2VFUA 1SKWA 2VPWB 1UWBA 1CSJA 4YB6A 5AQIA 3TZZA 4PWDB 2ZH7A 3TEHB 2HHVA 2HIYA 7FD1A 4L74A 2C3UA 2GX8A 3WX8A 3VTIA 3RGIA 1GNKA 1BXNA 4DV4K 3FGUA 2LECA 2K1RB 1FXLA 1KQSR 4LBIA 2Q79A 2VYPA 3MPVA 2XI3A 3QO9B 5KG5A 1JIHA 2XY7A 2GGPB 3SV4A 1IR1A 4S0MA 4DKWA 1RDCA 3O9TA 3VF6A 3PYGA 4DR3K 3OFHA 1FX2A 2HHTA 2DFFA 2QXLA 2L3MA 3PW2A 2RKIB 4IFVA 1AXQA 1RAGB 2CZ9A 3ULEA 4YOWA 4NYFA 5I42B 2RHQB 3SQ4A 1I94K 1X0FA 3KJNB 4JV5J 4UW2A 4CEFA 3GG4A 1MSWD 2COLA 2POKA 3R1LA 4TQRA 1N48A 2OMLA 4C8NA 4DG1B 2ACMA 2KKHA 3CDBA 3DOMB 4OLAA 4DL6A 3PEHA 2C2EA 4ZVEA 2BJ1A 3NGTA 5F0UA 3FBCA 2RPIA 2E6LA 3OYBA 3AO5A 3OVBA 4DR7K 5G4DA 1DARA 2J5AA 2HFNA 5HVFA 5SWMA 1I3AA 3OYFA 4CHQA 4IFYA 1DY3A 5HQLA 3R5GA 5K8PA 4XPEA 3EZ5A 3QEPA 4DSJA 1N4LA 3TYTA 4BC9A 4DN0A 3DOLB 4P2FA 3KKFA 3QINA 4ZA1A 1FHTA 4Y0WA 2X1FA 4C3MA 4WE1B 3IG1A 3BM7A 1FTRA 3FBEA 2CQ3A 2XCPA 2JL9A 5HQ8A 4CNYA 3DLJA 2CDQA 3JQJA 1ZM3A 2BJ3A 4ZP6A 5AT1B 1C1AA 3LP0A 4KI4A 3HVRA 1FWLA 5EN1A 3MMBB 4WYBA 4A48A 1RCHA 3OYAA 1HJRA 4CF2A 5GINA 5KFSA 4BRMA 1T6DA 2Z30B 4L76A 1RE1B 4KHUA 3MECB 3D54A 4EZ6A 2PIIA 3THYB 2QWMA 2OSRA 3U3YA 4BRIA 3CFPA 4YNQA 1C1CB 3O9SA 4CK1A 1OH8A 3OFGA 1F2HA 3OHAA 3AA4A 1Q86T 4IG0A 4OJHA 4DMNA 4FVCA 3LW5C 1VSHA 1PGZA 1WOQA 5H9FJ 4OI2A 3U1NA 1EWQA 2GV1A 4Y2CA 1YJ9N 3UO0A 3BGFA 4Z2XA 4FLZA 3DLKA 4KHMA 3MAAA 4F4YA 2YVSA 3T41A 4K8ZA 1KQGB 2VKZG 4K7QA 2JX2A 3TTDA 4H5RA 1N6QB 4TU7A 3CM5A 4CD1A 3BSCA 3LPTA 4LVOP 2MZSA 2Z1IA 5CY4A 4Q2MA 3KDOA 3N5FA 3VGLA 3VQSA 3D0PA 3JAMO 2ZUAA 2DFHA 1JLFB 3PSFA 2KVIA 2QWOA 1KOHA 5HRRA 3TAMB 2PC6A 5CYQB 5E84A 3LDPA 4H5WA 3QGHA 4J7CA 3AB2B 2XMJA 1TKTA 3KK2A 1WSEA 4R5PB 3WC2A 3HRGA 1V6HA 1UW9A 3CCQN 4J91A 1RBSA 2WVDA 3JYTB 4E2FB 2W8KA 2MQOA 2B4UA 3PACA 5KFAA 2GQ2A 1L3SA 2ACYA 2LVWA 5BPMA 3BF4A 2JNJA 1SJ1A 4JI3J 4NRTA 1ATRA 3S6EA 1FFSB 4F2SA 3VQQA 3ICLA 2XHCA 4QS8A 4CI0B 2QYCA 3DKDA 1VQ7N 3A8IA 4I6MA 2YHXA 2YHAA 1BQNA 3VENA 4J9KA 3WXKA 3ZTOA 1CJVA 4USUA 3RUBL 4CLPA 3DMJB 4KPYA 1GLEG 4NASA 4OJ1A 1SV5B 2M8DB 4J9NA 1ZBSA 5KFVA 1DBDA 3FCWA 3C95A 2VCPA 1S1WA 2V63A 1OQ3A 3I5AA 2H9ZA 4QYZK 4B3SK 5DM7L 5KG4A 1T9TA 1GLBG 5A2QY 3DRSB 4KYZA 3VQEA 1UP1A 4R25A 5F0WA 5DDRC 4QJVA 1UVNA 3GFXA 2DXDA 2M4MA 3FR0A 4M5MA 3OYHA 2K7KA 4OYMA 1RTJB 3ENHA 2HNYB 1NHVA 2LYVA 4E7HA 1JJCB 1Q78A 3AFGA 1ZS6A 3CC2S 4DV0J 1K8KA 4KTQA 2VQFJ 2BQ3A 2JC0A 2G0IA 2DRDA 4U7UD 1PJ6A 4JHDA 4BRHA 1HNZK 3TUIC 3JQKA 2ZH9A 3MWTA 2HBKA 3UKUA 4CE9A 3GFHA 4ECQA 3O08A 3ATVA 3R3LA 1RLDA 2CVEA 2NPIA 3ZX2A 1WWHA 1NOYA 4PZVA 1HBMA 4QIGA 1FE0A 4I7FA 2C2DA 2PFUA 2BABA 3UD5A 2JFKA 4YP3A 1R43A 3MCNA 2XNRA 4CHNA 3HVWA 4YDDB 5M2PA 3E66A 3HHKA 3FZBA 1ZZFA 5ETNA 2WSCC 2DGUA 3QBCA 2HNDA 4NLDA 2PI5A 3OYGA 5DG8A 1LW0A 5CA5A 4FBTA 1ITPA 2WVCA 4YQWA 5IV4A 3UI3A 4HLBA 4WBFA 3CCES 4K0KF 2YWEA 4AM6A 4BHQA 2FY1A 4Y2IA 4ELTA 1HNXK 3A5NC 1RT6B 1TL3B 3AA3A 4CF8A 1D0EA 2GAHC 2AD9A 5KG6A 4IXCA 4DZDA 3O4NA 4UY8T 3M2RA 1FJGK 2LXIA 5AQXA 3ZSWA 4TVAB 1QJHA 3MMAA 1XERA 3C15B 2HWHA 4NPOA 3EGWB 2I6WA 1TQLA 2ZD1A 2QV6A 4FKXA 4KH6A 4ZLLA 3NE6A 1U4BA 4DL5A 3H25A 1RBVA 3HZ6A 2I38A 4C6AA 1KLMA 1RBRA 1EWRA 2WOMB 1SJFA 5C2GA 2WRMA 3S3MA 4BG9A 4M5JA 3P45B 4O3NA 2QEXS 3D4JA 1RWUA 2HOEA 1QY7A 4IOAL 2ETJA 5ADZA 1Q81T 2DKOB 3KD5E