1S9EA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
total genus 142
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9eA05
3H5YA 2I1RA 1GOCA 2HVHA 4ZHRA 2HMIA 3SNNA 3V4IA 3ZT3A 2HHTA 3SV3A 3CDUA 4ZPCA 2BGGA 1S6PA 2AJQA 1HNVA 1HNVB 4DMNA 2XGQA 3HPOA 3SI6A 3THVA 3NE6A 4K4SA 2XCAA 4O55A 3NGZA 2RKIA 3NAHA 4ZHRB 2HNDB 2AX0A 2CJQA 3VQSA 4TN2A 3HK2A 4O4RA 3VQAA 4DSLA 2UUWA 4RW9B 2QKKA 2WONB 3TAFA 2OA8A 3S9HA 5DLGA 1T05A 3AVMA 3QINA 1NK6A 3MXJA 2G8VA 2XY8A 2R8HA 2P1JA 4J9OA 3KK1B 1KSPA 3AVJA 3SCXA 3U6FA 4EYHB 4DLEA 5KRSA 2BQRA 3DYAA 3PO4A 3PHEA 1BQNA 3QIOA 2B5JA 4NCGA 5F8LA 3Q8RB 3MEDA 3DLGA 2RDIA 1YTAA 1XI1A 3GIJA 2W42A 1UA1A 3DMJB 5C24A 2X6NA 4ZVFA 4BE1A 1WAFA 5I3UA 3QEWA 5FDLB 1U48A 2OH2A 3KHLA 1L5UA 1SL2A 4N56A 1RDCA 2VWJA 3KNAA 5KFEA 1VRTA 3KK2B 4J2BA 4CJEA 4B9MA 4QWDA 2C28A 4IG0B 1T3NA 1NJZA 3E01B 4IFVB 1LAWA 3K57A 1C2PA 3HT3A 1T03B 4CJ4A 1RTHA 3DLBA 1WSJA 4M95A 4NLTA 4YFUA 4NCAA 4NRUA 3KLFB 4EP4A 4KKOB 4EZ6A 1C0UB 1J53A 3OSPA 1LAVA 4KBIA 2Z1JA 3GIMA 4OL8A 5J2QA 1WNEA 2D0CA 4I9LA 3OY9A 2C2RA 4CF2A 3DI6A 3OYBA 4CERA 5L1KA 1HJRA 1EETB 4FM2A 4B3OB 4JUZA 4RW4A 2B43A 2OPQA 4AHSA 1IG9A 1TKXB 3SZ2A 1KLMB 3KK3A 5KFDA 1TL1A 4TXSA 5KG0A 3ZSRA 3ISND 1QHTA 2XY6A 3LANA 3BQ1A 1KFDA 2YHAA 4IR9A 4Z4FA 3OYLA 3FFIB 2C2DA 3LP3A 3RAQA 3PX0A 4MIAA 3IG1B 5D3GA 2RDJA 3ZSXA 2YNHA 1JLBA 3ZT2A 3QEIA 3M8PA 4KSEB 1RAJA 4KO0B 3LWMA 2D3ZA 2BANA 2QXFA 1S9GA 3NBPB 1J5OB 1B9DA 4ICLB 2E9ZA 2Y1IA 5HLFA 4DQPA 4M42A 1IKWA 4FK0A 5KT7A 3GYNA 1LWEB 1RDBA 4IKAA 5HRSA 4Z4CA 4FJMA 2IOCA 2GIQA 4ELUA 4KB7A 3O3FA 2FVSA 1BQMA 3VQ6A 3KHHA 3TAEA 1S0MA 4Y34A 5KFFA 3IRXA 5EDWA 4H4OB 2HWIA 3C6TB 4OGCA 1JKHA 3AVKA 4OKKA 1RTIB 3AO2A 5DK5A 3AA2A 3S3MA 5KFXA 3L2RA 4O3PA 4CCHA 1JLEA 1NKBA 1DLOB 4AHUA 4M3UA 3P83D 5KG5A 4F4XA 1BCOA 1KTQA 5KGWA 3U3YA 2D41A 2OPRA 4MKBA 1N5YB 3M8QA 1KVBA 3RBDA 2UVWA 1KHWA 1ASUA 3H08A 3ZSZA 1N56A 4YNQA 4NRTA 2BQ3A 1TAQA 1RT6B 4WE1B 4KHWA 3PO5A 4ECQA 3DM2B 3DRPB 1QSSA 1HQEA 3CM5A 4M3XA 4QWEA 2WRMA 3NGDA 4OJRA 4LY7A 4K4UA 4RNNA 1JLCA 2C22A 4LD0A 2XO7A 2W9CA 1RT5A 1RT5B 2R8KA 2W9CB 1DTQA 3NCIA 2ZD1A 5KT6A 3LP2B 4BDYA 1I3AA 4WYLA 2UVRA 4WFXA 1SH3A 4K8XA 4FJ9A 1UOCA 3PZPA 5HRPA 3DRPA 2JGUA 3DM2A 4MFBA 1S6QA 3KKRA 1RT6A 3SQ4A 3HHKA 4DL2A 3TQ1A 4N5SA 4NYNA 1NK8A 4OLBA 1RT7A 3NF7A 4CFCA 4FXDA 1F21A 1XHXA 1NJYA 3TR8A 4E1MA 2IM2A 3RTVA 3IN5A 2IS3A 4G1QA 4EYIB 4CK2A 4ECVA 3AVBA 1N5YA 4FVMA 1SH0A 3A2FA 4K8ZA 4LH4A 4JRQA 4J9KA 3OYIA 5I42B 3ICLA 3SUPA 3AVFA 4LQ3A 1S1WB 5HRRA 3TAPA 5L9XA 3G10A 4BDPA 1U49A 3CDEA 4WZMA 2RPIA 4H4OA 3RB0A 1CXUA 3PY8A 3P5JA 3OYCA 3AV9A 1RT1A 4IH6A 4CEFA 4I2PB 3UPFA 1S1TB 4Z4HA 1ZBUA 2HHVA 2E9RX 3RMAA 4E7KA 1NHVA 3NL0A 3DLHA 3ZSVA 4PUOA 5HLFB 4J2DA 4JV2A 3AO5A 5F8NA 2W9AA 3KD5E 1S9GB 3NBPA 1J5OA 2AU0A 2BANB 4DWIA 2Y1JA 2WOMB 5K14A 4KO0A 4Q0BB 4I2QB 3DLRA 2G8FA 4BWMA 4DSEA 4QPXA 3IG1A 4DU3A 2R2UA 2ASJA 1RCHA 4CF1A 3DRRA 3FFIA 4EBDA 4CEDA 4IKFA 4LSNA 3MECB 2ITGA 2IJFA 1LW0B 1KLMA 3I0SB 2YKMB 3AA4A 1N48A 4PWDB 1RBVA 4LH5A 1KVAA 4Q45A 4NYFA 4M45A 4DG1A 3V1QA 4BE0A 2F8TA 3MECA 4B8AB 3ITHA 4DFKA 1VSDA 3CG7A 4CJLA 3AVGA 2KZMA 2IDOA 4E3SA 2OPPA 2IGIA 3V6HA 4Q0BA 3PW2A 3DOLA 4J2EA 4KKOA 1WN7A 2GIRA 1EP4A 3KLFA 4M3RA 2WOMA 3MTKA 1HRHA 4CEAA 3QERA 3RRHA 4LSLA 4DTJA 2G8WA 4FJ8A 2OPSB 4KI6A 4DTNA 3TI0A 4FJIA 3ZT1A 4B8CA 3L8BA 2XI2A 5DQHA 4IFVA 1SUQB 4B08A 2FLNA 3OYNA 4IG0A 3M8RA 3T5KA 5KFKA 4I2PA 5HROA 4PQUA 5DQGA 2PZSA 4DFMA 1RT1B 1BHLA 1K1SA 3CVKA 3H2LA 4QW9A 3C6UA 3OL9A 4DTSA 4QAGA 1TKTA 4MK7A 4RU9A 3OS1A 2V0NA 2NUBA 2XY7A 3PJXA 2B5JB 4CK3A 1BQNB 4RW6A 2PY5A 3PW0A 2FJWA 1XR5A 1KRPA 4PA1A 3O3HA 4Y2AA 4OPJA 4J9QA 4BACA 4YR2A 5KFTA 3V9WA 1JXEA 5KT2A 1NK7A 4ZTJA 1RT7B 2R8IA 4DL3A 4IRKA 2IMWP 1QQCA 1HQUB 3G86A 5CYQB 1KVCA 3V6JA 4O5BA 2GBZA 2HNDA 2RKIB 4DL4A 3TANA 3RRGA 4CIGA 1HARA 1QSLA 4ZMMA 3VQBA 4E89A 4NZ0A 3K2PA 4EBEA 3LP2A 1S6PB 4CJ3A 3IGVA 1DTQB 4JS5A 4CJRA 2RF2A 1RTJB 5EU7A 2JC0A 2W7OA 5T7BA 4ZPDA 3OL6A 3MFIA 3HXMA 1R0AB 1S9EB 3KLHB 3ZSOA 3MR3A 3HVAA 3EY1A 3GIKA 1Q8IA 3ZT4A 1WNSA 2VWKA 4FS1A 4TY8A 1FK9B 4CHNA 4ID5B 1TP7A 4KAIA 4M94A 4FJHA 3T1AA 3EYZA 3TAMB 1JIHA 4KB1A 2R2RA 4HUEA 4GVMA 2FBTA 4IG3B 4O0JA 5KFIA 5C42A 3LPUA 3OJUA 2DPIA 1RNHA 4FYDA 2HHQA 5FRMA 3O3GA 2QE5A 5DG9A 3OYHA 2UVVA 3QEXA 2AX1A 4XPCA 1HYSA 3L2UA 4EZ9A 1JLAB 3HO1A 1S1XB 3KIOA 4IH5A 1RTIA 2XWYA 1D0EA 5J1EA 1N6QB 1JKHB 4FZYA 5F9NA 3BQ2A 4NLGA 4X2BA 4FLXA 4HCCA 4NLWA 3MEGA 3CJ2A 2E9TA 4FS2A 3RBEA 1EXQA 1VSHA 1IO2A 3RR7A 3IRXB 4TQSA 3IAYA 1BQMB 1X9SA 3NH1A 3V9XA 4ECYA 1SL1A 1U4BA 1U45A 1CZ9A 1B92A 1HNIA 3OYKA 4NLSA 4E19A 2P5OA 4M3ZA 4RW7A 4WFYA 3KTQA 3CWJA 3JSMA 4NLVA 5L1JA 2EC0A 4CEQA 1RA7A 5J2MB 3KLGA 1S1UB 3G6XA 1S49A 2E4LA 3M8PB 4IDKB 2YNHB 1GX5A 4M3YA 1NKEA 4GC6A 3QESA 4JS4A 5D3GB 4CJTA 3KJVA 2ZE2B 3UQSA 4IH7A 1HYZA 1I39A 3OYMA 4NLXA 4FZXC 2J6TA 3ZCMA 1TL1B 4ELVA 3Q8QB 4F4YA 4ZTFA 4ED3A 4CESA 4RW4B 4GW6A 2BE2B 1JLQA 3C95A 4EEYA 3QNNA 4KTWA 3UR0A 1NHUA 5J2QB 3JYTA 4LQ9A 1TGOA 5C5JA 4QOZB 3CJ3A 3GV5B 1VSMA 4DTXA 3AA3A 1ASVA 3QGGA 1C0UA 3DOKB 4TLRA 1WSFA 1VRUB 4YP3A 5KFJA 4TQRA 4CJ5A 2AGOA 2E6MA 2AGPA 4W5RA 1ZBFA 4IOBA 3MR5A 3C94A 1NK0A 3QLHA 4O0IA 3NF8A 2WB4A 2KFNA 4W5NA 1REVA 2FBVA 3SFGA 4CJVA 4CJPA 4E7HA 1S1VA 3NHGA 1VRTB 5KFSA 2XY5A 5DQIA 3H5SA 3HSTB 4CFDA 3V9SA 3TARA 1ZBLA 2WCXA 4H4MA 1Z4UA 4OKEA 4DSFA 3DMJA 3OYEA 4KB0A 2Z1GA 2O4IA 5KFHA 2IC3B 4FLUA 1IKXB 3DLGB 1W9HA 3M9NB 3MEDB 4W5OA 4FJJA 3QETA 3SQ1A 5KFBA 4O4GB 4O4GA 1D5AA 2R2TA 1EX4A 5F8IA 3EPGA 1RBTA 4MKAA 2R2SA 2Q3SA 4F8RA 2BRLA 4FK4A 1C0TB 4KHRA 1BIZA 4F4KA 4FBTA 3MR6A 1LWCB 2R8GA 1TKZA 1T05B 2KZZA 4DTMA 2R8JA 1JLGA 1B9FA 4CHZA 5EUHA 1YTUA 4ECXA 1J54A 5HP1B 5CYMB 4CJUA 1ZBIA 4RW9A 4ZP7A 4KE5A 2PYLA 3EZ5A 3I0RA 1HYVA 4K4WA 4KTQA 2Z1HA 3H59A 3NAEA 4HUFA 1C1CB 2RN2A 2F8SA 1VSLA 1CXQA 4KHUA 4CFAA 3OJSA 4Q8FA 1RT3A 5J2NA 3VQ5A 3MR2A 3DOKA 5KTQA 4I7FA 4E0DA 3PUFA 5J2PA 3LZJA 3V4IB 2HHUA 4MK9A 1TV6A 1MU2A 4R5PB 4FLTA 2ZKUA 1WSEA 1RILA 4NLOA 1IKVB 2BE2A 1FKOA 3NFAA 3S3NA 1IKYA 2W9BB 3PV8A 2W7PA 4Y2CA 5CY4A 4CEOA 5EWGA 1JLFA 4K4YA 3V6KA 5F8JA 2FLPA 2FJXA 1L3TA 4I9QA 3KJVB 4W5TA 4WXWA 1RT2A 3D28A 1QE1B 2XCPA 4YQWA 3M9OB 4DQIA 4CFBA 4IDKA 1KHVA 1XWLA 1X9MA 3DLKB 1HMVA 1S1UA 4ED8A 3V9ZA 3KLGB 4Z0UA 4BE2A 1TVRB 4DQSA 4OLAA 3FQLA 3CM6A 1C1BB 4O44B 4ZPAA 5KT4A 2AGQA 4J9RA 2GC8A 3FRZA 4Q44A 1A5XA 1JXBA 2FVQA 2YNFB 2VG6B 2YNGB 2JC1A 1BI4A 1KFSA 1TL3A 1TL3B 1TQLA 3WNFA 2FVCA 1BISA 3BR9A 4DLGA 1NK4A 2VG6A 2YNGA 1Q9XA 4KHSA 5EWFA 5KFVA 3NDKA 2P5GA 4KHYA 2YHBA 3QIPB 2X6SA 1BGXT 3I5CA 3K5MA 4QWCA 4URSA 5HBMA 3IS9B 5KFWA 1S0NA 3KLVA 3AVIA 2KFZA 5KFUA 1HMVB 2FC0A 3LAMA 4CHOA 2KW4A 1SKRA 1QE1A 1RT2B 1LWFB 2DFFA 4L8RB 1FKPB 3TAQA 5DG7A 3TAMA 3DLEB 4CGGA 4RNFA 2C2EA 2W8LA 3VQ8A 3GILA 3CO9A 4TY8B 1IKYB 2W9BA 2IBKA 1FKOB 4NLUA 3V81B 4FJNA 4KFBA 2YNIA 2ATLA 4F3OA 2HWHA 3MFHA 1RT4B 4CHYA 2CKWA 1MU2B 5FROA 2IAJB 3KLIB 1RTJA 2RF2B 2IM1A 3KD1E 3OL7A 3OYAA 4I7FB 3OYFA 3PW7A 3PR5B 1U09A 2J6SA 1RBSA 4AH9A 2HHWA 2HNYA 2ILZA 3L3UA 5KFAA 4ZVHA 2KTQA 3T5LA 2D3UA 3AVHA 4B9NA 4FBUA 3SPZA 3LP1A 2B6AB 4O3RA 1D9DA 4GMJB 3I0RB 3CIZA 3DRSB 3MF5A 4KV8B 3G6VA 4KPYA 4BWJA 5CYMA 5KG1A 1ITGA 1SKSA 2D0BA 1JLGB 3ULDA 5KFNA 1A5VA 2X78A 3LDSA 3MEEB 5KFRA 3OYJA 2ILYA 1LWCA 4KREA 2YKNB 3E51A 4KHMA 4FW1A 3D45A 4ZP9A 4IRDA 4OGEA 3BREA 4QWAA 4CHQA 4O3QA 2HHSA 1L3VA 4RW6B 1UWBB 4RUCA 5KFYA 2O4GA 4MQ3A 3OL8A 4FM0A 4Z4GA 4KI4A 3RAXA 2BR0A 1TKTB 4H4MB 1W0HA 5KFZA 4J2AA 1D9FA 3KLEA 1SH2A 2FVRA 4Y1CA 3KOAA 1S97A 4RW8B 5HROB 4PQUB 3O4NA 3T3FA 2HB5A 2J6UA 1D1UA 3ASMA 3IGNA 4NLRA 4YR3A 4HHTA 2UUTA 4NLDA 1LV5A 1REVB 3NF6A 3F9KA 2QV6A 2HNZA 4UQGA 4NLYA 2GV9A 4CF8A 5E41A 4JV0A 4LSLB 1GOAA 4IFYA 2EHGA 1QS4A 3LZIA 4HTUA 3DOLB 1Y97A 2BDPA 3BSAA 3KHRA 4RNHA 4RG8A 3VQ9A 4EO8A 5KFMA 3V6DB 2V4RA 2DTUA 4J9NA 4NLQA 4KAZA 1JLQB 1UA0A 4DG1B 4QW8A 4ED0A 3B6PA 4M3WA 4PWDA 4DL5A 2YKMA 4E7JA 3NKYA 1LW0A 4DEZA 3HJFA 3RWUA 4BDZA 4J9SA 4XIUA 4Q5VA 4DF8A 4IR1A 3I5BA 4O3NA 5JXSA 5SWMA 1LW2A 1XC9A 1QAIA 3NMAA 4XPEA 4I2QA 4Q8EA 1N4LA 2WTFA 5CZ2A 3GIIA 5K14B 1TK5A 3RB4A 1VSFA 3AO1A 5J2MA 3QO9A 3JSMB 2OZMA 5F9LA 4N76A 4DS4A 4DQQA 2I5JA 4CGIA 4PUOB 1HNIB 1DTTB 2G8UA 1ASWA 4FZZA 4HVJA 2IM3A 4CIFA 4MK8A 2VG5B 3OVNA 3LP0A 4ECUA 2VG5A 4IBNA 3QZ7A 4OVLA 5SZTA 2BQUA 5KFPA 2HW3A 1D8YA 4C8MA 4CJSA 1QAJA 3NGIA 3H40A 4WFZA 4CEZA 3PR4A 1G15A 1QUVA 1DTTA 2ASDA 1U47A 1S1WA 4NYZA 4WZQA 4ZPBA 5I42A 4CE9A 3U3GA 4CECA 4R8UB 4FW2A 3K5LA 4DQRA 1NK5A 3V1OA 1RDAA 3HM9A 1J9AA 1HYSB 1OS5A 1KLNA 4RZRA 4ED2A 3NGYA 4WXOA 2ZQBA 3AVAA 4G1QB 4URQU 4GC7A 4CGJA 3K58A 5JS2A 2G8IA 4FLVA 1WSIA 4CEBA 2XGPA 4E1NA 4MH8A 5KT3A 2KQ2A 2G8KA 4ID5A 4IRCA 3K5OA 3QZ8A 4CGDA 4NCBA 4DL7A 5F8MA 4ED6A 4MFBB 3VQEA 3BGRA 1K6YA 4FK2A 1C1AA 4ED7A 3RB3A 4OKJA 4AHCA 1RYRA 3KLHA 1R0AA 4EP5A 2YV0X 3GV7B 2ZD1B 3KMSA 4IFYB 4H54A 4CGFA 1JL2A 2IA6A 3QYYA 1VSIA 2FBXA 2HNZB 1RBUA 4Z4IA 3LAKA 4DTUA 3MXMA 5KG3A 4WYWA 2XI3A 2DY4A 1XHZA 5F8HA 4AILC 4WE1A 3AVNA 4TSXA 4RW8A 5CYQA 3VA0A 2VA3A 1NJWA 4FM1A 1HQUA 1WLJA 3OS0A 3KLEB 4KHNA 4ZVGA 2EX3A 5KI6A 4KHQA 4J9LA 2AQ4A 4HUGA 3Q8PB 3H4BA 3PW5A 1S9FA 3BDPA 3VQQA 1WSHA 1RA6A 4XO0A 1UWBA 3AVLA 3M8QB 3L2QA 1EKEA 4AHTA 1JX4A 3I5AA 5KG6A 3KMQA 1TK8A 3KKSA 1ZYQA 4Q43A 3QEPA 3L2VA 2IJNA 3LWLA 3VQ7A 3SI8A 4TYAA 1TKDA 2YKNA 4F4WA 4CIEA 4HCBA 3OLBA 4ECZA 4B9VA 4DSJA 1GX6A 3MEEA 3S3OA 1SKWA 3SJJA 3OHBA 4QWBA 1RBRA 3C6TA 3ALYA 5KRTA 3HYFA 3C6UB 4KV8A 4RNMA 3AVCA 3QGIA 3RMCA 4ZP6A 2Z1IA 1JL1A 2AWZA 5CZ1A 1XR7A 4ELTA 3NF9A 4B9SA 1NNDA 3AA5X 1LWEA 1SUQA 3SPYA 3D0PA 2W8KA 1IKWB 2OPSA 1S48A 4ICLA 4ECSA 2JEJA 5KGXA 3N6LA 4PY5A 2FJVA 2IAJA 1EP4B 3KLIA 4TY9A 1JLBB 1X1PA 4DFPA 1RT4A 2OPPB 4CJWA 3CJ0A 1GOBA 3BGRB 3CFRA 5DGBA 4K4TA 3CJ5A 3ITHB 3BJYA 4FJ7A 3DLEA 2G8HA 4N47A 3I0SA 2OPQB 5T14A 4B3OA 1EETA 1LWFA 3DI6B 4LSNB 1CZBA 3AO3A 1YVFA 5KFGA 5FRNA 3DRRB 5KT5A 3UDLA 4ECTA 3OSNA 3HPGA 1Z26A 4HYKA 4AHRA 3PW4A 1IH7A 3PVXA 2UVUA 4FLZA 3CYMA 4OPKA 4R8UA 1A5WA 4B9UA 3EPIA 1MMLA 1T94A 3KHGA 2LSNA 1RTHB 3OLAA 1T03A 4K4VA 5EWEA 1S4FA 3NH2A 4U7CA 1X9WA 1S1TA 3DDKA 4FJLA 3OS2A 2O5DA 3LP0B 4IQXA 3GQCA 3GV8B 4N41A 1TAUA 5FDLA 2D7SA 4ZVEA 5I3UB 4HKQA 3P1GA 1TK0A 2IM0A 2I5JB 2HAIA 3SFUA 3SUOA 3QO9B 1U04A 1TVRA 4J9PA 3RMDA 3DLKA 3NH0A 4J9MA 4K50A 3LPTA 3OHAA 3FSIA 2D0AA 3L3VA 1LW2B 3KK1A 3N6NA 1XR6A 4DTPA 3F73A 4FCYA 1NK9A 2A1RA 3G0ZA 4URGA 3ZSQA 3ISNC 1JLFB 5HRNA 2V9WA 2WONA 2JLEA 2DPJA 2HVIA 3EZUA 4DF4A 5DLFA 5DGAA 4ID1A 1ZBHA 1VK0A 1IKVA 2X74A 3HVRA 4U6PA 2ATQA 3NAIA 3WNEA 3QEVA 1S6QB 1TV6B 4R5PA 3V6DA 3HP9A 3QIDA 3H98A 4DL6A 1BIUA 2V4QA 1T8EA 5J2PB 4DSKA 3OYDA 3K59A 3HVWA 4EO6A 4JV1A 1RT3B 5J2NB 4CJQA 3WNGA 1ZETA 2ASLA 2JEGA 1C0MA 2HMIB 3LALA 1JLCB 4FLYA 3BSOA 1C1CA 2XC9A 1S5JA 3TABA 3H5XA 1L3UA 5C25B 1S10A 3RMBA 4DFJA 1HQEB 4RNOA 1BL3A 5HP1A 4JRPA 4YR0A 3L2WA 2QK9A 1RDDA 4F3TA 5KFLA 4RUAA 4ECWA 1TKZB 3CFPA 5L1LA 1HPZB 2GUIA 4B9LA 1NOYA 3WNHA 4DU4A 3VQ4A 1C0TA 4M41A 3MAQA 3ZSWA 2B4JA 3RB6A 1BCMA 4K4ZA 3HP6A 3AO4A 4DS5A 2OYQA 1VSJA 3ZT0A 4K4XA 1WSGA 5L1IA 2VG7B 1CSJA 2OPRB 1NJXA 4KTZA 1IKXA 4DU1A 2IC3A 1IM4A 1DLOA 1JLEB 2JEFA 2BRKA 1I6JA 3T5HA 1YVUA 3PJWA 1SV5B 4FJXA 2F8EX 3TWHA 4QCLA 1JXLA 1UAXA 1WAJA 4CF9A 3V9UA 1T7PA 2JEIA 1RTDA 3QGHA 1VSKA 3K5NA 3N6MA 1RDRA 3H5UA 1S1VB 4FJGA 2F96A 4CF0A 3UIQA 3DRSA 4DTOA 4AHVA 2B6AA 4O3OA 3LP1B 4KRFA 2E6LA 3QLHB 4DTRA 3CFOA 1VSEA 4C8KA 4EBCA 1Z25A 3HKWA 2A1SA 3MXIA 4NLPA 2HNYB 4W5QA 5JUMA 1VRUA 3BSNA 2FVPA 4E7LA 1RYSA 2R7YA 3BSCA 3VA3A 2P51A 4Y3CA 3JYTB 4MIBA 3HL8A 1L3SA 3T19A 3H4DA 2YNIB 4FJ5A 4KFBB 3V81A 3Q8SB 3HVTA 2XHBA 4B9TA 3TVKA 4YMEA 2FBYA 4CJFA 3KK3B 3FDSA 1TKXA 3ZSYA 1YT3A 2WK4A 3HVTB 2ZE2A 2ETJA 1FKPA 2VA2A 1SL0A 2XRIA 3CQ8A 4E7IA 3SUQA 5KG4A 4G3IA 4FLWA 3CDWA 4O3SA 4F50A 3G6YA 4C8OA 2DFEA 4JLHA 4F2RA 2HHXA 3D5MA 3CJ4A 3OYGA 2WHOA 3IS9A 3I8DA 5HBMB 3T5JA 4RW7B 1O1WA 3M9MB 5KG2A 1NKCA 3B6OA 4ED1A 3SV4A 4Y1DA 3QIPA 3TAGA 4F2SA 3HPHA 3FQKA 2DFHA 5F8GA 3V1RA 3E01A 4CJKA 5KFOA 3QNOA 3RR8A 3KK2A 1BI4B 4ECRA 3MEGB 4CHPA 1FXXA 1RTDB 1QSYA 3VQPA 3PX6A 2YNFA 5KFCA 4DSIA 1N6QA 5J1EB 3SQ2A 1SV5A 5KFQA 5DMRA 5KG7A 5C24B 4H8KA 1S1XA 4F4ZA 4C8LA 4O44A 1C1BA 3BQ0A 1JLAA 1KCFA 4NCGB 3SYZA 2VG7A 4TYBA 3DYAB 1S0OA 2PYJA 4FJKA 5DG8A 2FLLA 3SUNA 1Q9YA 3VN5A 3M8SA 4ZP8A 1K1QA 1CLQA 4Z4EA 5C42B 3SQ0A 4IG3A 3VQCA 4C8NA 1HPZA 1C6VA 2ALZA 2D5RA 1ZTWA 1W25A 4CEEA 3PX4A 4R0EA 3VQDA 1NOZA 2QKBA 1FK9A 4CGHA 4M3TA 2OZSA 1QTMA 3O4QA 5JS1A 1ZTTA 4CK1A 5C25A 1S9EA
chains in the Genus database with same CATH superfamily
5BYSA 4ES2A 2ZBRA 4CZMA 2HVHA 4ES3A 3SNNA 2ACYA 3PLAA 2JVOA 5AQSA 2AJQA 1HNVA 3M3ZA 3SI6A 3L7PA 2GQCA 4O55A 4X4RA 2RKIA 3VQSA 2NRTA 2AJ2A 3MHYA 1VJWA 4O4RA 4DSLA 2CQ2A 4DI6A 2BA9A 4RW9B 2DPNA 2WONB 3LM2A 2BVZA 4BC4A 3R2CJ 1QLNA 4AYBD 1VQMS 2YQ0A 3QFPA 2C2NA 2XY8A 4KQZA 1RHJB 5ELZA 5LJVA 3HSGA 1UW9A 3KUGA 5D0GA 4DLEA 3MPVA 3PHEA 1BLUA 1YTAA 3MMCA 5HL7Q 3UVJB 2F63A 3BBCA 3DMJB 5C24A 2ZJRQ 3S01A 2X6NA 1K8AT 5I3UA 4UOCA 3QEWA 5FDLB 1OH7A 4JI7J 1U48A 2JSXA 4JI3K 3KKFA 2QM1A 1Z6RA 3FBFA 1VRTA 1YIJS 2C28A 5H9FK 3TPQA 3CCQN 1T3NA 3BH7B 5LJWA 3HT3A 1ILYA 3RYLA 2HQDA 1SBRA 4NLTA 4YFUA 2MKIA 3M2RA 5AQWA 1LWXA 3KLFB 2CADA 1C0UB 2ZH6A 4LMZA 1HBMA 3EICA 4KBIA 5IFMA 4A8XA 3EVOA 4OL8A 1WNEA 3OY9A 4I9LA 2C2RA 3DI6A 4CERA 4AFFA 1HJRA 4FM2A 4B3OB 2L08A 4PABA 3BH6B 2B43A 3Q86A 3A3NB 4OHVA 1TKXB 3SZ2A 2CNNB 4TXSA 5KG0A 1AYEA 1QHTA 4IR9A 4C1NI 1T95A 3OYLA 3PM9A 2C2DA 4LSZB 3I56N 3RAQA 2O8EA 2DISA 4CVNE 2KM8B 2VBYA 2YNHA 3QFHA 3NOGA 4KSEB 1SB6A 4BR0A 2VQEK 1U26A 3O1LA 2PFDA 3P6YC 1S9GA 3NBPB 4ICLB 1NSQA 2QLWA 3TSUA 1TR0A 1IKWA 5L38A 4EMDA 2LEPA 2V7YA 4IKAA 2GIQA 4KB7A 4H5VA 2FVSA 3W2WB 4JD2B 3VQ6A 4WCEL 3DU5A 1P1LA 3PDNA 4Y34A 4G1IA 2F1FA 4JI0K 3EGNA 4CH1A 2FZCB 1UP1A 4USHA 1K8KA 3VCDA 4CLKA 3AOCA 4XK8C 3AY0A 1TUGB 1N34J 3AGKA 2CXEA 4KHPF 4CT9A 3MWPA 3HHLB 2VASA 3AA2A 3S3MA 1M1HA 3O8MA 2LVWA 1RKJA 3D6MB 4BRDA 4AHUA 1U1PA 4M3UA 1KTQA 1BCOA 3WZ0A 4USIA 2FJBB 5L9NA 2ZFHA 1BWVA 4KGVB 3OT9A 4QS9A 4FDFA 4JK9A 3DRYA 1WF2A 2PBDA 1ASUA 4CD3A 2FHJA 3JSYA 4C11B 1KC8O 3H08A 2ZOMA 3ETOA 3IWXA 1HBOB 3CGIA 4JB8B 4BC7A 4WE1B 4KPCA 2HIYA 5G4DA 2RHKA 5BYQA 1B64A 1JB0C 3T6BA 3IFRA 4OJRA 3THXA 5AQMA 2Q6CA 1N8RO 1EKRA 3IC1A 1RT5A 1RT5B 2R8KA 1NMNA 1DTQA 5HMWA 5KT6A 2XLIA 4FF2A 1CQMA 4BDYA 4Y6IA 2FJDB 1WI6A 4WFXA 3T41A 1NJIO 1SH3A 4K8XA 4FJ9A 3PZPA 3KG1A 2CQDA 3KKRA 5TKWA 1VQ7S 4RBTA 3A5NC 2VHGA 1Y3KA 3TQ1A 1S72S 4OLBA 1Q7LB 5IXUA 1F21A 1XHXA 1CC8A 2WAQD 2QYCA 1NGCA 2NRZA 4JOUA 3TR8A 3HD2A 4FKXA 1EIYB 2V94A 2VB6A 4C7QA 3J7AP 5C15A 4ECVA 3N01A 4FVMA 2MXYA 4FYVB 4B1YB 1SH0A 3JQMA 3R6MA 3O9QA 2VYPA 2YJFA 4K8ZA 4J9KA 2L9WA 2RAQA 3HHLA 3PSFA 4HDGA 5GINA 2F7VA 3O4WA 1JK9B 1K8KB 3CDEA 3GOIA 4WZMA 4LR7A 1CXUA 3KWGA 4I67A 1RK8A 3OYCA 3AV9A 1CS4B 2E66A 3S41A 4EFAC 4IH6A 4CEFA 4H4KA 1S1TB 2MZQA 2E9RX 3RMAA 4USMA 2I38A 3NL0A 3DLHA 4A61A 4JV2A 5I3PA 2W7AA 1UVLA 4A62A 1S9GB 3NBPA 4DDFA 5LSOA 1RGVA 4DWIA 3BPSP 3DLRA 4FOIA 4CF1A 1NGFA 1RWUA 5GIOA 3H1VX 2YWEA 4CEDA 4IKFA 4CNYA 3MECB 4GKKF 2IJFA 3GJRB 3AA4A 2DGQA 3U8XA 3CDBA 2BZ2A 4DG1A 2F8TA 4P72A 1LFPA 3ITHA 3OXFA 4WF9L 2ZHBA 5C12A 3CJBA 4ZVSB 3CG7A 1H73A 4K42A 4E3SA 2JWLA 1EWRA 2Q0RA 3UE2A 3AH6A 2VPXB 4Q0BA 4Q7AA 5CR4A 5GVQA 3NNAA 4J2EA 2GIRA 3KLFA 1Q82T 2WOMA 3MTKA 1VC5A 4CLWA 3M2RB 2KG1A 1PYTA 2L48A 3ENWA 4FJ8A 5BPLA 1UCNA 4DTNA 4FJIA 3L8BA 2M52A 2XI2A 3BM7A 5F41A 2GMHA 3PFOA 1Q7YT 3NGTA 4DR6F 1RT1B 4OI2A 4C0OC 3H2LA 2POKA 5IM0B 3I56S 1RWXB 4DR6J 1BO5O 1NPKA 3O6WA 3O8WA 4RU9A 3AXMA 4IOCQ 1BHNA 1WF1A 3B82A 2XY7A 2KU7A 5DDOC 3H2VE 4CK3A 4J37A 3GSDA 4DR5K 4OI6A 2UXDK 4PA1A 1NGJA 4MMOA 4Q2LA 3O3HA 4Y2AA 3MCSA 4BACA 1UPMB 3DNCA 4YR2A 2YKAA 5HO4A 4BRFA 1NK7A 2KN4A 3GCXP 2ZDPA 1W2BM 2R8IA 2J0XA 5CCMA 2IMWP 1QQCA 4YY3K 2BOPA 4MO5A 2DO0A 4L73A 2UUBF 2RKIB 4WPAA 1UZHA 4DL4A 1RAOA 3TANA 4CIGA 4E89A 2VPYB 4NZ0A 2AZ1A 3KNGA 3LP2A 5JVGL 3Q7BA 4DV4F 5FPNA 5AR0A 2W7OA 5T7BA 4CLYA 2VCPA 4HH0A 4V19X 4O5FA 3HXMA 1NU4A 2HYIB 3ZSOA 3MR3A 3HVAA 3EY1A 3MX2A 5U47A 2M88A 3TZWA 4CHNA 3B54A 4JKEA 4M94A 3FLCO 2LCWA 1JIHA 2CQPA 4KB1A 5KFIA 2M4MA 2BJ9A 5A8WB 6FDRA 2DXDA 2QE5A 1RWOB 2CQIA 5IZHA 2UVVA 3J81O 5DM6Q 4BR2A 4BRKA 4EZ9A 3HO1A 5M2UA 3IO1A 3CCUS 1S1XB 1CJVA 3HOSA 2PO4A 3UNYA 4DR2F 3KIOA 1IBLK 4IH5A 1VAZA 1G3OA 5J1EA 1N6QB 4FZYA 4NLGA 1VQ7N 3NVKA 2CPEA 2O8FB 4NLWA 4K0KK 2BTFA 1IO2A 2G1DA 4ZA1A 2XMUA 3QFUA 4B17A 2ZM6K 3IAYA 1BQMB 1X9SA 5DZ6A 4C3KA 3Q2TC 3O1BA 4NXMJ 3JXOA 1SL1A 1CZ9A 5JVGQ 1B92A 1HNIA 1SXLA 4NLSA 2DGOA 1XMOJ 3DLLL 3KTQA 3CWJA 3JSMA 4NLVA 2EC0A 1VR6A 4CEQA 5J2MB 2FZKB 3VEOA 4CZLA 2KT2A 3G6XA 4DUYK 4ER8A 4NOHA 1R43A 3MUMP 5D3GB 3UQSA 4IH7A 2XQCA 1HYZA 2WFBA 4J9UE 1FNMA 1KR4A 4QOTA 2J6TA 4FPIA 4CQ1A 1KVIA 4F4YA 4ZTFA 4CESA 1B70B 1IG8A 3M6UA 4BHQA 1RCOB 1NHUA 5J2QB 1VQ9S 1QM9A 4MYUA 3CJ3A 4J7CA 5D4LA 1RFQA 2A5XA 1OQ6A 4FP9A 1R89A 2GVZB 1WHWA 2X3DA 1WSFA 5KFJA 4CJ5A 1RISA 4JI0J 5HI7A 4LF1A 2JDJA 3MR5A 4OHZA 2AMCB 2QSWA 1NK0A 3NF8A 1NPPA 3WC0A 2WB4A 4W5NA 3SFGA 4CJVA 3IAM9 3H90A 3MM6B 4E7HA 2Z2LA 1S1VA 3NHGA 1JQGA 3ULEB 1DARA 2MZSA 2I0XA 1H7XA 2CPYA 1SS6A 2NUHA 2XY5A 3TARA 1ZBLA 4NXNK 3OW2R 5F1XA 4DSFA 4KB0A 1I1GA 4FLUA 2IC3B 3DXKA 1DGKN 4K5RA 4QIFA 4NMXA 3W2VA 2ZNZA 4AL6A 5AQVA 2Q3SA 1C0TB 3T1HK 3GCWP 1BIZA 4F4KA 3MR6A 4DV1J 4JKFA 1TKZA 2P9LB 1JLGA 3U4LA 4LVOP 1CBKA 5HP1B 1RUSA 3UKUB 2PYLA 4ILRA 2ALYB 4EU0A 3H59A 4IO1A 4HUFA 3EDRB 2F8SA 2U2FA 3MX5A 4W92B 2W4PA 3VEWA 5EX3A 5KTQA 3PUFA 4J91A 1P8GA 2OTJN 4DZDA 4BR9A 3IRWP 2X51A 4JAXA 4MK9A 1MU2A 3LPEA 4FLTA 1XNRF 4OZNA 3P38A 4GV9A 1RILA 1B0VA 1IKVB 3MMJA 1VK8A 2B4VA 4PKGA 1JLFA 1V3ZA 2ZHOA 3CJQA 5G0RB 1W26A 1RT2A 1QE1B 4JI7F 4DV4K 3AAWB 5AXLA 2O1PA 3R27A 1KHVA 4MLHA 1X9MA 1ATRA 4O23A 2ASPA 2D1KA 5IT9U 4ED8A 1VHXA 2DGVA 4DQSA 4OLAA 2HVEA 4O44B 5KT4A 3M1VB 2YKOA 3GYXB 3HSZA 3DGPA 4DCOB 3TP2A 1MMDA 4DV2K 4E1JA 2VG6B 3THYB 3TEHB 4YY3F 1TQLA 3VAJA 3BR9A 1FRLA 2YNGA 4ZJOA 2J0WA 3HI9A 3CD6S 1NUEA 4UTGA 3K5MA 5A8KA 3CJRA 2QA4S 3MZIA 2EBEA 1IBMF 3LAMA 2WB1D 5E84A 1HNZF 4L8RB 4FN5A 2HS4A 1Y0HA 3L09A 3TAMA 4B3TF 2EWHA 5LXYA 3JAMY 3CCZA 3LA0A 3IXQA 3CQXA 1IKYB 1DQ8A 1PJ5A 3Q24A 2Q0UA 3L7UA 2IVOA 1UJ5A 2YNIA 1YKWA 3Q23A 3KLIB 1RTJA 4QR2A 3PW7A 2J6SA 2HHWA 3DKDA 3P5BP 1X0PA 1WC3A 3L3UA 1MA9B 1AB8A 1NLKL 3J7YU 2D3UA 4ZCKA 2DHXA 1XMBA 1P9QC 4RCHA 2YHXA 4FBUA 2VQEF 4O3RA 3I0RB 3CIZA 3W63A 2HHHK 4ZS6A 2PGCA 3G6ES 1M1KT 4KPYA 3HHDA 4BWJA 4E2FB 3G96A 1SKSA 4P2MA 3M8ZA 3JTPA 1YITS 2X78A 3SMSA 1Y5NB 2ILYA 1LWCA 4CTAA 1J5EF 3E51A 3EX7B 4KHMA 5AQUA 2XMTA 4OGEA 1SC6A 2B7BB 1WBDA 4DUYJ 1N36F 3ZX3A 4RW6B 3US5A 1UWBB 3SK3A 1PBAA 5HAOA 1W97L 1PO6A 3OL8A 4RKUC 1JCEA 3CJKA 2BR0A 2VONA 5KFZA 4J2AA 3D3CJ 3W1YC 3LTOA 4HHHA 1YJRA 4Y1CA 2CG4A 2UUCK 1OKJA 4O8UA 4YUDA 4DR5J 4XAKA 2Z0GA 3ASMA 2A0FB 2H48B 2UUTA 4NLDA 1TUWA 3NF6A 1YXQA 2QA1A 2KYZA 2GV9A 4CF8A 4LSLB 3ONQA 3MWTA 4IFYA 3KHYA 3LZIA 4HTUA 4OHXA 2FYXA 1YF5L 4RNHA 3R1LA 1HWKA 4Y28C 2Z58B 1YZ6A 2CPHA 1RDUA 3NVMA 1VBKA 5FLXO 3ZNJ1 2ZM6F 4KAZA 2XB2D 3D2EA 1LNQA 4QW8A 2ZUAA 4OX9J 1S57A 4M3WA 4DL5A 2ROGA 3AA9A 3IBWA 4LFCF 1EHWA 3NKYA 2W4DA 4NXNJ 1T9TA 3RWUA 3RSEA 4BDZA 4J9SA 4JI3J 1VHIA 2JFKA 2KDOA 4DF8A 4YB7A 1DFDA 3I5BA 4CLFA 5LSRA 2H51B 2GGPA 3P45B 2LECA 3CJCA 1C4AA 2WTFA 2P9PB 5CZ2A 3GIIA 4U8YA 3RU0A 2OZMA 4L6V3 2VWBA 2JL9A 2WUSA 2CGLA 4DQQA 2K1RB 4K5SA 4F9OA 3N4QA 4YOVA 1DTTB 2UZAA 2QW9A 2FGOA 1QVFM 4CT8A 3CW2C 3LP0A 1ZA2B 4ECUA 4A8OA 1JJHA 3QZ7A 5KFPA 1QAJA 2O8CA 2KL8A 2HFNA 2FSJA 1HKAA 1T0TV 1FVSA 1MWKA 4EAHD 3R5BA 4I64A 2MZJA 3AHPA 5GAGI 1BY9A 1U2CA 4PQAA 3U3GA 4A8QA 2VIHA 4DV6J 4FW2A 3K5LA 3V5RA 4C23A 2WBRA 4CLZA 1J9AA 2ZC3A 2BABA 3B8HA 2DHSA 3CMAS 1KLNA 1UTAA 1YRTA 2V8GA 3AVAA 2G0CA 4LF4F 2A6AA 3J8AA 3HZEA 2G8IA 3Q8UA 1B0PA 1WSIA 4CEBA 2UU9K 2KQ2A 3MCMA 1SI9A 3A8KA 2PAVA 2V6AA 5K5MA 4ED6A 1CC7A 2MQLA 3FJ2A 4OKJA 3KLHA 1R0AA 3T9ZA 1T9UA 3ZX0A 3SQOP 4OYBA 3DCAA 3D68A 2YV0X 1BUXA 2DO4A 3U9DA 2ZD1B 1K9MO 4H54A 2NXJA 1JL2A 4MKVA 2IA6A 3ENQA 1NBEB 3ZTOA 1NGDA 1VSIA 3WX8A 3LM9A 2UUAK 3DN9A 1IXKA 4Z4IA 3LAKA 3BF3A 4H0YB 1VQ6S 2BH1A 2GA7A 4WP8A 2QWNA 4DKWA 1WOOA 4RW8A 1URNA 2BYCA 5AQJA 4OX9F 1VQ4N 1T3VA 4KHNA 2YHYA 1HI8A 4ZVGA 2EX3A 3A0IX 4J9LA 4MYTA 4HUGA 3Q8PB 4LFBK 1WELA 1VQ4S 1XJWB 1E3MA 1S9FA 5DS7A 1Q8LA 4KGMA 1WSHA 1T6DA 3A1YG 2CPDA 3M8QB 4EUVA 2V2VA 1JX4A 3I5AA 1TK8A 2FDNA 4Q43A 1CJUB 3L2VA 1PCAA 2IJNA 3ILIA 2YKNA 2NRHA 3OLBA 2CPZA 1GX6A 5M1NA 2LU2A 1SKWA 2HHHF 1FFGB 4C3LA 3C6TA 3QBCA 4BG8A 3QRPA 3D0HE 4AM6A 3FMBA 2YWFA 1JNRB 4KV8A 3QBWA 3QT6A 3D1OA 1JL1A 3ZZPA 1XR7A 2FHKA 3MM7A 5LXRA 2KHOA 4HI2A 3ILOA 3CMEN 2YXLA 4BGBA 2JEJA 4PG6A 1WHXA 1XEZA 1VQ5N 4PY5A 1EP4B 8AT1B 4TY9A 4DFPA 4HTLA 1YDLA 1GOBA 3I96A 3CFRA 3NCQA 4CH0S 2EC2A 2VQEJ 3VAMA 2UUCF 2HLTA 1DT9A 1GMWA 2ZGYA 4UW2A 2EPIA 5F0UA 4OYXA 2F4VJ 5C2GA 2RQKA 3VR1A 2B0GA 5ETQA 4ZPVR 2EFGA 3VF4A 1YVFA 1WHVA 4CYUA 3DRRB 2D74B 2BJ8A 5KT5A 1K9MT 3ZYYX 3AOAA 4ECTA 4DR4K 4GVLA 4DMZA 1IWAA 1N5TA 3VZHA 3H3OB 3PVXA 4FLZA 4OPKA 3M2UA 1YLXA 1A5WA 2VPZB 4B9UA 3EPIA 3D6FB 3K5PA 1NB7A 1RTHB 5HN0A 4K4VA 5EWEA 1FXRA 2BM0A 4CDIA 2C2KB 4U7CA 3ATVA 2O8CB 5ITHA 3ENOA 4FJLA 1IBMJ 1VBXA 4RO0A 1K73T 2Y3YA 1TL7B 2O5DA 3LP0B 3IMQJ 1S0VA 3GQCA 4N41A 2D7SA 1BOTO 3LGMA 2F3JA 4HKQA 1RTZA 3P1GA 2OEJA 2IM0A 2EVZA 2Z8QA 4LF6K 2XZDB 3SFUA 3QJJA 1RI7A 2NSCA 4J9PA 4XEIA 4KIAA 4OYZA 2KYXA 2HWTA 1JJCB 2VICA 3TTCA 1QDUB 4LF9F 2D0AA 2A1RA 3K0JA 2PN6A 2UXBF 3EZUA 4JEPA 5DGAA 2B9XA 5CH7B 3EWGA 4ID1A 2DNQA 4ZVPB 1VK0A 2X74A 1RHQB 3LUYA 4B3MF 3G8QA 2ATQA 4LT6A 3D2WA 2HGNA 3PYGA 3QEVA 1G6BA 2CDRB 2LFVA 4DV6K 1YJTA 4OI3A 4LF9K 5ETKA 4EO6A 3ZTRA 4JV1A 1RT3B 3NCRA 2ZH4A 3WNGA 2RILA 4FNIA 2OI2A 1JLCB 1C1CA 1S5JA 5ETPA 2CPIA 4WYBA 4DFJA 2F7TA 4I6AA 4RNOA 1QVGR 5IS2A 3R8EA 4JRPA 2E2NA 1X3MA 2QK9A 1S6UA 3CFPA 5L1LA 5FIIA 2GMJA 2MZRA 2D3OR 4QS7A 3CJKB 5AXMA 1KNZA 3BGLA 4DU4A 4M41A 2CJBA 3ZSWA 1YBTA 2E1ZA 3HP6A 1R3NA 4PKIA 1OVQA 4MTPA 3T6JA 2N3OA 3UD5A 5L1IA 2BOAA 1VIXA 2VG7B 4J9VA 4FPBA 1NJXA 3C19A 2MSTA 4KTZA 1IKXA 1ZAWA 4M5MA 2E7XA 2JEFA 4A47A 1I6JA 3CERA 1FKAF 4CTAB 1N33J 4CRJA 3TWHA 5M1KA 4DQ8A 3THWA 3H5UA 3BPDA 1GXUA 2KJVA 4FJGA 3QB0A 4KHPJ 3IWLA 3QLHB 2V69A 5B0AA 4C8KA 1PILA 1Z25A 1BUPA 1CJKB 1GMVA 2HGMA 2QN6B 3HKWA 1FTRA 4C98A 4C97A 2AKWB 2NLXA 2BKNA 3GPAA 3F2KA 3GU0A 2J7KA 3OW2M 4IO9Q 4Y3CA 3JYTB 1FX2A 1L3SA 3CCWA 2QTWA 1IBKJ 1FEEA 3VVUA 3NNCA 2YNIB 1OVYA 4OJGA 3HVTA 3MPUB 1VQMN 2HK3A 4OX9K 3MN9A 4FZVA 2PFFB 4YMEA 5L46A 3TRGA 3ZSYA 2WK4A 3H2UB 4ILHA 2B56A 3HVTB 3T1YF 2ZE2A 4RWWA 2CA9A 3O08A 3ZLJA 3PACA 2XRIA 1V5VA 2OTLS 2ITMA 4E7IA 2DHHA 2VUGA 3FZKA 4O3SA 2DFEA 1KBRA 4F2RA 3D5MA 1SQGA 2WHOA 1VQ5S 4KH5A 3IP0A 3T5JA 1FDBA 5KG2A 1HKBA 4ZVQB 2HBKA 3TAGA 3SBMA 1FA0A 3FQKA 1Y11A 1TUYA 4YDXA 3V1RA 3IDHA 4CJKA 1BA1A 3RR8A 3THWB 3THYA 3R1HA 1BWFO 4ECRA 3J80U 3O6QA 3MEGB 5B0GA 1NZ8A 4E8UA 3N9UC 3F41A 1T9VA 3CCEN 3N5BA 3HTVA 3CCQS 1VLOA 3DGPB 3QAEA 5KG7A 4AM7A 1X4CA 3M1VA 1HWIA 4O44A 3K0SA 3VMFB 1YG0A 5C2FA 2VG7A 4U96A 4C9DA 1S0OA 1CVJA 2NYHA 4P6QA 1WHYA 4FJKA 2FLLA 3SUNA 1Q9YA 1S77D 3M8SA 1K47A 3J7AN 2B4UA 1TMJA 4NL5A 2LXFA 4X4TA 5G0RA 1CLQA 3RZAA 5C42B 2K06A 2D5RA 2P8IA 4CEEA 2RHQB 3CHWA 1X60A 4XDDA 1NAQA 5J1NA 3U1NA 3MOJB 5LJ3Y 5D8HB 2DRDA 1ZTTA 4CK1A 4PHTX 1S9EA 2FHOB 3DOMA 3OPKA 3H5YA 1GOCA 4ZHRA 2CGJA 4ERDA 3ZT3A 4JP8A 3TOQA 2PFUA 3KJQB 4ZPCA 2R7WA 1S6PA 2E5JA 2QWQA 3J7YP 2DHAA 1LOTB 1RGIA 3BYRA 3NGZA 4GNIA 3NAHA 4JI2J 2AX0A 2CJQA 3HK2A 4I56A 1BC6A 2B8PA 3CE8A 3O2IA 3IAS9 4LF8J 3UKUA 2DNMA 2B51A 3S9HA 2P9LA 3AVMA 2E2OA 1T6CA 3MXJA 3QRQA 2P1JA 2LEAA 4J9OA 2CJYB 5K9FA 3SCXA 4PR6A 5CZVA 4DBQA 4TU8A 1HHSA 2BQRA 3PO4A 4U7BA 1MNEA 2UUAF 2B5JA 4NCGA 3DXKB 2AEFA 4BRQA 2W42A 1UA1A 4WIIA 3VGLA 1QQOA 4ZVFA 4BE1A 1WAFA 5LMNJ 4JI6K 3W5YA 3I4PA 2OH2A 1SJFA 1L5UA 3FZFA 2X1FA 3KNAA 2E1CA 5D78A 4QWDA 3EN9A 3MM6A 3CXCR 2KHDA 2XS7A 3E01B 1O8BA 5F0WA 3K57A 1C2PA 1U2VB 4CJ4A 1RTHA 3WQTA 1WSJA 3AA8A 4M95A 4B3TJ 4NCAA 2ZBPA 1H2VZ 4NRUA 1URRA 4M7YA 3M2UB 2W1BA 3IR7B 2YWHA 4CZJA 2HBLA 4DHVA 3OSPA 5LMUK 4PL8A 5M2PA 2YI1A 2Z1JA 1WACA 5J2QA 1FJ7A 3BKTA 1IQZA 3OYBA 2CAJA 5L1KA 3R7BB 5EX0A 4AHSA 1KLMB 3KK3A 2F4FA 3HSCA 2DY1A 3ZSRA 3ISND 2YHAA 4BY9C 1CQNA 1FRHA 1NM2A 1P6TA 3P5TL 2ZWHA 3LP3A 2ZVSA 5D3GA 1N5SA 4DZ6A 2RDJA 1GLAG 4UOHA 2WVDA 3ZT2A 4KO0B 3LWMA 2D3ZA 3AY9A 1YWXA 2K7KA 2ZNYA 1J5OB 4A8YA 1IBMK 1RSCA 4M42A 3D0IE 4FK0A 2MLYA 4GKJJ 3M8WA 1QUPA 2H9ZA 1Q8KA 4Z4CA 3CEDA 5SUHA 5BRDA 3O3FA 2FD2A 3WX4A 4OHYA 3G8SA 1BQMA 2Y9HA 3KHHA 3TAEA 3R9PA 4PG5A 5HMZA 4YHHF 1ZZFA 3QT5A 5EDWA 4DV3J 4H4OB 3CO0P 3C6TB 2FZGB 3EKUA 1DURA 2D1CA 4OKKA 3AO2A 5HVHA 5KFXA 2R7QA 4O3PA 4CCHA 1JLEA 5D4OA 1ATNA 1DLOB 2QL9B 3P83D 4WFAL 2D41A 4MKBA 1N5YB 4K7QA 3M8QA 1KVBA 2I9SA 2P9IB 3KG4A 2HBQB 3HX9A 3FCWA 2G2YA 1KHWA 3SCKE 2LLZA 2GV1A 4JI2F 4J5OA 2N3LA 4NA1A 2KVIA 2UP1A 3BZQA 1TAQA 1MW7A 4AUKA 2H5JB 1QSSA 3CM5A 3SMZA 2XNRA 4XH1A 4EI2A 2YQ1A 4ZDNA 4L75A 1IQTA 1KKHA 3IBFB 2KM8C 2P9SB 4BRIA 2W9CB 2ZD1A 2E5GA 3LP2B 1YJWS 2GJIA 1I3AA 5AQQA 2XLKA 1KD1O 5AQHA 2UV8G 1UOCA 1R6YA 3DRPA 3DM2A 3BF1A 1A6LA 5CA5A 4Y0FA 3LOUA 3WXLA 4N5SA 5BRHA 2N4CA 4FWNA 4NYNA 2WVEA 5E2QA 1NK8A 2BUPA 2ZBCA 3NF7A 1X5PA 3R5DA 4CFCA 1NLVA 1YRUA 5ETSA 4WQ4A 2R7OA 3M6VA 3PYEA 2ZEJA 4EYIB 2CZVC 2O67A 2PMHA 3NGUA 4F3MA 4BQLA 4RJVA 3P8BB 3E66A 1K8AO 2MLZA 1RHKB 3VPZA 2LMIA 4PWUA 4H5TA 4HDHA 2F9JA 4A5AA 4LQ3A 2QRRA 5CYJA 5HRRA 3TAPA 5LL6d 1B4SA 2HBRB 5L9XA 4BDPA 1U49A 4M5NA 3W9HA 2P9GA 4ENOA 5IM0A 3P5JA 1RT1A 2VD3A 2SXLA 3NY0A 2DNPA 2QI2A 1E6YA 1ZBUA 2HHVA 2FY1A 1VQLN 2A2DA 2H5EA 4UUWA 3ZSVA 5HLFB 4M63A 4BR7A 1YJ9N 1YJUA 2FJAB 3GJSB 3KD5E 2V50A 1KONA 3M32A 2CFXA 2BANB 2RVJA 2WOMB 2P9PA 4Q0BB 2B9YA 4BWMA 1KVKA 4QPXA 4LR8A 3IG1A 4DU3A 2ASJA 5GADI 2ZWPA 1HHQA 1VQOS 2Q79A 4ALZA 1ZAVA 2KFYA 1NGIA 2GX9A 1RBVA 4A8SA 1YBUA 4UZCA 2MSSA 1KVAA 4NYFA 4M45A 4JI8K 3MECA 3VGUA 1N5QA 3PCOB 1TTHB 2OSQA 5LY3A 1AZSA 4CJLA 3AVGA 2EI5A 3GE1A 1UETA 2CVIA 3TR5A 1WN7A 1N88A 9ATCB 3T9NA 2FF6A 3LDPA 3QERA 4LSLA 2FF3B 2VFSA 2AZ3A 3E9PA 1ZXOA 3TI0A 1PYOB 3JS6A 4IFVA 2MB0B 1YGYA 2M7SA 5AE1A 3T1HJ 1Q86T 3OYNA 4DR3J 3W8PA 3M8RA 1HI0P 2UUBJ 3EJMA 2LXUA 3CJ8A 4L3NA 2AF6A 2ZITA 3HRGA 1VQKS 1RBAA 1VHFA 1NGBA 2OD6A 3BN7A 3MMVA 2NREA 4MK7A 2OJ3A 2NUBA 1FDNA 4JBCA 4NB4A 4JYAJ 2M8HA 4BR5A 4RW6A 4PXCA 3MMAA 3UW1A 5LMUF 3TSPA 5GADP 3FGVA 4Y65A 2X1GA 3L95X 2MQNA 4B1VA 2BKPA 1FO1A 2QG9B 1WOQA 4LF2A 3MK6A 3G86A 1N8RT 4H0XB 5AQYA 5CYQB 2RT3A 2HNDA 4USUA 2EFPA 1R59O 3RRGA 4HTJA 3CCMS 1QSLA 4N8OA 1RWWB 1Z1ZA 1S99A 1VQ9N 3M8YA 3I82A 1FRMA 1DTQB 1BD6A 3L6QA 1RTJB 5EU7A 4AD6A 4ZPDA 3MFIA 3BKUA 3R2DJ 1DHMA 3JQJA 3THXB 2HQ3A 3GIKA 4AQYK 1WNSA 3D6TB 1FK9B 4ZPWR 1RKIA 1TP7A 4JKCA 1H3DA 3EYZA 4NXNF 3TAMB 2DB1A 2OUGA 4IG3B 3LPUA 2ZWOA 5GMKa 1GAOA 4K0KF 3O3GA 3GYGA 3PRBA 1UEKA 5EOYA 5DG9A 1KOOA 1WC6A 3QEXA 1HR0F 2RU9A 2AX1A 4PEOA 1OY9A 1JLAB 4P71A 4A48A 3GSIA 2DR6A 3O9RA 2FGCA 4K25A 4FXVA 1NDLA 2HAFA 3W5XA 4KJIA 5ETNA 4JI6J 5LMNK 5BXIA 4X2BA 4FLXA 1HPMA 2OEKA 4HCCA 3H0PA 1Y7PA 3CT9A 2GW8A 4B9QA 3MAAA 4DCJB 2IVMA 3OR1B 3W2WA 4JD2A 2L41A 1RHUB 1U45A 4JI5J 3CJTA 1XK8A 3OYKA 1NJIT 1R6VA 2DNOA 4RW7A 1GLEG 4WFYA 3BBFA 2VH7A 2PIIA 2NPIA 3CUNA 1F3VA 2E4LA 1X4BA 2HRUA 1ZZNA 2YNHB 4B3SK 3C3LA 1GX5A 3ZX2A 4GC6A 2E44A 4USWA 2O8EB 2UXBJ 2KKHA 2MJUA 3NNHA 4EK2A 3VF0B 5ETRA 4KBOA 4ZVUB 4DX8H 2E5LK 4X66J 3ZCMA 3W60A 4Y2MA 4H5RA 5DETA 1OY8A 3BYPA 3A8YA 4IOXA 1JLQA 3W3SA 3TSQA 4EEYA 3ELHA 4KTWA 3UR0A 3PEJA 1SJ4P 2WBMA 4LRDA 5C5JA 2YPZA 3VAHA 3M6XA 1HBMB 4DTXA 1ASVA 1C0UA 1Y4ZB 4A2BA 1YJNN 1OH8A 2Z57B 1Y5IB 3UDEA 3CMQA 2DJWA 5KOWA 1T3OA 1VQPN 5C2DA 1REVA 4A8MP 1M5KC 2H65B 4CJPA 5E3AA 1VRTB 1Q5YA 3VEXA 5KFSA 2QLBB 5DQIA 4IZ9A 3BR8A 1R0CB 1WTBA 3Q8VA 4CFDA 1GT8A 1F60B 5AJ3F 3PIOL 2WCXA 2RUSA 3DMJA 3HCXA 3CCLN 4OFZA 2RS8A 1FX4A 2J8AA 5KFHA 3G25A 1W9HA 3M9NB 4HHUA 1ZPWX 1LOUA 1R27B 5KFBA 1EX4A 1X5SA 1RBTA 4MKAA 3BO2A 2R2SA 4F8RA 4FK4A 3J7ZT 4KHRA 2QA4N 4RU2A 3OD2A 3FZBA 4FBTA 4OHWA 2VFRA 2R8JA 2AYEA 1B9FA 1YTUA 4ECXA 1VQKN 3WEEA 2KO1A 1J54A 5CYMB 4DX5A 1ZBIA 4RW9A 4ZP7A 4USKA 3J7YI 1YI2N 3EZ5A 2MQPA 5C7PA 4K4WA 4F0KA 3LDOA 3KUHA 2RN2A 1VSLA 1CXQA 1WDTA 5J2NA 2GVZA 3UO0A 4I7FA 4E0DA 5J2PA 3LZJA 2DNYA 4JI7K 2ZGZA 3VGKA 1JMTA 5IC4B 4R5PB 5CCLA 2CUYA 1WSEA 2NNWA 2D4WA 3FEYB 1FKOA 3NFAA 2R7SA 3OXLA 3CCRN 1EKSA 3IBCB 4DU8A 4UY8T 2O8DB 3L9ZA 3A3OB 3G6EN 4M5LA 2EK1A 4CNZA 1ESVA 4I9QA 4HT7A 1F2HA 4W5TA 3D28A 2XCPA 1X7VA 5GADU 2VBZA 4DR4J 1YJVA 1TVRB 1EAYC 4L72B 4LBHA 4U95A 3FQLA 3CM6A 2LU1A 3IA0A 1C1BB 4PWWA 4LF4J 3FR0A 4KH4A 5H1SV 4JKGB 2GC8A 3MCNA 1RHMB 4ZCMA 3FRZA 3UR3C 1RB0A 1VQYA 2VOPA 3W61A 1JXBA 1WKKA 2YNFB 3PFEA 1XTZA 3BBBA 1IUJA 4LF7J 4ISGA 1TL3A 1TL3B 3D6HB 1VQ6N 1OWXA 2FVCA 5DM6L 5IT4A 2O8FA 1F3FA 4IO9L 4UOGA 2DT9A 3NDKA 2P5GA 1YHQN 1BGXT 4JKGA 2OKQA 3I5CA 2R42A 4QWCA 1CJVB 4P74A 4URSA 3DHWC 5HBMA 3IS9B 3C15B 4KRWA 3TA1A 5KFWA 1S0NA 3KLVA 2KFZA 2F4VF 2EKYA 1SQEA 2L9DA 1T9YA 4YDDB 4PPZA 1U1OA 2V68A 2OIHA 3FSYA 2KW4A 2DFFA 1BA0A 2PI5A 3FEXB 3WXIA 2V2QA 1YVNA 4RNFA 4LREA 1YUWA 4BVPA 4LBPA 3GILA 4OI1A 4OYPA 1FKOB 4NLUA 5ADZA 4Q2MA 4F3OA 4YOXA 1XMQJ 2HWHA 4WK1A 3D1QA 2D9OA 2CKWA 2KKZA 3MXHP 5FROA 2IAJB 2IM1A 4NA2A 4I7FB 3OYFA 3FBEA 1U09A 4ILGB 1M5OC 4AH9A 3JTOA 2UXBK 2B7CB 1UJ6A 1NMDA 2E29A 4YB6A 1D9DA 2QFJA 4BGAA 2LDIA 3AODA 3DRSB 1GLBG 3VAGA 1PC5A 1RXOB 5CYMA 3KYLA 4CO5A 1SJQA 4WKYA 1A5VA 3MEEB 2RUGA 4GMKA 1U1LA 3M2VA 3DLLQ 3CPWR 4ZP9A 5FJ4A 4F04B 3ZZYA 4YOWA 2HHSA 1L3VA 4B3SJ 2ROPA 2UUBK 1N32K 2GEMA 1X5OA 4RUCA 5KFYA 4MQ3A 1D3WA 1H38A 4FM0A 2IIRA 2G0IA 4OJ1A 3RAXA 5KPZA 4CI6A 3VZIA 2F9DA 4LF5K 2FVRA 1S97A 1AXQA 3PYFA 2J5AA 3O4NA 2HPUA 1NO8A 4NLRA 4YR3A 1L3KA 4L3KA 1J27A 2PDAA 1REVB 2F4VK 2QX0A 2QV6A 2AJ4A 4UQGA 5E3QA 1J5EJ 4B3RJ 3UN2A 2WSFC 1GOAA 5AXKA 2EHGA 1RE1B 3G71N 3SBTA 4EO8A 5KFMA 3GL1A 1MDUB 4HLBA 4F0HA 2K2PA 2QLFB 4ZLPA 4CBXA 4FXWA 1JLQB 3C0BA 4DG1B 1H7WA 2BXJA 4ED0A 1GLCG 3W8GA 2EG2A 4DEZA 4OQJA 1ZA1B 3A13A 1I51B 2EKNA 4D3HA 5D0EA 4Q5VA 1X4AA 2H4YB 1HLUA 3PG9A 4R25A 4I6MA 1LW2A 1QAIA 1N36J 3QMLA 3NMAA 4P73A 2XO6A 4XPEA 1AFIA 1SVDA 1HBNB 1MSWD 4V19J 1VSFA 3W9JA 4I0WA 3QO9A 2A6MA 4IOAQ 5F9LA 1IBLJ 5EVZA 1GLLO 2I5JA 1RWPB 4NPOA 4QIEA 2J8SA 4GY2B 2G8UA 2V2KA 4HVJA 2HMPA 2VQFK 4ED4A 2BE9B 3WQUA 2VG5B 7AT1B 3T7ZA 4XH5A 2W24A 1HA1A 2IRYA 3MAAB 3LDLA 2IIHA 4F0MA 1CS4A 4FWKA 4IBNA 2BQUA 2YX6A 3MM9A 5A2QO 1D8YA 4DN9A 2MY8A 4CEZA 1G15A 4CO4A 1N32F 1NH7A 3HD1A 3QATA 2ASDA 2W25A 1RADB 1U47A 3I4HX 1NSPA 4FWQA 1FJEB 1YK9A 4WZQA 1G2EA 2OTJS 4CECA 2B9EA 2C3YA 2IBOA 1OYEA 3HM9A 1FT8A 3S1TA 4JKDA 2Z2MA 1OS5A 1ZC6A 2WSEC 3NGYA 4WXOA 2ZQBA 3SQGB 2HQFA 2VGMA 4CGJA 5C0YA 4DV4J 1UWAA 3WC2A 3ENHA 3CDAA 2XGPA 4E1NA 3KJFB 4MH8A 4I4BA 1SJRA 3IFEA 4DL7A 2NYIA 4CZFA 4IUFA 4BRNA 2F5GA 1K6YA 1C1AA 1N33K 3NMRA 2VDIA 2VKZG 4AHCA 5JVHQ 2OD4A 1N5VA 4DR7F 5AQGA 3VEVA 4QYZK 3GV7B 3CQYA 3R7SB 2R7RA 4DV7K 2HGLA 3QYYA 5HSPA 2FBXA 1MWZA 1VQPS 2HNZB 2IRXA 1F1BB 3KWIA 1U2FA 2HBYB 5KG3A 4WYWA 4RR5A 1SC1B 4AILC 1FWLA 3DAWA 4BRMA 5IOLA 4WE1A 3Q0AA 2ZH5A 3AVNA 4TSXA 5CYQA 1HBOA 4QU7A 4FM1A 3CD0A 4C0BA 1SZ2A 3KLEB 3OS0A 1FFSB 3R8YA 3OQ2A 5GAEI 2AT1B 4TKTA 4KHQA 2AQ4A 5B0CA 2GAGC 5ADXA 3BDPA 3D1HA 4XO0A 4I68A 1U8WA 4LUBA 4JI4J 2BBEA 2CPJA 3OTBA 3CCTA 3FZLA 2HSEB 1DZ5A 2CZ9A 5KG6A 1LCUA 4QIVA 4DV0J 3KKSA 3QEPA 3MMAB 4BG9A 4CLPA 1IBCB 3VQ7A 2ZH1A 4HCBA 4B9VA 4CO3A 3AAPA 3S3OA 3SJJA 2YVSA 2HK2A 3OHBA 1RBRA 3ALYA 4OYOA 4JYAF 3N4PA 3HYFA 3QGPA 4RNMA 1EWQA 3QGIA 3RMCA 4ETZA 1E6VA 4ZP6A 3JXUA 3MN6A 2AWZA 5CZ1A 4NLBA 3CC4S 1HNWK 2Y8WA 1RAHB 4LRCA 2AV5A 4WBFA 2W8KA 1IKWB 4P9SA 3GFYA 4MDBA 1D9AA 4ICLA 2GVDB 4X62J 5H9FJ 3N6LA 3VEYA 2XS2A 3C66A 2O8BB 2MKCA 4Z7YA 1RT4A 4C8ZA 2OP5A 5D6GA 2ZZMA 3CJ0A 1XIQA 4ZVRB 4K4TA 2P9KB 1REGX 4ILJA 3DLEA 4DPYA 4LF6F 3EDQB 1Q79A 3BV8A 2CDQA 3ZFVA 4B3OA 4QZVB 1RAIB 1LWFA 3DI6B 1HWJA 1CZBA 4IXCA 5KFGA 5FRNA 3GMGA 3AJDA 1WF0A 4LF5J 1B99A 5AQKA 3ULHA 4HYKA 2H3GX 3PW4A 3FFKB 3E2EA 2XMJA 3M32B 3QRRA 4PCQA 3RGIA 2QSFA 3HLUA 2DH9A 3OFEA 4AF1A 4MJKA 3HSJA 2BACA 3RRKA 4YHHJ 4KGZB 3GB0A 1XMOF 3FEZA 1VISA 3OS2A 1FXDA 2DHGA 4JKHA 2GELA 3AB2B 5FDLA 5I3UB 5F3TA 3UVJA 1YJ9S 4C8YA 2HAIA 3AD8C 3CSKA 5HQLA 3SUOA 2Q31A 5KQ8A 1GLJO 3DLKA 1H72C 4HEA9 1APSA 3SMPA 4LF7K 2B4PA 4K50A 2C2OB 3FSIA 5RUBA 3L3VA 3N6NA 4WKRA 4DTPA 4P75A 2QJ3A 1NK9A 3G0ZA 1N0VC 5HRNA 5EHHA 2WONA 1R8AA 3HOTA 3A8JA 1AUSL 2X7IA 1FE0A 1ZBHA 4ITSA 3WNEA 4C4WA 1GQEA 5AQPA 1QVGM 1TV6B 3V6DA 3NP5A 4DL6A 1BIUA 3A4TA 3CCJN 2HFSA 3HVWA 3H42A 3W9IA 3AQOA 4CJQA 1ZETA 1NZAA 1C0MA 3UCGA 3LALA 4FLYA 3BSOA 2XC9A 1L3UA 3H5XA 1S10A 3RMBA 1ZBSA 2MHNA 2B3TB 4YR0A 4F3TA 4ECWA 1PG5B 1JJ2R 1HPZB 2WSCC 2GUIA 3GFHA 3O3LA 1NOYA 3WNHA 3MAQA 2B4JA 1NDCA 3RB6A 1BCMA 2QFIA 3AO4A 2P9IA 1VSJA 4JV5F 4GKJF 2V52B 1EB0A 3TJAA 4DCHA 3CTRA 4DU1A 1IM4A 1DLOA 2PE8A 3TA2A 1JLEB 2BRKA 4G1PA 4JI1F 2MHEA 3KJNB 5HATA 4A46A 3D2FA 5ETOA 3EMTA 1VC0A 4OZ0A 2HBZB 3WIVA 1UAXA 1WAJA 2QEXN 5C10A 1UFKA 4YB5A 2ASMA 4B3RK 2CH5A 2MDAA 2F96A 1WC1A 4DTOA 4AHVA 2KVQE 2QL5B 3LP1B 4KRFA 2CJKA 3HSDA 4DTRA 3CFOA 3CD6N 2GFFA 4PPDA 4UY85 2G1HA 2XLJA 4CJ7A 3CC7S 3S8SA 1XNRJ 4NLPA 2HNYB 1TYQB 2MJNA 3IUCA 4JV5J 4OI0A 1VRUA 4JI1K 1MWQA 2FVPA 3C6AA 4B02A 3FBCA 2EG1A 1UMJA 2R7YA 4A8WA 3H4DA 4KFBB 2V2ZA 3UB5A 3V81A 3OFGA 1Q7YO 4QIGA 2Q1NA 3MPDA 3B6BA 5HJXA 3NWRA 2NCKL 3RAMA 5GAHP 2BJEA 4CLLA 5K8PA 4B9TA 3TVKA 2M8DB 3KK3B 4DV1F 4R79A 2ETJA 1FKPA 4PYAA 2MGZA 2ZF5O 5L8RC 4FYWB 1IJJA 2ASOA 3BS9A 3SUQA 5KG4A 1UPPA 4F50A 3G6YA 4HACA 3NLCA 4PG8A 3MD3A 1VI7A 1VDHA 1LEOA 3B6OA 3EZOA 4PZVA 3SV4A 1U1RA 5BR8F 4F2SA 2V4JA 1A0OB 5F8GA 1ZBTA 4IFEA 1U2VA 4DR3K 3E01A 5KFOA 1Q0NA 2MQ8A 4CHPA 1QSYA 2XSJA 2NZ4A 1SV5A 1ROFA 1X3NA 5AZIA 3MCPA 5AZJB 2CQCA 2BJ1A 2PSZA 1U1KA 4NI2A 5M1QA 4A4JA 5AQIA 4NCGB 5HQMA 5BRFA 4DR2K 2PYJA 5DG8A 3VN5A 3TUJC 5B09A 4V19S 4U8VA 2XBPA 5JLFA 4QJVA 2Z56B 2ALZA 2KRRA 4HVZA 4R0EA 4WQ5C 2DD8S 1NOZA 4CGHA 3CD7A 5E3CA 4ZOSA 5A2QU 3R6GB 2DNHA 3O4QA 1HNZK 1Q16B 3GDQA 5C25A 4ANCA 3UNGC 2DR9A 1YZ7A 3BF4A 3HFZB 2HHTA 3SV3A 2U1AA 3DDIA 3CDUA 1HNXF 3UKRB 2BGGA 4UOFA 2WZ1A 2HVDA 1FRJA 1VLYA 3IM9A 4DMNA 2XGQA 3ZC4A 3HPOA 4F7VA 4FYXB 4JI8F 3THVA 3NE6A 2XCAA 4IWVA 4ZHRB 2GS8A 2OAUA 4DR1F 3L3CA 2DCUB 2NR0A 1FE4A 3DOMB 1FXLA 4YHHK 4FPAA 3VQAA 2Y0SD 2NZCA 3B78A 3OXGA 2OANA 2A1BA 1OH5A 5DLGA 4DUYF 5JMNA 3QINA 1NK6A 2O01C 1S6OA 4WFBL 4BLGA 4NYPA 2JWKA 2YPYA 3VTHA 1BQNA 3WXMB 5F8LA 3Q8RB 2DNRA 3AJ2A 3DLGA 3K17A 1JWWA 2D9PA 3B8AX 1KDNA 2WC9A 1XI1A 3GIJA 1R31A 4OYAA 5GAGU 4BC9A 3Q8YA 1YX2A 2P9UA 2RRNA 4H4KC 4FVCA 2E1MC 4NMLA 2G9OA 3VAKA 2XULA 2ZDOA 2HBJA 3L4IA 2P9CA 2E7WA 3KHLA 1SL2A 4N56A 1RDCA 1XNQK 1CJTB 2QMXA 3PIOQ 4B9MA 4CJEA 4IG0B 1FFWB 1R8PA 2N4DA 4DV0K 1KVJA 3DLBA 2QWMA 4K41A 3SAHA 1W2IA 4EP4A 2PT0A 4KKOB 4EZ6A 2KXFA 2J9DA 3CCES 1J53A 3MM5A 3V2UC 2UXDJ 3GIMA 5LSLA 2D0CA 3BGOP 5H9EJ 4CF2A 3PJ9A 1EETB 1F5BA 2CQ0A 3L4BC 5KFDA 4HWIA 3O9SA 2XY6A 1I5OB 3LGNA 2Q43A 2CQ4A 5ETTA 4Z4FA 3FFIB 2XEXA 4KT0C 3PX0A 4H5NA 4JI0F 3HHNB 3MR7A 1JLBA 1ZS6A 4R0JA 3T69A 2QXFA 2W6KA 2E9ZA 3J7ZO 3NGSA 2Y1IA 2IPOB 3K8VA 1CLFA 3M5RA 2W2NP 3VGSA 3NG8A 1CJKA 3GYNA 3C14A 1RDBA 4PL7A 5HRSA 4FJMA 2IOCA 2H4WB 4ELUA 1S0MA 1H6KX 2A3ZA 1F5CA 5KFFA 4F36A 1A7GE 2DGUA 4WU2A 1UAWA 4OGCA 2XSFA 4GV3A 4CZEA 5DK5A 1VQLS 1TMMA 1X4DA 2CQ1A 1UVKA 2NXUA 1NKBA 3D66A 1OPIA 5KGWA 2ZH3A 1VQON 3U3YA 4TU9A 5BR8K 1CULB 1NDPA 2IY5B 3FBBA 2UVWA 1SQFA 4BRGA 3M4XA 5E26A 1TUVA 1Y9OA 4DPWA 4W98A 2MMYA 1V4TA 2YH1A 3ZSZA 3FMWA 1N56A 4MT1A 5MAOA 4NRTA 2LEBA 4RTFD 1RT6B 3PO5A 4DJBA 4QWEA 4LY7A 3TX0A 1HX1A 4UF4A 1MWMA 2BJ3A 1WC5A 1JLCA 1IV0A 3NCIA 2EFOA 3OTOK 1N54B 2D0PA 2UVRA 2RNEA 2CNKB 1HBUA 5HRPA 4MFBA 4A59A 1IM6A 3N28A 1RT6A 1KWMA 3I55N 3SQ4A 3HHKA 4OZ1A 2CPXA 4DL2A 4D3GA 3QWPA 3ZETA 2GWKA 3MWBA 2DGWA 1HW9A 4FXDA 1NJYA 5T41A 3RTVA 1XQSC 5AJ3J 2Z2YB 3IN5A 5A76A 2UXCJ 4G1QA 4CK2A 2UUCJ 4DX6A 3GE9A 5B0DA 2R7TA 5BN9A 2XWXA 4FWPA 2J7UA 1KQKA 4JRQA 4M5DA 3ICLA 1HNZJ 3SEOA 1S1WB 1FJGK 3G10A 4WP3A 1H98A 3TZYA 1M90T 3CCVS 4DV2J 3FZ2A 1TL7A 2BW2A 1QD1A 3CCMN 3VGVA 1CEZA 4OLPA 2NRVA 4Z4HA 2YY3A 5HQ8A 5EY4A 4E7KA 1EX8A 2LYVA 1PGZA 1WUUA 4PUOA 4NWBA 4CZGA 3HZGA 3AO5A 5F8NA 2W9AA 3MN5A 2AU0A 1GXLA 2BM1A 3TZXA 2NSBA 1VBYA 1X9JA 2ASYA 2FC8A 3QBXA 1X31C 2IVFB 2BE7D 4DX7A 2R2UA 1RCHA 3VESA 3DRRA 4CYUB 3FFIA 2ZBIA 4EBDA 4NZ6A 1F9FA 3J7A1 2KHCA 4LF5F 2LQ5A 4MIWA 4EWTA 2PMZD 1IVZA 3V1QA 4X4PA 2IDEA 2G0JA 4YOTA 1JJ2M 2HHPA 2XTJP 4M5HA 3Q7CA 3MM5B 2IDOA 4GRSA 2HURA 2IGIA 4OX6A 3PW2A 1UEUA 4KKOA 1EP4A 4M3RA 4H0VB 2MKYA 2W2QP 3MGJA 4DTJA 2J76E 4KI6A 1KP6A 2F40A 5D4PA 4NA3A 5DQHA 4B08A 4CBWA 4IG0A 3WUHA 2KT3A 1FESA 3T5KA 5KFKA 1VC6A 3CULA 4I2PA 4PQUA 3MI7X 5DQGA 2PZSA 4DFMA 2BJDA 2MKHA 3PNIA 4QW9A 3OL9A 4DTSA 3A8IA 5CHCB 2OMLA 4B3TK 4U7UD 1YJ7A 2JJ4D 2HS3A 2WBNA 3CMES 3OS1A 2V0NA 1X0FA 3W62A 2MKJA 1BQNB 2LQ9A 2F9WA 1VMBA 4IOAL 4CM0A 4G6VB 3PW0A 1XR5A 5GAEP 5AT1B 3B4MA 3OFFA 2RJZA 4FPRA 3QJPA 4OPJA 2P9NA 4J9QA 1YQHA 1GK8A 4PXBA 4DV7J 3I6PA 4H5WA 3UD4P 1JXEA 1EJ7L 2O3DA 2HZCA 1RT7B 1TU0B 3BN4A 3I32A 4DV2F 1P90A 2J9EA 5M1PA 1F6TA 3QFWA 1KVCA 1U6FA 4LFCK 3V6JA 4O5BA 2GBZA 2DGSA 1RWKB 2FUG9 4CZCA 5FLXY 3D0GE 3Q2SC 3K2PA 4EBEA 3OTCA 1IJFB 1WOPA 1GXTA 4Z94A 4I6YA 5IWAF 3CF5L 3GONA 4CJRA 3X3UA 2JC0A 1EO1A 4DV3K 3PYDA 1O0PA 2CQ3A 3SAFA 1R0AB 3HFKA 3KLHB 3GG0A 1YJNS 1OQ3A 3SSRA 1Q8IA 3HT0A 3ZT4A 4TY8A 3TA0A 1W2BR 2GTDA 1OSDA 3HZ6A 1XERA 3EVMA 4KAIA 1C0GA 2GWJA 5KPRA 2R2RA 4GVMA 4FVUA 4O0JA 1UFLA 4B3MK 1N34K 2DPIA 1SC4B 2HEKA 5FRMA 4WP9A 3G4SS 2IHR1 3H1QA 2W40A 3OYHA 1UVJA 4WFAQ 2FSKA 2MTLA 4P10A 4XPCA 2P6SA 5L39A 3G4SN 1OYDA 4YDUA 1XQIA 4X66F 1RTIA 1JKHB 5F9NA 2G4BA 5K8MA 2BMBA 1VQNN 1EXQA 1VSHA 1AFJA 2GZOA 3RR7A 3IRXB 4TQSA 3ZZZA 3CIMA 5AE2A 1Y10A 3NH1A 3V9XA 4ECYA 5KOXA 4OMFG 2WTUA 1HD0A 1WB9A 4MO4A 2V8DA 4E19A 2K1RA 1RQ0A 2P5OA 4M3ZA 4MKYA 1KTVA 3C7NA 4FF4A 1RA7A 3CCSN 3KLGA 2DRBA 1S1UB 2I2YA 5HANA 5HMXA 1S49A 3M8PB 4IDKB 3U9ZA 2H1YA 1NKEA 5CD4A 3QESA 4OZJA 1ZPVA 1I39A 2AP6A 5E0OA 3OYMA 3RSEB 3G87A 4ATNA 3TUZC 1TL1B 1F9HA 3Q8QB 1F9EB 1SC3B 2YWKA 1NPRA 4ED3A 4RW4B 4GW6A 3EE9A 4KY3A 3D2EB 3C95A 2Y1RI 1NCLA 4FWLA 4DR1J 4GV6A 3AAQA 9RUBA 3PEHA 3GV5B 1RACB 1R8CA 3MOZA 1XUPO 1J5EK 4ANEA 4FO0A 1NRKA 3QGGA 3RJMB 3DOKB 5I9EB 1VRUB 2JOQA 3GJTB 3AGRA 1TYQA 1YRXA 3R3TA 2AGOA 4AQYJ 3DFEA 4LF6J 2E6MA 2XMWA 2AGPA 4W5RA 2A42A 4IOBA 3OR2A 5EX5A 2YWGA 1WEXA 3F5TA 2WVBA 2KFNA 2KJWA 4HL9A 4FF3A 3BZKA 1T11A 1HR0K 1KAZA 3H5SA 1LK5A 4A8FA 5BR8J 4LFBJ 2FPHX 1MROB 5T7LA 3A5OC 3DLJA 2CH6A 2O4IA 2XZTB 2B8QA 4CBUA 3SDEA 4OZ5A 3MEDB 2LP4A 3QETA 3VF6A 3SQ1A 4O4GA 2W2OP 3DWLA 2JX2A 3EPGA 3VTIA 2QGFB 3WT0A 5MLCV 3MUVP 6AT1B 4DV7F 1LWCB 4GKKK 1FRXA 1MN9A 1DBDA 2YH0A 4QYRA 3P49B 1T05B 2KZZA 4DTMA 4UQTA 4CHZA 5EUHA 3W3DA 4CZKA 3W66A 2GAHC 4CJUA 5F2RA 4KE5A 4DPOA 2VFTA 2G2ZA 2DIUA 3I0RA 1HYVA 1NXIA 4KTQA 2Z1HA 3WXKA 4PAAA 4C6AA 3ZO7A 3G82A 4PRFA 4CFAA 1PAUB 1DKGD 3VQ5A 3KVGA 3NXZA 1RZMA 3BB5A 2P6TA 3V4IB 2HHUA 3SLCA 1TV6A 2ZKUA 1FNXH 4ZLNA 2HZAA 4OPAA 4NLOA 2BE2A 5EN1A 2JFDA 1WI8A 5IQQA 3EE8A 1IKYA 1HWLA 4H0OA 3M6GA 2VQFF 4CEOA 4JI3F 4Z2XA 3V6KA 1XNQF 2FLPA 2FJXA 2Z2ZA 1BE4A 1HJOA 3KJVB 3A8EA 3OVSA 4KHPK 2KXNB 2AEMA 3M30B 4CFBA 1XWLA 3DLKB 4DV3F 3V9ZA 4BE2A 1GLFO 1WUAA 1WEZA 2AEJA 3EZWA 4QYZJ 3H25A 5A2QY 2CNLB 2W2PP 4NLCA 5IC6B 2AGQA 1FJGJ 3UN3A 4X64F 2H5IB 3NRBA 1A5XA 1DQAA 1GMWD 4Y2KA 2FVQA 1NU0A 5B7WA 4CP5A 5AQRA 2YNGB 5BPNA 3O5BA 5AQFA 1BI4A 2GX8A 2VC1A 3ISZA 2QA4G 1BISA 1NK4A 2VG6A 4W4MA 4KHSA 3VGMA 2C1EB 1Q95G 5EWFA 3ZNUA 1HD1A 4FNHA 4P7TA 4K8RA 3EEQA 3QIPB 5BN8A 2DY9A 4GKJK 2OLWA 1EARA 4WWSA 5JJBA 3ETMA 5KFUA 4TU7A 3G9CA 2UYTA 5LL6Z 3CCLS 2WW4A 2FC0A 1ZH5A 5K8NA 1PAEX 4CHOA 1SKRA 1QE1A 1RT2B 1LWFB 2C2MB 2UUAJ 5D77A 2ZJQL 2XHCA 5DG7A 4WTOB 4CGGA 3DLEB 5AQTA 3HMJG 2C2EA 3UN5A 1R0BG 4JKAA 4BREA 4GO5X 3VQ8A 3CO9A 5FPEA 4P2SA 5ADXH 3MFHA 3VVTA 1RT4B 4C1NK 2MQMA 3WIUA 1MU2B 2O8BA 2RF2B 1P27B 3CCSS 3PR5B 2Q2RA 1R7IA 4P2FA 2D0OA 1PC4A 2ILZA 4LIRA 5KFAA 1YSJA 4QQBA 3IR5B 2E5LF 1A9NB 1GTEA 2B6AB 3H8YA 1E6VB 3CCRS 4IYQA 2ATCB 3G6VA 2VFVA 4WFNL 5KG1A 1JLGB 4J90A 1ICEB 5KFNA 3ADAC 4DR3F 1O5JA 2MKKA 4WIQA 3MTJA 4KREA 4FW1A 1T9WA 2V5HG 4QWAA 3W2VB 1S59A 4O3QA 3OUYB 1Q82O 2M0GB 2O4GA 4WFBQ 3T1YK 5F0XA 5E3PA 3HHEA 3EM1A 5C2CA 3ATUA 4Z4GA 4KI4A 2PEHA 1TKTB 1W0HA 4DR6K 1V9OA