1S9EA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 142
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s9eA05
2IM1A 4DLGA 2G8HA 1HQUA 3I0RB 3PJXA 3QINA 4U7CA 2XY8A 4KFBB 4WZQA 4GW6A 4TYBA 4AH9A 1VRUA 2Z1JA 1XR7A 1UWBA 5KG3A 4HKQA 5F8MA 2D0CA 5KFNA 3HVAA 2V9WA 1TKDA 3LP0B 3DLKB 4DF4A 3BGRB 3BREA 2JC0A 1A5WA 5J1EB 3KLGB 4YMEA 1JKHB 5C42A 2GIQA 2VG5B 3CDWA 3IRXA 4MKAA 3U3YA 5L9XA 3QERA 3NGYA 4TXSA 1NKEA 1NJYA 4QWCA 3SQ2A 5FDLA 1S1VB 4RNOA 1RDDA 3TAFA 4R8UB 4ZP8A 4ECWA 4JV1A 2X74A 1RAJA 2R2UA 3HVTB 2VA2A 1SV5B 4RW8A 1LWCA 3LAKA 4DFPA 4I9LA 3ITHB 4CJWA 4TY9A 4CE9A 3HPOA 1IKWB 4URQU 3OHBA 4ED6A 1YVFA 3OYGA 5KFJA 2IC3A 3IG1A 5HROB 3Q8PB 2JEFA 4IFYA 1DTTB 1C0TA 3BQ2A 4FLXA 4N5SA 1C1BA 4NLGA 4CF8A 3AO5A 2IM2A 3K59A 2HHTA 4CHOA 1ZBFA 1S1XA 4Y2AA 4H4MB 4O4RA 3KK1A 3PHEA 1QS4A 1TK8A 3T19A 3TVKA 1RBVA 3MAQA 1JLFA 4PUOA 4DQSA 4HCBA 5L1KA 2Y1JA 1FK9B 3QLHA 1LWEB 2D3ZA 3SV3A 4DTOA 3MFIA 3CDEA 4NLXA 3QZ8A 1W0HA 4TY8B 4E7LA 4DTJA 4K8XA 1RT5A 1J9AA 3CM5A 1BISA 3SCXA 4MIBA 2FLLA 1I39A 3RR8A 4DQIA 3S3MA 2HNYB 4FLZA 4FCYA 3KMSA 4URSA 2ZQBA 3AO1A 1UWBB 4CFDA 5DG9A 4BACA 3RMAA 2WK4A 4ECSA 4IG0A 5JS2A 2C2EA 4EP5A 4XO0A 4C8MA 1RT2A 2HHWA 2KFNA 1KRPA 4YFUA 3K5NA 4NYZA 5KFYA 4CHNA 3IRXB 3C6TA 2BQUA 2ZD1B 3C94A 2GUIA 4B9SA 3NAIA 2PYJA 3PVXA 1RT3A 1XC9A 3NKYA 3VQ7A 4DSIA 3Q8QB 1TKXA 1KSPA 4CIFA 5FDLB 4MFBA 4DU3A 3K5OA 3SI8A 1IKXA 3NF6A 4RW6A 2KZMA 2FVSA 5KT2A 2ASDA 1CXQA 4Q0BB 1RCHA 1LAWA 1B9DA 1IG9A 3VQEA 4ID1A 2YV0X 4JLHA 1RTJA 4RW8B 1LWCB 3BDPA 1JX4A 1HRHA 2B5JA 5CZ2A 3K5LA 4DTSA 4ZTJA 2Z1IA 4B9MA 4ZVGA 3DI6A 3KTQA 4ED0A 2IC3B 4IFYB 3PJWA 4AHVA 3SFGA 4MK9A 4Q5VA 1SKSA 4O4GA 4JRQA 1KVCA 3LPUA 2HHQA 1JLBA 4MKBA 1VSDA 1S1XB 4C8KA 2X6NA 3KK1B 4DSEA 4H4OA 1HNVB 5DQGA 2YNGB 3MFHA 1SH2A 3EY1A 1JLFB 5KG6A 1IKVA 3ZSVA 3QLHB 1RT6A 3M8SA 1WSHA 4C8LA 4ZP6A 3AO3A 4IRCA 4J9NA 4G1QA 2BQRA 1Q8IA 2BGGA 3HHKA 3KNAA 3N6LA 4YNQA 1TK5A 3DLBA 4KHRA 3RR7A 2O4IA 4KE5A 3HM9A 5J2NA 5E41A 2OPRA 3T3FA 2R8KA 2Y1IA 1YTUA 3V6DB 3PX6A 3EZUA 1TV6A 1VSFA 3E51A 4NLUA 1O1WA 3QYYA 3L2RA 4DL7A 2RKIB 4HYKA 5CYMA 3ICLA 3HXMA 1SUQA 4DSFA 2ETJA 3FFIA 2BRKA 3H5UA 3K57A 2G8UA 1N56A 4FBTA 3C6TB 4KKOA 1NKBA 2ZE2B 2BRLA 2B6AA 4ECYA 1WN7A 1NK9A 4M45A 1DTQB 2IAJA 1RT3B 1QTMA 2WCXA 1D9FA 1TKXB 4MFBB 2AGOA 1T7PA 4KREA 3PUFA 4ZTFA 3CVKA 3V81B 1ZBIA 3AVJA 4Y3CA 3F73A 3NCIA 3M8PA 1TKZA 4N76A 4Q43A 3K2PA 5HRNA 2QV6A 2UUWA 4K50A 3QEXA 1RTJB 4B8CA 1S1WA 1N6QA 2R8GA 1QQCA 2B5JB 2G8IA 5KFTA 4H8KA 1C1AA 4B3OA 4E3SA 4WFYA 3CIZA 2BDPA 4BDPA 3NGIA 3D45A 2LSNA 3DRPB 3ZT1A 4O4GB 5FRMA 1KLMA 4CGIA 2P5OA 4H4OB 1QAJA 1T03A 1X9SA 4GC6A 2IDOA 4M3TA 3VQAA 4R5PA 2OPQB 3HVWA 1REVA 1HYVA 3MF5A 3Q8SB 1MMLA 4ZVEA 4LY7A 4M3WA 4FLWA 2AGQA 1K1QA 2UUTA 4I2QA 2W9BA 3VQQA 4TSXA 2W9CA 2E4LA 4J2BA 4KB0A 1RNHA 3HT3A 2HHSA 3TAEA 4ED3A 4ID5B 3NH0A 2FBTA 2WOMB 3I5AA 1HMVB 1SH3A 1TV6B 1LW0B 3GIIA 4LSLB 4FJ9A 3C95A 1ZBUA 4DQRA 3LAMA 4LD0A 2EC0A 1L5UA 1S1UA 4NZ0A 3NF8A 4FJIA 2WONA 4K4ZA 1L3TA 1RTIA 4ECQA 4PWDA 4NCGA 4URGA 1D8YA 3CJ5A 3BJYA 4KKOB 4NLYA 2IA6A 2B6AB 4KV8A 2IAJB 2EX3A 3LP1A 4BWJA 1LWFA 3DRRA 5EU7A 1RT1A 3UIQA 2XY7A 3ISND 2BANB 4RW4A 4IH5A 1VSJA 2IOCA 3HP6A 1TKZB 4DLEA 3GV8B 4CEAA 4ELVA 2VG7A 2OPPA 3OYKA 1S1WB 1N6QB 3I0RA 2C28A 2W42A 3RMDA 1RYRA 5C24A 4HUFA 4B3OB 2GBZA 4FM0A 1VSKA 1S49A 4CJPA 2UVWA 3WNFA 1EETA 3SUPA 3QGHA 3QEPA 3DLKA 3BGRA 4F4XA 4F2RA 1UOCA 2ASJA 1KLMB 4O3NA 1TQLA 3DRSB 5J1EA 1RYSA 3KLGA 2AJQA 1T03B 2QE5A 3P5JA 1WSGA 3ZT0A 1S48A 4R5PB 3OLBA 4TLRA 3DMJA 4IG3A 3O3HA 4IKAA 3N6MA 4NLOA 2Z1GA 3KLHA 1RT7B 4ELTA 3GQCA 1S1VA 3AVFA 4I2QB 1I3AA 5KT7A 2W9CB 3ZSRA 3KHRA 4R8UA 4MQ3A 4QWDA 4B9LA 4KHQA 5SZTA 2ATQA 2DTUA 3HVTA 3QIPB 5KT5A 1VSLA 5F8NA 5KFEA 5EWGA 3KLIA 5I3UA 3ITHA 5F8JA 3NMAA 1IKWA 4K4TA 1TGOA 4W5NA 4F8RA 1RT4A 4FJ7A 5HROA 3TI0A 1DTTA 5KG7A 1BL3A 2I1RA 1RTIB 4MK8A 4PWDB 2ALZA 4B9VA 3RBEA 1LW2A 2ILZA 4E19A 4ZVHA 1R0AA 3MR6A 1LWFB 4I7FA 3DRRB 4CIGA 3TAMB 2DFEA 1RT1B 4YR2A 1FK9A 4AHSA 2QXFA 4RW4B 1D1UA 2AWZA 3GIKA 3HK2A 4H54A 4M94A 4KTZA 4DL5A 1S9FA 2VG7B 5DQHA 2OPPB 1EX4A 4O3OA 4PA1A 3LALA 3KIOA 3ZSYA 3PW7A 5C24B 3CFOA 2AGPA 1C2PA 3HPGA 3UR0A 2HNYA 3UQSA 5KFDA 4G3IA 4CEZA 4FLVA 3PR4A 1EETB 3OL7A 4QAGA 1YT3A 5HP1A 2W7OA 3IAYA 2J6UA 4AILC 4WZMA 1F21A 4J2DA 2IJNA 3L2VA 4FJGA 2WHOA 4TQSA 4NLSA 3DMJB 3G6XA 1RTDB 4IG3B 2ZD1A 3RB3A 4ED8A 2XI2A 3NH2A 3KLHB 4B8AB 1BQMB 3L2QA 3VQPA 4IH6A 3OYLA 4JS4A 1Z25A 3BQ1A 2FVRA 4CERA 3MEDA 3V6KA 4EBEA 4FM1A 1HNIB 4ZPCA 4E7IA 2PY5A 1NK8A 3MECA 2X6SA 4FS1A 4Q0BA 2YHBA 1U47A 3KLIB 4DTXA 5KFFA 2OH2A 4QWAA 5I3UB 4HHTA 4ZHRA 4E1MA 1WAFA 1BCOA 1RT4B 2ZKUA 1T3NA 3LZJA 3ISNC 1EP4A 4FLTA 5KFWA 1A5VA 3LANA 2AX1A 4OVLA 5KFXA 2FJWA 3VA0A 5J2QA 3Q8RB 5EWEA 1HNVA 1QUVA 3VQCA 1LW2B 4DMNA 2YNGA 1R0AB 4F4KA 5KFGA 4I7FB 2J6SA 2HB5A 2HW3A 1XR6A 1L3VA 4ZVFA 4CJUA 3NF7A 1B92A 4CCHA 4RZRA 3VQDA 4HUEA 4CECA 4CFBA 4UQGA 3MXIA 3QNOA 3HSTB 4GC7A 4DL6A 1ASWA 2B43A 4FBUA 3H5YA 4M3ZA 2F8TA 3V6DA 4KB7A 1WNEA 3AVMA 4B08A 4HTUA 1DLOA 4KAZA 1U48A 2RKIA 4CK2A 2FBYA 4HVJA 3LZIA 5HP1B 4K4YA 4K8ZA 4MK7A 3QGGA 5KFUA 4DSKA 1JLCA 4K4XA 5L1LA 3M9MB 3OYMA 4ECZA 2JEGA 1RBRA 4CIEA 1JLAB 2ZE2A 1XHXA 1DTQA 1T94A 1HARA 4Y2CA 1RDAA 2KW4A 1JLEA 3T5HA 1EXQA 2WRMA 3MEDB 3V81A 3O4NA 3DOKB 2E9ZA 2IM3A 2BE2A 1JL2A 2C2DA 3MECB 3L2UA 3T1AA 4ED7A 4NLRA 2HWIA 2EHGA 4CJSA 2JLEA 1IKYA 3CQ8A 4XIUA 1CSJA 4ZHRB 2D0BA 3PW5A 2DFFA 3I0SB 3TR8A 4I9QA 3PO4A 1EP4B 3L2WA 3MXJA 3DRPA 4CK1A 3OL6A 3FRZA 5DMRA 3QESA 3AA5X 5J2QB 2QKBA 3PW0A 4EP4A 3C6UA 4CK3A 5T14A 3LP3A 4O3QA 3KD5E 2OPQA 2W8LA 2R2TA 3U3GA 1T05A 3HP9A 3NGDA 3PX0A 5F8LA 4DL3A 4CJTA 1J5OB 2NUBA 2P1JA 4F4YA 3BSAA 4XPCA 3H98A 2Q3SA 4O3RA 3MR3A 3AVNA 3QGIA 1U45A 4AHCA 3QEIA 3OS1A 4Z4IA 4RG8A 3M9OB 2ILYA 4ID5A 5KFIA 2E9RX 2D0AA 3RAQA 2WOMA 1WSFA 1VRTB 3RB4A 1HMVA 4RUAA 5KGWA 4FYDA 1LW0A 2ATLA 1DLOB 4KPYA 5KT3A 4LSLA 2G8WA 1XI1A 5KFMA 1IH7A 4W5OA 1RBSA 1SL1A 1S0MA 1JLCB 4Z4GA 2YHAA 3E01A 2XCPA 4CEBA 4FJXA 4CHYA 2HNDA 1UAXA 1BIZA 5KFCA 3B6OA 2E6MA 4LSNB 1U04A 4OGEA 1JLEB 2CJQA 2BANA 1JXLA 3QEVA 1L3SA 3I8DA 4E0DA 2BE2B 4NRUA 5KG2A 4W5RA 4RW9A 1JLQB 1Y97A 2OA8A 3EYZA 1NK4A 5KFVA 4CJKA 4AHRA 3V9UA 2DPJA 4FZXC 5C5JA 1IKYB 3PW4A 1BHLA 2YNFA 4WYWA 4JRPA 4NLQA 3S3OA 4C8OA 1RILA 1UA1A 1NJZA 3TANA 4RNNA 3QETA 4FXDA 2RDIA 4J9RA 3RB0A 3S3NA 3N6NA 2FBVA 2RPIA 2O5DA 4KTWA 1RBUA 4J9LA 3DRSA 4CGDA 1ZYQA 2OZSA 4ED1A 3OYCA 3C6UB 1HQEB 3V4IB 3SUNA 3IGVA 3NAEA 4CESA 4ZPBA 1T05B 4O3SA 1KVBA 3BQ0A 3P83D 4QW8A 3BSCA 1RT7A 1S9GB 4DL2A 4NLVA 3K5MA 3DOLA 1VSIA 2R2RA 1VSMA 4B9NA 3CYMA 3OL9A 1B9FA 4EZ6A 3LP2B 4ZP7A 4GVMA 4Y1DA 5KTQA 4HCCA 1IM4A 3QIPA 3SUOA 3IGNA 2X78A 4M41A 4B9UA 4IR9A 1SL2A 4NLDA 1BI4A 4PQUA 3AO4A 3V1OA 3AV9A 1ASVA 3K58A 1C1CB 4TN2A 4IKFA 1TAQA 1ZETA 4DFMA 3H4DA 4WFZA 4NYFA 3RBDA 3G0ZA 3E01B 2HHUA 4O44A 3RAXA 3F9KA 1U4BA 1N5YA 4DU1A 2HNDB 4ICLA 3G6VA 1JIHA 1D5AA 3NDKA 3EZ5A 5DLFA 2IMWP 3G6YA 1EKEA 4KHNA 3TAMA 4CGHA 3OS2A 1RBTA 5KRSA 3CJ0A 2KTQA 3QIOA 3V9XA 2A1RA 4J2EA 4DS5A 4E7JA 2FLNA 3KD1E 4RW9B 3QNNA 4RU9A 3GV7B 4DTUA 1KFSA 2IBKA 4JUZA 3LWLA 1Z4UA 3BR9A 2P5GA 2OYQA 4J2AA 2GV9A 4O0IA 2YNFB 4CFCA 2W8KA 3SYZA 2YNIB 3H5SA 1KFDA 4B9TA 3KLFA 2D3UA 3SJJA 1WSEA 4LQ3A 1UA0A 3KJVB 4M95A 3HL8A 1HYSB 1TL3A 1FKPA 3LPTA 1HYZA 4DFJA 3RRHA 2PZSA 1XHZA 4CJ5A 2XCAA 1C6VA 1ZTWA 3H59A 3ZT2A 1J54A 4F4WA 3V6HA 2UVUA 3HYFA 1VSEA 5DK5A 3FDSA 1RTDA 4DG1B 3T5LA 3OYDA 4FJ8A 3V1RA 4OPJA 4E7KA 1QE1B 1BQMA 3PX4A 5FROA 3WNHA 4DTNA 3LWMA 3DOLB 1W25A 4ECTA 1ZBLA 1XR5A 4IBNA 3OSNA 4ECVA 4TQRA 1GOCA 4I2PB 4YQWA 1HNIA 1TVRB 3DLGB 4KHMA 1S9EB 4KO0B 4IRKA 3KMQA 1D0EA 4OLAA 3AVHA 5JXSA 2I5JB 5JUMA 2HWHA 3OYBA 1BI4B 1MU2B 1D9DA 4PQUB 4QWBA 3TAQA 3OYIA 4CHPA 3H40A 4M3UA 4IDKB 3SNNA 1FXXA 4ED2A 2F96A 4E7HA 1VK0A 4BDZA 3HVRA 3H08A 4CJEA 4K4WA 2XY5A 2IGIA 2YKNB 4NCAA 4EZ9A 4O44B 5KFAA 2F8SA 1N5YB 3EPGA 3KHLA 4KHYA 2GIRA 4ICLB 3GV5B 5KG0A 4OLBA 3MEEB 1NK6A 3PZPA 1NNDA 1JXBA 4WE1A 3NH1A 3I5BA 4CHZA 5I42A 5DG8A 4CF9A 4CHQA 4Y34A 4W5TA 4FJMA 2HHXA 3NBPA 3NGZA 3AVLA 4F2SA 4FW1A 4K4VA 3ZSOA 1GX6A 3OYNA 4EO6A 1S6QB 2UVVA 4IH7A 2ASLA 2HHVA 1NHUA 3ZT4A 2HAIA 4RW7A 3DDKA 4CEDA 5F8GA 3ULDA 3TABA 1Q9YA 1TP7A 3OSPA 4JS5A 3GIJA 3VQSA 3KLFB 1FKOA 4FW2A 1TL3B 4DQQA 5K14A 1FKPB 4OGCA 3IS9A 4O55A 1TK0A 3AO2A 2E6LA 1RDRA 1ITGA 3TWHA 1GOAA 1JLAA 2RN2A 2AQ4A 3L3VA 4CEFA 3O4QA 1ASUA 4CF1A 3ZSQA 3M8QB 4KSEB 3SUQA 4IFVA 1X9WA 2DFHA 1N48A 2C2RA 5KFKA 4QOZB 3DOKA 2G8FA 4YR0A 2R8IA 2XGQA 1KHWA 3RTVA 3V9ZA 4Z4EA 3QIDA 2HMIB 4DSLA 4EYHB 5C25A 4RNHA 3AA2A 1NK0A 5JS1A 1HPZA 2XWYA 3I0SA 4O0JA 4CJFA 3CDUA 5KFQA 3O3GA 5KFRA 1NJXA 5KFLA 3OL8A 3ZCMA 3U6FA 2FJVA 4OKKA 3T5JA 4J9OA 4GMJB 3V9SA 4KBIA 4ZPAA 4FK0A 1CXUA 2F8EX 1KLNA 4NRTA 4N47A 2HNZA 4FJLA 4EYIB 4WE1B 5J2PB 4FVMA 4EBDA 5I42B 4LQ9A 4K4UA 3OY9A 1SL0A 4M3XA 3HO1A 3ASMA 2AX0A 3GIMA 3NBPB 3KK3A 1J5OA 3VQBA 3SI6A 2OPSA 5KG5A 5F8IA 3VQ6A 4J9SA 4Z4FA 2RF2A 3JSMA 3SPZA 1C0UA 3L8BA 1QSLA 3AVGA 3CWJA 4KI6A 3OLAA 3D5MA 4ECUA 4RW7B 1VRTA 4IR1A 1HJRA 2J6TA 3AA4A 4DTMA 4KHSA 4Q8EA 3H4BA 3DYAA 3PR5B 5L1JA 4F4ZA 1FKOB 4O3PA 4J9MA 1WSIA 1WSJA 4FLYA 4FK4A 2XGPA 5K14B 4CF0A 4LH4A 1S6PA 4CFAA 5T7BA 3DM2A 1Q9XA 3IS9B 3KK2A 1HQUB 3PY8A 4ECXA 3OYEA 1QSSA 3TQ1A 3WNEA 5KI6A 1VRUB 1QAIA 3PW2A 5EWFA 2JGUA 4WYLA 3PO5A 2QK9A 2V0NA 3B6PA 4QPXA 3O3FA 4IFVB 2YKMA 4LSNA 3OYAA 2BQ3A 3A2FA 3KKRA 4FJHA 5C42B 4Q45A 2VWKA 4E1NA 2GC8A 1CLQA 1NJWA 2FLPA 4OL8A 4ELUA 4R0EA 4EBCA 1JLQA 1KTQA 5DGAA 3HPHA 4YR3A 3RMCA 4XPEA 4FJJA 4CGFA 1KVAA 5F9LA 4FJ5A 4BDYA 5C25B 4CEQA 4BE2A 1HPZB 4WXOA 4Z0UA 2JEJA 4OPKA 1NK5A 3SV4A 2HVIA 4F3TA 3ZT3A 3NAHA 4DFKA 1VSHA 1U49A 1LV5A 1NOYA 4KI4A 3AVAA 1SKRA 3OJUA 1HQEA 3KLEA 1Z26A 3NE6A 4QCLA 2HNZB 3IG1B 3V4IA 3VQ8A 3NFAA 4E89A 5KFOA 1C0TB 2C22A 5HLFA 1NKCA 2JC1A 1C1BB 4CJQA 4CEEA 3DLEA 3KK3B 5CYQA 3KKSA 5DLGA 4KRFA 1S9GA 4IOBA 2OPSB 4DSJA 4NLPA 5KFSA 4O5BA 1L3UA 2R2SA 2RF2B 3JSMB 5CY4A 1C0UB 4PUOB 3LP2A 2KQ2A 3ALYA 2E9TA 1RA6A 1JL1A 3TAGA 4RNMA 5KT4A 3T5KA 4WXWA 3ZSXA 4BE0A 1BGXT 3DYAB 4FJKA 4JV0A 3KHHA 4C8NA 5SWMA 2FBXA 1S0NA 3LDSA 1C1CA 5DGBA 3FQLA 1RT5B 2V4QA 4NYNA 2JEIA 1CZBA 5D3GA 1JLGA 1S6PB 3M8RA 4M3YA 5J2MA 3DM2B 3KOAA 3KK2B 4CJLA 3MXMA 1QSYA 4OJRA 3AVCA 5L1IA 2UVRA 2G8KA 4N41A 4MH8A 4KTQA 2FVQA 1SH0A 2FVCA 4F3OA 3CO9A 2W9AA 1LAVA 4FLUA 2YKMB 4IG0B 4L8RB 2HVHA 4DWIA 2KZZA 5HBMA 1WNSA 4CJRA 3OYFA 1RT2B 3M9NB 1K1SA 3RMBA 2G8VA 3OVNA 3WNGA 3CJ4A 3DLRA 3KHGA 4KAIA 4PY5A 1X1PA 4RUCA 5KFPA 2AU0A 4Z4HA 1NK7A 2Z1HA 1ZBHA 4J9PA 3FSIA 2XY6A 1IKXB 2CKWA 4DF8A 2XHBA 2VA3A 4RW6B 2KFZA 3FQKA 4AHTA 2YNIA 2R8JA 1WAJA 3TARA 2DPIA 1YTAA 4K4SA 3ZSZA 3SPYA 2A1SA 3KJVA 1TL1A 1HYSA 2WB4A 1WLJA 4M42A 2XO7A 1SKWA 4KHUA 3GILA 3BSOA 3H5XA 3DI6B 3RWUA 3KLEB 4CJ3A 3MR2A 3ZSWA 2W7PA 5HLFB 2XC9A 1W9HA 4DG1A 4Z4CA 2IJFA 5KG1A 1BQNA 1QHTA 4TYAA 1JLBB 3DLEB 3G10A 1QE1A 5CYQB 2R8HA 2P51A 3VQ5A 3OJSA 4FM2A 4ZPDA 2FC0A 4KHWA 1U09A 4QWEA 3TAPA 1KCFA 4MIAA 3CM6A 4I2PA 1TVRA 3DLGA 3I5CA 4CGJA 4DU4A 4CJ4A 1S9EA 4KO0A 4DTPA 3QEWA 1IKVB 3RB6A 1RT6B 3EPIA 2I5JA 4FK2A 1TKTA 2R7YA 1BCMA 1MU2A 1RDCA 3AVIA 3NHGA 4G1QB 5DQIA 4X2BA 4IDKA 3VA3A 2IM0A 3VQ4A 5D3GB 5HRSA 1JLGB 3MEGA 5J2MB 5J2NB 3SQ4A 2OPRB 2VG6A 1G15A 2YKNA 3V1QA 3V9WA 4ECRA 3PV8A 4KB1A 3SQ1A 3VQ9A 4JV2A 3S9HA 4N56A 4FZZA 3MEEA 1BIUA 4ZP9A 4IRDA 4YP3A 5CYMB 3UDLA 2VWJA 3CJ3A 1SUQB 5HBMB 3FFIB 5EUHA 1IO2A 3CFRA 2D41A 5EDWA 4RNFA 1XWLA 4DS4A 4DL4A 4DTRA 1RTHA 4J9QA 1K6YA 4DEZA 4EEYA 3QO9A 3RRGA 2YNHA 3BSNA 5CZ1A 3MR5A 4M3RA 4NLWA 4U6PA 3DLHA 4BWMA 1S6QA 3AVKA 1I6JA 1OS5A 1GX5A 5F8HA 4W5QA 1S1TA 3M8PB 3AVBA 4CGGA 4CEOA 1TL1B 3HKWA 2O4GA 3JYTA 5KFZA 3P1GA 3OYHA 4QW9A 2RDJA 1JXEA 1A5XA 3OYJA 4KFBA 2XI3A 4OKJA 2FJXA 1T8EA 1NHVA 3SZ2A 3SFUA 3LP0A 2D7SA 3THVA 1BQNB 3M8QA 3SQ0A 1GOBA 1JKHA 3G86A 2V4RA 2WTFA 2XRIA 1X9MA 1S97A 4OKEA 5F9NA 2VG5A 5KFHA 3VN5A 1S10A 3H2LA 2B4JA 4IQXA 1REVB 3NF9A 1RDBA 4CJVA 4DQPA 1TKTB 3D28A 4EO8A 2HMIA 4ZMMA 1N4LA 3GYNA 1S5JA 3IN5A 4CF2A 2DY4A 2W9BB 3MTKA 1TAUA 3MEGB 2BR0A 3OS0A 5KT6A 3NL0A 4Y1CA 2VG6B 2ITGA 1J53A 5KFBA 3CFPA 1SV5A 3D0PA 3KLVA 4Q44A 2IS3A 1RA7A 1S4FA 2QKKA 3HJFA 4FZYA 5HRPA 1CZ9A 5KGXA 4F50A 5KRTA 1S1UB 5J2PA 4NLTA 2WONB 4BE1A 3AA3A 1NOZA 3CJ2A 1RTHB 4NCGB 4WFXA 4AHUA 3CG7A 3UPFA 5HRRA 4H4MA 3QO9B 2YNHB 4KV8B 1YVUA 1S0OA 2OZMA 3LP1B 3QZ7A 5FRNA 3OHAA 3V6JA 2FVPA 1C0MA 4J9KA 5DG7A 4FJNA 4FS2A 1LWEA 4HUGA 5KG4A 4LH5A 3L3UA 4NCBA 1S1TB 4TY8A 2D5RA 2PYLA 1ZTTA 1KHVA 3JYTB 4Q8FA
chains in the Genus database with same CATH superfamily
4ZK7M 1HQUA 4H5TA 2FIUA 2AJ1A 3HTVA 2XY8A 4KFBB 4B3SF 3ULEA 5EN1A 3VVUA 1XR7A 4ANDA 3HVAA 1NM2A 3BH7B 3HT0A 4L73A 3DLKB 1Y00A 5J1EB 4HL9A 2QWMA 4EWTA 2RU9A 4JI7K 5H9FJ 2V2QA 3TO8A 4RR5A 2QFJA 5FDLA 4P2SA 4RNOA 2WVCA 5THWA 3R5AA 4J91A 5DDRC 3Q7CA 5I4MA 3D7SB 2QMXA 3M8WA 2X74A 3QMQA 2W2PP 3ZTSA 3CT9A 1VK8A 2BM1A 2W25A 1RCOB 3UN5A 4JEPA 1SV5B 1LWCA 4KH0B 4ES1A 3UKUA 4TY9A 4CE9A 2VONA 1IM6A 4FWOA 4URQU 3VR1A 3OHBA 3JSYA 2IC3A 5HROB 2ZF5O 3GG0A 4GKKK 1VQNN 2XNQA 1C1BA 1C0GA 4CF8A 1JNRB 4LFBK 4RX6A 1B4SA 3GYGA 1S1XA 4H4MB 1TK8A 2HS4A 3P96A 2ZEJA 2HS0A 4NXMF 5L1KA 1LWEB 1FD8A 2D3ZA 2RQMA 4TNOA 5LMUF 3BO4A 2R7QA 2QYGA 2ZOMA 1HR0J 5C2GA 4TY8B 2CPYA 3EWGA 3HHLA 1J9AA 1VR6A 4DN0A 3GR1A 2DH9A 3O9SA 2JH3A 3CPWR 3RR8A 4DQIA 5GMEA 2NPFA 3S3MA 4GV3A 1HNXK 2HNYB 3UD4P 5B0AA 2L41A 2E7VA 3KMSA 4URSA 2ZQBA 4CFDA 2WK4A 1GMVA 1V6HA 3NMUA 1NBEB 1H2VZ 1RABB 4JOUA 4NXNK 4XAKA 2KFYA 4C8MA 2HHWA 1B64A 3CI5A 3K5NA 3EXYA 4NO7A 5FJ4A 3C6TA 2QL5B 2ZD1B 3HM8A 3NAIA 3U02A 1NG9A 3VQ7A 2DNGA 4X64F 4DSIA 3OV7A 5FDLB 4OZNA 4RW6A 3WDOA 3HRGA 4Q0BB 1RZMA 2WVEA 1LAWA 3EO3A 2JX2A 1RTJA 3QRRA 1LWCB 1YI2S 1O5JA 2EWHA 3UCZP 2Z1IA 5AFUA 1LOTB 5EVZA 4OZ0A 2IC3B 3PJWA 5DJBA 5C15A 3SFGA 1GMWD 1SKSA 1KVCA 1S1XB 3N79A 2XLKA 4B3SJ 3GBTA 2QXLA 2YNGB 3MFHA 2FF3B 2NZ4A 1HBNA 2QIFA 4DR4F 2KHDA 1X9JA 3GE9A 1KS2A 4ZCIA 2O8BA 3VERA 4NZ6A 4ZP6A 5DZ6A 1SC1B 3AO3A 3CCQS 2BQRA 2BGGA 4DZ6A 4MLEA 4YNQA 3HHLB 4KHRA 4C2MA 2ZH4A 5IFMA 2R8KA 1YTUA 3V6DB 2ZH3A 3E51A 3EGVA 4JI7F 2UXBJ 3I96A 1MWKA 3J7ZO 5FPEA 2BACA 4DL7A 1LFWA 3ZNUA 2HQGA 2V52B 2NXCA 2E5GA 1VHFA 3BPDA 1OY8A 2QJ3A 2WW4A 2ETJA 3PIOQ 1HQ2A 3H5UA 3K57A 2G8UA 3CCMN 1N56A 2MPUA 3C6TB 5ADZA 2B6AA 5K8OA 3ZO7A 1NK9A 3UCGA 1C0FA 3SBGA 1GLCG 1T95A 2WCXA 2JFDA 1YZ7A 4JB8B 2VKZG 2WW8A 4Y3CA 3NP5A 4L3QA 4KT0C 4N76A 2QV6A 2F8HA 2UUWA 3QEXA 1RTJB 2QA4G 2DEJA 5LMUJ 2V8PA 2G8IA 4H8KA 3VEXA 1RAFB 2MSTA 3H3OB 3HZGA 4B3OA 3ET6A 3OTBA 3BUZB 1OSCA 3D45A 1UFWA 3KHYA 1U8SA 1GAOA 2O1PA 4WQ5C 2XS2A 4JKEA 1HW8A 3VTHA 4DXLA 2XO6A 3HI0A 2DXEA 1TUUA 1NPKA 4M3TA 3VQAA 1HBNB 2LQ9A 1PCAA 4ANEA 1TL4A 1HNXF 3D66A 1YTYA 2O8BB 3Q8SB 2FD2A 4G1PA 4FLWA 5BREA 5ETQA 4NXNF 3VQQA 2E4LA 4J2BA 2ZJPL 1GH8A 2YXLA 1PYSB 4YOUA 3BF3A 4D3HA 5AZIA 5IS2A 1HMVB 3MOZA 3O9UA 2F4VF 5M1PA 1W2IA 2M0GB 2DHHA 4DQRA 1UPPA 1K44A 3LAMA 3UB5A 1NRKA 3K8WA 5L39A 1EHWA 4FWQA 3NLCA 2YVSA 4KY3A 3BJYA 2BOPA 1PAUB 3M8YA 2IA6A 2B6AB 1PG5B 1DBDA 4KV8A 1ZH5A 3LP1A 1LWFA 3VEVA 4USJC 3DRRA 2EW9A 4CYUA 1RT1A 3CJQA 3UIQA 2BANB 4O0NA 4RW4A 3R8EA 3J7YU 1NNEA 4DV4F 4DLEA 2P9NA 1AW0A 2VG7A 3O4WA 1XK8A 4CZIA 3PRVA 2OPPA 2C28A 3GP9A 4B3OB 1YJNN 3BR8A 4JI2K 3JQMA 1VSKA 2C2ZB 1S49A 3KJQB 2UVWA 4CJPA 1FI4A 3CIPA 2VL1A 4ETZA 4OJGA 3RGIA 4FF1A 4F2RA 4R79A 1N54B 3TOQA 1JK9B 5LSLA 4J5OA 3CPWM 3R27A 3VF2A 3QQCD 1X4DA 5IXUA 3A4TA 5LY3A 1S5ZA 4IKAA 2Z1GA 5I3PA 3HD2A 4RL1A 1P90A 4CM2A 1ZZFA 3DNCA 2LA4A 1NDKA 1I3AA 2DXDA 3ZSRA 3KHRA 2LA6A 3PDNA 3CJKB 2ATQA 3PIPL 2E1MC 4DPOA 5EWGA 1URNA 1Q95G 1Y3KA 3ONQA 4KC5A 3NMAA 5HVFA 4W5NA 5HMZA 1CG2A 1U0SA 2QEXN 3TI0A 1DTTA 4FOEA 3G71S 2MKSA 2K8GA 1Z05A 2BABA 1NMNA 3I4PA 3NOGA 1HBOA 2ALZA 1CVJA 2P9SA 4XH4A 3H46O 4B9VA 2H1YA 2O8FA 3RBEA 4E19A 4ZVHA 4QIEA 3ZZUA 1LWFB 1WTFA 3DRRB 4CYUB 2WBRA 4X62F 2DFEA 4B3MK 1RT1B 3PYEA 4RW4B 1DQ9A 1JJ2R 2OFGX 3O5BA 2AWZA 1U24A 3GIKA 4M94A 3SCJE 3SDEA 2VG7B 5DQHA 3CF5L 2OPPB 5B0GA 4A46A 5ELZA 1C2PA 3ENOA 2VD3A 3UR0A 3L7OA 5KFDA 4CEZA 4FLVA 2GQQA 3JTPA 1RUSA 4OPHA 3W2VA 5CYJA 2BUPA 2NUHA 2W7OA 4WIQA 3BF1A 1WC1A 4WZMA 4P71A 1F21A 3CETA 3FEXB 2Q0RA 2WHOA 2R3VA 3G6XA 1U1RA 3RB3A 1QDUB 3NH2A 1VQMN 2PEHA 3C46A 1M0SA 3L2QA 1M1HA 2IVYA 3OD2A 1TL5A 4CLFA 4BG9A 4FM1A 2UV8A 3DGVA 1Y0HA 1KAZA 2FGOA 3O5TB 3W66A 5KFFA 3W9HA 2OH2A 1U0HA 3IWLA 3HMJG 4HHTA 2QLJB 4ZHRA 2DD8S 4E1MA 4KH5A 1WAFA 1UCNA 4ZIWA 4LF6J 2FC8A 1EP4A 1A5VA 3LANA 3ILOA 2WSEC 5HJYA 4PG5A 2HYIB 2XZWA 4WCEQ 2MLXA 4DR6F 2FJWA 1UFLA 2P9SB 3VA0A 5J2QA 1QLNA 1HNVA 2FC9A 2O8FB 3TJ8A 4DMNA 3Q8VA 2QYCA 3JB9k 5KFGA 4OV1A 2J6SA 2HW3A 1TUVA 1XR6A 3AXKA 4WKYA 4JI2F 2MQLA 2GMHA 1UWAA 4U96A 1OQ3A 2E29A 2N82B 2HPUA 4RZRA 3VQDA 4CFBA 1B7FA 5B08A 1G99A 3W3SA 4YHHK 3NS6A 3AAQA 3ATVA 3O9RA 2XYHB 5JVGQ 4UTGA 1U6ZA 2MDAA 1TZ0A 1SIZA 4TU7A 3AVMA 2MSSA 3JS9A 3A5MC 4HHUA 1UZHA 1F9FA 2RKIA 2N3OA 3R5DA 4CK2A 1FJCA 4P2FA 3W2VB 1SJ4P 2NRWA 1UEVA 1JLCA 1UZDA 1RAEB 3EX7B 2JEGA 4KGMA 2A42A 1CBKA 2E2NA 2HF4A 2ACYA 3PRBA 2ZGYA 5JLHA 2IRYA 3KG4A 3OTDA 2IVPA 4PKDB 4Y2CA 4CBXA 2C2OB 2KW4A 2WRMA 1ITPA 3O4NA 3J80U 2EEYA 2E9ZA 2IM3A 2C2DA 2ZBRA 3AB4B 2ROEA 2Y0SD 4LFCK 1GLEG 1U0HB 1UEUA 4ZHRB 2RB7A 2CPEA 2ROPA 2O8CA 4XEIA 3FGUA 2HFZA 1EP4B 3DRPA 3MM6A 1YITS 5J2QB 4CW7B 4LRBA 3MX2A 1VJWA 4IOCL 4C3LA 4O3QA 2OPQA 2CQBA 5D0RA 4WFBQ 3NGDA 3PX0A 1DGKN 4CJTA 2YPYA 3H25A 3AJ2A 3MN9A 2Z30B 3VEWA 4XPCA 3H98A 3F56A 3QGIA 1TTHB 3OS1A 3CDAA 5IOLA 2Y1LB 2UV8G 5KFIA 3CULA 3AGRA 1VRTB 1SJRA 4FYDA 2D0PA 2WFBA 5KT3A 4LSLA 2G8WA 1YWXA 3U8XA 1FRXA 5LMNF 2VPZB 4K0KJ 4OZ5A 1V5VA 1RBSA 1S0MA 1JLCB 4WIIA 3N4QA 2VPXB 2MTLA 3OFHA 3ZZTA 2VC1A 4CEBA 1S57A 2QN6B 4FWLA 3ATUA 4AE5A 1BIZA 5KFCA 5KPTA 1XMQK 4FPIA 2E6MA 2DGQA 1U04A 3G4SS 4OGEA 5CCMA 3VHQA 1QQOA 1ZAXA 1L3SA 3I8DA 1T11A 1QQMA 3EICA 1ELOA 3N5BA 4RW9A 1JLQB 1N5QA 2YWFA 3EYZA 2D9PA 2DPJA 5IT0A 1S99A 3FZLA 2H5IB 4ISEA 2GMJA 1IR2A 1NJZA 1JJ2M 4QIFA 3HHNB 1RXOB 4FXDA 2O5DA 1RBUA 3DRSA 1NH8A 1K73O 4ED1A 3R97A 2Q36A 1M1KO 3V4IB 3H45C 3T69A 4LJMA 4ZPBA 3W3DA 2YWHA 3OQ2A 1KQSR 2FHOB 1JXVA 1RT7A 4DL2A 1KDNA 3DOLA 2R2RA 2C3YA 3NXZA 1UFKA 4V1Ak 3CYMA 2DNPA 4GVMA 1IM4A 3IGNA 2CNLB 3DLLL 2X78A 3BM7A 4M41A 3EXCX 2OD6A 3A12A 3US5A 4B9UA 3UCUP 4IR9A 4DX7A 4PQUA 3V1OA 1WHWA 3BPSP 3H4DA 3RBDA 3R1HA 1OYDA 1HNZK 5CR4A 1N5YA 1P8ZA 1E4GT 1UL3A 1XERA 4ICLA 3PFOA 2V4JB 4JI5F 4XH5A 4Y2MA 3SK3A 2CQ0A 4CGHA 2VQFK 2KTQA 1GLDG 2HG4A 2PI4A 4D3GA 2UUBK 2ZM6F 1ZAVA 4RW9B 4BVOA 4RU9A 4DX6A 3CQYA 5HL7L 2VV5A 3LWLA 1RWMB 3IBCB 2OYQA 2ZH1A 3L3CA 1FERA 3G8TA 3TU5A 2W8KA 3QT7A 3W62A 2D3UA 8AT1B 1OWXA 1WSEA 3V2UC 2GQCA 4USVA 1FKPA 5ETKA 3UDEA 2XTJP 1UJ5A 2XCAA 3GE1A 1C6VA 2CWXA 2UVUA 5JVHL 5LMNJ 4RBUA 3FDSA 1RTDA 2K7JA 1QE1B 1PIEA 2LQJA 3M5RA 3LWMA 3DOLB 3KG0A 4IBNA 4TQRA 2RIJA 1HNIA 5HMWA 4JI0J 1CZAN 3EN9A 2W7AA 5CAAA 4OLAA 2FSKA 2HWHA 2DY1A 4PQUB 5BR8K 4QWBA 3B6BA 2ASYA 2PFFB 4CHPA 4CLZA 4IDKB 3SNNA 1FXXA 1Q53A 5CXTA 3D6TB 4AT1B 4RU2A 2XY5A 2IGIA 4DCHA 4LR7A 2YKNB 2UU9J 4NCAA 1J2VA 2F8SA 1N5YB 1U2VA 4A47A 3KHLA 2GIRA 4ICLB 2J7UA 1Q86O 4QYRA 5L38A 1UMJA 1URRA 3IR5B 4CF9A 3MX5A 2YWEA 1SZ2A 2HHXA 2KLAA 2DXFA 1F9EB 1Z2ZA 4LF9F 3AODA 1BHNA 5IM0A 3VF4A 1R59O 4L76A 2AYEA 1H73A 2XM3A 3OYNA 2PFDA 1B99A 5AJ3K 2U2FA 4RW7A 3DDKA 4CEDA 1WDDA 5B0BA 1Q9YA 3DRXA 3FCHA 4OIXA 1D09B 5LXYA 3C2PA 2M88A 4YY3F 4DQQA 5K14A 1FKPB 1NU4A 3IS9A 1TK0A 3AO2A 1KXPA 2CDRB 1DURA 3K9JA 1RDRA 1ITGA 1X31C 1S0VA 3HDSA 1FNXH 2RN2A 1VQSA 2YX7A 4CEFA 1CQNA 3O4QA 3M8QB 4IFVA 2BJDA 3H1QA 3P6YC 3AJ1A 3LF0A 1WC0A 2XMTA 2CQIA 2DFHA 1ZOTA 5DDOC 1N48A 2F9DA 5KFKA 3DOKA 2MEWA 2XHWA 2NRHA 3AOAA 3GU0A 4JI5J 2GA7A 3Q8UA 4OYWA 2LDYA 2FZCB 1H2TZ 1VQ6N 3V9ZA 1FDNA 2A1BA 1LXNA 1OVYA 2E44A 2CVIA 5C25A 2RS8A 1NK0A 2VOOA 2ZM6J 2QA1A 2E5LK 5KFQA 3G6EN 1NSPA 3ZCMA 3U6FA 2FJVA 3PLAA 4JI4K 1WF2A 2UUBF 2UYTA 4ZCKA 3L7UA 4JV5K 5AE2A 4KBIA 4FK0A 1U2VB 1KLNA 1AUSL 4GRSA 1T9UA 1R27B 2A6AA 3OY9A 2O8DA 4M3XA 3TEGA 3HO1A 1Q82O 2AX0A 3ZTRA 1Y5NB 1J5OA 4RJVA 3MHYA 3S7RA 5GAHP 5F8IA 2E1CA 3R5GA 4OHXA 5IM0B 3E66A 4Z4FA 3SPZA 3J81O 2AJ2A 1I5OB 3Q24A 2AP1A 4RW7B 5AQMA 1RQ0A 1HJRA 2OEMA 3AA4A 4DTMA 4DCPB 3DYAA 2GIFA 5L1JA 1KQSM 4YEAA 5LOQA 4O3PA 2APOA 5K14B 4LH4A 4PEOA 4CFAA 2M8HA 4NASA 5T7BA 4QIGA 3IS9B 4X4RA 3O08A 3C19A 1QSSA 3WNEA 1YJTA 5C0YA 1VHXA 1F5BA 3D9BA 3HHLC 1BY9A 2KT2A 4OHZA 3CJAA 3NVMA 4FNHA 2I7PA 5KAKA 5BR8F 3O3FA 4IFVB 4XK8C 3TYTA 3OYAA 3A2FA 5M1KA 3KKRA 4FJHA 1VQKN 2OJ3A 4E1NA 2KKZA 2GC8A 1F3VA 3NNHA 1CLQA 4YB6A 2JNJA 2MQNA 4YR3A 1RFQA 2VYPA 5M2UA 3CMES 5GIPA 4FJ5A 4BDYA 5C25B 1YRTA 2RSQA 4XH1A 1U02A 4WXOA 3SV4A 3S6EA 3DC2A 4DFKA 2I0XA 4LF6K 1LV5A 3UKRA 2QW9A 2RD5C 4LF8K 4KI4A 1HQEA 1HWIA 3PEJA 4QCLA 5AJ3F 3MCOA 1OPZA 3WT0A 4YY3J 1NKCA 3AD8C 3WXIA 4CJQA 3G25A 1AB8A 3LM2A 3OBYA 3DLEA 3K8VA 3J7YI 1R7IA 1M5PC 2DNMA 2ASPA 3TA1A 3J7ZT 2R2SA 3AOCA 3TVZA 3LP2A 1BE4A 4DUYJ 1WKLA 4RNMA 4X84A 5E7OB 4WXWA 3ZSXA 5DS7A 3AGKA 3NGSA 1BGXT 3DYAB 2Z8QA 2GX8A 4C8NA 1C1CA 4M5DB 5DGBA 3FQLA 4V19S 5E3PA 4A8MP 1JLGA 3M8RA 1PJ7A 1NJIT 4LBPA 3MAAB 2UVRA 4IYQA 2AJ0A 1FCAA 3QT8A 3CJ7A 3FBFA 1UP1A 3CO9A 3OA9A 2DBBA 2FUG9 2ZVSA 4IG0B 4DWIA 1G7CB 3HJVA 2ADCA 3BO3A 4CJRA 2E5LF 3RMBA 3OVNA 3MM7B 2HK3A 4JI4F 3AJDA 3F9MA 4USTA 5DM7L 2O3DA 3D0HE 4Z4HA 2BYCA 1FJEB 5AQVA 2XY6A 2CKWA 3AHPA 2CPZA 2XHCA 1VS3A 2QT7A 1QUPA 3ZSZA 1WHVA 2PO4A 3MAHA 1HYSA 1HI0P 1XEZA 1J5EJ 1DEJA 3NNAA 3BH6B 3BSOA 3WC2A 1ROFA 1AT1B 2PE8A 2WUSA 4CRJA 3ZSWA 3S1TA 1U2RA 2XC9A 1TYQA 4PR6A 7FD1A 4Z4CA 4OI1A 2IJFA 2L48A 3QT6A 1P27B 1JLBB 3DLEB 3G10A 4YB7A 4NEZA 5JMVA 2GJIA 1WSVA 1DKGD 4MIAA 3CM6A 1YI2N 1TVRA 3DLGA 2NRZA 3QEWA 1Y10A 3RB6A 3B8AX 1GXTA 1RT6B 3ZZYA 4JK8A 4FPBA 1IBLF 3EPIA 2I5JA 3E3XA 4IO8A 1RDCA 3AVIA 5DQIA 4YDUA 3MR7A 1J27A 4X2BA 1WOSA 5B0FA 3SMZA 4PL7A 1JLGB 2H4WB 2VGNA 2VG6A 3O8MA 4ECRA 2M5YA 4K0KK 5GMDA 3CSKA 3H8YA 3MEEA 1BIUA 1GLLO 4YP3A 3W8GA 3UDLA 3CJ3A 3CCQN 5DDPC 2AZ3A 1HWJA 5LJ5Y 4ES2A 3LO3A 4RNFA 1G2EA 2BJ3A 4DTRA 1RTHA 5A8WB 3DLJA 4EEYA 5BPMA 2B4PA 3QO9A 2MQOA 3P39A 3KUHA 4LF8F 4I56A 1EX8A 4MKYA 1S3XA 2G1DA 2DIVA 4JI3K 2QWPA 4BROA 4M5JA 3DXSX 3H3NO 2MKIA 1BOTO 1X3NA 4MO5A 3B4DA 1Q1KA 3HI9A 2O4GA 2ZOGA 3JYTA 3PG9A 4BRNA 1JXEA 1A5XA 3C6HA 3GPAA 2FJDB 2PI5A 2XZTB 1TYQB 3LP0A 1LCUA 2HLTA 2F3JA 1A7GE 4CTAA 1VGYA 4C0OC 4KBOA 1NCLA 1KOOA 4IUFA 3G86A 1K47A 1S97A 1RHUB 4B3TF 3VN5A 1CJKA 3EMTA 3H2LA 1VQ8S 2XZDB 4JP8A 4KHPF 3CTRA 1RDBA 3PIPQ 1M5HA 3Q89A 2ZBIA 1T9TA 4P10A 4EO8A 1VQ7S 3R5JB 4DV0F 9RUBA 1G4CA 3BYPA 5GAEU 3MTKA 5KT6A 2XYGB 2VG6B 1MLAA 1J53A 5KFBA 4DUZJ 2OEJA 3IBWA 1HBMA 2F5GA 1IVZA 2A6OA 2IS3A 5D0HA 1S4FA 3HJFA 2G0CA 2VJVA 5HRPA 1CZ9A 5KRTA 4F50A 1S1UB 4ES3A 1XNQF 4DV6J 1WUAA 1Q8KA 3CJ2A 1RTHB 4NCGB 3UPFA 4LF5K 2J9EA 2IVOA 1REGX 4Q2MA 2CDQA 5HOOA 3QO9B 2BKNA 7AT1B 4M5NA 4ZOSA 3QZ7A 2FVPA 3OR2A 1C0MA 4FJNA 3VAGA 4FS2A 2M52A 2POKA 3MMCA 5KG4A 5DETA 3CD5A 3L3UA 2DYAA 4FWKA 3VGMA 1KAYA 2H3EB 4AM6A 3M6WA 1ZTTA 1KHVA 3P38A 3JYTB 2K06A 4QR2A 1WDTA 2G8HA 3GSIA 5RUBA 4NI2B 4GKJF 4ZJQA 4USUA 3H2UB 2AA4A 3I55S 4PKGA 1VRUA 4H0TB 3U9DA 5KG3A 5F8MA 2KL8A 2CQ2A 2LXUA 3D67A 1TKDA 3LP0B 4DF4A 3BGRB 4CTAB 3QFWA 2P9KA 2IIHA 3B82A 3K0JA 4YMEA 2OMOA 5C42A 4B1XB 1FFSB 5JICA 1CJKB 3SQGA 3U3YA 3UO0A 3NGYA 2CPDA 1U8WA 4ZCMA 1LK5A 5DM6L 4DV7F 2YQ1A 2C3OA 1U7LA 3M7VA 4R8UB 1TMMA 2QL7B 4ECWA 2WAQD 3HVTB 2HHHF 1VOMA 3D6MB 4HH1A 1HBMB 2O8EA 4RW8A 2RUGA 3AQPA 3ITHB 1S7HA 3EDRB 1IKWB 1IBKJ 2UU9K 4ED6A 3SJHA 5KFJA 4ETXA 4JI3F 4FOIA 5E0OA 2HZAA 3AO5A 4CHOA 1ZBFA 4Y2AA 1MMNA 3TVKA 2AYGA 2NRTA 3LDPA 5IV3A 4JBCA 1CC8A 1WF0A 4ZVSB 3GL1A 3OR2B 5HMXA 1RKIA 3TZWA 2XS5A 1E6YA 2VH7A 4TVAB 4PXBA 3G71N 3IM9A 2OHDA 3VGLA 4I6AA 2NSBA 4NLXA 4XTTA 3QZ8A 4B3TJ 4H0VB 2IHR1 2JDJA 4DTJA 5F3TA 4BLGA 4KHPJ 5AQQA 2BJ7A 4X66J 5TKYA 1FW6A 3W9IA 3W2WA 4LSZB 3AO1A 2BX6A 5DG9A 3L4BC 3RMAA 3SIPB 3TTFA 4CO3A 4G65A 5JS2A 4EP5A 2QMWA 4XO0A 4NE9C 3B54A 3U7JA 4CHNA 3SQGB 5T41A 4IJAA 3EKSA 2WTUA 1O0PA 1RT3A 1N32F 2D4WA 4PQAA 3Q8QB 1TKXA 1OMSA 4CIFA 1CEZA 4MFBA 5CHCB 4L6V3 3ENAA 5AFUH 5T7LA 2QX0A 2LQ8A 4LVOP 4IXCA 4F25A 4ZN3A 3BN4A 2FVSA 1F60B 4AQYJ 1CXQA 4LF5F 2NNWA 2DGUA 1IG9A 2ZNYA 3VQEA 2YV0X 4RW8B 3BDPA 1SC3B 2HMPA 4GV6A 2ABYA 2GGPA 2HRYA 3DI6A 1AYEA 1RTZA 4ZVGA 3VGVA 3R9LA 1P9YA 4ED0A 2HVDA 4IOCQ 1WG1A 4MK9A 4OX9F 2RMLA 3LPUA 1JMTA 1VSDA 5FLXU 3G96A 4C8KA 1JB0C 1JWWA 2Z4PA 4DSEA 4H4OA 1VIXA 1T9VA 4EAHD 5BN9A 4MDBA 1EWQA 5GAGI 1VJQA 2VQEJ 2Z0GA 5KG6A 3FR0A 2MQ8A 2EC2A 4I6YA 3THWA 1E6YB 1CLFA 1WSHA 3TQEA 3CD6S 1RBAA 2UUCJ 3NS5A 2PSZA 2VBXA 3QGPA 4J9NA 2J0XA 4G1QA 2E1YA 1Q8IA 1SBRA 3HHKA 4MYTA 3W9JA 3N6LA 1TK5A 3DLBA 2BM0A 4Y0WA 1S22A 4MKVA 4H5VA 1U25A 5E41A 2OPRA 2Y1IA 1ATRA 3PX6A 3W2WB 1O1WA 4UF4A 3UNYA 2OP5A 4YUDA 2OTLS 5CYMA 3KNGA 3ICLA 1SUQA 3J81Y 3T7ZA 1YX2A 8ATCB 4DSFA 3FFIA 4DMZA 1C4CA 1XIQA 1RDUA 3F0NA 4DR1K 2VGMA 5HJXA 3GJTB 1NKBA 3KDNA 1DTQB 1RT3B 1CULA 1D9FA 1Q78A 1TKXB 5M2RA 4MFBB 3D3BJ 4KREA 1VQPS 1KVIA 5T7LB 1PJ5A 1RGIA 1Y7PA 4L75A 5M1FA 1K73T 3V81B 2AEMA 4HWIA 3HX9A 1V3RA 3F73A 1M1KT 3VAMA 1NGGA 4K50A 1X8DA 2PN6A 1S1WA 2ZVIA 2R8GA 4QBUA 2D3OR 2GGPB 3I8BA 3KK7A 3CJ1A 3GIRA 4WFYA 1BC6A 2QG9B 3UN3A 3CIZA 2UUAJ 3NGIA 2DISA 1YJRA 4FDFA 1VQOS 2V2VA 3ZTPA 4CGIA 2P5OA 4H4OB 1U6FA 2IDOA 1LFPA 3M6GA 4R5PA 4ISGA 3ZYYX 3THWB 2JSXA 3GG4A 4DV2F 1REVA 2MZSA 3N28A 1MWMA 2AHOB 4ZVRB 3DLLQ 1R8BA 4ZVEA 3ZTQA 4M3WA 2QEXS 2E7WA 1K1QA 2UUTA 2NZCA 2N7CA 1YITN 2W9BA 1TR0A 3H2VE 3D2EA 2HHSA 4JD2A 4ID5B 3NH0A 4J37A 1N32J 1UAWA 2RUSA 4JI1K 3M2RA 5D0GA 2DNKA 2WOMB 3I5AA 1CPZA 2Y3YA 4C3MA 3OFFA 4ILMA 2YWKA 2HOEA 2MGZA 3ENQA 4NZ0A 2HRTA 3VVTA 2JRSA 2V68A 1RTIA 1N36F 4ECQA 4PWDA 2EG2A 4LF4J 2KYZA 1R8CA 1YUWA 1Q81O 1NZAA 2IY5B 3TTDA 1CULB 4OX9J 3G8SA 5HL7Q 1IN0A 4BRDA 4J9UE 3O9QA 4A8XA 4IH5A 3IMQJ 1OH6A 1VSJA 3HP6A 2IRUA 4JKCA 4ELVA 4M5MA 2F4FA 3DHWC 1S1WB 4ZDNA 3I0RA 3OFEA 2W42A 4HI2A 2GBZA 3G4SN 3SQOP 1VQMS 3WNFA 1EETA 5JVHQ 2UXDJ 2NCKL 3MPWA 4F4XA 4UOGA 1UOCA 2ASJA 5K9FA 2I7NA 3HOTA 3R7NB 3ZLJA 3KLGA 4CO0A 4OYZA 5A8KB 3P5JA 1B7YB 3SSSA 5IT9U 1WSGA 3OXGA 2K7KA 4R5PB 2KHOA 1RAAB 3E8OA 4ZLNA 4TLRA 2HFSA 3GJRB 4IG3A 3N6MA 3NGTA 4OZ2A 4NLCA 2VFVA 3GQCA 3QAEA 3L0QA 1EB0A 1S1VA 5KT7A 4BR7A 2QRRA 2DVIA 3D2EB 3VV2B 1Q86T 4JD2B 3WXLA 2YHYA 1F3FA 5SZTA 4L3KA 5KT5A 5KFEA 4DR1F 2JWNA 4FL9A 3KLIA 3GSDA 3Q22A 1FNOA 4EFAC 5ADXA 1KC8O 4EFHA 2COLA 1WG5A 3IR6B 4K4TA 1TGOA 1DQAA 3FZMA 2MGZB 3SEOA 1MW7A 1YRXA 5KG7A 4H0XB 1RTIB 3A5OC 4YOTA 3J81j 4PWDB 4DPUA 3C3LA 3OVSA 3JAMO 2NRRA 1R0AA 1YF5L 3LDOA 5J1PA 1FK9A 1HWKA 2JWLA 1VK3A 3MCMA 1M5OC 4BG8A 1D1UA 1NDPA 4OYAA 2PA3A 3HK2A 3K17A 4BC5A 1S9FA 2QC3A 5A2QO 2KVQE 3LALA 1SPBP 1HPMA 3QRQA 3A8EA 2AGPA 3IC1A 4G3IA 2QWLA 3BB5A 1AROP 3O9TA 1EETB 2X3DA 1RKJA 4QAGA 1E6VA 2LEBA 5I9EB 3IAYA 3MD3A 2J6UA 4AILC 1WJ9A 3CCJS 1G1XA 2P9PA 1YGYA 4IOAL 3DU6A 1UKUA 4JKFA 2HGMA 2IJNA 5IWAK 4JI1F 4C98A 3IO1A 4NLSA 4IG3B 1N0UA 3CC2S 4U7UD 4B8AB 4CBWA 3VQPA 3PYGA 3Q8YA 5AXLA 4JS4A 1Z25A 3BQ1A 4CERA 3MEDA 2C2KB 2HBZB 4ZPCA 4E7IA 2QLFB 2ZUGA 2P9UB 3IWXA 4DR3J 4FS1A 3THXA 2CNNB 3KLIB 4DTXA 1GEHA 2HEKA 2CQ1A 1Q82T 5E3QA 3G8QA 4M5KA 3A3OB 4BC2A 3N9UC 1FA0A 2F1FA 1NO8A 3LZJA 3S41A 5KFWA 2AX1A 2FHJA 3MMJA 1NMEB 3DXKA 5KFXA 4DV1J 2J8AA 3Q8RB 4DV6K 3VQCA 1QUVA 1UVLA 4A8QA 4H0PA 2FF6A 2CWKA 1R0AB 4Z7YA 4F4KA 1KNZA 1L3VA 4ZVFA 1ZAWA 2LU1A 3QT5A 4JI6J 2FB0A 3MMVA 2HBLA 3LW5C 4CCHA 2FSJA 3W1YC 4OO1J 4CLYA 4HUEA 4UQGA 3MCPA 5JJBA 4DL6A 2D3O1 1ASWA 1N5VA 1IWGA 2DNNA 2B43A 4FBUA 3SLCA 2ZFHA 5ETTA 4KB7A 1WNEA 2X1AA 2E7XA 1BO5O 4HTUA 4OV6A 3R5BA 2F7TA 1U48A 2FBYA 4C8ZA 4HVJA 4DPWA 2IDLA 3CMAS 1QD1A 2KJWA 1E6VB 2JHEA 1U1LA 4DCJB 5D77A 5KFUA 4LIRA 4KYZA 2P9PB 3M9MB 3OYMA 4OYXA 3BP8A 5A8RB 4WF9L 2ZE2A 2X3GA 3F2KA 4M5HA 2ZJRL 3CXCR 1YBAA 4B9QA 1FEEA 2CNKB 3IAM9 4TU8A 2D1CA 3MEDB 4DR5J 1YJUA 2J9DA 1JL2A 2YKAA 2YI1A 3T41A 2MJUA 3THXB 2LQ5A 2MZJA 4PYDA 3TZZA 2JLEA 1UVJA 2KRRA 3CQ8A 3BGOP 4C0HA 2D0BA 2VKRA 3PW5A 3JS6A 4BQLA 4CZEA 5EX0A 3I0SB 4I9QA 3MPYA 5EXWA 1KONA 1IBKK 5ETNA 3DOMA 5E5NA 5DMRA 3W5XA 4YOXA 3QESA 3AA5X 4DV5K 1R8HA 4PCQA 3LP3A 3KD5E 4F36A 2R2TA 4B3RF 5F8LA 3MMBA 2P1JA 2NUBA 2Q3SA 2Q6BA 3MR3A 4AHCA 3OVBA 5CD4A 4Z4IA 2E9RX 3RAQA 1LW0A 2ATLA 2BE7D 3M2VA 4G6VB 1EJ7L 4WU3A 2DHXA 1UJ6A 4OJ1A 1SL1A 2AMCB 3MEKA 3E01A 1VQ4N 4FJXA 3FEYB 1HI8A 2Q43A 5CH7B 3IA0A 1VBYA 2HNDA 1ZPWX 2MMYA 2P9LA 2CPJA 5DM7Q 1TUYA 4LSNB 1PKUA 3R7BB 3CO0P 3TWZA 1YHQS 4LRFA 2AKWB 5GAEI 1SJ1A 3I9ZA 4NRUA 5A6WA 3QJLA 4ZVTB 1WHXA 3MOJB 3H20A 1Y97A 5A0YA 2MZRA 5KQDA 4CJKA 5LSOA 2J0WA 4OYPA 4QYZJ 2GTDA 3D6FB 1BQXA 7FDRA 3KWGA 4AQYK 1ZA2B 4WYWA 2R7XA 3S3OA 4C8OA 1RILA 1UA1A 3EZOA 1MN7A 4NA1A 3PRDA 4RNNA 2B7BB 2GZOA 2RDIA 1VQYA 5KOWA 5AQXA 2X51A 4DPYA 3TRGA 4KTWA 3CQXA 2YWWA 4CGDA 2OZSA 1VDHA 1YLXA 3J7YP 3OYCA 2HBKA 2CIMA 1DJ0A 2W1BA 3CCZA 2BJ1A 3CMEN 4P9SA 2EFPA 3VAJA 1CJVA 3P45B 4H0YB 2YKOA 3P83D 3M6XA 4QW8A 3BSCA 1K8KA 3OR1A 4PG8A 1VSIA 5BN8A 4QU7A 1ICEB 1VSMA 1R89A 4J90A 1B9FA 2HLUA 2YQ3A 4ZP7A 2B56A 1KBRA 4I0WA 3QIPA 5HANA 1MROB 1KQFB 3O44A 4NLDA 1Q8LA 2A2CA 3AO4A 1FX4A 3OTOJ 3M2VB 2PMZD 2A10A 2B9XA 2X1FA 4IKFA 1BG3A 1ZETA 2DGVA 1RAOA 3E01B 2HHUA 3U27A 3D7EO 4YDUC 4KQZA 1U4BA 3F9KA 3D1HA 1HWUA 4JK9A 4DU1A 1FDBA 4NMLA 2HNDB 3G6VA 1JIHA 1RU1A 3WX8A 1D5AA 4I4BA 3R1LA 3NDKA 3EZ5A 3A5LC 1EKEA 2P9LB 5EOYA 2HBMA 2HBJA 4KHNA 3TAMA 1B0TA 1RBTA 2OIHA 3IKMA 3GFHA 4GVBB 4J2EA 3LOUA 2J7KA 2RQ4A 2QLBB 3G82A 1NGAA 1Y64A 5A0YB 1NGJA 1KFSA 4DV5F 3V4MA 4JUZA 4B3RJ 1HHQA 1Y4ZB 4B17A 3W63A 1Z4UA 2CADA 3BR9A 2XB2D 4USWA 2GV9A 2F40A 2KH9A 1DY3A 3WIVA 3SYZA 1KFDA 3KLFA 3SJJA 4LQ3A 1IQTA 1UA0A 3K0SA 3QWPA 1YJ9S 1HYZA 1QQNA 3LPTA 2UUAK 3RRHA 4MIWA 2PZSA 1UW4A 4CJ5A 1FRMA 2V51B 4C1NK 1TMJA 1WC4A 4F4WA 3V6HA 2EFNA 4DG1B 4OPJA 5C12A 1BQMA 1LNQA 3PX4A 2HGLA 3D4JA 5FROA 4CJ7A 3OR1B 2GV1A 4DR7K 2L9NA 2F63A 4F02A 1ZM9A 5M1OA 3MPUB 4LBHA 4KHMA 4KO0B 3D68A 5AQGA 2VFTA 1N88A 1D0EA 1KVKA 3AVHA 3G9CA 4X4UA 5JXSA 4PG4A 1MU2B 1VC0A 3TAQA 3OYIA 4X4TA 1YSJA 4BDZA 3H08A 2PMWA 4PKHA 2LP4A 4QIWD 4XDDA 3NG8A 4EZ9A 1F0XA 2FZKB 2KXHA 5KFAA 1VC5A 4DPXA 3P4IA 3GV5B 4WE1A 3NH1A 3CJ9A 4CHZA 3GLJA 2OSRA 5DG8A 4Y34A 3C16A 4IO9L 3R6LB 3DU5A 3WQPA 4FJMA 3UE2A 1X4GA 3WQUA 3G82B 3AVLA 2ITMA 2HF3A 2I2YA 4FW1A 4PABA 5AXMA 3ZSOA 2EFGA 2AJ4A 3ZETA 3N4PA 3CCLS 5IV4A 1S6QB 3PJ9A 4IH7A 4P74A 1NHUA 3HSZA 4U9RA 2AZ1A 2V8HA 3CB4A 5F8GA 3ULDA 2JOQA 3KLFB 4OMFG 4I64A 1PYTA 1BWFO 3IP0A 2P2CB 3VAHA 2CGLA 1IBMF 3R3TA 4BRFA 1OO0B 1JLAA 1H2UX 2DNQA 2RHQB 3I31A 3O1LA 2G0JA 3BS9A 1RWOB 3CC7S 5DM6Q 1X9WA 2RNEA 2QFIA 1HNWK 3IRWP 3NY0A 4ZPWR 2C2RA 2MQMA 3TZYA 2XMMA 3ZZPA 2B3TB 2BE9B 2VZ9A 4RUBA 1KHWA 4OLPA 1NLVA 2OELA 3QIDA 2W6LA 4EYHB 1G3OA 4LFAJ 1Q5VA 3AA2A 1AZSA 2XWYA 3CDUA 5IT4A 3OL8A 3O1WA 2QTWA 3FGVA 4OKKA 4J9OA 4GMJB 1VQ8N 1NH7A 5MLCV 4OI4A 3CMQA 4PKIA 1T6DA 3NCRA 4NRTA 4OHWA 2JVRA 3PCOB 1E4FT 1VQ7N 4WE1B 3PKMA 4LQ9A 5J1NA 2B9WA 3CCWA 3C16B 3ASMA 3VQBA 2OPSA 5KG5A 2A6MA 3L6QA 3LQVA 2OCEA 1I1GA 2ATCB 1N33K 1QSLA 3CCRS 2NRVA 3OLAA 3D5MA 1T9XA 4ECUA 3T1YK 1NSKL 4P75A 4IR1A 3HOSA 3FLCO 3BN7A 4Q8EA 3JAMY 4F4ZA 4J9MA 1WSIA 1WSJA 4FLYA 1HKCA 3ENHA 2XGPA 1S6PA 2MJNA 1Q9XA 2J0SD 1HQUB 1MNEA 3BZKA 2FLOA 2BH1A 3ULEB 3DWLA 1MSWD 4PYAA 4LC9B 1QAIA 3EEQA 3PFEA 3RBZA 4WYLA 4FF2A 3PO5A 1YKWA 2V0NA 5G4DA 5A2QY 3B6PA 2Y8WA 5AR0A 2YKMA 3BF4A 1FTCA 1Z2LA 1GFWB 1AFIA 1WF1A 3AA8A 3MM5A 1FJGK 4MYUA 5L8RC 2E2OA 3I55N 1I94K 5CCLA 2LXIA 4Y00A 4XPEA 4LF7J 4CGFA 1F6TA 1KVAA 3D2FA 2FJBB 4DV3J 1AZSB 5F1XA 2NYIA 4ED5A 3ZT3A 4O5FA 2OGUA 2IDEA 1U49A 3CW2C 4X4PA 1NOYA 2KG1A 2LDIA 2A0FB 4CIOA 3UKUB 1SKRA 3AVAA 3B78A 3OJUA 3KLEA 1J6ZA 3VQ8A 2ROGA 3A8KA 3NFAA 4E89A 5KFOA 3OBWA 2CVEA 2EK6A 2JC1A 3ZXWA 1C1BB 1QZ5A 4OI3A 4K59A 3E9PA 5DLGA 1S9GA 4IOBA 2OPSB 3K2YA 4DSJA 2IYGA 3X1LB 4FP9A 4OPAA 3M6VA 2Q66A 4ILRA 5CY4A 1IR1A 5IZHA 1JL1A 4QS7A 3TUJC 1CS4A 3T5KA 1Q5YA 4FXWA 4FJKA 1XMOK 1NEEA 5SWMA 3TA2A 3GCXP 2LECA 3LDSA 2EFQA 4HR2A 2JEIA 5D3GA 2RRBA 2ZKTA 4JI8K 1S6PB 4M3YA 3KOAA 5FLXY 1QSYA 4CJLA 3MXMA 2EWSA 5L1IA 2G8KA 1S76D 2QA4S 4LF1A 2FVCA 2ZHOA 5C2CA 5MAOA 4F3OA 1QZ6A 2W9AA 3BGLA 4FLUA 2FYXA 4HTLA 2YKMB 2KM8B 2HVHA 2V8DA 4NA2A 1WNSA 3VGSA 1K1SA 1UVIA 1U1PA 2G8VA 1RU2A 3MM5B 4PY5A 3TP2A 2CPXA 2H48B 1GNKA 3VAKA 2IYIA 4RUCA 3AAPA 4CH1A 1FKAF 3D2FB 2J7WA 1NK7A 2VBYA 2QL9B 2Z1HA 1ZBHA 2LYVA 3FSIA 2ZH6A 1X60A 3QPIA 4GKKF 2J9CA 4DF8A 5IQ6A 3WHIA 4RW6B 1LEOA 4JKAA 4AXIA 3QFPA 3GFZA 2YNIA 2DPIA 4LFBF 4DOZA 4NXMJ 4Z37A 3MPVA 3OXLA 4N8OA 2X1BA 3KJVA 5D8HB 2A1SA 1TL1A 5H9EJ 2XO7A 2IBOA 2XLIA 2MZQA 4I1TA 1QHAA 3O3LA 1T02A 3GILA 4ED4A 3LGNA 1N33F 3KLEB 5AZJA 3MR2A 2P9GA 2W2QP 5GAGP 2W7PA 1NSAA 4RPFA 2FJAB 4OYIA 4FF3A 4OYMA 4WPAA 5LJ3Y 1QHTA 2F8MA 5CA5A 3OJSA 4A5AA 4YB5A 3EE9A 4KHWA 2K3KA 4ER8A 1OH7A 5IC6B 4I2PA 3T9NA 4CGJA 4CJ4A 1S9EA 4DTPA 4P7VA 3RBXA 2DR9A 4DKWA 2H5JB 1RACB 2HQIA 1N8RO 3NHGA 5BPNA 2D0OA 3VQ4A 5D3GB 5DZ7A 1APSA 3SQ4A 1N34K 2V69A 4X64J 3V1QA 1I94F 2XEXA 1Z6RA 4KB1A 3QBXA 3S9HA 2CJ9A 4N56A 4FZZA 3CD6N 1FRJA 1FVQA 3BO2A 5CABA 2VWJA 2WB1D 3ILJA 3CFRA 4P73A 2P9IA 4DS4A 1F2HA 1IG8A 4J9QA 4DEZA 3RRGA 2YNHA 4ZVUB 3MR5A 1OIAA 2CQGA 3C0BA 1CJTA 2OTLN 2PIIA 2G1HA 4OYOA 2NR0A 3ILIA 1EZZB 3RAMA 2YCHA 4QYZK 5F0UA 3DDNA 1S1TA 3IWNC 3M8ZA 4DR4J 6FD1A 4CEOA 3D6RA 2HAFA 1TL1B 2NREA 1RWPB 1NHKL 5KFZA 3P1GA 4UQTA 4QW9A 2RDJA 1ZXOA 2C3UA 4PXDA 5AZJB 3ET6B 2FHJD 4OHVA 4ZA1A 2EKNA 4USIA 1VQPN 1NGFA 4HDHA 1T8EA 1NHVA 1HJOA 2YHWA 4NA3A 4GV9A 3BYRA 2NLWA 1JKHA 4JI7J 4JI8F 2KJVA 2XRIA 1KC8T 2VG5A 2W40A 3U1LA 3SAHA 3GYXB 1HA1A 4HT7A 4USKA 2MLZA 2V8GA 1RAGB 3NF9A 1KEKA 2HMIA 4KH1B 1VQON 4ZMMA 1V3ZA 3TVYA 3I4HX 2BR0A 3NL0A 4QU6A 1FFWB 3OTOK 4DPTA 5AZIB 2DR8A 4A8FA 3CFPA 1X4FA 3T1HK 5IT9Y 3X3UA 5M2PA 3D0PA 4GKKJ 4QOTA 2DEIA 1HLUA 2RH3A 4TLQA 1R6VA 2I8EA 1V9OA 5KGXA 5J2PA 5E26A 4BE1A 6FDRA 2XSJA 3AA3A 1VI7A 2P9IB 5HRRA 4CP5A 1C4AA 4OX8A 1DRZA 2YNHB 2W2MP 2ERRA 4KV8B 3H6EA 4FWPA 4FYXB 2OEKA 3LP1B 5FRNA 2YKPA 3OHAA 1CJTB 1D4XA 5DG7A 3HHEA 4LUBA 1XNRK 3FSYA 3VEZA 2D1KA 2V94A 4K43A 3SBTA 5B0EA 1QY7A 3D6HB 2E2PA 4HACA 4M63A 5BYRA 1TFWA 4NCBA 1S1TB 5B8HA 2IPOB 2P9NB 4LVNP 1HNXJ 2IIRA 3MK6A 3EJMA 2IM1A 2YY3A 3PJXA 4BREA 4IFEA 1FXRA 3SCIE 3QINA 4U7CA 1CQMA 1X0FA 4TYBA 4E8UA 4NXNJ 2D0CA 4X65K 4IZ9A 2V9WA 1VLOA 4JYAK 3BREA 4A2BA 1A5WA 4OJHA 2DHGA 3GJQB 2F4VJ 1JKHB 1YRUA 4A8SA 3LPEA 4R0JA 1N34F 1BA1A 2VG5B 3IRXA 2FJEB 3SAFA 4DR2K 3TR5A 2CH5A 2X7IA 4HH0A 1VBZA 4CLKA 1NJYA 3SMSA 1UTAA 4QWCA 3SQ2A 4B1YB 1X0PA 2UXCK 1TU0B 1RAIB 5U47A 4JV1A 4M5GA 2VA2A 3QFHA 1A0OB 4DFPA 4I9LA 3HPOA 4DV4J 1YVFA 1FWLA 3OYGA 3IG1A 2O66A 5D4LA 3Q8PB 4IFYA 4BGAA 1DTTB 1C0TA 2CG4A 3AARA 5BRHA 2XSJB 4FLXA 4ZVOB 4N5SA 3MWBA 4BCAA 3K59A 4WCEL 2HHTA 1HBOB 3KK1A 3T19A 5D4OA 1RBVA 3MAQA 1X3MA 2ZWOA 2HSTA 1JLFA 4PUOA 4DQSA 4WYBA 4HCBA 3QLHA 3I87A 3SV3A 4HACB 4LMZA 1MN9A 1HD1A 3BKUA 1X7VA 3SDEB 4USMA 4E7LA 4K8XA 2CJKA 1RT5A 3CM5A 1BISA 2DJWA 3GTYX 3SCXA 3R3LA 1FJ7A 4A61A 4NMXA 5JMNA 2C2NA 4FYVB 3RRKA 2QLXA 4FLZA 2MYFA 5BYQA 1ZS6A 4BACA 3F44A 2LCWA 4WF9Q 4OLOA 3D3CJ 2ZJRQ 3MPDA 5LT5A 2C2EA 1RT2A 3VMFB 1KRPA 4WTOB 3IM8A 4NYZA 5KFYA 3IRXB 3D54A 4TU9A 2BQUA 4E1JA 2GUIA 3R6GB 3GJSB 2PYJA 3C15A 3D1OA 4EU0A 1KSPA 1KQKA 3MCAB 2BJ9A 4DU3A 3ZZOA 5H9FK 4ZS6A 3SI8A 4KRWA 1IKXA 3NF6A 3CCJN 3EZWA 4BC9A 1RSCA 2YPZA 3MN7A 5KT2A 4LFAK 4WFAL 1RISA 4X62J 1RCHA 4WTYA 1B9DA 4CZGA 4ID1A 3E9OA 1S12A 2B51A 1SC6A 1NDCA 4XDCA 4ZTJA 3FBBA 1FVSA 3ILLA 3CC2N 2GCFA 1VQ5S 4B9MA 1XNRF 3FFKB 4B3MF 3Q7BA 1IR0A 4IFYB 4AHVA 5E33A 2PFUA 5GADP 3SSQA 3LM9A 4Q5VA 2RQCA 3L4QA 4JRQA 4ZCLA 2Z58B 2VICA 3KK1B 2D74B 4L3NA 3CCUS 1HNVB 1HHTP 2CFXA 4N7TA 4HI1A 2CPHA 2FTRA 3SMPA 1JLFB 1IKVA 3SCLE 2P6SA 3QLHB 2GEMA 2Y0BB 3UD5A 4C8LA 1VLYA 3A5NC 4IRCA 5C2DA 3DFEA 4JYAF 4BR9A 5HI7A 1RBLA 3GCWP 1JJCB 2O4IA 1GLJO 3HM9A 4A5BA 5J2NA 1HR0K 3T3FA 3EZUA 1XN9A 1VSFA 1B3TA 4NLUA 3GOIA 4BRKA 2J9DE 3LGHA 4LRAA 1BXNA 2RKIB 1F2GA 4WWSA 4HEA9 1YDLA 4HYKA 1M90O 2GVDA 2UXCF 3WEEA 4BR0A 3NOCA 2KU7A 4YOWA 2E5HA 4NYPA 3W5ZA 2CPFA 4FBTA 2A5XA 5AQJA 4KKOA 2KG0A 3QJPA 1S59A 2AIRB 2IAJA 1QTMA 4H4KA 3UDVA 1ATNA 2AGOA 3CMAN 1SAZA 4DR6J 3PUFA 4ZTFA 4LF7K 3CVKA 4KGZB 1M1GA 3AVJA 4M1KA 3M8PA 3MUTP 4Q43A 3HFVA 2BV3A 1X5SA 4JI2J 4B8CA 1QQCA 5KFTA 4C0BA 2E1RA 1C1AA 2O8CB 3J7A1 2BDPA 4BDPA 4M7YA 2ZWPA 1N0VC 1S6UA 3HSCA 3DRPB 3ZT1A 1GLBG 5FRMA 2YJFA 3MM6B 3TEHB 4CWBA 4YHHF 3I56S 1T03A 4C97A 1AA1B 1X9SA 4KR0B 3FZKA 3EVMA 4B3SK 2OPQB 1S6OA 4TKTA 3HVWA 4GNIA 2DNZA 2PAVA 3AAWB 1HYVA 1XTZA 4K2XA 3JSRA 3K9KA 1MMLA 2NXJA 1FRKA 4YN3B 2DHAA 2F7VA 2W9CA 3PKYA 4KB0A 3HT3A 4F4AA 1HBUA 2H65B 3MM8A 2FBTA 2VFRA 3WIUA 2VIHA 1SH3A 2ZH2A 1BDGA 1NBWA 3GIIA 4LSLB 2AEFA 4FJ9A 3C95A 2E5JA 5K8NA 4P7TA 3RZAA 1ZBUA 4IWVA 4LD0A 3DRYA 2EC0A 1PBAA 3TJ9A 3NF8A 2GVDB 4KGKA 2WONA 4FJIA 2UXBK 2OSQA 2HBQB 3WEEB 3DAWA 3POTA 5GAEP 4KKOB 4LFCF 4HTIA 4LR9A 2IAJB 1GTEA 2YX4A 2XY7A 3W65A 3ISND 3W60A 1EWRA 1UVMA 2B4UA 4CQ1A 1HL6A 5KPZA 2IOCA 4EI2A 1V4SA 3UD3P 4JHDA 4CEAA 1T0TV 5FPDA 3OYKA 2H9ZA 4NXMK 3RMDA 4DUTA 5C24A 4HUFA 5H9EK 3RJMB 5E84A 2IMOA 4WFNL 2F9JA 1UVNA 2UP1A 3FSXA 5LMUK 1YHQN 3QGHA 3EGWB 3DLKA 3DRSB 5J1EA 2MZ1A 1T03B 3TPQA 1RK8A 2HBYB 2RAQA 1S48A 3W61A 3OLBA 3N5FA 3O3HA 4NLOA 4DU7A 3L95X 4ILLA 3WXKA 5ADXH 2E88A 1RT7B 3KJFB 1FWPA 3G2XA 2ZJQL 2U1AA 1I3OB 1YIJS 4F3QA 1YBTA 2W9CB 1RHQB 4MQ3A 4IQMA 4B9LA 4QWDA 1HBUB 3MM8B 4KHQA 3A8IA 2DTUA 2PC6A 1NB2A 1VSLA 1XMBA 3FZFA 3CCTA 4WP8A 4X64K 4OZLA 2XMAA 2A3ZA 5F8JA 3J7AP 1XMQF 4EMDA 4A8YA 4IO1A 2K3IA 1RT4A 5HROA 2R9LA 5BRDA 1BL3A 3POTB 1WOPA 4X4QA 4IO9Q 1YQHA 4HLBA 4WP3A 2AYBA 1LW2A 4NLBA 3MR6A 3O80A 4J9VA 3MN6A 4M8LA 5HVGA 2K2PA 1QVFR 4YHHJ 4AHSA 2QXFA 1SJFA 1VCTA 2Q0UA 2VFSA 1DFDA 4Z94A 3HSGA 4KTZA 3J8AA 3WQTA 2G0IA 4UOHA 4O3OA 1DAXA 3L09A 2ALYB 4ZLLA 3KIOA 4DR4K 5C24B 3CFOA 2W2OP 2HNYA 3UQSA 3PR4A 2EK1A 3WUHA 1NMDA 2V50A 2EKYA 1K9MO 1WBDA 4OI6A 1V5IB 3QBCA 1YG0A 1HKBA 2QWRA 2SXLA 4BR4A 4FJGA 3DXBA 4TQSA 2RDDA 2L3MA 4DX5A 1RTDB 5F3ZA 2ZD1A 4ED8A 2XI2A 2J76E 5KOXA 1F9HA 2HFUA 3OHRA 4IH6A 4I67A 5LL6d 1YJ9N 4LFCJ 2UXBF 1HNIB 2PY5A 2YQ0A 3NRBA 1HNZF 3MECA 1JCEA 4CZLA 5LL6Z 2KI2A 4Q0BA 1BD6A 3JTOA 3TX0A 3OFGA 2DH8A 3DN9A 3J80O 3CPEA 4CO2A 1RT4B 4O8UA 3TZXA 2ZKUA 1T3NA 2VQFF 4BRPA 3ISNC 4CD3A 3BDEA 4Y2KA 2B8QA 4UUXA 4FLTA 3KZBA 3QICA 4K7QA 1R43A 3FZ2A 5EWEA 1LW2B 4B1ZA 2YNGA 3C7NA 2W6KA 1MWYA 2QA2A 3D0GE 4F26A 2GWJA 4CJUA 3IFRA 3NF7A 1B92A 1OY6A 2M9KA 4BC3A 4CECA 3HSTB 3L9ZA 4GC7A 2UZAA 1VQ4S 3V6DA 4B08A 1LWXA 1Q7YO 1DLOA 2GO9A 2G9OA 3CGIA 3HULA 4K4YA 4MK7A 2GAGC 3QGGA 2FQQB 5AE1A 4W98A 1RWVB 2FSNA 1VAZA 3T6BA 3DGPA 4ECZA 5F0XA 2ZH5A 1RBRA 4OFZA 3CCLN 1XMQJ 4EIAA 4CIEA 2V7YA 2F4VK 2ZH7A 1U6BA 3W64A 1HARA 4UY8O 4C1NI 1EXQA 5HQ8A 3DOKB 3VWSA 2IFXA 2GJFA 1WSRA 2NQPA 5ETPA 5AQTA 3IR7B 3MECB 4O23A 2KM8C 3T1AA 4ED7A 2C3MA 4NLRA 2MQQA 3VGTA 4CJSA 1IKYA 4CZMA 3CC7N 1WOOA 2ZZMA 4PPDA 1Y11A 4LF9J 3TR8A 3PO4A 3L2WA 5HO4A 4DV4K 2QWQA 1BA0A 4ERDA 1GLFO 2BTFA 4EP4A 3UW1A 1NGDA 5T14A 5CD4H 4NYOA 3BKTA 3C7NB 2M7SA 3M1VA 4IOXA 2O8DB 1T05A 3GDQA 5AXNA 1ZA1B 1J5OB 3GG1A 3GMGA 4AUKA 3BSAA 3ZNJ1 3AVNA 5M1NA 1U45A 1SQKA 2HWTA 1KAXA 5L9NA 3ZTOA 2ILYA 3NNCA 5AQSA 1WSFA 2DGOA 3RB4A 1HMVA 5KGWA 3MZIA 1DLOB 2Z56B 5H1SQ 1HNZJ 3EKUA 1IH7A 4W5OA 1NSQA 4S0MA 2YHAA 2CNOB 3ULHA 2M4MA 3DGPB 4QIVA 3CCRN 1TL7A 2FZGB 3JXUA 5BPLA 2XCPA 1RHJB 3M05A 3LTOA 4P6QA 2VQFJ 1DT9A 2DKOB 1UAXA 1GQEA 1NJIO 1ESVA 4AL7A 2UUBJ 1E3MA 2CJQA 5AQUA 1P6TA 2BANA 1JXLA 4K42A 4E0DA 4CO4A 2A3JA 3H0PA 1BUXA 2C2MB 4A2AA 2N4CA 4JV5F 2OA8A 1FF2A 4AHRA 4USHA 3UNGC 4FZXC 2ZUAA 3EE8A 1IKYB 1UW9A 3PW4A 3CCVS 5K8PA 3VTIA 4X62K 1BHLA 2YNFA 1QVFM 2WVBA 3AH6A 3RW6A 3M32A 3QETA 3S3NA 5B7WA 1A6LA 1ZBSA 2FBVA 3PXGa 1FWKA 3UKRB 4KH6A 4J9LA 1KVJA 4OZ1A 1N8RT 1HQEB 2DNLA 1FXDA 3M1VB 1W26A 4CESA 1YZ6A 1T05B 3ADAC 3CC4S 4O3SA 2MZTA 1P9QC 3BQ0A 4C6AA 4NLVA 1HHSA 4A4JA 2QGFB 3OL9A 3MUVP 4KH4A 5FPNA 3LP2B 3CJCA 2ZJPQ 5BR8J 5KTQA 3CJKA 4BQZA 5ETVA 3SUOA 1SI9A 4FNIA 1SL2A 3PM9A 3OT9A 2KT3A 4A57A 3AV9A 1ASVA 3K58A 4RCHA 2WZ1A 1C1CB 4TN2A 1RLDA 2VWBA 1TAQA 5BXIA 4OQJA 4BHQA 4WFZA 2GO8A 2ZC3A 1TL7B 1XQSC 2L08A 2GELA 2GS8A 5DLFA 3WZ0A 2ZWHA 5D0EA 3VAIA 3OS2A 4JAXA 5KRSA 3V9XA 2A1RA 2DR6A 4F3MA 4CI0B 4QS8A 2MXYA 2FY1A 4P72A 1QAXA 3KD1E 5AJ3J 3QNNA 1FRLA 4LF6F 4DR6K 5EY4A 3GV7B 4DTUA 2IBKA 2QA4N 3A13A 2Q2RA 3KG1A 3C65A 3MMAA 2P5GA 4BBYA 3HZ6A 3OTCA 4UY85 4J2AA