4BRFA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with a distorted orthomolybdate ion and amp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brfA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brfA02
4H0TB 5BPNA 3CQYA 3QMLA 4XH5A 5ADXA 2A41A 3VF2A 5AQWA 1NGFA 5AQIA 2W40A 3MCPA 4FWQA 4O5FA 5KPTA 2IVNA 2A40A 3B8AX 5E26A 1YVNA 4BRPA 1HX1A 2Q0UA 3FFKB 1SQKA 1ZC6A 1TYQB 3LDQA 2V51B 5BPMA 1QQNA 5ELZA 3A5NC 2P9KB 1HUXA 3WXJA 5AQSA 2P9SA 2FSNA 4BR4A 4HWIA 4BRKA 1C0FA 4Z94A 2V52B 1CZAN 2HOEA 1QZ5A 1XQSC 3ZEUA 4Y0WA 3DXKA 5EY4A 4BRNA 3JS6A 2AA4A 2P9NB 3BUZB 1Z05A 4DB3A 3OHRA 3EZWA 5F1XA 3VGLA 2QW9A 3ATVA 4H0OA 3WEEB 2E20A 4M7YA 3FLCO 3D2FA 3M1FA 5AQLA 3WXLA 4BRGA 4F9OA 3QBXA 5CE3A 2QWQA 3HM8A 3GDQA 4B1WB 5I9EB 3U9ZA 3FZMA 4H5RA 3BP8A 2E2NA 3H1QA 3HZ6A 1V4SA 5KQ8A 4BR5A 3O1WA 5AQHA 2Q0RA 3W3DA 3GL1A 4IJAA 3O1BA 3KVGA 4RTFD 3UB5A 2WUSA 3ENOA 2GELA 2Q36A 3U4LA 4PKHA 2VYPA 3G25A 3DAWA 2GWJA 2QXLA 3WXKA 2BTFA 3WXIA 1ESVA 5TKYA 4K42A 4BRLA 1JCFA 4JHDB 3H45C 4H5VA 1U6ZA 1NGHA 3IUCA 1NGGA 4WQ5C 1GLFO 1TYQA 3MN9A 1U2VA 1GLJO 4CZGA 2P9KA 4BR7A 1NGIA 1YUWA 5AQJA 1QQOA 4CBUA 1HPMA 5AQKA 4IO8A 1NLVA 1BOTO 3WQTA 1WOQA 2QM1A 2CH6A 2P9NA 3D2EB 2KHOA 2VCPA 3FR0A 4QS7A 5AQUA 3HI0A 4FWMA 2ZWHA 5BN9A 5AQZA 4K43A 3WEEA 1E4FT 2E2PA 1X9JA 5FPMA 4CZMA 1NGJA 3VEOA 1T6DA 4EHTA 2F9TA 2QWRA 4BC3A 4BROA 4EFHA 3WQUA 3ULEB 1ATRA 5KPRA 5BREA 4AM7A 5AQYA 4BVOA 3H46O 2FF3B 4CD3A 4GNIA 1SZ2A 3SMSA 3ZX0A 4BC4A 3H3OB 4RWTA 1Z6RA 4GY2B 1V4TA 4JD2B 3QFPA 2H3GX 5AQMA 1ZXOA 2FSKA 4JHDA 5E84A 2ASMA 2FF6A 5AQFA 3R8EA 4BRHA 1ATSA 4BC2A 3CJAA 4DCHA 3GG4A 3LL3A 4M63C 3CETA 2PAVA 5EVZA 3ENHA 3FGUA 1ATNA 1GLAG 3QBWA 1BDGA 4I6MA 1E4GT 4DHYA 2I7NA 2BUPA 4H03B 1LOTB 3D2EA 4IZ9A 2V7ZA 3EKUA 3WT0A 4WQ4A 2FXUA 4H5TA 2IVOA 3GBTA 4K41A 5AQXA 5BN8A 5FPNA 3ID8A 4CI6A 5F2RA 4BR2A 2Q97A 3DJCA 3M6GA 1D4XA 5LJVA 3FZHA 2A3ZA 2QWMA 4B1XB 2ZGYA 3QFUA 1NM1A 3ULEA 3VENA 3MDQA 3GE1A 3AAQA 1OKJA 3O6WA 2J4RA 1GLCG 1RDWX 3CJ9A 4PL7A 3MN7A 1IG8A 2E8AA 1P8ZA 2OANA 3GOIA 4MLEA 3DWLA 4CJ7A 4FWRA 4CZJA 5BRHA 4JD2A 5F0XA 1KAXA 3WUHA 3HSCA 4H0XB 4H0YB 5FPDA 4A61A 4FWSA 3UKRB 4CZIA 3A0IX 1GLEG 1TUYA 1KXPA 4NO7A 3CJ7A 3A8YA 4K25A 1DGKN 1HKGA 2P9UB 2QWOA 2P9IB 1H1VA 3U9DA 2CGJA 2YCHA 3I8BA 3ZETB 1T44A 5EX5A 4C23A 2Q1NA 3BF3A 4QS9A 1GLBG 4BR0A 2IVPA 3CJ1A 1XC3A 3D7EO 4ISFA 4NB4A 4JN4A 2CGLA 3C7NB 4ISEA 2YJFA 4CZKA 2E2QA 1NWKA 3VEZA 2V7YA 4JNEA 3VESA 3QICA 4E1JA 5AZIB 4BG8A 1QQMA 2D4WA 3J8AA 2E1YA 1BWFO 2IIRA 3IDHA 2A42A 4FO0A 5AQQA 4BRAA 3EN9A 2UYTA 4FOEA 4MO5A 4H0PA 1J6ZA 4CD1A 4BRFA 1LCUA 3IFRA 3FE1A 1GLDG 4WQ4C 3VF4A 4A62A 5AQVA 4CBXA 5EXWA 3VERA 1BU6O 4FSVA 1XUPO 5AQNA 4BGAA 3FZFA 1MDUB 1KAYA 3F9MA 3A5OC 2YHYA 2YHXA 3EL2A 3H3NO 3UKRA 3C0BA 5AFUH 5KQDA 4AM6A 1JCEA 2P9PB 2P9UA 4YDUA 1YXQA 1MWKA 1RFQA 2P9IA 3VETA 4BRCA 3S41A 1Y64A 1NGCA 3RSEB 3CQXA 3O80A 1BA1A 4CZHA 4IXCA 2ASPA 5JLFA 1K8KB 4H5WA 3FZKA 4H5NA 3C7NA 4B1UB 1BUPA 1T6CA 3VPZA 5KPZA 5BRDA 5AZIA 3MN6A 1X3MA 2GWKA 3R9PA 4RCHA 3BEXA 4A2BA 2EWSA 1RGIA 3O5BA 1ZBSA 1NMDA 4FPAA 3AARA 2DPNA 4B1ZA 1R59O 1YAGA 3UKUB 3CIPA 4PL8A 1HLUA 3L6QA 2HF3A 4ISGA 4BC5A 1X3NA 4BRIA 1S22A 2A6AA 2W41A 4HTLA 1HKCA 4EIAA 4MO4A 4BVPA 3HBTA 2P9PA 3KHYA 3O4WA 5AZJA 5JLHA 4BG9A 2D1KA 2YI1A 4H0VB 5AQRA 4CBWA 3JXUA 3LDPA 4PKIA 2ZGZA 3MMVA 1K8KA 2HF4A 4XH1A 5BR9A 4YDUC 4KBOA 4FWOA 1SAZA 2FLOA 4O8KA 2FSJA 4LC9B 3LDLA 3CHWA 5ADXH 1U2VB 2Q31A 4BRDA 3VOVA 4FWKA 2NRHA 2Q2RA 4BQLA 3VGKA 3H6EA 4EAHD 3UKUA 3LM2A 4FWNA 3FZLA 3L4IA 5JICA 5FPEA 4CZEA 3CI5A 4IWVA 3A5LC 4CZLA 3EO3A 2E1ZA 3SMPA 5B8HA 3L0QA 5AQOA 3SJHA 5LY3A 4B1YB 2A5XA 2E2OA 4XH4A 3ATUA 2VWBA 4BRQA 5BRFA 4BR9A 4BQZA 1C0GA 5JMVA 3VEWA 1MA9B 4M7XA 3UE5A 3ZX2A 2HMPA 5AQPA 2ASOA 5AQTA 5AFUA 2I7PA 3R6MA 2F9WA 1Q18A 2NZTA 3DXMB 2YHWA 3P4IA 2CH5A 4JAXA 3QB0A 3MK6A 2GEMA 4QS8A 2QWPA 3SK3A 1BG3A 4BGBA 3LM9A 3CJCA 3AAPA 1BO5O 2D0PA 2P9LB 1NGBA 3W0LA 3VF6A 3CERA 3LDNA 1GLLO 5AQGA 1DKGD 4FWLA 1KAZA 4FOIA 3M3ZA 4FL9A 5AR0A 3I33A 3ZX3A 4I6MB 1JCGA 1QZ6A 3ZETA 5AZJB 3HTVA 1WUAA 3SLCA 1BA0A 3O08A 5LJWA 3H1VX 1HKBA 4MLHA 4PKGA 4B1VA 4B9QA 4A2AA 3MN5A 1NBWA 3LDOA 1NGAA 3AY9A 2PBDA 2QWNA 1QHAA 1NGDA 4IJNA 4DQ8A 4FPBA 1HJOA 1G99A 4WYBA 3O8MA 2D0OA 3VEXA 4BRMA 4J8FA 1EQYA 1S3XA 2P9SB 4FWPA 2YJEA 3IMXA 2ITMA 1NGEA 4EHUA 5BPLA 3DXMA 3ZEUB 4XEIA 3BF1A 4CZFA 3DXKB 3VEYA 3CJBA 2NLXA 1MWMA 2GTDA 2P9LA 4BREA 2CGKA 2E88A 3D2FB 1TUUA 3VGMA 3U8XA 2GUPA 3EKSA 1DEJA 1IJJA 3A5MC 5EOYA 2ZF5O 3QDKA 3TPQA 3TU5A 3VEVA 2AP1A 4L3QA 2QWLA 4WQ5A 3RSEA 3KZBA
chains in the Genus database with same CATH superfamily
3QIOA 4H0TB 1UWBA 3OYHA 5GADP 3QMLA 3F2KA 3AGRA 4XH5A 3T7ZA 3TSQA 1JL1A 1TKTA 2W42A 2W40A 4FWQA 1DTTA 3SQ2A 2QK9A 2O8FA 3MECA 2A40A 3L3VA 4OPJA 4JLHA 5E26A 1QHTA 4RW4A 4LF9K 2DTUA 1VSMA 1OVYA 1VSJA 3H08A 4IG0A 2UUBK 3G71N 1RDDA 5AQSA 4C8LA 1S1TA 3U3GA 4JS4A 3SUNA 2FBXA 4BRNA 4LH5A 2JLEA 3OHRA 4DB3A 3LDSA 2ZJRL 1TGOA 4DTRA 5AQLA 5GINA 3G0ZA 4JKGA 3FZMA 3HZ6A 3H1QA 1V4SA 3O1WA 5AQHA 1BGXT 2Q0RA 3GL1A 3O1BA 3PLAA 3UB5A 4CEDA 3HOTA 2VG5A 4M3RA 4JYAK 1S5JA 3U4LA 3DAWA 2QXLA 3WXKA 2BH1A 1D5AA 3WXIA 3KKRA 3D45A 4AHUA 3AVMA 4BRLA 4JHDB 3VA0A 1NGGA 4WQ5C 1FW6A 2IOCA 4BR7A 3E1YA 4H4MA 2Y1IA 1D9DA 4FJMA 4CEEA 3VQ8A 2ITGA 1WOQA 3WQTA 3D2EB 1XNQK 3EEQA 4DV0K 5AQUA 5BN9A 2HVHA 5AJ3K 4HUGA 1N34K 1QSLA 1CLQA 1NGJA 3J80O 2Q3SA 1T6DA 1TL1A 3WQUA 5KPRA 1CXUA 3DRPA 5AQYA 4GNIA 5FLXO 4Y1CA 3OYEA 1BHLA 1SZ2A 1VSKA 3SMSA 2OTLN 4EP4A 1S1VA 3ZX0A 1ZBLA 3H3OB 4RWTA 4JI1K 1V4TA 1WSJA 3QFPA 4JHDA 2P5OA 1L3SA 1Q86O 5AQFA 3R8EA 3CJAA 3KLEA 2B6AA 3DI6A 3MEEA 1S6PA 1Z25A 2EHGA 4AHVA 3AA4A 1J5OA 1GLAG 3RMAA 4KTZA 3EY1A 1BCOA 4AHRA 3DOKA 1LOTB 2BANA 3D2EA 3SV3A 3K0SA 4O5BA 2V7ZA 4H5TA 2IVOA 3HJFA 3OYJA 5FPNA 3AA3A 3ID8A 4CI6A 4JV5K 3ZT2A 4JI3K 4C1NK 3EYZA 3R3LA 1NM1A 1QE1A 3ZSRA 2IGIA 1I94K 4FJJA 4PL7A 3MN7A 3PV8A 3TAGA 1P8ZA 3GOIA 4CJ7A 4FWRA 4DS5A 4CZJA 3HSCA 4H0XB 4FWSA 4IDKA 2IAJA 4FCYA 3HRGA 4DV7K 3A0IX 4C8KA 5I42A 4O4GA 3OYGA 4K25A 1HKGA 3NGIA 2QWOA 4IKFA 3LPUA 3SAGA 3HOSA 4JEPA 1NJIO 4NCAA 1T44A 4B3OA 3BF3A 4BR0A 4K0KK 4ISFA 1C1CA 1KVAA 4MDBA 5M1OA 1IBLK 3OYNA 2KQ2A 3VEZA 1QVFM 4CEQA 4E1JA 3VESA 3QICA 3B6OA 3J8AA 3TTFA 2G8WA 4KKOA 3IDHA 4WFAL 3CFPA 4FO0A 4FJ8A 1IKWA 5HLFA 4BRFA 4IFVA 2XY7A 4A62A 5HRRA 5LMUK 4DR3K 1N32K 1XHXA 1ZYQA 4BGAA 2WTUA 1XMQK 4WFBL 4M3ZA 3F9MA 4YOXA 2YHXA 3C0BA 1C1AA 4DWIA 5KQDA 3SQ1A 3RMDA 2OPPA 2P9PB 2Z1IA 1VQON 4ZHRA 1ITGA 2DFHA 5JLFA 1T6CA 1BIUA 3C65A 5KPZA 5BRDA 3TWHA 3NE6A 4CJ3A 3A2FA 3LAMA 3MN6A 1K8AO 4J2AA 3AV9A 1ZBHA 1IG9A 3PX0A 1T8EA 3K9KA 4FW2A 1WN7A 5SZTA 3SUOA 1RGIA 4F3TA 1ZBSA 3TARA 1VQ5N 1VSDA 1HLUA 3KLGA 3K58A 3TSUA 3L6QA 1EETA 3WNGA 3NMUA 4AHCA 3HP9A 1GOCA 4I9LA 1X3NA 2YHBA 3FFIA 3NH0A 1A5VA 4EIAA 4BVPA 2WBNA 3RRHA 2P9PA 3KHYA 4RG8A 2OPQA 2D1KA 2YI1A 2E6LA 4H0VB 1OH7A 4C1NI 4G9ZA 3MEDA 3QEWA 1RDAA 3LP0A 2ZGZA 3MMVA 3PIPL 3TAEA 3VQPA 1U4BA 1BI4B 3F9KA 3SQ4A 2BGGA 1YHQN 5BR9A 4YOWA 3TSPA 4YDUC 3JAMO 3G10A 3IS9A 4O8KA 2IS3A 1QSSA 3ZSYA 3NVKA 1RT6A 4DU3A 3WNHA 4DTMA 1ZBUA 4KV8A 4JI0K 3VGKA 5D3GA 4IG3A 3LM2A 3O9QA 4JKCA 3LP3A 3FZLA 3L4IA 1OH8A 5FPEA 1X1PA 3KLIA 4LD0A 3CQ8A 1WSGA 5B8HA 1UA1A 4RW6A 4JRPA 3SJHA 3V9ZA 2HW3A 1VQLN 1RNHA 3ATUA 3ITHA 4DFMA 3RMBA 4DSIA 3J7ZO 1T05A 3VEWA 3UE5A 3HP6A 4DSEA 3ID6A 4MFBA 5AQTA 3AVFA 4FM1A 1TKZA 1NOYA 2GUIA 1BI4A 4CJ5A 2HHTA 5EU7A 4IFEA 2HHQA 2GEMA 1C6VA 1VQ6N 4DV6K 2PFUA 3NF6A 2D0PA 3P83D 2P9LB 3W0LA 1FXXA 1S1WA 1GLLO 5AQGA 4FLYA 4FOIA 1N8RO 5AR0A 3CC4N 3ZX3A 4I6MB 3SPYA 4CK3A 2HNDA 1VSEA 4BE0A 4LF5K 3VQBA 4PHTX 2VGMA 5LJWA 4PKGA 1S6QA 1DT9A 1JL2A 4FM0A 4JK8A 2QA4N 3VQ5A 1KRPA 5M1PA 2NNWA 3U6FA 1QHAA 1NGDA 4IJNA 5CYQA 1K9MO 4FLUA 5DM7L 3L8BA 4M3UA 1JJ2M 4DSFA 2NRXA 3O9UA 3VEXA 4F2SA 1S3XA 2YJEA 4KB0A 3ZEUB 4XEIA 2HHHK 4AH9A 3DLKA 3DOLA 4CJRA 3ZSQA 1VSHA 1M90O 2UXBK 1EWQA 2YNGA 1ILYA 2P9LA 2YNFA 4BREA 3ZT3A 4OGEA 3EKSA 4BY9C 2GV9A 4HHTA 4YOTA 2P51A 1IJJA 5CY4A 3K5NA 4CJKA 4X64K 4YHHK 4L3QA 3T69A 4I7FA 2QWLA 4WQ5A 3RSEA 3KZBA 4LF8K 1YTUA 3DMJA 5BPNA 3CQYA 3CCUN 1UOCA 2W6LA 5ADXA 3C94A 4IO9L 4PQUA 5AQWA 5AQIA 4QCLA 3ZT1A 4O5FA 2F8TA 3I56N 1VQ8N 1YVNA 3BZCA 1HX1A 3CG7A 3O9RA 2Q0UA 1KCFA 3FFKB 3QNNA 4CK2A 4BE2A 1NJWA 1NK0A 4LFCK 2HHUA 4E7IA 4NLCA 4AF1A 1QQNA 3A5NC 2P9KB 3OY9A 2X78A 1C0FA 5KGWA 4KHWA 2V52B 1CZAN 5KTQA 3ZEUA 3CF5L 1SL1A 1VAZA 5K14A 4DLEA 5SWMA 3JS6A 3PO5A 1BL3A 3BUZB 3EZWA 2QW9A 3ATVA 4H0OA 3O3FA 3TAPA 2E20A 3M1FA 4O0IA 4Y1DA 3QLHA 4F9OA 3LWLA 3QBXA 3I0SA 2QWQA 5I9EB 1T3VA 3GDQA 3U9ZA 3MX5A 1RCHA 2E2NA 4CJUA 3NGYA 2UUCK 1NK9A 2OPSA 1TAQA 4RTFD 2WUSA 1RBVA 2VYPA 3G25A 2DY4A 3LZIA 3CCRN 3BGRA 3THVA 1LAWA 1SL0A 1S1XA 4TSXA 2RE2A 1I3AA 3VQAA 4FJ5A 3H45C 4H5VA 4X62K 3IUCA 4CHOA 1VQPN 1YI2N 4C8OA 2P9KA 1WSFA 4KH5A 1YUWA 1VSLA 5J2MA 4CBUA 1QSYA 2HNZA 2QM1A 1GOBA 2CH6A 3FR0A 1EXQA 3CCMN 5C2FA 2D5RA 5AQZA 4CERA 2E2PA 3DLGA 1X9JA 4JS5A 2LSNA 4CZMA 4LH4A 4KHPK 2F9TA 2UXDK 1ASUA 4B3RK 4EFHA 4GV3A 4GKJK 1O1WA 2FBYA 3VA3A 1ATRA 3ZSZA 4FVMA 4B3TK 4BVOA 3H46O 4KAZA 4LF7K 3ZT4A 2UU9K 2RN2A 1QQCA 4JD2B 3I55N 2H3GX 3AVJA 4Z4CA 1E3MA 1EO1A 4DCHA 3LL3A 5BR8K 4PUOA 5A2QO 1HYVA 3FGUA 1ATNA 5GAEP 3CMEN 4LFBK 3CFOA 4KTWA 1ZBIA 2BUPA 4H03B 3L2WA 1X9WA 1U04A 4IZ9A 3EKUA 4DSKA 5BN8A 1VQ4N 4BDYA 3QNOA 3K5OA 1VQNN 2HB5A 5F2RA 3M6GA 1TKDA 3P39A 3FZHA 4ILGB 4B1XB 2ZGYA 3QFUA 2VWKA 3Q7BA 3MDQA 4IOXA 3GE1A 1OKJA 3O6WA 3CJ9A 1FK9A 3V9XA 4WE1A 3LWMA 3I8DA 1NKBA 4PY5A 4JD2A 5FPDA 1JLFA 5HOOA 3RVCA 3LZJA 3UKRB 4CZIA 1GLEG 1TUYA 2IC3A 4CHYA 3U9DA 2CGJA 4F8RA 2YCHA 3I8BA 3ZETB 5EX5A 3NH1A 2Q1NA 1GLBG 2ATQA 2IVPA 3CJ1A 1XC3A 1KTQA 3D7EO 4NB4A 3C7NB 4JRQA 4CZKA 4DR7K 4E7JA 2WONA 2XY6A 1J5EK 5CHIA 1RTIA 5HRNA 2D4WA 4OJRA 1BWFO 4N47A 4CF1A 3KLFA 2X6NA 4CVNE 1FJGK 1TK8A 4BRAA 1W0HA 4CJFA 4DTNA 1F21A 1J6ZA 4CD1A 3NBPA 2G8UA 1LWEA 3HPGA 2NRTA 1GLDG 4WQ4C 3NCIA 5AQVA 4CBXA 3E66A 4NCBA 3FZFA 3J7AP 3KWIA 3QEVA 1RT5A 4FZXC 3EL2A 3UKRA 3LPTA 5FRNA 4GV6A 3TAFA 3Q7CA 5GIPA 2RHKA 3DLBA 1Q7YO 4YDUA 4DR2K 1TKXA 4M45A 1HJRA 1W97L 4CW7B 4BRCA 3S41A 3IKMA 2Y1JA 1U48A 3C7NA 1BUPA 1VHXA 4DTUA 4JI4K 4YOYA 3V1RA 1NK6A 4AHSA 5FROA 1SKRA 1O13A 2NRWA 2XRIA 1RBTA 2G8HA 1LAVA 3HVTA 3RMCA 3ZYYX 3NGZA 4EP5A 4B1ZA 1RDCA 1Q9XA 4CHNA 1L3VA 4IEEA 1DLOA 2HF3A 4FZZA 2PYLA 3CXCM 4BC5A 3OBWA 1JKHA 4FK0A 3QEPA 3ISNC 2W41A 4HTLA 1HKCA 1OH6A 4OKJA 4JI8K 2FBTA 1C0TA 4BG9A 5H1SQ 3DRRA 1JLGA 3AO2A 4CGDA 4O44A 4PKIA 3IG1A 2RKIA 1K73O 2HF4A 2FLOA 1NJYA 1I39A 4CIFA 3EE8A 1N6QA 1J54A 2Z1GA 3HPOA 3CHWA 4KH6A 1U2VB 1B92A 3VOVA 3H6EA 4CHZA 4EAHD 1C1BA 4M3XA 3O4QA 3OA9A 4FWNA 5JICA 3DLHA 1HQEA 4CZEA 3SZ2A 4CJSA 1HQUA 4CZLA 3EO3A 3CFRA 2E1ZA 4NXMK 4DR1K 3OW2M 3D6RA 5LY3A 2A1SA 1BIZA 4JK9A 2A5XA 2R7YA 2E2OA 4XH4A 2G8IA 4OPKA 3O4NA 4CECA 5JMVA 1MA9B 1NNEA 2HMPA 2ZJQL 5AQPA 1SUQA 2ASOA 3OJSA 3R6MA 2F9WA 4V19S 4FXDA 2WFBA 4Z4EA 3QB0A 3MK6A 3HYFA 2DFEA 1UA0A 3SK3A 1HNZK 1VRUA 4ELUA 1RT4A 1BCMA 3C6TA 3VF6A 5HL7L 4X66K 3PX4A 3RR8A 4IOAL 3C6UA 5GAGP 4DU1A 4FWLA 1EP4A 5C2DA 1QZ6A 3M5RA 5AZJB 3VQ9A 1U45A 3HPHA 1VSIA 2KFNA 4LF4K 4RW8A 1HKBA 4B1VA 4B9QA 5C24A 3V1OA 3LDOA 4DMNA 1KVCA 1NGAA 3AY9A 1XHZA 4HTUA 1JXBA 2PBDA 4JKBA 2JWLA 4LY7A 1HYSA 4DQ8A 4FPBA 1HJOA 4JI2K 4M3YA 2F4VK 3MEGA 1EQYA 2P9SB 4J2DA 4Z4IA 1L3TA 3ZT0A 5HRPA 3IMXA 4FJ7A 1NGEA 4DTSA 4FJXA 3DXKB 4FLZA 4CJQA 2D0AA 1X9MA 1U47A 2RPIA 4NYNA 1MWMA 3CYMA 5JS2A 3B6PA 4LSLA 3D2FB 1TUUA 3BZKA 2ZQBA 1KSPA 1YJ9N 5HP1A 3MXMA 3QDKA 3TU5A 5KRSA 2AP1A 5AZJA 3T19A 3K9JA 1WSHA 4JKDA 4NXNK 2A41A 3VF2A 4DSJA 3AVCA 3NF7A 3MCPA 3ZSWA 3VQEA 3QINA 4DQSA 3CCJN 2IVNA 2EX3A 3B8AX 4Q5VA 3CPEA 3KK2A 3TTDA 1SQKA 1ZC6A 1TYQB 2F7TA 1LV5A 4DR5K 4B9LA 3P38A 4YFUA 1HUXA 4E1MA 5TKWA 2P9SA 2FSNA 4Z94A 3AVBA 4KTQA 1QZ5A 1XQSC 2YHAA 3VTIA 4Y0WA 3DXKA 2PYJA 2E6MA 1W2BM 2AA4A 3PIOL 3TAQA 3THXB 4CFCA 1UAXA 3WXMB 3PY8A 4JKFA 4HUFA 3D2FA 5DMRA 3OTOK 4E0DA 3WXLA 4O8UA 4BWMA 4H5RA 3O3HA 2DFFA 3W3DA 4IJAA 3NF9A 4DU4A 4A5BA 2XY5A 2FC0A 3C6HA 4ELTA 2GELA 2P5GA 1Z26A 4PKHA 1LW2A 2O8BB 5C25A 1NK5A 1NKEA 1RBSA 3ZSVA 2X74A 2PZSA 1ESVA 4J2EA 3S3MA 5HBMA 4CJWA 1JCFA 1DTQA 1RDBA 4N5SA 1NGHA 2D0CA 1TYQA 2WOMA 3K57A 5JS1A 3MN9A 1GLJO 1TVRA 4ICLA 1NGIA 3THWB 3NH2A 2NRZA 5AQJA 4KFBA 1SS6A 1HPMA 5AQKA 3DYAA 4CGHA 4IO8A 1BOTO 3PUFA 3THXA 2KHOA 2VCPA 4JI6K 3HI0A 2HHXA 4FJHA 2ZWHA 4YY3K 4K43A 1E4FT 3NFAA 3AVGA 4W5RA 4CGIA 4B9NA 2KZMA 3VEOA 2A1RA 3OYDA 4FJNA 4CGGA 3AO1A 3HO1A 4RW7A 4BC3A 4Z0UA 3MWPA 3L2RA 1JLEA 2KKZA 3ULEB 3TANA 3RR7A 4A59A 1RILA 5BREA 4IDHA 4AM7A 3CC7N 4F3OA 5HRSA 3QEIA 2O8BA 4FVUA 3E9LA 2OZMA 5CZ1A 3MXIA 1YVUA 3KLHA 5AQMA 1T03A 1ZXOA 2ASMA 1WLJA 4BE1A 3NVMA 1RBUA 3CETA 4GVEA 2PAVA 5EVZA 1YJWN 2O8EB 3P5JA 3ENHA 3THWA 3QBWA 4I6MA 1E4GT 1KD1O 3V9UA 2HNYA 1VQ7N 3WT0A 4ELVA 4M3WA 2F8SA 4WQ4A 1SL2A 3GBTA 4HCCA 3T1YK 4BWJA 5LJVA 2QKKA 4YNQA 2QWMA 3E9PA 2HBKA 3ULEA 3VENA 5CZ2A 3AO4A 3AAQA 2O4IA 4Z4FA 5J2PA 3U3YA 1D9FA 1IG8A 3KD5E 4CEZA 4M3TA 4MLEA 5C12A 3DWLA 3QEXA 4DQIA 2JWKA 5F0XA 3WUHA 5M1QA 1QVGM 4KO0A 1WNSA 3OYCA 3M8QA 4A61A 1FKPA 3F73A 3HVRA 5DM6L 1B9DA 4NO7A 2YV0X 3KD1E 3HK2A 3CJ7A 3A8YA 3I0RA 4ID5A 1VK0A 1XNRK 1H1VA 4C23A 3K59A 4DS4A 1NG9A 1HYZA 4JN4A 2CGLA 4E89A 4ISEA 5C10A 2E2QA 4YOUA 2V7YA 4CJ4A 5AZIB 1QQMA 2ZJPL 2OTJN 2IIRA 4QOZB 2A42A 3SAFA 1QS4A 4CGJA 1Q81O 1WBBA 4FJ9A 2X6SA 2UYTA 2WC9A 4MO5A 2ZM6K 1LCUA 3IFRA 3FE1A 4B9MA 1S9EA 3LP1A 5EXWA 3VERA 3ASMA 4FSVA 4B8CA 3THYB 1NKCA 3DM2A 1C0UA 2NUBA 3HM9A 2YNHA 1MDUB 3AO5A 3A5OC 3J7YP 4KB1A 3CM5A 5AFUH 4AM6A 4LFAK 3VMFB 1JCEA 4O0JA 5LL6Z 1YXQA 1RFQA 1WB9A 3KIOA 3VETA 1NGCA 3CQXA 4CZHA 3OVNA 2ASPA 4M42A 3UIQA 1K8KB 4H5NA 3FZKA 4DLGA 2IDOA 3VPZA 3ZSXA 4BACA 1KQSM 1KFSA 5AZIA 4DTJA 1X3MA 4A2BA 4KHQA 3MWTA 1YF5L 4B08A 3N4QA 3NHGA 3O5BA 2KZZA 3LP2A 3TTCA 1R59O 3UKUB 2HSTA 3THYA 5FRMA 3DLEA 4PL8A 1ASVA 2YNIA 4FJGA 3DRSA 4GMJB 4DQRA 3V4IA 1TV6A 4DR6K 1S22A 4OLAA 2O8DB 4CEOA 3VTHA 3RRGA 4B9UA 3OYFA 3O4WA 1M1KO 5AQRA 3VN5A 4CBWA 5C42A 3V81A 3BY5A 4DR4K 3JXUA 1TK0A 4OLBA 1Q9YA 1C0MA 1K8KA 4UQGA 3P1GA 4XH1A 4FWOA 3ULDA 4DG1A 2O4GA 2FSJA 3AVAA 4Q0BA 4G1QA 5M1KA 2KTQA 4BRDA 3K5MA 1D8YA 1OH5A 3L4QA 1GOAA 4FWKA 2Q2RA 4BQLA 3UKUA 4RW9A 2B5JA 4JKEA 5KGXA 2G8FA 5JVHL 3CI5A 5DK5A 1J53A 4K8ZA 3SMPA 2UXCK 3ENBA 4DF8A 3L0QA 1Y97A 4NLBA 3O9TA 2O8DA 4B1YB 1JLCA 4BRQA 5KI6A 4E19A 2HBJA 4BR9A 1C0GA 4BQZA 4CFBA 4FJIA 4M7XA 3ZX2A 3OS1A 3SPZA 1WSEA 4OX9K 4E7LA 1YITN 2VG7A 2I7PA 4KHSA 2NZTA 2YHWA 3P4IA 1JLBA 1N33K 4CIGA 2QWPA 4DFKA 1S9GA 4N41A 3HSTB 1BO5O 4HUEA 1NGBA 3SNNA 3LDNA 4WFNL 4PA1A 1YJNN 1DKGD 3LALA 3C95A 1KAZA 4FL9A 3I33A 1TAUA 2G8VA 1L5UA 2GBZA 3IRXA 1BQMA 3ZETA 1IO2A 1BA0A 2I5JA 4MLHA 2HHWA 4IOCL 4A2AA 4WCEL 4KI4A 5CR4A 3ALYA 4FZYA 5E41A 4YOVA 3PX6A 4FW1A 1EKEA 3OYKA 2E4LA 4B9SA 4F2RA 5J1EA 5C0YA 2VQEK 1W9HA 4N56A 1G99A 1XWLA 4KREA 3O8MA 3QIPA 4Z4HA 2HBLA 4OGCA 4BRMA 4FWPA 4R79A 4FLXA 4EHUA 3F5TA 5BPLA 5FDLA 4L8RB 1KLNA 4CZFA 3VQ7A 4A5AA 3VEYA 3CJBA 1TL3A 4ILJA 2NLXA 2CGKA 2E88A 3PSIA 3QESA 3U8XA 1RT1A 2GUPA 1IKYA 1DEJA 1NJZA 4LSNA 1Q82O 4JI7K 1REVA 2B4JA 2OYQA 3SV4A 3EZ5A 1EX4A 3SAHA 5MLCQ 1NGFA 1IKXA 3AA5X 5KPTA 2KLAA 1RT2A 4NCGA 1P90A 4CHPA 4BRPA 3ZSOA 4CJVA 3BDPA 2VG6A 3E9OA 3LDQA 2V51B 5BPMA 3L2UA 5ELZA 4FLVA 3S9HA 4C8NA 3WXJA 1JXEA 3SQ0A 1TK5A 4BR4A 4HWIA 4BRKA 1T7PA 1NK4A 3AVNA 2HOEA 3WNEA 1YT3A 5EY4A 4DFJA 1WAJA 3TI0A 1KFDA 2P9NB 3DLRA 1Z05A 5CYMA 3DLLL 1VQMN 3OJUA 3VQ6A 5F1XA 3VGLA 2FBVA 3WEEB 2OPRA 4M7YA 3FLCO 5I3UA 3M8PA 2XO7A 4BRGA 5CE3A 4J2BA 3HM8A 4B1WB 1KVBA 1A5XA 4B3MK 3BP8A 5KQ8A 1IBMK 4BR5A 1HNXK 1WAFA 3KVGA 4XIUA 4OO1J 3ENOA 2QEXN 4DKWA 2Q36A 4CJLA 2GWJA 2BTFA 5M1NA 4DV3K 2KFZA 5TKYA 4K42A 1W7AA 4OVLA 4NYFA 2ETJA 1U6ZA 4O55A 4OPHA 1GLFO 1KLMA 4FK2A 3AA2A 4WF9L 1U2VA 1JLQA 3AVKA 4CZGA 3HXMA 3LANA 3MCAB 3K5LA 1X9SA 4FJLA 2HBMA 4KHYA 4CEFA 4FYDA 1QQOA 4DTOA 1NLVA 1LWCA 3RTVA 2P9NA 3NF8A 4QS7A 4FJKA 4FWMA 4B9TA 3WEEA 2OA8A 1RTJA 3VQCA 5FPMA 1HNVA 2W6KA 4ZTFA 4W5QA 4I2PA 1YIJN 4B8AB 4EHTA 2QWRA 2ZE2A 4BROA 5C15A 2QKBA 1R0AA 1IKVA 1RDUA 3G4SN 2G8KA 4B3SK 4UY8O 4W5NA 4AQYK 1A5WA 4CJEA 3CCEN 3EE9A 2FF3B 4CD3A 1ASWA 3QETA 1BQNA 4C8MA 4FLTA 3NDKA 4DTXA 4BC4A 1HR0K 1Z6RA 4GY2B 4ZTJA 4IBNA 3TABA 4AHTA 2FSKA 1WSIA 3OS2A 5E84A 3J81O 2QTDA 2FF6A 4MQ3A 3OYMA 4KH4A 4BRHA 1ATSA 2XHBA 4BC2A 2OCEA 3GG4A 1LW0A 4M63C 3CCLN 2Z1JA 2BDPA 2HVIA 3M8SA 4DHYA 1BDGA 3KKSA 3L2VA 4CJTA 2I7NA 1QTMA 3OYBA 4DV2K 3CC2N 2ZD1A 3RWUA 2FXUA 3ZCMA 4K41A 5AQXA 4CHQA 4BR2A 2RF2A 2Q97A 3DJCA 4IFYA 1D4XA 2HHSA 4IEIA 3QO9A 3SUPA 5IWAK 2A3ZA 3SBGA 3KJVA 3T1AA 4GVMA 1HNWK 1HNIA 2J4RA 3JYTA 1GLCG 1RDWX 4EZ9A 2E8AA 2OANA 4GW6A 2QI2A 3AVHA 1VSFA 4YORA 2XY8A 5BRHA 2E5LK 1KAXA 1EWRA 4CE9A 4CF0A 4H0YB 1HMVA 3OS0A 4HCBA 1XMOK 1B9FA 5JVGL 1KXPA 1DGKN 2NRVA 2P9UB 4E7HA 4KHUA 1HRHA 1YTAA 4GV9A 2HHVA 2AJQA 2P9IB 3CCSN 1NK8A 4QS9A 3LAKA 4CESA 1CXQA 4U7BA 2YJFA 3S3NA 2F96A 5IT9O 1NWKA 4JNEA 4CEAA 4BG8A 3D0PA 2E1YA 4JK7A 4DF4A 2OZSA 4I2QA 5AQQA 3KK1A 3EN9A 5J2QA 4FOEA 3AO3A 4H0PA 4CIEA 3T1HK 3VF4A 4OKKA 3SUQA 1BU6O 1XUPO 5AQNA 3KK3A 4KRFA 1OVQA 5GIOA 1KAYA 1WBDA 4CF2A 4DQPA 1KC8O 2YHYA 1K6YA 4DUZK 3H3NO 4X65K 1IH7A 2VQFK 3SJJA 4CCHA 1HPZA 2P9UA 2QXFA 1XI1A 1MWKA 3AVIA 2P9IA 4CFDA 1Y64A 4DV5K 1FKOA 3RSEB 4KI6A 3O80A 1BA1A 1S72N 4IXCA 3R1XA 4ID1A 1RTHA 3V1QA 4CF9A 4U67L 1J9AA 1NMNA 4H5WA 4PWDA 4B1UB 4ILHA 3MXJA 5GAHP 3CCVN 4BDZA 4FM2A 3VQQA 2Z1HA 2GWKA 4MDAA 3R9PA 3VQ4A 4RCHA 4FLWA 3BEXA 3CCQN 1RT7A 2D0BA 1NK7A 2EWSA 1NMDA 1IV0A 4FPAA 1ZBFA 3AARA 4JKAA 1VQ9N 2PY5A 2DPNA 3CM6A 2NRRA 4HVJA 1YAGA 3CIPA 4DTPA 5KRTA 4ISGA 3SCXA 4E1NA 3HT3A 4CGFA 4BRIA 2A6AA 4QAGA 4W5OA 1NJXA 4MO4A 3HBTA 3KK7A 5JLHA 3NAEA 3ZLJA 4AILC 1NU0A 2P1JA 4OPAA 1XC9A 3LDPA 3PO4A 4GKKK 3E01A 1N36K 1RTDA 4LF6K 4KBOA 2BE2A 3HL8A 1SAZA 4F4KA 3TR8A 4M41A 4LC9B 3SI6A 3LDLA 1Q8IA 4B9VA 5ADXH 5HROA 2Q31A 1IBKK 3OBYA 1LWFA 2O8EA 3S3OA 2NRHA 4KPYA 4K8XA 3P31A 3TAMA 3V9SA 3AGKA 3L3UA 4IWVA 3A5LC 1RBRA 3K2PA 2HMIA 5AQOA 5J2NA 3O9SA 4EZ6A 3PSFA 2VWBA 3G6EN 4OKEA 5BRFA 3T3FA 3L2QA 2YX6A 1VQKN 1G15A 4Z4GA 5M1FA 5T7BA 5AFUA 3M8RA 4E7KA 1Q18A 3DXMB 2CH5A 4JAXA 1SV5A 4QS8A 4DFPA 1BG3A 3MX2A 4BGBA 4JKHA 3JSMA 3LM9A 3CJCA 4R5PA 3AAPA 3CPWM 4KHNA 3CERA 4CF8A 3KTQA 4JI5K 3CMAN 2O8CB 4A57A 3QERA 4W5TA 2GX9A 3V6DA 3M3ZA 1JCGA 3AVLA 3OYAA 4H4OA 2VWJA 3HTVA 3KWGA 1WUAA 3SLCA 4CEBA 3SYZA 4CFAA 3O08A 4H8KA 3H1VX 4N76A 1VRTA 3O3GA 1CZ9A 2YKNA 1NBWA 3MN5A 3SBTA 3IAYA 3OYIA 1RT3A 1SKSA 4DQQA 4DV1K 2O8FB 1CZBA 2QWNA 4DV4K 4I9QA 4WYBA 2KW4A 4E3SA 2D0OA 2VGNA 5LMNK 3V9WA 3WNFA 1MU2A 4J8FA 1N5YA 3OYLA 2ITMA 3DXMA 1JLAA 3BF1A 4DSLA 1SKWA 3MAQA 2JGUA 4BDPA 2GTDA 3VQDA 4CJPA 3N4PA 4FK4A 2UUAK 2O8CA 1S1UA 4CK1A 3VGMA 3C6AA 1BISA 1U49A 4JKGB 1L3UA 3CD6N 3A5MC 5EOYA 2ZF5O 3TPQA 3VEVA 4DUYK 2YKMA 1NOZA
chains in the Genus database with same CATH topology
4H0TB 4JKDA 5BPNA 3CQYA 5GADP 3QMLA 3F2KA 3AGRA 4XH5A 3T7ZA 3TSQA 3SAHA 5ADXA 2A41A 3VF2A 4IO9L 5MLCQ 5AQWA 1NGFA 5AQIA 2W40A 3MCPA 4FWQA 4O5FA 5KPTA 2KLAA 3CCJN 2IVNA 2A40A 3B8AX 3I56N 1VQ8N 3CPEA 1P90A 5E26A 1YVNA 3O9RA 1HX1A 4BRPA 2Q0UA 3FFKB 3TTDA 1SQKA 1OVYA 1ZC6A 1TYQB 3E9OA 2F7TA 3LDQA 2V51B 4NLCA 5BPMA 4AF1A 1QQNA 5ELZA 3A5NC 3G71N 3P38A 2P9KB 1HUXA 3WXJA 5AQSA 5TKWA 2P9SA 2FSNA 4BR4A 4HWIA 4BRKA 1C0FA 4Z94A 2V52B 1CZAN 2HOEA 1QZ5A 1XQSC 3ZEUA 3CF5L 3VTIA 1VAZA 4Y0WA 3DXKA 5EY4A 1W2BM 4BRNA 3JS6A 2AA4A 3PIOL 2P9NB 3BUZB 3DLLL 1Z05A 1VQMN 4DB3A 3OHRA 2ZJRL 3EZWA 3WXMB 5F1XA 3VGLA 2QW9A 3ATVA 4H0OA 4JKFA 3WEEB 2E20A 4M7YA 3FLCO 3D2FA 3M1FA 5AQLA 5GINA 3WXLA 4BRGA 4F9OA 3QBXA 5CE3A 2QWQA 3HM8A 1T3VA 3GDQA 4JKGA 4O8UA 3U9ZA 4B1WB 5I9EB 3FZMA 3MX5A 3BP8A 2E2NA 3H1QA 3HZ6A 1V4SA 4H5RA 4BR5A 5KQ8A 3O1WA 5AQHA 2Q0RA 3W3DA 3GL1A 4IJAA 3O1BA 3KVGA 4RTFD 3PLAA 3UB5A 4OO1J 2WUSA 3HOTA 3ENOA 4A5BA 3C6HA 2QEXN 4DKWA 2GELA 2Q36A 3U4LA 4PKHA 2VYPA 3G25A 3DAWA 2GWJA 3CCRN 2QXLA 3WXKA 2BH1A 2BTFA 3WXIA 5M1NA 1ESVA 5TKYA 4K42A 4BRLA 1JCFA 2RE2A 4JHDB 3H45C 4H5VA 1U6ZA 1NGHA 4OPHA 3IUCA 1NGGA 4WQ5C 1GLFO 1TYQA 3MN9A 4WF9L 1VQPN 1U2VA 1GLJO 1YI2N 4CZGA 2P9KA 3MCAB 3E1YA 4BR7A 1NGIA 4KH5A 1YUWA 2NRZA 5AQJA 2HBMA 1SS6A 1QQOA 4CBUA 1HPMA 5AQKA 4IO8A 1NLVA 1BOTO 3WQTA 1WOQA 2QM1A 2CH6A 2P9NA 3D2EB 2KHOA 2VCPA 3FR0A 4QS7A 5AQUA 3HI0A 4FWMA 3CCMN 5C2FA 2ZWHA 5BN9A 5AQZA 4K43A 3WEEA 1E4FT 2E2PA 1X9JA 5FPMA 4CZMA 1NGJA 3VEOA 1YIJN 1T6DA 4EHTA 2F9TA 2QWRA 4BC3A 4BROA 4EFHA 3MWPA 3WQUA 4GV3A 5C15A 2KKZA 1ATRA 3ULEB 5KPRA 1RDUA 3G4SN 4A59A 4UY8O 5BREA 4IDHA 4AM7A 3CC7N 3CCEN 5AQYA 4BVOA 3H46O 3EE9A 2FF3B 4CD3A 4GNIA 4FVUA 3E9LA 1SZ2A 3SMSA 2OTLN 3ZX0A 4BC4A 3H3OB 4RWTA 1Z6RA 4GY2B 1V4TA 4JD2B 3I55N 3QFPA 2H3GX 5AQMA 1ZXOA 2FSKA 4JHDA 5E84A 2ASMA 2QTDA 2FF6A 1Q86O 5AQFA 1EO1A 3R8EA 4KH4A 4BRHA 1ATSA 3NVMA 4BC2A 3CJAA 4DCHA 3GG4A 3LL3A 4M63C 3CETA 4GVEA 3CCLN 2PAVA 5EVZA 1YJWN 3ENHA 3FGUA 1ATNA 1GLAG 3QBWA 1BDGA 4I6MA 1E4GT 4DHYA 5GAEP 3CMEN 1KD1O 2I7NA 2BUPA 4H03B 1LOTB 3D2EA 1VQ7N 4IZ9A 2V7ZA 3EKUA 3WT0A 3CC2N 4WQ4A 2FXUA 4H5TA 2IVOA 3GBTA 4K41A 5AQXA 5BN8A 1VQ4N 5FPNA 3ID8A 4CI6A 5F2RA 1VQNN 4BR2A 2Q97A 3DJCA 3M6GA 1D4XA 3P39A 5LJVA 4IEIA 3FZHA 2A3ZA 3SBGA 4ILGB 2QWMA 3E9PA 4B1XB 4C1NK 2HBKA 3R3LA 2ZGYA 3QFUA 1NM1A 3Q7BA 3ULEA 3VENA 3MDQA 4IOXA 3GE1A 3AAQA 1OKJA 3O6WA 2J4RA 1GLCG 1RDWX 3CJ9A 4PL7A 3MN7A 1IG8A 2E8AA 1P8ZA 2OANA 3GOIA 4MLEA 3DWLA 5C12A 4CJ7A 2QI2A 4FWRA 4CZJA 2JWKA 4YORA 5BRHA 4JD2A 5F0XA 1KAXA 3WUHA 3HSCA 4H0XB 4H0YB 5M1QA 5FPDA 1QVGM 4A61A 4FWSA 5HOOA 3RVCA 3UKRB 4CZIA 3HRGA 3A0IX 1GLEG 1TUYA 5DM6L 5JVGL 1KXPA 4NO7A 3CJ7A 3A8YA 4K25A 1DGKN 1HKGA 2NRVA 2P9UB 4GV9A 2QWOA 2P9IB 3CCUN 1H1VA 3SAGA 3U9DA 2CGJA 3HOSA 2YCHA 4JEPA 3CCSN 1NJIO 3I8BA 3ZETB 1T44A 5EX5A 4C23A 2Q1NA 3BF3A 4QS9A 1GLBG 4BR0A 2IVPA 3CJ1A 1XC3A 3D7EO 4ISFA 4NB4A 4JN4A 2CGLA 4MDBA 3C7NB 5M1OA 4ISEA 2YJFA 5C10A 4CZKA 4U7BA 2E2QA 1NWKA 4YOUA 3VEZA 1QVFM 2V7YA 4JNEA 3VESA 3QICA 4E1JA 5CHIA 5AZIB 4BG8A 1QQMA 2ZJPL 2OTJN 2D4WA 3J8AA 3TTFA 2E1YA 1BWFO 2IIRA 3IDHA 4JK7A 4WFAL 2A42A 4FO0A 3SAFA 5AQQA 4BRAA 1Q81O 3EN9A 2UYTA 2WC9A 4FOEA 4H0PA 4MO5A 1J6ZA 4CD1A 4BRFA 1LCUA 3IFRA 2NRTA 1GLDG 3FE1A 4WQ4C 3VF4A 4A62A 5AQVA 4CBXA 5EXWA 3VERA 1BU6O 4FSVA 1XUPO 4IOCL 5AQNA 4BGAA 3E66A 3FZFA 1MDUB 3KWIA 5GIOA 1KAYA 4WFBL 3F9MA 3A5OC 4YOXA 1KC8O 2YHYA 2YHXA 3EL2A 3H3NO 3UKRA 3C0BA 5AFUH 4GV6A 5KQDA 4AM6A 3Q7CA 5GIPA 2RHKA 3VMFB 1Q7YO 1JCEA 2P9PB 2P9UA 4YDUA 1YXQA 1MWKA 1RFQA 1VQON 1W97L 2P9IA 3VETA 4BRCA 3S41A 1Y64A 1NGCA 3RSEB 3CQXA 3O80A 1BA1A 4CZHA 1S72N 4IXCA 3R1XA 2ASPA 4U67L 3IKMA 5JLFA 1K8KB 4H5WA 3FZKA 4H5NA 3C7NA 4ILHA 1BUPA 4B1UB 1T6CA 3VPZA 5GAHP 3CCVN 3C65A 5KPZA 4YOYA 1KQSM 5BRDA 5AZIA 3MN6A 1X3MA 1K8AO 2GWKA 4MDAA 3R9PA 1O13A 2NRWA 4RCHA 3BEXA 4A2BA 3CCQN 3MWTA 3K9KA 1YF5L 3N4QA 2EWSA 1RGIA 3O5BA 1ZBSA 3ZYYX 1NMDA 3TTCA 4FPAA 4JKAA 3AARA 1VQ9N 2DPNA 2NRRA 4B1ZA 1R59O 1YAGA 2HSTA 3UKUB 1VQ5N 3CIPA 4PL8A 1HLUA 4IEEA 3TSUA 3L6QA 2HF3A 3NMUA 4ISGA 3CXCM 4BC5A 3OBWA 1X3NA 4BRIA 1S22A 2A6AA 2W41A 4HTLA 1HKCA 4EIAA 3VTHA 4MO4A 4BVPA 3HBTA 3KK7A 2WBNA 2P9PA 3KHYA 3O4WA 5AZJA 5JLHA 1M1KO 4BG9A 5H1SQ 2D1KA 2YI1A 4H0VB 4OPAA 5AQRA 4C1NI 4CBWA 4G9ZA 3JXUA 3LDPA 4PKIA 2ZGZA 3MMVA 3PIPL 1K8KA 1K73O 1YHQN 2HF4A 4XH1A 5BR9A 4YOWA 3TSPA 4YDUC 4KBOA 4FWOA 1SAZA 2FLOA 4O8KA 2FSJA 4LC9B 3EE8A 3NVKA 3LDLA 5M1KA 3CHWA 5ADXH 4KH6A 1U2VB 2Q31A 4BRDA 3OBYA 3VOVA 3L4QA 4FWKA 2NRHA 2Q2RA 4BQLA 3VGKA 3H6EA 4EAHD 3UKUA 3LM2A 3OA9A 3O9QA 3P31A 4FWNA 3FZLA 4JKCA 4JKEA 3L4IA 5JICA 5JVHL 5FPEA 4CZEA 3CI5A 3AGKA 4IWVA 3A5LC 4CZLA 3EO3A 2E1ZA 3SMPA 3ENBA 5B8HA 3L0QA 5AQOA 4NLBA 3O9TA 3O9SA 3OW2M 3D6RA 3SJHA 5LY3A 4JK9A 4B1YB 1VQLN 2A5XA 2E2OA 4XH4A 3ATUA 3G6EN 2VWBA 4BRQA 5BRFA 3J7ZO 2HBJA 4BR9A 1C0GA 4BQZA 3VEWA 2YX6A 5JMVA 1VQKN 1MA9B 4M7XA 3UE5A 3ZX2A 2HMPA 2ZJQL 5AQPA 3ID6A 5M1FA 2ASOA 5AQTA 5AFUA 1YITN 2I7PA 3R6MA 2F9WA 1Q18A 2NZTA 3DXMB 2YHWA 3P4IA 2WFBA 2CH5A 4JAXA 3QB0A 3MK6A 4IFEA 2GEMA 1VQ6N 4QS8A 2QWPA 3SK3A 1BG3A 3MX2A 2PFUA 4BGBA 4JKHA 3LM9A 3CJCA 3AAPA 1BO5O 3CPWM 2D0PA 2P9LB 1NGBA 3W0LA 3VF6A 3CERA 5HL7L 4IOAL 3CMAN 3LDNA 4A57A 4WFNL 5GAGP 1GLLO 5AQGA 1YJNN 1DKGD 2GX9A 4FWLA 1KAZA 4FOIA 3M3ZA 1N8RO 4FL9A 5AR0A 3CC4N 3I33A 3ZX3A 4I6MB 1JCGA 5C2DA 1QZ6A 3M5RA 3ZETA 5AZJB 3HTVA 3KWGA 1WUAA 3SLCA 1BA0A 2VGMA 3O08A 4PHTX 3H1VX 1HKBA 4MLHA 4PKGA 4B1VA 4B9QA 4A2AA 4WCEL 5LJWA 3MN5A 1DT9A 1NBWA 5CR4A 3SBTA 3LDOA 4JK8A 4YOVA 2QA4N 1NGAA 3AY9A 5M1PA 2PBDA 4JKBA 2NNWA 2JWLA 2QWNA 1QHAA 1NGDA 4IJNA 1K9MO 5C0YA 4DQ8A 4FPBA 1HJOA 5DM7L 1G99A 4WYBA 3O8MA 2HBLA 2D0OA 1JJ2M 2VGNA 2NRXA 3O9UA 3VEXA 4BRMA 4J8FA 1EQYA 1S3XA 2P9SB 4FWPA 2YJEA 4R79A 3IMXA 2ITMA 1NGEA 3F5TA 4EHUA 5BPLA 3DXMA 3ZEUB 4XEIA 3BF1A 4CZFA 3DXKB 4A5AA 3VEYA 3CJBA 4ILJA 1M90O 2NLXA 1ILYA 1MWMA 2GTDA 2P9LA 4BREA 2CGKA 2E88A 3N4PA 3D2FB 1TUUA 3VGMA 3C6AA 3U8XA 2GUPA 4BY9C 3EKSA 1YJ9N 4YOTA 1DEJA 4JKGB 3CD6N 1IJJA 3A5MC 5EOYA 2ZF5O 3QDKA 3TPQA 3TU5A 1Q82O 3VEVA 2AP1A 4L3QA 3T69A 2QWLA 4WQ5A 3RSEA 3KZBA 3K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0T B;  5BPN A;  3CQY A;  3QML A;  4XH5 A;  5ADX A;  2A41 A;  3VF2 A;  5AQW A;  1NGF A;  5AQI A;  2W40 A;  3MCP A;  4FWQ A;  4O5F A;  5KPT A;  2IVN A;  2A40 A;  3B8A X;  5E26 A;  1YVN A;  4BRP A;  1HX1 A;  2Q0U A;  3FFK B;  1SQK A;  1ZC6 A;  1TYQ B;  3LDQ A;  2V51 B;  5BPM A;  1QQN A;  5ELZ A;  3A5N C;  2P9K B;  1HUX A;  3WXJ A;  5AQS A;  2P9S A;  2FSN A;  4BR4 A;  4HWI A;  4BRK A;  1C0F A;  4Z94 A;  2V52 B;  1CZA N;  2HOE A;  1QZ5 A;  1XQS C;  3ZEU A;  4Y0W A;  3DXK A;  5EY4 A;  4BRN A;  3JS6 A;  2AA4 A;  2P9N B;  3BUZ B;  1Z05 A;  4DB3 A;  3OHR A;  3EZW A;  5F1X A;  3VGL A;  2QW9 A;  3ATV A;  4H0O A;  3WEE B;  2E20 A;  4M7Y A;  3FLC O;  3D2F A;  3M1F A;  5AQL A;  3WXL A;  4BRG A;  4F9O A;  3QBX A;  5CE3 A;  2QWQ A;  3HM8 A;  3GDQ A;  4B1W B;  5I9E B;  3U9Z A;  3FZM A;  4H5R A;  3BP8 A;  2E2N A;  3H1Q A;  3HZ6 A;  1V4S A;  5KQ8 A;  4BR5 A;  3O1W A;  5AQH A;  2Q0R A;  3W3D A;  3GL1 A;  4IJA A;  3O1B A;  3KVG A;  4RTF D;  3UB5 A;  2WUS A;  3ENO A;  2GEL A;  2Q36 A;  3U4L A;  4PKH A;  2VYP A;  3G25 A;  3DAW A;  2GWJ A;  2QXL A;  3WXK A;  2BTF A;  3WXI A;  1ESV A;  5TKY A;  4K42 A;  4BRL A;  1JCF A;  4JHD B;  3H45 C;  4H5V A;  1U6Z A;  1NGH A;  3IUC A;  1NGG A;  4WQ5 C;  1GLF O;  1TYQ A;  3MN9 A;  1U2V A;  1GLJ O;  4CZG A;  2P9K A;  4BR7 A;  1NGI A;  1YUW A;  5AQJ A;  1QQO A;  4CBU A;  1HPM A;  5AQK A;  4IO8 A;  1NLV A;  1BOT O;  3WQT A;  1WOQ A;  2QM1 A;  2CH6 A;  2P9N A;  3D2E B;  2KHO A;  2VCP A;  3FR0 A;  4QS7 A;  5AQU A;  3HI0 A;  4FWM A;  2ZWH A;  5BN9 A;  5AQZ A;  4K43 A;  3WEE A;  1E4F T;  2E2P A;  1X9J A;  5FPM A;  4CZM A;  1NGJ A;  3VEO A;  1T6D A;  4EHT A;  2F9T A;  2QWR A;  4BC3 A;  4BRO A;  4EFH A;  3WQU A;  3ULE B;  1ATR A;  5KPR A;  5BRE A;  4AM7 A;  5AQY A;  4BVO A;  3H46 O;  2FF3 B;  4CD3 A;  4GNI A;  1SZ2 A;  3SMS A;  3ZX0 A;  4BC4 A;  3H3O B;  4RWT A;  1Z6R A;  4GY2 B;  1V4T A;  4JD2 B;  3QFP A;  2H3G X;  5AQM A;  1ZXO A;  2FSK A;  4JHD A;  5E84 A;  2ASM A;  2FF6 A;  5AQF A;  3R8E A;  4BRH A;  1ATS A;  4BC2 A;  3CJA A;  4DCH A;  3GG4 A;  3LL3 A;  4M63 C;  3CET A;  2PAV A;  5EVZ A;  3ENH A;  3FGU A;  1ATN A;  1GLA G;  3QBW A;  1BDG A;  4I6M A;  1E4G T;  4DHY A;  2I7N A;  2BUP A;  4H03 B;  1LOT B;  3D2E A;  4IZ9 A;  2V7Z A;  3EKU A;  3WT0 A;  4WQ4 A;  2FXU A;  4H5T A;  2IVO A;  3GBT A;  4K41 A;  5AQX A;  5BN8 A;  5FPN A;  3ID8 A;  4CI6 A;  5F2R A;  4BR2 A;  2Q97 A;  3DJC A;  3M6G A;  1D4X A;  5LJV A;  3FZH A;  2A3Z A;  2QWM A;  4B1X B;  2ZGY A;  3QFU A;  1NM1 A;  3ULE A;  3VEN A;  3MDQ A;  3GE1 A;  3AAQ A;  1OKJ A;  3O6W A;  2J4R A;  1GLC G;  1RDW X;  3CJ9 A;  4PL7 A;  3MN7 A;  1IG8 A;  2E8A A;  1P8Z A;  2OAN A;  3GOI A;  4MLE A;  3DWL A;  4CJ7 A;  4FWR A;  4CZJ A;  5BRH A;  4JD2 A;  5F0X A;  1KAX A;  3WUH A;  3HSC A;  4H0X B;  4H0Y B;  5FPD A;  4A61 A;  4FWS A;  3UKR B;  4CZI A;  3A0I X;  1GLE G;  1TUY A;  1KXP A;  4NO7 A;  3CJ7 A;  3A8Y A;  4K25 A;  1DGK N;  1HKG A;  2P9U B;  2QWO A;  2P9I B;  1H1V A;  3U9D A;  2CGJ A;  2YCH A;  3I8B A;  3ZET B;  1T44 A;  5EX5 A;  4C23 A;  2Q1N A;  3BF3 A;  4QS9 A;  1GLB G;  4BR0 A;  2IVP A;  3CJ1 A;  1XC3 A;  3D7E O;  4ISF A;  4NB4 A;  4JN4 A;  2CGL A;  3C7N B;  4ISE A;  2YJF A;  4CZK A;  2E2Q A;  1NWK A;  3VEZ A;  2V7Y A;  4JNE A;  3VES A;  3QIC A;  4E1J A;  5AZI B;  4BG8 A;  1QQM A;  2D4W A;  3J8A A;  2E1Y A;  1BWF O;  2IIR A;  3IDH A;  2A42 A;  4FO0 A;  5AQQ A;  4BRA A;  3EN9 A;  2UYT A;  4FOE A;  4MO5 A;  4H0P A;  1J6Z A;  4CD1 A;  4BRF A;  1LCU A;  3IFR A;  3FE1 A;  1GLD G;  4WQ4 C;  3VF4 A;  4A62 A;  5AQV A;  4CBX A;  5EXW A;  3VER A;  1BU6 O;  4FSV A;  1XUP O;  5AQN A;  4BGA A;  3FZF A;  1MDU B;  1KAY A;  3F9M A;  3A5O C;  2YHY A;  2YHX A;  3EL2 A;  3H3N O;  3UKR A;  3C0B A;  5AFU H;  5KQD A;  4AM6 A;  1JCE A;  2P9P B;  2P9U A;  4YDU A;  1YXQ A;  1MWK A;  1RFQ A;  2P9I A;  3VET A;  4BRC A;  3S41 A;  1Y64 A;  1NGC A;  3RSE B;  3CQX A;  3O80 A;  1BA1 A;  4CZH A;  4IXC A;  2ASP A;  5JLF A;  1K8K B;  4H5W A;  3FZK A;  4H5N A;  3C7N A;  4B1U B;  1BUP A;  1T6C A;  3VPZ A;  5KPZ A;  5BRD A;  5AZI A;  3MN6 A;  1X3M A;  2GWK A;  3R9P A;  4RCH A;  3BEX A;  4A2B A;  2EWS A;  1RGI A;  3O5B A;  1ZBS A;  1NMD A;  4FPA A;  3AAR A;  2DPN A;  4B1Z A;  1R59 O;  1YAG A;  3UKU B;  3CIP A;  4PL8 A;  1HLU A;  3L6Q A;  2HF3 A;  4ISG A;  4BC5 A;  1X3N A;  4BRI A;  1S22 A;  2A6A A;  2W41 A;  4HTL A;  1HKC A;  4EIA A;  4MO4 A;  4BVP A;  3HBT A;  2P9P A;  3KHY A;  3O4W A;  5AZJ A;  5JLH A;  4BG9 A;  2D1K A;  2YI1 A;  4H0V B;  5AQR A;  4CBW A;  3JXU A;  3LDP A;  4PKI A;  2ZGZ A;  3MMV A;  1K8K A;  2HF4 A;  4XH1 A;  5BR9 A;  4YDU C;  4KBO A;  4FWO A;  1SAZ A;  2FLO A;  4O8K A;  2FSJ A;  4LC9 B;  3LDL A;  3CHW A;  5ADX H;  1U2V B;  2Q31 A;  4BRD A;  3VOV A;  4FWK A;  2NRH A;  2Q2R A;  4BQL A;  3VGK A;  3H6E A;  4EAH D;  3UKU A;  3LM2 A;  4FWN A;  3FZL A;  3L4I A;  5JIC A;  5FPE A;  4CZE A;  3CI5 A;  4IWV A;  3A5L C;  4CZL A;  3EO3 A;  2E1Z A;  3SMP A;  5B8H A;  3L0Q A;  5AQO A;  3SJH A;  5LY3 A;  4B1Y B;  2A5X A;  2E2O A;  4XH4 A;  3ATU A;  2VWB A;  4BRQ A;  5BRF A;  4BR9 A;  4BQZ A;  1C0G A;  5JMV A;  3VEW A;  1MA9 B;  4M7X A;  3UE5 A;  3ZX2 A;  2HMP A;  5AQP A;  2ASO A;  5AQT A;  5AFU A;  2I7P A;  3R6M A;  2F9W A;  1Q18 A;  2NZT A;  3DXM B;  2YHW A;  3P4I A;  2CH5 A;  4JAX A;  3QB0 A;  3MK6 A;  2GEM A;  4QS8 A;  2QWP A;  3SK3 A;  1BG3 A;  4BGB A;  3LM9 A;  3CJC A;  3AAP A;  1BO5 O;  2D0P A;  2P9L B;  1NGB A;  3W0L A;  3VF6 A;  3CER A;  3LDN A;  1GLL O;  5AQG A;  1DKG D;  4FWL A;  1KAZ A;  4FOI A;  3M3Z A;  4FL9 A;  5AR0 A;  3I33 A;  3ZX3 A;  4I6M B;  1JCG A;  1QZ6 A;  3ZET A;  5AZJ B;  3HTV A;  1WUA A;  3SLC A;  1BA0 A;  3O08 A;  5LJW A;  3H1V X;  1HKB A;  4MLH A;  4PKG A;  4B1V A;  4B9Q A;  4A2A A;  3MN5 A;  1NBW A;  3LDO A;  1NGA A;  3AY9 A;  2PBD A;  2QWN A;  1QHA A;  1NGD A;  4IJN A;  4DQ8 A;  4FPB A;  1HJO A;  1G99 A;  4WYB A;  3O8M A;  2D0O A;  3VEX A;  4BRM A;  4J8F A;  1EQY A;  1S3X A;  2P9S B;  4FWP A;  2YJE A;  3IMX A;  2ITM A;  1NGE A;  4EHU A;  5BPL A;  3DXM A;  3ZEU B;  4XEI A;  3BF1 A;  4CZF A;  3DXK B;  3VEY A;  3CJB A;  2NLX A;  1MWM A;  2GTD A;  2P9L A;  4BRE A;  2CGK A;  2E88 A;  3D2F B;  1TUU A;  3VGM A;  3U8X A;  2GUP A;  3EKS A;  1DEJ A;  1IJJ A;  3A5M C;  5EOY A;  2ZF5 O;  3QDK A;  3TPQ A;  3TU5 A;  3VEV A;  2AP1 A;  4L3Q A;  2QWL A;  4WQ5 A;  3RSE A;  3KZB A; 
#chains in the Genus database with same CATH topology
 3QIO A;  4H0T B;  1UWB A;  3OYH A;  5GAD P;  3QML A;  3F2K A;  3AGR A;  4XH5 A;  3T7Z A;  3TSQ A;  1JL1 A;  1TKT A;  2W42 A;  2W40 A;  4FWQ A;  1DTT A;  3SQ2 A;  2QK9 A;  2O8F A;  3MEC A;  2A40 A;  3L3V A;  4OPJ A;  4JLH A;  5E26 A;  1QHT A;  4RW4 A;  4LF9 K;  2DTU A;  1VSM A;  1OVY A;  1VSJ A;  3H08 A;  4IG0 A;  2UUB K;  3G71 N;  1RDD A;  5AQS A;  4C8L A;  1S1T A;  3U3G A;  4JS4 A;  3SUN A;  2FBX A;  4BRN A;  4LH5 A;  2JLE A;  3OHR A;  4DB3 A;  3LDS A;  2ZJR L;  1TGO A;  4DTR A;  5AQL A;  5GIN A;  3G0Z A;  4JKG A;  3FZM A;  3HZ6 A;  3H1Q A;  1V4S A;  3O1W A;  5AQH A;  1BGX T;  2Q0R A;  3GL1 A;  3O1B A;  3PLA A;  3UB5 A;  4CED A;  3HOT A;  2VG5 A;  4M3R A;  4JYA K;  1S5J A;  3U4L A;  3DAW A;  2QXL A;  3WXK A;  2BH1 A;  1D5A A;  3WXI A;  3KKR A;  3D45 A;  4AHU A;  3AVM A;  4BRL A;  4JHD B;  3VA0 A;  1NGG A;  4WQ5 C;  1FW6 A;  2IOC A;  4BR7 A;  3E1Y A;  4H4M A;  2Y1I A;  1D9D A;  4FJM A;  4CEE A;  3VQ8 A;  2ITG A;  1WOQ A;  3WQT A;  3D2E B;  1XNQ K;  3EEQ A;  4DV0 K;  5AQU A;  5BN9 A;  2HVH A;  5AJ3 K;  4HUG A;  1N34 K;  1QSL A;  1CLQ A;  1NGJ A;  3J80 O;  2Q3S A;  1T6D A;  1TL1 A;  3WQU A;  5KPR A;  1CXU A;  3DRP A;  5AQY A;  4GNI A;  5FLX O;  4Y1C A;  3OYE A;  1BHL A;  1SZ2 A;  1VSK A;  3SMS A;  2OTL N;  4EP4 A;  1S1V A;  3ZX0 A;  1ZBL A;  3H3O B;  4RWT A;  4JI1 K;  1V4T A;  1WSJ A;  3QFP A;  4JHD A;  2P5O A;  1L3S A;  1Q86 O;  5AQF A;  3R8E A;  3CJA A;  3KLE A;  2B6A A;  3DI6 A;  3MEE A;  1S6P A;  1Z25 A;  2EHG A;  4AHV A;  3AA4 A;  1J5O A;  1GLA G;  3RMA A;  4KTZ A;  3EY1 A;  1BCO A;  4AHR A;  3DOK A;  1LOT B;  2BAN A;  3D2E A;  3SV3 A;  3K0S A;  4O5B A;  2V7Z A;  4H5T A;  2IVO A;  3HJF A;  3OYJ A;  5FPN A;  3AA3 A;  3ID8 A;  4CI6 A;  4JV5 K;  3ZT2 A;  4JI3 K;  4C1N K;  3EYZ A;  3R3L A;  1NM1 A;  1QE1 A;  3ZSR A;  2IGI A;  1I94 K;  4FJJ A;  4PL7 A;  3MN7 A;  3PV8 A;  3TAG A;  1P8Z A;  3GOI A;  4CJ7 A;  4FWR A;  4DS5 A;  4CZJ A;  3HSC A;  4H0X B;  4FWS A;  4IDK A;  2IAJ A;  4FCY A;  3HRG A;  4DV7 K;  3A0I X;  4C8K A;  5I42 A;  4O4G A;  3OYG A;  4K25 A;  1HKG A;  3NGI A;  2QWO A;  4IKF A;  3LPU A;  3SAG A;  3HOS A;  4JEP A;  1NJI O;  4NCA A;  1T44 A;  4B3O A;  3BF3 A;  4BR0 A;  4K0K K;  4ISF A;  1C1C A;  1KVA A;  4MDB A;  5M1O A;  1IBL K;  3OYN A;  2KQ2 A;  3VEZ A;  1QVF M;  4CEQ A;  4E1J A;  3VES A;  3QIC A;  3B6O A;  3J8A A;  3TTF A;  2G8W A;  4KKO A;  3IDH A;  4WFA L;  3CFP A;  4FO0 A;  4FJ8 A;  1IKW A;  5HLF A;  4BRF A;  4IFV A;  2XY7 A;  4A62 A;  5HRR A;  5LMU K;  4DR3 K;  1N32 K;  1XHX A;  1ZYQ A;  4BGA A;  2WTU A;  1XMQ K;  4WFB L;  4M3Z A;  3F9M A;  4YOX A;  2YHX A;  3C0B A;  1C1A A;  4DWI A;  5KQD A;  3SQ1 A;  3RMD A;  2OPP A;  2P9P B;  2Z1I A;  1VQO N;  4ZHR A;  1ITG A;  2DFH A;  5JLF A;  1T6C A;  1BIU A;  3C65 A;  5KPZ A;  5BRD A;  3TWH A;  3NE6 A;  4CJ3 A;  3A2F A;  3LAM A;  3MN6 A;  1K8A O;  4J2A A;  3AV9 A;  1ZBH A;  1IG9 A;  3PX0 A;  1T8E A;  3K9K A;  4FW2 A;  1WN7 A;  5SZT A;  3SUO A;  1RGI A;  4F3T A;  1ZBS A;  3TAR A;  1VQ5 N;  1VSD A;  1HLU A;  3KLG A;  3K58 A;  3TSU A;  3L6Q A;  1EET A;  3WNG A;  3NMU A;  4AHC A;  3HP9 A;  1GOC A;  4I9L A;  1X3N A;  2YHB A;  3FFI A;  3NH0 A;  1A5V A;  4EIA A;  4BVP A;  2WBN A;  3RRH A;  2P9P A;  3KHY A;  4RG8 A;  2OPQ A;  2D1K A;  2YI1 A;  2E6L A;  4H0V B;  1OH7 A;  4C1N I;  4G9Z A;  3MED A;  3QEW A;  1RDA A;  3LP0 A;  2ZGZ A;  3MMV A;  3PIP L;  3TAE A;  3VQP A;  1U4B A;  1BI4 B;  3F9K A;  3SQ4 A;  2BGG A;  1YHQ N;  5BR9 A;  4YOW A;  3TSP A;  4YDU C;  3JAM O;  3G10 A;  3IS9 A;  4O8K A;  2IS3 A;  1QSS A;  3ZSY A;  3NVK A;  1RT6 A;  4DU3 A;  3WNH A;  4DTM A;  1ZBU A;  4KV8 A;  4JI0 K;  3VGK A;  5D3G A;  4IG3 A;  3LM2 A;  3O9Q A;  4JKC A;  3LP3 A;  3FZL A;  3L4I A;  1OH8 A;  5FPE A;  1X1P A;  3KLI A;  4LD0 A;  3CQ8 A;  1WSG A;  5B8H A;  1UA1 A;  4RW6 A;  4JRP A;  3SJH A;  3V9Z A;  2HW3 A;  1VQL N;  1RNH A;  3ATU A;  3ITH A;  4DFM A;  3RMB A;  4DSI A;  3J7Z O;  1T05 A;  3VEW A;  3UE5 A;  3HP6 A;  4DSE A;  3ID6 A;  4MFB A;  5AQT A;  3AVF A;  4FM1 A;  1TKZ A;  1NOY A;  2GUI A;  1BI4 A;  4CJ5 A;  2HHT A;  5EU7 A;  4IFE A;  2HHQ A;  2GEM A;  1C6V A;  1VQ6 N;  4DV6 K;  2PFU A;  3NF6 A;  2D0P A;  3P83 D;  2P9L B;  3W0L A;  1FXX A;  1S1W A;  1GLL O;  5AQG A;  4FLY A;  4FOI A;  1N8R O;  5AR0 A;  3CC4 N;  3ZX3 A;  4I6M B;  3SPY A;  4CK3 A;  2HND A;  1VSE A;  4BE0 A;  4LF5 K;  3VQB A;  4PHT X;  2VGM A;  5LJW A;  4PKG A;  1S6Q A;  1DT9 A;  1JL2 A;  4FM0 A;  4JK8 A;  2QA4 N;  3VQ5 A;  1KRP A;  5M1P A;  2NNW A;  3U6F A;  1QHA A;  1NGD A;  4IJN A;  5CYQ A;  1K9M O;  4FLU A;  5DM7 L;  3L8B A;  4M3U A;  1JJ2 M;  4DSF A;  2NRX A;  3O9U A;  3VEX A;  4F2S A;  1S3X A;  2YJE A;  4KB0 A;  3ZEU B;  4XEI A;  2HHH K;  4AH9 A;  3DLK A;  3DOL A;  4CJR A;  3ZSQ A;  1VSH A;  1M90 O;  2UXB K;  1EWQ A;  2YNG A;  1ILY A;  2P9L A;  2YNF A;  4BRE A;  3ZT3 A;  4OGE A;  3EKS A;  4BY9 C;  2GV9 A;  4HHT A;  4YOT A;  2P51 A;  1IJJ A;  5CY4 A;  3K5N A;  4CJK A;  4X64 K;  4YHH K;  4L3Q A;  3T69 A;  4I7F A;  2QWL A;  4WQ5 A;  3RSE A;  3KZB A;  4LF8 K;  1YTU A;  3DMJ A;  5BPN A;  3CQY A;  3CCU N;  1UOC A;  2W6L A;  5ADX A;  3C94 A;  4IO9 L;  4PQU A;  5AQW A;  5AQI A;  4QCL A;  3ZT1 A;  4O5F A;  2F8T A;  3I56 N;  1VQ8 N;  1YVN A;  3BZC A;  1HX1 A;  3CG7 A;  3O9R A;  2Q0U A;  1KCF A;  3FFK B;  3QNN A;  4CK2 A;  4BE2 A;  1NJW A;  1NK0 A;  4LFC K;  2HHU A;  4E7I A;  4NLC A;  4AF1 A;  1QQN A;  3A5N C;  2P9K B;  3OY9 A;  2X78 A;  1C0F A;  5KGW A;  4KHW A;  2V52 B;  1CZA N;  5KTQ A;  3ZEU A;  3CF5 L;  1SL1 A;  1VAZ A;  5K14 A;  4DLE A;  5SWM A;  3JS6 A;  3PO5 A;  1BL3 A;  3BUZ B;  3EZW A;  2QW9 A;  3ATV A;  4H0O A;  3O3F A;  3TAP A;  2E20 A;  3M1F A;  4O0I A;  4Y1D A;  3QLH A;  4F9O A;  3LWL A;  3QBX A;  3I0S A;  2QWQ A;  5I9E B;  1T3V A;  3GDQ A;  3U9Z A;  3MX5 A;  1RCH A;  2E2N A;  4CJU A;  3NGY A;  2UUC K;  1NK9 A;  2OPS A;  1TAQ A;  4RTF D;  2WUS A;  1RBV A;  2VYP A;  3G25 A;  2DY4 A;  3LZI A;  3CCR N;  3BGR A;  3THV A;  1LAW A;  1SL0 A;  1S1X A;  4TSX A;  2RE2 A;  1I3A A;  3VQA A;  4FJ5 A;  3H45 C;  4H5V A;  4X62 K;  3IUC A;  4CHO A;  1VQP N;  1YI2 N;  4C8O A;  2P9K A;  1WSF A;  4KH5 A;  1YUW A;  1VSL A;  5J2M A;  4CBU A;  1QSY A;  2HNZ A;  2QM1 A;  1GOB A;  2CH6 A;  3FR0 A;  1EXQ A;  3CCM N;  5C2F A;  2D5R A;  5AQZ A;  4CER A;  2E2P A;  3DLG A;  1X9J A;  4JS5 A;  2LSN A;  4CZM A;  4LH4 A;  4KHP K;  2F9T A;  2UXD K;  1ASU A;  4B3R K;  4EFH A;  4GV3 A;  4GKJ K;  1O1W A;  2FBY A;  3VA3 A;  1ATR A;  3ZSZ A;  4FVM A;  4B3T K;  4BVO A;  3H46 O;  4KAZ A;  4LF7 K;  3ZT4 A;  2UU9 K;  2RN2 A;  1QQC A;  4JD2 B;  3I55 N;  2H3G X;  3AVJ A;  4Z4C A;  1E3M A;  1EO1 A;  4DCH A;  3LL3 A;  5BR8 K;  4PUO A;  5A2Q O;  1HYV A;  3FGU A;  1ATN A;  5GAE P;  3CME N;  4LFB K;  3CFO A;  4KTW A;  1ZBI A;  2BUP A;  4H03 B;  3L2W A;  1X9W A;  1U04 A;  4IZ9 A;  3EKU A;  4DSK A;  5BN8 A;  1VQ4 N;  4BDY A;  3QNO A;  3K5O A;  1VQN N;  2HB5 A;  5F2R A;  3M6G A;  1TKD A;  3P39 A;  3FZH A;  4ILG B;  4B1X B;  2ZGY A;  3QFU A;  2VWK A;  3Q7B A;  3MDQ A;  4IOX A;  3GE1 A;  1OKJ A;  3O6W A;  3CJ9 A;  1FK9 A;  3V9X A;  4WE1 A;  3LWM A;  3I8D A;  1NKB A;  4PY5 A;  4JD2 A;  5FPD A;  1JLF A;  5HOO A;  3RVC A;  3LZJ A;  3UKR B;  4CZI A;  1GLE G;  1TUY A;  2IC3 A;  4CHY A;  3U9D A;  2CGJ A;  4F8R A;  2YCH A;  3I8B A;  3ZET B;  5EX5 A;  3NH1 A;  2Q1N A;  1GLB G;  2ATQ A;  2IVP A;  3CJ1 A;  1XC3 A;  1KTQ A;  3D7E O;  4NB4 A;  3C7N B;  4JRQ A;  4CZK A;  4DR7 K;  4E7J A;  2WON A;  2XY6 A;  1J5E K;  5CHI A;  1RTI A;  5HRN A;  2D4W A;  4OJR A;  1BWF O;  4N47 A;  4CF1 A;  3KLF A;  2X6N A;  4CVN E;  1FJG K;  1TK8 A;  4BRA A;  1W0H A;  4CJF A;  4DTN A;  1F21 A;  1J6Z A;  4CD1 A;  3NBP A;  2G8U A;  1LWE A;  3HPG A;  2NRT A;  1GLD G;  4WQ4 C;  3NCI A;  5AQV A;  4CBX A;  3E66 A;  4NCB A;  3FZF A;  3J7A P;  3KWI A;  3QEV A;  1RT5 A;  4FZX C;  3EL2 A;  3UKR A;  3LPT A;  5FRN A;  4GV6 A;  3TAF A;  3Q7C A;  5GIP A;  2RHK A;  3DLB A;  1Q7Y O;  4YDU A;  4DR2 K;  1TKX A;  4M45 A;  1HJR A;  1W97 L;  4CW7 B;  4BRC A;  3S41 A;  3IKM A;  2Y1J A;  1U48 A;  3C7N A;  1BUP A;  1VHX A;  4DTU A;  4JI4 K;  4YOY A;  3V1R A;  1NK6 A;  4AHS A;  5FRO A;  1SKR A;  1O13 A;  2NRW A;  2XRI A;  1RBT A;  2G8H A;  1LAV A;  3HVT A;  3RMC A;  3ZYY X;  3NGZ A;  4EP5 A;  4B1Z A;  1RDC A;  1Q9X A;  4CHN A;  1L3V A;  4IEE A;  1DLO A;  2HF3 A;  4FZZ A;  2PYL A;  3CXC M;  4BC5 A;  3OBW A;  1JKH A;  4FK0 A;  3QEP A;  3ISN C;  2W41 A;  4HTL A;  1HKC A;  1OH6 A;  4OKJ A;  4JI8 K;  2FBT A;  1C0T A;  4BG9 A;  5H1S Q;  3DRR A;  1JLG A;  3AO2 A;  4CGD A;  4O44 A;  4PKI A;  3IG1 A;  2RKI A;  1K73 O;  2HF4 A;  2FLO A;  1NJY A;  1I39 A;  4CIF A;  3EE8 A;  1N6Q A;  1J54 A;  2Z1G A;  3HPO A;  3CHW A;  4KH6 A;  1U2V B;  1B92 A;  3VOV A;  3H6E A;  4CHZ A;  4EAH D;  1C1B A;  4M3X A;  3O4Q A;  3OA9 A;  4FWN A;  5JIC A;  3DLH A;  1HQE A;  4CZE A;  3SZ2 A;  4CJS A;  1HQU A;  4CZL A;  3EO3 A;  3CFR A;  2E1Z A;  4NXM K;  4DR1 K;  3OW2 M;  3D6R A;  5LY3 A;  2A1S A;  1BIZ A;  4JK9 A;  2A5X A;  2R7Y A;  2E2O A;  4XH4 A;  2G8I A;  4OPK A;  3O4N A;  4CEC A;  5JMV A;  1MA9 B;  1NNE A;  2HMP A;  2ZJQ L;  5AQP A;  1SUQ A;  2ASO A;  3OJS A;  3R6M A;  2F9W A;  4V19 S;  4FXD A;  2WFB A;  4Z4E A;  3QB0 A;  3MK6 A;  3HYF A;  2DFE A;  1UA0 A;  3SK3 A;  1HNZ K;  1VRU A;  4ELU A;  1RT4 A;  1BCM A;  3C6T A;  3VF6 A;  5HL7 L;  4X66 K;  3PX4 A;  3RR8 A;  4IOA L;  3C6U A;  5GAG P;  4DU1 A;  4FWL A;  1EP4 A;  5C2D A;  1QZ6 A;  3M5R A;  5AZJ B;  3VQ9 A;  1U45 A;  3HPH A;  1VSI A;  2KFN A;  4LF4 K;  4RW8 A;  1HKB A;  4B1V A;  4B9Q A;  5C24 A;  3V1O A;  3LDO A;  4DMN A;  1KVC A;  1NGA A;  3AY9 A;  1XHZ A;  4HTU A;  1JXB A;  2PBD A;  4JKB A;  2JWL A;  4LY7 A;  1HYS A;  4DQ8 A;  4FPB A;  1HJO A;  4JI2 K;  4M3Y A;  2F4V K;  3MEG A;  1EQY A;  2P9S B;  4J2D A;  4Z4I A;  1L3T A;  3ZT0 A;  5HRP A;  3IMX A;  4FJ7 A;  1NGE A;  4DTS A;  4FJX A;  3DXK B;  4FLZ A;  4CJQ A;  2D0A A;  1X9M A;  1U47 A;  2RPI A;  4NYN A;  1MWM A;  3CYM A;  5JS2 A;  3B6P A;  4LSL A;  3D2F B;  1TUU A;  3BZK A;  2ZQB A;  1KSP A;  1YJ9 N;  5HP1 A;  3MXM A;  3QDK A;  3TU5 A;  5KRS A;  2AP1 A;  5AZJ A;  3T19 A;  3K9J A;  1WSH A;  4JKD A;  4NXN K;  2A41 A;  3VF2 A;  4DSJ A;  3AVC A;  3NF7 A;  3MCP A;  3ZSW A;  3VQE A;  3QIN A;  4DQS A;  3CCJ N;  2IVN A;  2EX3 A;  3B8A X;  4Q5V A;  3CPE A;  3KK2 A;  3TTD A;  1SQK A;  1ZC6 A;  1TYQ B;  2F7T A;  1LV5 A;  4DR5 K;  4B9L A;  3P38 A;  4YFU A;  1HUX A;  4E1M A;  5TKW A;  2P9S A;  2FSN A;  4Z94 A;  3AVB A;  4KTQ A;  1QZ5 A;  1XQS C;  2YHA A;  3VTI A;  4Y0W A;  3DXK A;  2PYJ A;  2E6M A;  1W2B M;  2AA4 A;  3PIO L;  3TAQ A;  3THX B;  4CFC A;  1UAX A;  3WXM B;  3PY8 A;  4JKF A;  4HUF A;  3D2F A;  5DMR A;  3OTO K;  4E0D A;  3WXL A;  4O8U A;  4BWM A;  4H5R A;  3O3H A;  2DFF A;  3W3D A;  4IJA A;  3NF9 A;  4DU4 A;  4A5B A;  2XY5 A;  2FC0 A;  3C6H A;  4ELT A;  2GEL A;  2P5G A;  1Z26 A;  4PKH A;  1LW2 A;  2O8B B;  5C25 A;  1NK5 A;  1NKE A;  1RBS A;  3ZSV A;  2X74 A;  2PZS A;  1ESV A;  4J2E A;  3S3M A;  5HBM A;  4CJW A;  1JCF A;  1DTQ A;  1RDB A;  4N5S A;  1NGH A;  2D0C A;  1TYQ A;  2WOM A;  3K57 A;  5JS1 A;  3MN9 A;  1GLJ O;  1TVR A;  4ICL A;  1NGI A;  3THW B;  3NH2 A;  2NRZ A;  5AQJ A;  4KFB A;  1SS6 A;  1HPM A;  5AQK A;  3DYA A;  4CGH A;  4IO8 A;  1BOT O;  3PUF A;  3THX A;  2KHO A;  2VCP A;  4JI6 K;  3HI0 A;  2HHX A;  4FJH A;  2ZWH A;  4YY3 K;  4K43 A;  1E4F T;  3NFA A;  3AVG A;  4W5R A;  4CGI A;  4B9N A;  2KZM A;  3VEO A;  2A1R A;  3OYD A;  4FJN A;  4CGG A;  3AO1 A;  3HO1 A;  4RW7 A;  4BC3 A;  4Z0U A;  3MWP A;  3L2R A;  1JLE A;  2KKZ A;  3ULE B;  3TAN A;  3RR7 A;  4A59 A;  1RIL A;  5BRE A;  4IDH A;  4AM7 A;  3CC7 N;  4F3O A;  5HRS A;  3QEI A;  2O8B A;  4FVU A;  3E9L A;  2OZM A;  5CZ1 A;  3MXI A;  1YVU A;  3KLH A;  5AQM A;  1T03 A;  1ZXO A;  2ASM A;  1WLJ A;  4BE1 A;  3NVM A;  1RBU A;  3CET A;  4GVE A;  2PAV A;  5EVZ A;  1YJW N;  2O8E B;  3P5J A;  3ENH A;  3THW A;  3QBW A;  4I6M A;  1E4G T;  1KD1 O;  3V9U A;  2HNY A;  1VQ7 N;  3WT0 A;  4ELV A;  4M3W A;  2F8S A;  4WQ4 A;  1SL2 A;  3GBT A;  4HCC A;  3T1Y K;  4BWJ A;  5LJV A;  2QKK A;  4YNQ A;  2QWM A;  3E9P A;  2HBK A;  3ULE A;  3VEN A;  5CZ2 A;  3AO4 A;  3AAQ A;  2O4I A;  4Z4F A;  5J2P A;  3U3Y A;  1D9F A;  1IG8 A;  3KD5 E;  4CEZ A;  4M3T A;  4MLE A;  5C12 A;  3DWL A;  3QEX A;  4DQI A;  2JWK A;  5F0X A;  3WUH A;  5M1Q A;  1QVG M;  4KO0 A;  1WNS A;  3OYC A;  3M8Q A;  4A61 A;  1FKP A;  3F73 A;  3HVR A;  5DM6 L;  1B9D A;  4NO7 A;  2YV0 X;  3KD1 E;  3HK2 A;  3CJ7 A;  3A8Y A;  3I0R A;  4ID5 A;  1VK0 A;  1XNR K;  1H1V A;  4C23 A;  3K59 A;  4DS4 A;  1NG9 A;  1HYZ A;  4JN4 A;  2CGL A;  4E89 A;  4ISE A;  5C10 A;  2E2Q A;  4YOU A;  2V7Y A;  4CJ4 A;  5AZI B;  1QQM A;  2ZJP L;  2OTJ N;  2IIR A;  4QOZ B;  2A42 A;  3SAF A;  1QS4 A;  4CGJ A;  1Q81 O;  1WBB A;  4FJ9 A;  2X6S A;  2UYT A;  2WC9 A;  4MO5 A;  2ZM6 K;  1LCU A;  3IFR A;  3FE1 A;  4B9M A;  1S9E A;  3LP1 A;  5EXW A;  3VER A;  3ASM A;  4FSV A;  4B8C A;  3THY B;  1NKC A;  3DM2 A;  1C0U A;  2NUB A;  3HM9 A;  2YNH A;  1MDU B;  3AO5 A;  3A5O C;  3J7Y P;  4KB1 A;  3CM5 A;  5AFU H;  4AM6 A;  4LFA K;  3VMF B;  1JCE A;  4O0J A;  5LL6 Z;  1YXQ A;  1RFQ A;  1WB9 A;  3KIO A;  3VET A;  1NGC A;  3CQX A;  4CZH A;  3OVN A;  2ASP A;  4M42 A;  3UIQ A;  1K8K B;  4H5N A;  3FZK A;  4DLG A;  2IDO A;  3VPZ A;  3ZSX A;  4BAC A;  1KQS M;  1KFS A;  5AZI A;  4DTJ A;  1X3M A;  4A2B A;  4KHQ A;  3MWT A;  1YF5 L;  4B08 A;  3N4Q A;  3NHG A;  3O5B A;  2KZZ A;  3LP2 A;  3TTC A;  1R59 O;  3UKU B;  2HST A;  3THY A;  5FRM A;  3DLE A;  4PL8 A;  1ASV A;  2YNI A;  4FJG A;  3DRS A;  4GMJ B;  4DQR A;  3V4I A;  1TV6 A;  4DR6 K;  1S22 A;  4OLA A;  2O8D B;  4CEO A;  3VTH A;  3RRG A;  4B9U A;  3OYF A;  3O4W A;  1M1K O;  5AQR A;  3VN5 A;  4CBW A;  5C42 A;  3V81 A;  3BY5 A;  4DR4 K;  3JXU A;  1TK0 A;  4OLB A;  1Q9Y A;  1C0M A;  1K8K A;  4UQG A;  3P1G A;  4XH1 A;  4FWO A;  3ULD A;  4DG1 A;  2O4G A;  2FSJ A;  3AVA A;  4Q0B A;  4G1Q A;  5M1K A;  2KTQ A;  4BRD A;  3K5M A;  1D8Y A;  1OH5 A;  3L4Q A;  1GOA A;  4FWK A;  2Q2R A;  4BQL A;  3UKU A;  4RW9 A;  2B5J A;  4JKE A;  5KGX A;  2G8F A;  5JVH L;  3CI5 A;  5DK5 A;  1J53 A;  4K8Z A;  3SMP A;  2UXC K;  3ENB A;  4DF8 A;  3L0Q A;  1Y97 A;  4NLB A;  3O9T A;  2O8D A;  4B1Y B;  1JLC A;  4BRQ A;  5KI6 A;  4E19 A;  2HBJ A;  4BR9 A;  1C0G A;  4BQZ A;  4CFB A;  4FJI A;  4M7X A;  3ZX2 A;  3OS1 A;  3SPZ A;  1WSE A;  4OX9 K;  4E7L A;  1YIT N;  2VG7 A;  2I7P A;  4KHS A;  2NZT A;  2YHW A;  3P4I A;  1JLB A;  1N33 K;  4CIG A;  2QWP A;  4DFK A;  1S9G A;  4N41 A;  3HST B;  1BO5 O;  4HUE A;  1NGB A;  3SNN A;  3LDN A;  4WFN L;  4PA1 A;  1YJN N;  1DKG D;  3LAL A;  3C95 A;  1KAZ A;  4FL9 A;  3I33 A;  1TAU A;  2G8V A;  1L5U A;  2GBZ A;  3IRX A;  1BQM A;  3ZET A;  1IO2 A;  1BA0 A;  2I5J A;  4MLH A;  2HHW A;  4IOC L;  4A2A A;  4WCE L;  4KI4 A;  5CR4 A;  3ALY A;  4FZY A;  5E41 A;  4YOV A;  3PX6 A;  4FW1 A;  1EKE A;  3OYK A;  2E4L A;  4B9S A;  4F2R A;  5J1E A;  5C0Y A;  2VQE K;  1W9H A;  4N56 A;  1G99 A;  1XWL A;  4KRE A;  3O8M A;  3QIP A;  4Z4H A;  2HBL A;  4OGC A;  4BRM A;  4FWP A;  4R79 A;  4FLX A;  4EHU A;  3F5T A;  5BPL A;  5FDL A;  4L8R B;  1KLN A;  4CZF A;  3VQ7 A;  4A5A A;  3VEY A;  3CJB A;  1TL3 A;  4ILJ A;  2NLX A;  2CGK A;  2E88 A;  3PSI A;  3QES A;  3U8X A;  1RT1 A;  2GUP A;  1IKY A;  1DEJ A;  1NJZ A;  4LSN A;  1Q82 O;  4JI7 K;  1REV A;  2B4J A;  2OYQ A;  3SV4 A;  3EZ5 A;  1EX4 A;  3SAH A;  5MLC Q;  1NGF A;  1IKX A;  3AA5 X;  5KPT A;  2KLA A;  1RT2 A;  4NCG A;  1P90 A;  4CHP A;  4BRP A;  3ZSO A;  4CJV A;  3BDP A;  2VG6 A;  3E9O A;  3LDQ A;  2V51 B;  5BPM A;  3L2U A;  5ELZ A;  4FLV A;  3S9H A;  4C8N A;  3WXJ A;  1JXE A;  3SQ0 A;  1TK5 A;  4BR4 A;  4HWI A;  4BRK A;  1T7P A;  1NK4 A;  3AVN A;  2HOE A;  3WNE A;  1YT3 A;  5EY4 A;  4DFJ A;  1WAJ A;  3TI0 A;  1KFD A;  2P9N B;  3DLR A;  1Z05 A;  5CYM A;  3DLL L;  1VQM N;  3OJU A;  3VQ6 A;  5F1X A;  3VGL A;  2FBV A;  3WEE B;  2OPR A;  4M7Y A;  3FLC O;  5I3U A;  3M8P A;  2XO7 A;  4BRG A;  5CE3 A;  4J2B A;  3HM8 A;  4B1W B;  1KVB A;  1A5X A;  4B3M K;  3BP8 A;  5KQ8 A;  1IBM K;  4BR5 A;  1HNX K;  1WAF A;  3KVG A;  4XIU A;  4OO1 J;  3ENO A;  2QEX N;  4DKW A;  2Q36 A;  4CJL A;  2GWJ A;  2BTF A;  5M1N A;  4DV3 K;  2KFZ A;  5TKY A;  4K42 A;  1W7A A;  4OVL A;  4NYF A;  2ETJ A;  1U6Z A;  4O55 A;  4OPH A;  1GLF O;  1KLM A;  4FK2 A;  3AA2 A;  4WF9 L;  1U2V A;  1JLQ A;  3AVK A;  4CZG A;  3HXM A;  3LAN A;  3MCA B;  3K5L A;  1X9S A;  4FJL A;  2HBM A;  4KHY A;  4CEF A;  4FYD A;  1QQO A;  4DTO A;  1NLV A;  1LWC A;  3RTV A;  2P9N A;  3NF8 A;  4QS7 A;  4FJK A;  4FWM A;  4B9T A;  3WEE A;  2OA8 A;  1RTJ A;  3VQC A;  5FPM A;  1HNV A;  2W6K A;  4ZTF A;  4W5Q A;  4I2P A;  1YIJ N;  4B8A B;  4EHT A;  2QWR A;  2ZE2 A;  4BRO A;  5C15 A;  2QKB A;  1R0A A;  1IKV A;  1RDU A;  3G4S N;  2G8K A;  4B3S K;  4UY8 O;  4W5N A;  4AQY K;  1A5W A;  4CJE A;  3CCE N;  3EE9 A;  2FF3 B;  4CD3 A;  1ASW A;  3QET A;  1BQN A;  4C8M A;  4FLT A;  3NDK A;  4DTX A;  4BC4 A;  1HR0 K;  1Z6R A;  4GY2 B;  4ZTJ A;  4IBN A;  3TAB A;  4AHT A;  2FSK A;  1WSI A;  3OS2 A;  5E84 A;  3J81 O;  2QTD A;  2FF6 A;  4MQ3 A;  3OYM A;  4KH4 A;  4BRH A;  1ATS A;  2XHB A;  4BC2 A;  2OCE A;  3GG4 A;  1LW0 A;  4M63 C;  3CCL N;  2Z1J A;  2BDP A;  2HVI A;  3M8S A;  4DHY A;  1BDG A;  3KKS A;  3L2V A;  4CJT A;  2I7N A;  1QTM A;  3OYB A;  4DV2 K;  3CC2 N;  2ZD1 A;  3RWU A;  2FXU A;  3ZCM A;  4K41 A;  5AQX A;  4CHQ A;  4BR2 A;  2RF2 A;  2Q97 A;  3DJC A;  4IFY A;  1D4X A;  2HHS A;  4IEI A;  3QO9 A;  3SUP A;  5IWA K;  2A3Z A;  3SBG A;  3KJV A;  3T1A A;  4GVM A;  1HNW K;  1HNI A;  2J4R A;  3JYT A;  1GLC G;  1RDW X;  4EZ9 A;  2E8A A;  2OAN A;  4GW6 A;  2QI2 A;  3AVH A;  1VSF A;  4YOR A;  2XY8 A;  5BRH A;  2E5L K;  1KAX A;  1EWR A;  4CE9 A;  4CF0 A;  4H0Y B;  1HMV A;  3OS0 A;  4HCB A;  1XMO K;  1B9F A;  5JVG L;  1KXP A;  1DGK N;  2NRV A;  2P9U B;  4E7H A;  4KHU A;  1HRH A;  1YTA A;  4GV9 A;  2HHV A;  2AJQ A;  2P9I B;  3CCS N;  1NK8 A;  4QS9 A;  3LAK A;  4CES A;  1CXQ A;  4U7B A;  2YJF A;  3S3N A;  2F96 A;  5IT9 O;  1NWK A;  4JNE A;  4CEA A;  4BG8 A;  3D0P A;  2E1Y A;  4JK7 A;  4DF4 A;  2OZS A;  4I2Q A;  5AQQ A;  3KK1 A;  3EN9 A;  5J2Q A;  4FOE A;  3AO3 A;  4H0P A;  4CIE A;  3T1H K;  3VF4 A;  4OKK A;  3SUQ A;  1BU6 O;  1XUP O;  5AQN A;  3KK3 A;  4KRF A;  1OVQ A;  5GIO A;  1KAY A;  1WBD A;  4CF2 A;  4DQP A;  1KC8 O;  2YHY A;  1K6Y A;  4DUZ K;  3H3N O;  4X65 K;  1IH7 A;  2VQF K;  3SJJ A;  4CCH A;  1HPZ A;  2P9U A;  2QXF A;  1XI1 A;  1MWK A;  3AVI A;  2P9I A;  4CFD A;  1Y64 A;  4DV5 K;  1FKO A;  3RSE B;  4KI6 A;  3O80 A;  1BA1 A;  1S72 N;  4IXC A;  3R1X A;  4ID1 A;  1RTH A;  3V1Q A;  4CF9 A;  4U67 L;  1J9A A;  1NMN A;  4H5W A;  4PWD A;  4B1U B;  4ILH A;  3MXJ A;  5GAH P;  3CCV N;  4BDZ A;  4FM2 A;  3VQQ A;  2Z1H A;  2GWK A;  4MDA A;  3R9P A;  3VQ4 A;  4RCH A;  4FLW A;  3BEX A;  3CCQ N;  1RT7 A;  2D0B A;  1NK7 A;  2EWS A;  1NMD A;  1IV0 A;  4FPA A;  1ZBF A;  3AAR A;  4JKA A;  1VQ9 N;  2PY5 A;  2DPN A;  3CM6 A;  2NRR A;  4HVJ A;  1YAG A;  3CIP A;  4DTP A;  5KRT A;  4ISG A;  3SCX A;  4E1N A;  3HT3 A;  4CGF A;  4BRI A;  2A6A A;  4QAG A;  4W5O A;  1NJX A;  4MO4 A;  3HBT A;  3KK7 A;  5JLH A;  3NAE A;  3ZLJ A;  4AIL C;  1NU0 A;  2P1J A;  4OPA A;  1XC9 A;  3LDP A;  3PO4 A;  4GKK K;  3E01 A;  1N36 K;  1RTD A;  4LF6 K;  4KBO A;  2BE2 A;  3HL8 A;  1SAZ A;  4F4K A;  3TR8 A;  4M41 A;  4LC9 B;  3SI6 A;  3LDL A;  1Q8I A;  4B9V A;  5ADX H;  5HRO A;  2Q31 A;  1IBK K;  3OBY A;  1LWF A;  2O8E A;  3S3O A;  2NRH A;  4KPY A;  4K8X A;  3P31 A;  3TAM A;  3V9S A;  3AGK A;  3L3U A;  4IWV A;  3A5L C;  1RBR A;  3K2P A;  2HMI A;  5AQO A;  5J2N A;  3O9S A;  4EZ6 A;  3PSF A;  2VWB A;  3G6E N;  4OKE A;  5BRF A;  3T3F A;  3L2Q A;  2YX6 A;  1VQK N;  1G15 A;  4Z4G A;  5M1F A;  5T7B A;  5AFU A;  3M8R A;  4E7K A;  1Q18 A;  3DXM B;  2CH5 A;  4JAX A;  1SV5 A;  4QS8 A;  4DFP A;  1BG3 A;  3MX2 A;  4BGB A;  4JKH A;  3JSM A;  3LM9 A;  3CJC A;  4R5P A;  3AAP A;  3CPW M;  4KHN A;  3CER A;  4CF8 A;  3KTQ A;  4JI5 K;  3CMA N;  2O8C B;  4A57 A;  3QER A;  4W5T A;  2GX9 A;  3V6D A;  3M3Z A;  1JCG A;  3AVL A;  3OYA A;  4H4O A;  2VWJ A;  3HTV A;  3KWG A;  1WUA A;  3SLC A;  4CEB A;  3SYZ A;  4CFA A;  3O08 A;  4H8K A;  3H1V X;  4N76 A;  1VRT A;  3O3G A;  1CZ9 A;  2YKN A;  1NBW A;  3MN5 A;  3SBT A;  3IAY A;  3OYI A;  1RT3 A;  1SKS A;  4DQQ A;  4DV1 K;  2O8F B;  1CZB A;  2QWN A;  4DV4 K;  4I9Q A;  4WYB A;  2KW4 A;  4E3S A;  2D0O A;  2VGN A;  5LMN K;  3V9W A;  3WNF A;  1MU2 A;  4J8F A;  1N5Y A;  3OYL A;  2ITM A;  3DXM A;  1JLA A;  3BF1 A;  4DSL A;  1SKW A;  3MAQ A;  2JGU A;  4BDP A;  2GTD A;  3VQD A;  4CJP A;  3N4P A;  4FK4 A;  2UUA K;  2O8C A;  1S1U A;  4CK1 A;  3VGM A;  3C6A A;  1BIS A;  1U49 A;  4JKG B;  1L3U A;  3CD6 N;  3A5M C;  5EOY A;  2ZF5 O;  3TPQ A;  3VEV A;  4DUY K;  2YKM A;  1NOZ A; 
#chains in the Genus database with same CATH homology
 4H0T B;  4JKD A;  5BPN A;  3CQY A;  5GAD P;  3QML A;  3F2K A;  3AGR A;  4XH5 A;  3T7Z A;  3TSQ A;  3SAH A;  5ADX A;  2A41 A;  3VF2 A;  4IO9 L;  5MLC Q;  5AQW A;  1NGF A;  5AQI A;  2W40 A;  3MCP A;  4FWQ A;  4O5F A;  5KPT A;  2KLA A;  3CCJ N;  2IVN A;  2A40 A;  3B8A X;  3I56 N;  1VQ8 N;  3CPE A;  1P90 A;  5E26 A;  1YVN A;  3O9R A;  1HX1 A;  4BRP A;  2Q0U A;  3FFK B;  3TTD A;  1SQK A;  1OVY A;  1ZC6 A;  1TYQ B;  3E9O A;  2F7T A;  3LDQ A;  2V51 B;  4NLC A;  5BPM A;  4AF1 A;  1QQN A;  5ELZ A;  3A5N C;  3G71 N;  3P38 A;  2P9K B;  1HUX A;  3WXJ A;  5AQS A;  5TKW A;  2P9S A;  2FSN A;  4BR4 A;  4HWI A;  4BRK A;  1C0F A;  4Z94 A;  2V52 B;  1CZA N;  2HOE A;  1QZ5 A;  1XQS C;  3ZEU A;  3CF5 L;  3VTI A;  1VAZ A;  4Y0W A;  3DXK A;  5EY4 A;  1W2B M;  4BRN A;  3JS6 A;  2AA4 A;  3PIO L;  2P9N B;  3BUZ B;  3DLL L;  1Z05 A;  1VQM N;  4DB3 A;  3OHR A;  2ZJR L;  3EZW A;  3WXM B;  5F1X A;  3VGL A;  2QW9 A;  3ATV A;  4H0O A;  4JKF A;  3WEE B;  2E20 A;  4M7Y A;  3FLC O;  3D2F A;  3M1F A;  5AQL A;  5GIN A;  3WXL A;  4BRG A;  4F9O A;  3QBX A;  5CE3 A;  2QWQ A;  3HM8 A;  1T3V A;  3GDQ A;  4JKG A;  4O8U A;  3U9Z A;  4B1W B;  5I9E B;  3FZM A;  3MX5 A;  3BP8 A;  2E2N A;  3H1Q A;  3HZ6 A;  1V4S A;  4H5R A;  4BR5 A;  5KQ8 A;  3O1W A;  5AQH A;  2Q0R A;  3W3D A;  3GL1 A;  4IJA A;  3O1B A;  3KVG A;  4RTF D;  3PLA A;  3UB5 A;  4OO1 J;  2WUS A;  3HOT A;  3ENO A;  4A5B A;  3C6H A;  2QEX N;  4DKW A;  2GEL A;  2Q36 A;  3U4L A;  4PKH A;  2VYP A;  3G25 A;  3DAW A;  2GWJ A;  3CCR N;  2QXL A;  3WXK A;  2BH1 A;  2BTF A;  3WXI A;  5M1N A;  1ESV A;  5TKY A;  4K42 A;  4BRL A;  1JCF A;  2RE2 A;  4JHD B;  3H45 C;  4H5V A;  1U6Z A;  1NGH A;  4OPH A;  3IUC A;  1NGG A;  4WQ5 C;  1GLF O;  1TYQ A;  3MN9 A;  4WF9 L;  1VQP N;  1U2V A;  1GLJ O;  1YI2 N;  4CZG A;  2P9K A;  3MCA B;  3E1Y A;  4BR7 A;  1NGI A;  4KH5 A;  1YUW A;  2NRZ A;  5AQJ A;  2HBM A;  1SS6 A;  1QQO A;  4CBU A;  1HPM A;  5AQK A;  4IO8 A;  1NLV A;  1BOT O;  3WQT A;  1WOQ A;  2QM1 A;  2CH6 A;  2P9N A;  3D2E B;  2KHO A;  2VCP A;  3FR0 A;  4QS7 A;  5AQU A;  3HI0 A;  4FWM A;  3CCM N;  5C2F A;  2ZWH A;  5BN9 A;  5AQZ A;  4K43 A;  3WEE A;  1E4F T;  2E2P A;  1X9J A;  5FPM A;  4CZM A;  1NGJ A;  3VEO A;  1YIJ N;  1T6D A;  4EHT A;  2F9T A;  2QWR A;  4BC3 A;  4BRO A;  4EFH A;  3MWP A;  3WQU A;  4GV3 A;  5C15 A;  2KKZ A;  1ATR A;  3ULE B;  5KPR A;  1RDU A;  3G4S N;  4A59 A;  4UY8 O;  5BRE A;  4IDH A;  4AM7 A;  3CC7 N;  3CCE N;  5AQY A;  4BVO A;  3H46 O;  3EE9 A;  2FF3 B;  4CD3 A;  4GNI A;  4FVU A;  3E9L A;  1SZ2 A;  3SMS A;  2OTL N;  3ZX0 A;  4BC4 A;  3H3O B;  4RWT A;  1Z6R A;  4GY2 B;  1V4T A;  4JD2 B;  3I55 N;  3QFP A;  2H3G X;  5AQM A;  1ZXO A;  2FSK A;  4JHD A;  5E84 A;  2ASM A;  2QTD A;  2FF6 A;  1Q86 O;  5AQF A;  1EO1 A;  3R8E A;  4KH4 A;  4BRH A;  1ATS A;  3NVM A;  4BC2 A;  3CJA A;  4DCH A;  3GG4 A;  3LL3 A;  4M63 C;  3CET A;  4GVE A;  3CCL N;  2PAV A;  5EVZ A;  1YJW N;  3ENH A;  3FGU A;  1ATN A;  1GLA G;  3QBW A;  1BDG A;  4I6M A;  1E4G T;  4DHY A;  5GAE P;  3CME N;  1KD1 O;  2I7N A;  2BUP A;  4H03 B;  1LOT B;  3D2E A;  1VQ7 N;  4IZ9 A;  2V7Z A;  3EKU A;  3WT0 A;  3CC2 N;  4WQ4 A;  2FXU A;  4H5T A;  2IVO A;  3GBT A;  4K41 A;  5AQX A;  5BN8 A;  1VQ4 N;  5FPN A;  3ID8 A;  4CI6 A;  5F2R A;  1VQN N;  4BR2 A;  2Q97 A;  3DJC A;  3M6G A;  1D4X A;  3P39 A;  5LJV A;  4IEI A;  3FZH A;  2A3Z A;  3SBG A;  4ILG B;  2QWM A;  3E9P A;  4B1X B;  4C1N K;  2HBK A;  3R3L A;  2ZGY A;  3QFU A;  1NM1 A;  3Q7B A;  3ULE A;  3VEN A;  3MDQ A;  4IOX A;  3GE1 A;  3AAQ A;  1OKJ A;  3O6W A;  2J4R A;  1GLC G;  1RDW X;  3CJ9 A;  4PL7 A;  3MN7 A;  1IG8 A;  2E8A A;  1P8Z A;  2OAN A;  3GOI A;  4MLE A;  3DWL A;  5C12 A;  4CJ7 A;  2QI2 A;  4FWR A;  4CZJ A;  2JWK A;  4YOR A;  5BRH A;  4JD2 A;  5F0X A;  1KAX A;  3WUH A;  3HSC A;  4H0X B;  4H0Y B;  5M1Q A;  5FPD A;  1QVG M;  4A61 A;  4FWS A;  5HOO A;  3RVC A;  3UKR B;  4CZI A;  3HRG A;  3A0I X;  1GLE G;  1TUY A;  5DM6 L;  5JVG L;  1KXP A;  4NO7 A;  3CJ7 A;  3A8Y A;  4K25 A;  1DGK N;  1HKG A;  2NRV A;  2P9U B;  4GV9 A;  2QWO A;  2P9I B;  3CCU N;  1H1V A;  3SAG A;  3U9D A;  2CGJ A;  3HOS A;  2YCH A;  4JEP A;  3CCS N;  1NJI O;  3I8B A;  3ZET B;  1T44 A;  5EX5 A;  4C23 A;  2Q1N A;  3BF3 A;  4QS9 A;  1GLB G;  4BR0 A;  2IVP A;  3CJ1 A;  1XC3 A;  3D7E O;  4ISF A;  4NB4 A;  4JN4 A;  2CGL A;  4MDB A;  3C7N B;  5M1O A;  4ISE A;  2YJF A;  5C10 A;  4CZK A;  4U7B A;  2E2Q A;  1NWK A;  4YOU A;  3VEZ A;  1QVF M;  2V7Y A;  4JNE A;  3VES A;  3QIC A;  4E1J A;  5CHI A;  5AZI B;  4BG8 A;  1QQM A;  2ZJP L;  2OTJ N;  2D4W A;  3J8A A;  3TTF A;  2E1Y A;  1BWF O;  2IIR A;  3IDH A;  4JK7 A;  4WFA L;  2A42 A;  4FO0 A;  3SAF A;  5AQQ A;  4BRA A;  1Q81 O;  3EN9 A;  2UYT A;  2WC9 A;  4FOE A;  4H0P A;  4MO5 A;  1J6Z A;  4CD1 A;  4BRF A;  1LCU A;  3IFR A;  2NRT A;  1GLD G;  3FE1 A;  4WQ4 C;  3VF4 A;  4A62 A;  5AQV A;  4CBX A;  5EXW A;  3VER A;  1BU6 O;  4FSV A;  1XUP O;  4IOC L;  5AQN A;  4BGA A;  3E66 A;  3FZF A;  1MDU B;  3KWI A;  5GIO A;  1KAY A;  4WFB L;  3F9M A;  3A5O C;  4YOX A;  1KC8 O;  2YHY A;  2YHX A;  3EL2 A;  3H3N O;  3UKR A;  3C0B A;  5AFU H;  4GV6 A;  5KQD A;  4AM6 A;  3Q7C A;  5GIP A;  2RHK A;  3VMF B;  1Q7Y O;  1JCE A;  2P9P B;  2P9U A;  4YDU A;  1YXQ A;  1MWK A;  1RFQ A;  1VQO N;  1W97 L;  2P9I A;  3VET A;  4BRC A;  3S41 A;  1Y64 A;  1NGC A;  3RSE B;  3CQX A;  3O80 A;  1BA1 A;  4CZH A;  1S72 N;  4IXC A;  3R1X A;  2ASP A;  4U67 L;  3IKM A;  5JLF A;  1K8K B;  4H5W A;  3FZK A;  4H5N A;  3C7N A;  4ILH A;  1BUP A;  4B1U B;  1T6C A;  3VPZ A;  5GAH P;  3CCV N;  3C65 A;  5KPZ A;  4YOY A;  1KQS M;  5BRD A;  5AZI A;  3MN6 A;  1X3M A;  1K8A O;  2GWK A;  4MDA A;  3R9P A;  1O13 A;  2NRW A;  4RCH A;  3BEX A;  4A2B A;  3CCQ N;  3MWT A;  3K9K A;  1YF5 L;  3N4Q A;  2EWS A;  1RGI A;  3O5B A;  1ZBS A;  3ZYY X;  1NMD A;  3TTC A;  4FPA A;  4JKA A;  3AAR A;  1VQ9 N;  2DPN A;  2NRR A;  4B1Z A;  1R59 O;  1YAG A;  2HST A;  3UKU B;  1VQ5 N;  3CIP A;  4PL8 A;  1HLU A;  4IEE A;  3TSU A;  3L6Q A;  2HF3 A;  3NMU A;  4ISG A;  3CXC M;  4BC5 A;  3OBW A;  1X3N A;  4BRI A;  1S22 A;  2A6A A;  2W41 A;  4HTL A;  1HKC A;  4EIA A;  3VTH A;  4MO4 A;  4BVP A;  3HBT A;  3KK7 A;  2WBN A;  2P9P A;  3KHY A;  3O4W A;  5AZJ A;  5JLH A;  1M1K O;  4BG9 A;  5H1S Q;  2D1K A;  2YI1 A;  4H0V B;  4OPA A;  5AQR A;  4C1N I;  4CBW A;  4G9Z A;  3JXU A;  3LDP A;  4PKI A;  2ZGZ A;  3MMV A;  3PIP L;  1K8K A;  1K73 O;  1YHQ N;  2HF4 A;  4XH1 A;  5BR9 A;  4YOW A;  3TSP A;  4YDU C;  4KBO A;  4FWO A;  1SAZ A;  2FLO A;  4O8K A;  2FSJ A;  4LC9 B;  3EE8 A;  3NVK A;  3LDL A;  5M1K A;  3CHW A;  5ADX H;  4KH6 A;  1U2V B;  2Q31 A;  4BRD A;  3OBY A;  3VOV A;  3L4Q A;  4FWK A;  2NRH A;  2Q2R A;  4BQL A;  3VGK A;  3H6E A;  4EAH D;  3UKU A;  3LM2 A;  3OA9 A;  3O9Q A;  3P31 A;  4FWN A;  3FZL A;  4JKC A;  4JKE A;  3L4I A;  5JIC A;  5JVH L;  5FPE A;  4CZE A;  3CI5 A;  3AGK A;  4IWV A;  3A5L C;  4CZL A;  3EO3 A;  2E1Z A;  3SMP A;  3ENB A;  5B8H A;  3L0Q A;  5AQO A;  4NLB A;  3O9T A;  3O9S A;  3OW2 M;  3D6R A;  3SJH A;  5LY3 A;  4JK9 A;  4B1Y B;  1VQL N;  2A5X A;  2E2O A;  4XH4 A;  3ATU A;  3G6E N;  2VWB A;  4BRQ A;  5BRF A;  3J7Z O;  2HBJ A;  4BR9 A;  1C0G A;  4BQZ A;  3VEW A;  2YX6 A;  5JMV A;  1VQK N;  1MA9 B;  4M7X A;  3UE5 A;  3ZX2 A;  2HMP A;  2ZJQ L;  5AQP A;  3ID6 A;  5M1F A;  2ASO A;  5AQT A;  5AFU A;  1YIT N;  2I7P A;  3R6M A;  2F9W A;  1Q18 A;  2NZT A;  3DXM B;  2YHW A;  3P4I A;  2WFB A;  2CH5 A;  4JAX A;  3QB0 A;  3MK6 A;  4IFE A;  2GEM A;  1VQ6 N;  4QS8 A;  2QWP A;  3SK3 A;  1BG3 A;  3MX2 A;  2PFU A;  4BGB A;  4JKH A;  3LM9 A;  3CJC A;  3AAP A;  1BO5 O;  3CPW M;  2D0P A;  2P9L B;  1NGB A;  3W0L A;  3VF6 A;  3CER A;  5HL7 L;  4IOA L;  3CMA N;  3LDN A;  4A57 A;  4WFN L;  5GAG P;  1GLL O;  5AQG A;  1YJN N;  1DKG D;  2GX9 A;  4FWL A;  1KAZ A;  4FOI A;  3M3Z A;  1N8R O;  4FL9 A;  5AR0 A;  3CC4 N;  3I33 A;  3ZX3 A;  4I6M B;  1JCG A;  5C2D A;  1QZ6 A;  3M5R A;  3ZET A;  5AZJ B;  3HTV A;  3KWG A;  1WUA A;  3SLC A;  1BA0 A;  2VGM A;  3O08 A;  4PHT X;  3H1V X;  1HKB A;  4MLH A;  4PKG A;  4B1V A;  4B9Q A;  4A2A A;  4WCE L;  5LJW A;  3MN5 A;  1DT9 A;  1NBW A;  5CR4 A;  3SBT A;  3LDO A;  4JK8 A;  4YOV A;  2QA4 N;  1NGA A;  3AY9 A;  5M1P A;  2PBD A;  4JKB A;  2NNW A;  2JWL A;  2QWN A;  1QHA A;  1NGD A;  4IJN A;  1K9M O;  5C0Y A;  4DQ8 A;  4FPB A;  1HJO A;  5DM7 L;  1G99 A;  4WYB A;  3O8M A;  2HBL A;  2D0O A;  1JJ2 M;  2VGN A;  2NRX A;  3O9U A;  3VEX A;  4BRM A;  4J8F A;  1EQY A;  1S3X A;  2P9S B;  4FWP A;  2YJE A;  4R79 A;  3IMX A;  2ITM A;  1NGE A;  3F5T A;  4EHU A;  5BPL A;  3DXM A;  3ZEU B;  4XEI A;  3BF1 A;  4CZF A;  3DXK B;  4A5A A;  3VEY A;  3CJB A;  4ILJ A;  1M90 O;  2NLX A;  1ILY A;  1MWM A;  2GTD A;  2P9L A;  4BRE A;  2CGK A;  2E88 A;  3N4P A;  3D2F B;  1TUU A;  3VGM A;  3C6A A;  3U8X A;  2GUP A;  4BY9 C;  3EKS A;  1YJ9 N;  4YOT A;  1DEJ A;  4JKG B;  3CD6 N;  1IJJ A;  3A5M C;  5EOY A;  2ZF5 O;  3QDK A;  3TPQ A;  3TU5 A;  1Q82 O;  3VEV A;  2AP1 A;  4L3Q A;  3T69 A;  2QWL A;  4WQ5 A;  3RSE A;  3KZB A;  3K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...