4BRFA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with a distorted orthomolybdate ion and amp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
358
structure length
358
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 120
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brfA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brfA02
2Q36A 2FSNA 3W3DA 2ITMA 3QFPA 4F9OA 4EHUA 2P9SB 1HPMA 5AQRA 4CZFA 3VGMA 2KHOA 3CETA 2F9WA 4BC5A 2YHYA 2NLXA 3EO3A 4PKIA 3VEXA 1BU6O 2YJEA 3QBXA 4M7XA 1IJJA 4CZJA 4QS7A 5AR0A 2FF6A 4CZMA 5EXWA 3WXLA 3A5LC 4FWNA 5BPLA 3L4IA 1GLAG 3L0QA 3HI0A 2P9NB 4BR0A 3G25A 1NGBA 4BRPA 2A6AA 5KPZA 1V4TA 4JD2B 5E84A 3CJBA 1U6ZA 3M3ZA 2FSKA 4JHDA 2P9SA 1HLUA 5AQNA 3TU5A 4BGBA 2YHWA 4FWSA 5F0XA 5AQPA 2IVPA 1TYQB 1C0GA 1R59O 3UKUB 1QQMA 2VCPA 3GE1A 3ZEUB 3JXUA 4B1XB 1ESVA 1BG3A 4WYBA 2Q31A 5AQIA 3ZX2A 5BPMA 5KPRA 4Y0WA 4PL7A 4DHYA 1E4GT 1DEJA 4WQ4C 5BN8A 2YCHA 4BRKA 3BF1A 3MN7A 3MN9A 3WXKA 2CH6A 5F2RA 2P9NA 2PAVA 1ATSA 4FWRA 5ELZA 4K42A 4CD3A 4MO5A 3ENHA 3CJ9A 3KHYA 1JCFA 3DAWA 3VESA 1EQYA 3I8BA 4JD2A 3CHWA 3MN6A 4BRCA 3M6GA 4JN4A 1XC3A 3KVGA 1NGDA 5ADXH 4FSVA 2NZTA 2E2PA 4IXCA 3GOIA 3ENOA 2ZWHA 1KXPA 2GEMA 2BTFA 5AQGA 1TYQA 3EZWA 3O5BA 1V4SA 3C7NB 5AQZA 5JLFA 4RCHA 4XH5A 3CIPA 4L3QA 3ZEUA 3F9MA 2E20A 4YDUC 1C0FA 4B1VA 2HOEA 3BUZB 1G99A 3IUCA 3O4WA 3HSCA 4LC9B 2CGKA 2ZF5O 3VEWA 3KZBA 2PBDA 4B1YB 5LJVA 4BR9A 4CZGA 2HF3A 4IJAA 5KPTA 3CERA 2D1KA 2ZGYA 3VETA 5E26A 3IFRA 4I6MA 4FPBA 4FO0A 3HZ6A 5F1XA 3FZLA 4K25A 3GL1A 4E1JA 1Y64A 4EHTA 3GBTA 1TUYA 4FWQA 4H0TB 1RDWX 4HTLA 3SLCA 3WQUA 4BRQA 1SAZA 2E88A 4B1WB 3FZKA 4BVPA 3C7NA 3RSEB 1DKGD 3MCPA 3EKSA 3QMLA 2FSJA 2GUPA 3U9ZA 2P9IB 3MMVA 3WQTA 4BR5A 5FPEA 2P9UB 2HF4A 3CJCA 1YUWA 2W40A 4CD1A 2BUPA 5AZIB 4DB3A 5EOYA 4BQLA 4HWIA 3WXJA 3P4IA 2DPNA 2NRHA 3FZHA 4J8FA 1HUXA 3BP8A 4BR7A 1HKGA 1BUPA 5TKYA 3CJAA 1QZ6A 5AFUH 4AM6A 5LJWA 4A62A 4DCHA 1HX1A 4MLEA 5AQTA 1MDUB 5B8HA 1BA1A 1NGAA 3GG4A 4GNIA 3DJCA 3LDQA 3RSEA 3ZETB 2OANA 3EKUA 1GLBG 1NBWA 3CQXA 2YHXA 5BPNA 1GLLO 5JLHA 1KAYA 1T6CA 2P9KB 3VGKA 2P9IA 5EX5A 4BRIA 2P9UA 4QS8A 3VERA 1KAZA 2E1ZA 3DXMB 5AQLA 5AZIA 4NO7A 3W0LA 1JCEA 4FWLA 2V7YA 2HMPA 3A5NC 1QQNA 2QWQA 3WXIA 1MWMA 1YXQA 1S3XA 5ADXA 3DXKB 5AQKA 1NM1A 3J8AA 4H0OA 4BG8A 2AP1A 2D0PA 5FPMA 3VEVA 3D2FB 2E1YA 2QWRA 3TPQA 1BDGA 5FPNA 2GWJA 3AY9A 4MO4A 3ZETA 3D2EB 4K41A 5EVZA 3WUHA 5BRHA 1NGCA 2D4WA 5JICA 4M63C 5I9EB 3UKRB 4WQ4A 4BQZA 1D4XA 4H0YB 4FOEA 4BRMA 4BRDA 2P9KA 4CI6A 2E2QA 1XUPO 3U4LA 3VGLA 2ASPA 2ZGZA 4BG9A 5KQ8A 2YI1A 5AQVA 4WQ5C 1NGJA 3LM2A 4H5VA 3ZX3A 3VENA 4BC2A 1X3MA 2QXLA 3DXMA 3UKUA 1Q18A 5BR9A 2E8AA 4IZ9A 1IG8A 2QWMA 2P9LB 3FZMA 1MA9B 4IO8A 4JNEA 1YAGA 2QW9A 5AQYA 4H5NA 4A2AA 3H45C 1U2VB 4WQ5A 3DXKA 3L6QA 3QICA 2Q0UA 3U9DA 1DGKN 1QHAA 1NLVA 3O08A 2H3GX 1YVNA 1K8KB 5BRFA 2P9PB 4CZKA 4YDUA 3O8MA 3IDHA 3UE5A 3D2EA 1GLCG 2EWSA 3O80A 3ZX0A 3ATVA 4BROA 4FWMA 3WT0A 3UKRA 4Z94A 3B8AX 3WEEB 3BEXA 1S22A 3H6EA 4BGAA 5JMVA 2GWKA 4XH4A 2FF3B 4B9QA 2V52B 3QDKA 2ASOA 3DWLA 1GLFO 3H3OB 5AFUA 3GDQA 2P9LA 1Z6RA 1H1VA 2V7ZA 4FOIA 4GY2B 5AQHA 4BC3A 4BR2A 4CBWA 3LDNA 1LCUA 5AQQA 5AQSA 2A5XA 1NGEA 3AAPA 1QZ5A 3ULEB 4CZEA 5LY3A 3S41A 1CZAN 4H0XB 5AQFA 3A8YA 3AARA 4H0PA 1K8KA 2CGJA 2P9PA 4K43A 1MWKA 3ATUA 3H1QA 4O8KA 2QWPA 4AM7A 3R9PA 1RFQA 3FGUA 4PKGA 4PKHA 4H0VB 5AQMA 3JS6A 1SZ2A 4M7YA 4XH1A 1KAXA 5AZJB 3H3NO 4QS9A 1JCGA 2QM1A 2V51B 4ISEA 4PL8A 3WEEA 3A0IX 1TUUA 4IJNA 3O1WA 1T6DA 1ZC6A 4JHDB 1GLEG 5AQUA 4B1ZA 4CZHA 3CQYA 2IVNA 3QB0A 3D7EO 4FL9A 2QWOA 3QFUA 3LL3A 3VOVA 2VWBA 1WOQA 3H1VX 4FWKA 4O5FA 1NGIA 4FPAA 5AQJA 3SJHA 1NWKA 1SQKA 4BRHA 2GELA 2Q2RA 4H5TA 5BRDA 3ULEA 4ISGA 4EFHA 4BRFA 3C0BA 5CE3A 3IMXA 2W41A 3CJ1A 3FE1A 3M1FA 4FWPA 3LDOA 3LM9A 2UYTA 4H5WA 3O1BA 1RGIA 3BF3A 4BR4A 5BN9A 5AZJA 3UB5A 4BRAA 4KBOA 4RTFD 3VF4A 3HTVA 3A5OC 3LDPA 4CZLA 2QWNA 2A40A 5AQWA 4FWOA 2YJFA 1HKBA 4CZIA 2GTDA 3FLCO 4XEIA 3MDQA 4RWTA 2F9TA 3FZFA 3MK6A 4ISFA 5AQOA 3FR0A 4BREA 1NMDA 3O6WA 4B1UB 1NGFA 2Q1NA 2I7PA 5EY4A 4DQ8A 4CJ7A 4H03B 1QQOA 1ZXOA 4CBUA 4BC4A 5AQXA 4IWVA 4BRGA 1WUAA 1X3NA 3CJ7A 4I6MB 1LOTB 4BVOA 3D2FA 3R6MA 5BREA 3VF2A 4BRNA 1J6ZA 1GLJO 2IIRA 1GLDG 3CI5A 3HBTA 2IVOA 3SMSA 2CGLA 1P8ZA 3LDLA 2CH5A 2Q0RA 3AAQA 1NGHA 3ID8A 3SK3A 1BA0A 1X9JA 4JAXA 4CBXA 3HM8A 1BO5O 4A61A 2ASMA 2A42A 2I7NA 3VPZA 1BWFO 3I33A 3VEYA 2QWLA 3R8EA 4BRLA 1ZBSA 2FXUA 1HKCA 1NGGA 5KQDA 2D0OA 2E2NA 3EL2A 2E2OA 3H46O 1U2VA 3A5MC 1OKJA 3U8XA 1ATRA 1BOTO 3OHRA 3SMPA 2WUSA 2Q97A 1XQSC 3MN5A 2A41A 5FPDA 3QBWA 2AA4A 1Z05A 4EIAA 4NB4A 2FLOA 4H5RA 1E4FT 3VEOA 3VF6A 4A2BA 1T44A 3FFKB 2J4RA 1ATNA 3VEZA 3EN9A 4C23A 4EAHD 1HJOA 2VYPA 4MLHA 2A3ZA
chains in the Genus database with same CATH superfamily
4DU4A 1VQMN 2HNDA 3NAEA 1HPMA 5DM7L 5KI6A 4JKHA 3EO3A 4HUEA 4YFUA 1BU6O 4DU1A 3QBXA 4NCAA 4CZJA 2VQFK 5JVGL 4KRFA 5AR0A 4EZ6A 3U3YA 4FWNA 3THYB 4A5AA 5BPLA 4B9UA 3Q7BA 3KWIA 1R0AA 4GW6A 4PY5A 4BR0A 4O55A 4CHZA 2A6AA 3IRXA 5KPZA 4CEFA 3TSPA 1ILYA 4JD2B 4OKJA 4B8AB 4IBNA 2HBLA 1RBVA 3M3ZA 3AVCA 1VQ9N 4AHRA 1TYQB 1YJNN 3PUFA 4BY9C 3THVA 4X62K 1SS6A 3HRGA 1BG3A 3VQ8A 2Q31A 5AQIA 2GBZA 3WXMB 3LP2A 1DEJA 1U49A 2YCHA 4BRKA 1GOBA 4CJPA 3MN7A 3AO4A 2CH6A 2P9NA 4FWRA 1ATSA 5ELZA 1QHTA 1VQ5N 4XIUA 3ENHA 3ZT4A 3KHYA 4FJLA 4Z4IA 1JCFA 4JEPA 4CEAA 3CHWA 4Q5VA 3MN6A 4BRCA 4JN4A 3AGRA 4G9ZA 4CIEA 1NGDA 2NZTA 4IXCA 3CCJN 1S1UA 1S5JA 1UA0A 4W5NA 4AQYK 3I56N 4ZTJA 3O3FA 4I2PA 5JLFA 4RCHA 3OYAA 5JS1A 4XH5A 4CJEA 3QEWA 3OYMA 2HNZA 4JS5A 1DLOA 2E20A 2PYJA 4RW8A 3FFIA 4LC9B 3NF8A 3U3GA 2BDPA 1T3VA 2XY7A 4BR9A 1RBTA 2Y1JA 4CCHA 2VWKA 3E9LA 3CERA 4CF2A 4JYAK 4YOTA 2ZGYA 3KJVA 1VSKA 3HT3A 3OS1A 3K5NA 1SL0A 1FW6A 2FBTA 4FVMA 3FZLA 3TAMA 4N76A 3GL1A 4E1JA 4EHTA 1X1PA 2BH1A 4BRQA 3EEQA 1SAZA 2E88A 2IDOA 3RSEB 2WBNA 4NCBA 2KKZA 1TV6A 5CYMA 5C24A 4JI5K 2HHVA 4DR6K 2KFZA 4KTQA 3UIQA 2W42A 1RDAA 4KHYA 4CEEA 3U9ZA 4YY3K 4B3RK 5FPEA 2HF4A 3CJCA 1RT6A 1YUWA 2W40A 4CD1A 2BUPA 4M41A 5AZIB 4CEDA 3OYCA 4HWIA 3WXJA 3FZHA 1N33K 3MXMA 3BP8A 3CM6A 5TKYA 3CJAA 1QZ6A 3MEEA 2KZMA 2F8SA 2DTUA 1W7AA 4E7JA 3TARA 1NGAA 3K57A 2E5LK 3DJCA 3V1OA 3LDQA 1KVCA 3AGKA 5BPNA 1CLQA 4B3OA 5KTQA 1HJRA 3AVJA 1T6CA 4YOUA 4Z4GA 2P9IA 4JKFA 2P9UA 1QVGM 1KAZA 3ZT1A 3HXMA 3SV4A 3BZKA 2BANA 3W0LA 3KK7A 1YT3A 1JCEA 2V7YA 1C0TA 5LMUK 3V9UA 1NK5A 1Z26A 3LPTA 1YXQA 3SUQA 5ADXA 3AA5X 4PA1A 3VA3A 4Z4EA 2AP1A 4QAGA 1NK8A 4B3TK 3D2FB 3O9RA 5FRNA 5C25A 3D45A 5MLCQ 2JWKA 1FXXA 4DQSA 3ZETA 4JKDA 1SKWA 4K41A 3G0ZA 5EVZA 5HRRA 1IO2A 3C6TA 1D4XA 4M3ZA 4CI6A 2E2QA 3VGLA 3NVMA 3V1QA 3CMEN 4WQ5C 4M3YA 4H5VA 3ZX3A 1X3MA 1Q18A 2E8AA 3S3OA 2P9LB 3FZMA 1MA9B 4HUFA 1VSDA 3E66A 4LD0A 1EETA 4A2AA 3H45C 4CJUA 2UXCK 3E01A 5C0YA 4CHNA 3QICA 2Q0UA 3U9DA 3RR8A 1BI4A 4UY8O 1NLVA 1YVNA 4CZKA 4CF9A 3UE5A 5GAEP 1NOZA 4DKWA 2EWSA 4BROA 3VN5A 3UKRA 4B9MA 4BWMA 2RF2A 3BEXA 4HUGA 4J2EA 4JK9A 1B9DA 5JMVA 4DV7K 1RNHA 2O8EA 4KI6A 1X9WA 1HQUA 1L5UA 3H3OB 5AFUA 4I2QA 1H1VA 4CBWA 1WNSA 1NJWA 1XI1A 5GAHP 1W2BM 1NGEA 4CZEA 5J2QA 1A5VA 4YOVA 1NU0A 5IWAK 3T1YK 5AQFA 3KK1A 1YITN 1CZ9A 3EE8A 4CFDA 3ATUA 3SV3A 2QWPA 4AM7A 2NRZA 3KKSA 4CIFA 3D0PA 3LAMA 3LZJA 1U04A 4CFAA 4M7YA 4XH1A 1KAXA 2HMIA 4QS9A 4DTJA 3F2KA 3O1WA 3E9OA 3OYIA 4JHDB 1GLEG 3CQYA 4NXMK 2OPRA 3QB0A 2Z1GA 3D7EO 3VOVA 1YI2N 3QINA 4E7LA 1NWKA 1SQKA 4F8RA 1FJGK 2WFBA 1NJXA 3C0BA 5CE3A 2QEXN 1HNWK 4IOAL 1S1VA 4DLEA 3ISNC 1JJ2M 4H5WA 3L2VA 3BF3A 5AZJA 5BN9A 3UB5A 3V9ZA 4RTFD 3VF4A 1CZBA 3C65A 2QWNA 4CHYA 3DRRA 4KH6A 4CJVA 2GTDA 3FLCO 4RWTA 1VSIA 4EP5A 5CHIA 1D9DA 3ALYA 1QQCA 1KC8O 5EY4A 1VSFA 4CHOA 3EY1A 3TWHA 4H03B 1QQOA 4R5PA 3CQ8A 1VQ8N 4H8KA 5KRSA 4B9SA 1I39A 2KW4A 1UAXA 3NF9A 4HHTA 3D2FA 3ZT0A 4WF9L 4DQRA 5BREA 3CCLN 4DTUA 5C12A 3VF2A 2ATQA 4JRQA 2IIRA 1LV5A 1D8YA 1KVBA 3NCIA 1UWBA 3O9UA 3HOSA 3SK3A 3ZSXA 3QO9A 4E7IA 2WOMA 1WBBA 5HRSA 2A42A 2I7NA 1BWFO 3HYFA 4JI7K 4DF4A 3R8EA 1NK4A 4OKEA 3ZCMA 1J54A 5KQDA 1I94K 3OYKA 2ETJA 1IKYA 2E2NA 2HNYA 3EL2A 3V9XA 3U8XA 1ZBUA 3EE9A 5M1FA 5KRTA 1NNEA 1HQEA 4DS5A 3SUNA 2FLOA 1LAVA 3VEOA 5FLXO 4CEBA 3O9SA 3TANA 1HJOA 2VYPA 4DUYK 1U4BA 4F2RA 3W3DA 1REVA 3SUPA 1T8EA 3DLHA 3DYAA 3F5TA 1BCOA 2VG5A 5CYQA 5TKWA 4BC5A 2YHYA 2NRTA 4PKIA 1KVAA 2A1SA 1CXQA 4RW7A 4QS7A 3ULDA 2XO7A 4DR5K 5C10A 1N32K 3KLEA 4FZYA 3L4IA 4W5QA 1GLAG 2LSNA 2P9NB 3NDKA 3G25A 1C0MA 1T7PA 1OH5A 4BRPA 3M8QA 3V1RA 3L2WA 1V4TA 3SI6A 3MEDA 3K0SA 2QK9A 5E84A 4W5OA 1U6ZA 4DS4A 4JHDA 1TK8A 2P9SA 5AQNA 2F96A 1CXUA 3TU5A 4FLXA 5F0XA 2NRRA 3J80O 5AQPA 4DF8A 4B9LA 4KI4A 1W0HA 1QQMA 4IFYA 4YOWA 3RTVA 3WNFA 3TAQA 4DTMA 4WYBA 5KPRA 3P5JA 3VQQA 4DHYA 4Z4FA 5BN8A 3VMFB 3V4IA 4N41A 4JV5K 4U7BA 2XY5A 3AA2A 2PAVA 4CD3A 4DTOA 3OA9A 1DTQA 3DAWA 3SBGA 4KHQA 3VESA 4WFNL 4C8KA 3LP3A 3KVGA 4FLYA 3O3HA 1VAZA 4M42A 2IOCA 2YNFA 3GOIA 1WN7A 2GEMA 5AQGA 4H4OA 5AQZA 2D0BA 1FKPA 3MXIA 3ZEUA 3F9MA 4PHTX 5GIOA 4IDKA 3V6DA 2W6LA 1G99A 3IUCA 3O4WA 1IG9A 3HSCA 2CGKA 4IG0A 2ZF5O 3VEWA 3KZBA 2JWLA 1QSLA 4FK2A 2PBDA 3TAFA 3CYMA 2P5OA 4GMJB 4N5SA 4F2SA 3IFRA 2WTUA 4FPBA 1N6QA 4OPHA 4DR3K 2PFUA 3NF7A 2FBXA 1NKBA 3GBTA 1TUYA 1S6PA 4FW2A 4HTLA 3SLCA 2R7YA 3THXA 4FJXA 2VGMA 2RHKA 4DV5K 2G8FA 3OBYA 3ZYYX 4DSLA 4LF5K 4NLCA 3TABA 1EXQA 1BGXT 1BL3A 3LPUA 2P9IB 1C1CA 5SZTA 2P9UB 5DK5A 3LP0A 4DFPA 4YOYA 4YHHK 3P4IA 4J8FA 1GOAA 1KD1O 1BQNA 1BUPA 3KLIA 3SZ2A 2F8TA 3JYTA 4O0IA 4AM6A 4J2DA 4C8LA 4KHSA 1C6VA 2ZJRL 4MLEA 2OPPA 3OY9A 4K0KK 4IO9L 5B8HA 1D5AA 3ZETB 2YHBA 1GLBG 4RW6A 2X74A 5C15A 4X65K 3RMBA 4CK3A 3ITHA 3V81A 1RTJA 1TKZA 3VGKA 4DTPA 4DG1A 3I55N 3DLEA 2ZJQL 2E1ZA 4O5BA 4N47A 4FLUA 2QWQA 1MWMA 2E4LA 1RCHA 3AA3A 5HP1A 3KWGA 4BG8A 4H0OA 4LSLA 1BI4B 3HO1A 1BDGA 3THWB 1Q86O 4MO4A 3O9QA 3A2FA 5BRHA 1B92A 1NGCA 2D4WA 2HHTA 4KH5A 3JAMO 4FJMA 1BCMA 3UKRB 4H0YB 3U4LA 2ZGZA 1NG9A 3OYBA 3V9SA 4LFCK 2O8EB 1XHXA 4CF1A 4BC2A 3L2UA 1UA1A 1IG8A 4CJRA 3HJFA 4PQUA 4LFBK 3P83D 3DXKA 3CCSN 2UUAK 3BZCA 3O08A 2H3GX 2O8DA 3M8SA 3QEPA 5BRFA 1N36K 3ZSOA 4KHWA 1GOCA 3SJJA 3O8MA 1RBSA 3IDHA 4EZ9A 2X6SA 3O80A 4JI8K 2DY4A 3ATVA 4IEIA 3WT0A 4KTZA 2YX6A 4KO0A 1S22A 2ZE2A 3OJUA 3AVFA 3PSFA 5GIPA 1J9AA 1J53A 4JKBA 4B9QA 2V52B 3QDKA 5J1EA 4FCYA 3CFOA 3DWLA 4JI0K 5J2PA 1RT4A 2V7ZA 1Z6RA 5AQHA 4O0JA 1LCUA 2O8FB 3L4QA 1RTDA 1I3AA 3S41A 1CZAN 3CCRN 1NOYA 4H0PA 5C42A 1K8KA 4YORA 2CGJA 2P9PA 4K43A 1HR0K 4EP4A 1WSGA 1RFQA 1LWEA 5AQMA 4C8NA 4H0VB 1EO1A 1SZ2A 3OS2A 5AZJB 3LWMA 3OW2M 1JCGA 2QM1A 2V51B 2HHHK 1TAQA 4IJNA 4HTUA 5K14A 3MAQA 4J2BA 4CHPA 5J2NA 4FW1A 2VG7A 4F3TA 4QOZB 3H1VX 4FWKA 4O44A 5AQJA 3J7YP 3CC4N 3OYJA 4OKKA 4DTXA 5BRDA 3AVLA 1NMNA 3T69A 3V9WA 4KREA 4KH4A 3ZSWA 1K73O 1RTIA 2JLEA 4DU3A 1WSHA 3TTDA 4DR4K 3LDOA 5KGWA 1HNIA 3O1BA 4M3XA 2UXDK 1VQ4N 4DR7K 3MX5A 4CJSA 3HTVA 3HK2A 4HCBA 3LDPA 2HHSA 1BQMA 3HSTB 1S9EA 2HBKA 3Q7CA 4Z0UA 4FWOA 4LF6K 1JLBA 4AF1A 1HYVA 3VTIA 1HKBA 4XEIA 2VQEK 1NMDA 2RN2A 2BE2A 3O6WA 2ITGA 5M1KA 4B1UB 1NGFA 4GV9A 3AV9A 5DM6L 2Q1NA 1Q7YO 1SKRA 4W5TA 4DQ8A 4DLGA 1ZXOA 4CBUA 4CEQA 4KHNA 4BRGA 4C1NK 4JK7A 1RDBA 1VRTA 1QE1A 2F7TA 1WUAA 3CJ7A 3ID6A 5GAGP 1VQ7N 2QKKA 2GX9A 4DQPA 3T1HK 1SL2A 3LZIA 2FBVA 1EX4A 1RT3A 5C2FA 3THWA 1J6ZA 2AJQA 1GLDG 3CI5A 3QNNA 2IVOA 2CGLA 2VGNA 1P8ZA 3BY5A 2CH5A 2OPSA 3AAQA 1NGHA 4CGHA 2HVIA 3ID8A 5M1OA 4NYFA 4CGDA 4OO1J 1YTUA 4A61A 4E3SA 1E3MA 4X64K 3I33A 4BE1A 2HW3A 1Q82O 1A5WA 2FXUA 3TR8A 1NGGA 1W97L 2D0OA 3C6HA 3TTCA 2E2OA 2O4GA 3L8BA 1KFSA 1JLAA 1N34K 3G71N 3OHRA 3K9KA 3SMPA 4F4KA 3KIOA 3K59A 4GKKK 2Q3SA 3KLGA 1YHQN 4H5RA 1WAJA 3PIPL 3VF6A 3I8DA 1T44A 3OTOK 2J4RA 2OZSA 2OPQA 5JVHL 3EN9A 2D5RA 2DFFA 4MLHA 4CK1A 2Q36A 4DV1K 2ITMA 4F9OA 4YNQA 2P9SB 3AVBA 4JI4K 3VGMA 3AO3A 4FLZA 2F9WA 2NLXA 3AVGA 4QCLA 1G15A 3VEXA 2YJEA 1JKHA 3SNNA 4E7KA 4Y1CA 1J5OA 2O8FA 3R3LA 2E6LA 2P5GA 3QEVA 1VSJA 2FF6A 1JXBA 3WXLA 4FJJA 4JI1K 4ILHA 1UOCA 4CK2A 3MEGA 4GV3A 2NUBA 3L0QA 3HI0A 3IG1A 3QLHA 1U45A 4O8UA 1NGBA 4CHQA 1S9GA 5HROA 2W6KA 4FJNA 1KRPA 1TK0A 3OYGA 3O4NA 1NK6A 3CJBA 4DSJA 4LH5A 3VQ9A 1XNQK 2FSKA 4E89A 3QEXA 3OBWA 4BGBA 2YHWA 4E7HA 4FWSA 1N5YA 5IT9O 3UKUB 4LH4A 3L3UA 1OH8A 4KB0A 2VCPA 4NLBA 3ZEUB 3JXUA 1ESVA 3LAKA 5BPMA 2B5JA 4W5RA 2B4JA 1ZYQA 3NH1A 3BF1A 3MN9A 3DRSA 4HCCA 4JKEA 4I7FA 3CJ9A 3AVNA 1IBLK 1EQYA 3OYHA 2O8CA 1XC3A 2RPIA 1F21A 1NKEA 3R1XA 4MDBA 5ADXH 4FSVA 2XY8A 2E2PA 2G8KA 1TVRA 2EHGA 3SAGA 3THXB 1KXPA 4I9LA 4DV6K 2BTFA 4FLVA 4M3UA 3EZWA 3O5BA 3SPYA 4Y1DA 3TI0A 1YJWN 3ENBA 4L3QA 4AHCA 3RMAA 1RTHA 4YDUC 2HB5A 3QIPA 3SAFA 3AVHA 3CFRA 3PLAA 4ILGB 1XNRK 3ZSRA 3RVCA 1JXEA 4B1YB 2G8HA 1QSSA 4FJ8A 3NBPA 4K8XA 4IJAA 5KPTA 4CEZA 3IS9A 3RWUA 2D1KA 1SV5A 4JKAA 2IS3A 5E26A 1RT7A 4AILC 3NMUA 4FO0A 5F1XA 4FLWA 4NXNK 1TAUA 1Y64A 3ZSYA 4OJRA 4KV8A 1C1BA 3WQUA 1IV0A 2GUIA 1ZBLA 4B1WB 4BVPA 1HMVA 3C7NA 4FJ7A 3ZT2A 2BGGA 3MCPA 1HNVA 3OYFA 3EKSA 2KZZA 4CW7B 3QMLA 3CCEN 2FSJA 2GUPA 4KHUA 3WQTA 4BR5A 4IG3A 5EOYA 2NRHA 3NFAA 1HUXA 1JLEA 3BDPA 2YKNA 4BR7A 3AVKA 3NGIA 2QA4N 4JRPA 1ITGA 3NVKA 5AFUH 5LJWA 4A62A 4AHTA 3DOKA 4Z4CA 4YOXA 3KK2A 2OTLN 3AO5A 2WC9A 3GG4A 4OLAA 4GNIA 2WONA 2UUCK 3IAYA 3ZT3A 1NBWA 1ZBFA 3CQXA 2YHXA 1HPZA 1KAYA 1XMOK 5EX5A 4BRIA 4QS8A 1NKCA 3LDSA 4CIGA 3VERA 4M3RA 4CF0A 5LL6Z 5AQLA 4NO7A 3VQBA 2P1JA 2HSTA 1LW2A 2IGIA 4FZZA 4FM0A 2HMPA 3A5NC 1QQNA 3TAGA 3HP9A 3KKRA 1S3XA 1EWRA 4OGEA 3DXKB 5AQKA 3J8AA 1HRHA 2ZJPL 2OCEA 4ELVA 2B6AA 5FPMA 1ASUA 3VEVA 2E1YA 5CR4A 3JSMA 2QWRA 1TK5A 1OVYA 3O9TA 4FXDA 2O8DB 3TPQA 5FPNA 1JLFA 1YTAA 4ELTA 5CY4A 4CGJA 1L3UA 1JL2A 3WUHA 4M63C 3HP6A 4NCGA 4BQZA 3NH0A 3D6RA 4FOEA 3TAEA 2P9KA 3PX4A 4JKCA 4BG9A 1BIZA 4DFJA 2PYLA 5KQ8A 1XC9A 1VHXA 3CMAN 3DXMA 1ZBIA 3UKUA 2X6NA 4IO8A 4JNEA 3HL8A 1YAGA 5AQYA 4H5NA 3QNOA 1U2VB 3TTFA 3L6QA 2FBYA 5I3UA 1K8KB 4GV6A 1Z25A 2P9PB 1T05A 4YDUA 2OA8A 3D2EA 4WFAL 3ZSZA 4DSEA 4A57A 4MDAA 3KD5E 2DFEA 4Z94A 4AHUA 2E6MA 3H6EA 1N8RO 4N56A 2VWJA 3K9JA 4HVJA 2O4IA 1S1XA 2ASOA 1S72N 4FJHA 3QEIA 1VRUA 3GDQA 4BC3A 4FOIA 3L3VA 4GY2B 4KTWA 2PZSA 4LF9K 4BR2A 4KAZA 4JS4A 1YVUA 5AQSA 1LW0A 1ZBHA 3AAPA 2Z1IA 3CG7A 1TKTA 2NNWA 5LY3A 4LF7K 3KD1E 4H0XB 4V19S 3A8YA 4U67L 3AARA 1FK9A 5E41A 3H1QA 3DLGA 3R9PA 2HBJA 3JS6A 3CCMN 4F3OA 4MFBA 3WEEA 4ISEA 1HNXK 4FJ9A 3A0IX 1TUUA 1T6DA 1ZC6A 4CJ5A 4B1ZA 3DLBA 3MXJA 1K6YA 3J7ZO 3VQ5A 3SUOA 4FL9A 4DSFA 3VQCA 4CF8A 1SL1A 1S6QA 2QWOA 5DMRA 3SQ4A 1WOQA 3RMDA 4O5FA 1NGIA 3SJHA 5HOOA 3K5OA 2GELA 4RG8A 4BACA 2G8IA 2ZM6K 4H5TA 3ULEA 4ISGA 4EFHA 1YIJN 4JLHA 4BRFA 2QXFA 1D9FA 1O13A 2NRWA 3K5MA 4DR2K 3CJ1A 3FE1A 3TSUA 1T03A 3LM9A 5A2QO 1RGIA 3NGYA 4BR4A 4C8OA 2KLAA 4BRAA 4KBOA 5JS2A 1QVFM 3C6AA 4FLTA 4DSIA 5AQWA 1TL1A 2HHQA 1WSIA 3MDQA 1QSYA 3MK6A 4ISFA 3WNEA 5AQOA 3CF5L 4DUZK 3M5RA 1NJIO 1KQSM 1KCFA 3HPGA 3VQDA 2O8BA 2I7PA 3OYLA 3CC2N 4JI3K 4CJ7A 1SUQA 4CVNE 4BC4A 3T3FA 4IWVA 3ZLJA 3OVNA 3AO2A 3P39A 4CJKA 4M45A 2KQ2A 1U47A 1FKOA 4I6MB 1TKDA 3T7ZA 3R6MA 3BGRA 3LWLA 3RRGA 3ZSVA 3S3NA 1GLJO 1XHZA 4BDYA 3HPOA 4OPJA 3HBTA 3K2PA 3F73A 4O4GA 3AA4A 2YV0X 3VQEA 4DFKA 1Q8IA 2OYQA 2Q0RA 3CC7N 4KB1A 1TL3A 1BA0A 4JAXA 3TAPA 3HM8A 4KFBA 2ASMA 4NYNA 3VPZA 4JI6K 1OH6A 2QTDA 3U6FA 3VEYA 2QWLA 1NJZA 4JKGA 3DMJA 4BRLA 1RT2A 1HYSA 5D3GA 3C6UA 1VSLA 1B9FA 1U2VA 3A5MC 1OKJA 5M1QA 1ATRA 2WUSA 3VQ4A 3HM9A 1XQSC 3MN5A 4ILJA 2Y1IA 1X9MA 4E19A 4C1NI 4ZHRA 2A41A 2QKBA 5J2MA 3ASMA 2HHWA 3M8PA 2AA4A 4EIAA 1VQPN 4CECA 3SCXA 4DQQA 4CJQA 4A2BA 3FFKB 3VEZA 1VSEA 5I42A 4M3TA 2YHAA 4IFVA 1VQKN 2A3ZA 1IH7A 2FSNA 4X66K 3NF6A 3QFPA 1RT5A 4L8RB 4IDHA 4EHUA 2QI2A 1RDDA 5FROA 4CZFA 5AQRA 3DOLA 2KHOA 3B6OA 3CETA 1WSEA 3J7AP 4CFBA 4DV4K 1NJYA 1KLMA 4M7XA 1IJJA 3J81O 4OX9K 4CZMA 5EXWA 4DSKA 5KGXA 3A5LC 4BE2A 3T1AA 2HVHA 3SAHA 3PY8A 4DR1K 3KTQA 3RRHA 2XHBA 4DV2K 1ASWA 4FJGA 4WCEL 3MWTA 3QERA 1IKWA 2O8CB 3OS0A 1HLUA 1W9HA 3SBTA 2IVPA 2P51A 1C0GA 1R59O 2IAJA 4CFCA 3O4QA 3GE1A 2HBMA 1XMQK 1RBRA 1XWLA 4B1XB 4AHVA 3AO1A 3ZX2A 4Y0WA 1Q81O 4PL7A 4ID5A 1E4GT 3THYA 4WQ4C 3G4SN 3C95A 4DFMA 5M1NA 4Q0BA 3WXKA 5F2RA 1KLNA 1EWQA 4I9QA 2UU9K 4K42A 4MO5A 3EZ5A 2VG6A 3VQ7A 3I8BA 4JD2A 3M6GA 1C0UA 3S9HA 1NK0A 2OZMA 1JLQA 3DI6A 4PUOA 1M1KO 3C94A 4B9VA 3ENOA 4R79A 2ZWHA 3CCQN 1TYQA 1V4SA 3C7NB 4H4MA 4B8CA 1L3TA 3CIPA 3HPHA 3MWPA 2PY5A 4OPAA 2YKMA 1LWCA 1C0FA 4B1VA 3MCAB 4ICLA 3LALA 2HOEA 1C1AA 3BUZB 3KLFA 3CFPA 4CGFA 3QIOA 3HVTA 1VSMA 5SWMA 3E9PA 5LJVA 2OTJN 4BE0A 4CZGA 2HF3A 5HRPA 3SPZA 4K8ZA 4FK0A 4CJ3A 4CJFA 1M90O 3VETA 3VQ6A 4I6MA 1RBUA 3HZ6A 1JL1A 3VQPA 5HL7L 2YNIA 4K25A 2NRVA 1MU2A 4FWQA 3PX0A 4H0TB 3KLHA 1RDWX 1NK9A 2D0AA 4CE9A 2EX3A 1K8AO 3FZKA 4FJ5A 4E1NA 1DKGD 4BWJA 1KTQA 1OVQA 1NK7A 1YF5L 4OGCA 4OPKA 3CM5A 3P31A 2I5JA 4JI2K 4KHPK 1BISA 3MMVA 4CJ4A 3WNHA 1LWFA 3L2RA 3DLKA 3CCUN 2KFNA 3OYNA 4DB3A 4BQLA 2DPNA 5H1SQ 4LY7A 2YNHA 3TSQA 1HKGA 2G8UA 5CZ1A 4DCHA 3CXCM 1DTTA 1Y97A 5AQTA 1MDUB 2X78A 5EU7A 1BA1A 4E1MA 2NRXA 4ELUA 1Q9XA 2G8WA 3LP1A 3RSEA 3SQ0A 2OANA 3EKUA 4KPYA 3B6PA 1GLLO 5JLHA 1EKEA 4CJLA 4CERA 4FJKA 3L2QA 2P9KB 1TGOA 4CGIA 4C8MA 3DXMB 5AZIA 1EP4A 4DTSA 3PO4A 4IFEA 1L3SA 4FWLA 3NH2A 3H08A 3WXIA 4LF8K 4AHSA 1JLGA 4OLBA 4ZTFA 1NM1A 2D0PA 1K9MO 4G1QA 4OVLA 2GWJA 4PWDA 3AY9A 5HRNA 3EYZA 3D2EB 3DRPA 5JICA 5I9EB 3DLRA 2JGUA 4WQ4A 1SKSA 3VTHA 4BRDA 4BRMA 1VQON 1XUPO 2ASPA 2YI1A 5AQVA 1NGJA 3LM2A 3VENA 3CPWM 3SYZA 3DLLL 2QXLA 3ZSQA 5BR9A 4CEOA 4IZ9A 2QWMA 1RDCA 4DWIA 3K58A 3CD6N 2QW9A 4IKFA 4WQ5A 3N4PA 3PO5A 5M1PA 1DGKN 1QHAA 4CJTA 1VQNN 3G10A 4FZXC 1P90A 2XRIA 2HHUA 1BHLA 4LSNA 3VA0A 1A5XA 4FJIA 4TSXA 4CESA 2G8VA 1J5EK 1GLCG 1WLJA 3MECA 5CZ2A 3ZX0A 3I0SA 1WSJA 4FWMA 3WEEB 3B8AX 4WE1A 4BGAA 3PIOL 3AVMA 1IKVA 2GWKA 4XH4A 3DM2A 2FF3B 1S1TA 3E1YA 1WBDA 3QESA 1GLFO 4Z4HA 2P9LA 5C2DA 3LDNA 3OJSA 5AQQA 2A5XA 3PX6A 4J2AA 1QZ5A 1KSPA 3ULEB 4GVEA 1WB9A 1QTMA 2HHXA 1MWKA 1WAFA 4O8KA 4MQ3A 4E0DA 2GV9A 3FGUA 4PKGA 4PKHA 3F9KA 3LANA 3CCVN 2YNGA 3H3NO 2XY6A 4BDPA 4PL8A 2A1RA 4DV0K 4IEEA 3VQAA 4UQGA 3K5LA 5AQUA 3KK3A 4CZHA 2IVNA 3AVIA 1L3VA 3QFUA 3LL3A 2VWBA 4RW9A 4FPAA 1QS4A 4CGGA 4FM2A 4BRHA 2Q2RA 5LMNK 4DTRA 2RE2A 4IOXA 4DTNA 1HYZA 2O8BB 1ASVA 4JK8A 2DFHA 3IKMA 4LF4K 3IMXA 2W41A 4ID1A 4FWPA 1VK0A 3M1FA 1X9SA 2KTQA 3G6EN 2UYTA 4FYDA 2Z1HA 1LAWA 1YJ9N 3SQ2A 3HOTA 4RW4A 3A5OC 1BIUA 5HLFA 3N4QA 4CZLA 5AJ3K 4DV3K 1RILA 3S3MA 2A40A 1RDUA 2YJFA 3PSIA 4AH9A 4GKJK 4GVMA 4CZIA 5GINA 3O3GA 4LFAK 2F9TA 1IBMK 3FZFA 3OYDA 2ZQBA 3MX2A 3FR0A 4BREA 3PV8A 2IC3A 3RR7A 3P1GA 2F4VK 4CJWA 5GADP 3OYEA 4FM1A 2UXBK 2UUBK 1DT9A 4JKGB 5AQXA 3P38A 4B3SK 2ZD1A 3NGZA 5HBMA 3NHGA 1IBKK 1X3NA 3HVRA 1LOTB 1Q9YA 4BVOA 1VSHA 3I0RA 4WFBL 1U48A 3AVAA 4DMNA 4M3WA 2FC0A 1VQLN 4BRNA 1WSFA 3SMSA 4B9NA 3M8RA 3LDLA 1JLCA 1HNZK 4DQIA 1X9JA 3T19A 1OH7A 1KFDA 4CBXA 4FVUA 1BO5O 4B9TA 2Z1JA 3CPEA 1RT1A 5T7BA 1ZBSA 4B3MK 1HKCA 1O1WA 3NE6A 4KKOA 3H46O 4BDZA 1BOTO 1IKXA 5FDLA 4FK4A 2D0CA 2Q97A 1TKXA 5BR8K 3WNGA 5FPDA 3QBWA 1Z05A 4B08A 3QETA 3SQ1A 4NB4A 1VQ6N 1S1WA 1E4FT 2RKIA 1ATNA 3RMCA 4A5BA 4C23A 5FRMA 4A59A 4EAHD 4IOCL 1HX1A
chains in the Genus database with same CATH topology
2Q36A 2FSNA 3W3DA 2ITMA 3QFPA 1VQMN 4F9OA 4IDHA 4EHUA 2QI2A 3F5TA 2P9SB 1HPMA 5AQRA 4CZFA 5DM7L 3VGMA 2KHOA 3CETA 4JKHA 2F9WA 5TKWA 2YHYA 4BC5A 2NLXA 3EO3A 2NRTA 4PKIA 3VEXA 1BU6O 2YJEA 3QBXA 4M7XA 1IJJA 4CI6A 4CZJA 3R3LA 5JVGL 4QS7A 5AR0A 2FF6A 4CZMA 5EXWA 3WXLA 5C10A 3A5LC 4FWNA 4ILHA 4A5AA 5BPLA 3L4IA 3Q7BA 3KWIA 4GV3A 1GLAG 3L0QA 3SAHA 3HI0A 2P9NB 4BR0A 3G25A 4O8UA 1NGBA 4BRPA 2A6AA 5KPZA 1V4TA 4WCEL 3TSPA 3MWTA 1ILYA 4JD2B 5E84A 3CJBA 1U6ZA 2HBLA 3M3ZA 2FSKA 4JHDA 2P9SA 1HLUA 5AQNA 3TU5A 3OBWA 3SBTA 4BGBA 2YHWA 4FWSA 5F0XA 2NRRA 1VQ9N 5AQPA 2IVPA 1TYQB 1C0GA 1YJNN 1R59O 3UKUB 1QQMA 4YOWA 2VCPA 3GE1A 4NLBA 2HBMA 3ZEUB 4BY9C 3JXUA 4B1XB 1SS6A 1ESVA 1BG3A 3HRGA 2Q31A 4WYBA 5AQIA 3ZX2A 5BPMA 5KPRA 4Y0WA 1Q81O 3WXMB 4PL7A 4DHYA 1E4GT 1DEJA 4WQ4C 5BN8A 3VMFB 3G4SN 5M1NA 2YCHA 4BRKA 3BF1A 3MN7A 3MN9A 3WXKA 2CH6A 4U7BA 5F2RA 2P9NA 4JKEA 2PAVA 1ATSA 4FWRA 5ELZA 4K42A 1VQ5N 4CD3A 4MO5A 3ENHA 3CJ9A 3KHYA 3OA9A 1JCFA 3DAWA 4JEPA 3SBGA 3VESA 1EQYA 3I8BA 4JD2A 4WFNL 3CHWA 3MN6A 4BRCA 3M6GA 4JN4A 1XC3A 3KVGA 3AGRA 1VAZA 4G9ZA 3R1XA 1NGDA 4MDBA 5ADXH 4FSVA 2NZTA 2E2PA 1M1KO 4IXCA 3GOIA 3CCJN 3ENOA 4R79A 2ZWHA 3SAGA 1KXPA 3CCQN 2GEMA 2BTFA 5AQGA 1TYQA 3EZWA 3I56N 3O5BA 1V4SA 3C7NB 5AQZA 5JLFA 4RCHA 1YJWN 3ENBA 4XH5A 3CIPA 4L3QA 3ZEUA 3MWPA 3F9MA 4OPAA 4PHTX 2E20A 5GIOA 4YDUC 1C0FA 4B1VA 3MCAB 3SAFA 2HOEA 3BUZB 1G99A 3IUCA 3O4WA 3PLAA 3HSCA 4ILGB 4LC9B 2CGKA 2ZF5O 3VEWA 3KZBA 2JWLA 3RVCA 2PBDA 1T3VA 3E9PA 4B1YB 5LJVA 4BR9A 2OTJN 4CZGA 2HF3A 4IJAA 3E9LA 5KPTA 3CERA 2D1KA 4YOTA 2ZGYA 1VQON 1M90O 4JKAA 3VETA 5E26A 3IFRA 4I6MA 4FPBA 4FO0A 3NMUA 3HZ6A 5F1XA 5HL7L 3FZLA 4K25A 2NRVA 4OPHA 3GL1A 2PFUA 4E1JA 1Y64A 4EHTA 3GBTA 1TUYA 4FWQA 4H0TB 1RDWX 4HTLA 2BH1A 3SLCA 3WQUA 4BRQA 2VGMA 1SAZA 2E88A 4B1WB 2RHKA 3FZKA 4BVPA 3C7NA 1K8AO 3RSEB 1DKGD 2WBNA 2KKZA 3MCPA 1YF5L 3P31A 3EKSA 3OBYA 3ZYYX 4NLCA 3QMLA 3CCEN 2FSJA 2GUPA 3U9ZA 1VQKN 2P9IB 3MMVA 3WQTA 4BR5A 5FPEA 2P9UB 2HF4A 3CJCA 1YUWA 2W40A 3CCUN 4YOYA 4CD1A 2BUPA 5AZIB 4DB3A 5EOYA 4BQLA 4HWIA 3WXJA 3P4IA 2DPNA 2NRHA 3FZHA 4J8FA 5H1SQ 1HUXA 3TSQA 3BP8A 4BR7A 1HKGA 1KD1O 2QA4N 1BUPA 5TKYA 3NVKA 3CJAA 1QZ6A 5AFUH 4AM6A 5LJWA 4A62A 4DCHA 4YOXA 1HX1A 3CXCM 2OTLN 2ZJRL 4MLEA 2WC9A 5AQTA 4IO9L 1MDUB 5B8HA 1BA1A 1NGAA 2NRXA 3GG4A 4GNIA 3DJCA 3LDQA 3RSEA 3ZETB 2OANA 3EKUA 3AGKA 1GLBG 1NBWA 3CQXA 2YHXA 5C15A 5BPNA 1GLLO 5JLHA 1KAYA 4YOUA 1T6CA 2P9KB 3VGKA 2P9IA 4JKFA 5EX5A 4BRIA 2P9UA 4QS8A 1QVGM 3VERA 3I55N 2ZJQL 1KAZA 2E1ZA 3DXMB 5AQLA 5AZIA 4NO7A 3W0LA 3KK7A 4IFEA 1JCEA 2HSTA 4FWLA 2V7YA 2HMPA 3A5NC 1QQNA 2QWQA 3WXIA 1MWMA 1YXQA 1S3XA 5ADXA 3DXKB 5AQKA 1NM1A 3J8AA 3KWGA 4H0OA 4BG8A 2ZJPL 2AP1A 2D0PA 5FPMA 3VEVA 3D2FB 3O9RA 1K9MO 2E1YA 5CR4A 2QWRA 1OVYA 3O9TA 3TPQA 1BDGA 5FPNA 2GWJA 5MLCQ 1Q86O 2JWKA 3AY9A 4MO4A 3O9QA 3ZETA 4JKDA 3D2EB 4K41A 5EVZA 3WUHA 5BRHA 1NGCA 2D4WA 5JICA 4M63C 4KH5A 5I9EB 3UKRB 4WQ4A 4BQZA 1D4XA 4H0YB 3D6RA 4FOEA 3VTHA 2P9KA 4BRMA 4JKCA 2E2QA 4BRDA 1XUPO 3U4LA 3VGLA 2ASPA 2ZGZA 3NVMA 4BG9A 5KQ8A 2YI1A 5AQVA 3CMEN 4WQ5C 1NGJA 3LM2A 4H5VA 3ZX3A 3VENA 3CPWM 3CMAN 4BC2A 3DLLL 1X3MA 2QXLA 3DXMA 3UKUA 1Q18A 5BR9A 2E8AA 4IZ9A 1IG8A 2QWMA 2P9LB 3FZMA 1MA9B 4IO8A 4JNEA 3E66A 1YAGA 3CD6N 2QW9A 5AQYA 4H5NA 4A2AA 3H45C 1U2VB 3TTFA 5C0YA 4WQ5A 3DXKA 3L6QA 3N4PA 3QICA 2Q0UA 5M1PA 1DGKN 3U9DA 3CCSN 1QHAA 4UY8O 1NLVA 1VQNN 3O08A 1P90A 2H3GX 1YVNA 1K8KB 4GV6A 5BRFA 2P9PB 4CZKA 4YDUA 3O8MA 3IDHA 3UE5A 5GAEP 4DKWA 3D2EA 1GLCG 2EWSA 3O80A 4WFAL 3ZX0A 3ATVA 4BROA 4IEIA 4FWMA 4MDAA 3WT0A 3UKRA 4A57A 4Z94A 3B8AX 3WEEB 2YX6A 3BEXA 1S22A 4JK9A 3H6EA 4BGAA 5JMVA 3PIOL 1N8RO 2GWKA 4XH4A 5GIPA 2FF3B 4JKBA 3E1YA 4B9QA 3K9JA 2V52B 3QDKA 2ASOA 1S72N 3DWLA 1GLFO 3H3OB 5AFUA 3GDQA 2P9LA 1Z6RA 1H1VA 2V7ZA 4FOIA 4GY2B 5AQHA 4BC3A 4BR2A 4CBWA 3LDNA 1LCUA 5C2DA 5AQQA 5AQSA 5GAHP 2A5XA 3L4QA 1W2BM 1NGEA 3AAPA 1QZ5A 2NNWA 3ULEB 4CZEA 5LY3A 3S41A 1CZAN 4YOVA 4GVEA 3CCRN 4H0XB 5AQFA 3A8YA 4U67L 3AARA 4H0PA 1K8KA 1YITN 3EE8A 4YORA 2CGJA 2P9PA 4K43A 1MWKA 3ATUA 3H1QA 4O8KA 2QWPA 4AM7A 3R9PA 1RFQA 3FGUA 4PKGA 4PKHA 4H0VB 2NRZA 5AQMA 2HBJA 3JS6A 1EO1A 3CCVN 1SZ2A 3CCMN 4M7YA 4XH1A 1KAXA 5AZJB 3OW2M 3H3NO 4QS9A 1JCGA 2QM1A 2V51B 4ISEA 4PL8A 3WEEA 3F2KA 3A0IX 1TUUA 4IJNA 3O1WA 3E9OA 1T6DA 4IEEA 1ZC6A 4JHDB 1GLEG 5AQUA 4B1ZA 4CZHA 3CQYA 2IVNA 3J7ZO 3QB0A 3D7EO 4FL9A 2QWOA 3QFUA 3LL3A 3VOVA 1YI2N 2VWBA 1WOQA 3H1VX 4FWKA 4O5FA 1NGIA 4FPAA 5AQJA 3SJHA 1NWKA 1SQKA 5HOOA 3CC4N 4BRHA 2GELA 2Q2RA 4H5TA 5BRDA 2RE2A 3ULEA 3T69A 4IOXA 4ISGA 4EFHA 4KH4A 4JK8A 1YIJN 2WFBA 1K73O 4BRFA 3C0BA 1O13A 3IKMA 2NRWA 5CE3A 2QEXN 3IMXA 2W41A 3CJ1A 3FE1A 3M1FA 4FWPA 3TTDA 3TSUA 4IOAL 3LDOA 3G6EN 3LM9A 1JJ2M 2UYTA 4H5WA 3O1BA 1RGIA 3BF3A 4BR4A 5BN9A 5AZJA 1VQ4N 3UB5A 2KLAA 3MX5A 4BRAA 4KBOA 1YJ9N 4RTFD 3VF4A 3HOTA 3HTVA 3A5OC 3LDPA 3N4QA 3C65A 1QVFM 4CZLA 2QWNA 3C6AA 2HBKA 2A40A 3Q7CA 5AQWA 4FWOA 4KH6A 1RDUA 2YJFA 4AF1A 3VTIA 1HKBA 4CZIA 5GINA 2GTDA 3FLCO 4XEIA 3MDQA 4RWTA 2F9TA 3FZFA 3MK6A 5CHIA 4ISFA 5AQOA 3MX2A 3FR0A 4BREA 1NMDA 3CF5L 1NJIO 3M5RA 1KQSM 3O6WA 5M1KA 4B1UB 1NGFA 4GV9A 5DM6L 2Q1NA 2I7PA 1Q7YO 3CC2N 1KC8O 5EY4A 4DQ8A 4CJ7A 5GADP 4H03B 1QQOA 1ZXOA 1DT9A 4BC4A 4CBUA 4JKGB 5AQXA 4IWVA 4BRGA 4C1NK 1VQ8N 3P38A 4JK7A 3P39A 2F7TA 1WUAA 1X3NA 3CJ7A 4I6MB 3ID6A 1LOTB 5GAGP 1VQ7N 4BVOA 2GX9A 4IOCL 4WFBL 3T7ZA 3D2FA 3R6MA 4WF9L 5BREA 3CCLN 5C12A 3VF2A 5C2FA 1VQLN 4BRNA 1J6ZA 1GLJO 2IIRA 1GLDG 3CI5A 3HBTA 2IVOA 3SMSA 2CGLA 2VGNA 1P8ZA 3LDLA 2CH5A 2Q0RA 3CC7N 3AAQA 3O9UA 1NGHA 3HOSA 3ID8A 3SK3A 5M1OA 1BA0A 1X9JA 4JAXA 4CBXA 3HM8A 4FVUA 4OO1J 1BO5O 3CPEA 2ASMA 2A42A 2I7NA 3VPZA 1BWFO 4A61A 2QTDA 3I33A 3VEYA 1Q82O 2QWLA 3R8EA 4JKGA 4BRLA 1ZBSA 2FXUA 1HKCA 1NGGA 1W97L 5KQDA 2D0OA 3C6HA 2E2NA 3EL2A 2E2OA 3H46O 3TTCA 1U2VA 3A5MC 1OKJA 5M1QA 3U8XA 1ATRA 1BOTO 3OHRA 3G71N 3K9KA 3SMPA 2WUSA 2Q97A 3EE9A 5M1FA 1XQSC 3MN5A 4ILJA 4C1NI 2A41A 5FPDA 3QBWA 2AA4A 1Z05A 4EIAA 1VQPN 4NB4A 1VQ6N 1YHQN 2FLOA 4H5RA 1E4FT 3PIPL 3VEOA 3VF6A 4A2BA 1T44A 3FFKB 2J4RA 3O9SA 1ATNA 3VEZA 5JVHL 3EN9A 4A5BA 4C23A 4A59A 4EAHD 1HJOA 2VYPA 4MLHA 2A3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q36 A;  2FSN A;  3W3D A;  2ITM A;  3QFP A;  4F9O A;  4EHU A;  2P9S B;  1HPM A;  5AQR A;  4CZF A;  3VGM A;  2KHO A;  3CET A;  2F9W A;  4BC5 A;  2YHY A;  2NLX A;  3EO3 A;  4PKI A;  3VEX A;  1BU6 O;  2YJE A;  3QBX A;  4M7X A;  1IJJ A;  4CZJ A;  4QS7 A;  5AR0 A;  2FF6 A;  4CZM A;  5EXW A;  3WXL A;  3A5L C;  4FWN A;  5BPL A;  3L4I A;  1GLA G;  3L0Q A;  3HI0 A;  2P9N B;  4BR0 A;  3G25 A;  1NGB A;  4BRP A;  2A6A A;  5KPZ A;  1V4T A;  4JD2 B;  5E84 A;  3CJB A;  1U6Z A;  3M3Z A;  2FSK A;  4JHD A;  2P9S A;  1HLU A;  5AQN A;  3TU5 A;  4BGB A;  2YHW A;  4FWS A;  5F0X A;  5AQP A;  2IVP A;  1TYQ B;  1C0G A;  1R59 O;  3UKU B;  1QQM A;  2VCP A;  3GE1 A;  3ZEU B;  3JXU A;  4B1X B;  1ESV A;  1BG3 A;  4WYB A;  2Q31 A;  5AQI A;  3ZX2 A;  5BPM A;  5KPR A;  4Y0W A;  4PL7 A;  4DHY A;  1E4G T;  1DEJ A;  4WQ4 C;  5BN8 A;  2YCH A;  4BRK A;  3BF1 A;  3MN7 A;  3MN9 A;  3WXK A;  2CH6 A;  5F2R A;  2P9N A;  2PAV A;  1ATS A;  4FWR A;  5ELZ A;  4K42 A;  4CD3 A;  4MO5 A;  3ENH A;  3CJ9 A;  3KHY A;  1JCF A;  3DAW A;  3VES A;  1EQY A;  3I8B A;  4JD2 A;  3CHW A;  3MN6 A;  4BRC A;  3M6G A;  4JN4 A;  1XC3 A;  3KVG A;  1NGD A;  5ADX H;  4FSV A;  2NZT A;  2E2P A;  4IXC A;  3GOI A;  3ENO A;  2ZWH A;  1KXP A;  2GEM A;  2BTF A;  5AQG A;  1TYQ A;  3EZW A;  3O5B A;  1V4S A;  3C7N B;  5AQZ A;  5JLF A;  4RCH A;  4XH5 A;  3CIP A;  4L3Q A;  3ZEU A;  3F9M A;  2E20 A;  4YDU C;  1C0F A;  4B1V A;  2HOE A;  3BUZ B;  1G99 A;  3IUC A;  3O4W A;  3HSC A;  4LC9 B;  2CGK A;  2ZF5 O;  3VEW A;  3KZB A;  2PBD A;  4B1Y B;  5LJV A;  4BR9 A;  4CZG A;  2HF3 A;  4IJA A;  5KPT A;  3CER A;  2D1K A;  2ZGY A;  3VET A;  5E26 A;  3IFR A;  4I6M A;  4FPB A;  4FO0 A;  3HZ6 A;  5F1X A;  3FZL A;  4K25 A;  3GL1 A;  4E1J A;  1Y64 A;  4EHT A;  3GBT A;  1TUY A;  4FWQ A;  4H0T B;  1RDW X;  4HTL A;  3SLC A;  3WQU A;  4BRQ A;  1SAZ A;  2E88 A;  4B1W B;  3FZK A;  4BVP A;  3C7N A;  3RSE B;  1DKG D;  3MCP A;  3EKS A;  3QML A;  2FSJ A;  2GUP A;  3U9Z A;  2P9I B;  3MMV A;  3WQT A;  4BR5 A;  5FPE A;  2P9U B;  2HF4 A;  3CJC A;  1YUW A;  2W40 A;  4CD1 A;  2BUP A;  5AZI B;  4DB3 A;  5EOY A;  4BQL A;  4HWI A;  3WXJ A;  3P4I A;  2DPN A;  2NRH A;  3FZH A;  4J8F A;  1HUX A;  3BP8 A;  4BR7 A;  1HKG A;  1BUP A;  5TKY A;  3CJA A;  1QZ6 A;  5AFU H;  4AM6 A;  5LJW A;  4A62 A;  4DCH A;  1HX1 A;  4MLE A;  5AQT A;  1MDU B;  5B8H A;  1BA1 A;  1NGA A;  3GG4 A;  4GNI A;  3DJC A;  3LDQ A;  3RSE A;  3ZET B;  2OAN A;  3EKU A;  1GLB G;  1NBW A;  3CQX A;  2YHX A;  5BPN A;  1GLL O;  5JLH A;  1KAY A;  1T6C A;  2P9K B;  3VGK A;  2P9I A;  5EX5 A;  4BRI A;  2P9U A;  4QS8 A;  3VER A;  1KAZ A;  2E1Z A;  3DXM B;  5AQL A;  5AZI A;  4NO7 A;  3W0L A;  1JCE A;  4FWL A;  2V7Y A;  2HMP A;  3A5N C;  1QQN A;  2QWQ A;  3WXI A;  1MWM A;  1YXQ A;  1S3X A;  5ADX A;  3DXK B;  5AQK A;  1NM1 A;  3J8A A;  4H0O A;  4BG8 A;  2AP1 A;  2D0P A;  5FPM A;  3VEV A;  3D2F B;  2E1Y A;  2QWR A;  3TPQ A;  1BDG A;  5FPN A;  2GWJ A;  3AY9 A;  4MO4 A;  3ZET A;  3D2E B;  4K41 A;  5EVZ A;  3WUH A;  5BRH A;  1NGC A;  2D4W A;  5JIC A;  4M63 C;  5I9E B;  3UKR B;  4WQ4 A;  4BQZ A;  1D4X A;  4H0Y B;  4FOE A;  4BRM A;  4BRD A;  2P9K A;  4CI6 A;  2E2Q A;  1XUP O;  3U4L A;  3VGL A;  2ASP A;  2ZGZ A;  4BG9 A;  5KQ8 A;  2YI1 A;  5AQV A;  4WQ5 C;  1NGJ A;  3LM2 A;  4H5V A;  3ZX3 A;  3VEN A;  4BC2 A;  1X3M A;  2QXL A;  3DXM A;  3UKU A;  1Q18 A;  5BR9 A;  2E8A A;  4IZ9 A;  1IG8 A;  2QWM A;  2P9L B;  3FZM A;  1MA9 B;  4IO8 A;  4JNE A;  1YAG A;  2QW9 A;  5AQY A;  4H5N A;  4A2A A;  3H45 C;  1U2V B;  4WQ5 A;  3DXK A;  3L6Q A;  3QIC A;  2Q0U A;  3U9D A;  1DGK N;  1QHA A;  1NLV A;  3O08 A;  2H3G X;  1YVN A;  1K8K B;  5BRF A;  2P9P B;  4CZK A;  4YDU A;  3O8M A;  3IDH A;  3UE5 A;  3D2E A;  1GLC G;  2EWS A;  3O80 A;  3ZX0 A;  3ATV A;  4BRO A;  4FWM A;  3WT0 A;  3UKR A;  4Z94 A;  3B8A X;  3WEE B;  3BEX A;  1S22 A;  3H6E A;  4BGA A;  5JMV A;  2GWK A;  4XH4 A;  2FF3 B;  4B9Q A;  2V52 B;  3QDK A;  2ASO A;  3DWL A;  1GLF O;  3H3O B;  5AFU A;  3GDQ A;  2P9L A;  1Z6R A;  1H1V A;  2V7Z A;  4FOI A;  4GY2 B;  5AQH A;  4BC3 A;  4BR2 A;  4CBW A;  3LDN A;  1LCU A;  5AQQ A;  5AQS A;  2A5X A;  1NGE A;  3AAP A;  1QZ5 A;  3ULE B;  4CZE A;  5LY3 A;  3S41 A;  1CZA N;  4H0X B;  5AQF A;  3A8Y A;  3AAR A;  4H0P A;  1K8K A;  2CGJ A;  2P9P A;  4K43 A;  1MWK A;  3ATU A;  3H1Q A;  4O8K A;  2QWP A;  4AM7 A;  3R9P A;  1RFQ A;  3FGU A;  4PKG A;  4PKH A;  4H0V B;  5AQM A;  3JS6 A;  1SZ2 A;  4M7Y A;  4XH1 A;  1KAX A;  5AZJ B;  3H3N O;  4QS9 A;  1JCG A;  2QM1 A;  2V51 B;  4ISE A;  4PL8 A;  3WEE A;  3A0I X;  1TUU A;  4IJN A;  3O1W A;  1T6D A;  1ZC6 A;  4JHD B;  1GLE G;  5AQU A;  4B1Z A;  4CZH A;  3CQY A;  2IVN A;  3QB0 A;  3D7E O;  4FL9 A;  2QWO A;  3QFU A;  3LL3 A;  3VOV A;  2VWB A;  1WOQ A;  3H1V X;  4FWK A;  4O5F A;  1NGI A;  4FPA A;  5AQJ A;  3SJH A;  1NWK A;  1SQK A;  4BRH A;  2GEL A;  2Q2R A;  4H5T A;  5BRD A;  3ULE A;  4ISG A;  4EFH A;  4BRF A;  3C0B A;  5CE3 A;  3IMX A;  2W41 A;  3CJ1 A;  3FE1 A;  3M1F A;  4FWP A;  3LDO A;  3LM9 A;  2UYT A;  4H5W A;  3O1B A;  1RGI A;  3BF3 A;  4BR4 A;  5BN9 A;  5AZJ A;  3UB5 A;  4BRA A;  4KBO A;  4RTF D;  3VF4 A;  3HTV A;  3A5O C;  3LDP A;  4CZL A;  2QWN A;  2A40 A;  5AQW A;  4FWO A;  2YJF A;  1HKB A;  4CZI A;  2GTD A;  3FLC O;  4XEI A;  3MDQ A;  4RWT A;  2F9T A;  3FZF A;  3MK6 A;  4ISF A;  5AQO A;  3FR0 A;  4BRE A;  1NMD A;  3O6W A;  4B1U B;  1NGF A;  2Q1N A;  2I7P A;  5EY4 A;  4DQ8 A;  4CJ7 A;  4H03 B;  1QQO A;  1ZXO A;  4CBU A;  4BC4 A;  5AQX A;  4IWV A;  4BRG A;  1WUA A;  1X3N A;  3CJ7 A;  4I6M B;  1LOT B;  4BVO A;  3D2F A;  3R6M A;  5BRE A;  3VF2 A;  4BRN A;  1J6Z A;  1GLJ O;  2IIR A;  1GLD G;  3CI5 A;  3HBT A;  2IVO A;  3SMS A;  2CGL A;  1P8Z A;  3LDL A;  2CH5 A;  2Q0R A;  3AAQ A;  1NGH A;  3ID8 A;  3SK3 A;  1BA0 A;  1X9J A;  4JAX A;  4CBX A;  3HM8 A;  1BO5 O;  4A61 A;  2ASM A;  2A42 A;  2I7N A;  3VPZ A;  1BWF O;  3I33 A;  3VEY A;  2QWL A;  3R8E A;  4BRL A;  1ZBS A;  2FXU A;  1HKC A;  1NGG A;  5KQD A;  2D0O A;  2E2N A;  3EL2 A;  2E2O A;  3H46 O;  1U2V A;  3A5M C;  1OKJ A;  3U8X A;  1ATR A;  1BOT O;  3OHR A;  3SMP A;  2WUS A;  2Q97 A;  1XQS C;  3MN5 A;  2A41 A;  5FPD A;  3QBW A;  2AA4 A;  1Z05 A;  4EIA A;  4NB4 A;  2FLO A;  4H5R A;  1E4F T;  3VEO A;  3VF6 A;  4A2B A;  1T44 A;  3FFK B;  2J4R A;  1ATN A;  3VEZ A;  3EN9 A;  4C23 A;  4EAH D;  1HJO A;  2VYP A;  4MLH A;  2A3Z A; 
#chains in the Genus database with same CATH topology
 4DU4 A;  1VQM N;  2HND A;  3NAE A;  1HPM A;  5DM7 L;  5KI6 A;  4JKH A;  3EO3 A;  4HUE A;  4YFU A;  1BU6 O;  4DU1 A;  3QBX A;  4NCA A;  4CZJ A;  2VQF K;  5JVG L;  4KRF A;  5AR0 A;  4EZ6 A;  3U3Y A;  4FWN A;  3THY B;  4A5A A;  5BPL A;  4B9U A;  3Q7B A;  3KWI A;  1R0A A;  4GW6 A;  4PY5 A;  4BR0 A;  4O55 A;  4CHZ A;  2A6A A;  3IRX A;  5KPZ A;  4CEF A;  3TSP A;  1ILY A;  4JD2 B;  4OKJ A;  4B8A B;  4IBN A;  2HBL A;  1RBV A;  3M3Z A;  3AVC A;  1VQ9 N;  4AHR A;  1TYQ B;  1YJN N;  3PUF A;  4BY9 C;  3THV A;  4X62 K;  1SS6 A;  3HRG A;  1BG3 A;  3VQ8 A;  2Q31 A;  5AQI A;  2GBZ A;  3WXM B;  3LP2 A;  1DEJ A;  1U49 A;  2YCH A;  4BRK A;  1GOB A;  4CJP A;  3MN7 A;  3AO4 A;  2CH6 A;  2P9N A;  4FWR A;  1ATS A;  5ELZ A;  1QHT A;  1VQ5 N;  4XIU A;  3ENH A;  3ZT4 A;  3KHY A;  4FJL A;  4Z4I A;  1JCF A;  4JEP A;  4CEA A;  3CHW A;  4Q5V A;  3MN6 A;  4BRC A;  4JN4 A;  3AGR A;  4G9Z A;  4CIE A;  1NGD A;  2NZT A;  4IXC A;  3CCJ N;  1S1U A;  1S5J A;  1UA0 A;  4W5N A;  4AQY K;  3I56 N;  4ZTJ A;  3O3F A;  4I2P A;  5JLF A;  4RCH A;  3OYA A;  5JS1 A;  4XH5 A;  4CJE A;  3QEW A;  3OYM A;  2HNZ A;  4JS5 A;  1DLO A;  2E20 A;  2PYJ A;  4RW8 A;  3FFI A;  4LC9 B;  3NF8 A;  3U3G A;  2BDP A;  1T3V A;  2XY7 A;  4BR9 A;  1RBT A;  2Y1J A;  4CCH A;  2VWK A;  3E9L A;  3CER A;  4CF2 A;  4JYA K;  4YOT A;  2ZGY A;  3KJV A;  1VSK A;  3HT3 A;  3OS1 A;  3K5N A;  1SL0 A;  1FW6 A;  2FBT A;  4FVM A;  3FZL A;  3TAM A;  4N76 A;  3GL1 A;  4E1J A;  4EHT A;  1X1P A;  2BH1 A;  4BRQ A;  3EEQ A;  1SAZ A;  2E88 A;  2IDO A;  3RSE B;  2WBN A;  4NCB A;  2KKZ A;  1TV6 A;  5CYM A;  5C24 A;  4JI5 K;  2HHV A;  4DR6 K;  2KFZ A;  4KTQ A;  3UIQ A;  2W42 A;  1RDA A;  4KHY A;  4CEE A;  3U9Z A;  4YY3 K;  4B3R K;  5FPE A;  2HF4 A;  3CJC A;  1RT6 A;  1YUW A;  2W40 A;  4CD1 A;  2BUP A;  4M41 A;  5AZI B;  4CED A;  3OYC A;  4HWI A;  3WXJ A;  3FZH A;  1N33 K;  3MXM A;  3BP8 A;  3CM6 A;  5TKY A;  3CJA A;  1QZ6 A;  3MEE A;  2KZM A;  2F8S A;  2DTU A;  1W7A A;  4E7J A;  3TAR A;  1NGA A;  3K57 A;  2E5L K;  3DJC A;  3V1O A;  3LDQ A;  1KVC A;  3AGK A;  5BPN A;  1CLQ A;  4B3O A;  5KTQ A;  1HJR A;  3AVJ A;  1T6C A;  4YOU A;  4Z4G A;  2P9I A;  4JKF A;  2P9U A;  1QVG M;  1KAZ A;  3ZT1 A;  3HXM A;  3SV4 A;  3BZK A;  2BAN A;  3W0L A;  3KK7 A;  1YT3 A;  1JCE A;  2V7Y A;  1C0T A;  5LMU K;  3V9U A;  1NK5 A;  1Z26 A;  3LPT A;  1YXQ A;  3SUQ A;  5ADX A;  3AA5 X;  4PA1 A;  3VA3 A;  4Z4E A;  2AP1 A;  4QAG A;  1NK8 A;  4B3T K;  3D2F B;  3O9R A;  5FRN A;  5C25 A;  3D45 A;  5MLC Q;  2JWK A;  1FXX A;  4DQS A;  3ZET A;  4JKD A;  1SKW A;  4K41 A;  3G0Z A;  5EVZ A;  5HRR A;  1IO2 A;  3C6T A;  1D4X A;  4M3Z A;  4CI6 A;  2E2Q A;  3VGL A;  3NVM A;  3V1Q A;  3CME N;  4WQ5 C;  4M3Y A;  4H5V A;  3ZX3 A;  1X3M A;  1Q18 A;  2E8A A;  3S3O A;  2P9L B;  3FZM A;  1MA9 B;  4HUF A;  1VSD A;  3E66 A;  4LD0 A;  1EET A;  4A2A A;  3H45 C;  4CJU A;  2UXC K;  3E01 A;  5C0Y A;  4CHN A;  3QIC A;  2Q0U A;  3U9D A;  3RR8 A;  1BI4 A;  4UY8 O;  1NLV A;  1YVN A;  4CZK A;  4CF9 A;  3UE5 A;  5GAE P;  1NOZ A;  4DKW A;  2EWS A;  4BRO A;  3VN5 A;  3UKR A;  4B9M A;  4BWM A;  2RF2 A;  3BEX A;  4HUG A;  4J2E A;  4JK9 A;  1B9D A;  5JMV A;  4DV7 K;  1RNH A;  2O8E A;  4KI6 A;  1X9W A;  1HQU A;  1L5U A;  3H3O B;  5AFU A;  4I2Q A;  1H1V A;  4CBW A;  1WNS A;  1NJW A;  1XI1 A;  5GAH P;  1W2B M;  1NGE A;  4CZE A;  5J2Q A;  1A5V A;  4YOV A;  1NU0 A;  5IWA K;  3T1Y K;  5AQF A;  3KK1 A;  1YIT N;  1CZ9 A;  3EE8 A;  4CFD A;  3ATU A;  3SV3 A;  2QWP A;  4AM7 A;  2NRZ A;  3KKS A;  4CIF A;  3D0P A;  3LAM A;  3LZJ A;  1U04 A;  4CFA A;  4M7Y A;  4XH1 A;  1KAX A;  2HMI A;  4QS9 A;  4DTJ A;  3F2K A;  3O1W A;  3E9O A;  3OYI A;  4JHD B;  1GLE G;  3CQY A;  4NXM K;  2OPR A;  3QB0 A;  2Z1G A;  3D7E O;  3VOV A;  1YI2 N;  3QIN A;  4E7L A;  1NWK A;  1SQK A;  4F8R A;  1FJG K;  2WFB A;  1NJX A;  3C0B A;  5CE3 A;  2QEX N;  1HNW K;  4IOA L;  1S1V A;  4DLE A;  3ISN C;  1JJ2 M;  4H5W A;  3L2V A;  3BF3 A;  5AZJ A;  5BN9 A;  3UB5 A;  3V9Z A;  4RTF D;  3VF4 A;  1CZB A;  3C65 A;  2QWN A;  4CHY A;  3DRR A;  4KH6 A;  4CJV A;  2GTD A;  3FLC O;  4RWT A;  1VSI A;  4EP5 A;  5CHI A;  1D9D A;  3ALY A;  1QQC A;  1KC8 O;  5EY4 A;  1VSF A;  4CHO A;  3EY1 A;  3TWH A;  4H03 B;  1QQO A;  4R5P A;  3CQ8 A;  1VQ8 N;  4H8K A;  5KRS A;  4B9S A;  1I39 A;  2KW4 A;  1UAX A;  3NF9 A;  4HHT A;  3D2F A;  3ZT0 A;  4WF9 L;  4DQR A;  5BRE A;  3CCL N;  4DTU A;  5C12 A;  3VF2 A;  2ATQ A;  4JRQ A;  2IIR A;  1LV5 A;  1D8Y A;  1KVB A;  3NCI A;  1UWB A;  3O9U A;  3HOS A;  3SK3 A;  3ZSX A;  3QO9 A;  4E7I A;  2WOM A;  1WBB A;  5HRS A;  2A42 A;  2I7N A;  1BWF O;  3HYF A;  4JI7 K;  4DF4 A;  3R8E A;  1NK4 A;  4OKE A;  3ZCM A;  1J54 A;  5KQD A;  1I94 K;  3OYK A;  2ETJ A;  1IKY A;  2E2N A;  2HNY A;  3EL2 A;  3V9X A;  3U8X A;  1ZBU A;  3EE9 A;  5M1F A;  5KRT A;  1NNE A;  1HQE A;  4DS5 A;  3SUN A;  2FLO A;  1LAV A;  3VEO A;  5FLX O;  4CEB A;  3O9S A;  3TAN A;  1HJO A;  2VYP A;  4DUY K;  1U4B A;  4F2R A;  3W3D A;  1REV A;  3SUP A;  1T8E A;  3DLH A;  3DYA A;  3F5T A;  1BCO A;  2VG5 A;  5CYQ A;  5TKW A;  4BC5 A;  2YHY A;  2NRT A;  4PKI A;  1KVA A;  2A1S A;  1CXQ A;  4RW7 A;  4QS7 A;  3ULD A;  2XO7 A;  4DR5 K;  5C10 A;  1N32 K;  3KLE A;  4FZY A;  3L4I A;  4W5Q A;  1GLA G;  2LSN A;  2P9N B;  3NDK A;  3G25 A;  1C0M A;  1T7P A;  1OH5 A;  4BRP A;  3M8Q A;  3V1R A;  3L2W A;  1V4T A;  3SI6 A;  3MED A;  3K0S A;  2QK9 A;  5E84 A;  4W5O A;  1U6Z A;  4DS4 A;  4JHD A;  1TK8 A;  2P9S A;  5AQN A;  2F96 A;  1CXU A;  3TU5 A;  4FLX A;  5F0X A;  2NRR A;  3J80 O;  5AQP A;  4DF8 A;  4B9L A;  4KI4 A;  1W0H A;  1QQM A;  4IFY A;  4YOW A;  3RTV A;  3WNF A;  3TAQ A;  4DTM A;  4WYB A;  5KPR A;  3P5J A;  3VQQ A;  4DHY A;  4Z4F A;  5BN8 A;  3VMF B;  3V4I A;  4N41 A;  4JV5 K;  4U7B A;  2XY5 A;  3AA2 A;  2PAV A;  4CD3 A;  4DTO A;  3OA9 A;  1DTQ A;  3DAW A;  3SBG A;  4KHQ A;  3VES A;  4WFN L;  4C8K A;  3LP3 A;  3KVG A;  4FLY A;  3O3H A;  1VAZ A;  4M42 A;  2IOC A;  2YNF A;  3GOI A;  1WN7 A;  2GEM A;  5AQG A;  4H4O A;  5AQZ A;  2D0B A;  1FKP A;  3MXI A;  3ZEU A;  3F9M A;  4PHT X;  5GIO A;  4IDK A;  3V6D A;  2W6L A;  1G99 A;  3IUC A;  3O4W A;  1IG9 A;  3HSC A;  2CGK A;  4IG0 A;  2ZF5 O;  3VEW A;  3KZB A;  2JWL A;  1QSL A;  4FK2 A;  2PBD A;  3TAF A;  3CYM A;  2P5O A;  4GMJ B;  4N5S A;  4F2S A;  3IFR A;  2WTU A;  4FPB A;  1N6Q A;  4OPH A;  4DR3 K;  2PFU A;  3NF7 A;  2FBX A;  1NKB A;  3GBT A;  1TUY A;  1S6P A;  4FW2 A;  4HTL A;  3SLC A;  2R7Y A;  3THX A;  4FJX A;  2VGM A;  2RHK A;  4DV5 K;  2G8F A;  3OBY A;  3ZYY X;  4DSL A;  4LF5 K;  4NLC A;  3TAB A;  1EXQ A;  1BGX T;  1BL3 A;  3LPU A;  2P9I B;  1C1C A;  5SZT A;  2P9U B;  5DK5 A;  3LP0 A;  4DFP A;  4YOY A;  4YHH K;  3P4I A;  4J8F A;  1GOA A;  1KD1 O;  1BQN A;  1BUP A;  3KLI A;  3SZ2 A;  2F8T A;  3JYT A;  4O0I A;  4AM6 A;  4J2D A;  4C8L A;  4KHS A;  1C6V A;  2ZJR L;  4MLE A;  2OPP A;  3OY9 A;  4K0K K;  4IO9 L;  5B8H A;  1D5A A;  3ZET B;  2YHB A;  1GLB G;  4RW6 A;  2X74 A;  5C15 A;  4X65 K;  3RMB A;  4CK3 A;  3ITH A;  3V81 A;  1RTJ A;  1TKZ A;  3VGK A;  4DTP A;  4DG1 A;  3I55 N;  3DLE A;  2ZJQ L;  2E1Z A;  4O5B A;  4N47 A;  4FLU A;  2QWQ A;  1MWM A;  2E4L A;  1RCH A;  3AA3 A;  5HP1 A;  3KWG A;  4BG8 A;  4H0O A;  4LSL A;  1BI4 B;  3HO1 A;  1BDG A;  3THW B;  1Q86 O;  4MO4 A;  3O9Q A;  3A2F A;  5BRH A;  1B92 A;  1NGC A;  2D4W A;  2HHT A;  4KH5 A;  3JAM O;  4FJM A;  1BCM A;  3UKR B;  4H0Y B;  3U4L A;  2ZGZ A;  1NG9 A;  3OYB A;  3V9S A;  4LFC K;  2O8E B;  1XHX A;  4CF1 A;  4BC2 A;  3L2U A;  1UA1 A;  1IG8 A;  4CJR A;  3HJF A;  4PQU A;  4LFB K;  3P83 D;  3DXK A;  3CCS N;  2UUA K;  3BZC A;  3O08 A;  2H3G X;  2O8D A;  3M8S A;  3QEP A;  5BRF A;  1N36 K;  3ZSO A;  4KHW A;  1GOC A;  3SJJ A;  3O8M A;  1RBS A;  3IDH A;  4EZ9 A;  2X6S A;  3O80 A;  4JI8 K;  2DY4 A;  3ATV A;  4IEI A;  3WT0 A;  4KTZ A;  2YX6 A;  4KO0 A;  1S22 A;  2ZE2 A;  3OJU A;  3AVF A;  3PSF A;  5GIP A;  1J9A A;  1J53 A;  4JKB A;  4B9Q A;  2V52 B;  3QDK A;  5J1E A;  4FCY A;  3CFO A;  3DWL A;  4JI0 K;  5J2P A;  1RT4 A;  2V7Z A;  1Z6R A;  5AQH A;  4O0J A;  1LCU A;  2O8F B;  3L4Q A;  1RTD A;  1I3A A;  3S41 A;  1CZA N;  3CCR N;  1NOY A;  4H0P A;  5C42 A;  1K8K A;  4YOR A;  2CGJ A;  2P9P A;  4K43 A;  1HR0 K;  4EP4 A;  1WSG A;  1RFQ A;  1LWE A;  5AQM A;  4C8N A;  4H0V B;  1EO1 A;  1SZ2 A;  3OS2 A;  5AZJ B;  3LWM A;  3OW2 M;  1JCG A;  2QM1 A;  2V51 B;  2HHH K;  1TAQ A;  4IJN A;  4HTU A;  5K14 A;  3MAQ A;  4J2B A;  4CHP A;  5J2N A;  4FW1 A;  2VG7 A;  4F3T A;  4QOZ B;  3H1V X;  4FWK A;  4O44 A;  5AQJ A;  3J7Y P;  3CC4 N;  3OYJ A;  4OKK A;  4DTX A;  5BRD A;  3AVL A;  1NMN A;  3T69 A;  3V9W A;  4KRE A;  4KH4 A;  3ZSW A;  1K73 O;  1RTI A;  2JLE A;  4DU3 A;  1WSH A;  3TTD A;  4DR4 K;  3LDO A;  5KGW A;  1HNI A;  3O1B A;  4M3X A;  2UXD K;  1VQ4 N;  4DR7 K;  3MX5 A;  4CJS A;  3HTV A;  3HK2 A;  4HCB A;  3LDP A;  2HHS A;  1BQM A;  3HST B;  1S9E A;  2HBK A;  3Q7C A;  4Z0U A;  4FWO A;  4LF6 K;  1JLB A;  4AF1 A;  1HYV A;  3VTI A;  1HKB A;  4XEI A;  2VQE K;  1NMD A;  2RN2 A;  2BE2 A;  3O6W A;  2ITG A;  5M1K A;  4B1U B;  1NGF A;  4GV9 A;  3AV9 A;  5DM6 L;  2Q1N A;  1Q7Y O;  1SKR A;  4W5T A;  4DQ8 A;  4DLG A;  1ZXO A;  4CBU A;  4CEQ A;  4KHN A;  4BRG A;  4C1N K;  4JK7 A;  1RDB A;  1VRT A;  1QE1 A;  2F7T A;  1WUA A;  3CJ7 A;  3ID6 A;  5GAG P;  1VQ7 N;  2QKK A;  2GX9 A;  4DQP A;  3T1H K;  1SL2 A;  3LZI A;  2FBV A;  1EX4 A;  1RT3 A;  5C2F A;  3THW A;  1J6Z A;  2AJQ A;  1GLD G;  3CI5 A;  3QNN A;  2IVO A;  2CGL A;  2VGN A;  1P8Z A;  3BY5 A;  2CH5 A;  2OPS A;  3AAQ A;  1NGH A;  4CGH A;  2HVI A;  3ID8 A;  5M1O A;  4NYF A;  4CGD A;  4OO1 J;  1YTU A;  4A61 A;  4E3S A;  1E3M A;  4X64 K;  3I33 A;  4BE1 A;  2HW3 A;  1Q82 O;  1A5W A;  2FXU A;  3TR8 A;  1NGG A;  1W97 L;  2D0O A;  3C6H A;  3TTC A;  2E2O A;  2O4G A;  3L8B A;  1KFS A;  1JLA A;  1N34 K;  3G71 N;  3OHR A;  3K9K A;  3SMP A;  4F4K A;  3KIO A;  3K59 A;  4GKK K;  2Q3S A;  3KLG A;  1YHQ N;  4H5R A;  1WAJ A;  3PIP L;  3VF6 A;  3I8D A;  1T44 A;  3OTO K;  2J4R A;  2OZS A;  2OPQ A;  5JVH L;  3EN9 A;  2D5R A;  2DFF A;  4MLH A;  4CK1 A;  2Q36 A;  4DV1 K;  2ITM A;  4F9O A;  4YNQ A;  2P9S B;  3AVB A;  4JI4 K;  3VGM A;  3AO3 A;  4FLZ A;  2F9W A;  2NLX A;  3AVG A;  4QCL A;  1G15 A;  3VEX A;  2YJE A;  1JKH A;  3SNN A;  4E7K A;  4Y1C A;  1J5O A;  2O8F A;  3R3L A;  2E6L A;  2P5G A;  3QEV A;  1VSJ A;  2FF6 A;  1JXB A;  3WXL A;  4FJJ A;  4JI1 K;  4ILH A;  1UOC A;  4CK2 A;  3MEG A;  4GV3 A;  2NUB A;  3L0Q A;  3HI0 A;  3IG1 A;  3QLH A;  1U45 A;  4O8U A;  1NGB A;  4CHQ A;  1S9G A;  5HRO A;  2W6K A;  4FJN A;  1KRP A;  1TK0 A;  3OYG A;  3O4N A;  1NK6 A;  3CJB A;  4DSJ A;  4LH5 A;  3VQ9 A;  1XNQ K;  2FSK A;  4E89 A;  3QEX A;  3OBW A;  4BGB A;  2YHW A;  4E7H A;  4FWS A;  1N5Y A;  5IT9 O;  3UKU B;  4LH4 A;  3L3U A;  1OH8 A;  4KB0 A;  2VCP A;  4NLB A;  3ZEU B;  3JXU A;  1ESV A;  3LAK A;  5BPM A;  2B5J A;  4W5R A;  2B4J A;  1ZYQ A;  3NH1 A;  3BF1 A;  3MN9 A;  3DRS A;  4HCC A;  4JKE A;  4I7F A;  3CJ9 A;  3AVN A;  1IBL K;  1EQY A;  3OYH A;  2O8C A;  1XC3 A;  2RPI A;  1F21 A;  1NKE A;  3R1X A;  4MDB A;  5ADX H;  4FSV A;  2XY8 A;  2E2P A;  2G8K A;  1TVR A;  2EHG A;  3SAG A;  3THX B;  1KXP A;  4I9L A;  4DV6 K;  2BTF A;  4FLV A;  4M3U A;  3EZW A;  3O5B A;  3SPY A;  4Y1D A;  3TI0 A;  1YJW N;  3ENB A;  4L3Q A;  4AHC A;  3RMA A;  1RTH A;  4YDU C;  2HB5 A;  3QIP A;  3SAF A;  3AVH A;  3CFR A;  3PLA A;  4ILG B;  1XNR K;  3ZSR A;  3RVC A;  1JXE A;  4B1Y B;  2G8H A;  1QSS A;  4FJ8 A;  3NBP A;  4K8X A;  4IJA A;  5KPT A;  4CEZ A;  3IS9 A;  3RWU A;  2D1K A;  1SV5 A;  4JKA A;  2IS3 A;  5E26 A;  1RT7 A;  4AIL C;  3NMU A;  4FO0 A;  5F1X A;  4FLW A;  4NXN K;  1TAU A;  1Y64 A;  3ZSY A;  4OJR A;  4KV8 A;  1C1B A;  3WQU A;  1IV0 A;  2GUI A;  1ZBL A;  4B1W B;  4BVP A;  1HMV A;  3C7N A;  4FJ7 A;  3ZT2 A;  2BGG A;  3MCP A;  1HNV A;  3OYF A;  3EKS A;  2KZZ A;  4CW7 B;  3QML A;  3CCE N;  2FSJ A;  2GUP A;  4KHU A;  3WQT A;  4BR5 A;  4IG3 A;  5EOY A;  2NRH A;  3NFA A;  1HUX A;  1JLE A;  3BDP A;  2YKN A;  4BR7 A;  3AVK A;  3NGI A;  2QA4 N;  4JRP A;  1ITG A;  3NVK A;  5AFU H;  5LJW A;  4A62 A;  4AHT A;  3DOK A;  4Z4C A;  4YOX A;  3KK2 A;  2OTL N;  3AO5 A;  2WC9 A;  3GG4 A;  4OLA A;  4GNI A;  2WON A;  2UUC K;  3IAY A;  3ZT3 A;  1NBW A;  1ZBF A;  3CQX A;  2YHX A;  1HPZ A;  1KAY A;  1XMO K;  5EX5 A;  4BRI A;  4QS8 A;  1NKC A;  3LDS A;  4CIG A;  3VER A;  4M3R A;  4CF0 A;  5LL6 Z;  5AQL A;  4NO7 A;  3VQB A;  2P1J A;  2HST A;  1LW2 A;  2IGI A;  4FZZ A;  4FM0 A;  2HMP A;  3A5N C;  1QQN A;  3TAG A;  3HP9 A;  3KKR A;  1S3X A;  1EWR A;  4OGE A;  3DXK B;  5AQK A;  3J8A A;  1HRH A;  2ZJP L;  2OCE A;  4ELV A;  2B6A A;  5FPM A;  1ASU A;  3VEV A;  2E1Y A;  5CR4 A;  3JSM A;  2QWR A;  1TK5 A;  1OVY A;  3O9T A;  4FXD A;  2O8D B;  3TPQ A;  5FPN A;  1JLF A;  1YTA A;  4ELT A;  5CY4 A;  4CGJ A;  1L3U A;  1JL2 A;  3WUH A;  4M63 C;  3HP6 A;  4NCG A;  4BQZ A;  3NH0 A;  3D6R A;  4FOE A;  3TAE A;  2P9K A;  3PX4 A;  4JKC A;  4BG9 A;  1BIZ A;  4DFJ A;  2PYL A;  5KQ8 A;  1XC9 A;  1VHX A;  3CMA N;  3DXM A;  1ZBI A;  3UKU A;  2X6N A;  4IO8 A;  4JNE A;  3HL8 A;  1YAG A;  5AQY A;  4H5N A;  3QNO A;  1U2V B;  3TTF A;  3L6Q A;  2FBY A;  5I3U A;  1K8K B;  4GV6 A;  1Z25 A;  2P9P B;  1T05 A;  4YDU A;  2OA8 A;  3D2E A;  4WFA L;  3ZSZ A;  4DSE A;  4A57 A;  4MDA A;  3KD5 E;  2DFE A;  4Z94 A;  4AHU A;  2E6M A;  3H6E A;  1N8R O;  4N56 A;  2VWJ A;  3K9J A;  4HVJ A;  2O4I A;  1S1X A;  2ASO A;  1S72 N;  4FJH A;  3QEI A;  1VRU A;  3GDQ A;  4BC3 A;  4FOI A;  3L3V A;  4GY2 B;  4KTW A;  2PZS A;  4LF9 K;  4BR2 A;  4KAZ A;  4JS4 A;  1YVU A;  5AQS A;  1LW0 A;  1ZBH A;  3AAP A;  2Z1I A;  3CG7 A;  1TKT A;  2NNW A;  5LY3 A;  4LF7 K;  3KD1 E;  4H0X B;  4V19 S;  3A8Y A;  4U67 L;  3AAR A;  1FK9 A;  5E41 A;  3H1Q A;  3DLG A;  3R9P A;  2HBJ A;  3JS6 A;  3CCM N;  4F3O A;  4MFB A;  3WEE A;  4ISE A;  1HNX K;  4FJ9 A;  3A0I X;  1TUU A;  1T6D A;  1ZC6 A;  4CJ5 A;  4B1Z A;  3DLB A;  3MXJ A;  1K6Y A;  3J7Z O;  3VQ5 A;  3SUO A;  4FL9 A;  4DSF A;  3VQC A;  4CF8 A;  1SL1 A;  1S6Q A;  2QWO A;  5DMR A;  3SQ4 A;  1WOQ A;  3RMD A;  4O5F A;  1NGI A;  3SJH A;  5HOO A;  3K5O A;  2GEL A;  4RG8 A;  4BAC A;  2G8I A;  2ZM6 K;  4H5T A;  3ULE A;  4ISG A;  4EFH A;  1YIJ N;  4JLH A;  4BRF A;  2QXF A;  1D9F A;  1O13 A;  2NRW A;  3K5M A;  4DR2 K;  3CJ1 A;  3FE1 A;  3TSU A;  1T03 A;  3LM9 A;  5A2Q O;  1RGI A;  3NGY A;  4BR4 A;  4C8O A;  2KLA A;  4BRA A;  4KBO A;  5JS2 A;  1QVF M;  3C6A A;  4FLT A;  4DSI A;  5AQW A;  1TL1 A;  2HHQ A;  1WSI A;  3MDQ A;  1QSY A;  3MK6 A;  4ISF A;  3WNE A;  5AQO A;  3CF5 L;  4DUZ K;  3M5R A;  1NJI O;  1KQS M;  1KCF A;  3HPG A;  3VQD A;  2O8B A;  2I7P A;  3OYL A;  3CC2 N;  4JI3 K;  4CJ7 A;  1SUQ A;  4CVN E;  4BC4 A;  3T3F A;  4IWV A;  3ZLJ A;  3OVN A;  3AO2 A;  3P39 A;  4CJK A;  4M45 A;  2KQ2 A;  1U47 A;  1FKO A;  4I6M B;  1TKD A;  3T7Z A;  3R6M A;  3BGR A;  3LWL A;  3RRG A;  3ZSV A;  3S3N A;  1GLJ O;  1XHZ A;  4BDY A;  3HPO A;  4OPJ A;  3HBT A;  3K2P A;  3F73 A;  4O4G A;  3AA4 A;  2YV0 X;  3VQE A;  4DFK A;  1Q8I A;  2OYQ A;  2Q0R A;  3CC7 N;  4KB1 A;  1TL3 A;  1BA0 A;  4JAX A;  3TAP A;  3HM8 A;  4KFB A;  2ASM A;  4NYN A;  3VPZ A;  4JI6 K;  1OH6 A;  2QTD A;  3U6F A;  3VEY A;  2QWL A;  1NJZ A;  4JKG A;  3DMJ A;  4BRL A;  1RT2 A;  1HYS A;  5D3G A;  3C6U A;  1VSL A;  1B9F A;  1U2V A;  3A5M C;  1OKJ A;  5M1Q A;  1ATR A;  2WUS A;  3VQ4 A;  3HM9 A;  1XQS C;  3MN5 A;  4ILJ A;  2Y1I A;  1X9M A;  4E19 A;  4C1N I;  4ZHR A;  2A41 A;  2QKB A;  5J2M A;  3ASM A;  2HHW A;  3M8P A;  2AA4 A;  4EIA A;  1VQP N;  4CEC A;  3SCX A;  4DQQ A;  4CJQ A;  4A2B A;  3FFK B;  3VEZ A;  1VSE A;  5I42 A;  4M3T A;  2YHA A;  4IFV A;  1VQK N;  2A3Z A;  1IH7 A;  2FSN A;  4X66 K;  3NF6 A;  3QFP A;  1RT5 A;  4L8R B;  4IDH A;  4EHU A;  2QI2 A;  1RDD A;  5FRO A;  4CZF A;  5AQR A;  3DOL A;  2KHO A;  3B6O A;  3CET A;  1WSE A;  3J7A P;  4CFB A;  4DV4 K;  1NJY A;  1KLM A;  4M7X A;  1IJJ A;  3J81 O;  4OX9 K;  4CZM A;  5EXW A;  4DSK A;  5KGX A;  3A5L C;  4BE2 A;  3T1A A;  2HVH A;  3SAH A;  3PY8 A;  4DR1 K;  3KTQ A;  3RRH A;  2XHB A;  4DV2 K;  1ASW A;  4FJG A;  4WCE L;  3MWT A;  3QER A;  1IKW A;  2O8C B;  3OS0 A;  1HLU A;  1W9H A;  3SBT A;  2IVP A;  2P51 A;  1C0G A;  1R59 O;  2IAJ A;  4CFC A;  3O4Q A;  3GE1 A;  2HBM A;  1XMQ K;  1RBR A;  1XWL A;  4B1X B;  4AHV A;  3AO1 A;  3ZX2 A;  4Y0W A;  1Q81 O;  4PL7 A;  4ID5 A;  1E4G T;  3THY A;  4WQ4 C;  3G4S N;  3C95 A;  4DFM A;  5M1N A;  4Q0B A;  3WXK A;  5F2R A;  1KLN A;  1EWQ A;  4I9Q A;  2UU9 K;  4K42 A;  4MO5 A;  3EZ5 A;  2VG6 A;  3VQ7 A;  3I8B A;  4JD2 A;  3M6G A;  1C0U A;  3S9H A;  1NK0 A;  2OZM A;  1JLQ A;  3DI6 A;  4PUO A;  1M1K O;  3C94 A;  4B9V A;  3ENO A;  4R79 A;  2ZWH A;  3CCQ N;  1TYQ A;  1V4S A;  3C7N B;  4H4M A;  4B8C A;  1L3T A;  3CIP A;  3HPH A;  3MWP A;  2PY5 A;  4OPA A;  2YKM A;  1LWC A;  1C0F A;  4B1V A;  3MCA B;  4ICL A;  3LAL A;  2HOE A;  1C1A A;  3BUZ B;  3KLF A;  3CFP A;  4CGF A;  3QIO A;  3HVT A;  1VSM A;  5SWM A;  3E9P A;  5LJV A;  2OTJ N;  4BE0 A;  4CZG A;  2HF3 A;  5HRP A;  3SPZ A;  4K8Z A;  4FK0 A;  4CJ3 A;  4CJF A;  1M90 O;  3VET A;  3VQ6 A;  4I6M A;  1RBU A;  3HZ6 A;  1JL1 A;  3VQP A;  5HL7 L;  2YNI A;  4K25 A;  2NRV A;  1MU2 A;  4FWQ A;  3PX0 A;  4H0T B;  3KLH A;  1RDW X;  1NK9 A;  2D0A A;  4CE9 A;  2EX3 A;  1K8A O;  3FZK A;  4FJ5 A;  4E1N A;  1DKG D;  4BWJ A;  1KTQ A;  1OVQ A;  1NK7 A;  1YF5 L;  4OGC A;  4OPK A;  3CM5 A;  3P31 A;  2I5J A;  4JI2 K;  4KHP K;  1BIS A;  3MMV A;  4CJ4 A;  3WNH A;  1LWF A;  3L2R A;  3DLK A;  3CCU N;  2KFN A;  3OYN A;  4DB3 A;  4BQL A;  2DPN A;  5H1S Q;  4LY7 A;  2YNH A;  3TSQ A;  1HKG A;  2G8U A;  5CZ1 A;  4DCH A;  3CXC M;  1DTT A;  1Y97 A;  5AQT A;  1MDU B;  2X78 A;  5EU7 A;  1BA1 A;  4E1M A;  2NRX A;  4ELU A;  1Q9X A;  2G8W A;  3LP1 A;  3RSE A;  3SQ0 A;  2OAN A;  3EKU A;  4KPY A;  3B6P A;  1GLL O;  5JLH A;  1EKE A;  4CJL A;  4CER A;  4FJK A;  3L2Q A;  2P9K B;  1TGO A;  4CGI A;  4C8M A;  3DXM B;  5AZI A;  1EP4 A;  4DTS A;  3PO4 A;  4IFE A;  1L3S A;  4FWL A;  3NH2 A;  3H08 A;  3WXI A;  4LF8 K;  4AHS A;  1JLG A;  4OLB A;  4ZTF A;  1NM1 A;  2D0P A;  1K9M O;  4G1Q A;  4OVL A;  2GWJ A;  4PWD A;  3AY9 A;  5HRN A;  3EYZ A;  3D2E B;  3DRP A;  5JIC A;  5I9E B;  3DLR A;  2JGU A;  4WQ4 A;  1SKS A;  3VTH A;  4BRD A;  4BRM A;  1VQO N;  1XUP O;  2ASP A;  2YI1 A;  5AQV A;  1NGJ A;  3LM2 A;  3VEN A;  3CPW M;  3SYZ A;  3DLL L;  2QXL A;  3ZSQ A;  5BR9 A;  4CEO A;  4IZ9 A;  2QWM A;  1RDC A;  4DWI A;  3K58 A;  3CD6 N;  2QW9 A;  4IKF A;  4WQ5 A;  3N4P A;  3PO5 A;  5M1P A;  1DGK N;  1QHA A;  4CJT A;  1VQN N;  3G10 A;  4FZX C;  1P90 A;  2XRI A;  2HHU A;  1BHL A;  4LSN A;  3VA0 A;  1A5X A;  4FJI A;  4TSX A;  4CES A;  2G8V A;  1J5E K;  1GLC G;  1WLJ A;  3MEC A;  5CZ2 A;  3ZX0 A;  3I0S A;  1WSJ A;  4FWM A;  3WEE B;  3B8A X;  4WE1 A;  4BGA A;  3PIO L;  3AVM A;  1IKV A;  2GWK A;  4XH4 A;  3DM2 A;  2FF3 B;  1S1T A;  3E1Y A;  1WBD A;  3QES A;  1GLF O;  4Z4H A;  2P9L A;  5C2D A;  3LDN A;  3OJS A;  5AQQ A;  2A5X A;  3PX6 A;  4J2A A;  1QZ5 A;  1KSP A;  3ULE B;  4GVE A;  1WB9 A;  1QTM A;  2HHX A;  1MWK A;  1WAF A;  4O8K A;  4MQ3 A;  4E0D A;  2GV9 A;  3FGU A;  4PKG A;  4PKH A;  3F9K A;  3LAN A;  3CCV N;  2YNG A;  3H3N O;  2XY6 A;  4BDP A;  4PL8 A;  2A1R A;  4DV0 K;  4IEE A;  3VQA A;  4UQG A;  3K5L A;  5AQU A;  3KK3 A;  4CZH A;  2IVN A;  3AVI A;  1L3V A;  3QFU A;  3LL3 A;  2VWB A;  4RW9 A;  4FPA A;  1QS4 A;  4CGG A;  4FM2 A;  4BRH A;  2Q2R A;  5LMN K;  4DTR A;  2RE2 A;  4IOX A;  4DTN A;  1HYZ A;  2O8B B;  1ASV A;  4JK8 A;  2DFH A;  3IKM A;  4LF4 K;  3IMX A;  2W41 A;  4ID1 A;  4FWP A;  1VK0 A;  3M1F A;  1X9S A;  2KTQ A;  3G6E N;  2UYT A;  4FYD A;  2Z1H A;  1LAW A;  1YJ9 N;  3SQ2 A;  3HOT A;  4RW4 A;  3A5O C;  1BIU A;  5HLF A;  3N4Q A;  4CZL A;  5AJ3 K;  4DV3 K;  1RIL A;  3S3M A;  2A40 A;  1RDU A;  2YJF A;  3PSI A;  4AH9 A;  4GKJ K;  4GVM A;  4CZI A;  5GIN A;  3O3G A;  4LFA K;  2F9T A;  1IBM K;  3FZF A;  3OYD A;  2ZQB A;  3MX2 A;  3FR0 A;  4BRE A;  3PV8 A;  2IC3 A;  3RR7 A;  3P1G A;  2F4V K;  4CJW A;  5GAD P;  3OYE A;  4FM1 A;  2UXB K;  2UUB K;  1DT9 A;  4JKG B;  5AQX A;  3P38 A;  4B3S K;  2ZD1 A;  3NGZ A;  5HBM A;  3NHG A;  1IBK K;  1X3N A;  3HVR A;  1LOT B;  1Q9Y A;  4BVO A;  1VSH A;  3I0R A;  4WFB L;  1U48 A;  3AVA A;  4DMN A;  4M3W A;  2FC0 A;  1VQL N;  4BRN A;  1WSF A;  3SMS A;  4B9N A;  3M8R A;  3LDL A;  1JLC A;  1HNZ K;  4DQI A;  1X9J A;  3T19 A;  1OH7 A;  1KFD A;  4CBX A;  4FVU A;  1BO5 O;  4B9T A;  2Z1J A;  3CPE A;  1RT1 A;  5T7B A;  1ZBS A;  4B3M K;  1HKC A;  1O1W A;  3NE6 A;  4KKO A;  3H46 O;  4BDZ A;  1BOT O;  1IKX A;  5FDL A;  4FK4 A;  2D0C A;  2Q97 A;  1TKX A;  5BR8 K;  3WNG A;  5FPD A;  3QBW A;  1Z05 A;  4B08 A;  3QET A;  3SQ1 A;  4NB4 A;  1VQ6 N;  1S1W A;  1E4F T;  2RKI A;  1ATN A;  3RMC A;  4A5B A;  4C23 A;  5FRM A;  4A59 A;  4EAH D;  4IOC L;  1HX1 A; 
#chains in the Genus database with same CATH homology
 2Q36 A;  2FSN A;  3W3D A;  2ITM A;  3QFP A;  1VQM N;  4F9O A;  4IDH A;  4EHU A;  2QI2 A;  3F5T A;  2P9S B;  1HPM A;  5AQR A;  4CZF A;  5DM7 L;  3VGM A;  2KHO A;  3CET A;  4JKH A;  2F9W A;  5TKW A;  2YHY A;  4BC5 A;  2NLX A;  3EO3 A;  2NRT A;  4PKI A;  3VEX A;  1BU6 O;  2YJE A;  3QBX A;  4M7X A;  1IJJ A;  4CI6 A;  4CZJ A;  3R3L A;  5JVG L;  4QS7 A;  5AR0 A;  2FF6 A;  4CZM A;  5EXW A;  3WXL A;  5C10 A;  3A5L C;  4FWN A;  4ILH A;  4A5A A;  5BPL A;  3L4I A;  3Q7B A;  3KWI A;  4GV3 A;  1GLA G;  3L0Q A;  3SAH A;  3HI0 A;  2P9N B;  4BR0 A;  3G25 A;  4O8U A;  1NGB A;  4BRP A;  2A6A A;  5KPZ A;  1V4T A;  4WCE L;  3TSP A;  3MWT A;  1ILY A;  4JD2 B;  5E84 A;  3CJB A;  1U6Z A;  2HBL A;  3M3Z A;  2FSK A;  4JHD A;  2P9S A;  1HLU A;  5AQN A;  3TU5 A;  3OBW A;  3SBT A;  4BGB A;  2YHW A;  4FWS A;  5F0X A;  2NRR A;  1VQ9 N;  5AQP A;  2IVP A;  1TYQ B;  1C0G A;  1YJN N;  1R59 O;  3UKU B;  1QQM A;  4YOW A;  2VCP A;  3GE1 A;  4NLB A;  2HBM A;  3ZEU B;  4BY9 C;  3JXU A;  4B1X B;  1SS6 A;  1ESV A;  1BG3 A;  3HRG A;  2Q31 A;  4WYB A;  5AQI A;  3ZX2 A;  5BPM A;  5KPR A;  4Y0W A;  1Q81 O;  3WXM B;  4PL7 A;  4DHY A;  1E4G T;  1DEJ A;  4WQ4 C;  5BN8 A;  3VMF B;  3G4S N;  5M1N A;  2YCH A;  4BRK A;  3BF1 A;  3MN7 A;  3MN9 A;  3WXK A;  2CH6 A;  4U7B A;  5F2R A;  2P9N A;  4JKE A;  2PAV A;  1ATS A;  4FWR A;  5ELZ A;  4K42 A;  1VQ5 N;  4CD3 A;  4MO5 A;  3ENH A;  3CJ9 A;  3KHY A;  3OA9 A;  1JCF A;  3DAW A;  4JEP A;  3SBG A;  3VES A;  1EQY A;  3I8B A;  4JD2 A;  4WFN L;  3CHW A;  3MN6 A;  4BRC A;  3M6G A;  4JN4 A;  1XC3 A;  3KVG A;  3AGR A;  1VAZ A;  4G9Z A;  3R1X A;  1NGD A;  4MDB A;  5ADX H;  4FSV A;  2NZT A;  2E2P A;  1M1K O;  4IXC A;  3GOI A;  3CCJ N;  3ENO A;  4R79 A;  2ZWH A;  3SAG A;  1KXP A;  3CCQ N;  2GEM A;  2BTF A;  5AQG A;  1TYQ A;  3EZW A;  3I56 N;  3O5B A;  1V4S A;  3C7N B;  5AQZ A;  5JLF A;  4RCH A;  1YJW N;  3ENB A;  4XH5 A;  3CIP A;  4L3Q A;  3ZEU A;  3MWP A;  3F9M A;  4OPA A;  4PHT X;  2E20 A;  5GIO A;  4YDU C;  1C0F A;  4B1V A;  3MCA B;  3SAF A;  2HOE A;  3BUZ B;  1G99 A;  3IUC A;  3O4W A;  3PLA A;  3HSC A;  4ILG B;  4LC9 B;  2CGK A;  2ZF5 O;  3VEW A;  3KZB A;  2JWL A;  3RVC A;  2PBD A;  1T3V A;  3E9P A;  4B1Y B;  5LJV A;  4BR9 A;  2OTJ N;  4CZG A;  2HF3 A;  4IJA A;  3E9L A;  5KPT A;  3CER A;  2D1K A;  4YOT A;  2ZGY A;  1VQO N;  1M90 O;  4JKA A;  3VET A;  5E26 A;  3IFR A;  4I6M A;  4FPB A;  4FO0 A;  3NMU A;  3HZ6 A;  5F1X A;  5HL7 L;  3FZL A;  4K25 A;  2NRV A;  4OPH A;  3GL1 A;  2PFU A;  4E1J A;  1Y64 A;  4EHT A;  3GBT A;  1TUY A;  4FWQ A;  4H0T B;  1RDW X;  4HTL A;  2BH1 A;  3SLC A;  3WQU A;  4BRQ A;  2VGM A;  1SAZ A;  2E88 A;  4B1W B;  2RHK A;  3FZK A;  4BVP A;  3C7N A;  1K8A O;  3RSE B;  1DKG D;  2WBN A;  2KKZ A;  3MCP A;  1YF5 L;  3P31 A;  3EKS A;  3OBY A;  3ZYY X;  4NLC A;  3QML A;  3CCE N;  2FSJ A;  2GUP A;  3U9Z A;  1VQK N;  2P9I B;  3MMV A;  3WQT A;  4BR5 A;  5FPE A;  2P9U B;  2HF4 A;  3CJC A;  1YUW A;  2W40 A;  3CCU N;  4YOY A;  4CD1 A;  2BUP A;  5AZI B;  4DB3 A;  5EOY A;  4BQL A;  4HWI A;  3WXJ A;  3P4I A;  2DPN A;  2NRH A;  3FZH A;  4J8F A;  5H1S Q;  1HUX A;  3TSQ A;  3BP8 A;  4BR7 A;  1HKG A;  1KD1 O;  2QA4 N;  1BUP A;  5TKY A;  3NVK A;  3CJA A;  1QZ6 A;  5AFU H;  4AM6 A;  5LJW A;  4A62 A;  4DCH A;  4YOX A;  1HX1 A;  3CXC M;  2OTL N;  2ZJR L;  4MLE A;  2WC9 A;  5AQT A;  4IO9 L;  1MDU B;  5B8H A;  1BA1 A;  1NGA A;  2NRX A;  3GG4 A;  4GNI A;  3DJC A;  3LDQ A;  3RSE A;  3ZET B;  2OAN A;  3EKU A;  3AGK A;  1GLB G;  1NBW A;  3CQX A;  2YHX A;  5C15 A;  5BPN A;  1GLL O;  5JLH A;  1KAY A;  4YOU A;  1T6C A;  2P9K B;  3VGK A;  2P9I A;  4JKF A;  5EX5 A;  4BRI A;  2P9U A;  4QS8 A;  1QVG M;  3VER A;  3I55 N;  2ZJQ L;  1KAZ A;  2E1Z A;  3DXM B;  5AQL A;  5AZI A;  4NO7 A;  3W0L A;  3KK7 A;  4IFE A;  1JCE A;  2HST A;  4FWL A;  2V7Y A;  2HMP A;  3A5N C;  1QQN A;  2QWQ A;  3WXI A;  1MWM A;  1YXQ A;  1S3X A;  5ADX A;  3DXK B;  5AQK A;  1NM1 A;  3J8A A;  3KWG A;  4H0O A;  4BG8 A;  2ZJP L;  2AP1 A;  2D0P A;  5FPM A;  3VEV A;  3D2F B;  3O9R A;  1K9M O;  2E1Y A;  5CR4 A;  2QWR A;  1OVY A;  3O9T A;  3TPQ A;  1BDG A;  5FPN A;  2GWJ A;  5MLC Q;  1Q86 O;  2JWK A;  3AY9 A;  4MO4 A;  3O9Q A;  3ZET A;  4JKD A;  3D2E B;  4K41 A;  5EVZ A;  3WUH A;  5BRH A;  1NGC A;  2D4W A;  5JIC A;  4M63 C;  4KH5 A;  5I9E B;  3UKR B;  4WQ4 A;  4BQZ A;  1D4X A;  4H0Y B;  3D6R A;  4FOE A;  3VTH A;  2P9K A;  4BRM A;  4JKC A;  2E2Q A;  4BRD A;  1XUP O;  3U4L A;  3VGL A;  2ASP A;  2ZGZ A;  3NVM A;  4BG9 A;  5KQ8 A;  2YI1 A;  5AQV A;  3CME N;  4WQ5 C;  1NGJ A;  3LM2 A;  4H5V A;  3ZX3 A;  3VEN A;  3CPW M;  3CMA N;  4BC2 A;  3DLL L;  1X3M A;  2QXL A;  3DXM A;  3UKU A;  1Q18 A;  5BR9 A;  2E8A A;  4IZ9 A;  1IG8 A;  2QWM A;  2P9L B;  3FZM A;  1MA9 B;  4IO8 A;  4JNE A;  3E66 A;  1YAG A;  3CD6 N;  2QW9 A;  5AQY A;  4H5N A;  4A2A A;  3H45 C;  1U2V B;  3TTF A;  5C0Y A;  4WQ5 A;  3DXK A;  3L6Q A;  3N4P A;  3QIC A;  2Q0U A;  5M1P A;  1DGK N;  3U9D A;  3CCS N;  1QHA A;  4UY8 O;  1NLV A;  1VQN N;  3O08 A;  1P90 A;  2H3G X;  1YVN A;  1K8K B;  4GV6 A;  5BRF A;  2P9P B;  4CZK A;  4YDU A;  3O8M A;  3IDH A;  3UE5 A;  5GAE P;  4DKW A;  3D2E A;  1GLC G;  2EWS A;  3O80 A;  4WFA L;  3ZX0 A;  3ATV A;  4BRO A;  4IEI A;  4FWM A;  4MDA A;  3WT0 A;  3UKR A;  4A57 A;  4Z94 A;  3B8A X;  3WEE B;  2YX6 A;  3BEX A;  1S22 A;  4JK9 A;  3H6E A;  4BGA A;  5JMV A;  3PIO L;  1N8R O;  2GWK A;  4XH4 A;  5GIP A;  2FF3 B;  4JKB A;  3E1Y A;  4B9Q A;  3K9J A;  2V52 B;  3QDK A;  2ASO A;  1S72 N;  3DWL A;  1GLF O;  3H3O B;  5AFU A;  3GDQ A;  2P9L A;  1Z6R A;  1H1V A;  2V7Z A;  4FOI A;  4GY2 B;  5AQH A;  4BC3 A;  4BR2 A;  4CBW A;  3LDN A;  1LCU A;  5C2D A;  5AQQ A;  5AQS A;  5GAH P;  2A5X A;  3L4Q A;  1W2B M;  1NGE A;  3AAP A;  1QZ5 A;  2NNW A;  3ULE B;  4CZE A;  5LY3 A;  3S41 A;  1CZA N;  4YOV A;  4GVE A;  3CCR N;  4H0X B;  5AQF A;  3A8Y A;  4U67 L;  3AAR A;  4H0P A;  1K8K A;  1YIT N;  3EE8 A;  4YOR A;  2CGJ A;  2P9P A;  4K43 A;  1MWK A;  3ATU A;  3H1Q A;  4O8K A;  2QWP A;  4AM7 A;  3R9P A;  1RFQ A;  3FGU A;  4PKG A;  4PKH A;  4H0V B;  2NRZ A;  5AQM A;  2HBJ A;  3JS6 A;  1EO1 A;  3CCV N;  1SZ2 A;  3CCM N;  4M7Y A;  4XH1 A;  1KAX A;  5AZJ B;  3OW2 M;  3H3N O;  4QS9 A;  1JCG A;  2QM1 A;  2V51 B;  4ISE A;  4PL8 A;  3WEE A;  3F2K A;  3A0I X;  1TUU A;  4IJN A;  3O1W A;  3E9O A;  1T6D A;  4IEE A;  1ZC6 A;  4JHD B;  1GLE G;  5AQU A;  4B1Z A;  4CZH A;  3CQY A;  2IVN A;  3J7Z O;  3QB0 A;  3D7E O;  4FL9 A;  2QWO A;  3QFU A;  3LL3 A;  3VOV A;  1YI2 N;  2VWB A;  1WOQ A;  3H1V X;  4FWK A;  4O5F A;  1NGI A;  4FPA A;  5AQJ A;  3SJH A;  1NWK A;  1SQK A;  5HOO A;  3CC4 N;  4BRH A;  2GEL A;  2Q2R A;  4H5T A;  5BRD A;  2RE2 A;  3ULE A;  3T69 A;  4IOX A;  4ISG A;  4EFH A;  4KH4 A;  4JK8 A;  1YIJ N;  2WFB A;  1K73 O;  4BRF A;  3C0B A;  1O13 A;  3IKM A;  2NRW A;  5CE3 A;  2QEX N;  3IMX A;  2W41 A;  3CJ1 A;  3FE1 A;  3M1F A;  4FWP A;  3TTD A;  3TSU A;  4IOA L;  3LDO A;  3G6E N;  3LM9 A;  1JJ2 M;  2UYT A;  4H5W A;  3O1B A;  1RGI A;  3BF3 A;  4BR4 A;  5BN9 A;  5AZJ A;  1VQ4 N;  3UB5 A;  2KLA A;  3MX5 A;  4BRA A;  4KBO A;  1YJ9 N;  4RTF D;  3VF4 A;  3HOT A;  3HTV A;  3A5O C;  3LDP A;  3N4Q A;  3C65 A;  1QVF M;  4CZL A;  2QWN A;  3C6A A;  2HBK A;  2A40 A;  3Q7C A;  5AQW A;  4FWO A;  4KH6 A;  1RDU A;  2YJF A;  4AF1 A;  3VTI A;  1HKB A;  4CZI A;  5GIN A;  2GTD A;  3FLC O;  4XEI A;  3MDQ A;  4RWT A;  2F9T A;  3FZF A;  3MK6 A;  5CHI A;  4ISF A;  5AQO A;  3MX2 A;  3FR0 A;  4BRE A;  1NMD A;  3CF5 L;  1NJI O;  3M5R A;  1KQS M;  3O6W A;  5M1K A;  4B1U B;  1NGF A;  4GV9 A;  5DM6 L;  2Q1N A;  2I7P A;  1Q7Y O;  3CC2 N;  1KC8 O;  5EY4 A;  4DQ8 A;  4CJ7 A;  5GAD P;  4H03 B;  1QQO A;  1ZXO A;  1DT9 A;  4BC4 A;  4CBU A;  4JKG B;  5AQX A;  4IWV A;  4BRG A;  4C1N K;  1VQ8 N;  3P38 A;  4JK7 A;  3P39 A;  2F7T A;  1WUA A;  1X3N A;  3CJ7 A;  4I6M B;  3ID6 A;  1LOT B;  5GAG P;  1VQ7 N;  4BVO A;  2GX9 A;  4IOC L;  4WFB L;  3T7Z A;  3D2F A;  3R6M A;  4WF9 L;  5BRE A;  3CCL N;  5C12 A;  3VF2 A;  5C2F A;  1VQL N;  4BRN A;  1J6Z A;  1GLJ O;  2IIR A;  1GLD G;  3CI5 A;  3HBT A;  2IVO A;  3SMS A;  2CGL A;  2VGN A;  1P8Z A;  3LDL A;  2CH5 A;  2Q0R A;  3CC7 N;  3AAQ A;  3O9U A;  1NGH A;  3HOS A;  3ID8 A;  3SK3 A;  5M1O A;  1BA0 A;  1X9J A;  4JAX A;  4CBX A;  3HM8 A;  4FVU A;  4OO1 J;  1BO5 O;  3CPE A;  2ASM A;  2A42 A;  2I7N A;  3VPZ A;  1BWF O;  4A61 A;  2QTD A;  3I33 A;  3VEY A;  1Q82 O;  2QWL A;  3R8E A;  4JKG A;  4BRL A;  1ZBS A;  2FXU A;  1HKC A;  1NGG A;  1W97 L;  5KQD A;  2D0O A;  3C6H A;  2E2N A;  3EL2 A;  2E2O A;  3H46 O;  3TTC A;  1U2V A;  3A5M C;  1OKJ A;  5M1Q A;  3U8X A;  1ATR A;  1BOT O;  3OHR A;  3G71 N;  3K9K A;  3SMP A;  2WUS A;  2Q97 A;  3EE9 A;  5M1F A;  1XQS C;  3MN5 A;  4ILJ A;  4C1N I;  2A41 A;  5FPD A;  3QBW A;  2AA4 A;  1Z05 A;  4EIA A;  1VQP N;  4NB4 A;  1VQ6 N;  1YHQ N;  2FLO A;  4H5R A;  1E4F T;  3PIP L;  3VEO A;  3VF6 A;  4A2B A;  1T44 A;  3FFK B;  2J4R A;  3O9S A;  1ATN A;  3VEZ A;  5JVH L;  3EN9 A;  4A5B A;  4C23 A;  4A59 A;  4EAH D;  1HJO A;  2VYP A;  4MLH A;  2A3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...