3DOLA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
540
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 136
structure length 536
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dolA05
3CJ4A 3IG1A 1YVUA 1IKYA 3V6HA 1VSHA 4CF0A 4NCAA 5EDWA 4XO0A 4B9UA 2IAJA 3I0RA 5CY4A 3THVA 2AQ4A 2OZMA 2YNHB 4JRPA 4C8NA 5F8MA 2HWIA 3MTKA 4RNFA 4DG1A 4HUEA 3DLKA 2W9BA 3BJYA 3EYZA 3LP0A 1RTJB 3T5HA 1KFDA 4J9OA 1TAQA 4K4UA 2ATLA 2ZD1A 3RMBA 2XI3A 1VSDA 3FRZA 2UVVA 4TYAA 3LZIA 3AVMA 2Q3SA 3BSNA 3CJ0A 2X78A 2C2EA 4KB0A 4KFBB 1FKOB 4FLTA 4ZPDA 2O4GA 3OLAA 1S49A 4FS1A 1RA7A 3DLGB 1TV6B 4CHZA 3FFIB 3DI6B 1XI1A 4QWEA 1D5AA 3DYAA 4FLXA 1LWEB 3QINA 4B3OB 4H54A 3T5JA 4M45A 4DSJA 2KFZA 5I42A 3SFGA 4RUAA 4CEFA 3ZSRA 3NAHA 3K59A 4OGCA 1FKPB 1NJWA 4FJ9A 3OL8A 4B9LA 2AJQA 4E89A 2VG6B 3I5CA 4DL5A 1C1BA 4KB1A 1QE1A 1HYSB 3HPOA 4NYFA 1N4LA 3PR5B 3MFHA 1XWLA 4Y1CA 4CFAA 3RTVA 3TWHA 4Z4HA 3AO1A 1S1UB 3M8SA 4F8RA 2FJWA 1X1PA 4FCYA 2AX1A 3RAQA 2HHXA 4CJWA 1W9HA 3KKSA 4OLBA 4IRKA 3DLBA 1JL1A 4EBCA 1G15A 2X74A 3C94A 4W5NA 4QWBA 2C2RA 3LP3A 4Y3CA 3E01B 4DS4A 2W8LA 1RDDA 1SV5B 3ZSOA 3I0SB 3OSPA 2XY6A 1DLOA 4OJRA 1U4BA 4IDKA 4FJJA 3HJFA 4M41A 2W42A 4NLOA 1N6QA 4KRFA 4DQRA 4TLRA 1KLMA 3TAQA 4MKAA 2YNFA 2D0BA 4RW6B 4OVLA 1SL2A 2YNGA 5EWEA 3H5YA 4BWMA 4CGFA 1O1WA 5L1LA 3OHAA 3HO1A 2X6NA 5I3UA 5L1JA 3V9XA 4CJ5A 3RWUA 4W5RA 5KFHA 1WAJA 2E9TA 1ITGA 5DQIA 4F4WA 4HUGA 5KFSA 4E0DA 1S6PB 2FVSA 5HP1A 5EU7A 1RT2B 4CEQA 5KG1A 3MR3A 1WSEA 4CK1A 3GV7B 3L3VA 2VG5B 2WOMB 4GC7A 4K8ZA 1GOCA 2UUTA 4PWDB 2BRLA 1UA1A 1NJZA 4XPEA 3M8QA 1KCFA 5JXSA 2XHBA 3QZ8A 3WNGA 2PYJA 3QEPA 2GV9A 3MR6A 5KFUA 3FQLA 1VSIA 3V6DB 3PUFA 3DRPB 4CIEA 1B9DA 1RT5A 2BRKA 3LAKA 2P1JA 4ZTJA 5KFIA 4MFBB 4IH7A 4QW8A 1ZYQA 4IKAA 1GOBA 4CE9A 1Z4UA 4ECXA 2OYQA 3P1GA 4KAIA 3HPHA 4ECZA 4BE1A 2B6AB 4CFBA 3V6JA 3QEWA 4YP3A 4Q0BA 1N5YB 3CVKA 4Z4FA 3HXMA 4NLXA 3AO4A 2HHQA 2Z1HA 4AHCA 1IKVB 1QSLA 3QEVA 4Z4GA 5KT7A 3M8PA 4UQGA 3QYYA 2ZE2B 4K4TA 3QEIA 2OPQB 3IGVA 4LQ3A 1NNDA 1BQNB 3LZJA 5KG5A 3TQ1A 1QHTA 1J5OA 3F9KA 5L1KA 4Q44A 4URGA 1T8EA 4Y34A 3DOKA 2UUWA 4O4GA 5DGAA 1B92A 4C8LA 1RA6A 2FLNA 2R7YA 3QLHB 4QWAA 1ASUA 1Q8IA 1SL1A 4WE1B 4GVMA 5HLFB 3S3MA 4MQ3A 4WYWA 4DTNA 2FLLA 3CWJA 4NLTA 2WCXA 3QZ7A 1EP4B 1MU2B 4QWDA 4CF8A 3TR8A 4ZTFA 4ECSA 3VQ9A 5KT6A 2OPRB 5F8GA 4X2BA 2HHSA 3KK3B 1D0EA 4NLVA 4DL6A 2DPJA 1VK0A 4XIUA 5L1IA 2FVRA 4DTXA 5KFXA 3L3UA 2HVIA 1TK5A 2RN2A 4TY8A 1KVBA 1R0AB 3CQ8A 4BE2A 4PQUB 2I5JB 1J53A 1RT3A 1S4FA 1XHXA 5D3GA 4ED3A 5KFQA 1S9EA 4F4ZA 1SL0A 2RF2B 4JV0A 3L2UA 4KAZA 5KRSA 2GUIA 4CGJA 4O5BA 5DMRA 5KFCA 4IG0B 3OSNA 3RRGA 2HNZA 5J2PA 3TAMB 4BDZA 2R2RA 4R8UB 3AVLA 1JLGB 3VQ5A 4JRQA 1JLBB 1TKXB 3CO9A 3AVKA 2G8FA 1DTQA 1SH2A 4RNHA 4AHRA 5C42A 2HB5A 2IM0A 2EX3A 2IOCA 3AVJA 1ZTWA 5HROA 1NHVA 2QKKA 1RT4A 5T7BA 4CJFA 3JYTA 3LP1B 5C25B 2RKIA 3NL0A 2XC9A 3AA5X 1HNIA 4EP4A 3SUQA 2HW3A 3RB3A 2YNIB 2E6LA 4AH9A 3SUPA 1KVCA 5KFPA 2O4IA 3QO9A 4LH4A 1QTMA 2B5JA 2W9AA 2BANB 3KLGA 5C24B 4RW4B 3HP6A 4KSEB 1BQMB 3SCXA 1S1TB 4CEDA 4DL4A 1WSGA 1IKXB 4B9MA 1T03A 4YMEA 5DG9A 2IJFA 4B9SA 4FJNA 3KK1A 3BDPA 4DFPA 4IFYB 3TI0A 1EKEA 4CFCA 4K4XA 2GIRA 2IM3A 3KLVA 4LSNB 1TVRA 3L8BA 3CJ5A 2Z1JA 4I2QA 3B6PA 1RTHB 5J2NA 4M3TA 4O3SA 3DRRB 2RDIA 3WNEA 3DM2B 2HHTA 2OPSB 3T1AA 2HNDB 5KGWA 1JLFA 5K14B 1I3AA 4Q8FA 2WTFA 4CK3A 3KJVB 3BGRB 1UWBB 2YKNB 4J2DA 4ZHRB 1JX4A 1L3TA 4KO0A 1W25A 3MR2A 1C0UA 5FDLB 4FK0A 4KE5A 2FBXA 5DQGA 3CYMA 1T05A 3NF9A 3MEGB 1VSLA 2OPPA 5DLFA 1U45A 5CYQA 4RZRA 1J9AA 4HVJA 1HNVB 4DTMA 4DU4A 5F8LA 4F3TA 3KLFA 2G8UA 4IR9A 4H4OA 4O44B 1JLAB 4FYDA 3ITHB 1RDRA 3AVCA 4I7FB 3C6UB 2QV6A 4H4MA 4J9KA 1FXXA 5KRTA 2XCAA 3KLEB 2IGIA 3MECB 4W5TA 3RBDA 5CZ2A 1A5WA 3G0ZA 2V0NA 4M3RA 3HT3A 4Y2AA 5KG4A 1HPZB 1RBTA 3TANA 2WHOA 1Q9YA 4ZP7A 3ZSQA 3NBPB 1RYRA 1RBSA 3BSCA 2YNHA 5FROA 1TL1B 3CDEA 1HRHA 4DSLA 1OS5A 3SI8A 4CEEA 1RTJA 3ASMA 3T3FA 2WONB 3QIDA 1LW0A 1QAIA 4J2BA 3NHGA 1S97A 1RDBA 4ECTA 5C5JA 4B08A 4TQRA 2HWHA 1GOAA 3SQ2A 1X9MA 1I6JA 1Q9XA 1QS4A 4KFBA 3K5OA 4CHYA 3GIMA 4RNMA 1S1WB 3V1OA 4DL2A 4YQWA 4CHPA 3AA3A 4ELVA 3QGGA 1JLEA 1CXQA 4RW9A 3CJ3A 4KB7A 1TV6A 4FM0A 3FFIA 3DI6A 4LSLB 1NK4A 1LWEA 4BE0A 4B3OA 3CM6A 1LW2B 4B8AB 4E1NA 3QNNA 2FLPA 4KHWA 2Y1JA 3RAXA 4NLGA 3K5MA 1FKPA 2XY5A 3SQ1A 4GMJB 4RW7B 3C6TB 2VG6A 2DFEA 3CFOA 3QEXA 3I8DA 3FQKA 1KLNA 3S9HA 2V4RA 2BQRA 1HYSA 2JEIA 4OKEA 5KFKA 1REVA 4PUOB 3SQ0A 3HK2A 3IRXB 1VSFA 2QK9A 3HVTB 1S1UA 2G8HA 4DFMA 3PX4A 3G6VA 4Z4IA 5JS2A 2KZZA 5KFBA 3IN5A 4DTSA 1TP7A 3KMSA 3V4IB 3VQAA 1BCMA 4K50A 3NMAA 4B9NA 3E01A 4DL3A 5DG7A 1SV5A 2F8SA 4RUCA 3BQ0A 2F8TA 3KD5E 4TSXA 3OYDA 3UR0A 4DEZA 2R8HA 3NGZA 3NF8A 1KHWA 4CEOA 1IG9A 3EY1A 4YR2A 4ECVA 4ZVHA 3L2RA 3VQDA 5KFWA 2VWKA 1I39A 3OYCA 3RRHA 1TKDA 4DTPA 1NK8A 5KFLA 3QETA 1SUQB 2HHUA 1TK0A 4RW6A 2Z1IA 4QWCA 3K5NA 3Q8RB 4U7CA 1C0MA 2YHBA 2KZMA 2FVQA 3G10A 5KT5A 1LV5A 4DTRA 3SV3A 4OKKA 4DTOA 1XR7A 2E4LA 4YR0A 4E19A 4YR3A 2GIQA 1JXEA 3VQEA 3OS0A 1S6PA 4M3UA 4DWIA 4FLWA 1HMVA 4RNOA 4IRCA 4WZMA 2XO7A 1RTIB 2WOMA 2W7PA 4K4YA 1KTQA 4HTUA 3IG1B 1XHZA 4MK8A 3DRSB 3LALA 4M42A 4FK4A 4O3OA 3MEDB 1NHUA 2O5DA 4NRUA 3V6DA 3OYNA 1RBUA 3G86A 4ZVEA 1IM4A 3LWMA 1S1XA 4RNNA 5CZ1A 5FRMA 1CXUA 4CESA 1RT1B 3DLKB 3M9OB 4W5OA 3SNNA 2E9RX 3ZT4A 3GIIA 3JSMB 3GILA 4FZYA 3V81B 1BI4A 1BL3A 3KK2B 2B43A 4KTZA 4MK7A 1Z25A 1JLQA 2B6AA 2HMIB 4TXSA 3GV5B 2BQ3A 3VQSA 1N5YA 3NGIA 4NLUA 4F3OA 3D0PA 3NAIA 3CIZA 1IH7A 1IKVA 4WYLA 1TGOA 2ZE2A 2OPQA 3H08A 3ICLA 1S48A 4J9LA 4J9RA 2D0AA 2QKBA 3UQSA 3ZT2A 3RB6A 4NCGA 3KTQA 4IBNA 3QLHA 4QCLA 4WE1A 3AVHA 5HLFA 4FJ7A 2ETJA 4YNQA 3LP2B 3HHKA 3KLIB 4K4SA 4O55A 1C2PA 5EUHA 4DQQA 3QESA 3PVXA 1T3NA 3KOAA 1RCHA 4N47A 1MU2A 3ZT3A 3I5AA 4F50A 4J2EA 3TVKA 1WAFA 4O3QA 3QNOA 2OPRA 4RW8B 1JLCB 3KK3A 3CDWA 4MK9A 3T5KA 2DFFA 3IAYA 1XR6A 4ICLB 4KBIA 2ASDA 4RG8A 2GBZA 1C1AA 2IDOA 1R0AA 3MXIA 2JEFA 2IC3A 3IGNA 4PQUA 3MF5A 2I5JA 3KIOA 3VQBA 4IDKB 3SQ4A 1U48A 4TN2A 4DF4A 5KG6A 3HM9A 3NF6A 1KLMB 3DOLB 3WNHA 5HRSA 1S9GB 3OYBA 2RF2A 3RB4A 2Y1IA 3KMQA 1FK9B 1DTTB 1VSJA 3NE6A 1RILA 3TAMA 1S5JA 4NYZA 4EO8A 1JLBA 1TKXA 1WLJA 4NYNA 1RYSA 4CJVA 3AVBA 3UIQA 3O4NA 3ZT0A 3A2FA 4I2PB 5J2QB 2B4JA 4CF2A 2J6UA 3LP1A 4G1QB 4ID5B 3EZ5A 3I5BA 2YNIA 4YFUA 1MMLA 3LPUA 4KHNA 4KI6A 4HCBA 3RMAA 3V9WA 5C24A 3OYKA 1BCOA 1WSJA 3H4DA 5KFJA 4DSFA 1RT7B 1S1TA 4R0EA 4FJKA 4IH5A 1TKZB 1RT5B 1IKXA 3AVGA 1XR5A 4IFYA 4ZPCA 3CFPA 1N56A 2E9ZA 1YT3A 3CG7A 2R8IA 3G6XA 4CHOA 4LSNA 4ED8A 3H5XA 4KPYA 2FBVA 3OHBA 1VRUA 1GX6A 3DM2A 3HKWA 2BGGA 2OPSA 2HNDA 2IA6A 3RMCA 1JKHB 5K14A 2OA8A 3PHEA 4EP5A 1BHLA 4Z4CA 3BGRA 4O3PA 3BREA 1UWBA 4Z0UA 3PJXA 4ZMMA 4ZHRA 3V9ZA 1IO2A 3PO5A 4FBUA 4ED2A 1JXBA 1EETB 2YKMB 4OLAA 5FDLA 3OY9A 3V1RA 1HQEB 4DS5A 2FJXA 4DFJA 1J5OB 4CJRA 3MEGA 4M3YA 2PZSA 4M3XA 4ECWA 2VG7B 3AVIA 3OS1A 3DOKB 3T5LA 4F4XA 4O4GB 3RBEA 4AHSA 4FLZA 2YHAA 3Q8QB 4F2RA 2W7OA 1C0TB 1JLAA 5KT3A 4ECQA 4LD0A 3OJUA 1CSJA 3VQ4A 3C6UA 3VN5A 5HBMB 5DQHA 4DU3A 4OPKA 3QIPB 3KLEA 3MECA 4E3SA 1VSKA 1Z26A 4C8MA 3OJSA 3RR8A 5J2MB 2FBYA 3B6OA 4ZPBA 2W9CB 2NUBA 5KFGA 2XCPA 1HPZA 2C28A 3K58A 3DMJB 1ZETA 1TL3B 4FW2A 3NH2A 3LPTA 1TK8A 4KV8B 3NBPA 2F96A 4CJUA 4HUFA 4M3ZA 1S1VB 3H5UA 4ELUA 1TL1A 4CK2A 3MEEB 4AHTA 4DQSA 5KFRA 1HYZA 4K4ZA 2XWYA 1NKCA 2QE5A 4DLEA 2PY5A 2WONA 3KHHA 1NJYA 3NFAA 5KI6A 1TQLA 3VA0A 4R5PB 1LWFB 3SV4A 2OH2A 1LAWA 4FJMA 3D45A 1RT6B 4FZZA 1CZBA 4EZ9A 4NLYA 3DLRA 2D3ZA 4NLRA 3AO2A 2HHWA 1UOCA 4DSEA 1U09A 2J6SA 5KG0A 1L5UA 1VRTB 3ZSXA 4LSLA 4ID1A 3DDKA 3QGHA 4IFVB 2UVUA 4ED1A 3NDKA 1K1SA 1ASVA 3BR9A 1LW2A 4IG3B 2HHVA 2FC0A 4LQ9A 1K6YA 1KFSA 4QOZB 1K1QA 4ECUA 2ALZA 2AU0A 1QSYA 3KNAA 3C6TA 4ZP8A 2JEJA 3AV9A 1LWCB 4CEZA 2D7SA 1BGXT 3D5MA 4F4KA 2G8KA 3SFUA 4B9VA 5HRRA 3GQCA 2GC8A 4PUOA 4DTUA 1C1CB 3IRXA 1KSPA 3UPFA 4DLGA 3HVTA 3H5SA 5HRPA 1QUVA 2BE2B 3IS9B 4ZVFA 1T03B 3DLHA 1LAVA 3TABA 2HNYB 5J1EB 4CECA 4FM1A 1ASWA 4U6PA 4IOBA 3V4IA 1BIUA 3HPGA 3FSIA 1TVRB 1U49A 4BDYA 1RTDB 4I2QB 4DMNA 4NLDA 4TY9A 1HYVA 3PX6A 4KKOB 4DF8A 3SYZA 2D3UA 1RBRA 4HKQA 1JLFB 4ZPAA 1FKOA 3WNFA 3GIKA 5KFMA 2W8KA 2FBTA 4DTJA 1U47A 4C8OA 1WSHA 3DLGA 4KO0B 4CFDA 1U04A 1C0UB 4E7LA 5CYMB 3EPIA 4HCCA 4CGIA 1NJXA 3KLHB 4J9MA 4CIFA 4ZVGA 4DSKA 3V9UA 3CDUA 2R8KA 4I9LA 1IKWB 4NLWA 1X9SA 5FRNA 1NK7A 2KFNA 2R8JA 4NCBA 4F2SA 2AWZA 3AO5A 4FJHA 2XY7A 1RDAA 4N5SA 2C22A 1SKWA 5F8IA 1NOYA 1WNEA 2J6TA 2D5RA 1SKSA 2A1SA 4XPCA 4QAGA 4LH5A 4CGHA 4FLUA 3BSAA 2WK4A 1RTIA 4CJPA 3NGDA 3TAEA 3SI6A 1VSEA 1NK9A 3KHLA 3LANA 3MAQA 3DRSA 4E7IA 1S9FA 4J9NA 1JL2A 1S10A 4EBDA 3PO4A 3SZ2A 4TQSA 3MEDA 3PW4A 3H98A 1TKTB 5KGXA 4B8CA 3I0SA 5KFTA 3PW2A 5DK5A 4DL7A 3ZSYA 3CJ2A 5EWFA 4CIGA 5KFFA 1RT1A 1L3UA 3AA2A 2AX0A 5F8NA 3OYGA 4FS2A 1UAXA 1KVAA 3JSMA 1LW0B 2R2UA 1NK5A 1HQUB 3V81A 2R2SA 4CF9A 3KK2A 4HHTA 3DLEB 3OL7A 1D9DA 3HP9A 2IBKA 4O3NA 4KREA 2HMIA 3Q8SB 5L9XA 4NLQA 4Y2CA 3UDLA 4DSIA 3NH1A 4CJ3A 3KHRA 2A1RA 3PX0A 1JLEB 4RW9B 4EBEA 1L3VA 2QXFA 3QGIA 3OYIA 1HARA 1S6QB 4I9QA 4WFZA 3P83D 2ZQBA 1RT2A 2C2DA 2I1RA 3E51A 5T14A 5HRNA 2VG5A 4PWDA 4J9QA 3OYJA 1IKYB 2Z1GA 4FZXC 1REVB 1C6VA 4DQIA 4KHMA 4KHSA 2IAJB 3I0RB 3LP2A 2BQUA 3KLIA 3HYFA 4KTWA 3S3NA 2ZKUA 2IJNA 4B9TA 3DRPA 4EO6A 3K2PA 2P5OA 2IM1A 4CJTA 4DQPA 4FJ5A 2D41A 2CJQA 4DG1B 4IQXA 3P5JA 2HVHA 2W9BB 4GW6A 3LP0B 4ED7A 4MFBA 4RW8A 1JLCA 4K4WA 3VQ7A 4ICLA 3OYLA 2ZD1B 3OVNA 3TAGA 1NOZA 2XGQA 4MIBA 1NK0A 2X6SA 2JC1A 3MXJA 1WNSA 2KQ2A 4KTQA 3PJWA 3MXMA 3DOLA 4DFKA 3HL8A 1WSIA 4H8KA 1S9GA 4E7HA 4FBTA 4K4VA 3RMDA 3RB0A 3ZSWA 1FK9A 5EWGA 3DYAB 1BQNA 4ELTA 1DTTA 2F8EX 3K5LA 5KFAA 1S0NA 4KHQA 1SKRA 5I42B 2ATQA 4C8KA 4W5QA 3SUNA 4KHUA 5KG2A 4AILC 2KTQA 4EYHB 3OL9A 4JV2A 3NKYA 4NRTA 3G6YA 3SPYA 4CJQA 1C1BB 3BQ1A 1QE1B 3L2WA 4NZ0A 1ZBHA 1ZBFA 3NAEA 4I2PA 3U6FA 4E7JA 1HMVB 5J2QA 3ZCMA 3N6MA 4G1QA 4ID5A 4KHYA 4QPXA 5KT2A 2V4QA 2V9WA 1UA0A 3VA3A 1EP4A 2DPIA 1JIHA 5KT4A 4CJLA 1RNHA 3BSOA 3OYMA 1HJRA 4CHQA 2LSNA 1RT7A 4EZ6A 3M8RA 1QAJA 1JXLA 1TKZA 2FVPA 1S1XB 5JS1A 1DLOB 4PY5A 4M94A 3OS2A 3GIJA 3AVAA 3PZPA 1XC9A 4WFXA 1N6QB 4IH6A 3ZSZA 3MFIA 1BI4B 2UVRA 4O3RA 1YTAA 2YNFB 1D9FA 4RU9A 4ECYA 2BR0A 2P5GA 3PR4A 1JLQB 1RDCA 4IG0A 2HAIA 2JEGA 2YNGB 4J2AA 2RDJA 1JKHA 4R8UA 1JLGA 2ASJA 5KFEA 3OL6A 5I3UB 4ED6A 4FVMA 5SZTA 4KHRA 4FJGA 5KG7A 4GC6A 3OYHA 3ULDA 1EETA 2YKMA 4FJXA 4CJKA 1HQEA 3ISND 3PW5A 4AHUA 5HP1B 4FK2A 4M95A 2VG7A 3PW0A 1ZTTA 5C25A 4OPJA 1W0HA 4NCGB 4PA1A 3HVAA 3O4QA 1L3SA 2JGUA 4E7KA 4CGGA 4CEBA 4JLHA 1C0TA 4N76A 3M8QB 3N6LA 4Q43A 3EPGA 2BANA 4RW4A 1CZ9A 5HBMA 5KFZA 3QIPA 1BQMA 4CF1A 4J9SA 3K57A 4CJEA 3LDSA 3GYNA 4CCHA 4CEAA 3H2LA 2G8WA 2UVWA 1TAUA 5J2MA 1VSMA 1GX5A 3M9NB 4CERA 2W9CA 3ISNC 3D28A 2ITGA 5DGBA 2G8VA 3DMJA 1TL3A 2VWJA 3AVNA 3SJJA 1QQCA 4KV8A 1RTHA 1S0OA 1S1VA 3DRRA 3MEEA 2IC3B 1KHVA 2VA3A 2DFHA 1D1UA 4Q0BB 4ED0A 3LAMA 1T7PA 3KKRA 3OYFA 4FLYA 3KJVA 2WRMA 3M8PB 2YKNA 4AHVA 4R5PA 1LWFA 5DG8A 3CM5A 3F73A 4Q45A 3O3FA 3HVRA 4BACA 1RT6A 5KFDA 1A5XA 4MKBA 3VQPA 1CLQA 2G8IA 2CKWA 1HNVA 1NKEA 3AVFA 3V9SA 2R8GA 4FJIA 2ILZA 4KI4A 4J9PA 1EX4A 2EC0A 1VRTA 4O44A 4OL8A 4OGEA 4IFVA 3ITHA 1N48A 4IG3A 4I7FA 3ALYA 3QIOA 4FM2A 1QSSA 1T94A 3HVWA 2XI2A 2EHGA 3H59A 3O3HA 3OYEA 3VQ6A 2YV0X 2XGPA 4FLVA 1B9FA 3PW7A 3OLBA 1LWCA 3AO3A 2ILYA 3GV8B 2AGPA 4Q8EA 1S0MA 3SUOA 3T19A 1C1CA 5KG3A 2BE2A 4TY8B 4MH8A 2FVCA 3IS9A 4WXOA 4N56A 4FJ8A 1EXQA 2XY8A 4EEYA 4WFYA 2HNYA 5J1EA 1SH3A 1RT3B 4JUZA 3RR7A 3ZSVA 3PY8A 2DTUA 5D3GB 2P51A 4QW9A 3KHGA 4URSA 2D0CA 2E6MA 1S9EB 2KW4A 4URQU 5F9NA 4Y1DA 1RTDA 1J54A 3ZT1A 4N41A 3TAFA 4KKOA 1VRUB 4CJSA 4CGDA 2HNZB 5J2PB 1F21A 3L2VA 4E1MA 3AA4A 1A5VA 3H4BA 3HSTB 1S1WA 1Y97A 1DTQB 2AGQA 4K8XA 5C42B 1BISA 5KFNA 1ZBIA 5CYMA 2XRIA 4EYIB 3KLHA 2IMWP 4G3IA 4CHNA 5HROB 2JLEA 3O3GA 1IKWA 3NGYA 1RT4B 1KRPA 3JYTB 2IM2A 2RKIB 1HNIB 4HYKA 2WB4A 3MR5A 4TYBA 4RW7A 3TAPA 4NLSA 3LWLA 1SH0A 2AGOA 4M3WA 2PYLA 3QO9B 2R2TA 4NLPA 1D8YA 2B5JB 4WZQA 2BDPA 5F8JA 3TARA 4LY7A 4O0IA 3KLGB 3V6KA 1BIZA 1WSFA 4FJLA 4MIAA 2FJVA 1ZBLA 4Z4EA 3KK1B 1RBVA 3Q8PB 1NKBA 5E41A 3OYAA 1YVFA 3QERA 3C95A 1TKTA 4WXWA 5J2NB 3NCIA 1X9WA 4OKJA 3VQ8A 4L8RB 5KTQA 3L2QA 4CJ4A 3NF7A 3U3YA 5KFYA 1YTUA 5JUMA 4O0JA 5F9LA 3CFRA 2DY4A 2RPIA 1HQUA 5KFOA 4BWJA 2JC0A 3DLEA 4Q5VA 4JV1A 1SUQA 4IKFA 2OZSA 1T05B 4FW1A 3EZUA 1WN7A 3VQCA 3U3GA 2OPPB 3SPZA 5CYQB 5KFVA 3H40A 1NK6A 4JS4A 2ASLA 1RAJA 5DLGA 2VA2A 3KLFB 4IR1A 1ZBUA 3FDSA 4H4OB 4BDPA 2IS3A 3S3OA 4ZP9A 4O4RA 3PV8A 4FXDA 3KD1E 4DU1A 3V1QA 4JS5A 1S6QA 3BQ2A 4ECRA 3NH0A 4H4MB 3N6NA 4ZP6A 5SWMA 3M9MB 4F4YA 3VQQA 4IRDA 5F8HA
chains in the Genus database with same CATH superfamily
4Q7AA 1FRKA 4BC2A 5LJ5Y 4CF0A 3HD1A 3DHXA 4OJHA 2RHKA 2VFRA 5F8MA 3MTKA 1HW8A 4X64F 2G1DA 4HUEA 3DLKA 1VQ8S 3LP0A 4BRQA 2H51B 1KFDA 3SDEB 1IXKA 4LRDA 4YDXA 2C3UA 2EK1A 3FRZA 4E2FB 4TYAA 1KDNA 2Q3SA 3BGUA 1V6HA 2A5XA 1ZBTA 2BM0A 2ZKTA 2WUSA 2Z57B 2FHOB 4J37A 1RA7A 4CHZA 1XI1A 4QWEA 2XS7A 2OO4A 4FSVA 1LWEB 3JS9A 3T5JA 2EWHA 3PNIA 2KFZA 3TO8A 2HURA 4IO1A 2Q0UA 3A5MC 3KJQB 1W97L 1YG0A 2PD1A 2U2FA 1JJ2M 3I5CA 5T7LB 1N4LA 4IOAL 2YPYA 3GBTA 4F8RA 3T69A 4C9DA 1X9JA 4FCYA 3W9HA 3RAQA 1ZA2B 3KKSA 3HSZA 1VI7A 2HLTA 2X74A 4MLHA 2C2RA 3FCHA 4Y3CA 3B54A 3E01B 2HGNA 5BR8F 3I0SB 2O8BB 3R5CA 1DLOA 5DM7Q 1U4BA 5B0AA 4KRFA 2JVOA 4HI1A 1Q53A 3FCVA 2GJ2A 5AJ3K 1BG3A 4OZ1A 4RW6B 1SL2A 5K9FA 5EWEA 3H5YA 4CGFA 5L1LA 1GTHA 1U0SA 5ETPA 2JSXA 3JQJA 3SLCA 5I3UA 4B3TJ 4NB4A 4CJ5A 3RWUA 3M4XA 1ITGA 3TZYA 5KFSA 2H3EB 1H73A 3SSRA 4IJAA 2YX1A 4H5WA 1CS4A 2OANA 5KG1A 1WSEA 4DV1J 3GV7B 3L3VA 3N4WA 4GC7A 1DURA 3CCJS 1N32F 3G82A 4XPEA 1R59O 3CJ7A 1XTZA 3WNGA 3G71S 2DR7A 4WU2A 5KFUA 3FQLA 4XEIA 2M0GB 3V6DB 1RAIB 2JJ4D 3L3CA 4CJ7A 3LAKA 1HKAA 5L46A 1XMOF 1JQGA 3CD0A 1FFGB 4V19S 3E9OA 1CG2A 3OQ2A 5JMVA 1GOBA 3MM7A 2OYQA 3P1GA 4ILGB 1HBUB 1R8HA 3QEWA 1NDPA 3AA9A 3CVKA 2NSBA 1HX1A 1KP6A 2Z1HA 2CWXA 4CD3A 4RWXA 4WP9A 3M8PA 2QWPA 2ZE2B 2OPQB 4LQ3A 2DVIA 3N4QA 5KG5A 1D3WA 2PFUA 4JI1K 1KAZA 4RBVA 4OX8A 4AE5A 2HRUA 4Q44A 3DOMB 4QIGA 4I68A 1T8EA 2GNKA 3M2UA 2VKRA 2V2KA 4C8LA 2WSEC 4BRLA 4BRAA 3PJ9A 3QLHB 2YX4A 3M8WA 4QWAA 1Q8IA 4WE1B 4ZITA 3NRBA 4JYAJ 1J5EK 4DTNA 4NLTA 2WCXA 4PG5A 3OR1A 2V8VA 2HS0A 1P1TA 5AQZA 1FO1A 1Z2ZA 3HRGA 4WTYA 1FJEB 3PYDA 3VQ9A 4OQJA 1XEZA 3KK3B 2QX0A 2HHHJ 3E66A 4DR5K 5L1IA 1FW6A 3L3UA 2HVIA 3KUEA 1APSA 3VEXA 2I5JB 2ZM6J 1NGAA 4JHDB 1RTZA 3DFEA 4A62A 1T9TA 1WHWA 3TSQA 1O0PA 3D6FB 3CJ1A 4A8WA 2RF2B 4CGJA 2P9PA 4O5BA 5CHCB 4IG0B 3SXLA 1VQMS 1F2HA 2XMTA 4BDZA 4R8UB 4DR2J 3AVKA 1TKXB 2L9NA 1SH2A 1NPPA 4RNHA 3AARA 1JNZB 5CA5A 3AT1B 5HROA 1K8AT 4X84A 2HLUA 3IP0A 1VQKS 4IOXA 2XULA 4HTIA 5C25B 3TA1A 3QFWA 2VU5A 2HW3A 4EP4A 3RAMA 4DV3K 4NI2A 1Y00A 3C15A 3SUPA 5KFPA 1WSVA 3CC4S 4ZCIA 1QTMA 2W9AA 2CPEA 5C24B 4RW4B 1KQFB 1M1KT 2KB2A 1BQMB 3KDNA 4NZ7A 7FDRA 2BOAA 3QWPA 2OFGX 2IJFA 3VV2B 2VPWB 4IFYB 3A8KA 4DU8A 4U67L 3TI0A 1EKEA 5LL6Z 1LWXA 3KLVA 1RAGB 1ZAVA 2UU9K 2QFIA 5GADI 3CJ5A 2XMVA 1RHQB 4BRFA 1DQ9A 3A4TA 1YBUA 5IV3A 4WCEL 4B1VA 5IT9U 2OPSB 3T1AA 3CCJN 3LOUA 2N4CA 3K7RA 2YWWA 2NYIA 2YH0A 2IVYA 1QHAA 1MN7A 4RU2A 3KJVB 2ZWOA 3BGRB 1FEHA 2HG4A 4OI3A 5FDLB 4NXMJ 4U96A 2QFJA 1T05A 3NF9A 3VERA 4FVUA 1U45A 4RZRA 2NUUG 2LMIA 4HHHA 4HVJA 1HNVB 3U1LA 1PC4A 3W0LA 4DTMA 1AFIA 2QA4S 3OVBA 2G8UA 5HQMA 1RHMB 2LDYA 2ROEA 3B8AX 1VAZA 4O44B 1NEEA 2RUGA 4FWMA 4FF1A 1U02A 3C6UB 2UXBF 1OQ3A 1SIWB 2KM8C 2NRXA 3MMAA 2E5LK 3HHLB 3RBDA 2HF3A 5CZ2A 1A5WA 3LA0A 4Y2AA 3Q2SC 4HH0A 1HPZB 4XAKA 2O8FA 1HBOA 2WHOA 4M63A 1X4FA 4ZP7A 1X4CA 1RBSA 2XSFA 4BC7A 1BY9A 5D15A 2ZITA 4LT6A 4DSLA 1YAGA 4DUYF 1YX2A 5C2DA 3QDKA 1ZAXA 3DLLQ 5C5JA 2ATCB 4PG4A 1TL7A 5AQKA 3ZFVA 1TUYA 1K73O 5A0YB 4KFBA 4CHYA 5D6GA 1ZZNA 1XNQF 4AXIA 4DL2A 2FHJD 3AY0A 4YQWA 1GNKA 4CHPA 2AMCB 2CDRB 5B08A 1JLEA 2KDOA 3CJ3A 1TV6A 2WVEA 2AYBA 2EBGA 1WDTA 1AUDA 4LSLB 3E8OA 1NK4A 4BE0A 4BR7A 1RBOB 3O5TB 3K0JA 3KDOA 2RE1A 1FRIA 2VQFF 2ADBA 4JOUA 1MROB 1CULA 4QIFA 4C0OC 3RAXA 4IO9L 2HQDA 3K5MA 1W2BR 3R2DJ 2YHWA 2V4RA 2JEIA 3CQYA 3O9SA 4HACA 1RWKB 1MG7A 2CH5A 1K9MT 3IWNC 2F4FA 2NR0A 2G8HA 3PX4A 1RWNB 1IN0A 4USJC 2C1EB 1WSRA 3VALA 2PMZD 3VQAA 1BCMA 1GMVA 2W1BA 4K50A 5JICA 3TUZC 2H4YB 2FSKA 4B9NA 1N5SA 1NB2A 2POKA 4RUHA 5DG7A 1SV5A 2FUG9 3V2UC 3T9NA 2AD9A 3QGPA 2C42A 1TR0A 2MMYA 2CNKB 4NMXA 1F5BA 1HBMB 4ZVHA 2LEPA 3RRHA 1T9VA 4YB5A 5ETVA 1SUQB 1AT1B 4BQLA 1H2UX 4FF2A 1WHVA 2MJUA 2KZMA 2P9UA 1LV5A 5AQSA 4DTRA 3MMCA 1XR7A 4RTFD 1NLKL 3VAKA 4PYDA 3WDOA 3UVJB 3JSRA 4E19A 5HO4A 4JKBA 1JXEA 2GIQA 4UQTA 3VQEA 1FT8A 1S6PA 4X64K 1B0VA 3EDRB 1TYQB 4M3UA 4DWIA 2H48B 3DWLA 4B3RJ 1YJ7A 2WOMA 2W7PA 3W8GA 3FZMA 4HTUA 3OPKA 4MJKA 3I33A 3EDQB 3DRSB 5LMNJ 4JD2A 3J80U 4FK4A 1WG5A 3EGWB 1NHUA 2O5DA 3OYNA 1RBUA 3G86A 4UZBA 2ZJRQ 2QA4N 3ZX3A 3QQCD 1RT1B 2GMLA 4NEYA 4KC5A 2NXNA 3HKZD 1AYEA 1XQIA 3GCXP 1BI4A 2B43A 3DJCA 4K59A 1Z1ZA 2HZAA 1JLQA 2KL8A 2HMIB 2MKSA 4WFBL 2BQ3A 2VPZB 2UXCF 1W7AA 3NGIA 3D0PA 3CIZA 2J4RA 4LF2A 4DV2K 2J0SD 2WSCC 3P39A 2DXDA 2GGPA 1WOSA 1VQ7S 3ZT2A 3RB6A 2A3ZA 4DV0F 3NMRA 2GZOA 1N33J 3KTQA 5BR8K 1U7LA 1RACB 4IBNA 3JB9k 2CXEA 3AVHA 1X4DA 3I31A 5GADU 2CQ2A 4FJ7A 3IBFB 3RVCA 4O55A 3GWCA 3HFZB 1PIEA 4DQQA 3QESA 3PVXA 1X4HA 4N47A 6FDRA 2ZHAA 2UUAF 2DGXA 4F50A 4HWIA 1WAFA 2BJ1A 4OYOA 1I1GA 2IY5B 2OPRA 3EE3A 4RW8B 3T5KA 4MK9A 3LTOA 3UN2A 4NL5A 1XR6A 1C4CA 1YJNN 1TUUA 2HFNA 3MCPA 2FGOA 4ZCLA 1OVYA 4Z2XA 3IMQJ 4CLKA 3B82A 2JEFA 3KIOA 5D4OA 1DKGD 4IDKB 2AZ1A 2DHHA 5KG6A 3HM9A 3JXUA 2XNQA 3WNHA 5HRSA 5CHIA 4NXNF 2X1AA 2OHDA 1SC4B 5ADXH 3W65A 1URRA 1DTTB 2GHPA 2W25A 1N32K 2KH9A 3CULA 4JK9A 1S5JA 3HHNB 1CJVA 1JLBA 1HLUA 1EIYB 1WLJA 3GCWP 4TU8A 4NX9A 5EOYA 2Y1RI 3O4NA 3ZT0A 4HH1A 2DO4A 3A2FA 4CTAA 5J2QB 2XTJP 1YVNA 1OKJA 3OXLA 3MN9A 4LUBA 4G1QB 4ID5B 4LJMA 2FLOA 2HVZA 1RWUA 2PT0A 4JI8F 3G8SA 4ZCKA 4FKXA 4ITSA 4KHNA 1MMDA 3FGVA 4UT4A 1BCOA 1WSJA 3H4DA 3QBCA 3OTEA 1S1TA 4CW7B 4FJKA 1TKZB 1WACA 3P8BB 1RT5B 1HNZF 1N0UA 4ZPCA 1N56A 3ISZA 4M5IA 1RXOB 3CG7A 2R8IA 2D74B 3R97A 4KPYA 2FBVA 4ZLNA 2APOA 3VAGA 3GB0A 4GVBB 4IOAQ 3CW2C 1VRUA 5HMWA 4V19X 3HKWA 1I94F 5AQHA 1HWIA 2P9LB 3GYXB 3RW6A 2BW7A 4Z4CA 4NYPA 4DV5J 4Y28C 4Z0UA 4ZMMA 3V9ZA 2FHKA 4LFCF 1K8AO 1EETB 2YKMB 4OLAA 2K1RA 3V1RA 4YDUA 1HQEB 1W26A 4DS5A 4CJRA 3BB5A 3NCRA 2V63A 2PZSA 3ZEUB 4ECWA 3LPYA 2VG7B 4ZVUB 3TW0A 1KNZA 3EVWA 4RLEA 3OS1A 4O4GB 2HWTA 2HBKA 4AHSA 2VCPA 2YHAA 1UZDA 2W7OA 1JLAA 4LFAF 1M1KO 9RUBA 3VQ4A 3CJKA 1G4CA 4Z7CA 5HBMB 4DU3A 1NU4A 3DGPB 5LL6d 4A8KA 4E3SA 3RR8A 3B6OA 3MPUB 2W9CB 3MUVP 3J7ZT 2KO1A 1RU1A 3D66A 1T9XA 3LPTA 5FLXO 3NBPA 1VQ7N 4BRHA 1HNWK 2G0JA 5E3CA 4CK2A 1X60A 4OI1A 1HYZA 1KQGB 4F26A 1FWPA 3HSJA 1NKCA 4DLEA 1I3OB 4X4QA 2WONA 1ZM2A 1PGZA 3KHYA 2H4WB 1LWFB 2GS8A 3SV4A 1YITN 2WB1D 1PJ6A 4WQ5C 4FJMA 2MSSA 3CHWA 3ZX0A 4FZZA 2ZZMA 5M1FA 2DGSA 5DJBA 2MGZA 3DLRA 4NLRA 1U09A 1L5UA 2OFHX 5JVHL 1GLBG 3ZSXA 1F2GA 3AGKA 2LA6A 4IFVB 4ED1A 1K1SA 2NXJA 2WVBA 4IG3B 2XMKA 2D9OA 2OEJA 1S3XA 1KFSA 3U9ZA 4C3KA 4ZK7M 2RMLA 2ALZA 1NGJA 3O9TA 5F0UA 1CEZA 4CLZA 3C6TA 3AV9A 3D6TB 3GR1A 4CEZA 3D5MA 3SFUA 3GQCA 2GC8A 4PUOA 1BXNA 1KSPA 1F9HA 8ATCB 5LSLA 1LAVA 3HBTA 3TABA 1FD8A 2DNGA 3QJLA 4FM1A 2QMUB 2P9IB 4CECA 1TVRB 4IZ9A 4OJ1A 2DR5A 4BDYA 5B0EA 4I2QB 4L74A 4X65F 5BPNA 1IJJA 1AW0A 1F3FA 4NLDA 1HYVA 3SYZA 1Q8KA 4GVEA 2NRVA 3WNFA 1C4AA 3DN9A 5L38A 2UXBK 2ZDPA 5KFMA 3U7JA 2W8KA 4C8OA 4DTJA 3IR6B 3L7OA 3DDIA 4KO0B 4CZLA 2MZQA 3T6JA 2FY8A 4E7LA 4K8RA 5CYMB 4OYMA 3CC2S 3KLHB 4CIFA 1VQ6S 4DSKA 3CDUA 1NH8A 4K5RA 1NK7A 4NCBA 4FJHA 1RDAA 2C22A 2E2QA 1U1LA 2M2BA 2Q1NA 4QS8A 3BEGB 5T7LA 1YIJS 4GMKA 2A1SA 4QAGA 2C2ZB 1YRUA 2QWLA 4DUYK 1BU6O 3BSAA 2V2ZA 2WK4A 4JI6J 5E3AA 2O8DB 2QEXN 2L08A 2IVPA 3LANA 3MAQA 4LF4F 3EICA 3CDBA 1EZZB 1S10A 1GMWD 4JV5J 3MEDA 3G2XA 2PFFB 3I0SA 2IDEA 3LGMA 3CCUS 3BEXA 2Y3YA 2ZBRA 1Q79A 1VHIA 1S22A 1L3UA 4OYAA 4DR3J 5AR0A 3V81A 3KK2A 3OL7A 1I51B 2IBKA 4BGBA 4KGXB 2B8QA 1HJOA 2GELA 4DSIA 4PKDB 1ZBSA 2P2CB 2W4CA 1DY3A 2XLJA 4U67Q 1L3VA 3I87A 3J81j 4FYXB 4FWPA 1RLDA 2ZNZA 1TFWA 2EXUA 3E1YA 4NWBA 3UO0A 4OHYA 2EBEA 2I1RA 4OO1J 1XMQJ 4BY9C 3MR7A 1JJHA 1IKYB 4JI4F 4O5FA 2OMOA 1HD1A 3D67A 3BN7A 3KLIA 3S3NA 4P73A 4B9TA 3K2PA 2IM1A 5HATA 2MQQA 4FJ5A 2NXUA 4Y2IA 1JLCA 2KHCA 2ZJQQ 3VQ7A 4ICLA 3IMXA 2ZD1B 3OVNA 4M5GA 1HL6A 4YEAA 2XGQA 4AM6A 3R5JB 3GSIA 4MIBA 4CZMA 2X6SA 2W2PP 2KQ2A 1MWKA 3PJWA 5G0RA 3AFGA 3FCWA 2PSZA 3MXMA 3MOZA 1UAWA 1SIZA 3K89A 1DQ8A 3DOLA 2DNPA 2FJBB 5HJYA 1YGYA 3M6XA 3ZSWA 5BN8A 3DYAB 3VAHA 5F41A 1YJWS 3AD8C 4LF5J 3AODA 4W5QA 3SUNA 4KHUA 4DCHA 1FTRA 4JV2A 1U8SA 5KQDA 2E66A 3L2WA 1VQ9N 3AJ2A 4NZ0A 4FF3A 2H3GX 1IVZA 2CIMA 4I2PA 1HMVB 1IBLF 3ENVA 2C3OA 4PG8A 2CPJA 5KT2A 2YBVA 3VA3A 4BRKA 2YKOA 3ZTSA 3WQTA 1YHQS 2NLWA 1LNQA 2PA8D 2UXCK 1V3SA 1IR2A 4U8VA 1UJ6A 1X3NA 3EO3A 3DRYA 1JCGA 5JS1A 5B7WA 2D4WA 4PY5A 1D9AA 1VJWA 2DGTA 4ID8A 3C3LA 3OS2A 2KM8B 1XC9A 4WFXA 5D0EA 4PZVA 3UD3P 3M2VA 1SJ3P 1EB0A 2QIFA 4RU9A 4F04B 4DV0K 3D1HA 2VZ9A 4IG0A 1VGYA 2HAIA 5RUBA 3WZ0A 2RDJA 2LLZA 2CH6A 1FNXH 1WKLA 1WUAA 5F3ZA 4R8UA 3I9ZA 4FVMA 5H1SV 3FBFA 3S41A 5IQQA 2YX6A 4E1JA 2AF6A 2K7JA 2UUAK 2HRTA 3ISND 2I8EA 4AHUA 1VS3A 2CYYA 3DLJA 4FK2A 3MCOA 4M95A 3O1BA 5C25A 2DGWA 1Y3KA 5DZ6A 5MLCV 1OPZA 3O4QA 1XJWB 4I0WA 3I56S 3C16A 1C0TA 2Y0SD 4QS9A 3H90A 3BYPA 3N4PA 4Q43A 4RW4A 1P6TA 3VGMA 1BQMA 4CF1A 4J9SA 3K57A 4NLBA 3SBTA 4NXNK 1NAQA 4DI6A 4JI3F 2UVWA 2OAUA 4B1ZA 1WKKA 2A10A 1GX5A 4HT7A 4CERA 3D28A 4OV6A 5DGBA 2G8VA 3JAMU 4AF1A 4LFBF 3WXKA 1ZM4A 3WUHA 1S0OA 2VJVA 1MW7A 2OIHA 3GJTB 1HNXF 1KHVA 4KQZA 1D1UA 4MIWA 3OW2R 2AKWB 1QTNB 4J91A 4H5VA 4U7UD 4L3NA 4BRPA 2DY1A 1H7WA 3KJVA 3OD2A 2F4VK 5DG8A 2DK2A 2GVZB 3CM5A 3F73A 4ERDA 2GO9A 4JI8K 4BACA 1RT6A 1G3OA 2WBMA 3THWB 2Z2ZA 3QT5A 1S5ZA 3TUIC 2CKWA 3EKSA 2R7RA 1Q82T 1HNVA 5AJ3J 1DFDA 4KR0B 2ZGZA 4QYRA 4X4RA 1EX4A 4PXEA 1HNZK 2R7XA 4O44A 3I4HX 2R7TA 3CCSN 2DNLA 4P74A 1VQ5N 2R42A 2NXCA 3P3DA 2C2KB 4WFBQ 4V19J 2BW2A 4KGKA 1AB8A 3VQ6A 5DRKA 4OJ3A 4PG7A 2XGPA 2GJIA 2YV0X 3DXKB 3JS6A 3AO3A 3PCOB 3P4UB 4BHQA 1I94K 4K7QA 2VBZA 3OTOF 5AZJA 3M30B 3MPYA 4ES3A 3DNCA 4MH8A 2EKNA 2UUBK 4KPCA 2F8MA 4LFCK 5A2QU 4EEYA 1RT3B 3ZSVA 2VONA 1SVDA 2P51A 1UP1A 2W2QP 3KHGA 4GY2B 3WXMB 5I9EB 3TZWA 4URSA 2D0CA 4OZNA 1S9EB 1N8RT 2E6MA 4H4KA 1RTDA 4N41A 4ISFA 4C1NI 3AHPA 2HRYA 4EAHD 4WKYA 2DXEA 2LU2A 1JNRB 4LFAK 4OLPA 1IQTA 4FL9A 2P6SA 3HSTB 1HW9A 3ADAC 2HFVA 2FGCA 2VDIA 1Q78A 5C42B 3D54A 5KFNA 4ZA1A 5AQGA 5EHHA 2CPIA 2CJKA 3NS5A 1RT4B 4LBIA 4DJBA 3AOAA 2RKIB 4PL7A 3CNQP 2NNWA 3B4DA 2Z56B 5DM6Q 2MJNA 1SH0A 2ASOA 2R2TA 2JLGA 1E4GT 4C2MA 4LF9J 1BIZA 3GR0A 3M8YA 1SS6A 5K5MA 2HZCA 2DHAA 3FJ2A 3QSYB 1H38A 1WC3A 4YB1P 2DB1A 3O9QA 4Z4EA 2DCUB 1UEKA 2EFNA 3KK1B 2M70A 4HHUA 4DX5A 2MHEA 4DX7A 5ETTA 5FJ4A 3OYAA 3RW7A 3EWGA 3C95A 4WXWA 5J2NB 1JK9B 2GFFA 3L2QA 2YCHA 3W64A 2BV3A 2I7PA 4DR5J 5JUMA 2DY4A 2RPIA 2CRLA 5KFOA 3DLEA 3BGFA 1SUQA 3OT9A 1RGVA 2OZSA 3MM9A 1VLOA 3VQCA 3U3GA 3CI5A 2OPPB 4ZVSB 4BC4A 5CXTA 2ASLA 1RAJA 2OTLN 2AJ1A 2ZVIA 2XWXA 3MWTA 5AXNA 1FJ7A 2MZ1A 2V4JB 1N36J 4H4OB 3S3OA 4ZP9A 3QFHA 4FXDA 4DU1A 4ANEA 3BQ2A 1LKZA 4CM2A 4Y65A 4H4MB 5K8MA 3NWGA 5ETLA 3M9MB 3VQQA 1HKGA 4X65K 4KGMA 3TX0A 3GTYX 4IRDA 3ZETB 2VICA 3CJ4A 4UY8T 5AXMA 1N88A 4RBTA 3OBWA 4NCAA 4OHZA 3W5XA 4B9UA 3I0RA 1BLUA 2DNRA 3VPZA 3THVA 2OZMA 4DV3J 4C8NA 2DIVA 2V51B 4MKYA 4ZDNA 1LOUA 1RTJB 1V4SA 2V7YA 4NA3A 4K4UA 3ENWA 2XI3A 4NASA 3LZIA 3AVMA 3LW5C 4B3MK 3CJ0A 4RUBA 4KB0A 4JB8B 2LQ8A 2LXFA 2Q97A 2JWLA 2O4GA 1QQNA 4QU7A 1IWAA 2VASA 3OLAA 2Q43A 2E1PA 4FO0A 4A4JA 3DI6B 2DISA 1D5AA 4FLXA 4WP3A 1VQOS 4B3OB 4H54A 4DSJA 4M45A 5H9EK 4DV7K 3NCQA 5IM0A 2LA4A 4GKJF 5I42A 4LF4K 3T41A 5K8NA 1RKJA 5BN9A 4ZLPA 4OGCA 1FKPB 1X5TA 2VG6B 1FJCA 3F44A 4EGLA 4PG6A 3PIOL 1M1HA 1CPZA 1VQ4N 3CMAS 1DJ0A 4OJGA 2JWKA 4V1Ak 4Y1CA 3BN4A 1OYDA 4CFAA 5GAHP 3TWHA 4Z4HA 1S1UB 2VOOA 1S0VA 3QAUA 1W9HA 4OLBA 4FPAA 3F0NA 4IRKA 2Z30B 4EBCA 3KG4A 4W5NA 1Q0NA 4WF9Q 1R3NA 4MYUA 3CCLS 5JVHQ 3G96A 2Q6CA 2E5LJ 4DS4A 5FPEA 3KYLA 1Q86T 1YTYA 3CCRS 3CCQS 4BRCA 4IDKA 4CYUB 2CNNB 4M41A 4BG8A 1N6QA 4DQRA 1UKUA 3TAQA 5AFUA 2AA4A 2HBMA 3THYB 3CCTA 2D0BA 3WEEA 4DPWA 1RBLA 4BWMA 1O1WA 2DBBA 3OHAA 3BF4A 2ZBIA 3FLCO 3OR2B 5KFHA 2E9TA 4ILMA 2VUGA 2DKOB 2QA1A 3I9V9 5EU7A 2FIUA 3CJAA 3MR3A 4ZVOB 2V34A 4CK1A 2Y1LB 3L4QA 1GOCA 1CVJA 1YK9A 2UUTA 5A6PA 3HHEA 4CZHA 2BRLA 2CNLB 3M8QA 1Q8LA 1KCFA 5JXSA 2PYJA 2GV9A 3MR6A 4CBWA 2A40A 4OHVA 3DRPB 1RT5A 2BRKA 2P1JA 1KOOA 1PBUA 3CE8A 3CO0P 2XLIA 5IXUA 4QW8A 2IIHA 4CE9A 1Z4UA 3GP9A 4J9VA 3AB2B 3AGRA 3HPHA 1VQNS 4WQ4A 1RU2A 3V6JA 4YHHK 4YP3A 4Q0BA 1N5YB 4ES2A 4Z4FA 3FZFA 3GE1A 2RU3A 3HXMA 2P9LA 3IRWP 3CD5A 3EN9A 3J81Y 1ATSA 1IKVB 1QSLA 1RCXB 4X66J 5AQQA 1IBLK 5KT7A 3Q89A 3QYYA 1O51A 3LZJA 5GMDA 4DR1F 4L6V3 3SAHA 3OV7A 3N79A 3L95X 3MURP 2DHGA 4BS2A 2W01A 4O4GA 3IBCB 3VVUA 1B7FA 2R7YA 1GLLO 3OVAA 2BJ3A 3FBCA 4FN5A 4X62J 1SL1A 4P9SA 5HLFB 3H20A 4MQ3A 4USIA 3GG0A 1HWJA 1NSPA 3DGPA 5E3RA 1KBRA 4OYZA 1X5SA 4CF8A 3TR8A 1M5OC 2HHSA 2DPJA 3LUYA 3U4LA 3TSUA 2FVRA 1NGBA 4DTXA 2BJ7A 4CI6A 3TOQA 4TY8A 1X31C 3CQ8A 2BUNA 4BE2A 2KN4A 4PQUB 3IC1A 5CZXA 1J53A 5D4NA 2AHOB 5D3GA 4I6WA 5ELZA 2BEFA 1J27A 1FFSB 4P2MA 1U1RA 5BREA 3OFFA 5AE2A 1ULRA 4HI2A 2I7NA 5DMRA 3RRGA 2HNZA 5J2PA 4DR7J 3TAMB 2J9EA 1D09B 3PYEA 1QLNA 2QJ3A 2ZH7A 1NJIO 2CPZA 5C12A 1JJ4A 4FF4A 3A5NC 1QAXA 3EEQA 4JI7F 2EX3A 2IOCA 2CQCA 1ZTWA 4JI3K 2HVEA 3D2EA 3BDEA 1UVJA 2QKKA 2Z2MA 1Y64A 3PYGA 2QI2A 3N9UC 3QBXA 4CJFA 5DDRC 3JYTA 3BKUA 4F36A 4BG9A 3NL0A 4JI0F 3AD9C 2YNIB 2LDIA 3BGOP 4LIRA 3R5GA 3VF0B 5B0DA 4U7UK 3PHTA 4LH4A 1HNXK 1X4GA 2B5JA 5A8WB 2N4DA 5IC6B 3UDVA 2A3JA 3SCXA 4X4SA 3SMSA 4CEDA 4S0MA 5BR8J 1IKXB 3R7BB 4FJNA 2X1GA 1MMNA 5HSPA 2BJ8A 4LSNB 3T9ZA 1TVRA 3L8BA 3H1VX 2Z1JA 4I2QA 4Z94A 1E6YB 3FZLA 4M3TA 4O3SA 2RDIA 4DCPB 2GX8A 3DM2B 4CLLA 3ZZUA 5K14B 2LECA 2YH1A 4KY3A 4CK3A 5ETQA 3PIPQ 4JAXA 2YKNB 4ZHRB 1L3TA 1JX4A 4KO0A 2QLWA 3MR2A 3L7PA 4L76A 4KE5A 2FBXA 5DQGA 2QLXA 3A8YA 2W2OP 4BC5A 2Y8WA 2B56A 3NGTA 1YUWA 4F3TA 3LH2S 5AXKA 2G4BA 3Q0AA 4IR9A 4RCHA 2PAVA 3VMFB 5CCLA 1N32J 4QU6A 5AQFA 3AVCA 2CG8A 2W41A 4A59A 1FDBA 1NMNA 2KG0A 1DZ5A 2A1BA 1KONA 3G0ZA 2O8DA 2CPXA 4DPXA 3HT3A 2XHWA 1XMOJ 2O66A 2RQMA 1RBTA 3TANA 3ZSQA 4G9ZA 3ID6A 2YNHA 5FROA 2Z2LA 1TL1B 3ETOA 5LM7E 1S72N 3MWPA 3LQVA 2ERRA 3SI8A 4CEEA 3T3FA 2HBZB 2CWKA 2JZ5A 1VQPS 4I6YA 3UB5A 2IA0A 3N5BA 2HVDA 2A2DA 4M5NA 4J2BA 1RWWB 4OYPA 4I67A 1RDBA 4B08A 5EVZA 3MMBB 1X9MA 1FVQA 3O5BA 1OY9A 4RNMA 3A8JA 4NLCA 3ET6B 1S1WB 4ELVA 3QGGA 2B9EA 3S01A 4KB7A 1OQ6A 2Q3PA 4FM0A 3FFIA 4ILJA 3F2KA 1XQSC 2QMWA 4A47A 3CM6A 1O5JA 1H7XA 4OI6A 4F0HA 3POTB 2FF6A 2DD8S 2EG2A 4UY8O 3JTOA 1UFWA 3T1YK 1NG9A 2IIRA 2ZOGA 3CFOA 3QEXA 1SQEA 3VTHA 2BQRA 2KHOA 1HYSA 4HL9A 3EVMA 1FE0A 2X3GA 4C0HA 2F9TA 1B0PA 3HVTB 3GLJA 4DFMA 1WF0A 3O9RA 1P9QC 3K9JA 3M1VB 4F25A 5JS2A 1XNRF 4CLPA 1TP7A 2HHHF 1T95A 5LJVA 4Y00A 4YY3K 2ZNYA 3W63A 4JKEA 4CZGA 1U6ZA 4TSXA 2R8HA 1IG9A 4I69A 4ECVA 2VBYA 1HKCA 4OIXA 5I3QA 2ROGA 4MTPA 5GAHI 3BF3A 2E7VA 2E1RA 3QMQA 3T1HJ 1NK8A 4DTPA 2BE7D 3QETA 5J1PA 3NS6A 2HHUA 5F2RA 3K5NA 4QWCA 1RDUA 2GWJA 4U7CA 3D2WA 4C98A 1U1OA 5A8RA 1C0MA 3U02A 3G10A 4DR2F 2PIIA 4IUFA 3QPIA 3IUCA 2HF4A 3MMVA 1F9EB 3NVMA 2NXEA 3TJ8A 5IT9Y 2E4LA 2J9DA 1PJ5A 3C8YA 4J9UE 3BKTA 3CJTA 3RU0A 2WTUA 3QT6A 2WC9A 4MDBA 1VQLS 2PDAA 5HL7L 4XH5A 4FLWA 1HMVA 2QLBB 2E5GA 4CD1A 2XO7A 5K20B 1RTIB 1HBNB 3OBIA 4K4YA 4IO8A 1KTQA 4C11A 4DZ6A 3IG1B 3MD3A 5L39A 4AL5A 5F0WA 4M42A 2YKAA 4AT1B 4Y6IA 4CNYA 1KVKA 3DXMB 1FTCA 4K0KF 1BMQB 4M5DA 4NRUA 2GX9A 1IM4A 3LWMA 4RNNA 5CZ1A 1CXUA 5A76A 1S76D 1DT9A 3SNNA 5HOOA 4JI5K 3VAIA 3GIIA 4GKJK 4MO4A 1BL3A 3FEXB 2ZUGA 4I6AA 1Q7YO 5LMUF 3CGIA 4MK7A 3CCMN 3J7AP 4WFAL 3R7NB 2B6AA 4TXSA 1MNEA 4A8OA 1H72C 3VQSA 1FESA 4NLUA 2CQHA 4F3OA 1IH7A 2CA9A 2LQ9A 4C3LA 1TGOA 1Q18A 4ZPVR 4P2FA 3THPA 2J7WA 3UNGC 4NA1A 1S99A 2BKPA 2K3KA 5M2PA 4ZN1A 2RVJA 3H08A 4J9LA 2D0AA 2UXBJ 1YBAA 4OHWA 2LXUA 4LBHA 1CJUA 4LF8K 1RCOB 3U8XA 3ULEA 4ZIWA 3ZTPA 4QCLA 5HK4A 2BJEA 3GJSB 2P9KB 2BTFA 2ETJA 4AM7A 4K4SA 5EUHA 2NZ4A 3BZCA 3KOAA 1MU2A 2AV5A 3M1FA 4JI1F 3D68A 3WHIA 3C7NA 1SXLA 3H8YA 4CNZA 5JLFA 4DUYJ 1OY6A 4KBIA 4RG8A 3DU6A 4UUWA 1BOTO 2FHMA 2G2OA 1R0AA 3AAWB 3GIRA 2MQ8A 1U48A 1J5EF 3SQ4A 5A8KA 4YDDB 2H9ZA 3C2PA 4FWRA 3GG1A 3NF6A 1XNQJ 1TTHB 2O8EA 3RB4A 2JHEA 3KMQA 3K17A 3QT8A 3NE6A 2BE9B 4LRFA 1Q7LB 2MLYA 1N5QA 4NYZA 1X7VA 5EGYA 2VQFJ 1M5KC 3BO3A 2GMJA 1CC8A 3V5RA 1VBKA 4P75A 3AVBA 4FYWB 2B4JA 4G1IA 4CF2A 5EX3A 3LP1A 2P9CA 2JLFA 4K2JA 1K0VA 2DH7A 2L9DA 3LPUA 1Q81T 4CLUA 4EMDA 1ESVA 5D78A 3VAJA 4R0EA 5H1SQ 1RB0A 2CADA 1GTEA 2N7YA 4RO0A 4GKKF 4DR1K 3BO2A 3CFPA 2ZC3A 2GCFA 4ED8A 3OXFA 1UL3A 3PIOQ 1EWRA 1FVSA 2ITMA 1EO1A 3PSIA 5MLCQ 3EGVA 3OHBA 3R3LA 2LQJA 3PRBA 2BGGA 3AJ1A 1C0GA 2HNDA 4L73A 4KIAA 1JKHB 2OA8A 3PHEA 3W8PA 4CM0A 2D9PA 1RWMB 2FTRA 1TFYA 1UWBA 3PJXA 2EC2A 3VGTA 1K8KA 2CJXB 4JI2F 1N52B 5AXLA 3FRYA 2FJXA 4DFJA 1J5OB 4CH7A 3MEGA 1P8GA 1A6LA 4M3YA 2LEAA 5AQNA 4JKAA 3AVIA 4WFNL 4CP5A 4F4XA 5AQOA 2RQKA 4I6MB 3Q8QB 4LD0A 3OJUA 2CNOB 3M8ZA 2ZJPL 1QAYA 2OEMA 3VN5A 3K8VA 4B3RF 3QAEA 4OPKA 3QIPB 3KLEA 2VH7A 2CUYA 1ATNA 3MECA 4YB6A 1Z26A 4C8MA 4B1YB 3OJSA 2J0WA 2EVZA 5CZVA 1JCEA 4ZPBA 2DNKA 3QATA 4M7YA 1HLWA 1N34F 5GAHU 2CDQA 2NUBA 3K58A 3U1MA 1ZETA 2W4PA 4F0KA 2EWSA 2BKNA 5HAOA 4ANDA 2MQMA 4HUFA 1R27B 1S1VB 4ELUA 2AJ2A 4JI7K 1OMSA 2UXCJ 5I4MA 2XWYA 1S6UA 4ZVQB 2W4DA 4B02A 1NJYA 2EEYA 4R5PB 4C8YA 3VOVA 1ZM3A 4JI0K 5D4LA 1K47A 1LAWA 1GT8A 3EXCX 2O8CB 1CZBA 2XSJA 3L09A 3VWSA 4EZ9A 4H03B 4NLYA 2F8HA 3BBFA 3AO2A 4JKGB 2HHWA 2VWBA 3CJBA 5AQJA 3TPQA 1VRTB 1OH5A 1D4XA 4ID1A 5THWA 4DCJB 1ASVA 1LW2A 2HHVA 4K43A 3NEKA 2ZBQA 2M9KA 1B4SA 4K2XA 1N33F 1K1QA 2AU0A 1QSYA 3KNAA 2JEJA 2UUAJ 1LWCB 1BGXT 2D7SA 3RGIA 1EJ7L 3D0HE 4DTUA 1C1CB 3IRXA 4Q2MA 3IS9B 4NYOA 3VAFA 5E7OB 2HNYB 1Y5LB 3R8YA 3THTA 4U6PA 4IOBA 3V4IA 4Y0FA 1BIUA 4U95A 2YKQA 3HPGA 4AFFA 4XDCA 1FE4A 2DTJA 5IZHA 3NLCA 2WAQD 3FBBA 2CQDA 4NXNJ 2H54B 4TY9A 3TA2A 2OD6A 2D3UA 4WIIA 1RBRA 1NSAA 4LF6F 3UKUB 1UMJA 3ZZYA 5JLHA 4RBUA 1SAZA 3GIKA 4OI0A 3MN5A 3CCVN 3Q8UA 1U47A 2FBTA 1NPKA 2H65B 2VV5A 1U04A 4DUZF 1C0UB 2QA2A 3MZIA 1CJTB 2ASPA 2YI1A 1NJXA 4CGIA 1HWUA 5BRDA 1IKWB 4NLWA 2V5HG 2KFNA 4DB3A 2B3TB 2AWZA 3HSCA 1O8BA 1NSQA 2ZWPA 1BUPA 3F9MA 3AO5A 2XY7A 4JI8J 5F8IA 3WXIA 1WNEA 5IFMA 3FBEA 4OZJA 2CQPA 4NE9C 3NGUA 4XPCA 4CZCA 2DYAA 2ZF5O 4CGHA 2W7AA 3ZLJA 3DDNA 4CJPA 4R25A 3TAEA 1HNZJ 4QR1A 1QVFR 1NK9A 2E1AA 3KHLA 2I9SA 1WBDA 3O8MA 1WC5A 4J9NA 1YRXA 3PO4A 2FPHX 4TQSA 2JOQA 4B8CA 2JWNA 2MZSA 3PW2A 5DK5A 3ZX2A 3GE9A 4CIGA 4YOVA 3J81U 2D69A 1I94J 2GVDB 4CYUA 1SJ1A 4UOHA 1KVAA 3JSMA 2R2UA 3EGZA 2R2SA 2B4UA 4HHTA 4ZIVA 1QVGM 2BMBA 3HP9A 3AOBA 4AYBD 5L9XA 1QZ5A 4H0YB 4Y2CA 5AQTA 3KHRA 3UD4P 2A1RA 4IYQA 3W9JA 1WEZA 2BKOA 4ZS6A 2QXFA 1NU0A 1HARA 4I9QA 1XNRK 4LFAJ 3G8TA 2D0OA 4YOTA 2LVWA 1WUUA 2HHHK 3P31A 1CJKB 2KJWA 3E51A 5HRNA 1Z6RA 1LFWA 2J9DE 3TRGA 3UR3C 3MWBA 3T6BA 4J9QA 3EMTA 1WHXA 3UWTA 2Z1GA 2ZM6K 1C6VA 2WBRA 1RHJB 3CC7S 3LP2A 4DV2F 3QMLA 4DUTA 2R7UA 3DRPA 3W3SA 3HHLD 5HN0A 2P5OA 4CO3A 2NZTA 5CABA 3MDQA 3P5JA 3IAS9 1NGFA 4FPRA 2YHXA 4QYZJ 3LP0B 4ED7A 4YDUC 5M2RA 3F41A 2XHCA 1QZ6A 3CMEN 4DR2K 1N54B 1E4FT 5LSRA 1ZH5A 3TAGA 4BRIA 3O9UA 2QT7A 4ZPWR 1WNSA 2A2CA 2QMXA 2WBNA 5DDQC 2OTJS 4A5BA 3SCIE 4DFKA 1WSIA 4H8KA 1S9GA 4CO2A 3RB0A 4HTLA 4WKRA 1FK9A 5EWGA 4ELTA 1C0FA 3K5LA 4KHQA 1FXRA 3OVSA 3O1WA 1RJJA 2KTQA 3OL9A 5HJXA 4K0KK 3SPYA 4CJQA 3MI7X 3IO1A 1ZBHA 1ZBFA 3CPEA 3U6FA 4E7JA 1PJ7A 3CEDA 5CCMA 1WWHA 3BBCA 2E88A 1W7WA 1SBRA 2V4QA 3MAAA 1UVMA 1WC4A 4YOUA 2DPIA 5LMUK 5KT4A 4YB7A 2FD2A 2DH9A 1RNHA 1H2VZ 4ES1A 4ZKAA 3OYMA 1HJRA 1OPIA 1RT7A 3CSKA 1R89A 2KT2A 1JXLA 2M88A 2V68A 1S1XB 2Z2YB 1DLOB 1RLCL 1U24A 2Q31A 1EAYC 3PZPA 1AXQA 5CR4A 3MFIA 4ECYA 4FKYA 5IOLA 1FNMA 2P5GA 1RDCA 3VZHA 4DR6F 3D0IE 3B78A 1QD1A 2P5VA 5KFEA 5I3UB 3QBWA 3MCSA 5SZTA 3NGRA 4KHRA 1FEEA 1TZ0A 2UXDF 1FXLA 4FJXA 4CZKA 3ONQA 3PW5A 3LGHA 3VEOA 4PYAA 1VQ8N 1CS4B 1ZTTA 2L3MA 2VDHA 1W0HA 4NCGB 4PA1A 3HDSA 1T44A 1Q81O 2B4PA 1L3SA 4E7KA 5DDPC 4CEBA 5ETSA 3G82B 2CZ9A 3LF0A 3WBZA 4LF4J 1X5PA 5KFZA 4CEAA 2ZEJA 2G8WA 3IWLA 5J2MA 3M6VA 3WXJA 2J0XA 4DR4F 3MM8A 3DMJA 1TL3A 2VWJA 3NNCA 3AVNA 3QB0A 3H45C 4KV8A 2NPIA 2DNMA 1LQ9A 3C46A 1JWWA 2J7KA 3MEEA 1X0PA 2IC3B 3RZAA 2DNNA 3LAMA 2RUSA 3O2IA 1MN9A 4BROA 3KKRA 4HHJA 4P72A 3M8PB 2YKNA 2RAQA 4AHVA 3DC2A 4KH4A 5D0HA 3ZNJ1 2LXIA 1A5XA 4MKBA 3VQPA 3P4IA 1FKAF 3M2UB 5L9NA 3G4SS 1NKEA 3AVFA 3THXA 1HNWF 1U2VB 2R8GA 3O6WA 2E2OA 2EC0A 4P6QA 4IEIA 8RUCA 4OL8A 2HYIB 3EVOA 4JI4J 4GKKK 3AY9A 1HR0J 1N48A 3E9LA 1OO0B 5LXYA 1QSSA 2N3OA 3OR1B 2EHGA 5MAOA 4ILHA 5E0OA 2DRAA 1NBWA 2GIFA 5FIIA 2YWEA 3NCPA 4QOTA 1VR6A 2B4OA 2AT1B 3TUJC 4DPUA 1FNOA 1EWQA 2DNYA 2AGPA 4Q8EA 4MO5A 3SUOA 3S7RA 1ZPWX 2NUHA 2CQGA 2BE2A 2FVCA 3C65A 2G0CA 4N56A 1YXQA 3OBYA 1EXQA 4JI2K 5J1EA 1SH3A 4JUZA 1E6VA 1LK7A 3RR7A 4ISEA 4QW9A 3CUNA 1M1GA 1IJEB 1F1BB 4LR9A 2A6AA 4URQU 4XTTA 4Y1DA 3UE5A 4KKOA 1WORA 1B7YB 3A5OC 3G9CA 3MMBA 4CJSA 5F1XA 4FVCA 4H0XB 1Y0HA 4A8YA 4A8QA 3LDNA 4OYXA 2HGMA 3S8SA 2AJ0A 4K42A 3H4BA 1S1WA 4B3RK 3FUYA 3G71N 4O8KA 5B0BA 3FMWA 2GJFA 4K8XA 1BISA 1B64A 1Z2LA 1KC8O 2IMWP 4G3IA 4CHNA 5HROB 1GLEG 2QA4G 3O3GA 5DM7L 1N34K 3K8WA 2IM2A 1XERA 1IBLJ 4PXDA 4HYKA 1A9NB 2CJBA 4NI2B 3C15B 1SC3B 2XQCA 4WIQA 3BH7B 4M3WA 3VTIA 4L3QA 5F8JA 4LY7A 2P9NA 4FJLA 3L0QA 3W3DA 1F6TA 2XZTB 5E33A 2QL7B 4C23A 4HEA9 3ATVA 4PL8A 3Q8PB 1NKBA 4RWTA 5E41A 1PKUA 1YVFA 1TELA 2XMAA 2WVCA 4KGZB 1TKTA 3OFHA 3NCIA 3CT9A 4HTJA 4B3SF 2H1YA 4WK1A 5KTQA 1NSKL 2QO3A 4FPBA 3FSXA 3LPEA 2U1AA 2QG9B 2DJWA 3M6GA 2DNOA 4O0JA 1PYOB 2LFVA 2F40A 1HQUA 2XO6A 4Q5VA 3A0IX 2UP1A 4IWVA 4MLEA 3JAMY 3EXYA 1N33K 4IKFA 1T05B 1WN7A 3BO4A 5KFVA 3IR7B 1NK6A 3RG6A 4H0VB 5BYQA 4USTA 4O8UA 4ILLA 4U8YA 3FDSA 3W5ZA 2H5EA 2IS3A 5AQWA 3KD1E 5GMEA 1S6QA 4ECRA 1T02A 2ZZNA 2F9JA 2RB7A 4J5OA 1RWPB 4I56A 4Q2LA 5SWMA 3MMAB 3FNNA 1H0HB 1FI4A 1KEKA 3IG1A 4JI3J 3QJJA 2L41A 3WC0A 2A6OA 1SCJB 2ACYA 2DRBA 4LF6K 5M1KA 1VQMN 2CZVC 2O8FB 5C10A 4LFBJ 3DXMA 2IAJA 4D3GA 4DN9A 3CXCR 1T9UA 2AQ4A 4JRPA 2HSEB 4DUZK 4DG1A 1HNXJ 5B0GA 2W9BA 3BJYA 1NGDA 4J9OA 1TAQA 4OMFG 2D3O1 1VQKN 4F67A 3QWUA 2UVVA 3FEZA 2B7CB 2X78A 2C2EA 5IS2A 4NZ6A 4KFBB 4FLTA 3CJ9A 3CC4N 1WD6A 5A2QY 1YZ6A 2W6LA 1S49A 4FS1A 1TV6B 5AT1B 2E8AA 3GMGA 2I0XA 3AQOA 1WC0A 3M32A 2G2ZA 3NGKA 2HMPA 2E7WA 2QRRA 1KVJA 1CULB 3ELHA 4CEFA 3K59A 3NAHA 1NJWA 3M2RB 3OL8A 2AJQA 1RHUB 5E26A 4QS7A 3TUPA 4DL5A 1C1BA 1YF5L 5HI7A 4UUXA 1QE1A 2E5HA 4OX6A 2D1KA 4HACB 3OTOJ 1BQXA 2QW9A 2FZKB 4ZOSA 3AO1A 1SJQA 1YJ9S 2FJWA 2V2VA 3BGLA 1KD1T 4CZFA 4CJWA 3LDOA 1JL1A 2Q2RA 4PRFA 4C0BA 3C94A 1FRMA 3SK3A 3ENAA 3JXOA 2P9SA 2W2NP 4DV5K 2W8LA 2OLWA 1RDDA 1SV5B 3ZSOA 3K9KA 3OSPA 2VL1A 2XY6A 2KFYA 4OJRA 2GW8A 4MYTA 2CGJA 4ILRA 4IEEA 4GV6A 2W42A 4NLOA 1J2VA 4P2XA 5IQ6A 3KUGA 4MKAA 1NZ8A 2YNFA 1CZAN 1Y5IB 1CBKA 4DN0A 1DEJA 1JJCB 4C6AA 2YNGA 4C8ZA 2P9UB 2NZCA 1U2FA 2X6NA 3Q86A 3V9XA 2NS1B 4W5RA 5CD4A 2CGKA 4F4WA 4E0DA 2CVIA 1S6PB 1S7IA 2FVSA 1EHWA 5JVGQ 4E8UA 2F63A 4IDHA 5HP1A 2CZ4A 4CI0B 1RT2B 4CEQA 2C2NA 5IWAF 3AQPA 2KJVA 2ZWHA 1W2BM 2WOMB 4H4KC 4CBUA 4K8ZA 3J7AN 4PWDB 2UUCF 1ICEB 5CE3A 1NJZA 2E7XA 4JD2B 3D1QA 4M5LA 3QEPA 1Q5YA 4ZJQA 2V7ZA 1VSIA 2CQBA 3PUFA 1IJFB 3MM5B 1VC5A 4AD6A 2Q1LA 4JKDA 4ZTJA 3R5DA 5KFIA 3UDCA 4MFBB 1M5SA 4ENOA 4IH7A 4ECXA 1IR0A 3SBGA 2P6TA 4YOXA 4ECZA 4BE1A 4BREA 1MWZA 4H5RA 3NG8A 3TQEA 4NLXA 1AUSL 1UWAA 2HHQA 1GQEA 2YWGA 4AHCA 4CO5A 1ILYA 3QEVA 1Y10A 4Z4GA 3NNHA 3CERA 3IGVA 3AAQA 5ETOA 2RH3A 4H0OA 3MK6A 1J5OA 2WFBA 2M7SA 5DGAA 1B92A 1N36F 4I6MA 3PACA 5DDOC 6AT1B 4GVMA 1B99A 2OSQA 3S3MA 2FSJA 4PAAA 2FLLA 2F4VF 2JFKA 1VHXA 3QZ7A 1OJ4A 2IVNA 4QWDA 3WIVA 3TYTA 1Y11A 4DR6K 5KT6A 2OPRB 4O23A 1D0EA 4NLVA 3CTRA 3VHQA 1SC6A 2MKYA 2RRBA 1GMUA 1WJ9A 2HBYB 2HFZA 2BH1A 2RN2A 2UXDK 3PRVA 1N5TA 1OIAA 1XHXA 1RWOB 1NUEA 1TMJA 4MKVA 4DQ8A 5KFQA 4F4ZA 1SL0A 1WI8A 4KAZA 5KRSA 3MX5A 2GUIA 3DAWA 2Y9HA 3UKRA 5T41A 3OSNA 2HIQA 4AXJA 3CCES 4RR5A 2PBDA 3CMQA 4GV3A 2R2RA 3AVLA 4GKJJ 4LVOP 1QDUB 1CJVB 1JLBB 2V2QA 1DTQA 2UUBF 4R0JA 3N0VA 3EKUA 1PCAA 4HR2A 3AVJA 2IVMA 4LVNP 1NHVA 3A1YG 4DR4K 1SI9A 4C7QA 4H5TA 2XC9A 3AA5X 1HNIA 3BBBA 3SUQA 4AH9A 4W90B 2O4IA 3GL1A 2M52A 3QO9A 4FWLA 2RSQA 4DR3K 3D4JA 2BANB 3KLGA 4IQMA 3R1LA 3HP6A 4KSEB 2QN6B 5GIOA 1S1TB 2QGFB 1BUXA 2M3DA 1VDHA 1WSGA 3TWZA 4B9MA 2HQCA 4YMEA 1LCUA 5DG9A 2MPUA 4Y2MA 4DFPA 5BRHA 4K4XA 2GIRA 3A8EA 3PKYA 3FZ2A 2FSNA 1OH7A 1REGX 2KKHA 3W2VA 1RTHB 3W2WA 5LT5A 2MLZA 3W1YC 3DRRB 4F3QA 3I55S 1YRTA 2HHTA 3BV8A 3WNEA 5KGWA 4WK3A 1I3AA 4Q8FA 2V9KA 2WTFA 4EI2A 1F60B 3PSFA 3K2YA 1FJGF 4K25A 3AOCA 5BYSA 1C0UA 3BF1A 3WXLA 1WOOA 2K1RB 5C2FA 3OUYA 1FA0A 2ZJRL 5DLFA 5CYQA 2R7VA 2HS3A 1M5VC 1J9AA 3HOSA 3KLFA 2CFXA 3D6MB 1JJ2R 5AQMA 1H98A 2V69A 4PWUA 3KWIA 2DT9A 3OTCA 5LY3A 1JLAB 3C14A 3RYLA 3ITHB 1RDRA 1FX4A 4B1XB 1EQYA 4I7FB 2QV6A 4J9KA 4DV6F 3O08A 2IGIA 3CD7A 2XZDB 2FC8A 2DITA 3CB4A 4W5TA 2ZH5A 2G9OA 2V0NA 2YHYA 2ZH3A 1ZZFA 1Q9YA 3NBPB 3ENOA 5F0XA 3A3OB 3CDEA 1X4AA 4U9RA 2WSFC 1HRHA 5FPMA 4M5MA 4JEPA 1OS5A 3EE9A 3G25A 2GQ2A 2DXFA 3ASMA 2WONB 2QTWA 3SDEA 2DGOA 2CJAA 2VPXB 1V5IB 4OLOA 2D0PA 3DU5A 3R5BA 1S97A 4TQRA 1I6JA 4DR1J 1GXLA 4DU7A 4IOCL 3K5OA 3MX2A 2X7IA 1OSDA 1UEUA 2GEMA 3SSSA 3AB4B 3V1OA 3R6MA 3AA3A 2LEBA 1CXQA 3TSPA 2F3JA 1LWEA 4YS2A 5HVGA 3ZTQA 1J6ZA 4E1NA 3QNNA 3ILOA 2Z0GA 1CJKA 4NLGA 2E2PA 3SQ1A 2XY5A 2N7CA 4GMJB 3C6TB 4B3SK 2K2PA 4B3MF 1VFJA 3I8DA 5FLXU 2XEXA 4WQ4C 3FQKA 4X62F 1SKUB 1KLNA 3R6LB 3LDPA 3TA0A 3CCEN 5KFKA 3CJSA 4PUOB 1L3KA 3SQ0A 2L48A 3HK2A 1VSFA 4BRGA 2VGNA 2GAHC 2VBXA 1VYAA 3MGJA 4DPYA 1JMTA 4Z4IA 4CVNE 2KZZA 5KFBA 3IN5A 5HVHA 4DV7F 4HVZA 3KMSA 3CJQA 4L75A 5KAKA 4C97A 1YBTA 3E01A 9ATCB 2F8SA 2O8BA 4DBQA 4RUCA 3BQ0A 1NXIA 3OYDA 1B3TA 3UR0A 1T3VA 4DEZA 2FDNA 3WQUA 3NGZA 4CEOA 1KHWA 3EY1A 4YR2A 3NOGA 3L2RA 2F9DA 2YX7A 1LXJA 4M5HA 2V67A 3CJCA 4ZJOA 5C2GA 4AL6A 4JI7J 4RW6A 4DPOA 4DR7F 2X3DA 1V5VA 2FVQA 3SV3A 1X4BA 4OKKA 2NLXA 5M1PA 3UNYA 4JI0J 4YR3A 3KUHA 3HT0A 3I55N 2CVEA 4EIAA 1R0CB 5FD1A 4RNOA 1KD1O 4ETZA 4IRCA 2EFGA 4WCEQ 4H0PA 4DV4F 1UFKA 4AL7A 1S77D 1XHZA 3JQMA 1NGGA 4MK8A 3LALA 2QWNA 4QIWD 4O3OA 3MEDB 2IDLA 5M2UA 3V6DA 2WVDA 1S1XA 5FRMA 1UETA 4ZN3A 4A2AA 2UYTA 3CQXA 3PFOA 3GU0A 3M9OB 2KXHA 4W5OA 2E9RX 3ZT4A 2AYMA 1ZS6A 3BZQA 2IYGA 3MDFA 4DX8H 3V81B 1K0TA 3KK2B 2RD5C 1HBUA 3GV5B 4FP9A 1LOTB 2BACA 4EU0A 5B0CA 3NAIA 2EFOA 4WYLA 1O13A 3BYRA 2ZE2A 2OPQA 5LXRA 4NOHA 4JK8A 3ENHA 1S48A 2QKBA 3DOMA 4CH1A 3W61A 2DHXA 2PMHA 1FHTA 2YJFA 4NCGA 2HPUA 2DO0A 2V52B 3QNWB 4YHHF 3FK4A 3QLHA 1WI6A 3K0SA 4WE1A 1G99A 4AQYJ 4YNQA 3HHKA 4DDFA 3KLIB 4FYYB 5HVFA 1TUVA 4K41A 1T3NA 3U27A 3MOJB 1RCHA 4CT8A 4IFEA 3ZT3A 2EKYA 3I5AA 2A42A 2GV1A 4J2EA 3QNOA 3CC2N 2LCWA 1JLCB 3KK3A 3O44A 2W40A 3IAYA 1VQ6N 4ICLB 2MTLA 4KH0B 3NMUA 4X4TA 1TU0B 1TL4A 2GBZA 2IDOA 3H25A 1RP5A 4OV1A 3MXIA 2RQCA 2IC3A 3SQGB 2I5JA 4JHDA 3VQBA 4IO9Q 1BDGA 5G0RB 1YIJN 3SIPB 4TN2A 1KLMB 3ZZ0A 4BR9A 3DOLB 3OTBA 5IWAK 4CO1A 2RF2A 2AYGA 1S7HA 3JTPA 2UUCK 3SMPA 4USVA 3EL2A 1RILA 3I6PA 1IR1A 1P8ZA 4EO8A 4LF9K 2Q0RA 1TKXA 4YOWA 5IT9O 1U2VA 4Y2KA 4NYNA 2ZH9A 2DIUA 3KKFA 1R8BA 3SSQA 1OVQA 3CCUN 2PI4A 3F5TA 5KPRA 4USKA 4I2PB 2ASMA 3EM1A 3EZ5A 3DXSX 4OZ3A 1XNRJ 2EG1A 4KGVB 2PEHA 1X3MA 4KI6A 1FERA 3VCDA 3V9WA 5C24A 4GNIA 3OYKA 1P90A 5KFJA 4DSFA 1R8PA 4IH5A 2VPYB 3AVGA 2AYEA 3FZHA 3BS9A 4IFYA 1Q8BA 2HBLA 1YT3A 2B4VA 3EX7B 5ADZA 4CHOA 3H5XA 3M2VB 4RWWA 1HIYA 1R31A 1TUWA 1N36K 1GX6A 1FDDA 2OPSA 2IA6A 2PFDA 1JCFA 2VGMA 2VQEF 1EQMA 4EP5A 1WC6A 3I4PA 4DMZA 3T1HF 1M90T 3BGRA 1KVIA 4O3PA 3GFZA 3SCJE 1IO2A 2MKKA 4FBUA 4ED2A 1ITPA 3W62A 4B17A 2E1YA 3L6QA 5FDLA 2NRTA 4CT9A 3U9DA 5D8HB 4M3XA 5IT4A 3DOKB 3FC9A 3T5LA 3RBEA 4FLZA 3C16B 2MB0B 1NJIT 3R2CJ 1C0TB 4KH1B 5KT3A 4ECQA 1RUSA 1BE4A 3H3NO 1ZOTA 3EUNA 4P71A 1NMEB 3KK7A 4JKCA 4DL0C 1S6OA 3TZXA 4BGAA 3C6UA 2GUPA 4LF7F 3GJRB 4K0KJ 3HSDA 3HHLA 1VSKA 2CPFA 4KHPF 2VJUA 3ZTRA 5BR9A 2FBYA 3VAMA 1YJWN 2XCPA 1HPZA 4KH5A 4DXLA 1KAXA 4P52A 2FYXA 3NH2A 1TK8A 4ZPTR 2F96A 3H0PA 4M3ZA 1VIXA 5LMUJ 1IBMF 2I38A 2MY8A 1B0TA 4ZVPB 1HUXA 1RHKB 4K4ZA 2QE5A 4JKHA 3R5AA 2DHSA 2EW9A 3MN7A 3TTFA 3VA0A 2FY1A 4PABA 2R7WA 2OH2A 3JSBA 5AQIA 3D45A 1RT6B 1BWVA 1YHQN 3VQTA 2Q36A 4CIOA 5A0YA 3ZTOA 5I3PA 1XIQA 1UJ4A 2RIJA 4DPTA 3LM9A 2XS2A 1VK3A 2Y0BB 1UOCA 4DSEA 4F9OA 3MCAB 2K3IA 5KG0A 2ZJQL 1OY8A 3NY0A 4PPD