3DOLA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
540
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 136
structure length 536
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dolA05
5HRPA 4O5BA 3O3GA 3DLEA 3D0PA 2OH2A 1VSFA 4ZPDA 5F8LA 4FLXA 4FJXA 2DY4A 3G10A 1SV5B 1EXQA 4RW6A 4M3YA 3I0SA 1NK8A 3TAFA 2XY6A 3N6MA 1A5VA 4WYLA 1VSIA 1NK7A 1TQLA 4WE1B 3AVNA 1VSJA 3PX0A 2HHQA 4IKAA 4IR1A 3KLEA 2ASDA 4CJ3A 2C2EA 3KTQA 5CYMA 3MFHA 1S1XA 2AX1A 4ZP7A 3M8SA 3BSAA 5DMRA 3I5CA 1Y97A 1QSLA 4NZ0A 3V6HA 3QGHA 1RT5B 3P5JA 3KLGB 1IKWA 4EEYA 4YNQA 4CE9A 2ILYA 2RDJA 3PY8A 4FVMA 4LSNB 1D8YA 3NAIA 2CKWA 1UOCA 2A1RA 3K5NA 2ZD1A 3PZPA 2XGPA 5KT3A 1JLQB 2W7OA 5DQIA 3OYJA 1S9GB 3DOLA 4ZMMA 1NKEA 4TYAA 2V0NA 2UVVA 4FBTA 2VG5A 4K4ZA 3ZSRA 1EX4A 5KFDA 3BQ1A 4DWIA 3MR6A 1UAXA 4RUCA 1RT7B 2DFEA 1KFDA 4ED6A 3RWUA 3DMJA 3NBPA 4WFXA 2YV0X 1IG9A 2F8SA 2RF2A 4G3IA 3SQ1A 1GX6A 4F4XA 2FJXA 4NLTA 3RRGA 1VSLA 5JUMA 1TAUA 2B5JB 3LP2A 4FCYA 3AO3A 1RT3A 4TY8A 4G1QB 5KT6A 1EKEA 4FJGA 2W9BB 4EP5A 3MR2A 4W5NA 1CLQA 4RW4B 3SFGA 4DTXA 3IRXA 1R0AB 4J2DA 2XCAA 2HNYB 4XO0A 4CFAA 3DLRA 2WONB 5HROA 2JLEA 3RRHA 1JL2A 2JC0A 4HYKA 3MFIA 4F4KA 2IA6A 3V1OA 3DRRA 3L8BA 4IH6A 5EUHA 4F8RA 3GILA 3A2FA 1HYZA 4BDYA 1NK5A 1N48A 2ASLA 3FFIA 3VQBA 3DRPB 3LP3A 1HYVA 3Q8RB 3WNFA 1C2PA 3ISND 5J2NB 3AVCA 2G8WA 1I39A 4IFYA 2P1JA 1SKSA 5KI6A 2G8KA 1RT2A 3MAQA 2R2RA 4EYIB 3G6YA 3VQ7A 1TL1B 3CFPA 4ECSA 1RYRA 5EWEA 3KLFA 4CFCA 5FDLA 1TAQA 4CJUA 4FJIA 3VQCA 2HNZA 2YKMB 4KI6A 4F2SA 2AWZA 2V9WA 3K5OA 4PWDA 1JLEA 4EZ9A 3VQSA 2BE2A 4H4OA 4NLRA 3D5MA 2RKIB 2C2RA 3OJUA 5KT5A 1EETA 2HNDA 4NCGB 1LAVA 1QSSA 4NRTA 1RDBA 3B6PA 1LW0B 4FZZA 1S9FA 4CJVA 2XC9A 1TKDA 1TGOA 1WN7A 4KB7A 1HQEA 2I5JB 4EYHB 4RW8B 5KFLA 2W42A 3CDWA 2HHVA 5KG5A 4R8UB 4CJ5A 1NKBA 4ZP8A 4PUOB 3KNAA 2X6SA 4B9LA 4I2QA 3CM6A 4C8OA 2WK4A 3ZSXA 4ZHRA 1NK9A 1S1UB 4CEDA 2QV6A 3S3NA 1C0UA 3KIOA 3K5MA 4QWCA 2J6UA 4DQPA 2KQ2A 3O3FA 4RW6B 2FBVA 2X74A 2VA2A 3I0SB 4BDPA 1SL2A 1U47A 4FM0A 4C8MA 3KKSA 1RT1B 3ZCMA 4KHWA 4RW7A 5KT7A 1C1CA 4TQSA 2JEJA 4WXOA 4J9OA 4J2EA 3HVAA 4QWDA 4QCLA 4I7FB 3KLEB 2ITGA 4LH4A 3TAPA 3AA4A 2FBYA 3O4QA 4K8XA 1RT6A 4DU4A 3MF5A 1QSYA 4CF9A 5DQHA 3PV8A 1UA0A 4TQRA 1JLFA 3OL6A 1MMLA 1WNEA 3HVWA 4F4YA 3CFOA 4DL2A 1J53A 4N5SA 4WZQA 2IDOA 1DLOA 3M8PA 1BISA 2ZD1B 5KG1A 3L2VA 3P83D 1W25A 4ZPBA 4FJ9A 5KFIA 2BANA 4ED3A 5KFMA 2BQUA 3LPUA 4CJFA 3SUQA 3DI6B 1UWBB 3QIDA 1S49A 5FRMA 3KK1A 2FC0A 1IKVB 4RUAA 3NH2A 3QNNA 2HWHA 4JRPA 4IH5A 2J6SA 4MK7A 2D5RA 3T5HA 1NNDA 1WSFA 1CXUA 1TL3A 3EY1A 4CJQA 3HP6A 1QHTA 5KFHA 2HB5A 4RNHA 3AV9A 5KFRA 1J54A 3M8QA 3GV7B 3I5BA 3FQKA 3UDLA 3DMJB 4PY5A 3AVMA 5CY4A 4ECZA 4EBEA 3QYYA 1BI4A 4CF0A 5KT4A 4EO8A 4KO0A 4B9UA 3AVAA 4CIEA 2E6LA 2XI3A 4PA1A 3HM9A 3DLHA 1TV6B 4DSJA 1RT3B 3MR3A 4ZTFA 2KTQA 4CF2A 5KFTA 4I9LA 4URGA 3BDPA 2GV9A 4HVJA 4Z4IA 3CO9A 2LSNA 5JXSA 4TXSA 4JV1A 3OVNA 5EWGA 4ID5A 2IM0A 3V9ZA 4RW9A 3C6TB 1HNIB 3SI8A 2DPIA 1LWCB 4O4GA 3I0RA 1S0MA 1XWLA 1YTUA 3MEEA 3DRSA 4CJKA 4QWAA 3EPGA 3DRRB 1T8EA 4NLOA 5KFKA 1C0TB 1SUQB 1U04A 4DL7A 4B3OA 2FVCA 4N56A 3OYDA 2IGIA 3ZSVA 4L8RB 4CFBA 4CEAA 3SFUA 3QZ8A 3DM2A 1BHLA 2VG6A 2P5OA 4OGEA 3KMSA 3ZSQA 1K1QA 3MXIA 1ZBHA 3GIJA 2OPPB 1RBTA 1SL0A 5DK5A 1NJXA 4J9RA 3KLFB 1YTAA 2YNGB 1JXBA 4RG8A 1ITGA 4WFYA 4ECRA 4TYBA 1X9MA 3Q8PB 4FJHA 4PWDB 2HMIB 4LY7A 1JLEB 3MECA 2FJVA 4H4OB 4JRQA 5HP1A 3AO4A 4MQ3A 3QEWA 1ASVA 4EBCA 3HHKA 4CHPA 2HNDB 2FVQA 3CJ5A 3V6JA 4DG1A 3ZSOA 4B9TA 1RBRA 3NGDA 3OYKA 4Q5VA 3NAEA 5DLGA 2OZSA 2CJQA 1HRHA 5KG7A 4ED7A 3PX6A 4NLUA 3OS2A 3MTKA 1RA7A 2B43A 4KBIA 1HMVA 1QAJA 4XPEA 4KI4A 3M9NB 3H5YA 3TAGA 5SZTA 3L2WA 3IN5A 5FRNA 3CG7A 1Z25A 3JSMA 4KFBA 3LWMA 4I2QB 2AGOA 4O3RA 1I3AA 4QWEA 3L2RA 4ZHRB 1RT4A 1RILA 3HVTB 3H08A 3K2PA 1S6QB 5F9NA 3V6KA 3LAMA 5F8GA 5CZ2A 3MEGA 1RTDB 4YFUA 4DMNA 1XC9A 1C0UB 4KTWA 1I6JA 4K4SA 4FBUA 3L3VA 2KZZA 3ZT4A 5C25A 2HW3A 2OPRA 4IFVB 3SI6A 4ED1A 2ASJA 5HRRA 2OPQA 4CJ4A 4JLHA 4R0EA 4LQ9A 3KK2B 1Z4UA 4CEBA 1HYSA 3TAEA 3L3UA 4RW7B 4ECYA 2B4JA 2WOMB 5KG3A 2UVUA 1ZTTA 5J2MA 4DQSA 4C8LA 1N4LA 1ZBFA 2R8GA 1JIHA 1TKXB 3V4IA 2XO7A 3Q8SB 2RDIA 4KHQA 4FLVA 3HO1A 4RNNA 4ID1A 2XY8A 2W9CA 4QPXA 1TKTA 1MU2A 1JLFB 3HYFA 3LDSA 2BGGA 2Z1HA 3FQLA 3BREA 1DLOB 1NHUA 4KE5A 1K6YA 4CERA 1LWFA 2VA3A 4TN2A 3EZ5A 5KT2A 4DL5A 2FVPA 2RN2A 4B9MA 4FM2A 1RBVA 3HPOA 3OSNA 1BQNB 4ELUA 4ZP9A 4E89A 1N5YA 4ELVA 3ITHA 3BJYA 5KFAA 4N76A 1TL3B 3KK3B 1T03B 3TAMB 1XR6A 1JLAA 4IH7A 2IM2A 3BR9A 3IAYA 5J2PA 4FJKA 4TLRA 2FBXA 2XI2A 2WRMA 3PW7A 3QESA 4BDZA 4FZYA 1BL3A 2E9RX 5FROA 4K4XA 4EZ6A 3IG1A 4O44B 2IJFA 3DLGA 4O3OA 5K14A 1C6VA 1RDDA 3HPGA 1Q9YA 4J9LA 5HRNA 4GW6A 4IG0A 4YR2A 3LZJA 4CGGA 3K57A 2YNIA 3QETA 5KFOA 1RTHA 3M9MB 4E1NA 3HT3A 4EP4A 2BRLA 4O4GB 3I0RB 2G8FA 3MEEB 1Q8IA 1NJZA 3DRSB 4IG3A 1RNHA 3E51A 2XHBA 3OYAA 5KFJA 5KFUA 1WSHA 3H4DA 3OYBA 1LAWA 1WNSA 2ZE2B 3KHLA 1D5AA 4KPYA 1RAJA 2JEFA 3AA3A 5JS1A 3DM2B 1KSPA 3OL7A 1S5JA 3QEIA 3NF6A 2B6AA 4JUZA 4O3PA 3SPYA 1SKRA 3OSPA 4DTPA 4RNOA 1LWEA 4YR0A 1VSEA 3NE6A 1GX5A 2AGPA 2QKBA 1J5OB 3V1RA 3QNOA 3KLIB 2O5DA 4KV8A 3VQ4A 1BQMA 4OJRA 4BE1A 3T3FA 1F21A 1KLMB 4CJTA 1S1TB 1D9FA 4DSFA 3MECB 4MKBA 3DOKA 5HLFB 1JLCB 1FK9A 4DFMA 1WLJA 4DTJA 3ZT1A 1S9EB 1T94A 3KJVB 1Z26A 4KHNA 2Z1IA 1VRTB 2D0CA 4JS4A 4FJJA 4DG1B 4DQRA 2KW4A 4Q45A 1JX4A 4DTRA 3HXMA 2ATQA 4Z4HA 2IOCA 3QEPA 3TAQA 3VQ6A 2WHOA 3AO5A 3SQ0A 1K1SA 3T5KA 4J9PA 4HHTA 4ECUA 4AHRA 4DQQA 1RTIA 4YR3A 3JSMB 3NF7A 4CEOA 3RB3A 4WXWA 5HBMB 3Q8QB 3DLKA 4NLSA 3AVHA 4F3OA 1RT4B 1TKZA 4Y1CA 4Q43A 5L1JA 1LW2B 5KTQA 4Q44A 5I42A 1KHWA 1RDRA 1CZ9A 3TABA 4E7LA 3NKYA 2FLNA 3PO4A 4B9VA 1HQUB 3QLHA 4Y1DA 5C25B 2AQ4A 4F2RA 2OPRB 3PX4A 3I5AA 3RTVA 3RB0A 3AO1A 2OPQB 4BE0A 3CIZA 3LP0A 3V81A 3SJJA 3NGZA 1REVA 1YT3A 1SL1A 5EU7A 3OYMA 2UVWA 1ZYQA 4NYNA 5J2MB 3V4IB 3TR8A 1S1VA 3MR5A 4ED2A 4O0IA 2W9CB 2IAJA 1JLBA 2E6MA 1TKTB 1MU2B 3NF9A 1L3VA 1YVUA 2PZSA 1GOCA 3OL9A 3L2QA 1FKPA 3H5SA 3BQ2A 3NGYA 3DYAA 2P5GA 1HJRA 3AA5X 3U3GA 4PQUA 4CEFA 4J2BA 4FJLA 2XRIA 2PYLA 2YNFA 3VA0A 4E0DA 1EP4A 2W7PA 4ECTA 3P1GA 1A5WA 4QW9A 1U48A 3H5UA 3S3OA 5CYQB 2XCPA 3AVBA 3DLEB 4CF1A 5J2QA 4UQGA 1BGXT 5L9XA 5D3GA 3GIIA 2NUBA 1Q9XA 4M3UA 4KREA 4Z4GA 3NL0A 3TI0A 1U45A 1JLAB 5KRSA 3K58A 4FZXC 3WNGA 5C24A 2F8EX 4LD0A 4LH5A 4CHOA 3BGRA 4Z4CA 2G8VA 4FJ5A 4FXDA 3HL8A 3ASMA 3DDKA 3IG1B 4QWBA 5CYMB 4E7IA 3H40A 1CSJA 1S1XB 1DTTA 4KTQA 2Q3SA 4OLAA 3ICLA 3EPIA 4F50A 4IG0B 3CFRA 3NH0A 1GOBA 3VQDA 1IKWB 1NOYA 4HCCA 1FXXA 3KMQA 3RMDA 4HUEA 4LSLA 4E7KA 4DS4A 2DTUA 3NGIA 4ICLA 1VSMA 5KG2A 3RBEA 3RB4A 4ZVGA 3DOLB 3MXJA 4KHMA 3NMAA 3TVKA 3KLVA 3TANA 1KVAA 4CJLA 4MKAA 2VG5B 4O0JA 4CEQA 4AHCA 4B9NA 4HTUA 1S0NA 4JS5A 4ELTA 4Q8EA 4MFBA 4DFPA 1G15A 1RTJA 3QGIA 3KOAA 1D0EA 4CHYA 3NBPB 3JYTA 3V6DA 4IRDA 2RF2B 5C5JA 1IM4A 3CYMA 4AHTA 2XWYA 1HNVA 1LWEB 2R8HA 1N6QA 1IKXA 1W0HA 4FLTA 3LP2B 3RMBA 2DFHA 2FVSA 4KV8B 3C6UA 4FYDA 4TY8B 1JXLA 1BQMB 1CXQA 4NLXA 5SWMA 2E9TA 3SCXA 1S4FA 1FK9B 2W8KA 4B9SA 5DG7A 3IRXB 1TP7A 5JS2A 2Y1JA 1B9FA 5EWFA 2W9AA 1XHZA 5HROB 3OYNA 3BQ0A 3S9HA 2JEIA 3H98A 2G8IA 3KLGA 4CEEA 3VN5A 3OS0A 4DS5A 2FJWA 4FJNA 4RZRA 3TQ1A 4M42A 4J9KA 3NF8A 3FFIB 3RB6A 3N6LA 3SV4A 5KFXA 4BWJA 1S9GA 2VG7A 4FJ7A 2BQ3A 4BE2A 3OYCA 3L2UA 2QKKA 5F9LA 1IKYA 4IFYB 2E4LA 4GMJB 1W9HA 1RT2B 3ZSYA 3LZIA 4FK0A 4CGFA 1ZBLA 5KFPA 3DLKB 4JV0A 4IQXA 1NK4A 3T5LA 3NAHA 4FK4A 1L3UA 4W5TA 5FDLB 2F8TA 3D28A 1NOZA 5F8NA 2HNZB 4DL6A 2AJQA 1WSEA 5I42B 4IBNA 2EHGA 1KFSA 4EO6A 4YQWA 3G0ZA 2BE2B 3QLHB 4O3QA 4QOZB 4C8KA 1FKOA 2WTFA 3H5XA 4B8CA 1TVRA 3T5JA 3LP0B 4Y34A 4FS2A 4DF8A 2OPSA 1EETB 1REVB 3OYGA 4KAZA 2ZQBA 4ZVEA 4G1QA 2IS3A 4AILC 4AHVA 3NH1A 4KHUA 3SUOA 3PW4A 2ALZA 1WSIA 5KFEA 2V4QA 3ISNC 1HQEB 1S10A 2EC0A 3M8RA 1R0AA 3KD1E 2HNYA 4MH8A 4DSKA 3HJFA 2WONA 4QAGA 3BSNA 3HP9A 1OS5A 3ZT3A 1HARA 3VA3A 5KRTA 4H54A 4IR9A 3CWJA 4LQ3A 4DTNA 4BACA 3OY9A 3PUFA 1NK0A 4KB1A 2X6NA 5F8MA 4FM1A 3VQEA 3OYIA 2G8UA 2HHTA 2HHUA 5D3GB 1J9AA 4FS1A 3N6NA 3WNEA 3T19A 2HHXA 4IRCA 4CCHA 4OL8A 3QO9A 3GIKA 2HVIA 2BDPA 2ATLA 4CIFA 3PO5A 1C1CB 5C24B 4KKOA 5J1EA 1TK8A 4DSLA 3GIMA 2YKMA 2D7SA 4GVMA 4URSA 1T05A 3FSIA 3PJWA 3HSTB 5C42A 1A5XA 2ILZA 5F8JA 2RKIA 1RT6B 2R8IA 1RDAA 4NCGA 1KCFA 4CK2A 1LW0A 2YKNA 1L3SA 3M8PB 2QE5A 2V4RA 1VSHA 4LSLB 3AVLA 4I2PA 4K8ZA 4O3NA 3G6VA 2BANB 4J9MA 2DFFA 5KFNA 4RW8A 3OHBA 2KFNA 4FLWA 3KK1B 3H2LA 4CHZA 3QIOA 4PUOA 1KLNA 2A1SA 1CZBA 4CHNA 5KFYA 2QXFA 4DTMA 1RTJB 4URQU 4NYZA 3KKRA 4WZMA 4RU9A 3M8QB 4KB0A 4MIAA 3AVKA 2GIRA 1HPZA 3JYTB 3V6DB 3K59A 4NLGA 1QTMA 2IM1A 3I8DA 1HNVB 1BI4B 1N6QB 1IKXB 4KO0B 4CGJA 1QE1A 5KFBA 1DTQA 3C6UB 4AHSA 3FDSA 1RT1A 3LWLA 3QZ7A 3C95A 4O55A 2R8JA 3CJ2A 2BQRA 5KFZA 2FVRA 2GUIA 4I7FA 4ECWA 3EYZA 2XY7A 4ID5B 1LV5A 2KZMA 4W5OA 1IO2A 4RW9B 3ULDA 1B92A 2UUTA 2XGQA 1SKWA 4NLYA 3PR4A 3UQSA 3QGGA 3H4BA 3PVXA 1RBUA 4IKFA 4NYFA 2RPIA 3GV8B 4ECVA 3OYEA 4IDKA 3SV3A 4Y3CA 4B3OB 1BIZA 4CESA 3F73A 2J6TA 4CECA 3DI6A 5F8HA 3UIQA 2VG7B 4GC7A 1UWBA 2D0BA 4CJSA 2VG6B 3AVIA 1QS4A 1IKVA 2YNHA 1IKYB 3G86A 3IS9A 4ZVHA 1C0MA 4Y2AA 2UVRA 4H8KA 4CGIA 3LPTA 3TARA 2GIQA 1SH3A 5DGAA 3SQ4A 3SZ2A 4N41A 4R5PA 4IOBA 2C28A 4DTUA 3KLHA 4FK2A 4N47A 5HP1B 1FKOB 5KG0A 4EBDA 2O4IA 1TVRB 2OPSB 1TV6A 3BSOA 4YMEA 2HHSA 2FBTA 2EX3A 4CGHA 1SH0A 3PW2A 3CVKA 3LALA 5KFSA 3PJXA 1NJWA 2XY5A 2HVHA 3SUPA 2IM3A 1JLGA 3C6TA 1HNIA 4Q8FA 1YVFA 5DG9A 1HMVB 1LWCA 4Z0UA 3IGVA 3IGNA 4M3TA 4F4WA 1JXEA 4OKKA 3VQPA 3DLBA 4CK3A 1JL1A 3LP1A 2PY5A 1BCOA 3QEVA 4KFBB 1C0TA 3RAQA 1SUQA 4H4MA 4K4TA 3O3HA 3KHGA 4DL3A 4ZVFA 3OJSA 1NKCA 4DU1A 3MEGB 1SH2A 2R2TA 2BRKA 2IC3A 4TY9A 3O4NA 4NLPA 3OLAA 4KRFA 1ASWA 1QQCA 4W5RA 1TK5A 5KFCA 3AVJA 1B9DA 4CK1A 4NLVA 4M3WA 2OPPA 2I1RA 3QO9B 4QW8A 1QAIA 4CJEA 1HYSB 2YNGA 4O4RA 3KHHA 4Q0BA 4KKOB 4J9SA 5J1EB 3E01A 2VWJA 4ED0A 1S6PA 2Z1GA 3SUNA 1U09A 3CQ8A 1VSKA 3ZSZA 3S3MA 2HAIA 2HMIA 2OYQA 4F4ZA 1T05B 4NLWA 5C42B 4Y2CA 2Y1IA 1ASUA 1RDCA 3V9UA 4O3SA 2GBZA 4DFJA 5F8IA 2W8LA 2YKNB 4DU3A 4KHRA 2C2DA 1NK6A 1LWFB 3PHEA 3FRZA 4HCBA 3NDKA 4OPJA 4I2PB 4DSEA 1JKHA 5KFWA 3RMAA 4HKQA 4KAIA 3EZUA 4K4YA 4DFKA 1N5YB 3CJ3A 3ITHB 3LAKA 4NCBA 3NCIA 4CFDA 3AO2A 1KTQA 2D3ZA 3HVTA 1IH7A 1S6QA 5J2PB 1KVBA 1X1PA 1RTDA 1C1BA 1HPZB 5KFQA 3GYNA 4E3SA 2YHAA 3MEDA 4IFVA 5L1KA 5DGBA 1RBSA 3DLGB 1QE1B 5KG6A 1DTQB 5K14B 1S97A 1VRUA 3KK2A 3BSCA 3VQ9A 1ZBUA 4KTZA 3OYHA 2WOMA 1C1AA 4Z4FA 1TKXA 1NJYA 2X78A 2KFZA 2YNIB 3QIPA 2AX0A 1X9SA 2OA8A 1RTHB 3VQ8A 3SNNA 1S1WA 5L1IA 3F9KA 3D45A 1ZTWA 2HWIA 3PW5A 1N56A 4K4UA 2IJNA 3SYZA 4IG3B 3QERA 1D9DA 3OHAA 3V9XA 2G8HA 3M9OB 4X2BA 4E7HA 4FLYA 4IDKB 2F96A 4OPKA 4HUGA 3CJ0A 4DL4A 2FLPA 4M3XA 4JV2A 3ALYA 1BQNA 5I3UA 5KG4A 4DEZA 4OGCA 5E41A 1S48A 1X9WA 2YNHB 2B6AB 4DF4A 3IS9B 1SV5A 2JC1A 1WAFA 4BWMA 4KSEB 2JGUA 4ZP6A 4ZPAA 2C22A 1BCMA 3HPHA 4CF8A 3KK3A 1T03A 3TAMA 5DG8A 4E7JA 2UUWA 4B8AB 4DLEA 4DTSA 4ED8A 4WE1A 1L3TA 4U7CA 4R5PB 3KD5E 2HHWA 5KFVA 4DSIA 2D41A 1RA6A 3KLHB 3DOKB 4NLQA 4FJ8A 1VSDA 4O44A 4CGDA 3AVGA 4OKJA 2ZKUA 4E19A 4I9QA 1QUVA 2AGQA 3SQ2A 1XI1A 1S0OA 3CDUA 4M45A 3H59A 1RT5A 5KGXA 4ZPCA 1XHXA 2R7YA 4MIBA 4CHQA 4DQIA 3OL8A 3C94A 4LSNA 4OKEA 3NHGA 3RMCA 3MXMA 3WNHA 4GC6A 1L5UA 1JLGB 1JLQA 4M3ZA 3LANA 2YHBA 4AH9A 3RR8A 2GC8A 4MK9A 4E1MA 2VWKA 3U3YA 4J9QA 1RTIB 3CDEA 3LP1B 4DTOA 3CM5A 2PYJA 4WFZA 2ETJA 4H4MB 2AU0A 4K50A 1WSGA 4FLUA 2ZE2A 2IBKA 1TKZB 1RT7A 2E9ZA 4K4VA 2JEGA 4K4WA 2IC3B 4KHYA 5CZ1A 3ZSWA 4FJMA 2O4GA 4M95A 3G6XA 3OLBA 4FW2A 4ECXA 1D1UA 4AHUA 2B5JA 1J5OA 3V81B 3KLIA 3UR0A 4J9NA 3GV5B 1T3NA 1O1WA 4Q0BB 5DLFA 3VQAA 4XPCA 3E01B 4CEZA 1S6PB 4KHSA 4RNMA 3HK2A 2W9BA 1KLMA 4CJWA 1S1TA 1TK0A 4YP3A 1S1VB 3TWHA 2R2UA 5HLFA 4RW4A 3CJ4A 5T7BA 1JLCA 2D0AA 3PW0A 4CJRA 4TSXA 4ZTJA 2IAJB 1S9EA 1JLBB 3KJVA 2P51A 1T7PA 1VRTA 1BIUA 1FKPB 3SPZA 3DYAB 1KHVA 4PQUB 4OLBA 2YNFB 1JKHB 2WCXA 3PR5B 4Z4EA 3ZT2A 1EP4B 3K5LA 3V1QA 3HKWA 1GOAA 4MK8A 4NRUA 3DRPA 2D3UA 3RAXA 5J2QB 1WSJA 5J2NA 3GQCA 4CIGA 3U6FA 4U6PA 5HRSA 1RCHA 4J2AA 1TL1A 5HBMA 2WB4A 1ZETA 1KVCA 5L1LA 3NFAA 5T14A 4M3RA 5KFFA 3VQQA 4M94A 2BR0A 1XR7A 1LW2A 1NHVA 3RR7A 3ZT0A 1C1BB 4WYWA 4DLGA 1KRPA 3BGRB 2R2SA 2R8KA 3OYLA 4NCAA 3UPFA 1U4BA 5KFGA 1HQUA 3MEDB 3THVA 4F3TA 4OVLA 3RBDA 1DTTB 1VRUB 1XR5A 4FW1A 3AVFA 4M41A 1U49A 4FLZA 3B6OA 2OZMA 4B08A 4C8NA 1UA1A 4W5QA 3QIPB 3OYFA 3AA2A 2I5JA 2IMWP 1S1WB 4ICLB 4HUFA 3KHRA 3QEXA 1VK0A 4CJPA 3VQ5A 3T1AA 4R8UA 1ZBIA 5DQGA 2QK9A 3HVRA 4ECQA 1RYSA 2FLLA 4XIUA 3OS1A 3V9SA 5EDWA 1WAJA 4RNFA 2DPJA 3QINA 2Z1JA 1S1UA 4IRKA 4MFBB 5KGWA 3V9WA 5CYQA 4NLDA 5I3UB
chains in the Genus database with same CATH superfamily
3DLEA 2O8BB 3MDFA 2DGQA 3G10A 1EXQA 3BGFA 2AT1B 3FCWA 2OEMA 4UOFA 2XY6A 5EGYA 1A5VA 1TQLA 3I31A 4WE1B 1PG5B 1ZA1B 2DXEA 3G4SN 3AVNA 4L72B 4KJIA 4IKAA 4IR1A 2ASDA 1RWXB 4CP5A 3ET6A 5CYMA 2VONA 2VQEJ 1S1XA 1NJIO 7AT1B 1P8GA 2HQFA 4YB1P 4AE5A 1QSLA 2JWLA 3V6HA 3P5JA 5IT4A 1FRXA 4YNQA 2F8MA 4ILRA 4DV1F 2HVZA 1B7FA 4BVPA 2QLXA 5KT3A 2HSTA 4HHHA 3DRXA 3PIPQ 2IFXA 3PRBA 2E1ZA 3W2WB 2F63A 4JP8A 2QI2A 1CPZA 1EX4A 1URNA 3P4IA 1Q53A 2N3LA 4RUBA 3BQ1A 4DWIA 3MR6A 2IVPA 4KGXB 3DNCA 1X4BA 5F1XA 3DMJA 3NBPA 3G8TA 4JI4J 5LMUK 3W9JA 3SQ1A 1GX6A 3PDNA 2B5JB 5K8PA 2ZF5O 3LP2A 2A2CA 4FCYA 4P52A 4CO5A 2EK1A 1BU6O 1X0FA 1NM2A 5KT6A 1P9YA 3P38A 3QWUA 1YRUA 3K9JA 2CJ9A 3CJAA 2ZNYA 3WEEA 3IRXA 2WVEA 1R0AB 4CFAA 1OYEA 3DLRA 4CH1A 5HROA 1JL2A 2JC0A 3BBCA 2DHAA 4OPHA 2IA6A 3V1OA 3TA0A 3T6JA 3BO4A 4FPRA 2AD9A 3CCJN 3VQBA 4K7QA 1YITS 3Q8RB 2R7WA 3U8XA 1CJUB 2HBRB 2G8WA 2UUAJ 4AF1A 3L9ZA 1WACA 3LA0A 3CFPA 2FSKA 3MPYA 5EWEA 4CFCA 4JI2J 2QWOA 5CABA 4F2SA 1CS4A 3PJ9A 3Q2TC 2V9WA 1W2IA 1FHTA 4PR6A 2XLIA 4JI8K 4B3RF 2O01C 2C2RA 3OJUA 3BH6B 4K43A 1EETA 2HNDA 4NCGB 5AT1B 2NZCA 2XC9A 3HBTA 2KJVA 3GPAA 4I6MB 1HQEA 1WC4A 1Q81O 3DN9A 4IUFA 1EHWA 2HHVA 3WQUA 5KG5A 3ISZA 4ZP8A 1HW9A 3CD6S 3C7NB 3KNAA 4B9LA 1VQ4N 4R0JA 4DPWA 3ZX2A 3QRPA 1NK9A 2G0CA 5E7OB 3GONA 3D2EA 4M5DA 2RQMA 3HFZB 4DOZA 4OFZA 3AQPA 2J6UA 4DJBA 3A1YG 1FRJA 4DUZJ 4DV5F 4OI1A 4RW6B 4BDPA 1SL2A 4JNEA 1XMBA 4FM0A 3TRGA 1MWQA 2XS5A 3TTCA 2N3OA 3BZKA 3FZFA 1WJ9A 5E26A 1U1MA 4QWDA 4PYAA 1D3WA 1Q18A 2JX2A 2ITGA 4RBUA 2CQ1A 1WWHA 3F56A 3AA4A 3QSYB 2FBYA 3SCIE 4DU4A 1M1KT 3MF5A 3M2UA 5GADI 4CF9A 2RDDA 1WNEA 4F4YA 3CFOA 5M1FA 1BISA 2KT5A 3J81U 2ZD1B 3P83D 4QYZK 1W25A 2JWNA 5L9NA 2B0GA 2BANA 4ED3A 4CI6A 1UWBB 3QIDA 3BS9A 2Z2MA 1FJEB 5FRMA 1A9NB 1IKVB 3NH2A 2HWHA 4P75A 3J7AN 3ADAC 3T5HA 5THWA 1WSFA 2O8DA 2L9NA 1CXUA 3CI5A 1N36K 3HP6A 3KKFA 2HB5A 3BBFA 5H9FK 2D4WA 2NLXA 5KFRA 3L4IA 3M8QA 3MM8B 1WG1A 2GAGC 4ECZA 4EBEA 4IZ9A 3QYYA 1BI4A 4EO8A 1WOOA 2MHEA 5IQ6A 2F1FA 3HM9A 2CJBA 1TV6B 4NXMJ 3MR3A 4ZTFA 1IBLJ 2KTQA 4N7TA 3PG9A 3M30A 4TXSA 5EHHA 4JV1A 4ID5A 3HI9A 3O1LA 1KR4A 5M1KA 4RW9A 5D77A 5BRHA 2DPNA 3CCUS 1LWCB 1OVYA 1S0MA 1XWLA 2HS4A 4M5MA 3DRSA 2KVQE 3EPGA 2XMJA 3BM7A 3VAIA 5A76A 4B3OA 4P7TA 2CRLA 1RAIB 4L8RB 3SFUA 4F04B 1BHLA 2VG6A 1PO6A 3KMSA 1K1QA 3ID6A 2J0SD 2B56A 3GIJA 3WBZA 1RJJA 2RUGA 1RHQB 2YNGB 2KL8A 4LSZB 2E29A 3HZ6A 3TJAA 4TYBA 1X9MA 2DHGA 5D8HB 1JLEB 3MECA 3W9IA 2HBJA 4CTAB 5HP1A 1O13A 4MQ3A 2O66A 4JI1J 3CJ5A 3V6JA 4B9TA 1RBRA 1VQOS 2OZSA 2FHKA 1HNWK 3SSSA 1PYOB 4B3SK 1NGIA 1RA7A 3BF1A 1QAJA 2FHOB 4XPEA 3MUMP 3IBFB 2AZ1A 3MM7A 3HDSA 4B3TJ 5SZTA 1SQKA 3FBEA 2EPIA 2QL7B 1KD1T 2ZM6J 1FDAA 2E1PA 5CZ2A 2MKKA 2XSJA 1ZS6A 1XC9A 1SAZA 2GW8A 3FZKA 5J1PA 3DAWA 4OHZA 4OO1J 2E88A 2OPRA 4IFVB 4HLBA 4MYUA 3SI6A 2PFUA 2ASJA 1Y3JA 1YIJS 4CJ4A 4JLHA 4OV6A 4LQ9A 1YLXA 2IBOA 1HYSA 3TAEA 3L3UA 4RW7B 1VC5A 5KG3A 1EZZB 2UVUA 4DQSA 4ZPVR 1ZBFA 1XTZA 1RHJB 4UW2A 1FDDA 3CCQS 2XBPA 3Q8SB 3IR5B 4FLVA 4H5WA 2W9CA 3TUIC 1TKTA 3LDSA 3JAMU 2Z1HA 1T6CA 4KYZA 1Q82T 4LRBA 2Q79A 5HJXA 1CJTB 2DRBA 4Z7YA 4RBTA 2RIJA 4B9MA 1RU1A 4FM2A 2QWMA 3HPOA 3OSNA 1YQHA 2CPEA 5DO2A 4WP8A 4JI0F 4ELUA 1TUGB 1RDUA 4LRDA 1URRA 3GSDA 2HFZA 1N5YA 3THXA 4X4RA 2FZCB 1EB0A 1SJ4P 2KHOA 5BYQA 1GFWB 4YB7A 2CG4A 4X62J 1TL3B 2NXUA 1T03B 1XR6A 4PKHA 2XNRA 5B0BA 1HNZJ 1NRKA 3QFUA 2YI1A 1UZHA 2JJ4D 4FJKA 4YS2A 2FBXA 4PEOA 1NZ8A 2W6LA 1N33J 2CJKA 1TYQB 1Q8BA 3SAGA 4BDZA 4UUXA 2DGSA 1NGJA 2E9RX 1XNQJ 4K4XA 3SIPB 1X9JA 3DLGA 4LF5K 3HPGA 4IG0A 2W6KA 4DUYF 4JYAJ 2YH0A 3UKUA 2WB1D 2WBNA 4FYVB 2YNIA 1Y5IB 5KFOA 2PEBA 3GSIA 4CLKA 4ZVRB 3EVMA 2BRLA 2YWEA 3I0RB 3MEEB 5LXYA 1RNHA 2XHBA 2DHXA 2DVIA 2G4BA 3CD0A 3GFXA 4O8KA 1EO1A 1YZ6A 1AZSB 3KDOA 5LOQA 1LK7A 2GV1A 3OYBA 2AEFA 3O8MA 1D5AA 5JS1A 3DM2B 1KSPA 3OR2A 3OL7A 4DV0K 1IR1A 3OW2R 4YOEA 1V4SA 1DURA 3NF6A 2DR6A 2A3ZA 4JUZA 3UVJB 5AZJB 4O3PA 4JI4K 5A8KB 4OI6A 3OSPA 2GX9A 1SI9A 2IDEA 3OTBA 2UV8A 4GVEA 1I94J 4OJRA 4BE1A 1CJKA 2YKOA 2F7TA 1G2EA 4HI1A 3MDQA 4CJTA 1NPKA 2D74B 4YHHK 1RSCA 3FSYA 1B64A 4TU7A 5HVHA 4B1VA 4DCJB 2I8EA 1KS2A 1JLCB 1WI8A 3TTDA 3DHWC 1WLJA 3MCMA 4NB4A 1BHNA 3FCHA 2IIHA 1VQKN 2KW4A 2AYMA 4Q45A 1EAYC 1JX4A 3WC2A 1ZAWA 4LJMA 4DTRA 3TP2A 5FPEA 4Z4HA 5GAEI 2IOCA 5J1NA 2C2MB 2EBEA 3JS9A 1B3TA 3I96A 2CVIA 4OYPA 1NDPA 1K1SA 2YHXA 4HHTA 2RUSA 3W2VB 1WTBA 4ZLPA 1OPZA 2VFRA 4YUDA 4YR3A 3NF7A 4CEOA 2UUAK 4YDUA 3RB3A 4DR2K 4NLSA 1TUYA 1RT4B 1VQLS 2GQQA 1TKZA 4Y1CA 5L1JA 4AL6A 5KTQA 4JI2K 2M70A 1F9FA 3VF2A 4USHA 2QWRA 4C98A 1AROP 3D0HE 1VIOA 5BR8F 3KYLA 5AXNA 3I5AA 3RTVA 3RB0A 4RLEA 3SJJA 3V81A 3MD1A 3GE9A 3NGZA 4K5RA 2CFXA 1YT3A 4KGZB 5EU7A 2CZ9A 4JKGB 3J81Y 2QW9A 2LQ8A 5AFUA 1SB6A 2BM0A 4GKJF 4ED2A 4FF2A 3FEYB 2E6MA 2VIHA 1WSVA 1YVUA 1GOCA 2NXEA 3UWTA 3CGIA 3H46O 2OTJS 1W97L 1M5VC 2P5GA 3AA5X 2GCFA 4CEFA 2HK2A 1H2UX 4FJLA 2XSFA 2XRIA 4FXVA 4DV2F 1U48A 3AVBA 5AQTA 2KDOA 4XH4A 2XMTA 5L9XA 2VQFF 1WI6A 4M3UA 4UQTA 4KREA 2IRUA 1SQFA 3TI0A 1M5KC 1K8AO 3TW0A 4Q7AA 3K58A 1YJWS 4CHOA 3BGRA 3QATA 4FJ5A 4QWBA 3IG1B 2C3OA 4E7IA 4U7UD 5L46A 2Q3SA 3H45C 1KQSM 3UR3C 3J81O 2BJDA 3FFKB 4CZGA 1NOYA 3POTB 1FXXA 2APOA 4CZCA 3KMQA 4LSLA 2ZBPA 1LOUA 3EZWA 3RBEA 2IVOA 1WC5A 2HG4A 2VG5B 4O0JA 4OYIA 1U2VB 4B9NA 4AHCA 1SCJB 3IM8A 3AD9C 4JS5A 2P9NA 5AQYA 2YTCA 5CQGA 3KHYA 4IOXA 3ID8A 4CO2A 3MCAB 2GGPB 2XEXA 4E1JA 3CD6N 2W24A 1BE4A 3W60A 4IRDA 5C5JA 3CYMA 3UKRA 4OI3A 1YG0A 4BLGA 1W0HA 2PSZA 1N52B 3PYFA 2FVSA 4XH5A 1NGAA 4WFAL 3O8WA 1VK3A 1WEZA 2W8KA 2HHHK 5BYRA 5JS2A 5ADZA 3AD8C 1B9FA 1NNEA 3F0NA 5EWFA 2BOPA 2W9AA 3OUYB 3BQ0A 3DXKB 1BOTO 3KLGA 2HAFA 4J5OA 5ADXA 4HH0A 4RZRA 1CC7A 1KP6A 2ZOFA 3WHIA 3QMQA 2QX0A 4EK2A 1BWVA 5LJ5Y 4BWJA 1S9GA 3EO3A 2OAUA 3M7VA 2FUG9 4USTA 3IBWA 1W9HA 4GMJB 4IQXA 3DLKB 1NK4A 4EU0A 4FK4A 2V7YA 2L48A 1RGVA 2P9EA 5FDLB 1HL6A 1NOZA 3MPWA 3CO0P 3IMQJ 2HYIB 2AJQA 1WSEA 5C12A 2CUYA 4BRFA 1YUWA 1HKCA 5MAOA 4DV1J 3QLHB 4C8KA 2WTFA 3T5JA 4FS2A 2KRBA 4DB3A 2RHKA 1VQPS 4G1QA 4PKGA 5HAOA 3NH1A 3J80U 1H2VZ 2D9OA 2V4QA 1YK9A 5ETLA 5ETSA 4P2SA 3C15A 1S10A 4E8UA 2HNYA 2ZH5A 2V51B 1RWVB 3VA3A 3WXIA 4H0XB 4DI6A 4QU6A 1ACMB 3CCUN 3EVWA 4FPAA 5F8MA 1RB0A 2FY1A 3CC4S 3CF5L 2OLWA 2PFFB 3DDNA 1J9AA 2E2NA 4J90A 4GNIA 3T19A 1DKGD 4CCHA 3MTJA 4OL8A 3QO9A 2Q6BA 5AE3A 2QYCA 5C24B 4KKOA 5CR4A 1TK8A 3EMTA 1F3VA 4DSLA 4DV6F 2YKMA 4BRQA 3MZIA 2UXDK 3THWB 2B4OA 3U02A 3PJWA 4S0MA 3HSTB 5BN8A 3OBYA 4X64K 3EXYA 2VICA 4J9VA 4A57A 1U1OA 5JLFA 4MAKA 3CXCR 2DIUA 1GH8A 5FD1A 5AZIA 1FFSB 2ZDPA 1JJ2M 2M9KA 5E2QA 2QE5A 3EZOA 3R6MA 2Z4PA 3AVLA 3VENA 4GKKF 1Q78A 3CDAA 3I8BA 3EM1A 3ZTPA 4CHZA 1PJ5A 2BUPA 4GMKA 3UDCA 1VQ7N 4PUOA 3P96A 4NMXA 4JV5F 1KVJA 2I6WA 4B3RJ 3T69A 4X62K 5KFYA 4B1ZA 4DCPB 1RTJB 4URQU 2KT2A 4KB0A 3ENBA 2WVBA 1QTMA 4NLGA 3QICA 2IM1A 3HZGA 3CE8A 5FPNA 4O5FA 1N6QB 1IKXB 2W40A 1XNQK 5HOOA 2G2OA 1TL4A 4DZDA 2QA4G 1QE1A 1DTQA 5M1NA 1SJFA 3QZ7A 4O55A 5IWAK 2FVRA 2EKNA 2GUIA 2EFOA 2VC0A 4I7FA 1IM6A 4JYAK 2XY7A 4K0KF 1RACB 2KZMA 1YIJN 1VGYA 4ENOA 1IO2A 1FT8A 3ULDA 1B92A 1CZAN 3R6LB 1V9OA 2DGWA 3TOQA 2XGQA 4ZPWR 3PR4A 2Y1RI 3D1OA 3D3BJ 2HWTA 3CCQN 3QGGA 4OX8A 3WDOA 4NYFA 4DV5J 2RPIA 4CM0A 4JI3K 4ZVOB 3SV3A 3FMWA 1EQMA 5JICA 1Y7PA 3F73A 2LA6A 3C2PA 4AL5A 3CJCA 3AOAA 2ZGYA 3GCXP 2YNHA 3IS9A 3G8SA 2NUUG 2MKJA 4CZJA 5T7LA 4H8KA 1CJVA 3KUGA 1SH3A 4BR7A 2NUHA 2HBYB 3SZ2A 5A2QY 2ZUAA 2VWBA 3UN2A 1Q16B 2PA3A 4ZVQB 3CCMS 5EX5A 4OLPA 4FK2A 5EY4A 1TVRB 2H48B 4RWXA 2OPSB 3HHDA 3MM9B 3OVSA 2EX3A 2R7RA 2OEJA 1SH0A 3SLCA 3AOCA 2UU9F 2CGKA 2M0GB 1ICEB 2XMKA 4WFAQ 1SJRA 1HMVB 1UPMB 5M1QA 3IGNA 2BKOA 5LMNK 4OKKA 3DLBA 4CK3A 3LP1A 1K47A 2B7BB 2ZHAA 2Q36A 1WORA 3RAQA 3RVCA 1LEOA 3SMSA 1GT8A 3KHGA 4DL3A 3OJSA 1B4SA 2IC3A 3O4NA 1VK8A 3OLAA 2QTWA 4KRFA 1QQCA 4X4TA 2QTDA 2NQPA 1B9DA 3DRYA 2YHYA 1Q8LA 2OPPA 1PAUB 4Q2MA 4MT1A 2WC9A 3IWLA 1QAIA 1Y5NB 4CLPA 2E1MC 4CVNE 2I7PA 5J1EB 2ZKTA 2VWJA 4ED0A 1S6PA 1U09A 3O9RA 1MWZA 2FJEB 2HMIA 3FMBA 2GZOA 4Y2CA 4DR3F 1H0HB 3R2CJ 1MROA 2YKNB 4R79A 1AT1B 3AH6A 2C2DA 2BKPA 1NK6A 1LWFB 3OTDA 2QL5B 3WQTA 2BW2A 2E1RA 2IVNA 1HWKA 1UW4A 4KAIA 3KXDA 4ZIWA 3ZZ0A 1DZ5A 3H1VX 2OHDA 4AUKA 3TZWA 3MMCA 1MWYA 3CJ3A 3N9UC 1X4DA 3NCIA 3HD1A 5F3TA 4OHWA 3RBZA 3MMJA 3DXSX 3BF3A 4YOXA 1U6ZA 2X3DA 4MYTA 1KVBA 2FXUA 3SBMA 1RTDA 2L41A 1YBTA 2FHJD 3QFWA 4PZVA 3CF5Q 4CD3A 2R4FA 3PLAA 3ENWA 2E5LK 2YHAA 1B0TA 3KWIA 3NY0A 4UT4A 1S97A 3JS6A 3KK2A 1GMVA 3BSCA 3D6TB 2ITMA 1VMBA 2WVFA 3OYHA 4OZLA 4PXEA 2P9CA 3T7ZA 1TKXA 4WIQA 3WX4A 3B4DA 3TA1A 1X9SA 1K0TA 3V5RA 1SJ3P 1RTHB 3F9KA 3I4PA 5KQDA 1ZTWA 2J7UA 3Q89A 1AYEA 4CZFA 4K4UA 5HQMA 4IG3B 2QJ3A 3MN6A 3V9XA 1VHFA 5GAHP 5I3PA 4ZVUB 2N4CA 4M3XA 1RWNB 3ZX3A 3UD4P 5I3UA 5KG4A 2LA4A 2M4MA 2XLJA 1S48A 2EFGA 2GMLA 1X9WA 2F40A 4L75A 4HWIA 2YWGA 2B6AB 3TX0A 2R7OA 4ZP6A 4CLFA 1T95A 3CCTA 4B8AB 4DTSA 1Y5LB 3QRQA 2CDQA 3E9OA 4WE1A 3MHYA 2AF6A 1HUXA 3IDHA 1X5PA 4U7CA 4R5PB 2Q2RA 1MMDA 2D41A 3LGMA 3R7BB 4MIWA 1VSDA 4O44A 1YJWN 4CGDA 4OKJA 2FC9A 3ATUA 3PSFA 4JI0J 4CHQA 4DQIA 3GTYX 3IR6B 2ZH6A 1YHQN 4NX9A 3RMCA 5HN0A 3MXMA 4IOAL 3IA0A 4ZVPB 4DX8H 1VQNS 4UUWA 3LANA 2M7SA 4FWLA 3W2WA 2GC8A 2VJVA 2VWKA 1FDBA 2B4UA 4P73A 5IT0A 1MN7A 4DTOA 3CM5A 1QLNA 2ZWOA 2XS2A 3GB0A 2Q0UA 3L7OA 2ZE2A 1YBAA 2DNOA 5GAGI 2CAJA 1ZA2B 4BRCA 1D8ZA 2UXBF 4WK1A 2YKAA 2AZ3A 3H7HB 5A6WA 4DUYJ 2O4GA 4A59A 3G6XA 4C0BA 4DV1K 3OBIA 4ECXA 4AHUA 2B5JA 3PSIA 3CMES 5I9EB 3M2VA 3TYTA 3KZBA 2V7ZA 3GV5B 4Q0BB 4XPCA 4CEZA 3GG4A 5BPLA 4RNMA 1KLMA 1IJEB 1S1TA 1ELOA 3QJLA 3EE9A 1H74A 3DHXA 2R2UA 5HLFA 2A5XA 1UVJA 1KKHA 3DOMB 3W3SA 2IAJB 1DJ0A 3KJVA 2P51A 4MO5A 1N5SA 2H51B 1PJ6A 1LCUA 5E0OA 3RJMB 4PQUB 2WSCC 2C3MA 1NAQA 1J27A 4KH1B 1F1BB 5CAAA 2C3UA 3HKWA 5AR0A 1KC8O 1A6LA 5AQIA 2J7KA 1J5EK 4X66F 1CJUA 3TSUA 4CIGA 3H2VE 2GHPA 3CQXA 1VFJA 4J2AA 5BJRA 3P5BP 1HD1A 4ED4A 1HBUA 5KFFA 1HBMA 4CBXA 3JB9k 1LW2A 3KUHA 4QIWD 1E6YA 1YKWA 1IR2A 3MM5A 3OYLA 3S6EA 3CULA 1RE1B 1AUSL 4NA2A 1NGDA 4F3TA 3RBDA 1DTTB 1VRUB 2B4PA 2C2ZB 3HULA 1R8CA 3EKUA 4FW1A 1S7IA 3B6OA 1U25A 2CQPA 2OZMA 3N01A 4WPAA 4I6MA 1N36F 3R27A 2QIFA 2IMWP 4GVBA 1VQPN 5LM7E 2Z58B 3ILJA 4O0NA 5DQGA 2CVEA 5IQQA 1RYSA 5I3QA 4DU8A 3OS1A 4X4VA 5BR8J 1W2BR 3CJKB 4XH1A 3H8YA 2L9WA 3W61A 3SMPA 5KGWA 1YJNS 3V9WA 5CYQA 4V19S 5FIIA 2PA8D 3NOGA 2B4VA 3D0PA 3JQMA 2RE1A 4ZPDA 5F8LA 2DY4A 1SV5B 4A8XA 2ZDOA 4RW6A 2ACMA 4GKJJ 3D0GE 3TAFA 3N6MA 5AQPA 1HKAA 3I56N 2DNYA 4RL1A 2MDAA 3PX0A 2HHQA 3W62A 3O2IA 1QVFM 4K2XA 5K20B 4EHTA 1XUPO 2XG8A 3CJQA 4DV2J 4DDFA 3ETOA 2KH9A 2WSFC 3C6AA 4DV7F 2DD8S 3D0IE 5BXIA 2L08A 3NCQA 2CPFA 4N8OA 2ILYA 4CE9A 1JXVA 4ZLLA 2RDJA 2VQFJ 5DZ7A 1D8YA 3FE1A 4YDUC 2ZD1A 4DV5K 2XGPA 2I0XA 2ALYB 3OYJA 3FCVA 4AXIA 3RZAA 3KG0A 2DXDA 2V0NA 2UVVA 4FBTA 1OH6A 3MXHP 4K4ZA 3ZSRA 2BJ3A 4CYUB 3MMVA 4NL5A 3OXFA 5JVHL 1UAXA 1ESVA 2EBGA 4LUBA 4ED6A 3RG6A 2LFVA 4H0PA 5HQLA 1X31C 3MM8A 4WFXA 3D54A 2YWWA 4F26A 3BF4A 2HURA 4NLTA 1R31A 4ZK7M 3M4XA 2LYVA 4U8VA 4MKVA 3MEKA 2A0FB 1J6ZA 5DDPC 3R9PA 2CPZA 1NGHA 2V8DA 3BN7A 2QRRA 4Y2KA 2W9BB 2H65B 2VKRA 3V2UC 4EP5A 3FZMA 4LBPA 1T9UA 1G99A 1YXQA 4AFFA 4RW4B 3E9LA 1WHYA 4J2DA 4OYXA 2M3DA 3EXCX 1MWKA 3X3UA 2BH1A 4UF4A 3CDBA 1VQ6N 4IOAQ 1UEVA 2KFYA 1X3NA 2GO8A 3OTCA 1HYVA 3FC9A 3WNFA 4CO4A 3UD3P 3AVCA 5KI6A 3D9BA 4WTOB 3G6YA 1JJHA 3J7AP 1WG5A 1TAQA 4FJIA 3VQCA 1VQ8N 2XYPB 2HNZA 4KI6A 2AWZA 3UDEA 4FKYA 4E2FB 1JLEA 2CQ3A 4EZ9A 3RW7A 3E3XA 3HF5A 3VQSA 2FGCA 4NLRA 3R9LA 4CTAA 1PC4A 4RO0A 5AE1A 3ZZRA 4CLLA 2ZBRA 5KT5A 1X5OA 1LAVA 2FSNA 2XMVA 1FRLA 2MKHA 1RDBA 2RS2A 1B7YB 1XJWB 3PCOB 3ZTSA 2Z2YB 3CUNA 1HLWA 4EIAA 3DKDA 2EC2A 2J9DA 4RW8B 4HTIA 1NGEA 2ADBA 3HFKA 2GVZB 3VEZA 2I2YA 4CH0S 3FBCA 4R8UB 2ZGZA 1NKBA 2X6SA 1QY7A 4C3LA 4LF5F 4PCQA 2VL1A 2J9DE 3GG1A 2WFBA 2DNLA 3P49B 3S3NA 2Q1LA 3ENQA 3KIOA 4K5SA 5IXUA 4USUA 1RABB 2KM8C 1SIWB 2FBVA 2X74A 2VA2A 3TUJC 2P9SB 1U47A 3J7YU 4C8MA 2HBKA 3KKSA 3ZCMA 1X0PA 4RW7A 5KT7A 4TQSA 4WXOA 2HF4A 4J2EA 3M6WA 3HVAA 4RR5A 8RUCA 4QCLA 1NGBA 4OZ2A 2YJFA 5AE2A 3O4QA 3SSRA 3OTOF 4OX9F 1QSYA 1IUJA 4QOTA 1RADB 4DV0F 2DNQA 1MMLA 3HVWA 2CNKB 2DGXA 5GADU 4N5SA 1J53A 4OPAA 2QWNA 2JVOA 2LXUA 3M8PA 5F2RA 3AB2B 1CJTA 1GEHA 4ZPBA 4FJ9A 5KFIA 5KFMA 2BQUA 3LPUA 2YX4A 1S49A 5FLXY 4YHHF 2FC0A 4DV6J 4RUAA 1KAZA 1GXTA 3QNNA 2NRHA 3FZ2A 3CD7A 4JRPA 1TL3A 3VAJA 2G13A 3CC2N 5KFHA 4RNHA 1VQYA 3AV9A 2FJDB 3NGRA 3CCLN 2CJYB 3TZXA 3GV7B 4O8UA 4FDFA 4PY5A 1TYQA 1UJ5A 4NXNF 3I82A 3AVMA 1JK9B 2XNQA 3O08A 1RI7A 1VS3A 4KO0A 4B9UA 4GKKJ 1VBXA 3J7ZO 3OA9A 2UV8G 1RT3B 1XNRK 2GQCA 2YPYA 3BDPA 5ETNA 2GV9A 4HVJA 4JK9A 4Z4IA 2DJWA 2VPZB 4DR2F 2N4DA 1U0HB 5EWGA 4ANCA 2VOPA 1H1VA 1NZAA 4Z37A 4JV5J 1UJ6A 1HNIB 3A13A 2DPIA 3I0RA 3CEDA 1HLUA 3MEEA 2NYHA 2XLKA 3MAAB 3DRRB 1ZH5A 2RE2A 1C0TB 3MWBA 3CJ7A 2OCEA 1AZSA 3DCAA 2HS3A 5ITHA 2DNHA 3P39A 2MY7A 2PI5A 3ZSVA 4CEAA 3N28A 1M1GA 3DM2A 1JJ2R 2LDYA 4ISGA 1M5HA 4K0KJ 4C9DA 1S12A 3ZZPA 1ZBHA 1Q7YT 4UY8O 1RBTA 1R59O 4G6VB 1YTAA 3MGJA 1BO5O 4WFYA 1OSCA 1NCLA 1LQ9A 3VR1A 1CBKA 4PWDB 2UZAA 4FL9A 2CPJA 4UY85 2GVDB 3HHKA 4EBCA 3K9KA 1U8SA 3OFGA 5C2FA 1HHTP 3ZSOA 4BQZA 5AQRA 2CGJA 3OYKA 2K7KA 3GOIA 2B8PA 1HRHA 2KXFA 4ED7A 4BR5A 2NNWA 2O67A 3EGVA 1ZXOA 1FW6A 4KBIA 5JVGL 4WU2A 3H5YA 3L2WA 2HQCA 5FRNA 1Z25A 4KFBA 3LWMA 4I2QB 4O3RA 1NMNA 4QWEA 1IBMK 3L2RA 4ZHRB 1RT4A 1RILA 3HVTB 4Y65A 3K2PA 1OY9A 3HD2A 5F8GA 3H3OB 3FK4A 4OZ3A 3EGZA 4YFUA 3CQYA 1C0UB 4KTWA 4CO3A 4K4SA 2D0PA 2KZZA 2XYHB 2UU9J 3DC2A 1JJ4A 2H3GX 2NCKL 3ZT4A 1FE0A 2V2QA 3OQ2A 2HW3A 1YJ9N 2IYIA 4P2MA 5D4LA 4BC2A 2CNLB 3OFFA 2RHQB 4JKGA 1ZTTA 2V2KA 3R1HA 1UFWA 3CMEN 1HHQA 1HKGA 4BRAA 3D1QA 4DL0C 3T41A 2OUGA 3HO1A 4MDAA 4RNNA 2XY8A 4X4UA 2GWJA 2GHVC 2OSQA 5ETOA 2BGGA 1S77D 4M8LA 2DXFA 1DLOB 2R42A 1BMQB 4TN2A 5KPRA 5EXWA 5LL6d 5KT2A 4BRDA 5BR8K 1X5SA 2AV5A 1RBVA 3L7PA 4R25A 1BQNB 5KPZA 2YCHA 2NLWA 3ITHA 2HHHF 3LDNA 1K73T 3M1VB 2F5GA 4N76A 6FD1A 4JD2A 4DR3J 2ZHBA 4GKJK 3HHLB 1T02A 3CCVS 3WC0A 4ISFA 1MG7A 3BR9A 3IAYA 3PRDA 5CCMA 3LOUA 4P10A 5ETVA 3R5JB 2WRMA 5HMWA 3PW7A 3OFHA 4FF1A 3Q22A 4FZYA 2PN6A 3IG1A 5AQWA 4CW7B 4K2JA 4O3OA 4DV2K 2OTLN 5K14A 1C6VA 4BBYA 4ZPTR 5HRNA 1VQMS 1LXNA 1QAYA 1WTFA 4C1NI 4NEZA 1RBAA 1A0OB 3CC7S 2VQFK 2CPHA 3K57A 2Z0GA 2MHNA 4DZ6A 3QETA 1U1NA 1RAFB 4E1NA 2R7UA 3M1FA 2YQ0A 2W2OP 3HT3A 5CZVA 2EEYA 2OEKA 1Q8IA 2NRXA 3E51A 2Q1NA 4Y28C 4BROA 3IAM9 5KFUA 3SBGA 3TPQA 2CYYA 1U2VA 5AQNA 1NJIT 3MOJB 2V8HA 4LF7K 2OMOA 2BV3A 1FE4A 1S5JA 4OQJA 2GGPA 1NU0A 1ZBSA 1F5CA 2PD1A 3TJ8A 1CLFA 4DTPA 4RNOA 3DLLL 3NE6A 2X1FA 4UTGA 2AGPA 1J5OB 3KLIB 3BY5A 1KVIA 4LRCA 1P27B 1F21A 4DSFA 2LQJA 4CIOA 2HGLA 3H3NO 2K3IA 4DFMA 2QYGA 3SCJE 3A0IX 4DTJA 1JNZB 2DCLA 1S9EB 1T94A 4LF9F 1Z26A 1VRTB 2D0CA 4MTPA 4DG1B 2Z8QA 4M5IA 4QYRA 4DQRA 4HHUA 2K1RA 1NO8A 3KNGA 1G7CB 1AFIA 1DRZA 2WTUA 2QMWA 4CD1A 5GAEU 4PYDA 2FF3B 1AFJA 3TAQA 3VQ6A 4LF4K 4QJVA 2R7VA 3A5LC 2J9EA 4ECUA 4DQQA 1NH7A 5M1PA 1RTIA 2E8AA 8ATCB 1MDUB 1KOOA 1X4EA 4X64F 3MMAB 4WXWA 2FIUA 3Q8QB 3DLKA 3U1NA 1HBOA 4F3OA 1T6DA 4CDIA 3FZBA 3DGVA 1WHVA 2N7YA 2YQ1A 3TWZA 1CZ9A 3TABA 3NKYA 4A2BA 2ZZMA 1HQUB 3QLHA 3QPIA 2XS7A 4Y1DA 2AQ4A 1O8BA 4BR9A 5ETQA 1YF5L 2HBMA 1OO0B 1ZYQA 1Y9OA 3UO0A 3RU0A 5J2MB 1C4CA 1JWWA 1UL3A 3V4IB 4ED5A 3MR5A 4BS2A 4KRWA 4JI8J 1TMMA 1JLBA 4EFAC 1MU2B 2PZSA 5D4PA 1TMJA 3UB5A 2C3YA 3H5SA 1RKJA 3TU5A 1HJRA 2UXBJ 3U3GA 3C19A 1BA0A 2CGLA 2YQ3A 4B02A 4E0DA 4Z7CA 1H6KX 2F4VF 2W7PA 4ECTA 3A3NB 3NOCA 4QW9A 3C16A 3H5UA 5IWAF 4C11A 3DLEB 2E66A 5J2QA 4USJC 1BGXT 5JVGQ 3CCSS 4JK7A 3L3CA 1BWEA 2NUBA 4Z4GA 4V19J 1Q81T 1IWAA 1UVLA 1R8BA 4RJVA 3O44A 1ZAVA 2O3DA 1QVGR 3WNGA 4DMZA 1F6TA 5C24A 2F8EX 4C0OC 4LD0A 2L3MA 4Z4CA 3A3PB 3EJMA 4JI3F 2LU1A 3ET6B 5CYMB 2J0XA 4CNZA 1CSJA 1S1XB 1FFWB 2HZAA 4PXDA 5HSPA 2QG9B 2XMWA 4X4QA 2G1DA 2E5HA 4D3GA 1GOBA 4X66J 1NHKL 3G87A 1WB9A 5BREA 1AB8A 4DHYA 4E7KA 1JCEA 3MI7X 3A4TA 5AQUA 5E84A 4ICLA 3NXZA 1Q5YA 5KG2A 3RB4A 1R0CB 4BRGA 4KHMA 3KLVA 3TANA 4DV6K 3BGUA 4QYZJ 3AY9A 4DPYA 2IIRA 1RWUA 1NGFA 4MO4A 5CE3A 4Q8EA 1E4GT 3D67A 3GCWP 3ILLA 1RTJA 1MW7A 2PIIA 3BEGB 2VOOA 3QGIA 4JKEA 2V52B 3NBPB 1N6QA 1IKXA 1N36J 3LP2B 3RMBA 5H9FJ 2DFHA 4KV8B 4GKKK 1PJ7A 1JXLA 3AFGA 1BQMB 1CXQA 2E1YA 4PHTX 3SCXA 3BR8A 1YGYA 1FK9B 4OHXA 3IRXB 3WZ0A 2QLBB 4K25A 5HROB 3OYNA 2JEIA 2ZBCA 2G8IA 3QAEA 3VN5A 3OS0A 2R7XA 1S59A 2P9UA 1LWXA 4FJNA 2YY3A 2KVIA 1FJ7A 4M42A 4J9KA 4RU2A 4YOYA 5KFXA 2BQ3A 3J8AA 4V1Ak 1GLEG 3IR7B 2W25A 4CZKA 5F9LA 2QKKA 5KFPA 1OY8A 2EFPA 2YVSA 1L3UA 2R7QA 4W5TA 3O6QA 1OVQA 4DV7J 3Q24A 1XEZA 2E5JA 3NWRA 5I42B 1CS4B 1KFSA 2HBLA 3G0ZA 1HD0A 3AA9A 4ZN1A 4QOZB 1VIXA 3KFWX 3W3DA 2ASOA 4LT6A 4RCHA 1SC4B 1GXLA 1TVRA 3DLLQ 4Y34A 2OPSA 1EETB 1REVB 1WKLA 3MM9A 1I5OB 4ZVEA 2IS3A 1HHSA 3SUOA 3PW4A 1WSIA 2Z2LA 4OZ5A 1HQEB 2HKEA 4DSKA 2WONA 2LECA 4ZCLA 4QAGA 3HP9A 3VPZA 1HARA 4RKUC 2ZBIA 3ULHA 5KRTA 2FDNA 4H54A 4IR9A 1QVFR 4JHDA 4BACA 2E5LF 1HNWJ 4OHYA 4DR1K 1NSPA 2CNNB 2OKQA 4FVUA 2X6NA 4PG7A 1H73A 1FRIA 3D2EB 4M5DB 3VQEA 3LM9A 2G8UA 2HHTA 2HHUA 2NSBA 1VR6A 5D3GB 4FYWB 4C48A 1GLJO 3N6NA 3WNEA 3HM8A 4A47A 4MKYA 2UU9K 3K2YA 4IRCA 4I56A 3GIKA 3FSXA 3A5NC 1NDLA 1IV0A 2D1KA 3PO5A 1EIYB 5J1EA 5LJVA 3GIMA 2MQOA 2J4RA 1QDUB 2P9PA 2ZJQL 3CMAN 3FSIA 1HWUA 1RGIA 1A5XA 2ILZA 2RKIA 4WWSA 1RDAA 3M2UB 2PGCA 3W7BA 4CK2A 1LW0A 4BC9A 2YKNA 5DZ6A 3AGKA 3HSDA 4LIRA 4IJNA 2V4RA 3MCOA 4CT9A 1HFEL 4JB8B 1WC1A 1WKJA 2BANB 4J9MA 3D2WA 3CETA 2P9IA 2YWFA 2X1AA 1BWFO 1G3OA 2KFNA 4FLWA 3Q8YA 3VGKA 1TL5A 2F3JA 4J9UE 1BLUA 4OI4A 3L09A 2FYXA 2XZTB 2B9EA 3CNQP 4UZBA 2YKPA 1KLNA 4BRKA 5KAKA 4C1NK 2O8DB 3R1LA 2DRDA 3QB0A 1N34F 2CNOB 3KKRA 4W90B 4WZMA 3M8QB 2A6MA 1TL7B 3JYTB 1TUVA 2EG2A 2H9ZA 2JWKA 1U02A 4DBQA 1HNVB 2H54B 2MLXA 1BI4B 5AFUH 4CGJA 4G1PA 3FDSA 1RT1A 3VTHA 3LWLA 2LXIA 2R8JA 5KFZA 3M30B 3DWLA 4ECWA 3BPSP 2PO4A 4ID5B 4W5OA 4C6AA 4JN4A 4LF5J 4RW9B 3W65A 2VZ9A 2P2CB 2UUTA 1U1LA 3A5OC 5B0DA 3C14B 1AUDA 2DHSA 3H4BA 3PVXA 1E6VA 1NU4A 2Q97A 3O6WA 4M63A 4ECVA 2W41A 4XEIA 4D3HA 2E2QA 4B3OB 3AAPA 1BIZA 1U2FA 3DI6A 4NOHA 2VG7B 4GC7A 2D0BA 2VG6B 4LF8K 3E66A 2SXLA 3Q8UA 5EX3A 1XK8A 1C0MA 2FHJA 1GNKA 3M6UA 1BDGA 4CGIA 1OMSA 3K7RA 3OTOJ 4OX9J 5A0YA 2HLUA 4XDCA 4DV0J 2DR5A 3BGLA 1LFWA 5D0HA 4R5PA 4EMDA 4DTUA 4QIEA 5TKYA 5HP1B 1FKOB 1FWKA 5KG0A 1FX2A 3A8JA 4ZKAA 4KBOA 4Q2LA 2OD4A 1J5EF 2VBZA 1S22A 4OJ1A 2BUNA 4YMEA 2FBTA 1VQ9S 4YHHJ 4IJAA 3G82A 5D4NA 1H3DA 4H5TA 1HNXK 3PJXA 2VDHA 3CSKA 1NJWA 1Q4RA 4OYOA 3DU5A 3SUPA 2IM3A 3NMRA 2IHR1 4A8FA 2VFTA 3CCRS 1VQMN 3C6TA 1YVFA 1I51B 3MM7B 4CQ1A 2ZHOA 2ZITA 3IGVA 4M3TA 2DNNA 1KBRA 3CC7N 3UE2A 3OFEA 1JL1A 2PY5A 4NXNJ 1BCOA 1TTHB 2FJBB 1SUQA 3G6ES 4K4TA 3CJ9A 3O3HA 2KI2A 4A62A 3NS6A 1RU2A 1MLAA 2AIRB 4ERDA 4NASA 4NZ6A 3FUYA 2RRAA 3R3LA 4AT1B 2BRKA 5AQGA 4NLPA 1YI2S 4U95A 4EFHA 5KFCA 4DR2J 3A8IA 3HZEA 1HJOA 2VPXB 2W4DA 4KHPK 4CJEA 1HYSB 3VF4A 2BE9B 4Q0BA 5IC6B 2Z1GA 3CQ8A 4C3KA 3S3MA 2HAIA 3GU0A 4F4ZA 1T05B 3Q7BA 2VBWA 4CWBA 3NG8A 4HL9A 3JTPA 5ADXH 1ASUA 3MUTP 3M5RA 2V2ZA 1Q86O 3E1YA 5F8IA 2GO9A 4HTLA 4RWWA 3PHEA 2UXBK 4HCBA 4A5BA 1S7HA 5G4DA 1N5TA 3RMAA 2IJRA 3KWGA 1VYAA 4QQBA 1U1RA 2GMJA 1JJCB 3B4MA 1M90O 2GS8A 2H1YA 3A8YA 1BXNA 4DFKA 4G1IA 1N5YB 3THXB 4BC4A 3LAKA 2Y3YA 1WC0A 1YZ7A 3VESA 1RUSA 1U8WA 3AO2A 4OIXA 1IH7A 1VAZA 1S6QA 2K2PA 2DGOA 4BC3A 5M2PA 1HPZB 2P6SA 4DPTA 3MCSA 3J7YI 5B8HA 5D78A 1NB2A 1PGZA 5DGBA 1RBSA 3DLGB 2IY5B 1VRUA 4ER8A 4UOCA 3GR1A 3IXQA 2WOMA 2WSEC 4FN5A 4C23A 3W5YA 4X66K 4Z4FA 1QZ6A 4J91A 1K8AT 1NJYA 1REGX 3OR1A 5B0GA 1JQGA 1P9QC 2YNIB 2AX0A 2ZJQQ 3T1YK 4WKRA 3TSQA 3QBCA 2MGZB 5L1IA 2J5AA 5AXLA 2A2DA 5M1OA 4FXWA 1NGGA 3PW5A 1UZDA 1N56A 4PABA 3SYZA 2FGOA 3BDEA 1WSRA 2BEFA 4X2BA 3MWPA 3ZZUA 4IDKB 2F96A 4OPKA 4DL4A 2FLPA 3NWGA 4C3MA 4JV2A 3VGUA 1H72C 3OR2B 5GMKa 4I4BA 4JI6F 3O5BA 3TX8A 1SV5A 2IRXA 5D0GA 2JGUA 2QWLA 3KK3A 3TAMA 4E7JA 2UUWA 4P7VA 3O9TA 1RP5A 3H90A 1CJKB 3KD5E 5KFVA 3TVYA 4G9ZA 5DRKA 2A41A 4IEIA 3KLHB 2ZBQA 4E19A 1ULRA 1QQMA 1XI1A 1MMNA 1YRTA 3CDUA 2UUBF 4M45A 3B54A 5KGXA 2PT0A 3KDNA 2NRZA 3R5AA 2MQMA 4FWSA 2D69A 3NHGA 1K44A 2HHHJ 2HF3A 1L5UA 1JLGB 4ATNA 4FPBA 2P5VA 1UAWA 4ILMA 4AH9A 3RR8A 4GRSA 4E1MA 3UD5A 3U3YA 3THPA 4KIAA 4FF3A 4CYUA 4WFZA 3PRVA 2ETJA 4H4MB 1WSGA 1N32F 3TZYA 2IBKA 1TKZB 1WEYA 3QGPA 4L3QA 4DV7K 2E9ZA 2GJ2A 5CZ1A 2WVDA 2VUGA 4BGAA 1R6VA 5GAGU 4M95A 3OLBA 4FW2A 9ATCB 3W1YC 1U2CA 3BUZB 3V81B 4IQMA 4J9NA 3GFYA 1IJJA 2MQQA 3TZZA 1O1WA 3VQAA 3E01B 1YSJA 4KHSA 2W9BA 4LFCK 4PWUA 1TK0A 3AJ1A 4ZS6A 3TWHA 2MKIA 4RW4A 5T7BA 4OYWA 2D0AA 4CJRA 1N0VC 2OELA 5BR9A 1F9EB 4K41A 2JRSA 4FO0A 1S72S 1KHVA 2ZH2A 3I9V9 4OLBA 4USVA 1XC3A 1WC6A 3SXLA 1JKHB 1BD6A 2XWXA 2WCXA 3PR5B 2B9WA 3ZT2A 3R5DA 2MLYA 2K3KA 4NRUA 2MQ8A 3DXBA 2D3UA 1KN6A 2YWHA 3GQCA 2FF6A 3N0VA 2GNKA 3G4SS 5IM0B 1JCGA 1TFYA 2DNZA 3A5MC 5HBMA 1QAXA 1ZETA 3TSPA 2WW8A 3NFAA 5T14A 4M3RA 3VV2B 4YOWA 2V2VA 3RSEA 3I32A 4LF9J 2BR0A 1NHVA 1C1BB 4DLGA 4ANEA 4EI2A 3BGRB 4NCAA 1WG4A 4MJKA 5KFGA 4AM7A 4I0WA 3MEDB 4ES3A 3P4UB 4OVLA 4M41A 3FR0A 1U49A 2UXDJ 4F25A 1VRQC 3ULEA 3GJRB 1NBWA 3O3LA 2MXYA 4W5QA 3A8EA 4X64J 3QIPB 2AEJA 4NA1A 2MPUA 3TUZC 3KHRA 3QEXA 1VK0A 4CJPA 3VQ5A 3T1AA 4WKYA 3OVBA 4R8UA 1FJGK 4ECQA 2HSEB 4XIUA 4CRJA 1R8HA 2ZOMA 4WK3A 3V9SA 5IT9U 2N7CA 3PFOA 1WAJA 1XNRF 3QINA 2XZDB 2Z1JA 5HRPA 2MZJA 3O3GA 2E5IA 3AODA 1VSFA 2KB2A 4FLXA 4FJXA 4OX7A 1FX4A 1H7XA 3GJQB 2E2OA 3I55N 3UKRB 2V9KA 3NNAA 1NK8A 4B3MF 4WYLA 1VSIA 2ABYA 2VBYA 2EVZA 1LKZA 4CZLA 3GJTB 3H0PA 2KM8B 2DISA 3HHEA 4CJ3A 2CZVC 1HW8A 4K8RA 3MFHA 3LQVA 1UVIA 3TUPA 2F4VJ 2AX1A 3MWTA 5B0CA 3BSAA 5DMRA 3CD5A 3OVAA 1Y97A 3CCJS 3QGHA 5IWAJ 3KLGB 4FPIA 2QWQA 1IKWA 2X7IA 4EEYA 1RZMA 1OH8A 4USWA 3PY8A 2Z57B 2HS0A 3NAIA 2OI2A 3K5NA 4YOTA 2BVZA 3PZPA 1T9TA 5IOLA 1JLQB 1R0BG 3SJHA 5DQIA 4AL7A 1S9GB 3DOLA 4ZMMA 4WU3A 9RUBA 1VLOA 3LW5C 4JI3J 4DN9A 3HX9A 4P72A 3K17A 2EG1A 2PMHA 3OTOK 2UXCK 4OX9K 4RUCA 2W2MP 3VAGA 2LEBA 1QUPA 2F8SA 2RF2A 4G3IA 3ENHA 4IWVA 4F4XA 3RRGA 1VSLA 5JUMA 1TAUA 4NA3A 4NYOA 4ZJLA 2IYGA 2DEIA 1RT3A 4TY8A 4G1QB 2R9LA 3L7UA 3MR2A 5H9EK 2RAQA 1IBMF 3C15B 4I6AA 4DTXA 1VQ4S 2XCAA 2HNYB 4AYBD 5TKWA 1FESA 2JLEA 4GY2B 3AJDA 2R7SA 1D09B 4HYKA 4F4KA 3MX2A 3MAAA 3DRRA 3MPDA 2V8PA 5EUHA 4F8RA 4NXNK 3U1LA 3NCPA 3A2FA 1HYZA 2AP6A 3BEXA 1N48A 3FFIA 5G0RB 2UP1A 3DRPB 2DEJA 5B09A 2FJAB 2ZC3A 3L6QA 1Q5VA 1R8PA 1C2PA 5LMNJ 1BQXA 3ISND 5J2NB 3D4JA 5FJ4A 4UOGA 1I39A 4IFYA 2G8KA 1RT2A 2R2RA 3QSIA 4EYIB 3VQ7A 4OZNA 1TL1B 4ECSA 5B7WA 3PKYA 2BMBA 1AXQA 1WUUA 4ANDA 4CJUA 2YKMB 1FF2A 3FBFA 2XULA 4PWDA 2BE2A 4ZJQA 4F3QA 3MAHA 4FP9A 5AQVA 4NRTA 5AZIB 3VEWA 2MSTA 1P6TA 4CJVA 4C7QA 3OW2M 4NMLA 4IO9L 5A2QU 1HBNA 1WN7A 4I64A 2CPYA 3JQKA 4EYHB 2W42A 1SC1B 1Z6RA 3CDWA 1VQ9N 3UDVA 5DDQC 5HO4A 3MM6B 2AHOB 4PUOB 3MK6A 4OZJA 4I2QA 3CM6A 3HSZA 5AQMA 2DH9A 4C8OA 4ZHRA 3JSBA 2DCUB 4HR2A 1ATNA 2QV6A 2YXLA 4I67A 3MN7A 1C0UA 3K5MA 1EQ0A 5B0AA 2QMUB 4DQPA 2GJIA 1U7LA 2KQ2A 3I0SB 4P74A 5HJYA 1YITN 2GMHA 3QJPA 4KHWA 1GLFO 1YI2N 1C1CA 2JEJA 5CCLA 2FHMA 4J9OA 3K5PA 4YEAA 4I7FB 3KLEB 2J8SA 2ZH9A 2E5LJ 5CZXA 3WIUA 4LH4A 2PMZD 2MZRA 2H3EB 3PIPL 1B70B 1RT6A 1TR0A 4LF7F 2PEHA 1I94F 5DQHA 1UA0A 4TQRA 2NR0A 1VCTA 2HOEA 4BRPA 2E5GA 1F60B 2IDOA 1DLOA 4X4PA 5LSRA 4BC5A 5KG1A 3L2VA 4DV4K 4L76A 2XMAA 4L73A 3RUBL 2KRRA 2CH5A 5C2CA 3SUQA 2GFFA 4IO8A 3KK1A 2J6SA 4MK7A 2D5RA 3O1WA 4Z94A 2CQ0A 3SBTA 5T7LB 1NNDA 3M1VA 1CJVB 4CJQA 1QHTA 3HHLA 1N5VA 2YX7A 1PAEX 4Y0FA 3I5BA 1J2VA 4P2XA 5ETMA 4CF0A 5KT4A 1MWMA 2E6LA 4CIEA 4LF4F 4OYMA 3DLHA 4PA1A 2ROPA 4CF2A 5KFTA 4I9LA 2NRTA 3WXLA 3CO9A 2LSNA 5JXSA 3IRWP 1E4FT 1BUPA 3OVNA 3V9ZA 1IBKK 1NSQA 3N4PA 1EKSA 2W1BA 3B8AX 5CD4A 3SI8A 1SQGA 4ZDNA 1KAXA 1JMTA 1N34J 1S4EA 2WW4A 5L8RC 2MB0B 4M1KA 1T8EA 4CNYA 2MYFA 2MQNA 4JEPA 1D9AA 5BRDA 4N56A 2IGIA 4CFBA 2QSFA 1VBKA 3W8GA 3DGPB 5D15A 3ZSQA 1U24A 4X65K 3MXIA 3R5BA 2OPPB 3B82A 1KDNA 3TJ9A 1FNMA 1NJXA 3KLFB 2IVFB 4LF6K 1JXBA 5GIPA 1Z1ZA 4YY3F 1Y64A 2C1EB 1X8DA 3BV8A 1OY6A 3UI3A 3Q0AA 2HMIB 4OZ1A 4H4OB 3P6YC 2QM1A 3AO4A 3QEWA 3UE5A 2BJEA 1ASVA 4LBIA 1OIAA 2Q43A 1EJ7L 2OANA 2FVQA 4DG1A 3AT1B 3NGDA 2VGNA 2QFIA 5M2RA 4Q5VA 1WOPA 5IT9Y 5GIOA 5KG7A 5ETKA 3IAS9 1XERA 1T0TV 2RU9A 4NLUA 3EE3A 1G1XA 3OS2A 2B43A 2XYGB 3M9NB 5HQ8A 1VHIA 2E7WA 3TAGA 4BG9A 2HGMA 3H6EA 1WOSA 3IN5A 3PIOL 3MMCB 2HBZB 2WBRA 3MMAA 1LNQA 3FVYA 3WXKA 1SJ1A 3BPDA 3H08A 1J5EJ 4A8QA 5E3AA 3FRYA 1F2HA 1A7GE 2GTDA 3MEGA 1SC3B 1HI0P 4IEEA 1RTDB 4LF9K 1NXIA 4DMNA 1I6JA 3L3VA 3IWXA 1F3FA 3T6BA 5BRFA 4ED1A 1KC8T 4CLSA 3KK2B 1Z4UA 4CEBA 1HR0F 4ECYA 3C6HA 5J2MA 1N4LA 2R8GA 1JIHA 1TKXB 3GE1A 3V4IA 1UEUA 4WQ4A 1B0VA 4KHQA 2CWXA 2P9KA 3M8WA 3DJCA 1WD6A 4ID1A 3OXLA 2QA4S 1MU2A 4HEA9 1IG8A 1JLFB 3O9QA 5IT9O 3FQLA 3BREA 4KE5A 1K6YA 3W8PA 1FRHA 4CERA 4YOUA 4IO9Q 1LOTB 2MJUA 3NNCA 4DL5A 1F2GA 1ZZFA 2FVPA 3BKUA 2RN2A 4A8YA 3HT0A 4LVOP 4JI5K 2NXNA 1S72N 1RAHB 3BZCA 1VQON 2DITA 2HEKA 1FWPA 3NS5A 2P9LB 3Q8VA 4PAAA 5KFAA 2B9YA 1FD8A 3NEKA 3HJVA 4IH7A 2IM2A 3QBWA 3AA8A 1T11A 5J2PA 4TLRA 4F3MA 5EN1A 5AXKA 3F44A 8AT1B 2HRTA 1VQKS 2NXCA 3DLJA 3JQJA 4EZ6A 4O44B 1BC6A 2JSXA 2F4VK 4E98A 5A8WB 4J9LA 5AQFA 3AXMA 4QZVB 1LK5A 2QFJA 4YR2A 1TFWA 2EWHA 4RTFD 3LZJA 5K8OA 4CGGA 4DPOA 4O23A 3OHRA 4CJ7A 1X4GA 3M9MB 2AJFE 2QLFB 3WUHA 3BH7B 4EP4A 4O4GB 2G8FA 3TA2A 1NJZA 2LXFA 3SQGB 3OYAA 4CBWA 5M2UA 5I3UB 5GAHI 1MNEA 3VF0B 3J81j 3TTFA 4CZEA 2ZE2B 1SJQA 1WUAA 1RAJA 4CLZA 3AA3A 4LR8A 1ZPVA 2YHWA 3BBBA 5JMNA 4NLBA 4CLTA 4U8YA 2VJUA 3CXCM 4F0HA 1ILYA 1SKRA 2D3OR 2BYCA 2HIYA 1VSEA 3O9SA 2QKBA 2Q0RA 3M2VB 3V1RA 4KV8A 3NLCA 3VQ4A 1BQMA 3T3FA 5IV3A 3JSRA 2UUCK 3ZFVA 5E33A 1KLMB 1S1TB 1PIEA 3N4WA 4DR1F 1Z2ZA 3TR5A 3D3CJ 4MKBA 3DOKA 5HLFB 1FK9A 3IFEA 3S01A 3KJVB 3MMBA 4P71A 4JS4A 4H5VA 2HPUA 4JI6J 1U6BA 2ATQA 2LP4A 2VODA 3SAFA 1K9MO 2WHOA 3DXMB 4AQYK 1CEZA 3AO5A 2QWPA 3OPKA 3T5KA 4GO7X 4J9PA 3QJJA 1M5OC 3JSMB 3VHQA 4NI2B 1S57A 2X1GA 1HBUB 1HBMB 4Q43A 2AYEA 1LW2B 2UUBJ 3HHNB 1SS6A 1E6YB 4Q44A 5I42A 1KHWA 1RDRA 3MM5B 4E7LA 4JI7K 2BX6A 3PO4A 2QLWA 3M2RB 1U26A 4QS9A 5C25B 4F2RA 3PX4A 4MLEA 3AO1A 2C3PA 2OPQB 1K8KB 1REVA 4GVLA 2J0WA 1ZPWX 1BG3A 5A2QO 1SL1A 3ZTRA 5HI7A 3OYMA 2UVWA 4NYNA 5ETTA 5I4MA 3TR8A 1S1VA 1ZM2A 1R3NA 2EFVA 4PQAA 4O0IA 1RWOB 4GVBB 1HIYA 1N32J 3VZHA 3MUVP 3L2QA 1FKPA 4XDDA 3NGYA 3DYAA 2DNKA 3NVKA 4J2BA 3P5TL 3ENOA 1DAXA 2YNFA 3VA0A 1EP4A 1A5WA 5BYSA 1UCNA 2ADCA 2YX1A 5A6PA 3S3OA 5CYQB 4F4AA 5IS2A 2VYPA 2XQCA 1VI7A 3U1MA 1WBDA 3KUEA 3T9NA 5D3GA 3V4MA 3R5CA 3PIOQ 4B1YB 1JLAB 3BYRA 4OJ3A 4FZXC 1PBUA 3UNYA 2CPIA 3HL8A 1VQLN 4N8NA 1CQNA 2ZZTA 2HQDA 3EPIA 1UMJA 4F50A 4LF8F 2O8EA 3NH0A 2ZH3A 3LDPA 3VQDA 2DBBA 2RD5C 4KC5A 2EXUA 4DQ8A 1XMOK 3LPYA 2H5JB 4QU7A 2Y9HA 4BR0A 1U1QA 2ASMA 4KH0B 1R43A 1FTCA 3BO2A 1RHUB 1VSMA 4U67L 4LMZA 4ZVGA 2JFDA 2W2PP 1KVAA 1NDCA 4HTUA 4WP3A 4YN3B 4ELTA 3VALA 2HZVA 2OTJN 4MFBA 4C2MA 1P8ZA 5E5NA 2O8BA 3KOAA 2YKQA 1TL7A 2OGUA 4CHYA 1HNXF 1G6BA 3JYTA 3HRGA 2HVDA 4AHTA 4DV3K 1HNVA 1LWEB 1S5ZA 4FWKA 4FLTA 1YWXA 2V5HG 1PKUA 1SIZA 3T1HK 1FTRA 1V5VA 3N4QA 4NLXA 5SWMA 2E9TA 3H42A 4ZJOA 2K06A 4DU7A 1VC6A 1RAEB 5KQ8A 2FD2A 3AB4B 4B9SA 5DG7A 1TP7A 1IR0A 1XNRJ 1VC0A 1XHZA 3S9HA 1T9YA 4H4KA 4CEEA 1N34K 3C14A 4DS5A 2W01A 2FJWA 1WELA 3AQOA 4WJBA 2D3O1 2GAHC 4J8FA 3TQ1A 3NF8A 3J7ZT 4B3MJ 4KHPF 3SV4A 3RB6A 2FZKB 4BRHA 2ATCB 2FC8A 2VG7A 4MDBA 4FJ7A 4DX7A 4UZCA 3OYCA 1CG2A 1KQFB 3L2UA 5AQLA 2E4LA 2BKNA 4FWPA 4CGFA 1WEXA 2ASPA 1ZBLA 2DRAA 3HMJG 3T5LA 3BB5A 3WIVA 3D28A 3QQCD 4I1TA 1LFPA 1ZM4A 4I6YA 1UVKA 2YH1A 2HNZB 4DL6A 4DR5K 4B1XB 4IBNA 5FLXU 2EHGA 4EO6A 4YQWA 4LFAK 4HI2A 4U96A 3F2KA 4O3QA 1FKOA 3VGSA 3MR7A 4B8CA 3FNNA 4M7XA 1N8RO 3LP0B 3OYGA 4WP9A 1VISA 3VOVA 2RJZA 4FNIA 3NGTA 4AHVA 2A3JA 2V69A 4KHUA 1M5PC 3D1HA 2ALZA 5AQQA 1S76D 1F9HA 2DO4A 4CLYA 5FPMA 1VQ7S 1DBDA 4UY8T 2EC0A 1UPPA 1R0AA 3HJFA 3BSNA 2FTRA 4JKCA 1Z2LA 4YOVA 3CWJ