3DOLA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
540
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 136
structure length 536
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dolA05
3V4IB 4DF4A 4K8ZA 4DSKA 3RMBA 5I42B 3RMAA 4DSJA 5DLFA 4FLUA 1L3SA 4IFVB 3G86A 3IG1A 1S1WB 1TP7A 3VQ6A 3G6XA 1TKDA 3QYYA 3KIOA 3OLAA 5D3GB 1S9GB 3P83D 4KHWA 2W9CB 4O44A 3AO4A 3MR6A 4RNNA 3CO9A 4DTJA 4F4WA 5KFHA 2ETJA 4NYNA 4E7IA 2HB5A 3BQ2A 1ZBIA 4CFAA 1HQUB 3LANA 3QGHA 3QIDA 3KD1E 3SQ2A 3AA4A 1REVA 4O4GB 1BI4A 3SJJA 4ELTA 3NH1A 3CIZA 4PUOA 4KB1A 4IG3B 4E1MA 1RT1A 4EP4A 3OSNA 2IOCA 3VQ5A 3SUNA 1TKTA 4M3YA 2FJXA 3MEDB 2YNHB 3C95A 3C6UA 2E6LA 3K5OA 3DI6B 1HQEA 4NYZA 3PO5A 3PUFA 4ZHRA 3VA0A 5SZTA 3NF6A 1C1CB 1JKHA 4M3UA 1WSEA 5DG7A 1I6JA 3NGYA 1NKEA 3QNOA 1ZBHA 1TL1B 1TK8A 4PQUA 4FXDA 2B5JA 4OPJA 3TAEA 4FJ8A 1VRUB 2VG7B 3CVKA 1XWLA 4CJSA 2YNGB 1S10A 1LAWA 4DQIA 4ECTA 2OZMA 5C42B 3V9XA 4ZVFA 3KLIA 4DSLA 3L3UA 3EYZA 2W9BA 1G15A 4KTWA 4I9QA 3PJXA 5KFJA 2UVWA 3NKYA 4CIGA 3NL0A 5DMRA 4Q45A 2JEJA 2Y1JA 3PX4A 3KLHA 3I0SA 2VG5A 5KT5A 2KW4A 1RT4B 4PWDB 4NLVA 4CHNA 3CDWA 2YKNA 1BCOA 4DFPA 3MR2A 4E0DA 2XY8A 4Q5VA 5KG4A 1RT3B 3V6DB 1N5YA 1Q9XA 1RDBA 1FKOB 1NK9A 4B9SA 3NAHA 1JXEA 5KG6A 2YNFB 4IG0A 4ZPBA 4JUZA 3LP3A 1XI1A 1T05B 4ED8A 4BE2A 3E01A 2IDOA 1T8EA 3CJ2A 3MFHA 2DTUA 3V6JA 1NKCA 3K58A 1TVRB 4FW2A 1C0UA 3OYNA 3NGDA 1ASUA 4NLDA 3WNGA 1BQNA 4KI4A 1QHTA 3SI6A 5F8JA 4ECWA 4HYKA 5F9NA 4MK8A 1RT7A 4J9NA 5CZ1A 1BQMA 1R0AB 4CFDA 2AGOA 1RDCA 2OPQA 4IRKA 3MEEB 2E4LA 3H98A 3L2UA 4FJNA 1JLBA 4TY8B 5FROA 2F8TA 1C0TA 1S49A 2E9TA 3U3GA 1SH3A 2DFFA 3EPGA 4FS1A 3ISNC 4F4XA 3H5UA 4RNMA 4M3WA 4I2PA 4BWJA 1NK8A 5FDLA 2C28A 2HHSA 4O55A 2E6MA 1J5OB 3S3NA 2BANB 3K59A 1RTDB 2HMIB 3JYTA 3VQQA 1WNSA 4X2BA 1VSIA 3RR8A 1XC9A 3I0RA 2V9WA 3LZJA 3BREA 1S9EB 2IAJB 2F8SA 1N6QA 2VWKA 3SZ2A 1TKZB 3RRHA 3TANA 1IKXA 4RNHA 3DM2A 3M8QB 1QSSA 1HNVA 2HHTA 4J2BA 4ZPAA 2IM0A 5KFNA 4KFBB 3MEGA 4XPCA 4DEZA 4H4OB 3PVXA 4C8OA 1TKXB 3PY8A 1S0MA 3SFGA 2KFNA 1D0EA 1KHVA 4EZ9A 4KHNA 3TWHA 1MMLA 4IDKB 3H2LA 1KCFA 2QXFA 3BSOA 1T03B 3AA5X 4DSIA 1MU2A 1U49A 2PZSA 5KG5A 1T3NA 1VSFA 4XO0A 4O3NA 5L9XA 3KJVB 1Q8IA 3VQPA 1RT5B 4KO0A 4I2QA 4MK9A 4RNFA 2JEFA 5CYMB 1IG9A 4NCGB 4F4YA 3BJYA 3LWLA 2B6AA 3OJUA 1C1BA 1LW0A 5HP1A 4K4XA 2KQ2A 1RTHB 2BR0A 5KFWA 1VSEA 1VK0A 2X74A 5F8MA 3TAFA 2RDJA 3SCXA 4YP3A 1WLJA 3KHRA 3DRSA 4H4MA 4M42A 3ZSWA 3CJ5A 3AO2A 1N4LA 1NOZA 1HMVB 4B3OB 1X9MA 2W42A 3OYFA 4RW4A 4KHUA 1JLCA 4LH5A 2KFZA 2B43A 3ASMA 3HPGA 5KRSA 4PY5A 1KLNA 5KT4A 4OVLA 1WSGA 5J2NA 4URQU 1VSMA 2XY7A 4WFYA 5KFSA 5KTQA 2HAIA 3KLEA 2HNZA 4ED2A 1IKYA 1TV6B 1YVFA 3L3VA 1CLQA 1LW2B 3SQ1A 2HHVA 3G0ZA 4O3QA 3EY1A 3HXMA 5KFQA 2R2RA 4CEOA 5EWFA 1SL0A 4M3XA 3DRPA 3SI8A 1ZBUA 2O5DA 3LP1A 2IM2A 3NAIA 5I42A 3V81B 2FVCA 4DL3A 1FK9B 2UVUA 3OLBA 1A5VA 1U04A 4CESA 1JIHA 4ZP7A 2ASLA 2WOMA 1S1WA 1WSFA 1IH7A 3O3HA 4MIBA 3T5JA 1Z4UA 1HYVA 4FJ9A 1NNDA 5D3GA 4HTUA 2W9CA 3TAMA 5K14B 3ZSXA 4DTPA 3LALA 3HHKA 4GC6A 4N41A 3Q8SB 1HQUA 3Q8QB 1SKRA 4QOZB 2P5OA 3OHAA 4LSNA 4IG3A 4KV8B 4K4TA 4R8UB 1ZBFA 1KRPA 4K4UA 1KLMB 2HVHA 4CGDA 4JS5A 3MEDA 2YNHA 3LP0B 1QAIA 3QIPB 2XHBA 1U47A 4O5BA 4ZVGA 3NF8A 2RN2A 4Z4CA 4J9PA 1CZ9A 3NAEA 5HRSA 3ZSOA 2XC9A 4RW6B 3HT3A 4RUCA 1RTIA 3T5HA 4J9RA 4N5SA 1RBTA 3MF5A 1RAJA 1VSLA 2HWIA 1VRUA 3PW0A 3U6FA 4ZPDA 2I1RA 4M95A 4FJMA 3DLBA 1IM4A 1LWEA 1SH2A 2AGQA 3PR4A 2RF2B 2IC3B 4YR3A 3VQ8A 3DOKA 3QZ7A 3GV8B 4C8NA 3AVFA 3VQAA 4E1NA 4KSEB 4FJ5A 3IRXB 4CECA 3EZUA 3I8DA 4QAGA 4LSLB 1JLGB 1RT4A 4KRFA 5C24A 4W5NA 3ZSYA 3AVKA 1RT3A 3V6DA 1T94A 4CJUA 4GVMA 2XI3A 3DMJB 1HRHA 3AVHA 4CK3A 2P5GA 1HNIA 3KLFB 5J2MB 1DLOB 4F50A 4WFZA 4ID1A 4CF2A 4DS5A 3MXIA 3KMSA 1SH0A 3MR3A 3SPYA 4O0IA 2OA8A 3DOLB 1S1XB 4J9QA 4Y34A 4QWDA 3RR7A 4C8LA 4WXOA 5F9LA 4NLOA 3OY9A 3VQDA 1NK4A 3PX0A 3SV3A 3BDPA 1S5JA 5E41A 4M94A 3OYIA 3TARA 1JLAB 3MR5A 3L2WA 4DTSA 3H5YA 2DPIA 3SUPA 2FLLA 5KFFA 1QSLA 3L8BA 3SQ4A 1B9FA 4EZ6A 3PW2A 4CJWA 5DG8A 1VSHA 4EBEA 4URSA 3LP2A 1LWFB 4M3RA 1QE1B 4G1QB 1RDAA 2Z1JA 3PV8A 3T5KA 4OKJA 2J6SA 1RBRA 5EWEA 4B9UA 4CJFA 4CHPA 4ICLB 1KFDA 4K50A 4CJ3A 4W5OA 3OYDA 2IGIA 4TLRA 3UPFA 1TK5A 2ZD1A 1KTQA 3K5MA 5KGXA 5J2QB 3G6YA 3M8PB 4EBDA 4BACA 4CK1A 2BE2B 4ZP6A 4DL5A 1J5OA 3OHBA 1WSJA 4BE0A 2BANA 4F4KA 4XIUA 5KG1A 2PYLA 3HL8A 3ZSZA 2ATLA 2ZE2B 1U48A 1LV5A 1GOBA 3ZSQA 4CJLA 2FLNA 4TSXA 2VG6A 3LAKA 1S9EA 2IAJA 2ITGA 3H08A 3WNHA 4DG1A 5DQIA 1NK7A 4NZ0A 1RT2B 2HNYB 1DTTB 1U4BA 1TKZA 4EO8A 1DTQA 4KBIA 3M8QA 4I7FB 2R8GA 2QKBA 3HYFA 3F9KA 4TN2A 3DLGB 4Z0UA 4CHZA 4KE5A 4CHOA 4RW7B 5HROB 2AJQA 1S0NA 4KFBA 1WAJA 1NK5A 4NLRA 4ZP9A 3AVJA 2QK9A 1JLFA 3MFIA 1TGOA 1TKXA 4DS4A 4O0JA 1XR5A 2I5JB 4IDKA 1UA0A 5DK5A 4QW8A 1JXBA 4C8MA 4IQXA 2QV6A 3CDUA 3K5NA 3DLHA 3NBPB 3SFUA 3Q8PB 2EHGA 4EO6A 3KJVA 4AHVA 3SYZA 2W9AA 1CZBA 4ED0A 4URGA 3GV5B 4TYAA 4NCGA 4N76A 3FQKA 4ID5A 4ZTFA 4CF8A 1RTHA 3C6TB 3M9MB 1LAVA 4CFBA 1RTJA 1EETA 2XY6A 3RB0A 3GIMA 4QCLA 2IS3A 2RKIB 1JLEB 5KFTA 4DU3A 5KFXA 3FFIB 1HMVA 1RNHA 4ZTJA 1TK0A 3Q8RB 3HPHA 4NLWA 4GW6A 4FK0A 2WONA 1S1TA 4FJIA 1ZTWA 2NUBA 3QEWA 4DQSA 2CKWA 4NCBA 3KLGA 4WE1B 5KG7A 3QINA 3THVA 4RW8B 3OYAA 1HYZA 3OL6A 2JLEA 3B6OA 5DLGA 4B8CA 2JEIA 2HW3A 3HSTB 3ZT2A 2Z1IA 1LW2A 1BISA 4FBTA 2OPRA 3M8RA 2IMWP 5HRRA 5T14A 2FJWA 2D3UA 5J2PA 2R2TA 4FLVA 4E89A 3ITHA 2G8FA 3RMCA 3NH2A 1FK9A 3MXMA 4OKEA 4CJQA 4LQ9A 2HHXA 4CF9A 3KD5E 1CXQA 1BIUA 1XR6A 3D28A 4F2RA 2YNIB 4NLGA 5DGAA 1L3VA 5EDWA 4RNOA 4ZP8A 1Y97A 1VRTB 3H40A 1BL3A 4FZYA 1KFSA 4N47A 1RT6B 2OPPA 3AVGA 4IKAA 4FS2A 4NLXA 1N48A 1S1UB 2R2SA 1EKEA 1NKBA 2OPSA 3LP0A 1LWCB 3QIPA 5HLFB 1J54A 1UWBA 2GC8A 1OS5A 4F4ZA 4QWAA 3DLKB 1RDDA 1U45A 5CZ2A 3CFPA 1XHXA 4RW6A 3H4BA 4B9VA 4JRQA 1KVAA 4NLSA 3BGRA 4YR2A 3SPZA 4DQPA 1S6PB 3MXJA 3QLHA 5HBMB 1ZTTA 5KG0A 5J1EA 2VG6B 3N6MA 4IRDA 4HCBA 4CJRA 1FKPA 3H5XA 4CF1A 2RF2A 4B9MA 4HUEA 3HP6A 3TVKA 3KHLA 3ICLA 3TI0A 5DQHA 2YV0X 3AO1A 1NK0A 1WSIA 2X6NA 3HVTB 3SUOA 3T3FA 3VQCA 5KFLA 3K2PA 4MQ3A 1NJYA 1Q9YA 3QESA 1SUQB 5JS1A 3CFOA 1S6QB 1WAFA 4LSLA 1JLGA 5SWMA 1RA6A 4CERA 3BQ0A 3GIKA 1REVB 3AO5A 1BI4B 1NJWA 4PUOB 2F96A 4NLQA 2X78A 5T7BA 4EBCA 5J2MA 2EX3A 2BDPA 5DGBA 2GBZA 5JS2A 1HQEB 2RDIA 2DFHA 4ZHRB 4TQRA 2C2RA 5C25B 1KVBA 3IS9B 1JKHB 4AH9A 2E9RX 3OS1A 3QEVA 3OL7A 5KG2A 2ALZA 5DG9A 1BIZA 4PQUB 3QGGA 4FVMA 4CEQA 3RB3A 1B92A 3OS2A 2FJVA 4DTNA 3KLIB 4Y1CA 3O4NA 1T7PA 1S4FA 1LWFA 2W9BB 4FCYA 3HPOA 4R5PB 4G1QA 4CGGA 4CJ4A 2DY4A 3V9SA 4M45A 4J9MA 3WNEA 1KVCA 3I0SB 4KB0A 4KHMA 3TABA 2XGQA 4CEFA 1NK6A 1VSDA 1JL2A 3CG7A 1W0HA 3QERA 4MKBA 2YKMB 1D5AA 4YMEA 4CEZA 3CYMA 3L2RA 5J2QA 3V4IA 4KHSA 2BE2A 4BDPA 3G10A 4MIAA 4K4WA 3DLEB 4IFVA 4IG0B 5KFDA 2A1SA 3LPTA 1GOCA 3OYJA 4ELVA 2ZE2A 4ZPCA 4DTXA 3H5SA 2QKKA 1S9GA 4OGEA 2AU0A 1CSJA 2BGGA 1XHZA 4Q0BB 1QQCA 1X9WA 4B9NA 1SKWA 1YTAA 1ASVA 4MKAA 1RT2A 2HNYA 4LQ3A 5L1JA 4O4GA 4MH8A 4I7FA 3P1GA 4CHYA 3PJWA 3DLGA 4DLGA 1BCMA 1HJRA 4RW7A 5HROA 2VWJA 1BQMB 1ITGA 3DI6A 4NLYA 3V1OA 2XCPA 3OYGA 3AVNA 1JLBB 2G8UA 4EYHB 4JLHA 1C1CA 3MECB 1C0TB 4WFXA 4KKOB 4DQRA 1Z26A 3D5MA 4AHUA 4CIEA 1TL1A 4FLYA 4I2PB 3TAQA 4FJGA 3CFRA 4CIFA 2FVQA 2VG7A 4DL6A 2V4QA 1TAQA 4K8XA 2YNGA 4CJ5A 3CM6A 2B4JA 3DYAB 4J2AA 3RRGA 5C42A 3NH0A 3C6TA 4IBNA 3KK1B 4ZMMA 3UR0A 4Q8FA 1HPZB 4DL2A 3D45A 3CDEA 2UVVA 4AILC 4B9TA 2J6UA 2G8VA 3I0RB 4FJHA 3CJ0A 3FFIA 3IAYA 5JXSA 4Y3CA 4H8KA 2BQRA 1N6QB 4ZVHA 4Z4FA 4JV1A 4PWDA 3OYHA 3HO1A 1UOCA 2AWZA 1IKXB 2OYQA 4WE1A 3DM2B 4UQGA 5KT7A 4CGHA 4E7HA 4FJKA 4FZXC 2HNDB 1FKOA 2D41A 3KK2B 2ILYA 4O3PA 3MAQA 1JLQB 4JS4A 3BR9A 4YQWA 3UQSA 2YNFA 2FBTA 3T5LA 3KKRA 3MEGB 3T19A 1T05A 2R8KA 4BDZA 4RUAA 2IBKA 2A1RA 5L1IA 1U09A 1MU2B 1I3AA 5EUHA 1TVRA 1WN7A 3S3MA 4J2DA 1EXQA 2IJNA 4I2QB 2FBYA 3KNAA 3BSNA 1QUVA 4IH6A 2XCAA 4DFJA 4K4ZA 1J9AA 4RG8A 4TXSA 2B6AB 1YVUA 1C1BB 1LW0B 5HP1B 2YHAA 3BSAA 5CYQB 2D0AA 1KSPA 3F73A 5KT3A 4ECVA 3V9WA 2FC0A 2JC1A 1R0AA 1RBUA 2JEGA 2EC0A 3SUQA 3DRSB 4H4MB 3JSMB 4FYDA 1ASWA 2HVIA 3MEEA 4RW9B 1RT6A 4DTRA 1ZETA 1CXUA 3D0PA 4TY8A 4RW4B 2FVRA 3EZ5A 1BGXT 5KFOA 2BQUA 3PW7A 3OYCA 3VQ7A 4FZZA 4HCCA 4DTUA 2E9ZA 4FW1A 2Y1IA 4FJLA 4CJPA 5KFMA 2R8IA 4MK7A 4CGIA 1D8YA 2AX0A 1RILA 1IKYB 3ZCMA 4DF8A 3OYKA 3ZT1A 3QNNA 1RBSA 3CJ4A 3ZT4A 4GC7A 1RTDA 2HMIA 4KHRA 1S6PA 3DRPB 2FVSA 5HBMA 2ZKUA 2RPIA 3LP1B 3TR8A 3PZPA 4PA1A 3NGZA 3FSIA 5DQGA 3M9NB 3IGNA 1EP4B 4WXWA 3VN5A 3AO3A 2WOMB 4HKQA 4ECUA 2GIRA 3E51A 4CEEA 3SV4A 3KHHA 3HVRA 3HVTA 5L1LA 4F3TA 1HYSB 3CQ8A 3RMDA 4N56A 3TAMB 2W7PA 3N6NA 1JX4A 2BRKA 1D1UA 1SUQA 4O4RA 5KFZA 1TAUA 3HVWA 1S6QA 4JV0A 5KI6A 4JV2A 1A5XA 4KTZA 4ECSA 4NLPA 3SQ0A 4H4OA 5F8LA 1IKWB 5EWGA 4NLUA 1K1QA 1J53A 4LSNB 4O3RA 1T03A 4WZMA 5KRTA 4IOBA 3O3GA 5KFYA 4NRTA 1RDRA 4QWEA 2Q3SA 4FLWA 3HK2A 4RU9A 1RT5A 1RYRA 3B6PA 4OLAA 5F8IA 4KAZA 4K4YA 3NFAA 3FDSA 4EEYA 1S48A 5CYMA 1SV5B 4DL4A 4CCHA 4MFBB 2G8HA 3AVLA 4ED1A 3ULDA 5C25A 4CGJA 3OYBA 3IS9A 4FBUA 1TL3B 4G3IA 5F8NA 1RTIB 2O4GA 3RAQA 2UVRA 4CEBA 1S1VB 3NE6A 4M3ZA 4ECQA 4OPKA 4B3OA 2C22A 2W7OA 3VA3A 3OVNA 3DDKA 1FXXA 5CY4A 1LWEB 3PHEA 3OSPA 4F2SA 2OZSA 3DOKB 4XPEA 4DLEA 4R0EA 4R5PA 3NF9A 3KK3B 1IKVB 4ECXA 2D0CA 4L8RB 4F8RA 3P5JA 4NLTA 2P1JA 4HUFA 1NHVA 1TV6A 5C24B 4Y2CA 4W5RA 5L1KA 2YKMA 2W8KA 4F3OA 4OLBA 3TAPA 4DWIA 1W9HA 1BHLA 1HNIB 3V81A 1W25A 4IFYB 3FRZA 3DLEA 5F8GA 2IJFA 1C0MA 3N6LA 3QO9B 3OYLA 4CHQA 4ECRA 4KHQA 4C8KA 5K14A 2AGPA 4CJEA 3RWUA 4KTQA 3KHGA 1A5WA 4Q0BA 3DRRB 5KT2A 1X9SA 2Z1HA 3O3FA 1D9DA 4FJ7A 4OJRA 2C2EA 5KFCA 2J6TA 2ZQBA 2WHOA 3BQ1A 4FJXA 4KV8A 3RBDA 2R2UA 4R8UA 4ZVEA 3MTKA 3AVAA 1C2PA 4ELUA 3LP2B 4CJTA 1KLMA 1X1PA 1JXLA 3AVIA 2G8IA 4FLXA 2P51A 4GMJB 3QEPA 4RZRA 2XRIA 2JGUA 2XO7A 5KFIA 3MECA 2R8JA 4KKOA 2R7YA 2W8LA 5I3UB 1K6YA 1S0OA 4IH7A 3NF7A 2ZD1B 2AX1A 2WK4A 5KFGA 4B9LA 2ASJA 3RB6A 4K4VA 3V6KA 4CF0A 3TAGA 3PW4A 3NCIA 3DYAA 3LAMA 4CJKA 1NOYA 2D0BA 4NCAA 3KK1A 2GUIA 5FRNA 3IG1B 3GV7B 2IC3A 4YR0A 3T1AA 2G8WA 1HPZA 5HRPA 4IKFA 1EX4A 4EP5A 4CEAA 4O44B 4E7LA 1VSJA 4DTMA 4Z4GA 3IRXA 3HVAA 1I39A 1B9DA 4U7CA 3NGIA 5EU7A 4DG1B 2DPJA 5HRNA 2HWHA 4M41A 4AHRA 1NHUA 4FLZA 5KFPA 4ED3A 1DTQB 4Q44A 4Z4EA 3L2VA 3L2QA 4B08A 5KFEA 3U3YA 1RT1B 5KFBA 3DMJA 3KTQA 2HNDA 1TKTB 2XY5A 3KK2A 3KLFA 1JLQA 3C6UB 1YT3A 1DLOA 2D3ZA 4HHTA 4DQQA 3AVBA 3QZ8A 5KFAA 3V1QA 1JLFB 4WYLA 2HHQA 3RAXA 4AHSA 4WYWA 4KREA 4E7JA 3DOLA 1S1XA 3GQCA 4E19A 2QE5A 3I5BA 3ALYA 4EYIB 4CEDA 3G6VA 1RYSA 4FM2A 2B5JB 4KAIA 4CGFA 2KZMA 1JLAA 4KI6A 3OL8A 4ID5B 2V0NA 5CYQA 3A2FA 4B8AB 1RTJB 1EETB 4LY7A 1SL2A 2BRLA 2JC0A 3GIJA 2XI2A 4DTOA 3KLVA 1QE1A 1WNEA 2WTFA 1Z25A 3JSMA 3I5CA 4LD0A 4RW9A 4DSFA 3QEIA 4JRPA 3KLHB 2VG5B 4ICLA 2PY5A 2WONB 1S1TB 3V1RA 3LPUA 2YKNB 2Z1GA 1C1AA 3ZSVA 1L3UA 3KLGB 1N5YB 2KZZA 4FM0A 1GX5A 3M8PA 1KHWA 3OYEA 1QS4A 3QIOA 1QSYA 4ECZA 3QGIA 4KHYA 3KOAA 1RA7A 3WNFA 4DFMA 4BWMA 4YNQA 4DU1A 1HARA 4OKKA 3E01B 2WB4A 4IR1A 4FM1A 3TQ1A 2OPRB 2WCXA 2IM3A 2UUWA 3I5AA 5J2PB 4AHTA 3ITHB 2LSNA 3M9OB 2F8EX 4BDYA 1C0UB 1S9FA 1EP4A 4KPYA 4DSEA 4OGCA 3HM9A 2C2DA 4TYBA 5F8HA 2DFEA 1BQNB 1DTTA 1HYSA 2AQ4A 1UAXA 3EPIA 4J9OA 1RT7B 1ZBLA 4H54A 3PO4A 2D5RA 2GV9A 3RBEA 4FK2A 3DLRA 1QTMA 3VQ9A 2OPQB 5KFKA 3AV9A 2OPPB 1IKWA 4ED6A 4NRUA 2XGPA 4QWCA 2I5JA 4OL8A 3LZIA 3H4DA 1RBVA 4KB7A 4FJJA 5KT6A 4I9LA 3K5LA 2OPSB 3NBPA 2GIQA 1L3TA 1UWBB 3OYMA 3RTVA 5FDLB 1SV5A 4K4SA 4FK4A 4HVJA 3UDLA 4MFBA 1F21A 4QPXA 1TL3A 4CE9A 4YFUA 4CFCA 3BGRB 2BQ3A 3IN5A 1N56A 3PX6A 3HKWA 3QETA 3JYTB 1S1VA 3S3OA 2RKIA 1VSKA 1JLEA 1NJXA 1YTUA 3QLHB 2FVPA 5KFVA 3GYNA 2FLPA 5J1EB 3VQSA 1ZYQA 1D9FA 3PR5B 3H59A 4CJVA 1FKPB 4U6PA 4W5QA 3AVMA 2V4RA 4WZQA 2HHUA 2ATQA 3HJFA 1WSHA 2FBVA 3QEXA 3OJSA 3V6HA 4ED7A 1QAJA 3V9ZA 4TQSA 2WRMA 4DMNA 4Z4IA 4RW8A 3KK3A 1IKVA 1HNVB 5FRMA 4DFKA 4FLTA 4DL7A 4J9SA 2CJQA 1GOAA 2R8HA 3LWMA 2D7SA 4QW9A 4IRCA 4NYFA 1K1SA 2HHWA 3ZT0A 5KFRA 4J9KA 3O4QA 4Q8EA 4O3SA 3HP9A 3IGVA 2IA6A 4QWBA 2UUTA 3K57A 4Z4HA 3AVCA 4IFYA 3VQEA 4AHCA 4KO0B 1RCHA 3NHGA 3QO9A 3PW5A 3NDKA 3AA3A 3NMAA 1NJZA 2ILZA 1O1WA 4O3OA 3VQBA 2YNIA 4E7KA 2YHBA 1IO2A 4Y2AA 4Q43A 1JL1A 4DU4A 3ISND 5KGWA 2O4IA 2ASDA 5JUMA 1VRTA 4IR9A 4TY9A 3DRRA 3M8SA 3SNNA 3ZSRA 4BE1A 2PYJA 2XWYA 5KG3A 3UIQA 2VA3A 2KTQA 3KKSA 2OH2A 1S1UA 4J9LA 1GX6A 5C5JA 4HUGA 1SKSA 1JLCB 1UA1A 3VQ4A 1LWCA 5HLFA 2FBXA 1L5UA 5J2NB 1XR7A 3CJ3A 3LDSA 1TQLA 3GILA 1S97A 4CK2A 1C6VA 1SL1A 4J2EA 3KMQA 3C94A 3OS0A 3DLKA 4LH4A 3CM5A 3V9UA 3AA2A 3KLEB 5KFUA 4Y1DA 2HNZB 3FQLA 3ZT3A 3S9HA 2X6SA 2G8KA 4M3TA 4W5TA 3RB4A 5I3UA 3GIIA 4ECYA 4E3SA 3OL9A 3BSCA 2IM1A 4IH5A 3CWJA 2VA2A
chains in the Genus database with same CATH superfamily
2H3GX 3RMBA 4MO5A 1VQNN 3MDFA 2A1BA 4YB6A 1TKDA 2XMTA 1XQIA 3AO4A 3CO9A 1HIYA 1M5OC 4F4WA 5KFHA 3FFKB 3BQ2A 1G1XA 2JH3A 4CFAA 3LANA 1DEJA 1VQ5S 3QIDA 5BYQA 2CWXA 2EC2A 1NLKL 1REVA 3R7SB 1BI4A 3NH1A 4KB1A 4EP4A 1RT1A 4LF9K 4YB5A 4AL5A 3M5RA 4M3YA 1NB2A 2YNHB 2D9OA 3RBZA 1VHFA 3AOAA 3PUFA 4DV2F 3QT5A 4ZHRA 3VA0A 2ITMA 3POTA 4DCOB 1I6JA 2ZZTA 2XS2A 3BH7B 3CJRA 4FXDA 4B1VA 3J7Z5 2Q66A 3TAEA 2KHCA 4CJSA 2YNGB 4WK3A 5C42B 3V9XA 4LREA 4ED4A 2DNNA 2LDIA 3L3UA 3AJDA 4FWQA 2QX0A 4KTWA 4I9QA 2GX8A 3LH2S 2KRRA 4CZFA 5GAEP 1H3DA 5HL7L 4AXJA 2ZNYA 2CVEA 4CIGA 3NL0A 4AM6A 3F2KA 4H0PA 3J8AA 1VIOA 2JEJA 2AJ2A 2Y1JA 1YJWS 5KT5A 3ZZPA 4X4TA 4CHNA 5A0YA 4E0DA 4Q5VA 3V6DB 1N5YA 5AQPA 2J9EA 1FKOB 1NK9A 3A5OC 2GHPA 1IBLJ 1JXEA 5KG6A 2CRLA 5L9NA 2LCWA 4BE2A 2IDOA 1LOTB 1BQXA 1E4GT 4WP9A 3MFHA 3DC2A 3V6JA 3R9LA 3GSIA 2IRYA 3MTJA 1TVRB 1HBUA 5U47A 1CZAN 2AEMA 3NGDA 1BA0A 1JMTA 2VQFK 4U96A 1BQNA 1Q78A 4OZNA 3MCOA 4B3TJ 1MNEA 3BF4A 4J9NA 5CZ1A 1RDCA 2Y1LB 1AUDA 2AJFE 3H98A 1RDWX 4FJNA 1JLBA 1VCTA 1WC5A 5CZXA 2F8TA 4CI6A 1WF0A 3EPGA 3ILOA 1EHWA 3ISNC 1U0HB 3H5UA 4Y2IA 1NK8A 4OI4A 5FDLA 2H5JB 2HHSA 3GPAA 4W92B 2ZZMA 2GVZB 3CCMS 2MLXA 2BANB 4L6V3 3TQEA 2QIFA 4LF2A 1J5EF 3RR8A 3VEZA 2LA6A 3G8TA 1RSCA 3SQOP 3LZJA 3MD3A 2EFVA 2I7PA 3LDOA 2IAJB 2QO3A 4ZDNA 2RRBA 1N6QA 2CXEA 4NYPA 4JI1K 1HNXK 3CSKA 3RRHA 2GVDB 2KB2A 5D0GA 3OXLA 1NGAA 4ES2A 3CD6S 4GKKF 4YB7A 2CQ2A 2WSFC 2KJWA 4H4OB 1BOTO 3PY8A 2OTJS 5BYSA 2KFNA 1P27B 1KHVA 4IDKB 3H2LA 2GHVC 2JRSA 4BRDA 4K2JA 3IRWP 1F9EB 2ZJPL 1U49A 5KG5A 2C3UA 3NWGA 1RT5B 2J4RA 4I2QA 4MK9A 1N32J 3BB5A 3MCSA 1IG9A 5CYMB 3BJYA 3LWLA 3ZTOA 3R1XA 1C1BA 1RTHB 1M5VC 2KT5A 2MZTA 3QBCA 4O8UA 2OD6A 4J9UE 5HK4A 1WLJA 3RUBL 3ZSWA 2LKZA 3CJ5A 1N4LA 3AO2A 1NOZA 1HMVB 3NOGA 3HI9A 3TUJC 5CH7B 4KHUA 2OTLN 3ASMA 3HPGA 4PY5A 5KT4A 3M2VA 3OVAA 2VC1A 3RSEA 5J2NA 3FUYA 2V7YA 1T02A 2O3DA 1U6ZA 4WFYA 5KFSA 2CH5A 3AARA 2HAIA 1IKYA 3PYGA 4FWRA 2E2PA 3KDNA 2UV8A 2VQEJ 1TELA 1YVFA 3L3VA 5DM6L 4O3QA 3HXMA 2E44A 5KFQA 4CEOA 5EWFA 4LFAF 4A4JA 3DRPA 2FJEB 2YKPA 3SI8A 3D2FA 2FQQB 1ZBUA 3IR6B 4WPAA 2GMHA 4JI5K 2GV1A 2RU9A 3O9QA 3H1VX 3M1VA 1U04A 4CESA 4ZP7A 2WOMA 4LT6A 1YWXA 2JVRA 1K8KA 3O3HA 4HEA9 1WF1A 2XLKA 3RJMB 1FXLA 4NE9C 5D3GA 1T95A 1BHNA 3PACA 2ZH4A 3TAMA 4U9RA 2O66A 3QFHA 1BUPA 1X4BA 3H6EA 1S4EA 3I55N 4K41A 3Q8SB 3PLAA 1SKRA 4NMLA 4IG3A 4LVOP 1U26A 4BQZA 4KPCA 1FEEA 1QAIA 3QIPB 3P5BP 3TSQA 2QLXA 2J0XA 3K17A 1X0FA 4NLCA 4USJC 3NF8A 2IBOA 1LK5A 3NAEA 3ZSOA 1HI1A 1H6KX 4RUCA 2XSJA 3BR8A 1T6DA 5LJWA 1F6TA 1LCUA 1VSLA 1RBAA 1Q4RA 3PJ9A 3DLBA 1HKAA 1LWEA 2H48B 4OX8A 1Q95G 3QZ7A 4WU2A 4JI0J 3VQAA 1W2BM 5ETNA 3R6LB 4DX6A 3C6AA 1M1KT 2J7KA 4OLOA 1WF2A 3B78A 5D0EA 2ZGZA 3GBTA 1H2VZ 3WQPA 2BZ2A 3AVKA 3Q22A 1U1MA 3O80A 4BG8A 4LFCK 2NRVA 1HRHA 3VEWA 3K0SA 3THYB 5HJXA 1MN7A 3MWBA 4F50A 2EFGA 4WFZA 4OYZA 2HFNA 3KMSA 3CB4A 4HACB 1B7YB 4ZLLA 2Y1RI 1S1XB 3JTNA 3RR7A 4C8LA 1M5PC 4LRFA 4Y2KA 3OY9A 2VC0A 3UDEA 2IFXA 2F65A 3PX0A 3BDPA 4ILHA 3D66A 3F44A 1M0SA 3H5YA 2FLLA 4QZVB 3W66A 3ZFVA 1X5SA 3PW2A 3BZKA 3WC2A 4EBEA 4URSA 4DV6K 2RD5C 2GX9A 1SIZA 1E3MA 1KD1T 4BC4A 4I1TA 1RE1B 1RDAA 3BH6B 2J5AA 2Z1JA 3IM8A 2YWEA 3T5KA 3D3BJ 1RBRA 5EWEA 4B9UA 4ZS6A 4ICLB 1NPPA 3O9RA 2IIHA 2ZD1A 3O9SA 4JK9A 4CD1A 2DVIA 5J2QB 1O51A 3M8PB 3NEKA 5D4OA 3IWLA 4ZP6A 4DL5A 3CCEN 4XIUA 3VAHA 2QWPA 5KG1A 1H38A 3O9TA 2MHEA 4L3QA 1OH7A 4K5SA 4CH1A 1GOBA 3B6BA 3KG1A 4CJLA 2F8MA 3H45C 2FLNA 4JOUA 1V4TA 3R3LA 4YDDB 4A57A 2ITGA 2HQ3A 3M30A 4JKGA 1X4DA 3EXCX 1RT2B 3MM5B 1U4BA 2LYVA 4LF6F 3L0QA 4KBIA 5D0RA 2DHAA 3SAHA 1KVKA 3OTBA 4LF5J 4KGMA 4BRKA 4KE5A 5HROB 3A8YA 1S0NA 1DQ8A 1RK8A 3D7EO 4HTJA 2UUCJ 2QK9A 3MFIA 1UVIA 4U7UK 2WVFA 3ZZUA 2QWLA 5GIOA 1Q1KA 5EX3A 1JXBA 5DK5A 2QV6A 4BQLA 3NBPB 4I69A 3KJVA 4AHVA 4ILMA 1CZBA 1BUXA 1YG0A 3IMQJ 1AUSL 4ZTFA 3M9MB 4A48A 2YQ3A 3ZETA 4V19S 2XY6A 1HKGA 3L7UA 3WUHA 2L41A 4Y65A 1X0PA 2ZWPA 4NLWA 4GW6A 3U4LA 4PR6A 1HKBA 4IZ9A 3GDQA 1HJOA 3CF5L 3K8WA 4FJIA 2YKAA 4DQSA 4NCBA 2P8IA 3KLGA 2VB6A 1BMQB 3VTHA 3HOTA 2JLEA 4DX5A 1SQEA 5FIIA 3ZT2A 2Z1IA 2C2OB 2V4JB 2XYGB 1BISA 1VI7A 4H03B 2D3UA 4E89A 3ITHA 3ENBA 2K3IA 3C15B 3NH2A 1HHSA 1FK9A 4JHDB 1NSKL 2MSTA 3WIUA 1M1KO 4CF9A 3ZX3A 4KY3A 2DCLA 1VQLN 1L3VA 5M2PA 4C0HA 1RAIB 3DLLL 4N47A 1Y5IB 1S6UA 4ATNA 1FRLA 4NLXA 2VOOA 2FYXA 1S1UB 2W2MP 4DV2K 2OPSA 3LP0A 2MKYA 2DPNA 5HLFB 1HNZF 2E88A 2GC8A 1NCLA 1VGYA 3HHLD 5C0YA 2K7KA 3OFGA 3GFXA 1NBEB 4QWAA 1XHXA 1H2UX 1PYSB 4RW6A 5E7OB 1KVAA 2BJ9A 2ZWHA 4J7CA 4KT0C 4WFBL 4JKBA 5KG0A 4CJRA 1FKPA 2V69A 4CLFA 4RL1A 2JZ5A 1KD1O 3L4IA 2CQ0A 3H5XA 3NNHA 1AFJA 5SUHA 3NGKA 3KHLA 4PPZA 1NK0A 2XTJP 1OPIA 3T3FA 3K2PA 1V9OA 2KH9A 3U9DA 4PKGA 5KPTA 1NMDA 3VF0B 3H90A 5GAHU 4UUXA 5JS1A 1S6QB 4KGKA 4TU7A 5SWMA 1RA6A 4G1PA 2QA4N 4H4KA 4NX9A 3BQ0A 4C0BA 2V2VA 1NJWA 4DR1J 4PUOB 2AJ1A 1QVGR 4A8XA 4BGAA 1WOPA 3M6UA 4I68A 5GAEI 5CD4A 5J2MA 1O5JA 2F5GA 4WP8A 5DGBA 1BC6A 5C12A 2KHDA 3PRDA 2DH7A 5D6GA 2DFHA 2B9XA 1YRTA 3CCUS 2P5VA 1T6CA 3ZEUA 5BR8J 3C19A 3QEVA 3QJJA 3BPSP 5KG2A 1KTVA 2ALZA 3QGGA 4CEQA 3AAPA 4BG9A 4M5JA 3PFOA 3KLIB 3SK3A 3SIPB 1K73T 1CJKB 2DHXA 1HW9A 3IXQA 3HPOA 4G1QA 4CGGA 4J9MA 4G65A 3BKFA 2FY1A 2QZ8A 1KVCA 3VERA 1RB0A 3I0SB 3L7OA 3CCJN 4KHMA 3TABA 2FF3B 3OUYA 3PIOL 1U2VB 2XMWA 1SCJB 1JL2A 1FXRA 1CQNA 2HBYB 1YJ7A 4BC5A 4CEZA 2N3LA 3CYMA 1U6BA 1J5EK 2BE2A 2GJFA 3U9ZA 4BDPA 4MDBA 3G10A 2CAJA 4USVA 3DLEB 4IFVA 4IG0B 4JI8J 5LSOA 2A1SA 3OYJA 4ELVA 4BC9A 4ZPCA 3H5SA 1VQMS 1M5KC 2N82B 1S9GA 5CCMA 4X66F 1DARA 4C3MA 2BGGA 4G1IA 4Q7AA 5ETTA 2HHHJ 5DO2A 1LWXA 2BJ1A 3DU5A 4R0JA 2UXBJ 4GKKK 2EWHA 1SKWA 2PFFB 2BKOA 3K0JA 4LQ3A 1V5VA 4O4GA 2UU9F 1ELOA 3AD9C 1N33F 1SKUB 3H3OB 4CHYA 2ALYB 3ZZYA 4EFHA 2IRUA 3JTPA 1BQMB 5GMDA 1ITGA 3DI6A 4LRCA 4X4QA 2YHYA 1SJ1A 2L9NA 3DFEA 3R6GB 3AVNA 1AA1B 4IWVA 1VQOS 1C1CA 1C0TB 3KJFB 2ASPA 3IR5B 2J7WA 3QPIA 2DY1A 3A3NB 1ZAVA 3CFRA 4DL6A 1DZ5A 3VAJA 4KH1B 4JI2F 4J2AA 2QA1A 4F3MA 1B70B 2KKHA 3HD2A 4MO4A 1JJ4A 1F1BB 1Y3JA 3VAIA 3D45A 3W60A 1UW9A 2FC8A 4DR7J 5BRDA 4AILC 2IYGA 4B9TA 3O08A 1JQGA 4RCHA 3CJ0A 3IAYA 2KXFA 2XULA 1OY8A 1CJUB 4OZ2A 4JV1A 4PWDA 4CO0A 3OYHA 2XS7A 1T9YA 3CJ9A 2A2CA 5E84A 5KT7A 4CGHA 1RAHB 4DZ6A 4LFAK 3CC2S 2HIYA 3M1FA 2HNDB 1W26A 3VCDA 3KK2B 2DD8S 2ILYA 3MAQA 4JS4A 5HVHA 2YNFA 3T5LA 1CPZA 3MEGB 3T19A 3UE2A 2R8KA 2Q6BA 1Y4ZB 1WBDA 3N4QA 3CD5A 3JQJA 1YX2A 4FL9A 1MU2B 1I3AA 8RUCA 2OHDA 4OV6A 3HULA 1B99A 1WHWA 3ZTPA 4KHPJ 3KNAA 1VFJA 4C98A 3BSNA 4IH6A 5K5MA 4AL7A 4K4ZA 1B0TA 2M2BA 2YH1A 3EDQB 5BYRA 5HP1B 3NS5A 3R8EA 2Q43A 2VU5A 4I64A 2PMWA 5KT3A 4ECVA 2FC0A 2JC1A 5D77A 4ED5A 3TWZA 4H4MB 4FYDA 4PG4A 1LFWA 3SSQA 3MEEA 1CXUA 4RW4B 3I31A 5H9FJ 1BGXT 5DDRC 4WFNL 3GZ7A 2LFVA 5B08A 2XWXA 3PW7A 1BWFO 3B8AX 4HDGA 4BLGA 1IVZA 4FJLA 3OR2A 2R8IA 3IFRA 1X4EA 5ETQA 4JI7F 3EDRB 4CGIA 2DHSA 2AHOB 1M1HA 1RBSA 3ZT4A 2LU1A 1HPMA 4W98A 2LEPA 2RPIA 2B0GA 1XERA 4PA1A 1K73O 3FSIA 1MG7A 3MM8B 5CA5A 3GB0A 1NU4A 3VN5A 3R5CA 4ECUA 4CEEA 3KHHA 4E98A 3HVTA 1QVFR 4F3TA 3CQ8A 3MMAA 2W7PA 1JNRB 1XNQF 1FWPA 4FOEA 3N6NA 2HGNA 1FERA 5KFZA 3THXA 2CYYA 2GCFA 1VK3A 1OY6A 3TUZC 4KTZA 5IT9O 4NLUA 5JJBA 1J53A 4LSNB 3I82A 3D68A 4OHYA 1RHMB 5KRTA 3FBFA 4IOAL 2CPFA 2JNJA 2IVMA 2VYPA 3HK2A 5AQGA 4RU9A 4KAZA 3I8BA 3FDSA 4CT8A 5DM7Q 4ED1A 3IS9A 1KVIA 4LUBA 2XMUA 3PIPQ 5HOOA 2UVRA 4ZCMA 4CEBA 3X3UA 2O8CB 1P1LA 4LFBF 4M3ZA 4I6MB 2QWMA 2FHKA 1GXUA 5A8RB 3BBBA 1NH8A 2YX7A 5F0UA 4OJGA 4XPEA 1GEHA 2NRZA 2DY9A 2D0CA 1XQSC 4OIXA 4L8RB 1DRZA 4F8RA 2VIHA 5IWAF 3HD1A 4CM0A 3P5JA 2P1JA 1YJTA 4HUFA 1FNOA 5IFMA 2G2YA 4W5RA 4B1YB 2YQ0A 4P71A 2YKMA 4M1KA 3TAPA 4NXMF 4YY3F 3TU5A 1BHLA 1HNIB 3P5TL 1C0MA 3VWSA 2QN6B 3R2CJ 2WSCC 4U7UD 4ECRA 1KC8T 3GONA 5K14A 1GK8A 2JDJA 4LF6K 2E5LF 5ITHA 2FPHX 1TZ0A 3KHGA 1ZZFA 5KT2A 2BW7A 1HUXA 4FJ7A 1OMSA 3OW2R 3M32A 3VAGA 2J6TA 2Y9HA 1TUWA 1SC6A 3RBDA 1U1NA 3UKUA 3AVAA 3MTKA 4ELUA 1KWMA 2BM0A 2CIMA 3LP2B 3KFWX 1X1PA 3CD7A 3MOZA 2W4PA 3MM6B 1CQMA 1YIJS 5FPNA 4IYQA 1P9QC 2RE2A 4GMJB 2PGCA 3QEPA 1NSQA 2JGUA 3MDQA 2XO7A 4H5TA 5KFIA 4BVPA 1RP5A 2P9KB 2R8JA 3CMAS 3BGLA 4NLBA 2LDYA 5AQFA 3NF7A 2AX1A 2HZCA 5KFGA 3EXYA 3MEKA 3RB6A 1ZXOA 1RTZA 3PW4A 3NCIA 2Q0RA 3HCXA 1UTAA 2ACMA 3VGTA 1Q18A 3GV7B 1HPZA 5HRPA 2KG1A 5IT9Y 1EX4A 3HRGA 3JAMU 4E7LA 1YJUA 4XH1A 4NA2A 3IRXA 3J7A1 1I39A 3ILJA 1B9DA 4U7CA 1KR4A 4DG1B 2CQBA 2NR0A 1JJHA 4AHRA 1KONA 1BU6O 1NHUA 4IOCL 1OSDA 1H72C 2G0IA 4LBIA 2QG9B 3SSSA 1RT1B 4GVBA 3VVTA 2XY5A 5H1SQ 1JLQA 1DLOA 3KZBA 3JXOA 4C1NI 4ZITA 2MQOA 1F60B 1QZ6A 3QZ8A 3V1QA 1JLFB 4CIOA 4KIAA 5ETOA 2DO0A 2YJEA 2HHQA 1OH8A 4F9OA 2O67A 1G7CB 4KREA 3IKMA 3WX4A 3NGRA 3AY9A 4KAIA 4H0YB 2PDAA 1W2IA 1JLAA 1GXTA 1RZMA 3G2XA 3LQVA 1O13A 2A10A 2DYAA 4P73A 3EN9A 2MSSA 1S7HA 1RTJB 3HM8A 4C23A 3NRBA 3QWUA 3HT0A 1XMQF 1HNZK 2EKNA 1UAWA 2C2KB 2DR8A 2YHWA 3QBWA 4DR5J 1MROA 1S1TB 1FKAF 1WWHA 1I51B 3V1RA 2DNOA 3W0LA 3ZSVA 4WYBA 1L3UA 4GO5X 1N5YB 2I8EA 4PG6A 1KHWA 2VGMA 1HWKA 2ROPA 3QT6A 2NPIA 1IBLF 2CQPA 3CCLS 3QGIA 5AE3A 2EBEA 2QSFA 4BWMA 1KQGB 4ZVQB 4IR1A 1HW8A 2E5GA 2NRRA 4PYAA 4H4KC 4DV0J 3E9LA 1S72N 3M9OB 1S77D 2F8EX 1HBUB 5AQSA 3DDIA 2UV8G 3VTIA 2KM8C 1T11A 1HNWJ 3NCRA 1BQNB 2D3O1 3CJ8A 3CI5A 3K9KA 1HYSA 3I56S 2AQ4A 4OFZA 3OR1A 2W2PP 3DOMA 2GV9A 3RBEA 4JNEA 2HGMA 5LMUJ 2UUAF 3UN2A 2BOAA 5KFKA 1RKIA 1IKWA 3AXMA 3T6JA 4ED6A 4NRUA 3R6MA 3VF2A 4JI6J 4L3KA 4KB7A 3K5LA 4I9LA 1KC8O 2GIQA 5FDLB 1TFYA 1XNRJ 4K4SA 1NGDA 4FK4A 3UDLA 2P9GA 4YHHF 4CLWA 1F21A 3O5BA 4B3MJ 4MJKA 2KFYA 1QQOA 1UZDA 3BGRB 1NGFA 3WIVA 3HKWA 4BR5A 1S1VA 3CC4S 3ILIA 5J1EB 3VQSA 3PDNA 3WHIA 4CJVA 3H59A 1QUPA 4U6PA 4W5QA 3J7YP 4QYZK 5E33A 4N7TA 3JSBA 3QEXA 2XB2D 4FF1A 4RLEA 3ET6A 3LO3A 1FRKA 3EKSA 2ADBA 3OVBA 4Z4IA 4RW8A 4CZMA 5FRMA 3BBCA 3K2YA 4DV1F 4DFKA 1RBOB 2CJQA 4AFFA 3OVSA 2A40A 2A0FB 5MAOA 3NY0A 5E26A 1F3VA 1FDBA 4F02A 2UXCF 2QXLA 3MM9A 2FSKA 4J9KA 4Z2XA 3HP9A 5G0RA 4PYDA 4X66K 5J1PA 3BZCA 4IFYA 5IQQA 4AHCA 4IEIA 4J90A 3PW5A 1HBOA 3AA3A 4C4WA 3NG8A 1O1WA 1D9AA 3ADAC 2HGLA 4Q43A 5KGWA 2UU9K 3P96A 3H42A 4FPBA 2O4IA 5AZJB 1EWQA 2V8GA 3W61A 1N33K 4B3RJ 1VRTA 2ZM6J 2G0JA 2L9DA 5LXRA 3M2UB 1N54B 2XSFA 3EJMA 2W2QP 4ZA1A 2D0PA 4HUGA 4V1Ak 3VQ4A 4DQ8A 1SZ2A 2LXIA 2I9SA 2I6WA 3M2VB 1FJGF 1LWCA 5J2NB 1XR7A 3CJ3A 3LDSA 1XIQA 4CK2A 3OS0A 5KFUA 4Y1DA 1KEKA 3FSYA 3S9HA 4ZN3A 4MKYA 3CMQA 4JI2K 2X6SA 3K5PA 4ECYA 3W3DA 4E3SA 1I3OB 3DKDA 1RISA 3BSCA 2IM1A 4WBFA 3C8YA 4IH5A 3CD0A 1FDAA 1FCAA 4QIWD 3V4IB 4DF4A 2AP1A 4K8ZA 4UW2A 3BF3A 4OLPA 1X4CA 2V9KA 4FPRA 1AFIA 1L3SA 3IG1A 3VQ6A 3G6XA 2ZVSA 4USTA 5D3GB 3P83D 3MR6A 2UYTA 3CC7N 4DTJA 1T9TA 4YUDA 1YZ6A 2ABYA 4E7IA 4PKDB 4P7TA 5DZ6A 3TP2A 3QGHA 3EUNA 3D2EA 1KKHA 4Z37A 3AA4A 3OPKA 4O0NA 2M88A 5HI7A 4U67L 1FD2A 4IG3B 3O2IA 4UOFA 3WXIA 2C1EB 2E6LA 4ILRA 2QW9A 5BRFA 2H9ZA 2YY3A 4NYZA 4P74A 3C16B 4X64J 4MTPA 1BD6A 5SZTA 1X4HA 1JKHA 3EO3A 1HD0A 5DG7A 3MMCA 3T1HJ 1TL1B 3X1LB 2VDHA 2NSBA 2B5JA 4GVEA 4FJ8A 2VG7B 1LAWA 1F2HA 1HD1A 4IO9Q 5EVZA 1OYEA 5M2RA 1IJEB 2LU2A 2OMOA 1G15A 2HAFA 1I94J 1N5VA 1YI2N 3IM9A 2UZAA 4ZVSB 2NUHA 1MA9B 3VGKA 4C97A 1LEOA 2MPUA 3I4PA 3MR7A 1Q53A 4Q45A 3U7JA 3TX0A 2VG5A 4JI7K 2XYHB 2O8FA 4NLVA 5I9EB 5AQRA 1U25A 1RXOB 2YKNA 5KG4A 3DXKA 5AZIB 2GO8A 3SMZA 3H7HB 1Q9XA 3NNCA 2XMVA 1XI1A 4C2MA 3E01A 4WJBA 4NB4A 2MGZA 2DTUA 1NKCA 2HFZA 1RHKB 1KS2A 3DGPB 3CD6N 4FW2A 1N8RT 1XNQK 4DUYJ 4CH0S 1VQ4S 3SI6A 4CYUA 2VGNA 4G9ZA 1R8PA 4MK8A 4PEOA 3GL1A 3C2PA 1R0AB 3CXCR 2AGOA 3FZFA 4IRKA 2FHOB 4Q2LA 3L2UA 2CFXA 4TY8B 1N34F 4JI3F 2NXNA 3U3GA 1SH3A 3FEZA 4FS1A 4ANDA 4X4UA 2V50A 3W8GA 2P9LA 4ZLNA 4CQ1A 2RRNA 3KUEA 2B3TB 3U8XA 4LFBK 4B9QA 4AT1B 1HBMA 5A6PA 4O55A 2E6MA 3ZO7A 4ZVUB 5HL7Q 2YPYA 2NXEA 2UXDJ 2N4CA 4WFAL 3K59A 3BGFA 1RTDB 3GU0A 3LW5C 3VQQA 1WNSA 1VSIA 4WQ4A 4LVNP 3W2WA 2UUBF 4RBVA 5LL6d 3A3PB 2F8SA 1W7WA 4FZVA 3L9ZA 2VWKA 4JKGB 3SZ2A 5IWAK 2P9IA 3UN3A 2MHNA 3TANA 4RNHA 3DM2A 1OPZA 4OPHA 2M4MA 2OJ3A 2HHTA 4RWTA 1REGX 1YSJA 4NXMK 2BJDA 4YY3K 2HZAA 5KFNA 2VFTA 4CZCA 2Z2YB 4XPCA 4C8OA 4AUKA 4LF9J 3MMVA 3SFGA 1D0EA 4KHNA 1GNKA 3TWHA 1MMLA 2QXFA 1T03B 3GSDA 3TTCA 2PZSA 1KN6A 4GVLA 1T3NA 1CS4A 2E5LK 3KJVB 5DETA 2JL9A 2PAVA 3A5LC 4RNFA 4F4YA 2B6AA 3HSDA 1LW0A 2O01C 1TYQB 5KFWA 2VD3A 3ZETB 1VLOA 2ROGA 3D0GE 1Q5VA 4C48A 4YOUA 5IV4A 3EZWA 4RWXA 2WFBA 4CBUA 4M42A 2ZUAA 1ZBTA 2D1CA 5H9EJ 3OBWA 1X9MA 1NDLA 3AHPA 2PC6A 4E1JA 4QJVA 4IOXA 4KR0B 2LXUA 1UP1A 1JLCA 2NZCA 2B43A 1KLNA 2QFJA 3N9UC 4OVLA 1WSGA 2QJ3A 1IR0A 3TYTA 3ZZZA 4IXCA 1IXKA 3AOCA 1RABB 3KLEA 4DV5J 1RDUA 2C3OA 4EHUA 5DJBA 3R3TA 2YKOA 3SQ1A 2AEFA 3EY1A 1VS3A 1KAZA 4M3XA 2FHJA 5EX0A 1ROFA 2NPFA 2O5DA 2IM2A 4Y6IA 5I42A 2A6OA 3CJSA 3V81B 2HQDA 4DL3A 1FK9B 1A5VA 5J1NA 1AT1B 1S1WA 1WSFA 1IH7A 1S12A 4MIBA 2D4WA 1Z4UA 1HYVA 3T69A 4ZPTR 4P9SA 2W9CA 4PXEA 4DTPA 2ASOA 1RUSA 2PA8D 3ISZA 2VQFJ 1NWKA 1HQUA 1WG4A 2HS4A 1R8AA 2F9TA 4QOZB 1U1RA 3OHAA 3T41A 2GMLA 5MLCQ 2E29A 4K4TA 2ZOFA 1ZBFA 4K4UA 1KLMB 1T9VA 2HLTA 3MEDA 3LP0B 4LIWA 4DXLA 4FO0A 3MPUB 1NUEA 2MQLA 2RN2A 5HN0A 2EK6A 1WHXA 4J9PA 1CZ9A 3GIRA 4RW6B 3HT3A 3C3LA 3E8OA 4CDIA 1RTIA 3CCVS 2H3EB 4BRFA 2DGSA 1VC0A 4J9RA 1RBTA 5BPNA 3VGMA 3L7PA 2BM1A 4ZJLA 1NMEB 4CT9A 1VRUA 5GAGP 3PW0A 5JLFA 3IBFB 1NDPA 4ZPDA 3ZTQA 3THTA 2QC3A 4X4OA 1XMQK 4M95A 4FJMA 3GP9A 1R43A 4PWWA 5D4NA 5DDOC 1ACMB 5E3QA 1VBYA 3VQTA 1FTCA 5GIPA 1EARA 2KRBA 2HBKA 1YKWA 3MX2A 1RHUB 1DGKN 3MAAA 4QS8A 4QAGA 4WIQA 2YVSA 1HNXJ 4JI1J 1IBLK 1NGJA 1T94A 4GVMA 1ZM3A 2CGKA 3AVHA 4CK3A 4I56A 2KM8B 2E5JA 3WQUA 5J2MB 2HK2A 1GTEA 2E8AA 2YHXA 4JKAA 3SPYA 3ZEUB 4NXNF 1FI4A 3SSRA 2CNKB 1Z6RA 3NVKA 1RU1A 2AV5A 4Y34A 1HHQA 4WXOA 4NLOA 3SV3A 1S5JA 3H2UB 3OYIA 3R8YA 3TARA 1KBRA 2RS8A 4DTSA 5AE1A 2IVYA 5AJ3F 3SUPA 2UUAK 5ADXA 3L8BA 2BXJA 3CJ1A 4EZ6A 2N7CA 3D1QA 2HLUA 4UUWA 4CJWA 2CUYA 4EMDA 2V7ZA 2HFUA 5HJYA 3L09A 1RWKB 4A2BA 4ZVOB 1RWOB 4G1QB 2YBVA 4E2FB 2ZH7A 3KUGA 2V8HA 3PV8A 4OKJA 2J6SA 3TEGA 4CJFA 4CHPA 3OUYB 4YHHK 1KFDA 3OYDA 4XAKA 1FRMA 1ITPA 2C2MB 1EQYA 2B9WA 4TLRA 3UPFA 1KTQA 2L48A 3M7VA 1NM2A 1APSA 4WQ5C 3EICA 4K59A 5KGXA 4EBDA 4BACA 4CK1A 4PCQA 2BE2B 3Q8YA 5AQKA 1PILA 1WSJA 3HL8A 2ATLA 3KWMA 1FA0A 3D6HB 1U48A 4JI5J 3ZSQA 2G13A 4TSXA 3FCWA 3LUYA 2HHHF 1S9EA 2KG0A 3DHWC 4M5MA 4DV1K 5AT1B 3VGVA 5MLCV 3EL2A 3H20A 4YOTA 4NZ6A 3R7NB 1DTTB 1DTQA 3FC9A 2ZNZA 3O6QA 2UXCK 3M8QA 2AYBA 3HYFA 1GLLO 3F9KA 4TN2A 2ZH8A 4Z0UA 3CPWM 4C11A 3F5TA 5ETKA 2AKWB 4C6AA 4F3QA 4X62F 4KFBA 3AVJA 2RUGA 3G6ES 1TGOA 1TKXA 1FESA 3A13A 2I5JB 1T3VA 3TRGA 1UJ4A 4IQXA 2ZKTA 3Q8PB 2P9SA 2M8DB 2W9AA 4ED0A 3GV5B 1PCAA 3TJAA 2FJDB 4TYAA 4N76A 2A3ZA 5EHHA 4ID5A 3Q2TC 1LAVA 1NMNA 4CFBA 4LF7F 1HFEL 4R25A 1JWWA 3RB0A 5F3TA 4QCLA 2IS3A 2RKIB 1JLEB 2FHMA 2R7RA 1FWLA 1FJGK 5KFTA 3JS6A 1XMOF 3GMGA 4ENOA 3ZZRA 1NPRA 2WONA 4Y28C 2U1AA 1VQNS 4K7QA 1ZTWA 3AY0A 3CJBA 4H5WA 3QINA 3THVA 3QQCD 4N77A 4D3HA 2QLBB 1NZ8A 1HYZA 2OANA 3OYAA 2BA9A 1RWPB 4B8CA 1WSVA 1N36F 2PEBA 2HW3A 4ER8A 4LMZA 2LP4A 2WBRA 1T0TV 5LT5A 2DK2A 2W4CA 4WU3A 4LFCJ 2PEHA 3M8RA 2IMWP 2FJWA 1UEVA 4OI1A 3VAFA 2R2TA 3DJCA 5KQ8A 4FLVA 1BA1A 2G8FA 2QLWA 3RMCA 2I7NA 3MXMA 5BXIA 1PG5B 3TW0A 1QY7A 4KHPF 3HTVA 1GLAG 2FB0A 4OZ5A 1BIUA 1P6TA 1ZA1B 3UE5A 5DGAA 1YHQN 4QS9A 2QYCA 1ZS6A 3UDCA 5HSPA 5EDWA 1NDKA 3I32A 4O8KA 2VBXA 3H40A 3CEDA 1P90A 3FGUA 4CH7A 4FZYA 1KFSA 1SQKA 3N0VA 2OCEA 2OPPA 1FTRA 4DCJB 2R2SA 1EKEA 5A8KB 4ZCLA 1UWBA 4HTIA 4DPOA 4DR2F 1N52B 4JYAJ 3FJ2A 3M6XA 3DLKB 1RDDA 4LR8A 3CFPA 3U02A 1FNMA 5E0OA 3W5XA 4A8FA 4JRQA 4P75A 3SPZA 4J9VA 3MMJA 2YX4A 3QLHA 4DPYA 2LVWA 2VG6B 4HCBA 4NASA 1KAXA 1PAUB 2EKYA 3P31A 3SQGA 2RF2A 3SCIE 4OX6A 3IUCA 4CWBA 3TVKA 3ICLA 2YV0X 3VAMA 3HVTB 4ZCKA 3ZXWA 1VQ7N 3MMAB 5KFLA 3MX5A 3VALA 1KQSR 4GMKA 4LSLA 1JLGA 3TJ8A 2O8DB 5CQGA 2DRBA 3GIKA 3B82A 2P9PB 2IYIA 3CJ7A 4OX7A 2CPJA 3E1YA 2IMOA 2F96A 2X78A 3R5AA 1NDCA 1VK8A 4PKHA 1OH5A 3W64A 5CCLA 1QHAA 3H8YA 1HQEB 2FD2A 5DDQC 2JJ4D 3NWRA 3S6EA 3O1WA 1H98A 3IS9B 2CNNB 2E9RX 1U8WA 5AFUA 3SCKE 2WSEC 3A8JA 4PQUB 2HSTA 4KGZB 5AQVA 1B92A 2E66A 5GAHI 1PBAA 4QS7A 4H5NA 1PC4A 1HWIA 4CZIA 4S0MA 3ZX0A 3KKFA 2NZ4A 4Y1CA 1T7PA 1S4FA 2GAHC 2XMAA 5A2QO 1N34K 1W97L 1F9HA 1QLNA 2W9BB 4JI3K 1NSPA 1YJRA 1MWMA 4CJ4A 2PSZA 3V9SA 1R27B 3DNCA 2LEBA 2RQKA 4WFBQ 1NK6A 4UY8T 5DRKA 2V2ZA 3CG7A 1W0HA 2YKMB 4YMEA 4DUTA 1YRUA 3MCNA 2OO4A 2UUBK 4MIAA 4XDCA 1KQFB 8AT1B 3LPTA 1GOCA 1Y7PA 2ZE2A 4DTXA 2VDIA 2Z58B 2QKKA 4OGEA 1PSDA 3US5A 4GKJF 3GFZA 3SEOA 3ZTSA 4M7YA 2HQGA 4LF4F 1QQCA 1YTAA 2QMUB 3QT7A 3UD5A 1ASVA 4MKAA 3Q8UA 3M32B 2VV5A 4MH8A 4AD6A 2MKJA 2ZOMA 3ENHA 4DLGA 4KH6A 4RW7A 2VWJA 2OI2A 6FD1A 5KAKA 3V1OA 2XCPA 3OYGA 1WHYA 4DV2J 3AB2B 2MLYA 2OTLS 1Z26A 3HKZD 3D5MA 3A0IX 1W2BR 2WVBA 1PKUA 3KG0A 4I2PB 4NO7A 3TAQA 5AE2A 4CIFA 2FVQA 3HFKA 2O1PA 3H2VE 1TAQA 3F41A 2YNGA 4CJ5A 4K8XA 4A47A 5C42A 1VJQA 3UD3P 4FXVA 2HMPA 4Q8FA 3AODA 1HPZB 1IBKF 4DL2A 2ZBCA 4OPAA 1TMJA 2G2OA 2ZF5O 2FGOA 1GLEG 3IMXA 3I0RB 3PIOQ 4B1WB 2BQRA 4ZVHA 4BR2A 3ZLJA 2C3MA 4M5DB 4USKA 2QWNA 3MCMA 4JD2B 1UOCA 2AWZA 2CQ1A 1Y00A 1IKXB 2YXLA 3J7AN 2OYQA 4FYWB 4UQGA 3BGUA 4E7HA 4GVBB 5IT9U 4FZXC 1FKOA 2D41A 4O3PA 1JLQB 3I55S 3BR9A 4F7VA 1NG9A 3ULEA 2AZ1A 2WVEA 2ZH2A 3RBXA 1HLWA 4BDZA 2XZTB 4BRHA 1U1OA 4RUAA 2IBKA 1VQ6N 4J8FA 2PBDA 3AOBA 1YJNN 1TVRA 3VZHA 3CTRA 4J2DA 1EXQA 2VPXB 4DFJA 3VENA 5F41A 3FRYA 1BXNA 3L6QA 2CPDA 4BR0A 2GJ2A 1YVUA 3EE8A 2B4VA 3A8EA 4J91A 2AD9A 2QLFB 2W24A 2CADA 4BBYA 1KSPA 2RMLA 1RWXB 3F73A 3CIMA 3V9WA 4LR7A 2QTDA 4BHQA 4J37A 3DRSB 3RG6A 2HVIA 2KHOA 4YOEA 4JAXA 5M1NA 2FVRA 2FSNA 2WC9A 1A9NB 4OHVA 1UVMA 4DTUA 2E9ZA 1U0HA 2NRWA 2HVZA 4CJPA 2LA4A 1HHTP 1WEZA 1OO0B 2DRAA 2NXCA 2V34A 4BRMA 3W1YC 1RILA 3J81j 2ZEJA 3ZCMA 4ANEA 3OYKA 3R1HA 4NYOA 1EAYC 1EIYB 1WG5A 4CLPA 1J5EJ 2XBPA 3FMWA 3LP1B 3TR8A 4RWWA 4CLSA 3PZPA 3NGZA 2QYGA 3IGNA 3SXLA 2AEJA 4GNIA 2LQ9A 4HKQA 2GIRA 5LSLA 4OO1J 5M1QA 1HYSB 4UY8O 3RMDA 5LMNF 1HR0F 2GVDA 3CETA 3CJAA 3OR1B 2GELA 1D1UA 3OV7A 1TAUA 5GAGI 4O4RA 4GKKJ 4IFEA 3GG0A 2B51A 4ZVTB 5GADU 2YWWA 4JV2A 4NLPA 4H4OA 1S7IA 3Q2SC 1IKWB 3JQMA 5JLHA 1QVFM 3NLCA 1YJ9S 2ZVIA 4WZMA 3D3CJ 4NXNK 1I5OB 4NRTA 3TA2A 3FK4A 1DURA 4NMXA 1RT5A 3QT8A 3BPDA 3NFAA 2KU7A 5CYMA 2K2PA 4OI2A 4CCHA 5C25A 4FBUA 5AJ3K 5F8NA 2DH8A 3A1YG 4CI0B 3RAQA 2OGUA 3M8YA 1RHRB 1S1VB 2VH7A 4ECQA 4ZK7M 1YBUA 4WFNQ 1X4AA 2E7XA 2C22A 3HLUA 4FKXA 3VA3A 1FXXA 4PHTX 5AQXA 1H74A 3HFZB 2Z57B 5LJ3Y 3HHDA 3DOKB 4HLBA 4R5PA 1C4CA 1U8SA 2ZHOA 1UWAA 4ECXA 1X9JA 4DR6F 1UFWA 1EO1A 1JCGA 1LKZA 1TL5A 3BGOP 3AD7C 2WVCA 1WUUA 2CPEA 2CQCA 1RAGB 3AGKA 5C24B 3MM9B 3CMES 4LFAJ 3FZMA 4F3OA 2ZWOA 2HHPA 4DWIA 2GQCA 3V5RA 3CCQS 4PZVA 2NQPA 1PYOB 3D0IE 4UY85 4JI4F 4IFYB 2HHHK 3DU6A 5F8GA 4KGXB 5KPZA 1HBOB 3OYLA 1VQ8N 4CTAA 4CHQA 1SC3B 2B9YA 3AAWB 5FPDA 3R97A 4CJ7A 3RWUA 5M1KA 4P52A 2FXUA 2QA2A 2P9UA 2MDAA 4Q0BA 3MCAB 2BH1A 2Z1HA 3O3FA 1DAXA 4IOAQ 4OJRA 3O3LA 1U6FA 2FSJA 4X62K 1SIWB 1IJJA 4HTLA 3BQ1A 2BJEA 3CCTA 3CQYA 4ZVEA 1EB0A 3KDOA 2K1RB 5E3PA 5AQQA 5HVGA 2W40A 2E5IA 2YH0A 4FLXA 1SB6A 1HL6A 3OW2M 3UO0A 3KUHA 2W8LA 3PFEA 2K8GA 3GTYX 4LF7K 3OXFA 2XMKA 2ASJA 2E7VA 3V6KA 2KYXA 1HA1A 1VISA 5LJVA 3DYAA 2RE1A 1NOYA 2H4YB 4NCAA 2RUSA 2OMLA 2GUIA 1H1VA 5FRNA 4ZVRB 2Q31A 3IG1B 1XMOK 2DEIA 4N8NA 3OFFA 2D69A 1VQ9N 1QDUB 4CEAA 1WHVA 1WC0A 4Z4GA 2HF3A 3R5GA 4X4RA 1FFGB 3NGIA 3G25A 2VJUA 1N36K 3JS9A 4ED3A 3L2VA 3IBWA 1PYTA 3L2QA 3U3YA 4ZIWA 3THYA 4M63C 2MQNA 1IBMJ 2D3ZA 5JVHQ 4A8MP 4HACA 4KHPK 1RAAB 2AT1B 3E2EA 3VGUA 3W65A 4A8WA 4AHSA 3E66A 4NL5A 3C7NB 4WYWA 4ISEA 1S1XA 3TUPA 4AXIA 2R7WA 3TZZA 4E19A 2QE5A 3ALYA 2B5JB 1S59A 1KVJA 2KZMA 2KT2A 4IO1A 3Q7BA 3OL8A 4W90B 2R4FA 4HI2A 2OUGA 1RACB 2HWTA 4FWNA 3GFHA 1EETB 4BCAA 2BRLA 1I94F 3QJPA 3KLVA 1WC1A 4YDXA 3JSMA 5K8NA 4GV9A 4DR2K 1WOSA 2MKHA 5K8OA 2VG5B 4ICLA 2PY5A 3LGMA 2O8FB 4DV7F 1GMWD 5JVGL 3FSXA 2YKNB 2Z1GA 3T9NA 1C1AA 3CC4N 2B7CB 2QMXA 3M8PA 3OYEA 3NOCA 2EI5A 2P2CB 4HR2A 2E1YA 2QA4S 1VHXA 4RO0A 4HDHA 1NGGA 3E01B 2MKSA 2OPRB 2WCXA 3TPQA 3I5AA 5J2PB 4AHTA 2R7OA 4IOCQ 2YI1A 1OY9A 2LSNA 1SQFA 2HS0A 1RHQB 1N5TA 2H1YA 1S9FA 4DSEA 3HM9A 3LOUA 4A62A 2KXHA 4DN0A 4LF6J 2B4PA 2QL5B 3FKBA 5KOXA 4J9OA 4ILGB 1ZBLA 4H54A 1WI6A 4U7BA 5FLXO 1SS6A 3DLRA 1JNZB 2VFUA 3AV9A 2ZC3A 1S3XA 3VV2B 1YK9A 2CJKA 3FEXB 4OL8A 3AH6A 3LZIA 4EAHD 1VC6A 5KT6A 3NBPA 3MN7A 2V5HG 2P9LB 1L3TA 3OYMA 4F0MA 1FD8A 3RTVA 2CH6A 4MFBA 2HFSA 1RWVB 1OKJA 5K20B 1WORA 3D7SB 4CFCA 4EGLA 3VETA 2KVIA 4FF3A 4QOTA 4H0OA 2A6MA 2AJ4A 2FLPA 1D9FA 1ZYQA 1FO1A 4FXWA 2Y8WA 2XLIA 2V4RA 2HHUA 1HQ2A 1XN9A 5B7WA 3D6MB 2ATQA 3HJFA 2FBVA 4YOXA 3BUZB 3V6HA 1QAJA 4QR1A 4DI6A 2J0QD 3V9ZA 1GLBG 3I9V9 2P9IB 3J7AP 1VIXA 2VFRA 3KG4A 1MMDA 2EFPA 3ZYYX 4D3GA 5B0AA 4HHUA 1GOAA 1N5QA 2OKQA 2D7SA 1H2TZ 4QW9A 2F63A 4IRCA 1GMWA 3HHNB 3G4SN 4NYFA 2FZCB 2IDLA 1EQMA 3ZT0A 5KFRA 1Z05A 3BEXA 3O4QA 4O3SA 3FGVA 4NZ7A 2IA6A 4GKJK 1PJ5A 4L72B 4HWIA 1CS4B 3VQEA 4JHDA 3QSIA 1NJZA 2VKRA 4FPAA 4LF4K 1NPKA 5L38A 1SAZA 4OMFG 4HHJA 3ISND 3DXMA 2ZDPA 4B1XB 3FEYB 5JUMA 2ASDA 3AA9A 4K42A 3DRRA 3CGIA 4ILJA 3NXZA 2XWYA 5AQJA 1TUUA 3L3CA 4BVOA 1S1UA 1KOHA 2YX1A 5C5JA 4A5AA 1SKSA 3WC0A 2VJVA 1JLCB 4HT5A 4GV3A 2WVDA 5HLFA 4C7QA 2FBXA 3H1QA 1L5UA 1HNZJ 4QIVA 1TQLA 3GILA 3CULA 4J2EA 2A3JA 3CM5A 1Q82T 3KLEB 1K8AT 4DN9A 4DV5F 5DS7A 5GINA 4CZLA 6FDRA 1KXPA 1TUGB 5I3UA 4HH0A 1Q86T 3E9PA 3M4XA 1CBKA 1ZAXA 2OSRA 1IBKK 3W9JA 3CWJA 1JXVA 5I42B 1R3NA 3RMAA 3EKUA 1S1WB 5FLXY 4WWSA 4ZLPA 1PGZA 2ROEA 1OIAA 3H0PA 3QYYA 3CHWA 3OLAA 3LL3A 2W9CB 4O44A 2FDNA 5HQ8A 1FDDA 7FDRA 2ETJA 3UVJB 3BZQA 3OQ2A 2EEYA 2GMJA 1U0SA 3RYLA 3QFWA 1HQUB 4QYRA 3LGHA 3KD1E 4NEZA 4NI2A 4KH0B 2Y8YA 2C3PA 3PTWA 3OTCA 4PUOA 2CPYA 3OSNA 2IOCA 3VQ5A 1X5PA 1CVJA 3OA9A 4X4NA 1B3TA 3MEDB 3BV8A 4K0KF 4JBCA 2Z8QA 2N4DA 1MWZA 4F04B 3EM1A 2AW0A 3CCRN 3NF6A 1HWUA 2R3VA 4M3UA 4F36A 5FJ4A 1WSEA 2OFHX 4ITSA 2MTLA 4EWTA 1ZBHA 3QNOA 3HHEA 4OPJA 1VRUB 3CVKA 1XWLA 2DISA 1S10A 3NGUA 4ECTA 1RWWB 2OZMA 3P3DA 3KLIA 4DSLA 3EYZA 1MMNA 3ID8A 3N5FA 5CE3A 4QR0A 1EX8A 3PJXA 2ZBRA 3R27A 3VESA 4XTTA 3KWGA 2W01A 1AYEA 3BKTA 4DMZA 4QYZJ 5BR9A 5DMRA 2CQIA 3KLHA 4QQBA 3I0SA 4F4AA 1IQZA 2KW4A 5ADXH 2B7BB 1U2VA 1WOQA 2XY8A 1CJVB 2Q36A 2HIQA 2DRDA 2QRRA 1RDBA 4B9SA 1FJEB 4ES3A 4DV4J 1NAQA 4JUZA 4IG0A 4ZPBA 2V2KA 1WEXA 4OYIA 3KHYA 1T05B 4ED8A 1VDHA 4RUBA 4OZLA 1O6XA 3O44A 4P2FA 2EG1A 2VODA 1OYDA 5HMZA 1X3NA 3K58A 5LMNK 1HR0K 3PHTA 1C0UA 4U67Q 3OYNA 1ASUA 2P9NB 1QHTA 3NCQA 3THWA 2EFNA 2UU9J 2BACA 4ECWA 1N33J 5BREA 3GJSB 1VQSA 3QFPA 4CO1A 2IIRA 1RT7A 2B9EA 2DNKA 1ZA2B 1BQMA 2NSCA 2OPQA 4TVAB 2E4LA 2EPIA 4OYWA 3W3SA 1Q81T 5FROA 4TLQA 1C0TA 1S49A 2E9TA 2DT9A 4M3WA 4LF8F 1M5SA 3SBTA 4WKYA 4JI2J 3VPZA 1LXNA 2NLWA 2YJFA 1WG1A 3N4WA 1T3OA 3GYGA 4P2SA 2A2DA 3ZC4A 2HMIB 1YF5L 3QRQA 1XC9A 4ZN1A 2DXEA 4B1ZA 3BREA 4OJHA 1S9EB 4DR6K 4OJ3A 3N79A 3M6WA 2DJWA 4NOHA 2Z2ZA 1Q82O 5ETVA 1K8AO 2LLZA 3C0BA 1WOOA 3M8QB 2GGPA 1QSSA 1HNVA 1Q86O 2VFSA 4J2BA 2YKQA 4FWMA 1X31C 4C11B 2IM0A 4QBUA 2IVOA 4KFBB 4JI4K 3MEGA 2IJRA 2K7JA 3EVMA 5K9FA 4DEZA 4FNHA 5ETPA 1TKXB 1S0MA 2ASYA 3EE3A 1TU0B 2KKZA 1KCFA 2Q1NA 3BSOA 3NS7B 1GAOA 4DSIA 1MU2A 3WDOA 4BRPA 3U27A 1MDUB 5G4DA 4XO0A 4O3NA 5L9XA 3VQPA 1K0VA 1QJHA 4OI6A 2XQCA 3S7RA 3UWTA 3GE9A 3OJUA 4ZJOA 5HP1A 2KQ2A 2BR0A 5IC4B 1VK0A 2E20A 4P10A 2RDJA 2BEFA 4EUVA 2ATCB 4H4MA 3VGSA 2MQ8A 4B3OB 3T9ZA 2W42A 3MK6A 1X5OA 4RW4A 1B7FA 4AQYF 2CPZA 4ZKAA 2E1PA 4LRAA 1AXQA 4URQU 2ZH3A 1VSMA 1UEUA 4WFAQ 3L4BC 4JI7J 3T1YF 1DT9A 2HNZA 2BJ7A 1TV6B 4U8YA 4DX8H 3MXHP 3Q89A 2R2RA 4DR3J 1SL0A 2XMMA 3VEXA 3HHLA 3A3OB 3NAIA 4I6YA 1RGVA 3OLBA 4DR4F 1GLCG 2ASLA 3D9BA 3T5JA 2G1DA 4FJ9A 1PO6A 2LQ8A 2RJZA 3P4UB 2MKIA 3LALA 1XNQJ 3PYDA 3A8KA 4N41A 3PSIA 3W2VB 4PXBA 2RQMA 2MMYA 3CQXA 3WZ0A 5B0CA 4LSNA 3IDHA 2HOEA 4KV8B 3AAQA 2JOQA 4R8UB 3KJQB 2HF4A 3HSZA 4CGDA 1AB8A 4JS5A 2LECA 2XHBA 2V2QA 4X65J 4O5BA 1WC6A 1V4SA 4B3SF 4JYAF 5HQLA 1X60A 4Z4CA 5HRSA 2AMCB 3F0NA 4DCHA 2F9DA 1NGBA 3O8MA 4JK7A 2O8CA 4F25A 4LFBJ 1I94K 1VBKA 2HQCA 2HWIA 3GJRB 4RBUA 3Q0AA 2A6AA 1E6YB 4OX9J 2QGFB 3EVWA 4WF9Q 1SH2A 2CG8A 2AGQA 3PR4A 2RF2B 2EK1A 2PN6A 2HVEA 2IC3B 1QQMA 3DRXA 1Q81O 3S01A 2C2ZB 4DV7K 5AFUH 3AVFA 3SLCA 1ZBSA 4FJ5A 4CECA 3CUNA 3EZUA 2GHWA 3WX8A 5IWAJ 4LSLB 1JLGB 1RT4A 4KRFA 2HBRB 1RT3A 3NCPA 3UKRB 1X5TA 3DMJB 2FZGB 3GFYA 4NXMJ 4YY3J 5I3QA 4C0OC 3FR0A 4JV5F 2P5GA 1HNIA 4MAKA 4DHYA 3KLFB 4WP3A 3I6PA 4ID1A 4BRLA 4L73A 1ZM9A 2G2ZA 4EFAC 3MXIA 1G6BA 2C2NA 1H7WA 3DOLB 4HH1A 4J9QA 2XM3A 3G87A 3K89A 3VQDA 1NK4A 1EJ7L 2HRTA 3M2RA 2E7WA 4OV1A 2FF6A 3CJTA 1WSRA 5CHIA 3C14A 5KFFA 3G6EN 3SQ4A 3WBZA 4X4SA 2CJYB 1XBWA 2JVOA 2BW2A 4A46A 4ZJQA 4PQAA 2M70A 3LP2A 4OQJA 4M3RA 5IV3A 2P6TA 1WC3A 1QE1B 1QAXA 3O4WA 3OTOF 2F4VF 2CQGA 4OHZA 3EGZA 4I67A 3VEYA 2MYFA 4EIAA 2P9KA 1GTHA 3Q24A 3JAMY 4K50A 2ZJRQ 2DHHA 3W62A 4W5OA 4JEPA 2HRYA 1S22A 1Q8LA 2IGIA 2RQCA 1JJCB 1HWJA 2JWKA 3GJQB 4YS2A 2XZWA 2PMHA 3P8BB 1VQPN 2O8EB 1J5OA 2RIJA 5EY4A 2KN4A 2PYLA 1JCEA 3M8ZA 1IWGA 1AROP 3ZSZA 3FBBA 2ZE2B 3QAUA 2GZOA 1KQKA 3D2WA 3C6HA 4JN4A 1DFDA 3LAKA 1JJ2M 4DUZF 4DG1A 2RVJA 3TA0A 5DQIA 1NK7A 3Q83A 3TEHB 1TKZA 4EO8A 4ZLJA 2DGTA 1QM9A 3MN5A 3N28A 4CHOA 4RW7B 2LQBA 1ATSA 1XUPO 1NK5A 2CZ9A 4ZP9A 4DV3F 2MLZA 3DXBA 1JLFA 4DS4A 2JLFA 4O0JA 1XR5A 1UA0A 2PMZD 4C8MA 3CDUA 4CLTA 2AA4A 3DLHA 3UB5A 4EO6A 3PKYA 3IWXA 1Z1ZA 3DLJA 3SYZA 4URGA 2NNWA 1K47A 1S0VA 4NCGA 5T7LB 5H9EK 2NLXA 3E3XA 3ETMA 4UTGA 1VQKN 5HMWA 1RTJA 2G9OA 4EK2A 1P1TA 2MEWA 1FRHA 3GIMA 3W9HA 3AA8A 3PM9A 1PBUA 5BPLA 1XMQJ 4ALZA 1TK0A 1RNHA 3HPHA 3G82B 2NREA 3ENAA 4FK0A 6AT1B 1S1TA 4WTOB 4M5KA 3WEEB 4DV5K 3J80O 2NUBA 2CKWA 3CCSS 4QU6A 2JFKA 5KG7A 2C42A 3CC7S 5B0BA 3OBYA 5GMKa 1QZ5A 5AQHA 3QAEA 1OH6A 1KAYA 2MQQA 1FX2A 2A42A 2JEIA 3ULEB 1LW2A 3RRKA 3VVUA 1JCFA 4FBTA 2KJVA 5HRRA 5T14A 3HSCA 4FVUA 1FE0A 2NRHA 1F0XA 1SJRA 4OKEA 4U8VA 3B4MA 2MZ1A 2CJBA 1Q8KA 3D28A 4OYXA 4F2RA 2YNIB 5JVHL 2NS1B 3BYPA 3QATA 1WI8A 5HAOA 3K9JA 1Y97A 2M3DA 1RBLA 2DNQA 2GEMA 5AQOA 2UUAJ 5A2QU 2MB0B 3CE8A 1U1KA 4K0KK 2FLOA 3D6RA 4FS2A 1N48A 3G8QA 4KRWA 3ATVA 4GRSA 1YI2S 1NKBA 4P2XA 2BE7D 3BY5A 2H5IB 3VOVA 1OS5A 1KP6A 1Y9OA 1YBAA 2M9KA 3SDEA 3QJLA 4YHHJ 1P8GA 5LOQA 2CDRB 2QEXS 3BGRA 4YR2A 3QMQA 2XMJA 4DQPA 5D0HA 5J1EA 4A8OA 1AZSA 1IR1A 3QRRA 4B9MA 2VFVA 4HUEA 3HP6A 5B0GA 3K7RA 3TI0A 5DQHA 5M2UA 1WSIA 2X6NA 3SUOA 2EVZA 3VQCA 4AM7A 1RWMB 1F3FA 4JKHA 4MQ3A 3ENOA 1RWNB 1NJYA 3FVYA 1CG2A 1Q9YA 2ZH1A 1Q0NA 4DV1J 3QESA 1VHIA 5D15A 2QI2A 2H54B 5IM0A 4CERA 1GFWB 1MWKA 2UXCJ 2Q0UA 1REVB 3AO5A 1BI4B 2DGVA 4NLQA 3HSJA 5T7BA 1VLYA 1Y10A 2HBMA 3V2UC 2DNMA 4F0HA 2EX3A 2BDPA 7FD1A 2GBZA 5JS2A 1KQSM 2E1RA 2RDIA 2DGOA 2EXUA 4I4BA 4ZHRB 4XH4A 2C2RA 5C25B 1KVBA 2F7VA 3POTB 1FJ7A 5AZJA 3OL7A 2XEXA 3K8VA 5DG9A 4FVMA 3S8SA 3J80Y 3M2UA 2EW9A 2RHKA 1SVDA 3GCWP 2V8VA 1DKGD 2FJVA 1ATNA 4DTNA 1YITS 4FYYB 3VF4A 1LWFA 2KXNB 1K9MT 3QWPA 3DAWA 1DY3A 4FCYA 2ZH6A 1FJGJ 3P38A 1IN0A 4R5PB 1P9YA 1S5ZA 4LF8K 1RGIA 4KB0A 3L95X 4H0VB 1NNEA 1VSDA 1O8BA 4A5BA 3OTEA 1XC3A 2ZITA 4CVNE 5A0YB 1N88A 4USUA 3ZNUA 3L2RA 4YOYA 3V4IA 3MPWA 4K4WA 1NB7A 1URNA 1OVYA 4R79A 3GJTB 2G1HA 5KFDA 9RUBA 2O8BA 2RNEA 4CTAB 1RCOB 2YPZA 2X1GA 4DJBA 1WUAA 1CSJA 2AZ3A 2P9UB 1XHZA 3BM7A 4CLKA 4Q0BB 2MZJA 1X9WA 2F7TA 1NGIA 3TOQA 2HNYA 5L1JA 4B3TF 4I7FA 1J2VA 3PJWA 1HKCA 3DLGA 1HJRA 2NRXA 2VPZB 1X3MA 4NLYA 3C16A 1JLBB 3RAMA 2G8UA 4M7XA 4GY2B 4EYHB 4MT1A 4BY9C 2NYHA 4WFXA 3P49B 4DQRA 1FHTA 1TL1A 4M5NA 4HVZA 2CQ4A 2VG7A 2MJUA 2B4UA 2W2OP 3W8PA 3DYAB 3KK7A 3RRGA 4FWKA 3NH0A 3C6TA 2I2YA 3DCAA 3UR0A 2XNRA 4B17A 5HO4A 4AQYK 5F0WA 2UVVA 1IG8A 3CCZA 1A0OB 3JTOA 4NA3A 1YVNA 3FFIA 3R7BB 3HHLC 2BABA 5JXSA 5LSRA 4ANCA 4H8KA 2FIUA 1N6QB 5T41A 4Z4FA 3T1YK 3AQOA 3HMJG 5AZIA 5H1SV 1YTYA 4WE1A 2D1KA 1RFQA 3CERA 1UJ6A 2GQQA 1LXJA 4LRDA 2DB1A 1TL4A 4FJKA 2ZOGA 2DTJA 4L76A 1IBMF 3H46O 1HI8A 2FBTA 1RCXB 4DR4K 3FE1A