3DOLA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
540
structure length
536
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 536
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dolA05
3DLRA 4FJLA 1W0HA 3THVA 4DQSA 3MECB 1VRUB 5J2PB 4B9VA 4CEDA 5DMRA 2EC0A 4HTUA 2PYLA 4JRQA 3G6VA 2UVWA 4WFXA 1X9WA 2HHUA 1JLQA 4WE1B 1S9GA 3ITHA 2QV6A 1RNHA 3UQSA 3OY9A 4NRTA 4GW6A 3KK3A 2HWIA 4IQXA 4KI6A 1T7PA 4CF0A 2HNDA 4MFBA 2D3UA 2DTUA 4WYLA 5KFZA 4CF8A 4ZVHA 3NGZA 1KHVA 4TY8B 3CM5A 3OL6A 4RNOA 5DLFA 4Y1DA 4N47A 3K5NA 5CYMA 1VSKA 2HB5A 4NLSA 1UAXA 1NK6A 3QZ7A 4BACA 1A5XA 1BISA 2VA2A 3KLGB 1ASUA 4BDZA 3RRGA 2GIQA 1RA7A 4RW7B 4CJLA 4RZRA 4Q5VA 4AHTA 3C6UA 1S97A 4TSXA 2B5JB 2CKWA 4RW4A 5I3UA 2R8KA 3MECA 4KO0A 3H5YA 3CIZA 4ID1A 3D5MA 3CDUA 4IRKA 1JLFB 3HL8A 1JLQB 1NJXA 4MK8A 1K6YA 1WNEA 2C2EA 4KV8A 4OVLA 4F4XA 5I42A 4YR0A 4ED3A 3K2PA 3LDSA 1B9DA 5L1IA 1YVFA 4CJQA 3DLKA 3KLIA 4NLUA 3KMSA 4OLBA 4M3RA 1QSLA 3V6HA 2GV9A 2JC1A 3DLBA 2HWHA 3KHGA 4CFCA 2W42A 1S0NA 2DFHA 2FBTA 4FLXA 5E41A 3LZIA 3M8SA 4QW9A 1WAFA 3V9WA 3WNHA 4ZP6A 4DSIA 4LH4A 1HMVB 3OL7A 5KFSA 1LWCB 3SQ4A 3MR5A 2W8KA 3OLBA 2IDOA 3Q8PB 3ISNC 1SV5A 3LAKA 2W9BA 2AWZA 1RDCA 3RR7A 3OYJA 2WHOA 2W9CB 2ILZA 1RDRA 4FS1A 2FJVA 4CGFA 4EZ9A 5KFVA 1JLFA 2OPRB 4DF4A 1C0TA 3DM2A 3UIQA 4YMEA 5KG4A 2W9AA 3ZSRA 5KFLA 3DLGB 1N4LA 4WFYA 3OYBA 5KFOA 2Z1HA 3SQ2A 2R2SA 3ZCMA 1RBVA 2BRLA 4O0JA 3T1AA 3HJFA 3E01A 3OYMA 4Q0BB 4KFBA 5J2MB 4WXWA 4YP3A 4M3ZA 3V9ZA 3DRPA 4DL3A 3I5CA 3HVRA 1U49A 1C6VA 3H5UA 5D3GB 1S1VB 3IG1A 2C2RA 1KVCA 2IOCA 3RMCA 3ITHB 4KB7A 3AO3A 2HVIA 4ED0A 4Z4FA 4OPJA 1KLMB 4ICLB 4IH6A 4FJ8A 1RTIB 4PA1A 3QIOA 3CFOA 4DTSA 4RW9A 3KD1E 1TK8A 1KTQA 4FJ7A 3PJWA 4ZTJA 3EPIA 4JV2A 4CF9A 1N48A 2ATQA 4K4UA 3NH0A 1VSLA 4MK9A 1ZBHA 3LPUA 4IFVA 1VSMA 4DG1B 3DRSB 1D9DA 2V4RA 2G8WA 4ZP7A 1RT7B 4PQUB 4K4TA 1Q9XA 1C0MA 2BANA 1S1VA 3IG1B 4J9SA 3OS2A 1NK4A 3FFIA 5D3GA 1X9MA 1LWEB 3RMDA 1HYSB 5J2PA 1XR6A 1EX4A 4G3IA 1DTQA 2R8GA 3V6JA 4B3OA 5F8NA 2OPPB 3VQCA 2KFZA 3AVAA 1Z25A 5J1EB 4FK0A 2Y1IA 4JS4A 4PWDB 4K4XA 2WK4A 3QGIA 3H59A 1BIZA 3RRHA 1RBUA 1U09A 4NCAA 4KFBB 1RBTA 3QETA 4DSFA 3LP1A 5KFDA 3QLHB 1QS4A 4C8LA 2E9ZA 3M8PB 3LANA 4HYKA 3VQSA 2QKKA 1TKZB 4TYBA 4DL4A 1U04A 1A5WA 1LAWA 4FZZA 3FDSA 2ZD1B 3AA4A 4TXSA 1S5JA 3BGRA 4I7FA 2IS3A 3VQ9A 4BDPA 2YKMB 1HJRA 2R8HA 4CJSA 3A2FA 4RNMA 1REVB 3NGDA 1JLCB 4FXDA 4CEEA 1U47A 1HYSA 3K5LA 2G8UA 3AV9A 3DLKB 4LQ9A 3OYLA 4KHWA 4KHYA 4Y1CA 3ZSOA 4OL8A 1VSHA 4ZPAA 1S1UB 1UA1A 4TLRA 4RW8B 4U6PA 3M9NB 3PW0A 3QLHA 1JX4A 1ZTTA 2B4JA 4DU3A 4DFKA 1HYVA 1TAQA 1JKHB 3BGRB 3TAMA 4O5BA 1VRTA 1FXXA 3NGIA 3S3OA 1NK9A 1ZYQA 4Z4IA 3RR8A 5C5JA 4W5NA 3KLEB 1T03B 4BWJA 1VSIA 2FBVA 2PY5A 1JLBB 1Z4UA 3PW4A 3SFUA 4NYFA 1J5OA 2RKIB 2V9WA 4CHQA 3T5HA 4DLEA 1RT3B 3ZSVA 3PW7A 1N56A 5KFYA 3DOLA 3CJ3A 4O44A 3CG7A 3K57A 2D41A 1YVUA 5KG5A 1IKWB 1LWFB 4MH8A 5HROA 4DTOA 1LV5A 1NHUA 5KFBA 1VRUA 4RW8A 4DWIA 1IG9A 3AVMA 1SL2A 4Z4HA 1W25A 3QEIA 2KW4A 4ECTA 1D0EA 4NYNA 2XY7A 2F8EX 3ZSWA 3JSMB 3D28A 4KO0B 1RBRA 4OKKA 3LP0A 4DMNA 3S3NA 2R8JA 4CGHA 3OL8A 4F3OA 2KZZA 3DMJA 1RAJA 3IS9A 4JS5A 3KLEA 2V0NA 2FVPA 1HNIA 4JV1A 5DLGA 3QEWA 4GC7A 5DG7A 3QO9A 3GYNA 3LWMA 3IRXB 2RKIA 4CJUA 4CHZA 4X2BA 1IM4A 2WB4A 4B08A 3KLIB 3OYIA 4HCBA 3M9OB 1TVRA 2D5RA 2VWJA 4B9UA 2BR0A 2D0BA 1NJYA 4DU4A 1HNVB 5L1KA 5HP1A 3GIJA 2X6NA 1JXEA 4Q45A 4ECSA 3H5XA 1RILA 2VG5B 4GC6A 4K4WA 1C1BB 4IKAA 3CQ8A 1C0UB 1TK5A 2W9CA 3SFGA 3AO1A 4F4WA 3PHEA 3Q8QB 4O3QA 5HLFB 4IG0A 4MK7A 3HVWA 4EO6A 5T7BA 1NJZA 4DSLA 5CZ1A 2X6SA 5CZ2A 5SWMA 2WCXA 4IBNA 2OPRA 4OPKA 5DQGA 4OKJA 4YNQA 4WYWA 5FRNA 4CECA 3GV7B 4W5OA 1L5UA 2XY8A 1ASVA 3DDKA 4CJVA 2FLLA 4E1MA 3CFRA 2YNGB 3MXJA 3CM6A 1HQUA 3SUOA 1LW0B 2V4QA 1U45A 1MU2B 1RT4A 3AVIA 3KJVB 2XWYA 3TR8A 2VG7A 3NMAA 1WSGA 1KVBA 2ALZA 5KRSA 2IM1A 1TKZA 4FJGA 2WTFA 3PR5B 3JSMA 4K4VA 1U48A 4NLPA 1SKRA 1C1CB 4EYIB 4I7FB 3UPFA 4NLXA 3OS1A 3EYZA 1RTIA 3VQBA 3DLGA 3MR2A 3NL0A 3LP3A 1JLGA 2RDJA 4KKOB 1ZBLA 3PR4A 1J9AA 3K5OA 2ZKUA 3TWHA 4KHRA 1RYRA 3TVKA 4F2RA 3N6LA 2IGIA 4IG3B 4H8KA 1ASWA 3CDWA 4ED6A 4ECRA 3V6DB 2O5DA 4NLYA 4ZMMA 1S9EB 1IKWA 1LWFA 5HROB 2HMIA 4JUZA 3TQ1A 5JS2A 1LW0A 4KHUA 2HHXA 1BQMB 5KFIA 1NHVA 3DRRB 1WNSA 3QNNA 4QCLA 3H40A 4DTPA 3WNFA 4DSKA 2GC8A 2R7YA 3C95A 2BQ3A 1VRTB 2DPIA 3JYTA 3Q8RB 5KFTA 5KFRA 4E89A 4CEOA 1T8EA 3CO9A 4NCBA 2QE5A 3EY1A 4N76A 4H4MB 4CF2A 4NLWA 5L1LA 3OYEA 5F9NA 3SI6A 4AHSA 3L3UA 4MIBA 2YKNB 4DQQA 2ITGA 4ZPDA 2FVQA 4IFYA 3AVGA 4ECZA 4EYHB 2GUIA 1DLOA 1FKOB 2YV0X 4FLZA 5F9LA 2ZD1A 1X9SA 1LWEA 3SUNA 1SV5B 2P5GA 2XHBA 2YNHA 1XI1A 4RW6A 3KHHA 1RT5A 1EXQA 1TV6B 3GV5B 3PUFA 3ZSXA 4CERA 3T3FA 3JYTB 4GMJB 4HHTA 2HW3A 3HVTB 3IS9B 3SV3A 1FKPA 2J6UA 3PW5A 1GOBA 4H4OB 1BGXT 4XPEA 1QSSA 1SH2A 3V4IA 3BSAA 1SKSA 2UUWA 3QGGA 1J53A 5HP1B 3RAXA 3SJJA 1S1XB 4KSEB 5F8HA 4M3WA 1WSJA 2FLPA 3KJVA 1I3AA 3OL9A 3B6OA 3HSTB 4ELUA 1FK9A 3K58A 2FVRA 3BJYA 2ETJA 4NLQA 1I6JA 4WFZA 1L3SA 3SYZA 2QK9A 4RW4B 5I3UB 4AHVA 4E7KA 3K59A 4RUAA 2AGQA 3H5SA 3H2LA 1S4FA 3FQLA 2C2DA 4F4KA 4KE5A 4LSLB 3BQ2A 4FBUA 1ZBUA 3RBDA 3KNAA 3S3MA 2JLEA 4E1NA 3SUQA 1TL1A 3HVTA 4PUOA 1UOCA 2XCPA 4FVMA 4DU1A 3O4QA 3LWLA 4O55A 4CIEA 5J2NA 2JEJA 3DOLB 4ZPBA 2FVSA 1RDDA 4NLDA 3BREA 1R0AB 2AGPA 3GILA 4CFBA 2YNGA 1RA6A 1SL1A 4ZTFA 4CEBA 1TAUA 1DLOB 1FKOA 2FLNA 2BRKA 3CVKA 2OYQA 3KLHA 4FLVA 4Z4EA 3AVBA 5FDLA 3DRRA 4QAGA 3DRSA 3O3FA 2ILYA 4DFJA 4J2AA 3K5MA 3OVNA 1REVA 5DGBA 4RG8A 3QERA 1TKXB 3MEEA 3MEGB 4IDKA 3ZT4A 4B9NA 3VQPA 3CWJA 3V1RA 3SCXA 3OYAA 3H4BA 3L2RA 5KI6A 1ZBIA 5KG3A 1LW2B 1QE1A 1HARA 3NGYA 1S6QB 1SL0A 3NBPA 4F3TA 4CJKA 3L3VA 1RTJA 2WOMA 3V4IB 1TKTB 1SUQA 3AA5X 3TAGA 1JLGB 1D5AA 4WZMA 2IBKA 3L2UA 3VQ8A 4FLTA 2A1RA 4FLYA 1IKYA 4O4RA 4I9LA 5F8LA 4I2QA 1HNVA 1S9FA 4J9QA 2I1RA 4TYAA 1QHTA 3I0SB 3BQ1A 4YQWA 3OYCA 4J9KA 2YNFB 4ECYA 3FRZA 4KI4A 1S10A 3MEGA 4J2EA 3DYAB 1J5OB 3AVHA 2RPIA 1NNDA 3H98A 4KBIA 1NKCA 2XY5A 2YKNA 4KTZA 3QIPB 1QE1B 3MXIA 5J2NB 5KT6A 4HUFA 2GBZA 4ED7A 2G8HA 5CYMB 4LH5A 2BE2B 2RF2B 3BSOA 2IAJB 1HPZB 1YTUA 2IM0A 1S1XA 4O0IA 4NLOA 4WXOA 4O3RA 4CHPA 4YFUA 4W5RA 2ATLA 3ICLA 1YT3A 4FM2A 4DL5A 4DF8A 4ZPCA 2I5JB 1DTTB 4DLGA 3QGHA 1VK0A 5KFNA 2BANB 4NLTA 3SNNA 1SH3A 3IGNA 2B43A 4OGCA 4CHNA 4B9SA 2BQUA 4EBCA 1NJWA 2WRMA 5J1EA 5F8MA 4MQ3A 2D3ZA 5KT5A 4IKFA 1RT6B 4KHMA 4F4YA 1KCFA 4HVJA 5JXSA 5CYQB 4IG3A 2G8KA 1RDBA 2RF2A 3V9SA 5JS1A 4CGGA 3QEPA 1RDAA 3NCIA 3NFAA 1W9HA 4EP5A 2HHWA 3TAQA 1S9EA 2VG7B 1HQEB 1S1TB 1TL3B 1J54A 4Q0BA 4IRCA 2UVRA 1BL3A 1WN7A 3ZT0A 1IKVA 4QWCA 2D7SA 4FBTA 4B9MA 4DQPA 4O4GA 3BDPA 4L8RB 4M3XA 3HP9A 4K4SA 4XPCA 3TAEA 3V6KA 4LSNA 1U4BA 1BI4B 3AVFA 1S49A 4CFDA 3OJUA 4DQRA 4DFMA 4MFBB 4MKBA 3ZSZA 5KG6A 2ZE2B 1S6PB 3NBPB 3KIOA 4NLRA 4CJWA 4AH9A 5DG9A 1KLNA 1CLQA 4ELVA 3AO4A 4DTMA 3IGVA 2WONA 3IN5A 1TVRB 4KAZA 3ZSYA 3GIMA 3KLVA 4CK1A 4LD0A 3L2WA 4CJTA 5SZTA 4XIUA 4K8XA 3QEXA 1T94A 4Y2CA 2Z1IA 4CGIA 4Y3CA 3TAMB 3VQ6A 3G86A 4IDKB 2PZSA 4CJRA 5HRSA 1JXLA 1CZ9A 4FS2A 1EP4A 5K14A 1JLBA 5KFEA 3O4NA 3GIKA 5KT7A 3HO1A 4J9LA 4CJFA 2W7PA 2DPJA 5J2QB 4I2PA 2X78A 1SKWA 2OPPA 1TGOA 1ZETA 2DFFA 4IFYB 3VA3A 5L9XA 1L3UA 3H4DA 4KTQA 2OH2A 2R2UA 4EZ6A 3L8BA 5T14A 2O4GA 5KTQA 1B9FA 3MTKA 4NLGA 4FK2A 3C6TA 3DI6B 4FJMA 3RB6A 4B8CA 4DTJA 4Y2AA 3M8QA 3QZ8A 3PX6A 3RMAA 1KFDA 4LY7A 2G8FA 4CGDA 4E7JA 2IC3B 4O3NA 1XC9A 4NLVA 2IM3A 3TANA 3MEDB 3T5KA 3HK2A 3ALYA 4IH7A 2P1JA 4CE9A 4C8NA 1GX5A 4DTNA 4H4MA 1MMLA 3BQ0A 1EETB 1TL1B 4KPYA 4B3OB 1C1AA 3SI8A 1RT6A 3F9KA 3U3YA 5KFFA 4PWDA 4E0DA 4ID5A 4TY8A 1HRHA 3QESA 5DQIA 1S0OA 3GV8B 1L3TA 3QIPA 4RNHA 4ECQA 4R5PA 4CCHA 4BDYA 4NZ0A 5DG8A 4CJ3A 2NUBA 4HUEA 4CJPA 4O3PA 3KLGA 1YTAA 1IKVB 4DSJA 3NKYA 5FDLB 4FJXA 3KLHB 1C1BA 1NK7A 4HKQA 3DRPB 2FC0A 1Z26A 1O1WA 3NAIA 1BI4A 4FJIA 1KRPA 1ITGA 4KRFA 3CJ5A 2HNZB 4AHCA 3SPYA 1D1UA 1C2PA 2XI2A 2OPSA 2G8VA 3PV8A 3I8DA 4QWBA 1TKTA 1R0AA 4UQGA 3GIIA 3U6FA 4QWEA 4O44B 5KRTA 2P51A 4CJEA 3HYFA 4FJ5A 2D0AA 2RDIA 4DS4A 4KHNA 2LSNA 4IR9A 3EPGA 3RWUA 1RTDA 1KHWA 5KFUA 1WSIA 3NH1A 3PVXA 4M45A 2XO7A 4CEZA 3OJSA 2HHVA 3N6MA 3KK1B 3V9XA 4KV8B 1RT7A 4PQUA 4IH5A 3NHGA 3ISND 4FLWA 5F8GA 4QOZB 1TV6A 1Q9YA 3MFIA 3LP2A 1XWLA 1NKEA 2WONB 2E6LA 4I2PB 3AA3A 2DY4A 2BE2A 1CSJA 1RYSA 1JLEA 1UWBA 3CYMA 1N6QA 1IKXA 3E01B 5KFQA 1LWCA 3HHKA 3CDEA 3HPHA 3I0SA 4CJ4A 2PYJA 4J9PA 2I5JA 5DK5A 4ECUA 5KFPA 5L1JA 1S1WA 2IC3A 2RN2A 4FJNA 4DSEA 4QPXA 3HP6A 4TQSA 3LP0B 3U3GA 3NF7A 3KOAA 3CFPA 3BR9A 2FJXA 2P5OA 1GX6A 2YKMA 3T5LA 4G1QA 4WE1A 3KKRA 3KK1A 3QO9B 3PO4A 1KLMA 4ICLA 4AHRA 4FYDA 4W5TA 3AO2A 4J9MA 3EZUA 4ED2A 5C24A 2HNDB 2XCAA 4BE0A 3FQKA 2XGPA 1IH7A 5J2QA 2R2RA 4F50A 3CJ0A 5EWEA 2VG6B 4FJHA 2CJQA 4DEZA 2AX0A 1I39A 1KFSA 3NF9A 1UA0A 2A1SA 3I0RA 1VSEA 5HBMA 5C42A 2YNHB 1B92A 3C6UB 1JL2A 4IG0B 4J2DA 5KG1A 4DQIA 1GOAA 1JKHA 5CY4A 1QAIA 4CF1A 3SZ2A 2JEIA 3LP2B 2B6AA 1S6PA 1TQLA 4H4OA 3ULDA 4E7LA 4B9TA 4OKEA 1L3VA 3OSNA 3DLEB 4HCCA 2W8LA 3NH2A 4ID5B 4EBEA 1NKBA 4KREA 4ZVEA 1MU2A 1RT4B 4EP4A 4DG1A 3M8RA 1RTHA 1FK9B 3VQEA 3GQCA 4I2QB 2IM2A 2FJWA 4Q8FA 4ED8A 4J9NA 4ECXA 4FJKA 4DTXA 4ECVA 4NRUA 1NK8A 3V1QA 5KT2A 3OYHA 4ZP9A 2FVCA 1ZBFA 3OYFA 1T05B 4FJJA 2XC9A 4Q8EA 3LALA 2Z1GA 4GVMA 3QYYA 3V9UA 3MF5A 3TI0A 1S0MA 1HPZA 3KTQA 1HQEA 4CHYA 4TY9A 4C8OA 1SH0A 4H54A 3T5JA 4R0EA 1BIUA 5J2MA 1RTHB 5HRPA 4Y34A 3OHAA 3IAYA 3OHBA 5HLFA 3N6NA 1D8YA 2YNIB 2C22A 2JEGA 2W7OA 4URSA 5KFKA 3C94A 5KFMA 4K4ZA 2VG5A 1JLCA 3DOKB 2FBXA 5EDWA 3M9MB 3HKWA 4M3YA 4RW6B 4KAIA 4QW8A 4F4ZA 4BE1A 4QWAA 4E7HA 2AJQA 1BCMA 1QTMA 5KFXA 1EETA 4CEAA 1SUQB 1RT1B 1JIHA 1RTJB 2WOMB 1BCOA 3SQ1A 4E19A 2JGUA 3QIDA 5EWGA 5KT4A 3NE6A 4KB0A 2HHQA 3NAHA 5KFAA 4I9QA 2ASLA 3OSPA 5KG0A 4R5PB 1WSEA 2OZSA 2VA3A 4Q44A 4TQRA 2J6SA 3HPOA 4IFVB 4O3SA 4RUCA 5KG7A 4OLAA 2HAIA 5K14B 3D0PA 4FCYA 4EBDA 4CEFA 2HHSA 4DL6A 4O4GB 2UVUA 4CJ5A 1LAVA 3P5JA 4ELTA 1BHLA 4FLUA 4KKOA 5HRRA 1HNIB 3RAQA 4DTRA 1NOYA 4M95A 3RB3A 4JRPA 1KSPA 4E7IA 3SV4A 3HPGA 4PUOB 3G0ZA 3OLAA 3QNOA 3NAEA 3I5BA 2XI3A 2GIRA 3OS0A 1TP7A 4URQU 3SQ0A 2UUTA 2ASJA 4B9LA 3V6DA 5C42B 2E9RX 2OA8A 4FZXC 2OPQB 4M41A 3LZJA 3MXMA 1XHZA 5EU7A 4URGA 4FW2A 1XR5A 3LPTA 4CIFA 2O4IA 4NCGB 1EKEA 1D9FA 2VWKA 3DOKA 1TK0A 5F8JA 5FRMA 3PX4A 3P83D 2E9TA 5DGAA 4OJRA 2YHAA 4CIGA 3G10A 4FW1A 4J9OA 4EEYA 3KK3B 5KGWA 3ZT3A 2OPSB 4IOBA 3ZT1A 2DFEA 3PY8A 1RT1A 1RT2B 5C25B 4U7CA 1QUVA 1JLAB 1KVAA 1C0TB 3DM2B 1WSHA 4KHQA 3TAPA 2ZQBA 1S6QA 2ASDA 4IR1A 1JLEB 5KFHA 4BE2A 3HXMA 3TARA 2F8SA 2HHTA 1VSJA 2R8IA 4ECWA 4J2BA 4FM0A 1HQUB 1S1TA 1WSFA 1WAJA 4N5SA 1G15A 3SUPA 2HNYB 5DQHA 1IKYB 3RTVA 3UDLA 1VSDA 3ZSQA 2Y1JA 2EX3A 3RB4A 2YNIA 1RT5B 1TKXA 5KFGA 4K4YA 2E6MA 4B8AB 4AILC 3ASMA 4K8ZA 1Y97A 1HYZA 3PO5A 4MIAA 5F8IA 1LW2A 5FROA 2FBYA 4YR2A 3DYAA 3VQDA 4XO0A 4R8UA 3V1OA 5I42B 1IO2A 1NK0A 3HT3A 2AGOA 1RT3A 1N6QB 4W5QA 4C8MA 1FKPB 4JV0A 4DL2A 3OYDA 5C24B 1IKXB 4ZHRA 3LAMA 1NK5A 4ZVFA 4M3TA 4EO8A 3KHLA 3KLFB 2F96A 3CJ4A 1XR7A 5JUMA 3MR3A 3AVKA 3KK2A 1S48A 4RU9A 3VQ7A 4DL7A 3RMBA 3I0RB 1X1PA 5EUHA 4LSLA 5KFCA 3TAFA 3TABA 2KZMA 2KQ2A 4G1QB 2Z1JA 3WNEA 1RCHA 2KTQA 1GOCA 3FFIB 3DMJB 3AVCA 3EZ5A 3HVAA 3MR6A 4FK4A 2XGQA 2HNZA 1A5VA 1UWBB 4RNNA 3PJXA 1CZBA 4LQ3A 2VG6A 3WNGA 1TKDA 1WLJA 2JEFA 3H08A 3G6YA 1OS5A 2IMWP 4DFPA 5CYQA 4CESA 3C6TB 3DI6A 4DTUA 3V81B 2AQ4A 5HBMB 2B5JA 4M42A 1S1WB 1DTTA 3KKSA 1ZTWA 4CHOA 1TL3A 3OYNA 1RBSA 4JLHA 4J9RA 3KD5E 2BGGA 2B6AB 3AVJA 3AVLA 3I5AA 4M94A 1S9GB 4F2SA 2QXFA 1T05A 3DLEA 4M3UA 3AA2A 3NDKA 2R2TA 4C8KA 4O3OA 1DTQB 4FJ9A 5KFJA 4RW9B 4RNFA 4N56A 4HUGA 5EWFA 4Z4GA 2Q3SA 3QEVA 4IRDA 3P1GA 5HRNA 3Q8SB 3AVNA 2HNYA 4WZQA 4QWDA 4F8RA 2F8TA 1N5YB 3M8QB 4CGJA 4RW7A 2BDPA 4AHUA 1QAJA 4CK3A 2OZMA 2C28A 1CXQA 3VN5A 2OPQA 4FZYA 1HMVA 2AX1A 4LSNB 4KTWA 4NCGA 2YNFA 5KT3A 1RT2A 5C25A 4KHSA 1JLAA 3T19A 4Z4CA 1C1CA 2IJFA 3L2QA 2ZE2A 3KHRA 1QQCA 1T03A 1VSFA 3E51A 3D45A 2IAJA 3DLHA 3RB0A 3SPZA 5KGXA 3PX0A 3MAQA 1BQNB 4YR3A 4ZP8A 4E3SA 3KLFA 4Q43A 4N41A 3O3GA 3VQQA 1K1QA 3LP1B 2IA6A 3V81A 3NF8A 3M8PA 3PZPA 3KK2B 2X74A 2JC0A 4KB1A 4NYZA 3FSIA 4CEQA 2HMIB 1RTDB 3OYGA 1N5YA 4CFAA 3NF6A 4ZVGA 3OYKA 3G6XA 2E4LA 1C0UA 4FM1A 3UR0A 2J6TA 1EP4B 2W9BB 3BSCA 4OGEA 1CXUA 5KFWA 2UVVA 4K50A 1BQMA 3F73A 2G8IA 2XY6A 3B6PA 3MEEB 1JL1A 3PW2A 3BSNA 3VQ4A 4MKAA 3VA0A 4R8UB 3RBEA 2D0CA 3MEDA 3O3HA 3ZT2A 4PY5A 4Z0UA 3AO5A 2IJNA 2YHBA 3QINA 1QSYA 2BQRA 3S9HA 2QKBA 4BWMA 1JXBA 3MFHA 3VQ5A 4ED1A 2KFNA 3IRXA 1XHXA 2XRIA 3CJ2A 1T3NA 1F21A 1BQNA 5KG2A 3VQAA 4DS5A 4TN2A 3HM9A 4ZHRB 1K1SA 3L2VA 1S1UA 2EHGA 1Q8IA 2HVHA 4CK2A 1NOZA 2AU0A 3KMQA
chains in the Genus database with same CATH superfamily
3D6RA 1W0HA 1WBDA 4KY3A 4RBTA 1S0VA 5J2PB 1X5SA 3HM8A 4CEDA 2PYLA 5HATA 4LREA 4V19X 2A18A 1RNHA 3KWMA 3AB2B 2GQQA 2BM0A 2HWIA 1TELA 2ZVIA 1ACMB 4IOCL 3CM5A 3VAFA 3OL6A 4Y1DA 4WWSA 3K5NA 5CYMA 5B0AA 2BYCA 2CFXA 1BISA 2VA2A 3CJ7A 1ULRA 3J8AA 2E2NA 4Q5VA 2R7XA 3GOIA 2FTRA 1S97A 3D1QA 3W2WB 3J81j 2ZH5A 5C12A 5I3UA 2UZAA 4LF6K 3MECA 1Q7LB 3H5YA 1N36J 4DR6K 4ID1A 3D5MA 1SQEA 1CEZA 1JLQB 1ZM2A 4OVLA 3HHLB 1YHQN 5I42A 4LJMA 2GWKA 4ZIWA 1Y7PA 5A8WA 3DLKA 2MKHA 3KMSA 2FF6A 1QSLA 4M3RA 3V6HA 4JV5J 2IJRA 2JC1A 2HWHA 3BBCA 5BYQA 2FJBB 4GVBB 2W42A 2Z2YB 5BPLA 3N4QA 4ZP6A 1HMVB 2RE1A 3MX2A 3SQ4A 3MR5A 2W8KA 3OLBA 3Q8PB 2EEYA 1FJGF 3LAKA 2W9BA 2AWZA 3RR7A 3P38A 2UUAJ 4B3SF 4PL7A 2RUGA 1XUPO 4ZN1A 5KFVA 3KJNB 3HKZD 2OJ3A 3H45C 3UIQA 3JS6A 3ZSRA 1QHAA 5KFLA 3P39A 2AMCB 3DLGB 5JVGL 2Z1HA 2R2SA 3ZCMA 1RBVA 2W4DA 4LIWA 4O0JA 3T1AA 2H9ZA 3FBFA 3GJQB 3QICA 4DV7K 3OYMA 4KFBA 3UKUB 4OFZA 3JQJA 5J2MB 2C2KB 1G7CB 2VWBA 4LFAJ 3ENQA 1U49A 1C6VA 4PHTX 1NBWA 2BH1A 3CJ1A 3WDOA 2C2RA 1KVCA 4FWNA 2E20A 3IWLA 4FWOA 3NP5A 4F02A 3RMCA 3ENHA 1NMEB 3CO0P 1SQKA 3AO3A 4Z4FA 5T7LA 4ILHA 5AQFA 1HA1A 4JI5F 2ZZNA 4PA1A 4MO5A 1VQKS 3I9V9 4USVA 3L4QA 2IBOA 4RW9A 3Q2SC 3MM6A 3NLCA 3KD1E 1KTQA 4DR3J 1TUYA 3EE9A 3TR5A 4CF9A 1N48A 2VGNA 3NH0A 2HBJA 2WVDA 4MO4A 3V5RA 3H1VX 3ZO7A 4DG1B 2C1EB 4NZ6A 4DV5J 3GYXB 1X4AA 1RT7B 3CJQA 1Q9XA 2BANA 1U0HB 1NK4A 3FFIA 1FEEA 3GB0A 5D6GA 4A4JA 4I69A 3N4PA 1O5JA 2R8GA 3THTA 3V6JA 2OPPB 5LMUF 3AVAA 4M1KA 5J1EB 4YOWA 2HFZA 2Y1IA 4JS4A 4PWDB 3ENBA 2HSEB 2MKKA 4JYAJ 1BC6A 4HH0A 5MLCV 1U09A 1U24A 3B4DA 2GO8A 1QS4A 2J0WA 4HYKA 3VQSA 4IO1A 1U04A 1LAWA 1DQ8A 2ZD1B 3S01A 2V94A 1WSVA 3FEZA 2A2DA 2HS4A 4O5FA 2OEMA 5AR0A 3EVWA 2A42A 1REVB 3NGDA 4YOTA 1SAZA 2A41A 1U47A 3EJMA 1HYSA 2WFBA 3DLKB 2UUBF 2Q36A 3LW5C 4KHWA 4H0OA 4GO5X 2FHKA 2J9DA 3GG1A 4Y1CA 5H9FJ 2MSTA 4TU9A 5I9EB 1S12A 1UFWA 3LDPA 4TLRA 5M1FA 4W4MA 3PW0A 3D66A 4DU3A 3UB5A 1HYVA 4ENOA 1VQPS 1HD0A 3QJPA 3LDOA 1FEHA 1KS2A 2MQQA 3RBZA 2VD3A 4C3MA 5AZJB 3TAMA 1VRTA 3VEOA 1U2RA 2O1PA 3L09A 3NGIA 4Z4IA 2PY5A 1VSIA 3PW4A 2P9CA 3SFUA 1GK8A 4X64K 2K06A 2RKIB 2NLXA 3T5HA 2W2PP 3K0JA 1RT3B 3CW2C 3ZSVA 4NA2A 4JKGB 3DOLA 3UD3P 1VJWA 2CQDA 3CG7A 1R89A 4EK2A 2NRHA 2D41A 2JVOA 2IVMA 4DPTA 4MH8A 4DTOA 4JI1K 2DITA 1VRUA 2QN6B 2QWMA 4LF2A 3ZZZA 4KYZA 3E2EA 4JI7J 4NYNA 2FDNA 2XY7A 1OJ4A 2F8EX 3ZSWA 3D28A 4OI4A 1F2GA 4KO0B 1RBRA 3HZ6A 4OKKA 2R8JA 1HNXK 4JI0F 4CZEA 3QFUA 3KLEA 3A8JA 3QQCD 4QIGA 1MDUB 4JV1A 1BUXA 2YX6A 5ETPA 5DG7A 5MAOA 3GYNA 1TMJA 3DGVA 4CJUA 4CHZA 4Y2KA 4X2BA 5D4NA 1IM4A 3M2UB 1TVRA 5DETA 1IBLJ 2D5RA 3LPYA 1RKIA 2HVDA 2BR0A 1NJYA 4CZGA 1HNVB 2BJ3A 4X4PA 5HP1A 3I8BA 2VFRA 2DGOA 3RG6A 1JMTA 3WT0A 2KVQE 2CH5A 2E1MC 3QFWA 1S4EA 1T11A 4BC5A 3OVBA 4ECSA 3H5XA 2F4VF 2KXHA 2W9CA 1YI2N 4FVUA 5HLFB 4EO6A 1T9UA 2QWRA 2X6SA 2X3DA 3GR1A 4B3MF 2V8DA 3PCOB 5DQGA 3CCLN 1HNZK 2CDQA 1Q79A 5K9FA 4OHZA 3EGVA 5A76A 4KR0B 3GV7B 4W5OA 3BF4A 1L5UA 2ZITA 1ASVA 4USMA 1HQUA 1ZAWA 3SUOA 1RT4A 2DNNA 3AVIA 2AD9A 3R7SB 2E7VA 5HJXA 4A8OA 2XWYA 2G4BA 3NS6A 3TR8A 4UOHA 5DS7A 5JLFA 2K2PA 3CCWA 3FJ2A 1I1GA 3NMAA 5K8OA 1KAYA 1WSGA 5KRSA 2D0OA 1N5QA 2LFVA 4M5DA 1N32J 4CLPA 2MLXA 1SKRA 1RAEB 4NEYA 4EYIB 3GPAA 2J0QD 5FPMA 4IOAL 4A8YA 5D4PA 1KP6A 2HHHK 1IJJA 4DQ8A 4PL8A 1RTIA 3VQBA 3EGZA 3MR2A 2XZDB 4JKGA 1JLGA 2KI2A 4A62A 1F6TA 2OP5A 4LVOP 3K5OA 2ZKUA 5C2CA 3TWHA 1OKJA 4KHRA 1P8GA 5E0OA 3N6LA 1FWLA 4IG3B 2RSQA 3LQVA 2QLJB 4WQ5A 2O5DA 2UU9K 2MKSA 1F9HA 4JUZA 2XHWA 5M1PA 4LUBA 5JS2A 2PSZA 3WC2A 1UMJA 1IUJA 1PG5B 5FIIA 5KFIA 1NHVA 4FDFA 3QNNA 2B9WA 4JI5J 4I68A 2B56A 4DTPA 1T3VA 3WNFA 3AODA 2GMHA 1VRTB 2DPIA 3JYTA 5HOOA 4HLBA 1KQSM 2QO3A 2A6OA 3CF5Q 3EXYA 4H4MB 3C6HA 1X0PA 2G0JA 3BKUA 3OYEA 5EX5A 3SI6A 2LDYA 3SLCA 1M1KT 1RAHB 4DQQA 3QATA 4WIQA 5ADXH 1RHJB 5AXNA 3AVGA 4BRPA 2DRAA 4JI8F 1N34K 4ECZA 2HHHJ 3CI5A 1WC3A 2RB7A 2Y1LB 4HACB 3R2DJ 1DQAA 2XHBA 1F5CA 3D0GE 5IT0A 3MMCA 4X62J 4CERA 5CYJA 4GMJB 3DXSX 4JYAF 3HVTB 3FR0A 1FKPA 2J6UA 1J5EF 3G9CA 1QSSA 4XPEA 3W5YA 3SK3A 3ET6B 1I94J 1X4BA 2UUWA 3QGGA 3RAXA 1PJ6A 4KSEB 1TFWA 2WBNA 3B6OA 3HSTB 4ELUA 1HR0J 2OSQA 3K58A 2FVRA 3BJYA 2ETJA 1I6JA 4LFAF 4RW4B 4E7KA 4RUAA 2VQFF 2QT7A 3ZTSA 1ZM3A 1S4FA 1VGYA 3DXBA 4OYAA 3I55N 4AXJA 4F4KA 1AUSL 2B4PA 2XMVA 3BQ2A 2W2MP 3ATUA 2IRUA 2AEFA 2AF6A 3AOCA 4OI6A 2LQ8A 2JLEA 3SUQA 1TL1A 4HT5A 1YIJS 1IBLK 3O4QA 3LWLA 1XQIA 5LMNF 4O55A 2V67A 3RGIA 5D15A 4FPAA 1ZBSA 1F3VA 2I38A 1JWWA 1RDDA 1BLUA 2RRBA 2AGPA 1R3NA 3GILA 4CFBA 3R5GA 2RIJA 3CC7S 1TAUA 1VHIA 4P52A 2BRKA 4HTLA 3QFHA 2OYQA 5GIPA 5FDLA 3O8MA 2EK6A 3CC2S 4FNIA 1Y5LB 4DFJA 3OVNA 2WBRA 4RG8A 4J37A 2O8FA 3A4TA 5DDOC 4KC5A 4B9NA 4IOXA 3SCXA 3OYAA 4BG9A 3LGNA 1CJTB 4NL5A 4KT0C 1WEXA 4CO0A 3CD6N 2RDDA 1K0TA 4UZCA 1HARA 4X4QA 4CLSA 3I31A 1SL0A 4CO2A 3NBPA 1GNKA 2HVEA 1DZ5A 1DBDA 1ZBTA 3S1TA 1NAQA 1EAYC 4AF1A 1XK8A 3VQ8A 4I9LA 1H0HB 4DR1K 1S9FA 5IZHA 4TYAA 4AL5A 1Q82O 5DDPC 4JAXA 3BQ1A 4GVLA 1U8WA 1RP5A 4ECYA 3FRZA 3T1YK 2L48A 1GQEA 5AZIB 3QPIA 2F9JA 4ZVPB 3DYAB 3D68A 4U7UK 4PAAA 1U1RA 1Q7YO 1JK9B 3AARA 2FQQB 2O8BB 3CC4N 3VWSA 3MWBA 2XY5A 4J7CA 2YKNA 2VFTA 3MXIA 4AQYJ 4ED7A 2G8HA 1URRA 3EGWB 2NXUA 3BSOA 4B1YB 2IAJB 4DV3J 2OELA 4O0IA 1FXRA 1YJ9S 2GVDA 4W5RA 3BPDA 4MTPA 2F4VJ 2GJFA 4YY3K 3DDNA 4LR9A 5BYSA 2V9KA 3R97A 4DLGA 1X0FA 3MMAA 3L7UA 1Q86T 2C3PA 1PYSB 3WQTA 1HBNB 3JSYA 3J80U 2KM8B 3OXFA 2NZTA 3BO3A 5E2QA 2WRMA 5F8MA 1PAUB 3H2VE 3R2CJ 2D3ZA 2LU2A 2X1BA 5RUBA 4LMZA 1RT6B 2KG0A 1KCFA 5KAKA 5CYQB 1RDBA 3SMZA 2V6AA 2EW9A 2BVZA 1RDAA 3DDIA 3MGJA 3D6FB 1UEUA 1HQEB 1S1TB 2LQJA 2HFNA 1YJ7A 3GSDA 2UVRA 1WN7A 4Y0WA 2D7SA 5IS2A 4FBTA 2I7NA 4DQPA 3D9BA 2QEXS 4O4GA 3BDPA 4K4SA 3TAEA 3DKDA 3DRXA 1U4BA 4JKEA 4DV4F 2OTJN 4DHVA 3S6EA 1UW4A 3NBPB 4NLRA 1VIOA 4OX7A 5A8RB 2Q2RA 2F9WA 3IN5A 2HBLA 3PJ9A 5EY4A 3KYLA 2GELA 2FIUA 4IWVA 5F0XA 1T94A 1UEKA 1A7GE 2RUSA 1RISA 2VFSA 1HKBA 4G65A 4WFAQ 2I0XA 3D3CJ 3SMSA 4X4VA 4OX8A 4BC4A 4ISEA 3MTJA 4HEA9 5KT7A 3VEYA 5F0UA 1Y11A 2W7PA 4BY9C 2X78A 2A0FB 2OPPA 1U6FA 1ZETA 2MKCA 2DFFA 4IFYB 4DV2K 3MM7B 3R5CA 1IWAA 2OH2A 2R2UA 3L8BA 3A12A 1U1MA 2EFVA 3GMGA 4L3QA 2YBVA 4M5NA 4ZCIA 2CJXB 2L08A 4FK2A 4FJMA 1OQ6A 3RB6A 4P2XA 3OV7A 4Y2AA 1IV0A 1KFDA 1BWEA 2G8FA 2E5LF 1ATNA 2JDJA 4E7JA 1FTRA 1HD1A 3QRQA 4CP5A 4OZNA 4QYZJ 3PNIA 4TNOA 1EETB 4KPYA 4B3OB 1C1AA 5JJBA 2HYIB 4A8XA 2OIHA 3SI8A 3F9KA 4H5NA 2HBZB 4E0DA 1YHQS 3LTOA 5D8HB 4TY8A 3J7YP 2PA8D 2Q1LA 4ECQA 3IFEA 5KQDA 5DG8A 4LF4K 1AUDA 4CJPA 3THYA 2QXLA 1C4AA 2JLFA 3O6QA 4FJXA 3O9RA 1FRMA 2KT3A 5GAHU 3PG9A 1XEZA 1NK7A 4HKQA 1X9JA 2HS3A 3DCAA 1O1WA 2M8DB 2JH3A 2DEJA 1NM1A 2GIFA 4CLUA 2DGUA 2OTLN 4BRAA 2KLAA 2HNZB 4AHCA 3SPYA 1C2PA 2BZ2A 4M5KA 3FVYA 4ZOSA 3I8DA 3PIPQ 1WORA 1TKTA 1R0AA 4HR2A 4M5MA 3GIIA 4BRLA 4QWEA 3DHXA 4Y65A 4CLTA 4CJEA 3O6WA 2QJ3A 1HWKA 4U67Q 2J0XA 3IC1A 2WTUA 1FX4A 1U25A 2XWXA 3R27A 3NH1A 3PVXA 4M45A 2XO7A 5BYRA 4CEZA 3KK1B 3NHGA 4ZPWR 5F8GA 5K8MA 4X65K 3LP2A 3HSCA 1UPMB 3MOJB 3A8EA 5E3AA 3TA2A 5IC6B 1K9MT 4RR5A 4RUHA 1G6BA 2VBWA 4CYUB 3CJAA 2BE2A 1CSJA 3E9LA 4WYBA 3QWPA 2VL1A 4ED5A 2YHXA 1N6QA 3PYGA 2IFXA 1WBBA 5ETRA 1LWCA 3HHKA 1G3OA 2FY8A 3HPHA 3I0SA 2BTFA 4QYRA 4J9PA 5C15A 1CBKA 2PE8A 4P2MA 1VQ7N 2Y8WA 4UY8T 1XMQJ 1S1WA 2IC3A 1FW6A 1Q5YA 3LP0B 3U3GA 3KOAA 1T6CA 2Y3YA 4QIVA 3BR9A 2FJXA 2CIMA 2P5OA 3VALA 3KK1A 1WD6A 2HGMA 5F2RA 4J9UE 2ASPA 1B3TA 3QO9B 2A40A 4MIWA 4ZVOB 1OVQA 2UUCF 4LVNP 3QMLA 4ED2A 1R43A 2XCAA 4BE0A 3H90A 4I6YA 2FC8A 4C2MA 5J2QA 4PG6A 1WTBA 2C42A 2YKAA 4DEZA 3T1HF 1NWKA 1LWXA 4GV9A 1RAFB 1KWMA 3THXA 3TA0A 2MZTA 1U1NA 3B54A 3I0RA 2R7RA 4NOHA 3ENAA 3CCEN 2OI2A 5AQXA 5LXRA 4IG0B 5KG1A 3O5BA 1VBZA 1QAIA 2VPWB 4K0KJ 3G6ES 4R25A 2JEIA 2CZ4A 1W7WA 2OFHX 3TW0A 2FZKB 2NRRA 4OKEA 1UVNA 3DLEB 3MXHP 5GINA 4DV2F 3UVJB 4ID5B 1NKBA 3OR2B 4ZVEA 1ATSA 3ZXWA 1X3NA 3K17A 3M1VA 3THXB 4ED8A 4PKDB 3VVTA 4GNIA 4NRUA 3DRYA 5HO4A 3V1QA 1U6ZA 3RVCA 3OYHA 3MDFA 3IBWA 3MWPA 2FVCA 4FJJA 4ILRA 4NXMJ 5KQ8A 3CPWM 4Q8EA 3X1LB 2YTCA 4PXCA 1WC1A 3TI0A 2VU5A 3UCZP 5A2QO 2RU3A 4B02A 5AQLA 1VS3A 1U2VB 2F4VK 4C8OA 4B3TJ 3ILOA 1JJ2M 2XZWA 4UW2A 5HRPA 2FSKA 4AQYK 2KG1A 3IAYA 1ELOA 2L9DA 3OHBA 2XTJP 5HLFA 3N4WA 2NXCA 2JEGA 5KFKA 2ASOA 8RUCA 1JLCA 2HBYB 3DOKB 4DHYA 3L0QA 3TOQA 3HKWA 4CLFA 1DFDA 4M3YA 2DNQA 3CPWR 5AJ3F 4F4ZA 4E7HA 2ROPA 3WEEB 1PYTA 1QTMA 1JIHA 1RDWX 1RTJB 4YHHK 4QZVB 3A8IA 2MQLA 3SQ1A 2JGUA 3QIDA 2NZCA 2MZSA 2R7QA 2QWNA 2HIQA 4KB0A 4I9QA 2F9TA 2ASLA 3LPEA 2DNMA 1LQ9A 4CLZA 1HNWJ 2BJ1A 4DR7K 2E5LJ 3SBGA 1MA9B 1IJEB 1TYQB 3AFGA 2LEBA 2J6SA 4O3SA 1VHFA 4BRDA 1NZ8A 4PKGA 4OLAA 2Y0BB 1XNRJ 1HI0P 4CEFA 1WELA 3DXKB 2JWNA 3MN7A 3P5JA 4PG5A 2EWSA 1QQMA 3IFRA 1BHLA 2COLA 4LF8K 1T95A 1HNIB 4RWXA 4F4AA 2CJKA 3O2IA 3HPGA 4PUOB 2E44A 1MWZA 4BG8A 3OLAA 3NAEA 1NCLA 3I5BA 1BWVA 3QMQA 2XI3A 3M4XA 2NUUG 4URQU 3HOTA 2ASJA 4BGAA 1NU0A 2AJ1A 3VAHA 2C3YA 3DGPA 4UUXA 2R9LA 3J7YU 4NCGB 1EKEA 2QM1A 5AXLA 1TK0A 3LUYA 2DNZA 1VI7A 3TVZA 3P83D 4OJRA 4I6MA 4J9OA 4CD1A 3KK3B 1RDUA 3PY8A 2C3MA 1RT1A 3OW2M 1AZSA 1WSHA 3I56S 3KFWX 3P4UB 4DV1J 4EFHA 4ISGA 5KFHA 1Q8KA 4OYZA 4BE2A 3TARA 4Z94A 1SVDA 1PJ5A 3SUPA 2HNYB 2GW8A 2HLUA 3VEVA 1IKYB 3MX5A 5LSRA 3PIOL 3JXOA 3RB4A 4CLYA 4OHXA 4DKWA 1YRUA 1Z05A 2WC9A 3VEWA 4B8AB 4K8ZA 4JHDB 3AA8A 3QDKA 3W9HA 1HYZA 2EKYA 5B0CA 2KYXA 5F8IA 1H38A 1YITN 3DYAA 4X62K 4XO0A 1FF2A 3V1OA 5HAOA 5I42B 4CNYA 4ZCMA 1Q81T 3BY5A 3HT3A 2VBZA 1RT3A 2DGXA 4CT9A 4W5QA 3CUNA 4BLGA 1NK5A 3W8GA 4CBUA 2JJ4D 2F96A 1N34J 5DM7L 5D0EA 1NBEB 3VZHA 3CD7A 3ZX2A 4BRFA 2QSFA 4UZBA 1S48A 4RWTA 4FWLA 2V8PA 1WHWA 3VQ7A 3ZZOA 3WXJA 2HBRB 3L7OA 4K5SA 2OGUA 2AYBA 3TJ8A 2KQ2A 3VGSA 3SAFA 2KTQA 1IR0A 4MKYA 3DMJB 3EZ5A 3F56A 3MR6A 4JI5K 1FE0A 3JSRA 1NDLA 4GMKA 3KWGA 4FK4A 2HNZA 2O8EB 3EN9A 5F0WA 4OYBA 1SS6A 5T41A 3D2FA 2YWKA 1WLJA 4USUA 3J80O 2QMWA 1OS5A 4UF4A 1SJQA 2B7BB 3DJCA 4BQLA 3QSIA 2Z56B 2AQ4A 5HBMB 2E7XA 2WBMA 4LF4F 1VQ9N 4M42A 1S1WB 2K3IA 4BS2A 5FJ4A 1Z1ZA 3CCUN 2W4CA 3G8QA 3RJMB 1RBSA 2HFOA 3KD5E 2BGGA 2ZKTA 3VAIA 3AVJA 2VB6A 2FF3B 1T05A 1KEKA 3E66A 3TZYA 2UUBJ 4FJ9A 1OH8A 2WVBA 5GAGU 2GO9A 2L9NA 4HUGA 4OO1J 3M8WA 2Q97A 2Z4PA 1YIJN 3QEVA 1VISA 4D3HA 1UWAA 4D3GA 2XMUA 2XLIA 5M1QA 2HNYA 4WZQA 1FO1A 1Y9OA 2G2ZA 1QAJA 1BD6A 2OZMA 4EMDA 2KHOA 1FESA 1VQSA 1WHXA 2EBEA 4LSNB 2V2ZA 3CF5L 1KQKA 4NCGA 5KT3A 4KHSA 4Z4CA 1C1CA 2ZE2A 2RHSB 4BCAA 1HBUA 4DZDA 2IAJA 3QNWB 3SPZA 1BQNB 4DMZA 4O23A 2CWXA 2WAQD 4OV6A 2CG4A 4ZP8A 5E5NA 4E3SA 1KN6A 3KLFA 3HFZB 5L39A 4Q43A 3O3GA 3ETMA 2NRWA 1PSDA 1IBMJ 2IA6A 3V81A 3M8PA 3PZPA 4CEQA 1N5YA 2LLZA 4JBCA 1DEJA 4XEIA 1FNMA 2E4LA 3D7EO 1C0UA 4MLEA 3UR0A 3ZFVA 1QDUB 4DOZA 3DN9A 3VZIA 4X84A 3CJCA 2KKHA 1P6TA 1SCJB 3BSNA 5ETLA 4MKAA 3J7Z5 3RBEA 2KRRA 1D9AA 2IJNA 3CT9A 2RH3A 4JI7K 3QINA 4KGKA 1IM6A 3CMAN 3MM6B 1N8RO 4NXNF 3MFHA 3VQ5A 4ED1A 2KFNA 3VF0B 1U1QA 3HHLD 4I0WA 5EN1A 1QQOA 3U9ZA 1UZHA 4LF8J 4KGMA 5HL7L 2DR6A 1BQNA 4OYOA 5C2GA 4ZHRB 4DV5F 2CQ1A 4JV5F 2RAQA 3H20A 4CK2A 3MMBA 4YDXA 2CPDA 4JKDA 2QWLA 3TEGA 4B9VA 2VKRA 3MUTP 3WX4A 2JWLA 3FGVA 4C3LA 2QV6A 3OTOF 3U1MA 3OY9A 2KJWA 4GW6A 2ZJRL 3LL3A 4IQXA 2CNLB 3FGUA 2DTUA 1U26A 4WYLA 5KFZA 2VODA 4CF8A 3NGZA 2AT1B 5BN8A 1N33F 4RNOA 1FE4A 3OR1A 4C1NK 2MSSA 4BACA 1A5XA 3KNGA 4P7VA 1MMDA 2ZBRA 4BDZA 1RA7A 4RW7B 4CJLA 4RZRA 3JS9A 2ZH1A 2ZBPA 4A2BA 1FVQA 2B5JB 2CKWA 3W66A 4RW4A 4BGBA 4DN0A 2R8KA 4R0JA 5IFMA 3HOSA 2VONA 3L4IA 3BYRA 2ZJPQ 1JLFB 4IRKA 3HL8A 3THPA 1NJXA 4ITSA 4F4XA 4YR0A 4ZK7M 3K2PA 3LDSA 1EJ7L 2JL9A 1B9DA 5L1IA 2PA3A 3C7NB 4OLBA 3FZBA 5HMXA 4BRGA 1HUXA 2ZUGA 2KXNB 4CFCA 3KHYA 2FBTA 2E1CA 4A8KA 5E41A 2HURA 1FHTA 3LZIA 4B1XB 3V9WA 4LH4A 1LWCB 3DLLQ 1RABB 1LOTB 1SV5A 5CZVA 1E4GT 4C98A 1GLBG 3OYJA 2WHOA 2MGZA 1W7AA 3VERA 1RDRA 4CGFA 2VUGA 5H1SV 4EZ9A 2CJYB 3TSUA 3R8YA 1HBUB 2OPRB 1O8BA 2CGJA 4WTOB 5ETVA 3BGOP 5K8PA 3OYBA 4P72A 2NUHA 2NCKL 2VQEJ 2LEAA 3MPWA 1F9FA 1RACB 2XULA 3E01A 2DHSA 1AFIA 3GP9A 1U02A 4Q0BB 4LR8A 4JI8J 1UETA 3WQPA 4E8UA 5FLXY 3I5CA 3HVRA 3DXMA 3H5UA 5D3GB 2GX8A 1ZM4A 1S1VB 2P9GA 2WB1D 4H0TB 2KN4A 3G82B 1X5TA 2VDIA 3ITHB 3GU0A 2B3TB 3GG4A 1M5OC 3R5AA 4ED0A 3HHLA 3W60A 4ICLB 2YI1A 1X31C 2DNYA 3MMJA 5A8WB 2JFDA 4YB5A 4LSZB 5AE1A 4LFAK 3MM9B 1TK8A 1HKAA 2LQ9A 5BRHA 5M1NA 1VSLA 2F65A 1TUGB 4MK9A 1K8AT 1NGJA 1VSMA 2H3GX 3O1BA 2G8WA 4DCJB 3T6BA 5ETMA 3OFHA 1C0MA 3IG1B 3C3LA 5D3GA 3IA0A 3QJJA 1A9NB 3RMDA 3F0NA 4CZIA 1VQYA 2HWTA 2E2QA 1DTQA 1YSJA 3VQCA 3UN3A 4L76A 3M2VB 2HZVA 4K4XA 2FHOB 3BKFA 1JJHA 3JB9k 1BIZA 1RBUA 5JICA 3UNGC 4DZ6A 1RBTA 3QETA 4DSFA 2OSRA 3LP1A 3LH2S 3QLHB 4C8LA 1SKUB 1VQNN 4C9DA 2QKKA 4FZVA 4JKHA 4CZKA 1A5WA 4FZZA 1KOHA 2OFGX 1IWGA 4BDPA 3NNAA 5LJWA 2YKMB 1HJRA 4ZVRB 1FI4A 5GAEI 4M5DB 3VTHA 2FSJA 4AUKA 3AQOA 1JLCB 2KHDA 4AL7A 4DR6J 1N36K 3AV9A 4LF6J 1S99A 4O8KA 3OYLA 1K47A 4BRCA 4JK9A 3HZGA 4FNHA 4IEIA 1QTNB 1T9YA 2HFUA 2I9SA 4X4UA 2JOQA 4ZPAA 3MM5B 2ZJRQ 1HR0K 4U6PA 1Y0HA 3W5ZA 4X4RA 3KDOA 1ZTTA 2B4JA 1P90A 1YAGA 3G96A 4JK8A 1TAQA 3BGRB 3V4MA 2LQBA 4JKBA 1M5SA 1FXXA 1IR2A 4IO9Q 1NDCA 2DH9A 4RPFA 3S3OA 1BOTO 1ZYQA 1U1KA 2MJNA 4BWJA 4ETZA 2WVEA 2CQBA 4DLEA 1N56A 2WSFC 2W4PA 3MCNA 3VR1A 4F7VA 4AD6A 1FRLA 4O44A 3ETOA 3K57A 1GH8A 2DR9A 2QC3A 1CS4B 5KG5A 3R5BA 4ED4A 3SSSA 3VVUA 1LV5A 2HBKA 5KFBA 4DWIA 1SL2A 3AVMA 3H46O 1DARA 4OHWA 2M8HA 3L6QA 1D0EA 1HFEL 2XSFA 4DUTA 4XDDA 1FX2A 3SQOP 3GFZA 1ATRA 1RAJA 2JVRA 4JS5A 1N33J 1BHNA 1M1HA 1W2BM 5DLGA 3QEWA 2EBGA 1AB8A 2RKIA 3O80A 2LXFA 4B08A 4HCBA 3NEKA 4CQ1A 3VGMA 2SXLA 2D0BA 5L1KA 2H65B 1I3OB 5L8RC 4B1VA 3THYB 2ZBQA 4AM6A 1JXEA 4WKYA 2ASMA 2DHAA 1C1BB 2R7VA 4B1WB 1C0UB 2FUG9 4F4WA 2Z30B 4DL0C 3VCDA 4JHDA 4OPKA 2Q0RA 2KL8A 5KPTA 1NM2A 4CECA 2UU9F 2XQCA 1N32K 3TYTA 2XY8A 4CO4A 3DDKA 3GCXP 4CZLA 4QR2A 5JVGQ 1LW0B 1U45A 2V63A 1XMOF 5BN9A 1RSCA 1XBWA 2L9WA 3RW7A 4B3RF 2VG7A 2BOPA 1TKZA 4CD3A 2C3OA 3SCIE 5IT9U 3DOMA 3PR5B 3JSMA 4A8SA 4K4VA 4DCPB 1C1CB 4I7FB 3UPFA 1U0SA 5AQNA 4BRIA 5EX3A 4ANEA 3DHWC 2VJVA 4EHTA 2VQEF 3NL0A 1B0TA 3FZ2A 4H0YB 1Q53A 5AQIA 3KDNA 1J9AA 2OCEA 1RYRA 4A8WA 4DR4J 3LDLA 4FWKA 4CZMA 4H8KA 3IBCB 2AYGA 3LO3A 2QA4N 4ECRA 3NNHA 3M30B 2DNPA 1S9EB 1OH7A 2HMIA 3TQ1A 2K7JA 2FB0A 1SQGA 1YJTA 2HHXA 3VGVA 1RE1B 4ZLNA 2DH8A 1FJGK 2D3O1 2QLWA 2FY1A 1WNSA 3VF6A 4UOFA 3UDVA 1QVGM 4CIOA 1DY3A 3C95A 2B9EA 4E89A 4CEOA 1T8EA 1S77D 1HNXJ 2R4FA 5D0HA 4N76A 5SUHA 5KPZA 3AJ1A 5U47A 3Q8YA 4NLWA 2F40A 2AJ4A 5L1LA 5F9NA 2NYIA 1WHVA 1NHKL 1CS4A 2YKNB 2W01A 3D2EA 2FVQA 4PEOA 4IFYA 4ZIVA 3CJKA 1QAXA 2AP6A 4EYHB 5HVHA 3P49B 1DLOA 1FKOB 1UVLA 4FLZA 3AXMA 4JKAA 4Y2IA 1XNRK 1N5TA 1LWEA 3SUNA 3N9UC 2P5GA 2J8SA 4I64A 3UNYA 3GV5B 3ZSXA 4F9OA 1NB2A 2CVIA 3T3FA 3JYTB 2P9LB 1C4CA 2HW3A 3AOAA 2PEHA 4LC9B 3IS9B 3SV3A 1GOBA 1U1LA 2HVZA 2IIRA 1NO8A 5IV4A 1BGXT 4XH1A 2CZ9A 1TUWA 1GTEA 1OSDA 2EI5A 1RHKB 4LFBK 5AFUH 1SKSA 1IG8A 1J53A 1YJRA 1S1XB 4OX6A 1JNZB 4M3WA 1CJUB 2D74B 4IXCA 2PI5A 2RILA 1F3FA 1QZ6A 1KBRA 4LIRA 1L3SA 3SYZA 3UWTA 3AJDA 3TSQA 3ULEA 2ERRA 1IBKJ 4TVAB 2C2OB 4QS8A 3FQLA 3OQ2A 2RRAA 4B3TK 1RAIB 3S3MA 1FDBA 4E1NA 3HVTA 4JI4K 1VQMN 5ETNA 3ZNUA 4EHUA 3T9ZA 4CIEA 1TTHB 2MQPA 5J2NA 3DOLB 5CABA 5DZ6A 4ZJLA 4NLDA 5HN0A 4EUVA 1VFJA 3BGUA 2YH1A 4RL1A 4DX8H 3KLHA 1EARA 3JQMA 3DRRA 4QAGA 3O3FA 4KHPK 2ILYA 3T6JA 4J2AA 3K5MA 3MMCB 1REVA 3OFEA 2N3OA 5DGBA 1TKXB 3MEEA 2J5AA 2XLKA 3CWJA 3V1RA 2C2MB 4YB1P 4P7TA 1YJUA 5KI6A 5KG3A 1QE1A 1YLXA 3RRKA 5AQWA 3NGYA 2DHXA 2XZTB 4F3TA 1RTJA 1SB6A 2GHVC 4M63A 4WP9A 1PGZA 5GMKa 3FCVA 3J80Y 2CNOB 1D5AA 2IBKA 3IKMA 4C7QA 2LCWA 3L2UA 4FLTA 2V2VA 4O4RA 4ERDA 1HNVA 2DXEA 2W25A 2R7OA 4J9QA 5BRDA 2I1RA 2CQCA 1DKGD 3G82A 3OYCA 4WBFA 2QWQA 4J9KA 4YB6A 2IYGA 4DR5F 4KI4A 1K73T 4OYWA 4YN3B 1S10A 3MEGA 1WC4A 4J2EA 3DLJA 1VK3A 5A2QU 1NNDA 1RHRB 4KBIA 1LKZA 1WF0A 3D3BJ 4KTZA 1GT8A 4HUFA 2FPHX 3SDEA 1NH7A 5KOWA 2MY8A 2RF2B 1HPZB 2FLOA 2O01C 1S1XA 4HHUA 4JKFA 1Z2ZA 4NLOA 2Z2ZA 3PIOQ 3NCPA 2OMOA 1YT3A 2EFQA 4DL5A 4FM2A 2DNGA 1UVMA 3QGHA 3R1LA 4U7BA 4I56A 1HHTP 1FWPA 3SNNA 4CLKA 2YWHA 2UU9J 1RWWB 1NJWA 1OSCA 4FF3A 3WX8A 5KT5A 4IKFA 4B17A 2UUAK 4F4YA 1RK8A 3NWGA 4OX9J 1AFJA 5BPMA 2ZFHA 2G8KA 1KD1O 1DT9A 3QEPA 3NCIA 4X65J 4YY3F 3MPDA 2RQKA 3MAHA 4OQJA 1GLAG 3TAQA 2VCPA 1X8DA 1IBCB 4Z37A 1F5AA 4B9MA 1NMNA 2RU9A 3AB4B 4LF9F 4L8RB 2D4WA 4I6AA 2UUAF 3HP9A 3ULEB 4WQ5C 1BI4B 3OJUA 3AVFA 2DVIA 5AQSA 4DR4F 5BR8J 4M5IA 4PPDA 1OH6A 3KIOA 1LFWA 2VF3A 5DG9A 4J5OA 3AO4A 4ILLA 3I56N 4DTMA 2ZDPA 2YVSA 4JB8B 1TVRB 4KAZA 4HVZA 3ZSYA 5L38A 3QRPA 2EXUA 5SZTA 2ADBA 3MMAB 3G86A 1OYDA 4R79A 5LJ5Y 2BE7D 3O4NA 2O8CA 3CCSN 2ZH4A 1EX8A 1V6HA 1YWXA 4LRDA 1QVFM 3HO1A 5AQZA 4J9LA 2XMTA 2DPJA 5J2QB 1QY7A 3WXMB 3AQPA 1S57A 3F2KA 1L3UA 2EG1A 2QMXA 4YOVA 2CDRB 2M52A 4KTQA 4KH1B 4UT4A 3AGRA 4FWQA 2QLFB 2Q31A 2DXFA 2W41A 4NLGA 3VAJA 3C6TA 4WPAA 3RMAA 1C0GA 1NGEA 1UJ6A 4CGDA 4C23A 2CPEA 2IC3B 1VC5A 2QYCA 1XC9A 1VLOA 4NLVA 3NCRA 3U1NA 3MEDB 1UJ5A 2VJUA 4IH7A 2P1JA 3NMUA 2CPJA 3AD8C 4H4MA 1MMLA 4YHHF 3R9PA 2XYHB 3C15A 3PRDA 4DV2J 3U3YA 2CXEA 4PWDA 4ID5A 1LOUA 4N8NA 3OFGA 3N28A 1P9YA 2HFVA 3GV8B 4USWA 3QIPA 1WTFA 1S0OA 5AFUA 3WZ0A 2CJAA 1QUPA 4CCHA 3HFKA 1YZ6A 2H4YB 3KLGA 1YTAA 3VTIA 2IVYA 3G25A 1OYEA 5A0YB 4P73A 4M8LA 1RBOB 4NXMF 3G6EN 1BI4A 4FJIA 5CA5A 2ZHAA 1Q86O 3J7ZO 2LXIA 3CCMS 5H9FK 4F25A 2WVCA 4TLQA 5HK4A 3NGRA 1ITGA 2CRLA 3CJ5A 1D1UA 1R8AA 2AEMA 3PV8A 1JJ2R 3E9OA 2RHKA 1T0TV 1R6YA 4H4KC 3CCVN 1BO5O 2H5EA 2NZ4A 4O44B 5KRTA 7FDRA 3HYFA 4GVBA 1EWQA 3UN5A 2RDIA 1O13A 3RWUA 1DJ0A 1GXTA 3F44A 4JEPA 1LEOA 1WSIA 1S79A 1VIXA 3CTRA 2HHVA 4KV8B 4USKA 4PQUA 2BJ8A 4IH5A 5IXUA 2P2CB 1HBOB 4DV6F 2O8CB 3T1YF 1H6KX 4RTFD 2MB0B 2VICA 4QOZB 5EX0A 1Q9YA 2C2NA 3R5JB 3HULA 3PEHA 3N79A 2GAHC 2ZM6J 5E7OB 2BKPA 3CQYA 1V5IB 3LF0A 3CNQP 5ETOA 1RYSA 2HQ3A 2QI2A 1UWBA 2HFSA 3MCSA 1NSAA 4HTIA 3H2UB 2V34A 3F41A 5KFQA 1VQ4S 2HK2A 3CDEA 5DM6Q 2B0GA 3T41A 2I5JA 4OYXA 2QYGA 4GV3A 1H1VA 3CETA 3BF3A 4CZJA 5KFPA 5AQVA 1ITPA 2RN2A 4QPXA 3HP6A 3TJAA 1HJOA 5F1XA 3CFPA 5I3PA 2CNNB 5CCMA 3NS5A 4KHPF 1V9OA 2YKMA 3AY9A 4OI1A 3KKRA 5M2RA 5CHCB 4DR3K 1KLMA 4AHRA 2GZOA 1FA0A 5BXIA 4RO0A 5C24A 2DGTA 3MM5A 2R2RA 1WJ9A 3BPSP 1RWOB 5EWEA 4WCEL 2HOEA 3BKTA 4ZPVR 1R8CA 1KFSA 1MN9A 3EEQA 2A1SA 1YJWS 3MPUB 1VSEA 3D7SB 4F04B 3NXZA 2HQGA 2CQGA 1JL2A 4DQIA 2ZH3A 5GIOA 4PXDA 2Q3PA 4DR1J 1B70B 2AV5A 1AZSB 3FBCA 3LP2B 2B6AA 5BR9A 3U9DA 3ULDA 4H4OA 2OKQA 2GJ2A 4B9TA 1F60B 3OSNA 3R6GB 4HCCA 1SJRA 2GVZA 3JSBA 2BE9B 2F1FA 4L75A 3SSQA 1OY9A 4QIWD 4EBEA 4YOYA 1MU2A 3H25A 1NGFA 4LFCF 1OY6A 1FK9B 1Z2LA 3GQCA 2U1AA 3O8WA 2KHCA 2CPIA 2IM2A 1ZXOA 5CCLA 4CI6A 1BY9A 3EO3A 4IEEA 1HWLA 5ETTA 3A0IX 1RGIA 4DR5J 1T6DA 2GJIA 3DFEA 3VETA 4XH4A 1XNRF 2RQMA 3LALA 1RWMB 2Z1GA 4BHQA 4GVMA 1FT8A 1RADB 3QYYA 4U96A 3V9UA 2CZVC 2OMLA 4A5AA 2BKNA 4IOAQ 1IJFB 3KTQA 1HQEA 4CHYA 4TY9A 2AJ0A 1CLFA 2O8DA 4DJBA 1AT1B 4R0EA 3TTDA 1O51A 3IM8A 4AM7A 1KC8T 4Y34A 5C10A 3OHAA 2HZAA 4UOCA 4CZHA 4DV0K 1SJ1A 1K73O 4K8RA 3CCQN 5AZJA 5EDWA 4KRWA 4KAIA 1FCAA 3HZEA 2DJWA 4CBWA 1EETA 4CEAA 3D2WA 1TL7B 2F8MA 3B8AX 1DAXA 2V2QA 2WOMB 1XQSC 1BCOA 2DY9A 2YCHA 2RVJA 1UVJA 4P9SA 1PO6A 2DHHA 3NE6A 2HHQA 3NAHA 5KFAA 4DPUA 2M5YA 3PSFA 1WSEA 5IC4B 4Q44A 1HIYA 4RUCA 5KG7A 3FSXA 3O08A 3D1HA 2DR7A 2BUNA 3QBCA 3NGKA 3L7PA 4O4GB 2UVUA 2P9PB 4RX6A 2P9KB 4CJ5A 4IOCQ 2DXDA 2CPFA 3HI0A 3U4LA 4RCHA 4USHA 4LF5K 4FLUA 5HQMA 3RAQA 2GX9A 1VC6A 1QZ5A 2FXUA 4JRPA 1RQ0A 1RJJA 4E7IA 3PXGa 4LF9K 2CA9A 1I94F 3G4SN 3WIUA 1NH8A 3OS0A 4NMXA 1TP7A 1BQXA 2UUTA 3Q86A 3BH6B 4B9LA 2E9RX 2OA8A 3RSEA 4FVCA 3LZJA 2BW2A 3T1HK 3LPTA 3HFVA 5C2DA 1D9FA 1MSWD 2BV3A 2O67A 2N7CA 2QZ8A 2OPSB 4OHYA 2PMWA 3VEXA 4LRFA 1KVAA 1C0TB 3DM2B 4C11A 1RU1A 1Q8LA 3UDCA 4DXLA 1VCTA 4G1PA 1EWRA 2ASDA 5GMDA 4IR1A 3PRVA 3ZZPA 4U8YA 1HI1A 2J0SD 3G8SA 2PEBA 2EC2A 2R8IA 5HVGA 3OR1B 4FM0A 2OUGA 1HQUB 5GAHP 5D78A 3D2EB 3CCJN 1G15A 5AQPA 3T7ZA 3KXDA 3D6MB 3THWA 2B7CB 2NYHA 1RT5B 3RYLA 4GKKF 3UDEA 5KFGA 1VAZA 3ATVA 1HLUA 3CJ9A 4Y0FA 3BGLA 2FBYA 4O8UA 4YR2A 4R8UA 1D09B 1TU0B 2AGOA 3KJFB 3JTNA 4C8MA 2HHPA 2HLTA 3HSJA 1IKXB 4ZHRA 2XMJA 1OQ3A 4M3TA 3KLFB 3OTDA 1XR7A 2QA1A 2LU1A 3MURP 5JUMA 1Q5VA 5LY3A 3U8XA 2QA4G 2OLWA 2JX2A 4M5HA 3CJSA 4RU9A 2UP1A 2HF3A 4DL7A 4KHPJ 2ATCB 3TAFA 1KQGB 5FPDA 4G1QB 2Z1JA 3CCUS 3SIPB 1HW9A 1N88A 3ZTQA 3FBBA 4LBHA 1R59O 3MZIA 1N5VA 3CMAS 2ACYA 4AE5A 1GLDG 2XGQA 3PJXA 4LR7A 4JI4J 1CZBA 4LQ3A 4BC7A 1FJ7A 3J7ZT 2VG6A 3V2UC 4MLHA 4UOGA 3G6YA 5AT1B 4DFPA 5CYQA 4C8YA 4CESA 3C6TB 4DTUA 2B5JA 1RWUA 4DR2J 6FD1A 4P10A 1SZ2A 1ZTWA 2L3MA 3L4BC 4JLHA 3H42A 4FYYB 1X4DA 3I5AA 1GFWB 4M94A 1HBOA 3IO1A 5IWAJ 1S9GB 4JOUA 4DV6J 2QXFA 3O1WA 2ZBIA 1FFGB 4M3UA 3CHWA 2W2QP 3C7NA 4C8KA 2JNJA 4LF6F 4QU6A 5KFJA 4RW9B 1NSKL 4JI2F 3IUCA 4N56A 2Q3SA 2HEKA 4DR7J 5HRNA 3BYPA 4QWDA 4RBUA 1KQFB 1CQMA 4JI3K 1PJ7A 1MW7A 4RW7A 2BDPA 4CK3A 1KVIA 2EWHA 4YEAA 2DPNA 3VN5A 2FJAB 2AX1A 4ID8A 1YZ7A 2H1YA 3ID6A 2PDAA 3QFPA 1H73A 1YX2A 3T19A 1QQCA 2BX6A 1T03A 4IJNA 2DO0A 3AHPA 3C19A 3RB0A 2NQPA 2FHMA 2KVIA 3MAQA 1YJNS 3C14A 3N0VA 3UW1A 3HCXA 1K1QA 3AAQA 3FLCO 2X74A 1TR0A 3KG4A 5K8NA 3FSIA 1WSRA 2R42A 2HMIB 1RTDB 1Y3KA 3NF6A 1FJGJ 3OTBA 3EE3A 3OYKA 4J8FA 4P75A 1FRJA 4B3SJ 2DK2A 4K50A 2HMPA 3EMTA 5AQQA 4Z2XA 3VA0A 2ZOGA 4R8UB 3MEDA 4Z7YA 4JI6J 2HSTA 2CQ0A 4PY5A 4Z0UA 1JJCB 2YHBA 2YKOA 4JYAK 1FRHA 4KH0B 2BQRA 2IMOA 2QWOA 4FN5A 1JXBA 3ZX3A 1XHXA 2XS2A 1CJKA 1U6BA 1WC0A 2Q6CA 4ES3A 4DV7F 4CO3A 3D6TB 3FEXB 2EK1A 8AT1B 2E66A 4DS5A 1VQKN 4K59A 4TN2A 3OHRA 3EKUA 4UTGA 3FMWA 4PYAA 9ATCB 3M6WA 2LYVA 4A8QA 2AU0A 3O3LA 3M8QB 1B7FA 1O6XA 4DQSA 3MECB 1VRUB 3W5XA 4HTUA 4ES2A 3GFHA 2KM8C 4DX7A 2HHUA 3PEJA 1JLQA 1JNRB 4WE1B 1S9GA 3ITHA 1TL7A 3Q8VA 3GJSB 5HMZA 3UQSA 4BRNA 5IQQA 4CTAA 4NRTA 3HBTA 1N36F 4M63C 2HNDA 4MFBA 2D3UA 1RWVB 2QLBB 5AQOA 1KHVA 2XS5A 4C0BA 1QAYA 2HB5A 4NLSA 1IVZA 3AAWB 1TYQA 3UD4P 1XNQJ 3RRGA 1LK7A 2N4DA 4AHTA 5IM0B 5B0EA 4OZJA 4YOEA 1PAEX 2ZH6A 3CIZA 3FBEA 4B1UB 4FYWB 4OJ3A 4DR6F 3D0IE 3AJ2A 1K6YA 1P8ZA 1WNEA 2C2EA 5I4MA 5C0YA 2QL5B 2YX4A 5FLXU 2GVZB 4ED3A 3ZTRA 4FF4A 4IO8A 1CVJA 2CJ9A 1YVFA 2G13A 4CJQA 4B9QA 4NLUA 4QJVA 2NRVA 2J7KA 3DLBA 1N33K 3UI3A 3BO2A 1XC3A 1HPMA 3OT9A 1E4FT 4FLXA 3M8SA 5B0BA 4QW9A 1WAFA 3WNHA 4DSIA 5KFSA 4FO0A 2IDOA 3ISNC 3JTPA 4DPYA 2RHQB 2K1RA 2W9CB 3A3NB 4F67A 2BBEA 3LOUA 2IDLA 2FJVA 4EAHD 4CZFA 4FSVA 4JI6K 1C0TA 3DM2A 4C11B 3A3OB 1X4EA 1KONA 2HBMA 5KG4A 2Z2LA 2W9AA 3EGNA 1S22A 2BABA 2O8EA 1WDTA 2RD5C 4ISFA 2A3ZA 2AYEA 2CYYA 2LP4A 2X1AA 3CIPA 2MDAA 4HTJA 2MMYA 4WXWA 3P5BP 2VHGA 1KAZA 1KC8O 5AQGA 4AFFA 3DRPA 3TUJC 3AOBA 1PC4A 5G0RB 2GEMA 3U02A 5G4DA 3G8TA 3KVGA 1DURA 2HGNA 2MZ1A 4KB7A 2HVIA 2H48B 1FFSB 4OPJA 4IH6A 4FJ8A 3CB4A 1RTIB 3QIOA 3ZZYA 2V2KA 3CFOA 4DUYK 5TKWA 1Y10A 5LM7E 3D4JA 3A3PB 1XN9A 3M32B 2ZOMA 2P8IA 4ZTJA 4JV2A 3Q23A 1HHQA 4YUDA 3LPUA 1HWUA 1GLLO 1GMUA 5IV3A 1HHSA 2V4RA 1DRZA 4ZP7A 4PQUB 2OANA 4K4TA 3QWUA 4XH5A 3OS2A 4PABA 5AQTA 3VGKA 1XR6A 1EX4A 3CCRS 3BF1A 3X3UA 3I96A 4OLPA 3BN7A 5F8NA 4NI2A 2ZWPA 2KFZA 2M7SA 1Z25A 4FK0A 3GJRB 1BG3A 2WK4A 4L74A 5IT4A 1YGYA 2BXJA 3RRHA 2J8AA 3AGKA 1H2UX 4U67L 4NCAA 4KFBB 5CQGA 3ET6A 2NPFA 1JJ4A 5H1SQ 3M8PB 1TKZB 4TYBA 4DL4A 1EQMA 2AZ1A 1EIYB 3AA4A 4ZS6A 2EPIA 3LDNA 1I5OB 4TXSA 4ZVTB 4EU0A 4I7FA 2IS3A 3VQ9A 4NYOA 2N7YA 2GV1A 2V4JA 1F5BA 3A2FA 2Z0GA 4RNMA 4IQMA 5T7LB 2IHR1 3NY0A 3SSRA 2PC6A 4OV1A 4C0OC 2G8UA 2NXEA 4LQ9A 2V68A 2UV8G 1NLVA 2FC9A 3KUEA 3TNVA 2XSJA 4TU7A 3ZSOA 1Y00A 2PD1A 5JVHL 3TTCA 2VPZB 1S1UB 4I1TA 1SC6A 2MQOA 1UA1A 1JQGA 3QLHA 1NNEA 1JX4A 2BJDA 3G71S 3AT1B 4OZLA 3NGSA 2P9UB 1P1LA 2B4VA 1K8KA 4JI6F 2MKYA 4O5BA 1FERA 1M5VC 3RR8A 2Q6BA 2E8AA 2FBVA 1NXIA 5IT9Y 5HQLA 2YHYA 4NB4A 4CHQA 3O1LA 1XIQA 3PDNA 3ZZRA 2D9OA 1ZAXA 1SJFA 4QPTA 4UQTA 1HNWF 2IVPA 7AT1B 1Q0NA 5GAEP 3UE2A 7FD1A 1IKWB 1LWFB 5FPNA 5EHHA 2AKWB 1FJEB 5ETKA 3M5RA 4Z4HA 3QEIA 3RSEB 3VESA 4BC9A 3LP0A 4WCEQ 4ER8A 4CGHA 1ZA1B 4GKJK 5DM7Q 5D0GA 3IS9A 2DT9A 2V0NA 2FVPA 5AZIA 3NOGA 3FCWA 1NSPA 1VQ8S 3LGHA 3LWMA 1RHMB 1XMBA 5E26A 2E29A 2KH9A 4DUYF 2WB4A 3KLIB 3OYIA 4QOTA 2QW9A 4CM2A 2MKJA 1GMWD 2HHHF 2RE2A 3Q83A 1RHUB 1XERA 3GIJA 3CJKB 3I82A 4DV3K 1X4GA 5I3QA 2X6NA 2X1GA 3LGMA 5EXWA 4YDUA 4Q45A 2VG5B 1WI8A 3CJBA 4FPBA 4LF9J 4IKAA 3CQ8A 3UKRB 3AO1A 3Q8QB 4O3QA 2HQFA 4IG0A 4MK7A 3IMQJ 2BJEA 5T7BA 1S6UA 4DX5A 4DSLA 1FD2A 1NGDA 5CZ2A 3CD6S 4YDDB 4LF5J 4A59A 2OPRA 1S72N 3VGLA 3FKBA 2UXCJ 2ADCA 1H7XA 2RT3A 4F3MA 3CC7N 1WC5A 3CFRA 3MXJA 4U8VA 3CM6A 4BR5A 1B0PA 2FSNA 3GBTA 3UKUA 2HBQB 2AP1A 2E1RA 4FPIA 1T9VA 2ALZA 1KVBA 2IM1A 2VQFJ 2WTFA 1DQ9A 4B3MJ 4Y00A 4NLPA 4PR6A 3OS1A 5LSLA 2VASA 2POKA 3OVSA 3UKRA 1VQ5N 4N77A 1HI8A 3DLGA 3UE5A 4Z7CA 4FOIA 1YDLA 4X64F 3LP3A 1MNEA 1SI9A 4KKOB 2KB2A 3EDQB 2GFFA 1WOOA 3CDAA 1MG7A 4C97A 4J91A 1NLKL 5CZXA 3TVKA 1VQ6N 2IGIA 1VQPN 5M2UA 2ZUAA 3RAMA 3NWRA 2P5VA 3V6DB 4NLYA 2GWJA 2ZHBA 4ZMMA 2BA9A 1N32F 1IKWA 1LWFA 1XNQF 4OYPA 1LW0A 2ZVSA 1K8KB 1UFKA 4KHUA 1YG0A 2V50A 3DRRB 1F2HA 2UUCK 4QCLA 3H40A 1RHQB 4X66J 4DSKA 1N5SA 2BQ3A 1IBMK 3P31A 1SIZA 5KFRA 3C16B 2QTWA 3CO9A 2QE5A 3QRRA 3PYFA 3UCUP 2W6LA 4DR5K 2PMHA 2VZ9A 3IR5B 4MIBA 3L3UA 3E1YA 3L3CA 2GMLA 1G99A 1B99A 2LA6A 2YKPA 1VQ4N 1MLAA 3OTEA 2GUIA 5LOQA 1YJWN 4RUBA 2ZD1A 2V7YA 2J9EA 1SV5B 1TMMA 2ZOFA 3SAGA 3SBTA 3IXQA 4L3KA 3KHHA 3M8YA 1RT5A 3DNCA 2OTJS 2MQMA 4HHTA 2E7WA 1FXDA 2HPUA 1IXKA 4N8OA 3PW5A 1GLCG 4H4OB 4I4BA 4XK8C 3V4IA 3AY0A 4F3QA 1M1GA 5LXYA 3KUHA 4ZKAA 3OL9A 5BPNA 1FK9A 1MN7A 2KT5A 2ZWOA 3K89A 3TA1A 3MPYA 1Q7YT 4NLQA 3UCGA 3ZETA 3M6VA 3ENOA 2QK9A 4HACA 4AHVA 1T9WA 2AGQA 1YITS 4WIIA 3MD1A 2C2DA 4KE5A 3K8WA 4FBUA 1ZBUA 1IN0A 4H0XB 3KNAA 5HVFA 1RAOA 2IIHA 4FVMA 4DU1A 2X51A 2P9LA 1FD8A 3OUYB 3HD2A 4GV6A 4PG7A 1HR0F 1GMVA 2F9DA 2JEJA 4Q7AA 3Q2TC 1FDAA 4ZPBA 2OD6A 1TL4A 2FVSA 5F3ZA 4L6V3 2M70A 2P6SA 1R0AB 2UYTA 1SL1A 2E5JA 3O4WA 1DLOB 1FKOA 1WOSA 5C7PA 4LFBF 1YVNA 2JSXA 4G9ZA 4FLVA 3ZZUA 1U1OA 2B9YA 4K25A 5EGYA 2OD4A 2RMLA 4F0MA 1RBAA 2PT0A 3QERA 1APSA 2GUPA 2ZM6K 3VQPA 2G1DA 3HLUA 2D3OR 3H4BA 3L2RA 2MQNA 1LW2B 3B4MA 4LBIA 2UXBJ 3VAKA 3POTB 2VV5A 2J7WA 4NXNJ 2WOMA 3I33A 3M6XA 4C1NI 3J81Y 4KPCA 1YJVA 3LA0A 3JAMY 3PHTA 4WZMA 2BJ7A 3C8YA 2A1RA 4FLYA 5F8LA 2VPXB 2V52B 2MJUA 3GDQA 3T69A 4X65F 1B64A 3TP2A 3I0SB 4X4OA 2P9SB 4YQWA 1T02A 1TFYA 1PC5A 2X7IA 5BJRA 5DM6L 1Q78A 4C4WA 4BRKA 2OTLS 5E3PA 2RPIA 2CNKB 1M5PC 3H98A 2Q1NA 4U7UD 5JMVA 1RUSA 3MOZA 4DV1K 3ULHA 3QIPB 1QE1B 3R5DA 3M2RA 3SAHA 2GBZA 5CYMB 2BE2B 1YTUA 4RLEA 2IVFB 1LNQA 2EFPA 3GG0A 4YFUA 1J6ZA 3PSIA 3ICLA 1VQON 1FKAF 1PILA 1DTTB 4MDAA 1KVJA 3FZHA 1RAAB 2JHEA 1SH3A 3IGNA 3D6HB 4X4NA 2B43A 1LXNA 2VOOA 4OGCA 4CHNA 4B9SA 2UXCF 2BQUA 4B3RK 2BMBA 2UXDK 1VMBA 2HAFA 3Q89A 1ZM9A 2P9EA 2O8BA 4KHMA 1WUAA 4HVJA 4DV4J 1NPPA 4IG3A 5LMNJ 2ZDOA 3OW2R 2RF2A 5JS1A 3WBZA 3GYGA 3SDEB 3NFAA 2HHWA 4EP5A 4M5JA 3E3XA 3SXLA 2WW8A 3Q8UA 1XJWB 4Q0BA 4IRCA 2NSCA 1NJIO 3BV8A 1Q95G 4M3XA 3OXLA 3DXMB 3CCSS 4XPCA 4X64J 2E5LK 1JCFA 3PYEA 4CFDA 2PAVA 4MFBB 4MKBA 1Q8BA 3ZSZA 5KG6A 4YS2A 2ZE2B 3UR3C 3NCQA 4AH9A 1KLNA 2QRRA 2F7TA 1CLQA 4YHHJ 3IGVA 1S59A 4DUYJ 3NGUA 3EL2A 3GIMA 2DD8S 3W2VA 3TZZA 4LD0A 3L2WA 4CJTA 4XIUA 2XMMA 1NUEA 5AQKA 3QEXA 4Y2CA 4CGIA 2VPYB 1EKSA 4Y3CA 2ITMA 3VQ6A 3Q7BA 2G2OA 4IDKB 5HRSA 1JXLA 2AW0A 1N54B 4FS2A 1EP4A 3C66A 3ILLA 3DWLA 5K14A 4WFBL 5HQ8A 1JLBA 3OFFA 5B0FA 3KWIA 5BR8K 5AJ3K 2V8GA 2VKZG 3GIKA 3KK7A 3ZTPA 4HI2A 2L41A 3HSDA 5ETQA 2G9OA 4CJFA 1S6OA 2EG2A 2ZBCA 4NI2B 1GMWA 3SBMA 2HQCA 3H1QA 2Z2MA 5AQJA 2RRNA 3D2FB 3HHNB 4NXMK 4LRBA 3VA3A 3H4DA 4EZ6A 2O4GA 3N01A 3MTKA 1CZAN 2DKOB 4BRHA 1UCNA 4B8CA 3MN9A 4DTJA 2DCUB 2P9IB 3BGFA 4OMFG 3BO4A 4IZ9A 1HBMB 3OPKA 4LY7A 4GY2B 5E33A 3K5PA 4O3NA 2LDIA 2IM3A 3TANA 2AJ2A 3T5KA 3HK2A 4E2FB 4CE9A 4LF7K 2IYIA 1SPBP 1GX5A 2CPZA 4DTNA 4KQZA 2VDHA 1TL1B 3MCPA 2GAGC 1WC6A 4H5WA 3MM8B 1YJ9N 2FHJA 1FJCA 4GRSA 4FWRA 3RW6A 4DV5K 3SCJE