2YNIA

Hiv-1 reverse transcriptase in complex with inhibitor gsk952
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 163
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yniA05
3NKYA 3M9MB 2RF2A 4YR3A 2W7PA 5CY4A 4TY9A 1J53A 4MK7A 1L3SA 2UUWA 4FJNA 4O5BA 1WSJA 2F8TA 1K1QA 2AX0A 4M42A 1L3VA 2HHSA 4LSNA 2I5JA 2PYJA 4XPCA 2R8IA 2FBXA 2BGGA 5HRNA 1NOYA 1TKDA 5I3UA 1DTQA 2AJQA 4Z0UA 4OGEA 2VG6B 1QUVA 1JKHB 2A1SA 1SKSA 5CZ2A 5HLFB 3VQAA 3H5YA 2JLEA 3NF9A 4ED7A 4DL4A 1C0MA 4NLWA 4PA1A 4RG8A 3B6OA 3KLGB 2ASDA 2E4LA 3H59A 4CEDA 4CERA 1F21A 3QIPB 5KG5A 4E19A 4DFJA 3V6JA 3LDSA 5I42A 2XI3A 1S1XA 2ILZA 4QAGA 4Q44A 3EZ5A 1HPZA 5E41A 4IQXA 5KG2A 4CJVA 3V6HA 5KFSA 5EWFA 3KLFA 1VRTB 4DG1A 5KFMA 3OLAA 2O5DA 3H40A 2HHQA 3WNFA 2IDOA 2AGQA 2FVSA 3NBPA 4NLTA 3OYMA 4RW9A 2YNHA 4DL5A 4DSJA 1QAIA 5KFTA 4CF1A 2XHBA 3PJXA 5EUHA 1S9GB 3NAEA 4RW7A 4H4OA 1LWCA 3KK1B 4J9KA 4WYLA 1NK5A 3ASMA 5KFVA 1GX6A 2HHVA 3LP0B 1RTDB 3MR5A 2WK4A 3D5MA 5KFEA 1ASUA 1WN7A 1ZBFA 1HNVB 4NCGB 1EP4A 3AVLA 3CIZA 2G8UA 4ED3A 4CJTA 4CJUA 2BANA 1RT4B 2ALZA 3Q8QB 3OL7A 4DSEA 1IKYA 1QE1A 4CFAA 1TGOA 2ZKUA 5KG7A 3K58A 3KK3A 3OYDA 3OYIA 4OKKA 5J2QA 1RDRA 2W8LA 4DMNA 2BDPA 4TQSA 4BACA 5C25B 4IG0B 2DPJA 3GIIA 3P1GA 3OYBA 5F8HA 4CIEA 3DDKA 2YNGA 2ASLA 1QAJA 4MKBA 3V9XA 5T7BA 3HYFA 1X9WA 4KBIA 4FJMA 3LALA 4ELVA 4IH5A 2O4GA 1S48A 2IC3A 5FDLA 3IGNA 4LY7A 1D1UA 2XY7A 3ITHA 5HROA 4FS1A 3T19A 3NCIA 4MQ3A 3DLGB 2VWJA 4ZTFA 3QLHA 4NLYA 3C6UA 1HYSB 1XR6A 3DMJB 3PR5B 4DU3A 3OL8A 2X6SA 1SL2A 2QKKA 4DTPA 5KFWA 4E7LA 4BE1A 3U6FA 3LZIA 2OPPA 1SKWA 3CVKA 4H4MA 4ED0A 4DTXA 3K5LA 3KLVA 1RA6A 1WNEA 2DY4A 4E7KA 2RKIA 1BGXT 3EY1A 2PZSA 5KFXA 1REVA 3QYYA 5EDWA 3O4QA 4QWCA 2ZE2A 3QZ7A 2PYLA 3UIQA 3DOKA 2AX1A 4TYBA 4LSNB 3EPIA 2FLPA 3PR4A 3SYZA 4K4ZA 2WONA 4U6PA 3RMCA 1DTQB 4MK9A 4I2PA 2BE2A 2AQ4A 1LAWA 2NUBA 3EPGA 2P5OA 2GIRA 5C24B 4JRPA 1TV6A 2D0AA 3DRRA 1XR5A 4O0JA 2HVIA 3SV3A 1I6JA 1HMVA 3SQ2A 1D9FA 3DM2B 4K4VA 4YMEA 2LSNA 5KT3A 4CJFA 4AHUA 3S3MA 2OA8A 4C8OA 4LH4A 4RNHA 1J5OA 4IR1A 1FXXA 3OL9A 3ALYA 4OVLA 4U7CA 1SKRA 3I8DA 1ITGA 5KFPA 3L2QA 3MEGA 5I42B 4EO6A 1HPZB 3OYAA 5FROA 2ZD1A 3IRXA 4HCBA 3NH2A 2OPRA 1KVCA 2Q3SA 2FBYA 4CJLA 1S1UB 4BDYA 1RTIA 1BL3A 1TAUA 4B9VA 4KV8A 4DG1B 4ED6A 4WZMA 2FLLA 1UAXA 3FDSA 3MEEA 2YNHB 4BWJA 2IBKA 1GX5A 2BQRA 4IRDA 4H4OB 4CEFA 2ASJA 4URQU 3HVRA 1FK9A 3BR9A 4ECXA 3HPHA 4QWAA 1DLOA 4M3WA 5K14B 4B9MA 1TL1A 2WTFA 2FBVA 4K8XA 2D0BA 1EP4B 2WCXA 1JX4A 1EETB 2HWHA 3VQDA 3PW2A 2BANB 3O4NA 5F9NA 4ELUA 4RU9A 1KLMA 3KK3B 4GW6A 2YNFA 1D0EA 4DL3A 4QOZB 2D3UA 4RUAA 2X78A 3VQ5A 2PY5A 1RT7B 1NK4A 4ED2A 4IBNA 3E01A 3N6LA 3VQEA 3U3YA 1QHTA 3JYTB 1KCFA 4CFBA 4Y34A 1QSYA 3PW0A 3QETA 4FJ5A 2YNGB 2RDIA 4ED8A 5F9LA 3CWJA 4Q45A 2C2RA 4F4KA 1ASVA 1C1CA 2D3ZA 4K4XA 3OS2A 2IC3B 2UVVA 3LP1B 1C0UB 1VSEA 4JLHA 4DWIA 3CJ0A 3IN5A 4I9QA 3ITHB 4DTJA 5HROB 3NE6A 4KI6A 3QLHB 4FJJA 5KFGA 4CHOA 3BSAA 1C6VA 2W9AA 3PX4A 5KRSA 5KFLA 3WNGA 4Z4GA 1JKHA 4DF8A 3BSNA 1G15A 3PW5A 5HLFA 1U48A 4J2DA 4CFCA 5HBMB 1NJYA 3GV5B 2RKIB 4ECUA 1REVB 2YHBA 1C1BB 4N47A 3ZSVA 4KAIA 3KLGA 4ICLB 2ZE2B 3QIPA 2WOMB 4J9RA 4FZXC 4FW1A 3DOKB 5KTQA 4KE5A 1IM4A 4CJQA 2DFEA 5FRMA 3L2UA 4OL8A 4CGJA 2HHTA 5CZ1A 5JXSA 4I2PB 1K1SA 1NOZA 4R8UA 1TV6B 3QEWA 1VRTA 2IS3A 3G6VA 1Z4UA 1T8EA 1HMVB 3NGDA 3AA3A 3HSTB 3PO5A 3CDWA 3H5SA 4CHQA 4CEZA 4XO0A 1ZTWA 1BISA 1W0HA 3HT3A 4QPXA 1J5OB 5EWGA 4BE2A 4CK1A 2RN2A 4RNOA 4DTRA 5KG6A 3LP0A 1RTDA 1HNVA 2D41A 1JLFA 2B4JA 1NKCA 3E51A 4AHRA 2ZD1B 3CJ3A 1RT4A 4CGDA 1S6PB 1BIZA 3BSCA 2FVQA 5KT5A 4DTNA 1XC9A 4C8KA 5J1EB 4GMJB 1NJZA 2YV0X 1RTJB 2FVCA 4BDZA 1VSIA 4OPKA 3D45A 4KHSA 3THVA 3MEEB 3AVNA 4CF0A 1ASWA 1A5VA 1D5AA 4CIGA 1RT3B 2FLNA 3V1OA 2IJNA 2DFFA 4ZHRB 3KHRA 4DSKA 1BQMA 2FJXA 1S9FA 3SUNA 1UWBA 1DLOB 3CM6A 4WXWA 3SUOA 1ZBUA 4FXDA 1HNIA 3KIOA 4KRFA 1RDDA 5EU7A 2HNDA 4EEYA 4IKFA 1RT5B 1EKEA 2AGOA 3LPUA 5KFAA 1S1TB 2YNFB 4B9TA 1IKWB 3F73A 4YQWA 4F3TA 5KFUA 4DQIA 3LWLA 4RW8B 4CF2A 3HVTA 3KD5E 4HUFA 4BWMA 1SL0A 2G8VA 3DMJA 4J9PA 4DFPA 1ZYQA 4CEOA 1U47A 3DLBA 3GV8B 3ZSWA 3ZSOA 3H4DA 3L8BA 3LAKA 1L3UA 3OHBA 4CECA 3RRGA 4TY8A 1WSHA 1B9FA 3RTVA 4JS4A 2F8SA 3DYAB 2IMWP 1TVRA 1C1CB 4QW9A 4KHYA 2QV6A 1MMLA 4WFYA 3NGZA 4KHNA 4KKOB 4CJ3A 4KHUA 4CEBA 3C6TB 3CDUA 2E9RX 3QZ8A 4ECTA 3OY9A 2UVRA 4KHWA 3GQCA 4CIFA 1XR7A 1Z25A 3HVWA 3HM9A 4W5TA 2Y1JA 5F8NA 1EX4A 3O3HA 3MFHA 5KFRA 3QINA 1J9AA 3G6XA 5C24A 3UQSA 3S3OA 1S49A 4JV0A 4Q0BA 2Z1IA 5KFKA 3DM2A 5KFCA 3TAMB 3QGIA 3SI8A 1CXQA 1TK0A 3MR3A 4ZVHA 5KFYA 2YNIB 1S6QB 3NGIA 3TARA 4JV2A 4I7FB 4OLAA 4FJ8A 2XY5A 2JEGA 1RAJA 2Y1IA 3NH0A 3VQQA 4M45A 4FLYA 1MU2B 4YR2A 5HRRA 2XY6A 3HJFA 5KFFA 1RYSA 4DLEA 3OJSA 1S1UA 3KLEB 3GILA 3KHLA 2G8FA 3VQ4A 1WSEA 3KHGA 4R8UB 3PX0A 4KTZA 2KZZA 3PV8A 4OJRA 4NLPA 1HRHA 3KJVB 2FVPA 4DTMA 1NJXA 5C5JA 4KPYA 3Q8RB 1VRUB 3EZUA 1C0TA 1YT3A 3V81B 5HP1A 1KTQA 2ILYA 5KT7A 3FRZA 1CLQA 5K14A 4KI4A 1JLAB 1JLFB 4CJEA 3RB3A 1EETA 3CM5A 4ED1A 3NL0A 5J2NA 5DQIA 1IKVB 4Q43A 4ECQA 2Z1GA 5KFJA 2D7SA 3KD1E 2OPSA 4NLGA 4C8MA 5FRNA 1CXUA 4CESA 1RT7A 1XHXA 4E7JA 2QE5A 1S5JA 1S9EB 3S9HA 3H5XA 1JLGB 2BQUA 4CEEA 3QNOA 3L2WA 4Q5VA 3V9ZA 3JYTA 3NMAA 3P83D 2ATQA 1DTTA 4DTOA 3H98A 3TI0A 4M3ZA 1BQMB 1ZETA 1UWBB 4URSA 3KKRA 4FZZA 1IH7A 4MH8A 4Y3CA 3NF7A 1HNIB 2JEIA 4NZ0A 4LQ9A 2V4QA 4F4WA 2HNDB 4YP3A 3PY8A 3LP1A 1C0UA 1N6QB 2I1RA 3PO4A 3KK2B 4CJ5A 3PW7A 4QCLA 2E6MA 3QNNA 3HVTB 1SH0A 4MIAA 5F8GA 1XI1A 2E9TA 2ETJA 3TABA 3RMBA 3SNNA 4KB7A 1KFSA 3LPTA 4K4TA 1U4BA 1TAQA 3OYJA 4FK2A 1SH2A 3VQ9A 4DTSA 2YKMB 2Z1HA 1NHVA 4TY8B 3QERA 3MR6A 4PY5A 5HBMA 2J6TA 3DLEA 1TVRB 4OGCA 1C1BA 1T03A 1YTUA 2DFHA 4B9UA 4F2RA 3KLHB 4IG3B 4ICLA 1U09A 2BRLA 4RNFA 3VQ7A 2WOMA 1Q9YA 2F8EX 3PUFA 3L3VA 2W9BB 4EP5A 2C22A 1X9SA 4HTUA 3Q8SB 4Z4HA 1I3AA 3OHAA 1TKXB 4NLVA 1QTMA 1S0OA 3IS9A 3RR7A 3CJ5A 4YFUA 2HNYB 5DQHA 3S3NA 3ZT2A 3B6PA 2EX3A 4FJ9A 3T3FA 5KFIA 4EBDA 3OYCA 4C8NA 4Q0BB 4F2SA 2F96A 3TAEA 4Y1DA 4DU1A 1IO2A 1J54A 3SQ1A 4FLWA 2YKNA 1KHVA 2VA2A 3UR0A 3QGGA 1JIHA 4HVJA 3LWMA 1LV5A 2G8KA 3NAHA 3AA2A 1VSKA 5DK5A 3I5CA 3O3FA 4FCYA 4FLTA 4BE0A 4KB1A 3KLIA 4W5RA 4PUOA 3HPGA 4CJSA 3TQ1A 4Z4IA 1RA7A 4FVMA 4FJXA 2HVHA 3TANA 1ZTTA 4NLDA 5KG4A 1U45A 1S6PA 4M95A 4O4GA 4NLXA 1RBVA 2XRIA 3CYMA 1HQEA 4I2QB 4DFMA 4Q8EA 3WNHA 4OKEA 1GOCA 5J1EA 2KFZA 1Y97A 3CFRA 1RTJA 3VQ8A 1KRPA 3RB0A 4TSXA 5F8MA 4I9LA 4J2EA 1RT3A 1L5UA 1BI4A 3HXMA 3OYHA 1C0TB 4ZHRA 4TYAA 1N5YB 3N6NA 1WLJA 4TLRA 4MFBA 5HP1B 4CF9A 3PJWA 3HL8A 3VQBA 3RMDA 2R2RA 4M41A 3CJ4A 4KO0B 2HHUA 2OPQA 4DSFA 3MXMA 4AHVA 3D28A 3CG7A 1GOBA 3SFGA 5J2MA 1RT5A 5KI6A 5J2NB 3PZPA 2R2UA 1S1TA 4NYNA 1VSJA 5KGXA 1IKWA 4IH7A 3DRSA 2OPSB 3SFUA 4RW8A 4CJKA 1NK0A 1S0NA 3K57A 4Z4FA 3AO4A 1DTTB 4E0DA 2FJWA 4FLZA 2EC0A 5L1JA 2QK9A 4RUCA 4ECYA 3ZT4A 2JC1A 4XPEA 3SUPA 3DYAA 5KT4A 3ZSYA 2XGPA 3VQSA 2XI2A 4F8RA 4LSLB 3IG1B 3VQ6A 2P5GA 3BGRA 4NLOA 4KAZA 4KKOA 1S1VA 4URGA 1VSMA 3C6TA 1TKZA 4ECVA 5KT2A 4FZYA 4QWEA 3OJUA 4KHQA 1RDCA 3DLKB 1W9HA 4FJKA 3NF6A 3QIOA 2XGQA 4WE1A 1VSLA 3OS0A 1SV5B 3KMQA 4B9NA 4MKAA 4J9OA 2VA3A 4YNQA 1GOAA 3I5BA 4R5PB 3TAMA 1BQNB 2VG7A 3DLEB 2B5JA 1T03B 1S10A 4K50A 2YNIA 1TL3A 1T94A 1S6QA 2G8HA 1VK0A 4RNMA 4I7FA 1IKXB 1EXQA 1JL2A 2A1RA 4ID5B 1S1WA 2HAIA 1FKPA 4ZVEA 1MU2A 1D9DA 3M8QB 3IS9B 3H08A 2C28A 4NLSA 4CHZA 1RDBA 3KLEA 1UA0A 3C94A 2D0CA 1ZBIA 1QSLA 4J9SA 4PWDB 3MFIA 3M8PA 1U49A 3JSMA 4JS5A 3KJVA 5CYMA 3RWUA 3I0RB 2YKNB 1X9MA 4AILC 4TXSA 1VRUA 4F3OA 2HHXA 5KG1A 2JEJA 4O55A 3V81A 3KLIB 4EO8A 3T5LA 4PUOB 5DG8A 4DFKA 5EWEA 4ZVFA 4AHSA 3M9OB 3PHEA 3OYEA 1JLAA 1A5XA 1RNHA 3D0PA 3M8RA 3KOAA 3K5NA 1B92A 4KHMA 4IR9A 4ELTA 1JLEA 1WAJA 4R0EA 4W5QA 4CCHA 1C1AA 3OYLA 4O4GB 1HQEB 1IKVA 5KFNA 3CO9A 1KFDA 1RTHB 2FJVA 4KFBB 4M3UA 4B8AB 4WZQA 1S9EA 1JLGA 3RMAA 1SUQA 3V4IB 5DQGA 1W25A 3DLRA 4RW6B 2CKWA 4O44B 1BI4B 3RR8A 4E7IA 3ZT0A 3NAIA 3OVNA 5L1IA 2AU0A 4KB0A 3AO1A 4MFBB 3K59A 2XCPA 3OS1A 3SI6A 1T3NA 2OPQB 1T05B 3RAXA 4JV1A 4FM0A 2GV9A 5J2MB 1N6QA 3VA0A 3KK2A 3TAGA 2OZSA 2G8WA 4N41A 4Z4EA 1BHLA 1NHUA 3DRSB 1LW0B 2GC8A 5L1KA 4FBTA 3U3GA 2GUIA 4CFDA 3BSOA 3DRPA 3V1QA 1LW2B 4NLRA 3T5KA 2R8KA 3A2FA 4CGIA 1NJWA 1JLQB 3SPZA 3TAQA 1XHZA 2J6UA 2BQ3A 4GC7A 4M3TA 2YKMA 4NCBA 4FYDA 4IH6A 3PX6A 5KRTA 4J9LA 1UA1A 1HJRA 2D5RA 2V4RA 2FBTA 4EZ6A 4OKJA 4FM1A 4QWBA 2WRMA 3KLHA 4IG3A 5T14A 1FKOB 2QKBA 4AHTA 2UVWA 3K5MA 3BGRB 1BCOA 3SJJA 4NRUA 1Q9XA 1S1VB 1RILA 3AVIA 4IDKA 2W9BA 2HB5A 2EHGA 1TKZB 4O3NA 3F9KA 1HARA 1WSIA 4CJRA 3CDEA 4BDPA 4B9LA 1TKXA 5KT6A 4ID1A 2HNYA 5KGWA 3BQ2A 3I0SA 1QSSA 4WE1B 5F8LA 4M3XA 4ZPBA 4FJLA 4C8LA 4LH5A 3H5UA 4K4UA 4FLXA 2O4IA 5KG0A 1TKTB 5KFDA 4ECZA 4DS5A 1S4FA 1NKBA 1UOCA 2VG7B 4DQSA 3QEVA 2B5JB 4G1QA 1NKEA 1JLBA 1TK8A 4IFYB 4H8KA 4DL7A 2R7YA 1TL3B 4F4XA 3MEDA 5KFOA 3L2VA 5KFBA 2AGPA 3HO1A 4FW2A 3HVAA 2WHOA 1S1WB 1FKPB 2P1JA 4EYIB 2FC0A 1RT1B 5JS1A 1LWEA 1BIUA 4CGGA 4I2QA 5JUMA 3ZSQA 3M8PB 2BRKA 1NK7A 4X2BA 4PQUA 4EYHB 3JSMB 2P51A 4FJIA 4E1MA 4FK4A 4IFVA 4K8ZA 5CYMB 1TK5A 3LP3A 4LQ3A 4CEAA 4GC6A 5F8JA 2B43A 4DTUA 4O3PA 2IGIA 4FLUA 3PVXA 1A5WA 3QO9A 1N5YA 2R8HA 3V6DB 1Q8IA 4KO0A 3VN5A 5DGBA 4ZP9A 3AO5A 3FQKA 3AVFA 1JLEB 1BCMA 2RDJA 1NNDA 4W5NA 1RDAA 4JUZA 5D3GB 3K2PA 3N6MA 3KNAA 4K4SA 1JLCA 3DOLB 1T7PA 3QESA 3OYFA 3TAFA 2X74A 1YVFA 1SUQB 2E6LA 1HYVA 4HHTA 2XCAA 1N56A 4N76A 4EP4A 4O3QA 4O4RA 2IAJA 3NGYA 1LAVA 1RYRA 2AWZA 5DG9A 1CSJA 1HQUB 3SZ2A 4MK8A 3TVKA 1X1PA 4LSLA 3NF8A 3IG1A 2OH2A 4W5OA 2E9ZA 3P5JA 4DQQA 3V1RA 3LP2B 4FJHA 3FQLA 4E1NA 2W42A 3RBEA 4OPJA 3DI6B 5SZTA 3SV4A 1OS5A 2DPIA 3DRPB 4FS2A 4RW4B 3DLKA 3H2LA 3KKSA 3UPFA 4RZRA 2JEFA 1WSFA 4DL2A 4M3RA 4CJWA 3CFOA 3QEXA 2OZMA 2ZQBA 1SV5A 3CJ2A 2R8JA 3NH1A 4R5PA 1BQNA 3L2RA 4TN2A 3MTKA 4NYZA 4ZMMA 4GVMA 1KVAA 2GBZA 4DSIA 4CGFA 3O3GA 1B9DA 4IDKB 3SCXA 1D8YA 1IKXA 1U04A 4E3SA 3V9UA 4ID5A 4M3YA 4DLGA 2IM1A 4Y1CA 4IKAA 3L3UA 3HP6A 3M8QA 5KFZA 2ATLA 1C2PA 2JGUA 3WNEA 3V6KA 2RF2B 4J9NA 4CK2A 3I0SB 4F50A 2IOCA 1ZBHA 3SPYA 4PWDA 1KVBA 3AVJA 1KLNA 3FSIA 3BQ0A 3TR8A 4EBEA 2I5JB 3I0RA 4CK3A 4EBCA 3IAYA 4G1QB 1JLBB 3MF5A 4KHRA 3TWHA 3MEDB 5I3UB 4J2BA 4HUGA 3M8SA 2X6NA 1JXLA 4O3SA 4J9QA 4FK0A 2HW3A 1VSDA 4DSLA 3ISND 4E89A 4NLQA 1O1WA 5JS2A 3ZSZA 1LWEB 2UUTA 2HNZA 2R2TA 3HKWA 4CF8A 3ZCMA 3G6YA 3V9SA 3OL6A 5CYQA 2G8IA 4HKQA 3RB4A 3AVKA 1RTHA 4PQUB 4KFBA 4KTQA 4XIUA 4WXOA 3MECA 3FFIA 5J2PA 1WSGA 4IFVB 3GIJA 3AVMA 1R0AA 3G10A 1S1XB 3V4IA 2BR0A 2B6AA 5C42A 4CE9A 4RW6A 4O44A 4Q8FA 4CHNA 1CZ9A 1KSPA 4K4YA 3QO9B 5DG7A 2DTUA 3AVAA 2W9CA 4ZTJA 2JC0A 3KLFB 4OLBA 1RBSA 4LD0A 1XWLA 4DS4A 3NBPB 4NYFA 3VQPA 1T05A 3AVHA 4TQRA 2IJFA 4RW9B 2XC9A 1N4LA 3HP9A 2KZMA 1RBTA 4RW7B 3ULDA 1LWCB 4ZP8A 2C2DA 3HHKA 2VG5A 2IM3A 1LW0A 3HK2A 1JLCB 4IRKA 2KFNA 3RRHA 4FBUA 4UQGA 3H4BA 4O3OA 1LW2A 1N48A 2Z1JA 2IAJB 4KTWA 1IKYB 1QE1B 2HMIA 1JLQA 1LWFA 1S0MA 1QQCA 3V9WA 3K5OA 1NK6A 4HCCA 2HHWA 3DLHA 5J2QB 2W7OA 3KMSA 3G86A 2KW4A 3ZSXA 4FM2A 3AVBA 5SWMA 4ZVGA 2VWKA 4B8CA 1HYZA 1FKOA 1QS4A 3ZSRA 2YHAA 4O3RA 4E7HA 4EZ9A 3AVCA 4FLVA 4NCAA 1RT2A 3T5HA 1RT6A 5DMRA 3C95A 4B3OA 3OLBA 4AH9A 4ZP7A 4HUEA 3AO2A 5FDLB 2V0NA 4Z4CA 2KTQA 3CQ8A 3G0ZA 3TAPA 1SH3A 1S97A 1ZBLA 3MXJA 4B08A 5DLFA 1TKTA 1TP7A 3PW4A 1YTAA 5KFQA 4CHYA 2IM0A 4N56A 3C6UB 4FJGA 2HWIA 4CEQA 3ICLA 3VA3A 4IFYA 2UVUA 4IOBA 2OPPB 3AVGA 4RNNA 1I39A 2VG6A 1RBRA 3NDKA 4H4MB 4F4ZA 3AA4A 3NFAA 4CJPA 1JL1A 4WFZA 3BQ1A 2ITGA 4G3IA 3BREA 3IGVA 1IG9A 3UDLA 4FJ7A 1RT1A 2J6SA 3Q8PB 4IRCA 3OYGA 2IA6A 1RCHA 4WFXA 5HRSA 3ZT3A 3MR2A 3QEPA 3M9NB 4ZP6A 2RPIA 2R8GA 2WONB 3BDPA 1JXBA 3RAQA 3MXIA 4J2AA 2BE2B 1KHWA 3GV7B 4DQRA 4DF4A 2KQ2A 3DRRB 3LZJA 3V6DA 3BJYA 4O0IA 2XWYA 3KTQA 3HPOA 2R2SA 1NK8A 4ECWA 3OSNA 3MAQA 1S9GA 5KG3A 2HNZB 2V9WA 3LAMA 1NK9A 3KK1A 5D3GA 5CYQB 3GYNA 2WB4A 4CJ4A 3AV9A 1SL1A 3DOLA 3MEGB 1CZBA 1K6YA 4NLUA 1VSHA 3MECB 5DLGA 3FFIB 5J2PB 4NCGA 3EYZA 1R0AB 3GIMA 1RBUA 2B6AB 4WYWA 5C42B 1VSFA 3AO3A 3ZT1A 3IRXB 2OPRB 1RTIB 3LANA 4H54A 3OYNA 1JXEA 3QIDA 2W9CB 4KV8B 1HQUA 5L9XA 4Y2AA 5HRPA 5F8IA 4DL6A 4CHPA 4N5SA 4DEZA 5C25A 4F4YA 4IG0A 4QW8A 3SQ0A 4DQPA 3OSPA 1YVUA 4ECSA 3ISNC 1WAFA 5DGAA 4L8RB 1Z26A 3VQCA 3LP2A 2VG5B 4M94A 3AA5X 1FK9B 4B9SA 3NHGA 1TL1B 3DI6A 3T5JA 1TQLA 2XO7A 2QXFA 2C2EA 2GIQA 3I5AA 1L3TA 4KSEB 4NRTA 4MIBA 4DU4A 4RW4A 2IM2A 3RBDA 4KREA 2CJQA 2HMIB 4ZPDA 4ZPCA 1LWFB 1KLMB 4ZPAA 3RB6A 2FVRA 4AHCA 3SUQA 3DLGA 3KHHA 1WNSA 5L1LA 2W8KA 3CFPA 2OYQA 4JRQA 3QEIA 4Y2CA 1HYSA 3E01B 3QGHA 2XY8A 3GIKA 4K4WA 4HYKA 3SQ4A 5KFHA 3T1AA 4YR0A 4ECRA 4J9MA 4QWDA 1RT2B 1RT6B 4CGHA 3OYKA 4B3OB
chains in the Genus database with same CATH superfamily
4MK7A 1DHMA 2VQFK 4ANCA 1NB2A 1L3VA 4WKYA 2HZVA 4LSNA 2H54B 2XQCA 5IM0A 4I56A 2RAQA 3QQCD 1V5VA 1IBLK 1TKDA 2UXCK 1NU4A 1Q86O 1T9YA 4KH1B 1JKHB 1WF2A 1J27A 1PILA 1SC3B 2XNQA 3CCUS 3NF9A 4ED7A 1BO5O 2BKOA 4USVA 4RG8A 4PA1A 1DEJA 2BE7D 2ASDA 3H59A 4CERA 1BC6A 8AT1B 2BX6A 4YUDA 2IHR1 3EGWB 4OYMA 5I42A 2XI3A 1UFKA 2ILZA 4Q44A 5E41A 2YY3A 3MDQA 3O8WA 1RCOB 3AFGA 5HJXA 3KVGA 3G8QA 5KFSA 5C7PA 4A46A 2GJIA 1VRTB 2IDOA 3CCLS 2QEXS 3P31A 3AD8C 4J90A 2QFJA 4DL5A 4B3RK 2F4VK 1IN0A 3PJXA 3MCSA 1LWCA 4J9KA 4CZHA 4X84A 2M2BA 4OHWA 3PNIA 1Q18A 2YX6A 3ASMA 4OX9K 2DTJA 2FHMA 3CIZA 2D1CA 2VV5A 2FSJA 4CJTA 5FJ4A 2BANA 4WP8A 2ALZA 1RWVB 3DXMB 4CFAA 1TGOA 2P9IA 3D2FB 2DIVA 3OYDA 1FNOA 2DK2A 3OYIA 3ZX3A 5H1SV 1R7IA 4DMNA 1W7WA 4JI4F 1BE4A 4RUBA 3JTPA 4IG0B 2QWMA 2HVZA 3GIIA 3OYBA 2Q0RA 2OGUA 3MGJA 4FWNA 2P9LA 1QAJA 2A6MA 3WIVA 1LQ9A 2FC8A 2RQMA 2EFGA 4FJMA 5CA5A 3AA8A 2XY7A 3R9PA 1WF1A 2XMVA 2CQ1A 4H4KA 3E9PA 3DLGB 4MT1A 3CE8A 3S41A 5CD4H 3W3DA 2J8AA 3C6UA 4GO7X 3MWTA 3DMJB 3KHYA 3ZEUB 2ASPA 4DU3A 2QKKA 3WXJA 3CMAS 4CZIA 1U0SA 3MK6A 2GVDA 2DXDA 2KRBA 2V50A 4OYIA 1WNEA 4E7KA 2GCFA 5A8KA 1CQNA 1AROP 1N8RT 5EDWA 3HOSA 2C2KB 3DOKA 4TYBA 3D6RA 2E5LJ 4LSNB 3W64A 2IFXA 2KXFA 2RE1A 2R7XA 1X9JA 3GMGA 3RMCA 4LF6J 4LSZB 1DJ0A 4I2PA 2NYIA 2P5OA 1FWLA 4JRPA 1LOUA 2WW4A 1H38A 2E88A 1GMWA 5GMKa 2DGXA 3K8VA 4QR2A 1MNEA 2PO4A 1SC4B 3LDPA 3H3OB 4YHHK 4B9QA 4RNHA 1J5OA 1FXXA 7FD1A 3OL9A 3ALYA 2VQEF 2ZH1A 4JI0J 1WUAA 3L2QA 3MWBA 2DPNA 5I42B 4BY9C 3HT0A 2A5XA 4EO6A 3IRXA 3A0IX 4HCBA 1RTIA 2RHSB 1AUSL 1KOOA 2X51A 2WW8A 1LCUA 4N77A 4A2BA 1N0VC 4ED6A 2QL5B 3SQOP 3FDSA 4OZ2A 2OTLS 1FJCA 3SEOA 1T95A 4LC9B 4NXNK 2CA9A 2ASJA 1HNZF 4URQU 1U1OA 3TR5A 4QWAA 1DLOA 2P9EA 1TL1A 4B9MA 4F0MA 2D0BA 5A2QU 2WCXA 1ATRA 3CJ7A 1EETB 2HWHA 2BANB 3W3SA 3O4NA 3F9MA 4ELUA 3MMAA 2P9IB 2UUCF 4J5OA 4GW6A 4DL3A 4PRFA 4U95A 4RUAA 2X78A 1FD2A 4X66F 2I2YA 2OFGX 3N6LA 3R5AA 4CFBA 1QSYA 4HI1A 4DV6J 1OSCA 1R6YA 1H2VZ 2DGUA 4Z94A 1B4SA 5F9LA 5LJ3Y 3JTOA 4MDAA 2HK2A 4WCEL 2MYFA 2C2RA 1ZC6A 4WP9A 3GP9A 1ASVA 3PJ9A 4K4XA 3IWXA 4OZ5A 4DWIA 3NE6A 3NNAA 4JKCA 2VPWB 2MLYA 2LA4A 1X4CA 2FSKA 3QBWA 3AXMA 2W9AA 2VQFF 2C2NA 1M5VC 1RBAA 5KRSA 4OJ3A 3BB5A 4DR4J 4Y0WA 1OY9A 3BSNA 3IC1A 3IKMA 3PW5A 3TA0A 4CWBA 4J2DA 3FCWA 1NJYA 4JV5K 1IBLF 2UXCF 3H0PA 5A8KB 1C1BB 4LF5J 2YHBA 4N47A 3ZSVA 3MPDA 4LF8F 4ICLB 2ZH7A 1X4GA 2FJDB 2GWKA 2WOMB 4DX6A 4UOGA 3CJ9A 2ACMA 3O6WA 1TELA 1URNA 3DOKB 1VLYA 2DFEA 2BOPA 2WSEC 2P9SA 2NXCA 1M5SA 1IBMK 4CJ7A 5AZIA 3H20A 3H1VX 4EWTA 1HA1A 5JXSA 3O6QA 2K7KA 4I2PB 1K1SA 4DI6A 4IUFA 1Z4UA 1T8EA 3HSTB 5DJBA 5D0RA 2UXBJ 3H5SA 1GLAG 4CHQA 3UN3A 1FF2A 2E29A 1BISA 1W0HA 3O5BA 4QPXA 2LU1A 2CVIA 4ETXA 1J5OB 5D4OA 4BE2A 3J81j 2HYIB 2E7WA 4JBCA 4BRPA 2MZTA 4B3RF 1PKUA 2F4VF 1N5VA 2E7VA 1JLFA 2RILA 3KXDA 3OXFA 3M2VB 4OX9F 4P2MA 4CLLA 5ETKA 1XC9A 4C8KA 2CQ0A 1NLVA 3DGVA 1KQSR 2E1YA 4BDZA 1YHQN 4OPKA 1N36K 3THVA 2ASYA 4K41A 3AVNA 1A5VA 1D5AA 4CIGA 2AJFE 2CPHA 4ZHRB 3GYXB 3P3DA 3KHRA 2KXNB 4DR6K 2HQDA 1DLOB 4WXWA 2DRBA 1WDTA 1ZBUA 2KJWA 2WAQD 1RDDA 5EU7A 3CERA 2M70A 5IV4A 1RHKB 2HHHK 1EQ0A 1WKKA 1KNZA 3I96A 2LU2A 4RW8B 3PDNA 3NY0A 3HVTA 4DV3F 3OFFA 3H2UB 3Q23A 1ZYQA 1SIWB 3VEVA 5LSLA 3W5ZA 1G99A 1X60A 1Q95G 3D2EA 3G71N 3V2UC 5HJYA 2F8SA 2HSTA 4YOXA 3L4QA 2IMWP 4HL9A 1PJ7A 1MMLA 2AYEA 1R6VA 4KHNA 4C3LA 5LY3A 2QMXA 5AQRA 3C6TB 1NGEA 5D4PA 1IV0A 3OY9A 4KJIA 3FZMA 1XR7A 3J7Z5 3MD1A 2E1ZA 2EFPA 4NZ6A 1RWMB 5B8HA 1DT9A 4V1Ak 5KFRA 3QINA 2D0PA 5A0YB 1GTEA 4M5IA 2V69A 1SQEA 5KFKA 3TAMB 5KPTA 2LEPA 3SI8A 5K5MA 1CXQA 1TK0A 3MR3A 1VQ5N 5KFYA 2YNIB 5JICA 3NGIA 4JV2A 2J0WA 3MM5A 3UNYA 2W01A 2XY5A 2JEGA 3I33A 2Y1IA 3NH0A 4YHHF 2FQQB 2F9TA 2O67A 2P9SB 2RB7A 4YR2A 1EQYA 5HL7Q 1RYSA 4DLEA 3OJSA 5AZIB 1S1UA 3LDOA 3CC2S 3LM9A 5JLFA 3KHGA 3Q2TC 5BR8F 2QMUB 2EEYA 3BGOP 2COLA 1LNQA 2R7WA 3CULA 4C23A 3CCJS 3US5A 4UUWA 1KAZA 2W1BA 1YT3A 1BA0A 1KTQA 5HP1A 1YGYA 2ILYA 2UXDF 3IBWA 4KI4A 1JLAB 4BRNA 1JLFB 4GVBA 3RB3A 3EKUA 4USTA 4ED1A 3F44A 2K2PA 5DQIA 2DGOA 4DUZK 2ZWOA 3D3BJ 2Z1GA 2YWKA 2OPSA 5FRNA 4CESA 1RT7A 1GXUA 3QT6A 3QRPA 3QNOA 3L2WA 3AT1B 2DITA 3EDRB 3P83D 2DIUA 4U8VA 3TI0A 4M3ZA 4O8UA 3OA9A 2ZH2A 3ISZA 4FZZA 1HBMA 1ZA2B 4ZPVR 1DBDA 3FBBA 1FXLA 4Y3CA 2VUGA 4ZCIA 4OJGA 1FA0A 4LQ9A 4NX9A 3PY8A 1YJTA 5HMYA 3PO4A 1UFWA 4JI6F 4B3TJ 3CJ8A 2ZGYA 4OLPA 4L3NA 3TA1A 3HVTB 1YI2N 3QRQA 3ZTOA 5M1FA 1XNQJ 2D0OA 2ETJA 4ZVTB 3RMBA 4HT7A 4H0OA 2L3MA 1YITS 3LPTA 3JAMO 2GV1A 4EAHD 1KEKA 1C0GA 4DTSA 2Z1HA 3HBTA 3UVJA 3D2EB 3F56A 5HBMA 2ZH8A 1VOMA 2CZ4A 5IT4A 1GEHA 1TUWA 2NRVA 3FEZA 4RNFA 3L3CA 3VQ7A 4H0PA 1Q9YA 2B4OA 2GO8A 4FWOA 1JJ2M 2RRBA 4Z4HA 3K5PA 2XSJA 2ZC3A 1TKXB 3NG8A 1S0OA 3IS9A 3RR7A 5DQHA 2UUBK 3PSFA 2P6TA 3B6PA 2YX1A 1WC3A 2MLZA 3TSQA 2CXEA 3D67A 3OYCA 3QSYB 4RUHA 3W9IA 3IFEA 4DU1A 1IO2A 1H0HB 1HNWJ 2YKNA 2O01C 2JLFA 1AFIA 3SMSA 3UR0A 3QGGA 1JIHA 2G8KA 1FRMA 3CJQA 1EZZB 3EGZA 5JVHL 2W2OP 1Q79A 3AA2A 4P75A 5KQ8A 3O3FA 4FCYA 3CCLN 4FLTA 4BE0A 3MM5B 2QEXN 2AZ1A 3KLIA 4W5RA 4PUOA 3PIPL 1PSDA 5ADZA 3O1BA 4NI2A 4P72A 4M5DB 2ERRA 2OTJS 2HVHA 4EMDA 1ZTTA 3K7RA 5HVGA 3I4PA 4M95A 5AQHA 4I2QB 1SJRA 4DFMA 3WNHA 3A4TA 5I3PA 3CFRA 1NRKA 2B3TB 1NDCA 2NR0A 5HI7A 2CNNB 3ZXWA 3EZWA 3OYHA 2O3DA 5K8MA 5HP1B 3Q22A 3VQBA 1X4HA 2G2OA 3J7AP 1EAYC 4DSFA 4AHVA 1IBKJ 3D28A 1I94K 4FDFA 2EWHA 2RH3A 3UE2A 3SCIE 3TEGA 4QOTA 3PZPA 5K20B 1YJ7A 4NYNA 5H9FJ 3DRSA 4FYVB 4OZ1A 2OPSB 1E4GT 2BJ3A 2ZH4A 1R3NA 3C7NA 4ILMA 3K57A 2GUPA 2J5AA 4E0DA 4JK7A 4FOEA 4FLZA 3TRGA 2EC0A 3I8BA 5L1JA 3FMWA 2JC1A 2DNZA 2MZJA 4DCJB 3SUPA 2H4YB 5A8WB 3FLCO 4WFAQ 3ZSYA 3X3UA 3CMAN 2XI2A 3SBTA 4F8RA 3VQ6A 3ZZPA 2L9WA 3PTWA 1S1VA 1D3WA 4Q7AA 2ZM6K 4UOCA 2E5IA 1RHQB 3OJUA 1M1HA 3C15A 5KPRA 3KKFA 1HPMA 4LF7J 3EE9A 1ZAVA 3MI7X 1W9HA 2IRYA 3NF6A 1VSLA 3OS0A 2XEXA 3DC2A 3DHWC 3UVJB 4K43A 4NMXA 4O0NA 1FVSA 1IUJA 4H4KC 3HZGA 1SXLA 4HH0A 3M6GA 2VBYA 3A8KA 3W63A 1TL3A 1T94A 1S6QA 5CHIA 3KG4A 4OYWA 4RNMA 1VQ6N 2A10A 1IKXB 1A6LA 2FZKB 4P7VA 3MM9B 2MLXA 1MU2A 1D9DA 2NRTA 3IS9B 2WC9A 4LF1A 2C28A 2CPFA 3RW6A 5JMNA 4OMFG 2LA6A 4J9SA 2ZJQQ 4PWDB 1U2VA 1U49A 3UO0A 5HQMA 5D15A 3CCMS 3KJVA 2YKNB 5B0DA 1XUPO 4AILC 3CJKA 4UY8T 3JQMA 1U2CA 3THXA 4LF4K 3KLIB 3T5LA 1DZ5A 4PUOB 4BR4A 4NI2B 3OYEA 1RNHA 5G0RA 3M8RA 4BLGA 1G4CA 1B92A 1XMBA 4YOYA 3HLUA 1JLEA 4R0EA 3VAKA 2V8HA 3HKZD 4YOUA 4BR0A 1RTHB 4M3UA 4WZQA 3T1HJ 1S9EA 1JLGA 1RAHB 3RMAA 1SUQA 1QM9A 4GO5X 4DUZF 4NLCA 3MMBB 3NS6A 1YF5L 1CS4A 5IQ6A 4LRDA 2J0QD 3OVNA 1MW7A 4KB0A 4DX8H 3BN7A 3OS1A 1IJJA 5B0EA 1KD1T 1XJWB 1ZH5A 4JV1A 1F60B 3C19A 3TYTA 2HFUA 2VWBA 3G8SA 3TAGA 3DRSB 4IOAL 1U8SA 3C46A 3OW2R 2GC8A 5L1KA 4FBTA 2L9DA 1M90T 1R0CB 3C7NB 2FHOB 1LW2B 4P9SA 1DAXA 1GLDG 1NJWA 3HFKA 1JLQB 4DN9A 3M1FA 1RXOB 2DH9A 4FYDA 4L72B 4DR2J 4A57A 4OIXA 1VK3A 1KKHA 3W2VB 1UA1A 2K3IA 3MN5A 4CM0A 1R8BA 1B7YB 2FBTA 5DDOC 1G7CB 3KLHA 4JYAK 2LXFA 4JI3F 1VQ7S 4F02A 1BCOA 3SJJA 2MTLA 4NZ7A 1S1VB 3AVIA 3QT8A 2W9BA 2H51B 5M2PA 1YJRA 2W40A 4CJRA 3CDEA 1CG2A 4P2XA 3P38A 5EHHA 5KGWA 3T41A 2FGOA 2NXUA 4ZPBA 3JSRA 4C8LA 1YTYA 4K4UA 2CNKB 1TKTB 5KG0A 2V5HG 2P5VA 3QEVA 3CC7N 3THYB 1NKEA 1JLBA 4IFYB 1TL3B 2J9EA 3HULA 5ETQA 2AGPA 3MOZA 1VQOS 1ROFA 2JWKA 3Q7CA 1VJQA 1CULA 3VGKA 4U67L 5AE1A 4PKIA 4BRCA 3ENHA 2P1JA 3CCSS 2DJWA 4M5JA 4PG4A 2W6LA 1TTHB 1YBAA 2BW7A 5B0CA 5LMNJ 2HIQA 2EK6A 3SBGA 1DQ8A 3CCRS 1U2VB 1NK7A 1JCFA 3M6WA 4JI5J 4LQ3A 5F8JA 4O3PA 3PVXA 3MUMP 4F25A 3MUVP 3BBBA 1VQLS 4JI8K 3G82A 4DV1F 2E5JA 4F3MA 3FEXB 5K8OA 3RW7A 2MJUA 2YQ3A 3VN5A 2RU9A 3VAHA 3L95X 2ITMA 1JLEB 1BCMA 2RDJA 4CZFA 1NNDA 2CQBA 3OUYA 4K7QA 3TUZC 5D3GB 3K2PA 3N6MA 3GJRB 5BREA 4QS8A 3HSJA 1I94F 4K4SA 4ZA1A 3PSIA 2IMOA 4L74A 3VGTA 3TAFA 1RKJA 2BEFA 4DV2K 1SUQB 2YHWA 2XCAA 2VKZG 1N34J 1S0VA 1NGDA 5KAKA 5I9EB 5KQDA 3THPA 3NGYA 2XS7A 5IWAJ 4HEA9 1JJCB 3SZ2A 1Q7YT 4MK8A 3VVTA 4USUA 4ZLPA 3FCHA 3TVKA 4LSLA 3NF8A 3IG1A 3D7SB 2WVCA 4W5OA 1LKZA 5D78A 2EKYA 2F9JA 4DQQA 4X62K 2Z56B 3FQLA 2BZ2A 1IQZA 4E1NA 1FDNA 2V2ZA 5B09A 4QYZK 3SV4A 2BW2A 1OS5A 5ETPA 1N8RO 4RW4B 2ZM6F 4RZRA 1PYTA 2VASA 4M3RA 2ZQBA 3GONA 3QFWA 3L7OA 1JMTA 3B6BA 1Q82T 4QQBA 2IY5B 2Z2LA 2GFFA 3L2RA 3MTKA 4OO1J 4NYZA 1YVNA 4ZMMA 4DR5K 1KVAA 2YCHA 4WJBA 3HFVA 3TNVA 3O3GA 3KDNA 3E66A 3HZEA 1D8YA 2XNRA 1GMWD 1BWEA 1DQ9A 4DLGA 1RDUA 1AZSA 3M8QA 3MXHP 2RUSA 2JGUA 3WNEA 4OI6A 3D6TB 4F50A 5GADI 1QLNA 1S7IA 2ZZTA 1UEVA 4FWLA 4TU8A 1PCAA 1SVDA 4CNYA 4EBCA 4OI0A 1JLBB 1UAWA 3MF5A 2G13A 3J80O 2R3VA 3M8SA 3M5RA 4DPUA 4J9QA 1U7LA 4U7UK 4FK0A 1CULB 3HHNB 3CCJN 2Q43A 1VSDA 3BEXA 2QL7B 3M32A 5FPDA 2KLAA 4LF4F 4CF8A 3ZCMA 3G6YA 3V9SA 3OL6A 4CD1A 3M8ZA 1SQKA 4HKQA 3M6VA 4WXOA 2J8SA 4LF6K 1R0AA 2FJBB 1S1XB 3UD3P 3V4IA 1UVIA 2NPIA 2GA7A 4CHNA 5GAHU 3J7YI 4USKA 4CZMA 3A8IA 4K4YA 5DG7A 5FPMA 1F9HA 3G82B 3QMQA 4JI4J 3NBPB 4F9OA 2IJFA 4RW9B 4ENOA 4I6MA 5EX0A 4ES2A 1RBTA 1YJNN 4RW7B 3PM9A 2N4CA 3RG6A 2C2DA 3HHKA 1NSPA 3BF4A 1VHIA 3RRHA 4FBUA 2D4WA 3MDFA 2E2QA 3TTDA 4KTWA 1IKYB 1QE1B 2HMIA 2NZCA 3A3PB 4BRDA 4BCAA 3K5OA 4BGBA 4DV4K 2PFDA 1NK6A 4HCCA 4ANEA 3Q8YA 1FXDA 3DLHA 4H5NA 4N7TA 3ZTSA 3AVBA 3GSDA 4B8CA 1VISA 1WHVA 4PG6A 3ZSRA 2U1AA 2ACYA 1HBUA 4FLVA 5AXMA 4UTGA 5DMRA 1WDDA 1GT8A 3A8JA 3OLBA 4AH9A 4IO9L 3AO2A 1FT8A 2QMWA 1HWJA 2XMMA 1LXNA 1S97A 2YKQA 5K9FA 1ZBLA 1X5SA 1YTAA 5ETNA 2CUYA 1K44A 3AD9C 4DV6K 4FJGA 1RCXB 5HMXA 2ZBQA 4ISFA 3CCEN 5HQLA 1XMQF 1ACMB 5KOWA 4AL5A 3BPDA 3JAMY 3AVGA 4RNNA 5EXWA 3DU6A 1RBRA 4F4ZA 1UTAA 4OJ1A 1JL1A 3BREA 1PBAA 4JD2A 1RT1A 3OYGA 1OKJA 2IA6A 3E3XA 5A8RA 2GX8A 3MR2A 4PKGA 3V5RA 5CCLA 3M9NB 3IRWP 3OFHA 2NRWA 2R8GA 1FEEA 3BF3A 3WEEA 3RAQA 3MXIA 3D1OA 2NLWA 1EKRA 4DQRA 4LF5K 3V6DA 3BJYA 3CMQA 2XWYA 3KTQA 2K7JA 3L9ZA 2PE8A 2A40A 3MAQA 1U8WA 4JI8F 3M32B 3D54A 2CYYA 1HW8A 1HNZJ 3KK1A 1NPKA 2VODA 3BM7A 3GYNA 2WB4A 3C8YA 4CH0S 4FWSA 1VSHA 4A62A 4BRFA 3EYZA 1R0AB 3D0IE 1FFSB 1VSFA 1X7VA 8RUCA 3KUHA 4CI0B 4NO7A 2UUCJ 1UVMA 1HWKA 1JXEA 1X31C 2YWHA 2CPXA 4KV8B 2B4UA 4DV2F 4IEIA 2OHDA 5L9XA 2F7VA 1X5TA 5HRPA 4CHPA 1RBLA 2ZJPQ 4N5SA 3W66A 4F4YA 4I6MB 3OSPA 1YVUA 5C2CA 4ECSA 3ISNC 1ITPA 1UVNA 1UPPA 3MMVA 2O8FA 3A8YA 2PMWA 2CFXA 1FK9B 3N5FA 4HVZA 2YHXA 3OV7A 5T7LB 3I5AA 2NRZA 4MIBA 1K9MT 4X62F 2IM2A 2H48B 3RBDA 5GVQA 4KREA 2HMIB 1VS3A 4GVLA 1PG5B 4ZPAA 4AHCA 2V34A 4KGZB 2VQFJ 5DS7A 1OWXA 3QEIA 1N54B 4Y2CA 1HYSA 3E01B 3GIKA 3OR1B 2YPZA 4B1WB 3TPQA 1HBUB 5IV3A 4ECRA 3HTVA 4QWDA 1IBLJ 4DR5F 2UXCJ 2QA2A 3CI5A 1T9TA 2D9OA 2YTCA 4K25A 1QZ6A 3NKYA 4LF8J 2RF2A 2W7PA 1PYSB 2AEJA 2UUWA 4FJNA 1WSJA 5BN8A 5AXKA 4RTFD 4OZNA 4MYUA 4J8FA 4WWSA 1TL4A 2PYJA 1X4AA 5HMWA 1HKBA 2WVDA 2CWKA 5GMEA 3ULHA 2CH6A 2PA8D 4OZJA 5A6PA 5I3UA 2A1SA 5CZ2A 1HUXA 5HLFB 3H5YA 4DL4A 1C0MA 1Y00A 4M5LA 2F9DA 2JZ5A 4UZCA 3K0JA 3B6OA 4JD2B 3KLGB 2XZDB 5H9EK 2E4LA 1UKUA 3ZZZA 2JVRA 4YN3B 5KG5A 4B3RJ 4ES1A 4DZDA 2F4VJ 2V4JA 3I82A 2V2VA 1NGAA 3UW1A 3EZ5A 1WHYA 3L4IA 3U7JA 4OX9J 1N5SA 3WEEB 3LW5C 2ASMA 3O9UA 1Q86T 1S59A 1E6VA 1ZA1B 2QL9B 3KLFA 3RAMA 3R2CJ 2DISA 2FVSA 1IR1A 3GSIA 3W8PA 1XEZA 4CF1A 3PIOL 5EUHA 4AQYF 3KK1B 4LJMA 4U7BA 1GX6A 3LP0B 1RTDB 2WK4A 3W5XA 1ASUA 1WN7A 3DXSX 1EP4A 3AVLA 2KHOA 4BVPA 1Q1KA 4CJUA 2ZWPA 1RT4B 4FOIA 2V8GA 2ZKUA 2BUNA 2ZVIA 4CZJA 2E2NA 4AUKA 2C1EB 1LXJA 2N7YA 4DV3J 1W2IA 2W8LA 1KVJA 1ILYA 1MWKA 3R5JB 4TQSA 1JCGA 3LQVA 2YXLA 1VFJA 5GADU 1E6YB 4DV4F 4IOCL 4RLEA 4BS2A 1H2TZ 2GHWA 2ZKTA 3FGVA 1F6TA 2O8FB 3H3NO 3GIRA 4CLTA 1UZDA 1M0SA 2MDAA 3MM8B 2KHCA 2JWNA 5SUHA 1X3MA 3V9XA 4WPAA 1X9WA 3TZWA 1WG1A 1RHRB 4JKHA 1WC6A 4LY7A 4A8FA 4DR7F 3T19A 1S99A 5A76A 5DRKA 4CBUA 1N5QA 3M1VA 3WQUA 3N9UC 3VV2B 4NLYA 3OFGA 1HYSB 1XR6A 2J9CA 1GMVA 1SL2A 1X8DA 4DTPA 1GLBG 4BE1A 3CNQP 3U6FA 3LZIA 2MPUA 3T1YF 2OPPA 1LK7A 3GBTA 1MROA 3P6YC 4H4MA 2MKYA 4ED0A 2F8HA 2GIFA 5E33A 1BUXA 3VF4A 2CADA 3EY1A 3J7YU 3MN9A 3DOMB 2I6WA 2PZSA 3QYYA 3CHWA 3VAIA 1VQON 4OYBA 2I7NA 3QZ7A 3O1LA 2O8CB 1F2GA 5HATA 3M30A 4YHHJ 5GINA 4BR7A 3AOCA 2GTDA 2CG8A 3SYZA 2LXIA 3D1HA 3CCRN 3MPVA 1HI1A 5BR8J 3TO8A 2NUBA 3MPWA 3EPGA 4DR1K 4BRLA 3PRBA 2MZQA 2D0AA 4NMLA 1MWYA 5F0XA 3SV3A 1FWPA 1HMVA 5HN0A 3HSZA 3DM2B 4K4VA 5JVGL 2GW8A 4YB7A 2VD3A 1RU2A 1VQLN 4LH4A 3M4XA 2HRUA 3Q24A 4IR1A 1Z1ZA 4OVLA 2UXDJ 1ITGA 1DGKN 2V4JB 4FPRA 4NXNJ 4U67Q 4LFBK 3AJ2A 3OYAA 5FROA 2CJAA 2OPRA 2FBYA 4BDYA 4MKVA 4DU7A 1TAUA 4DHVA 1NNEA 1WC4A 1RWWB 1O8BA 2NPFA 3I4HX 2FLLA 4KHPK 2QA4N 4BWJA 2IBKA 4IWVA 4DHYA 2QWQA 2HVDA 1CEZA 1NGBA 3BF1A 1R31A 2VC1A 4CEFA 4NA2A 2QG9B 2VF3A 3JS6A 3TTFA 4GRSA 4K8XA 2I7PA 1EP4B 1V3ZA 2B8QA 1PAEX 4ZN3A 4NLBA 3RVCA 1RBOB 4RU9A 4BRMA 3RU0A 4Y2KA 1FX4A 4ED2A 4IBNA 3AXKA 1VK8A 3JYTB 2ROEA 1NDLA 5FLXO 2QLJB 1IBKK 3K9JA 1K8KB 4U9RA 3LGNA 2V8PA 4QIWD 3OW2M 1MG7A 3P45B 1C1CA 5H9FK 4ZLJA 3OS2A 3TUJC 3VGUA 1C0UB 4JLHA 1WB9A 2GGPB 3CJ0A 3IN5A 4C97A 4I9QA 2HBZB 2W2QP 5CCMA 5KFGA 3NWGA 2HAFA 3PX4A 4PCQA 5KFLA 3CJRA 4OX6A 4PXBA 1VQKN 2H5JB 1MROB 4NA3A 4BHQA 5E5NA 3ZO7A 4CFCA 3NCRA 5CAAA 3GV5B 3KJQB 5M1OA 3DXBA 3QIPA 4BC7A 3G9CA 4NXMK 2DNYA 5KTQA 1UETA 2RIJA 3ENOA 4CJQA 1OJ4A 1SJFA 2Q0UA 4C0HA 4CGJA 1H74A 5CZ1A 2V51B 2KT2A 4OYOA 4R8UA 3S6EA 4K2XA 3QEWA 2KJVA 1HMVB 3NGDA 3AA3A 3U9DA 1SB6A 2ZGZA 3RYLA 3J80Y 2ZZMA 1ZTWA 4B1YB 2O8DA 1TR0A 1SAZA 3G6ES 5L46A 1N36J 3MX2A 2RN2A 3FRYA 2RS8A 1P8ZA 3KWMA 2RDDA 1ELOA 2QLWA 1HNVA 2D41A 3O5TB 1NKCA 2C2ZB 3E51A 4DR6J 3VEXA 5IT0A 4CGDA 1BIZA 2HF3A 5KT5A 5C2DA 5J1EB 4GMJB 2Y0SD 2M3DA 1NJZA 2YV0X 1RTJB 2HHHJ 3EDQB 2O8EB 1FE0A 1WORA 2DHAA 1SIZA 5AXNA 1RT3B 3AODA 3V1OA 2IJNA 2DFFA 2A3ZA 1BQMA 4JI2K 1U25A 1N33K 1U1RA 4FXDA 1HNIA 3KIOA 4EIAA 1O6XA 4BR5A 4DUTA 2CQGA 1EKEA 5ETTA 3I56N 3LPUA 5KFAA 1S1TB 3ZX0A 4DV7K 3U02A 1U1MA 1IKWB 2ZDPA 4AFFA 2BOAA 3F73A 4F3TA 5KFUA 2VZ9A 4DQIA 3VAMA 5JJBA 4PWUA 4CF2A 8ATCB 4HUFA 4BWMA 3HHLD 1X3NA 4DFPA 3QWUA 2YI1A 4USWA 1U47A 4BRAA 3ZSWA 3L8BA 3LAKA 2E1MC 1L3UA 3RRGA 4NE9C 1WSHA 3RTVA 3D6FB 4C11A 1DFDA 4X64F 3DYAB 4JKGB 1C1CB 1XTZA 4WFYA 3NGZA 4BROA 1HNXK 3SDEA 4KKOB 4CJ3A 1AW0A 4KHUA 4HTIA 2J0XA 4CEBA 3CDUA 3QZ8A 4ECTA 1FRJA 1MMNA 3J7A1 3HZ6A 4CIFA 3EKSA 1IWGA 4IO9Q 4YOEA 2Z2ZA 1XNRK 2JH3A 5F8NA 1HJOA 1J9AA 3I55S 3R6MA 5C24A 3M2RA 3UQSA 4Y0FA 2HF4A 2LXUA 2BYCA 4DX7A 3OQ2A 4DR1F 4DMZA 4ZVHA 2ZBIA 4M5HA 2ZUAA 2E5GA 2MGZA 2V2KA 4ZOSA 3TARA 4I7FB 4C9DA 4AD6A 2QSWA 1TFYA 1UZHA 4FLYA 2B7CB 1GLEG 4OYXA 3KUGA 5HRRA 5KFFA 5MAOA 4L6V3 3FJ2A 3GILA 2F63A 3KHLA 2P9GA 3VQ4A 4HLBA 3FZ2A 4R8UB 2KZZA 4OJRA 1HRHA 3PLAA 4DUZJ 2FVPA 3R7SB 3QB0A 1TFWA 2KHDA 3K2YA 5C5JA 2O8DB 1KVIA 1YZ7A 1B64A 2HS4A 3UKUA 3QNWB 2JFKA 4KHPF 4DPYA 1Q7YO 5K14A 2GELA 2OD6A 2ADCA 2YH0A 2XYGB 3ZZTA 2NCKL 3O44A 1J2VA 3ID8A 1VR6A 1WEXA 1NO8A 1IKVB 2OJ3A 4ECQA 5KFJA 2H9ZA 1W2BR 3H5XA 4Q5VA 1PC5A 2ATQA 5MLCV 4C0BA 3H98A 5CYJA 4Q2MA 1WC1A 1BQMB 1F5BA 5BN9A 3DGPA 3AJ1A 3CXCM 1HNIB 4ISEA 3LP1A 1N6QB 4RU2A 2KKZA 1GMUA 1UMJA 1Q0NA 3VGVA 3KWGA 1N34K 5AQQA 3PW7A 4DB3A 3QNNA 3W2WA 2VIHA 3A5OC 4A61A 5IWAK 2OEJA 1FTRA 4QJVA 3E1YA 2BV3A 1QAYA 2E9TA 3SNNA 5GAGI 2VYPA 1KFSA 1VHFA 5LXYA 1U4BA 4CLPA 1AB8A 3DN9A 3GFYA 2UUBJ 3VQ9A 2MKSA 3CC4N 3QERA 3MR6A 4JI1K 2V67A 1CC8A 1YTUA 2DFHA 3EVOA 4HT5A 4B9UA 3VGMA 1O51A 1G1XA 2F8EX 5LOQA 2CVEA 1BWFO 3RUBL 4M7XA 1X9SA 1SC6A 4H0VB 4JNEA 3VESA 5ITHA 4X4TA 1S6OA 4Z7YA 3AQPA 2MQOA 4NXMF 1YQHA 3MM6A 4FJ9A 3W61A 4WU2A 2XZTB 2F96A 4Y1DA 3BUZB 1J54A 3SQ1A 2W2PP 4HI2A 4FLWA 4HHJA 2VA2A 3ONQA 1LV5A 3PEHA 2MMYA 3WC0A 3WXMB 2MGZB 3ETOA 4DV1J 4KB1A 4XTTA 1KXPA 1IM6A 1F3FA 1WEYA 1HI8A 3R8YA 3TQ1A 2L48A 3HD1A 5LSRA 4FJXA 3TANA 3IWLA 2AW0A 1ZBTA 2O8BA 3MCMA 1S6PA 3CYMA 1HQEA 2DKOB 2ZDOA 3ULEA 3SCJE 4OKEA 1I94J 4BQLA 3P8BB 2KFZA 3AAPA 1RI7A 3O80A 4CLKA 4ZJOA 3O9RA 3RB0A 4TSXA 1I3OB 3CPWM 3GR0A 3WUHA 3J7ZO 1ZBSA 2RJZA 1L5UA 3OTOF 3R3LA 2GEMA 1N5YB 1T11A 2XBPA 3QJJA 3ZETB 4TLRA 4MFBA 2VFUA 4M41A 2OPQA 4JOUA 4Y00A 1GLLO 1VQYA 3TU5A 1GOBA 4JI2F 5J1NA 4WFNL 1RT5A 4PEOA 5KI6A 2IVOA 5RUBA 1VYAA 1TL7A 1N33F 2DH8A 1VHXA 2M5YA 4ZLLA 3GL1A 4X4SA 4IH7A 3DXKA 4DDFA 3JB9k 3R1LA 1S4EA 3MTJA 3D0HE 2Q36A 2ZM6J 4LBHA 4LRFA 3IO1A 2WBRA 5BRFA 4V19S 3WC2A 2QK9A 3DGPB 2A1BA 4ECYA 3J80U 3ZT4A 1NGIA 4NL5A 3SK3A 2FHJA 3VAFA 4K2JA 1LOTB 1Y3KA 5KT4A 1HWUA 3VQSA 4KGMA 2KRRA 1UL3A 3KG1A 3BGRA 4KAZA 2P9PA 3VALA 4ECVA 2ZH6A 3UDEA 5F41A 5KT2A 4FZYA 2D3O1 1HNXF 4ANDA 1KBRA 1LFPA 3NOGA 3DLKB 4FJKA 3NRBA 1RWXB 1FFWB 3QIOA 5C15A 1VQMN 4U96A 1YX2A 2XHCA 4MKAA 2VA3A 1JJ2R 4LRAA 2FLOA 4YNQA 1XNRF 3O4WA 2ZOGA 3RJMB 5I3QA 1QQOA 1NGHA 1KS2A 2VBXA 3BKFA 2QTWA 5GAGP 1VK0A 1NBEB 2KN4A 2DRAA 1WF0A 4ID5B 2HAIA 2MZ1A 2H5EA 4C6AA 4MKYA 4IDHA 3JXUA 1WSRA 3E9OA 4LF4J 2YWWA 5B0BA 4CHZA 3KLEA 1UA0A 2B0GA 2LVWA 1QSLA 1PJ5A 3MM6B 1FDDA 3KFWX 2QWLA 3MFIA 2CJ9A 3M8PA 4KT0C 3JSMA 2F40A 3X1LB 4JS5A 3RWUA 3BN4A 3HD2A 4TXSA 2MY7A 1NGJA 3K0SA 1VRUA 5KG1A 3EM1A 3V81A 3C6HA 4HDGA 3R7BB 5DG8A 4XK8C 4AHSA 3M9OB 4B3MK 5BRHA 1H1VA 2VQEK 5JVGQ 3K5NA 3KOAA 3GTYX 1WAJA 4YS2A 2E1AA 4CCHA 2GVZA 1HQEB 3ULEB 3ET6A 1K0VA 3CO9A 1KFDA 2FJVA 4KFBB 4B8AB 5BPMA 3M6UA 5DQGA 1K9MO 3T6JA 4RW6B 4IO8A 1FFGB 4BGAA 3BPSP 4E7IA 4CDIA 3U1NA 5AQTA 4LIWA 2W2MP 3AO1A 4EHTA 4MFBB 3K59A 4G6VB 2DO0A 5CD4A 4Z7CA 1T3NA 2OPQB 3A5NC 1KVKA 1M1GA 2GV9A 5TKYA 4WKRA 1TL7B 3KK2A 2W6KA 5AQZA 2OZSA 2HEKA 4I4BA 1BHLA 1LW0B 4JYAJ 1M1KT 3QATA 2N3LA 1IWAA 4CFDA 2V7ZA 2A6AA 1TUVA 4X66K 4QU7A 1WOPA 2UV8A 4NLRA 1BDGA 1B99A 2POKA 4CGIA 1RISA 3SPZA 1WI8A 4DR3F 2J6UA 1S5ZA 4GC7A 4M3TA 2YKMA 3EX7B 1P1LA 1AYEA 3VTIA 3MAAA 5D0EA 2D5RA 3SQGB 3QMLA 1XMQJ 1RLDA 1YJ9N 1MWQA 1RAEB 4QWBA 5FLXY 4IG3A 5T14A 2BM0A 2UVWA 3BGRB 5CABA 1Q9XA 1XQIA 4JI1F 1VQ8N 2SXLA 2EHGA 3EUNA 3F9KA 5D77A 2HGMA 1Y9OA 2M52A 3M2UA 5KT6A 4ID1A 2HNYA 2D69A 3UCZP 3I0SA 2E7XA 2L08A 2RQ4A 3K9KA 3PKMA 3H25A 4KYZA 3WZ0A 2MKJA 4FJLA 1HLUA 5KFDA 2KVQE 4ECZA 4PABA 2UUAK 3PYDA 3FSXA 3C66A 3ZNJ1 1TK8A 4DL7A 2PN6A 2R7YA 4Y2MA 4CIOA 4IO1A 4JI7K 2Q6BA 1XN9A 3HO1A 1OSDA 4FW2A 4LF8K 2WHOA 4K5SA 4MLEA 3TZZA 2G0JA 4JI8J 2OD4A 1LWEA 2IJRA 3GZ7A 3LPEA 1YLXA 4ZCMA 5JUMA 4ZK7M 3M8PB 2PI4A 1EKSA 3JSMB 4P52A 4CBWA 1VAZA 4CI6A 4FJIA 1T9XA 3IFRA 3FMBA 1TK5A 1F9EB 4FF2A 5THWA 4DV2J 3QO9A 1QVGM 4RBTA 4KO0A 4JI0F 2OEKA 1SQFA 1UW9A 2NXJA 2J4RA 5DGBA 1P27B 5GAGU 3FQKA 3LA0A 4HHHA 4W5NA 2GVZB 3BBFA 1T7PA 1X0PA 1VQ9S 2X74A 2MEWA 1YVFA 4X62J 2E6LA 1H6KX 4N76A 2APOA 3G87A 2IRUA 3R6GB 1D9AA 4QYZJ 4OYPA 3C16B 5IZHA 2XLJA 1YJWN 2EFVA 3CSKA 4CT8A 3FZKA 4WFAL 2FTRA 3U1LA 1RAGB 3PACA 4LT6A 4UOFA 2B4VA 1ZM9A 2ROPA 3P5JA 2HBQB 2IVPA 3GR1A 1X4DA 4BC2A 1S12A 1K73T 4DR5J 2YKPA 1TYQA 4OPJA 1H98A 3DI6B 5K8PA 3CJAA 4P74A 3IMXA 2GHPA 3TJAA 2DPIA 3H2LA 3KKSA 3UPFA 4DV3K 1WSFA 4DL2A 5AZJA 5BR9A 5DM7Q 3CFOA 3QEXA 3ADAC 2OZMA 1SV5A 3CJ2A 1BU6O 4R5PA 3EVMA 1BQNA 2H3GX 4PXCA 1FVQA 4GVMA 4EU0A 2V63A 3O9TA 2P6SA 1KQKA 2BJEA 4DSIA 3HCXA 5M1NA 4ZCKA 3CUNA 3SCXA 5AQKA 1U04A 2BVZA 4E98A 4BRKA 4M3YA 2JRSA 2IM1A 4KRWA 4Y1CA 5AQUA 3M2UB 2HQCA 3HP6A 5DZ6A 2KG0A 5KFZA 3NCQA 1C2PA 5CR4A 3I0SB 3HHLC 4OI3A 2AZ3A 2F1FA 2IOCA 2XS5A 2ZJQL 3SPYA 1N32K 1IQTA 1KVBA 1KLNA 3AVJA 3FSIA 3MCNA 1ZS6A 4LR7A 3BQ0A 5AQWA 4PYAA 3WQPA 4EBEA 3I0RA 1RWNB 2MKCA 4P2FA 1HIYA 4L3QA 5IM0B 1DARA 4PR6A 4J2BA 4HUGA 1OY8A 3J81O 1JXLA 4PL7A 2DNHA 4O3SA 3AJDA 2QZ8A 1T6CA 3C6AA 2Q6CA 1YXQA 3BO3A 4DSLA 1CZAN 4NLQA 4YOVA 5JS2A 3VTHA 3ZSZA 1UWAA 4AQYJ 3TEHB 1LWEB 1U6FA 2CNLB 3O3LA 4CO1A 3CD6S 4B3MF 1NZ8A 5CYQA 2C3OA 3AVKA 2G8IA 2R9LA 2G0CA 3OXLA 4XIUA 4KY3A 3MECA 5BR8K 1RWKB 2UXBF 4O44A 4AXIA 4Q8FA 2RS2A 3QO9B 3AVAA 2RRAA 2W9CA 2OUGA 3TX8A 3HM8A 3FKBA 4DS4A 4NYFA 2D3OR 2OANA 1T05A 2DXFA 2J7KA 3AVHA 4H5VA 4DV4J 2Z0GA 2UXDK 2KZMA 2OP5A 3SMPA 1Y64A 1LWCB 4BC4A 2B51A 2M0GB 3MOJB 4HACA 1PGZA 4UQGA 2EI5A 3VF6A 1OPZA 1Y3JA 1NPRA 4DR7J 2AYMA 1P6TA 1Q4RA 3EGNA 1LWFA 1QQCA 4KIAA 3W0LA 2Z30B 3V9WA 1LWXA 2WBMA 1SKUB 1WC5A 1ULRA 1NGCA 3P5TL 4PG5A 3G86A 2VBZA 1EWQA 2YWFA 2G2YA 3LO3A 1HYZA 3T1YJ 1FKOA 2A6OA 2JDJA 4E7HA 2P9LB 1Y4ZB 1N5TA 1RT6A 4JI6K 3C95A 3UFCX 1WTBA 4ZP7A 4C3MA 2ALYB 3KDOA 2FXUA 1FTCA 3G0ZA 5AZJB 3CEDA 1KQGB 4WTYA 4B08A 5DLFA 3D0GE 2JLGA 3C6UB 1UCNA 4P2SA 2E8AA 5M1PA 3M8YA 2UUAF 2WVFA 4H03B 4G9ZA 2GVDB 4M5MA 4DZ6A 3NFAA 2JVOA 2OO4A 3CB4A 4WFZA 2ITGA 3IWNC 4BG9A 3HJVA 1ZM2A 4JI7F 3AGKA 1RSCA 3THTA 2J6SA 3ZLJA 4IOXA 3Q8PB 2B9YA 1QTNB 2N3OA 1IJEB 3G8TA 1C4CA 3SIPB 2WB1D 2CGLA 1VBZA 5EVZA 7FDRA 2RPIA 2HHPA 1NJIO 1HKAA 4P71A 1JXBA 2QX0A 2BKNA 1JB0C 1U24A 4DJBA 2M7SA 4DF4A 2F3JA 4O0IA 5FLXU 3HPOA 2R2SA 1NK8A 4ECWA 1H2UX 3CCTA 2ZHBA 1S9GA 2OCEA 3FFKB 5KG3A 1NK9A 2V9WA 5IT9U 3GWCA 5CYQB 2E1RA 3DOLA 2HFOA 4FXWA 1CZBA 4NLUA 3MECB 5DLGA 5DDRC 4NCGA 2H65B 3VQTA 4XAKA 1U0HA 1RBUA 3GU0A 3AO3A 3ZT1A 4G65A 1Z2ZA 3IRXB 2MHEA 3BR8A 2IYIA 2LYVA 1RTIB 2Z2MA 3LANA 4H54A 3TW0A 3GJSB 2W9CB 4ILJA 1QQMA 4CLFA 1HQUA 2AKWB 3CCVN 4NA1A 3QPIA 1X5PA 4F04B 5F8IA 2AJ2A 2GJ2A 4QW8A 3OTCA 3VQCA 6AT1B 1HR0F 3LP2A 3AA5X 4FWQA 3NHGA 1TL1B 4E8UA 3T5JA 1W2BM 3AHPA 1U2FA 2QXFA 4KSEB 3B78A 2DR7A 4ITSA 4OQJA 4BC3A 2FJAB 3NEKA 4WFNQ 1GLCG 2E1PA 5TKWA 1LWFB 3MMAB 2DNMA 2AYGA 3RB6A 2FVRA 3KHHA 5L1LA 4A8QA 2GZOA 3LM2A 3CFPA 4JRQA 2HVEA 2VH7A 3E8OA 4QIGA 4IEEA 4K4WA 4ID8A 3PG9A 2A3JA 3T9ZA 4J9MA 3D6HB 1RT6B 3MMJA 4H0TB 4EGLA 1BXNA 1FESA 3CTRA 3M9MB 5GAEI 4ERDA 1CC7A 4YR3A 1XNQF 4GY2B 5CY4A 4TY9A 1L3SA 4AM6A 4O5BA 4BC9A 1K1QA 4CZCA 4GMKA 4MO5A 4DUYK 1Q78A 5H9EJ 2I5JA 1VQPN 4WK3A 2FBXA 4G1PA 2BGGA 2EK1A 1TMJA 1N32F 3GJQB 2FB0A 1NOYA 1I51B 2UYTA 1OYDA 5LM7E 4Z0UA 4OGEA 3BEGB 4M7YA 3BBCA 3VQAA 2JLEA 4P73A 2PMZD 5L8RC 4NLWA 1Q16B 2LQBA 3MEKA 4CEDA 4E19A 3CQXA 4DFJA 4CZEA 1CJVA 3LDSA 1S6UA 4CM2A 3HHDA 2HBRB 4JHDA 4QAGA 4QIEA 1NZAA 1HNWF 3VPZA 5LL6Z 1NEEA 4XH4A 2EG1A 5F3ZA 4IQXA 4B3SK 3GFZA 2UP1A 2DNLA 2GMLA 4ZPWR 4DG1A 3OLAA 3SAFA 2HHQA 3WNFA 2AGQA 2HFVA 2AJ4A 3OYMA 3HSCA 4NPOA 1QAIA 5KFTA 3BYPA 2XHBA 4X65K 1S9GB 3AD7C 3NAEA 1QAXA 2W25A 4FYYB 4CVNE 4H4OA 5AQXA 4BRGA 1NK5A 3AB2B 4MJKA 3D5MA 5KFEA 2VPYB 2KM8C 3DLJA 3NS5A 4NCGB 3NGTA 1U0HB 4CO3A 4DSEA 4IFEA 5KG7A 3KK3A 3FNNA 3QWPA 2QO3A 4OKKA 5J2QA 2PD1A 1FD8A 2BDPA 4BACA 2MSSA 1KWMA 4JKEA 2DPJA 5BYSA 4B1VA 3PXGa 2LKZA 1SJQA 3IA0A 3QFUA 4AXJA 5T7BA 2BXJA 4KBIA 2YH1A 3SAGA 2D9PA 1RADB 2CQCA 2RHQB 4ELVA 3WT0A 2CQPA 5FDLA 2KT5A 3UCUP 3VMFB 3IGNA 2NRHA 2OI2A 3ITHA 5B0FA 3NCIA 1R8HA 2VWJA 3PFOA 4ZTFA 3DCAA 3QLHA 2DY9A 3FBEA 2DY1A 3PR5B 2PA3A 2PDAA 5KFWA 4DL0C 3I32A 3OTDA 3FC9A 2R4FA 4JI3K 3KLVA 1RA6A 4YY3F 1Q81O 1E4FT 3TA2A 1WI6A 2ZVSA 1BGXT 4DR1J 1V3SA 3NNHA 2UV8G 3MHYA 3R9LA 2BMBA 4MYTA 3DAWA 3O4QA 4QWCA 4OX7A 3EWGA 2ZE2A 2X1GA 3CCUN 2PYLA 3FZLA 1JNRB 3JXOA 5F0UA 1T3OA 2AX1A 2LECA 2R7UA 3CMES 2ZJRL 4PWWA 2VGMA 2XB2D 2WONA 5GAEP 2HK3A 1YWXA 4RKUC 3L7PA 2BE2A 4LFBJ 2GIRA 1TV6A 2HZCA 3DRRA 2XMJA 3R8EA 1XR5A 4DV5F 2HVIA 2Y8WA 1I6JA 2QA1A 1Q5YA 2QC3A 5DM6Q 3UWTA 4YMEA 3H42A 2BKPA 5KT3A 1YZ6A 4CJFA 1NSKL 3FK4A 3S3MA 4C8OA 1FX2A 4I1TA 4KHPJ 2ZH3A 4U7CA 4FF3A 1SZ2A 3I8DA 3MEGA 4JHDB 1QZ5A 2XWXA 2FF6A 4K0KK 2ZD1A 4EHUA 3NH2A 1KVCA 2Q3SA 1S1UB 1U26A 1SS6A 1VQ9N 1IXKA 4B9VA 3U4LA 1SJ3P 4XEIA 1FJEB 2PT0A 4DG1B 2ZJPL 1HLWA 1HHQA 4WZMA 5U47A 4DV1K 1A0OB 1GX5A 4IRDA 4H4OB 4LFAF 2W41A 2QYCA 2YBVA 3HVRA 4ECXA 3HPHA 4M3WA 4Z2XA 4OYAA 1EJ7L 3ZZ0A 4GVBB 3A3NB 3LPYA 3T1HF 2DHHA 4F4AA 4ZIWA 3UN2A 1YHQS 3GFXA 4NASA 3J8AA 3FBFA 3GPAA 2DHGA 1KLMA 3KK3B 1D0EA 5HANA 3KZBA 1OH6A 4CO5A 1RT7B 2PI5A 1EB0A 3CJTA 4X4NA 5AFUA 2OELA 3U3YA 1QHTA 1Q8BA 4AL6A 4Y34A 5BXIA 1O5JA 2QT7A 1UJ4A 4I68A 3PW0A 3KNGA 2UU9K 3BKUA 4ED8A 2CGKA 3CWJA 5ETMA 1HBMB 1FJ7A 3I6PA 4OI1A 1JJHA 2K1RA 1NSAA 2XMWA 2UVVA 2XLKA 1VSEA 2RRNA 4UOHA 2Q66A 3ITHB 2MQQA 5GAHI 3WDOA 3D3CJ 3QLHB 4CHOA 3BSAA 5HOOA 3UDCA 3G71S 4NXMJ 1ZAXA 4DUYF 3CF5L 3EL2A 1BQXA 3H90A 4Z4GA 1F3VA 1JKHA 1HX1A 1G15A 2AEFA 3Q0AA 2G4BA 4CW7B 4ZIVA 5HBMB 4RR5A 1NSQA 4QR0A 5AQYA 2A41A 1HHSA 4KAIA 1U02A 3FVYA 2E20A 2ZE2B 5CE3A 2BJ1A 4FZXC 2NREA 2QGFB 4KE5A 2GX9A 1NLKL 3JSYA 4OHYA 2XSJB 3L2UA 2VL1A 3N4PA 2CQ2A 1VC6A 1XK8A 4LUBA 2HHTA 3ENAA 4YOWA 1HFEL 4OI2A 2QA4G 1VQ5S 1TV6B 2K8GA 1VRTA 1EX8A 2IS3A 3G6VA 3PO5A 3CDWA 4XDDA 2DNOA 4YB1P 4B3SF 3OTOJ 3LL3A 4CEZA 2A0FB 3HT3A 1SJ1A 4JKAA 3J81Y 1YG0A 4CK1A 1F0XA 2KT3A 4BC5A 3EE8A 4LR9A 5LMNF 4IXCA 2EC2A 2HG4A 4CO2A 2OTLN 4OHVA 2HPUA 2E2PA 3TX0A 4X65F 2B4JA 4JI2J 2ZD1B 5LMUK 2HGNA 4LRBA 1N33J 5BYQA 2Y9HA 1X0FA 3BSCA 3DXMA 1I5OB 1R27B 3G25A 3D2FA 3SSSA 5L39A 2DEJA 3HHEA 1M1KO 5GAEU 3D45A 4DV7J 2R7TA 1ASWA 2LQ5A 3FR0A 3ZZYA 4CTAA 4CYUA 3SUNA 2MQLA 1UWBA 3CM6A 4DX5A 3RZAA 4KRFA 2HNDA 4EEYA 2BJ7A 2AGOA 1XIQA 3R3TA 4B9TA 2QI2A 1B0VA 1HNXJ 3LWLA 3BP8A 1SL0A 2DXEA 3DMJA 3A8EA 4WP3A 1OQ6A 3DLBA 1XQSC 2WSCC 5AE2A 1VQNS 4LREA 1EWRA 3IDHA 3OHBA 3AAWB 1EHWA 1XNRJ 4JS4A 2AT1B 1TVRA 4KHYA 4B1XB 1YI2S 2KO1A 2B9WA 1S79A 1YAGA 3GB0A 1KC8O 4C3KA 2HRYA 2HOEA 2F9WA 3T7ZA 4KHWA 2B7BB 3C15B 1HD1A 2CQDA 1JNZB 3HM9A 3AH6A 4A8SA 5AFUH 4W5TA 2OSRA 2Y1JA 3FE1A 1EX4A 3MFHA 1XMOK 2HRTA 3EO3A 2AIRB 5GAHP 1XMQK 3S3OA 3KK7A 1WG5A 2WSFC 1U6ZA 2VGNA 1JK9B 1FW6A 4FZVA 1UW4A 1FRXA 4MMOA 1R59O 3QGIA 4USIA 1S6QB 2MHNA 2NXNA 1C0FA 2NSBA 1TUUA 1UFLA 4USMA 3BDEA 3G96A 3VQQA 4M45A 3R2DJ 1MU2B 1JQGA 3S8SA 1SBRA 1U6BA 3HMJG 3LDNA 2MKIA 1WSEA 1NH8A 4XH5A 5D4LA 4FPIA 3PX0A 2JJ4D 3PV8A 4K0KF 2N82B 4XDCA 3KJVB 3UD5A 1NJXA 1GH8A 4OI4A 5DZ7A 3CJKB 3EZUA 3MWPA 3THXB 3QJLA 2RQKA 4FVCA 1ZM4A 1CLQA 4CJEA 5G0RB 3CD5A 2HQ3A 1EETA 3Q89A 3CM5A 4YDUA 2KXHA 2MQ8A 1RJJA 3PEJA 5J2NA 1BA1A 3M05A 5E7OB 2LEAA 1K73O 1U1KA 3KD1E 2J7WA 1CXUA 4E7JA 1S5JA 1S9EB 3IAS9 1JLGB 3OT9A 2J0SD 4CEEA 3V9ZA 3H1QA 2HMPA 3NMAA 4UY85 1CS4B 4MAKA 4WQ4A 4DR3J 4DTOA 4N8OA 4CTAB 1P90A 4CYUB 1UWBB 4HH1A 4PL8A 4CLSA 4H5WA 2AJ1A 1FDBA 3DWLA 2JEIA 2XZWA 2UU9F 3WX4A 2HNDB 3DDIA 1PBUA 4F4WA 3RGIA 3M3ZA 4PHTX 3VOVA 3TZXA 4JI1J 3F0NA 5D6GA 1VBXA 4CJ5A 4QCLA 2E6MA 4JKFA 3LDLA 2NUHA 1SH0A 3W8GA 5F8GA 3VZHA 1GLFO 4BRHA 2H3EB 4KB7A 2RD5C 2X1FA 4K4TA 1TAQA 1KTVA 4WF9L 1SH2A 1NHVA 4PY5A 3BZKA 3DLEA 1RACB 1TVRB 4R25A 4OGCA 1C1BA 4LIRA 4BR9A 1NPPA 3Q86A 4OZLA 4F2RA 3KLHB 4ATNA 4ICLA 1U09A 2BRLA 3OPKA 2WOMA 4I64A 4CZLA 3QDKA 2W9BB 2LEBA 5AE3A 1H7WA 2PAVA 4NLVA 1QTMA 4YB6A 2VFSA 4YFUA 3S3NA 3ZT2A 4CD3A 3T3FA 1W7AA 4EBDA 2P9KA 4C8NA 5AQLA 3TAEA 4RBVA 1K8AO 1VQ6S 4JP8A 1WOQA 2XLIA 2M88A 3CC2N 4HVJA 1T9UA 5MLCQ 2K06A 3NAHA 1VMBA 3I5CA 3CW2C 4YEAA 3VEOA 4ZN1A 3HPGA 4CJSA 4FNHA 2QWNA 1M5PC 1S7HA 3B8AX 1RA7A 2LQ8A 2F7TA 3OTEA 3W5YA 2ZH9A 3M2VA 3AB4B 3D68A 4NLXA 3G4SS 1RBVA 1F9FA 3W9JA 4DV0F 2R7VA 1Y5IB 2E1CA 1GOCA 3NGUA 1Y97A 5HAOA 4NOHA 5D0GA 1P9YA 5LMUF 2DB1A 1KRPA 1OH5A 5M1QA 5IFMA 2WUSA 1URRA 5F8MA 4I9LA 4J2EA 4KH6A 4YDDB 1BI4A 1ESVA 4ZHRA 2IDEA 2WVBA 1OO0B 4CF9A 3HL8A 3RMDA 5M2UA 4AQYK 2V52B 2HHUA 6FD1A 3CG7A 3VEWA 2WTUA 2EFOA 1LEOA 2LDIA 4D3HA 2OAUA 3OUYB 5J2NB 2R2UA 3O9QA 1VSJA 1K47A 5KGXA 2V8VA 2DNRA 4LBIA 4RW8A 3ENBA 4CJKA 3OD2A 3R1XA 3CXCR 3JQJA 3CPEA 2MSTA 1S0NA 4JN4A 3OVSA 1HWLA 3J7ZT 4QS9A 2FJWA 3PRVA 3HRGA 2IA0A 2QWPA 3KYLA 5AQNA 1YRTA 3J81U 3MN6A 1YITN 4LSLB 3IG1B 4PZVA 4YOTA 3D9BA 4URGA 1VSMA 5FD1A 3C6TA 4BBYA 4DR7K 3W7BA 4KHQA 1WD6A 1RDCA 3GLJA 2EXUA 3Q83A 1BUPA 2XGQA 3QFHA 3EICA 3CMEN 1Y5LB 2GMHA 5A0YA 2JX2A 4HHUA 3HX9A 3T1YK 3I5BA 3TAMA 3DLEB 4LF9K 1XMOF 2CAJA 2YNIA 1YBTA 2G8HA 2ATCB 2QLFB 5EX3A 4F3QA 3N5BA 1JL2A 1S1WA 3PRDA 1FKPA 4USHA 4ZVEA 2VHGA 1AZSB 3M8QB 3H08A 1T9VA 1RDBA 3CC7S 7AT1B 4B3MJ 3C94A 2D0CA 1ZBIA 4Y28C 2VQEJ 1VDHA 1D4XA 2P9KB 2OTJN 2B8PA 2ZITA 1YIJS 2ZJRQ 3GFHA 1RGVA 3W65A 4F3OA 4KH5A 2JEJA 4O55A 5GADP 2DYAA 3PFEA 4DFKA 5EWEA 4ZVFA 3DRXA 3PHEA 4DXLA 1JLAA 1A5XA 1YRUA 3CPWR 4KHMA 3RBXA 4IR9A 4ELTA 3VETA 4W5QA 3OYLA 3V4IB 3ZX2A 1BY9A 1U1NA 3LOUA 1BI4B 3WBZA 1XC3A 3W9HA 2ZWHA 3DJCA 1WEZA 2VOOA 4LFCK 4K8RA 4X66J 1F2HA 2XCPA 1S57A 3SI6A 2Q97A 3MCOA 3RAXA 2CRLA 4FM0A 3DLLL 3VA0A 3J7YP 3SSQA 2WFBA 5CH7B 3DU5A 4W98A 4E1JA 4DQ8A 2G8WA 4N41A 1NHUA 2PBDA 1MN7A 3P39A 3VGSA 2FPHX 3T6BA