2YNIA

Hiv-1 reverse transcriptase in complex with inhibitor gsk952
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 163
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yniA05
1Q9YA 5FDLA 3BGRA 4DQRA 4BE1A 4M3WA 2OPPB 4NLSA 3KLHB 5KFNA 4GC6A 3K59A 1C0MA 4CGHA 5HBMB 3GQCA 4ID5B 1LWFB 1C0UA 4J9LA 4O44B 4PQUB 2YKMB 4NLOA 3V1OA 4WZQA 4DFJA 5KFVA 1BI4A 2FVCA 2YV0X 4QAGA 4J2DA 2WOMB 1UOCA 4F3OA 1RT5A 1S1WB 1DTTA 4HCBA 2OPSB 2C2DA 1NJWA 4H8KA 1XR7A 1TKTA 4ZTFA 5CYQB 4IDKB 3BSNA 3RAQA 3H5XA 3SPZA 1RT2A 4O3SA 4KHSA 3OYIA 3BREA 2RDJA 4XO0A 2YNHA 3DRSB 2B43A 4FK0A 1C0TA 1HMVB 3CG7A 2ZE2B 3DYAB 1G15A 2CJQA 5HRPA 2FVQA 1NJZA 4FJLA 4LQ9A 1BIUA 5KFYA 3I5CA 3B6OA 3AO1A 3MECB 3EZUA 4PA1A 3NGIA 3L2RA 1RA7A 1SV5B 3AA5X 1U4BA 3HJFA 5J1EA 3C94A 3LWLA 3DM2A 1HYSA 2PZSA 1S1VA 4YNQA 3RB0A 4B9MA 4CJEA 1NK8A 1BQMB 3SPYA 5KFEA 3KJVA 3V81A 4KSEB 4KO0A 1EX4A 5KFXA 1DLOA 2JEIA 4HYKA 1S9EA 4CJ4A 3I5BA 4Q44A 4B9LA 3D45A 3MR2A 2FVPA 4LSNA 3RAXA 1JXEA 2FBTA 2BANB 3T5LA 2R2SA 3NBPB 3AVIA 1GX6A 4K4VA 4KFBA 2KFZA 4EEYA 3ITHB 4RZRA 3KK2B 2W8KA 2Y1IA 3H4DA 2HW3A 5CYMB 1ASVA 4HCCA 4CIFA 3AVMA 4FS1A 4IH5A 1S9FA 5KFLA 4URQU 3KLEA 3CJ0A 4O0JA 3DMJA 2B5JB 1W9HA 3ZSQA 4JS4A 4IR9A 1N48A 1A5VA 2G8IA 4F2RA 1FK9A 1LWCA 2DTUA 1IKWB 4ECRA 4IFVB 1FKOB 5EWFA 3M8PB 3H08A 3VQAA 1BISA 3LP2B 3CO9A 2RKIA 3IRXA 4OPKA 1IKVA 2EHGA 3ISND 2WONA 5C24B 4J9QA 3ZSWA 2R2RA 4O4GA 4ELUA 1S0OA 3VQ9A 1ZYQA 4ED0A 1NOYA 1L5UA 3NF6A 1L3UA 2P5OA 1QSYA 3H5UA 4LY7A 4KE5A 4DTOA 2ILZA 3V6KA 1L3VA 4M42A 2HHQA 1XR5A 1IKYA 3OS0A 2R8IA 3U6FA 2GIRA 3OYFA 4J2AA 4CFCA 3AO2A 2KFNA 1WSEA 4FM2A 1X1PA 3K5MA 4MK7A 1NOZA 3V9SA 4M94A 2VWKA 3HL8A 1LW0A 4F4WA 3DLRA 5DQHA 3UQSA 3VQCA 3QLHB 4ZPDA 3EY1A 1RBUA 2FLLA 2XY5A 1U48A 2VG6B 2A1SA 3UDLA 3H2LA 5J2PB 1O1WA 3JSMB 4K4TA 3IG1A 1RTJB 4NLDA 4KAIA 3KLIB 1VSMA 3DRRB 4CHOA 4FCYA 4IR1A 2IOCA 3CM6A 3SYZA 3DOLA 2FBVA 4E3SA 4I7FA 1NK9A 3LAKA 4BDZA 1NJXA 1YVFA 4ED3A 4HTUA 3CVKA 1BQNB 1J5OB 4CHYA 4FLVA 4O4RA 2I5JB 4QW9A 1WSFA 1TKZA 3LP0B 3L2VA 5DLFA 3QINA 5EWEA 3LANA 3QIDA 3M8QA 3GV7B 4FLWA 2DFHA 4BDYA 2QV6A 4J9RA 4IKAA 2ZKUA 3PZPA 2F96A 3KHLA 4OKEA 3U3GA 1SL1A 3LP1A 3HSTB 2V4QA 2B6AA 3DOKB 2ASJA 1ASWA 1KVCA 1RT6A 1EKEA 1KLMA 3I0RA 3CQ8A 4M3YA 1R0AA 2BRLA 3N6NA 2IDOA 3PR5B 4DL6A 2OPQB 4RNNA 4DTNA 3PJXA 5DK5A 4CJWA 3K58A 1HNVA 4GMJB 4U7CA 1B9FA 4NCGA 1XI1A 3LAMA 3VQBA 1X9SA 3RB6A 2BQRA 2QKKA 4DTUA 4CFBA 4J9NA 4CF9A 5K14B 4EYIB 3HPOA 2YNIB 5I3UA 3M8SA 4DSIA 4FS2A 3WNHA 5KFMA 5KT7A 4FJ8A 3H5YA 1N5YA 4E7JA 3FSIA 1SH2A 4DFMA 2DPIA 4E7LA 4LH4A 2XC9A 5DGAA 2XGPA 4AHSA 3EYZA 5J2MB 2DFEA 4K50A 4WFZA 2HMIB 3KK1B 4NLYA 3QEWA 1N4LA 5KFDA 4NLWA 3ULDA 3TAFA 3RMBA 1C1BB 1UWBA 4FXDA 2WRMA 3SV4A 5DGBA 3UIQA 4CEQA 4CHZA 3O4QA 4DLGA 3OHBA 4O5BA 1CLQA 5KG0A 2YNFB 1HYZA 4F3TA 3MF5A 2AJQA 3ZT2A 1JL2A 3PHEA 3VA0A 1T03A 5C42B 5KG6A 5C25A 4KKOB 3PVXA 4CFDA 4DTSA 3NF9A 2JC1A 3OYBA 2AGOA 5KFIA 5KG1A 1EETB 1WSJA 4CGGA 4RW7B 3RMAA 4RW4A 5F9LA 3V6DA 2O5DA 1ZTTA 4KTQA 3E01A 2B4JA 4BE0A 3CIZA 5KFAA 4Q0BA 2XCAA 4KB1A 2F8EX 1IG9A 2HWIA 2HHTA 2KW4A 4N41A 4MKAA 1BL3A 1JLQA 1RT4B 2FJWA 1TQLA 2HNYB 4EO6A 1B92A 3NCIA 5EWGA 4HUEA 3OJUA 3GIIA 3SUPA 4ZHRA 1S0MA 4KTWA 1U45A 4RW6A 4C8KA 4YR0A 1JLGA 1ZTWA 3V6HA 2D0CA 3OYAA 2HHUA 4H4MA 4MFBA 4E7HA 2FBYA 1S1TA 3DLBA 1ZBFA 3RR8A 5KFCA 3DLGB 3V9ZA 1LW2B 3BSCA 4JV1A 4CJUA 1A5WA 5FDLB 1NK7A 4PUOA 1QUVA 1HPZB 3ZSVA 4M3RA 4LSLB 4Z4GA 3ZSOA 3GIKA 1HQUA 2UUWA 4WFYA 3GIJA 1Z4UA 2IAJA 3ZSYA 4G1QA 5KFFA 3JYTB 1RDCA 1RT1B 2P1JA 3AA2A 3OS1A 3DRPA 2P51A 1RBVA 1J9AA 3KLFA 4H4OB 4PWDB 3FFIB 3G6VA 3ZT4A 1RT3B 1TKXA 3ISNC 4B9NA 4F8RA 2BE2A 5J2NB 4RW9A 3TAEA 3NH0A 3GILA 4RUCA 4DQQA 1RYRA 5KI6A 2JGUA 3SV3A 1SH0A 2YNHB 1U04A 1C0TB 1JXBA 2VG5A 3D5MA 1C6VA 2C28A 4K4ZA 3TWHA 3MR3A 3E51A 5KTQA 5HLFB 3SJJA 2IM1A 3SCXA 1A5XA 4RNMA 3OYNA 4CIEA 4KHNA 1VSIA 2FBXA 1KSPA 4FLXA 4ECXA 3FQKA 3HVTA 1JLAB 3AVBA 1S9GA 3PX4A 3QGHA 4FK4A 4IG0A 1Y97A 4B3OA 4YP3A 4CJVA 4EBCA 3DLHA 2RDIA 4N76A 1D5AA 2AWZA 2HNZA 1HYSB 1KVBA 2PY5A 3KMSA 5FRMA 1EXQA 2D3UA 3CFRA 2AGQA 4EZ6A 3GYNA 2VG7B 1EP4B 1S1XB 4DL5A 4K4UA 1S9EB 3V4IB 4E0DA 5HRNA 3ALYA 4NCAA 5I42B 1T05B 3P5JA 1HQEA 1DTQB 5F8JA 4I2PB 2IJNA 3PV8A 4FBTA 4IFYA 2HHSA 2ASDA 1JLEB 4Q43A 3K2PA 3F9KA 2XHBA 4DSKA 2FC0A 4O3PA 4FZYA 2YKNA 2HHWA 2OPRA 3TAMB 3KKSA 4CF1A 1HNIA 4ZP9A 3AA4A 2XWYA 4F4YA 4CEBA 4EP5A 4DFKA 4M3XA 1RTDB 4W5TA 5F8IA 2QE5A 1TL3A 3KLEB 4NLPA 2FLNA 3KOAA 4DG1B 4CE9A 3PUFA 2Z1JA 1IM4A 3RB3A 3AVAA 3AVJA 3L3UA 4DSFA 3H4BA 3CDEA 1FKPA 4CCHA 1FK9B 4ED1A 4YMEA 3TQ1A 3D0PA 1LWCB 4CF0A 3TANA 4IRDA 2WTFA 2DY4A 3TR8A 5L9XA 4YR3A 3C6UA 3SFGA 2AU0A 2QK9A 3QIPA 2X74A 5KFHA 4FM0A 4JS5A 2Z1IA 5HRSA 4BDPA 4BWMA 3HK2A 1S1UA 3T3FA 3DI6B 3T5JA 3QNNA 2HAIA 3M9OB 3LP3A 2WONB 1QS4A 4E1NA 2JEGA 3PO5A 4WZMA 5KFQA 4ZVHA 1ZETA 4QWAA 5KRTA 4IQXA 3LZJA 5DMRA 4KI6A 1NKCA 1KTQA 1N56A 4LQ3A 3HP6A 5SWMA 1JLBB 2XY8A 3ZSZA 2OPPA 5DQIA 3KLHA 3RR7A 1TL1B 3LPUA 1UAXA 1QE1B 2J6SA 4Z4EA 5HBMA 1JX4A 2DFFA 4ID5A 4Y2CA 3MR5A 2IMWP 3QERA 4O44A 4PQUA 2YKMA 2W7OA 4Z4FA 4B9SA 2PYLA 4CJ5A 3AVFA 1ZBHA 4ZTJA 3S9HA 4CIGA 2WOMA 1CZ9A 4YFUA 4DL7A 1Z25A 3SQ2A 3KTQA 3S3MA 2JEFA 2KZMA 2E9RX 2ITGA 4KHWA 4CJLA 1S6QA 3EPGA 2ALZA 3V9XA 5CYQA 4IDKA 2E6LA 4FZXC 1RBSA 4ZPBA 1ASUA 3T1AA 3DRSA 4OVLA 2ASLA 1RCHA 4AHUA 3T5KA 3WNFA 1REVA 4R8UB 2RN2A 1HMVA 4JV0A 2ZE2A 4I7FB 5KFWA 2Z1GA 2I1RA 2UUTA 3FRZA 2R2UA 2WCXA 4KHRA 2FLPA 4FJGA 4FBUA 3S3NA 1Q9XA 3Q8SB 1BCOA 3PW2A 1SV5A 1TKZB 1WSIA 4F4XA 3RRGA 4CEOA 2KZZA 5T7BA 3QEXA 4XIUA 3VQ4A 3QGGA 4FW2A 3M8QB 3HPHA 3Q8QB 2E9TA 1U47A 4OJRA 2R7YA 4NLVA 5KG4A 3KLVA 5L1JA 2RF2B 1X9MA 3NHGA 5KFRA 4Y1DA 1XHZA 2OZSA 3LP1B 4K8XA 2R8KA 4O0IA 2J6UA 4TSXA 5KFBA 1IKXA 1T94A 1C1CB 4Z4CA 3DDKA 4KHMA 4GC7A 4E89A 3NAEA 3I0RB 1ZBLA 2BANA 3OYJA 2OA8A 2UVUA 1UA0A 2C2EA 4FLTA 1BCMA 1RAJA 4DTJA 2XI2A 2FVSA 4FJXA 1RTHB 5EDWA 4I2QB 1VSHA 4X2BA 3MEEB 1JLCB 4TY8B 3KK2A 4FJ9A 4NCGB 3MXMA 5CYMA 4ICLB 4FZZA 4TQSA 2W9CA 1C2PA 4BACA 3OJSA 4Y34A 1LAWA 4C8NA 1RILA 4JRQA 1QAIA 3CJ4A 4EZ9A 4M3ZA 1K6YA 2B5JA 5KFKA 4CJPA 1TP7A 3QEVA 4ZMMA 4DL2A 3KKRA 3IS9B 4QCLA 3CJ3A 3VA3A 4FYDA 1IKWA 2UVRA 4IFVA 5F8LA 1FKOA 4CHNA 2R8HA 4UQGA 3M8PA 1SUQB 5KT5A 1L3TA 4QWBA 3LP2A 4F2SA 3OSPA 1W0HA 3OYDA 5F8MA 4YQWA 4TQRA 2IGIA 1TVRB 4CF2A 2GBZA 4E1MA 1S10A 3TAPA 5C24A 3I5AA 2F8SA 1UWBB 3S3OA 1T7PA 1WNSA 3HHKA 4WXOA 3Q8PB 3M8RA 4KI4A 5D3GA 1BGXT 5J2QA 3LZIA 4ZPCA 3WNEA 3CDWA 5EU7A 4DWIA 2W9BB 3G6XA 3AO3A 2YNGA 1TV6A 2XI3A 5CZ2A 4E7KA 2AQ4A 4URGA 1QQCA 4MIAA 2IC3A 2RPIA 1Z26A 3AO4A 1TK5A 3U3YA 3QLHA 1XWLA 2WK4A 3PW5A 4L8RB 1LV5A 3V6DB 4ZP8A 1QSLA 4OGEA 4KHQA 4NLRA 3E01B 3MEDB 1RTIB 4FW1A 2VG6A 3O4NA 4KBIA 2HNDA 3AO5A 2ZD1B 3NE6A 1TK0A 5J2PA 4DTXA 2AX0A 5JXSA 1RTJA 4CEZA 4RW8A 3H40A 1F21A 3VQEA 1Q8IA 4PY5A 4WE1B 2GV9A 2OH2A 1QHTA 3OLBA 3RMCA 2D5RA 2IA6A 4ID1A 4HUFA 3SUQA 4R5PB 4DS4A 1HARA 2BGGA 3OYLA 1S49A 3VQPA 3BJYA 3KLGB 3OSNA 4NLQA 4NCBA 2KQ2A 4CEFA 4H4MB 2BQ3A 3BSAA 1S1TB 3PX0A 1J5OA 4HKQA 2ETJA 1SKRA 4GW6A 3CJ5A 4OL8A 3HO1A 2I5JA 3LP0A 5F8GA 4DSEA 4DTRA 3ZT0A 3HM9A 1LWEB 4ED7A 3I0SB 1VRTB 4IG3B 4M3TA 2G8KA 3A2FA 4M3UA 4IRKA 2IAJB 5KRSA 2HVHA 4C8LA 4O3NA 3KHHA 3L2UA 4K4WA 4CJ3A 3QEPA 1XR6A 4DLEA 4TXSA 2VWJA 1U09A 5HP1B 1RDRA 3MXIA 1K1QA 1N6QB 2VA3A 3NFAA 4B9UA 1TKXB 4QW8A 2OPQA 2CKWA 4K4XA 3QZ7A 4RW9B 3SQ0A 2G8VA 1RDDA 3KK3A 3ICLA 1VSDA 1BIZA 2BR0A 3OY9A 1JLFB 4B9VA 1KVAA 5DG9A 5K14A 2YNIA 3NAIA 2D7SA 4MK9A 4FLUA 3F73A 3MEGB 2AX1A 5KG7A 4ED2A 1VRUB 1ZBUA 3DLKB 3QO9B 5HROB 4FJHA 4AHVA 1ZBIA 4KB7A 4F4KA 4DTMA 1RT7A 5CZ1A 1MU2B 3MR6A 1S9GB 2WHOA 1NKBA 1JKHB 3PX6A 5KFPA 1NKEA 3ZSXA 1GOBA 5J2MA 4DMNA 4KTZA 4CJSA 2HMIA 2HNZB 3BGRB 3PO4A 3QEIA 3KK1A 3BQ1A 1KHWA 4XPEA 4ZP6A 3UPFA 1C1AA 1C1BA 4XPCA 3PY8A 3V1QA 2FJVA 3K57A 4RU9A 4CESA 2E9ZA 1C0UB 3H59A 3PW0A 1HQEB 4DF4A 4FJNA 2X6SA 1BI4B 5L1IA 2YNFA 4J2BA 3SNNA 3OLAA 3NAHA 1RT5B 4TLRA 5C42A 1DTTB 5C5JA 4KKOA 4C8OA 4BWJA 3PR4A 1TKTB 4JV2A 3VQSA 2YKNB 4CJKA 4ECYA 4CGDA 1U49A 1HNIB 1RT2B 3LPTA 3VQ5A 4RW7A 4KB0A 1J54A 4NRUA 4ELTA 3AVCA 1VSLA 2YHAA 2XY6A 3P83D 3VQ8A 4OGCA 4B08A 2AGPA 4CHPA 1FKPB 3QYYA 2HHVA 2HNYA 4GVMA 3C6TA 1NK0A 4KREA 3MFHA 3PW4A 3BR9A 3KHGA 5L1KA 3V6JA 2E6MA 5HRRA 4NLXA 1D8YA 4QWEA 4DQSA 5J1EB 4Q45A 2G8WA 3DM2B 3O3HA 5F9NA 1S1UB 1S1VB 1JL1A 4DQIA 4ECQA 1B9DA 4O3QA 2F8TA 3THVA 4E7IA 3ZT3A 2XY7A 3KJVB 3V81B 2FJXA 4KO0B 1J53A 3EZ5A 3KD5E 1DLOB 3DLGA 5KFOA 4OLAA 4URSA 2D41A 3VQDA 3OYEA 1KLNA 1LW2A 2D0AA 4NLTA 4W5OA 2QXFA 1S48A 2E4LA 3SUNA 4LSNB 1HPZA 2O4IA 4B9TA 4LSLA 1KFDA 4TYAA 2OYQA 4FJIA 1K1SA 1BHLA 2XGQA 4IOBA 3SQ1A 4KFBB 1KFSA 3OL7A 1VSFA 4HVJA 5DG7A 3O3GA 1QAJA 4CEEA 3GIMA 4J9PA 1TK8A 3JYTA 3QGIA 3VN5A 1RT1A 1OS5A 4OPJA 2D0BA 2ATQA 5JUMA 4H4OA 4F4ZA 4ECSA 1MMLA 4PWDA 2A1RA 3FFIA 3NGYA 3QETA 1RT3A 4OKKA 3DMJB 4G3IA 5KT3A 3TI0A 1S6QB 5J2NA 5KT6A 1I39A 4MKBA 2GC8A 1HRHA 3Q8RB 3SFUA 1HJRA 4K8ZA 4U6PA 4ZVEA 1S0NA 4NYFA 3DLEA 1REVB 4KV8A 3OHAA 3P1GA 1WSHA 5HLFA 4QOZB 2LSNA 4FJMA 1I3AA 1S97A 2RKIB 4NZ0A 3IRXB 3RWUA 1S6PA 4M95A 3VQQA 1IKVB 3BSOA 3QNOA 2YHBA 1JLAA 3L3VA 1JXLA 4OLBA 1RDAA 5SZTA 4O4GB 4CJFA 3TAQA 1NHVA 3GV8B 4DU3A 1SL0A 4CECA 5FRNA 4NLUA 4CERA 2VA2A 1IKYB 3LALA 1CXUA 4IH6A 4ED6A 4K4YA 2VG7A 3SI8A 1VK0A 4FJ7A 1EP4A 2HHXA 1S1XA 4TY9A 1LWFA 4EYHB 3V4IA 4W5QA 3K5NA 1GX5A 5I42A 4B8AB 1T05A 1LW0B 4NYNA 1IKXB 4CJTA 3NKYA 1DTQA 2P5GA 4AHTA 4I2PA 4NYZA 4MIBA 2C22A 4DQPA 4MH8A 1JLEA 3SUOA 3EPIA 1S1WA 2X6NA 4CEAA 4I9LA 2BQUA 2OPSA 4J9KA 3V9WA 4EO8A 4FJJA 5KT2A 4DEZA 4RNHA 3AVKA 3H98A 3TAMA 3VQ6A 4EBDA 4KAZA 3ZSRA 4CK3A 3IG1B 3NMAA 2W9CB 5CY4A 1RTDA 1XC9A 1VSEA 1S4FA 3SI6A 3ASMA 3LWMA 3TABA 2EC0A 3DOLB 4DG1A 3NL0A 4Z4IA 3DYAA 1RA6A 4CJQA 5E41A 3CYMA 2XRIA 1HYVA 3O3FA 3ZT1A 4OKJA 1UA1A 3AVGA 1GOAA 4DU4A 4KHUA 4ECVA 3MECA 4O3OA 4FJ5A 3OYHA 3V1RA 5KG3A 3NH1A 2PYJA 3QIOA 3ZCMA 4N56A 2XO7A 1SKWA 1CZBA 4DSJA 2XCPA 3N6LA 3DI6A 1NK6A 1BQMA 2DPJA 4MK8A 2G8UA 3MAQA 4Q5VA 1SKSA 1WSGA 1KCFA 4CK1A 5T14A 4C8MA 2FVRA 2B6AB 3FDSA 1WNEA 5JS2A 3BQ2A 5D3GB 1NNDA 3L2WA 1RT6B 1KLMB 1JLBA 4O55A 4AHRA 5J2QB 1R0AB 1TL1A 1NHUA 2HVIA 2G8FA 3NBPA 1QE1A 3AVNA 4R0EA 2QKBA 3FQLA 2R2TA 3OL8A 4AHCA 4Z4HA 2YNGB 1TV6B 3OVNA 4KHYA 1HNVB 3CFOA 3ITHA 2UVWA 4H54A 4DFPA 4FVMA 2IC3B 1D9DA 3OYMA 2V4RA 3K5OA 1LAVA 4QWCA 2UVVA 4RUAA 2O4GA 3G10A 5I3UB 3PJWA 1TAUA 4J9OA 2HNDB 1T3NA 1N5YB 2X78A 4DF8A 1TAQA 2W7PA 3HKWA 4KPYA 2WB4A 4RW8B 4CEDA 1RNHA 3CJ2A 1TGOA 4R8UA 3OYCA 4ZP7A 1KRPA 4CF8A 4WYWA 4QPXA 3VQ7A 1JIHA 3RTVA 4ECWA 1NJYA 5DLGA 3RBDA 4AILC 4J2EA 3RB4A 5DG8A 4CHQA 3KD1E 4W5RA 1TKDA 3H5SA 3HPGA 4ED8A 4JUZA 3QESA 3OL9A 1WLJA 1T03B 1X9WA 3KMQA 5C25B 2RF2A 4Q8EA 5L1LA 5KT4A 1QTMA 4DU1A 1WAFA 3GV5B 1WN7A 4DSLA 1C1CA 4EP4A 1YTAA 4M41A 2J6TA 4RW4B 1T8EA 4ZPAA 4ZVFA 3IGNA 4EBEA 3MTKA 3M9NB 1RYSA 1RTHA 4I2QA 4Q0BB 3NH2A 3MEEA 1JLCA 4CFAA 4TY8A 3HT3A 3KK3B 3JSMA 4WXWA 4CGFA 1JLQB 2ILYA 4ICLA 1RBRA 1VSJA 4Y2AA 3KLIA 3NF8A 4LD0A 3DRRA 4RNFA 4ZHRB 2IJFA 4RW6B 1JLGB 5DQGA 3CWJA 3TARA 1D1UA 4JRPA 3RMDA 2V9WA 4MFBB 5KFZA 2R8GA 4RG8A 3IS9A 1RT7B 1BQNA 3D28A 3OL6A 3OYGA 3CDUA 4TN2A 4FLZA 3OS2A 3B6PA 2OZMA 1SUQA 4BE2A 4PUOB 3IAYA 4CJRA 3CM5A 4W5NA 1TVRA 4IRCA 5KG2A 2BDPA 4LH5A 4ECZA 3K5LA 2IS3A 3AV9A 3MXJA 4Z0UA 1HQUB 4NRTA 2W42A 2C2RA 4ZVGA 3IN5A 2IM0A 4K4SA 5KFSA 5FROA 2Z1HA 2ZQBA 3L2QA 3SQ4A 5KFUA 4G1QB 2Q3SA 3DOKA 4N47A 4DL3A 1IO2A 4J9MA 2IBKA 4FM1A 3HVAA 3KHRA 4CK2A 3DRPB 2G8HA 1W25A 1RDBA 5KGWA 1L3SA 3KLFB 4TYBA 3AA3A 2W9BA 4FJKA 3TVKA 2BE2B 4FLYA 5KFJA 4CGIA 3NGZA 3HXMA 3G6YA 1KHVA 3UR0A 3KNAA 2JC0A 2VG5B 4KRFA 1IH7A 2HB5A 3MEDA 1RTIA 3HYFA 4DS5A 2JLEA 4B8CA 2ZD1A 4DL4A 3CFPA 2GUIA 4F50A 1WAJA 1YTUA 4I9QA 3HVTB 3C6TB 4WE1A 2V0NA 4IG0B 4IKFA 2R8JA 4ELVA 1CSJA 5F8HA 1D0EA 4B3OB 3AVLA 4JLHA 1S5JA 3T19A 4AH9A 4WYLA 1XHXA 4R5PA 1CXQA 1D9FA 5JS1A 2Y1JA 4Y1CA 3HP9A 3NF7A 3KLGA 3RRHA 4RNOA 4M45A 3C95A 1FXXA 3RBEA 3WNGA 4N5SA 4CGJA 4J9SA 2JEJA 4HHTA 5KG5A 1NK5A 3OYKA 4YR2A 3IGVA 4IFYB 1LWEA 3I0SA 4Q8FA 1VRTA 4IG3A 4HUGA 4NLGA 3T5HA 4FK2A 4DTPA 3LDSA 2IM3A 2KTQA 3NGDA 2W8LA 2OPRB 5KFGA 3KIOA 5F8NA 4E19A 4WFXA 3NDKA 1EETA 2IM2A 2EX3A 3I8DA 2W9AA 1SL2A 1SH3A 5HP1A 4ECTA 1N6QA 3AVHA 1YT3A 3BQ0A 1TL3B 3M9MB 4IBNA 2ATLA 3TAGA 3N6MA 2HWHA 1QSSA 1RT4A 4QWDA 4Y3CA 5KGXA 3PW7A 1JLFA 3G0ZA 2GIQA 1ITGA 3DLEB 4KV8B 3QZ8A 2D3ZA 3C6UB 1NK4A 3QIPB 3SZ2A 1RBTA 3MEGA 1VRUA 5EUHA 3DLKA 3QO9A 2NUBA 5HROA 3HVWA 1S6PB 3L8BA 3G86A 5KFTA 3HVRA 3MFIA 1MU2A 2BRKA 1VSKA 4O3RA 1JKHA 4IH7A 4MQ3A 1I6JA 1YVUA 3V9UA 1GOCA 3BDPA 4ECUA
chains in the Genus database with same CATH superfamily
3Q8UA 5AQUA 3BS9A 3IAM9 3BGRA 4KGZB 5CE3A 3O1BA 3U1LA 2OPPB 4CH1A 5KFNA 2R7QA 1HR0J 3NGKA 3WT0A 1QTNB 2H5JB 5HBMB 3FBCA 3D2EA 1YI2N 4OYAA 2JNJA 4PQUB 2QG9B 3QRRA 3GE9A 4Q2MA 4WZQA 5E0OA 2ZM6K 2FVCA 2J7UA 4QAGA 4J2DA 4JI1J 4E98A 4KHPF 2C2DA 4FPIA 2B9WA 1TKTA 1MMNA 4CO4A 2VDIA 2KKHA 2LQBA 3BSNA 4O3SA 4KHSA 2RDJA 3S6EA 2YNHA 2B43A 2XLJA 2PAVA 2AF6A 2J7KA 4XTTA 3NY0A 1HKGA 3QWPA 1K8KB 4OI2A 5CAAA 4PPZA 4JI7J 1S57A 4YOYA 1P1TA 2FVQA 4C98A 1Q8BA 1NJZA 5AZIA 4NI2A 3PM9A 1UWAA 3RBXA 1G7CB 1TUWA 3MECB 4XDDA 1FFGB 3UKRB 3DM2A 1T0TV 1SJRA 1WOPA 3H90A 2JJ4D 5AQIA 5LJVA 4DUYJ 1NK8A 4CJEA 1BQMB 1RHKB 3G6EN 2C1EB 4QQBA 3UE5A 1YX2A 3D68A 5KFXA 1DLOA 4LF6F 2JEIA 3T9ZA 1S9EA 2Z2YB 4ISEA 2LXFA 3D45A 3NNCA 2C3MA 3OFFA 3RAXA 4CLLA 2KT5A 2UYTA 1SPBP 1WTBA 3NBPB 2XSJA 2ZH9A 1GX6A 1WDDA 2KFZA 1K44A 3UDEA 4RO0A 2YPYA 5HL7L 4RZRA 1UEVA 4FWPA 3T69A 5D4PA 5CYMB 5B0GA 3WXKA 2W01A 5T7LA 3FUYA 1D9AA 1QAYA 4LF6K 5A8KA 4O0JA 3DMJA 2HEKA 1TFWA 1WHVA 4F2RA 4JB8B 4CQ1A 1N32J 2Z4PA 2A6AA 2DTUA 1VQ7S 3ILOA 3QBWA 4ECRA 2XEXA 1JJHA 3WUHA 4B3RJ 1SB6A 2J0QD 3CCWA 3H08A 1N33F 3VQAA 1SVDA 2YH1A 5HMYA 4K7QA 4ZLLA 2DXFA 3IRXA 1UPMB 4OPKA 2X51A 3ISND 3ID8A 4J9QA 1S77D 2QYCA 3MCSA 4RBUA 5M1QA 5CABA 4LIRA 2CG4A 3VQ9A 4QYZJ 4ED0A 3NF6A 1L3UA 4USVA 1QQOA 4WU3A 4ZIVA 3JAMY 3W3DA 5SUHA 1I94F 1P9YA 5BR8K 3I96A 3V6KA 1L3VA 4M42A 5U47A 3OS0A 4OX8A 4CFCA 3AO2A 3K5MA 3BEGB 2DNOA 1N33K 3JS6A 2E5IA 1LW0A 4F4WA 4DR1F 2BYCA 3H0PA 2F8HA 2VFUA 1VJWA 2O3DA 4MDBA 3KYLA 1QD1A 3AOAA 5IWAF 2CQCA 2VPZB 1UVIA 1RBUA 2FLLA 3TSQA 1I94K 2HQDA 3H2LA 1O1WA 5K8MA 1YDLA 4DV2F 5C2GA 4HTIA 2RQKA 4LR9A 3DRRB 1UVNA 1DEJA 4LF5J 1QDUB 1M5SA 1WBDA 2J0SD 2HRYA 2Q1LA 1NK9A 3LAKA 4BDZA 3O8WA 1MMDA 2GJFA 1RLDA 2X1AA 1BQNB 1J5OB 5CQGA 2WVDA 3NG8A 2I5JB 4OHZA 1WSFA 1FRJA 4ZPTR 3L2VA 2FHMA 5EWEA 3VF2A 4EGLA 1S4EA 3QIDA 3M8QA 4FLWA 2DFHA 2BMBA 2QV6A 1IR2A 1BO5O 2ZGZA 2F7VA 2P9LA 4BRPA 3DOKB 1FJCA 1YRXA 4TNOA 1RT6A 3MM7A 5AQSA 1VQLN 4PWWA 3V5RA 3U9ZA 2EK6A 3OQ2A 2ZF5O 1ZOTA 5DO2A 2NXNA 3MMVA 4DL6A 2OPQB 3WX8A 4RNNA 5BREA 4CLUA 2VIHA 1UZDA 2MSSA 3LDOA 4GMJB 1HBUB 2DCLA 4NCGA 3C14B 2M9KA 3RB6A 4DTUA 5MLCV 3HZGA 2H3EB 4EYIB 4DKWA 1WELA 4DSIA 4ANCA 1R8AA 2QO3A 3SLCA 2DPIA 2V67A 2XC9A 5ETPA 3CSKA 4AHSA 2YHWA 5IC6B 3B8AX 2HIQA 5J2MB 2DFEA 2UUCJ 1IWAA 4WKRA 3J7ZO 5B0BA 3AA8A 3KK1B 2H4WB 5D0GA 3AFGA 3IUCA 1FXDA 3IBCB 1N4LA 3ULDA 2PEHA 1UWBA 1PSDA 2CQIA 1SQEA 3SV4A 5DGBA 4CEQA 3O4QA 3A5OC 3OHBA 2P9GA 4WK1A 1OSDA 4J37A 4B3SF 1KQSR 4F04B 4HTLA 2VOOA 4OLPA 2LKZA 4KKOB 3PG9A 3HHLA 3Q2TC 4H5NA 3OYBA 2ZZMA 3LL3A 2GMJA 4LF9J 5E5NA 4RW7B 5FJ4A 5A8WB 1WI8A 2IHR1 3RMAA 1WKLA 4ZOSA 4RW4A 3N28A 1PJ6A 2R4FA 4OZ5A 3E01A 2Z57B 1VFJA 1FTRA 2F8EX 2WBRA 1IG9A 4QYRA 2VU5A 2CH6A 2HBZB 1YBUA 3ADAC 2FJWA 1R0CB 4EHTA 2HNYB 4IDHA 4HUEA 3SCLE 4P9SA 1X4AA 2DK2A 4RW6A 1JLGA 1BC6A 1EAYC 1ZTWA 3L7OA 3SBGA 5LMUJ 1VQNS 2CVIA 4DR3F 3QT5A 2A42A 4RX6A 3RR8A 1HD1A 1CBKA 5ADXA 2MKJA 1TELA 2CWXA 2OTJN 5FDLB 2ZOMA 2AJFE 1O6XA 3CCZA 1VR6A 2UUWA 2ZC3A 3D6MB 3IAS9 2IAJA 4CTAB 5BRFA 3TW0A 3VQTA 4NXMJ 3AXMA 4G1QA 5KFFA 2UUAF 4LF7K 2G2ZA 1P90A 4OYWA 1J9AA 3KLFA 2QW9A 3D3BJ 4H4KC 5J2NB 3QRQA 3GILA 4B3MF 4DQQA 2O8CA 3SV3A 2V9KA 1VLYA 2B8QA 1C0TB 2NZ4A 4K4ZA 5LJ3Y 3TWHA 3CETA 4Z2XA 4CD1A 3TJ9A 3OVBA 2R7WA 2V50A 1A5XA 2E1MC 2QWRA 5B0DA 3OYNA 4AFFA 2JVOA 4X62J 4FLXA 3FQKA 5EGYA 3LDNA 1JLAB 1S9GA 3QGHA 4FN5A 2NRZA 1Y97A 3BP8A 3T6BA 1NGAA 1HW8A 3WIVA 4DCHA 2WVFA 3CUNA 1HYSB 5D0EA 4ED4A 1Y64A 1YXQA 3QATA 2GMHA 2D3UA 2AGQA 5ETOA 4DU7A 3DXMA 3OBWA 4ZVTB 2V2VA 1Z2ZA 3J7ZT 1YHQN 4RKUC 3ALYA 3C65A 1T05B 3P5JA 4FNHA 5F8JA 4JKEA 3VHQA 4FBTA 4C97A 2HHSA 3J7A1 4AXJA 3K2PA 3MN6A 2FUG9 2VPYB 4DSKA 2FC0A 4O3PA 3VEXA 2AIRB 2CG8A 3KKSA 1HNIA 3AA4A 2XWYA 4M3XA 4EP5A 3H7HB 1RTDB 4JKGB 3U27A 2V8GA 2QE5A 4FZVA 3OUYB 3KLEB 2FLNA 3OHRA 4CE9A 3PUFA 2Z1JA 3MM8B 3AVAA 3AVJA 3H4BA 1FKPA 4P2MA 2NRWA 3TQ1A 3O5TB 4X4QA 1G1XA 2DY4A 2ZBCA 4RU2A 4CLWA 5L9XA 3SFGA 4YS2A 2DGUA 4CZCA 1Q8KA 4JS5A 5HRSA 3DI6B 3QNNA 3FMWA 1U1NA 1RWOB 2H65B 2XO6A 1E6YB 1QUPA 2RE1A 4Y2IA 4DR5J 4BREA 3ETMA 4OZ2A 1N56A 2BW7A 3HHEA 5LMNJ 1HLWA 3HP6A 3TOQA 2XY8A 3ZTRA 2DR8A 3ZNJ1 1MWQA 4X84A 1OH6A 1TL1B 4NA1A 1QE1B 5BN8A 3W2WB 2O67A 4AE5A 2J6SA 1YJ9N 3BF4A 2FSJA 2HOEA 2VFSA 4WQ4C 1DRZA 1NZAA 3WQTA 2YKMA 2W7OA 3MCPA 2DR9A 1X60A 1FDNA 2GX9A 1S76D 1Z25A 3S3MA 2JEFA 5F0UA 2KZMA 3T1YK 3G6ES 4CJLA 3PDNA 4CLTA 3V9XA 1EZZB 4HT5A 4FZXC 3HHLD 3JS9A 4ZPBA 1ASUA 3QGPA 1N88A 2ASLA 4H0VB 1REVA 4H0XB 1BMQB 2RN2A 2IVYA 2ZE2A 4DCJB 2C2NA 2X7IA 2I1RA 4RWXA 1KD1O 2JFKA 3FJ2A 3E2EA 3S3NA 3BM7A 1Q9XA 4JI0F 2LEBA 3QJJA 5G0RA 5IFMA 1TKZB 3MOZA 4OYMA 2D3OR 2ZH6A 5GIPA 1VQSA 5T7BA 2RU3A 3QEXA 2UXCJ 2K06A 3IP0A 3THWA 4P7TA 2HHHF 4KJIA 2E9TA 1X4HA 4FWRA 5BRHA 2YKAA 5A76A 3NHGA 2HQIA 1RISA 1NJIO 2ZWHA 4K0KF 1F3VA 4O0IA 3MN9A 1T94A 1Y0HA 4U96A 2MQPA 4KHMA 4GC7A 3I0RB 5HVGA 2YQ3A 4CLFA 1KR4A 4JI0K 4JI1K 2MLXA 2FVSA 4MYUA 3UCUP 4JHDA 4X2BA 1CJUB 1URNA 3MXMA 2W9CA 1C2PA 5GAEU 2Q43A 4B3TF 3Q8VA 3WHIA 4PL7A 3DN9A 4C8NA 3ZZZA 1QAIA 3CJ4A 3EGWB 4YY3J 3B54A 4BR2A 4R79A 5IZHA 4CJPA 5I9EB 1TP7A 4JI7K 4DL2A 3IS9B 1F5AA 2RSQA 1P9QC 1NDLA 2UVRA 4ZK7M 2OCEA 3LGHA 4CZMA 4UQGA 3IA0A 3MX5A 1AFJA 1FTCA 1RWWB 3AAQA 3OSPA 1W0HA 2GBZA 3JXUA 2QTDA 3TAPA 4DUYK 5C24A 2H1YA 3HHKA 3GFYA 3FLCO 3M8RA 3FRYA 5JICA 2NXUA 3O44A 2LDIA 4V19X 4Q2LA 3LOUA 2HFVA 4M5JA 4ZPCA 4DCPB 3WNEA 2DGXA 1X3MA 2DO4A 4GKKF 1HHSA 2W9BB 4A8YA 3CIPA 3AO3A 1H2TZ 2BABA 4A8WA 1N52B 2XZWA 1IN0A 2CJYB 2EG1A 1XNQF 5A8RA 4AL7A 3U3YA 2WK4A 4USHA 3PW5A 2ZBIA 3I4HX 2G9OA 1RTIB 2DPNA 3AO5A 1BY9A 2ZD1B 3QMQA 1HNWF 1TK0A 1XEZA 2MHEA 4XH5A 1U6FA 1RTJA 4IO1A 3CXCR 2FB0A 4L3NA 3VQEA 4PY5A 3IXQA 4WE1B 2OH2A 1QHTA 1DBDA 5F2RA 1N32K 4GKKK 2IRUA 2P9EA 2D5RA 1JJCB 3MMCB 2UUBF 5HATA 3SUQA 4R5PB 3M3ZA 1HARA 2BGGA 3OYLA 4B3RK 1CJKA 3KLGB 5AQYA 4ETZA 4NLQA 3OSNA 5BR9A 2BQ3A 3J7AP 5I4MA 4HKQA 3MGJA 3AY9A 4A2BA 4MO4A 4P72A 2JHEA 1T9VA 4CLZA 2NPIA 1KD1T 1IJEB 3I0SB 1VRTB 2P9IA 3M2VA 4CYUA 3A2FA 2UUBK 4ID8A 4IRKA 5IT0A 2HVHA 1YJNN 3H2VE 2OGUA 5HANA 3BUZB 3VGKA 4O3NA 2HSTA 3L2UA 4CJ3A 2CGLA 5E3RA 3U02A 4K59A 5GAGP 5HP1B 2J7WA 3L3CA 1N6QB 2VA3A 1NJIT 4QW8A 2FTRA 4RW9B 2XULA 2Z2ZA 2K1RA 2CPXA 3KK3A 1GT8A 1NSPA 3ICLA 3N4QA 3U4LA 3SQGA 2W2QP 1KVAA 4CLSA 5EX0A 5K14A 4LF5K 3NAIA 2OTLN 4LFBF 2ASOA 3MEGB 5KG7A 3GG4A 4DBQA 1Z1ZA 4W4MA 3QO9B 3QQCD 4DR4J 4AHVA 1ZBIA 3PYEA 3JQKA 2QA4S 2LU1A 5CZ1A 4QIWD 2HMPA 3ELHA 1X7VA 1JKHB 1NKBA 3ZSXA 3DC2A 2AW0A 4C1NI 2Y1RI 3OTOF 4CBUA 5B8HA 4FF4A 3CNQP 2HNZB 3ZX3A 2YBVA 3DGPB 1HBNA 2F9JA 5DM7Q 3CJ7A 4CO0A 4QR1A 3CF5Q 3FCWA 4LFBK 4XPCA 3EXYA 3O6QA 4CESA 3OXFA 2LQ5A 3CCMN 3CCSS 3KFWX 2YNFA 1GNKA 3JTOA 2WSEC 3NAHA 3IR6B 1R8CA 3AHPA 2KFYA 1RT5B 2NRXA 5FPMA 2NLXA 5K9FA 1JCEA 1DTTB 1N5TA 1T3VA 5C5JA 3HHNB 4BWJA 2HRTA 3GSDA 4HWIA 3VQSA 5HK4A 3W8GA 4CGDA 3LUYA 4J90A 3OBYA 5B08A 1J54A 5HSPA 1K0TA 2OTJS 8AT1B 3SQOP 1PAUB 1ESVA 2V69A 3W66A 3ENHA 1FJ7A 4ZCLA 1OKJA 1HA1A 1MG7A 3AJ1A 3NCRA 1W26A 4GVMA 1W2BM 4FF3A 2BV3A 3PW4A 1CULA 1OWXA 3VGUA 1XMQF 2E6MA 4GVBB 1OYEA 4MIWA 1RP5A 4Q45A 3JTNA 3O3HA 3NVKA 1EWRA 2QWPA 3UE2A 1S1UB 1S1VB 1JL1A 1P8GA 4DQIA 4ECQA 4ZCMA 1OY9A 1WJ9A 1QZ5A 1HW9A 4E7IA 2XY7A 3KJVB 3THXA 1J53A 1EIYB 2C3PA 3O8MA 3DLGA 1X0PA 2J76E 2ZJQL 4DV5F 1NGBA 4NLTA 5EN1A 5AQZA 2G13A 1JMTA 4F26A 4LSNB 3VEOA 2YQ1A 1FW6A 2P6TA 2IDEA 4M5NA 5HMZA 4ZS6A 1BHLA 2XGQA 2B0GA 1MN7A 2CADA 4OX9J 4PYDA 3OL7A 1VSFA 5DG7A 5JMNA 4DOZA 3A8IA 2RD5C 3QGIA 1RT1A 4OPJA 2ATQA 4LF9K 2RRNA 4ECSA 1MMLA 2A1RA 1YAGA 1HBOA 1RT3A 3EKUA 2X1BA 3TI0A 1S6QB 3THYA 1D09B 4GV6A 2CDRB 4MKBA 1RKIA 1NDKA 3Q8RB 1YHQS 1WF1A 4K8ZA 4X4SA 1S0NA 4NYFA 1XUPO 1HBMA 2KT2A 3OHAA 3BPDA 4RLEA 5HLFA 3EDRB 3CO0P 4FKYA 1I3AA 1GMWA 3GLJA 3SK3A 3Q89A 2ZHOA 4NZ0A 3RWUA 3CCUN 2RE2A 3VQQA 1IKVB 2J9DE 2GFFA 4KBOA 4A8OA 5LMUK 1WC4A 1JXLA 2RDDA 3T1HF 5SZTA 1RDAA 4CJFA 2V2ZA 4QPTA 2VKRA 1NHVA 2XMVA 1VQOS 4NPOA 4DU3A 1SL0A 4CECA 4NLUA 4CERA 2CYYA 3GOIA 2VA2A 3TU5A 4Z37A 7FD1A 4ZJQA 2H54B 5DM7L 4IXCA 4OJ3A 1WHWA 3SI8A 3DJCA 1BLUA 1EP4A 2HHXA 3CF5L 4W5QA 1QVFR 4B8AB 3NKYA 1DTQA 2G2OA 2E2PA 4MIBA 5HJYA 2GHWA 5JLFA 4I9LA 2D9OA 2L48A 4NYPA 1YITS 4BRLA 3H98A 3TAMA 4KAZA 3ZSRA 3DFEA 2HBRB 4FSVA 1M5VC 2F65A 2AYBA 1YJVA 5BPNA 1S4FA 3SI6A 3LWMA 1WC0A 5E2QA 1K8KA 3TABA 1U0SA 3DOLB 3NL0A 1RA6A 2PFDA 1NLVA 1Y5LB 2DD8S 3AB2B 2UV8G 3UVJB 3CYMA 3SBTA 3K17A 4OKJA 1RUSA 1GOAA 4Y0WA 4F02A 4ECVA 3MECA 5AJ3K 4X62K 1VQPN 5KG3A 3BH7B 2PYJA 3ZZOA 5C15A 4N56A 5LJ5Y 2ZUAA 2XO7A 3CCES 1CZBA 3T6JA 2XCPA 3N6LA 3LDQA 1B4SA 2I6WA 3F0NA 1BQMA 2C3OA 1Q8LA 4ALZA 3M1VB 1FJGJ 3ZTPA 3JTPA 1KNZA 3TRGA 1GLBG 4P52A 5EY4A 4CK1A 3BH6B 3Q8YA 4C8MA 2B6AB 2GVDB 4E1JA 2N3LA 3L2WA 2M70A 1KLMB 4JI3J 4O55A 3R97A 1KXPA 2Y0SD 1NHUA 2HVIA 2G8FA 3NBPA 3AVNA 1RAGB 1T9XA 4R0EA 3MN5A 4DPOA 1T44A 3UR3C 2R2TA 3MR7A 4AHCA 3IWNC 1TV6B 4KHYA 1CC7A 3W9HA 4FVMA 2F7TA 2IC3B 1N5VA 3QAEA 3K5OA 2ZFHA 1WHYA 4RUAA 4FYVB 3G10A 3PJWA 4U95A 3I56S 5RUBA 4KQZA 1CQMA 3QBCA 1T3NA 4WFBL 2HSEB 2KI2A 1TAQA 4JV5F 3NGSA 3CJ2A 2AJ4A 5DRKA 2LA4A 3AGKA 2L41A 2HFOA 1PGZA 3B4DA 1TFYA 1JIHA 2LLZA 5IT9O 3RBDA 3RB4A 2JL9A 3HFVA 3SSQA 1NAQA 2NZTA 1KONA 3H5SA 2VFRA 3G8QA 2BJ3A 4JKBA 1XK8A 4CLKA 3CCLS 1IBMJ 1W2IA 4TU7A 4WCEQ 1ATNA 3WC0A 2JH3A 3QESA 1T03B 1U0HB 4Q8EA 3FC9A 1SJ4P 3F2KA 1FD8A 3C16B 1WAFA 2P9PA 4A8QA 2DHHA 4BVOA 4M41A 2J6TA 1T8EA 4ZPAA 4ZVFA 4DPXA 3UCZP 3EL2A 1M5KC 4Q0BB 3MEEA 1JLCA 1NUEA 4NMXA 4WXWA 4DV6J 4ICLA 2W7AA 3DRRA 1PYTA 4EU0A 2VICA 2QWMA 3TEHB 5HVFA 2ZJPL 1XQSC 4ZHRB 5E3AA 1L3KA 5CA5A 3E9PA 4M63A 3MPYA 4OHXA 4NX9A 3TARA 1D1UA 3RMDA 4MFBB 3CE8A 1RT7B 1BQNA 2QC3A 3OL6A 4PG6A 3OYGA 4TN2A 1VQ9S 4F4AA 4FLZA 3E66A 3OS2A 1RCXB 2OZMA 4OFZA 4PUOB 3CJKB 1GMWD 3B6BA 4I56A 1OSCA 4ECZA 3K5LA 2Q66A 2IS3A 2UXCK 1HQUB 2C2RA 4ZVGA 2HK2A 4YDDB 1G2EA 3GTYX 4XK8C 4WP8A 4ZVRB 5KFUA 4N47A 3DOKA 4IUFA 4DL3A 4KH0B 3DRPB 1PILA 1RDBA 5KGWA 2HZVA 4BRKA 4W90B 1UP1A 5IQQA 3AGRA 2F5GA 2N3OA 4FLYA 4CGIA 1WACA 1HBUA 3NGZA 2FHOB 2MKSA 1FRMA 3C14A 2JC0A 2YWWA 2CPIA 4K43A 3TA2A 2M4MA 4A5BA 1IH7A 4NXNJ 3MEDA 3H3NO 2WSCC 3HYFA 3H2UB 1HWJA 1YJNS 1WAJA 5JLHA 2PT0A 2Y8WA 4Y2KA 3G82A 3CC7N 4IKFA 2R8JA 2HGMA 2ROEA 4OZ0A 1D0EA 4B3OB 1S5JA 4WYLA 1XHXA 2DTJA 5JS1A 1IBLF 3FCVA 4JP8A 3TVZA 3HP9A 1J5EF 2BM0A 4BRQA 3R5JB 4N7TA 1Y00A 3RRHA 1IQTA 4M45A 4PWUA 3ZEUB 3C95A 1WBBA 5ETKA 3VERA 1REGX 1FXXA 3RBEA 4DR2F 1A9NB 4C3MA 2HS4A 1SCJB 3WNGA 4N5SA 4CGJA 1XMOJ 2E7VA 1NK5A 1YVNA 3OR1A 5EHHA 3A8EA 4YR2A 3J81O 4IFYB 2NQPA 1GAOA 4KRWA 4GKJJ 1X8DA 4OHWA 3THPA 4X66F 3NS5A 4WCEL 1PBUA 3W9JA 1WTFA 4DTPA 3HSDA 3RW7A 1MWKA 2AJ2A 1J5EK 2YJFA 2JVRA 4FWQA 4LF2A 3NDKA 3KKFA 1CJVB 3ZZ0A 2EX3A 1T6CA 2CQ0A 3I8DA 2W9AA 4DR2K 1SL2A 2V8VA 1SH3A 1F2GA 4CM2A 1U1KA 3DRXA 3MDQA 5M1PA 2ATLA 1TUGB 4HVZA 4ILRA 4QWDA 1X5PA 3LGMA 5KGXA 3PW7A 1Q82O 2GIQA 4KV8B 5C0YA 2D3ZA 4C9DA 2HRUA 1X5OA 4QU7A 1ZAVA 2DHXA 3CCTA 1VRUA 4UQTA 5DZ7A 2B56A 1S6PB 2ACYA 3OR2A 3MFIA 1MU2A 1GMUA 5HO4A 1YVUA 1GOCA 2YTCA 4EUVA 2NPFA 1FEEA 3BDPA 3WC2A 5H9EK 5FDLA 2BJ8A 2LQ8A 8RUCA 3C2PA 3ULEB 4M3WA 1M5PC 3A1YG 3PYGA 3Q7CA 4GC6A 3J80U 1C0MA 4M5GA 3ZX2A 1QQMA 3CGIA 4JD2B 4H0PA 5B0FA 1C0UA 4LSZB 3MK6A 3I9ZA 4U9RA 2F8MA 4C11B 4AD6A 1BI4A 1NB2A 3ENBA 4IOXA 3BGLA 1DHMA 3BGFA 3TP2A 3P6YC 2WOMB 2AJ0A 1VQYA 3GJQB 2OPSB 2F40A 1VC6A 4H8KA 4ZTFA 1VYAA 5CYQB 1AUDA 1N34J 3SPZA 1RT2A 3OYIA 3BREA 4XO0A 2JSXA 2F9WA 3DRSB 1NGIA 4FK0A 3M5RA 1C0TA 5FLXO 5JMVA 3CIMA 1ULRA 3CG7A 3BKFA 4JYAJ 5HRPA 4U7UD 2OSRA 3MM6A 1PC5A 1BIUA 2K3KA 5KFYA 3AXKA 1E3MA 5CCLA 4C4WA 4YHHK 3AO1A 1RWNB 3BDEA 3KDNA 3NGIA 1AZSB 2Y8YA 1SV5B 4FWMA 3CJTA 3D1HA 3HJFA 3CTRA 4NASA 3VGTA 1HWKA 1Q7LB 1HYSA 2PZSA 3RB0A 3CULA 3HOSA 3N4WA 1FNOA 2QTWA 1TMMA 3V81A 4KO0A 3P39A 1CG2A 1CJTA 2P9CA 1FWLA 3I55N 1R43A 4Q44A 4B9LA 3VAKA 5JJBA 1JXEA 2FBTA 2BANB 3T5LA 4ENOA 2RT3A 1UKUA 1EQMA 1ZZNA 4BC3A 3AVIA 2R3VA 5CXTA 3UO0A 2XBPA 2RUGA 4CLPA 2GX8A 3OFHA 2W8KA 2Y1IA 1GQEA 3A5NC 1ASVA 4B02A 2IBOA 5M1NA 4CIFA 1YJWN 3D7EO 2H5EA 4CZGA 1SBRA 3OUYA 3KLEA 3CJ0A 2BJ1A 2R7UA 1W9HA 4IR9A 2DNZA 5IT9Y 2W2MP 3TUIC 4ZITA 2L9DA 4NEZA 1CS4A 1X5TA 1IKWB 4GO5X 3M30B 3M8PB 3W64A 3CC2N 1BISA 3LP2B 2RKIA 2NXJA 4OV1A 3THTA 1KVJA 3W2VA 3EE9A 1RBAA 2FJAB 2UXDJ 2EHGA 2Q31A 1E6YA 1PCAA 1U1RA 6AT1B 2ZDOA 3ZSWA 2R2RA 2F9DA 1S0OA 1ITPA 1L5UA 1Y5IB 3F56A 1UVMA 2ILZA 3CJQA 3L09A 1UFKA 5LSRA 1IKYA 2R8IA 4DUTA 2GIRA 2KFNA 2VQEJ 3W2WA 5DJBA 1V3ZA 2CQPA 3V9SA 3ZZPA 1TMJA 1RGVA 4OX9K 3H25A 1MLAA 3ZLJA 4X4OA 3VTHA 5DQHA 2C3YA 3QLHB 2BKNA 1CVJA 3EY1A 2KHDA 3OA9A 3O5BA 2XY5A 2Z58B 2A1SA 3D9BA 2RU9A 3PTWA 4ETXA 3EX7B 3IG1A 2UXBJ 3HSCA 2CQ4A 3A3PB 2LA6A 4USWA 5AXNA 2D9PA 5LXRA 1HNZJ 1LWXA 3SYZA 2FBVA 4E3SA 4L3QA 4CBXA 3FCHA 2YX6A 1IG8A 4HTUA 3OTBA 4C7QA 5C2CA 4USKA 4CHYA 2XZTB 2E5JA 4HACB 1WC6A 4QW9A 1TKZA 2KYXA 3UN2A 2IMOA 4DPUA 1RB0A 4C8ZA 3KG0A 4CI0B 1XJWB 2NS1B 2IY5B 1KAZA 2R9LA 3ZO7A 1PYOB 4J9RA 2D69A 4IKAA 2ZKUA 3PZPA 5B09A 5GAHU 2RB7A 3U3GA 1T9TA 3UKUB 3HSTB 3DDNA 2V4QA 1R6YA 3J7AN 3MUTP 1P6TA 2HQGA 2ASJA 1ASWA 3HT0A 4ZCKA 1EKEA 4EI2A 3RVCA 3I0RA 1ROFA 1NEEA 4M3YA 3IMXA 1R0AA 2IDOA 3DAWA 4AL6A 3U9DA 2BM1A 3FZBA 1KAXA 1D3WA 3DU5A 4DTNA 5GIOA 4DPTA 3K58A 1CJUA 3VGMA 4LF1A 3SCKE 1LFWA 1MNEA 4WTOB 1KP6A 1X9SA 4MDAA 3HTVA 3GWCA 4CF9A 3HPOA 2YNIB 2CPHA 5I3UA 2MGZB 1SIWB 3EVOA 3MN7A 5D4OA 1K8AO 1MWMA 4RJVA 3EMTA 2CAJA 4GRSA 2QN6B 2QZ8A 1RWPB 4LH4A 2IVOA 1SKUB 1YKWA 2OD6A 2XGPA 2LXIA 4WPAA 4LFCJ 3A3OB 4K50A 3J81Y 2XYPB 3ENWA 4NLYA 1JWWA 2XB2D 2E2NA 4HT7A 5KFDA 3UDVA 1PJ5A 1ZZFA 3UIQA 1FCAA 3CJ8A 4F3TA 2DNGA 3J81j 1JNRB 1JCFA 3MF5A 3K9JA 3ZT2A 1JL2A 4M5IA 3R6GB 3JQJA 4JI3K 3C15A 2D3O1 1EHWA 4FNIA 1M0SA 2HLTA 3DOMB 3NF9A 1F9HA 5KFIA 1TL5A 3ULHA 3H1VX 2O8DB 4CGGA 5EX3A 1OVQA 3TNVA 2O5DA 2JZ5A 2B4JA 2JOQA 1NSQA 5KFAA 3SDEB 3VWSA 2XCAA 2RS2A 2MTLA 2PE8A 4ZVPB 2DBBA 2KW4A 1WEXA 4N41A 4MKAA 2CIMA 4OX7A 1RT4B 1ZC6A 2DNKA 4A8KA 4OX6A 2AHOB 1B92A 3NCIA 4ZCIA 3O08A 5EWGA 2OHDA 3GIIA 3MMCA 4M5DB 1RBLA 4C8KA 1X4CA 2ZVSA 4QJVA 3VEVA 4E7HA 1OY8A 4KHPJ 2OFHX 2XHCA 2KXHA 5KFCA 3ZTSA 5HOOA 4FYYB 3RGIA 5GMKa 1LW2B 3BSCA 2YHYA 2LQJA 2I0XA 1F5CA 4JV1A 1A5WA 2OEKA 1QUVA 1NDCA 2CNOB 1HPZB 2OSQA 3ZSVA 4M3RA 3S1TA 3EN9A 3GIKA 2EWSA 1IBMK 3M32B 1RHRB 4UZCA 3HD1A 2YH0A 1IUJA 1KOHA 2P6SA 3OS1A 2P51A 3QBXA 3MM5A 2QWOA 3P3DA 1RBVA 2EFPA 1FD2A 4I68A 5FLXY 2AD9A 2E5HA 1NGJA 4IJNA 2GW8A 3KK7A 1RHJB 5CZXA 3ISNC 4MO5A 1FDBA 4TLQA 4RW9A 2WBMA 3NH0A 2ZOFA 2HZAA 2BA9A 3JSYA 2DRBA 1SH0A 4BC5A 4LF6J 1JXBA 4CJ7A 2C28A 3VVUA 2PDAA 3MR3A 3E51A 2HFSA 1QVGM 3D6RA 3SJJA 2IM1A 2GO9A 4RNMA 5HI7A 5H9FK 2RQMA 1YUWA 1KSPA 2QL7B 4ECXA 1JJ4A 3HVTA 2ITMA 4YOEA 2LFVA 3AVBA 2OEJA 1K8AT 2B9YA 4C0HA 3OTDA 4CJVA 5D78A 4EBCA 3PSIA 3IKMA 4L76A 3NWRA 2AWZA 3G71S 1RGIA 2CPFA 2HNZA 1QHAA 2C2OB 1CZAN 4JBCA 3MMAB 2PY5A 1YJ7A 3KMSA 1N5QA 1FX2A 2FYXA 5A0YB 4UZBA 5FRMA 1EXQA 1G4CA 3NWGA 3GFHA 3CCRS 1X4DA 1NRKA 3V4IB 4E0DA 2O1PA 3NOCA 5I42B 2BJ7A 3VAGA 4I2PB 2IJNA 5A2QU 4ER8A 3PV8A 2FSKA 2PGCA 2VC1A 2ASDA 1N33J 2HYIB 2FY1A 3F9KA 2LQ9A 4I6MB 2VODA 3CMAS 4PYAA 4CF1A 3P4IA 4CEBA 1WB9A 2GJ2A 2QWNA 2Z56B 4W5TA 3MURP 3FSXA 1SQFA 1D8ZA 1HKAA 1I94J 1TL3A 4DG1B 2W1BA 4NXNK 1EQ0A 3RB3A 4YORA 3CDEA 1FK9B 4YMEA 1LWCB 2R7SA 3MD3A 2MMYA 3TR8A 4BBYA 1UFLA 3C6UA 2AU0A 2QK9A 1UJ5A 2X74A 4DR1J 3G2XA 3O1WA 4JI4F 3D2FA 1S1UA 3CPWR 5IWAJ 1X3NA 3A3NB 3R5CA 1QS4A 5D0HA 5KPRA 1DQ9A 3IBFB 4ZVHA 2L9NA 4IQXA 4A4JA 4DV2J 2RRBA 4MTPA 5GMDA 2F9TA 1JLBB 1R89A 4CO2A 3KLHA 3RR7A 1CC8A 3LPUA 3U8XA 2QSWA 4GKJK 1IM6A 1EJ7L 1FI4A 2KU7A 4ZLPA 2P9NB 4ID5A 1FRXA 4Y2CA 2AYEA 2OLWA 3QERA 4O44A 1H0HB 2LVWA 1T95A 2WAQD 1ZBHA 4ZTJA 3S9HA 2DIVA 4CIGA 1XMBA 1N36F 1RACB 4YFUA 4LFAF 3QJPA 3SQ2A 1LFPA 2E9RX 2ITGA 1S6QA 2ALZA 2B4UA 5C7PA 4IDKA 3K7RA 4X4NA 1RAOA 3GIRA 2YQ0A 2JFDA 3BGUA 2XZDB 1KVIA 2P9SA 3I55S 1RCHA 4AHUA 1RWMB 2HF3A 2DITA 3WNFA 2E66A 1HMVA 3ENAA 2EFGA 2AJ1A 4I7FB 1SQKA 5KFWA 2O8EA 2H48B 1U7LA 3EZOA 3Q24A 2QL9B 2NUHA 1N36K 2FLPA 4FJGA 4LRCA 4FBUA 3TPQA 1U26A 3WIUA 3PW2A 2I7PA 2GZOA 1YJWS 2OELA 2IYIA 4EIAA 2XWXA 5IS2A 2EKNA 4XIUA 4NB4A 3ZNUA 4DZ6A 3QGGA 3VQ4A 5C12A 3KJFB 4CBWA 2XMTA 1U47A 2XMUA 1QLNA 2DT9A 5KG4A 1WD6A 5L1JA 1XHZA 2GMLA 2OZSA 3LP1B 4K8XA 1VBZA 5HJXA 4TSXA 1C1CB 4Z4CA 3CC2S 3A12A 4HHUA 2Q1NA 2GAGC 2UVUA 4D3HA 3HULA 2H9ZA 2V5HG 4I2QB 1WHXA 3QFPA 3H3OB 3KK2A 4FJ9A 4FZZA 1N34K 4Y34A 3K8WA 1NPKA 3SJHA 2M8HA 3HI0A 4M3ZA 4B3SJ 1K6YA 2B5JA 2QA1A 1RAIB 2PO4A 3UVJA 4A8MP 3QEVA 1Q81O 3J7YU 2MZ1A 2IRYA 2CXEA 5AQKA 2QA2A 3CJ3A 4JKHA 5LSOA 4DV3F 4IFVA 3K5PA 1V6HA 1FKOA 2E29A 2WFBA 2DNYA 1SUQB 5L8RC 3OYDA 2V7ZA 5F8MA 4YQWA 2IGIA 4LT6A 2BTFA 5K8OA 4CF2A 2KRRA 3MPUB 3N5FA 3M1VA 3Q2SC 1QVFM 1E4FT 2U2FA 1T9YA 4DV1F 1WNSA 3HHDA 4OMFG 3R7BB 3D6TB 2A41A 2DH8A 3IR7B 1HIYA 2YX1A 1Y11A 4DV3K 3NOGA 1D4XA 4X4UA 2XQCA 4JK7A 4KGXB 3KJNB 4CZLA 4DR3J 2XI3A 1TV6A 1PG5B 3W5YA 2AQ4A 4URGA 4PHTX 4MIAA 2HK3A 2IC3A 2RPIA 1SQGA 1NNEA 4L8RB 2FZCB 1Q4RA 5L39A 3V6DB 4ZP8A 2CDQA 4OGEA 2EI5A 4NLRA 1M1KO 4PXBA 2PBDA 4XEIA 2VG6A 1UAWA 3P5TL 4KBIA 3RYLA 3N5BA 1DKGD 5J2PA 2AX0A 5JXSA 1Q8IA 2GV9A 1JJ2M 3M4XA 2GVZB 3UN5A 4ID1A 4OYIA 4HUFA 2YY3A 2UUAJ 3MM9B 2KT3A 2XS7A 4DS4A 2LMIA 2WUSA 3E9OA 3AODA 3QSYB 3VQPA 4DX7A 3GCWP 3BJYA 2KQ2A 1RHQB 4OIXA 2E88A 2E1RA 2Q6BA 3CEDA 4P2FA 4B3MJ 4GW6A 3CJ5A 3M8ZA 3HO1A 3LP0A 3ZZTA 3HM9A 4QBUA 1LWEB 4BQLA 2EW9A 4IG3B 3R5GA 1U0HA 2VQEK 1FJEB 4UOHA 5D4LA 3KHHA 4BR7A 3CJ9A 1NWKA 5IV4A 2VWJA 3RSEB 1RDRA 1K1QA 3NFAA 4B9UA 1TKXB 4LR8A 1VQKN 3OV7A 2CKWA 1AB8A 3HOTA 1U8SA 1ZM3A 4ED5A 2QLJB 2KM8B 3OY9A 1JLFB 1WSVA 2UXBK 1ACMB 3C66A 3CI5A 2VBZA 2D7SA 2CFXA 1HNZK 1AW0A 4ED2A 1U6BA 5HROB 5ITHA 2HGLA 1DFDA 2ZH4A 3GSIA 2VQFF 1PO6A 1RT7A 2W24A 1U24A 4MLHA 5KFPA 2V4JA 1GOBA 4DX8H 2FIUA 1OMSA 1Q81T 1NGHA 2HMIA 3BGRB 3CQYA 3PO4A 3R2CJ 3QEIA 3KWIA 5FPEA 3BQ1A 1KHWA 1LEOA 1VQMN 1C1BA 3SCJE 2FJVA 7FDRA 3K57A 4RU9A 3D2EB 1SJ1A 4OYZA 3D0IE 3H59A 1HQEB 1HI8A 4FJNA 4FF2A 2FGOA 3OLAA 2CJXB 1DJ0A 4TLRA 1MROA 5C42A 1V5IB 5HL7Q 4C8OA 1NGFA 1TKTB 4CJKA 4IOCQ 1U49A 4FWOA 5B0EA 4ZIWA 2RAQA 4KB0A 3CT9A 2OJ3A 3D67A 3EEQA 4OGCA 2O8BA 1RWUA 4B08A 3G4SS 2AGPA 1ZM2A 5AZIB 4NI2B 3EXCX 1NK0A 2ZNYA 1M1KT 3MFHA 2Z0GA 5HRRA 1IVZA 3DM2B 1IBKF 2XMWA 2CJKA 4JK8A 5F9NA 4NA3A 5LOQA 4LFCK 3NS6A 2PIIA 4YB5A 4O3QA 4F36A 3ZEUA 5CR4A 3ZT3A 2LECA 1VIOA 2FJXA 5E84A 1E4GT 2VBWA 1DLOB 4OLAA 5D4NA 2IVFB 2D0AA 2G0JA 4W5OA 1S48A 4IJAA 2DKOB 2O4IA 4LSLA 3JQMA 1NH7A 1KFDA 2OYQA 2XSJB 3SQ1A 2W6KA 5HQ8A 4J9UE 1IBKK 3O3GA 3GIMA 2VD3A 3KXDA 1TK8A 1YJTA 3JYTA 3VN5A 5ADXH 1OS5A 4JI0J 1K47A 2W4DA 5AE2A 4H4OA 4PWDA 3EGVA 3FFIA 4PEOA 3DMJB 4G3IA 4DV7F 5KT6A 1AXQA 2FC8A 2HHHJ 1HRHA 4H0YB 2QL5B 3UW1A 1HX1A 4U6PA 3HCXA 3FBEA 1LOTB 4K0KJ 4KV8A 2GGPA 5E26A 3PEJA 1RWVB 1IR0A 3GONA 1HKBA 1LCUA 3IRXB 1S6PA 2WW4A 5ELZA 1M1GA 2EPIA 3L3VA 3WEEA 4KHPK 1GXLA 4QS7A 2IFXA 1NGEA 4PAAA 1C4CA 3GV8B 4WTYA 1VOMA 1HWUA 4B3TJ 1CXUA 4I64A 2H51B 4ED6A 1RWXB 2VG7A 3W3SA 2J0XA 1S1XA 4BR0A 4EYHB 1LW0B 1F6TA 2P5GA 4NYZA 1W97L 4MH8A 1JLEA 4MYTA 1H3DA 3EPIA 2BEFA 2X6NA 4CEAA 1N0UA 2WVEA 4LR7A 2BQUA 2OPSA 5KOWA 2NXEA 5DDOC 3CCQS 3VQ6A 4OYXA 4EBDA 4UTGA 3R7NB 3GMGA 4IOCL 3NMAA 2J9EA 1T6DA 2LU2A 1VSEA 5CZVA 3I82A 4HHJA 3R8YA 4Z4IA 4CJQA 1R6VA 2B9XA 8ATCB 4GKKJ 1UA1A 3TJAA 2C2MB 4KHUA 2QEXN 4FJ5A 4AM7A 1FE0A 3US5A 4DV4F 3ZCMA 2JWKA 2VOPA 2OMLA 4DSJA 1HI1A 5D77A 1HNXF 4OJHA 3UD4P 2G8UA 1HNWJ 1WSGA 2P9LB 2MQ8A 4DX6A 5T14A 3DHWC 4DXLA 4NLBA 2FVRA 3FDSA 1WNEA 2AKWB 1UVKA 1NNDA 1RT6B 1UVLA 1KKHA 1VHIA 2UUBJ 1H7XA 5J2QB 2KVIA 1Q78A 4J7CA 3M05A 4DV4K 1R8BA 4JKDA 2I38A 3OVNA 2UVWA 2KYZA 4DFPA 1JXVA 2MXYA 1XN9A 3OYMA 2V4RA 1LAVA 4QWCA 2ZEJA 4BC2A 1VQ8S 2O4GA 4BRMA 2RQ4A 4MJKA 4DUZF 2CJAA 2E2OA 2HNDB 3C8YA 4KPYA 4RW8B 4E2FB 3IWLA 4CEDA 2YWKA 4OI6A 1TGOA 1A7GE 3VAIA 4R8UA 1KRPA 4CF8A 1CEZA 2G0CA 1A0OB 1NMEB 4PR6A 4JAXA 4AQYF 4OPAA 4ECWA 1NJYA 1MN9A 4DR1K 3VEWA 2W2PP 4J2EA 4WQ5A 1R59O 3QT8A 5IWAK 5L9NA 4CHQA 3KD1E 3X3UA 4DUZK 4W5RA 1ZA1B 1GTEA 4ED8A 2ACMA 4DV2K 4LFBJ 4YEAA 1X9WA 2RF2A 4WF9Q 2PMWA 5L1LA 3HHLB 5KT4A 3H42A 4CNYA 4DU1A 1WN7A 1B70B 4DSLA 4EP4A 3ET6A 4RW4B 3OTOJ 1K73O 3M9NB 4ZJOA 1FJGF 1RTHA 4MMOA 3PEHA 3NH2A 2RIJA 4CFAA 3TTCA 2KB2A 4TY8A 2ILYA 1RBRA 2NREA 1VSJA 4LD0A 3D6HB 4DJBA 3TEGA 1WUAA 4RNFA 4WIQA 3U1NA 3PFOA 2JLFA 3FR0A 4RW6B 1JLGB 5DQGA 2CNLB 3FEXB 2HBQB 3Q83A 5ETLA 4JRPA 2J0WA 3GP9A 2V9WA 2DIUA 2HF4A 1Q1KA 2MQLA 4RG8A 1NZ8A 3D28A 2J9DA 2F4VF 3D1OA 2V34A 4EWTA 3SMSA 3B6PA 3R5BA 1TL7A 4IEEA 3W7BA 2FJBB 4YOVA 3CM5A 1TVRA 4N77A 2DHSA 5KG2A 2HZCA 4U8VA 3UN3A 3IN5A 3ISZA 2IM0A 5KFSA 5THWA 2Z1HA 2K7JA 3NMRA 4G1QB 4C3LA 4F7VA 1IO2A 5FPDA 3PRBA 1XMQJ 1SAZA 2G8HA 2MZRA 3RRKA 3KLFB 2ZNZA 3TVKA 4OJGA 1FRKA 1GXUA 3MD1A 2V52B 2KXNB 1NO8A 3BBCA 1SJQA 3G6YA 1SC3B 3UR0A 4IO8A 3R1LA 4DV5J 2HB5A 2F3JA 2QLXA 1GLEG 4JK9A 5F0WA 2MGZA 2VHGA 1LQ9A 2JLEA 3AD7C 4X65F 3CFPA 2GUIA 2YWEA 4B3SK 2A10A 4F50A 1OIAA 4I9QA 3C6TB 2NNWA 4JI5F 5F8HA 3PCOB 2Y1JA 2A2CA 4GVEA 3NF7A 1VQKS 3EE8A 2L08A 1TYQA 5MLCQ 4DV6F 3MCOA 3DXMB 2FC9A 2NUUG 1R0BG 4FWKA 4DR6F 3CMEN 5KG5A 4CM0A 3W9IA 1NBEB 1UW4A 3LTOA 3IGVA 3KJQB 1TUYA 3GR0A 2K3IA 4FK2A 1FRHA 3LDSA 1PBAA 2HBLA 2MZQA 3DOMA 3NGDA 4ATNA 2W8LA 4WF9L 4WFXA 3T1HJ 4DR3K 4NL5A 1EKRA 4M5MA 2IPOB 3PFEA 1YT3A 3BQ0A 2RMLA 1WG5A 3I33A 2Z8QA 1H7WA 1VQMS 1RT4A 2QRRA 4KPCA 3K9KA 4Y3CA 3UB5A 5E3CA 2GO8A 4QR2A 3DLEB 1K73T 3QZ8A 4Z7YA 4BGAA 5HQMA 3V4MA 4M5DA 2YCHA 3T7ZA 4J8FA 4IO9Q 2U1AA 5EUHA 2BOAA 3DLKA 2UUAK 2NUBA 4BG9A 3L8BA 3G86A 1RHMB 5KFTA 5AJ3J 1UJ4A 4B1ZA 1EQYA 5B0AA 4HDHA 1I6JA 4B3MK 4ECUA 4IYQA 1Q9YA 5KQ8A 3FSYA 4FYXB 2N4CA 5E7OB 4BE1A 5AQHA 4WBFA 3TSPA 2GHPA 4NA2A 3RJMB 3GR1A 4DR7F 3BF3A 4CGHA 3LF0A 3RAMA 2H5IB 4K2XA 4J9LA 1OH7A 4C8YA 2YKMB 4NLOA 1RDWX 4DFJA 2W41A 5KFVA 4CZIA 1NM2A 3MMJA 5GAEI 3I32A 2P9UA 4F67A 4WK3A 4HCBA 3TO8A 3SSSA 4PKGA 2HLUA 2J5AA 3RAQA 1YZ7A 3H5XA 3HZEA 3MX2A 3DXBA 3M2RB 4ILHA 3VAJA 1XNRF 3H45C 4ILLA 4X4PA 4KT0C 2ZE2B 1FE4A 2NRRA 2W2NP 3DYAB 1G15A 2DNNA 2CJQA 2V63A 1VCTA 4LQ9A 1YI2S 4P6QA 1NSAA 3I5CA 3B6OA 1KC8O 5J1PA 3EZUA 2J8AA 4CT8A 5DDQC 1M90O 1YJRA 3M6VA 1U4BA 2G0IA 3S41A 5J1EA 3C94A 4CNZA 5K8PA 4DV0F 5ADZA 4O8KA 1M1HA 3D66A 4YNQA 4P75A 4BRGA 3THWB 5A0YA 3SPYA 2KJWA 5KFEA 3IM8A 4KSEB 2A6OA 2HBMA 3JB9k 3DRYA 5AZJA 4C6AA 5BRDA 4I6AA 4N8NA 3FGVA 4HYKA 3FZMA 4JV5J 4CJ4A 3I5BA 4IEIA 2G2YA 3MR2A 2FVPA 5KQDA 4M5HA 2CQ1A 1UETA 2ZHBA 3IMQJ 1Y5NB 4K4VA 4KFBA 1UMJA 4I6MA 1K0VA 3ITHB 3ATUA 1HJOA 2QMUB 1BQXA 2HW3A 3KUHA 4FS1A 2KKZA 3AQPA 3VF6A 2E2QA 3MCAB 1VQ5N 5KFLA 4URQU 2HQFA 1Q95G 1NU4A 2KDOA 3ZZUA 3J80O 5GVQA 4ERDA 4BR4A 1FK9A 2XNQA 1LWCA 1IXKA 3M6UA 3VENA 5BJRA 2ADBA 1HWLA 2OEMA 3EUNA 2XM3A 2KL8A 2B9EA 3DCAA 2DH7A 2MZJA 4IO9L 5AXMA 3GB0A 3MAAA 1DT9A 2MZSA 1QM9A 2MKYA 3DDIA 1B0PA 5HMWA 5C24B 4CO3A 5H1SV 4O4GA 1UPPA 3CW2C 1NOYA 2CJBA 1H73A 3L0QA 2P5OA 1QSYA 5TKWA 2RNEA 2M2BA 4ZPWR 5BPMA 1YBAA 2BW2A 3MDFA 4KE5A 2HHQA 4CLYA 2PMHA 5GADP 1F9EB 1ZAWA 4FM2A 1X1PA 4MK7A 4LJMA 1NOZA 2EFNA 3BO3A 4O8UA 4YDUA 3D4JA 2QEXS 1B3TA 3TWZA 3DLRA 3UQSA 1QAXA 5A8RB 4ZPDA 3R1XA 4HEA9 4AL5A 3LDLA 5CD4A 2GS8A 3BKTA 3KUEA 4HH0A 4K4TA 3S7RA 1RTJB 1WF2A 2HHHK 5GMEA 4USTA 3H20A 2Q79A 1B7YB 1O5JA 4I7FA 4K0KK 4XH4A 3FGUA 4ED3A 3AA9A 3L9ZA 3BYRA 1HHTP 2AT1B 2ASPA 4FXVA 4O4RA 2OD4A 1JQGA 1OQ3A 3AOCA 4BLGA 5DETA 3QINA 1FESA 2DGTA 4LUBA 4ANDA 4MLEA 2QWLA 4B3TK 1KC8T 2X1GA 3C19A 3M2VB 3GV7B 4CYUB 4BDYA 1M90T 2N4DA 3ZTQA 3LP1A 1NBWA 1NG9A 1S6UA 4JNEA 3BZKA 2C42A 2YJEA 1TUUA 3CQ8A 3N6NA 1FX4A 4PCQA 2V94A 1IBLJ 5ETSA 3WZ0A 1J5EJ 1F9FA 2O8FA 2K1RB 2CQDA 4CJWA 1HNVA 4DR2J 5IT4A 3LAMA 3VQBA 5I3PA 3SQGB 1T3OA 3ZZYA 3VAMA 3FMBA 5K14B 3DKDA 3EWGA 5C2DA 1V3RA 1K9MO 2YX4A 3M8SA 4FS2A 2MQMA 2J8SA 2CQGA 3WNHA 1H98A 3POTB 5KT7A 1VBYA 3H5YA 2IVPA 4P2SA 3Q86A 1N5YA 1BDGA 4E7JA 3FSIA 1SH2A 4AXIA 4DFMA 3M2UB 1ZBSA 4BRDA 4E7LA 1NGGA 5DGAA 3MTJA 2CNKB 2FXUA 1VQLS 2CH5A 4Z94A 1KTVA 4LF8F 4USUA 2Q6CA 4JI8F 4G1PA 1HBNB 1XNQK 3R9PA 2F1FA 3OFGA 1ZBTA 3QEWA 3TAFA 4NLWA 1RSCA 3RMBA 2Y1LB 3O9TA 2ZJQQ 5H9EJ 2WRMA 2Z2MA 1HNWK 4JKCA 2A18A 2FSNA 2DR5A 4O5BA 2OFGX 4HLBA 2YNFB 1HYZA 5C25A 3PVXA 1NCLA 2BBEA 3NCQA 4DTSA 2JC1A 5KG1A 2ROPA 1EETB 1WSJA 5AQFA 2CQ3A 2EFVA 4ES1A 4BROA 3V6DA 4M63C 2R7TA 3E1YA 4KTQA 3TZZA 1Y3KA 2VPWB 2P9KA 1BWEA 3O9RA 1OQ6A 3MMBA 4OYBA 2HWIA 2ZOGA 4LRDA 2UU9F 2OMOA 1VAZA 1JLQA 4LBHA 2XMKA 1TQLA 4EO6A 1T02A 2EKYA 2WC9A 1ZM4A 3SUPA 2E5LF 3QFHA 1SJ3P 1U45A 1S0MA 2Q36A 4KTWA 3V6HA 2D0CA 3SIPB 3OYAA 2HHUA 3FZLA 5IM0B 4DDFA 4YHHJ 1WG4A 1ZBFA 1YK9A 1Y3JA 4BRHA 1IWGA 3CDBA 3DLGB 4JI2F 3V9ZA 4C0BA 4DX5A 1NB7A 2NRHA 2XYGB 2BKOA 3WDOA 2UU9K 4CJUA 4RBVA 4CRJA 2ZWPA 3AH6A 2UP1A 3FZ2A 2DB1A 7AT1B 3GIJA 2E5LK 1Z4UA 2EFQA 1KWMA 3TTFA 3GCXP 4WP9A 1RT1B 3AA2A 2QSFA 4P2XA 4BC9A 2FZKB 3RSEA 3G6VA 3ZT4A 1HBOB 4QIGA 1RT3B 1TKXA 4JI2K 4F8RA 2WTUA 3OTOK 2BE2A 1KN6A 3TAEA 3THYB 2R7OA 3VEYA 1H6KX 1RYRA 3C7NA 3ZX0A 2IIHA 5LXYA 4QU6A 2DH9A 3CDAA 2VG5A 1LNQA 3D5MA 1C6VA 1HBMB 1OPIA 2POKA 2CWKA 3GJRB 1WDTA 5KTQA 5HLFB 1YIJN 4LBIA 2FJDB 1Q79A 2YKOA 3HBTA 1IJJA 4CIEA 4KHNA 4IOAQ 1VSIA 2ZM6F 1SC4B 3TR5A 1ZPVA 1UVJA 3PX4A 4FK4A 4IG0A 1K9MT 3BBBA 4YP3A 2DXEA 5EVZA 3AAWB 2YKQA 3V2UC 5KAKA 1IV0A 4DPWA 5LL6Z 4DQ8A 4BQZA 3CFRA 2LP4A 4EZ6A 3GYNA 1EP4B 3CC4N 4DL5A 4K4UA 1CQNA 3UCGA 1NGCA 2D0OA 5HRNA 1T9WA 2QFJA 2VCPA 1HQEA 4PL8A 3L7PA 1DTQB 5AQXA 3KG1A 4Q43A 4M7XA 1XMQK 1R3NA 2XHBA 1PC4A 4FZYA 3J80Y 4G6VB 2ALYB 2OPRA 3TAMB 1URRA 1G99A 1FXRA 4ZP9A 3JSBA 4F4YA 2I7NA 2MEWA 4WIIA 2ZUGA 3TUPA 5BYQA 5F8IA 1RDUA 2XMMA 3IBWA 4WFBQ 3KOAA 4F9OA 5AQTA 4DV5K 3NCPA 1F1BB 1FWKA 4DSFA 3ENQA 2EK1A 1N0VC 4Z7CA 3ZZRA 4CF0A 3TANA 2B3TB 3RW6A 3ILLA 4FXWA 1DURA 2MQQA 3PJ9A 3QIPA 3W8PA 1E6VA 2B7CB 2HFNA 4LRAA 4FM0A 5BXIA 4BWMA 3HK2A 3T3FA 3W0LA 4OHVA 1LKZA 3M9OB 4FDFA 3LP3A 2WONB 4YOXA 4E1NA 2AZ1A 1WC5A 2JEGA 5KFQA 1EB0A 4QWAA 1NKCA 1KTQA 4LQ3A 1LOUA 2OPPA 3D2WA 5DQIA 1U8WA 4Z4EA 5HBMA 2EFOA 2DFFA 1KQKA 3MR5A 3VR1A 1UW9A 2D74B 4OI1A 4PQUA 3FE1A 4B9SA 2WZ1A 2PYLA 3AVFA 1RXOB 3GFXA 3T1HK 4UW2A 3TX0A 4BGBA 1YBTA 4KHWA 2CGJA 1FNMA 2CZ4A 2Y3YA 3SMPA 2E6LA 5C10A 2QLBB 5BR8F 3OVAA 3SAHA 2ZVIA 2ZJPQ 1MW7A 1FT8A 5A2QO 2CPEA 5DM6L 5D8HB 3P49B 2ZH2A 3CERA 4NZ7A 4NZ6A 4Y65A 3AB4B 1YJ9S 2R2UA 2V7YA 3L4BC 2WCXA 4IOAL 1VDHA 2OO4A 2YI1A 3TZXA 3Q8SB 3ZETB 1BCOA 3PKYA 4A8SA 4YOUA 3PACA 4F4XA 2D4WA 3UKRA 2VDHA 1VQ5S 2KZZA 2DR7A 1VBXA 1TR0A 4FW2A 5B0CA 4OJRA 2BXJA 3D1QA 1WEZA 1X9MA 4Y1DA 3AD9C 2KXFA 3GYXB 3Q0AA 4LF4F 4X4VA 4NYOA 2P9PB 5KFBA 3UD5A 3W65A 2E1CA 3NAEA 1HL6A 4CZHA 1B7FA 4FWLA 4JEPA 3R9LA 2MJNA 4FJXA 2WB1D 3MEEB 1JLCB 3PYFA 3ENVA 5CYMA 4ICLB 2FDNA 3ZFVA 4BACA 4CWBA 4MKVA 1LAWA 1RILA 4JRQA 5L46A 1S99A 4LF4K 1DGKN 2O66A 3W5XA 3GPAA 3BPSP 5F41A 2JLGA 4QCLA 5F8LA 2R8HA 3IWXA 5KT5A 4QWBA 2CVEA 2BZ2A 2HKEA 3L95X 3MPVA 3VGLA 2C2ZB 4KY3A 2Q3PA 1S10A 4A62A 5A6WA 1T7PA 2WW8A 4USJC 4WXOA 2HFUA 2VZ9A 4H5WA 2G1DA 4AT1B 3GL1A 4KI4A 1UEKA 4JV5K 2D1KA 4A57A 3W60A 5J2QA 1Q53A 3K2YA 1PYSB 3CDWA 4XAKA 3OPKA 1O13A 5EU7A 3VGSA 4DWIA 1YLXA 2B51A 1N54B 3R6LB 3KZBA 1VLOA 3VZIA 1Q5YA 3HF5A 2BJEA 4WYBA 1B64A 5CYJA 1Z26A 4DCOB 4QOTA 1TK5A 1RABB 5ETRA 4IFEA 1WOOA 4L72B 3MEDB 1R8PA 2QM1A 4CW7B 2ZZNA 3O4NA 2HNDA 1BE4A 4CEZA 4RW8A 2NYHA 2DNQA 3LM2A 3G82B 4YN3B 3SEOA 1SC1B 3OLBA 4DB3A 3RMCA 2IA6A 3F41A 1HD0A 3WXIA 5H9FJ 3P5BP 1SI9A 1S49A 2EXUA 4H4MB 4A61A 1S1TB 3PX0A 1J5OA 2ETJA 1SKRA 2ASMA 4CVNE 2I5JA 4WP3A 5F8GA 2X3GA 2IDLA 3OR1B 4DSEA 4ES2A 4DTRA 3ZT0A 2ZHAA 4QIVA 4ED7A 5F3TA 4TU8A 4M3TA 2G8KA 2MKIA 2MHNA 4M3UA 3GDQA 4P10A 2BVZA 4O23A 1NHKL 4C8LA 3TZYA 2QA4N 4BRCA 4K4WA 2XHWA 1XR6A 4TXSA 5IV3A 1U09A 2V8DA 3LQVA 3MXIA 2OPQA 2VUGA 4CZKA 1V4TA 2CA9A 2ZBQA 1OPZA 2K8GA 1BIZA 4B9VA 1YSJA 3CCSN 4MK9A 1VRUB 3FZKA 4FJHA 4LF7F 5EX5A 3OR2B 1MU2B 1NMNA