2YNIA

Hiv-1 reverse transcriptase in complex with inhibitor gsk952
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 163
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yniA05
2O5DA 4KHWA 1XR7A 3RWUA 4OJRA 3MFHA 2J6TA 1UWBA 4ZMMA 5HP1A 1CZ9A 4OKEA 4E1MA 1S0OA 3TAMB 4O4GA 3OYLA 5DG9A 5F8GA 3AVHA 3IG1A 4ZPAA 2YNHB 1LW2A 2OPPB 2G8WA 3KMSA 4C8LA 3NAEA 2Z1JA 3UDLA 1RTHA 2QK9A 5HLFB 2ATLA 3K5MA 3V1QA 1T03B 1RT3A 4EYHB 1TK8A 5CYQA 4I9QA 5DG7A 4CHQA 2OPSB 4ZPBA 4NLVA 4FJKA 1IM4A 3TAFA 2GIQA 4KHNA 4EO6A 3LP0A 1HQEA 3M8PA 3KK3B 3ZSOA 4Q0BB 4RW4B 1IKWA 3GV7B 2AJQA 4CK3A 3EZ5A 3KLGA 1YVFA 3KNAA 4DU1A 4NYNA 1JIHA 3DMJB 4WZQA 5KFIA 1HPZB 2WTFA 1BI4A 4FJ9A 4NLTA 3BQ2A 1N6QA 4CJ3A 2HAIA 4Z4GA 2YKMB 3H98A 3IGVA 3S9HA 2WONB 4MKAA 2YNIB 4FJ8A 1S1UA 4BDZA 4PQUA 4F3TA 1NKBA 1IG9A 4EBCA 3QGGA 1JXLA 1RDDA 4E1NA 4F4KA 4NLPA 5F8NA 3CG7A 1D9FA 1NK7A 2VG7B 3KMQA 3KD5E 3GIIA 1X1PA 5KT6A 3IN5A 1ZBFA 5HRPA 1YTAA 4BE0A 4Y34A 4EP5A 3EZUA 3I0RA 3GV5B 2BQRA 4FXDA 3V1OA 3V9WA 4FVMA 3SPYA 1A5VA 1LAVA 3TAGA 4F50A 2FBTA 1JLQA 1K1QA 4G3IA 4CJKA 2EX3A 4YR3A 3OYAA 5C42B 1U09A 3OL8A 1ZTTA 4FLWA 4GW6A 3SI6A 1VRTB 4CIEA 4OKJA 4HKQA 4E7LA 4KE5A 1X9MA 4ZPCA 3PW5A 4Z4CA 2I5JB 1B9FA 4IFYB 5KFRA 2IGIA 2JLEA 1KCFA 4RNMA 4LSLA 4QAGA 3DOKB 1QS4A 5KFXA 3MXIA 3NH0A 2O4IA 4CEBA 3L3UA 3G86A 1BCMA 5KFTA 2VG6A 4NLOA 4KI6A 3H4BA 4O4RA 3ZSRA 1UA1A 5KFLA 5KFGA 1S9FA 3ZT4A 4KKOB 1TP7A 1RNHA 3AVNA 4FLTA 5DG8A 3K2PA 4B3OB 2OPRB 4FLZA 1D0EA 2HHUA 4DL3A 4Q5VA 1HMVB 3WNHA 3C94A 1FKOA 2YNHA 3T1AA 5EWEA 2X74A 1XI1A 4O5BA 5CZ2A 3VQ8A 3VQCA 1LWEA 2HMIB 3SCXA 1NK4A 3NF9A 3HVAA 4IRKA 1NNDA 4DEZA 4OPKA 5HLFA 4CJSA 2CJQA 3BREA 1TKXA 5DGAA 1IKXB 1NK6A 2FJVA 3NAIA 4G1QB 2P51A 4URSA 4H4MA 1FK9A 1JLGB 1D5AA 2AX1A 1EXQA 1KLNA 2OPSA 1LV5A 2W9CB 5F8MA 4J9KA 2GV9A 3OHAA 1JX4A 2X6SA 2R8HA 2QE5A 2R2SA 2RN2A 4CJ4A 2XY8A 3G6VA 4RW4A 4DS4A 5DQHA 3H08A 3NCIA 2B6AB 4E7KA 1UA0A 4HYKA 3TI0A 4JLHA 2FVPA 3DMJA 4CFCA 1ZETA 1HPZA 2KFZA 1W9HA 2NUBA 4BDPA 4ED7A 4EO8A 4K4ZA 2KW4A 3SV4A 5EUHA 4DSFA 4ELUA 2WONA 4DTJA 2FJXA 4O0JA 2V4RA 1EKEA 3L2UA 1NJYA 4IKFA 3TWHA 1N56A 2F8SA 1C1AA 1RT4A 4GC6A 2IJFA 4CEQA 4I9LA 1A5XA 2ZD1B 2VG7A 2G8HA 3NGDA 1BQMB 4PUOB 3KOAA 2AU0A 1WSEA 3OS1A 1KVBA 2WK4A 4N47A 3UPFA 2X78A 5J1EA 1JKHB 3O3HA 1DTQA 3NF7A 3D45A 5KG4A 1SL0A 5KFHA 4C8KA 4JS5A 3MR5A 3KJVB 1DTTB 4DL7A 1IKYB 3L3VA 1S0NA 1VRTA 4CEFA 1HNIB 3ALYA 1NOYA 1I6JA 4CEAA 2XC9A 1TKTA 4M94A 1RCHA 2XCPA 3PW7A 1HYSB 1NJWA 4IFYA 1ZTWA 4FJHA 3KKRA 3DOKA 2R8JA 2C28A 4ED0A 4JRQA 3CFPA 3RMBA 2DPJA 4IRDA 4DU3A 3G0ZA 4M3ZA 4WXWA 3DLHA 5HROB 2HWHA 3F73A 4FZZA 3MEDA 4ID5B 3OYMA 3TANA 1NJXA 4PA1A 4RW6A 4B3OA 3HHKA 1WAJA 4NLSA 1HMVA 1L3UA 2OZMA 4RNHA 4BACA 3KK1B 1CXUA 1GOCA 3IRXB 3CYMA 3PX4A 5K14B 5KFJA 2YHBA 4XIUA 3DLEB 2DFFA 1IKXA 4NCBA 4PY5A 4J2BA 3CJ4A 2B5JB 3VQBA 3T5JA 4ZPDA 4DFMA 4O44B 4RNNA 1JLGA 4RW8B 1QAJA 5I3UA 5KFMA 4EP4A 2BQ3A 4K8XA 5KFZA 4E0DA 2OA8A 1HARA 4GMJB 4DFJA 3OS2A 3QYYA 2FVCA 4LD0A 3SFUA 4NYFA 4Q45A 3H4DA 2W9AA 3PUFA 1HNVA 3PHEA 3LP1B 2FVQA 1Q9XA 2A1SA 3AVLA 4QWBA 3V9ZA 4NLRA 4GC7A 3AA4A 4O4GB 3QNNA 1L5UA 3MR3A 4WFZA 2IOCA 3EPGA 1T8EA 4ELTA 3QLHA 4RZRA 2BRKA 4CJ5A 3HPHA 4XO0A 1QHTA 3QEIA 2YV0X 2KQ2A 5I42A 5DMRA 3DLKA 5KFAA 2E6LA 3V6KA 4CJQA 2E4LA 1CZBA 3I5AA 4JV0A 2BANA 1CSJA 4DQRA 4DWIA 4TSXA 2XY6A 4KO0B 2J6SA 3NH2A 1JKHA 1S49A 2GBZA 3C95A 1HQEB 4FS1A 1ZBIA 4CJRA 3QIDA 2BDPA 3CVKA 1IKWB 2XI2A 4ECTA 5KT3A 1DTTA 4CEZA 3KLGB 5KFEA 3ZCMA 3SQ2A 5HRRA 4O3RA 3S3OA 3LDSA 5KI6A 3MR6A 2V4QA 1KVAA 4HHTA 5F8LA 1TV6A 1N6QB 4BWMA 2FBVA 1LAWA 2D3ZA 1BQNB 3DLGB 1VSDA 2Y1JA 4EYIB 4PQUB 2KZMA 1RILA 1GX5A 2ZKUA 1S6PA 3SV3A 5HROA 4DTNA 5L1KA 3G10A 4LQ9A 4NCAA 1GOAA 4K4WA 4Y2CA 2IM1A 3AA2A 1C1CA 3FDSA 3PZPA 2BR0A 4HTUA 3KHRA 3PO4A 2ATQA 4M3TA 1RDBA 3ZSWA 3RTVA 3PX0A 3M8SA 1BIZA 3SQ4A 2QV6A 1KRPA 2G8IA 3RAQA 3CDWA 1QAIA 4K50A 4E3SA 1JLAA 4EZ9A 3KK1A 1WAFA 2FC0A 5KT2A 3OS0A 3CM5A 1ZBUA 2HNDA 3KLEB 4O3OA 1T3NA 4CJPA 3GIKA 2DFEA 3BSCA 5EWGA 5KFKA 1ASWA 1TL1A 5J2QA 1Z4UA 5F8IA 1RDAA 1S0MA 2HB5A 4W5OA 4J2DA 1C1BA 4RW8A 2JC1A 2W8LA 4LSLB 3QEWA 1S1VB 3AVBA 2BE2B 1RTIB 3CJ0A 1SH3A 2ITGA 4DFKA 2VG5B 1U45A 1LW0A 4OLAA 1KFDA 3DYAB 4KAIA 2DPIA 1JL2A 3V4IB 4MH8A 3MTKA 2VG6B 1G15A 5KG2A 3MEEA 2D7SA 2FLLA 3NAHA 3MF5A 4U7CA 3BR9A 1S1WA 3LP1A 1TQLA 3DDKA 4B9SA 1Q8IA 4FW1A 1X9SA 3ZSZA 3GV8B 3DRRB 4KHUA 1RT6A 3CQ8A 3KD1E 4ED3A 2IS3A 3RMDA 3HVRA 2G8VA 1FKOB 1JLCB 3VQSA 2E6MA 1LWEB 2QKKA 4CJLA 3VQ7A 3SYZA 4FJJA 3RAXA 1VSKA 2ASLA 3ISNC 3TAQA 3TAPA 1TKXB 1QUVA 1ASVA 2R7YA 2IJNA 3OYEA 3H5XA 5J2PB 1F21A 1HQUB 4H4MB 1FK9B 1SH0A 3GIJA 2E9ZA 3T5HA 3IS9A 3QINA 4XPCA 4Y3CA 3U3YA 4KO0A 4WXOA 3N6MA 3CIZA 1XHZA 5T14A 3SJJA 3CJ2A 3NE6A 3MXMA 5DLGA 2RPIA 4DSJA 4ICLA 4LH5A 4TQSA 2XY5A 3AO4A 3FFIB 4K4YA 5FRMA 4J9QA 1IKVB 4K4XA 1RBTA 1SV5B 3RMAA 3JYTB 5D3GA 2EC0A 4BE1A 1Z26A 3KLVA 4LY7A 2XGQA 4RW9B 3O3FA 2B43A 3M9OB 1KLMB 1BQNA 3DLGA 3P83D 4AHSA 3OYCA 4ECVA 1W25A 1I3AA 3K58A 1KHVA 5HRNA 1JXEA 1IH7A 2C2RA 4ZVHA 4B9NA 4MKBA 3HP9A 1Q9YA 4CERA 5KFPA 1NKCA 4ZHRB 1RT4B 1WSFA 2JEGA 3QERA 4IOBA 3B6OA 3S3NA 2JEJA 5FDLB 3QO9A 5KGXA 3HPGA 5J1EB 2HVHA 3KKSA 3HJFA 4DL6A 1DTQB 2D3UA 3THVA 4ECSA 1LWCA 1BGXT 4HCBA 4FJ7A 4FCYA 3LWMA 4RUAA 3KLEA 3V6DA 2JC0A 3T19A 1JLFA 2UVRA 3HO1A 1UOCA 3M8RA 4R8UA 1R0AB 1UAXA 4WYLA 4TY8A 3FQKA 4Z4IA 1FKPA 4MFBB 1TKTB 1J5OB 3H5SA 1TAUA 4ZP8A 1S1XB 4K4UA 1BIUA 2A1RA 3UIQA 4K8ZA 2HHWA 1L3TA 1S1VA 4DTOA 5FRNA 1VRUA 1RTIA 2BE2A 3KIOA 1SL2A 2VG5A 2PYJA 1GOBA 5KG5A 4FM1A 3DYAA 3V4IA 1B9DA 4I2PB 4ED8A 3SQ1A 5F9LA 3JSMA 3MEDB 3BGRB 4DS5A 4IRCA 4CEDA 2C2DA 3QESA 4C8OA 5L9XA 4ECXA 3SPZA 1U47A 3DM2B 2D0BA 4J9SA 3HK2A 4H4OA 4RW6B 4J9RA 4IDKA 1L3VA 1S9EB 3DRRA 3LWLA 3OJSA 5DGBA 2JEIA 3MEGA 1RT7A 3LPUA 2E9TA 2HNYB 1JLCA 4N5SA 3PJXA 1IO2A 3RBEA 1MMLA 2IM3A 1TGOA 1TK0A 1HYZA 4DLEA 4L8RB 1SKSA 5KFUA 2D41A 4J9MA 4QWEA 2J6UA 4URGA 3M9NB 4DQPA 3E01B 2HHTA 5J2PA 3CJ3A 1ZYQA 3AVIA 1HQUA 3RRHA 5I3UB 3SQ0A 4E7JA 4F2RA 3ISND 4EBDA 3NMAA 4KSEB 3RB6A 3K5LA 4B9VA 3T5LA 3GIMA 5C25A 1EP4A 3OYIA 1SL1A 1TKZB 3L8BA 4W5QA 1C0TA 4CHZA 4Z0UA 4B9UA 2FBYA 3FFIA 1RAJA 1HNVB 4Z4HA 1IKVA 2D0CA 2IM2A 3CDUA 2XGPA 3AVFA 1SV5A 2JEFA 4HUGA 3HSTB 1TK5A 3JYTA 3KLIB 2HVIA 4DL5A 3SUPA 2FBXA 4RW7B 4RW9A 5DLFA 5KFDA 3PY8A 1KLMA 5KFVA 4KB1A 4DF4A 2HW3A 2QKBA 3NGYA 4NCGB 3QLHB 4CF9A 3WNGA 2WRMA 3V9SA 1X9WA 3OL7A 4FJXA 2HHXA 1TVRB 3RB4A 5I42B 1S9GA 4IR9A 1YT3A 3DLKB 4AHRA 3K5NA 4ZHRA 1RT5A 2IC3B 4DL2A 3PO5A 3AA3A 2BANB 1QE1A 1RT2B 5FDLA 1BCOA 3L2VA 4JV2A 4CEEA 4RNOA 2RDIA 5L1LA 5KFYA 2DY4A 4Q44A 3M9MB 4CGIA 4KB0A 4N56A 3PW4A 3RMCA 1S48A 3QZ7A 3DLBA 1EETA 4ELVA 2IM0A 4ZP7A 1R0AA 3PR5B 1J54A 1RDCA 4CGFA 1RBUA 4MFBA 1J5OA 4JUZA 3LANA 1CLQA 3ZT2A 3QEXA 1S1XA 1TV6B 4KREA 4FK2A 5SWMA 4F2SA 2RF2A 3OSNA 1QTMA 3UR0A 5DQGA 1VSEA 2UVUA 4MIBA 4CGGA 1S6PB 1NK9A 1RA6A 3VQ9A 4OVLA 3WNFA 4I2PA 2F96A 3OYGA 1D9DA 3D5MA 3IAYA 3OYNA 1C1CB 3BGRA 3LZJA 3AO1A 1QSSA 3DM2A 4ZTFA 2Q3SA 3T3FA 2YHAA 1SH2A 4E89A 1S9EA 3AO5A 4FZXC 1O1WA 4NZ0A 4MK7A 4CGHA 4IG3B 2HNYA 4CHYA 1JLAB 3I0SA 4M3RA 1YTUA 3VA0A 3EPIA 4R5PB 4ECUA 2HNDB 4FJMA 3MFIA 3OYJA 4IH5A 3KLFB 1WLJA 1TL1B 5J2QB 3SZ2A 3BSNA 3E01A 4O0IA 3H5YA 4Z4EA 3B6PA 3AO3A 1C1BB 2HNZB 3SI8A 4WYWA 1XHXA 3I8DA 2FLNA 4HCCA 4KTZA 3VQ4A 2XCAA 2HHQA 1RBSA 1LW0B 4RNFA 1SKWA 4DTPA 1TKZA 4CFAA 2DTUA 3NFAA 2R2UA 2UUTA 3LP3A 4F4ZA 4YQWA 3MEEB 1T7PA 1KVCA 5KFWA 4FJLA 4B8CA 2C22A 1S1WB 1U4BA 1CXQA 1REVA 4FJ5A 3KLIA 1ZBHA 2P5OA 5KFQA 1RT6B 4AH9A 2W7OA 4RW7A 3HP6A 4KHSA 1NKEA 4FBTA 2OYQA 3A2FA 4NCGA 5C24A 5HBMB 4RU9A 3N6NA 1K1SA 1JLBA 4NLDA 4ECWA 4DU4A 2C2EA 1TVRA 1HJRA 1U48A 4PWDB 2IC3A 4CK1A 1KSPA 3CDEA 2ZE2A 3C6TB 2PYLA 4DQIA 5FROA 3IS9B 3OLAA 2WB4A 5KG3A 4CEOA 1RT2A 2VWKA 4IBNA 3VQAA 4E19A 4EBEA 4TN2A 4ZVFA 3G6YA 4TLRA 3I5CA 4NRTA 3BQ0A 4ICLB 2RDJA 4DG1A 3H40A 1WNEA 2IAJA 4TQRA 3Q8PB 2QXFA 4DFPA 3M8QB 3O4QA 3HM9A 5T7BA 4CJFA 4C8NA 4DTUA 5J2NB 3VA3A 2VA2A 2XI3A 2G8FA 5D3GB 3V6JA 3PX6A 4FJIA 2G8KA 3IGNA 3NBPA 3TVKA 4KHRA 3H5UA 4B08A 3NGZA 1GX6A 4FZYA 1WSHA 3L2WA 4KTQA 2OZSA 1C2PA 3P5JA 4N76A 3QIPA 4FW2A 3LZIA 3N6LA 2OPQA 1D1UA 1N5YA 5KG1A 3VQ5A 4IQXA 5E41A 3GQCA 2KZZA 3NH1A 3BSOA 3V9XA 5F8HA 4M3XA 1S1TA 5J2MA 3QO9B 2W42A 1XWLA 4XPEA 4H8KA 2ZQBA 4IG3A 4KHYA 5CY4A 3PR4A 3T5KA 3SNNA 1LWCB 3VQ6A 5JS1A 2LSNA 2O4GA 2AGQA 4R5PA 2XRIA 4CHPA 3V6DB 4LQ3A 1JLFB 4R8UB 4ED1A 2P1JA 3KLFA 1S5JA 1W0HA 3TR8A 2V9WA 4TY8B 1FKPB 3LAKA 1RDRA 2HNZA 4IR1A 3BJYA 4CGJA 2YNGB 3L2QA 5KT7A 4Y1DA 1RTDB 4YP3A 1C0UB 1VRUB 1KHWA 2F8EX 4OL8A 2DFHA 1RT1B 2Z1HA 2UVVA 4DL4A 3SFGA 2W9BB 4E7HA 3QGIA 1U04A 3VQEA 4FYDA 3CFOA 1VSFA 2Z1IA 2RKIB 1DLOA 4JRPA 3JSMB 1RBVA 4B9LA 4O3NA 2HHSA 4KB7A 4DTSA 3OYHA 3AVCA 4N41A 1VK0A 4H4OB 4YNQA 3NL0A 4IDKB 1JLEB 1HRHA 5KFNA 3OYBA 2IMWP 3MAQA 3MEGB 1RT7B 4JS4A 5L1IA 3ZT1A 2IA6A 4CJUA 3K57A 3ZSYA 5HBMA 2WOMB 2IDOA 1QQCA 2V0NA 1K6YA 4IFVB 1Y97A 4F4YA 4CECA 4Z4FA 4ECQA 5EWFA 1TAQA 3HYFA 3TAEA 5JXSA 3TABA 3KHHA 4PWDA 3V81B 1I39A 3C6TA 4CIGA 4KHQA 1VSJA 4Q8EA 4F8RA 2AQ4A 4OLBA 4EZ6A 3OL6A 3ZT3A 1B92A 4YFUA 4IG0A 3V9UA 4KFBB 5C25B 1EP4B 4LSNB 2E9RX 2VA3A 1C0TB 2W8KA 3HL8A 4NLYA 3Q8RB 3M8QA 4J9PA 3DI6B 3RB3A 4OGEA 4C8MA 2YKNA 4CJWA 5J2NA 4Y2AA 1HYVA 4WFYA 3QNOA 4K4TA 4DSIA 4BE2A 1BISA 4DF8A 2HHVA 4DSKA 2GC8A 2PY5A 3GYNA 4KAZA 4CHOA 2F8TA 4J9OA 3S3MA 4ZTJA 4CHNA 4EEYA 5CYMA 3K59A 4FLUA 3PJWA 1S9GB 3HT3A 1XC9A 4F4WA 1RT5B 4J2EA 3CO9A 4QCLA 1WN7A 3G6XA 4DTXA 5SZTA 1QE1B 5EDWA 3RR8A 3C6UA 4FBUA 1ASUA 3BQ1A 3EYZA 4YR2A 4M41A 3ULDA 4QPXA 4R0EA 1VSHA 4M3YA 3VQDA 3QEPA 4KTWA 1EETB 4J9NA 4URQU 3SUNA 4NLGA 4U6PA 4X2BA 1RBRA 4FK4A 5C5JA 2ILYA 3TARA 4QWCA 2P5GA 3NF6A 4RG8A 2YNGA 4O55A 2FLPA 1NOZA 4ZP6A 1RTDA 2PZSA 1C0UA 4E7IA 2R8KA 3LPTA 3V6HA 2RF2B 4QWAA 1LWFB 1RYSA 4DTMA 3AO2A 3HPOA 1RT1A 4QWDA 2W9BA 3DRSB 2RKIA 5KFOA 2XWYA 3ITHB 1RTJA 4I2QA 1VSIA 1JLEA 5L1JA 3CWJA 1TKDA 3OL9A 3HVTB 5KRTA 3SUQA 4FLYA 2ASDA 3ZT0A 3I0SB 2JGUA 2WOMA 4IFVA 3MR2A 5JS2A 3TAMA 1N4LA 4IH6A 4WZMA 4NYZA 3V81A 2BGGA 1RYRA 5KT4A 4M95A 3QZ8A 2ASJA 3O4NA 4I7FB 4AHCA 3Q8SB 3TQ1A 2OPPA 3L2RA 4TYAA 4KFBA 3PW0A 4LSNA 3OYKA 1SUQB 2AGOA 1T03A 4ECRA 4IH7A 4CIFA 1N48A 4Q8FA 3CJ5A 4FM2A 1C6VA 4CJVA 4YR0A 3DI6A 1VSMA 4W5TA 2FVSA 1REVB 1WSJA 2D0AA 4F4XA 2AGPA 1NK8A 3KK3A 3FRZA 3P1GA 4M3UA 4Q0BA 3NF8A 4K4VA 4GVMA 5KG0A 1A5WA 5KFBA 5F9NA 4FK0A 4HUEA 5C24B 1WSGA 2YNFB 1JLBB 3H59A 2ETJA 1D8YA 4M42A 2ILZA 3DLRA 3FSIA 2ZE2B 4RUCA 2YKMA 4LH4A 4CCHA 2EHGA 3CM6A 4CK2A 4O3PA 2YNIA 2UUWA 2WCXA 3F9KA 3UQSA 1T05B 2W7PA 3OVNA 4CESA 4O3SA 3D0PA 4DG1B 3U3GA 4UQGA 1OS5A 2IAJB 5KFCA 4FJGA 3MECB 3AVAA 3RB0A 3OLBA 3OYDA 3U6FA 3ZSQA 3GILA 1L3SA 3KHLA 4KV8B 3KLHB 3NBPB 4J9LA 3K5OA 2OH2A 3ICLA 5JUMA 1TL3B 2XHBA 5EU7A 3O3GA 5C42A 1QSLA 2I1RA 5KFSA 3QIPB 2Y1IA 2CKWA 2OPQB 1LWFA 1XR5A 3AVGA 4YMEA 3LP2B 1N5YB 2D5RA 3PW2A 4WE1B 4QOZB 3DOLB 5KTQA 5DQIA 2BRLA 4B9MA 3DRSA 3VQPA 2I5JA 4MK8A 4CF8A 3ITHA 3KHGA 3QETA 3VQQA 1MU2B 1Z25A 4M45A 1S1TB 5J2MB 3FQLA 4NLXA 2UVWA 3I5BA 4CJEA 4DTRA 3HVTA 2XY7A 4CF1A 4O3QA 4ZVEA 4ED6A 4ZVGA 1S10A 4KKOA 1NHVA 3V1RA 3KK2B 2AX0A 2IBKA 3DRPB 2OPRA 1U49A 3OYFA 4NLWA 4J2AA 4I7FA 3OHBA 2HMIA 4DMNA 4OKKA 5KRSA 1XR6A 2HWIA 3PVXA 4TXSA 1QSYA 2GUIA 4CF2A 1SUQA 4ED2A 1S6QB 4G1QA 3ZSXA 1DLOB 3EY1A 4AHTA 2B4JA 3RRGA 3OY9A 2W9CA 4B9TA 4MQ3A 5F8JA 4W5RA 4FJNA 2R8IA 2R2RA 4CF0A 1T94A 4FM0A 4HUFA 3Q8QB 1WNSA 3AV9A 4AHUA 3PV8A 3NGIA 3AVMA 1S97A 1KTQA 2YNFA 4JV1A 2B6AA 2FJWA 1UWBB 5HP1B 5KT5A 3CFRA 4K4SA 1FXXA 3HVWA 5DK5A 3KTQA 3IG1B 3RBDA 5KFFA 3AVJA 2G8UA 1LW2B 3LAMA 1BL3A 2GIRA 4Q43A 5KGWA 5KG7A 2VWJA 4DQQA 3BDPA 3HKWA 1RTHB 4FLXA 5HRSA 4IG0B 4HVJA 3VN5A 4TY9A 1T05A 3BSAA 1RT3B 4MK9A 2Z1GA 5CYQB 4QW8A 2ZD1A 3MECA 1BQMA 4PUOA 2ALZA 2YKNB 3AVKA 1JL1A 3D28A 4KV8A 4B8AB 3KLHA 3LP0B 1S4FA 4NRUA 4OGCA 5KG6A 4KPYA 4KRFA 3M8PB 1NJZA 1TL3A 4FS2A 4AHVA 1VSLA 4ECZA 3KJVA 4OPJA 4KBIA 4DSLA 1IKYA 5CZ1A 3LALA 3LP2A 1HNIA 5CYMB 2KTQA 4WE1A 4DQSA 3NKYA 1BI4B 4WFXA 4QW9A 3DOLA 4Y1CA 1HYSA 3AA5X 4FLVA 4NLUA 3OSPA 3NHGA 1C0MA 4ZP9A 4DSEA 2AWZA 1MU2A 3C6UB 1S1UB 3ZSVA 4M3WA 3QEVA 4CE9A 1RA7A 3HXMA 4ID5A 1J9AA 1NK0A 1KFSA 3OJUA 4H54A 1NK5A 1NHUA 3KK2A 3I0RB 2WHOA 2KFNA 3DRPA 1JXBA 2BQUA 4IKAA 1JLQB 3RR7A 4CJTA 4ECYA 3H2LA 3IRXA 1SKRA 5K14A 1WSIA 3QGHA 4AILC 4CFBA 4W5NA 3NDKA 3DLEA 1EX4A 4MIAA 3ASMA 1J53A 1S6QA 1BHLA 4TYBA 2B5JA 4F3OA 1ZBLA 4KHMA 4O44A 4ID1A 4KI4A 2FVRA 1RTJB 2R8GA 4I2QB 3QIOA 4BDYA 3SUOA 3WNEA 4NLQA 1YVUA 4BWJA 3MXJA 1ITGA 4DLGA 4CFDA 2R2TA 2X6NA 3E51A 4CGDA 2XO7A
chains in the Genus database with same CATH superfamily
3TP2A 1HBMA 1ZXOA 2K7KA 3E1YA 1QDUB 1RHRB 3MFHA 4GKJK 5B09A 3AY0A 1UWBA 3HFVA 4DV1K 1RFQA 3TAMB 5CCMA 4O4GA 2ZBIA 3H1VX 5F8GA 1L3KA 3IG1A 4DV2F 8ATCB 2R7RA 2HS4A 2ZZMA 3NAEA 5BREA 3OR2A 4C2MA 4LF1A 2V52B 3VGLA 2HQ3A 2R7TA 3NGRA 4MYTA 5CYQA 3C15B 4OYBA 1A0OB 4JV5K 2VB6A 2OPSB 1HNXJ 1VBXA 4TLQA 3GR0A 1VBYA 3M8PA 5DS7A 4RW4B 4WIIA 1Q4RA 2XZDB 3EZ5A 1QUPA 1B99A 2KHOA 4DU1A 1JIHA 3DMJB 4WZQA 1HPZB 4DPTA 4FJ9A 3BQ2A 4CJ3A 2HAIA 5LJWA 3O44A 3RYLA 3S9HA 4X4TA 4FJ8A 4KH1B 4F3TA 4F0KA 1NKBA 1T02A 4DR1J 2JH3A 4LF4F 4E1NA 2CJBA 3CG7A 4AM6A 2YQ1A 2FC9A 4PXCA 2BJ3A 3KKFA 1N34J 2B7BB 1YTAA 4Y34A 4O8UA 3EZUA 3I0RA 4FXDA 2RQCA 2XSFA 3JQMA 4F50A 2ZH7A 2LQ8A 1LOUA 3OYAA 3BDEA 1O8BA 1U09A 2E20A 4XAKA 4LRFA 5GAGU 2AZ1A 4RCHA 3SI6A 1HNZK 4CIEA 4HKQA 1T3VA 4LFBJ 3CIPA 4P9SA 4Z4CA 4C8YA 4BR7A 4AQYK 1QS4A 1F0XA 3WEEA 5J1PA 4DI6A 3ZEUB 4CEBA 2GJFA 2Q1NA 2HRUA 1R27B 1RWPB 2HBQB 2VG6A 4DR2K 3H4BA 2NNWA 2RUGA 2I0XA 1XQIA 3EXYA 2DCLA 5KFGA 3ZT4A 3HCXA 1WC6A 1JCGA 3MDQA 1EKSA 4FLTA 5DG8A 4BRFA 3ID6A 4DL3A 4Q5VA 1EARA 4IOAQ 4A48A 3C94A 1W2IA 1UJ4A 2QT7A 4BRQA 1LWEA 2HMIB 4JI1K 1NK4A 3NF9A 1M90T 2UU9F 1TKXA 2YJEA 1IKXB 1NK6A 4G1QB 4PG5A 3VMFB 2XYPB 1FK9A 3AAPA 1WBBA 2AX1A 1KLNA 4IO8A 1X4FA 2I6WA 3AH6A 5F8MA 4WJBA 1V5IB 3HHLA 2X6SA 4JI2F 3QAUA 4I67A 4H03B 1T9TA 3DXKA 1UA0A 4HYKA 3UD5A 2FXUA 4JLHA 4FYWB 1ZETA 4USVA 1W9HA 4M5GA 2NUBA 2HHHJ 1IQTA 3C0BA 5BYQA 4IO1A 3E8OA 1SBRA 2KW4A 4DSFA 4LRAA 2WONA 3PACA 3OBYA 1NJYA 2DO4A 1N56A 1VQYA 2HIQA 1NGBA 2V50A 4GC6A 2K3KA 3BP8A 1YI2S 1HNWJ 2G8HA 4LRBA 2AU0A 2CQIA 1KVBA 4N47A 4JD2B 5J1EA 5GMEA 3O3HA 1BG3A 3D45A 5KFHA 1WG5A 4OZ2A 4IOCQ 3QSIA 4EFAC 4C8KA 4JS5A 3MR5A 1F1BB 2AJ4A 2EVZA 4DL7A 3KG1A 1IKYB 1TUGB 1HNXF 3UVJA 4JHDA 3G4SN 2FHOB 3KNGA 4HR2A 2XC9A 1RCHA 3PW7A 1HYSB 4PCQA 1FRXA 4IFYA 2MB0B 1XERA 3PYDA 2RU3A 3AGRA 4MLHA 4QIGA 1FXDA 4WXWA 1SJRA 2ZZTA 3CCUN 2HEKA 3MEDA 1VLYA 3OYMA 2Q79A 1U1LA 1YAGA 2MKSA 3BYRA 3FVYA 2MLYA 4BROA 4OI4A 1U02A 5HI7A 4DR1F 1VYAA 4KR0B 5A8WB 2OZMA 4NL5A 3KK1B 2DR6A 3C66A 3CF5Q 5KFJA 3IMXA 3KJQB 1HR0K 4FKXA 5LSOA 4J2BA 1CJUB 3W8PA 4A59A 2H51B 1JLGA 2VHGA 5F41A 1HARA 4A5AA 3D7EO 4GMJB 4L75A 5A6WA 1D4XA 2DIUA 2WSFC 4LFBF 2KHCA 2KO1A 3O6WA 1B0VA 4Y2MA 1ESVA 4DCJB 3SSQA 2ZGZA 4DR6K 2P9EA 2VFVA 2QLXA 1HBMB 3PUFA 3BKUA 3P3DA 3PXGa 2YKPA 4PG7A 4OPHA 3TW0A 5HMXA 5LMNK 4O4GB 1L5UA 3MR3A 1OYDA 4WFZA 1XEZA 3MN7A 3CO0P 3EN9A 3B4MA 4DV2K 3QLHA 4DQ8A 3OR2B 4LR8A 4CJ5A 3KJNB 4XO0A 1QHTA 1LXJA 1JNRB 4HDGA 4JI6K 2QWLA 1G1XA 3M2VA 3LDNA 4CJQA 2E4LA 1CZBA 4JV0A 3R5AA 2YVSA 4DQRA 1P8GA 1UTAA 4KO0B 4QPTA 5ETLA 3R6LB 2IHR1 4FP9A 4CJRA 3A1YG 3CVKA 2LCWA 4Y2IA 2NZTA 3DU6A 2ZM6F 2Q6CA 1NMNA 4QIEA 3R8EA 4O3RA 1S72S 4PRFA 3FCWA 3LDSA 2CJYB 4K59A 1RTZA 1X31C 3FCVA 4DJBA 2QRRA 3OTBA 2V4QA 1KVAA 1CC7A 3FSYA 1LAWA 1M90O 2MKCA 1VSDA 4GKJJ 2UXDK 1PJ7A 3QICA 3VEOA 1RGVA 4LF8J 5D4OA 3SQGB 2GMJA 1S6PA 5JJBA 5HROA 4NCAA 1RI7A 4XTTA 1YJVA 3S6EA 1C1CA 3FZKA 2VFTA 5AE1A 3I96A 3NRBA 5AQPA 4YB6A 3TOQA 3RTVA 3PX0A 3Q86A 2DNKA 2ZHAA 2G0IA 1KRPA 2BA9A 5L8RC 3RAQA 3CDWA 1VGYA 1HNWF 4K50A 2XZTB 4JKCA 3OS0A 1ZBUA 5K20B 2RHKA 1ZA1B 4FN5A 2CDQA 2IRUA 5JLFA 5KFKA 3LL3A 1V4TA 1ASWA 4DDFA 9ATCB 3H90A 1S0MA 4RW8A 3FZFA 2ZJPL 5M1OA 4V19X 4LR9A 1LW0A 4RU2A 2DPIA 1JL2A 4MH8A 3LDOA 2VG6B 3F5TA 3W5YA 3K5PA 2D7SA 3MF5A 5H1SQ 3GPAA 4IJNA 1TQLA 3DDKA 4B9SA 1YHQS 3Q2TC 1Y5NB 2J7UA 1ZBTA 2IS3A 2PMZD 3OXLA 2M70A 4RUBA 1JLCB 3NMUA 3VQSA 1GLAG 2V6AA 1LWEB 1IBLF 2QKKA 4CJLA 3SYZA 3RAXA 1VSKA 2PI5A 5HATA 3ZX2A 3TAQA 1TKXB 2VC1A 8AT1B 1QUVA 1CJVA 5EX0A 5E5NA 3CMES 3GTYX 2R7YA 1BXNA 2ZJRL 1F21A 1FK9B 1DGKN 3IMQJ 1KVIA 3U3YA 5E3QA 1HNZJ 2ADCA 3N6MA 3NS6A 1RQ0A 1M5PC 2E88A 1R0BG 1IN0A 2XY5A 1FD8A 3DXKB 2RH3A 4BE1A 5KAKA 3KLVA 5IT9Y 2CQ0A 4OYZA 1YG0A 2B43A 2JWNA 2UV8A 3NS7B 3M9OB 1KLMB 1BQNA 2YWEA 3P83D 4AHSA 1KHVA 3GOIA 4CBXA 3CDAA 4C3KA 2QW9A 2VFRA 2HQFA 4OV1A 4B3MK 4B9NA 4MKBA 4FWOA 4QS9A 4R79A 1EWRA 4BRLA 4YDDB 3FMWA 4IOBA 1RHUB 1NPRA 5AQXA 1KR4A 3HM8A 3HPGA 3WIVA 5J1EB 5MLCV 2IVPA 1X3NA 5K9FA 2YJFA 4H5RA 1LWCA 4FOIA 3R3LA 1OIAA 1OY8A 1FWKA 5FPDA 1UOCA 2YWHA 3QBWA 1TFYA 3M2RA 1UAXA 2OHDA 4JHDB 3WQUA 2VBZA 1VQ8S 4KGZB 1J5OB 2XG8A 3IA0A 5AT1B 5DDOC 2QLJB 4K8ZA 3CEDA 3R3TA 1URNA 1YZ6A 2VG5A 5G0RA 1R0CB 2PYJA 3AAQA 4FM1A 2BJDA 2NXUA 4EHUA 4HACA 4PR6A 2DYAA 1REGX 2CNOB 3JSMA 3MEDB 3BGRB 1NCLA 4C8OA 4ECXA 5IFMA 4H4OA 4DV7F 4LF8F 1L3VA 3JXOA 2NR0A 1S9EB 2XZWA 2W4PA 3C46A 3CPWM 4JOUA 2VASA 1X4EA 1ULRA 3RBEA 1MMLA 3BO2A 1TGOA 4LSZB 3U9ZA 3R1HA 1SKSA 2A41A 2VPXB 4B1YB 4C48A 4J9MA 2AT1B 4QWEA 2V51B 2GTDA 2QTDA 3E01B 4LRCA 4A46A 4E7JA 2QI2A 4NLBA 2DNQA 1CG2A 3EE3A 4KSEB 3VTHA 2JZ5A 4CQ1A 3R8YA 3RG6A 3IFEA 5DDPC 3L8BA 2P9IA 2LQ9A 4KBOA 4H4KC 2D0CA 3AVFA 1VQKS 1UVMA 1SV5A 1HFEL 1WC3A 1WKJA 3HFZB 5FLXY 4DL5A 4F36A 3SUPA 2EK1A 3EJMA 4X65K 4RW9A 5KFDA 3BM7A 3I33A 4DF4A 2QKBA 2M52A 1QQNA 3QLHB 2XTJP 3R5BA 5F3TA 3WNGA 2WRMA 4DR5J 3JTNA 3TVZA 5B7WA 4V1Ak 4JKHA 1HPMA 4ZVSB 1RT5A 4DPUA 2O8EA 1IR1A 1UW9A 4FYYB 3TZXA 1QE1A 2JVRA 4UQTA 5FDLA 1BCOA 2O8BA 1H7WA 4RNOA 1HR0J 1RJJA 4KB0A 2ZDOA 4LF5F 1S48A 4DV0F 4JP8A 4ELVA 3PR5B 3AA8A 1J54A 3M6WA 2ABYA 3O3LA 3LANA 3M7VA 3QEXA 3D68A 4KREA 3G2XA 5SWMA 3HSDA 2OSRA 3OFGA 1AB8A 1JK9B 3UR0A 4ILHA 2UVUA 4IO9L 1S6PB 4M63A 5LMNJ 1NK9A 4RJVA 3OYGA 3OYNA 5AQNA 1C1CB 2QL5B 3DM2A 2V2KA 2Q3SA 2YHWA 4E89A 3SBGA 3NGKA 3AO5A 1OH7A 1NM1A 4JI6J 2BW2A 4WK3A 4F4AA 1EQYA 2DNMA 2HNYA 1HI1A 4M3RA 5GAGP 1YTUA 2A1BA 5IM0A 4HWIA 2CGJA 1YWXA 2YBVA 4DV4F 2XWXA 5GIPA 4O0IA 5IT9U 4LVOP 2B4UA 2COLA 4UOCA 2HNZB 1CEZA 5AQJA 2DK2A 2X1FA 1X5OA 1MW7A 5BRDA 1HBOB 4HCCA 3IDHA 5IZHA 1LW0B 2RHSB 1MN9A 2HIYA 1TKZA 4F0HA 4OI2A 3NFAA 1QTNB 2UUTA 3LP3A 4F4ZA 3TU5A 3CC7N 3TEHB 1X4AA 2DH7A 2C22A 2Y1RI 3LW5C 1Z05A 1BUXA 1SVDA 2UXDJ 5KFQA 3A8KA 3J80Y 4AH9A 2W7OA 2M2BA 1HKCA 3RUBL 1F3VA 3TJAA 5LL6Z 4N77A 4AYBD 5C24A 2KG0A 4NLDA 3T1YF 2VQEJ 2DNZA 1OMSA 1CJVB 4PWDB 2VOPA 2IC3A 1KSPA 2IDEA 3CDEA 3C6TB 2RJZA 1LNQA 3U1NA 1H1VA 3EE8A 3OLAA 2DNOA 4MJKA 4QR2A 1BOTO 2VWKA 4TLRA 2MKKA 5AR0A 3THYA 2RDJA 2ZF5O 4BR5A 3H40A 2A18A 3U02A 1WSRA 3C7NA 3Q8PB 3M8QB 2F65A 5T7BA 4H4KA 3FUYA 3MPYA 4C8NA 2FSNA 1H2VZ 3VA3A 3V6JA 4KHRA 5AQIA 3H5UA 3NGZA 2VBXA 4TKTA 3BBFA 1WSHA 1NMDA 5CR4A 3P5JA 4OZJA 3N6LA 1SAZA 3KUEA 3DNCA 5B0FA 2P9PA 3VQ5A 1SI9A 2YQ3A 4FNIA 5T7LA 4PYDA 2KYXA 3RSEB 4OYIA 4JK8A 3W2VA 1MWKA 3E66A 3NH1A 3UNYA 1UAWA 1M5HA 3F0NA 4DR5F 1YITN 1KKHA 5F8HA 3VAIA 4M3XA 5J2MA 1UZDA 1FFGB 5CXTA 1XWLA 4XPEA 4KHYA 3T5KA 1LWCB 4FWNA 2AGQA 1NH8A 4BRCA 1MWMA 1HI0P 4XDCA 3TR8A 1HQ2A 5FLXU 1VAZA 2VV5A 1NSKL 4NE9C 2VBYA 4IR1A 4BR9A 4CGJA 4JI8F 3CCQS 1C0UB 4G65A 2ZGYA 2CWXA 5G0RB 3DAWA 3EGVA 1KHWA 4OL8A 4X62F 4WYBA 3G9CA 2JHEA 3SFGA 4Y0FA 3VQEA 2ZNZA 3CFOA 1VSFA 3AQOA 4FPRA 3JSMB 4J7CA 2Z8QA 4O3NA 4KB7A 1O0PA 1FRMA 4H4OB 1R89A 4YNQA 4K8RA 4DV7K 1GTHA 1JLEB 3CCVN 3CDBA 3OYBA 1IUJA 3IM8A 1FDAA 5L1IA 3L4IA 4FSVA 2FUG9 3K57A 4USKA 5F3ZA 2WOMB 4JI4K 2V0NA 3K17A 4IFVB 2V7YA 4F4YA 4CECA 3QMQA 3HYFA 1R3NA 2PDAA 2KRRA 2R7VA 3V81B 3M30A 1I39A 3BN4A 4EFHA 2M8DB 4CIGA 3ZTQA 4ZVTB 6FDRA 4CI6A 3ZETA 4OLBA 3OL6A 2X1BA 4LFAJ 4WTYA 3V9UA 4KFBB 2W2QP 2DXEA 2E9RX 1H3DA 2W8KA 3HL8A 2P9IB 2C2KB 2YWGA 2X3GA 3TVYA 2BM1A 4H5WA 5J2NA 2MEWA 4JI3J 4K4TA 4P2SA 2AYEA 1BISA 2RMLA 2PY5A 3GYNA 1XTZA 4H0PA 2F8TA 2N3LA 1H7XA 4J9OA 3VAJA 2QEXN 3QFHA 1YGYA 3ZTSA 3K59A 2FY8A 4JB8B 4NYOA 2LKZA 4WWSA 1Q81T 5AFUH 1RT5B 4CT8A 1WN7A 1DFDA 4DTXA 1QE1B 2EFOA 3BQ1A 4LRDA 3GCWP 2E1ZA 1VSHA 3VQDA 3QEPA 4LF5K 4DV0K 3IAS9 1KD1T 4YDXA 1VISA 4OYPA 2HG4A 2J0SD 4M5KA 3J80U 3MZIA 1JJ4A 2VPWB 3J7Z5 3F9MA 1OPZA 4WP8A 2R8KA 3V6HA 1FDDA 4QWAA 1R8CA 2IRXA 3N28A 3AO2A 2Y9HA 1RT1A 4QWDA 3ET6A 4WQ4A 4X65J 1KTVA 4EAHD 2RKIA 1X0FA 2F9TA 3O08A 4I2QA 1MNEA 1RCOB 4KQZA 4CLUA 4CZHA 2MYFA 2G13A 2HKEA 3J7ZT 5F0XA 3UN2A 2FHKA 3QATA 1OY6A 2VBWA 2R7OA 1W2BR 3MOJB 1K0VA 3MM5B 4CTAA 1TFWA 1XK8A 4H0OA 1S4EA 2D1KA 1EQMA 3W3SA 2BGGA 3BKTA 5KT4A 3QZ8A 4LF6F 2MJNA 5HJXA 3O4NA 4I7FB 4CYUB 4GNIA 3HTVA 5BR9A 2MQ8A 2ASOA 4TYAA 1SUQB 4BCAA 4IH7A 1C6VA 3D3CJ 2H3EB 3LTOA 4YB5A 1ZC6A 3DI6A 4KHPF 1Y5IB 3H1QA 4F0MA 2D0AA 3MURP 4M3UA 2WVFA 5M2PA 4GVMA 2XSJB 4RKUC 2GIFA 3CJSA 3M3ZA 4CLFA 5C24B 3EEQA 2DNLA 3A8EA 3JS6A 1JJ2M 2ETJA 7FD1A 2ZC4A 1D8YA 3ETOA 3O5BA 3NVMA 4HEA9 2P9CA 2XMVA 4WIQA 3N4PA 3FSIA 2Y3YA 1O51A 4OLPA 2H54B 4J91A 1U1OA 5F2RA 4CCHA 4CK2A 1VC5A 4WFNL 4ZJOA 3FC9A 3SCJE 4YDUA 3LOUA 3THYB 4ZIWA 1WKKA 2W7PA 1XIQA 1NGCA 3TO8A 1YDLA 2DNRA 1MMNA 4LFAF 3U6FA 1O5JA 3ZSQA 3GILA 3AGKA 3NGUA 3KLHB 2CJKA 1ZM3A 1RWNB 4J9LA 1VQ9N 4LMZA 3ICLA 5EU7A 4ETXA 4OYAA 5HL7Q 4K42A 4IYQA 3AVGA 1PJ6A 5E26A 3TTDA 3PW2A 2P9PB 2DHXA 3CCRN 4QOZB 5EVZA 5T7LB 2LEAA 4DMZA 4F3MA 2I5JA 4MK8A 5L9NA 3W2VB 1QQMA 4CF8A 3KHGA 2DNPA 1Z25A 5ETMA 2CPXA 5J2MB 4USHA 2OELA 4ED5A 4UOHA 4ZPWR 4Y28C 3HVTA 3W5ZA 4CF1A 4PPDA 4DZDA 1UVLA 2W4CA 1JJCB 2PI4A 3BF4A 2HZCA 4OHZA 1S7IA 2AX0A 5A2QY 3DRPB 1PKUA 1SXLA 2RUSA 3QT7A 1RWWB 4JI8K 1LOTB 2EI5A 4L3QA 3DOMB 5E33A 4LF7J 4H5VA 2JFDA 4Z2XA 4USUA 1XR6A 1Q81O 4TXSA 5KOWA 4X62K 1UL3A 4CF2A 2DISA 2PGCA 1NWKA 2CPDA 2QA4N 3RRGA 1NGJA 1VBZA 3O1WA 4R25A 1KAZA 4CD3A 1WEZA 4ZLJA 1PIEA 4HUFA 4U8YA 4P2MA 1E6YB 4AHUA 1YJUA 4OYWA 4M7YA 3AOAA 4IUFA 1EO1A 4QZVB 3UKRB 4EMDA 3A5LC 4JKDA 4OZLA 2B6AA 2FJWA 5KT5A 4WCEL 4RBVA 5DK5A 3M30B 3AVJA 3GE9A 2MZ1A 3QRRA 3LAMA 4W4MA 1BL3A 2GIRA 2DGWA 4P74A 2D3O1 4X4PA 3ZETB 4DQQA 3D6RA 3H46O 3HKWA 1F60B 4HTIA 3A4TA 3IBCB 2CVEA 5B8HA 4HL9A 2E2PA 2Z1GA 4MK9A 4B3SF 4Y6IA 2ZD1A 1BQMA 4PUOA 2ALZA 1BHNA 1RAAB 3J7ZO 1SKUB 3D28A 4B8AB 4DHVA 3LP0B 1S4FA 4KPYA 4DV3K 1D8ZA 3IBFB 3TUZC 2B9YA 4DSLA 1SZ2A 3OXGA 4YY3K 2CH6A 2C3OA 1XJWB 2KTQA 4WE1A 4KPCA 5AFUA 3CPWR 3AJDA 3AA5X 4NLUA 3MCPA 3NHGA 2Y8YA 4ZP9A 2AWZA 1SJ3P 1HKBA 1MU2A 4JI4J 1U25A 4YB1P 4DCPB 4LFCK 1RA7A 1MROA 2V8DA 5KPTA 3HXMA 2O8DB 4EK2A 5EY4A 1KFSA 3OJUA 3P8BB 1YTYA 1NK5A 4LIWA 1NHUA 3KK2A 5JICA 4GVBB 3KG0A 4KY3A 4V19J 3CQXA 3V5RA 4ECYA 2BH1A 1FTRA 2C2MB 2Z58B 1GNKA 3QGHA 1G4CA 2CQPA 5IQ6A 4AILC 4A8KA 4CFBA 3NDKA 3DLEA 1JWWA 4MIAA 3OVBA 3POTB 2R9LA 1VK3A 4F3OA 1SJ4P 4O44A 1CQMA 4IDHA 2R8GA 4I2QB 4NO7A 4A8YA 1IM6A 3Q89A 2JLFA 3SUOA 4DN0A 3L6QA 4FWPA 1ITGA 1N0VC 1RAHB 1J5EJ 3O9SA 3CPEA 3E51A 2HF3A 2XO7A 4CGDA 2N4CA 2YHXA 4KHWA 1XR7A 3RWUA 1NDPA 3CJKB 2XS7A 3L9ZA 2J6TA 4CTAB 4ZMMA 5HP1A 1CZ9A 4OKEA 4E1MA 1S0OA 3OYLA 5DM6Q 4P6QA 3D1OA 5DG9A 2V69A 4ZN1A 4LF6K 2YNHB 1WEXA 1LW2A 4D3GA 2CZ9A 4EWTA 5D6GA 1RK8A 3UDLA 1RTHA 2QK9A 5JVHQ 1CJTB 1VHFA 1IJEB 5AZIB 1RT3A 1TK8A 1Q0NA 4I9QA 2DHAA 4CHQA 4LF7F 2BJ1A 2VFSA 3MEKA 1KONA 4ZPBA 4NLVA 4FJKA 4BRMA 5JVGL 1N5TA 3TAFA 2GIQA 4KHNA 4BRGA 1Q82T 3DDIA 4ZKAA 3US5A 4OZ5A 3ZSOA 2RS8A 5BRHA 2CADA 1CS4A 2LDIA 3W2WB 2QA4G 2NYIA 3C19A 3KNAA 2YKOA 3QFUA 2CUYA 2PIIA 3KK7A 5ADZA 5A2QU 2WTFA 1BI4A 5D0HA 5C2FA 2VC0A 4E2FB 2DH9A 3H98A 3NGTA 1HIYA 2CPEA 4CZEA 3UNGC 4MKAA 4ZA1A 4DV5J 5IC4B 1S1UA 4KH4A 2O8CB 3MM9A 3QGGA 4UUXA 1CJKA 1D9FA 2VG7B 1X1PA 3IN5A 1ZBFA 4JYAK 3RRKA 3I6PA 2ZWOA 4EP5A 2RRBA 1OQ3A 4NPOA 1AUDA 3IXQA 3SPYA 2O66A 1LAVA 3NG8A 3TAGA 1JLQA 1CULA 1K1QA 3BPSP 2CQ2A 4PWUA 3R5GA 2FJAB 2M7SA 2NRXA 4OKJA 5LT5A 4KE5A 1X9MA 2LECA 4BLGA 4ZPCA 1FXLA 3CCMN 2I5JB 2K8GA 2FZCB 5KFRA 4QAGA 3DOKB 5EHHA 3MXIA 1RE1B 3NH0A 1V9OA 2AYGA 1BCMA 3K2YA 4NLOA 6FD1A 3GFXA 1SIWB 3IWNC 2DGVA 2RILA 1S9FA 2VU5A 3R1XA 4TVAB 1TP7A 2LYVA 5B0EA 1PO6A 3W1YC 2GFFA 2HBYB 4B3OB 1QZ5A 4FLZA 2D74B 1VQ4N 4WQ5C 2D69A 2QA2A 1HMVB 1S99A 3IAM9 2VONA 5CZ2A 2Z4PA 4FWMA 4IRKA 1NNDA 4DEZA 5HLFA 5C2GA 3P6YC 5M2RA 4MYUA 4P2XA 1LCUA 4H4MA 4A2BA 1D5AA 1DZ5A 4OMFG 1LV5A 2ZUAA 3GCXP 2HBKA 2GV9A 4CI0B 2QWRA 5HK4A 2ZDPA 2R8HA 2R2SA 1WC4A 4DS4A 2DCUB 1S79A 1YJNN 2DR7A 3N5FA 1SJ1A 2B6AB 5AE2A 4WPAA 3KWMA 4EO8A 5IV3A 4J9VA 3W0LA 1XMQK 2ACMA 5EUHA 1T95A 4ELUA 1J2VA 1ZZFA 2C2OB 4V19S 4DTJA 1WI6A 2FJXA 2CGKA 3U9DA 5M1NA 4O0JA 2V4RA 2DVIA 4I68A 5AQVA 3J7YP 3T1HF 1RT4A 2F4VJ 2XLIA 3CCWA 2ZD1B 3ZNJ1 1V3RA 3N9UC 1BQMB 5CZVA 4PUOB 1SPBP 3D2WA 3A8JA 2NREA 2WK4A 4C11A 1JKHB 1Q5YA 3NF7A 1B0PA 5KG4A 1Q79A 2AEMA 1DTTB 3I9ZA 6AT1B 3P5TL 2WVDA 1TYQB 1VRTA 2V8GA 4CEFA 1FE0A 1NBWA 4PAAA 2QWMA 5D4NA 3D7SB 1TKTA 3CC2N 1G6BA 4YN3B 3A3OB 3H2UB 3JS9A 2MSSA 1VQMS 2R8JA 2C28A 3W63A 2FF6A 3D1QA 4JRQA 3HF5A 4IRDA 2IVFB 2L48A 1TMJA 2AV5A 2EXUA 5D0EA 2G2OA 4USIA 1NJXA 1Q82O 1OYEA 3UN3A 1RAGB 3FGUA 2RD5C 2OAUA 3OUYB 4NLSA 1T6CA 3BGLA 2HBZB 5AQLA 1CXUA 2V8VA 3PX4A 4CZIA 3GJQB 1U2RA 2YHBA 4FVUA 1FRJA 3GR1A 4XIUA 3DLEB 4NCBA 4PY5A 1WD6A 3FSXA 1I94F 4JI7K 4DV3J 4O44B 4RNNA 4ANEA 1NGAA 1RHMB 5I3UA 3HHNB 4EP4A 4K8XA 2Z0GA 4U9RA 1WTBA 2OEMA 3H2VE 5BPNA 4YY3J 2ZC3A 5F0WA 3QYYA 1UVKA 3FR0A 4LD0A 4ID8A 2W6KA 1N33F 4Q45A 3A3NB 4USTA 4QIVA 1UP1A 3J7A1 3LP1B 1WI8A 1VK8A 2NXNA 4GC7A 3AA4A 2GX8A 4JI0K 2VZ9A 3BS9A 2BJEA 3IR5B 2LEBA 1PYOB 3ENOA 4HI1A 1AZSA 3OTOJ 3IFRA 3MPDA 2V94A 1YJWN 4U7BA 2YV0X 1FT8A 2KQ2A 2PSZA 3BN7A 3Q0AA 2FSKA 5KFAA 3V6KA 3CUNA 3I5AA 4JI5J 1GLLO 3ENHA 1CSJA 2GWJA 3DFEA 2XY6A 3NH2A 3CGIA 3C95A 4TU8A 1YXQA 1GTEA 2AJ2A 3EZOA 3RBZA 4I69A 3PKMA 2H5EA 4BC3A 1H6KX 3S3OA 4OJHA 3AY9A 3MR6A 2W6LA 4DR3J 1TV6A 3DLGB 2FDNA 3E3XA 3PSIA 3O9UA 3SV3A 4W92B 5IT9O 2ZH1A 4K4WA 4Y2CA 3AA2A 1CJKB 2ZBCA 3FDSA 2OTJS 3IR6B 1GT8A 4CNZA 3PO4A 2ATQA 2L3MA 1IVZA 3ZSWA 4OX9K 3MD3A 1MSWD 3G8QA 4ALZA 1BIZA 3SQ4A 3IBWA 1Y9OA 4FF4A 2F4VF 3EL2A 2YX1A 2PFUA 5ETNA 1JLAA 1HWJA 1WAFA 3CM5A 4K0KF 4CO2A 1RKJA 3KLEB 1RB0A 1FWPA 1T3NA 4CJPA 3GIKA 1WUAA 3BSCA 4LF9K 3UE5A 5AZJA 1ZH5A 1TL1A 5F8IA 2IRYA 5AXLA 3LM9A 4J2DA 3CCSS 5KOXA 1A9NB 3MDFA 1WUUA 3QEWA 1S1VB 2BE2B 1SH3A 2HZAA 1U45A 4YOEA 1CPZA 3CC4S 2BM0A 4IFEA 3DYAB 2DR8A 3V4IB 1AUSL 4OHWA 3MTKA 1TUUA 2YX4A 2C1EB 3X3UA 1U1PA 5KG2A 1G15A 3MEEA 1A6LA 2MXYA 4U7CA 3BR9A 1RU1A 1N36K 1S1WA 3FEZA 3ENAA 1Q8IA 3ZTOA 3ZSZA 3MHYA 4KHUA 1RT6A 1P8ZA 2CH5A 4YOWA 1U1NA 4A47A 2E7XA 2OUGA 2XMMA 4JYAJ 2BW7A 4DOZA 2ASLA 3ISNC 3TAPA 3M8YA 2ACYA 2MHEA 1RBLA 2H9ZA 4H4MB 1AROP 1KOOA 3QINA 4XPCA 3GG0A 4Y3CA 3I56S 1FO1A 2L9NA 1YJ9N 1SQKA 2JVOA 4GV9A 3CF5L 3CJ2A 3MXMA 4DSJA 2OANA 3AO4A 1CVJA 4M7XA 3FFIB 4K4XA 1FI4A 4C0BA 3JYTB 2EC0A 5AJ3F 1Y10A 4C1NK 2FZGB 3BUZB 1MWZA 1W25A 2KT2A 2EK6A 1P9QC 1WORA 4L74A 3BR8A 5FLXO 5ETOA 4ZVHA 4A2AA 3H20A 4M1KA 1Q9YA 3M6UA 1K8AT 5KFPA 2UUBF 1RT4B 3T1HK 5CH7B 1KAXA 3FZ2A 2BKPA 2QJ3A 2Q31A 1PBUA 2JEJA 2KN4A 3R6MA 5KGXA 3WDOA 3Q8VA 4OHVA 4RUAA 3AB2B 3V6DA 4GY2B 3T19A 1JLFA 2UVRA 1ZAXA 2P9LA 4R8UA 5H9FK 2WW4A 2BE9B 4WYLA 1N52B 2CG4A 3SAGA 4MFBB 1TKTB 1WHWA 2B3TB 2VDIA 4AD6A 4MKYA 1S1XB 2XBPA 1BIUA 2A1RA 3UIQA 5AQUA 1X4GA 1IBKF 1AFIA 1RTIA 1SL2A 2LDYA 4P7TA 3MMVA 1GMVA 1GOBA 5H1SV 1FDNA 4ZOSA 2DGTA 2VQFJ 3CJ7A 4I2PB 3J81Y 4C6AA 4LC9B 3CI5A 1XMQJ 3DHXA 2Y8WA 4OYOA 5L9XA 3SPZA 2D0BA 4J9SA 4J9RA 2KFYA 3O4WA 3DRRA 3LWLA 3OJSA 5DGBA 3DLLL 2MQNA 1OSCA 3MEGA 1RT7A 2FYXA 5AQSA 2VD3A 2YHYA 3I8BA 2XEXA 4N5SA 2MQOA 1IO2A 3AQPA 2BXJA 2PMWA 1TK0A 1HYZA 2CAJA 4DV6F 4Y0WA 5KFUA 1MMDA 3CD6S 1Y11A 1Y00A 2LVWA 2J6UA 2ZBQA 3R5JB 1I94K 5J2PA 3CJ3A 2E5IA 3AVIA 1HQUA 2ROGA 5I3UB 3FMBA 2F1FA 4EBDA 3NMAA 1G99A 4QIWD 3PJ9A 2YH0A 2WUSA 1N33K 1XMOF 1SC4B 2FBYA 2MKJA 1RAJA 1IKVA 2IM2A 4DUTA 2JEFA 4HUGA 1TK5A 2ZH2A 2EC2A 4NXMJ 2GVZB 1K8KB 2FBXA 2E7WA 4CT9A 2HWTA 1V3SA 4RW7B 2MZQA 5ETKA 2YI1A 3A13A 1U24A 4HT7A 1F2GA 1SCJB 1AZSB 5E7OB 5LSLA 5C7PA 1FD2A 4CBUA 1TVRB 3J80O 4IR9A 1S9GA 3D0IE 4ZHRA 2AEFA 2EFVA 3J7YI 3SAFA 3G8SA 1V3ZA 2LFVA 4QIFA 1U1KA 3L2VA 3CXCM 2VJUA 1QY7A 4DUZJ 2DY4A 2ZJPQ 3M9MB 4CGIA 4Z94A 4MT1A 4JI7J 3PW4A 1OKJA 3M1VB 1VQ5N 1VQPN 4CZMA 3QZ7A 3Q8UA 3DLBA 3ZX0A 3CJTA 2IFXA 2IM0A 2MGZA 5I9EB 1R0AA 2JDJA 4NI2A 4CLYA 1RBUA 3NXZA 4CGFA 4JUZA 3ZT2A 3TZZA 1TV6B 1P1TA 1FNOA 4DBQA 3JXUA 4UY85 5LMUF 5M1KA 4B3TK 3OFHA 4OVLA 1FESA 3D6FB 4JI0J 3D5MA 4IZ9A 2XMUA 4RWWA 3P39A 3BV8A 1QSSA 2R42A 2YHAA 4XH1A 4J37A 1KVJA 2ZJRQ 4KC5A 1O1WA 4FF3A 4KRWA 3TX0A 1VQ6S 4CGHA 4OV6A 2CQDA 3FEYB 1JJHA 1JLAB 2J9CA 3I4HX 4UY8T 4R5PB 4ECUA 4K0KK 4FJMA 2OD6A 4M8LA 2QL9B 3KLFB 2FLOA 3K9KA 1G3OA 1TL1B 3ZZUA 3BSNA 1T44A 3VV2B 2LEPA 2CA9A 2I7NA 4WYWA 4WFBL 2U2FA 2FLNA 3VQ4A 5DRKA 5E3AA 2Z2LA 3GG1A 2IVNA 1SKWA 1YBUA 4DTPA 1HWLA 2DTUA 4CFAA 2CGLA 4DUYJ 1GLEG 2R2UA 3MEEB 1WF2A 1T7PA 5CHIA 1KVCA 4NA2A 3UW1A 1ZPVA 5KFWA 4AL5A 3QAEA 4QYZJ 1S1WB 2J5AA 1Y4ZB 1VQNS 1CXQA 2K7JA 1REVA 3B8HA 3KLIA 2P5OA 1RT6B 4QS8A 4P72A 5G4DA 2K1RA 3HP6A 4X64F 4KHSA 1NKEA 4C8ZA 1B4SA 3KDNA 3KUGA 2OYQA 3DDNA 3O5TB 3A2FA 5IWAK 4NCGA 2F3JA 5HBMB 4RU9A 4DHYA 2AD9A 2E2OA 3W9HA 2WAQD 1UJ5A 4X4RA 4ECWA 2C2EA 3ZZOA 1HJRA 1U48A 1XNQF 1YJWS 4CK1A 3W9IA 4DQIA 3IC1A 4C0OC 1RT2A 4IBNA 1UFLA 4MLEA 3VQAA 3ZTPA 2CPZA 4EBEA 3MCOA 3ZC4A 1PJ5A 4ZVFA 1UVIA 2OLWA 3MX2A 3J81U 2IAJA 4TQRA 1UCNA 3O4QA 3A5NC 5DETA 3B54A 3CCJN 4F67A 2RDDA 3A5OC 2XI3A 1MN7A 5D78A 2EFNA 2G8KA 5AJ3K 3TVKA 2GAGC 3Q23A 1IBMF 3L2WA 2MY8A 4X66K 1NBEB 1GQEA 1X60A 3VGSA 4ZVQB 2DKOB 2H48B 3QIPA 3LZIA 1HD1A 2OPQA 4NXMF 4M5MA 1RU2A 5KG1A 3AXKA 2W2NP 3VVUA 2A6AA 2WVBA 5BR8F 3BSOA 2VGNA 3CD5A 5HQMA 1N54B 1BUPA 4CLZA 2A2DA 2W42A 3O1LA 1YIJS 5AXNA 4H8KA 2UUCJ 4IG3A 5CY4A 4GVLA 3SNNA 2KH9A 3VQ6A 1EHWA 2NRWA 1FDBA 4CHPA 3V6DB 3G25A 1JLFB 2P9LB 4R8UB 2E44A 1S5JA 2W24A 2V9WA 2XLKA 4BR4A 1QJHA 1T3OA 2MTLA 2SXLA 2DGQA 2PO4A 2QFJA 2F8EX 2JWLA 3P31A 3AHPA 2DB1A 3C8YA 2PE8A 2Z1HA 1Z2ZA 2W9BB 2UV8G 3QGIA 1U04A 4FYDA 1RXOB 2Z1IA 1RBVA 2JLGA 4B9LA 2HHSA 5L46A 4FXVA 4HTJA 2YX6A 3W61A 5H9EJ 3HHLC 1NLVA 3RBXA 3NL0A 1HRHA 2BE7D 2P9SA 4OZNA 3MEGB 1RT7B 1JNZB 1R59O 4JS4A 2VICA 4DXLA 1FJGF 5IOLA 5B08A 4CJUA 5E84A 3VAKA 2AZ3A 1Y97A 2I38A 5EWFA 1HBUA 1WDDA 5EGYA 3TAEA 5JXSA 3KHHA 1IXKA 1U6BA 1XNRJ 3LUYA 4KJIA 1VSJA 2A5XA 1TUYA 2ASYA 2ZH9A 3EMTA 4EZ6A 1GXLA 1SS6A 2I7PA 2AYBA 2VA3A 1IR2A 2XLJA 3Q8RB 1XMOK 2OP5A 3THTA 1Y64A 4WTOB 4IO9Q 4J9PA 3MMAA 4C8MA 4CJWA 1HYVA 4BGBA 2JNJA 1HBNB 4DUYF 2FQQB 1BY9A 4UY8O 3TA1A 4DF8A 2YPZA 3M32B 4CHOA 2QMXA 4KIAA 3ATUA 4CHNA 4EEYA 1KQFB 1BWFO 3EICA 2FC8A 3PJWA 2ZH6A 1S9GB 3HT3A 5FPNA 4LIRA 3VF4A 5B0CA 3D2EA 4WF9L 1PAEX 2KXHA 4RLEA 1RADB 1TELA 1ASUA 1R6YA 4YR2A 1RACB 1ZM2A 3ULDA 2IIHA 2GV1A 4M3YA 3OR1A 5HMYA 2AW0A 5CABA 2QSFA 2MGZB 3MXHP 4URQU 3SUNA 4B3RK 4NLGA 4W90B 1I5OB 2WSEC 4YHHF 4QWCA 2YKAA 1V4SA 4Y65A 1VQ7S 2YNGA 2ZWHA 4MIWA 4ETZA 1PAUB 1RTDA 2ZUGA 5FJ4A 3LPTA 3EZWA 2XNRA 2E5HA 2VH7A 4BC7A 3AB4B 2PA8D 3D0HE 3DRSB 4OO1J 4J90A 2XWYA 1HHTP 2RIJA 5IQQA 4K5RA 3ZZPA 5L1JA 1EQ0A 4I4BA 4PWWA 4GKKF 4ANCA 1VQSA 3OL9A 4ILLA 1U1MA 3OA9A 1VHXA 3SUQA 3T6JA 2ASDA 3ZT0A 5ETQA 1BLUA 3VERA 3WIUA 1YK9A 2PFFB 5JS2A 1T0TV 2X1AA 3THWB 4C7QA 1YRUA 1RYRA 1SC6A 2HBRB 3EDRB 3L2RA 5A2QO 1EAYC 1HLWA 4LSNA 2B8PA 2ZHOA 1SQEA 1T03A 4CIFA 4Q8FA 3CJ5A 3VF6A 4CJVA 3K8WA 1R6VA 2WBNA 1RWXB 3ADAC 3Q7CA 2E5LK 1VSMA 1REVB 3KHYA 2QZ8A 4B3TJ 2HOEA 2ZBRA 4K2XA 4F4XA 4X4UA 4HHHA 2AGPA 2K1RB 2O8FA 4JK7A 4X4OA 2CNKB 3U7JA 4HUEA 4DR4J 1BA0A 3W8GA 3AJ2A 1LFPA 2CXEA 4KGMA 3SMSA 4B9QA 3FBFA 3ENWA 3HRGA 2NRVA 2QYCA 3FJ2A 4M42A 1YRTA 4M5IA 2V8PA 4KGVB 3EVWA 1W7AA 1NLKL 5A8RA 4UF4A 1XNRF 3UQSA 2UP1A 1T05B 3GSDA 4O0NA 1OS5A 3TUPA 2IAJB 5KFCA 1X5SA 3MECB 4QYRA 3BBBA 3RB0A 2LA6A 5K8PA 4BRAA 1L3SA 1TU0B 5LM7E 2KM8C 5JUMA 1TL3B 2FJBB 1IBMK 1OWXA 1NHKL 4ES3A 1QSLA 5HOOA 2FJDB 3QIPB 2CKWA 2OPQB 1LWFA 1XR5A 5GAHU 3AXMA 3P5BP 2D5RA 1JCFA 1WELA 2UXBJ 3R27A 5DQIA 2BRLA 3A8YA 3VQPA 1B70B 1IWGA 3JB9k 2DY9A 3ITHA 2G9OA 2Y0BB 5BR8K 2IPOB 3NOGA 3VGTA 1WSVA 3SQOP 1B7FA 2HVEA 1JCEA 3PHTA 1FEHA 4O3QA 2HURA 2PAVA 4KKOA 3VALA 1HW8A 4ANDA 1FFWB 2IBKA 2W40A 3BZKA 2OPRA 1BDGA 3SBMA 3OYFA 2LU1A 4LT6A 4NLWA 1R8AA 1YKWA 4CZCA 1FF2A 1WBDA 4CLSA 2KB2A 3OHBA 1N34F 2UXCK 2DGUA 4DMNA 3MPWA 4JKFA 1LK5A 3PVXA 1NGIA 2GUIA 1OH8A 2R7XA 1S6QB 4NX9A 1T6DA 2P9KA 5EOYA 4X66J 4AHTA 3AD8C 3BEGB 2W9CA 2FHJD 4MQ3A 1QM9A 2RRNA 1VQON 2YH1A 2R8IA 2R2RA 2P9SB 1NZAA 3AV9A 1N32K 2NUUG 3PV8A 2UUAK 4DR7K 1FJGK 2YNFA 2WZ1A 4K41A 1UWBB 1HBUB 3VAFA 4K5SA 1A7GE 2QWQA 3OT9A 1WHYA 3IG1B 3SCIE 3RBDA 5KFFA 3VCDA 1ZPWX 2OTLN 4Q43A 5KG7A 2Z2MA 3TZWA 2EFGA 3T9ZA 4HVJA 2GQCA 1AT1B 4TY9A 2GX9A 3GIRA 3FRYA 4CBWA 1NMEB 5AXMA 2E1PA 1W2BM 5CYQB 4NXNJ 2GHPA 1SQGA 4P52A 4U67L 4YOYA 2Z2ZA 2GNKA 1JL1A 1BD6A 3FZMA 4KV8A 5KG6A 2MJUA 3M8PB 3QRPA 4A8WA 3FBBA 5HVGA 3EKSA 4PL7A 2BYCA 1BA1A 3KJVA 2LXUA 2ZH4A 3MN5A 3LP2A 2CIMA 2G1DA 2QMWA 3NNAA 2QN6B 4WFXA 4QW9A 3DOLA 4CO4A 3CB4A 1MWQA 3D2EB 4WKRA 4DR4F 1C0MA 4DSEA 4LVNP 4K2JA 4DV1J 5AXKA 4CE9A 2HHHF 2DEIA 4LF4K 2DNNA 5LXYA 3TWZA 3O9RA 3PLAA 2CRLA 3OR1B 3QDKA 3AFGA 5DZ7A 2FPHX 2E5JA 3HBTA 2O01C 3I0RB 4BS2A 4HH0A 1S57A 1XUPO 4PHTX 4YHHK 3CCLN 2WB1D 4CJTA 4F25A 5GAEU 3SMPA 4UZBA 3UFCX 3IRXA 1SKRA 4JV5J 5K14A 1WSIA 2Z2YB 3VTIA 2LQBA 3L4BC 5CE3A 2GAHC 3W5XA 3EUNA 4TYBA 1ZBLA 1GLBG 2NPIA 4KI4A 2FVRA 3GJSB 1W97L 3WEEB 3QIOA 3K8VA 2GMHA 4NLQA 1Z6RA 3MXJA 5THWA 1NPKA 5HMZA 3PKYA 3MD1A 5A8KA 2LA4A 4CFDA 1QD1A 3CJAA 2HK3A 5ITHA 4WFNQ 2AEJA 2X6NA 4KGXB 4JKGA 2BJ7A 4MDAA 1EJ7L 3MMBA 4P73A 3CXCR 3AVHA 3CJCA 4ZPAA 2E2NA 3KMSA 4C8LA 1MDUB 2WC9A 4QBUA 4B3RJ 3ENVA 2Z1JA 1Q8LA 2BJ8A 4J8FA 4B1WB 2UU9K 3GP9A 3V1QA 2MMYA 1T03B 4EYHB 2GWKA 3DLJA 2IVYA 1N5QA 3QBCA 4MKVA 2NLXA 2A2CA 3CD7A 1IM4A 3LGHA 1E4GT 4EO6A 4O8KA 5CAAA 2B4OA 2ZNYA 3HHLB 2QL7B 1HQEA 1PYTA 4QS7A 2BBEA 4JI2K 1IKWA 5GVQA 2HHPA 3GV7B 4AQYJ 3KLGA 1YVFA 3SCKE 4I56A 2BZ2A 5KFIA 4ZITA 4DR2J 1N6QA 4Z4GA 2V4JA 1VBKA 2FJEB 5BXIA 2JFKA 4MO5A 3BO4A 2DBBA 2MQLA 4BRNA 2WONB 5FPMA 2B7CB 4M63C 4BDZA 4PQUA 5AQRA 5A8RB 2J0WA 1FRIA 4FWRA 2QG9B 3HOSA 1IG9A 3HSZA 4EBCA 5AQZA 2B4PA 4F4KA 4NLPA 5F8NA 2RU9A 1NK7A 3KMQA 4BRDA 4JI1J 3R9PA 4BE0A 3ZFVA 3GV5B 3QRQA 1F2HA 4FVMA 2RNEA 2QM1A 1KN6A 3OHRA 1A5VA 1WOOA 1XN9A 2FBTA 3GG4A 4CJKA 4NXNF 1PG5B 2PN6A 3IO1A 3OL8A 2C2NA 3O9QA 1ZTTA 2IYIA 2E5LJ 5GIOA 5ETPA 4H5NA 1M0SA 3UO0A 3UVJB 1HNXK 2NQPA 4E7LA 2RVJA 4L3KA 1UPMB 3PRBA 3C6HA 3PW5A 1NSAA 2IGIA 4IFYB 1KCFA 4ZCIA 3D1HA 4WCEQ 3HOTA 5KFXA 1AYEA 2O4IA 4OJGA 2OEKA 3L3UA 3PEJA 2ROEA 3RZAA 4KI6A 3PYFA 2CYYA 1UA1A 4AXIA 3AOBA 4DKWA 4KKOB 4GKJF 2OMLA 2A10A 1GAOA 4DV1F 1X7VA 3AVNA 4OQJA 3TJ8A 2FZKB 3K2PA 1PSDA 3VPZA 4DR1K 2OPRB 3TA2A 4DPWA 3UWTA 1WACA 1FKOA 1X5PA 3T1AA 1XQSC 3PFEA 2KKHA 2F7VA 4O5BA 3VQCA 1UW4A 4PEOA 4BG9A 3HVAA 4CJSA 3Q2SC 1NRKA 2LQJA 3QQCD 2FJVA 3NAIA 1K73T 2P9KB 3H7HB 4URSA 3C15A 1JLGB 4JV5F 2MY7A 2OPSA 3K0SA 2W9CB 2RHQB 3BF3A 1Q53A 2A6MA 3LO3A 4LBHA 2CFXA 4LFBK 2C3YA 3GL1A 4CJ4A 2XY8A 3VF2A 3G6VA 4RW4A 4HTLA 4MDBA 2N4DA 1U2FA 3NCIA 3ENQA 3QJLA 4E7KA 3TI0A 2B9XA 3L7OA 5LSRA 3DMJA 4CFCA 1RSCA 1H38A 1HPZA 2BOPA 1SQFA 1M1HA 4BDPA 4K4ZA 4PPZA 3SV4A 5KPRA 1M5SA 3CW2C 2VIHA 3TWHA 3M2VB 3GYXB 1YI2N 1QAXA 2IJFA 3IWLA 1WC5A 3MUMP 3HHEA 1A5XA 3OTDA 3NGDA 4PKGA 1WSEA 4WFAL 3OS1A 1HA1A 3OD2A 4YB7A 5F1XA 2X78A 1DKGD 4HDHA 1HKAA 2FF3B 1DTQA 5E3CA 3R1LA 1SL0A 5JVHL 3MCMA 3KJVB 3WQPA 4BVPA 3B78A 3L3VA 1HNZF 2ZM6K 4CO5A 3ALYA 1X0PA 4CEAA 2PBDA 3G4SS 2NLWA 2NUHA 2XCPA 3G87A 2MSTA 3PIOL 4WP3A 3MN6A 1N32J 3BO3A 5E0OA 2UUAJ 3WT0A 1ZTWA 4DR6J 4AQYF 3KKRA 1P90A 4ED0A 3ZEUA 2MZSA 1KWMA 2DPJA 4DU3A 3ENBA 4M3ZA 3SCLE 4PQAA 3CMQA 5DZ6A 5HROB 2KI2A 2W7AA 2HHHK 4DR2F 4OYXA 2MDAA 2NCKL 1FJEB 2HWHA 3F73A 4FZZA 3MM8A 3CCUS 1C0GA 4DV2J 4B1XB 3TANA 4ZLNA 4PA1A 4QU6A 3BF1A 4AF1A 4QR0A 4DX6A 3HHKA 4A8SA 3DCAA 4LBPA 5HN0A 4RNHA 3ULHA 1HNWK 4FF2A 2KM8B 1KNZA 1GOCA 3IRXB 3CYMA 4JI1F 5K14B 3KVGA 1U0HA 5B0BA 4YOXA 1IKXA 4C4WA 1LWXA 3CJ4A 1BU6O 3NP5A 3VQBA 3T5JA 2HLUA 1PCAA 4RW8B 1QAJA 3QNWB 2QA1A 3NS5A 4ZN3A 3CJRA 4E0DA 4OI3A 2YCHA 4DFJA 1RAIB 3KFWX 3DKDA 3OPKA 3SFUA 5A8KB 4NYFA 2F5GA 4JKGB 3H4DA 3T7ZA 2W9AA 2DR9A 2FVQA 4QU7A 1Q9XA 2B9WA 4QWBA 3V9ZA 2QYGA 4NLRA 2FHMA 2EBGA 2XULA 4LF4J 2AJ0A 3EPGA 1VIXA 5HQLA 4ELTA 1G2EA 1IBLK 4RZRA 2BRKA 3HPHA 3KWIA 4JKBA 3QEIA 3LDQA 2DTJA 1YJ7A 5I42A 5DMRA 3QGPA 3DLKA 3B8AX 2E6LA 4DN9A 2GZOA 3KZBA 4DWIA 2J6SA 2DH8A 2WBMA 2NXEA 4JD2A 4OJ1A 1S49A 5KQ8A 1HQEB 3WHIA 1X5TA 3VGMA 1ZBIA 3A8IA 4CM2A 1FFSB 1IKWB 2QWPA 4I6MA 2XHWA 3KLGB 2NPFA 1S72N 5KFEA 3P96A 5HRRA 1B64A 3MM6A 1RDUA 5KI6A 4BRIA 3NNCA 1K0TA 4HHTA 5F8LA 1N6QB 2Q43A 2FBVA 4JNEA 1BQNB 2KXFA 3CJQA 3BGOP 4ZDNA 4EYIB 4PQUB 2KZMA 4WQ4C 1NGGA 1GX5A 4IQMA 4HVZA 4DTNA 3ILOA 1DQ9A 3G10A 3BH7B 1GOAA 3PG9A 2IM1A 3GYGA 3PZPA 2BR0A 1WDTA 4M3TA 1RDBA 4BREA 1ZM4A 1S7HA 4OI0A 3M8SA 2QLWA 5GADP 5A8WA 3Q7BA 3CCLS 4E3SA 3KK1A 2DNHA 5KT2A 2HNDA 3O9TA 5GAHP 2DFEA 3IRWP 3M2RB 5EWGA 3H6EA 1HR0F 1CJUA 1RAOA 4JI2J 4NLCA 2HB5A 5IV4A 4EI2A 1C1BA 2JC1A 2W8LA 3KDOA 3AVBA 4DFKA 2VG5B 1K47A 4OLAA 1KFDA 1DQAA 2KT3A 1IV0A 3SLCA 4HACB 3BZQA 4S0MA 2W2OP 3NAHA 4OX8A 4DU8A 2H4WB 2YQ0A 3JSRA 3VHQA 1YHQN 1NJIT 3N01A 3N0VA 4LF8K 2FTRA 5L38A 5LMNF 1PBAA 4B3MJ 4ED3A 2QX0A 4CZJA 3NOCA 2G8VA 3J81O 2VUGA 1FKOB 2HQGA 1IQZA 2LP4A 3FBEA 2HS0A 2HS3A 3VEWA 3SDEA 1JB0C 2A6OA 4JI6F 3CMEN 1ASVA 1KBRA 3BY5A 2IJNA 1T11A 3OYEA 3H5XA 3GIJA 3T5HA 3IS9A 2I8EA 1CBKA 1HI8A 4EGLA 3SSRA 4YDUC 2F8MA 4KO0A 4WXOA 1ZZNA 1H2UX 3CIZA 3UDCA 3DGVA 5T14A 1U1QA 3NE6A 2RPIA 4ICLA 2GO8A 4CLLA 4TQSA 3CT9A 3J7YU 3ZZZA 4KT0C 1NB2A 4QQBA 2VPYB 5FRMA 4J9QA 1RBTA 2OIHA 1SV5B 1HX1A 1LXNA 5D3GA 2ZFHA 5U47A 3P4UB 2HZVA 1Z26A 1X8DA 4LY7A 5B0AA 4AM7A 3PM9A 2GQQA 4RW9B 3OYCA 2EWHA 4CWBA 3K58A 3BEXA 3DRYA 2UXDF 3E9LA 1I3OB 5HRNA 1F9FA 3SQGA 5L39A 2DRAA 5AQKA 2VF3A 3TX8A 4CERA 1FX2A 1X4BA 3MWBA 1RGIA 3CMAN 1WSFA 2JEGA 2O8EB 2CDRB 3WC0A 2KJWA 2DJWA 4ILGB 2GJIA 5FDLB 2VQEF 3QO9A 2O8BB 3TSUA 2HVHA 3KXDA 4DL6A 1DTQB 1F9EB 1FRHA 3THVA 2YXLA 4FJ7A 3HD1A 1Y3KA 4FCYA 2JC0A 1URRA 1WKLA 2CJXB 1VQ8N 3M8RA 1HWIA 2E1AA 2ZBPA 1KQKA 4TY8A 3FQKA 1FKPA 2DEJA 3R6GB 3F44A 3H5SA 2Q0RA 4K4UA 1UETA 2P5VA 1L3TA 4DTOA 5FRNA 1VRUA 3KIOA 2E66A 5A6PA 2DGSA 4IOXA 1ZS6A 4JBCA 3F2KA 1Q7LB 3HSGA 2KT5A 4ED8A 4FVCA 1QZ6A 3TEGA 5F9LA 1GLFO 4CDIA 3MM8B 1YZ7A 4DS5A 4CEDA 3QESA 4CO3A 3DM2B 3GBTA 2NSCA 1OJ4A 2AP1A 4H0VB 2JEIA 5GAEP 2HNYB 1JLCA 2ZH5A 5IM0B 2W2MP 1U0HB 2F9JA 4MAKA 4L8RB 1F5BA 2D41A 2V63A 4H0XB 4FWSA 5E3RA 4M5LA 3CJ9A 4GO5X 4URGA 3KYLA 3R2DJ 4DV4K 4DQPA 3MWTA 3RGIA 5J1NA 2HHTA 1ACMB 2JL9A 1ZYQA 1RLDA 4R0JA 5M1PA 3SQ0A 1VHIA 4F2RA 4B1UB 3ISND 4OPAA 2ZM6J 3RB6A 3K5LA 3FLCO 3GIMA 4C3LA 1EP4A 1WF0A 1QAYA 2GEMA 1TKZB 2J9DA 4CHZA 5D4PA 4B9UA 2R7UA 4Z0UA 1UFKA 4J5OA 1VQKN 4Z4HA 2J0XA 1VMBA 2E29A 3WX8A 3ILJA 2XGPA 4IJAA 5BPLA 3HSTB 4Q7AA 2YWFA 2HVIA 5EX3A 4DCHA 5DLFA 1KLMA 3NGYA 1H98A 1ZM9A 2ZVSA 4ED4A 1Q95G 2CQHA 3V9SA 3FCHA 1X9WA 1KC8T 3T1YK 4B3MF 2HHXA 3EO3A 1Y5LB 3MAAA 5I42B 4USMA 2QLBB 4KH0B 1YT3A 3DLKB 4OIXA 4AHRA 3K5NA 2IC3B 3G6EN 3OFFA 4NZ6A 2Q97A 2DNYA 1H73A 2CQBA 2QSWA 4AT1B 4JV2A 1EB0A 4CEEA 5IS2A 2RDIA 5KFYA 3N79A 1JQGA 1C4CA 3RMCA 1U2VA 1YLXA 2CG8A 1NJIO 3C7NB 4I6MB 2CQCA 2EW9A 2M4MA 2M3DA 2QLFB 4ZP7A 2JX2A 1IBCB 3MM6B 1RDCA 1J5OA 1PILA 2CZ4A 2VGMA 3SAHA 3FGVA 4F2SA 3DXMA 2QIFA 2RF2A 4OX7A 3OSNA 5F0UA 4JI3F 4FOEA 4MIBA 3R7NB 4CGGA 3WNFA 1D9DA 2U1AA 3MWPA 3BGRA 1J27A 3DWLA 4XEIA 3CHWA 4ZTFA 1IBLJ 4FWQA 3I87A 2FY1A 2BUPA 4DR5K 1S9EA 3AODA 2IDLA 2F8HA 4NZ0A 3B4DA 4MK7A 5LJ3Y 3HX9A 4ZCLA 5ETSA 3I0SA 4G1PA 3VA0A 3EPIA 1KDNA 5CCLA 2HNDB 3NWRA 3MTJA 3MFIA 3OYJA 4IH5A 1WLJA 3SZ2A 3E01A 4Z4EA 1RABB 1QVGR 3AO3A 1C1BB 2X7IA 4KTZA 1J6ZA 2HHQA 2OI2A 3F41A 3PTWA 1TL5A 3NY0A 1OVQA 2LMIA 1QVFM 3M4XA 4PZVA 1MLAA 1NB7A 3MCAB 1BQXA 4B8CA 1X9JA 1U4BA 3CC7S 4FJ5A 3RVCA 2XMKA 2B9EA 4X65F 3VESA 3CCTA 4FBTA 1KD1O 4NA1A 3QWPA 2H4YB 2HFUA 3J7AP 1K1SA 4NMXA 2CQ1A 5HO4A 3SDEB 4DPXA 2R7WA 3EVOA 4DU4A 3GE1A 1DJ0A 2CJAA 2ZE2A 2XNQA 3P4IA 3G82A 5FROA 3IS9B 2KXNB 5KG3A 4CEOA 1YF5L 1UMJA 4E19A 3X1LB 5D0RA 4TN2A 1RAFB 2ZJQL 4K7QA 2HFVA 3MPUB 2MZRA 3ZZYA 3I5CA 4CH7A 3BQ0A 4ICLB 2RAQA 4B1ZA 4DG1A 3SIPB 2Q66A 3HM9A 4CJFA 4FF1A 5J2NB 5D3GB 3PIPL 3O2IA 3AJ1A 4FJIA 2Z30B 4BRHA 2F40A 1GX6A 4TU9A 4FZYA 4KTQA 2AF6A 1B0TA 5EN1A 1C2PA 4FYVB 3DLLQ 4N76A 4ZPVR 5E2QA 4FW2A 2YY3A 3BB5A 4DV7J 1N5YA