2YNIA

Hiv-1 reverse transcriptase in complex with inhibitor gsk952
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 163
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yniA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yniA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yniA05
5DLGA 1JLGA 2XCAA 3IG1A 3S9HA 4E7JA 2FBVA 4IRCA 4RW9B 2E9RX 4K4YA 3PR4A 3NHGA 4AILC 3GYNA 3PW7A 2IS3A 2QXFA 3SPYA 1RT6B 2BR0A 3S3OA 3VQDA 1S4FA 3QLHA 3OL6A 2HNYB 3MEEA 5KG7A 3E51A 4CECA 3MEDA 2I1RA 1NK7A 4J2DA 3NAHA 1QS4A 4FLUA 5J2PB 4DQIA 1K6YA 1HNVB 4O5BA 2YNGB 4LH4A 3RTVA 4M3XA 2VA2A 1RTHA 5HROB 3TAGA 4KB1A 3BQ2A 1A5WA 4RZRA 1VK0A 3KK1B 4FJIA 1XHXA 1JLEA 1RT2A 4DEZA 2YNFA 5J2NB 1CXUA 5F9LA 2V4RA 1RA7A 3KMQA 4FW1A 1QSLA 2HAIA 4CFCA 4HCBA 3CDWA 2KTQA 5DQGA 1DTQA 2OPPB 1JIHA 4W5OA 2JEFA 3NF7A 4CJUA 3OL7A 4ECZA 2ASJA 3D5MA 1S9GB 1FXXA 1XI1A 4ZHRA 4N5SA 4AH9A 5SZTA 1SV5B 4CJWA 4E1MA 4FJKA 2DY4A 1VSIA 1ASWA 3PW4A 2WRMA 1L3SA 2AJQA 3NL0A 3A2FA 3KHRA 3AA3A 3VQQA 1RT4A 3PW5A 3SCXA 3HPOA 3DRRA 3TARA 4BE1A 1SH3A 4RUCA 3SFGA 3D0PA 2QKBA 1S97A 4FJGA 3H5YA 3LP0A 4IH7A 4CF2A 1VSEA 2YNIA 2BE2A 4E0DA 1D0EA 4ZVFA 4OGEA 4LQ3A 4B8CA 4E3SA 4FLYA 4NLTA 3V6DA 5EWEA 1UA1A 2B5JB 4MIBA 1UWBB 1X1PA 1ZBIA 3S3NA 3DYAA 4CFDA 2FC0A 2W9CA 3T1AA 4DQQA 1RTJB 5I3UB 3LANA 1HPZA 5T7BA 4DL6A 1LW0A 1UWBA 2B5JA 3HP6A 4TY9A 1B9FA 3H40A 5KRSA 4CHQA 1Z4UA 4KE5A 3BREA 4CF0A 1EX4A 3PUFA 2W8KA 3QZ8A 4FJ7A 3P1GA 4NCGA 2HVHA 2W9BA 2GC8A 4IRDA 2YHBA 3G6YA 4TLRA 2KQ2A 2HHWA 2Z1HA 5F8IA 3RRGA 2WCXA 3V1OA 3P83D 1TV6B 3BGRB 1WN7A 3K5MA 1CSJA 3NDKA 3AO1A 4ZHRB 1NOZA 3AV9A 1D9FA 4URGA 4ECQA 1T94A 2AWZA 4CJPA 2R7YA 1TL1B 1S6QB 4RUAA 3LAKA 3H5XA 3V9XA 4WZMA 4KHUA 4FM2A 1RT5A 4O0IA 1Q9YA 2YHAA 3QZ7A 4Y2AA 5T14A 3HPHA 4I7FB 4QWCA 2EX3A 1KHWA 3CO9A 3QEIA 2YNFB 5J2NA 4TY8A 1VSMA 3LWLA 1JLEB 1RT2B 1L3UA 3IN5A 3K2PA 1K1SA 2BQ3A 1GOBA 4Q0BB 1XR6A 3DLGA 3O3FA 4C8NA 3EYZA 4EBDA 3OYFA 4ECTA 4O3RA 3L3UA 4FM1A 5HBMB 1SH2A 5L1IA 4NLPA 4CGIA 2FVSA 4OJRA 3OYIA 1VRTB 5L9XA 3C95A 1YT3A 2A1SA 5KG0A 4EO8A 2NUBA 4B9NA 3DOKA 3RRHA 2WHOA 1WLJA 4CEOA 4EYIB 4J9LA 5KG4A 1KTQA 4DFKA 4ELVA 2HWHA 3BR9A 2FLLA 3ZSRA 4RW9A 2DFFA 4RU9A 3OSPA 4FJ5A 5KFSA 4FVMA 3NAIA 4CJSA 1IM4A 1NNDA 4F4YA 1ZTTA 3K59A 2HVIA 4RW6B 4RNOA 2X6SA 5KFOA 2XY7A 1Z25A 1FKOB 4ED6A 2DFHA 3EZUA 4NLGA 2WOMB 4EP5A 3MEDB 4ECUA 4BDPA 1S1WA 3SNNA 4KB7A 4KHWA 4RW7A 1KVAA 4Y1CA 1RAJA 1RT1A 4TYBA 4ZPCA 5KT6A 3UR0A 3NGIA 4ZVEA 4RNHA 4KI4A 5HRNA 3DLGB 3JSMA 2RN2A 5KFGA 4B9UA 1J5OA 3E01A 2OPRA 1KLMA 1BQNA 1R0AB 2IAJA 4Q8EA 4EBEA 1C1CB 2UVVA 4E7KA 1TKZB 3V6HA 3KHHA 3CG7A 5KFLA 2CKWA 3DLKA 3KLHA 4IRKA 4FS1A 4RNNA 1NJXA 1OS5A 1IO2A 4N76A 3F9KA 4DQRA 4ZP8A 2OA8A 3LWMA 2IBKA 4OKKA 3H59A 3V81B 4Y34A 3ZCMA 4ZP6A 1LV5A 5JUMA 3FFIA 4FW2A 4OPKA 1QSYA 1N4LA 3N6MA 1JXLA 5KT3A 2C2DA 4B9VA 4KRFA 1G15A 4K4TA 1VSFA 5CZ2A 3DOKB 1ZETA 1S1UA 4EBCA 3MXIA 1LWEB 5C42A 5K14A 1N6QA 3DOLB 4OVLA 4NZ0A 1RNHA 4LY7A 4Q45A 3KD5E 4Y1DA 3HVAA 4URQU 4PWDB 3LPTA 5KFCA 1LW0B 3IAYA 4Q44A 5DGAA 3TAEA 3OJSA 4FM0A 1FKOA 3PX0A 2VG7A 3HVRA 1RTJA 2ZKUA 4CK2A 4ED0A 5KFYA 1KFDA 3BSAA 4DWIA 3C6TA 5I42A 3TVKA 4AHSA 4OGCA 4NLRA 1MMLA 4R8UB 3H4DA 4O3QA 2HHUA 3V6KA 3AVHA 2VWKA 4DL2A 1JKHB 4DU3A 4OLBA 2FVRA 2IM0A 3PJXA 3NH0A 4CJ5A 4PQUB 1SH0A 4Q8FA 1NKCA 1S0NA 5F8GA 5F8JA 2HW3A 2YV0X 5KRTA 2IC3B 1B92A 2KFNA 4M42A 4CK3A 4GVMA 3DLEB 3C94A 4O44A 3LDSA 4GW6A 4CEEA 5KFQA 3QGGA 1S9GA 4CCHA 2IM1A 2R2TA 2BQUA 3CFOA 3KMSA 1S10A 3HSTB 4CJRA 2W9BB 3SQ0A 4CFAA 4CJFA 4M95A 4UQGA 4CEFA 4CE9A 4FK0A 4EYHB 3QGIA 4B9TA 5KT5A 3T19A 3CFPA 3PR5B 3AVMA 3RMDA 4J9QA 4IQXA 1ITGA 5L1JA 4WXOA 3SQ2A 3OYJA 4WFXA 3RAQA 2IM3A 2P5GA 1CXQA 1S6PA 5KGXA 3C6UB 3KLVA 1WSEA 5HBMA 2HHVA 4W5NA 1BIUA 1YTUA 4EP4A 3FSIA 4QW8A 4RNFA 1D8YA 4K4SA 3K5NA 4DSJA 4WYWA 3OYGA 5HLFA 2FLNA 3KLIB 5J2PA 4MFBB 4PUOB 4KTZA 2VA3A 4DU4A 1KVCA 1NHVA 4QWEA 4TY8B 1NJWA 4YQWA 4PQUA 4BE2A 1EETA 3DDKA 3P5JA 3VQ4A 3QIPA 3AVBA 1ZTWA 3T5HA 1RT4B 3DRSA 2KW4A 2Q3SA 3CM5A 1X9SA 3M8QA 4MFBA 1KRPA 3AO4A 4FBTA 4H8KA 1D5AA 4LQ9A 3SQ1A 3AA5X 4EZ9A 3M9OB 3PVXA 3B6PA 5DG9A 3KLEB 5KFKA 2GV9A 4ID1A 4KHYA 1HQUA 4ICLB 2JGUA 3IS9B 4F50A 2FVPA 4DSFA 4O3SA 4BWMA 3SI8A 4ZTFA 1VRUA 1IG9A 3DM2B 2J6TA 3PX6A 3MTKA 3HVWA 1Q8IA 4KKOB 3SI6A 1TGOA 3QO9A 5L1LA 4K8XA 4IDKB 1Z26A 3V9UA 2PYJA 5K14B 1N6QB 3SFUA 2Z1JA 1S1UB 1S48A 4MKBA 1X9MA 3RR8A 1IKYA 3LZIA 4LSLB 1WAFA 2G8FA 4JUZA 4PUOA 4M94A 2YNGA 3V1RA 3RMBA 5HLFB 4CESA 2FJVA 4F4WA 3FDSA 3I5CA 2QV6A 1S9FA 3RWUA 4CEQA 2QE5A 3L2WA 5KFTA 2IC3A 2WONA 2B43A 4FJJA 1IKWA 2RKIB 3HK2A 1RYRA 3KLHB 3VQ8A 3DMJA 3V4IB 5KFXA 1DTQB 2XO7A 1KHVA 4TQRA 1CLQA 1U48A 4F4ZA 4KHQA 4NYZA 4O3NA 3TWHA 4I2PB 3TANA 4ECYA 4Z4EA 2VG6B 4C8MA 3E01B 3MECA 1WSJA 1S1XA 3SUQA 2C22A 1IKXB 1W25A 4FJLA 2KZMA 3NH2A 4KFBB 3ULDA 1JXBA 4B3OB 5J2QB 2AQ4A 2EC0A 1KVBA 5KFDA 5KFVA 5E41A 4HKQA 2BRLA 3QIDA 4W5TA 3L2VA 2R8KA 4RG8A 1NK9A 2RDJA 1LWFB 5C25A 4GC7A 2G8VA 3LALA 5J2QA 4CHNA 2WK4A 3NGDA 1RT6A 1VSKA 3V9ZA 3CJ4A 2JEJA 5KG5A 1U49A 4RW6A 3WNGA 4TYAA 3OS2A 5I42B 1S1TA 4E19A 1RTHB 2YNHA 2JC0A 3AA4A 4Y3CA 5KFAA 2FVCA 3HL8A 2OZMA 2D5RA 1T3NA 4FLWA 3V4IA 1TQLA 3SPZA 3U3YA 3NF6A 4N56A 3M9MB 3M8RA 2XCPA 5L1KA 4MK7A 2IAJB 1T7PA 2AGQA 4QPXA 3QETA 3GV8B 1SKRA 1C0TA 1UA0A 4DQSA 1TK8A 4ELUA 3GV7B 2BQRA 4B3OA 4KFBA 1NHUA 4DG1B 4FLTA 4U6PA 1JLCB 2J6UA 2JEIA 3TAQA 2IGIA 1EKEA 4JV0A 4DSLA 3HT3A 1Y97A 3BDPA 1J54A 4ELTA 2XY6A 4IR9A 4HUFA 3RBDA 4DU1A 2I5JB 4IG0B 3VQAA 3ZT2A 1S0OA 4MQ3A 2X6NA 3S3MA 4FJXA 1BI4A 1VRUB 4CIGA 3V1QA 2G8WA 1IKWB 2RKIA 5KFUA 4C8KA 2BRKA 2WONB 1S1VB 1R0AA 5KFIA 3MR3A 2OPRB 1J5OB 1HMVB 4NLSA 4BDYA 3I0RA 3DRPA 3SUOA 2FBTA 3OYBA 1XR7A 4IH6A 2HHXA 3QIPB 1VSDA 3V9WA 4NCBA 4O3OA 3LAMA 2FBYA 5CYQA 2AX0A 1REVA 1YVUA 3OYKA 1RTDB 2E4LA 4JS5A 3ASMA 1LAWA 2IA6A 4N47A 3KLIA 3AVKA 4NLOA 3O4QA 4F3OA 2RF2A 3K5LA 2ILYA 3HXMA 5HP1B 2FJXA 4CJEA 3OS0A 3HP9A 3AVLA 1QAJA 1C2PA 3NBPB 3IS9A 1D1UA 1SUQB 3VQCA 2W9CB 1BISA 4H4MA 1XR5A 5FDLA 4CHYA 3KJVA 1S1XB 3KKRA 1ASVA 4ECSA 4PA1A 4ZTJA 1SKSA 4FLXA 2C2EA 2HNZB 3H2LA 4M3YA 2V4QA 5J2MB 3WNHA 2B4JA 5KTQA 2YNIB 2OPSA 1XWLA 3SV3A 2O4IA 3T5KA 3WNEA 4FK2A 3K57A 1RT5B 4DTUA 4IFYA 3Q8SB 4K50A 1D9DA 4B8AB 3LP1A 3GIIA 4E7LA 2O5DA 2IM2A 3NE6A 5HRPA 2HNDB 4NLYA 1TP7A 1SL1A 4YR2A 3GILA 1EXQA 4KV8A 4DTXA 4BWJA 2UUTA 3OYNA 3KD1E 3LP1B 2UVUA 2W8LA 2QKKA 1S0MA 2OZSA 4LD0A 2AGOA 1REVB 2FLPA 4G3IA 3SUPA 3I5AA 1NKEA 3VQ7A 3OLAA 5J1EA 5C24B 2V0NA 4DTMA 4DL4A 3PW0A 3RMAA 4Q5VA 5CY4A 5FDLB 4KHRA 4CGHA 3HPGA 2KZZA 3OYLA 3SYZA 5HROA 3VQPA 2E9TA 4C8OA 3QEWA 3KLEA 1U45A 4TQSA 4JRPA 2GIRA 3QNNA 4J9OA 1S9EB 2YKMA 3V6DB 2ITGA 5KFRA 3NF8A 4O4RA 4J9NA 4YFUA 3H08A 2E6LA 4CEDA 3U3GA 3TAMB 4JRQA 4J2BA 1VSLA 3HO1A 3PX4A 3VQ6A 2J6SA 3N6LA 3AO5A 3ZSXA 2DFEA 4HYKA 3C6TB 3MR5A 1RDCA 3PO5A 5DGBA 1WSIA 2E9ZA 3PZPA 3MR6A 1WAJA 3LP2A 3KIOA 4CGDA 3KLFA 5EU7A 4KB0A 1S5JA 3C6UA 4TSXA 3RR7A 1S6PB 3DLKB 2GUIA 4IFVB 3N6NA 3UDLA 4FLVA 2ATLA 5J1EB 4E89A 3QEVA 4ED2A 1DTTA 1QQCA 1QE1B 1BQNB 1HRHA 4Z0UA 3K58A 2XI3A 4JV1A 3T5LA 4DFJA 1NK0A 1C0UA 4NLXA 3DRRB 2R2UA 1N48A 2UVWA 3G86A 1RDBA 1TKTA 1Q9XA 3D45A 1T03A 2DPJA 1HNVA 3QYYA 3TR8A 4CGGA 3V81A 3JYTA 2X74A 4IKFA 3L2RA 2HHTA 5CZ1A 3GIJA 2HWIA 3NH1A 5KT2A 1WSGA 3AVNA 5EUHA 3CJ5A 4CGJA 1ASUA 1NK8A 2HNYA 3I8DA 4XPCA 5KI6A 1I3AA 5HRRA 3B6OA 1SL0A 3RB4A 2D41A 2OPSB 4AHUA 4FJMA 3PJWA 4EEYA 3OYEA 3OL9A 2HNZA 2D3UA 4MK9A 5DQHA 3FRZA 4HCCA 2FVQA 4DF4A 2OPQA 3QESA 4LSNB 2JLEA 1A5XA 3KK1A 3WNFA 2XHBA 1L3VA 4DS4A 2VG7B 1U47A 1RBUA 1ZBHA 2HMIB 4M3TA 3AVCA 4FK4A 1L3TA 3I0SB 1O1WA 1RT1B 2X78A 1LWFA 4F3TA 4HUEA 1RTDA 3IRXB 1VRTA 1KCFA 2ZQBA 3ALYA 3NGYA 1DLOB 2XGPA 4NCAA 3PO4A 5KG3A 1BQMB 1QUVA 2WTFA 4K4VA 4ED7A 1A5VA 4CF8A 2UVRA 4CK1A 5KT7A 4OPJA 2EHGA 4ED1A 3FFIB 3ZT1A 1ZBFA 3M8PB 3MECB 4ZMMA 3VQBA 4LSNA 3QNOA 4DL5A 2XY8A 1N5YA 3CDEA 3AO2A 5KG6A 4ED8A 4ZPBA 4DSIA 4L8RB 3G10A 5CYMA 3ITHB 4G1QA 3ISNC 1BI4B 1JX4A 2ETJA 4KKOA 1JLBA 4B9LA 1SKWA 3AVGA 2I5JA 4IG0A 1C1CA 4DMNA 2V9WA 3NGZA 4Z4FA 3DLRA 2ZE2A 1RBVA 4IH5A 1U04A 4DF8A 4ECXA 2O4GA 4FBUA 1QHTA 4I9QA 4K4XA 4IG3B 2LSNA 1IKXA 4CJTA 3Q8RB 3MXJA 5KFWA 1TL3A 1JLAA 2YKNA 3H5UA 1NK5A 3HJFA 4RW7B 4KBIA 5D3GB 1GX6A 1RT3A 3RB3A 3QGHA 3DM2A 1TVRA 3RAXA 5HRSA 2XRIA 5F8HA 1QTMA 2R8JA 4ZP9A 1WSHA 5KFJA 4ZPDA 3DI6A 2YKMB 2ASLA 5I3UA 4FZXC 4DQPA 3CJ2A 2F8SA 2D0AA 5KG2A 1JLQA 4I2QB 2AU0A 3PY8A 3TAFA 3DLBA 3DI6B 3IGVA 2JC1A 4DTSA 3ZSYA 2BANA 3ZT3A 1NKBA 1X9WA 4QCLA 5KFPA 5KT4A 4IBNA 4ECRA 3AVFA 1TAQA 2VG5A 2W9AA 3T5JA 4C8LA 3MF5A 1T05A 1W0HA 4Z4HA 3QEPA 4IG3A 1S9EA 3NMAA 4U7CA 2IMWP 3CVKA 1ZBUA 3UPFA 2PYLA 5KFNA 3BJYA 2ZE2B 4OL8A 4O44B 1F21A 1T05B 2BGGA 4M3WA 4NYNA 3G0ZA 4CJ4A 4DFPA 4WYLA 2GIQA 3KK3B 1RDRA 4AHTA 3M8QB 4I7FA 4E7IA 4ZVHA 3DRSB 1UAXA 1HYVA 3KK3A 2G8HA 4CIFA 4KHNA 2HHQA 4R0EA 3QIOA 3SV4A 4CJQA 4J9MA 3CYMA 4ECVA 3RMCA 3GQCA 2Z1IA 4MIAA 3OVNA 1RA6A 1NOYA 3FQLA 3VQ9A 5HP1A 1TVRB 4PWDA 2G8UA 3RBEA 3GV5B 1LWCB 5EDWA 2XGQA 1J9AA 1HQEB 4IFYB 4ID5A 4FCYA 1XHZA 3ZSZA 2G8KA 3KTQA 1TK5A 1LWEA 1KLNA 1RTIB 4DL3A 1U09A 4CHZA 4E7HA 4CERA 4GMJB 3SJJA 2IJFA 3KHGA 3EPGA 4IR1A 1BCMA 2BANB 1JLGB 2P1JA 2W42A 3I0RB 3BSCA 3F73A 2R2RA 4NLWA 1SUQA 3KHLA 4B08A 3V6JA 3CFRA 2Y1JA 2ZD1B 1K1QA 3BSOA 4GC6A 3ZT4A 1KFSA 3D28A 2PY5A 4ED3A 3Q8PB 4KREA 3OY9A 3ITHA 4G1QB 4DS5A 4O3PA 4KTQA 1BIZA 1CZBA 2XC9A 2D3ZA 4DTRA 3CJ3A 1J53A 1JLAB 2YKNB 1JL1A 3MFHA 1S49A 3BSNA 4WFYA 4R8UA 4IKAA 4OKEA 1TKTB 1VSJA 4DTPA 4DG1A 4FZYA 2ASDA 1HJRA 4I9LA 3IGNA 1N56A 1S1VA 3ZSVA 3GIMA 4FZZA 4J9KA 1DLOA 2R8IA 3KNAA 5EWGA 4Z4IA 3OYAA 5FRNA 2OPPA 1C0MA 4Z4GA 4WXWA 4RW4A 3MR2A 1JLBB 4CJKA 2WOMA 3T3FA 1NK6A 1UOCA 2HHSA 2HMIA 4E1NA 1TKDA 4CEZA 4DLGA 4QOZB 3KLFB 4O4GA 4BE0A 4DTOA 3LP2B 3ZSWA 4RNMA 3OHBA 2C2RA 4KPYA 2JEGA 2HB5A 2OPQB 2RPIA 4CHOA 4QWBA 3MXMA 4YP3A 2P5OA 3OSNA 1C0TB 1NJYA 4IOBA 3K5OA 4O0JA 4OLAA 3TQ1A 2ILZA 4BDZA 4CJVA 3MEGA 3QLHB 5JS1A 3PW2A 4EO6A 4XPEA 3VQ5A 5KFHA 1WNEA 2GBZA 4YR3A 4XIUA 4K4UA 1T03B 4JLHA 3G6XA 2FJWA 5DK5A 3IG1B 5DG8A 4AHRA 1IKVB 1C0UB 4MH8A 3UIQA 1RBRA 3QINA 1BGXT 2FBXA 5JXSA 5C24A 3VQSA 3ZT0A 3VQEA 3ISND 2B6AB 4H4OA 3AA2A 5C25B 4KSEB 4KHMA 2XWYA 3QEXA 4NLUA 1HQEA 4KO0A 1JLFA 5C42B 1LWCA 2W7PA 1QSSA 4YMEA 4HTUA 3OL8A 2OYQA 3H5SA 4Z4CA 4Q0BA 1YTAA 1YVFA 5KFZA 4FJ8A 1XC9A 5FRMA 4CEAA 1HYSA 3CM6A 4DL7A 1WNSA 3L2UA 4LSLA 3RB0A 3AVAA 4NYFA 5F8MA 3TI0A 4NCGB 3OS1A 1EP4B 3NF9A 1QE1A 1RYSA 1RDDA 1DTTB 3V9SA 1B9DA 4CJLA 4J9RA 4H54A 1C1BA 3KOAA 1CZ9A 4PY5A 2P51A 1HYZA 5SWMA 1TL1A 3NFAA 1KLMB 4F2SA 3KJVB 4H4MB 4ICLA 2XY5A 2D7SA 3OLBA 1NJZA 4NLQA 3DYAB 1IH7A 3AVJA 1RBTA 4JV2A 4HHTA 2R2SA 2RF2B 2C28A 1LAVA 4NLVA 4O55A 3KK2A 4NRUA 3PV8A 4YR0A 1L5UA 1RTIA 4RW8A 2AX1A 1RBSA 4DTNA 4KAZA 4CGFA 4M45A 4IDKA 2VG5B 3L2QA 3QO9B 1S1WB 3TAMA 3HYFA 4ECWA 2BDPA 1GX5A 4QAGA 4Q43A 4IFVA 4KV8B 3ICLA 1FK9B 2OH2A 3KLGB 4K4WA 1HPZB 4TN2A 1BL3A 1HQUB 4CFBA 1HMVA 1BCOA 4I2QA 2ZD1A 4FJNA 2XI2A 3HKWA 1C1AA 1RT7B 4DSKA 1KSPA 1TV6A 4F4XA 3BGRA 4WFZA 4URSA 3CWJA 4KI6A 5DQIA 3KLGA 3Q8QB 5KGWA 2W7OA 1FK9A 2D0BA 4F4KA 3O4NA 2BE2B 2DTUA 3G6VA 1RT3B 1EP4A 4HUGA 1EETB 2A1RA 4TXSA 3I5BA 4ID5B 1TL3B 5KG1A 3HVTA 3VA0A 4KTWA 2UUWA 1SL2A 1TK0A 4J2AA 3TABA 1RILA 2PZSA 5C5JA 2DPIA 4FXDA 4ZPAA 3LP3A 4LH5A 2HNDA 4QWAA 3BQ1A 3DLEA 3M8SA 3HVTB 4KO0B 4B9MA 3H4BA 4N41A 4J9SA 1W9HA 1C1BB 2G8IA 4H4OB 2B6AA 5DLFA 3SZ2A 2Z1GA 3LP0B 4W5QA 1RDAA 4KHSA 5J2MA 1U4BA 3FQKA 3O3HA 3LPUA 3DRPB 3SQ4A 1RCHA 3MAQA 3AO3A 4MK8A 1C6VA 2D0CA 3CQ8A 4CF9A 3EZ5A 3EPIA 3CJ0A 5DMRA 1I6JA 3AVIA 4CF1A 4M41A 2YNHB 1S6QA 4CIEA 4BACA 4EZ6A 2F8EX 4YNQA 5KFEA 1RT7A 2F96A 2R8GA 1S1TB 3OYMA 3THVA 4J2EA 2IOCA 2E6MA 5F8NA 1VSHA 1SV5A 4J9PA 4WZQA 3U6FA 1TKXA 4ZP7A 1QAIA 3GIKA 5KFMA 4W5RA 3HM9A 3M9NB 1BQMA 3O3GA 5D3GA 3MEGB 3VA3A 4F2RA 1FKPB 4WE1A 1JKHA 2RDIA 5FROA 4QW9A 4JS4A 2WB4A 3RB6A 1JL2A 4HVJA 3I0SA 3UQSA 3OYDA 4RW8B 3MFIA 3KK2B 4DTJA 3L3VA 4NRTA 1JLCA 4FS2A 2AGPA 4CHPA 1NK4A 3NAEA 2IJNA 2F8TA 2KFZA 5F9NA 1IKVA 1JXEA 3OYHA 4O4GB 3CDUA 4Y2CA 1LW2B 2ALZA 3ZSQA 4ZVGA 3NBPA 1JLQB 2VG6A 4NLDA 4I2PA 4R5PA 2R8HA 4FLZA 2IDOA 4K8ZA 1I39A 1GOAA 1MU2A 3OYCA 4RW4B 4MKAA 3SUNA 1ZYQA 5CYMB 3DMJB 1GOCA 2CJQA 1WSFA 5CYQB 3DOLA 3MEEB 3OJUA 4DSEA 5KFBA 4X2BA 4XO0A 3NKYA 3EY1A 1TAUA 3CIZA 1ZBLA 4K4ZA 4R5PB 2Y1IA 3BQ0A 2VWJA 1HNIA 1T8EA 4FYDA 3JYTB 4FJHA 1HYSB 2QK9A 3M8PA 5JS2A 4CEBA 1HARA 3JSMB 4DLEA 4M3UA 3KKSA 4M3RA 3ZSOA 1HNIB 1IKYB 4B9SA 4DFMA 3PHEA 4QWDA 3DLHA 3QERA 1BHLA 3H98A 1JLFB 4OKJA 4AHCA 5F8LA 4KAIA 4WE1B 3IRXA 1FKPA 4F8RA 3L8BA 3NCIA 1MU2B 1TKZA 4AHVA 3LZJA 3TAPA 5EWFA 5KFFA 4FJ9A 4CJ3A 3OHAA 1TKXB 3HHKA 4M3ZA 3VN5A 2ATQA 1LW2A 5DG7A 1N5YB
chains in the Genus database with same CATH superfamily
5KAKA 1KR4A 1X60A 2PA8D 1QQNA 2XYPB 3ZZZA 3SCLE 2N82B 2FBVA 2HOEA 2E9RX 2XZTB 2E88A 2IS3A 2UU9J 2Q6BA 3NMRA 4DMZA 2IFXA 2HZVA 3R6GB 3S3OA 5KPTA 3QFWA 4JI6J 4J2DA 3IFEA 3OR1B 4JYAK 5J2PB 3A8YA 4NWBA 5GAHP 3WQPA 2BJ1A 2A0FB 1HPMA 5E26A 3RTVA 4KB1A 3SMSA 1VK0A 4FJIA 3UKRA 1IBMJ 2JJ4D 4JI0F 2VF3A 1RA7A 3CD5A 5H9EJ 2EWSA 3KMQA 3ETOA 1LEOA 3MUVP 3LF0A 4CH0S 3N5BA 4HCBA 2H65B 2XMAA 2R7UA 1GQEA 2CJ9A 1P9QC 4DV3F 2JEFA 3Q8UA 1HKCA 1RK8A 1UZHA 4YY3K 3V4MA 4ECZA 2ASJA 4USIA 1S9GB 4N77A 4UOFA 1GXUA 1W7AA 1YRUA 5HMZA 3PW4A 1L3SA 2AJQA 4BRQA 5LJWA 3KHRA 3TUJC 1RWWB 4TVAB 3SCXA 2CNLB 3CF5Q 3VEVA 5D15A 4X4VA 2YHWA 2CRLA 1SH3A 4H0OA 1DQ8A 1RHJB 1FX4A 2VH7A 1S97A 4OX9J 2QSWA 3KJFB 3H5YA 4X64J 3LP0A 4ZKAA 4CF2A 1F6TA 2YNIA 1N0UA 2NYHA 2YKOA 2M5YA 3EJMA 2Q66A 4A5AA 3J80O 4NLTA 3E3XA 1R27B 1A6LA 2Q1NA 3O44A 3QRRA 1P1TA 2W9CA 3EVOA 3LANA 5M1OA 4MMOA 5EX3A 1LW0A 2B5JA 1KTVA 4BC3A 1QVGM 4TY9A 3BGUA 3O4WA 1B9FA 4U9RA 1J6ZA 3L9ZA 3H40A 4MKYA 5IWAF 3M8YA 3BBBA 3E66A 4FJ7A 2ZJRQ 4NCGA 1M1KT 5LJVA 3F9MA 2YHBA 4TLRA 4YY3J 3EDRB 4M5HA 2YWHA 4ILRA 2CPEA 1Q8BA 5HK4A 3P83D 1GK8A 1CSJA 3R3LA 1NOZA 4JEPA 4ECQA 4U95A 3O08A 1TL1B 1S6QB 3CCWA 4WZMA 1NUEA 3OTCA 5HO4A 1H72C 1K44A 4C8YA 2KXHA 4O0IA 3LUYA 4QBUA 5GAGU 1PG5B 5IS2A 5T14A 4I7FB 1JK9B 3TQEA 2EI5A 3LWLA 2VONA 3UNYA 1WELA 5F2RA 2CPXA 1K1SA 3W2WA 4YDDB 1JQGA 2DH9A 2RU9A 1XR6A 3DLGA 2RRNA 3O3FA 2HLTA 2OFHX 5LMNF 2RB7A 3IDHA 4ECTA 4O3RA 2RMLA 2CQDA 4I6AA 5CABA 2XSFA 1Q0NA 4DV2J 2UUBK 2FVSA 4OJRA 3OYIA 4OHWA 1VRTB 2WVCA 2DGOA 4OYAA 4EO8A 2NUBA 5AQYA 1VQNN 1WHXA 4C9DA 3RRHA 2WVFA 4CEOA 2P5VA 2N3OA 1KP6A 5KG4A 2AD9A 2HZCA 3TO8A 5B8HA 3SQGB 2L48A 3ZSRA 3OSPA 2FDNA 2A2CA 3NAIA 2GZOA 4JBCA 4NXNF 2Z2MA 1FD8A 3BUZB 3K59A 2DBBA 3EUNA 3HKZD 4RW6B 3P5BP 2G2YA 4O0NA 5KFOA 1FKOB 4PKHA 1XEZA 2DFHA 4NLGA 3M6XA 5HMYA 4I0WA 1Y10A 4ECUA 1V4TA 3KWGA 3SNNA 4NMLA 1DQAA 2VC1A 2VPZB 2DCLA 2EPIA 4H5VA 4CZJA 1Y5NB 4ZPCA 5GAEP 4AL7A 3MM7A 4LC9B 3NGIA 4RNHA 2QL9B 2V8VA 4JD2A 5HRNA 3AGRA 4I6YA 3A8KA 1VIOA 3JSMA 3TTDA 2LA4A 1VBYA 1FJ7A 3TOQA 5AQQA 5KFGA 4DJBA 1YK9A 3RJMB 3E01A 2AHOB 2OPRA 2V8PA 1BQNA 2VFRA 1R0AB 3CJ1A 2LQ9A 2QYGA 1C1CB 3ZYYX 5B0BA 3D66A 3S6EA 3KHHA 2ZZNA 5KFLA 3DLKA 3KLHA 1NJXA 4DQRA 2J0XA 5KOXA 1XBWA 2OA8A 4JKAA 2IBKA 4DV3K 2N7CA 4NPOA 3V81B 4Y34A 2AT1B 3CCQN 4FW2A 1QSYA 3MOJB 2ZHAA 1U25A 4KRFA 4QZVB 4K4TA 5ADZA 2CJKA 4ISGA 5KQ8A 4JI0K 3DOKB 5M2RA 4PPDA 1UL3A 4EBCA 3MXIA 5K14A 1ZM9A 1KOOA 2OO4A 1RNHA 4LY7A 4OVLA 2I6WA 4HL9A 2VZ9A 4XH4A 4X62K 1NZ8A 3M2UA 2W41A 2H54B 4HLBA 3TR5A 2BACA 4PWDB 2XZDB 1GXTA 3CC2N 2FJDB 2KRBA 4FNHA 1F2GA 2GQQA 4E8UA 5I42A 3D2FB 4OGCA 5GAEI 3U4LA 5B7WA 4NLRA 2DNQA 3VEOA 4R8UB 3CIMA 1WEYA 3R8EA 4OLBA 1HI8A 1MN9A 3DDIA 3PACA 5EX0A 2MY7A 2BJEA 4PWUA 5F8GA 2YV0X 3CMAN 4GVMA 3C94A 4O44A 5IT9O 1N54B 4CEEA 1F9HA 2BQUA 3CFOA 3KMSA 1XMOJ 4DV5J 1FRMA 1VI7A 4CJFA 2JDJA 4CEFA 4GKKJ 4KC5A 4CE9A 4FK0A 2MKKA 4B9TA 4LRFA 2V7YA 2MKCA 3CF5L 2NXCA 5G0RA 1XC3A 4CLZA 3SQ2A 3OYJA 1CXQA 2AYBA 1S6PA 1AZSA 4HVZA 3EMTA 2HHVA 4RNFA 4K4SA 2V4JB 4OJHA 1R0CB 5HLFA 3KLIB 1NWKA 4MFBB 4DU4A 3IWNC 4QWEA 3VENA 1NU4A 3RAMA 2FSKA 2ZNYA 3K8WA 3O3LA 1T6DA 4LUBA 3L7UA 2E2QA 3CI5A 1ZTWA 4OZ5A 1V5VA 3M8QA 3QB0A 1D5AA 3AA5X 1TUVA 4B1UB 2CADA 4XAKA 3MXHP 1ULRA 2C42A 4ID1A 2I38A 3LGNA 3OPKA 5E5NA 2FPHX 3WQUA 1FTRA 4F50A 1YBAA 5AE1A 5LSLA 5RUBA 3EEQA 4ZTFA 3GFHA 1VRUA 3DM2B 2F63A 3PX6A 3MTKA 4USVA 3CNQP 4K8XA 4IDKB 1Y00A 2IIHA 2J9DA 1DEJA 5F0UA 4FWRA 2CQ1A 4C48A 1LXNA 2HF3A 4PXEA 3SFUA 2DHAA 1S1UB 3CDAA 5EX5A 3CJTA 2BOAA 3TVZA 3GJRB 4LSLB 2PEHA 5HLFB 3SSRA 2P9KA 4K8RA 4M7XA 2F9WA 2QE5A 1XN9A 2F8MA 2DTJA 3G6EN 4DR7K 2RKIB 3W2VB 3KLHB 2KYXA 5KFXA 1DTQB 2PFDA 4OHVA 2YKAA 2XO7A 1KHVA 1PGZA 4LF7F 4M5LA 1U48A 2M9KA 4KHQA 4NYZA 4O3NA 1Q86O 2WVBA 3TWHA 4H4KC 4Z4EA 4GMKA 2VG6B 2X1AA 3NEKA 3TA0A 3KYLA 1R59O 3MECA 2P8IA 3SUQA 1FWPA 3CERA 1W25A 4FJLA 3AT1B 4A8YA 1FERA 2KZMA 3K17A 4KFBB 2F7VA 2JVOA 4B3OB 1VLYA 4CRJA 3H25A 2QXLA 2WW4A 3IA0A 1ZZFA 5GAEU 4LF2A 3K5PA 2J76E 3OTBA 5E41A 4BCAA 3SQOP 2JFDA 3O8MA 4H0TB 2E2PA 3MCPA 1NGIA 3K8VA 3DGPB 1OH8A 4TLQA 1VYAA 2WK4A 1RT6A 4BR2A 5KG5A 3T1YK 3N4WA 4P9SA 1U49A 4LVNP 4N8OA 3VF4A 5I42B 2PFUA 3ZZUA 1NB2A 4K42A 1Y5LB 1RTHB 1FFGB 2JC0A 2DXEA 4OYPA 3M5RA 1HNWJ 1MLAA 2CVIA 2D5RA 4O8UA 3J81O 2AEFA 3TX0A 2J8AA 3B82A 4G1IA 5LMUJ 3NF6A 3M9MB 4AE5A 3W2VA 3ZZYA 3ID8A 1SKRA 1AROP 2KXNB 1TYQA 1E6YB 1R31A 1UA0A 3U1NA 5LXYA 2CZVC 4DU8A 3EO3A 1RAFB 2BQRA 3BGFA 3SAGA 2BM1A 2VDIA 2E5LK 4DG1B 3MPWA 2BVZA 2BKOA 1ZBSA 2DYAA 4QIGA 3PRVA 1Y97A 2UU9K 4PG4A 1D9AA 4DXLA 3MCAB 1WKLA 2V8GA 4FJXA 3QWUA 1C4CA 5CD4H 5FLXO 5AQJA 1N5TA 3BZCA 3VETA 5CR4A 4H03B 1S1VB 1R0AA 4YB6A 2YX4A 2OPRB 2GX9A 3N9UC 3IUCA 2ZJQL 3SLCA 4NLSA 3CXCM 1NB7A 4IJAA 4UY8T 2QWPA 1KN6A 1K9MT 5D0RA 3D0GE 3CETA 5M2UA 2U1AA 1VSDA 1BU6O 2EC2A 3THPA 3V9WA 4LFCK 4EFAC 1YJNS 1MSWD 3UNGC 5I3QA 1YVUA 3PSIA 2M70A 4JS5A 3ASMA 3G4SS 1LAWA 3EGZA 4USWA 7FDRA 3KLIA 3RZAA 1RBLA 1EAYC 2J7UA 3OS0A 1T9YA 1SUQB 4ZLLA 4P2SA 2YH1A 3WT0A 1XR5A 4H4MA 1BISA 5FDLA 3D4JA 1S1XB 2LVWA 3E9PA 3FMWA 3BF1A 2W4CA 4OZJA 4FLXA 5HQLA 1OPIA 4EU0A 5KTQA 2JZ5A 1XWLA 1X5TA 2P6TA 4MYTA 2O4IA 3WNEA 1EKSA 3O5TB 4DTUA 1PYOB 2CH5A 3C14A 2ZH1A 1HBNA 2XS7A 2A6MA 4DV5K 4WFAQ 3NE6A 2BW2A 5L46A 4NLYA 1TP7A 1VQ4S 4YR2A 3T7ZA 2GJIA 4DTXA 4BWJA 1T3VA 4M7YA 3W5ZA 1EIYB 3OYNA 3N28A 2VQFF 5A8RA 3Q0AA 2HAFA 2AGOA 4OZ0A 3SUPA 2MJNA 2YWGA 4ZJQA 3VQ7A 3OLAA 2V0NA 4JKEA 4M5DA 3PW0A 3CHWA 3A12A 3PFOA 2IVPA 4CGHA 3OYLA 2PMHA 3VQPA 3F44A 2E9TA 4DX5A 4LF1A 4TQSA 1K0TA 1R8CA 2OI2A 4ALZA 2YKMA 3V6DB 1ELOA 2F9JA 1Q86T 4BRDA 2HHPA 3A5NC 2BTFA 3AH6A 3I4HX 5J1PA 3MDQA 5AZIB 4DPWA 4ZPTR 4J2BA 2AYGA 4LF6J 1VSLA 3GONA 4M1KA 3R7NB 3C66A 4OI3A 4CTAA 2KVIA 4EUVA 1PILA 2ZJPL 4LR7A 2DFEA 3BH6B 4RBUA 3MR5A 3MM5B 1HLUA 1WSIA 2E9ZA 3PZPA 4JI6F 1EHWA 3KIOA 5EU7A 2YPZA 4P2FA 4DB3A 3DLKB 2AZ1A 3N6NA 3UDLA 4FLVA 2CQ3A 3IBWA 2DNGA 4ILHA 4E89A 4ED2A 2ITMA 1BQNB 1HRHA 2Q36A 4JV1A 3KWMA 1VQLS 4RX6A 2WW8A 3DRRB 1Q9XA 4AM7A 1T03A 4YDXA 3TVYA 2ZJPQ 2BE9B 2NRRA 4IKFA 4BG9A 5CZ1A 4CO4A 1WEXA 4PKIA 3AVNA 2HNYA 2HBJA 2JWLA 1I3AA 2OPSB 5FD1A 4FJMA 3PJWA 1FRIA 4EEYA 3HSDA 3OL9A 2NRXA 4MK9A 2XMMA 3FRZA 2Y8YA 3QESA 1T95A 4CP5A 7AT1B 2JLEA 3DLLL 4TU8A 4LT6A 3QNWB 3VF0B 3WNFA 4BGBA 2NSCA 3GR0A 5AT1B 3WDOA 2Q0UA 2Q97A 1M5SA 2HMIB 3VGSA 1E4FT 4YHHF 1L3TA 2KXFA 3WC2A 2X78A 2LYVA 3IXQA 3UR3C 3I96A 1RWXB 1YIJS 3IRXB 1VRTA 3GL1A 3VVUA 2HS3A 1DLOB 4NCAA 3R7SB 5GMDA 3PO4A 2GCFA 3TW0A 1QUVA 1BHNA 2LU2A 2P9LA 4K4VA 1NAQA 4N8NA 1MWKA 1RBAA 4CW7B 1PIEA 1NGEA 4ED1A 1WDDA 3ZT1A 3VQTA 5EY4A 1ZAVA 4ZMMA 1U1KA 3VQBA 4DL5A 3JAMU 5T41A 1X3NA 4F04B 4ZPBA 1U1NA 3IFRA 5AQLA 3TWZA 4L8RB 1ATRA 5CYMA 1VQ9N 4X4RA 2X1FA 2ETJA 1JLBA 2KT3A 1SKWA 5M1KA 2KKZA 4IJNA 2I5JA 5GAGP 3CD6N 4OJ1A 4CNYA 1C1CA 1G7CB 2J7KA 2HFNA 1VQ5N 4DMNA 2V9WA 4DR4F 4WCEL 4Z4FA 3DLRA 4M5IA 3JAMO 1HI0P 4PKDB 4K0KJ 1QHTA 2O4GA 4K4XA 2HHHK 1IKXA 1FD2A 3Q8RB 4WKRA 1GH8A 1A7GE 4DR1K 2DNOA 3D6FB 5KFWA 4FF1A 3CC4N 1NK5A 2MQQA 4RW7B 2OJ3A 4WPAA 5DDOC 2O01C 4KBIA 1EZZB 1GX6A 4YDUC 1OSCA 2ZH9A 5LOQA 5HRSA 1CJKB 2QT7A 4A2BA 4F0MA 5HJYA 1XMOF 4FZXC 3CJ2A 1ZH5A 3US5A 3CD0A 1VOMA 2AU0A 4MKVA 2FHOB 3DLBA 4CH7A 2BANA 1T9TA 2R42A 5G0RB 2CQPA 3CJ9A 4ECRA 5L8RC 3K7RA 4YUDA 4DKWA 3T5JA 3VPZA 4C8LA 2VDHA 1HNWK 3RG6A 3QQCD 3MF5A 3IR5B 3HSZA 1CC8A 2IDEA 4Z4HA 1KEKA 1SIWB 1YI2N 3W9HA 1B0VA 1YVNA 2GMJA 2IYGA 2QW9A 4F0HA 2PYLA 1YLXA 2J9EA 2IVNA 4OL8A 3X3UA 3NCRA 5HATA 4J9UE 3SAHA 1EQMA 1TFYA 1T05B 4NYNA 1RDUA 3KK3B 3M8QB 4P52A 4ZVHA 1DT9A 3BR8A 2VICA 4B3RK 2ZKTA 2ACMA 1VBZA 2ZZMA 2GHWA 4A8OA 1VISA 5A8RB 3OVBA 4GKJK 2G8HA 4CIFA 2HEKA 4JB8B 2XBPA 1WI6A 2QZ8A 3EX7B 4OJ3A 4LR8A 2YI1A 1VCTA 2Z8QA 5HP1A 5GMKa 5FPEA 2NXEA 1TVRB 2RQMA 1HWKA 2FF3B 4AL6A 1LWCB 1J9AA 3T6BA 3B8HA 1W97L 4IFYB 3GU0A 4ID5A 4IO9L 3KDNA 2G8KA 1OO0B 3GWCA 2XYHB 3FEYB 1P8GA 2EKYA 4E7HA 4JKCA 3THWA 1BCMA 1LXJA 1OPZA 2P1JA 1JLGB 2QL7B 3I0RB 1Q8LA 1VHIA 4C0OC 4NLWA 1SUQA 1YZ6A 4PQAA 1AYEA 1HD1A 3PKYA 3BSOA 4KH0B 4GC6A 1UJ4A 1KFSA 4HHJA 4PR6A 3QT5A 3SSQA 3W5XA 4BC9A 5D4OA 1VQ7N 4H5RA 2Q6CA 1BIZA 2FC9A 2XC9A 1HUXA 1H2VZ 2D3ZA 3NOGA 1XNRK 4DTRA 3CJ3A 1JLAB 2EKNA 3MFHA 5AQXA 3BSNA 5B0AA 1WHWA 4ZPVR 3G8TA 4IKAA 3ZTSA 1YX2A 2HGNA 2FY8A 1VSJA 4Y0FA 4WTOB 1NPKA 2FIUA 4I9LA 3J7ZO 5H9FK 1S1VA 3KNAA 2DNPA 4BBYA 3AD8C 4QYZJ 4Z4GA 3MR2A 1JLBB 3FZKA 1NO8A 1NJIO 3I33A 3BPDA 8ATCB 2GTDA 3A1YG 1GLJO 5L38A 5ETLA 3HMJG 4O4GA 3EKSA 4DCJB 2B56A 3OHBA 4KPYA 2HWTA 1WOOA 2AJ0A 2OPQB 2UUCJ 1O8BA 2OEJA 4QWBA 3KNGA 4YP3A 4BY9C 1C0TB 3AAPA 2JSXA 2ILZA 5D0HA 2E1YA 5LMNJ 4YOUA 1NLKL 4F67A 5F1XA 3O9UA 3QLHB 5JS1A 3VQ5A 3KG0A 1NGCA 4WFNQ 4MDBA 5AQUA 1X4GA 1O6XA 3VMFB 1WNEA 4YR3A 2UXDJ 2M3DA 4DR7F 3NLCA 4K4UA 3G6XA 2FJWA 1KS2A 3CMAS 4BVOA 1DKGD 2ZH2A 4PL7A 2VOPA 1FE4A 5DK5A 1ZA2B 1NSQA 1U0HB 1IKVB 4UW2A 1C0UB 4MH8A 5IT4A 5AQFA 3TPQA 1RKIA 1IBLF 4H4OA 4KSEB 1OWXA 2XWYA 5B0GA 3QEXA 4KPCA 5LMUK 4NLUA 3POTB 1HQEA 3OTDA 4KO0A 2ZM6F 1QSSA 3A5MC 4B3RF 5EOYA 4DR2J 4U67Q 4LIRA 1N33K 1YVFA 4D3GA 1TFWA 3MZIA 3RB0A 3DN9A 3KHYA 3T1YF 2DB1A 4FF3A 3TI0A 4NCGB 2VC0A 4NZ7A 4QIWD 3NP5A 3NF9A 1EQ0A 1RDDA 3V9SA 1B9DA 4H54A 1C1BA 4AXIA 1CZ9A 4PY5A 2P51A 3U1LA 1HYZA 2V51B 5SWMA 1LKZA 3MUTP 1KLMB 2ZH6A 4H4MB 2IBOA 4ICLA 4BR4A 3QSIA 4NLQA 5THWA 4DPXA 3AVJA 3TZZA 2LU1A 4WK3A 4O55A 3D1HA 4Q2LA 4NRUA 1CC7A 1KOHA 4RW8A 4CTAB 2KLAA 4KAZA 4CGFA 3A3PB 4DR6F 3V2UC 1S0VA 1FJCA 1S1WB 3TAMA 1FWLA 3HYFA 3TZXA 1UWAA 1KVIA 1N34J 4BC7A 4Q43A 2F65A 4K4WA 1V6HA 4NA2A 2CXEA 2GMLA 2HQGA 4BRNA 3PSFA 1U6ZA 2L08A 2M4MA 5B0EA 1MMDA 2Q2RA 2B9EA 1FA0A 1N5QA 4KI6A 5KGWA 4S0MA 2W7OA 1FK9A 3O4NA 2AP6A 2JOQA 4FN5A 2D74B 1RT3B 4AUKA 1SJ3P 3GR1A 1Q1KA 4LFAK 3AOBA 3I5BA 4IO9Q 2NR0A 2GVZA 1HWLA 1SL2A 4KTWA 1TK0A 3TABA 3UD3P 2E2OA 2V4JA 2P9PA 5HQMA 3J81U 3Q86A 4X4NA 3DLEA 3M8SA 3ZZPA 4K5RA 3SCJE 2VPXB 4FF2A 2A3ZA 1BE4A 3M1FA 1C1BB 4JK8A 2G8IA 3WZ0A 2B6AA 5DZ7A 4LBPA 3F2KA 4IYQA 3W8PA 5JVGL 3SK3A 1UAWA 4IOAQ 2E5JA 3I56S 4MK8A 3CJ0A 9RUBA 3AVIA 4CF1A 3J7YP 3DXBA 4BACA 1FNXH 2JH3A 1OY8A 5K8PA 2BEFA 2PI4A 4KH1B 1B7YB 2XSJB 4EWTA 2QO3A 5F8NA 3RUBL 3LW5C 4PYAA 3CXCR 1IXKA 5FLXU 1SJ1A 2VCPA 4W5RA 2HQ3A 3VA3A 5L9NA 2GHVC 4IXCA 1RLCL 4FWKA 2ADBA 5FROA 4LFCJ 4QW9A 1YJWN 1RSCA 4A5BA 2VBWA 3RB6A 2GGPA 4PPZA 2VD3A 3QJPA 4YOEA 5F9NA 1JXEA 5LY3A 3FZBA 4X62J 3CDUA 1LW2B 4GO5X 3F41A 1JLQB 2VG6A 3TZWA 2XTJP 5BYQA 3KKFA 4R5PA 1RAGB 3EXCX 2LXUA 4P71A 1S7HA 4JI1F 1I39A 1GOAA 3OYCA 4ETZA 1ZYQA 1LFWA 1CEZA 1WSFA 1SJFA 2G0JA 4B1XB 3NKYA 3EY1A 2YQ1A 3OVAA 5HSPA 2CPYA 4K4ZA 2Y1IA 2F4VJ 3TUPA 1IBMK 1HNIA 2PE8A 5BR8F 3S1TA 4WTYA 4FDFA 4DV1J 5A0YB 3GG0A 5IC6B 3QERA 3QT7A 1E6YA 4AQYK 4B3SJ 5IM0B 4KY3A 4MO4A 2ZH3A 2MHNA 3L8BA 5H1SV 1QY7A 2LFVA 3SIPB 4YOVA 2DNZA 3OT9A 3ELHA 1AW0A 1IJEB 2OLWA 4M3ZA 2GO8A 1LW2A 4A8XA 4YOXA 3G8QA 3IG1A 4FPRA 5AQVA 4QJVA 2KM8B 1Z2ZA 2OMOA 3ULHA 4DUTA 2QXFA 1EWQA 5JMVA 2JNJA 1JMTA 3TP2A 3VQDA 4DL0C 4JK7A 3OL6A 4JI7J 1WTBA 2HNYB 2GJFA 4JI5K 3E51A 5KQDA 2I1RA 3LQVA 3W66A 4JV5F 3NAHA 4C11A 2MQLA 1SAZA 4ZDNA 4DQIA 2DK2A 3HHLA 1RBOB 3CCMN 2YNGB 2A5XA 4LH4A 1KVJA 3VGVA 1U8SA 2VA2A 3IC1A 3R2CJ 2DCUB 2QTWA 2FUG9 3FRYA 1RT2A 1O5JA 2YNFA 5J2NB 2V4RA 3BGLA 4OJGA 2D3O1 3IMXA 3CDWA 3NMUA 2YJEA 2J5AA 5DQGA 1DTQA 3OXGA 3U27A 1AA1B 4W5OA 3TA2A 3OBYA 1WWHA 2IMOA 1Z05A 1UEKA 1HQ2A 3JQKA 1BUXA 5DO2A 2N4DA 1XI1A 4ZHRA 2QC3A 1MWYA 5SZTA 1F9EB 1SV5B 4E1MA 4EHUA 3AA3A 5U47A 2Y9HA 4JYAF 2IVFB 3HPOA 4U8VA 4C97A 4BE1A 1KD1O 1V5IB 4RUCA 2VFTA 1YQHA 3D0PA 1ZC6A 2H3GX 2E1RA 4FJGA 1VSEA 2BE2A 4ZVFA 2IDLA 4OGEA 4E3SA 3V6DA 4WU2A 4DV2K 1T0TV 4NLCA 4MIBA 1YZ7A 5A8WB 3DYAA 2UUCF 5I3UB 2ZUAA 1X5PA 3FBBA 4B3MK 5A8WA 5T7BA 4DL6A 4DQ8A 3HP6A 2V6AA 3NRBA 4ES1A 3ZZ0A 1RGIA 1QM9A 4G1PA 2D0PA 1Z4UA 3Q24A 2BM0A 4AQYJ 2VODA 1GLEG 1KD1T 4IOCQ 2W9BA 4C3MA 2O8FA 2CNNB 2Z1HA 4A4JA 2WCXA 3H8YA 4FXVA 3BGRB 1OMSA 3AO1A 2K1RB 1D9FA 1S22A 2BKPA 2B3TB 4C3LA 4RUAA 3H20A 4LRAA 4KHUA 2OMLA 1S79A 3EWGA 3JAMY 1RT5A 3TYTA 4YN3B 1JJ2R 3QPIA 2XHWA 3R27A 3KWIA 2EX3A 4I6MA 1KHWA 2XULA 3QEIA 2D3OR 2YNFB 5J2NA 2ALYB 4TY8A 2ASMA 1JLEB 3AY9A 1HBMB 2HBRB 2GWKA 4OYOA 4X64F 3BP8A 1FRKA 4F25A 3HJVA 4CO3A 4RJVA 4C3KA 4MLHA 2WSFC 4BR5A 2M8HA 1R6YA 3OYFA 2QWQA 3CT9A 5HBMB 1SH2A 2MMYA 2RS2A 3UDVA 3WXMB 4WFAL 4ZOSA 5L9XA 5AQZA 1YT3A 1PJ5A 4NXNJ 2K7KA 4AQYF 3Q7CA 5LM7E 1FX2A 3HZ6A 2HS0A 1N0VC 3W62A 2H4WB 1U1QA 2CGLA 4HDHA 2XNQA 4RW9A 2LECA 2ZBRA 2E44A 4FVMA 3D6HB 4CJSA 4HTIA 1FF2A 1IM4A 1IBLJ 1ZTTA 4QU7A 4RNOA 1RWMB 2X6SA 2XY7A 5FPNA 3PJ9A 4H0PA 4ED6A 4ZK7M 4OX8A 3EZUA 2Z4PA 4BGAA 2ZWOA 3U7JA 3FGUA 2YCHA 1T11A 1KXPA 2GQCA 3M8WA 1RT1A 4TYBA 2F8HA 1S7IA 5LL6d 5KT6A 2ZWHA 3R5JB 1EARA 3DXMA 4LF9J 4P75A 4BR9A 2DGXA 4M5MA 3J80U 1J5OA 3ZC4A 1KLMA 5ELZA 3NNHA 2IAJA 3MD3A 4Q8EA 4DV1K 4E7KA 4OV1A 2I7PA 1IG8A 2YHXA 1H74A 3BV8A 4IRKA 1I1GA 4N76A 4ENOA 4ZP8A 4ZPWR 3OXLA 4OKKA 2P9NB 3CMEN 4BROA 3H59A 3GLJA 4CLLA 3FBCA 1CJTB 1LV5A 5JUMA 1F5BA 1N4LA 2BA9A 2XB2D 1KBRA 1G15A 3D67A 2OELA 5AQRA 1LWEB 1N6QA 3DOLB 2N3LA 1UJ5A 1M1GA 3CE8A 3HVAA 1AT1B 4URQU 3H1QA 3VESA 1VQ6N 4IWVA 1LW0B 2JRSA 3OJSA 1VQPN 1FKOA 2VG7A 5KFYA 2XSJA 4JN4A 3MM5A 4RLEA 4GVBA 3C6TA 3TVKA 5CHIA 3J7A1 2ZBCA 1XMQK 2VB6A 3H4DA 4O3QA 2VWKA 4DL2A 1X4HA 2FVRA 2IM0A 3PXGa 5I4MA 4C2MA 3NH0A 4WJBA 1VK8A 3CJCA 1SH0A 4R25A 2YJFA 4Q8FA 2KFNA 4M42A 4CK3A 2C3MA 3DLEB 1F0XA 1F5CA 3LDSA 3EN9A 4GW6A 1YF5L 5KFQA 3QGGA 1S9GA 4CCHA 4IOXA 2A2DA 1UTAA 4ES3A 3GOIA 2NZCA 1U2VB 4X4SA 4CJRA 1YDLA 2W9BB 2YWKA 4CFAA 2WBMA 1PAEX 1Q81O 1WC4A 4OLOA 4EYHB 3QGIA 1YHQN 2M7SA 3VCDA 4FPBA 3GCWP 1K73O 2LMIA 4J9QA 3W61A 5L1JA 4WXOA 4WFXA 2P5GA 4CLKA 1DHMA 3OQ2A 4P73A 4W5NA 4ZJOA 1YXQA 1YTUA 1D8YA 1NBWA 4L74A 4GY2B 3W9IA 3K5NA 3M30B 3OYGA 2YH0A 3NXZA 3C15A 5B09A 5J2PA 1PC4A 4KTZA 2VA3A 5E3CA 4B3TF 4FYYB 1NHVA 4TY8B 4TU7A 4XTTA 1NNEA 4R79A 2X1GA 3NNCA 5E33A 1GT8A 4H0VB 3AVBA 2CQHA 3W63A 3T5HA 5K8OA 1RT4B 3DRSA 3CM5A 2MGZB 1X9SA 4MFBA 3AO4A 1CULA 2E5LJ 3M9OB 3ENHA 3DU5A 1VQ9S 3FVYA 3B6PA 5DG9A 1X0PA 2CQ2A 5KFKA 2MKJA 1TR0A 5ETSA 4KHYA 1HQUA 3J81Y 3I87A 3M1VA 2FVPA 4DSFA 2JVRA 4FZVA 3SI8A 3ZZTA 3G9CA 3CJQA 2A18A 2CZ9A 2JLFA 1WF2A 3AHPA 3MM6B 1HI1A 4K0KF 2O8EA 3U1MA 3O1WA 3V9UA 5GADP 2HFZA 2Z1JA 2GMHA 2D69A 1S48A 2M8DB 3M2VB 4O8KA 1WSRA 5A2QU 3H7HB 4P72A 2ZFHA 3LZIA 1WAFA 4PUOA 4DX8H 4B9QA 4NXMF 2YNGA 4CESA 4F4WA 3M30A 3Q2TC 4CEQA 2B43A 3HK2A 3MN6A 3VEYA 1X4AA 3VQ8A 1YRXA 2ZDPA 3CMES 1RFQA 2DNMA 4PAAA 4TQRA 4DOZA 1FJGJ 1VQON 4L75A 4F4ZA 1FRLA 2OHDA 4QS9A 3TANA 2R9LA 3LA0A 3CJAA 3UKRB 1WSJA 3M6VA 3M32B 2G13A 3NH2A 3ULDA 3C16A 4HH0A 2AQ4A 1TL4A 5KFVA 4KH4A 4HKQA 2BRLA 4OIXA 4W5TA 3L2VA 1PYSB 5C25A 4CZFA 3BF3A 2UXDK 4CHNA 1SKUB 3NGDA 4EHTA 3V9ZA 2C3YA 4NZ6A 3CJ4A 2JEJA 2E1MC 4M63C 3SXLA 3Q23A 3QAEA 3CCTA 2FVCA 2OZMA 3DLJA 3GFXA 1T3NA 5C2FA 2E8AA 1E3MA 3U3YA 5LL6Z 1GMWA 2XCPA 1Y7PA 5L1KA 1GTEA 3KJQB 3PFEA 3DRXA 1QHAA 4Y65A 4DQSA 4NOHA 5AXNA 4ELUA 1Q82O 3VAJA 4FVCA 1NHUA 4NXNK 4U6PA 2J6UA 1OQ6A 1FE0A 4JI1K 3G96A 3QJJA 5B0DA 3TAQA 3D6TB 4YB7A 4JV0A 4R0JA 2HF4A 2ZBIA 2MXYA 3BDPA 3AARA 4M63A 1CVJA 4ELTA 4LRBA 2I2YA 4HUFA 5BYRA 3RBDA 2OANA 3TTCA 3OTOK 4DU1A 5EGYA 3NWRA 2X6NA 4MQ3A 3S3MA 3QMLA 4UZCA 1CS4A 1K0VA 1CJUA 5BR8K 2DY9A 5CD4A 2RKIA 3MN7A 4C8KA 2KT5A 3OUYA 2HBMA 2R7WA 3CJSA 4BRHA 3GIRA 2WONB 1XNRJ 4UY8O 3MR3A 2EVZA 3F5TA 3I0RA 2ROGA 5BRHA 3SUOA 1BXNA 1XR7A 2N4CA 1RP5A 1B7FA 5GAHU 1IN0A 1IWGA 3JS6A 4DV3J 3VGKA 2YQ0A 2Q43A 2FBYA 2AX0A 1REVA 2HKEA 3OYKA 2R7XA 1RISA 2Q0RA 5E2QA 3VZHA 2IA6A 3AVKA 3O4QA 4F3OA 3CEDA 3K5LA 2ILYA 5HP1B 2X3DA 4USKA 5AQWA 1W26A 3VQCA 4CZEA 3HF5A 1HX1A 2MLYA 1HHSA 3KJVA 1LQ9A 3B78A 3U8XA 3UE2A 4PA1A 4ZTJA 1B0PA 1SKSA 2MKYA 4M3YA 5J2MB 2VPWB 2B4JA 3MPVA 2ZZTA 4LFBF 2J0WA 1VQLN 3LP1A 3GIIA 3HZGA 3H42A 3D3BJ 4E7LA 3CJKA 2O5DA 4GVEA 4NB4A 4ZVPB 3ZETB 5A6WA 3MN9A 2HFVA 1MN7A 1SL1A 2DEJA 2IYIA 4WKYA 2DHSA 4ILMA 1YSJA 1J5EK 2UUTA 1N5VA 2W8LA 3E2EA 4WQ5C 1MNEA 2OZSA 4U67L 3T69A 2EWHA 2FLPA 1HFEL 1WG4A 4QYRA 3C46A 3FCWA 3L95X 2M0GB 2CPFA 5C24B 1UPPA 4GVBB 4DR1J 2GV1A 3BKTA 4FSVA 4ZN3A 3M05A 4BVPA 5CY4A 4K2JA 3HLUA 3UE5A 1C0FA 3HPGA 2QMUB 5CHCB 1F60B 2P9PB 4DR2K 1S9EB 3NF8A 4CI6A 4F0KA 1IUJA 2Y8WA 3H08A 3RSEA 5D4LA 2E6LA 2DNNA 1U2RA 3VAIA 1WOQA 4JRQA 4A57A 3HO1A 3P96A 3IM9A 2J6SA 2F5GA 4USMA 3AO5A 3ZSXA 1RABB 2NS1B 2QFIA 4JP8A 4DR5J 5DM6L 4J9VA 3K9JA 4U7UD 5H9FJ 5MLCQ 4K2XA 1IQZA 3P4IA 1IJFB 3MMVA 4DV2F 5LJ5Y 4PYDA 2ATLA 2RILA 3QEVA 1QE1B 3GYGA 2QI2A 3K58A 1NSPA 4DFJA 1C0UA 1B64A 1N48A 3G71N 2HFUA 2P6SA 2RQCA 3TR8A 3VAKA 3V81A 4A8MP 1FCAA 3QFHA 1JCEA 3HFKA 3GIJA 1WSGA 1ASUA 3I8DA 4QR1A 5HRRA 1S99A 1SL0A 2CPHA 1CQMA 1CS4B 3HT0A 2QMXA 4AHUA 2QYCA 4HTJA 4X64K 3OYEA 1K8KB 3MTJA 2XMTA 4HCCA 2HSTA 2DGTA 3KUGA 1HW9A 4EMDA 1L3VA 3ET6B 2EK6A 4KQZA 1U47A 1GLCG 1RBUA 4KBOA 2OGUA 4LBIA 3I82A 4FF4A 3AVCA 2WBRA 4MLEA 1QVGR 4FK4A 3I0SB 3B54A 1O1WA 3E9OA 3DWLA 2F40A 1I94F 1J5EJ 2ZQBA 2R7SA 1N5SA 1U1RA 2XGPA 4DX7A 5KG3A 3NNAA 2WTFA 1YKWA 4DR1F 4ED7A 3R6LB 2UVRA 2O8CA 1R89A 1HNZJ 4C1NK 2YXLA 4OPJA 2FD2A 2EHGA 2HQIA 2RU3A 3FFIB 1ZBFA 3M8PB 1U0HA 2WZ1A 1X4BA 4LBHA 4NI2B 3TSPA 2XY8A 2H5EA 3HCXA 3DLLQ 3AO2A 5KG6A 1B70B 3G10A 2F9TA 2CWXA 3UO0A 1JX4A 4KKOA 2DRAA 4B9LA 3AVGA 5CH7B 2UZAA 4C1NI 3IBCB 2ZE2A 2HS4A 1RBVA 1U04A 4DF8A 4ECXA 4I9QA 4IG3B 2LSNA 3W60A 4CJTA 2E5GA 5ADXH 1FKAF 1BA0A 2YKNA 4L6V3 1HD0A 1RWOB 2D0OA 2QEXS 1HIYA 1UFWA 3RB3A 5ETTA 1TVRA 3AFGA 2XRIA 5F8HA 1PO6A 4ZP9A 5KFJA 3AAQA 4ZPDA 1VQSA 1JJ2M 4JI2K 2YKMB 3KZBA 2HBYB 2ZWPA 4J7CA 1VHFA 4CT8A 1U6BA 2F8SA 3H3NO 2D0AA 2D1CA 3O1LA 3I55S 8AT1B 3SCIE 5KG2A 1JLQA 4ER8A 3LGMA 3UN3A 3KUEA 3UI3A 3HI0A 4RTFD 4DTSA 2UU9F 1NKBA 3W9JA 2BJ9A 1HWJA 4KGKA 5K20B 3A3OB 2W4DA 3AVFA 2ZUGA 2W9AA 4JI1J 1IM6A 5A2QY 3JQJA 2LXFA 2G2ZA 2W6KA 1VQOS 3SJHA 3NMAA 4U7CA 1ZBUA 3CVKA 4ZLPA 4WIQA 5KFNA 3BJYA 1OH5A 2ZE2B 4DR2F 2GIFA 5IWAJ 5E84A 4IO8A 1NPRA 4NO7A 5E3AA 1WHVA 2H3EB 4DFPA 3G0ZA 1WKJA 2CJXB 5DRKA 3QSYB 4KGMA 1WC6A 3BN4A 3QBXA 2OTJS 3GFYA 2HHQA 5LT5A 4L73A 3CYMA 2F4FA 3CCJS 3GQCA 1NOYA 2ASOA 3FQLA 3WHIA 5EXWA 5JLHA 3CCEN 3PYEA 2O8FB 2H48B 2V94A 3GV5B 5EDWA 3WUHA 3MN5A 2G1HA 1HQEB 1SC1B 4RUBA 4DV7J 4FCYA 3PIOL 1XHZA 3ZSZA 4HEA9 3KTQA 2C2MB 3A5OC 1TZ0A 4BRLA 1SI9A 2K06A 3O9TA 1OY6A 3CPWR 2UUAK 4M5GA 5AJ3F 3SJJA 3EE9A 1BUPA 2NXUA 1KQGB 3WC0A 2W42A 2UUAJ 2DRDA 2R2RA 2MY8A 3KHLA 4NEZA 3CFRA 1PKUA 2RQ4A 3G6ES 4KREA 5F0WA 3OY9A 4G1QB 5TKYA 4O3PA 4ZVQB 5C2GA 4BR0A 2VGNA 5F0XA 5CCMA 4OLPA 3DCAA 3CSKA 3BYRA 1J53A 4ZITA 1S49A 8RUCA 5BPMA 1VC0A 4GRSA 5AE3A 1BWFO 4I64A 4JV5K 4J8FA 4DG1A 3G82A 1HJRA 3OTEA 3HFVA 5ETKA 3C6HA 4PHTX 4FZZA 1HNZK 4ANCA 2GJ2A 2R8IA 1CJUB 5L39A 1QVFM 2P9GA 2GEMA 2BBEA 3NY0A 3WQTA 2CYYA 1NK6A 1UOCA 2HHSA 2R7QA 2ZGZA 4E1NA 4WQ5A 4PRFA 3OW2M 3E1YA 4DLGA 4BE0A 1O0PA 4XDDA 3LP2B 3ZSWA 3CTRA 3VTIA 3R1LA 4DTOA 4RNMA 2C2RA 1OYEA 2POKA 2KO1A 2HB5A 4JI6K 4CHOA 2PMWA 2B0GA 2G0IA 4HI2A 4JI2F 3KXDA 3HHLB 4NLBA 2P5OA 2FJAB 2A6OA 5AXMA 1WDTA 1YJ9N 3H6EA 4OLAA 4FWPA 3AOCA 4CJVA 3ISZA 3FZFA 1BY9A 4EO6A 2HGMA 4XPEA 3NG8A 3CQYA 4ERDA 1FVQA 5I3PA 2GBZA 5IC4B 3WIVA 4F9OA 1T03B 3ADAC 4JLHA 2ZHOA 2CDRB 5DG8A 2W24A 4Y00A 2NYIA 2ZITA 2H9ZA 3TX8A 2Y1LB 1RBRA 3CJ8A 2W01A 4FYXB 1BGXT 4X65J 2FBXA 5C24A 3VQEA 4CD3A 2B6AB 3IR6B 1UVLA 4KHMA 3CD7A 1LCUA 3BEXA 1SVDA 2W7PA 2UUBJ 4Y2MA 3MD1A 3MM8B 3OL8A 3G82B 3E8OA 4Q0BA 1JB0C 2YKPA 2DPNA 5KFZA 1HYSA 3CM6A 3VEWA 1WNSA 3CJKB 4DR7J 4LSLA 3K0JA 3AVAA 3BO2A 2HIYA 4UUXA 4CT9A 1HNXJ 1S3XA 4E1JA 4IZ9A 5MAOA 1CQNA 1M0SA 1EP4B 4G6VB 1VBKA 3R2DJ 2AZ3A 2B9YA 1K9MO 2DHGA 1OH7A 1TL1A 3A13A 3NFAA 5ETPA 3CPWM 4F2SA 1HHQA 4YORA 1UETA 2NSBA 3EL2A 4HR2A 1IH7A 4HHTA 3KG1A 2V2KA 5LMUF 3HULA 3D3CJ 2NXJA 4B17A 3PV8A 1IWAA 1L5UA 1RTIA 2AX1A 2B8PA 4DTNA 2MQPA 1VC6A 1HA1A 2VG5B 1PAUB 2DNYA 4ATNA 1GX5A 1PYTA 4B1ZA 4IFVA 4KV8B 4CZKA 2HQCA 2MZSA 3ICLA 2EFVA 2LDIA 3M1VB 3KLGB 1BWEA 1HPZB 2ZVSA 4L72B 1BL3A 4CFBA 2XWXA 1U2CA 1LWXA 3MWPA 3RYLA 2XI2A 2VFSA 4ISFA 2G0CA 4ZVTB 3W0LA 2E20A 4F4XA 3BGRA 2B9XA 3CWJA 1AZSB 1VK3A 1RAIB 2ZJRL 1SB6A 1RHMB 2MPUA 3HI9A 1JCFA 2EBEA 2MZ1A 2GHPA 2LCWA 3KVGA 5DETA 5GADU 4P2XA 1VAZA 2GELA 2E7WA 1TL3B 4CM0A 1ZZNA 3ENBA 5KG1A 1TTHB 1TU0B 1HR0J 5EVZA 2MQMA 4A48A 3VA0A 2H4YB 1RILA 5C5JA 2DPIA 4JI3F 3KUHA 4DV4F 1HWIA 3LP3A 1F5AA 3B4DA 2HNDA 3C19A 4B9MA 3AA8A 3EXYA 3IAM9 3H4BA 3HHDA 2Y1RI 3J7AP 2Z1GA 1V3SA 1RDAA 5J2MA 3FQKA 2APOA 3AO3A 3CQ8A 4M5NA 1I6JA 4D3HA 1R8BA 1S6QA 1ICEB 4B02A 5KFEA 2F96A 1S1TB 3BKUA 2IOCA 2NLXA 2E6MA 2ZNZA 1SV5A 3ZTQA 3OFGA 3U6FA 3AJ1A 4ZP7A 3GJQB 2HBKA 2BE7D 3BY5A 3MMCA 4JS4A 2RNEA 2BZ2A 1TUYA 4RW8B 1L3KA 3KK2B 5D0EA 4CD1A 4DTJA 3L3VA 4FS2A 2AGPA 4CHPA 1NK4A 2F8TA 2KFZA 1YJ7A 3CCUS 3OYHA 2VJVA 3B6BA 2UYTA 4Y6IA 2CZ4A 2U2FA 4MIWA 2X3GA 5DDPC 4BR7A 2R8HA 2M52A 4K8ZA 1MU2A 1CJKA 4I6WA 4JI5J 3DMJB 4C0HA 4CWBA 1AUDA 1N36J 5CYQB 4JKGB 3QBCA 3OJUA 4DSEA 2E5IA 5E3QA 4XO0A 1TAUA 5DM7Q 5IXUA 1ZBLA 2Z2YB 4FYDA 1WC5A 2FYXA 2GVDA 4LFCF 2XEXA 4CEBA 4DV6J 1HARA 2E66A 4M3UA 4M3RA 3ZSOA 2YWEA 1IKYB 2F7TA 2LXIA 4DFMA 3PHEA 4QWDA 3DLHA 3JXUA 1BHLA 3FZMA 1JLFB 4M8LA 3DXKB 4RU2A 4OKJA 4AHCA 4DUZJ 2CQCA 5AQGA 1FKPA 4F8RA 2K8GA 3J7Z5 3O2IA 4QQBA 1MU2B 4BG8A 1RCOB 4DUZK 4AHVA 3LZJA 4QIEA 3TAPA 1JJCB 5KFFA 4CZMA 4FJ9A 1TKXB 2D1KA 2V9KA 2ATQA 1DY3A 4FWQA 1JLGA 2XCAA 4DV6K 5F3ZA 4CBWA 4E7JA 1NH7A 4M5JA 2J0QD 1SQEA 4IRCA 4K4YA 3PR4A 2GO9A 3Q7BA 4AILC 3J7AN 3GYNA 2IRXA 2BJ3A 1S4FA 3QLHA 1ZA1B 3MEEA 2OD4A 3MEDA 1BC6A 2V7ZA 1S57A 1BLUA 2QM1A 4FLUA 2L9NA 1PBAA 3C15B 4V19X 2F4VF 4GV9A 1HNVB 1UZDA 4O5BA 3ULEB 4HH1A 2QWOA 4M3XA 1RTHA 4WF9L 1FHTA 5BR8J 2VBXA 3JSYA 2ZC4A 5SUHA 3LDLA 5ADXA 3BQ2A 1A5WA 2A6AA 3L3CA 5AQSA 3KK1B 1XHXA 3LM2A 4LF4J 1VDHA 4PXBA 2HAIA 3OFEA 1U8WA 2L41A 4CFCA 5JVHL 1VBXA 3RU0A 2VYPA 2KTQA 4C0BA 2OPPB 3NF7A 1JJ4A 2P9SB 2DNHA 2FSJA 1RLDA 2NZTA 2OUGA 3M3ZA 3OL7A 1XUPO 5IQ6A 2KFYA 3D5MA 1FXXA 2MYFA 1NMDA 4N5SA 2M88A 3ILJA 2J9DE 4CJWA 2DY4A 1VSIA 1ASWA 4OI4A 4JI8K 3A2FA 3T41A 2GVDB 3PW5A 4FPAA 3L4BC 3DRRA 2YKQA 1VQ4N 3J81j 3SFGA 2QKBA 1NBEB 2XLKA 3VAHA 4E0DA 1D0EA 4LQ3A 3MI7X 4B8CA 3FSXA 4JV5J 5EWEA 2H1YA 2B5JB 3NGRA 4LF8F 1U6FA 3OR2B 1ZBIA 3LDNA 2FC0A 3LL3A 4JI3K 1I94J 1RTJB 1HPZA 2KKHA 2QJ3A 1FEEA 1KVKA 3THWB 3Q8VA 3AD7C 1WF0A 2RE2A 3T1HF 5FLXY 2A41A 3AB2B 4LVOP 3BREA 4CF0A 3D2WA 3W7BA 3CJ7A 2W8KA 3QZ8A 2V2VA 3P1GA 3BBCA 1QVFR 1Q8KA 2G1DA 4IRDA 1WB9A 5F8IA 3RRGA 2XG8A 1Y0HA 1CJTA 1TV6B 4FWMA 3BPSP 1WN7A 3NDKA 2DGQA 2QLFB 3AV9A 1T94A 2AWZA 2OTLN 4CJPA 2R7YA 3ZTOA 1DARA 3LAKA 3V9XA 2NREA 4GVLA 5I9EB 4FM2A 2QA4N 3Q89A 2KT2A 3CGIA 1Q9YA 2YHAA 3QZ7A 4Y2AA 3BYPA 2AIRB 2V5HG 3CO9A 3IN5A 3K2PA 2O66A 1CJVA 2PO4A 2KVQE 4Q0BB 3EYZA 1BD6A 3BH7B 2DR7A 3L3UA 4FM1A 3ZX2A 4NLPA 4X84A 3C95A 3L0QA 2A1SA 3MPYA 5KG0A 3GBTA 4BC5A 4B9NA 3DOKA 1NU0A 1WI8A 3TJ8A 4EYIB 1KTQA 4ELVA 3CD6S 3D1QA 3HHEA 3L4QA 4FJ5A 5KFSA 1IBKJ 2P9IA 3U9ZA 4CLFA 1NNDA 4F4YA 4KHPJ 2HVIA 4DV0K 4YB5A 3R3TA 1Z25A 4G9ZA 2C2ZB 2O1PA 1OVQA 2WFBA 2O8CB 3DGPA 3UVJA 1ZOTA 4KB7A 4RW7A 4WFNL 4Y1CA 1RAJA 3MPDA 2Q79A 2VIHA 4X65K 3C8YA 1KKHA 4ZVEA 4IQMA 4KI4A 5M1PA 3P8BB 4FWLA 2KN4A 2Z2LA 4DV6F 3UKUA 2RN2A 2WVEA 4LF9K 1NXIA 3ATVA 4LFAJ 4Y28C 5M1NA 4RL1A 2HHHF 2UVVA 1YJUA 1W2IA 4ITSA 4L3KA 4J90A 2CKWA 1KONA 4JKBA 2MSTA 5A6PA 1U1MA 4ZLJA 4RNNA 1OS5A 1IO2A 1XMQF 3F9KA 5HVFA 3LWMA 4MTPA 1EQYA 4KH6A 1X7VA 3CDBA 3ZCMA 3OW2R 2O8BA 1G99A 4RWTA 1JXLA 1RJJA 4B9VA 2Q1LA 3IKMA 1D4XA 5KOWA 4FXWA 1VSFA 1U02A 3MR7A 4PABA 3QDKA 2CPZA 3JB9k 1K8AT 2FF6A 5IT9U 1S1UA 3MWTA 5C42A 4NZ0A 4Q45A 2DD8S 4A2AA 1TMMA 1Q79A 4Y1DA 2VFUA 1ZS6A 4K41A 1IBMF 3LPTA 2FTRA 3RW7A 1HNWF 1M5VC 1NMEB 1FT8A 1WF1A 3MMAA 3HVRA 2ZKUA 4DV1F 4CK2A 2K2PA 4U7UK 4ED0A 3M32A 1KFDA 2KDOA 2QSFA 2RQKA 2EW9A 4CLWA 1LOUA 1NSAA 2HHUA 4OX6A 3AVHA 4W92B 5AQIA 1JKHB 2V34A 5A8KA 4DU3A 2LEBA 3PJXA 2E1PA 1YI2S 4G65A 2HG4A 1NKCA 4CQ1A 2LA6A 5IV4A 2HW3A 4KGVB 5KRTA 1B92A 3VWSA 3LH2S 5K8NA 1Q5YA 3FK4A 2OTJN 2VKRA 5AZJA 2O67A 3R5DA 1GLBG 3SSSA 2B4VA 2AYEA 2FHKA 3C2PA 2D9OA 2R2TA 2QTDA 3FBEA 1S10A 2DNKA 4OHXA 3OV7A 4UQGA 4WP8A 5DJBA 1HBUA 2MQ8A 1Y4ZB 3IM8A 2F3JA 4DN0A 2IJRA 4ZLNA 4JI5F 2NCKL 5KT5A 3CFPA 3PR5B 3RMDA 3AJDA 3S41A 1EB0A 4CDIA 2IM3A 2V69A 1CG2A 2I0XA 5KGXA 3C6UB 1GLLO 3KLVA 1WSEA 3AOAA 1MROB 1WOSA 1BIUA 4EP4A 3FSIA 1IR0A 2EFPA 2OEMA 4QW8A 4DSJA 3CJBA 3M4XA 2FLNA 1ATNA 1P90A 2MGZA 2PAVA 3FMBA 5LMNK 3VAMA 3HX9A 1NJWA 2MZRA 4YQWA 3CC4S 1UW4A 3CCZA 4BE2A 1UP1A 4OYBA 3O8WA 5A8KB 3GSDA 3P5JA 5AZIA 4OI1A 1SQFA 1IQTA 1ZM3A 2DKOB 2FZGB 1OJ4A 4FBTA 4LQ9A 4EZ9A 4V1Ak 2NLWA 3KLEB 3OD2A 3ZTPA 2BW7A 1VQNS 2OCEA 2JGUA 3IS9B 3UD5A 2V2ZA 1N8RO 2ZOGA 4O3SA 4BWMA 1IG9A 2LEPA 4ZCLA 5BXIA 2J6TA 4OQJA 4JYAJ 3HVWA 3SI6A 4LJMA 3GDQA 1Z26A 4NEYA 2PYJA 2W2MP 5K14B 4MKBA 1E6VA 3RR8A 1Y64A 2RHKA 4BHQA 2ZH7A 3KK7A 3ULEA 2KI2A 3RMBA 3GYXB 2NNWA 1H2TZ 3MAAA 1UCNA 3FDSA 3I5CA 2QV6A 2Y3YA 4KGZB 3VGUA 4V19S 1QAYA 2LEAA 3L2WA 4YHHJ 2E1ZA 2IC3A 2P9LB 2RRAA 2WONA 1YAGA 4OPAA 2RHQB 1XK8A 1IKWA 4ZN1A 1RYRA 1X4DA 3P39A 3CCJN 1P27B 2FHJD 4X66J 4ANEA 3FZHA 3PCOB 3R5CA 1CLQA 2HIQA 1FEHA 4NYPA 2X51A 4ECYA 4C8MA 3E01B 3BB5A 1S1XA 5D8HB 3QWPA 2C22A 1IKXB 5CZXA 4K0KK 4OI2A 1FFSB 1JXBA 4JD2B 4PKGA 5J2QB 3P4UB 1KVBA 5HN0A 1NGJA 3POTA 1FDDA 2R8KA 2C2OB 3UVJB 2RDJA 1VQKN 4LF8J 3BGOP 4GKKF 4GC7A 4H0YB 2G8VA 3LALA 5J2QA 3HDSA 2CUYA 3P3DA 1B3TA 4RW6A 3WNGA 4BC2A 4E19A 3GMGA 4ZS6A 1MWZA 2L9DA 3DGVA 2YNHA 2EEYA 1FW6A 3AA4A 5E0OA 3FFKB 3HL8A 4FLWA 2GAHC 3BF4A 4Y2IA 3SCKE 1XNQK 3ZEUB 4X66F 3M8RA 3G8SA 2IAJB 1T7PA 4QPXA 3UD4P 3GV8B 4JKHA 3R9PA 1C0TA 1HNXF 4RWWA 2W2QP 1TK8A 4OYWA 1S77D 4HI1A 2AMCB 1GLAG 4DDFA 4FLTA 3HD2A 2JEIA 4A61A 4OZNA 2IGIA 2C3UA 4DSLA 5JICA 1TYQB 3OTOJ 3CCRS 5BN8A 2BOPA 1V3RA 4IG0B 3ZT2A 1QTNB 1BI4A 3B8AX 3DRYA 1VRUB 1NRKA 3V1QA 4FOEA 2V63A 5KFUA 4X4TA 2BRKA 1N8RT 5KFIA 5C2CA 3VTHA 3PTWA 3DDNA 3NCQA 9ATCB 2NRZA 4BDYA 4DV7K 3DRPA 2EXUA 2FBTA 3OYBA 1RKJA 2GNKA 2HHXA 3J80Y 2G4BA 3R8YA 1T02A 4NCBA 3PIPQ 5CYQA 3TA1A 3MMBB 4C98A 5CA5A 2VHGA 4N47A 2VQEF 4NLOA 5HMWA 1UJ6A 2A10A 2RF2A 4BRGA 1RGVA 3AVLA 1QAJA 1C2PA 1D1UA 3SMZA 3BO4A 3GSIA 5B0CA 2W9CB 4DUZF 1SXLA 2K3KA 3MWBA 3MURP 2ROPA 4RKUC 2QA1A 4ZA1A 3KKRA 1KAXA 3GE1A 2CVEA 3I31A 4ECSA 2B4OA 1K8KA 1NDPA 3H2LA 3SQGA 2V4QA 1R8HA 3JQMA 2PT0A 4YEAA 2YNIB 3BS9A 2D9PA 3SV3A 4FK2A 3K57A 1RT5B 4HTLA 5AQHA 2W6LA 4IFYA 3MCOA 1NLVA 3Q8SB 3O80A 4ZCMA 3WXKA 1D9DA 2DNLA 2BUNA 4AT1B 2AF6A 4DX6A 3UCUP 5A2QO 5HRPA 4JAXA 4DUYJ 2P9KB 2CAJA 3L7PA 4JKDA 3UW1A 4KV8A 1KAYA 1DQ9A 1YRTA 2CA9A 1G1XA 5BREA 3KD1E 2NQPA 3TU5A 2FZKB 3LP1B 2MSSA 2Z57B 3O9SA 1KQFB 4B3TJ 2QKKA 3W3DA 3G87A 5E3PA 4CO5A 1J27A 3I5AA 2GS8A 1NKEA 2XNRA 3IR7B 3L09A 5J1EA 1P6TA 1FWKA 2QWMA 4DTMA 4DL4A 2G2OA 4RBVA 4P6QA 2E7VA 1AFIA 1P9YA 1BA1A 4ZCIA 4A8KA 4A8WA 3LDOA 3SYZA 4C8OA 3QEWA 3KLEA 1ZM2A 4KT0C 2GIRA 3QNNA 5JVHQ 5C0YA 2ITGA 5KFRA 3FZLA 4ILJA 4Z7YA 2O8DA 1IV0A 1NGBA 3OR1A 1GEHA 5HOOA 4CEDA 1TELA 3U3GA 3C14B 3W1YC 2DR5A 3TAMB 3DC2A 2UXCF 2DVIA 1Q16B 2KJWA 4AXJA 3ENAA 3PX4A 1AFJA 3VQ6A 4AFFA 1Y3JA 1VGYA 4DPOA 5ITHA 4DBQA 4X4PA 5K5MA 3I56N 3AODA 3K89A 4LR9A 3C6TB 2IVYA 2XLJA 3PO5A 1RDCA 1N32F 2OD6A 4QU6A 3MM8A 4CGDA 1MROA 2IRUA 4KB0A 1S5JA 1DJ0A 1B99A 3C6UA 3CW2C 5IZHA 3RR7A 4TSXA 1S6PB 2DGVA 2RRBA 1FVSA 2GUIA 4IFVB 2OTLS 2HRYA 1MWMA 1DTTA 2JFKA 2XS2A 5M2PA 4KYZA 5DZ6A 4Z0UA 1U26A 4BREA 3L6QA 3R1XA 1RWNB 1NK0A 2QLJB 2B4UA 2RHSB 2R2UA 3HD1A 2DEIA 2UV8A 1XJWB 1RDBA 1RHKB 1TKTA 4XH5A 2PN6A 3UCZP 1QQMA 3QYYA 3FEZA 4CGGA 3BZQA 1VQ7S 2X74A 3CC7N 2FQQB 2P9NA 3TUIC 4CBXA 3NH1A 2RUGA 4MO5A 3CJ5A 4CGJA 3TNVA 3B4MA 2C3OA 4DPUA 3RB4A 1O51A 4FL9A 2DR6A 2A3JA 3G2XA 2HNZA 2D3UA 4L3QA 1Y9OA 2FVQA 4DF4A 2VBYA 4LSNB 4AD6A 3KK1A 1FO1A 4WYBA 1MMNA 1NGGA 4DHYA 1GLDG 4DS4A 2BH1A 3IO1A 5DS7A 4GV3A 1SC3B 2FSNA 3N4QA 2HPUA 1RT1B