3U3YA

Mouse trex1 d200h mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
215
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
molecule keywords Three prime repair exonuclease 1
total genus 68
structure length 215
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u3yA01
3RMBA 1RT6A 4CIFA 3NF8A 4DSLA 5HROA 4OGEA 1RDDA 3IG1A 3KLIA 3ZT0A 3O3FA 1YT3A 4CEEA 3EYZA 2VG5A 4DLGA 3OYGA 4CJSA 3OY9A 3DYAA 3AVNA 5JS2A 3V1RA 2HNYA 1KVCA 1WLJA 4FW2A 3SCXA 4CFAA 1SUQA 3UIQA 3DLKA 3NDKA 4CFDA 4W5RA 1DLOA 3LPTA 1SKSA 4M42A 4CJFA 4FLYA 4J2DA 1KVBA 2I5JA 3V1QA 1RBSA 3NF6A 4FJ7A 4B08A 3VQAA 2HVIA 4E3SA 4OPKA 3WNEA 3U3YA 3VQ8A 3ZT3A 4KKOA 2D0BA 4CEZA 5KGXA 2P5OA 2KTQA 1SKRA 1FK9A 3V81A 1D8YA 3KKRA 5J1EA 4AHRA 5D3GA 3ZSVA 4PA1A 1LWEA 3OS0A 2XY8A 1LV5A 4UQGA 4FLXA 1QQCA 1ASUA 2E6MA 4E7JA 1WSJA 4XIUA 5HLFA 4JS4A 3THVA 3CFOA 3DM2A 3TWHA 5CZ1A 4HTUA 2Q3SA 3ZSYA 4CJQA 3DRSA 2PYJA 1RILA 4CIEA 2B6AA 4CJ3A 3QINA 4C8MA 3NH1A 4AHUA 3F9KA 4I2QA 3KK2A 4R5PA 1LWCA 4W5OA 1C6VA 1D5AA 1U49A 4H4OA 4I9QA 4QOZB 1A5WA 4CJWA 3KTQA 4Q0BA 1BQMA 4K8ZA 3G10A 4C8KA 5KGWA 4DS4A 3CYMA 2YNIA 2ETJA 3AVMA 3RMCA 4Z4IA 4FLUA 4Y1CA 3NBPA 2XY6A 3SQ2A 4NCGA 4DTRA 4IBNA 4CFCA 1HQUA 1BHLA 1IKYA 3P83D 3QIPA 3NGIA 4W5QA 1WAFA 4EZ6A 1J53A 1WSFA 3HYFA 4CEDA 4HUEA 4MFBA 3SNNA 3LZJA 1L5UA 3VQ4A 1VRUA 2RKIA 2VWKA 2WOMA 4CIGA 1WSIA 4RW6A 3SUOA 5C24A 3SUNA 4FLZA 4QAGA 3DRRA 3K5OA 1EKEA 4B9VA 4FZYA 3TARA 3PO5A 4WE1A 4B9LA 3TAQA 3NE6A 4F2RA 4CJTA 4ZTJA 3PX6A 1C1AA 4CK3A 1IG9A 1TVRA 2EHGA 3ZT2A 4CJLA 2YNHA 1ZYQA 4DLEA 3PO4A 3RTVA 2PYLA 4CCHA 3LP1A 2O4IA 4E1NA 3IRXA 3VQ7A 2IAJA 2P51A 1JXBA 4O0IA 4NCBA 4DU4A 5HRPA 4PQUA 3NH2A 1C1CA 2ATQA 3AVAA 4B8CA 3PX4A 4C8OA 1CZBA 4KTZA 4AILC 4N41A 3DOKA 1KSPA 4HCBA 2DY4A 1RCHA 2BANA 1S1VA 1S1XA 4IFVA 4CGIA 5HP1A 4DSIA 3SYZA 3O4NA 4HVJA 3AVKA 2HHVA 3V4IA 4QCLA 1J9AA 1VSEA 4EP5A 4M3ZA 1DTQA 3IS9A 1RTJA 1YTUA 1W0HA 1KFDA 1DTTA 3HP9A 2HVHA 2FBTA 1JLAA 4F8RA 1RBVA 5HRNA 1ZBLA 4NCAA 1BGXT 4AH9A 1LWFA 1CZ9A 3LDSA 4DU1A 3V9WA 2HNDA 2YKMA 4CE9A 3SQ1A 1WN7A 1RT5A 3CQ8A 4F2SA 4CF2A 3QESA 4E7KA 4B9NA 3QETA 1HPZA 2B5JA 4CJEA 4F3TA 4N76A 1C0MA 2G8UA 3SUPA 3OVNA 1Z25A 4CJRA 3DMJA 5EU7A 4OKEA 1GOAA 3HPGA 4DTSA 4LY7A 3ZSWA 3OYIA 1WSHA 3JSMA 1L3UA 2YNGA 4FYDA 3HVTA 3TAMA 4KTWA 1RTHA 2OZSA 1JLBA 4I2PA 2FC0A 3VA0A 2ZQBA 3OYMA 1NJXA 2R7YA 4LSLA 3V9ZA 4K8XA 2Z1GA 2HNZA 3LP3A 3VQ6A 4JS5A 3MXIA 1KRPA 4BE0A 1A5VA 2RPIA 4M3WA 1JKHA 4OGCA 3ZCMA 1NOYA 4FZXC 4M3RA 3DI6A 4FM2A 3RRHA 1NK8A 3VA3A 4M3UA 2IS3A 1BI4A 3K59A 1BCOA 4PUOA 3HSTB 3MAQA 2D0CA 2DFHA 3AA3A 4AHTA 4HCCA 3ULDA 4W5NA 3SV4A 3CM6A 3VQCA 3VQDA 4BDYA 3T3FA 3SQ0A 5I42A 4PWDA 1TAUA 4PY5A 4DQRA 3AVGA 1ZBIA 4DQIA 1B92A 3OYCA 2WONA 1JLFA 3TABA 3VQ5A 1HJRA 1KCFA 3LPUA 2O4GA 2W42A 2DFFA 2FBXA 4Z4CA 3HJFA 1IH7A 2RN2A 3HPHA 4Z4HA 3VQEA 3LAMA 2QKKA 3C95A 3I0RA 2HW3A 1I3AA 1BCMA 4C8NA 3NCIA 4N56A 3ITHA 1SV5A 3K5LA 3HO1A 3HXMA 2ITGA 3AO2A 5KI6A 4O55A 3QERA 3C6UA 1VRTA 4DMNA 1UA0A 3OYEA 3KD5E 1VSKA 1TK5A 4DG1A 4KFBA 1XHXA 3LWLA 4ELVA 4IDKA 3MXJA 3PY8A 4FJLA 4RW4A 3QNOA 2HHQA 5J2QA 1JXEA 1ASVA 4DWIA 3OS2A 1TGOA 1I39A 4B8AB 3VQQA 4CEAA 3OJSA 3LAKA 4BACA 3OYDA 3NH0A 3AV9A 4O4GA 1RTDA 1W9HA 4C8LA 3QLHA 3AO4A 5DK5A 4AHSA 3M8RA 3L2VA 2XRIA 1S1UA 1S5JA 4B9MA 4FZZA 4OPJA 1JLEA 5FRNA 4E0DA 1VSFA 4CHZA 1HRHA 3SPZA 1QSSA 3KKSA 3K57A 2FBVA 4BE1A 3SPYA 4DF4A 2OPQA 3NF9A 3S3NA 3HL8A 4OJRA 2XHBA 1N5YA 2G8WA 4J2AA 4KHWA 3SI6A 4G1QA 2E4LA 3NHGA 4NYNA 4IKFA 3K5MA 3P1GA 1BIZA 1TKZA 5JS1A 3ALYA 1VSHA 1RDCA 1T7PA 4CGHA 1CLQA 4CEQA 2IGIA 4W5TA 4FJNA 2VG7A 3OYAA 4ID1A 1TK0A 4CEFA 4IFYA 3M8SA 4JRQA 1Y97A 4KO0A 5E41A 1S1TA 1S6PA 2ZE2A 3HK2A 2HHXA 3QO9A 3TR8A 4ELTA 3SQ4A 4DSKA 3WNFA 1R0AA 4ELUA 4OLBA 1N6QA 2X74A 1UAXA 2QKBA 4FK0A 2EX3A 4EZ9A 3RRGA 3ZT1A 4CJ5A 3MXMA 3RR8A 2G8FA 1S1WA 4CF0A 3AVIA 1NK4A 4KREA 2LSNA 4M45A 4RW7A 5HRRA 1JL2A 5I3UA 4FJJA 1NOZA 3L3UA 3LZIA 1KLNA 2PY5A 1REVA 4BDZA 5J2NA 3MEEA 2OA8A 1KTQA 3MEDA 4OKJA 3V9XA 4FJKA 1KVAA 2A1RA 1Z26A 5CY4A 3KK1A 3DLGA 3V6DA 1RBTA 2B4JA 1FKPA 1HQEA 3AA5X 4RW9A 3PV8A 3AO3A 1L3SA 3MEGA 3OS1A 4H8KA 3PUFA 1XWLA 5C42A 4FJIA 3LP0A 3SJJA 4HUFA 1RNHA 2Z1JA 3ASMA 1C0UA 2Z1IA 4RW8A 3TAFA 2BGGA 4DTJA 1C1BA 4BWMA 3OYHA 4NYFA 3ISNC 4Z4GA 2HHTA 1KFSA 3E01A 4CJ4A 4OKKA 2JLEA 4KV8A 4OLAA 1RT4A 1ZBHA 3TAPA 4FCYA 4FJGA 1O1WA 2KW4A 2NUBA 3KLHA 4DQPA 1SL0A 5CZ2A 4DTPA 4FLWA 1HYZA 3AVCA 4E1MA 5SWMA 4DTUA 3U6FA 4GW6A 3F73A 1D9DA 2OYQA 5FRMA 2DTUA 4M41A 1S9GA 4CEBA 1GOBA 5SZTA 3VQ9A 3SV3A 2HB5A 4E7LA 3KLFA 3KK3A 2ZD1A 3S3OA 2E6LA 1EETA 3NFAA 2HHWA 1BL3A 1KLMA 3V9UA 1NKEA 1LW2A 2YKNA 4B9UA 4BE2A 4KHQA 3G0ZA 4KB1A 1NK0A 3LANA 3OYNA 1S9EA 2HMIA 4M3TA 1FKOA 4GVMA 1HNVA 2X6NA 4CJVA 1T05A 3RMDA 1RT1A 4FM1A 3B6PA 3BGRA 4KPYA 3LALA 4CF9A 4FK2A 4I7FA 4DTOA 1FXXA 3S9HA 3ZSZA 1IKXA 1YVUA 1CXUA 1VK0A 4DFPA 4FVMA 3VQPA 2YHBA 4FW1A 3OYFA 4HUGA 1NKBA 3O3GA 3C94A 4DSFA 4AHCA 1ZBFA 2D0AA 4ICLA 4N47A 1L3TA 3LWMA 2BE2A 3U3GA 4EP4A 2XO7A 1U4BA 4Y1DA 1JLGA 4FJ5A 4IG0A 4L8RB 3NGZA 3SUQA 1NK6A 1LW0A 2G8IA 3ZSQA 3AVHA 2OPRA 3AVJA 2KFNA 1RDBA 2OPPA 5KTQA 4DQSA 1L3VA 4MQ3A 4E7HA 4Z4FA 4B9SA 3HP6A 5J2PA 2P1JA 1BI4B 3OYLA 5FROA 2OZMA 1TKDA 3ZSOA 4DTNA 4CJUA 3B6OA 2VG6A 3HVRA 1RDAA 1NK9A 1U48A 4O5BA 3L2UA 1XI1A 3I8DA 1X9MA 1X9WA 4CJKA 4CHPA 1NJYA 2KZZA 1EXQA 4DSJA 4OVLA 1TAQA 3M8PA 1QSYA 3TI0A 2HHUA 4LD0A 4CECA 1BISA 4FXDA 1JLQA 3DLRA 3L2QA 4ZTFA 3K58A 4JLHA 3K5NA 2KQ2A 3AVLA 4CK2A 1TK8A 3D0PA 1B9DA 5KRTA 3IAYA 4KHUA 2GV9A 1VSDA 1GOCA 1A5XA 1LAVA 2XY5A 4BDPA 4CGFA 1EP4A 1WSEA 3M8QA 2VWJA 3QEXA 1VSJA 1U04A 4KRFA 1B9FA 3ZSXA 1TKTA 2YNFA 1YTAA 2IDOA 5DMRA 3L2WA 3QEWA 2QXFA 3PX0A 5HRSA 4YNQA 5T7BA 1HNIA 5KRSA 1UOCA 3LP2A 1WSGA 1HYVA 5HBMA 4CGGA 4ZHRA 4O0JA 4CHYA 1IO2A 1HMVA 2OPSA 2Y1JA 1NK5A 1T8EA 4E89A 3KD1E 2KFZA 4O44A 4DU3A 2F8TA 2X6SA 3QIOA 4KTQA 3ZT4A 3RR7A 4ID5A 1MU2A 4CF1A 1NKCA 4FJ9A 4YFUA 3TANA 5FDLA 1NJZA 3QEPA 3RMAA 1ASWA 2X78A 3HT3A 2FBYA 3TAEA 4KB0A 4FK4A 3AA4A 2JGUA 4Z4EA 3SZ2A 4JRPA 3MECA 3AVFA 3QEIA 1X1PA 4FJHA 1TL1A 2YHAA 1SL1A 3I0SA 3NGYA 4CJPA 1TKXA 4KI4A 4FLVA 1VSMA 4CEOA 4DFMA 1Q9XA 3DLHA 1U45A 4F4KA 2IOCA 3CG7A 3AO5A 1TL3A 1T03A 2GBZA 1CXQA 3L2RA 1D9FA 2G8VA 4KHSA 1RT2A 4KI6A 4FJMA 1BIUA 1RBUA 3AA2A 4CHOA 4KHNA 2G8HA 4DQQA 3AVBA 3L8BA 1QS4A 2A1SA 4CGDA 3HPOA 4DFJA 1NK7A 3V1OA 4B3OA 4M3YA 1JLCA 3T1AA 4BWJA 3OYKA 1XHZA 4DF8A 3KIOA 3AO1A 2KZMA 3S3MA 1RT3A 1S6QA 4Z0UA 1J5OA 4LH4A 2PZSA 4CESA 4CFBA 4N5SA 3OYBA 3EY1A 3O3HA 1ITGA 1RT7A 1BQNA 2Z1HA 1WNSA 1HYSA 4DTXA 3DLBA 4CGJA 4E7IA 2G8KA 3RWUA 4KHYA 1RTIA 3WNHA 3CFPA 1C0TA 1QE1A 5J2MA 4TSXA 1UWBA 3D45A 3T19A 1QTMA 3VQBA 4CF8A 1IKVA 3NF7A 3CM5A 4F3OA 3KLEA 4J2EA 1J54A 2Y1IA 2QK9A 3C6TA 3TAGA 1QSLA 2P5GA 5CYMA 4M3XA 1K6YA 3CFRA 1VSLA 3KLGA 3DOLA 4FJXA 2AJQA 1SKWA 1RBRA 4CHQA 4B9TA 1SL2A 4AHVA 2YV0X 1NJWA 4HHTA 3EZ5A 4FLTA 4I9LA 5C25A 3OYJA 2F96A 1Q9YA 4DFKA 1UA1A 2F8SA 1XC9A 3HM9A 4KAZA 3NAEA 4E19A 4IG3A 3QEVA 3K2PA 1IKWA 3H08A 4RG8A 1JL1A 3WNGA 1G15A 4DTMA 1ZBUA 2D5RA 2DFEA 1F21A 2IC3A 2XY7A 4LH5A 4FJ8A 1EX4A 3V9SA 4Q5VA 4CK1A 3A2FA 2GUIA 3DRPA 4DSEA 3BDPA 4CERA 4J2BA 3L3VA 5CYQA 4GMJB 1VSIA 1LAWA 2BDPA 4FM0A 1Q8IA 3O4QA 2RF2A 5K14A 3KJVA 3DLEA 3QNNA 1WAJA 4H4MA 1X9SA 1QHTA 2HHSA 4LSNA 1U47A 3JYTA 3P5JA 3FFIA 3ZSRA 3OJUA 4CHNA 1TV6A 3VN5A 4DS5A
chains in the Genus database with same CATH superfamily
1RT6A 3OTOK 3KLIA 4KBOA 3O3FA 3QBXA 4CJSA 1M90O 4A5BA 2HNYA 1WLJA 4FW2A 3SCXA 4V19S 3UIQA 3DLKA 3LPTA 2I5JA 4ILGB 4OPKA 3WNEA 3VQ8A 4KKOA 4CEZA 2P5OA 5KGXA 4A57A 2CGKA 4B3MK 3OS0A 2XY8A 4UQGA 4FLXA 1ASUA 4FWRA 3CFOA 3VEWA 4BC4A 2Q3SA 3ZSYA 2PYJA 2O8EB 3DWLA 3TSUA 3QINA 1HLUA 3SK3A 3EZWA 4YDUA 5BREA 3A0IX 3KK2A 1C6VA 3SLCA 1A5WA 4JI8K 1HNWK 3FZLA 3Q7BA 3EL2A 2UXCK 2GWJA 3NMUA 4K8ZA 3G10A 2GEMA 2A42A 3CYMA 1QVFM 1DGKN 4Y1CA 4DTRA 3CCSN 4HWIA 2WTUA 3NGIA 1IKYA 5AQTA 1OKJA 3HYFA 3J7AP 3VQ4A 1VRUA 1GLAG 2WOMA 4CIGA 5C24A 2NRHA 3SUNA 4FLZA 1NMDA 3BUZB 4I6MA 5CE3A 2FXUA 1EKEA 4B9VA 4FZYA 4GY2B 3THYA 1YVNA 4WE1A 4B9LA 2HHUA 3I55N 5GADP 4CK3A 1TVRA 2Q1NA 2ZJQL 2P9SB 4E1NA 3IRXA 3P31A 3THWA 4FWPA 4PQUA 3NH2A 4CZFA 3AVAA 2WBNA 3VEVA 3JAMO 4KTZA 3DOKA 1KSPA 4HCBA 2YI1A 2VCPA 1T6DA 2FSJA 3DXMB 1J9AA 1RTJA 1YTUA 1W0HA 1KFDA 1DTTA 2HVHA 5DM7L 4BREA 5HRNA 4NCAA 1QZ6A 2ASMA 3MCPA 1YITN 4ILJA 4CE9A 2YKMA 4CF2A 3QESA 3M3ZA 4BY9C 3ZX0A 4A59A 5BN8A 4CJEA 1C0MA 1NGHA 3EE8A 3MN5A 4PKIA 2ITMA 1GOAA 3HPGA 3ZSWA 5KPTA 1EWRA 3OYIA 4AM7A 3HVTA 3TAMA 3K9KA 1JLBA 1QHAA 1H1VA 4PKGA 3RVCA 3LDQA 3VA0A 3RSEB 1NJXA 3WT0A 4LSLA 2IIRA 1OH8A 1NBWA 3AARA 4K8XA 4JS5A 4ISFA 5CR4A 1QZ5A 2RPIA 1JKHA 1T6CA 1NOYA 3EKUA 3RRHA 1NK8A 4DUZK 2IS3A 3AA3A 4HCCA 2V7ZA 3THYB 1V4TA 3VQDA 3VQCA 4BDYA 5I42A 4DQRA 4DQIA 1B92A 3OYCA 3TABA 4J8FA 3LPUA 3VGKA 3VQ5A 3KVGA 4Y0WA 3O9RA 2D0OA 3HJFA 1IH7A 3HPHA 5AQFA 4Z4HA 3UE5A 4JD2A 2D4WA 2KHOA 5JICA 3NCIA 4EHUA 4N56A 2O8DB 2O8EA 3C7NA 2P9LA 5M1QA 4O55A 2IVPA 3CETA 1UA0A 2NRRA 3KK7A 3LWLA 3GBTA 3P4IA 1TGOA 1I39A 3VQQA 2QTDA 3AV9A 3QLHA 4AHSA 4CZKA 3M8RA 2XRIA 1S1UA 1YAGA 3VETA 3DXKB 1KAXA 3OBYA 3JS6A 3VEZA 2A5XA 1VSFA 4JI1K 1HRHA 3SPZA 3KKSA 4BRQA 1N5YA 5EVZA 3HL8A 4OJRA 2XHBA 5GIOA 3GOIA 3LDLA 1NMNA 5GIPA 3P1GA 3CCVN 3OHRA 5JS1A 1YUWA 4W5TA 3ULEB 2VG7A 4IFYA 3M8SA 4MDAA 1S1TA 1NGJA 1S6PA 3K9JA 2ZE2A 5EX5A 3HK2A 2JWKA 4JEPA 5BPNA 5LMNK 5AFUA 2WC9A 4ELUA 4OLBA 4YORA 3U9DA 1UAXA 4FK0A 4X65K 2G8FA 2CH6A 2W41A 4KH6A 1Q81O 4GVEA 1ESVA 5HRRA 1NOZA 3LZIA 1KLNA 2PY5A 2QEXN 3MEEA 5AQMA 5FLXO 1RBTA 3A8YA 1ATSA 3CERA 1L3SA 3O8MA 5LY3A 3HOSA 3PUFA 5M1PA 1TYQA 3OYHA 4CJ4A 4OKKA 4OLAA 4KV8A 5BN9A 3S41A 2O8BA 1G99A 4ILHA 2NUBA 2VQFK 5CZ2A 1SAZA 3AVCA 5SWMA 3CCJN 2V7YA 2P9PA 3MK6A 3SV3A 3O1WA 4A62A 3KK3A 4CZLA 5AQPA 1QQNA 1EETA 3NFAA 2HHWA 1KLMA 3O6WA 4K25A 1NKEA 4KHQA 4GNIA 4M3TA 1S9EA 1FKOA 4GVMA 4OPAA 1KXPA 3S9HA 1FXXA 2UYTA 4FW1A 1T44A 4HUGA 2QA4N 3I8BA 3H1QA 3C94A 4DSFA 4N47A 3THXA 1L3TA 3LWMA 3U3GA 3H45C 3K0SA 4Y1DA 4JKGA 2ZJRL 2W6KA 1RDBA 2F7TA 2OPPA 4BRKA 5J2PA 1BI4B 4JHDA 3ZSOA 5GAEP 3VF2A 3B6OA 2VG6A 2HHHK 4FWSA 1U48A 4O5BA 4IXCA 5A2QO 2YHYA 2WFBA 3L2QA 3K58A 1XMOK 3K5NA 1BO5O 3AVLA 4CK2A 3IAYA 2GV9A 1GOCA 1A5XA 1LAVA 4CGFA 1WSEA 3L4IA 1VSJA 1U04A 4B3TK 1GLFO 3QEWA 5HRSA 4H0TB 5BRHA 4CHYA 2HBMA 1IO2A 1HMVA 1NK5A 3A5OC 4E89A 1NGAA 4DR6K 4LF6K 1MU2A 5AQWA 4A2BA 5FDLA 1NJZA 3RMAA 1ASWA 2X78A 3WXLA 4FK4A 3U8XA 5C0YA 1SL1A 2O8FB 4BGBA 4PKHA 1VHXA 1GLCG 1IG8A 1VSMA 1Q9XA 3DLHA 1NGIA 2GELA 1KAZA 2F9WA 1T03A 2YCHA 5AQGA 2ZGYA 4KI6A 4FJMA 1BIUA 1IBKK 4JKDA 3FE1A 3OYKA 3LDNA 3AO1A 1S6QA 4LFBK 1VQ6N 2VGNA 1ITGA 1RT7A 1BQNA 3QDKA 3L0QA 5CHIA 1HKBA 3DLBA 2E2OA 4KHYA 4IOXA 3CFPA 1C0TA 2NRZA 4TSXA 4JV5K 1UWBA 2YHWA 3TU5A 1E3MA 3D45A 2CGJA 1QTMA 3VQBA 3NF7A 4IOAL 4J2EA 3WQTA 4DV1K 3TAGA 1QSLA 1K6YA 4MO4A 1TUUA 3PSIA 1Q9YA 4I9LA 4JKEA 2O8CA 1YXQA 1UA1A 3H08A 3WNGA 2QWRA 2DFEA 1F21A 1HKCA 3O4WA 1EWQA 1X3NA 4UY8O 3R9PA 3L4QA 5IT9O 2GX9A 4J2BA 3L3VA 5CYQA 4JK7A 2PFUA 2QWQA 4FM0A 4BROA 2HHSA 4FVUA 3FFIA 3OJUA 1BG3A 5I9EB 4LF9K 4DS5A 4X64K 3RMBA 2OTJN 3ZT0A 4CEEA 2VG5A 4DLGA 3OY9A 3DYAA 3AVNA 1KVCA 3W3DA 2ZM6K 4QS8A 4W5RA 1DLOA 3KZBA 3NF6A 4JI5K 4FJ7A 3GDQA 3U3YA 1NGGA 3CJBA 1FK9A 2F9TA 3V81A 2Q2RA 4AHRA 5D3GA 4PA1A 3DXKA 3GE1A 1LV5A 4E7JA 1WSJA 3THVA 4B1ZA 4HTUA 3DRSA 1OVQA 1RILA 4CIEA 2B6AA 4CJ3A 3F9MA 3C65A 4AHUA 4I2QA 4R5PA 4QOZB 4BRNA 4Q0BA 1BOTO 1BQMA 3SBGA 4C8KA 4DR4K 5KGWA 4Z4IA 2ETJA 3AVMA 3C7NB 3RMCA 3LM2A 3MX2A 4NCGA 3CC2N 3ZEUB 2JWLA 4DR2K 4JKHA 3R1XA 1BHLA 2QWPA 4RW6A 3ZYYX 3DRRA 3TARA 4B1WB 4F2RA 4CJTA 1IG9A 3ZT2A 2EHGA 4DLEA 3PO4A 2I7PA 1WB9A 4DU4A 5EOYA 1C1CA 4B8CA 4IOCL 4AILC 2HBKA 4K0KK 4NB4A 4RWTA 3FZMA 3O4NA 1XNQK 3LDOA 3V4IA 2IVNA 4EP5A 3IS9A 3ID6A 1YHQN 2FBTA 4YOVA 3CD6N 1RBVA 1ZBLA 4H0YB 1LWFA 3LDSA 1C0GA 3QICA 3V9WA 1VQMN 3SQ1A 5F1XA 4BVPA 1KD1O 3QETA 1HPZA 4N76A 2G8UA 4CJRA 4XH1A 3DMJA 5EU7A 3NVMA 4OKEA 4FWLA 3J7ZO 4FYDA 2NRTA 2OZSA 2P9SA 4I2PA 3ATVA 2FC0A 3OYMA 2R7YA 4CW7B 3VTHA 4KH4A 4JI3K 1TYQB 3LP3A 5AQZA 4BE0A 1A5VA 3I33A 4M3RA 2BTFA 4FM2A 4M3UA 1X9JA 5DM6L 1BCOA 3CJ9A 4PUOA 4PL8A 4XEIA 5AQQA 2DFHA 3ULDA 3SV4A 3CM6A 3TTDA 1E4FT 1HPMA 1JLFA 4PL7A 1HJRA 2W42A 2O4GA 5C2DA 3CIPA 4C1NK 3VQEA 3LAMA 2QKKA 2HW3A 1I3AA 1BCMA 4LFCK 2UUBK 3K5LA 1HX1A 3HXMA 2ITGA 3VENA 3OYEA 4ELVA 3J7YP 1XHXA 4BRMA 4FJLA 4RW4A 1ASVA 1Q86O 4B8AB 4O4GA 5AZIB 4JI7K 2BUPA 1S5JA 3MCAB 4B9MA 4OPJA 1XNRK 2NRXA 2EWSA 1QSSA 3K57A 4BE1A 5AZIA 4BRCA 3SPYA 5TKYA 2P9LB 3SI6A 2E4LA 4NYNA 3K5MA 1BIZA 5HOOA 2F4VK 3ALYA 1RDCA 3AGKA 3OYAA 1D4XA 3ENOA 4H03B 4KO0A 4BR5A 2E2PA 3IMXA 4BR4A 3SMPA 3NVKA 3QO9A 4ELTA 3H46O 4DSKA 4WFNL 3WNFA 2QKBA 3CXCM 4BRPA 4EZ9A 3RRGA 1X3MA 4CF0A 3AVIA 2O8CB 4M45A 4RW7A 1JL2A 5J2NA 1BUPA 2OA8A 3V9XA 1HKGA 1KVAA 1GLBG 1Z26A 5CY4A 3RSEA 3KK1A 4H8KA 4DKWA 3ZEUA 3F2KA 1XMQK 4MDBA 3LP0A 3SJJA 4FJIA 3D2FB 4RW8A 3ZX2A 4O5FA 4DTJA 4BWMA 1SQKA 4NYFA 1KFSA 3E01A 1ZBHA 3VGMA 2KW4A 3KLHA 3ZLJA 4DTPA 3FZKA 4DTUA 5JVHL 2OYQA 1D9DA 1GOBA 3WXMB 5SZTA 4JI0K 1T3VA 4E7LA 2HBLA 4H5TA 2ZD1A 2P9NA 1LW2A 2HOEA 4BE2A 5LMUK 1J6ZA 2HMIA 4CJVA 1MWKA 1T05A 2ZF5O 3BGRA 4JKBA 4KPYA 4JK9A 1IKXA 2I7NA 4JKCA 4FVMA 3OYFA 4KH5A 2D0AA 4ICLA 4WCEL 4WYBA 2BE2A 1GLEG 3D2EA 1BWFO 3FR0A 2P9IB 4LC9B 5M1FA 3ZETB 1NNEA 2V51B 3NGZA 1QQMA 4JKFA 4AM6A 1DEJA 5KTQA 4DR5K 3KWIA 4MQ3A 4B3RK 4Z4FA 4B9SA 3MN7A 4IWVA 4CJUA 5JVGL 3HVRA 1NK9A 1XI1A 3I8DA 3KHYA 1X9WA 4CJKA 4FPBA 2KZZA 5F0XA 4DSJA 4OVLA 4FSVA 1QSYA 4CZGA 4JI6K 4CECA 3CHWA 5F2RA 4ZTFA 3DLRA 4JLHA 4NXMK 5KRTA 4BG8A 2Q97A 2YNFA 1YTAA 3T69A 2QXFA 4JHDB 3LP2A 4ZHRA 1Q82O 3J8AA 3D6RA 1T8EA 3WUHA 4O44A 4FOEA 5C10A 4YY3K 1U2VA 3ZT4A 1NG9A 4CF1A 4FJ9A 4B1YB 2Q0UA 2RHKA 4IO9L 4KB0A 3AA4A 1EQYA 4CJPA 4BRAA 3O08A 1VQKN 5AQLA 1KQSM 1U45A 1MWMA 3LDPA 5KPRA 5C15A 3CG7A 2W40A 5C2FA 5B8HA 1S72N 3UKRA 3EEQA 4CI6A 3R8EA 3HBTA 2A1SA 4CGDA 2P9PB 4FPAA 4CZIA 3HPOA 1DKGD 3T1AA 1XHZA 3D7EO 3CI5A 4EAHD 4BGAA 4CFBA 2Z1HA 3QB0A 3BF3A 2A40A 1YF5L 4DTXA 2IVOA 3RWUA 1RTIA 3TTCA 1QE1A 2YJEA 3VMFB 4CF8A 1IKVA 1V4SA 5TKWA 5E26A 2P5GA 4M3XA 4JYAK 2AJQA 3MX5A 1SKWA 1SL2A 3CMAN 5AQOA 3J81O 4BRGA 3GG4A 2F96A 4DFKA 1XC9A 4XH4A 4KAZA 3NAEA 3K2PA 4JNEA 4JKAA 4DTMA 1ZBUA 2D5RA 5BRDA 2XY7A 4FJ8A 1LOTB 3UKUA 3VOVA 3V9SA 4Q5VA 3A2FA 3A5LC 3MWPA 3MMVA 1FW6A 3DRPA 1SS6A 4CERA 4BRIA 2P9IA 1VSIA 3DLEA 4H4MA 1QHTA 1U47A 3P5JA 4CHNA 3PV8A 3ATUA 4CIFA 3NF8A 3FGUA 5HROA 3EYZA 3IG1A 2HF3A 3OYGA 2AA4A 3HRGA 5JS2A 3MDQA 2O8FA 2P9UB 5E84A 4CFDA 3U9ZA 1HUXA 1NGFA 1SKSA 4YOYA 4CJFA 4J2DA 4B08A 2HVIA 3ZT3A 4JK8A 4K43A 3KKRA 2ZWHA 1NGEA 3ZSVA 1LWEA 1QQCA 4FWNA 2E6MA 5KQDA 4XIUA 5HLFA 3HSCA 3WXKA 3AGRA 3WEEB 5FPDA 2NLXA 2Q31A 3F9KA 1LWCA 4W5OA 1D5AA 4I9QA 4H4OA 4CJWA 4IFEA 4LF5K 1OVYA 5FPMA 4A2AA 3VEOA 3B8AX 2BH1A 3NBPA 3SQ2A 4CD3A 1RDWX 2E88A 4CFCA 3WQUA 3P83D 3QIPA 1N33K 4CEDA 1L5UA 2VWKA 1WSIA 1YJWN 3O9QA 4QAGA 1VQ7N 3K5OA 1GLLO 1C0FA 2V52B 3NE6A 4ZTJA 5AQHA 4CJLA 4C1NI 1ZYQA 2YNHA 1K8KB 1BDGA 3LP1A 2O4IA 2IAJA 3TSQA 1JXBA 1OH6A 2VQEK 1W2BM 2DY4A 1RCHA 1S1XA 5HP1A 1VQ8N 3AVKA 4QCLA 1DTQA 2PAVA 2WUSA 2P9NB 4YHHK 4QS7A 1JCGA 4BR2A 4CBWA 4AH9A 3VERA 1U2VB 3W0LA 4DU1A 1U6ZA 2HNDA 4F2SA 1WN7A 4H0OA 5AQJA 3DXMA 4OPHA 4B9NA 3FZHA 4F3TA 1Z25A 1MA9B 1EO1A 4DTSA 5AQXA 3JSMA 1R59O 3H3OB 3CCLN 3VEYA 4WQ4A 4O8KA 2ZQBA 3V9ZA 3T1YK 2HNZA 4B9QA 1Y64A 4M3WA 3ZCMA 4X62K 3VA3A 2AP1A 3CJCA 3HSTB 2D0CA 4W5NA 4AHTA 1TAUA 5AQKA 3CCRN 3T3FA 4PWDA 4BC5A 4IJAA 1ZBIA 3O1BA 2WONA 4A61A 1KCFA 5AZJB 4Z4CA 1RDUA 4BQLA 5BPLA 3M5RA 5AR0A 4DR3K 3I0RA 3QMLA 3ITHA 5H1SQ 1SV5A 3AO2A 5KI6A 3QERA 3SBTA 1VAZA 3ZX3A 3KD5E 1VSKA 3HZ6A 3ID8A 4IDKA 3MXJA 3G6EN 3PY8A 2HHQA 1XUPO 4NLCA 4BR0A 5J2QA 1JXEA 3OS2A 4QS9A 3OJSA 3LAKA 3OYDA 4A5AA 3CCQN 1W9HA 4O8UA 4CZHA 3J80O 2J4RA 2CGLA 3L2VA 4FZZA 2A3ZA 5FRNA 3IKMA 3E66A 4EHTA 4E0DA 3SJHA 4AQYK 4HTLA 5BR9A 4FWMA 3NF9A 4CZJA 4J2AA 2G8WA 4KHWA 4ISGA 4G1QA 3TTFA 4PHTX 1TKZA 4XH5A 4YDUC 1VSHA 1T7PA 1K8KA 4CGHA 1CLQA 4CEQA 2IGIA 1SZ2A 5AZJA 5LJVA 4ID1A 1TK0A 4CEFA 4JRQA 5E41A 2HHXA 2PBDA 3EN9A 3OBWA 3G4SN 1R0AA 2FSKA 1N6QA 2EX3A 5AQUA 3ZT1A 1IBMK 4DR1K 3VTIA 1NK4A 4LF8K 2FF3B 2LSNA 5JMVA 5I3UA 4FJJA 3BY5A 1ILYA 1REVA 4BDZA 4OO1J 1KTQA 4OKJA 2GWKA 1VQNN 5AQVA 3V6DA 2B4JA 3AO3A 3TAFA 3ASMA 2Z1IA 4DB3A 1C1BA 1W7AA 5JLHA 3ISNC 2JLEA 1RT4A 2QW9A 2FSNA 4FCYA 4DQPA 2HMPA 1SL0A 2UU9K 3WXIA 4FLWA 4E1MA 3U6FA 4BG9A 1IBLK 3VPZA 4IEIA 3VQ9A 2HB5A 3KLFA 3UKRB 5BRFA 3S3OA 2ZJPL 3EE9A 3V9UA 5M1OA 1KAYA 4B9UA 3VGLA 2E8AA 2UXBK 3LANA 3OYNA 1E4GT 1NGCA 3RMDA 3CCEN 3B6PA 1LCUA 4H0VB 4CF9A 4DTOA 1QVGM 3ZSZA 4BRDA 1CXUA 3E1YA 3QFPA 2QWNA 1VQLN 3O3GA 1ZBFA 1NJIO 2XO7A 2E5LK 3A5NC 1P8ZA 3P38A 4FJ5A 4IG0A 4L8RB 1NK6A 3SUQA 4IJNA 3H6EA 2G8IA 3ZSQA 2A6AA 2OPRA 3AVJA 2OTLN 4DQSA 4E7HA 1YJNN 2P1JA 4GKKK 5FROA 1OH5A 2OANA 1TKDA 3PLAA 1P90A 1RDAA 3L2UA 1EXQA 3HTVA 1GLDG 1TAQA 3VF4A 3M8PA 3TI0A 4LD0A 4FXDA 1BISA 2UXDK 1ATRA 1JLQA 4B1XB 4B1UB 4FL9A 2KQ2A 4YOXA 3D0PA 1B9DA 3FFKB 5AQRA 4DV5K 4KHUA 1VSDA 4H5RA 2XY5A 3N4PA 1EP4A 3M8QA 3T7ZA 2VWJA 3QEXA 3CMEN 4FOIA 1B9FA 4H5WA 2IDOA 3EKSA 5DMRA 4BVOA 3PX0A 1N32K 5T7BA 1HNIA 5KRSA 1WSGA 4CGGA 3H3NO 4O0JA 4FWQA 3KD1E 3Q7CA 3CPWM 3ZETA 4CBXA 4KTQA 4ID5A 4CBUA 4YFUA 3TANA 4M7XA 3THXB 4NO7A 4EFHA 3HT3A 2D0PA 2JGUA 3TSPA 4JRPA 3SZ2A 3AVFA 1TL1A 2YHAA 3I0SA 4DV3K 1TKXA 4KI4A 4DFMA 3R6MA 4IZ9A 2GBZA 3VEXA 2KLAA 3L2RA 1D9FA 4WF9L 1RT2A 3WXJA 5FPEA 1RBUA 4KHNA 2G8HA 4WQ5C 4DQQA 3DLLL 4DV6K 1NK7A 2VGMA 3V1OA 3M1FA 4M3YA 4B3OA 1JLCA 2VWBA 4GV9A 4BWJA 3KIOA 2KZMA 1RT3A 2O8BB 4Z0UA 3LL3A 1J5OA 4LH4A 2PZSA 3TPQA 4N5SA 3EY1A 1Q7YO 3O3HA 1BU6O 5EXWA 1HYSA 4CGJA 4E7IA 1WOQA 2A41A 2G8KA 1HNXK 5J2MA 2QXLA 5ELZA 1XQSC 1J54A 2QK9A 3C6TA 3OW2M 2P9KB 3BZCA 3CFRA 4FJXA 1VSLA 3KLGA 3DOLA 1NGBA 1RBRA 2HSTA 2YV0X 4HHTA 4DV0K 3OYJA 2F8SA 3HM9A 4E19A 3QEVA 1IKWA 4RG8A 1JL1A 1G15A 2DPNA 1HNZK 3CCUN 4LH5A 1EX4A 4CK1A 4DSEA 3BDPA 3CQYA 1FJGK 4JN4A 4B3SK 1LAWA 2BDPA 1Z6RA 3KJVA 1O13A 3QNNA 1X9SA 1WAJA 2QM1A 3BEXA 2QI2A 3VESA 3JYTA 1TV6A 3VN5A 4DSLA 4OGEA 1RDDA 1YT3A 3SMSA 3PIOL 2E2QA 3V1RA 4YOUA 5AFUH 4CFAA 1SUQA 2YHXA 3NDKA 4MLHA 4M42A 4FLYA 1KVBA 3V1QA 1RBSA 1CZAN 3I56N 1N34K 2RE2A 3VQAA 5AQSA 4E3SA 3LM9A 2D0BA 5JLFA 4CVNE 4LF7K 2KTQA 1SKRA 3BZKA 1D8YA 5J1EA 4JS4A 3DM2A 3TWHA 5CZ1A 2GUPA 4CJQA 3C6HA 4R79A 3C6AA 3CF5L 3D2FA 5BR8K 3CPEA 4C8MA 3NH1A 4JI4K 1U49A 3M6GA 5ADXH 3KTQA 1MDUB 3CQXA 4DS4A 4WFAL 2YNIA 2H3GX 1HJOA 4FLUA 4DV2K 2XY6A 2E1ZA 5FPNA 4IBNA 1HQUA 2YX6A 1WBBA 4EZ6A 4W5QA 1WAFA 2Q36A 1J53A 1WSFA 4CZEA 4HUEA 4MFBA 3SNNA 3LZJA 4H0PA 2RKIA 3SUOA 4JKGB 4IO8A 3PO5A 3P39A 3TAQA 1KC8O 3PX6A 1C1AA 2HHVA 3RTVA 4DCHA 2PYLA 4CCHA 3VQ7A 2P51A 4O0IA 4NCBA 5HRPA 3PX4A 2ATQA 4C8OA 1CZBA 4EIAA 4N41A 4NLBA 3G71N 3ENBA 4H5VA 3D2EB 2BANA 1YJ9N 1S1VA 4CGIA 4IFVA 1BA1A 4DSIA 3SYZA 4HVJA 1VSEA 4M3ZA 4CJ7A 3BP8A 3HP9A 3A5MC 1JLAA 4F8RA 1BGXT 1YI2N 1CZ9A 1BA0A 5GAGP 1HR0K 1RT5A 3CQ8A 2NRVA 4E7KA 1NLVA 3O80A 2B5JA 1NWKA 3CJ7A 4IDHA 3SUPA 3OVNA 1J5EK 4LY7A 1JJ2M 2D1KA 1WSHA 3THWB 1L3UA 2YNGA 4KTWA 1RTHA 1Q18A 5LL6Z 2Z1GA 3VQ6A 1KRPA 3MXIA 1YIJN 1JCEA 2FF6A 4OGCA 4FZXC 5GAHP 3DI6A 5M1KA 4DQ8A 1M1KO 4M63C 1S22A 1BI4A 3K59A 3MAQA 4AF1A 5AQNA 3SQ0A 4PY5A 3AVGA 1GLJO 3O9SA 3UKUB 3MN9A 4WFBL 1DT9A 2DFFA 2FBXA 2RN2A 3E9LA 1S3XA 3C95A 1Z05A 4C8NA 3HO1A 3O9UA 3C6UA 1VRTA 4DMNA 4BR9A 4WQ5A 3AAPA 1TK5A 4DG1A 4KFBA 1OH7A 3QNOA 3CC4N 4DWIA 1N36K 4CEAA 4OX9K 4BACA 5IWAK 3NH0A 4BQZA 2VYPA 1RTDA 4L3QA 4C8LA 3AO4A 5DK5A 3QFUA 1TUYA 1QQOA 1JLEA 1WUAA 1ZBSA 4CHZA 4YOWA 1IV0A 2FBVA 3S3NA 4DF4A 2OPQA 4BC2A 3HOTA 3HM8A 4FWKA 2O8DA 4IEEA 3NHGA 4IKFA 5GINA 4JD2B 4FJNA 2HBJA 1Y97A 3R3LA 4DHYA 3TR8A 3CJ1A 1VQON 3SQ4A 2NZTA 1K8AO 1K9MO 1RGIA 2X74A 4GKJK 4YOTA 4MO5A 4ISEA 4CJ5A 5KPZA 3MXMA 3RR8A 1ZXOA 3JXUA 1S1WA 4KREA 2ZGZA 3L3UA 3O9TA 3MEDA 4FJKA 2P9KA 2A1RA 1VQ5N 4FWOA 2E20A 3DLGA 1FKPA 1HQEA 3AA5X 4RW9A 3G25A 3MEGA 3OS1A 1XWLA 5C42A 4KHPK 2GTDA 4HUFA 1RNHA 2Z1JA 1C0UA 2BGGA 3F5TA 5LJWA 4Z4GA 2HHTA 4H0XB 3TAPA 4MLEA 4FJGA 3PSFA 1O1WA 1VQPN 1HYZA 4BRLA 2DTUA 4GW6A 3F73A 5FRMA 2CH5A 3CJAA 1WBDA 4M41A 4BR7A 4DV7K 1S9GA 4CEBA 3IUCA 2E6LA 2E1YA 1BL3A 1NGDA 2YKNA 3G0ZA 4KB1A 1NK0A 4RCHA 3ENHA 1HNVA 2X6NA 3OA9A 3MN6A 1RT1A 4FM1A 3LALA 4M7YA 4I7FA 4FK2A 1YVUA 1N8RO 1VK0A 4E1JA 3VQPA 1ATNA 4DFPA 2YHBA 1NKBA 5M1NA 4AHCA 3GL1A 5AQYA 4DR7K 4EP4A 1U4BA 1RFQA 1JLGA 4JAXA 1IJJA 1LW0A 3AVHA 1W97L 2KFNA 4U67L 3U4LA 1L3VA 3UB5A 2QWLA 3CC7N 3HP6A 3OYLA 2OZMA 2ASOA 4DTNA 1VQ4N 4Z94A 3FZFA 3H1VX 1X9MA 3E9PA 4I6MB 4CHPA 1NJYA 2YJFA 3QBWA 5BPMA 2NNWA 3E9OA 4DV4K 5AQIA 5C12A 1TK8A 4GV6A 4BDPA 3WEEA 4KRFA 1NU0A 3ZSXA 1TKTA 3L2WA 4YNQA 1UOCA 1HYVA 5HBMA 2OPSA 2Y1JA 3L6QA 2KFZA 2F8TA 4DU3A 2ASPA 2X6SA 3QIOA 3DAWA 3RR7A 1NKCA 3QEPA 4CD1A 2FLOA 3TAEA 2FBYA 5EY4A 3BF1A 4Z4EA 2KKZA 3MECA 3IDHA 3IFRA 1X1PA 5ADXA 3QEIA 4FJHA 3NGYA 3EO3A 4CEOA 4FLVA 4F4KA 4CZMA 2IOCA 1NM1A 3ULEA 3AO5A 1TL3A 2G8VA 1CXQA 4KHSA 4FO0A 3VF6A 3N4QA 4U7BA 2HF4A 3SAFA 3AA2A 2P9UA 4CHOA 4C23A 3AVBA 1VQ9N 4F9OA 3DJCA 1QS4A 3SAHA 3L8BA 4K42A 4DFJA 4H5NA 2QWMA 4DF8A 3S3MA 5HL7L 2UUCK 4DUYK 4CESA 3OYBA 4LF4K 1WNSA 3MWTA 3HI0A 4JI2K 4WQ4C 3WNHA 4B1VA 3CCMN 3O5BA 3C0BA 2OCEA 3T19A 4GV3A 3CM5A 4F3OA 3KLEA 2Y1IA 2NRWA 3PIPL 5CYMA 1JCFA 4CHQA 4B9TA 3AY9A 4AHVA 1NJWA 3EZ5A 4FLTA 5C25A 5AJ3K 4BRFA 4X66K 4K41A 4IG3A 3SAGA 3KWGA 1K73O 2IC3A 5MLCQ 1I94K 1XC3A 2Q0RA 2W6LA 2GUIA 4BRHA 4LFAK 4G9ZA 4GMJB 3FLCO 2QWOA 1Q8IA 3O4QA 2RF2A 5K14A 1ZC6A 4NXNK 2E2NA 3AAQA 4BC3A 4LSNA 5KQ8A 3ZSRA 4RTFD 3T1HK 2UUAK
chains in the Genus database with same CATH topology
3RMBA 1RT6A 4CIFA 3NF8A 4DSLA 5HROA 4OGEA 1RDDA 3IG1A 3KLIA 3ZT0A 3O3FA 1YT3A 4CEEA 3EYZA 2VG5A 4DLGA 3OYGA 4CJSA 3OY9A 3DYAA 3AVNA 5JS2A 3V1RA 2HNYA 1KVCA 1WLJA 4FW2A 3SCXA 4CFAA 1SUQA 3UIQA 3DLKA 3NDKA 4CFDA 4W5RA 1DLOA 3LPTA 1SKSA 4M42A 4CJFA 4FLYA 4J2DA 1KVBA 2I5JA 3V1QA 1RBSA 3NF6A 4FJ7A 4B08A 3VQAA 2HVIA 4E3SA 4OPKA 3WNEA 3U3YA 3VQ8A 3ZT3A 4KKOA 2D0BA 4CEZA 5KGXA 2P5OA 2KTQA 1SKRA 1FK9A 3V81A 1D8YA 3KKRA 5J1EA 4AHRA 5D3GA 3ZSVA 4PA1A 1LWEA 3OS0A 2XY8A 1LV5A 4UQGA 4FLXA 1QQCA 1ASUA 2E6MA 4E7JA 1WSJA 4XIUA 5HLFA 4JS4A 3THVA 3CFOA 3DM2A 3TWHA 5CZ1A 4HTUA 2Q3SA 3ZSYA 4CJQA 3DRSA 2PYJA 1RILA 4CIEA 2B6AA 4CJ3A 3QINA 4C8MA 3NH1A 4AHUA 3F9KA 4I2QA 3KK2A 4R5PA 1LWCA 4W5OA 1C6VA 1D5AA 1U49A 4H4OA 4I9QA 4QOZB 1A5WA 4CJWA 3KTQA 4Q0BA 1BQMA 4K8ZA 3G10A 4C8KA 5KGWA 4DS4A 3CYMA 2YNIA 2ETJA 3AVMA 3RMCA 4Z4IA 4FLUA 4Y1CA 3NBPA 2XY6A 3SQ2A 4NCGA 4DTRA 4IBNA 4CFCA 1HQUA 1BHLA 1IKYA 3P83D 3QIPA 3NGIA 4W5QA 1WAFA 4EZ6A 1J53A 1WSFA 3HYFA 4CEDA 4HUEA 4MFBA 3SNNA 3LZJA 1L5UA 3VQ4A 1VRUA 2RKIA 2VWKA 2WOMA 4CIGA 1WSIA 4RW6A 3SUOA 5C24A 3SUNA 4FLZA 4QAGA 3DRRA 3K5OA 1EKEA 4B9VA 4FZYA 3TARA 3PO5A 4WE1A 4B9LA 3TAQA 3NE6A 4F2RA 4CJTA 4ZTJA 3PX6A 1C1AA 4CK3A 1IG9A 1TVRA 2EHGA 3ZT2A 4CJLA 2YNHA 1ZYQA 4DLEA 3PO4A 3RTVA 2PYLA 4CCHA 3LP1A 2O4IA 4E1NA 3IRXA 3VQ7A 2IAJA 2P51A 1JXBA 4O0IA 4NCBA 4DU4A 5HRPA 4PQUA 3NH2A 1C1CA 2ATQA 3AVAA 4B8CA 3PX4A 4C8OA 1CZBA 4KTZA 4AILC 4N41A 3DOKA 1KSPA 4HCBA 2DY4A 1RCHA 2BANA 1S1VA 1S1XA 4IFVA 4CGIA 5HP1A 4DSIA 3SYZA 3O4NA 4HVJA 3AVKA 2HHVA 3V4IA 4QCLA 1J9AA 1VSEA 4EP5A 4M3ZA 1DTQA 3IS9A 1RTJA 1YTUA 1W0HA 1KFDA 1DTTA 3HP9A 2HVHA 2FBTA 1JLAA 4F8RA 1RBVA 5HRNA 1ZBLA 4NCAA 1BGXT 4AH9A 1LWFA 1CZ9A 3LDSA 4DU1A 3V9WA 2HNDA 2YKMA 4CE9A 3SQ1A 1WN7A 1RT5A 3CQ8A 4F2SA 4CF2A 3QESA 4E7KA 4B9NA 3QETA 1HPZA 2B5JA 4CJEA 4F3TA 4N76A 1C0MA 2G8UA 3SUPA 3OVNA 1Z25A 4CJRA 3DMJA 5EU7A 4OKEA 1GOAA 3HPGA 4DTSA 4LY7A 3ZSWA 3OYIA 1WSHA 3JSMA 1L3UA 2YNGA 4FYDA 3HVTA 3TAMA 4KTWA 1RTHA 2OZSA 1JLBA 4I2PA 2FC0A 3VA0A 2ZQBA 3OYMA 1NJXA 2R7YA 4LSLA 3V9ZA 4K8XA 2Z1GA 2HNZA 3LP3A 3VQ6A 4JS5A 3MXIA 1KRPA 4BE0A 1A5VA 2RPIA 4M3WA 1JKHA 4OGCA 3ZCMA 1NOYA 4FZXC 4M3RA 3DI6A 4FM2A 3RRHA 1NK8A 3VA3A 4M3UA 2IS3A 1BI4A 3K59A 1BCOA 4PUOA 3HSTB 3MAQA 2D0CA 2DFHA 3AA3A 4AHTA 4HCCA 3ULDA 4W5NA 3SV4A 3CM6A 3VQCA 3VQDA 4BDYA 3T3FA 3SQ0A 5I42A 4PWDA 1TAUA 4PY5A 4DQRA 3AVGA 1ZBIA 4DQIA 1B92A 3OYCA 2WONA 1JLFA 3TABA 3VQ5A 1HJRA 1KCFA 3LPUA 2O4GA 2W42A 2DFFA 2FBXA 4Z4CA 3HJFA 1IH7A 2RN2A 3HPHA 4Z4HA 3VQEA 3LAMA 2QKKA 3C95A 3I0RA 2HW3A 1I3AA 1BCMA 4C8NA 3NCIA 4N56A 3ITHA 1SV5A 3K5LA 3HO1A 3HXMA 2ITGA 3AO2A 5KI6A 4O55A 3QERA 3C6UA 1VRTA 4DMNA 1UA0A 3OYEA 3KD5E 1VSKA 1TK5A 4DG1A 4KFBA 1XHXA 3LWLA 4ELVA 4IDKA 3MXJA 3PY8A 4FJLA 4RW4A 3QNOA 2HHQA 5J2QA 1JXEA 1ASVA 4DWIA 3OS2A 1TGOA 1I39A 4B8AB 3VQQA 4CEAA 3OJSA 3LAKA 4BACA 3OYDA 3NH0A 3AV9A 4O4GA 1RTDA 1W9HA 4C8LA 3QLHA 3AO4A 5DK5A 4AHSA 3M8RA 3L2VA 2XRIA 1S1UA 1S5JA 4B9MA 4FZZA 4OPJA 1JLEA 5FRNA 4E0DA 1VSFA 4CHZA 1HRHA 3SPZA 1QSSA 3KKSA 3K57A 2FBVA 4BE1A 3SPYA 4DF4A 2OPQA 3NF9A 3S3NA 3HL8A 4OJRA 2XHBA 1N5YA 2G8WA 4J2AA 4KHWA 3SI6A 4G1QA 2E4LA 3NHGA 4NYNA 4IKFA 3K5MA 3P1GA 1BIZA 1TKZA 5JS1A 3ALYA 1VSHA 1RDCA 1T7PA 4CGHA 1CLQA 4CEQA 2IGIA 4W5TA 4FJNA 2VG7A 3OYAA 4ID1A 1TK0A 4CEFA 4IFYA 3M8SA 4JRQA 1Y97A 4KO0A 5E41A 1S1TA 1S6PA 2ZE2A 3HK2A 2HHXA 3QO9A 3TR8A 4ELTA 3SQ4A 4DSKA 3WNFA 1R0AA 4ELUA 4OLBA 1N6QA 2X74A 1UAXA 2QKBA 4FK0A 2EX3A 4EZ9A 3RRGA 3ZT1A 4CJ5A 3MXMA 3RR8A 2G8FA 1S1WA 4CF0A 3AVIA 1NK4A 4KREA 2LSNA 4M45A 4RW7A 5HRRA 1JL2A 5I3UA 4FJJA 1NOZA 3L3UA 3LZIA 1KLNA 2PY5A 1REVA 4BDZA 5J2NA 3MEEA 2OA8A 1KTQA 3MEDA 4OKJA 3V9XA 4FJKA 1KVAA 2A1RA 1Z26A 5CY4A 3KK1A 3DLGA 3V6DA 1RBTA 2B4JA 1FKPA 1HQEA 3AA5X 4RW9A 3PV8A 3AO3A 1L3SA 3MEGA 3OS1A 4H8KA 3PUFA 1XWLA 5C42A 4FJIA 3LP0A 3SJJA 4HUFA 1RNHA 2Z1JA 3ASMA 1C0UA 2Z1IA 4RW8A 3TAFA 2BGGA 4DTJA 1C1BA 4BWMA 3OYHA 4NYFA 3ISNC 4Z4GA 2HHTA 1KFSA 3E01A 4CJ4A 4OKKA 2JLEA 4KV8A 4OLAA 1RT4A 1ZBHA 3TAPA 4FCYA 4FJGA 1O1WA 2KW4A 2NUBA 3KLHA 4DQPA 1SL0A 5CZ2A 4DTPA 4FLWA 1HYZA 3AVCA 4E1MA 5SWMA 4DTUA 3U6FA 4GW6A 3F73A 1D9DA 2OYQA 5FRMA 2DTUA 4M41A 1S9GA 4CEBA 1GOBA 5SZTA 3VQ9A 3SV3A 2HB5A 4E7LA 3KLFA 3KK3A 2ZD1A 3S3OA 2E6LA 1EETA 3NFAA 2HHWA 1BL3A 1KLMA 3V9UA 1NKEA 1LW2A 2YKNA 4B9UA 4BE2A 4KHQA 3G0ZA 4KB1A 1NK0A 3LANA 3OYNA 1S9EA 2HMIA 4M3TA 1FKOA 4GVMA 1HNVA 2X6NA 4CJVA 1T05A 3RMDA 1RT1A 4FM1A 3B6PA 3BGRA 4KPYA 3LALA 4CF9A 4FK2A 4I7FA 4DTOA 1FXXA 3S9HA 3ZSZA 1IKXA 1YVUA 1CXUA 1VK0A 4DFPA 4FVMA 3VQPA 2YHBA 4FW1A 3OYFA 4HUGA 1NKBA 3O3GA 3C94A 4DSFA 4AHCA 1ZBFA 2D0AA 4ICLA 4N47A 1L3TA 3LWMA 2BE2A 3U3GA 4EP4A 2XO7A 1U4BA 4Y1DA 1JLGA 4FJ5A 4IG0A 4L8RB 3NGZA 3SUQA 1NK6A 1LW0A 2G8IA 3ZSQA 3AVHA 2OPRA 3AVJA 2KFNA 1RDBA 2OPPA 5KTQA 4DQSA 1L3VA 4MQ3A 4E7HA 4Z4FA 4B9SA 3HP6A 5J2PA 2P1JA 1BI4B 3OYLA 5FROA 2OZMA 1TKDA 3ZSOA 4DTNA 4CJUA 3B6OA 2VG6A 3HVRA 1RDAA 1NK9A 1U48A 4O5BA 3L2UA 1XI1A 3I8DA 1X9MA 1X9WA 4CJKA 4CHPA 1NJYA 2KZZA 1EXQA 4DSJA 4OVLA 1TAQA 3M8PA 1QSYA 3TI0A 2HHUA 4LD0A 4CECA 1BISA 4FXDA 1JLQA 3DLRA 3L2QA 4ZTFA 3K58A 4JLHA 3K5NA 2KQ2A 3AVLA 4CK2A 1TK8A 3D0PA 1B9DA 5KRTA 3IAYA 4KHUA 2GV9A 1VSDA 1GOCA 1A5XA 1LAVA 2XY5A 4BDPA 4CGFA 1EP4A 1WSEA 3M8QA 2VWJA 3QEXA 1VSJA 1U04A 4KRFA 1B9FA 3ZSXA 1TKTA 2YNFA 1YTAA 2IDOA 5DMRA 3L2WA 3QEWA 2QXFA 3PX0A 5HRSA 4YNQA 5T7BA 1HNIA 5KRSA 1UOCA 3LP2A 1WSGA 1HYVA 5HBMA 4CGGA 4ZHRA 4O0JA 4CHYA 1IO2A 1HMVA 2OPSA 2Y1JA 1NK5A 1T8EA 4E89A 3KD1E 2KFZA 4O44A 4DU3A 2F8TA 2X6SA 3QIOA 4KTQA 3ZT4A 3RR7A 4ID5A 1MU2A 4CF1A 1NKCA 4FJ9A 4YFUA 3TANA 5FDLA 1NJZA 3QEPA 3RMAA 1ASWA 2X78A 3HT3A 2FBYA 3TAEA 4KB0A 4FK4A 3AA4A 2JGUA 4Z4EA 3SZ2A 4JRPA 3MECA 3AVFA 3QEIA 1X1PA 4FJHA 1TL1A 2YHAA 1SL1A 3I0SA 3NGYA 4CJPA 1TKXA 4KI4A 4FLVA 1VSMA 4CEOA 4DFMA 1Q9XA 3DLHA 1U45A 4F4KA 2IOCA 3CG7A 3AO5A 1TL3A 1T03A 2GBZA 1CXQA 3L2RA 1D9FA 2G8VA 4KHSA 1RT2A 4KI6A 4FJMA 1BIUA 1RBUA 3AA2A 4CHOA 4KHNA 2G8HA 4DQQA 3AVBA 3L8BA 1QS4A 2A1SA 4CGDA 3HPOA 4DFJA 1NK7A 3V1OA 4B3OA 4M3YA 1JLCA 3T1AA 4BWJA 3OYKA 1XHZA 4DF8A 3KIOA 3AO1A 2KZMA 3S3MA 1RT3A 1S6QA 4Z0UA 1J5OA 4LH4A 2PZSA 4CESA 4CFBA 4N5SA 3OYBA 3EY1A 3O3HA 1ITGA 1RT7A 1BQNA 2Z1HA 1WNSA 1HYSA 4DTXA 3DLBA 4CGJA 4E7IA 2G8KA 3RWUA 4KHYA 1RTIA 3WNHA 3CFPA 1C0TA 1QE1A 5J2MA 4TSXA 1UWBA 3D45A 3T19A 1QTMA 3VQBA 4CF8A 1IKVA 3NF7A 3CM5A 4F3OA 3KLEA 4J2EA 1J54A 2Y1IA 2QK9A 3C6TA 3TAGA 1QSLA 2P5GA 5CYMA 4M3XA 1K6YA 3CFRA 1VSLA 3KLGA 3DOLA 4FJXA 2AJQA 1SKWA 1RBRA 4CHQA 4B9TA 1SL2A 4AHVA 2YV0X 1NJWA 4HHTA 3EZ5A 4FLTA 4I9LA 5C25A 3OYJA 2F96A 1Q9YA 4DFKA 1UA1A 2F8SA 1XC9A 3HM9A 4KAZA 3NAEA 4E19A 4IG3A 3QEVA 3K2PA 1IKWA 3H08A 4RG8A 1JL1A 3WNGA 1G15A 4DTMA 1ZBUA 2D5RA 2DFEA 1F21A 2IC3A 2XY7A 4LH5A 4FJ8A 1EX4A 3V9SA 4Q5VA 4CK1A 3A2FA 2GUIA 3DRPA 4DSEA 3BDPA 4CERA 4J2BA 3L3VA 5CYQA 4GMJB 1VSIA 1LAWA 2BDPA 4FM0A 1Q8IA 3O4QA 2RF2A 5K14A 3KJVA 3DLEA 3QNNA 1WAJA 4H4MA 1X9SA 1QHTA 2HHSA 4LSNA 1U47A 3JYTA 3P5JA 3FFIA 3ZSRA 3OJUA 4CHNA 1TV6A 3VN5A 4DS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMB A;  1RT6 A;  4CIF A;  3NF8 A;  4DSL A;  5HRO A;  4OGE A;  1RDD A;  3IG1 A;  3KLI A;  3ZT0 A;  3O3F A;  1YT3 A;  4CEE A;  3EYZ A;  2VG5 A;  4DLG A;  3OYG A;  4CJS A;  3OY9 A;  3DYA A;  3AVN A;  5JS2 A;  3V1R A;  2HNY A;  1KVC A;  1WLJ A;  4FW2 A;  3SCX A;  4CFA A;  1SUQ A;  3UIQ A;  3DLK A;  3NDK A;  4CFD A;  4W5R A;  1DLO A;  3LPT A;  1SKS A;  4M42 A;  4CJF A;  4FLY A;  4J2D A;  1KVB A;  2I5J A;  3V1Q A;  1RBS A;  3NF6 A;  4FJ7 A;  4B08 A;  3VQA A;  2HVI A;  4E3S A;  4OPK A;  3WNE A;  3U3Y A;  3VQ8 A;  3ZT3 A;  4KKO A;  2D0B A;  4CEZ A;  5KGX A;  2P5O A;  2KTQ A;  1SKR A;  1FK9 A;  3V81 A;  1D8Y A;  3KKR A;  5J1E A;  4AHR A;  5D3G A;  3ZSV A;  4PA1 A;  1LWE A;  3OS0 A;  2XY8 A;  1LV5 A;  4UQG A;  4FLX A;  1QQC A;  1ASU A;  2E6M A;  4E7J A;  1WSJ A;  4XIU A;  5HLF A;  4JS4 A;  3THV A;  3CFO A;  3DM2 A;  3TWH A;  5CZ1 A;  4HTU A;  2Q3S A;  3ZSY A;  4CJQ A;  3DRS A;  2PYJ A;  1RIL A;  4CIE A;  2B6A A;  4CJ3 A;  3QIN A;  4C8M A;  3NH1 A;  4AHU A;  3F9K A;  4I2Q A;  3KK2 A;  4R5P A;  1LWC A;  4W5O A;  1C6V A;  1D5A A;  1U49 A;  4H4O A;  4I9Q A;  4QOZ B;  1A5W A;  4CJW A;  3KTQ A;  4Q0B A;  1BQM A;  4K8Z A;  3G10 A;  4C8K A;  5KGW A;  4DS4 A;  3CYM A;  2YNI A;  2ETJ A;  3AVM A;  3RMC A;  4Z4I A;  4FLU A;  4Y1C A;  3NBP A;  2XY6 A;  3SQ2 A;  4NCG A;  4DTR A;  4IBN A;  4CFC A;  1HQU A;  1BHL A;  1IKY A;  3P83 D;  3QIP A;  3NGI A;  4W5Q A;  1WAF A;  4EZ6 A;  1J53 A;  1WSF A;  3HYF A;  4CED A;  4HUE A;  4MFB A;  3SNN A;  3LZJ A;  1L5U A;  3VQ4 A;  1VRU A;  2RKI A;  2VWK A;  2WOM A;  4CIG A;  1WSI A;  4RW6 A;  3SUO A;  5C24 A;  3SUN A;  4FLZ A;  4QAG A;  3DRR A;  3K5O A;  1EKE A;  4B9V A;  4FZY A;  3TAR A;  3PO5 A;  4WE1 A;  4B9L A;  3TAQ A;  3NE6 A;  4F2R A;  4CJT A;  4ZTJ A;  3PX6 A;  1C1A A;  4CK3 A;  1IG9 A;  1TVR A;  2EHG A;  3ZT2 A;  4CJL A;  2YNH A;  1ZYQ A;  4DLE A;  3PO4 A;  3RTV A;  2PYL A;  4CCH A;  3LP1 A;  2O4I A;  4E1N A;  3IRX A;  3VQ7 A;  2IAJ A;  2P51 A;  1JXB A;  4O0I A;  4NCB A;  4DU4 A;  5HRP A;  4PQU A;  3NH2 A;  1C1C A;  2ATQ A;  3AVA A;  4B8C A;  3PX4 A;  4C8O A;  1CZB A;  4KTZ A;  4AIL C;  4N41 A;  3DOK A;  1KSP A;  4HCB A;  2DY4 A;  1RCH A;  2BAN A;  1S1V A;  1S1X A;  4IFV A;  4CGI A;  5HP1 A;  4DSI A;  3SYZ A;  3O4N A;  4HVJ A;  3AVK A;  2HHV A;  3V4I A;  4QCL A;  1J9A A;  1VSE A;  4EP5 A;  4M3Z A;  1DTQ A;  3IS9 A;  1RTJ A;  1YTU A;  1W0H A;  1KFD A;  1DTT A;  3HP9 A;  2HVH A;  2FBT A;  1JLA A;  4F8R A;  1RBV A;  5HRN A;  1ZBL A;  4NCA A;  1BGX T;  4AH9 A;  1LWF A;  1CZ9 A;  3LDS A;  4DU1 A;  3V9W A;  2HND A;  2YKM A;  4CE9 A;  3SQ1 A;  1WN7 A;  1RT5 A;  3CQ8 A;  4F2S A;  4CF2 A;  3QES A;  4E7K A;  4B9N A;  3QET A;  1HPZ A;  2B5J A;  4CJE A;  4F3T A;  4N76 A;  1C0M A;  2G8U A;  3SUP A;  3OVN A;  1Z25 A;  4CJR A;  3DMJ A;  5EU7 A;  4OKE A;  1GOA A;  3HPG A;  4DTS A;  4LY7 A;  3ZSW A;  3OYI A;  1WSH A;  3JSM A;  1L3U A;  2YNG A;  4FYD A;  3HVT A;  3TAM A;  4KTW A;  1RTH A;  2OZS A;  1JLB A;  4I2P A;  2FC0 A;  3VA0 A;  2ZQB A;  3OYM A;  1NJX A;  2R7Y A;  4LSL A;  3V9Z A;  4K8X A;  2Z1G A;  2HNZ A;  3LP3 A;  3VQ6 A;  4JS5 A;  3MXI A;  1KRP A;  4BE0 A;  1A5V A;  2RPI A;  4M3W A;  1JKH A;  4OGC A;  3ZCM A;  1NOY A;  4FZX C;  4M3R A;  3DI6 A;  4FM2 A;  3RRH A;  1NK8 A;  3VA3 A;  4M3U A;  2IS3 A;  1BI4 A;  3K59 A;  1BCO A;  4PUO A;  3HST B;  3MAQ A;  2D0C A;  2DFH A;  3AA3 A;  4AHT A;  4HCC A;  3ULD A;  4W5N A;  3SV4 A;  3CM6 A;  3VQC A;  3VQD A;  4BDY A;  3T3F A;  3SQ0 A;  5I42 A;  4PWD A;  1TAU A;  4PY5 A;  4DQR A;  3AVG A;  1ZBI A;  4DQI A;  1B92 A;  3OYC A;  2WON A;  1JLF A;  3TAB A;  3VQ5 A;  1HJR A;  1KCF A;  3LPU A;  2O4G A;  2W42 A;  2DFF A;  2FBX A;  4Z4C A;  3HJF A;  1IH7 A;  2RN2 A;  3HPH A;  4Z4H A;  3VQE A;  3LAM A;  2QKK A;  3C95 A;  3I0R A;  2HW3 A;  1I3A A;  1BCM A;  4C8N A;  3NCI A;  4N56 A;  3ITH A;  1SV5 A;  3K5L A;  3HO1 A;  3HXM A;  2ITG A;  3AO2 A;  5KI6 A;  4O55 A;  3QER A;  3C6U A;  1VRT A;  4DMN A;  1UA0 A;  3OYE A;  3KD5 E;  1VSK A;  1TK5 A;  4DG1 A;  4KFB A;  1XHX A;  3LWL A;  4ELV A;  4IDK A;  3MXJ A;  3PY8 A;  4FJL A;  4RW4 A;  3QNO A;  2HHQ A;  5J2Q A;  1JXE A;  1ASV A;  4DWI A;  3OS2 A;  1TGO A;  1I39 A;  4B8A B;  3VQQ A;  4CEA A;  3OJS A;  3LAK A;  4BAC A;  3OYD A;  3NH0 A;  3AV9 A;  4O4G A;  1RTD A;  1W9H A;  4C8L A;  3QLH A;  3AO4 A;  5DK5 A;  4AHS A;  3M8R A;  3L2V A;  2XRI A;  1S1U A;  1S5J A;  4B9M A;  4FZZ A;  4OPJ A;  1JLE A;  5FRN A;  4E0D A;  1VSF A;  4CHZ A;  1HRH A;  3SPZ A;  1QSS A;  3KKS A;  3K57 A;  2FBV A;  4BE1 A;  3SPY A;  4DF4 A;  2OPQ A;  3NF9 A;  3S3N A;  3HL8 A;  4OJR A;  2XHB A;  1N5Y A;  2G8W A;  4J2A A;  4KHW A;  3SI6 A;  4G1Q A;  2E4L A;  3NHG A;  4NYN A;  4IKF A;  3K5M A;  3P1G A;  1BIZ A;  1TKZ A;  5JS1 A;  3ALY A;  1VSH A;  1RDC A;  1T7P A;  4CGH A;  1CLQ A;  4CEQ A;  2IGI A;  4W5T A;  4FJN A;  2VG7 A;  3OYA A;  4ID1 A;  1TK0 A;  4CEF A;  4IFY A;  3M8S A;  4JRQ A;  1Y97 A;  4KO0 A;  5E41 A;  1S1T A;  1S6P A;  2ZE2 A;  3HK2 A;  2HHX A;  3QO9 A;  3TR8 A;  4ELT A;  3SQ4 A;  4DSK A;  3WNF A;  1R0A A;  4ELU A;  4OLB A;  1N6Q A;  2X74 A;  1UAX A;  2QKB A;  4FK0 A;  2EX3 A;  4EZ9 A;  3RRG A;  3ZT1 A;  4CJ5 A;  3MXM A;  3RR8 A;  2G8F A;  1S1W A;  4CF0 A;  3AVI A;  1NK4 A;  4KRE A;  2LSN A;  4M45 A;  4RW7 A;  5HRR A;  1JL2 A;  5I3U A;  4FJJ A;  1NOZ A;  3L3U A;  3LZI A;  1KLN A;  2PY5 A;  1REV A;  4BDZ A;  5J2N A;  3MEE A;  2OA8 A;  1KTQ A;  3MED A;  4OKJ A;  3V9X A;  4FJK A;  1KVA A;  2A1R A;  1Z26 A;  5CY4 A;  3KK1 A;  3DLG A;  3V6D A;  1RBT A;  2B4J A;  1FKP A;  1HQE A;  3AA5 X;  4RW9 A;  3PV8 A;  3AO3 A;  1L3S A;  3MEG A;  3OS1 A;  4H8K A;  3PUF A;  1XWL A;  5C42 A;  4FJI A;  3LP0 A;  3SJJ A;  4HUF A;  1RNH A;  2Z1J A;  3ASM A;  1C0U A;  2Z1I A;  4RW8 A;  3TAF A;  2BGG A;  4DTJ A;  1C1B A;  4BWM A;  3OYH A;  4NYF A;  3ISN C;  4Z4G A;  2HHT A;  1KFS A;  3E01 A;  4CJ4 A;  4OKK A;  2JLE A;  4KV8 A;  4OLA A;  1RT4 A;  1ZBH A;  3TAP A;  4FCY A;  4FJG A;  1O1W A;  2KW4 A;  2NUB A;  3KLH A;  4DQP A;  1SL0 A;  5CZ2 A;  4DTP A;  4FLW A;  1HYZ A;  3AVC A;  4E1M A;  5SWM A;  4DTU A;  3U6F A;  4GW6 A;  3F73 A;  1D9D A;  2OYQ A;  5FRM A;  2DTU A;  4M41 A;  1S9G A;  4CEB A;  1GOB A;  5SZT A;  3VQ9 A;  3SV3 A;  2HB5 A;  4E7L A;  3KLF A;  3KK3 A;  2ZD1 A;  3S3O A;  2E6L A;  1EET A;  3NFA A;  2HHW A;  1BL3 A;  1KLM A;  3V9U A;  1NKE A;  1LW2 A;  2YKN A;  4B9U A;  4BE2 A;  4KHQ A;  3G0Z A;  4KB1 A;  1NK0 A;  3LAN A;  3OYN A;  1S9E A;  2HMI A;  4M3T A;  1FKO A;  4GVM A;  1HNV A;  2X6N A;  4CJV A;  1T05 A;  3RMD A;  1RT1 A;  4FM1 A;  3B6P A;  3BGR A;  4KPY A;  3LAL A;  4CF9 A;  4FK2 A;  4I7F A;  4DTO A;  1FXX A;  3S9H A;  3ZSZ A;  1IKX A;  1YVU A;  1CXU A;  1VK0 A;  4DFP A;  4FVM A;  3VQP A;  2YHB A;  4FW1 A;  3OYF A;  4HUG A;  1NKB A;  3O3G A;  3C94 A;  4DSF A;  4AHC A;  1ZBF A;  2D0A A;  4ICL A;  4N47 A;  1L3T A;  3LWM A;  2BE2 A;  3U3G A;  4EP4 A;  2XO7 A;  1U4B A;  4Y1D A;  1JLG A;  4FJ5 A;  4IG0 A;  4L8R B;  3NGZ A;  3SUQ A;  1NK6 A;  1LW0 A;  2G8I A;  3ZSQ A;  3AVH A;  2OPR A;  3AVJ A;  2KFN A;  1RDB A;  2OPP A;  5KTQ A;  4DQS A;  1L3V A;  4MQ3 A;  4E7H A;  4Z4F A;  4B9S A;  3HP6 A;  5J2P A;  2P1J A;  1BI4 B;  3OYL A;  5FRO A;  2OZM A;  1TKD A;  3ZSO A;  4DTN A;  4CJU A;  3B6O A;  2VG6 A;  3HVR A;  1RDA A;  1NK9 A;  1U48 A;  4O5B A;  3L2U A;  1XI1 A;  3I8D A;  1X9M A;  1X9W A;  4CJK A;  4CHP A;  1NJY A;  2KZZ A;  1EXQ A;  4DSJ A;  4OVL A;  1TAQ A;  3M8P A;  1QSY A;  3TI0 A;  2HHU A;  4LD0 A;  4CEC A;  1BIS A;  4FXD A;  1JLQ A;  3DLR A;  3L2Q A;  4ZTF A;  3K58 A;  4JLH A;  3K5N A;  2KQ2 A;  3AVL A;  4CK2 A;  1TK8 A;  3D0P A;  1B9D A;  5KRT A;  3IAY A;  4KHU A;  2GV9 A;  1VSD A;  1GOC A;  1A5X A;  1LAV A;  2XY5 A;  4BDP A;  4CGF A;  1EP4 A;  1WSE A;  3M8Q A;  2VWJ A;  3QEX A;  1VSJ A;  1U04 A;  4KRF A;  1B9F A;  3ZSX A;  1TKT A;  2YNF A;  1YTA A;  2IDO A;  5DMR A;  3L2W A;  3QEW A;  2QXF A;  3PX0 A;  5HRS A;  4YNQ A;  5T7B A;  1HNI A;  5KRS A;  1UOC A;  3LP2 A;  1WSG A;  1HYV A;  5HBM A;  4CGG A;  4ZHR A;  4O0J A;  4CHY A;  1IO2 A;  1HMV A;  2OPS A;  2Y1J A;  1NK5 A;  1T8E A;  4E89 A;  3KD1 E;  2KFZ A;  4O44 A;  4DU3 A;  2F8T A;  2X6S A;  3QIO A;  4KTQ A;  3ZT4 A;  3RR7 A;  4ID5 A;  1MU2 A;  4CF1 A;  1NKC A;  4FJ9 A;  4YFU A;  3TAN A;  5FDL A;  1NJZ A;  3QEP A;  3RMA A;  1ASW A;  2X78 A;  3HT3 A;  2FBY A;  3TAE A;  4KB0 A;  4FK4 A;  3AA4 A;  2JGU A;  4Z4E A;  3SZ2 A;  4JRP A;  3MEC A;  3AVF A;  3QEI A;  1X1P A;  4FJH A;  1TL1 A;  2YHA A;  1SL1 A;  3I0S A;  3NGY A;  4CJP A;  1TKX A;  4KI4 A;  4FLV A;  1VSM A;  4CEO A;  4DFM A;  1Q9X A;  3DLH A;  1U45 A;  4F4K A;  2IOC A;  3CG7 A;  3AO5 A;  1TL3 A;  1T03 A;  2GBZ A;  1CXQ A;  3L2R A;  1D9F A;  2G8V A;  4KHS A;  1RT2 A;  4KI6 A;  4FJM A;  1BIU A;  1RBU A;  3AA2 A;  4CHO A;  4KHN A;  2G8H A;  4DQQ A;  3AVB A;  3L8B A;  1QS4 A;  2A1S A;  4CGD A;  3HPO A;  4DFJ A;  1NK7 A;  3V1O A;  4B3O A;  4M3Y A;  1JLC A;  3T1A A;  4BWJ A;  3OYK A;  1XHZ A;  4DF8 A;  3KIO A;  3AO1 A;  2KZM A;  3S3M A;  1RT3 A;  1S6Q A;  4Z0U A;  1J5O A;  4LH4 A;  2PZS A;  4CES A;  4CFB A;  4N5S A;  3OYB A;  3EY1 A;  3O3H A;  1ITG A;  1RT7 A;  1BQN A;  2Z1H A;  1WNS A;  1HYS A;  4DTX A;  3DLB A;  4CGJ A;  4E7I A;  2G8K A;  3RWU A;  4KHY A;  1RTI A;  3WNH A;  3CFP A;  1C0T A;  1QE1 A;  5J2M A;  4TSX A;  1UWB A;  3D45 A;  3T19 A;  1QTM A;  3VQB A;  4CF8 A;  1IKV A;  3NF7 A;  3CM5 A;  4F3O A;  3KLE A;  4J2E A;  1J54 A;  2Y1I A;  2QK9 A;  3C6T A;  3TAG A;  1QSL A;  2P5G A;  5CYM A;  4M3X A;  1K6Y A;  3CFR A;  1VSL A;  3KLG A;  3DOL A;  4FJX A;  2AJQ A;  1SKW A;  1RBR A;  4CHQ A;  4B9T A;  1SL2 A;  4AHV A;  2YV0 X;  1NJW A;  4HHT A;  3EZ5 A;  4FLT A;  4I9L A;  5C25 A;  3OYJ A;  2F96 A;  1Q9Y A;  4DFK A;  1UA1 A;  2F8S A;  1XC9 A;  3HM9 A;  4KAZ A;  3NAE A;  4E19 A;  4IG3 A;  3QEV A;  3K2P A;  1IKW A;  3H08 A;  4RG8 A;  1JL1 A;  3WNG A;  1G15 A;  4DTM A;  1ZBU A;  2D5R A;  2DFE A;  1F21 A;  2IC3 A;  2XY7 A;  4LH5 A;  4FJ8 A;  1EX4 A;  3V9S A;  4Q5V A;  4CK1 A;  3A2F A;  2GUI A;  3DRP A;  4DSE A;  3BDP A;  4CER A;  4J2B A;  3L3V A;  5CYQ A;  4GMJ B;  1VSI A;  1LAW A;  2BDP A;  4FM0 A;  1Q8I A;  3O4Q A;  2RF2 A;  5K14 A;  3KJV A;  3DLE A;  3QNN A;  1WAJ A;  4H4M A;  1X9S A;  1QHT A;  2HHS A;  4LSN A;  1U47 A;  3JYT A;  3P5J A;  3FFI A;  3ZSR A;  3OJU A;  4CHN A;  1TV6 A;  3VN5 A;  4DS5 A; 
#chains in the Genus database with same CATH topology
 1RT6 A;  3OTO K;  3KLI A;  4KBO A;  3O3F A;  3QBX A;  4CJS A;  1M90 O;  4A5B A;  2HNY A;  1WLJ A;  4FW2 A;  3SCX A;  4V19 S;  3UIQ A;  3DLK A;  3LPT A;  2I5J A;  4ILG B;  4OPK A;  3WNE A;  3VQ8 A;  4KKO A;  4CEZ A;  2P5O A;  5KGX A;  4A57 A;  2CGK A;  4B3M K;  3OS0 A;  2XY8 A;  4UQG A;  4FLX A;  1ASU A;  4FWR A;  3CFO A;  3VEW A;  4BC4 A;  2Q3S A;  3ZSY A;  2PYJ A;  2O8E B;  3DWL A;  3TSU A;  3QIN A;  1HLU A;  3SK3 A;  3EZW A;  4YDU A;  5BRE A;  3A0I X;  3KK2 A;  1C6V A;  3SLC A;  1A5W A;  4JI8 K;  1HNW K;  3FZL A;  3Q7B A;  3EL2 A;  2UXC K;  2GWJ A;  3NMU A;  4K8Z A;  3G10 A;  2GEM A;  2A42 A;  3CYM A;  1QVF M;  1DGK N;  4Y1C A;  4DTR A;  3CCS N;  4HWI A;  2WTU A;  3NGI A;  1IKY A;  5AQT A;  1OKJ A;  3HYF A;  3J7A P;  3VQ4 A;  1VRU A;  1GLA G;  2WOM A;  4CIG A;  5C24 A;  2NRH A;  3SUN A;  4FLZ A;  1NMD A;  3BUZ B;  4I6M A;  5CE3 A;  2FXU A;  1EKE A;  4B9V A;  4FZY A;  4GY2 B;  3THY A;  1YVN A;  4WE1 A;  4B9L A;  2HHU A;  3I55 N;  5GAD P;  4CK3 A;  1TVR A;  2Q1N A;  2ZJQ L;  2P9S B;  4E1N A;  3IRX A;  3P31 A;  3THW A;  4FWP A;  4PQU A;  3NH2 A;  4CZF A;  3AVA A;  2WBN A;  3VEV A;  3JAM O;  4KTZ A;  3DOK A;  1KSP A;  4HCB A;  2YI1 A;  2VCP A;  1T6D A;  2FSJ A;  3DXM B;  1J9A A;  1RTJ A;  1YTU A;  1W0H A;  1KFD A;  1DTT A;  2HVH A;  5DM7 L;  4BRE A;  5HRN A;  4NCA A;  1QZ6 A;  2ASM A;  3MCP A;  1YIT N;  4ILJ A;  4CE9 A;  2YKM A;  4CF2 A;  3QES A;  3M3Z A;  4BY9 C;  3ZX0 A;  4A59 A;  5BN8 A;  4CJE A;  1C0M A;  1NGH A;  3EE8 A;  3MN5 A;  4PKI A;  2ITM A;  1GOA A;  3HPG A;  3ZSW A;  5KPT A;  1EWR A;  3OYI A;  4AM7 A;  3HVT A;  3TAM A;  3K9K A;  1JLB A;  1QHA A;  1H1V A;  4PKG A;  3RVC A;  3LDQ A;  3VA0 A;  3RSE B;  1NJX A;  3WT0 A;  4LSL A;  2IIR A;  1OH8 A;  1NBW A;  3AAR A;  4K8X A;  4JS5 A;  4ISF A;  5CR4 A;  1QZ5 A;  2RPI A;  1JKH A;  1T6C A;  1NOY A;  3EKU A;  3RRH A;  1NK8 A;  4DUZ K;  2IS3 A;  3AA3 A;  4HCC A;  2V7Z A;  3THY B;  1V4T A;  3VQD A;  3VQC A;  4BDY A;  5I42 A;  4DQR A;  4DQI A;  1B92 A;  3OYC A;  3TAB A;  4J8F A;  3LPU A;  3VGK A;  3VQ5 A;  3KVG A;  4Y0W A;  3O9R A;  2D0O A;  3HJF A;  1IH7 A;  3HPH A;  5AQF A;  4Z4H A;  3UE5 A;  4JD2 A;  2D4W A;  2KHO A;  5JIC A;  3NCI A;  4EHU A;  4N56 A;  2O8D B;  2O8E A;  3C7N A;  2P9L A;  5M1Q A;  4O55 A;  2IVP A;  3CET A;  1UA0 A;  2NRR A;  3KK7 A;  3LWL A;  3GBT A;  3P4I A;  1TGO A;  1I39 A;  3VQQ A;  2QTD A;  3AV9 A;  3QLH A;  4AHS A;  4CZK A;  3M8R A;  2XRI A;  1S1U A;  1YAG A;  3VET A;  3DXK B;  1KAX A;  3OBY A;  3JS6 A;  3VEZ A;  2A5X A;  1VSF A;  4JI1 K;  1HRH A;  3SPZ A;  3KKS A;  4BRQ A;  1N5Y A;  5EVZ A;  3HL8 A;  4OJR A;  2XHB A;  5GIO A;  3GOI A;  3LDL A;  1NMN A;  5GIP A;  3P1G A;  3CCV N;  3OHR A;  5JS1 A;  1YUW A;  4W5T A;  3ULE B;  2VG7 A;  4IFY A;  3M8S A;  4MDA A;  1S1T A;  1NGJ A;  1S6P A;  3K9J A;  2ZE2 A;  5EX5 A;  3HK2 A;  2JWK A;  4JEP A;  5BPN A;  5LMN K;  5AFU A;  2WC9 A;  4ELU A;  4OLB A;  4YOR A;  3U9D A;  1UAX A;  4FK0 A;  4X65 K;  2G8F A;  2CH6 A;  2W41 A;  4KH6 A;  1Q81 O;  4GVE A;  1ESV A;  5HRR A;  1NOZ A;  3LZI A;  1KLN A;  2PY5 A;  2QEX N;  3MEE A;  5AQM A;  5FLX O;  1RBT A;  3A8Y A;  1ATS A;  3CER A;  1L3S A;  3O8M A;  5LY3 A;  3HOS A;  3PUF A;  5M1P A;  1TYQ A;  3OYH A;  4CJ4 A;  4OKK A;  4OLA A;  4KV8 A;  5BN9 A;  3S41 A;  2O8B A;  1G99 A;  4ILH A;  2NUB A;  2VQF K;  5CZ2 A;  1SAZ A;  3AVC A;  5SWM A;  3CCJ N;  2V7Y A;  2P9P A;  3MK6 A;  3SV3 A;  3O1W A;  4A62 A;  3KK3 A;  4CZL A;  5AQP A;  1QQN A;  1EET A;  3NFA A;  2HHW A;  1KLM A;  3O6W A;  4K25 A;  1NKE A;  4KHQ A;  4GNI A;  4M3T A;  1S9E A;  1FKO A;  4GVM A;  4OPA A;  1KXP A;  3S9H A;  1FXX A;  2UYT A;  4FW1 A;  1T44 A;  4HUG A;  2QA4 N;  3I8B A;  3H1Q A;  3C94 A;  4DSF A;  4N47 A;  3THX A;  1L3T A;  3LWM A;  3U3G A;  3H45 C;  3K0S A;  4Y1D A;  4JKG A;  2ZJR L;  2W6K A;  1RDB A;  2F7T A;  2OPP A;  4BRK A;  5J2P A;  1BI4 B;  4JHD A;  3ZSO A;  5GAE P;  3VF2 A;  3B6O A;  2VG6 A;  2HHH K;  4FWS A;  1U48 A;  4O5B A;  4IXC A;  5A2Q O;  2YHY A;  2WFB A;  3L2Q A;  3K58 A;  1XMO K;  3K5N A;  1BO5 O;  3AVL A;  4CK2 A;  3IAY A;  2GV9 A;  1GOC A;  1A5X A;  1LAV A;  4CGF A;  1WSE A;  3L4I A;  1VSJ A;  1U04 A;  4B3T K;  1GLF O;  3QEW A;  5HRS A;  4H0T B;  5BRH A;  4CHY A;  2HBM A;  1IO2 A;  1HMV A;  1NK5 A;  3A5O C;  4E89 A;  1NGA A;  4DR6 K;  4LF6 K;  1MU2 A;  5AQW A;  4A2B A;  5FDL A;  1NJZ A;  3RMA A;  1ASW A;  2X78 A;  3WXL A;  4FK4 A;  3U8X A;  5C0Y A;  1SL1 A;  2O8F B;  4BGB A;  4PKH A;  1VHX A;  1GLC G;  1IG8 A;  1VSM A;  1Q9X A;  3DLH A;  1NGI A;  2GEL A;  1KAZ A;  2F9W A;  1T03 A;  2YCH A;  5AQG A;  2ZGY A;  4KI6 A;  4FJM A;  1BIU A;  1IBK K;  4JKD A;  3FE1 A;  3OYK A;  3LDN A;  3AO1 A;  1S6Q A;  4LFB K;  1VQ6 N;  2VGN A;  1ITG A;  1RT7 A;  1BQN A;  3QDK A;  3L0Q A;  5CHI A;  1HKB A;  3DLB A;  2E2O A;  4KHY A;  4IOX A;  3CFP A;  1C0T A;  2NRZ A;  4TSX A;  4JV5 K;  1UWB A;  2YHW A;  3TU5 A;  1E3M A;  3D45 A;  2CGJ A;  1QTM A;  3VQB A;  3NF7 A;  4IOA L;  4J2E A;  3WQT A;  4DV1 K;  3TAG A;  1QSL A;  1K6Y A;  4MO4 A;  1TUU A;  3PSI A;  1Q9Y A;  4I9L A;  4JKE A;  2O8C A;  1YXQ A;  1UA1 A;  3H08 A;  3WNG A;  2QWR A;  2DFE A;  1F21 A;  1HKC A;  3O4W A;  1EWQ A;  1X3N A;  4UY8 O;  3R9P A;  3L4Q A;  5IT9 O;  2GX9 A;  4J2B A;  3L3V A;  5CYQ A;  4JK7 A;  2PFU A;  2QWQ A;  4FM0 A;  4BRO A;  2HHS A;  4FVU A;  3FFI A;  3OJU A;  1BG3 A;  5I9E B;  4LF9 K;  4DS5 A;  4X64 K;  3RMB A;  2OTJ N;  3ZT0 A;  4CEE A;  2VG5 A;  4DLG A;  3OY9 A;  3DYA A;  3AVN A;  1KVC A;  3W3D A;  2ZM6 K;  4QS8 A;  4W5R A;  1DLO A;  3KZB A;  3NF6 A;  4JI5 K;  4FJ7 A;  3GDQ A;  3U3Y A;  1NGG A;  3CJB A;  1FK9 A;  2F9T A;  3V81 A;  2Q2R A;  4AHR A;  5D3G A;  4PA1 A;  3DXK A;  3GE1 A;  1LV5 A;  4E7J A;  1WSJ A;  3THV A;  4B1Z A;  4HTU A;  3DRS A;  1OVQ A;  1RIL A;  4CIE A;  2B6A A;  4CJ3 A;  3F9M A;  3C65 A;  4AHU A;  4I2Q A;  4R5P A;  4QOZ B;  4BRN A;  4Q0B A;  1BOT O;  1BQM A;  3SBG A;  4C8K A;  4DR4 K;  5KGW A;  4Z4I A;  2ETJ A;  3AVM A;  3C7N B;  3RMC A;  3LM2 A;  3MX2 A;  4NCG A;  3CC2 N;  3ZEU B;  2JWL A;  4DR2 K;  4JKH A;  3R1X A;  1BHL A;  2QWP A;  4RW6 A;  3ZYY X;  3DRR A;  3TAR A;  4B1W B;  4F2R A;  4CJT A;  1IG9 A;  3ZT2 A;  2EHG A;  4DLE A;  3PO4 A;  2I7P A;  1WB9 A;  4DU4 A;  5EOY A;  1C1C A;  4B8C A;  4IOC L;  4AIL C;  2HBK A;  4K0K K;  4NB4 A;  4RWT A;  3FZM A;  3O4N A;  1XNQ K;  3LDO A;  3V4I A;  2IVN A;  4EP5 A;  3IS9 A;  3ID6 A;  1YHQ N;  2FBT A;  4YOV A;  3CD6 N;  1RBV A;  1ZBL A;  4H0Y B;  1LWF A;  3LDS A;  1C0G A;  3QIC A;  3V9W A;  1VQM N;  3SQ1 A;  5F1X A;  4BVP A;  1KD1 O;  3QET A;  1HPZ A;  4N76 A;  2G8U A;  4CJR A;  4XH1 A;  3DMJ A;  5EU7 A;  3NVM A;  4OKE A;  4FWL A;  3J7Z O;  4FYD A;  2NRT A;  2OZS A;  2P9S A;  4I2P A;  3ATV A;  2FC0 A;  3OYM A;  2R7Y A;  4CW7 B;  3VTH A;  4KH4 A;  4JI3 K;  1TYQ B;  3LP3 A;  5AQZ A;  4BE0 A;  1A5V A;  3I33 A;  4M3R A;  2BTF A;  4FM2 A;  4M3U A;  1X9J A;  5DM6 L;  1BCO A;  3CJ9 A;  4PUO A;  4PL8 A;  4XEI A;  5AQQ A;  2DFH A;  3ULD A;  3SV4 A;  3CM6 A;  3TTD A;  1E4F T;  1HPM A;  1JLF A;  4PL7 A;  1HJR A;  2W42 A;  2O4G A;  5C2D A;  3CIP A;  4C1N K;  3VQE A;  3LAM A;  2QKK A;  2HW3 A;  1I3A A;  1BCM A;  4LFC K;  2UUB K;  3K5L A;  1HX1 A;  3HXM A;  2ITG A;  3VEN A;  3OYE A;  4ELV A;  3J7Y P;  1XHX A;  4BRM A;  4FJL A;  4RW4 A;  1ASV A;  1Q86 O;  4B8A B;  4O4G A;  5AZI B;  4JI7 K;  2BUP A;  1S5J A;  3MCA B;  4B9M A;  4OPJ A;  1XNR K;  2NRX A;  2EWS A;  1QSS A;  3K57 A;  4BE1 A;  5AZI A;  4BRC A;  3SPY A;  5TKY A;  2P9L B;  3SI6 A;  2E4L A;  4NYN A;  3K5M A;  1BIZ A;  5HOO A;  2F4V K;  3ALY A;  1RDC A;  3AGK A;  3OYA A;  1D4X A;  3ENO A;  4H03 B;  4KO0 A;  4BR5 A;  2E2P A;  3IMX A;  4BR4 A;  3SMP A;  3NVK A;  3QO9 A;  4ELT A;  3H46 O;  4DSK A;  4WFN L;  3WNF A;  2QKB A;  3CXC M;  4BRP A;  4EZ9 A;  3RRG A;  1X3M A;  4CF0 A;  3AVI A;  2O8C B;  4M45 A;  4RW7 A;  1JL2 A;  5J2N A;  1BUP A;  2OA8 A;  3V9X A;  1HKG A;  1KVA A;  1GLB G;  1Z26 A;  5CY4 A;  3RSE A;  3KK1 A;  4H8K A;  4DKW A;  3ZEU A;  3F2K A;  1XMQ K;  4MDB A;  3LP0 A;  3SJJ A;  4FJI A;  3D2F B;  4RW8 A;  3ZX2 A;  4O5F A;  4DTJ A;  4BWM A;  1SQK A;  4NYF A;  1KFS A;  3E01 A;  1ZBH A;  3VGM A;  2KW4 A;  3KLH A;  3ZLJ A;  4DTP A;  3FZK A;  4DTU A;  5JVH L;  2OYQ A;  1D9D A;  1GOB A;  3WXM B;  5SZT A;  4JI0 K;  1T3V A;  4E7L A;  2HBL A;  4H5T A;  2ZD1 A;  2P9N A;  1LW2 A;  2HOE A;  4BE2 A;  5LMU K;  1J6Z A;  2HMI A;  4CJV A;  1MWK A;  1T05 A;  2ZF5 O;  3BGR A;  4JKB A;  4KPY A;  4JK9 A;  1IKX A;  2I7N A;  4JKC A;  4FVM A;  3OYF A;  4KH5 A;  2D0A A;  4ICL A;  4WCE L;  4WYB A;  2BE2 A;  1GLE G;  3D2E A;  1BWF O;  3FR0 A;  2P9I B;  4LC9 B;  5M1F A;  3ZET B;  1NNE A;  2V51 B;  3NGZ A;  1QQM A;  4JKF A;  4AM6 A;  1DEJ A;  5KTQ A;  4DR5 K;  3KWI A;  4MQ3 A;  4B3R K;  4Z4F A;  4B9S A;  3MN7 A;  4IWV A;  4CJU A;  5JVG L;  3HVR A;  1NK9 A;  1XI1 A;  3I8D A;  3KHY A;  1X9W A;  4CJK A;  4FPB A;  2KZZ A;  5F0X A;  4DSJ A;  4OVL A;  4FSV A;  1QSY A;  4CZG A;  4JI6 K;  4CEC A;  3CHW A;  5F2R A;  4ZTF A;  3DLR A;  4JLH A;  4NXM K;  5KRT A;  4BG8 A;  2Q97 A;  2YNF A;  1YTA A;  3T69 A;  2QXF A;  4JHD B;  3LP2 A;  4ZHR A;  1Q82 O;  3J8A A;  3D6R A;  1T8E A;  3WUH A;  4O44 A;  4FOE A;  5C10 A;  4YY3 K;  1U2V A;  3ZT4 A;  1NG9 A;  4CF1 A;  4FJ9 A;  4B1Y B;  2Q0U A;  2RHK A;  4IO9 L;  4KB0 A;  3AA4 A;  1EQY A;  4CJP A;  4BRA A;  3O08 A;  1VQK N;  5AQL A;  1KQS M;  1U45 A;  1MWM A;  3LDP A;  5KPR A;  5C15 A;  3CG7 A;  2W40 A;  5C2F A;  5B8H A;  1S72 N;  3UKR A;  3EEQ A;  4CI6 A;  3R8E A;  3HBT A;  2A1S A;  4CGD A;  2P9P B;  4FPA A;  4CZI A;  3HPO A;  1DKG D;  3T1A A;  1XHZ A;  3D7E O;  3CI5 A;  4EAH D;  4BGA A;  4CFB A;  2Z1H A;  3QB0 A;  3BF3 A;  2A40 A;  1YF5 L;  4DTX A;  2IVO A;  3RWU A;  1RTI A;  3TTC A;  1QE1 A;  2YJE A;  3VMF B;  4CF8 A;  1IKV A;  1V4S A;  5TKW A;  5E26 A;  2P5G A;  4M3X A;  4JYA K;  2AJQ A;  3MX5 A;  1SKW A;  1SL2 A;  3CMA N;  5AQO A;  3J81 O;  4BRG A;  3GG4 A;  2F96 A;  4DFK A;  1XC9 A;  4XH4 A;  4KAZ A;  3NAE A;  3K2P A;  4JNE A;  4JKA A;  4DTM A;  1ZBU A;  2D5R A;  5BRD A;  2XY7 A;  4FJ8 A;  1LOT B;  3UKU A;  3VOV A;  3V9S A;  4Q5V A;  3A2F A;  3A5L C;  3MWP A;  3MMV A;  1FW6 A;  3DRP A;  1SS6 A;  4CER A;  4BRI A;  2P9I A;  1VSI A;  3DLE A;  4H4M A;  1QHT A;  1U47 A;  3P5J A;  4CHN A;  3PV8 A;  3ATU A;  4CIF A;  3NF8 A;  3FGU A;  5HRO A;  3EYZ A;  3IG1 A;  2HF3 A;  3OYG A;  2AA4 A;  3HRG A;  5JS2 A;  3MDQ A;  2O8F A;  2P9U B;  5E84 A;  4CFD A;  3U9Z A;  1HUX A;  1NGF A;  1SKS A;  4YOY A;  4CJF A;  4J2D A;  4B08 A;  2HVI A;  3ZT3 A;  4JK8 A;  4K43 A;  3KKR A;  2ZWH A;  1NGE A;  3ZSV A;  1LWE A;  1QQC A;  4FWN A;  2E6M A;  5KQD A;  4XIU A;  5HLF A;  3HSC A;  3WXK A;  3AGR A;  3WEE B;  5FPD A;  2NLX A;  2Q31 A;  3F9K A;  1LWC A;  4W5O A;  1D5A A;  4I9Q A;  4H4O A;  4CJW A;  4IFE A;  4LF5 K;  1OVY A;  5FPM A;  4A2A A;  3VEO A;  3B8A X;  2BH1 A;  3NBP A;  3SQ2 A;  4CD3 A;  1RDW X;  2E88 A;  4CFC A;  3WQU A;  3P83 D;  3QIP A;  1N33 K;  4CED A;  1L5U A;  2VWK A;  1WSI A;  1YJW N;  3O9Q A;  4QAG A;  1VQ7 N;  3K5O A;  1GLL O;  1C0F A;  2V52 B;  3NE6 A;  4ZTJ A;  5AQH A;  4CJL A;  4C1N I;  1ZYQ A;  2YNH A;  1K8K B;  1BDG A;  3LP1 A;  2O4I A;  2IAJ A;  3TSQ A;  1JXB A;  1OH6 A;  2VQE K;  1W2B M;  2DY4 A;  1RCH A;  1S1X A;  5HP1 A;  1VQ8 N;  3AVK A;  4QCL A;  1DTQ A;  2PAV A;  2WUS A;  2P9N B;  4YHH K;  4QS7 A;  1JCG A;  4BR2 A;  4CBW A;  4AH9 A;  3VER A;  1U2V B;  3W0L A;  4DU1 A;  1U6Z A;  2HND A;  4F2S A;  1WN7 A;  4H0O A;  5AQJ A;  3DXM A;  4OPH A;  4B9N A;  3FZH A;  4F3T A;  1Z25 A;  1MA9 B;  1EO1 A;  4DTS A;  5AQX A;  3JSM A;  1R59 O;  3H3O B;  3CCL N;  3VEY A;  4WQ4 A;  4O8K A;  2ZQB A;  3V9Z A;  3T1Y K;  2HNZ A;  4B9Q A;  1Y64 A;  4M3W A;  3ZCM A;  4X62 K;  3VA3 A;  2AP1 A;  3CJC A;  3HST B;  2D0C A;  4W5N A;  4AHT A;  1TAU A;  5AQK A;  3CCR N;  3T3F A;  4PWD A;  4BC5 A;  4IJA A;  1ZBI A;  3O1B A;  2WON A;  4A61 A;  1KCF A;  5AZJ B;  4Z4C A;  1RDU A;  4BQL A;  5BPL A;  3M5R A;  5AR0 A;  4DR3 K;  3I0R A;  3QML A;  3ITH A;  5H1S Q;  1SV5 A;  3AO2 A;  5KI6 A;  3QER A;  3SBT A;  1VAZ A;  3ZX3 A;  3KD5 E;  1VSK A;  3HZ6 A;  3ID8 A;  4IDK A;  3MXJ A;  3G6E N;  3PY8 A;  2HHQ A;  1XUP O;  4NLC A;  4BR0 A;  5J2Q A;  1JXE A;  3OS2 A;  4QS9 A;  3OJS A;  3LAK A;  3OYD A;  4A5A A;  3CCQ N;  1W9H A;  4O8U A;  4CZH A;  3J80 O;  2J4R A;  2CGL A;  3L2V A;  4FZZ A;  2A3Z A;  5FRN A;  3IKM A;  3E66 A;  4EHT A;  4E0D A;  3SJH A;  4AQY K;  4HTL A;  5BR9 A;  4FWM A;  3NF9 A;  4CZJ A;  4J2A A;  2G8W A;  4KHW A;  4ISG A;  4G1Q A;  3TTF A;  4PHT X;  1TKZ A;  4XH5 A;  4YDU C;  1VSH A;  1T7P A;  1K8K A;  4CGH A;  1CLQ A;  4CEQ A;  2IGI A;  1SZ2 A;  5AZJ A;  5LJV A;  4ID1 A;  1TK0 A;  4CEF A;  4JRQ A;  5E41 A;  2HHX A;  2PBD A;  3EN9 A;  3OBW A;  3G4S N;  1R0A A;  2FSK A;  1N6Q A;  2EX3 A;  5AQU A;  3ZT1 A;  1IBM K;  4DR1 K;  3VTI A;  1NK4 A;  4LF8 K;  2FF3 B;  2LSN A;  5JMV A;  5I3U A;  4FJJ A;  3BY5 A;  1ILY A;  1REV A;  4BDZ A;  4OO1 J;  1KTQ A;  4OKJ A;  2GWK A;  1VQN N;  5AQV A;  3V6D A;  2B4J A;  3AO3 A;  3TAF A;  3ASM A;  2Z1I A;  4DB3 A;  1C1B A;  1W7A A;  5JLH A;  3ISN C;  2JLE A;  1RT4 A;  2QW9 A;  2FSN A;  4FCY A;  4DQP A;  2HMP A;  1SL0 A;  2UU9 K;  3WXI A;  4FLW A;  4E1M A;  3U6F A;  4BG9 A;  1IBL K;  3VPZ A;  4IEI A;  3VQ9 A;  2HB5 A;  3KLF A;  3UKR B;  5BRF A;  3S3O A;  2ZJP L;  3EE9 A;  3V9U A;  5M1O A;  1KAY A;  4B9U A;  3VGL A;  2E8A A;  2UXB K;  3LAN A;  3OYN A;  1E4G T;  1NGC A;  3RMD A;  3CCE N;  3B6P A;  1LCU A;  4H0V B;  4CF9 A;  4DTO A;  1QVG M;  3ZSZ A;  4BRD A;  1CXU A;  3E1Y A;  3QFP A;  2QWN A;  1VQL N;  3O3G A;  1ZBF A;  1NJI O;  2XO7 A;  2E5L K;  3A5N C;  1P8Z A;  3P38 A;  4FJ5 A;  4IG0 A;  4L8R B;  1NK6 A;  3SUQ A;  4IJN A;  3H6E A;  2G8I A;  3ZSQ A;  2A6A A;  2OPR A;  3AVJ A;  2OTL N;  4DQS A;  4E7H A;  1YJN N;  2P1J A;  4GKK K;  5FRO A;  1OH5 A;  2OAN A;  1TKD A;  3PLA A;  1P90 A;  1RDA A;  3L2U A;  1EXQ A;  3HTV A;  1GLD G;  1TAQ A;  3VF4 A;  3M8P A;  3TI0 A;  4LD0 A;  4FXD A;  1BIS A;  2UXD K;  1ATR A;  1JLQ A;  4B1X B;  4B1U B;  4FL9 A;  2KQ2 A;  4YOX A;  3D0P A;  1B9D A;  3FFK B;  5AQR A;  4DV5 K;  4KHU A;  1VSD A;  4H5R A;  2XY5 A;  3N4P A;  1EP4 A;  3M8Q A;  3T7Z A;  2VWJ A;  3QEX A;  3CME N;  4FOI A;  1B9F A;  4H5W A;  2IDO A;  3EKS A;  5DMR A;  4BVO A;  3PX0 A;  1N32 K;  5T7B A;  1HNI A;  5KRS A;  1WSG A;  4CGG A;  3H3N O;  4O0J A;  4FWQ A;  3KD1 E;  3Q7C A;  3CPW M;  3ZET A;  4CBX A;  4KTQ A;  4ID5 A;  4CBU A;  4YFU A;  3TAN A;  4M7X A;  3THX B;  4NO7 A;  4EFH A;  3HT3 A;  2D0P A;  2JGU A;  3TSP A;  4JRP A;  3SZ2 A;  3AVF A;  1TL1 A;  2YHA A;  3I0S A;  4DV3 K;  1TKX A;  4KI4 A;  4DFM A;  3R6M A;  4IZ9 A;  2GBZ A;  3VEX A;  2KLA A;  3L2R A;  1D9F A;  4WF9 L;  1RT2 A;  3WXJ A;  5FPE A;  1RBU A;  4KHN A;  2G8H A;  4WQ5 C;  4DQQ A;  3DLL L;  4DV6 K;  1NK7 A;  2VGM A;  3V1O A;  3M1F A;  4M3Y A;  4B3O A;  1JLC A;  2VWB A;  4GV9 A;  4BWJ A;  3KIO A;  2KZM A;  1RT3 A;  2O8B B;  4Z0U A;  3LL3 A;  1J5O A;  4LH4 A;  2PZS A;  3TPQ A;  4N5S A;  3EY1 A;  1Q7Y O;  3O3H A;  1BU6 O;  5EXW A;  1HYS A;  4CGJ A;  4E7I A;  1WOQ A;  2A41 A;  2G8K A;  1HNX K;  5J2M A;  2QXL A;  5ELZ A;  1XQS C;  1J54 A;  2QK9 A;  3C6T A;  3OW2 M;  2P9K B;  3BZC A;  3CFR A;  4FJX A;  1VSL A;  3KLG A;  3DOL A;  1NGB A;  1RBR A;  2HST A;  2YV0 X;  4HHT A;  4DV0 K;  3OYJ A;  2F8S A;  3HM9 A;  4E19 A;  3QEV A;  1IKW A;  4RG8 A;  1JL1 A;  1G15 A;  2DPN A;  1HNZ K;  3CCU N;  4LH5 A;  1EX4 A;  4CK1 A;  4DSE A;  3BDP A;  3CQY A;  1FJG K;  4JN4 A;  4B3S K;  1LAW A;  2BDP A;  1Z6R A;  3KJV A;  1O13 A;  3QNN A;  1X9S A;  1WAJ A;  2QM1 A;  3BEX A;  2QI2 A;  3VES A;  3JYT A;  1TV6 A;  3VN5 A;  4DSL A;  4OGE A;  1RDD A;  1YT3 A;  3SMS A;  3PIO L;  2E2Q A;  3V1R A;  4YOU A;  5AFU H;  4CFA A;  1SUQ A;  2YHX A;  3NDK A;  4MLH A;  4M42 A;  4FLY A;  1KVB A;  3V1Q A;  1RBS A;  1CZA N;  3I56 N;  1N34 K;  2RE2 A;  3VQA A;  5AQS A;  4E3S A;  3LM9 A;  2D0B A;  5JLF A;  4CVN E;  4LF7 K;  2KTQ A;  1SKR A;  3BZK A;  1D8Y A;  5J1E A;  4JS4 A;  3DM2 A;  3TWH A;  5CZ1 A;  2GUP A;  4CJQ A;  3C6H A;  4R79 A;  3C6A A;  3CF5 L;  3D2F A;  5BR8 K;  3CPE A;  4C8M A;  3NH1 A;  4JI4 K;  1U49 A;  3M6G A;  5ADX H;  3KTQ A;  1MDU B;  3CQX A;  4DS4 A;  4WFA L;  2YNI A;  2H3G X;  1HJO A;  4FLU A;  4DV2 K;  2XY6 A;  2E1Z A;  5FPN A;  4IBN A;  1HQU A;  2YX6 A;  1WBB A;  4EZ6 A;  4W5Q A;  1WAF A;  2Q36 A;  1J53 A;  1WSF A;  4CZE A;  4HUE A;  4MFB A;  3SNN A;  3LZJ A;  4H0P A;  2RKI A;  3SUO A;  4JKG B;  4IO8 A;  3PO5 A;  3P39 A;  3TAQ A;  1KC8 O;  3PX6 A;  1C1A A;  2HHV A;  3RTV A;  4DCH A;  2PYL A;  4CCH A;  3VQ7 A;  2P51 A;  4O0I A;  4NCB A;  5HRP A;  3PX4 A;  2ATQ A;  4C8O A;  1CZB A;  4EIA A;  4N41 A;  4NLB A;  3G71 N;  3ENB A;  4H5V A;  3D2E B;  2BAN A;  1YJ9 N;  1S1V A;  4CGI A;  4IFV A;  1BA1 A;  4DSI A;  3SYZ A;  4HVJ A;  1VSE A;  4M3Z A;  4CJ7 A;  3BP8 A;  3HP9 A;  3A5M C;  1JLA A;  4F8R A;  1BGX T;  1YI2 N;  1CZ9 A;  1BA0 A;  5GAG P;  1HR0 K;  1RT5 A;  3CQ8 A;  2NRV A;  4E7K A;  1NLV A;  3O80 A;  2B5J A;  1NWK A;  3CJ7 A;  4IDH A;  3SUP A;  3OVN A;  1J5E K;  4LY7 A;  1JJ2 M;  2D1K A;  1WSH A;  3THW B;  1L3U A;  2YNG A;  4KTW A;  1RTH A;  1Q18 A;  5LL6 Z;  2Z1G A;  3VQ6 A;  1KRP A;  3MXI A;  1YIJ N;  1JCE A;  2FF6 A;  4OGC A;  4FZX C;  5GAH P;  3DI6 A;  5M1K A;  4DQ8 A;  1M1K O;  4M63 C;  1S22 A;  1BI4 A;  3K59 A;  3MAQ A;  4AF1 A;  5AQN A;  3SQ0 A;  4PY5 A;  3AVG A;  1GLJ O;  3O9S A;  3UKU B;  3MN9 A;  4WFB L;  1DT9 A;  2DFF A;  2FBX A;  2RN2 A;  3E9L A;  1S3X A;  3C95 A;  1Z05 A;  4C8N A;  3HO1 A;  3O9U A;  3C6U A;  1VRT A;  4DMN A;  4BR9 A;  4WQ5 A;  3AAP A;  1TK5 A;  4DG1 A;  4KFB A;  1OH7 A;  3QNO A;  3CC4 N;  4DWI A;  1N36 K;  4CEA A;  4OX9 K;  4BAC A;  5IWA K;  3NH0 A;  4BQZ A;  2VYP A;  1RTD A;  4L3Q A;  4C8L A;  3AO4 A;  5DK5 A;  3QFU A;  1TUY A;  1QQO A;  1JLE A;  1WUA A;  1ZBS A;  4CHZ A;  4YOW A;  1IV0 A;  2FBV A;  3S3N A;  4DF4 A;  2OPQ A;  4BC2 A;  3HOT A;  3HM8 A;  4FWK A;  2O8D A;  4IEE A;  3NHG A;  4IKF A;  5GIN A;  4JD2 B;  4FJN A;  2HBJ A;  1Y97 A;  3R3L A;  4DHY A;  3TR8 A;  3CJ1 A;  1VQO N;  3SQ4 A;  2NZT A;  1K8A O;  1K9M O;  1RGI A;  2X74 A;  4GKJ K;  4YOT A;  4MO5 A;  4ISE A;  4CJ5 A;  5KPZ A;  3MXM A;  3RR8 A;  1ZXO A;  3JXU A;  1S1W A;  4KRE A;  2ZGZ A;  3L3U A;  3O9T A;  3MED A;  4FJK A;  2P9K A;  2A1R A;  1VQ5 N;  4FWO A;  2E20 A;  3DLG A;  1FKP A;  1HQE A;  3AA5 X;  4RW9 A;  3G25 A;  3MEG A;  3OS1 A;  1XWL A;  5C42 A;  4KHP K;  2GTD A;  4HUF A;  1RNH A;  2Z1J A;  1C0U A;  2BGG A;  3F5T A;  5LJW A;  4Z4G A;  2HHT A;  4H0X B;  3TAP A;  4MLE A;  4FJG A;  3PSF A;  1O1W A;  1VQP N;  1HYZ A;  4BRL A;  2DTU A;  4GW6 A;  3F73 A;  5FRM A;  2CH5 A;  3CJA A;  1WBD A;  4M41 A;  4BR7 A;  4DV7 K;  1S9G A;  4CEB A;  3IUC A;  2E6L A;  2E1Y A;  1BL3 A;  1NGD A;  2YKN A;  3G0Z A;  4KB1 A;  1NK0 A;  4RCH A;  3ENH A;  1HNV A;  2X6N A;  3OA9 A;  3MN6 A;  1RT1 A;  4FM1 A;  3LAL A;  4M7Y A;  4I7F A;  4FK2 A;  1YVU A;  1N8R O;  1VK0 A;  4E1J A;  3VQP A;  1ATN A;  4DFP A;  2YHB A;  1NKB A;  5M1N A;  4AHC A;  3GL1 A;  5AQY A;  4DR7 K;  4EP4 A;  1U4B A;  1RFQ A;  1JLG A;  4JAX A;  1IJJ A;  1LW0 A;  3AVH A;  1W97 L;  2KFN A;  4U67 L;  3U4L A;  1L3V A;  3UB5 A;  2QWL A;  3CC7 N;  3HP6 A;  3OYL A;  2OZM A;  2ASO A;  4DTN A;  1VQ4 N;  4Z94 A;  3FZF A;  3H1V X;  1X9M A;  3E9P A;  4I6M B;  4CHP A;  1NJY A;  2YJF A;  3QBW A;  5BPM A;  2NNW A;  3E9O A;  4DV4 K;  5AQI A;  5C12 A;  1TK8 A;  4GV6 A;  4BDP A;  3WEE A;  4KRF A;  1NU0 A;  3ZSX A;  1TKT A;  3L2W A;  4YNQ A;  1UOC A;  1HYV A;  5HBM A;  2OPS A;  2Y1J A;  3L6Q A;  2KFZ A;  2F8T A;  4DU3 A;  2ASP A;  2X6S A;  3QIO A;  3DAW A;  3RR7 A;  1NKC A;  3QEP A;  4CD1 A;  2FLO A;  3TAE A;  2FBY A;  5EY4 A;  3BF1 A;  4Z4E A;  2KKZ A;  3MEC A;  3IDH A;  3IFR A;  1X1P A;  5ADX A;  3QEI A;  4FJH A;  3NGY A;  3EO3 A;  4CEO A;  4FLV A;  4F4K A;  4CZM A;  2IOC A;  1NM1 A;  3ULE A;  3AO5 A;  1TL3 A;  2G8V A;  1CXQ A;  4KHS A;  4FO0 A;  3VF6 A;  3N4Q A;  4U7B A;  2HF4 A;  3SAF A;  3AA2 A;  2P9U A;  4CHO A;  4C23 A;  3AVB A;  1VQ9 N;  4F9O A;  3DJC A;  1QS4 A;  3SAH A;  3L8B A;  4K42 A;  4DFJ A;  4H5N A;  2QWM A;  4DF8 A;  3S3M A;  5HL7 L;  2UUC K;  4DUY K;  4CES A;  3OYB A;  4LF4 K;  1WNS A;  3MWT A;  3HI0 A;  4JI2 K;  4WQ4 C;  3WNH A;  4B1V A;  3CCM N;  3O5B A;  3C0B A;  2OCE A;  3T19 A;  4GV3 A;  3CM5 A;  4F3O A;  3KLE A;  2Y1I A;  2NRW A;  3PIP L;  5CYM A;  1JCF A;  4CHQ A;  4B9T A;  3AY9 A;  4AHV A;  1NJW A;  3EZ5 A;  4FLT A;  5C25 A;  5AJ3 K;  4BRF A;  4X66 K;  4K41 A;  4IG3 A;  3SAG A;  3KWG A;  1K73 O;  2IC3 A;  5MLC Q;  1I94 K;  1XC3 A;  2Q0R A;  2W6L A;  2GUI A;  4BRH A;  4LFA K;  4G9Z A;  4GMJ B;  3FLC O;  2QWO A;  1Q8I A;  3O4Q A;  2RF2 A;  5K14 A;  1ZC6 A;  4NXN K;  2E2N A;  3AAQ A;  4BC3 A;  4LSN A;  5KQ8 A;  3ZSR A;  4RTF D;  3T1H K;  2UUA K; 
#chains in the Genus database with same CATH homology
 3RMB A;  1RT6 A;  4CIF A;  3NF8 A;  4DSL A;  5HRO A;  4OGE A;  1RDD A;  3IG1 A;  3KLI A;  3ZT0 A;  3O3F A;  1YT3 A;  4CEE A;  3EYZ A;  2VG5 A;  4DLG A;  3OYG A;  4CJS A;  3OY9 A;  3DYA A;  3AVN A;  5JS2 A;  3V1R A;  2HNY A;  1KVC A;  1WLJ A;  4FW2 A;  3SCX A;  4CFA A;  1SUQ A;  3UIQ A;  3DLK A;  3NDK A;  4CFD A;  4W5R A;  1DLO A;  3LPT A;  1SKS A;  4M42 A;  4CJF A;  4FLY A;  4J2D A;  1KVB A;  2I5J A;  3V1Q A;  1RBS A;  3NF6 A;  4FJ7 A;  4B08 A;  3VQA A;  2HVI A;  4E3S A;  4OPK A;  3WNE A;  3U3Y A;  3VQ8 A;  3ZT3 A;  4KKO A;  2D0B A;  4CEZ A;  5KGX A;  2P5O A;  2KTQ A;  1SKR A;  1FK9 A;  3V81 A;  1D8Y A;  3KKR A;  5J1E A;  4AHR A;  5D3G A;  3ZSV A;  4PA1 A;  1LWE A;  3OS0 A;  2XY8 A;  1LV5 A;  4UQG A;  4FLX A;  1QQC A;  1ASU A;  2E6M A;  4E7J A;  1WSJ A;  4XIU A;  5HLF A;  4JS4 A;  3THV A;  3CFO A;  3DM2 A;  3TWH A;  5CZ1 A;  4HTU A;  2Q3S A;  3ZSY A;  4CJQ A;  3DRS A;  2PYJ A;  1RIL A;  4CIE A;  2B6A A;  4CJ3 A;  3QIN A;  4C8M A;  3NH1 A;  4AHU A;  3F9K A;  4I2Q A;  3KK2 A;  4R5P A;  1LWC A;  4W5O A;  1C6V A;  1D5A A;  1U49 A;  4H4O A;  4I9Q A;  4QOZ B;  1A5W A;  4CJW A;  3KTQ A;  4Q0B A;  1BQM A;  4K8Z A;  3G10 A;  4C8K A;  5KGW A;  4DS4 A;  3CYM A;  2YNI A;  2ETJ A;  3AVM A;  3RMC A;  4Z4I A;  4FLU A;  4Y1C A;  3NBP A;  2XY6 A;  3SQ2 A;  4NCG A;  4DTR A;  4IBN A;  4CFC A;  1HQU A;  1BHL A;  1IKY A;  3P83 D;  3QIP A;  3NGI A;  4W5Q A;  1WAF A;  4EZ6 A;  1J53 A;  1WSF A;  3HYF A;  4CED A;  4HUE A;  4MFB A;  3SNN A;  3LZJ A;  1L5U A;  3VQ4 A;  1VRU A;  2RKI A;  2VWK A;  2WOM A;  4CIG A;  1WSI A;  4RW6 A;  3SUO A;  5C24 A;  3SUN A;  4FLZ A;  4QAG A;  3DRR A;  3K5O A;  1EKE A;  4B9V A;  4FZY A;  3TAR A;  3PO5 A;  4WE1 A;  4B9L A;  3TAQ A;  3NE6 A;  4F2R A;  4CJT A;  4ZTJ A;  3PX6 A;  1C1A A;  4CK3 A;  1IG9 A;  1TVR A;  2EHG A;  3ZT2 A;  4CJL A;  2YNH A;  1ZYQ A;  4DLE A;  3PO4 A;  3RTV A;  2PYL A;  4CCH A;  3LP1 A;  2O4I A;  4E1N A;  3IRX A;  3VQ7 A;  2IAJ A;  2P51 A;  1JXB A;  4O0I A;  4NCB A;  4DU4 A;  5HRP A;  4PQU A;  3NH2 A;  1C1C A;  2ATQ A;  3AVA A;  4B8C A;  3PX4 A;  4C8O A;  1CZB A;  4KTZ A;  4AIL C;  4N41 A;  3DOK A;  1KSP A;  4HCB A;  2DY4 A;  1RCH A;  2BAN A;  1S1V A;  1S1X A;  4IFV A;  4CGI A;  5HP1 A;  4DSI A;  3SYZ A;  3O4N A;  4HVJ A;  3AVK A;  2HHV A;  3V4I A;  4QCL A;  1J9A A;  1VSE A;  4EP5 A;  4M3Z A;  1DTQ A;  3IS9 A;  1RTJ A;  1YTU A;  1W0H A;  1KFD A;  1DTT A;  3HP9 A;  2HVH A;  2FBT A;  1JLA A;  4F8R A;  1RBV A;  5HRN A;  1ZBL A;  4NCA A;  1BGX T;  4AH9 A;  1LWF A;  1CZ9 A;  3LDS A;  4DU1 A;  3V9W A;  2HND A;  2YKM A;  4CE9 A;  3SQ1 A;  1WN7 A;  1RT5 A;  3CQ8 A;  4F2S A;  4CF2 A;  3QES A;  4E7K A;  4B9N A;  3QET A;  1HPZ A;  2B5J A;  4CJE A;  4F3T A;  4N76 A;  1C0M A;  2G8U A;  3SUP A;  3OVN A;  1Z25 A;  4CJR A;  3DMJ A;  5EU7 A;  4OKE A;  1GOA A;  3HPG A;  4DTS A;  4LY7 A;  3ZSW A;  3OYI A;  1WSH A;  3JSM A;  1L3U A;  2YNG A;  4FYD A;  3HVT A;  3TAM A;  4KTW A;  1RTH A;  2OZS A;  1JLB A;  4I2P A;  2FC0 A;  3VA0 A;  2ZQB A;  3OYM A;  1NJX A;  2R7Y A;  4LSL A;  3V9Z A;  4K8X A;  2Z1G A;  2HNZ A;  3LP3 A;  3VQ6 A;  4JS5 A;  3MXI A;  1KRP A;  4BE0 A;  1A5V A;  2RPI A;  4M3W A;  1JKH A;  4OGC A;  3ZCM A;  1NOY A;  4FZX C;  4M3R A;  3DI6 A;  4FM2 A;  3RRH A;  1NK8 A;  3VA3 A;  4M3U A;  2IS3 A;  1BI4 A;  3K59 A;  1BCO A;  4PUO A;  3HST B;  3MAQ A;  2D0C A;  2DFH A;  3AA3 A;  4AHT A;  4HCC A;  3ULD A;  4W5N A;  3SV4 A;  3CM6 A;  3VQC A;  3VQD A;  4BDY A;  3T3F A;  3SQ0 A;  5I42 A;  4PWD A;  1TAU A;  4PY5 A;  4DQR A;  3AVG A;  1ZBI A;  4DQI A;  1B92 A;  3OYC A;  2WON A;  1JLF A;  3TAB A;  3VQ5 A;  1HJR A;  1KCF A;  3LPU A;  2O4G A;  2W42 A;  2DFF A;  2FBX A;  4Z4C A;  3HJF A;  1IH7 A;  2RN2 A;  3HPH A;  4Z4H A;  3VQE A;  3LAM A;  2QKK A;  3C95 A;  3I0R A;  2HW3 A;  1I3A A;  1BCM A;  4C8N A;  3NCI A;  4N56 A;  3ITH A;  1SV5 A;  3K5L A;  3HO1 A;  3HXM A;  2ITG A;  3AO2 A;  5KI6 A;  4O55 A;  3QER A;  3C6U A;  1VRT A;  4DMN A;  1UA0 A;  3OYE A;  3KD5 E;  1VSK A;  1TK5 A;  4DG1 A;  4KFB A;  1XHX A;  3LWL A;  4ELV A;  4IDK A;  3MXJ A;  3PY8 A;  4FJL A;  4RW4 A;  3QNO A;  2HHQ A;  5J2Q A;  1JXE A;  1ASV A;  4DWI A;  3OS2 A;  1TGO A;  1I39 A;  4B8A B;  3VQQ A;  4CEA A;  3OJS A;  3LAK A;  4BAC A;  3OYD A;  3NH0 A;  3AV9 A;  4O4G A;  1RTD A;  1W9H A;  4C8L A;  3QLH A;  3AO4 A;  5DK5 A;  4AHS A;  3M8R A;  3L2V A;  2XRI A;  1S1U A;  1S5J A;  4B9M A;  4FZZ A;  4OPJ A;  1JLE A;  5FRN A;  4E0D A;  1VSF A;  4CHZ A;  1HRH A;  3SPZ A;  1QSS A;  3KKS A;  3K57 A;  2FBV A;  4BE1 A;  3SPY A;  4DF4 A;  2OPQ A;  3NF9 A;  3S3N A;  3HL8 A;  4OJR A;  2XHB A;  1N5Y A;  2G8W A;  4J2A A;  4KHW A;  3SI6 A;  4G1Q A;  2E4L A;  3NHG A;  4NYN A;  4IKF A;  3K5M A;  3P1G A;  1BIZ A;  1TKZ A;  5JS1 A;  3ALY A;  1VSH A;  1RDC A;  1T7P A;  4CGH A;  1CLQ A;  4CEQ A;  2IGI A;  4W5T A;  4FJN A;  2VG7 A;  3OYA A;  4ID1 A;  1TK0 A;  4CEF A;  4IFY A;  3M8S A;  4JRQ A;  1Y97 A;  4KO0 A;  5E41 A;  1S1T A;  1S6P A;  2ZE2 A;  3HK2 A;  2HHX A;  3QO9 A;  3TR8 A;  4ELT A;  3SQ4 A;  4DSK A;  3WNF A;  1R0A A;  4ELU A;  4OLB A;  1N6Q A;  2X74 A;  1UAX A;  2QKB A;  4FK0 A;  2EX3 A;  4EZ9 A;  3RRG A;  3ZT1 A;  4CJ5 A;  3MXM A;  3RR8 A;  2G8F A;  1S1W A;  4CF0 A;  3AVI A;  1NK4 A;  4KRE A;  2LSN A;  4M45 A;  4RW7 A;  5HRR A;  1JL2 A;  5I3U A;  4FJJ A;  1NOZ A;  3L3U A;  3LZI A;  1KLN A;  2PY5 A;  1REV A;  4BDZ A;  5J2N A;  3MEE A;  2OA8 A;  1KTQ A;  3MED A;  4OKJ A;  3V9X A;  4FJK A;  1KVA A;  2A1R A;  1Z26 A;  5CY4 A;  3KK1 A;  3DLG A;  3V6D A;  1RBT A;  2B4J A;  1FKP A;  1HQE A;  3AA5 X;  4RW9 A;  3PV8 A;  3AO3 A;  1L3S A;  3MEG A;  3OS1 A;  4H8K A;  3PUF A;  1XWL A;  5C42 A;  4FJI A;  3LP0 A;  3SJJ A;  4HUF A;  1RNH A;  2Z1J A;  3ASM A;  1C0U A;  2Z1I A;  4RW8 A;  3TAF A;  2BGG A;  4DTJ A;  1C1B A;  4BWM A;  3OYH A;  4NYF A;  3ISN C;  4Z4G A;  2HHT A;  1KFS A;  3E01 A;  4CJ4 A;  4OKK A;  2JLE A;  4KV8 A;  4OLA A;  1RT4 A;  1ZBH A;  3TAP A;  4FCY A;  4FJG A;  1O1W A;  2KW4 A;  2NUB A;  3KLH A;  4DQP A;  1SL0 A;  5CZ2 A;  4DTP A;  4FLW A;  1HYZ A;  3AVC A;  4E1M A;  5SWM A;  4DTU A;  3U6F A;  4GW6 A;  3F73 A;  1D9D A;  2OYQ A;  5FRM A;  2DTU A;  4M41 A;  1S9G A;  4CEB A;  1GOB A;  5SZT A;  3VQ9 A;  3SV3 A;  2HB5 A;  4E7L A;  3KLF A;  3KK3 A;  2ZD1 A;  3S3O A;  2E6L A;  1EET A;  3NFA A;  2HHW A;  1BL3 A;  1KLM A;  3V9U A;  1NKE A;  1LW2 A;  2YKN A;  4B9U A;  4BE2 A;  4KHQ A;  3G0Z A;  4KB1 A;  1NK0 A;  3LAN A;  3OYN A;  1S9E A;  2HMI A;  4M3T A;  1FKO A;  4GVM A;  1HNV A;  2X6N A;  4CJV A;  1T05 A;  3RMD A;  1RT1 A;  4FM1 A;  3B6P A;  3BGR A;  4KPY A;  3LAL A;  4CF9 A;  4FK2 A;  4I7F A;  4DTO A;  1FXX A;  3S9H A;  3ZSZ A;  1IKX A;  1YVU A;  1CXU A;  1VK0 A;  4DFP A;  4FVM A;  3VQP A;  2YHB A;  4FW1 A;  3OYF A;  4HUG A;  1NKB A;  3O3G A;  3C94 A;  4DSF A;  4AHC A;  1ZBF A;  2D0A A;  4ICL A;  4N47 A;  1L3T A;  3LWM A;  2BE2 A;  3U3G A;  4EP4 A;  2XO7 A;  1U4B A;  4Y1D A;  1JLG A;  4FJ5 A;  4IG0 A;  4L8R B;  3NGZ A;  3SUQ A;  1NK6 A;  1LW0 A;  2G8I A;  3ZSQ A;  3AVH A;  2OPR A;  3AVJ A;  2KFN A;  1RDB A;  2OPP A;  5KTQ A;  4DQS A;  1L3V A;  4MQ3 A;  4E7H A;  4Z4F A;  4B9S A;  3HP6 A;  5J2P A;  2P1J A;  1BI4 B;  3OYL A;  5FRO A;  2OZM A;  1TKD A;  3ZSO A;  4DTN A;  4CJU A;  3B6O A;  2VG6 A;  3HVR A;  1RDA A;  1NK9 A;  1U48 A;  4O5B A;  3L2U A;  1XI1 A;  3I8D A;  1X9M A;  1X9W A;  4CJK A;  4CHP A;  1NJY A;  2KZZ A;  1EXQ A;  4DSJ A;  4OVL A;  1TAQ A;  3M8P A;  1QSY A;  3TI0 A;  2HHU A;  4LD0 A;  4CEC A;  1BIS A;  4FXD A;  1JLQ A;  3DLR A;  3L2Q A;  4ZTF A;  3K58 A;  4JLH A;  3K5N A;  2KQ2 A;  3AVL A;  4CK2 A;  1TK8 A;  3D0P A;  1B9D A;  5KRT A;  3IAY A;  4KHU A;  2GV9 A;  1VSD A;  1GOC A;  1A5X A;  1LAV A;  2XY5 A;  4BDP A;  4CGF A;  1EP4 A;  1WSE A;  3M8Q A;  2VWJ A;  3QEX A;  1VSJ A;  1U04 A;  4KRF A;  1B9F A;  3ZSX A;  1TKT A;  2YNF A;  1YTA A;  2IDO A;  5DMR A;  3L2W A;  3QEW A;  2QXF A;  3PX0 A;  5HRS A;  4YNQ A;  5T7B A;  1HNI A;  5KRS A;  1UOC A;  3LP2 A;  1WSG A;  1HYV A;  5HBM A;  4CGG A;  4ZHR A;  4O0J A;  4CHY A;  1IO2 A;  1HMV A;  2OPS A;  2Y1J A;  1NK5 A;  1T8E A;  4E89 A;  3KD1 E;  2KFZ A;  4O44 A;  4DU3 A;  2F8T A;  2X6S A;  3QIO A;  4KTQ A;  3ZT4 A;  3RR7 A;  4ID5 A;  1MU2 A;  4CF1 A;  1NKC A;  4FJ9 A;  4YFU A;  3TAN A;  5FDL A;  1NJZ A;  3QEP A;  3RMA A;  1ASW A;  2X78 A;  3HT3 A;  2FBY A;  3TAE A;  4KB0 A;  4FK4 A;  3AA4 A;  2JGU A;  4Z4E A;  3SZ2 A;  4JRP A;  3MEC A;  3AVF A;  3QEI A;  1X1P A;  4FJH A;  1TL1 A;  2YHA A;  1SL1 A;  3I0S A;  3NGY A;  4CJP A;  1TKX A;  4KI4 A;  4FLV A;  1VSM A;  4CEO A;  4DFM A;  1Q9X A;  3DLH A;  1U45 A;  4F4K A;  2IOC A;  3CG7 A;  3AO5 A;  1TL3 A;  1T03 A;  2GBZ A;  1CXQ A;  3L2R A;  1D9F A;  2G8V A;  4KHS A;  1RT2 A;  4KI6 A;  4FJM A;  1BIU A;  1RBU A;  3AA2 A;  4CHO A;  4KHN A;  2G8H A;  4DQQ A;  3AVB A;  3L8B A;  1QS4 A;  2A1S A;  4CGD A;  3HPO A;  4DFJ A;  1NK7 A;  3V1O A;  4B3O A;  4M3Y A;  1JLC A;  3T1A A;  4BWJ A;  3OYK A;  1XHZ A;  4DF8 A;  3KIO A;  3AO1 A;  2KZM A;  3S3M A;  1RT3 A;  1S6Q A;  4Z0U A;  1J5O A;  4LH4 A;  2PZS A;  4CES A;  4CFB A;  4N5S A;  3OYB A;  3EY1 A;  3O3H A;  1ITG A;  1RT7 A;  1BQN A;  2Z1H A;  1WNS A;  1HYS A;  4DTX A;  3DLB A;  4CGJ A;  4E7I A;  2G8K A;  3RWU A;  4KHY A;  1RTI A;  3WNH A;  3CFP A;  1C0T A;  1QE1 A;  5J2M A;  4TSX A;  1UWB A;  3D45 A;  3T19 A;  1QTM A;  3VQB A;  4CF8 A;  1IKV A;  3NF7 A;  3CM5 A;  4F3O A;  3KLE A;  4J2E A;  1J54 A;  2Y1I A;  2QK9 A;  3C6T A;  3TAG A;  1QSL A;  2P5G A;  5CYM A;  4M3X A;  1K6Y A;  3CFR A;  1VSL A;  3KLG A;  3DOL A;  4FJX A;  2AJQ A;  1SKW A;  1RBR A;  4CHQ A;  4B9T A;  1SL2 A;  4AHV A;  2YV0 X;  1NJW A;  4HHT A;  3EZ5 A;  4FLT A;  4I9L A;  5C25 A;  3OYJ A;  2F96 A;  1Q9Y A;  4DFK A;  1UA1 A;  2F8S A;  1XC9 A;  3HM9 A;  4KAZ A;  3NAE A;  4E19 A;  4IG3 A;  3QEV A;  3K2P A;  1IKW A;  3H08 A;  4RG8 A;  1JL1 A;  3WNG A;  1G15 A;  4DTM A;  1ZBU A;  2D5R A;  2DFE A;  1F21 A;  2IC3 A;  2XY7 A;  4LH5 A;  4FJ8 A;  1EX4 A;  3V9S A;  4Q5V A;  4CK1 A;  3A2F A;  2GUI A;  3DRP A;  4DSE A;  3BDP A;  4CER A;  4J2B A;  3L3V A;  5CYQ A;  4GMJ B;  1VSI A;  1LAW A;  2BDP A;  4FM0 A;  1Q8I A;  3O4Q A;  2RF2 A;  5K14 A;  3KJV A;  3DLE A;  3QNN A;  1WAJ A;  4H4M A;  1X9S A;  1QHT A;  2HHS A;  4LSN A;  1U47 A;  3JYT A;  3P5J A;  3FFI A;  3ZSR A;  3OJU A;  4CHN A;  1TV6 A;  3VN5 A;  4DS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...