3U3YA

Mouse trex1 d200h mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
215
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Three prime repair exonuclease 1
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 215
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u3yA01
5HP1A 4N56A 1FKPA 3ZSQA 1EKEA 2VG6A 4CF1A 3LWMA 2G8VA 4KB0A 1Z26A 4EP4A 4IBNA 2G8FA 1JLQA 2YNFA 3QINA 3CFOA 3TARA 1N5YA 2BDPA 3B6OA 4KHNA 4CJEA 1S9GA 1BIUA 3ZSVA 4FJKA 1HNVA 4CE9A 1KRPA 3DLEA 3VQ5A 5KGWA 4M45A 3P1GA 2F8SA 3OYKA 1L3SA 3SV4A 3RR8A 5CZ2A 1GOCA 4DQPA 4JS4A 1ASVA 1JLBA 4IG3A 4N47A 2XRIA 1IO2A 3AVHA 1XHZA 4RW9A 4CEAA 3LWLA 3L8BA 4CF0A 3L2WA 3HP9A 1BISA 3P83D 2KTQA 5KRTA 3TAMA 4FXDA 3ZSWA 2EHGA 4O4GA 4ZTFA 4ID5A 4DWIA 4FK0A 4BDZA 1CZBA 1XI1A 3NH0A 4AHSA 2HHXA 1Q8IA 1TKZA 3NF7A 2HVHA 3VQQA 2KZZA 2G8WA 4CHOA 4CJFA 1QHTA 2Z1JA 3L3VA 4FLZA 4FLUA 4W5RA 3VN5A 3NF6A 1FXXA 5HBMA 4BWMA 4DFJA 3DRSA 1RTJA 1D5AA 3FFIA 1TVRA 1YT3A 3AO2A 3D45A 2HMIA 1UA1A 1JXBA 2HHSA 4EZ9A 3ZSRA 3T19A 2I5JA 1WSIA 3AVGA 1IKYA 1JLEA 1S1XA 1WSGA 1LWFA 3VQAA 2YNIA 3O3FA 1ITGA 3OYLA 4FM0A 5HRPA 1TKDA 1BCOA 4CF8A 4C8LA 1UAXA 5EU7A 4CIFA 1BCMA 3DLBA 4FW2A 3ZSOA 1EX4A 2F96A 4CEFA 1RTHA 3K59A 1QSLA 3LAMA 3EZ5A 4HTUA 4TSXA 1S5JA 4AHVA 4YFUA 3PX4A 1JL2A 1SL1A 1J53A 2O4IA 3LP2A 4O0IA 4E1NA 1EETA 4CGFA 4RW6A 1ZBFA 1T05A 3LZIA 3E01A 4I9LA 3L2RA 4KAZA 4J2AA 2QK9A 1I3AA 4O55A 2Y1JA 4LH5A 1RT1A 4KHYA 4L8RB 3SQ4A 3THVA 4HCCA 4FJ5A 2Z1HA 3DOLA 3QERA 3IAYA 2E6MA 3SCXA 1HYVA 4B08A 1F21A 4W5NA 3RMAA 3MXJA 4NCGA 2E6LA 4JLHA 4CJPA 1NK8A 1SKWA 4CEDA 4DS4A 4DTNA 3QIOA 4QAGA 4E7LA 4OKJA 3U6FA 1LW0A 2VG7A 1LV5A 3DLHA 5D3GA 1I39A 3K5MA 2DY4A 1RT5A 1GOBA 1RT7A 1VRTA 3ULDA 3JYTA 1BL3A 1DTQA 1Y97A 3AVBA 3HPGA 3NAEA 4CFDA 3LZJA 1RDBA 1C0TA 1WLJA 2KFZA 2G8UA 3ZCMA 4I7FA 4KB1A 4IKFA 3U3GA 4E0DA 2DFFA 5HRSA 4K8XA 3QIPA 3TWHA 4CJVA 3OYDA 4B9NA 2G8HA 4CGIA 3ALYA 3C95A 1NK7A 3RMBA 4DSKA 3KD1E 4FZYA 4M3XA 3AA2A 1C1CA 1JLAA 3MEDA 1J54A 2YNGA 3SYZA 1SL2A 2QKBA 1RBSA 4FJMA 1W0HA 2IGIA 2ITGA 3SPZA 5HLFA 2ZE2A 4FLWA 3VA3A 1IKXA 1NJWA 1NK6A 1L3UA 4ELUA 3D0PA 3O4NA 4RW8A 3I0SA 1RDCA 1SKRA 4OJRA 1HMVA 2PYJA 4KHWA 4FLVA 4DSEA 3K5LA 1U04A 3AA4A 1NOYA 3PO5A 1VSIA 3VQBA 3ZT4A 1U48A 3RR7A 4R5PA 3KD5E 2AJQA 1RBVA 3TAEA 1WNSA 1LAWA 4CJ5A 1QQCA 2Q3SA 2IC3A 4CJ3A 2P5OA 4OLBA 2BE2A 4H4MA 4C8OA 2IDOA 3K5OA 2P1JA 4C8MA 3AO1A 2HB5A 3TI0A 4CHQA 4CHYA 1KVAA 4FJIA 4M3RA 2XHBA 4JRPA 4M42A 2D5RA 5C42A 3NGYA 5SZTA 4Z0UA 3V9SA 1X1PA 2XY6A 3DOKA 5CZ1A 2HHUA 1HNIA 2EX3A 4EZ6A 4B9UA 4M3ZA 1EXQA 4FK4A 1YVUA 4FJXA 2HHWA 1KVBA 3I0RA 1NJXA 4CK1A 4F2SA 4CJRA 2ATQA 4CFAA 4F3OA 4Z4CA 3LP3A 1VSHA 1HPZA 1CXQA 3AVAA 2D0AA 3PV8A 1J5OA 4FJ8A 3ITHA 3NBPA 2DTUA 5KGXA 4B9VA 2WONA 1BGXT 1KLNA 4LSNA 4CGJA 2WOMA 4BE1A 1YTUA 1MU2A 4B9SA 1S6PA 4DSLA 3V9XA 3OVNA 3NFAA 2XY7A 3S9HA 4NCBA 3NH1A 2LSNA 2P5GA 4FJ9A 1CZ9A 1TGOA 2FC0A 4F3TA 2BGGA 1RT3A 1WAFA 4LSLA 4O0JA 4Q5VA 4DF4A 3VA0A 4CIEA 2OZMA 2O4GA 4F2RA 1B92A 1KTQA 3S3MA 4DG1A 3HXMA 3ZSYA 3HO1A 1SL0A 4PQUA 4I2QA 1VSKA 4FJNA 4M3UA 3HT3A 2XO7A 1SKSA 4CF9A 2RKIA 4OGEA 3M8SA 4O5BA 3OYFA 4DQSA 2OYQA 2KW4A 1RT2A 3LAKA 3PO4A 3TAGA 1R0AA 3CG7A 1RTDA 4F4KA 1SV5A 1VSDA 4RW4A 4CESA 4CGDA 3OJUA 3K57A 5KTQA 3AO5A 3LANA 1NK9A 4Q0BA 5FRNA 4CEOA 1BI4A 3S3OA 1QTMA 2KZMA 4WE1A 1U47A 3RMCA 4DFMA 1GOAA 3QEVA 4Y1DA 4FZZA 3DI6A 3M8PA 1VRUA 1Z25A 3WNGA 2QXFA 4CGHA 3HPOA 5FROA 3VQEA 3M8RA 4FCYA 1VSFA 2GBZA 3MXMA 1N6QA 1BIZA 3G10A 3LPUA 3PUFA 4OVLA 3L2QA 4BDYA 3V9UA 1ASWA 2Z1IA 4MQ3A 4CJKA 3OYBA 5HROA 3DLKA 1L3TA 2Z1GA 1TAUA 3MEGA 1JLGA 3QNOA 1XHXA 4CJ4A 3K58A 3AVMA 4RW7A 5HRNA 4PY5A 2Y1IA 3LP0A 4FM2A 1LWEA 3TAFA 1VSJA 2HNYA 3TR8A 1WN7A 2OPPA 4OPJA 1JXEA 1NJYA 4DLGA 3MAQA 3HSTB 3NHGA 1RDDA 3O3GA 1D9DA 3RWUA 4PUOA 3ZT3A 4Z4IA 3RTVA 2HW3A 1LWCA 5J2PA 1NJZA 3G0ZA 4FK2A 4C8NA 3WNFA 3QO9A 4GW6A 3QEXA 1NKBA 5KRSA 2B4JA 1G15A 4GVMA 1KFDA 3AVIA 3V9WA 3TAQA 4BDPA 4AHCA 4W5OA 3UIQA 1BQNA 2G8IA 1KFSA 2OZSA 3IG1A 1TK8A 4KTZA 3I8DA 4FW1A 3SUNA 1ZYQA 3K2PA 5CYQA 1C0MA 3KLEA 1BHLA 1C0UA 3LPTA 5DMRA 4DFKA 3AVCA 1VSEA 1HQEA 2XY5A 1RT6A 4KI4A 4DQQA 2FBVA 1L3VA 4ELTA 4ZHRA 1KLMA 3ZT2A 3HP6A 4W5QA 4FJHA 3VQPA 1W9HA 3HM9A 1CLQA 1U45A 1X9SA 3VQ6A 3OYIA 3V1OA 1A5VA 1T03A 2D0CA 1NK4A 3SUOA 3C94A 3DLRA 1WSHA 3AVLA 3AV9A 4JS5A 1QSSA 2OA8A 4N76A 1C1BA 3KIOA 3QLHA 3V81A 3CM5A 4CJWA 3L2UA 3V6DA 2VWKA 3TAPA 4DMNA 4CECA 4CHNA 4DTXA 2IS3A 3MECA 3SUQA 3V4IA 3QNNA 3ASMA 1TL1A 4CHPA 5JS2A 5E41A 3OJSA 4H8KA 3HYFA 3WNEA 4CFBA 1UWBA 1RT4A 3CM6A 1NK0A 3L3UA 3HK2A 2XY8A 1D8YA 3RRGA 2YKMA 2YKNA 3SQ2A 1ZBLA 3AO4A 1RBUA 3KK3A 2NUBA 4GMJB 1HYSA 1QE1A 2FBXA 3CYMA 4J2EA 1KSPA 3A2FA 4M3YA 3CFRA 4N41A 4AILC 2F8TA 2DFHA 3NE6A 4E7IA 4DSFA 4KHQA 2KFNA 3VQ7A 3KJVA 4E1MA 4AH9A 4XIUA 1B9DA 4DLEA 5HRRA 3SUPA 3KKRA 2G8KA 2W42A 4KRFA 1SUQA 3DRPA 4B8CA 3HJFA 4BACA 2RN2A 4BE0A 2P51A 5I42A 4HCBA 3DRRA 4DSJA 1RDAA 3AVNA 4I9QA 1RNHA 1O1WA 3KTQA 1JLCA 1NK5A 4J2DA 2HVIA 4IFYA 4FYDA 4IDKA 3SI6A 4E7HA 4E7JA 4RG8A 3T3FA 1L5UA 3DMJA 3OYAA 4G1QA 3PX0A 4KHSA 2BANA 1CXUA 4DTOA 2B6AA 3B6PA 1Q9XA 1S1UA 4NYNA 3SPYA 3DLGA 1WSEA 1HYZA 4HVJA 1VSMA 4KPYA 4B8AB 3OS0A 3OS2A 4KTQA 3OYGA 4BWJA 1WSJA 3QEIA 2VWJA 4NCAA 4Z4GA 4H4OA 4KKOA 1S6QA 4E19A 1NKEA 1U49A 1HJRA 4N5SA 3NDKA 3VQ8A 3SZ2A 1J9AA 3KK2A 4HHTA 4DS5A 2HHTA 5JS1A 2IAJA 2D0BA 3KLIA 2GV9A 1IH7A 4HUGA 4KREA 3LALA 2A1SA 1IKVA 2GUIA 4CGGA 4FJLA 3AVKA 4LY7A 4DU3A 1REVA 3SV3A 3RMDA 2PZSA 3CQ8A 3RRHA 5K14A 4AHRA 3AA3A 4KFBA 3JSMA 3TANA 1A5XA 2YHAA 1TK0A 3F73A 2HHQA 1FK9A 3KLFA 1FKOA 1S9EA 4MFBA 1A5WA 3EYZA 3AVJA 5J2QA 3AA5X 1S1VA 3H08A 3KK1A 4DQRA 1C6VA 4FLYA 4FLXA 1TL3A 4CIGA 1T8EA 1HQUA 1VSLA 2KQ2A 1LW2A 3DM2A 4KO0A 2VG5A 4ICLA 3VQDA 3TABA 4EP5A 1DLOA 5CYMA 2JLEA 4J2BA 4B3OA 2YV0X 4W5TA 3CFPA 4FJ7A 4B9TA 2IOCA 2JGUA 4KHUA 1JLFA 2FBYA 1IG9A 5J2MA 3V9ZA 1QSYA 2HNDA 1VK0A 4CJUA 4DTSA 1LAVA 2HHVA 1B9FA 5I3UA 1TAQA 3BGRA 3IRXA 5C25A 4B9LA 3C6UA 2X78A 4ELVA 4AHTA 4FJJA 4Z4HA 4FJGA 3T1AA 2X6SA 1EP4A 1QS4A 1RBTA 3AVFA 5FRMA 1TKXA 4AHUA 2X74A 3VQ9A 3LP1A 2X6NA 4CJSA 5FDLA 3HPHA 3O3HA 3QEPA 1X9WA 1ASUA 4DTJA 1BQMA 4KI6A 1WAJA 4CJLA 4Y1CA 3M8QA 4ID1A 4CEQA 3NH2A 3S3NA 4CJQA 4DTMA 3SNNA 3OYEA 4IFVA 2RPIA 2PYLA 5SWMA 2E4LA 4CF2A 5J1EA 4LD0A 4UQGA 3KLHA 4HUFA 4FLTA 3O4QA 3SJJA 5J2NA 3KKSA 4OGCA 1RBRA 1BI4B 1RCHA 3DYAA 4FVMA 4PA1A 4CJTA 5T7BA 4HUEA 4DU1A 4OKEA 1Q9YA 4DTPA 1C1AA 3HVTA 2YHBA 3NF9A 4OPKA 3OYMA 1UA0A 1S1TA 1TV6A 2OPRA 4O44A 1U4BA 4DTRA 4K8ZA 4PWDA 4CEBA 3OS1A 4KTWA 3V1RA 4F8RA 3ZSZA 4Z4FA 3VQ4A 2R7YA 4CEZA 4QOZB 3QETA 3P5JA 1RTIA 4YNQA 4CCHA 3EY1A 3NGIA 3MXIA 1WSFA 3U3YA 4DQIA 3PY8A 3QESA 4E7KA 1RILA 2HNZA 3KLGA 1ZBUA 2B5JA 3C6TA 3OYNA 3OYHA 3OYJA 4NYFA 4M3TA 3WNHA 1XWLA 2A1RA 1ZBHA 3ZT1A 3QEWA 1YTAA 1NOZA 2FBTA 4DU4A 4OLAA 5DK5A 1KCFA 4LH4A 1HRHA 2RF2A 2QKKA 3SQ0A 4M3WA 1KVCA 3F9KA 5KI6A 3NF8A 3OY9A 4OKKA 2ZQBA 3PX6A 4C8KA 4Z4EA 4CERA 4QCLA 1K6YA 4DTUA 4IG0A 3BDPA 1JL1A 1T7PA 1JKHA 3OYCA 4CK2A 2OPQA 1TK5A 4FZXC 4B9MA 3L2VA 2YNHA 4E3SA 3ISNC 3HVRA 4CEEA 4DFPA 1D9FA 3SQ1A 2PY5A 1NKCA 1UOCA 5CY4A 1IKWA 3ZSXA 1TKTA 3K5NA 3NCIA 4DF8A 4CFCA 3V1QA 3IS9A 4I2PA 3VQCA 3HL8A 2ZD1A 5C24A 1DTTA 4KV8A 4CHZA 4CK3A 4BE2A 1ZBIA 4FM1A 3NGZA 2ETJA 2OPSA 4E89A 1X9MA 4ZTJA 4M41A 2DFEA 3LDSA 3MEEA 3AO3A 1XC9A 3ZT0A 1S1WA 4JRQA 4DSIA
chains in the Genus database with same CATH superfamily
4JKDA 5AZIA 4N56A 5LMUK 3T69A 2E1YA 3WXIA 4BREA 3QINA 5GAGP 2BDPA 1BA0A 4CJEA 1S9GA 3DLEA 4M45A 3ZEUB 1VQ4N 3QB0A 3RR8A 3LM9A 5ELZA 1JLBA 4IG3A 3CCEN 3LWLA 1EO1A 3O4WA 5BRFA 3Q7BA 4PKHA 4DQ8A 4PKGA 4I6MB 4FXDA 4ZTFA 3RSEA 1P90A 5BRHA 1CZBA 3NH0A 5LL6Z 4XH1A 4M7YA 1EQYA 1TKZA 4CHOA 2QW9A 5F0XA 2Z1JA 2Q0UA 4FLZA 4FLUA 3HI0A 5BREA 3VGLA 1TVRA 1ZBSA 3U9ZA 3AY9A 3D6RA 2WTUA 3ZSRA 1G99A 4M7XA 3MK6A 3I8BA 1YI2N 1IKYA 3VERA 4B1UB 1T8EA 2HHSA 1LWFA 4H5VA 2YNIA 3OYLA 5HRPA 5AQUA 4RTFD 4CF8A 4M63C 2YJFA 1BCMA 3F2KA 1W97L 1RTHA 1QSLA 2P9IB 3LAMA 4AHVA 2HF3A 4YFUA 4H0OA 3LP2A 3CCLN 1EETA 3LZIA 4O55A 2Y1JA 3KWIA 1RT1A 3THVA 4HCCA 2NRZA 5AQXA 4CJ7A 3H45C 3FR0A 4CEDA 4AM6A 3HBTA 3PSFA 4E7LA 2NRXA 1LW0A 5D3GA 1TUYA 4QS7A 5MLCQ 1RT7A 3GG4A 1BL3A 2A3ZA 4CFDA 3LZJA 4LF4K 1C0TA 5AQHA 1I94K 5HRSA 2G8HA 2WFBA 3RMBA 3KD1E 4IZ9A 4QS8A 3MDQA 4BRCA 4JI8K 1W0HA 3SPZA 3OA9A 4X66K 4LF7K 4ELUA 5TKYA 3ZX2A 3I0SA 1SKRA 1VHXA 3P31A 4KHWA 3K5LA 4IO8A 3ZT4A 1U48A 4R5PA 4JNEA 4IXCA 2O8BA 4OLBA 3DXKB 4WYBA 2P5OA 2Q3SA 2IC3A 4CJ3A 2BE2A 4H4MA 2IDOA 1OVYA 3H3OB 2P1JA 4CHQA 3WXLA 1YUWA 4CZIA 3UKUA 4GKJK 3NGYA 3CC2N 3AGKA 3OHRA 3U9DA 4JK7A 4M3ZA 4WFBL 1VQMN 1YVUA 3FZMA 3I0RA 1NJXA 4CK1A 4CJRA 1NGFA 1HPZA 3R1XA 3M3ZA 5AQWA 3NBPA 5KGXA 1BGXT 4CGJA 3BY5A 4NB4A 2XY7A 3NFAA 4IWVA 2VQFK 4FJ9A 2D1KA 3SAHA 1TGOA 4CIEA 3IFRA 3I55N 3ID8A 4CF9A 2RKIA 4OGEA 3OYFA 2OYQA 3QBWA 3PO4A 3CG7A 4CGDA 1YJNN 3K57A 3AO5A 3LANA 3R9PA 1NLVA 1BI4A 4BR4A 1U47A 4EHTA 2O8FA 4Y1DA 3A0IX 1T3VA 1ILYA 4DS5A 1SQKA 4E0DA 3CHWA 4BDYA 2Z1IA 4MQ3A 2QTDA 1M1KO 4A2AA 5HROA 1L3TA 1K9MO 3MEGA 1J5EK 4CD1A 4CJ4A 5C2DA 2HHHK 3LP0A 3MCAB 4FM2A 1R59O 3TR8A 5IT9O 3MAQA 3AAPA 1GLJO 3NHGA 3O3GA 4PUOA 4Z4IA 1FJGK 5AJ3K 1BA1A 1XNQK 5J2PA 3WNFA 1Z6RA 3HSCA 1BOTO 4YY3K 4IO9L 4KH5A 4LF6K 3A8YA 1KC8O 3DJCA 2E88A 3UIQA 1BQNA 4JEPA 5AQKA 4CZHA 1BHLA 4DFKA 3AVCA 4BRAA 4KI4A 1YIJN 1HNWK 3ZT2A 3HP6A 4JYAK 3LDLA 3KVGA 3VQ6A 3C94A 1NM1A 2YHWA 1QSSA 4N76A 5AQSA 3V81A 3CM5A 4CJWA 4DMNA 2EWSA 3SUQA 3ULEB 5EOYA 3OJSA 5JS2A 5E41A 3HYFA 3L3UA 1NGDA 1D8YA 2O8DA 2YKNA 3CD6N 3AO4A 2NUBA 4KBOA 1KSPA 4B1VA 2QWQA 3DXMB 2DPNA 1EWQA 2DFHA 3MX2A 4E7IA 4DSFA 4KHQA 3TPQA 2P9LA 4E1MA 4AH9A 3MWPA 4L3QA 1QVGM 2WBNA 4JKHA 5HRRA 1XNRK 2G8KA 2W42A 1IBMK 4B8CA 2RN2A 4H03B 2P51A 3SMPA 1Y64A 3DRRA 4DUZK 4FYDA 2QWNA 1KAXA 1NJIO 1L5UA 4J8FA 2BANA 1CXUA 2B6AA 4NYNA 2GELA 4HVJA 1VSMA 4Y0WA 4WQ5A 3OS0A 1Q81O 3S41A 3CJCA 3T7ZA 1WSJA 2VWJA 4NCAA 4C8OA 1S6QA 2Q31A 3NDKA 3SZ2A 4HHTA 2E2OA 4BRDA 3VOVA 2HHTA 2D0BA 3U8XA 1N33K 4HUGA 1IKVA 2GUIA 2UXCK 3AVKA 3O9TA 2RHKA 1REVA 3RMDA 1S72N 5K14A 2UXDK 3JSMA 1A5XA 4B1WB 4WQ4A 3AA5X 4JAXA 3KK1A 4DQRA 2FF6A 3LDOA 4YDUA 2A6AA 5AFUH 4FLYA 4FLXA 2BTFA 1NGEA 1LW2A 4MLEA 4B3MK 2VG5A 1OKJA 4ICLA 4EP5A 1DLOA 2JLEA 1M90O 2YV0X 5M1KA 3CFPA 5BPLA 2V7ZA 3ENBA 2FBYA 3V9ZA 2NRHA 3C6HA 1VK0A 4DTSA 1LAVA 4JI1K 1B9FA 3IRXA 5C25A 2VCPA 2X78A 5AFUA 3WT0A 5M1OA 2X6SA 4R79A 5FLXO 3VQ9A 2X6NA 1ATSA 1X9WA 3O3HA 5HOOA 4ILJA 4CJLA 1DKGD 4CEQA 1S3XA 3S3NA 4OO1J 3OYEA 2RPIA 2PYLA 3CCQN 4FLTA 3KLHA 4MDBA 4HUFA 2W6LA 3O4QA 3SJJA 1RBRA 4O8KA 5T7BA 4FVMA 4DU1A 4CJTA 2O8CB 4OKEA 1C1AA 2O8EB 2HBMA 1SZ2A 1S1TA 1TV6A 2OPRA 1N32K 3V1RA 4F8RA 2FSJA 1RTIA 4YOYA 3VESA 3MN6A 3NGIA 5EVZA 1GLCG 1WSFA 4E7KA 2HNZA 1E4FT 4H0PA 4JD2A 4DU4A 3SK3A 1HRHA 2QKKA 3OY9A 4OKKA 3PX6A 3CPWM 5EXWA 1K6YA 3BDPA 3EL2A 1T7PA 3OYCA 4LC9B 5GIPA 3VTIA 4FSVA 4CEEA 1YJWN 1NKCA 3NVMA 5CY4A 4LFAK 1VQ5N 4DF8A 5C12A 1S22A 1V4SA 4KH6A 3EKSA 4CHZA 4BE2A 2ETJA 2F9WA 4M41A 4DCHA 4JRQA 3VEXA 2VG6A 3LWMA 4IBNA 2G8FA 1JLQA 2YNFA 2HBLA 4XH4A 2ITMA 1BIUA 4CE9A 1KRPA 4O8UA 5KGWA 3WQTA 2F8SA 3SV4A 4Z94A 1WBDA 4DQPA 3P4IA 3M6GA 4JS4A 3VETA 1IO2A 2P9NB 1XHZA 3L8BA 3L2WA 4H0TB 3HP9A 2UU9K 3WEEB 3OBWA 2KTQA 3ZSWA 2EHGA 1JCGA 2QM1A 4ID5A 4FK0A 3ATUA 2NRTA 4BRLA 3EKUA 3A5MC 1Q8IA 4CJFA 2E2NA 1QHTA 3ZETA 3L3VA 3O9UA 4WFAL 1C0GA 4IJNA 4FWNA 4H5WA 1FXXA 2ASPA 3Q7CA 3J81O 1YT3A 3AO2A 3P38A 4K41A 3T19A 2I5JA 3CERA 3D2FB 1BG3A 1JLEA 4FM0A 3BF1A 4JKFA 4C8LA 2V51B 3I33A 4C1NK 4AM7A 1LOTB 4CIFA 3ZSOA 1EX4A 4CZGA 2F96A 2P9SB 3K59A 1JL2A 1J53A 2E2QA 4E1NA 3D2EB 4RW6A 1T05A 3E01A 4BVOA 1VQ8N 3CC7N 2VGNA 4DKWA 4KHYA 4ISGA 4FJ5A 4DV0K 3DOLA 2E6MA 1NMDA 2YJEA 3MXJA 4CJPA 4GVEA 4B3SK 4DS4A 5F2RA 4OPAA 4OKJA 1GOBA 4FWSA 4MLHA 5M1NA 1Y97A 3NAEA 1QZ5A 1WLJA 2KFZA 4I7FA 4KB1A 4UY8O 1U2VA 4PHTX 3CXCM 3QIPA 3OYDA 3ALYA 3R8EA 3SJHA 3ZX3A 4DSKA 3N4PA 3WQUA 2UYTA 3ZLJA 4FZYA 4M3XA 3SYZA 1JLAA 2YNGA 1SL2A 1RBSA 4FOIA 3RVCA 2IGIA 2V52B 3VA3A 1NK6A 2Q0RA 3O4NA 3D0PA 3FZKA 4RW8A 1RDCA 2FF3B 4OJRA 3WXKA 3RR7A 3MCPA 5BR9A 4YHHK 1RBVA 3VEOA 3TAEA 1WNSA 1LAWA 5FPDA 2CH5A 2HB5A 4WCEL 2XHBA 2F7TA 2ZF5O 3BEXA 4JKGA 1HNIA 3OBYA 4EZ6A 4B9UA 1VQ9N 1EXQA 1NGIA 4FJXA 3NMUA 3UKRA 3G25A 2FLOA 2HSTA 2NRRA 2ATQA 3PV8A 1KAYA 2WONA 3CCUN 1KLNA 1U2VB 4BE1A 3V9XA 3OVNA 3S9HA 1VQLN 4NCBA 2LSNA 2FC0A 1WAFA 4O0JA 4LSLA 2F9TA 4Q5VA 4DF4A 3E9PA 1B92A 2Q97A 4DG1A 3VPZA 3HO1A 4X64K 3F5TA 4EIAA 4FJNA 4GKKK 4FWLA 4O5BA 3TTFA 1RT2A 5EY4A 3TAGA 4LF5K 4RW4A 5KTQA 5BN9A 1NK9A 3S3OA 3ZX0A 1DEJA 3RMCA 4DFMA 4BR9A 4FZZA 3DI6A 4FCYA 3K9KA 5AZIB 3M8RA 2GBZA 3MWTA 1N6QA 3G10A 3LPUA 1ASWA 4CJKA 1VQNN 3T1YK 5ADXA 1MA9B 4DR7K 1XHXA 2ZGYA 3AVMA 4RW7A 3UKRB 2KKZA 2ZGZA 1HR0K 3HRGA 1LWEA 1IJJA 4DV1K 1WN7A 1NJYA 3O6WA 3RWUA 1JCFA 2UUBK 3ZT3A 4NXMK 4IFEA 1NJZA 4C8NA 4GW6A 3CI5A 3M1FA 4JK8A 5KRSA 1G15A 3V9WA 1KFDA 4W5OA 2G8IA 4BRPA 3RSEB 4DR4K 2OZSA 4KTZA 3I8DA 3SUNA 3KLEA 1C0UA 4K25A 5AQVA 3NVKA 1VSEA 5E26A 1RT6A 4XEIA 4ELTA 4W5QA 1CLQA 4BRHA 3OYIA 2FSKA 3V1OA 1A5VA 3SUOA 3DLRA 1WSHA 4BQLA 2OA8A 4BVPA 3QLHA 3VEYA 1OVQA 3H3NO 5JMVA 4BRFA 3CC4N 4DTXA 1VQON 2IS3A 3MECA 5AQNA 2A40A 3CCJN 5KPTA 3V4IA 3ASMA 1NGHA 4H8KA 3CM6A 1RT4A 1NK0A 3HK2A 2W40A 2YKMA 2P9PA 1ATNA 5C10A 1HYSA 2FBXA 3CYMA 4FVUA 1YXQA 3A2FA 5AQLA 3CFRA 4AILC 3KWGA 2UUCK 4FWRA 3VQ7A 3O1WA 5AQGA 1B9DA 4XIUA 4IEEA 1WB9A 4BACA 1Q86O 3W3DA 5TKWA 4LF8K 4DV7K 1RDAA 3AVNA 1RNHA 3KTQA 2HVIA 4IFYA 3UE5A 1HPMA 3OYAA 4G1QA 1W7AA 4DTOA 1Q7YO 3DLGA 4CZEA 1W2BM 4KPYA 3QEIA 1QQNA 4Z4GA 5BRDA 4KKOA 3JS6A 4N5SA 3VQ8A 3KK2A 2IAJA 4A2BA 2GV9A 4JI2K 4FJLA 1NMNA 3AGRA 2O8BB 1TYQA 4WQ5C 3CQ8A 3KHYA 3RRHA 2KLAA 4AHRA 3AA3A 3FZHA 4X65K 1TK0A 2QA4N 1K8AO 1FK9A 3KLFA 3UKUB 1S9EA 3O8MA 1A5WA 3AVJA 5J2QA 5BR8K 1S1VA 1C6VA 2I7NA 3VGKA 1VSLA 2KQ2A 3DM2A 4KO0A 3VQDA 3TABA 4LFBK 4H5TA 1XC3A 4W5TA 4FJ7A 2IOCA 2JGUA 4KHUA 2QEXN 4MO5A 1QSYA 3J8AA 4WQ4C 3VF4A 2HHVA 4F2RA 4B9LA 2AP1A 4YDUC 1P8ZA 1EP4A 1RBTA 4DV3K 4B3TK 4AHUA 3SBTA 4CJSA 3HPHA 4OPHA 4DTJA 4KI6A 4B1ZA 4JK9A 4X62K 4CJQA 4DTMA 3SNNA 4CF2A 5J1EA 2JWKA 3A5NC 4A5BA 3KKSA 4OGCA 4PA1A 1BI4B 1RCHA 3O5BA 2Q2RA 3VGMA 4DTPA 2O8FB 1VAZA 2YHBA 4OPKA 3L6QA 4DTRA 4K8ZA 4CEBA 4KTWA 3EE9A 3EY1A 3U3YA 1X9JA 4DQIA 3PY8A 3O08A 4XH5A 3KLGA 1NNEA 3OYNA 3OYJA 4K0KK 4CZLA 4M3TA 4BG9A 1NOZA 1ZXOA 4OLAA 4ISEA 1HNZK 2RF2A 2GUPA 3F9KA 2ZQBA 4C8KA 2E2PA 3HOTA 4IG0A 2OPQA 1TK5A 3CCMN 4IEIA 1NG9A 3HVRA 3HZ6A 4YOVA 3SQ1A 3T1HK 1RDWX 2F4VK 1IKWA 2VQEK 1T6DA 4FO0A 3NCIA 4DR1K 4CFCA 3V1QA 3QBXA 3HL8A 2ZD1A 3VQCA 1DTTA 4CK3A 5FPEA 5GADP 3NGZA 4H5RA 4E89A 3GL1A 3MEEA 3ZT0A 1RDUA 5HP1A 1FKPA 4CF1A 5A2QO 1Z26A 4EP4A 3TARA 2YCHA 3CFOA 1N5YA 3A5OC 3B6OA 4KHNA 3ZSVA 3PLAA 4NLBA 3VQ5A 3BZKA 3OYKA 1L3SA 2OTJN 2O8DB 3G6EN 1X3MA 4N47A 3VEZA 3AVHA 2NRVA 2YHYA 4RW9A 4CEAA 4BY9C 3CIPA 2P9UA 5KRTA 3TAMA 4DWIA 4O4GA 2P9LB 1XI1A 3OTOK 2HHXA 3IDHA 2HVHA 3VQQA 2KZZA 2G8WA 4W5RA 3VN5A 3NF6A 3DLLL 4HWIA 3DRSA 1RTJA 1D5AA 5H1SQ 2YHXA 3GOIA 3E9LA 3D45A 2HMIA 3MN5A 4CBUA 3K9JA 3AVGA 1S1XA 1WSGA 1TKDA 1BCOA 5EU7A 3HTVA 1QQOA 4FW2A 4DV6K 3DLBA 4NXNK 3PX4A 4TSXA 3QFPA 5M1QA 2GWJA 1DT9A 4CGFA 2UXBK 1BWFO 1ZBFA 3QFUA 2QK9A 3CJBA 1YVNA 5BPNA 5LY3A 4L8RB 2ZJPL 1N34K 3IAYA 2HBKA 3TTCA 3SCXA 4B08A 1F21A 3RMAA 4NCGA 2E6LA 3CCRN 1NK8A 1YAGA 3U6FA 4GV6A 2DY4A 3P39A 1I39A 1RT5A 1VRTA 5AR0A 1HKGA 4YOUA 3AVBA 5JVHL 1J6ZA 4IKFA 2DFFA 4K8XA 5C0YA 2WC9A 4CJVA 3OW2M 5AQIA 1TUUA 3C95A 4DV5K 3A5LC 4E1JA 1QHAA 2YI1A 3AA2A 1C1CA 3MEDA 1FW6A 3THXA 4DR6K 4FJMA 2ITGA 2ZE2A 4FLWA 3C6AA 1IKXA 1L3UA 3C0BA 4PL7A 3E66A 3CJAA 3GDQA 2PYJA 3MMVA 4FLVA 3AA4A 2HHWA 3KD5E 2E20A 1VSIA 2AJQA 4CJ5A 1QQCA 4C8MA 3AO1A 3H46O 5AQTA 3TI0A 4JRPA 5SZTA 4NO7A 4Z0UA 2CGJA 3V9SA 1X1PA 4C1NI 2XY6A 3DOKA 5I9EB 5CZ1A 2HHUA 4CZJA 1RFQA 5LMNK 2P9KA 5C2FA 2H3GX 4FOEA 4FK4A 1GLBG 1KVBA 4F2SA 4Z4CA 1VSHA 3AVAA 1J5OA 3VENA 2D0AA 1GLAG 1YHQN 1E3MA 3AARA 4JD2B 2AA4A 1HKCA 2VWBA 3KK7A 4B9SA 5AZJA 1S6PA 4BRQA 1NGBA 3NH1A 5BN8A 2OZMA 4JKBA 5CHIA 5DM7L 1KTQA 3S3MA 2FXUA 4PQUA 4I2QA 1VSKA 3HT3A 1SKSA 3M8SA 3CMAN 2QWPA 3CJ1A 1RTDA 1SV5A 3BZCA 1VSDA 4CESA 3ENHA 5GAHP 3FZFA 4BC5A 5FRNA 4CEOA 1QTMA 4IOCL 2KZMA 4WE1A 1GOAA 3QEVA 2NLXA 3FFKB 1E4GT 3M8PA 3HPOA 4CGHA 5FROA 3VQEA 3MXMA 4B3OA 1VSFA 5AQJA 3PUFA 4BR7A 3THWA 3L2QA 4CZMA 2P9KB 3OYBA 1WOQA 1JLGA 4H0XB 3K58A 1IBKK 2NZTA 2Y1IA 3EZWA 2HNYA 2OPPA 4OPJA 4CVNE 4ILGB 4U7BA 1WBBA 2VYPA 3CQXA 5EX5A 1D9DA 5AZJB 3RTVA 3EN9A 2HW3A 1LWCA 4FK2A 5DM6L 1NU0A 1JCEA 3QO9A 3QEXA 4GV3A 2B4JA 3TAQA 3AVIA 1KFSA 3IG1A 1TK8A 1ZYQA 3K2PA 4H0VB 5CYQA 1C0MA 3LPTA 3IUCA 3E1YA 1LCUA 3ZETB 2FBVA 1YITN 1L3VA 4ZHRA 1KLMA 2W41A 4FJHA 1U45A 3CPEA 4JKEA 1T03A 4BRNA 3AVLA 3UB5A 3AV9A 4EAHD 3W0LA 3V6DA 3L2UA 1VQ6N 3J7AP 5C15A 3J7YP 2OCEA 4CHNA 4CD3A 5CR4A 3WXJA 3ATVA 3QNNA 4MO4A 1TL1A 4CHPA 2E1ZA 3WNEA 4CFBA 3ZEUA 4CBWA 4V19S 2XY8A 1KQSM 4DR5K 3F9MA 4GY2B 1RBUA 4JI0K 4GMJB 3B8AX 1HJOA 4J2EA 4I6MA 5M1FA 3NE6A 2KFNA 3FE1A 1GLFO 3KJVA 4BR0A 1VQPN 4DLEA 2FSNA 2QWLA 3SUPA 3KKRA 4KRFA 3QDKA 2JWLA 4BE0A 5I42A 3TU5A 4I9QA 1O1WA 4DV2K 1JJ2M 4DR3K 2QI2A 5CE3A 5JICA 4ILHA 1NGCA 1Q9XA 3B6PA 1T6CA 3SPYA 1BDGA 1HYZA 5KPZA 4B8AB 3OYGA 3IKMA 4BWJA 1OH8A 4FWQA 4OX9K 1T44A 5IWAK 4E19A 2HBJA 1HJRA 1U49A 2P9IA 2A42A 1VQKN 5ADXH 1IH7A 4BC3A 4KREA 3LALA 5GIOA 3EEQA 4BRGA 4DU3A 4KFBA 2YHAA 3F73A 1FKOA 4MFBA 1XMQK 4CZKA 5FPMA 3EYZA 4HTLA 1SS6A 4JKGB 4WF9L 3H08A 2IIRA 3SMSA 3J80O 2OANA 3FZLA 3HM8A 5CYMA 4GNIA 4YOTA 4J2BA 5KPRA 1HNXK 2I7PA 2V7YA 3L4QA 5I3UA 1TAQA 4FPAA 4ELVA 3C6UA 1CZAN 1QS4A 3AVFA 3LDNA 5FRMA 2ASOA 1BUPA 3QICA 3LP1A 4BRIA 3QEPA 1ASUA 3BUZB 3TTDA 3M8QA 4ID1A 3DXKA 2YX6A 5SWMA 2E4LA 4B1YB 4LD0A 5E84A 3LDQA 5FPNA 3R3LA 1Q9YA 5AQFA 3NF9A 1UA0A 4BROA 4U67L 4YOWA 4O44A 3OS1A 4Z4FA 4DV4K 4FWPA 3VQ4A 2R7YA 3QETA 3P5JA 3JXUA 4YNQA 4CCHA 3O80A 3MXIA 5JLHA 1QQMA 3QESA 1ZBUA 2B5JA 3C6TA 3OYHA 1K73O 1BO5O 4NYFA 3WNHA 1ZBHA 1YTAA 5DK5A 3CQYA 1KCFA 4LH4A 2HOEA 3SQ0A 1KVCA 2A41A 3CJ7A 5KI6A 4EFHA 2E8AA 3M5RA 1JL1A 1JKHA 4CK2A 5HL7L 4FZXC 4B9MA 3L2VA 1IBLK 4E3SA 3ISNC 3ZSXA 1MWKA 4EHUA 1TKTA 1GLEG 4DB3A 3ENOA 1WUAA 4RCHA 4I2PA 3TSUA 4KV8A 1ZBIA 1X9MA 3LDSA 1XC9A 1S1WA 4BR2A 2G8VA 3ZSQA 1EKEA 4CBXA 3THYA 4KB0A 2CGLA 4LFCK 1KAZA 4CW7B 4FJKA 1HNVA 4YORA 3P1GA 3VTHA 3JAMO 4JI4K 4WFNL 5CZ2A 1GOCA 3L0QA 2NRWA 3MX5A 3H1QA 4O5FA 1ASVA 2P9PB 2XRIA 4JI5K 4CF0A 1BISA 2HMPA 3SLCA 3P83D 4BDZA 3GE1A 4AHSA 3NF7A 3C7NA 5LJWA 3N4QA 4NLCA 1K8KA 5HBMA 4BWMA 4DFJA 3DWLA 3FFIA 2PBDA 1N8RO 4JKCA 1UA1A 1JXBA 4EZ9A 3G71N 4JHDA 4RWTA 4G9ZA 2GEMA 1WSIA 2CGKA 3VQAA 3THYB 3O3FA 1ITGA 2WUSA 3ULEA 1UAXA 5F1XA 4JI6K 1KXPA 5B8HA 4CEFA 4BC4A 5JLFA 3EZ5A 4HTUA 1SL1A 1S5JA 2O4IA 4O0IA 3PIPL 4KAZA 4I9LA 3L2RA 4J2AA 1I3AA 4BR5A 3H6EA 4LH5A 1TYQB 1IV0A 2D4WA 3SQ4A 1C0FA 3DXMA 2Z1HA 2PAVA 3PSIA 3QERA 1HYVA 5GINA 4W5NA 1SKWA 1OH5A 1RGIA 3LL3A 4JLHA 2OTLN 3DAWA 3FGUA 3CCVN 4DTNA 3QIOA 2ASMA 4QAGA 2VG7A 5AQRA 1EWRA 1LV5A 3DLHA 3K5MA 2UUAK 3C7NB 3ULDA 3JYTA 2ZM6K 4IDHA 5M1PA 1DTQA 2W6KA 3HPGA 1X3NA 4BG8A 4A57A 1K8KB 1RDBA 2G8UA 1H1VA 3ZCMA 3U3GA 4B9NA 3TWHA 4CGIA 1NK7A 4JHDB 4B3RK 1J54A 2QKBA 4A61A 5HLFA 2RE2A 4PKIA 1NJWA 2NNWA 1HMVA 3C65A 3SAGA 3U4LA 3PO5A 4DSEA 4JN4A 1U04A 1NOYA 3VQBA 1NGJA 4H0YB 3K5OA 4FJIA 4CHYA 1KVAA 3O9SA 4M3RA 4M42A 2D0OA 3MN9A 2D5RA 1MDUB 5C42A 4JI7K 2GTDA 4B9QA 1YJ9N 1NGGA 2EX3A 4C23A 1XMOK 1YF5L 3CJ9A 1XQSC 1QVFM 4BGBA 4CFAA 4F3OA 1BU6O 3LP3A 1CXQA 4BRMA 4FJ8A 3ITHA 1Q82O 2DTUA 3O1BA 4B9VA 5AQOA 2ZJQL 3G4SN 4LSNA 2WOMA 1YTUA 1MU2A 3MN7A 2CH6A 4DSLA 5BPMA 2P5GA 1CZ9A 4CI6A 4F3TA 2BGGA 1RT3A 1GLLO 1SAZA 3VA0A 2O4GA 3HXMA 3ZSYA 3VF2A 1SL0A 3BP8A 3VEWA 4M3UA 2XO7A 3SAFA 4JV5K 4DQSA 2KW4A 3LAKA 1R0AA 1HX1A 4F4KA 1V4TA 3EO3A 3OJUA 1XUPO 1GLDG 4Q0BA 2QWRA 2O8CA 2O8EA 1VRUA 1Z25A 3WNGA 2QXFA 4DUYK 4M3WA 1BIZA 4OVLA 4JKAA 3V9UA 3EE8A 3DLKA 3O9QA 2Z1GA 1TAUA 3QNOA 4PY5A 5HRNA 4IJAA 1ZC6A 3TAFA 1VSJA 2BUPA 4IOXA 1JXEA 3BF3A 4DLGA 2QWOA 3VMFB 3HSTB 4CZFA 1RDDA 4F9OA 3G0ZA 1NKBA 2P9UB 4GVMA 4BDPA 3CCSN 3CETA 4AHCA 3GBTA 4BQZA 4FW1A 1Z05A 1OH7A 5DMRA 1QZ6A 2XY5A 1HQEA 3SBGA 4DQQA 3VQPA 1W9HA 3HM9A 1X9SA 1NWKA 4KHPK 2D0CA 1NK4A 3QMLA 4MDAA 2E5LK 4JS5A 1C1BA 3KIOA 2VWKA 3TAPA 4CECA 5AQQA 4DR2K 1UWBA 4DHYA 4A62A 3H1VX 3RRGA 3SQ2A 1ZBLA 3KK3A 2P9NA 3ZYYX 1QE1A 3VF6A 4M3YA 1KD1O 4N41A 3K0SA 3CMEN 2F8TA 3IMXA 3WEEA 3VEVA 1IG8A 4FWMA 4K43A 3TSPA 4K42A 1SUQA 3DRPA 3HJFA 5AQPA 3ID6A 4HCBA 4DSJA 2QXLA 1NBWA 4JI3K 1JLCA 1NK5A 4J2DA 4IDKA 3SI6A 4E7HA 4E7JA 4RG8A 3T3FA 3DMJA 1ATRA 3PX0A 3CF5L 4KHSA 2GWKA 1S1UA 2BH1A 4FWKA 1WSEA 3D2FA 4A5AA 2GX9A 4KTQA 3OS2A 4FPBA 3FLCO 3THXB 3WUHA 4AQYK 4H4OA 1NKEA 2P9SA 3J7ZO 1J9AA 5JS1A 3KLIA 4BC2A 2J4RA 3D2EA 2A1SA 4CGGA 4LY7A 3KZBA 3R6MA 3PIOL 2Q1NA 4H5NA 3SV3A 2PZSA 5AQZA 3TANA 2Q36A 2HHQA 1VQ7N 5GAEP 4KH4A 4LF9K 3E9OA 3L4IA 1OH6A 4IOAL 1TL3A 4QS9A 4CIGA 1HQUA 4PL8A 1HUXA 1HKBA 4B9TA 1MWMA 1JLFA 1IG9A 5J2MA 4FL9A 2HNDA 2IVOA 3LDPA 2D0PA 4CJUA 3BGRA 4A59A 2VGMA 1O13A 4AHTA 4FJJA 4Z4HA 4FJGA 3T1AA 3O9RA 1TKXA 2X74A 5FDLA 5LJVA 2IVNA 5KQ8A 3HOSA 1BQMA 1WAJA 4Y1CA 3NH2A 2IVPA 3AAQA 4ISFA 4IFVA 4UQGA 4FWOA 5J2NA 3DYAA 1Q18A 4HUEA 3HVTA 5AQMA 3LM2A 5AQYA 3OYMA 1U4BA 4PWDA 1ESVA 4QOZB 3THWB 3ZSZA 3I56N 4CEZA 2HF4A 1RILA 2PFUA 2ZJRL 1D4XA 2A1RA 1XWLA 1HLUA 3ZT1A 4YOXA 3QEWA 2FBTA 2ZWHA 3D7EO 3NF8A 1DGKN 4Z4EA 1N36K 4CERA 4QCLA 4DTUA 4BRKA 2YNHA 1NGAA 3TSQA 4DFPA 4BGAA 1D9FA 2PY5A 1UOCA 5KQDA 3K5NA 4GV9A 4AF1A 1U6ZA 2A5XA 3IS9A 5JVGL 5C24A 2KHOA 2QWMA 4B1XB 2OPSA 4ZTJA 3WXMB 2DFEA 3AO3A 4FM1A 4DSIA
chains in the Genus database with same CATH topology
5HP1A 4N56A 1FKPA 3ZSQA 1EKEA 2VG6A 4CF1A 3LWMA 2G8VA 4KB0A 1Z26A 4EP4A 4IBNA 2G8FA 1JLQA 2YNFA 3QINA 3CFOA 3TARA 1N5YA 2BDPA 3B6OA 4KHNA 4CJEA 1S9GA 1BIUA 3ZSVA 4FJKA 1HNVA 4CE9A 1KRPA 3DLEA 3VQ5A 5KGWA 4M45A 3P1GA 2F8SA 3OYKA 1L3SA 3SV4A 3RR8A 5CZ2A 1GOCA 4DQPA 4JS4A 1ASVA 1JLBA 4IG3A 4N47A 2XRIA 1IO2A 3AVHA 1XHZA 4RW9A 4CEAA 3LWLA 3L8BA 4CF0A 3L2WA 3HP9A 1BISA 3P83D 2KTQA 5KRTA 3TAMA 4FXDA 3ZSWA 2EHGA 4O4GA 4ZTFA 4ID5A 4DWIA 4FK0A 4BDZA 1CZBA 1XI1A 3NH0A 4AHSA 2HHXA 1Q8IA 1TKZA 3NF7A 2HVHA 3VQQA 2KZZA 2G8WA 4CHOA 4CJFA 1QHTA 2Z1JA 3L3VA 4FLZA 4FLUA 4W5RA 3VN5A 3NF6A 1FXXA 5HBMA 4BWMA 4DFJA 3DRSA 1RTJA 1D5AA 3FFIA 1TVRA 1YT3A 3AO2A 3D45A 2HMIA 1UA1A 1JXBA 2HHSA 4EZ9A 3ZSRA 3T19A 2I5JA 1WSIA 3AVGA 1IKYA 1JLEA 1S1XA 1WSGA 1LWFA 3VQAA 2YNIA 3O3FA 1ITGA 3OYLA 4FM0A 5HRPA 1TKDA 1BCOA 4CF8A 4C8LA 1UAXA 5EU7A 4CIFA 1BCMA 3DLBA 4FW2A 3ZSOA 1EX4A 2F96A 4CEFA 1RTHA 3K59A 1QSLA 3LAMA 3EZ5A 4HTUA 4TSXA 1S5JA 4AHVA 4YFUA 3PX4A 1JL2A 1SL1A 1J53A 2O4IA 3LP2A 4O0IA 4E1NA 1EETA 4CGFA 4RW6A 1ZBFA 1T05A 3LZIA 3E01A 4I9LA 3L2RA 4KAZA 4J2AA 2QK9A 1I3AA 4O55A 2Y1JA 4LH5A 1RT1A 4KHYA 4L8RB 3SQ4A 3THVA 4HCCA 4FJ5A 2Z1HA 3DOLA 3QERA 3IAYA 2E6MA 3SCXA 1HYVA 4B08A 1F21A 4W5NA 3RMAA 3MXJA 4NCGA 2E6LA 4JLHA 4CJPA 1NK8A 1SKWA 4CEDA 4DS4A 4DTNA 3QIOA 4QAGA 4E7LA 4OKJA 3U6FA 1LW0A 2VG7A 1LV5A 3DLHA 5D3GA 1I39A 3K5MA 2DY4A 1RT5A 1GOBA 1RT7A 1VRTA 3ULDA 3JYTA 1BL3A 1DTQA 1Y97A 3AVBA 3HPGA 3NAEA 4CFDA 3LZJA 1RDBA 1C0TA 1WLJA 2KFZA 2G8UA 3ZCMA 4I7FA 4KB1A 4IKFA 3U3GA 4E0DA 2DFFA 5HRSA 4K8XA 3QIPA 3TWHA 4CJVA 3OYDA 4B9NA 2G8HA 4CGIA 3ALYA 3C95A 1NK7A 3RMBA 4DSKA 3KD1E 4FZYA 4M3XA 3AA2A 1C1CA 1JLAA 3MEDA 1J54A 2YNGA 3SYZA 1SL2A 2QKBA 1RBSA 4FJMA 1W0HA 2IGIA 2ITGA 3SPZA 5HLFA 2ZE2A 4FLWA 3VA3A 1IKXA 1NJWA 1NK6A 1L3UA 4ELUA 3D0PA 3O4NA 4RW8A 3I0SA 1RDCA 1SKRA 4OJRA 1HMVA 2PYJA 4KHWA 4FLVA 4DSEA 3K5LA 1U04A 3AA4A 1NOYA 3PO5A 1VSIA 3VQBA 3ZT4A 1U48A 3RR7A 4R5PA 3KD5E 2AJQA 1RBVA 3TAEA 1WNSA 1LAWA 4CJ5A 1QQCA 2Q3SA 2IC3A 4CJ3A 2P5OA 4OLBA 2BE2A 4H4MA 4C8OA 2IDOA 3K5OA 2P1JA 4C8MA 3AO1A 2HB5A 3TI0A 4CHQA 4CHYA 1KVAA 4FJIA 4M3RA 2XHBA 4JRPA 4M42A 2D5RA 5C42A 3NGYA 5SZTA 4Z0UA 3V9SA 1X1PA 2XY6A 3DOKA 5CZ1A 2HHUA 1HNIA 2EX3A 4EZ6A 4B9UA 4M3ZA 1EXQA 4FK4A 1YVUA 4FJXA 2HHWA 1KVBA 3I0RA 1NJXA 4CK1A 4F2SA 4CJRA 2ATQA 4CFAA 4F3OA 4Z4CA 3LP3A 1VSHA 1HPZA 1CXQA 3AVAA 2D0AA 3PV8A 1J5OA 4FJ8A 3ITHA 3NBPA 2DTUA 5KGXA 4B9VA 2WONA 1BGXT 1KLNA 4LSNA 4CGJA 2WOMA 4BE1A 1YTUA 1MU2A 4B9SA 1S6PA 4DSLA 3V9XA 3OVNA 3NFAA 2XY7A 3S9HA 4NCBA 3NH1A 2LSNA 2P5GA 4FJ9A 1CZ9A 1TGOA 2FC0A 4F3TA 2BGGA 1RT3A 1WAFA 4LSLA 4O0JA 4Q5VA 4DF4A 3VA0A 4CIEA 2OZMA 2O4GA 4F2RA 1B92A 1KTQA 3S3MA 4DG1A 3HXMA 3ZSYA 3HO1A 1SL0A 4PQUA 4I2QA 1VSKA 4FJNA 4M3UA 3HT3A 2XO7A 1SKSA 4CF9A 2RKIA 4OGEA 3M8SA 4O5BA 3OYFA 4DQSA 2OYQA 2KW4A 1RT2A 3LAKA 3PO4A 3TAGA 1R0AA 3CG7A 1RTDA 4F4KA 1SV5A 1VSDA 4RW4A 4CESA 4CGDA 3OJUA 3K57A 5KTQA 3AO5A 3LANA 1NK9A 4Q0BA 5FRNA 4CEOA 1BI4A 3S3OA 1QTMA 2KZMA 4WE1A 1U47A 3RMCA 4DFMA 1GOAA 3QEVA 4Y1DA 4FZZA 3DI6A 3M8PA 1VRUA 1Z25A 3WNGA 2QXFA 4CGHA 3HPOA 5FROA 3VQEA 3M8RA 4FCYA 1VSFA 2GBZA 3MXMA 1N6QA 1BIZA 3G10A 3LPUA 3PUFA 4OVLA 3L2QA 4BDYA 3V9UA 1ASWA 2Z1IA 4MQ3A 4CJKA 3OYBA 5HROA 3DLKA 1L3TA 2Z1GA 1TAUA 3MEGA 1JLGA 3QNOA 1XHXA 4CJ4A 3K58A 3AVMA 4RW7A 5HRNA 4PY5A 2Y1IA 3LP0A 4FM2A 1LWEA 3TAFA 1VSJA 2HNYA 3TR8A 1WN7A 2OPPA 4OPJA 1JXEA 1NJYA 4DLGA 3MAQA 3HSTB 3NHGA 1RDDA 3O3GA 1D9DA 3RWUA 4PUOA 3ZT3A 4Z4IA 3RTVA 2HW3A 1LWCA 5J2PA 1NJZA 3G0ZA 4FK2A 4C8NA 3WNFA 3QO9A 4GW6A 3QEXA 1NKBA 5KRSA 2B4JA 1G15A 4GVMA 1KFDA 3AVIA 3V9WA 3TAQA 4BDPA 4AHCA 4W5OA 3UIQA 1BQNA 2G8IA 1KFSA 2OZSA 3IG1A 1TK8A 4KTZA 3I8DA 4FW1A 3SUNA 1ZYQA 3K2PA 5CYQA 1C0MA 3KLEA 1BHLA 1C0UA 3LPTA 5DMRA 4DFKA 3AVCA 1VSEA 1HQEA 2XY5A 1RT6A 4KI4A 4DQQA 2FBVA 1L3VA 4ELTA 4ZHRA 1KLMA 3ZT2A 3HP6A 4W5QA 4FJHA 3VQPA 1W9HA 3HM9A 1CLQA 1U45A 1X9SA 3VQ6A 3OYIA 3V1OA 1A5VA 1T03A 2D0CA 1NK4A 3SUOA 3C94A 3DLRA 1WSHA 3AVLA 3AV9A 4JS5A 1QSSA 2OA8A 4N76A 1C1BA 3KIOA 3QLHA 3V81A 3CM5A 4CJWA 3L2UA 3V6DA 2VWKA 3TAPA 4DMNA 4CECA 4CHNA 4DTXA 2IS3A 3MECA 3SUQA 3V4IA 3QNNA 3ASMA 1TL1A 4CHPA 5JS2A 5E41A 3OJSA 4H8KA 3HYFA 3WNEA 4CFBA 1UWBA 1RT4A 3CM6A 1NK0A 3L3UA 3HK2A 2XY8A 1D8YA 3RRGA 2YKMA 2YKNA 3SQ2A 1ZBLA 3AO4A 1RBUA 3KK3A 2NUBA 4GMJB 1HYSA 1QE1A 2FBXA 3CYMA 4J2EA 1KSPA 3A2FA 4M3YA 3CFRA 4N41A 4AILC 2F8TA 2DFHA 3NE6A 4E7IA 4DSFA 4KHQA 2KFNA 3VQ7A 3KJVA 4E1MA 4AH9A 4XIUA 1B9DA 4DLEA 5HRRA 3SUPA 3KKRA 2G8KA 2W42A 4KRFA 1SUQA 3DRPA 4B8CA 3HJFA 4BACA 2RN2A 4BE0A 2P51A 5I42A 4HCBA 3DRRA 4DSJA 1RDAA 3AVNA 4I9QA 1RNHA 1O1WA 3KTQA 1JLCA 1NK5A 4J2DA 2HVIA 4IFYA 4FYDA 4IDKA 3SI6A 4E7HA 4E7JA 4RG8A 3T3FA 1L5UA 3DMJA 3OYAA 4G1QA 3PX0A 4KHSA 2BANA 1CXUA 4DTOA 2B6AA 3B6PA 1Q9XA 1S1UA 4NYNA 3SPYA 3DLGA 1WSEA 1HYZA 4HVJA 1VSMA 4KPYA 4B8AB 3OS0A 3OS2A 4KTQA 3OYGA 4BWJA 1WSJA 3QEIA 2VWJA 4NCAA 4Z4GA 4H4OA 4KKOA 1S6QA 4E19A 1NKEA 1U49A 1HJRA 4N5SA 3NDKA 3VQ8A 3SZ2A 1J9AA 3KK2A 4HHTA 4DS5A 2HHTA 5JS1A 2IAJA 2D0BA 3KLIA 2GV9A 1IH7A 4HUGA 4KREA 3LALA 2A1SA 1IKVA 2GUIA 4CGGA 4FJLA 3AVKA 4LY7A 4DU3A 1REVA 3SV3A 3RMDA 2PZSA 3CQ8A 3RRHA 5K14A 4AHRA 3AA3A 4KFBA 3JSMA 3TANA 1A5XA 2YHAA 1TK0A 3F73A 2HHQA 1FK9A 3KLFA 1FKOA 1S9EA 4MFBA 1A5WA 3EYZA 3AVJA 5J2QA 3AA5X 1S1VA 3H08A 3KK1A 4DQRA 1C6VA 4FLYA 4FLXA 1TL3A 4CIGA 1T8EA 1HQUA 1VSLA 2KQ2A 1LW2A 3DM2A 4KO0A 2VG5A 4ICLA 3VQDA 3TABA 4EP5A 1DLOA 5CYMA 2JLEA 4J2BA 4B3OA 2YV0X 4W5TA 3CFPA 4FJ7A 4B9TA 2IOCA 2JGUA 4KHUA 1JLFA 2FBYA 1IG9A 5J2MA 3V9ZA 1QSYA 2HNDA 1VK0A 4CJUA 4DTSA 1LAVA 2HHVA 1B9FA 5I3UA 1TAQA 3BGRA 3IRXA 5C25A 4B9LA 3C6UA 2X78A 4ELVA 4AHTA 4FJJA 4Z4HA 4FJGA 3T1AA 2X6SA 1EP4A 1QS4A 1RBTA 3AVFA 5FRMA 1TKXA 4AHUA 2X74A 3VQ9A 3LP1A 2X6NA 4CJSA 5FDLA 3HPHA 3O3HA 3QEPA 1X9WA 1ASUA 4DTJA 1BQMA 4KI6A 1WAJA 4CJLA 4Y1CA 3M8QA 4ID1A 4CEQA 3NH2A 3S3NA 4CJQA 4DTMA 3SNNA 3OYEA 4IFVA 2RPIA 2PYLA 5SWMA 2E4LA 4CF2A 5J1EA 4LD0A 4UQGA 3KLHA 4HUFA 4FLTA 3O4QA 3SJJA 5J2NA 3KKSA 4OGCA 1RBRA 1BI4B 1RCHA 3DYAA 4FVMA 4PA1A 4CJTA 5T7BA 4HUEA 4DU1A 4OKEA 1Q9YA 4DTPA 1C1AA 3HVTA 2YHBA 3NF9A 4OPKA 3OYMA 1UA0A 1S1TA 1TV6A 2OPRA 4O44A 1U4BA 4DTRA 4K8ZA 4PWDA 4CEBA 3OS1A 4KTWA 3V1RA 4F8RA 3ZSZA 4Z4FA 3VQ4A 2R7YA 4CEZA 4QOZB 3QETA 3P5JA 1RTIA 4YNQA 4CCHA 3EY1A 3NGIA 3MXIA 1WSFA 3U3YA 4DQIA 3PY8A 3QESA 4E7KA 1RILA 2HNZA 3KLGA 1ZBUA 2B5JA 3C6TA 3OYNA 3OYHA 3OYJA 4NYFA 4M3TA 3WNHA 1XWLA 2A1RA 1ZBHA 3ZT1A 3QEWA 1YTAA 1NOZA 2FBTA 4DU4A 4OLAA 5DK5A 1KCFA 4LH4A 1HRHA 2RF2A 2QKKA 3SQ0A 4M3WA 1KVCA 3F9KA 5KI6A 3NF8A 3OY9A 4OKKA 2ZQBA 3PX6A 4C8KA 4Z4EA 4CERA 4QCLA 1K6YA 4DTUA 4IG0A 3BDPA 1JL1A 1T7PA 1JKHA 3OYCA 4CK2A 2OPQA 1TK5A 4FZXC 4B9MA 3L2VA 2YNHA 4E3SA 3ISNC 3HVRA 4CEEA 4DFPA 1D9FA 3SQ1A 2PY5A 1NKCA 1UOCA 5CY4A 1IKWA 3ZSXA 1TKTA 3K5NA 3NCIA 4DF8A 4CFCA 3V1QA 3IS9A 4I2PA 3VQCA 3HL8A 2ZD1A 5C24A 1DTTA 4KV8A 4CHZA 4CK3A 4BE2A 1ZBIA 4FM1A 3NGZA 2ETJA 2OPSA 4E89A 1X9MA 4ZTJA 4M41A 2DFEA 3LDSA 3MEEA 3AO3A 1XC9A 3ZT0A 1S1WA 4JRQA 4DSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HP1 A;  4N56 A;  1FKP A;  3ZSQ A;  1EKE A;  2VG6 A;  4CF1 A;  3LWM A;  2G8V A;  4KB0 A;  1Z26 A;  4EP4 A;  4IBN A;  2G8F A;  1JLQ A;  2YNF A;  3QIN A;  3CFO A;  3TAR A;  1N5Y A;  2BDP A;  3B6O A;  4KHN A;  4CJE A;  1S9G A;  1BIU A;  3ZSV A;  4FJK A;  1HNV A;  4CE9 A;  1KRP A;  3DLE A;  3VQ5 A;  5KGW A;  4M45 A;  3P1G A;  2F8S A;  3OYK A;  1L3S A;  3SV4 A;  3RR8 A;  5CZ2 A;  1GOC A;  4DQP A;  4JS4 A;  1ASV A;  1JLB A;  4IG3 A;  4N47 A;  2XRI A;  1IO2 A;  3AVH A;  1XHZ A;  4RW9 A;  4CEA A;  3LWL A;  3L8B A;  4CF0 A;  3L2W A;  3HP9 A;  1BIS A;  3P83 D;  2KTQ A;  5KRT A;  3TAM A;  4FXD A;  3ZSW A;  2EHG A;  4O4G A;  4ZTF A;  4ID5 A;  4DWI A;  4FK0 A;  4BDZ A;  1CZB A;  1XI1 A;  3NH0 A;  4AHS A;  2HHX A;  1Q8I A;  1TKZ A;  3NF7 A;  2HVH A;  3VQQ A;  2KZZ A;  2G8W A;  4CHO A;  4CJF A;  1QHT A;  2Z1J A;  3L3V A;  4FLZ A;  4FLU A;  4W5R A;  3VN5 A;  3NF6 A;  1FXX A;  5HBM A;  4BWM A;  4DFJ A;  3DRS A;  1RTJ A;  1D5A A;  3FFI A;  1TVR A;  1YT3 A;  3AO2 A;  3D45 A;  2HMI A;  1UA1 A;  1JXB A;  2HHS A;  4EZ9 A;  3ZSR A;  3T19 A;  2I5J A;  1WSI A;  3AVG A;  1IKY A;  1JLE A;  1S1X A;  1WSG A;  1LWF A;  3VQA A;  2YNI A;  3O3F A;  1ITG A;  3OYL A;  4FM0 A;  5HRP A;  1TKD A;  1BCO A;  4CF8 A;  4C8L A;  1UAX A;  5EU7 A;  4CIF A;  1BCM A;  3DLB A;  4FW2 A;  3ZSO A;  1EX4 A;  2F96 A;  4CEF A;  1RTH A;  3K59 A;  1QSL A;  3LAM A;  3EZ5 A;  4HTU A;  4TSX A;  1S5J A;  4AHV A;  4YFU A;  3PX4 A;  1JL2 A;  1SL1 A;  1J53 A;  2O4I A;  3LP2 A;  4O0I A;  4E1N A;  1EET A;  4CGF A;  4RW6 A;  1ZBF A;  1T05 A;  3LZI A;  3E01 A;  4I9L A;  3L2R A;  4KAZ A;  4J2A A;  2QK9 A;  1I3A A;  4O55 A;  2Y1J A;  4LH5 A;  1RT1 A;  4KHY A;  4L8R B;  3SQ4 A;  3THV A;  4HCC A;  4FJ5 A;  2Z1H A;  3DOL A;  3QER A;  3IAY A;  2E6M A;  3SCX A;  1HYV A;  4B08 A;  1F21 A;  4W5N A;  3RMA A;  3MXJ A;  4NCG A;  2E6L A;  4JLH A;  4CJP A;  1NK8 A;  1SKW A;  4CED A;  4DS4 A;  4DTN A;  3QIO A;  4QAG A;  4E7L A;  4OKJ A;  3U6F A;  1LW0 A;  2VG7 A;  1LV5 A;  3DLH A;  5D3G A;  1I39 A;  3K5M A;  2DY4 A;  1RT5 A;  1GOB A;  1RT7 A;  1VRT A;  3ULD A;  3JYT A;  1BL3 A;  1DTQ A;  1Y97 A;  3AVB A;  3HPG A;  3NAE A;  4CFD A;  3LZJ A;  1RDB A;  1C0T A;  1WLJ A;  2KFZ A;  2G8U A;  3ZCM A;  4I7F A;  4KB1 A;  4IKF A;  3U3G A;  4E0D A;  2DFF A;  5HRS A;  4K8X A;  3QIP A;  3TWH A;  4CJV A;  3OYD A;  4B9N A;  2G8H A;  4CGI A;  3ALY A;  3C95 A;  1NK7 A;  3RMB A;  4DSK A;  3KD1 E;  4FZY A;  4M3X A;  3AA2 A;  1C1C A;  1JLA A;  3MED A;  1J54 A;  2YNG A;  3SYZ A;  1SL2 A;  2QKB A;  1RBS A;  4FJM A;  1W0H A;  2IGI A;  2ITG A;  3SPZ A;  5HLF A;  2ZE2 A;  4FLW A;  3VA3 A;  1IKX A;  1NJW A;  1NK6 A;  1L3U A;  4ELU A;  3D0P A;  3O4N A;  4RW8 A;  3I0S A;  1RDC A;  1SKR A;  4OJR A;  1HMV A;  2PYJ A;  4KHW A;  4FLV A;  4DSE A;  3K5L A;  1U04 A;  3AA4 A;  1NOY A;  3PO5 A;  1VSI A;  3VQB A;  3ZT4 A;  1U48 A;  3RR7 A;  4R5P A;  3KD5 E;  2AJQ A;  1RBV A;  3TAE A;  1WNS A;  1LAW A;  4CJ5 A;  1QQC A;  2Q3S A;  2IC3 A;  4CJ3 A;  2P5O A;  4OLB A;  2BE2 A;  4H4M A;  4C8O A;  2IDO A;  3K5O A;  2P1J A;  4C8M A;  3AO1 A;  2HB5 A;  3TI0 A;  4CHQ A;  4CHY A;  1KVA A;  4FJI A;  4M3R A;  2XHB A;  4JRP A;  4M42 A;  2D5R A;  5C42 A;  3NGY A;  5SZT A;  4Z0U A;  3V9S A;  1X1P A;  2XY6 A;  3DOK A;  5CZ1 A;  2HHU A;  1HNI A;  2EX3 A;  4EZ6 A;  4B9U A;  4M3Z A;  1EXQ A;  4FK4 A;  1YVU A;  4FJX A;  2HHW A;  1KVB A;  3I0R A;  1NJX A;  4CK1 A;  4F2S A;  4CJR A;  2ATQ A;  4CFA A;  4F3O A;  4Z4C A;  3LP3 A;  1VSH A;  1HPZ A;  1CXQ A;  3AVA A;  2D0A A;  3PV8 A;  1J5O A;  4FJ8 A;  3ITH A;  3NBP A;  2DTU A;  5KGX A;  4B9V A;  2WON A;  1BGX T;  1KLN A;  4LSN A;  4CGJ A;  2WOM A;  4BE1 A;  1YTU A;  1MU2 A;  4B9S A;  1S6P A;  4DSL A;  3V9X A;  3OVN A;  3NFA A;  2XY7 A;  3S9H A;  4NCB A;  3NH1 A;  2LSN A;  2P5G A;  4FJ9 A;  1CZ9 A;  1TGO A;  2FC0 A;  4F3T A;  2BGG A;  1RT3 A;  1WAF A;  4LSL A;  4O0J A;  4Q5V A;  4DF4 A;  3VA0 A;  4CIE A;  2OZM A;  2O4G A;  4F2R A;  1B92 A;  1KTQ A;  3S3M A;  4DG1 A;  3HXM A;  3ZSY A;  3HO1 A;  1SL0 A;  4PQU A;  4I2Q A;  1VSK A;  4FJN A;  4M3U A;  3HT3 A;  2XO7 A;  1SKS A;  4CF9 A;  2RKI A;  4OGE A;  3M8S A;  4O5B A;  3OYF A;  4DQS A;  2OYQ A;  2KW4 A;  1RT2 A;  3LAK A;  3PO4 A;  3TAG A;  1R0A A;  3CG7 A;  1RTD A;  4F4K A;  1SV5 A;  1VSD A;  4RW4 A;  4CES A;  4CGD A;  3OJU A;  3K57 A;  5KTQ A;  3AO5 A;  3LAN A;  1NK9 A;  4Q0B A;  5FRN A;  4CEO A;  1BI4 A;  3S3O A;  1QTM A;  2KZM A;  4WE1 A;  1U47 A;  3RMC A;  4DFM A;  1GOA A;  3QEV A;  4Y1D A;  4FZZ A;  3DI6 A;  3M8P A;  1VRU A;  1Z25 A;  3WNG A;  2QXF A;  4CGH A;  3HPO A;  5FRO A;  3VQE A;  3M8R A;  4FCY A;  1VSF A;  2GBZ A;  3MXM A;  1N6Q A;  1BIZ A;  3G10 A;  3LPU A;  3PUF A;  4OVL A;  3L2Q A;  4BDY A;  3V9U A;  1ASW A;  2Z1I A;  4MQ3 A;  4CJK A;  3OYB A;  5HRO A;  3DLK A;  1L3T A;  2Z1G A;  1TAU A;  3MEG A;  1JLG A;  3QNO A;  1XHX A;  4CJ4 A;  3K58 A;  3AVM A;  4RW7 A;  5HRN A;  4PY5 A;  2Y1I A;  3LP0 A;  4FM2 A;  1LWE A;  3TAF A;  1VSJ A;  2HNY A;  3TR8 A;  1WN7 A;  2OPP A;  4OPJ A;  1JXE A;  1NJY A;  4DLG A;  3MAQ A;  3HST B;  3NHG A;  1RDD A;  3O3G A;  1D9D A;  3RWU A;  4PUO A;  3ZT3 A;  4Z4I A;  3RTV A;  2HW3 A;  1LWC A;  5J2P A;  1NJZ A;  3G0Z A;  4FK2 A;  4C8N A;  3WNF A;  3QO9 A;  4GW6 A;  3QEX A;  1NKB A;  5KRS A;  2B4J A;  1G15 A;  4GVM A;  1KFD A;  3AVI A;  3V9W A;  3TAQ A;  4BDP A;  4AHC A;  4W5O A;  3UIQ A;  1BQN A;  2G8I A;  1KFS A;  2OZS A;  3IG1 A;  1TK8 A;  4KTZ A;  3I8D A;  4FW1 A;  3SUN A;  1ZYQ A;  3K2P A;  5CYQ A;  1C0M A;  3KLE A;  1BHL A;  1C0U A;  3LPT A;  5DMR A;  4DFK A;  3AVC A;  1VSE A;  1HQE A;  2XY5 A;  1RT6 A;  4KI4 A;  4DQQ A;  2FBV A;  1L3V A;  4ELT A;  4ZHR A;  1KLM A;  3ZT2 A;  3HP6 A;  4W5Q A;  4FJH A;  3VQP A;  1W9H A;  3HM9 A;  1CLQ A;  1U45 A;  1X9S A;  3VQ6 A;  3OYI A;  3V1O A;  1A5V A;  1T03 A;  2D0C A;  1NK4 A;  3SUO A;  3C94 A;  3DLR A;  1WSH A;  3AVL A;  3AV9 A;  4JS5 A;  1QSS A;  2OA8 A;  4N76 A;  1C1B A;  3KIO A;  3QLH A;  3V81 A;  3CM5 A;  4CJW A;  3L2U A;  3V6D A;  2VWK A;  3TAP A;  4DMN A;  4CEC A;  4CHN A;  4DTX A;  2IS3 A;  3MEC A;  3SUQ A;  3V4I A;  3QNN A;  3ASM A;  1TL1 A;  4CHP A;  5JS2 A;  5E41 A;  3OJS A;  4H8K A;  3HYF A;  3WNE A;  4CFB A;  1UWB A;  1RT4 A;  3CM6 A;  1NK0 A;  3L3U A;  3HK2 A;  2XY8 A;  1D8Y A;  3RRG A;  2YKM A;  2YKN A;  3SQ2 A;  1ZBL A;  3AO4 A;  1RBU A;  3KK3 A;  2NUB A;  4GMJ B;  1HYS A;  1QE1 A;  2FBX A;  3CYM A;  4J2E A;  1KSP A;  3A2F A;  4M3Y A;  3CFR A;  4N41 A;  4AIL C;  2F8T A;  2DFH A;  3NE6 A;  4E7I A;  4DSF A;  4KHQ A;  2KFN A;  3VQ7 A;  3KJV A;  4E1M A;  4AH9 A;  4XIU A;  1B9D A;  4DLE A;  5HRR A;  3SUP A;  3KKR A;  2G8K A;  2W42 A;  4KRF A;  1SUQ A;  3DRP A;  4B8C A;  3HJF A;  4BAC A;  2RN2 A;  4BE0 A;  2P51 A;  5I42 A;  4HCB A;  3DRR A;  4DSJ A;  1RDA A;  3AVN A;  4I9Q A;  1RNH A;  1O1W A;  3KTQ A;  1JLC A;  1NK5 A;  4J2D A;  2HVI A;  4IFY A;  4FYD A;  4IDK A;  3SI6 A;  4E7H A;  4E7J A;  4RG8 A;  3T3F A;  1L5U A;  3DMJ A;  3OYA A;  4G1Q A;  3PX0 A;  4KHS A;  2BAN A;  1CXU A;  4DTO A;  2B6A A;  3B6P A;  1Q9X A;  1S1U A;  4NYN A;  3SPY A;  3DLG A;  1WSE A;  1HYZ A;  4HVJ A;  1VSM A;  4KPY A;  4B8A B;  3OS0 A;  3OS2 A;  4KTQ A;  3OYG A;  4BWJ A;  1WSJ A;  3QEI A;  2VWJ A;  4NCA A;  4Z4G A;  4H4O A;  4KKO A;  1S6Q A;  4E19 A;  1NKE A;  1U49 A;  1HJR A;  4N5S A;  3NDK A;  3VQ8 A;  3SZ2 A;  1J9A A;  3KK2 A;  4HHT A;  4DS5 A;  2HHT A;  5JS1 A;  2IAJ A;  2D0B A;  3KLI A;  2GV9 A;  1IH7 A;  4HUG A;  4KRE A;  3LAL A;  2A1S A;  1IKV A;  2GUI A;  4CGG A;  4FJL A;  3AVK A;  4LY7 A;  4DU3 A;  1REV A;  3SV3 A;  3RMD A;  2PZS A;  3CQ8 A;  3RRH A;  5K14 A;  4AHR A;  3AA3 A;  4KFB A;  3JSM A;  3TAN A;  1A5X A;  2YHA A;  1TK0 A;  3F73 A;  2HHQ A;  1FK9 A;  3KLF A;  1FKO A;  1S9E A;  4MFB A;  1A5W A;  3EYZ A;  3AVJ A;  5J2Q A;  3AA5 X;  1S1V A;  3H08 A;  3KK1 A;  4DQR A;  1C6V A;  4FLY A;  4FLX A;  1TL3 A;  4CIG A;  1T8E A;  1HQU A;  1VSL A;  2KQ2 A;  1LW2 A;  3DM2 A;  4KO0 A;  2VG5 A;  4ICL A;  3VQD A;  3TAB A;  4EP5 A;  1DLO A;  5CYM A;  2JLE A;  4J2B A;  4B3O A;  2YV0 X;  4W5T A;  3CFP A;  4FJ7 A;  4B9T A;  2IOC A;  2JGU A;  4KHU A;  1JLF A;  2FBY A;  1IG9 A;  5J2M A;  3V9Z A;  1QSY A;  2HND A;  1VK0 A;  4CJU A;  4DTS A;  1LAV A;  2HHV A;  1B9F A;  5I3U A;  1TAQ A;  3BGR A;  3IRX A;  5C25 A;  4B9L A;  3C6U A;  2X78 A;  4ELV A;  4AHT A;  4FJJ A;  4Z4H A;  4FJG A;  3T1A A;  2X6S A;  1EP4 A;  1QS4 A;  1RBT A;  3AVF A;  5FRM A;  1TKX A;  4AHU A;  2X74 A;  3VQ9 A;  3LP1 A;  2X6N A;  4CJS A;  5FDL A;  3HPH A;  3O3H A;  3QEP A;  1X9W A;  1ASU A;  4DTJ A;  1BQM A;  4KI6 A;  1WAJ A;  4CJL A;  4Y1C A;  3M8Q A;  4ID1 A;  4CEQ A;  3NH2 A;  3S3N A;  4CJQ A;  4DTM A;  3SNN A;  3OYE A;  4IFV A;  2RPI A;  2PYL A;  5SWM A;  2E4L A;  4CF2 A;  5J1E A;  4LD0 A;  4UQG A;  3KLH A;  4HUF A;  4FLT A;  3O4Q A;  3SJJ A;  5J2N A;  3KKS A;  4OGC A;  1RBR A;  1BI4 B;  1RCH A;  3DYA A;  4FVM A;  4PA1 A;  4CJT A;  5T7B A;  4HUE A;  4DU1 A;  4OKE A;  1Q9Y A;  4DTP A;  1C1A A;  3HVT A;  2YHB A;  3NF9 A;  4OPK A;  3OYM A;  1UA0 A;  1S1T A;  1TV6 A;  2OPR A;  4O44 A;  1U4B A;  4DTR A;  4K8Z A;  4PWD A;  4CEB A;  3OS1 A;  4KTW A;  3V1R A;  4F8R A;  3ZSZ A;  4Z4F A;  3VQ4 A;  2R7Y A;  4CEZ A;  4QOZ B;  3QET A;  3P5J A;  1RTI A;  4YNQ A;  4CCH A;  3EY1 A;  3NGI A;  3MXI A;  1WSF A;  3U3Y A;  4DQI A;  3PY8 A;  3QES A;  4E7K A;  1RIL A;  2HNZ A;  3KLG A;  1ZBU A;  2B5J A;  3C6T A;  3OYN A;  3OYH A;  3OYJ A;  4NYF A;  4M3T A;  3WNH A;  1XWL A;  2A1R A;  1ZBH A;  3ZT1 A;  3QEW A;  1YTA A;  1NOZ A;  2FBT A;  4DU4 A;  4OLA A;  5DK5 A;  1KCF A;  4LH4 A;  1HRH A;  2RF2 A;  2QKK A;  3SQ0 A;  4M3W A;  1KVC A;  3F9K A;  5KI6 A;  3NF8 A;  3OY9 A;  4OKK A;  2ZQB A;  3PX6 A;  4C8K A;  4Z4E A;  4CER A;  4QCL A;  1K6Y A;  4DTU A;  4IG0 A;  3BDP A;  1JL1 A;  1T7P A;  1JKH A;  3OYC A;  4CK2 A;  2OPQ A;  1TK5 A;  4FZX C;  4B9M A;  3L2V A;  2YNH A;  4E3S A;  3ISN C;  3HVR A;  4CEE A;  4DFP A;  1D9F A;  3SQ1 A;  2PY5 A;  1NKC A;  1UOC A;  5CY4 A;  1IKW A;  3ZSX A;  1TKT A;  3K5N A;  3NCI A;  4DF8 A;  4CFC A;  3V1Q A;  3IS9 A;  4I2P A;  3VQC A;  3HL8 A;  2ZD1 A;  5C24 A;  1DTT A;  4KV8 A;  4CHZ A;  4CK3 A;  4BE2 A;  1ZBI A;  4FM1 A;  3NGZ A;  2ETJ A;  2OPS A;  4E89 A;  1X9M A;  4ZTJ A;  4M41 A;  2DFE A;  3LDS A;  3MEE A;  3AO3 A;  1XC9 A;  3ZT0 A;  1S1W A;  4JRQ A;  4DSI A; 
#chains in the Genus database with same CATH topology
 4JKD A;  5AZI A;  4N56 A;  5LMU K;  3T69 A;  2E1Y A;  3WXI A;  4BRE A;  3QIN A;  5GAG P;  2BDP A;  1BA0 A;  4CJE A;  1S9G A;  3DLE A;  4M45 A;  3ZEU B;  1VQ4 N;  3QB0 A;  3RR8 A;  3LM9 A;  5ELZ A;  1JLB A;  4IG3 A;  3CCE N;  3LWL A;  1EO1 A;  3O4W A;  5BRF A;  3Q7B A;  4PKH A;  4DQ8 A;  4PKG A;  4I6M B;  4FXD A;  4ZTF A;  3RSE A;  1P90 A;  5BRH A;  1CZB A;  3NH0 A;  5LL6 Z;  4XH1 A;  4M7Y A;  1EQY A;  1TKZ A;  4CHO A;  2QW9 A;  5F0X A;  2Z1J A;  2Q0U A;  4FLZ A;  4FLU A;  3HI0 A;  5BRE A;  3VGL A;  1TVR A;  1ZBS A;  3U9Z A;  3AY9 A;  3D6R A;  2WTU A;  3ZSR A;  1G99 A;  4M7X A;  3MK6 A;  3I8B A;  1YI2 N;  1IKY A;  3VER A;  4B1U B;  1T8E A;  2HHS A;  1LWF A;  4H5V A;  2YNI A;  3OYL A;  5HRP A;  5AQU A;  4RTF D;  4CF8 A;  4M63 C;  2YJF A;  1BCM A;  3F2K A;  1W97 L;  1RTH A;  1QSL A;  2P9I B;  3LAM A;  4AHV A;  2HF3 A;  4YFU A;  4H0O A;  3LP2 A;  3CCL N;  1EET A;  3LZI A;  4O55 A;  2Y1J A;  3KWI A;  1RT1 A;  3THV A;  4HCC A;  2NRZ A;  5AQX A;  4CJ7 A;  3H45 C;  3FR0 A;  4CED A;  4AM6 A;  3HBT A;  3PSF A;  4E7L A;  2NRX A;  1LW0 A;  5D3G A;  1TUY A;  4QS7 A;  5MLC Q;  1RT7 A;  3GG4 A;  1BL3 A;  2A3Z A;  4CFD A;  3LZJ A;  4LF4 K;  1C0T A;  5AQH A;  1I94 K;  5HRS A;  2G8H A;  2WFB A;  3RMB A;  3KD1 E;  4IZ9 A;  4QS8 A;  3MDQ A;  4BRC A;  4JI8 K;  1W0H A;  3SPZ A;  3OA9 A;  4X66 K;  4LF7 K;  4ELU A;  5TKY A;  3ZX2 A;  3I0S A;  1SKR A;  1VHX A;  3P31 A;  4KHW A;  3K5L A;  4IO8 A;  3ZT4 A;  1U48 A;  4R5P A;  4JNE A;  4IXC A;  2O8B A;  4OLB A;  3DXK B;  4WYB A;  2P5O A;  2Q3S A;  2IC3 A;  4CJ3 A;  2BE2 A;  4H4M A;  2IDO A;  1OVY A;  3H3O B;  2P1J A;  4CHQ A;  3WXL A;  1YUW A;  4CZI A;  3UKU A;  4GKJ K;  3NGY A;  3CC2 N;  3AGK A;  3OHR A;  3U9D A;  4JK7 A;  4M3Z A;  4WFB L;  1VQM N;  1YVU A;  3FZM A;  3I0R A;  1NJX A;  4CK1 A;  4CJR A;  1NGF A;  1HPZ A;  3R1X A;  3M3Z A;  5AQW A;  3NBP A;  5KGX A;  1BGX T;  4CGJ A;  3BY5 A;  4NB4 A;  2XY7 A;  3NFA A;  4IWV A;  2VQF K;  4FJ9 A;  2D1K A;  3SAH A;  1TGO A;  4CIE A;  3IFR A;  3I55 N;  3ID8 A;  4CF9 A;  2RKI A;  4OGE A;  3OYF A;  2OYQ A;  3QBW A;  3PO4 A;  3CG7 A;  4CGD A;  1YJN N;  3K57 A;  3AO5 A;  3LAN A;  3R9P A;  1NLV A;  1BI4 A;  4BR4 A;  1U47 A;  4EHT A;  2O8F A;  4Y1D A;  3A0I X;  1T3V A;  1ILY A;  4DS5 A;  1SQK A;  4E0D A;  3CHW A;  4BDY A;  2Z1I A;  4MQ3 A;  2QTD A;  1M1K O;  4A2A A;  5HRO A;  1L3T A;  1K9M O;  3MEG A;  1J5E K;  4CD1 A;  4CJ4 A;  5C2D A;  2HHH K;  3LP0 A;  3MCA B;  4FM2 A;  1R59 O;  3TR8 A;  5IT9 O;  3MAQ A;  3AAP A;  1GLJ O;  3NHG A;  3O3G A;  4PUO A;  4Z4I A;  1FJG K;  5AJ3 K;  1BA1 A;  1XNQ K;  5J2P A;  3WNF A;  1Z6R A;  3HSC A;  1BOT O;  4YY3 K;  4IO9 L;  4KH5 A;  4LF6 K;  3A8Y A;  1KC8 O;  3DJC A;  2E88 A;  3UIQ A;  1BQN A;  4JEP A;  5AQK A;  4CZH A;  1BHL A;  4DFK A;  3AVC A;  4BRA A;  4KI4 A;  1YIJ N;  1HNW K;  3ZT2 A;  3HP6 A;  4JYA K;  3LDL A;  3KVG A;  3VQ6 A;  3C94 A;  1NM1 A;  2YHW A;  1QSS A;  4N76 A;  5AQS A;  3V81 A;  3CM5 A;  4CJW A;  4DMN A;  2EWS A;  3SUQ A;  3ULE B;  5EOY A;  3OJS A;  5JS2 A;  5E41 A;  3HYF A;  3L3U A;  1NGD A;  1D8Y A;  2O8D A;  2YKN A;  3CD6 N;  3AO4 A;  2NUB A;  4KBO A;  1KSP A;  4B1V A;  2QWQ A;  3DXM B;  2DPN A;  1EWQ A;  2DFH A;  3MX2 A;  4E7I A;  4DSF A;  4KHQ A;  3TPQ A;  2P9L A;  4E1M A;  4AH9 A;  3MWP A;  4L3Q A;  1QVG M;  2WBN A;  4JKH A;  5HRR A;  1XNR K;  2G8K A;  2W42 A;  1IBM K;  4B8C A;  2RN2 A;  4H03 B;  2P51 A;  3SMP A;  1Y64 A;  3DRR A;  4DUZ K;  4FYD A;  2QWN A;  1KAX A;  1NJI O;  1L5U A;  4J8F A;  2BAN A;  1CXU A;  2B6A A;  4NYN A;  2GEL A;  4HVJ A;  1VSM A;  4Y0W A;  4WQ5 A;  3OS0 A;  1Q81 O;  3S41 A;  3CJC A;  3T7Z A;  1WSJ A;  2VWJ A;  4NCA A;  4C8O A;  1S6Q A;  2Q31 A;  3NDK A;  3SZ2 A;  4HHT A;  2E2O A;  4BRD A;  3VOV A;  2HHT A;  2D0B A;  3U8X A;  1N33 K;  4HUG A;  1IKV A;  2GUI A;  2UXC K;  3AVK A;  3O9T A;  2RHK A;  1REV A;  3RMD A;  1S72 N;  5K14 A;  2UXD K;  3JSM A;  1A5X A;  4B1W B;  4WQ4 A;  3AA5 X;  4JAX A;  3KK1 A;  4DQR A;  2FF6 A;  3LDO A;  4YDU A;  2A6A A;  5AFU H;  4FLY A;  4FLX A;  2BTF A;  1NGE A;  1LW2 A;  4MLE A;  4B3M K;  2VG5 A;  1OKJ A;  4ICL A;  4EP5 A;  1DLO A;  2JLE A;  1M90 O;  2YV0 X;  5M1K A;  3CFP A;  5BPL A;  2V7Z A;  3ENB A;  2FBY A;  3V9Z A;  2NRH A;  3C6H A;  1VK0 A;  4DTS A;  1LAV A;  4JI1 K;  1B9F A;  3IRX A;  5C25 A;  2VCP A;  2X78 A;  5AFU A;  3WT0 A;  5M1O A;  2X6S A;  4R79 A;  5FLX O;  3VQ9 A;  2X6N A;  1ATS A;  1X9W A;  3O3H A;  5HOO A;  4ILJ A;  4CJL A;  1DKG D;  4CEQ A;  1S3X A;  3S3N A;  4OO1 J;  3OYE A;  2RPI A;  2PYL A;  3CCQ N;  4FLT A;  3KLH A;  4MDB A;  4HUF A;  2W6L A;  3O4Q A;  3SJJ A;  1RBR A;  4O8K A;  5T7B A;  4FVM A;  4DU1 A;  4CJT A;  2O8C B;  4OKE A;  1C1A A;  2O8E B;  2HBM A;  1SZ2 A;  1S1T A;  1TV6 A;  2OPR A;  1N32 K;  3V1R A;  4F8R A;  2FSJ A;  1RTI A;  4YOY A;  3VES A;  3MN6 A;  3NGI A;  5EVZ A;  1GLC G;  1WSF A;  4E7K A;  2HNZ A;  1E4F T;  4H0P A;  4JD2 A;  4DU4 A;  3SK3 A;  1HRH A;  2QKK A;  3OY9 A;  4OKK A;  3PX6 A;  3CPW M;  5EXW A;  1K6Y A;  3BDP A;  3EL2 A;  1T7P A;  3OYC A;  4LC9 B;  5GIP A;  3VTI A;  4FSV A;  4CEE A;  1YJW N;  1NKC A;  3NVM A;  5CY4 A;  4LFA K;  1VQ5 N;  4DF8 A;  5C12 A;  1S22 A;  1V4S A;  4KH6 A;  3EKS A;  4CHZ A;  4BE2 A;  2ETJ A;  2F9W A;  4M41 A;  4DCH A;  4JRQ A;  3VEX A;  2VG6 A;  3LWM A;  4IBN A;  2G8F A;  1JLQ A;  2YNF A;  2HBL A;  4XH4 A;  2ITM A;  1BIU A;  4CE9 A;  1KRP A;  4O8U A;  5KGW A;  3WQT A;  2F8S A;  3SV4 A;  4Z94 A;  1WBD A;  4DQP A;  3P4I A;  3M6G A;  4JS4 A;  3VET A;  1IO2 A;  2P9N B;  1XHZ A;  3L8B A;  3L2W A;  4H0T B;  3HP9 A;  2UU9 K;  3WEE B;  3OBW A;  2KTQ A;  3ZSW A;  2EHG A;  1JCG A;  2QM1 A;  4ID5 A;  4FK0 A;  3ATU A;  2NRT A;  4BRL A;  3EKU A;  3A5M C;  1Q8I A;  4CJF A;  2E2N A;  1QHT A;  3ZET A;  3L3V A;  3O9U A;  4WFA L;  1C0G A;  4IJN A;  4FWN A;  4H5W A;  1FXX A;  2ASP A;  3Q7C A;  3J81 O;  1YT3 A;  3AO2 A;  3P38 A;  4K41 A;  3T19 A;  2I5J A;  3CER A;  3D2F B;  1BG3 A;  1JLE A;  4FM0 A;  3BF1 A;  4JKF A;  4C8L A;  2V51 B;  3I33 A;  4C1N K;  4AM7 A;  1LOT B;  4CIF A;  3ZSO A;  1EX4 A;  4CZG A;  2F96 A;  2P9S B;  3K59 A;  1JL2 A;  1J53 A;  2E2Q A;  4E1N A;  3D2E B;  4RW6 A;  1T05 A;  3E01 A;  4BVO A;  1VQ8 N;  3CC7 N;  2VGN A;  4DKW A;  4KHY A;  4ISG A;  4FJ5 A;  4DV0 K;  3DOL A;  2E6M A;  1NMD A;  2YJE A;  3MXJ A;  4CJP A;  4GVE A;  4B3S K;  4DS4 A;  5F2R A;  4OPA A;  4OKJ A;  1GOB A;  4FWS A;  4MLH A;  5M1N A;  1Y97 A;  3NAE A;  1QZ5 A;  1WLJ A;  2KFZ A;  4I7F A;  4KB1 A;  4UY8 O;  1U2V A;  4PHT X;  3CXC M;  3QIP A;  3OYD A;  3ALY A;  3R8E A;  3SJH A;  3ZX3 A;  4DSK A;  3N4P A;  3WQU A;  2UYT A;  3ZLJ A;  4FZY A;  4M3X A;  3SYZ A;  1JLA A;  2YNG A;  1SL2 A;  1RBS A;  4FOI A;  3RVC A;  2IGI A;  2V52 B;  3VA3 A;  1NK6 A;  2Q0R A;  3O4N A;  3D0P A;  3FZK A;  4RW8 A;  1RDC A;  2FF3 B;  4OJR A;  3WXK A;  3RR7 A;  3MCP A;  5BR9 A;  4YHH K;  1RBV A;  3VEO A;  3TAE A;  1WNS A;  1LAW A;  5FPD A;  2CH5 A;  2HB5 A;  4WCE L;  2XHB A;  2F7T A;  2ZF5 O;  3BEX A;  4JKG A;  1HNI A;  3OBY A;  4EZ6 A;  4B9U A;  1VQ9 N;  1EXQ A;  1NGI A;  4FJX A;  3NMU A;  3UKR A;  3G25 A;  2FLO A;  2HST A;  2NRR A;  2ATQ A;  3PV8 A;  1KAY A;  2WON A;  3CCU N;  1KLN A;  1U2V B;  4BE1 A;  3V9X A;  3OVN A;  3S9H A;  1VQL N;  4NCB A;  2LSN A;  2FC0 A;  1WAF A;  4O0J A;  4LSL A;  2F9T A;  4Q5V A;  4DF4 A;  3E9P A;  1B92 A;  2Q97 A;  4DG1 A;  3VPZ A;  3HO1 A;  4X64 K;  3F5T A;  4EIA A;  4FJN A;  4GKK K;  4FWL A;  4O5B A;  3TTF A;  1RT2 A;  5EY4 A;  3TAG A;  4LF5 K;  4RW4 A;  5KTQ A;  5BN9 A;  1NK9 A;  3S3O A;  3ZX0 A;  1DEJ A;  3RMC A;  4DFM A;  4BR9 A;  4FZZ A;  3DI6 A;  4FCY A;  3K9K A;  5AZI B;  3M8R A;  2GBZ A;  3MWT A;  1N6Q A;  3G10 A;  3LPU A;  1ASW A;  4CJK A;  1VQN N;  3T1Y K;  5ADX A;  1MA9 B;  4DR7 K;  1XHX A;  2ZGY A;  3AVM A;  4RW7 A;  3UKR B;  2KKZ A;  2ZGZ A;  1HR0 K;  3HRG A;  1LWE A;  1IJJ A;  4DV1 K;  1WN7 A;  1NJY A;  3O6W A;  3RWU A;  1JCF A;  2UUB K;  3ZT3 A;  4NXM K;  4IFE A;  1NJZ A;  4C8N A;  4GW6 A;  3CI5 A;  3M1F A;  4JK8 A;  5KRS A;  1G15 A;  3V9W A;  1KFD A;  4W5O A;  2G8I A;  4BRP A;  3RSE B;  4DR4 K;  2OZS A;  4KTZ A;  3I8D A;  3SUN A;  3KLE A;  1C0U A;  4K25 A;  5AQV A;  3NVK A;  1VSE A;  5E26 A;  1RT6 A;  4XEI A;  4ELT A;  4W5Q A;  1CLQ A;  4BRH A;  3OYI A;  2FSK A;  3V1O A;  1A5V A;  3SUO A;  3DLR A;  1WSH A;  4BQL A;  2OA8 A;  4BVP A;  3QLH A;  3VEY A;  1OVQ A;  3H3N O;  5JMV A;  4BRF A;  3CC4 N;  4DTX A;  1VQO N;  2IS3 A;  3MEC A;  5AQN A;  2A40 A;  3CCJ N;  5KPT A;  3V4I A;  3ASM A;  1NGH A;  4H8K A;  3CM6 A;  1RT4 A;  1NK0 A;  3HK2 A;  2W40 A;  2YKM A;  2P9P A;  1ATN A;  5C10 A;  1HYS A;  2FBX A;  3CYM A;  4FVU A;  1YXQ A;  3A2F A;  5AQL A;  3CFR A;  4AIL C;  3KWG A;  2UUC K;  4FWR A;  3VQ7 A;  3O1W A;  5AQG A;  1B9D A;  4XIU A;  4IEE A;  1WB9 A;  4BAC A;  1Q86 O;  3W3D A;  5TKW A;  4LF8 K;  4DV7 K;  1RDA A;  3AVN A;  1RNH A;  3KTQ A;  2HVI A;  4IFY A;  3UE5 A;  1HPM A;  3OYA A;  4G1Q A;  1W7A A;  4DTO A;  1Q7Y O;  3DLG A;  4CZE A;  1W2B M;  4KPY A;  3QEI A;  1QQN A;  4Z4G A;  5BRD A;  4KKO A;  3JS6 A;  4N5S A;  3VQ8 A;  3KK2 A;  2IAJ A;  4A2B A;  2GV9 A;  4JI2 K;  4FJL A;  1NMN A;  3AGR A;  2O8B B;  1TYQ A;  4WQ5 C;  3CQ8 A;  3KHY A;  3RRH A;  2KLA A;  4AHR A;  3AA3 A;  3FZH A;  4X65 K;  1TK0 A;  2QA4 N;  1K8A O;  1FK9 A;  3KLF A;  3UKU B;  1S9E A;  3O8M A;  1A5W A;  3AVJ A;  5J2Q A;  5BR8 K;  1S1V A;  1C6V A;  2I7N A;  3VGK A;  1VSL A;  2KQ2 A;  3DM2 A;  4KO0 A;  3VQD A;  3TAB A;  4LFB K;  4H5T A;  1XC3 A;  4W5T A;  4FJ7 A;  2IOC A;  2JGU A;  4KHU A;  2QEX N;  4MO5 A;  1QSY A;  3J8A A;  4WQ4 C;  3VF4 A;  2HHV A;  4F2R A;  4B9L A;  2AP1 A;  4YDU C;  1P8Z A;  1EP4 A;  1RBT A;  4DV3 K;  4B3T K;  4AHU A;  3SBT A;  4CJS A;  3HPH A;  4OPH A;  4DTJ A;  4KI6 A;  4B1Z A;  4JK9 A;  4X62 K;  4CJQ A;  4DTM A;  3SNN A;  4CF2 A;  5J1E A;  2JWK A;  3A5N C;  4A5B A;  3KKS A;  4OGC A;  4PA1 A;  1BI4 B;  1RCH A;  3O5B A;  2Q2R A;  3VGM A;  4DTP A;  2O8F B;  1VAZ A;  2YHB A;  4OPK A;  3L6Q A;  4DTR A;  4K8Z A;  4CEB A;  4KTW A;  3EE9 A;  3EY1 A;  3U3Y A;  1X9J A;  4DQI A;  3PY8 A;  3O08 A;  4XH5 A;  3KLG A;  1NNE A;  3OYN A;  3OYJ A;  4K0K K;  4CZL A;  4M3T A;  4BG9 A;  1NOZ A;  1ZXO A;  4OLA A;  4ISE A;  1HNZ K;  2RF2 A;  2GUP A;  3F9K A;  2ZQB A;  4C8K A;  2E2P A;  3HOT A;  4IG0 A;  2OPQ A;  1TK5 A;  3CCM N;  4IEI A;  1NG9 A;  3HVR A;  3HZ6 A;  4YOV A;  3SQ1 A;  3T1H K;  1RDW X;  2F4V K;  1IKW A;  2VQE K;  1T6D A;  4FO0 A;  3NCI A;  4DR1 K;  4CFC A;  3V1Q A;  3QBX A;  3HL8 A;  2ZD1 A;  3VQC A;  1DTT A;  4CK3 A;  5FPE A;  5GAD P;  3NGZ A;  4H5R A;  4E89 A;  3GL1 A;  3MEE A;  3ZT0 A;  1RDU A;  5HP1 A;  1FKP A;  4CF1 A;  5A2Q O;  1Z26 A;  4EP4 A;  3TAR A;  2YCH A;  3CFO A;  1N5Y A;  3A5O C;  3B6O A;  4KHN A;  3ZSV A;  3PLA A;  4NLB A;  3VQ5 A;  3BZK A;  3OYK A;  1L3S A;  2OTJ N;  2O8D B;  3G6E N;  1X3M A;  4N47 A;  3VEZ A;  3AVH A;  2NRV A;  2YHY A;  4RW9 A;  4CEA A;  4BY9 C;  3CIP A;  2P9U A;  5KRT A;  3TAM A;  4DWI A;  4O4G A;  2P9L B;  1XI1 A;  3OTO K;  2HHX A;  3IDH A;  2HVH A;  3VQQ A;  2KZZ A;  2G8W A;  4W5R A;  3VN5 A;  3NF6 A;  3DLL L;  4HWI A;  3DRS A;  1RTJ A;  1D5A A;  5H1S Q;  2YHX A;  3GOI A;  3E9L A;  3D45 A;  2HMI A;  3MN5 A;  4CBU A;  3K9J A;  3AVG A;  1S1X A;  1WSG A;  1TKD A;  1BCO A;  5EU7 A;  3HTV A;  1QQO A;  4FW2 A;  4DV6 K;  3DLB A;  4NXN K;  3PX4 A;  4TSX A;  3QFP A;  5M1Q A;  2GWJ A;  1DT9 A;  4CGF A;  2UXB K;  1BWF O;  1ZBF A;  3QFU A;  2QK9 A;  3CJB A;  1YVN A;  5BPN A;  5LY3 A;  4L8R B;  2ZJP L;  1N34 K;  3IAY A;  2HBK A;  3TTC A;  3SCX A;  4B08 A;  1F21 A;  3RMA A;  4NCG A;  2E6L A;  3CCR N;  1NK8 A;  1YAG A;  3U6F A;  4GV6 A;  2DY4 A;  3P39 A;  1I39 A;  1RT5 A;  1VRT A;  5AR0 A;  1HKG A;  4YOU A;  3AVB A;  5JVH L;  1J6Z A;  4IKF A;  2DFF A;  4K8X A;  5C0Y A;  2WC9 A;  4CJV A;  3OW2 M;  5AQI A;  1TUU A;  3C95 A;  4DV5 K;  3A5L C;  4E1J A;  1QHA A;  2YI1 A;  3AA2 A;  1C1C A;  3MED A;  1FW6 A;  3THX A;  4DR6 K;  4FJM A;  2ITG A;  2ZE2 A;  4FLW A;  3C6A A;  1IKX A;  1L3U A;  3C0B A;  4PL7 A;  3E66 A;  3CJA A;  3GDQ A;  2PYJ A;  3MMV A;  4FLV A;  3AA4 A;  2HHW A;  3KD5 E;  2E20 A;  1VSI A;  2AJQ A;  4CJ5 A;  1QQC A;  4C8M A;  3AO1 A;  3H46 O;  5AQT A;  3TI0 A;  4JRP A;  5SZT A;  4NO7 A;  4Z0U A;  2CGJ A;  3V9S A;  1X1P A;  4C1N I;  2XY6 A;  3DOK A;  5I9E B;  5CZ1 A;  2HHU A;  4CZJ A;  1RFQ A;  5LMN K;  2P9K A;  5C2F A;  2H3G X;  4FOE A;  4FK4 A;  1GLB G;  1KVB A;  4F2S A;  4Z4C A;  1VSH A;  3AVA A;  1J5O A;  3VEN A;  2D0A A;  1GLA G;  1YHQ N;  1E3M A;  3AAR A;  4JD2 B;  2AA4 A;  1HKC A;  2VWB A;  3KK7 A;  4B9S A;  5AZJ A;  1S6P A;  4BRQ A;  1NGB A;  3NH1 A;  5BN8 A;  2OZM A;  4JKB A;  5CHI A;  5DM7 L;  1KTQ A;  3S3M A;  2FXU A;  4PQU A;  4I2Q A;  1VSK A;  3HT3 A;  1SKS A;  3M8S A;  3CMA N;  2QWP A;  3CJ1 A;  1RTD A;  1SV5 A;  3BZC A;  1VSD A;  4CES A;  3ENH A;  5GAH P;  3FZF A;  4BC5 A;  5FRN A;  4CEO A;  1QTM A;  4IOC L;  2KZM A;  4WE1 A;  1GOA A;  3QEV A;  2NLX A;  3FFK B;  1E4G T;  3M8P A;  3HPO A;  4CGH A;  5FRO A;  3VQE A;  3MXM A;  4B3O A;  1VSF A;  5AQJ A;  3PUF A;  4BR7 A;  3THW A;  3L2Q A;  4CZM A;  2P9K B;  3OYB A;  1WOQ A;  1JLG A;  4H0X B;  3K58 A;  1IBK K;  2NZT A;  2Y1I A;  3EZW A;  2HNY A;  2OPP A;  4OPJ A;  4CVN E;  4ILG B;  4U7B A;  1WBB A;  2VYP A;  3CQX A;  5EX5 A;  1D9D A;  5AZJ B;  3RTV A;  3EN9 A;  2HW3 A;  1LWC A;  4FK2 A;  5DM6 L;  1NU0 A;  1JCE A;  3QO9 A;  3QEX A;  4GV3 A;  2B4J A;  3TAQ A;  3AVI A;  1KFS A;  3IG1 A;  1TK8 A;  1ZYQ A;  3K2P A;  4H0V B;  5CYQ A;  1C0M A;  3LPT A;  3IUC A;  3E1Y A;  1LCU A;  3ZET B;  2FBV A;  1YIT N;  1L3V A;  4ZHR A;  1KLM A;  2W41 A;  4FJH A;  1U45 A;  3CPE A;  4JKE A;  1T03 A;  4BRN A;  3AVL A;  3UB5 A;  3AV9 A;  4EAH D;  3W0L A;  3V6D A;  3L2U A;  1VQ6 N;  3J7A P;  5C15 A;  3J7Y P;  2OCE A;  4CHN A;  4CD3 A;  5CR4 A;  3WXJ A;  3ATV A;  3QNN A;  4MO4 A;  1TL1 A;  4CHP A;  2E1Z A;  3WNE A;  4CFB A;  3ZEU A;  4CBW A;  4V19 S;  2XY8 A;  1KQS M;  4DR5 K;  3F9M A;  4GY2 B;  1RBU A;  4JI0 K;  4GMJ B;  3B8A X;  1HJO A;  4J2E A;  4I6M A;  5M1F A;  3NE6 A;  2KFN A;  3FE1 A;  1GLF O;  3KJV A;  4BR0 A;  1VQP N;  4DLE A;  2FSN A;  2QWL A;  3SUP A;  3KKR A;  4KRF A;  3QDK A;  2JWL A;  4BE0 A;  5I42 A;  3TU5 A;  4I9Q A;  1O1W A;  4DV2 K;  1JJ2 M;  4DR3 K;  2QI2 A;  5CE3 A;  5JIC A;  4ILH A;  1NGC A;  1Q9X A;  3B6P A;  1T6C A;  3SPY A;  1BDG A;  1HYZ A;  5KPZ A;  4B8A B;  3OYG A;  3IKM A;  4BWJ A;  1OH8 A;  4FWQ A;  4OX9 K;  1T44 A;  5IWA K;  4E19 A;  2HBJ A;  1HJR A;  1U49 A;  2P9I A;  2A42 A;  1VQK N;  5ADX H;  1IH7 A;  4BC3 A;  4KRE A;  3LAL A;  5GIO A;  3EEQ A;  4BRG A;  4DU3 A;  4KFB A;  2YHA A;  3F73 A;  1FKO A;  4MFB A;  1XMQ K;  4CZK A;  5FPM A;  3EYZ A;  4HTL A;  1SS6 A;  4JKG B;  4WF9 L;  3H08 A;  2IIR A;  3SMS A;  3J80 O;  2OAN A;  3FZL A;  3HM8 A;  5CYM A;  4GNI A;  4YOT A;  4J2B A;  5KPR A;  1HNX K;  2I7P A;  2V7Y A;  3L4Q A;  5I3U A;  1TAQ A;  4FPA A;  4ELV A;  3C6U A;  1CZA N;  1QS4 A;  3AVF A;  3LDN A;  5FRM A;  2ASO A;  1BUP A;  3QIC A;  3LP1 A;  4BRI A;  3QEP A;  1ASU A;  3BUZ B;  3TTD A;  3M8Q A;  4ID1 A;  3DXK A;  2YX6 A;  5SWM A;  2E4L A;  4B1Y B;  4LD0 A;  5E84 A;  3LDQ A;  5FPN A;  3R3L A;  1Q9Y A;  5AQF A;  3NF9 A;  1UA0 A;  4BRO A;  4U67 L;  4YOW A;  4O44 A;  3OS1 A;  4Z4F A;  4DV4 K;  4FWP A;  3VQ4 A;  2R7Y A;  3QET A;  3P5J A;  3JXU A;  4YNQ A;  4CCH A;  3O80 A;  3MXI A;  5JLH A;  1QQM A;  3QES A;  1ZBU A;  2B5J A;  3C6T A;  3OYH A;  1K73 O;  1BO5 O;  4NYF A;  3WNH A;  1ZBH A;  1YTA A;  5DK5 A;  3CQY A;  1KCF A;  4LH4 A;  2HOE A;  3SQ0 A;  1KVC A;  2A41 A;  3CJ7 A;  5KI6 A;  4EFH A;  2E8A A;  3M5R A;  1JL1 A;  1JKH A;  4CK2 A;  5HL7 L;  4FZX C;  4B9M A;  3L2V A;  1IBL K;  4E3S A;  3ISN C;  3ZSX A;  1MWK A;  4EHU A;  1TKT A;  1GLE G;  4DB3 A;  3ENO A;  1WUA A;  4RCH A;  4I2P A;  3TSU A;  4KV8 A;  1ZBI A;  1X9M A;  3LDS A;  1XC9 A;  1S1W A;  4BR2 A;  2G8V A;  3ZSQ A;  1EKE A;  4CBX A;  3THY A;  4KB0 A;  2CGL A;  4LFC K;  1KAZ A;  4CW7 B;  4FJK A;  1HNV A;  4YOR A;  3P1G A;  3VTH A;  3JAM O;  4JI4 K;  4WFN L;  5CZ2 A;  1GOC A;  3L0Q A;  2NRW A;  3MX5 A;  3H1Q A;  4O5F A;  1ASV A;  2P9P B;  2XRI A;  4JI5 K;  4CF0 A;  1BIS A;  2HMP A;  3SLC A;  3P83 D;  4BDZ A;  3GE1 A;  4AHS A;  3NF7 A;  3C7N A;  5LJW A;  3N4Q A;  4NLC A;  1K8K A;  5HBM A;  4BWM A;  4DFJ A;  3DWL A;  3FFI A;  2PBD A;  1N8R O;  4JKC A;  1UA1 A;  1JXB A;  4EZ9 A;  3G71 N;  4JHD A;  4RWT A;  4G9Z A;  2GEM A;  1WSI A;  2CGK A;  3VQA A;  3THY B;  3O3F A;  1ITG A;  2WUS A;  3ULE A;  1UAX A;  5F1X A;  4JI6 K;  1KXP A;  5B8H A;  4CEF A;  4BC4 A;  5JLF A;  3EZ5 A;  4HTU A;  1SL1 A;  1S5J A;  2O4I A;  4O0I A;  3PIP L;  4KAZ A;  4I9L A;  3L2R A;  4J2A A;  1I3A A;  4BR5 A;  3H6E A;  4LH5 A;  1TYQ B;  1IV0 A;  2D4W A;  3SQ4 A;  1C0F A;  3DXM A;  2Z1H A;  2PAV A;  3PSI A;  3QER A;  1HYV A;  5GIN A;  4W5N A;  1SKW A;  1OH5 A;  1RGI A;  3LL3 A;  4JLH A;  2OTL N;  3DAW A;  3FGU A;  3CCV N;  4DTN A;  3QIO A;  2ASM A;  4QAG A;  2VG7 A;  5AQR A;  1EWR A;  1LV5 A;  3DLH A;  3K5M A;  2UUA K;  3C7N B;  3ULD A;  3JYT A;  2ZM6 K;  4IDH A;  5M1P A;  1DTQ A;  2W6K A;  3HPG A;  1X3N A;  4BG8 A;  4A57 A;  1K8K B;  1RDB A;  2G8U A;  1H1V A;  3ZCM A;  3U3G A;  4B9N A;  3TWH A;  4CGI A;  1NK7 A;  4JHD B;  4B3R K;  1J54 A;  2QKB A;  4A61 A;  5HLF A;  2RE2 A;  4PKI A;  1NJW A;  2NNW A;  1HMV A;  3C65 A;  3SAG A;  3U4L A;  3PO5 A;  4DSE A;  4JN4 A;  1U04 A;  1NOY A;  3VQB A;  1NGJ A;  4H0Y B;  3K5O A;  4FJI A;  4CHY A;  1KVA A;  3O9S A;  4M3R A;  4M42 A;  2D0O A;  3MN9 A;  2D5R A;  1MDU B;  5C42 A;  4JI7 K;  2GTD A;  4B9Q A;  1YJ9 N;  1NGG A;  2EX3 A;  4C23 A;  1XMO K;  1YF5 L;  3CJ9 A;  1XQS C;  1QVF M;  4BGB A;  4CFA A;  4F3O A;  1BU6 O;  3LP3 A;  1CXQ A;  4BRM A;  4FJ8 A;  3ITH A;  1Q82 O;  2DTU A;  3O1B A;  4B9V A;  5AQO A;  2ZJQ L;  3G4S N;  4LSN A;  2WOM A;  1YTU A;  1MU2 A;  3MN7 A;  2CH6 A;  4DSL A;  5BPM A;  2P5G A;  1CZ9 A;  4CI6 A;  4F3T A;  2BGG A;  1RT3 A;  1GLL O;  1SAZ A;  3VA0 A;  2O4G A;  3HXM A;  3ZSY A;  3VF2 A;  1SL0 A;  3BP8 A;  3VEW A;  4M3U A;  2XO7 A;  3SAF A;  4JV5 K;  4DQS A;  2KW4 A;  3LAK A;  1R0A A;  1HX1 A;  4F4K A;  1V4T A;  3EO3 A;  3OJU A;  1XUP O;  1GLD G;  4Q0B A;  2QWR A;  2O8C A;  2O8E A;  1VRU A;  1Z25 A;  3WNG A;  2QXF A;  4DUY K;  4M3W A;  1BIZ A;  4OVL A;  4JKA A;  3V9U A;  3EE8 A;  3DLK A;  3O9Q A;  2Z1G A;  1TAU A;  3QNO A;  4PY5 A;  5HRN A;  4IJA A;  1ZC6 A;  3TAF A;  1VSJ A;  2BUP A;  4IOX A;  1JXE A;  3BF3 A;  4DLG A;  2QWO A;  3VMF B;  3HST B;  4CZF A;  1RDD A;  4F9O A;  3G0Z A;  1NKB A;  2P9U B;  4GVM A;  4BDP A;  3CCS N;  3CET A;  4AHC A;  3GBT A;  4BQZ A;  4FW1 A;  1Z05 A;  1OH7 A;  5DMR A;  1QZ6 A;  2XY5 A;  1HQE A;  3SBG A;  4DQQ A;  3VQP A;  1W9H A;  3HM9 A;  1X9S A;  1NWK A;  4KHP K;  2D0C A;  1NK4 A;  3QML A;  4MDA A;  2E5L K;  4JS5 A;  1C1B A;  3KIO A;  2VWK A;  3TAP A;  4CEC A;  5AQQ A;  4DR2 K;  1UWB A;  4DHY A;  4A62 A;  3H1V X;  3RRG A;  3SQ2 A;  1ZBL A;  3KK3 A;  2P9N A;  3ZYY X;  1QE1 A;  3VF6 A;  4M3Y A;  1KD1 O;  4N41 A;  3K0S A;  3CME N;  2F8T A;  3IMX A;  3WEE A;  3VEV A;  1IG8 A;  4FWM A;  4K43 A;  3TSP A;  4K42 A;  1SUQ A;  3DRP A;  3HJF A;  5AQP A;  3ID6 A;  4HCB A;  4DSJ A;  2QXL A;  1NBW A;  4JI3 K;  1JLC A;  1NK5 A;  4J2D A;  4IDK A;  3SI6 A;  4E7H A;  4E7J A;  4RG8 A;  3T3F A;  3DMJ A;  1ATR A;  3PX0 A;  3CF5 L;  4KHS A;  2GWK A;  1S1U A;  2BH1 A;  4FWK A;  1WSE A;  3D2F A;  4A5A A;  2GX9 A;  4KTQ A;  3OS2 A;  4FPB A;  3FLC O;  3THX B;  3WUH A;  4AQY K;  4H4O A;  1NKE A;  2P9S A;  3J7Z O;  1J9A A;  5JS1 A;  3KLI A;  4BC2 A;  2J4R A;  3D2E A;  2A1S A;  4CGG A;  4LY7 A;  3KZB A;  3R6M A;  3PIO L;  2Q1N A;  4H5N A;  3SV3 A;  2PZS A;  5AQZ A;  3TAN A;  2Q36 A;  2HHQ A;  1VQ7 N;  5GAE P;  4KH4 A;  4LF9 K;  3E9O A;  3L4I A;  1OH6 A;  4IOA L;  1TL3 A;  4QS9 A;  4CIG A;  1HQU A;  4PL8 A;  1HUX A;  1HKB A;  4B9T A;  1MWM A;  1JLF A;  1IG9 A;  5J2M A;  4FL9 A;  2HND A;  2IVO A;  3LDP A;  2D0P A;  4CJU A;  3BGR A;  4A59 A;  2VGM A;  1O13 A;  4AHT A;  4FJJ A;  4Z4H A;  4FJG A;  3T1A A;  3O9R A;  1TKX A;  2X74 A;  5FDL A;  5LJV A;  2IVN A;  5KQ8 A;  3HOS A;  1BQM A;  1WAJ A;  4Y1C A;  3NH2 A;  2IVP A;  3AAQ A;  4ISF A;  4IFV A;  4UQG A;  4FWO A;  5J2N A;  3DYA A;  1Q18 A;  4HUE A;  3HVT A;  5AQM A;  3LM2 A;  5AQY A;  3OYM A;  1U4B A;  4PWD A;  1ESV A;  4QOZ B;  3THW B;  3ZSZ A;  3I56 N;  4CEZ A;  2HF4 A;  1RIL A;  2PFU A;  2ZJR L;  1D4X A;  2A1R A;  1XWL A;  1HLU A;  3ZT1 A;  4YOX A;  3QEW A;  2FBT A;  2ZWH A;  3D7E O;  3NF8 A;  1DGK N;  4Z4E A;  1N36 K;  4CER A;  4QCL A;  4DTU A;  4BRK A;  2YNH A;  1NGA A;  3TSQ A;  4DFP A;  4BGA A;  1D9F A;  2PY5 A;  1UOC A;  5KQD A;  3K5N A;  4GV9 A;  4AF1 A;  1U6Z A;  2A5X A;  3IS9 A;  5JVG L;  5C24 A;  2KHO A;  2QWM A;  4B1X B;  2OPS A;  4ZTJ A;  3WXM B;  2DFE A;  3AO3 A;  4FM1 A;  4DSI A; 
#chains in the Genus database with same CATH homology
 5HP1 A;  4N56 A;  1FKP A;  3ZSQ A;  1EKE A;  2VG6 A;  4CF1 A;  3LWM A;  2G8V A;  4KB0 A;  1Z26 A;  4EP4 A;  4IBN A;  2G8F A;  1JLQ A;  2YNF A;  3QIN A;  3CFO A;  3TAR A;  1N5Y A;  2BDP A;  3B6O A;  4KHN A;  4CJE A;  1S9G A;  1BIU A;  3ZSV A;  4FJK A;  1HNV A;  4CE9 A;  1KRP A;  3DLE A;  3VQ5 A;  5KGW A;  4M45 A;  3P1G A;  2F8S A;  3OYK A;  1L3S A;  3SV4 A;  3RR8 A;  5CZ2 A;  1GOC A;  4DQP A;  4JS4 A;  1ASV A;  1JLB A;  4IG3 A;  4N47 A;  2XRI A;  1IO2 A;  3AVH A;  1XHZ A;  4RW9 A;  4CEA A;  3LWL A;  3L8B A;  4CF0 A;  3L2W A;  3HP9 A;  1BIS A;  3P83 D;  2KTQ A;  5KRT A;  3TAM A;  4FXD A;  3ZSW A;  2EHG A;  4O4G A;  4ZTF A;  4ID5 A;  4DWI A;  4FK0 A;  4BDZ A;  1CZB A;  1XI1 A;  3NH0 A;  4AHS A;  2HHX A;  1Q8I A;  1TKZ A;  3NF7 A;  2HVH A;  3VQQ A;  2KZZ A;  2G8W A;  4CHO A;  4CJF A;  1QHT A;  2Z1J A;  3L3V A;  4FLZ A;  4FLU A;  4W5R A;  3VN5 A;  3NF6 A;  1FXX A;  5HBM A;  4BWM A;  4DFJ A;  3DRS A;  1RTJ A;  1D5A A;  3FFI A;  1TVR A;  1YT3 A;  3AO2 A;  3D45 A;  2HMI A;  1UA1 A;  1JXB A;  2HHS A;  4EZ9 A;  3ZSR A;  3T19 A;  2I5J A;  1WSI A;  3AVG A;  1IKY A;  1JLE A;  1S1X A;  1WSG A;  1LWF A;  3VQA A;  2YNI A;  3O3F A;  1ITG A;  3OYL A;  4FM0 A;  5HRP A;  1TKD A;  1BCO A;  4CF8 A;  4C8L A;  1UAX A;  5EU7 A;  4CIF A;  1BCM A;  3DLB A;  4FW2 A;  3ZSO A;  1EX4 A;  2F96 A;  4CEF A;  1RTH A;  3K59 A;  1QSL A;  3LAM A;  3EZ5 A;  4HTU A;  4TSX A;  1S5J A;  4AHV A;  4YFU A;  3PX4 A;  1JL2 A;  1SL1 A;  1J53 A;  2O4I A;  3LP2 A;  4O0I A;  4E1N A;  1EET A;  4CGF A;  4RW6 A;  1ZBF A;  1T05 A;  3LZI A;  3E01 A;  4I9L A;  3L2R A;  4KAZ A;  4J2A A;  2QK9 A;  1I3A A;  4O55 A;  2Y1J A;  4LH5 A;  1RT1 A;  4KHY A;  4L8R B;  3SQ4 A;  3THV A;  4HCC A;  4FJ5 A;  2Z1H A;  3DOL A;  3QER A;  3IAY A;  2E6M A;  3SCX A;  1HYV A;  4B08 A;  1F21 A;  4W5N A;  3RMA A;  3MXJ A;  4NCG A;  2E6L A;  4JLH A;  4CJP A;  1NK8 A;  1SKW A;  4CED A;  4DS4 A;  4DTN A;  3QIO A;  4QAG A;  4E7L A;  4OKJ A;  3U6F A;  1LW0 A;  2VG7 A;  1LV5 A;  3DLH A;  5D3G A;  1I39 A;  3K5M A;  2DY4 A;  1RT5 A;  1GOB A;  1RT7 A;  1VRT A;  3ULD A;  3JYT A;  1BL3 A;  1DTQ A;  1Y97 A;  3AVB A;  3HPG A;  3NAE A;  4CFD A;  3LZJ A;  1RDB A;  1C0T A;  1WLJ A;  2KFZ A;  2G8U A;  3ZCM A;  4I7F A;  4KB1 A;  4IKF A;  3U3G A;  4E0D A;  2DFF A;  5HRS A;  4K8X A;  3QIP A;  3TWH A;  4CJV A;  3OYD A;  4B9N A;  2G8H A;  4CGI A;  3ALY A;  3C95 A;  1NK7 A;  3RMB A;  4DSK A;  3KD1 E;  4FZY A;  4M3X A;  3AA2 A;  1C1C A;  1JLA A;  3MED A;  1J54 A;  2YNG A;  3SYZ A;  1SL2 A;  2QKB A;  1RBS A;  4FJM A;  1W0H A;  2IGI A;  2ITG A;  3SPZ A;  5HLF A;  2ZE2 A;  4FLW A;  3VA3 A;  1IKX A;  1NJW A;  1NK6 A;  1L3U A;  4ELU A;  3D0P A;  3O4N A;  4RW8 A;  3I0S A;  1RDC A;  1SKR A;  4OJR A;  1HMV A;  2PYJ A;  4KHW A;  4FLV A;  4DSE A;  3K5L A;  1U04 A;  3AA4 A;  1NOY A;  3PO5 A;  1VSI A;  3VQB A;  3ZT4 A;  1U48 A;  3RR7 A;  4R5P A;  3KD5 E;  2AJQ A;  1RBV A;  3TAE A;  1WNS A;  1LAW A;  4CJ5 A;  1QQC A;  2Q3S A;  2IC3 A;  4CJ3 A;  2P5O A;  4OLB A;  2BE2 A;  4H4M A;  4C8O A;  2IDO A;  3K5O A;  2P1J A;  4C8M A;  3AO1 A;  2HB5 A;  3TI0 A;  4CHQ A;  4CHY A;  1KVA A;  4FJI A;  4M3R A;  2XHB A;  4JRP A;  4M42 A;  2D5R A;  5C42 A;  3NGY A;  5SZT A;  4Z0U A;  3V9S A;  1X1P A;  2XY6 A;  3DOK A;  5CZ1 A;  2HHU A;  1HNI A;  2EX3 A;  4EZ6 A;  4B9U A;  4M3Z A;  1EXQ A;  4FK4 A;  1YVU A;  4FJX A;  2HHW A;  1KVB A;  3I0R A;  1NJX A;  4CK1 A;  4F2S A;  4CJR A;  2ATQ A;  4CFA A;  4F3O A;  4Z4C A;  3LP3 A;  1VSH A;  1HPZ A;  1CXQ A;  3AVA A;  2D0A A;  3PV8 A;  1J5O A;  4FJ8 A;  3ITH A;  3NBP A;  2DTU A;  5KGX A;  4B9V A;  2WON A;  1BGX T;  1KLN A;  4LSN A;  4CGJ A;  2WOM A;  4BE1 A;  1YTU A;  1MU2 A;  4B9S A;  1S6P A;  4DSL A;  3V9X A;  3OVN A;  3NFA A;  2XY7 A;  3S9H A;  4NCB A;  3NH1 A;  2LSN A;  2P5G A;  4FJ9 A;  1CZ9 A;  1TGO A;  2FC0 A;  4F3T A;  2BGG A;  1RT3 A;  1WAF A;  4LSL A;  4O0J A;  4Q5V A;  4DF4 A;  3VA0 A;  4CIE A;  2OZM A;  2O4G A;  4F2R A;  1B92 A;  1KTQ A;  3S3M A;  4DG1 A;  3HXM A;  3ZSY A;  3HO1 A;  1SL0 A;  4PQU A;  4I2Q A;  1VSK A;  4FJN A;  4M3U A;  3HT3 A;  2XO7 A;  1SKS A;  4CF9 A;  2RKI A;  4OGE A;  3M8S A;  4O5B A;  3OYF A;  4DQS A;  2OYQ A;  2KW4 A;  1RT2 A;  3LAK A;  3PO4 A;  3TAG A;  1R0A A;  3CG7 A;  1RTD A;  4F4K A;  1SV5 A;  1VSD A;  4RW4 A;  4CES A;  4CGD A;  3OJU A;  3K57 A;  5KTQ A;  3AO5 A;  3LAN A;  1NK9 A;  4Q0B A;  5FRN A;  4CEO A;  1BI4 A;  3S3O A;  1QTM A;  2KZM A;  4WE1 A;  1U47 A;  3RMC A;  4DFM A;  1GOA A;  3QEV A;  4Y1D A;  4FZZ A;  3DI6 A;  3M8P A;  1VRU A;  1Z25 A;  3WNG A;  2QXF A;  4CGH A;  3HPO A;  5FRO A;  3VQE A;  3M8R A;  4FCY A;  1VSF A;  2GBZ A;  3MXM A;  1N6Q A;  1BIZ A;  3G10 A;  3LPU A;  3PUF A;  4OVL A;  3L2Q A;  4BDY A;  3V9U A;  1ASW A;  2Z1I A;  4MQ3 A;  4CJK A;  3OYB A;  5HRO A;  3DLK A;  1L3T A;  2Z1G A;  1TAU A;  3MEG A;  1JLG A;  3QNO A;  1XHX A;  4CJ4 A;  3K58 A;  3AVM A;  4RW7 A;  5HRN A;  4PY5 A;  2Y1I A;  3LP0 A;  4FM2 A;  1LWE A;  3TAF A;  1VSJ A;  2HNY A;  3TR8 A;  1WN7 A;  2OPP A;  4OPJ A;  1JXE A;  1NJY A;  4DLG A;  3MAQ A;  3HST B;  3NHG A;  1RDD A;  3O3G A;  1D9D A;  3RWU A;  4PUO A;  3ZT3 A;  4Z4I A;  3RTV A;  2HW3 A;  1LWC A;  5J2P A;  1NJZ A;  3G0Z A;  4FK2 A;  4C8N A;  3WNF A;  3QO9 A;  4GW6 A;  3QEX A;  1NKB A;  5KRS A;  2B4J A;  1G15 A;  4GVM A;  1KFD A;  3AVI A;  3V9W A;  3TAQ A;  4BDP A;  4AHC A;  4W5O A;  3UIQ A;  1BQN A;  2G8I A;  1KFS A;  2OZS A;  3IG1 A;  1TK8 A;  4KTZ A;  3I8D A;  4FW1 A;  3SUN A;  1ZYQ A;  3K2P A;  5CYQ A;  1C0M A;  3KLE A;  1BHL A;  1C0U A;  3LPT A;  5DMR A;  4DFK A;  3AVC A;  1VSE A;  1HQE A;  2XY5 A;  1RT6 A;  4KI4 A;  4DQQ A;  2FBV A;  1L3V A;  4ELT A;  4ZHR A;  1KLM A;  3ZT2 A;  3HP6 A;  4W5Q A;  4FJH A;  3VQP A;  1W9H A;  3HM9 A;  1CLQ A;  1U45 A;  1X9S A;  3VQ6 A;  3OYI A;  3V1O A;  1A5V A;  1T03 A;  2D0C A;  1NK4 A;  3SUO A;  3C94 A;  3DLR A;  1WSH A;  3AVL A;  3AV9 A;  4JS5 A;  1QSS A;  2OA8 A;  4N76 A;  1C1B A;  3KIO A;  3QLH A;  3V81 A;  3CM5 A;  4CJW A;  3L2U A;  3V6D A;  2VWK A;  3TAP A;  4DMN A;  4CEC A;  4CHN A;  4DTX A;  2IS3 A;  3MEC A;  3SUQ A;  3V4I A;  3QNN A;  3ASM A;  1TL1 A;  4CHP A;  5JS2 A;  5E41 A;  3OJS A;  4H8K A;  3HYF A;  3WNE A;  4CFB A;  1UWB A;  1RT4 A;  3CM6 A;  1NK0 A;  3L3U A;  3HK2 A;  2XY8 A;  1D8Y A;  3RRG A;  2YKM A;  2YKN A;  3SQ2 A;  1ZBL A;  3AO4 A;  1RBU A;  3KK3 A;  2NUB A;  4GMJ B;  1HYS A;  1QE1 A;  2FBX A;  3CYM A;  4J2E A;  1KSP A;  3A2F A;  4M3Y A;  3CFR A;  4N41 A;  4AIL C;  2F8T A;  2DFH A;  3NE6 A;  4E7I A;  4DSF A;  4KHQ A;  2KFN A;  3VQ7 A;  3KJV A;  4E1M A;  4AH9 A;  4XIU A;  1B9D A;  4DLE A;  5HRR A;  3SUP A;  3KKR A;  2G8K A;  2W42 A;  4KRF A;  1SUQ A;  3DRP A;  4B8C A;  3HJF A;  4BAC A;  2RN2 A;  4BE0 A;  2P51 A;  5I42 A;  4HCB A;  3DRR A;  4DSJ A;  1RDA A;  3AVN A;  4I9Q A;  1RNH A;  1O1W A;  3KTQ A;  1JLC A;  1NK5 A;  4J2D A;  2HVI A;  4IFY A;  4FYD A;  4IDK A;  3SI6 A;  4E7H A;  4E7J A;  4RG8 A;  3T3F A;  1L5U A;  3DMJ A;  3OYA A;  4G1Q A;  3PX0 A;  4KHS A;  2BAN A;  1CXU A;  4DTO A;  2B6A A;  3B6P A;  1Q9X A;  1S1U A;  4NYN A;  3SPY A;  3DLG A;  1WSE A;  1HYZ A;  4HVJ A;  1VSM A;  4KPY A;  4B8A B;  3OS0 A;  3OS2 A;  4KTQ A;  3OYG A;  4BWJ A;  1WSJ A;  3QEI A;  2VWJ A;  4NCA A;  4Z4G A;  4H4O A;  4KKO A;  1S6Q A;  4E19 A;  1NKE A;  1U49 A;  1HJR A;  4N5S A;  3NDK A;  3VQ8 A;  3SZ2 A;  1J9A A;  3KK2 A;  4HHT A;  4DS5 A;  2HHT A;  5JS1 A;  2IAJ A;  2D0B A;  3KLI A;  2GV9 A;  1IH7 A;  4HUG A;  4KRE A;  3LAL A;  2A1S A;  1IKV A;  2GUI A;  4CGG A;  4FJL A;  3AVK A;  4LY7 A;  4DU3 A;  1REV A;  3SV3 A;  3RMD A;  2PZS A;  3CQ8 A;  3RRH A;  5K14 A;  4AHR A;  3AA3 A;  4KFB A;  3JSM A;  3TAN A;  1A5X A;  2YHA A;  1TK0 A;  3F73 A;  2HHQ A;  1FK9 A;  3KLF A;  1FKO A;  1S9E A;  4MFB A;  1A5W A;  3EYZ A;  3AVJ A;  5J2Q A;  3AA5 X;  1S1V A;  3H08 A;  3KK1 A;  4DQR A;  1C6V A;  4FLY A;  4FLX A;  1TL3 A;  4CIG A;  1T8E A;  1HQU A;  1VSL A;  2KQ2 A;  1LW2 A;  3DM2 A;  4KO0 A;  2VG5 A;  4ICL A;  3VQD A;  3TAB A;  4EP5 A;  1DLO A;  5CYM A;  2JLE A;  4J2B A;  4B3O A;  2YV0 X;  4W5T A;  3CFP A;  4FJ7 A;  4B9T A;  2IOC A;  2JGU A;  4KHU A;  1JLF A;  2FBY A;  1IG9 A;  5J2M A;  3V9Z A;  1QSY A;  2HND A;  1VK0 A;  4CJU A;  4DTS A;  1LAV A;  2HHV A;  1B9F A;  5I3U A;  1TAQ A;  3BGR A;  3IRX A;  5C25 A;  4B9L A;  3C6U A;  2X78 A;  4ELV A;  4AHT A;  4FJJ A;  4Z4H A;  4FJG A;  3T1A A;  2X6S A;  1EP4 A;  1QS4 A;  1RBT A;  3AVF A;  5FRM A;  1TKX A;  4AHU A;  2X74 A;  3VQ9 A;  3LP1 A;  2X6N A;  4CJS A;  5FDL A;  3HPH A;  3O3H A;  3QEP A;  1X9W A;  1ASU A;  4DTJ A;  1BQM A;  4KI6 A;  1WAJ A;  4CJL A;  4Y1C A;  3M8Q A;  4ID1 A;  4CEQ A;  3NH2 A;  3S3N A;  4CJQ A;  4DTM A;  3SNN A;  3OYE A;  4IFV A;  2RPI A;  2PYL A;  5SWM A;  2E4L A;  4CF2 A;  5J1E A;  4LD0 A;  4UQG A;  3KLH A;  4HUF A;  4FLT A;  3O4Q A;  3SJJ A;  5J2N A;  3KKS A;  4OGC A;  1RBR A;  1BI4 B;  1RCH A;  3DYA A;  4FVM A;  4PA1 A;  4CJT A;  5T7B A;  4HUE A;  4DU1 A;  4OKE A;  1Q9Y A;  4DTP A;  1C1A A;  3HVT A;  2YHB A;  3NF9 A;  4OPK A;  3OYM A;  1UA0 A;  1S1T A;  1TV6 A;  2OPR A;  4O44 A;  1U4B A;  4DTR A;  4K8Z A;  4PWD A;  4CEB A;  3OS1 A;  4KTW A;  3V1R A;  4F8R A;  3ZSZ A;  4Z4F A;  3VQ4 A;  2R7Y A;  4CEZ A;  4QOZ B;  3QET A;  3P5J A;  1RTI A;  4YNQ A;  4CCH A;  3EY1 A;  3NGI A;  3MXI A;  1WSF A;  3U3Y A;  4DQI A;  3PY8 A;  3QES A;  4E7K A;  1RIL A;  2HNZ A;  3KLG A;  1ZBU A;  2B5J A;  3C6T A;  3OYN A;  3OYH A;  3OYJ A;  4NYF A;  4M3T A;  3WNH A;  1XWL A;  2A1R A;  1ZBH A;  3ZT1 A;  3QEW A;  1YTA A;  1NOZ A;  2FBT A;  4DU4 A;  4OLA A;  5DK5 A;  1KCF A;  4LH4 A;  1HRH A;  2RF2 A;  2QKK A;  3SQ0 A;  4M3W A;  1KVC A;  3F9K A;  5KI6 A;  3NF8 A;  3OY9 A;  4OKK A;  2ZQB A;  3PX6 A;  4C8K A;  4Z4E A;  4CER A;  4QCL A;  1K6Y A;  4DTU A;  4IG0 A;  3BDP A;  1JL1 A;  1T7P A;  1JKH A;  3OYC A;  4CK2 A;  2OPQ A;  1TK5 A;  4FZX C;  4B9M A;  3L2V A;  2YNH A;  4E3S A;  3ISN C;  3HVR A;  4CEE A;  4DFP A;  1D9F A;  3SQ1 A;  2PY5 A;  1NKC A;  1UOC A;  5CY4 A;  1IKW A;  3ZSX A;  1TKT A;  3K5N A;  3NCI A;  4DF8 A;  4CFC A;  3V1Q A;  3IS9 A;  4I2P A;  3VQC A;  3HL8 A;  2ZD1 A;  5C24 A;  1DTT A;  4KV8 A;  4CHZ A;  4CK3 A;  4BE2 A;  1ZBI A;  4FM1 A;  3NGZ A;  2ETJ A;  2OPS A;  4E89 A;  1X9M A;  4ZTJ A;  4M41 A;  2DFE A;  3LDS A;  3MEE A;  3AO3 A;  1XC9 A;  3ZT0 A;  1S1W A;  4JRQ A;  4DSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...