3U3YA

Mouse trex1 d200h mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
215
Chain Sequence
b'LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 68
structure length 215
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u3yA01
2BE2A 3AVCA 1RILA 3V9UA 1B9FA 2O4GA 3O3GA 4B8CA 3LZIA 1BIUA 3MXJA 4LD0A 3VQ9A 1TK8A 2ETJA 3AA4A 1KLNA 4FVMA 3OJSA 4CIGA 1S1TA 4DTRA 3QEIA 1GOBA 1RDBA 1KFDA 4ID1A 5JS1A 4M42A 2GV9A 4F8RA 3CM5A 1VSLA 3HM9A 1NK9A 4IG0A 4FJLA 1TV6A 1EKEA 4CK1A 4B9SA 1RBUA 4DWIA 1VSFA 2FBTA 2ZE2A 3KKRA 5KRTA 3IG1A 2PY5A 4FLYA 5SZTA 1S6QA 3QNNA 1VSMA 1J5OA 4CJPA 2ITGA 3WNHA 1CZBA 2A1SA 4CEOA 1RBTA 1C6VA 1XHXA 1L5UA 3LDSA 1YTUA 1U4BA 3CM6A 4JS5A 3L2UA 3ZSXA 1REVA 1FKPA 3OYHA 4B9LA 4JLHA 4KHQA 4ZTJA 1T7PA 5C42A 3DLKA 1IO2A 4CHYA 1TK0A 4E7HA 1ITGA 1HNIA 1KVAA 1TVRA 3AV9A 3AVFA 1J9AA 3CYMA 3IAYA 4DTSA 1KVBA 1IG9A 3PUFA 1B92A 4MQ3A 1UWBA 2XY8A 4Z4FA 4CJLA 3V1QA 4UQGA 1JXEA 2A1RA 5E41A 1FKOA 3TR8A 2OPSA 4CJEA 1VRTA 3HK2A 4DS5A 2Z1IA 4OKEA 3HJFA 3K5MA 4CJUA 1JL1A 4DS4A 4FZXC 1EXQA 2W42A 3V9WA 3QEVA 4W5RA 1LV5A 2PYJA 4M3ZA 4I2QA 3TAGA 3OY9A 1S6PA 1GOCA 3KK3A 3EZ5A 4FJMA 3AO5A 4I9LA 1WSGA 3U6FA 3HO1A 5CYMA 3NDKA 4KHNA 1SUQA 1BL3A 5J2NA 3TAEA 1S9EA 1FK9A 1BI4A 1WLJA 4HTUA 3QNOA 3OYLA 4DQIA 1TK5A 4KTWA 4E1MA 3NGZA 4Z4HA 3S3NA 4NCAA 1HYVA 2ATQA 2DFHA 4ZTFA 1BQMA 3DLRA 1KTQA 4DSJA 1JXBA 2P5GA 3V1RA 1Q9YA 4C8LA 4DFJA 3I0SA 3SNNA 3QEXA 3G10A 3C94A 3P83D 3TARA 4KFBA 3V81A 3C95A 1LW0A 4GMJB 2R7YA 4E3SA 1QSYA 4YNQA 4B9VA 1HQEA 3O3FA 3DRRA 4AHUA 1RT1A 1HMVA 4CF9A 4BDYA 1NK4A 4B3OA 3QEWA 4HCBA 5J1EA 2YKMA 3HYFA 4FLTA 4RW6A 2D5RA 3DMJA 4CF8A 4CFDA 4QCLA 4KB0A 1RTHA 2RN2A 2HHTA 3QEPA 4F4KA 1YTAA 3HXMA 5CYQA 3RTVA 5CY4A 2HVHA 3CFPA 4BE2A 3NCIA 4Z0UA 3IS9A 4E19A 4ID5A 3S9HA 2P5OA 3V9XA 2FBVA 4Y1DA 5DMRA 1RBSA 4PY5A 3VQ7A 2YNIA 3S3OA 3OYCA 4CEFA 4DMNA 3KIOA 4DQRA 3TABA 1A5XA 1K6YA 1UAXA 1XWLA 1JLBA 4FZYA 3ZSOA 4BE0A 4FJ7A 3WNGA 3AA2A 1TL1A 3V9SA 3SUNA 3AA3A 4CF2A 3O3HA 1JKHA 3VQ5A 3THVA 4KAZA 4RW4A 2IS3A 4F3TA 3CFOA 3K59A 4C8KA 1WAJA 3AVGA 3V9ZA 3CQ8A 4FLUA 2PZSA 3LAKA 5CZ2A 1TAQA 3NBPA 3PY8A 2KFZA 4NYFA 3OYBA 1LWCA 3F9KA 3S3MA 5HLFA 3PO5A 4PA1A 1CZ9A 2HB5A 3ZT2A 1UA1A 1SKRA 5HBMA 1IKVA 1RBVA 3VQPA 2B5JA 3M8RA 3SUQA 3EY1A 1RTIA 2D0CA 4CFBA 1CXUA 3QESA 3NFAA 3ZSWA 5KRSA 3OS1A 2YNGA 4JS4A 4BWJA 5FDLA 3AVHA 4KV8A 3RRGA 4DLGA 1RDDA 2IDOA 2EHGA 2VG6A 4BDPA 4DSEA 2IGIA 3V4IA 2YV0X 1XI1A 4CJ5A 1QE1A 3MAQA 4RW7A 1IH7A 3OYKA 1R0AA 4EP5A 4DQSA 3SCXA 1WSIA 3KD5E 2XY7A 4OGEA 1ASVA 1X9MA 3TI0A 4ELVA 1WSFA 3H08A 4LSLA 4CHQA 4CF1A 2XY5A 2HHWA 1NK0A 3PX0A 1C0MA 2G8VA 4C8NA 3O4NA 3OYMA 4RW9A 4CJ4A 1BCOA 4N41A 4BDZA 1W0HA 4CJWA 3A2FA 1F21A 4FYDA 2YNHA 1O1WA 3F73A 2FC0A 2DFEA 3L2QA 3SJJA 3ZT3A 2G8HA 4E1NA 4EZ9A 4FLZA 4BACA 1XHZA 4J2BA 4ZHRA 4CECA 4O0JA 3ZSZA 1C1AA 2JGUA 2XY6A 4FJIA 4DSLA 1C0TA 2Y1JA 3PX6A 1IKXA 3K5NA 4E7KA 3IRXA 1S1UA 3AO1A 5J2PA 3QERA 4FK2A 2YKNA 4HHTA 2DTUA 4GVMA 4FK0A 5K14A 3VQBA 2BDPA 3AO4A 1TAUA 4KPYA 3AVKA 1RT2A 4ICLA 4AHCA 4CGFA 3HT3A 3SQ2A 3SUOA 1ZBLA 4B9MA 1Y97A 2E6LA 2O4IA 2HW3A 4CK2A 2HHVA 1S1XA 5J2MA 1GOAA 2JLEA 4DTPA 1T03A 4LY7A 1QSLA 3DLBA 5KGXA 2Z1GA 3OYFA 3QO9A 4M3XA 1RTJA 4B9UA 1VSHA 4O4GA 3L8BA 3RMAA 1U47A 4AH9A 4M3YA 1KFSA 3SPZA 2E6MA 3I8DA 1ASWA 1CLQA 3HL8A 3SPYA 1QS4A 3NF6A 1D5AA 1CXQA 2PYLA 4O44A 1X1PA 4BWMA 4KI6A 3VA3A 3QIPA 1QHTA 2QXFA 5FROA 4FW2A 3K57A 4DF4A 2KZMA 2X74A 3LPUA 4FJ8A 3G0ZA 1S1WA 3OVNA 4G1QA 3ULDA 1X9SA 3HPOA 1QSSA 3SQ4A 5HP1A 3SQ1A 2HHXA 4CJQA 4Z4GA 1NJYA 5FRNA 3VQAA 3NHGA 4FJHA 1ASUA 2XRIA 3V6DA 4O55A 2ZD1A 2OZSA 1NK6A 4J2EA 2G8KA 1LW2A 2WONA 3SZ2A 3KLHA 4O5BA 3QINA 2HMIA 1C1CA 3PX4A 1HJRA 1RTDA 3QLHA 2HHQA 2QKBA 4F2RA 1BHLA 4DTOA 1SL2A 4IBNA 1NJXA 4EP4A 4DFKA 2G8WA 4CIEA 3RMBA 1RT5A 1EP4A 2RKIA 3LAMA 4DTJA 3BDPA 4J2DA 4DQQA 2GBZA 3OS0A 4MFBA 4W5OA 3RRHA 3AVNA 2HHUA 4FJKA 4FJNA 2OPQA 2IOCA 4CFAA 2XO7A 2FBYA 1S9GA 1JLQA 4KKOA 3VQDA 4OPKA 2OZMA 2G8UA 4RG8A 4HUEA 5D3GA 4FJXA 2VG7A 3M8SA 3AVAA 4PQUA 3LPTA 1L3SA 3B6OA 2P51A 4K8XA 3ISNC 4FLVA 3NAEA 3SUPA 2KQ2A 4IKFA 1A5WA 4DQPA 1FXXA 4CERA 4DLEA 2IAJA 3B6PA 4CGIA 3TAPA 2RPIA 3NH2A 2QKKA 1TKXA 1RT6A 2IC3A 2F96A 2GUIA 4NYNA 4O0IA 4Q0BA 4NCBA 1ZBIA 3SV3A 3ZCMA 1RDAA 3NF9A 1Q8IA 1WSEA 2P1JA 3L3VA 4CEDA 4CHZA 5HRNA 3KLGA 3DLEA 5J2QA 3LANA 2F8SA 4J2AA 3CG7A 3L3UA 3JYTA 4RW8A 1Z26A 3LP0A 4AHRA 4R5PA 4HUGA 4BE1A 4W5NA 3CFRA 4I2PA 4WE1A 4CF0A 3MEEA 2XHBA 2OPRA 1NKBA 4FZZA 3LP1A 3KLEA 3QETA 3OYJA 1S5JA 1TKTA 1U04A 2YHBA 4KO0A 1DTTA 3M8PA 3HPHA 4CGJA 1C0UA 1UOCA 3HVRA 4CFCA 1BQNA 1NK5A 1SL0A 3KK2A 4QOZB 3TWHA 1LWFA 3SQ0A 4ELTA 4E7LA 4OKKA 4KREA 1J53A 1LWEA 2KTQA 3C6TA 3T1AA 4OJRA 4CHNA 4CIFA 4LSNA 1ZBFA 3DRSA 3DLHA 1SKWA 1Q9XA 4CEZA 2RF2A 3ITHA 3K2PA 1L3TA 4DU1A 4E7JA 4CJRA 3D45A 1YT3A 4CEBA 1NJWA 3VQ4A 1ZBHA 3OYDA 2HNYA 1WSHA 1WNSA 3AVIA 4Q5VA 2NUBA 3VQ8A 4F2SA 2DY4A 1D9FA 4KHUA 4N5SA 3U3GA 4C8MA 4OPJA 4JRQA 1IKYA 3TAFA 3KLIA 3WNEA 4KHSA 2OPPA 3ALYA 4OKJA 2Z1HA 4DTUA 3KJVA 2G8IA 1RT7A 1VSEA 5HRSA 4KI4A 1BCMA 4CGHA 3FFIA 4Z4EA 4Z4CA 3TANA 1NK8A 4DTNA 2D0AA 5CZ1A 3NE6A 4CJVA 3SI6A 1TL3A 5KGWA 1A5VA 3OJUA 3T3FA 4M3WA 4CEEA 4DSFA 2FBXA 1VSJA 3AVLA 4CJTA 1BIZA 1HYZA 4CCHA 2OA8A 1LAWA 2X6SA 4AHVA 4AHTA 3L2VA 1NOYA 4DG1A 2OYQA 3VN5A 4CEAA 1NJZA 4FJ5A 1JLCA 3OYNA 1NK7A 5HRPA 1X9WA 4Y1CA 4FJGA 4FM1A 2BANA 4YFUA 4HUFA 3SYZA 2VG5A 3KK1A 4H8KA 1NKEA 3U3YA 3LWLA 4Z4IA 4I9QA 4LH5A 3D0PA 4B9NA 4TSXA 4DSKA 1RCHA 3ZSVA 4HCCA 1LAVA 2BGGA 2E4LA 4E0DA 1JL2A 1C1BA 1RBRA 3TAMA 4CJSA 2KFNA 3EYZA 3ZSQA 4CJ3A 5I42A 1U45A 3OYGA 4FLWA 4DFPA 2WOMA 2X78A 4K8ZA 1VSIA 3LWMA 4M3UA 3BGRA 3MEDA 5EU7A 1T05A 3E01A 1Z25A 3VA0A 4OVLA 1L3VA 3LZJA 3LALA 4OLBA 1KSPA 1TGOA 3AVMA 4IDKA 4KRFA 3HP6A 5KTQA 1EETA 1ZBUA 4M3RA 4EZ6A 5T7BA 3NH0A 4FW1A 3PV8A 4ELUA 4XIUA 4DFMA 1HPZA 2VWKA 4KTZA 3I0RA 3TAQA 1SKSA 3ZSRA 5C25A 3KTQA 1J54A 3DOKA 3VQCA 3MXIA 4H4MA 4AILC 5C24A 4CHOA 3P1GA 4DSIA 3MEGA 3LP3A 4DTMA 1N5YA 1NOZA 3AO3A 3HVTA 3VQQA 1VSKA 4B9TA 3OYIA 3DLGA 4B8AB 1KRPA 4KB1A 2HHSA 5DK5A 3KKSA 2VWJA 1BGXT 4OLAA 1D8YA 4HVJA 4DTXA 2Z1JA 3RR8A 3MXMA 3PO4A 4PUOA 3OS2A 4W5TA 3RR7A 4DU4A 1NKCA 3HPGA 3NGIA 1G15A 4FLXA 1JLFA 5JS2A 3K5LA 4C8OA 1KCFA 2B4JA 1BI4B 3VQEA 1DTQA 2EX3A 4IFYA 3QIOA 1I3AA 1HNVA 2Q3SA 2YHAA 4DU3A 1RDCA 4GW6A 2D0BA 3AVJA 3KLFA 5HROA 1S1VA 3MECA 1JLGA 4L8RB 2Y1IA 1TKZA 2QK9A 1QTMA 3ZT4A 4FM0A 3RWUA 1MU2A 4NCGA 3VQ6A 4CK3A 1VSDA 1BISA 3DM2A 3HP9A 3K5OA 4E89A 1SL1A 1VK0A 1IKWA 3M8QA 2HNDA 4AHSA 1RT3A 4CGGA 3RMDA 4CESA 4QAGA 1N6QA 1HRHA 4I7FA 3DOLA 1L3UA 2B6AA 3KD1E 1XC9A 4PWDA 2YNFA 1B9DA 5SWMA 1W9HA 4H4OA 5I3UA 3AVBA 4N76A 4FCYA 3HSTB 1QQCA 3T19A 1WN7A 3K58A 4FJJA 3WNFA 2G8FA 4B08A 4KTQA 1JLEA 4IFVA 3AO2A 4LH4A 1U48A 3UIQA 2LSNA 3DI6A 3L2RA 3DYAA 3ZT1A 2HVIA 4N47A 4IG3A 4M3TA 4M41A 1HQUA 3JSMA 3V1OA 2KZZA 4OGCA 3NGYA 2X6NA 3O4QA 3OYAA 4JRPA 1UA0A 1SV5A 4FJ9A 1RT4A 3ZSYA 3DRPA 4CGDA 1HYSA 4W5QA 3NH1A 2ZQBA 2I5JA 1EX4A 4DF8A 4CJKA 1YVUA 5HRRA 1U49A 3NF7A 4N56A 3L2WA 3SV4A 4E7IA 4FM2A 2AJQA 4F3OA 1WSJA 1WAFA 1KVCA 1RNHA 1T8EA 4M45A 2F8TA 4CHPA 3ZT0A 3P5JA 3C6UA 4FK4A 1VRUA 4KHYA 1D9DA 1KLMA 3OYEA 3RMCA 3NF8A 5KI6A 2KW4A 4CEQA 5FRMA 1TKDA 3LP2A 3ASMA 4KHWA 1I39A 4CE9A 4FXDA 2DFFA 1JLAA 3AA5X 1ZYQA 4CJFA 1DLOA 2HNZA
chains in the Genus database with same CATH superfamily
3BY5A 2BE2A 4A61A 5HL7L 3A5OC 2O4GA 1BA1A 4B8CA 3D7EO 1TK8A 3OW2M 2O8FB 3ATVA 5E84A 3ZETB 1VSLA 4FJLA 4B9SA 1RBUA 1YJ9N 4FLYA 1J5OA 1S72N 4A5BA 5JVHL 1L5UA 4XEIA 2E5LK 4JS5A 4CZHA 4KHQA 4EHUA 3CD6N 1LCUA 3DLKA 5LJVA 2ZJQL 1TVRA 3IAYA 4MQ3A 3V1QA 4UQGA 3PLAA 1JXEA 2A1RA 3E66A 2VGNA 1SQKA 2YCHA 1VQLN 2Z1IA 1N8RO 2ZGZA 4CJUA 4H03B 3QEVA 1LV5A 2PYJA 4M3ZA 1S6PA 1ZC6A 3EZ5A 3PSFA 3VF4A 3U6FA 1K8AO 1BUPA 5CYMA 3NDKA 4B1ZA 3TAEA 4HTUA 1WLJA 1BI4A 4DQIA 4KTWA 4EFHA 1TYQB 4BQZA 4ZTFA 1KTQA 4CD1A 1XMOK 4C8LA 3ENHA 3TARA 1U6ZA 2WUSA 4YOYA 4GMJB 1QSYA 4YNQA 4FPBA 1NM1A 3DRRA 4I6MA 3ZX0A 1NK4A 4B3OA 4HCBA 2UXDK 3WUHA 3O1WA 3Q7BA 5GAGP 4JKEA 4CFDA 1RTHA 5E26A 5LMUK 3ZYYX 3HXMA 1YVNA 5CYQA 5AQFA 1BO5O 1QQNA 3CFPA 3D6RA 3VF2A 1JCFA 2P5OA 3EO3A 2V52B 5DMRA 1RBSA 4JKGB 2O8CB 1QVFM 3MDQA 3TABA 2PBDA 2ZM6K 4FJ7A 3CCQN 2ZJPL 3VQ5A 1GLLO 3VGKA 1YI2N 4C8KA 1WAJA 3V9ZA 4FLUA 2PZSA 3LAKA 5AZIA 2KFZA 3OYBA 3QB0A 4YOWA 5HLFA 1CZ9A 2HB5A 1UA1A 2O8FA 3EY1A 4CFBA 2YJFA 1EWRA 3ZETA 3OS1A 4A2AA 4B1VA 4FJHA 1RDDA 2VG6A 4BDPA 1XI1A 3L4IA 1WSIA 3KD5E 4OGEA 4BRFA 2HHWA 1HNWK 3PX0A 1LOTB 3O4NA 4CJ4A 3CC7N 2RHKA 3ENOA 5I9EB 3CCSN 1KD1O 2G8HA 4FLZA 4CJ7A 5LMNK 4CECA 4LFAK 2JGUA 4FWNA 1XUPO 4FJIA 1C0TA 3MN9A 3PX6A 4FK2A 3TSPA 2YKNA 4FK0A 4QS7A 5AJ3K 4KPYA 1MWKA 4ICLA 4AHCA 3SQ2A 3SUOA 2O4IA 1Y97A 3CQYA 2QEXN 3LDNA 1S1XA 3CJBA 1GOAA 3NVKA 4LY7A 3L6QA 5KGXA 2Z1GA 3QO9A 4M3XA 4JI2K 1TYQA 4B9UA 1U47A 1YUWA 3WQUA 4JKFA 4M3YA 4GNIA 1KFSA 2OTLN 1CLQA 1ASWA 1HKCA 3HL8A 3SPYA 1QS4A 2PYLA 4BWMA 3VA3A 2NRRA 2X74A 4FJ8A 4G1QA 3OVNA 4B9QA 1V4SA 3U4LA 2FF3B 3TSQA 4FSVA 3V6DA 5C2DA 1NK6A 3VEOA 2WONA 3KLHA 4O5BA 2HHQA 3FZLA 2QKBA 1BHLA 3C7NB 1SL2A 4IBNA 4JKGA 4EP4A 3P31A 2O8CA 1RT5A 4IDHA 4RCHA 5LY3A 5GAHP 3QBWA 5BRHA 4BC3A 4DTJA 4J2DA 4DQQA 1K8KA 3CCLN 5CR4A 2HHUA 2XO7A 1OVQA 1S9GA 2FBYA 4KKOA 4OPHA 3ZX3A 4HUEA 4K25A 5D3GA 1JCEA 3WXMB 5FPMA 3AVAA 4PQUA 3B6OA 1OVYA 1QZ6A 3SUPA 4O8UA 4IKFA 1A5WA 3LDQA 4DLEA 2IAJA 2F7TA 2RPIA 3IMXA 3UKRA 2QKKA 1RT6A 4NYNA 3SV3A 3VMFB 3NF9A 1Q8IA 1WSEA 2HBKA 3FLCO 2F8SA 2QM1A 3VEYA 3L3UA 1VQ9N 1Z26A 4AHRA 4EAHD 4BGAA 4I2PA 3AY9A 2OPRA 3KLEA 5M1OA 4KO0A 1UOCA 4CFCA 3KK2A 1LWFA 3M5RA 2KTQA 3D2FA 4CBXA 3G4SN 4CIFA 1NGGA 1Q9XA 3ITHA 3K2PA 4E7JA 2PFUA 1ZBHA 2HNYA 1WNSA 3THWB 4JI1K 2AA4A 4KHUA 5AZJB 4N5SA 3U3GA 2IVNA 3ENBA 4JRQA 1X9JA 4M7XA 3EE9A 4KHSA 1N33K 3ALYA 1NBWA 2G8IA 1EWQA 2Q2RA 5HRSA 4YDUC 3ULEA 4Z4EA 3TANA 3P39A 4DTNA 5CZ1A 4CJVA 1JJ2M 3OJUA 1VSJA 3AVLA 4CJTA 4OX9K 4BRMA 1E4FT 1BG3A 2X6SA 2OYQA 5KPZA 3VN5A 4DQ8A 3OYNA 1QQMA 4FJGA 3AARA 4QS8A 4DV6K 3GG4A 2O8BB 3SYZA 1NKEA 4Z4IA 1ILYA 2ZWHA 5AQTA 4LH5A 1RCHA 3FR0A 1LAVA 2E4LA 1JL2A 1C1BA 4NLBA 1RBRA 3A5MC 4JKDA 5AQXA 4CJSA 1TUYA 5I42A 2WOMA 2X78A 2V7ZA 4M3UA 2W40A 3I33A 3E01A 3VENA 1T05A 3VA0A 3LZJA 3LALA 3HP6A 1T44A 4M3RA 2W6KA 3C7NA 4ELUA 4FW1A 3PV8A 4Z94A 4Y0WA 5C25A 1ESVA 2VCPA 3A8YA 2ZJRL 5C24A 3R8EA 1N5YA 3VQQA 1VSKA 4CZJA 1BOTO 4CVNE 2HHSA 3WXKA 4DV0K 1NNEA 4YORA 2E88A 3SAHA 4HVJA 3RR8A 1W7AA 4AM6A 3HPGA 2VYPA 2W41A 5JS2A 3K5LA 1KCFA 3K0SA 3U9ZA 2EX3A 3HRGA 3QIOA 2Q3SA 1RDCA 1K73O 5HROA 1JLGA 1ZXOA 5KQDA 1Y64A 4NCGA 5AQHA 4CK3A 4E89A 1BISA 3K5OA 2HBMA 1IKWA 2HNDA 4AHSA 3RMDA 1VQ8N 3E9OA 4M63C 4I7FA 4NO7A 1L3UA 4B3TK 4G9ZA 5C12A 4GVEA 5M1FA 4JHDB 5TKYA 3T19A 3WNFA 3FFKB 3THWA 3BF3A 1JLEA 4IFVA 3DI6A 3NVMA 5AZJA 4BRNA 4N47A 3ZEUB 4M3TA 5M1QA 2A41A 4OGCA 1NGBA 3OYAA 2X6NA 2YHXA 1YAGA 4BGBA 4DF8A 3NF7A 4N56A 3SV4A 4FM2A 4F3OA 4HTLA 4FO0A 4CHPA 1HNZK 2IVOA 3ZT0A 3C6UA 4KHYA 2A5XA 2KW4A 3CPEA 4H0XB 3GDQA 1YJNN 5FRMA 2UXCK 4FXDA 4JEPA 3BDPA 3F9KA 2HNZA 1RILA 3V9UA 2O8BA 3MXJA 4LD0A 3VQ9A 2ETJA 1KLNA 4DTRA 1S1TA 1KFDA 3AGKA 4ID1A 4IZ9A 3CJ1A 2D0OA 3CM5A 3O9QA 4IG0A 1TV6A 4FWPA 3JAMO 1T3VA 4CW7B 4DWIA 2ZE2A 2WBNA 3KKRA 5KRTA 3VOVA 3VERA 4CJPA 2ITGA 3MN5A 2QW9A 4CZKA 1VQ4N 1CZBA 2A1SA 4CEOA 1RBTA 2NRVA 1YTUA 2F4VK 2CGLA 3IUCA 1T7PA 3Q7CA 4C1NK 2J4RA 5JLFA 1U2VB 3M3ZA 1TK0A 4E7HA 4IOAL 3AV9A 3AVFA 1N36K 4DTSA 1IG9A 3PUFA 1UWBA 4FWQA 2P9UB 1VQ5N 2OPSA 3VTIA 2GX9A 3DLLL 4OKEA 2HHHK 4AM7A 3K5MA 1JL1A 1EXQA 2W42A 3V9WA 4W5RA 5FLXO 1HNXK 1R59O 3AO5A 4I9LA 3HO1A 4GKKK 3OBWA 1S9EA 1FK9A 3QNOA 3T69A 1TK5A 3NGZA 3VEZA 4NCAA 1HKBA 1JXBA 3V1RA 3ZX2A 3QEXA 3C94A 1P8ZA 4DKWA 4B9VA 1LW0A 4E3SA 2W6LA 4FWKA 4WQ5C 3QEWA 1C0GA 5J1EA 2YKMA 3HYFA 4RW6A 1VQMN 2D5RA 4JHDA 2UYTA 4H5NA 2QWOA 1YTAA 2HVHA 3NCIA 4IO9L 4FVUA 1T6DA 3J7ZO 4PY5A 4BRCA 3VQ7A 3ZEUA 2WFBA 4CEFA 4DMNA 5BPLA 3KIOA 1NGEA 3BF1A 4H0TB 1XWLA 1JLBA 4FZYA 4BE0A 5AQIA 5ADXA 3SUNA 3AA3A 4CF2A 1JKHA 3THVA 5AQPA 4DV1K 1BU6O 1RDUA 1TAQA 3U9DA 3DAWA 3NBPA 3PY8A 3CJ9A 4UY8O 3O08A 3PO5A 3SJHA 4PA1A 1WOQA 2A3ZA 4JK9A 5F0XA 5HBMA 1IKVA 3EE8A 4JI7K 2E2NA 3M8RA 1HLUA 3MN7A 5AQQA 3KZBA 1ZBSA 3ZSWA 5KRSA 3MWTA 5KQ8A 3AVHA 5JVGL 2O8EB 1O13A 4DLGA 2EHGA 1VAZA 3V4IA 4CJ5A 5C15A 5DM6L 3MAQA 4RW7A 1IH7A 1GLDG 5AFUH 3OYKA 5AQUA 2XY7A 2E2PA 1Q81O 3EKUA 1ASVA 1X9MA 3KWGA 1NK0A 4BRLA 1C0MA 1GLEG 1U2VA 2G8VA 4FWSA 4BQLA 4B1YB 1W0HA 3M1FA 4CJWA 1NU0A 3A2FA 3VGMA 1F21A 5AQVA 3BEXA 2P9UA 4IEIA 2DFEA 1SAZA 4EZ9A 1XHZA 4FL9A 2XY6A 5KPTA 4DSLA 3IRXA 3QERA 3DJCA 4B1XB 3VQBA 1TAUA 3LDOA 3AVKA 3HT3A 2P9IB 2HW3A 1FJGK 4CK2A 2JLEA 1T03A 2QA4N 3QDKA 1QSLA 3DLBA 1M1KO 1RTJA 4JI4K 1VSHA 3L8BA 4AH9A 1NGCA 3CHWA 3HTVA 2NRTA 1GLCG 5M1KA 3KWIA 1ATSA 4O44A 1X1PA 3QIPA 2QXFA 3H1QA 4FW2A 2KZMA 3LPUA 4DR1K 1XQSC 3HPOA 3SQ4A 3SQ1A 5FRNA 5BRDA 4WF9L 3NHGA 1IBKK 4H0VB 2ZD1A 1HJOA 2OZSA 2G8KA 3H45C 3THXB 2UUAK 2HMIA 1C1CA 4BC4A 3QICA 1EP4A 3LAMA 1E3MA 1JCGA 1NGJA 3RRHA 3AVNA 4FJKA 4B3MK 4FJNA 3TTFA 1Q18A 3ID8A 3CERA 2BH1A 4OPKA 1VQ6N 2OZMA 2G8UA 4RG8A 1YITN 3LPTA 3NAEA 3B6PA 4O0IA 4WQ4A 4CEDA 4CHZA 5J2QA 2VWBA 3CG7A 4RW8A 4R5PA 2QXLA 3MX2A 3H3NO 4WE1A 2XHBA 1QZ5A 3QETA 4H0PA 2YHBA 2O8EA 3M8PA 1C0UA 1DGKN 2NZTA 3HVRA 2ZGYA 1SL0A 2A6AA 4BC2A 3OHRA 4ELTA 3SMPA 3CC2N 4CEZA 2Q0UA 5FPDA 1C0FA 4KH4A 4H0OA 4IJAA 4DU1A 2HF3A 1XMQK 4MLHA 1NJWA 3VQ4A 1WSHA 3AVIA 2NUBA 3TTDA 3VQ8A 4F2SA 1IV0A 1NGDA 2NNWA 2Q0RA 2P9SB 1SZ2A 4KH5A 4C8MA 3CCMN 4DR2K 4FWLA 3TAFA 3WNEA 4OKJA 4LF4K 4IFEA 1VSEA 3QBXA 4YHHK 1BCMA 4CGHA 4Z4CA 3R3LA 2VQFK 2HF4A 3SI6A 5KGWA 4EHTA 1A5VA 5ADXH 3T3FA 4CEEA 1NLVA 1EQYA 4BRPA 4DCHA 1J5EK 4AHTA 3L2VA 1NOYA 4CEAA 4FJ5A 2DPNA 2BANA 4YFUA 1Z05A 2VG5A 4H8KA 3LWLA 3CI5A 3TPQA 4DSKA 4HCCA 4E0DA 3TAMA 2KFNA 3EYZA 4CJ3A 3OYGA 4FLWA 4K0KK 2ITMA 4DFPA 1KXPA 4OVLA 3NMUA 3LM2A 3THXA 3AVMA 4KRFA 5KTQA 1YHQN 3O8MA 4EZ6A 4RWTA 4LFBK 4KTZA 3TAQA 1OH7A 3LDLA 2E8AA 3CF5L 4DSIA 3MEGA 4DTMA 3AO3A 3J7YP 4B8AB 2UU9K 2UUCK 3IDHA 4OLAA 5M1PA 4JKHA 3WEEB 2P9LB 3PO4A 4MO4A 1K9MO 2GWJA 4PHTX 5A2QO 3ATUA 3VPZA 4FLXA 1JLFA 4C8OA 4NB4A 2CH5A 3PIPL 1I3AA 1HNVA 2YHAA 1Z6RA 3AVJA 3MMVA 5JICA 3MECA 1TKZA 1N32K 3ZT4A 4FM0A 5BR9A 3VQ6A 4WFNL 3CXCM 1VSDA 3DM2A 1VK0A 2O8DB 3VEVA 1N6QA 1HRHA 3FZHA 1B9DA 4H4OA 4N76A 5AR0A 1W2BM 1WN7A 3VGLA 2FSNA 3E9LA 4LH4A 3UIQA 3AGRA 2P9SA 2HVIA 3FE1A 3IKMA 3RSEB 3NGYA 2CGJA 3O4QA 4JRPA 1SV5A 1RT4A 3DRPA 3G71N 4CGDA 1HYSA 3K9JA 1J6ZA 1EX4A 5DM7L 4CJKA 1YVUA 1U49A 2AJQA 4PKIA 5AQMA 1WSJA 1DKGD 1RNHA 1T8EA 5BREA 4DUYK 3P5JA 4BG9A 3CC4N 3SK3A 4BRHA 4FK4A 3O1BA 3TU5A 1TKDA 3LP2A 3ASMA 2DFFA 2OPPA 4CJFA 1DLOA 3AVCA 4CD3A 3O9SA 3T1YK 3LZIA 1HKGA 3AA4A 2YJEA 4FVMA 3OJSA 4CIGA 1RDBA 1WUAA 5JS1A 1HR0K 4FPAA 4M42A 2HMPA 4F8RA 2UXBK 1NK9A 4CK1A 1KAYA 2FBTA 2WTUA 2PY5A 5SZTA 3QNNA 4BREA 1VSMA 5GAEP 3WNHA 3THYB 1U4BA 1T6CA 3CM6A 3L2UA 1FKPA 4ZTJA 3N4PA 3MX5A 5C42A 1IO2A 4XH4A 4CHYA 1VHXA 1HNIA 2JWLA 3CYMA 1J9AA 2FSJA 4BY9C 1KVBA 4JNEA 1BA0A 1NMDA 5M1NA 3E9PA 1B92A 5GIOA 4LF5K 1OKJA 2XY8A 4Z4FA 2OANA 4CJLA 4OO1J 1FKOA 4IXCA 3TR8A 4CJEA 3WXLA 4FZXC 4DS4A 4BR0A 3WEEA 4JK7A 2P9LA 2OCEA 4H5RA 4I2QA 3TAGA 1P90A 4JI3K 3K9KA 1Q86O 4FJMA 3HZ6A 3M6GA 1WSGA 2GELA 3O9TA 4E1MA 1GLAG 4DR3K 4Z4HA 1BQMA 1NGFA 1Q9YA 3H6EA 4DFJA 3I0SA 1OH5A 4KFBA 3V81A 2R7YA 1D4XA 1HQEA 3O3FA 5C0YA 1RT1A 2QWQA 4IOXA 3WT0A 3DMJA 5EX5A 4CF8A 4KB0A 2RN2A 4LF8K 5C2FA 3VESA 4F4KA 3RTVA 4B3SK 4Z0UA 1RDWX 4ISGA 2FBVA 4X66K 1YIJN 3GE1A 3RSEA 3OYCA 1A5XA 1K6YA 3T1HK 1UAXA 5AQYA 3WNGA 3AA2A 1TL1A 3V9SA 2PAVA 4BVPA 2A42A 4KAZA 2IS3A 3CFOA 3K59A 4LF9K 3AVGA 5CZ2A 4F9OA 1LWCA 2BUPA 3S3MA 4DB3A 1RBVA 3VQPA 2B5JA 1RTIA 1CXUA 3KHYA 3O9UA 3CQXA 3HOTA 5FDLA 2IDOA 3O6WA 3F5TA 5FPEA 1NJIO 4CZFA 4JI0K 3THYA 1IG8A 2QWNA 4ILJA 5KPRA 4ELVA 1WSFA 3MK6A 4CHQA 4LF7K 1WBBA 2YHYA 4C8NA 1Q7YO 4GY2B 2P9KB 4MLEA 4FYDA 1O1WA 4FOEA 3F73A 3SMSA 3L2QA 3ZT3A 4E1NA 2E1YA 2P9NB 4BACA 4J2BA 4O0JA 2ZF5O 1C1AA 1YF5L 3GBTA 2QWPA 3CCVN 1IKXA 2DTUA 5J2PA 1S1UA 4HHTA 4GVMA 5K14A 3AO4A 1RT2A 3CIPA 4CZEA 4CGFA 1S22A 3WXIA 2HHVA 4B9MA 1HX1A 1N34K 4BG8A 1MWMA 4DTPA 4RTFD 4DHYA 4YOVA 4O4GA 3RMAA 5GIPA 5AQRA 4WFBL 4BC5A 3OA9A 4KI6A 3N4QA 2I7PA 2IVPA 1QHTA 4JKAA 4DF4A 3G0ZA 5AQGA 3MCPA 1QSSA 5HP1A 2HHXA 3FZMA 4U7BA 4CJQA 4Z4GA 3VQAA 1ASUA 4J2EA 4CBUA 3SZ2A 4KBOA 3QINA 3PX4A 1HJRA 1RTDA 3QLHA 1NJXA 3HOSA 2G8WA 3RMBA 5H1SQ 2RKIA 4A5AA 2GBZA 3OS0A 4MFBA 4W5OA 1RGIA 3PSIA 1QHAA 4CZLA 3L4QA 3I8BA 1WBDA 4BRGA 3M8SA 1E4GT 2P51A 4FLVA 4PL8A 4WYBA 2KQ2A 4DQPA 1FXXA 3I56N 4CGIA 3P4IA 1TKXA 2IC3A 2F96A 3D2EB 2GUIA 3DXMB 4PL7A 3ZCMA 2I7NA 3HBTA 3FZFA 3L0QA 3LANA 4YOUA 3H3OB 4J2AA 3JYTA 3CCEN 4HUGA 4CF0A 3MEEA 4BR5A 4FZZA 3LP1A 3EZWA 1S5JA 1DTTA 1BQNA 4QOZB 4BROA 1FW6A 4CBWA 3BZKA 3SQ0A 3I55N 1CZAN 4KREA 1LWEA 3C6TA 3T1AA 4OJRA 5BRFA 4CHNA 1ZBFA 3A0IX 3MCAB 3EL2A 2EWSA 4CJRA 3VEWA 3D45A 3OYDA 2P9KA 3CCUN 2DY4A 1IJJA 4ILGB 1DT9A 3VEXA 2P9NA 4OPJA 1IKYA 3A5NC 3IFRA 4ISFA 2Z1HA 4DTUA 4CI6A 1RT7A 4WCEL 3FFIA 3EEQA 1NK8A 2D0AA 1MDUB 3NE6A 5MLCQ 2RE2A 4LFCK 4JKCA 4BR2A 1BIZA 2VQEK 3GOIA 2OA8A 5BR8K 1QVGM 3SAGA 1NJZA 4PKHA 1NK7A 1X9WA 5HRPA 4NLCA 4FWRA 4HUFA 1OH6A 4BRDA 4I9QA 3C6AA 3D0PA 2BGGA 2D0PA 3WXJA 3ZSQA 1U45A 2FXUA 4K8ZA 1VSIA 3LWMA 5EU7A 5BN8A 4DV4K 1KSPA 4YDUA 1EETA 5T7BA 3NH0A 4XIUA 1HPZA 3I0RA 3KTQA 4FWMA 1YXQA 2KKZA 1J54A 3VQCA 4H4MA 4AILC 4CHOA 3FZKA 3LP3A 1NOZA 4CZIA 3OYIA 1KRPA 4KB1A 5DK5A 3KKSA 2VWJA 3QFPA 2H3GX 1D8YA 4DTXA 3SLCA 4PUOA 5LL6Z 3OS2A 3KVGA 4DU4A 5IWAK 3NGIA 3D2EA 3DXMA 4XH5A 5B8HA 2B4JA 3G6EN 3VQEA 3VTHA 5EVZA 4DU3A 2D0BA 3KLFA 3LDPA 2QK9A 4BRQA 3MWPA 1MU2A 2NRHA 3HP9A 2F9TA 3JS6A 5CE3A 1XNQK 4CGGA 4CESA 1RFQA 4QAGA 3OTOK 2CGKA 2B6AA 3KD1E 1XC9A 4H0YB 3AVBA 5F1XA 4DR5K 2ASPA 3HSTB 4FCYA 1QQCA 3K58A 4FJJA 1K8KB 2G8FA 3OBYA 2NRWA 3B8AX 1KC8O 4KTQA 3H1VX 3AO2A 1U48A 2UUBK 2LSNA 3L2RA 3ZT1A 1X3MA 3QMLA 1HQUA 2KZZA 2GWKA 4FJ9A 5EY4A 3ZSYA 3UB5A 4W5QA 3JXUA 2I5JA 5HRRA 4YOXA 3UKRB 3L2WA 1KVCA 2F8TA 1DEJA 4M45A 5AQSA 1GLJO 4DR7K 1VRUA 5IT9O 5AQKA 3RMCA 3AAQA 4LF6K 2Q1NA 4CEQA 1I39A 3NF6A 3AA5X 2HOEA 2P9PB 2KHOA 2P9IA 4ISEA 1B9FA 3O3GA 1BIUA 3QEIA 1GOBA 4DV5K 2FF6A 5F2RA 2WC9A 3D2FB 4C1NI 2GV9A 3VETA 2QI2A 4GV9A 3HM9A 3CMAN 4H5VA 1EKEA 3QFUA 3BP8A 1VSFA 3IG1A 1S6QA 4GV3A 3O5BA 3R9PA 3VF6A 5AQZA 1V4TA 1C6VA 1XHXA 3LDSA 3ZSXA 1REVA 2ASMA 3OYHA 4J8FA 1TUUA 4B9LA 4JLHA 5C10A 4M7YA 2D4WA 2NRXA 1ITGA 1KVAA 4K43A 1BDGA 3ULEB 2IIRA 4IOCL 3MN6A 5E41A 4A2BA 3KK7A 2HBLA 1VRTA 4BR9A 3HK2A 4DS5A 3H46O 3ID6A 4MDBA 3HJFA 3R6MA 2KLAA 4BRKA 3HSCA 3G25A 3OY9A 4IJNA 3KK3A 1GOCA 1QQOA 2QWMA 4KHNA 1SUQA 1G99A 1BL3A 5J2NA 2NRZA 3OYLA 1NG9A 3S3NA 1HYVA 2ATQA 2DFHA 4BRAA 3DLRA 4DSJA 2QWLA 2P5GA 3SNNA 3G10A 3P83D 3C95A 4BVOA 1BWFO 2HSTA 1W97L 2FSKA 3DXKB 4PKGA 4AHUA 1HMVA 4CF9A 4BDYA 2V51B 4NXNK 3P38A 4JD2B 2GUPA 4FLTA 4K41A 4QCLA 2HHTA 4DR4K 4YY3K 3QEPA 5CY4A 5BN9A 4BE2A 4KHPK 4YOTA 3IS9A 4E19A 4ID5A 3S9HA 3T7ZA 3V9XA 4Y1DA 4CZMA 2YNIA 3S3OA 4IWVA 4DQRA 1HUXA 2E2OA 3ZSOA 3EKSA 5HOOA 3O3HA 4KH6A 4JYAK 4RW4A 4F3TA 3CQ8A 3HM8A 4B1WB 4NYFA 1NGHA 2P9PA 4WQ5A 2E1ZA 3CMEN 3ZT2A 2Q36A 3F9MA 3UKUB 1SKRA 4U67L 3J7AP 3SUQA 2D0CA 4MDAA 3QESA 3DWLA 3NFAA 4JS4A 2YNGA 4BWJA 4E1JA 3ZLJA 3CJCA 4KV8A 3RRGA 4DSEA 2IGIA 2YV0X 5FPNA 4JV5K 1NGIA 2HBJA 1QE1A 3AAPA 3RVCA 1R0AA 4EP5A 3CCRN 4JK8A 4DQSA 3SCXA 1IBMK 3C6HA 5EOYA 1ATRA 2E2QA 3C65A 4NXMK 3TI0A 3H08A 4LSLA 1KQSM 4CF1A 2XY5A 3O9RA 3OYMA 3LM9A 4RW9A 1BCOA 4N41A 4BDZA 4CZGA 2YNHA 2FC0A 3SJJA 4ZHRA 3ZSZA 4XH1A 5LJWA 1IBLK 2Y1JA 3K5NA 2E20A 4FWOA 4E7KA 3AO1A 1VQNN 1VQKN 1S3XA 5AQJA 5ELZA 5AQWA 2BDPA 4DV2K 5EXWA 4BR7A 5AQOA 1ZBLA 4A62A 2E6LA 5JLHA 5J2MA 3W3DA 3SAFA 1VQPN 3OYFA 4R79A 5GINA 1X3NA 1GLFO 3CJ7A 3SPZA 2E6MA 3I8DA 1D5AA 1CXQA 3DXKA 5FROA 3HI0A 3K57A 3O4WA 5AQNA 1S1WA 3ULDA 1X9SA 1VQ7N 4DR6K 4BR4A 4WQ4C 4JD2A 3TTCA 5JMVA 4DV7K 4X64K 4IEEA 1NJYA 2NLXA 2XRIA 4O55A 2O8DA 4X62K 4JI8K 1LW2A 4JKBA 3BUZB 4F2RA 4O8KA 4DTOA 4H5WA 4JI6K 4DFKA 4GV6A 4CIEA 1MA9B 1KAXA 3A5LC 3BZCA 2ASOA 2OPQA 2IOCA 4CFAA 3VQDA 1JLQA 4FJXA 2VG7A 2V7YA 4LC9B 1L3SA 4K8XA 3ISNC 3PIOL 2OTJN 4QS9A 4CERA 3TAPA 3NH2A 4JAXA 4Q0BA 3EN9A 3SBGA 3F2KA 4NCBA 1ZBIA 1NMNA 4A59A 1KAZA 3UKUA 3L3VA 1RDAA 2P1JA 5HRNA 3KLGA 3DLEA 1NWKA 4K42A 4L3QA 3SBTA 5AFUA 2BTFA 3LP0A 4BE1A 4W5NA 1EO1A 3CFRA 4V19S 3CCJN 1NKBA 4O5FA 3OYJA 1TKTA 1U04A 4CGJA 3HPHA 2QWRA 1NK5A 3TWHA 4OPAA 3U8XA 4E7LA 4OKKA 1J53A 4LSNA 2GEMA 4IO8A 3R1XA 3E1YA 3DRSA 3DLHA 1SKWA 3J81O 2RF2A 2YX6A 1L3TA 1SS6A 1YT3A 4CEBA 4Q5VA 1D9FA 1XC3A 3S41A 1WB9A 2GTDA 3KLIA 3CPWM 3O80A 4ILHA 3KJVA 4KI4A 5CHIA 5BPNA 4AQYK 4C23A 2QTDA 1TL3A 3J80O 4M3WA 4DSFA 2FBXA 1ATNA 2YI1A 1HYZA 4CCHA 1GLBG 1LAWA 4AHVA 4DG1A 1JLCA 3LL3A 4Y1CA 4FM1A 2A40A 4DV3K 1XNRK 3KK1A 1VQON 4A57A 3U3YA 4B3RK 4B9NA 4TSXA 3ZSVA 3CETA 3BGRA 3MEDA 2Q97A 3WQTA 1Z25A 1L3VA 4H5TA 4OLBA 1TGOA 4IDKA 3C0BA 1ZBUA 4JI5K 4DFMA 1SKSA 2VWKA 3ZSRA 3DOKA 3MXIA 3P1GA 4B9TA 3HVTA 4MO5A 3DLGA 1Q82O 1I94K 4EIAA 1BGXT 3J8AA 2F9WA 2Z1JA 3MXMA 1YJWN 2JWKA 4W5TA 3RR7A 1NKCA 1G15A 2YHWA 1BI4B 4JN4A 1DTQA 4IFYA 4GW6A 4L8RB 1S1VA 4AF1A 2Y1IA 5BPMA 1QTMA 3RWUA 4HWIA 2FLOA 4GKJK 1SL1A 1OH8A 3M8QA 1RT3A 5GADP 4I6MB 4BRIA 3FGUA 3DOLA 4B1UB 4PWDA 2YNFA 5SWMA 1H1VA 1W9HA 5I3UA 4WFAL 4B08A 2AP1A 4DUZK 3CJAA 3TSUA 3DYAA 3W0LA 4IG3A 4M41A 3JSMA 3V1OA 4X65K 3GL1A 1UA0A 3NH1A 2ZQBA 2VGMA 4E7IA 1WAFA 1HPMA 1M90O 5TKWA 1D9DA 1KLMA 3OYEA 2D1KA 3NF8A 5KI6A 1NGAA 4FOIA 3UE5A 4KHWA 2CH6A 5AQLA 4CE9A 5AZIB 1JLAA 1ZYQA 2Q31A
chains in the Genus database with same CATH topology
2BE2A 3AVCA 1RILA 3V9UA 1B9FA 2O4GA 3O3GA 4B8CA 3LZIA 1BIUA 3MXJA 4LD0A 3VQ9A 1TK8A 2ETJA 3AA4A 1KLNA 4FVMA 3OJSA 4CIGA 1S1TA 4DTRA 3QEIA 1GOBA 1RDBA 1KFDA 4ID1A 5JS1A 4M42A 2GV9A 4F8RA 3CM5A 1VSLA 3HM9A 1NK9A 4IG0A 4FJLA 1TV6A 1EKEA 4CK1A 4B9SA 1RBUA 4DWIA 1VSFA 2FBTA 2ZE2A 3KKRA 5KRTA 3IG1A 2PY5A 4FLYA 5SZTA 1S6QA 3QNNA 1VSMA 1J5OA 4CJPA 2ITGA 3WNHA 1CZBA 2A1SA 4CEOA 1RBTA 1C6VA 1XHXA 1L5UA 3LDSA 1YTUA 1U4BA 3CM6A 4JS5A 3L2UA 3ZSXA 1REVA 1FKPA 3OYHA 4B9LA 4JLHA 4KHQA 4ZTJA 1T7PA 5C42A 3DLKA 1IO2A 4CHYA 1TK0A 4E7HA 1ITGA 1HNIA 1KVAA 1TVRA 3AV9A 3AVFA 1J9AA 3CYMA 3IAYA 4DTSA 1KVBA 1IG9A 3PUFA 1B92A 4MQ3A 1UWBA 2XY8A 4Z4FA 4CJLA 3V1QA 4UQGA 1JXEA 2A1RA 5E41A 1FKOA 3TR8A 2OPSA 4CJEA 1VRTA 3HK2A 4DS5A 2Z1IA 4OKEA 3HJFA 3K5MA 4CJUA 1JL1A 4DS4A 4FZXC 1EXQA 2W42A 3V9WA 3QEVA 4W5RA 1LV5A 2PYJA 4M3ZA 4I2QA 3TAGA 3OY9A 1S6PA 1GOCA 3KK3A 3EZ5A 4FJMA 3AO5A 4I9LA 1WSGA 3U6FA 3HO1A 5CYMA 3NDKA 4KHNA 1SUQA 1BL3A 5J2NA 3TAEA 1S9EA 1FK9A 1BI4A 1WLJA 4HTUA 3QNOA 3OYLA 4DQIA 1TK5A 4KTWA 4E1MA 3NGZA 4Z4HA 3S3NA 4NCAA 1HYVA 2ATQA 2DFHA 4ZTFA 1BQMA 3DLRA 1KTQA 4DSJA 1JXBA 2P5GA 3V1RA 1Q9YA 4C8LA 4DFJA 3I0SA 3SNNA 3QEXA 3G10A 3C94A 3P83D 3TARA 4KFBA 3V81A 3C95A 1LW0A 4GMJB 2R7YA 4E3SA 1QSYA 4YNQA 4B9VA 1HQEA 3O3FA 3DRRA 4AHUA 1RT1A 1HMVA 4CF9A 4BDYA 1NK4A 4B3OA 3QEWA 4HCBA 5J1EA 2YKMA 3HYFA 4FLTA 4RW6A 2D5RA 3DMJA 4CF8A 4CFDA 4QCLA 4KB0A 1RTHA 2RN2A 2HHTA 3QEPA 4F4KA 1YTAA 3HXMA 5CYQA 3RTVA 5CY4A 2HVHA 3CFPA 4BE2A 3NCIA 4Z0UA 3IS9A 4E19A 4ID5A 3S9HA 2P5OA 3V9XA 2FBVA 4Y1DA 5DMRA 1RBSA 4PY5A 3VQ7A 2YNIA 3S3OA 3OYCA 4CEFA 4DMNA 3KIOA 4DQRA 3TABA 1A5XA 1K6YA 1UAXA 1XWLA 1JLBA 4FZYA 3ZSOA 4BE0A 4FJ7A 3WNGA 3AA2A 1TL1A 3V9SA 3SUNA 3AA3A 4CF2A 3O3HA 1JKHA 3VQ5A 3THVA 4KAZA 4RW4A 2IS3A 4F3TA 3CFOA 3K59A 4C8KA 1WAJA 3AVGA 3V9ZA 3CQ8A 4FLUA 2PZSA 3LAKA 5CZ2A 1TAQA 3NBPA 3PY8A 2KFZA 4NYFA 3OYBA 1LWCA 3F9KA 3S3MA 5HLFA 3PO5A 4PA1A 1CZ9A 2HB5A 3ZT2A 1UA1A 1SKRA 5HBMA 1IKVA 1RBVA 3VQPA 2B5JA 3M8RA 3SUQA 3EY1A 1RTIA 2D0CA 4CFBA 1CXUA 3QESA 3NFAA 3ZSWA 5KRSA 3OS1A 2YNGA 4JS4A 4BWJA 5FDLA 3AVHA 4KV8A 3RRGA 4DLGA 1RDDA 2IDOA 2EHGA 2VG6A 4BDPA 4DSEA 2IGIA 3V4IA 2YV0X 1XI1A 4CJ5A 1QE1A 3MAQA 4RW7A 1IH7A 3OYKA 1R0AA 4EP5A 4DQSA 3SCXA 1WSIA 3KD5E 2XY7A 4OGEA 1ASVA 1X9MA 3TI0A 4ELVA 1WSFA 3H08A 4LSLA 4CHQA 4CF1A 2XY5A 2HHWA 1NK0A 3PX0A 1C0MA 2G8VA 4C8NA 3O4NA 3OYMA 4RW9A 4CJ4A 1BCOA 4N41A 4BDZA 1W0HA 4CJWA 3A2FA 1F21A 4FYDA 2YNHA 1O1WA 3F73A 2FC0A 2DFEA 3L2QA 3SJJA 3ZT3A 2G8HA 4E1NA 4EZ9A 4FLZA 4BACA 1XHZA 4J2BA 4ZHRA 4CECA 4O0JA 3ZSZA 1C1AA 2JGUA 2XY6A 4FJIA 4DSLA 1C0TA 2Y1JA 3PX6A 1IKXA 3K5NA 4E7KA 3IRXA 1S1UA 3AO1A 5J2PA 3QERA 4FK2A 2YKNA 4HHTA 2DTUA 4GVMA 4FK0A 5K14A 3VQBA 2BDPA 3AO4A 1TAUA 4KPYA 3AVKA 1RT2A 4ICLA 4AHCA 4CGFA 3HT3A 3SQ2A 3SUOA 1ZBLA 4B9MA 1Y97A 2E6LA 2O4IA 2HW3A 4CK2A 2HHVA 1S1XA 5J2MA 1GOAA 2JLEA 4DTPA 1T03A 4LY7A 1QSLA 3DLBA 5KGXA 2Z1GA 3OYFA 3QO9A 4M3XA 1RTJA 4B9UA 1VSHA 4O4GA 3L8BA 3RMAA 1U47A 4AH9A 4M3YA 1KFSA 3SPZA 2E6MA 3I8DA 1ASWA 1CLQA 3HL8A 3SPYA 1QS4A 3NF6A 1D5AA 1CXQA 2PYLA 4O44A 1X1PA 4BWMA 4KI6A 3VA3A 3QIPA 1QHTA 2QXFA 5FROA 4FW2A 3K57A 4DF4A 2KZMA 2X74A 3LPUA 4FJ8A 3G0ZA 1S1WA 3OVNA 4G1QA 3ULDA 1X9SA 3HPOA 1QSSA 3SQ4A 5HP1A 3SQ1A 2HHXA 4CJQA 4Z4GA 1NJYA 5FRNA 3VQAA 3NHGA 4FJHA 1ASUA 2XRIA 3V6DA 4O55A 2ZD1A 2OZSA 1NK6A 4J2EA 2G8KA 1LW2A 2WONA 3SZ2A 3KLHA 4O5BA 3QINA 2HMIA 1C1CA 3PX4A 1HJRA 1RTDA 3QLHA 2HHQA 2QKBA 4F2RA 1BHLA 4DTOA 1SL2A 4IBNA 1NJXA 4EP4A 4DFKA 2G8WA 4CIEA 3RMBA 1RT5A 1EP4A 2RKIA 3LAMA 4DTJA 3BDPA 4J2DA 4DQQA 2GBZA 3OS0A 4MFBA 4W5OA 3RRHA 3AVNA 2HHUA 4FJKA 4FJNA 2OPQA 2IOCA 4CFAA 2XO7A 2FBYA 1S9GA 1JLQA 4KKOA 3VQDA 4OPKA 2OZMA 2G8UA 4RG8A 4HUEA 5D3GA 4FJXA 2VG7A 3M8SA 3AVAA 4PQUA 3LPTA 1L3SA 3B6OA 2P51A 4K8XA 3ISNC 4FLVA 3NAEA 3SUPA 2KQ2A 4IKFA 1A5WA 4DQPA 1FXXA 4CERA 4DLEA 2IAJA 3B6PA 4CGIA 3TAPA 2RPIA 3NH2A 2QKKA 1TKXA 1RT6A 2IC3A 2F96A 2GUIA 4NYNA 4O0IA 4Q0BA 4NCBA 1ZBIA 3SV3A 3ZCMA 1RDAA 3NF9A 1Q8IA 1WSEA 2P1JA 3L3VA 4CEDA 4CHZA 5HRNA 3KLGA 3DLEA 5J2QA 3LANA 2F8SA 4J2AA 3CG7A 3L3UA 3JYTA 4RW8A 1Z26A 3LP0A 4AHRA 4R5PA 4HUGA 4BE1A 4W5NA 3CFRA 4I2PA 4WE1A 4CF0A 3MEEA 2XHBA 2OPRA 1NKBA 4FZZA 3LP1A 3KLEA 3QETA 3OYJA 1S5JA 1TKTA 1U04A 2YHBA 4KO0A 1DTTA 3M8PA 3HPHA 4CGJA 1C0UA 1UOCA 3HVRA 4CFCA 1BQNA 1NK5A 1SL0A 3KK2A 4QOZB 3TWHA 1LWFA 3SQ0A 4ELTA 4E7LA 4OKKA 4KREA 1J53A 1LWEA 2KTQA 3C6TA 3T1AA 4OJRA 4CHNA 4CIFA 4LSNA 1ZBFA 3DRSA 3DLHA 1SKWA 1Q9XA 4CEZA 2RF2A 3ITHA 3K2PA 1L3TA 4DU1A 4E7JA 4CJRA 3D45A 1YT3A 4CEBA 1NJWA 3VQ4A 1ZBHA 3OYDA 2HNYA 1WSHA 1WNSA 3AVIA 4Q5VA 2NUBA 3VQ8A 4F2SA 2DY4A 1D9FA 4KHUA 4N5SA 3U3GA 4C8MA 4OPJA 4JRQA 1IKYA 3TAFA 3KLIA 3WNEA 4KHSA 2OPPA 3ALYA 4OKJA 2Z1HA 4DTUA 3KJVA 2G8IA 1RT7A 1VSEA 5HRSA 4KI4A 1BCMA 4CGHA 3FFIA 4Z4EA 4Z4CA 3TANA 1NK8A 4DTNA 2D0AA 5CZ1A 3NE6A 4CJVA 3SI6A 1TL3A 5KGWA 1A5VA 3OJUA 3T3FA 4M3WA 4CEEA 4DSFA 2FBXA 1VSJA 3AVLA 4CJTA 1BIZA 1HYZA 4CCHA 2OA8A 1LAWA 2X6SA 4AHVA 4AHTA 3L2VA 1NOYA 4DG1A 2OYQA 3VN5A 4CEAA 1NJZA 4FJ5A 1JLCA 3OYNA 1NK7A 5HRPA 1X9WA 4Y1CA 4FJGA 4FM1A 2BANA 4YFUA 4HUFA 3SYZA 2VG5A 3KK1A 4H8KA 1NKEA 3U3YA 3LWLA 4Z4IA 4I9QA 4LH5A 3D0PA 4B9NA 4TSXA 4DSKA 1RCHA 3ZSVA 4HCCA 1LAVA 2BGGA 2E4LA 4E0DA 1JL2A 1C1BA 1RBRA 3TAMA 4CJSA 2KFNA 3EYZA 3ZSQA 4CJ3A 5I42A 1U45A 3OYGA 4FLWA 4DFPA 2WOMA 2X78A 4K8ZA 1VSIA 3LWMA 4M3UA 3BGRA 3MEDA 5EU7A 1T05A 3E01A 1Z25A 3VA0A 4OVLA 1L3VA 3LZJA 3LALA 4OLBA 1KSPA 1TGOA 3AVMA 4IDKA 4KRFA 3HP6A 5KTQA 1EETA 1ZBUA 4M3RA 4EZ6A 5T7BA 3NH0A 4FW1A 3PV8A 4ELUA 4XIUA 4DFMA 1HPZA 2VWKA 4KTZA 3I0RA 3TAQA 1SKSA 3ZSRA 5C25A 3KTQA 1J54A 3DOKA 3VQCA 3MXIA 4H4MA 4AILC 5C24A 4CHOA 3P1GA 4DSIA 3MEGA 3LP3A 4DTMA 1N5YA 1NOZA 3AO3A 3HVTA 3VQQA 1VSKA 4B9TA 3OYIA 3DLGA 4B8AB 1KRPA 4KB1A 2HHSA 5DK5A 3KKSA 2VWJA 1BGXT 4OLAA 1D8YA 4HVJA 4DTXA 2Z1JA 3RR8A 3MXMA 3PO4A 4PUOA 3OS2A 4W5TA 3RR7A 4DU4A 1NKCA 3HPGA 3NGIA 1G15A 4FLXA 1JLFA 5JS2A 3K5LA 4C8OA 1KCFA 2B4JA 1BI4B 3VQEA 1DTQA 2EX3A 4IFYA 3QIOA 1I3AA 1HNVA 2Q3SA 2YHAA 4DU3A 1RDCA 4GW6A 2D0BA 3AVJA 3KLFA 5HROA 1S1VA 3MECA 1JLGA 4L8RB 2Y1IA 1TKZA 2QK9A 1QTMA 3ZT4A 4FM0A 3RWUA 1MU2A 4NCGA 3VQ6A 4CK3A 1VSDA 1BISA 3DM2A 3HP9A 3K5OA 4E89A 1SL1A 1VK0A 1IKWA 3M8QA 2HNDA 4AHSA 1RT3A 4CGGA 3RMDA 4CESA 4QAGA 1N6QA 1HRHA 4I7FA 3DOLA 1L3UA 2B6AA 3KD1E 1XC9A 4PWDA 2YNFA 1B9DA 5SWMA 1W9HA 4H4OA 5I3UA 3AVBA 4N76A 4FCYA 3HSTB 1QQCA 3T19A 1WN7A 3K58A 4FJJA 3WNFA 2G8FA 4B08A 4KTQA 1JLEA 4IFVA 3AO2A 4LH4A 1U48A 3UIQA 2LSNA 3DI6A 3L2RA 3DYAA 3ZT1A 2HVIA 4N47A 4IG3A 4M3TA 4M41A 1HQUA 3JSMA 3V1OA 2KZZA 4OGCA 3NGYA 2X6NA 3O4QA 3OYAA 4JRPA 1UA0A 1SV5A 4FJ9A 1RT4A 3ZSYA 3DRPA 4CGDA 1HYSA 4W5QA 3NH1A 2ZQBA 2I5JA 1EX4A 4DF8A 4CJKA 1YVUA 5HRRA 1U49A 3NF7A 4N56A 3L2WA 3SV4A 4E7IA 4FM2A 2AJQA 4F3OA 1WSJA 1WAFA 1KVCA 1RNHA 1T8EA 4M45A 2F8TA 4CHPA 3ZT0A 3P5JA 3C6UA 4FK4A 1VRUA 4KHYA 1D9DA 1KLMA 3OYEA 3RMCA 3NF8A 5KI6A 2KW4A 4CEQA 5FRMA 1TKDA 3LP2A 3ASMA 4KHWA 1I39A 4CE9A 4FXDA 2DFFA 1JLAA 3AA5X 1ZYQA 4CJFA 1DLOA 2HNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE2 A;  3AVC A;  1RIL A;  3V9U A;  1B9F A;  2O4G A;  3O3G A;  4B8C A;  3LZI A;  1BIU A;  3MXJ A;  4LD0 A;  3VQ9 A;  1TK8 A;  2ETJ A;  3AA4 A;  1KLN A;  4FVM A;  3OJS A;  4CIG A;  1S1T A;  4DTR A;  3QEI A;  1GOB A;  1RDB A;  1KFD A;  4ID1 A;  5JS1 A;  4M42 A;  2GV9 A;  4F8R A;  3CM5 A;  1VSL A;  3HM9 A;  1NK9 A;  4IG0 A;  4FJL A;  1TV6 A;  1EKE A;  4CK1 A;  4B9S A;  1RBU A;  4DWI A;  1VSF A;  2FBT A;  2ZE2 A;  3KKR A;  5KRT A;  3IG1 A;  2PY5 A;  4FLY A;  5SZT A;  1S6Q A;  3QNN A;  1VSM A;  1J5O A;  4CJP A;  2ITG A;  3WNH A;  1CZB A;  2A1S A;  4CEO A;  1RBT A;  1C6V A;  1XHX A;  1L5U A;  3LDS A;  1YTU A;  1U4B A;  3CM6 A;  4JS5 A;  3L2U A;  3ZSX A;  1REV A;  1FKP A;  3OYH A;  4B9L A;  4JLH A;  4KHQ A;  4ZTJ A;  1T7P A;  5C42 A;  3DLK A;  1IO2 A;  4CHY A;  1TK0 A;  4E7H A;  1ITG A;  1HNI A;  1KVA A;  1TVR A;  3AV9 A;  3AVF A;  1J9A A;  3CYM A;  3IAY A;  4DTS A;  1KVB A;  1IG9 A;  3PUF A;  1B92 A;  4MQ3 A;  1UWB A;  2XY8 A;  4Z4F A;  4CJL A;  3V1Q A;  4UQG A;  1JXE A;  2A1R A;  5E41 A;  1FKO A;  3TR8 A;  2OPS A;  4CJE A;  1VRT A;  3HK2 A;  4DS5 A;  2Z1I A;  4OKE A;  3HJF A;  3K5M A;  4CJU A;  1JL1 A;  4DS4 A;  4FZX C;  1EXQ A;  2W42 A;  3V9W A;  3QEV A;  4W5R A;  1LV5 A;  2PYJ A;  4M3Z A;  4I2Q A;  3TAG A;  3OY9 A;  1S6P A;  1GOC A;  3KK3 A;  3EZ5 A;  4FJM A;  3AO5 A;  4I9L A;  1WSG A;  3U6F A;  3HO1 A;  5CYM A;  3NDK A;  4KHN A;  1SUQ A;  1BL3 A;  5J2N A;  3TAE A;  1S9E A;  1FK9 A;  1BI4 A;  1WLJ A;  4HTU A;  3QNO A;  3OYL A;  4DQI A;  1TK5 A;  4KTW A;  4E1M A;  3NGZ A;  4Z4H A;  3S3N A;  4NCA A;  1HYV A;  2ATQ A;  2DFH A;  4ZTF A;  1BQM A;  3DLR A;  1KTQ A;  4DSJ A;  1JXB A;  2P5G A;  3V1R A;  1Q9Y A;  4C8L A;  4DFJ A;  3I0S A;  3SNN A;  3QEX A;  3G10 A;  3C94 A;  3P83 D;  3TAR A;  4KFB A;  3V81 A;  3C95 A;  1LW0 A;  4GMJ B;  2R7Y A;  4E3S A;  1QSY A;  4YNQ A;  4B9V A;  1HQE A;  3O3F A;  3DRR A;  4AHU A;  1RT1 A;  1HMV A;  4CF9 A;  4BDY A;  1NK4 A;  4B3O A;  3QEW A;  4HCB A;  5J1E A;  2YKM A;  3HYF A;  4FLT A;  4RW6 A;  2D5R A;  3DMJ A;  4CF8 A;  4CFD A;  4QCL A;  4KB0 A;  1RTH A;  2RN2 A;  2HHT A;  3QEP A;  4F4K A;  1YTA A;  3HXM A;  5CYQ A;  3RTV A;  5CY4 A;  2HVH A;  3CFP A;  4BE2 A;  3NCI A;  4Z0U A;  3IS9 A;  4E19 A;  4ID5 A;  3S9H A;  2P5O A;  3V9X A;  2FBV A;  4Y1D A;  5DMR A;  1RBS A;  4PY5 A;  3VQ7 A;  2YNI A;  3S3O A;  3OYC A;  4CEF A;  4DMN A;  3KIO A;  4DQR A;  3TAB A;  1A5X A;  1K6Y A;  1UAX A;  1XWL A;  1JLB A;  4FZY A;  3ZSO A;  4BE0 A;  4FJ7 A;  3WNG A;  3AA2 A;  1TL1 A;  3V9S A;  3SUN A;  3AA3 A;  4CF2 A;  3O3H A;  1JKH A;  3VQ5 A;  3THV A;  4KAZ A;  4RW4 A;  2IS3 A;  4F3T A;  3CFO A;  3K59 A;  4C8K A;  1WAJ A;  3AVG A;  3V9Z A;  3CQ8 A;  4FLU A;  2PZS A;  3LAK A;  5CZ2 A;  1TAQ A;  3NBP A;  3PY8 A;  2KFZ A;  4NYF A;  3OYB A;  1LWC A;  3F9K A;  3S3M A;  5HLF A;  3PO5 A;  4PA1 A;  1CZ9 A;  2HB5 A;  3ZT2 A;  1UA1 A;  1SKR A;  5HBM A;  1IKV A;  1RBV A;  3VQP A;  2B5J A;  3M8R A;  3SUQ A;  3EY1 A;  1RTI A;  2D0C A;  4CFB A;  1CXU A;  3QES A;  3NFA A;  3ZSW A;  5KRS A;  3OS1 A;  2YNG A;  4JS4 A;  4BWJ A;  5FDL A;  3AVH A;  4KV8 A;  3RRG A;  4DLG A;  1RDD A;  2IDO A;  2EHG A;  2VG6 A;  4BDP A;  4DSE A;  2IGI A;  3V4I A;  2YV0 X;  1XI1 A;  4CJ5 A;  1QE1 A;  3MAQ A;  4RW7 A;  1IH7 A;  3OYK A;  1R0A A;  4EP5 A;  4DQS A;  3SCX A;  1WSI A;  3KD5 E;  2XY7 A;  4OGE A;  1ASV A;  1X9M A;  3TI0 A;  4ELV A;  1WSF A;  3H08 A;  4LSL A;  4CHQ A;  4CF1 A;  2XY5 A;  2HHW A;  1NK0 A;  3PX0 A;  1C0M A;  2G8V A;  4C8N A;  3O4N A;  3OYM A;  4RW9 A;  4CJ4 A;  1BCO A;  4N41 A;  4BDZ A;  1W0H A;  4CJW A;  3A2F A;  1F21 A;  4FYD A;  2YNH A;  1O1W A;  3F73 A;  2FC0 A;  2DFE A;  3L2Q A;  3SJJ A;  3ZT3 A;  2G8H A;  4E1N A;  4EZ9 A;  4FLZ A;  4BAC A;  1XHZ A;  4J2B A;  4ZHR A;  4CEC A;  4O0J A;  3ZSZ A;  1C1A A;  2JGU A;  2XY6 A;  4FJI A;  4DSL A;  1C0T A;  2Y1J A;  3PX6 A;  1IKX A;  3K5N A;  4E7K A;  3IRX A;  1S1U A;  3AO1 A;  5J2P A;  3QER A;  4FK2 A;  2YKN A;  4HHT A;  2DTU A;  4GVM A;  4FK0 A;  5K14 A;  3VQB A;  2BDP A;  3AO4 A;  1TAU A;  4KPY A;  3AVK A;  1RT2 A;  4ICL A;  4AHC A;  4CGF A;  3HT3 A;  3SQ2 A;  3SUO A;  1ZBL A;  4B9M A;  1Y97 A;  2E6L A;  2O4I A;  2HW3 A;  4CK2 A;  2HHV A;  1S1X A;  5J2M A;  1GOA A;  2JLE A;  4DTP A;  1T03 A;  4LY7 A;  1QSL A;  3DLB A;  5KGX A;  2Z1G A;  3OYF A;  3QO9 A;  4M3X A;  1RTJ A;  4B9U A;  1VSH A;  4O4G A;  3L8B A;  3RMA A;  1U47 A;  4AH9 A;  4M3Y A;  1KFS A;  3SPZ A;  2E6M A;  3I8D A;  1ASW A;  1CLQ A;  3HL8 A;  3SPY A;  1QS4 A;  3NF6 A;  1D5A A;  1CXQ A;  2PYL A;  4O44 A;  1X1P A;  4BWM A;  4KI6 A;  3VA3 A;  3QIP A;  1QHT A;  2QXF A;  5FRO A;  4FW2 A;  3K57 A;  4DF4 A;  2KZM A;  2X74 A;  3LPU A;  4FJ8 A;  3G0Z A;  1S1W A;  3OVN A;  4G1Q A;  3ULD A;  1X9S A;  3HPO A;  1QSS A;  3SQ4 A;  5HP1 A;  3SQ1 A;  2HHX A;  4CJQ A;  4Z4G A;  1NJY A;  5FRN A;  3VQA A;  3NHG A;  4FJH A;  1ASU A;  2XRI A;  3V6D A;  4O55 A;  2ZD1 A;  2OZS A;  1NK6 A;  4J2E A;  2G8K A;  1LW2 A;  2WON A;  3SZ2 A;  3KLH A;  4O5B A;  3QIN A;  2HMI A;  1C1C A;  3PX4 A;  1HJR A;  1RTD A;  3QLH A;  2HHQ A;  2QKB A;  4F2R A;  1BHL A;  4DTO A;  1SL2 A;  4IBN A;  1NJX A;  4EP4 A;  4DFK A;  2G8W A;  4CIE A;  3RMB A;  1RT5 A;  1EP4 A;  2RKI A;  3LAM A;  4DTJ A;  3BDP A;  4J2D A;  4DQQ A;  2GBZ A;  3OS0 A;  4MFB A;  4W5O A;  3RRH A;  3AVN A;  2HHU A;  4FJK A;  4FJN A;  2OPQ A;  2IOC A;  4CFA A;  2XO7 A;  2FBY A;  1S9G A;  1JLQ A;  4KKO A;  3VQD A;  4OPK A;  2OZM A;  2G8U A;  4RG8 A;  4HUE A;  5D3G A;  4FJX A;  2VG7 A;  3M8S A;  3AVA A;  4PQU A;  3LPT A;  1L3S A;  3B6O A;  2P51 A;  4K8X A;  3ISN C;  4FLV A;  3NAE A;  3SUP A;  2KQ2 A;  4IKF A;  1A5W A;  4DQP A;  1FXX A;  4CER A;  4DLE A;  2IAJ A;  3B6P A;  4CGI A;  3TAP A;  2RPI A;  3NH2 A;  2QKK A;  1TKX A;  1RT6 A;  2IC3 A;  2F96 A;  2GUI A;  4NYN A;  4O0I A;  4Q0B A;  4NCB A;  1ZBI A;  3SV3 A;  3ZCM A;  1RDA A;  3NF9 A;  1Q8I A;  1WSE A;  2P1J A;  3L3V A;  4CED A;  4CHZ A;  5HRN A;  3KLG A;  3DLE A;  5J2Q A;  3LAN A;  2F8S A;  4J2A A;  3CG7 A;  3L3U A;  3JYT A;  4RW8 A;  1Z26 A;  3LP0 A;  4AHR A;  4R5P A;  4HUG A;  4BE1 A;  4W5N A;  3CFR A;  4I2P A;  4WE1 A;  4CF0 A;  3MEE A;  2XHB A;  2OPR A;  1NKB A;  4FZZ A;  3LP1 A;  3KLE A;  3QET A;  3OYJ A;  1S5J A;  1TKT A;  1U04 A;  2YHB A;  4KO0 A;  1DTT A;  3M8P A;  3HPH A;  4CGJ A;  1C0U A;  1UOC A;  3HVR A;  4CFC A;  1BQN A;  1NK5 A;  1SL0 A;  3KK2 A;  4QOZ B;  3TWH A;  1LWF A;  3SQ0 A;  4ELT A;  4E7L A;  4OKK A;  4KRE A;  1J53 A;  1LWE A;  2KTQ A;  3C6T A;  3T1A A;  4OJR A;  4CHN A;  4CIF A;  4LSN A;  1ZBF A;  3DRS A;  3DLH A;  1SKW A;  1Q9X A;  4CEZ A;  2RF2 A;  3ITH A;  3K2P A;  1L3T A;  4DU1 A;  4E7J A;  4CJR A;  3D45 A;  1YT3 A;  4CEB A;  1NJW A;  3VQ4 A;  1ZBH A;  3OYD A;  2HNY A;  1WSH A;  1WNS A;  3AVI A;  4Q5V A;  2NUB A;  3VQ8 A;  4F2S A;  2DY4 A;  1D9F A;  4KHU A;  4N5S A;  3U3G A;  4C8M A;  4OPJ A;  4JRQ A;  1IKY A;  3TAF A;  3KLI A;  3WNE A;  4KHS A;  2OPP A;  3ALY A;  4OKJ A;  2Z1H A;  4DTU A;  3KJV A;  2G8I A;  1RT7 A;  1VSE A;  5HRS A;  4KI4 A;  1BCM A;  4CGH A;  3FFI A;  4Z4E A;  4Z4C A;  3TAN A;  1NK8 A;  4DTN A;  2D0A A;  5CZ1 A;  3NE6 A;  4CJV A;  3SI6 A;  1TL3 A;  5KGW A;  1A5V A;  3OJU A;  3T3F A;  4M3W A;  4CEE A;  4DSF A;  2FBX A;  1VSJ A;  3AVL A;  4CJT A;  1BIZ A;  1HYZ A;  4CCH A;  2OA8 A;  1LAW A;  2X6S A;  4AHV A;  4AHT A;  3L2V A;  1NOY A;  4DG1 A;  2OYQ A;  3VN5 A;  4CEA A;  1NJZ A;  4FJ5 A;  1JLC A;  3OYN A;  1NK7 A;  5HRP A;  1X9W A;  4Y1C A;  4FJG A;  4FM1 A;  2BAN A;  4YFU A;  4HUF A;  3SYZ A;  2VG5 A;  3KK1 A;  4H8K A;  1NKE A;  3U3Y A;  3LWL A;  4Z4I A;  4I9Q A;  4LH5 A;  3D0P A;  4B9N A;  4TSX A;  4DSK A;  1RCH A;  3ZSV A;  4HCC A;  1LAV A;  2BGG A;  2E4L A;  4E0D A;  1JL2 A;  1C1B A;  1RBR A;  3TAM A;  4CJS A;  2KFN A;  3EYZ A;  3ZSQ A;  4CJ3 A;  5I42 A;  1U45 A;  3OYG A;  4FLW A;  4DFP A;  2WOM A;  2X78 A;  4K8Z A;  1VSI A;  3LWM A;  4M3U A;  3BGR A;  3MED A;  5EU7 A;  1T05 A;  3E01 A;  1Z25 A;  3VA0 A;  4OVL A;  1L3V A;  3LZJ A;  3LAL A;  4OLB A;  1KSP A;  1TGO A;  3AVM A;  4IDK A;  4KRF A;  3HP6 A;  5KTQ A;  1EET A;  1ZBU A;  4M3R A;  4EZ6 A;  5T7B A;  3NH0 A;  4FW1 A;  3PV8 A;  4ELU A;  4XIU A;  4DFM A;  1HPZ A;  2VWK A;  4KTZ A;  3I0R A;  3TAQ A;  1SKS A;  3ZSR A;  5C25 A;  3KTQ A;  1J54 A;  3DOK A;  3VQC A;  3MXI A;  4H4M A;  4AIL C;  5C24 A;  4CHO A;  3P1G A;  4DSI A;  3MEG A;  3LP3 A;  4DTM A;  1N5Y A;  1NOZ A;  3AO3 A;  3HVT A;  3VQQ A;  1VSK A;  4B9T A;  3OYI A;  3DLG A;  4B8A B;  1KRP A;  4KB1 A;  2HHS A;  5DK5 A;  3KKS A;  2VWJ A;  1BGX T;  4OLA A;  1D8Y A;  4HVJ A;  4DTX A;  2Z1J A;  3RR8 A;  3MXM A;  3PO4 A;  4PUO A;  3OS2 A;  4W5T A;  3RR7 A;  4DU4 A;  1NKC A;  3HPG A;  3NGI A;  1G15 A;  4FLX A;  1JLF A;  5JS2 A;  3K5L A;  4C8O A;  1KCF A;  2B4J A;  1BI4 B;  3VQE A;  1DTQ A;  2EX3 A;  4IFY A;  3QIO A;  1I3A A;  1HNV A;  2Q3S A;  2YHA A;  4DU3 A;  1RDC A;  4GW6 A;  2D0B A;  3AVJ A;  3KLF A;  5HRO A;  1S1V A;  3MEC A;  1JLG A;  4L8R B;  2Y1I A;  1TKZ A;  2QK9 A;  1QTM A;  3ZT4 A;  4FM0 A;  3RWU A;  1MU2 A;  4NCG A;  3VQ6 A;  4CK3 A;  1VSD A;  1BIS A;  3DM2 A;  3HP9 A;  3K5O A;  4E89 A;  1SL1 A;  1VK0 A;  1IKW A;  3M8Q A;  2HND A;  4AHS A;  1RT3 A;  4CGG A;  3RMD A;  4CES A;  4QAG A;  1N6Q A;  1HRH A;  4I7F A;  3DOL A;  1L3U A;  2B6A A;  3KD1 E;  1XC9 A;  4PWD A;  2YNF A;  1B9D A;  5SWM A;  1W9H A;  4H4O A;  5I3U A;  3AVB A;  4N76 A;  4FCY A;  3HST B;  1QQC A;  3T19 A;  1WN7 A;  3K58 A;  4FJJ A;  3WNF A;  2G8F A;  4B08 A;  4KTQ A;  1JLE A;  4IFV A;  3AO2 A;  4LH4 A;  1U48 A;  3UIQ A;  2LSN A;  3DI6 A;  3L2R A;  3DYA A;  3ZT1 A;  2HVI A;  4N47 A;  4IG3 A;  4M3T A;  4M41 A;  1HQU A;  3JSM A;  3V1O A;  2KZZ A;  4OGC A;  3NGY A;  2X6N A;  3O4Q A;  3OYA A;  4JRP A;  1UA0 A;  1SV5 A;  4FJ9 A;  1RT4 A;  3ZSY A;  3DRP A;  4CGD A;  1HYS A;  4W5Q A;  3NH1 A;  2ZQB A;  2I5J A;  1EX4 A;  4DF8 A;  4CJK A;  1YVU A;  5HRR A;  1U49 A;  3NF7 A;  4N56 A;  3L2W A;  3SV4 A;  4E7I A;  4FM2 A;  2AJQ A;  4F3O A;  1WSJ A;  1WAF A;  1KVC A;  1RNH A;  1T8E A;  4M45 A;  2F8T A;  4CHP A;  3ZT0 A;  3P5J A;  3C6U A;  4FK4 A;  1VRU A;  4KHY A;  1D9D A;  1KLM A;  3OYE A;  3RMC A;  3NF8 A;  5KI6 A;  2KW4 A;  4CEQ A;  5FRM A;  1TKD A;  3LP2 A;  3ASM A;  4KHW A;  1I39 A;  4CE9 A;  4FXD A;  2DFF A;  1JLA A;  3AA5 X;  1ZYQ A;  4CJF A;  1DLO A;  2HNZ A; 
#chains in the Genus database with same CATH topology
 3BY5 A;  2BE2 A;  4A61 A;  5HL7 L;  3A5O C;  2O4G A;  1BA1 A;  4B8C A;  3D7E O;  1TK8 A;  3OW2 M;  2O8F B;  3ATV A;  5E84 A;  3ZET B;  1VSL A;  4FJL A;  4B9S A;  1RBU A;  1YJ9 N;  4FLY A;  1J5O A;  1S72 N;  4A5B A;  5JVH L;  1L5U A;  4XEI A;  2E5L K;  4JS5 A;  4CZH A;  4KHQ A;  4EHU A;  3CD6 N;  1LCU A;  3DLK A;  5LJV A;  2ZJQ L;  1TVR A;  3IAY A;  4MQ3 A;  3V1Q A;  4UQG A;  3PLA A;  1JXE A;  2A1R A;  3E66 A;  2VGN A;  1SQK A;  2YCH A;  1VQL N;  2Z1I A;  1N8R O;  2ZGZ A;  4CJU A;  4H03 B;  3QEV A;  1LV5 A;  2PYJ A;  4M3Z A;  1S6P A;  1ZC6 A;  3EZ5 A;  3PSF A;  3VF4 A;  3U6F A;  1K8A O;  1BUP A;  5CYM A;  3NDK A;  4B1Z A;  3TAE A;  4HTU A;  1WLJ A;  1BI4 A;  4DQI A;  4KTW A;  4EFH A;  1TYQ B;  4BQZ A;  4ZTF A;  1KTQ A;  4CD1 A;  1XMO K;  4C8L A;  3ENH A;  3TAR A;  1U6Z A;  2WUS A;  4YOY A;  4GMJ B;  1QSY A;  4YNQ A;  4FPB A;  1NM1 A;  3DRR A;  4I6M A;  3ZX0 A;  1NK4 A;  4B3O A;  4HCB A;  2UXD K;  3WUH A;  3O1W A;  3Q7B A;  5GAG P;  4JKE A;  4CFD A;  1RTH A;  5E26 A;  5LMU K;  3ZYY X;  3HXM A;  1YVN A;  5CYQ A;  5AQF A;  1BO5 O;  1QQN A;  3CFP A;  3D6R A;  3VF2 A;  1JCF A;  2P5O A;  3EO3 A;  2V52 B;  5DMR A;  1RBS A;  4JKG B;  2O8C B;  1QVF M;  3MDQ A;  3TAB A;  2PBD A;  2ZM6 K;  4FJ7 A;  3CCQ N;  2ZJP L;  3VQ5 A;  1GLL O;  3VGK A;  1YI2 N;  4C8K A;  1WAJ A;  3V9Z A;  4FLU A;  2PZS A;  3LAK A;  5AZI A;  2KFZ A;  3OYB A;  3QB0 A;  4YOW A;  5HLF A;  1CZ9 A;  2HB5 A;  1UA1 A;  2O8F A;  3EY1 A;  4CFB A;  2YJF A;  1EWR A;  3ZET A;  3OS1 A;  4A2A A;  4B1V A;  4FJH A;  1RDD A;  2VG6 A;  4BDP A;  1XI1 A;  3L4I A;  1WSI A;  3KD5 E;  4OGE A;  4BRF A;  2HHW A;  1HNW K;  3PX0 A;  1LOT B;  3O4N A;  4CJ4 A;  3CC7 N;  2RHK A;  3ENO A;  5I9E B;  3CCS N;  1KD1 O;  2G8H A;  4FLZ A;  4CJ7 A;  5LMN K;  4CEC A;  4LFA K;  2JGU A;  4FWN A;  1XUP O;  4FJI A;  1C0T A;  3MN9 A;  3PX6 A;  4FK2 A;  3TSP A;  2YKN A;  4FK0 A;  4QS7 A;  5AJ3 K;  4KPY A;  1MWK A;  4ICL A;  4AHC A;  3SQ2 A;  3SUO A;  2O4I A;  1Y97 A;  3CQY A;  2QEX N;  3LDN A;  1S1X A;  3CJB A;  1GOA A;  3NVK A;  4LY7 A;  3L6Q A;  5KGX A;  2Z1G A;  3QO9 A;  4M3X A;  4JI2 K;  1TYQ A;  4B9U A;  1U47 A;  1YUW A;  3WQU A;  4JKF A;  4M3Y A;  4GNI A;  1KFS A;  2OTL N;  1CLQ A;  1ASW A;  1HKC A;  3HL8 A;  3SPY A;  1QS4 A;  2PYL A;  4BWM A;  3VA3 A;  2NRR A;  2X74 A;  4FJ8 A;  4G1Q A;  3OVN A;  4B9Q A;  1V4S A;  3U4L A;  2FF3 B;  3TSQ A;  4FSV A;  3V6D A;  5C2D A;  1NK6 A;  3VEO A;  2WON A;  3KLH A;  4O5B A;  2HHQ A;  3FZL A;  2QKB A;  1BHL A;  3C7N B;  1SL2 A;  4IBN A;  4JKG A;  4EP4 A;  3P31 A;  2O8C A;  1RT5 A;  4IDH A;  4RCH A;  5LY3 A;  5GAH P;  3QBW A;  5BRH A;  4BC3 A;  4DTJ A;  4J2D A;  4DQQ A;  1K8K A;  3CCL N;  5CR4 A;  2HHU A;  2XO7 A;  1OVQ A;  1S9G A;  2FBY A;  4KKO A;  4OPH A;  3ZX3 A;  4HUE A;  4K25 A;  5D3G A;  1JCE A;  3WXM B;  5FPM A;  3AVA A;  4PQU A;  3B6O A;  1OVY A;  1QZ6 A;  3SUP A;  4O8U A;  4IKF A;  1A5W A;  3LDQ A;  4DLE A;  2IAJ A;  2F7T A;  2RPI A;  3IMX A;  3UKR A;  2QKK A;  1RT6 A;  4NYN A;  3SV3 A;  3VMF B;  3NF9 A;  1Q8I A;  1WSE A;  2HBK A;  3FLC O;  2F8S A;  2QM1 A;  3VEY A;  3L3U A;  1VQ9 N;  1Z26 A;  4AHR A;  4EAH D;  4BGA A;  4I2P A;  3AY9 A;  2OPR A;  3KLE A;  5M1O A;  4KO0 A;  1UOC A;  4CFC A;  3KK2 A;  1LWF A;  3M5R A;  2KTQ A;  3D2F A;  4CBX A;  3G4S N;  4CIF A;  1NGG A;  1Q9X A;  3ITH A;  3K2P A;  4E7J A;  2PFU A;  1ZBH A;  2HNY A;  1WNS A;  3THW B;  4JI1 K;  2AA4 A;  4KHU A;  5AZJ B;  4N5S A;  3U3G A;  2IVN A;  3ENB A;  4JRQ A;  1X9J A;  4M7X A;  3EE9 A;  4KHS A;  1N33 K;  3ALY A;  1NBW A;  2G8I A;  1EWQ A;  2Q2R A;  5HRS A;  4YDU C;  3ULE A;  4Z4E A;  3TAN A;  3P39 A;  4DTN A;  5CZ1 A;  4CJV A;  1JJ2 M;  3OJU A;  1VSJ A;  3AVL A;  4CJT A;  4OX9 K;  4BRM A;  1E4F T;  1BG3 A;  2X6S A;  2OYQ A;  5KPZ A;  3VN5 A;  4DQ8 A;  3OYN A;  1QQM A;  4FJG A;  3AAR A;  4QS8 A;  4DV6 K;  3GG4 A;  2O8B B;  3SYZ A;  1NKE A;  4Z4I A;  1ILY A;  2ZWH A;  5AQT A;  4LH5 A;  1RCH A;  3FR0 A;  1LAV A;  2E4L A;  1JL2 A;  1C1B A;  4NLB A;  1RBR A;  3A5M C;  4JKD A;  5AQX A;  4CJS A;  1TUY A;  5I42 A;  2WOM A;  2X78 A;  2V7Z A;  4M3U A;  2W40 A;  3I33 A;  3E01 A;  3VEN A;  1T05 A;  3VA0 A;  3LZJ A;  3LAL A;  3HP6 A;  1T44 A;  4M3R A;  2W6K A;  3C7N A;  4ELU A;  4FW1 A;  3PV8 A;  4Z94 A;  4Y0W A;  5C25 A;  1ESV A;  2VCP A;  3A8Y A;  2ZJR L;  5C24 A;  3R8E A;  1N5Y A;  3VQQ A;  1VSK A;  4CZJ A;  1BOT O;  4CVN E;  2HHS A;  3WXK A;  4DV0 K;  1NNE A;  4YOR A;  2E88 A;  3SAH A;  4HVJ A;  3RR8 A;  1W7A A;  4AM6 A;  3HPG A;  2VYP A;  2W41 A;  5JS2 A;  3K5L A;  1KCF A;  3K0S A;  3U9Z A;  2EX3 A;  3HRG A;  3QIO A;  2Q3S A;  1RDC A;  1K73 O;  5HRO A;  1JLG A;  1ZXO A;  5KQD A;  1Y64 A;  4NCG A;  5AQH A;  4CK3 A;  4E89 A;  1BIS A;  3K5O A;  2HBM A;  1IKW A;  2HND A;  4AHS A;  3RMD A;  1VQ8 N;  3E9O A;  4M63 C;  4I7F A;  4NO7 A;  1L3U A;  4B3T K;  4G9Z A;  5C12 A;  4GVE A;  5M1F A;  4JHD B;  5TKY A;  3T19 A;  3WNF A;  3FFK B;  3THW A;  3BF3 A;  1JLE A;  4IFV A;  3DI6 A;  3NVM A;  5AZJ A;  4BRN A;  4N47 A;  3ZEU B;  4M3T A;  5M1Q A;  2A41 A;  4OGC A;  1NGB A;  3OYA A;  2X6N A;  2YHX A;  1YAG A;  4BGB A;  4DF8 A;  3NF7 A;  4N56 A;  3SV4 A;  4FM2 A;  4F3O A;  4HTL A;  4FO0 A;  4CHP A;  1HNZ K;  2IVO A;  3ZT0 A;  3C6U A;  4KHY A;  2A5X A;  2KW4 A;  3CPE A;  4H0X B;  3GDQ A;  1YJN N;  5FRM A;  2UXC K;  4FXD A;  4JEP A;  3BDP A;  3F9K A;  2HNZ A;  1RIL A;  3V9U A;  2O8B A;  3MXJ A;  4LD0 A;  3VQ9 A;  2ETJ A;  1KLN A;  4DTR A;  1S1T A;  1KFD A;  3AGK A;  4ID1 A;  4IZ9 A;  3CJ1 A;  2D0O A;  3CM5 A;  3O9Q A;  4IG0 A;  1TV6 A;  4FWP A;  3JAM O;  1T3V A;  4CW7 B;  4DWI A;  2ZE2 A;  2WBN A;  3KKR A;  5KRT A;  3VOV A;  3VER A;  4CJP A;  2ITG A;  3MN5 A;  2QW9 A;  4CZK A;  1VQ4 N;  1CZB A;  2A1S A;  4CEO A;  1RBT A;  2NRV A;  1YTU A;  2F4V K;  2CGL A;  3IUC A;  1T7P A;  3Q7C A;  4C1N K;  2J4R A;  5JLF A;  1U2V B;  3M3Z A;  1TK0 A;  4E7H A;  4IOA L;  3AV9 A;  3AVF A;  1N36 K;  4DTS A;  1IG9 A;  3PUF A;  1UWB A;  4FWQ A;  2P9U B;  1VQ5 N;  2OPS A;  3VTI A;  2GX9 A;  3DLL L;  4OKE A;  2HHH K;  4AM7 A;  3K5M A;  1JL1 A;  1EXQ A;  2W42 A;  3V9W A;  4W5R A;  5FLX O;  1HNX K;  1R59 O;  3AO5 A;  4I9L A;  3HO1 A;  4GKK K;  3OBW A;  1S9E A;  1FK9 A;  3QNO A;  3T69 A;  1TK5 A;  3NGZ A;  3VEZ A;  4NCA A;  1HKB A;  1JXB A;  3V1R A;  3ZX2 A;  3QEX A;  3C94 A;  1P8Z A;  4DKW A;  4B9V A;  1LW0 A;  4E3S A;  2W6L A;  4FWK A;  4WQ5 C;  3QEW A;  1C0G A;  5J1E A;  2YKM A;  3HYF A;  4RW6 A;  1VQM N;  2D5R A;  4JHD A;  2UYT A;  4H5N A;  2QWO A;  1YTA A;  2HVH A;  3NCI A;  4IO9 L;  4FVU A;  1T6D A;  3J7Z O;  4PY5 A;  4BRC A;  3VQ7 A;  3ZEU A;  2WFB A;  4CEF A;  4DMN A;  5BPL A;  3KIO A;  1NGE A;  3BF1 A;  4H0T B;  1XWL A;  1JLB A;  4FZY A;  4BE0 A;  5AQI A;  5ADX A;  3SUN A;  3AA3 A;  4CF2 A;  1JKH A;  3THV A;  5AQP A;  4DV1 K;  1BU6 O;  1RDU A;  1TAQ A;  3U9D A;  3DAW A;  3NBP A;  3PY8 A;  3CJ9 A;  4UY8 O;  3O08 A;  3PO5 A;  3SJH A;  4PA1 A;  1WOQ A;  2A3Z A;  4JK9 A;  5F0X A;  5HBM A;  1IKV A;  3EE8 A;  4JI7 K;  2E2N A;  3M8R A;  1HLU A;  3MN7 A;  5AQQ A;  3KZB A;  1ZBS A;  3ZSW A;  5KRS A;  3MWT A;  5KQ8 A;  3AVH A;  5JVG L;  2O8E B;  1O13 A;  4DLG A;  2EHG A;  1VAZ A;  3V4I A;  4CJ5 A;  5C15 A;  5DM6 L;  3MAQ A;  4RW7 A;  1IH7 A;  1GLD G;  5AFU H;  3OYK A;  5AQU A;  2XY7 A;  2E2P A;  1Q81 O;  3EKU A;  1ASV A;  1X9M A;  3KWG A;  1NK0 A;  4BRL A;  1C0M A;  1GLE G;  1U2V A;  2G8V A;  4FWS A;  4BQL A;  4B1Y B;  1W0H A;  3M1F A;  4CJW A;  1NU0 A;  3A2F A;  3VGM A;  1F21 A;  5AQV A;  3BEX A;  2P9U A;  4IEI A;  2DFE A;  1SAZ A;  4EZ9 A;  1XHZ A;  4FL9 A;  2XY6 A;  5KPT A;  4DSL A;  3IRX A;  3QER A;  3DJC A;  4B1X B;  3VQB A;  1TAU A;  3LDO A;  3AVK A;  3HT3 A;  2P9I B;  2HW3 A;  1FJG K;  4CK2 A;  2JLE A;  1T03 A;  2QA4 N;  3QDK A;  1QSL A;  3DLB A;  1M1K O;  1RTJ A;  4JI4 K;  1VSH A;  3L8B A;  4AH9 A;  1NGC A;  3CHW A;  3HTV A;  2NRT A;  1GLC G;  5M1K A;  3KWI A;  1ATS A;  4O44 A;  1X1P A;  3QIP A;  2QXF A;  3H1Q A;  4FW2 A;  2KZM A;  3LPU A;  4DR1 K;  1XQS C;  3HPO A;  3SQ4 A;  3SQ1 A;  5FRN A;  5BRD A;  4WF9 L;  3NHG A;  1IBK K;  4H0V B;  2ZD1 A;  1HJO A;  2OZS A;  2G8K A;  3H45 C;  3THX B;  2UUA K;  2HMI A;  1C1C A;  4BC4 A;  3QIC A;  1EP4 A;  3LAM A;  1E3M A;  1JCG A;  1NGJ A;  3RRH A;  3AVN A;  4FJK A;  4B3M K;  4FJN A;  3TTF A;  1Q18 A;  3ID8 A;  3CER A;  2BH1 A;  4OPK A;  1VQ6 N;  2OZM A;  2G8U A;  4RG8 A;  1YIT N;  3LPT A;  3NAE A;  3B6P A;  4O0I A;  4WQ4 A;  4CED A;  4CHZ A;  5J2Q A;  2VWB A;  3CG7 A;  4RW8 A;  4R5P A;  2QXL A;  3MX2 A;  3H3N O;  4WE1 A;  2XHB A;  1QZ5 A;  3QET A;  4H0P A;  2YHB A;  2O8E A;  3M8P A;  1C0U A;  1DGK N;  2NZT A;  3HVR A;  2ZGY A;  1SL0 A;  2A6A A;  4BC2 A;  3OHR A;  4ELT A;  3SMP A;  3CC2 N;  4CEZ A;  2Q0U A;  5FPD A;  1C0F A;  4KH4 A;  4H0O A;  4IJA A;  4DU1 A;  2HF3 A;  1XMQ K;  4MLH A;  1NJW A;  3VQ4 A;  1WSH A;  3AVI A;  2NUB A;  3TTD A;  3VQ8 A;  4F2S A;  1IV0 A;  1NGD A;  2NNW A;  2Q0R A;  2P9S B;  1SZ2 A;  4KH5 A;  4C8M A;  3CCM N;  4DR2 K;  4FWL A;  3TAF A;  3WNE A;  4OKJ A;  4LF4 K;  4IFE A;  1VSE A;  3QBX A;  4YHH K;  1BCM A;  4CGH A;  4Z4C A;  3R3L A;  2VQF K;  2HF4 A;  3SI6 A;  5KGW A;  4EHT A;  1A5V A;  5ADX H;  3T3F A;  4CEE A;  1NLV A;  1EQY A;  4BRP A;  4DCH A;  1J5E K;  4AHT A;  3L2V A;  1NOY A;  4CEA A;  4FJ5 A;  2DPN A;  2BAN A;  4YFU A;  1Z05 A;  2VG5 A;  4H8K A;  3LWL A;  3CI5 A;  3TPQ A;  4DSK A;  4HCC A;  4E0D A;  3TAM A;  2KFN A;  3EYZ A;  4CJ3 A;  3OYG A;  4FLW A;  4K0K K;  2ITM A;  4DFP A;  1KXP A;  4OVL A;  3NMU A;  3LM2 A;  3THX A;  3AVM A;  4KRF A;  5KTQ A;  1YHQ N;  3O8M A;  4EZ6 A;  4RWT A;  4LFB K;  4KTZ A;  3TAQ A;  1OH7 A;  3LDL A;  2E8A A;  3CF5 L;  4DSI A;  3MEG A;  4DTM A;  3AO3 A;  3J7Y P;  4B8A B;  2UU9 K;  2UUC K;  3IDH A;  4OLA A;  5M1P A;  4JKH A;  3WEE B;  2P9L B;  3PO4 A;  4MO4 A;  1K9M O;  2GWJ A;  4PHT X;  5A2Q O;  3ATU A;  3VPZ A;  4FLX A;  1JLF A;  4C8O A;  4NB4 A;  2CH5 A;  3PIP L;  1I3A A;  1HNV A;  2YHA A;  1Z6R A;  3AVJ A;  3MMV A;  5JIC A;  3MEC A;  1TKZ A;  1N32 K;  3ZT4 A;  4FM0 A;  5BR9 A;  3VQ6 A;  4WFN L;  3CXC M;  1VSD A;  3DM2 A;  1VK0 A;  2O8D B;  3VEV A;  1N6Q A;  1HRH A;  3FZH A;  1B9D A;  4H4O A;  4N76 A;  5AR0 A;  1W2B M;  1WN7 A;  3VGL A;  2FSN A;  3E9L A;  4LH4 A;  3UIQ A;  3AGR A;  2P9S A;  2HVI A;  3FE1 A;  3IKM A;  3RSE B;  3NGY A;  2CGJ A;  3O4Q A;  4JRP A;  1SV5 A;  1RT4 A;  3DRP A;  3G71 N;  4CGD A;  1HYS A;  3K9J A;  1J6Z A;  1EX4 A;  5DM7 L;  4CJK A;  1YVU A;  1U49 A;  2AJQ A;  4PKI A;  5AQM A;  1WSJ A;  1DKG D;  1RNH A;  1T8E A;  5BRE A;  4DUY K;  3P5J A;  4BG9 A;  3CC4 N;  3SK3 A;  4BRH A;  4FK4 A;  3O1B A;  3TU5 A;  1TKD A;  3LP2 A;  3ASM A;  2DFF A;  2OPP A;  4CJF A;  1DLO A;  3AVC A;  4CD3 A;  3O9S A;  3T1Y K;  3LZI A;  1HKG A;  3AA4 A;  2YJE A;  4FVM A;  3OJS A;  4CIG A;  1RDB A;  1WUA A;  5JS1 A;  1HR0 K;  4FPA A;  4M42 A;  2HMP A;  4F8R A;  2UXB K;  1NK9 A;  4CK1 A;  1KAY A;  2FBT A;  2WTU A;  2PY5 A;  5SZT A;  3QNN A;  4BRE A;  1VSM A;  5GAE P;  3WNH A;  3THY B;  1U4B A;  1T6C A;  3CM6 A;  3L2U A;  1FKP A;  4ZTJ A;  3N4P A;  3MX5 A;  5C42 A;  1IO2 A;  4XH4 A;  4CHY A;  1VHX A;  1HNI A;  2JWL A;  3CYM A;  1J9A A;  2FSJ A;  4BY9 C;  1KVB A;  4JNE A;  1BA0 A;  1NMD A;  5M1N A;  3E9P A;  1B92 A;  5GIO A;  4LF5 K;  1OKJ A;  2XY8 A;  4Z4F A;  2OAN A;  4CJL A;  4OO1 J;  1FKO A;  4IXC A;  3TR8 A;  4CJE A;  3WXL A;  4FZX C;  4DS4 A;  4BR0 A;  3WEE A;  4JK7 A;  2P9L A;  2OCE A;  4H5R A;  4I2Q A;  3TAG A;  1P90 A;  4JI3 K;  3K9K A;  1Q86 O;  4FJM A;  3HZ6 A;  3M6G A;  1WSG A;  2GEL A;  3O9T A;  4E1M A;  1GLA G;  4DR3 K;  4Z4H A;  1BQM A;  1NGF A;  1Q9Y A;  3H6E A;  4DFJ A;  3I0S A;  1OH5 A;  4KFB A;  3V81 A;  2R7Y A;  1D4X A;  1HQE A;  3O3F A;  5C0Y A;  1RT1 A;  2QWQ A;  4IOX A;  3WT0 A;  3DMJ A;  5EX5 A;  4CF8 A;  4KB0 A;  2RN2 A;  4LF8 K;  5C2F A;  3VES A;  4F4K A;  3RTV A;  4B3S K;  4Z0U A;  1RDW X;  4ISG A;  2FBV A;  4X66 K;  1YIJ N;  3GE1 A;  3RSE A;  3OYC A;  1A5X A;  1K6Y A;  3T1H K;  1UAX A;  5AQY A;  3WNG A;  3AA2 A;  1TL1 A;  3V9S A;  2PAV A;  4BVP A;  2A42 A;  4KAZ A;  2IS3 A;  3CFO A;  3K59 A;  4LF9 K;  3AVG A;  5CZ2 A;  4F9O A;  1LWC A;  2BUP A;  3S3M A;  4DB3 A;  1RBV A;  3VQP A;  2B5J A;  1RTI A;  1CXU A;  3KHY A;  3O9U A;  3CQX A;  3HOT A;  5FDL A;  2IDO A;  3O6W A;  3F5T A;  5FPE A;  1NJI O;  4CZF A;  4JI0 K;  3THY A;  1IG8 A;  2QWN A;  4ILJ A;  5KPR A;  4ELV A;  1WSF A;  3MK6 A;  4CHQ A;  4LF7 K;  1WBB A;  2YHY A;  4C8N A;  1Q7Y O;  4GY2 B;  2P9K B;  4MLE A;  4FYD A;  1O1W A;  4FOE A;  3F73 A;  3SMS A;  3L2Q A;  3ZT3 A;  4E1N A;  2E1Y A;  2P9N B;  4BAC A;  4J2B A;  4O0J A;  2ZF5 O;  1C1A A;  1YF5 L;  3GBT A;  2QWP A;  3CCV N;  1IKX A;  2DTU A;  5J2P A;  1S1U A;  4HHT A;  4GVM A;  5K14 A;  3AO4 A;  1RT2 A;  3CIP A;  4CZE A;  4CGF A;  1S22 A;  3WXI A;  2HHV A;  4B9M A;  1HX1 A;  1N34 K;  4BG8 A;  1MWM A;  4DTP A;  4RTF D;  4DHY A;  4YOV A;  4O4G A;  3RMA A;  5GIP A;  5AQR A;  4WFB L;  4BC5 A;  3OA9 A;  4KI6 A;  3N4Q A;  2I7P A;  2IVP A;  1QHT A;  4JKA A;  4DF4 A;  3G0Z A;  5AQG A;  3MCP A;  1QSS A;  5HP1 A;  2HHX A;  3FZM A;  4U7B A;  4CJQ A;  4Z4G A;  3VQA A;  1ASU A;  4J2E A;  4CBU A;  3SZ2 A;  4KBO A;  3QIN A;  3PX4 A;  1HJR A;  1RTD A;  3QLH A;  1NJX A;  3HOS A;  2G8W A;  3RMB A;  5H1S Q;  2RKI A;  4A5A A;  2GBZ A;  3OS0 A;  4MFB A;  4W5O A;  1RGI A;  3PSI A;  1QHA A;  4CZL A;  3L4Q A;  3I8B A;  1WBD A;  4BRG A;  3M8S A;  1E4G T;  2P51 A;  4FLV A;  4PL8 A;  4WYB A;  2KQ2 A;  4DQP A;  1FXX A;  3I56 N;  4CGI A;  3P4I A;  1TKX A;  2IC3 A;  2F96 A;  3D2E B;  2GUI A;  3DXM B;  4PL7 A;  3ZCM A;  2I7N A;  3HBT A;  3FZF A;  3L0Q A;  3LAN A;  4YOU A;  3H3O B;  4J2A A;  3JYT A;  3CCE N;  4HUG A;  4CF0 A;  3MEE A;  4BR5 A;  4FZZ A;  3LP1 A;  3EZW A;  1S5J A;  1DTT A;  1BQN A;  4QOZ B;  4BRO A;  1FW6 A;  4CBW A;  3BZK A;  3SQ0 A;  3I55 N;  1CZA N;  4KRE A;  1LWE A;  3C6T A;  3T1A A;  4OJR A;  5BRF A;  4CHN A;  1ZBF A;  3A0I X;  3MCA B;  3EL2 A;  2EWS A;  4CJR A;  3VEW A;  3D45 A;  3OYD A;  2P9K A;  3CCU N;  2DY4 A;  1IJJ A;  4ILG B;  1DT9 A;  3VEX A;  2P9N A;  4OPJ A;  1IKY A;  3A5N C;  3IFR A;  4ISF A;  2Z1H A;  4DTU A;  4CI6 A;  1RT7 A;  4WCE L;  3FFI A;  3EEQ A;  1NK8 A;  2D0A A;  1MDU B;  3NE6 A;  5MLC Q;  2RE2 A;  4LFC K;  4JKC A;  4BR2 A;  1BIZ A;  2VQE K;  3GOI A;  2OA8 A;  5BR8 K;  1QVG M;  3SAG A;  1NJZ A;  4PKH A;  1NK7 A;  1X9W A;  5HRP A;  4NLC A;  4FWR A;  4HUF A;  1OH6 A;  4BRD A;  4I9Q A;  3C6A A;  3D0P A;  2BGG A;  2D0P A;  3WXJ A;  3ZSQ A;  1U45 A;  2FXU A;  4K8Z A;  1VSI A;  3LWM A;  5EU7 A;  5BN8 A;  4DV4 K;  1KSP A;  4YDU A;  1EET A;  5T7B A;  3NH0 A;  4XIU A;  1HPZ A;  3I0R A;  3KTQ A;  4FWM A;  1YXQ A;  2KKZ A;  1J54 A;  3VQC A;  4H4M A;  4AIL C;  4CHO A;  3FZK A;  3LP3 A;  1NOZ A;  4CZI A;  3OYI A;  1KRP A;  4KB1 A;  5DK5 A;  3KKS A;  2VWJ A;  3QFP A;  2H3G X;  1D8Y A;  4DTX A;  3SLC A;  4PUO A;  5LL6 Z;  3OS2 A;  3KVG A;  4DU4 A;  5IWA K;  3NGI A;  3D2E A;  3DXM A;  4XH5 A;  5B8H A;  2B4J A;  3G6E N;  3VQE A;  3VTH A;  5EVZ A;  4DU3 A;  2D0B A;  3KLF A;  3LDP A;  2QK9 A;  4BRQ A;  3MWP A;  1MU2 A;  2NRH A;  3HP9 A;  2F9T A;  3JS6 A;  5CE3 A;  1XNQ K;  4CGG A;  4CES A;  1RFQ A;  4QAG A;  3OTO K;  2CGK A;  2B6A A;  3KD1 E;  1XC9 A;  4H0Y B;  3AVB A;  5F1X A;  4DR5 K;  2ASP A;  3HST B;  4FCY A;  1QQC A;  3K58 A;  4FJJ A;  1K8K B;  2G8F A;  3OBY A;  2NRW A;  3B8A X;  1KC8 O;  4KTQ A;  3H1V X;  3AO2 A;  1U48 A;  2UUB K;  2LSN A;  3L2R A;  3ZT1 A;  1X3M A;  3QML A;  1HQU A;  2KZZ A;  2GWK A;  4FJ9 A;  5EY4 A;  3ZSY A;  3UB5 A;  4W5Q A;  3JXU A;  2I5J A;  5HRR A;  4YOX A;  3UKR B;  3L2W A;  1KVC A;  2F8T A;  1DEJ A;  4M45 A;  5AQS A;  1GLJ O;  4DR7 K;  1VRU A;  5IT9 O;  5AQK A;  3RMC A;  3AAQ A;  4LF6 K;  2Q1N A;  4CEQ A;  1I39 A;  3NF6 A;  3AA5 X;  2HOE A;  2P9P B;  2KHO A;  2P9I A;  4ISE A;  1B9F A;  3O3G A;  1BIU A;  3QEI A;  1GOB A;  4DV5 K;  2FF6 A;  5F2R A;  2WC9 A;  3D2F B;  4C1N I;  2GV9 A;  3VET A;  2QI2 A;  4GV9 A;  3HM9 A;  3CMA N;  4H5V A;  1EKE A;  3QFU A;  3BP8 A;  1VSF A;  3IG1 A;  1S6Q A;  4GV3 A;  3O5B A;  3R9P A;  3VF6 A;  5AQZ A;  1V4T A;  1C6V A;  1XHX A;  3LDS A;  3ZSX A;  1REV A;  2ASM A;  3OYH A;  4J8F A;  1TUU A;  4B9L A;  4JLH A;  5C10 A;  4M7Y A;  2D4W A;  2NRX A;  1ITG A;  1KVA A;  4K43 A;  1BDG A;  3ULE B;  2IIR A;  4IOC L;  3MN6 A;  5E41 A;  4A2B A;  3KK7 A;  2HBL A;  1VRT A;  4BR9 A;  3HK2 A;  4DS5 A;  3H46 O;  3ID6 A;  4MDB A;  3HJF A;  3R6M A;  2KLA A;  4BRK A;  3HSC A;  3G25 A;  3OY9 A;  4IJN A;  3KK3 A;  1GOC A;  1QQO A;  2QWM A;  4KHN A;  1SUQ A;  1G99 A;  1BL3 A;  5J2N A;  2NRZ A;  3OYL A;  1NG9 A;  3S3N A;  1HYV A;  2ATQ A;  2DFH A;  4BRA A;  3DLR A;  4DSJ A;  2QWL A;  2P5G A;  3SNN A;  3G10 A;  3P83 D;  3C95 A;  4BVO A;  1BWF O;  2HST A;  1W97 L;  2FSK A;  3DXK B;  4PKG A;  4AHU A;  1HMV A;  4CF9 A;  4BDY A;  2V51 B;  4NXN K;  3P38 A;  4JD2 B;  2GUP A;  4FLT A;  4K41 A;  4QCL A;  2HHT A;  4DR4 K;  4YY3 K;  3QEP A;  5CY4 A;  5BN9 A;  4BE2 A;  4KHP K;  4YOT A;  3IS9 A;  4E19 A;  4ID5 A;  3S9H A;  3T7Z A;  3V9X A;  4Y1D A;  4CZM A;  2YNI A;  3S3O A;  4IWV A;  4DQR A;  1HUX A;  2E2O A;  3ZSO A;  3EKS A;  5HOO A;  3O3H A;  4KH6 A;  4JYA K;  4RW4 A;  4F3T A;  3CQ8 A;  3HM8 A;  4B1W B;  4NYF A;  1NGH A;  2P9P A;  4WQ5 A;  2E1Z A;  3CME N;  3ZT2 A;  2Q36 A;  3F9M A;  3UKU B;  1SKR A;  4U67 L;  3J7A P;  3SUQ A;  2D0C A;  4MDA A;  3QES A;  3DWL A;  3NFA A;  4JS4 A;  2YNG A;  4BWJ A;  4E1J A;  3ZLJ A;  3CJC A;  4KV8 A;  3RRG A;  4DSE A;  2IGI A;  2YV0 X;  5FPN A;  4JV5 K;  1NGI A;  2HBJ A;  1QE1 A;  3AAP A;  3RVC A;  1R0A A;  4EP5 A;  3CCR N;  4JK8 A;  4DQS A;  3SCX A;  1IBM K;  3C6H A;  5EOY A;  1ATR A;  2E2Q A;  3C65 A;  4NXM K;  3TI0 A;  3H08 A;  4LSL A;  1KQS M;  4CF1 A;  2XY5 A;  3O9R A;  3OYM A;  3LM9 A;  4RW9 A;  1BCO A;  4N41 A;  4BDZ A;  4CZG A;  2YNH A;  2FC0 A;  3SJJ A;  4ZHR A;  3ZSZ A;  4XH1 A;  5LJW A;  1IBL K;  2Y1J A;  3K5N A;  2E20 A;  4FWO A;  4E7K A;  3AO1 A;  1VQN N;  1VQK N;  1S3X A;  5AQJ A;  5ELZ A;  5AQW A;  2BDP A;  4DV2 K;  5EXW A;  4BR7 A;  5AQO A;  1ZBL A;  4A62 A;  2E6L A;  5JLH A;  5J2M A;  3W3D A;  3SAF A;  1VQP N;  3OYF A;  4R79 A;  5GIN A;  1X3N A;  1GLF O;  3CJ7 A;  3SPZ A;  2E6M A;  3I8D A;  1D5A A;  1CXQ A;  3DXK A;  5FRO A;  3HI0 A;  3K57 A;  3O4W A;  5AQN A;  1S1W A;  3ULD A;  1X9S A;  1VQ7 N;  4DR6 K;  4BR4 A;  4WQ4 C;  4JD2 A;  3TTC A;  5JMV A;  4DV7 K;  4X64 K;  4IEE A;  1NJY A;  2NLX A;  2XRI A;  4O55 A;  2O8D A;  4X62 K;  4JI8 K;  1LW2 A;  4JKB A;  3BUZ B;  4F2R A;  4O8K A;  4DTO A;  4H5W A;  4JI6 K;  4DFK A;  4GV6 A;  4CIE A;  1MA9 B;  1KAX A;  3A5L C;  3BZC A;  2ASO A;  2OPQ A;  2IOC A;  4CFA A;  3VQD A;  1JLQ A;  4FJX A;  2VG7 A;  2V7Y A;  4LC9 B;  1L3S A;  4K8X A;  3ISN C;  3PIO L;  2OTJ N;  4QS9 A;  4CER A;  3TAP A;  3NH2 A;  4JAX A;  4Q0B A;  3EN9 A;  3SBG A;  3F2K A;  4NCB A;  1ZBI A;  1NMN A;  4A59 A;  1KAZ A;  3UKU A;  3L3V A;  1RDA A;  2P1J A;  5HRN A;  3KLG A;  3DLE A;  1NWK A;  4K42 A;  4L3Q A;  3SBT A;  5AFU A;  2BTF A;  3LP0 A;  4BE1 A;  4W5N A;  1EO1 A;  3CFR A;  4V19 S;  3CCJ N;  1NKB A;  4O5F A;  3OYJ A;  1TKT A;  1U04 A;  4CGJ A;  3HPH A;  2QWR A;  1NK5 A;  3TWH A;  4OPA A;  3U8X A;  4E7L A;  4OKK A;  1J53 A;  4LSN A;  2GEM A;  4IO8 A;  3R1X A;  3E1Y A;  3DRS A;  3DLH A;  1SKW A;  3J81 O;  2RF2 A;  2YX6 A;  1L3T A;  1SS6 A;  1YT3 A;  4CEB A;  4Q5V A;  1D9F A;  1XC3 A;  3S41 A;  1WB9 A;  2GTD A;  3KLI A;  3CPW M;  3O80 A;  4ILH A;  3KJV A;  4KI4 A;  5CHI A;  5BPN A;  4AQY K;  4C23 A;  2QTD A;  1TL3 A;  3J80 O;  4M3W A;  4DSF A;  2FBX A;  1ATN A;  2YI1 A;  1HYZ A;  4CCH A;  1GLB G;  1LAW A;  4AHV A;  4DG1 A;  1JLC A;  3LL3 A;  4Y1C A;  4FM1 A;  2A40 A;  4DV3 K;  1XNR K;  3KK1 A;  1VQO N;  4A57 A;  3U3Y A;  4B3R K;  4B9N A;  4TSX A;  3ZSV A;  3CET A;  3BGR A;  3MED A;  2Q97 A;  3WQT A;  1Z25 A;  1L3V A;  4H5T A;  4OLB A;  1TGO A;  4IDK A;  3C0B A;  1ZBU A;  4JI5 K;  4DFM A;  1SKS A;  2VWK A;  3ZSR A;  3DOK A;  3MXI A;  3P1G A;  4B9T A;  3HVT A;  4MO5 A;  3DLG A;  1Q82 O;  1I94 K;  4EIA A;  1BGX T;  3J8A A;  2F9W A;  2Z1J A;  3MXM A;  1YJW N;  2JWK A;  4W5T A;  3RR7 A;  1NKC A;  1G15 A;  2YHW A;  1BI4 B;  4JN4 A;  1DTQ A;  4IFY A;  4GW6 A;  4L8R B;  1S1V A;  4AF1 A;  2Y1I A;  5BPM A;  1QTM A;  3RWU A;  4HWI A;  2FLO A;  4GKJ K;  1SL1 A;  1OH8 A;  3M8Q A;  1RT3 A;  5GAD P;  4I6M B;  4BRI A;  3FGU A;  3DOL A;  4B1U B;  4PWD A;  2YNF A;  5SWM A;  1H1V A;  1W9H A;  5I3U A;  4WFA L;  4B08 A;  2AP1 A;  4DUZ K;  3CJA A;  3TSU A;  3DYA A;  3W0L A;  4IG3 A;  4M41 A;  3JSM A;  3V1O A;  4X65 K;  3GL1 A;  1UA0 A;  3NH1 A;  2ZQB A;  2VGM A;  4E7I A;  1WAF A;  1HPM A;  1M90 O;  5TKW A;  1D9D A;  1KLM A;  3OYE A;  2D1K A;  3NF8 A;  5KI6 A;  1NGA A;  4FOI A;  3UE5 A;  4KHW A;  2CH6 A;  5AQL A;  4CE9 A;  5AZI B;  1JLA A;  1ZYQ A;  2Q31 A; 
#chains in the Genus database with same CATH homology
 2BE2 A;  3AVC A;  1RIL A;  3V9U A;  1B9F A;  2O4G A;  3O3G A;  4B8C A;  3LZI A;  1BIU A;  3MXJ A;  4LD0 A;  3VQ9 A;  1TK8 A;  2ETJ A;  3AA4 A;  1KLN A;  4FVM A;  3OJS A;  4CIG A;  1S1T A;  4DTR A;  3QEI A;  1GOB A;  1RDB A;  1KFD A;  4ID1 A;  5JS1 A;  4M42 A;  2GV9 A;  4F8R A;  3CM5 A;  1VSL A;  3HM9 A;  1NK9 A;  4IG0 A;  4FJL A;  1TV6 A;  1EKE A;  4CK1 A;  4B9S A;  1RBU A;  4DWI A;  1VSF A;  2FBT A;  2ZE2 A;  3KKR A;  5KRT A;  3IG1 A;  2PY5 A;  4FLY A;  5SZT A;  1S6Q A;  3QNN A;  1VSM A;  1J5O A;  4CJP A;  2ITG A;  3WNH A;  1CZB A;  2A1S A;  4CEO A;  1RBT A;  1C6V A;  1XHX A;  1L5U A;  3LDS A;  1YTU A;  1U4B A;  3CM6 A;  4JS5 A;  3L2U A;  3ZSX A;  1REV A;  1FKP A;  3OYH A;  4B9L A;  4JLH A;  4KHQ A;  4ZTJ A;  1T7P A;  5C42 A;  3DLK A;  1IO2 A;  4CHY A;  1TK0 A;  4E7H A;  1ITG A;  1HNI A;  1KVA A;  1TVR A;  3AV9 A;  3AVF A;  1J9A A;  3CYM A;  3IAY A;  4DTS A;  1KVB A;  1IG9 A;  3PUF A;  1B92 A;  4MQ3 A;  1UWB A;  2XY8 A;  4Z4F A;  4CJL A;  3V1Q A;  4UQG A;  1JXE A;  2A1R A;  5E41 A;  1FKO A;  3TR8 A;  2OPS A;  4CJE A;  1VRT A;  3HK2 A;  4DS5 A;  2Z1I A;  4OKE A;  3HJF A;  3K5M A;  4CJU A;  1JL1 A;  4DS4 A;  4FZX C;  1EXQ A;  2W42 A;  3V9W A;  3QEV A;  4W5R A;  1LV5 A;  2PYJ A;  4M3Z A;  4I2Q A;  3TAG A;  3OY9 A;  1S6P A;  1GOC A;  3KK3 A;  3EZ5 A;  4FJM A;  3AO5 A;  4I9L A;  1WSG A;  3U6F A;  3HO1 A;  5CYM A;  3NDK A;  4KHN A;  1SUQ A;  1BL3 A;  5J2N A;  3TAE A;  1S9E A;  1FK9 A;  1BI4 A;  1WLJ A;  4HTU A;  3QNO A;  3OYL A;  4DQI A;  1TK5 A;  4KTW A;  4E1M A;  3NGZ A;  4Z4H A;  3S3N A;  4NCA A;  1HYV A;  2ATQ A;  2DFH A;  4ZTF A;  1BQM A;  3DLR A;  1KTQ A;  4DSJ A;  1JXB A;  2P5G A;  3V1R A;  1Q9Y A;  4C8L A;  4DFJ A;  3I0S A;  3SNN A;  3QEX A;  3G10 A;  3C94 A;  3P83 D;  3TAR A;  4KFB A;  3V81 A;  3C95 A;  1LW0 A;  4GMJ B;  2R7Y A;  4E3S A;  1QSY A;  4YNQ A;  4B9V A;  1HQE A;  3O3F A;  3DRR A;  4AHU A;  1RT1 A;  1HMV A;  4CF9 A;  4BDY A;  1NK4 A;  4B3O A;  3QEW A;  4HCB A;  5J1E A;  2YKM A;  3HYF A;  4FLT A;  4RW6 A;  2D5R A;  3DMJ A;  4CF8 A;  4CFD A;  4QCL A;  4KB0 A;  1RTH A;  2RN2 A;  2HHT A;  3QEP A;  4F4K A;  1YTA A;  3HXM A;  5CYQ A;  3RTV A;  5CY4 A;  2HVH A;  3CFP A;  4BE2 A;  3NCI A;  4Z0U A;  3IS9 A;  4E19 A;  4ID5 A;  3S9H A;  2P5O A;  3V9X A;  2FBV A;  4Y1D A;  5DMR A;  1RBS A;  4PY5 A;  3VQ7 A;  2YNI A;  3S3O A;  3OYC A;  4CEF A;  4DMN A;  3KIO A;  4DQR A;  3TAB A;  1A5X A;  1K6Y A;  1UAX A;  1XWL A;  1JLB A;  4FZY A;  3ZSO A;  4BE0 A;  4FJ7 A;  3WNG A;  3AA2 A;  1TL1 A;  3V9S A;  3SUN A;  3AA3 A;  4CF2 A;  3O3H A;  1JKH A;  3VQ5 A;  3THV A;  4KAZ A;  4RW4 A;  2IS3 A;  4F3T A;  3CFO A;  3K59 A;  4C8K A;  1WAJ A;  3AVG A;  3V9Z A;  3CQ8 A;  4FLU A;  2PZS A;  3LAK A;  5CZ2 A;  1TAQ A;  3NBP A;  3PY8 A;  2KFZ A;  4NYF A;  3OYB A;  1LWC A;  3F9K A;  3S3M A;  5HLF A;  3PO5 A;  4PA1 A;  1CZ9 A;  2HB5 A;  3ZT2 A;  1UA1 A;  1SKR A;  5HBM A;  1IKV A;  1RBV A;  3VQP A;  2B5J A;  3M8R A;  3SUQ A;  3EY1 A;  1RTI A;  2D0C A;  4CFB A;  1CXU A;  3QES A;  3NFA A;  3ZSW A;  5KRS A;  3OS1 A;  2YNG A;  4JS4 A;  4BWJ A;  5FDL A;  3AVH A;  4KV8 A;  3RRG A;  4DLG A;  1RDD A;  2IDO A;  2EHG A;  2VG6 A;  4BDP A;  4DSE A;  2IGI A;  3V4I A;  2YV0 X;  1XI1 A;  4CJ5 A;  1QE1 A;  3MAQ A;  4RW7 A;  1IH7 A;  3OYK A;  1R0A A;  4EP5 A;  4DQS A;  3SCX A;  1WSI A;  3KD5 E;  2XY7 A;  4OGE A;  1ASV A;  1X9M A;  3TI0 A;  4ELV A;  1WSF A;  3H08 A;  4LSL A;  4CHQ A;  4CF1 A;  2XY5 A;  2HHW A;  1NK0 A;  3PX0 A;  1C0M A;  2G8V A;  4C8N A;  3O4N A;  3OYM A;  4RW9 A;  4CJ4 A;  1BCO A;  4N41 A;  4BDZ A;  1W0H A;  4CJW A;  3A2F A;  1F21 A;  4FYD A;  2YNH A;  1O1W A;  3F73 A;  2FC0 A;  2DFE A;  3L2Q A;  3SJJ A;  3ZT3 A;  2G8H A;  4E1N A;  4EZ9 A;  4FLZ A;  4BAC A;  1XHZ A;  4J2B A;  4ZHR A;  4CEC A;  4O0J A;  3ZSZ A;  1C1A A;  2JGU A;  2XY6 A;  4FJI A;  4DSL A;  1C0T A;  2Y1J A;  3PX6 A;  1IKX A;  3K5N A;  4E7K A;  3IRX A;  1S1U A;  3AO1 A;  5J2P A;  3QER A;  4FK2 A;  2YKN A;  4HHT A;  2DTU A;  4GVM A;  4FK0 A;  5K14 A;  3VQB A;  2BDP A;  3AO4 A;  1TAU A;  4KPY A;  3AVK A;  1RT2 A;  4ICL A;  4AHC A;  4CGF A;  3HT3 A;  3SQ2 A;  3SUO A;  1ZBL A;  4B9M A;  1Y97 A;  2E6L A;  2O4I A;  2HW3 A;  4CK2 A;  2HHV A;  1S1X A;  5J2M A;  1GOA A;  2JLE A;  4DTP A;  1T03 A;  4LY7 A;  1QSL A;  3DLB A;  5KGX A;  2Z1G A;  3OYF A;  3QO9 A;  4M3X A;  1RTJ A;  4B9U A;  1VSH A;  4O4G A;  3L8B A;  3RMA A;  1U47 A;  4AH9 A;  4M3Y A;  1KFS A;  3SPZ A;  2E6M A;  3I8D A;  1ASW A;  1CLQ A;  3HL8 A;  3SPY A;  1QS4 A;  3NF6 A;  1D5A A;  1CXQ A;  2PYL A;  4O44 A;  1X1P A;  4BWM A;  4KI6 A;  3VA3 A;  3QIP A;  1QHT A;  2QXF A;  5FRO A;  4FW2 A;  3K57 A;  4DF4 A;  2KZM A;  2X74 A;  3LPU A;  4FJ8 A;  3G0Z A;  1S1W A;  3OVN A;  4G1Q A;  3ULD A;  1X9S A;  3HPO A;  1QSS A;  3SQ4 A;  5HP1 A;  3SQ1 A;  2HHX A;  4CJQ A;  4Z4G A;  1NJY A;  5FRN A;  3VQA A;  3NHG A;  4FJH A;  1ASU A;  2XRI A;  3V6D A;  4O55 A;  2ZD1 A;  2OZS A;  1NK6 A;  4J2E A;  2G8K A;  1LW2 A;  2WON A;  3SZ2 A;  3KLH A;  4O5B A;  3QIN A;  2HMI A;  1C1C A;  3PX4 A;  1HJR A;  1RTD A;  3QLH A;  2HHQ A;  2QKB A;  4F2R A;  1BHL A;  4DTO A;  1SL2 A;  4IBN A;  1NJX A;  4EP4 A;  4DFK A;  2G8W A;  4CIE A;  3RMB A;  1RT5 A;  1EP4 A;  2RKI A;  3LAM A;  4DTJ A;  3BDP A;  4J2D A;  4DQQ A;  2GBZ A;  3OS0 A;  4MFB A;  4W5O A;  3RRH A;  3AVN A;  2HHU A;  4FJK A;  4FJN A;  2OPQ A;  2IOC A;  4CFA A;  2XO7 A;  2FBY A;  1S9G A;  1JLQ A;  4KKO A;  3VQD A;  4OPK A;  2OZM A;  2G8U A;  4RG8 A;  4HUE A;  5D3G A;  4FJX A;  2VG7 A;  3M8S A;  3AVA A;  4PQU A;  3LPT A;  1L3S A;  3B6O A;  2P51 A;  4K8X A;  3ISN C;  4FLV A;  3NAE A;  3SUP A;  2KQ2 A;  4IKF A;  1A5W A;  4DQP A;  1FXX A;  4CER A;  4DLE A;  2IAJ A;  3B6P A;  4CGI A;  3TAP A;  2RPI A;  3NH2 A;  2QKK A;  1TKX A;  1RT6 A;  2IC3 A;  2F96 A;  2GUI A;  4NYN A;  4O0I A;  4Q0B A;  4NCB A;  1ZBI A;  3SV3 A;  3ZCM A;  1RDA A;  3NF9 A;  1Q8I A;  1WSE A;  2P1J A;  3L3V A;  4CED A;  4CHZ A;  5HRN A;  3KLG A;  3DLE A;  5J2Q A;  3LAN A;  2F8S A;  4J2A A;  3CG7 A;  3L3U A;  3JYT A;  4RW8 A;  1Z26 A;  3LP0 A;  4AHR A;  4R5P A;  4HUG A;  4BE1 A;  4W5N A;  3CFR A;  4I2P A;  4WE1 A;  4CF0 A;  3MEE A;  2XHB A;  2OPR A;  1NKB A;  4FZZ A;  3LP1 A;  3KLE A;  3QET A;  3OYJ A;  1S5J A;  1TKT A;  1U04 A;  2YHB A;  4KO0 A;  1DTT A;  3M8P A;  3HPH A;  4CGJ A;  1C0U A;  1UOC A;  3HVR A;  4CFC A;  1BQN A;  1NK5 A;  1SL0 A;  3KK2 A;  4QOZ B;  3TWH A;  1LWF A;  3SQ0 A;  4ELT A;  4E7L A;  4OKK A;  4KRE A;  1J53 A;  1LWE A;  2KTQ A;  3C6T A;  3T1A A;  4OJR A;  4CHN A;  4CIF A;  4LSN A;  1ZBF A;  3DRS A;  3DLH A;  1SKW A;  1Q9X A;  4CEZ A;  2RF2 A;  3ITH A;  3K2P A;  1L3T A;  4DU1 A;  4E7J A;  4CJR A;  3D45 A;  1YT3 A;  4CEB A;  1NJW A;  3VQ4 A;  1ZBH A;  3OYD A;  2HNY A;  1WSH A;  1WNS A;  3AVI A;  4Q5V A;  2NUB A;  3VQ8 A;  4F2S A;  2DY4 A;  1D9F A;  4KHU A;  4N5S A;  3U3G A;  4C8M A;  4OPJ A;  4JRQ A;  1IKY A;  3TAF A;  3KLI A;  3WNE A;  4KHS A;  2OPP A;  3ALY A;  4OKJ A;  2Z1H A;  4DTU A;  3KJV A;  2G8I A;  1RT7 A;  1VSE A;  5HRS A;  4KI4 A;  1BCM A;  4CGH A;  3FFI A;  4Z4E A;  4Z4C A;  3TAN A;  1NK8 A;  4DTN A;  2D0A A;  5CZ1 A;  3NE6 A;  4CJV A;  3SI6 A;  1TL3 A;  5KGW A;  1A5V A;  3OJU A;  3T3F A;  4M3W A;  4CEE A;  4DSF A;  2FBX A;  1VSJ A;  3AVL A;  4CJT A;  1BIZ A;  1HYZ A;  4CCH A;  2OA8 A;  1LAW A;  2X6S A;  4AHV A;  4AHT A;  3L2V A;  1NOY A;  4DG1 A;  2OYQ A;  3VN5 A;  4CEA A;  1NJZ A;  4FJ5 A;  1JLC A;  3OYN A;  1NK7 A;  5HRP A;  1X9W A;  4Y1C A;  4FJG A;  4FM1 A;  2BAN A;  4YFU A;  4HUF A;  3SYZ A;  2VG5 A;  3KK1 A;  4H8K A;  1NKE A;  3U3Y A;  3LWL A;  4Z4I A;  4I9Q A;  4LH5 A;  3D0P A;  4B9N A;  4TSX A;  4DSK A;  1RCH A;  3ZSV A;  4HCC A;  1LAV A;  2BGG A;  2E4L A;  4E0D A;  1JL2 A;  1C1B A;  1RBR A;  3TAM A;  4CJS A;  2KFN A;  3EYZ A;  3ZSQ A;  4CJ3 A;  5I42 A;  1U45 A;  3OYG A;  4FLW A;  4DFP A;  2WOM A;  2X78 A;  4K8Z A;  1VSI A;  3LWM A;  4M3U A;  3BGR A;  3MED A;  5EU7 A;  1T05 A;  3E01 A;  1Z25 A;  3VA0 A;  4OVL A;  1L3V A;  3LZJ A;  3LAL A;  4OLB A;  1KSP A;  1TGO A;  3AVM A;  4IDK A;  4KRF A;  3HP6 A;  5KTQ A;  1EET A;  1ZBU A;  4M3R A;  4EZ6 A;  5T7B A;  3NH0 A;  4FW1 A;  3PV8 A;  4ELU A;  4XIU A;  4DFM A;  1HPZ A;  2VWK A;  4KTZ A;  3I0R A;  3TAQ A;  1SKS A;  3ZSR A;  5C25 A;  3KTQ A;  1J54 A;  3DOK A;  3VQC A;  3MXI A;  4H4M A;  4AIL C;  5C24 A;  4CHO A;  3P1G A;  4DSI A;  3MEG A;  3LP3 A;  4DTM A;  1N5Y A;  1NOZ A;  3AO3 A;  3HVT A;  3VQQ A;  1VSK A;  4B9T A;  3OYI A;  3DLG A;  4B8A B;  1KRP A;  4KB1 A;  2HHS A;  5DK5 A;  3KKS A;  2VWJ A;  1BGX T;  4OLA A;  1D8Y A;  4HVJ A;  4DTX A;  2Z1J A;  3RR8 A;  3MXM A;  3PO4 A;  4PUO A;  3OS2 A;  4W5T A;  3RR7 A;  4DU4 A;  1NKC A;  3HPG A;  3NGI A;  1G15 A;  4FLX A;  1JLF A;  5JS2 A;  3K5L A;  4C8O A;  1KCF A;  2B4J A;  1BI4 B;  3VQE A;  1DTQ A;  2EX3 A;  4IFY A;  3QIO A;  1I3A A;  1HNV A;  2Q3S A;  2YHA A;  4DU3 A;  1RDC A;  4GW6 A;  2D0B A;  3AVJ A;  3KLF A;  5HRO A;  1S1V A;  3MEC A;  1JLG A;  4L8R B;  2Y1I A;  1TKZ A;  2QK9 A;  1QTM A;  3ZT4 A;  4FM0 A;  3RWU A;  1MU2 A;  4NCG A;  3VQ6 A;  4CK3 A;  1VSD A;  1BIS A;  3DM2 A;  3HP9 A;  3K5O A;  4E89 A;  1SL1 A;  1VK0 A;  1IKW A;  3M8Q A;  2HND A;  4AHS A;  1RT3 A;  4CGG A;  3RMD A;  4CES A;  4QAG A;  1N6Q A;  1HRH A;  4I7F A;  3DOL A;  1L3U A;  2B6A A;  3KD1 E;  1XC9 A;  4PWD A;  2YNF A;  1B9D A;  5SWM A;  1W9H A;  4H4O A;  5I3U A;  3AVB A;  4N76 A;  4FCY A;  3HST B;  1QQC A;  3T19 A;  1WN7 A;  3K58 A;  4FJJ A;  3WNF A;  2G8F A;  4B08 A;  4KTQ A;  1JLE A;  4IFV A;  3AO2 A;  4LH4 A;  1U48 A;  3UIQ A;  2LSN A;  3DI6 A;  3L2R A;  3DYA A;  3ZT1 A;  2HVI A;  4N47 A;  4IG3 A;  4M3T A;  4M41 A;  1HQU A;  3JSM A;  3V1O A;  2KZZ A;  4OGC A;  3NGY A;  2X6N A;  3O4Q A;  3OYA A;  4JRP A;  1UA0 A;  1SV5 A;  4FJ9 A;  1RT4 A;  3ZSY A;  3DRP A;  4CGD A;  1HYS A;  4W5Q A;  3NH1 A;  2ZQB A;  2I5J A;  1EX4 A;  4DF8 A;  4CJK A;  1YVU A;  5HRR A;  1U49 A;  3NF7 A;  4N56 A;  3L2W A;  3SV4 A;  4E7I A;  4FM2 A;  2AJQ A;  4F3O A;  1WSJ A;  1WAF A;  1KVC A;  1RNH A;  1T8E A;  4M45 A;  2F8T A;  4CHP A;  3ZT0 A;  3P5J A;  3C6U A;  4FK4 A;  1VRU A;  4KHY A;  1D9D A;  1KLM A;  3OYE A;  3RMC A;  3NF8 A;  5KI6 A;  2KW4 A;  4CEQ A;  5FRM A;  1TKD A;  3LP2 A;  3ASM A;  4KHW A;  1I39 A;  4CE9 A;  4FXD A;  2DFF A;  1JLA A;  3AA5 X;  1ZYQ A;  4CJF A;  1DLO A;  2HNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...