3U3YA

Mouse trex1 d200h mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
215
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
molecule keywords Three prime repair exonuclease 1
total genus 68
structure length 215
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u3yA01
3AVBA 3AVKA 3C94A 3VN5A 3MXIA 4Z4GA 2BE2A 1R0AA 3NFAA 4BACA 4DF4A 4OLAA 1LWEA 3S3OA 4C8LA 4DF8A 4IG3A 1GOCA 3S3NA 4TSXA 1TKDA 1JLEA 1KRPA 2O4IA 2EX3A 1SL2A 4KHUA 1WSIA 1EX4A 4FLYA 3V9XA 3U3GA 4CGGA 3SZ2A 3QEIA 3HT3A 2XY8A 3ZSWA 1UA0A 2KZMA 3O3FA 4FK4A 3MXJA 3NDKA 3KKRA 1ZBHA 1WN7A 1Z26A 3TAEA 4IKFA 1X1PA 3V6DA 4CIGA 4BDYA 3PX0A 3TAPA 1TK5A 4L8RB 2Q3SA 3VQDA 3VQCA 4E7IA 1FKPA 1BQNA 3MXMA 1NOZA 1TAQA 1HNIA 4B9UA 5SZTA 1IKWA 1LAVA 5J1EA 1NK8A 4KHQA 1RT7A 2B5JA 3HO1A 3JYTA 3PUFA 2HHTA 3LP0A 3V9WA 4FJJA 4AILC 1LV5A 3QINA 4DQPA 3OJSA 4CJKA 1KFDA 4FZXC 3MECA 3L2UA 3RRHA 1T05A 1ASVA 1TAUA 3OYDA 2HNDA 3OS2A 5C24A 4FK0A 3AVLA 1W0HA 2JGUA 4DQIA 1BCMA 4FJ7A 1VSLA 3LP1A 4HTUA 3L2WA 3DRSA 2XRIA 1IO2A 2GBZA 1ZBLA 2ETJA 2HNYA 4CJVA 1VSKA 4JLHA 2O4GA 4KO0A 1NOYA 4FJHA 3PV8A 2HHXA 3WNGA 5JS1A 4KTQA 5HRRA 2OPQA 3SJJA 2G8VA 3ISNC 5JS2A 3ULDA 4M3TA 4YNQA 4DU3A 1JLAA 4DFKA 3IG1A 3V9ZA 4DSFA 5KRSA 2E4LA 2PYJA 1RDDA 3KTQA 2E6MA 2D0BA 4CJWA 4CJTA 1J5OA 1NK9A 3UIQA 2X74A 3VQ8A 4LH5A 1JLBA 4DLEA 3VQAA 1VK0A 3DRRA 4Q0BA 1L5UA 5DK5A 1VSHA 5HRNA 4AHUA 1EKEA 4MQ3A 3L2VA 4DTJA 4CHPA 3OYIA 4O0JA 4YFUA 4W5RA 4LH4A 4Z4FA 4HUGA 4FJMA 1LWFA 1FXXA 4AHSA 5KRTA 3SV4A 3LANA 4CJ5A 2YKNA 2B4JA 3SQ2A 4CEDA 2A1RA 3NGIA 3THVA 4N76A 3A2FA 3LAMA 1U04A 3DOKA 2WONA 4FVMA 4OPKA 3ZT0A 4E7HA 3TAGA 1KCFA 2LSNA 3O3GA 3V9SA 4KKOA 4C8OA 3RMDA 1LAWA 1IG9A 3AA5X 4RW4A 1RBUA 4O55A 4DQQA 3DOLA 3HP9A 4M3YA 4ELTA 2GV9A 1A5XA 1KVAA 2ZQBA 3NCIA 1WLJA 4DQSA 2KTQA 3L8BA 4B9VA 4BWMA 3AV9A 4ID1A 4F3TA 4C8MA 4CEFA 2VWKA 1JXEA 4CHNA 4LY7A 3M8QA 4FLTA 4PUOA 4HHTA 1SL1A 3OYLA 3TWHA 1NJWA 4F2RA 4LSLA 1CXQA 1U4BA 2YV0X 3F73A 4CHZA 2VWJA 3P1GA 3LZJA 3P83D 4NYFA 3C95A 3AA2A 4O4GA 4DSEA 4FJIA 4PY5A 2YNIA 3OYFA 3IS9A 2QKBA 2HW3A 1UAXA 1BIUA 1KVBA 3G10A 4DMNA 4N47A 4CF9A 4Y1CA 1VSDA 3WNFA 4CGIA 1VSJA 3ZSXA 1N5YA 4BWJA 1RNHA 4CERA 3L2RA 4UQGA 3RMBA 1K6YA 1HPZA 1WSFA 1RTIA 4FJ5A 3V1RA 1C0UA 1TGOA 3T1AA 3OYEA 2OZSA 1QE1A 4E3SA 2R7YA 4CF0A 3QNOA 4B9MA 4E7KA 3ZT2A 3TR8A 3MAQA 1VSFA 4J2BA 4CEZA 4KHYA 4KREA 4AHRA 3SUPA 4K8XA 2HVHA 2G8FA 1FK9A 1HQEA 3VQPA 5CYMA 3I0SA 3OS1A 4CK2A 5I3UA 1WAFA 4EP4A 1Y97A 3KLIA 2P5OA 1LW0A 2HHUA 4C8KA 4I9QA 2YNGA 1NK0A 3DLKA 1DLOA 1ASWA 3QETA 1L3TA 1MU2A 2ITGA 3HYFA 1ZYQA 3RR8A 2DFFA 1S1WA 4RW6A 4B3OA 1BI4A 3P5JA 4JS4A 3EZ5A 1NJZA 4EZ9A 5FDLA 1UWBA 4DTUA 4DQRA 3ZCMA 1RT3A 3D0PA 5C42A 1ZBIA 5HP1A 4DFJA 3WNHA 1UA1A 4FJKA 1QSLA 3V4IA 1QQCA 1RTDA 2NUBA 4ZTFA 4Z4CA 3SNNA 3OJUA 4LD0A 4F4KA 5EU7A 4MFBA 2DFHA 3ASMA 5KGWA 3HP6A 1QHTA 3HK2A 1DTTA 3WNEA 1ZBUA 4DLGA 3M8RA 4M3XA 1WNSA 3LZIA 1X9WA 3VQQA 1U48A 1IKVA 3DLEA 3V9UA 4E7JA 3S9HA 3KK3A 3NGZA 3ALYA 4CHQA 4J2DA 4NCAA 1L3UA 3RRGA 1IKXA 1NJYA 3OS0A 3CQ8A 3KLGA 2YNFA 2DY4A 1YTUA 5J2QA 1RDBA 2DFEA 1T8EA 4R5PA 4CEEA 2ZE2A 3AVGA 1RT6A 4C8NA 4CEAA 4N56A 1S9GA 1BCOA 3KD1E 4KPYA 1RBTA 1I39A 4QOZB 4DSIA 3VQ7A 3AVAA 3MEDA 1Q9YA 4HUFA 1GOBA 1S1VA 4B8CA 1RILA 4CK1A 1YVUA 4CF8A 4FW2A 5C25A 3AVIA 1QSSA 4B9NA 4CF2A 4F8RA 2FBVA 5J2NA 3NAEA 1BQMA 2XY5A 2PY5A 3L3VA 3HVRA 3DM2A 2PYLA 4FJXA 1J9AA 3DYAA 1SL0A 4QCLA 1XC9A 1T03A 3NH1A 2B6AA 4M41A 2JLEA 1C1BA 1UOCA 3DLRA 1JLFA 3DLGA 3DRPA 4IBNA 4IDKA 4CK3A 5KGXA 3RR7A 4DSLA 4M3UA 2IS3A 4CJEA 1EETA 4KTWA 4AH9A 5FRMA 4B8AB 3OYGA 1U47A 4I7FA 3SI6A 3F9KA 4FJLA 2KFZA 1HYVA 4IG0A 3G0ZA 4PA1A 4FM0A 2YKMA 4PQUA 4M42A 2XO7A 1TKZA 2HHSA 1ZBFA 4OLBA 4DTRA 2X6NA 4FCYA 1HJRA 3SCXA 3SQ0A 3ITHA 3TI0A 3OYNA 1J53A 3VQBA 4FZYA 2KW4A 1S6QA 4DTMA 4OVLA 1KSPA 2D0CA 2G8UA 3RTVA 2G8HA 3B6OA 3ZSRA 4CFDA 2YHBA 4K8ZA 1S5JA 4JRPA 4B9LA 2Y1JA 4CJLA 4I2QA 1S1UA 3QNNA 2Y1IA 2G8KA 1RDAA 1G15A 3AA3A 2A1SA 1CZBA 2Z1HA 3O3HA 3EY1A 4CJUA 1RT1A 4FM1A 3K2PA 3NF8A 2RKIA 3KD5E 3QERA 3MEGA 4CJSA 4DFPA 4BE2A 3TAQA 1BI4B 5CYQA 1NK5A 3ZSQA 2W42A 1WSJA 5HROA 3AVFA 4M3ZA 3L2QA 4ZTJA 1KVCA 1RTJA 1NK7A 4WE1A 3RWUA 1W9HA 2P5GA 4Z4IA 4PWDA 2KQ2A 3VQ6A 4J2AA 4KHNA 1QSYA 2IOCA 1NJXA 3O4QA 4QAGA 3TABA 3ZSOA 2GUIA 4DWIA 5HRSA 3I8DA 1B9DA 1TV6A 2HNZA 3MEEA 1YT3A 4F2SA 4KI6A 2YNHA 3HXMA 3AA4A 4OGCA 3SUNA 3HSTB 5T7BA 4DTOA 4W5OA 3B6PA 4ELVA 1F21A 3CM6A 4NCGA 4HCCA 4DTSA 3C6UA 4DFMA 2D5RA 3KLHA 4CECA 1WSGA 1DTQA 1Q8IA 3ZSZA 4NCBA 1SUQA 1TKTA 3L3UA 1XI1A 1SKRA 4IFYA 2FBXA 3CM5A 4BE0A 4FLWA 1VSIA 3V81A 2OZMA 1VSMA 3KLEA 2G8IA 4CCHA 3LWLA 4FLVA 4HCBA 2FC0A 4CE9A 3CFRA 4RG8A 5CZ1A 3SPYA 3QIPA 2Z1JA 4BDZA 2OPSA 3OYMA 3NH2A 3VQ4A 4H8KA 1S9EA 4B9SA 4FJNA 2YHAA 1TK8A 4Z4EA 2IAJA 3AVMA 3ZSVA 1JLQA 3I0RA 1YTAA 1VRTA 4DS4A 3SUQA 2WOMA 4HVJA 2RN2A 3QEPA 1NK4A 1L3SA 4DTXA 1N6QA 4W5NA 5HLFA 2BGGA 4IFVA 4NYNA 3HVTA 3QEVA 3TARA 1JXBA 2G8WA 3LP3A 2QK9A 3U3YA 4DS5A 2BDPA 4JRQA 2ATQA 3T3FA 1HYZA 3M8PA 3TAMA 4Z4HA 2QKKA 4RW8A 2EHGA 2F96A 3VA0A 1JL2A 4CGHA 3BGRA 1U45A 1D9DA 3AO5A 1IH7A 4FZZA 3LP2A 2P51A 1A5WA 4CGDA 3V1OA 2PZSA 4CEOA 1VRUA 3QESA 4GMJB 1NKCA 2OPRA 4CFBA 3CYMA 5DMRA 3NF9A 3TAFA 1TKXA 1CZ9A 1WSHA 3OYHA 2XY6A 3AVHA 4KTZA 5KTQA 1EP4A 4GW6A 3QEXA 1RT2A 5HRPA 4CJQA 3NGYA 3AVCA 4AHTA 5CY4A 4CIEA 4E7LA 2FBYA 1RTHA 3K57A 4FXDA 2IC3A 3AVJA 2OPPA 4CGFA 4KAZA 3HPGA 5FRNA 1CLQA 2XHBA 3VA3A 1IKYA 3QLHA 3OYKA 4FLUA 4DU4A 4CFAA 4B08A 4AHVA 3CFOA 2OYQA 3DI6A 4KB0A 1BGXT 2KFNA 3PY8A 3HJFA 4FJ8A 4DSJA 1ASUA 2D0AA 3OY9A 1T7PA 1C1CA 4M3WA 4FYDA 2HMIA 4W5TA 4E0DA 3SPZA 1NKEA 1D9FA 1O1WA 1RBSA 4FK2A 1Z25A 4OKEA 5J2MA 4CJFA 1KTQA 3D45A 3EYZA 1B92A 1VSEA 3K5OA 1J54A 5FROA 3NH0A 3HPOA 3OVNA 4HUEA 4KB1A 3O4NA 3KJVA 1U49A 5SWMA 1B9FA 4CHYA 4BDPA 1JLCA 3LAKA 4J2EA 2RPIA 5HBMA 3VQ5A 3ZT3A 3QEWA 3ZT4A 3VQ9A 3NE6A 2XY7A 3HL8A 3NBPA 1HRHA 4I9LA 3NHGA 1HYSA 2QXFA 2VG7A 4N41A 3AO4A 1GOAA 3SQ4A 4LSNA 3KLFA 3KK2A 4I2PA 4FLZA 1RBRA 5CZ2A 4OGEA 2F8TA 4OKKA 3H08A 3CFPA 1KLNA 4CEQA 3PO4A 4CIFA 4RW9A 3K58A 1S1XA 3NF6A 4ICLA 4Z0UA 4O0IA 3LDSA 3DLHA 4DU1A 3V1QA 2I5JA 3PO5A 3M8SA 4OJRA 4EZ6A 4F3OA 3BDPA 3DLBA 4E89A 1XHZA 1D8YA 4CJ3A 3KK1A 1BHLA 2BANA 2E6LA 1QS4A 3OYCA 4CEBA 4FM2A 1HMVA 3QIOA 4O44A 3K5NA 1X9MA 1XWLA 1D5AA 3VQEA 4G1QA 3LWMA 3LPTA 4FW1A 2HHQA 2HB5A 1FKOA 2DTUA 1JL1A 2RF2A 3ZT1A 4CJ4A 4OPJA 3OYBA 1TL1A 3SQ1A 1HNVA 2HHWA 1JLGA 1BL3A 2X78A 3LALA 4E19A 1ITGA 1NKBA 1RDCA 3RMCA 1S6PA 4CF1A 1EXQA 1C1AA 4CHOA 1CXUA 1SKSA 4B9TA 1L3VA 2HVIA 1NK6A 4ZHRA 4KHWA 3KIOA 3RMAA 4KI4A 4O5BA 5J2PA 4JS5A 3QO9A 4W5QA 5I42A 3TANA 1KFSA 1XHXA 4ELUA 5D3GA 2F8SA 4DTNA 3S3MA 4RW7A 1LWCA 1REVA 1I3AA 3SUOA 3K5LA 4BE1A 2HHVA 3PX6A 2FBTA 2IGIA 1A5VA 1C6VA 1WAJA 3DMJA 3AO1A 1RT5A 4DTPA 2KZZA 1TL3A 1RT4A 4E1MA 1BIZA 2VG5A 4CJRA 3AO2A 4M45A 3SYZA 2Z1GA 4FLXA 1C0MA 1SKWA 1KLMA 1LW2A 4CFCA 4E1NA 4ID5A 5KI6A 3ZSYA 3T19A 3LPUA 5E41A 4KV8A 2ZD1A 3C6TA 4H4MA 1S1TA 4EP5A 1RCHA 3HM9A 3SV3A 2X6SA 3KKSA 3JSMA 1HQUA 3CG7A 4FJ9A 1JKHA 2Z1IA 2AJQA 2VG6A 4CGJA 1QTMA 3U6FA 3E01A 1TVRA 4Q5VA 4DSKA 3NF7A 1C0TA 5K14A 3AVNA 3IRXA 2OA8A 4H4OA 3PX4A 2P1JA 4M3RA 3IAYA 4KRFA 3OYJA 4XIUA 3K59A 4CESA 3OYAA 1X9SA 4CJPA 1BISA 1SV5A 4KHSA 3FFIA 3HPHA 4FJGA 3AO3A 4DG1A 4OKJA 4Y1DA 4KFBA 2IDOA 1Q9XA 1WSEA 4N5SA 4GVMA 3K5MA 1RBVA 4AHCA 1TK0A
chains in the Genus database with same CATH superfamily
3AVBA 4O5FA 5AQQA 3O9QA 3CCUN 3NFAA 2O8FA 3S3OA 1GOCA 3TU5A 4TSXA 1TKDA 3MN6A 1P8ZA 1C0GA 4KHUA 3KK7A 2F9TA 2I7NA 5ADXA 3SZ2A 4JHDA 2P9PA 3ZSWA 2KZMA 3O3FA 4FK4A 3MXJA 4A59A 3KKRA 1HNWK 3TAEA 4IKFA 3V6DA 2Q3SA 3VQDA 1FKPA 1X3MA 4B9UA 1HNIA 4GNIA 5SZTA 1RT7A 1K8KB 1VQ4N 3HO1A 3CJAA 3LP0A 4AILC 1LV5A 3QINA 3L2UA 3RRHA 1TAUA 1W0HA 2CGKA 4FWKA 2FSKA 1IO2A 2ETJA 1NOYA 4JD2B 2HHXA 3L4QA 2ZWHA 5HRRA 2G8VA 5JS2A 4YNQA 2Q36A 1JLAA 1YJWN 4JKEA 3V9ZA 4C23A 2E4LA 3ZLJA 3Q7CA 1NK9A 4B9QA 4LH5A 3WT0A 4CZMA 4Q0BA 1EKEA 4MQ3A 2D0OA 4W5RA 4Z4FA 4HUGA 1LWFA 1FXXA 3AARA 1OH8A 1WBBA 4DR6K 4CJ5A 5ELZA 2WONA 3ZT0A 3LM9A 1DGKN 3O3GA 4C8OA 4KKOA 1LAWA 1IG9A 4GV9A 3K9KA 3DOLA 4M3YA 5BREA 4JK9A 2ZQBA 5HOOA 4BRDA 2YHXA 1WLJA 2HF3A 2NRWA 3RSEA 4A2AA 2YJEA 3M8QA 4FLTA 4F2RA 2W41A 4FWSA 4LSLA 1U4BA 3HM8A 2ASPA 3SAGA 4FJIA 1CZAN 2YNIA 2QKBA 4N47A 1VSDA 1N5YA 1RNHA 4FWPA 3L2RA 4UQGA 1HPZA 1WSFA 1KAYA 3SMSA 3CERA 1TGOA 4E3SA 4CF0A 4E7KA 4CEZA 4KHYA 3M6GA 2HVHA 4JKCA 1HQEA 4RCHA 1WAFA 2P9LB 3WXMB 3KLIA 1OVYA 3U8XA 1NK0A 5AQSA 1Y64A 4DV7K 1ZYQA 4RW6A 4B3OA 4B1XB 1NJZA 5C2FA 5F0XA 3S41A 4CZJA 5HP1A 4LF5K 1IBKK 3LM2A 4G9ZA 1RTDA 4BGBA 4E1JA 1VQ9N 4MFBA 3H6EA 4JKGA 1DTTA 1ZBUA 3QICA 4DLGA 3M8RA 2RHKA 1GLBG 1U48A 3S9HA 3NGZA 3C6HA 3CPWM 1NJYA 3CQ8A 3KLGA 4BRMA 3CCMN 1YTUA 2DFEA 4R5PA 3KD1E 2ZE2A 3AVGA 4CEAA 1RBTA 1I39A 3AAPA 4DSIA 3VEXA 3VQ7A 3K9JA 3MEDA 5AFUA 4BRFA 2JWKA 3ZX2A 4HUFA 1GOBA 4CK1A 1Q9YA 4CF8A 4F8RA 2Q2RA 1ILYA 3NAEA 2XY5A 3L3VA 1BA1A 5E84A 1BO5O 2E2PA 3E1YA 1GLJO 2VCPA 3NH1A 3I8DA 1UOCA 3DLRA 1JLFA 3UB5A 4BVOA 2IS3A 3VEYA 4CJEA 5DM6L 1HKBA 4AH9A 3K0SA 4CZHA 1U47A 2E2QA 2D1KA 2P9IB 3G0ZA 5EXWA 4DTRA 2X6NA 3SCXA 3ITHA 1J53A 3VQBA 3CETA 4B1WB 4GY2B 4OVLA 2OTJN 2QWQA 3ZEUB 2YHBA 4FWMA 4JN4A 3CCQN 5AQFA 4A62A 4CJLA 1S1UA 2E20A 1RDAA 3EY1A 2A1SA 3O3HA 4KH5A 4CJUA 4FM1A 2IVPA 3NF8A 1LCUA 3QERA 4DFPA 1HNXK 3G71N 4H5WA 2KHOA 3CMEN 4WQ5A 4O8UA 3CF5L 4FWLA 4WE1A 2O8BB 4Z4IA 4PWDA 2KQ2A 3VQ6A 4J2AA 4DV2K 4EHUA 4QAGA 3TABA 2GUIA 5HRSA 1TV6A 1YT3A 4KI6A 4DCHA 5ADXH 3HXMA 5AQYA 4DTOA 2ASOA 4DTSA 4NB4A 5BPMA 3NVKA 1SUQA 3D2FA 3ID8A 1SKRA 2OZMA 1VSIA 3A0IX 1VAZA 3OTOK 2G8IA 5KPZA 4JNEA 2FC0A 3CFRA 3J7YP 5CZ1A 4WQ4A 1HUXA 4I6MA 2ZJPL 1WBDA 1S22A 1X3NA 3T69A 5KQDA 2P9UA 2IAJA 3MN9A 2ZF5O 1YTAA 1VRTA 1NK4A 2E5LK 1LOTB 2P9LA 3E9OA 4YY3K 2BGGA 4NYNA 2QK9A 4DS5A 5EOYA 1HYZA 4IZ9A 2F96A 4CGHA 1U45A 1D9DA 5EX5A 3TTCA 2D0PA 1A5WA 4CGDA 2J4RA 2PZSA 1E4GT 4WFNL 1FJGK 4BR9A 1TKXA 3QBWA 3AVHA 4YDUC 2F7TA 1VHXA 2YX6A 4DQ8A 4CJQA 1K9MO 3AVCA 4CZLA 5CY4A 3CCEN 1U2VA 3HPGA 1T6CA 4JI2K 3ZETB 3P39A 1IBLK 4BQLA 1GLFO 4JK7A 4KB0A 4IWVA 1BGXT 2KFNA 4WYBA 1IG8A 4M3WA 4FYDA 4E0DA 1T44A 2P9SA 3SPZA 4FK2A 4OO1J 4DV4K 4PHTX 3EYZA 1B92A 4JEPA 4GV6A 5SWMA 1B9FA 3KWGA 2O8DA 3LAKA 3EN9A 4J2EA 3R8EA 3ZT4A 3HL8A 3NBPA 3PLAA 3IKMA 2QXFA 3CC4N 1GOAA 3H1VX 4IO9L 4FLZA 2NRZA 1RBRA 4LF8K 4BR5A 3H08A 3CFPA 3QB0A 2GEMA 4CEQA 2NLXA 4YDUA 4FWNA 3MCAB 3LDSA 5GINA 3DLHA 3M8SA 4C1NI 1C0FA 4F3OA 3T7ZA 1D8YA 3KK1A 2BANA 3AGRA 4CEBA 3R3LA 3UKUB 3QIOA 3VQEA 2O8CA 3ID6A 4ISFA 1HNVA 3VPZA 3THYB 4CF1A 1EXQA 4LF7K 1WOQA 3C7NA 1L3VA 3KIOA 3HZ6A 4CZIA 5I42A 1EQYA 1KFSA 1XHXA 4ELUA 5D3GA 3VESA 3O6WA 4RW7A 3TSQA 1I3AA 4V19S 1C6VA 4LFCK 3GOIA 3GE1A 3DLLL 3AO1A 3NVMA 4DTPA 2YHWA 4IEIA 2FF6A 4DR7K 5AQKA 4CJRA 3AO2A 5MLCQ 4FLXA 1SKWA 4F4KA 4CFCA 3ZSYA 4EP5A 4B3RK 4FJ9A 3CG7A 1JKHA 2AJQA 4CGJA 3E01A 4Q5VA 4DSKA 4MLEA 5IT9O 5TKYA 4DUYK 2W6KA 1BUPA 4YOXA 5LJWA 3K59A 3OYAA 1X9SA 4CJPA 1VQPN 2O8BA 2UYTA 1RBVA 4AHCA 4MDBA 3L6QA 2BE2A 1SS6A 1R0AA 4DV0K 3CCRN 5IWAK 4OLAA 4CZKA 3GBTA 5GAGP 4C8LA 1MDUB 2W40A 1KRPA 1JLEA 2EX3A 3PSIA 1WSIA 1EX4A 3V9XA 3ENHA 1UA0A 4JI5K 3WEEB 1WN7A 1Z26A 1WUAA 1D4XA 1Q82O 2QWLA 1TK5A 3EE9A 3J80O 4BRCA 1ZBSA 3THXA 3THXB 4IEEA 1IKWA 1NK8A 3PUFA 1R59O 4FJJA 4KBOA 4DQPA 4FZXC 3MECA 2I7PA 3OS2A 5I9EB 2QEXN 2Q1NA 1QQOA 4AM6A 4HTUA 1VQNN 1N32K 2V52B 2GBZA 3ZETA 4KO0A 2O4GA 2RE2A 4EAHD 3P31A 5JS1A 2E1YA 4KTQA 4DU3A 4DFKA 3BUZB 4ILHA 2D0BA 1J5OA 1EO1A 4GV3A 1VK0A 5DK5A 5HRNA 4FOEA 3EE8A 4O0JA 4FJMA 1HR0K 3LANA 3FLCO 2YKNA 5JICA 2B4JA 3SQ2A 4N76A 1OH6A 3A2FA 4FL9A 4BRHA 4PL7A 4OPKA 4FVMA 3EKUA 4RW4A 3JXUA 3G6EN 1K8AO 4ELTA 1KVAA 1NM1A 5JVGL 3NCIA 3QFUA 4DQSA 4NXNK 2KTQA 4JKFA 3WQTA 3L8BA 4YHHK 1HKGA 4B9VA 4BWMA 3AV9A 2HMPA 4CEFA 4CHNA 4PUOA 3OA9A 3OYLA 3O9RA 1GLLO 3F73A 2VWJA 3LZJA 3C95A 4O4GA 3DAWA 2HW3A 1UAXA 1KVBA 1XNQK 1VSJA 4CERA 1OH7A 5KPTA 2Q0UA 1RDUA 3V1RA 4CBXA 1C0UA 4FVUA 3OYEA 2OZSA 2VGMA 2R7YA 3P4IA 3FZMA 4OX9K 2FF3B 3TR8A 3MAQA 1TUYA 3O1BA 4AHRA 3SLCA 2E1ZA 3VGMA 1Y97A 3FZFA 2HHUA 4C8KA 3KWIA 3EL2A 5M1FA 1DLOA 3SBTA 3CQXA 3QETA 3RR8A 1ZC6A 4JS4A 3EZ5A 3TPQA 4EZ9A 5FDLA 4DTUA 2BTFA 3D0PA 5BRDA 5KPRA 4BR0A 2FSNA 3P38A 4IOAL 2NUBA 3IDHA 2GWKA 3F5TA 3H3NO 4DB3A 1YIJN 3OJUA 1NNEA 5FLXO 3HP6A 3ASMA 5BR9A 1RGIA 2YHYA 3WNEA 5BPLA 5BR8K 1WNSA 3VQQA 4I6MB 3AY9A 1X9JA 3ENBA 4M7YA 3ALYA 2P9NA 3M1FA 1IKXA 3OS0A 3A5OC 2DY4A 1RDBA 1RT6A 4N56A 1BCOA 4QOZB 4JI3K 5AQMA 4XEIA 4CI6A 4K41A 3C6AA 2GWJA 4CF2A 5C10A 1BQMA 3A5LC 3CCLN 2YJFA 2PYLA 2A5XA 3DYAA 4QCLA 3JAMO 4M41A 3DRPA 4FWOA 4CK3A 1XNRK 1YXQA 4KTWA 5AQLA 5FRMA 3OYGA 4FJLA 2KFZA 5BN8A 4PA1A 1W7AA 2YKMA 3MWTA 4PQUA 1TKZA 2HHSA 4OLBA 4FCYA 3TI0A 3OYNA 1NWKA 4FZYA 3FGUA 4DTMA 3MWPA 1VQLN 2UUCK 1S5JA 1VQMN 4B9LA 2Y1JA 3O8MA 3EKSA 4YOWA 4CD1A 4DR5K 4CVNE 1RT1A 3K2PA 2RKIA 3KD5E 3MEGA 4BE2A 1VQ6N 1TUUA 4BROA 2W42A 4OPHA 3AVFA 3CQYA 4ZTJA 1RTJA 1SAZA 3RWUA 3O1WA 2ZJRL 3BP8A 4KHNA 3HOSA 1ATRA 3O4QA 4DWIA 2IVOA 3FE1A 1B9DA 4O8KA 3TTFA 4EHTA 2UXBK 3HSTB 5T7BA 4W5OA 3B6PA 4X62K 4A2BA 1F21A 5M1OA 1XMQK 2PAVA 2CGLA 3IMXA 5AZIA 3BEXA 1TKTA 1NMDA 4FK0A 4IFYA 3CM5A 4JKAA 1VSMA 4CCHA 4HCBA 2FLOA 1NBWA 2O8EA 2Z1JA 1Q18A 3OYMA 3NH2A 2V51B 4BVPA 4B9SA 1YUWA 2YHAA 4JKGB 2A41A 5AQZA 3AVMA 3QEPA 1L3SA 4JAXA 4HVJA 2RN2A 3O80A 4DTXA 1N6QA 4W5NA 3ZX3A 2QA4N 3ZEUA 3ZYYX 2G8WA 2A6AA 2ATQA 1JCGA 5CE3A 3HOTA 3BGRA 4WQ5C 3AO5A 4FZZA 3VTIA 2P51A 1Z6RA 1TYQA 4GMJB 3CYMA 5DMRA 2P9IA 4KTZA 3QEXA 3VGLA 1RT2A 3NGYA 5BN9A 1RTHA 3K57A 4DR2K 4CGFA 1IKYA 5CR4A 4DU4A 1HPMA 3CFOA 2OYQA 4IOCL 4FOIA 1C1CA 4PKGA 2CGJA 4AF1A 2D4WA 4ISEA 5J2MA 3D45A 3K5OA 2NNWA 2WUSA 1N33K 3KJVA 2GX9A 4BDPA 3WXJA 4JI6K 1QHAA 1HRHA 4CZFA 1JCEA 2GELA 3NHGA 1GLEG 3SQ4A 4NO7A 3I56N 2F8TA 2QWNA 2ITMA 4MDAA 4RW9A 3K58A 3NF6A 4Z0UA 3V1QA 4IFEA 4YOVA 4B1ZA 2P9NB 4CJ3A 4FM2A 3OYCA 2E6LA 2P9UB 3H46O 4LF4K 1HMVA 3K5NA 1XWLA 1D5AA 3M5RA 3D2EB 4H5NA 3VETA 4LFBK 4M7XA 4CJ4A 3SQ1A 1JLGA 4E19A 3QMLA 1RDCA 3MX5A 3CIPA 5JLHA 5FPEA 3O9TA 4KHWA 3RMAA 3KVGA 3CCJN 1WB9A 4BRLA 1S72N 4DTNA 5GIOA 1V4SA 4JI8K 3BY5A 1A5VA 1NG9A 3DMJA 2OANA 1RT5A 1TL3A 4YORA 1NGFA 1BIZA 2VG5A 3B8AX 3WXLA 3FR0A 4EFHA 1J5EK 4H5TA 1KLMA 5E41A 1L5UA 5KI6A 3LPUA 4KV8A 4H4MA 3WXKA 1RCHA 3DJCA 2X6SA 1HQUA 4DV6K 2VG6A 1QTMA 3U6FA 3DXKB 1TVRA 3AVNA 3IRXA 2OA8A 3PX4A 3IAYA 4KHPK 3OYJA 4DV3K 2UXCK 4NXMK 1GLAG 4N5SA 4BRAA 4IJNA 3NDKA 4KH4A 4K25A 3AVKA 3C94A 3SJHA 3VN5A 3MXIA 4IDHA 4Z4GA 1TYQB 3IFRA 1LWEA 1ESVA 4B1YB 4IG3A 3G25A 2O4IA 1SL2A 4BRNA 2VQEK 1ATSA 1YJNN 3I8BA 3U3GA 3HT3A 3E66A 2HBKA 1ZBHA 1XC3A 3GL1A 1X1PA 1H1VA 1MWKA 3TAPA 4L8RB 1XQSC 3MCPA 3VQCA 4E7IA 1BQNA 1QVGM 1NOZA 1TAQA 4KHQA 5B8HA 1NGHA 2B5JA 3JYTA 2HHTA 3V9WA 3MN5A 4CJKA 1T05A 5C24A 3VEWA 2JGUA 4DQIA 1BCMA 3HTVA 1JCFA 3VF2A 3LP1A 4CW7B 5GAEP 3HRGA 3L2WA 3DRSA 5M1NA 4ILGB 2HNYA 4CJVA 1VSKA 2YI1A 3PV8A 2CH6A 4M3TA 4DSFA 2PYJA 3FZLA 4BR4A 3LDLA 3LL3A 3UIQA 1YJ9N 2X74A 2HSTA 3AAQA 3VQ8A 4DLEA 4WFBL 3VQAA 1IJJA 5CHIA 4DTJA 4YFUA 3LDOA 4AHSA 5F1XA 3SV4A 3IUCA 4E7HA 3TAGA 3OHRA 1KCFA 3V9SA 1SQKA 3AA5X 1RBUA 3PIPL 2GV9A 1A5XA 3N4PA 3BF3A 4NLBA 4BC3A 4FSVA 1GLCG 3VOVA 4F3TA 5KQ8A 1JXEA 2ZJQL 4LY7A 5BRFA 3TWHA 1M90O 1BOTO 3P1GA 4R79A 3P83D 4NYFA 3EO3A 3MDQA 3CHWA 4BR7A 3IS9A 4DMNA 3G10A 4CF9A 4Y1CA 4MLHA 5AZIB 3WNFA 3ZSXA 4BRIA 1KQSM 4IOXA 4OPAA 3VTHA 3RMBA 3AGKA 2FSJA 3QNOA 3ZT2A 4K43A 3SUPA 2G8FA 4CK2A 4H0XB 3O9UA 4EP4A 2P5OA 4I9QA 2NRHA 3QDKA 1MA9B 1MU2A 5C12A 2ITGA 3HYFA 2OCEA 1BI4A 3KZBA 4H03B 4A61A 1UWBA 4CD3A 4DQRA 3FZKA 1RT3A 5C42A 1ZBIA 2NRTA 4DFJA 3WNHA 4DKWA 3CC2N 2KLAA 3QFPA 1QQCA 4H5VA 4YOYA 3THYA 4ZTFA 3I55N 3H1QA 4LD0A 3BZKA 2DFHA 2W6LA 2O8CB 3EZWA 4X66K 3LZIA 1IKVA 3DLEA 4NCAA 3EEQA 5AR0A 3KK3A 3UE5A 4CHQA 3RRGA 2YNFA 5J2QA 4CEEA 4C8NA 1JJ2M 3SAFA 3AVAA 3DWLA 3OBYA 4BRGA 1S1VA 4QS9A 3AVIA 4B9NA 2FBVA 5J2NA 2PY5A 4FPBA 4FJXA 1J9AA 1NMNA 1XC9A 3BZCA 2JLEA 1C1BA 4IBNA 4IDKA 1BA0A 5KGXA 3RR7A 3WQUA 4M3UA 2WC9A 3OBWA 2ZGYA 4Z94A 4I7FA 3SI6A 3F9KA 4IG0A 4FM0A 4M42A 2XO7A 1ZBFA 2E2OA 1Q7YO 3BF1A 3CXCM 3SQ0A 1YI2N 4IO8A 2KKZA 4BRPA 2KW4A 5C2DA 4BRKA 4F9OA 2G8UA 2G8HA 1NGEA 4JRPA 3DXMB 3QNNA 4I2QA 2Y1IA 1O13A 1G15A 2Z1HA 4JKBA 4BREA 5JVHL 5EY4A 4CJSA 1U2VB 5AQTA 2A40A 2Q0RA 5CYQA 3ZSQA 4H0VB 1WSJA 2QM1A 3L2QA 1NK7A 2HBMA 2P5GA 1QSYA 2IOCA 1NJXA 1T3VA 5M1KA 3ZSOA 1HX1A 4K42A 2HNZA 3MEEA 4F2SA 1N36K 3VEVA 2YNHA 3AA4A 1ATNA 2HBLA 1E3MA 5AQOA 3CM6A 4NCGA 4HCCA 3C6UA 4BRQA 4CECA 1WSGA 4JI0K 4BC5A 2UU9K 3L3UA 4J2DA 4BE0A 2FBXA 3V81A 4LFAK 3LWLA 4FLVA 4CE9A 3THWA 3QIPA 3PSFA 3VENA 4BDZA 2OPSA 3O4WA 5LY3A 3O5BA 3VQ4A 4H8KA 1NGIA 4FJNA 1TK8A 3ZSVA 1JLQA 3I0RA 4DS4A 2WOMA 1RDWX 1IV0A 4LC9B 1HNZK 3WEEA 2HHHK 5HLFA 4IFVA 4PKHA 3HVTA 3QEVA 3TARA 1JXBA 3LP3A 3VMFB 3CI5A 3U3YA 2BDPA 4JRQA 3M8PA 2QKKA 4Z4HA 1NGAA 2EHGA 4DUZK 1JL2A 1KXPA 4XH5A 3CJBA 3LP2A 3QESA 2OPRA 5TKWA 4CFBA 3NF9A 3SBGA 3RVCA 3OYHA 5KTQA 2Q31A 4CIEA 2FBYA 3CCSN 3U9DA 2IC3A 3AVJA 2OPPA 5C0YA 4DR3K 1YHQN 2VQFK 3VA3A 3MK6A 3QLHA 3OYKA 4FLUA 4CFAA 2P9PB 4J8FA 5E26A 3PY8A 3HJFA 3VGKA 3LDQA 2D0AA 2NRXA 4YOTA 4DR1K 4W5TA 1RBSA 4OKEA 1J54A 3FZHA 3NH0A 3HPOA 3OVNA 1IBMK 4XH1A 1EWQA 3O4NA 2HBJA 4CHYA 1HLUA 1OH5A 4B3SK 2RPIA 3WUHA 3ZT3A 4K0KK 3VQ9A 4HTLA 4WFAL 3O9SA 3AO4A 4BR2A 3KLFA 2NZTA 5GAHP 5CZ2A 4OGEA 4B1VA 1KLNA 3DXKA 1OVQA 4UY8O 4ICLA 4Y0WA 1YITN 2I5JA 4B3TK 1NGJA 4EZ6A 3BDPA 3DLBA 3D7EO 1KAZA 4E89A 5GADP 4JI4K 4FO0A 1QS4A 4AM7A 1X9MA 1K73O 3MN7A 1P90A 4GKJK 5AFUH 2O8EB 2O8FB 2DTUA 1JL1A 2RF2A 3ZT1A 2HHWA 4OPJA 3OW2M 3G4SN 2X78A 2AP1A 5FPMA 1NU0A 4BC2A 1S6PA 3CD6N 1C1AA 4JHDB 1SKSA 4B9TA 1NK6A 4ZHRA 4KI4A 4O5BA 5J2PA 2A3ZA 3QO9A 5AQWA 5AJ3K 3SAHA 3CMAN 3S3MA 1LWCA 5AQUA 3SUOA 3R9PA 3K5LA 2HHVA 2FBTA 2IGIA 5AQNA 1WAJA 2KZZA 1RT4A 3PIOL 5BRHA 4M45A 3SYZA 2Z1GA 2VYPA 3SK3A 1C0MA 5AQHA 3T19A 2UUAK 2ZD1A 1NGBA 4C1NK 4L3QA 2CH5A 2DPNA 3WXIA 3VF6A 3U9ZA 5C15A 4H4OA 2P1JA 2WFBA 5M1PA 2P9KA 2V7YA 4CESA 1BISA 1SV5A 4KHSA 3HPHA 4FJGA 3AO3A 4DG1A 1T6DA 1NGCA 4Y1DA 1MWMA 2IDOA 1Q9XA 1WSEA 3W0LA 3L4IA 1G99A 2WTUA 3A5NC 4BACA 2QW9A 3LDNA 4MO4A 3RSEB 3U4LA 5GIPA 2E2NA 4DF4A 5A2QO 4DF8A 3S3NA 2QXLA 3CJ9A 4FLYA 4CGGA 3QEIA 1RFQA 2XY8A 1J6ZA 2VGNA 2EWSA 4CIGA 4BDYA 3PX0A 1XMOK 3MXMA 2H3GX 3CJCA 1LAVA 5J1EA 3H3OB 2ZGZA 3R1XA 4RWTA 3OJSA 1KFDA 5BPNA 3D2FB 1ASVA 3OYDA 2HNDA 5LL6Z 4AQYK 3AVLA 4DV1K 5AQVA 4FJ7A 1KD1O 1VSLA 3C0BA 1ZBLA 2XRIA 4BG8A 4JLHA 4H0TB 2QWOA 4FJHA 4JD2A 3WNGA 3ULEA 4BC4A 1VQ5N 2OPQA 3SJJA 3ISNC 3ULDA 3JS6A 3IG1A 2PFUA 5KRSA 3KTQA 1RDDA 2E6MA 4CJWA 4CJTA 1JLBA 1XUPO 2F9WA 4QS7A 3VEOA 3DRRA 4JKHA 1VSHA 3CJ1A 4AHUA 2WBNA 3L2VA 4CHPA 3OYIA 2QWRA 4LH4A 4PL8A 1K8KA 5KRTA 3TTDA 2A1RA 4CEDA 1NJIO 3NGIA 3THVA 2UXDK 2BH1A 1U04A 3DOKA 3LAMA 5AQGA 2LSNA 3RMDA 1QQMA 4DQQA 4O55A 3HP9A 2O8DB 3M3ZA 5HL7L 1DKGD 4HWIA 4ID1A 4C8MA 2VWKA 5FPNA 2V7ZA 4HHTA 1SL1A 1NJWA 1CXQA 1YVNA 2PBDA 2YV0X 2P9SB 4CHZA 3AA2A 4DSEA 5H1SQ 4PY5A 3OYFA 3N4QA 1BIUA 2JWLA 4CGIA 4JK8A 4BWJA 3D6RA 1K6YA 1RTIA 4FJ5A 3T1AA 1QE1A 1ZXOA 4B9MA 1VSFA 4J2BA 1KAXA 4KREA 3F9MA 4K8XA 1FK9A 3VQPA 5CYMA 3I0SA 3OS1A 5I3UA 3CCVN 1LW0A 5M1QA 2YNGA 3DLKA 2QTDA 2ZM6K 1ASWA 4A5BA 3CC7N 1S3XA 1L3TA 3ATVA 5JMVA 2DFFA 1S1WA 1E4FT 4JI1K 3ENOA 3P5JA 1QZ5A 3ZCMA 1BU6O 2E88A 1UA1A 4FJKA 1QSLA 3V4IA 3C65A 3DXMA 1VQON 4Z4CA 3SNNA 3ATUA 4GVEA 3E9PA 3HSCA 2A42A 2E8AA 5EU7A 5KGWA 1QHTA 3HK2A 5F2RA 4M3XA 2F4VK 1X9WA 3V9UA 4E7JA 1L3UA 2HF4A 1OKJA 1T8EA 4M3ZA 1S9GA 1U6ZA 4KPYA 2IIRA 3QBXA 2ASMA 4B8CA 1RILA 1YVUA 1SZ2A 4FW2A 5C25A 4H5RA 3O08A 1QSSA 4H0PA 1KC8O 2FXUA 3HVRA 3DM2A 1SL0A 3L0QA 3J7AP 1T03A 2B6AA 4BQZA 3DLGA 4DSLA 3UKRB 4RTFD 1EETA 3A8YA 4B8AB 4NLCA 1HJOA 3I33A 1HYVA 4WQ4C 1N34K 1HJRA 3ZX0A 1W97L 1N8RO 4H0YB 1S6QA 2VWBA 1KSPA 2D0CA 3VERA 3HBTA 4IXCA 3RTVA 1DEJA 3B6OA 3ZSRA 4CFDA 4K8ZA 4DR4K 2G8KA 3AA3A 1CZBA 5AQXA 2BUPA 3MMVA 3TAQA 1BI4B 3E9LA 1NK5A 5HROA 4XH4A 1KVCA 3THWB 4QS8A 1W9HA 4FWQA 4YOUA 1NGDA 5AQRA 4WF9L 4KH6A 4BGAA 4EIAA 4ISGA 4WCEL 3SUNA 4OGCA 4ELVA 1DT9A 4DFMA 3GG4A 4X64K 2D5RA 3KLHA 1DTQA 1Q8IA 3ZSZA 4U67L 4A5AA 1XI1A 4FLWA 4DV5K 3KLEA 2P9KB 4H0OA 3SPYA 4RG8A 1HKCA 4CBWA 3J8AA 3W3DA 4IJAA 1S9EA 2GTDA 5FPDA 2NRRA 4Z4EA 3KHYA 3SUQA 4DHYA 1EWRA 4FWRA 1W2BM 3F2KA 3GDQA 4U7BA 1YF5L 1VQ8N 4CZEA 3T3FA 3TAMA 4RW8A 3CJ7A 3VA0A 3HI0A 1IH7A 3V1OA 4CEOA 1VRUA 4LF9K 2QWMA 1NKCA 2HOEA 2GUPA 2XY6A 3TAFA 4B1UB 1CZ9A 1WSHA 3VEZA 2UUBK 1EP4A 4GW6A 2YCHA 4LF6K 5HRPA 4AHTA 1M1KO 4E7LA 1QVFM 4ILJA 2IVNA 4FXDA 5FRNA 5JLFA 1I94K 4A57A 4KAZA 1CLQA 2XHBA 3Q7BA 5LMNK 4MO5A 4FPAA 3UKUA 2NRVA 4B08A 4AHVA 4JI7K 3DI6A 3T1HK 3H45C 3TSPA 4FJ8A 4DSJA 1ASUA 1Z05A 4JV5K 3OY9A 1T7PA 2HMIA 1Q86O 1Q81O 1NKEA 1D9FA 5DM7L 1O1WA 1Z25A 4CJFA 1BWFO 1KTQA 5AQJA 5AZJB 1VSEA 5FROA 4B3MK 4HUEA 4JKDA 4KB1A 1U49A 3NMUA 2QI2A 4X65K 1JLCA 3T1YK 3R6MA 3TSUA 5HBMA 3VQ5A 3UKRA 3QEWA 3NE6A 2XY7A 4CJ7A 3FFKB 4I9LA 1HYSA 2VG7A 3SMPA 4N41A 4LSNA 3KK2A 3ULEB 4I2PA 1QZ6A 4OKKA 4BG9A 3A5MC 3D2EA 3PO4A 4CIFA 1S1XA 4O0IA 3MX2A 4DU1A 4GKKK 3PO5A 2Q97A 5LJVA 5EVZA 4OJRA 3VF4A 1XHZA 1BHLA 1NLVA 4O44A 1QQNA 3LWMA 4G1QA 1YAGA 3LPTA 4FW1A 4CBUA 2HHQA 2HB5A 2QWPA 1FKOA 3OYBA 5AQPA 1TL1A 1BL3A 3LALA 1ITGA 1NKBA 3RMCA 4CHOA 1CXUA 2HVIA 3C7NB 3CPEA 4BY9C 4JS5A 1FW6A 4W5QA 3TANA 2F8SA 1VQ7N 1REVA 4BE1A 5AZJA 3PX6A 1NGGA 4CZGA 4E1MA 3J81O 4M63C 3J7ZO 1VQKN 1LW2A 4E1NA 4NCBA 4ID5A 3C6TA 3HM9A 1S1TA 4PKIA 3SV3A 3KKSA 3JSMA 2Z1IA 4JYAK 3NF7A 1C0TA 5K14A 5LMUK 5AQIA 4M3RA 4KRFA 3LDPA 1BG3A 4XIUA 2AA4A 3FFIA 1V4TA 4OKJA 1GLDG 4KFBA 1BDGA 2OTLN 4GVMA 3K5MA 1TK0A
chains in the Genus database with same CATH topology
3AVBA 3AVKA 3C94A 3VN5A 3MXIA 4Z4GA 2BE2A 1R0AA 3NFAA 4BACA 4DF4A 4OLAA 1LWEA 3S3OA 4C8LA 4DF8A 4IG3A 1GOCA 3S3NA 4TSXA 1TKDA 1JLEA 1KRPA 2O4IA 2EX3A 1SL2A 4KHUA 1WSIA 1EX4A 4FLYA 3V9XA 3U3GA 4CGGA 3SZ2A 3QEIA 3HT3A 2XY8A 3ZSWA 1UA0A 2KZMA 3O3FA 4FK4A 3MXJA 3NDKA 3KKRA 1ZBHA 1WN7A 1Z26A 3TAEA 4IKFA 1X1PA 3V6DA 4CIGA 4BDYA 3PX0A 3TAPA 1TK5A 4L8RB 2Q3SA 3VQDA 3VQCA 4E7IA 1FKPA 1BQNA 3MXMA 1NOZA 1TAQA 1HNIA 4B9UA 5SZTA 1IKWA 1LAVA 5J1EA 1NK8A 4KHQA 1RT7A 2B5JA 3HO1A 3JYTA 3PUFA 2HHTA 3LP0A 3V9WA 4FJJA 4AILC 1LV5A 3QINA 4DQPA 3OJSA 4CJKA 1KFDA 4FZXC 3MECA 3L2UA 3RRHA 1T05A 1ASVA 1TAUA 3OYDA 2HNDA 3OS2A 5C24A 4FK0A 3AVLA 1W0HA 2JGUA 4DQIA 1BCMA 4FJ7A 1VSLA 3LP1A 4HTUA 3L2WA 3DRSA 2XRIA 1IO2A 2GBZA 1ZBLA 2ETJA 2HNYA 4CJVA 1VSKA 4JLHA 2O4GA 4KO0A 1NOYA 4FJHA 3PV8A 2HHXA 3WNGA 5JS1A 4KTQA 5HRRA 2OPQA 3SJJA 2G8VA 3ISNC 5JS2A 3ULDA 4M3TA 4YNQA 4DU3A 1JLAA 4DFKA 3IG1A 3V9ZA 4DSFA 5KRSA 2E4LA 2PYJA 1RDDA 3KTQA 2E6MA 2D0BA 4CJWA 4CJTA 1J5OA 1NK9A 3UIQA 2X74A 3VQ8A 4LH5A 1JLBA 4DLEA 3VQAA 1VK0A 3DRRA 4Q0BA 1L5UA 5DK5A 1VSHA 5HRNA 4AHUA 1EKEA 4MQ3A 3L2VA 4DTJA 4CHPA 3OYIA 4O0JA 4YFUA 4W5RA 4LH4A 4Z4FA 4HUGA 4FJMA 1LWFA 1FXXA 4AHSA 5KRTA 3SV4A 3LANA 4CJ5A 2YKNA 2B4JA 3SQ2A 4CEDA 2A1RA 3NGIA 3THVA 4N76A 3A2FA 3LAMA 1U04A 3DOKA 2WONA 4FVMA 4OPKA 3ZT0A 4E7HA 3TAGA 1KCFA 2LSNA 3O3GA 3V9SA 4KKOA 4C8OA 3RMDA 1LAWA 1IG9A 3AA5X 4RW4A 1RBUA 4O55A 4DQQA 3DOLA 3HP9A 4M3YA 4ELTA 2GV9A 1A5XA 1KVAA 2ZQBA 3NCIA 1WLJA 4DQSA 2KTQA 3L8BA 4B9VA 4BWMA 3AV9A 4ID1A 4F3TA 4C8MA 4CEFA 2VWKA 1JXEA 4CHNA 4LY7A 3M8QA 4FLTA 4PUOA 4HHTA 1SL1A 3OYLA 3TWHA 1NJWA 4F2RA 4LSLA 1CXQA 1U4BA 2YV0X 3F73A 4CHZA 2VWJA 3P1GA 3LZJA 3P83D 4NYFA 3C95A 3AA2A 4O4GA 4DSEA 4FJIA 4PY5A 2YNIA 3OYFA 3IS9A 2QKBA 2HW3A 1UAXA 1BIUA 1KVBA 3G10A 4DMNA 4N47A 4CF9A 4Y1CA 1VSDA 3WNFA 4CGIA 1VSJA 3ZSXA 1N5YA 4BWJA 1RNHA 4CERA 3L2RA 4UQGA 3RMBA 1K6YA 1HPZA 1WSFA 1RTIA 4FJ5A 3V1RA 1C0UA 1TGOA 3T1AA 3OYEA 2OZSA 1QE1A 4E3SA 2R7YA 4CF0A 3QNOA 4B9MA 4E7KA 3ZT2A 3TR8A 3MAQA 1VSFA 4J2BA 4CEZA 4KHYA 4KREA 4AHRA 3SUPA 4K8XA 2HVHA 2G8FA 1FK9A 1HQEA 3VQPA 5CYMA 3I0SA 3OS1A 4CK2A 5I3UA 1WAFA 4EP4A 1Y97A 3KLIA 2P5OA 1LW0A 2HHUA 4C8KA 4I9QA 2YNGA 1NK0A 3DLKA 1DLOA 1ASWA 3QETA 1L3TA 1MU2A 2ITGA 3HYFA 1ZYQA 3RR8A 2DFFA 1S1WA 4RW6A 4B3OA 1BI4A 3P5JA 4JS4A 3EZ5A 1NJZA 4EZ9A 5FDLA 1UWBA 4DTUA 4DQRA 3ZCMA 1RT3A 3D0PA 5C42A 1ZBIA 5HP1A 4DFJA 3WNHA 1UA1A 4FJKA 1QSLA 3V4IA 1QQCA 1RTDA 2NUBA 4ZTFA 4Z4CA 3SNNA 3OJUA 4LD0A 4F4KA 5EU7A 4MFBA 2DFHA 3ASMA 5KGWA 3HP6A 1QHTA 3HK2A 1DTTA 3WNEA 1ZBUA 4DLGA 3M8RA 4M3XA 1WNSA 3LZIA 1X9WA 3VQQA 1U48A 1IKVA 3DLEA 3V9UA 4E7JA 3S9HA 3KK3A 3NGZA 3ALYA 4CHQA 4J2DA 4NCAA 1L3UA 3RRGA 1IKXA 1NJYA 3OS0A 3CQ8A 3KLGA 2YNFA 2DY4A 1YTUA 5J2QA 1RDBA 2DFEA 1T8EA 4R5PA 4CEEA 2ZE2A 3AVGA 1RT6A 4C8NA 4CEAA 4N56A 1S9GA 1BCOA 3KD1E 4KPYA 1RBTA 1I39A 4QOZB 4DSIA 3VQ7A 3AVAA 3MEDA 1Q9YA 4HUFA 1GOBA 1S1VA 4B8CA 1RILA 4CK1A 1YVUA 4CF8A 4FW2A 5C25A 3AVIA 1QSSA 4B9NA 4CF2A 4F8RA 2FBVA 5J2NA 3NAEA 1BQMA 2XY5A 2PY5A 3L3VA 3HVRA 3DM2A 2PYLA 4FJXA 1J9AA 3DYAA 1SL0A 4QCLA 1XC9A 1T03A 3NH1A 2B6AA 4M41A 2JLEA 1C1BA 1UOCA 3DLRA 1JLFA 3DLGA 3DRPA 4IBNA 4IDKA 4CK3A 5KGXA 3RR7A 4DSLA 4M3UA 2IS3A 4CJEA 1EETA 4KTWA 4AH9A 5FRMA 4B8AB 3OYGA 1U47A 4I7FA 3SI6A 3F9KA 4FJLA 2KFZA 1HYVA 4IG0A 3G0ZA 4PA1A 4FM0A 2YKMA 4PQUA 4M42A 2XO7A 1TKZA 2HHSA 1ZBFA 4OLBA 4DTRA 2X6NA 4FCYA 1HJRA 3SCXA 3SQ0A 3ITHA 3TI0A 3OYNA 1J53A 3VQBA 4FZYA 2KW4A 1S6QA 4DTMA 4OVLA 1KSPA 2D0CA 2G8UA 3RTVA 2G8HA 3B6OA 3ZSRA 4CFDA 2YHBA 4K8ZA 1S5JA 4JRPA 4B9LA 2Y1JA 4CJLA 4I2QA 1S1UA 3QNNA 2Y1IA 2G8KA 1RDAA 1G15A 3AA3A 2A1SA 1CZBA 2Z1HA 3O3HA 3EY1A 4CJUA 1RT1A 4FM1A 3K2PA 3NF8A 2RKIA 3KD5E 3QERA 3MEGA 4CJSA 4DFPA 4BE2A 3TAQA 1BI4B 5CYQA 1NK5A 3ZSQA 2W42A 1WSJA 5HROA 3AVFA 4M3ZA 3L2QA 4ZTJA 1KVCA 1RTJA 1NK7A 4WE1A 3RWUA 1W9HA 2P5GA 4Z4IA 4PWDA 2KQ2A 3VQ6A 4J2AA 4KHNA 1QSYA 2IOCA 1NJXA 3O4QA 4QAGA 3TABA 3ZSOA 2GUIA 4DWIA 5HRSA 3I8DA 1B9DA 1TV6A 2HNZA 3MEEA 1YT3A 4F2SA 4KI6A 2YNHA 3HXMA 3AA4A 4OGCA 3SUNA 3HSTB 5T7BA 4DTOA 4W5OA 3B6PA 4ELVA 1F21A 3CM6A 4NCGA 4HCCA 4DTSA 3C6UA 4DFMA 2D5RA 3KLHA 4CECA 1WSGA 1DTQA 1Q8IA 3ZSZA 4NCBA 1SUQA 1TKTA 3L3UA 1XI1A 1SKRA 4IFYA 2FBXA 3CM5A 4BE0A 4FLWA 1VSIA 3V81A 2OZMA 1VSMA 3KLEA 2G8IA 4CCHA 3LWLA 4FLVA 4HCBA 2FC0A 4CE9A 3CFRA 4RG8A 5CZ1A 3SPYA 3QIPA 2Z1JA 4BDZA 2OPSA 3OYMA 3NH2A 3VQ4A 4H8KA 1S9EA 4B9SA 4FJNA 2YHAA 1TK8A 4Z4EA 2IAJA 3AVMA 3ZSVA 1JLQA 3I0RA 1YTAA 1VRTA 4DS4A 3SUQA 2WOMA 4HVJA 2RN2A 3QEPA 1NK4A 1L3SA 4DTXA 1N6QA 4W5NA 5HLFA 2BGGA 4IFVA 4NYNA 3HVTA 3QEVA 3TARA 1JXBA 2G8WA 3LP3A 2QK9A 3U3YA 4DS5A 2BDPA 4JRQA 2ATQA 3T3FA 1HYZA 3M8PA 3TAMA 4Z4HA 2QKKA 4RW8A 2EHGA 2F96A 3VA0A 1JL2A 4CGHA 3BGRA 1U45A 1D9DA 3AO5A 1IH7A 4FZZA 3LP2A 2P51A 1A5WA 4CGDA 3V1OA 2PZSA 4CEOA 1VRUA 3QESA 4GMJB 1NKCA 2OPRA 4CFBA 3CYMA 5DMRA 3NF9A 3TAFA 1TKXA 1CZ9A 1WSHA 3OYHA 2XY6A 3AVHA 4KTZA 5KTQA 1EP4A 4GW6A 3QEXA 1RT2A 5HRPA 4CJQA 3NGYA 3AVCA 4AHTA 5CY4A 4CIEA 4E7LA 2FBYA 1RTHA 3K57A 4FXDA 2IC3A 3AVJA 2OPPA 4CGFA 4KAZA 3HPGA 5FRNA 1CLQA 2XHBA 3VA3A 1IKYA 3QLHA 3OYKA 4FLUA 4DU4A 4CFAA 4B08A 4AHVA 3CFOA 2OYQA 3DI6A 4KB0A 1BGXT 2KFNA 3PY8A 3HJFA 4FJ8A 4DSJA 1ASUA 2D0AA 3OY9A 1T7PA 1C1CA 4M3WA 4FYDA 2HMIA 4W5TA 4E0DA 3SPZA 1NKEA 1D9FA 1O1WA 1RBSA 4FK2A 1Z25A 4OKEA 5J2MA 4CJFA 1KTQA 3D45A 3EYZA 1B92A 1VSEA 3K5OA 1J54A 5FROA 3NH0A 3HPOA 3OVNA 4HUEA 4KB1A 3O4NA 3KJVA 1U49A 5SWMA 1B9FA 4CHYA 4BDPA 1JLCA 3LAKA 4J2EA 2RPIA 5HBMA 3VQ5A 3ZT3A 3QEWA 3ZT4A 3VQ9A 3NE6A 2XY7A 3HL8A 3NBPA 1HRHA 4I9LA 3NHGA 1HYSA 2QXFA 2VG7A 4N41A 3AO4A 1GOAA 3SQ4A 4LSNA 3KLFA 3KK2A 4I2PA 4FLZA 1RBRA 5CZ2A 4OGEA 2F8TA 4OKKA 3H08A 3CFPA 1KLNA 4CEQA 3PO4A 4CIFA 4RW9A 3K58A 1S1XA 3NF6A 4ICLA 4Z0UA 4O0IA 3LDSA 3DLHA 4DU1A 3V1QA 2I5JA 3PO5A 3M8SA 4OJRA 4EZ6A 4F3OA 3BDPA 3DLBA 4E89A 1XHZA 1D8YA 4CJ3A 3KK1A 1BHLA 2BANA 2E6LA 1QS4A 3OYCA 4CEBA 4FM2A 1HMVA 3QIOA 4O44A 3K5NA 1X9MA 1XWLA 1D5AA 3VQEA 4G1QA 3LWMA 3LPTA 4FW1A 2HHQA 2HB5A 1FKOA 2DTUA 1JL1A 2RF2A 3ZT1A 4CJ4A 4OPJA 3OYBA 1TL1A 3SQ1A 1HNVA 2HHWA 1JLGA 1BL3A 2X78A 3LALA 4E19A 1ITGA 1NKBA 1RDCA 3RMCA 1S6PA 4CF1A 1EXQA 1C1AA 4CHOA 1CXUA 1SKSA 4B9TA 1L3VA 2HVIA 1NK6A 4ZHRA 4KHWA 3KIOA 3RMAA 4KI4A 4O5BA 5J2PA 4JS5A 3QO9A 4W5QA 5I42A 3TANA 1KFSA 1XHXA 4ELUA 5D3GA 2F8SA 4DTNA 3S3MA 4RW7A 1LWCA 1REVA 1I3AA 3SUOA 3K5LA 4BE1A 2HHVA 3PX6A 2FBTA 2IGIA 1A5VA 1C6VA 1WAJA 3DMJA 3AO1A 1RT5A 4DTPA 2KZZA 1TL3A 1RT4A 4E1MA 1BIZA 2VG5A 4CJRA 3AO2A 4M45A 3SYZA 2Z1GA 4FLXA 1C0MA 1SKWA 1KLMA 1LW2A 4CFCA 4E1NA 4ID5A 5KI6A 3ZSYA 3T19A 3LPUA 5E41A 4KV8A 2ZD1A 3C6TA 4H4MA 1S1TA 4EP5A 1RCHA 3HM9A 3SV3A 2X6SA 3KKSA 3JSMA 1HQUA 3CG7A 4FJ9A 1JKHA 2Z1IA 2AJQA 2VG6A 4CGJA 1QTMA 3U6FA 3E01A 1TVRA 4Q5VA 4DSKA 3NF7A 1C0TA 5K14A 3AVNA 3IRXA 2OA8A 4H4OA 3PX4A 2P1JA 4M3RA 3IAYA 4KRFA 3OYJA 4XIUA 3K59A 4CESA 3OYAA 1X9SA 4CJPA 1BISA 1SV5A 4KHSA 3FFIA 3HPHA 4FJGA 3AO3A 4DG1A 4OKJA 4Y1DA 4KFBA 2IDOA 1Q9XA 1WSEA 4N5SA 4GVMA 3K5MA 1RBVA 4AHCA 1TK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVB A;  3AVK A;  3C94 A;  3VN5 A;  3MXI A;  4Z4G A;  2BE2 A;  1R0A A;  3NFA A;  4BAC A;  4DF4 A;  4OLA A;  1LWE A;  3S3O A;  4C8L A;  4DF8 A;  4IG3 A;  1GOC A;  3S3N A;  4TSX A;  1TKD A;  1JLE A;  1KRP A;  2O4I A;  2EX3 A;  1SL2 A;  4KHU A;  1WSI A;  1EX4 A;  4FLY A;  3V9X A;  3U3G A;  4CGG A;  3SZ2 A;  3QEI A;  3HT3 A;  2XY8 A;  3ZSW A;  1UA0 A;  2KZM A;  3O3F A;  4FK4 A;  3MXJ A;  3NDK A;  3KKR A;  1ZBH A;  1WN7 A;  1Z26 A;  3TAE A;  4IKF A;  1X1P A;  3V6D A;  4CIG A;  4BDY A;  3PX0 A;  3TAP A;  1TK5 A;  4L8R B;  2Q3S A;  3VQD A;  3VQC A;  4E7I A;  1FKP A;  1BQN A;  3MXM A;  1NOZ A;  1TAQ A;  1HNI A;  4B9U A;  5SZT A;  1IKW A;  1LAV A;  5J1E A;  1NK8 A;  4KHQ A;  1RT7 A;  2B5J A;  3HO1 A;  3JYT A;  3PUF A;  2HHT A;  3LP0 A;  3V9W A;  4FJJ A;  4AIL C;  1LV5 A;  3QIN A;  4DQP A;  3OJS A;  4CJK A;  1KFD A;  4FZX C;  3MEC A;  3L2U A;  3RRH A;  1T05 A;  1ASV A;  1TAU A;  3OYD A;  2HND A;  3OS2 A;  5C24 A;  4FK0 A;  3AVL A;  1W0H A;  2JGU A;  4DQI A;  1BCM A;  4FJ7 A;  1VSL A;  3LP1 A;  4HTU A;  3L2W A;  3DRS A;  2XRI A;  1IO2 A;  2GBZ A;  1ZBL A;  2ETJ A;  2HNY A;  4CJV A;  1VSK A;  4JLH A;  2O4G A;  4KO0 A;  1NOY A;  4FJH A;  3PV8 A;  2HHX A;  3WNG A;  5JS1 A;  4KTQ A;  5HRR A;  2OPQ A;  3SJJ A;  2G8V A;  3ISN C;  5JS2 A;  3ULD A;  4M3T A;  4YNQ A;  4DU3 A;  1JLA A;  4DFK A;  3IG1 A;  3V9Z A;  4DSF A;  5KRS A;  2E4L A;  2PYJ A;  1RDD A;  3KTQ A;  2E6M A;  2D0B A;  4CJW A;  4CJT A;  1J5O A;  1NK9 A;  3UIQ A;  2X74 A;  3VQ8 A;  4LH5 A;  1JLB A;  4DLE A;  3VQA A;  1VK0 A;  3DRR A;  4Q0B A;  1L5U A;  5DK5 A;  1VSH A;  5HRN A;  4AHU A;  1EKE A;  4MQ3 A;  3L2V A;  4DTJ A;  4CHP A;  3OYI A;  4O0J A;  4YFU A;  4W5R A;  4LH4 A;  4Z4F A;  4HUG A;  4FJM A;  1LWF A;  1FXX A;  4AHS A;  5KRT A;  3SV4 A;  3LAN A;  4CJ5 A;  2YKN A;  2B4J A;  3SQ2 A;  4CED A;  2A1R A;  3NGI A;  3THV A;  4N76 A;  3A2F A;  3LAM A;  1U04 A;  3DOK A;  2WON A;  4FVM A;  4OPK A;  3ZT0 A;  4E7H A;  3TAG A;  1KCF A;  2LSN A;  3O3G A;  3V9S A;  4KKO A;  4C8O A;  3RMD A;  1LAW A;  1IG9 A;  3AA5 X;  4RW4 A;  1RBU A;  4O55 A;  4DQQ A;  3DOL A;  3HP9 A;  4M3Y A;  4ELT A;  2GV9 A;  1A5X A;  1KVA A;  2ZQB A;  3NCI A;  1WLJ A;  4DQS A;  2KTQ A;  3L8B A;  4B9V A;  4BWM A;  3AV9 A;  4ID1 A;  4F3T A;  4C8M A;  4CEF A;  2VWK A;  1JXE A;  4CHN A;  4LY7 A;  3M8Q A;  4FLT A;  4PUO A;  4HHT A;  1SL1 A;  3OYL A;  3TWH A;  1NJW A;  4F2R A;  4LSL A;  1CXQ A;  1U4B A;  2YV0 X;  3F73 A;  4CHZ A;  2VWJ A;  3P1G A;  3LZJ A;  3P83 D;  4NYF A;  3C95 A;  3AA2 A;  4O4G A;  4DSE A;  4FJI A;  4PY5 A;  2YNI A;  3OYF A;  3IS9 A;  2QKB A;  2HW3 A;  1UAX A;  1BIU A;  1KVB A;  3G10 A;  4DMN A;  4N47 A;  4CF9 A;  4Y1C A;  1VSD A;  3WNF A;  4CGI A;  1VSJ A;  3ZSX A;  1N5Y A;  4BWJ A;  1RNH A;  4CER A;  3L2R A;  4UQG A;  3RMB A;  1K6Y A;  1HPZ A;  1WSF A;  1RTI A;  4FJ5 A;  3V1R A;  1C0U A;  1TGO A;  3T1A A;  3OYE A;  2OZS A;  1QE1 A;  4E3S A;  2R7Y A;  4CF0 A;  3QNO A;  4B9M A;  4E7K A;  3ZT2 A;  3TR8 A;  3MAQ A;  1VSF A;  4J2B A;  4CEZ A;  4KHY A;  4KRE A;  4AHR A;  3SUP A;  4K8X A;  2HVH A;  2G8F A;  1FK9 A;  1HQE A;  3VQP A;  5CYM A;  3I0S A;  3OS1 A;  4CK2 A;  5I3U A;  1WAF A;  4EP4 A;  1Y97 A;  3KLI A;  2P5O A;  1LW0 A;  2HHU A;  4C8K A;  4I9Q A;  2YNG A;  1NK0 A;  3DLK A;  1DLO A;  1ASW A;  3QET A;  1L3T A;  1MU2 A;  2ITG A;  3HYF A;  1ZYQ A;  3RR8 A;  2DFF A;  1S1W A;  4RW6 A;  4B3O A;  1BI4 A;  3P5J A;  4JS4 A;  3EZ5 A;  1NJZ A;  4EZ9 A;  5FDL A;  1UWB A;  4DTU A;  4DQR A;  3ZCM A;  1RT3 A;  3D0P A;  5C42 A;  1ZBI A;  5HP1 A;  4DFJ A;  3WNH A;  1UA1 A;  4FJK A;  1QSL A;  3V4I A;  1QQC A;  1RTD A;  2NUB A;  4ZTF A;  4Z4C A;  3SNN A;  3OJU A;  4LD0 A;  4F4K A;  5EU7 A;  4MFB A;  2DFH A;  3ASM A;  5KGW A;  3HP6 A;  1QHT A;  3HK2 A;  1DTT A;  3WNE A;  1ZBU A;  4DLG A;  3M8R A;  4M3X A;  1WNS A;  3LZI A;  1X9W A;  3VQQ A;  1U48 A;  1IKV A;  3DLE A;  3V9U A;  4E7J A;  3S9H A;  3KK3 A;  3NGZ A;  3ALY A;  4CHQ A;  4J2D A;  4NCA A;  1L3U A;  3RRG A;  1IKX A;  1NJY A;  3OS0 A;  3CQ8 A;  3KLG A;  2YNF A;  2DY4 A;  1YTU A;  5J2Q A;  1RDB A;  2DFE A;  1T8E A;  4R5P A;  4CEE A;  2ZE2 A;  3AVG A;  1RT6 A;  4C8N A;  4CEA A;  4N56 A;  1S9G A;  1BCO A;  3KD1 E;  4KPY A;  1RBT A;  1I39 A;  4QOZ B;  4DSI A;  3VQ7 A;  3AVA A;  3MED A;  1Q9Y A;  4HUF A;  1GOB A;  1S1V A;  4B8C A;  1RIL A;  4CK1 A;  1YVU A;  4CF8 A;  4FW2 A;  5C25 A;  3AVI A;  1QSS A;  4B9N A;  4CF2 A;  4F8R A;  2FBV A;  5J2N A;  3NAE A;  1BQM A;  2XY5 A;  2PY5 A;  3L3V A;  3HVR A;  3DM2 A;  2PYL A;  4FJX A;  1J9A A;  3DYA A;  1SL0 A;  4QCL A;  1XC9 A;  1T03 A;  3NH1 A;  2B6A A;  4M41 A;  2JLE A;  1C1B A;  1UOC A;  3DLR A;  1JLF A;  3DLG A;  3DRP A;  4IBN A;  4IDK A;  4CK3 A;  5KGX A;  3RR7 A;  4DSL A;  4M3U A;  2IS3 A;  4CJE A;  1EET A;  4KTW A;  4AH9 A;  5FRM A;  4B8A B;  3OYG A;  1U47 A;  4I7F A;  3SI6 A;  3F9K A;  4FJL A;  2KFZ A;  1HYV A;  4IG0 A;  3G0Z A;  4PA1 A;  4FM0 A;  2YKM A;  4PQU A;  4M42 A;  2XO7 A;  1TKZ A;  2HHS A;  1ZBF A;  4OLB A;  4DTR A;  2X6N A;  4FCY A;  1HJR A;  3SCX A;  3SQ0 A;  3ITH A;  3TI0 A;  3OYN A;  1J53 A;  3VQB A;  4FZY A;  2KW4 A;  1S6Q A;  4DTM A;  4OVL A;  1KSP A;  2D0C A;  2G8U A;  3RTV A;  2G8H A;  3B6O A;  3ZSR A;  4CFD A;  2YHB A;  4K8Z A;  1S5J A;  4JRP A;  4B9L A;  2Y1J A;  4CJL A;  4I2Q A;  1S1U A;  3QNN A;  2Y1I A;  2G8K A;  1RDA A;  1G15 A;  3AA3 A;  2A1S A;  1CZB A;  2Z1H A;  3O3H A;  3EY1 A;  4CJU A;  1RT1 A;  4FM1 A;  3K2P A;  3NF8 A;  2RKI A;  3KD5 E;  3QER A;  3MEG A;  4CJS A;  4DFP A;  4BE2 A;  3TAQ A;  1BI4 B;  5CYQ A;  1NK5 A;  3ZSQ A;  2W42 A;  1WSJ A;  5HRO A;  3AVF A;  4M3Z A;  3L2Q A;  4ZTJ A;  1KVC A;  1RTJ A;  1NK7 A;  4WE1 A;  3RWU A;  1W9H A;  2P5G A;  4Z4I A;  4PWD A;  2KQ2 A;  3VQ6 A;  4J2A A;  4KHN A;  1QSY A;  2IOC A;  1NJX A;  3O4Q A;  4QAG A;  3TAB A;  3ZSO A;  2GUI A;  4DWI A;  5HRS A;  3I8D A;  1B9D A;  1TV6 A;  2HNZ A;  3MEE A;  1YT3 A;  4F2S A;  4KI6 A;  2YNH A;  3HXM A;  3AA4 A;  4OGC A;  3SUN A;  3HST B;  5T7B A;  4DTO A;  4W5O A;  3B6P A;  4ELV A;  1F21 A;  3CM6 A;  4NCG A;  4HCC A;  4DTS A;  3C6U A;  4DFM A;  2D5R A;  3KLH A;  4CEC A;  1WSG A;  1DTQ A;  1Q8I A;  3ZSZ A;  4NCB A;  1SUQ A;  1TKT A;  3L3U A;  1XI1 A;  1SKR A;  4IFY A;  2FBX A;  3CM5 A;  4BE0 A;  4FLW A;  1VSI A;  3V81 A;  2OZM A;  1VSM A;  3KLE A;  2G8I A;  4CCH A;  3LWL A;  4FLV A;  4HCB A;  2FC0 A;  4CE9 A;  3CFR A;  4RG8 A;  5CZ1 A;  3SPY A;  3QIP A;  2Z1J A;  4BDZ A;  2OPS A;  3OYM A;  3NH2 A;  3VQ4 A;  4H8K A;  1S9E A;  4B9S A;  4FJN A;  2YHA A;  1TK8 A;  4Z4E A;  2IAJ A;  3AVM A;  3ZSV A;  1JLQ A;  3I0R A;  1YTA A;  1VRT A;  4DS4 A;  3SUQ A;  2WOM A;  4HVJ A;  2RN2 A;  3QEP A;  1NK4 A;  1L3S A;  4DTX A;  1N6Q A;  4W5N A;  5HLF A;  2BGG A;  4IFV A;  4NYN A;  3HVT A;  3QEV A;  3TAR A;  1JXB A;  2G8W A;  3LP3 A;  2QK9 A;  3U3Y A;  4DS5 A;  2BDP A;  4JRQ A;  2ATQ A;  3T3F A;  1HYZ A;  3M8P A;  3TAM A;  4Z4H A;  2QKK A;  4RW8 A;  2EHG A;  2F96 A;  3VA0 A;  1JL2 A;  4CGH A;  3BGR A;  1U45 A;  1D9D A;  3AO5 A;  1IH7 A;  4FZZ A;  3LP2 A;  2P51 A;  1A5W A;  4CGD A;  3V1O A;  2PZS A;  4CEO A;  1VRU A;  3QES A;  4GMJ B;  1NKC A;  2OPR A;  4CFB A;  3CYM A;  5DMR A;  3NF9 A;  3TAF A;  1TKX A;  1CZ9 A;  1WSH A;  3OYH A;  2XY6 A;  3AVH A;  4KTZ A;  5KTQ A;  1EP4 A;  4GW6 A;  3QEX A;  1RT2 A;  5HRP A;  4CJQ A;  3NGY A;  3AVC A;  4AHT A;  5CY4 A;  4CIE A;  4E7L A;  2FBY A;  1RTH A;  3K57 A;  4FXD A;  2IC3 A;  3AVJ A;  2OPP A;  4CGF A;  4KAZ A;  3HPG A;  5FRN A;  1CLQ A;  2XHB A;  3VA3 A;  1IKY A;  3QLH A;  3OYK A;  4FLU A;  4DU4 A;  4CFA A;  4B08 A;  4AHV A;  3CFO A;  2OYQ A;  3DI6 A;  4KB0 A;  1BGX T;  2KFN A;  3PY8 A;  3HJF A;  4FJ8 A;  4DSJ A;  1ASU A;  2D0A A;  3OY9 A;  1T7P A;  1C1C A;  4M3W A;  4FYD A;  2HMI A;  4W5T A;  4E0D A;  3SPZ A;  1NKE A;  1D9F A;  1O1W A;  1RBS A;  4FK2 A;  1Z25 A;  4OKE A;  5J2M A;  4CJF A;  1KTQ A;  3D45 A;  3EYZ A;  1B92 A;  1VSE A;  3K5O A;  1J54 A;  5FRO A;  3NH0 A;  3HPO A;  3OVN A;  4HUE A;  4KB1 A;  3O4N A;  3KJV A;  1U49 A;  5SWM A;  1B9F A;  4CHY A;  4BDP A;  1JLC A;  3LAK A;  4J2E A;  2RPI A;  5HBM A;  3VQ5 A;  3ZT3 A;  3QEW A;  3ZT4 A;  3VQ9 A;  3NE6 A;  2XY7 A;  3HL8 A;  3NBP A;  1HRH A;  4I9L A;  3NHG A;  1HYS A;  2QXF A;  2VG7 A;  4N41 A;  3AO4 A;  1GOA A;  3SQ4 A;  4LSN A;  3KLF A;  3KK2 A;  4I2P A;  4FLZ A;  1RBR A;  5CZ2 A;  4OGE A;  2F8T A;  4OKK A;  3H08 A;  3CFP A;  1KLN A;  4CEQ A;  3PO4 A;  4CIF A;  4RW9 A;  3K58 A;  1S1X A;  3NF6 A;  4ICL A;  4Z0U A;  4O0I A;  3LDS A;  3DLH A;  4DU1 A;  3V1Q A;  2I5J A;  3PO5 A;  3M8S A;  4OJR A;  4EZ6 A;  4F3O A;  3BDP A;  3DLB A;  4E89 A;  1XHZ A;  1D8Y A;  4CJ3 A;  3KK1 A;  1BHL A;  2BAN A;  2E6L A;  1QS4 A;  3OYC A;  4CEB A;  4FM2 A;  1HMV A;  3QIO A;  4O44 A;  3K5N A;  1X9M A;  1XWL A;  1D5A A;  3VQE A;  4G1Q A;  3LWM A;  3LPT A;  4FW1 A;  2HHQ A;  2HB5 A;  1FKO A;  2DTU A;  1JL1 A;  2RF2 A;  3ZT1 A;  4CJ4 A;  4OPJ A;  3OYB A;  1TL1 A;  3SQ1 A;  1HNV A;  2HHW A;  1JLG A;  1BL3 A;  2X78 A;  3LAL A;  4E19 A;  1ITG A;  1NKB A;  1RDC A;  3RMC A;  1S6P A;  4CF1 A;  1EXQ A;  1C1A A;  4CHO A;  1CXU A;  1SKS A;  4B9T A;  1L3V A;  2HVI A;  1NK6 A;  4ZHR A;  4KHW A;  3KIO A;  3RMA A;  4KI4 A;  4O5B A;  5J2P A;  4JS5 A;  3QO9 A;  4W5Q A;  5I42 A;  3TAN A;  1KFS A;  1XHX A;  4ELU A;  5D3G A;  2F8S A;  4DTN A;  3S3M A;  4RW7 A;  1LWC A;  1REV A;  1I3A A;  3SUO A;  3K5L A;  4BE1 A;  2HHV A;  3PX6 A;  2FBT A;  2IGI A;  1A5V A;  1C6V A;  1WAJ A;  3DMJ A;  3AO1 A;  1RT5 A;  4DTP A;  2KZZ A;  1TL3 A;  1RT4 A;  4E1M A;  1BIZ A;  2VG5 A;  4CJR A;  3AO2 A;  4M45 A;  3SYZ A;  2Z1G A;  4FLX A;  1C0M A;  1SKW A;  1KLM A;  1LW2 A;  4CFC A;  4E1N A;  4ID5 A;  5KI6 A;  3ZSY A;  3T19 A;  3LPU A;  5E41 A;  4KV8 A;  2ZD1 A;  3C6T A;  4H4M A;  1S1T A;  4EP5 A;  1RCH A;  3HM9 A;  3SV3 A;  2X6S A;  3KKS A;  3JSM A;  1HQU A;  3CG7 A;  4FJ9 A;  1JKH A;  2Z1I A;  2AJQ A;  2VG6 A;  4CGJ A;  1QTM A;  3U6F A;  3E01 A;  1TVR A;  4Q5V A;  4DSK A;  3NF7 A;  1C0T A;  5K14 A;  3AVN A;  3IRX A;  2OA8 A;  4H4O A;  3PX4 A;  2P1J A;  4M3R A;  3IAY A;  4KRF A;  3OYJ A;  4XIU A;  3K59 A;  4CES A;  3OYA A;  1X9S A;  4CJP A;  1BIS A;  1SV5 A;  4KHS A;  3FFI A;  3HPH A;  4FJG A;  3AO3 A;  4DG1 A;  4OKJ A;  4Y1D A;  4KFB A;  2IDO A;  1Q9X A;  1WSE A;  4N5S A;  4GVM A;  3K5M A;  1RBV A;  4AHC A;  1TK0 A; 
#chains in the Genus database with same CATH topology
 3AVB A;  4O5F A;  5AQQ A;  3O9Q A;  3CCU N;  3NFA A;  2O8F A;  3S3O A;  1GOC A;  3TU5 A;  4TSX A;  1TKD A;  3MN6 A;  1P8Z A;  1C0G A;  4KHU A;  3KK7 A;  2F9T A;  2I7N A;  5ADX A;  3SZ2 A;  4JHD A;  2P9P A;  3ZSW A;  2KZM A;  3O3F A;  4FK4 A;  3MXJ A;  4A59 A;  3KKR A;  1HNW K;  3TAE A;  4IKF A;  3V6D A;  2Q3S A;  3VQD A;  1FKP A;  1X3M A;  4B9U A;  1HNI A;  4GNI A;  5SZT A;  1RT7 A;  1K8K B;  1VQ4 N;  3HO1 A;  3CJA A;  3LP0 A;  4AIL C;  1LV5 A;  3QIN A;  3L2U A;  3RRH A;  1TAU A;  1W0H A;  2CGK A;  4FWK A;  2FSK A;  1IO2 A;  2ETJ A;  1NOY A;  4JD2 B;  2HHX A;  3L4Q A;  2ZWH A;  5HRR A;  2G8V A;  5JS2 A;  4YNQ A;  2Q36 A;  1JLA A;  1YJW N;  4JKE A;  3V9Z A;  4C23 A;  2E4L A;  3ZLJ A;  3Q7C A;  1NK9 A;  4B9Q A;  4LH5 A;  3WT0 A;  4CZM A;  4Q0B A;  1EKE A;  4MQ3 A;  2D0O A;  4W5R A;  4Z4F A;  4HUG A;  1LWF A;  1FXX A;  3AAR A;  1OH8 A;  1WBB A;  4DR6 K;  4CJ5 A;  5ELZ A;  2WON A;  3ZT0 A;  3LM9 A;  1DGK N;  3O3G A;  4C8O A;  4KKO A;  1LAW A;  1IG9 A;  4GV9 A;  3K9K A;  3DOL A;  4M3Y A;  5BRE A;  4JK9 A;  2ZQB A;  5HOO A;  4BRD A;  2YHX A;  1WLJ A;  2HF3 A;  2NRW A;  3RSE A;  4A2A A;  2YJE A;  3M8Q A;  4FLT A;  4F2R A;  2W41 A;  4FWS A;  4LSL A;  1U4B A;  3HM8 A;  2ASP A;  3SAG A;  4FJI A;  1CZA N;  2YNI A;  2QKB A;  4N47 A;  1VSD A;  1N5Y A;  1RNH A;  4FWP A;  3L2R A;  4UQG A;  1HPZ A;  1WSF A;  1KAY A;  3SMS A;  3CER A;  1TGO A;  4E3S A;  4CF0 A;  4E7K A;  4CEZ A;  4KHY A;  3M6G A;  2HVH A;  4JKC A;  1HQE A;  4RCH A;  1WAF A;  2P9L B;  3WXM B;  3KLI A;  1OVY A;  3U8X A;  1NK0 A;  5AQS A;  1Y64 A;  4DV7 K;  1ZYQ A;  4RW6 A;  4B3O A;  4B1X B;  1NJZ A;  5C2F A;  5F0X A;  3S41 A;  4CZJ A;  5HP1 A;  4LF5 K;  1IBK K;  3LM2 A;  4G9Z A;  1RTD A;  4BGB A;  4E1J A;  1VQ9 N;  4MFB A;  3H6E A;  4JKG A;  1DTT A;  1ZBU A;  3QIC A;  4DLG A;  3M8R A;  2RHK A;  1GLB G;  1U48 A;  3S9H A;  3NGZ A;  3C6H A;  3CPW M;  1NJY A;  3CQ8 A;  3KLG A;  4BRM A;  3CCM N;  1YTU A;  2DFE A;  4R5P A;  3KD1 E;  2ZE2 A;  3AVG A;  4CEA A;  1RBT A;  1I39 A;  3AAP A;  4DSI A;  3VEX A;  3VQ7 A;  3K9J A;  3MED A;  5AFU A;  4BRF A;  2JWK A;  3ZX2 A;  4HUF A;  1GOB A;  4CK1 A;  1Q9Y A;  4CF8 A;  4F8R A;  2Q2R A;  1ILY A;  3NAE A;  2XY5 A;  3L3V A;  1BA1 A;  5E84 A;  1BO5 O;  2E2P A;  3E1Y A;  1GLJ O;  2VCP A;  3NH1 A;  3I8D A;  1UOC A;  3DLR A;  1JLF A;  3UB5 A;  4BVO A;  2IS3 A;  3VEY A;  4CJE A;  5DM6 L;  1HKB A;  4AH9 A;  3K0S A;  4CZH A;  1U47 A;  2E2Q A;  2D1K A;  2P9I B;  3G0Z A;  5EXW A;  4DTR A;  2X6N A;  3SCX A;  3ITH A;  1J53 A;  3VQB A;  3CET A;  4B1W B;  4GY2 B;  4OVL A;  2OTJ N;  2QWQ A;  3ZEU B;  2YHB A;  4FWM A;  4JN4 A;  3CCQ N;  5AQF A;  4A62 A;  4CJL A;  1S1U A;  2E20 A;  1RDA A;  3EY1 A;  2A1S A;  3O3H A;  4KH5 A;  4CJU A;  4FM1 A;  2IVP A;  3NF8 A;  1LCU A;  3QER A;  4DFP A;  1HNX K;  3G71 N;  4H5W A;  2KHO A;  3CME N;  4WQ5 A;  4O8U A;  3CF5 L;  4FWL A;  4WE1 A;  2O8B B;  4Z4I A;  4PWD A;  2KQ2 A;  3VQ6 A;  4J2A A;  4DV2 K;  4EHU A;  4QAG A;  3TAB A;  2GUI A;  5HRS A;  1TV6 A;  1YT3 A;  4KI6 A;  4DCH A;  5ADX H;  3HXM A;  5AQY A;  4DTO A;  2ASO A;  4DTS A;  4NB4 A;  5BPM A;  3NVK A;  1SUQ A;  3D2F A;  3ID8 A;  1SKR A;  2OZM A;  1VSI A;  3A0I X;  1VAZ A;  3OTO K;  2G8I A;  5KPZ A;  4JNE A;  2FC0 A;  3CFR A;  3J7Y P;  5CZ1 A;  4WQ4 A;  1HUX A;  4I6M A;  2ZJP L;  1WBD A;  1S22 A;  1X3N A;  3T69 A;  5KQD A;  2P9U A;  2IAJ A;  3MN9 A;  2ZF5 O;  1YTA A;  1VRT A;  1NK4 A;  2E5L K;  1LOT B;  2P9L A;  3E9O A;  4YY3 K;  2BGG A;  4NYN A;  2QK9 A;  4DS5 A;  5EOY A;  1HYZ A;  4IZ9 A;  2F96 A;  4CGH A;  1U45 A;  1D9D A;  5EX5 A;  3TTC A;  2D0P A;  1A5W A;  4CGD A;  2J4R A;  2PZS A;  1E4G T;  4WFN L;  1FJG K;  4BR9 A;  1TKX A;  3QBW A;  3AVH A;  4YDU C;  2F7T A;  1VHX A;  2YX6 A;  4DQ8 A;  4CJQ A;  1K9M O;  3AVC A;  4CZL A;  5CY4 A;  3CCE N;  1U2V A;  3HPG A;  1T6C A;  4JI2 K;  3ZET B;  3P39 A;  1IBL K;  4BQL A;  1GLF O;  4JK7 A;  4KB0 A;  4IWV A;  1BGX T;  2KFN A;  4WYB A;  1IG8 A;  4M3W A;  4FYD A;  4E0D A;  1T44 A;  2P9S A;  3SPZ A;  4FK2 A;  4OO1 J;  4DV4 K;  4PHT X;  3EYZ A;  1B92 A;  4JEP A;  4GV6 A;  5SWM A;  1B9F A;  3KWG A;  2O8D A;  3LAK A;  3EN9 A;  4J2E A;  3R8E A;  3ZT4 A;  3HL8 A;  3NBP A;  3PLA A;  3IKM A;  2QXF A;  3CC4 N;  1GOA A;  3H1V X;  4IO9 L;  4FLZ A;  2NRZ A;  1RBR A;  4LF8 K;  4BR5 A;  3H08 A;  3CFP A;  3QB0 A;  2GEM A;  4CEQ A;  2NLX A;  4YDU A;  4FWN A;  3MCA B;  3LDS A;  5GIN A;  3DLH A;  3M8S A;  4C1N I;  1C0F A;  4F3O A;  3T7Z A;  1D8Y A;  3KK1 A;  2BAN A;  3AGR A;  4CEB A;  3R3L A;  3UKU B;  3QIO A;  3VQE A;  2O8C A;  3ID6 A;  4ISF A;  1HNV A;  3VPZ A;  3THY B;  4CF1 A;  1EXQ A;  4LF7 K;  1WOQ A;  3C7N A;  1L3V A;  3KIO A;  3HZ6 A;  4CZI A;  5I42 A;  1EQY A;  1KFS A;  1XHX A;  4ELU A;  5D3G A;  3VES A;  3O6W A;  4RW7 A;  3TSQ A;  1I3A A;  4V19 S;  1C6V A;  4LFC K;  3GOI A;  3GE1 A;  3DLL L;  3AO1 A;  3NVM A;  4DTP A;  2YHW A;  4IEI A;  2FF6 A;  4DR7 K;  5AQK A;  4CJR A;  3AO2 A;  5MLC Q;  4FLX A;  1SKW A;  4F4K A;  4CFC A;  3ZSY A;  4EP5 A;  4B3R K;  4FJ9 A;  3CG7 A;  1JKH A;  2AJQ A;  4CGJ A;  3E01 A;  4Q5V A;  4DSK A;  4MLE A;  5IT9 O;  5TKY A;  4DUY K;  2W6K A;  1BUP A;  4YOX A;  5LJW A;  3K59 A;  3OYA A;  1X9S A;  4CJP A;  1VQP N;  2O8B A;  2UYT A;  1RBV A;  4AHC A;  4MDB A;  3L6Q A;  2BE2 A;  1SS6 A;  1R0A A;  4DV0 K;  3CCR N;  5IWA K;  4OLA A;  4CZK A;  3GBT A;  5GAG P;  4C8L A;  1MDU B;  2W40 A;  1KRP A;  1JLE A;  2EX3 A;  3PSI A;  1WSI A;  1EX4 A;  3V9X A;  3ENH A;  1UA0 A;  4JI5 K;  3WEE B;  1WN7 A;  1Z26 A;  1WUA A;  1D4X A;  1Q82 O;  2QWL A;  1TK5 A;  3EE9 A;  3J80 O;  4BRC A;  1ZBS A;  3THX A;  3THX B;  4IEE A;  1IKW A;  1NK8 A;  3PUF A;  1R59 O;  4FJJ A;  4KBO A;  4DQP A;  4FZX C;  3MEC A;  2I7P A;  3OS2 A;  5I9E B;  2QEX N;  2Q1N A;  1QQO A;  4AM6 A;  4HTU A;  1VQN N;  1N32 K;  2V52 B;  2GBZ A;  3ZET A;  4KO0 A;  2O4G A;  2RE2 A;  4EAH D;  3P31 A;  5JS1 A;  2E1Y A;  4KTQ A;  4DU3 A;  4DFK A;  3BUZ B;  4ILH A;  2D0B A;  1J5O A;  1EO1 A;  4GV3 A;  1VK0 A;  5DK5 A;  5HRN A;  4FOE A;  3EE8 A;  4O0J A;  4FJM A;  1HR0 K;  3LAN A;  3FLC O;  2YKN A;  5JIC A;  2B4J A;  3SQ2 A;  4N76 A;  1OH6 A;  3A2F A;  4FL9 A;  4BRH A;  4PL7 A;  4OPK A;  4FVM A;  3EKU A;  4RW4 A;  3JXU A;  3G6E N;  1K8A O;  4ELT A;  1KVA A;  1NM1 A;  5JVG L;  3NCI A;  3QFU A;  4DQS A;  4NXN K;  2KTQ A;  4JKF A;  3WQT A;  3L8B A;  4YHH K;  1HKG A;  4B9V A;  4BWM A;  3AV9 A;  2HMP A;  4CEF A;  4CHN A;  4PUO A;  3OA9 A;  3OYL A;  3O9R A;  1GLL O;  3F73 A;  2VWJ A;  3LZJ A;  3C95 A;  4O4G A;  3DAW A;  2HW3 A;  1UAX A;  1KVB A;  1XNQ K;  1VSJ A;  4CER A;  1OH7 A;  5KPT A;  2Q0U A;  1RDU A;  3V1R A;  4CBX A;  1C0U A;  4FVU A;  3OYE A;  2OZS A;  2VGM A;  2R7Y A;  3P4I A;  3FZM A;  4OX9 K;  2FF3 B;  3TR8 A;  3MAQ A;  1TUY A;  3O1B A;  4AHR A;  3SLC A;  2E1Z A;  3VGM A;  1Y97 A;  3FZF A;  2HHU A;  4C8K A;  3KWI A;  3EL2 A;  5M1F A;  1DLO A;  3SBT A;  3CQX A;  3QET A;  3RR8 A;  1ZC6 A;  4JS4 A;  3EZ5 A;  3TPQ A;  4EZ9 A;  5FDL A;  4DTU A;  2BTF A;  3D0P A;  5BRD A;  5KPR A;  4BR0 A;  2FSN A;  3P38 A;  4IOA L;  2NUB A;  3IDH A;  2GWK A;  3F5T A;  3H3N O;  4DB3 A;  1YIJ N;  3OJU A;  1NNE A;  5FLX O;  3HP6 A;  3ASM A;  5BR9 A;  1RGI A;  2YHY A;  3WNE A;  5BPL A;  5BR8 K;  1WNS A;  3VQQ A;  4I6M B;  3AY9 A;  1X9J A;  3ENB A;  4M7Y A;  3ALY A;  2P9N A;  3M1F A;  1IKX A;  3OS0 A;  3A5O C;  2DY4 A;  1RDB A;  1RT6 A;  4N56 A;  1BCO A;  4QOZ B;  4JI3 K;  5AQM A;  4XEI A;  4CI6 A;  4K41 A;  3C6A A;  2GWJ A;  4CF2 A;  5C10 A;  1BQM A;  3A5L C;  3CCL N;  2YJF A;  2PYL A;  2A5X A;  3DYA A;  4QCL A;  3JAM O;  4M41 A;  3DRP A;  4FWO A;  4CK3 A;  1XNR K;  1YXQ A;  4KTW A;  5AQL A;  5FRM A;  3OYG A;  4FJL A;  2KFZ A;  5BN8 A;  4PA1 A;  1W7A A;  2YKM A;  3MWT A;  4PQU A;  1TKZ A;  2HHS A;  4OLB A;  4FCY A;  3TI0 A;  3OYN A;  1NWK A;  4FZY A;  3FGU A;  4DTM A;  3MWP A;  1VQL N;  2UUC K;  1S5J A;  1VQM N;  4B9L A;  2Y1J A;  3O8M A;  3EKS A;  4YOW A;  4CD1 A;  4DR5 K;  4CVN E;  1RT1 A;  3K2P A;  2RKI A;  3KD5 E;  3MEG A;  4BE2 A;  1VQ6 N;  1TUU A;  4BRO A;  2W42 A;  4OPH A;  3AVF A;  3CQY A;  4ZTJ A;  1RTJ A;  1SAZ A;  3RWU A;  3O1W A;  2ZJR L;  3BP8 A;  4KHN A;  3HOS A;  1ATR A;  3O4Q A;  4DWI A;  2IVO A;  3FE1 A;  1B9D A;  4O8K A;  3TTF A;  4EHT A;  2UXB K;  3HST B;  5T7B A;  4W5O A;  3B6P A;  4X62 K;  4A2B A;  1F21 A;  5M1O A;  1XMQ K;  2PAV A;  2CGL A;  3IMX A;  5AZI A;  3BEX A;  1TKT A;  1NMD A;  4FK0 A;  4IFY A;  3CM5 A;  4JKA A;  1VSM A;  4CCH A;  4HCB A;  2FLO A;  1NBW A;  2O8E A;  2Z1J A;  1Q18 A;  3OYM A;  3NH2 A;  2V51 B;  4BVP A;  4B9S A;  1YUW A;  2YHA A;  4JKG B;  2A41 A;  5AQZ A;  3AVM A;  3QEP A;  1L3S A;  4JAX A;  4HVJ A;  2RN2 A;  3O80 A;  4DTX A;  1N6Q A;  4W5N A;  3ZX3 A;  2QA4 N;  3ZEU A;  3ZYY X;  2G8W A;  2A6A A;  2ATQ A;  1JCG A;  5CE3 A;  3HOT A;  3BGR A;  4WQ5 C;  3AO5 A;  4FZZ A;  3VTI A;  2P51 A;  1Z6R A;  1TYQ A;  4GMJ B;  3CYM A;  5DMR A;  2P9I A;  4KTZ A;  3QEX A;  3VGL A;  1RT2 A;  3NGY A;  5BN9 A;  1RTH A;  3K57 A;  4DR2 K;  4CGF A;  1IKY A;  5CR4 A;  4DU4 A;  1HPM A;  3CFO A;  2OYQ A;  4IOC L;  4FOI A;  1C1C A;  4PKG A;  2CGJ A;  4AF1 A;  2D4W A;  4ISE A;  5J2M A;  3D45 A;  3K5O A;  2NNW A;  2WUS A;  1N33 K;  3KJV A;  2GX9 A;  4BDP A;  3WXJ A;  4JI6 K;  1QHA A;  1HRH A;  4CZF A;  1JCE A;  2GEL A;  3NHG A;  1GLE G;  3SQ4 A;  4NO7 A;  3I56 N;  2F8T A;  2QWN A;  2ITM A;  4MDA A;  4RW9 A;  3K58 A;  3NF6 A;  4Z0U A;  3V1Q A;  4IFE A;  4YOV A;  4B1Z A;  2P9N B;  4CJ3 A;  4FM2 A;  3OYC A;  2E6L A;  2P9U B;  3H46 O;  4LF4 K;  1HMV A;  3K5N A;  1XWL A;  1D5A A;  3M5R A;  3D2E B;  4H5N A;  3VET A;  4LFB K;  4M7X A;  4CJ4 A;  3SQ1 A;  1JLG A;  4E19 A;  3QML A;  1RDC A;  3MX5 A;  3CIP A;  5JLH A;  5FPE A;  3O9T A;  4KHW A;  3RMA A;  3KVG A;  3CCJ N;  1WB9 A;  4BRL A;  1S72 N;  4DTN A;  5GIO A;  1V4S A;  4JI8 K;  3BY5 A;  1A5V A;  1NG9 A;  3DMJ A;  2OAN A;  1RT5 A;  1TL3 A;  4YOR A;  1NGF A;  1BIZ A;  2VG5 A;  3B8A X;  3WXL A;  3FR0 A;  4EFH A;  1J5E K;  4H5T A;  1KLM A;  5E41 A;  1L5U A;  5KI6 A;  3LPU A;  4KV8 A;  4H4M A;  3WXK A;  1RCH A;  3DJC A;  2X6S A;  1HQU A;  4DV6 K;  2VG6 A;  1QTM A;  3U6F A;  3DXK B;  1TVR A;  3AVN A;  3IRX A;  2OA8 A;  3PX4 A;  3IAY A;  4KHP K;  3OYJ A;  4DV3 K;  2UXC K;  4NXM K;  1GLA G;  4N5S A;  4BRA A;  4IJN A;  3NDK A;  4KH4 A;  4K25 A;  3AVK A;  3C94 A;  3SJH A;  3VN5 A;  3MXI A;  4IDH A;  4Z4G A;  1TYQ B;  3IFR A;  1LWE A;  1ESV A;  4B1Y B;  4IG3 A;  3G25 A;  2O4I A;  1SL2 A;  4BRN A;  2VQE K;  1ATS A;  1YJN N;  3I8B A;  3U3G A;  3HT3 A;  3E66 A;  2HBK A;  1ZBH A;  1XC3 A;  3GL1 A;  1X1P A;  1H1V A;  1MWK A;  3TAP A;  4L8R B;  1XQS C;  3MCP A;  3VQC A;  4E7I A;  1BQN A;  1QVG M;  1NOZ A;  1TAQ A;  4KHQ A;  5B8H A;  1NGH A;  2B5J A;  3JYT A;  2HHT A;  3V9W A;  3MN5 A;  4CJK A;  1T05 A;  5C24 A;  3VEW A;  2JGU A;  4DQI A;  1BCM A;  3HTV A;  1JCF A;  3VF2 A;  3LP1 A;  4CW7 B;  5GAE P;  3HRG A;  3L2W A;  3DRS A;  5M1N A;  4ILG B;  2HNY A;  4CJV A;  1VSK A;  2YI1 A;  3PV8 A;  2CH6 A;  4M3T A;  4DSF A;  2PYJ A;  3FZL A;  4BR4 A;  3LDL A;  3LL3 A;  3UIQ A;  1YJ9 N;  2X74 A;  2HST A;  3AAQ A;  3VQ8 A;  4DLE A;  4WFB L;  3VQA A;  1IJJ A;  5CHI A;  4DTJ A;  4YFU A;  3LDO A;  4AHS A;  5F1X A;  3SV4 A;  3IUC A;  4E7H A;  3TAG A;  3OHR A;  1KCF A;  3V9S A;  1SQK A;  3AA5 X;  1RBU A;  3PIP L;  2GV9 A;  1A5X A;  3N4P A;  3BF3 A;  4NLB A;  4BC3 A;  4FSV A;  1GLC G;  3VOV A;  4F3T A;  5KQ8 A;  1JXE A;  2ZJQ L;  4LY7 A;  5BRF A;  3TWH A;  1M90 O;  1BOT O;  3P1G A;  4R79 A;  3P83 D;  4NYF A;  3EO3 A;  3MDQ A;  3CHW A;  4BR7 A;  3IS9 A;  4DMN A;  3G10 A;  4CF9 A;  4Y1C A;  4MLH A;  5AZI B;  3WNF A;  3ZSX A;  4BRI A;  1KQS M;  4IOX A;  4OPA A;  3VTH A;  3RMB A;  3AGK A;  2FSJ A;  3QNO A;  3ZT2 A;  4K43 A;  3SUP A;  2G8F A;  4CK2 A;  4H0X B;  3O9U A;  4EP4 A;  2P5O A;  4I9Q A;  2NRH A;  3QDK A;  1MA9 B;  1MU2 A;  5C12 A;  2ITG A;  3HYF A;  2OCE A;  1BI4 A;  3KZB A;  4H03 B;  4A61 A;  1UWB A;  4CD3 A;  4DQR A;  3FZK A;  1RT3 A;  5C42 A;  1ZBI A;  2NRT A;  4DFJ A;  3WNH A;  4DKW A;  3CC2 N;  2KLA A;  3QFP A;  1QQC A;  4H5V A;  4YOY A;  3THY A;  4ZTF A;  3I55 N;  3H1Q A;  4LD0 A;  3BZK A;  2DFH A;  2W6L A;  2O8C B;  3EZW A;  4X66 K;  3LZI A;  1IKV A;  3DLE A;  4NCA A;  3EEQ A;  5AR0 A;  3KK3 A;  3UE5 A;  4CHQ A;  3RRG A;  2YNF A;  5J2Q A;  4CEE A;  4C8N A;  1JJ2 M;  3SAF A;  3AVA A;  3DWL A;  3OBY A;  4BRG A;  1S1V A;  4QS9 A;  3AVI A;  4B9N A;  2FBV A;  5J2N A;  2PY5 A;  4FPB A;  4FJX A;  1J9A A;  1NMN A;  1XC9 A;  3BZC A;  2JLE A;  1C1B A;  4IBN A;  4IDK A;  1BA0 A;  5KGX A;  3RR7 A;  3WQU A;  4M3U A;  2WC9 A;  3OBW A;  2ZGY A;  4Z94 A;  4I7F A;  3SI6 A;  3F9K A;  4IG0 A;  4FM0 A;  4M42 A;  2XO7 A;  1ZBF A;  2E2O A;  1Q7Y O;  3BF1 A;  3CXC M;  3SQ0 A;  1YI2 N;  4IO8 A;  2KKZ A;  4BRP A;  2KW4 A;  5C2D A;  4BRK A;  4F9O A;  2G8U A;  2G8H A;  1NGE A;  4JRP A;  3DXM B;  3QNN A;  4I2Q A;  2Y1I A;  1O13 A;  1G15 A;  2Z1H A;  4JKB A;  4BRE A;  5JVH L;  5EY4 A;  4CJS A;  1U2V B;  5AQT A;  2A40 A;  2Q0R A;  5CYQ A;  3ZSQ A;  4H0V B;  1WSJ A;  2QM1 A;  3L2Q A;  1NK7 A;  2HBM A;  2P5G A;  1QSY A;  2IOC A;  1NJX A;  1T3V A;  5M1K A;  3ZSO A;  1HX1 A;  4K42 A;  2HNZ A;  3MEE A;  4F2S A;  1N36 K;  3VEV A;  2YNH A;  3AA4 A;  1ATN A;  2HBL A;  1E3M A;  5AQO A;  3CM6 A;  4NCG A;  4HCC A;  3C6U A;  4BRQ A;  4CEC A;  1WSG A;  4JI0 K;  4BC5 A;  2UU9 K;  3L3U A;  4J2D A;  4BE0 A;  2FBX A;  3V81 A;  4LFA K;  3LWL A;  4FLV A;  4CE9 A;  3THW A;  3QIP A;  3PSF A;  3VEN A;  4BDZ A;  2OPS A;  3O4W A;  5LY3 A;  3O5B A;  3VQ4 A;  4H8K A;  1NGI A;  4FJN A;  1TK8 A;  3ZSV A;  1JLQ A;  3I0R A;  4DS4 A;  2WOM A;  1RDW X;  1IV0 A;  4LC9 B;  1HNZ K;  3WEE A;  2HHH K;  5HLF A;  4IFV A;  4PKH A;  3HVT A;  3QEV A;  3TAR A;  1JXB A;  3LP3 A;  3VMF B;  3CI5 A;  3U3Y A;  2BDP A;  4JRQ A;  3M8P A;  2QKK A;  4Z4H A;  1NGA A;  2EHG A;  4DUZ K;  1JL2 A;  1KXP A;  4XH5 A;  3CJB A;  3LP2 A;  3QES A;  2OPR A;  5TKW A;  4CFB A;  3NF9 A;  3SBG A;  3RVC A;  3OYH A;  5KTQ A;  2Q31 A;  4CIE A;  2FBY A;  3CCS N;  3U9D A;  2IC3 A;  3AVJ A;  2OPP A;  5C0Y A;  4DR3 K;  1YHQ N;  2VQF K;  3VA3 A;  3MK6 A;  3QLH A;  3OYK A;  4FLU A;  4CFA A;  2P9P B;  4J8F A;  5E26 A;  3PY8 A;  3HJF A;  3VGK A;  3LDQ A;  2D0A A;  2NRX A;  4YOT A;  4DR1 K;  4W5T A;  1RBS A;  4OKE A;  1J54 A;  3FZH A;  3NH0 A;  3HPO A;  3OVN A;  1IBM K;  4XH1 A;  1EWQ A;  3O4N A;  2HBJ A;  4CHY A;  1HLU A;  1OH5 A;  4B3S K;  2RPI A;  3WUH A;  3ZT3 A;  4K0K K;  3VQ9 A;  4HTL A;  4WFA L;  3O9S A;  3AO4 A;  4BR2 A;  3KLF A;  2NZT A;  5GAH P;  5CZ2 A;  4OGE A;  4B1V A;  1KLN A;  3DXK A;  1OVQ A;  4UY8 O;  4ICL A;  4Y0W A;  1YIT N;  2I5J A;  4B3T K;  1NGJ A;  4EZ6 A;  3BDP A;  3DLB A;  3D7E O;  1KAZ A;  4E89 A;  5GAD P;  4JI4 K;  4FO0 A;  1QS4 A;  4AM7 A;  1X9M A;  1K73 O;  3MN7 A;  1P90 A;  4GKJ K;  5AFU H;  2O8E B;  2O8F B;  2DTU A;  1JL1 A;  2RF2 A;  3ZT1 A;  2HHW A;  4OPJ A;  3OW2 M;  3G4S N;  2X78 A;  2AP1 A;  5FPM A;  1NU0 A;  4BC2 A;  1S6P A;  3CD6 N;  1C1A A;  4JHD B;  1SKS A;  4B9T A;  1NK6 A;  4ZHR A;  4KI4 A;  4O5B A;  5J2P A;  2A3Z A;  3QO9 A;  5AQW A;  5AJ3 K;  3SAH A;  3CMA N;  3S3M A;  1LWC A;  5AQU A;  3SUO A;  3R9P A;  3K5L A;  2HHV A;  2FBT A;  2IGI A;  5AQN A;  1WAJ A;  2KZZ A;  1RT4 A;  3PIO L;  5BRH A;  4M45 A;  3SYZ A;  2Z1G A;  2VYP A;  3SK3 A;  1C0M A;  5AQH A;  3T19 A;  2UUA K;  2ZD1 A;  1NGB A;  4C1N K;  4L3Q A;  2CH5 A;  2DPN A;  3WXI A;  3VF6 A;  3U9Z A;  5C15 A;  4H4O A;  2P1J A;  2WFB A;  5M1P A;  2P9K A;  2V7Y A;  4CES A;  1BIS A;  1SV5 A;  4KHS A;  3HPH A;  4FJG A;  3AO3 A;  4DG1 A;  1T6D A;  1NGC A;  4Y1D A;  1MWM A;  2IDO A;  1Q9X A;  1WSE A;  3W0L A;  3L4I A;  1G99 A;  2WTU A;  3A5N C;  4BAC A;  2QW9 A;  3LDN A;  4MO4 A;  3RSE B;  3U4L A;  5GIP A;  2E2N A;  4DF4 A;  5A2Q O;  4DF8 A;  3S3N A;  2QXL A;  3CJ9 A;  4FLY A;  4CGG A;  3QEI A;  1RFQ A;  2XY8 A;  1J6Z A;  2VGN A;  2EWS A;  4CIG A;  4BDY A;  3PX0 A;  1XMO K;  3MXM A;  2H3G X;  3CJC A;  1LAV A;  5J1E A;  3H3O B;  2ZGZ A;  3R1X A;  4RWT A;  3OJS A;  1KFD A;  5BPN A;  3D2F B;  1ASV A;  3OYD A;  2HND A;  5LL6 Z;  4AQY K;  3AVL A;  4DV1 K;  5AQV A;  4FJ7 A;  1KD1 O;  1VSL A;  3C0B A;  1ZBL A;  2XRI A;  4BG8 A;  4JLH A;  4H0T B;  2QWO A;  4FJH A;  4JD2 A;  3WNG A;  3ULE A;  4BC4 A;  1VQ5 N;  2OPQ A;  3SJJ A;  3ISN C;  3ULD A;  3JS6 A;  3IG1 A;  2PFU A;  5KRS A;  3KTQ A;  1RDD A;  2E6M A;  4CJW A;  4CJT A;  1JLB A;  1XUP O;  2F9W A;  4QS7 A;  3VEO A;  3DRR A;  4JKH A;  1VSH A;  3CJ1 A;  4AHU A;  2WBN A;  3L2V A;  4CHP A;  3OYI A;  2QWR A;  4LH4 A;  4PL8 A;  1K8K A;  5KRT A;  3TTD A;  2A1R A;  4CED A;  1NJI O;  3NGI A;  3THV A;  2UXD K;  2BH1 A;  1U04 A;  3DOK A;  3LAM A;  5AQG A;  2LSN A;  3RMD A;  1QQM A;  4DQQ A;  4O55 A;  3HP9 A;  2O8D B;  3M3Z A;  5HL7 L;  1DKG D;  4HWI A;  4ID1 A;  4C8M A;  2VWK A;  5FPN A;  2V7Z A;  4HHT A;  1SL1 A;  1NJW A;  1CXQ A;  1YVN A;  2PBD A;  2YV0 X;  2P9S B;  4CHZ A;  3AA2 A;  4DSE A;  5H1S Q;  4PY5 A;  3OYF A;  3N4Q A;  1BIU A;  2JWL A;  4CGI A;  4JK8 A;  4BWJ A;  3D6R A;  1K6Y A;  1RTI A;  4FJ5 A;  3T1A A;  1QE1 A;  1ZXO A;  4B9M A;  1VSF A;  4J2B A;  1KAX A;  4KRE A;  3F9M A;  4K8X A;  1FK9 A;  3VQP A;  5CYM A;  3I0S A;  3OS1 A;  5I3U A;  3CCV N;  1LW0 A;  5M1Q A;  2YNG A;  3DLK A;  2QTD A;  2ZM6 K;  1ASW A;  4A5B A;  3CC7 N;  1S3X A;  1L3T A;  3ATV A;  5JMV A;  2DFF A;  1S1W A;  1E4F T;  4JI1 K;  3ENO A;  3P5J A;  1QZ5 A;  3ZCM A;  1BU6 O;  2E88 A;  1UA1 A;  4FJK A;  1QSL A;  3V4I A;  3C65 A;  3DXM A;  1VQO N;  4Z4C A;  3SNN A;  3ATU A;  4GVE A;  3E9P A;  3HSC A;  2A42 A;  2E8A A;  5EU7 A;  5KGW A;  1QHT A;  3HK2 A;  5F2R A;  4M3X A;  2F4V K;  1X9W A;  3V9U A;  4E7J A;  1L3U A;  2HF4 A;  1OKJ A;  1T8E A;  4M3Z A;  1S9G A;  1U6Z A;  4KPY A;  2IIR A;  3QBX A;  2ASM A;  4B8C A;  1RIL A;  1YVU A;  1SZ2 A;  4FW2 A;  5C25 A;  4H5R A;  3O08 A;  1QSS A;  4H0P A;  1KC8 O;  2FXU A;  3HVR A;  3DM2 A;  1SL0 A;  3L0Q A;  3J7A P;  1T03 A;  2B6A A;  4BQZ A;  3DLG A;  4DSL A;  3UKR B;  4RTF D;  1EET A;  3A8Y A;  4B8A B;  4NLC A;  1HJO A;  3I33 A;  1HYV A;  4WQ4 C;  1N34 K;  1HJR A;  3ZX0 A;  1W97 L;  1N8R O;  4H0Y B;  1S6Q A;  2VWB A;  1KSP A;  2D0C A;  3VER A;  3HBT A;  4IXC A;  3RTV A;  1DEJ A;  3B6O A;  3ZSR A;  4CFD A;  4K8Z A;  4DR4 K;  2G8K A;  3AA3 A;  1CZB A;  5AQX A;  2BUP A;  3MMV A;  3TAQ A;  1BI4 B;  3E9L A;  1NK5 A;  5HRO A;  4XH4 A;  1KVC A;  3THW B;  4QS8 A;  1W9H A;  4FWQ A;  4YOU A;  1NGD A;  5AQR A;  4WF9 L;  4KH6 A;  4BGA A;  4EIA A;  4ISG A;  4WCE L;  3SUN A;  4OGC A;  4ELV A;  1DT9 A;  4DFM A;  3GG4 A;  4X64 K;  2D5R A;  3KLH A;  1DTQ A;  1Q8I A;  3ZSZ A;  4U67 L;  4A5A A;  1XI1 A;  4FLW A;  4DV5 K;  3KLE A;  2P9K B;  4H0O A;  3SPY A;  4RG8 A;  1HKC A;  4CBW A;  3J8A A;  3W3D A;  4IJA A;  1S9E A;  2GTD A;  5FPD A;  2NRR A;  4Z4E A;  3KHY A;  3SUQ A;  4DHY A;  1EWR A;  4FWR A;  1W2B M;  3F2K A;  3GDQ A;  4U7B A;  1YF5 L;  1VQ8 N;  4CZE A;  3T3F A;  3TAM A;  4RW8 A;  3CJ7 A;  3VA0 A;  3HI0 A;  1IH7 A;  3V1O A;  4CEO A;  1VRU A;  4LF9 K;  2QWM A;  1NKC A;  2HOE A;  2GUP A;  2XY6 A;  3TAF A;  4B1U B;  1CZ9 A;  1WSH A;  3VEZ A;  2UUB K;  1EP4 A;  4GW6 A;  2YCH A;  4LF6 K;  5HRP A;  4AHT A;  1M1K O;  4E7L A;  1QVF M;  4ILJ A;  2IVN A;  4FXD A;  5FRN A;  5JLF A;  1I94 K;  4A57 A;  4KAZ A;  1CLQ A;  2XHB A;  3Q7B A;  5LMN K;  4MO5 A;  4FPA A;  3UKU A;  2NRV A;  4B08 A;  4AHV A;  4JI7 K;  3DI6 A;  3T1H K;  3H45 C;  3TSP A;  4FJ8 A;  4DSJ A;  1ASU A;  1Z05 A;  4JV5 K;  3OY9 A;  1T7P A;  2HMI A;  1Q86 O;  1Q81 O;  1NKE A;  1D9F A;  5DM7 L;  1O1W A;  1Z25 A;  4CJF A;  1BWF O;  1KTQ A;  5AQJ A;  5AZJ B;  1VSE A;  5FRO A;  4B3M K;  4HUE A;  4JKD A;  4KB1 A;  1U49 A;  3NMU A;  2QI2 A;  4X65 K;  1JLC A;  3T1Y K;  3R6M A;  3TSU A;  5HBM A;  3VQ5 A;  3UKR A;  3QEW A;  3NE6 A;  2XY7 A;  4CJ7 A;  3FFK B;  4I9L A;  1HYS A;  2VG7 A;  3SMP A;  4N41 A;  4LSN A;  3KK2 A;  3ULE B;  4I2P A;  1QZ6 A;  4OKK A;  4BG9 A;  3A5M C;  3D2E A;  3PO4 A;  4CIF A;  1S1X A;  4O0I A;  3MX2 A;  4DU1 A;  4GKK K;  3PO5 A;  2Q97 A;  5LJV A;  5EVZ A;  4OJR A;  3VF4 A;  1XHZ A;  1BHL A;  1NLV A;  4O44 A;  1QQN A;  3LWM A;  4G1Q A;  1YAG A;  3LPT A;  4FW1 A;  4CBU A;  2HHQ A;  2HB5 A;  2QWP A;  1FKO A;  3OYB A;  5AQP A;  1TL1 A;  1BL3 A;  3LAL A;  1ITG A;  1NKB A;  3RMC A;  4CHO A;  1CXU A;  2HVI A;  3C7N B;  3CPE A;  4BY9 C;  4JS5 A;  1FW6 A;  4W5Q A;  3TAN A;  2F8S A;  1VQ7 N;  1REV A;  4BE1 A;  5AZJ A;  3PX6 A;  1NGG A;  4CZG A;  4E1M A;  3J81 O;  4M63 C;  3J7Z O;  1VQK N;  1LW2 A;  4E1N A;  4NCB A;  4ID5 A;  3C6T A;  3HM9 A;  1S1T A;  4PKI A;  3SV3 A;  3KKS A;  3JSM A;  2Z1I A;  4JYA K;  3NF7 A;  1C0T A;  5K14 A;  5LMU K;  5AQI A;  4M3R A;  4KRF A;  3LDP A;  1BG3 A;  4XIU A;  2AA4 A;  3FFI A;  1V4T A;  4OKJ A;  1GLD G;  4KFB A;  1BDG A;  2OTL N;  4GVM A;  3K5M A;  1TK0 A; 
#chains in the Genus database with same CATH homology
 3AVB A;  3AVK A;  3C94 A;  3VN5 A;  3MXI A;  4Z4G A;  2BE2 A;  1R0A A;  3NFA A;  4BAC A;  4DF4 A;  4OLA A;  1LWE A;  3S3O A;  4C8L A;  4DF8 A;  4IG3 A;  1GOC A;  3S3N A;  4TSX A;  1TKD A;  1JLE A;  1KRP A;  2O4I A;  2EX3 A;  1SL2 A;  4KHU A;  1WSI A;  1EX4 A;  4FLY A;  3V9X A;  3U3G A;  4CGG A;  3SZ2 A;  3QEI A;  3HT3 A;  2XY8 A;  3ZSW A;  1UA0 A;  2KZM A;  3O3F A;  4FK4 A;  3MXJ A;  3NDK A;  3KKR A;  1ZBH A;  1WN7 A;  1Z26 A;  3TAE A;  4IKF A;  1X1P A;  3V6D A;  4CIG A;  4BDY A;  3PX0 A;  3TAP A;  1TK5 A;  4L8R B;  2Q3S A;  3VQD A;  3VQC A;  4E7I A;  1FKP A;  1BQN A;  3MXM A;  1NOZ A;  1TAQ A;  1HNI A;  4B9U A;  5SZT A;  1IKW A;  1LAV A;  5J1E A;  1NK8 A;  4KHQ A;  1RT7 A;  2B5J A;  3HO1 A;  3JYT A;  3PUF A;  2HHT A;  3LP0 A;  3V9W A;  4FJJ A;  4AIL C;  1LV5 A;  3QIN A;  4DQP A;  3OJS A;  4CJK A;  1KFD A;  4FZX C;  3MEC A;  3L2U A;  3RRH A;  1T05 A;  1ASV A;  1TAU A;  3OYD A;  2HND A;  3OS2 A;  5C24 A;  4FK0 A;  3AVL A;  1W0H A;  2JGU A;  4DQI A;  1BCM A;  4FJ7 A;  1VSL A;  3LP1 A;  4HTU A;  3L2W A;  3DRS A;  2XRI A;  1IO2 A;  2GBZ A;  1ZBL A;  2ETJ A;  2HNY A;  4CJV A;  1VSK A;  4JLH A;  2O4G A;  4KO0 A;  1NOY A;  4FJH A;  3PV8 A;  2HHX A;  3WNG A;  5JS1 A;  4KTQ A;  5HRR A;  2OPQ A;  3SJJ A;  2G8V A;  3ISN C;  5JS2 A;  3ULD A;  4M3T A;  4YNQ A;  4DU3 A;  1JLA A;  4DFK A;  3IG1 A;  3V9Z A;  4DSF A;  5KRS A;  2E4L A;  2PYJ A;  1RDD A;  3KTQ A;  2E6M A;  2D0B A;  4CJW A;  4CJT A;  1J5O A;  1NK9 A;  3UIQ A;  2X74 A;  3VQ8 A;  4LH5 A;  1JLB A;  4DLE A;  3VQA A;  1VK0 A;  3DRR A;  4Q0B A;  1L5U A;  5DK5 A;  1VSH A;  5HRN A;  4AHU A;  1EKE A;  4MQ3 A;  3L2V A;  4DTJ A;  4CHP A;  3OYI A;  4O0J A;  4YFU A;  4W5R A;  4LH4 A;  4Z4F A;  4HUG A;  4FJM A;  1LWF A;  1FXX A;  4AHS A;  5KRT A;  3SV4 A;  3LAN A;  4CJ5 A;  2YKN A;  2B4J A;  3SQ2 A;  4CED A;  2A1R A;  3NGI A;  3THV A;  4N76 A;  3A2F A;  3LAM A;  1U04 A;  3DOK A;  2WON A;  4FVM A;  4OPK A;  3ZT0 A;  4E7H A;  3TAG A;  1KCF A;  2LSN A;  3O3G A;  3V9S A;  4KKO A;  4C8O A;  3RMD A;  1LAW A;  1IG9 A;  3AA5 X;  4RW4 A;  1RBU A;  4O55 A;  4DQQ A;  3DOL A;  3HP9 A;  4M3Y A;  4ELT A;  2GV9 A;  1A5X A;  1KVA A;  2ZQB A;  3NCI A;  1WLJ A;  4DQS A;  2KTQ A;  3L8B A;  4B9V A;  4BWM A;  3AV9 A;  4ID1 A;  4F3T A;  4C8M A;  4CEF A;  2VWK A;  1JXE A;  4CHN A;  4LY7 A;  3M8Q A;  4FLT A;  4PUO A;  4HHT A;  1SL1 A;  3OYL A;  3TWH A;  1NJW A;  4F2R A;  4LSL A;  1CXQ A;  1U4B A;  2YV0 X;  3F73 A;  4CHZ A;  2VWJ A;  3P1G A;  3LZJ A;  3P83 D;  4NYF A;  3C95 A;  3AA2 A;  4O4G A;  4DSE A;  4FJI A;  4PY5 A;  2YNI A;  3OYF A;  3IS9 A;  2QKB A;  2HW3 A;  1UAX A;  1BIU A;  1KVB A;  3G10 A;  4DMN A;  4N47 A;  4CF9 A;  4Y1C A;  1VSD A;  3WNF A;  4CGI A;  1VSJ A;  3ZSX A;  1N5Y A;  4BWJ A;  1RNH A;  4CER A;  3L2R A;  4UQG A;  3RMB A;  1K6Y A;  1HPZ A;  1WSF A;  1RTI A;  4FJ5 A;  3V1R A;  1C0U A;  1TGO A;  3T1A A;  3OYE A;  2OZS A;  1QE1 A;  4E3S A;  2R7Y A;  4CF0 A;  3QNO A;  4B9M A;  4E7K A;  3ZT2 A;  3TR8 A;  3MAQ A;  1VSF A;  4J2B A;  4CEZ A;  4KHY A;  4KRE A;  4AHR A;  3SUP A;  4K8X A;  2HVH A;  2G8F A;  1FK9 A;  1HQE A;  3VQP A;  5CYM A;  3I0S A;  3OS1 A;  4CK2 A;  5I3U A;  1WAF A;  4EP4 A;  1Y97 A;  3KLI A;  2P5O A;  1LW0 A;  2HHU A;  4C8K A;  4I9Q A;  2YNG A;  1NK0 A;  3DLK A;  1DLO A;  1ASW A;  3QET A;  1L3T A;  1MU2 A;  2ITG A;  3HYF A;  1ZYQ A;  3RR8 A;  2DFF A;  1S1W A;  4RW6 A;  4B3O A;  1BI4 A;  3P5J A;  4JS4 A;  3EZ5 A;  1NJZ A;  4EZ9 A;  5FDL A;  1UWB A;  4DTU A;  4DQR A;  3ZCM A;  1RT3 A;  3D0P A;  5C42 A;  1ZBI A;  5HP1 A;  4DFJ A;  3WNH A;  1UA1 A;  4FJK A;  1QSL A;  3V4I A;  1QQC A;  1RTD A;  2NUB A;  4ZTF A;  4Z4C A;  3SNN A;  3OJU A;  4LD0 A;  4F4K A;  5EU7 A;  4MFB A;  2DFH A;  3ASM A;  5KGW A;  3HP6 A;  1QHT A;  3HK2 A;  1DTT A;  3WNE A;  1ZBU A;  4DLG A;  3M8R A;  4M3X A;  1WNS A;  3LZI A;  1X9W A;  3VQQ A;  1U48 A;  1IKV A;  3DLE A;  3V9U A;  4E7J A;  3S9H A;  3KK3 A;  3NGZ A;  3ALY A;  4CHQ A;  4J2D A;  4NCA A;  1L3U A;  3RRG A;  1IKX A;  1NJY A;  3OS0 A;  3CQ8 A;  3KLG A;  2YNF A;  2DY4 A;  1YTU A;  5J2Q A;  1RDB A;  2DFE A;  1T8E A;  4R5P A;  4CEE A;  2ZE2 A;  3AVG A;  1RT6 A;  4C8N A;  4CEA A;  4N56 A;  1S9G A;  1BCO A;  3KD1 E;  4KPY A;  1RBT A;  1I39 A;  4QOZ B;  4DSI A;  3VQ7 A;  3AVA A;  3MED A;  1Q9Y A;  4HUF A;  1GOB A;  1S1V A;  4B8C A;  1RIL A;  4CK1 A;  1YVU A;  4CF8 A;  4FW2 A;  5C25 A;  3AVI A;  1QSS A;  4B9N A;  4CF2 A;  4F8R A;  2FBV A;  5J2N A;  3NAE A;  1BQM A;  2XY5 A;  2PY5 A;  3L3V A;  3HVR A;  3DM2 A;  2PYL A;  4FJX A;  1J9A A;  3DYA A;  1SL0 A;  4QCL A;  1XC9 A;  1T03 A;  3NH1 A;  2B6A A;  4M41 A;  2JLE A;  1C1B A;  1UOC A;  3DLR A;  1JLF A;  3DLG A;  3DRP A;  4IBN A;  4IDK A;  4CK3 A;  5KGX A;  3RR7 A;  4DSL A;  4M3U A;  2IS3 A;  4CJE A;  1EET A;  4KTW A;  4AH9 A;  5FRM A;  4B8A B;  3OYG A;  1U47 A;  4I7F A;  3SI6 A;  3F9K A;  4FJL A;  2KFZ A;  1HYV A;  4IG0 A;  3G0Z A;  4PA1 A;  4FM0 A;  2YKM A;  4PQU A;  4M42 A;  2XO7 A;  1TKZ A;  2HHS A;  1ZBF A;  4OLB A;  4DTR A;  2X6N A;  4FCY A;  1HJR A;  3SCX A;  3SQ0 A;  3ITH A;  3TI0 A;  3OYN A;  1J53 A;  3VQB A;  4FZY A;  2KW4 A;  1S6Q A;  4DTM A;  4OVL A;  1KSP A;  2D0C A;  2G8U A;  3RTV A;  2G8H A;  3B6O A;  3ZSR A;  4CFD A;  2YHB A;  4K8Z A;  1S5J A;  4JRP A;  4B9L A;  2Y1J A;  4CJL A;  4I2Q A;  1S1U A;  3QNN A;  2Y1I A;  2G8K A;  1RDA A;  1G15 A;  3AA3 A;  2A1S A;  1CZB A;  2Z1H A;  3O3H A;  3EY1 A;  4CJU A;  1RT1 A;  4FM1 A;  3K2P A;  3NF8 A;  2RKI A;  3KD5 E;  3QER A;  3MEG A;  4CJS A;  4DFP A;  4BE2 A;  3TAQ A;  1BI4 B;  5CYQ A;  1NK5 A;  3ZSQ A;  2W42 A;  1WSJ A;  5HRO A;  3AVF A;  4M3Z A;  3L2Q A;  4ZTJ A;  1KVC A;  1RTJ A;  1NK7 A;  4WE1 A;  3RWU A;  1W9H A;  2P5G A;  4Z4I A;  4PWD A;  2KQ2 A;  3VQ6 A;  4J2A A;  4KHN A;  1QSY A;  2IOC A;  1NJX A;  3O4Q A;  4QAG A;  3TAB A;  3ZSO A;  2GUI A;  4DWI A;  5HRS A;  3I8D A;  1B9D A;  1TV6 A;  2HNZ A;  3MEE A;  1YT3 A;  4F2S A;  4KI6 A;  2YNH A;  3HXM A;  3AA4 A;  4OGC A;  3SUN A;  3HST B;  5T7B A;  4DTO A;  4W5O A;  3B6P A;  4ELV A;  1F21 A;  3CM6 A;  4NCG A;  4HCC A;  4DTS A;  3C6U A;  4DFM A;  2D5R A;  3KLH A;  4CEC A;  1WSG A;  1DTQ A;  1Q8I A;  3ZSZ A;  4NCB A;  1SUQ A;  1TKT A;  3L3U A;  1XI1 A;  1SKR A;  4IFY A;  2FBX A;  3CM5 A;  4BE0 A;  4FLW A;  1VSI A;  3V81 A;  2OZM A;  1VSM A;  3KLE A;  2G8I A;  4CCH A;  3LWL A;  4FLV A;  4HCB A;  2FC0 A;  4CE9 A;  3CFR A;  4RG8 A;  5CZ1 A;  3SPY A;  3QIP A;  2Z1J A;  4BDZ A;  2OPS A;  3OYM A;  3NH2 A;  3VQ4 A;  4H8K A;  1S9E A;  4B9S A;  4FJN A;  2YHA A;  1TK8 A;  4Z4E A;  2IAJ A;  3AVM A;  3ZSV A;  1JLQ A;  3I0R A;  1YTA A;  1VRT A;  4DS4 A;  3SUQ A;  2WOM A;  4HVJ A;  2RN2 A;  3QEP A;  1NK4 A;  1L3S A;  4DTX A;  1N6Q A;  4W5N A;  5HLF A;  2BGG A;  4IFV A;  4NYN A;  3HVT A;  3QEV A;  3TAR A;  1JXB A;  2G8W A;  3LP3 A;  2QK9 A;  3U3Y A;  4DS5 A;  2BDP A;  4JRQ A;  2ATQ A;  3T3F A;  1HYZ A;  3M8P A;  3TAM A;  4Z4H A;  2QKK A;  4RW8 A;  2EHG A;  2F96 A;  3VA0 A;  1JL2 A;  4CGH A;  3BGR A;  1U45 A;  1D9D A;  3AO5 A;  1IH7 A;  4FZZ A;  3LP2 A;  2P51 A;  1A5W A;  4CGD A;  3V1O A;  2PZS A;  4CEO A;  1VRU A;  3QES A;  4GMJ B;  1NKC A;  2OPR A;  4CFB A;  3CYM A;  5DMR A;  3NF9 A;  3TAF A;  1TKX A;  1CZ9 A;  1WSH A;  3OYH A;  2XY6 A;  3AVH A;  4KTZ A;  5KTQ A;  1EP4 A;  4GW6 A;  3QEX A;  1RT2 A;  5HRP A;  4CJQ A;  3NGY A;  3AVC A;  4AHT A;  5CY4 A;  4CIE A;  4E7L A;  2FBY A;  1RTH A;  3K57 A;  4FXD A;  2IC3 A;  3AVJ A;  2OPP A;  4CGF A;  4KAZ A;  3HPG A;  5FRN A;  1CLQ A;  2XHB A;  3VA3 A;  1IKY A;  3QLH A;  3OYK A;  4FLU A;  4DU4 A;  4CFA A;  4B08 A;  4AHV A;  3CFO A;  2OYQ A;  3DI6 A;  4KB0 A;  1BGX T;  2KFN A;  3PY8 A;  3HJF A;  4FJ8 A;  4DSJ A;  1ASU A;  2D0A A;  3OY9 A;  1T7P A;  1C1C A;  4M3W A;  4FYD A;  2HMI A;  4W5T A;  4E0D A;  3SPZ A;  1NKE A;  1D9F A;  1O1W A;  1RBS A;  4FK2 A;  1Z25 A;  4OKE A;  5J2M A;  4CJF A;  1KTQ A;  3D45 A;  3EYZ A;  1B92 A;  1VSE A;  3K5O A;  1J54 A;  5FRO A;  3NH0 A;  3HPO A;  3OVN A;  4HUE A;  4KB1 A;  3O4N A;  3KJV A;  1U49 A;  5SWM A;  1B9F A;  4CHY A;  4BDP A;  1JLC A;  3LAK A;  4J2E A;  2RPI A;  5HBM A;  3VQ5 A;  3ZT3 A;  3QEW A;  3ZT4 A;  3VQ9 A;  3NE6 A;  2XY7 A;  3HL8 A;  3NBP A;  1HRH A;  4I9L A;  3NHG A;  1HYS A;  2QXF A;  2VG7 A;  4N41 A;  3AO4 A;  1GOA A;  3SQ4 A;  4LSN A;  3KLF A;  3KK2 A;  4I2P A;  4FLZ A;  1RBR A;  5CZ2 A;  4OGE A;  2F8T A;  4OKK A;  3H08 A;  3CFP A;  1KLN A;  4CEQ A;  3PO4 A;  4CIF A;  4RW9 A;  3K58 A;  1S1X A;  3NF6 A;  4ICL A;  4Z0U A;  4O0I A;  3LDS A;  3DLH A;  4DU1 A;  3V1Q A;  2I5J A;  3PO5 A;  3M8S A;  4OJR A;  4EZ6 A;  4F3O A;  3BDP A;  3DLB A;  4E89 A;  1XHZ A;  1D8Y A;  4CJ3 A;  3KK1 A;  1BHL A;  2BAN A;  2E6L A;  1QS4 A;  3OYC A;  4CEB A;  4FM2 A;  1HMV A;  3QIO A;  4O44 A;  3K5N A;  1X9M A;  1XWL A;  1D5A A;  3VQE A;  4G1Q A;  3LWM A;  3LPT A;  4FW1 A;  2HHQ A;  2HB5 A;  1FKO A;  2DTU A;  1JL1 A;  2RF2 A;  3ZT1 A;  4CJ4 A;  4OPJ A;  3OYB A;  1TL1 A;  3SQ1 A;  1HNV A;  2HHW A;  1JLG A;  1BL3 A;  2X78 A;  3LAL A;  4E19 A;  1ITG A;  1NKB A;  1RDC A;  3RMC A;  1S6P A;  4CF1 A;  1EXQ A;  1C1A A;  4CHO A;  1CXU A;  1SKS A;  4B9T A;  1L3V A;  2HVI A;  1NK6 A;  4ZHR A;  4KHW A;  3KIO A;  3RMA A;  4KI4 A;  4O5B A;  5J2P A;  4JS5 A;  3QO9 A;  4W5Q A;  5I42 A;  3TAN A;  1KFS A;  1XHX A;  4ELU A;  5D3G A;  2F8S A;  4DTN A;  3S3M A;  4RW7 A;  1LWC A;  1REV A;  1I3A A;  3SUO A;  3K5L A;  4BE1 A;  2HHV A;  3PX6 A;  2FBT A;  2IGI A;  1A5V A;  1C6V A;  1WAJ A;  3DMJ A;  3AO1 A;  1RT5 A;  4DTP A;  2KZZ A;  1TL3 A;  1RT4 A;  4E1M A;  1BIZ A;  2VG5 A;  4CJR A;  3AO2 A;  4M45 A;  3SYZ A;  2Z1G A;  4FLX A;  1C0M A;  1SKW A;  1KLM A;  1LW2 A;  4CFC A;  4E1N A;  4ID5 A;  5KI6 A;  3ZSY A;  3T19 A;  3LPU A;  5E41 A;  4KV8 A;  2ZD1 A;  3C6T A;  4H4M A;  1S1T A;  4EP5 A;  1RCH A;  3HM9 A;  3SV3 A;  2X6S A;  3KKS A;  3JSM A;  1HQU A;  3CG7 A;  4FJ9 A;  1JKH A;  2Z1I A;  2AJQ A;  2VG6 A;  4CGJ A;  1QTM A;  3U6F A;  3E01 A;  1TVR A;  4Q5V A;  4DSK A;  3NF7 A;  1C0T A;  5K14 A;  3AVN A;  3IRX A;  2OA8 A;  4H4O A;  3PX4 A;  2P1J A;  4M3R A;  3IAY A;  4KRF A;  3OYJ A;  4XIU A;  3K59 A;  4CES A;  3OYA A;  1X9S A;  4CJP A;  1BIS A;  1SV5 A;  4KHS A;  3FFI A;  3HPH A;  4FJG A;  3AO3 A;  4DG1 A;  4OKJ A;  4Y1D A;  4KFB A;  2IDO A;  1Q9X A;  1WSE A;  4N5S A;  4GVM A;  3K5M A;  1RBV A;  4AHC A;  1TK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...