3U3YA

Mouse trex1 d200h mutant
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
215
Chain Sequence
LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRPPRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALKALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWVDEHARPFSTVKPMYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three prime repair exonuclease 1
publication title Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/dna
total genus 68
structure length 215
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.11.2: Exodeoxyribonuclease III.
pdb deposition date 2011-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3u3yA01
4G1QA 1BGXT 1GOAA 3HPGA 2EX3A 1CZ9A 2YKNA 1I3AA 4KFBA 5JS2A 3DYAA 3P1GA 4FJMA 2XRIA 3OYLA 1TK8A 3AO4A 1WSFA 1T8EA 3L2RA 2OPPA 3AVAA 1X1PA 4O44A 4DQSA 1BQNA 4M3YA 3DLBA 3PO5A 4BACA 2F8TA 4W5NA 3VQDA 4CJSA 3V9SA 3NFAA 4CGDA 4RG8A 4I9QA 4CFCA 3TAMA 2D0AA 5C25A 3LDSA 1S9EA 3LP3A 4AHVA 3SUOA 4PA1A 1NJWA 3RR7A 5J2MA 3KD1E 4FYDA 5CYQA 4Q5VA 1S1XA 4IDKA 3NCIA 4CJEA 1C0MA 4C8MA 3AVBA 3O3FA 2KW4A 4B8AB 1CXQA 1HYVA 2YHAA 3KK2A 4E7LA 5I3UA 4ELUA 4KHYA 4FLXA 3ZSZA 3LANA 4M3TA 4FLYA 3KLEA 3SV4A 3MXIA 2X78A 3PY8A 2OZSA 4KHQA 4M3WA 4QAGA 4J2EA 1RTDA 2YV0X 1DTTA 3OS0A 2VWJA 5CY4A 3KD5E 4CHYA 5D3GA 3G10A 2F8SA 2JGUA 3AVCA 4B9LA 3TARA 1C1BA 4KO0A 3OYIA 1TKDA 4EZ9A 3K5LA 4FK0A 1Z25A 3L8BA 3ZSRA 3S9HA 4F4KA 4IKFA 3C6TA 1GOBA 3RMAA 3ZSVA 2X6SA 2AJQA 1U4BA 4I2QA 3MXJA 4DLEA 1NK4A 1VSEA 2ITGA 4ID5A 3AVFA 3ITHA 3AV9A 4FLVA 2FBXA 1TK0A 4YFUA 3LP1A 4BE1A 4DS5A 2LSNA 3V9ZA 5FROA 1LAVA 2ZQBA 1FKPA 1VSLA 3HSTB 3T19A 4CJQA 4E7IA 2XY8A 4DTJA 4FZYA 3B6OA 1HNVA 4JS4A 3NGZA 3OJUA 5J2NA 3DM2A 1YTAA 4OKJA 2HHQA 3LP0A 1ASWA 3TWHA 4HCCA 3DRSA 1ZBHA 2XO7A 2O4IA 4GW6A 4RW4A 2D0BA 5J2PA 4ELTA 2JLEA 4CE9A 2IAJA 3ULDA 4DSIA 5C24A 4OGCA 4AHUA 2FBYA 3MEGA 3QEXA 2HNZA 1XHZA 1WNSA 4O5BA 4CF2A 2G8FA 3SYZA 4DTRA 4FK4A 1TKTA 3F73A 3WNEA 1BQMA 3QEPA 1RT4A 1CZBA 4CJFA 3SQ4A 4DWIA 4Z4IA 4JLHA 3AO5A 4C8LA 3LP2A 4B8CA 1IKWA 3KLIA 1LV5A 1J5OA 2HB5A 1HQUA 4E89A 1LAWA 1U49A 3U3GA 1VSFA 2HMIA 4FJ5A 1ITGA 2HNDA 4DQRA 3DLHA 3H08A 1KLMA 3BGRA 3O3GA 5I42A 3K58A 3MECA 4CEAA 3HYFA 3RRHA 3EY1A 4PY5A 2KZZA 3ASMA 3VQ6A 4PQUA 1BI4A 2Z1GA 1W9HA 2OZMA 1HMVA 3OYBA 1D5AA 4AH9A 1C0TA 3V9UA 4JRPA 4FLZA 4FJKA 4KTQA 4CJUA 3TAQA 1G15A 3RWUA 1WAJA 3BDPA 2YNGA 4O0JA 2ZE2A 3ZT2A 3M8SA 3L3VA 1JLFA 3M8QA 4KB0A 4Y1DA 4N5SA 4DQPA 3I0SA 3PX6A 4DSKA 3NGYA 1VSJA 1L3SA 2G8KA 4E3SA 4KHUA 4MQ3A 3PO4A 2RN2A 5C42A 1JXEA 4DFJA 4E1NA 2QXFA 2Z1HA 3LZJA 3B6PA 5FDLA 2HHTA 3MAQA 4CHNA 3OVNA 4LD0A 2IOCA 1QHTA 1VSHA 1ZBLA 3V1RA 3PX4A 3HO1A 4QOZB 1LW0A 4CEOA 1S9GA 3AVLA 3AVIA 3DOKA 3V6DA 4M41A 2PYLA 3HP6A 3TR8A 4B9MA 5JS1A 2WOMA 3VQ7A 2Q3SA 4Y1CA 1NK8A 4B9NA 1GOCA 3CM6A 3SCXA 3KLHA 4OLBA 2IC3A 4E7JA 2X74A 1X9WA 3AVHA 3RTVA 1C1CA 4L8RB 1BISA 3D0PA 1TAQA 2VWKA 4I2PA 1RDBA 4IFVA 4CJVA 3IAYA 4KHNA 4B3OA 2HW3A 1HPZA 3DOLA 4W5RA 4HTUA 2OA8A 4W5QA 2QKBA 1TVRA 1LWEA 4CJ3A 3V1QA 4OKEA 4HCBA 2ZD1A 3WNHA 4XIUA 3AO3A 4DLGA 4EZ6A 3I0RA 5EU7A 1BCOA 5SWMA 3QEWA 3KTQA 4J2AA 1NK0A 1T7PA 4DFKA 5KRTA 2KFZA 1EP4A 1SL2A 1T05A 1KVAA 1L3VA 2B6AA 1XHXA 3DLKA 3HPOA 1NK6A 3P83D 5HROA 4E7KA 4O55A 1Q8IA 4DTOA 1ASVA 3HK2A 3SV3A 3L2UA 2HVIA 4CK3A 3QEIA 1VK0A 1BIUA 1RDDA 4LH4A 1RTIA 4CJLA 4TSXA 3QNOA 4FZZA 4KRFA 2P51A 1RTJA 3SQ0A 3SQ1A 3VN5A 1NK7A 4ELVA 2VG5A 1HQEA 3D45A 4KHWA 2E6LA 1JLCA 2VG7A 4ICLA 4Z4HA 4DTMA 3CFOA 4KKOA 3K57A 3OYCA 3DRPA 2E6MA 2IGIA 2DFHA 1BCMA 3ZSYA 4HUFA 2G8UA 3QINA 3G0ZA 4CEZA 1ASUA 3VQ8A 4HUGA 1TL3A 2RF2A 3RR8A 1I39A 3KJVA 1FXXA 1ZBFA 4KAZA 4CFDA 4C8OA 3ZT1A 3L2VA 4FJ8A 1KTQA 4B9TA 2QKKA 2XY7A 1JKHA 2GUIA 4C8KA 4IG3A 1BHLA 3ZSWA 1JLAA 5SZTA 4BE0A 2HHVA 1Z26A 4FCYA 4CHPA 1UOCA 4GMJB 1EX4A 3LAMA 3V81A 2YNIA 2IS3A 3NHGA 1U47A 3HVRA 4CJKA 4AILC 1T03A 1TGOA 3DLEA 4KB1A 4PWDA 3DI6A 1S1VA 1IO2A 5KI6A 4QCLA 4I9LA 2OPQA 2DFEA 3DRRA 1K6YA 1QSYA 3KLFA 4F3TA 2R7YA 3QEVA 2Z1JA 3TANA 3TAPA 1RT7A 1SKRA 3UIQA 4CIGA 2YNFA 3QERA 1D8YA 3RMDA 1JL1A 3O3HA 4DTSA 4OGEA 4W5OA 3EYZA 3ZSOA 3AVGA 5KTQA 3OY9A 3FFIA 2YKMA 3PV8A 5HRSA 4DSEA 3QNNA 4B9UA 1RT2A 4OPKA 4DQIA 1JLGA 1RDCA 1MU2A 1B9DA 4DS4A 2KFNA 3AVKA 1LWCA 3E01A 4FW1A 3HP9A 1JLBA 3IG1A 4OVLA 4FXDA 1HJRA 1SV5A 2NUBA 3S3OA 1NK9A 5T7BA 1L3TA 4UQGA 3RMBA 1B92A 5DMRA 3ZSQA 4CHQA 1RT6A 3CFRA 3PX0A 1NJXA 2P5OA 3NAEA 3CG7A 4AHCA 3V4IA 3AVMA 2GBZA 1IKVA 4OKKA 3KIOA 4DMNA 4FLWA 3C6UA 1L5UA 4FJHA 3NBPA 5DK5A 4DSFA 4CJ5A 4CF0A 1VRTA 2XY5A 1N5YA 1ZYQA 4LY7A 1RNHA 3LZIA 3U3YA 1QTMA 4CCHA 4CEEA 4DU3A 4Z4FA 4FM1A 2HVHA 2O4GA 3SI6A 1D9DA 1J9AA 1HYSA 3NH1A 4E7HA 4PUOA 2A1SA 3CQ8A 3ALYA 1RBUA 4JS5A 3NF7A 3ZCMA 1RDAA 1NKBA 3NF6A 1C1AA 4GVMA 4DF4A 3OYEA 3KKRA 4Z4CA 3L2WA 3VQ5A 3QIPA 2PY5A 3MEEA 4F3OA 1SKWA 1HNIA 2DFFA 3ZT0A 3SUPA 1RBVA 4FJGA 3TAGA 1XWLA 4H8KA 4M3UA 4EP4A 3DLRA 5K14A 4FZXC 1SL1A 4CJRA 4BDPA 4DU4A 1D9FA 3SPYA 4KI4A 1LWFA 4F2SA 4IFYA 1KVCA 3K5MA 4DSJA 3L3UA 4DF8A 1FK9A 3VA3A 4O0IA 2RPIA 3AA2A 2PZSA 4DFPA 4AHRA 3VQEA 1RT1A 3S3MA 4CF1A 3JYTA 3THVA 1S6QA 4CGJA 3F9KA 3OYAA 3KK1A 2KTQA 1A5WA 1U04A 1O1WA 1WAFA 2P5GA 1TAUA 4DFMA 3QETA 3A2FA 4MFBA 1FKOA 3O4NA 4ZHRA 4OLAA 3LWLA 3K2PA 1JLQA 4AHTA 4DSLA 3K59A 2X6NA 1EXQA 4NCAA 4BWJA 4BDYA 3QESA 5HLFA 1KLNA 1RT5A 4B08A 4CK1A 4R5PA 3QIOA 4N47A 4OPJA 2G8HA 2BGGA 2KQ2A 1RBSA 1HYZA 4FLTA 1A5XA 3ZSXA 3S3NA 5HRNA 1TV6A 2YHBA 1LW2A 1TKZA 4LSNA 1REVA 3OS2A 1HRHA 4KHSA 4LSLA 4CFAA 1DTQA 3SZ2A 4DTNA 1SKSA 1NJZA 3AVJA 1IH7A 1YVUA 4C8NA 3P5JA 3TI0A 3VQBA 4E1MA 2ETJA 3VQ9A 3HPHA 4H4OA 3U6FA 1KCFA 5J2QA 4EP5A 2EHGA 3SUQA 1ZBIA 3OYNA 3NGIA 1RCHA 4E0DA 1S1TA 1X9SA 1J54A 4CEBA 3SNNA 1ZBUA 3VQCA 1BI4B 4FJ9A 4E19A 1S1UA 2F96A 3K5OA 1NKCA 1KRPA 2ATQA 4N56A 3KLGA 4DTXA 4CEDA 3K5NA 4CIFA 1XI1A 3OYDA 1X9MA 4CGIA 2QK9A 2HHXA 3ISNC 2HNYA 1XC9A 3VQAA 3T3FA 1VSMA 3CFPA 1UA0A 1KVBA 4CJPA 2GV9A 4FJJA 1IKXA 1TK5A 4KPYA 4DTUA 4M3XA 5FRNA 1QQCA 5HRPA 4FM2A 3IRXA 4DU1A 4CFBA 3SPZA 1EKEA 2OPRA 3DMJA 4NYFA 3C94A 3LPUA 1RBRA 2Z1IA 2Y1IA 1NJYA 2OYQA 3JSMA 4N41A 2D5RA 2E4LA 3ZT3A 3V9XA 4Q0BA 1QSSA 1RTHA 4M3RA 1KSPA 1S5JA 1QE1A 2WONA 3TAEA 2G8IA 3HM9A 1TL1A 4KREA 4NYNA 3CYMA 4OJRA 4K8XA 1J53A 3AO1A 4IG0A 1IKYA 4FJNA 1KFDA 3SQ2A 4ZTJA 2DY4A 1WN7A 4O4GA 5KGXA 1NK5A 2P1JA 2FBVA 1S6PA 3IS9A 5HP1A 4I7FA 1C0UA 1WSJA 1L3UA 3KK3A 4F2RA 4B9SA 2G8VA 3HJFA 4KI6A 1IG9A 1UAXA 3CM5A 3T1AA 3TAFA 1EETA 2D0CA 2PYJA 1JL2A 3HVTA 1Y97A 1C6VA 3HT3A 4DQQA 4M3ZA 1NOZA 4CGHA 3C95A 2G8WA 1U48A 4FK2A 3MEDA 4NCGA 3VQ4A 1F21A 3HL8A 2B4JA 2FC0A 3NH2A 5CZ1A 4KTWA 3I8DA 1W0HA 4FJ7A 1RBTA 4RW6A 4CGFA 1WSEA 1U45A 4FJIA 3NDKA 2HHSA 3AA4A 4FVMA 4KV8A 1NOYA 4CF9A 4HUEA 3TABA 3LAKA 3NH0A 3V9WA 4RW7A 2VG6A 4BWMA 3OJSA 4RW8A 4CHZA 1N6QA 3OYHA 3OYKA 4HVJA 4B9VA 1Q9YA 3KKSA 3OYGA 4NCBA 3SJJA 4FW2A 4CJTA 1B9FA 1VSIA 3RMCA 3M8RA 4J2DA 1BIZA 1JLEA 3PUFA 1YT3A 5HRRA 3NE6A 1UWBA 1VSDA 3MXMA 1KFSA 4F8RA 3AVNA 4FJLA 4Z4EA 1A5VA 3QO9A 3OYFA 4FM0A 3LWMA 4FLUA 5CYMA 1NKEA 4N76A 3M8PA 1RILA 3VQQA 5CZ2A 4HHTA 4K8ZA 1YTUA 4JRQA 4Z4GA 3AO2A 1SUQA 4Z0UA 1VSKA 2IDOA 5J1EA 1QS4A 4IBNA 4ID1A 2DTUA 4RW9A 4CF8A 3V1OA 3L2QA 1VRUA 4CHOA 4DTPA 3WNFA 2KZMA 4H4MA 3RRGA 1CLQA 3SUNA 1R0AA 2HHUA 4WE1A 3HXMA 2A1RA 2XHBA 2B5JA 4CECA 2BDPA 4CEQA 2HHWA 4LH5A 1SL0A 1CXUA 5E41A 3LPTA 1DLOA 4BE2A 3ZT4A 4YNQA 5HBMA 3AA3A 4CJ4A 4FJXA 2FBTA 2YNHA 3LALA 1Q9XA 4J2BA 2BANA 1WLJA 3OYMA 2BE2A 2Y1JA 3DLGA 4M45A 1QSLA 4CEFA 4DG1A 1WSGA 4ZTFA 4CERA 1TKXA 1WSHA 1UA1A 3NF9A 1RT3A 3NF8A 2XY6A 4W5TA 4CK2A 3OS1A 2I5JA 5FRMA 3OYJA 3EZ5A 5KGWA 4BDZA 5KRSA 1WSIA 1BL3A 3AA5X 4AHSA 4CIEA 1JXBA 4KTZA 2W42A 4M42A 4CGGA 2RKIA 4CESA 3QLHA 3WNGA 3VQPA 3O4QA 1S1WA 3VA0A 4CJWA 2OPSA
chains in the Genus database with same CATH superfamily
1BGXT 3HPGA 4WFNL 1EO1A 4KFBA 5JS2A 1TK8A 1WSFA 2A6AA 5JVHL 2OPPA 3AVAA 4DQSA 1BQNA 4BACA 3O9SA 4CJSA 5AQUA 4I9QA 4CFCA 3AAQA 3RR7A 4FYDA 3DJCA 5CYQA 1S1XA 4IDKA 4CJEA 4M63C 1CXQA 2FF3B 3VETA 4FWPA 4M3TA 2UXDK 2P9SA 4BQZA 1HJOA 3E9OA 2VWJA 1OH6A 3KD5E 5D3GA 2HSTA 4B9LA 1C1BA 3OYIA 4FK0A 3S9HA 3CD6N 3I8BA 4JI2K 1U4BA 4DLEA 1XMOK 2FBXA 3HSCA 2VGMA 3G25A 4BG9A 2ZQBA 1VSLA 4FZYA 3T19A 4CJQA 4NO7A 2HF3A 1SZ2A 1QVGM 3FZKA 2GWJA 2V7YA 3LP0A 4HCCA 3DRSA 1VQ7N 4RW4A 4ELTA 2E2PA 4DSIA 4O5BA 1RDUA 4V19S 4A2AA 4Z4IA 4BR5A 3SQ4A 4DWIA 3TPQA 3THXA 4BGBA 3U4LA 1GLAG 3WEEB 1OH7A 4LF4K 4NXMK 3K58A 3IUCA 4CEAA 3I33A 1LOTB 3M3ZA 4JV5K 2W41A 3P31A 1KC8O 4FLZA 4CJUA 3EZWA 1G15A 3RWUA 2YI1A 3KVGA 2A5XA 4KB0A 4LFAK 1D4XA 3I0SA 4H0XB 5E84A 3ENOA 3MCPA 3PO4A 2RN2A 4E1NA 3N4PA 2P9KB 2HHTA 3MAQA 1NGDA 3OVNA 1QHTA 2HBMA 1ZBLA 3V1RA 4WQ4A 1S9GA 3AVIA 3HP6A 4H5RA 2WOMA 3VGMA 3J7ZO 4JK7A 1GOCA 3CM6A 2E5LK 5EXWA 3SCXA 1Q7YO 4E7JA 4YOUA 3AVHA 5E26A 1BISA 3D0PA 4IFVA 2ASMA 2VWKA 4B3OA 2D1KA 5AFUA 2ZM6K 1HPZA 2BTFA 4CJ7A 4HTUA 2QKBA 3VF6A 2CGJA 5EU7A 2KHOA 3QEWA 3KTQA 4DFKA 5AQQA 4AQYK 1T05A 4FWQA 1XHXA 3AAPA 4NXNK 3ZLJA 2HVIA 3ULEB 1Q81O 1BIUA 1RDDA 1RTIA 4KRFA 3SQ0A 3SQ1A 3N4QA 2VG5A 3D45A 1JLCA 3CFOA 3VGLA 2E6MA 3QICA 3DXMB 1ASUA 4WQ4C 2QEXN 3L4IA 1KTQA 1NGAA 5AQXA 4B9TA 3GL1A 4IG3A 1BHLA 5SZTA 4H5VA 2KKZA 1V4TA 3PIPL 4BRNA 2FSKA 1NNEA 2KLAA 1TGOA 5BN8A 4KB1A 1S1VA 3AGKA 5KI6A 4FWSA 1XMQK 1NWKA 3DRRA 1K6YA 1QSYA 3KLFA 2E2NA 3TANA 2YNFA 4JKHA 4OGEA 4W5OA 4FWRA 5KTQA 4X62K 3VTIA 4BY9C 4Y0WA 3TTFA 4OPKA 4DQIA 2UYTA 3W3DA 5FPNA 3AVKA 1LWCA 3E01A 3IG1A 1HJRA 1SV5A 5AZJA 1NK9A 3THWB 2O8FA 4UQGA 3ZX2A 1YVNA 2E1YA 1T6DA 3AVMA 1FW6A 3O9TA 1IBMK 1VQNN 3KIOA 3MWTA 4FLWA 1L5UA 3NBPA 5DK5A 4DSFA 4CF0A 2ZJRL 1NMDA 2XY5A 3MK6A 4LF7K 4BRHA 1U6ZA 3VENA 3LZIA 1YAGA 4DU3A 3WQUA 4R79A 2HVHA 3SI6A 5GAGP 3ALYA 3R6MA 4ILHA 4JS5A 3ZCMA 2JWKA 1G99A 3OYEA 3KKRA 3MEEA 3VGKA 4JI3K 4XH5A 2DFFA 3ZT0A 1RBVA 5F1XA 1VHXA 4BDPA 4CJRA 2GWKA 3DXKB 1D9FA 1LWFA 4F2SA 1KVCA 3D6RA 5M1OA 1WUAA 3SAFA 3VA3A 3G71N 4XEIA 3MX5A 1VQ8N 1I94K 3S3MA 4JI7K 3MX2A 3THVA 2KTQA 3F9KA 3A5OC 1A5WA 1U04A 2HBKA 4YHHK 2AP1A 3O4NA 4M7YA 3LWLA 1VQPN 4BWJA 4BDYA 5GADP 4EHTA 4R5PA 5BPNA 3QIOA 4ILJA 3K0SA 2BGGA 1QQMA 3CJCA 1HYZA 5ADXH 4FLTA 3ZSXA 2QA4N 3P4IA 2YHBA 3OS2A 1QHAA 1N36K 4CFAA 3O6WA 2QWPA 3RSEB 4B3TK 3TI0A 2EHGA 4FJ9A 4CEBA 1ZBUA 2Q1NA 1BI4B 3ENBA 4ISFA 4KH4A 2ATQA 4DV4K 4CEDA 4CIFA 1GLLO 3ISNC 2HHXA 3OW2M 4CZIA 3R1XA 2GV9A 3T69A 4RWTA 4M3XA 3CCQN 3IRXA 2WFBA 4XH1A 3SPZA 2Y1IA 4N41A 1YXQA 3FR0A 2E4LA 2VCPA 3SMSA 4WQ5A 1KSPA 2G8IA 3ATUA 1JCEA 4JD2B 2UUAK 3SQ2A 4O4GA 3IS9A 3KK3A 2QWNA 4B9SA 2G8VA 3NMUA 2BUPA 1EETA 3QFUA 4QS9A 4QS7A 4IOXA 2O8CA 1JL2A 1Y97A 1C6VA 1NOZA 2P9NB 3VQ4A 1NGGA 2B4JA 3I8DA 2WBNA 5BPLA 4BROA 1WSEA 1U45A 2P9IA 3NDKA 3O5BA 1NOYA 4CF9A 1QQNA 4B1YB 3V9WA 5AQVA 4BWMA 2A42A 4CHZA 1N6QA 2F4VK 1N8RO 1DT9A 4NCBA 3SJJA 4FW2A 3K9KA 4CJTA 1BO5O 3W0LA 1VSIA 3RMCA 3M8RA 1K9MO 4DV2K 3J8AA 1BIZA 1JLEA 3PUFA 5HRRA 4FWKA 4F8RA 5HL7L 3QO9A 2ASOA 3EEQA 4N76A 1RILA 3VQQA 5CZ2A 2OANA 4Z0UA 3IFRA 4IBNA 2DTUA 4CF8A 3V1OA 3MWPA 1VRUA 3B8AX 3CC2N 1ATRA 1GLBG 4O5FA 3HXMA 2ITMA 3ATVA 5AQMA 5LMNK 4B3RK 3LPTA 2E20A 1S22A 2UXCK 3AA3A 4FJXA 2FBTA 3VF4A 2YNHA 3LALA 1Q9XA 3MN7A 2P9UB 2BANA 1WLJA 2BE2A 4H0VB 3UKUA 1T3VA 4ZTFA 1WSHA 1UA1A 1RT3A 4BRAA 4W5TA 5AZIA 4CK2A 2I5JA 3OS1A 1X3MA 2IVNA 3EN9A 5KGWA 1WSIA 2W42A 1QZ5A 2P9LA 2E88A 2UU9K 2RKIA 4FVUA 1BA1A 3NVMA 1VQ4N 5T7BA 2EWSA 2JWLA 3OHRA 5ELZA 4DR4K 3DYAA 2D4WA 4FJMA 2XRIA 1WOQA 4FWOA 3AO4A 3E66A 1T8EA 3FZLA 3L2RA 1X1PA 4O44A 3A5LC 3DLBA 3PO5A 4W5NA 3VQDA 3L0QA 3GOIA 4CBUA 2D0AA 5C25A 4QCLA 3GE1A 5J2MA 3KD1E 1KAZA 4Q5VA 3NCIA 1J6ZA 1C0MA 4C8MA 3AVBA 3EO3A 5GIPA 2KW4A 4B8AB 4ELUA 3HBTA 4YOYA 3CI5A 3LDPA 4FLYA 3VEZA 1DEJA 3KLEA 2X78A 4CVNE 2OZSA 4KHQA 4CBXA 3VMFB 4QAGA 4M3WA 4MO4A 4CHYA 4JHDA 3AVCA 3TARA 2NZTA 3K5LA 3F2KA 3GDQA 3WT0A 3C6TA 2AJQA 2YCHA 1IJJA 1VQ9N 3LP1A 4DS5A 4I6MB 4AF1A 3VEYA 2LSNA 3V9ZA 4JI0K 1FKPA 4CZLA 2YHXA 1HNVA 3B6OA 4JS4A 3NGZA 2QWLA 4OKJA 4ILGB 2QWOA 1ZBHA 4GW6A 1P90A 3ULDA 4CE9A 2YJFA 4OGCA 2FBYA 3QEXA 2HNZA 1XHZA 4CF2A 5AQFA 4DTRA 1YHQN 1TKTA 3WNEA 4DV0K 1RT4A 1CZBA 4JLHA 1IKWA 1U49A 4CD1A 3U3GA 1VSFA 3BF3A 1ITGA 4DQRA 1KLMA 3EL2A 4A5AA 1YITN 3MECA 4JEPA 3DLLL 4PQUA 2Z1GA 3E1YA 4IOCL 4DR2K 1HMVA 5AQTA 2UXBK 1D5AA 5AQGA 4DR1K 2H3GX 4DCHA 3TAQA 2PBDA 1WAJA 4O0JA 3R9PA 3SBTA 3M8SA 1NLVA 3M8QA 4Y1DA 3PX6A 3LDNA 1L3SA 4KHUA 4UY8O 3T1YK 5C42A 4DFJA 2Z1HA 3CCSN 5TKWA 4LD0A 2IOCA 3OA9A 3HO1A 3HZ6A 3PX4A 3AVLA 5LJWA 3DOKA 2PYLA 4JKGA 2HF4A 2X74A 4X66K 1RDBA 4CJVA 4KHNA 4OX9K 2HW3A 4W5QA 3C6AA 2VQFK 2VQEK 4HCBA 4XIUA 3AO3A 3CJBA 4C23A 4EZ6A 3I0RA 4KBOA 3MN5A 3WXKA 2KFZA 1SL2A 2B6AA 3P83D 1X9JA 4E7KA 4O55A 4DTOA 1ASVA 3KWIA 4GVEA 1VK0A 4CJLA 4TSXA 2AA4A 1RTJA 1YI2N 1NGEA 2VG7A 3FZFA 4KKOA 4JYAK 1Y64A 3DRPA 4HUFA 1BCMA 4PL8A 3ZSYA 2G8UA 3G0ZA 2QWRA 3CQXA 1TL3A 2RF2A 3RR8A 3KJVA 4C8OA 4FWMA 3ZT1A 2P9PA 2QKKA 2XY7A 5H1SQ 4C8KA 3ZSWA 2HHVA 1Z26A 1FJGK 4FCYA 1UOCA 4LF6K 4LC9B 4B9QA 3V81A 5M1NA 4AILC 1T03A 3FLCO 2IVOA 2OPQA 5KQ8A 2VWBA 3FE1A 2V51B 2A3ZA 2Z1JA 4CIGA 3O3HA 4DTSA 3QBXA 3ZSOA 3BEXA 4H0PA 3FFIA 4LFBK 2YKMA 5C12A 5HRSA 3PV8A 4BR9A 3QNNA 1RT2A 1RDCA 2O8DA 2KFNA 1NGFA 3HP9A 1XQSC 1L3TA 3O9QA 1B92A 5DMRA 3ZSQA 3PX0A 3O9UA 4BRCA 5DM7L 3V4IA 4OKKA 2GBZA 2CGKA 2QI2A 3UKRA 3C6UA 3FGUA 4FJHA 3ZYYX 4FOIA 5I9EB 4LY7A 1RNHA 2GELA 3LDOA 4PKGA 3U3YA 1QTMA 4CEEA 3EE9A 4H5NA 4G9ZA 2P9SB 5AQLA 1EQYA 3BP8A 4Z4FA 4FM1A 2O4GA 1J9AA 2Q31A 4IJAA 3NH1A 3CQ8A 3HOSA 3NF6A 4DF4A 4Z4CA 3QIPA 4F3OA 1T6CA 3SUPA 1VQMN 4PKIA 2F9WA 3TSUA 4K43A 4DU4A 4H0YB 3SPYA 2IIRA 4KI4A 3TSPA 4IFYA 3K5MA 3TTCA 5JLHA 4O0IA 2PFUA 3VQEA 2QM1A 4CF1A 1ZXOA 4CGJA 2FSJA 2OTLN 1WAFA 4JK8A 4MFBA 1FKOA 2D0OA 1JLQA 4NCAA 4DR6K 3QESA 4B08A 4CK1A 3TSQA 5LJVA 5M1FA 1A5XA 3KZBA 5EOYA 1YIJN 3THXB 3WUHA 1REVA 3MN6A 4KHSA 4DTNA 1HKGA 1SKSA 4BRPA 1NJZA 5GIOA 1YVUA 3VQBA 3CJ7A 3U6FA 3CCEN 3SUQA 3NGIA 4E0DA 1S1TA 1GLEG 1TYQA 4H03B 2E8AA 4E19A 4YORA 1S1UA 2UUCK 2WTUA 4CBWA 4N56A 3KLGA 4DTXA 4PHTX 5IWAK 4CGIA 3CMAN 2HNYA 3CCVN 1IKXA 4KPYA 3C0BA 1NU0A 1XNQK 4JI6K 5HRPA 1P8ZA 5AQHA 2IVPA 1ZBSA 3C94A 3ZX3A 1RBRA 2Z1IA 1MDUB 3JSMA 3CJAA 3V9XA 3H46O 1QSSA 1JJ2M 1RTHA 4M3RA 2F9TA 3HM9A 1TL1A 4NYNA 4JKBA 1KD1O 1HLUA 1M1KO 3M5RA 1WN7A 2NRHA 2P1JA 4F2RA 1C0UA 3F5TA 1E4FT 3HJFA 3CCRN 2F7TA 3T1AA 2D0CA 3D2EA 4OO1J 4BRFA 2PYJA 3HOTA 4B1XB 1GLCG 3ID6A 4CGHA 4KH5A 3DXKA 1F21A 4H0TB 4DUZK 4JAXA 2FC0A 1NMNA 1GLDG 3TTDA 2O8BA 5JLFA 3H3OB 5EY4A 4DQ8A 3CMEN 5M1KA 2NNWA 5CR4A 3U9ZA 3LAKA 4HUEA 3NH0A 4RW8A 4K0KK 3OYHA 4B3MK 4HVJA 2YX6A 1Q9YA 4O8KA 4JNEA 1YT3A 3Q7BA 1VSDA 3AVNA 1A5VA 4FM0A 5AQRA 3LWMA 3RSEA 1NKEA 1WB9A 4K8ZA 1YTUA 4Z4GA 1SUQA 5J1EA 2IDOA 1NGIA 4ID1A 4RW9A 3JS6A 3L2QA 4A59A 1SAZA 4IEIA 3RRGA 4CZJA 1YJ9N 2RHKA 2XHBA 5AQOA 4CEQA 4OPHA 5FPEA 1CXUA 3CJ1A 1DLOA 3PSIA 5C10A 3ZT4A 5FLXO 4CJ4A 1X3NA 1BU6O 2NRVA 2ASPA 4IJNA 1N32K 3CCUN 4DG1A 1WSGA 4CERA 4YOXA 4Z94A 3NF9A 3NF8A 5KQDA 3CCJN 2XY6A 5FRMA 4JKAA 1VQON 3S41A 1BL3A 3QB0A 4CIEA 4CGGA 2Q2RA 3QLHA 5AZJB 3VQPA 2O8FB 3U8XA 3D2FA 1S1WA 4CJWA 2V7ZA 5CHIA 1ATNA 1GOAA 2P9NA 2EX3A 1CZ9A 2YKNA 3Q7CA 4FWLA 4YY3K 3J7YP 4YOVA 2D0PA 4BREA 4M3YA 4RG8A 3TAMA 3LP3A 4AHVA 3AY9A 4PA1A 4B1UB 2FSNA 4U7BA 1U2VA 1NGJA 4E1JA 5I3UA 3KK2A 2YHAA 1E4GT 4FLXA 3H45C 3C7NA 4EIAA 3ZETA 4CI6A 4J2EA 1RTDA 2YV0X 3AARA 3OS0A 4MO5A 5CY4A 2F8SA 4KO0A 4EZ9A 4CZGA 4IKFA 3ZSRA 4F4KA 2X6SA 4IO9L 4MDBA 4WYBA 1NK4A 1VSEA 4ID5A 3AVFA 3ITHA 3AV9A 1TK0A 3BZCA 5JMVA 3ZX0A 3OBYA 3HSTB 4E7IA 2HOEA 4U67L 2CH6A 3AGRA 5J2NA 1YTAA 5LL6Z 2O4IA 4HWIA 3G4SN 5J2PA 2JLEA 1XUPO 5C24A 4AHUA 4DV1K 1WNSA 3SMPA 4DR5K 2G8FA 1QQOA 1M90O 5AJ3K 2FLOA 5EX5A 5BR8K 4C8LA 3LP2A 3UB5A 3KLIA 3D7EO 1J5OA 2HB5A 1HQUA 4E89A 1LAWA 3EE8A 4GV3A 3NVKA 3H08A 3BGRA 4CD3A 3ZEUA 5MLCQ 3ASMA 2HHHK 1W9HA 2HBJA 3OYBA 5M1QA 3A8YA 4FJKA 4KTQA 2GX9A 4A61A 3THYA 3BDPA 2YNGA 3G6EN 2ZE2A 3EKSA 3ZT2A 3L3VA 4DQPA 3NGYA 5GAEP 4CZEA 4RCHA 5KPTA 2DPNA 1JXEA 3L4QA 5AR0A 2QXFA 3LZJA 1K8AO 3BZKA 4RTFD 1MA9B 1TUUA 2O8CB 3MCAB 4M41A 1V4SA 5JS1A 3TR8A 1IBKK 3DAWA 2Q3SA 4Y1CA 1NK8A 4B9NA 3KLHA 4BG8A 1X9WA 2I7PA 1S3XA 5A2QO 3RTVA 2P9IB 4L8RB 1TAQA 3MMVA 4I2PA 3IAYA 2O8EA 4W5RA 2OA8A 2CGLA 4PKHA 1TVRA 3C6HA 4B1WB 3QFPA 2ZD1A 3WNHA 4DLGA 4BRQA 1H1VA 4QS8A 5AQPA 1T7PA 1RGIA 5KRTA 1DGKN 3LDQA 3QMLA 4IFEA 1WBBA 3H1VX 1NK6A 1BOTO 1Q8IA 1Z05A 3EKUA 4JI1K 4YDUA 3L2UA 1O13A 5TKYA 4LH4A 5DM6L 3VN5A 3WXJA 4Z4HA 4ICLA 1MWKA 3K57A 3OYCA 3O08A 5LMUK 2IGIA 3QINA 5C0YA 3VQ8A 2ZJQL 4HUGA 1WBDA 2E1ZA 1FXXA 3VEVA 4CZHA 4BE0A 1GLFO 4CHPA 4BRLA 4GMJB 3UKUB 2YNIA 1R59O 1U47A 2YHYA 3DLEA 1IO2A 5AZIB 1OH5A 3VEXA 2DFEA 5AFUH 4BVPA 4C1NK 4F3TA 2P9LB 3QEVA 3TAPA 1RT7A 3UIQA 3QERA 4FPBA 4DSEA 4NLCA 4YDUC 1JLGA 4JI5K 1MU2A 1B9DA 2VGNA 5JVGL 1LCUA 2QWMA 1KXPA 1JLBA 3MN9A 4FXDA 3S3OA 5ADXA 1HR0K 3CFRA 2P5OA 3NAEA 4FSVA 4DHYA 4AHCA 4DV5K 4NB4A 4CJ5A 1VRTA 1Q82O 4WCEL 3J80O 4FO0A 4CCHA 3U9DA 5AQSA 1GLJO 1HYSA 4E7HA 4PUOA 5C2DA 1RBUA 3NF7A 4IEEA 1C1AA 4JHDB 3CCLN 3VEOA 2VYPA 1ATSA 3GBTA 5LY3A 1SKWA 1HNIA 4JKFA 1XWLA 3DLRA 5K14A 3KK7A 1SL1A 3O1WA 4JKEA 4BRIA 1JCGA 4IDHA 1S72N 3M1FA 1FK9A 2Q0UA 1Q86O 2RPIA 3AA2A 2PZSA 1HKBA 4AHRA 3OYAA 3TU5A 3KK1A 1TAUA 3QETA 4ZHRA 4J8FA 2ZF5O 3K2PA 4AHTA 4DSLA 3K59A 5KPZA 1EXQA 3SAHA 1KLNA 1RT5A 2ZWHA 3LDLA 4N47A 4OPJA 3T1HK 1RBSA 4A5BA 1TV6A 1TKZA 5AQIA 2PAVA 5AQKA 1ESVA 1DTQA 3SZ2A 3AVJA 1IH7A 2ETJA 3VQ9A 3HPHA 4EP5A 3OYNA 4MLEA 3J7AP 3E9LA 3SNNA 2F96A 4GY2B 1NKCA 4MDAA 1KRPA 5M1PA 4BC3A 3OYDA 1X9MA 2QK9A 3WEEA 3VQAA 3T3FA 5BPMA 4FJJA 1TK5A 4DTUA 2QWQA 1QQCA 4DU1A 4CFBA 4DKWA 2OPRA 4NYFA 3LPUA 2OYQA 1EWRA 4GKJK 2WONA 4KREA 4OJRA 1KFDA 2W6KA 1HKCA 4ZTJA 1OKJA 2DY4A 4I7FA 1VAZA 4CW7B 2NLXA 2P9KA 4JKGB 1IG9A 2NRWA 4WFBL 2QTDA 1K8KB 1IG8A 4DQQA 3HVTA 3P38A 4LFCK 5IT9O 2ZGYA 5BN9A 2G8WA 1U48A 4FK2A 3MEDA 4NCGA 2NRRA 1VQ5N 4JKDA 4X65K 3NH2A 4KTWA 4FPAA 3I55N 1W0HA 3H6EA 3AA4A 4FVMA 3R3LA 3LM9A 3TABA 4RW7A 2VG6A 3C65A 3OYKA 4YOTA 3KKSA 3SAGA 4BRDA 3OBWA 3NE6A 1UWBA 3T7ZA 1KFSA 4FJLA 4GKKK 3ENHA 4A2BA 4BR2A 5BRFA 5CYMA 2QXLA 1RFQA 4HHTA 4EFHA 3ULEA 4JRQA 1VQLN 2I7NA 5BREA 2P9PB 4DTPA 3WNFA 1VQKN 4JN4A 2Q0RA 3SUNA 1R0AA 1IBLK 1XNRK 2A1RA 3CETA 2FXUA 3DXMA 4CECA 2BDPA 2HHWA 4B1ZA 4LH5A 1SL0A 5E41A 4BE2A 4BR4A 3SK3A 1SQKA 4EHUA 2Y1JA 4JI8K 4M45A 1MWMA 1NGHA 3CF5L 1BG3A 1QZ6A 3OYJA 3EZ5A 2O8DB 4BDZA 2G8KA 4M42A 3AA5X 4AHSA 4KTZA 4CESA 3WNGA 5F2RA 2KZZA 4IOAL 1YJNN 4G1QA 1I3AA 3HTVA 3P1GA 3UKRB 3PIOL 3OYLA 4LF5K 1NGBA 3SJHA 2F8TA 3V9SA 3NFAA 3CC4N 4CGDA 4AM7A 3THWA 2V52B 4EAHD 3LDSA 1S9EA 3SUOA 1NJWA 1C0GA 1YF5L 3O3FA 3VOVA 1HYVA 4E7LA 4KHYA 3ZSZA 3CHWA 3LANA 4C1NI 3SV4A 3MXIA 3PY8A 3LM2A 1DTTA 3CERA 2GUPA 4GV6A 3G10A 2JGUA 1NBWA 4BRKA 1TKDA 1Z25A 3L8BA 1GOBA 3RMAA 3ZSVA 4AM6A 4I2QA 3MXJA 2ITGA 4FLVA 4YFUA 4BE1A 1KQSM 1KAYA 5FROA 1LAVA 2ZGZA 4DTJA 2XY8A 3H3NO 3OJUA 2NRZA 3DM2A 3HI0A 1ZC6A 2RE2A 2HHQA 1ASWA 3TWHA 2XO7A 3VF2A 2D0BA 5BRDA 2IAJA 4FWNA 3J81O 3MEGA 3M6GA 3SYZA 4FK4A 3F73A 1BQMA 3QEPA 4CJFA 3AO5A 4BQLA 1TYQB 4B8CA 3CCMN 1LV5A 2HBLA 2HMIA 4FJ5A 4BC4A 4DR7K 3CPWM 2HNDA 3DLHA 3A5NC 5F0XA 5C2FA 4HTLA 3O3GA 5I42A 3HYFA 3RRHA 3EY1A 4PY5A 5GINA 3VQ6A 4GV9A 1BI4A 3FZHA 4H5TA 2OZMA 4AH9A 1C0TA 3V9UA 4JRPA 5KPRA 1Z6RA 1HUXA 4CZMA 3BF1A 1JLFA 4N5SA 1HPMA 3DWLA 4DSKA 3H1QA 1VSJA 4E3SA 4MQ3A 4FL9A 1T44A 3PSFA 5AQWA 3B6PA 5FDLA 4CHNA 4JI4K 2HMPA 3GG4A 4QOZB 1VSHA 3D2EB 5AQZA 1LW0A 3WXMB 4JD2A 4CEOA 4BGAA 3CQYA 3V6DA 4B9MA 1NJIO 3VQ7A 3QDKA 1N33K 2O8BB 1HX1A 3CIPA 4OLBA 2IC3A 3CPEA 1C1CA 1EWQA 3DOLA 1C0FA 1LWEA 4CJ3A 3V1QA 4OKEA 4M7XA 1TUYA 5SWMA 4J2AA 1BCOA 3WQTA 5FPMA 1NK0A 1EP4A 3VERA 1KVAA 4WFAL 4A57A 1L3VA 3HPOA 3DLKA 4B3SK 5HROA 3HK2A 3SV3A 4CK3A 3QEIA 3QNOA 2A41A 1NG9A 5AQYA 4FZZA 2P51A 1NK7A 4ELVA 1HQEA 2NRXA 4KHWA 2E6LA 4DTMA 2YHWA 2DFHA 4CEZA 5AQNA 1I39A 1ZBFA 4KAZA 2GTDA 4BR0A 2GEMA 4CFDA 3L2VA 4FJ8A 3CC7N 1JKHA 4ISGA 2GUIA 4XH4A 4ISEA 5B8HA 4YOWA 1JLAA 1BA0A 3E9PA 1EX4A 3JXUA 3LAMA 4BR7A 3LL3A 2IS3A 3NHGA 3HVRA 4CJKA 3KHYA 4PWDA 3DI6A 1W2BM 4I9LA 3VESA 1QVFM 2P9UA 2R7YA 1SKRA 4IXCA 3O9RA 1D8YA 4JK9A 3D2FB 3RMDA 5BRHA 1JL1A 3EYZA 3AVGA 3OY9A 1BWFO 3VEWA 4B9UA 3IDHA 5C15A 4DS4A 4FW1A 4OVLA 2YJEA 2NUBA 3R8EA 2A40A 4NLBA 3RMBA 3O4WA 1NJXA 4CHQA 1RT6A 3CG7A 2WC9A 1JCFA 3HRGA 1IKVA 3O1BA 3ID8A 2OCEA 4DMNA 1U2VB 3SBGA 1N5YA 1ZYQA 3FZMA 5BR9A 3C7NB 3P39A 1D9DA 3ZETB 2ZJPL 2A1SA 4WQ5C 3I56N 1RDAA 1NKBA 4JKCA 1KAXA 4GVMA 1N34K 5JICA 3L2WA 2PY5A 3VQ5A 2CH5A 4MLHA 4WF9L 3TAGA 4FJGA 3IMXA 4H8KA 4LF8K 4EP4A 4M3UA 1OH8A 4FZXC 1W97L 4B1VA 4DV6K 3VPZA 2W40A 4DSJA 3L3UA 4DF8A 3FFKB 4DFPA 2OTJN 4BRMA 1RT1A 3JYTA 1S6QA 4O8UA 1IV0A 1O1WA 2NRTA 2P5GA 4I6MA 4DFMA 3A2FA 4OLAA 1CZAN 2X6NA 3WXIA 5HLFA 2G8HA 2KQ2A 1VQ6N 4GNIA 1NM1A 3S3NA 1BUPA 5HRNA 5AQJA 1LW2A 3RVCA 3L6QA 4IWVA 4LSNA 1HRHA 4LSLA 3O8MA 4C8NA 3P5JA 4E1MA 4H4OA 3HM8A 1KCFA 5J2QA 5GAHP 3ZEUB 5EVZA 1ZBIA 1RCHA 3F9MA 1X9SA 1J54A 3VQCA 4IO8A 3K5OA 1XI1A 3K5NA 1Q18A 4BC5A 4IZ9A 1XC9A 3UE5A 1HNZK 1VSMA 3CFPA 3THYB 1KVBA 4CJPA 3QBWA 1UA0A 3SLCA 5FRNA 3BUZB 2Q97A 4FM2A 4DR3K 1EKEA 3DMJA 1NJYA 2D5RA 3ZT3A 5CE3A 4Q0BA 2Q36A 1S5JA 1QE1A 1OVQA 3TAEA 3CYMA 4K8XA 1J53A 3AO1A 4IG0A 1IKYA 3BY5A 4FJNA 4F9OA 3A0IX 5KGXA 1YJWN 1NK5A 2FBVA 1S6PA 5HP1A 1L3UA 1WSJA 1SS6A 4CZFA 1HNXK 4KI6A 1UAXA 3CM5A 3TAFA 2O8EB 3HT3A 2QW9A 4M3ZA 1XC3A 3C95A 4FOEA 3O80A 3HL8A 4H0OA 1YUWA 5CZ1A 2J4RA 4FJ7A 1RBTA 4RW6A 4CGFA 4FJIA 2HHSA 1W7AA 3JAMO 4KV8A 4KHPK 4DUYK 4H5WA 2UUBK 3OJSA 1OVYA 4A62A 4B9VA 4BRGA 4BVOA 3OYGA 4KH6A 1B9FA 4J2DA 4X64K 3CJ9A 1J5EK 2W6LA 3MXMA 4Z4EA 4K41A 3OYFA 3WXLA 4FLUA 4CZKA 3M8PA 3AO2A 1K73O 1VSKA 1QS4A 3MDQA 4CHOA 1DKGD 4L3QA 2KZMA 4H4MA 4DB3A 1CLQA 2HHUA 4K42A 4WE1A 3IKMA 1BDGA 2B5JA 2FF6A 3VTHA 1ILYA 3OTOK 4OPAA 4YNQA 5HBMA 1NGCA 4DV3K 4PL7A 2E2OA 3PLAA 1E3MA 4J2BA 3OYMA 1RDWX 3DLGA 1QSLA 4K25A 4CEFA 4DV7K 4LF9K 1TKXA 5HOOA 2WUSA 3CXCM 2BH1A 4BC2A 3KWGA 5FPDA 1HNWK 5KRSA 2E2QA 1JXBA 3K9JA 1K8KA 3A5MC 3O4QA 3VA0A 2OPSA
chains in the Genus database with same CATH topology
4G1QA 1BGXT 1GOAA 3HPGA 2EX3A 1CZ9A 2YKNA 1I3AA 4KFBA 5JS2A 3DYAA 3P1GA 4FJMA 2XRIA 3OYLA 1TK8A 3AO4A 1WSFA 1T8EA 3L2RA 2OPPA 3AVAA 1X1PA 4O44A 4DQSA 1BQNA 4M3YA 3DLBA 3PO5A 4BACA 2F8TA 4W5NA 3VQDA 4CJSA 3V9SA 3NFAA 4CGDA 4RG8A 4I9QA 4CFCA 3TAMA 2D0AA 5C25A 3LDSA 1S9EA 3LP3A 4AHVA 3SUOA 4PA1A 1NJWA 3RR7A 5J2MA 3KD1E 4FYDA 5CYQA 4Q5VA 1S1XA 4IDKA 3NCIA 4CJEA 1C0MA 4C8MA 3AVBA 3O3FA 2KW4A 4B8AB 1CXQA 1HYVA 2YHAA 3KK2A 4E7LA 5I3UA 4ELUA 4KHYA 4FLXA 3ZSZA 3LANA 4M3TA 4FLYA 3KLEA 3SV4A 3MXIA 2X78A 3PY8A 2OZSA 4KHQA 4M3WA 4QAGA 4J2EA 1RTDA 2YV0X 1DTTA 3OS0A 2VWJA 5CY4A 3KD5E 4CHYA 5D3GA 3G10A 2F8SA 2JGUA 3AVCA 4B9LA 3TARA 1C1BA 4KO0A 3OYIA 1TKDA 4EZ9A 3K5LA 4FK0A 1Z25A 3L8BA 3ZSRA 3S9HA 4F4KA 4IKFA 3C6TA 1GOBA 3RMAA 3ZSVA 2X6SA 2AJQA 1U4BA 4I2QA 3MXJA 4DLEA 1NK4A 1VSEA 2ITGA 4ID5A 3AVFA 3ITHA 3AV9A 4FLVA 2FBXA 1TK0A 4YFUA 3LP1A 4BE1A 4DS5A 2LSNA 3V9ZA 5FROA 1LAVA 2ZQBA 1FKPA 1VSLA 3HSTB 3T19A 4CJQA 4E7IA 2XY8A 4DTJA 4FZYA 3B6OA 1HNVA 4JS4A 3NGZA 3OJUA 5J2NA 3DM2A 1YTAA 4OKJA 2HHQA 3LP0A 1ASWA 3TWHA 4HCCA 3DRSA 1ZBHA 2XO7A 2O4IA 4GW6A 4RW4A 2D0BA 5J2PA 4ELTA 2JLEA 4CE9A 2IAJA 3ULDA 4DSIA 5C24A 4OGCA 4AHUA 2FBYA 3MEGA 3QEXA 2HNZA 1XHZA 1WNSA 4O5BA 4CF2A 2G8FA 3SYZA 4DTRA 4FK4A 1TKTA 3F73A 3WNEA 1BQMA 3QEPA 1RT4A 1CZBA 4CJFA 3SQ4A 4DWIA 4Z4IA 4JLHA 3AO5A 4C8LA 3LP2A 4B8CA 1IKWA 3KLIA 1LV5A 1J5OA 2HB5A 1HQUA 4E89A 1LAWA 1U49A 3U3GA 1VSFA 2HMIA 4FJ5A 1ITGA 2HNDA 4DQRA 3DLHA 3H08A 1KLMA 3BGRA 3O3GA 5I42A 3K58A 3MECA 4CEAA 3HYFA 3RRHA 3EY1A 4PY5A 2KZZA 3ASMA 3VQ6A 4PQUA 1BI4A 2Z1GA 1W9HA 2OZMA 1HMVA 3OYBA 1D5AA 4AH9A 1C0TA 3V9UA 4JRPA 4FLZA 4FJKA 4KTQA 4CJUA 3TAQA 1G15A 3RWUA 1WAJA 3BDPA 2YNGA 4O0JA 2ZE2A 3ZT2A 3M8SA 3L3VA 1JLFA 3M8QA 4KB0A 4Y1DA 4N5SA 4DQPA 3I0SA 3PX6A 4DSKA 3NGYA 1VSJA 1L3SA 2G8KA 4E3SA 4KHUA 4MQ3A 3PO4A 2RN2A 5C42A 1JXEA 4DFJA 4E1NA 2QXFA 2Z1HA 3LZJA 3B6PA 5FDLA 2HHTA 3MAQA 4CHNA 3OVNA 4LD0A 2IOCA 1QHTA 1VSHA 1ZBLA 3V1RA 3PX4A 3HO1A 4QOZB 1LW0A 4CEOA 1S9GA 3AVLA 3AVIA 3DOKA 3V6DA 4M41A 2PYLA 3HP6A 3TR8A 4B9MA 5JS1A 2WOMA 3VQ7A 2Q3SA 4Y1CA 1NK8A 4B9NA 1GOCA 3CM6A 3SCXA 3KLHA 4OLBA 2IC3A 4E7JA 2X74A 1X9WA 3AVHA 3RTVA 1C1CA 4L8RB 1BISA 3D0PA 1TAQA 2VWKA 4I2PA 1RDBA 4IFVA 4CJVA 3IAYA 4KHNA 4B3OA 2HW3A 1HPZA 3DOLA 4W5RA 4HTUA 2OA8A 4W5QA 2QKBA 1TVRA 1LWEA 4CJ3A 3V1QA 4OKEA 4HCBA 2ZD1A 3WNHA 4XIUA 3AO3A 4DLGA 4EZ6A 3I0RA 5EU7A 1BCOA 5SWMA 3QEWA 3KTQA 4J2AA 1NK0A 1T7PA 4DFKA 5KRTA 2KFZA 1EP4A 1SL2A 1T05A 1KVAA 1L3VA 2B6AA 1XHXA 3DLKA 3HPOA 1NK6A 3P83D 5HROA 4E7KA 4O55A 1Q8IA 4DTOA 1ASVA 3HK2A 3SV3A 3L2UA 2HVIA 4CK3A 3QEIA 1VK0A 1BIUA 1RDDA 4LH4A 1RTIA 4CJLA 4TSXA 3QNOA 4FZZA 4KRFA 2P51A 1RTJA 3SQ0A 3SQ1A 3VN5A 1NK7A 4ELVA 2VG5A 1HQEA 3D45A 4KHWA 2E6LA 1JLCA 2VG7A 4ICLA 4Z4HA 4DTMA 3CFOA 4KKOA 3K57A 3OYCA 3DRPA 2E6MA 2IGIA 2DFHA 1BCMA 3ZSYA 4HUFA 2G8UA 3QINA 3G0ZA 4CEZA 1ASUA 3VQ8A 4HUGA 1TL3A 2RF2A 3RR8A 1I39A 3KJVA 1FXXA 1ZBFA 4KAZA 4CFDA 4C8OA 3ZT1A 3L2VA 4FJ8A 1KTQA 4B9TA 2QKKA 2XY7A 1JKHA 2GUIA 4C8KA 4IG3A 1BHLA 3ZSWA 1JLAA 5SZTA 4BE0A 2HHVA 1Z26A 4FCYA 4CHPA 1UOCA 4GMJB 1EX4A 3LAMA 3V81A 2YNIA 2IS3A 3NHGA 1U47A 3HVRA 4CJKA 4AILC 1T03A 1TGOA 3DLEA 4KB1A 4PWDA 3DI6A 1S1VA 1IO2A 5KI6A 4QCLA 4I9LA 2OPQA 2DFEA 3DRRA 1K6YA 1QSYA 3KLFA 4F3TA 2R7YA 3QEVA 2Z1JA 3TANA 3TAPA 1RT7A 1SKRA 3UIQA 4CIGA 2YNFA 3QERA 1D8YA 3RMDA 1JL1A 3O3HA 4DTSA 4OGEA 4W5OA 3EYZA 3ZSOA 3AVGA 5KTQA 3OY9A 3FFIA 2YKMA 3PV8A 5HRSA 4DSEA 3QNNA 4B9UA 1RT2A 4OPKA 4DQIA 1JLGA 1RDCA 1MU2A 1B9DA 4DS4A 2KFNA 3AVKA 1LWCA 3E01A 4FW1A 3HP9A 1JLBA 3IG1A 4OVLA 4FXDA 1HJRA 1SV5A 2NUBA 3S3OA 1NK9A 5T7BA 1L3TA 4UQGA 3RMBA 1B92A 5DMRA 3ZSQA 4CHQA 1RT6A 3CFRA 3PX0A 1NJXA 2P5OA 3NAEA 3CG7A 4AHCA 3V4IA 3AVMA 2GBZA 1IKVA 4OKKA 3KIOA 4DMNA 4FLWA 3C6UA 1L5UA 4FJHA 3NBPA 5DK5A 4DSFA 4CJ5A 4CF0A 1VRTA 2XY5A 1N5YA 1ZYQA 4LY7A 1RNHA 3LZIA 3U3YA 1QTMA 4CCHA 4CEEA 4DU3A 4Z4FA 4FM1A 2HVHA 2O4GA 3SI6A 1D9DA 1J9AA 1HYSA 3NH1A 4E7HA 4PUOA 2A1SA 3CQ8A 3ALYA 1RBUA 4JS5A 3NF7A 3ZCMA 1RDAA 1NKBA 3NF6A 1C1AA 4GVMA 4DF4A 3OYEA 3KKRA 4Z4CA 3L2WA 3VQ5A 3QIPA 2PY5A 3MEEA 4F3OA 1SKWA 1HNIA 2DFFA 3ZT0A 3SUPA 1RBVA 4FJGA 3TAGA 1XWLA 4H8KA 4M3UA 4EP4A 3DLRA 5K14A 4FZXC 1SL1A 4CJRA 4BDPA 4DU4A 1D9FA 3SPYA 4KI4A 1LWFA 4F2SA 4IFYA 1KVCA 3K5MA 4DSJA 3L3UA 4DF8A 1FK9A 3VA3A 4O0IA 2RPIA 3AA2A 2PZSA 4DFPA 4AHRA 3VQEA 1RT1A 3S3MA 4CF1A 3JYTA 3THVA 1S6QA 4CGJA 3F9KA 3OYAA 3KK1A 2KTQA 1A5WA 1U04A 1O1WA 1WAFA 2P5GA 1TAUA 4DFMA 3QETA 3A2FA 4MFBA 1FKOA 3O4NA 4ZHRA 4OLAA 3LWLA 3K2PA 1JLQA 4AHTA 4DSLA 3K59A 2X6NA 1EXQA 4NCAA 4BWJA 4BDYA 3QESA 5HLFA 1KLNA 1RT5A 4B08A 4CK1A 4R5PA 3QIOA 4N47A 4OPJA 2G8HA 2BGGA 2KQ2A 1RBSA 1HYZA 4FLTA 1A5XA 3ZSXA 3S3NA 5HRNA 1TV6A 2YHBA 1LW2A 1TKZA 4LSNA 1REVA 3OS2A 1HRHA 4KHSA 4LSLA 4CFAA 1DTQA 3SZ2A 4DTNA 1SKSA 1NJZA 3AVJA 1IH7A 1YVUA 4C8NA 3P5JA 3TI0A 3VQBA 4E1MA 2ETJA 3VQ9A 3HPHA 4H4OA 3U6FA 1KCFA 5J2QA 4EP5A 2EHGA 3SUQA 1ZBIA 3OYNA 3NGIA 1RCHA 4E0DA 1S1TA 1X9SA 1J54A 4CEBA 3SNNA 1ZBUA 3VQCA 1BI4B 4FJ9A 4E19A 1S1UA 2F96A 3K5OA 1NKCA 1KRPA 2ATQA 4N56A 3KLGA 4DTXA 4CEDA 3K5NA 4CIFA 1XI1A 3OYDA 1X9MA 4CGIA 2QK9A 2HHXA 3ISNC 2HNYA 1XC9A 3VQAA 3T3FA 1VSMA 3CFPA 1UA0A 1KVBA 4CJPA 2GV9A 4FJJA 1IKXA 1TK5A 4KPYA 4DTUA 4M3XA 5FRNA 1QQCA 5HRPA 4FM2A 3IRXA 4DU1A 4CFBA 3SPZA 1EKEA 2OPRA 3DMJA 4NYFA 3C94A 3LPUA 1RBRA 2Z1IA 2Y1IA 1NJYA 2OYQA 3JSMA 4N41A 2D5RA 2E4LA 3ZT3A 3V9XA 4Q0BA 1QSSA 1RTHA 4M3RA 1KSPA 1S5JA 1QE1A 2WONA 3TAEA 2G8IA 3HM9A 1TL1A 4KREA 4NYNA 3CYMA 4OJRA 4K8XA 1J53A 3AO1A 4IG0A 1IKYA 4FJNA 1KFDA 3SQ2A 4ZTJA 2DY4A 1WN7A 4O4GA 5KGXA 1NK5A 2P1JA 2FBVA 1S6PA 3IS9A 5HP1A 4I7FA 1C0UA 1WSJA 1L3UA 3KK3A 4F2RA 4B9SA 2G8VA 3HJFA 4KI6A 1IG9A 1UAXA 3CM5A 3T1AA 3TAFA 1EETA 2D0CA 2PYJA 1JL2A 3HVTA 1Y97A 1C6VA 3HT3A 4DQQA 4M3ZA 1NOZA 4CGHA 3C95A 2G8WA 1U48A 4FK2A 3MEDA 4NCGA 3VQ4A 1F21A 3HL8A 2B4JA 2FC0A 3NH2A 5CZ1A 4KTWA 3I8DA 1W0HA 4FJ7A 1RBTA 4RW6A 4CGFA 1WSEA 1U45A 4FJIA 3NDKA 2HHSA 3AA4A 4FVMA 4KV8A 1NOYA 4CF9A 4HUEA 3TABA 3LAKA 3NH0A 3V9WA 4RW7A 2VG6A 4BWMA 3OJSA 4RW8A 4CHZA 1N6QA 3OYHA 3OYKA 4HVJA 4B9VA 1Q9YA 3KKSA 3OYGA 4NCBA 3SJJA 4FW2A 4CJTA 1B9FA 1VSIA 3RMCA 3M8RA 4J2DA 1BIZA 1JLEA 3PUFA 1YT3A 5HRRA 3NE6A 1UWBA 1VSDA 3MXMA 1KFSA 4F8RA 3AVNA 4FJLA 4Z4EA 1A5VA 3QO9A 3OYFA 4FM0A 3LWMA 4FLUA 5CYMA 1NKEA 4N76A 3M8PA 1RILA 3VQQA 5CZ2A 4HHTA 4K8ZA 1YTUA 4JRQA 4Z4GA 3AO2A 1SUQA 4Z0UA 1VSKA 2IDOA 5J1EA 1QS4A 4IBNA 4ID1A 2DTUA 4RW9A 4CF8A 3V1OA 3L2QA 1VRUA 4CHOA 4DTPA 3WNFA 2KZMA 4H4MA 3RRGA 1CLQA 3SUNA 1R0AA 2HHUA 4WE1A 3HXMA 2A1RA 2XHBA 2B5JA 4CECA 2BDPA 4CEQA 2HHWA 4LH5A 1SL0A 1CXUA 5E41A 3LPTA 1DLOA 4BE2A 3ZT4A 4YNQA 5HBMA 3AA3A 4CJ4A 4FJXA 2FBTA 2YNHA 3LALA 1Q9XA 4J2BA 2BANA 1WLJA 3OYMA 2BE2A 2Y1JA 3DLGA 4M45A 1QSLA 4CEFA 4DG1A 1WSGA 4ZTFA 4CERA 1TKXA 1WSHA 1UA1A 3NF9A 1RT3A 3NF8A 2XY6A 4W5TA 4CK2A 3OS1A 2I5JA 5FRMA 3OYJA 3EZ5A 5KGWA 4BDZA 5KRSA 1WSIA 1BL3A 3AA5X 4AHSA 4CIEA 1JXBA 4KTZA 2W42A 4M42A 4CGGA 2RKIA 4CESA 3QLHA 3WNGA 3VQPA 3O4QA 1S1WA 3VA0A 4CJWA 2OPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1Q A;  1BGX T;  1GOA A;  3HPG A;  2EX3 A;  1CZ9 A;  2YKN A;  1I3A A;  4KFB A;  5JS2 A;  3DYA A;  3P1G A;  4FJM A;  2XRI A;  3OYL A;  1TK8 A;  3AO4 A;  1WSF A;  1T8E A;  3L2R A;  2OPP A;  3AVA A;  1X1P A;  4O44 A;  4DQS A;  1BQN A;  4M3Y A;  3DLB A;  3PO5 A;  4BAC A;  2F8T A;  4W5N A;  3VQD A;  4CJS A;  3V9S A;  3NFA A;  4CGD A;  4RG8 A;  4I9Q A;  4CFC A;  3TAM A;  2D0A A;  5C25 A;  3LDS A;  1S9E A;  3LP3 A;  4AHV A;  3SUO A;  4PA1 A;  1NJW A;  3RR7 A;  5J2M A;  3KD1 E;  4FYD A;  5CYQ A;  4Q5V A;  1S1X A;  4IDK A;  3NCI A;  4CJE A;  1C0M A;  4C8M A;  3AVB A;  3O3F A;  2KW4 A;  4B8A B;  1CXQ A;  1HYV A;  2YHA A;  3KK2 A;  4E7L A;  5I3U A;  4ELU A;  4KHY A;  4FLX A;  3ZSZ A;  3LAN A;  4M3T A;  4FLY A;  3KLE A;  3SV4 A;  3MXI A;  2X78 A;  3PY8 A;  2OZS A;  4KHQ A;  4M3W A;  4QAG A;  4J2E A;  1RTD A;  2YV0 X;  1DTT A;  3OS0 A;  2VWJ A;  5CY4 A;  3KD5 E;  4CHY A;  5D3G A;  3G10 A;  2F8S A;  2JGU A;  3AVC A;  4B9L A;  3TAR A;  1C1B A;  4KO0 A;  3OYI A;  1TKD A;  4EZ9 A;  3K5L A;  4FK0 A;  1Z25 A;  3L8B A;  3ZSR A;  3S9H A;  4F4K A;  4IKF A;  3C6T A;  1GOB A;  3RMA A;  3ZSV A;  2X6S A;  2AJQ A;  1U4B A;  4I2Q A;  3MXJ A;  4DLE A;  1NK4 A;  1VSE A;  2ITG A;  4ID5 A;  3AVF A;  3ITH A;  3AV9 A;  4FLV A;  2FBX A;  1TK0 A;  4YFU A;  3LP1 A;  4BE1 A;  4DS5 A;  2LSN A;  3V9Z A;  5FRO A;  1LAV A;  2ZQB A;  1FKP A;  1VSL A;  3HST B;  3T19 A;  4CJQ A;  4E7I A;  2XY8 A;  4DTJ A;  4FZY A;  3B6O A;  1HNV A;  4JS4 A;  3NGZ A;  3OJU A;  5J2N A;  3DM2 A;  1YTA A;  4OKJ A;  2HHQ A;  3LP0 A;  1ASW A;  3TWH A;  4HCC A;  3DRS A;  1ZBH A;  2XO7 A;  2O4I A;  4GW6 A;  4RW4 A;  2D0B A;  5J2P A;  4ELT A;  2JLE A;  4CE9 A;  2IAJ A;  3ULD A;  4DSI A;  5C24 A;  4OGC A;  4AHU A;  2FBY A;  3MEG A;  3QEX A;  2HNZ A;  1XHZ A;  1WNS A;  4O5B A;  4CF2 A;  2G8F A;  3SYZ A;  4DTR A;  4FK4 A;  1TKT A;  3F73 A;  3WNE A;  1BQM A;  3QEP A;  1RT4 A;  1CZB A;  4CJF A;  3SQ4 A;  4DWI A;  4Z4I A;  4JLH A;  3AO5 A;  4C8L A;  3LP2 A;  4B8C A;  1IKW A;  3KLI A;  1LV5 A;  1J5O A;  2HB5 A;  1HQU A;  4E89 A;  1LAW A;  1U49 A;  3U3G A;  1VSF A;  2HMI A;  4FJ5 A;  1ITG A;  2HND A;  4DQR A;  3DLH A;  3H08 A;  1KLM A;  3BGR A;  3O3G A;  5I42 A;  3K58 A;  3MEC A;  4CEA A;  3HYF A;  3RRH A;  3EY1 A;  4PY5 A;  2KZZ A;  3ASM A;  3VQ6 A;  4PQU A;  1BI4 A;  2Z1G A;  1W9H A;  2OZM A;  1HMV A;  3OYB A;  1D5A A;  4AH9 A;  1C0T A;  3V9U A;  4JRP A;  4FLZ A;  4FJK A;  4KTQ A;  4CJU A;  3TAQ A;  1G15 A;  3RWU A;  1WAJ A;  3BDP A;  2YNG A;  4O0J A;  2ZE2 A;  3ZT2 A;  3M8S A;  3L3V A;  1JLF A;  3M8Q A;  4KB0 A;  4Y1D A;  4N5S A;  4DQP A;  3I0S A;  3PX6 A;  4DSK A;  3NGY A;  1VSJ A;  1L3S A;  2G8K A;  4E3S A;  4KHU A;  4MQ3 A;  3PO4 A;  2RN2 A;  5C42 A;  1JXE A;  4DFJ A;  4E1N A;  2QXF A;  2Z1H A;  3LZJ A;  3B6P A;  5FDL A;  2HHT A;  3MAQ A;  4CHN A;  3OVN A;  4LD0 A;  2IOC A;  1QHT A;  1VSH A;  1ZBL A;  3V1R A;  3PX4 A;  3HO1 A;  4QOZ B;  1LW0 A;  4CEO A;  1S9G A;  3AVL A;  3AVI A;  3DOK A;  3V6D A;  4M41 A;  2PYL A;  3HP6 A;  3TR8 A;  4B9M A;  5JS1 A;  2WOM A;  3VQ7 A;  2Q3S A;  4Y1C A;  1NK8 A;  4B9N A;  1GOC A;  3CM6 A;  3SCX A;  3KLH A;  4OLB A;  2IC3 A;  4E7J A;  2X74 A;  1X9W A;  3AVH A;  3RTV A;  1C1C A;  4L8R B;  1BIS A;  3D0P A;  1TAQ A;  2VWK A;  4I2P A;  1RDB A;  4IFV A;  4CJV A;  3IAY A;  4KHN A;  4B3O A;  2HW3 A;  1HPZ A;  3DOL A;  4W5R A;  4HTU A;  2OA8 A;  4W5Q A;  2QKB A;  1TVR A;  1LWE A;  4CJ3 A;  3V1Q A;  4OKE A;  4HCB A;  2ZD1 A;  3WNH A;  4XIU A;  3AO3 A;  4DLG A;  4EZ6 A;  3I0R A;  5EU7 A;  1BCO A;  5SWM A;  3QEW A;  3KTQ A;  4J2A A;  1NK0 A;  1T7P A;  4DFK A;  5KRT A;  2KFZ A;  1EP4 A;  1SL2 A;  1T05 A;  1KVA A;  1L3V A;  2B6A A;  1XHX A;  3DLK A;  3HPO A;  1NK6 A;  3P83 D;  5HRO A;  4E7K A;  4O55 A;  1Q8I A;  4DTO A;  1ASV A;  3HK2 A;  3SV3 A;  3L2U A;  2HVI A;  4CK3 A;  3QEI A;  1VK0 A;  1BIU A;  1RDD A;  4LH4 A;  1RTI A;  4CJL A;  4TSX A;  3QNO A;  4FZZ A;  4KRF A;  2P51 A;  1RTJ A;  3SQ0 A;  3SQ1 A;  3VN5 A;  1NK7 A;  4ELV A;  2VG5 A;  1HQE A;  3D45 A;  4KHW A;  2E6L A;  1JLC A;  2VG7 A;  4ICL A;  4Z4H A;  4DTM A;  3CFO A;  4KKO A;  3K57 A;  3OYC A;  3DRP A;  2E6M A;  2IGI A;  2DFH A;  1BCM A;  3ZSY A;  4HUF A;  2G8U A;  3QIN A;  3G0Z A;  4CEZ A;  1ASU A;  3VQ8 A;  4HUG A;  1TL3 A;  2RF2 A;  3RR8 A;  1I39 A;  3KJV A;  1FXX A;  1ZBF A;  4KAZ A;  4CFD A;  4C8O A;  3ZT1 A;  3L2V A;  4FJ8 A;  1KTQ A;  4B9T A;  2QKK A;  2XY7 A;  1JKH A;  2GUI A;  4C8K A;  4IG3 A;  1BHL A;  3ZSW A;  1JLA A;  5SZT A;  4BE0 A;  2HHV A;  1Z26 A;  4FCY A;  4CHP A;  1UOC A;  4GMJ B;  1EX4 A;  3LAM A;  3V81 A;  2YNI A;  2IS3 A;  3NHG A;  1U47 A;  3HVR A;  4CJK A;  4AIL C;  1T03 A;  1TGO A;  3DLE A;  4KB1 A;  4PWD A;  3DI6 A;  1S1V A;  1IO2 A;  5KI6 A;  4QCL A;  4I9L A;  2OPQ A;  2DFE A;  3DRR A;  1K6Y A;  1QSY A;  3KLF A;  4F3T A;  2R7Y A;  3QEV A;  2Z1J A;  3TAN A;  3TAP A;  1RT7 A;  1SKR A;  3UIQ A;  4CIG A;  2YNF A;  3QER A;  1D8Y A;  3RMD A;  1JL1 A;  3O3H A;  4DTS A;  4OGE A;  4W5O A;  3EYZ A;  3ZSO A;  3AVG A;  5KTQ A;  3OY9 A;  3FFI A;  2YKM A;  3PV8 A;  5HRS A;  4DSE A;  3QNN A;  4B9U A;  1RT2 A;  4OPK A;  4DQI A;  1JLG A;  1RDC A;  1MU2 A;  1B9D A;  4DS4 A;  2KFN A;  3AVK A;  1LWC A;  3E01 A;  4FW1 A;  3HP9 A;  1JLB A;  3IG1 A;  4OVL A;  4FXD A;  1HJR A;  1SV5 A;  2NUB A;  3S3O A;  1NK9 A;  5T7B A;  1L3T A;  4UQG A;  3RMB A;  1B92 A;  5DMR A;  3ZSQ A;  4CHQ A;  1RT6 A;  3CFR A;  3PX0 A;  1NJX A;  2P5O A;  3NAE A;  3CG7 A;  4AHC A;  3V4I A;  3AVM A;  2GBZ A;  1IKV A;  4OKK A;  3KIO A;  4DMN A;  4FLW A;  3C6U A;  1L5U A;  4FJH A;  3NBP A;  5DK5 A;  4DSF A;  4CJ5 A;  4CF0 A;  1VRT A;  2XY5 A;  1N5Y A;  1ZYQ A;  4LY7 A;  1RNH A;  3LZI A;  3U3Y A;  1QTM A;  4CCH A;  4CEE A;  4DU3 A;  4Z4F A;  4FM1 A;  2HVH A;  2O4G A;  3SI6 A;  1D9D A;  1J9A A;  1HYS A;  3NH1 A;  4E7H A;  4PUO A;  2A1S A;  3CQ8 A;  3ALY A;  1RBU A;  4JS5 A;  3NF7 A;  3ZCM A;  1RDA A;  1NKB A;  3NF6 A;  1C1A A;  4GVM A;  4DF4 A;  3OYE A;  3KKR A;  4Z4C A;  3L2W A;  3VQ5 A;  3QIP A;  2PY5 A;  3MEE A;  4F3O A;  1SKW A;  1HNI A;  2DFF A;  3ZT0 A;  3SUP A;  1RBV A;  4FJG A;  3TAG A;  1XWL A;  4H8K A;  4M3U A;  4EP4 A;  3DLR A;  5K14 A;  4FZX C;  1SL1 A;  4CJR A;  4BDP A;  4DU4 A;  1D9F A;  3SPY A;  4KI4 A;  1LWF A;  4F2S A;  4IFY A;  1KVC A;  3K5M A;  4DSJ A;  3L3U A;  4DF8 A;  1FK9 A;  3VA3 A;  4O0I A;  2RPI A;  3AA2 A;  2PZS A;  4DFP A;  4AHR A;  3VQE A;  1RT1 A;  3S3M A;  4CF1 A;  3JYT A;  3THV A;  1S6Q A;  4CGJ A;  3F9K A;  3OYA A;  3KK1 A;  2KTQ A;  1A5W A;  1U04 A;  1O1W A;  1WAF A;  2P5G A;  1TAU A;  4DFM A;  3QET A;  3A2F A;  4MFB A;  1FKO A;  3O4N A;  4ZHR A;  4OLA A;  3LWL A;  3K2P A;  1JLQ A;  4AHT A;  4DSL A;  3K59 A;  2X6N A;  1EXQ A;  4NCA A;  4BWJ A;  4BDY A;  3QES A;  5HLF A;  1KLN A;  1RT5 A;  4B08 A;  4CK1 A;  4R5P A;  3QIO A;  4N47 A;  4OPJ A;  2G8H A;  2BGG A;  2KQ2 A;  1RBS A;  1HYZ A;  4FLT A;  1A5X A;  3ZSX A;  3S3N A;  5HRN A;  1TV6 A;  2YHB A;  1LW2 A;  1TKZ A;  4LSN A;  1REV A;  3OS2 A;  1HRH A;  4KHS A;  4LSL A;  4CFA A;  1DTQ A;  3SZ2 A;  4DTN A;  1SKS A;  1NJZ A;  3AVJ A;  1IH7 A;  1YVU A;  4C8N A;  3P5J A;  3TI0 A;  3VQB A;  4E1M A;  2ETJ A;  3VQ9 A;  3HPH A;  4H4O A;  3U6F A;  1KCF A;  5J2Q A;  4EP5 A;  2EHG A;  3SUQ A;  1ZBI A;  3OYN A;  3NGI A;  1RCH A;  4E0D A;  1S1T A;  1X9S A;  1J54 A;  4CEB A;  3SNN A;  1ZBU A;  3VQC A;  1BI4 B;  4FJ9 A;  4E19 A;  1S1U A;  2F96 A;  3K5O A;  1NKC A;  1KRP A;  2ATQ A;  4N56 A;  3KLG A;  4DTX A;  4CED A;  3K5N A;  4CIF A;  1XI1 A;  3OYD A;  1X9M A;  4CGI A;  2QK9 A;  2HHX A;  3ISN C;  2HNY A;  1XC9 A;  3VQA A;  3T3F A;  1VSM A;  3CFP A;  1UA0 A;  1KVB A;  4CJP A;  2GV9 A;  4FJJ A;  1IKX A;  1TK5 A;  4KPY A;  4DTU A;  4M3X A;  5FRN A;  1QQC A;  5HRP A;  4FM2 A;  3IRX A;  4DU1 A;  4CFB A;  3SPZ A;  1EKE A;  2OPR A;  3DMJ A;  4NYF A;  3C94 A;  3LPU A;  1RBR A;  2Z1I A;  2Y1I A;  1NJY A;  2OYQ A;  3JSM A;  4N41 A;  2D5R A;  2E4L A;  3ZT3 A;  3V9X A;  4Q0B A;  1QSS A;  1RTH A;  4M3R A;  1KSP A;  1S5J A;  1QE1 A;  2WON A;  3TAE A;  2G8I A;  3HM9 A;  1TL1 A;  4KRE A;  4NYN A;  3CYM A;  4OJR A;  4K8X A;  1J53 A;  3AO1 A;  4IG0 A;  1IKY A;  4FJN A;  1KFD A;  3SQ2 A;  4ZTJ A;  2DY4 A;  1WN7 A;  4O4G A;  5KGX A;  1NK5 A;  2P1J A;  2FBV A;  1S6P A;  3IS9 A;  5HP1 A;  4I7F A;  1C0U A;  1WSJ A;  1L3U A;  3KK3 A;  4F2R A;  4B9S A;  2G8V A;  3HJF A;  4KI6 A;  1IG9 A;  1UAX A;  3CM5 A;  3T1A A;  3TAF A;  1EET A;  2D0C A;  2PYJ A;  1JL2 A;  3HVT A;  1Y97 A;  1C6V A;  3HT3 A;  4DQQ A;  4M3Z A;  1NOZ A;  4CGH A;  3C95 A;  2G8W A;  1U48 A;  4FK2 A;  3MED A;  4NCG A;  3VQ4 A;  1F21 A;  3HL8 A;  2B4J A;  2FC0 A;  3NH2 A;  5CZ1 A;  4KTW A;  3I8D A;  1W0H A;  4FJ7 A;  1RBT A;  4RW6 A;  4CGF A;  1WSE A;  1U45 A;  4FJI A;  3NDK A;  2HHS A;  3AA4 A;  4FVM A;  4KV8 A;  1NOY A;  4CF9 A;  4HUE A;  3TAB A;  3LAK A;  3NH0 A;  3V9W A;  4RW7 A;  2VG6 A;  4BWM A;  3OJS A;  4RW8 A;  4CHZ A;  1N6Q A;  3OYH A;  3OYK A;  4HVJ A;  4B9V A;  1Q9Y A;  3KKS A;  3OYG A;  4NCB A;  3SJJ A;  4FW2 A;  4CJT A;  1B9F A;  1VSI A;  3RMC A;  3M8R A;  4J2D A;  1BIZ A;  1JLE A;  3PUF A;  1YT3 A;  5HRR A;  3NE6 A;  1UWB A;  1VSD A;  3MXM A;  1KFS A;  4F8R A;  3AVN A;  4FJL A;  4Z4E A;  1A5V A;  3QO9 A;  3OYF A;  4FM0 A;  3LWM A;  4FLU A;  5CYM A;  1NKE A;  4N76 A;  3M8P A;  1RIL A;  3VQQ A;  5CZ2 A;  4HHT A;  4K8Z A;  1YTU A;  4JRQ A;  4Z4G A;  3AO2 A;  1SUQ A;  4Z0U A;  1VSK A;  2IDO A;  5J1E A;  1QS4 A;  4IBN A;  4ID1 A;  2DTU A;  4RW9 A;  4CF8 A;  3V1O A;  3L2Q A;  1VRU A;  4CHO A;  4DTP A;  3WNF A;  2KZM A;  4H4M A;  3RRG A;  1CLQ A;  3SUN A;  1R0A A;  2HHU A;  4WE1 A;  3HXM A;  2A1R A;  2XHB A;  2B5J A;  4CEC A;  2BDP A;  4CEQ A;  2HHW A;  4LH5 A;  1SL0 A;  1CXU A;  5E41 A;  3LPT A;  1DLO A;  4BE2 A;  3ZT4 A;  4YNQ A;  5HBM A;  3AA3 A;  4CJ4 A;  4FJX A;  2FBT A;  2YNH A;  3LAL A;  1Q9X A;  4J2B A;  2BAN A;  1WLJ A;  3OYM A;  2BE2 A;  2Y1J A;  3DLG A;  4M45 A;  1QSL A;  4CEF A;  4DG1 A;  1WSG A;  4ZTF A;  4CER A;  1TKX A;  1WSH A;  1UA1 A;  3NF9 A;  1RT3 A;  3NF8 A;  2XY6 A;  4W5T A;  4CK2 A;  3OS1 A;  2I5J A;  5FRM A;  3OYJ A;  3EZ5 A;  5KGW A;  4BDZ A;  5KRS A;  1WSI A;  1BL3 A;  3AA5 X;  4AHS A;  4CIE A;  1JXB A;  4KTZ A;  2W42 A;  4M42 A;  4CGG A;  2RKI A;  4CES A;  3QLH A;  3WNG A;  3VQP A;  3O4Q A;  1S1W A;  3VA0 A;  4CJW A;  2OPS A; 
#chains in the Genus database with same CATH topology
 1BGX T;  3HPG A;  4WFN L;  1EO1 A;  4KFB A;  5JS2 A;  1TK8 A;  1WSF A;  2A6A A;  5JVH L;  2OPP A;  3AVA A;  4DQS A;  1BQN A;  4BAC A;  3O9S A;  4CJS A;  5AQU A;  4I9Q A;  4CFC A;  3AAQ A;  3RR7 A;  4FYD A;  3DJC A;  5CYQ A;  1S1X A;  4IDK A;  4CJE A;  4M63 C;  1CXQ A;  2FF3 B;  3VET A;  4FWP A;  4M3T A;  2UXD K;  2P9S A;  4BQZ A;  1HJO A;  3E9O A;  2VWJ A;  1OH6 A;  3KD5 E;  5D3G A;  2HST A;  4B9L A;  1C1B A;  3OYI A;  4FK0 A;  3S9H A;  3CD6 N;  3I8B A;  4JI2 K;  1U4B A;  4DLE A;  1XMO K;  2FBX A;  3HSC A;  2VGM A;  3G25 A;  4BG9 A;  2ZQB A;  1VSL A;  4FZY A;  3T19 A;  4CJQ A;  4NO7 A;  2HF3 A;  1SZ2 A;  1QVG M;  3FZK A;  2GWJ A;  2V7Y A;  3LP0 A;  4HCC A;  3DRS A;  1VQ7 N;  4RW4 A;  4ELT A;  2E2P A;  4DSI A;  4O5B A;  1RDU A;  4V19 S;  4A2A A;  4Z4I A;  4BR5 A;  3SQ4 A;  4DWI A;  3TPQ A;  3THX A;  4BGB A;  3U4L A;  1GLA G;  3WEE B;  1OH7 A;  4LF4 K;  4NXM K;  3K58 A;  3IUC A;  4CEA A;  3I33 A;  1LOT B;  3M3Z A;  4JV5 K;  2W41 A;  3P31 A;  1KC8 O;  4FLZ A;  4CJU A;  3EZW A;  1G15 A;  3RWU A;  2YI1 A;  3KVG A;  2A5X A;  4KB0 A;  4LFA K;  1D4X A;  3I0S A;  4H0X B;  5E84 A;  3ENO A;  3MCP A;  3PO4 A;  2RN2 A;  4E1N A;  3N4P A;  2P9K B;  2HHT A;  3MAQ A;  1NGD A;  3OVN A;  1QHT A;  2HBM A;  1ZBL A;  3V1R A;  4WQ4 A;  1S9G A;  3AVI A;  3HP6 A;  4H5R A;  2WOM A;  3VGM A;  3J7Z O;  4JK7 A;  1GOC A;  3CM6 A;  2E5L K;  5EXW A;  3SCX A;  1Q7Y O;  4E7J A;  4YOU A;  3AVH A;  5E26 A;  1BIS A;  3D0P A;  4IFV A;  2ASM A;  2VWK A;  4B3O A;  2D1K A;  5AFU A;  2ZM6 K;  1HPZ A;  2BTF A;  4CJ7 A;  4HTU A;  2QKB A;  3VF6 A;  2CGJ A;  5EU7 A;  2KHO A;  3QEW A;  3KTQ A;  4DFK A;  5AQQ A;  4AQY K;  1T05 A;  4FWQ A;  1XHX A;  3AAP A;  4NXN K;  3ZLJ A;  2HVI A;  3ULE B;  1Q81 O;  1BIU A;  1RDD A;  1RTI A;  4KRF A;  3SQ0 A;  3SQ1 A;  3N4Q A;  2VG5 A;  3D45 A;  1JLC A;  3CFO A;  3VGL A;  2E6M A;  3QIC A;  3DXM B;  1ASU A;  4WQ4 C;  2QEX N;  3L4I A;  1KTQ A;  1NGA A;  5AQX A;  4B9T A;  3GL1 A;  4IG3 A;  1BHL A;  5SZT A;  4H5V A;  2KKZ A;  1V4T A;  3PIP L;  4BRN A;  2FSK A;  1NNE A;  2KLA A;  1TGO A;  5BN8 A;  4KB1 A;  1S1V A;  3AGK A;  5KI6 A;  4FWS A;  1XMQ K;  1NWK A;  3DRR A;  1K6Y A;  1QSY A;  3KLF A;  2E2N A;  3TAN A;  2YNF A;  4JKH A;  4OGE A;  4W5O A;  4FWR A;  5KTQ A;  4X62 K;  3VTI A;  4BY9 C;  4Y0W A;  3TTF A;  4OPK A;  4DQI A;  2UYT A;  3W3D A;  5FPN A;  3AVK A;  1LWC A;  3E01 A;  3IG1 A;  1HJR A;  1SV5 A;  5AZJ A;  1NK9 A;  3THW B;  2O8F A;  4UQG A;  3ZX2 A;  1YVN A;  2E1Y A;  1T6D A;  3AVM A;  1FW6 A;  3O9T A;  1IBM K;  1VQN N;  3KIO A;  3MWT A;  4FLW A;  1L5U A;  3NBP A;  5DK5 A;  4DSF A;  4CF0 A;  2ZJR L;  1NMD A;  2XY5 A;  3MK6 A;  4LF7 K;  4BRH A;  1U6Z A;  3VEN A;  3LZI A;  1YAG A;  4DU3 A;  3WQU A;  4R79 A;  2HVH A;  3SI6 A;  5GAG P;  3ALY A;  3R6M A;  4ILH A;  4JS5 A;  3ZCM A;  2JWK A;  1G99 A;  3OYE A;  3KKR A;  3MEE A;  3VGK A;  4JI3 K;  4XH5 A;  2DFF A;  3ZT0 A;  1RBV A;  5F1X A;  1VHX A;  4BDP A;  4CJR A;  2GWK A;  3DXK B;  1D9F A;  1LWF A;  4F2S A;  1KVC A;  3D6R A;  5M1O A;  1WUA A;  3SAF A;  3VA3 A;  3G71 N;  4XEI A;  3MX5 A;  1VQ8 N;  1I94 K;  3S3M A;  4JI7 K;  3MX2 A;  3THV A;  2KTQ A;  3F9K A;  3A5O C;  1A5W A;  1U04 A;  2HBK A;  4YHH K;  2AP1 A;  3O4N A;  4M7Y A;  3LWL A;  1VQP N;  4BWJ A;  4BDY A;  5GAD P;  4EHT A;  4R5P A;  5BPN A;  3QIO A;  4ILJ A;  3K0S A;  2BGG A;  1QQM A;  3CJC A;  1HYZ A;  5ADX H;  4FLT A;  3ZSX A;  2QA4 N;  3P4I A;  2YHB A;  3OS2 A;  1QHA A;  1N36 K;  4CFA A;  3O6W A;  2QWP A;  3RSE B;  4B3T K;  3TI0 A;  2EHG A;  4FJ9 A;  4CEB A;  1ZBU A;  2Q1N A;  1BI4 B;  3ENB A;  4ISF A;  4KH4 A;  2ATQ A;  4DV4 K;  4CED A;  4CIF A;  1GLL O;  3ISN C;  2HHX A;  3OW2 M;  4CZI A;  3R1X A;  2GV9 A;  3T69 A;  4RWT A;  4M3X A;  3CCQ N;  3IRX A;  2WFB A;  4XH1 A;  3SPZ A;  2Y1I A;  4N41 A;  1YXQ A;  3FR0 A;  2E4L A;  2VCP A;  3SMS A;  4WQ5 A;  1KSP A;  2G8I A;  3ATU A;  1JCE A;  4JD2 B;  2UUA K;  3SQ2 A;  4O4G A;  3IS9 A;  3KK3 A;  2QWN A;  4B9S A;  2G8V A;  3NMU A;  2BUP A;  1EET A;  3QFU A;  4QS9 A;  4QS7 A;  4IOX A;  2O8C A;  1JL2 A;  1Y97 A;  1C6V A;  1NOZ A;  2P9N B;  3VQ4 A;  1NGG A;  2B4J A;  3I8D A;  2WBN A;  5BPL A;  4BRO A;  1WSE A;  1U45 A;  2P9I A;  3NDK A;  3O5B A;  1NOY A;  4CF9 A;  1QQN A;  4B1Y B;  3V9W A;  5AQV A;  4BWM A;  2A42 A;  4CHZ A;  1N6Q A;  2F4V K;  1N8R O;  1DT9 A;  4NCB A;  3SJJ A;  4FW2 A;  3K9K A;  4CJT A;  1BO5 O;  3W0L A;  1VSI A;  3RMC A;  3M8R A;  1K9M O;  4DV2 K;  3J8A A;  1BIZ A;  1JLE A;  3PUF A;  5HRR A;  4FWK A;  4F8R A;  5HL7 L;  3QO9 A;  2ASO A;  3EEQ A;  4N76 A;  1RIL A;  3VQQ A;  5CZ2 A;  2OAN A;  4Z0U A;  3IFR A;  4IBN A;  2DTU A;  4CF8 A;  3V1O A;  3MWP A;  1VRU A;  3B8A X;  3CC2 N;  1ATR A;  1GLB G;  4O5F A;  3HXM A;  2ITM A;  3ATV A;  5AQM A;  5LMN K;  4B3R K;  3LPT A;  2E20 A;  1S22 A;  2UXC K;  3AA3 A;  4FJX A;  2FBT A;  3VF4 A;  2YNH A;  3LAL A;  1Q9X A;  3MN7 A;  2P9U B;  2BAN A;  1WLJ A;  2BE2 A;  4H0V B;  3UKU A;  1T3V A;  4ZTF A;  1WSH A;  1UA1 A;  1RT3 A;  4BRA A;  4W5T A;  5AZI A;  4CK2 A;  2I5J A;  3OS1 A;  1X3M A;  2IVN A;  3EN9 A;  5KGW A;  1WSI A;  2W42 A;  1QZ5 A;  2P9L A;  2E88 A;  2UU9 K;  2RKI A;  4FVU A;  1BA1 A;  3NVM A;  1VQ4 N;  5T7B A;  2EWS A;  2JWL A;  3OHR A;  5ELZ A;  4DR4 K;  3DYA A;  2D4W A;  4FJM A;  2XRI A;  1WOQ A;  4FWO A;  3AO4 A;  3E66 A;  1T8E A;  3FZL A;  3L2R A;  1X1P A;  4O44 A;  3A5L C;  3DLB A;  3PO5 A;  4W5N A;  3VQD A;  3L0Q A;  3GOI A;  4CBU A;  2D0A A;  5C25 A;  4QCL A;  3GE1 A;  5J2M A;  3KD1 E;  1KAZ A;  4Q5V A;  3NCI A;  1J6Z A;  1C0M A;  4C8M A;  3AVB A;  3EO3 A;  5GIP A;  2KW4 A;  4B8A B;  4ELU A;  3HBT A;  4YOY A;  3CI5 A;  3LDP A;  4FLY A;  3VEZ A;  1DEJ A;  3KLE A;  2X78 A;  4CVN E;  2OZS A;  4KHQ A;  4CBX A;  3VMF B;  4QAG A;  4M3W A;  4MO4 A;  4CHY A;  4JHD A;  3AVC A;  3TAR A;  2NZT A;  3K5L A;  3F2K A;  3GDQ A;  3WT0 A;  3C6T A;  2AJQ A;  2YCH A;  1IJJ A;  1VQ9 N;  3LP1 A;  4DS5 A;  4I6M B;  4AF1 A;  3VEY A;  2LSN A;  3V9Z A;  4JI0 K;  1FKP A;  4CZL A;  2YHX A;  1HNV A;  3B6O A;  4JS4 A;  3NGZ A;  2QWL A;  4OKJ A;  4ILG B;  2QWO A;  1ZBH A;  4GW6 A;  1P90 A;  3ULD A;  4CE9 A;  2YJF A;  4OGC A;  2FBY A;  3QEX A;  2HNZ A;  1XHZ A;  4CF2 A;  5AQF A;  4DTR A;  1YHQ N;  1TKT A;  3WNE A;  4DV0 K;  1RT4 A;  1CZB A;  4JLH A;  1IKW A;  1U49 A;  4CD1 A;  3U3G A;  1VSF A;  3BF3 A;  1ITG A;  4DQR A;  1KLM A;  3EL2 A;  4A5A A;  1YIT N;  3MEC A;  4JEP A;  3DLL L;  4PQU A;  2Z1G A;  3E1Y A;  4IOC L;  4DR2 K;  1HMV A;  5AQT A;  2UXB K;  1D5A A;  5AQG A;  4DR1 K;  2H3G X;  4DCH A;  3TAQ A;  2PBD A;  1WAJ A;  4O0J A;  3R9P A;  3SBT A;  3M8S A;  1NLV A;  3M8Q A;  4Y1D A;  3PX6 A;  3LDN A;  1L3S A;  4KHU A;  4UY8 O;  3T1Y K;  5C42 A;  4DFJ A;  2Z1H A;  3CCS N;  5TKW A;  4LD0 A;  2IOC A;  3OA9 A;  3HO1 A;  3HZ6 A;  3PX4 A;  3AVL A;  5LJW A;  3DOK A;  2PYL A;  4JKG A;  2HF4 A;  2X74 A;  4X66 K;  1RDB A;  4CJV A;  4KHN A;  4OX9 K;  2HW3 A;  4W5Q A;  3C6A A;  2VQF K;  2VQE K;  4HCB A;  4XIU A;  3AO3 A;  3CJB A;  4C23 A;  4EZ6 A;  3I0R A;  4KBO A;  3MN5 A;  3WXK A;  2KFZ A;  1SL2 A;  2B6A A;  3P83 D;  1X9J A;  4E7K A;  4O55 A;  4DTO A;  1ASV A;  3KWI A;  4GVE A;  1VK0 A;  4CJL A;  4TSX A;  2AA4 A;  1RTJ A;  1YI2 N;  1NGE A;  2VG7 A;  3FZF A;  4KKO A;  4JYA K;  1Y64 A;  3DRP A;  4HUF A;  1BCM A;  4PL8 A;  3ZSY A;  2G8U A;  3G0Z A;  2QWR A;  3CQX A;  1TL3 A;  2RF2 A;  3RR8 A;  3KJV A;  4C8O A;  4FWM A;  3ZT1 A;  2P9P A;  2QKK A;  2XY7 A;  5H1S Q;  4C8K A;  3ZSW A;  2HHV A;  1Z26 A;  1FJG K;  4FCY A;  1UOC A;  4LF6 K;  4LC9 B;  4B9Q A;  3V81 A;  5M1N A;  4AIL C;  1T03 A;  3FLC O;  2IVO A;  2OPQ A;  5KQ8 A;  2VWB A;  3FE1 A;  2V51 B;  2A3Z A;  2Z1J A;  4CIG A;  3O3H A;  4DTS A;  3QBX A;  3ZSO A;  3BEX A;  4H0P A;  3FFI A;  4LFB K;  2YKM A;  5C12 A;  5HRS A;  3PV8 A;  4BR9 A;  3QNN A;  1RT2 A;  1RDC A;  2O8D A;  2KFN A;  1NGF A;  3HP9 A;  1XQS C;  1L3T A;  3O9Q A;  1B92 A;  5DMR A;  3ZSQ A;  3PX0 A;  3O9U A;  4BRC A;  5DM7 L;  3V4I A;  4OKK A;  2GBZ A;  2CGK A;  2QI2 A;  3UKR A;  3C6U A;  3FGU A;  4FJH A;  3ZYY X;  4FOI A;  5I9E B;  4LY7 A;  1RNH A;  2GEL A;  3LDO A;  4PKG A;  3U3Y A;  1QTM A;  4CEE A;  3EE9 A;  4H5N A;  4G9Z A;  2P9S B;  5AQL A;  1EQY A;  3BP8 A;  4Z4F A;  4FM1 A;  2O4G A;  1J9A A;  2Q31 A;  4IJA A;  3NH1 A;  3CQ8 A;  3HOS A;  3NF6 A;  4DF4 A;  4Z4C A;  3QIP A;  4F3O A;  1T6C A;  3SUP A;  1VQM N;  4PKI A;  2F9W A;  3TSU A;  4K43 A;  4DU4 A;  4H0Y B;  3SPY A;  2IIR A;  4KI4 A;  3TSP A;  4IFY A;  3K5M A;  3TTC A;  5JLH A;  4O0I A;  2PFU A;  3VQE A;  2QM1 A;  4CF1 A;  1ZXO A;  4CGJ A;  2FSJ A;  2OTL N;  1WAF A;  4JK8 A;  4MFB A;  1FKO A;  2D0O A;  1JLQ A;  4NCA A;  4DR6 K;  3QES A;  4B08 A;  4CK1 A;  3TSQ A;  5LJV A;  5M1F A;  1A5X A;  3KZB A;  5EOY A;  1YIJ N;  3THX B;  3WUH A;  1REV A;  3MN6 A;  4KHS A;  4DTN A;  1HKG A;  1SKS A;  4BRP A;  1NJZ A;  5GIO A;  1YVU A;  3VQB A;  3CJ7 A;  3U6F A;  3CCE N;  3SUQ A;  3NGI A;  4E0D A;  1S1T A;  1GLE G;  1TYQ A;  4H03 B;  2E8A A;  4E19 A;  4YOR A;  1S1U A;  2UUC K;  2WTU A;  4CBW A;  4N56 A;  3KLG A;  4DTX A;  4PHT X;  5IWA K;  4CGI A;  3CMA N;  2HNY A;  3CCV N;  1IKX A;  4KPY A;  3C0B A;  1NU0 A;  1XNQ K;  4JI6 K;  5HRP A;  1P8Z A;  5AQH A;  2IVP A;  1ZBS A;  3C94 A;  3ZX3 A;  1RBR A;  2Z1I A;  1MDU B;  3JSM A;  3CJA A;  3V9X A;  3H46 O;  1QSS A;  1JJ2 M;  1RTH A;  4M3R A;  2F9T A;  3HM9 A;  1TL1 A;  4NYN A;  4JKB A;  1KD1 O;  1HLU A;  1M1K O;  3M5R A;  1WN7 A;  2NRH A;  2P1J A;  4F2R A;  1C0U A;  3F5T A;  1E4F T;  3HJF A;  3CCR N;  2F7T A;  3T1A A;  2D0C A;  3D2E A;  4OO1 J;  4BRF A;  2PYJ A;  3HOT A;  4B1X B;  1GLC G;  3ID6 A;  4CGH A;  4KH5 A;  3DXK A;  1F21 A;  4H0T B;  4DUZ K;  4JAX A;  2FC0 A;  1NMN A;  1GLD G;  3TTD A;  2O8B A;  5JLF A;  3H3O B;  5EY4 A;  4DQ8 A;  3CME N;  5M1K A;  2NNW A;  5CR4 A;  3U9Z A;  3LAK A;  4HUE A;  3NH0 A;  4RW8 A;  4K0K K;  3OYH A;  4B3M K;  4HVJ A;  2YX6 A;  1Q9Y A;  4O8K A;  4JNE A;  1YT3 A;  3Q7B A;  1VSD A;  3AVN A;  1A5V A;  4FM0 A;  5AQR A;  3LWM A;  3RSE A;  1NKE A;  1WB9 A;  4K8Z A;  1YTU A;  4Z4G A;  1SUQ A;  5J1E A;  2IDO A;  1NGI A;  4ID1 A;  4RW9 A;  3JS6 A;  3L2Q A;  4A59 A;  1SAZ A;  4IEI A;  3RRG A;  4CZJ A;  1YJ9 N;  2RHK A;  2XHB A;  5AQO A;  4CEQ A;  4OPH A;  5FPE A;  1CXU A;  3CJ1 A;  1DLO A;  3PSI A;  5C10 A;  3ZT4 A;  5FLX O;  4CJ4 A;  1X3N A;  1BU6 O;  2NRV A;  2ASP A;  4IJN A;  1N32 K;  3CCU N;  4DG1 A;  1WSG A;  4CER A;  4YOX A;  4Z94 A;  3NF9 A;  3NF8 A;  5KQD A;  3CCJ N;  2XY6 A;  5FRM A;  4JKA A;  1VQO N;  3S41 A;  1BL3 A;  3QB0 A;  4CIE A;  4CGG A;  2Q2R A;  3QLH A;  5AZJ B;  3VQP A;  2O8F B;  3U8X A;  3D2F A;  1S1W A;  4CJW A;  2V7Z A;  5CHI A;  1ATN A;  1GOA A;  2P9N A;  2EX3 A;  1CZ9 A;  2YKN A;  3Q7C A;  4FWL A;  4YY3 K;  3J7Y P;  4YOV A;  2D0P A;  4BRE A;  4M3Y A;  4RG8 A;  3TAM A;  3LP3 A;  4AHV A;  3AY9 A;  4PA1 A;  4B1U B;  2FSN A;  4U7B A;  1U2V A;  1NGJ A;  4E1J A;  5I3U A;  3KK2 A;  2YHA A;  1E4G T;  4FLX A;  3H45 C;  3C7N A;  4EIA A;  3ZET A;  4CI6 A;  4J2E A;  1RTD A;  2YV0 X;  3AAR A;  3OS0 A;  4MO5 A;  5CY4 A;  2F8S A;  4KO0 A;  4EZ9 A;  4CZG A;  4IKF A;  3ZSR A;  4F4K A;  2X6S A;  4IO9 L;  4MDB A;  4WYB A;  1NK4 A;  1VSE A;  4ID5 A;  3AVF A;  3ITH A;  3AV9 A;  1TK0 A;  3BZC A;  5JMV A;  3ZX0 A;  3OBY A;  3HST B;  4E7I A;  2HOE A;  4U67 L;  2CH6 A;  3AGR A;  5J2N A;  1YTA A;  5LL6 Z;  2O4I A;  4HWI A;  3G4S N;  5J2P A;  2JLE A;  1XUP O;  5C24 A;  4AHU A;  4DV1 K;  1WNS A;  3SMP A;  4DR5 K;  2G8F A;  1QQO A;  1M90 O;  5AJ3 K;  2FLO A;  5EX5 A;  5BR8 K;  4C8L A;  3LP2 A;  3UB5 A;  3KLI A;  3D7E O;  1J5O A;  2HB5 A;  1HQU A;  4E89 A;  1LAW A;  3EE8 A;  4GV3 A;  3NVK A;  3H08 A;  3BGR A;  4CD3 A;  3ZEU A;  5MLC Q;  3ASM A;  2HHH K;  1W9H A;  2HBJ A;  3OYB A;  5M1Q A;  3A8Y A;  4FJK A;  4KTQ A;  2GX9 A;  4A61 A;  3THY A;  3BDP A;  2YNG A;  3G6E N;  2ZE2 A;  3EKS A;  3ZT2 A;  3L3V A;  4DQP A;  3NGY A;  5GAE P;  4CZE A;  4RCH A;  5KPT A;  2DPN A;  1JXE A;  3L4Q A;  5AR0 A;  2QXF A;  3LZJ A;  1K8A O;  3BZK A;  4RTF D;  1MA9 B;  1TUU A;  2O8C B;  3MCA B;  4M41 A;  1V4S A;  5JS1 A;  3TR8 A;  1IBK K;  3DAW A;  2Q3S A;  4Y1C A;  1NK8 A;  4B9N A;  3KLH A;  4BG8 A;  1X9W A;  2I7P A;  1S3X A;  5A2Q O;  3RTV A;  2P9I B;  4L8R B;  1TAQ A;  3MMV A;  4I2P A;  3IAY A;  2O8E A;  4W5R A;  2OA8 A;  2CGL A;  4PKH A;  1TVR A;  3C6H A;  4B1W B;  3QFP A;  2ZD1 A;  3WNH A;  4DLG A;  4BRQ A;  1H1V A;  4QS8 A;  5AQP A;  1T7P A;  1RGI A;  5KRT A;  1DGK N;  3LDQ A;  3QML A;  4IFE A;  1WBB A;  3H1V X;  1NK6 A;  1BOT O;  1Q8I A;  1Z05 A;  3EKU A;  4JI1 K;  4YDU A;  3L2U A;  1O13 A;  5TKY A;  4LH4 A;  5DM6 L;  3VN5 A;  3WXJ A;  4Z4H A;  4ICL A;  1MWK A;  3K57 A;  3OYC A;  3O08 A;  5LMU K;  2IGI A;  3QIN A;  5C0Y A;  3VQ8 A;  2ZJQ L;  4HUG A;  1WBD A;  2E1Z A;  1FXX A;  3VEV A;  4CZH A;  4BE0 A;  1GLF O;  4CHP A;  4BRL A;  4GMJ B;  3UKU B;  2YNI A;  1R59 O;  1U47 A;  2YHY A;  3DLE A;  1IO2 A;  5AZI B;  1OH5 A;  3VEX A;  2DFE A;  5AFU H;  4BVP A;  4C1N K;  4F3T A;  2P9L B;  3QEV A;  3TAP A;  1RT7 A;  3UIQ A;  3QER A;  4FPB A;  4DSE A;  4NLC A;  4YDU C;  1JLG A;  4JI5 K;  1MU2 A;  1B9D A;  2VGN A;  5JVG L;  1LCU A;  2QWM A;  1KXP A;  1JLB A;  3MN9 A;  4FXD A;  3S3O A;  5ADX A;  1HR0 K;  3CFR A;  2P5O A;  3NAE A;  4FSV A;  4DHY A;  4AHC A;  4DV5 K;  4NB4 A;  4CJ5 A;  1VRT A;  1Q82 O;  4WCE L;  3J80 O;  4FO0 A;  4CCH A;  3U9D A;  5AQS A;  1GLJ O;  1HYS A;  4E7H A;  4PUO A;  5C2D A;  1RBU A;  3NF7 A;  4IEE A;  1C1A A;  4JHD B;  3CCL N;  3VEO A;  2VYP A;  1ATS A;  3GBT A;  5LY3 A;  1SKW A;  1HNI A;  4JKF A;  1XWL A;  3DLR A;  5K14 A;  3KK7 A;  1SL1 A;  3O1W A;  4JKE A;  4BRI A;  1JCG A;  4IDH A;  1S72 N;  3M1F A;  1FK9 A;  2Q0U A;  1Q86 O;  2RPI A;  3AA2 A;  2PZS A;  1HKB A;  4AHR A;  3OYA A;  3TU5 A;  3KK1 A;  1TAU A;  3QET A;  4ZHR A;  4J8F A;  2ZF5 O;  3K2P A;  4AHT A;  4DSL A;  3K59 A;  5KPZ A;  1EXQ A;  3SAH A;  1KLN A;  1RT5 A;  2ZWH A;  3LDL A;  4N47 A;  4OPJ A;  3T1H K;  1RBS A;  4A5B A;  1TV6 A;  1TKZ A;  5AQI A;  2PAV A;  5AQK A;  1ESV A;  1DTQ A;  3SZ2 A;  3AVJ A;  1IH7 A;  2ETJ A;  3VQ9 A;  3HPH A;  4EP5 A;  3OYN A;  4MLE A;  3J7A P;  3E9L A;  3SNN A;  2F96 A;  4GY2 B;  1NKC A;  4MDA A;  1KRP A;  5M1P A;  4BC3 A;  3OYD A;  1X9M A;  2QK9 A;  3WEE A;  3VQA A;  3T3F A;  5BPM A;  4FJJ A;  1TK5 A;  4DTU A;  2QWQ A;  1QQC A;  4DU1 A;  4CFB A;  4DKW A;  2OPR A;  4NYF A;  3LPU A;  2OYQ A;  1EWR A;  4GKJ K;  2WON A;  4KRE A;  4OJR A;  1KFD A;  2W6K A;  1HKC A;  4ZTJ A;  1OKJ A;  2DY4 A;  4I7F A;  1VAZ A;  4CW7 B;  2NLX A;  2P9K A;  4JKG B;  1IG9 A;  2NRW A;  4WFB L;  2QTD A;  1K8K B;  1IG8 A;  4DQQ A;  3HVT A;  3P38 A;  4LFC K;  5IT9 O;  2ZGY A;  5BN9 A;  2G8W A;  1U48 A;  4FK2 A;  3MED A;  4NCG A;  2NRR A;  1VQ5 N;  4JKD A;  4X65 K;  3NH2 A;  4KTW A;  4FPA A;  3I55 N;  1W0H A;  3H6E A;  3AA4 A;  4FVM A;  3R3L A;  3LM9 A;  3TAB A;  4RW7 A;  2VG6 A;  3C65 A;  3OYK A;  4YOT A;  3KKS A;  3SAG A;  4BRD A;  3OBW A;  3NE6 A;  1UWB A;  3T7Z A;  1KFS A;  4FJL A;  4GKK K;  3ENH A;  4A2B A;  4BR2 A;  5BRF A;  5CYM A;  2QXL A;  1RFQ A;  4HHT A;  4EFH A;  3ULE A;  4JRQ A;  1VQL N;  2I7N A;  5BRE A;  2P9P B;  4DTP A;  3WNF A;  1VQK N;  4JN4 A;  2Q0R A;  3SUN A;  1R0A A;  1IBL K;  1XNR K;  2A1R A;  3CET A;  2FXU A;  3DXM A;  4CEC A;  2BDP A;  2HHW A;  4B1Z A;  4LH5 A;  1SL0 A;  5E41 A;  4BE2 A;  4BR4 A;  3SK3 A;  1SQK A;  4EHU A;  2Y1J A;  4JI8 K;  4M45 A;  1MWM A;  1NGH A;  3CF5 L;  1BG3 A;  1QZ6 A;  3OYJ A;  3EZ5 A;  2O8D B;  4BDZ A;  2G8K A;  4M42 A;  3AA5 X;  4AHS A;  4KTZ A;  4CES A;  3WNG A;  5F2R A;  2KZZ A;  4IOA L;  1YJN N;  4G1Q A;  1I3A A;  3HTV A;  3P1G A;  3UKR B;  3PIO L;  3OYL A;  4LF5 K;  1NGB A;  3SJH A;  2F8T A;  3V9S A;  3NFA A;  3CC4 N;  4CGD A;  4AM7 A;  3THW A;  2V52 B;  4EAH D;  3LDS A;  1S9E A;  3SUO A;  1NJW A;  1C0G A;  1YF5 L;  3O3F A;  3VOV A;  1HYV A;  4E7L A;  4KHY A;  3ZSZ A;  3CHW A;  3LAN A;  4C1N I;  3SV4 A;  3MXI A;  3PY8 A;  3LM2 A;  1DTT A;  3CER A;  2GUP A;  4GV6 A;  3G10 A;  2JGU A;  1NBW A;  4BRK A;  1TKD A;  1Z25 A;  3L8B A;  1GOB A;  3RMA A;  3ZSV A;  4AM6 A;  4I2Q A;  3MXJ A;  2ITG A;  4FLV A;  4YFU A;  4BE1 A;  1KQS M;  1KAY A;  5FRO A;  1LAV A;  2ZGZ A;  4DTJ A;  2XY8 A;  3H3N O;  3OJU A;  2NRZ A;  3DM2 A;  3HI0 A;  1ZC6 A;  2RE2 A;  2HHQ A;  1ASW A;  3TWH A;  2XO7 A;  3VF2 A;  2D0B A;  5BRD A;  2IAJ A;  4FWN A;  3J81 O;  3MEG A;  3M6G A;  3SYZ A;  4FK4 A;  3F73 A;  1BQM A;  3QEP A;  4CJF A;  3AO5 A;  4BQL A;  1TYQ B;  4B8C A;  3CCM N;  1LV5 A;  2HBL A;  2HMI A;  4FJ5 A;  4BC4 A;  4DR7 K;  3CPW M;  2HND A;  3DLH A;  3A5N C;  5F0X A;  5C2F A;  4HTL A;  3O3G A;  5I42 A;  3HYF A;  3RRH A;  3EY1 A;  4PY5 A;  5GIN A;  3VQ6 A;  4GV9 A;  1BI4 A;  3FZH A;  4H5T A;  2OZM A;  4AH9 A;  1C0T A;  3V9U A;  4JRP A;  5KPR A;  1Z6R A;  1HUX A;  4CZM A;  3BF1 A;  1JLF A;  4N5S A;  1HPM A;  3DWL A;  4DSK A;  3H1Q A;  1VSJ A;  4E3S A;  4MQ3 A;  4FL9 A;  1T44 A;  3PSF A;  5AQW A;  3B6P A;  5FDL A;  4CHN A;  4JI4 K;  2HMP A;  3GG4 A;  4QOZ B;  1VSH A;  3D2E B;  5AQZ A;  1LW0 A;  3WXM B;  4JD2 A;  4CEO A;  4BGA A;  3CQY A;  3V6D A;  4B9M A;  1NJI O;  3VQ7 A;  3QDK A;  1N33 K;  2O8B B;  1HX1 A;  3CIP A;  4OLB A;  2IC3 A;  3CPE A;  1C1C A;  1EWQ A;  3DOL A;  1C0F A;  1LWE A;  4CJ3 A;  3V1Q A;  4OKE A;  4M7X A;  1TUY A;  5SWM A;  4J2A A;  1BCO A;  3WQT A;  5FPM A;  1NK0 A;  1EP4 A;  3VER A;  1KVA A;  4WFA L;  4A57 A;  1L3V A;  3HPO A;  3DLK A;  4B3S K;  5HRO A;  3HK2 A;  3SV3 A;  4CK3 A;  3QEI A;  3QNO A;  2A41 A;  1NG9 A;  5AQY A;  4FZZ A;  2P51 A;  1NK7 A;  4ELV A;  1HQE A;  2NRX A;  4KHW A;  2E6L A;  4DTM A;  2YHW A;  2DFH A;  4CEZ A;  5AQN A;  1I39 A;  1ZBF A;  4KAZ A;  2GTD A;  4BR0 A;  2GEM A;  4CFD A;  3L2V A;  4FJ8 A;  3CC7 N;  1JKH A;  4ISG A;  2GUI A;  4XH4 A;  4ISE A;  5B8H A;  4YOW A;  1JLA A;  1BA0 A;  3E9P A;  1EX4 A;  3JXU A;  3LAM A;  4BR7 A;  3LL3 A;  2IS3 A;  3NHG A;  3HVR A;  4CJK A;  3KHY A;  4PWD A;  3DI6 A;  1W2B M;  4I9L A;  3VES A;  1QVF M;  2P9U A;  2R7Y A;  1SKR A;  4IXC A;  3O9R A;  1D8Y A;  4JK9 A;  3D2F B;  3RMD A;  5BRH A;  1JL1 A;  3EYZ A;  3AVG A;  3OY9 A;  1BWF O;  3VEW A;  4B9U A;  3IDH A;  5C15 A;  4DS4 A;  4FW1 A;  4OVL A;  2YJE A;  2NUB A;  3R8E A;  2A40 A;  4NLB A;  3RMB A;  3O4W A;  1NJX A;  4CHQ A;  1RT6 A;  3CG7 A;  2WC9 A;  1JCF A;  3HRG A;  1IKV A;  3O1B A;  3ID8 A;  2OCE A;  4DMN A;  1U2V B;  3SBG A;  1N5Y A;  1ZYQ A;  3FZM A;  5BR9 A;  3C7N B;  3P39 A;  1D9D A;  3ZET B;  2ZJP L;  2A1S A;  4WQ5 C;  3I56 N;  1RDA A;  1NKB A;  4JKC A;  1KAX A;  4GVM A;  1N34 K;  5JIC A;  3L2W A;  2PY5 A;  3VQ5 A;  2CH5 A;  4MLH A;  4WF9 L;  3TAG A;  4FJG A;  3IMX A;  4H8K A;  4LF8 K;  4EP4 A;  4M3U A;  1OH8 A;  4FZX C;  1W97 L;  4B1V A;  4DV6 K;  3VPZ A;  2W40 A;  4DSJ A;  3L3U A;  4DF8 A;  3FFK B;  4DFP A;  2OTJ N;  4BRM A;  1RT1 A;  3JYT A;  1S6Q A;  4O8U A;  1IV0 A;  1O1W A;  2NRT A;  2P5G A;  4I6M A;  4DFM A;  3A2F A;  4OLA A;  1CZA N;  2X6N A;  3WXI A;  5HLF A;  2G8H A;  2KQ2 A;  1VQ6 N;  4GNI A;  1NM1 A;  3S3N A;  1BUP A;  5HRN A;  5AQJ A;  1LW2 A;  3RVC A;  3L6Q A;  4IWV A;  4LSN A;  1HRH A;  4LSL A;  3O8M A;  4C8N A;  3P5J A;  4E1M A;  4H4O A;  3HM8 A;  1KCF A;  5J2Q A;  5GAH P;  3ZEU B;  5EVZ A;  1ZBI A;  1RCH A;  3F9M A;  1X9S A;  1J54 A;  3VQC A;  4IO8 A;  3K5O A;  1XI1 A;  3K5N A;  1Q18 A;  4BC5 A;  4IZ9 A;  1XC9 A;  3UE5 A;  1HNZ K;  1VSM A;  3CFP A;  3THY B;  1KVB A;  4CJP A;  3QBW A;  1UA0 A;  3SLC A;  5FRN A;  3BUZ B;  2Q97 A;  4FM2 A;  4DR3 K;  1EKE A;  3DMJ A;  1NJY A;  2D5R A;  3ZT3 A;  5CE3 A;  4Q0B A;  2Q36 A;  1S5J A;  1QE1 A;  1OVQ A;  3TAE A;  3CYM A;  4K8X A;  1J53 A;  3AO1 A;  4IG0 A;  1IKY A;  3BY5 A;  4FJN A;  4F9O A;  3A0I X;  5KGX A;  1YJW N;  1NK5 A;  2FBV A;  1S6P A;  5HP1 A;  1L3U A;  1WSJ A;  1SS6 A;  4CZF A;  1HNX K;  4KI6 A;  1UAX A;  3CM5 A;  3TAF A;  2O8E B;  3HT3 A;  2QW9 A;  4M3Z A;  1XC3 A;  3C95 A;  4FOE A;  3O80 A;  3HL8 A;  4H0O A;  1YUW A;  5CZ1 A;  2J4R A;  4FJ7 A;  1RBT A;  4RW6 A;  4CGF A;  4FJI A;  2HHS A;  1W7A A;  3JAM O;  4KV8 A;  4KHP K;  4DUY K;  4H5W A;  2UUB K;  3OJS A;  1OVY A;  4A62 A;  4B9V A;  4BRG A;  4BVO A;  3OYG A;  4KH6 A;  1B9F A;  4J2D A;  4X64 K;  3CJ9 A;  1J5E K;  2W6L A;  3MXM A;  4Z4E A;  4K41 A;  3OYF A;  3WXL A;  4FLU A;  4CZK A;  3M8P A;  3AO2 A;  1K73 O;  1VSK A;  1QS4 A;  3MDQ A;  4CHO A;  1DKG D;  4L3Q A;  2KZM A;  4H4M A;  4DB3 A;  1CLQ A;  2HHU A;  4K42 A;  4WE1 A;  3IKM A;  1BDG A;  2B5J A;  2FF6 A;  3VTH A;  1ILY A;  3OTO K;  4OPA A;  4YNQ A;  5HBM A;  1NGC A;  4DV3 K;  4PL7 A;  2E2O A;  3PLA A;  1E3M A;  4J2B A;  3OYM A;  1RDW X;  3DLG A;  1QSL A;  4K25 A;  4CEF A;  4DV7 K;  4LF9 K;  1TKX A;  5HOO A;  2WUS A;  3CXC M;  2BH1 A;  4BC2 A;  3KWG A;  5FPD A;  1HNW K;  5KRS A;  2E2Q A;  1JXB A;  3K9J A;  1K8K A;  3A5M C;  3O4Q A;  3VA0 A;  2OPS A; 
#chains in the Genus database with same CATH homology
 4G1Q A;  1BGX T;  1GOA A;  3HPG A;  2EX3 A;  1CZ9 A;  2YKN A;  1I3A A;  4KFB A;  5JS2 A;  3DYA A;  3P1G A;  4FJM A;  2XRI A;  3OYL A;  1TK8 A;  3AO4 A;  1WSF A;  1T8E A;  3L2R A;  2OPP A;  3AVA A;  1X1P A;  4O44 A;  4DQS A;  1BQN A;  4M3Y A;  3DLB A;  3PO5 A;  4BAC A;  2F8T A;  4W5N A;  3VQD A;  4CJS A;  3V9S A;  3NFA A;  4CGD A;  4RG8 A;  4I9Q A;  4CFC A;  3TAM A;  2D0A A;  5C25 A;  3LDS A;  1S9E A;  3LP3 A;  4AHV A;  3SUO A;  4PA1 A;  1NJW A;  3RR7 A;  5J2M A;  3KD1 E;  4FYD A;  5CYQ A;  4Q5V A;  1S1X A;  4IDK A;  3NCI A;  4CJE A;  1C0M A;  4C8M A;  3AVB A;  3O3F A;  2KW4 A;  4B8A B;  1CXQ A;  1HYV A;  2YHA A;  3KK2 A;  4E7L A;  5I3U A;  4ELU A;  4KHY A;  4FLX A;  3ZSZ A;  3LAN A;  4M3T A;  4FLY A;  3KLE A;  3SV4 A;  3MXI A;  2X78 A;  3PY8 A;  2OZS A;  4KHQ A;  4M3W A;  4QAG A;  4J2E A;  1RTD A;  2YV0 X;  1DTT A;  3OS0 A;  2VWJ A;  5CY4 A;  3KD5 E;  4CHY A;  5D3G A;  3G10 A;  2F8S A;  2JGU A;  3AVC A;  4B9L A;  3TAR A;  1C1B A;  4KO0 A;  3OYI A;  1TKD A;  4EZ9 A;  3K5L A;  4FK0 A;  1Z25 A;  3L8B A;  3ZSR A;  3S9H A;  4F4K A;  4IKF A;  3C6T A;  1GOB A;  3RMA A;  3ZSV A;  2X6S A;  2AJQ A;  1U4B A;  4I2Q A;  3MXJ A;  4DLE A;  1NK4 A;  1VSE A;  2ITG A;  4ID5 A;  3AVF A;  3ITH A;  3AV9 A;  4FLV A;  2FBX A;  1TK0 A;  4YFU A;  3LP1 A;  4BE1 A;  4DS5 A;  2LSN A;  3V9Z A;  5FRO A;  1LAV A;  2ZQB A;  1FKP A;  1VSL A;  3HST B;  3T19 A;  4CJQ A;  4E7I A;  2XY8 A;  4DTJ A;  4FZY A;  3B6O A;  1HNV A;  4JS4 A;  3NGZ A;  3OJU A;  5J2N A;  3DM2 A;  1YTA A;  4OKJ A;  2HHQ A;  3LP0 A;  1ASW A;  3TWH A;  4HCC A;  3DRS A;  1ZBH A;  2XO7 A;  2O4I A;  4GW6 A;  4RW4 A;  2D0B A;  5J2P A;  4ELT A;  2JLE A;  4CE9 A;  2IAJ A;  3ULD A;  4DSI A;  5C24 A;  4OGC A;  4AHU A;  2FBY A;  3MEG A;  3QEX A;  2HNZ A;  1XHZ A;  1WNS A;  4O5B A;  4CF2 A;  2G8F A;  3SYZ A;  4DTR A;  4FK4 A;  1TKT A;  3F73 A;  3WNE A;  1BQM A;  3QEP A;  1RT4 A;  1CZB A;  4CJF A;  3SQ4 A;  4DWI A;  4Z4I A;  4JLH A;  3AO5 A;  4C8L A;  3LP2 A;  4B8C A;  1IKW A;  3KLI A;  1LV5 A;  1J5O A;  2HB5 A;  1HQU A;  4E89 A;  1LAW A;  1U49 A;  3U3G A;  1VSF A;  2HMI A;  4FJ5 A;  1ITG A;  2HND A;  4DQR A;  3DLH A;  3H08 A;  1KLM A;  3BGR A;  3O3G A;  5I42 A;  3K58 A;  3MEC A;  4CEA A;  3HYF A;  3RRH A;  3EY1 A;  4PY5 A;  2KZZ A;  3ASM A;  3VQ6 A;  4PQU A;  1BI4 A;  2Z1G A;  1W9H A;  2OZM A;  1HMV A;  3OYB A;  1D5A A;  4AH9 A;  1C0T A;  3V9U A;  4JRP A;  4FLZ A;  4FJK A;  4KTQ A;  4CJU A;  3TAQ A;  1G15 A;  3RWU A;  1WAJ A;  3BDP A;  2YNG A;  4O0J A;  2ZE2 A;  3ZT2 A;  3M8S A;  3L3V A;  1JLF A;  3M8Q A;  4KB0 A;  4Y1D A;  4N5S A;  4DQP A;  3I0S A;  3PX6 A;  4DSK A;  3NGY A;  1VSJ A;  1L3S A;  2G8K A;  4E3S A;  4KHU A;  4MQ3 A;  3PO4 A;  2RN2 A;  5C42 A;  1JXE A;  4DFJ A;  4E1N A;  2QXF A;  2Z1H A;  3LZJ A;  3B6P A;  5FDL A;  2HHT A;  3MAQ A;  4CHN A;  3OVN A;  4LD0 A;  2IOC A;  1QHT A;  1VSH A;  1ZBL A;  3V1R A;  3PX4 A;  3HO1 A;  4QOZ B;  1LW0 A;  4CEO A;  1S9G A;  3AVL A;  3AVI A;  3DOK A;  3V6D A;  4M41 A;  2PYL A;  3HP6 A;  3TR8 A;  4B9M A;  5JS1 A;  2WOM A;  3VQ7 A;  2Q3S A;  4Y1C A;  1NK8 A;  4B9N A;  1GOC A;  3CM6 A;  3SCX A;  3KLH A;  4OLB A;  2IC3 A;  4E7J A;  2X74 A;  1X9W A;  3AVH A;  3RTV A;  1C1C A;  4L8R B;  1BIS A;  3D0P A;  1TAQ A;  2VWK A;  4I2P A;  1RDB A;  4IFV A;  4CJV A;  3IAY A;  4KHN A;  4B3O A;  2HW3 A;  1HPZ A;  3DOL A;  4W5R A;  4HTU A;  2OA8 A;  4W5Q A;  2QKB A;  1TVR A;  1LWE A;  4CJ3 A;  3V1Q A;  4OKE A;  4HCB A;  2ZD1 A;  3WNH A;  4XIU A;  3AO3 A;  4DLG A;  4EZ6 A;  3I0R A;  5EU7 A;  1BCO A;  5SWM A;  3QEW A;  3KTQ A;  4J2A A;  1NK0 A;  1T7P A;  4DFK A;  5KRT A;  2KFZ A;  1EP4 A;  1SL2 A;  1T05 A;  1KVA A;  1L3V A;  2B6A A;  1XHX A;  3DLK A;  3HPO A;  1NK6 A;  3P83 D;  5HRO A;  4E7K A;  4O55 A;  1Q8I A;  4DTO A;  1ASV A;  3HK2 A;  3SV3 A;  3L2U A;  2HVI A;  4CK3 A;  3QEI A;  1VK0 A;  1BIU A;  1RDD A;  4LH4 A;  1RTI A;  4CJL A;  4TSX A;  3QNO A;  4FZZ A;  4KRF A;  2P51 A;  1RTJ A;  3SQ0 A;  3SQ1 A;  3VN5 A;  1NK7 A;  4ELV A;  2VG5 A;  1HQE A;  3D45 A;  4KHW A;  2E6L A;  1JLC A;  2VG7 A;  4ICL A;  4Z4H A;  4DTM A;  3CFO A;  4KKO A;  3K57 A;  3OYC A;  3DRP A;  2E6M A;  2IGI A;  2DFH A;  1BCM A;  3ZSY A;  4HUF A;  2G8U A;  3QIN A;  3G0Z A;  4CEZ A;  1ASU A;  3VQ8 A;  4HUG A;  1TL3 A;  2RF2 A;  3RR8 A;  1I39 A;  3KJV A;  1FXX A;  1ZBF A;  4KAZ A;  4CFD A;  4C8O A;  3ZT1 A;  3L2V A;  4FJ8 A;  1KTQ A;  4B9T A;  2QKK A;  2XY7 A;  1JKH A;  2GUI A;  4C8K A;  4IG3 A;  1BHL A;  3ZSW A;  1JLA A;  5SZT A;  4BE0 A;  2HHV A;  1Z26 A;  4FCY A;  4CHP A;  1UOC A;  4GMJ B;  1EX4 A;  3LAM A;  3V81 A;  2YNI A;  2IS3 A;  3NHG A;  1U47 A;  3HVR A;  4CJK A;  4AIL C;  1T03 A;  1TGO A;  3DLE A;  4KB1 A;  4PWD A;  3DI6 A;  1S1V A;  1IO2 A;  5KI6 A;  4QCL A;  4I9L A;  2OPQ A;  2DFE A;  3DRR A;  1K6Y A;  1QSY A;  3KLF A;  4F3T A;  2R7Y A;  3QEV A;  2Z1J A;  3TAN A;  3TAP A;  1RT7 A;  1SKR A;  3UIQ A;  4CIG A;  2YNF A;  3QER A;  1D8Y A;  3RMD A;  1JL1 A;  3O3H A;  4DTS A;  4OGE A;  4W5O A;  3EYZ A;  3ZSO A;  3AVG A;  5KTQ A;  3OY9 A;  3FFI A;  2YKM A;  3PV8 A;  5HRS A;  4DSE A;  3QNN A;  4B9U A;  1RT2 A;  4OPK A;  4DQI A;  1JLG A;  1RDC A;  1MU2 A;  1B9D A;  4DS4 A;  2KFN A;  3AVK A;  1LWC A;  3E01 A;  4FW1 A;  3HP9 A;  1JLB A;  3IG1 A;  4OVL A;  4FXD A;  1HJR A;  1SV5 A;  2NUB A;  3S3O A;  1NK9 A;  5T7B A;  1L3T A;  4UQG A;  3RMB A;  1B92 A;  5DMR A;  3ZSQ A;  4CHQ A;  1RT6 A;  3CFR A;  3PX0 A;  1NJX A;  2P5O A;  3NAE A;  3CG7 A;  4AHC A;  3V4I A;  3AVM A;  2GBZ A;  1IKV A;  4OKK A;  3KIO A;  4DMN A;  4FLW A;  3C6U A;  1L5U A;  4FJH A;  3NBP A;  5DK5 A;  4DSF A;  4CJ5 A;  4CF0 A;  1VRT A;  2XY5 A;  1N5Y A;  1ZYQ A;  4LY7 A;  1RNH A;  3LZI A;  3U3Y A;  1QTM A;  4CCH A;  4CEE A;  4DU3 A;  4Z4F A;  4FM1 A;  2HVH A;  2O4G A;  3SI6 A;  1D9D A;  1J9A A;  1HYS A;  3NH1 A;  4E7H A;  4PUO A;  2A1S A;  3CQ8 A;  3ALY A;  1RBU A;  4JS5 A;  3NF7 A;  3ZCM A;  1RDA A;  1NKB A;  3NF6 A;  1C1A A;  4GVM A;  4DF4 A;  3OYE A;  3KKR A;  4Z4C A;  3L2W A;  3VQ5 A;  3QIP A;  2PY5 A;  3MEE A;  4F3O A;  1SKW A;  1HNI A;  2DFF A;  3ZT0 A;  3SUP A;  1RBV A;  4FJG A;  3TAG A;  1XWL A;  4H8K A;  4M3U A;  4EP4 A;  3DLR A;  5K14 A;  4FZX C;  1SL1 A;  4CJR A;  4BDP A;  4DU4 A;  1D9F A;  3SPY A;  4KI4 A;  1LWF A;  4F2S A;  4IFY A;  1KVC A;  3K5M A;  4DSJ A;  3L3U A;  4DF8 A;  1FK9 A;  3VA3 A;  4O0I A;  2RPI A;  3AA2 A;  2PZS A;  4DFP A;  4AHR A;  3VQE A;  1RT1 A;  3S3M A;  4CF1 A;  3JYT A;  3THV A;  1S6Q A;  4CGJ A;  3F9K A;  3OYA A;  3KK1 A;  2KTQ A;  1A5W A;  1U04 A;  1O1W A;  1WAF A;  2P5G A;  1TAU A;  4DFM A;  3QET A;  3A2F A;  4MFB A;  1FKO A;  3O4N A;  4ZHR A;  4OLA A;  3LWL A;  3K2P A;  1JLQ A;  4AHT A;  4DSL A;  3K59 A;  2X6N A;  1EXQ A;  4NCA A;  4BWJ A;  4BDY A;  3QES A;  5HLF A;  1KLN A;  1RT5 A;  4B08 A;  4CK1 A;  4R5P A;  3QIO A;  4N47 A;  4OPJ A;  2G8H A;  2BGG A;  2KQ2 A;  1RBS A;  1HYZ A;  4FLT A;  1A5X A;  3ZSX A;  3S3N A;  5HRN A;  1TV6 A;  2YHB A;  1LW2 A;  1TKZ A;  4LSN A;  1REV A;  3OS2 A;  1HRH A;  4KHS A;  4LSL A;  4CFA A;  1DTQ A;  3SZ2 A;  4DTN A;  1SKS A;  1NJZ A;  3AVJ A;  1IH7 A;  1YVU A;  4C8N A;  3P5J A;  3TI0 A;  3VQB A;  4E1M A;  2ETJ A;  3VQ9 A;  3HPH A;  4H4O A;  3U6F A;  1KCF A;  5J2Q A;  4EP5 A;  2EHG A;  3SUQ A;  1ZBI A;  3OYN A;  3NGI A;  1RCH A;  4E0D A;  1S1T A;  1X9S A;  1J54 A;  4CEB A;  3SNN A;  1ZBU A;  3VQC A;  1BI4 B;  4FJ9 A;  4E19 A;  1S1U A;  2F96 A;  3K5O A;  1NKC A;  1KRP A;  2ATQ A;  4N56 A;  3KLG A;  4DTX A;  4CED A;  3K5N A;  4CIF A;  1XI1 A;  3OYD A;  1X9M A;  4CGI A;  2QK9 A;  2HHX A;  3ISN C;  2HNY A;  1XC9 A;  3VQA A;  3T3F A;  1VSM A;  3CFP A;  1UA0 A;  1KVB A;  4CJP A;  2GV9 A;  4FJJ A;  1IKX A;  1TK5 A;  4KPY A;  4DTU A;  4M3X A;  5FRN A;  1QQC A;  5HRP A;  4FM2 A;  3IRX A;  4DU1 A;  4CFB A;  3SPZ A;  1EKE A;  2OPR A;  3DMJ A;  4NYF A;  3C94 A;  3LPU A;  1RBR A;  2Z1I A;  2Y1I A;  1NJY A;  2OYQ A;  3JSM A;  4N41 A;  2D5R A;  2E4L A;  3ZT3 A;  3V9X A;  4Q0B A;  1QSS A;  1RTH A;  4M3R A;  1KSP A;  1S5J A;  1QE1 A;  2WON A;  3TAE A;  2G8I A;  3HM9 A;  1TL1 A;  4KRE A;  4NYN A;  3CYM A;  4OJR A;  4K8X A;  1J53 A;  3AO1 A;  4IG0 A;  1IKY A;  4FJN A;  1KFD A;  3SQ2 A;  4ZTJ A;  2DY4 A;  1WN7 A;  4O4G A;  5KGX A;  1NK5 A;  2P1J A;  2FBV A;  1S6P A;  3IS9 A;  5HP1 A;  4I7F A;  1C0U A;  1WSJ A;  1L3U A;  3KK3 A;  4F2R A;  4B9S A;  2G8V A;  3HJF A;  4KI6 A;  1IG9 A;  1UAX A;  3CM5 A;  3T1A A;  3TAF A;  1EET A;  2D0C A;  2PYJ A;  1JL2 A;  3HVT A;  1Y97 A;  1C6V A;  3HT3 A;  4DQQ A;  4M3Z A;  1NOZ A;  4CGH A;  3C95 A;  2G8W A;  1U48 A;  4FK2 A;  3MED A;  4NCG A;  3VQ4 A;  1F21 A;  3HL8 A;  2B4J A;  2FC0 A;  3NH2 A;  5CZ1 A;  4KTW A;  3I8D A;  1W0H A;  4FJ7 A;  1RBT A;  4RW6 A;  4CGF A;  1WSE A;  1U45 A;  4FJI A;  3NDK A;  2HHS A;  3AA4 A;  4FVM A;  4KV8 A;  1NOY A;  4CF9 A;  4HUE A;  3TAB A;  3LAK A;  3NH0 A;  3V9W A;  4RW7 A;  2VG6 A;  4BWM A;  3OJS A;  4RW8 A;  4CHZ A;  1N6Q A;  3OYH A;  3OYK A;  4HVJ A;  4B9V A;  1Q9Y A;  3KKS A;  3OYG A;  4NCB A;  3SJJ A;  4FW2 A;  4CJT A;  1B9F A;  1VSI A;  3RMC A;  3M8R A;  4J2D A;  1BIZ A;  1JLE A;  3PUF A;  1YT3 A;  5HRR A;  3NE6 A;  1UWB A;  1VSD A;  3MXM A;  1KFS A;  4F8R A;  3AVN A;  4FJL A;  4Z4E A;  1A5V A;  3QO9 A;  3OYF A;  4FM0 A;  3LWM A;  4FLU A;  5CYM A;  1NKE A;  4N76 A;  3M8P A;  1RIL A;  3VQQ A;  5CZ2 A;  4HHT A;  4K8Z A;  1YTU A;  4JRQ A;  4Z4G A;  3AO2 A;  1SUQ A;  4Z0U A;  1VSK A;  2IDO A;  5J1E A;  1QS4 A;  4IBN A;  4ID1 A;  2DTU A;  4RW9 A;  4CF8 A;  3V1O A;  3L2Q A;  1VRU A;  4CHO A;  4DTP A;  3WNF A;  2KZM A;  4H4M A;  3RRG A;  1CLQ A;  3SUN A;  1R0A A;  2HHU A;  4WE1 A;  3HXM A;  2A1R A;  2XHB A;  2B5J A;  4CEC A;  2BDP A;  4CEQ A;  2HHW A;  4LH5 A;  1SL0 A;  1CXU A;  5E41 A;  3LPT A;  1DLO A;  4BE2 A;  3ZT4 A;  4YNQ A;  5HBM A;  3AA3 A;  4CJ4 A;  4FJX A;  2FBT A;  2YNH A;  3LAL A;  1Q9X A;  4J2B A;  2BAN A;  1WLJ A;  3OYM A;  2BE2 A;  2Y1J A;  3DLG A;  4M45 A;  1QSL A;  4CEF A;  4DG1 A;  1WSG A;  4ZTF A;  4CER A;  1TKX A;  1WSH A;  1UA1 A;  3NF9 A;  1RT3 A;  3NF8 A;  2XY6 A;  4W5T A;  4CK2 A;  3OS1 A;  2I5J A;  5FRM A;  3OYJ A;  3EZ5 A;  5KGW A;  4BDZ A;  5KRS A;  1WSI A;  1BL3 A;  3AA5 X;  4AHS A;  4CIE A;  1JXB A;  4KTZ A;  2W42 A;  4M42 A;  4CGG A;  2RKI A;  4CES A;  3QLH A;  3WNG A;  3VQP A;  3O4Q A;  1S1W A;  3VA0 A;  4CJW A;  2OPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...