4DV4K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv4K00
4DV7K 3T1HK 4LF7K 2UUAK 4GKKK 4X62K 4JI5K 4DR4K 4OX9K 5BR8K 1N36K 2UXCK 4X64K 4DUZK 4DUYK 2HHHK 3J7YP 5LL6Z 4DR7K 4DV1K 4B3MK 5FLXO 4GKJK 4YHHK 4DV4K 5IT9O 4NXNK 1HNWK 1XNRK 1IBKK 4DR2K 4JI8K 1N33K 4DR5K 4YY3K 4X65K 1N32K 3J80O 4DR6K 1FJGK 4DV5K 4V19S 1HNZK 4CVNE 1HR0K 2UU9K 2E5LK 3J81O 1N34K 4DR1K 4K0KK 4DV2K 1XMQK 1I94K 4LF6K 5AJ3K 5LMNK 1IBLK 4DV6K 2UUCK 3J7AP 4JI6K 4JI1K 4DR3K 4LFCK 4JI3K 2UXDK 4JV5K 4JI0K 4LF9K 5IWAK 2ZM6K 4JI4K 4LFBK 4B3RK 4X66K 5A2QO 4NXMK 4CW7B 1IBMK 4LF5K 5LMUK 4JI2K 4AQYK 4LFAK 1XMOK 3JAMO 4JYAK 4JI7K 4B3SK 4DV3K 1HNXK 2VQEK 4B3TK 2UXBK 4KHPK 1XNQK 4LF4K 4LF8K 3OTOK 2VQFK 3T1YK 2UUBK 1J5EK 4DV0K 2F4VK
chains in the Genus database with same CATH superfamily
2HB5A 3P4IA 3D2EB 1WB9A 3C7NA 1VK0A 2G8UA 4KKOA 4RCHA 1HRHA 3SUOA 3LDPA 4MDAA 3ZT0A 1BL3A 3P1GA 1D5AA 3AA3A 4GV6A 4DLGA 4FWKA 1IG8A 5EY4A 1SZ2A 4MO5A 4YOXA 1XHZA 3RWUA 2F8SA 4JHDB 2YJFA 1XI1A 1NK7A 2HHHK 3CJBA 3NH2A 5BPLA 2HBMA 1JLBA 5EVZA 4CE9A 5FLXO 4PHTX 2KHOA 3ENHA 3IFRA 4B9NA 1S6QA 5FPNA 4BR5A 3WXKA 3L3UA 1TK0A 1IBKK 1VSDA 1N33K 3M5RA 1RDWX 3ZT1A 4NCGA 3DXKA 4M3ZA 1VQPN 3M8QA 3NF8A 2X78A 1IG9A 3NF9A 1CLQA 3HSTB 1VQ8N 4CZIA 5DK5A 3J81O 1TKXA 1UWBA 1BISA 5E26A 3SI6A 3K57A 4OGEA 3J7AP 1EXQA 3QNOA 3AO5A 2QWMA 3OS2A 3KK1A 2GWJA 3QMLA 3VEXA 4CFCA 4OPJA 4ICLA 4DSLA 2KZMA 2D0BA 1Z25A 4H03B 3ZX2A 1VQ5N 3CHWA 3L3VA 4JI4K 2OZSA 3DI6A 3BGRA 3SQ1A 4BRFA 5C0YA 5AQMA 4BGAA 4BR4A 4Q0BA 3CCEN 1KFDA 4MLEA 4JK7A 4JS5A 3LDOA 3ENBA 2D5RA 2JWKA 3NF7A 4M41A 1EETA 4IOXA 1GLDG 3O6WA 1KAXA 3DXMB 3HRGA 3LM9A 3WQUA 4BDZA 3HSCA 4CZHA 4DLEA 1UA0A 4GNIA 3NE6A 1HX1A 3THXA 1CZ9A 3N4PA 3O1BA 4FWMA 3HP9A 3VGMA 4BWMA 3ZSYA 2F4VK 3THWA 1NMNA 1R59O 3A0IX 4DTNA 5AQZA 2ITGA 4N76A 4OPAA 4J2EA 4WF9L 2HW3A 3SBTA 4IJAA 2P9KB 2W42A 1NNEA 4H0PA 2QEXN 1QSSA 2P51A 3V9ZA 1RT2A 1BA1A 3RVCA 3CJCA 4FLZA 3ULDA 4KI4A 4M3XA 3V1OA 1UA1A 2OZMA 2HF3A 1VRUA 4GVEA 4BG9A 3H6EA 3CFPA 5KGWA 5MLCQ 1RT7A 3QEPA 3AGRA 4CEEA 1RGIA 4GMJB 5C15A 3VQ8A 2CH6A 2E4LA 3MWPA 5KPZA 3DMJA 2ZJRL 3DJCA 4DV5K 2CGJA 1NLVA 5LY3A 1JL2A 2UU9K 1IO2A 4CZEA 1GLEG 4Q5VA 4HWIA 4BACA 2QWPA 5KQDA 3ITHA 4KTQA 2O8CB 4RG8A 3LP3A 4OPKA 3AVIA 3CM6A 1KAZA 3UKUB 1S3XA 3ZYYX 1JLFA 2D1KA 2OPRA 2QM1A 3BP8A 4E1JA 1C0TA 1CZAN 3MN5A 4O0JA 3E1YA 3AAQA 2E2PA 2IOCA 5E41A 4DHYA 1FKPA 1ZBUA 3DM2A 4C23A 1QVFM 2EX3A 1I39A 3CCSN 1HKBA 5CZ1A 2UXBK 1HYVA 2GBZA 1QSYA 1BWFO 3D0PA 1QQCA 1IKWA 4BC2A 1J6ZA 2HVIA 1UAXA 1QE1A 3VQ4A 1RILA 2Z1GA 4F2RA 4FWSA 4CECA 3ZX0A 2DY4A 3UIQA 4PL7A 2X74A 3V9WA 4OLAA 3H45C 4OGCA 5BRHA 1IV0A 4CJEA 4H0YB 1RDUA 3CCUN 1NJWA 1D9FA 2P9LB 4M7YA 3LZIA 3VA3A 5LL6Z 4CEZA 4FJKA 3VF4A 1ASWA 3A5OC 4CZKA 1VSKA 3MEEA 5J1EA 4ID5A 3NHGA 1RBVA 1QZ5A 4CGHA 2WUSA 1VQNN 1XC3A 1NGAA 3LDSA 2E1YA 2VGNA 4BQLA 1HQEA 3KKRA 2NUBA 4E0DA 2FSNA 1B9FA 3OYHA 3VPZA 3VQEA 4BC5A 2D4WA 1JLQA 4GV9A 4AHSA 1MWKA 1TL1A 2EHGA 3C0BA 1L3UA 4DQ8A 4RTFD 1ATRA 4H5WA 3JS6A 4HTLA 1TAQA 3OYIA 4DB3A 3HM8A 3HVRA 1XMQK 2HNZA 1QHTA 2YX6A 4LF6K 2O8BA 4J8FA 2UUCK 3V9XA 3KVGA 5FRMA 3FZHA 3WXLA 3LPTA 3HM9A 1HJRA 3C6UA 4JK8A 4Z4FA 4CJSA 3KTQA 1P8ZA 4IXCA 3I8DA 4DQQA 2OTLN 2O8DA 3TAQA 1YVUA 3ISNC 5EX5A 5HROA 3VQ7A 2G8KA 1WSFA 2D0AA 2YHWA 4YOWA 3AO2A 4DWIA 3AV9A 2KQ2A 3U3YA 1XMOK 1TAUA 3SJHA 3KLIA 3OBWA 4C1NI 1HNXK 1YT3A 5F1XA 3KWIA 3GDQA 1VSJA 4FVMA 3SAHA 1YTAA 5E84A 5JICA 3WNHA 4BROA 1TVRA 4LF8K 3VQDA 3T1YK 3JYTA 1VSHA 4E7KA 3LL3A 5AQVA 3AY9A 3ZSQA 3ZSOA 1K8KA 2CGLA 5AZJA 1FK9A 2E1ZA 3FZKA 3L2UA 4JI5K 4OX9K 5BR8K 1N36K 5GAHP 3MAQA 1KFSA 3G0ZA 3BUZB 3O9SA 1JJ2M 1NOZA 4CZMA 4CJ3A 3E9PA 3ZSZA 4IEEA 2D0OA 3CCRN 3SJJA 4AM7A 3G10A 2WOMA 2B5JA 3V9SA 3GOIA 1U4BA 1A5VA 1X3NA 2YHXA 3ATVA 3VA0A 1GLAG 4M3TA 1NBWA 1ZC6A 4MDBA 3CCVN 4FPBA 3CI5A 4KV8A 3HP6A 4JS4A 1QS4A 4JKAA 3MEDA 5DM7L 4NLBA 3H46O 2HSTA 3OYAA 4MQ3A 3QETA 3I0SA 4CHPA 2G8VA 4O55A 4FZZA 3AO3A 4IDKA 5AJ3K 4B9MA 4DKWA 3O9QA 3D2EA 4FWPA 2DFEA 3U3GA 2RPIA 4LC9B 5CZ2A 2FSJA 4OO1J 3KK2A 1M90O 3QNNA 1HNIA 4JD2B 1QTMA 4CERA 3E9OA 3I8BA 4JHDA 5HBMA 5HRRA 4AH9A 4BG8A 4JKCA 4M45A 3U9DA 2AA4A 3QIPA 3MECA 3MN9A 3CQXA 1LW2A 3SV4A 3HK2A 3CQYA 2HHWA 4C1NK 4QS7A 4JI7K 4B3SK 3PO4A 3U9ZA 1BQNA 3OYGA 3ZETB 2E2QA 4DU1A 1X1PA 2VG6A 3TU5A 3O4NA 1WBBA 3HPGA 3OTOK 3DRPA 4IZ9A 5FDLA 3O3HA 4FLVA 1WAJA 1NM1A 3SUNA 4PUOA 3OYCA 3KKSA 2QTDA 3TTFA 2WFBA 4BY9C 3MCPA 2NNWA 5TKYA 4BRNA 4X62K 4HUEA 2VWJA 4E89A 4CEAA 3CCJN 2XO7A 1U04A 4NCAA 3S3NA 2OTJN 2GUPA 4CF2A 3QEWA 5M1KA 2VGMA 3DLEA 3O9RA 3ZSXA 4GKJK 4CEFA 5KQ8A 2HHUA 1HNWK 3G4SN 4CFDA 4FLUA 3D7EO 1N32K 5BRDA 1BCMA 3HPOA 1M1KO 3PUFA 1XQSC 3C94A 2I7NA 1Q9YA 3EE9A 3R1XA 1K8AO 2QWRA 3O8MA 3H08A 3P83D 3IG1A 4B1WB 3AVJA 4DV2K 2QWLA 1XC9A 5LMNK 1KVAA 1RCHA 3D45A 4B8CA 3SAGA 2RE2A 4CGJA 1ZYQA 3H1VX 3SLCA 1RDDA 3VERA 2P9KA 4I6MB 5IWAK 4ZHRA 1SKSA 3AA5X 1D4XA 2ZQBA 1V4SA 5KRTA 1FXXA 3THYB 4U67L 4W5QA 3R9PA 3T19A 3MN7A 4BR9A 3J8AA 4W5NA 3SYZA 1S5JA 4E7IA 2FBVA 1TL3A 3OYFA 3FFKB 2O8EB 4U7BA 5M1PA 1VQ4N 1VQ7N 3QIOA 4B8AB 1MDUB 3T69A 4DV7K 4FM2A 5C12A 5JMVA 5FRNA 1YAGA 2YNIA 4FCYA 3M8SA 5J2PA 1Q8IA 3BZKA 4FWLA 3CIPA 5GADP 5JVGL 1OKJA 4IJNA 3MK6A 3BY5A 2O8CA 4N56A 2OCEA 1XWLA 4FOIA 3UKUA 4JEPA 4QCLA 2D0CA 1NGJA 5I42A 4EFHA 4CJLA 2BTFA 4DV4K 4K25A 1NGCA 3CM5A 1KCFA 2GWKA 3CXCM 1KQSM 3H3NO 3KZBA 3EZWA 1MWMA 2PBDA 1BQMA 3LANA 5BN8A 4FL9A 3FLCO 4M3RA 3DAWA 1OVYA 1ATNA 3K9KA 4CJFA 3PO5A 1GLCG 3NCIA 1FJGK 3KLHA 3U8XA 3PY8A 4CGGA 5FPEA 4O5FA 1N8RO 1NGHA 2KLAA 3MN6A 2E5LK 4K43A 3LPUA 3O5BA 4LSLA 3LP0A 4WE1A 4E19A 4K0KK 3GG4A 1W2BM 1NGBA 1Z6RA 4K8ZA 3SAFA 1HKGA 2ZD1A 1GLJO 3DLGA 4FLYA 1TGOA 2O8FB 3ASMA 4CF9A 4G9ZA 4E7JA 2ZM6K 3C6AA 2VG7A 1RDCA 2E6MA 4N47A 1SV5A 1RTIA 5A2QO 2P9LA 4HCCA 4FJ7A 1IKVA 1I3AA 3A5MC 4KH5A 4I9QA 2HHXA 1EWRA 3HVTA 3U4LA 3N4QA 4XH1A 4PL8A 3DLBA 4CJPA 2Z1IA 3R6MA 3R3LA 4DV3K 4FWOA 2A1RA 4KTZA 3ZX3A 4FW2A 3V81A 2RF2A 4FM1A 1F21A 3U6FA 4DTUA 3AARA 3Q7BA 4EP5A 3E01A 4CZLA 4FLXA 2LSNA 3CD6N 3TSUA 4B9LA 1CZBA 2HBLA 2VQFK 1K73O 3NF6A 5C2DA 5D3GA 5SWMA 3RSEB 1GLLO 3TAMA 4WFBL 3W0LA 4BR2A 1IH7A 1X9MA 2HHSA 5AQPA 3VEYA 2F8TA 3WNGA 1CXUA 2FLOA 4C8KA 1RDBA 3K9JA 2JWLA 3EO3A 1SL2A 1NWKA 4DUZK 2FXUA 5BN9A 4CJTA 3W3DA 2JLEA 1C6VA 4EHUA 3F9MA 3QBWA 2NRXA 2IS3A 3E66A 4IEIA 3VEOA 2NZTA 5AQUA 4JLHA 2KW4A 3GE1A 4ID1A 2B4JA 5EXWA 1WOQA 4AM6A 3HT3A 4JKDA 1KC8O 4GW6A 1YXQA 3EE8A 4E7HA 2O4GA 4DU4A 3SQ0A 4ZTJA 3THVA 4BC3A 4CK1A 3ENOA 5BREA 1VSFA 3NGIA 1WNSA 1V4TA 3EYZA 1HYSA 1WSEA 1LAVA 3E9LA 3TSQA 5EOYA 4JK9A 3IRXA 1U47A 3ZSRA 4B9VA 3QLHA 4CIEA 2Z1HA 4O8KA 4N41A 4I2QA 3TTCA 1KLNA 3O08A 4CGIA 3AVKA 4K8XA 3LAKA 1I94K 3K0SA 3DLRA 5F2RA 1O1WA 1S22A 3HL8A 1RTHA 3QESA 3HXMA 2KFZA 4LFCK 1EQYA 1S1WA 4PKIA 1BA0A 4K41A 1TKDA 1VQKN 4TSXA 3L4QA 2FBYA 2R7YA 4FM0A 3LP1A 4IFYA 4FSVA 1S1XA 4FZYA 4FPAA 4CW7B 2P9SB 1W7AA 1FKOA 5KPTA 2ASOA 4CIFA 4JI2K 1ATSA 1DTQA 4WFAL 3NGYA 1J9AA 1NK5A 1HMVA 2OANA 4ISEA 1BCOA 4CK2A 1G15A 2V7YA 5BRFA 1JXBA 5AQTA 3HBTA 3CJ7A 2YV0X 5DMRA 5M1FA 3WXMB 4A59A 3CYMA 1L3SA 3PSFA 2NRZA 2VYPA 3RMDA 1J54A 3T1HK 2NRWA 4XEIA 4KHQA 3QERA 2UUAK 1BIZA 3KIOA 4IOCL 1G99A 4Y1CA 5JLHA 4WQ5C 4CHZA 3ULEB 4X64K 3CCMN 3C95A 4WYBA 4M3WA 3KHYA 2GELA 2E6LA 3D2FB 4DTOA 5AQSA 3A5LC 3TAEA 4JD2A 3OYLA 4DSFA 3SQ2A 3RRGA 3FFIA 3RMBA 3OVNA 1W9HA 4CHNA 3GL1A 2BH1A 3TABA 3KLFA 5C10A 1NGGA 4JI8K 3UB5A 3FGUA 4KHWA 3MXIA 2Y1IA 3ATUA 3ZETA 1YVNA 1DT9A 4H5RA 4DR6K 2ZJPL 2BE2A 3TARA 4Z94A 4EZ6A 1LWFA 1NJZA 4V19S 3CCQN 4CGDA 3BZCA 2AJQA 3NFAA 3UE5A 3IAYA 3VMFB 1KVBA 1LWEA 3SBGA 1NKCA 3OBYA 1RFQA 4CHYA 3VQ5A 4MFBA 4JI3K 2B6AA 4PKGA 4EP4A 4F3TA 1HUXA 1OH5A 4JKGA 2BGGA 4KAZA 1L3TA 4B3RK 5HRSA 4DFMA 5HOOA 2DFHA 3EL2A 3LDLA 1HNVA 3C65A 1GLBG 1TKZA 3ALYA 5LMUK 3WQTA 3CJAA 3WT0A 3BF1A 4BRLA 1LWCA 2IGIA 5GINA 4IWVA 1JLGA 2F9TA 2DTUA 1U48A 5H1SQ 3VOVA 3K5OA 2ZGZA 2Q36A 3F73A 5AQJA 2Q2RA 1YTUA 1NJYA 2FSKA 1WSGA 2FC0A 2GV9A 3HYFA 3S3OA 4BR0A 4FJGA 2NLXA 1NOYA 5AQKA 3V1RA 4Y0WA 3QEIA 4JRQA 4YOUA 1KSPA 1BO5O 1ZBFA 4B1YB 5CE3A 4K42A 5AQGA 2ZF5O 2PY5A 2HBKA 3AVAA 3OJSA 4F8RA 3THXB 4FJNA 3NDKA 5AQLA 4I6MA 4OLBA 2E20A 5ELZA 2FF6A 1YUWA 4DUYK 5J2QA 1TK5A 4HUFA 1DTTA 4Z0UA 3BF3A 4AILC 4O5BA 4OPHA 3OS0A 3L2RA 4YHHK 4L3QA 2P9UB 3MX5A 1TUYA 3LWLA 3QICA 1QSLA 1VSMA 3THYA 4ELVA 4NXNK 1XNRK 4YFUA 3QFUA 1KXPA 3SMSA 1SQKA 3SQ4A 5AQWA 4BRKA 4EHTA 1RDAA 3VQQA 4F9OA 2YHYA 4X65K 1OH7A 1NG9A 2OA8A 2E2NA 2O8EA 1NU0A 2QI2A 4DSKA 4DQPA 3SNNA 4CGFA 4H4OA 3SMPA 3Q7CA 4PQUA 4NB4A 3I55N 3I56N 4ISGA 3M8PA 5JS2A 3TI0A 3NAEA 4DV6K 4BRQA 1Y64A 4JKFA 4FK4A 1E4GT 4A5BA 4BRIA 3ZEUB 1WN7A 4WQ5A 3RR8A 3IUCA 2HHTA 1RT1A 2HMPA 5AQRA 4PWDA 2W40A 1OH8A 3PX6A 4FJIA 1ITGA 1WSJA 4LFBK 3LDQA 2V52B 4NXMK 4I2PA 3EZ5A 1QQOA 2OPSA 4BGBA 4H0OA 1KTQA 1B9DA 2Q0RA 5HL7L 4A61A 4DQRA 1U45A 4M7XA 3VEVA 1WSHA 5HLFA 4WQ4C 4A2BA 3GBTA 4CK3A 4LF4K 1X9SA 3F2KA 1ASUA 2GUIA 3K5LA 1E4FT 1J5EK 4FOEA 2XY8A 5DM6L 3BEXA 3CETA 4BREA 3OYBA 4C8MA 4CJRA 4BE2A 3V9UA 4HVJA 2ITMA 5LJVA 2OYQA 5KGXA 3K2PA 3NMUA 5HRNA 2BDPA 2O8FA 5AFUA 1Q18A 5BPNA 1NK8A 1NJXA 1RT6A 1CXQA 4JKHA 1SS6A 3FR0A 4DV1K 2FBTA 3HTVA 4C8NA 3RRHA 4CHQA 3UKRB 4CFBA 1VQ6N 3V4IA 3LP2A 1YHQN 1TKTA 3SPYA 3SUPA 3P5JA 4YOVA 2IIRA 2GEMA 2WBNA 1W0HA 3VN5A 4CEDA 1ASVA 1S1VA 1BU6O 1TYQB 3KLGA 3VENA 3SK3A 1HNZK 3IKMA 3CC4N 1NK0A 4CVNE 4IG3A 2QW9A 3PIOL 1RBSA 5JVHL 3RSEA 4OVLA 4CF0A 4FXDA 3F9KA 2ZJQL 4I7FA 2P9IB 5AQXA 4CBWA 3DXMA 1L5UA 2QWOA 4HUGA 3M8RA 1BHLA 2G8IA 1ZBSA 1Q81O 3EN9A 4WFNL 3CF5L 4CIGA 4KHSA 2NRHA 4CEOA 1UOCA 4FO0A 2QXLA 4DS4A 3G71N 4ELTA 4GVMA 3IDHA 4O0IA 4DMNA 4IDHA 4JYAK 1Q9XA 1RBTA 4KBOA 1C1AA 2QXFA 2P9PB 1NMDA 3DLLL 3IMXA 1D8YA 1RT5A 1ZBHA 1SL1A 1SKWA 3IS9A 1A5XA 3SZ2A 4DV0K 1IBMK 4IKFA 1ZBIA 1EP4A 2IVPA 4YNQA 3G25A 1WUAA 4C8LA 1C0GA 4CJ7A 3MWTA 4CBXA 4HTUA 3KD1E 1U2VB 1NGIA 3LWMA 1VSLA 3MEGA 1S1UA 4AHVA 2RKIA 4Z4EA 5EU7A 1T05A 2P9SA 1ILYA 1LCUA 4HCBA 4KB0A 4LSNA 4Z4GA 1REVA 3NH1A 4Z4CA 1BGXT 4ILHA 1Q82O 1C0UA 4DR5K 3TAPA 4B9SA 1S72N 2A41A 5B8HA 4WQ4A 5GAEP 2XY7A 2YNGA 1HKCA 4DF8A 2A40A 5AQQA 1YJ9N 1SUQA 1QQMA 4JAXA 3OYDA 4DFJA 3ZSWA 4BRDA 5KPRA 4DFKA 4B3OA 2A1SA 3VQBA 1BI4B 3H3OB 4OKJA 2W6KA 3WNEA 3C6TA 3CJ1A 3ZCMA 3PIPL 4BVOA 2XY6A 3O4QA 2I7PA 3FZFA 4HHTA 4H8KA 3CPEA 4FJHA 3AVFA 1LW0A 2VWBA 3B6PA 3ULEA 2Q3SA 1T8EA 3OYEA 3D2FA 3VETA 3CJ9A 5AQYA 2F96A 4LF5K 3HZ6A 4FWQA 1C0FA 2HHQA 2WONA 1NGEA 3KWGA 1GOCA 3JAMO 1RTJA 3L4IA 3DOLA 4RW4A 3K58A 1O13A 1KRPA 4BRHA 4ELUA 1Q86O 1SAZA 5SZTA 3MXMA 4DTMA 4XH5A 1C1BA 3V6DA 2A6AA 2PYJA 4DF4A 3OYMA 4J2AA 4FLWA 1LV5A 2KKZA 4B9QA 1JLCA 2F7TA 4GKKK 1VSEA 2UYTA 3RMCA 1Q7YO 4KO0A 4WCEL 2V7ZA 3ID6A 3TSPA 2YJEA 1DEJA 4DSIA 3DLHA 3EY1A 3VQAA 4BC4A 3LALA 3L8BA 2X6SA 3CG7A 4KH6A 4KI6A 5CY4A 3OS1A 4DR7K 1NK4A 3T3FA 3B8AX 1QVGM 2ASMA 3QEVA 5F0XA 2O4IA 4RW7A 4GY2B 4PKHA 5AR0A 4FJJA 1T6DA 4CJWA 4IO9L 2QWNA 2XY5A 4A2AA 2KFNA 3RTVA 1NJIO 1WBDA 3CC2N 4R5PA 2Q0UA 3B6OA 4AHTA 1A5WA 2X6NA 2KTQA 1JLAA 2NRRA 2P9NB 4CD1A 4DR1K 3ZT2A 4ILJA 3I0RA 1JL1A 3HI0A 4RW6A 2HNDA 5BR9A 4CZGA 2XRIA 1JXEA 3K5NA 4OJRA 2YI1A 1NKEA 5CYMA 3AVBA 3QINA 4DCHA 2G8HA 5M1NA 2ZGYA 3LZJA 4BRCA 3A8YA 1B92A 1YI2N 1IKXA 4H5VA 2ASPA 3QFPA 2P9UA 3A2FA 3HOSA 3VESA 3AVCA 4LH4A 3CMEN 5BPMA 2VG5A 4CBUA 3DWLA 4BQZA 3QBXA 4KTWA 2E2OA 2Z1JA 4DS5A 5ADXA 4FJXA 3EEQA 3DRRA 2VWKA 4DQIA 4FK0A 3H1QA 3KK7A 4MO4A 4RW8A 5KTQA 2V51B 4E1NA 3OYKA 3CMAN 1Z26A 3AA4A 4AHCA 4W5RA 5KI6A 4MLHA 2G8FA 3WEEB 2YNFA 1RT3A 4Y1DA 3NH0A 3AA2A 1QZ6A 4YDUA 5C2FA 3OHRA 4A62A 3HO1A 4ISFA 3K5MA 3ZEUA 3CC7N 3ZLJA 2IC3A 3PLAA 3M1FA 1BUPA 5JLFA 3OY9A 4CESA 3J7YP 4B9TA 2BUPA 1IJJA 4B3MK 3AVGA 4W5OA 1XHXA 4UY8O 1RBUA 4CZFA 3P31A 3CERA 1YJNN 4H4MA 5AZIB 2ATQA 3OW2M 3J7ZO 1U49A 2PAVA 3WNFA 2ZWHA 4CF8A 3AAPA 4YY3K 3VEZA 1WLJA 4EZ9A 1VQMN 3O4WA 3ID8A 3QDKA 3VEWA 2Q31A 1N34K 4H0VB 3C7NB 3VQCA 2YHAA 4QOZB 5FPDA 4IO8A 3CFRA 1YJWN 1JKHA 4B1XB 3G6EN 4DSEA 4BDYA 5AQOA 4DTRA 4JI1K 3PV8A 3RMAA 2HHVA 2UXDK 3CQ8A 4LF9K 4NYNA 4EIAA 1KVCA 2J4RA 2ZE2A 3P39A 3QB0A 3JXUA 4F2SA 4XH4A 1EKEA 3PX4A 4AF1A 1YITN 4ZTFA 4JKEA 4QS9A 1JCEA 2P1JA 5CR4A 4E1MA 3I33A 4LFAK 3UKRA 5GAGP 1GOAA 3DXKB 4FWRA 3ZT3A 4W5TA 1RNHA 1RBRA 1TYQA 2E8AA 3VTIA 3A5NC 4DR2K 4CJUA 4O44A 3VGKA 4Z4IA 3HOTA 2I5JA 3O9UA 2EWSA 3JSMA 3VF2A 3AVMA 1X3MA 4DR4K 3L0QA 2P9IA 5M1QA 1LAWA 3O9TA 2KZZA 5ADXH 4BE1A 2PZSA 4KREA 4B1VA 3VQ6A 3AVLA 3AGKA 4FJ9A 5KRSA 4L8RB 1K9MO 4KHUA 2HVHA 5I3UA 3WUHA 1JCFA 1NKBA 4QAGA 1XUPO 2HNYA 1TUUA 5J2NA 4KFBA 2HOEA 3DOKA 1H1VA 4O8UA 1BG3A 4FLTA 5JS1A 2P9PA 3AVNA 1BOTO 3THWB 4F4KA 4KPYA 4CJ4A 4IFVA 4LH5A 3VQ9A 2HF4A 4M63C 1OH6A 4JN4A 2P5GA 2G8WA 3ZT4A 3V1QA 3TR8A 4CJKA 2IDOA 1IBLK 4FK2A 2IVOA 5FPMA 1HJOA 4DTJA 3M6GA 2WTUA 4JRPA 4M42A 4FJMA 4B1ZA 4YOTA 1QQNA 1N6QA 1SKRA 1U2VA 5GIOA 5GIPA 4G1QA 4CZJA 5FROA 4I9LA 1IKYA 4CJQA 1S9GA 4AQYK 3M3ZA 4Z4HA 4FWNA 4CJVA 2H3GX 4F3OA 2PFUA 4JKBA 3CCLN 1DLOA 1C0MA 1J53A 1NK9A 3TAGA 2VQEK 3ZSVA 1HPMA 4OKKA 3TWHA 4H0TB 3KD5E 5C25A 5TKWA 4OKEA 3SUQA 1VQON 2OPPA 4FJ5A 2YHBA 4AHUA 1C1CA 5K14A 3FE1A 3VTHA 1BDGA 1X9JA 4EAHD 4KHYA 1VSIA 2FF3B 4IG0A 3S41A 4YOYA 3O3GA 3TAFA 4LF7K 2YKMA 1RTDA 1BI4A 2Q97A 4NCBA 4FW1A 3DRSA 2YKNA 4H5TA 1DKGD 3O3FA 5J2MA 4IBNA 1ZXOA 2UXCK 3DYAA 4KH4A 4B1UB 4M3YA 5CHIA 5AQIA 1T44A 4DTXA 4KHNA 1MA9B 2QK9A 1DGKN 3R8EA 4CEBA 1YF5L 5C24A 5IT9O 5AQNA 3VF6A 5CYQA 1VAZA 4CI6A 4BR7A 1HYZA 4RW9A 3TTDA 4CF1A 2YNHA 4FJLA 1HQUA 1WSIA 2QWQA 1KD1O 3J80O 3SCXA 1KLMA 2QKKA 2W41A 1X9WA 2HMIA 3AO1A 2CH5A 2CGKA 1HR0K 4C8OA 2BANA 4PY5A 1GLFO 4DG1A 4A5AA 3LAMA 5T7BA 3LDNA 1HPZA 4LD0A 4CFAA 2NRTA 3SV3A 2NRVA 4KRFA 2OPQA 4BWJA 5HP1A 1P90A 4DR3K 4R79A 1J5OA 3HJFA 1SL0A 4AHRA 4JV5K 4JI0K 4BRMA 2E88A 3OJUA 3TANA 4BRGA 2AP1A 3L2QA 1E3MA 4FJ8A 2QA4N 4DTPA 1EX4A 5LJWA 3EKUA 1L3VA 4FVUA 4CCHA 1R0AA 1TV6A 1MU2A 3NBPA 2DPNA 4XIUA 3L2VA 1TK8A 3FZLA 4ILGB 1HLUA 4E3SA 2D0PA 3DLKA 4JKGB 4KHPK 4O4GA 1S9EA 5I9EB 2W6LA 3PX0A 1QHAA 4E7LA 4J2BA 2UUBK 3MDQA 2O8BB 2P9NA 1S6PA 1N5YA 3WXIA 4GV3A 4KB1A 4CEQA 3CFOA 3LM2A 4M3UA 3KK3A 2YCHA 3L2WA 4DQSA 2A3ZA 2GX9A 2JGUA 1T3VA 3MCAB 3NVKA 2RN2A 4FZXC 4FYDA 3S3MA 3OYNA 3O80A 2O8DB 5HRPA 2IVNA 4BRPA 1D9DA 3MX2A 2HBJA 4DFPA 4N5SA 2XHBA 1Z05A 2A42A 2FBXA 4RWTA 1EWQA 4H5NA 2WC9A 5AQHA 1VQLN 2GTDA 1YIJN 2QKBA 4YORA 2A5XA 3NGZA 1FW6A 1VQ9N 1NGFA 3O1WA 1GOBA 4IFEA 3KJVA 4LY7A 4A57A 3OYJA 1ESVA 3KLEA 1W97L 3BDPA 1K6YA 1T7PA 1NK6A 4IOAL 2ETJA 3F5TA 4DTSA 5AQFA 1K8KB 4DU3A 1S1TA 3C6HA 5C42A 3MXJA 5AZJB 4PA1A 5M1OA 1JLEA 1U6ZA 4JI6K 4JNEA 5AFUH 1Y97A 2PYLA 3TPQA 1WAFA 4H0XB 4CD3A 3WEEA 1ZBLA 3P38A 4CHOA 4DSJA 1EO1A 3NVMA 3OA9A 2P5OA 4X66K 4B9UA 2IAJA 3HPHA 3RR7A 3VGLA 4NLCA 1LOTB 4NO7A 2DFFA 2Q1NA 1T03A 4BDPA 3S9HA 4B08A 1BIUA 4QS8A 3QEXA 4BVPA 2RHKA 4UQGA 1VRTA 3WXJA 1RT4A 3AO4A 1KAYA 4NYFA 3D6RA 1OVQA 3T7ZA 4BE0A 5AZIA 3EKSA 2Y1JA 3VQPA 4CJ5A 4B3TK 4YDUC 3CPWM 3QO9A 3T1AA 3L6QA 1XNQK 1VHXA 2VCPA 4BRAA 3K59A 3PSIA 4J2DA 2F9WA 3FZMA 1JCGA 3AVHA 3MMVA 1T6CA 1NGDA 3SPZA
chains in the Genus database with same CATH topology
4DV7K 3T1HK 4LF7K 2UUAK 4GKKK 4X62K 4JI5K 4DR4K 4OX9K 5BR8K 1N36K 2UXCK 4X64K 4DUZK 4DUYK 2HHHK 3J7YP 5LL6Z 4DR7K 4DV1K 4B3MK 5FLXO 4GKJK 4YHHK 4DV4K 5IT9O 4NXNK 1HNWK 1XNRK 1IBKK 4DR2K 4JI8K 1N33K 4DR5K 4YY3K 4X65K 1N32K 3J80O 4DR6K 1FJGK 4DV5K 4V19S 1HNZK 4CVNE 1HR0K 2UU9K 2E5LK 3J81O 1N34K 4DR1K 4K0KK 4DV2K 1XMQK 1I94K 4LF6K 5AJ3K 5LMNK 1IBLK 4DV6K 2UUCK 3J7AP 4JI6K 4JI1K 4DR3K 4LFCK 4JI3K 2UXDK 4JV5K 4JI0K 4LF9K 5IWAK 2ZM6K 4JI4K 4LFBK 4B3RK 4X66K 5A2QO 4NXMK 4CW7B 1IBMK 4LF5K 5LMUK 4JI2K 4AQYK 4LFAK 1XMOK 3JAMO 4JYAK 4JI7K 4B3SK 4DV3K 1HNXK 2VQEK 4B3TK 2UXBK 4KHPK 1XNQK 4LF4K 4LF8K 3OTOK 2VQFK 3T1YK 2UUBK 1J5EK 4DV0K 2F4VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 K;  3T1H K;  4LF7 K;  2UUA K;  4GKK K;  4X62 K;  4JI5 K;  4DR4 K;  4OX9 K;  5BR8 K;  1N36 K;  2UXC K;  4X64 K;  4DUZ K;  4DUY K;  2HHH K;  3J7Y P;  5LL6 Z;  4DR7 K;  4DV1 K;  4B3M K;  5FLX O;  4GKJ K;  4YHH K;  4DV4 K;  5IT9 O;  4NXN K;  1HNW K;  1XNR K;  1IBK K;  4DR2 K;  4JI8 K;  1N33 K;  4DR5 K;  4YY3 K;  4X65 K;  1N32 K;  3J80 O;  4DR6 K;  1FJG K;  4DV5 K;  4V19 S;  1HNZ K;  4CVN E;  1HR0 K;  2UU9 K;  2E5L K;  3J81 O;  1N34 K;  4DR1 K;  4K0K K;  4DV2 K;  1XMQ K;  1I94 K;  4LF6 K;  5AJ3 K;  5LMN K;  1IBL K;  4DV6 K;  2UUC K;  3J7A P;  4JI6 K;  4JI1 K;  4DR3 K;  4LFC K;  4JI3 K;  2UXD K;  4JV5 K;  4JI0 K;  4LF9 K;  5IWA K;  2ZM6 K;  4JI4 K;  4LFB K;  4B3R K;  4X66 K;  5A2Q O;  4NXM K;  4CW7 B;  1IBM K;  4LF5 K;  5LMU K;  4JI2 K;  4AQY K;  4LFA K;  1XMO K;  3JAM O;  4JYA K;  4JI7 K;  4B3S K;  4DV3 K;  1HNX K;  2VQE K;  4B3T K;  2UXB K;  4KHP K;  1XNQ K;  4LF4 K;  4LF8 K;  3OTO K;  2VQF K;  3T1Y K;  2UUB K;  1J5E K;  4DV0 K;  2F4V K; 
#chains in the Genus database with same CATH topology
 2HB5 A;  3P4I A;  3D2E B;  1WB9 A;  3C7N A;  1VK0 A;  2G8U A;  4KKO A;  4RCH A;  1HRH A;  3SUO A;  3LDP A;  4MDA A;  3ZT0 A;  1BL3 A;  3P1G A;  1D5A A;  3AA3 A;  4GV6 A;  4DLG A;  4FWK A;  1IG8 A;  5EY4 A;  1SZ2 A;  4MO5 A;  4YOX A;  1XHZ A;  3RWU A;  2F8S A;  4JHD B;  2YJF A;  1XI1 A;  1NK7 A;  2HHH K;  3CJB A;  3NH2 A;  5BPL A;  2HBM A;  1JLB A;  5EVZ A;  4CE9 A;  5FLX O;  4PHT X;  2KHO A;  3ENH A;  3IFR A;  4B9N A;  1S6Q A;  5FPN A;  4BR5 A;  3WXK A;  3L3U A;  1TK0 A;  1IBK K;  1VSD A;  1N33 K;  3M5R A;  1RDW X;  3ZT1 A;  4NCG A;  3DXK A;  4M3Z A;  1VQP N;  3M8Q A;  3NF8 A;  2X78 A;  1IG9 A;  3NF9 A;  1CLQ A;  3HST B;  1VQ8 N;  4CZI A;  5DK5 A;  3J81 O;  1TKX A;  1UWB A;  1BIS A;  5E26 A;  3SI6 A;  3K57 A;  4OGE A;  3J7A P;  1EXQ A;  3QNO A;  3AO5 A;  2QWM A;  3OS2 A;  3KK1 A;  2GWJ A;  3QML A;  3VEX A;  4CFC A;  4OPJ A;  4ICL A;  4DSL A;  2KZM A;  2D0B A;  1Z25 A;  4H03 B;  3ZX2 A;  1VQ5 N;  3CHW A;  3L3V A;  4JI4 K;  2OZS A;  3DI6 A;  3BGR A;  3SQ1 A;  4BRF A;  5C0Y A;  5AQM A;  4BGA A;  4BR4 A;  4Q0B A;  3CCE N;  1KFD A;  4MLE A;  4JK7 A;  4JS5 A;  3LDO A;  3ENB A;  2D5R A;  2JWK A;  3NF7 A;  4M41 A;  1EET A;  4IOX A;  1GLD G;  3O6W A;  1KAX A;  3DXM B;  3HRG A;  3LM9 A;  3WQU A;  4BDZ A;  3HSC A;  4CZH A;  4DLE A;  1UA0 A;  4GNI A;  3NE6 A;  1HX1 A;  3THX A;  1CZ9 A;  3N4P A;  3O1B A;  4FWM A;  3HP9 A;  3VGM A;  4BWM A;  3ZSY A;  2F4V K;  3THW A;  1NMN A;  1R59 O;  3A0I X;  4DTN A;  5AQZ A;  2ITG A;  4N76 A;  4OPA A;  4J2E A;  4WF9 L;  2HW3 A;  3SBT A;  4IJA A;  2P9K B;  2W42 A;  1NNE A;  4H0P A;  2QEX N;  1QSS A;  2P51 A;  3V9Z A;  1RT2 A;  1BA1 A;  3RVC A;  3CJC A;  4FLZ A;  3ULD A;  4KI4 A;  4M3X A;  3V1O A;  1UA1 A;  2OZM A;  2HF3 A;  1VRU A;  4GVE A;  4BG9 A;  3H6E A;  3CFP A;  5KGW A;  5MLC Q;  1RT7 A;  3QEP A;  3AGR A;  4CEE A;  1RGI A;  4GMJ B;  5C15 A;  3VQ8 A;  2CH6 A;  2E4L A;  3MWP A;  5KPZ A;  3DMJ A;  2ZJR L;  3DJC A;  4DV5 K;  2CGJ A;  1NLV A;  5LY3 A;  1JL2 A;  2UU9 K;  1IO2 A;  4CZE A;  1GLE G;  4Q5V A;  4HWI A;  4BAC A;  2QWP A;  5KQD A;  3ITH A;  4KTQ A;  2O8C B;  4RG8 A;  3LP3 A;  4OPK A;  3AVI A;  3CM6 A;  1KAZ A;  3UKU B;  1S3X A;  3ZYY X;  1JLF A;  2D1K A;  2OPR A;  2QM1 A;  3BP8 A;  4E1J A;  1C0T A;  1CZA N;  3MN5 A;  4O0J A;  3E1Y A;  3AAQ A;  2E2P A;  2IOC A;  5E41 A;  4DHY A;  1FKP A;  1ZBU A;  3DM2 A;  4C23 A;  1QVF M;  2EX3 A;  1I39 A;  3CCS N;  1HKB A;  5CZ1 A;  2UXB K;  1HYV A;  2GBZ A;  1QSY A;  1BWF O;  3D0P A;  1QQC A;  1IKW A;  4BC2 A;  1J6Z A;  2HVI A;  1UAX A;  1QE1 A;  3VQ4 A;  1RIL A;  2Z1G A;  4F2R A;  4FWS A;  4CEC A;  3ZX0 A;  2DY4 A;  3UIQ A;  4PL7 A;  2X74 A;  3V9W A;  4OLA A;  3H45 C;  4OGC A;  5BRH A;  1IV0 A;  4CJE A;  4H0Y B;  1RDU A;  3CCU N;  1NJW A;  1D9F A;  2P9L B;  4M7Y A;  3LZI A;  3VA3 A;  5LL6 Z;  4CEZ A;  4FJK A;  3VF4 A;  1ASW A;  3A5O C;  4CZK A;  1VSK A;  3MEE A;  5J1E A;  4ID5 A;  3NHG A;  1RBV A;  1QZ5 A;  4CGH A;  2WUS A;  1VQN N;  1XC3 A;  1NGA A;  3LDS A;  2E1Y A;  2VGN A;  4BQL A;  1HQE A;  3KKR A;  2NUB A;  4E0D A;  2FSN A;  1B9F A;  3OYH A;  3VPZ A;  3VQE A;  4BC5 A;  2D4W A;  1JLQ A;  4GV9 A;  4AHS A;  1MWK A;  1TL1 A;  2EHG A;  3C0B A;  1L3U A;  4DQ8 A;  4RTF D;  1ATR A;  4H5W A;  3JS6 A;  4HTL A;  1TAQ A;  3OYI A;  4DB3 A;  3HM8 A;  3HVR A;  1XMQ K;  2HNZ A;  1QHT A;  2YX6 A;  4LF6 K;  2O8B A;  4J8F A;  2UUC K;  3V9X A;  3KVG A;  5FRM A;  3FZH A;  3WXL A;  3LPT A;  3HM9 A;  1HJR A;  3C6U A;  4JK8 A;  4Z4F A;  4CJS A;  3KTQ A;  1P8Z A;  4IXC A;  3I8D A;  4DQQ A;  2OTL N;  2O8D A;  3TAQ A;  1YVU A;  3ISN C;  5EX5 A;  5HRO A;  3VQ7 A;  2G8K A;  1WSF A;  2D0A A;  2YHW A;  4YOW A;  3AO2 A;  4DWI A;  3AV9 A;  2KQ2 A;  3U3Y A;  1XMO K;  1TAU A;  3SJH A;  3KLI A;  3OBW A;  4C1N I;  1HNX K;  1YT3 A;  5F1X A;  3KWI A;  3GDQ A;  1VSJ A;  4FVM A;  3SAH A;  1YTA A;  5E84 A;  5JIC A;  3WNH A;  4BRO A;  1TVR A;  4LF8 K;  3VQD A;  3T1Y K;  3JYT A;  1VSH A;  4E7K A;  3LL3 A;  5AQV A;  3AY9 A;  3ZSQ A;  3ZSO A;  1K8K A;  2CGL A;  5AZJ A;  1FK9 A;  2E1Z A;  3FZK A;  3L2U A;  4JI5 K;  4OX9 K;  5BR8 K;  1N36 K;  5GAH P;  3MAQ A;  1KFS A;  3G0Z A;  3BUZ B;  3O9S A;  1JJ2 M;  1NOZ A;  4CZM A;  4CJ3 A;  3E9P A;  3ZSZ A;  4IEE A;  2D0O A;  3CCR N;  3SJJ A;  4AM7 A;  3G10 A;  2WOM A;  2B5J A;  3V9S A;  3GOI A;  1U4B A;  1A5V A;  1X3N A;  2YHX A;  3ATV A;  3VA0 A;  1GLA G;  4M3T A;  1NBW A;  1ZC6 A;  4MDB A;  3CCV N;  4FPB A;  3CI5 A;  4KV8 A;  3HP6 A;  4JS4 A;  1QS4 A;  4JKA A;  3MED A;  5DM7 L;  4NLB A;  3H46 O;  2HST A;  3OYA A;  4MQ3 A;  3QET A;  3I0S A;  4CHP A;  2G8V A;  4O55 A;  4FZZ A;  3AO3 A;  4IDK A;  5AJ3 K;  4B9M A;  4DKW A;  3O9Q A;  3D2E A;  4FWP A;  2DFE A;  3U3G A;  2RPI A;  4LC9 B;  5CZ2 A;  2FSJ A;  4OO1 J;  3KK2 A;  1M90 O;  3QNN A;  1HNI A;  4JD2 B;  1QTM A;  4CER A;  3E9O A;  3I8B A;  4JHD A;  5HBM A;  5HRR A;  4AH9 A;  4BG8 A;  4JKC A;  4M45 A;  3U9D A;  2AA4 A;  3QIP A;  3MEC A;  3MN9 A;  3CQX A;  1LW2 A;  3SV4 A;  3HK2 A;  3CQY A;  2HHW A;  4C1N K;  4QS7 A;  4JI7 K;  4B3S K;  3PO4 A;  3U9Z A;  1BQN A;  3OYG A;  3ZET B;  2E2Q A;  4DU1 A;  1X1P A;  2VG6 A;  3TU5 A;  3O4N A;  1WBB A;  3HPG A;  3OTO K;  3DRP A;  4IZ9 A;  5FDL A;  3O3H A;  4FLV A;  1WAJ A;  1NM1 A;  3SUN A;  4PUO A;  3OYC A;  3KKS A;  2QTD A;  3TTF A;  2WFB A;  4BY9 C;  3MCP A;  2NNW A;  5TKY A;  4BRN A;  4X62 K;  4HUE A;  2VWJ A;  4E89 A;  4CEA A;  3CCJ N;  2XO7 A;  1U04 A;  4NCA A;  3S3N A;  2OTJ N;  2GUP A;  4CF2 A;  3QEW A;  5M1K A;  2VGM A;  3DLE A;  3O9R A;  3ZSX A;  4GKJ K;  4CEF A;  5KQ8 A;  2HHU A;  1HNW K;  3G4S N;  4CFD A;  4FLU A;  3D7E O;  1N32 K;  5BRD A;  1BCM A;  3HPO A;  1M1K O;  3PUF A;  1XQS C;  3C94 A;  2I7N A;  1Q9Y A;  3EE9 A;  3R1X A;  1K8A O;  2QWR A;  3O8M A;  3H08 A;  3P83 D;  3IG1 A;  4B1W B;  3AVJ A;  4DV2 K;  2QWL A;  1XC9 A;  5LMN K;  1KVA A;  1RCH A;  3D45 A;  4B8C A;  3SAG A;  2RE2 A;  4CGJ A;  1ZYQ A;  3H1V X;  3SLC A;  1RDD A;  3VER A;  2P9K A;  4I6M B;  5IWA K;  4ZHR A;  1SKS A;  3AA5 X;  1D4X A;  2ZQB A;  1V4S A;  5KRT A;  1FXX A;  3THY B;  4U67 L;  4W5Q A;  3R9P A;  3T19 A;  3MN7 A;  4BR9 A;  3J8A A;  4W5N A;  3SYZ A;  1S5J A;  4E7I A;  2FBV A;  1TL3 A;  3OYF A;  3FFK B;  2O8E B;  4U7B A;  5M1P A;  1VQ4 N;  1VQ7 N;  3QIO A;  4B8A B;  1MDU B;  3T69 A;  4DV7 K;  4FM2 A;  5C12 A;  5JMV A;  5FRN A;  1YAG A;  2YNI A;  4FCY A;  3M8S A;  5J2P A;  1Q8I A;  3BZK A;  4FWL A;  3CIP A;  5GAD P;  5JVG L;  1OKJ A;  4IJN A;  3MK6 A;  3BY5 A;  2O8C A;  4N56 A;  2OCE A;  1XWL A;  4FOI A;  3UKU A;  4JEP A;  4QCL A;  2D0C A;  1NGJ A;  5I42 A;  4EFH A;  4CJL A;  2BTF A;  4DV4 K;  4K25 A;  1NGC A;  3CM5 A;  1KCF A;  2GWK A;  3CXC M;  1KQS M;  3H3N O;  3KZB A;  3EZW A;  1MWM A;  2PBD A;  1BQM A;  3LAN A;  5BN8 A;  4FL9 A;  3FLC O;  4M3R A;  3DAW A;  1OVY A;  1ATN A;  3K9K A;  4CJF A;  3PO5 A;  1GLC G;  3NCI A;  1FJG K;  3KLH A;  3U8X A;  3PY8 A;  4CGG A;  5FPE A;  4O5F A;  1N8R O;  1NGH A;  2KLA A;  3MN6 A;  2E5L K;  4K43 A;  3LPU A;  3O5B A;  4LSL A;  3LP0 A;  4WE1 A;  4E19 A;  4K0K K;  3GG4 A;  1W2B M;  1NGB A;  1Z6R A;  4K8Z A;  3SAF A;  1HKG A;  2ZD1 A;  1GLJ O;  3DLG A;  4FLY A;  1TGO A;  2O8F B;  3ASM A;  4CF9 A;  4G9Z A;  4E7J A;  2ZM6 K;  3C6A A;  2VG7 A;  1RDC A;  2E6M A;  4N47 A;  1SV5 A;  1RTI A;  5A2Q O;  2P9L A;  4HCC A;  4FJ7 A;  1IKV A;  1I3A A;  3A5M C;  4KH5 A;  4I9Q A;  2HHX A;  1EWR A;  3HVT A;  3U4L A;  3N4Q A;  4XH1 A;  4PL8 A;  3DLB A;  4CJP A;  2Z1I A;  3R6M A;  3R3L A;  4DV3 K;  4FWO A;  2A1R A;  4KTZ A;  3ZX3 A;  4FW2 A;  3V81 A;  2RF2 A;  4FM1 A;  1F21 A;  3U6F A;  4DTU A;  3AAR A;  3Q7B A;  4EP5 A;  3E01 A;  4CZL A;  4FLX A;  2LSN A;  3CD6 N;  3TSU A;  4B9L A;  1CZB A;  2HBL A;  2VQF K;  1K73 O;  3NF6 A;  5C2D A;  5D3G A;  5SWM A;  3RSE B;  1GLL O;  3TAM A;  4WFB L;  3W0L A;  4BR2 A;  1IH7 A;  1X9M A;  2HHS A;  5AQP A;  3VEY A;  2F8T A;  3WNG A;  1CXU A;  2FLO A;  4C8K A;  1RDB A;  3K9J A;  2JWL A;  3EO3 A;  1SL2 A;  1NWK A;  4DUZ K;  2FXU A;  5BN9 A;  4CJT A;  3W3D A;  2JLE A;  1C6V A;  4EHU A;  3F9M A;  3QBW A;  2NRX A;  2IS3 A;  3E66 A;  4IEI A;  3VEO A;  2NZT A;  5AQU A;  4JLH A;  2KW4 A;  3GE1 A;  4ID1 A;  2B4J A;  5EXW A;  1WOQ A;  4AM6 A;  3HT3 A;  4JKD A;  1KC8 O;  4GW6 A;  1YXQ A;  3EE8 A;  4E7H A;  2O4G A;  4DU4 A;  3SQ0 A;  4ZTJ A;  3THV A;  4BC3 A;  4CK1 A;  3ENO A;  5BRE A;  1VSF A;  3NGI A;  1WNS A;  1V4T A;  3EYZ A;  1HYS A;  1WSE A;  1LAV A;  3E9L A;  3TSQ A;  5EOY A;  4JK9 A;  3IRX A;  1U47 A;  3ZSR A;  4B9V A;  3QLH A;  4CIE A;  2Z1H A;  4O8K A;  4N41 A;  4I2Q A;  3TTC A;  1KLN A;  3O08 A;  4CGI A;  3AVK A;  4K8X A;  3LAK A;  1I94 K;  3K0S A;  3DLR A;  5F2R A;  1O1W A;  1S22 A;  3HL8 A;  1RTH A;  3QES A;  3HXM A;  2KFZ A;  4LFC K;  1EQY A;  1S1W A;  4PKI A;  1BA0 A;  4K41 A;  1TKD A;  1VQK N;  4TSX A;  3L4Q A;  2FBY A;  2R7Y A;  4FM0 A;  3LP1 A;  4IFY A;  4FSV A;  1S1X A;  4FZY A;  4FPA A;  4CW7 B;  2P9S B;  1W7A A;  1FKO A;  5KPT A;  2ASO A;  4CIF A;  4JI2 K;  1ATS A;  1DTQ A;  4WFA L;  3NGY A;  1J9A A;  1NK5 A;  1HMV A;  2OAN A;  4ISE A;  1BCO A;  4CK2 A;  1G15 A;  2V7Y A;  5BRF A;  1JXB A;  5AQT A;  3HBT A;  3CJ7 A;  2YV0 X;  5DMR A;  5M1F A;  3WXM B;  4A59 A;  3CYM A;  1L3S A;  3PSF A;  2NRZ A;  2VYP A;  3RMD A;  1J54 A;  3T1H K;  2NRW A;  4XEI A;  4KHQ A;  3QER A;  2UUA K;  1BIZ A;  3KIO A;  4IOC L;  1G99 A;  4Y1C A;  5JLH A;  4WQ5 C;  4CHZ A;  3ULE B;  4X64 K;  3CCM N;  3C95 A;  4WYB A;  4M3W A;  3KHY A;  2GEL A;  2E6L A;  3D2F B;  4DTO A;  5AQS A;  3A5L C;  3TAE A;  4JD2 A;  3OYL A;  4DSF A;  3SQ2 A;  3RRG A;  3FFI A;  3RMB A;  3OVN A;  1W9H A;  4CHN A;  3GL1 A;  2BH1 A;  3TAB A;  3KLF A;  5C10 A;  1NGG A;  4JI8 K;  3UB5 A;  3FGU A;  4KHW A;  3MXI A;  2Y1I A;  3ATU A;  3ZET A;  1YVN A;  1DT9 A;  4H5R A;  4DR6 K;  2ZJP L;  2BE2 A;  3TAR A;  4Z94 A;  4EZ6 A;  1LWF A;  1NJZ A;  4V19 S;  3CCQ N;  4CGD A;  3BZC A;  2AJQ A;  3NFA A;  3UE5 A;  3IAY A;  3VMF B;  1KVB A;  1LWE A;  3SBG A;  1NKC A;  3OBY A;  1RFQ A;  4CHY A;  3VQ5 A;  4MFB A;  4JI3 K;  2B6A A;  4PKG A;  4EP4 A;  4F3T A;  1HUX A;  1OH5 A;  4JKG A;  2BGG A;  4KAZ A;  1L3T A;  4B3R K;  5HRS A;  4DFM A;  5HOO A;  2DFH A;  3EL2 A;  3LDL A;  1HNV A;  3C65 A;  1GLB G;  1TKZ A;  3ALY A;  5LMU K;  3WQT A;  3CJA A;  3WT0 A;  3BF1 A;  4BRL A;  1LWC A;  2IGI A;  5GIN A;  4IWV A;  1JLG A;  2F9T A;  2DTU A;  1U48 A;  5H1S Q;  3VOV A;  3K5O A;  2ZGZ A;  2Q36 A;  3F73 A;  5AQJ A;  2Q2R A;  1YTU A;  1NJY A;  2FSK A;  1WSG A;  2FC0 A;  2GV9 A;  3HYF A;  3S3O A;  4BR0 A;  4FJG A;  2NLX A;  1NOY A;  5AQK A;  3V1R A;  4Y0W A;  3QEI A;  4JRQ A;  4YOU A;  1KSP A;  1BO5 O;  1ZBF A;  4B1Y B;  5CE3 A;  4K42 A;  5AQG A;  2ZF5 O;  2PY5 A;  2HBK A;  3AVA A;  3OJS A;  4F8R A;  3THX B;  4FJN A;  3NDK A;  5AQL A;  4I6M A;  4OLB A;  2E20 A;  5ELZ A;  2FF6 A;  1YUW A;  4DUY K;  5J2Q A;  1TK5 A;  4HUF A;  1DTT A;  4Z0U A;  3BF3 A;  4AIL C;  4O5B A;  4OPH A;  3OS0 A;  3L2R A;  4YHH K;  4L3Q A;  2P9U B;  3MX5 A;  1TUY A;  3LWL A;  3QIC A;  1QSL A;  1VSM A;  3THY A;  4ELV A;  4NXN K;  1XNR K;  4YFU A;  3QFU A;  1KXP A;  3SMS A;  1SQK A;  3SQ4 A;  5AQW A;  4BRK A;  4EHT A;  1RDA A;  3VQQ A;  4F9O A;  2YHY A;  4X65 K;  1OH7 A;  1NG9 A;  2OA8 A;  2E2N A;  2O8E A;  1NU0 A;  2QI2 A;  4DSK A;  4DQP A;  3SNN A;  4CGF A;  4H4O A;  3SMP A;  3Q7C A;  4PQU A;  4NB4 A;  3I55 N;  3I56 N;  4ISG A;  3M8P A;  5JS2 A;  3TI0 A;  3NAE A;  4DV6 K;  4BRQ A;  1Y64 A;  4JKF A;  4FK4 A;  1E4G T;  4A5B A;  4BRI A;  3ZEU B;  1WN7 A;  4WQ5 A;  3RR8 A;  3IUC A;  2HHT A;  1RT1 A;  2HMP A;  5AQR A;  4PWD A;  2W40 A;  1OH8 A;  3PX6 A;  4FJI A;  1ITG A;  1WSJ A;  4LFB K;  3LDQ A;  2V52 B;  4NXM K;  4I2P A;  3EZ5 A;  1QQO A;  2OPS A;  4BGB A;  4H0O A;  1KTQ A;  1B9D A;  2Q0R A;  5HL7 L;  4A61 A;  4DQR A;  1U45 A;  4M7X A;  3VEV A;  1WSH A;  5HLF A;  4WQ4 C;  4A2B A;  3GBT A;  4CK3 A;  4LF4 K;  1X9S A;  3F2K A;  1ASU A;  2GUI A;  3K5L A;  1E4F T;  1J5E K;  4FOE A;  2XY8 A;  5DM6 L;  3BEX A;  3CET A;  4BRE A;  3OYB A;  4C8M A;  4CJR A;  4BE2 A;  3V9U A;  4HVJ A;  2ITM A;  5LJV A;  2OYQ A;  5KGX A;  3K2P A;  3NMU A;  5HRN A;  2BDP A;  2O8F A;  5AFU A;  1Q18 A;  5BPN A;  1NK8 A;  1NJX A;  1RT6 A;  1CXQ A;  4JKH A;  1SS6 A;  3FR0 A;  4DV1 K;  2FBT A;  3HTV A;  4C8N A;  3RRH A;  4CHQ A;  3UKR B;  4CFB A;  1VQ6 N;  3V4I A;  3LP2 A;  1YHQ N;  1TKT A;  3SPY A;  3SUP A;  3P5J A;  4YOV A;  2IIR A;  2GEM A;  2WBN A;  1W0H A;  3VN5 A;  4CED A;  1ASV A;  1S1V A;  1BU6 O;  1TYQ B;  3KLG A;  3VEN A;  3SK3 A;  1HNZ K;  3IKM A;  3CC4 N;  1NK0 A;  4CVN E;  4IG3 A;  2QW9 A;  3PIO L;  1RBS A;  5JVH L;  3RSE A;  4OVL A;  4CF0 A;  4FXD A;  3F9K A;  2ZJQ L;  4I7F A;  2P9I B;  5AQX A;  4CBW A;  3DXM A;  1L5U A;  2QWO A;  4HUG A;  3M8R A;  1BHL A;  2G8I A;  1ZBS A;  1Q81 O;  3EN9 A;  4WFN L;  3CF5 L;  4CIG A;  4KHS A;  2NRH A;  4CEO A;  1UOC A;  4FO0 A;  2QXL A;  4DS4 A;  3G71 N;  4ELT A;  4GVM A;  3IDH A;  4O0I A;  4DMN A;  4IDH A;  4JYA K;  1Q9X A;  1RBT A;  4KBO A;  1C1A A;  2QXF A;  2P9P B;  1NMD A;  3DLL L;  3IMX A;  1D8Y A;  1RT5 A;  1ZBH A;  1SL1 A;  1SKW A;  3IS9 A;  1A5X A;  3SZ2 A;  4DV0 K;  1IBM K;  4IKF A;  1ZBI A;  1EP4 A;  2IVP A;  4YNQ A;  3G25 A;  1WUA A;  4C8L A;  1C0G A;  4CJ7 A;  3MWT A;  4CBX A;  4HTU A;  3KD1 E;  1U2V B;  1NGI A;  3LWM A;  1VSL A;  3MEG A;  1S1U A;  4AHV A;  2RKI A;  4Z4E A;  5EU7 A;  1T05 A;  2P9S A;  1ILY A;  1LCU A;  4HCB A;  4KB0 A;  4LSN A;  4Z4G A;  1REV A;  3NH1 A;  4Z4C A;  1BGX T;  4ILH A;  1Q82 O;  1C0U A;  4DR5 K;  3TAP A;  4B9S A;  1S72 N;  2A41 A;  5B8H A;  4WQ4 A;  5GAE P;  2XY7 A;  2YNG A;  1HKC A;  4DF8 A;  2A40 A;  5AQQ A;  1YJ9 N;  1SUQ A;  1QQM A;  4JAX A;  3OYD A;  4DFJ A;  3ZSW A;  4BRD A;  5KPR A;  4DFK A;  4B3O A;  2A1S A;  3VQB A;  1BI4 B;  3H3O B;  4OKJ A;  2W6K A;  3WNE A;  3C6T A;  3CJ1 A;  3ZCM A;  3PIP L;  4BVO A;  2XY6 A;  3O4Q A;  2I7P A;  3FZF A;  4HHT A;  4H8K A;  3CPE A;  4FJH A;  3AVF A;  1LW0 A;  2VWB A;  3B6P A;  3ULE A;  2Q3S A;  1T8E A;  3OYE A;  3D2F A;  3VET A;  3CJ9 A;  5AQY A;  2F96 A;  4LF5 K;  3HZ6 A;  4FWQ A;  1C0F A;  2HHQ A;  2WON A;  1NGE A;  3KWG A;  1GOC A;  3JAM O;  1RTJ A;  3L4I A;  3DOL A;  4RW4 A;  3K58 A;  1O13 A;  1KRP A;  4BRH A;  4ELU A;  1Q86 O;  1SAZ A;  5SZT A;  3MXM A;  4DTM A;  4XH5 A;  1C1B A;  3V6D A;  2A6A A;  2PYJ A;  4DF4 A;  3OYM A;  4J2A A;  4FLW A;  1LV5 A;  2KKZ A;  4B9Q A;  1JLC A;  2F7T A;  4GKK K;  1VSE A;  2UYT A;  3RMC A;  1Q7Y O;  4KO0 A;  4WCE L;  2V7Z A;  3ID6 A;  3TSP A;  2YJE A;  1DEJ A;  4DSI A;  3DLH A;  3EY1 A;  3VQA A;  4BC4 A;  3LAL A;  3L8B A;  2X6S A;  3CG7 A;  4KH6 A;  4KI6 A;  5CY4 A;  3OS1 A;  4DR7 K;  1NK4 A;  3T3F A;  3B8A X;  1QVG M;  2ASM A;  3QEV A;  5F0X A;  2O4I A;  4RW7 A;  4GY2 B;  4PKH A;  5AR0 A;  4FJJ A;  1T6D A;  4CJW A;  4IO9 L;  2QWN A;  2XY5 A;  4A2A A;  2KFN A;  3RTV A;  1NJI O;  1WBD A;  3CC2 N;  4R5P A;  2Q0U A;  3B6O A;  4AHT A;  1A5W A;  2X6N A;  2KTQ A;  1JLA A;  2NRR A;  2P9N B;  4CD1 A;  4DR1 K;  3ZT2 A;  4ILJ A;  3I0R A;  1JL1 A;  3HI0 A;  4RW6 A;  2HND A;  5BR9 A;  4CZG A;  2XRI A;  1JXE A;  3K5N A;  4OJR A;  2YI1 A;  1NKE A;  5CYM A;  3AVB A;  3QIN A;  4DCH A;  2G8H A;  5M1N A;  2ZGY A;  3LZJ A;  4BRC A;  3A8Y A;  1B92 A;  1YI2 N;  1IKX A;  4H5V A;  2ASP A;  3QFP A;  2P9U A;  3A2F A;  3HOS A;  3VES A;  3AVC A;  4LH4 A;  3CME N;  5BPM A;  2VG5 A;  4CBU A;  3DWL A;  4BQZ A;  3QBX A;  4KTW A;  2E2O A;  2Z1J A;  4DS5 A;  5ADX A;  4FJX A;  3EEQ A;  3DRR A;  2VWK A;  4DQI A;  4FK0 A;  3H1Q A;  3KK7 A;  4MO4 A;  4RW8 A;  5KTQ A;  2V51 B;  4E1N A;  3OYK A;  3CMA N;  1Z26 A;  3AA4 A;  4AHC A;  4W5R A;  5KI6 A;  4MLH A;  2G8F A;  3WEE B;  2YNF A;  1RT3 A;  4Y1D A;  3NH0 A;  3AA2 A;  1QZ6 A;  4YDU A;  5C2F A;  3OHR A;  4A62 A;  3HO1 A;  4ISF A;  3K5M A;  3ZEU A;  3CC7 N;  3ZLJ A;  2IC3 A;  3PLA A;  3M1F A;  1BUP A;  5JLF A;  3OY9 A;  4CES A;  3J7Y P;  4B9T A;  2BUP A;  1IJJ A;  4B3M K;  3AVG A;  4W5O A;  1XHX A;  4UY8 O;  1RBU A;  4CZF A;  3P31 A;  3CER A;  1YJN N;  4H4M A;  5AZI B;  2ATQ A;  3OW2 M;  3J7Z O;  1U49 A;  2PAV A;  3WNF A;  2ZWH A;  4CF8 A;  3AAP A;  4YY3 K;  3VEZ A;  1WLJ A;  4EZ9 A;  1VQM N;  3O4W A;  3ID8 A;  3QDK A;  3VEW A;  2Q31 A;  1N34 K;  4H0V B;  3C7N B;  3VQC A;  2YHA A;  4QOZ B;  5FPD A;  4IO8 A;  3CFR A;  1YJW N;  1JKH A;  4B1X B;  3G6E N;  4DSE A;  4BDY A;  5AQO A;  4DTR A;  4JI1 K;  3PV8 A;  3RMA A;  2HHV A;  2UXD K;  3CQ8 A;  4LF9 K;  4NYN A;  4EIA A;  1KVC A;  2J4R A;  2ZE2 A;  3P39 A;  3QB0 A;  3JXU A;  4F2S A;  4XH4 A;  1EKE A;  3PX4 A;  4AF1 A;  1YIT N;  4ZTF A;  4JKE A;  4QS9 A;  1JCE A;  2P1J A;  5CR4 A;  4E1M A;  3I33 A;  4LFA K;  3UKR A;  5GAG P;  1GOA A;  3DXK B;  4FWR A;  3ZT3 A;  4W5T A;  1RNH A;  1RBR A;  1TYQ A;  2E8A A;  3VTI A;  3A5N C;  4DR2 K;  4CJU A;  4O44 A;  3VGK A;  4Z4I A;  3HOT A;  2I5J A;  3O9U A;  2EWS A;  3JSM A;  3VF2 A;  3AVM A;  1X3M A;  4DR4 K;  3L0Q A;  2P9I A;  5M1Q A;  1LAW A;  3O9T A;  2KZZ A;  5ADX H;  4BE1 A;  2PZS A;  4KRE A;  4B1V A;  3VQ6 A;  3AVL A;  3AGK A;  4FJ9 A;  5KRS A;  4L8R B;  1K9M O;  4KHU A;  2HVH A;  5I3U A;  3WUH A;  1JCF A;  1NKB A;  4QAG A;  1XUP O;  2HNY A;  1TUU A;  5J2N A;  4KFB A;  2HOE A;  3DOK A;  1H1V A;  4O8U A;  1BG3 A;  4FLT A;  5JS1 A;  2P9P A;  3AVN A;  1BOT O;  3THW B;  4F4K A;  4KPY A;  4CJ4 A;  4IFV A;  4LH5 A;  3VQ9 A;  2HF4 A;  4M63 C;  1OH6 A;  4JN4 A;  2P5G A;  2G8W A;  3ZT4 A;  3V1Q A;  3TR8 A;  4CJK A;  2IDO A;  1IBL K;  4FK2 A;  2IVO A;  5FPM A;  1HJO A;  4DTJ A;  3M6G A;  2WTU A;  4JRP A;  4M42 A;  4FJM A;  4B1Z A;  4YOT A;  1QQN A;  1N6Q A;  1SKR A;  1U2V A;  5GIO A;  5GIP A;  4G1Q A;  4CZJ A;  5FRO A;  4I9L A;  1IKY A;  4CJQ A;  1S9G A;  4AQY K;  3M3Z A;  4Z4H A;  4FWN A;  4CJV A;  2H3G X;  4F3O A;  2PFU A;  4JKB A;  3CCL N;  1DLO A;  1C0M A;  1J53 A;  1NK9 A;  3TAG A;  2VQE K;  3ZSV A;  1HPM A;  4OKK A;  3TWH A;  4H0T B;  3KD5 E;  5C25 A;  5TKW A;  4OKE A;  3SUQ A;  1VQO N;  2OPP A;  4FJ5 A;  2YHB A;  4AHU A;  1C1C A;  5K14 A;  3FE1 A;  3VTH A;  1BDG A;  1X9J A;  4EAH D;  4KHY A;  1VSI A;  2FF3 B;  4IG0 A;  3S41 A;  4YOY A;  3O3G A;  3TAF A;  4LF7 K;  2YKM A;  1RTD A;  1BI4 A;  2Q97 A;  4NCB A;  4FW1 A;  3DRS A;  2YKN A;  4H5T A;  1DKG D;  3O3F A;  5J2M A;  4IBN A;  1ZXO A;  2UXC K;  3DYA A;  4KH4 A;  4B1U B;  4M3Y A;  5CHI A;  5AQI A;  1T44 A;  4DTX A;  4KHN A;  1MA9 B;  2QK9 A;  1DGK N;  3R8E A;  4CEB A;  1YF5 L;  5C24 A;  5IT9 O;  5AQN A;  3VF6 A;  5CYQ A;  1VAZ A;  4CI6 A;  4BR7 A;  1HYZ A;  4RW9 A;  3TTD A;  4CF1 A;  2YNH A;  4FJL A;  1HQU A;  1WSI A;  2QWQ A;  1KD1 O;  3J80 O;  3SCX A;  1KLM A;  2QKK A;  2W41 A;  1X9W A;  2HMI A;  3AO1 A;  2CH5 A;  2CGK A;  1HR0 K;  4C8O A;  2BAN A;  4PY5 A;  1GLF O;  4DG1 A;  4A5A A;  3LAM A;  5T7B A;  3LDN A;  1HPZ A;  4LD0 A;  4CFA A;  2NRT A;  3SV3 A;  2NRV A;  4KRF A;  2OPQ A;  4BWJ A;  5HP1 A;  1P90 A;  4DR3 K;  4R79 A;  1J5O A;  3HJF A;  1SL0 A;  4AHR A;  4JV5 K;  4JI0 K;  4BRM A;  2E88 A;  3OJU A;  3TAN A;  4BRG A;  2AP1 A;  3L2Q A;  1E3M A;  4FJ8 A;  2QA4 N;  4DTP A;  1EX4 A;  5LJW A;  3EKU A;  1L3V A;  4FVU A;  4CCH A;  1R0A A;  1TV6 A;  1MU2 A;  3NBP A;  2DPN A;  4XIU A;  3L2V A;  1TK8 A;  3FZL A;  4ILG B;  1HLU A;  4E3S A;  2D0P A;  3DLK A;  4JKG B;  4KHP K;  4O4G A;  1S9E A;  5I9E B;  2W6L A;  3PX0 A;  1QHA A;  4E7L A;  4J2B A;  2UUB K;  3MDQ A;  2O8B B;  2P9N A;  1S6P A;  1N5Y A;  3WXI A;  4GV3 A;  4KB1 A;  4CEQ A;  3CFO A;  3LM2 A;  4M3U A;  3KK3 A;  2YCH A;  3L2W A;  4DQS A;  2A3Z A;  2GX9 A;  2JGU A;  1T3V A;  3MCA B;  3NVK A;  2RN2 A;  4FZX C;  4FYD A;  3S3M A;  3OYN A;  3O80 A;  2O8D B;  5HRP A;  2IVN A;  4BRP A;  1D9D A;  3MX2 A;  2HBJ A;  4DFP A;  4N5S A;  2XHB A;  1Z05 A;  2A42 A;  2FBX A;  4RWT A;  1EWQ A;  4H5N A;  2WC9 A;  5AQH A;  1VQL N;  2GTD A;  1YIJ N;  2QKB A;  4YOR A;  2A5X A;  3NGZ A;  1FW6 A;  1VQ9 N;  1NGF A;  3O1W A;  1GOB A;  4IFE A;  3KJV A;  4LY7 A;  4A57 A;  3OYJ A;  1ESV A;  3KLE A;  1W97 L;  3BDP A;  1K6Y A;  1T7P A;  1NK6 A;  4IOA L;  2ETJ A;  3F5T A;  4DTS A;  5AQF A;  1K8K B;  4DU3 A;  1S1T A;  3C6H A;  5C42 A;  3MXJ A;  5AZJ B;  4PA1 A;  5M1O A;  1JLE A;  1U6Z A;  4JI6 K;  4JNE A;  5AFU H;  1Y97 A;  2PYL A;  3TPQ A;  1WAF A;  4H0X B;  4CD3 A;  3WEE A;  1ZBL A;  3P38 A;  4CHO A;  4DSJ A;  1EO1 A;  3NVM A;  3OA9 A;  2P5O A;  4X66 K;  4B9U A;  2IAJ A;  3HPH A;  3RR7 A;  3VGL A;  4NLC A;  1LOT B;  4NO7 A;  2DFF A;  2Q1N A;  1T03 A;  4BDP A;  3S9H A;  4B08 A;  1BIU A;  4QS8 A;  3QEX A;  4BVP A;  2RHK A;  4UQG A;  1VRT A;  3WXJ A;  1RT4 A;  3AO4 A;  1KAY A;  4NYF A;  3D6R A;  1OVQ A;  3T7Z A;  4BE0 A;  5AZI A;  3EKS A;  2Y1J A;  3VQP A;  4CJ5 A;  4B3T K;  4YDU C;  3CPW M;  3QO9 A;  3T1A A;  3L6Q A;  1XNQ K;  1VHX A;  2VCP A;  4BRA A;  3K59 A;  3PSI A;  4J2D A;  2F9W A;  3FZM A;  1JCG A;  3AVH A;  3MMV A;  1T6C A;  1NGD A;  3SPZ A; 
#chains in the Genus database with same CATH homology
 4DV7 K;  3T1H K;  4LF7 K;  2UUA K;  4GKK K;  4X62 K;  4JI5 K;  4DR4 K;  4OX9 K;  5BR8 K;  1N36 K;  2UXC K;  4X64 K;  4DUZ K;  4DUY K;  2HHH K;  3J7Y P;  5LL6 Z;  4DR7 K;  4DV1 K;  4B3M K;  5FLX O;  4GKJ K;  4YHH K;  4DV4 K;  5IT9 O;  4NXN K;  1HNW K;  1XNR K;  1IBK K;  4DR2 K;  4JI8 K;  1N33 K;  4DR5 K;  4YY3 K;  4X65 K;  1N32 K;  3J80 O;  4DR6 K;  1FJG K;  4DV5 K;  4V19 S;  1HNZ K;  4CVN E;  1HR0 K;  2UU9 K;  2E5L K;  3J81 O;  1N34 K;  4DR1 K;  4K0K K;  4DV2 K;  1XMQ K;  1I94 K;  4LF6 K;  5AJ3 K;  5LMN K;  1IBL K;  4DV6 K;  2UUC K;  3J7A P;  4JI6 K;  4JI1 K;  4DR3 K;  4LFC K;  4JI3 K;  2UXD K;  4JV5 K;  4JI0 K;  4LF9 K;  5IWA K;  2ZM6 K;  4JI4 K;  4LFB K;  4B3R K;  4X66 K;  5A2Q O;  4NXM K;  4CW7 B;  1IBM K;  4LF5 K;  5LMU K;  4JI2 K;  4AQY K;  4LFA K;  1XMO K;  3JAM O;  4JYA K;  4JI7 K;  4B3S K;  4DV3 K;  1HNX K;  2VQE K;  4B3T K;  2UXB K;  4KHP K;  1XNQ K;  4LF4 K;  4LF8 K;  3OTO K;  2VQF K;  3T1Y K;  2UUB K;  1J5E K;  4DV0 K;  2F4V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...