4DV4K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv4K00
4YY3K 4DUZK 4DV0K 4B3RK 5LMUK 4DV2K 1HNWK 4LF4K 3JAMO 4X66K 4GKJK 4DUYK 1HNZK 4DR1K 3OTOK 1N34K 4YHHK 4NXNK 4DV3K 4LF6K 2UXDK 5LL6Z 2UUAK 2UUBK 1HR0K 4X62K 3J7AP 3T1HK 4OX9K 4DV5K 4V19S 4JI1K 2E5LK 5LMNK 4JI8K 2VQFK 4JI5K 4AQYK 2UXBK 4JI7K 1IBKK 2VQEK 4X64K 4CW7B 4DR6K 5IWAK 3J80O 4B3TK 4DR4K 4LFBK 1IBMK 1XNRK 1HNXK 5A2QO 2UXCK 1XMOK 4DV6K 4GKKK 1N32K 4DV7K 1IBLK 3J7YP 4LF5K 2UU9K 1N36K 4LFCK 4DV4K 4DR7K 1J5EK 4JI4K 4JI3K 4LFAK 2HHHK 4B3MK 4JI6K 3T1YK 4NXMK 3J81O 4DR5K 4JYAK 4JI0K 4DV1K 5FLXO 4LF8K 4K0KK 4B3SK 1XNQK 5IT9O 4CVNE 2ZM6K 2UUCK 5AJ3K 2F4VK 1FJGK 1N33K 5BR8K 4JI2K 4KHPK 4DR3K 4LF7K 4X65K 4JV5K 1I94K 4LF9K 4DR2K 1XMQK
chains in the Genus database with same CATH superfamily
1QQCA 4KTQA 4CIEA 4FPBA 3OBYA 3EY1A 3U9ZA 4IJNA 4OLAA 3SV4A 3ZT0A 2RPIA 4BC3A 3CCRN 2F9WA 4DR1K 3H3OB 3BZCA 4NXNK 4DV3K 1SUQA 2VWKA 5MLCQ 4I6MB 4NLCA 3T1HK 1VQMN 4I9QA 4E1MA 2KTQA 3NF6A 3RR8A 4DV5K 4V19S 4IEEA 3AV9A 3SAGA 4JLHA 4DTPA 1BWFO 3G25A 4FWPA 1FKPA 1VRTA 4KO0A 2BH1A 1ZXOA 1VQ8N 4FPAA 1KXPA 2ASMA 4CIGA 2D0AA 4I2QA 2NNWA 2GELA 3E66A 4A61A 4U7BA 2FF3B 4C8OA 1B9FA 3R8EA 3HVRA 4CGGA 4FXDA 4X64K 1LWFA 4CW7B 4BE0A 3CERA 1KVBA 1T3VA 3V6DA 2A5XA 3CM6A 3VEYA 1N32K 5BRDA 3ZSOA 3CC4N 4MO5A 3P39A 3LZJA 4Y1CA 4EAHD 1Q9XA 4YOWA 4AILC 3ATVA 2UU9K 3NCIA 4BVOA 2VWBA 2D0OA 3KLGA 4BC4A 4E7KA 2O8BB 1D9DA 2D0CA 3C6AA 2HNYA 2QI2A 5AQWA 5BPNA 4I6MA 1BGXT 1VAZA 4LSNA 3AVGA 4JKHA 4DQQA 4DQPA 4FJ5A 4ISFA 1LW2A 1NK8A 4CK2A 3I55N 3PX0A 2P9UB 5GAGP 3HVTA 1L5UA 3SNNA 4FLXA 3KKSA 3P4IA 4OPHA 4CEZA 1WSHA 3P83D 3U3YA 5DM6L 1YHQN 3SUOA 4FJ8A 4LF7K 1Q18A 3VEXA 3CETA 1L3SA 3V9UA 1TL1A 4DSJA 3OYCA 1QSYA 4BRDA 4Z4EA 3AY9A 3LWMA 1C1CA 3KIOA 3P1GA 2O8BA 1N5YA 4J2BA 4N76A 2YNIA 4CZFA 5B8HA 1TK5A 2PY5A 1ATSA 3ZEUB 3SJHA 1GLDG 2Q0UA 4DG1A 5FROA 1HNIA 1WB9A 2P9UA 3NVKA 4FJXA 2VQFK 1FK9A 4MLEA 1NU0A 1WSJA 2FC0A 3CJBA 5JMVA 4BR7A 4FJMA 2JLEA 1GOBA 2O4IA 3HZ6A 1C6VA 2HF3A 1LOTB 1JL2A 3WXLA 1NOYA 1Y97A 1GOAA 5BPMA 1TL3A 1KAXA 3ENHA 4J2DA 3KK3A 2YNFA 3T7ZA 3LAMA 3PX4A 1VSEA 1NGJA 1C1BA 4GV9A 1CZBA 3ZEUA 3H08A 1BI4A 1GLLO 2ITMA 1ZBIA 5C0YA 3OJUA 4OKKA 1RGIA 1O13A 4F4KA 4FJLA 2ZGYA 3VGLA 4BGAA 4MO4A 4DF8A 1HRHA 1KAZA 3M5RA 5J2MA 1YTAA 3THWA 3HYFA 4O5BA 1GLEG 4M3XA 3M8RA 3IUCA 1NOZA 4KHWA 1ASWA 2PFUA 1Q9YA 2HMIA 2I7NA 3EO3A 1NGEA 4R5PA 3J8AA 1B9DA 3CJ7A 1X9JA 1Z05A 2A1RA 3V9SA 2A1SA 1YXQA 4M3RA 2QM1A 2ZGZA 2X74A 1JLAA 2QXLA 1C1AA 4FK4A 4YY3K 5AQMA 4B3RK 1D5AA 1WOQA 3CYMA 2WC9A 3BZKA 3E9LA 4R79A 5GIOA 3MEEA 3CFPA 2VGMA 3NF8A 1U47A 4FWLA 4CZGA 4CGJA 4O0IA 1DGKN 2UUBK 1ZBHA 3TANA 1K8AO 3SPZA 4A62A 3EYZA 5EXWA 2PBDA 4O5FA 5CYQA 1IV0A 1VSKA 3ZT3A 4GW6A 3RMCA 4GVEA 1GOCA 3ZX3A 2HNZA 4KH4A 4FWNA 3ULEB 4CFBA 4CJQA 4C8KA 4DS4A 3VTIA 4E1JA 1U2VA 4WQ5C 5M1QA 3DLKA 5AQPA 1J53A 5EVZA 5SZTA 2RKIA 3ULDA 4FK0A 4CERA 4DR6K 4LFBK 3J80O 4HTUA 4CGDA 4PKHA 3EKUA 4L3QA 5A2QO 5BRFA 1BO5O 1S5JA 3SLCA 4B8AB 1UWBA 3BF1A 3T1AA 3SMPA 2ZWHA 2F9TA 4CZMA 4O0JA 4YFUA 4DV4K 4OGEA 3OS1A 5HBMA 1ZYQA 4LFAK 2DY4A 2HHHK 4FVMA 3MX5A 4Z4FA 1S3XA 3KVGA 3AO2A 3F5TA 4CJWA 3AARA 5M1OA 3OYBA 3VA0A 3VESA 2W6KA 4FCYA 4DLGA 2D0PA 3I33A 3VQQA 4FJNA 1YTUA 3KK7A 3MK6A 4YOUA 1TKTA 3C7NB 3W3DA 3TPQA 4KI6A 1NKCA 1D4XA 2OZSA 4CEFA 5HRNA 4JK8A 4H5RA 2HHUA 1I3AA 3UKRB 4CVNE 3OYIA 4F8RA 2UUCK 3QESA 1GLBG 1NGDA 4CF9A 1KC8O 3HXMA 4X65K 3WXMB 3QIPA 4BDYA 2OZMA 3PIOL 4FLTA 4I2PA 4A57A 3QLHA 2D5RA 4EZ6A 4XEIA 4KV8A 3PX6A 4OVLA 3TSUA 1UOCA 4WE1A 3HK2A 1U45A 3JAMO 4DUYK 4H8KA 1IG9A 3OS0A 5AQNA 1IH7A 5LL6Z 4BGBA 3SBGA 1VRUA 3C7NA 3VN5A 2CGLA 4JS4A 4CZLA 1KFSA 2O4GA 1T8EA 4A2BA 2OPQA 2WOMA 2EX3A 3L4QA 3UKRA 3TAPA 4AQYK 4GV6A 2XY8A 1G15A 3HPGA 2VQEK 1JL1A 1XHXA 2UYTA 4M7XA 3IKMA 4BC5A 5AQTA 3LPUA 1SL2A 5FRNA 2DFFA 3HP6A 2HSTA 2BUPA 1BIUA 1XNRK 3U4LA 5EU7A 1I39A 3O9RA 3WUHA 1OH8A 5HP1A 3O3GA 3LDNA 1CZAN 5AQYA 3FGUA 3MCPA 2HF4A 4IO8A 3THXB 4DQSA 4RW7A 2FBVA 5M1KA 5J2NA 1EKEA 4QS8A 4DS5A 2B5JA 3WEEB 2HHTA 4DHYA 1EX4A 3H1QA 1J5OA 2WFBA 1ESVA 3KK1A 2VCPA 3ZT1A 4KB1A 1RBTA 3VTHA 5KRTA 2D4WA 4Y1DA 4CBXA 1NNEA 1MA9B 1S1XA 1Z25A 2EWSA 1KFDA 4BG8A 2GBZA 3SJJA 5GADP 5AJ3K 3OYAA 4NCGA 1DTQA 4FWOA 1S22A 1X9WA 3CFOA 4HUFA 3TTFA 5BR8K 3C95A 1BOTO 3JS6A 5E84A 3VPZA 4B9SA 2P5GA 2IVOA 3THXA 4ILGB 5ELZA 2E2QA 2V52B 2KLAA 3A5OC 4Z0UA 3CC7N 3ZX0A 3AVBA 5T7BA 5HROA 3QEXA 4MLHA 2HBJA 4JKGB 4YOVA 1HNZK 4CIFA 2W41A 3V9XA 2HHWA 1TKXA 1U4BA 4M41A 3TAEA 1W97L 3CQYA 3VF6A 4FJ7A 3FZKA 3PV8A 4BQLA 4Q0BA 3HI0A 4CJTA 5HRPA 5HRRA 3VQDA 4PKIA 2OCEA 3O9TA 3WXIA 2RE2A 3JXUA 2ITGA 4CHPA 4DSLA 4N41A 4DTSA 1RTHA 3LM2A 3ZX2A 2QEXN 3SYZA 1HKGA 3HTVA 1NWKA 1D9FA 5J1EA 1SS6A 1RBVA 2UXCK 4BY9C 1YI2N 4M3ZA 5LJVA 5C2FA 1ASVA 3RSEB 3J7YP 4H0OA 3CCMN 3E1YA 3O4NA 4KAZA 1JXEA 4FWSA 4JD2B 5AFUH 4JKGA 3ZYYX 3WXKA 1UAXA 2P9NB 3A5NC 4AM6A 3DJCA 4FO0A 4HCBA 3RMDA 3AO1A 2G8UA 1S6PA 2QKBA 4LH4A 2YHXA 3CCUN 1T44A 1OH7A 4ELUA 4A59A 3ZSVA 3L2RA 4B9UA 4DR5K 3LALA 1HYZA 1HX1A 1TUUA 1QHTA 1LAWA 3S3NA 2Y1JA 1N6QA 2YNHA 4FW1A 3HRGA 4OKJA 3QICA 5GAEP 2Q2RA 3SAFA 1RT2A 3LANA 4HTLA 3THVA 1NG9A 2F8SA 1X9SA 3RSEA 2HHQA 1IJJA 3FFIA 4M63C 4OKEA 2O8EB 4JS5A 1HQEA 3AVMA 3MMVA 4DV0K 4JD2A 4K43A 3LP0A 1YUWA 4FLUA 3IFRA 3OHRA 4KB0A 2P9NA 3OYMA 5AQRA 4IFEA 3WNGA 3BDPA 4OPJA 4E1NA 3HOTA 2QWNA 3UIQA 1N34K 4FJGA 1DLOA 4DF4A 3VGKA 3TTCA 3O08A 2F96A 1VSIA 2QXFA 2Z1GA 4W5QA 3IMXA 4DQRA 4NCAA 1YJWN 4NB4A 3KLEA 4B8CA 4QOZB 5BN8A 3AGRA 2KKZA 3VMFB 3KD1E 1D8YA 1C0UA 3ID6A 4W5RA 2Q3SA 1S1TA 2FXUA 5DK5A 1U48A 1SQKA 1TYQB 1OKJA 3I8DA 1MU2A 4MQ3A 2B4JA 5IWAK 1RDDA 4CJFA 3PY8A 1HUXA 3C6TA 2IVNA 4IOXA 2BANA 5F2RA 3D2FB 4DTJA 1XMOK 3ZSWA 1NM1A 3MN5A 4GKKK 4JK9A 1SV5A 2BGGA 2JWLA 3VQ5A 4DSFA 4JKCA 3TTDA 1YVUA 2Q97A 4DR7K 4K41A 3QETA 1TV6A 4JI4K 3U6FA 5FDLA 2ZJRL 4JI6K 4O8UA 3UE5A 4BRGA 3D7EO 3H46O 4EZ9A 1TAUA 5ADXH 4CJ5A 1NJIO 2G8WA 1J6ZA 1XI1A 3ENBA 3RRHA 4M3YA 4JYAK 2Z1IA 3HO1A 4BRFA 1W0HA 4CESA 4CJ7A 2E2NA 3ID8A 1TYQA 1KTQA 4KH6A 1L3TA 1SZ2A 1RBUA 2GWKA 3AVIA 2HBMA 1FJGK 4ISEA 4YOXA 4B1VA 3DXKB 5BREA 3CJCA 1GLFO 3D2FA 3B6PA 3CJ1A 4LF9K 4DCHA 3AO3A 5EOYA 1K9MO 2FBYA 1MWMA 4EHTA 3VEOA 1JXBA 3V4IA 4IG0A 4F3TA 3DI6A 1IKWA 2IIRA 4DTRA 3LPTA 4IFYA 4BR2A 1IG8A 1HNWK 5LJWA 3EE8A 4XH4A 3MWPA 3BEXA 2PYJA 3AVCA 1RBSA 4IXCA 3RMAA 2UXDK 5AQJA 2ETJA 4DFJA 4CE9A 3VA3A 3O1WA 5JVHL 2NRWA 3O9UA 1YT3A 4FZZA 1RTIA 3OYDA 3ASMA 4CFDA 2OYQA 4KPYA 3OYNA 4DB3A 4BR9A 4JI7K 4BVPA 1IBKK 1YAGA 4NLBA 5KGWA 1NKEA 1NJXA 1BCMA 1HKCA 4IFVA 3ZETB 3DXKA 4F9OA 3A5LC 1N8RO 4B3TK 1JLCA 1CXQA 5C2DA 4WFNL 3EZ5A 3E9OA 1WNSA 2NRXA 2G8KA 4WQ4A 2G8FA 3WQTA 4CHYA 4Z4IA 1S6QA 3CXCM 3HM9A 4GVMA 4DV7K 3K5LA 1VSMA 2I7PA 1SAZA 4H0XB 1DEJA 1X3MA 1BU6O 5DMRA 4JAXA 4IO9L 3B6OA 1R0AA 3P5JA 4YOTA 1BA1A 3CCLN 2V7YA 3KWGA 4DFPA 1WBDA 3C6UA 3SUPA 3QNOA 2BTFA 3MWTA 4IWVA 4E19A 4RWTA 3PLAA 3MDQA 4CCHA 2WUSA 2H3GX 1VQ5N 3QB0A 2KHOA 4FWQA 2YHBA 3QEVA 5AQOA 1VQNN 4JHDB 1CXUA 4BE1A 4K42A 4E7LA 1BISA 1JKHA 3VERA 3LDSA 4F2SA 4CEBA 3AAQA 3J7ZO 5C25A 2ZM6K 2KQ2A 3T3FA 3DYAA 3EKSA 2YNGA 3WNHA 1WBBA 3TSQA 3NH2A 4GMJB 2P9LB 3DLBA 3DXMB 3I8BA 2ZJQL 1NBWA 3ZT2A 1QE1A 3NVMA 2OPRA 3GDQA 3U9DA 1ILYA 3GBTA 4RW8A 3QEWA 4DUZK 4LC9B 3ZCMA 3WT0A 1KVAA 2Z1HA 3AA4A 1QZ6A 5KQDA 4BRPA 3NHGA 3RTVA 1YJNN 5BN9A 2A42A 4B1XB 3TAFA 1TAQA 4GKJK 5AQSA 2E20A 3OS2A 4PL8A 2G8VA 4CEEA 2W42A 4YHHK 2HHXA 3OBWA 1WLJA 4HUGA 1V4TA 4JHDA 4BG9A 1E4FT 4JI1K 2E5LK 4PY5A 2X6SA 3MECA 5C10A 5KRSA 1VQPN 3OYJA 1C0MA 3TABA 3TU5A 3ENOA 1QQMA 4BC2A 3LP1A 5AQQA 4C1NK 3OYGA 2YHWA 2UXBK 4XH1A 2E1ZA 2XHBA 1EO1A 4CFCA 5CR4A 2ATQA 2P9LA 4DR4K 3DXMA 5HL7L 5JLFA 4B9MA 4DV6K 3K9JA 4EP5A 3NFAA 3KJVA 2NUBA 4Z4GA 1N36K 3H3NO 1BG3A 2DPNA 2WBNA 1J5EK 4FJIA 4ISGA 2QWLA 4DKWA 1WAJA 3I0SA 2ZF5O 3PSIA 1S1UA 1RT1A 2J4RA 5F1XA 3CCSN 1RDBA 4OLBA 4CECA 3VEWA 4FSVA 4DMNA 3NMUA 2PZSA 3BF3A 3WXJA 5KQ8A 3AA5X 3SK3A 3SMSA 1C0GA 2F7TA 1KAYA 4IEIA 4FM1A 5DM7L 4FLWA 5AQLA 2HBKA 1XHZA 4AHTA 3CD6N 1LAVA 1I94K 3F73A 4RW6A 1Y64A 3QERA 3SUQA 4ILHA 4W5NA 1IKVA 3L2VA 1XWLA 2G8HA 4DSKA 3T69A 1IKYA 4CI6A 2OANA 4DWIA 3ULEA 5KI6A 3DRSA 3H45C 3UB5A 4LF4K 2O8FB 3L2QA 3LDLA 4ZTFA 4BRKA 2QW9A 1X1PA 3MEGA 1T7PA 3J7AP 4PUOA 3IDHA 3NGZA 3NH1A 4DFKA 1H1VA 3PO4A 3F9KA 4U67L 3G6EN 4JI5K 3VEVA 1J54A 2V51B 3VQ9A 4BRLA 4DFMA 2E2PA 4DU3A 1HYVA 4WYBA 1FKOA 3QBWA 3OA9A 2XRIA 1RFQA 3NDKA 3CG7A 2FBXA 1KVCA 4BR4A 4CZKA 3O3FA 3JYTA 1NGHA 4FZXC 1K6YA 3O9SA 3CM5A 3M8PA 4IDHA 3VETA 3DAWA 4LF5K 4BRCA 4CD1A 4DSIA 3OYFA 4YNQA 3V1QA 3LDQA 3RVCA 3I56N 3MCAB 3DMJA 5AQFA 1HLUA 3OYHA 1X3NA 4WCEL 1SKWA 4KTWA 3G71N 1LCUA 1XUPO 1NGAA 5AZJB 4XIUA 5BR9A 4WF9L 5JVGL 4RW4A 3S9HA 4IOCL 3ZSQA 1NGGA 3DOLA 3RMBA 2IC3A 3E9PA 1XNQK 5IT9O 3O80A 2IAJA 3H1VX 3N4PA 2Y1IA 3HP9A 5AQVA 1REVA 2VGNA 3OJSA 4JI2K 1C0TA 1WUAA 3LM9A 4DR3K 1EETA 4FWRA 4YDUA 4FM2A 5CYMA 3QNNA 2IGIA 4K8XA 2Q31A 4QAGA 1NJYA 2P9PB 5GAHP 3VENA 3KWIA 3PIPL 1T05A 3M6GA 4AHVA 2RF2A 3ATUA 1KCFA 3A5MC 3CMEN 1QZ5A 3C65A 3OTOK 3SQ1A 4JRPA 4LF6K 4NCBA 1M90O 4B1UB 5AZJA 3ZLJA 1VQ4N 3TAMA 1S9EA 1NK5A 4A5AA 4WFAL 2Q1NA 2P9KB 1KLNA 2YHAA 4M45A 3FLCO 3AVJA 2VG6A 5CE3A 3V1OA 3WEEA 4H0TB 5EX5A 4Z4CA 2F8TA 1BL3A 1JLBA 5AQZA 3VQCA 2E6MA 1BCOA 2QTDA 1WN7A 4FLZA 4C8NA 4YORA 2HB5A 1QVGM 1NK7A 3GG4A 1MWKA 1NKBA 1W9HA 1RDAA 2E4LA 4FYDA 3K9KA 4ZTJA 3DLEA 1HNVA 2FLOA 3TR8A 1HMVA 3D45A 3K57A 3MAQA 1TGOA 1RT3A 5KTQA 3EEQA 4JKEA 4BR0A 4ICLA 3K58A 3N4QA 4WQ4C 2E88A 3DRRA 3O6WA 5K14A 4H5NA 4H4MA 1BA0A 1S1WA 5LY3A 1KQSM 1NLVA 3QEPA 3PSFA 3KLFA 2E1YA 4LF8K 2KW4A 4KTZA 3ZT4A 5AQUA 4LH5A 3AVAA 3C94A 4PL7A 3HL8A 1LWEA 3A8YA 4DU4A 3UKUB 4KHSA 5C42A 3HT3A 1GLJO 1N33K 4FZYA 1J9AA 4KHPK 4JV5K 1W2BM 1K73O 3K5MA 4IG3A 1IO2A 1TVRA 4BDZA 1FXXA 2ASPA 3V1RA 3KLIA 4B08A 5E41A 3VQAA 3SI6A 1ZC6A 3LDOA 4DV2K 4L8RB 4HCCA 4E7JA 2YV0X 4CJEA 3QINA 3SBTA 2LSNA 1U04A 5AQXA 4H5WA 2GUIA 1Q8IA 4NO7A 1NGIA 3V9ZA 3FFKB 4KFBA 4QS7A 1X9MA 3NE6A 1VSLA 4CJSA 3A2FA 3BP8A 3FR0A 3WNEA 2CH5A 5M1NA 3UKUA 5AZIB 2W40A 3HM8A 4DTNA 1A5XA 1B92A 1SKSA 5AR0A 3K0SA 3PO5A 2HHSA 4OO1J 2ZE2A 4BROA 4F2RA 3SQ0A 4CGHA 5GINA 3CCQN 5I3UA 4K8ZA 3KD5E 1SL0A 1QQOA 1QQNA 4FOEA 3DLGA 1V4SA 4BRMA 4JNEA 2HVIA 1HKBA 4DTOA 1QVFM 2FBTA 4M7YA 1QHAA 4KRFA 4HHTA 2AJQA 4EIAA 2KZMA 4F3OA 4FL9A 3HJFA 3ZSZA 2HHVA 3D2EB 1RDWX 4OPKA 3OYKA 2O8EA 3HSTB 3OY9A 2O8CB 2W6LA 4M42A 1R59O 3DWLA 2NRTA 4ZHRA 1JLGA 3SAHA 5AZIA 2RHKA 3G10A 3VQPA 3S3MA 3ALYA 4B1WB 2DTUA 1RDUA 3SZ2A 3VQ8A 1JLQA 1NK6A 4CHQA 4B3OA 1SKRA 1QSLA 3MXMA 1GLAG 5CZ2A 1JLEA 3SQ4A 5J2PA 1JLFA 4OPAA 2QA4N 3QO9A 1XMQK 3EN9A 1GLCG 2E2OA 4FM0A 2P9IB 5JICA 5LMUK 4ELTA 3NAEA 3NF9A 2KFNA 1YITN 1HQUA 5I42A 4CBUA 2D0BA 4BQZA 1L3UA 4PHTX 3D2EA 1W7AA 2X6NA 1HR0K 2NZTA 4CJRA 2O8CA 3KLHA 2GUPA 4MDBA 2YKNA 4CJPA 4DLEA 2BDPA 3NBPA 2QKKA 2KZZA 2E8AA 3S41A 1RT4A 4KREA 5GIPA 1IKXA 2YCHA 3O5BA 3L4IA 3MXIA 1VQ6N 5FPNA 4N56A 4EFHA 4B9NA 1BDGA 3BGRA 1LWCA 5C15A 2A40A 2A41A 4BRAA 4Z94A 1WSEA 3WNFA 1S9GA 4OJRA 3M8SA 5C24A 4G1QA 1NMDA 2O8DB 1VQON 3VQ6A 1T6CA 2P9IA 1TKDA 4BR5A 4CEOA 1EQYA 3VQ4A 1UA0A 2V7ZA 3CPWM 4O55A 3GE1A 3L6QA 4H0VB 4MDAA 4AH9A 3HPOA 2YJFA 2G8IA 3CF5L 3WQUA 3JSMA 4Z4HA 3ISNC 1RT7A 3T1YK 1RT6A 2ASOA 2QWPA 3HBTA 3KHYA 3CJ9A 4B9TA 3AAPA 3J81O 1RTJA 5SWMA 3O3HA 3LL3A 4AHCA 5M1FA 3TAGA 4LSLA 4EP4A 2DFHA 5HLFA 2QWOA 4KHYA 3FZFA 4B9VA 2Z1JA 2X78A 1NK4A 3G0ZA 2NRRA 1P90A 4E0DA 3R9PA 2KFZA 5KPZA 3LAKA 4KBOA 2FF6A 1BI4B 2P5OA 2O8DA 3TAQA 3DOKA 2VG5A 2IS3A 5KPTA 1VSHA 2BE2A 1Q81O 2OPPA 2CGJA 2DFEA 4RTFD 4BRQA 4DSEA 1Q7YO 3THWB 1YJ9N 4N5SA 1DKGD 3D6RA 3QFPA 3ZETA 4X66K 4YDUC 4JRQA 4K25A 4CJVA 4H4OA 2HW3A 4KI4A 2UUAK 3QBXA 4H0YB 3O9QA 2NRVA 4KH5A 3AGKA 5EY4A 5HRSA 1E4GT 4JI8K 2AA4A 4C23A 3CQXA 3M3ZA 4FWMA 2NRHA 3LP2A 3LP3A 1WSGA 4AHUA 4M3UA 2CH6A 1ZBFA 1QTMA 1VQ7N 1NGBA 1LV5A 1RDCA 3Q7BA 2VG7A 4XH5A 2GV9A 5C12A 3L3VA 3OYEA 4JN4A 1NK9A 4B1YB 1IBLK 2XY7A 4C8MA 1JCFA 4GNIA 3HOSA 3I0RA 5AQGA 4C1NI 4I9LA 4AF1A 5E26A 4CJKA 1U2VB 1EWRA 4NXMK 3U3GA 4UQGA 3L2WA 4RG8A 3GOIA 1VQ9N 4CZIA 1RCHA 1VQLN 2GWJA 3IG1A 2NLXA 1S72N 4KHQA 2WONA 1P8ZA 1VSDA 3B8AX 3R6MA 3FZLA 3QIOA 2QWMA 3DLRA 3VQEA 5FLXO 3OVNA 4CGFA 1KD1O 2P1JA 4GY2B 1WSIA 1U6ZA 4EHUA 2P51A 3L0QA 1NGFA 3LDPA 3TWHA 4FLVA 2FSKA 4E89A 4FK2A 4J8FA 3O4QA 3L8BA 2VWJA 3VF4A 5BRHA 4CHZA 2ZJPL 3FE1A 5CHIA 1M1KO 4M3TA 4CEDA 3SCXA 3H6EA 4Y0WA 2JGUA 3IRXA 4FW2A 4IJAA 3VF2A 2XY6A 4BACA 4B9LA 1ATNA 4CEAA 2P9SB 1HJOA 3MN7A 3RR7A 4Q5VA 3IAYA 3OW2M 4KHUA 2RN2A 4FOIA 4B9QA 3P31A 1BQNA 4DTXA 1G99A 3IS9A 1BUPA 4J2EA 1NJWA 3K2PA 1Q82O 4QCLA 3O1BA 4BWMA 2YI1A 3HPHA 2B6AA 3TSPA 4X62K 4J2AA 3S3OA 4BE2A 1WAFA 4B1ZA 1VQKN 2FSNA 4CK3A 4N47A 5LMNK 3KTQA 2FSJA 1SL1A 3M8QA 3CCVN 1CZ9A 3AVNA 3CJAA 3CPEA 1YVNA 1XC3A 3KK2A 3AVLA 4BRNA 1MDUB 5KGXA 4O8KA 5FPMA 4H5TA 4WFBL 1IBMK 3P38A 1XQSC 5AQKA 4CZEA 4DQ8A 1KSPA 4LD0A 4IZ9A 1VHXA 2P9SA 4W5OA 3NH0A 3K5NA 1OVQA 1OH5A 3RRGA 4O4GA 4CHOA 3ZSRA 2A6AA 1RILA 1EXQA 2ZD1A 4B3MK 4O44A 1K8KB 3O4WA 3C6HA 4DTUA 3V81A 4FJHA 2GEMA 2PAVA 1LW0A 4C8LA 1DTTA 5I9EB 3OYLA 4CF0A 1Z26A 4DV1K 2XY5A 2IVPA 4H5VA 4FVUA 4B3SK 1JCGA 1EP4A 4HUEA 4CJ4A 3DLHA 2O8FA 4PKGA 2YX6A 5CZ1A 2IOCA 5M1PA 4JKAA 3D0PA 1VK0A 3SV3A 2HOEA 3EZWA 2GX9A 3AO5A 4CGIA 5BPLA 1TK0A 4NYNA 3THYB 1HPMA 4AHSA 1A5VA 4CFAA 2OTJN 1NJZA 4BRIA 5AFUA 3HSCA 2YHYA 3NF7A 1K8KA 1VSJA 4PWDA 4QS9A 1L3VA 4CZHA 3E01A 3CCJN 4BWJA 3L3UA 1O1WA 2E6LA 4H03B 3R1XA 3VEZA 4CF2A 3PUFA 1NGCA 3T19A 3ITHA 4PQUA 3AVKA 3AA2A 4OX9K 3NGIA 1RT5A 2CGKA 1NMNA 4BDPA 5CY4A 1BIZA 2Q0RA 2QK9A 4ID5A 5KPRA 3W0LA 3TARA 3CMAN 2HNDA 2XO7A 1ZBSA 3CC2N 3G4SN 2PYLA 1ZBLA 2OPSA 4CF1A 1F21A 3AVFA 1ATRA 2HVHA 4FLYA 2HMPA 1NK0A 3THYA 1EWQA 1HNXK 1S1VA 3CCEN 4E3SA 3DRPA 1KLMA 4CJLA 4UY8O 3QDKA 3CI5A 1KRPA 3AA3A 4JI3K 1HJRA 3NGYA 4M3WA 4CEQA 3DLLL 3GL1A 2VYPA 5HOOA 3VOVA 1ZBUA 1T6DA 4IDKA 4JKBA 4JI0K 3BY5A 2P9PA 2OTLN 4BRHA 3VQ7A 2OA8A 3MN6A 1FW6A 2ZQBA 4IBNA 1UA1A 5FRMA 2JWKA 1TKZA 2F4VK 4MFBA 4KKOA 4OGCA 2Q36A 4CD3A 4FWKA 4HWIA 1DT9A 4CHNA 3AO4A 3O8MA 4DR2K 4DQIA 3MX2A 3A0IX 2P9KA 2I5JA 4CZJA 5FPDA 5AQHA 3L2UA 4ILJA 2AP1A 4JKDA 3C0BA 4DU1A 3LZIA 3QEIA 3VGMA 4JKFA 5ADXA 4WQ5A 1CLQA 1Z6RA 5FPEA 5J2QA 3MEDA 4LY7A 1TK8A 3CIPA 3FZHA 4RW9A 3ZSYA 1Q86O 2D1KA 1JJ2M 3EE9A 4PA1A 4CJUA 4KHNA 4AHRA 1OVYA 2NRZA 5TKWA 4AM7A 4BREA 1HPZA 2WTUA 1ITGA 3SUNA 3CQ8A 3V9WA 5D3GA 1E3MA 4TSXA 3MN9A 1HYSA 1BQMA 3F2KA 3EL2A 4I7FA 4DTMA 4YOYA 1RTDA 4FJJA 3M1FA 1U49A 3U8XA 2YJEA 4CK1A 2QWRA 3VQBA 1TUYA 4CJ3A 3AVHA 1RNHA 4IOAL 2YKMA 3BUZB 4ELVA 1C0FA 4LFCK 4A5BA 5F0XA 3CFRA 1VSFA 4IKFA 4A2AA 3RWUA 1ASUA 5JS2A 2EHGA 1YIJN 3K59A 1QSSA 5TKYA 2A3ZA 1BHLA 3ZSXA 1JCEA 3F9MA 4W5TA 3LWLA 4E7IA 3KZBA 3FZMA 2R7YA 4K0KK 3R3LA 1A5WA 4RCHA 4JK7A 5H1SQ 5AQIA 3DM2A 4CF8A 5JLHA 4JEPA 4GV3A 3KKRA 3SPYA 2GTDA 3CHWA 4HVJA 4E7HA 4FJ9A 4NYFA 3Q7CA 1T03A 4ID1A 3QFUA 3K5OA 2QWQA 1WSFA 4H0PA 4G9ZA 1RBRA 3MXJA 1YF5L 4FJKA 3QMLA 2IDOA 3TI0A 5JS1A 4CBWA 3SQ2A 1XC9A 1QS4A 1OH6A 2HBLA
chains in the Genus database with same CATH topology
4YY3K 4DUZK 4DV0K 4B3RK 5LMUK 4DV2K 1HNWK 4LF4K 3JAMO 4X66K 4GKJK 4DUYK 1HNZK 4DR1K 3OTOK 1N34K 4YHHK 4NXNK 4DV3K 4LF6K 2UXDK 5LL6Z 2UUAK 2UUBK 1HR0K 4X62K 3J7AP 3T1HK 4OX9K 4DV5K 4V19S 4JI1K 2E5LK 5LMNK 4JI8K 2VQFK 4JI5K 4AQYK 2UXBK 4JI7K 1IBKK 2VQEK 4X64K 4CW7B 4DR6K 5IWAK 3J80O 4B3TK 4DR4K 4LFBK 1IBMK 1XNRK 1HNXK 5A2QO 2UXCK 1XMOK 4DV6K 4GKKK 1N32K 4DV7K 1IBLK 3J7YP 4LF5K 2UU9K 1N36K 4LFCK 4DV4K 4DR7K 1J5EK 4JI4K 4JI3K 4LFAK 2HHHK 4B3MK 4JI6K 3T1YK 4NXMK 3J81O 4DR5K 4JYAK 4JI0K 4DV1K 5FLXO 4LF8K 4K0KK 4B3SK 1XNQK 5IT9O 4CVNE 2ZM6K 2UUCK 5AJ3K 2F4VK 1FJGK 1N33K 5BR8K 4JI2K 4KHPK 4DR3K 4LF7K 4X65K 4JV5K 1I94K 4LF9K 4DR2K 1XMQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 K;  4DUZ K;  4DV0 K;  4B3R K;  5LMU K;  4DV2 K;  1HNW K;  4LF4 K;  3JAM O;  4X66 K;  4GKJ K;  4DUY K;  1HNZ K;  4DR1 K;  3OTO K;  1N34 K;  4YHH K;  4NXN K;  4DV3 K;  4LF6 K;  2UXD K;  5LL6 Z;  2UUA K;  2UUB K;  1HR0 K;  4X62 K;  3J7A P;  3T1H K;  4OX9 K;  4DV5 K;  4V19 S;  4JI1 K;  2E5L K;  5LMN K;  4JI8 K;  2VQF K;  4JI5 K;  4AQY K;  2UXB K;  4JI7 K;  1IBK K;  2VQE K;  4X64 K;  4CW7 B;  4DR6 K;  5IWA K;  3J80 O;  4B3T K;  4DR4 K;  4LFB K;  1IBM K;  1XNR K;  1HNX K;  5A2Q O;  2UXC K;  1XMO K;  4DV6 K;  4GKK K;  1N32 K;  4DV7 K;  1IBL K;  3J7Y P;  4LF5 K;  2UU9 K;  1N36 K;  4LFC K;  4DV4 K;  4DR7 K;  1J5E K;  4JI4 K;  4JI3 K;  4LFA K;  2HHH K;  4B3M K;  4JI6 K;  3T1Y K;  4NXM K;  3J81 O;  4DR5 K;  4JYA K;  4JI0 K;  4DV1 K;  5FLX O;  4LF8 K;  4K0K K;  4B3S K;  1XNQ K;  5IT9 O;  4CVN E;  2ZM6 K;  2UUC K;  5AJ3 K;  2F4V K;  1FJG K;  1N33 K;  5BR8 K;  4JI2 K;  4KHP K;  4DR3 K;  4LF7 K;  4X65 K;  4JV5 K;  1I94 K;  4LF9 K;  4DR2 K;  1XMQ K; 
#chains in the Genus database with same CATH topology
 1QQC A;  4KTQ A;  4CIE A;  4FPB A;  3OBY A;  3EY1 A;  3U9Z A;  4IJN A;  4OLA A;  3SV4 A;  3ZT0 A;  2RPI A;  4BC3 A;  3CCR N;  2F9W A;  4DR1 K;  3H3O B;  3BZC A;  4NXN K;  4DV3 K;  1SUQ A;  2VWK A;  5MLC Q;  4I6M B;  4NLC A;  3T1H K;  1VQM N;  4I9Q A;  4E1M A;  2KTQ A;  3NF6 A;  3RR8 A;  4DV5 K;  4V19 S;  4IEE A;  3AV9 A;  3SAG A;  4JLH A;  4DTP A;  1BWF O;  3G25 A;  4FWP A;  1FKP A;  1VRT A;  4KO0 A;  2BH1 A;  1ZXO A;  1VQ8 N;  4FPA A;  1KXP A;  2ASM A;  4CIG A;  2D0A A;  4I2Q A;  2NNW A;  2GEL A;  3E66 A;  4A61 A;  4U7B A;  2FF3 B;  4C8O A;  1B9F A;  3R8E A;  3HVR A;  4CGG A;  4FXD A;  4X64 K;  1LWF A;  4CW7 B;  4BE0 A;  3CER A;  1KVB A;  1T3V A;  3V6D A;  2A5X A;  3CM6 A;  3VEY A;  1N32 K;  5BRD A;  3ZSO A;  3CC4 N;  4MO5 A;  3P39 A;  3LZJ A;  4Y1C A;  4EAH D;  1Q9X A;  4YOW A;  4AIL C;  3ATV A;  2UU9 K;  3NCI A;  4BVO A;  2VWB A;  2D0O A;  3KLG A;  4BC4 A;  4E7K A;  2O8B B;  1D9D A;  2D0C A;  3C6A A;  2HNY A;  2QI2 A;  5AQW A;  5BPN A;  4I6M A;  1BGX T;  1VAZ A;  4LSN A;  3AVG A;  4JKH A;  4DQQ A;  4DQP A;  4FJ5 A;  4ISF A;  1LW2 A;  1NK8 A;  4CK2 A;  3I55 N;  3PX0 A;  2P9U B;  5GAG P;  3HVT A;  1L5U A;  3SNN A;  4FLX A;  3KKS A;  3P4I A;  4OPH A;  4CEZ A;  1WSH A;  3P83 D;  3U3Y A;  5DM6 L;  1YHQ N;  3SUO A;  4FJ8 A;  4LF7 K;  1Q18 A;  3VEX A;  3CET A;  1L3S A;  3V9U A;  1TL1 A;  4DSJ A;  3OYC A;  1QSY A;  4BRD A;  4Z4E A;  3AY9 A;  3LWM A;  1C1C A;  3KIO A;  3P1G A;  2O8B A;  1N5Y A;  4J2B A;  4N76 A;  2YNI A;  4CZF A;  5B8H A;  1TK5 A;  2PY5 A;  1ATS A;  3ZEU B;  3SJH A;  1GLD G;  2Q0U A;  4DG1 A;  5FRO A;  1HNI A;  1WB9 A;  2P9U A;  3NVK A;  4FJX A;  2VQF K;  1FK9 A;  4MLE A;  1NU0 A;  1WSJ A;  2FC0 A;  3CJB A;  5JMV A;  4BR7 A;  4FJM A;  2JLE A;  1GOB A;  2O4I A;  3HZ6 A;  1C6V A;  2HF3 A;  1LOT B;  1JL2 A;  3WXL A;  1NOY A;  1Y97 A;  1GOA A;  5BPM A;  1TL3 A;  1KAX A;  3ENH A;  4J2D A;  3KK3 A;  2YNF A;  3T7Z A;  3LAM A;  3PX4 A;  1VSE A;  1NGJ A;  1C1B A;  4GV9 A;  1CZB A;  3ZEU A;  3H08 A;  1BI4 A;  1GLL O;  2ITM A;  1ZBI A;  5C0Y A;  3OJU A;  4OKK A;  1RGI A;  1O13 A;  4F4K A;  4FJL A;  2ZGY A;  3VGL A;  4BGA A;  4MO4 A;  4DF8 A;  1HRH A;  1KAZ A;  3M5R A;  5J2M A;  1YTA A;  3THW A;  3HYF A;  4O5B A;  1GLE G;  4M3X A;  3M8R A;  3IUC A;  1NOZ A;  4KHW A;  1ASW A;  2PFU A;  1Q9Y A;  2HMI A;  2I7N A;  3EO3 A;  1NGE A;  4R5P A;  3J8A A;  1B9D A;  3CJ7 A;  1X9J A;  1Z05 A;  2A1R A;  3V9S A;  2A1S A;  1YXQ A;  4M3R A;  2QM1 A;  2ZGZ A;  2X74 A;  1JLA A;  2QXL A;  1C1A A;  4FK4 A;  4YY3 K;  5AQM A;  4B3R K;  1D5A A;  1WOQ A;  3CYM A;  2WC9 A;  3BZK A;  3E9L A;  4R79 A;  5GIO A;  3MEE A;  3CFP A;  2VGM A;  3NF8 A;  1U47 A;  4FWL A;  4CZG A;  4CGJ A;  4O0I A;  1DGK N;  2UUB K;  1ZBH A;  3TAN A;  1K8A O;  3SPZ A;  4A62 A;  3EYZ A;  5EXW A;  2PBD A;  4O5F A;  5CYQ A;  1IV0 A;  1VSK A;  3ZT3 A;  4GW6 A;  3RMC A;  4GVE A;  1GOC A;  3ZX3 A;  2HNZ A;  4KH4 A;  4FWN A;  3ULE B;  4CFB A;  4CJQ A;  4C8K A;  4DS4 A;  3VTI A;  4E1J A;  1U2V A;  4WQ5 C;  5M1Q A;  3DLK A;  5AQP A;  1J53 A;  5EVZ A;  5SZT A;  2RKI A;  3ULD A;  4FK0 A;  4CER A;  4DR6 K;  4LFB K;  3J80 O;  4HTU A;  4CGD A;  4PKH A;  3EKU A;  4L3Q A;  5A2Q O;  5BRF A;  1BO5 O;  1S5J A;  3SLC A;  4B8A B;  1UWB A;  3BF1 A;  3T1A A;  3SMP A;  2ZWH A;  2F9T A;  4CZM A;  4O0J A;  4YFU A;  4DV4 K;  4OGE A;  3OS1 A;  5HBM A;  1ZYQ A;  4LFA K;  2DY4 A;  2HHH K;  4FVM A;  3MX5 A;  4Z4F A;  1S3X A;  3KVG A;  3AO2 A;  3F5T A;  4CJW A;  3AAR A;  5M1O A;  3OYB A;  3VA0 A;  3VES A;  2W6K A;  4FCY A;  4DLG A;  2D0P A;  3I33 A;  3VQQ A;  4FJN A;  1YTU A;  3KK7 A;  3MK6 A;  4YOU A;  1TKT A;  3C7N B;  3W3D A;  3TPQ A;  4KI6 A;  1NKC A;  1D4X A;  2OZS A;  4CEF A;  5HRN A;  4JK8 A;  4H5R A;  2HHU A;  1I3A A;  3UKR B;  4CVN E;  3OYI A;  4F8R A;  2UUC K;  3QES A;  1GLB G;  1NGD A;  4CF9 A;  1KC8 O;  3HXM A;  4X65 K;  3WXM B;  3QIP A;  4BDY A;  2OZM A;  3PIO L;  4FLT A;  4I2P A;  4A57 A;  3QLH A;  2D5R A;  4EZ6 A;  4XEI A;  4KV8 A;  3PX6 A;  4OVL A;  3TSU A;  1UOC A;  4WE1 A;  3HK2 A;  1U45 A;  3JAM O;  4DUY K;  4H8K A;  1IG9 A;  3OS0 A;  5AQN A;  1IH7 A;  5LL6 Z;  4BGB A;  3SBG A;  1VRU A;  3C7N A;  3VN5 A;  2CGL A;  4JS4 A;  4CZL A;  1KFS A;  2O4G A;  1T8E A;  4A2B A;  2OPQ A;  2WOM A;  2EX3 A;  3L4Q A;  3UKR A;  3TAP A;  4AQY K;  4GV6 A;  2XY8 A;  1G15 A;  3HPG A;  2VQE K;  1JL1 A;  1XHX A;  2UYT A;  4M7X A;  3IKM A;  4BC5 A;  5AQT A;  3LPU A;  1SL2 A;  5FRN A;  2DFF A;  3HP6 A;  2HST A;  2BUP A;  1BIU A;  1XNR K;  3U4L A;  5EU7 A;  1I39 A;  3O9R A;  3WUH A;  1OH8 A;  5HP1 A;  3O3G A;  3LDN A;  1CZA N;  5AQY A;  3FGU A;  3MCP A;  2HF4 A;  4IO8 A;  3THX B;  4DQS A;  4RW7 A;  2FBV A;  5M1K A;  5J2N A;  1EKE A;  4QS8 A;  4DS5 A;  2B5J A;  3WEE B;  2HHT A;  4DHY A;  1EX4 A;  3H1Q A;  1J5O A;  2WFB A;  1ESV A;  3KK1 A;  2VCP A;  3ZT1 A;  4KB1 A;  1RBT A;  3VTH A;  5KRT A;  2D4W A;  4Y1D A;  4CBX A;  1NNE A;  1MA9 B;  1S1X A;  1Z25 A;  2EWS A;  1KFD A;  4BG8 A;  2GBZ A;  3SJJ A;  5GAD P;  5AJ3 K;  3OYA A;  4NCG A;  1DTQ A;  4FWO A;  1S22 A;  1X9W A;  3CFO A;  4HUF A;  3TTF A;  5BR8 K;  3C95 A;  1BOT O;  3JS6 A;  5E84 A;  3VPZ A;  4B9S A;  2P5G A;  2IVO A;  3THX A;  4ILG B;  5ELZ A;  2E2Q A;  2V52 B;  2KLA A;  3A5O C;  4Z0U A;  3CC7 N;  3ZX0 A;  3AVB A;  5T7B A;  5HRO A;  3QEX A;  4MLH A;  2HBJ A;  4JKG B;  4YOV A;  1HNZ K;  4CIF A;  2W41 A;  3V9X A;  2HHW A;  1TKX A;  1U4B A;  4M41 A;  3TAE A;  1W97 L;  3CQY A;  3VF6 A;  4FJ7 A;  3FZK A;  3PV8 A;  4BQL A;  4Q0B A;  3HI0 A;  4CJT A;  5HRP A;  5HRR A;  3VQD A;  4PKI A;  2OCE A;  3O9T A;  3WXI A;  2RE2 A;  3JXU A;  2ITG A;  4CHP A;  4DSL A;  4N41 A;  4DTS A;  1RTH A;  3LM2 A;  3ZX2 A;  2QEX N;  3SYZ A;  1HKG A;  3HTV A;  1NWK A;  1D9F A;  5J1E A;  1SS6 A;  1RBV A;  2UXC K;  4BY9 C;  1YI2 N;  4M3Z A;  5LJV A;  5C2F A;  1ASV A;  3RSE B;  3J7Y P;  4H0O A;  3CCM N;  3E1Y A;  3O4N A;  4KAZ A;  1JXE A;  4FWS A;  4JD2 B;  5AFU H;  4JKG A;  3ZYY X;  3WXK A;  1UAX A;  2P9N B;  3A5N C;  4AM6 A;  3DJC A;  4FO0 A;  4HCB A;  3RMD A;  3AO1 A;  2G8U A;  1S6P A;  2QKB A;  4LH4 A;  2YHX A;  3CCU N;  1T44 A;  1OH7 A;  4ELU A;  4A59 A;  3ZSV A;  3L2R A;  4B9U A;  4DR5 K;  3LAL A;  1HYZ A;  1HX1 A;  1TUU A;  1QHT A;  1LAW A;  3S3N A;  2Y1J A;  1N6Q A;  2YNH A;  4FW1 A;  3HRG A;  4OKJ A;  3QIC A;  5GAE P;  2Q2R A;  3SAF A;  1RT2 A;  3LAN A;  4HTL A;  3THV A;  1NG9 A;  2F8S A;  1X9S A;  3RSE A;  2HHQ A;  1IJJ A;  3FFI A;  4M63 C;  4OKE A;  2O8E B;  4JS5 A;  1HQE A;  3AVM A;  3MMV A;  4DV0 K;  4JD2 A;  4K43 A;  3LP0 A;  1YUW A;  4FLU A;  3IFR A;  3OHR A;  4KB0 A;  2P9N A;  3OYM A;  5AQR A;  4IFE A;  3WNG A;  3BDP A;  4OPJ A;  4E1N A;  3HOT A;  2QWN A;  3UIQ A;  1N34 K;  4FJG A;  1DLO A;  4DF4 A;  3VGK A;  3TTC A;  3O08 A;  2F96 A;  1VSI A;  2QXF A;  2Z1G A;  4W5Q A;  3IMX A;  4DQR A;  4NCA A;  1YJW N;  4NB4 A;  3KLE A;  4B8C A;  4QOZ B;  5BN8 A;  3AGR A;  2KKZ A;  3VMF B;  3KD1 E;  1D8Y A;  1C0U A;  3ID6 A;  4W5R A;  2Q3S A;  1S1T A;  2FXU A;  5DK5 A;  1U48 A;  1SQK A;  1TYQ B;  1OKJ A;  3I8D A;  1MU2 A;  4MQ3 A;  2B4J A;  5IWA K;  1RDD A;  4CJF A;  3PY8 A;  1HUX A;  3C6T A;  2IVN A;  4IOX A;  2BAN A;  5F2R A;  3D2F B;  4DTJ A;  1XMO K;  3ZSW A;  1NM1 A;  3MN5 A;  4GKK K;  4JK9 A;  1SV5 A;  2BGG A;  2JWL A;  3VQ5 A;  4DSF A;  4JKC A;  3TTD A;  1YVU A;  2Q97 A;  4DR7 K;  4K41 A;  3QET A;  1TV6 A;  4JI4 K;  3U6F A;  5FDL A;  2ZJR L;  4JI6 K;  4O8U A;  3UE5 A;  4BRG A;  3D7E O;  3H46 O;  4EZ9 A;  1TAU A;  5ADX H;  4CJ5 A;  1NJI O;  2G8W A;  1J6Z A;  1XI1 A;  3ENB A;  3RRH A;  4M3Y A;  4JYA K;  2Z1I A;  3HO1 A;  4BRF A;  1W0H A;  4CES A;  4CJ7 A;  2E2N A;  3ID8 A;  1TYQ A;  1KTQ A;  4KH6 A;  1L3T A;  1SZ2 A;  1RBU A;  2GWK A;  3AVI A;  2HBM A;  1FJG K;  4ISE A;  4YOX A;  4B1V A;  3DXK B;  5BRE A;  3CJC A;  1GLF O;  3D2F A;  3B6P A;  3CJ1 A;  4LF9 K;  4DCH A;  3AO3 A;  5EOY A;  1K9M O;  2FBY A;  1MWM A;  4EHT A;  3VEO A;  1JXB A;  3V4I A;  4IG0 A;  4F3T A;  3DI6 A;  1IKW A;  2IIR A;  4DTR A;  3LPT A;  4IFY A;  4BR2 A;  1IG8 A;  1HNW K;  5LJW A;  3EE8 A;  4XH4 A;  3MWP A;  3BEX A;  2PYJ A;  3AVC A;  1RBS A;  4IXC A;  3RMA A;  2UXD K;  5AQJ A;  2ETJ A;  4DFJ A;  4CE9 A;  3VA3 A;  3O1W A;  5JVH L;  2NRW A;  3O9U A;  1YT3 A;  4FZZ A;  1RTI A;  3OYD A;  3ASM A;  4CFD A;  2OYQ A;  4KPY A;  3OYN A;  4DB3 A;  4BR9 A;  4JI7 K;  4BVP A;  1IBK K;  1YAG A;  4NLB A;  5KGW A;  1NKE A;  1NJX A;  1BCM A;  1HKC A;  4IFV A;  3ZET B;  3DXK A;  4F9O A;  3A5L C;  1N8R O;  4B3T K;  1JLC A;  1CXQ A;  5C2D A;  4WFN L;  3EZ5 A;  3E9O A;  1WNS A;  2NRX A;  2G8K A;  4WQ4 A;  2G8F A;  3WQT A;  4CHY A;  4Z4I A;  1S6Q A;  3CXC M;  3HM9 A;  4GVM A;  4DV7 K;  3K5L A;  1VSM A;  2I7P A;  1SAZ A;  4H0X B;  1DEJ A;  1X3M A;  1BU6 O;  5DMR A;  4JAX A;  4IO9 L;  3B6O A;  1R0A A;  3P5J A;  4YOT A;  1BA1 A;  3CCL N;  2V7Y A;  3KWG A;  4DFP A;  1WBD A;  3C6U A;  3SUP A;  3QNO A;  2BTF A;  3MWT A;  4IWV A;  4E19 A;  4RWT A;  3PLA A;  3MDQ A;  4CCH A;  2WUS A;  2H3G X;  1VQ5 N;  3QB0 A;  2KHO A;  4FWQ A;  2YHB A;  3QEV A;  5AQO A;  1VQN N;  4JHD B;  1CXU A;  4BE1 A;  4K42 A;  4E7L A;  1BIS A;  1JKH A;  3VER A;  3LDS A;  4F2S A;  4CEB A;  3AAQ A;  3J7Z O;  5C25 A;  2ZM6 K;  2KQ2 A;  3T3F A;  3DYA A;  3EKS A;  2YNG A;  3WNH A;  1WBB A;  3TSQ A;  3NH2 A;  4GMJ B;  2P9L B;  3DLB A;  3DXM B;  3I8B A;  2ZJQ L;  1NBW A;  3ZT2 A;  1QE1 A;  3NVM A;  2OPR A;  3GDQ A;  3U9D A;  1ILY A;  3GBT A;  4RW8 A;  3QEW A;  4DUZ K;  4LC9 B;  3ZCM A;  3WT0 A;  1KVA A;  2Z1H A;  3AA4 A;  1QZ6 A;  5KQD A;  4BRP A;  3NHG A;  3RTV A;  1YJN N;  5BN9 A;  2A42 A;  4B1X B;  3TAF A;  1TAQ A;  4GKJ K;  5AQS A;  2E20 A;  3OS2 A;  4PL8 A;  2G8V A;  4CEE A;  2W42 A;  4YHH K;  2HHX A;  3OBW A;  1WLJ A;  4HUG A;  1V4T A;  4JHD A;  4BG9 A;  1E4F T;  4JI1 K;  2E5L K;  4PY5 A;  2X6S A;  3MEC A;  5C10 A;  5KRS A;  1VQP N;  3OYJ A;  1C0M A;  3TAB A;  3TU5 A;  3ENO A;  1QQM A;  4BC2 A;  3LP1 A;  5AQQ A;  4C1N K;  3OYG A;  2YHW A;  2UXB K;  4XH1 A;  2E1Z A;  2XHB A;  1EO1 A;  4CFC A;  5CR4 A;  2ATQ A;  2P9L A;  4DR4 K;  3DXM A;  5HL7 L;  5JLF A;  4B9M A;  4DV6 K;  3K9J A;  4EP5 A;  3NFA A;  3KJV A;  2NUB A;  4Z4G A;  1N36 K;  3H3N O;  1BG3 A;  2DPN A;  2WBN A;  1J5E K;  4FJI A;  4ISG A;  2QWL A;  4DKW A;  1WAJ A;  3I0S A;  2ZF5 O;  3PSI A;  1S1U A;  1RT1 A;  2J4R A;  5F1X A;  3CCS N;  1RDB A;  4OLB A;  4CEC A;  3VEW A;  4FSV A;  4DMN A;  3NMU A;  2PZS A;  3BF3 A;  3WXJ A;  5KQ8 A;  3AA5 X;  3SK3 A;  3SMS A;  1C0G A;  2F7T A;  1KAY A;  4IEI A;  4FM1 A;  5DM7 L;  4FLW A;  5AQL A;  2HBK A;  1XHZ A;  4AHT A;  3CD6 N;  1LAV A;  1I94 K;  3F73 A;  4RW6 A;  1Y64 A;  3QER A;  3SUQ A;  4ILH A;  4W5N A;  1IKV A;  3L2V A;  1XWL A;  2G8H A;  4DSK A;  3T69 A;  1IKY A;  4CI6 A;  2OAN A;  4DWI A;  3ULE A;  5KI6 A;  3DRS A;  3H45 C;  3UB5 A;  4LF4 K;  2O8F B;  3L2Q A;  3LDL A;  4ZTF A;  4BRK A;  2QW9 A;  1X1P A;  3MEG A;  1T7P A;  3J7A P;  4PUO A;  3IDH A;  3NGZ A;  3NH1 A;  4DFK A;  1H1V A;  3PO4 A;  3F9K A;  4U67 L;  3G6E N;  4JI5 K;  3VEV A;  1J54 A;  2V51 B;  3VQ9 A;  4BRL A;  4DFM A;  2E2P A;  4DU3 A;  1HYV A;  4WYB A;  1FKO A;  3QBW A;  3OA9 A;  2XRI A;  1RFQ A;  3NDK A;  3CG7 A;  2FBX A;  1KVC A;  4BR4 A;  4CZK A;  3O3F A;  3JYT A;  1NGH A;  4FZX C;  1K6Y A;  3O9S A;  3CM5 A;  3M8P A;  4IDH A;  3VET A;  3DAW A;  4LF5 K;  4BRC A;  4CD1 A;  4DSI A;  3OYF A;  4YNQ A;  3V1Q A;  3LDQ A;  3RVC A;  3I56 N;  3MCA B;  3DMJ A;  5AQF A;  1HLU A;  3OYH A;  1X3N A;  4WCE L;  1SKW A;  4KTW A;  3G71 N;  1LCU A;  1XUP O;  1NGA A;  5AZJ B;  4XIU A;  5BR9 A;  4WF9 L;  5JVG L;  4RW4 A;  3S9H A;  4IOC L;  3ZSQ A;  1NGG A;  3DOL A;  3RMB A;  2IC3 A;  3E9P A;  1XNQ K;  5IT9 O;  3O80 A;  2IAJ A;  3H1V X;  3N4P A;  2Y1I A;  3HP9 A;  5AQV A;  1REV A;  2VGN A;  3OJS A;  4JI2 K;  1C0T A;  1WUA A;  3LM9 A;  4DR3 K;  1EET A;  4FWR A;  4YDU A;  4FM2 A;  5CYM A;  3QNN A;  2IGI A;  4K8X A;  2Q31 A;  4QAG A;  1NJY A;  2P9P B;  5GAH P;  3VEN A;  3KWI A;  3PIP L;  1T05 A;  3M6G A;  4AHV A;  2RF2 A;  3ATU A;  1KCF A;  3A5M C;  3CME N;  1QZ5 A;  3C65 A;  3OTO K;  3SQ1 A;  4JRP A;  4LF6 K;  4NCB A;  1M90 O;  4B1U B;  5AZJ A;  3ZLJ A;  1VQ4 N;  3TAM A;  1S9E A;  1NK5 A;  4A5A A;  4WFA L;  2Q1N A;  2P9K B;  1KLN A;  2YHA A;  4M45 A;  3FLC O;  3AVJ A;  2VG6 A;  5CE3 A;  3V1O A;  3WEE A;  4H0T B;  5EX5 A;  4Z4C A;  2F8T A;  1BL3 A;  1JLB A;  5AQZ A;  3VQC A;  2E6M A;  1BCO A;  2QTD A;  1WN7 A;  4FLZ A;  4C8N A;  4YOR A;  2HB5 A;  1QVG M;  1NK7 A;  3GG4 A;  1MWK A;  1NKB A;  1W9H A;  1RDA A;  2E4L A;  4FYD A;  3K9K A;  4ZTJ A;  3DLE A;  1HNV A;  2FLO A;  3TR8 A;  1HMV A;  3D45 A;  3K57 A;  3MAQ A;  1TGO A;  1RT3 A;  5KTQ A;  3EEQ A;  4JKE A;  4BR0 A;  4ICL A;  3K58 A;  3N4Q A;  4WQ4 C;  2E88 A;  3DRR A;  3O6W A;  5K14 A;  4H5N A;  4H4M A;  1BA0 A;  1S1W A;  5LY3 A;  1KQS M;  1NLV A;  3QEP A;  3PSF A;  3KLF A;  2E1Y A;  4LF8 K;  2KW4 A;  4KTZ A;  3ZT4 A;  5AQU A;  4LH5 A;  3AVA A;  3C94 A;  4PL7 A;  3HL8 A;  1LWE A;  3A8Y A;  4DU4 A;  3UKU B;  4KHS A;  5C42 A;  3HT3 A;  1GLJ O;  1N33 K;  4FZY A;  1J9A A;  4KHP K;  4JV5 K;  1W2B M;  1K73 O;  3K5M A;  4IG3 A;  1IO2 A;  1TVR A;  4BDZ A;  1FXX A;  2ASP A;  3V1R A;  3KLI A;  4B08 A;  5E41 A;  3VQA A;  3SI6 A;  1ZC6 A;  3LDO A;  4DV2 K;  4L8R B;  4HCC A;  4E7J A;  2YV0 X;  4CJE A;  3QIN A;  3SBT A;  2LSN A;  1U04 A;  5AQX A;  4H5W A;  2GUI A;  1Q8I A;  4NO7 A;  1NGI A;  3V9Z A;  3FFK B;  4KFB A;  4QS7 A;  1X9M A;  3NE6 A;  1VSL A;  4CJS A;  3A2F A;  3BP8 A;  3FR0 A;  3WNE A;  2CH5 A;  5M1N A;  3UKU A;  5AZI B;  2W40 A;  3HM8 A;  4DTN A;  1A5X A;  1B92 A;  1SKS A;  5AR0 A;  3K0S A;  3PO5 A;  2HHS A;  4OO1 J;  2ZE2 A;  4BRO A;  4F2R A;  3SQ0 A;  4CGH A;  5GIN A;  3CCQ N;  5I3U A;  4K8Z A;  3KD5 E;  1SL0 A;  1QQO A;  1QQN A;  4FOE A;  3DLG A;  1V4S A;  4BRM A;  4JNE A;  2HVI A;  1HKB A;  4DTO A;  1QVF M;  2FBT A;  4M7Y A;  1QHA A;  4KRF A;  4HHT A;  2AJQ A;  4EIA A;  2KZM A;  4F3O A;  4FL9 A;  3HJF A;  3ZSZ A;  2HHV A;  3D2E B;  1RDW X;  4OPK A;  3OYK A;  2O8E A;  3HST B;  3OY9 A;  2O8C B;  2W6L A;  4M42 A;  1R59 O;  3DWL A;  2NRT A;  4ZHR A;  1JLG A;  3SAH A;  5AZI A;  2RHK A;  3G10 A;  3VQP A;  3S3M A;  3ALY A;  4B1W B;  2DTU A;  1RDU A;  3SZ2 A;  3VQ8 A;  1JLQ A;  1NK6 A;  4CHQ A;  4B3O A;  1SKR A;  1QSL A;  3MXM A;  1GLA G;  5CZ2 A;  1JLE A;  3SQ4 A;  5J2P A;  1JLF A;  4OPA A;  2QA4 N;  3QO9 A;  1XMQ K;  3EN9 A;  1GLC G;  2E2O A;  4FM0 A;  2P9I B;  5JIC A;  5LMU K;  4ELT A;  3NAE A;  3NF9 A;  2KFN A;  1YIT N;  1HQU A;  5I42 A;  4CBU A;  2D0B A;  4BQZ A;  1L3U A;  4PHT X;  3D2E A;  1W7A A;  2X6N A;  1HR0 K;  2NZT A;  4CJR A;  2O8C A;  3KLH A;  2GUP A;  4MDB A;  2YKN A;  4CJP A;  4DLE A;  2BDP A;  3NBP A;  2QKK A;  2KZZ A;  2E8A A;  3S41 A;  1RT4 A;  4KRE A;  5GIP A;  1IKX A;  2YCH A;  3O5B A;  3L4I A;  3MXI A;  1VQ6 N;  5FPN A;  4N56 A;  4EFH A;  4B9N A;  1BDG A;  3BGR A;  1LWC A;  5C15 A;  2A40 A;  2A41 A;  4BRA A;  4Z94 A;  1WSE A;  3WNF A;  1S9G A;  4OJR A;  3M8S A;  5C24 A;  4G1Q A;  1NMD A;  2O8D B;  1VQO N;  3VQ6 A;  1T6C A;  2P9I A;  1TKD A;  4BR5 A;  4CEO A;  1EQY A;  3VQ4 A;  1UA0 A;  2V7Z A;  3CPW M;  4O55 A;  3GE1 A;  3L6Q A;  4H0V B;  4MDA A;  4AH9 A;  3HPO A;  2YJF A;  2G8I A;  3CF5 L;  3WQU A;  3JSM A;  4Z4H A;  3ISN C;  1RT7 A;  3T1Y K;  1RT6 A;  2ASO A;  2QWP A;  3HBT A;  3KHY A;  3CJ9 A;  4B9T A;  3AAP A;  3J81 O;  1RTJ A;  5SWM A;  3O3H A;  3LL3 A;  4AHC A;  5M1F A;  3TAG A;  4LSL A;  4EP4 A;  2DFH A;  5HLF A;  2QWO A;  4KHY A;  3FZF A;  4B9V A;  2Z1J A;  2X78 A;  1NK4 A;  3G0Z A;  2NRR A;  1P90 A;  4E0D A;  3R9P A;  2KFZ A;  5KPZ A;  3LAK A;  4KBO A;  2FF6 A;  1BI4 B;  2P5O A;  2O8D A;  3TAQ A;  3DOK A;  2VG5 A;  2IS3 A;  5KPT A;  1VSH A;  2BE2 A;  1Q81 O;  2OPP A;  2CGJ A;  2DFE A;  4RTF D;  4BRQ A;  4DSE A;  1Q7Y O;  3THW B;  1YJ9 N;  4N5S A;  1DKG D;  3D6R A;  3QFP A;  3ZET A;  4X66 K;  4YDU C;  4JRQ A;  4K25 A;  4CJV A;  4H4O A;  2HW3 A;  4KI4 A;  2UUA K;  3QBX A;  4H0Y B;  3O9Q A;  2NRV A;  4KH5 A;  3AGK A;  5EY4 A;  5HRS A;  1E4G T;  4JI8 K;  2AA4 A;  4C23 A;  3CQX A;  3M3Z A;  4FWM A;  2NRH A;  3LP2 A;  3LP3 A;  1WSG A;  4AHU A;  4M3U A;  2CH6 A;  1ZBF A;  1QTM A;  1VQ7 N;  1NGB A;  1LV5 A;  1RDC A;  3Q7B A;  2VG7 A;  4XH5 A;  2GV9 A;  5C12 A;  3L3V A;  3OYE A;  4JN4 A;  1NK9 A;  4B1Y B;  1IBL K;  2XY7 A;  4C8M A;  1JCF A;  4GNI A;  3HOS A;  3I0R A;  5AQG A;  4C1N I;  4I9L A;  4AF1 A;  5E26 A;  4CJK A;  1U2V B;  1EWR A;  4NXM K;  3U3G A;  4UQG A;  3L2W A;  4RG8 A;  3GOI A;  1VQ9 N;  4CZI A;  1RCH A;  1VQL N;  2GWJ A;  3IG1 A;  2NLX A;  1S72 N;  4KHQ A;  2WON A;  1P8Z A;  1VSD A;  3B8A X;  3R6M A;  3FZL A;  3QIO A;  2QWM A;  3DLR A;  3VQE A;  5FLX O;  3OVN A;  4CGF A;  1KD1 O;  2P1J A;  4GY2 B;  1WSI A;  1U6Z A;  4EHU A;  2P51 A;  3L0Q A;  1NGF A;  3LDP A;  3TWH A;  4FLV A;  2FSK A;  4E89 A;  4FK2 A;  4J8F A;  3O4Q A;  3L8B A;  2VWJ A;  3VF4 A;  5BRH A;  4CHZ A;  2ZJP L;  3FE1 A;  5CHI A;  1M1K O;  4M3T A;  4CED A;  3SCX A;  3H6E A;  4Y0W A;  2JGU A;  3IRX A;  4FW2 A;  4IJA A;  3VF2 A;  2XY6 A;  4BAC A;  4B9L A;  1ATN A;  4CEA A;  2P9S B;  1HJO A;  3MN7 A;  3RR7 A;  4Q5V A;  3IAY A;  3OW2 M;  4KHU A;  2RN2 A;  4FOI A;  4B9Q A;  3P31 A;  1BQN A;  4DTX A;  1G99 A;  3IS9 A;  1BUP A;  4J2E A;  1NJW A;  3K2P A;  1Q82 O;  4QCL A;  3O1B A;  4BWM A;  2YI1 A;  3HPH A;  2B6A A;  3TSP A;  4X62 K;  4J2A A;  3S3O A;  4BE2 A;  1WAF A;  4B1Z A;  1VQK N;  2FSN A;  4CK3 A;  4N47 A;  5LMN K;  3KTQ A;  2FSJ A;  1SL1 A;  3M8Q A;  3CCV N;  1CZ9 A;  3AVN A;  3CJA A;  3CPE A;  1YVN A;  1XC3 A;  3KK2 A;  3AVL A;  4BRN A;  1MDU B;  5KGX A;  4O8K A;  5FPM A;  4H5T A;  4WFB L;  1IBM K;  3P38 A;  1XQS C;  5AQK A;  4CZE A;  4DQ8 A;  1KSP A;  4LD0 A;  4IZ9 A;  1VHX A;  2P9S A;  4W5O A;  3NH0 A;  3K5N A;  1OVQ A;  1OH5 A;  3RRG A;  4O4G A;  4CHO A;  3ZSR A;  2A6A A;  1RIL A;  1EXQ A;  2ZD1 A;  4B3M K;  4O44 A;  1K8K B;  3O4W A;  3C6H A;  4DTU A;  3V81 A;  4FJH A;  2GEM A;  2PAV A;  1LW0 A;  4C8L A;  1DTT A;  5I9E B;  3OYL A;  4CF0 A;  1Z26 A;  4DV1 K;  2XY5 A;  2IVP A;  4H5V A;  4FVU A;  4B3S K;  1JCG A;  1EP4 A;  4HUE A;  4CJ4 A;  3DLH A;  2O8F A;  4PKG A;  2YX6 A;  5CZ1 A;  2IOC A;  5M1P A;  4JKA A;  3D0P A;  1VK0 A;  3SV3 A;  2HOE A;  3EZW A;  2GX9 A;  3AO5 A;  4CGI A;  5BPL A;  1TK0 A;  4NYN A;  3THY B;  1HPM A;  4AHS A;  1A5V A;  4CFA A;  2OTJ N;  1NJZ A;  4BRI A;  5AFU A;  3HSC A;  2YHY A;  3NF7 A;  1K8K A;  1VSJ A;  4PWD A;  4QS9 A;  1L3V A;  4CZH A;  3E01 A;  3CCJ N;  4BWJ A;  3L3U A;  1O1W A;  2E6L A;  4H03 B;  3R1X A;  3VEZ A;  4CF2 A;  3PUF A;  1NGC A;  3T19 A;  3ITH A;  4PQU A;  3AVK A;  3AA2 A;  4OX9 K;  3NGI A;  1RT5 A;  2CGK A;  1NMN A;  4BDP A;  5CY4 A;  1BIZ A;  2Q0R A;  2QK9 A;  4ID5 A;  5KPR A;  3W0L A;  3TAR A;  3CMA N;  2HND A;  2XO7 A;  1ZBS A;  3CC2 N;  3G4S N;  2PYL A;  1ZBL A;  2OPS A;  4CF1 A;  1F21 A;  3AVF A;  1ATR A;  2HVH A;  4FLY A;  2HMP A;  1NK0 A;  3THY A;  1EWQ A;  1HNX K;  1S1V A;  3CCE N;  4E3S A;  3DRP A;  1KLM A;  4CJL A;  4UY8 O;  3QDK A;  3CI5 A;  1KRP A;  3AA3 A;  4JI3 K;  1HJR A;  3NGY A;  4M3W A;  4CEQ A;  3DLL L;  3GL1 A;  2VYP A;  5HOO A;  3VOV A;  1ZBU A;  1T6D A;  4IDK A;  4JKB A;  4JI0 K;  3BY5 A;  2P9P A;  2OTL N;  4BRH A;  3VQ7 A;  2OA8 A;  3MN6 A;  1FW6 A;  2ZQB A;  4IBN A;  1UA1 A;  5FRM A;  2JWK A;  1TKZ A;  2F4V K;  4MFB A;  4KKO A;  4OGC A;  2Q36 A;  4CD3 A;  4FWK A;  4HWI A;  1DT9 A;  4CHN A;  3AO4 A;  3O8M A;  4DR2 K;  4DQI A;  3MX2 A;  3A0I X;  2P9K A;  2I5J A;  4CZJ A;  5FPD A;  5AQH A;  3L2U A;  4ILJ A;  2AP1 A;  4JKD A;  3C0B A;  4DU1 A;  3LZI A;  3QEI A;  3VGM A;  4JKF A;  5ADX A;  4WQ5 A;  1CLQ A;  1Z6R A;  5FPE A;  5J2Q A;  3MED A;  4LY7 A;  1TK8 A;  3CIP A;  3FZH A;  4RW9 A;  3ZSY A;  1Q86 O;  2D1K A;  1JJ2 M;  3EE9 A;  4PA1 A;  4CJU A;  4KHN A;  4AHR A;  1OVY A;  2NRZ A;  5TKW A;  4AM7 A;  4BRE A;  1HPZ A;  2WTU A;  1ITG A;  3SUN A;  3CQ8 A;  3V9W A;  5D3G A;  1E3M A;  4TSX A;  3MN9 A;  1HYS A;  1BQM A;  3F2K A;  3EL2 A;  4I7F A;  4DTM A;  4YOY A;  1RTD A;  4FJJ A;  3M1F A;  1U49 A;  3U8X A;  2YJE A;  4CK1 A;  2QWR A;  3VQB A;  1TUY A;  4CJ3 A;  3AVH A;  1RNH A;  4IOA L;  2YKM A;  3BUZ B;  4ELV A;  1C0F A;  4LFC K;  4A5B A;  5F0X A;  3CFR A;  1VSF A;  4IKF A;  4A2A A;  3RWU A;  1ASU A;  5JS2 A;  2EHG A;  1YIJ N;  3K59 A;  1QSS A;  5TKY A;  2A3Z A;  1BHL A;  3ZSX A;  1JCE A;  3F9M A;  4W5T A;  3LWL A;  4E7I A;  3KZB A;  3FZM A;  2R7Y A;  4K0K K;  3R3L A;  1A5W A;  4RCH A;  4JK7 A;  5H1S Q;  5AQI A;  3DM2 A;  4CF8 A;  5JLH A;  4JEP A;  4GV3 A;  3KKR A;  3SPY A;  2GTD A;  3CHW A;  4HVJ A;  4E7H A;  4FJ9 A;  4NYF A;  3Q7C A;  1T03 A;  4ID1 A;  3QFU A;  3K5O A;  2QWQ A;  1WSF A;  4H0P A;  4G9Z A;  1RBR A;  3MXJ A;  1YF5 L;  4FJK A;  3QML A;  2IDO A;  3TI0 A;  5JS1 A;  4CBW A;  3SQ2 A;  1XC9 A;  1QS4 A;  1OH6 A;  2HBL A; 
#chains in the Genus database with same CATH homology
 4YY3 K;  4DUZ K;  4DV0 K;  4B3R K;  5LMU K;  4DV2 K;  1HNW K;  4LF4 K;  3JAM O;  4X66 K;  4GKJ K;  4DUY K;  1HNZ K;  4DR1 K;  3OTO K;  1N34 K;  4YHH K;  4NXN K;  4DV3 K;  4LF6 K;  2UXD K;  5LL6 Z;  2UUA K;  2UUB K;  1HR0 K;  4X62 K;  3J7A P;  3T1H K;  4OX9 K;  4DV5 K;  4V19 S;  4JI1 K;  2E5L K;  5LMN K;  4JI8 K;  2VQF K;  4JI5 K;  4AQY K;  2UXB K;  4JI7 K;  1IBK K;  2VQE K;  4X64 K;  4CW7 B;  4DR6 K;  5IWA K;  3J80 O;  4B3T K;  4DR4 K;  4LFB K;  1IBM K;  1XNR K;  1HNX K;  5A2Q O;  2UXC K;  1XMO K;  4DV6 K;  4GKK K;  1N32 K;  4DV7 K;  1IBL K;  3J7Y P;  4LF5 K;  2UU9 K;  1N36 K;  4LFC K;  4DV4 K;  4DR7 K;  1J5E K;  4JI4 K;  4JI3 K;  4LFA K;  2HHH K;  4B3M K;  4JI6 K;  3T1Y K;  4NXM K;  3J81 O;  4DR5 K;  4JYA K;  4JI0 K;  4DV1 K;  5FLX O;  4LF8 K;  4K0K K;  4B3S K;  1XNQ K;  5IT9 O;  4CVN E;  2ZM6 K;  2UUC K;  5AJ3 K;  2F4V K;  1FJG K;  1N33 K;  5BR8 K;  4JI2 K;  4KHP K;  4DR3 K;  4LF7 K;  4X65 K;  4JV5 K;  1I94 K;  4LF9 K;  4DR2 K;  1XMQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...