4DV4K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv4K00
3OTOK 5LMUK 4DR6K 4DUYK 4LF4K 5A2QO 4B3TK 4DV3K 2UU9K 5IT9O 4DV2K 1XNRK 4OX9K 3J81O 3J80O 5IWAK 5BR8K 4LF5K 1HNWK 1XMOK 4JI3K 4DV1K 4DV4K 1IBMK 4JI0K 1N32K 3J7AP 4DR4K 4DV0K 4JYAK 4DV7K 2UXCK 4NXNK 1HNXK 1N36K 3J7YP 4X64K 4K0KK 4B3RK 4LFAK 4LF7K 4JI6K 2UXBK 1XMQK 4YY3K 1HR0K 3T1YK 1IBKK 4LF8K 4CW7B 5LMNK 2HHHK 3JAMO 2VQEK 5AJ3K 4DUZK 4LF9K 4KHPK 4NXMK 4DR5K 2UUAK 4B3MK 4JI8K 4JI4K 4DR7K 4AQYK 4B3SK 2UUCK 1N33K 4LF6K 4LFCK 4DR2K 4LFBK 4JV5K 4CVNE 1J5EK 2ZM6K 4YHHK 4JI2K 1XNQK 5LL6Z 4JI7K 1I94K 2E5LK 4V19S 1IBLK 4X65K 2VQFK 4X62K 1FJGK 3T1HK 4GKKK 2UXDK 2F4VK 5FLXO 4DV5K 4DV6K 4JI1K 4X66K 4JI5K 4DR3K 2UUBK 4GKJK 1HNZK 4DR1K 1N34K
chains in the Genus database with same CATH superfamily
1FXXA 1NJZA 3ID6A 1HQUA 2KW4A 5HRPA 2OPSA 3OHRA 3HTVA 1NGBA 3IUCA 3C6AA 2UU9K 1WN7A 3Q7BA 3VQ9A 5M1QA 4GW6A 4BG9A 2HBJA 1KSPA 5FROA 4JS5A 3P1GA 2D5RA 4IEIA 4CZMA 3DAWA 3P39A 1WSFA 4O5BA 3SBTA 1T8EA 3D6RA 3K0SA 1SV5A 4JD2A 1MA9B 3A5LC 3ATUA 3G71N 3MXMA 4CFBA 4C8LA 3R8EA 4CBWA 2AJQA 2A6AA 4DSEA 1WUAA 4JI6K 5F1XA 2E2NA 4KTWA 3ZX0A 4JKDA 3OBWA 4WQ5A 2E6MA 3CM5A 5FDLA 4MDBA 1NGGA 1SS6A 3MCPA 3MEDA 1S9EA 2V51B 1C0UA 4ZTJA 1GLCG 3L6QA 2PY5A 3HI0A 4GVEA 4CGJA 2QWOA 4K41A 4GNIA 3ID8A 4CF2A 3HT3A 4J2AA 2DY4A 3FZLA 4OJRA 3VQBA 1K8AO 3TSQA 4YNQA 4V19S 2NRHA 2A1RA 4CGGA 4BDPA 1WSHA 2WONA 2B5JA 3MXIA 4KHWA 3C95A 4IWVA 4FCYA 2VGMA 3NF9A 2PAVA 4CGHA 3T1HK 4GKKK 4FXDA 3SPYA 3HVRA 1LWCA 3QERA 2F4VK 2W40A 1F21A 2KZZA 2JWKA 4GVMA 5AQKA 4CD3A 1ILYA 5CY4A 3SV4A 1WSEA 4LH4A 4WFBL 1Q18A 2H3GX 3SUQA 3SQ2A 3RMAA 1X9MA 1YTUA 3KD1E 1BO5O 1QQCA 4DS5A 1HYVA 5DK5A 1X9SA 4B3TK 1VQ9N 2G8KA 4DV2K 1C1AA 1JCEA 1RBRA 1XNRK 2ZJQL 4H4MA 3EKSA 4JKBA 3HSCA 5LJVA 1DGKN 2WBNA 4FJ5A 5IWAK 2Y1JA 1HNWK 1RCHA 5AZIB 4FWQA 1ATSA 5D3GA 2I7PA 4DV7K 3WNGA 4XH4A 4FM1A 1D9FA 5AQIA 4B3RK 4LFAK 4G9ZA 4B9VA 4DB3A 4H0XB 4CEBA 1HR0K 3CJBA 4LSNA 4DQRA 3SCXA 3G0ZA 2NRVA 3CJ1A 2BDPA 4CJ3A 4LF8K 4FLYA 3T69A 1A5WA 4LY7A 2A41A 2G8WA 2O8CB 3DLEA 5AQNA 3QEVA 3LDNA 4W5RA 1S6PA 4MQ3A 4J2DA 3BY5A 4BRNA 1SL1A 3O9SA 1WB9A 1I39A 3MCAB 2W42A 4BE0A 2X6NA 5KPTA 1GLBG 4LF6K 4NCAA 1VSLA 5C42A 4FJKA 1NJXA 3VOVA 4W5OA 3CC4N 3VA3A 2BGGA 4CZHA 1B9FA 2FLOA 1YVNA 3GL1A 4PQUA 2HOEA 4BY9C 4I6MA 4JN4A 3TI0A 3GG4A 3C7NA 3AA5X 2IOCA 3FZKA 3KWGA 1U04A 4O55A 4A57A 4BQZA 3PLAA 3C0BA 2CH6A 3V81A 2HMPA 3ZETA 1NMDA 1QS4A 3CCMN 4BRHA 1TUYA 2GX9A 2IDOA 4O5FA 3V1RA 4H0YB 4Y1CA 2PZSA 1YVUA 2UUBK 4KHUA 1T6DA 1KVCA 3OTOK 3ENBA 3SMPA 2QI2A 3HPGA 1HMVA 4Z4FA 1T6CA 3HBTA 3OJUA 4ZTFA 1M1KO 1OH5A 3MN5A 3LP3A 2Z1IA 4FLWA 2P5GA 3TAGA 1VSHA 4EIAA 3LALA 4DTPA 4YOWA 3P5JA 4M45A 4DLGA 1WBBA 1VSMA 3ZEUA 4DV1K 3ZLJA 4DV4K 1BISA 3UKUB 2FXUA 1D5AA 3FFKB 3L3VA 4HWIA 2F9WA 2A3ZA 3O9UA 2FBVA 2QXFA 3G25A 2DFHA 1VAZA 1B92A 1S1XA 4KV8A 1IV0A 1QZ6A 4FM2A 3NGZA 1VQ8N 4MO4A 3GE1A 2Q97A 3EEQA 1TKDA 3T1YK 4E89A 1TKZA 3KLGA 2NRRA 4OGEA 2E2PA 2IVOA 1VSDA 4IKFA 4AHRA 4ILJA 4CZLA 5CYQA 2E6LA 3K5NA 3MMVA 3AVLA 1U45A 4OLBA 2P9NB 3O9TA 1TGOA 4IO8A 2A5XA 1RBUA 2KZMA 1NKBA 1C0MA 4FWSA 4AQYK 2DFEA 4CHOA 3S3NA 3U9ZA 4LFBK 3U9DA 5FRNA 4KHSA 1JXBA 4YHHK 4JI2K 1XNQK 4FYDA 1WBDA 3VQ8A 3O6WA 4A59A 1NK6A 5JS2A 5HL7L 3CCVN 1TKXA 3TAMA 4F3TA 4NYNA 4A2BA 3LANA 4KHYA 3ZX3A 2O4GA 1WLJA 3H3OB 4CJKA 1RFQA 2PFUA 4BRMA 3SLCA 4YORA 3TPQA 1KD1O 4BRPA 5HOOA 3L4IA 3DLLL 1N6QA 3CMAN 1NJWA 5FRMA 1GOBA 3QICA 5C2FA 2HNDA 1DEJA 3D2EA 1MWKA 5EOYA 4FJGA 2XO7A 4FZYA 1GLLO 2O8BB 2E2OA 1CXUA 4A5AA 1J9AA 4B8AB 3T3FA 3OYDA 4H5TA 3ZT3A 4CZJA 4DTUA 5A2QO 2P9IB 3HZ6A 5DM7L 4CJRA 4CZFA 4PHTX 4RG8A 3L2VA 3OYKA 1S1WA 2RPIA 4DSIA 1J5OA 4DSLA 4H5WA 3JYTA 3K58A 4EZ9A 3P31A 3ASMA 4HUEA 3VA0A 1VSEA 1NGHA 3SNNA 4TSXA 4HCBA 2QW9A 5BRFA 1BA0A 1H1VA 4CK3A 2HSTA 1WSJA 4NXNK 2CGKA 2Z1GA 1OH6A 4IOCL 3HK2A 3ZSZA 3VQEA 3C6TA 3K59A 3KKRA 1HPZA 3AA3A 3CPWM 3L4QA 5AQYA 4B8CA 4BQLA 3HL8A 3I8BA 3LWMA 4M7XA 2G8VA 4WE1A 3QETA 3JAMO 3VEWA 1KLMA 1UOCA 1RILA 2PBDA 4FPBA 1S5JA 3WXMB 1WAFA 2QWMA 4FLZA 2Q0RA 3VERA 5BRHA 4AH9A 3FLCO 1N5YA 1YJWN 3MK6A 3O5BA 1CZBA 3KLHA 3CERA 3VQDA 5LJWA 1NK8A 1K6YA 2D0PA 1VQPN 4FK2A 4J2BA 2YKMA 1YXQA 2YNFA 4H0OA 2HMIA 2HB5A 1E4GT 3PX4A 4FVUA 1KCFA 4JKFA 3NGYA 1QQMA 3K2PA 1FKOA 3CCJN 1EWRA 4CEQA 4JRPA 2OTJN 4DG1A 3OYGA 5JVGL 3G10A 3VEZA 4FJJA 4EHTA 2FSNA 4LSLA 4B9MA 5EX5A 5I3UA 2QXLA 2HHVA 2P9LB 1YJ9N 1RDUA 4EFHA 3PO5A 2D0AA 3U3GA 3AVBA 3NH1A 1B9DA 2D0CA 4FWNA 3OYCA 1QHAA 1O13A 2QM1A 3DXMB 3MWPA 2YJEA 3OBYA 2PYJA 3TTDA 3OW2M 3QNNA 4FWMA 2QKKA 2A40A 4QAGA 4YOUA 4KREA 1Y64A 1Q86O 4Y0WA 3D2FA 3RVCA 3ZSYA 1ATNA 1RBVA 4ILGB 3VEOA 3J80O 3RRHA 1VQ4N 3VEYA 1ZBHA 3VN5A 5C15A 4Z4HA 1G15A 5BN9A 4G1QA 1FK9A 1BQNA 1MWMA 4KAZA 4JKGA 3A0IX 3ZYYX 1Q7YO 1HNVA 4ELVA 3J7YP 3V9UA 3CCEN 4O0JA 4AM7A 1JLGA 1BL3A 2ZF5O 3OS2A 4Q5VA 3THVA 3IDHA 3IKMA 4CF1A 2VCPA 1IH7A 3KIOA 3DXKB 2YX6A 1IBKK 3FE1A 2HHHK 3K9JA 5M1FA 2NZTA 3BUZB 1SZ2A 1YIJN 2D0OA 4DU1A 1VSIA 4IG0A 2HF4A 3AARA 4FL9A 3B6PA 2NNWA 4FZZA 3THYB 3OYIA 1R59O 4KH6A 4JKCA 3L2QA 2OTLN 5JVHL 4CF0A 5CR4A 3CCUN 3EY1A 1N33K 4KH4A 3BDPA 4RW8A 4UQGA 4DTXA 1NOYA 1WSIA 1GLEG 3SYZA 4IOAL 2ITMA 1RDCA 1VQON 3CJCA 1WAJA 4HCCA 3CQ8A 4ISEA 2GEMA 2J4RA 4X62K 1I3AA 3A5NC 2NRTA 5FPEA 3ULEA 1RDAA 3DRRA 3AAQA 3PY8A 2FBTA 1O1WA 3QBXA 3NAEA 3A2FA 4AHCA 4C8OA 3E9LA 3L0QA 5FLXO 1HKGA 2I7NA 4NLCA 4I9QA 2P9SA 1X1PA 3DWLA 1XC3A 4E0DA 2Q36A 1RT4A 4CFCA 5ADXA 1HYZA 1KLNA 1HNIA 3L2WA 3RRGA 1LW0A 2XY6A 4FJHA 3HPOA 3WXJA 2V7YA 2NRXA 3EZWA 3MN9A 4M3TA 1BU6O 4DTJA 4WQ5C 4XH1A 3OYLA 3KK7A 3VENA 2VG6A 2GUIA 4KBOA 3OYMA 3HRGA 3JXUA 3DMJA 1YF5L 3KD5E 3NH2A 1EKEA 4CD1A 1R0AA 3RWUA 4CJSA 3L2UA 4NB4A 4CJWA 3K5MA 3S9HA 1YITN 1U4BA 1SL2A 4F2SA 5SWMA 3DYAA 1LV5A 4WQ4C 4BRKA 4KI6A 1Q81O 2ZE2A 4CK2A 4IJNA 1ZBIA 3DOLA 4K0KK 3HM9A 4IXCA 3D7EO 2P9KB 3ZT0A 4DQQA 4LF7K 3L3UA 5H1SQ 4MO5A 3RMBA 1Z26A 4CGFA 3QBWA 4JK7A 4K43A 1NG9A 5F2RA 3AVMA 1UA1A 3I0SA 5F0XA 4CJLA 2YNHA 5AJ3K 2HHXA 3O1WA 4B9NA 5AFUA 1L3VA 4KHNA 4ILHA 3KJVA 3AVNA 1Q82O 1RT3A 1RTJA 2UUAK 4CJTA 3GOIA 4JI4K 4BR7A 1VQMN 5DM6L 1RT5A 1K8KA 1V4TA 3LP2A 1LWEA 5AQZA 4FK4A 2ZM6K 4YFUA 1I94K 2E5LK 1EETA 5KTQA 1RBTA 3CJ9A 3WQUA 3CFPA 2OYQA 4KH5A 4XEIA 2OZSA 3HXMA 2AA4A 3O4WA 3AVIA 3O3GA 4CEAA 3DRPA 2HBMA 4NO7A 4WQ4A 3THXB 3QEIA 3GBTA 3J7ZO 3SMSA 3VTHA 2HNZA 4YOTA 3HPHA 3O1BA 4HVJA 3CG7A 3R1XA 2BTFA 4CI6A 4DR3K 1Q9YA 1BUPA 4M3UA 1KQSM 1BCOA 3IFRA 4FVMA 4JK8A 2BE2A 5AQQA 4DCHA 4PL8A 4K42A 4IDKA 2WC9A 4E3SA 1OH8A 5JLHA 5AQMA 3E9PA 1S3XA 3J81O 4BRIA 1TK5A 3C6UA 4E7KA 3A5OC 4CZKA 3JSMA 5BR8K 4BROA 4RWTA 4CJ4A 2EHGA 3W3DA 4K8ZA 3DI6A 3CXCM 1BIUA 3G4SN 1X3MA 4CJEA 1JL1A 2IVNA 5KRTA 4CEDA 4Z4EA 4FJ9A 3EL2A 3BZKA 2E1ZA 1J53A 2QK9A 1EX4A 3C6HA 4E7IA 1YUWA 4BREA 2HBLA 3KHYA 3ZSXA 2GTDA 2VQEK 4FJ7A 3LPTA 3UB5A 2ASMA 1JLAA 4DWIA 5AQXA 4EP4A 3M8SA 1GOAA 4BWJA 3SAHA 2EWSA 4WFAL 3V9WA 4B3MK 2FBXA 2E20A 1MDUB 5GAEP 5T7BA 4DKWA 4QCLA 1S1TA 3K5LA 5C25A 4I2PA 3CC2N 4HHTA 4BDZA 3BGRA 4DQ8A 3M8QA 3SAFA 4OPKA 2RHKA 1JLEA 2R7YA 5BPLA 2RF2A 2E2QA 5FPNA 1SKWA 4H0TB 4B1YB 2EX3A 3V1OA 4EP5A 3HOTA 1TV6A 3ZSRA 2VG7A 3MX5A 5EXWA 1Q9XA 3UIQA 3EYZA 1TL1A 5KPRA 4F4KA 4O4GA 3MWTA 1IKVA 3M1FA 4UY8O 1NGIA 2F7TA 4RW4A 1VSJA 3VEVA 1A5XA 5M1NA 3D0PA 1S22A 4DV6K 4JI1K 5JS1A 3U4LA 3SV3A 3HOSA 3ZETB 4FLVA 5HRSA 4GV6A 5KQ8A 4RW6A 5E84A 1N34K 4M7YA 3CCSN 4K25A 4F9OA 1BI4A 3LM9A 4JHDA 1BQMA 4CBXA 1WOQA 1NOZA 3DLHA 1JCGA 2O8FA 3GDQA 4DU3A 1X9JA 1BA1A 1QVFM 3CIPA 2O8DA 1VQNN 3RMDA 2VWJA 4FZXC 3WXKA 1K9MO 2O8CA 1NGEA 2YJFA 4E1NA 4B9SA 1IBMK 2ZGYA 4W5TA 3V4IA 3QESA 4JYAK 1CXQA 2YNGA 2QWQA 4CHPA 3I56N 3V1QA 4OLAA 4O8UA 5HBMA 1ITGA 1EXQA 3H1VX 3V9XA 1RDWX 3E01A 1U2VA 3TARA 1U47A 1Z6RA 4W5QA 2HHSA 2P51A 3AA2A 3CF5L 1BGXT 4CGIA 4M3XA 5AQRA 3LDLA 3IRXA 1REVA 2FF3B 4KHPK 2WOMA 4DR5K 3HM8A 3H1QA 4BRAA 4DTSA 3CHWA 3ZT2A 4B1UB 5GAGP 2DTUA 3RSEB 3A8YA 3IS9A 1RT6A 4FWOA 5M1KA 2YNIA 1T7PA 2UUCK 1TK0A 4CVNE 3SUOA 4JRQA 5LL6Z 4U7BA 1LAWA 3E9OA 4FOIA 3TR8A 4E7LA 1OVQA 3QEWA 1IJJA 3HSTB 4FWLA 1W9HA 3QMLA 3SAGA 3UKRB 4JKAA 3ZSQA 4ID5A 4E7HA 5FPMA 5GADP 1NK5A 1BHLA 1TUUA 4B9QA 4Q0BA 1UAXA 3DLBA 1HQEA 4GY2B 5AQUA 4H5RA 3UKUA 4KPYA 3WNHA 4AHSA 4F8RA 1HNZK 3D2EB 3RR7A 4FLUA 2F8SA 1NK7A 1ZBLA 4PUOA 5J2PA 3SPZA 1OKJA 3PX6A 2NRZA 2CGLA 1U49A 4OX9K 2QWRA 1JKHA 3KK1A 1SKSA 2KTQA 1N32K 2P9NA 4BE1A 2F8TA 1TAQA 5J2NA 1D4XA 3FZMA 5AQGA 5KQDA 3WXLA 1QE1A 3MN6A 3THWB 4IZ9A 1XI1A 1CZ9A 1YI2N 1VQ7N 1VRUA 3SJJA 3OYJA 3I8DA 4DSJA 1QTMA 4DTNA 4CW7B 4DTRA 3QIOA 4LF9K 4B1ZA 3OYEA 4PY5A 2D0BA 1ASVA 4JNEA 2A1SA 4CIFA 4KHQA 4N47A 2E88A 5CHIA 1YJNN 5M1PA 1Y97A 3NF6A 4BR2A 3CD6N 4DR7K 4FJLA 5GIOA 4LFCK 5KRSA 4DR2K 1EQYA 4C8KA 3O4NA 3VPZA 2P1JA 3LDPA 1IG9A 1DTQA 3LDQA 3QEPA 4BG8A 3VESA 5C2DA 4DSFA 2OA8A 3R9PA 2P9IA 2ATQA 5GIPA 1CLQA 1C0FA 3NDKA 5ADXH 1Q8IA 3F9KA 3DLGA 1VQLN 1SKRA 2Q0UA 3F9MA 5B8HA 2UXDK 3EKUA 1S1UA 2YHAA 3PIOL 4FW2A 1FKPA 4KO0A 5HLFA 1BCMA 4QS9A 4FLXA 4DHYA 5I9EB 3CI5A 2JLEA 4ID1A 2Q3SA 4AHUA 3HP6A 3SZ2A 3HYFA 4DFKA 2A42A 4DF4A 2X78A 1C0TA 3K57A 2XHBA 2O8EA 4B9TA 5GINA 3ULDA 5AZJB 4DV3K 3S41A 3BP8A 4E1JA 5AQLA 5EY4A 4YDUA 4QOZB 1S6QA 2AP1A 2FF6A 3ZT4A 3C65A 4A2AA 1HRHA 2P9UA 2KHOA 2W6LA 4BACA 1X9WA 1LWFA 5CZ2A 4DV0K 4ELUA 3KTQA 4LC9B 4EZ6A 4MDAA 1P90A 4PA1A 1N36K 1RTIA 5AFUH 1IKYA 3I55N 2ZD1A 2ZWHA 4C1NI 3E1YA 1YAGA 4FWRA 2ASPA 1KXPA 1KC8O 3H6EA 1KAZA 1U6ZA 4L3QA 4FSVA 4C8NA 2GWKA 3CCRN 4AILC 4I7FA 4BDYA 5M1OA 5EVZA 2FSJA 5AQPA 4J2EA 1P8ZA 1S9GA 1QVGM 4DU4A 4RTFD 4B9LA 4DFMA 2P9LA 3LP0A 1NK0A 2IVPA 4QS7A 4BRDA 1GOCA 3AGRA 1VSFA 3LZIA 1SAZA 3QEXA 4XH5A 4KKOA 2ASOA 4JI7K 4PKIA 3Q7CA 3OYBA 3DLKA 1VSKA 4CECA 1E4FT 2OZMA 3E66A 1QSYA 2G8HA 3TWHA 1T44A 3SJHA 2P9PA 4CJ5A 1J6ZA 3QINA 5MLCQ 3TAFA 2KFZA 4PWDA 3ISNC 4E19A 4H0PA 4KRFA 3JS6A 3V9SA 1TYQB 4M3YA 3ULEB 4WYBA 1RT1A 2GV9A 5C10A 1NJYA 3RTVA 2OPQA 5J1EA 1W0HA 3OVNA 4CHQA 4W5NA 2VGNA 1KFDA 2OPPA 2WFBA 2YHBA 4I9LA 3NVKA 1HX1A 1HLUA 4Z94A 2F9TA 1QQNA 1NK9A 3MN7A 4H0VB 4IFEA 4DSKA 1TL3A 4LH5A 3MAQA 4H5NA 3KK3A 2BUPA 3AVGA 1NLVA 3DXKA 1XWLA 3MX2A 3AVFA 2E4LA 2FBYA 4CERA 3WT0A 1DT9A 1XHXA 3KLEA 3EO3A 1C1CA 4BE2A 1NKCA 3J8AA 2W6KA 4R79A 3LAKA 4M3WA 4JI3K 4FJMA 1GLJO 3THYA 1RT2A 3FZFA 4BR5A 2QEXN 1NMNA 3AO1A 4FPAA 4OPHA 3AA4A 5CZ1A 3AV9A 2ZGZA 5DMRA 3V9ZA 3ATVA 3CQXA 4GV3A 2F96A 3AGKA 2RE2A 3ENOA 3KLFA 4U67L 3U3YA 1S72N 5JMVA 1QQOA 4DQSA 5J2QA 3DJCA 3FGUA 4OPAA 2X6SA 4BWMA 3WEEA 1TAUA 4JD2B 3TAPA 4CJFA 2OANA 4CEEA 3NCIA 1J54A 1V4SA 3N4PA 4LD0A 2B4JA 1IKWA 4N41A 4EAHD 3LDOA 1QSLA 3F2KA 3LDSA 3AO2A 4OGCA 4KTQA 3CPEA 1NK4A 3LL3A 4WF9L 4CEFA 3NBPA 1GLAG 3NE6A 3MEGA 2QKBA 1Z05A 4BR4A 3AO5A 2X74A 4Y1DA 4B08A 4FO0A 1SL0A 2G8UA 2Z1HA 4M63C 3OYHA 3ZSOA 3VTIA 3L8BA 4EHUA 2IIRA 4CESA 2IAJA 1JXEA 3MXJA 3LP1A 4JLHA 1ZBSA 3VETA 4X66K 4CHYA 4ZHRA 4DR1K 3KK2A 2HVIA 5SZTA 3S3OA 2P9KA 1C1BA 2IS3A 1HJRA 1HJOA 4DQIA 3NFAA 4IEEA 1HYSA 4B1XB 1VK0A 2YHXA 4BVPA 4DTOA 4F2RA 4C23A 1D8YA 3O9QA 2ITGA 3LPUA 3AO4A 3DOKA 1W97L 2W41A 3CQYA 4XIUA 3O08A 3QFPA 4B9UA 3H46O 3K9KA 4JS4A 4CJ7A 1LOTB 4Z4CA 1M90O 3V6DA 4I2QA 4N76A 5AQVA 1NGJA 3VGLA 1L5UA 2OCEA 1QSSA 4E1MA 4R5PA 3QNOA 1KRPA 1RNHA 1EP4A 4B3OA 4C1NK 3WXIA 1JLCA 1G99A 3S3MA 4JEPA 3NMUA 3AVJA 4O44A 3THXA 2Y1IA 2Q2RA 3EE9A 4FJ8A 2KQ2A 4NYFA 2VWBA 1ESVA 1RBSA 1RGIA 1NM1A 2UYTA 5AQSA 5AQWA 3OY9A 3PUFA 3LWLA 4RW7A 1E3MA 4KTZA 1IBLK 2QWPA 3M3ZA 5E41A 4WFNL 2VQFK 2E8AA 4IG3A 1BIZA 1HUXA 4M41A 5GAHP 5ELZA 3HP9A 4CZEA 2D4WA 4CJQA 4IDHA 4CJVA 1N8RO 1DTTA 2HNYA 3DLRA 2NLXA 4CFAA 1JJ2M 3IAYA 1VRTA 4ISGA 4BGBA 4CBUA 4H8KA 4YOYA 4ELTA 1JLBA 4OO1J 4BR0A 4FWKA 1BOTO 2Q31A 2WUSA 3WQTA 1RTDA 4M3RA 4JI5K 2QTDA 4H4OA 4GKJK 1NGFA 3TANA 4BVOA 2BANA 5J2MA 3VQ4A 4BC5A 5JLFA 1K73O 1XQSC 3R3LA 1NGAA 4DR6K 4BGAA 5AR0A 3VQ5A 5E26A 4CF9A 2HW3A 2P5OA 3AVHA 3NHGA 1BI4B 4JHDB 3ZT1A 3CFOA 3PV8A 1XUPO 5IT9O 4I6MB 1KFSA 2O8FB 3T19A 1OH7A 2YV0X 3C7NB 1C0GA 1LW2A 5AZIA 4A61A 4CE9A 2O8DB 3O4QA 1SUQA 4LF5K 3FR0A 3VQAA 3FZHA 5C0YA 3M5RA 3R6MA 2NUBA 3H3NO 4DR4K 1JL2A 4NCGA 2D1KA 2NRWA 4IO9L 2UXCK 4WCEL 3SUNA 1BWFO 3SQ4A 2KLAA 1ZXOA 3K5OA 3QO9A 4PKGA 2Z1JA 3VQPA 2QWLA 4RCHA 4YY3K 4AHTA 4B1VA 1ZYQA 2LSNA 3OJSA 1U2VB 1HKBA 4BRQA 5LMNK 1VQ6N 4PKHA 1ZC6A 1VQKN 4N5SA 3NH0A 3ZEUB 5FPDA 3BF3A 3SQ1A 3NGIA 4FOEA 4QS8A 2E1YA 3HJFA 3CMEN 3B8AX 3WNEA 4MFBA 2V7ZA 3VF2A 2HHQA 4AF1A 2OPRA 5CYMA 3ENHA 3TTFA 3EN9A 1NJIO 2IC3A 2HF3A 1JLFA 3F5TA 1L3UA 1W2BM 4CK1A 2GELA 1T05A 4X65K 4BR9A 4B1WB 3RR8A 2XRIA 4NCBA 2G8FA 3CFRA 1YT3A 2HHWA 4M3ZA 3TABA 1ZBFA 3CCLN 3P4IA 1NU0A 5BR9A 3SUPA 1C6VA 1WNSA 4BRCA 4JKEA 4J8FA 4DQPA 4HTUA 3P83D 5BREA 5LMUK 4OVLA 3KVGA 4CHNA 5BPMA 3SI6A 4AHVA 2BH1A 5BPNA 2QWNA 1TVRA 4YOXA 3VGKA 3IG1A 3C94A 4OKKA 1D9DA 2RN2A 1VHXA 2RKIA 3TTCA 1XHZA 3CETA 3TSPA 3M8RA 5AQTA 3M8PA 4JI0K 4JK9A 3CC7N 1JCFA 3RSEA 1UWBA 3WUHA 3OYNA 4X64K 3MDQA 5AQJA 2ZJRL 1L3TA 2UXBK 4BRFA 1QHTA 1QZ5A 3LAMA 1NGCA 1ASWA 3TAEA 2CGJA 4BC2A 4BC4A 4IFYA 2YHYA 4GMJB 1KAXA 3B6OA 3NF7A 1T03A 4DUZK 2VYPA 4DS4A 3QIPA 3UKRA 3L2RA 5LY3A 4JAXA 2FSKA 1KAYA 3AAPA 4OKJA 2VWKA 2G8IA 2YI1A 3N4QA 5HRRA 4JI8K 4M42A 4DFJA 2XY5A 3ITHA 4AM6A 4DFPA 3VF4A 2ZQBA 3PSFA 3P38A 5HP1A 4DLEA 2GBZA 3QB0A 1SQKA 4CZGA 5TKWA 1A5VA 1OVYA 5AQOA 3DM2A 3KLIA 3VQ6A 4KB0A 1TKTA 3CJ7A 2DFFA 4CEZA 2ETJA 3AVAA 3LZJA 4YDUC 1KVBA 3MECA 3NF8A 3SBGA 5JICA 3PIPL 2VG5A 3AVKA 4DV5K 1LAVA 1T3VA 4H5VA 2KFNA 3AVCA 2O8BA 1BDGA 1L3SA 4IFVA 3ALYA 3OA9A 2JWLA 1YHQN 1X3NA 4BRGA 1GLDG 1S1VA 5BRDA 4BRLA 4DUYK 3LM2A 3TAQA 4LF4K 3U8XA 3THWA 2HHTA 4CGDA 5BN8A 4HUGA 2O8EB 2I5JA 3T7ZA 5HRNA 3CJAA 4RW9A 2YHWA 1ATRA 3O80A 3ZSVA 4PL7A 4FW1A 5C24A 1U48A 1XMOK 2XY7A 4CFDA 4FWPA 4KFBA 1RTHA 3W0LA 4CIGA 2P9UB 1HNXK 3EE8A 5KI6A 2KKZA 2YKNA 3SK3A 4OPJA 4YOVA 4FM0A 3ZX2A 4DMNA 3AO3A 3EZ5A 2HBKA 4CHZA 3D2FB 3BZCA 2QA4N 4KB1A 4KI4A 4CCHA 4F3OA 5I42A 3A5MC 4C8MA 3CM6A 1TK8A 3KKSA 3QFUA 1YTAA 4FJNA 2DPNA 3OYAA 3QDKA 4JKGB 2V52B 4HUFA 3WNFA 4B3SK 3IMXA 3VMFB 4IOXA 2HHUA 4JV5K 4FLTA 3H08A 3VF6A 4JKHA 2XY8A 3PSIA 5AZJA 3PX0A 4H03B 5TKYA 1IKXA 2P9PB 4FK0A 1HPMA 4OKEA 1DLOA 3RMCA 4IBNA 3BEXA 4K8XA 1NKEA 1DKGD 3UE5A 3DXMA 1BG3A 5C12A 4HTLA 2JGUA 4CJPA 3U6FA 4A5BA 3VQCA 4Z4GA 2ZJPL 3OS0A 3T1AA 1LCUA 3ZCMA 4CEOA 1EO1A 4NLBA 2GUPA 3OYFA 4CZIA 4DF8A 2CH5A 1RDDA 3SQ0A 3VEXA 4FJXA 4O0IA 1W7AA 3I0RA 3F73A 5AQFA 2FC0A 3NVMA 1Z25A 5CE3A 4ICLA 3VQQA 3J7AP 1RDBA 4IJAA 2P9SB 2GWJA 4CIEA 1KTQA 4GV9A 3TU5A 3ZSWA 1HKCA 4N56A 4E7JA 5EU7A 3OS1A 3CCQN 1NGDA 3VGMA 1UA0A 1FW6A 3O9RA 1KVAA 2IGIA 3BF1A 1MU2A 1XMQK 2PYLA 3VQ7A 4CF8A 3HO1A 4O8KA 4Z4IA 1NNEA 3DRSA 1CZAN 1NBWA 3HVTA 3AY9A 1JLQA 3D45A 3O3FA 4FJIA 2Q1NA 3FFIA 4NXMK 3KZBA 3WEEB 1TYQA 1ASUA 2WTUA 5AQHA 4A62A 2YCHA 4MLEA 5KGWA 3O3HA 3H45C 1NWKA 1J5EK 3KWIA 3G6EN 1VQ5N 2HVHA 5K14A 1RT7A 5HROA 5KGXA 1EWQA 3QLHA 1WSGA 3I33A 3TSUA 1FJGK 1IG8A 1GLFO 4L8RB 5KPZA 3O8MA 4ISFA 4Z0UA 3CYMA 3M6GA 3PO4A 1K8KB 1XC9A 4CJUA 1IO2A 4BC3A 4DTMA 1ZBUA 2B6AA 4MLHA 3MEEA 2O4IA
chains in the Genus database with same CATH topology
3OTOK 5LMUK 4DR6K 4DUYK 4LF4K 5A2QO 4B3TK 4DV3K 2UU9K 5IT9O 4DV2K 1XNRK 4OX9K 3J81O 3J80O 5IWAK 5BR8K 4LF5K 1HNWK 1XMOK 4JI3K 4DV1K 4DV4K 1IBMK 4JI0K 1N32K 3J7AP 4DR4K 4DV0K 4JYAK 4DV7K 2UXCK 4NXNK 1HNXK 1N36K 3J7YP 4X64K 4K0KK 4B3RK 4LFAK 4LF7K 4JI6K 2UXBK 1XMQK 4YY3K 1HR0K 3T1YK 1IBKK 4LF8K 4CW7B 5LMNK 2HHHK 3JAMO 2VQEK 5AJ3K 4DUZK 4LF9K 4KHPK 4NXMK 4DR5K 2UUAK 4B3MK 4JI8K 4JI4K 4DR7K 4AQYK 4B3SK 2UUCK 1N33K 4LF6K 4LFCK 4DR2K 4LFBK 4JV5K 4CVNE 1J5EK 2ZM6K 4YHHK 4JI2K 1XNQK 5LL6Z 4JI7K 1I94K 2E5LK 4V19S 1IBLK 4X65K 2VQFK 4X62K 1FJGK 3T1HK 4GKKK 2UXDK 2F4VK 5FLXO 4DV5K 4DV6K 4JI1K 4X66K 4JI5K 4DR3K 2UUBK 4GKJK 1HNZK 4DR1K 1N34K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO K;  5LMU K;  4DR6 K;  4DUY K;  4LF4 K;  5A2Q O;  4B3T K;  4DV3 K;  2UU9 K;  5IT9 O;  4DV2 K;  1XNR K;  4OX9 K;  3J81 O;  3J80 O;  5IWA K;  5BR8 K;  4LF5 K;  1HNW K;  1XMO K;  4JI3 K;  4DV1 K;  4DV4 K;  1IBM K;  4JI0 K;  1N32 K;  3J7A P;  4DR4 K;  4DV0 K;  4JYA K;  4DV7 K;  2UXC K;  4NXN K;  1HNX K;  1N36 K;  3J7Y P;  4X64 K;  4K0K K;  4B3R K;  4LFA K;  4LF7 K;  4JI6 K;  2UXB K;  1XMQ K;  4YY3 K;  1HR0 K;  3T1Y K;  1IBK K;  4LF8 K;  4CW7 B;  5LMN K;  2HHH K;  3JAM O;  2VQE K;  5AJ3 K;  4DUZ K;  4LF9 K;  4KHP K;  4NXM K;  4DR5 K;  2UUA K;  4B3M K;  4JI8 K;  4JI4 K;  4DR7 K;  4AQY K;  4B3S K;  2UUC K;  1N33 K;  4LF6 K;  4LFC K;  4DR2 K;  4LFB K;  4JV5 K;  4CVN E;  1J5E K;  2ZM6 K;  4YHH K;  4JI2 K;  1XNQ K;  5LL6 Z;  4JI7 K;  1I94 K;  2E5L K;  4V19 S;  1IBL K;  4X65 K;  2VQF K;  4X62 K;  1FJG K;  3T1H K;  4GKK K;  2UXD K;  2F4V K;  5FLX O;  4DV5 K;  4DV6 K;  4JI1 K;  4X66 K;  4JI5 K;  4DR3 K;  2UUB K;  4GKJ K;  1HNZ K;  4DR1 K;  1N34 K; 
#chains in the Genus database with same CATH topology
 1FXX A;  1NJZ A;  3ID6 A;  1HQU A;  2KW4 A;  5HRP A;  2OPS A;  3OHR A;  3HTV A;  1NGB A;  3IUC A;  3C6A A;  2UU9 K;  1WN7 A;  3Q7B A;  3VQ9 A;  5M1Q A;  4GW6 A;  4BG9 A;  2HBJ A;  1KSP A;  5FRO A;  4JS5 A;  3P1G A;  2D5R A;  4IEI A;  4CZM A;  3DAW A;  3P39 A;  1WSF A;  4O5B A;  3SBT A;  1T8E A;  3D6R A;  3K0S A;  1SV5 A;  4JD2 A;  1MA9 B;  3A5L C;  3ATU A;  3G71 N;  3MXM A;  4CFB A;  4C8L A;  3R8E A;  4CBW A;  2AJQ A;  2A6A A;  4DSE A;  1WUA A;  4JI6 K;  5F1X A;  2E2N A;  4KTW A;  3ZX0 A;  4JKD A;  3OBW A;  4WQ5 A;  2E6M A;  3CM5 A;  5FDL A;  4MDB A;  1NGG A;  1SS6 A;  3MCP A;  3MED A;  1S9E A;  2V51 B;  1C0U A;  4ZTJ A;  1GLC G;  3L6Q A;  2PY5 A;  3HI0 A;  4GVE A;  4CGJ A;  2QWO A;  4K41 A;  4GNI A;  3ID8 A;  4CF2 A;  3HT3 A;  4J2A A;  2DY4 A;  3FZL A;  4OJR A;  3VQB A;  1K8A O;  3TSQ A;  4YNQ A;  4V19 S;  2NRH A;  2A1R A;  4CGG A;  4BDP A;  1WSH A;  2WON A;  2B5J A;  3MXI A;  4KHW A;  3C95 A;  4IWV A;  4FCY A;  2VGM A;  3NF9 A;  2PAV A;  4CGH A;  3T1H K;  4GKK K;  4FXD A;  3SPY A;  3HVR A;  1LWC A;  3QER A;  2F4V K;  2W40 A;  1F21 A;  2KZZ A;  2JWK A;  4GVM A;  5AQK A;  4CD3 A;  1ILY A;  5CY4 A;  3SV4 A;  1WSE A;  4LH4 A;  4WFB L;  1Q18 A;  2H3G X;  3SUQ A;  3SQ2 A;  3RMA A;  1X9M A;  1YTU A;  3KD1 E;  1BO5 O;  1QQC A;  4DS5 A;  1HYV A;  5DK5 A;  1X9S A;  4B3T K;  1VQ9 N;  2G8K A;  4DV2 K;  1C1A A;  1JCE A;  1RBR A;  1XNR K;  2ZJQ L;  4H4M A;  3EKS A;  4JKB A;  3HSC A;  5LJV A;  1DGK N;  2WBN A;  4FJ5 A;  5IWA K;  2Y1J A;  1HNW K;  1RCH A;  5AZI B;  4FWQ A;  1ATS A;  5D3G A;  2I7P A;  4DV7 K;  3WNG A;  4XH4 A;  4FM1 A;  1D9F A;  5AQI A;  4B3R K;  4LFA K;  4G9Z A;  4B9V A;  4DB3 A;  4H0X B;  4CEB A;  1HR0 K;  3CJB A;  4LSN A;  4DQR A;  3SCX A;  3G0Z A;  2NRV A;  3CJ1 A;  2BDP A;  4CJ3 A;  4LF8 K;  4FLY A;  3T69 A;  1A5W A;  4LY7 A;  2A41 A;  2G8W A;  2O8C B;  3DLE A;  5AQN A;  3QEV A;  3LDN A;  4W5R A;  1S6P A;  4MQ3 A;  4J2D A;  3BY5 A;  4BRN A;  1SL1 A;  3O9S A;  1WB9 A;  1I39 A;  3MCA B;  2W42 A;  4BE0 A;  2X6N A;  5KPT A;  1GLB G;  4LF6 K;  4NCA A;  1VSL A;  5C42 A;  4FJK A;  1NJX A;  3VOV A;  4W5O A;  3CC4 N;  3VA3 A;  2BGG A;  4CZH A;  1B9F A;  2FLO A;  1YVN A;  3GL1 A;  4PQU A;  2HOE A;  4BY9 C;  4I6M A;  4JN4 A;  3TI0 A;  3GG4 A;  3C7N A;  3AA5 X;  2IOC A;  3FZK A;  3KWG A;  1U04 A;  4O55 A;  4A57 A;  4BQZ A;  3PLA A;  3C0B A;  2CH6 A;  3V81 A;  2HMP A;  3ZET A;  1NMD A;  1QS4 A;  3CCM N;  4BRH A;  1TUY A;  2GX9 A;  2IDO A;  4O5F A;  3V1R A;  4H0Y B;  4Y1C A;  2PZS A;  1YVU A;  2UUB K;  4KHU A;  1T6D A;  1KVC A;  3OTO K;  3ENB A;  3SMP A;  2QI2 A;  3HPG A;  1HMV A;  4Z4F A;  1T6C A;  3HBT A;  3OJU A;  4ZTF A;  1M1K O;  1OH5 A;  3MN5 A;  3LP3 A;  2Z1I A;  4FLW A;  2P5G A;  3TAG A;  1VSH A;  4EIA A;  3LAL A;  4DTP A;  4YOW A;  3P5J A;  4M45 A;  4DLG A;  1WBB A;  1VSM A;  3ZEU A;  4DV1 K;  3ZLJ A;  4DV4 K;  1BIS A;  3UKU B;  2FXU A;  1D5A A;  3FFK B;  3L3V A;  4HWI A;  2F9W A;  2A3Z A;  3O9U A;  2FBV A;  2QXF A;  3G25 A;  2DFH A;  1VAZ A;  1B92 A;  1S1X A;  4KV8 A;  1IV0 A;  1QZ6 A;  4FM2 A;  3NGZ A;  1VQ8 N;  4MO4 A;  3GE1 A;  2Q97 A;  3EEQ A;  1TKD A;  3T1Y K;  4E89 A;  1TKZ A;  3KLG A;  2NRR A;  4OGE A;  2E2P A;  2IVO A;  1VSD A;  4IKF A;  4AHR A;  4ILJ A;  4CZL A;  5CYQ A;  2E6L A;  3K5N A;  3MMV A;  3AVL A;  1U45 A;  4OLB A;  2P9N B;  3O9T A;  1TGO A;  4IO8 A;  2A5X A;  1RBU A;  2KZM A;  1NKB A;  1C0M A;  4FWS A;  4AQY K;  2DFE A;  4CHO A;  3S3N A;  3U9Z A;  4LFB K;  3U9D A;  5FRN A;  4KHS A;  1JXB A;  4YHH K;  4JI2 K;  1XNQ K;  4FYD A;  1WBD A;  3VQ8 A;  3O6W A;  4A59 A;  1NK6 A;  5JS2 A;  5HL7 L;  3CCV N;  1TKX A;  3TAM A;  4F3T A;  4NYN A;  4A2B A;  3LAN A;  4KHY A;  3ZX3 A;  2O4G A;  1WLJ A;  3H3O B;  4CJK A;  1RFQ A;  2PFU A;  4BRM A;  3SLC A;  4YOR A;  3TPQ A;  1KD1 O;  4BRP A;  5HOO A;  3L4I A;  3DLL L;  1N6Q A;  3CMA N;  1NJW A;  5FRM A;  1GOB A;  3QIC A;  5C2F A;  2HND A;  1DEJ A;  3D2E A;  1MWK A;  5EOY A;  4FJG A;  2XO7 A;  4FZY A;  1GLL O;  2O8B B;  2E2O A;  1CXU A;  4A5A A;  1J9A A;  4B8A B;  3T3F A;  3OYD A;  4H5T A;  3ZT3 A;  4CZJ A;  4DTU A;  5A2Q O;  2P9I B;  3HZ6 A;  5DM7 L;  4CJR A;  4CZF A;  4PHT X;  4RG8 A;  3L2V A;  3OYK A;  1S1W A;  2RPI A;  4DSI A;  1J5O A;  4DSL A;  4H5W A;  3JYT A;  3K58 A;  4EZ9 A;  3P31 A;  3ASM A;  4HUE A;  3VA0 A;  1VSE A;  1NGH A;  3SNN A;  4TSX A;  4HCB A;  2QW9 A;  5BRF A;  1BA0 A;  1H1V A;  4CK3 A;  2HST A;  1WSJ A;  4NXN K;  2CGK A;  2Z1G A;  1OH6 A;  4IOC L;  3HK2 A;  3ZSZ A;  3VQE A;  3C6T A;  3K59 A;  3KKR A;  1HPZ A;  3AA3 A;  3CPW M;  3L4Q A;  5AQY A;  4B8C A;  4BQL A;  3HL8 A;  3I8B A;  3LWM A;  4M7X A;  2G8V A;  4WE1 A;  3QET A;  3JAM O;  3VEW A;  1KLM A;  1UOC A;  1RIL A;  2PBD A;  4FPB A;  1S5J A;  3WXM B;  1WAF A;  2QWM A;  4FLZ A;  2Q0R A;  3VER A;  5BRH A;  4AH9 A;  3FLC O;  1N5Y A;  1YJW N;  3MK6 A;  3O5B A;  1CZB A;  3KLH A;  3CER A;  3VQD A;  5LJW A;  1NK8 A;  1K6Y A;  2D0P A;  1VQP N;  4FK2 A;  4J2B A;  2YKM A;  1YXQ A;  2YNF A;  4H0O A;  2HMI A;  2HB5 A;  1E4G T;  3PX4 A;  4FVU A;  1KCF A;  4JKF A;  3NGY A;  1QQM A;  3K2P A;  1FKO A;  3CCJ N;  1EWR A;  4CEQ A;  4JRP A;  2OTJ N;  4DG1 A;  3OYG A;  5JVG L;  3G10 A;  3VEZ A;  4FJJ A;  4EHT A;  2FSN A;  4LSL A;  4B9M A;  5EX5 A;  5I3U A;  2QXL A;  2HHV A;  2P9L B;  1YJ9 N;  1RDU A;  4EFH A;  3PO5 A;  2D0A A;  3U3G A;  3AVB A;  3NH1 A;  1B9D A;  2D0C A;  4FWN A;  3OYC A;  1QHA A;  1O13 A;  2QM1 A;  3DXM B;  3MWP A;  2YJE A;  3OBY A;  2PYJ A;  3TTD A;  3OW2 M;  3QNN A;  4FWM A;  2QKK A;  2A40 A;  4QAG A;  4YOU A;  4KRE A;  1Y64 A;  1Q86 O;  4Y0W A;  3D2F A;  3RVC A;  3ZSY A;  1ATN A;  1RBV A;  4ILG B;  3VEO A;  3J80 O;  3RRH A;  1VQ4 N;  3VEY A;  1ZBH A;  3VN5 A;  5C15 A;  4Z4H A;  1G15 A;  5BN9 A;  4G1Q A;  1FK9 A;  1BQN A;  1MWM A;  4KAZ A;  4JKG A;  3A0I X;  3ZYY X;  1Q7Y O;  1HNV A;  4ELV A;  3J7Y P;  3V9U A;  3CCE N;  4O0J A;  4AM7 A;  1JLG A;  1BL3 A;  2ZF5 O;  3OS2 A;  4Q5V A;  3THV A;  3IDH A;  3IKM A;  4CF1 A;  2VCP A;  1IH7 A;  3KIO A;  3DXK B;  2YX6 A;  1IBK K;  3FE1 A;  2HHH K;  3K9J A;  5M1F A;  2NZT A;  3BUZ B;  1SZ2 A;  1YIJ N;  2D0O A;  4DU1 A;  1VSI A;  4IG0 A;  2HF4 A;  3AAR A;  4FL9 A;  3B6P A;  2NNW A;  4FZZ A;  3THY B;  3OYI A;  1R59 O;  4KH6 A;  4JKC A;  3L2Q A;  2OTL N;  5JVH L;  4CF0 A;  5CR4 A;  3CCU N;  3EY1 A;  1N33 K;  4KH4 A;  3BDP A;  4RW8 A;  4UQG A;  4DTX A;  1NOY A;  1WSI A;  1GLE G;  3SYZ A;  4IOA L;  2ITM A;  1RDC A;  1VQO N;  3CJC A;  1WAJ A;  4HCC A;  3CQ8 A;  4ISE A;  2GEM A;  2J4R A;  4X62 K;  1I3A A;  3A5N C;  2NRT A;  5FPE A;  3ULE A;  1RDA A;  3DRR A;  3AAQ A;  3PY8 A;  2FBT A;  1O1W A;  3QBX A;  3NAE A;  3A2F A;  4AHC A;  4C8O A;  3E9L A;  3L0Q A;  5FLX O;  1HKG A;  2I7N A;  4NLC A;  4I9Q A;  2P9S A;  1X1P A;  3DWL A;  1XC3 A;  4E0D A;  2Q36 A;  1RT4 A;  4CFC A;  5ADX A;  1HYZ A;  1KLN A;  1HNI A;  3L2W A;  3RRG A;  1LW0 A;  2XY6 A;  4FJH A;  3HPO A;  3WXJ A;  2V7Y A;  2NRX A;  3EZW A;  3MN9 A;  4M3T A;  1BU6 O;  4DTJ A;  4WQ5 C;  4XH1 A;  3OYL A;  3KK7 A;  3VEN A;  2VG6 A;  2GUI A;  4KBO A;  3OYM A;  3HRG A;  3JXU A;  3DMJ A;  1YF5 L;  3KD5 E;  3NH2 A;  1EKE A;  4CD1 A;  1R0A A;  3RWU A;  4CJS A;  3L2U A;  4NB4 A;  4CJW A;  3K5M A;  3S9H A;  1YIT N;  1U4B A;  1SL2 A;  4F2S A;  5SWM A;  3DYA A;  1LV5 A;  4WQ4 C;  4BRK A;  4KI6 A;  1Q81 O;  2ZE2 A;  4CK2 A;  4IJN A;  1ZBI A;  3DOL A;  4K0K K;  3HM9 A;  4IXC A;  3D7E O;  2P9K B;  3ZT0 A;  4DQQ A;  4LF7 K;  3L3U A;  5H1S Q;  4MO5 A;  3RMB A;  1Z26 A;  4CGF A;  3QBW A;  4JK7 A;  4K43 A;  1NG9 A;  5F2R A;  3AVM A;  1UA1 A;  3I0S A;  5F0X A;  4CJL A;  2YNH A;  5AJ3 K;  2HHX A;  3O1W A;  4B9N A;  5AFU A;  1L3V A;  4KHN A;  4ILH A;  3KJV A;  3AVN A;  1Q82 O;  1RT3 A;  1RTJ A;  2UUA K;  4CJT A;  3GOI A;  4JI4 K;  4BR7 A;  1VQM N;  5DM6 L;  1RT5 A;  1K8K A;  1V4T A;  3LP2 A;  1LWE A;  5AQZ A;  4FK4 A;  2ZM6 K;  4YFU A;  1I94 K;  2E5L K;  1EET A;  5KTQ A;  1RBT A;  3CJ9 A;  3WQU A;  3CFP A;  2OYQ A;  4KH5 A;  4XEI A;  2OZS A;  3HXM A;  2AA4 A;  3O4W A;  3AVI A;  3O3G A;  4CEA A;  3DRP A;  2HBM A;  4NO7 A;  4WQ4 A;  3THX B;  3QEI A;  3GBT A;  3J7Z O;  3SMS A;  3VTH A;  2HNZ A;  4YOT A;  3HPH A;  3O1B A;  4HVJ A;  3CG7 A;  3R1X A;  2BTF A;  4CI6 A;  4DR3 K;  1Q9Y A;  1BUP A;  4M3U A;  1KQS M;  1BCO A;  3IFR A;  4FVM A;  4JK8 A;  2BE2 A;  5AQQ A;  4DCH A;  4PL8 A;  4K42 A;  4IDK A;  2WC9 A;  4E3S A;  1OH8 A;  5JLH A;  5AQM A;  3E9P A;  1S3X A;  3J81 O;  4BRI A;  1TK5 A;  3C6U A;  4E7K A;  3A5O C;  4CZK A;  3JSM A;  5BR8 K;  4BRO A;  4RWT A;  4CJ4 A;  2EHG A;  3W3D A;  4K8Z A;  3DI6 A;  3CXC M;  1BIU A;  3G4S N;  1X3M A;  4CJE A;  1JL1 A;  2IVN A;  5KRT A;  4CED A;  4Z4E A;  4FJ9 A;  3EL2 A;  3BZK A;  2E1Z A;  1J53 A;  2QK9 A;  1EX4 A;  3C6H A;  4E7I A;  1YUW A;  4BRE A;  2HBL A;  3KHY A;  3ZSX A;  2GTD A;  2VQE K;  4FJ7 A;  3LPT A;  3UB5 A;  2ASM A;  1JLA A;  4DWI A;  5AQX A;  4EP4 A;  3M8S A;  1GOA A;  4BWJ A;  3SAH A;  2EWS A;  4WFA L;  3V9W A;  4B3M K;  2FBX A;  2E20 A;  1MDU B;  5GAE P;  5T7B A;  4DKW A;  4QCL A;  1S1T A;  3K5L A;  5C25 A;  4I2P A;  3CC2 N;  4HHT A;  4BDZ A;  3BGR A;  4DQ8 A;  3M8Q A;  3SAF A;  4OPK A;  2RHK A;  1JLE A;  2R7Y A;  5BPL A;  2RF2 A;  2E2Q A;  5FPN A;  1SKW A;  4H0T B;  4B1Y B;  2EX3 A;  3V1O A;  4EP5 A;  3HOT A;  1TV6 A;  3ZSR A;  2VG7 A;  3MX5 A;  5EXW A;  1Q9X A;  3UIQ A;  3EYZ A;  1TL1 A;  5KPR A;  4F4K A;  4O4G A;  3MWT A;  1IKV A;  3M1F A;  4UY8 O;  1NGI A;  2F7T A;  4RW4 A;  1VSJ A;  3VEV A;  1A5X A;  5M1N A;  3D0P A;  1S22 A;  4DV6 K;  4JI1 K;  5JS1 A;  3U4L A;  3SV3 A;  3HOS A;  3ZET B;  4FLV A;  5HRS A;  4GV6 A;  5KQ8 A;  4RW6 A;  5E84 A;  1N34 K;  4M7Y A;  3CCS N;  4K25 A;  4F9O A;  1BI4 A;  3LM9 A;  4JHD A;  1BQM A;  4CBX A;  1WOQ A;  1NOZ A;  3DLH A;  1JCG A;  2O8F A;  3GDQ A;  4DU3 A;  1X9J A;  1BA1 A;  1QVF M;  3CIP A;  2O8D A;  1VQN N;  3RMD A;  2VWJ A;  4FZX C;  3WXK A;  1K9M O;  2O8C A;  1NGE A;  2YJF A;  4E1N A;  4B9S A;  1IBM K;  2ZGY A;  4W5T A;  3V4I A;  3QES A;  4JYA K;  1CXQ A;  2YNG A;  2QWQ A;  4CHP A;  3I56 N;  3V1Q A;  4OLA A;  4O8U A;  5HBM A;  1ITG A;  1EXQ A;  3H1V X;  3V9X A;  1RDW X;  3E01 A;  1U2V A;  3TAR A;  1U47 A;  1Z6R A;  4W5Q A;  2HHS A;  2P51 A;  3AA2 A;  3CF5 L;  1BGX T;  4CGI A;  4M3X A;  5AQR A;  3LDL A;  3IRX A;  1REV A;  2FF3 B;  4KHP K;  2WOM A;  4DR5 K;  3HM8 A;  3H1Q A;  4BRA A;  4DTS A;  3CHW A;  3ZT2 A;  4B1U B;  5GAG P;  2DTU A;  3RSE B;  3A8Y A;  3IS9 A;  1RT6 A;  4FWO A;  5M1K A;  2YNI A;  1T7P A;  2UUC K;  1TK0 A;  4CVN E;  3SUO A;  4JRQ A;  5LL6 Z;  4U7B A;  1LAW A;  3E9O A;  4FOI A;  3TR8 A;  4E7L A;  1OVQ A;  3QEW A;  1IJJ A;  3HST B;  4FWL A;  1W9H A;  3QML A;  3SAG A;  3UKR B;  4JKA A;  3ZSQ A;  4ID5 A;  4E7H A;  5FPM A;  5GAD P;  1NK5 A;  1BHL A;  1TUU A;  4B9Q A;  4Q0B A;  1UAX A;  3DLB A;  1HQE A;  4GY2 B;  5AQU A;  4H5R A;  3UKU A;  4KPY A;  3WNH A;  4AHS A;  4F8R A;  1HNZ K;  3D2E B;  3RR7 A;  4FLU A;  2F8S A;  1NK7 A;  1ZBL A;  4PUO A;  5J2P A;  3SPZ A;  1OKJ A;  3PX6 A;  2NRZ A;  2CGL A;  1U49 A;  4OX9 K;  2QWR A;  1JKH A;  3KK1 A;  1SKS A;  2KTQ A;  1N32 K;  2P9N A;  4BE1 A;  2F8T A;  1TAQ A;  5J2N A;  1D4X A;  3FZM A;  5AQG A;  5KQD A;  3WXL A;  1QE1 A;  3MN6 A;  3THW B;  4IZ9 A;  1XI1 A;  1CZ9 A;  1YI2 N;  1VQ7 N;  1VRU A;  3SJJ A;  3OYJ A;  3I8D A;  4DSJ A;  1QTM A;  4DTN A;  4CW7 B;  4DTR A;  3QIO A;  4LF9 K;  4B1Z A;  3OYE A;  4PY5 A;  2D0B A;  1ASV A;  4JNE A;  2A1S A;  4CIF A;  4KHQ A;  4N47 A;  2E88 A;  5CHI A;  1YJN N;  5M1P A;  1Y97 A;  3NF6 A;  4BR2 A;  3CD6 N;  4DR7 K;  4FJL A;  5GIO A;  4LFC K;  5KRS A;  4DR2 K;  1EQY A;  4C8K A;  3O4N A;  3VPZ A;  2P1J A;  3LDP A;  1IG9 A;  1DTQ A;  3LDQ A;  3QEP A;  4BG8 A;  3VES A;  5C2D A;  4DSF A;  2OA8 A;  3R9P A;  2P9I A;  2ATQ A;  5GIP A;  1CLQ A;  1C0F A;  3NDK A;  5ADX H;  1Q8I A;  3F9K A;  3DLG A;  1VQL N;  1SKR A;  2Q0U A;  3F9M A;  5B8H A;  2UXD K;  3EKU A;  1S1U A;  2YHA A;  3PIO L;  4FW2 A;  1FKP A;  4KO0 A;  5HLF A;  1BCM A;  4QS9 A;  4FLX A;  4DHY A;  5I9E B;  3CI5 A;  2JLE A;  4ID1 A;  2Q3S A;  4AHU A;  3HP6 A;  3SZ2 A;  3HYF A;  4DFK A;  2A42 A;  4DF4 A;  2X78 A;  1C0T A;  3K57 A;  2XHB A;  2O8E A;  4B9T A;  5GIN A;  3ULD A;  5AZJ B;  4DV3 K;  3S41 A;  3BP8 A;  4E1J A;  5AQL A;  5EY4 A;  4YDU A;  4QOZ B;  1S6Q A;  2AP1 A;  2FF6 A;  3ZT4 A;  3C65 A;  4A2A A;  1HRH A;  2P9U A;  2KHO A;  2W6L A;  4BAC A;  1X9W A;  1LWF A;  5CZ2 A;  4DV0 K;  4ELU A;  3KTQ A;  4LC9 B;  4EZ6 A;  4MDA A;  1P90 A;  4PA1 A;  1N36 K;  1RTI A;  5AFU H;  1IKY A;  3I55 N;  2ZD1 A;  2ZWH A;  4C1N I;  3E1Y A;  1YAG A;  4FWR A;  2ASP A;  1KXP A;  1KC8 O;  3H6E A;  1KAZ A;  1U6Z A;  4L3Q A;  4FSV A;  4C8N A;  2GWK A;  3CCR N;  4AIL C;  4I7F A;  4BDY A;  5M1O A;  5EVZ A;  2FSJ A;  5AQP A;  4J2E A;  1P8Z A;  1S9G A;  1QVG M;  4DU4 A;  4RTF D;  4B9L A;  4DFM A;  2P9L A;  3LP0 A;  1NK0 A;  2IVP A;  4QS7 A;  4BRD A;  1GOC A;  3AGR A;  1VSF A;  3LZI A;  1SAZ A;  3QEX A;  4XH5 A;  4KKO A;  2ASO A;  4JI7 K;  4PKI A;  3Q7C A;  3OYB A;  3DLK A;  1VSK A;  4CEC A;  1E4F T;  2OZM A;  3E66 A;  1QSY A;  2G8H A;  3TWH A;  1T44 A;  3SJH A;  2P9P A;  4CJ5 A;  1J6Z A;  3QIN A;  5MLC Q;  3TAF A;  2KFZ A;  4PWD A;  3ISN C;  4E19 A;  4H0P A;  4KRF A;  3JS6 A;  3V9S A;  1TYQ B;  4M3Y A;  3ULE B;  4WYB A;  1RT1 A;  2GV9 A;  5C10 A;  1NJY A;  3RTV A;  2OPQ A;  5J1E A;  1W0H A;  3OVN A;  4CHQ A;  4W5N A;  2VGN A;  1KFD A;  2OPP A;  2WFB A;  2YHB A;  4I9L A;  3NVK A;  1HX1 A;  1HLU A;  4Z94 A;  2F9T A;  1QQN A;  1NK9 A;  3MN7 A;  4H0V B;  4IFE A;  4DSK A;  1TL3 A;  4LH5 A;  3MAQ A;  4H5N A;  3KK3 A;  2BUP A;  3AVG A;  1NLV A;  3DXK A;  1XWL A;  3MX2 A;  3AVF A;  2E4L A;  2FBY A;  4CER A;  3WT0 A;  1DT9 A;  1XHX A;  3KLE A;  3EO3 A;  1C1C A;  4BE2 A;  1NKC A;  3J8A A;  2W6K A;  4R79 A;  3LAK A;  4M3W A;  4JI3 K;  4FJM A;  1GLJ O;  3THY A;  1RT2 A;  3FZF A;  4BR5 A;  2QEX N;  1NMN A;  3AO1 A;  4FPA A;  4OPH A;  3AA4 A;  5CZ1 A;  3AV9 A;  2ZGZ A;  5DMR A;  3V9Z A;  3ATV A;  3CQX A;  4GV3 A;  2F96 A;  3AGK A;  2RE2 A;  3ENO A;  3KLF A;  4U67 L;  3U3Y A;  1S72 N;  5JMV A;  1QQO A;  4DQS A;  5J2Q A;  3DJC A;  3FGU A;  4OPA A;  2X6S A;  4BWM A;  3WEE A;  1TAU A;  4JD2 B;  3TAP A;  4CJF A;  2OAN A;  4CEE A;  3NCI A;  1J54 A;  1V4S A;  3N4P A;  4LD0 A;  2B4J A;  1IKW A;  4N41 A;  4EAH D;  3LDO A;  1QSL A;  3F2K A;  3LDS A;  3AO2 A;  4OGC A;  4KTQ A;  3CPE A;  1NK4 A;  3LL3 A;  4WF9 L;  4CEF A;  3NBP A;  1GLA G;  3NE6 A;  3MEG A;  2QKB A;  1Z05 A;  4BR4 A;  3AO5 A;  2X74 A;  4Y1D A;  4B08 A;  4FO0 A;  1SL0 A;  2G8U A;  2Z1H A;  4M63 C;  3OYH A;  3ZSO A;  3VTI A;  3L8B A;  4EHU A;  2IIR A;  4CES A;  2IAJ A;  1JXE A;  3MXJ A;  3LP1 A;  4JLH A;  1ZBS A;  3VET A;  4X66 K;  4CHY A;  4ZHR A;  4DR1 K;  3KK2 A;  2HVI A;  5SZT A;  3S3O A;  2P9K A;  1C1B A;  2IS3 A;  1HJR A;  1HJO A;  4DQI A;  3NFA A;  4IEE A;  1HYS A;  4B1X B;  1VK0 A;  2YHX A;  4BVP A;  4DTO A;  4F2R A;  4C23 A;  1D8Y A;  3O9Q A;  2ITG A;  3LPU A;  3AO4 A;  3DOK A;  1W97 L;  2W41 A;  3CQY A;  4XIU A;  3O08 A;  3QFP A;  4B9U A;  3H46 O;  3K9K A;  4JS4 A;  4CJ7 A;  1LOT B;  4Z4C A;  1M90 O;  3V6D A;  4I2Q A;  4N76 A;  5AQV A;  1NGJ A;  3VGL A;  1L5U A;  2OCE A;  1QSS A;  4E1M A;  4R5P A;  3QNO A;  1KRP A;  1RNH A;  1EP4 A;  4B3O A;  4C1N K;  3WXI A;  1JLC A;  1G99 A;  3S3M A;  4JEP A;  3NMU A;  3AVJ A;  4O44 A;  3THX A;  2Y1I A;  2Q2R A;  3EE9 A;  4FJ8 A;  2KQ2 A;  4NYF A;  2VWB A;  1ESV A;  1RBS A;  1RGI A;  1NM1 A;  2UYT A;  5AQS A;  5AQW A;  3OY9 A;  3PUF A;  3LWL A;  4RW7 A;  1E3M A;  4KTZ A;  1IBL K;  2QWP A;  3M3Z A;  5E41 A;  4WFN L;  2VQF K;  2E8A A;  4IG3 A;  1BIZ A;  1HUX A;  4M41 A;  5GAH P;  5ELZ A;  3HP9 A;  4CZE A;  2D4W A;  4CJQ A;  4IDH A;  4CJV A;  1N8R O;  1DTT A;  2HNY A;  3DLR A;  2NLX A;  4CFA A;  1JJ2 M;  3IAY A;  1VRT A;  4ISG A;  4BGB A;  4CBU A;  4H8K A;  4YOY A;  4ELT A;  1JLB A;  4OO1 J;  4BR0 A;  4FWK A;  1BOT O;  2Q31 A;  2WUS A;  3WQT A;  1RTD A;  4M3R A;  4JI5 K;  2QTD A;  4H4O A;  4GKJ K;  1NGF A;  3TAN A;  4BVO A;  2BAN A;  5J2M A;  3VQ4 A;  4BC5 A;  5JLF A;  1K73 O;  1XQS C;  3R3L A;  1NGA A;  4DR6 K;  4BGA A;  5AR0 A;  3VQ5 A;  5E26 A;  4CF9 A;  2HW3 A;  2P5O A;  3AVH A;  3NHG A;  1BI4 B;  4JHD B;  3ZT1 A;  3CFO A;  3PV8 A;  1XUP O;  5IT9 O;  4I6M B;  1KFS A;  2O8F B;  3T19 A;  1OH7 A;  2YV0 X;  3C7N B;  1C0G A;  1LW2 A;  5AZI A;  4A61 A;  4CE9 A;  2O8D B;  3O4Q A;  1SUQ A;  4LF5 K;  3FR0 A;  3VQA A;  3FZH A;  5C0Y A;  3M5R A;  3R6M A;  2NUB A;  3H3N O;  4DR4 K;  1JL2 A;  4NCG A;  2D1K A;  2NRW A;  4IO9 L;  2UXC K;  4WCE L;  3SUN A;  1BWF O;  3SQ4 A;  2KLA A;  1ZXO A;  3K5O A;  3QO9 A;  4PKG A;  2Z1J A;  3VQP A;  2QWL A;  4RCH A;  4YY3 K;  4AHT A;  4B1V A;  1ZYQ A;  2LSN A;  3OJS A;  1U2V B;  1HKB A;  4BRQ A;  5LMN K;  1VQ6 N;  4PKH A;  1ZC6 A;  1VQK N;  4N5S A;  3NH0 A;  3ZEU B;  5FPD A;  3BF3 A;  3SQ1 A;  3NGI A;  4FOE A;  4QS8 A;  2E1Y A;  3HJF A;  3CME N;  3B8A X;  3WNE A;  4MFB A;  2V7Z A;  3VF2 A;  2HHQ A;  4AF1 A;  2OPR A;  5CYM A;  3ENH A;  3TTF A;  3EN9 A;  1NJI O;  2IC3 A;  2HF3 A;  1JLF A;  3F5T A;  1L3U A;  1W2B M;  4CK1 A;  2GEL A;  1T05 A;  4X65 K;  4BR9 A;  4B1W B;  3RR8 A;  2XRI A;  4NCB A;  2G8F A;  3CFR A;  1YT3 A;  2HHW A;  4M3Z A;  3TAB A;  1ZBF A;  3CCL N;  3P4I A;  1NU0 A;  5BR9 A;  3SUP A;  1C6V A;  1WNS A;  4BRC A;  4JKE A;  4J8F A;  4DQP A;  4HTU A;  3P83 D;  5BRE A;  5LMU K;  4OVL A;  3KVG A;  4CHN A;  5BPM A;  3SI6 A;  4AHV A;  2BH1 A;  5BPN A;  2QWN A;  1TVR A;  4YOX A;  3VGK A;  3IG1 A;  3C94 A;  4OKK A;  1D9D A;  2RN2 A;  1VHX A;  2RKI A;  3TTC A;  1XHZ A;  3CET A;  3TSP A;  3M8R A;  5AQT A;  3M8P A;  4JI0 K;  4JK9 A;  3CC7 N;  1JCF A;  3RSE A;  1UWB A;  3WUH A;  3OYN A;  4X64 K;  3MDQ A;  5AQJ A;  2ZJR L;  1L3T A;  2UXB K;  4BRF A;  1QHT A;  1QZ5 A;  3LAM A;  1NGC A;  1ASW A;  3TAE A;  2CGJ A;  4BC2 A;  4BC4 A;  4IFY A;  2YHY A;  4GMJ B;  1KAX A;  3B6O A;  3NF7 A;  1T03 A;  4DUZ K;  2VYP A;  4DS4 A;  3QIP A;  3UKR A;  3L2R A;  5LY3 A;  4JAX A;  2FSK A;  1KAY A;  3AAP A;  4OKJ A;  2VWK A;  2G8I A;  2YI1 A;  3N4Q A;  5HRR A;  4JI8 K;  4M42 A;  4DFJ A;  2XY5 A;  3ITH A;  4AM6 A;  4DFP A;  3VF4 A;  2ZQB A;  3PSF A;  3P38 A;  5HP1 A;  4DLE A;  2GBZ A;  3QB0 A;  1SQK A;  4CZG A;  5TKW A;  1A5V A;  1OVY A;  5AQO A;  3DM2 A;  3KLI A;  3VQ6 A;  4KB0 A;  1TKT A;  3CJ7 A;  2DFF A;  4CEZ A;  2ETJ A;  3AVA A;  3LZJ A;  4YDU C;  1KVB A;  3MEC A;  3NF8 A;  3SBG A;  5JIC A;  3PIP L;  2VG5 A;  3AVK A;  4DV5 K;  1LAV A;  1T3V A;  4H5V A;  2KFN A;  3AVC A;  2O8B A;  1BDG A;  1L3S A;  4IFV A;  3ALY A;  3OA9 A;  2JWL A;  1YHQ N;  1X3N A;  4BRG A;  1GLD G;  1S1V A;  5BRD A;  4BRL A;  4DUY K;  3LM2 A;  3TAQ A;  4LF4 K;  3U8X A;  3THW A;  2HHT A;  4CGD A;  5BN8 A;  4HUG A;  2O8E B;  2I5J A;  3T7Z A;  5HRN A;  3CJA A;  4RW9 A;  2YHW A;  1ATR A;  3O80 A;  3ZSV A;  4PL7 A;  4FW1 A;  5C24 A;  1U48 A;  1XMO K;  2XY7 A;  4CFD A;  4FWP A;  4KFB A;  1RTH A;  3W0L A;  4CIG A;  2P9U B;  1HNX K;  3EE8 A;  5KI6 A;  2KKZ A;  2YKN A;  3SK3 A;  4OPJ A;  4YOV A;  4FM0 A;  3ZX2 A;  4DMN A;  3AO3 A;  3EZ5 A;  2HBK A;  4CHZ A;  3D2F B;  3BZC A;  2QA4 N;  4KB1 A;  4KI4 A;  4CCH A;  4F3O A;  5I42 A;  3A5M C;  4C8M A;  3CM6 A;  1TK8 A;  3KKS A;  3QFU A;  1YTA A;  4FJN A;  2DPN A;  3OYA A;  3QDK A;  4JKG B;  2V52 B;  4HUF A;  3WNF A;  4B3S K;  3IMX A;  3VMF B;  4IOX A;  2HHU A;  4JV5 K;  4FLT A;  3H08 A;  3VF6 A;  4JKH A;  2XY8 A;  3PSI A;  5AZJ A;  3PX0 A;  4H03 B;  5TKY A;  1IKX A;  2P9P B;  4FK0 A;  1HPM A;  4OKE A;  1DLO A;  3RMC A;  4IBN A;  3BEX A;  4K8X A;  1NKE A;  1DKG D;  3UE5 A;  3DXM A;  1BG3 A;  5C12 A;  4HTL A;  2JGU A;  4CJP A;  3U6F A;  4A5B A;  3VQC A;  4Z4G A;  2ZJP L;  3OS0 A;  3T1A A;  1LCU A;  3ZCM A;  4CEO A;  1EO1 A;  4NLB A;  2GUP A;  3OYF A;  4CZI A;  4DF8 A;  2CH5 A;  1RDD A;  3SQ0 A;  3VEX A;  4FJX A;  4O0I A;  1W7A A;  3I0R A;  3F73 A;  5AQF A;  2FC0 A;  3NVM A;  1Z25 A;  5CE3 A;  4ICL A;  3VQQ A;  3J7A P;  1RDB A;  4IJA A;  2P9S B;  2GWJ A;  4CIE A;  1KTQ A;  4GV9 A;  3TU5 A;  3ZSW A;  1HKC A;  4N56 A;  4E7J A;  5EU7 A;  3OS1 A;  3CCQ N;  1NGD A;  3VGM A;  1UA0 A;  1FW6 A;  3O9R A;  1KVA A;  2IGI A;  3BF1 A;  1MU2 A;  1XMQ K;  2PYL A;  3VQ7 A;  4CF8 A;  3HO1 A;  4O8K A;  4Z4I A;  1NNE A;  3DRS A;  1CZA N;  1NBW A;  3HVT A;  3AY9 A;  1JLQ A;  3D45 A;  3O3F A;  4FJI A;  2Q1N A;  3FFI A;  4NXM K;  3KZB A;  3WEE B;  1TYQ A;  1ASU A;  2WTU A;  5AQH A;  4A62 A;  2YCH A;  4MLE A;  5KGW A;  3O3H A;  3H45 C;  1NWK A;  1J5E K;  3KWI A;  3G6E N;  1VQ5 N;  2HVH A;  5K14 A;  1RT7 A;  5HRO A;  5KGX A;  1EWQ A;  3QLH A;  1WSG A;  3I33 A;  3TSU A;  1FJG K;  1IG8 A;  1GLF O;  4L8R B;  5KPZ A;  3O8M A;  4ISF A;  4Z0U A;  3CYM A;  3M6G A;  3PO4 A;  1K8K B;  1XC9 A;  4CJU A;  1IO2 A;  4BC3 A;  4DTM A;  1ZBU A;  2B6A A;  4MLH A;  3MEE A;  2O4I A; 
#chains in the Genus database with same CATH homology
 3OTO K;  5LMU K;  4DR6 K;  4DUY K;  4LF4 K;  5A2Q O;  4B3T K;  4DV3 K;  2UU9 K;  5IT9 O;  4DV2 K;  1XNR K;  4OX9 K;  3J81 O;  3J80 O;  5IWA K;  5BR8 K;  4LF5 K;  1HNW K;  1XMO K;  4JI3 K;  4DV1 K;  4DV4 K;  1IBM K;  4JI0 K;  1N32 K;  3J7A P;  4DR4 K;  4DV0 K;  4JYA K;  4DV7 K;  2UXC K;  4NXN K;  1HNX K;  1N36 K;  3J7Y P;  4X64 K;  4K0K K;  4B3R K;  4LFA K;  4LF7 K;  4JI6 K;  2UXB K;  1XMQ K;  4YY3 K;  1HR0 K;  3T1Y K;  1IBK K;  4LF8 K;  4CW7 B;  5LMN K;  2HHH K;  3JAM O;  2VQE K;  5AJ3 K;  4DUZ K;  4LF9 K;  4KHP K;  4NXM K;  4DR5 K;  2UUA K;  4B3M K;  4JI8 K;  4JI4 K;  4DR7 K;  4AQY K;  4B3S K;  2UUC K;  1N33 K;  4LF6 K;  4LFC K;  4DR2 K;  4LFB K;  4JV5 K;  4CVN E;  1J5E K;  2ZM6 K;  4YHH K;  4JI2 K;  1XNQ K;  5LL6 Z;  4JI7 K;  1I94 K;  2E5L K;  4V19 S;  1IBL K;  4X65 K;  2VQF K;  4X62 K;  1FJG K;  3T1H K;  4GKK K;  2UXD K;  2F4V K;  5FLX O;  4DV5 K;  4DV6 K;  4JI1 K;  4X66 K;  4JI5 K;  4DR3 K;  2UUB K;  4GKJ K;  1HNZ K;  4DR1 K;  1N34 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...