5M1FA

Crystal structure of the large terminase nuclease from thermophilic phage g20c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
186
Chain Sequence
MNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 61
structure length 186
sequence length 187
ec nomenclature
pdb deposition date 2016-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17289 Terminase_6C Terminase RNaseH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1fA00
3C6AA 3C6HA 5C2FA 5M1NA 4IFEA 5C10A 5M1FA 3CPEA 4IEIA 4IEEA 5M1QA 5C15A 5C2DA 5M1KA 5M1PA 5M1OA 5C12A 4IDHA
chains in the Genus database with same CATH superfamily
5FPNA 3AVNA 4DSJA 3CC2N 3S3NA 1YAGA 3QBXA 2GWKA 4PKHA 3SBTA 3F9MA 3A8YA 2E2QA 5JLFA 3SAHA 1RT5A 4DHYA 2O8FA 3J7ZO 4RW6A 4DS5A 4NXNK 3QETA 3O8MA 2XHBA 1S5JA 1ZBIA 3V9ZA 4DSKA 1JXEA 3SYZA 2UUBK 2E1ZA 2ZD1A 3C6TA 3I8BA 3LPTA 3DLRA 4AM6A 5JS2A 4CHQA 2ITGA 2D0AA 3FGUA 4BC3A 3O9SA 4CD3A 2V7YA 4DCHA 2YNIA 3MK6A 1R59O 5CZ2A 2HNYA 1NGIA 2OPPA 3NHGA 4BRDA 2HNZA 3GDQA 5AQNA 1MWKA 1ZBHA 4MLEA 4BR5A 3MN5A 3K58A 3S3OA 3HM9A 2G8IA 1LWFA 3VEZA 2P9UA 1TK5A 4FWOA 1L3SA 4DLEA 3O9RA 4YFUA 2UXCK 4CJUA 3VMFB 1BO5O 4CGGA 5HL7L 2ZJPL 1RT6A 4IFEA 1IBMK 4LY7A 3TAPA 4B9VA 3DMJA 3NH0A 2W41A 3CM6A 4R5PA 5GAGP 1YF5L 4ZHRA 1W7AA 2OTLN 1IG9A 4CEZA 4FJGA 1TUYA 4JYAK 3QB0A 4BG9A 5HLFA 1VQKN 4M3ZA 3RMBA 4BREA 1JJ2M 3VETA 1HQUA 3SUQA 4FWMA 3R8EA 1VQPN 2P9IA 2FSNA 1FXXA 3OYEA 4FLXA 1YJ9N 2I7PA 2F96A 4A5AA 3DM2A 4CFDA 1VHXA 4CZGA 4CZKA 5CYMA 3ID6A 4CGFA 5DK5A 5C2FA 1N33K 1TAUA 4TSXA 4PHTX 3P31A 2OPQA 1HLUA 1EETA 2NRZA 5E26A 3LZIA 5D3GA 2VGMA 4AHSA 5E41A 2G8UA 2D0CA 4X66K 4BR4A 4DTUA 1WB9A 5J2QA 3BUZB 3QFUA 4JK8A 1OVYA 3SUPA 1TKDA 5AFUA 3SBGA 3CM5A 1DLOA 4PL7A 4AF1A 3BZCA 3VGLA 3L4IA 3VQPA 2WFBA 2IVOA 1C0MA 3V1OA 4BRKA 3SAGA 3QERA 2HMPA 4CEOA 1NKEA 3FZHA 1X9SA 1VQ9N 1QSLA 4FSVA 4YORA 2KFZA 3ULEB 1HX1A 3ZSXA 5AQZA 3NAEA 3WXMB 2DPNA 4H5NA 1NNEA 4CF9A 1KLNA 1N36K 2E2NA 1JL1A 3I55N 4OGCA 4E1NA 4DTXA 3THXA 3OYAA 4M63C 3TTFA 3BF1A 3K9KA 3SJHA 1EQYA 5HROA 1LW0A 4CJWA 4BE0A 1QZ6A 2O4IA 4KBOA 3SAFA 4CECA 2NNWA 4B3TK 4BC5A 3ZSYA 2QXFA 5H1SQ 3SUOA 5ADXA 1GLDG 3CCQN 1TVRA 3SV4A 4KH6A 4J2AA 3S41A 1GLFO 3GBTA 1RBTA 2Z1GA 4CJQA 5I9EB 4DSIA 1NKBA 1LAWA 3O9UA 4DQIA 4KH5A 2IDOA 4NLCA 3SMPA 4LF9K 3D2EA 5C12A 3E01A 4GW6A 2YI1A 3L8BA 2PYLA 1BL3A 5KTQA 5C10A 2G8KA 4NYFA 3WNFA 5J2MA 4E7JA 1T6CA 3U4LA 3KKRA 3D45A 4W5NA 4LH5A 1SL2A 3RTVA 4C8LA 4I9QA 1ATNA 3SQ4A 2F8TA 4HTUA 1S6QA 1R0AA 5KRSA 3AA2A 4CZMA 3JAMO 4B1ZA 3QESA 2YKNA 1KC8O 1KLMA 4B1VA 4U67L 4LFAK 4K8XA 4FPBA 5JVGL 2QWOA 5AQGA 3OYIA 3AO4A 3VQAA 4YHHK 5KQ8A 4J8FA 3NBPA 4KI4A 4CZJA 1Y97A 3BDPA 4KH4A 2GV9A 4JNEA 2O8BB 4WQ5C 1NGDA 3CCJN 4H0XB 3LL3A 1Q82O 4MDBA 1WNSA 2Q97A 3MN7A 3A5NC 3F9KA 1K9MO 1J6ZA 1C1CA 2VG6A 2YHWA 4FOIA 4JN4A 5BPLA 1A5WA 4GV9A 1RDAA 1NKCA 4A2BA 1HRHA 4AM7A 3DOKA 4ELTA 5EU7A 1U49A 3EN9A 4B9SA 3KK7A 2BGGA 4IDHA 3VGMA 2GUIA 4X65K 1LV5A 4BR7A 4N41A 1MWMA 3CJ1A 1RNHA 3NE6A 3QINA 3QFPA 3KK2A 4FLUA 3ZX2A 1OH6A 1S1WA 3GL1A 4UQGA 2ZE2A 4OVLA 4EAHD 3TTDA 5JMVA 3LPUA 4E7IA 1S72N 4CGJA 2CGKA 3NGIA 1NBWA 4KHUA 4JK7A 3ENBA 1E4GT 4XEIA 3HVTA 3DRPA 5AQRA 3LP0A 3HSCA 5HRSA 1L3TA 3ENHA 1B9DA 1QQCA 5M1PA 3HBTA 3V6DA 5AQUA 3AV9A 3EKSA 1JLQA 3U3YA 1Q86O 4M41A 4CFBA 5JLHA 1BCMA 3MWPA 3KD5E 4N76A 4FJ7A 3CMAN 3JYTA 2FBTA 3VA0A 2E6LA 2X78A 3QNOA 4KHYA 1GLBG 3HT3A 2E2OA 4FLZA 3NDKA 3VTIA 5EY4A 2Y1JA 4FZXC 3DXKB 2QTDA 4K8ZA 3DI6A 3HPGA 1I39A 4OKKA 3MAQA 4JD2B 3V1RA 1U04A 2VG5A 1NOYA 1IH7A 3ZT3A 1K73O 3ZSOA 2O8FB 4OKEA 2AP1A 1ZBUA 3EZWA 3SQ2A 3ULEA 4MFBA 2UU9K 1N6QA 1KRPA 1NU0A 5M1QA 4JKEA 2P5OA 1U48A 4CHYA 2QM1A 1QQMA 3LP2A 4B1WB 1S9EA 3FE1A 4HWIA 2KQ2A 2O8CB 3VEWA 1CXQA 2GX9A 4H03B 4CZLA 1NJWA 3LDLA 1NJIO 4RW9A 3SLCA 3OYLA 2E4LA 4KO0A 5M1OA 4FWRA 1EWRA 4H4OA 3H1VX 5C2DA 1DTQA 4DR1K 4CVNE 3PX6A 3CC4N 2O8EB 1WUAA 3PIPL 1UA0A 5B8HA 3ZT0A 3M1FA 1VSKA 1HYSA 2P9NB 2RPIA 1O13A 3C6AA 1C1AA 4BRCA 1EX4A 1G15A 1P90A 4FVUA 1S9GA 1VQON 4DV1K 3TSUA 3EKUA 2WUSA 3AVFA 1RT4A 1P8ZA 5J1EA 1NLVA 4GKKK 1KAZA 3E9OA 1RDCA 1V4SA 1MA9B 3V9XA 3K5MA 4WCEL 4C8NA 1WSGA 4AHTA 4LSLA 4O44A 1OH7A 4FZZA 5KRTA 1VSHA 1T05A 1VK0A 1TAQA 3K0SA 5J2PA 1K8AO 3V9SA 3U6FA 4KFBA 3O4NA 3G25A 1DEJA 4IDKA 4CBUA 1ILYA 3DLBA 4FLWA 4BC2A 4H0TB 3AVJA 4YDUA 1VSMA 3KLFA 4IJAA 4FL9A 4OPJA 5BR9A 4IO9L 1I94K 2YHXA 4CF0A 3T7ZA 4CJ4A 1N34K 4V19S 4IEEA 4PQUA 5C24A 2O8BA 2PFUA 4DS4A 4B8AB 3VPZA 1REVA 4O0IA 2ZJRL 1VQ8N 3MMVA 4C1NK 3CCSN 4LF8K 4CGHA 4RWTA 4AHCA 3CJ9A 2A40A 3VEYA 1S1TA 3RR8A 1UOCA 1TKTA 1KVCA 4YOXA 1EP4A 1FKPA 2PBDA 2IS3A 3LM9A 5AQLA 4KHQA 1VQMN 1HYVA 3CFOA 2ZWHA 4X62K 2P1JA 3TTCA 3DLKA 2ATQA 1RDDA 3DLHA 5AQVA 1BUPA 5AJ3K 2IVNA 3RMAA 2D0BA 3HYFA 2QWPA 4RG8A 1BIZA 3AGRA 2OTJN 4NLBA 4DLGA 4CGDA 3EO3A 4AHVA 2HOEA 4H5VA 3VOVA 2FXUA 4CJRA 2R7YA 2GEMA 4KB1A 3ENOA 4G1QA 2Q31A 3VQ5A 2P51A 3KK1A 4BG8A 3MCPA 3TARA 3OHRA 3LAKA 5EOYA 2XY5A 4CJTA 5HOOA 3WXIA 1FJGK 4IOAL 3THYA 2O8DB 3DJCA 2QI2A 4IBNA 4E89A 5K14A 4BGBA 1JKHA 3AA4A 1NK9A 1CZ9A 1NG9A 2NUBA 1ATRA 5LJWA 2OPSA 2HBKA 4H5WA 3CJ7A 4CEEA 3L4QA 3SQ0A 1QSSA 1QVFM 1WBBA 2ASPA 3MCAB 4W5TA 3CFRA 3LP1A 4K25A 5AZIB 3DXKA 4DQSA 4DR7K 4JD2A 1CZBA 1IG8A 1WSIA 3A2FA 4H5RA 4OPHA 3GOIA 2WBNA 1BGXT 2DFEA 2YNGA 4FLTA 3Q7CA 3OYGA 1UWBA 3ZYYX 3FLCO 4F2RA 3EE9A 1VRUA 3OVNA 4DSEA 3LZJA 1D8YA 5AQTA 5GIPA 1NMDA 3IDHA 2HHHK 3TU5A 2VWJA 2O8CA 5CE3A 2D4WA 4WFBL 2KFNA 3HO1A 1TYQB 3B8AX 3O4WA 4G9ZA 3BZKA 2OZMA 2BUPA 4JV5K 1KTQA 3CHWA 1HNVA 4Y0WA 3TAGA 2HVHA 4JI3K 3WUHA 3NVKA 3VEVA 3KZBA 5JS1A 3TSPA 3G10A 2O8EA 3VEOA 4H0YB 3T1AA 3G0ZA 5TKWA 4B1YB 4XIUA 4EFHA 1GOCA 2FBXA 2P9NA 3O1BA 2NZTA 4CZIA 3LDSA 1WOQA 4KPYA 3VA3A 1JLBA 3OA9A 3NVMA 3OYNA 4LF4K 4K43A 3DLLL 3TABA 4ILGB 3O9QA 4DFJA 3RR7A 1SAZA 1SL0A 4CHZA 1RT7A 3SMSA 3A5MC 3WXJA 3KKSA 3ZLJA 3TANA 4JKAA 5KPZA 4FO0A 3VEXA 4Y1DA 3J80O 3EY1A 3PLAA 4BRQA 4I2PA 2A1SA 3J81O 4IJNA 4FJKA 4DSLA 3I33A 3PO4A 3IKMA 5M1NA 3EZ5A 1YI2N 3OTOK 2QKKA 1C0UA 2W40A 4BACA 2Q2RA 4WE1A 1F21A 1G99A 3PY8A 1VQ7N 3H08A 3OS1A 3RSEA 1VAZA 4FM2A 3AO2A 2OANA 3OYDA 1IKXA 1ASWA 3L2UA 1YITN 3H3OB 5LY3A 3P5JA 2G8WA 4Z0UA 2ASOA 2XY7A 1LCUA 3AO1A 5HRNA 4FJLA 4K41A 5AZJB 3TWHA 4CD1A 4PUOA 1Y64A 1RBUA 3D2FB 4WFAL 3OS0A 1XMOK 4CHOA 2RHKA 3H6EA 2J4RA 1WSFA 2HHWA 1RTIA 3NMUA 2B4JA 5BRDA 4YOTA 4CK1A 4LC9B 1RDUA 2HHSA 4JI5K 2QW9A 3AVKA 4A5BA 3WNGA 1NJXA 1NGGA 1HUXA 3KVGA 4JI6K 2QWQA 4NYNA 1U6ZA 1X9WA 3T3FA 1QHTA 4DTRA 3WNEA 4M7YA 4KHWA 1YXQA 1U47A 3MEDA 1RDBA 2JGUA 1VQ5N 2NRHA 4I2QA 3LDOA 3CQXA 2ZJQL 3HOSA 1VQ4N 5FDLA 1L5UA 3O08A 1JXBA 1CLQA 4J2EA 1DKGD 4IWVA 4DQQA 2IOCA 4M42A 2D5RA 1YTAA 2FBVA 3CJBA 3LANA 4Z94A 4DG1A 3CMEN 1QQOA 4O4GA 4B9UA 4BVOA 2Q36A 1EXQA 1B9FA 2D0PA 4E3SA 4LF6K 5A2QO 3LM2A 4BRNA 4WQ4A 1KFDA 3C7NA 3WNHA 1VRTA 1ITGA 5BREA 4OO1J 4JK9A 5EVZA 2W42A 3NGYA 3VQ8A 5AQQA 4DUZK 2O8DA 3SNNA 1RT3A 1K8KB 1B92A 1RBSA 3ZETB 1XHZA 1ASUA 2AA4A 5IWAK 1IJJA 1LOTB 3ATVA 1JCFA 1JL2A 4FWPA 4IG0A 5CY4A 1UA1A 2G8HA 1N32K 2BTFA 4W5QA 4HCBA 4DFMA 5AZIA 2OZSA 1BISA 4CIGA 3C6UA 4CFAA 2NRVA 4XH1A 2P5GA 4M3RA 3DXMB 1WSJA 1J53A 2XY8A 3HPHA 3LDPA 2RKIA 3NH2A 1S1XA 1SKSA 3DOLA 2VQEK 1U45A 4ID1A 4BR0A 4CZHA 2OCEA 1RDWX 4O55A 1TYQA 1LAVA 2X6SA 3TAMA 4CE9A 5BPMA 2HBJA 2ASMA 5KPRA 4DTJA 2VCPA 4LSNA 2BDPA 4YY3K 2Z1IA 4ILHA 5AQIA 5I42A 2QWNA 1WBDA 2XY6A 1TK0A 5GINA 2PAVA 5C42A 4GV6A 3RRHA 4M45A 1SKWA 4CERA 1KAYA 3M5RA 3P4IA 1S6PA 4NCAA 1RTJA 1S3XA 3N4PA 2HHVA 3FZLA 1ZBLA 3AVCA 4FWSA 4CBXA 1Z6RA 3U8XA 3O1WA 4W5RA 4DU1A 4FLVA 3RRGA 5BR8K 3PIOL 4F4KA 3AA5X 4W5OA 1WAJA 2FSJA 4B9LA 2IVPA 5AQYA 1ESVA 3NFAA 5AQHA 4CZFA 3TAEA 4NXMK 2VQFK 1XC3A 4FWQA 4DTMA 4Q0BA 4A62A 5C25A 4DTPA 3ZT4A 1J54A 5CZ1A 4OLBA 1C0GA 5AQJA 3WQUA 3CCRN 2FSKA 5EXWA 4U7BA 3H1QA 3V9UA 4FJ9A 5T7BA 4FK2A 4Q5VA 3CG7A 4KREA 3KTQA 1IO2A 4QS8A 4CHPA 3AO3A 4JS5A 3TPQA 4OX9K 1TKZA 4JI1K 4JKGB 3O80A 4C8MA 4CIFA 1Z25A 1T7PA 3A5OC 5FPEA 3ALYA 1HYZA 5HP1A 3THYB 4QS7A 1GLCG 3OJSA 5AZJA 4JKHA 3AARA 3D2FA 3CCVN 2E88A 1KSPA 4CJVA 3QEVA 1RGIA 4CIEA 1HR0K 4GMJB 4DU4A 4X64K 4RCHA 3M8RA 3L3VA 3QNNA 4FWNA 2KZZA 3MEGA 2VYPA 2QK9A 3PO5A 3CCMN 1VSLA 1RCHA 4FVMA 3C95A 3AAQA 4JI7K 4CF8A 4EZ6A 1BQMA 1VSEA 4JKFA 1ATSA 1TV6A 2D0OA 4A2AA 3VTHA 5ELZA 1X3NA 4FW1A 3MXJA 2FLOA 3ZSRA 1XNRK 1JLCA 4CJSA 3VENA 3FFIA 3MDQA 3B6PA 1SQKA 3HL8A 2KLAA 3IG1A 4BRAA 1BOTO 2AJQA 3PX0A 3M8QA 4KV8A 1X9MA 2A3ZA 1YJNN 4CF2A 4F8RA 3HXMA 1SS6A 3HP9A 2FBYA 3ZEUB 1SL1A 4CZEA 3P83D 4L3QA 1RTDA 2A5XA 1Q81O 3ZSQA 4DMNA 4I6MB 3VQEA 3KHYA 4KB0A 3BGRA 4OPKA 1NK6A 1XNQK 3G71N 3L2QA 4LF7K 4HVJA 1NOZA 3JSMA 2CGJA 2LSNA 3QLHA 3VF6A 4LH4A 3GE1A 1CZAN 1K8KA 4IG3A 4JAXA 2PZSA 3MXMA 3MECA 3ZETA 2B5JA 3HM8A 2E8AA 1NGHA 3L2WA 4GVMA 1NGFA 3BF3A 5MLCQ 4IOCL 1GLLO 5FROA 2FF6A 1W2BM 1QTMA 1HKCA 4HCCA 3J7YP 3FR0A 2A6AA 1HQEA 3SPZA 2X74A 1OH5A 4AILC 1EWQA 4CF1A 4FOEA 3VF2A 1O1WA 1E4FT 3NF8A 3QDKA 3IS9A 1JLFA 4PA1A 4YOWA 2ZGZA 3DXMA 3ZSVA 1GLJO 5F1XA 4FWKA 2BE2A 4KHNA 4BRFA 2A1RA 3J7AP 1J9AA 4CFCA 3RSEB 1WSEA 2ZM6K 3JS6A 1QSYA 2JLEA 3QEWA 5M1KA 1DGKN 4BRPA 4FCYA 3ZX0A 1LWCA 4DSFA 4M3TA 2EWSA 3NF9A 3D6RA 2F9WA 4QOZB 4IOXA 4C1NI 1XUPO 4M3UA 1NGJA 4GVEA 2QXLA 4DR6K 2VWBA 4BRLA 2NLXA 4JHDA 1NGBA 1SZ2A 4IFYA 3HPOA 5I3UA 1QS4A 2YJFA 4DB3A 1VSIA 3V1QA 4CW7B 3VQDA 1IKYA 3V81A 3AVLA 3K5OA 4MDAA 4CBWA 3T19A 3LWMA 3QBWA 1N5YA 4Z4GA 4BE2A 4IZ9A 2EHGA 4HUFA 3NF6A 3SI6A 1HNXK 3KJVA 1NGCA 1NWKA 4ELVA 1FK9A 2DY4A 3C6HA 4BE1A 3GG4A 1ZC6A 3FZMA 1D5AA 1VQ6N 2UXDK 3RVCA 4WQ5A 4WFNL 1JLEA 4WYBA 5LMNK 2DTUA 1TUUA 4FM1A 4FJNA 2IIRA 1XC9A 2EX3A 4EZ9A 5DM7L 1KXPA 2NRWA 1HKBA 2HW3A 1T03A 4XH4A 4CJ3A 5KPTA 3CF5L 3TSQA 4B3SK 3TAQA 3I8DA 1FW6A 4BRHA 3C7NB 4JKGA 2FF3B 2YNHA 1HKGA 1X9JA 4BQZA 4CHNA 3THVA 3CPEA 1HNZK 2Q0UA 2WONA 1I3AA 5J2NA 1NGEA 4PL8A 3TAFA 1M1KO 4IFVA 2Z1HA 4RW7A 4CEAA 4DV6K 4F3TA 3AVGA 4H8KA 5AR0A 3AO5A 4CEQA 4GNIA 1NK4A 4LFCK 1JLAA 3J8AA 4NO7A 2JWKA 1DTTA 1BA1A 3S9HA 1IKVA 4BRIA 2UYTA 3T1YK 1S1VA 5CR4A 4C8KA 1D4XA 3U9ZA 4BRGA 4FK4A 1YT3A 3I0RA 4A59A 1XMQK 3G4SN 3U9DA 4B1XB 2QEXN 4BWMA 4E7LA 4IKFA 3BY5A 4ZTJA 2UUAK 4O8KA 1JLGA 3PV8A 2E20A 3CC7N 3D7EO 4R79A 3T1HK 2YHAA 3D0PA 4CJPA 5C0YA 5HRPA 1TL3A 1RT1A 1HNWK 5LMUK 2GTDA 3VQ7A 3ZEUA 2KZMA 3NGZA 4DKWA 3QEXA 3LAMA 3BEXA 2P9PA 4I6MA 4CEFA 1XQSC 2QA4N 1A5VA 4DR4K 1NM1A 1BU6O 2YKMA 2I5JA 4JS4A 5HBMA 1W0HA 1FKOA 3O3GA 3M8PA 4OPAA 4YOUA 3UKRB 2E6MA 3N4QA 3CD6N 2ITMA 1QE1A 2OA8A 1HMVA 3O5BA 5BN8A 1W9HA 3QICA 5FRNA 4FJ8A 4H0PA 1VQLN 1Q9XA 4CCHA 5M1FA 5FPDA 3CERA 2Q1NA 2I7NA 3E9LA 3ULDA 3CJCA 4PY5A 3VQCA 3P1GA 3HVRA 4K42A 3VQ9A 4MLHA 3JXUA 5LL6Z 3R9PA 3LWLA 4FWLA 2WOMA 3ZCMA 4FXDA 3CI5A 1S22A 1BQNA 2RE2A 5KI6A 3CCEN 4LF5K 2V7ZA 3LALA 1CXUA 3DLGA 3CQ8A 1HPMA 1KVBA 1VSJA 3A0IX 3MEEA 1IV0A 1DT9A 3DRRA 2V51B 4CK2A 1W97L 4HTLA 1YVNA 1QVGM 4DFKA 4IO8A 4NCGA 3HK2A 2WTUA 4EHTA 3K2PA 5KGWA 1EO1A 4BY9C 3H46O 2IC3A 3HI0A 3K5NA 4FJIA 4MQ3A 3WQTA 4JI8K 5AQOA 3ZSZA 3K5LA 3Q7BA 2BH1A 3HTVA 3OS2A 2HB5A 1Q9YA 1OKJA 1KQSM 1KAXA 3VQ4A 3OY9A 1K6YA 2FC0A 2YNFA 4O5FA 3ISNC 4QAGA 2V52B 3HJFA 5BN9A 3IMXA 4CK3A 3IFRA 1WLJA 1S1UA 2GBZA 4DFPA 1YHQN 1C0TA 5GAEP 3R1XA 4B8CA 2F7TA 1BDGA 3FFKB 5GIOA 4C23A 3WEEB 1NMNA 3I0SA 3TI0A 2E2PA 3VERA 3CPWM 4FJXA 3MX5A 1Q8IA 2KKZA 4H4MA 5E84A 3ASMA 3S3MA 2D1KA 2P9LB 1YIJN 5BRFA 3QEPA 4ISGA 1NJZA 2BANA 3G6EN 4DTOA 4FYDA 3M3ZA 4DV2K 4E7KA 3RMCA 1U2VB 2QWMA 1BIUA 5EX5A 3NH1A 4OGEA 4DWIA 4EP5A 1KFSA 5FRMA 2X6NA 3SJJA 4M3WA 3KLGA 2YCHA 4DUYK 3HP6A 4B3RK 2CGLA 4DV7K 1BA0A 1NJYA 4KRFA 2HSTA 1ZBFA 4WF9L 4HHTA 3VESA 3VGKA 2PYJA 4B3MK 4PKGA 3KD1E 1YTUA 1J5EK 1BCOA 1XHXA 2QWLA 1X3MA 1D9FA 3HSTB 3QIPA 4O5BA 2VWKA 3OBYA 2HHTA 3HOTA 3BP8A 3KLIA 4O8UA 1IKWA 4YDUC 4DR5K 3CCUN 2KTQA 3ITHA 2W6KA 4JI4K 3OYMA 2IAJA 1QQNA 3HZ6A 3P38A 3AAPA 3IAYA 1LW2A 1Q18A 3QIOA 4NCBA 4JEPA 2HBMA 3E9PA 5AQKA 4CJFA 4IXCA 3OJUA 2HHQA 2XO7A 1J5OA 4Z4CA 4CEDA 4ID5A 1IBLK 3WXLA 3CJAA 1C0FA 1KCFA 2YX6A 2Q3SA 2KHOA 3UE5A 4CI6A 1YVUA 3AVBA 1YJWN 5TKYA 4BC4A 3OYBA 1JCGA 3CCLN 3MWTA 3MX2A 4BDYA 2GWJA 2GUPA 4JKBA 1TGOA 2YHBA 1N8RO 5KQDA 4JRPA 3THWB 1UAXA 1HNIA 1BI4B 3UB5A 1NK5A 4H0VB 2A41A 4JHDB 1L3VA 4FK0A 5DMRA 1OH8A 4KTZA 1X1PA 1LWEA 1HJRA 3UKRA 4DU3A 1NK8A 2P9KB 1RTHA 3CETA 3EYZA 3KWGA 3KLEA 3C65A 1BHLA 1RBVA 3CIPA 2VGNA 1NGAA 1TL1A 4F2SA 1TK8A 4KTQA 4KHSA 1MU2A 3EE8A 5AQSA 3AVAA 5GADP 4BDPA 3F2KA 4BR2A 3LDQA 4H5TA 4AQYK 3SZ2A 3K59A 1VQNN 1H1VA 3CQYA 2Q0RA 4DV3K 2F9TA 4DR3K 1ASVA 3K57A 1L3UA 1EKEA 4BRMA 4E7HA 2YJEA 3IRXA 2W6LA 4ISFA 4M3XA 4O0JA 3F73A 3O3FA 3MXIA 4CJ5A 4B08A 4JI0K 3ZT2A 4E19A 4M7XA 3AVMA 1C6VA 1Z26A 2Y1IA 4F3OA 5BPNA 4JI2K 3P39A 3OYKA 4QS9A 1OVQA 4CESA 4OKJA 4KHPK 1GLAG 2CH5A 3V4IA 2HF3A 3IUCA 2P9SB 4FPAA 3M8SA 4CJLA 3WT0A 4K0KK 4B9MA 2HBLA 4A57A 1Z05A 1NK7A 4B3OA 3NCIA 5AQWA 2A42A 4MO5A 1QHAA 3DYAA 2HHXA 1KVAA 5AQXA 1E3MA 1YUWA 3QO9A 1M90O 3SCXA 4E1JA 3WXKA 3PSFA 4JLHA 4ILJA 3I56N 2UUCK 2H3GX 3OW2M 3UKUB 3OYFA 4B9TA 3L3UA 4BDZA 2B6AA 4JKDA 3RMDA 1U4BA 4AHUA 3FZKA 3AVHA 3L2RA 2YV0X 5JVHL 4DTNA 4Z4FA 4L8RB 4YNQA 1GOAA 4ZTFA 4NB4A 3SV3A 2E5LK 4C8OA 4B1UB 2HHUA 1RILA 3OBWA 3WEEA 5C15A 1QZ5A 4DQRA 1SUQA 1T3VA 3H45C 5LJVA 3SQ1A 3VQQA 4BR9A 4DQ8A 2P9LA 2RN2A 4LFBK 5BRHA 2QWRA 3AGKA 2P9PB 4YOYA 1NK0A 4ICLA 2DFFA 4CJ7A 1VSFA 3KIOA 4OJRA 1VSDA 4B9QA 2YHYA 1U2VA 3HRGA 2UXBK 5HRRA 4CJKA 4I7FA 4JRQA 4FJJA 2HMIA 4N47A 3PUFA 3E66A 3LDNA 3A5LC 3R3LA 2IGIA 4CGIA 4RW4A 3FZFA 5F2RA 5AQMA 3PX4A 4KTWA 4EIAA 5AQPA 4N5SA 3ZX3A 4YOVA 1HPZA 4RW8A 1XI1A 3CFPA 1WSHA 2P9UB 5SZTA 4BROA 4JKCA 1T6DA 4A61A 4CEBA 3VF4A 4UY8O 1XWLA 4LD0A 3AY9A 2NRXA 2NRTA 4BGAA 4HUGA 4J2BA 3ATUA 1SKRA 1RBRA 3EEQA 3B6OA 3O6WA 5KGXA 1JCEA 3PSIA 4KAZA 1TKXA 5DM6L 3CYMA 2ZQBA 2XRIA 2OPRA 1SV5A 3H3NO 3K9JA 3QMLA 4DF8A 1Q7YO 2JWLA 3KLHA 1ZYQA 4KKOA 1BWFO 2G8FA 4B9NA 3C94A 2PY5A 2HF4A 3TR8A 3OYHA 2F8SA 1GOBA 1HJOA 1BG3A 4OLAA 3QEIA 1D9DA 4Z4IA 2P9IB 4PKIA 4EHUA 4DV4K 5AFUH 4MO4A 4F9OA 3THWA 1C1BA 3UIQA 4FM0A 2E1YA 1BI4A 3MN6A 2G8VA 1A5XA 3L2VA 3SK3A 3DRSA 3R6MA 3O3HA 4Y1CA 4DTSA 2P9KA 3O9TA 5FLXO 3KK3A 1ZBSA 4E1MA 3ID8A 4BWJA 4FJMA 2DFHA 4J2DA 3E1YA 4EP4A 4AHRA 1T8EA 5IT9O 2HVIA 2O4GA 4WQ4C 1V4TA 3U3GA 3NF7A 3W0LA 1WAFA 2Z1JA 1T44A 4ELUA 3L6QA 5SWMA 3KWIA 2ZGYA 3SUNA 2QKBA 4BVPA 5AQFA 4DR2K 4PWDA 4XH5A 5ADXH 4I9LA 5CYQA 3SPYA 4FJ5A 4GY2B 2ZF5O 4Z4EA 3O4QA 1WN7A 2GELA 3VQ6A 4HUEA 5JICA 4FZYA 3THXB 1ZXOA 5GAHP 5F0XA 2F4VK 2ETJA 3LP3A 4FLYA 1RFQA 3MN9A 3OYCA 2VG7A 4QCLA 2NRRA 2P9SA 3F5TA 3DAWA 2RF2A 3C0BA 4N56A 3VQBA 1IBKK 2KW4A 5FPMA 4AH9A 3EL2A 5CHIA 4FW2A 3L0QA 3RWUA 4KI6A 3OYJA 1MDUB 1GLEG 4IEIA 4GKJK 3M6GA 4DQPA 4CJEA 1KD1O 4ISEA 4GV3A 4BQLA 4FJHA 1RT2A 3D2EB 2WC9A 4DV5K 3AVIA 3W3DA 3UKUA 3V9WA 4E0DA 4RTFD 3ZSWA 4DV0K 3CXCM 4M3YA 2OYQA 4H0OA 3T69A 4DF4A 3ZT1A 3VN5A 2HNDA 2CH6A 3AA3A 4Z4HA 3DWLA 3DLEA
chains in the Genus database with same CATH topology
5FPNA 3CC2N 1XC3A 3IFRA 4FWQA 1YAGA 3QBXA 2GWKA 4PKHA 4A62A 3SBTA 3F9MA 1YHQN 3A8YA 5GAEP 1C0GA 3R1XA 5AQJA 2E2QA 2F7TA 2FSKA 3WQUA 5JLFA 3SAHA 3CCRN 1BDGA 5EXWA 3FFKB 4U7BA 5GIOA 3H1QA 4C23A 3WEEB 4DHYA 3J7ZO 1K8AO 2E2PA 3VERA 3CPWM 3MX5A 2KKZA 3G25A 3O8MA 1DEJA 4QS8A 5E84A 4CBUA 1ILYA 2D1KA 2P9LB 1YIJN 5BRFA 3TPQA 4BC2A 4H0TB 4ISGA 2E1ZA 4YDUA 4IJAA 3I8BA 4JKGB 3O80A 3G6EN 4FL9A 3M3ZA 4AM6A 5BR9A 3A5OC 4IO9L 1U2VB 2QWMA 3FGUA 5EX5A 2YHXA 4BC3A 5FPEA 3O9SA 4QS7A 1GLCG 3T7ZA 4CD3A 2V7YA 4DCHA 5AZJA 4JKHA 3AARA 3MK6A 1R59O 2YCHA 4IEEA 2CGLA 1NGIA 3D2FA 2PFUA 3CCVN 2E88A 1BA0A 4BRDA 3GDQA 1RGIA 5AQNA 1MWKA 2HSTA 3VPZA 4WF9L 3VESA 3VGKA 4RCHA 4MLEA 4PKGA 4BR5A 3MN5A 2ZJRL 1VQ8N 3MMVA 4C1NK 4FWNA 2QWLA 3CCSN 3VEZA 2P9UA 4RWTA 3OBYA 3CJ9A 2A40A 4FWOA 3VEYA 2VYPA 3HOTA 3BP8A 4O8UA 3O9RA 3CCMN 4YDUC 3CCUN 4YOXA 2PBDA 3HZ6A 1QQNA 3P38A 3AAPA 3AAQA 3VMFB 1BO5O 5HL7L 2ZJPL 1Q18A 3LM9A 4JEPA 4JKFA 2HBMA 5AQLA 1ATSA 3E9PA 2D0OA 5AQKA 4A2AA 1VQMN 4IFEA 3VTHA 5ELZA 1X3NA 2ZWHA 4IXCA 2FLOA 3TTCA 2W41A 3VENA 3MDQA 5GAGP 1SQKA 1YF5L 2OTLN 5AQVA 1BUPA 2IVNA 2KLAA 1TUYA 3WXLA 3CJAA 1C0FA 3QB0A 2QWPA 4BG9A 4BRAA 1VQKN 2YX6A 3AGRA 2OTJN 1BOTO 4NLBA 4BREA 2KHOA 3UE5A 1JJ2M 4CI6A 3VETA 3EO3A 2A3ZA 2HOEA 4FWMA 4H5VA 3VOVA 2FXUA 1YJWN 1YJNN 5TKYA 4BC4A 3CCLN 1JCGA 2GEMA 3R8EA 3MWTA 2P9IA 1SS6A 3ENOA 2FSNA 2GWJA 3MX2A 1VQPN 2GUPA 3ZEUB 2Q31A 4JKBA 4CZEA 1YJ9N 2I7PA 4L3QA 1N8RO 4A5AA 5KQDA 2A5XA 4BG8A 3MCPA 4CZKA 4I6MB 3OHRA 4CZGA 3KHYA 1Q81O 3ID6A 5EOYA 3UB5A 4H0VB 2A41A 5C2FA 5HOOA 3G71N 3WXIA 4PHTX 4JHDB 4IOAL 3P31A 3DJCA 2QI2A 1HLUA 2NRZA 5E26A 2CGJA 3UKRA 3VF6A 4BGBA 2VGMA 2P9KB 1CZAN 3CETA 3GE1A 1K8KA 4JAXA 4BR4A 3KWGA 3C65A 1ATRA 3BUZB 3QFUA 3HM8A 3ZETA 3CIPA 5LJWA 2E8AA 1NGHA 4JK8A 2HBKA 2VGNA 1NGAA 4H5WA 1OVYA 1NGFA 3BF3A 5AFUA 5MLCQ 3EE8A 5AQSA 3CJ7A 3SBGA 5GADP 4IOCL 1GLLO 3L4QA 2FF6A 1W2BM 3F2KA 4BR2A 3LDQA 1HKCA 4H5TA 4PL7A 4AF1A 1QVFM 2ASPA 3VGLA 3FR0A 3MCAB 3L4IA 2A6AA 1VQNN 1H1VA 2WFBA 2IVOA 4K25A 5AZIB 3DXKA 3CQYA 2Q0RA 4BRKA 4JD2A 2F9TA 4FOEA 3VF2A 1IG8A 3SAGA 4H5RA 4OPHA 1E4FT 2HMPA 3QDKA 4BRMA 3GOIA 3FZHA 4YOWA 2ZGZA 3DXMA 1VQ9N 2WBNA 2YJEA 1GLJO 5F1XA 4FWKA 4FSVA 4ISFA 4YORA 3ULEB 4BRFA 1HX1A 5AQZA 3WXMB 3Q7CA 2DPNA 3ZYYX 4H5NA 3FLCO 3RSEB 3EE9A 2E2NA 3I55N 3JS6A 5AQTA 1NMDA 3IDHA 4M7XA 5GIPA 3TU5A 5CE3A 2D4WA 5BPNA 1DGKN 5M1KA 4BRPA 4WFBL 1TYQB 3ZX0A 3B8AX 3O4WA 4M63C 3TTFA 3BF1A 3K9KA 3SJHA 1EQYA 3P39A 4G9ZA 2EWSA 1QZ6A 2BUPA 3D6RA 4QS9A 4KBOA 3SAFA 2F9WA 4IOXA 2NNWA 4BC5A 1XUPO 3CHWA 4C1NI 1GLAG 1NGJA 2CH5A 4Y0WA 4GVEA 2HF3A 2QXLA 5H1SQ 3IUCA 3WUHA 3NVKA 3VEVA 1GLDG 2P9SB 3KZBA 3TSPA 5ADXA 3CCQN 4FPAA 3VEOA 4H0YB 2VWBA 4BRLA 3WT0A 2NLXA 5TKWA 2HBLA 4A57A 4KH6A 4B1YB 1Z05A 4EFHA 1GLFO 3S41A 1NGBA 3GBTA 1SZ2A 4JHDA 2P9NA 3O1BA 2YJFA 2NZTA 5AQWA 2A42A 4MO5A 4CZIA 1QHAA 4DB3A 5I9EB 1WOQA 5AQXA 3O9UA 4KH5A 1YUWA 1M90O 4NLCA 3SMPA 4E1JA 3WXKA 3D2EA 3OA9A 5C12A 3NVMA 4MDAA 3I56N 4ILJA 4K43A 4CBWA 3DLLL 2H3GX 3OW2M 2YI1A 3QBWA 4ILGB 3UKUB 4IZ9A 3O9QA 4JKDA 5C10A 1NGCA 1SAZA 3FZKA 1NWKA 3SMSA 5JVHL 3A5MC 3WXJA 3C6HA 3GG4A 4JKAA 1ZC6A 1T6CA 3FZMA 4FO0A 3U4LA 4NB4A 5KPZA 1VQ6N 3VEXA 4B1UB 3RVCA 3PLAA 4WQ5A 1ATNA 4WYBA 4BRQA 3OBWA 4WFNL 1TUUA 3WEEA 5C15A 2IIRA 4IJNA 1QZ5A 3I33A 5DM7L 1T3VA 1KXPA 2NRWA 3H45C 3IKMA 4CZMA 4B1ZA 5LJVA 5M1NA 1YI2N 1HKBA 2W40A 4BR9A 4DQ8A 2P9LA 1KC8O 4U67L 2QWRA 2Q2RA 4XH4A 4B1VA 3AGKA 5BRHA 1G99A 5KPTA 3CF5L 3TSQA 1VQ7N 4FPBA 5JVGL 2P9PB 2QWOA 3RSEA 4BRHA 4YOYA 1VAZA 3C7NB 5AQGA 4CJ7A 4JKGA 2OANA 2FF3B 4B9QA 1HKGA 1X9JA 4BQZA 5KQ8A 1YITN 3CPEA 4J8FA 2YHYA 1U2VA 3H3OB 5LY3A 3HRGA 2ASOA 2Q0UA 4CZJA 1LCUA 1NGEA 4K41A 5AZJB 3E66A 4KH4A 3LDNA 3A5LC 3R3LA 4PL8A 4CD1A 1Y64A 1M1KO 3D2FB 4JNEA 4WFAL 3FZFA 5F2RA 5AQMA 4WQ5C 1NGDA 3CCJN 4H0XB 3LL3A 2RHKA 3H6EA 4EIAA 5AQPA 4MDBA 2J4RA 1Q82O 3ZX3A 5AR0A 4YOVA 2Q97A 3MN7A 3A5NC 4GNIA 3NMUA 5BRDA 1K9MO 1J6ZA 2P9UB 4YOTA 4LC9B 1RDUA 4JKCA 4BROA 1T6DA 2YHWA 3J8AA 4FOIA 2QW9A 4JN4A 4NO7A 4A61A 3VF4A 5BPLA 4GV9A 4A5BA 4UY8O 2JWKA 3AY9A 1NGGA 2NRXA 1BA1A 1HUXA 2NRTA 4BGAA 3KVGA 3ATUA 4A2BA 4BRIA 4AM7A 2QWQA 2UYTA 1U6ZA 3O6WA 5CR4A 4WCEL 3EN9A 1JCEA 3KK7A 5DM6L 4IDHA 1D4XA 3U9ZA 3VGMA 4BRGA 4M7YA 1YXQA 4BR7A 1VQ5N 1MWMA 2NRHA 3H3NO 3K9JA 4A59A 3CJ1A 3LDOA 3CQXA 3QMLA 2ZJQL 3HOSA 1Q7YO 3G4SN 3U9DA 4B1XB 1VQ4N 2QEXN 3QFPA 3O08A 2JWLA 3ZX2A 4O8KA 3GL1A 1BWFO 1DKGD 4IWVA 2E20A 3CC7N 3D7EO 2HF4A 4EAHD 3CJBA 4Z94A 4R79A 1HJOA 3TTDA 5JMVA 3CMEN 1BG3A 1S72N 1QQOA 5C0YA 2CGKA 1NBWA 2P9IB 4JK7A 4PKIA 4BVOA 2GTDA 2Q36A 3ENBA 1E4GT 4XEIA 2D0PA 3ZEUA 4DKWA 4EHUA 3LM2A 4BRNA 5AQRA 4WQ4A 4MO4A 3BEXA 2P9PA 3HSCA 4I6MA 5AFUH 4F9OA 3C7NA 5BREA 1XQSC 3ENHA 2QA4N 4JK9A 4OO1J 2E1YA 5EVZA 1BU6O 1NM1A 5M1PA 3HBTA 3MN6A 5AQUA 3EKSA 1Q86O 5AQQA 3SK3A 5JLHA 4OPAA 4YOUA 3UKRB 3R6MA 3N4QA 2P9KA 3CD6N 3MWPA 3O9TA 1K8KB 2ITMA 3O5BA 5BN8A 3QICA 4H0PA 1ZBSA 3ZETB 3CMAN 3ID8A 1VQLN 2AA4A 5M1FA 5FPDA 3CERA 1GLBG 3E1YA 2Q1NA 1IJJA 1LOTB 2I7NA 3ATVA 3E9LA 1JCFA 4FWPA 2E2OA 3CJCA 4WQ4C 2BTFA 1V4TA 3VTIA 5EY4A 4K42A 5AZIA 4MLHA 3JXUA 3W0LA 3DXKB 2QTDA 3R9PA 1T44A 4JD2B 3L6QA 3KWIA 2ZGYA 1K73O 4FWLA 4BVPA 2NRVA 5AQFA 4XH1A 3CI5A 3DXMB 1S22A 2RE2A 2AP1A 3CCEN 3EZWA 3ULEA 4XH5A 3LDPA 2V7ZA 5ADXH 4GY2B 2ZF5O 1HPMA 3A0IX 5M1QA 4JKEA 1DT9A 2QM1A 1QQMA 2V51B 4B1WB 2GELA 3FE1A 4BR0A 5JICA 4HWIA 4CZHA 1W97L 1RDWX 4HTLA 3VEWA 4H03B 1TYQA 1ZXOA 1YVNA 2GX9A 4CZLA 5F0XA 5GAHP 3LDLA 2HBJA 5BPMA 1QVGM 2ASMA 5KPRA 1NJIO 4IO8A 3SLCA 4EHTA 2VCPA 5M1OA 1EO1A 1RFQA 4BY9C 5AQIA 3MN9A 4FWRA 4ILHA 3H46O 3H1VX 2QWNA 3HI0A 5C2DA 2NRRA 5GINA 2PAVA 4GV6A 2P9SA 3F5TA 3WQTA 3DAWA 3C0BA 5AQOA 3CC4N 1WUAA 3PIPL 5FPMA 5B8HA 3EL2A 3Q7BA 5CHIA 3M1FA 1KAYA 2BH1A 3L0QA 3HTVA 3M5RA 1MDUB 2P9NB 1OKJA 3P4IA 1GLEG 4IEIA 3M6GA 1KQSM 1KAXA 1S3XA 3N4PA 1O13A 3C6AA 3FZLA 1KD1O 4FWSA 4BRCA 4CBXA 4ISEA 1Z6RA 1P90A 4GV3A 4BQLA 1VQON 4O5FA 3U8XA 4FVUA 3D2EB 3O1WA 2WC9A 3EKUA 2WUSA 3TSUA 3PIOL 3W3DA 1P8ZA 3UKUA 1NLVA 4RTFD 2V52B 3CXCM 2FSJA 5BN9A 1KAZA 2IVPA 4H0OA 3E9OA 3IMXA 5AQYA 3T69A 1ESVA 1V4SA 2CH6A 1MA9B 3DWLA 5AQHA 4CZFA 1X3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6A A;  3C6H A;  5C2F A;  5M1N A;  4IFE A;  5C10 A;  5M1F A;  3CPE A;  4IEI A;  4IEE A;  5M1Q A;  5C15 A;  5C2D A;  5M1K A;  5M1P A;  5M1O A;  5C12 A;  4IDH A; 
#chains in the Genus database with same CATH topology
 5FPN A;  3AVN A;  4DSJ A;  3CC2 N;  3S3N A;  1YAG A;  3QBX A;  2GWK A;  4PKH A;  3SBT A;  3F9M A;  3A8Y A;  2E2Q A;  5JLF A;  3SAH A;  1RT5 A;  4DHY A;  2O8F A;  3J7Z O;  4RW6 A;  4DS5 A;  4NXN K;  3QET A;  3O8M A;  2XHB A;  1S5J A;  1ZBI A;  3V9Z A;  4DSK A;  1JXE A;  3SYZ A;  2UUB K;  2E1Z A;  2ZD1 A;  3C6T A;  3I8B A;  3LPT A;  3DLR A;  4AM6 A;  5JS2 A;  4CHQ A;  2ITG A;  2D0A A;  3FGU A;  4BC3 A;  3O9S A;  4CD3 A;  2V7Y A;  4DCH A;  2YNI A;  3MK6 A;  1R59 O;  5CZ2 A;  2HNY A;  1NGI A;  2OPP A;  3NHG A;  4BRD A;  2HNZ A;  3GDQ A;  5AQN A;  1MWK A;  1ZBH A;  4MLE A;  4BR5 A;  3MN5 A;  3K58 A;  3S3O A;  3HM9 A;  2G8I A;  1LWF A;  3VEZ A;  2P9U A;  1TK5 A;  4FWO A;  1L3S A;  4DLE A;  3O9R A;  4YFU A;  2UXC K;  4CJU A;  3VMF B;  1BO5 O;  4CGG A;  5HL7 L;  2ZJP L;  1RT6 A;  4IFE A;  1IBM K;  4LY7 A;  3TAP A;  4B9V A;  3DMJ A;  3NH0 A;  2W41 A;  3CM6 A;  4R5P A;  5GAG P;  1YF5 L;  4ZHR A;  1W7A A;  2OTL N;  1IG9 A;  4CEZ A;  4FJG A;  1TUY A;  4JYA K;  3QB0 A;  4BG9 A;  5HLF A;  1VQK N;  4M3Z A;  3RMB A;  4BRE A;  1JJ2 M;  3VET A;  1HQU A;  3SUQ A;  4FWM A;  3R8E A;  1VQP N;  2P9I A;  2FSN A;  1FXX A;  3OYE A;  4FLX A;  1YJ9 N;  2I7P A;  2F96 A;  4A5A A;  3DM2 A;  4CFD A;  1VHX A;  4CZG A;  4CZK A;  5CYM A;  3ID6 A;  4CGF A;  5DK5 A;  5C2F A;  1N33 K;  1TAU A;  4TSX A;  4PHT X;  3P31 A;  2OPQ A;  1HLU A;  1EET A;  2NRZ A;  5E26 A;  3LZI A;  5D3G A;  2VGM A;  4AHS A;  5E41 A;  2G8U A;  2D0C A;  4X66 K;  4BR4 A;  4DTU A;  1WB9 A;  5J2Q A;  3BUZ B;  3QFU A;  4JK8 A;  1OVY A;  3SUP A;  1TKD A;  5AFU A;  3SBG A;  3CM5 A;  1DLO A;  4PL7 A;  4AF1 A;  3BZC A;  3VGL A;  3L4I A;  3VQP A;  2WFB A;  2IVO A;  1C0M A;  3V1O A;  4BRK A;  3SAG A;  3QER A;  2HMP A;  4CEO A;  1NKE A;  3FZH A;  1X9S A;  1VQ9 N;  1QSL A;  4FSV A;  4YOR A;  2KFZ A;  3ULE B;  1HX1 A;  3ZSX A;  5AQZ A;  3NAE A;  3WXM B;  2DPN A;  4H5N A;  1NNE A;  4CF9 A;  1KLN A;  1N36 K;  2E2N A;  1JL1 A;  3I55 N;  4OGC A;  4E1N A;  4DTX A;  3THX A;  3OYA A;  4M63 C;  3TTF A;  3BF1 A;  3K9K A;  3SJH A;  1EQY A;  5HRO A;  1LW0 A;  4CJW A;  4BE0 A;  1QZ6 A;  2O4I A;  4KBO A;  3SAF A;  4CEC A;  2NNW A;  4B3T K;  4BC5 A;  3ZSY A;  2QXF A;  5H1S Q;  3SUO A;  5ADX A;  1GLD G;  3CCQ N;  1TVR A;  3SV4 A;  4KH6 A;  4J2A A;  3S41 A;  1GLF O;  3GBT A;  1RBT A;  2Z1G A;  4CJQ A;  5I9E B;  4DSI A;  1NKB A;  1LAW A;  3O9U A;  4DQI A;  4KH5 A;  2IDO A;  4NLC A;  3SMP A;  4LF9 K;  3D2E A;  5C12 A;  3E01 A;  4GW6 A;  2YI1 A;  3L8B A;  2PYL A;  1BL3 A;  5KTQ A;  5C10 A;  2G8K A;  4NYF A;  3WNF A;  5J2M A;  4E7J A;  1T6C A;  3U4L A;  3KKR A;  3D45 A;  4W5N A;  4LH5 A;  1SL2 A;  3RTV A;  4C8L A;  4I9Q A;  1ATN A;  3SQ4 A;  2F8T A;  4HTU A;  1S6Q A;  1R0A A;  5KRS A;  3AA2 A;  4CZM A;  3JAM O;  4B1Z A;  3QES A;  2YKN A;  1KC8 O;  1KLM A;  4B1V A;  4U67 L;  4LFA K;  4K8X A;  4FPB A;  5JVG L;  2QWO A;  5AQG A;  3OYI A;  3AO4 A;  3VQA A;  4YHH K;  5KQ8 A;  4J8F A;  3NBP A;  4KI4 A;  4CZJ A;  1Y97 A;  3BDP A;  4KH4 A;  2GV9 A;  4JNE A;  2O8B B;  4WQ5 C;  1NGD A;  3CCJ N;  4H0X B;  3LL3 A;  1Q82 O;  4MDB A;  1WNS A;  2Q97 A;  3MN7 A;  3A5N C;  3F9K A;  1K9M O;  1J6Z A;  1C1C A;  2VG6 A;  2YHW A;  4FOI A;  4JN4 A;  5BPL A;  1A5W A;  4GV9 A;  1RDA A;  1NKC A;  4A2B A;  1HRH A;  4AM7 A;  3DOK A;  4ELT A;  5EU7 A;  1U49 A;  3EN9 A;  4B9S A;  3KK7 A;  2BGG A;  4IDH A;  3VGM A;  2GUI A;  4X65 K;  1LV5 A;  4BR7 A;  4N41 A;  1MWM A;  3CJ1 A;  1RNH A;  3NE6 A;  3QIN A;  3QFP A;  3KK2 A;  4FLU A;  3ZX2 A;  1OH6 A;  1S1W A;  3GL1 A;  4UQG A;  2ZE2 A;  4OVL A;  4EAH D;  3TTD A;  5JMV A;  3LPU A;  4E7I A;  1S72 N;  4CGJ A;  2CGK A;  3NGI A;  1NBW A;  4KHU A;  4JK7 A;  3ENB A;  1E4G T;  4XEI A;  3HVT A;  3DRP A;  5AQR A;  3LP0 A;  3HSC A;  5HRS A;  1L3T A;  3ENH A;  1B9D A;  1QQC A;  5M1P A;  3HBT A;  3V6D A;  5AQU A;  3AV9 A;  3EKS A;  1JLQ A;  3U3Y A;  1Q86 O;  4M41 A;  4CFB A;  5JLH A;  1BCM A;  3MWP A;  3KD5 E;  4N76 A;  4FJ7 A;  3CMA N;  3JYT A;  2FBT A;  3VA0 A;  2E6L A;  2X78 A;  3QNO A;  4KHY A;  1GLB G;  3HT3 A;  2E2O A;  4FLZ A;  3NDK A;  3VTI A;  5EY4 A;  2Y1J A;  4FZX C;  3DXK B;  2QTD A;  4K8Z A;  3DI6 A;  3HPG A;  1I39 A;  4OKK A;  3MAQ A;  4JD2 B;  3V1R A;  1U04 A;  2VG5 A;  1NOY A;  1IH7 A;  3ZT3 A;  1K73 O;  3ZSO A;  2O8F B;  4OKE A;  2AP1 A;  1ZBU A;  3EZW A;  3SQ2 A;  3ULE A;  4MFB A;  2UU9 K;  1N6Q A;  1KRP A;  1NU0 A;  5M1Q A;  4JKE A;  2P5O A;  1U48 A;  4CHY A;  2QM1 A;  1QQM A;  3LP2 A;  4B1W B;  1S9E A;  3FE1 A;  4HWI A;  2KQ2 A;  2O8C B;  3VEW A;  1CXQ A;  2GX9 A;  4H03 B;  4CZL A;  1NJW A;  3LDL A;  1NJI O;  4RW9 A;  3SLC A;  3OYL A;  2E4L A;  4KO0 A;  5M1O A;  4FWR A;  1EWR A;  4H4O A;  3H1V X;  5C2D A;  1DTQ A;  4DR1 K;  4CVN E;  3PX6 A;  3CC4 N;  2O8E B;  1WUA A;  3PIP L;  1UA0 A;  5B8H A;  3ZT0 A;  3M1F A;  1VSK A;  1HYS A;  2P9N B;  2RPI A;  1O13 A;  3C6A A;  1C1A A;  4BRC A;  1EX4 A;  1G15 A;  1P90 A;  4FVU A;  1S9G A;  1VQO N;  4DV1 K;  3TSU A;  3EKU A;  2WUS A;  3AVF A;  1RT4 A;  1P8Z A;  5J1E A;  1NLV A;  4GKK K;  1KAZ A;  3E9O A;  1RDC A;  1V4S A;  1MA9 B;  3V9X A;  3K5M A;  4WCE L;  4C8N A;  1WSG A;  4AHT A;  4LSL A;  4O44 A;  1OH7 A;  4FZZ A;  5KRT A;  1VSH A;  1T05 A;  1VK0 A;  1TAQ A;  3K0S A;  5J2P A;  1K8A O;  3V9S A;  3U6F A;  4KFB A;  3O4N A;  3G25 A;  1DEJ A;  4IDK A;  4CBU A;  1ILY A;  3DLB A;  4FLW A;  4BC2 A;  4H0T B;  3AVJ A;  4YDU A;  1VSM A;  3KLF A;  4IJA A;  4FL9 A;  4OPJ A;  5BR9 A;  4IO9 L;  1I94 K;  2YHX A;  4CF0 A;  3T7Z A;  4CJ4 A;  1N34 K;  4V19 S;  4IEE A;  4PQU A;  5C24 A;  2O8B A;  2PFU A;  4DS4 A;  4B8A B;  3VPZ A;  1REV A;  4O0I A;  2ZJR L;  1VQ8 N;  3MMV A;  4C1N K;  3CCS N;  4LF8 K;  4CGH A;  4RWT A;  4AHC A;  3CJ9 A;  2A40 A;  3VEY A;  1S1T A;  3RR8 A;  1UOC A;  1TKT A;  1KVC A;  4YOX A;  1EP4 A;  1FKP A;  2PBD A;  2IS3 A;  3LM9 A;  5AQL A;  4KHQ A;  1VQM N;  1HYV A;  3CFO A;  2ZWH A;  4X62 K;  2P1J A;  3TTC A;  3DLK A;  2ATQ A;  1RDD A;  3DLH A;  5AQV A;  1BUP A;  5AJ3 K;  2IVN A;  3RMA A;  2D0B A;  3HYF A;  2QWP A;  4RG8 A;  1BIZ A;  3AGR A;  2OTJ N;  4NLB A;  4DLG A;  4CGD A;  3EO3 A;  4AHV A;  2HOE A;  4H5V A;  3VOV A;  2FXU A;  4CJR A;  2R7Y A;  2GEM A;  4KB1 A;  3ENO A;  4G1Q A;  2Q31 A;  3VQ5 A;  2P51 A;  3KK1 A;  4BG8 A;  3MCP A;  3TAR A;  3OHR A;  3LAK A;  5EOY A;  2XY5 A;  4CJT A;  5HOO A;  3WXI A;  1FJG K;  4IOA L;  3THY A;  2O8D B;  3DJC A;  2QI2 A;  4IBN A;  4E89 A;  5K14 A;  4BGB A;  1JKH A;  3AA4 A;  1NK9 A;  1CZ9 A;  1NG9 A;  2NUB A;  1ATR A;  5LJW A;  2OPS A;  2HBK A;  4H5W A;  3CJ7 A;  4CEE A;  3L4Q A;  3SQ0 A;  1QSS A;  1QVF M;  1WBB A;  2ASP A;  3MCA B;  4W5T A;  3CFR A;  3LP1 A;  4K25 A;  5AZI B;  3DXK A;  4DQS A;  4DR7 K;  4JD2 A;  1CZB A;  1IG8 A;  1WSI A;  3A2F A;  4H5R A;  4OPH A;  3GOI A;  2WBN A;  1BGX T;  2DFE A;  2YNG A;  4FLT A;  3Q7C A;  3OYG A;  1UWB A;  3ZYY X;  3FLC O;  4F2R A;  3EE9 A;  1VRU A;  3OVN A;  4DSE A;  3LZJ A;  1D8Y A;  5AQT A;  5GIP A;  1NMD A;  3IDH A;  2HHH K;  3TU5 A;  2VWJ A;  2O8C A;  5CE3 A;  2D4W A;  4WFB L;  2KFN A;  3HO1 A;  1TYQ B;  3B8A X;  3O4W A;  4G9Z A;  3BZK A;  2OZM A;  2BUP A;  4JV5 K;  1KTQ A;  3CHW A;  1HNV A;  4Y0W A;  3TAG A;  2HVH A;  4JI3 K;  3WUH A;  3NVK A;  3VEV A;  3KZB A;  5JS1 A;  3TSP A;  3G10 A;  2O8E A;  3VEO A;  4H0Y B;  3T1A A;  3G0Z A;  5TKW A;  4B1Y B;  4XIU A;  4EFH A;  1GOC A;  2FBX A;  2P9N A;  3O1B A;  2NZT A;  4CZI A;  3LDS A;  1WOQ A;  4KPY A;  3VA3 A;  1JLB A;  3OA9 A;  3NVM A;  3OYN A;  4LF4 K;  4K43 A;  3DLL L;  3TAB A;  4ILG B;  3O9Q A;  4DFJ A;  3RR7 A;  1SAZ A;  1SL0 A;  4CHZ A;  1RT7 A;  3SMS A;  3A5M C;  3WXJ A;  3KKS A;  3ZLJ A;  3TAN A;  4JKA A;  5KPZ A;  4FO0 A;  3VEX A;  4Y1D A;  3J80 O;  3EY1 A;  3PLA A;  4BRQ A;  4I2P A;  2A1S A;  3J81 O;  4IJN A;  4FJK A;  4DSL A;  3I33 A;  3PO4 A;  3IKM A;  5M1N A;  3EZ5 A;  1YI2 N;  3OTO K;  2QKK A;  1C0U A;  2W40 A;  4BAC A;  2Q2R A;  4WE1 A;  1F21 A;  1G99 A;  3PY8 A;  1VQ7 N;  3H08 A;  3OS1 A;  3RSE A;  1VAZ A;  4FM2 A;  3AO2 A;  2OAN A;  3OYD A;  1IKX A;  1ASW A;  3L2U A;  1YIT N;  3H3O B;  5LY3 A;  3P5J A;  2G8W A;  4Z0U A;  2ASO A;  2XY7 A;  1LCU A;  3AO1 A;  5HRN A;  4FJL A;  4K41 A;  5AZJ B;  3TWH A;  4CD1 A;  4PUO A;  1Y64 A;  1RBU A;  3D2F B;  4WFA L;  3OS0 A;  1XMO K;  4CHO A;  2RHK A;  3H6E A;  2J4R A;  1WSF A;  2HHW A;  1RTI A;  3NMU A;  2B4J A;  5BRD A;  4YOT A;  4CK1 A;  4LC9 B;  1RDU A;  2HHS A;  4JI5 K;  2QW9 A;  3AVK A;  4A5B A;  3WNG A;  1NJX A;  1NGG A;  1HUX A;  3KVG A;  4JI6 K;  2QWQ A;  4NYN A;  1U6Z A;  1X9W A;  3T3F A;  1QHT A;  4DTR A;  3WNE A;  4M7Y A;  4KHW A;  1YXQ A;  1U47 A;  3MED A;  1RDB A;  2JGU A;  1VQ5 N;  2NRH A;  4I2Q A;  3LDO A;  3CQX A;  2ZJQ L;  3HOS A;  1VQ4 N;  5FDL A;  1L5U A;  3O08 A;  1JXB A;  1CLQ A;  4J2E A;  1DKG D;  4IWV A;  4DQQ A;  2IOC A;  4M42 A;  2D5R A;  1YTA A;  2FBV A;  3CJB A;  3LAN A;  4Z94 A;  4DG1 A;  3CME N;  1QQO A;  4O4G A;  4B9U A;  4BVO A;  2Q36 A;  1EXQ A;  1B9F A;  2D0P A;  4E3S A;  4LF6 K;  5A2Q O;  3LM2 A;  4BRN A;  4WQ4 A;  1KFD A;  3C7N A;  3WNH A;  1VRT A;  1ITG A;  5BRE A;  4OO1 J;  4JK9 A;  5EVZ A;  2W42 A;  3NGY A;  3VQ8 A;  5AQQ A;  4DUZ K;  2O8D A;  3SNN A;  1RT3 A;  1K8K B;  1B92 A;  1RBS A;  3ZET B;  1XHZ A;  1ASU A;  2AA4 A;  5IWA K;  1IJJ A;  1LOT B;  3ATV A;  1JCF A;  1JL2 A;  4FWP A;  4IG0 A;  5CY4 A;  1UA1 A;  2G8H A;  1N32 K;  2BTF A;  4W5Q A;  4HCB A;  4DFM A;  5AZI A;  2OZS A;  1BIS A;  4CIG A;  3C6U A;  4CFA A;  2NRV A;  4XH1 A;  2P5G A;  4M3R A;  3DXM B;  1WSJ A;  1J53 A;  2XY8 A;  3HPH A;  3LDP A;  2RKI A;  3NH2 A;  1S1X A;  1SKS A;  3DOL A;  2VQE K;  1U45 A;  4ID1 A;  4BR0 A;  4CZH A;  2OCE A;  1RDW X;  4O55 A;  1TYQ A;  1LAV A;  2X6S A;  3TAM A;  4CE9 A;  5BPM A;  2HBJ A;  2ASM A;  5KPR A;  4DTJ A;  2VCP A;  4LSN A;  2BDP A;  4YY3 K;  2Z1I A;  4ILH A;  5AQI A;  5I42 A;  2QWN A;  1WBD A;  2XY6 A;  1TK0 A;  5GIN A;  2PAV A;  5C42 A;  4GV6 A;  3RRH A;  4M45 A;  1SKW A;  4CER A;  1KAY A;  3M5R A;  3P4I A;  1S6P A;  4NCA A;  1RTJ A;  1S3X A;  3N4P A;  2HHV A;  3FZL A;  1ZBL A;  3AVC A;  4FWS A;  4CBX A;  1Z6R A;  3U8X A;  3O1W A;  4W5R A;  4DU1 A;  4FLV A;  3RRG A;  5BR8 K;  3PIO L;  4F4K A;  3AA5 X;  4W5O A;  1WAJ A;  2FSJ A;  4B9L A;  2IVP A;  5AQY A;  1ESV A;  3NFA A;  5AQH A;  4CZF A;  3TAE A;  4NXM K;  2VQF K;  1XC3 A;  4FWQ A;  4DTM A;  4Q0B A;  4A62 A;  5C25 A;  4DTP A;  3ZT4 A;  1J54 A;  5CZ1 A;  4OLB A;  1C0G A;  5AQJ A;  3WQU A;  3CCR N;  2FSK A;  5EXW A;  4U7B A;  3H1Q A;  3V9U A;  4FJ9 A;  5T7B A;  4FK2 A;  4Q5V A;  3CG7 A;  4KRE A;  3KTQ A;  1IO2 A;  4QS8 A;  4CHP A;  3AO3 A;  4JS5 A;  3TPQ A;  4OX9 K;  1TKZ A;  4JI1 K;  4JKG B;  3O80 A;  4C8M A;  4CIF A;  1Z25 A;  1T7P A;  3A5O C;  5FPE A;  3ALY A;  1HYZ A;  5HP1 A;  3THY B;  4QS7 A;  1GLC G;  3OJS A;  5AZJ A;  4JKH A;  3AAR A;  3D2F A;  3CCV N;  2E88 A;  1KSP A;  4CJV A;  3QEV A;  1RGI A;  4CIE A;  1HR0 K;  4GMJ B;  4DU4 A;  4X64 K;  4RCH A;  3M8R A;  3L3V A;  3QNN A;  4FWN A;  2KZZ A;  3MEG A;  2VYP A;  2QK9 A;  3PO5 A;  3CCM N;  1VSL A;  1RCH A;  4FVM A;  3C95 A;  3AAQ A;  4JI7 K;  4CF8 A;  4EZ6 A;  1BQM A;  1VSE A;  4JKF A;  1ATS A;  1TV6 A;  2D0O A;  4A2A A;  3VTH A;  5ELZ A;  1X3N A;  4FW1 A;  3MXJ A;  2FLO A;  3ZSR A;  1XNR K;  1JLC A;  4CJS A;  3VEN A;  3FFI A;  3MDQ A;  3B6P A;  1SQK A;  3HL8 A;  2KLA A;  3IG1 A;  4BRA A;  1BOT O;  2AJQ A;  3PX0 A;  3M8Q A;  4KV8 A;  1X9M A;  2A3Z A;  1YJN N;  4CF2 A;  4F8R A;  3HXM A;  1SS6 A;  3HP9 A;  2FBY A;  3ZEU B;  1SL1 A;  4CZE A;  3P83 D;  4L3Q A;  1RTD A;  2A5X A;  1Q81 O;  3ZSQ A;  4DMN A;  4I6M B;  3VQE A;  3KHY A;  4KB0 A;  3BGR A;  4OPK A;  1NK6 A;  1XNQ K;  3G71 N;  3L2Q A;  4LF7 K;  4HVJ A;  1NOZ A;  3JSM A;  2CGJ A;  2LSN A;  3QLH A;  3VF6 A;  4LH4 A;  3GE1 A;  1CZA N;  1K8K A;  4IG3 A;  4JAX A;  2PZS A;  3MXM A;  3MEC A;  3ZET A;  2B5J A;  3HM8 A;  2E8A A;  1NGH A;  3L2W A;  4GVM A;  1NGF A;  3BF3 A;  5MLC Q;  4IOC L;  1GLL O;  5FRO A;  2FF6 A;  1W2B M;  1QTM A;  1HKC A;  4HCC A;  3J7Y P;  3FR0 A;  2A6A A;  1HQE A;  3SPZ A;  2X74 A;  1OH5 A;  4AIL C;  1EWQ A;  4CF1 A;  4FOE A;  3VF2 A;  1O1W A;  1E4F T;  3NF8 A;  3QDK A;  3IS9 A;  1JLF A;  4PA1 A;  4YOW A;  2ZGZ A;  3DXM A;  3ZSV A;  1GLJ O;  5F1X A;  4FWK A;  2BE2 A;  4KHN A;  4BRF A;  2A1R A;  3J7A P;  1J9A A;  4CFC A;  3RSE B;  1WSE A;  2ZM6 K;  3JS6 A;  1QSY A;  2JLE A;  3QEW A;  5M1K A;  1DGK N;  4BRP A;  4FCY A;  3ZX0 A;  1LWC A;  4DSF A;  4M3T A;  2EWS A;  3NF9 A;  3D6R A;  2F9W A;  4QOZ B;  4IOX A;  4C1N I;  1XUP O;  4M3U A;  1NGJ A;  4GVE A;  2QXL A;  4DR6 K;  2VWB A;  4BRL A;  2NLX A;  4JHD A;  1NGB A;  1SZ2 A;  4IFY A;  3HPO A;  5I3U A;  1QS4 A;  2YJF A;  4DB3 A;  1VSI A;  3V1Q A;  4CW7 B;  3VQD A;  1IKY A;  3V81 A;  3AVL A;  3K5O A;  4MDA A;  4CBW A;  3T19 A;  3LWM A;  3QBW A;  1N5Y A;  4Z4G A;  4BE2 A;  4IZ9 A;  2EHG A;  4HUF A;  3NF6 A;  3SI6 A;  1HNX K;  3KJV A;  1NGC A;  1NWK A;  4ELV A;  1FK9 A;  2DY4 A;  3C6H A;  4BE1 A;  3GG4 A;  1ZC6 A;  3FZM A;  1D5A A;  1VQ6 N;  2UXD K;  3RVC A;  4WQ5 A;  4WFN L;  1JLE A;  4WYB A;  5LMN K;  2DTU A;  1TUU A;  4FM1 A;  4FJN A;  2IIR A;  1XC9 A;  2EX3 A;  4EZ9 A;  5DM7 L;  1KXP A;  2NRW A;  1HKB A;  2HW3 A;  1T03 A;  4XH4 A;  4CJ3 A;  5KPT A;  3CF5 L;  3TSQ A;  4B3S K;  3TAQ A;  3I8D A;  1FW6 A;  4BRH A;  3C7N B;  4JKG A;  2FF3 B;  2YNH A;  1HKG A;  1X9J A;  4BQZ A;  4CHN A;  3THV A;  3CPE A;  1HNZ K;  2Q0U A;  2WON A;  1I3A A;  5J2N A;  1NGE A;  4PL8 A;  3TAF A;  1M1K O;  4IFV A;  2Z1H A;  4RW7 A;  4CEA A;  4DV6 K;  4F3T A;  3AVG A;  4H8K A;  5AR0 A;  3AO5 A;  4CEQ A;  4GNI A;  1NK4 A;  4LFC K;  1JLA A;  3J8A A;  4NO7 A;  2JWK A;  1DTT A;  1BA1 A;  3S9H A;  1IKV A;  4BRI A;  2UYT A;  3T1Y K;  1S1V A;  5CR4 A;  4C8K A;  1D4X A;  3U9Z A;  4BRG A;  4FK4 A;  1YT3 A;  3I0R A;  4A59 A;  1XMQ K;  3G4S N;  3U9D A;  4B1X B;  2QEX N;  4BWM A;  4E7L A;  4IKF A;  3BY5 A;  4ZTJ A;  2UUA K;  4O8K A;  1JLG A;  3PV8 A;  2E20 A;  3CC7 N;  3D7E O;  4R79 A;  3T1H K;  2YHA A;  3D0P A;  4CJP A;  5C0Y A;  5HRP A;  1TL3 A;  1RT1 A;  1HNW K;  5LMU K;  2GTD A;  3VQ7 A;  3ZEU A;  2KZM A;  3NGZ A;  4DKW A;  3QEX A;  3LAM A;  3BEX A;  2P9P A;  4I6M A;  4CEF A;  1XQS C;  2QA4 N;  1A5V A;  4DR4 K;  1NM1 A;  1BU6 O;  2YKM A;  2I5J A;  4JS4 A;  5HBM A;  1W0H A;  1FKO A;  3O3G A;  3M8P A;  4OPA A;  4YOU A;  3UKR B;  2E6M A;  3N4Q A;  3CD6 N;  2ITM A;  1QE1 A;  2OA8 A;  1HMV A;  3O5B A;  5BN8 A;  1W9H A;  3QIC A;  5FRN A;  4FJ8 A;  4H0P A;  1VQL N;  1Q9X A;  4CCH A;  5M1F A;  5FPD A;  3CER A;  2Q1N A;  2I7N A;  3E9L A;  3ULD A;  3CJC A;  4PY5 A;  3VQC A;  3P1G A;  3HVR A;  4K42 A;  3VQ9 A;  4MLH A;  3JXU A;  5LL6 Z;  3R9P A;  3LWL A;  4FWL A;  2WOM A;  3ZCM A;  4FXD A;  3CI5 A;  1S22 A;  1BQN A;  2RE2 A;  5KI6 A;  3CCE N;  4LF5 K;  2V7Z A;  3LAL A;  1CXU A;  3DLG A;  3CQ8 A;  1HPM A;  1KVB A;  1VSJ A;  3A0I X;  3MEE A;  1IV0 A;  1DT9 A;  3DRR A;  2V51 B;  4CK2 A;  1W97 L;  4HTL A;  1YVN A;  1QVG M;  4DFK A;  4IO8 A;  4NCG A;  3HK2 A;  2WTU A;  4EHT A;  3K2P A;  5KGW A;  1EO1 A;  4BY9 C;  3H46 O;  2IC3 A;  3HI0 A;  3K5N A;  4FJI A;  4MQ3 A;  3WQT A;  4JI8 K;  5AQO A;  3ZSZ A;  3K5L A;  3Q7B A;  2BH1 A;  3HTV A;  3OS2 A;  2HB5 A;  1Q9Y A;  1OKJ A;  1KQS M;  1KAX A;  3VQ4 A;  3OY9 A;  1K6Y A;  2FC0 A;  2YNF A;  4O5F A;  3ISN C;  4QAG A;  2V52 B;  3HJF A;  5BN9 A;  3IMX A;  4CK3 A;  3IFR A;  1WLJ A;  1S1U A;  2GBZ A;  4DFP A;  1YHQ N;  1C0T A;  5GAE P;  3R1X A;  4B8C A;  2F7T A;  1BDG A;  3FFK B;  5GIO A;  4C23 A;  3WEE B;  1NMN A;  3I0S A;  3TI0 A;  2E2P A;  3VER A;  3CPW M;  4FJX A;  3MX5 A;  1Q8I A;  2KKZ A;  4H4M A;  5E84 A;  3ASM A;  3S3M A;  2D1K A;  2P9L B;  1YIJ N;  5BRF A;  3QEP A;  4ISG A;  1NJZ A;  2BAN A;  3G6E N;  4DTO A;  4FYD A;  3M3Z A;  4DV2 K;  4E7K A;  3RMC A;  1U2V B;  2QWM A;  1BIU A;  5EX5 A;  3NH1 A;  4OGE A;  4DWI A;  4EP5 A;  1KFS A;  5FRM A;  2X6N A;  3SJJ A;  4M3W A;  3KLG A;  2YCH A;  4DUY K;  3HP6 A;  4B3R K;  2CGL A;  4DV7 K;  1BA0 A;  1NJY A;  4KRF A;  2HST A;  1ZBF A;  4WF9 L;  4HHT A;  3VES A;  3VGK A;  2PYJ A;  4B3M K;  4PKG A;  3KD1 E;  1YTU A;  1J5E K;  1BCO A;  1XHX A;  2QWL A;  1X3M A;  1D9F A;  3HST B;  3QIP A;  4O5B A;  2VWK A;  3OBY A;  2HHT A;  3HOT A;  3BP8 A;  3KLI A;  4O8U A;  1IKW A;  4YDU C;  4DR5 K;  3CCU N;  2KTQ A;  3ITH A;  2W6K A;  4JI4 K;  3OYM A;  2IAJ A;  1QQN A;  3HZ6 A;  3P38 A;  3AAP A;  3IAY A;  1LW2 A;  1Q18 A;  3QIO A;  4NCB A;  4JEP A;  2HBM A;  3E9P A;  5AQK A;  4CJF A;  4IXC A;  3OJU A;  2HHQ A;  2XO7 A;  1J5O A;  4Z4C A;  4CED A;  4ID5 A;  1IBL K;  3WXL A;  3CJA A;  1C0F A;  1KCF A;  2YX6 A;  2Q3S A;  2KHO A;  3UE5 A;  4CI6 A;  1YVU A;  3AVB A;  1YJW N;  5TKY A;  4BC4 A;  3OYB A;  1JCG A;  3CCL N;  3MWT A;  3MX2 A;  4BDY A;  2GWJ A;  2GUP A;  4JKB A;  1TGO A;  2YHB A;  1N8R O;  5KQD A;  4JRP A;  3THW B;  1UAX A;  1HNI A;  1BI4 B;  3UB5 A;  1NK5 A;  4H0V B;  2A41 A;  4JHD B;  1L3V A;  4FK0 A;  5DMR A;  1OH8 A;  4KTZ A;  1X1P A;  1LWE A;  1HJR A;  3UKR A;  4DU3 A;  1NK8 A;  2P9K B;  1RTH A;  3CET A;  3EYZ A;  3KWG A;  3KLE A;  3C65 A;  1BHL A;  1RBV A;  3CIP A;  2VGN A;  1NGA A;  1TL1 A;  4F2S A;  1TK8 A;  4KTQ A;  4KHS A;  1MU2 A;  3EE8 A;  5AQS A;  3AVA A;  5GAD P;  4BDP A;  3F2K A;  4BR2 A;  3LDQ A;  4H5T A;  4AQY K;  3SZ2 A;  3K59 A;  1VQN N;  1H1V A;  3CQY A;  2Q0R A;  4DV3 K;  2F9T A;  4DR3 K;  1ASV A;  3K57 A;  1L3U A;  1EKE A;  4BRM A;  4E7H A;  2YJE A;  3IRX A;  2W6L A;  4ISF A;  4M3X A;  4O0J A;  3F73 A;  3O3F A;  3MXI A;  4CJ5 A;  4B08 A;  4JI0 K;  3ZT2 A;  4E19 A;  4M7X A;  3AVM A;  1C6V A;  1Z26 A;  2Y1I A;  4F3O A;  5BPN A;  4JI2 K;  3P39 A;  3OYK A;  4QS9 A;  1OVQ A;  4CES A;  4OKJ A;  4KHP K;  1GLA G;  2CH5 A;  3V4I A;  2HF3 A;  3IUC A;  2P9S B;  4FPA A;  3M8S A;  4CJL A;  3WT0 A;  4K0K K;  4B9M A;  2HBL A;  4A57 A;  1Z05 A;  1NK7 A;  4B3O A;  3NCI A;  5AQW A;  2A42 A;  4MO5 A;  1QHA A;  3DYA A;  2HHX A;  1KVA A;  5AQX A;  1E3M A;  1YUW A;  3QO9 A;  1M90 O;  3SCX A;  4E1J A;  3WXK A;  3PSF A;  4JLH A;  4ILJ A;  3I56 N;  2UUC K;  2H3G X;  3OW2 M;  3UKU B;  3OYF A;  4B9T A;  3L3U A;  4BDZ A;  2B6A A;  4JKD A;  3RMD A;  1U4B A;  4AHU A;  3FZK A;  3AVH A;  3L2R A;  2YV0 X;  5JVH L;  4DTN A;  4Z4F A;  4L8R B;  4YNQ A;  1GOA A;  4ZTF A;  4NB4 A;  3SV3 A;  2E5L K;  4C8O A;  4B1U B;  2HHU A;  1RIL A;  3OBW A;  3WEE A;  5C15 A;  1QZ5 A;  4DQR A;  1SUQ A;  1T3V A;  3H45 C;  5LJV A;  3SQ1 A;  3VQQ A;  4BR9 A;  4DQ8 A;  2P9L A;  2RN2 A;  4LFB K;  5BRH A;  2QWR A;  3AGK A;  2P9P B;  4YOY A;  1NK0 A;  4ICL A;  2DFF A;  4CJ7 A;  1VSF A;  3KIO A;  4OJR A;  1VSD A;  4B9Q A;  2YHY A;  1U2V A;  3HRG A;  2UXB K;  5HRR A;  4CJK A;  4I7F A;  4JRQ A;  4FJJ A;  2HMI A;  4N47 A;  3PUF A;  3E66 A;  3LDN A;  3A5L C;  3R3L A;  2IGI A;  4CGI A;  4RW4 A;  3FZF A;  5F2R A;  5AQM A;  3PX4 A;  4KTW A;  4EIA A;  5AQP A;  4N5S A;  3ZX3 A;  4YOV A;  1HPZ A;  4RW8 A;  1XI1 A;  3CFP A;  1WSH A;  2P9U B;  5SZT A;  4BRO A;  4JKC A;  1T6D A;  4A61 A;  4CEB A;  3VF4 A;  4UY8 O;  1XWL A;  4LD0 A;  3AY9 A;  2NRX A;  2NRT A;  4BGA A;  4HUG A;  4J2B A;  3ATU A;  1SKR A;  1RBR A;  3EEQ A;  3B6O A;  3O6W A;  5KGX A;  1JCE A;  3PSI A;  4KAZ A;  1TKX A;  5DM6 L;  3CYM A;  2ZQB A;  2XRI A;  2OPR A;  1SV5 A;  3H3N O;  3K9J A;  3QML A;  4DF8 A;  1Q7Y O;  2JWL A;  3KLH A;  1ZYQ A;  4KKO A;  1BWF O;  2G8F A;  4B9N A;  3C94 A;  2PY5 A;  2HF4 A;  3TR8 A;  3OYH A;  2F8S A;  1GOB A;  1HJO A;  1BG3 A;  4OLA A;  3QEI A;  1D9D A;  4Z4I A;  2P9I B;  4PKI A;  4EHU A;  4DV4 K;  5AFU H;  4MO4 A;  4F9O A;  3THW A;  1C1B A;  3UIQ A;  4FM0 A;  2E1Y A;  1BI4 A;  3MN6 A;  2G8V A;  1A5X A;  3L2V A;  3SK3 A;  3DRS A;  3R6M A;  3O3H A;  4Y1C A;  4DTS A;  2P9K A;  3O9T A;  5FLX O;  3KK3 A;  1ZBS A;  4E1M A;  3ID8 A;  4BWJ A;  4FJM A;  2DFH A;  4J2D A;  3E1Y A;  4EP4 A;  4AHR A;  1T8E A;  5IT9 O;  2HVI A;  2O4G A;  4WQ4 C;  1V4T A;  3U3G A;  3NF7 A;  3W0L A;  1WAF A;  2Z1J A;  1T44 A;  4ELU A;  3L6Q A;  5SWM A;  3KWI A;  2ZGY A;  3SUN A;  2QKB A;  4BVP A;  5AQF A;  4DR2 K;  4PWD A;  4XH5 A;  5ADX H;  4I9L A;  5CYQ A;  3SPY A;  4FJ5 A;  4GY2 B;  2ZF5 O;  4Z4E A;  3O4Q A;  1WN7 A;  2GEL A;  3VQ6 A;  4HUE A;  5JIC A;  4FZY A;  3THX B;  1ZXO A;  5GAH P;  5F0X A;  2F4V K;  2ETJ A;  3LP3 A;  4FLY A;  1RFQ A;  3MN9 A;  3OYC A;  2VG7 A;  4QCL A;  2NRR A;  2P9S A;  3F5T A;  3DAW A;  2RF2 A;  3C0B A;  4N56 A;  3VQB A;  1IBK K;  2KW4 A;  5FPM A;  4AH9 A;  3EL2 A;  5CHI A;  4FW2 A;  3L0Q A;  3RWU A;  4KI6 A;  3OYJ A;  1MDU B;  1GLE G;  4IEI A;  4GKJ K;  3M6G A;  4DQP A;  4CJE A;  1KD1 O;  4ISE A;  4GV3 A;  4BQL A;  4FJH A;  1RT2 A;  3D2E B;  2WC9 A;  4DV5 K;  3AVI A;  3W3D A;  3UKU A;  3V9W A;  4E0D A;  4RTF D;  3ZSW A;  4DV0 K;  3CXC M;  4M3Y A;  2OYQ A;  4H0O A;  3T69 A;  4DF4 A;  3ZT1 A;  3VN5 A;  2HND A;  2CH6 A;  3AA3 A;  4Z4H A;  3DWL A;  3DLE A; 
#chains in the Genus database with same CATH homology
 5FPN A;  3CC2 N;  1XC3 A;  3IFR A;  4FWQ A;  1YAG A;  3QBX A;  2GWK A;  4PKH A;  4A62 A;  3SBT A;  3F9M A;  1YHQ N;  3A8Y A;  5GAE P;  1C0G A;  3R1X A;  5AQJ A;  2E2Q A;  2F7T A;  2FSK A;  3WQU A;  5JLF A;  3SAH A;  3CCR N;  1BDG A;  5EXW A;  3FFK B;  4U7B A;  5GIO A;  3H1Q A;  4C23 A;  3WEE B;  4DHY A;  3J7Z O;  1K8A O;  2E2P A;  3VER A;  3CPW M;  3MX5 A;  2KKZ A;  3G25 A;  3O8M A;  1DEJ A;  4QS8 A;  5E84 A;  4CBU A;  1ILY A;  2D1K A;  2P9L B;  1YIJ N;  5BRF A;  3TPQ A;  4BC2 A;  4H0T B;  4ISG A;  2E1Z A;  4YDU A;  4IJA A;  3I8B A;  4JKG B;  3O80 A;  3G6E N;  4FL9 A;  3M3Z A;  4AM6 A;  5BR9 A;  3A5O C;  4IO9 L;  1U2V B;  2QWM A;  3FGU A;  5EX5 A;  2YHX A;  4BC3 A;  5FPE A;  3O9S A;  4QS7 A;  1GLC G;  3T7Z A;  4CD3 A;  2V7Y A;  4DCH A;  5AZJ A;  4JKH A;  3AAR A;  3MK6 A;  1R59 O;  2YCH A;  4IEE A;  2CGL A;  1NGI A;  3D2F A;  2PFU A;  3CCV N;  2E88 A;  1BA0 A;  4BRD A;  3GDQ A;  1RGI A;  5AQN A;  1MWK A;  2HST A;  3VPZ A;  4WF9 L;  3VES A;  3VGK A;  4RCH A;  4MLE A;  4PKG A;  4BR5 A;  3MN5 A;  2ZJR L;  1VQ8 N;  3MMV A;  4C1N K;  4FWN A;  2QWL A;  3CCS N;  3VEZ A;  2P9U A;  4RWT A;  3OBY A;  3CJ9 A;  2A40 A;  4FWO A;  3VEY A;  2VYP A;  3HOT A;  3BP8 A;  4O8U A;  3O9R A;  3CCM N;  4YDU C;  3CCU N;  4YOX A;  2PBD A;  3HZ6 A;  1QQN A;  3P38 A;  3AAP A;  3AAQ A;  3VMF B;  1BO5 O;  5HL7 L;  2ZJP L;  1Q18 A;  3LM9 A;  4JEP A;  4JKF A;  2HBM A;  5AQL A;  1ATS A;  3E9P A;  2D0O A;  5AQK A;  4A2A A;  1VQM N;  4IFE A;  3VTH A;  5ELZ A;  1X3N A;  2ZWH A;  4IXC A;  2FLO A;  3TTC A;  2W41 A;  3VEN A;  3MDQ A;  5GAG P;  1SQK A;  1YF5 L;  2OTL N;  5AQV A;  1BUP A;  2IVN A;  2KLA A;  1TUY A;  3WXL A;  3CJA A;  1C0F A;  3QB0 A;  2QWP A;  4BG9 A;  4BRA A;  1VQK N;  2YX6 A;  3AGR A;  2OTJ N;  1BOT O;  4NLB A;  4BRE A;  2KHO A;  3UE5 A;  1JJ2 M;  4CI6 A;  3VET A;  3EO3 A;  2A3Z A;  2HOE A;  4FWM A;  4H5V A;  3VOV A;  2FXU A;  1YJW N;  1YJN N;  5TKY A;  4BC4 A;  3CCL N;  1JCG A;  2GEM A;  3R8E A;  3MWT A;  2P9I A;  1SS6 A;  3ENO A;  2FSN A;  2GWJ A;  3MX2 A;  1VQP N;  2GUP A;  3ZEU B;  2Q31 A;  4JKB A;  4CZE A;  1YJ9 N;  2I7P A;  4L3Q A;  1N8R O;  4A5A A;  5KQD A;  2A5X A;  4BG8 A;  3MCP A;  4CZK A;  4I6M B;  3OHR A;  4CZG A;  3KHY A;  1Q81 O;  3ID6 A;  5EOY A;  3UB5 A;  4H0V B;  2A41 A;  5C2F A;  5HOO A;  3G71 N;  3WXI A;  4PHT X;  4JHD B;  4IOA L;  3P31 A;  3DJC A;  2QI2 A;  1HLU A;  2NRZ A;  5E26 A;  2CGJ A;  3UKR A;  3VF6 A;  4BGB A;  2VGM A;  2P9K B;  1CZA N;  3CET A;  3GE1 A;  1K8K A;  4JAX A;  4BR4 A;  3KWG A;  3C65 A;  1ATR A;  3BUZ B;  3QFU A;  3HM8 A;  3ZET A;  3CIP A;  5LJW A;  2E8A A;  1NGH A;  4JK8 A;  2HBK A;  2VGN A;  1NGA A;  4H5W A;  1OVY A;  1NGF A;  3BF3 A;  5AFU A;  5MLC Q;  3EE8 A;  5AQS A;  3CJ7 A;  3SBG A;  5GAD P;  4IOC L;  1GLL O;  3L4Q A;  2FF6 A;  1W2B M;  3F2K A;  4BR2 A;  3LDQ A;  1HKC A;  4H5T A;  4PL7 A;  4AF1 A;  1QVF M;  2ASP A;  3VGL A;  3FR0 A;  3MCA B;  3L4I A;  2A6A A;  1VQN N;  1H1V A;  2WFB A;  2IVO A;  4K25 A;  5AZI B;  3DXK A;  3CQY A;  2Q0R A;  4BRK A;  4JD2 A;  2F9T A;  4FOE A;  3VF2 A;  1IG8 A;  3SAG A;  4H5R A;  4OPH A;  1E4F T;  2HMP A;  3QDK A;  4BRM A;  3GOI A;  3FZH A;  4YOW A;  2ZGZ A;  3DXM A;  1VQ9 N;  2WBN A;  2YJE A;  1GLJ O;  5F1X A;  4FWK A;  4FSV A;  4ISF A;  4YOR A;  3ULE B;  4BRF A;  1HX1 A;  5AQZ A;  3WXM B;  3Q7C A;  2DPN A;  3ZYY X;  4H5N A;  3FLC O;  3RSE B;  3EE9 A;  2E2N A;  3I55 N;  3JS6 A;  5AQT A;  1NMD A;  3IDH A;  4M7X A;  5GIP A;  3TU5 A;  5CE3 A;  2D4W A;  5BPN A;  1DGK N;  5M1K A;  4BRP A;  4WFB L;  1TYQ B;  3ZX0 A;  3B8A X;  3O4W A;  4M63 C;  3TTF A;  3BF1 A;  3K9K A;  3SJH A;  1EQY A;  3P39 A;  4G9Z A;  2EWS A;  1QZ6 A;  2BUP A;  3D6R A;  4QS9 A;  4KBO A;  3SAF A;  2F9W A;  4IOX A;  2NNW A;  4BC5 A;  1XUP O;  3CHW A;  4C1N I;  1GLA G;  1NGJ A;  2CH5 A;  4Y0W A;  4GVE A;  2HF3 A;  2QXL A;  5H1S Q;  3IUC A;  3WUH A;  3NVK A;  3VEV A;  1GLD G;  2P9S B;  3KZB A;  3TSP A;  5ADX A;  3CCQ N;  4FPA A;  3VEO A;  4H0Y B;  2VWB A;  4BRL A;  3WT0 A;  2NLX A;  5TKW A;  2HBL A;  4A57 A;  4KH6 A;  4B1Y B;  1Z05 A;  4EFH A;  1GLF O;  3S41 A;  1NGB A;  3GBT A;  1SZ2 A;  4JHD A;  2P9N A;  3O1B A;  2YJF A;  2NZT A;  5AQW A;  2A42 A;  4MO5 A;  4CZI A;  1QHA A;  4DB3 A;  5I9E B;  1WOQ A;  5AQX A;  3O9U A;  4KH5 A;  1YUW A;  1M90 O;  4NLC A;  3SMP A;  4E1J A;  3WXK A;  3D2E A;  3OA9 A;  5C12 A;  3NVM A;  4MDA A;  3I56 N;  4ILJ A;  4K43 A;  4CBW A;  3DLL L;  2H3G X;  3OW2 M;  2YI1 A;  3QBW A;  4ILG B;  3UKU B;  4IZ9 A;  3O9Q A;  4JKD A;  5C10 A;  1NGC A;  1SAZ A;  3FZK A;  1NWK A;  3SMS A;  5JVH L;  3A5M C;  3WXJ A;  3C6H A;  3GG4 A;  4JKA A;  1ZC6 A;  1T6C A;  3FZM A;  4FO0 A;  3U4L A;  4NB4 A;  5KPZ A;  1VQ6 N;  3VEX A;  4B1U B;  3RVC A;  3PLA A;  4WQ5 A;  1ATN A;  4WYB A;  4BRQ A;  3OBW A;  4WFN L;  1TUU A;  3WEE A;  5C15 A;  2IIR A;  4IJN A;  1QZ5 A;  3I33 A;  5DM7 L;  1T3V A;  1KXP A;  2NRW A;  3H45 C;  3IKM A;  4CZM A;  4B1Z A;  5LJV A;  5M1N A;  1YI2 N;  1HKB A;  2W40 A;  4BR9 A;  4DQ8 A;  2P9L A;  1KC8 O;  4U67 L;  2QWR A;  2Q2R A;  4XH4 A;  4B1V A;  3AGK A;  5BRH A;  1G99 A;  5KPT A;  3CF5 L;  3TSQ A;  1VQ7 N;  4FPB A;  5JVG L;  2P9P B;  2QWO A;  3RSE A;  4BRH A;  4YOY A;  1VAZ A;  3C7N B;  5AQG A;  4CJ7 A;  4JKG A;  2OAN A;  2FF3 B;  4B9Q A;  1HKG A;  1X9J A;  4BQZ A;  5KQ8 A;  1YIT N;  3CPE A;  4J8F A;  2YHY A;  1U2V A;  3H3O B;  5LY3 A;  3HRG A;  2ASO A;  2Q0U A;  4CZJ A;  1LCU A;  1NGE A;  4K41 A;  5AZJ B;  3E66 A;  4KH4 A;  3LDN A;  3A5L C;  3R3L A;  4PL8 A;  4CD1 A;  1Y64 A;  1M1K O;  3D2F B;  4JNE A;  4WFA L;  3FZF A;  5F2R A;  5AQM A;  4WQ5 C;  1NGD A;  3CCJ N;  4H0X B;  3LL3 A;  2RHK A;  3H6E A;  4EIA A;  5AQP A;  4MDB A;  2J4R A;  1Q82 O;  3ZX3 A;  5AR0 A;  4YOV A;  2Q97 A;  3MN7 A;  3A5N C;  4GNI A;  3NMU A;  5BRD A;  1K9M O;  1J6Z A;  2P9U B;  4YOT A;  4LC9 B;  1RDU A;  4JKC A;  4BRO A;  1T6D A;  2YHW A;  3J8A A;  4FOI A;  2QW9 A;  4JN4 A;  4NO7 A;  4A61 A;  3VF4 A;  5BPL A;  4GV9 A;  4A5B A;  4UY8 O;  2JWK A;  3AY9 A;  1NGG A;  2NRX A;  1BA1 A;  1HUX A;  2NRT A;  4BGA A;  3KVG A;  3ATU A;  4A2B A;  4BRI A;  4AM7 A;  2QWQ A;  2UYT A;  1U6Z A;  3O6W A;  5CR4 A;  4WCE L;  3EN9 A;  1JCE A;  3KK7 A;  5DM6 L;  4IDH A;  1D4X A;  3U9Z A;  3VGM A;  4BRG A;  4M7Y A;  1YXQ A;  4BR7 A;  1VQ5 N;  1MWM A;  2NRH A;  3H3N O;  3K9J A;  4A59 A;  3CJ1 A;  3LDO A;  3CQX A;  3QML A;  2ZJQ L;  3HOS A;  1Q7Y O;  3G4S N;  3U9D A;  4B1X B;  1VQ4 N;  2QEX N;  3QFP A;  3O08 A;  2JWL A;  3ZX2 A;  4O8K A;  3GL1 A;  1BWF O;  1DKG D;  4IWV A;  2E20 A;  3CC7 N;  3D7E O;  2HF4 A;  4EAH D;  3CJB A;  4Z94 A;  4R79 A;  1HJO A;  3TTD A;  5JMV A;  3CME N;  1BG3 A;  1S72 N;  1QQO A;  5C0Y A;  2CGK A;  1NBW A;  2P9I B;  4JK7 A;  4PKI A;  4BVO A;  2GTD A;  2Q36 A;  3ENB A;  1E4G T;  4XEI A;  2D0P A;  3ZEU A;  4DKW A;  4EHU A;  3LM2 A;  4BRN A;  5AQR A;  4WQ4 A;  4MO4 A;  3BEX A;  2P9P A;  3HSC A;  4I6M A;  5AFU H;  4F9O A;  3C7N A;  5BRE A;  1XQS C;  3ENH A;  2QA4 N;  4JK9 A;  4OO1 J;  2E1Y A;  5EVZ A;  1BU6 O;  1NM1 A;  5M1P A;  3HBT A;  3MN6 A;  5AQU A;  3EKS A;  1Q86 O;  5AQQ A;  3SK3 A;  5JLH A;  4OPA A;  4YOU A;  3UKR B;  3R6M A;  3N4Q A;  2P9K A;  3CD6 N;  3MWP A;  3O9T A;  1K8K B;  2ITM A;  3O5B A;  5BN8 A;  3QIC A;  4H0P A;  1ZBS A;  3ZET B;  3CMA N;  3ID8 A;  1VQL N;  2AA4 A;  5M1F A;  5FPD A;  3CER A;  1GLB G;  3E1Y A;  2Q1N A;  1IJJ A;  1LOT B;  2I7N A;  3ATV A;  3E9L A;  1JCF A;  4FWP A;  2E2O A;  3CJC A;  4WQ4 C;  2BTF A;  1V4T A;  3VTI A;  5EY4 A;  4K42 A;  5AZI A;  4MLH A;  3JXU A;  3W0L A;  3DXK B;  2QTD A;  3R9P A;  1T44 A;  4JD2 B;  3L6Q A;  3KWI A;  2ZGY A;  1K73 O;  4FWL A;  4BVP A;  2NRV A;  5AQF A;  4XH1 A;  3CI5 A;  3DXM B;  1S22 A;  2RE2 A;  2AP1 A;  3CCE N;  3EZW A;  3ULE A;  4XH5 A;  3LDP A;  2V7Z A;  5ADX H;  4GY2 B;  2ZF5 O;  1HPM A;  3A0I X;  5M1Q A;  4JKE A;  1DT9 A;  2QM1 A;  1QQM A;  2V51 B;  4B1W B;  2GEL A;  3FE1 A;  4BR0 A;  5JIC A;  4HWI A;  4CZH A;  1W97 L;  1RDW X;  4HTL A;  3VEW A;  4H03 B;  1TYQ A;  1ZXO A;  1YVN A;  2GX9 A;  4CZL A;  5F0X A;  5GAH P;  3LDL A;  2HBJ A;  5BPM A;  1QVG M;  2ASM A;  5KPR A;  1NJI O;  4IO8 A;  3SLC A;  4EHT A;  2VCP A;  5M1O A;  1EO1 A;  1RFQ A;  4BY9 C;  5AQI A;  3MN9 A;  4FWR A;  4ILH A;  3H46 O;  3H1V X;  2QWN A;  3HI0 A;  5C2D A;  2NRR A;  5GIN A;  2PAV A;  4GV6 A;  2P9S A;  3F5T A;  3WQT A;  3DAW A;  3C0B A;  5AQO A;  3CC4 N;  1WUA A;  3PIP L;  5FPM A;  5B8H A;  3EL2 A;  3Q7B A;  5CHI A;  3M1F A;  1KAY A;  2BH1 A;  3L0Q A;  3HTV A;  3M5R A;  1MDU B;  2P9N B;  1OKJ A;  3P4I A;  1GLE G;  4IEI A;  3M6G A;  1KQS M;  1KAX A;  1S3X A;  3N4P A;  1O13 A;  3C6A A;  3FZL A;  1KD1 O;  4FWS A;  4BRC A;  4CBX A;  4ISE A;  1Z6R A;  1P90 A;  4GV3 A;  4BQL A;  1VQO N;  4O5F A;  3U8X A;  4FVU A;  3D2E B;  3O1W A;  2WC9 A;  3EKU A;  2WUS A;  3TSU A;  3PIO L;  3W3D A;  1P8Z A;  3UKU A;  1NLV A;  4RTF D;  2V52 B;  3CXC M;  2FSJ A;  5BN9 A;  1KAZ A;  2IVP A;  4H0O A;  3E9O A;  3IMX A;  5AQY A;  3T69 A;  1ESV A;  1V4S A;  2CH6 A;  1MA9 B;  3DWL A;  5AQH A;  4CZF A;  1X3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...