5M1FA

Crystal structure of the large terminase nuclease from thermophilic phage g20c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
187
structure length
186
Chain Sequence
MNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
total genus 61
structure length 186
sequence length 187
ec nomenclature
pdb deposition date 2016-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17289 Terminase_6C Terminase RNaseH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1fA00
4IEIA 3C6HA 5M1OA 4IDHA 5M1QA 5C12A 5M1PA 5C15A 5C2FA 5M1NA 5M1FA 3CPEA 5M1KA 4IFEA 5C2DA 5C10A 4IEEA 3C6AA
chains in the Genus database with same CATH superfamily
5E26A 3KZBA 3SMPA 1RDAA 4BRDA 4BRHA 5E84A 5HRRA 4YOYA 3WNHA 1W0HA 3DXKA 3AY9A 1IKYA 3VQDA 4QS9A 4CJUA 4X62K 3BY5A 4RTFD 4DV6K 5SWMA 3NFAA 1U48A 4BGAA 1KRPA 2P9LB 1QVFM 2QWPA 4IEIA 2G8IA 5C2FA 4FL9A 5BN8A 3ZX0A 3LAKA 4BDPA 1CXUA 1UAXA 3VQAA 4LH4A 3AO3A 5I42A 3L3VA 3ZCMA 4XEIA 1NJYA 1NNEA 4DQSA 1K8KA 4CEQA 2P51A 1HNXK 4GKKK 3LP1A 3VEYA 4B1XB 4A2BA 2HHXA 1WUAA 3KIOA 1HNWK 4H5TA 1EKEA 5M1PA 2NRTA 5BR9A 3MWTA 5H1SQ 3V9WA 4OJRA 4ILJA 1KD1O 3CJBA 2HNZA 2A41A 3RSEA 5AQOA 4O8KA 4FOEA 2HMIA 1SQKA 2ZQBA 1FKOA 3D45A 4JKCA 3OS1A 4FK0A 3DMJA 4QS8A 5GINA 3NF8A 1C0TA 5C24A 5J2MA 1NKEA 3ID6A 1C0MA 3ZSWA 1Y97A 4XH5A 4DTNA 4KB1A 3WT0A 3H1VX 3MX5A 4FM2A 4H5NA 3PV8A 4JKAA 4CI6A 1S6QA 3CJ7A 4I9LA 4DKWA 3ZSXA 2WUSA 3WEEB 4O44A 2HHUA 1WOQA 1CZ9A 4J2EA 2HBLA 4JS4A 1NK9A 3A8YA 5T7BA 1RCHA 1NGAA 3DJCA 3SK3A 3L2VA 3O1BA 3VTHA 4FPAA 4JYAK 1NGGA 4WQ5C 1BUPA 2JWKA 3OS0A 1H1VA 2A1RA 1N5YA 3QLHA 4KB0A 4CD1A 2NRWA 3TR8A 1JLQA 4Z0UA 3W0LA 3RMAA 2ASPA 3VQBA 1K73O 1WSFA 3THYA 4RW7A 1HYSA 4E1JA 4BROA 3K57A 1RBUA 1S9GA 5J1EA 4GY2B 3L2QA 1U04A 3C65A 3OW2M 1CZBA 2QM1A 3MWPA 5AFUH 4TSXA 4QS7A 3ALYA 3CD6N 3VEVA 3THXB 3AAPA 3DI6A 1XMQK 1T03A 3VEZA 1NGJA 2G8WA 4LC9B 4DS4A 2NNWA 4H5RA 4JI4K 3U3GA 5LMNK 4V19S 5CZ1A 4YOVA 3Q7CA 2FXUA 2ZWHA 2HVIA 3AVJA 1HKBA 1VQKN 4WFAL 4JRQA 2NRXA 2HHWA 1BI4B 3OBYA 5HP1A 2YHBA 3QNOA 3NF9A 3SAHA 4OPJA 2F9WA 3W3DA 1OVYA 3N4PA 1VSMA 4FWQA 4C23A 2P9SB 1TK5A 1O1WA 4DV3K 4A5BA 4F9OA 4B9UA 4LF8K 3ATUA 1R59O 4DSIA 3DRSA 3QMLA 3TSQA 1IO2A 5KRTA 1TKTA 1VQ7N 2VCPA 4B3SK 3CCMN 3AVIA 3VQ9A 4RW9A 2OPRA 4CZGA 4FLUA 4CEFA 3OJSA 3ZETA 4DR2K 4Q5VA 4YDUA 1P8ZA 3A5OC 4M3WA 3OYHA 3QEWA 5F2RA 4K25A 5IWAK 4E19A 4H0PA 3WXIA 1S6PA 4BRMA 1NJXA 3U8XA 3OY9A 3ZLJA 4E3SA 4JD2A 4AHSA 3CQYA 2KHOA 3AVAA 5HOOA 1JL2A 2BANA 4DTMA 5AZIB 3OYMA 1BHLA 1RDWX 4CJVA 3AVMA 2XY8A 4FM0A 4J8FA 4JHDB 1MA9B 3M1FA 1UA1A 3MN7A 4HHTA 5JVGL 4BR9A 1Q9XA 3C0BA 1ZBHA 3CMEN 3R1XA 4CZKA 3CG7A 4LF6K 1GLCG 1NMDA 2RKIA 4RW4A 3LP0A 3IFRA 5HBMA 4H0XB 3FZFA 1VRTA 4O0JA 2FLOA 5HL7L 2VQEK 2W40A 1BCMA 5M1NA 3ID8A 3PSFA 4CF9A 5FPDA 1Q86O 1M90O 1X3NA 2GV9A 4Z4GA 1TV6A 4Y1DA 1KLMA 4X66K 3NF7A 4EHTA 1BDGA 4FWRA 4DMNA 1U4BA 2BE2A 1YJ9N 3LWLA 3O8MA 3A5LC 3RMDA 3P38A 4DSFA 4JK7A 5F1XA 1KAZA 2FBXA 3K5OA 3L4IA 2HF3A 1IKVA 4PKHA 1VQPN 3T7ZA 2BUPA 3WUHA 1WB9A 3CM5A 2D0OA 2KW4A 3UKUA 4BRNA 3NHGA 4GVEA 3IAYA 1S1WA 3NVMA 4BDYA 1JXBA 3H3OB 4K0KK 3LDQA 4DV7K 3M6GA 2ZGZA 4H4OA 3HPHA 2FBYA 3H6EA 2KFNA 3VF6A 3HP6A 4DTPA 2O4IA 4FW2A 4XH4A 3ASMA 1SKWA 3TANA 3LZJA 3KD1E 4BR0A 1EP4A 3OYCA 5FLXO 2V7YA 4PKIA 1S1UA 1RT2A 1YI2N 1RDCA 4DB3A 3THWA 2QXFA 4BR5A 1SUQA 1WSIA 3ULEB 4W5OA 3H08A 3SUQA 1NMNA 3TTCA 5KGXA 2EX3A 1T6CA 1DTTA 3HP9A 1IG9A 2FBTA 2KFZA 4ID1A 2O8FB 4JI5K 2HW3A 4CZIA 4EHUA 4GV9A 4C8MA 3HRGA 4H0OA 3ISNC 3K0SA 2E2QA 4C8KA 4NLBA 5BPLA 1QZ6A 3CF5L 3OYIA 1E3MA 1C1BA 4L3QA 1RGIA 1XNQK 4HVJA 1D4XA 4I6MA 3ZX2A 4B9NA 3TI0A 1S3XA 3MCAB 4CF1A 3PX4A 4EAHD 1Z05A 1VSLA 4CJ3A 3U9DA 2KKZA 3CJAA 3WNFA 4B08A 1IJJA 3L0QA 4OGCA 3D7EO 1QS4A 1D9DA 1JJ2M 3HO1A 5FDLA 1RTJA 4E1NA 2V51B 3CC7N 1OH7A 5AQSA 3I55N 1V4TA 4FLZA 4CEAA 3PY8A 3VQ4A 2E6MA 4A62A 3GE1A 4CJFA 3T1HK 3HM8A 1JLAA 5BPMA 4BRCA 1NGEA 2Y1IA 1OKJA 3CFOA 3NGYA 4B3RK 4CZFA 4U7BA 4E0DA 1S5JA 1JL1A 3ZT2A 4CZLA 2P9UB 3F2KA 4O0IA 4BWJA 4CBWA 3FE1A 2I5JA 1GLDG 3GOIA 3A0IX 4CZMA 4CJRA 3CC4N 3SI6A 4FJKA 5KPRA 1EETA 4U67L 4ZHRA 3ZT3A 3IDHA 1QSYA 1S72N 2PYJA 1LWCA 1ZC6A 3NVKA 1XC9A 4NCBA 1HR0K 3ZT1A 5AQFA 4FJHA 1NBWA 4IFEA 1X9WA 2B5JA 4M45A 4CGIA 2GUPA 1J5OA 3M8PA 3HSTB 1YTAA 2R7YA 1XHZA 1FW6A 2P9LA 3LDPA 3HVRA 4Q0BA 1HYZA 3OYBA 1KVAA 2VG7A 1SS6A 1XUPO 5GIOA 2Q1NA 2HOEA 3WQUA 4IO9L 4KO0A 1BO5O 3HJFA 2YHWA 4FLYA 4B3MK 3SNNA 4BRAA 3O1WA 5BPNA 4M41A 4CD3A 4KFBA 1NGDA 3TTDA 4FZYA 5C25A 4DUZK 1RDDA 5EVZA 4RG8A 3VTIA 2CGJA 1DKGD 2QK9A 2QWRA 1BQMA 2E1YA 4HTLA 2W6LA 3OYFA 1VQMN 2YNHA 1NGCA 5TKWA 1LV5A 3CI5A 4OKJA 4OPHA 4W5TA 3DLRA 4FW1A 5AQZA 1DEJA 3M3ZA 4DHYA 4N5SA 3IMXA 1GOCA 2UXCK 4LSLA 3OYLA 3LDSA 4H8KA 3O9UA 4R79A 5BREA 4JAXA 3ULDA 3CCJN 2UUCK 1BCOA 3L2UA 2Z1JA 2YKNA 5C42A 4DS5A 4A61A 3L2WA 1YITN 4ZTFA 1J53A 2GELA 2ITGA 1RBVA 4JKGB 1YVUA 1ITGA 4ISFA 4JI0K 4FWSA 3J7ZO 1MWMA 5GIPA 2D1KA 3L2RA 2ASOA 1QHTA 4AM6A 2UU9K 1U47A 3R6MA 2VGMA 3C95A 2DY4A 4JI2K 4CJTA 5B8HA 4YORA 1TK8A 1C6VA 4CHOA 3AVNA 5AJ3K 3JS6A 3DRRA 1SKSA 3FZLA 1YAGA 3FZKA 4QCLA 5JLHA 1QQCA 3MK6A 3SUNA 3IUCA 3BDPA 2F4VK 4IKFA 3DLEA 4L8RB 2UYTA 4EZ6A 1X1PA 4F3TA 5EOYA 1VSJA 2KZZA 4YOUA 4JKEA 4A2AA 1ZYQA 3TAEA 2AA4A 4IDKA 2YV0X 4B1UB 1B92A 4I2PA 1RBSA 2OTJN 4CHNA 4AHRA 4CESA 4NCGA 1GOBA 2WOMA 3CHWA 3THXA 1JCEA 4FWOA 1QE1A 2DFFA 4NYNA 5CHIA 3SYZA 1HNZK 4B9LA 3HOTA 1HX1A 1K8AO 1IBMK 3V1QA 3QDKA 4CIEA 3GBTA 4W5RA 1EX4A 3KWGA 1HKGA 1WNSA 1NOYA 5FRMA 4NLCA 1NK5A 4FJIA 1HJOA 3DLKA 3MEGA 4ILGB 4LY7A 3VETA 3ZSYA 4DTJA 4A5AA 1BI4A 1IBLK 1RBRA 4KI6A 2RF2A 1KCFA 4AH9A 3AVCA 1T7PA 1F21A 5LY3A 5GAHP 3AVGA 2P9SA 3DWLA 3KLEA 5HRNA 4NCAA 2GEMA 2CH5A 4N41A 1WBBA 1ZBFA 4RCHA 3AV9A 2JGUA 1GOAA 3VQ6A 4CJWA 2A6AA 2WBNA 3NF6A 2ZJRL 4X65K 5KPZA 4F8RA 1NJIO 4MO5A 1WAJA 2I7PA 5BRHA 3BF3A 1SL1A 1NK0A 1KC8O 1TYQB 2ETJA 3I56N 3WNGA 1BA0A 4DV5K 3OBWA 1HQEA 3C7NB 3PX6A 3KLGA 5JLFA 3M8QA 3EO3A 4X64K 3VQEA 2F8TA 4GV6A 3BZCA 2PY5A 4DWIA 2Q2RA 3AA5X 4CF8A 1SZ2A 1S22A 2KQ2A 4MLHA 4OGEA 4OPKA 3E66A 5FROA 3P83D 5AZIA 3VMFB 1TVRA 2H3GX 3ZSOA 3KK2A 1JXEA 3EEQA 4JHDA 5AQXA 2A5XA 4MFBA 1BGXT 1IBKK 2GBZA 4CJQA 1GLAG 4FWKA 3DXMB 3OVNA 3QERA 1NKCA 3NMUA 2DFEA 2P5GA 3OYKA 4DTSA 3DYAA 3SQ0A 3AO4A 3CXCM 4CEEA 1KFDA 5AR0A 4M3UA 2ZE2A 1XMOK 4DQIA 4YFUA 1LAVA 3O4QA 3CYMA 1T8EA 1SL0A 2RN2A 4FJLA 3QIPA 4JLHA 1VQLN 3VF2A 4FZZA 3RWUA 1QQNA 2IS3A 3TTFA 1B9FA 3L6QA 1TAUA 3KJVA 4MDBA 4OLAA 3TARA 4DTXA 5F0XA 1X9SA 4KHSA 1QQOA 2IVNA 1BA1A 1A5VA 4N56A 3PIPL 1FXXA 3EKUA 4LD0A 2YHAA 4JKDA 2BGGA 4RW6A 3G0ZA 3OTOK 4PY5A 3I8BA 3NDKA 4BRPA 5AFUA 1FK9A 4R5PA 4CHPA 1S1TA 1I3AA 2P9NB 3M8RA 3QESA 1BIUA 4DCHA 3O6WA 3ZSZA 1S1VA 4CJ4A 4FJGA 5JICA 4N76A 3G6EN 4DTRA 3MEEA 2CGKA 5HROA 2UUBK 3SUOA 3THVA 2V7ZA 4OO1J 3M5RA 3V6DA 4IG3A 5FPMA 4FWNA 4BVPA 3HBTA 3LDLA 3AA4A 3V1OA 3LANA 5JS1A 1SV5A 5BR8K 4FJJA 2HHQA 5AQLA 1VSFA 4GW6A 3VGMA 3PX0A 2G8VA 1N33K 1J5EK 1S1XA 1ILYA 3AGKA 1RDUA 4LFBK 2HB5A 4BGBA 3KWIA 3ULEA 3C6TA 3MDQA 5J2NA 2EWSA 3EY1A 2QWNA 3MXJA 4B1VA 1BISA 1JLCA 2W6KA 3J80O 1ZBLA 2O8FA 3LM2A 2ZD1A 4E7KA 5AQGA 3DLLL 4CJKA 4IG0A 4KHPK 1GLJO 4DF8A 4CCHA 4K8ZA 4O8UA 3ENHA 1JLBA 3BF1A 4JI6K 3KLIA 3VQ5A 3WXMB 1KAXA 4DQRA 2YHXA 1B9DA 1L3SA 2Q97A 1GLBG 1MWKA 3DLGA 3QBWA 3U4LA 2QWLA 3OYJA 4CW7B 3ATVA 4KHWA 3CIPA 5LJWA 1NK8A 5J2PA 3I0SA 4BC4A 3HYFA 4DU1A 4I9QA 3SZ2A 2HNYA 4KAZA 1ATRA 1JCFA 2CH6A 2P9IB 4O4GA 3CJ1A 4AHUA 2KTQA 5ADXH 1G15A 3ENBA 2OANA 4XH1A 2O8BB 1YJNN 5DK5A 1MU2A 4OVLA 2F96A 1ASUA 3S9HA 1WLJA 3AO2A 1VQ4N 4KHNA 2D0PA 3U6FA 2IAJA 1ATNA 2RHKA 3CERA 3SCXA 4DR3K 3V9SA 4ELTA 5ELZA 2XRIA 4BR7A 3IG1A 4B9MA 3HL8A 1QQMA 2IVPA 1RFQA 1HMVA 2NLXA 3KKSA 1TK0A 1T6DA 4FWLA 4DR4K 1K6YA 4HUFA 1WBDA 2FBVA 2AJQA 2QKKA 5C15A 3CQXA 3FFKB 3JAMO 4EP5A 4IXCA 3P39A 2ZM6K 1IV0A 1U49A 3HPOA 4AILC 1HPZA 2UXDK 3D2EB 3THYB 4CHYA 3QETA 3MCPA 4H5WA 4EP4A 3T1AA 4WQ5A 3PSIA 2YNFA 1G99A 1VQ6N 3L3UA 1QSLA 2X6SA 3EZWA 4DR7K 1IKXA 1RILA 2NRHA 3S3OA 5AQMA 4DU4A 1W2BM 4JEPA 3RR7A 1NKBA 4CF2A 1YJWN 1C0FA 3JYTA 3LDOA 4C8OA 2A42A 1TL1A 3WQTA 2VWJA 4DV0K 3LM9A 5AQJA 1D9FA 4HCCA 1REVA 4M7XA 1L3TA 2DTUA 4FJ8A 1RTDA 4CEBA 1MDUB 5AQRA 5C10A 2P9PB 1Q7YO 3IKMA 4GMJB 5DM6L 4LF5K 3EN9A 3O9RA 4NXMK 4BRGA 5EX5A 4DV4K 3QBXA 3C6HA 5FRNA 4FSVA 3SQ1A 4KV8A 3VQCA 3K58A 4K8XA 1GLEG 2B6AA 2VG5A 1TGOA 3CC2N 4KTZA 3HM9A 3LP2A 2WFBA 3ZX3A 4JI8K 1VHXA 5JMVA 1KTQA 4CEOA 4CK3A 1RNHA 3VF4A 4BC5A 4JKHA 2JWLA 3EKSA 3HTVA 3LAMA 4JK8A 4JKBA 2OPSA 4E89A 3J7AP 4MLEA 4FYDA 4WF9L 1TUYA 1NGHA 2VGNA 4G1QA 1YUWA 4IFYA 3SV3A 3VA3A 3PLAA 1LWEA 4CBUA 2RPIA 4DF4A 4ISGA 3QEIA 1VSHA 2VG6A 4DV1K 1RT4A 2DFHA 3R8EA 1I94K 5E41A 1VQNN 3VGKA 3TWHA 2HNDA 3K9KA 3ITHA 4KHYA 2OCEA 4BDZA 4BRKA 3FZHA 5JS2A 4M3ZA 4JKGA 1C0GA 1ZXOA 4IO8A 3I8DA 1U2VB 4E7LA 1SL2A 3SQ4A 3F73A 5HLFA 4CGJA 4PL8A 1YVNA 1NJZA 5M1QA 1BQNA 5FPNA 3A2FA 5LMUK 2D0BA 1LW2A 1HNIA 1NG9A 3VA0A 4BR4A 1VQ5N 1XNRK 1KXPA 2PAVA 3GDQA 2D5RA 5EY4A 2VWKA 3V9XA 2GUIA 3T3FA 4DTUA 4RWTA 3V9ZA 4FJ5A 2HBJA 3SMSA 1WSGA 1ZBIA 2O8CB 1FKPA 4BQZA 3MEDA 4J2BA 4WCEL 2OPQA 4Z4HA 1A5XA 3E9OA 1RTHA 1Z25A 1D8YA 4YHHK 3K59A 4KRFA 3BEXA 2PZSA 5M1OA 2FF6A 4B9VA 3O3FA 3CPEA 4PUOA 4KH5A 3F9MA 5J2QA 4DU3A 5MLCQ 1L3VA 2G8UA 3K5MA 3UKRB 2P9KB 4LFAK 4ID5A 2PFUA 5C0YA 5AQKA 4IDHA 3H46O 4CERA 1IKWA 2OPPA 1OH5A 4BR2A 1C1AA 1P90A 1D5AA 2O4GA 1NK7A 4GV3A 3CCRN 3KD5E 4IEEA 4OKKA 3AVHA 3MXMA 1JLGA 4DLGA 2HSTA 3BP8A 3LL3A 3I33A 1X9MA 2BH1A 4BG8A 3SBGA 1RT1A 2W42A 3TAPA 2HF4A 5I3UA 2XY6A 5CYMA 2Q3SA 1DGKN 3HSCA 3CFPA 3E9PA 1C0UA 2V52B 4UQGA 5HRPA 3GL1A 2QWOA 1TYQA 3BUZB 4LH5A 5GAGP 2F9TA 3J81O 3AVKA 1N34K 4XIUA 2PBDA 1XQSC 2OTLN 2VYPA 2IDOA 2Z1GA 3E01A 4FJNA 3THWB 3AAQA 3C7NA 3NH1A 1QZ5A 4EZ9A 3HPGA 1CLQA 1NGBA 5C2DA 5AQHA 4J2AA 3FR0A 3WXKA 1E4GT 1BU6O 3R9PA 4CFDA 3EE8A 4CE9A 3O4NA 2A3ZA 3TU5A 3TPQA 3EE9A 2D4WA 3TSPA 1J54A 2X78A 2P1JA 3T19A 3O3HA 2IGIA 1QTMA 3O9QA 4DFKA 4IJNA 3WEEA 4CIFA 4DR6K 4WE1A 3OHRA 5EU7A 4JKFA 4H0TB 3QNNA 1V4SA 1HQUA 4I2QA 3UIQA 4GNIA 4DUYK 2IOCA 4JI3K 1JLEA 4DSEA 1IG8A 1DT9A 5AZJB 2DPNA 4EIAA 2YCHA 3T69A 4B3TK 4M3XA 1I39A 4PA1A 3T1YK 1RBTA 1BIZA 3VERA 4CJPA 2E5LK 4CHQA 3CCUN 2F7TA 3CCLN 4AHVA 4KPYA 3B6PA 4FWPA 5AQUA 5A2QO 4CEZA 4ELUA 3AO1A 5K14A 4OPAA 1KVBA 3SJJA 2UXBK 5CZ2A 2GWKA 1BOTO 1X3MA 3OA9A 4BQLA 4JN4A 4FZXC 1Z6RA 4KKOA 3AVFA 3TAQA 5LL6Z 4PHTX 4OKEA 1RT5A 3MN6A 1XHXA 2O8EB 1YT3A 1TAQA 2P9NA 1DLOA 3VQQA 4OX9K 4K43A 4QAGA 4ILHA 5BRDA 1W7AA 1O13A 1RT6A 1XC3A 4FJMA 3V1RA 3MMVA 3MXIA 4AF1A 1U45A 4YDUC 4E7HA 3V9UA 2E2PA 2NZTA 4FWMA 3E9LA 4DFMA 2ITMA 1WSEA 1Q82O 1VSKA 1R0AA 3ZT4A 1J9AA 4DQQA 2NRRA 3E1YA 1T05A 3VEOA 3B8AX 3CCQN 1NGFA 4AM7A 1HJRA 4PQUA 3VEWA 4IOCL 4GKJK 5M1FA 3L8BA 1KVCA 2CGLA 3DRPA 4JK9A 4J2DA 4LF7K 3QICA 2XY7A 2B4JA 4CK1A 3V4IA 3DAWA 1NK6A 1YXQA 4DSLA 1YF5L 4CZEA 3KTQA 3ZEUB 3G4SN 1SAZA 4DSKA 1Q8IA 2O8DB 1N36K 3GG4A 5CE3A 4F4KA 4FK4A 2HBMA 2FSNA 3IS9A 4CGHA 1LWFA 3G25A 2WONA 1UOCA 3AA3A 1VQ8N 4B3OA 3O5BA 3BGRA 3FZMA 4WFNL 4LSNA 4H0YB 3S41A 2P9IA 5AQTA 3L4QA 4B8AB 3O4WA 1Y64A 4DQPA 2QWMA 3P4IA 2O8BA 2D0AA 4BC2A 3LWMA 3O9TA 4PKGA 3ZT0A 1JKHA 3OYNA 3VOVA 5KI6A 2W41A 1VK0A 3MN5A 1WN7A 2LSNA 4CZHA 4Y0WA 3D2FB 3SUPA 3KLFA 5I9EB 4E7IA 3ZYYX 1WAFA 4CGGA 4CJEA 2QA4N 2HVHA 3WXJA 3K5LA 4NO7A 2E6LA 3RRGA 3LALA 4OLBA 5KGWA 5D3GA 5AQYA 3QB0A 1VSDA 2QWQA 4ELVA 4CF0A 3D2EA 3VQ8A 4FPBA 3WNEA 1N8RO 2IVOA 3SJHA 2I7NA 1GLLO 3VN5A 3TAFA 4FO0A 4JI1K 5DMRA 4BE1A 3DXKB 3KLHA 1HRHA 3DM2A 4FLXA 5BN9A 1Q9YA 4F3OA 3NAEA 5GADP 3TAGA 1EWQA 3C6UA 5KQ8A 4MDAA 3LZIA 4FJ9A 3G71N 1VRUA 5CY4A 3NH0A 4B9SA 4JS5A 3O80A 1JCGA 2FF3B 2YNIA 4HCBA 4ZTJA 1TKZA 3O08A 4M42A 2P9PA 1NJWA 1K8KB 4MO4A 3OYEA 3U9ZA 4DR1K 4O5BA 1YIJN 4BRLA 1TUUA 4FOIA 4JNEA 2P5OA 4FXDA 4G9ZA 1GLFO 2Q0UA 4HTUA 2XO7A 2ZJPL 1HUXA 4C8NA 4H0VB 5KQDA 5JVHL 5AQVA 4IBNA 2X6NA 1EO1A 2YX6A 4FJ7A 1EXQA 3RSEB 2A1SA 1NWKA 2E2OA 1BG3A 3KHYA 2FSKA 1ATSA 3VPZA 4QOZB 5AQWA 3S3MA 3CQ8A 5LJVA 1HLUA 1SKRA 1A5WA 5AQNA 2QEXN 3SLCA 4BG9A 3NBPA 3RTVA 4KTQA 3VESA 4Z4FA 2HHTA 3MN9A 1U2VA 1NK4A 4MQ3A 2G8HA 4M7YA 3H3NO 3I0RA 4JV5K 4NXNK 3HVTA 4O55A 3O9SA 4WQ4C 3SAGA 4BREA 1RDBA 4YOXA 4KI4A 3EZ5A 4BY9C 3KK3A 3DLBA 5ADXA 4Z4IA 1VQ9N 2GTDA 4K42A 2P9UA 2OYQA 2O8CA 3TAMA 3VGLA 4LFCK 3RRHA 4H03B 3OS2A 3CCSN 2G8KA 1HYVA 4ICLA 4FM1A 1ASVA 3QEVA 1NU0A 1XWLA 3VQPA 4AQYK 4CFAA 4NB4A 2X74A 3SAFA 3N4QA 2RE2A 4B9QA 1U6ZA 3CETA 3AVBA 4BE0A 4CBXA 2ZF5O 5AQQA 3H45C 3UKRA 2P9KA 4FLTA 1OH8A 3QINA 3MAQA 3WXLA 3DOKA 3FLCO 3QFUA 3AARA 5DM7L 1T44A 3CCVN 1RTIA 4BRQA 4A57A 4N47A 4B1YB 3P1GA 3EYZA 4AHCA 1CXQA 3NCIA 2E8AA 4W5NA 2HMPA 1ZBUA 4DR5K 3D6RA 3SV4A 2BDPA 2YJFA 2WC9A 4KHQA 3ENOA 2A40A 2E4LA 3AA2A 3PUFA 2F8SA 5GAEP 4IOXA 3FFIA 3V81A 2JLEA 1VQON 4CFBA 1RT7A 3CFRA 4BE2A 2IC3A 1KLNA 1NOZA 2G8FA 1BL3A 2HHVA 3CM6A 1UA0A 3M8SA 3NE6A 3AO5A 1WSJA 3JSMA 4PWDA 3O3GA 3KKRA 3BZKA 4CEDA 4CJLA 3ZETB 2D0CA 4K41A 4Y1CA 3LP3A 5SZTA 3CCEN 4IWVA 4BC3A 4M3TA 4YOWA 1RT3A 1Q18A 1TKDA 4IFVA 2E20A 1EQYA 4DTOA 5C12A 4BVOA 3PO5A 5M1KA 4IOAL 4Z94A 4DQ8A 1VAZA 3JXUA 1W9HA 1NM1A 4JD2B 3TABA 4BWMA 3HOSA 3J8AA 1KSPA 5CYQA 4FVUA 2GX9A 1L5UA 3CJCA 1HPMA 2Y1JA 2YI1A 1VSIA 3D0PA 3K9JA 4BRIA 1ASWA 2HHHK 4PL7A 4KHUA 2E2NA 5AQIA 2XHBA 4DFJA 5EXWA 2ZGYA 1LW0A 4YNQA 4C1NK 3CPWM 4YOTA 1C1CA 4CFCA 5AZJA 3H1QA 1E4FT 2KLAA 1QSSA 2QKBA 2QXLA 4B1WB 2VWBA 3LPUA 3QFPA 1LOTB 2QI2A 3KK1A 4I7FA 3AGRA 2QW9A 2ZJQL 3CJ9A 3ZSQA 3R3LA 4HWIA 1M1KO 4M3YA 4KBOA 3RR8A 3HI0A 1TL3A 3K2PA 4FJXA 4E7JA 2EHGA 2YNGA 3QIOA 4KH6A 3B6OA 4UY8O 4W5QA 1N6QA 5IT9O 4B9TA 2NRVA 5FPEA 1YTUA 3MECA 1X9JA 4WQ4A 4HUEA 3EL2A 2YJEA 2Q31A 1BWFO 4C1NI 3Q7BA 2O8EA 3QEXA 4AHTA 4JRPA 3PIOL 1VSEA 2HHSA 2AP1A 3QO9A 4DLEA 3CMAN 1XI1A 3S3NA 4DV2K 4WFBL 2OZSA 1OVQA 3LPTA 3SQ2A 5KPTA 1LCUA 3SPZA 3F5TA 2UUAK 3UKUB 2KZMA 3HT3A 3AVLA 4FLWA 4FLVA 1NGIA 1JLFA 2E88A 3ZSRA 4KH4A 3U3YA 4CZJA 3UE5A 4FCYA 1K9MO 1J6ZA 1T3VA 4CJ5A 4M3RA 5BRFA 1IH7A 4B8CA 2Z1IA 2HBKA 4Z4CA 2ASMA 4RW8A 2YHYA 2VQFK 3PO4A 3KK7A 5KRSA 4LF4K 1Q81O 3TSUA 2QTDA 4CIGA 4H5VA 3LDNA 1OH6A 2PYLA 1LAWA 3ZSVA 1ESVA 3G10A 4NYFA 3KVGA 3HXMA 4YY3K 5HRSA 1FJGK 4JI7K 1L3UA 4BRFA 2XY5A 1HKCA 3J7YP 1YHQN 2OA8A 2J4RA 1W97L 4CK2A 3FGUA 2OZMA 4DSJA 3IRXA 4FVMA 4H4MA 3NGZA 3K5NA 3SPYA 3DOLA 3ZEUA 4LF9K 4EFHA 4Z4EA 4WYBA 3RVCA 3P31A 4M63C 2O8DA 4C8LA 3VQ7A 1KAYA 1HNVA 2Q0RA 1KQSM 1N32K 4E1MA 2FSJA 3P5JA 1ZBSA 3HK2A 1EWRA 4I6MB 4DFPA 4IJAA 3RMBA 1UWBA 4B1ZA 4GVMA 2GWJA 4CHZA 5KTQA 3DLHA 3QEPA 3DXMA 2NUBA 4F2RA 3A5NC 4CJ7A 4CGFA 2WTUA 1NLVA 3VEXA 3C94A 3UB5A 4CVNE 4ISEA 3OYAA 4CJSA 4O5FA 2BTFA 1KFSA 3HZ6A 1CZAN 3OYGA 2NRZA 2ATQA 4CECA 2E1ZA 5CR4A 4FK2A 3VENA 3D2FA 4CGDA 1QHAA 2YKMA 3C6AA 3NGIA 3F9KA 3OJUA 1QVGM 1WSHA 4IZ9A 2FC0A 3A5MC 1Z26A 3NH2A 1S9EA 2Q36A 4BACA 3OYDA 1DTQA 2IIRA 4A59A 5TKYA 3MX2A 4KTWA 4HUGA 1TKXA 2Z1HA 4DG1A 5AQPA 3SBTA 4KREA 4F2SA 3RMCA
chains in the Genus database with same CATH topology
5E26A 1ZC6A 3NVKA 3MCPA 4H5WA 2I7NA 3KZBA 1GLLO 4WQ5A 4FO0A 1NBWA 5AQFA 3SMPA 4BRDA 4IFEA 4BRHA 5E84A 4YOYA 3DXKA 1G99A 3AY9A 1VQ6N 3DXKB 2GUPA 4QS9A 3EZWA 5BN9A 2NRHA 4RTFD 5GADP 2P9LA 3LDPA 5AQMA 5KQ8A 4BGAA 2P9LB 4MDAA 1W2BM 4JEPA 2QWPA 1QVFM 4IEIA 3G71N 1SS6A 1XUPO 4FL9A 5C2FA 5GIOA 5BN8A 1YJWN 3ZX0A 1C0FA 3O80A 2Q1NA 1JCGA 2FF3B 3LDOA 2A42A 2HOEA 3WQUA 4IO9L 3WQTA 3LM9A 4XEIA 1BO5O 5AQJA 3O08A 4M7XA 2YHWA 1K8KA 1MDUB 3O1WA 4BRAA 5AQRA 5BPNA 2P9PA 1K8KB 4MO4A 5C10A 2P9PB 3U9ZA 3VEYA 4B1XB 4CD3A 1Q7YO 4A2BA 3IKMA 1YIJN 1NGDA 4BRLA 1TUUA 1WUAA 4FOIA 3TTDA 4JNEA 5DM6L 3EN9A 3O9RA 5EVZA 4BRGA 4H5TA 5EX5A 4G9ZA 3QBXA 3C6HA 4FSVA 5M1PA 2NRTA 1GLFO 5BR9A 3VTIA 1GLEG 2CGJA 1DKGD 2Q0UA 2QWRA 3CC2N 2E1YA 3MWTA 5H1SQ 4HTLA 2WFBA 3ZX3A 1HUXA 2ZJPL 1VQMN 5JMVA 4H0VB 5KQDA 1NGCA 5TKWA 5JVHL 5AQVA 4ILJA 3CI5A 3VF4A 4OPHA 1KD1O 4BC5A 3CJBA 4JKHA 1EO1A 2YX6A 2JWLA 3EKSA 5AQZA 1DEJA 2A41A 3M3ZA 3HTVA 4O8KA 3IMXA 4JK8A 4FOEA 4JKBA 5AQOA 3RSEB 1NWKA 2E2OA 1BG3A 1SQKA 2FSKA 1ATSA 3KHYA 3O9UA 3VPZA 5AQWA 4MLEA 4WF9L 1TUYA 4JKCA 5LJVA 1NGHA 4R79A 5BREA 2VGNA 4JAXA 4QS8A 3CCJN 1YUWA 1HLUA 5GINA 3PLAA 4CBUA 5AQNA 2QEXN 4ISGA 3ID6A 3SLCA 4BG9A 4XH5A 3R8EA 1VQNN 3WT0A 3VGKA 3H1VX 3MX5A 4A61A 3K9KA 4H5NA 1YITN 3VESA 4JKAA 3FZHA 4BRKA 4CI6A 3CJ7A 4JKGA 2GELA 3MN9A 1C0GA 1U2VA 4DKWA 1ZXOA 4IO8A 4JKGB 1U2VB 2WUSA 4ISFA 3WEEB 4FWSA 4M7YA 3H3NO 3J7ZO 1MWMA 5GIPA 2D1KA 1WOQA 4WQ4C 3O9SA 4PL8A 2ASOA 1YVNA 4BREA 3SAGA 2HBLA 3A8YA 5M1QA 4AM6A 5FPNA 4YOXA 3R6MA 1NGAA 3DJCA 3SK3A 3O1BA 3VTHA 2VGMA 1VQ5N 4BR4A 1KXPA 4FPAA 4BY9C 2PAVA 3GDQA 1NGGA 5EY4A 4WQ5C 5B8HA 5ADXA 1BUPA 2JWKA 4YORA 1VQ9N 2GTDA 4K42A 4RWTA 1H1VA 2P9UA 3JS6A 2HBJA 3SMSA 3FZLA 1YAGA 3VGLA 3FZKA 2NRWA 4CD1A 4H03B 5JLHA 3CCSN 3MK6A 4BQZA 4WCEL 3IUCA 3W0LA 3E9OA 2UYTA 2ASPA 1K73O 5EOYA 3BEXA 4YOUA 4E1JA 4JKEA 4BROA 4NB4A 5M1OA 4A2AA 2FF6A 3SAFA 2AA4A 3N4QA 4GY2B 3C65A 3OW2M 3CPEA 2QM1A 2RE2A 3MWPA 4B1UB 4KH5A 4B9QA 1U6ZA 3F9MA 3CETA 5AFUH 2OTJN 4QS7A 4CBXA 3CD6N 2ZF5O 3CHWA 5MLCQ 1JCEA 5AQQA 3H45C 4FWOA 2P9KA 3UKRA 3AAPA 3VEVA 5CHIA 3UKRB 2P9KB 3HOTA 3VEZA 1NGJA 1HX1A 4LC9B 1K8AO 3WXLA 2PFUA 3QDKA 3FLCO 3GBTA 3QFUA 5C0YA 3RSEA 3AARA 5AQKA 5DM7L 4IDHA 3H46O 3KWGA 2NNWA 4H5RA 1HKGA 1T44A 3CCVN 4BR2A 1P90A 4YOVA 3Q7CA 2FXUA 4NLCA 2ZWHA 4A57A 4BRQA 3CCRN 4GV3A 4B1YB 1HJOA 1HKBA 4ILGB 3VETA 4IEEA 1VQKN 4A5AA 4WFAL 2NRXA 3OBYA 2HSTA 3SAHA 3BP8A 2F9WA 3LL3A 3W3DA 1OVYA 3I33A 3N4PA 5LY3A 5GAHP 2BH1A 3DWLA 2E8AA 2P9SA 2HMPA 4FWQA 3SBGA 4BG8A 4C23A 3D6RA 2GEMA 2P9SB 2CH5A 2HF4A 2YJFA 2WC9A 3ENOA 2A40A 4RCHA 4A5BA 4F9OA 3ATUA 5GAEP 1DGKN 1R59O 3HSCA 2A6AA 2WBNA 2ZJRL 4IOXA 3E9PA 1VQON 3QMLA 3TSQA 2V52B 5KPZA 1NJIO 4MO5A 2I7PA 3GL1A 5BRHA 2QWOA 1TYQA 3BF3A 2VCPA 3BUZB 2F9TA 5GAGP 1KC8O 1VQ7N 1TYQB 3CCMN 2PBDA 3I56N 1XQSC 2OTLN 2VYPA 4CZGA 3AAQA 1BA0A 3C7NA 3OBWA 1QZ5A 3C7NB 1NGBA 5C2DA 3ZETA 5JLFA 5AQHA 3EO3A 3ZETB 4GV6A 4K41A 4YDUA 3FR0A 3WXKA 1E4GT 1BU6O 1P8ZA 3A5OC 4IWVA 3R9PA 4BC3A 3EE8A 5F2RA 2Q2RA 4K25A 2A3ZA 3TU5A 4YOWA 1Q18A 4H0PA 3WXIA 3TPQA 3EE9A 2D4WA 4BRMA 3TSPA 2E20A 1EQYA 5C12A 4BVOA 5M1KA 1SZ2A 3U8XA 1S22A 4IOAL 4Z94A 4MLHA 3O9QA 4DQ8A 4IJNA 1VAZA 3JXUA 3E66A 3WEEA 4JD2A 3CQYA 2KHOA 1NM1A 4JD2B 5AZIA 3VMFB 5HOOA 2H3GX 5AZIB 3OHRA 3HOSA 1RDWX 3J8AA 4FVUA 4JKFA 2GX9A 4JHDA 4J8FA 3CJCA 1HPMA 4JHDB 1MA9B 2A5XA 3M1FA 5AQXA 2YI1A 3MN7A 4H0TB 5JVGL 1V4SA 3K9JA 4BRIA 4BR9A 4PL7A 2E2NA 4GNIA 3C0BA 5AQIA 5EXWA 2ZGYA 3CMEN 1GLAG 4FWKA 3DXMB 3R1XA 4C1NK 4CZKA 3NMUA 3CPWM 1IG8A 4YOTA 5AZJA 3H1QA 1GLCG 1NMDA 1DT9A 1E4FT 5AZJB 2DPNA 2KLAA 4EIAA 2QXLA 2YCHA 3IFRA 4B1WB 4H0XB 2VWBA 3T69A 3CXCM 3QFPA 5AR0A 1LOTB 2QI2A 3AGRA 3FZFA 2QW9A 5HL7L 2FLOA 3VERA 2ZJQL 3CJ9A 2W40A 3CCUN 2F7TA 3R3LA 3ID8A 4HWIA 5M1NA 4KBOA 5FPDA 1M1KO 3CCLN 3HI0A 1Q86O 1M90O 1X3NA 1VQLN 3VF2A 4FWPA 5AQUA 1QQNA 3TTFA 3L6QA 4MDBA 4OPAA 4EHTA 5F0XA 4KH6A 1BDGA 4FWRA 2GWKA 4UY8O 1QQOA 2IVNA 1BOTO 1X3MA 1BA1A 3OA9A 4BQLA 2NRVA 4JN4A 5FPEA 1Z6RA 1X9JA 4WQ4A 3PIPL 1YJ9N 3EKUA 3O8MA 3A5LC 3EL2A 2YJEA 2Q31A 4JKDA 1BWFO 4C1NI 3Q7BA 3P38A 4PHTX 3MN6A 4JK7A 5F1XA 3PIOL 1KAZA 3I8BA 2AP1A 2P9NA 3L4IA 4BRPA 5AFUA 3CMAN 2HF3A 2P9NB 4PKHA 4WFBL 4DCHA 4K43A 3O6WA 1VQPN 3T7ZA 5KPTA 2BUPA 3WUHA 4ILHA 5BRDA 1LCUA 1O13A 5JICA 3G6EN 2D0OA 3F5TA 1XC3A 3UKUA 2CGKA 4BRNA 4GVEA 3UKUB 2V7ZA 3NVMA 4OO1J 3M5RA 3H3OB 3MMVA 3LDQA 1NGIA 4AF1A 5FPMA 3M6GA 4FWNA 4BVPA 2E88A 3HBTA 3LDLA 2ZGZA 3H6EA 4KH4A 4YDUC 4CZJA 5AQLA 3VF6A 3UE5A 3VGMA 2E2PA 2NZTA 4FWMA 1J6ZA 1T3VA 3E9LA 1K9MO 5BRFA 2ITMA 4XH4A 2HBKA 1Q82O 4DHYA 1ILYA 2ASMA 3AGKA 4BR0A 1RDUA 2V7YA 2NRRA 4PKIA 3E1YA 2YHYA 3VEOA 3B8AX 3CCQN 1YI2N 1NGFA 3KK7A 4AM7A 4BGBA 1Q81O 3KWIA 3ULEA 4DB3A 3TSUA 2QTDA 4BR5A 4H5VA 3LDNA 3ULEB 3MDQA 2EWSA 1ESVA 2QWNA 3KVGA 3TTCA 3VEWA 4B1VA 1T6CA 4IOCL 4BRFA 3LM2A 1HKCA 1YHQN 5AQGA 5M1FA 4CZIA 2CGLA 4EHUA 2J4RA 3DLLL 1W97L 4JK9A 3QICA 3FGUA 1GLJO 4GV9A 3HRGA 4H0OA 3DAWA 2E2QA 1YXQA 4NLBA 5BPLA 4O8UA 1YF5L 3BF1A 3ENHA 3ZEUA 4CZEA 4EFHA 1QZ6A 4WYBA 3ZEUB 3G4SN 3WXMB 3CF5L 3RVCA 3P31A 1KAXA 4M63C 1SAZA 4L3QA 2YHXA 1KAYA 1RGIA 2Q0RA 1KQSM 1D4XA 2FSJA 2Q97A 3GG4A 5CE3A 4I6MA 1GLBG 2HBMA 1ZBSA 1MWKA 2FSNA 3ZX2A 4I6MB 3QBWA 4IJAA 3U4LA 2QWLA 1S3XA 3MCAB 3G25A 4EAHD 1Z05A 3ATVA 1VQ8N 3CIPA 5LJWA 4B1ZA 3O5BA 2GWJA 3U9DA 3FZMA 2KKZA 3CJAA 4BC4A 4WFNL 1IJJA 3L0QA 3DXMA 3D7EO 4H0YB 2P9IA 3S41A 3A5NC 5AQTA 1ATRA 1JCFA 2CH6A 3L4QA 4CJ7A 1JJ2M 2P9IB 3O4WA 1Y64A 3CJ1A 2QWMA 5ADXH 3P4IA 1NLVA 3VEXA 3ENBA 2OANA 4XH1A 2V51B 3CC7N 4BC2A 5AQSA 3I55N 1YJNN 3UB5A 3O9TA 4PKGA 4ISEA 1V4TA 4O5FA 2BTFA 3HZ6A 1CZAN 2NRZA 3VOVA 2E1ZA 5CR4A 1VQ4N 2W41A 2D0PA 4A62A 3GE1A 3MN5A 3VENA 1ATNA 2RHKA 3D2FA 3CERA 1QHAA 3C6AA 4CZHA 4Y0WA 3HM8A 3D2FB 5BPMA 5ELZA 1QVGM 4BR7A 5I9EB 4BRCA 3CCEN 4IZ9A 1NGEA 1OKJA 3A5MC 3ZYYX 4CZFA 4U7BA 1QQMA 2IVPA 2P9UB 4CZLA 1RFQA 3F2KA 2Q36A 2NLXA 2QA4N 4CBWA 3FE1A 1GLDG 1T6DA 4FWLA 2IIRA 3GOIA 3A0IX 3WXJA 4A59A 4CZMA 4NO7A 5TKYA 3CC4N 5C15A 3CQXA 3FFKB 3MX2A 5KPRA 4IXCA 5AQYA 3QB0A 3P39A 4U67L 2QWQA 3D2EA 3IDHA 4FPBA 5AQPA 3SBTA 3D2EB 1S72N 1N8RO 2IVOA 3SJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEI A;  3C6H A;  5M1O A;  4IDH A;  5M1Q A;  5C12 A;  5M1P A;  5C15 A;  5C2F A;  5M1N A;  5M1F A;  3CPE A;  5M1K A;  4IFE A;  5C2D A;  5C10 A;  4IEE A;  3C6A A; 
#chains in the Genus database with same CATH topology
 5E26 A;  3KZB A;  3SMP A;  1RDA A;  4BRD A;  4BRH A;  5E84 A;  5HRR A;  4YOY A;  3WNH A;  1W0H A;  3DXK A;  3AY9 A;  1IKY A;  3VQD A;  4QS9 A;  4CJU A;  4X62 K;  3BY5 A;  4RTF D;  4DV6 K;  5SWM A;  3NFA A;  1U48 A;  4BGA A;  1KRP A;  2P9L B;  1QVF M;  2QWP A;  4IEI A;  2G8I A;  5C2F A;  4FL9 A;  5BN8 A;  3ZX0 A;  3LAK A;  4BDP A;  1CXU A;  1UAX A;  3VQA A;  4LH4 A;  3AO3 A;  5I42 A;  3L3V A;  3ZCM A;  4XEI A;  1NJY A;  1NNE A;  4DQS A;  1K8K A;  4CEQ A;  2P51 A;  1HNX K;  4GKK K;  3LP1 A;  3VEY A;  4B1X B;  4A2B A;  2HHX A;  1WUA A;  3KIO A;  1HNW K;  4H5T A;  1EKE A;  5M1P A;  2NRT A;  5BR9 A;  3MWT A;  5H1S Q;  3V9W A;  4OJR A;  4ILJ A;  1KD1 O;  3CJB A;  2HNZ A;  2A41 A;  3RSE A;  5AQO A;  4O8K A;  4FOE A;  2HMI A;  1SQK A;  2ZQB A;  1FKO A;  3D45 A;  4JKC A;  3OS1 A;  4FK0 A;  3DMJ A;  4QS8 A;  5GIN A;  3NF8 A;  1C0T A;  5C24 A;  5J2M A;  1NKE A;  3ID6 A;  1C0M A;  3ZSW A;  1Y97 A;  4XH5 A;  4DTN A;  4KB1 A;  3WT0 A;  3H1V X;  3MX5 A;  4FM2 A;  4H5N A;  3PV8 A;  4JKA A;  4CI6 A;  1S6Q A;  3CJ7 A;  4I9L A;  4DKW A;  3ZSX A;  2WUS A;  3WEE B;  4O44 A;  2HHU A;  1WOQ A;  1CZ9 A;  4J2E A;  2HBL A;  4JS4 A;  1NK9 A;  3A8Y A;  5T7B A;  1RCH A;  1NGA A;  3DJC A;  3SK3 A;  3L2V A;  3O1B A;  3VTH A;  4FPA A;  4JYA K;  1NGG A;  4WQ5 C;  1BUP A;  2JWK A;  3OS0 A;  1H1V A;  2A1R A;  1N5Y A;  3QLH A;  4KB0 A;  4CD1 A;  2NRW A;  3TR8 A;  1JLQ A;  4Z0U A;  3W0L A;  3RMA A;  2ASP A;  3VQB A;  1K73 O;  1WSF A;  3THY A;  4RW7 A;  1HYS A;  4E1J A;  4BRO A;  3K57 A;  1RBU A;  1S9G A;  5J1E A;  4GY2 B;  3L2Q A;  1U04 A;  3C65 A;  3OW2 M;  1CZB A;  2QM1 A;  3MWP A;  5AFU H;  4TSX A;  4QS7 A;  3ALY A;  3CD6 N;  3VEV A;  3THX B;  3AAP A;  3DI6 A;  1XMQ K;  1T03 A;  3VEZ A;  1NGJ A;  2G8W A;  4LC9 B;  4DS4 A;  2NNW A;  4H5R A;  4JI4 K;  3U3G A;  5LMN K;  4V19 S;  5CZ1 A;  4YOV A;  3Q7C A;  2FXU A;  2ZWH A;  2HVI A;  3AVJ A;  1HKB A;  1VQK N;  4WFA L;  4JRQ A;  2NRX A;  2HHW A;  1BI4 B;  3OBY A;  5HP1 A;  2YHB A;  3QNO A;  3NF9 A;  3SAH A;  4OPJ A;  2F9W A;  3W3D A;  1OVY A;  3N4P A;  1VSM A;  4FWQ A;  4C23 A;  2P9S B;  1TK5 A;  1O1W A;  4DV3 K;  4A5B A;  4F9O A;  4B9U A;  4LF8 K;  3ATU A;  1R59 O;  4DSI A;  3DRS A;  3QML A;  3TSQ A;  1IO2 A;  5KRT A;  1TKT A;  1VQ7 N;  2VCP A;  4B3S K;  3CCM N;  3AVI A;  3VQ9 A;  4RW9 A;  2OPR A;  4CZG A;  4FLU A;  4CEF A;  3OJS A;  3ZET A;  4DR2 K;  4Q5V A;  4YDU A;  1P8Z A;  3A5O C;  4M3W A;  3OYH A;  3QEW A;  5F2R A;  4K25 A;  5IWA K;  4E19 A;  4H0P A;  3WXI A;  1S6P A;  4BRM A;  1NJX A;  3U8X A;  3OY9 A;  3ZLJ A;  4E3S A;  4JD2 A;  4AHS A;  3CQY A;  2KHO A;  3AVA A;  5HOO A;  1JL2 A;  2BAN A;  4DTM A;  5AZI B;  3OYM A;  1BHL A;  1RDW X;  4CJV A;  3AVM A;  2XY8 A;  4FM0 A;  4J8F A;  4JHD B;  1MA9 B;  3M1F A;  1UA1 A;  3MN7 A;  4HHT A;  5JVG L;  4BR9 A;  1Q9X A;  3C0B A;  1ZBH A;  3CME N;  3R1X A;  4CZK A;  3CG7 A;  4LF6 K;  1GLC G;  1NMD A;  2RKI A;  4RW4 A;  3LP0 A;  3IFR A;  5HBM A;  4H0X B;  3FZF A;  1VRT A;  4O0J A;  2FLO A;  5HL7 L;  2VQE K;  2W40 A;  1BCM A;  5M1N A;  3ID8 A;  3PSF A;  4CF9 A;  5FPD A;  1Q86 O;  1M90 O;  1X3N A;  2GV9 A;  4Z4G A;  1TV6 A;  4Y1D A;  1KLM A;  4X66 K;  3NF7 A;  4EHT A;  1BDG A;  4FWR A;  4DMN A;  1U4B A;  2BE2 A;  1YJ9 N;  3LWL A;  3O8M A;  3A5L C;  3RMD A;  3P38 A;  4DSF A;  4JK7 A;  5F1X A;  1KAZ A;  2FBX A;  3K5O A;  3L4I A;  2HF3 A;  1IKV A;  4PKH A;  1VQP N;  3T7Z A;  2BUP A;  3WUH A;  1WB9 A;  3CM5 A;  2D0O A;  2KW4 A;  3UKU A;  4BRN A;  3NHG A;  4GVE A;  3IAY A;  1S1W A;  3NVM A;  4BDY A;  1JXB A;  3H3O B;  4K0K K;  3LDQ A;  4DV7 K;  3M6G A;  2ZGZ A;  4H4O A;  3HPH A;  2FBY A;  3H6E A;  2KFN A;  3VF6 A;  3HP6 A;  4DTP A;  2O4I A;  4FW2 A;  4XH4 A;  3ASM A;  1SKW A;  3TAN A;  3LZJ A;  3KD1 E;  4BR0 A;  1EP4 A;  3OYC A;  5FLX O;  2V7Y A;  4PKI A;  1S1U A;  1RT2 A;  1YI2 N;  1RDC A;  4DB3 A;  3THW A;  2QXF A;  4BR5 A;  1SUQ A;  1WSI A;  3ULE B;  4W5O A;  3H08 A;  3SUQ A;  1NMN A;  3TTC A;  5KGX A;  2EX3 A;  1T6C A;  1DTT A;  3HP9 A;  1IG9 A;  2FBT A;  2KFZ A;  4ID1 A;  2O8F B;  4JI5 K;  2HW3 A;  4CZI A;  4EHU A;  4GV9 A;  4C8M A;  3HRG A;  4H0O A;  3ISN C;  3K0S A;  2E2Q A;  4C8K A;  4NLB A;  5BPL A;  1QZ6 A;  3CF5 L;  3OYI A;  1E3M A;  1C1B A;  4L3Q A;  1RGI A;  1XNQ K;  4HVJ A;  1D4X A;  4I6M A;  3ZX2 A;  4B9N A;  3TI0 A;  1S3X A;  3MCA B;  4CF1 A;  3PX4 A;  4EAH D;  1Z05 A;  1VSL A;  4CJ3 A;  3U9D A;  2KKZ A;  3CJA A;  3WNF A;  4B08 A;  1IJJ A;  3L0Q A;  4OGC A;  3D7E O;  1QS4 A;  1D9D A;  1JJ2 M;  3HO1 A;  5FDL A;  1RTJ A;  4E1N A;  2V51 B;  3CC7 N;  1OH7 A;  5AQS A;  3I55 N;  1V4T A;  4FLZ A;  4CEA A;  3PY8 A;  3VQ4 A;  2E6M A;  4A62 A;  3GE1 A;  4CJF A;  3T1H K;  3HM8 A;  1JLA A;  5BPM A;  4BRC A;  1NGE A;  2Y1I A;  1OKJ A;  3CFO A;  3NGY A;  4B3R K;  4CZF A;  4U7B A;  4E0D A;  1S5J A;  1JL1 A;  3ZT2 A;  4CZL A;  2P9U B;  3F2K A;  4O0I A;  4BWJ A;  4CBW A;  3FE1 A;  2I5J A;  1GLD G;  3GOI A;  3A0I X;  4CZM A;  4CJR A;  3CC4 N;  3SI6 A;  4FJK A;  5KPR A;  1EET A;  4U67 L;  4ZHR A;  3ZT3 A;  3IDH A;  1QSY A;  1S72 N;  2PYJ A;  1LWC A;  1ZC6 A;  3NVK A;  1XC9 A;  4NCB A;  1HR0 K;  3ZT1 A;  5AQF A;  4FJH A;  1NBW A;  4IFE A;  1X9W A;  2B5J A;  4M45 A;  4CGI A;  2GUP A;  1J5O A;  3M8P A;  3HST B;  1YTA A;  2R7Y A;  1XHZ A;  1FW6 A;  2P9L A;  3LDP A;  3HVR A;  4Q0B A;  1HYZ A;  3OYB A;  1KVA A;  2VG7 A;  1SS6 A;  1XUP O;  5GIO A;  2Q1N A;  2HOE A;  3WQU A;  4IO9 L;  4KO0 A;  1BO5 O;  3HJF A;  2YHW A;  4FLY A;  4B3M K;  3SNN A;  4BRA A;  3O1W A;  5BPN A;  4M41 A;  4CD3 A;  4KFB A;  1NGD A;  3TTD A;  4FZY A;  5C25 A;  4DUZ K;  1RDD A;  5EVZ A;  4RG8 A;  3VTI A;  2CGJ A;  1DKG D;  2QK9 A;  2QWR A;  1BQM A;  2E1Y A;  4HTL A;  2W6L A;  3OYF A;  1VQM N;  2YNH A;  1NGC A;  5TKW A;  1LV5 A;  3CI5 A;  4OKJ A;  4OPH A;  4W5T A;  3DLR A;  4FW1 A;  5AQZ A;  1DEJ A;  3M3Z A;  4DHY A;  4N5S A;  3IMX A;  1GOC A;  2UXC K;  4LSL A;  3OYL A;  3LDS A;  4H8K A;  3O9U A;  4R79 A;  5BRE A;  4JAX A;  3ULD A;  3CCJ N;  2UUC K;  1BCO A;  3L2U A;  2Z1J A;  2YKN A;  5C42 A;  4DS5 A;  4A61 A;  3L2W A;  1YIT N;  4ZTF A;  1J53 A;  2GEL A;  2ITG A;  1RBV A;  4JKG B;  1YVU A;  1ITG A;  4ISF A;  4JI0 K;  4FWS A;  3J7Z O;  1MWM A;  5GIP A;  2D1K A;  3L2R A;  2ASO A;  1QHT A;  4AM6 A;  2UU9 K;  1U47 A;  3R6M A;  2VGM A;  3C95 A;  2DY4 A;  4JI2 K;  4CJT A;  5B8H A;  4YOR A;  1TK8 A;  1C6V A;  4CHO A;  3AVN A;  5AJ3 K;  3JS6 A;  3DRR A;  1SKS A;  3FZL A;  1YAG A;  3FZK A;  4QCL A;  5JLH A;  1QQC A;  3MK6 A;  3SUN A;  3IUC A;  3BDP A;  2F4V K;  4IKF A;  3DLE A;  4L8R B;  2UYT A;  4EZ6 A;  1X1P A;  4F3T A;  5EOY A;  1VSJ A;  2KZZ A;  4YOU A;  4JKE A;  4A2A A;  1ZYQ A;  3TAE A;  2AA4 A;  4IDK A;  2YV0 X;  4B1U B;  1B92 A;  4I2P A;  1RBS A;  2OTJ N;  4CHN A;  4AHR A;  4CES A;  4NCG A;  1GOB A;  2WOM A;  3CHW A;  3THX A;  1JCE A;  4FWO A;  1QE1 A;  2DFF A;  4NYN A;  5CHI A;  3SYZ A;  1HNZ K;  4B9L A;  3HOT A;  1HX1 A;  1K8A O;  1IBM K;  3V1Q A;  3QDK A;  4CIE A;  3GBT A;  4W5R A;  1EX4 A;  3KWG A;  1HKG A;  1WNS A;  1NOY A;  5FRM A;  4NLC A;  1NK5 A;  4FJI A;  1HJO A;  3DLK A;  3MEG A;  4ILG B;  4LY7 A;  3VET A;  3ZSY A;  4DTJ A;  4A5A A;  1BI4 A;  1IBL K;  1RBR A;  4KI6 A;  2RF2 A;  1KCF A;  4AH9 A;  3AVC A;  1T7P A;  1F21 A;  5LY3 A;  5GAH P;  3AVG A;  2P9S A;  3DWL A;  3KLE A;  5HRN A;  4NCA A;  2GEM A;  2CH5 A;  4N41 A;  1WBB A;  1ZBF A;  4RCH A;  3AV9 A;  2JGU A;  1GOA A;  3VQ6 A;  4CJW A;  2A6A A;  2WBN A;  3NF6 A;  2ZJR L;  4X65 K;  5KPZ A;  4F8R A;  1NJI O;  4MO5 A;  1WAJ A;  2I7P A;  5BRH A;  3BF3 A;  1SL1 A;  1NK0 A;  1KC8 O;  1TYQ B;  2ETJ A;  3I56 N;  3WNG A;  1BA0 A;  4DV5 K;  3OBW A;  1HQE A;  3C7N B;  3PX6 A;  3KLG A;  5JLF A;  3M8Q A;  3EO3 A;  4X64 K;  3VQE A;  2F8T A;  4GV6 A;  3BZC A;  2PY5 A;  4DWI A;  2Q2R A;  3AA5 X;  4CF8 A;  1SZ2 A;  1S22 A;  2KQ2 A;  4MLH A;  4OGE A;  4OPK A;  3E66 A;  5FRO A;  3P83 D;  5AZI A;  3VMF B;  1TVR A;  2H3G X;  3ZSO A;  3KK2 A;  1JXE A;  3EEQ A;  4JHD A;  5AQX A;  2A5X A;  4MFB A;  1BGX T;  1IBK K;  2GBZ A;  4CJQ A;  1GLA G;  4FWK A;  3DXM B;  3OVN A;  3QER A;  1NKC A;  3NMU A;  2DFE A;  2P5G A;  3OYK A;  4DTS A;  3DYA A;  3SQ0 A;  3AO4 A;  3CXC M;  4CEE A;  1KFD A;  5AR0 A;  4M3U A;  2ZE2 A;  1XMO K;  4DQI A;  4YFU A;  1LAV A;  3O4Q A;  3CYM A;  1T8E A;  1SL0 A;  2RN2 A;  4FJL A;  3QIP A;  4JLH A;  1VQL N;  3VF2 A;  4FZZ A;  3RWU A;  1QQN A;  2IS3 A;  3TTF A;  1B9F A;  3L6Q A;  1TAU A;  3KJV A;  4MDB A;  4OLA A;  3TAR A;  4DTX A;  5F0X A;  1X9S A;  4KHS A;  1QQO A;  2IVN A;  1BA1 A;  1A5V A;  4N56 A;  3PIP L;  1FXX A;  3EKU A;  4LD0 A;  2YHA A;  4JKD A;  2BGG A;  4RW6 A;  3G0Z A;  3OTO K;  4PY5 A;  3I8B A;  3NDK A;  4BRP A;  5AFU A;  1FK9 A;  4R5P A;  4CHP A;  1S1T A;  1I3A A;  2P9N B;  3M8R A;  3QES A;  1BIU A;  4DCH A;  3O6W A;  3ZSZ A;  1S1V A;  4CJ4 A;  4FJG A;  5JIC A;  4N76 A;  3G6E N;  4DTR A;  3MEE A;  2CGK A;  5HRO A;  2UUB K;  3SUO A;  3THV A;  2V7Z A;  4OO1 J;  3M5R A;  3V6D A;  4IG3 A;  5FPM A;  4FWN A;  4BVP A;  3HBT A;  3LDL A;  3AA4 A;  3V1O A;  3LAN A;  5JS1 A;  1SV5 A;  5BR8 K;  4FJJ A;  2HHQ A;  5AQL A;  1VSF A;  4GW6 A;  3VGM A;  3PX0 A;  2G8V A;  1N33 K;  1J5E K;  1S1X A;  1ILY A;  3AGK A;  1RDU A;  4LFB K;  2HB5 A;  4BGB A;  3KWI A;  3ULE A;  3C6T A;  3MDQ A;  5J2N A;  2EWS A;  3EY1 A;  2QWN A;  3MXJ A;  4B1V A;  1BIS A;  1JLC A;  2W6K A;  3J80 O;  1ZBL A;  2O8F A;  3LM2 A;  2ZD1 A;  4E7K A;  5AQG A;  3DLL L;  4CJK A;  4IG0 A;  4KHP K;  1GLJ O;  4DF8 A;  4CCH A;  4K8Z A;  4O8U A;  3ENH A;  1JLB A;  3BF1 A;  4JI6 K;  3KLI A;  3VQ5 A;  3WXM B;  1KAX A;  4DQR A;  2YHX A;  1B9D A;  1L3S A;  2Q97 A;  1GLB G;  1MWK A;  3DLG A;  3QBW A;  3U4L A;  2QWL A;  3OYJ A;  4CW7 B;  3ATV A;  4KHW A;  3CIP A;  5LJW A;  1NK8 A;  5J2P A;  3I0S A;  4BC4 A;  3HYF A;  4DU1 A;  4I9Q A;  3SZ2 A;  2HNY A;  4KAZ A;  1ATR A;  1JCF A;  2CH6 A;  2P9I B;  4O4G A;  3CJ1 A;  4AHU A;  2KTQ A;  5ADX H;  1G15 A;  3ENB A;  2OAN A;  4XH1 A;  2O8B B;  1YJN N;  5DK5 A;  1MU2 A;  4OVL A;  2F96 A;  1ASU A;  3S9H A;  1WLJ A;  3AO2 A;  1VQ4 N;  4KHN A;  2D0P A;  3U6F A;  2IAJ A;  1ATN A;  2RHK A;  3CER A;  3SCX A;  4DR3 K;  3V9S A;  4ELT A;  5ELZ A;  2XRI A;  4BR7 A;  3IG1 A;  4B9M A;  3HL8 A;  1QQM A;  2IVP A;  1RFQ A;  1HMV A;  2NLX A;  3KKS A;  1TK0 A;  1T6D A;  4FWL A;  4DR4 K;  1K6Y A;  4HUF A;  1WBD A;  2FBV A;  2AJQ A;  2QKK A;  5C15 A;  3CQX A;  3FFK B;  3JAM O;  4EP5 A;  4IXC A;  3P39 A;  2ZM6 K;  1IV0 A;  1U49 A;  3HPO A;  4AIL C;  1HPZ A;  2UXD K;  3D2E B;  3THY B;  4CHY A;  3QET A;  3MCP A;  4H5W A;  4EP4 A;  3T1A A;  4WQ5 A;  3PSI A;  2YNF A;  1G99 A;  1VQ6 N;  3L3U A;  1QSL A;  2X6S A;  3EZW A;  4DR7 K;  1IKX A;  1RIL A;  2NRH A;  3S3O A;  5AQM A;  4DU4 A;  1W2B M;  4JEP A;  3RR7 A;  1NKB A;  4CF2 A;  1YJW N;  1C0F A;  3JYT A;  3LDO A;  4C8O A;  2A42 A;  1TL1 A;  3WQT A;  2VWJ A;  4DV0 K;  3LM9 A;  5AQJ A;  1D9F A;  4HCC A;  1REV A;  4M7X A;  1L3T A;  2DTU A;  4FJ8 A;  1RTD A;  4CEB A;  1MDU B;  5AQR A;  5C10 A;  2P9P B;  1Q7Y O;  3IKM A;  4GMJ B;  5DM6 L;  4LF5 K;  3EN9 A;  3O9R A;  4NXM K;  4BRG A;  5EX5 A;  4DV4 K;  3QBX A;  3C6H A;  5FRN A;  4FSV A;  3SQ1 A;  4KV8 A;  3VQC A;  3K58 A;  4K8X A;  1GLE G;  2B6A A;  2VG5 A;  1TGO A;  3CC2 N;  4KTZ A;  3HM9 A;  3LP2 A;  2WFB A;  3ZX3 A;  4JI8 K;  1VHX A;  5JMV A;  1KTQ A;  4CEO A;  4CK3 A;  1RNH A;  3VF4 A;  4BC5 A;  4JKH A;  2JWL A;  3EKS A;  3HTV A;  3LAM A;  4JK8 A;  4JKB A;  2OPS A;  4E89 A;  3J7A P;  4MLE A;  4FYD A;  4WF9 L;  1TUY A;  1NGH A;  2VGN A;  4G1Q A;  1YUW A;  4IFY A;  3SV3 A;  3VA3 A;  3PLA A;  1LWE A;  4CBU A;  2RPI A;  4DF4 A;  4ISG A;  3QEI A;  1VSH A;  2VG6 A;  4DV1 K;  1RT4 A;  2DFH A;  3R8E A;  1I94 K;  5E41 A;  1VQN N;  3VGK A;  3TWH A;  2HND A;  3K9K A;  3ITH A;  4KHY A;  2OCE A;  4BDZ A;  4BRK A;  3FZH A;  5JS2 A;  4M3Z A;  4JKG A;  1C0G A;  1ZXO A;  4IO8 A;  3I8D A;  1U2V B;  4E7L A;  1SL2 A;  3SQ4 A;  3F73 A;  5HLF A;  4CGJ A;  4PL8 A;  1YVN A;  1NJZ A;  5M1Q A;  1BQN A;  5FPN A;  3A2F A;  5LMU K;  2D0B A;  1LW2 A;  1HNI A;  1NG9 A;  3VA0 A;  4BR4 A;  1VQ5 N;  1XNR K;  1KXP A;  2PAV A;  3GDQ A;  2D5R A;  5EY4 A;  2VWK A;  3V9X A;  2GUI A;  3T3F A;  4DTU A;  4RWT A;  3V9Z A;  4FJ5 A;  2HBJ A;  3SMS A;  1WSG A;  1ZBI A;  2O8C B;  1FKP A;  4BQZ A;  3MED A;  4J2B A;  4WCE L;  2OPQ A;  4Z4H A;  1A5X A;  3E9O A;  1RTH A;  1Z25 A;  1D8Y A;  4YHH K;  3K59 A;  4KRF A;  3BEX A;  2PZS A;  5M1O A;  2FF6 A;  4B9V A;  3O3F A;  3CPE A;  4PUO A;  4KH5 A;  3F9M A;  5J2Q A;  4DU3 A;  5MLC Q;  1L3V A;  2G8U A;  3K5M A;  3UKR B;  2P9K B;  4LFA K;  4ID5 A;  2PFU A;  5C0Y A;  5AQK A;  4IDH A;  3H46 O;  4CER A;  1IKW A;  2OPP A;  1OH5 A;  4BR2 A;  1C1A A;  1P90 A;  1D5A A;  2O4G A;  1NK7 A;  4GV3 A;  3CCR N;  3KD5 E;  4IEE A;  4OKK A;  3AVH A;  3MXM A;  1JLG A;  4DLG A;  2HST A;  3BP8 A;  3LL3 A;  3I33 A;  1X9M A;  2BH1 A;  4BG8 A;  3SBG A;  1RT1 A;  2W42 A;  3TAP A;  2HF4 A;  5I3U A;  2XY6 A;  5CYM A;  2Q3S A;  1DGK N;  3HSC A;  3CFP A;  3E9P A;  1C0U A;  2V52 B;  4UQG A;  5HRP A;  3GL1 A;  2QWO A;  1TYQ A;  3BUZ B;  4LH5 A;  5GAG P;  2F9T A;  3J81 O;  3AVK A;  1N34 K;  4XIU A;  2PBD A;  1XQS C;  2OTL N;  2VYP A;  2IDO A;  2Z1G A;  3E01 A;  4FJN A;  3THW B;  3AAQ A;  3C7N A;  3NH1 A;  1QZ5 A;  4EZ9 A;  3HPG A;  1CLQ A;  1NGB A;  5C2D A;  5AQH A;  4J2A A;  3FR0 A;  3WXK A;  1E4G T;  1BU6 O;  3R9P A;  4CFD A;  3EE8 A;  4CE9 A;  3O4N A;  2A3Z A;  3TU5 A;  3TPQ A;  3EE9 A;  2D4W A;  3TSP A;  1J54 A;  2X78 A;  2P1J A;  3T19 A;  3O3H A;  2IGI A;  1QTM A;  3O9Q A;  4DFK A;  4IJN A;  3WEE A;  4CIF A;  4DR6 K;  4WE1 A;  3OHR A;  5EU7 A;  4JKF A;  4H0T B;  3QNN A;  1V4S A;  1HQU A;  4I2Q A;  3UIQ A;  4GNI A;  4DUY K;  2IOC A;  4JI3 K;  1JLE A;  4DSE A;  1IG8 A;  1DT9 A;  5AZJ B;  2DPN A;  4EIA A;  2YCH A;  3T69 A;  4B3T K;  4M3X A;  1I39 A;  4PA1 A;  3T1Y K;  1RBT A;  1BIZ A;  3VER A;  4CJP A;  2E5L K;  4CHQ A;  3CCU N;  2F7T A;  3CCL N;  4AHV A;  4KPY A;  3B6P A;  4FWP A;  5AQU A;  5A2Q O;  4CEZ A;  4ELU A;  3AO1 A;  5K14 A;  4OPA A;  1KVB A;  3SJJ A;  2UXB K;  5CZ2 A;  2GWK A;  1BOT O;  1X3M A;  3OA9 A;  4BQL A;  4JN4 A;  4FZX C;  1Z6R A;  4KKO A;  3AVF A;  3TAQ A;  5LL6 Z;  4PHT X;  4OKE A;  1RT5 A;  3MN6 A;  1XHX A;  2O8E B;  1YT3 A;  1TAQ A;  2P9N A;  1DLO A;  3VQQ A;  4OX9 K;  4K43 A;  4QAG A;  4ILH A;  5BRD A;  1W7A A;  1O13 A;  1RT6 A;  1XC3 A;  4FJM A;  3V1R A;  3MMV A;  3MXI A;  4AF1 A;  1U45 A;  4YDU C;  4E7H A;  3V9U A;  2E2P A;  2NZT A;  4FWM A;  3E9L A;  4DFM A;  2ITM A;  1WSE A;  1Q82 O;  1VSK A;  1R0A A;  3ZT4 A;  1J9A A;  4DQQ A;  2NRR A;  3E1Y A;  1T05 A;  3VEO A;  3B8A X;  3CCQ N;  1NGF A;  4AM7 A;  1HJR A;  4PQU A;  3VEW A;  4IOC L;  4GKJ K;  5M1F A;  3L8B A;  1KVC A;  2CGL A;  3DRP A;  4JK9 A;  4J2D A;  4LF7 K;  3QIC A;  2XY7 A;  2B4J A;  4CK1 A;  3V4I A;  3DAW A;  1NK6 A;  1YXQ A;  4DSL A;  1YF5 L;  4CZE A;  3KTQ A;  3ZEU B;  3G4S N;  1SAZ A;  4DSK A;  1Q8I A;  2O8D B;  1N36 K;  3GG4 A;  5CE3 A;  4F4K A;  4FK4 A;  2HBM A;  2FSN A;  3IS9 A;  4CGH A;  1LWF A;  3G25 A;  2WON A;  1UOC A;  3AA3 A;  1VQ8 N;  4B3O A;  3O5B A;  3BGR A;  3FZM A;  4WFN L;  4LSN A;  4H0Y B;  3S41 A;  2P9I A;  5AQT A;  3L4Q A;  4B8A B;  3O4W A;  1Y64 A;  4DQP A;  2QWM A;  3P4I A;  2O8B A;  2D0A A;  4BC2 A;  3LWM A;  3O9T A;  4PKG A;  3ZT0 A;  1JKH A;  3OYN A;  3VOV A;  5KI6 A;  2W41 A;  1VK0 A;  3MN5 A;  1WN7 A;  2LSN A;  4CZH A;  4Y0W A;  3D2F B;  3SUP A;  3KLF A;  5I9E B;  4E7I A;  3ZYY X;  1WAF A;  4CGG A;  4CJE A;  2QA4 N;  2HVH A;  3WXJ A;  3K5L A;  4NO7 A;  2E6L A;  3RRG A;  3LAL A;  4OLB A;  5KGW A;  5D3G A;  5AQY A;  3QB0 A;  1VSD A;  2QWQ A;  4ELV A;  4CF0 A;  3D2E A;  3VQ8 A;  4FPB A;  3WNE A;  1N8R O;  2IVO A;  3SJH A;  2I7N A;  1GLL O;  3VN5 A;  3TAF A;  4FO0 A;  4JI1 K;  5DMR A;  4BE1 A;  3DXK B;  3KLH A;  1HRH A;  3DM2 A;  4FLX A;  5BN9 A;  1Q9Y A;  4F3O A;  3NAE A;  5GAD P;  3TAG A;  1EWQ A;  3C6U A;  5KQ8 A;  4MDA A;  3LZI A;  4FJ9 A;  3G71 N;  1VRU A;  5CY4 A;  3NH0 A;  4B9S A;  4JS5 A;  3O80 A;  1JCG A;  2FF3 B;  2YNI A;  4HCB A;  4ZTJ A;  1TKZ A;  3O08 A;  4M42 A;  2P9P A;  1NJW A;  1K8K B;  4MO4 A;  3OYE A;  3U9Z A;  4DR1 K;  4O5B A;  1YIJ N;  4BRL A;  1TUU A;  4FOI A;  4JNE A;  2P5O A;  4FXD A;  4G9Z A;  1GLF O;  2Q0U A;  4HTU A;  2XO7 A;  2ZJP L;  1HUX A;  4C8N A;  4H0V B;  5KQD A;  5JVH L;  5AQV A;  4IBN A;  2X6N A;  1EO1 A;  2YX6 A;  4FJ7 A;  1EXQ A;  3RSE B;  2A1S A;  1NWK A;  2E2O A;  1BG3 A;  3KHY A;  2FSK A;  1ATS A;  3VPZ A;  4QOZ B;  5AQW A;  3S3M A;  3CQ8 A;  5LJV A;  1HLU A;  1SKR A;  1A5W A;  5AQN A;  2QEX N;  3SLC A;  4BG9 A;  3NBP A;  3RTV A;  4KTQ A;  3VES A;  4Z4F A;  2HHT A;  3MN9 A;  1U2V A;  1NK4 A;  4MQ3 A;  2G8H A;  4M7Y A;  3H3N O;  3I0R A;  4JV5 K;  4NXN K;  3HVT A;  4O55 A;  3O9S A;  4WQ4 C;  3SAG A;  4BRE A;  1RDB A;  4YOX A;  4KI4 A;  3EZ5 A;  4BY9 C;  3KK3 A;  3DLB A;  5ADX A;  4Z4I A;  1VQ9 N;  2GTD A;  4K42 A;  2P9U A;  2OYQ A;  2O8C A;  3TAM A;  3VGL A;  4LFC K;  3RRH A;  4H03 B;  3OS2 A;  3CCS N;  2G8K A;  1HYV A;  4ICL A;  4FM1 A;  1ASV A;  3QEV A;  1NU0 A;  1XWL A;  3VQP A;  4AQY K;  4CFA A;  4NB4 A;  2X74 A;  3SAF A;  3N4Q A;  2RE2 A;  4B9Q A;  1U6Z A;  3CET A;  3AVB A;  4BE0 A;  4CBX A;  2ZF5 O;  5AQQ A;  3H45 C;  3UKR A;  2P9K A;  4FLT A;  1OH8 A;  3QIN A;  3MAQ A;  3WXL A;  3DOK A;  3FLC O;  3QFU A;  3AAR A;  5DM7 L;  1T44 A;  3CCV N;  1RTI A;  4BRQ A;  4A57 A;  4N47 A;  4B1Y B;  3P1G A;  3EYZ A;  4AHC A;  1CXQ A;  3NCI A;  2E8A A;  4W5N A;  2HMP A;  1ZBU A;  4DR5 K;  3D6R A;  3SV4 A;  2BDP A;  2YJF A;  2WC9 A;  4KHQ A;  3ENO A;  2A40 A;  2E4L A;  3AA2 A;  3PUF A;  2F8S A;  5GAE P;  4IOX A;  3FFI A;  3V81 A;  2JLE A;  1VQO N;  4CFB A;  1RT7 A;  3CFR A;  4BE2 A;  2IC3 A;  1KLN A;  1NOZ A;  2G8F A;  1BL3 A;  2HHV A;  3CM6 A;  1UA0 A;  3M8S A;  3NE6 A;  3AO5 A;  1WSJ A;  3JSM A;  4PWD A;  3O3G A;  3KKR A;  3BZK A;  4CED A;  4CJL A;  3ZET B;  2D0C A;  4K41 A;  4Y1C A;  3LP3 A;  5SZT A;  3CCE N;  4IWV A;  4BC3 A;  4M3T A;  4YOW A;  1RT3 A;  1Q18 A;  1TKD A;  4IFV A;  2E20 A;  1EQY A;  4DTO A;  5C12 A;  4BVO A;  3PO5 A;  5M1K A;  4IOA L;  4Z94 A;  4DQ8 A;  1VAZ A;  3JXU A;  1W9H A;  1NM1 A;  4JD2 B;  3TAB A;  4BWM A;  3HOS A;  3J8A A;  1KSP A;  5CYQ A;  4FVU A;  2GX9 A;  1L5U A;  3CJC A;  1HPM A;  2Y1J A;  2YI1 A;  1VSI A;  3D0P A;  3K9J A;  4BRI A;  1ASW A;  2HHH K;  4PL7 A;  4KHU A;  2E2N A;  5AQI A;  2XHB A;  4DFJ A;  5EXW A;  2ZGY A;  1LW0 A;  4YNQ A;  4C1N K;  3CPW M;  4YOT A;  1C1C A;  4CFC A;  5AZJ A;  3H1Q A;  1E4F T;  2KLA A;  1QSS A;  2QKB A;  2QXL A;  4B1W B;  2VWB A;  3LPU A;  3QFP A;  1LOT B;  2QI2 A;  3KK1 A;  4I7F A;  3AGR A;  2QW9 A;  2ZJQ L;  3CJ9 A;  3ZSQ A;  3R3L A;  4HWI A;  1M1K O;  4M3Y A;  4KBO A;  3RR8 A;  3HI0 A;  1TL3 A;  3K2P A;  4FJX A;  4E7J A;  2EHG A;  2YNG A;  3QIO A;  4KH6 A;  3B6O A;  4UY8 O;  4W5Q A;  1N6Q A;  5IT9 O;  4B9T A;  2NRV A;  5FPE A;  1YTU A;  3MEC A;  1X9J A;  4WQ4 A;  4HUE A;  3EL2 A;  2YJE A;  2Q31 A;  1BWF O;  4C1N I;  3Q7B A;  2O8E A;  3QEX A;  4AHT A;  4JRP A;  3PIO L;  1VSE A;  2HHS A;  2AP1 A;  3QO9 A;  4DLE A;  3CMA N;  1XI1 A;  3S3N A;  4DV2 K;  4WFB L;  2OZS A;  1OVQ A;  3LPT A;  3SQ2 A;  5KPT A;  1LCU A;  3SPZ A;  3F5T A;  2UUA K;  3UKU B;  2KZM A;  3HT3 A;  3AVL A;  4FLW A;  4FLV A;  1NGI A;  1JLF A;  2E88 A;  3ZSR A;  4KH4 A;  3U3Y A;  4CZJ A;  3UE5 A;  4FCY A;  1K9M O;  1J6Z A;  1T3V A;  4CJ5 A;  4M3R A;  5BRF A;  1IH7 A;  4B8C A;  2Z1I A;  2HBK A;  4Z4C A;  2ASM A;  4RW8 A;  2YHY A;  2VQF K;  3PO4 A;  3KK7 A;  5KRS A;  4LF4 K;  1Q81 O;  3TSU A;  2QTD A;  4CIG A;  4H5V A;  3LDN A;  1OH6 A;  2PYL A;  1LAW A;  3ZSV A;  1ESV A;  3G10 A;  4NYF A;  3KVG A;  3HXM A;  4YY3 K;  5HRS A;  1FJG K;  4JI7 K;  1L3U A;  4BRF A;  2XY5 A;  1HKC A;  3J7Y P;  1YHQ N;  2OA8 A;  2J4R A;  1W97 L;  4CK2 A;  3FGU A;  2OZM A;  4DSJ A;  3IRX A;  4FVM A;  4H4M A;  3NGZ A;  3K5N A;  3SPY A;  3DOL A;  3ZEU A;  4LF9 K;  4EFH A;  4Z4E A;  4WYB A;  3RVC A;  3P31 A;  4M63 C;  2O8D A;  4C8L A;  3VQ7 A;  1KAY A;  1HNV A;  2Q0R A;  1KQS M;  1N32 K;  4E1M A;  2FSJ A;  3P5J A;  1ZBS A;  3HK2 A;  1EWR A;  4I6M B;  4DFP A;  4IJA A;  3RMB A;  1UWB A;  4B1Z A;  4GVM A;  2GWJ A;  4CHZ A;  5KTQ A;  3DLH A;  3QEP A;  3DXM A;  2NUB A;  4F2R A;  3A5N C;  4CJ7 A;  4CGF A;  2WTU A;  1NLV A;  3VEX A;  3C94 A;  3UB5 A;  4CVN E;  4ISE A;  3OYA A;  4CJS A;  4O5F A;  2BTF A;  1KFS A;  3HZ6 A;  1CZA N;  3OYG A;  2NRZ A;  2ATQ A;  4CEC A;  2E1Z A;  5CR4 A;  4FK2 A;  3VEN A;  3D2F A;  4CGD A;  1QHA A;  2YKM A;  3C6A A;  3NGI A;  3F9K A;  3OJU A;  1QVG M;  1WSH A;  4IZ9 A;  2FC0 A;  3A5M C;  1Z26 A;  3NH2 A;  1S9E A;  2Q36 A;  4BAC A;  3OYD A;  1DTQ A;  2IIR A;  4A59 A;  5TKY A;  3MX2 A;  4KTW A;  4HUG A;  1TKX A;  2Z1H A;  4DG1 A;  5AQP A;  3SBT A;  4KRE A;  4F2S A;  3RMC A; 
#chains in the Genus database with same CATH homology
 5E26 A;  1ZC6 A;  3NVK A;  3MCP A;  4H5W A;  2I7N A;  3KZB A;  1GLL O;  4WQ5 A;  4FO0 A;  1NBW A;  5AQF A;  3SMP A;  4BRD A;  4IFE A;  4BRH A;  5E84 A;  4YOY A;  3DXK A;  1G99 A;  3AY9 A;  1VQ6 N;  3DXK B;  2GUP A;  4QS9 A;  3EZW A;  5BN9 A;  2NRH A;  4RTF D;  5GAD P;  2P9L A;  3LDP A;  5AQM A;  5KQ8 A;  4BGA A;  2P9L B;  4MDA A;  1W2B M;  4JEP A;  2QWP A;  1QVF M;  4IEI A;  3G71 N;  1SS6 A;  1XUP O;  4FL9 A;  5C2F A;  5GIO A;  5BN8 A;  1YJW N;  3ZX0 A;  1C0F A;  3O80 A;  2Q1N A;  1JCG A;  2FF3 B;  3LDO A;  2A42 A;  2HOE A;  3WQU A;  4IO9 L;  3WQT A;  3LM9 A;  4XEI A;  1BO5 O;  5AQJ A;  3O08 A;  4M7X A;  2YHW A;  1K8K A;  1MDU B;  3O1W A;  4BRA A;  5AQR A;  5BPN A;  2P9P A;  1K8K B;  4MO4 A;  5C10 A;  2P9P B;  3U9Z A;  3VEY A;  4B1X B;  4CD3 A;  1Q7Y O;  4A2B A;  3IKM A;  1YIJ N;  1NGD A;  4BRL A;  1TUU A;  1WUA A;  4FOI A;  3TTD A;  4JNE A;  5DM6 L;  3EN9 A;  3O9R A;  5EVZ A;  4BRG A;  4H5T A;  5EX5 A;  4G9Z A;  3QBX A;  3C6H A;  4FSV A;  5M1P A;  2NRT A;  1GLF O;  5BR9 A;  3VTI A;  1GLE G;  2CGJ A;  1DKG D;  2Q0U A;  2QWR A;  3CC2 N;  2E1Y A;  3MWT A;  5H1S Q;  4HTL A;  2WFB A;  3ZX3 A;  1HUX A;  2ZJP L;  1VQM N;  5JMV A;  4H0V B;  5KQD A;  1NGC A;  5TKW A;  5JVH L;  5AQV A;  4ILJ A;  3CI5 A;  3VF4 A;  4OPH A;  1KD1 O;  4BC5 A;  3CJB A;  4JKH A;  1EO1 A;  2YX6 A;  2JWL A;  3EKS A;  5AQZ A;  1DEJ A;  2A41 A;  3M3Z A;  3HTV A;  4O8K A;  3IMX A;  4JK8 A;  4FOE A;  4JKB A;  5AQO A;  3RSE B;  1NWK A;  2E2O A;  1BG3 A;  1SQK A;  2FSK A;  1ATS A;  3KHY A;  3O9U A;  3VPZ A;  5AQW A;  4MLE A;  4WF9 L;  1TUY A;  4JKC A;  5LJV A;  1NGH A;  4R79 A;  5BRE A;  2VGN A;  4JAX A;  4QS8 A;  3CCJ N;  1YUW A;  1HLU A;  5GIN A;  3PLA A;  4CBU A;  5AQN A;  2QEX N;  4ISG A;  3ID6 A;  3SLC A;  4BG9 A;  4XH5 A;  3R8E A;  1VQN N;  3WT0 A;  3VGK A;  3H1V X;  3MX5 A;  4A61 A;  3K9K A;  4H5N A;  1YIT N;  3VES A;  4JKA A;  3FZH A;  4BRK A;  4CI6 A;  3CJ7 A;  4JKG A;  2GEL A;  3MN9 A;  1C0G A;  1U2V A;  4DKW A;  1ZXO A;  4IO8 A;  4JKG B;  1U2V B;  2WUS A;  4ISF A;  3WEE B;  4FWS A;  4M7Y A;  3H3N O;  3J7Z O;  1MWM A;  5GIP A;  2D1K A;  1WOQ A;  4WQ4 C;  3O9S A;  4PL8 A;  2ASO A;  1YVN A;  4BRE A;  3SAG A;  2HBL A;  3A8Y A;  5M1Q A;  4AM6 A;  5FPN A;  4YOX A;  3R6M A;  1NGA A;  3DJC A;  3SK3 A;  3O1B A;  3VTH A;  2VGM A;  1VQ5 N;  4BR4 A;  1KXP A;  4FPA A;  4BY9 C;  2PAV A;  3GDQ A;  1NGG A;  5EY4 A;  4WQ5 C;  5B8H A;  5ADX A;  1BUP A;  2JWK A;  4YOR A;  1VQ9 N;  2GTD A;  4K42 A;  4RWT A;  1H1V A;  2P9U A;  3JS6 A;  2HBJ A;  3SMS A;  3FZL A;  1YAG A;  3VGL A;  3FZK A;  2NRW A;  4CD1 A;  4H03 B;  5JLH A;  3CCS N;  3MK6 A;  4BQZ A;  4WCE L;  3IUC A;  3W0L A;  3E9O A;  2UYT A;  2ASP A;  1K73 O;  5EOY A;  3BEX A;  4YOU A;  4E1J A;  4JKE A;  4BRO A;  4NB4 A;  5M1O A;  4A2A A;  2FF6 A;  3SAF A;  2AA4 A;  3N4Q A;  4GY2 B;  3C65 A;  3OW2 M;  3CPE A;  2QM1 A;  2RE2 A;  3MWP A;  4B1U B;  4KH5 A;  4B9Q A;  1U6Z A;  3F9M A;  3CET A;  5AFU H;  2OTJ N;  4QS7 A;  4CBX A;  3CD6 N;  2ZF5 O;  3CHW A;  5MLC Q;  1JCE A;  5AQQ A;  3H45 C;  4FWO A;  2P9K A;  3UKR A;  3AAP A;  3VEV A;  5CHI A;  3UKR B;  2P9K B;  3HOT A;  3VEZ A;  1NGJ A;  1HX1 A;  4LC9 B;  1K8A O;  3WXL A;  2PFU A;  3QDK A;  3FLC O;  3GBT A;  3QFU A;  5C0Y A;  3RSE A;  3AAR A;  5AQK A;  5DM7 L;  4IDH A;  3H46 O;  3KWG A;  2NNW A;  4H5R A;  1HKG A;  1T44 A;  3CCV N;  4BR2 A;  1P90 A;  4YOV A;  3Q7C A;  2FXU A;  4NLC A;  2ZWH A;  4A57 A;  4BRQ A;  3CCR N;  4GV3 A;  4B1Y B;  1HJO A;  1HKB A;  4ILG B;  3VET A;  4IEE A;  1VQK N;  4A5A A;  4WFA L;  2NRX A;  3OBY A;  2HST A;  3SAH A;  3BP8 A;  2F9W A;  3LL3 A;  3W3D A;  1OVY A;  3I33 A;  3N4P A;  5LY3 A;  5GAH P;  2BH1 A;  3DWL A;  2E8A A;  2P9S A;  2HMP A;  4FWQ A;  3SBG A;  4BG8 A;  4C23 A;  3D6R A;  2GEM A;  2P9S B;  2CH5 A;  2HF4 A;  2YJF A;  2WC9 A;  3ENO A;  2A40 A;  4RCH A;  4A5B A;  4F9O A;  3ATU A;  5GAE P;  1DGK N;  1R59 O;  3HSC A;  2A6A A;  2WBN A;  2ZJR L;  4IOX A;  3E9P A;  1VQO N;  3QML A;  3TSQ A;  2V52 B;  5KPZ A;  1NJI O;  4MO5 A;  2I7P A;  3GL1 A;  5BRH A;  2QWO A;  1TYQ A;  3BF3 A;  2VCP A;  3BUZ B;  2F9T A;  5GAG P;  1KC8 O;  1VQ7 N;  1TYQ B;  3CCM N;  2PBD A;  3I56 N;  1XQS C;  2OTL N;  2VYP A;  4CZG A;  3AAQ A;  1BA0 A;  3C7N A;  3OBW A;  1QZ5 A;  3C7N B;  1NGB A;  5C2D A;  3ZET A;  5JLF A;  5AQH A;  3EO3 A;  3ZET B;  4GV6 A;  4K41 A;  4YDU A;  3FR0 A;  3WXK A;  1E4G T;  1BU6 O;  1P8Z A;  3A5O C;  4IWV A;  3R9P A;  4BC3 A;  3EE8 A;  5F2R A;  2Q2R A;  4K25 A;  2A3Z A;  3TU5 A;  4YOW A;  1Q18 A;  4H0P A;  3WXI A;  3TPQ A;  3EE9 A;  2D4W A;  4BRM A;  3TSP A;  2E20 A;  1EQY A;  5C12 A;  4BVO A;  5M1K A;  1SZ2 A;  3U8X A;  1S22 A;  4IOA L;  4Z94 A;  4MLH A;  3O9Q A;  4DQ8 A;  4IJN A;  1VAZ A;  3JXU A;  3E66 A;  3WEE A;  4JD2 A;  3CQY A;  2KHO A;  1NM1 A;  4JD2 B;  5AZI A;  3VMF B;  5HOO A;  2H3G X;  5AZI B;  3OHR A;  3HOS A;  1RDW X;  3J8A A;  4FVU A;  4JKF A;  2GX9 A;  4JHD A;  4J8F A;  3CJC A;  1HPM A;  4JHD B;  1MA9 B;  2A5X A;  3M1F A;  5AQX A;  2YI1 A;  3MN7 A;  4H0T B;  5JVG L;  1V4S A;  3K9J A;  4BRI A;  4BR9 A;  4PL7 A;  2E2N A;  4GNI A;  3C0B A;  5AQI A;  5EXW A;  2ZGY A;  3CME N;  1GLA G;  4FWK A;  3DXM B;  3R1X A;  4C1N K;  4CZK A;  3NMU A;  3CPW M;  1IG8 A;  4YOT A;  5AZJ A;  3H1Q A;  1GLC G;  1NMD A;  1DT9 A;  1E4F T;  5AZJ B;  2DPN A;  2KLA A;  4EIA A;  2QXL A;  2YCH A;  3IFR A;  4B1W B;  4H0X B;  2VWB A;  3T69 A;  3CXC M;  3QFP A;  5AR0 A;  1LOT B;  2QI2 A;  3AGR A;  3FZF A;  2QW9 A;  5HL7 L;  2FLO A;  3VER A;  2ZJQ L;  3CJ9 A;  2W40 A;  3CCU N;  2F7T A;  3R3L A;  3ID8 A;  4HWI A;  5M1N A;  4KBO A;  5FPD A;  1M1K O;  3CCL N;  3HI0 A;  1Q86 O;  1M90 O;  1X3N A;  1VQL N;  3VF2 A;  4FWP A;  5AQU A;  1QQN A;  3TTF A;  3L6Q A;  4MDB A;  4OPA A;  4EHT A;  5F0X A;  4KH6 A;  1BDG A;  4FWR A;  2GWK A;  4UY8 O;  1QQO A;  2IVN A;  1BOT O;  1X3M A;  1BA1 A;  3OA9 A;  4BQL A;  2NRV A;  4JN4 A;  5FPE A;  1Z6R A;  1X9J A;  4WQ4 A;  3PIP L;  1YJ9 N;  3EKU A;  3O8M A;  3A5L C;  3EL2 A;  2YJE A;  2Q31 A;  4JKD A;  1BWF O;  4C1N I;  3Q7B A;  3P38 A;  4PHT X;  3MN6 A;  4JK7 A;  5F1X A;  3PIO L;  1KAZ A;  3I8B A;  2AP1 A;  2P9N A;  3L4I A;  4BRP A;  5AFU A;  3CMA N;  2HF3 A;  2P9N B;  4PKH A;  4WFB L;  4DCH A;  4K43 A;  3O6W A;  1VQP N;  3T7Z A;  5KPT A;  2BUP A;  3WUH A;  4ILH A;  5BRD A;  1LCU A;  1O13 A;  5JIC A;  3G6E N;  2D0O A;  3F5T A;  1XC3 A;  3UKU A;  2CGK A;  4BRN A;  4GVE A;  3UKU B;  2V7Z A;  3NVM A;  4OO1 J;  3M5R A;  3H3O B;  3MMV A;  3LDQ A;  1NGI A;  4AF1 A;  5FPM A;  3M6G A;  4FWN A;  4BVP A;  2E88 A;  3HBT A;  3LDL A;  2ZGZ A;  3H6E A;  4KH4 A;  4YDU C;  4CZJ A;  5AQL A;  3VF6 A;  3UE5 A;  3VGM A;  2E2P A;  2NZT A;  4FWM A;  1J6Z A;  1T3V A;  3E9L A;  1K9M O;  5BRF A;  2ITM A;  4XH4 A;  2HBK A;  1Q82 O;  4DHY A;  1ILY A;  2ASM A;  3AGK A;  4BR0 A;  1RDU A;  2V7Y A;  2NRR A;  4PKI A;  3E1Y A;  2YHY A;  3VEO A;  3B8A X;  3CCQ N;  1YI2 N;  1NGF A;  3KK7 A;  4AM7 A;  4BGB A;  1Q81 O;  3KWI A;  3ULE A;  4DB3 A;  3TSU A;  2QTD A;  4BR5 A;  4H5V A;  3LDN A;  3ULE B;  3MDQ A;  2EWS A;  1ESV A;  2QWN A;  3KVG A;  3TTC A;  3VEW A;  4B1V A;  1T6C A;  4IOC L;  4BRF A;  3LM2 A;  1HKC A;  1YHQ N;  5AQG A;  5M1F A;  4CZI A;  2CGL A;  4EHU A;  2J4R A;  3DLL L;  1W97 L;  4JK9 A;  3QIC A;  3FGU A;  1GLJ O;  4GV9 A;  3HRG A;  4H0O A;  3DAW A;  2E2Q A;  1YXQ A;  4NLB A;  5BPL A;  4O8U A;  1YF5 L;  3BF1 A;  3ENH A;  3ZEU A;  4CZE A;  4EFH A;  1QZ6 A;  4WYB A;  3ZEU B;  3G4S N;  3WXM B;  3CF5 L;  3RVC A;  3P31 A;  1KAX A;  4M63 C;  1SAZ A;  4L3Q A;  2YHX A;  1KAY A;  1RGI A;  2Q0R A;  1KQS M;  1D4X A;  2FSJ A;  2Q97 A;  3GG4 A;  5CE3 A;  4I6M A;  1GLB G;  2HBM A;  1ZBS A;  1MWK A;  2FSN A;  3ZX2 A;  4I6M B;  3QBW A;  4IJA A;  3U4L A;  2QWL A;  1S3X A;  3MCA B;  3G25 A;  4EAH D;  1Z05 A;  3ATV A;  1VQ8 N;  3CIP A;  5LJW A;  4B1Z A;  3O5B A;  2GWJ A;  3U9D A;  3FZM A;  2KKZ A;  3CJA A;  4BC4 A;  4WFN L;  1IJJ A;  3L0Q A;  3DXM A;  3D7E O;  4H0Y B;  2P9I A;  3S41 A;  3A5N C;  5AQT A;  1ATR A;  1JCF A;  2CH6 A;  3L4Q A;  4CJ7 A;  1JJ2 M;  2P9I B;  3O4W A;  1Y64 A;  3CJ1 A;  2QWM A;  5ADX H;  3P4I A;  1NLV A;  3VEX A;  3ENB A;  2OAN A;  4XH1 A;  2V51 B;  3CC7 N;  4BC2 A;  5AQS A;  3I55 N;  1YJN N;  3UB5 A;  3O9T A;  4PKG A;  4ISE A;  1V4T A;  4O5F A;  2BTF A;  3HZ6 A;  1CZA N;  2NRZ A;  3VOV A;  2E1Z A;  5CR4 A;  1VQ4 N;  2W41 A;  2D0P A;  4A62 A;  3GE1 A;  3MN5 A;  3VEN A;  1ATN A;  2RHK A;  3D2F A;  3CER A;  1QHA A;  3C6A A;  4CZH A;  4Y0W A;  3HM8 A;  3D2F B;  5BPM A;  5ELZ A;  1QVG M;  4BR7 A;  5I9E B;  4BRC A;  3CCE N;  4IZ9 A;  1NGE A;  1OKJ A;  3A5M C;  3ZYY X;  4CZF A;  4U7B A;  1QQM A;  2IVP A;  2P9U B;  4CZL A;  1RFQ A;  3F2K A;  2Q36 A;  2NLX A;  2QA4 N;  4CBW A;  3FE1 A;  1GLD G;  1T6D A;  4FWL A;  2IIR A;  3GOI A;  3A0I X;  3WXJ A;  4A59 A;  4CZM A;  4NO7 A;  5TKY A;  3CC4 N;  5C15 A;  3CQX A;  3FFK B;  3MX2 A;  5KPR A;  4IXC A;  5AQY A;  3QB0 A;  3P39 A;  4U67 L;  2QWQ A;  3D2E A;  3IDH A;  4FPB A;  5AQP A;  3SBT A;  3D2E B;  1S72 N;  1N8R O;  2IVO A;  3SJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...