3DLKA

Crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
552
structure length
552
Chain Sequence
b'SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal engineering of HIV-1 reverse transcriptase for structure-based drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 152
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlkA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlkA05
3C6TA 3G0ZA 1F21A 4HUFA 1NK8A 3H2LA 4FLZA 4ID5B 4RW8B 3NCIA 3G6XA 2E9RX 2KQ2A 2G8FA 4U7CA 1KLMB 4KPYA 3WNGA 1J9AA 4ICLB 2W7OA 4M3XA 3I5CA 1SKSA 2B6AB 2B5JA 4ZP9A 4HHTA 1IO2A 5EUHA 3LAKA 2ZD1B 1HPZB 5I42B 4FLWA 1X9WA 4C8NA 3L2WA 4OVLA 3T5JA 2IJNA 1UWBB 3NGIA 2IOCA 5C24A 5DQIA 3HP6A 3ISNC 3OY9A 1BHLA 4URSA 1TK0A 3KKSA 2QE5A 4Y1CA 4EO6A 2FBXA 2JEGA 4JLHA 4Z0UA 2B43A 4B9UA 4C8LA 1JL2A 1ZBFA 1MU2A 1RT4A 3KLEA 4O0JA 3KJVB 2JEJA 1VSFA 4PA1A 4BDZA 3DYAA 4IFYB 4BDYA 4Q8FA 5KFNA 3P1GA 1KFSA 4KB0A 3VQ6A 2V4RA 1QAIA 1RDCA 4RW9B 3M8QB 1S49A 4RW6A 1VSHA 3SNNA 4M95A 4M3UA 2A1SA 1C1BA 1VRTA 3V4IB 1C1AA 1BISA 3CFPA 2OZSA 3AVBA 2AX0A 4AHTA 1D9DA 4DEZA 2HWHA 4Q43A 3D0PA 3H5UA 2C28A 4CJUA 1G15A 4J9PA 3RTVA 1N6QB 1LWCB 2IAJA 3TABA 1N5YB 3SFUA 4Y3CA 1JLFA 1DTTB 5DGBA 4MFBA 3OYCA 1RT7A 1U49A 4KAIA 3IRXA 2ZQBA 4ZVEA 4JV2A 1SH3A 4CEOA 2UVUA 3QO9A 3LP3A 3AVJA 4GMJB 1C0TA 1XR7A 1WNEA 4RNFA 3TAFA 4QCLA 1IKYB 1RBSA 3AVAA 2F8EX 5HRNA 4KFBA 5KT4A 5KT7A 3NL0A 3RB6A 1NK7A 3HVAA 3MR3A 3NBPA 4TY8A 1EKEA 3M9MB 2P5OA 4J9LA 4FJXA 1KVBA 2FBYA 1QSLA 1HQUA 3HVTB 4ED0A 3H4BA 3TQ1A 4NYFA 2DFFA 3A2FA 3RMCA 4ZP8A 2C22A 2VWJA 4GC7A 3AVKA 3O3HA 4FBUA 4LSNA 3KK3A 2J6TA 4U6PA 1TK8A 4OJRA 1T05A 4IQXA 4DSEA 3HVRA 3CDWA 1SKRA 2IM3A 1HMVA 3KD1E 3UIQA 3OYKA 1JXBA 2YV0X 1TKDA 4NLDA 2YKMB 3I8DA 3L3UA 4NYZA 2RKIA 4ECUA 4O3QA 3AA3A 1JLQA 3VQSA 4CF8A 4CHPA 2HW3A 1QSYA 3V6HA 3BGRB 4WYWA 1DTQA 3H4DA 3QNNA 2PYJA 5F8GA 3C6UA 4DTOA 1BQNA 4TYAA 2GBZA 3HM9A 4F4KA 2D5RA 4Z4HA 4E0DA 5J1EA 1TP7A 2LSNA 2AQ4A 3O3FA 2GIQA 2UVVA 1J5OB 2VG6B 1RTIB 2ZD1A 1HQEB 4WZQA 3RRHA 5C25B 3BQ2A 2OPQB 3SQ0A 4FM0A 3NF6A 2O4IA 5KFLA 3AO3A 3KLHB 1JLBA 4CEEA 4DFKA 5KFPA 4JV0A 4WXWA 3SPYA 3S3MA 4CJTA 3DRRB 1GX6A 3D5MA 3QLHB 5J2QA 3BSAA 1VSKA 1NJZA 3MXIA 4G1QB 5K14B 2JEIA 2DTUA 3K2PA 5KFWA 2YNIA 3S3OA 3VQ4A 4CGIA 4DMNA 5FDLA 4FLUA 2FVPA 1S9FA 4RUCA 4EYHB 3M8QA 4W5TA 4B8AB 4QWCA 1D5AA 3DRPB 2G8KA 2HAIA 2C2EA 4BWMA 2D0BA 4CGDA 3B6OA 1SV5A 4CFBA 4ZPAA 2RF2B 3UQSA 1N6QA 3DRSB 3NGDA 4KHWA 1W25A 1S1WA 1SH0A 4N76A 2J6SA 2RDIA 3NH2A 2XY5A 4J2BA 3AA4A 3ZCMA 4NLSA 2OH2A 1XHXA 3PW5A 3KLGA 4OGEA 4KHNA 1JL1A 2FJVA 3QGHA 4YR2A 4MK7A 4OPJA 1SH2A 4F4WA 1HYSB 1X9SA 5KFUA 1TQLA 5F9LA 2JGUA 3DM2B 3OJSA 3KKRA 4F8RA 1S1TB 2I5JA 1WSIA 1W0HA 1EXQA 3MFIA 2BE2B 4R0EA 4QWEA 4Q44A 3ZT0A 5KT6A 4IKAA 3K58A 4O44B 5L9XA 3KOAA 5EWFA 2W9BB 5KG2A 1RNHA 4FJ5A 4YP3A 2HVIA 1TL1B 4IG3B 4MK8A 4FZXC 4FJMA 4FBTA 4RNHA 5D3GA 4AHUA 4IFVA 2WK4A 2XO7A 4URGA 2AGQA 2XY7A 3VQDA 5HP1B 2IA6A 3OYIA 3Q8SB 4TQSA 3AV9A 4Y2CA 2ILZA 4ED6A 5KTQA 3RR8A 4O55A 4AHRA 3AVCA 1S6QB 4TLRA 4AH9A 4TN2A 1J54A 4DSIA 3KK2A 4DG1A 1VK0A 3RBEA 4CHQA 4AHCA 3K57A 4CJKA 3RWUA 2IS3A 3L2VA 4M94A 3MTKA 3RB0A 3SI6A 4CJSA 1QHTA 3ISND 5KFAA 1A5XA 3CG7A 3VQAA 3GV5B 4H4MB 5KFVA 3BDPA 2XGPA 4FLXA 4I2PB 4YQWA 4I7FA 5KFZA 3H5YA 4C8KA 3CO9A 4YR3A 3LP0B 4CJ4A 1J5OA 2C2RA 2VG6A 1RTIA 1ASVA 3NKYA 1HQEA 2EX3A 1NK9A 4W5QA 4K4XA 1C0UA 2OPQA 2AX1A 3BR9A 4CIFA 4ZP7A 3HPGA 3PJWA 4CIEA 3NHGA 2FC0A 1BIZA 4FK2A 1BCOA 3G10A 2IMWP 3PR4A 1LV5A 3DRRA 2YNHB 4ZP6A 1WLJA 3I0SB 3WNFA 3QEWA 1FKPB 3QIPB 3I5AA 4PWDA 3IG1B 4CJQA 1EP4A 4G1QA 3TAMB 3CVKA 5K14A 5DG7A 2YNGB 1TL3A 5HLFB 1T03A 1N56A 4J9QA 2BANB 4LH5A 1JLGB 4DQRA 3OS0A 2ASLA 2OPSA 1T3NA 4EEYA 4B9SA 5SWMA 3E51A 4NCGB 4IR1A 2R2SA 3K5NA 3DRPA 2YHAA 3HL8A 1QQCA 2GUIA 5KRSA 3RR7A 4J2DA 2V4QA 3RAXA 1Q9XA 4IBNA 1RT6A 5I3UB 1HNIA 5HRRA 4N5SA 3NGZA 2RF2A 2GC8A 1KHWA 3DRSA 1S6PA 3OL6A 2HMIB 3G6YA 3DMJA 2W9CA 4EBCA 2FVSA 4ED7A 3PX4A 5KFCA 3PY8A 4BACA 3IGVA 2AJQA 4ELUA 2XGQA 5F8JA 3I0RA 3OVNA 3WNEA 5FRMA 3MEDB 5C5JA 1RYSA 4EP4A 4Y34A 3SZ2A 4E1MA 1KFDA 3MECB 3DM2A 3RB3A 3D45A 4CHOA 1RTHA 4DS4A 4TXSA 4KHYA 4CHZA 1C6VA 4O44A 4Q45A 2E4LA 4XPCA 3OYFA 4M45A 4PQUA 2UVRA 2W9BA 1NK6A 3V6DA 3DLKA 3ULDA 2W7PA 2B4JA 5KFEA 4KHUA 2VG5B 3BQ0A 4ELTA 2R2RA 3GQCA 4FLYA 1NK4A 1TL1A 4IG3A 1IKWB 4ECWA 1S9GB 3KHGA 4ZVGA 4ECRA 5SZTA 2F96A 4DQQA 4CK2A 1JLAB 4NLGA 3HJFA 1YVUA 3HPHA 1ZBUA 2XHBA 1RBVA 3DLEB 5HP1A 3KHLA 4DL2A 5KFOA 1NKBA 3OLBA 3K5OA 1HNVA 3H98A 4CJRA 2DPIA 4NLTA 4XIUA 3IAYA 4RUAA 4J9KA 4DL4A 1SL2A 4W5OA 2ITGA 3OYHA 4DL5A 1LWFA 4ZPBA 2X6SA 4I9QA 3MAQA 2FLLA 4KTWA 3WNHA 5J2NB 4CGJA 3AVNA 1RT2B 3UPFA 4NRUA 4KAZA 4DL3A 4CFAA 3KK1B 4KO0B 2HB5A 4BWJA 1U48A 5F8NA 4RW7B 2JEFA 1B92A 4DTJA 3CDUA 4FW2A 5DLGA 4FJ8A 4I2PA 4OKKA 4DSLA 1BQMB 2HNDB 1K1SA 4MIBA 4M41A 3SV3A 3LP1B 3KNAA 4F2SA 3QIDA 3OYLA 1TKZB 3V81B 4NLUA 3TAQA 5T7BA 4WFXA 2BQUA 5HBMA 3AVFA 1YT3A 1KRPA 4CIGA 4YMEA 2XCPA 4ID1A 3ZSWA 2WTFA 1WSFA 3L3VA 2YNHA 5DLFA 3NF9A 2IJFA 1S9EA 3SQ2A 1TKTA 3I0SA 4J2EA 3QIPA 3KTQA 3IG1A 2I1RA 1JKHA 4O0IA 3RMDA 3P5JA 3TAMA 4QWAA 5KG0A 2YNGA 3NMAA 1Z26A 3MXJA 4FLVA 5EU7A 5HLFA 2WONB 3LZIA 1TK5A 1Q9YA 4M3YA 3G6VA 1ASWA 5JS1A 2WCXA 3ZT2A 4IRDA 2FVQA 4ED8A 3ZSYA 2QXFA 4M42A 1QTMA 1JLCB 4ED1A 4DF4A 1CZ9A 4DF8A 4J9MA 1NHVA 4CK3A 1JXEA 4CK1A 2D0CA 1S1UA 4KSEB 4O3SA 3GV8B 3V6KA 2HVHA 2WRMA 5I3UA 4IRCA 2O4GA 4CECA 4CF0A 3QINA 3VQ9A 4LQ3A 3OYAA 1CXUA 3K5MA 2QKBA 2JC1A 4O4GB 1TGOA 3GILA 1ZTWA 4HKQA 3CJ5A 1FKOA 1RILA 1T8EA 3VQQA 3JYTB 2FVRA 3TI0A 1S48A 3SCXA 5KG6A 4Z4FA 3KLFA 4B9VA 4Z4EA 3ASMA 3B6PA 2P1JA 5DMRA 5CYQB 1I39A 2R8KA 2YKNA 1GOBA 4CJEA 2BRLA 4OLBA 3NF7A 1EX4A 5HRSA 4FJKA 4ZMMA 3PO4A 3LP2A 1RTJB 1XI1A 3GIKA 3SUPA 4O4RA 3CJ2A 4OKJA 2IM0A 3NGYA 3NE6A 4F4XA 4KTZA 1U09A 3DLGA 2Z1IA 4BE0A 1KLNA 2WOMA 4DU1A 2ETJA 4K4TA 4RG8A 3OL7A 1IKWA 1S9GA 2HHWA 2WB4A 4HYKA 4K4ZA 5KT2A 4E1NA 2XCAA 3VQPA 4LSLB 2E9TA 2BQ3A 3MEEB 4H4OB 3DLRA 2W42A 3LPTA 2ASJA 4FVMA 3O3GA 1L3UA 3EPIA 4LY7A 2DPJA 1SUQB 1HJRA 1BIUA 3HXMA 4DQPA 3SUQA 3ZSVA 4B9MA 2ZKUA 4ID5A 1U47A 4RW8A 3AVHA 3HVWA 4FYDA 4I2QB 1KLMA 1I6JA 4ICLA 3VQ8A 4BDPA 3HSTB 1R0AB 1RT2A 3LALA 2B6AA 1IKVB 4AHSA 4K8XA 3KK1A 3TWHA 1ZBHA 1QS4A 3MFHA 4RW7A 5F9NA 2R8IA 1HPZA 4NLPA 5I42A 3QEPA 4F3OA 1JIHA 2FJXA 5DGAA 1WAFA 3DLBA 1BQMA 2HNDA 3V1OA 3QIOA 1ZETA 1UWBA 3IGNA 4DTSA 5KFSA 2D3ZA 4IRKA 2HHQA 2VG7B 2OYQA 3H5SA 4F3TA 5KFMA 3DOKB 4KI4A 3VQBA 4K4VA 2BGGA 4IH6A 3OJUA 3UDLA 4Q0BB 3AVMA 2HHXA 3KLIB 4KTQA 4DWIA 4TYBA 1XC9A 2JC0A 4WFZA 3KJVA 5FROA 4E89A 4IFYA 2BQRA 4CJWA 3G86A 1C2PA 5J2MB 3VQ5A 4FXDA 4ECSA 4E7IA 4EBDA 3ITHB 1TKXB 4ZHRB 1OS5A 5KGWA 4RW9A 3ALYA 3LWMA 3ZSOA 1L3SA 1L3VA 1GOCA 3QNOA 3V4IA 4TY9A 4R5PB 2OPPB 3M8PB 2ZE2B 4DSFA 1JLCA 4EYIB 4QAGA 5KFYA 3ZSQA 4CHYA 3KMSA 3TAPA 2D7SA 3QESA 3ZSZA 4TSXA 1LWCA 1N5YA 4OLAA 1U04A 4YFUA 1DTTA 1S4FA 3BQ1A 2OPRB 4QW9A 1RDBA 2Z1JA 5KFQA 5F8IA 2FVCA 4RNMA 2PZSA 1XWLA 1X9MA 5HRPA 3SQ1A 1RT3B 3NH1A 4JUZA 3OYBA 4PY5A 4DU4A 3JSMB 2E6LA 3HYFA 4O4GA 4CERA 2X74A 3L8BA 2CJQA 2W8LA 2FLPA 4CHNA 3JYTA 4DFJA 2C2DA 4Z4IA 1IKYA 4NLOA 1UA1A 5KFTA 1RA6A 1W9HA 1SKWA 5CYQA 1RTDB 3LWLA 2D0AA 3PW7A 1TAQA 2G8WA 2ATQA 2GV9A 5EWGA 2RPIA 2KTQA 4XO0A 1RTJA 1Z4UA 4DTNA 3HVTA 1EETB 1VSMA 2BDPA 2F8TA 2HWIA 3N6MA 5KFDA 1X1PA 4EBEA 4DQSA 3MR6A 4Y2AA 2KW4A 4H8KA 3T5HA 4FJNA 3U3YA 2J6UA 3GYNA 4FJIA 4AHVA 5J2PB 4IOBA 4JS4A 1NKEA 2YKMA 4LSLA 5KG5A 3CQ8A 3MEEA 3MEGB 2HHVA 1ZTTA 2O5DA 4B8CA 3AVGA 3CJ3A 3HT3A 3ZSXA 2R2UA 2GIRA 2YNFB 4FCYA 1L3TA 3BGRA 3C6TB 1RBUA 4I2QA 5KFKA 1IKVA 4CGGA 1GX5A 4ECVA 1VSJA 3U6FA 3E01B 4RW4B 4EO8A 5C25A 3N6NA 4Q8EA 2KFNA 1UAXA 3THVA 3IS9B 1S1XB 3KLHA 3MF5A 4ECYA 2VG7A 1TVRB 4X2BA 2R8JA 4MK9A 4NZ0A 3RRGA 5C24B 4DTUA 4WYLA 4DU3A 1WSJA 4FM1A 1D8YA 3QLHA 4DSJA 3SUOA 4JS5A 3TVKA 3Q8QB 3QGIA 4CF9A 4B9TA 3PJXA 3M9OB 3V1QA 3O4NA 3CYMA 4FLTA 1MU2B 4HVJA 1TKXA 4ZHRA 1LAVA 1LWEB 1N48A 2KFZA 4CFCA 1KVCA 1BI4B 3CM6A 4WE1B 3LANA 4CEQA 2UUTA 4FJHA 2OPPA 4LH4A 3M8PA 4E19A 1A5VA 3OYDA 1NJYA 1RT5B 1C1BB 4O3RA 2X78A 3F73A 3QYYA 3TANA 1VRUB 4RNNA 3VQ7A 3SYZA 3SFGA 3UR0A 2D41A 3FFIB 2OPRA 4ECXA 4IR9A 1DLOB 2IAJB 5KFRA 1VSIA 2V9WA 4MFBB 1BGXT 4MKAA 3VQCA 1RT7B 3H08A 5HROB 3IRXB 4GC6A 4FS2A 4QWBA 3S9HA 3OYMA 1HYSA 4TQRA 4CEFA 3ZT4A 3QO9B 1S1TA 3EY1A 2A1RA 1ZYQA 3QZ8A 2CKWA 2BE2A 3PZPA 4I9LA 3V9WA 4IDKB 1U45A 4KHSA 1C0TB 4IH5A 4DLGA 2G8VA 5DQHA 3HO1A 1RTDA 1O1WA 1NK0A 1C0MA 1ITGA 1RCHA 4KFBB 4CEDA 3M8RA 2VA2A 3NF8A 3H5XA 5KFXA 4QOZB 2IBKA 3AO1A 5F8MA 4DL7A 3NH0A 3BSNA 1HQUB 4NLYA 1IG9A 4DTRA 5KFBA 2G8HA 2WHOA 2RDJA 5CYMB 5KT5A 4KE5A 5L1JA 2HHSA 3QZ7A 5J2PA 2W8KA 4FJLA 1RYRA 1S6QA 4ZPDA 4QPXA 4N41A 1VSDA 5EDWA 1KTQA 3Q8RB 3I5BA 4LQ9A 3M8SA 4WFYA 3HHKA 1S0OA 3T3FA 1U4BA 4KREA 3M9NB 1RDRA 2X6NA 1D1UA 4FJGA 4HCBA 5EWEA 2DFHA 4H4MA 1ASUA 4M3WA 2FLNA 3OYEA 3V9XA 1D0EA 3SI8A 1DTQB 2VA3A 4R8UB 4K4YA 3C6UB 3OSNA 4M3RA 1BQNB 3LP0A 2D3UA 1QUVA 4HCCA 2IGIA 4O3OA 4DTXA 5J1EB 3E01A 4RW4A 4CCHA 4Q5VA 4JRPA 1S5JA 4H54A 4RZRA 4CJLA 2XI3A 3IS9A 1S1XA 5KG7A 2XY8A 4W5NA 4F50A 4FM2A 2HHUA 1TVRA 1LW2B 2R2TA 5CY4A 3CIZA 1JLBB 4L8RB 5E41A 4WXOA 1FKPA 3TR8A 3PX6A 5KFIA 3KIOA 3MR2A 4IG0B 5F8LA 5J2QB 3GIMA 2BANA 1JLGA 4NLWA 1IKXB 3PW2A 3PO5A 1LWEA 4FZZA 3V9SA 2YNIB 5C42B 2KZMA 5CZ2A 2G8IA 4ELVA 1BI4A 4CEAA 4NCGA 4WE1A 5FDLB 1CXQA 5DG8A 4NLVA 2Y1IA 2UUWA 5DG9A 4LD0A 5KI6A 1LAWA 1S1VB 3OS2A 2F8SA 3T5LA 3C95A 4CF1A 1RT5A 1YTUA 3PW4A 2W9AA 1VRUA 2BR0A 2HMIA 3N6LA 4NLXA 4N56A 1FK9B 4O5BA 1SV5B 3DDKA 3FFIA 4CF2A 1DLOA 5L1LA 4QW8A 3KMQA 3KLVA 4C8MA 2OZMA 1C1CB 1BL3A 4ZVFA 1CZBA 1S1WB 3ZSRA 2P5GA 3GIJA 1CLQA 5HROA 2IC3B 3MEDA 3DI6B 3ICLA 2AGOA 3KLGB 4PUOB 3MECA 4CESA 3AO5A 5JS2A 5CZ1A 3AA5X 4IDKA 2ILYA 2I5JB 3DLHA 1YVFA 3Q8PB 1WNSA 3TAGA 3V1RA 3CFRA 1GOAA 3PVXA 2VG5A 3HP9A 4W5RA 3OYJA 1K1QA 4KHRA 1KSPA 3VA0A 3RMBA 1JLAA 4WZMA 3PV8A 3DLEA 3CWJA 5CYMA 5D3GB 5FRNA 1Q8IA 4FS1A 2UVWA 4IFVB 3F9KA 5KFGA 3SJJA 2YHBA 2HNYB 4XPEA 1WAJA 4KI6A 1SL1A 4OGCA 4JRQA 4B3OB 3SUNA 4JV1A 4ECZA 5J2NA 4J9RA 1NKCA 4J9OA 3KK2B 4DG1B 1CSJA 3PHEA 4J2AA 2Z1HA 4YR0A 4MH8A 4KO0A 1S10A 3AVLA 1I3AA 4B08A 3GV7B 4O3PA 2DFEA 3EYZA 3FQKA 4R8UA 3HPOA 3KHHA 3RB4A 1B9FA 4CJFA 3LP1A 1TKZA 1Z25A 3V81A 3T1AA 3V6JA 4I7FB 2NUBA 3ZT3A 3FSIA 4Y1DA 2JLEA 1B9DA 1KVAA 1FXXA 3OL9A 3FDSA 2XRIA 3GIIA 1C0UB 1LW2A 3H59A 3L2RA 1ZBIA 5KG1A 1YTAA 3EPGA 3VN5A 3QEXA 4DTPA 4IG0A 1NOZA 2WONA 1UOCA 2R8HA 4PWDB 1EP4B 1RA7A 2KZZA 4E7LA 4KRFA 1IKXA 3VA3A 4K50A 1TL3B 4HUGA 1T03B 3K5LA 5C42A 3DOLB 4ECTA 1WSHA 3PUFA 2EC0A 4KHQA 2Q3SA 2OPSB 2HNZB 4K4WA 1SL0A 4ZTJA 1S0NA 1VSEA 1S1VA 4KB1A 1IM4A 2XWYA 2AU0A 2BRKA 2VWKA 4ZVHA 1TV6B 4CGHA 3NFAA 5KGXA 1TAUA 4KV8B 2V0NA 1FK9A 3TAEA 1KCFA 1RT6B 3BSCA 1HNIB 2XY6A 2P51A 2PYLA 1S6PB 4RNOA 4FW1A 3DMJB 1UA0A 3CFOA 1C1CA 2W9CB 3U3GA 4CEZA 5KFHA 1JX4A 3RAQA 2IC3A 1JLEB 3DI6A 3NAIA 3I0RB 4UQGA 1REVB 4PUOA 4DL6A 4URQU 4MQ3A 3VQEA 1NNDA 4NYNA 1HYZA 1RT1B 3BREA 4E7KA 2R7YA 4J9NA 2Y1JA 4FJ9A 3L2UA 3PR5B 4OL8A 1LW0B 1QE1B 4ZPCA 3EZ5A 4HUEA 1RTHB 4GW6A 1HRHA 4K8ZA 4DS5A 4ED2A 1WSGA 4DFMA 4IKFA 1D9FA 4RU9A 2ALZA 4PQUB 3T5KA 3L2QA 2QK9A 3V6DB 1HYVA 3DLKB 1ZBLA 5DK5A 4MKBA 1HARA 5JUMA 1S0MA 3CDEA 3BSOA 4IH7A 1J53A 5KT3A 4H4OA 1XHZA 4NLRA 3AO4A 1IH7A 4FK4A 4NCBA 2HNYA 4ZTFA 1SUQA 4CJVA 2RN2A 3LPUA 4KKOB 3K59A 3OYGA 3BJYA 1HNVB 1T7PA 4B3OA 3FQLA 4CFDA 2XI2A 4K4SA 4NLQA 2EHGA 1R0AA 3CJ0A 4Z4GA 4HTUA 2OA8A 1WSEA 1LWFB 3RMAA 5KG4A 4DFPA 4AILC 1KHVA 3KHRA 2B5JB 1NJXA 1QAJA 1NK5A 4CJ3A 4ED3A 3OLAA 3H40A 5KG3A 3OSPA 2IM1A 1JLQB 3OL8A 5F8HA 1NOYA 4E7JA 2DY4A 3T19A 5KRTA 3DOKA 2G8UA 1RDAA 3NDKA 3IN5A 4DQIA 4OPKA 1NHUA 4Q0BA 1S97A 3CJ4A 3KLIA 1RBRA 4DSKA 3AVIA 3EZUA 5HBMB 1XR6A 2QKKA 3PW0A 1VSLA 4GVMA 3NAEA 2E6MA 1MMLA 5J2MA 1BCMA 2PY5A 3HK2A 3ITHA 2FJWA 4EP5A 4CE9A 1RT4B 3KLEB 3QEIA 4KB7A 4E7HA 3DYAB 1S9EB 1TKTB 3SPZA 3QETA 1N4LA 1JKHB 3PX0A 4CJ5A 1NJWA 2FBVA 4R5PA 4RW6B 2ZE2A 3OHAA 3DOLA 4BE2A 3LDSA 1VRTB 3O4QA 2R8GA 2IM2A 3OS1A 3V9UA 2HNZA 5KFJA 4EZ6A 2HHTA 4OKEA 3AA2A 4BE1A 1S1UB 4EZ9A 3QEVA 1TV6A 1RT3A 4NCAA 1JLFB 1WN7A 4ECQA 3ZT1A 1T94A 2XC9A 4E3SA 4KV8A 3HKWA 3SQ4A 2Z1GA 3D28A 3JSMA 3QERA 5JXSA 1K6YA 2ASDA 3RBDA 4QWDA 3MXMA 3NAHA 4KBIA 2ATLA 3AO2A 4B9NA 1JLEA 4CGFA 4FJJA 1RAJA 1FKOB 3C94A 1REVA 1RDDA 1Y97A 2AWZA 4Z4CA 1RT1A 4M3TA 4KHMA 3KLFB 4K4UA 4F4ZA 3TARA 4CJPA 1JXLA 3LAMA 4MIAA 4F2RA 3FRZA 4F4YA 3NBPB 2YKNB 1LW0A 1QE1A 4TY8B 2AGPA 4CEBA 4FJ7A 4FK0A 4FZYA 1EETA 4G3IA 3LP2B 1QSSA 3OYNA 5KFFA 3LZJA 4YNQA 3P83D 5DQGA 4B9LA 4J9SA 5L1KA 4LSNB 3KK3B 3SV4A 4O3NA 3DLGB 4DLEA 2WOMB 3CM5A 1L5UA 1T05B 3S3NA 1A5WA 4DTMA 1HMVB 1XR5A 4NRTA 3MEGA 5L1IA 2QV6A 3V9ZA 5T14A 2E9ZA 4M3ZA 4C8OA 3QGGA 3MR5A 4KKOA 2RKIB 1RBTA 4N47A 3KD5E 2YNFA 2IDOA 2FBTA 3OHBA
chains in the Genus database with same CATH superfamily
2LDYA 3EDRB 1B3TA 4FLZA 4CDIA 2ZJQL 3K0JA 1GLJO 2E9RX 1FWPA 1VQKS 2VHGA 2KQ2A 4NEYA 1AFIA 4U7CA 4KPYA 2V52B 4RWXA 4NXNK 2B6AB 2AP1A 4HHTA 1YRUA 3EVWA 3CIPA 5D8HB 3NNCA 3GWCA 2PMZD 1HNXK 1OQ3A 1X9WA 2CADA 3TW0A 2IJNA 4PPZA 3NGIA 5C24A 1KWMA 4MT1A 2CPDA 2Q66A 1SB6A 4Y1CA 3IA0A 1HBOB 2FBXA 2JEGA 4Z0UA 2V9KA 4B9UA 4C8LA 1YJNN 3FE1A 2IJRA 5DJBA 1JB0C 3DYAA 3NWGA 2HVDA 2VBWA 3D2WA 2QLWA 1FJGK 3SNNA 2FPHX 4M95A 2B7BB 1FFGB 1VRTA 3V4IB 2ZJPQ 5HATA 1C1AA 2OZSA 3AVBA 4AHTA 3D9BA 1NSQA 4DEZA 2ITMA 5HQ8A 5CH7B 3VAGA 4J9PA 2E1PA 2IAJA 2DO0A 4EFAC 1N5YB 3O08A 4Y3CA 4ILHA 2ZGYA 5AZJA 3EDQB 4MFBA 3OYCA 2CUYA 4YDXA 3CERA 3NEKA 2EFNA 1RT7A 2Q0UA 2HK3A 4EWTA 4P73A 4MAKA 1NWKA 3U4LA 3IRXA 1EKSA 2XWXA 4NA3A 2GQCA 2XBPA 4EUVA 1WB9A 2YY3A 1KAXA 4YB5A 4RWWA 5H9FJ 5IFMA 2BKPA 2ABYA 2W2NP 4KGVB 3AVJA 1BWEA 2AYEA 4OHVA 3QDKA 3C19A 2AZ1A 1OMSA 1VQ9S 1LXNA 2G0JA 3A3NB 3ZNUA 3G96A 2ZVSA 2QM1A 4HDGA 3HZ6A 2DGVA 2B4OA 1MLAA 1N5TA 1QQNA 2B4PA 3NBPA 2VQFJ 3M9MB 4DCJB 3U9ZA 1DJ0A 5I3QA 4BC4A 1PAEX 3IXQA 5BJRA 1QSLA 1HHTP 1HQUA 3I4HX 4ED0A 3CD7A 1NGHA 3A2FA 1WOQA 1TELA 1U02A 1Y5NB 2YX4A 3QMLA 3QBWA 1OSDA 2V2ZA 3KK3A 4LBPA 1BUXA 2F3JA 4DR3K 4HT5A 3CDWA 2E20A 2IM3A 3CJSA 3UIQA 5CR4A 1UVIA 4YDUC 3BBFA 5AXLA 2GHWA 1TKDA 2YKMB 2HG4A 3MOJB 2LQ5A 4C11A 4ECUA 1X60A 3PKYA 4KGXB 1VC5A 1AA1B 4LF8K 2P9CA 3H4DA 1SJ4P 2OKQA 4LVOP 5F8GA 5D15A 1BQNA 4TYAA 4C7QA 3WC2A 4Z4HA 2EC2A 2H5IB 5AZIB 4DR1J 3Q7BA 4YOTA 1N33F 1ITPA 1R27B 1J5OB 2ALYB 2VG6B 4P2FA 2ZD1A 2LQ9A 4CVNE 3PYFA 1WC3A 3DHWC 4I6MA 3BQ2A 5L39A 4FM0A 4KY3A 5KFLA 3SBGA 3KLHB 1UW9A 3OTBA 5KFPA 5EY4A 3AT1B 3QLHB 3WIVA 2GJFA 2ZEJA 3HSJA 5K14B 4MTPA 1RACB 3LPYA 2QZ8A 1S6OA 5KFWA 3K2PA 4P74A 5IWAF 1IR1A 3FJ2A 4CGIA 5FDLA 3AB4B 4W92B 5KAKA 4F0HA 5KOWA 2FVPA 4A8OA 4ISFA 2JVRA 4W5TA 2LYVA 2PFUA 2OMOA 3I55S 4FWKA 1QQOA 3A13A 2WW4A 3DLLQ 2RF2B 1N32J 1N6QA 4FWQA 3OR2A 4K7QA 5L38A 2CQIA 1W25A 1SH0A 5LOQA 3CCZA 2QC3A 3EVOA 3ZCMA 4QIFA 4NLSA 1X5TA 2B9YA 2EFOA 3B4DA 4FXVA 1TL4A 1CJUB 1S59A 1SH2A 3VAKA 1KQFB 4EIAA 4LF1A 1U8SA 1J5EJ 3AA9A 1S1TB 4JV5J 2BE2B 4R0EA 2AJ4A 4QWEA 2RHKA 1YJ9S 2IVOA 3SLCA 5L9XA 4DBQA 5CD4A 2E5LJ 3UD4P 4X62J 4AYBD 4LR8A 4LIWA 3GR1A 4FZVA 4AL6A 4PAAA 1T3VA 1KD1T 4YP3A 4FZXC 2R7QA 4FBTA 1YAGA 5HO4A 3HHNB 1BO5O 4NB4A 4IFVA 2XO7A 4URGA 4LF5K 4TQSA 1QVGM 1A6LA 2RU3A 2ILZA 3A3PB 3AVCA 2C2MB 2FC8A 3VAJA 4FKYA 3HRGA 4AH9A 1APSA 2D0PA 3UKRB 1FF2A 5H9FK 3AOCA 4DSIA 4FP9A 3RBEA 4D3GA 3K57A 5H1SV 3L2VA 2YWWA 3QT5A 1HBNB 3QJPA 2BX6A 3OUYB 2R9LA 3VQAA 4ZKAA 4U7BA 5KFVA 2P9SB 1UEUA 3PIPQ 2VC1A 3MN5A 1K8KB 3CC2S 2RAQA 3FBEA 1VBZA 1ASVA 1YWXA 1HQEA 2HMPA 4W5QA 3QFWA 1RHRB 2HPUA 1RDUA 2AX1A 3BR9A 4DV0J 1NGJA 3SQOP 3UI3A 3CC7S 1NJIT 4WCEL 1FE0A 1BCOA 3PRDA 4B1YB 1LV5A 2HZAA 1Z1ZA 2O66A 1FKPB 3QIPB 2KDOA 4PWDA 3I5AA 5C10A 4CJQA 3CJKA 4E1JA 3J7ZO 3ULEA 4G1QA 2ZZTA 4IOAL 1TL3A 5AQSA 4J9QA 4OX9F 4UY8T 3BGOP 4Z37A 5SWMA 3QNWB 4DR4F 1EQMA 2KRBA 5ADZA 3WC0A 3HL8A 1QQCA 2GUIA 5KRSA 2JX2A 1YZ7A 3R9PA 4OYZA 1Q9XA 4AQYK 2IA0A 5I3UB 3B54A 2F4VK 1DKGD 3CCES 2HOEA 1KHWA 1S6PA 3P38A 2Y0BB 2FVSA 5AQKA 3HHLD 4ELUA 2CNOB 3OVNA 3WNEA 3K9KA 1O5JA 3RUBL 4EP4A 4Y34A 1X4AA 3SZ2A 1KFDA 3DM2A 3LH2S 3BKFA 2DO4A 2KHOA 4CHOA 4DS4A 2Y8WA 2XZWA 3GIRA 4O44A 2E4LA 4XPCA 1BOTO 1CZAN 1WSRA 3CSKA 3R1HA 2VG5B 2ZHAA 2RRNA 3SBMA 1TL1A 2DH9A 2RQ4A 1CPZA 1CBKA 4CK2A 1VQMN 5BN8A 2HFUA 1JLAB 4OYBA 3HJFA 4JI8J 4NYOA 1J27A 1RBVA 5HP1A 4K0KJ 1VAZA 1NKBA 3WQPA 2ZBIA 2DR8A 2DPIA 1SJ3P 4P2XA 4XIUA 3IAYA 1KONA 4DL4A 4EU0A 2DR7A 3ZZRA 1HBUA 4DCOB 2HQCA 2J9DA 4CTAB 4NI2B 5AQZA 4DL5A 3DNCA 4DUZJ 2FLLA 5J2NB 1T9WA 5GADU 4CGJA 4JV5K 4OX8A 4KAZA 3MWTA 4KO0B 1NGDA 1U48A 3E9LA 1WC4A 4LBIA 2JEFA 1B92A 2BMBA 2JRSA 2NXJA 3BF3A 4I2PA 3G4SN 1PO6A 1K1SA 3C7NB 4F2SA 3KNAA 3UFCX 3IWLA 5DS7A 2BQUA 1NAQA 3CJBA 3AVFA 4J9VA 3CCJN 4YMEA 3MM5A 4ID1A 2Q2RA 1VQYA 2ZBCA 4NO7A 4DX6A 3Q0AA 1F5CA 2N7YA 3AA8A 2MGZA 4C6AA 3TAMA 5KG0A 3MXJA 5M1FA 1VRQC 2WONB 3M2UA 3ENOA 3ZT2A 4ED8A 4ZCKA 3MD1A 4OLOA 1XUPO 1QTMA 2BBEA 4K59A 3D1OA 4DF8A 4J9MA 4DPOA 4CK3A 2GVZA 2SXLA 2JFDA 5E2QA 1WC1A 1URRA 4JOUA 3OA9A 2ACYA 5JJBA 3V6KA 2HVHA 2GMJA 2V6AA 4K42A 4CECA 3QINA 1CXUA 1ATRA 2CPJA 2HBLA 4P7VA 4O4GB 4DV0K 1O0PA 3S8SA 4GV6A 2KH9A 4HKQA 3H3OB 1FRHA 2VONA 1V6HA 5CA5A 1WSVA 1X4BA 3HDSA 1ZM4A 3FZFA 4Z4FA 2EBEA 3JTNA 3B6PA 1NZAA 2KXFA 5CYQB 2CQ2A 3CJTA 2YX7A 1I39A 4CO4A 3ILIA 2H5JB 2ZH2A 3CQYA 1EX4A 4WIIA 4FJKA 5H9EK 3KWGA 1RTJB 3DXSX 3O9QA 3AD9C 1RAEB 3ZX2A 3GIKA 3S7RA 3HKZD 2JDJA 4O4RA 3CJ2A 3NE6A 3SSSA 3LA0A 3TOQA 2OEMA 2Z1IA 4BE0A 1FRMA 4NMLA 5T7LA 2KJVA 4RG8A 3MMAA 4JKGB 4E98A 3LPEA 4HYKA 3MCMA 4J37A 4CLTA 4Y00A 3MEEB 5AQTA 2ASJA 3O3GA 4LY7A 3G82A 4V19X 4TKTA 2N3LA 1BHNA 3DCAA 4YDDB 1BIUA 2OELA 1W2BM 4CWBA 3J7Z5 4DV4F 5BYSA 3CHWA 1TTHB 2QA4G 2P9NB 4B17A 4BDPA 4JI0F 1RT2A 3D2EB 4EK2A 2LP4A 3Q83A 4IO1A 2Y3YA 3KK1A 3NS7B 3JXUA 1RQ0A 2QWRA 2PBDA 5F9NA 5LSRA 5I42A 3GG1A 3LF0A 1K8AO 2HNDA 1ZETA 1UWBA 3IGNA 5LM7E 2HZCA 2VFTA 3Q8VA 2HHQA 2VG7B 4GY2B 4MYTA 4F3TA 6FDRA 3DOKB 4OJ1A 1F9FA 1T9XA 4OZ2A 4IH6A 1UVNA 2H9ZA 3R8YA 2A2CA 3AVMA 4KC5A 4KTQA 4DWIA 1R6VA 4TYBA 1XC9A 3P31A 3KJVA 5FROA 4IFYA 1RDWX 3TX8A 3OTOK 4FXDA 4YB1P 4ECSA 4E7IA 2F9TA 4D3HA 2HQ3A 1ILYA 3N9UC 3GFXA 4X4QA 5RUBA 4YORA 3RBXA 1HNZJ 1XERA 3P45B 2AIRB 5E3CA 4R5PB 1X0FA 1W26A 4ZVOB 4LFAK 2CGLA 4EYIB 4QAGA 3HCXA 1AROP 3QESA 3ZSZA 4WQ5A 4TSXA 4MKYA 4RBVA 1OY6A 1FXLA 3UKUB 2ROEA 3DGPB 3FBFA 4RNMA 4DR1F 3PFOA 5AQUA 1X9MA 3VEXA 3SQ1A 1F3FA 4P52A 1M5OC 2BH1A 2NRVA 5HJXA 4CH7A 4BY9C 3JSMB 2E6LA 5B0GA 4QPTA 3L8BA 1GH8A 3CCQS 4CHNA 3L7UA 2C2DA 2UXBJ 3I4PA 2YWHA 1W9HA 1SKWA 2X3GA 2G1DA 1A0OB 3LWLA 4OLPA 8RUCA 2ATQA 2KO1A 4V1Ak 3I9ZA 1Z4UA 3JS9A 3HVTA 1FJEB 1JJHA 1EETB 2BDPA 2DJWA 3VGSA 3M6XA 3SMZA 2IVYA 4DXLA 4WFNL 3HULA 3H45C 1X3NA 1Y4ZB 4NOHA 2J6UA 1DBDA 3IWXA 4M5MA 4IOBA 2YJFA 3I82A 2HK2A 1V5IB 1N32F 4BRKA 5GADP 4LSLA 5ITHA 3MWBA 2DGWA 3FBBA 3M6UA 3K2YA 2Z4PA 3TYTA 3HT3A 2QLJB 5CHIA 2LKZA 1N34J 5IT9O 3EGVA 3AAWB 2YNFB 3T1YK 1L3TA 1EX8A 5LJVA 2YKAA 2ADBA 2IPOB 1VQOS 3M2RB 1RBUA 1RWKB 3WX8A 3QWUA 4O8KA 3OTCA 3CD6S 1J5EF 2GJIA 1IKVA 4N8OA 2HIQA 3CCVN 1GX5A 4UW2A 2ZDOA 1OH5A 3U6FA 4EO8A 1ZA1B 5C25A 4JHDA 2CGJA 2E5LF 4X62F 2R8JA 4MK9A 2A42A 2V7YA 5C24B 4GV3A 4JKDA 2K2PA 2DNZA 1D8YA 4JI5J 5JLHA 1UW4A 1VK8A 4KJIA 3M2VB 1ZPVA 4XAKA 3TVKA 4JS5A 3CD5A 1FXRA 1TUUA 1YIJS 4FLTA 1ZC6A 4DV5J 5BPLA 3GDQA 3AARA 4CFCA 1FNOA 2ZKTA 2HQIA 2GZOA 2DH7A 2MQNA 1WC5A 4E19A 4IUFA 3M7VA 1QHAA 4CZLA 4HI1A 3BDEA 3F2KA 4AL7A 4CLWA 1B0TA 5F0XA 3GONA 3QFPA 3QGPA 3QT6A 5CZXA 4BC9A 4X64J 2IAJB 2CH6A 2C2OB 4MFBB 3I9V9 1RT7B 5HROB 2PC6A 3IRXB 1TYQB 4R79A 5LL6Z 2D0OA 4TQRA 4DMZA 2ZH1A 2NUUG 1TFWA 1U45A 4DLGA 2AD9A 2G8VA 5DQHA 1UZDA 2D1CA 1RTDA 1H38A 1FEHA 1YRXA 1C0MA 4CEDA 3F9MA 2MQOA 3NF8A 3PTWA 5DM7Q 4QOZB 2IBKA 1AXQA 1VBYA 3OV7A 2AF6A 2W2PP 3ETMA 2AJ1A 3BSNA 1HQUB 4NLYA 3H8YA 2ZH9A 2HS0A 4X4NA 2A6OA 2QA1A 2WHOA 2XZTB 4ER8A 4KE5A 5L1JA 5E33A 1VIXA 1WI8A 3PYDA 1S6QA 4ZPDA 4QPXA 4ILLA 2R4FA 2OTLS 3M8SA 2UXDK 2R7VA 2J8SA 3KUEA 4KREA 3IAS9 5E3AA 3QQCD 2UXBK 3R5BA 3ZTPA 4ZJOA 3VGUA 4H0XB 2DFHA 3M5RA 1ASUA 2DK2A 3V9XA 5LMNJ 1BQNB 3LP0A 4A2AA 1KC8T 4HCCA 5LJ5Y 4DTXA 2LEAA 1OSCA 2ERRA 3E01A 4RW4A 4A8MP 1S5JA 4RZRA 2IVFB 1YGYA 2NSCA 1WUUA 4I6MB 2CQCA 1DGKN 4A61A 4JKAA 2ZF5O 2DNQA 3VESA 3Q2TC 4OHZA 4PRFA 4H0PA 1WELA 2X7IA 3UB5A 1U1NA 4L8RB 4DR4K 3M30A 3MR2A 5F8LA 4K0KF 3THYA 1A7GE 1C0FA 1WTFA 2IYGA 1JLGA 3V9SA 4C3KA 5CZ2A 2G8IA 1SAZA 1HWLA 4CEAA 3FZBA 4NCGA 3WHIA 4WE1A 5FDLB 4WP8A 2NRXA 4NLVA 2Y1IA 4A8XA 2OLWA 4LD0A 2DNMA 5KI6A 1WHYA 4DUZF 1RKJA 3W63A 2N4DA 3B6BA 2QA4N 2E2QA 1VRUA 5DZ7A 1HPMA 2VFVA 3TWZA 5IS2A 3A5LC 1KR4A 4O5BA 4GRSA 4CF2A 1DLOA 1XMQK 4QW8A 3KMQA 4C8MA 4U7UK 1N5QA 3OR2B 3E9PA 1C1CB 1CZBA 2P5GA 4NZ7A 2CIMA 3VQTA 3GYXB 2BA9A 1UVLA 3DI6B 4ES1A 3AO5A 2A40A 1NMDA 4LF2A 3JSRA 1R7IA 1P90A 1RTZA 2ILYA 1Z05A 2H4YB 2GO8A 1VFJA 3Q8PB 2VPXB 4R25A 3Q89A 2LVWA 1SJ1A 1YJTA 5U47A 2GJ2A 3BV8A 3BKTA 2HRUA 3PVXA 4MIWA 3HP9A 4W5RA 2K8GA 2MTLA 4CLYA 2CJXB 2HRTA 1WD6A 3RMBA 4WZMA 5B7WA 1MMNA 1DQ8A 2FSNA 4QIEA 3PV8A 4KH5A 3DLEA 2UU9F 5CYMA 5FRNA 5BR8F 2WVBA 4FS1A 4IFVB 5KFGA 3U9DA 3NGRA 4OYMA 4KI6A 2GWKA 4OGCA 4OHXA 3PIOQ 2I2YA 4NA2A 2VD3A 1YXQA 1G4CA 1TL5A 2HHHF 1NGIA 1P27B 1CSJA 4J2AA 3T6BA 2GGPA 1QDUB 3I56S 1RBAA 1LFWA 4A5AA 4O3PA 1W97L 4PG5A 1VQSA 3RB4A 3V81A 3SDEA 3EN9A 3FSIA 1EKRA 1G3OA 3E1YA 4Y0FA 3V5RA 1X4CA 1U2VA 2UUAF 4DOZA 3H59A 1QTNB 2CG4A 5KG1A 1YTAA 2VBZA 5A8KA 1JCGA 4C3MA 3EPGA 1AT1B 4H0YB 2VFRA 1WOSA 4IG0A 2E1MC 2KG0A 4CZJA 1UOCA 4PWDB 1R8HA 3CJKB 2VCPA 5AQFA 1Q8BA 3ULEB 4WQ4A 1IKXA 4WQ5C 3VA3A 3DJCA 2ZOFA 1TL3B 3K5LA 5C42A 1WSHA 3SCKE 2N4CA 2CJAA 4K4WA 1SL0A 4ZTJA 5LMNK 3G2XA 4ZVPB 5IT9Y 3EICA 2BRKA 2DXFA 1OVYA 2KFYA 1TAUA 2P51A 1UWAA 1OVQA 1S6PB 2HF4A 3CFOA 4BRAA 1WDTA 1N5SA 3RAQA 3PIPL 5K8OA 4GMKA 1Z2LA 2N82B 4PUOA 2H5EA 4NYNA 2KVIA 4E7KA 4KGKA 3UNYA 2MPUA 1LW0B 1CJVB 3TTDA 1VK3A 2RT3A 4WTYA 1IR2A 5E3QA 5ETPA 1HNZF 1WSGA 4IKFA 4DV2J 2VFSA 2QIFA 1YK9A 1ZBLA 2MXYA 3ET6B 3A5MC 5HI7A 5JUMA 5B8HA 6FD1A 1M1KT 3TR5A 3CDEA 4LBHA 2L9WA 3DN9A 3BSOA 1RHKB 4P2SA 1EB0A 4DV4K 2MKHA 3F44A 1SPBP 5ETTA 3WIUA 2HNYA 4H4KA 4GKJJ 3DXKA 4LF4K 3CCLN 3AQPA 4KKOB 3K59A 3BJYA 1IJFB 4JYAJ 2CQ4A 1T7PA 3QATA 2VQEK 1K9MO 2ZDPA 4K4SA 1U2RA 1HBUB 4CZCA 1R0AA 4Z4GA 2AEMA 2OA8A 1WSEA 2KHDA 3RMAA 4DFPA 1TUVA 2DY9A 3O6WA 4AILC 2RUSA 2B5JB 4QU6A 4H0TB 2GV1A 4CJ3A 4GVEA 3OSPA 4DUYK 3AJDA 3OL8A 4DR2F 3MN7A 1IUJA 1NOYA 2DY4A 1SS6A 4C0HA 2EFPA 5DDOC 3QJLA 1VYAA 4Q0BA 4DSKA 3CJ4A 3KLIA 4PCQA 1IBKJ 2QKKA 2AP6A 1FDAA 2POKA 5F0WA 4GVMA 1LOTB 1XK8A 4ZS6A 3EJMA 2A2DA 3EZOA 1BCMA 2EPIA 4A8YA 3D6RA 4JI4K 5JVGQ 3KLEB 4P10A 1DQAA 4I64A 4USKA 4CQ1A 3RGIA 1N4LA 2MGZB 5AQXA 4XK8C 3ONQA 1SVDA 2ZE2A 1U2FA 2DVIA 3OHAA 1N34F 3DOLA 2XNQA 3M2UB 5B0FA 2HNZA 2QGFB 4M5NA 4KGZB 4RBUA 4NX9A 3KUGA 3W62A 4BE1A 2IVPA 2GVZB 4EZ9A 1U0HB 4L72B 4JK9A 3VF6A 3QT8A 1JLFB 2RMLA 3BUZB 4E3SA 1GLBG 3HKWA 4YY3J 4PKGA 3EWGA 3AJ2A 5JXSA 4CZIA 4A8SA 3C14A 3KG0A 2BW2A 2CNNB 3CIMA 1JLEA 4FJJA 4ZOSA 2ZUGA 1RAJA 3CCRS 3C94A 1RDDA 1RT1A 5DZ6A 3CB4A 2O8DA 3ZETB 4DV5F 1KKHA 3B82A 3FRZA 3TA1A 2AGPA 1QE1A 3L0QA 4ZPVR 3SQGB 4L73A 2DYAA 4FK0A 1R59O 2NPIA 2FTRA 1QSSA 1E6YA 1DARA 4P2MA 2XS7A 4TU9A 4G6VB 4OPAA 4YNQA 3PSFA 4J8FA 4B9LA 4J9SA 1SBRA 5L1KA 4LSNB 3SV4A 1XNRK 2BKNA 5T7LB 3CM5A 3S3NA 1A5WA 1XR5A 4B3TJ 3MEGA 1VISA 2U1AA 2ZC3A 4IEEA 2YX1A 4X64F 3ZZZA 2E9ZA 4FPAA 1ULRA 5IZHA 1LNQA 3D3BJ 1HLUA 1RBTA 4KQZA 5HANA 1VQ5N 2GVDA 1P1TA 2IDOA 2ZBQA 2UUBJ 1JLQB 1HR0J 2Z8QA 1Q5YA 4HUFA 3ZO7A 1F21A 3JXOA 2YQ1A 3G6XA 3EXYA 3IFEA 2BYCA 2F9JA 2YHYA 3WNGA 5ETOA 1SKSA 2IDEA 1BC6A 5AXMA 4ZP9A 3IC1A 5JVHL 3LAKA 5I42B 4FLWA 4DV2K 4C8NA 2W4DA 3B4MA 1UEKA 3OPKA 1UWBB 1UL3A 5BRFA 2IOCA 5DQIA 3P5TL 3HP6A 3QRPA 1WG5A 3ISNC 2J9EA 3MM6A 3OY9A 1BHLA 4E8UA 4URSA 4WBFA 1HWJA 5EGYA 3ELHA 1X9JA 4M63A 2A6MA 5IQQA 2H1YA 2VDHA 4JLHA 4GKJK 2V4JA 1JL2A 1ZBFA 1MU2A 3MPWA 1RT4A 4O0JA 3KJVB 4JYAK 4IFYB 2KVQE 3DHXA 4BDYA 3L4BC 1KFSA 5CE3A 5KPTA 2DY1A 4KB0A 3Q8UA 3M8QB 1S49A 4RW6A 2RJZA 3VGKA 3GU0A 4BREA 1VQ7N 2NSBA 4JI2K 1VLOA 5DM6Q 3ENHA 4BRDA 1FVQA 1T9YA 2AX0A 2C1EB 2AYBA 5D4LA 1G15A 3RTVA 1DRZA 3N0VA 3I8BA 1U7LA 4DX8H 1TFYA 4M5KA 4OV6A 1Q82T 4K25A 4PEOA 3JAMU 2LEPA 3LDPA 4ZVEA 2JOQA 2ZJQQ 3N4QA 1A9NB 2PMWA 2NXNA 4ZLLA 2F8HA 2O8FB 3R2CJ 4GMJB 3HJVA 2HBKA 1WNEA 4GKKF 3TAFA 2VOPA 1RBSA 1KQSM 2K3IA 3LDNA 2F8EX 1MN7A 4LF9K 3JQMA 3QAUA 5KT4A 2XMWA 3RB6A 1FFSB 4P6QA 4C1NI 1DURA 1M1GA 4DN9A 5M2UA 3C65A 4CNYA 1V9OA 1VC0A 4CO0A 4KPCA 2FBYA 3RMCA 3HVTB 4OYAA 3TQ1A 4NYFA 1M0SA 4LRAA 4ZP8A 4FF2A 5BPMA 3G87A 2Q0RA 4FBUA 1GLDG 2J6TA 4ILJA 4OJRA 1T05A 1AB8A 4DSEA 5F0UA 3HT0A 1KEKA 3OYKA 3X3UA 2JSXA 2EFQA 4QOTA 2DEIA 3JSYA 4CLSA 1OPZA 3HFVA 1K73T 3L3UA 2RKIA 2XLJA 4ZCMA 1GMUA 1HNWJ 2HBRB 7FDRA 2HW3A 1G99A 2ZGZA 3W5XA 2VPWB 1NBEB 1I1GA 1DTQA 5CCMA 2HQDA 3QNNA 1FDNA 2GBZA 5AFUH 2UUCK 1YJUA 1ICEB 2MJUA 2A41A 2D5RA 4F0MA 4E0DA 3G9CA 3J81O 2LSNA 3O3FA 2GIQA 2UVVA 4RCHA 2GX8A 1HUXA 4OYOA 2EVZA 4WZQA 1C0GA 3RRHA 5C25B 4JHDB 2HFZA 2EW9A 3OW2R 1RU1A 2OFGX 5AXKA 2O4IA 3ENWA 3VAMA 1JLBA 4C1NK 4CEEA 2DR5A 1WKKA 4EHUA 3CE8A 3S3MA 5GMDA 3CXCR 4Z7YA 2CQPA 4A57A 1EWRA 3U27A 5MLCQ 4JEPA 1GX6A 2O01C 5J2QA 3EEQA 1R31A 2DTUA 4CLPA 4HTJA 2YNIA 2D74B 2HGMA 2GEMA 4KRWA 2DNOA 2F9WA 5ADXH 2OIHA 1GLFO 1U0SA 4RUCA 1VQKN 1EHWA 1UCNA 4GV9A 2HZVA 5HVGA 3SXLA 3VGMA 1LOUA 2C2EA 2K7JA 2MLZA 4CGDA 4FWNA 2H51B 2D69A 3GJRB 2YPYA 2ZH6A 4CZHA 9ATCB 3NLCA 1U25A 2GAGC 3ZZOA 2Z2ZA 4J2BA 2NRRA 4FOEA 4BHQA 2OH2A 1FI4A 1XHXA 3PW5A 1JCEA 4LF6F 4OGEA 4KHNA 5AQRA 1JL1A 2XULA 3VEWA 4YR2A 4MK7A 4OPJA 3TNVA 2AJ2A 4X65J 2XQCA 3MWPA 1X9SA 1VI7A 5KFUA 5F9LA 2JGUA 3KKRA 4ZK7M 1WSIA 3MFIA 3LL3A 4Q44A 4LIRA 3ZT0A 5KT6A 2BVZA 3TJAA 2CQ1A 4IKAA 1FEEA 2A3JA 4Y0WA 3KOAA 5EWFA 1V5VA 2W9BB 2QWLA 1XMOF 5EX0A 1VDHA 3FFKB 3ID8A 2PDAA 4U8YA 3N5BA 4IG3B 4H4KC 4MK8A 4DHVA 3DU6A 1IJEB 4BLGA 2ZM6K 1BD6A 1KS2A 3R6MA 2WK4A 1JJ2R 2HHHK 3OYIA 2IA6A 3Q8SB 2L3MA 3P39A 4Y2CA 1MMDA 5E7OB 4AHRA 1S6QB 1M5KC 4TLRA 3QICA 3WXLA 1IN0A 4ED4A 1J54A 4DG1A 2XMTA 1BA0A 2V2QA 1VQ9N 3MTKA 2P9LB 1QHTA 2VPZB 2XG8A 3KWMA 1PCAA 2HFSA 2UUAK 2G9OA 2XGPA 4FLXA 2G1HA 3GMGA 1HW8A 3POTB 4C8KA 3LP0B 4CJ4A 4ITSA 5IXUA 1J5OA 4FVUA 2VG6A 2OEKA 2EX3A 1NK9A 3UE2A 2D9PA 4OZ3A 1Q79A 3OFEA 4CIFA 3HPGA 3NHGA 3MM9A 3KFWX 2R7OA 5DM7L 2Q1LA 1NEEA 2F5GA 3CCUS 3PR4A 3T1HJ 2BW7A 2YNHB 3MEKA 3I0SB 2CJBA 3IG1B 1FX4A 1EP4A 5K14A 3M30B 4I6WA 3MAAA 4JI6F 3THYB 1GAOA 1HNWK 1T03A 2R3VA 3PKMA 4ANDA 1JLGB 3J7YU 3F41A 2E7VA 3OVSA 2DGXA 3E51A 4NCGB 4IR1A 2R2SA 3K5NA 3UVJB 3BYRA 4M5JA 2E1YA 5ELZA 4FL9A 1SI9A 3PXGa 3WXJA 4CI6A 4BBYA 1HNIA 3GSIA 2W01A 4N5SA 5HRRA 2RF2A 1QAXA 5SUHA 5A8RB 2FDNA 4F7VA 2DNKA 1GTEA 4LF7J 3DMJA 2KYXA 4ED7A 4M7XA 1GMWD 3C16B 3PX4A 3PY8A 1E4FT 3THXB 2Q36A 3I0RA 2KT3A 2OSRA 1TMJA 5CYJA 5HMZA 1DY3A 1H2VZ 4N7TA 1IBKF 2DHXA 3O9TA 3TUPA 5M1OA 3FZMA 7AT1B 3D45A 1RTHA 4KHYA 3TA2A 2R7WA 4Q45A 1HA1A 1ZM9A 3V6DA 3DLKA 3W65A 4WCEQ 3RZAA 4KHUA 3BQ0A 4ELTA 4ID8A 1IWAA 4ECWA 4YHHF 4DR5F 4DQQA 5G4DA 3NCQA 4IOAQ 2XS5A 3HPHA 3DLEB 4PXDA 2DR9A 4DL2A 4YY3F 3K5OA 3O9UA 3H98A 4CJRA 2MZQA 3DXMB 4IJAA 4J9KA 3CMEN 1SL2A 3UKRA 1YJWN 1H0HB 2ADCA 1KXPA 4JN4A 1PSDA 1T0TV 3MAQA 4KTWA 3WNHA 4BVOA 1HBNA 1YJ9N 1XNQJ 2A5XA 1HLWA 4RJVA 3UPFA 3AVNA 3OUYA 1K44A 5EXWA 2YWEA 4BWJA 5F41A 3IM9A 5F8NA 2P9SA 3R5JB 1W7AA 4JI3K 1YG0A 1SZ2A 1NDPA 3EMTA 4FW2A 5DLGA 4FJ8A 4L76A 4OKKA 1BQMB 2FGOA 2XSJA 3SV3A 4M63C 4M41A 2P6SA 3QIDA 1K8KA 3V81B 1RAIB 3SDEB 3MX5A 1HKAA 2O1PA 4ZJLA 4K43A 5HBMA 5FPDA 1KRPA 2CWKA 2RILA 1U2VB 2DGOA 4K5RA 5AQVA 1NG9A 2HBQB 2XCPA 3ZSWA 1GMVA 1WF2A 1YBAA 3ZX3A 1WSFA 4ZJQA 3NF9A 4HHHA 3SQ2A 1TKTA 4B3TF 4FNHA 3O9RA 5C12A 4J2EA 3QIPA 2VBYA 1JKHA 3RMDA 4C3LA 2DNLA 4JP8A 3P5JA 2L08A 1Z26A 1S99A 5EU7A 1S76D 1Q9YA 1ASWA 5JS1A 2UUBF 3Q22A 8AT1B 2WCXA 1HR0F 4RO0A 3ZSYA 2QXFA 4M42A 2QTWA 1NHVA 5F3TA 3IDHA 1I5OB 1S1UA 4OPHA 4DI6A 3GV8B 3CC2N 1OIAA 4IRCA 5I3UA 1RWOB 3VQ9A 2F7TA 3IR5B 2O8EA 3G8QA 5AQQA 3K5MA 2CQDA 5LMUK 2LQJA 1TGOA 3CC7N 3GILA 3RSEA 2KXNB 1FKOA 1RILA 3W2WB 5GAHU 2FVRA 1IBMK 4B1WB 4A4JA 1Q5VA 2HAFA 5AE2A 2ASMA 4FSVA 1SC4B 4Z4EA 4RU2A 3L4QA 2R8KA 4BRHA 2BRLA 3H0PA 4ZPWR 3NF7A 4UUWA 3LP2A 4DJBA 2CPEA 1H73A 1RB0A 1XI1A 3SUPA 4MMOA 3Q7CA 4OKJA 2V7ZA 2IM0A 1MA9B 2M88A 2F4FA 4KTZA 1FD8A 3UR3C 3O3LA 2WOMA 4EAHD 5B09A 5C7PA 4K4TA 4HVZA 1IBLJ 1EO1A 2HHWA 4K4ZA 2JVOA 4UF4A 2KB2A 4RTFD 4E1NA 4DV6K 4C0OC 3PFEA 3VQPA 2E9TA 3M32B 4JI7K 3A8EA 2BQ3A 5HVFA 3QJJA 3DLRA 5AE1A 2W42A 3LPTA 1AYEA 4ED5A 3D0HE 1UKUA 3ZZUA 2KI2A 2FC9A 3DXKB 2ASOA 3HXMA 3SUQA 1NDLA 2ZKUA 1U47A 2Z57B 4RW8A 2GMHA 4X84A 4J5OA 4QS9A 1GXLA 2W25A 4I2QB 3V2UC 1KLMA 4HWIA 2C3UA 2J5AA 1I6JA 4ICLA 3HSTB 1R0AB 2FGCA 1UVMA 3LALA 1UPPA 2R42A 1QS4A 3MFHA 2CH5A 2XM3A 5ADXA 2R8IA 1HPZA 4NLPA 1M90O 4DL0C 1JIHA 2FJXA 1L3KA 1WAFA 2G0IA 3QIOA 3C7NA 2DIUA 4DTSA 5KFSA 4RWTA 4OZ1A 1OY9A 3NNAA 3JS6A 2BUPA 4NMXA 3FZ2A 3OJUA 1AW0A 3THWA 4Q0BB 3KLIB 1VBKA 3J7YP 2RQMA 4C2MA 4FO0A 3R7NB 4B3MJ 4WFZA 2BQRA 3W5YA 2K3KA 2I38A 4CJWA 2CVIA 4DU7A 2C3YA 1UZHA 3TVYA 4ZHRB 3LWMA 1FFWB 3US5A 3NVMA 1L3SA 1L3VA 5GINA 3QNOA 2FJAB 2OPPB 2ZE2B 1PKUA 3U02A 1WDDA 4CHYA 3SMSA 2LMIA 3KMSA 3TAPA 5JMVA 3BH6B 2HURA 4OLAA 4XEIA 1U04A 1DTTA 1VQPS 1YJVA 4K41A 4BR0A 1U8WA 5F8IA 2FVCA 1BG3A 2Z56B 2PI4A 5HRPA 3NH1A 3ZX0A 3OYBA 4GKKK 2FD2A 3LDLA 4CM2A 2FHJA 4KHPK 2MZJA 1ESVA 3HYFA 4O4GA 4LR7A 4OYIA 2X74A 4W98A 3ZTRA 1I3OB 4OZ5A 3C14B 1F0XA 4DFJA 2DHAA 1G6BA 5KOXA 3M1VB 4NLOA 2H3EB 1JXVA 5M1NA 5CYQA 4X4UA 3VF4A 2B0GA 3JQJA 1TAQA 3A5OC 2GV9A 2O8DB 1XMBA 2B51A 1RTJA 3CCMS 4NXNJ 1D9AA 1VSMA 2OAUA 4NZ6A 2G13A 4CZKA 3N6MA 3NGSA 3QT7A 1HNXJ 5KFDA 3BZKA 2NXCA 5GIOA 3W9HA 3AQOA 4Y2AA 3T5HA 4JKGA 4FJIA 4AHVA 3JSBA 4JS4A 1R43A 1SXLA 3CJRA 1OQ6A 3CQ8A 5IT0A 3EKUA 3MEEA 3MEGB 5CZVA 2O5DA 4B8CA 3CJ3A 1NGGA 1SC3B 5IT9U 3MDFA 1QZ6A 3NOGA 1MWMA 4OX7A 3C3LA 3A1YG 2A10A 5A8WB 4P7TA 3N01A 4X65F 2XLKA 2UZAA 1YVNA 5KFKA 3MCNA 4ILGB 3GPAA 1FJGJ 3D2EA 2HBYB 3MAHA 2E7XA 3MUMP 2E5IA 4M1KA 1VSJA 2PAVA 3PM9A 1FO1A 3M05A 2NZ4A 2ZWHA 2ASYA 4Q8EA 3TUZC 1NGAA 1S1XB 5IOLA 3FLCO 1BA1A 4ECYA 3ENQA 2VG7A 1TVRB 3TTFA 4DPXA 4NZ0A 1FXDA 1Y0HA 2JJ4D 4HL9A 4BR4A 5FLXU 1WSJA 5D6GA 2R7XA 1VLYA 2DRDA 4FM1A 3MM6B 1OJ4A 3ILJA 3P4IA 3BM7A 3Q8QB 4B9TA 3DDIA 2YVSA 1K0TA 3TJ8A 4WP9A 3A12A 4USHA 1MU2B 4HVJA 3W66A 1LAVA 3TSQA 4WFNQ 3MUVP 1BI4B 1Q81T 3L9ZA 3VF0B 4FJHA 4K2JA 1AZSA 3MXHP 4LH4A 2RS8A 3I87A 3VWSA 3OTDA 1A5VA 1IXKA 3P8BB 1RT5B 4IFEA 2ZWOA 4O3RA 1RI7A 4I4BA 3TANA 1SKUB 4RNNA 4LF6K 4LFCF 3EGNA 4OJGA 3THPA 1WBDA 5GAHP 3UKUA 1Q16B 3FFIB 2YPZA 4DQ8A 1RABB 4AFFA 1FJCA 1VSIA 2L48A 4IXCA 4DR3J 2V9WA 1BGXT 4MKAA 3VQCA 3DU5A 2IFXA 4AT1B 4FS2A 4QWBA 5FPNA 3OYMA 1HYSA 2ZNZA 4CEFA 5AQYA 5BRDA 3GYGA 3QZ8A 3UCZP 3DRXA 3PZPA 3V9WA 3T1HF 1GLCG 3AAQA 4DR7K 2Y9HA 3UN5A 1O1WA 1NK0A 4LF8J 1O51A 1RCHA 4QYZK 2NLWA 3H5XA 3CETA 2CNLB 5KFXA 1YSJA 1HKBA 3AO1A 1Q7YO 2B9WA 4ZIVA 3GOIA 5JICA 2LQ8A 4LJMA 3ENBA 5K8NA 2JLFA 1TZ0A 3HHLB 2RDJA 3QZ7A 2QSWA 2JFKA 1RYRA 5IM0B 1DQ9A 3J80Y 1VSDA 5EDWA 3S6EA 1KTQA 3Q8RB 2EFGA 4LF7F 4WFYA 2F9DA 4JAXA 3T3FA 1U4BA 2QLFB 3L09A 3M9NB 4XDCA 3CCQN 4WK3A 4NLBA 2VYPA 1LXJA 4FJGA 4JKEA 2NREA 3M2RA 4G1IA 2FLNA 1VJWA 1EQ0A 5HMXA 5CHCB 1D0EA 3SI8A 1DTQB 4DR6F 3OSNA 4M3RA 3JTPA 3M6WA 2IGIA 3MM8B 4CCHA 4JRPA 4H54A 4BVPA 2E2OA 2XI3A 3RVCA 4X66J 2VJVA 4NLCA 1LW2B 3HZEA 3ULHA 4LFBF 4MLEA 3CIZA 1JLBB 4CLFA 3PX6A 4KT0C 3M2VA 5KFIA 5AJ3F 3NGKA 5J2QB 4B3RK 2CQGA 3PHTA 2BANA 3N28A 3PW2A 3PO5A 2YNIB 2PE8A 2BACA 1NRKA 3BO2A 1VQON 4ELVA 3LM2A 3A8JA 3BF4A 3CDAA 1HI1A 5DG8A 2UUWA 3CD6N 1RHMB 2EXUA 1LAWA 1S1VB 1G1XA 5M1KA 5CXTA 2J0QD 3L3CA 4I56A 4L6V3 4NXMJ 1XNQF 4ANCA 1YTUA 2HS3A 5E3PA 2HMIA 2E1AA 4N56A 3CPEA 3ZC4A 1VQ4S 4A48A 3KLVA 2OZMA 1Q86T 4EGLA 1BL3A 4ZVFA 4LF5J 3BS9A 3P3DA 3SIPB 5HROA 1NXIA 1PG5B 2IC3B 3MEDA 1TYQA 3HTVA 3MR7A 3ZXWA 5JS2A 1YIJN 2P9IA 3AA5X 4TLQA 3MN6A 2FHOB 5CQGA 5GAHI 2M4MA 1B7FA 2NS1B 1YF5L 4YHHK 4DR5K 3LGNA 1WNSA 2QWMA 5GVQA 3L6QA 4OZNA 3BO4A 3CFRA 2O8BB 3PRBA 2FJBB 2HQFA 4QQBA 2W40A 4B3SK 2RD5C 3CJCA 4AM6A 4LRCA 1FA0A 4U9RA 4BC5A 3VF2A 3O4WA 2Q6CA 3VEYA 1WC0A 1T95A 2UVWA 3F9KA 2AJFE 3OFFA 3EXCX 2YKOA 4XPEA 1UJ6A 1SL1A 2J9CA 4P71A 1NPRA 3SUNA 1X0PA 2LA4A 1NH8A 1RWXB 2P9KA 4DG1B 1RFQA 2Z1HA 3UN2A 2H4WB 1S10A 3AVLA 4M5HA 5K20B 5AQLA 4DV7K 1WKLA 1Y64A 1HD0A 3VEOA 5E3RA 2DGSA 3EYZA 3TSUA 3LP1A 3VAFA 2AA4A 1TKZA 2P6TA 2QMUB 3VV2B 3SCJE 2G2YA 2NUBA 2JLEA 4AQYJ 2F4VJ 1WG1A 1LK5A 1I94K 3GIIA 2ZBPA 3L2RA 1ZBIA 1IBLF 2HBZB 2OTLN 3MM9B 2WVCA 1HX1A 2EWHA 3MPDA 2R8HA 3D0IE 1EP4B 1RA7A 3O8MA 2KZZA 4KRFA 4FN5A 3MAAB 4R0JA 4HUGA 1T03B 2WW8A 2E5GA 5AQNA 2NR0A 2Q3SA 1TUYA 5I9EB 2E1RA 2RB7A 1VSEA 3MPVA 4DV1K 1R0CB 4Y28C 3WT0A 1TV6B 4CGHA 3NFAA 4WFBL 3TAEA 2OD6A 3BSCA 1HNIB 2XY6A 2CRLA 4X66K 4M5GA 2D3O1 3DMJB 1C1CA 2BM1A 3W0LA 3U3GA 2N7CA 2UXCK 4CYUB 4LSZB 2OMLA 1U24A 4ZN3A 2B8PA 3DI6A 4AXJA 3I0RB 4UQGA 1REVB 4MQ3A 1NNDA 4KGMA 3BREA 4B3MF 1URNA 3L2UA 2WAQD 4HUEA 4ZPCA 1RTHB 1HRHA 3KUHA 4K8ZA 4DS5A 4ED2A 4DFMA 4RKUC 3T5KA 3L2QA 2Q6BA 3V6DB 2YI1A 3DLKB 2M70A 3CMAS 4NXMK 1BWVA 2PI5A 2BE9B 1HWIA 5DK5A 1RWPB 3W8GA 1S0MA 3AFGA 1J53A 3E9OA 1YRTA 4FK4A 2OHDA 2OI2A 4AM7A 2BJ9A 1SUQA 4IJNA 2V69A 3D6MB 4PKDB 2XB2D 4QR0A 1F3VA 4JD2B 2UV8G 2KXHA 5B0CA 1CS4A 3OBWA 4YOUA 3FQLA 3MURP 4CFDA 1R89A 4M5DA 1ATNA 4WF9Q 3GG0A 4ZN1A 4WIQA 1O13A 4PL7A 4QU7A 3C6AA 3KHRA 1QVFM 1KOOA 1T02A 1QAJA 1IVZA 2RIJA 3MOZA 2IM1A 3LTOA 4J91A 1S79A 3W8PA 4RBTA 2XSJB 3NG8A 2G8UA 3SCIE 4CLUA 1V3ZA 3T6JA 2DH8A 1HNXF 1RBRA 2RS2A 3R8EA 2JHEA 3OR1A 3EZUA 1U1LA 5HBMB 1XR6A 3PW0A 1VSLA 3IR7B 2V8DA 5J2MA 2AJ0A 3WUHA 3ITHA 2FJWA 4EP5A 4CE9A 4O5FA 1R0BG 1RAOA 4KB7A 4E7HA 1TKTB 3LGHA 3R7SB 3HFKA 1JKHB 2RNEA 3MCSA 4Y2IA 1NJWA 3TVZA 2MZRA 2FBVA 4LT6A 4QYRA 2ZUAA 4JI1J 2DNYA 4A8FA 5KFJA 5H9EJ 4EZ6A 2HHTA 1SQKA 4ZVUB 5HAOA 1FJGF 1TMMA 3DRYA 1S1UB 3QEVA 4A8QA 1IG8A 4ZITA 1RT3A 2QW9A 4NCAA 2FIUA 3ZT1A 1T94A 2QJ3A 1JMTA 3JTOA 3HF5A 2NCKL 2ZNYA 1B70B 2VODA 1FRIA 1K6YA 2ASDA 2O8EB 4KBIA 3AO2A 4FWSA 4CGFA 3CXCM 3RSEB 3UCGA 3T9NA 1FKOB 4BRMA 1Y97A 3A4TA 3FNNA 4M3TA 4ATNA 3CNQP 4K4UA 2W2MP 2ATCB 1JJ4A 4CJPA 3LAMA 3NMRA 2GQ2A 5ETKA 4F2RA 1LW0A 4TY8B 4ES3A 4FJ7A 1CJVA 4FZYA 2BJEA 2HQGA 5KQDA 2AMCB 4G3IA 3LP2B 2PIIA 4BRLA 4IDHA 1U1MA 3OYNA 3VR1A 3CCWA 2HRYA 4PG4A 2E5JA 3LZJA 3HSGA 3ET6A 4CZGA 1Q95G 2J4RA 4DLEA 3MPUB 2WOMB 5BYRA 3W7BA 1HMVB 3KDOA 4USTA 1MWKA 4AL5A 3BB5A 2QV6A 3C8YA 1GLEG 5T14A 4M3ZA 3PSIA 3MR5A 4KKOA 2HGNA 2V68A 4DR3F 1G2EA 4H5VA 1LKZA 5DGBA 2FBTA 1NSAA 3OTOJ 3VVUA 2OD4A 3C6TA 2GELA 3EX7B 1NK8A 1H7WA 3H2LA 2MJNA 3H42A 4RW8B 1WORA 1Q18A 2HBMA 5KPZA 4AXIA 1AUDA 3UO0A 2G8FA 1KLMB 1J9AA 4ICLB 3E2EA 3CJ9A 1FVSA 4X4SA 3I5CA 1S7IA 2B5JA 4LFAJ 3HHEA 1IO2A 1U26A 4LF8F 5EUHA 2J7UA 2ZH7A 2RRAA 1HPZB 3BGUA 4FXWA 3L2WA 5LJWA 3T5JA 4GO5X 2GHPA 1VOMA 1JNRB 2ZZNA 2GHVC 2LQBA 3E3XA 2HYIB 3QSIA 1ROFA 4FF3A 1X7VA 4DKWA 1TK0A 3K7RA 1JJ2M 2MZTA 3D7SB 3GFHA 4EO6A 3M6GA 1EIYB 1N88A 3THWB 3QBXA 4H5WA 3KLEA 2JEJA 4BDZA 4P9SA 1KD1O 4Q8FA 5KFNA 3P1GA 3KNGA 3TJ9A 2V4RA 1QAIA 1RDCA 4LFCK 2CQ0A 3TEGA 3DFEA 4C0BA 4M3UA 1C1BA 1N36K 1BISA 2C42A 1M5VC 1GXUA 2V8VA 4USMA 3D0PA 1U6BA 1D4XA 1U0HA 3TABA 4PXEA 2QWOA 1JLFA 2YH1A 1DTTB 2CQBA 2YTCA 3D1QA 1OYDA 1U49A 2ZQBA 1H7XA 2AHOB 2UVUA 1KDNA 2FXUA 4UZCA 1F2GA 1C0TA 2DKOB 3CF5L 5JVHQ 1UVKA 3RW7A 3BZCA 2M2BA 3AVAA 2EK6A 2WSFC 3T1YJ 5HRNA 2V63A 4KFBA 5KT7A 2KL8A 3ZEUB 3HVAA 3ZETA 2CYYA 3SQGA 1EKEA 1R8PA 2P5OA 4FJXA 1KVBA 4JI1K 1NJIO 1KAZA 4IEIA 4I6AA 4DV3K 2DFFA 1GLAG 2VWJA 4GC7A 2H65B 3O3HA 4LSNA 3GG4A 2VASA 2WBRA 2P9PA 3HVRA 2V51B 1FWLA 3FCVA 4UY8O 1JXBA 3EKSA 3TRGA 3I8DA 4NYZA 4LF5F 4JNEA 3AA3A 4YDUA 4USIA 1JLQA 2BJ7A 3D68A 2EKNA 1QSYA 3X1LB 1NMEB 2MKKA 3KYLA 3NP5A 4CRJA 2PYJA 3ZTSA 2E2PA 3HM9A 2QLXA 3GE9A 4F4KA 1H2UX 4LFBK 1ZOTA 1TP7A 2AQ4A 4UOCA 1RTIB 2COLA 5ETMA 1UFKA 2OPQB 5IV3A 5AJ3K 2J0WA 2VQFF 3T41A 3NF6A 2YQ3A 2BXJA 3AO3A 1VQNS 5IC6B 4DFKA 3WXKA 4JV0A 4WXWA 3FCWA 1NMNA 3LGMA 2FF3B 3SPYA 3DRRB 4KIAA 3W1YC 4UZBA 3BSAA 3VALA 4KH4A 2I9SA 1WTBA 1WOOA 2P5VA 1X3MA 1CC8A 1LEOA 2Q97A 1JK9B 3M8QA 4X4RA 1PBAA 1D5AA 3DRPB 2VZ9A 1QAYA 5IT4A 3FZHA 1AZSB 5ETLA 2RE1A 1N52B 3CD0A 4BWMA 5AQIA 2CPYA 3RAMA 4CFBA 2V67A 4ZPAA 2LECA 2CDQA 3DRSB 3NGDA 4HEA9 4ILRA 4N76A 2MQPA 3PLAA 2J6SA 2RDIA 3HOSA 1CQMA 2YWFA 3AA4A 4UTGA 4AQYF 2F4VF 3KLGA 3D6HB 2XSFA 2V94A 3K8VA 1KVKA 2UXDJ 2FJVA 5D0GA 3QGHA 2O8FA 2KJWA 1HYSB 3E8OA 4ETXA 2I5JA 1RSCA 5HMYA 1W0HA 3P49B 1XJWB 3BN7A 3SAGA 1WHVA 1ZA2B 2E2NA 4L3QA 2RHQB 4F26A 5KG2A 2Q43A 1RNHA 4FJ5A 1PC4A 4ZCIA 2DEJA 2NXEA 1WEXA 1DFDA 4B1XB 2H3GX 2ZJRL 2HVIA 1MWZA 3P4UB 3MCAB 2F63A 3PYEA 4RNHA 3GFYA 3OBIA 3Q23A 3R3LA 3PYGA 4BG8A 2F7VA 2XY7A 3VQDA 4DCPB 3I6PA 5AE3A 3AV9A 2WBMA 5KTQA 4X4PA 3RR8A 4OX9J 4O55A 2HHPA 1CQNA 3U1LA 3K17A 4DR4J 4FYVB 4O8UA 4CHQA 4AHCA 2IS3A 4M94A 3KKFA 3SI6A 1X5PA 4CBUA 2HWTA 4NPOA 3ISND 3GR0A 1N33K 4ZIWA 1A5XA 1XC3A 2EEYA 3A5NC 3EE9A 5LSLA 2NZCA 5AQGA 2C3OA 2B4VA 2XNRA 5G0RA 1X4GA 4JV5F 5KFZA 3CO9A 2C2RA 2W4PA 3RBZA 2DNNA 3NKYA 2Y0SD 1S72S 4K4XA 1C0UA 4CH1A 1XMQJ 1FRXA 4ZP7A 3L4IA 3PJWA 1ZAWA 4CIEA 2FC0A 1BIZA 2DIVA 3P96A 1Y00A 2NNWA 4ALZA 4U7UD 4FK2A 1F5AA 1Q78A 3G10A 5IWAK 2IMWP 1J2VA 2IRUA 4ZP6A 5ETVA 1WLJA 3WNFA 3OFHA 2BM0A 2BOAA 3CVKA 2YNGB 2YBVA 4G1PA 2A3ZA 5HLFB 2BANB 3GCXP 1OH7A 4I6YA 2OPSA 2QMWA 1T3NA 4EEYA 4B9SA 4LC9B 4BS2A 2BUNA 2YHAA 2L9NA 2M5YA 3L7OA 4WWSA 1EJ7L 3KHYA 1KN6A 4J2DA 3I96A 3EGWB 3RAXA 3ID6A 1NU4A 2MMYA 4USJC 1MG7A 1KQKA 2KKHA 2RHSB 2GC8A 3NOCA 3W64A 2HMIB 1MROB 1Q53A 2IIHA 2W9CA 3HSZA 5C2FA 4EBCA 3M4XA 2L9DA 2BOPA 2AEFA 4EFHA 4BACA 3GJTB 1R6YA 1VCTA 2XGQA 5F8JA 2FY1A 2JL9A 1HKGA 4UY85 5FRMA 3MEDB 5C5JA 1RYSA 2DRAA 3D1HA 4DV0F 4MJKA 2P9IB 4TXSA 2GMLA 4EHTA 1WUAA 3D6FB 1KVIA 3SCLE 3OYFA 3Q8YA 4PQUA 2UVRA 2W9BA 4IO8A 4F04B 3SSQA 3ULDA 2EFVA 3BH7B 3CDBA 5A2QO 1YBTA 4Z7CA 1RP5A 2R2RA 3GQCA 1NK4A 4FLYA 4IG3A 5MLCV 1IKWB 4ZVQB 1S9GB 1Y3JA 3HI0A 1SC6A 2DITA 3K8WA 5BREA 4QS7A 1VQLN 1ZBUA 2XHBA 3IBCB 2XMJA 2WVDA 4K5SA 3NVKA 2AYGA 1HNVA 2GQQA 1H6KX 1RE1B 2M7SA 4NLTA 4Y6IA 3WBZA 3HMJG 4RUAA 2EBGA 2ITGA 1DHMA 2V8PA 3OYHA 2WB1D 4LREA 2IY5B 2P9KB 2P9LA 2VOOA 4NRUA 4RW7B 4DTJA 1R8BA 2Q1NA 5HL7Q 3AHPA 3FR0A 4DSLA 4MIBA 3POTA 5DDPC 5GADI 3LP1B 1TKZB 5T7BA 3EL2A 4WFXA 2QXLA 2HIYA 1RISA 2MDAA 4ISEA 2VL1A 2G0CA 3GP9A 1YT3A 2QO3A 2CPZA 1MWQA 4CIGA 4HLBA 1NPPA 2KU7A 4OX9K 2YNHA 2CJYB 4FOIA 1S9EA 4DX5A 3I0SA 1JQGA 3KTQA 2PT0A 3IG1A 4JI8F 2MY8A 3NMAA 2HBJA 4FLVA 1TK5A 3RG6A 3MMCA 3CQXA 3OTOF 4IRDA 1JLCB 1AUSL 4ED1A 3J80U 1CZ9A 4QIGA 3OXLA 3P6YC 3UVJA 1ZM3A 3R1XA 1JXEA 4CK1A 2FZKB 3CJ7A 3D0GE 3FEXB 2DNGA 2NLXA 3MMBA 4LFAF 1NBWA 1YHQS 2I0XA 5A8RA 4CF0A 3JAMO 3VZIA 2J7WA 2B9EA 3G71S 4DV4J 4BGAA 3O6QA 3C16A 3FSXA 4MYUA 3THXA 1ZTWA 4MO4A 1P6TA 3CCUN 1B64A 1YBUA 4JKBA 4LF4J 1T8EA 4JI0J 3VQQA 3JYTB 3FZKA 1NGFA 3TI0A 1S48A 4F02A 5KG6A 4B9VA 2VQEJ 3ASMA 3VENA 2J0XA 2QL9B 1MNEA 3O2IA 4BROA 2YKNA 4CJEA 3L7PA 4H0VB 1YTYA 3BBBA 5HRSA 2GCFA 4BG9A 4ZMMA 3PO4A 4HI2A 2MLXA 3J7ZT 3CTRA 4DUYJ 3TZYA 4X4OA 3C15A 1QY7A 2ZWPA 1KLNA 4DU1A 1Y9OA 2ETJA 3OL7A 3VOVA 3NCPA 1FTRA 2YHWA 1WF1A 3NXZA 3ENVA 4OI1A 4RPFA 4FVMA 3TP2A 1L3UA 2VWBA 1HQ2A 4L75A 2DPJA 1SUQB 2MY7A 4CIOA 3DXMA 3GZ7A 3UNGC 1PAUB 4JI4J 2PGCA 4ID5A 4OI2A 3HD1A 3AVHA 1CS4B 4YB6A 4GNIA 3HVWA 4M5DB 4JK7A 4PKHA 4OI6A 4U67L 1FDDA 4AHSA 4UOGA 4K8XA 4P75A 3W61A 3TWHA 1ZBHA 4AUKA 3T1YF 4F3OA 3QEPA 5DGAA 3DLBA 4QZVB 3M6VA 1BQMA 3WXMB 1CJTA 2D3ZA 3QB0A 2OYQA 5KFMA 4KI4A 3VQBA 3IMXA 3U8XA 1XTZA 3WDOA 4FKXA 3CGIA 3OR1B 2VKZG 2P9UA 2RU9A 2CPHA 2DISA 1BE4A 2PEBA 4H03B 3G86A 1C2PA 1T44A 4B1ZA 5J2MB 2ZHBA 4HT7A 5TKWA 3ITHB 5HQMA 1TKXB 5C2DA 1OS5A 5KGWA 4RW9A 3ILOA 4PG7A 3O44A 5AXNA 5LY3A 1CC7A 1E3MA 3M8PB 3DXBA 4DSFA 3ZZ0A 3ZSQA 4A5BA 3A0IX 5F2RA 4UQTA 1LWCA 1GTHA 4FF4A 3CMQA 3M3ZA 4RR5A 4KBOA 2OPRB 2Z1JA 2CZ9A 5KFQA 4JK8A 3ATVA 4WF9L 4IOCL 1BY9A 1XWLA 1XNRJ 1RT3B 1YQHA 3RRKA 4H5TA 2LFVA 3CMES 2LLZA 1YJWS 4ANEA 3BP8A 2AW0A 3D7EO 3FCHA 3Q2SC 3W2WA 4Z4IA 1IKYA 3MDQA 1KC8O 1UA1A 1RA6A 2DTJA 1Y7PA 1KVJA 4BR2A 2X51A 1FT8A 2D0AA 1H72C 3H1QA 4JB8B 3PW7A 2NRZA 1G7CB 2G8WA 5EWGA 1VGYA 4DTNA 1VQ8S 2A18A 2JWKA 2F8TA 2HWIA 1X5SA 4NL5A 5I4MA 1RBOB 4EBEA 3MR6A 2KW4A 4H8KA 1NHKL 5HK4A 1NLKL 3GYNA 5J2PB 3EZWA 1FERA 1SJQA 3M32A 2IMOA 5KG5A 1CJKA 2DGQA 3Q86A 1TU0B 4YN3B 2BKOA 1WJ9A 2HF3A 2OP5A 4JI0K 2R2UA 1N8RO 2UXDF 3BGRA 2XHWA 4CI0B 3C6TB 2X1FA 3O9SA 1X4DA 4I2QA 2AT1B 2VQFK 3K5PA 1RHQB 1GXTA 3IBWA 5EOYA 4CGGA 2UXBF 4JI2J 3H2VE 2B4UA 3H90A 2RQKA 3SEOA 2XLIA 3PJ9A 4LRBA 3IS9B 3FKBA 3D54A 2Y1RI 1VJQA 3MF5A 2E5HA 3F0NA 4X2BA 3RRGA 4WYLA 1HD1A 4WKYA 2QMXA 2QEXN 5A2QY 3SUOA 1KQSR <