3DLKA

Crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal engineering of HIV-1 reverse transcriptase for structure-based drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 152
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlkA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlkA05
2HMIB 4M95A 2UVVA 2AX1A 4TY8A 3QETA 4NLXA 3JYTA 3LP1A 4M3WA 4CEZA 1MU2B 1YTAA 3AVCA 4G1QA 1IKXB 4RNOA 3GQCA 2IMWP 2VA3A 4O3SA 2EX3A 1NK4A 1JLCB 1RDCA 1B92A 4FJ8A 3MAQA 1C6VA 5KFCA 4OLAA 5KG3A 4PWDB 3OS2A 3V6DB 3NH2A 3QESA 4RZRA 2VG6B 3HPOA 4CJPA 1JX4A 4KB7A 2KZZA 4IRDA 2KTQA 1JLEA 3GV8B 4NCGB 4TQSA 3OL6A 2OYQA 1U09A 1L3UA 4O4RA 4FW2A 4B9TA 2IA6A 2GC8A 1TV6A 4DTPA 1S1WA 4AHVA 3KHGA 2VWJA 4K4UA 4KTZA 4CJVA 3PX6A 3D5MA 1RTDB 5DQHA 1NK5A 1HNIB 4WYLA 3UQSA 1BCOA 4ECQA 3KLVA 4CJKA 3BGRB 3VQQA 4LSLA 3EZ5A 4NLOA 4TN2A 1LV5A 2C2EA 2AGOA 1W0HA 1S5JA 5J2NB 2X78A 2FVRA 1NHVA 1HQUB 5KFXA 5I42B 3ALYA 1C1CB 4CF0A 3B6PA 4JV2A 1S48A 4CJWA 2HNYA 4FK0A 5EWFA 3TVKA 2O5DA 4N5SA 2O4IA 3SCXA 2W9CA 4AHRA 1RT6A 1WSJA 3VQ6A 4J9PA 4LQ9A 4Y1DA 1RT2A 4KE5A 4QW9A 5KI6A 3BQ0A 3KJVB 3KK3B 1RBVA 5J2PA 2HAIA 3NF8A 4G3IA 3NGYA 3S3OA 2BRLA 4ZP6A 5KG7A 3VQ4A 1KRPA 2YKNA 4MH8A 3L2RA 1JKHB 3DRSB 5HRPA 4E7JA 4K4SA 5C42B 1VRTB 4KRFA 4Q44A 4EZ9A 4O3PA 3K5MA 5J2MA 1NKEA 3TABA 4Z4EA 4ID1A 2VG5B 3DM2A 3RRGA 1JLGA 1I6JA 4H4MA 2I1RA 3OYHA 4E0DA 4IBNA 3H5XA 3V4IA 4ED0A 3D45A 4CFCA 2AJQA 5F9NA 5FRMA 2HMIA 1C2PA 3I0RB 2YKMB 5CY4A 3G86A 4IFYB 1MU2A 1RTHB 4J9RA 1IKXA 1RBTA 1VSFA 2DFHA 4NLYA 1JLCA 4FVMA 4KHWA 5HLFB 5KFJA 4J9KA 1EETB 1NK6A 1Z4UA 2JC1A 4ED3A 4PWDA 3SFUA 3V6DA 4KTWA 4RW7B 3ZSXA 4RW9A 2VG6A 2KFNA 1S1XB 4YR0A 3MR5A 1LWFB 4RUCA 2V9WA 4OKKA 1RDRA 4DS5A 4NCGA 1S0MA 1C1AA 4IH6A 1JXBA 4IG0B 5L1KA 4CJQA 4WZMA 2OPSB 3PX4A 2VG7B 4DFPA 4FJIA 3NE6A 3ZT0A 1HNIA 1VSIA 3V6JA 4K4YA 2IM0A 1S6QB 4QWDA 5EDWA 3BGRA 4AHTA 2HHUA 2IC3B 1XR5A 2WK4A 3FSIA 3PZPA 1XI1A 4Q5VA 5J2NA 1C0UB 3CJ4A 1BQNB 2ZE2B 4DL3A 3OYKA 2ZKUA 4PY5A 3GIJA 5F8NA 3Q8QB 2C2RA 5K14B 1DTTB 1ZBUA 3M8QA 3KK2A 1RAJA 2BRKA 5HRNA 1BISA 3V9UA 2A1RA 4CGGA 3NH0A 4RNHA 3K5NA 3H98A 3O3HA 3O4NA 2XCPA 1NKCA 4E89A 1BIUA 3PUFA 2BQRA 3V1QA 3AA5X 2ZQBA 3KJVA 4JRQA 3KK3A 1MMLA 1VSJA 2X6NA 3CM6A 1RA7A 1JKHA 4FZYA 3DRSA 1SUQB 3VQSA 3TAGA 1NJWA 2XCAA 2E4LA 4I9LA 1UA0A 1CXQA 3V1RA 4CEDA 2G8HA 3ZCMA 1YVFA 4J2BA 3V9SA 3LPTA 1HQEB 3NDKA 4TY9A 5KT4A 5E41A 3QEXA 4J2AA 4PQUA 3S3NA 3I0RA 2RDIA 2YKMA 4XPCA 3FRZA 1RT1A 3OJSA 1RTHA 1FK9B 2E6LA 3RMBA 4C8MA 2RN2A 1BI4B 3EZUA 4H4OB 2XGQA 5HLFA 2AU0A 2R7YA 1Z25A 3V6HA 2D3UA 1U04A 1K6YA 3NAHA 4EBCA 3CJ2A 1EXQA 1DTQB 1SV5B 4RW7A 3KNAA 4K4ZA 3M9OB 3SQ2A 4RG8A 5C25B 4ZP7A 1S97A 1VRUA 3MEDB 3FDSA 4ECRA 1RILA 2IM1A 1GOAA 3SUQA 2QKBA 1LWFA 2ASDA 3OHBA 3UDLA 5KFMA 4KB0A 4WZQA 3IG1A 4IG0A 5KGXA 3IAYA 1NKBA 2F8EX 4B8AB 5KFYA 3ZSRA 4Z0UA 2OPSA 3HVWA 3TAPA 3G6VA 2VG7A 3AA2A 3IS9B 4Z4HA 1FKPA 4CGDA 4CJLA 3QERA 4KBIA 4Q45A 2C22A 3SI6A 1SKWA 2P5OA 3SYZA 1S6QA 4F2SA 5F8HA 3PW7A 3ZSQA 4OKEA 4QOZB 4FJ7A 3QNNA 2IC3A 3BSNA 4F4YA 3L3UA 1C0UA 5KFGA 4RUAA 4DL5A 1YT3A 1BCMA 1BQMB 3ITHB 4YR3A 4B3OA 1S0OA 2BANA 4BE1A 5CZ2A 4J9QA 4FJ9A 1DTTA 3NCIA 4WXWA 4NRUA 2B43A 4HCBA 3ZSWA 3OYGA 4TLRA 2UUWA 2F96A 4GVMA 2XC9A 3OVNA 2G8FA 4CJTA 4Z4GA 3HPHA 1T03B 3THVA 3I8DA 1Q8IA 4HYKA 3GYNA 4M94A 1SUQA 3JYTB 3HK2A 5F8LA 4RW8B 4UQGA 3KD5E 3HYFA 1WLJA 4ED2A 5KG5A 4JUZA 4EP5A 1K1QA 4MKBA 1CLQA 1HQEA 4F4ZA 4CERA 4IOBA 3QLHA 1SH0A 3KLGA 4FBTA 3TAEA 4NYZA 4J2EA 2Z1GA 4CEOA 3CJ5A 1IKYB 3IGNA 5EWGA 1FK9A 3WNFA 1BI4A 2QK9A 2FC0A 3HVAA 2E9RX 2Y1JA 3RAXA 1XHXA 4K8XA 4Q0BA 2IGIA 4HCCA 2OA8A 1SV5A 3M8PA 4RW6B 1QSYA 4DSLA 3CO9A 3MEDA 3MXIA 4ED8A 4LSNB 2ATLA 4O3OA 2Y1IA 1WNSA 4NLPA 1ZBHA 4QCLA 2YNGB 5KG0A 3KOAA 4LSLB 4NYFA 3H40A 3HP9A 4CGJA 2E9TA 3AVKA 3K5OA 4ZMMA 4F50A 3UIQA 3IS9A 4O5BA 4JS4A 4ID5B 2WTFA 3RB4A 1VSLA 3TARA 1TKXB 3NBPB 3BSOA 1HJRA 2AX0A 4E7LA 3BREA 3LALA 1WSFA 3OYEA 4DSJA 4DTSA 3M8RA 4DQIA 4W5NA 3PHEA 4MK8A 1BQMA 3ITHA 1N4LA 1QE1B 1RT2B 4FW1A 3LAMA 3NKYA 3M8SA 2XWYA 3QEVA 2ATQA 4KHNA 4JV0A 3GIMA 2ALZA 1RT4B 4WFYA 3QIPB 5CYQB 3K5LA 2RKIA 1U45A 4IFVB 3U3GA 4CF9A 1N5YB 3ZSZA 3H59A 4W5RA 2JEJA 2HWIA 4KHQA 2QXFA 5L1IA 4AHCA 4FJXA 4JLHA 3S9HA 4NLSA 4M3TA 3QGGA 3HJFA 4J2DA 4URGA 4IKFA 1T03A 4E7IA 4FS1A 1CZ9A 4OGCA 3ZT3A 3KLIB 4RW8A 2R2UA 3QEPA 2XRIA 2R8JA 2BGGA 3G6YA 1D1UA 4K4WA 1CSJA 4DQPA 2FBYA 4EZ6A 3QNOA 1A5XA 1WAJA 1SKSA 3FQKA 1QQCA 1LWCB 4DTOA 4RW9B 3OYIA 2FBXA 1IKYA 3EPGA 2HHTA 3D0PA 4KPYA 5DGAA 1HNVB 4DQSA 5KFSA 3AO5A 4CJRA 1X9MA 1IKVA 5HRSA 2D0BA 3VQ8A 4N76A 1S1UB 5DQGA 4PA1A 4RW6A 3N6NA 2R8IA 4DU3A 3QEIA 4L8RB 1N56A 3RMCA 4LSNA 4KO0B 4XPEA 4X2BA 4BDPA 3HVRA 4DFMA 2YNGA 1RDDA 1VSHA 1KFSA 4LQ3A 4CEQA 3L2UA 3ISND 3AV9A 3LPUA 3DYAA 4O3QA 2LSNA 4O44B 3OLAA 5KFBA 4YQWA 1RBRA 1B9DA 4O0JA 2P1JA 3DMJA 2PZSA 1YVUA 4FYDA 4ID5A 4BDYA 1F21A 4RNNA 3F9KA 5KFVA 1TKXA 1W9HA 3NBPA 4Z4IA 3H5SA 3SZ2A 3VQBA 2GIQA 1RT5B 3M8QB 3KK2B 2QV6A 4ZVEA 2OPPB 2GUIA 5KT5A 2FBTA 1LW2B 1TKDA 2OPQB 4DU4A 4CJ4A 4DU1A 4TYAA 4R8UB 3KHHA 1D9DA 4K50A 1QE1A 3OSPA 3SQ0A 5DG7A 2HHSA 4KSEB 3SPYA 1NNDA 4DL2A 1HYZA 4MIAA 2IM3A 2WHOA 5KFQA 1JL1A 3AO4A 4NRTA 2GBZA 3RRHA 1RT4A 3QIPA 5CYQA 1KCFA 2JEIA 4IFVA 5D3GB 1N5YA 1Y97A 5J1EB 4ECWA 3OJUA 4FLTA 4NCAA 2ETJA 4DTXA 2HVIA 1QAIA 4ED6A 2VWKA 3WNHA 2HHXA 3OYBA 4C8OA 2DFEA 1FXXA 4H8KA 3MR3A 4BWJA 4PQUB 5KFDA 3RR8A 3T5LA 1Q9XA 4B9VA 1Z26A 3KLIA 1RT1B 2XY8A 1EP4B 3HT3A 3PR4A 2D0AA 3KTQA 3DLBA 5F9LA 4KI6A 4NLWA 1QAJA 2FLLA 3PV8A 4W5TA 3PY8A 2XY6A 4DTRA 1LWCA 4NLDA 3LP2B 3M9NB 1ZBIA 2HB5A 3RTVA 3BQ2A 1VRUB 1KVAA 3NGIA 1HNVA 4QWAA 1X9WA 4R5PB 4OJRA 2W8LA 4DWIA 4MFBA 1BIZA 1NK7A 3IG1B 5C24B 1S49A 3NAEA 3ZT1A 4EYIB 5CYMB 3MXMA 4KTQA 3L8BA 3BSCA 4GW6A 3RR7A 2X6SA 4CJSA 1S1UA 1U48A 4DLGA 2OZSA 1J54A 3HSTB 5CZ1A 1FKPB 3PO5A 2HNZA 3GILA 3BQ1A 2J6SA 4KO0A 2W7OA 3HO1A 4F4WA 1ZBFA 4DSKA 2FLPA 4ZHRB 2QE5A 3QZ8A 1JLFB 1KVCA 4DG1B 4O44A 3CFOA 5JS1A 1RCHA 4HUEA 4NCBA 2XHBA 5SZTA 1TVRB 4ECVA 2F8SA 4B3OB 3RB3A 2UVWA 2DPJA 2BANB 4OL8A 5KT7A 1N6QB 3L2QA 1TKZB 4FCYA 1RT5A 2OPPA 5HP1B 1QS4A 1LW2A 3CJ0A 4CK3A 2OPQA 1S10A 4R8UA 1TAQA 4GMJB 1XR6A 1IO2A 3S3MA 3I5CA 4DMNA 2IAJA 4NLUA 3CYMA 1NK9A 4ZTFA 2AGPA 5KFHA 4F3TA 3T5JA 3FFIB 4M3RA 5JUMA 4FJNA 4DSFA 3HKWA 2JC0A 5D3GA 4ICLA 1RYSA 3IRXB 5J1EA 5KRTA 1SH3A 4Z4FA 4E1MA 1BGXT 3CWJA 4KHRA 4LY7A 2YNHA 2JGUA 2R8HA 5I3UA 1X9SA 3QLHB 4ECTA 1ZTWA 3KLGB 1HYSB 3Q8SB 3PJXA 5DG9A 3I0SB 4LD0A 1XC9A 4M3UA 2PYLA 4OLBA 3CFPA 1EP4A 4MKAA 1ITGA 4BACA 1Q9YA 3DLHA 4FLZA 1N48A 4JS5A 2ZD1A 1R0AB 3NL0A 1B9FA 3ISNC 2V4RA 4QWCA 1RNHA 1UAXA 2YNIA 3I5AA 1GX6A 2W7PA 4Q0BB 4DFKA 1TK0A 3U3YA 4I2PB 4MIBA 2ASJA 3M8PB 3LP2A 3OS0A 2XY7A 1HPZB 4EBEA 3VQ5A 2Z1JA 1U47A 5KFUA 2IS3A 4R5PA 3NH1A 4I9QA 4J9OA 4PUOB 3T3FA 3KLFB 4CIGA 3JSMB 2IM2A 2P5GA 5C24A 2OH2A 5CYMA 2HHWA 3OL7A 1SKRA 1NJYA 2OPRA 1JLAB 3P5JA 4DSEA 2XI2A 2JEGA 2BR0A 4OKJA 4DQRA 2YV0X 1KSPA 1J9AA 4ZHRA 1I3AA 1JLFA 4K8ZA 4FBUA 3HM9A 4DG1A 3QZ7A 2HHQA 1TL1B 1S9GB 5KGWA 4FM1A 4CJ3A 1TVRA 4ZVGA 3CDEA 4FJLA 1IKWA 4EEYA 2YHBA 3ICLA 2V4QA 4ECUA 5KFRA 2R2RA 3EY1A 3NF7A 3DLKA 4CF8A 1N6QA 1TKZA 4EBDA 3HVTB 3QGHA 2D0CA 5HBMA 5HP1A 2DY4A 4IH5A 5FDLB 3N6LA 5EUHA 2RKIB 4OPKA 4M3XA 3DLEB 4FLVA 3RB0A 1WNEA 2B5JB 5J2QA 1KFDA 4JRPA 3RMAA 3U6FA 5JXSA 4DF8A 1NOZA 3CG7A 1WSHA 2ILYA 3FFIA 3RWUA 4FXDA 1YTUA 3IRXA 1WSIA 4C8NA 1D5AA 4M41A 4FLUA 1LW0B 3KK1B 3HPGA 4LH4A 4W5OA 4DTMA 1HYSA 3I0SA 2HNDB 3HL8A 4BE2A 4CGFA 5SWMA 1I39A 4FM2A 4IQXA 3T1AA 3OLBA 1R0AA 5F8GA 4HTUA 2G8IA 3LDSA 3LZIA 4KAZA 3MF5A 1IKVB 1S1TA 3SQ1A 1RA6A 3AVHA 4I2PA 4KV8A 1HPZA 3NF6A 3E51A 4O3NA 2BQUA 3RB6A 2ITGA 1DLOB 4U7CA 1SL2A 3G10A 4PUOA 3KLFA 3JSMA 4NLGA 3CM5A 3CVKA 3GIKA 2KW4A 3DYAB 3PVXA 3NGZA 4F2RA 3AA3A 3QO9B 5KFPA 4J9MA 4CJ5A 2WRMA 4IR9A 1JLAA 2CKWA 3DRRB 4OGEA 2IJNA 2BE2A 3DMJB 1ZYQA 3E01A 3K59A 1KTQA 3NFAA 3V9XA 3L3VA 1NOYA 1RDAA 2E6MA 2F8TA 4WFZA 4FJMA 2PY5A 1WSGA 1TL1A 3TQ1A 5KFOA 2HWHA 1S9GA 2IJFA 3SV3A 3D28A 1ASUA 4AH9A 3ZT4A 3V9WA 3T19A 1D0EA 1LAWA 3V1OA 3HHKA 1JIHA 1QSLA 5DK5A 3DDKA 1J5OA 3NF9A 5KFLA 4CIEA 3HVTA 3UPFA 3MR2A 1S6PA 5FROA 5FDLA 5KT2A 2DTUA 1D9FA 4KHUA 1S1VA 3OL8A 3OS1A 1RTIA 3DRPB 2YHAA 4F3OA 3OYFA 2WOMB 4YNQA 2FVCA 4IR1A 4F4KA 4FJGA 4QAGA 3DLEA 5KFTA 3M9MB 5KG6A 2HHVA 4E3SA 5KG2A 2B5JA 3ASMA 4ECSA 2KZMA 3KD1E 4HUFA 4E19A 4FJJA 4FZZA 3KMSA 4ZPAA 3KHRA 4K4VA 3MECB 4ECZA 3AVNA 5DG8A 3PW4A 3AVMA 3GV7B 1IH7A 4IKAA 4ZPDA 3UR0A 1RTJB 1LW0A 3KK1A 5KT3A 2QKKA 4BWMA 2PYJA 3V81B 1REVB 2AQ4A 3TANA 4N41A 1NJXA 3L2VA 2HNDA 4DL6A 3O3GA 1L3SA 2B6AB 4CK1A 4URSA 5F8MA 4BE0A 4Y2AA 1TK5A 3KLHB 3PJWA 4FK4A 1TL3A 3P83D 3C6TB 2FLNA 3QGIA 3AO1A 4MFBB 2X74A 4C8KA 2CJQA 2KQ2A 3AA4A 3GIIA 5DQIA 2AWZA 3CQ8A 3SI8A 4FLXA 4IRKA 3ULDA 5KFKA 4ECXA 5KRSA 1RYRA 1TGOA 4DL7A 3C95A 3KKSA 1LWEA 2HNZB 4O4GA 1ASWA 4TSXA 1DLOA 4LH5A 4C8LA 3SJJA 1VSDA 4RNMA 2AGQA 3VQPA 3QO9A 3WNGA 5KFNA 1TK8A 3TAMA 3SNNA 4DF4A 4DTUA 4RU9A 3DRRA 4J9NA 4IH7A 1L5UA 4XIUA 3LWMA 4R0EA 4QWEA 1O1WA 2Q3SA 3KKRA 5HRRA 3H4BA 3O4QA 1SL1A 3TAFA 4IG3B 2XI3A 4KAIA 3IGVA 1KHVA 3DLGB 1L3TA 2JEFA 4N56A 4ZP8A 3HP6A 4DTJA 5KFZA 3H4DA 4KKOA 4B8CA 4Y2CA 1TAUA 4EO6A 4KFBB 4DLEA 3MTKA 2IAJB 4N47A 3WNEA 1NJZA 5KFFA 3MXJA 2ASLA 3RBDA 1GOCA 2HVHA 4I2QB 4QPXA 3PW5A 1XWLA 5DLGA 3VQAA 4J9LA 3V6KA 3DRPA 3A2FA 2WOMA 4ICLB 4H54A 5F8IA 4DQQA 3MFIA 3DOLA 2IOCA 1UWBB 3MEGB 3LP3A 3TI0A 2YNHB 5I3UB 1GX5A 1RT7B 4ZPCA 4CIFA 1S9FA 3NGDA 1UA1A 2UVRA 1TKTB 5KFWA 3MECA 3KLEB 1BL3A 1NHUA 4E1NA 4ELVA 1KVBA 4AHSA 2ZD1B 1RTJA 3LWLA 4ECYA 4ZVHA 3PW2A 4Q8EA 3V81A 1REVA 3RAQA 2YNIB 4TXSA 2FVPA 1QHTA 1CXUA 1QUVA 3Q8PB 2EHGA 1S0NA 2OZMA 4Q43A 3DOKB 1QTMA 2B6AA 2EC0A 5DLFA 3KLHA 4CGIA 1C1BB 4NLQA 4DS4A 3C6TA 1VK0A 4J9SA 3QYYA 3PO4A 4RNFA 3OYCA 4CHPA 2FJWA 2OPRB 3MR6A 1ASVA 3CFRA 5L9XA 1NK8A 3C94A 4CE9A 4Y34A 1U4BA 4CCHA 4B9SA 1JL2A 3SFGA 2RF2B 3CJ3A 4KHYA 4AILC 3TWHA 1T05B 4B9LA 1J53A 2HW3A 1RBUA 3OY9A 3OHAA 4NYNA 3O3FA 4F4XA 3P1GA 4U6PA 1IKWB 3QINA 3V9ZA 1K1SA 3OYJA 2A1SA 1RTDA 4NLVA 1RT3B 3KMQA 3DLKB 3NHGA 4IG3A 1A5VA 2R8KA 5HBMB 4B9UA 3DLGA 3EPIA 4CJFA 1XHZA 3OYMA 1KLMB 4ZPBA 3LP0B 4AHUA 1JXEA 1HQUA 2G8VA 5I42A 1CZBA 1C1CA 4MQ3A 5DGBA 2R8GA 4ED7A 4E7KA 4IDKB 3K2PA 4KFBA 4HKQA 3KHLA 5J2QB 1S9EB 3VQEA 3G0ZA 4ZVFA 4I2QA 4CJUA 2WONB 4CHNA 4CHZA 3T5KA 4RW4B 1WSEA 3DI6B 4GC7A 3NMAA 1UWBA 3MEGA 1VSMA 4CGHA 4CFAA 3C6UB 1RT7A 5KFEA 4MK9A 3VN5A 3HXMA 3ZSVA 2C28A 2D5RA 1WN7A 1RDBA 1TKTA 3KLEA 2W9BB 5C42A 4ZP9A 1VRTA 3AVGA 5HROB 3FQLA 4FK2A 2I5JB 4FS2A 2VG5A 4MK7A 3VA3A 3BDPA 4O3RA 4EP4A 2IDOA 4CHQA 4CHOA 3B6OA 3SPZA 2NUBA 1XR7A 3CIZA 1S1TB 3BSAA 4WFXA 4CEFA 3DOKA 3MEEB 4IFYA 3H5UA 4KV8B 3K58A 4HHTA 2G8KA 2FVQA 4DL4A 2Z1IA 3AO3A 1C1BA 3BJYA 3TR8A 3PR5B 2VA2A 4CF2A 3VQ7A 5C5JA 1IG9A 1JLQB 1EETA 4IRCA 4CEBA 2D7SA 4YR2A 1VSKA 1KLNA 4HVJA 3OYAA 2W8KA 3L2WA 2XY5A 1JLBB 3AVIA 4HUGA 4CF1A 4DFJA 3NAIA 4WXOA 2BE2B 1TP7A 1QSSA 3T5HA 3E01B 1S1XA 2RDJA 1TQLA 2RF2A 4XO0A 3GV5B 2DFFA 3OYLA 4WE1B 3IN5A 1D8YA 1C0MA 1HRHA 1T05A 1T3NA 2WB4A 2J6UA 2E9ZA 1FKOB 1VSEA 3H08A 2O4GA 4FLYA 4FLWA 1EKEA 1C0TB 5KG1A 4DSIA 4B9MA 4YFUA 2P51A 2Z1HA 4QWBA 4ELTA 4QW8A 1RT3A 2GIRA 4GC6A 4NZ0A 5EU7A 4E7HA 1GOBA 3BR9A 1HYVA 2FBVA 3QIOA 1J5OB 2BDPA 3SV4A 2D41A 1S6PB 5KT6A 2BQ3A 1ZBLA 2IBKA 1S1VB 3CDUA 1RTIB 4B9NA 1KLMA 1BQNA 2ZE2A 3LP0A 3OYNA 4M3ZA 3AVLA 3TAQA 3ZSYA 4FJ5A 2YNFB 4O55A 4IDKA 4I7FB 5K14A 3PW0A 3SUPA 3AO2A 3VA0A 2V0NA 4CEEA 1S9EA 4F8RA 2WONA 5T14A 5L1JA 4Q8FA 3AVBA 3I5BA 4RW4A 4CHYA 4Z4CA 3DI6A 3LAKA 4CJEA 1HMVB 3H5YA 3G6XA 4TYBA 4FJKA 3F73A 3C6UA 4JV1A 1UOCA 1X1PA 5FRNA 3EYZA 4TY8B 1ZETA 4FJHA 3LP1B 2W9BA 1A5WA 3KIOA 1L3VA 4KREA 5KFIA 4G1QB 5HROA 4FZXC 2I5JA 1ZTTA 4CECA 3SUNA 1TL3B 3VQDA 5DMRA 2R2TA 3LZJA 4M45A 4Y1CA 4EYHB 3CDWA 4M42A 4OVLA 5KG4A 1T8EA 2FVSA 4FM0A 4WYWA 1T7PA 2RPIA 3MEEA 5JS2A 2R2SA 2FJVA 3ZT2A 3VQCA 1LWEB 4ELUA 4O4GB 3H2LA 1JLEB 4H4OA 4O0IA 4M3YA 3MFHA 1JLQA 4EO8A 2KFZA 3QEWA 2W42A 2B4JA 1TV6B 1DTQA 1S1WB 3AVAA 1JLBA 3TAMB 2D3ZA 3PX0A 4YP3A 5C25A 1S4FA 5F8JA 4YMEA 3SQ4A 4WE1A 2WCXA 2C2DA 1G15A 2J6TA 2JLEA 3K57A 1W25A 2XGPA 5T7BA 1FKOA 2G8UA 1SH2A 4B08A 4DEZA 4TQRA 3OSNA 1SL0A 1C0TA 3AVFA 1JXLA 3AVJA 5EWEA 4KKOB 1WAFA 1LAVA 1OS5A 4W5QA 4OPJA 2HNYB 2UUTA 2XO7A 4KHMA 3LANA 3SUOA 1NK0A 1IM4A 1KHWA 1RBSA 3OYDA 4CFBA 1BHLA 1HARA 2GV9A 2W9CB 1RT6B 4K4TA 3Q8RB 3DLRA 2ILZA 4CESA 3DOLB 4KHSA 5L1LA 2YNFA 4NLTA 4I7FA 3RMDA 4ZTJA 5J2PB 4KB1A 2DPIA 5KTQA 3VQ9A 3RBEA 4Y3CA 2G8WA 2YKNB 4KI4A 4NLRA 5KFAA 1U49A 3N6MA 4URQU 1T94A 4DTNA 1EX4A 4CEAA 4BDZA 4ED1A 1HMVA 4K4XA 5J2MB 3OL9A 4CFDA 2UVUA 2W9AA 3QIDA 3DM2B 2FJXA 3ZSOA 1JLGB 4H4MB 3V4IB 4CK2A
chains in the Genus database with same CATH superfamily
2DNKA 1NSKL 4UOFA 3SBTA 2HMIB 2R7SA 5GMDA 2MMYA 2J76E 2UVVA 2AX1A 4DV6K 2LYVA 3LM2A 3LP1A 3CMQA 4I68A 2RJZA 4M3WA 4BRFA 1KKHA 3CB4A 5KPRA 4RNOA 1HD1A 1RDCA 5ETVA 1FD8A 4FJ8A 2EKNA 4GKJF 3OS2A 5JVHL 2C3OA 2BJ9A 2Y8WA 3NH2A 3HPOA 2KZZA 2KTQA 1JLEA 3Q83A 1SXLA 4WKYA 3OL6A 1LKZA 1L3UA 4B9TA 2IA6A 3JTOA 2OHDA 1S1WA 3ETMA 1Q8KA 4JI3J 3I96A 2WTUA 5MAOA 2RUGA 5A2QO 1P6TA 2LLZA 2OFHX 3VEYA 4H0OA 3DLLL 3UFCX 2UU9J 3CC7S 1N0VC 4LSLA 2CJAA 3EZ5A 5LMUF 4OJ1A 4N8NA 3E2EA 1LV5A 3JTNA 1HWLA 4ZOSA 1S5JA 1XMQJ 2DNYA 3SXLA 5A76A 3V5RA 1HQUB 4JV2A 2MTLA 3DU6A 3BR8A 4FK0A 2MQMA 2RIJA 4UTGA 2XMWA 2VWBA 4L6V3 2XLJA 4KGKA 1FJGF 4BQZA 4AHRA 2I7PA 1WSJA 3PKMA 4LQ9A 4DPOA 4OYBA 3KJVB 3IFEA 4LFCF 3S3OA 2BRLA 2KYZA 4NASA 4ZP6A 4QYRA 4N77A 2YKNA 3IBWA 5AT1B 3BUZB 1SJ3P 1IBKJ 3DXMA 3HDSA 1VRTB 1Q0NA 4JKEA 4Q44A 1D3WA 1NKEA 1N5SA 1JLGA 2CG4A 2Q1LA 4IBNA 4F3QA 4ED0A 1YXQA 3D45A 2P9KB 2MHNA 5FRMA 1G3OA 3J81O 1K8KB 1IJFB 4GY2B 4KBOA 3QDKA 3NMRA 4NLCA 1RBTA 2GTDA 2V8GA 4CI6A 5HLFB 3TVZA 3UVJB 4DV3J 2DTJA 2N7CA 5KFJA 1Z4UA 3IM9A 2ABYA 3SFUA 5D0EA 3ZSXA 2LU2A 3IO1A 3ENOA 3JSYA 4XH5A 2KFNA 3MUVP 1S1XB 2E88A 4RKUC 1FJCA 2HBRB 2V9WA 3J8AA 1SIZA 2QMWA 2CFXA 4IG0B 1TL7B 1QZ5A 1CZAN 1MN7A 5L1KA 4CJQA 2ZBQA 2RS2A 4WZMA 3L6QA 1I94K 2DGQA 3FFKB 5KPTA 3SIPB 1YX2A 2IM0A 1S6QB 3CIMA 3BGRA 2ASMA 2QWNA 1KD1O 2MYFA 1XR5A 1LQ9A 3W5XA 1C0UB 3CJ4A 4WK3A 4C23A 1NDPA 5H9EJ 4PY5A 2GVZB 2QWQA 2XMJA 4PXEA 3GIJA 5F8NA 2C2RA 5K14B 2RHKA 4J9UE 1R6VA 4RWXA 5HRNA 2QA4N 3KK2A 4FN5A 4O5FA 4EFHA 3DXKA 2ZWPA 4C3LA 3PJ9A 3K5NA 5CE3A 5EXWA 3NG8A 2HZAA 4X62F 1QLNA 2ZJRQ 5CZVA 4ZA1A 2P9IB 1BIUA 5M2RA 5AZJA 1MMLA 3M2UB 1HI8A 2CQDA 1UVLA 4DV5J 1FDDA 2OMLA 1KR4A 9RUBA 4OI2A 3C19A 4OYXA 1SUQB 2LCWA 3VQSA 3TAGA 1PAUB 2OD6A 1NJWA 5B0EA 2E4LA 3I55S 1GLJO 4CEDA 4OV6A 3W2WB 3F41A 3CC4N 2G0JA 5AQUA 1HQEB 2AV5A 5C7PA 3NDKA 4TY9A 3K17A 3PM9A 1EQYA 3W9JA 1RAOA 4PQUA 3S3NA 4JHDA 1O6XA 4CO4A 3FRZA 4E8UA 4H0VB 1RT1A 4CYUB 1RTHA 3M6XA 2Z56B 4C8MA 5K8OA 2EK6A 5E26A 2AU0A 2DR5A 2R7YA 1IBMF 2E1MC 2NZCA 4KH4A 2JFDA 2PO4A 1EXQA 4AM7A 5T7LA 5C25B 3CQYA 1H74A 1LCUA 3WUHA 3W2VA 2C2OB 1IR0A 1GH8A 1HHQA 3OHBA 1NU4A 3UDLA 3N9UC 4X66K 1IWAA 2HQCA 1YJRA 2F8HA 3CTRA 3IAYA 1E6YA 3ZSRA 4Z0UA 2OPSA 3TAPA 4JI1K 2VG7A 3AA2A 2HFVA 1H38A 3MMBA 4FYWB 4CJLA 4Q45A 3SI6A 5DDOC 1VMBA 3ISZA 3SYZA 1XN9A 2LMIA 1H72C 4OI6A 2ROPA 3MMCA 4B3TJ 3AD9C 1Q1KA 1HNZK 2K7JA 2IC3A 2LDYA 3AY0A 3BSNA 2ZHAA 1N8RO 2PGCA 3BN7A 5L8RC 2AJ1A 1BCMA 1KQGB 3I82A 1TL5A 3C3LA 4J9QA 4FJ9A 1DTTA 3LTOA 1VQ6N 3LQVA 1N32F 4WXWA 3CCUS 1B64A 4KGVB 2DHAA 5M1PA 1B70B 2VFRA 4ILGB 1OPZA 3UKRA 1N36K 2EWHA 2XC9A 1K73T 2GHVC 3OVNA 2G8FA 3GOIA 4Z4GA 4OQJA 2DNOA 2DKOB 2O8EB 1VRQC 5A0YA 2WVFA 4M94A 1YJWS 3JYTB 1VQOS 3SQGA 4ED2A 4OHYA 4GKKF 4MKBA 4FWOA 3QLHA 2ZGYA 2HRYA 4HDHA 1C4CA 4CEOA 3HHNB 3CJ5A 2Q6BA 2HFOA 1FK9A 3R3TA 3R1XA 3SCLE 1U0SA 1YG0A 3HVAA 5B0CA 4OZ2A 4LF8F 4HCCA 2X51A 1GNKA 1S99A 2HF4A 4XTTA 1FVQA 3MXIA 1S79A 1VQ9N 4MO4A 4ED8A 3GG1A 5B0FA 4NLPA 1DEJA 4M5DB 5KG0A 1ZS6A 1UZDA 4IEEA 1UEUA 3ZTRA 3HP9A 1YSJA 4AYBD 1URNA 4MTPA 3OFGA 1W26A 4OX9F 4F50A 4DR5J 1M5SA 4QOTA 1VSLA 2WW8A 4WFNQ 1YRXA 1WEYA 2NLWA 2D3OR 5EN1A 3BSOA 4CZJA 3EVWA 2AX0A 1HR0K 3BREA 4KH0B 2DR9A 4JK9A 2DCUB 4FF3A 1K44A 1WSFA 4K5RA 3MM6A 4BG8A 4DN9A 2B8QA 3O1LA 4BR0A 3OYEA 2DNGA 2GHPA 2I8EA 1T3VA 5C2GA 1HBMB 3BZCA 4OMFG 2ZH8A 1QE1B 2ZNZA 5LL6Z 3KDOA 3ENBA 3P5TL 3FMBA 3NKYA 1WKJA 3M8SA 2DB1A 3O1WA 3QEVA 3HSZA 4ILMA 2ATQA 3BEGB 5LMUK 1Q8BA 3TSUA 4WFYA 3QIPB 4F04B 3K5LA 4CI0B 2RKIA 1N5YB 5HVGA 3H59A 5D0GA 4YN3B 4F36A 3R5BA 1GLDG 4BC3A 1RTZA 2ZJPL 3W61A 3HJFA 2HQDA 5AQJA 4FYYB 1T03A 1VDHA 3EZWA 4OX8A 1MNEA 2HHHJ 1CS4B 1HI1A 3A5MC 5GADI 1OY9A 4K4WA 1CSJA 4DQPA 1WELA 2YWFA 4A8OA 3FEZA 4LFCK 1FNMA 5EX3A 5D15A 1QQCA 1LWCB 4HL9A 1B0VA 1R6YA 1YKWA 3EPGA 2HHTA 4C8ZA 3D0PA 2LFVA 5AQXA 3CJAA 3QBCA 3L09A 4DQSA 2QMUB 5KFSA 1X9MA 1V4SA 2AD9A 2CQ4A 2A10A 4WP3A 5F0UA 4N76A 3UB5A 4DCHA 5TKWA 1LXNA 4RW6A 4DU3A 4PHTX 2LEPA 3QEIA 3THWB 4CNYA 1YJVA 3IR6B 2V68A 4RWWA 1BOTO 3US5A 4FWSA 2ZH4A 2Z58B 2QA4G 3L2UA 5DDQC 4USKA 3AV9A 2HFSA 3ULHA 2IYGA 3D6FB 3G8TA 2LSNA 3T6JA 4O44B 2R7UA 1B9DA 3M1FA 3DMJA 1Y5LB 2PZSA 1YVUA 3KJNB 2UXCF 2PE8A 3F9KA 2HQIA 2HBZB 4CD3A 4LRFA 4BVOA 3H5SA 3CJKB 2E5JA 3D1QA 2QV6A 3M8QB 4ZVEA 3NNAA 1LW2B 4OIXA 2OPQB 1U26A 1RGVA 3KHHA 2AW0A 5A2QU 3S6EA 1VBYA 2DH8A 3MAAB 5DG7A 1QVFR 3Q86A 3SPYA 1NNDA 4DL2A 3GFZA 3P4UB 3AO4A 2BOAA 4LF7F 2FHJA 1NCLA 2GBZA 2NZ4A 2K06A 3GDQA 2E7XA 2G2OA 4IFVA 1NGEA 1WOSA 2UXDF 5J1EB 2FC9A 3OJUA 3C46A 4FLTA 2FZGB 4QZVB 3MCOA 1XNQJ 1QAIA 2HHXA 3OYBA 1Z6RA 1FXXA 3MR3A 4X64K 4B9VA 4JI7J 1NGIA 3KLIA 1P1LA 3H1QA 1EP4B 3KTQA 4X62K 3DLBA 5F9LA 4NLWA 4QR2A 2EVZA 5K8MA 1S7IA 2H3GX 3WEEB 3PY8A 2XY6A 3BGFA 1WTBA 5LJ3Y 3CW2C 3LP2B 3HOTA 4CWBA 2RB7A 4QYZJ 2BJDA 2CQ1A 1HNVA 4QWAA 1X9WA 2FGOA 1BIZA 3MM5B 3QT8A 3CMES 3QFWA 5CYMB 3MXMA 3VESA 5FPDA 3BSCA 4GW6A 2MDAA 4KHPF 3UCUP 3J81U 3O08A 4DLGA 3IAS9 2OZSA 1J54A 3HSTB 1FFGB 1FKPB 3DHXA 4IJAA 2MQNA 2MZSA 4JYAF 2W7OA 4DSKA 1ESVA 4Y6IA 2FLPA 1NPKA 1IBMK 3QZ8A 1DQ8A 1VYAA 2J0XA 1RWVB 5GADP 1RCHA 4HUEA 4YB7A 2AHOB 2EC2A 4ECVA 1NLKL 3ATVA 3TA2A 4B3OB 2UVWA 3AOBA 3GE9A 4OL8A 2CJYB 1TKZB 1VQ7N 4IZ9A 1RT5A 4ANDA 1GLAG 1HUXA 3H45C 3HHLB 2GVDB 3CJ0A 1RB0A 3Q8YA 2VOOA 4R8UA 4GMJB 1VQ6S 2EFOA 4CZEA 4ZTFA 1GAOA 3NMUA 3JSRA 4AT1B 4CZCA 3R8YA 4M3RA 1MROA 3OW2M 4ZCIA 4IXCA 4DSFA 3HKWA 1BD6A 1SH3A 2ZF5O 3O6WA 4E1MA 2HZCA 4EI2A 2JHEA 1IUJA 4LY7A 2YNHA 2O01C 2JGUA 5I3UA 2FXUA 3P39A 4ECTA 3GYGA 5DG9A 3I0SB 1N32K 3JSBA 2UUAK 3PIPQ 5D6GA 3AXMA 2E7VA 1Q5YA 4JI2F 1NMDA 4X65F 4ZVRB 1NGAA 2VBYA 2PYLA 1ATNA 4ZVSB 2DEIA 1Q81T 4WU2A 5GAGU 4FLZA 1B9FA 3NVMA 3QGPA 1KC8T 4IFEA 4RUBA 3PSIA 2YNIA 2G9OA 3T7ZA 3U3YA 4MIBA 2ASJA 1JWWA 4NEYA 2XY7A 5IZHA 4EBEA 1XMOF 4DR6K 4MMOA 2MQ8A 3NH1A 3CF5L 3FCVA 4RBTA 2BABA 4J9OA 3T3FA 4DV1K 1URRA 3NGKA 5L38A 3JTPA 3RSEB 3TOQA 1JLAB 4NPOA 4PXDA 1QTNB 4U95A 3D6RA 2BR0A 4K0KJ 4DQRA 4NMXA 2QSFA 2YV0X 3LDNA 3VGTA 1TZ0A 1ZM9A 4ZHRA 2AYEA 2ZITA 3AQOA 1R8BA 2B8PA 3D2EA 4DR7K 2DNHA 4LF8K 5JVHQ 1VFJA 1M1KO 3Q23A 1FXRA 5M1KA 3ICLA 3ZZTA 2F65A 2V4QA 4ECUA 5ADXH 4PXBA 5CABA 3X1LB 4JAXA 3EY1A 1OH8A 1MWYA 2K8GA 3RW6A 5KQ8A 1CJKB 3Q2TC 2VH7A 5HP1A 2DY4A 3E66A 3N6LA 4L76A 4H5TA 4XDDA 3D6HB 3MUTP 1EAYC 1N0UA 4ZPWR 4LRCA 1HWUA 2EWSA 3RMAA 3U6FA 4DF8A 1NOZA 3DLLQ 4UUXA 1RHMB 3FFIA 1F1BB 1GK8A 3IRXA 1WSIA 4C8NA 3BZQA 3K0JA 1REGX 4P7VA 4LH4A 4GVEA 4DTMA 1HYSA 4ENOA 2GMLA 2D0OA 1MWZA 2W4DA 4NE9C 1YWXA 5SWMA 3ULEB 4UOCA 2DNNA 3CD0A 3QRRA 2P9SB 3OLBA 3B4DA 2QFIA 2HIQA 1MMNA 1NBEB 3G8SA 4A61A 4HTUA 2G8IA 3SDEA 4PZVA 3CUNA 4HACB 2KG1A 1S1TA 3PNIA 4H03B 3CERA 2GX8A 4QR1A 1HPZA 4ES2A 3FSYA 5IOLA 4Y2IA 2BQUA 2BVZA 1TFYA 2K7KA 3RB6A 5IM0B 1OH6A 2CGLA 4KT0C 3G10A 4PUOA 4NLGA 3GIKA 3WT0A 3DYAB 1F5CA 4F2RA 3L7OA 1LOUA 5DDRC 2YBVA 4OGEA 2BXJA 2ADBA 1X4EA 2PIIA 5EX0A 2P9NB 3CJ8A 2HBYB 3ZLJA 2HRUA 1QVGR 3CC2N 1Q7YT 4WQ5C 5CAAA 5ETKA 5GAEU 3GLJA 2VOPA 2PY5A 1WSGA 2HWHA 2XSJB 3SV3A 4AH9A 2LA4A 2E1CA 3OTOJ 4USIA 3N79A 1Y10A 3NF9A 4DPYA 5KFLA 4I69A 3HVTA 3UPFA 1S6PA 1K0VA 2Q31A 1D9FA 4KHUA 1S1VA 3CCLN 1RTIA 3DRPB 2YHAA 2FYXA 4QAGA 3DLEA 3I87A 4JOUA 2GA7A 4A2AA 2OTLS 2KZMA 2AT1B 3D6MB 4E19A 3ZTSA 2RRNA 4ECZA 3AVNA 5I4MA 1TMJA 2RU9A 3CGIA 2R3VA 3KK1A 5L39A 1NJXA 2DCLA 4LF7K 5B09A 3EGVA 3B82A 4URSA 4X4RA 5AFUA 1HBOB 3QPIA 3PJWA 2ITMA 3H20A 1MG7A 2QRRA 4MFBB 3F2KA 3JXUA 3WXKA 2GGPA 4DV3F 1UKUA 4IRKA 5KFKA 1SJ4P 1JCGA 1TGOA 4DL7A 5CHCB 3C95A 5AQQA 2VC1A 3DOMA 1SZ2A 4DR4J 3KUHA 4TSXA 3OD2A 1FRIA 5AQFA 3SJJA 3SSSA 1VSDA 3HMJG 2AZ3A 4RNMA 3VR1A 2CZ4A 2AGQA 2ROGA 2MQLA 3WNGA 2GW8A 5KFNA 1U1MA 4RU9A 3TX8A 1JNRB 2F7VA 4IH7A 1L5UA 2ZOMA 3I31A 1N34J 3VTHA 4QWEA 2Q3SA 3H4BA 1UFWA 4M5LA 1SL1A 4IG3B 5FPNA 2XI3A 1FTCA 3IGVA 1EB0A 3NRBA 1KHVA 1TYQB 2LVWA 3WIUA 2RQKA 3FBEA 4N56A 3HP6A 4KHPK 3H42A 2CPIA 1APSA 1QUPA 3BY5A 1VQ7S 2XM3A 1HBNA 3GJQB 3MTKA 4N47A 3WNEA 1CJVB 2QL5B 4QS9A 4B17A 1UEKA 2ASLA 1K73O 2HVHA 4Z94A 4E2FB 1RWMB 4EFAC 4GVLA 2WOMA 4H54A 1S12A 3FBCA 5BN9A 5F8IA 5U47A 3M7VA 4DQQA 3THYA 3TQEA 3C6HA 4EIAA 3QSYB 1U6BA 4P9SA 1DRZA 3CDBA 2J9DE 2XQCA 5AQZA 1UA1A 2UVRA 4DV5F 3EKSA 2W6LA 2QMXA 3MECA 3KLEB 3EGZA 4WFAQ 3W3DA 1CJUA 4ELVA 1VHXA 2WBRA 3LWLA 2EW9A 5KPZA 4ZVHA 3PW2A 3V81A 3RAQA 2APOA 4CZGA 3Q8PB 3L4BC 1EARA 2OZMA 2DO4A 3CCWA 2Y1LB 2MKCA 2ZHOA 1VOMA 3DCAA 4CGIA 3EICA 1X31C 2DXDA 1VK0A 3F44A 3QBXA 1FCAA 4JNEA 4AQYK 4RNFA 3P96A 2NRVA 4CHPA 2FUG9 2OPRB 1GTHA 1UVKA 4Y34A 4HLBA 3ZX3A 2BE7D 1V5IB 2RF2B 3CJ3A 4P71A 2YHXA 3DXBA 1T95A 4WTOB 1T05B 1VIOA 4HTLA 3OHAA 4NYNA 3O3FA 4F4XA 3P1GA 2A41A 1KOOA 2CYYA 2HVDA 3V9ZA 2E5LF 3VEOA 2SXLA 1RTDA 4NLVA 1D09B 2QN6B 4OYOA 2ZH2A 4DUZJ 2R8KA 2Q0UA 3M5RA 3D3CJ 2XS2A 4CJFA 3Q24A 4ZDNA 2O8BA 4WIIA 5I42A 1C1CA 4MQ3A 1AUSL 2B9EA 4CH1A 4E7KA 1IBLJ 1RHUB 4KFBA 3R5AA 3DXSX 3HSCA 5D0HA 1ZBTA 4CJUA 2WONB 1GQEA 4M7YA 2BA9A 2AYBA 2AYGA 1WSEA 1GT8A 4JV5J 4CGHA 1DAXA 2JH3A 1R8AA 2B56A 3MHYA 4CFAA 1RT7A 3HXMA 3D67A 4C6AA 1WN7A 3C16A 3NGSA 4A8WA 4EGLA 2W9BB 4ZP9A 1SI9A 1OY6A 2DR6A 2CVIA 1M5OC 1RDWX 3PEHA 2JLFA 4PAAA 3O44A 3B6OA 3CIZA 1LEOA 2GMHA 3I9ZA 4WFXA 3DOKA 3MEEB 3H5UA 1BC6A 1Z2LA 4IO1A 5F2RA 4DL4A 3CETA 1C1BA 4OHXA 2AJ4A 3PR5B 3T1YJ 3CEDA 5C5JA 2W25A 4LFBK 1PCAA 1JLQB 1WTFA 1SQFA 1AXQA 2D7SA 2DY9A 2XMAA 2KT2A 3OPKA 4HVJA 2W8KA 1MN9A 2WB1D 3L2WA 2ZJPQ 1Q7LB 3NAIA 2FJAB 2XG8A 4WXOA 4Y2MA 1TP7A 1QSSA 4UOHA 3SBMA 1TQLA 2DEJA 3W9IA 2V7YA 4XO0A 5AQKA 3AAPA 3CCSN 1D8YA 1R59O 4I6AA 1C0MA 2BUPA 4DUYF 5CHIA 2UV8G 2E9ZA 1LWXA 2E5IA 2RQMA 1EKEA 1TU0B 2VBXA 5KG1A 3ATUA 4DZ6A 5A8KB 4YFUA 2J9EA 2JNJA 4HHHA 1ZM3A 4PCQA 3OHRA 1RT3A 2GIRA 4GC6A 2XULA 3CC2S 2AA4A 3VERA 5IC4B 4UZBA 2YXLA 4OX7A 1VQ4N 3BR9A 3QIOA 2FHJD 1J5OB 2P9PA 2FF3B 4OYPA 3TR5A 3HJVA 3TWZA 4FPRA 4OYWA 3P3DA 4AXJA 1H7XA 2R7QA 3CJ9A 3OBIA 2ZE2A 5F1XA 4RO0A 3MX5A 2KI2A 4JI3K 4UT4A 4U7BA 1FRLA 3SUPA 4CEEA 2C3PA 3G82B 5I3PA 3AGKA 2NYIA 3GONA 2UU9K 4RW4A 3DI6A 2V2VA 3LAKA 3TZYA 1HMVB 4CJEA 3WXLA 4JI0F 2V69A 3BF4A 1MWKA 2QLWA 1XMQK 4TYBA 2B9XA 2YJFA 4OZ3A 4X4VA 1G6BA 5FRNA 2N3LA 3EXYA 3TJ8A 2VD3A 4LRDA 4YDUC 1YK9A 4PG4A 2VPZB 1L3VA 4KREA 4F25A 4FZXC 3THTA 3H25A 2E5HA 3SUNA 2HHHF 2MPUA 1KWMA 2DISA 2YVSA 3B6BA 5DMRA 4M45A 1F0XA 4EYHB 4OVLA 2MY8A 2CPFA 2HS4A 3MUMP 2FVSA 1T7PA 2D69A 3M2VA 3VQCA 1LWEB 3BDEA 4DHYA 4O4GB 4H4OA 1IBKK 4O0IA 1X9JA 2EKYA 4A4JA 2PN6A 3P49B 2KFZA 3CNQP 4NZ7A 2YTCA 4JI5J 3GSDA 2B4JA 2VL1A 2L41A 4JKCA 1Q79A 3M2RA 2POKA 4WE1A 2WCXA 5ETOA 2J6TA 5BRHA 4JD2A 3NCQA 2I6WA 1VGYA 2QC3A 4DV3K 1ZZFA 5AE2A 1C0TA 3AVFA 1JXLA 4M5NA 3AVJA 5EWEA 4KKOB 5LSLA 2C3UA 1LAVA 1NGBA 3NVKA 2J8SA 2XO7A 3R5CA 1WSVA 3DGPB 3MM9B 3G25A 2CPYA 3PFOA 1Y5IB 1E4FT 3DU5A 3G6EN 3RBXA 3MI7X 1RU2A 1LXJA 4K4TA 5IT4A 4MKYA 4CESA 3DOLB 5AQNA 4KHSA 1MDUB 3ZZZA 1RAHB 3OTBA 3VQ9A 4QIGA 3RBEA 4K43A 1D8ZA 4NLRA 4YHHJ 1U49A 4F3MA 4D3GA 1T94A 3LUYA 1A7GE 4ED1A 4BDZA 2ZM6F 4K4XA 4CFDA 3OL9A 1R8PA 3C2PA 2W9AA 3TZWA 4H4MB 1Q81O 3QFHA 1U6FA 1SC1B 2VICA 4G65A 4CLFA 5H9EK 1XNQF 4FXVA 1AFIA 1OY8A 4TY8A 3QETA 4NLXA 2VHGA 4XDCA 2CH6A 2Y0SD 4G1QA 1IKXB 2IMWP 2VFUA 4JI7F 4O3SA 1JLCB 1CPZA 4NI2A 3MAQA 5HMWA 3DNCA 2J5AA 4OLAA 4PWDB 5M1QA 3V6DB 2NRTA 2ASYA 1WWHA 2QX0A 3QESA 2WVEA 2VG6B 1PGZA 4DV5K 1JX4A 3H3OB 3R8EA 3R1LA 4NCGB 2VDIA 4WTYA 2CADA 3GFHA 1JQGA 1MW7A 4LFAJ 4KTZA 1NH8A 3L7UA 4TLQA 3PYDA 2JFKA 5DQHA 5IFMA 1HNIB 1RCXB 2ZH1A 3OW2R 3UQSA 3TUIC 4P10A 2NZTA 1QDUB 4P75A 2QTWA 1YIJN 1C0GA 2MQPA 5J2NB 3SSRA 3UKUA 2F8MA 4BVPA 5EWFA 2CAJA 2O5DA 1U1QA 3CF5Q 2BTFA 3CJQA 4N5SA 2YKAA 4U7UK 3DHWC 4UQTA 2O4IA 1OVYA 4NA3A 2W9CA 2IVPA 1RT6A 1FERA 4E98A 4Y1DA 4QQBA 4DR1J 3BQ0A 3GSIA 1RBVA 5J2PA 1GLBG 4Z37A 3NGYA 2E66A 3QFUA 4MH8A 3L2RA 2CPHA 3DRSB 2MJNA 5ETMA 3IBCB 3SAGA 3CCTA 4B3TK 1FNOA 2O8FA 3TABA 3J7AN 2VG5B 2XMVA 2PT0A 1F2HA 3W8PA 3H5XA 4DX8H 3UDCA 2AJQA 4CFCA 2HMIA 1T9YA 1YITN 1RWUA 1C2PA 1FDAA 3I0RB 5F3TA 1W2BM 3MDFA 4P2SA 4J9RA 4WPAA 1VSFA 4CLWA 4U7UD 4A2BA 2XNRA 2GAHC 3BS9A 4WWSA 2ZNYA 4NXMJ 1FE4A 3R97A 1BE4A 3HZ6A 1YJ9N 4EK2A 4YR0A 5EOYA 1KBRA 1LWFB 3L0QA 4DR2F 3MPWA 2AEFA 4UZCA 2ZH9A 4IH6A 1JXBA 4G1IA 2AEJA 3CD7A 1FF2A 1Q7YO 1R8CA 4H5VA 4FJIA 3TRGA 4IO9L 1KQFB 1DY3A 3CCSS 4B3RJ 1NB2A 3MMVA 1VSIA 4PKGA 4K0KF 5ETNA 2CNKB 2HHUA 5BR8J 2V7ZA 3FSIA 1XI1A 1DJ0A 5ELZA 2ZKUA 4C4WA 4IO8A 3RGIA 3O80A 5AE3A 3MMAB 3TX0A 1ITPA 3MN7A 4C7QA 2HQGA 3V9UA 4CGGA 3H98A 3O3HA 3BH7B 2XCPA 2VKZG 4JI8F 3TUZC 2PMWA 3RAMA 3KJVA 4JRQA 4DR5K 3H2VE 1F9FA 2GMJA 5CCLA 2NSBA 3ILOA 4EMDA 1EX8A 3M8YA 3CCRN 1VQYA 2XCAA 4I9LA 2A6MA 1CXQA 1HHTP 4DV4J 2G8HA 1YVFA 1EKRA 3V9SA 3LPTA 2WBNA 1EQ0A 1PAEX 2P9KA 1HNXJ 1K8KA 4ZCLA 1FKAF 4USVA 3QQCD 3PKYA 2E6LA 1EO1A 1BI4B 1F3FA 1U2RA 3EZUA 3F9MA 1PC5A 4YDDB 2NRHA 3KJFB 5HLFA 3QWUA 3UVJA 2HOEA 5M1NA 5D78A 1U04A 2D3UA 1K6YA 2RT3A 2VYPA 2HF3A 3NS5A 3R1HA 4BY9C 3CJ2A 1SQGA 1DTQB 3MCSA 3S7RA 1SV5B 3KK7A 3KNAA 1U6ZA 3CHWA 3M9OB 2RE2A 4ZP7A 1VRUA 2NUHA 1RILA 3BKTA 5KAKA 4GVBA 2ASDA 2UP1A 2VQEF 2DNMA 1FWPA 2HHHK 4WZQA 3TU5A 3TTDA 4IG0A 1TL7A 2OLWA 2ASPA 2HK3A 1NKBA 2F8EX 4B8AB 1D4XA 5DM6L 4M5GA 4Z4HA 1X8DA 4KBIA 3OTEA 1RSCA 2AKWB 1IWGA 1J2VA 1S6QA 3EXCX 5F8HA 1RWWB 4HT7A 3ZSQA 4OKEA 4CNZA 4CVNE 1S4EA 4FJ7A 2XYPB 2N7YA 1C0UA 3PDNA 1BQMB 3BF3A 1FESA 1Y9OA 1OJ4A 2BANA 2CNNB 4O23A 4BC4A 4JKFA 1H73A 3CPEA 1EJ7L 3G6ES 3FZHA 2DPNA 4CO0A 2A2CA 3KDNA 1Q95G 1X4GA 2P9IA 2FHKA 2YWEA 1JCEA 5ITHA 4ZIWA 4OHZA 2G1DA 2MHEA 4RX6A 1IBCB 1UAWA 2QWRA 5K8NA 3VWSA 4L73A 3GYNA 2HS0A 1SUQA 4KIAA 2C3YA 3I56S 4RW8B 4UQGA 4H0YB 5KG5A 3AA8A 4ISGA 1K1QA 4OYZA 1HQEA 1VR6A 4IOBA 2HHPA 5CD4A 2ASOA 5IT9Y 1QAYA 2MZ1A 4J2EA 2Z1GA 4HHUA 4CYUA 1ZH5A 3O2IA 3NY0A 3IGNA 5EWGA 4V19S 4Y28C 3QNWB 2E9RX 4P2FA 2Y1JA 1U1OA 5GAHI 2RUSA 1X5PA 4A8QA 1XHXA 4K8XA 2IGIA 5EHHA 1H2UX 3M8PA 1XNQK 5JVGL 1YJNN 2M7SA 2MQQA 4O3OA 3VALA 2Y1IA 1A0OB 4M63A 4BC5A 4JI7K 4DR4F 2Y9HA 3QATA 1YGYA 4LSLB 1J5EJ 1T6CA 4NYFA 1RACB 4OFZA 4ZMMA 2O1PA 3UIQA 4ID5B 1RWPB 1KQSR 4YDUA 4FO0A 3NBPB 5KOWA 5F3ZA 4QYZK 2Y8YA 1KAYA 3K9KA 3NGTA 1N34F 3LALA 3IM8A 2K3KA 1U0HB 3RZAA 5HK4A 1EQMA 4DSJA 4DQIA 2NLXA 1FRXA 1N4LA 3ENWA 1S57A 3MMJA 3VGSA 2CXEA 2XWYA 3SQOP 4AL7A 2C42A 1P27B 3THPA 1RT4B 5CYQB 3DXMB 2V8HA 2MLZA 1NDCA 2HWIA 4HR2A 5E0OA 2IFXA 3GR0A 2E20A 1DQ9A 4JLHA 2X1GA 3QGGA 2RQ4A 4J2DA 1WC3A 3WXJA 2O8EA 1CZ9A 4AL6A 3ZT3A 2XRIA 2BGGA 3ZC4A 5LL6d 7FD1A 1YITS 1K47A 2M9KA 5RUBA 1A5XA 2Q1NA 1ZZNA 1T9WA 5AQSA 3QWPA 4CO3A 4DTOA 3OYIA 3GCXP 3P38A 3ENVA 5DGAA 4NMLA 2QFJA 4DR7J 3A5OC 4CT8A 4BR5A 2LU1A 3MK6A 5K9FA 4K59A 1YJ9S 4OHWA 5DQGA 4B3SF 4PA1A 5T41A 3GBTA 1N56A 2BMBA 5E33A 2UV8A 1UFKA 4EUVA 4KO0B 2E1RA 4FWMA 2D1KA 4BDPA 3HVRA 4BR9A 1GMVA 3N4QA 1P1TA 1RDDA 1KFSA 1HFEL 4LQ3A 2I0XA 3W5ZA 3BKFA 3OLAA 4YQWA 3C6AA 3T69A 3VAGA 2ACMA 4A57A 3IA0A 4BDYA 5AQGA 3FVYA 3TJ9A 1MA9B 5CA5A 1B7FA 2NNWA 3SZ2A 5M2PA 3KK2B 3FEXB 2OPPB 4DCPB 5BREA 1V4TA 1E3MA 3WC0A 1RDUA 1TKDA 4DUZF 2IBOA 4CJ4A 4DU1A 3UDVA 4TYAA 3CT9A 1N33J 1HBMA 4LSZB 4CLTA 4QIWD 1D9DA 1QE1A 8RUCA 2ZOGA 5AZJB 4C8YA 4KSEB 1NPRA 3GB0A 2IM3A 1IBLF 1Q86T 1UPPA 4NRTA 2PMZD 3QIPA 2JEIA 1A9NB 4R79A 4CRJA 1N5YA 1Y97A 4ECWA 2KM8B 1NSQA 5AQVA 2PD1A 3D2FB 2V67A 4NXNJ 3G4SS 4JV5F 2VWKA 3WNHA 5DJBA 1S77D 4PQUB 1RJJA 4JHDB 3CCRS 1CQNA 1RT1B 2Z2MA 1VHFA 2XY8A 1QAJA 3CCQS 3AAQA 4FF1A 3R27A 3D2WA 1IQZA 4DTRA 1LWCA 3NWGA 3GYXB 1D9AA 1E4GT 5T7LB 1ZBIA 3PYFA 3DLJA 4R5PB 4OJRA 1TL4A 3SBGA 3SLCA 3MCNA 5C24B 4WJBA 4EYIB 1WHWA 1NG9A 1E6YB 3L8BA 2FF6A 4CJSA 1BQXA 4M8LA 1U48A 4ZJLA 1I5OB 1UZHA 2HNZA 5H1SV 2C3MA 3GILA 3MWTA 3QJJA 1FRKA 4W4MA 1YRTA 1ZBFA 4K2JA 3DN9A 4FWKA 1FA0A 2QE5A 4DG1B 4LMZA 3J7YU 4Z7CA 5BPLA 4O44A 1QJHA 4QU7A 2F8SA 2VZ9A 3AARA 3N5BA 3D68A 1N6QB 3CJTA 2CGKA 4LF9J 3VEZA 2YQ3A 1LW2A 4CK3A 2OPQA 2QJ3A 5LMNJ 5AQLA 4G6VB 1S10A 2YKOA 3OT9A 1NJIT 3UKRB 1TAQA 1XR6A 1UWAA 3MAAA 3UCZP 1HWIA 1FEHA 4NLUA 2DNLA 1Y64A 2R7WA 4BROA 1R89A 2OJ3A 5JUMA 3KZBA 2JC0A 2A0FB 4ICLA 1RYSA 2F9WA 5J1EA 2IA0A 3CWJA 4WIQA 4KHRA 1WEZA 1OKJA 1X9SA 3QLHB 1HLUA 2OEMA 2XB2D 3OTOK 1FO1A 1EP4A 1JJHA 1ITGA 3IWLA 4BACA 2B0GA 1VQKN 2MKKA 2V34A 2ZD1A 1R0AB 5HANA 1VBZA 1PKUA 2H5IB 1VAZA 3WEEA 2P6SA 4DFKA 4I2PB 3LP2A 2V6AA 2WFBA 1VQLN 2WSEC 3FRYA 5D77A 2PA8D 4KQZA 4L72B 3HHDA 4C3KA 3JSMB 3MM5A 2Z2YB 2P5GA 5B7WA 5CYMA 1UVNA 4DR3J 1YJNS 3HI9A 4AL5A 5FPEA 4JI5F 1UJ4A 2XI2A 2HVEA 2QIFA 1FXLA 3JS6A 2HURA 3LGNA 4P74A 4K2XA 4CP5A 8ATCB 4K8ZA 1AT1B 2CIMA 1TL1B 4DV2J 1JCFA 1S9GB 5KGWA 2Q6CA 4FJLA 1IKWA 2YHBA 5K8PA 5KFRA 1JB0C 3NF7A 1V3RA 2QLFB 4CM0A 4P6QA 4BG9A 1TKZA 4EBDA 3QGHA 4DR4K 3HD2A 4IH5A 2GVDA 1FD2A 3TTCA 2RKIB 4OPKA 4M3XA 5JLHA 1E6VB 2DHSA 1WNEA 2B5JB 1KFDA 2H1YA 4WP9A 3EVMA 4B9QA 1S72N 2DVIA 1N34K 2R7RA 2ILYA 2R42A 1PG5B 2VODA 1QY7A 3OXLA 1AW0A 2HPUA 3AD8C 1Q5VA 3RWUA 1CULB 2DRBA 4YHHF 4JKDA 3OTCA 1PYSB 4ISFA 2Q0RA 3HPGA 2CPZA 4W5OA 2KFYA 3PRVA 4QIEA 3I0SA 5I3QA 2HNDB 4WKRA 1FTRA 3FZ2A 2XS7A 3TO8A 3D66A 1I39A 3VEXA 4FM2A 3T1AA 4X66F 3SCKE 4J8FA 1NGJA 2ZC3A 1WF1A 4DU8A 3ZO7A 3LZIA 4KAZA 2KL8A 3MGJA 4KV8A 1HNWJ 4JI6J 3NF6A 3NXZA 3E51A 4O3NA 1YI2S 1EWRA 2GQQA 4A8YA 2ITGA 1EWQA 1SL2A 2CRLA 4TU7A 5SUHA 5IWAJ 1VLYA 2OTJN 4OYMA 3CVKA 2VONA 1HNZF 1WORA 3RSEA 1HI0P 2KT3A 1JLAA 1RK8A 1YVNA 3DRRB 2YWWA 2BE2A 9ATCB 3TEHB 3DMJB 4BRKA 3UR3C 4LFAF 2D9PA 2GHWA 4ANCA 3K59A 1TUUA 1RU1A 3NFAA 4RR5A 2CPEA 5JMNA 1NOYA 1K8AT 2Z57B 4JEPA 2E6MA 1NAQA 5HQLA 4DV0J 2Q2RA 4WFZA 5AXMA 5KFOA 1U24A 1ASUA 4H5RA 3V9WA 3HHKA 1JIHA 1QSLA 1HKBA 1W2BR 5DK5A 2GJ2A 3DDKA 2VBZA 1GTEA 3H1VX 3MR2A 1CJKA 3QJLA 5KT2A 2QG9B 3NOCA 1T3OA 3HBTA 3OS1A 1S6UA 3RUBL 2QLBB 4F3OA 4F4KA 2FVCA 4FJGA 1VI7A 3TEGA 3ET6B 1WKKA 2ZWOA 4IO9Q 5KG6A 5KG2A 2CJKA 4ECSA 4DR1F 4HUFA 4FZZA 3KMSA 2GWKA 4K4VA 1HW8A 4DUZK 3PG9A 5IV3A 3W66A 4RWTA 3OXFA 2DGVA 1VLOA 3W8GA 3HOSA 1VQMN 3O4WA 3L2VA 3W7BA 2MZRA 3O3GA 1IBLK 2B6AB 3GFYA 3EE8A 4CK1A 2G2YA 3CCVN 3EVOA 3P5BP 2QW9A 3ULEA 4QIFA 4Y2AA 1TK5A 4FK4A 2E2NA 2DR8A 4B1VA 2F9DA 3QJPA 2P9SA 2NUUG 3C6TB 2DRDA 3AO1A 4IEIA 1YJUA 4DHVA 1TUGB 4MKVA 4C8KA 5H1SQ 4JV5K 5DQIA 2RE1A 3CQ8A 4FLXA 5KRSA 3PACA 4LR9A 4ZLLA 1HR0F 4OLOA 1WDDA 2JVOA 1R7IA 5DM7L 3DGVA 1UPMB 2BJ7A 2M88A 3IWXA 3SNNA 1U25A 4DF4A 1RLCL 4NYOA 2BBEA 4LRBA 1NDLA 4J9NA 3K0SA 2P9NA 3MM7A 2DY1A 4R0EA 4OZNA 1O1WA 3UDEA 2J9CA 4C0BA 1MSWD 3RG6A 3W62A 3DLGB 3T1YK 1L3TA 2ZUAA 1VCTA 2XSJA 5DRKA 1NM1A 3ZEUB 4BR2A 2ZH7A 2J7KA 4B8CA 5BR8F 1TAUA 2QTDA 3S1TA 4V1Ak 1Q16B 1Y7PA 1EKSA 3PCOB 3RBDA 4I2QB 1XWLA 5DLGA 3VQAA 3PHTA 3DRPA 1I51B 2A18A 2IOCA 5DM6Q 4PG6A 3LP3A 1F9EB 2YNHB 4Q2MA 5I3UB 2XMMA 1AFJA 1X60A 1QVGM 1TKTB 4CO5A 1RZMA 2FJBB 2ALYB 3HT0A 1NHUA 3ILIA 3LM9A 4AHSA 4GKJJ 3C15A 2ZZNA 4DV4F 2YNIB 4FSVA 1QHTA 1CXUA 2ZWHA 1QTMA 2EC0A 1HNXF 1VQKS 1HBOA 4PXCA 4NLQA 5FJ4A 1FDNA 2ZDOA 4BC9A 4LVOP 3QYYA 3N28A 4BS2A 4LF5J 2B4UA 3Q2SC 2J7WA 5HVHA 1U4BA 4MJKA 1N88A 1RAEB 1JL2A 4M5HA 3UN5A 1SBRA 2DD8S 2M5YA 1S76D 1RKIA 3VMFB 5E2QA 4B9LA 2HW3A 1UMJA 1OVQA 1RBUA 4PRFA 3EMTA 2J9DA 1WACA 1KEKA 1K1SA 1SKUB 5IT9O 2FQQB 2V4JB 5CZXA 3AHPA 5IS2A 3KMQA 2E1AA 4IG3A 2C2MB 3K8WA 1FJGJ 2C2ZB 2XZDB 4OV1A 4B9UA 1TYQA 2LEAA 3EPIA 1LK5A 5HMYA 2IRUA 1XHZA 4USWA 1KLMB 4AHUA 4OI1A 4JI5K 4A59A 1CZBA 2LXUA 5D0RA 5JVGQ 2Q3PA 4F0MA 2FZKB 3R3LA 4IDKB 4HKQA 3FGUA 1CJVA 4X64F 3VQEA 3G0ZA 3T41A 2A40A 4JI4J 4I6MB 4CHZA 1R31A 2JOQA 3TA0A 2KT5A 4L74A 1V6HA 3BBFA 1XJWB 3C6UB 5KFEA 4OZLA 2RVJA 3VF2A 4A8KA 2C28A 2D5RA 4J37A 1RHQB 4FF4A 5A6PA 3VHQA 4RTFD 3KLEA 5C42A 4ILRA 4S0MA 4JKGA 1VQNN 3MPUB 2I5JB 1WJ9A 4MK7A 4BHQA 3VA3A 3BDPA 4O3RA 2KVQE 4EP4A 2IDOA 3ZFVA 4CHQA 4CHOA 3SPZA 4A8XA 1S1TB 5DO2A 4W92B 3A8YA 5HATA 4IFYA 2LA6A 1DFDA 2ZH6A 2EFQA 2FVQA 3VCDA 2NXEA 3BJYA 4YHHK 2M8DB 1EETA 4IRCA 4CEBA 5D4OA 1VSKA 1L3KA 2CA9A 4CF1A 2NREA 1FW6A 4OO1J 1WC6A 2RH3A 1IQTA 2JRSA 3BGUA 3NLCA 3CI5A 2RF2A 2OTJS 4C11A 4M5IA 1T05A 1T3NA 1P8ZA 1FKOB 3A8KA 5IXUA 1NZ8A 4ITSA 4USMA 2O4GA 4FLYA 2BKOA 2Z4PA 3FGVA 3EJMA 4KY3A 1J5EF 4TU8A 4DSIA 3IRWP 1HX1A 4CLUA 4DDFA 3O5BA 3UD4P 4NZ0A 3VEVA 3J7Z5 3VAJA 3KUEA 3J7A1 3TW0A 4WFAL 1S6PB 1CG2A 1ZBLA 1UCNA 1KTVA 1CVJA 1S1VB 1RTIB 2NXUA 4B9NA 1BQNA 3KWMA 3AFGA 4L3NA 4PWUA 3O6QA 4ZCMA 5A8RA 4YOTA 3J7ZO 4LFAK 5AQOA 3R6GB 4I7FB 1NSPA 3C8YA 3J81j 2PAVA 3AO2A 3VA0A 2GV1A 1ZM2A 2UUAF 4F8RA 2WONA 5T14A 4Q8FA 3AVBA 2W01A 1ZAVA 4CHYA 2E2QA 4K41A 2P9UB 1CLFA 4DX6A 1GLLO 2ZKTA 1X1PA 1TMMA 3WBZA 4GMKA 4WFBL 3VOVA 3EYZA 1ZETA 1WHYA 4DR6F 4FJHA 1A5WA 2W9BA 3KIOA 1SJFA 4H5NA 1ZTTA 1OIAA 4DV1F 3ZX0A 3VVUA 2R2TA 1BWVA 1VQMS 1N52B 1RFQA 5JMVA 3HLUA 3HFKA 3CCVS 1T8EA 4DR1K 3N4WA 3MEEA 5JS2A 3DOMB 3H2LA 3FCHA 4Q7AA 4M3YA 3MFHA 1JLQA 3JQKA 3QEWA 3A8EA 4DR7F 2L9DA 2GELA 1TV6B 2LDIA 2OO4A 2D3ZA 2H4YB 4FF2A 3P31A 3PX0A 5E3RA 4YP3A 1S4FA 5CYJA 2J4RA 4LREA 4YMEA 2RRBA 3AQPA 3WQPA 3VAFA 2IYIA 3K57A 1W25A 3MN9A 3D1OA 1PILA 3CD6N 1SH2A 4B08A 4ZN1A 1SL0A 4ZK7M 5A8KA 3QRPA 2B3TB 3HFVA 3U9ZA 4EHUA 4N8OA 2DIVA 2LXFA 1OS5A 2LECA 4NXMK 3BN4A 2HNYB 4UY85 2FHMA 4Z2XA 1NJIO 2ZGZA 1HBNB 4QPTA 2MEWA 1FHTA 1KD1T 5C2DA 5IT0A 3LANA 4V19J 3SUOA 1VC0A 1XNRJ 1KHWA 4M1KA 3E8OA 4CFBA 5D4NA 4DN0A 1HARA 4LIWA 4LF2A 3DLRA 2P9GA 4UY8O 5L1LA 1KAXA 3O8MA 3HKZD 4NLTA 1N33F 3RMDA 4ZTJA 4LF6J 2DPIA 1Y3KA 1BMQB 2QEXN 4B3RK 4Y3CA 2G8WA 4AFFA 2MZQA 2R7OA 2W6KA 5CQGA 3M30B 2W2QP 4KI4A 3G82A 4DUTA 5BJRA 4GKKJ 4HT5A 2OI2A 2W2OP 1CJUB 1HMVA 5J2MB 5IV4A 2UVUA 5BR8K 3DM2B 2FJXA 1N54B 2LQ5A 3V4IB 1IXKA 2XHWA 2X1FA 1F3VA 1X3MA 4NXNF 4M95A 4G1PA 2PEHA 2GCFA 4CEZA 1MU2B 4U8YA 3H8YA 3AVCA 2VA3A 1RWKB 3LDQA 1NK4A 2EX3A 1PBUA 4CLSA 3LW5C 1YBAA 1X5OA 3EE9A 1B0TA 5KG3A 3KFWX 1PJ7A 4OHVA 1R8HA 2VU5A 4AUKA 4RZRA 2KKZA 3BPDA 3BBBA 4CJPA 1GMWD 5IQQA 4QR0A 3HHEA 3N01A 3LDOA 4N7TA 3UN3A 3SEOA 4TQSA 2V9KA 3Q8VA 2OELA 4O4RA 2E1YA 4OX9J 4DTPA 4DV4K 3FZLA 1ULRA 4AHVA 5C10A 2X7IA 2P9CA 4CJVA 1HNXK 1YUWA 1RTDB 1VK3A 3UW1A 1WF0A 3GZ7A 1BCOA 4ECQA 2W40A 4CJKA 3VQQA 4YOWA 3HHLD 4TN2A 3AOAA 1FNXH 2C2EA 4ID8A 3CE8A 1W0HA 1DT9A 1SJRA 2FVRA 2OGUA 5I42B 3ALYA 1C1CB 4CF0A 3LOUA 2O66A 1O13A 1S48A 1T9TA 1WI6A 3MM9A 3DGPA 2V8VA 2V8PA 4LRAA 5CH7B 3SCXA 3VVTA 3CD5A 4FPBA 4LF9F 4Y2KA 1HWKA 1RT2A 4KE5A 4QW9A 5LMNF 5KI6A 1ZM4A 2ZH3A 2QA4S 1Z05A 3KK3B 4G3IA 3DWLA 1U2CA 1NH7A 4E1JA 4MIWA 2CQIA 1XMBA 1JKHB 4E7JA 5HRPA 1WEXA 4KRFA 1HHSA 3K5MA 4ID1A 3RRGA 1I6JA 4H4MA 4E0DA 3OYHA 2GX9A 3BPSP 1NDKA 1Q82O 5F9NA 2M4MA 1Z1ZA 2YKMB 5CY4A 4CLPA 3GFXA 1VQNS 3ZZYA 4G9ZA 4DB3A 3CC4S 2VPYB 1IKXA 4YB6A 1OSCA 4FVCA 2DFHA 1NXIA 1JLCA 4FVMA 1SB6A 1LK7A 1X5SA 2FC8A 4ED3A 4PWDA 2HWTA 3V6DA 4F26A 4RW7B 4RW9A 3IDHA 2CQ3A 2VG6A 3HTVA 4CO2A 5C0YA 5JJBA 3MR5A 1K9MO 1SCJB 4OKKA 1WC0A 4NCGA 3MCPA 3SAHA 1G99A 2FB0A 4TNOA 4A8FA 3VPZA 3CCMN 1R3NA 2Z2LA 3CC7N 1RGIA 2UXCJ 3HRGA 4DFPA 3NE6A 1YBUA 3ZT0A 1NGGA 5AQRA 1T11A 4IYQA 3IR5B 2NRXA 1HNIA 3V6JA 4QWDA 4OX6A 5EDWA 2ZBIA 1AZSA 5K20B 3KXDA 1R0CB 2EK1A 2WK4A 3PZPA 2F3JA 3FBFA 5J2NA 1UW4A 5HQ8A 2ZE2B 4DV2F 4IOAL 2I9SA 1NGCA 4PYAA 2QLJB 1NGDA 1J6ZA 3I4HX 2A6AA 1ZBUA 1RAJA 2BRKA 3FK4A 2AYMA 3TP2A 5DDPC 1CQMA 3NH0A 4RNHA 4ZPTR 3ZZUA 3IMQJ 1NKCA 1J5EK 3U27A 3QICA 3V1QA 3AA5X 3O9SA 2ZQBA 5IT9U 1VSJA 3O9RA 2X6NA 3CM6A 3CJSA 1OO0B 4FZYA 4NEZA 3DRSA 4U96A 1X4AA 1ZPWX 2HBJA 1MWMA 1UA0A 2VF3A 3V1RA 1XC3A 4AQYF 4J2BA 4I56A 3QEXA 4J2AA 4FOIA 3I0RA 2RDIA 4B1ZA 3AJDA 4XPCA 5AZIB 4I6YA 1HJOA 3OJSA 3M2VB 3AB2B 4LJMA 3RMBA 2RN2A 2MKSA 4X4TA 4H4OB 2J0WA 1YLXA 3QT5A 3AB4B 2AJ2A 4A47A 3NAHA 1NM2A 2GNKA 2WBMA 5AQIA 3SQ2A 4JYAJ 4RG8A 4PG5A 1S97A 4RU2A 3MEDB 2Q79A 3VF4A 4ECRA 3M2RB 1GOAA 3SUQA 3U8XA 1HNWF 2QKBA 1LWFA 3CJBA 3VAIA 3VAHA 1V3SA 4KB0A 3IG1A 4PKHA 4JD2B 4P2MA 4OZ1A 3EKUA 5IWAF 5BRDA 4QU6A 3ZXWA 1VQ9S 1WD6A 2CQBA 3G6VA 3IKMA 3CMAN 3IS9B 3A3NB 3QERA 2C22A 2P5OA 1QAXA 1DZ5A 2W7AA 4CH0S 1YHQN 3W5YA 3HZGA 3PW7A 4CZHA 4OJHA 4QOZB 3GPAA 3VEWA 3L3UA 4RUAA 3B8HA 1YT3A 3ITHB 4YR3A 1S0OA 1BY9A 5CZ2A 3A0IX 1KVIA 2ZJQL 2FHOB 3MMAA 3NCIA 3M6GA 1HWJA 4FWQA 2WW4A 2B43A 3A3PB 5DM7Q 1H3DA 1QHAA 3OYGA 3VAKA 3VGVA 2WVDA 4WF9L 2YKPA 2UUWA 1RISA 2F96A 4GVMA 5JLFA 3VENA 2QEXS 4CJTA 4BRNA 5M1FA 4JI2J 4X65J 3HPHA 3K8VA 3THVA 3I8DA 1Q8IA 4HYKA 3T1HJ 4X4OA 3HK2A 2AMCB 5F8LA 4DKWA 3KD5E 3HYFA 4DPUA 4CW7B 1RWOB 4DMZA 4LFBF 4JKAA 4CT9A 4EP5A 4BRMA 2NRZA 1CLQA 1S7HA 3E9LA 4BRHA 2WVCA 4JBCA 4CERA 2HAFA 4LBIA 1N33K 1A6LA 5GADU 3KLGA 5LOQA 4DPWA 4UF4A 4FBTA 3TAEA 1XMOJ 4ETZA 3WX8A 1K0TA 3FMWA 3CQXA 1TUVA 5AXNA 1IKYB 2COLA 4PYDA 1NZAA 2RRAA 1BI4A 2GJFA 2O8CB 2DNZA 2FC0A 2P9LB 4J90A 1LOTB 5K5MA 3P6YC 4Q0BA 3HD1A 1AROP 1SV5A 4NXNK 1KVJA 3NS7B 3Q7CA 4XH4A 2CNLB 4ZJQA 4LR7A 4LSNB 2ATLA 4WCEL 2KJVA 3R7SB 3TZXA 3SAFA 4QCLA 2YNGB 7AT1B 1NO8A 1FFSB 4CGJA 2E9TA 1OSDA 5E3PA 4KGMA 4JI3F 3ZTQA 1TTHB 2WTFA 3RB4A 3UKUB 4AE5A 3ZETB 3PTWA 3TARA 2ZEJA 3W9HA 3OFEA 2CJXB 1TKXB 3IBFB 3SCIE 5HMXA 2UU9F 1U2VB 2AJ0A 2F40A 4ILLA 2AF6A 3AD7C 3CCUN 4W5NA 3M8RA 3PHEA 4MK8A 5GMEA 2L08A 1BQMA 1XMQF 4B3MJ 4FW1A 3QMLA 4BRQA 5JICA 2YI1A 2G13A 3KKFA 4Q2LA 4ED5A 4MYTA 1P9QC 3EE3A 3GIMA 2ALZA 5G0RA 4KH6A 3U3GA 4W5RA 1YJWN 4WQ4C 2O8FB 2JEJA 4KHQA 2QXFA 4X4PA 4A5BA 2FPHX 3QFPA 3T6BA 3BO3A 3OR2A 1YBTA 1DGKN 4AHCA 4I4BA 4FJXA 2CQGA 4QS7A 3S9HA 4M3TA 3V4MA 2ZHBA 3W64A 3QT7A 2VQFJ 4E7IA 1Y11A 4OGCA 4RW8A 4MYUA 1IBKF 3QEPA 2VJUA 4LF9K 2R8JA 3LL3A 1BG3A 4ZVTB 5AQHA 2FBYA 5LMNK 2DNPA 4EZ6A 2NQPA 3ZTPA 3QNOA 3IC1A 3UNYA 1WAJA 2HLUA 1SKSA 4W98A 3FQKA 3OTDA 2BE9B 2FBXA 2CQ0A 1MLAA 2DNRA 1Y00A 2EPIA 2OFGX 3Q0AA 1IM6A 2GIFA 1U02A 2RHSB 1IKVA 1RE1B 2BZ2A 2D0BA 3VQ8A 1ZA2B 4O8UA 1S1UB 2FJEB 3N6NA 2R8IA 4L8RB 4LF5F 1P9YA 2JLGA 5LJVA 3RMCA 2MQOA 1PBAA 4ERDA 1XBWA 3AJ2A 4XPEA 3PIOL 4X2BA 1NU0A 3CCMS 1O0PA 4DFMA 3K89A 4A8SA 2F1FA 4LVNP 1DQAA 4ZIVA 3LPUA 4O3QA 5KFBA 1RBRA 4O0JA 3FSXA 2P1JA 2C2NA 4YDXA 4ID5A 3Q8UA 1VHIA 4PKDB 3NBPA 4Z4IA 1B99A 3VQBA 1JNZB 1Q8LA 2GIQA 3MM8A 1U0HA 1ATRA 2V2ZA 2FBTA 1M1KT 3A1YG 4H0PA 1UW9A 1WHVA 3L9ZA 5E84A 3MCMA 3F56A 3LDPA 5C15A 4DR3K 4MLHA 2HHSA 2Q97A 5KFQA 3TPQA 3MTJA 3IUCA 2DITA 3RRHA 1RT4A 5CYQA 2F5GA 3M6VA 2IDLA 4YORA 2UUCJ 5D3GB 4JI4F 3R6LB 3D4JA 7FDRA 4DV2K 4DTXA 1BWEA 2IIRA 1WOQA 2E2PA 1KQSM 2H5JB 3HZEA 6FD1A 2N4CA 3DDNA 5LM7E 3PR4A 2D0AA 2KHOA 5B0DA 2FLLA 3PV8A 2O8DB 3LDLA 4W5TA 1JXVA 2DHHA 2IY5B 2YX7A 2QA2A 4GV6A 3POTB 3M9NB 2XZWA 3RTVA 1VRUB 1KVAA 5AQPA 3C14B 5M2UA 2XWXA 2W2MP 4GVBB 1IV0A 1G7CB 2YX4A 2V2QA 3NAEA 3ZT1A 4KTQA 4BRPA 1Z2ZA 1RBOB 5AXLA 1S59A 1U1RA 2HGNA 4WFBQ 5CZ1A 3MAHA 1CC7A 3PO5A 4YOYA 5F0WA 2J6SA 4KO0A 2PBDA 3HO1A 3U9DA 2MZJA 1JLFB 1NRKA 2AJFE 4KPCA 3ZZOA 3CFOA 3CMAS 5JS1A 3KUGA 2VUGA 4J7CA 4F67A 2XHBA 5SZTA 1TVRB 4ZVPB 4H4KC 1W97L 2R7TA 1X4DA 2H4WB 2BANB 1YHQS 3MR7A 1HNWK 4JI6K 2DR7A 3L2QA 4FCYA 2QL9B 5E3AA 2OPPA 2VASA 1QS4A 1XTZA 3OVBA 1VQPN 4B3TF 5IWAK 2IRYA 3VGMA 2OSRA 2FLOA 2V2KA 3ONQA 3UD5A 3S3MA 4Z7YA 1FJEB 2PSZA 1FJ7A 1UTAA 2IAJA 2B4PA 3CYMA 2UXBK 1I3OB 4MLEA 4CBWA 4F3TA 3T5JA 3FEYB 4FJNA 3E9PA 4Z4FA 4DV0K 4GRSA 3D2FA 3PFEA 2VCPA 2G1HA 3ENHA 4U9RA 2R8HA 3S01A 1UETA 4P7TA 2ZUGA 4CLYA 4M3UA 1XC9A 3BF1A 2W2NP 4OLBA 4MKAA 1Q9YA 2H51B 3GE1A 4JS5A 2CQ2A 3ISNC 4QWCA 3U1LA 1UAXA 3M1VB 3G96A 3EL2A 5A8WB 3CMEN 2RILA 3N0VA 5E7OB 3M8PB 4LBHA 3L7PA 2MLYA 2EFPA 4Y00A 1S5ZA 1U47A 1O51A 5KFUA 3TYTA 4CTAB 2IS3A 5AQMA 4R5PA 2KG0A 2BOPA 1BO5O 3KLFB 4CIGA 2KHDA 2BJ8A 4WP8A 1PJ5A 3L4QA 5C24A 1FRHA 3G9CA 2X3GA 2E5LJ 4TKTA 4DSEA 3H6EA 3R7BB 5FLXY 2QT7A 2BKNA 2EXUA 4WK1A 1J9AA 4HH1A 2CQHA 3W60A 4I1TA 4FBUA 4DG1A 1WUAA 2HHQA 1GXLA 4YY3J 2NXCA 1UJ5A 5BYQA 4CJ3A 4FWLA 3QSIA 2LKZA 4DR5F 3DLKA 1N6QA 4DQ8A 2D0CA 3CPWM 5HBMA 3AODA 5FDLB 2MSSA 5EUHA 1RP5A 3NNCA 2CQCA 1XNRF 4ZPVR 1YZ7A 4FLVA 2XYHB 4BRGA 4OPAA 2NSCA 3RB0A 1GLEG 5J2QA 2KVIA 5AQWA 2JL9A 3CCLS 1WSHA 4LF6F 3H0PA 1OWXA 4FKYA 4NA2A 4M63C 3CJ1A 4FXDA 3OUYB 2DBBA 3HSGA 2EI5A 3CCZA 1D5AA 4M41A 3GG0A 3JAMO 3PRDA 2DGOA 1IVZA 2F4VJ 1H7WA