3DLKA

Crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal engineering of HIV-1 reverse transcriptase for structure-based drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 152
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlkA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlkA05
4F3OA 2FVRA 5CZ2A 3OL9A 1KHWA 1HNVB 1N48A 4CF2A 1NK0A 4CEOA 1TVRB 1QSYA 4N56A 1SL0A 4IFVA 4DF4A 3C95A 1QAJA 5DLGA 4FZXC 5J2PA 2IM1A 3TI0A 1FK9B 3QZ8A 4ZP8A 4ECRA 5J1EB 2FLNA 3AVJA 3OS2A 1Z4UA 2XRIA 1S1UB 4W5OA 3AVGA 3MXMA 1C0UA 4EYIB 4OLAA 4KHUA 3AV9A 4RNMA 3DRRB 4CIFA 4DMNA 5EWEA 4J2BA 5KFKA 4QOZB 5KFPA 1C0MA 3QLHB 2WONA 3DYAA 3SFGA 1B92A 1S1TB 1D0EA 3G6VA 3HPHA 1KTQA 3O4NA 4KTWA 4BE0A 1DTTA 4QWEA 1DTQB 3DI6B 1VK0A 1S1XA 2HWIA 1TP7A 3CQ8A 4EEYA 4DQQA 4J9PA 3UQSA 2FBYA 4F2RA 2B5JB 1C6VA 1KVAA 4CERA 1HNIA 1QSLA 3AO5A 4ZTJA 4CK2A 4XPEA 2AGOA 1U09A 5KG1A 3G6XA 3AVMA 5J2NB 1S0NA 4HCCA 1ZTTA 2HHQA 1NK4A 2XGPA 1CSJA 3GIMA 3NAIA 4WFXA 5L1LA 1WSGA 2PZSA 1JL1A 3LP1A 4O4GA 2YNHA 4GW6A 1B9DA 1XWLA 4Z0UA 3OL6A 4KTZA 3N6LA 3DLEA 4FS2A 3FSIA 1S4FA 1HYSA 4K50A 4M42A 5KFSA 4RU9A 3ASMA 1S49A 3EPIA 4DS4A 1BISA 3BDPA 1RTIA 4NYNA 4FZYA 3F9KA 3RB0A 1ZYQA 4BDYA 3SNNA 4QWAA 1JLAA 2VWKA 4TY9A 4B9VA 3VQPA 2OZMA 5DG8A 4DSFA 4Q0BB 1DTQA 3RAQA 4CF1A 3KNAA 1YT3A 4F4KA 1C1BA 3BQ0A 4FW1A 3VN5A 4FJLA 4ZHRB 1UOCA 1UA1A 2B6AA 2HNZA 3ZCMA 2EC0A 1RT5B 1T3NA 4LQ9A 5KFJA 1NK5A 2HWHA 1G15A 4WE1B 5T14A 3L3VA 2P51A 1FXXA 4ECZA 5K14A 3Q8QB 3QEWA 3NGYA 1F21A 2RPIA 1SUQB 3MR3A 4YR3A 3HSTB 5DQGA 4TN2A 4F4WA 3P1GA 1J53A 3KK3B 4DS5A 2RDJA 1S6QB 4M94A 1LV5A 1JL2A 4ELUA 2D3UA 2V4RA 4RNHA 4CJKA 3LAMA 2ASJA 5C24A 4C8MA 3DOLA 2KTQA 4FLZA 1Q9XA 2OPPB 4KFBA 3UPFA 4KPYA 3O3HA 4TYAA 2DTUA 4N47A 2OPRB 4DSLA 5FDLB 4EO6A 4FJ7A 1WSIA 3D0PA 4F2SA 4J9SA 4ECXA 4DF8A 3NAEA 3DRPB 1ASWA 1RT4A 4PWDB 5HROA 5KT7A 5EWGA 4DTOA 4BDPA 4GC6A 3V9UA 2C22A 1NK7A 4KHQA 5L9XA 4DL7A 3H4BA 3TQ1A 5L1IA 2R8JA 5FRNA 4LSNA 5HP1A 4BACA 3TAPA 5KI6A 1DTTB 4ZP9A 4IKAA 1TAQA 4RW7A 3KLHA 4IR9A 1LWFB 4B8AB 4Q43A 3RMBA 4MKBA 3P83D 3ZSXA 2YNIA 1TK5A 1RTHB 5KFEA 4RNFA 2BR0A 4IR1A 3VQQA 3WNGA 2HVIA 3CWJA 3EZ5A 1HNIB 1VSEA 1ASVA 4G1QB 3KK1B 4XPCA 3QYYA 4Q45A 2XY6A 2R8KA 3BSAA 1JKHA 3V81B 4FM2A 4B3OB 2GC8A 4LSLA 3IRXA 4CEDA 1EKEA 4FK2A 4NCGA 3HKWA 4ZP6A 1NOYA 4MFBA 3A2FA 1LAWA 1CLQA 2HHXA 2F8TA 3FDSA 4NLRA 4J9QA 3RB3A 4J9MA 5JS2A 3LP0A 4CF0A 1LW2B 5C5JA 3SQ0A 3MFHA 3HT3A 4IFYA 1NK9A 3DOKB 3T5KA 4FBTA 1VRTB 5HBMA 3FFIA 5KT2A 2F96A 2Z1IA 5KFYA 4CE9A 4FLXA 1VSHA 5KFAA 1S9FA 4N41A 1KCFA 1RTDA 4LSNB 4B9TA 3Q8SB 3KLGB 1X9SA 3PW5A 1S6QA 2W8KA 4HUEA 3RBDA 4J9RA 4KB0A 1HNVA 1S1TA 2VWJA 3OYDA 4DL5A 3ITHB 1TKZA 5KFOA 1YTAA 1T03B 1HMVA 5DMRA 3V9XA 4I2QA 5J2QB 4CEFA 3CM5A 5EUHA 3HVRA 5KT5A 4NZ0A 3OYMA 3TAMA 4QW9A 4Y34A 3CFRA 1JXEA 2JGUA 3I5CA 2Q3SA 5KFXA 3QINA 4CJEA 1NKEA 1C0TA 4CF8A 1HQEB 4OJRA 4M3TA 1TKXA 4O0IA 3RB6A 3KLVA 1HPZB 4FJJA 1LW0B 3C6TA 3MEGB 4CHZA 5KFUA 1SH3A 2VG5A 3LP2A 4C8KA 5HRNA 1LWEA 4K4YA 4TY8A 2UUTA 1KHVA 3CDEA 3RBEA 4E7HA 2IJFA 4CJ5A 4DSJA 3TAFA 3H5YA 1RA6A 1FKOB 5F8MA 3QEXA 2YNIB 4DU1A 3T1AA 3C6UA 3VQ8A 1REVB 2E4LA 3H98A 2G8KA 2YKNB 2HNDB 4Y1CA 4K8ZA 3K57A 2WRMA 4Q5VA 3KLFA 3GV8B 2D7SA 2IMWP 2AX0A 3S3NA 3DRSB 4KHMA 3FRZA 4QW8A 2WOMA 1BQNB 3GIIA 2R7YA 3D45A 4HTUA 2WK4A 2J6SA 4OPJA 4CJFA 1JLAB 1WLJA 3NDKA 2ZD1B 1RT4B 4PWDA 2A1RA 3WNFA 4W5TA 1C2PA 2LSNA 1JXBA 4J9KA 3KK2B 1S9EB 1ZBIA 1FK9A 3NMAA 3DLRA 3SFUA 4E1NA 2EX3A 4Z4GA 2B43A 1VRUB 4DTMA 5DG7A 4I2PA 2G8IA 4WZMA 5JS1A 4EYHB 3AVCA 1BQMA 3KIOA 3M9OB 3AVKA 4NLPA 4DG1B 4O3QA 3DLEB 5KFWA 1SUQA 4I9LA 1HYSB 1JLFA 4FS1A 3T19A 5KG5A 4DL6A 4E7JA 4DTSA 3MECA 3ZT2A 2HNDA 4B9LA 1TKTB 1T03A 3AA3A 3ZSOA 3SV4A 3AO2A 1RT6B 1U47A 3K5MA 3MEEB 5EU7A 4B8CA 3DOLB 1C1BB 4F4ZA 2OZSA 1O1WA 3BR9A 1S1UA 2W8LA 4AHTA 2E6MA 2IAJA 4UQGA 1T7PA 4CHNA 1RT3B 1BL3A 3S3OA 5CYQA 4EBDA 3NL0A 4IRCA 4B9NA 1L3TA 5EWFA 1Z26A 4Y1DA 4ECUA 5HRSA 4IG3A 3CYMA 1TL1B 3IG1A 3ZT1A 4FLTA 1CXUA 4M3UA 2YNFA 5HLFB 1YTUA 2HVHA 2R2RA 1A5VA 4FLWA 2BRLA 3NGIA 4KV8B 1RILA 4NYFA 4I9QA 1UWBB 3E01A 2ZKUA 3MECB 3BGRA 2XY7A 4DQSA 1CXQA 4QWDA 4EZ6A 3OVNA 2PYJA 3VQEA 3SJJA 4R5PA 3CJ4A 4QWBA 4Z4IA 1UAXA 4PY5A 4EP4A 3DLKB 1X9MA 4O5BA 4AHCA 4FJGA 1N6QB 3OJSA 4J2DA 2AQ4A 3HP9A 4DL2A 3LZJA 2D0BA 4ICLA 3G6YA 4FJ5A 5KG2A 2BANA 4DFKA 3DLBA 3AVLA 1FKPA 1GOCA 3JYTA 1NOZA 1Z25A 4H4MB 4KO0A 3AA5X 1MMLA 4O3SA 4K4SA 4LY7A 3NKYA 4NRUA 4IH5A 3M8QA 4FW2A 1HARA 2RF2B 5KG3A 3V4IA 2YKMB 4JRQA 1S5JA 3D5MA 5CY4A 3V6HA 3CDUA 1L3SA 2W7PA 2Y1JA 5C42A 4IG3B 3UIQA 1S1WB 1RBTA 3IN5A 4KKOB 5KGXA 2IC3B 1OS5A 4DL4A 4E7IA 3JSMA 4J9OA 2G8WA 3CFOA 3PJWA 4E1MA 4MIBA 3HVTB 4CGJA 1UWBA 3OHBA 3CFPA 1VRUA 3PW2A 3MEEA 4BWMA 5KFCA 3PX4A 5F9NA 3OYIA 4RG8A 3SUNA 3VQAA 5K14B 2IJNA 4URQU 3CJ3A 1IKYB 3OYNA 4KSEB 2IM2A 3ZSZA 1S9GA 4ZPDA 1EETA 2F8SA 4ELVA 2IM3A 1RBVA 5KFQA 3DLHA 2DPJA 4GMJB 1KLMB 3F73A 4IDKB 3CJ0A 3L2RA 1HYZA 2W42A 4OGEA 2XC9A 1FKPB 4URGA 4ECSA 1SV5A 4IBNA 4ELTA 5C25A 1QE1B 2VG5B 3LP2B 1T8EA 4O44B 3TR8A 3TVKA 1IKVA 3V9WA 1RTDB 2GV9A 3I0RA 1SKSA 1TKZB 3V6DB 3OS0A 2V4QA 1QQCA 3KHHA 3NF7A 4YMEA 3NHGA 2QK9A 1C1AA 2JC0A 3ZSRA 4Q44A 4I2QB 1JLGB 1ZBLA 4B9UA 3AVHA 3KHGA 2CKWA 3I5AA 3Q8PB 1RCHA 3OS1A 1HQEA 2XHBA 4IOBA 2AJQA 5KFLA 4FJHA 4ICLB 4NLWA 1C1CB 3OYAA 1LW0A 1XR5A 3MFIA 1X1PA 3U3GA 1ZETA 3V9ZA 2G8VA 4WYWA 1RDCA 1WSHA 4PA1A 1IKYA 1D8YA 2XCAA 4FCYA 3DM2A 4IRDA 3L3UA 4E19A 3SZ2A 3FFIB 4K8XA 2YNFB 5HLFA 4FJ8A 1RDDA 1GOAA 3M8RA 5L1JA 3QETA 3H2LA 1D9DA 3M8PB 4DTJA 4OLBA 2VA2A 1QAIA 4W5QA 1S48A 4Q8EA 5KG6A 1KSPA 4MIAA 1BCOA 5KG7A 4RNNA 1N5YA 3OYGA 2C2RA 1S6PB 5I42A 3NF8A 3O4QA 2ILZA 4ED0A 4R8UA 1TAUA 1S1VA 3QGGA 2Y1IA 1S97A 1BQNA 4H8KA 2IOCA 5KFNA 5HRRA 4IFYB 3DLGA 3GYNA 3EZUA 4M41A 1S9GB 4JV0A 3C94A 1NHUA 1I6JA 3JYTB 4CK1A 2GIRA 4GVMA 1KFDA 4KHSA 4H54A 1SKWA 3HL8A 3KMSA 2FBXA 2JC1A 3CJ2A 3NBPB 3QNNA 5T7BA 2KZMA 3KK3A 4EBEA 3V1QA 5C25B 4CEBA 2FVSA 4M3YA 3I0SB 2ASLA 1IKXB 3M8SA 5F9LA 3CM6A 3NGDA 1JLFB 3FQLA 5F8JA 4AHSA 3IS9B 3NAHA 1GX5A 2D5RA 4YQWA 1HJRA 4KB1A 2VG7A 3MEDA 2KZZA 1NNDA 2V9WA 1I39A 2WHOA 3TAMB 4CJ3A 4Z4HA 4AHRA 4K4WA 4CHOA 2GUIA 2QXFA 3M9MB 1S0MA 3P5JA 1DLOB 2XWYA 3RMAA 3BSNA 1JLBA 1RDRA 2CJQA 3L2UA 1S9EA 3KK2A 2OYQA 2BE2B 3QIOA 4TY8B 4I2PB 1L5UA 3RR8A 1QE1A 4L8RB 2DFHA 4IH6A 2HB5A 1KLNA 3KHRA 2RKIB 4FJ9A 2J6UA 4TQSA 1NKBA 1BHLA 1KVCA 3VQ7A 2W9CB 2AGQA 4KO0B 5C24B 1EX4A 4CECA 4QCLA 3EY1A 2HHVA 4FBUA 1RT1B 3LWLA 3OYEA 3OYFA 4DTXA 2BQ3A 4NCAA 3MEDB 2ASDA 1BI4B 4CGFA 4J9NA 4ECWA 3RRGA 3KLIB 4AH9A 3O3GA 3DLGB 4PQUB 4ED2A 5KFRA 4KREA 3LALA 4CJLA 1TKDA 4ZVHA 1ZBFA 5KTQA 1JLCB 1R0AB 2D3ZA 1RBRA 3AO3A 3MR6A 1TK0A 2HNYB 3DM2B 5KFDA 5JUMA 4CFBA 3K5OA 4M3WA 4K4ZA 4RW7B 4BWJA 1VRTA 2RDIA 3DOKA 5CYQB 4FK4A 4MQ3A 4KAZA 1K6YA 3VA3A 4CEEA 4O4GB 4AHVA 4RW8B 3ZT4A 3CVKA 4ECYA 1LWEB 1LWFA 3IS9A 1LWCB 3QGIA 2PY5A 1JLQB 1FKOA 3NF6A 4ED8A 4WFYA 3TARA 1S1XB 2ALZA 3OSNA 4IKFA 3UR0A 3PO5A 2QV6A 3CIZA 3BGRB 1RA7A 3KD1E 3ALYA 1B9FA 1TQLA 2IAJB 4ECQA 1HRHA 3GQCA 4YFUA 3NF9A 3HVAA 5KT6A 1A5XA 1IG9A 1NHVA 3H5XA 3H5UA 1W9HA 3NE6A 2HMIA 2UVVA 3IGVA 4ID1A 1RT7B 1IKWB 2X6NA 1IM4A 3KOAA 2X78A 2R8IA 4JRPA 1JLEA 1BQMB 1RTJB 3SI8A 3DI6A 3V6JA 3VQ9A 4FJXA 4CIEA 4U6PA 1D5AA 4M95A 1IKVB 1YVUA 2W9BA 4FZZA 2W9CA 4EP5A 1XHXA 2X74A 3E01B 1N4LA 2O4GA 3WNEA 1LWCA 3B6OA 1RT1A 2XGQA 1NJZA 1JLQA 1T05A 1MU2B 1D1UA 1RYSA 1XR7A 3HVWA 5JXSA 3DRSA 2Z1JA 3L2VA 1CZBA 1WAJA 3ZSYA 4O0JA 5HRPA 3QEPA 4DSKA 3KLIA 1RDBA 5KFBA 4U7CA 4ED1A 3S9HA 3RRHA 4BDZA 4RUAA 3SPYA 3H5SA 2OPRA 2HNYA 3CJ5A 2B4JA 1T94A 3MR2A 3KJVB 4FJIA 3OYKA 3H40A 3TABA 2EHGA 3PV8A 4CIGA 3OYCA 4IG0A 3AVNA 3PX6A 3PJXA 2HHSA 4HKQA 1VSLA 4ZTFA 5DGAA 1ZBHA 2IBKA 4RW8A 4CK3A 2R8GA 1SV5B 3H08A 5I3UB 3GIJA 2E6LA 1QSSA 4O55A 3LDSA 4DSEA 4CHYA 4O44A 4FLVA 4CGGA 2WOMB 1IKXA 3PZPA 1RBSA 3SYZA 1RNHA 5L1KA 4FLYA 3HVTA 3TAGA 4F4YA 3LANA 3NH2A 2DFFA 1TVRA 1BCMA 1WNSA 4HVJA 3K5NA 3RWUA 1RT6A 1BIZA 4AILC 3DMJA 1TGOA 5J2MA 1T05B 2ZD1A 3AO1A 3V6KA 5KFMA 3SI6A 3BSCA 4H4OB 3OJUA 3QZ7A 1VSFA 3H59A 3AVIA 4FJMA 3MAQA 4CFAA 4RUCA 3GV5B 1XHZA 5J2PB 1RT2B 4DTPA 2UVWA 5KFIA 3PO4A 4JS4A 2BRKA 2BGGA 3DDKA 3NBPA 2IA6A 1HQUB 3PW7A 5D3GA 3OY9A 3AVBA 4FK0A 2YHAA 4ZPCA 2BANB 4NYZA 2VG6B 4OL8A 4N76A 3ICLA 3OSPA 1J9AA 1NJYA 2IGIA 5KT3A 4C8OA 4CJWA 2HHWA 1TK8A 3FQKA 3RTVA 2BQUA 4KV8A 4CJUA 4RW6B 4ZPAA 4K4XA 1EP4B 5CYMA 3L2WA 3L2QA 3HM9A 4JLHA 3HO1A 1HMVB 4NLOA 2GBZA 4JV1A 3OYHA 4R5PB 4MFBB 3O3FA 1BIUA 4Q8FA 1RT3A 2NUBA 4F3TA 4PUOA 5DK5A 1LW2A 3PR4A 3OYJA 5HP1B 4CJQA 2V0NA 4LQ3A 4FJKA 3M8PA 2XY5A 1VSJA 3DRRA 2ILYA 1TL1A 2XI3A 5HBMB 5DLFA 4CESA 1U48A 1RTHA 3I0SA 5KFVA 3OHAA 3M8QB 4WXOA 5KFHA 4NLGA 3BSOA 3IG1B 4FM0A 4MH8A 5KFTA 3MXIA 4N5SA 4WYLA 1J5OB 3IRXB 2IC3A 3LPUA 1YVFA 1U49A 3T5HA 2FC0A 3VA0A 4Y3CA 3ZSWA 4E7KA 2F8EX 2HAIA 4QAGA 4E3SA 2D41A 1QTMA 4FYDA 4XIUA 4DU4A 3DMJB 1VSMA 3KKSA 1D9FA 5DG9A 2FBVA 4RNOA 5J2MB 1BI4A 3D28A 2YV0X 4EBCA 1N56A 1SL1A 2YNGA 4OVLA 1K1SA 3PW4A 1WNEA 3OYBA 4CFDA 4IQXA 4HUGA 1HQUA 5KRSA 5SZTA 3V4IB 4ZPBA 4QPXA 3K58A 4OPKA 3GIKA 1QHTA 2KW4A 2IS3A 5D3GB 3OYLA 4NLQA 3QO9B 3PUFA 4IRKA 2UVUA 3AVFA 3T3FA 3OLBA 1Q8IA 4JS5A 2WB4A 4MK7A 2ATLA 4EZ9A 2J6TA 4RZRA 2AWZA 2R8HA 5SWMA 2YKNA 3KLFB 3TWHA 4ZP7A 2QKKA 2E9RX 3K59A 3SUOA 3QEIA 1IO2A 3I0RB 4HHTA 4KKOA 4B9MA 4X2BA 5EDWA 3U3YA 4O3OA 3H4DA 4Q0BA 4JUZA 4RW6A 2YHBA 2RN2A 2Z1HA 3QGHA 4DEZA 4ZHRA 4NLXA 2G8HA 1S6PA 2O4IA 3MXJA 2OPPA 2R2UA 3CO9A 2B6AB 2HNZB 4CGHA 1EETB 2YNHB 2GIQA 4M3ZA 4R0EA 3IAYA 4LH5A 4WFZA 2DFEA 1L3UA 4TLRA 4DWIA 4ID5A 3V9SA 4W5NA 3PVXA 3Q8RB 2WTFA 3DRPA 1NJWA 5J1EA 3RAXA 4CJTA 3M9NB 2IDOA 3VQDA 4WXWA 1RTIB 3LPTA 4NLYA 3GV7B 1RT7A 1WSFA 1JIHA 2W9BB 2XO7A 3GILA 4NCBA 4NRTA 1J5OA 2IM0A 1NJXA 3RR7A 1TKTA 2O5DA 5KG0A 2UUWA 3B6PA 4K4TA 4MK9A 4CJ4A 3K5LA 3VQ6A 2BQRA 2FBTA 3L8BA 3QIPA 3MF5A 2VG7B 4AHUA 4DSIA 4CJVA 4ED3A 2JEGA 5FROA 4DLGA 3CDWA 4CEAA 4WE1A 1TV6B 1QUVA 3S3MA 4DTNA 2AU0A 2W9AA 2C2EA 4ED6A 3SCXA 4DLEA 3QEVA 5F8NA 4Y2CA 4KE5A 1VSDA 3I5BA 1C1CA 3KJVA 4QWCA 3ZSVA 2JEJA 2HMIB 3UDLA 1A5WA 2JEFA 5J2NA 4RW9B 3N6NA 1W0HA 1IKWA 3KLHB 3QIDA 3OLAA 1JLEB 4NLDA 4HYKA 4FXDA 4O3NA 3HPGA 3LAKA 1NK6A 3G0ZA 4CHPA 3K2PA 4W5RA 4NLVA 3KTQA 2ITGA 4FJNA 4BE1A 3SUQA 1U4BA 1N5YB 3NH1A 3CG7A 1KRPA 4KFBB 2ATQA 3I8DA 2E9TA 4NLSA 1I3AA 4M3XA 4R8UB 3WNHA 4KHNA 2B5JA 4LSLB 4KI6A 4C8NA 2P5GA 4URSA 1NK8A 4TYBA 1IH7A 4IFVB 1S1VB 2FVPA 3NCIA 5F8LA 4OGCA 4WZQA 2KFNA 1EP4A 2PYLA 1X9WA 1TV6A 1C0UB 3N6MA 3AA4A 4H4OA 1Q9YA 1U45A 1GOBA 5CZ1A 3SV3A 3HPOA 3AVAA 2DPIA 4ECTA 1K1QA 1RT2A 1TL3B 1UA0A 4ECVA 4CJRA 4CHQA 4H4MA 4DQPA 2VG6A 3U6FA 1JXLA 4GC7A 4O3RA 4YR0A 4ED7A 4E0DA 5F8IA 3G10A 1BGXT 3HXMA 4F50A 1W25A 3QESA 2FVCA 3SQ2A 3NFAA 4KTQA 1S1WA 3AA2A 1KVBA 4I7FB 4M45A 1ITGA 3T5LA 2XI2A 2G8UA 2KQ2A 4CF9A 3NGZA 4CJPA 2FJXA 4HCBA 4F4XA 3JSMB 3V6DA 4KB7A 1WN7A 4Y2AA 4DU3A 1J54A 5KFFA 3KMQA 5DGBA 2ZQBA 3OL7A 2OPQB 3ZT3A 4DFMA 1C0TB 4DFJA 4LH4A 4K4VA 1HYVA 2E9ZA 4PQUA 4DTRA 1WAFA 2BE2A 3ULDA 1JLGA 3ZSQA 5FDLA 1RAJA 1SH0A 3PR5B 2AGPA 4YNQA 3VQCA 1KLMA 4J9LA 4DQIA 3DYAB 3C6TB 5DQHA 2UVRA 2RF2A 5KFGA 4RW4A 4KHWA 4KAIA 4OKEA 2DY4A 2YNGB 1S10A 1KFSA 4J2AA 4CEQA 3V1OA 1QS4A 3HK2A 2XY8A 2Z1GA 5FRMA 5C42B 4CJSA 3G86A 3PHEA 1VSKA 4MKAA 2QKBA 2ZE2A 4KBIA 1RBUA 2R2TA 2QE5A 4TSXA 2P1JA 4C8LA 2FJVA 3HHKA 3AO4A 3LZIA 3VQBA 3V1RA 2I5JB 1TKXB 4Z4EA 5I42B 4B3OA 3ISND 3NH0A 3VQ4A 4DFPA 1HPZA 3LP1B 1SKRA 3KLEB 1SH2A 3BJYA 3MEGA 4YR2A 4RW9A 1RT5A 1JLCA 1R0AA 2X6SA 2BDPA 2OPQA 1XR6A 3TAQA 3RMDA 3VQSA 1ASUA 3EPGA 1VSIA 1EXQA 1TL3A 3LP0B 2R2SA 4O3PA 4CFCA 1CZ9A 1REVA 4E7LA 4OKJA 2JLEA 2P5OA 1RTJA 3RB4A 3ISNC 4O4RA 4K4UA 4FLUA 3THVA 3HYFA 5KG4A 5DQIA 4JV2A 4G3IA 4OKKA 4ZVFA 4DTUA 3PX0A 4IG0B 4B9SA 2D0AA 2A1SA 3TAEA 3RMCA 3QERA 4FM1A 5F8GA 3HJFA 4DL3A 5CYMB 4KHYA 4F8RA 4I7FA 1Y97A 1MU2A 2ETJA 3MTKA 4NCGB 2ZE2B 2FJWA 3E51A 4DQRA 3ITHA 4XO0A 3ZT0A 2I1RA 4PUOB 4CEZA 3LP3A 3PY8A 2G8FA 3QIPB 2OPSB 5J2QA 1RYRA 3EYZA 1N6QA 4CGIA 1LAVA 2D0CA 4J2EA 3TANA 3DLKA 4ID5B 4TQRA 4ZMMA 4HUFA 3LWMA 1U04A 2FVQA 4BE2A 4DG1A 3SQ4A 3KHLA 2C2DA 1ZTWA 4CGDA 2JEIA 2HW3A 4E89A 4NLUA 2HHTA 3QLHA 2AX1A 4B08A 3QNOA 3SUPA 5KGWA 2VA3A 4MK8A 2YKMA 2XCPA 2WONB 3KKRA 3VQ5A 2KFZA 5KRTA 4G1QA 3KK1A 5I3UA 2HHUA 1ZBUA 1XI1A 1SL2A 2C28A 3T5JA 3SQ1A 4KI4A 2OH2A 1GX6A 4EO8A 3KD5E 1JKHB 3V81A 3IGNA 1WSJA 3MR5A 4FVMA 3SPZA 4KRFA 1DLOA 2FLLA 5F8HA 5HROB 4LD0A 2I5JA 4NLTA 4ZVGA 5KT4A 3BREA 4KHRA 3OL8A 3KLEA 4Z4FA 4IH7A 1JLBB 4RW4B 4YP3A 3HP6A 2OA8A 4ZVEA 1S0OA 2FLPA 2OPSA 4Z4CA 5E41A 5KFZA 3QO9A 1XC9A 2W7OA 2WCXA 1RDAA 1L3VA 1NKCA 4IDKA 3PW0A 4TXSA 3C6UB 3BQ1A 1JX4A 2RKIA 4M3RA 4CCHA 3KLGA 3BQ2A 1WSEA
chains in the Genus database with same CATH superfamily
4F3OA 2ZC4A 1FNXH 4RKUC 1N48A 1NK0A 4XEIA 1WORA 2KXHA 3S7RA 3QRRA 3BF3A 2DGXA 4FWQA 5GINA 4OYPA 1SL0A 1RLDA 4IFVA 4DF4A 1QAJA 3PDNA 2HVEA 4FZXC 1FWLA 2IM1A 4DPUA 3UDEA 1NGIA 5TKYA 3GMGA 3CPEA 1F3FA 4L73A 3DLLL 2XRIA 4CLFA 3VGKA 4NEYA 3NMRA 2R9LA 1LK5A 4RNMA 3DRRB 5EWEA 1IVZA 2CPZA 1VI7A 2HRTA 5IWAJ 2WONA 3DYAA 2F9WA 3G6VA 5L39A 2E7WA 4NASA 3O4NA 2E66A 4UZCA 1XNRJ 2GVZA 4JAXA 4KTWA 3P5BP 3WT0A 2QSWA 2AJ1A 4RPFA 1DTTA 4QWEA 1DTQB 2N82B 2HMPA 5DJBA 5HQLA 1TP7A 3CQ8A 3QBXA 2MZQA 4EEYA 4RCHA 4BRMA 4OO1J 1C6VA 2ZOGA 4ZTJA 4XPEA 3BDEA 3EE8A 4IUFA 1KQSR 4BR2A 1FDDA 2HHQA 2HHHJ 1NK4A 3NAIA 4O4GA 2NCKL 4OZ2A 4Z0UA 4KTZA 3N6LA 4CLUA 3FSIA 1HYSA 2ZBPA 4K50A 3AOBA 2HRYA 3EZOA 2W40A 4DS4A 1AZSA 3IBCB 4DZDA 4DV6J 1ZYQA 4JNEA 4BDYA 2QLXA 1U1MA 2VWKA 1TL4A 3MN6A 4TY9A 3VQPA 3MEKA 4CF1A 3CW2C 3KNAA 4FW1A 3VN5A 2ACMA 4ZHRB 1UA1A 4NI2B 1UVKA 4A62A 4OX9F 2HFSA 2B6AA 2HNZA 2B9YA 1VQ5S 3ZCMA 2V2QA 5D77A 1MN9A 2CZ4A 3I87A 1G15A 3L3VA 5F3TA 2ZJRQ 4P73A 4CLKA 1FXXA 1E6VB 3IBFB 4TKTA 1WC3A 3NGYA 4X64F 2N4CA 5DQGA 3P1GA 3QDKA 2E29A 5JICA 3CCMS 2RDJA 1S6QB 1BQXA 1JL2A 5JLFA 4ATNA 1LK7A 4CJKA 3IM8A 3ID8A 3VGTA 3LAMA 2ASJA 5H1SQ 3IR5B 3J80U 1UEVA 2BA9A 2YI1A 4DV7K 3PKMA 3UPFA 1WSRA 4N47A 4DSLA 4PAAA 1QAYA 1KWMA 4U7UD 2Z4PA 3HOSA 3DRPB 3Q2SC 3UWTA 3QT5A 5HROA 2X51A 4DL7A 3D0HE 2UUCK 1HBMB 3LL3A 3I82A 3VF0B 4BACA 2Q0UA 3FCVA 4JI0K 1HKCA 4RW7A 5ELZA 1BXNA 1YITS 1R8PA 4Q43A 4DL0C 2ZH7A 3ILOA 1UTAA 5I3QA 1TK5A 4IR1A 3CWJA 2P9SB 1VSEA 3OBYA 3KK1B 3QYYA 2OEKA 2XY6A 2R8KA 4FM2A 4B3OB 1OSDA 4FVCA 1WC6A 3IRXA 4OJ1A 4FK2A 1HWLA 3MURP 3PM9A 1NOYA 4JKGB 5HMZA 5EXWA 2HHXA 1OH7A 2F8TA 3GONA 2HHHK 4J9QA 3RB3A 3PIOQ 5JS2A 2H48B 2EEYA 1MN7A 2M3DA 1NK9A 1DQAA 4B1ZA 5L46A 1FVQA 3TUZC 1YVNA 3T5KA 4X65J 4FBTA 1JJ2R 2JFKA 4L3QA 3W8GA 2HSTA 1GMUA 3FFIA 3O6QA 1UVNA 2QMUB 3U1NA 2OMOA 2RQCA 4N41A 1RTDA 3R9LA 2XQCA 4B17A 4LFCJ 3ZYYX 2NRWA 2UYTA 2FIUA 4ZPWR 3CJBA 3GJTB 3NY0A 2MKHA 3OYDA 4DL5A 3ITHB 5KFOA 3CMAN 3L4BC 3TJAA 1T03B 2VQFJ 4R79A 3V9XA 3UCGA 2VFTA 4YHHJ 3HVRA 2W25A 3NRBA 3OYMA 1Q81O 4PCQA 3CFRA 2DR8A 2Q3SA 5KFXA 4ANDA 1HWIA 3UR3C 2DY9A 1C0TA 2GAHC 4CF8A 1VQNN 1YRTA 3WZ0A 3GE9A 2ZF5O 4OJRA 1TKXA 2GIFA 4E8UA 1KVJA 5AQMA 2NPFA 4H5NA 1HPZB 5ETVA 1HNXF 5KFUA 3Q8YA 5DZ7A 2FZKB 1ZM2A 3LP2A 3BZQA 1HBMA 4C8KA 1LWEA 3VEOA 1KDNA 2PMHA 3VTIA 2D3OR 1KAZA 4YB5A 3M8YA 3H5YA 1XIQA 2QMXA 5IXUA 4R0JA 5A6PA 3T1AA 4WPAA 4JI3J 1HLUA 3UN2A 4W90B 2CQ0A 3M6WA 4ZN1A 3NWRA 3Q23A 3K57A 1U0HA 2E7XA 1SS6A 1X4EA 1ZAVA 3GV8B 2BE9B 2D7SA 2C3MA 3AHPA 2CNLB 2J6SA 4CJFA 1WLJA 1F2HA 3AOAA 4OLPA 4ZCMA 2DB1A 1KC8T 5KOWA 3MPWA 1QQNA 1FK9A 4NLCA 3SFUA 4DR2J 4E1NA 1UPPA 2B43A 4Z4GA 4DTMA 4I2PA 1S59A 4LF4J 5D4LA 3OTOJ 4G65A 4N8OA 3FSXA 1M1KO 3LH2S 1HKAA 4O3QA 4HR2A 4DR4K 4OV6A 2AV5A 3KKFA 4I6MB 3HHLA 2XLIA 4FS1A 1FNMA 5HK4A 4MYTA 1S7IA 1SJRA 4DTSA 3MECA 3MPUB 1H3DA 3D1QA 5EX5A 2BTFA 4LF1A 2HNDA 2I6WA 5H9FJ 2GV1A 1NGDA 4C1NI 2F8MA 4LUBA 3VHQA 9RUBA 3K5MA 4V19S 1RQ0A 4B8CA 3DOLB 4PZVA 2KRBA 3DLJA 1HNXJ 1IBKK 1C1BB 4F4ZA 4OQJA 1FDNA 4DUYJ 4FF2A 4WJBA 2CPYA 2W2MP 2E6MA 2XYPB 2M7SA 2KG0A 1MWKA 4A8YA 5B0DA 4DI6A 2E5LF 1D9AA 2JNJA 4FWSA 3C65A 1GH8A 4IRCA 5EWFA 4KIAA 3I96A 3VTHA 1E4GT 4P9SA 1FRIA 3D6HB 2CPHA 3QFHA 1AYEA 5HRSA 3OV7A 3R1LA 2P8IA 1TL1B 5A8WA 1IBMK 2HVHA 2JX2A 5ETMA 2R2RA 4X84A 2E1MC 2BRLA 3NGIA 4O8UA 1EJ7L 4BR4A 3ZZTA 1UWBB 2ZKUA 4QWDA 4EZ6A 2LVWA 3BKTA 2DNQA 4O5BA 2B7CB 5BR8K 1S7HA 2CXEA 3OJSA 2LU2A 5HOOA 4P2SA 4CYUA 1FRHA 4FJ5A 2BANA 3QSIA 3ADAC 5A8RA 1Z25A 1MMLA 5HMWA 4I6MA 1HARA 4LSZB 2I9SA 3CCSS 2DK2A 1EIYB 1MROB 1P8GA 4UY85 4RWXA 1NH8A 1R3NA 2Y1JA 5C42A 3SSSA 3UIQA 2JVRA 1RBTA 4DV2J 3KZBA 8RUCA 4WKRA 1FJGF 2CPDA 3QICA 1R59O 1DQ8A 1VC0A 3CFPA 2HK2A 3DXKB 2W6LA 5KFCA 4WP3A 5F9NA 1IWGA 2M4MA 1CQMA 4URQU 4M63A 3CJ3A 2DHAA 3OYNA 2VZ9A 4KSEB 2FZGB 4ZPDA 4AM6A 5AQPA 4QPTA 4C11B 3MM8B 4FO0A 1KLMB 3EN9A 2G1HA 4WFNQ 3C15B 2QA1A 1PILA 4ECSA 3CJQA 3LP2B 2Y1LB 4O44B 4H5RA 2G2YA 4JKBA 2XMUA 4RX6A 2XZWA 3I0RA 3V6DB 2C42A 2VOPA 3OS0A 2V4QA 3LGNA 5GAHP 1T02A 4Y65A 3KHHA 2CDQA 4YMEA 3R7BB 3UDVA 1FDAA 1ITPA 4DN9A 2VDHA 4XDDA 2EFVA 2QO3A 1C1AA 3FEZA 1LWXA 2FHKA 4BHQA 3MM7A 2CADA 4Q44A 2VBYA 3CCRN 4DUZF 4NXNF 1QDUB 3KHGA 1VQPN 2CKWA 2W2PP 3I5AA 3MMCB 5U47A 2G9OA 4IOBA 4LRFA 4ICLB 4KT0C 5AQVA 2LQJA 1N32K 3H8YA 2G8VA 2FPHX 1RDCA 1WSHA 1IKYA 3DDNA 1Z6RA 1H2VZ 4H0OA 3VCDA 3FFIB 4K8XA 5HLFA 5L1JA 3WQUA 2KU7A 4OLBA 2VA2A 4W5QA 1HR0J 5KQ8A 4KGZB 2B9EA 2NUUG 3IMQJ 4UT4A 1S6PB 3JS9A 4OMFG 5I42A 3RYLA 3IXQA 5HSPA 3MM6A 4TNOA 4MJKA 5C0YA 4NMLA 1BQNA 2BKOA 1NEEA 1T9TA 5IT4A 2KKHA 3MM5B 5HRRA 4IFYB 4AL6A 3DLGA 3GYNA 3QBWA 4DPTA 3J7YI 3EZUA 1S9GB 3W8PA 2SXLA 3JYTB 2GIRA 2MZRA 4WBFA 2QC3A 4KHSA 2HVZA 1RHMB 4LF6K 1SJ3P 1FXDA 2FY1A 3AAPA 3QNNA 5T7BA 5HL7Q 3V1QA 4M3YA 4BS2A 3TZYA 4B3TK 3NXZA 2J7KA 3NGDA 4PYDA 1O13A 4LIWA 3PRVA 1IQZA 1RU2A 1YJ9S 2XMJA 2Q97A 1PYOB 1C0FA 1RK8A 1I39A 2WHOA 4P7VA 3HKZD 4X62K 4Z4HA 1ULRA 3BEXA 3D3CJ 3GB0A 4QOTA 1S0MA 3SSQA 1CZAN 3HHDA 3MPVA 2KHOA 1RCOB 4DUZJ 4KHPK 2CJQA 3M7VA 1P8ZA 4Q7AA 5CE3A 5ETQA 2OYQA 1FXLA 2NXNA 4JV5K 4DR2K 1GLCG 4GV3A 1L5UA 1T95A 3EXYA 2DY1A 1QE1A 2QN6B 4CT8A 2WAQD 2EG2A 1BG3A 4L8RB 4JI5K 5GAHU 2DGWA 2J6UA 2MJNA 1KVCA 3VQ7A 3SLCA 5ETLA 3BO2A 3BPDA 2MZTA 3FEYB 4L74A 3EE9A 4CECA 1KD1O 3OYEA 3FZMA 4JHDA 3U7JA 3MPDA 3HHLC 1KKHA 3DRXA 4BG9A 4ECWA 3KLIB 4AH9A 2DNYA 4YDUA 4LF8J 2XMTA 1ATSA 3O3GA 4USWA 5KFRA 2VJVA 5KTQA 1JLCB 4FZVA 5SUHA 1A9NB 3AO3A 2C2OB 3WUHA 4GKKK 2HNYB 3P96A 2H9ZA 2XBPA 1CJUB 3C14B 3OTBA 3CXCM 5CYQB 4A59A 5BPLA 5LJ3Y 3VA3A 3KWMA 4PR6A 4IXCA 2LYVA 2RQKA 5DM7Q 3U4LA 4ECYA 1FE0A 1GLBG 3W7BA 1LWEB 1TYQB 3MUVP 5D4OA 4MKYA 1CQNA 3H3NO 1KOOA 1LWCB 3UI3A 1UWAA 1WEYA 4K8RA 1GLJO 4YOXA 1UFWA 1SPBP 3MM6B 4WFYA 2Z58B 3TARA 1S1XB 2VH7A 3OSNA 4OI0A 3M4XA 3PO5A 3BF1A 1XMOJ 3P31A 1FJEB 2YBVA 4AE5A 1EO1A 3CIZA 4JI7F 3GU0A 1WC5A 3D2FB 2HG4A 1PGZA 3ALYA 1TQLA 2RQ4A 4ECQA 1HNWF 4YFUA 4P72A 4GV9A 4PG5A 3S01A 2CNNB 2RE2A 3NF9A 1Q0NA 2W4DA 1LCUA 3H5UA 1RAGB 3H2VE 5ETTA 1PIEA 4NPOA 2HEKA 4DZ6A 5LXRA 3CC2S 1IM4A 2X78A 2H5JB 2GVZB 3DI6A 3V6JA 3VQ9A 5BRFA 3KG1A 3A8JA 1X4FA 2W9BA 4EP5A 3CHWA 1N54B 5D8HB 3Q7CA 1N4LA 5H9EK 4KGMA 2O4GA 3L4QA 3GZ7A 5B0AA 3B6OA 1VGYA 5GAHI 2AT1B 1H72C 4C48A 2Z1JA 3LA0A 1T6DA 4O0JA 1NGHA 4JI4K 3TTDA 4OYWA 4JEPA 1QVFR 1RDBA 5KFBA 4U7CA 4X4VA 1X4GA 4JI8K 3M30A 1U02A 2OPRA 2HZCA 1NM1A 4WQ5C 4H4KA 3SEOA 4QQBA 2UXBJ 4JD2A 3H40A 3MM8A 4JI5J 2EXUA 3FR0A 3NVMA 1X3MA 5KPRA 1Y4ZB 3KVGA 3BV8A 2QL7B 3JTPA 5AE3A 4HKQA 2IBKA 4RW8A 1EX8A 1XMOF 2P9PA 4LVNP 1UEKA 2DGTA 3VAFA 3ID6A 1UZDA 4ES1A 5A8KA 2DFFA 2MY8A 3G4SS 3RWUA 1RT6A 4AILC 2GO9A 4EHTA 2KH9A 1VBZA 5J2MA 3KG0A 3DGVA 5FIIA 3D7SB 3V6KA 4CI0B 1JWWA 3BSCA 3QZ7A 3ATUA 1EHWA 2NRZA 4M5HA 4DV1J 2YQ0A 4MT1A 3MK6A 2UVWA 2NZTA 3MDQA 1VBXA 4PRFA 5M1PA 4FWKA 2X7IA 2IMOA 3QJLA 3NS7B 2BANB 4GY2B 3UCZP 2BXJA 5AZIA 4N76A 4LFBF 2P9KB 3PFOA 4FF1A 3ONQA 1TK8A 3PIPL 3M8ZA 2DNZA 3HSZA 4DB3A 4CJUA 3CMQA 2CNKB 4RW6B 1J6ZA 4ZPAA 3A5OC 2YWHA 2RH3A 3L2WA 2Q31A 3HO1A 4NLOA 2VHGA 5LMNJ 1V4TA 2JOQA 3FBEA 5LT5A 2DISA 2P6TA 1NDCA 3QGPA 4Q8FA 3D6RA 3N5FA 1IBLK 1DRZA 4F3TA 1OQ6A 1LW2A 3PR4A 3OYJA 1PBUA 5HP1B 1R0BG 4JI3K 3P38A 2GVDA 4NZ7A 1RWKB 2DR9A 3F44A 1TELA 3QT6A 3CSKA 5DLFA 1U48A 2D4WA 1XJWB 3I0SA 2YKPA 4LF8F 4WXOA 3BSOA 2ASYA 4F4AA 3MOJB 3IG1B 1CBKA 2WVEA 1FE4A 2JZ5A 1KONA 3IRWP 5KFTA 3MXIA 5JVGQ 3VF4A 5HANA 1ATRA 3T5HA 2VQEF 3VA0A 4Y3CA 3ZSWA 1N33J 1M5SA 2HAIA 1AT1B 4YB6A 2AD9A 4XIUA 1U2VB 3DMJB 2L9WA 4CJ7A 3OFFA 2NPIA 1CLFA 2CIMA 4EBCA 1N56A 5BXIA 3O9TA 1VLYA 3CGIA 5AQWA 4L3KA 2W2OP 3SMSA 5IWAK 1F5BA 4OHWA 2UUAF 1VQ4N 5LJWA 4Q2LA 3V4IB 1Q8LA 4QPXA 3MDFA 2BV3A 3NWGA 3R8YA 3GIKA 5AJ3J 3JQJA 1QHTA 3AODA 3GG4A 2RSQA 2YX7A 4DR5J 3PUFA 3MHYA 3OLBA 2WB4A 4MK7A 2WB1D 5GMEA 3DWLA 5SWMA 3KLFB 3ULHA 4ZP7A 3H90A 3Q8UA 3I0RB 4HHTA 3NLCA 4X2BA 1YG0A 5EDWA 1GLDG 4LF7J 4IOAQ 2F3JA 2RN2A 3QGHA 4DEZA 3W63A 2XHWA 4NMXA 3VF2A 4YB7A 2AJ2A 3CO9A 2B6AB 2HNZB 1EETB 5K8MA 4UY8T 2GIQA 3GG1A 1UFKA 1DAXA 4GV6A 1PAEX 4WFZA 1L3UA 3UVJA 2WSCC 4P52A 3VWSA 4ID5A 3V9SA 4OYOA 3EDRB 3DRPA 2CWKA 1VK3A 5IM0A 1SQKA 3VQDA 4QR2A 4WXWA 2XMMA 4B3SJ 4NLYA 1RT7A 1WSFA 1JIHA 1AB8A 2DNRA 4NCBA 1KOHA 1J5OA 5BJRA 3RR7A 3HJVA 1TKTA 4CD3A 1N34J 5KG0A 4MK9A 3VQ6A 4C23A 3O8MA 2OD6A 2XTJP 4JI8F 4K0KF 1YJWN 2K8GA 3R6LB 1TV6B 1HNZF 1PSDA 5GAGU 2C2EA 4OHXA 4KE5A 4BQLA 5K8NA 1C1CA 4QWCA 2G0CA 2P9UA 3B82A 3N6NA 1FX2A 5IZHA 1B0PA 1WG5A 4FXDA 4RTFD 3R97A 1R6VA 4QJVA 3LAKA 1NK6A 3JTNA 2B4VA 1M1HA 3M6XA 4NLVA 2ITGA 4BE1A 1C4CA 2FC9A 3SUQA 3CG7A 5DDRC 4ED5A 4KFBB 2WFBA 1U8WA 4IO9Q 1I3AA 4ZJQA 3Q8VA 4R8UB 4A2AA 3H46O 4DV7J 1SJ4P 2P5GA 1IH7A 1TUWA 1S1VB 4IO8A 3IAM9 3W2WB 2YKOA 1LFPA 4WZQA 4NZ6A 3KYLA 2Y3YA 5GAEP 3J7Z5 1EP4A 3SK3A 1VDHA 3V5RA 2OUGA 3N4QA 1RUSA 3RBZA 1U45A 2M5YA 3SQGA 1DGKN 4MDBA 3E2EA 3NNCA 3GCWP 1TL3B 5M1QA 4B3SK 5A76A 5E0OA 3U6FA 4C11A 4A8WA 1KEKA 1EARA 2EFNA 4F50A 2BE7D 3QESA 5C15A 1FERA 2Z2MA 4BC4A 4PEOA 1M5PC 2H54B 1TUVA 2KQ2A 4CF9A 4CJPA 3PRDA 2ZH3A 3WXJA 1CS4B 1WC4A 5BYSA 5KFFA 3KMQA 4FXWA 3JS6A 4LH4A 2MY7A 4PQUA 1NDPA 1WAFA 2BE2A 5FDLA 2AGPA 2RIJA 4MLEA 4J9LA 5K8OA 2P9LB 4KHWA 4ILRA 5LL6Z 5BN9A 3MOZA 4KBOA 3A0IX 2Q1LA 1QS4A 4ZVSB 3E9LA 3VZIA 4CJSA 3CQXA 2QM1A 1V5IB 4DR7J 1Q82O 2G13A 2E5HA 1VSKA 3AFGA 2QKBA 3CPWR 2RJZA 1DEJA 2QE5A 4Y0FA 2P1JA 2HOEA 4CLSA 4C8LA 3SCLE 3VQBA 4L6V3 3V1RA 2RVJA 4Z4EA 3MMAA 4FPRA 4ZLJA 4YY3F 4FNIA 1SKRA 2DH7A 3OVAA 1RT5A 3WQTA 2NRTA 3WXLA 2X6SA 2C2ZB 4XDCA 3LW5C 1X4HA 3VQSA 1ASUA 2CQ1A 3JAMY 3VAGA 3TJ8A 4JI2F 1YHQN 2Q66A 3RB4A 3ISNC 1WG1A 1NBWA 3BKUA 2H4YB 2YWGA 1HD0A 3TAEA 4CI6A 2ZJQL 1ZBTA 5F8GA 3OR1B 3HJFA 4DL3A 3CD7A 2ZGYA 4DV4K 3NS6A 2QWRA 1Q86O 2YQ1A 3GFYA 1BWEA 3MTKA 2FJWA 3ITHA 2KN4A 2RNEA 3HFVA 4B3SF 3PY8A 2VGNA 3A4TA 5J2QA 4CGIA 4J2EA 3TANA 3N01A 1HI8A 3UNYA 4HUFA 2NXEA 1VQNS 2FVQA 2ITMA 2FLOA 4M5DB 2NXUA 5B0GA 3QJJA 1PJ5A 4W4MA 3NVKA 1SJFA 5HO4A 4CGDA 3HHLB 4CH0S 1X60A 4QYZK 3SUPA 5KGWA 2XCPA 4WIIA 1VAZA 4FSVA 3OBWA 3K5PA 2JL9A 3BP8A 4CIOA 5KRTA 4G1QA 3Q86A 5I3UA 3ETOA 1VOMA 2F4VJ 1YJNS 2HHUA 1T9UA 3SCIE 1ZBUA 3ZTQA 1RWMB 2P9SA 5A8KB 1NM2A 3T5JA 2NR0A 3SQ1A 1Q8KA 3C8YA 2VFUA 2E2NA 5F8HA 2IRUA 1N32J 4CZHA 2GS8A 3G2XA 5GADI 4IOXA 5KT4A 1WDTA 2VFRA 4UOHA 1V6HA 4ZVEA 5DM6Q 3UVJB 2OPSA 3CJSA 5E41A 4P2FA 1N52B 2QW9A 3QO9A 1JCFA 4QYRA 1YRUA 4JP8A 4LF2A 3T9NA 4OYZA 1RDAA 1TL7B 1L3VA 5AQRA 4IDKA 4LRDA 5IT9O 1OH6A 3BQ1A 3KLGA 3BQ2A 3RRKA 3CD5A 1WSEA 5KPTA 3LGHA 4CF2A 2LMIA 4LFAJ 1HW8A 2GHVC 3MWBA 1QSYA 4N56A 3J7YU 5DLGA 1N36J 4ETXA 1G4CA 1FHTA 1V3RA 2D1CA 3G6EN 1HKBA 3DHXA 1HA1A 3TI0A 3ZZZA 1FK9B 1TMMA 3QZ8A 2COLA 5J1EB 2FLNA 3AVJA 3M6UA 1QQMA 1Z4UA 2GTDA 4NOHA 1S1UB 3MXMA 2ZBCA 4OLAA 4DMNA 4J2BA 5HI7A 2LECA 2ZH1A 1NGAA 4QOZB 2W1BA 3L9ZA 1C0MA 3QLHB 1B92A 2LEAA 3HPHA 2B9WA 2VB6A 2VBWA 2YCHA 3HHLD 4WP8A 5CXTA 2KHCA 1S1XA 2HWIA 4NXNJ 1ELOA 2F4VF 3T7ZA 4DQQA 4J9PA 4F2RA 3AAQA 3G9CA 2B5JB 4OZ1A 2WBNA 4BR5A 1HNIA 2I38A 2ZH8A 1IM6A 1QSLA 3HI9A 3FZ2A 2I7NA 1UKUA 2AGOA 2UU9F 5KG1A 3HMJG 4CO3A 2GX8A 3VGSA 2GVDB 1ZTTA 3I31A 4LRCA 2PAVA 1CSJA 3VAMA 1OIAA 4CD1A 1WSGA 2PZSA 4CP5A 3EXCX 3LP1A 2ABYA 3UE5A 4QIGA 1RGVA 2NYHA 4GW6A 1VK8A 4ID8A 2R7OA 3MCOA 3MUTP 1MMNA 1M5HA 3EPIA 1HWJA 1H0HB 3EO3A 2NRRA 3U27A 4LR8A 4PABA 4H5WA 3SNNA 1XNRK 2V2VA 2HBJA 4B9VA 2OZMA 3UKUB 4BRQA 5DG8A 1DTQA 1YT3A 4F4KA 4A5AA 1C1BA 2N3OA 4ZDNA 3FGUA 1K8KA 3OQ2A 4B1VA 3AA8A 5CYJA 2BBEA 2ZH2A 3BEGB 1Y5LB 1T3NA 2HWHA 2UXBF 3AY9A 3MAAB 2E5IA 4UZBA 4V19J 1F21A 4YR3A 4OIXA 3SBGA 1F6TA 3AY0A 1MDUB 3AH6A 3FSYA 3KK3B 4DR2F 4JV5F 4LF4K 3SAGA 2BUPA 3DDIA 1SQGA 2UU9K 4ISGA 1GK8A 5E26A 2UU9J 2HYIB 3B8HA 4QBUA 2KTQA 1W2BR 3VAJA 1Q9XA 5J1PA 1K44A 2OPPB 2G4BA 1RAEB 3FZFA 2RAQA 3E3XA 2HQDA 2DTUA 1H2TZ 4FPBA 2IRYA 1OJ4A 2OHDA 3ENOA 2CH5A 5G0RB 1O0PA 3THXA 3D0PA 5LMUJ 4J9SA 4F3QA 2NS1B 2VASA 3G87A 4P71A 5KT7A 4BDPA 1NK7A 3BY5A 2ZDPA 4OX9J 5GVQA 2GWKA 5FRNA 4CLWA 3C7NA 5HP1A 3TAPA 1BHNA 1JXVA 4IR9A 4X4OA 4IJNA 3RU0A 3TZWA 3CCMN 4QU6A 3C19A 2YNIA 3EKSA 2P6SA 2WW4A 4ZIWA 3CJ8A 4PKIA 1RTHB 5KFEA 2HVIA 3TU5A 3MXHP 1HNIB 4ILGB 3U02A 1ASVA 3G8TA 2H1YA 2AJFE 4G1QB 3P4UB 3MWPA 4WK1A 3NP5A 4X66K 4LSLA 2VOOA 3CF5L 3O44A 4NCGA 4BRDA 2QFJA 1W2IA 3OTCA 4MFBA 5C2CA 1CJKA 1LAWA 5H1SV 1CLQA 1NU4A 4HEA9 1YQHA 4ZVUB 1VMBA 2QEXN 3R5DA 3LP0A 3OD2A 3THPA 4RU2A 3MD1A 3R7SB 1XTZA 3HT3A 3HDSA 4ALZA 3KUHA 3ZETB 1NJIT 3G96A 2YKAA 4DV5F 1I94J 5RUBA 5C12A 4Z7YA 1N32F 3QJPA 5KT2A 2F96A 2H5IB 3E1YA 3PIPQ 4CE9A 2B9XA 3D1OA 5KFAA 1HHQA 4LSNB 3Q8SB 1X9SA 1S6QA 3HM8A 3VOVA 1RWXB 4BRCA 3RBDA 1QM9A 2A0FB 5A2QO 5D0GA 2A10A 4J9RA 1UVIA 1NJIO 4KB0A 2VWJA 2XYGB 2G0IA 5DMRA 2UUBJ 1S99A 2AZ1A 2HPUA 3R1HA 4G1PA 2UUCF 2FXUA 2L3MA 5EUHA 1K0TA 1CS4A 5KT5A 4Y34A 4ZITA 1DKGD 1S72N 1FRXA 2P9NB 3BGOP 3R7NB 1NGBA 2A40A 2PFUA 1HQEB 3TX0A 4O0IA 1VQ4S 4FJJA 1LW0B 3C6TA 1SH3A 2Z2LA 1JCEA 4K4YA 2E2PA 4E7HA 2Q36A 1AXQA 2V51B 4CJ5A 1FKOB 3ZNJ1 5CQGA 2G8KA 2HNDB 3AAWB 2WRMA 2CAJA 4Q5VA 4UUWA 3HD2A 3S3NA 4KHMA 3FRZA 4QW8A 5HMXA 3GIIA 2R7YA 3D45A 2B4PA 3IWLA 2EK6A 3MCPA 4A8MP 2OTLS 1JLAB 2XO6A 2A6AA 2W24A 3A8IA 3UD3P 1RT4B 4B3TF 3CJKA 2CG8A 3X1LB 2LSNA 1S9EB 1ZBIA 3EM1A 3M2RA 4BC9A 4EI2A 2Y8YA 4WZMA 4MTPA 2MQQA 3FCHA 3DU5A 1T9YA 5DS7A 5EOYA 2W4CA 4HT5A 1WUUA 1P27B 4NLPA 4JI1F 1LXNA 3KWIA 5E3RA 1UPMB 2HVDA 1BE4A 2CVEA 1ZBSA 3O80A 4F3MA 5KG5A 3QPIA 3DFEA 4DL6A 3T1YJ 4GRSA 3AA9A 1Q53A 1H6KX 3AA3A 5DDQC 4BCAA 1GQEA 4A4JA 4TU9A 2HQFA 1N33K 1F2GA 1TUUA 3MEEB 1Q18A 2O67A 2OZSA 2P9NA 2FTRA 5AZJA 1O1WA 1HIYA 4USVA 1FWPA 1HL6A 4IFEA 2IAJA 4ISEA 3AXMA 1T7PA 3OVBA 3MX2A 1RT3B 2VWBA 3S3OA 5CYQA 4H5VA 3SAFA 4EBDA 2E5LK 4LIRA 2GX9A 3FKBA 2NLXA 4C3LA 2YX1A 1HW9A 4B9NA 1YDLA 1Z26A 2E5LJ 3I9ZA 2A42A 2GJ2A 2UV8A 3IR7B 5EX3A 4AXJA 1MWZA 2DGUA 2ZM6K 2JDJA 3CYMA 1XQIA 3IP0A 2PBDA 3ZT1A 2Z8QA 1CXUA 2E1ZA 4M3UA 4CBWA 1A5VA 3AJ2A 1SI9A 2V4JA 3K8WA 4NYFA 2KKZA 3E01A 1YJWS 3MECB 2M0GB 2WVDA 2XY7A 4UY8O 4DQSA 3THYB 1NUEA 2PYJA 3VQEA 2BW2A 1EZZB 1UAXA 4PY5A 1X9MA 3DGPB 4Z2XA 4DV1K 2DEJA 4FJGA 4DL2A 3LZJA 1Q1KA 3TWZA 2D0BA 4ICLA 2VF3A 2QJ3A 3PNIA 4GO7X 1FKPA 1P90A 1GOCA 4J9VA 4CLYA 4H4MB 4KO0A 3EICA 4K2JA 1S72S 1TYQA 2YHXA 4LY7A 4A61A 5GAEU 3R5BA 4C8ZA 4NRUA 4DUTA 3CE8A 3V4IA 4J91A 1S5JA 4B3MJ 2PT0A 1IBKF 1XEZA 5CY4A 3OPKA 3A8EA 2M9KA 2W7PA 4IG3B 1WOOA 2F65A 5KGXA 3CCSN 2QLFB 4E7IA 3PJWA 3ZX3A 3M05A 3GP9A 1VRUA 3MEEA 4FXVA 5G0RA 2WBRA 3VQAA 5K14B 2IJNA 3CNQP 2DNNA 2ZWHA 3CCJN 4X4SA 3ZSZA 1EETA 2IM3A 3DLHA 2DPJA 3WXKA 1QAXA 1RHQB 2UXDJ 1FCAA 3I8BA 3GLJA 5EGYA 2CQBA 3L2RA 2V52B 2WC9A 1RKJA 3FE1A 2PEHA 2IVYA 4DR7F 1SV5A 2DR7A 1OO0B 2VG5B 4UF4A 2HHHF 4M7XA 1EKRA 3V9WA 3GR0A 2GV9A 2LCWA 4NYOA 1DJ0A 1RP5A 4D3HA 4N77A 1QQCA 3P4IA 2Y8WA 3NF7A 3CCUN 3MM5A 1GLLO 2VL1A 4YHHK 3KJNB 4X66J 3TA0A 2ZWPA 3SCJE 4CO1A 4I2QB 1PYTA 1JLGB 3AVHA 5AQFA 2ADCA 1RCHA 3OS1A 1KXPA 2JH3A 4EWTA 4ILLA 2E2OA 2XHBA 4O0NA 4FJHA 2OFGX 1C1CB 1LW0A 4WFBQ 4RLEA 1RADB 4PA1A 4HTIA 2ATCB 5ADXA 2XCAA 4FCYA 1BD6A 4IRDA 2CH6A 4E19A 4HDHA 4KY3A 2ZEJA 4FWMA 1GOAA 3QETA 2ZNYA 1D9DA 3M8PB 4DTJA 2KT2A 2DCUB 1JNRB 4V1Ak 1KSPA 2H4WB 3IKMA 4C6AA 5HQMA 3NF8A 4FWLA 2ILZA 4R8UA 2YPZA 4A8QA 4GKKF 2Y1IA 1S97A 3A12A 2V9KA 2ZBQA 4NA2A 1SJQA 5D6GA 4FPIA 1IJJA 1ZXOA 1I6JA 1KFDA 3OTDA 1OY9A 1WDDA 2FBXA 1MLAA 2JC1A 1RI7A 2JJ4D 1JMTA 3UCUP 5C25B 2GNKA 4CEBA 4RBTA 1JJ4A 1IKXB 3CM6A 1B7FA 3S6EA 5F8JA 2EFGA 3NAHA 1GX5A 2P9KA 3BKFA 3MEDA 4MAKA 2GHWA 1NNDA 2DGQA 2O1PA 1YJ9N 5D0EA 4AHRA 2GUIA 1RLCL 2VGMA 2XWYA 3C2PA 1S76D 3SJHA 3RMAA 2OEJA 5MLCQ 3BSNA 3L2UA 1S9EA 3UB5A 2BE2B 2B51A 2KT3A 2VFVA 4I2PB 4HLBA 3OBIA 4B1UB 3ULEB 1LEOA 5DO2A 4CO5A 5L38A 2HB5A 2PFFB 2A5XA 3KHRA 1WELA 5HJYA 4YHHF 2HHPA 1BHLA 2AGQA 1EX4A 3MCSA 3IR6B 4QCLA 3JAMU 1J5EF 2HHVA 2V8VA 2VPXB 1HKGA 1RT1B 1VQYA 4DR1K 4PPZA 1S3XA 3J80Y 2K1RA 3TSQA 3OYFA 3OTEA 1REGX 3RW6A 3D54A 1BI4B 2AIRB 3AJ1A 4J9NA 3LQVA 4ED2A 4BRPA 1EAYC 1TKDA 3EGNA 1ZBFA 3HFKA 1RBRA 1R0AB 1Y0HA 1VIOA 3EMTA 4ZCIA 2ALYB 1TK0A 3DM2B 4BGBA 2VBZA 4LF5F 4F26A 2VV5A 1N8RO 4JI0J 1WBBA 4BLGA 3DOKA 4OFZA 2DVIA 4MQ3A 5BRHA 4KAZA 4O4GB 3LM2A 2J9CA 2KDOA 3KXDA 1VQKS 4YUDA 2Z56B 4LF9J 1X4DA 4DR4F 2PY5A 3BZKA 1S6OA 2ALZA 1WHVA 3AJDA 1SAZA 1DT9A 4IYQA 2J7WA 2ZITA 1FRKA 2QV6A 1FFSB 2BJEA 5K9FA 2KLAA 3KD1E 1B9FA 1QZ6A 2IVFB 3CCVS 1HRHA 3GQCA 1WJ9A 2BKNA 1HBUB 2MLZA 3HVAA 5KT6A 1HNWJ 1EKSA 4CTAB 2O8BA 1NHVA 4WWSA 1NMEB 4H03B 1NB2A 3IGVA 1NRKA 3TJ9A 4ID1A 4FDFA 1IKWB 2OO4A 4KYZA 3KOAA 2GQCA 5FLXO 1ZM4A 3BYRA 4CIEA 1YVUA 2W9CA 2EG1A 2GGPA 2H3EB 2ZKTA 1YJVA 3VEWA 4PWUA 3L09A 1LWCA 2YX6A 2R4FA 1JLQA 1MU2B 1IR0A 4CLTA 1RYSA 1O8BA 3L2VA 1WAJA 3ZSYA 4P75A 5IFMA 4LF8K 3QEPA 1VS3A 5TKWA 3MX5A 4MLHA 4ZLNA 2DHSA 4OZ5A 2BVZA 3D1HA 3SPYA 3H5SA 2HNYA 3MR7A 1HBNB 2VIHA 1HQ2A 1RBOB 3DN9A 5A2QU 2Q0RA 3OYKA 3TABA 1V4SA 5AQQA 1FRJA 5CD4A 4QIFA 1NZ8A 2E20A 1PC4A 4YOEA 4ZTFA 1ZBHA 3FJ2A 1UAWA 5I3UB 4Y2KA 1QSSA 1CPZA 4O55A 3QFPA 3AGRA 1NWKA 1I94K 4G6VB 4CHYA 2C3OA 1D8ZA 2CJBA 2XULA 2WOMB 1RBSA 5GAEI 3TAGA 3LANA 5AXKA 5E5NA 1TVRA 4A46A 1BCMA 4C2MA 2WZ1A 1G99A 4YY3K 1TGOA 2IHR1 1J27A 4H0XB 2UV8G 1WACA 3HZEA 1N0UA 1ACMB 4U9RA 1RB0A 3AVIA 5A0YA 3W66A 4A57A 4CFAA 4DV3K 2E1AA 4LF5J 3GV5B 4AF1A 3J80O 1IJEB 1XHZA 1RT2B 3DGPA 5DM7L 4HACA 2XEXA 4BREA 2BRKA 3NBPA 2WUSA 1U6FA 2IA6A 2CJYB 3PW7A 3G82A 3WEEA 1XNQJ 1RHUB 3OY9A 4NYZA 1A0OB 4FP9A 2QRRA 1GXLA 5AQHA 3M6VA 5AT1B 5LJ5Y 4C8YA 3B78A 1J9AA 1NJYA 3J8AA 3R2DJ 4UOGA 4C8OA 1F0XA 2HHWA 3M2UB 4CM2A 4BRHA 3C0BA 1RBAA 1NAQA 4K4XA 1EP4B 5CYMA 3OR2A 4JV1A 3OYHA 3T1YF 4R5PB 3HBTA 3V2UC 2QLWA 1RT3A 2KI2A 2NUBA 2LEPA 4NX9A 3NGRA 4AL7A 3VVTA 3CIMA 4CJQA 2V0NA 4YOVA 1SVDA 3HI0A 5AQIA 1ZPWX 3M8PA 4LJMA 2X3DA 3EGWB 3WIUA 2XLJA 1DBDA 1I5OB 2AF6A 5HBMB 4DV7F 2X1FA 1MROA 2M8DB 3M3ZA 3GG0A 1RGIA 4KGVB 1G1XA 3QT8A 4FM0A 4MH8A 1ICEB 2H3GX 1N36K 1YVFA 2QL9B 4E7KA 3ZNUA 2F8EX 3DHWC 3VGMA 4QAGA 4BR9A 4CLZA 5HATA 2D41A 1QTMA 4FYDA 4DOZA 2AA4A 2O8DA 3KKSA 1D9FA 2FBVA 5J2MB 2OI2A 3H45C 2KO1A 2GJFA 3EZWA 2OSQA 5L9NA 1XNQF 3C66A 3IDHA 1SL1A 2YNGA 4DR4J 3PW4A 3OYBA 1VRQC 4BRLA 2QWOA 4IQXA 1HQUA 3VGUA 3VV2B 1S12A 2HFOA 1CULA 2RMLA 4OPKA 3VEVA 5D3GB 1P1LA 3AOCA 3W1YC 3OYLA 5DDPC 3G25A 3O1LA 2UXDF 4IRKA 1GNKA 2UVUA 3AVFA 4JYAJ 3DAWA 2O01C 4JS5A 4BQZA 2ATLA 4EZ9A 5IV3A 2J6TA 1N34K 4WKYA 4BC3A 3D66A 2R8HA 4FF4A 2FF3B 2DEIA 3ZEUB 3TWHA 4JK8A 3D9BA 4B3RJ 3RG6A 3S41A 4H4KC 1HI0P 4KKOA 1WF2A 1XMOK 4JUZA 1MA9B 4RW6A 2Z1HA 2MKCA 5AE1A 4ZHRA 1U25A 2G8HA 1DHMA 2R2UA 1X5SA 4CGHA 1RAOA 4ZJOA 4R0EA 4LH5A 2DFEA 2CQ2A 4DWIA 4GVEA 5K8PA 4LFCK 3Q8RB 5CHIA 4OYIA 5E3PA 3ZC4A 5J1EA 2EFQA 4DHVA 3RAXA 4DV0K 1RTIB 3IO1A 3NGTA 3EJMA 4X66F 4FWOA 3FFKB 4CBUA 2KM8C 2XO7A 4C98A 4CM0A 1WUAA 3RSEB 3B6PA 4K4TA 4CJ4A 3QIPA 1Z05A 2VG7B 3B4DA 4DR6K 1KR4A 5FROA 1UEUA 4DLGA 3TP2A 3CDWA 4CEAA 3MN9A 1QUVA 5EX0A 4DTNA 4DV4J 2W9AA 2HBYB 3SCXA 3QWUA 4KHPJ 1FI4A 1A5WA 5J2NA 2DTJA 2GZOA 3TUIC 4RW9B 5IC6B 1KAXA 1HBNA 2J4RA 2ZOFA 1NGGA 3K7RA 3GOIA 4DR3K 4OJGA 3QIDA 4WFBL 4NLDA 1JLEB 4X65K 4QR0A 3O2IA 3A5NC 3K2PA 4CZLA 3NS5A 4PG7A 2FHOB 1VQLN 3NH1A 4JYAF 1RSCA 5AQLA 3QRPA 2XYHB 1IG8A 3I8DA 4C7QA 2E9TA 3R1XA 1F9FA 1WC1A 4ZPVR 4KHNA 4IDHA 2B5JA 1U24A 5AXMA 4KI6A 4O8KA 5AQGA 4A8XA 1VQPS 2CPXA 4IFVB 2DHXA 2NUHA 3DLLQ 4ZPTR 4DU7A 2L9NA 3DOMB 1ZA2B 3A13A 4ZVQB 1X9WA 1C0UB 4U7UK 3N6MA 4H4OA 1Q9YA 2O8EA 1GOBA 1RHRB 5CZ1A 2P9IB 3SV3A 3CF5Q 3J7YP 1NU0A 3G82B 4ECTA 2ACYA 1RT2A 1UA0A 4J5OA 1NBEB 3KFWX 2J0QD 5E3QA 3VALA 1N88A 1JXLA 3WQPA 1Q4RA 2IPOB 4HDGA 5IWAF 3NOGA 1MSWD 1BGXT 1FWKA 2C2KB 1TUYA 1W25A 3D67A 2FVCA 3SQ2A 2HFNA 3KUGA 5M1FA 3W64A 5AQXA 2PSZA 3Q2TC 1KVBA 2EFPA 1QJHA 4DR5K 3FBBA 2XHCA 1HBOA 2VKZG 3VVUA 4NEZA 2MKIA 4KB7A 1WN7A 3TTCA 3UO0A 4LMZA 2ZQBA 2OPQB 2RRAA 2CZVC 3ZT3A 3TX8A 1HYVA 3PFEA 2KFYA 2G2OA 4IQMA 2V68A 2E1CA 2MKJA 3PEJA 4JYAK 1WHXA 1HFEL 2VYPA 5DQHA 1CJTB 2UVRA 2RF2A 1HR0F 3QATA 3CCEN 3V1OA 1YZ6A 4YOTA 2Z1GA 4PXCA 5IQQA 1T0TV 3EWGA 4EGLA 2V5HG 3HSGA 1YBTA 2KHDA 1RJJA 3JB9k 3ZZUA 4LT6A 4DX8H 4DX5A 5HN0A 2LXFA 3UKUA 1VJQA 1T9VA 3PHEA 1ROFA 4MKAA 3H1QA 5D15A 1RBUA 4TSXA 3QT7A 2FJVA 3CCVN 2YVSA 3DC2A 3W65A 2MTLA 1TKXB 4UOFA 4B3OA 3ISND 3VQ4A 1HPZA 3LP1B 3GJQB 1SH2A 1CVJA 4OYBA 4YR2A 4RW9A 1G3OA 1R0AA 2QMWA 4LF9F 4DXLA 2OPQA 3TAQA 1VSIA 4B3MK 1EXQA 3LP0B 2R2SA 2EPIA 3M1VA 4CFCA 1CZ9A 1E6YB 1CC7A 1REVA 4OKJA 1UW4A 1Q95G 4B02A 3THVA 1NPRA 5DQIA 4G3IA 4OKKA 4ZVFA 4DTUA 3MMBB 4B9SA 2A6OA 5F3ZA 3QERA 4BRNA 4RO0A 4YDDB 4R25A 2E7VA 3N79A 2XMAA 4KHYA 4F8RA 2F1FA 1FD2A 2Y0BB 4CO4A 4NCGB 2ZE2B 2ROEA 3E51A 5AQUA 1B99A 4XO0A 5AQJA 2I1RA 1CJKB 3PYEA 4QR1A 2CRLA 3RAMA 2W41A 4I56A 5CA5A 4CRJA 2IVNA 3QIPB 2VICA 2QXLA 3R6MA 1H2UX 3LWMA 1U04A 3A3OB 2O3DA 2C2DA 2DH9A 3IAS9 3EKUA 3MWTA 2JEIA 4E89A 2UXDK 3SDEA 4B08A 2A3JA 2VA3A 2YKMA 5HJXA 4AQYK 3KK1A 2KL8A 1IJFB 4C9DA 2EBGA 4HH0A 1ZZFA 3IC1A 2O66A 1JKHB 3V81A 3HTVA 3U9DA 3SPZA 3VMFB 3E66A 1C4AA 1Y3JA 5HROB 3W2VB 2B4UA 4CZCA 1UZHA 2BACA 4JI2K 2HRUA 4C97A 4NLTA 5A0YB 1QY7A 4KHRA 2BZ2A 4PG8A 3KLEA 3LDOA 3CCZA 1WF0A 1WHWA 1X4BA 3WC2A 3QNWB 2OA8A 1S0OA 4Z4CA 2GHPA 4BROA 4FOIA 2WCXA 4JKEA 1PKUA 1X31C 2F4FA 1PBAA 2B3TB 2BM0A 1Q5YA 4DV0J 1NKCA 4WCEL 1QHAA 2B8PA 3CPWM 4UUXA 4TXSA 3C6UB 1MW7A 5AQZA 4CCHA 1NSPA 2RHKA 4JI7J 5KFYA 2VCPA 2G2ZA 1GTHA 4RUBA 4EU0A 3Q0AA 3DKDA 2DRBA 2LXUA 3MTJA 4OLOA 1LNQA 2LQ8A 1TVRB 1SIWB 3LDQA 3UFCX 4GVBB 5IT9Y 1SJ1A 3C95A 3VAKA 3HRGA 2W2QP 3LDNA 4JKAA 4ZVTB 5J2PA 4C0OC 2NLWA 5JJBA 4USUA 4AD6A 2ASOA 4ECRA 4JI0F 3OS2A 2ZHOA 3W62A 1EWQA 2QX0A 4W5OA 2YX4A 3AVGA 1C0UA 1PJ7A 5KQDA 3JXUA 3AV9A 1BUPA 3CMES 3I56N 4NB4A 3SFGA 1S1TB 3PIOL 1KTQA 4OHVA 2RUGA 4LVOP 4ISFA 1JJCB 2VJUA 5F0WA 3NNAA 1UCNA 2RS8A 2P9GA 1TFWA 2FYXA 1GAOA 2C3PA 2FBYA 2BUNA 2HWTA 1KVAA 3ZZYA 3AO5A 4AYBD 1U09A 2APOA 4B1XB 2OTLN 2GW8A 5K5MA 2PE8A 3G6XA 1VQOS 2N3LA 3AVMA 2QWQA 5J2NB 1A6LA 3CULA 4HCCA 1BWFO 2XGPA 3GIMA 4I0WA 2KVQE 1JL1A 1RWNB 2RUSA 3HCXA 1B9DA 3KDOA 3OL6A 3DLEA 2QWLA 4FS2A 4HHUA 3MD3A 4FYVB 4M42A 5KFSA 3ASMA 1S49A 2E44A 2W4PA 3P49B 1BISA 3BDPA 4DV0F 4BVPA 1R8AA 1M1GA 1K9MO 3ETMA 3GSDA 2ZDOA 1I3OB 4FZYA 3F9KA 3RB0A 4M5GA 1FVSA 4DV5K 4IEIA 1JLAA 5FPMA 1F5AA 9ATCB 3ATVA 4Q0BB 3RAQA 4I67A 3H2UB 3FZBA 3SXLA 2EC0A 4NL5A 1RT5B 2BYCA 3F56A 3AB2B 5KFJA 4WE1B 2EI5A 2VQFF 2P51A 2Z0GA 2FD2A 4ECZA 2ZH6A 3WHIA 1SCJB 2B56A 3QEWA 1CJVB 2PEBA 3IBWA 3GL1A 3DXMB 3HSTB 3MN7A 4TN2A 4F4WA 1RACB 3F9MA 4DS5A 1LV5A 3S1TA 4OHZA 3I55S 2DR6A 5CHCB 4ELUA 2D3UA 5D4NA 2V4RA 4XH5A 4A48A 4NXMK 5C24A 2V63A 1RBLA 4OZ3A 4C8MA 3DOLA 4FLZA 3TUJC 2V7ZA 1OPZA 2C3YA 2DITA 3HF5A 1H7WA 3L7PA 4TYAA 2OPRB 5IV4A 3OHRA 4Z94A 3DXKA 5FDLB 4EO6A 1TUGB 3RZAA 4OYAA 4DF8A 4LFAK 1F9HA 2R7WA 5JVHL 5I3PA 3NAEA 4PWDB 1VHXA 4GC6A 2DO0A 5F41A 5ETKA 5L9XA 3H4BA 3TQ1A 5L1IA 3NCRA 5FPDA 3LTOA 3R3TA 1E6VA 1YX2A 5KI6A 4ZP9A 4IKAA 5AXNA 3FZHA 2OELA 1LWFB 3M32A 3RMBA 3GTYX 3GPAA 2LP4A 4MKBA 3L7OA 1QUPA 3X3UA 5HL7L 4XPCA 2D69A 2YWWA 5HMYA 3TQEA 2KYXA 5B0FA 4K42A 3HKWA 4ZP6A 1XNRF 3A2FA 3ILLA 5K20B 3AD8C 3FDSA 4NLRA 3TPQA 4CF0A 5C5JA 4FL9A 1QLNA 1E6YA 5DETA 1IN0A 3ET6A 3MFHA 3NCQA 1Z2ZA 2E1YA 1Q8BA 1OY8A 2ZZTA 1OKJA 5HBMA 2QSFA 3D7EO 2Z1IA 4BY9C 4QYZJ 4ILHA 2J0XA 1JK9B 1KCFA 4B9TA 4ES3A 4GNIA 3KLGB 3FMBA 4KHPF 4ILJA 1WKKA 4OZLA 1B0TA 2YXLA 2IYGA 3QWPA 2CZ9A 1NGCA 2GMJA 3DCAA 2PI4A 1S1TA 2M52A 4PWWA 4W92B 2IRXA 4DV3F 3IWNC 2LDIA 3OR2B 3R2CJ 4CEFA 1M5OC 3CM5A 3CD0A 2JGUA 4HTJA 3QINA 4CJEA 1FRMA 5KAKA 2YTCA 1Y00A 4PG6A 2D0OA 3KLVA 2ROGA 2V34A 4OZ0A 3MEGB 4RBVA 1AROP 2YJFA 1YBUA 5HRNA 3W3DA 2XWXA 4TY8A 1APSA 4EHUA 4DV2K 3CDEA 2UXBK 2IJFA 3TAFA 3ULEA 1RA6A 1X8DA 5F8MA 3QEXA 1WB9A 2BX6A 1KN6A 3PYDA 2AP6A 3C6UA 3VQ8A 1REVB 2DNKA 3M32B 5CABA 4M1KA 1NDLA 4JKHA 4Y1CA 4K8ZA 4AQYF 2HFZA 4CLLA 2IJRA 3KLFA 4P74A 2G0JA 4DR3F 2IMWP 3DRSB 2D9OA 4OX6A 1Q7YO 5AR0A 4BG8A 2WOMA 1BQNB 3SSRA 4HTUA 2WK4A 3FBFA 4OPJA 4FN5A 4PWDA 5CCMA 1RWWB 2A1RA 3ZTRA 4W5TA 4FWPA 2W6KA 1C2PA 4JI6K 4J9KA 2ZC3A 3NMAA 3DLRA 2EX3A 1VRUB 5DG7A 2N7CA 1BLUA 1PCAA 3SMZA 2G8IA 1XMBA 5JS1A 2DNPA 4ZOSA 1YJRA 3M9OB 1X4CA 3EGVA 4RWWA 1OMSA 4DG1B 3DLEB 2H5EA 5KFWA 1SUQA 1HYSB 4P10A 4F02A 3T19A 1FTCA 3BN7A 4OI2A 2FY8A 1FD8A 4QS7A 3PSIA 4E7JA 2BABA 3TEGA 3GFXA 4JOUA 3K9JA 4B9LA 1TKTB 3BGUA 3B8AX 3SV4A 3G6ES 1U47A 5EU7A 1T9XA 3VGLA 5EN1A 1V9OA 4OYXA 3ILIA 2W8LA 2DH8A 4AHTA 4WU3A 1KS2A 3LF0A 4USKA 3M2VA 4CW7B 1K73O 2FZCB 3CCES 5T7LB 5CZXA 2EWSA 4K7QA 2PGCA 1L3TA 1UVMA 4Y1DA 4WCEQ 1NSAA 1I1GA 3PKYA 3T6BA 3QFUA 1NMDA 4USIA 4ECUA 1NSQA 1OPIA 2A1BA 3D2EB 3IG1A 3D6MB 4FLTA 5HLFB 3A5LC 2GO8A 2Q43A 2V7YA 4BC7A 4FLWA 4KV8B 1RILA 4I9QA 3HOTA 2R7VA 3OFEA 2GMHA 1VYAA 4KPCA 4R5PA 4QWBA 1KTVA 3K0JA 4Z4IA 4EP4A 3DLKB 3P45B 4I6YA 2DNOA 3WX4A 5F0UA 2JWKA 1N6QB 1S57A 4USMA 4J2DA 1DFDA 4JKFA 3THXB 3M2RB 3MUMP 4GMKA 5KG2A 3PYFA 2CPJA 1U7LA 3R5GA 3AVLA 3R8EA 3JYTA 1JNZB 1NOZA 3CO0P 5BRDA 1NCLA 3O1BA 3AA5X 4O3SA 3CC4S 3NKYA 3D68A 1S6UA 3QBCA 4FW2A 3O1WA 1DURA 8ATCB 6FD1A 2P2CB 4BR0A 2UUBF 1SB6A 3V6HA 3CDUA 4OX8A 2DXFA 1SXLA 1L3SA 3L7UA 3CD6S 2HF4A 1S1WB 4KKOB 1EQ0A 1UETA 1B70B 1TR0A 3JSMA 2KG1A 4J9OA 2G8WA 3CFOA 2AYEA 4E1MA 2ASMA 2HGMA 1S5ZA 3HVTB 2Z57B 4CGJA 1Y5IB 1UWBA 2OMLA 3CXCR 3PW2A 3EVWA 2P9EA 3MAAA 4P6QA 3W60A 1SBRA 5CD4H 1U1OA 3F0NA 1KC8O 4U67L 3AD7C 3OYIA 3SUNA 1HNWK 4JK7A 2HBZB 1IKYB 2RU3A 2IM2A 2F8SA 1S9GA 1NXIA 5LXYA 2AHOB 1RBVA 5KFQA 2P9LA 5IQ6A 3BZCA 4GMJB 3F73A 4JI6F 3ET6B 5BR9A 3B4MA 1VBKA 1HYZA 3CJCA 2W42A 2U2FA 4OGEA 1TZ0A 2XC9A 1FKPB 4URGA 4ELTA 4ZVPB 3V4MA 3D2EA 1T8EA 3OTOK 3TR8A 1DY3A 1IKVA 1N0VC 4LF4F 2F7VA 1RTDB 3C6AA 1SKSA 1TKZB 2EC2A 3MMBA 4JKCA 2QWNA 4KH6A 2ZUAA 4YOYA 2QK9A 1TL5A 4MDAA 3N4PA 5BREA 1NB7A 2JC0A 4ZK7M 2ZJQQ 2RD5C 1Z2LA 4B9UA 4U7BA 4CQ1A 3Q8PB 1HQEA 3EDQB 5KFLA 3OA9A 4TVAB 4AQYJ 3H7HB 2O8CB 1IBMF 8AT1B 3MFIA 1X1PA 1ZETA 3V9ZA 4WYWA 3JQMA 3DM2A 3L3UA 4PHTX 4ENOA 4ZLPA 3SZ2A 3L0QA 3M8RA 2W2NP 3CCWA 1MWYA 5DDOC 4CDIA 2HS4A 2OIHA 4Q8EA 1N5QA 1Q7LB 2RDDA 2RS2A 2GMLA 4EIAA 5KG7A 5LSLA 2NXCA 4L72B 1X5TA 4ES2A 3IA0A 4ERDA 2ZFHA 4DV2F 4ED0A 1S1VA 3QGGA 5E3AA 1WOPA 2EWHA 2IA0A 2MSSA 2MQNA 4M5IA 4LRBA 3MGJA 3CDBA 1NHKL 2DYAA 2E1RA 5DZ6A 2HFUA 4GVMA 4JI4J 1SKWA 4IOAL 4M5LA 2IFXA 2F5GA 4CTAA 2LLZA 3TZXA 3POTA 2CQCA 3NBPB 4ZCKA 2V67A 3KK3A 4EBEA 2FVSA 4QIEA 1KQKA 1SIZA 3FQLA 1GXTA 1RWPB 3J7AN 1Y64A 2D5RA 4LRAA 1HJRA 2VG7A 2KZZA 1BA0A 3H0PA 4GKJJ 3FZKA 4CJ3A 2XMKA 3W9JA 1DQ9A 3TRGA 1W7WA 3M9MB 2FF6A 3P5JA 1DLOB 5M1NA 4RR5A 1N8RT 4MIWA 1X5OA 5EY4A 2GJIA 2IVPA 3QIOA 3F5TA 5AZJB 2O8CA 4TY8B 4N8NA 2CG4A 3TVYA 2EVZA 3CB4A 2N7YA 3PEHA 3J81Y 3GSIA 4HH1A 1VQON 2NZ4A 4IH6A 3TYTA 3P39A 3SIPB 4FJ9A 2VBXA 2LKZA 1EQYA 4RBUA 2W9CB 3WXIA 3Q83A 2BW7A 5C24B 2RHSB 2QGFB 2OP5A 2OJ3A 2DPNA 4IOCL 4PYAA 3EEQA 2YJEA 2XMVA 3EY1A 3M8WA 1SZ2A 1J5EK 2CA9A 4MO5A 1TMJA 4WYBA 2VKRA 1M5VC 4DTXA 3WDOA 3GWCA 5B0EA 4NCAA 5KOXA 4CGFA 3U9ZA 4H0YB 1KP6A 3K89A 3RRGA 2VQFK 3CJRA 4FKYA 1UW9A 2VU5A 2ZWOA 1FX4A 1UVJA 1ZAWA 4CJLA 2UP1A 4L76A 1V3SA 1VCTA 1Y3KA 1Z1ZA 2AW0A 4I6AA 2OLWA 4OYMA 1Y7PA 2QYGA 4CFBA 3TO8A 4RW7B 4BWJA 1ZAXA 4JI2J 1X0FA 4PXDA 1K6YA 4CEEA 3UKRB 3ZZOA 4O5FA 1KQFB 4KGKA 1LWFA 4DV1F 1PC5A 4I1TA 3QGIA 1B0VA 3F2KA 1W2BM 4BC5A 3U8XA 2FJDB 1GFWB 3QMLA 1FKOA 3NF6A 3VEYA 1FEEA 2YWKA 4IKFA 1SKUB 3UR0A 4J7CA 3BBFA 3THYA 4YORA 2DXEA 3W5YA 1WTFA 4EMDA 1IG9A 4Z37A 1NLVA 2UVVA 3LDLA 4IZ9A 5B8HA 3G8QA 3J81U 5F0XA 3O08A 3J7ZO 4HI1A 3VGVA 2X6NA 4YDUC 2EK1A 1RKIA 4P2MA 2LEBA 1BQMB 4DHYA 3CUNA 4A8KA 2LQ5A 3SI8A 3LM9A 1YF5L 2UXCF 1K47A 4I69A 2I7PA 4FJXA 5IT9U 4B9QA 4U6PA 1D5AA 4M95A 2AP1A 2RT3A 3GYXB 2X74A 2CFXA 5ETPA 1U0HB 2CQDA 3E8OA 5LMUK 1X4AA 1RT1A 1NJZA 2HQGA 1T05A 1NG9A 5LMNF 5JXSA 4Q2MA 4A8OA 2VC0A 2MZ1A 2NNWA 3HSCA 4J90A 5AQYA 3O9SA 1VC6A 5DM6L 4OX9K 2HS3A 3KLIA 4ED1A 2HAFA 4RUAA 4GKKJ 3CJ5A 3LGMA 5M1OA 1AA1B 5AQOA 4F25A