3DLKA

Crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal engineering of HIV-1 reverse transcriptase for structure-based drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 152
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlkA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlkA05
5KRTA 5L9XA 1UWBB 3T5LA 5KTQA 1VRUA 4W5RA 3GILA 3MTKA 1U45A 3MR6A 4KHYA 1S1TA 4DL5A 3QIPB 4NLYA 1B92A 1JXBA 3M8SA 1RTJA 3AA5X 4TN2A 2E9RX 3ZT0A 1HNIB 1RTHB 3OYBA 2W9BB 4NLPA 4ZP7A 4CJRA 4OKEA 3QZ7A 4O3QA 3P5JA 3FFIA 2ZE2A 4WFYA 4CJQA 3LWLA 1WAJA 4LH5A 5DG8A 3PV8A 4K50A 4RNOA 1KHVA 1JL2A 1FKPB 4RZRA 4CE9A 1UA0A 3KJVB 4IRDA 3MECB 4DU4A 3TWHA 2YHBA 3MEDB 3LP3A 4BDZA 5C24A 3V6KA 1QUVA 2HNYB 2W9CB 4N41A 1RT5A 1RDCA 1VRTB 4TY8B 1S9EB 2HHTA 4CJUA 4OLBA 4PA1A 1Z25A 4YR3A 4LD0A 1BI4A 3NAHA 1WSFA 1RT6A 4YQWA 1ZTTA 4CHZA 3HHKA 2AQ4A 4CF1A 3SUNA 4O3NA 3K5MA 2V4RA 5KFPA 1KLMA 2D0CA 3HVTA 2P1JA 3L2VA 4R8UA 3WNHA 3OYLA 4N56A 3D45A 1U47A 3K2PA 3RR8A 4E7IA 3CDUA 4O44B 2QE5A 3S3OA 3MR3A 1EETA 4FK2A 1D5AA 3IG1B 3NBPA 1NHUA 1YVFA 4NYFA 3V9WA 2AWZA 2BANA 1DLOB 5EWFA 4JS4A 1VK0A 3DYAB 1RT3B 3B6PA 2XHBA 5HLFB 2E6MA 4MKAA 1RNHA 4ECQA 2HNZA 4CEEA 3ITHB 4Q45A 1JLAA 1RBTA 5KG0A 4Z4GA 1WSIA 2HMIA 3KLVA 4KB1A 4KHQA 2BRLA 3OSNA 4EEYA 3AV9A 1RTHA 2IJNA 4C8NA 3G6YA 3VQPA 2OZMA 2W9BA 2YV0X 2F8SA 1C0UA 3DLGA 1L5UA 4Y2AA 1TKZB 5F8JA 3A2FA 3OYDA 2UVWA 3MAQA 1TKTB 3SV3A 4LSNB 2OZSA 3QO9B 1VSEA 4OL8A 3MECA 2R2SA 1TL1A 1LWCB 1JLBB 1EX4A 5J2PB 1KVBA 3TABA 4RW7B 1IH7A 2HNYA 4Z4FA 2OPPA 3SQ1A 2RKIB 1BQMA 4H4OB 2O4GA 3VQCA 3OS1A 1RTIA 3I0SB 3VQEA 4DL6A 1RT4A 4FVMA 3KOAA 3OYMA 2BDPA 3TAGA 5DG7A 3OYFA 3MFIA 1HNVA 2FBYA 3G10A 4KO0B 2EX3A 1B9FA 4TQSA 4KFBB 3F73A 4IG3B 1TK8A 1T8EA 2FJWA 1DLOA 3JYTA 3VQSA 3PW4A 3ZSQA 2IM1A 3O4NA 1WSHA 3V9XA 4AHRA 5HLFA 1RBVA 3OLAA 2G8HA 4B9SA 2QKBA 1BGXT 4CF8A 4DQPA 4ZVHA 4DTNA 5L1IA 3V6HA 3VN5A 5KFSA 2YKMB 1X9MA 3RMDA 4Y3CA 3OYIA 4NCGA 4NYZA 1JLFB 5F8IA 5KFBA 3QZ8A 2IDOA 4CFAA 4KKOA 4JRPA 4KI6A 4KHWA 2BGGA 3U3YA 3U6FA 3BJYA 1BQNA 1XHZA 4QWEA 3KLEA 4FBTA 4KI4A 4LQ3A 1LWCA 3P83D 4CGDA 4O4GA 3H2LA 3AVLA 4Z4CA 2WOMA 4BE2A 4F2RA 3L3UA 3TAPA 4LSLA 2RKIA 4O3PA 3BSCA 4FW1A 2HW3A 3HPOA 4M3WA 3CYMA 3SQ4A 4Q43A 4OKJA 3AO2A 1RA6A 4F4ZA 1SH2A 4Q8FA 3KHLA 5KG2A 3NF9A 1S0OA 5C42B 5J2MA 4FLVA 1S5JA 3LP1B 4FJLA 3ISND 1C0TA 4CEAA 1D9DA 4PQUB 4J2BA 4IG0A 3EPGA 3MXIA 3QLHA 4IG3A 2R2TA 3DM2B 1BL3A 4CJ4A 1SH3A 3DOLA 4URSA 1RDDA 3RBDA 1S9FA 1LAWA 4B9NA 1VSFA 4DLGA 3KMQA 5CY4A 2A1SA 4CEZA 4DTJA 4KE5A 4XO0A 3QEPA 2XRIA 1QS4A 3LPTA 3ZT4A 1KFSA 1BIZA 4CGJA 1R0AB 4J2EA 1RDAA 2GBZA 1Q8IA 2R8HA 1T03A 1EP4B 4RW8A 4NLXA 1JLEB 3KK2B 1N6QB 3KHHA 3CFPA 5KFAA 3NL0A 3M8QB 2KFZA 3G6VA 4E1MA 1C1AA 3V1QA 3LANA 2Z1JA 2IMWP 3OY9A 4JV2A 1YT3A 5F8MA 3BSNA 4Z4HA 2FLPA 3HK2A 2DTUA 4ID5B 4DMNA 2QV6A 3KLIB 2FVPA 2C22A 3NH0A 3L8BA 4ZPDA 3T19A 5SWMA 4G3IA 4LY7A 5HRPA 2HHSA 4IH7A 3DLHA 1I39A 3TI0A 5J2QB 2AU0A 4KHSA 2V4QA 1S6PB 3DMJB 4O3RA 5C42A 4MIAA 3PW7A 2BQ3A 1J5OB 3O3HA 2VG6A 3DLKA 1IKVB 3QEVA 4ZPBA 1L3UA 4G1QA 1W9HA 3QIDA 3PW2A 4Q44A 1LW2A 2YKNB 3BGRA 4M3UA 3GV7B 5KFOA 3L2RA 1HRHA 2B4JA 4HVJA 4C8OA 4R0EA 5D3GB 5DQIA 4K4WA 3OHAA 3H40A 3SCXA 3BQ0A 1TL3A 4ED3A 2RPIA 4DQQA 3C94A 4AHSA 5F8NA 5J2NA 3EY1A 1S1UA 3DLRA 3JSMA 5KG7A 3AVMA 1RT2A 3SUPA 2JC0A 3C6UB 1HQUB 1QHTA 1NK5A 4F4WA 4E7KA 2DY4A 2G8WA 1U04A 2W8LA 4E7LA 4TYAA 1C2PA 4KV8A 2X74A 3NF7A 1FKOA 1VRUB 1SH0A 1JLEA 1S1TB 2R2UA 4DU1A 1XHXA 5T7BA 3AVIA 4E19A 3SI6A 4MQ3A 3PVXA 3UQSA 4CJFA 3D5MA 4MKBA 2GV9A 1LWEA 1NKBA 1NK7A 1WSJA 4WFZA 2JEJA 3TQ1A 2HWHA 3FFIB 4CF0A 3M8PA 5DQGA 3G6XA 4ED0A 2OPRA 4IH5A 4WYLA 3AO4A 3PHEA 1C1CA 1S49A 2FLLA 2Z1IA 5C24B 1WN7A 4HCCA 3RB3A 3RTVA 1GX6A 3V9UA 3HM9A 4ECZA 1BI4B 4CGIA 4NLDA 3OHBA 1RT6B 4OGEA 4MIBA 3SUQA 3MEGB 4IOBA 3AO5A 4CF2A 4EP5A 4FJJA 1KLMB 3HVTB 2R8JA 1X1PA 4I2PA 4DSIA 3PX4A 3CIZA 4ZVGA 4IKFA 5DK5A 1MMLA 5KGWA 5F8GA 2F96A 5KFJA 1EETB 3GIKA 3V4IA 4RUCA 4QWCA 3NBPB 4TYBA 2VG7A 1VSLA 2AGPA 3ZCMA 4CF9A 2YNHA 2FJVA 2BANB 1SKRA 4GVMA 2WHOA 3T3FA 1RTDA 4FJNA 4FJHA 3TR8A 1K1QA 4FM1A 3NKYA 3M8RA 3QERA 5FRMA 4F4KA 5EU7A 3IRXA 2HNZB 2DFFA 3NGYA 4F4YA 4F4XA 1RBUA 1JLAB 1HYSA 2KZMA 5I3UA 4CHQA 1JIHA 2HMIB 4MK9A 2KZZA 3HVWA 2C28A 2I5JA 1N48A 3LDSA 3GYNA 1C0UB 5DGAA 1NK8A 3HJFA 1SV5B 3DLGB 3T5KA 4ZVEA 4DSKA 3PO4A 4DQSA 4CHNA 3T5JA 3NMAA 1S1WA 4NCAA 3SPYA 4W5QA 4ED2A 3CDWA 3SI8A 3RAXA 1TL1B 4ZVFA 4HUFA 1VSIA 4CJSA 3PR5B 3LPUA 4FLWA 5HRRA 5K14A 1U09A 4YR2A 2OPPB 3PW0A 5CYMB 3Q8RB 4DU3A 4Z4EA 3V9SA 4CGGA 3CWJA 4O5BA 1BQMB 3VQBA 3VA0A 3SNNA 4MK8A 1RTIB 4ZTFA 1RT7A 1S0NA 1RT4B 4DSJA 1LWFA 3MEGA 1J54A 2UVVA 3FDSA 1L3VA 4FZXC 4OLAA 3DRSA 4WE1B 3Q8PB 1NKCA 1HNVB 4J9SA 3DI6A 1U49A 2HB5A 4C8KA 3RB4A 2BR0A 1JKHA 3GIJA 1FK9A 3RMBA 2YNFA 3OVNA 4BE0A 4ICLA 3VQ4A 3JYTB 3BSAA 2E9TA 3RMCA 3KD1E 1JL1A 4CJ3A 3LWMA 4RNMA 1T3NA 4K4VA 2PZSA 2D0AA 3HT3A 3E01A 4FJ8A 2V0NA 4YMEA 4K4XA 5I42A 2IJFA 3AVCA 3PX6A 2J6SA 3KKSA 4NCGB 5DLFA 5KG6A 3DLEA 4B8AB 4ZTJA 1SV5A 1BISA 2IAJB 3PJWA 4C8MA 4DSLA 4KKOB 3NH1A 4DQIA 1UAXA 4NCBA 4F3OA 1LAVA 4LQ9A 2OYQA 1HPZA 3L2QA 4RNFA 4GC7A 1KLNA 1NK0A 1Y97A 1BQNB 4X2BA 2XC9A 4AHCA 3KLEB 1XR7A 3PR4A 4FYDA 4NYNA 1NK6A 4O4GB 1Q9XA 1S10A 1IKXA 2WOMB 1KHWA 4TSXA 5CYMA 3OYEA 1TK5A 4LSLB 4W5NA 2BRKA 3MEEB 3H98A 4CK2A 2RF2B 4RW9B 4CJVA 4J2DA 4IR9A 4IFVB 4RW6A 5J1EA 1WSEA 4Y1DA 4B9UA 1MU2A 4DQRA 1D1UA 4WE1A 1JLGA 5J2MB 3OYGA 5HRNA 1TVRA 5KT2A 2X6SA 1ASWA 4HUGA 3SV4A 4ED1A 3ZT2A 1CXQA 1NJXA 2Y1IA 1C0TB 1C0MA 2G8IA 4O3SA 3DRPA 1U48A 3M9NB 4IG0B 3QLHB 4U6PA 4F50A 5KI6A 4H4MA 1S9GB 1N56A 3DOLB 2ATLA 4KHMA 4FW2A 1F21A 4KREA 3IN5A 1QAIA 3NF6A 4ELTA 4PUOA 3L2UA 1XR5A 4FJXA 2R8GA 3O4QA 3I0RA 3WNEA 4I2QA 2CKWA 4B08A 4HUEA 2ETJA 2OH2A 1S1XA 1EXQA 1DTQB 1SL1A 1T03B 2IAJA 4RW8B 2V9WA 1SL2A 3OSPA 4OJRA 3ICLA 1DTTA 5HBMA 1S48A 4O3OA 3G0ZA 3CJ2A 4DL2A 3CDEA 3B6OA 3GV8B 3QEXA 3QNNA 2KTQA 1TAQA 2BQRA 4W5TA 1I6JA 2G8FA 4DEZA 3K58A 4KB7A 3ZT3A 1RT1A 2PY5A 4EBEA 2OPQA 1T05B 2ASLA 4OGCA 4M3YA 3O3FA 5KG3A 2JEFA 3VQQA 3I5BA 4E89A 3PY8A 5EUHA 4EBCA 2VA3A 5JUMA 3HP6A 4HYKA 5JS1A 4MH8A 5KFXA 3MEEA 3UPFA 3SYZA 3THVA 2RF2A 3EZUA 4RW9A 1NNDA 1HARA 4IFVA 5SZTA 4IQXA 4CHYA 5KFQA 4Y1CA 1C1BA 4CCHA 3NGZA 5CYQA 1UOCA 1S1VA 5JS2A 3AA2A 5F9LA 4MFBB 3K5OA 4CFCA 2PYJA 2VG6B 3DLKB 4CEOA 4CERA 4G1QB 1ASUA 4CGFA 1Z26A 4M95A 1X9SA 1LW2B 3BGRB 4CHOA 3NAEA 3SFUA 3HSTB 4CJKA 1A5WA 3TAMB 5KG1A 3Q8QB 3PO5A 3V6DA 1S9GA 2HHQA 4FJ5A 4J2AA 1S4FA 1TL3B 3HPHA 2Z1GA 3OL8A 3QEIA 3OJSA 3DDKA 1RCHA 3AO1A 4BDYA 5J2NB 1S1UB 2HNDB 3JSMB 3K5NA 1RT2B 5KGXA 4OVLA 4CJPA 3H4DA 4DSEA 3E51A 3VQ8A 4WZQA 1HJRA 1C6VA 1GX5A 1QSYA 1L3SA 4NZ0A 4I7FB 2W7PA 4OPKA 4KV8B 1DTQA 1FKOB 4EYHB 2DPIA 4DL4A 3I8DA 3LP2A 1TV6A 5FDLA 3DOKA 2IOCA 5KFKA 2XY7A 1QQCA 4E7HA 3ZSXA 1LWEB 3T1AA 2ILYA 4ECWA 1ZYQA 1T05A 2FJXA 2WRMA 5KG5A 3M8PB 2WCXA 1VSJA 4FJKA 3QEWA 4KTQA 3RMAA 4CGHA 1TQLA 3EYZA 5KFZA 2D41A 2OPRB 3GV5B 4EZ6A 3HVRA 4FM2A 4TQRA 3OYNA 1C1CB 4XPEA 3QNOA 4DG1A 4ECRA 4E0DA 3HPGA 4I9QA 5F8LA 3AVHA 2OA8A 3I5AA 2ASDA 2WONA 1Q9YA 3VQDA 1ZBHA 4MFBA 2B5JA 2IS3A 3KK3A 3OYHA 3KK1A 3V9ZA 4K4TA 3KMSA 2E9ZA 3IGVA 3C6TA 4I2PB 4M41A 1RAJA 4E3SA 5L1LA 4CESA 3PW5A 4ZMMA 3TAMA 4QWDA 4EP4A 4ZPCA 3V4IB 2HHVA 3KHGA 2VG7B 4KHUA 1U4BA 4ECTA 4K4SA 4HCBA 2YNHB 5KFIA 1SKWA 4WXOA 3H5YA 4ZPAA 2HNDA 3BQ1A 1RTDB 3U3GA 4M3XA 2QXFA 1KVAA 3ZSYA 3ZT1A 3V1OA 2OPSA 4FS1A 3QIOA 1CLQA 3IRXB 1QAJA 4B8CA 1W25A 4I7FA 4NLRA 2GIQA 2XI2A 2VG5A 2KW4A 1HYSB 5I3UB 4J9PA 2KFNA 4AH9A 1NK9A 3CFRA 1TKXA 3NHGA 4F3TA 1YVUA 2E4LA 2DFHA 5KFEA 4ED7A 1FXXA 3V1RA 2I5JB 2D3UA 3MXMA 4FJMA 3S3MA 3BR9A 4PWDA 2ZKUA 4DSFA 3G86A 4O55A 4LH4A 1HMVA 1EKEA 2ZQBA 2P5OA 1S1WB 2B43A 2ALZA 2P5GA 1N5YB 1JLCA 1S6QB 4CEQA 1GOCA 4CK3A 1A5VA 4ELVA 3TARA 4BDPA 3DRRB 4DFJA 2C2EA 3LP0A 3KLHA 4J9RA 4GW6A 3V81A 4HTUA 3C95A 3CM6A 4R5PB 3AA4A 4FXDA 3KLFA 3BSOA 5K14B 2CJQA 3GIIA 4N5SA 1WNEA 2XO7A 4H8KA 2WTFA 3PZPA 3I5CA 3CG7A 1RT7B 4JV1A 2BE2A 1KTQA 1LWFB 4N47A 1QE1A 3DLBA 3N6LA 4OPJA 3DRSB 3LALA 1UA1A 3LAMA 2W8KA 4B9VA 1CXUA 2WK4A 3DI6B 4CIGA 5DLGA 2ZD1A 2VWKA 1TK0A 3CJ0A 3QGIA 1JKHB 3SJJA 2JLEA 4URQU 1FK9B 2HAIA 1S0MA 2YNFB 3TANA 1VSDA 1BHLA 4ICLB 4IKAA 4CJWA 2XCPA 3VQ7A 3BDPA 2HHXA 2FC0A 1YTAA 3H59A 2Q3SA 2R2RA 3KIOA 1ZTWA 4ECUA 2LSNA 3VQ9A 1KRPA 2XGQA 5JXSA 3RB6A 1RYRA 1XC9A 2E6LA 4U7CA 4KRFA 3E01B 4J9LA 4ED8A 3WNGA 5I42B 3KNAA 1ZBUA 5C25A 1SL0A 2P51A 2HVIA 3DLEB 3ALYA 4B9LA 3SZ2A 4CJ5A 4ZP6A 4M45A 1LW0A 2VWJA 1N5YA 2F8TA 1HPZB 1S6QA 3SUOA 5DMRA 1TKDA 3DRRA 1T7PA 4HKQA 3VQ5A 4CEBA 4DL3A 4CK1A 2XWYA 4B3OA 2F8EX 4IR1A 2YHAA 4R5PA 4BACA 4DWIA 4YNQA 4PY5A 2JGUA 4CJLA 1BCOA 1IKXB 4NLUA 2FBXA 3HL8A 4QOZB 4EO8A 5EWEA 4M42A 5KFTA 2JEIA 3D28A 1KSPA 2O4IA 4RW6B 5J1EB 1I3AA 3LAKA 3BREA 4Q0BB 1MU2B 2Z1HA 4KB0A 4FS2A 4RW4B 4J9NA 3KLGB 1IKYA 3HP9A 4I9LA 5KT6A 4XPCA 1QSLA 4CHPA 1JLGB 1TVRB 1ITGA 3CFOA 4IFYA 1XR6A 1NHVA 4GC6A 4DF8A 4E1NA 4FJ7A 3PJXA 3DRPB 3AA3A 4ZHRA 4O0JA 4CEDA 2W7OA 3QGGA 4AILC 4YR0A 1WSGA 4H4MB 4JLHA 2RN2A 3WNFA 1RA7A 2GC8A 4UQGA 1KCFA 3ASMA 5HP1A 2RDJA 4J9OA 4PUOB 4QAGA 4FJIA 5KT7A 4XIUA 2HHUA 4TXSA 3I0RB 3CQ8A 4KHNA 4ZP9A 4I2QB 3AVAA 3NH2A 1WLJA 2D0BA 2RDIA 2I1RA 3AVGA 4DLEA 1S1XB 1ZBIA 4NRTA 2J6TA 2XY5A 3TAQA 3CJ5A 4H54A 1HYZA 5KFMA 3TVKA 4JV0A 1UWBA 5DQHA 4Z0UA 4FZZA 1A5XA 1DTTB 5DGBA 5HBMB 2C2RA 3ZSVA 3ULDA 3K57A 3QETA 3QIPA 5F9NA 1HYVA 4ECXA 1HNIA 5EWGA 1RT1B 3D0PA 3AO3A 4Y2CA 4FJGA 3HXMA 2OPQB 3L3VA 4TLRA 3NFAA 3OJUA 2W42A 1CSJA 3HYFA 1ZBFA 5DG9A 4GMJB 4O0IA 4FK0A 3KKRA 1BIUA 2IM0A 3CM5A 1FKPA 4FCYA 5KG4A 2YNGB 2IC3B 5T14A 3CJ4A 5KFRA 3KJVA 4Y34A 3MEDA 5KFDA 1VSKA 4IDKB 3ZSOA 5KFUA 1TAUA 1C1BB 4Q0BA 2W9CA 4RW4A 1VRTA 5CYQB 3KLGA 4TY8A 1S9EA 4BWJA 4QW9A 4DS5A 3ZSRA 1RBSA 1S1VB 3AVFA 4AHVA 3EZ5A 3OS0A 3OYJA 4RU9A 4IRKA 1ASVA 3KHRA 1IM4A 3H4BA 2PYLA 4KTWA 3RRGA 1X9WA 1NOZA 3TAFA 3S3NA 4CJEA 4DTMA 3IS9B 3AVBA 3SQ2A 3V6DB 3CO9A 4KHRA 2R8IA 2QK9A 4O44A 2IBKA 3PUFA 4KAIA 3L2WA 1REVB 3IG1A 3LZJA 1RDRA 2HHWA 4F2SA 4NLOA 5E41A 1KFDA 3QESA 3O3GA 2FVRA 4K4ZA 4EO6A 2FVCA 3RBEA 3DYAA 1RT3A 1N4LA 1ZBLA 4DS4A 3HO1A 3AVJA 3PX0A 4IH6A 3ITHA 3LP2B 1TV6B 5FDLB 1Z4UA 4DL7A 4E7JA 5EDWA 3DOKB 3SPZA 3RWUA 1SUQB 5KFYA 1RBRA 3AVNA 5F8HA 3OS2A 2ATQA 3RR7A 1OS5A 2IM3A 3UDLA 1B9DA 1TKZA 1QSSA 3UIQA 1TKTA 2DFEA 1BCMA 3TAEA 4J9MA 5KRSA 3KTQA 4LSNA 1D8YA 4WZMA 3OYKA 2YNGA 3QO9A 4DTXA 1GOAA 2IC3A 4JRQA 4DG1B 3SFGA 4FLYA 1JLBA 4IDKA 5J2PA 4RW7A 1D0EA 3Q8SB 3HKWA 2WONB 5HRSA 4RNNA 4CFBA 1HQEB 2R8KA 4H4OA 4NLTA 4KTZA 3VQ6A 4NLSA 2B5JB 4NLVA 2AGQA 2FBVA 4RG8A 3I0SA 3KK3B 3IGNA 3KK1B 1TGOA 4HHTA 4M94A 3C6TB 1J9AA 2G8UA 2C2DA 2ILZA 4AHTA 3H08A 4OKKA 4ECSA 4KBIA 2O5DA 2B6AB 3IS9A 3OLBA 2YNIB 4DTUA 2IM2A 2AX0A 3OYCA 4KO0A 2EC0A 1VSMA 1REVA 5KT5A 4W5OA 2FLNA 4QWAA 5KT3A 4KFBA 2D5RA 4CECA 5KFHA 4NLWA 2X78A 4N76A 4J9QA 3P1GA 2OPSB 3IAYA 4FZYA 3M9OB 1G15A 4O4RA 4QCLA 3RAQA 4KAZA 2VG5B 4CIFA 3RRHA 1TKXB 4FBUA 4TY9A 5L1KA 3HVAA 2YKMA 4K8XA 3BQ2A 4FLTA 1SUQA 4QWBA 3OYAA 5KFFA 4DF4A 4NLQA 4PWDB 4FM0A 2XY8A 1JLQB 1JLFA 2UVRA 2KQ2A 4URGA 2XI3A 1HMVB 4DFKA 5KT4A 1JLCB 2IA6A 4FK4A 3NDKA 4YP3A 3LP0B 3KLHB 4F8RA 2QKKA 3V81B 2UVUA 4AHUA 4DTOA 3KLFB 4RUAA 1S97A 5FROA 2XCAA 5CZ1A 3M9MB 3UR0A 3GQCA 2Y1JA 3VQAA 3V6JA 3FQKA 1HQEA 2W9AA 3QINA 1GOBA 3QGHA 2BE2B 4M3TA 4ID1A 2EHGA 2XY6A 3CVKA 5KFGA 1VSHA 1QE1B 3NAIA 2IGIA 1IO2A 2ASJA 1WAFA 2HWIA 4KPYA 4YFUA 3FQLA 4NRUA 2NUBA 3NGDA 4CJTA 1JXLA 3QYYA 4CIEA 1LV5A 3H5XA 1WNSA 3NGIA 3MR2A 2B6AA 3MFHA 2GUIA 2YNIA 2ZD1B 1NKEA 4L8RB 3LP1A 4NLGA 5C5JA 1XI1A 4PQUA 5HROB 2FBTA 3H5SA 3OL6A 4ED6A 1CZBA 2J6UA 3DM2A 3N6MA 3H5UA 4Q5VA 4FJ9A 4RNHA 3OL7A 4J9KA 3N6NA 3NCIA 1IKWB 3RB0A 1W0HA 1L3TA 1T94A 1NJWA 1O1WA 3MR5A 4IRCA 5C25B 4IBNA 2JC1A 3SQ0A 4BE1A 1R0AA 1D9FA 4CEFA 3S9HA 2AJQA 4M3ZA 3OL9A 1JLQA 1EP4A 3ZSWA 1LW0B 1JX4A 2HVHA 4JUZA 3KK2A 1N6QA 4ECVA 1NK4A 4DTRA 1RTJB 2DPJA 3NF8A 3M8QA 4B3OB 3T5HA 2FVSA 2R7YA 4DFMA 1NOYA 1JXEA 3CJ3A 4DTSA 4DTPA 4FLXA 1ZETA 5KFWA 2ZE2B 4EBDA 1SKSA 1QTMA 4ID5A 4M3RA 4QPXA 1YTUA 3KLIA 1RYSA 4QW8A 4B9MA 2GIRA 2D7SA 2WB4A 3NE6A 4K4YA 3K59A 4WYWA 4WFXA 1RT5B 2X6NA 4WXWA 5J2QA 1IKYB 2D3ZA 4K8ZA 3GIMA 3ZSZA 1CZ9A 1S6PA 3DMJA 4IFYB 2ITGA 5CZ2A 2AX1A 3VA3A 2G8VA 3MXJA 1J5OA 4ZHRB 1IKVA 1K1SA 2BQUA 3F9KA 2XGPA 3FSIA 3K5LA 2A1RA 2G8KA 5FRNA 3KD5E 1TP7A 4Q8EA 4R8UB 2VA2A 5HROA 2YKNA 4JS5A 1NJYA 3MF5A 3ISNC 4ELUA 1XWLA 2UUWA 4DFPA 5KFVA 4B9TA 4FLUA 4C8LA 5D3GA 5HP1B 5KFLA 4ZP8A 1IG9A 1K6YA 3LZIA 1KVCA 1NJZA 1RDBA 1IKWA 4ECYA 5KFCA 4Z4IA 4BWMA 2AGOA 1J53A 2JEGA 2FVQA 2UUTA 3AVKA 4EZ9A 4CFDA 4KSEB 5L1JA 4FLZA 3FRZA 4MK7A 4EYIB 3EPIA 3C6UA 1HQUA 5KFNA 4K4UA 1RILA
chains in the Genus database with same CATH superfamily
3T5LA 4P2XA 1VRUA 4W5RA 3M1VA 2C3UA 2UUCK 1U45A 2UP1A 1S1TA 3M6VA 4DL5A 3QIPB 1B92A 1HNIB 5ADXH 3UB5A 2MKKA 3EUNA 3MN5A 2MGZB 4OKEA 1TMMA 4O3QA 2ZE2A 4MYTA 2ZC3A 1XNRJ 5DG8A 1OMSA 3EE8A 4CE9A 2XMVA 5BN8A 1UJ5A 2V2QA 4EU0A 3MECB 4DU4A 3DDIA 3D3BJ 3GP9A 3KZBA 4ZLPA 4JBCA 5C24A 4N41A 3OXGA 1S9EB 4A8SA 3CJCA 3IRWP 4YR3A 2A0FB 3NAHA 4AXIA 4FF1A 3HHKA 4CF1A 3SUNA 3CSKA 5KFPA 1GLCG 3GJTB 2Y9HA 1TUYA 3L2VA 3O08A 3CCVS 3W2VB 2ITMA 3D45A 3CDUA 4CNZA 3MR3A 5SUHA 4FK2A 1CJUA 2MDAA 3IG1B 4QIWD 3NBPA 4NYFA 3R97A 1GLJO 4FN5A 4B3MJ 2RB7A 3HBTA 1OY6A 1YJVA 3DYAB 4PG8A 2VFTA 2HQFA 5LJWA 4JV5J 2LXIA 1FNOA 3POTB 1JLAA 2GAGC 4U7UK 2O1PA 2OIHA 1NGIA 4Z4GA 5EX5A 5DM7Q 2U2FA 4EEYA 2OZMA 4C8NA 2BM1A 2IBOA 2W9BA 2YV0X 1EQ0A 4C23A 2BMBA 2QT7A 3A2FA 3MAQA 5C12A 1T3OA 4CZHA 1FCAA 5ETVA 1OSDA 3VZHA 4CH7A 1HNXF 4LSNB 1NO8A 3H1VX 3WXLA 4OL8A 3PFOA 1NDLA 5J2PB 1KVBA 3FZHA 4PL7A 2OPPA 4I1TA 3AJ1A 1N5TA 2O4GA 2DR6A 2MZJA 4NPOA 1RT4A 4C97A 1RWOB 2YCHA 3TAGA 3CUNA 2QM1A 4BRLA 3MXHP 4ZIWA 3A3NB 2VYPA 4IXCA 2R7WA 3MFIA 1FE0A 2CADA 4TU8A 2ZEJA 1TZ0A 2CQIA 4DDFA 4LF7F 1VQ4N 2JSXA 4LF9F 3BGOP 2O8DB 1X4HA 2A10A 1FRMA 3OTOK 3AJDA 3CMEN 4KFBB 1TK8A 3PRBA 1DLOA 3NY0A 4KT0C 2DR5A 3O4NA 3R7SB 3V9XA 4M5DB 5HLFA 1RBVA 2O01C 2G8HA 4CF8A 1C0GA 1Q81T 1N32J 2YKMB 5DJBA 3O8MA 4Y3CA 3RSEB 4RWWA 2YQ1A 3DHWC 1JLFB 1YK9A 3HSZA 2QG9B 3P49B 2IDOA 4KKOA 1EWRA 5JLHA 2BGGA 3CC4N 1S79A 3U3YA 3BJYA 4J90A 4AYBD 2BA9A 4KI4A 3G9CA 2WOMA 3OW2R 1SB6A 4BE2A 2H3EB 4F2RA 2FHJA 4OYXA 4LSLA 5D4OA 4MMOA 4JD2A 1EQYA 5T7LA 1RA6A 3SAGA 5C42B 2AYEA 4LFAK 4X84A 1YBTA 4OI3A 1WBBA 2F7VA 3ISND 3SBGA 1C0TA 3CPEA 4G1PA 4BVPA 5F0XA 3T1HK 2W24A 3EPGA 4ZK7M 2IFXA 3IBCB 4PHTX 3QLHA 4IG3A 1ZC6A 1NGBA 2E29A 3ZZPA 3EJMA 4OQJA 1SH3A 2M0GB 3DOLA 4HH1A 1S9FA 4R0JA 3KMQA 5CY4A 2DNHA 4CEZA 1WC5A 2RE2A 1SJ4P 1BIZA 4DV1K 3THYB 3WX8A 5ITHA 2R7TA 3W60A 2GBZA 4LF5F 3BS9A 4AE5A 2D9OA 1T03A 2NRVA 1EP4B 3R1HA 3VTIA 1N6QB 3CD0A 2K1RA 3GDQA 4EAHD 1ICEB 5BRFA 3M8QB 2B4OA 4DUZJ 3FEXB 2B9XA 1C1AA 2FF3B 3MCPA 4BRMA 1CG2A 2Z1JA 1NMNA 4HT5A 5F8MA 4X64J 4Z4HA 2FLPA 2CZ9A 3C14B 3B8AX 2C22A 3O9SA 4OZJA 2QW9A 2BM0A 5C0YA 1R8BA 3LDOA 4JK9A 3FGUA 1AYEA 4BROA 5HRPA 1VYAA 5J2QB 2V4QA 3HI0A 2M2BA 3ISZA 1S6PB 2GZOA 3D66A 4K41A 3K9KA 3CC7S 5LXRA 2BQ3A 3ZYYX 2PMHA 1IKVB 4ZPBA 3HX9A 2MY7A 3OBYA 1V6HA 4G1QA 1HBOA 4GV3A 2FYXA 3QIDA 2UXCK 2YKNB 4M3UA 3MPYA 2DNKA 3AXKA 2NRWA 4DV5J 1KWMA 1VC0A 1HRHA 1XQSC 2ZGYA 4P74A 4K4WA 2GELA 2QMXA 3C66A 1E4GT 4ED3A 1E3MA 3DOMB 2NUUG 4AHSA 2N3LA 3SQGA 1YITN 2E5LK 1RT2A 1GXUA 2JC0A 1D9AA 1X9JA 1DJ0A 4E7KA 1FRIA 2DY4A 1U04A 4KV8A 2RHQB 3PSFA 3MWTA 4I6MB 2R2UA 4DU1A 1XHXA 3K17A 4ANCA 4CJFA 4CLPA 3D5MA 4MKBA 4NZ6A 4LFBJ 3MGJA 1NKBA 1LWEA 3HF5A 3E66A 3A13A 2XHCA 3BEGB 3IA0A 3H7HB 5I4MA 1WG1A 4CF0A 3M8PA 3G6XA 5B0CA 3AO4A 1FXRA 2E5HA 3P31A 1C1CA 3TR5A 4A48A 5MAOA 3BN4A 2ZOFA 2ZNZA 3HSCA 3RB3A 3SDEB 3GR0A 3V9UA 3HM9A 1Q78A 1BI4B 1TL7A 1RT6B 3OHBA 1IBMK 2ZDOA 1OKJA 2YHXA 3CW2C 2CJXB 3TTCA 3MEGB 2MSTA 4IOBA 3ETMA 2R42A 4EP5A 2J76E 4JI6F 2R8JA 2W4DA 5JVHQ 1TL5A 5E3CA 3PX4A 1WB9A 4OI0A 1SPBP 5F8GA 5KFJA 1EETB 3V4IA 2ZZMA 1WC3A 5AE3A 4JKBA 5BR8K 3G25A 1VSLA 3ZCMA 3G8SA 1UVIA 3T3FA 1RTDA 2V52B 4A8WA 4NXNF 3R2DJ 5FRMA 3ADAC 3MM9A 1FJGJ 2HNZB 5ETPA 1IV0A 3OVAA 4F4XA 1RBUA 5K8OA 1FDDA 2DBBA 2K7JA 4Q2LA 2VFUA 5EHHA 4AL6A 2HMIB 1Q8KA 2YBVA 4KGZB 4OX9F 3CJSA 2DGWA 2C28A 2VICA 3LDSA 2UXBF 5DGAA 3EGVA 3LGMA 2E1YA 2GS8A 2LDYA 2Z57B 1WEYA 2CG4A 1UVNA 3T5JA 2G13A 4NCAA 1FJEB 5E3RA 1PBAA 3AH6A 4GMKA 2XTJP 5GADI 1PSDA 3ENOA 5E3QA 1CQNA 3HD1A 5EVZA 4HUFA 4RWTA 1QVGM 4CJSA 2Q6CA 4CH0S 1RHUB 4PAAA 1YVNA 2UV8A 3H42A 4DU3A 3Q8RB 4Z4EA 2HFSA 1IVZA 2FZKB 2LEAA 3SNNA 2AP6A 2R7OA 3GG4A 2J0WA 3Q8UA 1LWFA 4NMXA 1J54A 2VIHA 2Y1RI 5ADZA 4RU2A 1NKCA 1X4BA 1U49A 4DXLA 4LFCJ 2H5IB 3KK7A 3F5TA 4HWIA 2UXDF 4EFHA 3GE1A 1B4SA 1FK9A 4DV0J 3T6BA 4X66K 3G2XA 1IG8A 4BE0A 3VQ4A 3JYTB 3BSAA 1QZ5A 4QS8A 2BE9B 2WBMA 1BQXA 4FWNA 4RNMA 5U47A 5DETA 2PZSA 3HT3A 2J0SD 1XMQK 2E1MC 2V0NA 1Q81O 3MPVA 3IP0A 5AR0A 3FZBA 2IAJB 2FPHX 3UDEA 1VQLN 2EK1A 1HBNA 2E44A 3NH1A 2RRAA 1UAXA 4F3OA 1LAVA 4LQ9A 1BXNA 2NXCA 3JSBA 3UCGA 1VQ8N 2Q1NA 4FVUA 3MTJA 4IOXA 4AHCA 1XR7A 4PG6A 4J9UE 2V67A 3WHIA 4PKIA 4HACB 2NZTA 4NYNA 1QQNA 1YWXA 3JQJA 4G9ZA 3KXDA 2FJAB 1O0PA 1TK5A 1VJQA 4W5NA 3FNNA 3MEEB 3H98A 2JVRA 4CK2A 3TJ8A 4BRQA 1HKAA 4V19J 1CJVB 2MY8A 5LL6Z 3ET6A 3X3UA 2ZITA 4U95A 1GAOA 1GMWA 4U8YA 2YTCA 2XMKA 3FR0A 3SV4A 4ED1A 3CCRN 1CXQA 4PXBA 3WQTA 4BREA 1EJ7L 3RGIA 1U48A 2PI4A 3M9NB 3WEEB 4DN0A 5AXLA 2BBEA 5AQSA 2KB2A 2NRXA 1N56A 3K0SA 3EICA 1LXNA 1M5OC 1OJ4A 3GG1A 4JKAA 1F21A 4KREA 3AOCA 3Q86A 3IN5A 2F9JA 3VEOA 4FJXA 2R8GA 1JJCB 4XH5A 4I2QA 3VOVA 4USMA 2ETJA 4LF4K 1NBWA 2OH2A 4M5GA 4AL5A 5FD1A 1EXQA 1UAWA 4Y2MA 4DUZF 4BG9A 2ZWOA 4RW8B 2V9WA 1CJKA 1SL2A 5IT9U 2QZ8A 1DTTA 4O3OA 2NXJA 4AQYJ 3J80U 5IZHA 3QNNA 2G8FA 4XH4A 1IBCB 4OGCA 3OW2M 2JEFA 3R9PA 1XNQJ 2BTFA 2CNOB 1JNZB 3MMBB 5KFXA 3UPFA 1IBLF 4KH1B 1NNDA 4CHYA 3RRKA 2BOPA 1XBWA 5CYQA 1GXLA 5HMYA 5LT5A 5CD4A 4WP3A 1UOCA 4OX7A 3K5OA 3DLKB 5K8NA 5A0YB 1T9XA 3E9PA 1OH6A 4BQLA 3HZ6A 1Z26A 3J8AA 1RU2A 1LW2B 2ZJQQ 4CJKA 3M05A 2E7XA 1LK7A 2WSFC 5D0EA 1S57A 3J81j 1A5WA 3WDOA 4YOXA 5KG1A 3PO5A 2YQ0A 1HR0F 3V6DA 1S9GA 2VBWA 4O8KA 1NM2A 2DD8S 3CDAA 3U7JA 3WT0A 1RCHA 2ZNYA 1W7WA 4JI5J 3JSMB 3K5NA 1GEHA 3H4DA 4BR2A 3E51A 1YI2N 4WZQA 1GX5A 3RYLA 1VQPS 2ZGZA 1I94F 1QSYA 2W7PA 4L6V3 1DTQA 1AB8A 4LT6A 1U6ZA 4EYHB 2I2YA 4DL4A 3VPZA 3DXMA 2XULA 1NM1A 3TUJC 4GRSA 4A46A 4BHQA 3I6PA 5KFKA 5IM0A 1QQCA 2DEJA 1FT8A 3O2IA 3HOSA 3ZSXA 5IT9O 1WBDA 1T05A 1NGDA 1BO5O 2WCXA 4FJKA 3J80O 4YOVA 3IO1A 2KU7A 5KFZA 2PMWA 2OPRB 4DCHA 4JI8F 1Q8BA 4FM2A 4UW2A 3QT5A 2DGXA 3OYNA 3QNOA 3JTPA 3ZZYA 4E0DA 2COLA 3BGLA 2V4JB 2OAUA 2K7KA 3R5BA 4CT8A 2E66A 5DO2A 1HNXK 2IS3A 3KK3A 4AUKA 3OYHA 3V9ZA 1D09B 1BD6A 3C6TA 3R27A 3LF0A 1N33F 1R59O 5DDPC 2JLGA 3PHTA 4RBUA 3PW5A 4ZMMA 4ZCIA 1I3OB 4N77A 2GVZB 1VQ5N 3TVYA 1RHQB 1C4AA 4KHUA 3V4MA 4CIOA 1U4BA 2FIUA 2YNHB 1X5OA 5A2QU 3U3GA 3OTDA 1NXIA 4QYZJ 2DO0A 4KBOA 3W1YC 1KVAA 3QIOA 3EE9A 1W25A 4LF7K 4I7FA 4K5RA 4LF9K 3F9MA 3W2WB 2P9KA 2Z2LA 4J9PA 1NK9A 3CFRA 4F3TA 1YVUA 1N52B 2DFHA 1VC5A 2IVMA 3NWRA 1U7LA 2GWJA 4KPCA 4JKCA 4FJMA 3HCXA 6FD1A 2GGPB 3BR9A 2EFQA 4JKGB 4PWDA 2FC9A 2IRUA 2KHCA 4DV2J 2RNEA 4U67Q 2HBQB 4O55A 1FRLA 1EKEA 3R1LA 2ZQBA 3KUHA 3PEJA 4ZITA 2ALZA 1HKGA 4DPXA 1S6QB 3OTEA 3TARA 2AJ4A 4DFJA 3VEWA 2C2EA 3M6WA 2HBMA 3LP0A 3KLHA 3V81A 3CCQS 1IR2A 2CJQA 2VGMA 4RCHA 3QFHA 2XO7A 4DKWA 2F9DA 1FRJA 3HHLB 2KLAA 3HLUA 2N3OA 2V51B 4ZVUB 4N47A 1VBZA 4U67L 4K2XA 4GO5X 1WOSA 1UA1A 1CXUA 1KBRA 2WK4A 4BRIA 4CIGA 3I82A 2AW0A 1NAQA 5F3ZA 1DEJA 1TK0A 3QGIA 1JKHB 2HRUA 4IOCQ 4OZ2A 2FGCA 3SJJA 2JLEA 1JXVA 2HAIA 1S0MA 2YNFB 1URNA 2OMLA 3TZXA 4CJWA 1C4CA 2HS3A 2Y0BB 3H59A 4LIWA 4F3QA 3KIOA 1AA1B 2HBRB 4ECUA 2LSNA 3VQ9A 1HLWA 5JXSA 2XGQA 5D6GA 1RYRA 2WVFA 1XC9A 2XZTB 4DR3F 3ZXWA 1ZOTA 1OYDA 3LQVA 4J9LA 2DNGA 3T1YF 5I42B 1ZBUA 2D0PA 2HEKA 1J5EF 3MM8B 3DLEB 1VQ9N 1JMTA 1J2VA 2ZOMA 1H1VA 1TELA 3D9BA 2IVOA 2W4CA 2F8TA 4QYRA 4UTGA 2NYHA 3U1LA 1WJ9A 3SUOA 5DMRA 1T7PA 4HKQA 4CEBA 3LPYA 3FBCA 3D4JA 3AGRA 2YHAA 4LF5K 2GHWA 3MM6A 4DWIA 4PY5A 1Z05A 2JGUA 1IKXB 1KQSR 2D1CA 1N34J 2HF4A 1WHYA 3HL8A 4QOZB 2OTJN 5EWEA 3UDVA 5KFTA 3HHLC 3ZZUA 2EFNA 3QDKA 1KSPA 5AXNA 4FWQA 3N4QA 3J7YI 1YJTA 2BJ1A 3BREA 3NOGA 3HP9A 2HAFA 4I9LA 1QSLA 1S6UA 3TX0A 1JLGB 1ITGA 2M4MA 4ZPWR 1XR6A 4GC6A 5AXKA 4FJ7A 3PJXA 1H2VZ 1U2VB 1Q82T 4O0JA 1BUXA 3M6GA 2W7OA 4PKHA 4YR0A 2O8EB 1AUSL 3Q7BA 4H4MB 1V4SA 3THXA 4JI3F 1CLFA 4NYOA 2LP4A 4MYUA 3RU0A 3ASMA 3HOTA 4WKRA 4PUOB 4QAGA 1Q79A 2RH3A 4FJIA 3GLJA 1V5IB 2EFVA 4HEA9 3I0RB 3AVAA 4M5JA 4CLTA 3D0GE 3AVGA 4DLEA 1FX2A 2QLJB 4H54A 5KFMA 3TVKA 1FXLA 1UWBA 4Z0UA 2XYPB 1A5XA 5DGBA 2RS2A 1WHVA 1VQON 3I31A 2QSWA 3T9ZA 2CNKB 3MDFA 5M1OA 3K8WA 8ATCB 3AO3A 3H3NO 4ID8A 3U9DA 3MAAB 4TLRA 4IEIA 2W42A 1ZBFA 3DXKA 5DG9A 4O0IA 4FK0A 2BKNA 1F2HA 2XMMA 4H5TA 4FCYA 1T9WA 1N36F 2DRBA 2IVNA 2OEMA 4BR5A 4Y34A 4IDKB 2YPYA 3EDRB 1TAUA 3BO4A 2MJNA 3CCUN 4Q0BA 1VRTA 4TY8A 5B0AA 3FMWA 1S1VB 3PLAA 5KPZA 4IRKA 2G4BA 2ZVSA 4CP5A 2YQ3A 5AZJA 1MLAA 2SXLA 3KHRA 1GMVA 1P1TA 1IM4A 3EMTA 2PYLA 2RAQA 3J81Y 4P2SA 3TAFA 3RBZA 2M52A 3IS9B 3OR2B 2R8IA 3MM5A 1U1NA 4Q2MA 2MQMA 3L2WA 1REVB 5GAGI 1IQZA 2GJ2A 4JI6K 4M5IA 1CJTA 2FVRA 3MMCB 5D4NA 3RBEA 3HJVA 4DS4A 4C1NI 2VFSA 3VGTA 4CO2A 1BA1A 3C15A 2OSQA 3ITHA 3LP2B 3OR1A 4DL7A 2W2OP 4WFBL 1NDKA 4X4TA 3C46A 3WXMB 3DOKB 1KC8T 2KT3A 1U0HB 1SUQB 4OYAA 3R5GA 5KFYA 1RBRA 3ZX2A 5F8HA 4NXNK 4X62F 2ATQA 2KM8C 4ED4A 1H74A 4OYIA 3M8ZA 4AM7A 2IM3A 1B99A 1TKZA 1APSA 3UIQA 1TKTA 1BCMA 2JWNA 4E8UA 3TAEA 2NPFA 4OX9K 3VR1A 4WZMA 3PTWA 2YNGA 3QO9A 4DTXA 3DLLL 2R7UA 2UXBK 3F56A 1JLBA 3Q23A 1XERA 1YITS 1IBKF 4DR2F 2AJ1A 1CULB 4L76A 1XEZA 4DZ6A 1H0HB 4CFBA 4H4OA 1YXQA 2ZH5A 1U26A 3VQ6A 3LUYA 2AGQA 2FBVA 4RG8A 3I0SA 3KK1B 5HJYA 2L41A 3O9RA 1VOMA 1U6FA 2OO4A 3U1MA 3H08A 3BV8A 3TO8A 3IUCA 4OKKA 2YNIB 4DTUA 2B9EA 1WC4A 3MM7B 5F0UA 2JX2A 1VBXA 4W5OA 4QWAA 5A8WB 3CD6N 2AZ1A 1DZ5A 2A2CA 3G4SS 5KFHA 3JSRA 1HBUB 2KYXA 4ZJLA 3M9OB 2I7NA 4RLEA 4O4RA 2UXDK 3WUHA 4LVNP 4DV2F 4PXCA 1E4FT 4FBUA 4TY9A 2XSJB 1T3VA 1VRQC 2VU5A 3HVAA 2ZBRA 4FLTA 3OYAA 4NLQA 4H4KC 2XY8A 2Y0SD 2KQ2A 2O8FB 2XI3A 2XS2A 1LEOA 3BF1A 3EKUA 4DFKA 2X1BA 3DGPA 2U1AA 3RW7A 4DL0C 2R4FA 2B4UA 1HI0P 3UKRB 2GVDB 1CC7A 1RSCA 3KLFB 1S97A 2EKNA 2BX6A 5CHIA 3UR0A 4DR4F 3J7AP 1QY7A 4QU7A 9ATCB 2BE2B 4M3TA 2ZBQA 4JI4F 4ID1A 1RCOB 3ENVA 2XY6A 3U8XA 2HWIA 1G2EA 4YFUA 2QA4G 1LFWA 4NRUA 4BQZA 4CJTA 2MJUA 4CIEA 3H5XA 5LSRA 4S0MA 2GUIA 4L8RB 5GADU 3LP1A 2RUGA 4MIWA 4NLGA 3S01A 1HBMA 1RGIA 5C5JA 4B9QA 1XI1A 4OI6A 5H9FK 5GAHI 3VEXA 3VGKA 3CJBA 3AQPA 3DM2A 2P9LA 2G2ZA 3NP5A 1RKJA 3H5UA 1UEVA 3NCIA 4KGKA 1FWKA 2AT1B 1X0PA 3RB0A 1L3TA 3ZEUA 4OJ3A 5T41A 1O1WA 2IYGA 4BE1A 4AL7A 2Z2YB 3VF4A 3OL9A 2QWNA 5BR9A 4NA2A 4BC4A 2M70A 1LW0B 3AARA 1ZH5A 4JI1F 3KK2A 1H7WA 2D74B 3O6WA 1UEKA 1RTJB 1FWPA 5G0RA 5M1KA 3NF8A 4B3OB 3T5HA 2FVSA 2VONA 2WBNA 5HVHA 2R7YA 4A8MP 3CJ3A 4DUZK 1Z6RA 1WOPA 5GVQA 5MLCV 4F0HA 1QTMA 4ID5A 3TUZC 1YTUA 5AQKA 1RYSA 4BRCA 4B9MA 2Q31A 1RWKB 3VAJA 3NE6A 4JYAJ 3MHYA 4V19X 2HQIA 4K8ZA 3GIMA 1X4EA 2C42A 2ITGA 1DFDA 1WACA 3VA3A 1IBLK 1KDNA 2G8VA 4PL8A 4ZHRB 2EFPA 4LRDA 4HTJA 2XGPA 3TYTA 1Q82O 2FSKA 4XDCA 3JTNA 3ISNC 1XWLA 3CMAN 5AZIA 3BY5A 2HBLA 4HTIA 5KFLA 2VKZG 5JVGL 4UZCA 3LZIA 3MPWA 2M88A 1RDBA 4C3MA 4Z4IA 4BWMA 1QZ6A 2AGOA 2QLBB 5AQLA 4IQMA 2ZJPQ 3GJRB 3J7Z5 4Y00A 3Q2TC 5JLFA 3I4PA 1HR0K 4OYOA 3D3CJ 2QWPA 4QR0A 2OTLN 5KRTA 3HI9A 5L9XA 2QMWA 2PSZA 3MTKA 4NXMJ 3D2FB 1JXBA 3ZT0A 5IFMA 2R7RA 1RTHB 1WWHA 5HMZA 4OZ5A 1I94K 2E1AA 3QZ7A 3P5JA 4CJQA 1WAJA 4LH5A 3PV8A 1KHVA 2N4CA 1FKPB 2ZJPL 1W2BR 3PXGa 1UA0A 3KJVB 5HSPA 3MEDB 2CPIA 4BDZA 2HNYB 2W9CB 4OLBA 4PA1A 3MMVA 1LOTB 4CHZA 4YQWA 1ZTTA 4MLHA 4JI8K 2AQ4A 4BRKA 5THWA 3CJQA 2NNWA 2E7VA 2MLZA 1GXTA 3O8WA 4R8UA 3M3ZA 3HRGA 2MPUA 3M32A 5IC6B 1U47A 4LF6J 2JHEA 2DY9A 3K2PA 4E7IA 3G71S 3LL3A 2NRZA 3QBXA 1XTZA 1D5AA 4MO4A 2KH9A 2H4YB 2AWZA 4MAKA 1U2CA 1N33K 2BANA 3DGVA 1F0XA 2CQ4A 3SQOP 1GLFO 4JS4A 4C3LA 3B6PA 2XHBA 4DCJB 3FK4A 5CHCB 4MKAA 1RNHA 2AIRB 4ECQA 4CI0B 3P4IA 4B3RJ 4CEEA 4Q45A 1BA0A 3CCZA 1KXPA 2CA9A 3A5MC 5EN1A 4KGVB 1KC8O 3G6YA 1VFJA 2UYTA 3WIUA 4TU9A 1C0UA 3ZC4A 2Z8QA 2Q0RA 2C3YA 4C3KA 3DLGA 4Y2AA 4CM0A 3W3DA 2NSBA 3D7SB 3N5BA 1NHKL 1FHTA 2OZSA 3E2EA 3FMBA 1B0TA 2R7QA 4CO5A 2DRDA 4DX8H 4BR0A 3MECA 1LWCB 1TL4A 1IN0A 2W2QP 3VEZA 2VC0A 1MROA 4B1ZA 2DNNA 2DXFA 4F4AA 3TA0A 3ZLJA 1RAEB 3MMAB 3JS9A 4L75A 2F9TA 3SQ1A 4FP9A 4C0OC 4XDDA 4WPAA 4BRAA 5LY3A 2W7AA 2YY3A 2W1BA 2BDPA 7AT1B 4NB4A 3A0IX 4OHVA 3D2EB 3W5XA 3W2VA 1HNVA 4LR8A 2HFUA 3L7OA 4KO0B 2EX3A 1H38A 1EIYB 5AQHA 2LQBA 3ZSQA 2IM1A 3H2VE 2KXFA 1FX4A 3OLAA 2V8VA 2QKBA 4DQPA 2ZHAA 1ZS6A 3V6HA 2PT0A 3VN5A 1X9MA 1S4EA 2LU1A 2R9LA 3OYIA 4NCGA 3QSIA 1NJIT 1PILA 4CO3A 4NYZA 2J0QD 5KFBA 2AKWB 5EX0A 3QZ8A 4L72B 4DR3K 2E5JA 1P90A 4KHWA 4AD6A 3T1YK 2YX4A 2I9SA 4WBFA 3U6FA 3CCVN 2QWQA 1FI4A 1XHZA 1J5EK 4QWEA 3KLEA 4FBTA 4LQ3A 1UPMB 2HHHJ 2WSCC 2V8DA 2HSTA 5IV3A 2KHDA 2PFFB 2FSJA 3L3UA 3L09A 5BPNA 5A76A 3BGFA 4ZN3A 3HPOA 3N79A 4M3WA 4FWKA 4HR2A 3AO2A 3LDNA 4F4ZA 4ETXA 4DV3J 4EMDA 5IT9Y 1TUUA 5J2MA 1BY9A 2UU9J 3BBCA 4FJLA 1A6LA 2NXUA 4P75A 4DV4F 4W92B 2HKEA 4UY8T 4K8RA 3HZGA 4BRDA 3BBFA 4RPFA 3VAKA 4OZLA 4EUVA 4BRHA 4M63A 3M2UA 2HLUA 2HG4A 3DJCA 3MXIA 4DBQA 1HNWJ 4MJKA 1RHMB 1N5QA 3GCXP 1S72S 4PRFA 1BL3A 3W62A 4CJ4A 2ZH7A 4MKVA 1VSFA 4DLGA 1NGAA 1DURA 4XO0A 1KFSA 4DR6J 3M4XA 2EFGA 4CO4A 4J2EA 1SJQA 4JI3K 1RAAB 4NLXA 1JLEB 2CPFA 4NLCA 3ENHA 4X4VA 4YY3J 1EQMA 5KFAA 2WFBA 5LMUJ 4WF9Q 5A8RB 3MUMP 4H4KA 3V1QA 4JYAF 2HS0A 2UUBF 3CJTA 1G1XA 2CIMA 1F5BA 2CXEA 4AXJA 3BSNA 4BR4A 1IJFB 1Q86T 2A41A 3R8EA 4ZPDA 2HHSA 3LDQA 1WORA 3ULEB 5GAEI 1R7IA 5CCMA 3S7RA 4DV7F 5C42A 3KYLA 2F40A 1N36K 3AQOA 2VG6A 2ZFHA 4ILHA 4LF8J 1FDAA 1W9HA 3GV7B 2J9EA 4H5NA 2B4JA 4C8OA 4R0EA 3TZYA 5DQIA 2F4FA 1K47A 1KVKA 4IJNA 3SCXA 3EXCX 1TL3A 3CJ7A 3CXCR 2PFDA 3J7YU 5F8NA 5J2NA 3EY1A 2P6SA 1MA9B 3DLRA 4QS9A 4NXMF 2LU2A 5KG7A 3AVMA 4M7XA 2Q3PA 3C6UB 4JP8A 2F4VJ 4E7LA 4TYAA 2X74A 1R8HA 1FKOA 2WZ1A 1VRUB 3M1VB 2N82B 1S1TB 3G6ES 3M7VA 2Z58B 1RWVB 1NWKA 4MQ3A 3UQSA 3LGHA 2HPUA 3EL2A 1SCJB 4BRPA 1MMNA 1WSJA 2DR7A 4WFZA 3TQ1A 2LA4A 1IM6A 3UD5A 2VBYA 3MN6A 5A2QY 4BC9A 1KP6A 4NMLA 2IPOB 3UKUB 4X62K 5C24B 3MCOA 4HCCA 2VQFJ 3E9OA 4F04B 2X3GA 1X4FA 3G8QA 2Y8WA 3MCNA 5HQMA 4OGEA 2RQCA 4MDAA 3ATVA 2UUAJ 3AO5A 1YZ6A 4H0XB 1X1PA 4I2PA 3RBXA 1IBKK 1BHNA 4DR2K 2V2KA 5H1SQ 5DK5A 5AQPA 1EB0A 1CJUB 4QWCA 4QOTA 3NBPB 4NYPA 1S0VA 4UOFA 3M8WA 5K5MA 4B3RF 4CF9A 3DOMA 2FJVA 4F25A 1TFYA 4OJGA 8AT1B 4DN9A 3EEQA 3NKYA 4OFZA 3QERA 2DHAA 1WTFA 1EKRA 1ZM3A 2FJBB 3IRXA 1JLAB 1HYSA 5I3UA 1RHJB 4CHQA 3QRQA 2M5YA 4JN4A 2W6LA 1RAIB 4D3HA 4BRGA 1X4CA 3CC7N 1S12A 2XMAA 3HFKA 1IJEB 4DSKA 4ILLA 1RLDA 4DV2K 1S1WA 2RVJA 3O1LA 4MT1A 2W2PP 4W5QA 3CDWA 4OZ1A 3TPQA 4ITSA 1VSIA 3LPUA 3CC2S 1KQKA 2OPPB 3SDEA 5CYMB 4HI1A 4O5BA 3THWA 3VTHA 4WJBA 1RT7A 4H5WA 2F7TA 3TSPA 1S0NA 1RT4B 3MEGA 1CBKA 4DCOB 2UVVA 3FDSA 2QMUB 4OLAA 3MX5A 1FERA 4DR4K 1T0TV 4ZVOB 3DI6A 2HB5A 2V8PA 3O1WA 3RB4A 4JI4K 2AD9A 3MURP 3RMBA 4U9RA 3NG8A 3OVNA 4ICLA 1U1QA 2E9TA 2W40A 3H8YA 4DR7F 1RAFB 4LR9A 2IMOA 1VQYA 2MZ1A 3LWMA 4KJIA 2DR8A 1MNEA 2CVEA 1M5HA 3H0PA 1FJCA 2Y1LB 4ZOSA 2D0AA 3E01A 2AZ3A 4YMEA 2Q97A 4YUDA 2QRRA 3O4WA 4XEIA 3AVCA 2L48A 3KKSA 1OIAA 2PE8A 1VK3A 2ASMA 4PYDA 1NJIO 3AY9A 4PKDB 4DSLA 4KKOB 1UP1A 4NCBA 4EGLA 2OYQA 1HPZA 2ZH3A 4RNFA 1KLNA 1NK0A 4CZJA 5D0RA 1ILYA 4X2BA 2XC9A 4USUA 4BGBA 2N7YA 2RUSA 4RBVA 1NK6A 3VZIA 4KHPJ 1Q9XA 5M2PA 1S10A 2WOMB 1KHWA 4DV3F 4TSXA 4JI1K 4LSLB 1FTRA 1WC1A 2BRKA 2BYCA 2CGJA 2KKHA 5T7LB 3H25A 4CJVA 2BUPA 1ITPA 4F36A 4RW6A 1WELA 5J1EA 1WSEA 1MU2A 3T6JA 2B4VA 2B56A 1D1UA 1EZZB 4USTA 5B0GA 5KT2A 1YHQS 1SBRA 2X6SA 1ASWA 2FY8A 2Y1IA 1C0TB 1SVDA 2L3MA 1C0MA 5AQWA 4O3SA 2AEJA 5CA5A 4UY8O 1I5OB 1T11A 1V4TA 3UDCA 3QLHB 2YX1A 2VGNA 4M5LA 1Y64A 2XSFA 4RUBA 1B7YB 3C65A 3DOLB 4K5SA 2ATLA 4FW2A 5L38A 1QAIA 2IDLA 2J0XA 3HDSA 3GFHA 3L2UA 2GHPA 1LNQA 1A9NB 2JL9A 5IXUA 4HUEA 1VDHA 2KL8A 4X4UA 2V9KA 4OYWA 3WC2A 1Y10A 5DM6L 2GA7A 1SL1A 1T03B 2IAJA 4DR5F 4CQ1A 4OJRA 2K1RB 1S48A 3G0ZA 5J1PA 3NGTA 4HHUA 3CDEA 3GV8B 4ZKAA 2BQRA 1I6JA 4DEZA 3MN9A 4KB7A 1TYQA 3ZT3A 1RT1A 2PY5A 4EBEA 3VEYA 5KAKA 3O3FA 5KG3A 3W5YA 3VQQA 4CNYA 4E89A 1Y7PA 4EBCA 2VA3A 5IWAJ 3HP6A 4PPDA 4HYKA 1Q86O 3MEEA 3SYZA 2WVCA 3B54A 2CRLA 4DPYA 2LEPA 1GMUA 1RUSA 1CJVA 4IQXA 3SEOA 4R79A 4Y1CA 1C1BA 1DQ9A 5HMWA 4LF8F 3NGZA 2LXFA 3OBWA 3VF6A 3AODA 5JS2A 1JJ4A 1WG4A 1Q7LB 4CEOA 2OKQA 4G1QB 1X9SA 1WSVA 5TKWA 3SFUA 3D0IE 1NGHA 2J4RA 3TAMB 3UR3C 2Z56B 2HHQA 1S4FA 5ETSA 3CCJS 2F4VF 3O5TB 3OJSA 3AO1A 3BGUA 5ETMA 4WQ5C 3SQGB 2HNDB 1RT2B 5KGXA 4DSEA 2J7UA 3CB4A 1U25A 1ZPVA 3CF5Q 1HJRA 1C6VA 1KQFB 3W9JA 2W25A 4KV8B 1PC5A 3H90A 1TV6A 2BW2A 3SBTA 3MDQA 2IOCA 2QWRA 5GADP 2PA3A 4FWPA 1LWEB 2ILYA 1UZDA 1FRXA 1ZYQA 2DR9A 3UNYA 3M8PB 9RUBA 4G65A 3QEWA 4A8OA 3RMAA 2KVQE 1UJ6A 5AQFA 1TQLA 3EYZA 2D41A 2BW7A 4PXEA 2MKJA 3QWPA 1C1CB 4K0KF 4DG1A 4GNIA 3HPGA 2GO8A 2HIQA 5F8LA 2OA8A 3I5AA 2VQEF 2WONA 1UFKA 1HHTP 3T41A 2AHOB 4DQ8A 3VQDA 2K3KA 1TL7B 3ENAA 2O8BB 3KG1A 5AJ3J 4B3TF 1UW9A 4ZLJA 2B5JA 5A0YA 1SAZA 2JJ4D 2E9ZA 2YX6A 4L73A 1HNZF 2P9NA 1Y0HA 3BO3A 5L1LA 2I7PA 2KO1A 4EP4A 1NPPA 4ZPCA 5JJBA 5TKYA 4WCEQ 3V4IB 4ECTA 3CXCM 3R5AA 3OFEA 3BBBA 4A59A 2ASPA 4RBTA 4G6VB 1UW4A 2QLFB 1RTDB 2B8PA 2YJEA 3AY0A 1Q53A 1YIJS 1KOHA 1Q5VA 1WF0A 2R7SA 3ZSYA 3V1OA 3PYEA 2OPSA 4FS1A 3MM9B 2UUCJ 3W9IA 2XI2A 3G82A 4WFAQ 2VDIA 4HT7A 4OX8A 1U1MA 5KFEA 3MOJB 2B9WA 4CO1A 4FWOA 5FPNA 1FXXA 1WI6A 3SCLE 5GMDA 1UVJA 4P2FA 4YDUA 5HOOA 4LH4A 4JI7F 1NLVA 2P5OA 4CBWA 4OV1A 3PEHA 1N5YB 1JLCA 3D6TB 3B78A 3DRRB 3S1TA 3R7BB 3C95A 4F3MA 4FXDA 3BSOA 2I38A 4FPBA 2ZZNA 1V3ZA 5CH7B 4B3SF 3PZPA 4ZPTR 3ID8A 3IC1A 4JV1A 2FGOA 4K2JA 1LWFB 2F1FA 3IKMA 1GFWB 6FDRA 1VQPN 2V34A 3P96A 4PKGA 4KC5A 2BV3A 3LM9A 3BUZB 1VQMS 2GHVC 2E88A 5DLGA 2GVZA 1RDUA 5H9EK 5BXIA 2XHWA 1SZ2A 4URQU 5E2QA 1FK9B 5LMNK 3TANA 3N9UC 3QPIA 3QMQA 3VQ7A 4C98A 1IUJA 1FNMA 4PG7A 2R2RA 2GV1A 2EXUA 1S99A 4DV4K 3PIPL 4LUBA 3JTOA 4PPZA 4I64A 4KRFA 2EG1A 2NS1B 2RS8A 5KOXA 3O44A 5C25A 1SL0A 2DH9A 3ALYA 4B9LA 3SZ2A 4CJ5A 1H6KX 4ZP6A 1HBNB 2MQ8A 1QDUB 4FKXA 1KN6A 2CZVC 1S6QA 4CW7B 4WKYA 4DL3A 4CK1A 3D67A 3F44A 4CJLA 1ZAVA 5I9EB 3QJJA 4NLUA 3VETA 2VJUA 1R8CA 3L3CA 2ZHBA 5D15A 2GW8A 4USJC 4EK2A 1I3AA 4H0PA 4JYAK 3ET6B 2UUBK 4RW4B 1ZAWA 1IKYA 5KT6A 4XPCA 3O3LA 4CHPA 2DHSA 3VGUA 1FD2A 2OEJA 4A47A 2HQGA 4DF8A 3VWSA 4DV6F 1RWPB 3OTOJ 1NRKA 3CE8A 2A6MA 2L9DA 2YKPA 4AILC 2CQ3A 5AQNA 4FPAA 1WSGA 4DPWA 4A2BA 8RUCA 3UWTA 2D4WA 4DV7K 2GC8A 4RX6A 3M2VA 1YJNS 3BN7A 3I55S 1KCFA 5HP1A 1VIOA 4J9OA 2WVDA 1YJWS 1FVSA 3CQ8A 4ZP9A 4I2QB 3CCQN 3W9HA 1SC1B 4GKKJ 1A7GE 5B0DA 4JNEA 2O8CA 1NU4A 1V3SA 5DDQC 4IYQA 3A12A 4BC5A 3CIPA 3TAQA 3MM8A 1YLXA 1CJKB 3R8YA 1XMBA 4JKEA 5DQHA 1DTTB 5F0WA 3ZSVA 3K7RA 3C2PA 2IDEA 4PQAA 4NXMK 1Z2ZA 4ECXA 5IWAF 3D6MB 4FOEA 2L08A 3D0PA 3SMPA 4Y2CA 2VL1A 4BLGA 3J81U 4BRFA 1CSJA 1OPZA 4GMJB 3CCLS 2DIUA 1MG7A 3M30B 1NNEA 2ROGA 1SS6A 5KG4A 2GUPA 3FZMA 2IC3B 3OXLA 3MR7A 1MWKA 3ZSOA 4BWJA 3QB0A 5CYQB 3ZSRA 1Y5NB 3EZ5A 3VALA 4O23A 5BPMA 4Z7CA 3CGIA 2OD6A 3T9NA 3H4BA 1WHWA 1PIEA 5F41A 3S6EA 1NOZA 1IJJA 3FC9A 2XLIA 2CJAA 4H0VB 2RT3A 3KFWX 2QEXS 3AVBA 2BABA 3V6DB 3CJ9A 3CO9A 2JFDA 4HL9A 3PKYA 4O44A 2IBKA 3PUFA 2HHWA 4NLOA 3OQ2A 3O3GA 4PG4A 2ZH6A 1QD1A 4K4ZA 2FVCA 5GAEU 3UCZP 1RT3A 1N4LA 1U0SA 1ZBLA 2DTJA 3PX0A 2J7WA 3K5PA 3JXOA 1RWUA 4IH6A 3DXMB 1Z4UA 4F9OA 3THPA 4X4PA 4B3RK 3TSUA 1PKUA 2E1RA 3SPZA 3EZWA 3RJMB 5IM0B 3DC2A 2KN4A 2VHGA 3IMXA 4KQZA 3UDLA 1B7FA 2LLZA 1QSSA 5B09A 1GLAG 2DFEA 3FBBA 3AAQA 2K2PA 1U1RA 5B08A 4A61A 2E1ZA 4GKJF 1N54B 1D8YA 3J81O 3SFGA 4LVOP 4CD1A 4IDKA 2ZUGA 4RW7A 2QA1A 1VQ6S 5HRSA 4DHVA 2CPXA 3NXZA 3OFGA 1HQEB 1NPRA 2MSSA 4C11B 1T44A 2KJWA 1FDNA 4NLSA 3OT9A 4K25A 1V5VA 3KK3B 2YH1A 5AQUA 1IR1A 3C6TB 3ZNUA 1J9AA 2G8UA 3VGSA 2C2DA 2ZBCA 2ILZA 4AHTA 2CDRB 2GMJA 1Q95G 3IS9A 4QBUA 4C48A 1WSRA 3SCKE 5E33A 4CZGA 4ALZA 2EC0A 2X51A 4JI0F 2WBRA 1REVA 3K2YA 2E5LJ 3NS7B 5KT3A 5IT0A 4QIGA 4RTFD 2PIIA 4CECA 2CUYA 1MN7A 4DR1J 5AE2A 1K8KA 3IAYA 1GT8A 1WDDA 1X5TA 3THTA 2KFYA 3KWMA 5B8HA 1HWJA 2P9KB 3GFZA 4WQ5A 3EO3A 1SQGA 2FUG9 5L1KA 2D69A 1FVQA 1RWMB 3BQ2A 1G7CB 1SUQA 2RJZA 4DF4A 4ZLNA 3CI5A 4M5MA 4DR7K 4PWDB 4FM0A 1JLQB 3FSYA 2QO3A 4TLQA 3NDKA 2LMIA 5RUBA 5DZ6A 3LP0B 3KLHB 3JB9k 3V81B 4CLKA 1S3XA 1KD1O 4IOAL 3J7YP 3FRYA 3CCWA 1NCLA 1ZAXA 1UL3A 1IBMJ 1AFJA 3FQKA 3BH6B 3IR5B 2W9AA 4C1NK 3O5BA 2EHGA 1ULRA 3CVKA 5KFGA 3SSRA 3NAIA 2MZRA 3ZETA 4K7QA 1IO2A 1YSJA 1RK8A 3F41A 2NUBA 4DV3K 5LOQA 1JXLA 3RG6A 1LV5A 1BUPA 1WNSA 3CCMS 2YNIA 1VQKS 5C2DA 3MM7A 1D3WA 2OFHX 1YJ9S 5BRHA 1TR0A 3ZZZA 3IM8A 4PQUA 5AQZA 2FBTA 3CJKA 4A57A 5FIIA 3R6LB 1RABB 4CO0A 4ERDA 3KHYA 2J6UA 1HBUA 3SIPB 3N6MA 1V9OA 2QL9B 4FJ9A 1M1HA 4RNHA 3OL7A 3BF3A 1IKWB 2VCPA 1WEXA 3MCMA 4IBNA 1NDPA 1AFIA 1R0AA 1D9FA 4CEFA 4CH1A 2AJQA 1TU0B 5GIPA 1JNRB 2O8FA 3AA9A 2RQKA 3ZSWA 1NK4A 3HD2A 2MZSA 1XNRF 1O6XA 2DXEA 4P10A 4EI2A 4MKYA 2I8EA 1NOYA 1NSQA 1M0SA 3MM6B 5ETTA 2QIFA 3I9V9 4DTSA 5GMKa 1ZETA 3EWGA 4WTOB 3P6YC 5KFWA 4EBDA 4DR5K 5LM7E 4M3RA 3KLIA 3HMJG 4LREA 1GLDG 1K9MT 2PC6A 4UZBA 1HKCA 1OQ3A 3G4SN 4ZA1A 3ENQA 4WYWA 3FSXA 2V94A 1DRZA 1RT5B 2D3ZA 1F3VA 3WX4A 3J7A1 2MKYA 3NVMA 3VEVA 1ATSA 3DMJA 1NU0A 1E6VA 1R6VA 3MXJA 1J5OA 4X66J 4A5BA 1K1SA 5GAGP 3F9KA 4CYUA 3FSIA 2G8KA 3UN3A 4Q8EA 4LF8K 4ZJQA 1NJYA 3KWGA 4B3MF 3THXB 2UUWA 4GKKF 4B9TA 4CT9A 2ACYA 2ATCB 5D3GA 4DI6A 4YB6A 2N4DA 1MWZA 1IG9A 1XMQJ 4JV5F 2JZ5A 2RDDA 1WKJA 4OLOA 4FNIA 3TZZA 2FD2A 3FZKA 3AVKA 2A40A 1HI1A 5L1JA 1QTNB 4FLZA 5HQ8A 4MK7A 2BKOA 1HQUA 5BYSA 5IT4A 4ES3A 3GYXB 1RILA 1ATNA 1UWBB 5KTQA 1BMQB 4NI2B 2F4VK 3MR6A 1RDWX 2J7KA 3PNIA 3KUGA 3M8SA 1RTJA 3AA5X 1YBAA 2HIYA 3OYBA 3US5A 4CJRA 2V5HG 2ZH8A 2HGLA 2GWKA 3FFIA 3DXKB 2MQPA 2DNMA 4X65J 3LWLA 1SQKA 2DGSA 4K50A 4RNOA 2LVWA 1JL2A 3NMRA 1F1BB 4RZRA 2R7XA 3HT0A 1F5CA 2FXUA 4IRDA 4HTLA 3LP3A 5A6WA 4BG8A 3W5ZA 2XS5A 1VRTB 4TY8B 2HHTA 1X0FA 4KGMA 3UN5A 4CJUA 4BVOA 4OHXA 2ACMA 4LD0A 3AJ2A 2XMTA 3FBEA 1JB0C 1WSFA 2GQCA 4FWMA 4O3NA 3K5MA 5AZJB 4K0KK 1XK8A 1KLMA 3HVTA 3GWCA 3TUIC 2P1JA 2RU3A 2K06A 2VQEK 3WNHA 2DPNA 2QI2A 3MM5B 2A6OA 5D78A 2QE5A 3S3OA 5B7WA 2MLYA 4B3TK 3R5CA 2ZKTA 1NB2A 3SBMA 2Q6BA 1WF1A 3V9WA 2DNQA 3QT6A 4LF4J 2H5JB 1HNZK 5LJ3Y 2CGLA 5ADXA 3DNCA 3EGZA 1N32F 2YXLA 1FXDA 1S22A 2EK6A 4TNOA 3PIOQ 2DVIA 5K9FA 3FCHA 2VODA 3ITHB 1RTZA 4WU2A 2ADCA 3EKSA 2VBXA 1ELOA 3A3PB 3KLVA 1EARA 4KB1A 2BRLA 4ANDA 1RTHA 2IJNA 3HZEA 3FZLA 3OXFA 4ZIVA 4NEZA 5GINA 2XYGB 3D1OA 2RSQA 4J5OA 2LA6A 2FB0A 1L5UA 1TKZB 5F8JA 3OYDA 1TKTB 3SV3A 3W8PA 2HWTA 3NMUA 3AOAA 3QO9B 2C3MA 1VSEA 2P9IA 2R2SA 3PIOL 1TL1A 1JLBB 1Y5LB 3GJQB 3M6XA 2G0JA 2HNYA 1IH7A 4JI7K 4Z4FA 3I32A 3UW1A 4OYBA 2RKIB 1BQMA 4H4OB 3VQCA 3CCES 5FPMA 4X4OA 3M1FA 1U2RA 3OS1A 1RTIA 3I0SB 5E3PA 1FRKA 2P2CB 3QT8A 4DL6A 3KOAA 5L46A 3OYMA 4YDDB 3A5LC 3L9ZA 2E5LF 2BZ2A 4B3SK 5GAHP 3OYFA 1UVLA 2PMZD 1HI8A 3N28A 3G10A 1YBUA 4DR1F 3I56S 2NREA 4GV6A 1B9FA 4TQSA 4GVEA 1LXJA 2QTWA 2XNRA 3NCRA 3TTDA 3F73A 4CBXA 4CI6A 1T8EA 4CZEA 3TQEA 3VQSA 3IAS9 1W2IA 4AHRA 1T6DA 4Y65A 4B9SA 1BGXT 4BS2A 4ZVHA 5KFSA 2EKYA 4ZDNA 5CZVA 3EZOA 1UPPA 3GB0A 5LJVA 3ENWA 1SJFA 4LRAA 3MWBA 5F8IA 4JOUA 3AXMA 2DNPA 4JRPA 3E3XA 4X64F 4P72A 4I68A 4P71A 1EO1A 1BQNA 1ZM2A 2HVDA 3VVUA 2XM3A 1NEEA 2C2MB 1LWCA 3P83D 3G71N 4O4GA 3H2LA 4Z4CA 2PBDA 4ZPVR 2C2ZB 2E2PA 1HNXJ 1MWMA 3EE3A 4O3PA 3BSCA 4B17A 5AQVA 2HW3A 4UUXA 1X3MA 2MEWA 3HSGA 4Q43A 4OKJA 1SH2A 1OY9A 3PFEA 4Q8FA 1S76D 3KHLA 3DXBA 5FJ4A 1YG0A 3QAEA 4XH1A 1T95A 3NF9A 2OJ3A 4H5VA 2MHEA 4FLVA 4WU3A 5LL6d 4DV5F 4FWSA 4R25A 3LP1B 2WW8A 3J7AN 2IY5B 1HBMB 4J2BA 4IG0A 1WF2A 3I87A 1ZZFA 5I3PA 1ZZNA 4LF9J 3DM2B 2P9LB 3MK6A 4DV6K 1ZPWX 2QGFB 3IWNC 2OD4A 1XJWB 2OI2A 1AUDA 5ETKA 1JCFA 1HL6A 3ZEUB 4DTJA 4AT1B 4KE5A 2CYYA 2XRIA 1QS4A 1HWKA 2QL5B 1F9EB 2ZH9A 1RDAA 1VISA 4LFBF 2RHKA 5FPEA 3GZ7A 3MN7A 3KK2B 1U8WA 3KHHA 4OX6A 2HURA 5G0RB 3BB5A 3NL0A 5AQOA 2A3JA 4E1MA 1X3NA 5DS7A 1REGX 4ILGB 1CS4A 2MQLA 2BXJA 3OY9A 4JV2A 2A1BA 1QVFR 3HK2A 2DTUA 4ID5B 4DMNA 3TVZA 1K9MO 5IWAK 3L8BA 1XUPO 2XMUA 1Q4RA 4UF4A 5SWMA 4G3IA 4LY7A 5A6PA 1I39A 3TI0A 2PI5A 2AU0A 2VKRA 4KHSA 1HQ2A 2QA2A 2Z2MA 2QFIA 4E98A 4GVBA 3ZZTA 3NLCA 3PW7A 2WVEA 4RJVA 4KH6A 3TNVA 3LDLA 1EX8A 2BJ3A 3PW2A 3BGRA 1K0VA 5KFOA 3L2RA 5AZIB 3P4UB 5I3QA 4HVJA 2P9SB 3H40A 3BQ0A 2HBJA 2RPIA 4DQQA 1FJGF 3C94A 1YJRA 4JKFA 1S1UA 1FE4A 1FTCA 3MWPA 3EGWB 1FFWB 2HSEB 5D4PA 1MSWD 2DGQA 3GG0A 1KAZA 3SUPA 1QHTA 1NK5A 1QUPA 4F4WA 2G8WA 3ETOA 3EVOA 4M7YA 4OZ0A 1R43A 5EXWA 3NF7A 2D0OA 1JLEA 5T7BA 4WWSA 4E19A 1P27B 4X65F 3SI6A 2IRYA 4LF5J 2HK2A 2AJ0A 4OIXA 3VAHA 1NK7A 3KNGA 5BRDA 1RWNB 2JEJA 3FFKB 1HWIA 1NGCA 5DQGA 1KQGB 2HK3A 1HWUA 2DT9A 2V50A 5HJXA 3W63A 2HBKA 4YB1P 3T69A 2FLLA 1S72N 1WN7A 3HSDA 3MUVP 3C16A 3TZWA 3FGVA 1GX6A 3O80A 3CDBA 1LKZA 1YF5L 2VOPA 5HVGA 4NLDA 1OPIA 4GKJK 4P6QA 1XC3A 4MIBA 3SUQA 4LFCF 4OYPA 4CF2A 4ZVPB 4FJJA 4YDXA 5EGYA 4YORA 4DV0F 2XO6A 3M32B 3DRXA 4IKFA 2XZDB 2VF3A 3BDEA 2F96A 1RLCL 3IFEA 4RUCA 4B02A 4TYBA 2VG7A 3I8BA 1VBYA 3M6UA 2CH5A 3HHDA 2AGPA 2BANB 3P8BB 2BJDA 1K8AT 3IR7B 2MXYA 2WHOA 1N0UA 1RBOB 4FJHA 1YRXA 3UVJA 1K1QA 2QWLA 3ZTRA 5CXTA 5EU7A 5M1FA 3PACA 2DFFA 3NGYA 4JI0K 4WIIA 4WP8A 4OPHA 5A2QO 2KZMA 1JIHA 3R6MA 5BJRA 4MK9A 5HL7Q 2I5JA 5E84A 1GNKA 1C0UB 1F6TA 5D77A 3OPKA 2DHXA 1SV5B 1SC6A 3DLGB 2D1KA 1SXLA 3T5KA 4ZVEA 3PO4A 4OJ1A 4B1YB 5KOWA 3D1QA 2E20A 5LSLA 2BJ8A 3GU0A 3SPYA 1UVMA 2N7CA 2KKZA 3RAXA 3UKUA 3A8IA 2FQQB 3PR5B 1QVGR 4FLWA 5EY4A 5K14A 1MROB 4Y0WA 5HRRA 2NLWA 4YR2A 2HZCA 3PW0A 2C2NA 2D3O1 4CGGA 2NZCA 3CWJA 3VA0A 5HL7L 2XQCA 4A2AA 4ZTFA 2HVEA 4U7UD 2AJFE 1OY8A 3I9ZA 2DHGA 2PEBA 2QYCA 3DRSA 3ZZ0A 1Z1ZA 3ZO7A 1BLUA 4WE1B 3Q8PB 2AYMA 1HNVB 4HI2A 3G6EN 3BH7B 2OMOA 2CPDA 2H4WB 1YKWA 4FYXB 2V2ZA 3GIJA 2G1DA 4JI6J 1T9YA 3Q83A 4X4NA 4EWTA 3I4HX 3CT9A 1HPMA 4JHDA 2VUGA 2R3VA 3RMCA 3X1LB 3KD1E 1JL1A 4CJ3A 2F9WA 4K4VA 2RRBA 2XG8A 4TKTA 2B51A 3H1QA 3R1XA 4K4XA 4NXNJ 3D6FB 2IJFA 4MTPA 3PX6A 4NCGB 2CPHA 4AQYF 2M9KA 1UEUA 5C7PA 4X4RA 4ZTJA 2AF6A 1BISA 2FZCB 3PJWA 4DQIA 3FCVA 4OX9J 2UXBJ 3ZZRA 4GC7A 1XNQF 4BC3A 2KM8B 3KLEB 3PR4A 1YUWA 1M90T 4FYDA 4LF2A 3RZAA 1KTVA 1BWEA 5IQQA 1R8AA 3P3DA 3CEDA 5CYMA 4KH0B 5GAEP 1DHMA 1KVJA 5DM7L 4Q7AA 3JXUA 1XNRK 3GYGA 2P8IA 3WXKA 5IQ6A 2RF2B 4RW9B 4J2DA 4IR9A 4IFVB 2XS7A 4Y1DA 1KVIA 4CZIA 2VB6A 2OANA 1M1KT 4DQRA 4YB5A 2P9PA 3QRRA 5J2MB 1TVRA 1HHQA 3ZT2A 1SKUB 1NJXA 4YOWA 2G8IA 2Q79A 3TA1A 3DRPA 2GIFA 4AF1A 3M2UB 3GONA 4WFBQ 5AQTA 4U6PA 4F50A 5KI6A 2GMHA 2CQBA 4JI5F 1U1PA 5CD4H 2J8AA 2UXDJ 2IRXA 5C2GA 5ETLA 1YGYA 3NF6A 1H7XA 5DDOC 5CR4A 1XR5A 3WNEA 2CKWA 3WXIA 3A5OC 5FPDA 3CC2N 4B3MK 1S1XA 4GKKK 3DLLQ 5LSOA 3AAPA 1PYOB 4WP9A 4UOGA 2EPIA 4JV5K 5MLCQ 3ICLA 5HBMA 3HM8A 3CJ2A 3BR8A 3GPAA 5FLXU 4CLZA 3HHNB 2RE1A 2P9UA 2ZF5O 1DY3A 4DOZA 3UD3P 2RQMA 2OPQA 4M3YA 1VK8A 1YJUA 3I5BA 1BDGA 5EUHA 1SIZA 1FD8A 4I67A 2AA4A 1HA1A 2M3DA 3FEZA 5SZTA 5KFQA 3TW0A 1VIXA 4ZN1A 2YWWA 4Z37A 3AA2A 5F9LA 4MFBB 2CQGA 2VG6B 1AZSA 3GCWP 4CERA 4PCQA 5H9FJ 4NASA 2GNKA 2YWFA 3KDNA 4CHOA 3NAEA 2WVBA 4M63C 1PAEX 2DGOA 1RISA 1UTAA 3Q8QB 3C6HA 1VQNS 1FA0A 3P45B 2H3GX 4J2AA 1TL3B 1GTEA 2CH6A 3UN2A 3ZTQA 3ILIA 1N8RT 1KEKA 2Z1GA 1QJHA 3DDKA 4BDYA 5J2NB 1RBLA 2CAJA 4OVLA 3IXQA 3VQ8A 5D4LA 2MLXA 4DMZA 4CTAA 1NMDA 1L3SA 4OPKA 4TU7A 1FKOB 4A8QA 2BJ9A 4PWUA 2QL7B 4OPAA 3I8DA 5FDLA 2DO4A 4PG5A 1Q0NA 1GLLO 4LJMA 2XY7A 3GE9A 1N32K 4E7HA 3KG4A 3AAWB 2HBYB 1NDCA 3TEHB 1WOQA 1YHQN 1QVFM 2WRMA 1VSJA 4RWXA 2CGKA 3FCWA 1YTYA 5FLXO 3IR6B 3VGMA 4EZ6A 3GV5B 2CQ2A 4ILJA 5L9NA 3CJ8A 4I9QA 4DJBA 5AQMA 4N8NA 3AVHA 2ASDA 2YWKA 3HHEA 1WDTA 1IBLJ 3H45C 2VPYB 4CZMA 1ZBHA 3LDPA 1WOOA 1RQ0A 3PRVA 1VBKA 1OVQA 1DQAA 2GJIA 4K4TA 3KMSA 1QQOA 4I2PB 4M41A 4JI2J 5B0BA 3VQTA 3S8SA 1RAJA 4E3SA 4OYMA 4IEEA 3TAMA 4QWDA 2IHR1 2B3TB 2HHPA 4CLUA 1BC6A 3CD5A 2HHVA 1VR6A 1Y3JA 4K4SA 3ZNJ1 1VLOA 4HCBA 2E2NA 3RW6A 2PGCA 1FDBA 4DU8A 3CTRA 1SKWA 2V7YA 4WXOA 3H5YA 2YHWA 2XLKA 2HNDA 3BQ1A 2VV5A 4C7QA 1HR0J 1DKGD 1K8AO 4M3XA 3ZT1A 3AB4B 1CLQA 3IRXB 1QAJA 3OFHA 4B8CA 4DR1K 1VQ7S 3H6EA 4JAXA 4KGXB 2KW4A 2VG5A 2DNRA 2JWLA 1HYSB 2L9NA 5I3UB 3CNQP 1TKXA 4XK8C 2E4LA 3C7NA 4ED7A 3V1RA 2PAVA 3M2RA 1I94J 2PN6A 3S3MA 1PYSB 1T9VA 3G86A 3CJ1A 1HMVA 1S1WB 2B43A 2P5GA 1R0BG 4YHHJ 4CEQA 1A5VA 4O5FA 4BDPA 2Z2ZA 5GMEA 3T7ZA 1N34F 4GW6A 1CEZA 1HFEL 3CM6A 4R5PB 1VLYA 1NGFA 4JB8B 3U9ZA 5A8KB 4QPTA 3GIIA 1YAGA 3THWB 4CLFA 3SCIE 3CCJN 1O51A 2WTFA 2LCWA 4JI8J 2KG0A 4X64K 4I69A