1VSIA

Asv integrase core domain with ca(ii) cofactor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
total genus 51
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsiA00
3LDSA 4CHNA 3O4NA 2A1RA 5E41A 4FLTA 2X78A 1CZBA 1EXQA 1NJWA 1R0AA 1SL0A 3M8PA 3U3GA 2XY7A 1ZBLA 2Q3SA 3QIPA 3RMDA 2EX3A 4E1NA 1S1UA 1IKXA 3K2PA 4M41A 3V1QA 3SQ0A 1J5OA 3K5LA 3L2QA 3LP0A 1ASUA 3AVLA 4DQSA 1L3UA 1KLMA 1BL3A 3DYAA 4N41A 3HP9A 2DY4A 2G8KA 5I42A 1T8EA 5DK5A 3MEGA 2YNFA 4B3OA 1C1AA 4CE9A 1Q9YA 4IKFA 3ZT3A 3PX4A 1X9SA 1YTUA 1VSMA 2GBZA 4GMJB 5CZ1A 5CYQA 3KJVA 2Y1JA 4B9MA 4FJIA 4CGJA 3M8SA 3AO1A 4FLZA 1NK6A 3IG1A 3SUPA 2O4IA 2DFHA 1TL3A 1C0UA 4FJLA 1WSHA 2BANA 1QE1A 3IAYA 4CJQA 1BGXT 3AVMA 3K5OA 3AVHA 3LANA 1JLEA 2IGIA 1S1TA 3I0SA 4B9UA 2QXFA 4EZ9A 1B9FA 4M3UA 4NCBA 3K5MA 3SQ2A 1S6PA 3VQBA 3QNOA 2HHWA 3ALYA 1XI1A 1Z26A 2WONA 3AVAA 4B9TA 1DTQA 4DQQA 3A2FA 1C1CA 1TGOA 3AO2A 3NHGA 1KFDA 1XC9A 4CFCA 1JLGA 4KKOA 3O3HA 3KD1E 2P51A 1IKWA 5SWMA 2DTUA 1A5XA 4RW7A 4KHYA 3ZSOA 2GUIA 3OYMA 4DMNA 3LZJA 1RDCA 4AHRA 1B9DA 1C6VA 1SKRA 3V1OA 3OVNA 3JYTA 2KW4A 1RTDA 3S3NA 4ICLA 2P5OA 3LP1A 2G8UA 2HNYA 1JLCA 4B8AB 1NJYA 4I9QA 2YHBA 3DI6A 4DFJA 2X6SA 3ASMA 2G8IA 2OPPA 1EKEA 3DLKA 3KK2A 1T03A 3SQ1A 3V4IA 1NJZA 2HHXA 1UAXA 4CF1A 3NDKA 3MXMA 4OVLA 4FJXA 1Y97A 3IRXA 3VQEA 3ZSYA 2FBYA 4CIGA 3KK1A 3U3YA 4B9NA 1RCHA 1FXXA 4MQ3A 3VQ5A 2HMIA 3AA3A 4OKKA 4KHWA 4W5NA 1RDAA 3QNNA 4ZTJA 1UA0A 2BDPA 3OYHA 3HPHA 4HUGA 4DFMA 2PYJA 4DWIA 4DTSA 1SL2A 1C0TA 2OZSA 3NCIA 1L3SA 4FJGA 1KTQA 2B6AA 2X74A 3QERA 4ZTFA 1NK9A 1J9AA 3E01A 1Q9XA 3KD5E 1RT6A 3S3OA 2VWJA 2G8FA 4FZYA 4Z4IA 4M3RA 1S6QA 4W5QA 3OS2A 4CF0A 1WAFA 2IOCA 1WLJA 3QETA 2HVIA 4AHCA 4JLHA 4CGHA 5EU7A 1NK0A 4KTQA 5JS1A 1S9GA 4CHYA 3IS9A 2PZSA 2LSNA 4CJ3A 2YKMA 4R5PA 1U47A 1JLQA 4M3WA 2KTQA 3C6UA 2FBVA 4HTUA 3VA0A 3RMBA 2YV0X 1RBSA 5HP1A 2YNIA 1J54A 4O55A 4B8CA 2D0BA 1TV6A 3CG7A 3KKSA 4DTOA 2HW3A 4EZ6A 3ZT4A 3OYGA 4I2PA 4IDKA 1GOAA 1RT5A 4DQPA 1CLQA 3DRPA 5CZ2A 3NF6A 1JLAA 2P5GA 4FW2A 4LH5A 5J2NA 5JS2A 5I3UA 1JXBA 3TABA 1LV5A 4FJJA 1ITGA 1SL1A 2ZD1A 3CQ8A 3DLGA 3TAGA 2OPRA 3SV4A 4PWDA 2RPIA 1N6QA 4CJEA 3HXMA 3OYBA 1VSKA 2VG7A 3KKRA 4O0IA 3BGRA 3V1RA 4W5OA 3OS1A 3LAMA 5FDLA 3VQAA 4Q0BA 1ZBIA 3CFOA 3VQ4A 3LWLA 2DFFA 1TAUA 1K6YA 4IG3A 2PYLA 1REVA 3OYKA 3QIOA 1WSJA 2BGGA 3DOKA 3DMJA 3ZSXA 4OKEA 4TSXA 2Z1JA 4FJHA 4RW4A 4PUOA 1TVRA 3CM5A 3LP3A 3JSMA 2R7YA 1NOYA 2HNZA 4MFBA 3RMCA 3NAEA 3SNNA 4DU1A 2G8HA 2FBXA 3DM2A 4BACA 1WSEA 5HRSA 3OYDA 1ZBFA 1RTJA 3VQCA 1W0HA 2HHUA 1JLBA 1RDBA 3NFAA 4DTPA 2OPQA 1NKBA 3UIQA 4F2SA 3D0PA 1IO2A 2FBTA 2YNHA 1RT2A 3HVTA 4DLEA 4YFUA 5CYMA 1B92A 2G8WA 1LW0A 1Z25A 5KGWA 4Z4HA 4YNQA 3HJFA 3DRSA 4KPYA 2ITGA 4RG8A 4CESA 1FK9A 1S5JA 4LH4A 3WNFA 4I7FA 3ZSRA 2OYQA 4FVMA 1UWBA 2QKKA 3WNEA 4CJ5A 4CJ4A 3B6OA 3L2UA 4FJ8A 4C8NA 5HRPA 4M3XA 3THVA 1FKOA 3AVFA 3KIOA 4CFAA 4M42A 5J1EA 3ZSZA 1BI4A 4DSIA 4FK2A 4M3TA 1JL2A 3L3UA 4CGDA 3RR7A 1WSIA 4CJFA 3S3MA 2HHTA 4NYFA 3OYFA 3DLRA 3MXJA 3OJSA 3VN5A 1JLFA 4J2DA 4E7JA 2ETJA 4N76A 1TKXA 4GVMA 3KLEA 2VWKA 4H4OA 1LAWA 1KRPA 3SPYA 4QOZB 4OPKA 3NE6A 3AVIA 3KTQA 1KVCA 3I0RA 1X1PA 4PA1A 5HBMA 3KLGA 3PO4A 3G0ZA 4CJUA 2ATQA 4O44A 3HVRA 4KHQA 1HNIA 3RRGA 4BDZA 4BDPA 3NF8A 2PY5A 1J53A 1DLOA 4AHTA 3V6DA 3ULDA 1HQEA 4LSLA 1A5VA 2XHBA 3SUNA 3SUOA 4B9LA 2YNGA 3AVNA 3MEEA 3QEWA 5DMRA 3V9XA 4CERA 4KFBA 3TAEA 5J2PA 1L3VA 1YTAA 1RTIA 1TAQA 4BWJA 3OJUA 4JRPA 3VQDA 2JLEA 3HP6A 3HPGA 4H8KA 4BE1A 3SV3A 1NK4A 3NF7A 4CIFA 1CXQA 1HPZA 4HVJA 4DLGA 5FRNA 2KZMA 3ITHA 4FM2A 4E0DA 5FROA 4CEZA 4ID5A 1IKYA 1C0MA 1RT3A 3AVGA 3O4QA 2OA8A 4DTXA 3SQ4A 1QQCA 4LY7A 3HO1A 1BI4B 3LP2A 4DG1A 2D0AA 1BHLA 3H08A 3DLBA 4F8RA 4B9SA 2KFNA 1VSIA 3P83D 4Z0UA 1BIZA 4DS4A 4HUEA 3SI6A 4C8OA 3U6FA 1KCFA 3PO5A 1ASWA 1L5UA 4F4KA 4F2RA 3DRRA 3C94A 1S1XA 3SZ2A 1WAJA 2O4GA 1JL1A 4OJRA 1TK5A 1RNHA 1VRUA 4OGCA 4KRFA 4Z4FA 3OS0A 1U45A 4HCCA 2D0CA 2F96A 4CFBA 1UOCA 3KLHA 1RBTA 1EP4A 3PX6A 3T3FA 3TAQA 3M8QA 3OYIA 4BE0A 4NYNA 3LAKA 1NKCA 1VSHA 2X6NA 4W5TA 1SV5A 2E4LA 2ZQBA 2IDOA 3T1AA 4Q5VA 1G15A 3VQ6A 4CJTA 4W5RA 4C8KA 4DSLA 2XRIA 4AHSA 3HPOA 3NH1A 3HYFA 3OYJA 3QLHA 3MAQA 4HUFA 3P1GA 3M8RA 3P5JA 3O3GA 3TI0A 1QS4A 4DSFA 1LWEA 4CGGA 5KTQA 4FJMA 4DFKA 1KSPA 4CEBA 1BCMA 1ZBUA 4IG0A 3ISNC 4KO0A 4O5BA 1KFSA 1A5WA 2WOMA 2EHGA 4NCGA 1HQUA 4AHVA 1Q8IA 2DFEA 3AO5A 3QESA 1CZ9A 1S9EA 4K8XA 4DQIA 1IH7A 4IFYA 4WE1A 2RF2A 4CEAA 3BDPA 4KI6A 4PY5A 2HHSA 4JS4A 1U49A 1XWLA 1T7PA 4C8MA 4CJLA 4O0JA 4FW1A 4CIEA 5KRTA 1DTTA 3O3FA 4DF4A 1FKPA 2W42A 2Z1GA 3CFRA 1SKSA 4FM0A 3L3VA 3DLHA 5D3GA 4M3YA 4N47A 4Y1DA 3VQQA 4OKJA 4JS5A 4FM1A 2KFZA 4E1MA 1LW2A 4QAGA 4KHSA 3LPTA 1HRHA 4QCLA 2ZE2A 4EP4A 3AVCA 3RMAA 3WNHA 3OYEA 3CM6A 3C6TA 1F21A 4ID1A 2IC3A 4FJKA 3AVBA 2E6MA 4RW8A 4F3TA 3ZT0A 4DFPA 3AO4A 1RILA 4FJNA 3TAFA 3RTVA 4H4MA 4G1QA 1I3AA 5J2MA 3RR8A 1BISA 1LWFA 4CFDA 1BQMA 2P1JA 2Z1HA 4CEEA 4CK3A 4HHTA 4RW9A 4E7KA 1S1VA 1GOBA 3K5NA 4KHUA 3F9KA 3L2WA 5C25A 2D5RA 3V9UA 3KK3A 4AILC 2G8VA 4FLWA 4CCHA 4CGIA 4CK1A 4L8RB 4CEOA 3EY1A 3PV8A 1LWCA 3EZ5A 4IBNA 4J2AA 4KI4A 2GV9A 3WNGA 1GOCA 1NKEA 1QSSA 3HK2A 1D9FA 1NK8A 3QEIA 4FLXA 2QK9A 1TK0A 4M3ZA 3ZSWA 1X9WA 3NGZA 5KRSA 3L8BA 4DU4A 4DS5A 3AA5X 3TR8A 1RBUA 4KHNA 3DOLA 4BWMA 3S9HA 3TWHA 2F8SA 3G10A 2KQ2A 4CEDA 4IFVA 4ELUA 3KLIA 3AA4A 2IS3A 3VQ7A 2XY8A 3C95A 3QEXA 3MXIA 2JGUA 1D5AA 4I2QA 1KVAA 4FLUA 3VQ9A 4CJKA 1NJXA 4E19A 3K57A 3NH2A 4CJSA 5K14A 3OYCA 3CFPA 3TARA 1HNVA 5HRRA 2YHAA 4FXDA 1VSEA 3PUFA 3LWMA 1VK0A 1X9MA 4B9VA 4FJ9A 1VSLA 1WNSA 3L2RA 1HJRA 2BE2A 1HYVA 1NK5A 3AV9A 4OPJA 4KAZA 1RT1A 4FJ5A 3HSTB 4FK4A 2B5JA 1I39A 4N56A 3V81A 1N5YA 3SCXA 4Y1CA 4M45A 1TKTA 2AJQA 1U48A 4CF9A 3RWUA 2NUBA 4Z4CA 1S1WA 4CF8A 1TKDA 1EX4A 3D45A 1HMVA 4DU3A 4JRQA 4CECA 1JXEA 4KREA 1MU2A 4CGFA 4EP5A 4KB0A 1BCOA 1NOZA 3HL8A 4CK2A 3QEPA 4FLVA 4FJ7A 1XHZA 4J2EA 2FC0A 3MEDA 4GW6A 3AVKA 4FK0A 4DTMA 3SPZA 1U04A 4XIUA 4J2BA 1ZYQA 4K8ZA 3NH0A 3K58A 3SJJA 1WN7A 4AHUA 4CJWA 1C1BA 1TKZA 3TANA 1D8YA 1TK8A 3AO3A 4HCBA 2KZZA 4B08A 3DLEA 3VQPA 1L3TA 2Z1IA 4E7IA 2QKBA 2I5JA 3B6PA 5HLFA 4DSJA 4FZXC 1RT4A 1VRTA 3VA3A 4CF2A 4Z4GA 3ZT2A 3OYAA 3PY8A 3OYLA 1KLNA 2IAJA 4DTRA 4OLBA 3L2VA 3OYNA 4ELTA 4KTZA 2VG6A 5HROA 1NK7A 4FZZA 3KLFA 5KI6A 2RN2A 4PQUA 3NF9A 1HYSA 2XO7A 3AVJA 2HB5A 5C24A 1D9DA 4F3OA 2F8TA 4O4GA 1LAVA 1QSYA 3MECA 1QHTA 1KVBA 2OPSA 5SZTA 2HHQA 4OLAA 2A1SA 5C42A 4ELVA 2RKIA 4CHOA 1RTHA 3VQ8A 1IG9A 4DSEA 4FLYA 2HVHA 1T05A 3F73A 3V9ZA 3NBPA 3FFIA 1YVUA 1CXUA 3TAMA 3ZSQA 1JKHA 4ZHRA 5KGXA 4N5SA 4UQGA 3I8DA 1UA1A 2OZMA 4FYDA 3LALA 4KV8A 2YKNA 3HT3A 1XHXA 1ASVA 4E7HA 4RW6A 4CJRA 3LPUA 4DTUA 3TAPA 3ZCMA 4LD0A 4NCAA 4DF8A 1SUQA 3QINA 2VG5A 3ZT1A 4CEQA 1IKVA 4CHZA 4CHPA 4CJVA 4BE2A 4DSKA 1O1WA 3AA2A 4DTJA 3SUQA 1WSFA 4BDYA 4E7LA 4FCYA 1VSJA 4E89A 3EYZA 1QTMA 5FRMA 1RT7A 1VSDA 2XY6A 2B4JA 4CHQA 1RBRA 2HNDA 5J2QA 4E3SA 3SYZA 3NGYA 4CEFA 1RDDA 3HM9A 3V9WA 1BIUA 3K59A 4DTNA 4Z4EA 1BQNA 4OGEA 2Y1IA 5T7BA 4CJPA 1EETA 1WSGA 1YT3A 1U4BA 1ZBHA 2E6LA 4I9LA 4AH9A 4C8LA 1TL1A 3RRHA 4LSNA 1VSFA 5HRNA 3OY9A 3QO9A 4KB1A 1W9HA 1RBVA 3T19A 3NGIA 3QEVA 1HYZA 1QSLA 3ZSVA 3LZIA 4KTWA 5CY4A 3V9SA 4DQRA 3PX0A 3CYMA 2XY5A 1SKWA 2HHVA
chains in the Genus database with same CATH superfamily
3LDSA 1YIJN 3O4NA 5E41A 2E20A 4JKDA 1CZBA 3M8PA 3U3GA 4C1NK 2Q3SA 3RMDA 4OPAA 4M41A 3V1QA 3SQ0A 3K5LA 3L2QA 2HOEA 4JN4A 3HP9A 2G8KA 5DK5A 2YNFA 4B3OA 4IEEA 4BRGA 4IKFA 3BP8A 4FWKA 3PX4A 3D2EB 1TL3A 2NRHA 1WSHA 3CCVN 1QE1A 4CJQA 1BGXT 4YOXA 5BRDA 2QXFA 1B9FA 3U9ZA 4NCBA 3FR0A 2VGMA 3QNOA 2HHWA 4B9TA 3AO2A 1C1CA 3PSIA 1XC9A 1JLGA 4KKOA 3UKRB 4BC2A 1IKWA 4IDHA 3AY9A 3DXMB 1GLBG 3SBGA 1B9DA 3ULEB 3V1OA 2D1KA 1DKGD 4JYAK 1JCGA 3LP1A 4CZEA 4CZJA 4LF6K 4H0OA 3DI6A 4MLHA 2W6LA 2OPPA 1EKEA 4EFHA 1NJZA 1HNWK 3THXB 4FJXA 2ZF5O 4NLCA 3IRXA 3VQEA 3ZSYA 4CZLA 3U3YA 1MDUB 4KHWA 1HPMA 1IBKK 3EO3A 3SMPA 2OZSA 1NGHA 3VGKA 4YOTA 3O1WA 2D0PA 3QFPA 2X74A 3VEVA 1Q9XA 3BEXA 3LDOA 2VWJA 3THYA 3OS2A 1WAFA 4AHCA 1NJIO 5C0YA 2KTQA 2LSNA 4GV9A 3C6UA 2GTDA 2YV0X 1RBSA 5GIOA 5HP1A 4O55A 1J54A 3KKSA 4DTOA 3ZT4A 4I2PA 1RT5A 4DQPA 3DRPA 3NF6A 1JLAA 4AM7A 4ISFA 4BR0A 3BF1A 1LV5A 3TABA 4FJJA 1XC3A 3C65A 3DLGA 1NGAA 5BPNA 1N6QA 1OH7A 4IWVA 4MDAA 3KKRA 3MCPA 5CR4A 2GWKA 2E88A 3V1RA 3HTVA 4AF1A 1REVA 1TUYA 3QIOA 3DMJA 3O9UA 4OKEA 4TSXA 3CM5A 3NAEA 3SNNA 4XH4A 1ZXOA 5HRSA 1RTJA 4IJAA 4B1XB 1RDBA 1SQKA 5AQKA 2OPQA 2FBTA 5LL6Z 4JI6K 1NGCA 5C2FA 4DLEA 3A0IX 5CYMA 4RG8A 3VENA 3R1XA 4G9ZA 3LDLA 4FVMA 1UWBA 2QKKA 4M3XA 4JKAA 1GLFO 1OH6A 1WB9A 3ENHA 4M42A 5J1EA 1BI4A 4M3TA 4CGDA 3RR7A 3MDQA 4NYFA 3OYFA 3P31A 2PAVA 3CMAN 2ETJA 1OH8A 4H0PA 4BRNA 4GVMA 2VWKA 3T1YK 2F4VK 3CCQN 5AQNA 2VGNA 3I0RA 4PA1A 3KLGA 5I9EB 4DV0K 3G0ZA 2E2PA 4CJUA 5A2QO 2ATQA 2Q0UA 4O44A 1HNIA 4BDZA 2KLAA 3NF8A 4O5FA 3ULDA 2YNGA 3AVNA 2FSNA 2FXUA 2GWJA 1VQ9N 4BWJA 1TAQA 4JRPA 3VQDA 4H8KA 3ZETB 1CXQA 5FRNA 2KZMA 4DLGA 1YI2N 3THWA 4E0DA 4ID5A 1C0MA 4DTXA 3SQ4A 1YUWA 3CQXA 3DLBA 1BHLA 3H08A 3I8BA 4A5BA 2ZM6K 3P83D 4Z0UA 3VEYA 3JAMO 3D2FB 3U6FA 1KCFA 1L5UA 2PFUA 3C94A 2P9SA 3SAHA 4JKFA 2O4GA 4OJRA 1VRUA 3OS0A 4HCCA 3GG4A 4CD3A 4IFEA 3PX6A 3TAQA 3M8QA 4NYNA 1NKCA 2X6NA 2WC9A 2ZQBA 4Q5VA 4AHSA 4BC4A 4HUFA 3P1GA 1TUUA 3P5JA 3TI0A 3U8XA 1QZ6A 3HM8A 3ZYYX 1HQUA 1Q8IA 4IZ9A 1TYQB 1CZ9A 5AQJA 3IMXA 2HHSA 5M1QA 1XWLA 1T7PA 4FW1A 4CIEA 4KRFA 1DTTA 4RCHA 1ATNA 4N47A 4OKJA 2FF6A 4QAGA 3LPTA 3RMAA 3D7EO 3CM6A 4OPHA 5BRHA 3WT0A 4F3TA 3ZT0A 3R6MA 3PIOL 3TAFA 4H4MA 4FVUA 1I3AA 4CK3A 1N33K 4GV6A 2Z1HA 4RW9A 4YOYA 3F9KA 3L2WA 2YHWA 4CK1A 4C23A 3EZ5A 4JKCA 1NKEA 3HK2A 1O13A 1D9FA 4CZMA 1NK8A 2QK9A 4O8KA 4ISEA 3ZSWA 3NGZA 5KRSA 4DS5A 2Q2RA 4JI2K 3AA5X 3DOLA 2F8SA 3ENBA 3TWHA 1V4TA 1S3XA 3S9HA 2O8DA 3HOSA 2IS3A 3K9KA 3VQ7A 4ILJA 3QEXA 2JGUA 4FLUA 1Q86O 3NH2A 3CFPA 5K14A 1NG9A 2BUPA 2ZWHA 1VSEA 2BE2A 1HYVA 4KAZA 4OPJA 3HSTB 3O1BA 4JI0K 3TTCA 3O9RA 1TKTA 1IJJA 2QWQA 3WQTA 4DR2K 2VYPA 4KH6A 1GLAG 4CF8A 4V19S 1S22A 4DR4K 4JD2B 4KB0A 4JKGA 4CK2A 3BZCA 1BUPA 5MLCQ 3TSUA 4GW6A 1BDGA 2Q36A 3OBYA 3SPZA 4PKIA 4J2BA 4K8ZA 3IDHA 1WN7A 4AHUA 2KZZA 1D8YA 1CZAN 4HCBA 4A61A 3L0QA 4QS8A 5AQZA 2QKBA 1VQ5N 3HZ6A 1Q18A 3DXKB 5HLFA 4GNIA 1RT4A 1VRTA 5E26A 4DR5K 4CF2A 3ZT2A 3OYAA 3LM9A 3TSQA 5GAHP 3OYNA 4ELTA 2Q1NA 4LFBK 1D9DA 5C24A 4O4GA 3VPZA 2OPSA 1NM1A 3BY5A 4U7BA 4IO9L 2W41A 2RKIA 3SJHA 3VQ8A 1IG9A 4DSEA 1E4GT 3MN6A 1T05A 5CE3A 3NBPA 3TAMA 1YVUA 3ZSQA 2XY5A 4FYDA 1JKHA 5KGXA 4YDUC 4N5SA 4UQGA 2VQEK 4KH5A 4IJNA 3KWIA 3QFUA 3O9QA 2IVPA 3FZHA 1ASVA 3G71N 4CJRA 3TAPA 4NCAA 4DF8A 2CGLA 2ZJQL 4CHZA 3WXMB 4I6MA 5AQOA 1WSFA 4FO0A 5JVGL 4BDYA 3MN7A 1VSDA 4A5AA 2HNDA 5J2QA 3AGRA 3SYZA 3NGYA 2HBKA 3PLAA 4WQ5A 4DTNA 3HI0A 1BQNA 4OGEA 2Y1IA 3O9SA 2O8FB 1WSGA 2QW9A 3MK6A 4C8LA 3CC4N 1BO5O 3CJCA 1VSFA 3OHRA 2E5LK 1Z6RA 3QO9A 4KB1A 1HYZA 3LZIA 3FZLA 4KTWA 3V9SA 4DQRA 3PX0A 5M1PA 1XMOK 3H1VX 4WF9L 4FLTA 3OW2M 3MX5A 2O8BA 4BRIA 4BRKA 1ZBLA 3E66A 3CCJN 1S1UA 1IKXA 3K2PA 4BY9C 3LP0A 1L3UA 3FLCO 1KAYA 3DYAA 4ILHA 4N41A 1YHQN 2DY4A 5I42A 3TPQA 3MEGA 1C1AA 4CE9A 1Q9YA 5M1FA 2QEXN 2UU9K 2HMPA 3ZT3A 1X9SA 3KJVA 3CCEN 3SAFA 4CGJA 3FE1A 3CCLN 4IO8A 3O4WA 3IAYA 3AVHA 4EZ9A 1JLEA 5BPMA 1YXQA 3HRGA 5F0XA 1S6PA 3VQBA 1QVGM 2O8CB 3ALYA 1XI1A 3AVAA 1NBWA 3VF2A 4DQQA 4B1ZA 4DQ8A 3NHGA 4CZGA 1KFDA 3OTOK 3O3HA 3KK7A 3KD1E 4BGBA 1A5XA 2HSTA 4KHYA 4H5WA 4XEIA 5FPDA 3GOIA 5AQRA 1NGFA 1SKRA 5AQTA 3OVNA 3JYTA 1RTDA 3A5OC 2G8UA 3CERA 4B8AB 1NJYA 4I9QA 2HBMA 3QBXA 3NDKA 5AZJA 1Y97A 4B9QA 2FBYA 4OO1J 3AA3A 3OYHA 3J8AA 4CZIA 4HUGA 4DTSA 1BA1A 1SL2A 1C0TA 3L6QA 1YJWN 3VEXA 4FJGA 1KTQA 1YVNA 1J9AA 5BR9A 3S3OA 4W5QA 2ZGYA 2HVIA 3HOTA 4KTQA 3OA9A 4CHYA 4CJ3A 2YKMA 4R5PA 4M3WA 1W97L 5E84A 4FSVA 2YNIA 1ILYA 4IDKA 4B3RK 1GOAA 1CLQA 2P5GA 4FPBA 4LH5A 5JS2A 5I3UA 1JXBA 3SV4A 4PWDA 3U4LA 3VEZA 4JEPA 3IUCA 4JI4K 3BGRA 3LAMA 1ZBIA 2DFFA 1Q7YO 4BG9A 1TAUA 4YOUA 2PYLA 3OYKA 4JI8K 3DOKA 3ZSXA 2ZJRL 3CXCM 2J4RA 1TVRA 3LP3A 4HWIA 3VTIA 2HNZA 2FBXA 3DM2A 4BACA 1DT9A 3WXLA 3OYDA 3VQCA 3THYB 2HHUA 1JLBA 3NFAA 3UIQA 3WXKA 3TSPA 3D0PA 1IO2A 1FJGK 4B3MK 3M3ZA 2YNHA 4GKJK 3IFRA 4YFUA 1LW0A 4Z4HA 3HJFA 5BREA 4YNQA 2GEMA 1T3VA 2NRZA 4DR3K 1FK9A 1GLJO 4YOWA 4QS9A 5AQMA 4X62K 4C8NA 3THVA 1FKOA 2ASPA 3AVFA 1JCEA 3ZSZA 4FK2A 1WSIA 1VQ8N 1FW6A 3S3MA 2HHTA 3AARA 2VWBA 3OJSA 3A5MC 1JLFA 4N76A 2OTJN 3CC7N 1TKXA 4BRAA 3KLEA 2IVOA 2WFBA 1LAWA 3M5RA 5FPNA 3T7ZA 3T1HK 3NE6A 3KTQA 4MO4A 3L4IA 3VESA 2CGJA 3HVRA 1R59O 1P90A 2I7PA 3CF5L 4JKHA 4AHTA 3V6DA 2HBLA 4LSLA 1A5VA 4DV7K 3SUNA 3TU5A 3MEEA 5DMRA 4CERA 4KFBA 5J2PA 1YTAA 1C0FA 4KBOA 3HPGA 1NGJA 3VEOA 4BQLA 3E9PA 4FM2A 3N4PA 4QCLA 2E2QA 5KQ8A 3AVGA 3O4QA 4LF4K 3LDNA 4LY7A 1Y64A 3HO1A 1BI4B 4DG1A 4F8RA 4CJ7A 4B9SA 4C8OA 4F9OA 4HUEA 3PO5A 3DRRA 3SZ2A 1S1XA 1WAJA 1TK5A 4K41A 4AQYK 4WFBL 2D0CA 3KLHA 3T3FA 4BE0A 2HF3A 2A3ZA 1SV5A 3G4SN 3T1AA 4CJTA 4C8KA 4W5RA 3HPOA 3VF6A 3CJ7A 4FWSA 1X3MA 4IXCA 4LF7K 4FJMA 1EQYA 4IG0A 5LMUK 3MWTA 2WTUA 2RF2A 1EWRA 4KI6A 4PY5A 3FZMA 1U49A 1WOQA 4PKGA 4C8MA 4BROA 3THWB 1QSSA 4BRFA 2W42A 2A41A 4FM0A 5D3GA 3CJ9A 1XQSC 3VQQA 4JS5A 4JKEA 4EP4A 3WNHA 4A62A 5KPRA 3OYEA 2P9SB 3C6TA 5AQVA 4ID1A 2IC3A 3AVBA 4RW8A 4Y0WA 3AO4A 1IBLK 5J2MA 4DCHA 3CIPA 5BR8K 4E7KA 4O8UA 2D5RA 3V9UA 2RE2A 4CGIA 4L8RB 4CEOA 3EY1A 1LWCA 4EAHD 4IBNA 3U9DA 4J2AA 1GOCA 4CVNE 5AQPA 1TK0A 4M3ZA 4GKKK 3WEEA 5AQSA 2XY8A 3MXIA 5AZIA 1NNEA 4JI3K 1D5AA 1NGIA 4E19A 3K57A 4CJSA 2KHOA 3CETA 3TARA 2YHAA 4FXDA 3PUFA 3LWMA 1VK0A 1X9MA 4FJ9A 1VSLA 4BRPA 3L2RA 1HJRA 3AV9A 1I39A 3V81A 3RSEA 4DV1K 2UUCK 1GLLO 5ADXH 3H45C 2V52B 4CF9A 2V7ZA 4Z4CA 1S1WA 4E1JA 3BF3A 1EX4A 1N34K 1HMVA 2YJFA 4JRQA 3TTDA 4CECA 2OTLN 1EO1A 4KREA 4EP5A 4DB3A 3QEPA 5JLFA 4FLVA 2NRVA 3MEDA 3J7ZO 1U04A 1T44A 4XIUA 3R3LA 5TKWA 3CCUN 3NH0A 4BRHA 1C0GA 3A8YA 3K9JA 4CJWA 3TANA 3NMUA 4JK7A 3DLEA 1QQMA 2O8DB 4IEIA 4DSJA 1X9JA 4FWOA 3WXJA 3PY8A 1KLNA 4KTZA 4BRCA 3P38A 1NK7A 3A5NC 4A57A 5KI6A 1HYSA 4PQUA 1NMNA 2XO7A 3AVJA 2HBJA 3MECA 4JKBA 4J8FA 5SZTA 4OLAA 5C42A 4ELVA 2NRTA 5CHIA 1TKDA 3RR8A 1CXUA 4ZHRA 1UA1A 3ZX2A 4JKGB 5C10A 4DKWA 3LALA 1WUAA 3KWGA 1NLVA 1VQLN 3A5LC 4RW6A 4H0XB 3ZT1A 4H5VA 1IKVA 3SUQA 4BG8A 4BVPA 2QWPA 1VSJA 3LL3A 4LFAK 4E89A 3EYZA 3K0SA 3GL1A 1QTMA 2B4JA 3PIPL 4PKHA 4CHQA 1RFQA 4E3SA 4Z4EA 2ASMA 4CJPA 1YT3A 5T7BA 1U4BA 2E6LA 4I9LA 1QZ5A 3SMSA 1TL1A 4LSNA 3O80A 3QICA 5EXWA 3MX2A 4Z94A 3T19A 4BR9A 4RWTA 4B9NA 3CYMA 3QINA 3VF4A 2HHVA 4KHPK 3ZLJA 2X78A 4YDUA 3VMFB 1SL0A 3DLLL 2XY7A 3QIPA 2ASOA 5AQFA 1ASUA 2FSKA 3AVLA 4DQSA 1KLMA 1BL3A 3C7NA 3R9PA 1VQKN 3VEWA 1T8EA 1K73O 4I6MB 1U2VA 1YTUA 1YF5L 1OVYA 1GLDG 4GMJB 5CZ1A 5CYQA 2Y1JA 2QWMA 4WFAL 3IG1A 3SUPA 2DFHA 3J80O 2NRXA 2BANA 3GDQA 4BQZA 3AVMA 3LANA 3N4QA 2IGIA 3I0SA 3VERA 3SQ2A 1JCFA 4BR5A 2F9TA 1KQSM 3A2FA 4CW7B 1TGOA 3EE8A 1NWKA 3HBTA 4YORA 2DTUA 1NMDA 4RW7A 3PSFA 1BU6O 2O8BB 1XMQK 3LZJA 4B1YB 1RDCA 3DWLA 1C6VA 4RTFD 4X66K 3I55N 1SZ2A 1BA0A 4KH4A 2KW4A 3S3NA 3CJ1A 5AQLA 3ASMA 2G8IA 3C6HA 3KK2A 1J5EK 1T03A 2P9IA 3SQ1A 4DV3K 3MXMA 4OVLA 3KK1A 1RCHA 1FXXA 1KAZA 2HMIA 4OKKA 4W5NA 3CMEN 1VQ7N 3HPHA 2PYJA 4DFMA 1QQNA 4JHDA 5GAEP 3KD5E 3QERA 3OBWA 4ZTFA 1NK9A 2P9PA 3J7YP 4CZKA 3EL2A 1RT6A 4B1UB 2H3GX 4FZYA 4Z4IA 2Q0RA 1VQ6N 3QETA 2IOCA 1WLJA 4JLHA 4CGHA 5EU7A 5JS1A 2PZSA 1U47A 1JLQA 4HTUA 4PL7A 3RMBA 4DV4K 4B8CA 2HW3A 3ID8A 2E1YA 3OYGA 1HNZK 2DPNA 5GADP 4NXMK 4FW2A 1U6ZA 5J2NA 3EZWA 2UUBK 2WBNA 3VGLA 2ZD1A 1X3NA 3Q7CA 2RPIA 4CJEA 3HXMA 3OYBA 1VSKA 1KAXA 2VG7A 5AZJB 3OS1A 5FDLA 3FZKA 1RDUA 3VQ4A 2EWSA 2P9NA 4CZHA 2CH5A 4IG3A 1MWKA 4FWRA 4JI5K 1VHXA 2HHHK 3FZFA 4FJHA 1NOYA 3JSMA 5DM6L 4MFBA 2QI2A 1ZBFA 5JVHL 1W0HA 3JS6A 1HX1A 5C2DA 1NKBA 4F2SA 3HVTA 4BRMA 1W2BM 1B92A 2G8WA 5HL7L 2IIRA 3DRSA 4KPYA 2QA4N 1YITN 1S5JA 3E9OA 4LH4A 1RGIA 4I7FA 2OYQA 1D4XA 4FJ8A 3L2UA 4CJ4A 1BWFO 2NNWA 5KPTA 1NGGA 2P9KA 3KIOA 4CFAA 3CCMN 4K42A 3L3UA 2P9UA 4CJFA 3DLRA 3MXJA 3VN5A 3UKUA 2YX6A 1G99A 3T69A 1KRPA 4EHTA 2Q97A 5HBMA 1X1PA 4FOEA 2O8EA 1WBBA 4KHQA 3RRGA 4PL8A 1HUXA 4FWPA 3M6GA 1J53A 1DLOA 2E1ZA 2GX9A 3TAEA 3OJUA 3F9MA 5BN9A 2ITMA 3NF7A 4CIFA 1WBDA 1HPZA 4HVJA 4EHUA 3ITHA 5LJWA 1J6ZA 4HTLA 5FROA 1IKYA 3FGUA 1K8AO 1QQCA 4K43A 2D0AA 1NGEA 1YJNN 4DS4A 3SI6A 3WUHA 1BG3A 4MO5A 4F4KA 3O5BA 3VOVA 1RNHA 4OGCA 1DEJA 4Z4FA 1U45A 5IT9O 3BZKA 2F96A 4CFBA 1UOCA 4WQ5C 1EP4A 4H5NA 3J7AP 4W5TA 3IKMA 3H3OB 4DV6K 2KKZA 2XRIA 2NRWA 3NH1A 3HYFA 3QLHA 3AAPA 5BPLA 3MAQA 4JI7K 3M8RA 4WQ4C 3O3GA 3MWPA 3G25A 1LWEA 3F2KA 4BVOA 4KO0A 3ISNC 1A5WA 2WOMA 2EHGA 3L4QA 1GLEG 4K8XA 1IH7A 4IFYA 4BRLA 3BDPA 4DUYK 1KXPA 2W6KA 5AFUH 1N36K 5IWAK 3O3FA 3DLHA 1FKPA 2Z1GA 1W7AA 4FL9A 1XNQK 4DUZK 2KFZA 3DAWA 3NVKA 2UXDK 3VETA 5GIPA 5BN8A 1F21A 2E6MA 4ILGB 1N32K 3O6WA 4FJNA 5M1NA 1HKBA 1BISA 1LWFA 3MMVA 1BQMA 4CEEA 4CFDA 5AFUA 4HHTA 1S1VA 3K5NA 4DR6K 5C25A 2G8VA 4H03B 3KK3A 4AILC 3QB0A 4FPAA 3PV8A 2GV9A 1QHAA 3QEIA 3DJCA 1KC8O 4DV5K 4ISGA 3CPEA 3L8BA 4IOAL 3CCRN 4FWNA 3TR8A 3CC2N 1RBUA 3G10A 2KQ2A 4CEDA 4IFVA 4ELUA 3B8AX 4JV5K 3ZEUA 3C95A 3H6EA 1NJXA 5AQUA 3G6EN 3WQUA 4CI6A 5HRRA 1VQ4N 1WNSA 1NK5A 4FJ5A 4FK4A 2B5JA 4N56A 3ZX0A 3SCXA 4Y1CA 3QBWA 2AJQA 3C6AA 3HSCA 3QDKA 2I7NA 1E4FT 3D45A 4DU3A 3LDQA 4IOXA 3J81O 1BCOA 1NOZA 3HL8A 4DR7K 2P9LA 4FJ7A 1XHZA 4J2EA 2FC0A 3AVKA 4FK0A 1VQON 4DTMA 1OKJA 1ZYQA 1RDWX 1JJ2M 3VTHA 3SAGA 3SJJA 1XUPO 1C1BA 4H5RA 1TK8A 3AO3A 1L3TA 2Z1IA 3QMLA 4NLBA 2I5JA 3B6PA 3WEEB 4CBWA 5AZIB 4Z4GA 4H0TB 3OYLA 4NO7A 4OLBA 3L2VA 3EE9A 3KLFA 4K25A 3NF9A 4H5TA 2HB5A 5LMNK 1QSYA 1K8KA 3RSEB 5ELZA 4CHOA 5AJ3K 1RTHA 4DR1K 4FLYA 3F73A 4C1NI 2JWKA 5DM7L 4CD1A 3ZCMA 2ZGZA 5AQWA 4LD0A 3M1FA 4CHPA 4CEQA 4CJVA 4BE2A 4NB4A 1O1WA 3EN9A 4DTJA 2CH6A 4LFCK 4E7LA 4R79A 5FRMA 2XY6A 5AQYA 2OANA 3D2EA 3W3DA 3HM9A 3SBTA 4AH9A 1VAZA 4BGAA 5EVZA 2QTDA 3OY9A 2V7YA 1W9HA 3QEVA 5EX5A 4BR7A 3CJBA 2F7TA 4M3UA 3UKRA 4LC9B 3SK3A 4CHNA 2A1RA 5JICA 1YAGA 1EXQA 1NJWA 3CI5A 3DXMA 1R0AA 2UUAK 2QWNA 2PBDA 4NXNK 3ULEA 5AQXA 2EX3A 4E1NA 3H3NO 1J5OA 4M7XA 1HKGA 2E8AA 4YY3K 3EKUA 4OX9K 2GUPA 5F2RA 2CGKA 4BRQA 2AP1A 3THXA 1VSMA 2GBZA 4B9MA 4FJIA 5AQHA 5H1SQ 3O9TA 3M8SA 3AO1A 4FLZA 1NK6A 2O4IA 5M1KA 4XH1A 1C0UA 1M90O 1BOTO 3CJAA 4FJLA 4YHHK 3K5OA 4B9UA 4WFNL 1S1TA 1T6DA 1H1VA 3K5MA 1VQNN 4U67L 2UXBK 1Z26A 2WONA 1DTQA 3UE5A 4BC3A 4CFCA 2P51A 5SWMA 2BTFA 4FWLA 3ZSOA 2GUIA 3Q7BA 1P8ZA 3OYMA 4DMNA 5C15A 5ADXA 4AHRA 4UY8O 4X64K 4EIAA 2AA4A 2P5OA 1QVFM 4ICLA 2HNYA 1JLCA 3LM2A 2YHBA 3C7NB 4DFJA 4A2AA 2X6SA 2FSJA 2A6AA 3DLKA 1U2VB 3V4IA 1Z05A 2HHXA 1UAXA 2RHKA 2W40A 4CF1A 4CIGA 3VQ5A 1Q81O 4MQ3A 2Q31A 1RDAA 3QNNA 2FF3B 4ZTJA 1UA0A 2BDPA 1Q82O 1LCUA 4YOVA 5B8HA 5JMVA 4DWIA 3NCIA 5GAGP 1L3SA 2ZJPL 3RVCA 2B6AA 3E01A 5M1OA 2G8FA 4M3RA 1S6QA 5F1XA 4CF0A 1I94K 1NK0A 1S9GA 3IS9A 1HJOA 2FBVA 3VA0A 3VGMA 4B3SK 3ATUA 2D0BA 1TV6A 3AAQA 3CG7A 4EZ6A 2YJEA 5CZ2A 5JLHA 3D6RA 3UB5A 2VCPA 4H0YB 3SLCA 1ITGA 1SL1A 3CQ8A 3TAGA 2OPRA 4QS7A 2P9IB 3GE1A 4A59A 4O0IA 4W5OA 3MCAB 3VQAA 4Q0BA 3CFOA 2IVNA 3LWLA 3EKSA 1K6YA 1WSJA 5TKYA 2BGGA 4PUOA 2Z1JA 3P39A 4RW4A 3CQYA 4JHDB 2R7YA 2YHYA 3RMCA 5AQIA 2P9PB 1ZC6A 3KVGA 4FOIA 4DU1A 2G8HA 1WSEA 5HOOA 1YJ9N 1ATSA 2YHXA 4AM6A 4DTPA 3TTFA 1RT2A 4IOCL 5KGWA 1Z25A 3F5TA 2ITGA 2UXCK 1XNRK 2A42A 4CESA 3WNFA 1VQPN 1SAZA 3ZETA 3ZSRA 3ZX3A 3C0BA 3WNEA 4CJ5A 3B6OA 5EY4A 5HRPA 4DSIA 1JL2A 4BREA 1GLCG 3D2FA 2NLXA 1IBMK 2P9NB 4J2DA 4E7JA 2NZTA 1VQMN 4H4OA 3CPWM 3P4IA 3SPYA 4M7YA 4QOZB 4OPKA 3MN5A 3AVIA 1KVCA 3PO4A 3ATVA 1E3MA 1M1KO 2V51B 4MDBA 2BH1A 4BDPA 2PY5A 1HQEA 2XHBA 3SUOA 4B9LA 3QEWA 1L3VA 1TYQA 4GV3A 1RTIA 5FLXO 3HP6A 2JLEA 3NVMA 2HF4A 4BE1A 3SV3A 1NK4A 4CEZA 1RT3A 2OA8A 2P9KB 1NU0A 2YCHA 1KD1O 3LP2A 2KFNA 2P9UB 1VSIA 1BIZA 1ASWA 4F2RA 4K0KK 4MLEA 2QWOA 1JL1A 3H46O 3UKUB 2FLOA 1RBTA 1HKCA 3OYIA 3LAKA 1VSHA 2E4LA 3FFKB 2IDOA 1G15A 3VQ6A 4DSLA 3OYJA 2O8EB 4JAXA 3CHWA 1QS4A 4DSFA 5KQDA 4CGGA 5KTQA 4DFKA 1KSPA 4CEBA 1BCMA 1ZBUA 1KFSA 1V4SA 4O5BA 4NCGA 1ZBSA 4AHVA 5AQGA 2DFEA 3AO5A 3QESA 1S9EA 4DQIA 4CEAA 4WE1A 2E2NA 5LY3A 3JXUA 4JS4A 4FWQA 2D0OA 4CJLA 1MWMA 4O0JA 5KRTA 1SKSA 4DF4A 5AQQA 4WYBA 3CFRA 3L3VA 3CCSN 4M3YA 4BRDA 4Y1DA 2A5XA 4FM1A 4E1MA 1LW2A 3WXIA 4KHSA 5AR0A 1HRHA 1IG8A 2ZE2A 3AVCA 4M63C 1HLUA 4FJKA 4DFPA 1SS6A 4LF8K 1NGBA 1RILA 3RTVA 4G1QA 3ENOA 5GINA 2P1JA 4DHYA 2UYTA 5C12A 3KHYA 1GOBA 3GBTA 4KHUA 4GVEA 4JD2A 4FLWA 4WQ4A 4CCHA 5EOYA 5KPZA 3R8EA 2WUSA 4KI4A 4JNEA 3WNGA 4DV2K 4FLXA 1NGDA 1X9WA 5LJVA 4DU4A 4KHNA 4BWMA 4BR4A 3DXKA 4B1VA 3KLIA 3AA4A 4CBXA 4CZFA 4PHTX 2JWLA 2VQFK 4I2QA 1KVAA 3I33A 5FPMA 3VQ9A 4CJKA 1K9MO 3OYCA 3KZBA 1HNVA 2A40A 4B9VA 4FWMA 5FPEA 1RT1A 1N5YA 1S72N 4M45A 3EEQA 4JK8A 2F9WA 4BR2A 1U48A 3H1QA 3RWUA 2NUBA 3I56N 2QXLA 1JXEA 1MU2A 4CGFA 1DGKN 4CBUA 2NRRA 2YI1A 3K58A 1N8RO 1TKZA 4B08A 1OVQA 3VQPA 4A2BA 4E7IA 3O8MA 4B3TK 3ZEUB 4FZXC 3VA3A 1IV0A 4XH5A 4X65K 2IAJA 4DTRA 3W0LA 2VG6A 5HROA 4FZZA 2O8FA 2RN2A 4F3OA 2F8TA 1LAVA 1QHTA 1KVBA 2HHQA 2A1SA 2HVHA 3S41A 1EWQA 1OH5A 3V9ZA 3FFIA 3V9XA 2OZMA 2QWRA 2GELA 3I8DA 3CD6N 2E2OA 2QWLA 3LDPA 2P9LB 3AGKA 2YKNA 4KV8A 2OCEA 3HT3A 1XHXA 2QM1A 4L3QA 1LOTB 4E7HA 3LPUA 4DTUA 4BC5A 4LF9K 1QQOA 4WCEL 1HNXK 1SUQA 2VG5A 4DSKA 2D4WA 3AA2A 4FCYA 3O08A 1RT7A 4JI1K 5BRFA 1ATRA 3ID6A 4GY2B 1RBRA 3MN9A 4CEFA 1RDDA 3V9WA 1BIUA 3E1YA 3K59A 1ESVA 1HR0K 4JK9A 1EETA 1ZBHA 3E9LA 3RRHA 1K8KB 2O8CA 5HRNA 1MA9B 1RBVA 4LF5K 3NGIA 1QSLA 3ZSVA 5CY4A 4B1WB 1T6CA 4H0VB 1SKWA 3BUZB
chains in the Genus database with same CATH topology
3LDSA 4CHNA 3O4NA 2A1RA 5E41A 4FLTA 2X78A 1CZBA 1EXQA 1NJWA 1R0AA 1SL0A 3M8PA 3U3GA 2XY7A 1ZBLA 2Q3SA 3QIPA 3RMDA 2EX3A 4E1NA 1S1UA 1IKXA 3K2PA 4M41A 3V1QA 3SQ0A 1J5OA 3K5LA 3L2QA 3LP0A 1ASUA 3AVLA 4DQSA 1L3UA 1KLMA 1BL3A 3DYAA 4N41A 3HP9A 2DY4A 2G8KA 5I42A 1T8EA 5DK5A 3MEGA 2YNFA 4B3OA 1C1AA 4CE9A 1Q9YA 4IKFA 3ZT3A 3PX4A 1X9SA 1YTUA 1VSMA 2GBZA 4GMJB 5CZ1A 5CYQA 3KJVA 2Y1JA 4B9MA 4FJIA 4CGJA 3M8SA 3AO1A 4FLZA 1NK6A 3IG1A 3SUPA 2O4IA 2DFHA 1TL3A 1C0UA 4FJLA 1WSHA 2BANA 1QE1A 3IAYA 4CJQA 1BGXT 3AVMA 3K5OA 3AVHA 3LANA 1JLEA 2IGIA 1S1TA 3I0SA 4B9UA 2QXFA 4EZ9A 1B9FA 4M3UA 4NCBA 3K5MA 3SQ2A 1S6PA 3VQBA 3QNOA 2HHWA 3ALYA 1XI1A 1Z26A 2WONA 3AVAA 4B9TA 1DTQA 4DQQA 3A2FA 1C1CA 1TGOA 3AO2A 3NHGA 1KFDA 1XC9A 4CFCA 1JLGA 4KKOA 3O3HA 3KD1E 2P51A 1IKWA 5SWMA 2DTUA 1A5XA 4RW7A 4KHYA 3ZSOA 2GUIA 3OYMA 4DMNA 3LZJA 1RDCA 4AHRA 1B9DA 1C6VA 1SKRA 3V1OA 3OVNA 3JYTA 2KW4A 1RTDA 3S3NA 4ICLA 2P5OA 3LP1A 2G8UA 2HNYA 1JLCA 4B8AB 1NJYA 4I9QA 2YHBA 3DI6A 4DFJA 2X6SA 3ASMA 2G8IA 2OPPA 1EKEA 3DLKA 3KK2A 1T03A 3SQ1A 3V4IA 1NJZA 2HHXA 1UAXA 4CF1A 3NDKA 3MXMA 4OVLA 4FJXA 1Y97A 3IRXA 3VQEA 3ZSYA 2FBYA 4CIGA 3KK1A 3U3YA 4B9NA 1RCHA 1FXXA 4MQ3A 3VQ5A 2HMIA 3AA3A 4OKKA 4KHWA 4W5NA 1RDAA 3QNNA 4ZTJA 1UA0A 2BDPA 3OYHA 3HPHA 4HUGA 4DFMA 2PYJA 4DWIA 4DTSA 1SL2A 1C0TA 2OZSA 3NCIA 1L3SA 4FJGA 1KTQA 2B6AA 2X74A 3QERA 4ZTFA 1NK9A 1J9AA 3E01A 1Q9XA 3KD5E 1RT6A 3S3OA 2VWJA 2G8FA 4FZYA 4Z4IA 4M3RA 1S6QA 4W5QA 3OS2A 4CF0A 1WAFA 2IOCA 1WLJA 3QETA 2HVIA 4AHCA 4JLHA 4CGHA 5EU7A 1NK0A 4KTQA 5JS1A 1S9GA 4CHYA 3IS9A 2PZSA 2LSNA 4CJ3A 2YKMA 4R5PA 1U47A 1JLQA 4M3WA 2KTQA 3C6UA 2FBVA 4HTUA 3VA0A 3RMBA 2YV0X 1RBSA 5HP1A 2YNIA 1J54A 4O55A 4B8CA 2D0BA 1TV6A 3CG7A 3KKSA 4DTOA 2HW3A 4EZ6A 3ZT4A 3OYGA 4I2PA 4IDKA 1GOAA 1RT5A 4DQPA 1CLQA 3DRPA 5CZ2A 3NF6A 1JLAA 2P5GA 4FW2A 4LH5A 5J2NA 5JS2A 5I3UA 1JXBA 3TABA 1LV5A 4FJJA 1ITGA 1SL1A 2ZD1A 3CQ8A 3DLGA 3TAGA 2OPRA 3SV4A 4PWDA 2RPIA 1N6QA 4CJEA 3HXMA 3OYBA 1VSKA 2VG7A 3KKRA 4O0IA 3BGRA 3V1RA 4W5OA 3OS1A 3LAMA 5FDLA 3VQAA 4Q0BA 1ZBIA 3CFOA 3VQ4A 3LWLA 2DFFA 1TAUA 1K6YA 4IG3A 2PYLA 1REVA 3OYKA 3QIOA 1WSJA 2BGGA 3DOKA 3DMJA 3ZSXA 4OKEA 4TSXA 2Z1JA 4FJHA 4RW4A 4PUOA 1TVRA 3CM5A 3LP3A 3JSMA 2R7YA 1NOYA 2HNZA 4MFBA 3RMCA 3NAEA 3SNNA 4DU1A 2G8HA 2FBXA 3DM2A 4BACA 1WSEA 5HRSA 3OYDA 1ZBFA 1RTJA 3VQCA 1W0HA 2HHUA 1JLBA 1RDBA 3NFAA 4DTPA 2OPQA 1NKBA 3UIQA 4F2SA 3D0PA 1IO2A 2FBTA 2YNHA 1RT2A 3HVTA 4DLEA 4YFUA 5CYMA 1B92A 2G8WA 1LW0A 1Z25A 5KGWA 4Z4HA 4YNQA 3HJFA 3DRSA 4KPYA 2ITGA 4RG8A 4CESA 1FK9A 1S5JA 4LH4A 3WNFA 4I7FA 3ZSRA 2OYQA 4FVMA 1UWBA 2QKKA 3WNEA 4CJ5A 4CJ4A 3B6OA 3L2UA 4FJ8A 4C8NA 5HRPA 4M3XA 3THVA 1FKOA 3AVFA 3KIOA 4CFAA 4M42A 5J1EA 3ZSZA 1BI4A 4DSIA 4FK2A 4M3TA 1JL2A 3L3UA 4CGDA 3RR7A 1WSIA 4CJFA 3S3MA 2HHTA 4NYFA 3OYFA 3DLRA 3MXJA 3OJSA 3VN5A 1JLFA 4J2DA 4E7JA 2ETJA 4N76A 1TKXA 4GVMA 3KLEA 2VWKA 4H4OA 1LAWA 1KRPA 3SPYA 4QOZB 4OPKA 3NE6A 3AVIA 3KTQA 1KVCA 3I0RA 1X1PA 4PA1A 5HBMA 3KLGA 3PO4A 3G0ZA 4CJUA 2ATQA 4O44A 3HVRA 4KHQA 1HNIA 3RRGA 4BDZA 4BDPA 3NF8A 2PY5A 1J53A 1DLOA 4AHTA 3V6DA 3ULDA 1HQEA 4LSLA 1A5VA 2XHBA 3SUNA 3SUOA 4B9LA 2YNGA 3AVNA 3MEEA 3QEWA 5DMRA 3V9XA 4CERA 4KFBA 3TAEA 5J2PA 1L3VA 1YTAA 1RTIA 1TAQA 4BWJA 3OJUA 4JRPA 3VQDA 2JLEA 3HP6A 3HPGA 4H8KA 4BE1A 3SV3A 1NK4A 3NF7A 4CIFA 1CXQA 1HPZA 4HVJA 4DLGA 5FRNA 2KZMA 3ITHA 4FM2A 4E0DA 5FROA 4CEZA 4ID5A 1IKYA 1C0MA 1RT3A 3AVGA 3O4QA 2OA8A 4DTXA 3SQ4A 1QQCA 4LY7A 3HO1A 1BI4B 3LP2A 4DG1A 2D0AA 1BHLA 3H08A 3DLBA 4F8RA 4B9SA 2KFNA 1VSIA 3P83D 4Z0UA 1BIZA 4DS4A 4HUEA 3SI6A 4C8OA 3U6FA 1KCFA 3PO5A 1ASWA 1L5UA 4F4KA 4F2RA 3DRRA 3C94A 1S1XA 3SZ2A 1WAJA 2O4GA 1JL1A 4OJRA 1TK5A 1RNHA 1VRUA 4OGCA 4KRFA 4Z4FA 3OS0A 1U45A 4HCCA 2D0CA 2F96A 4CFBA 1UOCA 3KLHA 1RBTA 1EP4A 3PX6A 3T3FA 3TAQA 3M8QA 3OYIA 4BE0A 4NYNA 3LAKA 1NKCA 1VSHA 2X6NA 4W5TA 1SV5A 2E4LA 2ZQBA 2IDOA 3T1AA 4Q5VA 1G15A 3VQ6A 4CJTA 4W5RA 4C8KA 4DSLA 2XRIA 4AHSA 3HPOA 3NH1A 3HYFA 3OYJA 3QLHA 3MAQA 4HUFA 3P1GA 3M8RA 3P5JA 3O3GA 3TI0A 1QS4A 4DSFA 1LWEA 4CGGA 5KTQA 4FJMA 4DFKA 1KSPA 4CEBA 1BCMA 1ZBUA 4IG0A 3ISNC 4KO0A 4O5BA 1KFSA 1A5WA 2WOMA 2EHGA 4NCGA 1HQUA 4AHVA 1Q8IA 2DFEA 3AO5A 3QESA 1CZ9A 1S9EA 4K8XA 4DQIA 1IH7A 4IFYA 4WE1A 2RF2A 4CEAA 3BDPA 4KI6A 4PY5A 2HHSA 4JS4A 1U49A 1XWLA 1T7PA 4C8MA 4CJLA 4O0JA 4FW1A 4CIEA 5KRTA 1DTTA 3O3FA 4DF4A 1FKPA 2W42A 2Z1GA 3CFRA 1SKSA 4FM0A 3L3VA 3DLHA 5D3GA 4M3YA 4N47A 4Y1DA 3VQQA 4OKJA 4JS5A 4FM1A 2KFZA 4E1MA 1LW2A 4QAGA 4KHSA 3LPTA 1HRHA 4QCLA 2ZE2A 4EP4A 3AVCA 3RMAA 3WNHA 3OYEA 3CM6A 3C6TA 1F21A 4ID1A 2IC3A 4FJKA 3AVBA 2E6MA 4RW8A 4F3TA 3ZT0A 4DFPA 3AO4A 1RILA 4FJNA 3TAFA 3RTVA 4H4MA 4G1QA 1I3AA 5J2MA 3RR8A 1BISA 1LWFA 4CFDA 1BQMA 2P1JA 2Z1HA 4CEEA 4CK3A 4HHTA 4RW9A 4E7KA 1S1VA 1GOBA 3K5NA 4KHUA 3F9KA 3L2WA 5C25A 2D5RA 3V9UA 3KK3A 4AILC 2G8VA 4FLWA 4CCHA 4CGIA 4CK1A 4L8RB 4CEOA 3EY1A 3PV8A 1LWCA 3EZ5A 4IBNA 4J2AA 4KI4A 2GV9A 3WNGA 1GOCA 1NKEA 1QSSA 3HK2A 1D9FA 1NK8A 3QEIA 4FLXA 2QK9A 1TK0A 4M3ZA 3ZSWA 1X9WA 3NGZA 5KRSA 3L8BA 4DU4A 4DS5A 3AA5X 3TR8A 1RBUA 4KHNA 3DOLA 4BWMA 3S9HA 3TWHA 2F8SA 3G10A 2KQ2A 4CEDA 4IFVA 4ELUA 3KLIA 3AA4A 2IS3A 3VQ7A 2XY8A 3C95A 3QEXA 3MXIA 2JGUA 1D5AA 4I2QA 1KVAA 4FLUA 3VQ9A 4CJKA 1NJXA 4E19A 3K57A 3NH2A 4CJSA 5K14A 3OYCA 3CFPA 3TARA 1HNVA 5HRRA 2YHAA 4FXDA 1VSEA 3PUFA 3LWMA 1VK0A 1X9MA 4B9VA 4FJ9A 1VSLA 1WNSA 3L2RA 1HJRA 2BE2A 1HYVA 1NK5A 3AV9A 4OPJA 4KAZA 1RT1A 4FJ5A 3HSTB 4FK4A 2B5JA 1I39A 4N56A 3V81A 1N5YA 3SCXA 4Y1CA 4M45A 1TKTA 2AJQA 1U48A 4CF9A 3RWUA 2NUBA 4Z4CA 1S1WA 4CF8A 1TKDA 1EX4A 3D45A 1HMVA 4DU3A 4JRQA 4CECA 1JXEA 4KREA 1MU2A 4CGFA 4EP5A 4KB0A 1BCOA 1NOZA 3HL8A 4CK2A 3QEPA 4FLVA 4FJ7A 1XHZA 4J2EA 2FC0A 3MEDA 4GW6A 3AVKA 4FK0A 4DTMA 3SPZA 1U04A 4XIUA 4J2BA 1ZYQA 4K8ZA 3NH0A 3K58A 3SJJA 1WN7A 4AHUA 4CJWA 1C1BA 1TKZA 3TANA 1D8YA 1TK8A 3AO3A 4HCBA 2KZZA 4B08A 3DLEA 3VQPA 1L3TA 2Z1IA 4E7IA 2QKBA 2I5JA 3B6PA 5HLFA 4DSJA 4FZXC 1RT4A 1VRTA 3VA3A 4CF2A 4Z4GA 3ZT2A 3OYAA 3PY8A 3OYLA 1KLNA 2IAJA 4DTRA 4OLBA 3L2VA 3OYNA 4ELTA 4KTZA 2VG6A 5HROA 1NK7A 4FZZA 3KLFA 5KI6A 2RN2A 4PQUA 3NF9A 1HYSA 2XO7A 3AVJA 2HB5A 5C24A 1D9DA 4F3OA 2F8TA 4O4GA 1LAVA 1QSYA 3MECA 1QHTA 1KVBA 2OPSA 5SZTA 2HHQA 4OLAA 2A1SA 5C42A 4ELVA 2RKIA 4CHOA 1RTHA 3VQ8A 1IG9A 4DSEA 4FLYA 2HVHA 1T05A 3F73A 3V9ZA 3NBPA 3FFIA 1YVUA 1CXUA 3TAMA 3ZSQA 1JKHA 4ZHRA 5KGXA 4N5SA 4UQGA 3I8DA 1UA1A 2OZMA 4FYDA 3LALA 4KV8A 2YKNA 3HT3A 1XHXA 1ASVA 4E7HA 4RW6A 4CJRA 3LPUA 4DTUA 3TAPA 3ZCMA 4LD0A 4NCAA 4DF8A 1SUQA 3QINA 2VG5A 3ZT1A 4CEQA 1IKVA 4CHZA 4CHPA 4CJVA 4BE2A 4DSKA 1O1WA 3AA2A 4DTJA 3SUQA 1WSFA 4BDYA 4E7LA 4FCYA 1VSJA 4E89A 3EYZA 1QTMA 5FRMA 1RT7A 1VSDA 2XY6A 2B4JA 4CHQA 1RBRA 2HNDA 5J2QA 4E3SA 3SYZA 3NGYA 4CEFA 1RDDA 3HM9A 3V9WA 1BIUA 3K59A 4DTNA 4Z4EA 1BQNA 4OGEA 2Y1IA 5T7BA 4CJPA 1EETA 1WSGA 1YT3A 1U4BA 1ZBHA 2E6LA 4I9LA 4AH9A 4C8LA 1TL1A 3RRHA 4LSNA 1VSFA 5HRNA 3OY9A 3QO9A 4KB1A 1W9HA 1RBVA 3T19A 3NGIA 3QEVA 1HYZA 1QSLA 3ZSVA 3LZIA 4KTWA 5CY4A 3V9SA 4DQRA 3PX0A 3CYMA 2XY5A 1SKWA 2HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDS A;  4CHN A;  3O4N A;  2A1R A;  5E41 A;  4FLT A;  2X78 A;  1CZB A;  1EXQ A;  1NJW A;  1R0A A;  1SL0 A;  3M8P A;  3U3G A;  2XY7 A;  1ZBL A;  2Q3S A;  3QIP A;  3RMD A;  2EX3 A;  4E1N A;  1S1U A;  1IKX A;  3K2P A;  4M41 A;  3V1Q A;  3SQ0 A;  1J5O A;  3K5L A;  3L2Q A;  3LP0 A;  1ASU A;  3AVL A;  4DQS A;  1L3U A;  1KLM A;  1BL3 A;  3DYA A;  4N41 A;  3HP9 A;  2DY4 A;  2G8K A;  5I42 A;  1T8E A;  5DK5 A;  3MEG A;  2YNF A;  4B3O A;  1C1A A;  4CE9 A;  1Q9Y A;  4IKF A;  3ZT3 A;  3PX4 A;  1X9S A;  1YTU A;  1VSM A;  2GBZ A;  4GMJ B;  5CZ1 A;  5CYQ A;  3KJV A;  2Y1J A;  4B9M A;  4FJI A;  4CGJ A;  3M8S A;  3AO1 A;  4FLZ A;  1NK6 A;  3IG1 A;  3SUP A;  2O4I A;  2DFH A;  1TL3 A;  1C0U A;  4FJL A;  1WSH A;  2BAN A;  1QE1 A;  3IAY A;  4CJQ A;  1BGX T;  3AVM A;  3K5O A;  3AVH A;  3LAN A;  1JLE A;  2IGI A;  1S1T A;  3I0S A;  4B9U A;  2QXF A;  4EZ9 A;  1B9F A;  4M3U A;  4NCB A;  3K5M A;  3SQ2 A;  1S6P A;  3VQB A;  3QNO A;  2HHW A;  3ALY A;  1XI1 A;  1Z26 A;  2WON A;  3AVA A;  4B9T A;  1DTQ A;  4DQQ A;  3A2F A;  1C1C A;  1TGO A;  3AO2 A;  3NHG A;  1KFD A;  1XC9 A;  4CFC A;  1JLG A;  4KKO A;  3O3H A;  3KD1 E;  2P51 A;  1IKW A;  5SWM A;  2DTU A;  1A5X A;  4RW7 A;  4KHY A;  3ZSO A;  2GUI A;  3OYM A;  4DMN A;  3LZJ A;  1RDC A;  4AHR A;  1B9D A;  1C6V A;  1SKR A;  3V1O A;  3OVN A;  3JYT A;  2KW4 A;  1RTD A;  3S3N A;  4ICL A;  2P5O A;  3LP1 A;  2G8U A;  2HNY A;  1JLC A;  4B8A B;  1NJY A;  4I9Q A;  2YHB A;  3DI6 A;  4DFJ A;  2X6S A;  3ASM A;  2G8I A;  2OPP A;  1EKE A;  3DLK A;  3KK2 A;  1T03 A;  3SQ1 A;  3V4I A;  1NJZ A;  2HHX A;  1UAX A;  4CF1 A;  3NDK A;  3MXM A;  4OVL A;  4FJX A;  1Y97 A;  3IRX A;  3VQE A;  3ZSY A;  2FBY A;  4CIG A;  3KK1 A;  3U3Y A;  4B9N A;  1RCH A;  1FXX A;  4MQ3 A;  3VQ5 A;  2HMI A;  3AA3 A;  4OKK A;  4KHW A;  4W5N A;  1RDA A;  3QNN A;  4ZTJ A;  1UA0 A;  2BDP A;  3OYH A;  3HPH A;  4HUG A;  4DFM A;  2PYJ A;  4DWI A;  4DTS A;  1SL2 A;  1C0T A;  2OZS A;  3NCI A;  1L3S A;  4FJG A;  1KTQ A;  2B6A A;  2X74 A;  3QER A;  4ZTF A;  1NK9 A;  1J9A A;  3E01 A;  1Q9X A;  3KD5 E;  1RT6 A;  3S3O A;  2VWJ A;  2G8F A;  4FZY A;  4Z4I A;  4M3R A;  1S6Q A;  4W5Q A;  3OS2 A;  4CF0 A;  1WAF A;  2IOC A;  1WLJ A;  3QET A;  2HVI A;  4AHC A;  4JLH A;  4CGH A;  5EU7 A;  1NK0 A;  4KTQ A;  5JS1 A;  1S9G A;  4CHY A;  3IS9 A;  2PZS A;  2LSN A;  4CJ3 A;  2YKM A;  4R5P A;  1U47 A;  1JLQ A;  4M3W A;  2KTQ A;  3C6U A;  2FBV A;  4HTU A;  3VA0 A;  3RMB A;  2YV0 X;  1RBS A;  5HP1 A;  2YNI A;  1J54 A;  4O55 A;  4B8C A;  2D0B A;  1TV6 A;  3CG7 A;  3KKS A;  4DTO A;  2HW3 A;  4EZ6 A;  3ZT4 A;  3OYG A;  4I2P A;  4IDK A;  1GOA A;  1RT5 A;  4DQP A;  1CLQ A;  3DRP A;  5CZ2 A;  3NF6 A;  1JLA A;  2P5G A;  4FW2 A;  4LH5 A;  5J2N A;  5JS2 A;  5I3U A;  1JXB A;  3TAB A;  1LV5 A;  4FJJ A;  1ITG A;  1SL1 A;  2ZD1 A;  3CQ8 A;  3DLG A;  3TAG A;  2OPR A;  3SV4 A;  4PWD A;  2RPI A;  1N6Q A;  4CJE A;  3HXM A;  3OYB A;  1VSK A;  2VG7 A;  3KKR A;  4O0I A;  3BGR A;  3V1R A;  4W5O A;  3OS1 A;  3LAM A;  5FDL A;  3VQA A;  4Q0B A;  1ZBI A;  3CFO A;  3VQ4 A;  3LWL A;  2DFF A;  1TAU A;  1K6Y A;  4IG3 A;  2PYL A;  1REV A;  3OYK A;  3QIO A;  1WSJ A;  2BGG A;  3DOK A;  3DMJ A;  3ZSX A;  4OKE A;  4TSX A;  2Z1J A;  4FJH A;  4RW4 A;  4PUO A;  1TVR A;  3CM5 A;  3LP3 A;  3JSM A;  2R7Y A;  1NOY A;  2HNZ A;  4MFB A;  3RMC A;  3NAE A;  3SNN A;  4DU1 A;  2G8H A;  2FBX A;  3DM2 A;  4BAC A;  1WSE A;  5HRS A;  3OYD A;  1ZBF A;  1RTJ A;  3VQC A;  1W0H A;  2HHU A;  1JLB A;  1RDB A;  3NFA A;  4DTP A;  2OPQ A;  1NKB A;  3UIQ A;  4F2S A;  3D0P A;  1IO2 A;  2FBT A;  2YNH A;  1RT2 A;  3HVT A;  4DLE A;  4YFU A;  5CYM A;  1B92 A;  2G8W A;  1LW0 A;  1Z25 A;  5KGW A;  4Z4H A;  4YNQ A;  3HJF A;  3DRS A;  4KPY A;  2ITG A;  4RG8 A;  4CES A;  1FK9 A;  1S5J A;  4LH4 A;  3WNF A;  4I7F A;  3ZSR A;  2OYQ A;  4FVM A;  1UWB A;  2QKK A;  3WNE A;  4CJ5 A;  4CJ4 A;  3B6O A;  3L2U A;  4FJ8 A;  4C8N A;  5HRP A;  4M3X A;  3THV A;  1FKO A;  3AVF A;  3KIO A;  4CFA A;  4M42 A;  5J1E A;  3ZSZ A;  1BI4 A;  4DSI A;  4FK2 A;  4M3T A;  1JL2 A;  3L3U A;  4CGD A;  3RR7 A;  1WSI A;  4CJF A;  3S3M A;  2HHT A;  4NYF A;  3OYF A;  3DLR A;  3MXJ A;  3OJS A;  3VN5 A;  1JLF A;  4J2D A;  4E7J A;  2ETJ A;  4N76 A;  1TKX A;  4GVM A;  3KLE A;  2VWK A;  4H4O A;  1LAW A;  1KRP A;  3SPY A;  4QOZ B;  4OPK A;  3NE6 A;  3AVI A;  3KTQ A;  1KVC A;  3I0R A;  1X1P A;  4PA1 A;  5HBM A;  3KLG A;  3PO4 A;  3G0Z A;  4CJU A;  2ATQ A;  4O44 A;  3HVR A;  4KHQ A;  1HNI A;  3RRG A;  4BDZ A;  4BDP A;  3NF8 A;  2PY5 A;  1J53 A;  1DLO A;  4AHT A;  3V6D A;  3ULD A;  1HQE A;  4LSL A;  1A5V A;  2XHB A;  3SUN A;  3SUO A;  4B9L A;  2YNG A;  3AVN A;  3MEE A;  3QEW A;  5DMR A;  3V9X A;  4CER A;  4KFB A;  3TAE A;  5J2P A;  1L3V A;  1YTA A;  1RTI A;  1TAQ A;  4BWJ A;  3OJU A;  4JRP A;  3VQD A;  2JLE A;  3HP6 A;  3HPG A;  4H8K A;  4BE1 A;  3SV3 A;  1NK4 A;  3NF7 A;  4CIF A;  1CXQ A;  1HPZ A;  4HVJ A;  4DLG A;  5FRN A;  2KZM A;  3ITH A;  4FM2 A;  4E0D A;  5FRO A;  4CEZ A;  4ID5 A;  1IKY A;  1C0M A;  1RT3 A;  3AVG A;  3O4Q A;  2OA8 A;  4DTX A;  3SQ4 A;  1QQC A;  4LY7 A;  3HO1 A;  1BI4 B;  3LP2 A;  4DG1 A;  2D0A A;  1BHL A;  3H08 A;  3DLB A;  4F8R A;  4B9S A;  2KFN A;  1VSI A;  3P83 D;  4Z0U A;  1BIZ A;  4DS4 A;  4HUE A;  3SI6 A;  4C8O A;  3U6F A;  1KCF A;  3PO5 A;  1ASW A;  1L5U A;  4F4K A;  4F2R A;  3DRR A;  3C94 A;  1S1X A;  3SZ2 A;  1WAJ A;  2O4G A;  1JL1 A;  4OJR A;  1TK5 A;  1RNH A;  1VRU A;  4OGC A;  4KRF A;  4Z4F A;  3OS0 A;  1U45 A;  4HCC A;  2D0C A;  2F96 A;  4CFB A;  1UOC A;  3KLH A;  1RBT A;  1EP4 A;  3PX6 A;  3T3F A;  3TAQ A;  3M8Q A;  3OYI A;  4BE0 A;  4NYN A;  3LAK A;  1NKC A;  1VSH A;  2X6N A;  4W5T A;  1SV5 A;  2E4L A;  2ZQB A;  2IDO A;  3T1A A;  4Q5V A;  1G15 A;  3VQ6 A;  4CJT A;  4W5R A;  4C8K A;  4DSL A;  2XRI A;  4AHS A;  3HPO A;  3NH1 A;  3HYF A;  3OYJ A;  3QLH A;  3MAQ A;  4HUF A;  3P1G A;  3M8R A;  3P5J A;  3O3G A;  3TI0 A;  1QS4 A;  4DSF A;  1LWE A;  4CGG A;  5KTQ A;  4FJM A;  4DFK A;  1KSP A;  4CEB A;  1BCM A;  1ZBU A;  4IG0 A;  3ISN C;  4KO0 A;  4O5B A;  1KFS A;  1A5W A;  2WOM A;  2EHG A;  4NCG A;  1HQU A;  4AHV A;  1Q8I A;  2DFE A;  3AO5 A;  3QES A;  1CZ9 A;  1S9E A;  4K8X A;  4DQI A;  1IH7 A;  4IFY A;  4WE1 A;  2RF2 A;  4CEA A;  3BDP A;  4KI6 A;  4PY5 A;  2HHS A;  4JS4 A;  1U49 A;  1XWL A;  1T7P A;  4C8M A;  4CJL A;  4O0J A;  4FW1 A;  4CIE A;  5KRT A;  1DTT A;  3O3F A;  4DF4 A;  1FKP A;  2W42 A;  2Z1G A;  3CFR A;  1SKS A;  4FM0 A;  3L3V A;  3DLH A;  5D3G A;  4M3Y A;  4N47 A;  4Y1D A;  3VQQ A;  4OKJ A;  4JS5 A;  4FM1 A;  2KFZ A;  4E1M A;  1LW2 A;  4QAG A;  4KHS A;  3LPT A;  1HRH A;  4QCL A;  2ZE2 A;  4EP4 A;  3AVC A;  3RMA A;  3WNH A;  3OYE A;  3CM6 A;  3C6T A;  1F21 A;  4ID1 A;  2IC3 A;  4FJK A;  3AVB A;  2E6M A;  4RW8 A;  4F3T A;  3ZT0 A;  4DFP A;  3AO4 A;  1RIL A;  4FJN A;  3TAF A;  3RTV A;  4H4M A;  4G1Q A;  1I3A A;  5J2M A;  3RR8 A;  1BIS A;  1LWF A;  4CFD A;  1BQM A;  2P1J A;  2Z1H A;  4CEE A;  4CK3 A;  4HHT A;  4RW9 A;  4E7K A;  1S1V A;  1GOB A;  3K5N A;  4KHU A;  3F9K A;  3L2W A;  5C25 A;  2D5R A;  3V9U A;  3KK3 A;  4AIL C;  2G8V A;  4FLW A;  4CCH A;  4CGI A;  4CK1 A;  4L8R B;  4CEO A;  3EY1 A;  3PV8 A;  1LWC A;  3EZ5 A;  4IBN A;  4J2A A;  4KI4 A;  2GV9 A;  3WNG A;  1GOC A;  1NKE A;  1QSS A;  3HK2 A;  1D9F A;  1NK8 A;  3QEI A;  4FLX A;  2QK9 A;  1TK0 A;  4M3Z A;  3ZSW A;  1X9W A;  3NGZ A;  5KRS A;  3L8B A;  4DU4 A;  4DS5 A;  3AA5 X;  3TR8 A;  1RBU A;  4KHN A;  3DOL A;  4BWM A;  3S9H A;  3TWH A;  2F8S A;  3G10 A;  2KQ2 A;  4CED A;  4IFV A;  4ELU A;  3KLI A;  3AA4 A;  2IS3 A;  3VQ7 A;  2XY8 A;  3C95 A;  3QEX A;  3MXI A;  2JGU A;  1D5A A;  4I2Q A;  1KVA A;  4FLU A;  3VQ9 A;  4CJK A;  1NJX A;  4E19 A;  3K57 A;  3NH2 A;  4CJS A;  5K14 A;  3OYC A;  3CFP A;  3TAR A;  1HNV A;  5HRR A;  2YHA A;  4FXD A;  1VSE A;  3PUF A;  3LWM A;  1VK0 A;  1X9M A;  4B9V A;  4FJ9 A;  1VSL A;  1WNS A;  3L2R A;  1HJR A;  2BE2 A;  1HYV A;  1NK5 A;  3AV9 A;  4OPJ A;  4KAZ A;  1RT1 A;  4FJ5 A;  3HST B;  4FK4 A;  2B5J A;  1I39 A;  4N56 A;  3V81 A;  1N5Y A;  3SCX A;  4Y1C A;  4M45 A;  1TKT A;  2AJQ A;  1U48 A;  4CF9 A;  3RWU A;  2NUB A;  4Z4C A;  1S1W A;  4CF8 A;  1TKD A;  1EX4 A;  3D45 A;  1HMV A;  4DU3 A;  4JRQ A;  4CEC A;  1JXE A;  4KRE A;  1MU2 A;  4CGF A;  4EP5 A;  4KB0 A;  1BCO A;  1NOZ A;  3HL8 A;  4CK2 A;  3QEP A;  4FLV A;  4FJ7 A;  1XHZ A;  4J2E A;  2FC0 A;  3MED A;  4GW6 A;  3AVK A;  4FK0 A;  4DTM A;  3SPZ A;  1U04 A;  4XIU A;  4J2B A;  1ZYQ A;  4K8Z A;  3NH0 A;  3K58 A;  3SJJ A;  1WN7 A;  4AHU A;  4CJW A;  1C1B A;  1TKZ A;  3TAN A;  1D8Y A;  1TK8 A;  3AO3 A;  4HCB A;  2KZZ A;  4B08 A;  3DLE A;  3VQP A;  1L3T A;  2Z1I A;  4E7I A;  2QKB A;  2I5J A;  3B6P A;  5HLF A;  4DSJ A;  4FZX C;  1RT4 A;  1VRT A;  3VA3 A;  4CF2 A;  4Z4G A;  3ZT2 A;  3OYA A;  3PY8 A;  3OYL A;  1KLN A;  2IAJ A;  4DTR A;  4OLB A;  3L2V A;  3OYN A;  4ELT A;  4KTZ A;  2VG6 A;  5HRO A;  1NK7 A;  4FZZ A;  3KLF A;  5KI6 A;  2RN2 A;  4PQU A;  3NF9 A;  1HYS A;  2XO7 A;  3AVJ A;  2HB5 A;  5C24 A;  1D9D A;  4F3O A;  2F8T A;  4O4G A;  1LAV A;  1QSY A;  3MEC A;  1QHT A;  1KVB A;  2OPS A;  5SZT A;  2HHQ A;  4OLA A;  2A1S A;  5C42 A;  4ELV A;  2RKI A;  4CHO A;  1RTH A;  3VQ8 A;  1IG9 A;  4DSE A;  4FLY A;  2HVH A;  1T05 A;  3F73 A;  3V9Z A;  3NBP A;  3FFI A;  1YVU A;  1CXU A;  3TAM A;  3ZSQ A;  1JKH A;  4ZHR A;  5KGX A;  4N5S A;  4UQG A;  3I8D A;  1UA1 A;  2OZM A;  4FYD A;  3LAL A;  4KV8 A;  2YKN A;  3HT3 A;  1XHX A;  1ASV A;  4E7H A;  4RW6 A;  4CJR A;  3LPU A;  4DTU A;  3TAP A;  3ZCM A;  4LD0 A;  4NCA A;  4DF8 A;  1SUQ A;  3QIN A;  2VG5 A;  3ZT1 A;  4CEQ A;  1IKV A;  4CHZ A;  4CHP A;  4CJV A;  4BE2 A;  4DSK A;  1O1W A;  3AA2 A;  4DTJ A;  3SUQ A;  1WSF A;  4BDY A;  4E7L A;  4FCY A;  1VSJ A;  4E89 A;  3EYZ A;  1QTM A;  5FRM A;  1RT7 A;  1VSD A;  2XY6 A;  2B4J A;  4CHQ A;  1RBR A;  2HND A;  5J2Q A;  4E3S A;  3SYZ A;  3NGY A;  4CEF A;  1RDD A;  3HM9 A;  3V9W A;  1BIU A;  3K59 A;  4DTN A;  4Z4E A;  1BQN A;  4OGE A;  2Y1I A;  5T7B A;  4CJP A;  1EET A;  1WSG A;  1YT3 A;  1U4B A;  1ZBH A;  2E6L A;  4I9L A;  4AH9 A;  4C8L A;  1TL1 A;  3RRH A;  4LSN A;  1VSF A;  5HRN A;  3OY9 A;  3QO9 A;  4KB1 A;  1W9H A;  1RBV A;  3T19 A;  3NGI A;  3QEV A;  1HYZ A;  1QSL A;  3ZSV A;  3LZI A;  4KTW A;  5CY4 A;  3V9S A;  4DQR A;  3PX0 A;  3CYM A;  2XY5 A;  1SKW A;  2HHV A; 
#chains in the Genus database with same CATH topology
 3LDS A;  1YIJ N;  3O4N A;  5E41 A;  2E20 A;  4JKD A;  1CZB A;  3M8P A;  3U3G A;  4C1N K;  2Q3S A;  3RMD A;  4OPA A;  4M41 A;  3V1Q A;  3SQ0 A;  3K5L A;  3L2Q A;  2HOE A;  4JN4 A;  3HP9 A;  2G8K A;  5DK5 A;  2YNF A;  4B3O A;  4IEE A;  4BRG A;  4IKF A;  3BP8 A;  4FWK A;  3PX4 A;  3D2E B;  1TL3 A;  2NRH A;  1WSH A;  3CCV N;  1QE1 A;  4CJQ A;  1BGX T;  4YOX A;  5BRD A;  2QXF A;  1B9F A;  3U9Z A;  4NCB A;  3FR0 A;  2VGM A;  3QNO A;  2HHW A;  4B9T A;  3AO2 A;  1C1C A;  3PSI A;  1XC9 A;  1JLG A;  4KKO A;  3UKR B;  4BC2 A;  1IKW A;  4IDH A;  3AY9 A;  3DXM B;  1GLB G;  3SBG A;  1B9D A;  3ULE B;  3V1O A;  2D1K A;  1DKG D;  4JYA K;  1JCG A;  3LP1 A;  4CZE A;  4CZJ A;  4LF6 K;  4H0O A;  3DI6 A;  4MLH A;  2W6L A;  2OPP A;  1EKE A;  4EFH A;  1NJZ A;  1HNW K;  3THX B;  4FJX A;  2ZF5 O;  4NLC A;  3IRX A;  3VQE A;  3ZSY A;  4CZL A;  3U3Y A;  1MDU B;  4KHW A;  1HPM A;  1IBK K;  3EO3 A;  3SMP A;  2OZS A;  1NGH A;  3VGK A;  4YOT A;  3O1W A;  2D0P A;  3QFP A;  2X74 A;  3VEV A;  1Q9X A;  3BEX A;  3LDO A;  2VWJ A;  3THY A;  3OS2 A;  1WAF A;  4AHC A;  1NJI O;  5C0Y A;  2KTQ A;  2LSN A;  4GV9 A;  3C6U A;  2GTD A;  2YV0 X;  1RBS A;  5GIO A;  5HP1 A;  4O55 A;  1J54 A;  3KKS A;  4DTO A;  3ZT4 A;  4I2P A;  1RT5 A;  4DQP A;  3DRP A;  3NF6 A;  1JLA A;  4AM7 A;  4ISF A;  4BR0 A;  3BF1 A;  1LV5 A;  3TAB A;  4FJJ A;  1XC3 A;  3C65 A;  3DLG A;  1NGA A;  5BPN A;  1N6Q A;  1OH7 A;  4IWV A;  4MDA A;  3KKR A;  3MCP A;  5CR4 A;  2GWK A;  2E88 A;  3V1R A;  3HTV A;  4AF1 A;  1REV A;  1TUY A;  3QIO A;  3DMJ A;  3O9U A;  4OKE A;  4TSX A;  3CM5 A;  3NAE A;  3SNN A;  4XH4 A;  1ZXO A;  5HRS A;  1RTJ A;  4IJA A;  4B1X B;  1RDB A;  1SQK A;  5AQK A;  2OPQ A;  2FBT A;  5LL6 Z;  4JI6 K;  1NGC A;  5C2F A;  4DLE A;  3A0I X;  5CYM A;  4RG8 A;  3VEN A;  3R1X A;  4G9Z A;  3LDL A;  4FVM A;  1UWB A;  2QKK A;  4M3X A;  4JKA A;  1GLF O;  1OH6 A;  1WB9 A;  3ENH A;  4M42 A;  5J1E A;  1BI4 A;  4M3T A;  4CGD A;  3RR7 A;  3MDQ A;  4NYF A;  3OYF A;  3P31 A;  2PAV A;  3CMA N;  2ETJ A;  1OH8 A;  4H0P A;  4BRN A;  4GVM A;  2VWK A;  3T1Y K;  2F4V K;  3CCQ N;  5AQN A;  2VGN A;  3I0R A;  4PA1 A;  3KLG A;  5I9E B;  4DV0 K;  3G0Z A;  2E2P A;  4CJU A;  5A2Q O;  2ATQ A;  2Q0U A;  4O44 A;  1HNI A;  4BDZ A;  2KLA A;  3NF8 A;  4O5F A;  3ULD A;  2YNG A;  3AVN A;  2FSN A;  2FXU A;  2GWJ A;  1VQ9 N;  4BWJ A;  1TAQ A;  4JRP A;  3VQD A;  4H8K A;  3ZET B;  1CXQ A;  5FRN A;  2KZM A;  4DLG A;  1YI2 N;  3THW A;  4E0D A;  4ID5 A;  1C0M A;  4DTX A;  3SQ4 A;  1YUW A;  3CQX A;  3DLB A;  1BHL A;  3H08 A;  3I8B A;  4A5B A;  2ZM6 K;  3P83 D;  4Z0U A;  3VEY A;  3JAM O;  3D2F B;  3U6F A;  1KCF A;  1L5U A;  2PFU A;  3C94 A;  2P9S A;  3SAH A;  4JKF A;  2O4G A;  4OJR A;  1VRU A;  3OS0 A;  4HCC A;  3GG4 A;  4CD3 A;  4IFE A;  3PX6 A;  3TAQ A;  3M8Q A;  4NYN A;  1NKC A;  2X6N A;  2WC9 A;  2ZQB A;  4Q5V A;  4AHS A;  4BC4 A;  4HUF A;  3P1G A;  1TUU A;  3P5J A;  3TI0 A;  3U8X A;  1QZ6 A;  3HM8 A;  3ZYY X;  1HQU A;  1Q8I A;  4IZ9 A;  1TYQ B;  1CZ9 A;  5AQJ A;  3IMX A;  2HHS A;  5M1Q A;  1XWL A;  1T7P A;  4FW1 A;  4CIE A;  4KRF A;  1DTT A;  4RCH A;  1ATN A;  4N47 A;  4OKJ A;  2FF6 A;  4QAG A;  3LPT A;  3RMA A;  3D7E O;  3CM6 A;  4OPH A;  5BRH A;  3WT0 A;  4F3T A;  3ZT0 A;  3R6M A;  3PIO L;  3TAF A;  4H4M A;  4FVU A;  1I3A A;  4CK3 A;  1N33 K;  4GV6 A;  2Z1H A;  4RW9 A;  4YOY A;  3F9K A;  3L2W A;  2YHW A;  4CK1 A;  4C23 A;  3EZ5 A;  4JKC A;  1NKE A;  3HK2 A;  1O13 A;  1D9F A;  4CZM A;  1NK8 A;  2QK9 A;  4O8K A;  4ISE A;  3ZSW A;  3NGZ A;  5KRS A;  4DS5 A;  2Q2R A;  4JI2 K;  3AA5 X;  3DOL A;  2F8S A;  3ENB A;  3TWH A;  1V4T A;  1S3X A;  3S9H A;  2O8D A;  3HOS A;  2IS3 A;  3K9K A;  3VQ7 A;  4ILJ A;  3QEX A;  2JGU A;  4FLU A;  1Q86 O;  3NH2 A;  3CFP A;  5K14 A;  1NG9 A;  2BUP A;  2ZWH A;  1VSE A;  2BE2 A;  1HYV A;  4KAZ A;  4OPJ A;  3HST B;  3O1B A;  4JI0 K;  3TTC A;  3O9R A;  1TKT A;  1IJJ A;  2QWQ A;  3WQT A;  4DR2 K;  2VYP A;  4KH6 A;  1GLA G;  4CF8 A;  4V19 S;  1S22 A;  4DR4 K;  4JD2 B;  4KB0 A;  4JKG A;  4CK2 A;  3BZC A;  1BUP A;  5MLC Q;  3TSU A;  4GW6 A;  1BDG A;  2Q36 A;  3OBY A;  3SPZ A;  4PKI A;  4J2B A;  4K8Z A;  3IDH A;  1WN7 A;  4AHU A;  2KZZ A;  1D8Y A;  1CZA N;  4HCB A;  4A61 A;  3L0Q A;  4QS8 A;  5AQZ A;  2QKB A;  1VQ5 N;  3HZ6 A;  1Q18 A;  3DXK B;  5HLF A;  4GNI A;  1RT4 A;  1VRT A;  5E26 A;  4DR5 K;  4CF2 A;  3ZT2 A;  3OYA A;  3LM9 A;  3TSQ A;  5GAH P;  3OYN A;  4ELT A;  2Q1N A;  4LFB K;  1D9D A;  5C24 A;  4O4G A;  3VPZ A;  2OPS A;  1NM1 A;  3BY5 A;  4U7B A;  4IO9 L;  2W41 A;  2RKI A;  3SJH A;  3VQ8 A;  1IG9 A;  4DSE A;  1E4G T;  3MN6 A;  1T05 A;  5CE3 A;  3NBP A;  3TAM A;  1YVU A;  3ZSQ A;  2XY5 A;  4FYD A;  1JKH A;  5KGX A;  4YDU C;  4N5S A;  4UQG A;  2VQE K;  4KH5 A;  4IJN A;  3KWI A;  3QFU A;  3O9Q A;  2IVP A;  3FZH A;  1ASV A;  3G71 N;  4CJR A;  3TAP A;  4NCA A;  4DF8 A;  2CGL A;  2ZJQ L;  4CHZ A;  3WXM B;  4I6M A;  5AQO A;  1WSF A;  4FO0 A;  5JVG L;  4BDY A;  3MN7 A;  1VSD A;  4A5A A;  2HND A;  5J2Q A;  3AGR A;  3SYZ A;  3NGY A;  2HBK A;  3PLA A;  4WQ5 A;  4DTN A;  3HI0 A;  1BQN A;  4OGE A;  2Y1I A;  3O9S A;  2O8F B;  1WSG A;  2QW9 A;  3MK6 A;  4C8L A;  3CC4 N;  1BO5 O;  3CJC A;  1VSF A;  3OHR A;  2E5L K;  1Z6R A;  3QO9 A;  4KB1 A;  1HYZ A;  3LZI A;  3FZL A;  4KTW A;  3V9S A;  4DQR A;  3PX0 A;  5M1P A;  1XMO K;  3H1V X;  4WF9 L;  4FLT A;  3OW2 M;  3MX5 A;  2O8B A;  4BRI A;  4BRK A;  1ZBL A;  3E66 A;  3CCJ N;  1S1U A;  1IKX A;  3K2P A;  4BY9 C;  3LP0 A;  1L3U A;  3FLC O;  1KAY A;  3DYA A;  4ILH A;  4N41 A;  1YHQ N;  2DY4 A;  5I42 A;  3TPQ A;  3MEG A;  1C1A A;  4CE9 A;  1Q9Y A;  5M1F A;  2QEX N;  2UU9 K;  2HMP A;  3ZT3 A;  1X9S A;  3KJV A;  3CCE N;  3SAF A;  4CGJ A;  3FE1 A;  3CCL N;  4IO8 A;  3O4W A;  3IAY A;  3AVH A;  4EZ9 A;  1JLE A;  5BPM A;  1YXQ A;  3HRG A;  5F0X A;  1S6P A;  3VQB A;  1QVG M;  2O8C B;  3ALY A;  1XI1 A;  3AVA A;  1NBW A;  3VF2 A;  4DQQ A;  4B1Z A;  4DQ8 A;  3NHG A;  4CZG A;  1KFD A;  3OTO K;  3O3H A;  3KK7 A;  3KD1 E;  4BGB A;  1A5X A;  2HST A;  4KHY A;  4H5W A;  4XEI A;  5FPD A;  3GOI A;  5AQR A;  1NGF A;  1SKR A;  5AQT A;  3OVN A;  3JYT A;  1RTD A;  3A5O C;  2G8U A;  3CER A;  4B8A B;  1NJY A;  4I9Q A;  2HBM A;  3QBX A;  3NDK A;  5AZJ A;  1Y97 A;  4B9Q A;  2FBY A;  4OO1 J;  3AA3 A;  3OYH A;  3J8A A;  4CZI A;  4HUG A;  4DTS A;  1BA1 A;  1SL2 A;  1C0T A;  3L6Q A;  1YJW N;  3VEX A;  4FJG A;  1KTQ A;  1YVN A;  1J9A A;  5BR9 A;  3S3O A;  4W5Q A;  2ZGY A;  2HVI A;  3HOT A;  4KTQ A;  3OA9 A;  4CHY A;  4CJ3 A;  2YKM A;  4R5P A;  4M3W A;  1W97 L;  5E84 A;  4FSV A;  2YNI A;  1ILY A;  4IDK A;  4B3R K;  1GOA A;  1CLQ A;  2P5G A;  4FPB A;  4LH5 A;  5JS2 A;  5I3U A;  1JXB A;  3SV4 A;  4PWD A;  3U4L A;  3VEZ A;  4JEP A;  3IUC A;  4JI4 K;  3BGR A;  3LAM A;  1ZBI A;  2DFF A;  1Q7Y O;  4BG9 A;  1TAU A;  4YOU A;  2PYL A;  3OYK A;  4JI8 K;  3DOK A;  3ZSX A;  2ZJR L;  3CXC M;  2J4R A;  1TVR A;  3LP3 A;  4HWI A;  3VTI A;  2HNZ A;  2FBX A;  3DM2 A;  4BAC A;  1DT9 A;  3WXL A;  3OYD A;  3VQC A;  3THY B;  2HHU A;  1JLB A;  3NFA A;  3UIQ A;  3WXK A;  3TSP A;  3D0P A;  1IO2 A;  1FJG K;  4B3M K;  3M3Z A;  2YNH A;  4GKJ K;  3IFR A;  4YFU A;  1LW0 A;  4Z4H A;  3HJF A;  5BRE A;  4YNQ A;  2GEM A;  1T3V A;  2NRZ A;  4DR3 K;  1FK9 A;  1GLJ O;  4YOW A;  4QS9 A;  5AQM A;  4X62 K;  4C8N A;  3THV A;  1FKO A;  2ASP A;  3AVF A;  1JCE A;  3ZSZ A;  4FK2 A;  1WSI A;  1VQ8 N;  1FW6 A;  3S3M A;  2HHT A;  3AAR A;  2VWB A;  3OJS A;  3A5M C;  1JLF A;  4N76 A;  2OTJ N;  3CC7 N;  1TKX A;  4BRA A;  3KLE A;  2IVO A;  2WFB A;  1LAW A;  3M5R A;  5FPN A;  3T7Z A;  3T1H K;  3NE6 A;  3KTQ A;  4MO4 A;  3L4I A;  3VES A;  2CGJ A;  3HVR A;  1R59 O;  1P90 A;  2I7P A;  3CF5 L;  4JKH A;  4AHT A;  3V6D A;  2HBL A;  4LSL A;  1A5V A;  4DV7 K;  3SUN A;  3TU5 A;  3MEE A;  5DMR A;  4CER A;  4KFB A;  5J2P A;  1YTA A;  1C0F A;  4KBO A;  3HPG A;  1NGJ A;  3VEO A;  4BQL A;  3E9P A;  4FM2 A;  3N4P A;  4QCL A;  2E2Q A;  5KQ8 A;  3AVG A;  3O4Q A;  4LF4 K;  3LDN A;  4LY7 A;  1Y64 A;  3HO1 A;  1BI4 B;  4DG1 A;  4F8R A;  4CJ7 A;  4B9S A;  4C8O A;  4F9O A;  4HUE A;  3PO5 A;  3DRR A;  3SZ2 A;  1S1X A;  1WAJ A;  1TK5 A;  4K41 A;  4AQY K;  4WFB L;  2D0C A;  3KLH A;  3T3F A;  4BE0 A;  2HF3 A;  2A3Z A;  1SV5 A;  3G4S N;  3T1A A;  4CJT A;  4C8K A;  4W5R A;  3HPO A;  3VF6 A;  3CJ7 A;  4FWS A;  1X3M A;  4IXC A;  4LF7 K;  4FJM A;  1EQY A;  4IG0 A;  5LMU K;  3MWT A;  2WTU A;  2RF2 A;  1EWR A;  4KI6 A;  4PY5 A;  3FZM A;  1U49 A;  1WOQ A;  4PKG A;  4C8M A;  4BRO A;  3THW B;  1QSS A;  4BRF A;  2W42 A;  2A41 A;  4FM0 A;  5D3G A;  3CJ9 A;  1XQS C;  3VQQ A;  4JS5 A;  4JKE A;  4EP4 A;  3WNH A;  4A62 A;  5KPR A;  3OYE A;  2P9S B;  3C6T A;  5AQV A;  4ID1 A;  2IC3 A;  3AVB A;  4RW8 A;  4Y0W A;  3AO4 A;  1IBL K;  5J2M A;  4DCH A;  3CIP A;  5BR8 K;  4E7K A;  4O8U A;  2D5R A;  3V9U A;  2RE2 A;  4CGI A;  4L8R B;  4CEO A;  3EY1 A;  1LWC A;  4EAH D;  4IBN A;  3U9D A;  4J2A A;  1GOC A;  4CVN E;  5AQP A;  1TK0 A;  4M3Z A;  4GKK K;  3WEE A;  5AQS A;  2XY8 A;  3MXI A;  5AZI A;  1NNE A;  4JI3 K;  1D5A A;  1NGI A;  4E19 A;  3K57 A;  4CJS A;  2KHO A;  3CET A;  3TAR A;  2YHA A;  4FXD A;  3PUF A;  3LWM A;  1VK0 A;  1X9M A;  4FJ9 A;  1VSL A;  4BRP A;  3L2R A;  1HJR A;  3AV9 A;  1I39 A;  3V81 A;  3RSE A;  4DV1 K;  2UUC K;  1GLL O;  5ADX H;  3H45 C;  2V52 B;  4CF9 A;  2V7Z A;  4Z4C A;  1S1W A;  4E1J A;  3BF3 A;  1EX4 A;  1N34 K;  1HMV A;  2YJF A;  4JRQ A;  3TTD A;  4CEC A;  2OTL N;  1EO1 A;  4KRE A;  4EP5 A;  4DB3 A;  3QEP A;  5JLF A;  4FLV A;  2NRV A;  3MED A;  3J7Z O;  1U04 A;  1T44 A;  4XIU A;  3R3L A;  5TKW A;  3CCU N;  3NH0 A;  4BRH A;  1C0G A;  3A8Y A;  3K9J A;  4CJW A;  3TAN A;  3NMU A;  4JK7 A;  3DLE A;  1QQM A;  2O8D B;  4IEI A;  4DSJ A;  1X9J A;  4FWO A;  3WXJ A;  3PY8 A;  1KLN A;  4KTZ A;  4BRC A;  3P38 A;  1NK7 A;  3A5N C;  4A57 A;  5KI6 A;  1HYS A;  4PQU A;  1NMN A;  2XO7 A;  3AVJ A;  2HBJ A;  3MEC A;  4JKB A;  4J8F A;  5SZT A;  4OLA A;  5C42 A;  4ELV A;  2NRT A;  5CHI A;  1TKD A;  3RR8 A;  1CXU A;  4ZHR A;  1UA1 A;  3ZX2 A;  4JKG B;  5C10 A;  4DKW A;  3LAL A;  1WUA A;  3KWG A;  1NLV A;  1VQL N;  3A5L C;  4RW6 A;  4H0X B;  3ZT1 A;  4H5V A;  1IKV A;  3SUQ A;  4BG8 A;  4BVP A;  2QWP A;  1VSJ A;  3LL3 A;  4LFA K;  4E89 A;  3EYZ A;  3K0S A;  3GL1 A;  1QTM A;  2B4J A;  3PIP L;  4PKH A;  4CHQ A;  1RFQ A;  4E3S A;  4Z4E A;  2ASM A;  4CJP A;  1YT3 A;  5T7B A;  1U4B A;  2E6L A;  4I9L A;  1QZ5 A;  3SMS A;  1TL1 A;  4LSN A;  3O80 A;  3QIC A;  5EXW A;  3MX2 A;  4Z94 A;  3T19 A;  4BR9 A;  4RWT A;  4B9N A;  3CYM A;  3QIN A;  3VF4 A;  2HHV A;  4KHP K;  3ZLJ A;  2X78 A;  4YDU A;  3VMF B;  1SL0 A;  3DLL L;  2XY7 A;  3QIP A;  2ASO A;  5AQF A;  1ASU A;  2FSK A;  3AVL A;  4DQS A;  1KLM A;  1BL3 A;  3C7N A;  3R9P A;  1VQK N;  3VEW A;  1T8E A;  1K73 O;  4I6M B;  1U2V A;  1YTU A;  1YF5 L;  1OVY A;  1GLD G;  4GMJ B;  5CZ1 A;  5CYQ A;  2Y1J A;  2QWM A;  4WFA L;  3IG1 A;  3SUP A;  2DFH A;  3J80 O;  2NRX A;  2BAN A;  3GDQ A;  4BQZ A;  3AVM A;  3LAN A;  3N4Q A;  2IGI A;  3I0S A;  3VER A;  3SQ2 A;  1JCF A;  4BR5 A;  2F9T A;  1KQS M;  3A2F A;  4CW7 B;  1TGO A;  3EE8 A;  1NWK A;  3HBT A;  4YOR A;  2DTU A;  1NMD A;  4RW7 A;  3PSF A;  1BU6 O;  2O8B B;  1XMQ K;  3LZJ A;  4B1Y B;  1RDC A;  3DWL A;  1C6V A;  4RTF D;  4X66 K;  3I55 N;  1SZ2 A;  1BA0 A;  4KH4 A;  2KW4 A;  3S3N A;  3CJ1 A;  5AQL A;  3ASM A;  2G8I A;  3C6H A;  3KK2 A;  1J5E K;  1T03 A;  2P9I A;  3SQ1 A;  4DV3 K;  3MXM A;  4OVL A;  3KK1 A;  1RCH A;  1FXX A;  1KAZ A;  2HMI A;  4OKK A;  4W5N A;  3CME N;  1VQ7 N;  3HPH A;  2PYJ A;  4DFM A;  1QQN A;  4JHD A;  5GAE P;  3KD5 E;  3QER A;  3OBW A;  4ZTF A;  1NK9 A;  2P9P A;  3J7Y P;  4CZK A;  3EL2 A;  1RT6 A;  4B1U B;  2H3G X;  4FZY A;  4Z4I A;  2Q0R A;  1VQ6 N;  3QET A;  2IOC A;  1WLJ A;  4JLH A;  4CGH A;  5EU7 A;  5JS1 A;  2PZS A;  1U47 A;  1JLQ A;  4HTU A;  4PL7 A;  3RMB A;  4DV4 K;  4B8C A;  2HW3 A;  3ID8 A;  2E1Y A;  3OYG A;  1HNZ K;  2DPN A;  5GAD P;  4NXM K;  4FW2 A;  1U6Z A;  5J2N A;  3EZW A;  2UUB K;  2WBN A;  3VGL A;  2ZD1 A;  1X3N A;  3Q7C A;  2RPI A;  4CJE A;  3HXM A;  3OYB A;  1VSK A;  1KAX A;  2VG7 A;  5AZJ B;  3OS1 A;  5FDL A;  3FZK A;  1RDU A;  3VQ4 A;  2EWS A;  2P9N A;  4CZH A;  2CH5 A;  4IG3 A;  1MWK A;  4FWR A;  4JI5 K;  1VHX A;  2HHH K;  3FZF A;  4FJH A;  1NOY A;  3JSM A;  5DM6 L;  4MFB A;  2QI2 A;  1ZBF A;  5JVH L;  1W0H A;  3JS6 A;  1HX1 A;  5C2D A;  1NKB A;  4F2S A;  3HVT A;  4BRM A;  1W2B M;  1B92 A;  2G8W A;  5HL7 L;  2IIR A;  3DRS A;  4KPY A;  2QA4 N;  1YIT N;  1S5J A;  3E9O A;  4LH4 A;  1RGI A;  4I7F A;  2OYQ A;  1D4X A;  4FJ8 A;  3L2U A;  4CJ4 A;  1BWF O;  2NNW A;  5KPT A;  1NGG A;  2P9K A;  3KIO A;  4CFA A;  3CCM N;  4K42 A;  3L3U A;  2P9U A;  4CJF A;  3DLR A;  3MXJ A;  3VN5 A;  3UKU A;  2YX6 A;  1G99 A;  3T69 A;  1KRP A;  4EHT A;  2Q97 A;  5HBM A;  1X1P A;  4FOE A;  2O8E A;  1WBB A;  4KHQ A;  3RRG A;  4PL8 A;  1HUX A;  4FWP A;  3M6G A;  1J53 A;  1DLO A;  2E1Z A;  2GX9 A;  3TAE A;  3OJU A;  3F9M A;  5BN9 A;  2ITM A;  3NF7 A;  4CIF A;  1WBD A;  1HPZ A;  4HVJ A;  4EHU A;  3ITH A;  5LJW A;  1J6Z A;  4HTL A;  5FRO A;  1IKY A;  3FGU A;  1K8A O;  1QQC A;  4K43 A;  2D0A A;  1NGE A;  1YJN N;  4DS4 A;  3SI6 A;  3WUH A;  1BG3 A;  4MO5 A;  4F4K A;  3O5B A;  3VOV A;  1RNH A;  4OGC A;  1DEJ A;  4Z4F A;  1U45 A;  5IT9 O;  3BZK A;  2F96 A;  4CFB A;  1UOC A;  4WQ5 C;  1EP4 A;  4H5N A;  3J7A P;  4W5T A;  3IKM A;  3H3O B;  4DV6 K;  2KKZ A;  2XRI A;  2NRW A;  3NH1 A;  3HYF A;  3QLH A;  3AAP A;  5BPL A;  3MAQ A;  4JI7 K;  3M8R A;  4WQ4 C;  3O3G A;  3MWP A;  3G25 A;  1LWE A;  3F2K A;  4BVO A;  4KO0 A;  3ISN C;  1A5W A;  2WOM A;  2EHG A;  3L4Q A;  1GLE G;  4K8X A;  1IH7 A;  4IFY A;  4BRL A;  3BDP A;  4DUY K;  1KXP A;  2W6K A;  5AFU H;  1N36 K;  5IWA K;  3O3F A;  3DLH A;  1FKP A;  2Z1G A;  1W7A A;  4FL9 A;  1XNQ K;  4DUZ K;  2KFZ A;  3DAW A;  3NVK A;  2UXD K;  3VET A;  5GIP A;  5BN8 A;  1F21 A;  2E6M A;  4ILG B;  1N32 K;  3O6W A;  4FJN A;  5M1N A;  1HKB A;  1BIS A;  1LWF A;  3MMV A;  1BQM A;  4CEE A;  4CFD A;  5AFU A;  4HHT A;  1S1V A;  3K5N A;  4DR6 K;  5C25 A;  2G8V A;  4H03 B;  3KK3 A;  4AIL C;  3QB0 A;  4FPA A;  3PV8 A;  2GV9 A;  1QHA A;  3QEI A;  3DJC A;  1KC8 O;  4DV5 K;  4ISG A;  3CPE A;  3L8B A;  4IOA L;  3CCR N;  4FWN A;  3TR8 A;  3CC2 N;  1RBU A;  3G10 A;  2KQ2 A;  4CED A;  4IFV A;  4ELU A;  3B8A X;  4JV5 K;  3ZEU A;  3C95 A;  3H6E A;  1NJX A;  5AQU A;  3G6E N;  3WQU A;  4CI6 A;  5HRR A;  1VQ4 N;  1WNS A;  1NK5 A;  4FJ5 A;  4FK4 A;  2B5J A;  4N56 A;  3ZX0 A;  3SCX A;  4Y1C A;  3QBW A;  2AJQ A;  3C6A A;  3HSC A;  3QDK A;  2I7N A;  1E4F T;  3D45 A;  4DU3 A;  3LDQ A;  4IOX A;  3J81 O;  1BCO A;  1NOZ A;  3HL8 A;  4DR7 K;  2P9L A;  4FJ7 A;  1XHZ A;  4J2E A;  2FC0 A;  3AVK A;  4FK0 A;  1VQO N;  4DTM A;  1OKJ A;  1ZYQ A;  1RDW X;  1JJ2 M;  3VTH A;  3SAG A;  3SJJ A;  1XUP O;  1C1B A;  4H5R A;  1TK8 A;  3AO3 A;  1L3T A;  2Z1I A;  3QML A;  4NLB A;  2I5J A;  3B6P A;  3WEE B;  4CBW A;  5AZI B;  4Z4G A;  4H0T B;  3OYL A;  4NO7 A;  4OLB A;  3L2V A;  3EE9 A;  3KLF A;  4K25 A;  3NF9 A;  4H5T A;  2HB5 A;  5LMN K;  1QSY A;  1K8K A;  3RSE B;  5ELZ A;  4CHO A;  5AJ3 K;  1RTH A;  4DR1 K;  4FLY A;  3F73 A;  4C1N I;  2JWK A;  5DM7 L;  4CD1 A;  3ZCM A;  2ZGZ A;  5AQW A;  4LD0 A;  3M1F A;  4CHP A;  4CEQ A;  4CJV A;  4BE2 A;  4NB4 A;  1O1W A;  3EN9 A;  4DTJ A;  2CH6 A;  4LFC K;  4E7L A;  4R79 A;  5FRM A;  2XY6 A;  5AQY A;  2OAN A;  3D2E A;  3W3D A;  3HM9 A;  3SBT A;  4AH9 A;  1VAZ A;  4BGA A;  5EVZ A;  2QTD A;  3OY9 A;  2V7Y A;  1W9H A;  3QEV A;  5EX5 A;  4BR7 A;  3CJB A;  2F7T A;  4M3U A;  3UKR A;  4LC9 B;  3SK3 A;  4CHN A;  2A1R A;  5JIC A;  1YAG A;  1EXQ A;  1NJW A;  3CI5 A;  3DXM A;  1R0A A;  2UUA K;  2QWN A;  2PBD A;  4NXN K;  3ULE A;  5AQX A;  2EX3 A;  4E1N A;  3H3N O;  1J5O A;  4M7X A;  1HKG A;  2E8A A;  4YY3 K;  3EKU A;  4OX9 K;  2GUP A;  5F2R A;  2CGK A;  4BRQ A;  2AP1 A;  3THX A;  1VSM A;  2GBZ A;  4B9M A;  4FJI A;  5AQH A;  5H1S Q;  3O9T A;  3M8S A;  3AO1 A;  4FLZ A;  1NK6 A;  2O4I A;  5M1K A;  4XH1 A;  1C0U A;  1M90 O;  1BOT O;  3CJA A;  4FJL A;  4YHH K;  3K5O A;  4B9U A;  4WFN L;  1S1T A;  1T6D A;  1H1V A;  3K5M A;  1VQN N;  4U67 L;  2UXB K;  1Z26 A;  2WON A;  1DTQ A;  3UE5 A;  4BC3 A;  4CFC A;  2P51 A;  5SWM A;  2BTF A;  4FWL A;  3ZSO A;  2GUI A;  3Q7B A;  1P8Z A;  3OYM A;  4DMN A;  5C15 A;  5ADX A;  4AHR A;  4UY8 O;  4X64 K;  4EIA A;  2AA4 A;  2P5O A;  1QVF M;  4ICL A;  2HNY A;  1JLC A;  3LM2 A;  2YHB A;  3C7N B;  4DFJ A;  4A2A A;  2X6S A;  2FSJ A;  2A6A A;  3DLK A;  1U2V B;  3V4I A;  1Z05 A;  2HHX A;  1UAX A;  2RHK A;  2W40 A;  4CF1 A;  4CIG A;  3VQ5 A;  1Q81 O;  4MQ3 A;  2Q31 A;  1RDA A;  3QNN A;  2FF3 B;  4ZTJ A;  1UA0 A;  2BDP A;  1Q82 O;  1LCU A;  4YOV A;  5B8H A;  5JMV A;  4DWI A;  3NCI A;  5GAG P;  1L3S A;  2ZJP L;  3RVC A;  2B6A A;  3E01 A;  5M1O A;  2G8F A;  4M3R A;  1S6Q A;  5F1X A;  4CF0 A;  1I94 K;  1NK0 A;  1S9G A;  3IS9 A;  1HJO A;  2FBV A;  3VA0 A;  3VGM A;  4B3S K;  3ATU A;  2D0B A;  1TV6 A;  3AAQ A;  3CG7 A;  4EZ6 A;  2YJE A;  5CZ2 A;  5JLH A;  3D6R A;  3UB5 A;  2VCP A;  4H0Y B;  3SLC A;  1ITG A;  1SL1 A;  3CQ8 A;  3TAG A;  2OPR A;  4QS7 A;  2P9I B;  3GE1 A;  4A59 A;  4O0I A;  4W5O A;  3MCA B;  3VQA A;  4Q0B A;  3CFO A;  2IVN A;  3LWL A;  3EKS A;  1K6Y A;  1WSJ A;  5TKY A;  2BGG A;  4PUO A;  2Z1J A;  3P39 A;  4RW4 A;  3CQY A;  4JHD B;  2R7Y A;  2YHY A;  3RMC A;  5AQI A;  2P9P B;  1ZC6 A;  3KVG A;  4FOI A;  4DU1 A;  2G8H A;  1WSE A;  5HOO A;  1YJ9 N;  1ATS A;  2YHX A;  4AM6 A;  4DTP A;  3TTF A;  1RT2 A;  4IOC L;  5KGW A;  1Z25 A;  3F5T A;  2ITG A;  2UXC K;  1XNR K;  2A42 A;  4CES A;  3WNF A;  1VQP N;  1SAZ A;  3ZET A;  3ZSR A;  3ZX3 A;  3C0B A;  3WNE A;  4CJ5 A;  3B6O A;  5EY4 A;  5HRP A;  4DSI A;  1JL2 A;  4BRE A;  1GLC G;  3D2F A;  2NLX A;  1IBM K;  2P9N B;  4J2D A;  4E7J A;  2NZT A;  1VQM N;  4H4O A;  3CPW M;  3P4I A;  3SPY A;  4M7Y A;  4QOZ B;  4OPK A;  3MN5 A;  3AVI A;  1KVC A;  3PO4 A;  3ATV A;  1E3M A;  1M1K O;  2V51 B;  4MDB A;  2BH1 A;  4BDP A;  2PY5 A;  1HQE A;  2XHB A;  3SUO A;  4B9L A;  3QEW A;  1L3V A;  1TYQ A;  4GV3 A;  1RTI A;  5FLX O;  3HP6 A;  2JLE A;  3NVM A;  2HF4 A;  4BE1 A;  3SV3 A;  1NK4 A;  4CEZ A;  1RT3 A;  2OA8 A;  2P9K B;  1NU0 A;  2YCH A;  1KD1 O;  3LP2 A;  2KFN A;  2P9U B;  1VSI A;  1BIZ A;  1ASW A;  4F2R A;  4K0K K;  4MLE A;  2QWO A;  1JL1 A;  3H46 O;  3UKU B;  2FLO A;  1RBT A;  1HKC A;  3OYI A;  3LAK A;  1VSH A;  2E4L A;  3FFK B;  2IDO A;  1G15 A;  3VQ6 A;  4DSL A;  3OYJ A;  2O8E B;  4JAX A;  3CHW A;  1QS4 A;  4DSF A;  5KQD A;  4CGG A;  5KTQ A;  4DFK A;  1KSP A;  4CEB A;  1BCM A;  1ZBU A;  1KFS A;  1V4S A;  4O5B A;  4NCG A;  1ZBS A;  4AHV A;  5AQG A;  2DFE A;  3AO5 A;  3QES A;  1S9E A;  4DQI A;  4CEA A;  4WE1 A;  2E2N A;  5LY3 A;  3JXU A;  4JS4 A;  4FWQ A;  2D0O A;  4CJL A;  1MWM A;  4O0J A;  5KRT A;  1SKS A;  4DF4 A;  5AQQ A;  4WYB A;  3CFR A;  3L3V A;  3CCS N;  4M3Y A;  4BRD A;  4Y1D A;  2A5X A;  4FM1 A;  4E1M A;  1LW2 A;  3WXI A;  4KHS A;  5AR0 A;  1HRH A;  1IG8 A;  2ZE2 A;  3AVC A;  4M63 C;  1HLU A;  4FJK A;  4DFP A;  1SS6 A;  4LF8 K;  1NGB A;  1RIL A;  3RTV A;  4G1Q A;  3ENO A;  5GIN A;  2P1J A;  4DHY A;  2UYT A;  5C12 A;  3KHY A;  1GOB A;  3GBT A;  4KHU A;  4GVE A;  4JD2 A;  4FLW A;  4WQ4 A;  4CCH A;  5EOY A;  5KPZ A;  3R8E A;  2WUS A;  4KI4 A;  4JNE A;  3WNG A;  4DV2 K;  4FLX A;  1NGD A;  1X9W A;  5LJV A;  4DU4 A;  4KHN A;  4BWM A;  4BR4 A;  3DXK A;  4B1V A;  3KLI A;  3AA4 A;  4CBX A;  4CZF A;  4PHT X;  2JWL A;  2VQF K;  4I2Q A;  1KVA A;  3I33 A;  5FPM A;  3VQ9 A;  4CJK A;  1K9M O;  3OYC A;  3KZB A;  1HNV A;  2A40 A;  4B9V A;  4FWM A;  5FPE A;  1RT1 A;  1N5Y A;  1S72 N;  4M45 A;  3EEQ A;  4JK8 A;  2F9W A;  4BR2 A;  1U48 A;  3H1Q A;  3RWU A;  2NUB A;  3I56 N;  2QXL A;  1JXE A;  1MU2 A;  4CGF A;  1DGK N;  4CBU A;  2NRR A;  2YI1 A;  3K58 A;  1N8R O;  1TKZ A;  4B08 A;  1OVQ A;  3VQP A;  4A2B A;  4E7I A;  3O8M A;  4B3T K;  3ZEU B;  4FZX C;  3VA3 A;  1IV0 A;  4XH5 A;  4X65 K;  2IAJ A;  4DTR A;  3W0L A;  2VG6 A;  5HRO A;  4FZZ A;  2O8F A;  2RN2 A;  4F3O A;  2F8T A;  1LAV A;  1QHT A;  1KVB A;  2HHQ A;  2A1S A;  2HVH A;  3S41 A;  1EWQ A;  1OH5 A;  3V9Z A;  3FFI A;  3V9X A;  2OZM A;  2QWR A;  2GEL A;  3I8D A;  3CD6 N;  2E2O A;  2QWL A;  3LDP A;  2P9L B;  3AGK A;  2YKN A;  4KV8 A;  2OCE A;  3HT3 A;  1XHX A;  2QM1 A;  4L3Q A;  1LOT B;  4E7H A;  3LPU A;  4DTU A;  4BC5 A;  4LF9 K;  1QQO A;  4WCE L;  1HNX K;  1SUQ A;  2VG5 A;  4DSK A;  2D4W A;  3AA2 A;  4FCY A;  3O08 A;  1RT7 A;  4JI1 K;  5BRF A;  1ATR A;  3ID6 A;  4GY2 B;  1RBR A;  3MN9 A;  4CEF A;  1RDD A;  3V9W A;  1BIU A;  3E1Y A;  3K59 A;  1ESV A;  1HR0 K;  4JK9 A;  1EET A;  1ZBH A;  3E9L A;  3RRH A;  1K8K B;  2O8C A;  5HRN A;  1MA9 B;  1RBV A;  4LF5 K;  3NGI A;  1QSL A;  3ZSV A;  5CY4 A;  4B1W B;  1T6C A;  4H0V B;  1SKW A;  3BUZ B; 
#chains in the Genus database with same CATH homology
 3LDS A;  4CHN A;  3O4N A;  2A1R A;  5E41 A;  4FLT A;  2X78 A;  1CZB A;  1EXQ A;  1NJW A;  1R0A A;  1SL0 A;  3M8P A;  3U3G A;  2XY7 A;  1ZBL A;  2Q3S A;  3QIP A;  3RMD A;  2EX3 A;  4E1N A;  1S1U A;  1IKX A;  3K2P A;  4M41 A;  3V1Q A;  3SQ0 A;  1J5O A;  3K5L A;  3L2Q A;  3LP0 A;  1ASU A;  3AVL A;  4DQS A;  1L3U A;  1KLM A;  1BL3 A;  3DYA A;  4N41 A;  3HP9 A;  2DY4 A;  2G8K A;  5I42 A;  1T8E A;  5DK5 A;  3MEG A;  2YNF A;  4B3O A;  1C1A A;  4CE9 A;  1Q9Y A;  4IKF A;  3ZT3 A;  3PX4 A;  1X9S A;  1YTU A;  1VSM A;  2GBZ A;  4GMJ B;  5CZ1 A;  5CYQ A;  3KJV A;  2Y1J A;  4B9M A;  4FJI A;  4CGJ A;  3M8S A;  3AO1 A;  4FLZ A;  1NK6 A;  3IG1 A;  3SUP A;  2O4I A;  2DFH A;  1TL3 A;  1C0U A;  4FJL A;  1WSH A;  2BAN A;  1QE1 A;  3IAY A;  4CJQ A;  1BGX T;  3AVM A;  3K5O A;  3AVH A;  3LAN A;  1JLE A;  2IGI A;  1S1T A;  3I0S A;  4B9U A;  2QXF A;  4EZ9 A;  1B9F A;  4M3U A;  4NCB A;  3K5M A;  3SQ2 A;  1S6P A;  3VQB A;  3QNO A;  2HHW A;  3ALY A;  1XI1 A;  1Z26 A;  2WON A;  3AVA A;  4B9T A;  1DTQ A;  4DQQ A;  3A2F A;  1C1C A;  1TGO A;  3AO2 A;  3NHG A;  1KFD A;  1XC9 A;  4CFC A;  1JLG A;  4KKO A;  3O3H A;  3KD1 E;  2P51 A;  1IKW A;  5SWM A;  2DTU A;  1A5X A;  4RW7 A;  4KHY A;  3ZSO A;  2GUI A;  3OYM A;  4DMN A;  3LZJ A;  1RDC A;  4AHR A;  1B9D A;  1C6V A;  1SKR A;  3V1O A;  3OVN A;  3JYT A;  2KW4 A;  1RTD A;  3S3N A;  4ICL A;  2P5O A;  3LP1 A;  2G8U A;  2HNY A;  1JLC A;  4B8A B;  1NJY A;  4I9Q A;  2YHB A;  3DI6 A;  4DFJ A;  2X6S A;  3ASM A;  2G8I A;  2OPP A;  1EKE A;  3DLK A;  3KK2 A;  1T03 A;  3SQ1 A;  3V4I A;  1NJZ A;  2HHX A;  1UAX A;  4CF1 A;  3NDK A;  3MXM A;  4OVL A;  4FJX A;  1Y97 A;  3IRX A;  3VQE A;  3ZSY A;  2FBY A;  4CIG A;  3KK1 A;  3U3Y A;  4B9N A;  1RCH A;  1FXX A;  4MQ3 A;  3VQ5 A;  2HMI A;  3AA3 A;  4OKK A;  4KHW A;  4W5N A;  1RDA A;  3QNN A;  4ZTJ A;  1UA0 A;  2BDP A;  3OYH A;  3HPH A;  4HUG A;  4DFM A;  2PYJ A;  4DWI A;  4DTS A;  1SL2 A;  1C0T A;  2OZS A;  3NCI A;  1L3S A;  4FJG A;  1KTQ A;  2B6A A;  2X74 A;  3QER A;  4ZTF A;  1NK9 A;  1J9A A;  3E01 A;  1Q9X A;  3KD5 E;  1RT6 A;  3S3O A;  2VWJ A;  2G8F A;  4FZY A;  4Z4I A;  4M3R A;  1S6Q A;  4W5Q A;  3OS2 A;  4CF0 A;  1WAF A;  2IOC A;  1WLJ A;  3QET A;  2HVI A;  4AHC A;  4JLH A;  4CGH A;  5EU7 A;  1NK0 A;  4KTQ A;  5JS1 A;  1S9G A;  4CHY A;  3IS9 A;  2PZS A;  2LSN A;  4CJ3 A;  2YKM A;  4R5P A;  1U47 A;  1JLQ A;  4M3W A;  2KTQ A;  3C6U A;  2FBV A;  4HTU A;  3VA0 A;  3RMB A;  2YV0 X;  1RBS A;  5HP1 A;  2YNI A;  1J54 A;  4O55 A;  4B8C A;  2D0B A;  1TV6 A;  3CG7 A;  3KKS A;  4DTO A;  2HW3 A;  4EZ6 A;  3ZT4 A;  3OYG A;  4I2P A;  4IDK A;  1GOA A;  1RT5 A;  4DQP A;  1CLQ A;  3DRP A;  5CZ2 A;  3NF6 A;  1JLA A;  2P5G A;  4FW2 A;  4LH5 A;  5J2N A;  5JS2 A;  5I3U A;  1JXB A;  3TAB A;  1LV5 A;  4FJJ A;  1ITG A;  1SL1 A;  2ZD1 A;  3CQ8 A;  3DLG A;  3TAG A;  2OPR A;  3SV4 A;  4PWD A;  2RPI A;  1N6Q A;  4CJE A;  3HXM A;  3OYB A;  1VSK A;  2VG7 A;  3KKR A;  4O0I A;  3BGR A;  3V1R A;  4W5O A;  3OS1 A;  3LAM A;  5FDL A;  3VQA A;  4Q0B A;  1ZBI A;  3CFO A;  3VQ4 A;  3LWL A;  2DFF A;  1TAU A;  1K6Y A;  4IG3 A;  2PYL A;  1REV A;  3OYK A;  3QIO A;  1WSJ A;  2BGG A;  3DOK A;  3DMJ A;  3ZSX A;  4OKE A;  4TSX A;  2Z1J A;  4FJH A;  4RW4 A;  4PUO A;  1TVR A;  3CM5 A;  3LP3 A;  3JSM A;  2R7Y A;  1NOY A;  2HNZ A;  4MFB A;  3RMC A;  3NAE A;  3SNN A;  4DU1 A;  2G8H A;  2FBX A;  3DM2 A;  4BAC A;  1WSE A;  5HRS A;  3OYD A;  1ZBF A;  1RTJ A;  3VQC A;  1W0H A;  2HHU A;  1JLB A;  1RDB A;  3NFA A;  4DTP A;  2OPQ A;  1NKB A;  3UIQ A;  4F2S A;  3D0P A;  1IO2 A;  2FBT A;  2YNH A;  1RT2 A;  3HVT A;  4DLE A;  4YFU A;  5CYM A;  1B92 A;  2G8W A;  1LW0 A;  1Z25 A;  5KGW A;  4Z4H A;  4YNQ A;  3HJF A;  3DRS A;  4KPY A;  2ITG A;  4RG8 A;  4CES A;  1FK9 A;  1S5J A;  4LH4 A;  3WNF A;  4I7F A;  3ZSR A;  2OYQ A;  4FVM A;  1UWB A;  2QKK A;  3WNE A;  4CJ5 A;  4CJ4 A;  3B6O A;  3L2U A;  4FJ8 A;  4C8N A;  5HRP A;  4M3X A;  3THV A;  1FKO A;  3AVF A;  3KIO A;  4CFA A;  4M42 A;  5J1E A;  3ZSZ A;  1BI4 A;  4DSI A;  4FK2 A;  4M3T A;  1JL2 A;  3L3U A;  4CGD A;  3RR7 A;  1WSI A;  4CJF A;  3S3M A;  2HHT A;  4NYF A;  3OYF A;  3DLR A;  3MXJ A;  3OJS A;  3VN5 A;  1JLF A;  4J2D A;  4E7J A;  2ETJ A;  4N76 A;  1TKX A;  4GVM A;  3KLE A;  2VWK A;  4H4O A;  1LAW A;  1KRP A;  3SPY A;  4QOZ B;  4OPK A;  3NE6 A;  3AVI A;  3KTQ A;  1KVC A;  3I0R A;  1X1P A;  4PA1 A;  5HBM A;  3KLG A;  3PO4 A;  3G0Z A;  4CJU A;  2ATQ A;  4O44 A;  3HVR A;  4KHQ A;  1HNI A;  3RRG A;  4BDZ A;  4BDP A;  3NF8 A;  2PY5 A;  1J53 A;  1DLO A;  4AHT A;  3V6D A;  3ULD A;  1HQE A;  4LSL A;  1A5V A;  2XHB A;  3SUN A;  3SUO A;  4B9L A;  2YNG A;  3AVN A;  3MEE A;  3QEW A;  5DMR A;  3V9X A;  4CER A;  4KFB A;  3TAE A;  5J2P A;  1L3V A;  1YTA A;  1RTI A;  1TAQ A;  4BWJ A;  3OJU A;  4JRP A;  3VQD A;  2JLE A;  3HP6 A;  3HPG A;  4H8K A;  4BE1 A;  3SV3 A;  1NK4 A;  3NF7 A;  4CIF A;  1CXQ A;  1HPZ A;  4HVJ A;  4DLG A;  5FRN A;  2KZM A;  3ITH A;  4FM2 A;  4E0D A;  5FRO A;  4CEZ A;  4ID5 A;  1IKY A;  1C0M A;  1RT3 A;  3AVG A;  3O4Q A;  2OA8 A;  4DTX A;  3SQ4 A;  1QQC A;  4LY7 A;  3HO1 A;  1BI4 B;  3LP2 A;  4DG1 A;  2D0A A;  1BHL A;  3H08 A;  3DLB A;  4F8R A;  4B9S A;  2KFN A;  1VSI A;  3P83 D;  4Z0U A;  1BIZ A;  4DS4 A;  4HUE A;  3SI6 A;  4C8O A;  3U6F A;  1KCF A;  3PO5 A;  1ASW A;  1L5U A;  4F4K A;  4F2R A;  3DRR A;  3C94 A;  1S1X A;  3SZ2 A;  1WAJ A;  2O4G A;  1JL1 A;  4OJR A;  1TK5 A;  1RNH A;  1VRU A;  4OGC A;  4KRF A;  4Z4F A;  3OS0 A;  1U45 A;  4HCC A;  2D0C A;  2F96 A;  4CFB A;  1UOC A;  3KLH A;  1RBT A;  1EP4 A;  3PX6 A;  3T3F A;  3TAQ A;  3M8Q A;  3OYI A;  4BE0 A;  4NYN A;  3LAK A;  1NKC A;  1VSH A;  2X6N A;  4W5T A;  1SV5 A;  2E4L A;  2ZQB A;  2IDO A;  3T1A A;  4Q5V A;  1G15 A;  3VQ6 A;  4CJT A;  4W5R A;  4C8K A;  4DSL A;  2XRI A;  4AHS A;  3HPO A;  3NH1 A;  3HYF A;  3OYJ A;  3QLH A;  3MAQ A;  4HUF A;  3P1G A;  3M8R A;  3P5J A;  3O3G A;  3TI0 A;  1QS4 A;  4DSF A;  1LWE A;  4CGG A;  5KTQ A;  4FJM A;  4DFK A;  1KSP A;  4CEB A;  1BCM A;  1ZBU A;  4IG0 A;  3ISN C;  4KO0 A;  4O5B A;  1KFS A;  1A5W A;  2WOM A;  2EHG A;  4NCG A;  1HQU A;  4AHV A;  1Q8I A;  2DFE A;  3AO5 A;  3QES A;  1CZ9 A;  1S9E A;  4K8X A;  4DQI A;  1IH7 A;  4IFY A;  4WE1 A;  2RF2 A;  4CEA A;  3BDP A;  4KI6 A;  4PY5 A;  2HHS A;  4JS4 A;  1U49 A;  1XWL A;  1T7P A;  4C8M A;  4CJL A;  4O0J A;  4FW1 A;  4CIE A;  5KRT A;  1DTT A;  3O3F A;  4DF4 A;  1FKP A;  2W42 A;  2Z1G A;  3CFR A;  1SKS A;  4FM0 A;  3L3V A;  3DLH A;  5D3G A;  4M3Y A;  4N47 A;  4Y1D A;  3VQQ A;  4OKJ A;  4JS5 A;  4FM1 A;  2KFZ A;  4E1M A;  1LW2 A;  4QAG A;  4KHS A;  3LPT A;  1HRH A;  4QCL A;  2ZE2 A;  4EP4 A;  3AVC A;  3RMA A;  3WNH A;  3OYE A;  3CM6 A;  3C6T A;  1F21 A;  4ID1 A;  2IC3 A;  4FJK A;  3AVB A;  2E6M A;  4RW8 A;  4F3T A;  3ZT0 A;  4DFP A;  3AO4 A;  1RIL A;  4FJN A;  3TAF A;  3RTV A;  4H4M A;  4G1Q A;  1I3A A;  5J2M A;  3RR8 A;  1BIS A;  1LWF A;  4CFD A;  1BQM A;  2P1J A;  2Z1H A;  4CEE A;  4CK3 A;  4HHT A;  4RW9 A;  4E7K A;  1S1V A;  1GOB A;  3K5N A;  4KHU A;  3F9K A;  3L2W A;  5C25 A;  2D5R A;  3V9U A;  3KK3 A;  4AIL C;  2G8V A;  4FLW A;  4CCH A;  4CGI A;  4CK1 A;  4L8R B;  4CEO A;  3EY1 A;  3PV8 A;  1LWC A;  3EZ5 A;  4IBN A;  4J2A A;  4KI4 A;  2GV9 A;  3WNG A;  1GOC A;  1NKE A;  1QSS A;  3HK2 A;  1D9F A;  1NK8 A;  3QEI A;  4FLX A;  2QK9 A;  1TK0 A;  4M3Z A;  3ZSW A;  1X9W A;  3NGZ A;  5KRS A;  3L8B A;  4DU4 A;  4DS5 A;  3AA5 X;  3TR8 A;  1RBU A;  4KHN A;  3DOL A;  4BWM A;  3S9H A;  3TWH A;  2F8S A;  3G10 A;  2KQ2 A;  4CED A;  4IFV A;  4ELU A;  3KLI A;  3AA4 A;  2IS3 A;  3VQ7 A;  2XY8 A;  3C95 A;  3QEX A;  3MXI A;  2JGU A;  1D5A A;  4I2Q A;  1KVA A;  4FLU A;  3VQ9 A;  4CJK A;  1NJX A;  4E19 A;  3K57 A;  3NH2 A;  4CJS A;  5K14 A;  3OYC A;  3CFP A;  3TAR A;  1HNV A;  5HRR A;  2YHA A;  4FXD A;  1VSE A;  3PUF A;  3LWM A;  1VK0 A;  1X9M A;  4B9V A;  4FJ9 A;  1VSL A;  1WNS A;  3L2R A;  1HJR A;  2BE2 A;  1HYV A;  1NK5 A;  3AV9 A;  4OPJ A;  4KAZ A;  1RT1 A;  4FJ5 A;  3HST B;  4FK4 A;  2B5J A;  1I39 A;  4N56 A;  3V81 A;  1N5Y A;  3SCX A;  4Y1C A;  4M45 A;  1TKT A;  2AJQ A;  1U48 A;  4CF9 A;  3RWU A;  2NUB A;  4Z4C A;  1S1W A;  4CF8 A;  1TKD A;  1EX4 A;  3D45 A;  1HMV A;  4DU3 A;  4JRQ A;  4CEC A;  1JXE A;  4KRE A;  1MU2 A;  4CGF A;  4EP5 A;  4KB0 A;  1BCO A;  1NOZ A;  3HL8 A;  4CK2 A;  3QEP A;  4FLV A;  4FJ7 A;  1XHZ A;  4J2E A;  2FC0 A;  3MED A;  4GW6 A;  3AVK A;  4FK0 A;  4DTM A;  3SPZ A;  1U04 A;  4XIU A;  4J2B A;  1ZYQ A;  4K8Z A;  3NH0 A;  3K58 A;  3SJJ A;  1WN7 A;  4AHU A;  4CJW A;  1C1B A;  1TKZ A;  3TAN A;  1D8Y A;  1TK8 A;  3AO3 A;  4HCB A;  2KZZ A;  4B08 A;  3DLE A;  3VQP A;  1L3T A;  2Z1I A;  4E7I A;  2QKB A;  2I5J A;  3B6P A;  5HLF A;  4DSJ A;  4FZX C;  1RT4 A;  1VRT A;  3VA3 A;  4CF2 A;  4Z4G A;  3ZT2 A;  3OYA A;  3PY8 A;  3OYL A;  1KLN A;  2IAJ A;  4DTR A;  4OLB A;  3L2V A;  3OYN A;  4ELT A;  4KTZ A;  2VG6 A;  5HRO A;  1NK7 A;  4FZZ A;  3KLF A;  5KI6 A;  2RN2 A;  4PQU A;  3NF9 A;  1HYS A;  2XO7 A;  3AVJ A;  2HB5 A;  5C24 A;  1D9D A;  4F3O A;  2F8T A;  4O4G A;  1LAV A;  1QSY A;  3MEC A;  1QHT A;  1KVB A;  2OPS A;  5SZT A;  2HHQ A;  4OLA A;  2A1S A;  5C42 A;  4ELV A;  2RKI A;  4CHO A;  1RTH A;  3VQ8 A;  1IG9 A;  4DSE A;  4FLY A;  2HVH A;  1T05 A;  3F73 A;  3V9Z A;  3NBP A;  3FFI A;  1YVU A;  1CXU A;  3TAM A;  3ZSQ A;  1JKH A;  4ZHR A;  5KGX A;  4N5S A;  4UQG A;  3I8D A;  1UA1 A;  2OZM A;  4FYD A;  3LAL A;  4KV8 A;  2YKN A;  3HT3 A;  1XHX A;  1ASV A;  4E7H A;  4RW6 A;  4CJR A;  3LPU A;  4DTU A;  3TAP A;  3ZCM A;  4LD0 A;  4NCA A;  4DF8 A;  1SUQ A;  3QIN A;  2VG5 A;  3ZT1 A;  4CEQ A;  1IKV A;  4CHZ A;  4CHP A;  4CJV A;  4BE2 A;  4DSK A;  1O1W A;  3AA2 A;  4DTJ A;  3SUQ A;  1WSF A;  4BDY A;  4E7L A;  4FCY A;  1VSJ A;  4E89 A;  3EYZ A;  1QTM A;  5FRM A;  1RT7 A;  1VSD A;  2XY6 A;  2B4J A;  4CHQ A;  1RBR A;  2HND A;  5J2Q A;  4E3S A;  3SYZ A;  3NGY A;  4CEF A;  1RDD A;  3HM9 A;  3V9W A;  1BIU A;  3K59 A;  4DTN A;  4Z4E A;  1BQN A;  4OGE A;  2Y1I A;  5T7B A;  4CJP A;  1EET A;  1WSG A;  1YT3 A;  1U4B A;  1ZBH A;  2E6L A;  4I9L A;  4AH9 A;  4C8L A;  1TL1 A;  3RRH A;  4LSN A;  1VSF A;  5HRN A;  3OY9 A;  3QO9 A;  4KB1 A;  1W9H A;  1RBV A;  3T19 A;  3NGI A;  3QEV A;  1HYZ A;  1QSL A;  3ZSV A;  3LZI A;  4KTW A;  5CY4 A;  3V9S A;  4DQR A;  3PX0 A;  3CYM A;  2XY5 A;  1SKW A;  2HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...