1VSIA

Asv integrase core domain with ca(ii) cofactor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 51
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsiA00
1I3AA 5JS2A 1VSIA 3V81A 4RW6A 2KFNA 2G8VA 2DFHA 4AHVA 1RTJA 1TK0A 1RBVA 3V1QA 4CFDA 3ASMA 3NGZA 4HCCA 5J1EA 1VSKA 4GW6A 1ZBLA 3KKRA 1VK0A 4WE1A 3SV3A 1S6QA 2R7YA 3NGIA 4DSFA 1JLEA 1TAUA 2OPQA 1W9HA 4DTNA 4M3TA 4O44A 4CEEA 2KZMA 2VG6A 3B6PA 4CJ4A 4FJGA 1IKYA 2O4IA 3NF9A 3H08A 2GBZA 1KLMA 3NH1A 4B8AB 3L2WA 1C1AA 4E1NA 1RBSA 3ZT2A 1VSMA 2D0AA 1HPZA 3MECA 5EU7A 3MEEA 4KB1A 4KPYA 2YNHA 1T8EA 1KLNA 2HVHA 3S3OA 1S6PA 4DFKA 2DFFA 4EZ6A 3FFIA 4O55A 3SQ0A 1FKPA 3F73A 1HMVA 3HP9A 1L3SA 2GV9A 3IG1A 4Y1CA 1BIUA 4DQPA 4CGJA 4OKJA 3DRPA 4CEAA 4KHYA 4NYNA 4NCBA 5HLFA 3V1RA 4DLEA 1XI1A 1VRUA 2BANA 3CG7A 4BWJA 5J2QA 2PYJA 5C42A 3TWHA 3AVNA 4O5BA 1TAQA 1NOZA 1FXXA 1SKRA 1KFSA 4I9LA 3PX4A 1EX4A 2YKMA 4M3RA 3NHGA 4OPKA 3QLHA 3OYNA 4FJ9A 1SL0A 1TGOA 4CJ3A 3F9KA 4TSXA 3AV9A 4DF8A 5KRSA 2Q3SA 4QAGA 3TANA 1D8YA 2OPSA 4FK2A 2IC3A 2BGGA 3C95A 3AVBA 4CEBA 1RILA 3AVHA 4EP4A 3V9UA 4C8OA 4DSIA 4OPJA 1O1WA 4CEOA 1EKEA 1KVAA 4DTUA 1EXQA 1I39A 1S1TA 4LH4A 4CJVA 1RT2A 2AJQA 3T19A 4B9SA 4KTZA 4KI4A 5C24A 4DWIA 4IFVA 4IDKA 2Z1HA 1XWLA 1JLQA 2XY8A 3ZSRA 3E01A 1QSYA 1Q8IA 2G8FA 2HNZA 3ZSQA 1NK8A 1CLQA 1NOYA 1UA0A 3VA3A 4FCYA 5FDLA 5HRSA 3ZT0A 2KTQA 2FBXA 4JRPA 3KLEA 4DU4A 3MEDA 3IRXA 2KW4A 3WNGA 3OYJA 3S9HA 2X74A 4B08A 1XHXA 2Y1IA 1U48A 4CJTA 4CF2A 1JXBA 1DTTA 3QNNA 1BIZA 1RCHA 2ITGA 3RRHA 3TI0A 1QQCA 4CEFA 4CESA 4ELUA 2OPPA 2KZZA 3OJSA 3OYGA 4DTSA 4FJIA 4Z4EA 2HHWA 4N56A 2YNFA 5CZ2A 5DMRA 4BDZA 2E4LA 5FROA 1CZ9A 4DTOA 1S1XA 1NJWA 3VQ4A 3HSTB 3TAQA 4O0JA 2X6SA 4FLUA 3ISNC 1JKHA 1S5JA 3KIOA 3KK2A 3K59A 3DYAA 3QEIA 5HBMA 1LWEA 1MU2A 2F96A 3CYMA 4BWMA 4CHNA 4FLWA 3MXMA 1BI4A 1NK5A 1LAVA 2Z1JA 3B6OA 4ELVA 3CFPA 1IH7A 1J5OA 3VQ5A 3LANA 1ASUA 4HTUA 5DK5A 1U4BA 1WAFA 1A5XA 4C8MA 1BHLA 3QO9A 4W5QA 3K2PA 4BE1A 1U04A 1BISA 3HPGA 3OYIA 5I3UA 4CJFA 4DSJA 2X78A 4KHSA 4MFBA 1L5UA 3RR8A 4DSEA 1TL1A 4Z0UA 4Z4CA 1RT4A 3LWMA 3K5MA 1YT3A 3OYLA 3O3HA 3PX6A 1LW2A 1UOCA 4CERA 1IKWA 1ITGA 1CXQA 4OVLA 1TKTA 4ELTA 1JLAA 1Y97A 3LP0A 2RF2A 1C0MA 2PY5A 1JLFA 3AVIA 3NF7A 4DTPA 1QSLA 3DLHA 2HVIA 4HUEA 4DU3A 4DSKA 1BCMA 1BL3A 4FJMA 3KLFA 4OKKA 4FJXA 4Y1DA 1J54A 3G10A 3MAQA 3QIPA 2Y1JA 1T05A 4FJKA 1TV6A 3AVLA 3SJJA 4F8RA 3OYEA 4CIEA 1KCFA 3NF6A 4CHYA 3C6UA 2XY5A 3ZT3A 3KJVA 4DS4A 4CIGA 3PUFA 1S1VA 4YFUA 1ZBHA 4RW8A 4AHUA 4FM1A 4DU1A 4FJLA 4J2BA 4E89A 4C8NA 4CK2A 2OPRA 2WOMA 5T7BA 2NUBA 4JS5A 4BE2A 3V9WA 1B9FA 1G15A 3QNOA 1NK7A 2G8WA 1VSEA 2XO7A 5CYMA 3NFAA 3V1OA 1T7PA 3VQPA 1NJZA 4K8XA 3SPYA 1NJYA 4HUFA 1SKWA 2DY4A 3VQDA 4CECA 5E41A 3HPHA 4FLYA 2YNGA 3QETA 3RR7A 2VWKA 3ZSXA 4KO0A 1SL2A 4MQ3A 4AHCA 3D0PA 1WNSA 3A2FA 4CGFA 1ASVA 1TKZA 1HNIA 4Z4IA 1HNVA 3KLGA 3SUNA 1XC9A 3ALYA 3LALA 3CM6A 4CJSA 1VSFA 2B5JA 4JRQA 3DM2A 3MXIA 4ID5A 4M3ZA 1S1UA 4HUGA 5KRTA 1HJRA 3MEGA 4ID1A 3PX0A 3HXMA 2HHQA 2IAJA 4NCAA 1RT3A 3OJUA 1C0UA 4W5TA 1LWFA 1QSSA 4FM2A 3THVA 4J2EA 1RBRA 2P5OA 4B9MA 4FZZA 1RT7A 3BDPA 2EX3A 4O0IA 1WSGA 4DQIA 3KLIA 3WNFA 1XHZA 5C25A 4KRFA 4QCLA 1NK6A 1JL1A 4E3SA 1X9SA 3OYCA 1KTQA 4AH9A 1WSEA 4LH5A 3V9SA 3PY8A 4C8LA 1HYZA 3ZCMA 1FK9A 5KGXA 4BDYA 3LP2A 3ULDA 2YHBA 3SUQA 3O3GA 4CGGA 2YHAA 4Q5VA 2G8HA 4KHWA 5FRMA 5J2NA 4DSLA 2ATQA 4RW7A 1D9FA 2LSNA 4CF9A 3ZT1A 4E19A 3L8BA 3PO4A 3V9XA 1HQEA 4CGDA 3LP3A 4CJQA 1S1WA 3NDKA 2QKBA 4CCHA 5SZTA 3SQ1A 3SPZA 3VQ8A 4FW1A 4KHNA 3P1GA 3OY9A 1ASWA 3LPUA 2DFEA 4KB0A 3SUPA 4LSLA 4AHSA 4CJWA 3U6FA 1NK4A 4KHQA 1VSDA 4F2RA 3QEVA 1ZBFA 2IGIA 3NH2A 2XY6A 3SQ2A 3RMBA 2WONA 4B9VA 2G8IA 4KFBA 4M3XA 1TL3A 1J53A 1A5WA 3RMAA 2QXFA 2IS3A 3P5JA 1VSHA 4CFBA 4FJ5A 1HYVA 3HL8A 1BI4B 4KI6A 5KI6A 3OYAA 2HW3A 3OYHA 5I42A 3KTQA 4KTQA 1RTHA 2F8TA 3ZSZA 2Z1GA 4CJUA 4M3UA 4FJ8A 2P51A 3OYBA 2YNIA 1S9EA 1ZBIA 1WSJA 4IG0A 1YTAA 3SQ4A 1JLGA 1LW0A 1Z26A 2P1JA 4IG3A 4KTWA 3TAMA 3OS2A 1DTQA 1D5AA 3HPOA 2OA8A 4CFCA 4CGHA 3I0SA 1TK8A 4N76A 2G8UA 4FXDA 3ZT4A 4DQSA 4I2PA 3KLHA 1TVRA 1BQNA 3SI6A 4FJHA 1LAWA 3DLKA 3RTVA 1TKXA 1NKEA 4E7HA 4CE9A 4CJKA 3RMCA 2A1SA 3VQ9A 4CIFA 4M3YA 4G1QA 2E6LA 3C6TA 4J2AA 3VQ7A 3SZ2A 3QINA 3AVJA 1C0TA 3PO5A 4KAZA 1RBTA 1RDDA 4FZYA 3AA5X 3VA0A 3ZSYA 3OS1A 1C1BA 3HK2A 4KHUA 1CXUA 2D0CA 1NK9A 4H8KA 3HP6A 2OYQA 2JLEA 3LZJA 1C6VA 2QK9A 3QESA 3V4IA 1N6QA 3HJFA 4FM0A 3TAFA 3K58A 3CFOA 2XY7A 1D9DA 3VQQA 4F3TA 4FJ7A 2HNDA 1A5VA 4IBNA 4PY5A 2IDOA 3EY1A 3K5LA 4C8KA 1U47A 4JS4A 4PWDA 4ZTJA 2ZQBA 4UQGA 3NH0A 2A1RA 3RRGA 4FLTA 3OVNA 3D45A 3VQAA 4W5OA 2FC0A 1QS4A 4E7LA 4EP5A 1F21A 5KGWA 1RT1A 4HHTA 1GOCA 5KTQA 1BGXT 4KV8A 4R5PA 4I9QA 3ZSWA 5K14A 3K5OA 3PV8A 4W5NA 3AA2A 4CF0A 3P83D 4RW4A 3LWLA 5D3GA 1WAJA 3VQEA 4M42A 1B92A 3KK1A 2HHVA 5CY4A 4DTMA 3QEXA 4Z4FA 3G0ZA 4DMNA 1IO2A 3DLBA 1BCOA 4DTJA 1U49A 3IAYA 4F2SA 1WN7A 4HCBA 1ZBUA 2KFZA 3QEWA 3VQCA 2P5GA 4YNQA 1RBUA 1GOAA 1S9GA 4I2QA 5HRRA 4CJLA 4DTXA 5FRNA 3KKSA 1QHTA 3S3MA 4CGIA 1K6YA 3L3VA 2RN2A 3DMJA 4FK0A 3EZ5A 2X6NA 3V6DA 2ETJA 4M3WA 4E1MA 2Z1IA 4CEZA 1IKXA 4NCGA 4FJNA 5SWMA 3AO3A 4CHQA 5HP1A 4K8ZA 2XRIA 5CZ1A 3UIQA 3NF8A 1C1CA 3HVTA 3JYTA 2W42A 3CFRA 1WSIA 3O4QA 4E7JA 3RWUA 3LAKA 3DRRA 4LSNA 1T03A 1WSFA 4DLGA 4I7FA 4PQUA 4EZ9A 4CK1A 3DI6A 4AHTA 4CF1A 4DFPA 2EHGA 1U45A 2OZSA 1L3UA 4H4MA 4CFAA 4RW9A 1ZYQA 2PYLA 3AVKA 3WNHA 3OYMA 4BACA 2KQ2A 1LV5A 4LY7A 3DRSA 3NGYA 3OS0A 3O4NA 1RNHA 3LP1A 3V9ZA 1IG9A 3O3FA 4B9TA 1EETA 1RDBA 3LPTA 4CF8A 2QKKA 1J9AA 2FBVA 3I8DA 4FLXA 4LD0A 1KFDA 2FBYA 3HYFA 2PZSA 4F4KA 3AVCA 3NE6A 4M45A 3AO4A 3HVRA 3NAEA 3C94A 3DOKA 3OYDA 3OYKA 3K5NA 3SUOA 4DQRA 3L2VA 4DQQA 3ZSVA 4B3OA 1RTIA 1RDCA 3AA3A 4CHZA 3AVGA 3LZIA 3S3NA 1VSJA 3TAPA 2HB5A 4F3OA 4FLZA 2BDPA 1VSLA 2ZE2A 1BQMA 4Z4HA 3MXJA 4NYFA 3VN5A 1HQUA 1W0HA 3L2RA 3QERA 1RT6A 1L3TA 3KD5E 1JLBA 2FBTA 4RG8A 3ZSOA 3HT3A 1UA1A 3DLGA 3L2UA 3TARA 1N5YA 3DLEA 3L2QA 4DTRA 3M8SA 1KSPA 4B9UA 4OGEA 1EP4A 1WSHA 4E7IA 3M8RA 2E6MA 2G8KA 5HRPA 4KREA 4BDPA 4Q0BA 3AA4A 3I0RA 1X9MA 4AILC 3DLRA 4DF4A 3QIOA 1UWBA 1X9WA 4OKEA 1JL2A 4FLVA 1GOBA 3VQBA 2VWJA 4HVJA 4ZTFA 3ITHA 3U3GA 2YKNA 4N5SA 4E7KA 5JS1A 4GMJB 2B6AA 1L3VA 4ICLA 4N41A 2IOCA 3DOLA 4BE0A 4Z4GA 1KRPA 1SKSA 5J2MA 4L8RB 4CHPA 4M41A 4CJPA 4B8CA 4FK4A 3KD1E 5J2PA 4FW2A 1LWCA 3NCIA 4FYDA 3SNNA 3AVFA 3HM9A 1SUQA 2OZMA 3HO1A 3AO5A 2RKIA 3SCXA 3TAEA 2YV0X 2HHUA 1FKOA 1TKDA 3TABA 2D5RA 2JGUA 4CJRA 1Q9XA 1R0AA 2F8SA 2I5JA 1HYSA 4FJJA 4GVMA 3CM5A 1KVCA 1REVA 2XHBA 3QEPA 3M8PA 2BE2A 2HNYA 3TAGA 1RTDA 3AVAA 3WNEA 4XIUA 3U3YA 3VQ6A 1Q9YA 5HRNA 4ZHRA 3SV4A 4IFYA 4W5RA 4OGCA 4J2DA 1IKVA 4CJ5A 3IS9A 4CEQA 4OLBA 4CJEA 2HHXA 1WLJA 1CZBA 4DG1A 1RT5A 4IKFA 4CHOA 3K57A 2VG7A 3TR8A 3SYZA 4H4OA 3AVMA 4CEDA 1UAXA 4O4GA 2GUIA 1TK5A 2HMIA 4DFMA 2DTUA 1NJXA 1RDAA 1SV5A 4B9LA 4OJRA 2B4JA 4N47A 5HROA 4B9NA 1SL1A 1NKBA 3L3UA 4KKOA 3JSMA 1Z25A 3AO2A 1KVBA 1YVUA 5CYQA 3EYZA 3BGRA 4CK3A 3T3FA 4PA1A 3AO1A 2ZD1A 3CQ8A 3KK3A 1QE1A 4DS5A 3OYFA 4DFJA 1QTMA 4OLAA 1X1PA 3LAMA 1JLCA 3LDSA 1B9DA 3NBPA 1VRTA 4FVMA 4AHRA 1NKCA 4FZXC 4E0DA 2HHSA 1NK0A 1JXEA 1YTUA 2VG5A 1DLOA 2D0BA 2RPIA 3M8QA 3T1AA 4QOZB 2HHTA 2O4GA 3RMDA 4PUOA 4JLHA 1HRHA
chains in the Genus database with same CATH superfamily
1I3AA 1RTJA 3VOVA 1VSKA 5AQXA 2YHWA 4BREA 3SV3A 1S6QA 3NGIA 4JYAK 4DSFA 4M3TA 4O44A 1GLCG 4CEEA 1GLEG 4CJ4A 3L2WA 1KXPA 3EKUA 2D0PA 3NH1A 2JWKA 1RBSA 4IOXA 5DM6L 1QVGM 5A2QO 1OVYA 3AY9A 2D0AA 1NGHA 3MECA 5EU7A 5B8HA 1ZBSA 3WXIA 1Q18A 4DFKA 3FFIA 4O55A 4MLEA 4JKDA 1BIUA 4OKJA 3IUCA 4MO4A 3KVGA 1XI1A 2PYJA 2V7YA 5C42A 3TWHA 4BC2A 1SKRA 1FXXA 3OYNA 2CH5A 1VQ5N 4TSXA 5M1NA 5KRSA 3QICA 1P8ZA 4BROA 1D8YA 4FK2A 3C95A 4QS7A 4EP4A 4JAXA 5M1KA 3C0BA 1O1WA 3WXJA 4DTUA 1EKEA 4CJVA 2E20A 3T19A 3DWLA 4KI4A 3QFUA 4DV0K 4IDKA 1TYQB 2XY8A 2FSNA 2HNZA 2FLOA 1NOYA 3GG4A 2WTUA 4JRPA 4CZEA 1NNEA 2KW4A 4NLCA 4CESA 5M1OA 3RVCA 4WF9L 4FWLA 4N56A 1V4SA 1JCGA 1FJGK 5DMRA 1E4GT 1CZ9A 4DTOA 4BRNA 4K42A 3KK2A 3DYAA 4B1WB 3AGKA 1LWEA 1MU2A 1VQ4N 1KC8O 1LAVA 2Z1JA 3OHRA 3OW2M 1IH7A 1GLAG 2O8FB 4HTUA 1U4BA 3U9ZA 1NGBA 1BHLA 3CJ1A 3QO9A 3K2PA 4BE1A 3OYIA 1NGJA 4MFBA 3FZFA 1L5UA 3LWMA 2P9SA 3OYLA 1LW2A 1OH6A 1CXQA 4ELTA 3QMLA 4DSKA 2F9WA 4OKKA 1J54A 4ISEA 3ZYYX 3EZWA 4FWKA 4F8RA 3OYEA 4CIGA 1VAZA 1S1VA 4C23A 4YFUA 1ZBHA 4FM1A 4B1UB 3THYB 4J2BA 4E89A 2OPRA 2NUBA 3CJAA 1HNXK 3QNOA 1G15A 3OBWA 2UYTA 2XO7A 1T7PA 3E9PA 4K8XA 4HUFA 2DY4A 4CECA 4FLYA 4BG9A 2YNGA 4KHPK 4XH5A 2VWKA 4KO0A 1ASVA 3LALA 4JRQA 3DM2A 4HUGA 2IVOA 1NWKA 3J81O 4EIAA 4NCAA 1SZ2A 4W5TA 1LWFA 1T3VA 4FZZA 1QHAA 1SS6A 3BDPA 4DQIA 1JL1A 1X9SA 4DB3A 4JHDA 4AH9A 4LH5A 3PY8A 3K9JA 3MN9A 5JMVA 1NM1A 3D2EA 4C1NI 1Q7YO 3LP2A 1HLUA 2YHBA 3O3GA 3FZLA 4YDUA 4Q5VA 2G8HA 4IZ9A 3FLCO 2QWMA 4JK9A 2YJFA 3NDKA 1S1WA 4O8UA 3U4LA 4FWNA 3C7NB 2QWOA 3PLAA 1VSDA 1LOTB 4YY3K 2XY6A 3ENHA 3RMBA 3ENOA 3D6RA 1VSHA 2WC9A 4KI6A 3GOIA 2VQEK 5I42A 3KTQA 4KTQA 3CF5L 2E2NA 5GAGP 1YTAA 1C0FA 1JLGA 1Z26A 3QDKA 4IG3A 2E2OA 1DTQA 3HPOA 4JI2K 5LMNK 4CZGA 5ELZA 1LAWA 4FJHA 3RTVA 3NVMA 1NKEA 1I94K 4X62K 2W6LA 3H45C 4CJKA 3RMCA 4PL7A 4CIFA 3DAWA 1IJJA 4BRHA 3C6TA 4JNEA 4KH5A 4JI0K 4FL9A 1C0TA 3PO5A 1RDDA 3OBYA 2VWBA 3VETA 1J5EK 3HP6A 2IVPA 2QW9A 1C6VA 2QK9A 3QESA 3HJFA 4H5VA 4BGAA 1TYQA 3K58A 5BPNA 3O9SA 4IBNA 4XH4A 2IDOA 4PY5A 3EY1A 1GLDG 5EY4A 4X66K 1NU0A 3RRGA 2HBKA 2YX6A 3D45A 3VQAA 1QS4A 4BRCA 4E7LA 5KGWA 1P90A 5F1XA 1GOCA 5KTQA 1BGXT 4KV8A 4I9QA 4Z94A 3LWLA 5AQPA 1WAJA 4H0VB 5CY4A 4Z4FA 3QEXA 2E1ZA 1IO2A 4DTJA 1U49A 1WN7A 3GBTA 3DLLL 5JVGL 2Q97A 2P9KB 1RBUA 1GOAA 4I2QA 1WUAA 1LCUA 3KKSA 4B9QA 3S3MA 2O8FA 2OANA 4X65K 1XQSC 3SJHA 4I6MB 2Z1IA 3VPZA 4A2BA 4K8ZA 5AFUH 4A61A 3ID6A 1QZ5A 3NF8A 5AQNA 2W42A 1YITN 4PKHA 4E7JA 4LSNA 4H0XB 5AQJA 4PQUA 4JD2B 3M3ZA 4BR2A 4H4MA 4CFAA 4BACA 2GELA 4LY7A 1KAZA 3OS0A 1RNHA 4B9TA 4CF8A 2HBMA 3THYA 1NG9A 4IFEA 4F4KA 3AVCA 3OTOK 3SUOA 5JICA 5GIOA 4DQRA 4DQQA 1GLFO 1RTIA 3LZIA 2QWRA 1VSJA 4F3OA 4FLZA 1Q82O 1VSLA 1RDWX 4LF6K 3MWPA 3QERA 1VHXA 1RT6A 1VQLN 3MDQA 1UA1A 3VMFB 3DLGA 3QFPA 3TARA 3G25A 1EP4A 3BF1A 4BDPA 4Q0BA 1X9MA 2HOEA 4DR7K 1X9WA 3Q7CA 1GOBA 5ADXH 1W97L 3M5RA 5JS1A 3T7ZA 3QBWA 3DOLA 4BE0A 1SKSA 2W40A 4CHPA 4DR5K 4FK4A 5AQHA 3KD1E 2ZGZA 1LWCA 4FYDA 4LF7K 3UB5A 3TAEA 2YV0X 3AARA 2DPNA 4CJRA 2I7PA 4DV1K 2BE2A 5CR4A 2ITMA 3J7ZO 4IFYA 1N8RO 3IS9A 4B1ZA 5C0YA 4DV5K 4CHOA 2VG7A 3TR8A 5M1FA 4H4OA 3WQTA 3SYZA 3ATUA 4UY8O 1SV5A 2P9PB 2KLAA 2KKZA 1SL1A 3CJCA 4KKOA 3VEWA 2F4VK 3DXMB 1Z25A 3O4WA 1EO1A 4CK3A 2YI1A 3KK3A 1K8KB 1QTMA 1SQKA 3L4IA 3LAMA 1GLJO 4CJ7A 1OVQA 3I8BA 4AHRA 4FZXC 2HHSA 4BR4A 2VG5A 2RPIA 4HWIA 2O4GA 3RMDA 1VSIA 4DR2K 3V81A 2GX9A 1MWKA 4RW6A 4BRQA 2KFNA 2DFHA 4AHVA 3BZCA 4FWPA 4LFCK 1ZBLA 3CC7N 3FR0A 4EHTA 5AQMA 3R3LA 1K8AO 2OPQA 2VGNA 4DCHA 2KZMA 4FJGA 1IKYA 2O4IA 3NF9A 3H08A 5MLCQ 4BRIA 5F2RA 1C1AA 4CBWA 4GV9A 3CHWA 3Q7BA 1HPZA 4KB1A 2YNHA 2GEMA 1KLNA 3S3OA 4O5FA 3SQ0A 1FKPA 4LFAK 1L3SA 3TSUA 3IG1A 4AM7A 3DRPA 4KHYA 2P9KA 5HLFA 1U2VB 2BANA 4BWJA 2AA4A 3CIPA 3LDPA 4K41A 4BRLA 4I9LA 1EX4A 2YKMA 3NHGA 4I6MA 1TGOA 3AV9A 4BY9C 4CZIA 3AVBA 4BR0A 4CEBA 3FZKA 3V9UA 4C8OA 1KVAA 4JD2A 2WFBA 4LH4A 2QWLA 4H0YB 2HF4A 3R1XA 2Z1HA 1XWLA 3ZSRA 4CZKA 5FPNA 2UUBK 3UKUB 4FCYA 5HRSA 1N33K 4FOEA 1NGEA 2KTQA 2FBXA 4NB4A 3KLEA 3OYJA 2X74A 1XHXA 1U48A 1HKGA 3QNNA 1RCHA 4ELUA 1VQPN 4JKFA 2OPPA 3ZX3A 3DJCA 3D2FB 2CH6A 5CZ2A 4RCHA 4BDZA 4H5WA 3HSTB 4H5RA 3PIPL 2F96A 4CHNA 1BI4A 4ELVA 1WB9A 5LJVA 3LANA 4BRAA 3H1VX 3CCEN 2Q31A 4WCEL 5EX5A 3O9TA 5I3UA 4KHSA 1EWQA 2X78A 3O9RA 4DSEA 1TL1A 3LDNA 1KAXA 1UOCA 3O1BA 4A2AA 4FWSA 4OVLA 1TKTA 1W7AA 1Y97A 2PY5A 3HZ6A 1JLFA 3AVIA 1QSLA 3CCVN 3ZLJA 5IWAK 3K0SA 1BCMA 4FJMA 3KLFA 4YOWA 4B3TK 1T05A 3CC4N 1TV6A 3AVLA 3MX2A 4CHYA 3C6UA 1BWFO 2XY5A 3G6EN 3SK3A 3A5OC 4DU1A 4FJLA 5GAEP 5T7BA 4C8NA 4BE2A 2WOMA 3V9WA 4F3TA 3VGLA 1B9FA 3VEXA 4HTLA 3NFAA 3V1OA 3VQPA 1NJZA 2QWNA 3QETA 4JI1K 1WNSA 1TKZA 1HNVA 1YJNN 2P9PA 1XC9A 1MWMA 3ALYA 3CM6A 5AQIA 1VSFA 2B5JA 1XNQK 3DXMA 4ID5A 1S1UA 5KRTA 1HJRA 2QM1A 3HXMA 3ZEUB 1S72N 4WQ4C 3O80A 4QCLA 4KRFA 1WSEA 3L0QA 1FK9A 5KGXA 4BDYA 3LM9A 4B1YB 1JJ2M 5FRMA 5J2NA 4DSLA 4RW7A 1D9FA 2NRWA 5AQOA 4E19A 3L8BA 2UXDK 4CJQA 2Q0RA 3LP3A 4CCHA 5SZTA 3VQ8A 3EE9A 3OY9A 3LPUA 4KB0A 1NK4A 4KHQA 2O8CB 3NH2A 2WONA 2ZF5O 1TL3A 1J53A 1A5WA 1EQYA 3ULEB 1HYVA 3HL8A 5KQ8A 3OYHA 4U7BA 1YVNA 1V4TA 2H3GX 2Z1GA 2P51A 3OYBA 2YNIA 4JI7K 1ZBIA 2P9LB 3SQ4A 3TAMA 1LW0A 3CXCM 1U2VA 1D5AA 3I0SA 4N76A 1NJIO 1XNRK 3H3OB 4I2PA 4DQ8A 2ZJRL 1BQNA 3SI6A 3DLKA 1TKXA 3BF3A 4M3YA 2A3ZA 1BU6O 4BC4A 3VQ7A 3QINA 4KAZA 1RBTA 4FZYA 4M7XA 3OS1A 3TSQA 1X9JA 1NK9A 4IEEA 5AQFA 3MMVA 2JLEA 2RE2A 3GE1A 3A0IX 2ZM6K 2NRRA 3LL3A 3CFOA 3VQQA 4A59A 2NRVA 3LM2A 1A5VA 5BN8A 1WBDA 3G71N 4ZTJA 3NH0A 2A1RA 5AR0A 4FLTA 4W5OA 3WEEB 4EP5A 1F21A 1NMNA 5E84A 4RTFD 4R5PA 5K14A 1Z05A 4GY2B 4W5NA 4CF0A 3P83D 3D2FA 4RW4A 3IKMA 3CCRN 4M42A 3KK1A 4JKAA 3G0ZA 4DMNA 3DLBA 3P38A 4F2SA 3VQCA 2P5GA 2EWSA 4CJLA 3FGUA 4DKWA 3DMJA 4FK0A 3CJ7A 1ZC6A 1K73O 3LDQA 3D7EO 1S3XA 2VGMA 5SWMA 1JCEA 4CHQA 5HP1A 5CZ1A 3HVTA 2AP1A 3HSCA 3O4QA 4OPHA 4KH4A 4LF8K 4H5TA 4DLGA 3A8YA 3THWB 4CF1A 2EHGA 1J6ZA 3P39A 2V7ZA 4RW9A 4CZJA 3AVKA 3WNHA 2KQ2A 2HSTA 3CJ9A 3WQUA 3LP1A 1IG9A 1X3MA 3LPTA 2QKKA 4YOXA 3VENA 1BG3A 3I8DA 4EAHD 4FLXA 1KFDA 4BGBA 2PZSA 3OYKA 2HF3A 3L2VA 1RDCA 4FWRA 4Z4HA 4GVEA 3MXJA 3L2RA 1JLBA 3HT3A 2WBNA 4FWQA 4ILGB 2ASPA 5TKWA 5M1PA 5F0XA 4XEIA 3L2QA 4G9ZA 3WXLA 2G8KA 2E6MA 3ZEUA 5AQYA 3DLRA 1M1KO 4OKEA 3VTIA 3F5TA 2UU9K 2YKNA 4E7KA 2B6AA 2IOCA 4Z4GA 1KRPA 4L8RB 3NMUA 1HPMA 3AVFA 1TUYA 3HM9A 3HO1A 3AO5A 3IDHA 1XMQK 1TKDA 1Q9XA 2I5JA 4FJJA 4GVMA 3QEPA 2ASMA 3BUZB 3TAGA 3AVAA 4JKHA 2VYPA 3T69A 3WNEA 4DUZK 2OCEA 5AQWA 1Q9YA 2O8CA 1Y64A 5HRNA 4OGCA 1Q86O 4CJ5A 4CJEA 3CCJN 1WLJA 2NRZA 3ULEA 1RT5A 4IOCL 3K57A 1NLVA 4CEDA 4O4GA 2GUIA 2HMIA 1NMDA 4B9LA 2P9LA 3CPEA 4B9NA 4YOYA 1KVBA 2E88A 4CBUA 3OYFA 1X1PA 3NBPA 1NKCA 2UUCK 1NK0A 2E1YA 2D0BA 4QOZB 3M8QA 2QI2A 4FSVA 2HHTA 4JLHA 1HRHA 5JS2A 5HL7L 3CCSN 1TK0A 2YHXA 3V1QA 1YUWA 4GW6A 3KKRA 4GKJK 2R7YA 4YDUC 3JXUA 5AZJB 4JN4A 1W9HA 3UE5A 4DTNA 4BRGA 2VG6A 3HOTA 2A42A 2GBZA 4OX9K 1ATNA 4B8AB 3WEEA 5C10A 3TTCA 4E1NA 1SAZA 1YXQA 1VSMA 1ZXOA 4H5NA 2V51B 3VTHA 1BOTO 2GTDA 3VF4A 4EZ6A 3F73A 2GV9A 4DQPA 4CGJA 5LJWA 4CEAA 1XC3A 3N4PA 4NCBA 3VF2A 3SAFA 4DLEA 1VRUA 3CG7A 5J2QA 5TKYA 4FWOA 1TAQA 4IJAA 4OPAA 1KFSA 2NRHA 4OPKA 4ILJA 3QLHA 4FJ9A 4DF8A 1VQNN 3TTFA 3TANA 3O8MA 2OPSA 5CHIA 4DSIA 3EE8A 2GWKA 1EXQA 3THWA 4BQZA 2AJQA 1RT2A 4B9SA 4KTZA 4CI6A 1H1VA 3J7YP 4DWIA 3S41A 4CD1A 1JLQA 3E01A 1CLQA 1UA0A 2I7NA 3CETA 3A5MC 5FDLA 3MEDA 3E9OA 4MLHA 4B08A 2Y1IA 4CJTA 4CF2A 1JXBA 5AZIB 5GIPA 2GWJA 1BIZA 2ITGA 3RRHA 3TI0A 3C7NA 4CEFA 3BEXA 3OYGA 4DTSA 4FJIA 1HKCA 4Z4EA 4RWTA 2YNFA 2RHKA 4ILHA 1S1XA 3GL1A 3ZETB 4A5AA 3TAQA 4O0JA 4FLUA 3ISNC 1JKHA 3KIOA 3QEIA 5HBMA 4YHHK 3MXMA 3THXB 3CFPA 3E66A 3VQ5A 1ASUA 1WAFA 1A5XA 3WUHA 4C8MA 3W3DA 3CD6N 4H03B 1BISA 2QXLA 4DSJA 4Z0UA 4Z4CA 3K5MA 3O3HA 3PX6A 4CERA 4B1XB 2BUPA 4IXCA 2GUPA 3FE1A 2RF2A 1C0MA 3BY5A 4BVOA 5FLXO 4DTPA 3DLHA 1HUXA 1BL3A 4FJKA 5C12A 3G4SN 4J8FA 4CIEA 2PFUA 4ISFA 3O5BA 3ZT3A 3KJVA 4IWVA 3AAQA 1N36K 3PUFA 3MN6A 1IBMK 2IVNA 4JS5A 3SMPA 2G8WA 5FPEA 2F9TA 1NJYA 1SKWA 5AQSA 3VQDA 1N34K 3RR7A 3CQYA 4MQ3A 3D0PA 3K9KA 1HNIA 4Z4IA 2YCHA 3KLGA 3SUNA 4BRDA 2HHQA 3MEGA 3FFKB 4J2EA 2ZWHA 3THVA 1RBRA 2P5OA 4B9MA 3M1FA 3N4QA 2EX3A 3WNFA 2D4WA 1XHZA 5C25A 1NK6A 1KTQA 3VEVA 3PSIA 3V9SA 3IFRA 3ZCMA 1T6DA 4KBOA 2YHAA 5AQZA 2ATQA 2LSNA 4CF9A 4CVNE 3PO4A 4M7YA 1T6CA 3V9XA 4CGDA 3RSEB 2QKBA 4GKKK 1JCFA 4A62A 5AZJA 3P1GA 5KPRA 2DFEA 4YOVA 4LSLA 4AHSA 4CJWA 3QEVA 1ZBFA 2QWQA 4KFBA 4LC9B 4M3XA 2QXFA 2IS3A 2ASOA 3EEQA 3CPWM 4WQ4A 1RTHA 3ZX0A 3ZSZA 4CJUA 4IOAL 3ID8A 4M3UA 2A6AA 5BPMA 4PHTX 2F7TA 4IO8A 5KPTA 2P1JA 3OS2A 5GADP 2OA8A 4CFCA 1RFQA 1TK8A 4BR9A 3CCLN 3ZT4A 4JI8K 3KLHA 4IJNA 4E7HA 2VCPA 4CE9A 2QWPA 3VQ9A 4B3RK 4BR7A 5AJ3K 4J2AA 3SZ2A 4GV6A 3EO3A 3AA5X 3VA0A 3L6QA 3JS6A 1C1BA 1CXUA 2D0CA 5BR8K 1YIJN 3LZJA 5BRDA 4WQ5C 1N6QA 3C6AA 4FM0A 2XY7A 1D9DA 3P31A 2O8DB 4CD3A 4FJ7A 2HNDA 3QB0A 2V52B 3K5LA 4C8KA 1U47A 4JS4A 5EVZA 1HX1A 2VQFK 3OVNA 3O9UA 1IBLK 2FC0A 3M6GA 4HHTA 1MDUB 4U67L 1T44A 2CGJA 5AZIA 5IT9O 3PV8A 3AA2A 1QQNA 4DR1K 5D3GA 3VQEA 1B92A 2HHVA 2CGKA 3H3NO 4YOUA 3ZETA 3QEWA 2ZJPL 3CCMN 2FSKA 4YNQA 4DV7K 4OO1J 4BR5A 4DTXA 3THXA 1QHTA 4CZMA 4CGIA 4DR3K 1ATSA 1HR0K 4E1MA 3I55N 3F2KA 4CEZA 3WT0A 4CZHA 1IKXA 4NCGA 3AO3A 2XRIA 2Q36A 3UIQA 3JYTA 2D0OA 1WSIA 3QBXA 3LAKA 1K8KA 1WSFA 5EXWA 4DV6K 3AGRA 3H6EA 2KHOA 1U45A 4DFPA 1OH7A 4MO5A 1MA9B 4E1JA 3DRSA 3NGYA 4FWMA 3R9PA 1WOQA 3V9ZA 3O3FA 3LDLA 1EETA 1BA0A 1HJOA 1J9AA 2FBVA 4PL8A 4LD0A 1QQOA 1E4FT 1O13A 3NE6A 4X64K 3EKSA 4WFBL 3C94A 3DOKA 2E5LK 3ZSVA 4B3OA 4CHZA 3S3NA 2HB5A 1BUPA 1OH8A 2BH1A 2BDPA 2ZE2A 4NYFA 3KD5E 4EFHA 5C15A 2FBTA 4RG8A 3ZSOA 3L2UA 4AF1A 3DLEA 4O8KA 5GAHP 4DTRA 3M8SA 1KSPA 1QQMA 4OGEA 4B9UA 1WSHA 3M8RA 5LL6Z 5HRPA 4KREA 3F9MA 3BZKA 4AILC 5LMUK 3QIOA 1JL2A 3VQBA 3J7AP 3SBTA 4HVJA 4NXNK 4AQYK 1YJ9N 4DUYK 3SAGA 4N5SA 1L3VA 4N41A 4FPAA 1BA1A 5J2MA 5JVHL 3VF6A 3PSFA 4M41A 3WXKA 5J2PA 4FW2A 2E2PA 3VERA 4JI5K 2RKIA 3VESA 3SCXA 3FZMA 2HHUA 2JGUA 3RSEA 1VQON 2P9UB 1WBBA 3CM5A 1FW6A 1KVCA 2XHBA 2OTLN 1RTDA 3U3YA 3VQ6A 5AQKA 5JLFA 4OLBA 2HHHK 3CMEN 3IMXA 2HHXA 2UXBK 3UKUA 3SMSA 3VEOA 4QS9A 3AVMA 3JAMO 1UAXA 3C65A 4Y0WA 1QVFM 3HOSA 4QS8A 4JKGB 3JSMA 3AO2A 1YVUA 5CYQA 3EYZA 4F9OA 4PA1A 3CQ8A 1YJWN 3MK6A 4FVMA 2D1KA 4B3MK 2NZTA 4NXMK 4EHUA 4JKCA 5I9EB 2G8VA 1YAGA 1RBVA 4CFDA 3ASMA 3NGZA 4HCCA 5J1EA 4H0PA 4B3SK 1VK0A 4WE1A 5BPLA 4K0KK 4IO9L 2O8DA 3I33A 1JLEA 1TAUA 4JI4K 4PKGA 3TU5A 4JK7A 5CE3A 2FSJA 3B6PA 1KLMA 5HOOA 5C2FA 5AQRA 2Q0UA 3MN7A 4DV3K 3ZT2A 3MEEA 3MCPA 1T8EA 4KPYA 2HVHA 1E3MA 1S6PA 2IIRA 3WXMB 3KZBA 4WFAL 2DFFA 1TUUA 1HMVA 3HP9A 4IEIA 2J4RA 4Y1CA 3DXKB 3HRGA 3HM8A 4NYNA 4B1VA 3V1RA 2NNWA 3AVNA 4O5BA 1NOZA 5LY3A 3PX4A 4M3RA 2PAVA 3C6HA 1DKGD 1VQMN 1SL0A 4CJ3A 3F9KA 5AQVA 2Q3SA 2P9NB 5FPMA 4QAGA 2UXCK 4ISGA 5AQUA 3UKRB 1NGGA 2IC3A 2BGGA 3CQXA 1RILA 3AVHA 1EWRA 4OPJA 4CEOA 1S1TA 1I39A 5C24A 1BDGA 4IFVA 3ZX2A 2Q2RA 1QSYA 1Q8IA 2G8FA 3ZSQA 1NK8A 2UUAK 3H1QA 3VA3A 5AFUA 4DV2K 3ZT0A 1D4XA 4DU4A 3GDQA 3MWTA 3IRXA 1XMOK 3WNGA 3S9HA 2CGLA 1NGDA 3CC2N 1DTTA 2KZZA 1QQCA 4H0TB 2FF3B 3OJSA 2HHWA 3CCUN 2W41A 1KAYA 2E4LA 2YJEA 5FROA 1NJWA 3VQ4A 2X6SA 4BC5A 5KPZA 1S5JA 3K59A 2HVIA 3CYMA 4BWMA 4FLWA 1NK5A 1N32K 3B6OA 5E26A 1J5OA 5DK5A 3OA9A 2E2QA 5M1QA 4W5QA 1ILYA 1U04A 4NO7A 3HPGA 5DM7L 4CJFA 3RR8A 3CERA 1RT4A 2NLXA 1YT3A 1IKWA 1ITGA 3HI0A 1VQ7N 1JLAA 3LP0A 3NF7A 4FO0A 1YI2N 4DR4K 2O8EB 4HUEA 4JKBA 3CCQN 4DU3A 2ZGYA 3KWGA 1HNWK 4FJXA 4Y1DA 3MAQA 3G10A 1DEJA 3QIPA 4NLBA 2Y1JA 3SJJA 3NVKA 5ADXA 1KCFA 3NF6A 2P9UA 4WYBA 1NGAA 4DS4A 4YORA 1HKBA 3CI5A 4RW8A 4AHUA 4GNIA 1BO5O 3KK7A 4BRMA 4CK2A 2G8UA 4J2DA 1CZAN 2O8BB 4A5BA 1NK7A 1VSEA 2W6KA 5CYMA 1VQ9N 3SPYA 5E41A 3HPHA 3O9QA 3ZSXA 4JI3K 1SL2A 4AHCA 3A2FA 4CGFA 1RGIA 4JKGA 1G99A 4CJSA 4H0OA 3MXIA 3E1YA 4M3ZA 1OH5A 1Z6RA 4ID1A 1Q81O 3PX0A 1YF5L 2IAJA 1RT3A 3OJUA 1C0UA 1QSSA 4FM2A 2YHYA 2BTFA 1RT7A 4O0IA 1WSGA 3KLIA 1IG8A 4XH1A 2FF6A 4E3SA 3OYCA 2NRTA 1KD1O 4C8LA 1HYZA 3KWIA 4FOIA 3ULDA 3SUQA 4MDAA 4CGGA 4KHWA 4BVPA 3ZT1A 4M63C 4CW7B 1HQEA 3SLCA 3A5NC 3SQ1A 3SPZA 4FW1A 4KHNA 1ASWA 4JI6K 2PBDA 3R8EA 3SUPA 3U6FA 4F2RA 2A40A 2IGIA 3SQ2A 4B9VA 3CMAN 4DV4K 3W0LA 2G8IA 3RMAA 3L4QA 3P5JA 4CFBA 4FJ5A 1BI4B 3EN9A 5KI6A 3OYAA 2HW3A 2F8TA 3U8XA 4L3QA 2Q1NA 2P9IB 3HBTA 4FJ8A 5BRFA 4AM6A 3H46O 1S9EA 2HBJA 4CZLA 1WSJA 1K9MO 4IG0A 5BR9A 3DXKA 4CBXA 4KTWA 3ENBA 4CGHA 4R79A 4FXDA 1DGKN 4DQSA 3MCAB 4BRPA 5C2DA 1TVRA 4PKIA 2OTJN 3EL2A 1NGCA 4C1NK 3TSPA 3FZHA 4BG8A 1YHQN 2A1SA 2P9NA 4G1QA 3KHYA 3UKRA 2E6LA 1VQ8N 1R59O 1S22A 3AVJA 4LF5K 4BC3A 4K25A 1QZ6A 3ZSYA 3HK2A 4KHUA 4H8KA 2OYQA 3U9DA 3V4IA 1NBWA 3TAFA 2NRXA 4YOTA 4PWDA 2ZQBA 4UQGA 3VEYA 2HMPA 2FXUA 3O08A 1RT1A 3MN5A 5BN9A 4KH6A 3I56N 3ZSWA 4DR6K 3K5OA 1W2BM 4WFNL 3E9LA 4V19S 3MX5A 3CJBA 4DTMA 1ATRA 1GLBG 1BCOA 3IAYA 4HCBA 1ZBUA 2KFZA 1X3NA 1S9GA 5HRRA 5FRNA 5GINA 1K6YA 3L3VA 1DT9A 2RN2A 4WQ5A 3EZ5A 2X6NA 3V6DA 2ETJA 4M3WA 3A5LC 4LFBK 5JLHA 4FJNA 1VQKN 3TPQA 4JEPA 1C1CA 3CFRA 3RWUA 3DRRA 1T03A 4I7FA 4EZ9A 4CK1A 3DI6A 4AHTA 4A57A 3T1YK 2OZSA 2O8EA 1L3UA 5AQQA 1ZYQA 2PYLA 4JK8A 5KQDA 3OYMA 1LV5A 1XUPO 3O4NA 3LDOA 2HBLA 1RDBA 1IV0A 1KQSM 4BRKA 2FBYA 3HYFA 4DHYA 2O8BA 4GV3A 4M45A 2QEXN 4LF9K 3AO4A 3HVRA 3NAEA 1ESVA 4K43A 3OYDA 3K5NA 1C0GA 1HNZK 3AA3A 3AVGA 4IDHA 2QTDA 3TAPA 1M90O 1BQMA 1YTUA 3VN5A 1HQUA 1W0HA 1L3TA 1IBKK 1NGFA 1N5YA 3SAHA 1VQ6N 3P4IA 2A41A 4FPBA 5FPDA 1GLLO 4E7IA 4BRFA 3AA4A 3I0RA 2E8AA 4DF4A 1UWBA 4FLVA 1U6ZA 2VWJA 4FVUA 4ZTFA 3ITHA 3U3GA 2P9SB 4GMJB 4ICLA 4CJPA 4B8CA 2QA4N 3NCIA 3SNNA 1NGIA 1SUQA 3AAPA 2OZMA 4LF4K 1FKOA 3BP8A 3TABA 2D5RA 3SBGA 1HYSA 4JV5K 1R0AA 2F8SA 5BRHA 1REVA 4JKEA 3M8PA 2HNYA 5H1SQ 3O6WA 1OKJA 5AQTA 4XIUA 4ZHRA 3SV4A 4W5RA 1IKVA 4CEQA 2JWLA 3T1HK 5AQLA 1CZBA 4DG1A 4IKFA 3J8AA 1RDUA 3HTVA 3R6MA 3VEZA 1TK5A 2DTUA 3B8AX 2P9IA 4DFMA 1NJXA 1RDAA 2WUSA 4CZFA 3PIOL 3ATVA 4OJRA 2B4JA 4MDBA 4N47A 5HROA 5BREA 1NKBA 3L3UA 3BGRA 5EOYA 3T3FA 3AO1A 2ZD1A 4DFJA 1QE1A 4DS5A 4OLAA 1JLCA 3O1WA 3LDSA 1B9DA 3TTDA 1VRTA 5AQGA 4BQLA 2A5XA 4E0DA 3J80O 4JHDB 1JXEA 1DLOA 3T1AA 2ZJQL 3VGKA 3D2EB 4PUOA 3VGMA
chains in the Genus database with same CATH topology
1I3AA 5JS2A 1VSIA 3V81A 4RW6A 2KFNA 2G8VA 2DFHA 4AHVA 1RTJA 1TK0A 1RBVA 3V1QA 4CFDA 3ASMA 3NGZA 4HCCA 5J1EA 1VSKA 4GW6A 1ZBLA 3KKRA 1VK0A 4WE1A 3SV3A 1S6QA 2R7YA 3NGIA 4DSFA 1JLEA 1TAUA 2OPQA 1W9HA 4DTNA 4M3TA 4O44A 4CEEA 2KZMA 2VG6A 3B6PA 4CJ4A 4FJGA 1IKYA 2O4IA 3NF9A 3H08A 2GBZA 1KLMA 3NH1A 4B8AB 3L2WA 1C1AA 4E1NA 1RBSA 3ZT2A 1VSMA 2D0AA 1HPZA 3MECA 5EU7A 3MEEA 4KB1A 4KPYA 2YNHA 1T8EA 1KLNA 2HVHA 3S3OA 1S6PA 4DFKA 2DFFA 4EZ6A 3FFIA 4O55A 3SQ0A 1FKPA 3F73A 1HMVA 3HP9A 1L3SA 2GV9A 3IG1A 4Y1CA 1BIUA 4DQPA 4CGJA 4OKJA 3DRPA 4CEAA 4KHYA 4NYNA 4NCBA 5HLFA 3V1RA 4DLEA 1XI1A 1VRUA 2BANA 3CG7A 4BWJA 5J2QA 2PYJA 5C42A 3TWHA 3AVNA 4O5BA 1TAQA 1NOZA 1FXXA 1SKRA 1KFSA 4I9LA 3PX4A 1EX4A 2YKMA 4M3RA 3NHGA 4OPKA 3QLHA 3OYNA 4FJ9A 1SL0A 1TGOA 4CJ3A 3F9KA 4TSXA 3AV9A 4DF8A 5KRSA 2Q3SA 4QAGA 3TANA 1D8YA 2OPSA 4FK2A 2IC3A 2BGGA 3C95A 3AVBA 4CEBA 1RILA 3AVHA 4EP4A 3V9UA 4C8OA 4DSIA 4OPJA 1O1WA 4CEOA 1EKEA 1KVAA 4DTUA 1EXQA 1I39A 1S1TA 4LH4A 4CJVA 1RT2A 2AJQA 3T19A 4B9SA 4KTZA 4KI4A 5C24A 4DWIA 4IFVA 4IDKA 2Z1HA 1XWLA 1JLQA 2XY8A 3ZSRA 3E01A 1QSYA 1Q8IA 2G8FA 2HNZA 3ZSQA 1NK8A 1CLQA 1NOYA 1UA0A 3VA3A 4FCYA 5FDLA 5HRSA 3ZT0A 2KTQA 2FBXA 4JRPA 3KLEA 4DU4A 3MEDA 3IRXA 2KW4A 3WNGA 3OYJA 3S9HA 2X74A 4B08A 1XHXA 2Y1IA 1U48A 4CJTA 4CF2A 1JXBA 1DTTA 3QNNA 1BIZA 1RCHA 2ITGA 3RRHA 3TI0A 1QQCA 4CEFA 4CESA 4ELUA 2OPPA 2KZZA 3OJSA 3OYGA 4DTSA 4FJIA 4Z4EA 2HHWA 4N56A 2YNFA 5CZ2A 5DMRA 4BDZA 2E4LA 5FROA 1CZ9A 4DTOA 1S1XA 1NJWA 3VQ4A 3HSTB 3TAQA 4O0JA 2X6SA 4FLUA 3ISNC 1JKHA 1S5JA 3KIOA 3KK2A 3K59A 3DYAA 3QEIA 5HBMA 1LWEA 1MU2A 2F96A 3CYMA 4BWMA 4CHNA 4FLWA 3MXMA 1BI4A 1NK5A 1LAVA 2Z1JA 3B6OA 4ELVA 3CFPA 1IH7A 1J5OA 3VQ5A 3LANA 1ASUA 4HTUA 5DK5A 1U4BA 1WAFA 1A5XA 4C8MA 1BHLA 3QO9A 4W5QA 3K2PA 4BE1A 1U04A 1BISA 3HPGA 3OYIA 5I3UA 4CJFA 4DSJA 2X78A 4KHSA 4MFBA 1L5UA 3RR8A 4DSEA 1TL1A 4Z0UA 4Z4CA 1RT4A 3LWMA 3K5MA 1YT3A 3OYLA 3O3HA 3PX6A 1LW2A 1UOCA 4CERA 1IKWA 1ITGA 1CXQA 4OVLA 1TKTA 4ELTA 1JLAA 1Y97A 3LP0A 2RF2A 1C0MA 2PY5A 1JLFA 3AVIA 3NF7A 4DTPA 1QSLA 3DLHA 2HVIA 4HUEA 4DU3A 4DSKA 1BCMA 1BL3A 4FJMA 3KLFA 4OKKA 4FJXA 4Y1DA 1J54A 3G10A 3MAQA 3QIPA 2Y1JA 1T05A 4FJKA 1TV6A 3AVLA 3SJJA 4F8RA 3OYEA 4CIEA 1KCFA 3NF6A 4CHYA 3C6UA 2XY5A 3ZT3A 3KJVA 4DS4A 4CIGA 3PUFA 1S1VA 4YFUA 1ZBHA 4RW8A 4AHUA 4FM1A 4DU1A 4FJLA 4J2BA 4E89A 4C8NA 4CK2A 2OPRA 2WOMA 5T7BA 2NUBA 4JS5A 4BE2A 3V9WA 1B9FA 1G15A 3QNOA 1NK7A 2G8WA 1VSEA 2XO7A 5CYMA 3NFAA 3V1OA 1T7PA 3VQPA 1NJZA 4K8XA 3SPYA 1NJYA 4HUFA 1SKWA 2DY4A 3VQDA 4CECA 5E41A 3HPHA 4FLYA 2YNGA 3QETA 3RR7A 2VWKA 3ZSXA 4KO0A 1SL2A 4MQ3A 4AHCA 3D0PA 1WNSA 3A2FA 4CGFA 1ASVA 1TKZA 1HNIA 4Z4IA 1HNVA 3KLGA 3SUNA 1XC9A 3ALYA 3LALA 3CM6A 4CJSA 1VSFA 2B5JA 4JRQA 3DM2A 3MXIA 4ID5A 4M3ZA 1S1UA 4HUGA 5KRTA 1HJRA 3MEGA 4ID1A 3PX0A 3HXMA 2HHQA 2IAJA 4NCAA 1RT3A 3OJUA 1C0UA 4W5TA 1LWFA 1QSSA 4FM2A 3THVA 4J2EA 1RBRA 2P5OA 4B9MA 4FZZA 1RT7A 3BDPA 2EX3A 4O0IA 1WSGA 4DQIA 3KLIA 3WNFA 1XHZA 5C25A 4KRFA 4QCLA 1NK6A 1JL1A 4E3SA 1X9SA 3OYCA 1KTQA 4AH9A 1WSEA 4LH5A 3V9SA 3PY8A 4C8LA 1HYZA 3ZCMA 1FK9A 5KGXA 4BDYA 3LP2A 3ULDA 2YHBA 3SUQA 3O3GA 4CGGA 2YHAA 4Q5VA 2G8HA 4KHWA 5FRMA 5J2NA 4DSLA 2ATQA 4RW7A 1D9FA 2LSNA 4CF9A 3ZT1A 4E19A 3L8BA 3PO4A 3V9XA 1HQEA 4CGDA 3LP3A 4CJQA 1S1WA 3NDKA 2QKBA 4CCHA 5SZTA 3SQ1A 3SPZA 3VQ8A 4FW1A 4KHNA 3P1GA 3OY9A 1ASWA 3LPUA 2DFEA 4KB0A 3SUPA 4LSLA 4AHSA 4CJWA 3U6FA 1NK4A 4KHQA 1VSDA 4F2RA 3QEVA 1ZBFA 2IGIA 3NH2A 2XY6A 3SQ2A 3RMBA 2WONA 4B9VA 2G8IA 4KFBA 4M3XA 1TL3A 1J53A 1A5WA 3RMAA 2QXFA 2IS3A 3P5JA 1VSHA 4CFBA 4FJ5A 1HYVA 3HL8A 1BI4B 4KI6A 5KI6A 3OYAA 2HW3A 3OYHA 5I42A 3KTQA 4KTQA 1RTHA 2F8TA 3ZSZA 2Z1GA 4CJUA 4M3UA 4FJ8A 2P51A 3OYBA 2YNIA 1S9EA 1ZBIA 1WSJA 4IG0A 1YTAA 3SQ4A 1JLGA 1LW0A 1Z26A 2P1JA 4IG3A 4KTWA 3TAMA 3OS2A 1DTQA 1D5AA 3HPOA 2OA8A 4CFCA 4CGHA 3I0SA 1TK8A 4N76A 2G8UA 4FXDA 3ZT4A 4DQSA 4I2PA 3KLHA 1TVRA 1BQNA 3SI6A 4FJHA 1LAWA 3DLKA 3RTVA 1TKXA 1NKEA 4E7HA 4CE9A 4CJKA 3RMCA 2A1SA 3VQ9A 4CIFA 4M3YA 4G1QA 2E6LA 3C6TA 4J2AA 3VQ7A 3SZ2A 3QINA 3AVJA 1C0TA 3PO5A 4KAZA 1RBTA 1RDDA 4FZYA 3AA5X 3VA0A 3ZSYA 3OS1A 1C1BA 3HK2A 4KHUA 1CXUA 2D0CA 1NK9A 4H8KA 3HP6A 2OYQA 2JLEA 3LZJA 1C6VA 2QK9A 3QESA 3V4IA 1N6QA 3HJFA 4FM0A 3TAFA 3K58A 3CFOA 2XY7A 1D9DA 3VQQA 4F3TA 4FJ7A 2HNDA 1A5VA 4IBNA 4PY5A 2IDOA 3EY1A 3K5LA 4C8KA 1U47A 4JS4A 4PWDA 4ZTJA 2ZQBA 4UQGA 3NH0A 2A1RA 3RRGA 4FLTA 3OVNA 3D45A 3VQAA 4W5OA 2FC0A 1QS4A 4E7LA 4EP5A 1F21A 5KGWA 1RT1A 4HHTA 1GOCA 5KTQA 1BGXT 4KV8A 4R5PA 4I9QA 3ZSWA 5K14A 3K5OA 3PV8A 4W5NA 3AA2A 4CF0A 3P83D 4RW4A 3LWLA 5D3GA 1WAJA 3VQEA 4M42A 1B92A 3KK1A 2HHVA 5CY4A 4DTMA 3QEXA 4Z4FA 3G0ZA 4DMNA 1IO2A 3DLBA 1BCOA 4DTJA 1U49A 3IAYA 4F2SA 1WN7A 4HCBA 1ZBUA 2KFZA 3QEWA 3VQCA 2P5GA 4YNQA 1RBUA 1GOAA 1S9GA 4I2QA 5HRRA 4CJLA 4DTXA 5FRNA 3KKSA 1QHTA 3S3MA 4CGIA 1K6YA 3L3VA 2RN2A 3DMJA 4FK0A 3EZ5A 2X6NA 3V6DA 2ETJA 4M3WA 4E1MA 2Z1IA 4CEZA 1IKXA 4NCGA 4FJNA 5SWMA 3AO3A 4CHQA 5HP1A 4K8ZA 2XRIA 5CZ1A 3UIQA 3NF8A 1C1CA 3HVTA 3JYTA 2W42A 3CFRA 1WSIA 3O4QA 4E7JA 3RWUA 3LAKA 3DRRA 4LSNA 1T03A 1WSFA 4DLGA 4I7FA 4PQUA 4EZ9A 4CK1A 3DI6A 4AHTA 4CF1A 4DFPA 2EHGA 1U45A 2OZSA 1L3UA 4H4MA 4CFAA 4RW9A 1ZYQA 2PYLA 3AVKA 3WNHA 3OYMA 4BACA 2KQ2A 1LV5A 4LY7A 3DRSA 3NGYA 3OS0A 3O4NA 1RNHA 3LP1A 3V9ZA 1IG9A 3O3FA 4B9TA 1EETA 1RDBA 3LPTA 4CF8A 2QKKA 1J9AA 2FBVA 3I8DA 4FLXA 4LD0A 1KFDA 2FBYA 3HYFA 2PZSA 4F4KA 3AVCA 3NE6A 4M45A 3AO4A 3HVRA 3NAEA 3C94A 3DOKA 3OYDA 3OYKA 3K5NA 3SUOA 4DQRA 3L2VA 4DQQA 3ZSVA 4B3OA 1RTIA 1RDCA 3AA3A 4CHZA 3AVGA 3LZIA 3S3NA 1VSJA 3TAPA 2HB5A 4F3OA 4FLZA 2BDPA 1VSLA 2ZE2A 1BQMA 4Z4HA 3MXJA 4NYFA 3VN5A 1HQUA 1W0HA 3L2RA 3QERA 1RT6A 1L3TA 3KD5E 1JLBA 2FBTA 4RG8A 3ZSOA 3HT3A 1UA1A 3DLGA 3L2UA 3TARA 1N5YA 3DLEA 3L2QA 4DTRA 3M8SA 1KSPA 4B9UA 4OGEA 1EP4A 1WSHA 4E7IA 3M8RA 2E6MA 2G8KA 5HRPA 4KREA 4BDPA 4Q0BA 3AA4A 3I0RA 1X9MA 4AILC 3DLRA 4DF4A 3QIOA 1UWBA 1X9WA 4OKEA 1JL2A 4FLVA 1GOBA 3VQBA 2VWJA 4HVJA 4ZTFA 3ITHA 3U3GA 2YKNA 4N5SA 4E7KA 5JS1A 4GMJB 2B6AA 1L3VA 4ICLA 4N41A 2IOCA 3DOLA 4BE0A 4Z4GA 1KRPA 1SKSA 5J2MA 4L8RB 4CHPA 4M41A 4CJPA 4B8CA 4FK4A 3KD1E 5J2PA 4FW2A 1LWCA 3NCIA 4FYDA 3SNNA 3AVFA 3HM9A 1SUQA 2OZMA 3HO1A 3AO5A 2RKIA 3SCXA 3TAEA 2YV0X 2HHUA 1FKOA 1TKDA 3TABA 2D5RA 2JGUA 4CJRA 1Q9XA 1R0AA 2F8SA 2I5JA 1HYSA 4FJJA 4GVMA 3CM5A 1KVCA 1REVA 2XHBA 3QEPA 3M8PA 2BE2A 2HNYA 3TAGA 1RTDA 3AVAA 3WNEA 4XIUA 3U3YA 3VQ6A 1Q9YA 5HRNA 4ZHRA 3SV4A 4IFYA 4W5RA 4OGCA 4J2DA 1IKVA 4CJ5A 3IS9A 4CEQA 4OLBA 4CJEA 2HHXA 1WLJA 1CZBA 4DG1A 1RT5A 4IKFA 4CHOA 3K57A 2VG7A 3TR8A 3SYZA 4H4OA 3AVMA 4CEDA 1UAXA 4O4GA 2GUIA 1TK5A 2HMIA 4DFMA 2DTUA 1NJXA 1RDAA 1SV5A 4B9LA 4OJRA 2B4JA 4N47A 5HROA 4B9NA 1SL1A 1NKBA 3L3UA 4KKOA 3JSMA 1Z25A 3AO2A 1KVBA 1YVUA 5CYQA 3EYZA 3BGRA 4CK3A 3T3FA 4PA1A 3AO1A 2ZD1A 3CQ8A 3KK3A 1QE1A 4DS5A 3OYFA 4DFJA 1QTMA 4OLAA 1X1PA 3LAMA 1JLCA 3LDSA 1B9DA 3NBPA 1VRTA 4FVMA 4AHRA 1NKCA 4FZXC 4E0DA 2HHSA 1NK0A 1JXEA 1YTUA 2VG5A 1DLOA 2D0BA 2RPIA 3M8QA 3T1AA 4QOZB 2HHTA 2O4GA 3RMDA 4PUOA 4JLHA 1HRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3A A;  5JS2 A;  1VSI A;  3V81 A;  4RW6 A;  2KFN A;  2G8V A;  2DFH A;  4AHV A;  1RTJ A;  1TK0 A;  1RBV A;  3V1Q A;  4CFD A;  3ASM A;  3NGZ A;  4HCC A;  5J1E A;  1VSK A;  4GW6 A;  1ZBL A;  3KKR A;  1VK0 A;  4WE1 A;  3SV3 A;  1S6Q A;  2R7Y A;  3NGI A;  4DSF A;  1JLE A;  1TAU A;  2OPQ A;  1W9H A;  4DTN A;  4M3T A;  4O44 A;  4CEE A;  2KZM A;  2VG6 A;  3B6P A;  4CJ4 A;  4FJG A;  1IKY A;  2O4I A;  3NF9 A;  3H08 A;  2GBZ A;  1KLM A;  3NH1 A;  4B8A B;  3L2W A;  1C1A A;  4E1N A;  1RBS A;  3ZT2 A;  1VSM A;  2D0A A;  1HPZ A;  3MEC A;  5EU7 A;  3MEE A;  4KB1 A;  4KPY A;  2YNH A;  1T8E A;  1KLN A;  2HVH A;  3S3O A;  1S6P A;  4DFK A;  2DFF A;  4EZ6 A;  3FFI A;  4O55 A;  3SQ0 A;  1FKP A;  3F73 A;  1HMV A;  3HP9 A;  1L3S A;  2GV9 A;  3IG1 A;  4Y1C A;  1BIU A;  4DQP A;  4CGJ A;  4OKJ A;  3DRP A;  4CEA A;  4KHY A;  4NYN A;  4NCB A;  5HLF A;  3V1R A;  4DLE A;  1XI1 A;  1VRU A;  2BAN A;  3CG7 A;  4BWJ A;  5J2Q A;  2PYJ A;  5C42 A;  3TWH A;  3AVN A;  4O5B A;  1TAQ A;  1NOZ A;  1FXX A;  1SKR A;  1KFS A;  4I9L A;  3PX4 A;  1EX4 A;  2YKM A;  4M3R A;  3NHG A;  4OPK A;  3QLH A;  3OYN A;  4FJ9 A;  1SL0 A;  1TGO A;  4CJ3 A;  3F9K A;  4TSX A;  3AV9 A;  4DF8 A;  5KRS A;  2Q3S A;  4QAG A;  3TAN A;  1D8Y A;  2OPS A;  4FK2 A;  2IC3 A;  2BGG A;  3C95 A;  3AVB A;  4CEB A;  1RIL A;  3AVH A;  4EP4 A;  3V9U A;  4C8O A;  4DSI A;  4OPJ A;  1O1W A;  4CEO A;  1EKE A;  1KVA A;  4DTU A;  1EXQ A;  1I39 A;  1S1T A;  4LH4 A;  4CJV A;  1RT2 A;  2AJQ A;  3T19 A;  4B9S A;  4KTZ A;  4KI4 A;  5C24 A;  4DWI A;  4IFV A;  4IDK A;  2Z1H A;  1XWL A;  1JLQ A;  2XY8 A;  3ZSR A;  3E01 A;  1QSY A;  1Q8I A;  2G8F A;  2HNZ A;  3ZSQ A;  1NK8 A;  1CLQ A;  1NOY A;  1UA0 A;  3VA3 A;  4FCY A;  5FDL A;  5HRS A;  3ZT0 A;  2KTQ A;  2FBX A;  4JRP A;  3KLE A;  4DU4 A;  3MED A;  3IRX A;  2KW4 A;  3WNG A;  3OYJ A;  3S9H A;  2X74 A;  4B08 A;  1XHX A;  2Y1I A;  1U48 A;  4CJT A;  4CF2 A;  1JXB A;  1DTT A;  3QNN A;  1BIZ A;  1RCH A;  2ITG A;  3RRH A;  3TI0 A;  1QQC A;  4CEF A;  4CES A;  4ELU A;  2OPP A;  2KZZ A;  3OJS A;  3OYG A;  4DTS A;  4FJI A;  4Z4E A;  2HHW A;  4N56 A;  2YNF A;  5CZ2 A;  5DMR A;  4BDZ A;  2E4L A;  5FRO A;  1CZ9 A;  4DTO A;  1S1X A;  1NJW A;  3VQ4 A;  3HST B;  3TAQ A;  4O0J A;  2X6S A;  4FLU A;  3ISN C;  1JKH A;  1S5J A;  3KIO A;  3KK2 A;  3K59 A;  3DYA A;  3QEI A;  5HBM A;  1LWE A;  1MU2 A;  2F96 A;  3CYM A;  4BWM A;  4CHN A;  4FLW A;  3MXM A;  1BI4 A;  1NK5 A;  1LAV A;  2Z1J A;  3B6O A;  4ELV A;  3CFP A;  1IH7 A;  1J5O A;  3VQ5 A;  3LAN A;  1ASU A;  4HTU A;  5DK5 A;  1U4B A;  1WAF A;  1A5X A;  4C8M A;  1BHL A;  3QO9 A;  4W5Q A;  3K2P A;  4BE1 A;  1U04 A;  1BIS A;  3HPG A;  3OYI A;  5I3U A;  4CJF A;  4DSJ A;  2X78 A;  4KHS A;  4MFB A;  1L5U A;  3RR8 A;  4DSE A;  1TL1 A;  4Z0U A;  4Z4C A;  1RT4 A;  3LWM A;  3K5M A;  1YT3 A;  3OYL A;  3O3H A;  3PX6 A;  1LW2 A;  1UOC A;  4CER A;  1IKW A;  1ITG A;  1CXQ A;  4OVL A;  1TKT A;  4ELT A;  1JLA A;  1Y97 A;  3LP0 A;  2RF2 A;  1C0M A;  2PY5 A;  1JLF A;  3AVI A;  3NF7 A;  4DTP A;  1QSL A;  3DLH A;  2HVI A;  4HUE A;  4DU3 A;  4DSK A;  1BCM A;  1BL3 A;  4FJM A;  3KLF A;  4OKK A;  4FJX A;  4Y1D A;  1J54 A;  3G10 A;  3MAQ A;  3QIP A;  2Y1J A;  1T05 A;  4FJK A;  1TV6 A;  3AVL A;  3SJJ A;  4F8R A;  3OYE A;  4CIE A;  1KCF A;  3NF6 A;  4CHY A;  3C6U A;  2XY5 A;  3ZT3 A;  3KJV A;  4DS4 A;  4CIG A;  3PUF A;  1S1V A;  4YFU A;  1ZBH A;  4RW8 A;  4AHU A;  4FM1 A;  4DU1 A;  4FJL A;  4J2B A;  4E89 A;  4C8N A;  4CK2 A;  2OPR A;  2WOM A;  5T7B A;  2NUB A;  4JS5 A;  4BE2 A;  3V9W A;  1B9F A;  1G15 A;  3QNO A;  1NK7 A;  2G8W A;  1VSE A;  2XO7 A;  5CYM A;  3NFA A;  3V1O A;  1T7P A;  3VQP A;  1NJZ A;  4K8X A;  3SPY A;  1NJY A;  4HUF A;  1SKW A;  2DY4 A;  3VQD A;  4CEC A;  5E41 A;  3HPH A;  4FLY A;  2YNG A;  3QET A;  3RR7 A;  2VWK A;  3ZSX A;  4KO0 A;  1SL2 A;  4MQ3 A;  4AHC A;  3D0P A;  1WNS A;  3A2F A;  4CGF A;  1ASV A;  1TKZ A;  1HNI A;  4Z4I A;  1HNV A;  3KLG A;  3SUN A;  1XC9 A;  3ALY A;  3LAL A;  3CM6 A;  4CJS A;  1VSF A;  2B5J A;  4JRQ A;  3DM2 A;  3MXI A;  4ID5 A;  4M3Z A;  1S1U A;  4HUG A;  5KRT A;  1HJR A;  3MEG A;  4ID1 A;  3PX0 A;  3HXM A;  2HHQ A;  2IAJ A;  4NCA A;  1RT3 A;  3OJU A;  1C0U A;  4W5T A;  1LWF A;  1QSS A;  4FM2 A;  3THV A;  4J2E A;  1RBR A;  2P5O A;  4B9M A;  4FZZ A;  1RT7 A;  3BDP A;  2EX3 A;  4O0I A;  1WSG A;  4DQI A;  3KLI A;  3WNF A;  1XHZ A;  5C25 A;  4KRF A;  4QCL A;  1NK6 A;  1JL1 A;  4E3S A;  1X9S A;  3OYC A;  1KTQ A;  4AH9 A;  1WSE A;  4LH5 A;  3V9S A;  3PY8 A;  4C8L A;  1HYZ A;  3ZCM A;  1FK9 A;  5KGX A;  4BDY A;  3LP2 A;  3ULD A;  2YHB A;  3SUQ A;  3O3G A;  4CGG A;  2YHA A;  4Q5V A;  2G8H A;  4KHW A;  5FRM A;  5J2N A;  4DSL A;  2ATQ A;  4RW7 A;  1D9F A;  2LSN A;  4CF9 A;  3ZT1 A;  4E19 A;  3L8B A;  3PO4 A;  3V9X A;  1HQE A;  4CGD A;  3LP3 A;  4CJQ A;  1S1W A;  3NDK A;  2QKB A;  4CCH A;  5SZT A;  3SQ1 A;  3SPZ A;  3VQ8 A;  4FW1 A;  4KHN A;  3P1G A;  3OY9 A;  1ASW A;  3LPU A;  2DFE A;  4KB0 A;  3SUP A;  4LSL A;  4AHS A;  4CJW A;  3U6F A;  1NK4 A;  4KHQ A;  1VSD A;  4F2R A;  3QEV A;  1ZBF A;  2IGI A;  3NH2 A;  2XY6 A;  3SQ2 A;  3RMB A;  2WON A;  4B9V A;  2G8I A;  4KFB A;  4M3X A;  1TL3 A;  1J53 A;  1A5W A;  3RMA A;  2QXF A;  2IS3 A;  3P5J A;  1VSH A;  4CFB A;  4FJ5 A;  1HYV A;  3HL8 A;  1BI4 B;  4KI6 A;  5KI6 A;  3OYA A;  2HW3 A;  3OYH A;  5I42 A;  3KTQ A;  4KTQ A;  1RTH A;  2F8T A;  3ZSZ A;  2Z1G A;  4CJU A;  4M3U A;  4FJ8 A;  2P51 A;  3OYB A;  2YNI A;  1S9E A;  1ZBI A;  1WSJ A;  4IG0 A;  1YTA A;  3SQ4 A;  1JLG A;  1LW0 A;  1Z26 A;  2P1J A;  4IG3 A;  4KTW A;  3TAM A;  3OS2 A;  1DTQ A;  1D5A A;  3HPO A;  2OA8 A;  4CFC A;  4CGH A;  3I0S A;  1TK8 A;  4N76 A;  2G8U A;  4FXD A;  3ZT4 A;  4DQS A;  4I2P A;  3KLH A;  1TVR A;  1BQN A;  3SI6 A;  4FJH A;  1LAW A;  3DLK A;  3RTV A;  1TKX A;  1NKE A;  4E7H A;  4CE9 A;  4CJK A;  3RMC A;  2A1S A;  3VQ9 A;  4CIF A;  4M3Y A;  4G1Q A;  2E6L A;  3C6T A;  4J2A A;  3VQ7 A;  3SZ2 A;  3QIN A;  3AVJ A;  1C0T A;  3PO5 A;  4KAZ A;  1RBT A;  1RDD A;  4FZY A;  3AA5 X;  3VA0 A;  3ZSY A;  3OS1 A;  1C1B A;  3HK2 A;  4KHU A;  1CXU A;  2D0C A;  1NK9 A;  4H8K A;  3HP6 A;  2OYQ A;  2JLE A;  3LZJ A;  1C6V A;  2QK9 A;  3QES A;  3V4I A;  1N6Q A;  3HJF A;  4FM0 A;  3TAF A;  3K58 A;  3CFO A;  2XY7 A;  1D9D A;  3VQQ A;  4F3T A;  4FJ7 A;  2HND A;  1A5V A;  4IBN A;  4PY5 A;  2IDO A;  3EY1 A;  3K5L A;  4C8K A;  1U47 A;  4JS4 A;  4PWD A;  4ZTJ A;  2ZQB A;  4UQG A;  3NH0 A;  2A1R A;  3RRG A;  4FLT A;  3OVN A;  3D45 A;  3VQA A;  4W5O A;  2FC0 A;  1QS4 A;  4E7L A;  4EP5 A;  1F21 A;  5KGW A;  1RT1 A;  4HHT A;  1GOC A;  5KTQ A;  1BGX T;  4KV8 A;  4R5P A;  4I9Q A;  3ZSW A;  5K14 A;  3K5O A;  3PV8 A;  4W5N A;  3AA2 A;  4CF0 A;  3P83 D;  4RW4 A;  3LWL A;  5D3G A;  1WAJ A;  3VQE A;  4M42 A;  1B92 A;  3KK1 A;  2HHV A;  5CY4 A;  4DTM A;  3QEX A;  4Z4F A;  3G0Z A;  4DMN A;  1IO2 A;  3DLB A;  1BCO A;  4DTJ A;  1U49 A;  3IAY A;  4F2S A;  1WN7 A;  4HCB A;  1ZBU A;  2KFZ A;  3QEW A;  3VQC A;  2P5G A;  4YNQ A;  1RBU A;  1GOA A;  1S9G A;  4I2Q A;  5HRR A;  4CJL A;  4DTX A;  5FRN A;  3KKS A;  1QHT A;  3S3M A;  4CGI A;  1K6Y A;  3L3V A;  2RN2 A;  3DMJ A;  4FK0 A;  3EZ5 A;  2X6N A;  3V6D A;  2ETJ A;  4M3W A;  4E1M A;  2Z1I A;  4CEZ A;  1IKX A;  4NCG A;  4FJN A;  5SWM A;  3AO3 A;  4CHQ A;  5HP1 A;  4K8Z A;  2XRI A;  5CZ1 A;  3UIQ A;  3NF8 A;  1C1C A;  3HVT A;  3JYT A;  2W42 A;  3CFR A;  1WSI A;  3O4Q A;  4E7J A;  3RWU A;  3LAK A;  3DRR A;  4LSN A;  1T03 A;  1WSF A;  4DLG A;  4I7F A;  4PQU A;  4EZ9 A;  4CK1 A;  3DI6 A;  4AHT A;  4CF1 A;  4DFP A;  2EHG A;  1U45 A;  2OZS A;  1L3U A;  4H4M A;  4CFA A;  4RW9 A;  1ZYQ A;  2PYL A;  3AVK A;  3WNH A;  3OYM A;  4BAC A;  2KQ2 A;  1LV5 A;  4LY7 A;  3DRS A;  3NGY A;  3OS0 A;  3O4N A;  1RNH A;  3LP1 A;  3V9Z A;  1IG9 A;  3O3F A;  4B9T A;  1EET A;  1RDB A;  3LPT A;  4CF8 A;  2QKK A;  1J9A A;  2FBV A;  3I8D A;  4FLX A;  4LD0 A;  1KFD A;  2FBY A;  3HYF A;  2PZS A;  4F4K A;  3AVC A;  3NE6 A;  4M45 A;  3AO4 A;  3HVR A;  3NAE A;  3C94 A;  3DOK A;  3OYD A;  3OYK A;  3K5N A;  3SUO A;  4DQR A;  3L2V A;  4DQQ A;  3ZSV A;  4B3O A;  1RTI A;  1RDC A;  3AA3 A;  4CHZ A;  3AVG A;  3LZI A;  3S3N A;  1VSJ A;  3TAP A;  2HB5 A;  4F3O A;  4FLZ A;  2BDP A;  1VSL A;  2ZE2 A;  1BQM A;  4Z4H A;  3MXJ A;  4NYF A;  3VN5 A;  1HQU A;  1W0H A;  3L2R A;  3QER A;  1RT6 A;  1L3T A;  3KD5 E;  1JLB A;  2FBT A;  4RG8 A;  3ZSO A;  3HT3 A;  1UA1 A;  3DLG A;  3L2U A;  3TAR A;  1N5Y A;  3DLE A;  3L2Q A;  4DTR A;  3M8S A;  1KSP A;  4B9U A;  4OGE A;  1EP4 A;  1WSH A;  4E7I A;  3M8R A;  2E6M A;  2G8K A;  5HRP A;  4KRE A;  4BDP A;  4Q0B A;  3AA4 A;  3I0R A;  1X9M A;  4AIL C;  3DLR A;  4DF4 A;  3QIO A;  1UWB A;  1X9W A;  4OKE A;  1JL2 A;  4FLV A;  1GOB A;  3VQB A;  2VWJ A;  4HVJ A;  4ZTF A;  3ITH A;  3U3G A;  2YKN A;  4N5S A;  4E7K A;  5JS1 A;  4GMJ B;  2B6A A;  1L3V A;  4ICL A;  4N41 A;  2IOC A;  3DOL A;  4BE0 A;  4Z4G A;  1KRP A;  1SKS A;  5J2M A;  4L8R B;  4CHP A;  4M41 A;  4CJP A;  4B8C A;  4FK4 A;  3KD1 E;  5J2P A;  4FW2 A;  1LWC A;  3NCI A;  4FYD A;  3SNN A;  3AVF A;  3HM9 A;  1SUQ A;  2OZM A;  3HO1 A;  3AO5 A;  2RKI A;  3SCX A;  3TAE A;  2YV0 X;  2HHU A;  1FKO A;  1TKD A;  3TAB A;  2D5R A;  2JGU A;  4CJR A;  1Q9X A;  1R0A A;  2F8S A;  2I5J A;  1HYS A;  4FJJ A;  4GVM A;  3CM5 A;  1KVC A;  1REV A;  2XHB A;  3QEP A;  3M8P A;  2BE2 A;  2HNY A;  3TAG A;  1RTD A;  3AVA A;  3WNE A;  4XIU A;  3U3Y A;  3VQ6 A;  1Q9Y A;  5HRN A;  4ZHR A;  3SV4 A;  4IFY A;  4W5R A;  4OGC A;  4J2D A;  1IKV A;  4CJ5 A;  3IS9 A;  4CEQ A;  4OLB A;  4CJE A;  2HHX A;  1WLJ A;  1CZB A;  4DG1 A;  1RT5 A;  4IKF A;  4CHO A;  3K57 A;  2VG7 A;  3TR8 A;  3SYZ A;  4H4O A;  3AVM A;  4CED A;  1UAX A;  4O4G A;  2GUI A;  1TK5 A;  2HMI A;  4DFM A;  2DTU A;  1NJX A;  1RDA A;  1SV5 A;  4B9L A;  4OJR A;  2B4J A;  4N47 A;  5HRO A;  4B9N A;  1SL1 A;  1NKB A;  3L3U A;  4KKO A;  3JSM A;  1Z25 A;  3AO2 A;  1KVB A;  1YVU A;  5CYQ A;  3EYZ A;  3BGR A;  4CK3 A;  3T3F A;  4PA1 A;  3AO1 A;  2ZD1 A;  3CQ8 A;  3KK3 A;  1QE1 A;  4DS5 A;  3OYF A;  4DFJ A;  1QTM A;  4OLA A;  1X1P A;  3LAM A;  1JLC A;  3LDS A;  1B9D A;  3NBP A;  1VRT A;  4FVM A;  4AHR A;  1NKC A;  4FZX C;  4E0D A;  2HHS A;  1NK0 A;  1JXE A;  1YTU A;  2VG5 A;  1DLO A;  2D0B A;  2RPI A;  3M8Q A;  3T1A A;  4QOZ B;  2HHT A;  2O4G A;  3RMD A;  4PUO A;  4JLH A;  1HRH A; 
#chains in the Genus database with same CATH topology
 1I3A A;  1RTJ A;  3VOV A;  1VSK A;  5AQX A;  2YHW A;  4BRE A;  3SV3 A;  1S6Q A;  3NGI A;  4JYA K;  4DSF A;  4M3T A;  4O44 A;  1GLC G;  4CEE A;  1GLE G;  4CJ4 A;  3L2W A;  1KXP A;  3EKU A;  2D0P A;  3NH1 A;  2JWK A;  1RBS A;  4IOX A;  5DM6 L;  1QVG M;  5A2Q O;  1OVY A;  3AY9 A;  2D0A A;  1NGH A;  3MEC A;  5EU7 A;  5B8H A;  1ZBS A;  3WXI A;  1Q18 A;  4DFK A;  3FFI A;  4O55 A;  4MLE A;  4JKD A;  1BIU A;  4OKJ A;  3IUC A;  4MO4 A;  3KVG A;  1XI1 A;  2PYJ A;  2V7Y A;  5C42 A;  3TWH A;  4BC2 A;  1SKR A;  1FXX A;  3OYN A;  2CH5 A;  1VQ5 N;  4TSX A;  5M1N A;  5KRS A;  3QIC A;  1P8Z A;  4BRO A;  1D8Y A;  4FK2 A;  3C95 A;  4QS7 A;  4EP4 A;  4JAX A;  5M1K A;  3C0B A;  1O1W A;  3WXJ A;  4DTU A;  1EKE A;  4CJV A;  2E20 A;  3T19 A;  3DWL A;  4KI4 A;  3QFU A;  4DV0 K;  4IDK A;  1TYQ B;  2XY8 A;  2FSN A;  2HNZ A;  2FLO A;  1NOY A;  3GG4 A;  2WTU A;  4JRP A;  4CZE A;  1NNE A;  2KW4 A;  4NLC A;  4CES A;  5M1O A;  3RVC A;  4WF9 L;  4FWL A;  4N56 A;  1V4S A;  1JCG A;  1FJG K;  5DMR A;  1E4G T;  1CZ9 A;  4DTO A;  4BRN A;  4K42 A;  3KK2 A;  3DYA A;  4B1W B;  3AGK A;  1LWE A;  1MU2 A;  1VQ4 N;  1KC8 O;  1LAV A;  2Z1J A;  3OHR A;  3OW2 M;  1IH7 A;  1GLA G;  2O8F B;  4HTU A;  1U4B A;  3U9Z A;  1NGB A;  1BHL A;  3CJ1 A;  3QO9 A;  3K2P A;  4BE1 A;  3OYI A;  1NGJ A;  4MFB A;  3FZF A;  1L5U A;  3LWM A;  2P9S A;  3OYL A;  1LW2 A;  1OH6 A;  1CXQ A;  4ELT A;  3QML A;  4DSK A;  2F9W A;  4OKK A;  1J54 A;  4ISE A;  3ZYY X;  3EZW A;  4FWK A;  4F8R A;  3OYE A;  4CIG A;  1VAZ A;  1S1V A;  4C23 A;  4YFU A;  1ZBH A;  4FM1 A;  4B1U B;  3THY B;  4J2B A;  4E89 A;  2OPR A;  2NUB A;  3CJA A;  1HNX K;  3QNO A;  1G15 A;  3OBW A;  2UYT A;  2XO7 A;  1T7P A;  3E9P A;  4K8X A;  4HUF A;  2DY4 A;  4CEC A;  4FLY A;  4BG9 A;  2YNG A;  4KHP K;  4XH5 A;  2VWK A;  4KO0 A;  1ASV A;  3LAL A;  4JRQ A;  3DM2 A;  4HUG A;  2IVO A;  1NWK A;  3J81 O;  4EIA A;  4NCA A;  1SZ2 A;  4W5T A;  1LWF A;  1T3V A;  4FZZ A;  1QHA A;  1SS6 A;  3BDP A;  4DQI A;  1JL1 A;  1X9S A;  4DB3 A;  4JHD A;  4AH9 A;  4LH5 A;  3PY8 A;  3K9J A;  3MN9 A;  5JMV A;  1NM1 A;  3D2E A;  4C1N I;  1Q7Y O;  3LP2 A;  1HLU A;  2YHB A;  3O3G A;  3FZL A;  4YDU A;  4Q5V A;  2G8H A;  4IZ9 A;  3FLC O;  2QWM A;  4JK9 A;  2YJF A;  3NDK A;  1S1W A;  4O8U A;  3U4L A;  4FWN A;  3C7N B;  2QWO A;  3PLA A;  1VSD A;  1LOT B;  4YY3 K;  2XY6 A;  3ENH A;  3RMB A;  3ENO A;  3D6R A;  1VSH A;  2WC9 A;  4KI6 A;  3GOI A;  2VQE K;  5I42 A;  3KTQ A;  4KTQ A;  3CF5 L;  2E2N A;  5GAG P;  1YTA A;  1C0F A;  1JLG A;  1Z26 A;  3QDK A;  4IG3 A;  2E2O A;  1DTQ A;  3HPO A;  4JI2 K;  5LMN K;  4CZG A;  5ELZ A;  1LAW A;  4FJH A;  3RTV A;  3NVM A;  1NKE A;  1I94 K;  4X62 K;  2W6L A;  3H45 C;  4CJK A;  3RMC A;  4PL7 A;  4CIF A;  3DAW A;  1IJJ A;  4BRH A;  3C6T A;  4JNE A;  4KH5 A;  4JI0 K;  4FL9 A;  1C0T A;  3PO5 A;  1RDD A;  3OBY A;  2VWB A;  3VET A;  1J5E K;  3HP6 A;  2IVP A;  2QW9 A;  1C6V A;  2QK9 A;  3QES A;  3HJF A;  4H5V A;  4BGA A;  1TYQ A;  3K58 A;  5BPN A;  3O9S A;  4IBN A;  4XH4 A;  2IDO A;  4PY5 A;  3EY1 A;  1GLD G;  5EY4 A;  4X66 K;  1NU0 A;  3RRG A;  2HBK A;  2YX6 A;  3D45 A;  3VQA A;  1QS4 A;  4BRC A;  4E7L A;  5KGW A;  1P90 A;  5F1X A;  1GOC A;  5KTQ A;  1BGX T;  4KV8 A;  4I9Q A;  4Z94 A;  3LWL A;  5AQP A;  1WAJ A;  4H0V B;  5CY4 A;  4Z4F A;  3QEX A;  2E1Z A;  1IO2 A;  4DTJ A;  1U49 A;  1WN7 A;  3GBT A;  3DLL L;  5JVG L;  2Q97 A;  2P9K B;  1RBU A;  1GOA A;  4I2Q A;  1WUA A;  1LCU A;  3KKS A;  4B9Q A;  3S3M A;  2O8F A;  2OAN A;  4X65 K;  1XQS C;  3SJH A;  4I6M B;  2Z1I A;  3VPZ A;  4A2B A;  4K8Z A;  5AFU H;  4A61 A;  3ID6 A;  1QZ5 A;  3NF8 A;  5AQN A;  2W42 A;  1YIT N;  4PKH A;  4E7J A;  4LSN A;  4H0X B;  5AQJ A;  4PQU A;  4JD2 B;  3M3Z A;  4BR2 A;  4H4M A;  4CFA A;  4BAC A;  2GEL A;  4LY7 A;  1KAZ A;  3OS0 A;  1RNH A;  4B9T A;  4CF8 A;  2HBM A;  3THY A;  1NG9 A;  4IFE A;  4F4K A;  3AVC A;  3OTO K;  3SUO A;  5JIC A;  5GIO A;  4DQR A;  4DQQ A;  1GLF O;  1RTI A;  3LZI A;  2QWR A;  1VSJ A;  4F3O A;  4FLZ A;  1Q82 O;  1VSL A;  1RDW X;  4LF6 K;  3MWP A;  3QER A;  1VHX A;  1RT6 A;  1VQL N;  3MDQ A;  1UA1 A;  3VMF B;  3DLG A;  3QFP A;  3TAR A;  3G25 A;  1EP4 A;  3BF1 A;  4BDP A;  4Q0B A;  1X9M A;  2HOE A;  4DR7 K;  1X9W A;  3Q7C A;  1GOB A;  5ADX H;  1W97 L;  3M5R A;  5JS1 A;  3T7Z A;  3QBW A;  3DOL A;  4BE0 A;  1SKS A;  2W40 A;  4CHP A;  4DR5 K;  4FK4 A;  5AQH A;  3KD1 E;  2ZGZ A;  1LWC A;  4FYD A;  4LF7 K;  3UB5 A;  3TAE A;  2YV0 X;  3AAR A;  2DPN A;  4CJR A;  2I7P A;  4DV1 K;  2BE2 A;  5CR4 A;  2ITM A;  3J7Z O;  4IFY A;  1N8R O;  3IS9 A;  4B1Z A;  5C0Y A;  4DV5 K;  4CHO A;  2VG7 A;  3TR8 A;  5M1F A;  4H4O A;  3WQT A;  3SYZ A;  3ATU A;  4UY8 O;  1SV5 A;  2P9P B;  2KLA A;  2KKZ A;  1SL1 A;  3CJC A;  4KKO A;  3VEW A;  2F4V K;  3DXM B;  1Z25 A;  3O4W A;  1EO1 A;  4CK3 A;  2YI1 A;  3KK3 A;  1K8K B;  1QTM A;  1SQK A;  3L4I A;  3LAM A;  1GLJ O;  4CJ7 A;  1OVQ A;  3I8B A;  4AHR A;  4FZX C;  2HHS A;  4BR4 A;  2VG5 A;  2RPI A;  4HWI A;  2O4G A;  3RMD A;  1VSI A;  4DR2 K;  3V81 A;  2GX9 A;  1MWK A;  4RW6 A;  4BRQ A;  2KFN A;  2DFH A;  4AHV A;  3BZC A;  4FWP A;  4LFC K;  1ZBL A;  3CC7 N;  3FR0 A;  4EHT A;  5AQM A;  3R3L A;  1K8A O;  2OPQ A;  2VGN A;  4DCH A;  2KZM A;  4FJG A;  1IKY A;  2O4I A;  3NF9 A;  3H08 A;  5MLC Q;  4BRI A;  5F2R A;  1C1A A;  4CBW A;  4GV9 A;  3CHW A;  3Q7B A;  1HPZ A;  4KB1 A;  2YNH A;  2GEM A;  1KLN A;  3S3O A;  4O5F A;  3SQ0 A;  1FKP A;  4LFA K;  1L3S A;  3TSU A;  3IG1 A;  4AM7 A;  3DRP A;  4KHY A;  2P9K A;  5HLF A;  1U2V B;  2BAN A;  4BWJ A;  2AA4 A;  3CIP A;  3LDP A;  4K41 A;  4BRL A;  4I9L A;  1EX4 A;  2YKM A;  3NHG A;  4I6M A;  1TGO A;  3AV9 A;  4BY9 C;  4CZI A;  3AVB A;  4BR0 A;  4CEB A;  3FZK A;  3V9U A;  4C8O A;  1KVA A;  4JD2 A;  2WFB A;  4LH4 A;  2QWL A;  4H0Y B;  2HF4 A;  3R1X A;  2Z1H A;  1XWL A;  3ZSR A;  4CZK A;  5FPN A;  2UUB K;  3UKU B;  4FCY A;  5HRS A;  1N33 K;  4FOE A;  1NGE A;  2KTQ A;  2FBX A;  4NB4 A;  3KLE A;  3OYJ A;  2X74 A;  1XHX A;  1U48 A;  1HKG A;  3QNN A;  1RCH A;  4ELU A;  1VQP N;  4JKF A;  2OPP A;  3ZX3 A;  3DJC A;  3D2F B;  2CH6 A;  5CZ2 A;  4RCH A;  4BDZ A;  4H5W A;  3HST B;  4H5R A;  3PIP L;  2F96 A;  4CHN A;  1BI4 A;  4ELV A;  1WB9 A;  5LJV A;  3LAN A;  4BRA A;  3H1V X;  3CCE N;  2Q31 A;  4WCE L;  5EX5 A;  3O9T A;  5I3U A;  4KHS A;  1EWQ A;  2X78 A;  3O9R A;  4DSE A;  1TL1 A;  3LDN A;  1KAX A;  1UOC A;  3O1B A;  4A2A A;  4FWS A;  4OVL A;  1TKT A;  1W7A A;  1Y97 A;  2PY5 A;  3HZ6 A;  1JLF A;  3AVI A;  1QSL A;  3CCV N;  3ZLJ A;  5IWA K;  3K0S A;  1BCM A;  4FJM A;  3KLF A;  4YOW A;  4B3T K;  1T05 A;  3CC4 N;  1TV6 A;  3AVL A;  3MX2 A;  4CHY A;  3C6U A;  1BWF O;  2XY5 A;  3G6E N;  3SK3 A;  3A5O C;  4DU1 A;  4FJL A;  5GAE P;  5T7B A;  4C8N A;  4BE2 A;  2WOM A;  3V9W A;  4F3T A;  3VGL A;  1B9F A;  3VEX A;  4HTL A;  3NFA A;  3V1O A;  3VQP A;  1NJZ A;  2QWN A;  3QET A;  4JI1 K;  1WNS A;  1TKZ A;  1HNV A;  1YJN N;  2P9P A;  1XC9 A;  1MWM A;  3ALY A;  3CM6 A;  5AQI A;  1VSF A;  2B5J A;  1XNQ K;  3DXM A;  4ID5 A;  1S1U A;  5KRT A;  1HJR A;  2QM1 A;  3HXM A;  3ZEU B;  1S72 N;  4WQ4 C;  3O80 A;  4QCL A;  4KRF A;  1WSE A;  3L0Q A;  1FK9 A;  5KGX A;  4BDY A;  3LM9 A;  4B1Y B;  1JJ2 M;  5FRM A;  5J2N A;  4DSL A;  4RW7 A;  1D9F A;  2NRW A;  5AQO A;  4E19 A;  3L8B A;  2UXD K;  4CJQ A;  2Q0R A;  3LP3 A;  4CCH A;  5SZT A;  3VQ8 A;  3EE9 A;  3OY9 A;  3LPU A;  4KB0 A;  1NK4 A;  4KHQ A;  2O8C B;  3NH2 A;  2WON A;  2ZF5 O;  1TL3 A;  1J53 A;  1A5W A;  1EQY A;  3ULE B;  1HYV A;  3HL8 A;  5KQ8 A;  3OYH A;  4U7B A;  1YVN A;  1V4T A;  2H3G X;  2Z1G A;  2P51 A;  3OYB A;  2YNI A;  4JI7 K;  1ZBI A;  2P9L B;  3SQ4 A;  3TAM A;  1LW0 A;  3CXC M;  1U2V A;  1D5A A;  3I0S A;  4N76 A;  1NJI O;  1XNR K;  3H3O B;  4I2P A;  4DQ8 A;  2ZJR L;  1BQN A;  3SI6 A;  3DLK A;  1TKX A;  3BF3 A;  4M3Y A;  2A3Z A;  1BU6 O;  4BC4 A;  3VQ7 A;  3QIN A;  4KAZ A;  1RBT A;  4FZY A;  4M7X A;  3OS1 A;  3TSQ A;  1X9J A;  1NK9 A;  4IEE A;  5AQF A;  3MMV A;  2JLE A;  2RE2 A;  3GE1 A;  3A0I X;  2ZM6 K;  2NRR A;  3LL3 A;  3CFO A;  3VQQ A;  4A59 A;  2NRV A;  3LM2 A;  1A5V A;  5BN8 A;  1WBD A;  3G71 N;  4ZTJ A;  3NH0 A;  2A1R A;  5AR0 A;  4FLT A;  4W5O A;  3WEE B;  4EP5 A;  1F21 A;  1NMN A;  5E84 A;  4RTF D;  4R5P A;  5K14 A;  1Z05 A;  4GY2 B;  4W5N A;  4CF0 A;  3P83 D;  3D2F A;  4RW4 A;  3IKM A;  3CCR N;  4M42 A;  3KK1 A;  4JKA A;  3G0Z A;  4DMN A;  3DLB A;  3P38 A;  4F2S A;  3VQC A;  2P5G A;  2EWS A;  4CJL A;  3FGU A;  4DKW A;  3DMJ A;  4FK0 A;  3CJ7 A;  1ZC6 A;  1K73 O;  3LDQ A;  3D7E O;  1S3X A;  2VGM A;  5SWM A;  1JCE A;  4CHQ A;  5HP1 A;  5CZ1 A;  3HVT A;  2AP1 A;  3HSC A;  3O4Q A;  4OPH A;  4KH4 A;  4LF8 K;  4H5T A;  4DLG A;  3A8Y A;  3THW B;  4CF1 A;  2EHG A;  1J6Z A;  3P39 A;  2V7Z A;  4RW9 A;  4CZJ A;  3AVK A;  3WNH A;  2KQ2 A;  2HST A;  3CJ9 A;  3WQU A;  3LP1 A;  1IG9 A;  1X3M A;  3LPT A;  2QKK A;  4YOX A;  3VEN A;  1BG3 A;  3I8D A;  4EAH D;  4FLX A;  1KFD A;  4BGB A;  2PZS A;  3OYK A;  2HF3 A;  3L2V A;  1RDC A;  4FWR A;  4Z4H A;  4GVE A;  3MXJ A;  3L2R A;  1JLB A;  3HT3 A;  2WBN A;  4FWQ A;  4ILG B;  2ASP A;  5TKW A;  5M1P A;  5F0X A;  4XEI A;  3L2Q A;  4G9Z A;  3WXL A;  2G8K A;  2E6M A;  3ZEU A;  5AQY A;  3DLR A;  1M1K O;  4OKE A;  3VTI A;  3F5T A;  2UU9 K;  2YKN A;  4E7K A;  2B6A A;  2IOC A;  4Z4G A;  1KRP A;  4L8R B;  3NMU A;  1HPM A;  3AVF A;  1TUY A;  3HM9 A;  3HO1 A;  3AO5 A;  3IDH A;  1XMQ K;  1TKD A;  1Q9X A;  2I5J A;  4FJJ A;  4GVM A;  3QEP A;  2ASM A;  3BUZ B;  3TAG A;  3AVA A;  4JKH A;  2VYP A;  3T69 A;  3WNE A;  4DUZ K;  2OCE A;  5AQW A;  1Q9Y A;  2O8C A;  1Y64 A;  5HRN A;  4OGC A;  1Q86 O;  4CJ5 A;  4CJE A;  3CCJ N;  1WLJ A;  2NRZ A;  3ULE A;  1RT5 A;  4IOC L;  3K57 A;  1NLV A;  4CED A;  4O4G A;  2GUI A;  2HMI A;  1NMD A;  4B9L A;  2P9L A;  3CPE A;  4B9N A;  4YOY A;  1KVB A;  2E88 A;  4CBU A;  3OYF A;  1X1P A;  3NBP A;  1NKC A;  2UUC K;  1NK0 A;  2E1Y A;  2D0B A;  4QOZ B;  3M8Q A;  2QI2 A;  4FSV A;  2HHT A;  4JLH A;  1HRH A;  5JS2 A;  5HL7 L;  3CCS N;  1TK0 A;  2YHX A;  3V1Q A;  1YUW A;  4GW6 A;  3KKR A;  4GKJ K;  2R7Y A;  4YDU C;  3JXU A;  5AZJ B;  4JN4 A;  1W9H A;  3UE5 A;  4DTN A;  4BRG A;  2VG6 A;  3HOT A;  2A42 A;  2GBZ A;  4OX9 K;  1ATN A;  4B8A B;  3WEE A;  5C10 A;  3TTC A;  4E1N A;  1SAZ A;  1YXQ A;  1VSM A;  1ZXO A;  4H5N A;  2V51 B;  3VTH A;  1BOT O;  2GTD A;  3VF4 A;  4EZ6 A;  3F73 A;  2GV9 A;  4DQP A;  4CGJ A;  5LJW A;  4CEA A;  1XC3 A;  3N4P A;  4NCB A;  3VF2 A;  3SAF A;  4DLE A;  1VRU A;  3CG7 A;  5J2Q A;  5TKY A;  4FWO A;  1TAQ A;  4IJA A;  4OPA A;  1KFS A;  2NRH A;  4OPK A;  4ILJ A;  3QLH A;  4FJ9 A;  4DF8 A;  1VQN N;  3TTF A;  3TAN A;  3O8M A;  2OPS A;  5CHI A;  4DSI A;  3EE8 A;  2GWK A;  1EXQ A;  3THW A;  4BQZ A;  2AJQ A;  1RT2 A;  4B9S A;  4KTZ A;  4CI6 A;  1H1V A;  3J7Y P;  4DWI A;  3S41 A;  4CD1 A;  1JLQ A;  3E01 A;  1CLQ A;  1UA0 A;  2I7N A;  3CET A;  3A5M C;  5FDL A;  3MED A;  3E9O A;  4MLH A;  4B08 A;  2Y1I A;  4CJT A;  4CF2 A;  1JXB A;  5AZI B;  5GIP A;  2GWJ A;  1BIZ A;  2ITG A;  3RRH A;  3TI0 A;  3C7N A;  4CEF A;  3BEX A;  3OYG A;  4DTS A;  4FJI A;  1HKC A;  4Z4E A;  4RWT A;  2YNF A;  2RHK A;  4ILH A;  1S1X A;  3GL1 A;  3ZET B;  4A5A A;  3TAQ A;  4O0J A;  4FLU A;  3ISN C;  1JKH A;  3KIO A;  3QEI A;  5HBM A;  4YHH K;  3MXM A;  3THX B;  3CFP A;  3E66 A;  3VQ5 A;  1ASU A;  1WAF A;  1A5X A;  3WUH A;  4C8M A;  3W3D A;  3CD6 N;  4H03 B;  1BIS A;  2QXL A;  4DSJ A;  4Z0U A;  4Z4C A;  3K5M A;  3O3H A;  3PX6 A;  4CER A;  4B1X B;  2BUP A;  4IXC A;  2GUP A;  3FE1 A;  2RF2 A;  1C0M A;  3BY5 A;  4BVO A;  5FLX O;  4DTP A;  3DLH A;  1HUX A;  1BL3 A;  4FJK A;  5C12 A;  3G4S N;  4J8F A;  4CIE A;  2PFU A;  4ISF A;  3O5B A;  3ZT3 A;  3KJV A;  4IWV A;  3AAQ A;  1N36 K;  3PUF A;  3MN6 A;  1IBM K;  2IVN A;  4JS5 A;  3SMP A;  2G8W A;  5FPE A;  2F9T A;  1NJY A;  1SKW A;  5AQS A;  3VQD A;  1N34 K;  3RR7 A;  3CQY A;  4MQ3 A;  3D0P A;  3K9K A;  1HNI A;  4Z4I A;  2YCH A;  3KLG A;  3SUN A;  4BRD A;  2HHQ A;  3MEG A;  3FFK B;  4J2E A;  2ZWH A;  3THV A;  1RBR A;  2P5O A;  4B9M A;  3M1F A;  3N4Q A;  2EX3 A;  3WNF A;  2D4W A;  1XHZ A;  5C25 A;  1NK6 A;  1KTQ A;  3VEV A;  3PSI A;  3V9S A;  3IFR A;  3ZCM A;  1T6D A;  4KBO A;  2YHA A;  5AQZ A;  2ATQ A;  2LSN A;  4CF9 A;  4CVN E;  3PO4 A;  4M7Y A;  1T6C A;  3V9X A;  4CGD A;  3RSE B;  2QKB A;  4GKK K;  1JCF A;  4A62 A;  5AZJ A;  3P1G A;  5KPR A;  2DFE A;  4YOV A;  4LSL A;  4AHS A;  4CJW A;  3QEV A;  1ZBF A;  2QWQ A;  4KFB A;  4LC9 B;  4M3X A;  2QXF A;  2IS3 A;  2ASO A;  3EEQ A;  3CPW M;  4WQ4 A;  1RTH A;  3ZX0 A;  3ZSZ A;  4CJU A;  4IOA L;  3ID8 A;  4M3U A;  2A6A A;  5BPM A;  4PHT X;  2F7T A;  4IO8 A;  5KPT A;  2P1J A;  3OS2 A;  5GAD P;  2OA8 A;  4CFC A;  1RFQ A;  1TK8 A;  4BR9 A;  3CCL N;  3ZT4 A;  4JI8 K;  3KLH A;  4IJN A;  4E7H A;  2VCP A;  4CE9 A;  2QWP A;  3VQ9 A;  4B3R K;  4BR7 A;  5AJ3 K;  4J2A A;  3SZ2 A;  4GV6 A;  3EO3 A;  3AA5 X;  3VA0 A;  3L6Q A;  3JS6 A;  1C1B A;  1CXU A;  2D0C A;  5BR8 K;  1YIJ N;  3LZJ A;  5BRD A;  4WQ5 C;  1N6Q A;  3C6A A;  4FM0 A;  2XY7 A;  1D9D A;  3P31 A;  2O8D B;  4CD3 A;  4FJ7 A;  2HND A;  3QB0 A;  2V52 B;  3K5L A;  4C8K A;  1U47 A;  4JS4 A;  5EVZ A;  1HX1 A;  2VQF K;  3OVN A;  3O9U A;  1IBL K;  2FC0 A;  3M6G A;  4HHT A;  1MDU B;  4U67 L;  1T44 A;  2CGJ A;  5AZI A;  5IT9 O;  3PV8 A;  3AA2 A;  1QQN A;  4DR1 K;  5D3G A;  3VQE A;  1B92 A;  2HHV A;  2CGK A;  3H3N O;  4YOU A;  3ZET A;  3QEW A;  2ZJP L;  3CCM N;  2FSK A;  4YNQ A;  4DV7 K;  4OO1 J;  4BR5 A;  4DTX A;  3THX A;  1QHT A;  4CZM A;  4CGI A;  4DR3 K;  1ATS A;  1HR0 K;  4E1M A;  3I55 N;  3F2K A;  4CEZ A;  3WT0 A;  4CZH A;  1IKX A;  4NCG A;  3AO3 A;  2XRI A;  2Q36 A;  3UIQ A;  3JYT A;  2D0O A;  1WSI A;  3QBX A;  3LAK A;  1K8K A;  1WSF A;  5EXW A;  4DV6 K;  3AGR A;  3H6E A;  2KHO A;  1U45 A;  4DFP A;  1OH7 A;  4MO5 A;  1MA9 B;  4E1J A;  3DRS A;  3NGY A;  4FWM A;  3R9P A;  1WOQ A;  3V9Z A;  3O3F A;  3LDL A;  1EET A;  1BA0 A;  1HJO A;  1J9A A;  2FBV A;  4PL8 A;  4LD0 A;  1QQO A;  1E4F T;  1O13 A;  3NE6 A;  4X64 K;  3EKS A;  4WFB L;  3C94 A;  3DOK A;  2E5L K;  3ZSV A;  4B3O A;  4CHZ A;  3S3N A;  2HB5 A;  1BUP A;  1OH8 A;  2BH1 A;  2BDP A;  2ZE2 A;  4NYF A;  3KD5 E;  4EFH A;  5C15 A;  2FBT A;  4RG8 A;  3ZSO A;  3L2U A;  4AF1 A;  3DLE A;  4O8K A;  5GAH P;  4DTR A;  3M8S A;  1KSP A;  1QQM A;  4OGE A;  4B9U A;  1WSH A;  3M8R A;  5LL6 Z;  5HRP A;  4KRE A;  3F9M A;  3BZK A;  4AIL C;  5LMU K;  3QIO A;  1JL2 A;  3VQB A;  3J7A P;  3SBT A;  4HVJ A;  4NXN K;  4AQY K;  1YJ9 N;  4DUY K;  3SAG A;  4N5S A;  1L3V A;  4N41 A;  4FPA A;  1BA1 A;  5J2M A;  5JVH L;  3VF6 A;  3PSF A;  4M41 A;  3WXK A;  5J2P A;  4FW2 A;  2E2P A;  3VER A;  4JI5 K;  2RKI A;  3VES A;  3SCX A;  3FZM A;  2HHU A;  2JGU A;  3RSE A;  1VQO N;  2P9U B;  1WBB A;  3CM5 A;  1FW6 A;  1KVC A;  2XHB A;  2OTL N;  1RTD A;  3U3Y A;  3VQ6 A;  5AQK A;  5JLF A;  4OLB A;  2HHH K;  3CME N;  3IMX A;  2HHX A;  2UXB K;  3UKU A;  3SMS A;  3VEO A;  4QS9 A;  3AVM A;  3JAM O;  1UAX A;  3C65 A;  4Y0W A;  1QVF M;  3HOS A;  4QS8 A;  4JKG B;  3JSM A;  3AO2 A;  1YVU A;  5CYQ A;  3EYZ A;  4F9O A;  4PA1 A;  3CQ8 A;  1YJW N;  3MK6 A;  4FVM A;  2D1K A;  4B3M K;  2NZT A;  4NXM K;  4EHU A;  4JKC A;  5I9E B;  2G8V A;  1YAG A;  1RBV A;  4CFD A;  3ASM A;  3NGZ A;  4HCC A;  5J1E A;  4H0P A;  4B3S K;  1VK0 A;  4WE1 A;  5BPL A;  4K0K K;  4IO9 L;  2O8D A;  3I33 A;  1JLE A;  1TAU A;  4JI4 K;  4PKG A;  3TU5 A;  4JK7 A;  5CE3 A;  2FSJ A;  3B6P A;  1KLM A;  5HOO A;  5C2F A;  5AQR A;  2Q0U A;  3MN7 A;  4DV3 K;  3ZT2 A;  3MEE A;  3MCP A;  1T8E A;  4KPY A;  2HVH A;  1E3M A;  1S6P A;  2IIR A;  3WXM B;  3KZB A;  4WFA L;  2DFF A;  1TUU A;  1HMV A;  3HP9 A;  4IEI A;  2J4R A;  4Y1C A;  3DXK B;  3HRG A;  3HM8 A;  4NYN A;  4B1V A;  3V1R A;  2NNW A;  3AVN A;  4O5B A;  1NOZ A;  5LY3 A;  3PX4 A;  4M3R A;  2PAV A;  3C6H A;  1DKG D;  1VQM N;  1SL0 A;  4CJ3 A;  3F9K A;  5AQV A;  2Q3S A;  2P9N B;  5FPM A;  4QAG A;  2UXC K;  4ISG A;  5AQU A;  3UKR B;  1NGG A;  2IC3 A;  2BGG A;  3CQX A;  1RIL A;  3AVH A;  1EWR A;  4OPJ A;  4CEO A;  1S1T A;  1I39 A;  5C24 A;  1BDG A;  4IFV A;  3ZX2 A;  2Q2R A;  1QSY A;  1Q8I A;  2G8F A;  3ZSQ A;  1NK8 A;  2UUA K;  3H1Q A;  3VA3 A;  5AFU A;  4DV2 K;  3ZT0 A;  1D4X A;  4DU4 A;  3GDQ A;  3MWT A;  3IRX A;  1XMO K;  3WNG A;  3S9H A;  2CGL A;  1NGD A;  3CC2 N;  1DTT A;  2KZZ A;  1QQC A;  4H0T B;  2FF3 B;  3OJS A;  2HHW A;  3CCU N;  2W41 A;  1KAY A;  2E4L A;  2YJE A;  5FRO A;  1NJW A;  3VQ4 A;  2X6S A;  4BC5 A;  5KPZ A;  1S5J A;  3K59 A;  2HVI A;  3CYM A;  4BWM A;  4FLW A;  1NK5 A;  1N32 K;  3B6O A;  5E26 A;  1J5O A;  5DK5 A;  3OA9 A;  2E2Q A;  5M1Q A;  4W5Q A;  1ILY A;  1U04 A;  4NO7 A;  3HPG A;  5DM7 L;  4CJF A;  3RR8 A;  3CER A;  1RT4 A;  2NLX A;  1YT3 A;  1IKW A;  1ITG A;  3HI0 A;  1VQ7 N;  1JLA A;  3LP0 A;  3NF7 A;  4FO0 A;  1YI2 N;  4DR4 K;  2O8E B;  4HUE A;  4JKB A;  3CCQ N;  4DU3 A;  2ZGY A;  3KWG A;  1HNW K;  4FJX A;  4Y1D A;  3MAQ A;  3G10 A;  1DEJ A;  3QIP A;  4NLB A;  2Y1J A;  3SJJ A;  3NVK A;  5ADX A;  1KCF A;  3NF6 A;  2P9U A;  4WYB A;  1NGA A;  4DS4 A;  4YOR A;  1HKB A;  3CI5 A;  4RW8 A;  4AHU A;  4GNI A;  1BO5 O;  3KK7 A;  4BRM A;  4CK2 A;  2G8U A;  4J2D A;  1CZA N;  2O8B B;  4A5B A;  1NK7 A;  1VSE A;  2W6K A;  5CYM A;  1VQ9 N;  3SPY A;  5E41 A;  3HPH A;  3O9Q A;  3ZSX A;  4JI3 K;  1SL2 A;  4AHC A;  3A2F A;  4CGF A;  1RGI A;  4JKG A;  1G99 A;  4CJS A;  4H0O A;  3MXI A;  3E1Y A;  4M3Z A;  1OH5 A;  1Z6R A;  4ID1 A;  1Q81 O;  3PX0 A;  1YF5 L;  2IAJ A;  1RT3 A;  3OJU A;  1C0U A;  1QSS A;  4FM2 A;  2YHY A;  2BTF A;  1RT7 A;  4O0I A;  1WSG A;  3KLI A;  1IG8 A;  4XH1 A;  2FF6 A;  4E3S A;  3OYC A;  2NRT A;  1KD1 O;  4C8L A;  1HYZ A;  3KWI A;  4FOI A;  3ULD A;  3SUQ A;  4MDA A;  4CGG A;  4KHW A;  4BVP A;  3ZT1 A;  4M63 C;  4CW7 B;  1HQE A;  3SLC A;  3A5N C;  3SQ1 A;  3SPZ A;  4FW1 A;  4KHN A;  1ASW A;  4JI6 K;  2PBD A;  3R8E A;  3SUP A;  3U6F A;  4F2R A;  2A40 A;  2IGI A;  3SQ2 A;  4B9V A;  3CMA N;  4DV4 K;  3W0L A;  2G8I A;  3RMA A;  3L4Q A;  3P5J A;  4CFB A;  4FJ5 A;  1BI4 B;  3EN9 A;  5KI6 A;  3OYA A;  2HW3 A;  2F8T A;  3U8X A;  4L3Q A;  2Q1N A;  2P9I B;  3HBT A;  4FJ8 A;  5BRF A;  4AM6 A;  3H46 O;  1S9E A;  2HBJ A;  4CZL A;  1WSJ A;  1K9M O;  4IG0 A;  5BR9 A;  3DXK A;  4CBX A;  4KTW A;  3ENB A;  4CGH A;  4R79 A;  4FXD A;  1DGK N;  4DQS A;  3MCA B;  4BRP A;  5C2D A;  1TVR A;  4PKI A;  2OTJ N;  3EL2 A;  1NGC A;  4C1N K;  3TSP A;  3FZH A;  4BG8 A;  1YHQ N;  2A1S A;  2P9N A;  4G1Q A;  3KHY A;  3UKR A;  2E6L A;  1VQ8 N;  1R59 O;  1S22 A;  3AVJ A;  4LF5 K;  4BC3 A;  4K25 A;  1QZ6 A;  3ZSY A;  3HK2 A;  4KHU A;  4H8K A;  2OYQ A;  3U9D A;  3V4I A;  1NBW A;  3TAF A;  2NRX A;  4YOT A;  4PWD A;  2ZQB A;  4UQG A;  3VEY A;  2HMP A;  2FXU A;  3O08 A;  1RT1 A;  3MN5 A;  5BN9 A;  4KH6 A;  3I56 N;  3ZSW A;  4DR6 K;  3K5O A;  1W2B M;  4WFN L;  3E9L A;  4V19 S;  3MX5 A;  3CJB A;  4DTM A;  1ATR A;  1GLB G;  1BCO A;  3IAY A;  4HCB A;  1ZBU A;  2KFZ A;  1X3N A;  1S9G A;  5HRR A;  5FRN A;  5GIN A;  1K6Y A;  3L3V A;  1DT9 A;  2RN2 A;  4WQ5 A;  3EZ5 A;  2X6N A;  3V6D A;  2ETJ A;  4M3W A;  3A5L C;  4LFB K;  5JLH A;  4FJN A;  1VQK N;  3TPQ A;  4JEP A;  1C1C A;  3CFR A;  3RWU A;  3DRR A;  1T03 A;  4I7F A;  4EZ9 A;  4CK1 A;  3DI6 A;  4AHT A;  4A57 A;  3T1Y K;  2OZS A;  2O8E A;  1L3U A;  5AQQ A;  1ZYQ A;  2PYL A;  4JK8 A;  5KQD A;  3OYM A;  1LV5 A;  1XUP O;  3O4N A;  3LDO A;  2HBL A;  1RDB A;  1IV0 A;  1KQS M;  4BRK A;  2FBY A;  3HYF A;  4DHY A;  2O8B A;  4GV3 A;  4M45 A;  2QEX N;  4LF9 K;  3AO4 A;  3HVR A;  3NAE A;  1ESV A;  4K43 A;  3OYD A;  3K5N A;  1C0G A;  1HNZ K;  3AA3 A;  3AVG A;  4IDH A;  2QTD A;  3TAP A;  1M90 O;  1BQM A;  1YTU A;  3VN5 A;  1HQU A;  1W0H A;  1L3T A;  1IBK K;  1NGF A;  1N5Y A;  3SAH A;  1VQ6 N;  3P4I A;  2A41 A;  4FPB A;  5FPD A;  1GLL O;  4E7I A;  4BRF A;  3AA4 A;  3I0R A;  2E8A A;  4DF4 A;  1UWB A;  4FLV A;  1U6Z A;  2VWJ A;  4FVU A;  4ZTF A;  3ITH A;  3U3G A;  2P9S B;  4GMJ B;  4ICL A;  4CJP A;  4B8C A;  2QA4 N;  3NCI A;  3SNN A;  1NGI A;  1SUQ A;  3AAP A;  2OZM A;  4LF4 K;  1FKO A;  3BP8 A;  3TAB A;  2D5R A;  3SBG A;  1HYS A;  4JV5 K;  1R0A A;  2F8S A;  5BRH A;  1REV A;  4JKE A;  3M8P A;  2HNY A;  5H1S Q;  3O6W A;  1OKJ A;  5AQT A;  4XIU A;  4ZHR A;  3SV4 A;  4W5R A;  1IKV A;  4CEQ A;  2JWL A;  3T1H K;  5AQL A;  1CZB A;  4DG1 A;  4IKF A;  3J8A A;  1RDU A;  3HTV A;  3R6M A;  3VEZ A;  1TK5 A;  2DTU A;  3B8A X;  2P9I A;  4DFM A;  1NJX A;  1RDA A;  2WUS A;  4CZF A;  3PIO L;  3ATV A;  4OJR A;  2B4J A;  4MDB A;  4N47 A;  5HRO A;  5BRE A;  1NKB A;  3L3U A;  3BGR A;  5EOY A;  3T3F A;  3AO1 A;  2ZD1 A;  4DFJ A;  1QE1 A;  4DS5 A;  4OLA A;  1JLC A;  3O1W A;  3LDS A;  1B9D A;  3TTD A;  1VRT A;  5AQG A;  4BQL A;  2A5X A;  4E0D A;  3J80 O;  4JHD B;  1JXE A;  1DLO A;  3T1A A;  2ZJQ L;  3VGK A;  3D2E B;  4PUO A;  3VGM A; 
#chains in the Genus database with same CATH homology
 1I3A A;  5JS2 A;  1VSI A;  3V81 A;  4RW6 A;  2KFN A;  2G8V A;  2DFH A;  4AHV A;  1RTJ A;  1TK0 A;  1RBV A;  3V1Q A;  4CFD A;  3ASM A;  3NGZ A;  4HCC A;  5J1E A;  1VSK A;  4GW6 A;  1ZBL A;  3KKR A;  1VK0 A;  4WE1 A;  3SV3 A;  1S6Q A;  2R7Y A;  3NGI A;  4DSF A;  1JLE A;  1TAU A;  2OPQ A;  1W9H A;  4DTN A;  4M3T A;  4O44 A;  4CEE A;  2KZM A;  2VG6 A;  3B6P A;  4CJ4 A;  4FJG A;  1IKY A;  2O4I A;  3NF9 A;  3H08 A;  2GBZ A;  1KLM A;  3NH1 A;  4B8A B;  3L2W A;  1C1A A;  4E1N A;  1RBS A;  3ZT2 A;  1VSM A;  2D0A A;  1HPZ A;  3MEC A;  5EU7 A;  3MEE A;  4KB1 A;  4KPY A;  2YNH A;  1T8E A;  1KLN A;  2HVH A;  3S3O A;  1S6P A;  4DFK A;  2DFF A;  4EZ6 A;  3FFI A;  4O55 A;  3SQ0 A;  1FKP A;  3F73 A;  1HMV A;  3HP9 A;  1L3S A;  2GV9 A;  3IG1 A;  4Y1C A;  1BIU A;  4DQP A;  4CGJ A;  4OKJ A;  3DRP A;  4CEA A;  4KHY A;  4NYN A;  4NCB A;  5HLF A;  3V1R A;  4DLE A;  1XI1 A;  1VRU A;  2BAN A;  3CG7 A;  4BWJ A;  5J2Q A;  2PYJ A;  5C42 A;  3TWH A;  3AVN A;  4O5B A;  1TAQ A;  1NOZ A;  1FXX A;  1SKR A;  1KFS A;  4I9L A;  3PX4 A;  1EX4 A;  2YKM A;  4M3R A;  3NHG A;  4OPK A;  3QLH A;  3OYN A;  4FJ9 A;  1SL0 A;  1TGO A;  4CJ3 A;  3F9K A;  4TSX A;  3AV9 A;  4DF8 A;  5KRS A;  2Q3S A;  4QAG A;  3TAN A;  1D8Y A;  2OPS A;  4FK2 A;  2IC3 A;  2BGG A;  3C95 A;  3AVB A;  4CEB A;  1RIL A;  3AVH A;  4EP4 A;  3V9U A;  4C8O A;  4DSI A;  4OPJ A;  1O1W A;  4CEO A;  1EKE A;  1KVA A;  4DTU A;  1EXQ A;  1I39 A;  1S1T A;  4LH4 A;  4CJV A;  1RT2 A;  2AJQ A;  3T19 A;  4B9S A;  4KTZ A;  4KI4 A;  5C24 A;  4DWI A;  4IFV A;  4IDK A;  2Z1H A;  1XWL A;  1JLQ A;  2XY8 A;  3ZSR A;  3E01 A;  1QSY A;  1Q8I A;  2G8F A;  2HNZ A;  3ZSQ A;  1NK8 A;  1CLQ A;  1NOY A;  1UA0 A;  3VA3 A;  4FCY A;  5FDL A;  5HRS A;  3ZT0 A;  2KTQ A;  2FBX A;  4JRP A;  3KLE A;  4DU4 A;  3MED A;  3IRX A;  2KW4 A;  3WNG A;  3OYJ A;  3S9H A;  2X74 A;  4B08 A;  1XHX A;  2Y1I A;  1U48 A;  4CJT A;  4CF2 A;  1JXB A;  1DTT A;  3QNN A;  1BIZ A;  1RCH A;  2ITG A;  3RRH A;  3TI0 A;  1QQC A;  4CEF A;  4CES A;  4ELU A;  2OPP A;  2KZZ A;  3OJS A;  3OYG A;  4DTS A;  4FJI A;  4Z4E A;  2HHW A;  4N56 A;  2YNF A;  5CZ2 A;  5DMR A;  4BDZ A;  2E4L A;  5FRO A;  1CZ9 A;  4DTO A;  1S1X A;  1NJW A;  3VQ4 A;  3HST B;  3TAQ A;  4O0J A;  2X6S A;  4FLU A;  3ISN C;  1JKH A;  1S5J A;  3KIO A;  3KK2 A;  3K59 A;  3DYA A;  3QEI A;  5HBM A;  1LWE A;  1MU2 A;  2F96 A;  3CYM A;  4BWM A;  4CHN A;  4FLW A;  3MXM A;  1BI4 A;  1NK5 A;  1LAV A;  2Z1J A;  3B6O A;  4ELV A;  3CFP A;  1IH7 A;  1J5O A;  3VQ5 A;  3LAN A;  1ASU A;  4HTU A;  5DK5 A;  1U4B A;  1WAF A;  1A5X A;  4C8M A;  1BHL A;  3QO9 A;  4W5Q A;  3K2P A;  4BE1 A;  1U04 A;  1BIS A;  3HPG A;  3OYI A;  5I3U A;  4CJF A;  4DSJ A;  2X78 A;  4KHS A;  4MFB A;  1L5U A;  3RR8 A;  4DSE A;  1TL1 A;  4Z0U A;  4Z4C A;  1RT4 A;  3LWM A;  3K5M A;  1YT3 A;  3OYL A;  3O3H A;  3PX6 A;  1LW2 A;  1UOC A;  4CER A;  1IKW A;  1ITG A;  1CXQ A;  4OVL A;  1TKT A;  4ELT A;  1JLA A;  1Y97 A;  3LP0 A;  2RF2 A;  1C0M A;  2PY5 A;  1JLF A;  3AVI A;  3NF7 A;  4DTP A;  1QSL A;  3DLH A;  2HVI A;  4HUE A;  4DU3 A;  4DSK A;  1BCM A;  1BL3 A;  4FJM A;  3KLF A;  4OKK A;  4FJX A;  4Y1D A;  1J54 A;  3G10 A;  3MAQ A;  3QIP A;  2Y1J A;  1T05 A;  4FJK A;  1TV6 A;  3AVL A;  3SJJ A;  4F8R A;  3OYE A;  4CIE A;  1KCF A;  3NF6 A;  4CHY A;  3C6U A;  2XY5 A;  3ZT3 A;  3KJV A;  4DS4 A;  4CIG A;  3PUF A;  1S1V A;  4YFU A;  1ZBH A;  4RW8 A;  4AHU A;  4FM1 A;  4DU1 A;  4FJL A;  4J2B A;  4E89 A;  4C8N A;  4CK2 A;  2OPR A;  2WOM A;  5T7B A;  2NUB A;  4JS5 A;  4BE2 A;  3V9W A;  1B9F A;  1G15 A;  3QNO A;  1NK7 A;  2G8W A;  1VSE A;  2XO7 A;  5CYM A;  3NFA A;  3V1O A;  1T7P A;  3VQP A;  1NJZ A;  4K8X A;  3SPY A;  1NJY A;  4HUF A;  1SKW A;  2DY4 A;  3VQD A;  4CEC A;  5E41 A;  3HPH A;  4FLY A;  2YNG A;  3QET A;  3RR7 A;  2VWK A;  3ZSX A;  4KO0 A;  1SL2 A;  4MQ3 A;  4AHC A;  3D0P A;  1WNS A;  3A2F A;  4CGF A;  1ASV A;  1TKZ A;  1HNI A;  4Z4I A;  1HNV A;  3KLG A;  3SUN A;  1XC9 A;  3ALY A;  3LAL A;  3CM6 A;  4CJS A;  1VSF A;  2B5J A;  4JRQ A;  3DM2 A;  3MXI A;  4ID5 A;  4M3Z A;  1S1U A;  4HUG A;  5KRT A;  1HJR A;  3MEG A;  4ID1 A;  3PX0 A;  3HXM A;  2HHQ A;  2IAJ A;  4NCA A;  1RT3 A;  3OJU A;  1C0U A;  4W5T A;  1LWF A;  1QSS A;  4FM2 A;  3THV A;  4J2E A;  1RBR A;  2P5O A;  4B9M A;  4FZZ A;  1RT7 A;  3BDP A;  2EX3 A;  4O0I A;  1WSG A;  4DQI A;  3KLI A;  3WNF A;  1XHZ A;  5C25 A;  4KRF A;  4QCL A;  1NK6 A;  1JL1 A;  4E3S A;  1X9S A;  3OYC A;  1KTQ A;  4AH9 A;  1WSE A;  4LH5 A;  3V9S A;  3PY8 A;  4C8L A;  1HYZ A;  3ZCM A;  1FK9 A;  5KGX A;  4BDY A;  3LP2 A;  3ULD A;  2YHB A;  3SUQ A;  3O3G A;  4CGG A;  2YHA A;  4Q5V A;  2G8H A;  4KHW A;  5FRM A;  5J2N A;  4DSL A;  2ATQ A;  4RW7 A;  1D9F A;  2LSN A;  4CF9 A;  3ZT1 A;  4E19 A;  3L8B A;  3PO4 A;  3V9X A;  1HQE A;  4CGD A;  3LP3 A;  4CJQ A;  1S1W A;  3NDK A;  2QKB A;  4CCH A;  5SZT A;  3SQ1 A;  3SPZ A;  3VQ8 A;  4FW1 A;  4KHN A;  3P1G A;  3OY9 A;  1ASW A;  3LPU A;  2DFE A;  4KB0 A;  3SUP A;  4LSL A;  4AHS A;  4CJW A;  3U6F A;  1NK4 A;  4KHQ A;  1VSD A;  4F2R A;  3QEV A;  1ZBF A;  2IGI A;  3NH2 A;  2XY6 A;  3SQ2 A;  3RMB A;  2WON A;  4B9V A;  2G8I A;  4KFB A;  4M3X A;  1TL3 A;  1J53 A;  1A5W A;  3RMA A;  2QXF A;  2IS3 A;  3P5J A;  1VSH A;  4CFB A;  4FJ5 A;  1HYV A;  3HL8 A;  1BI4 B;  4KI6 A;  5KI6 A;  3OYA A;  2HW3 A;  3OYH A;  5I42 A;  3KTQ A;  4KTQ A;  1RTH A;  2F8T A;  3ZSZ A;  2Z1G A;  4CJU A;  4M3U A;  4FJ8 A;  2P51 A;  3OYB A;  2YNI A;  1S9E A;  1ZBI A;  1WSJ A;  4IG0 A;  1YTA A;  3SQ4 A;  1JLG A;  1LW0 A;  1Z26 A;  2P1J A;  4IG3 A;  4KTW A;  3TAM A;  3OS2 A;  1DTQ A;  1D5A A;  3HPO A;  2OA8 A;  4CFC A;  4CGH A;  3I0S A;  1TK8 A;  4N76 A;  2G8U A;  4FXD A;  3ZT4 A;  4DQS A;  4I2P A;  3KLH A;  1TVR A;  1BQN A;  3SI6 A;  4FJH A;  1LAW A;  3DLK A;  3RTV A;  1TKX A;  1NKE A;  4E7H A;  4CE9 A;  4CJK A;  3RMC A;  2A1S A;  3VQ9 A;  4CIF A;  4M3Y A;  4G1Q A;  2E6L A;  3C6T A;  4J2A A;  3VQ7 A;  3SZ2 A;  3QIN A;  3AVJ A;  1C0T A;  3PO5 A;  4KAZ A;  1RBT A;  1RDD A;  4FZY A;  3AA5 X;  3VA0 A;  3ZSY A;  3OS1 A;  1C1B A;  3HK2 A;  4KHU A;  1CXU A;  2D0C A;  1NK9 A;  4H8K A;  3HP6 A;  2OYQ A;  2JLE A;  3LZJ A;  1C6V A;  2QK9 A;  3QES A;  3V4I A;  1N6Q A;  3HJF A;  4FM0 A;  3TAF A;  3K58 A;  3CFO A;  2XY7 A;  1D9D A;  3VQQ A;  4F3T A;  4FJ7 A;  2HND A;  1A5V A;  4IBN A;  4PY5 A;  2IDO A;  3EY1 A;  3K5L A;  4C8K A;  1U47 A;  4JS4 A;  4PWD A;  4ZTJ A;  2ZQB A;  4UQG A;  3NH0 A;  2A1R A;  3RRG A;  4FLT A;  3OVN A;  3D45 A;  3VQA A;  4W5O A;  2FC0 A;  1QS4 A;  4E7L A;  4EP5 A;  1F21 A;  5KGW A;  1RT1 A;  4HHT A;  1GOC A;  5KTQ A;  1BGX T;  4KV8 A;  4R5P A;  4I9Q A;  3ZSW A;  5K14 A;  3K5O A;  3PV8 A;  4W5N A;  3AA2 A;  4CF0 A;  3P83 D;  4RW4 A;  3LWL A;  5D3G A;  1WAJ A;  3VQE A;  4M42 A;  1B92 A;  3KK1 A;  2HHV A;  5CY4 A;  4DTM A;  3QEX A;  4Z4F A;  3G0Z A;  4DMN A;  1IO2 A;  3DLB A;  1BCO A;  4DTJ A;  1U49 A;  3IAY A;  4F2S A;  1WN7 A;  4HCB A;  1ZBU A;  2KFZ A;  3QEW A;  3VQC A;  2P5G A;  4YNQ A;  1RBU A;  1GOA A;  1S9G A;  4I2Q A;  5HRR A;  4CJL A;  4DTX A;  5FRN A;  3KKS A;  1QHT A;  3S3M A;  4CGI A;  1K6Y A;  3L3V A;  2RN2 A;  3DMJ A;  4FK0 A;  3EZ5 A;  2X6N A;  3V6D A;  2ETJ A;  4M3W A;  4E1M A;  2Z1I A;  4CEZ A;  1IKX A;  4NCG A;  4FJN A;  5SWM A;  3AO3 A;  4CHQ A;  5HP1 A;  4K8Z A;  2XRI A;  5CZ1 A;  3UIQ A;  3NF8 A;  1C1C A;  3HVT A;  3JYT A;  2W42 A;  3CFR A;  1WSI A;  3O4Q A;  4E7J A;  3RWU A;  3LAK A;  3DRR A;  4LSN A;  1T03 A;  1WSF A;  4DLG A;  4I7F A;  4PQU A;  4EZ9 A;  4CK1 A;  3DI6 A;  4AHT A;  4CF1 A;  4DFP A;  2EHG A;  1U45 A;  2OZS A;  1L3U A;  4H4M A;  4CFA A;  4RW9 A;  1ZYQ A;  2PYL A;  3AVK A;  3WNH A;  3OYM A;  4BAC A;  2KQ2 A;  1LV5 A;  4LY7 A;  3DRS A;  3NGY A;  3OS0 A;  3O4N A;  1RNH A;  3LP1 A;  3V9Z A;  1IG9 A;  3O3F A;  4B9T A;  1EET A;  1RDB A;  3LPT A;  4CF8 A;  2QKK A;  1J9A A;  2FBV A;  3I8D A;  4FLX A;  4LD0 A;  1KFD A;  2FBY A;  3HYF A;  2PZS A;  4F4K A;  3AVC A;  3NE6 A;  4M45 A;  3AO4 A;  3HVR A;  3NAE A;  3C94 A;  3DOK A;  3OYD A;  3OYK A;  3K5N A;  3SUO A;  4DQR A;  3L2V A;  4DQQ A;  3ZSV A;  4B3O A;  1RTI A;  1RDC A;  3AA3 A;  4CHZ A;  3AVG A;  3LZI A;  3S3N A;  1VSJ A;  3TAP A;  2HB5 A;  4F3O A;  4FLZ A;  2BDP A;  1VSL A;  2ZE2 A;  1BQM A;  4Z4H A;  3MXJ A;  4NYF A;  3VN5 A;  1HQU A;  1W0H A;  3L2R A;  3QER A;  1RT6 A;  1L3T A;  3KD5 E;  1JLB A;  2FBT A;  4RG8 A;  3ZSO A;  3HT3 A;  1UA1 A;  3DLG A;  3L2U A;  3TAR A;  1N5Y A;  3DLE A;  3L2Q A;  4DTR A;  3M8S A;  1KSP A;  4B9U A;  4OGE A;  1EP4 A;  1WSH A;  4E7I A;  3M8R A;  2E6M A;  2G8K A;  5HRP A;  4KRE A;  4BDP A;  4Q0B A;  3AA4 A;  3I0R A;  1X9M A;  4AIL C;  3DLR A;  4DF4 A;  3QIO A;  1UWB A;  1X9W A;  4OKE A;  1JL2 A;  4FLV A;  1GOB A;  3VQB A;  2VWJ A;  4HVJ A;  4ZTF A;  3ITH A;  3U3G A;  2YKN A;  4N5S A;  4E7K A;  5JS1 A;  4GMJ B;  2B6A A;  1L3V A;  4ICL A;  4N41 A;  2IOC A;  3DOL A;  4BE0 A;  4Z4G A;  1KRP A;  1SKS A;  5J2M A;  4L8R B;  4CHP A;  4M41 A;  4CJP A;  4B8C A;  4FK4 A;  3KD1 E;  5J2P A;  4FW2 A;  1LWC A;  3NCI A;  4FYD A;  3SNN A;  3AVF A;  3HM9 A;  1SUQ A;  2OZM A;  3HO1 A;  3AO5 A;  2RKI A;  3SCX A;  3TAE A;  2YV0 X;  2HHU A;  1FKO A;  1TKD A;  3TAB A;  2D5R A;  2JGU A;  4CJR A;  1Q9X A;  1R0A A;  2F8S A;  2I5J A;  1HYS A;  4FJJ A;  4GVM A;  3CM5 A;  1KVC A;  1REV A;  2XHB A;  3QEP A;  3M8P A;  2BE2 A;  2HNY A;  3TAG A;  1RTD A;  3AVA A;  3WNE A;  4XIU A;  3U3Y A;  3VQ6 A;  1Q9Y A;  5HRN A;  4ZHR A;  3SV4 A;  4IFY A;  4W5R A;  4OGC A;  4J2D A;  1IKV A;  4CJ5 A;  3IS9 A;  4CEQ A;  4OLB A;  4CJE A;  2HHX A;  1WLJ A;  1CZB A;  4DG1 A;  1RT5 A;  4IKF A;  4CHO A;  3K57 A;  2VG7 A;  3TR8 A;  3SYZ A;  4H4O A;  3AVM A;  4CED A;  1UAX A;  4O4G A;  2GUI A;  1TK5 A;  2HMI A;  4DFM A;  2DTU A;  1NJX A;  1RDA A;  1SV5 A;  4B9L A;  4OJR A;  2B4J A;  4N47 A;  5HRO A;  4B9N A;  1SL1 A;  1NKB A;  3L3U A;  4KKO A;  3JSM A;  1Z25 A;  3AO2 A;  1KVB A;  1YVU A;  5CYQ A;  3EYZ A;  3BGR A;  4CK3 A;  3T3F A;  4PA1 A;  3AO1 A;  2ZD1 A;  3CQ8 A;  3KK3 A;  1QE1 A;  4DS5 A;  3OYF A;  4DFJ A;  1QTM A;  4OLA A;  1X1P A;  3LAM A;  1JLC A;  3LDS A;  1B9D A;  3NBP A;  1VRT A;  4FVM A;  4AHR A;  1NKC A;  4FZX C;  4E0D A;  2HHS A;  1NK0 A;  1JXE A;  1YTU A;  2VG5 A;  1DLO A;  2D0B A;  2RPI A;  3M8Q A;  3T1A A;  4QOZ B;  2HHT A;  2O4G A;  3RMD A;  4PUO A;  4JLH A;  1HRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...