1VSIA

Asv integrase core domain with ca(ii) cofactor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
total genus 51
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsiA00
1TK8A 1RTHA 3JSMA 3VQ5A 1UA0A 4E7JA 4CECA 4FJ7A 2G8IA 1S6QA 1WN7A 3LANA 5HLFA 3IAYA 3KD5E 2OPQA 3RMAA 5J2MA 2VG5A 4FM1A 3D45A 4OKJA 4W5OA 1RT1A 3V81A 3ZSWA 3HPOA 3M8RA 1Y97A 2XY6A 2W42A 4DQQA 4ZTFA 1JLQA 1HNIA 4O44A 3NH2A 3OYCA 4DSLA 3V9ZA 1NK9A 4DTXA 4KHYA 3U6FA 3KD1E 4FK4A 2VWJA 3KLIA 1JLBA 1S1XA 3PO5A 3AVBA 2KTQA 1HQUA 3E01A 3K5NA 3HM9A 1NK6A 1D9FA 3NCIA 4C8NA 4ZHRA 4JRPA 5KI6A 4OGCA 4KHNA 1D5AA 4Y1CA 3AO3A 1IH7A 5SZTA 3ZT2A 1QSYA 4CJLA 1RT7A 1S5JA 3KLHA 4J2EA 2D0CA 1RT4A 4HTUA 3V9WA 4OLAA 1BHLA 3OVNA 1NOYA 3WNFA 4KTWA 2YNHA 2HHUA 3ZCMA 1KLNA 4OVLA 1A5XA 2ZD1A 1L3VA 4KHSA 3KLGA 4IG3A 4AHCA 4DQSA 1KRPA 4O0JA 2PYJA 3WNEA 2EHGA 3HK2A 1TL1A 1EP4A 3IS9A 4J2BA 1VK0A 1VSHA 4AHVA 3V1QA 1U48A 4FZXC 3L2VA 2EX3A 4LH4A 2HNYA 3MAQA 3OYFA 3LALA 3QEVA 4DS5A 4CHOA 2WOMA 4M45A 4FJKA 4FCYA 3ZSZA 5DMRA 4R5PA 3HT3A 4B3OA 4HUEA 3PUFA 3SQ0A 4JLHA 3OS0A 1HYZA 3HVTA 3QNNA 3KKRA 5HBMA 3CFOA 1C0MA 4CFDA 5HRPA 4PUOA 2P5GA 4DLEA 4Z4GA 3EYZA 4DF4A 3DRPA 3SUNA 2WONA 4BWMA 4CJKA 4DFKA 4FLVA 4O5BA 3VQ8A 1S1VA 3OYGA 3S3OA 4M42A 3NH1A 1LV5A 4K8ZA 1BIUA 3ALYA 1NK4A 4DF8A 1RILA 2IAJA 4CHYA 4DFJA 4IDKA 1U4BA 1SKSA 1CZBA 1BQMA 4Z4HA 5C42A 3DLRA 1XHXA 4CF0A 4I2PA 5E41A 3QIPA 1TAQA 4ELVA 4DSFA 3UIQA 1B92A 1I3AA 2ZQBA 3LWLA 2D0BA 1LW0A 5KGWA 2OYQA 2HHSA 3L3UA 3TAMA 2Z1GA 3K59A 4E7HA 5C24A 4B08A 5HROA 4M3XA 3S3MA 1RT2A 5I3UA 1SL2A 1VSDA 4BDPA 3OJUA 1R0AA 4FJNA 3AVMA 4OLBA 4KRFA 3K57A 2HNZA 4N5SA 4CEBA 1VSIA 1KCFA 1J53A 1UOCA 4KO0A 3ZSQA 1U04A 1JLFA 1S1UA 3V4IA 3VA0A 1CZ9A 3OYMA 4JRQA 4CHQA 3NBPA 3PX6A 3AO2A 5D3GA 3HO1A 2KFNA 3TAGA 2XY7A 4CF9A 5J2QA 1T05A 1L3TA 4KTZA 4CEAA 2VG7A 3T3FA 2IS3A 3CM6A 3SJJA 4FLUA 1A5VA 4MFBA 4AHTA 4O0IA 2YV0X 2KZZA 3AVGA 1FXXA 4CHZA 1VSKA 4AHUA 4LSNA 2OPSA 3C94A 1IG9A 4CK3A 3DLHA 3P5JA 4RG8A 3EY1A 3NF7A 2F8TA 2FBVA 3ZSOA 3A2FA 3AA2A 4CJFA 4CJRA 2XHBA 4DQPA 1HYSA 1WAFA 5KRSA 3LPUA 1RBTA 3CG7A 1WSHA 1KLMA 3ZSRA 1KVAA 4CIFA 1NKEA 1GOAA 1NOZA 1TV6A 1VRTA 2IDOA 2OPPA 3HYFA 4KKOA 4FLYA 1NKCA 1CLQA 3ITHA 3DRRA 1QHTA 2E4LA 4K8XA 1LW2A 3ISNC 3G10A 4CCHA 4BE2A 3F9KA 1BQNA 5J2NA 1U45A 3QETA 3AO4A 2AJQA 1EKEA 1JLGA 4FW2A 3QNOA 2HVIA 4B8AB 4QOZB 3LDSA 1RTIA 3LP1A 2GBZA 3V1OA 3K5MA 3S3NA 1QSLA 4DTSA 1ASUA 1BI4B 3MXMA 4KB0A 2QXFA 3SUPA 1VSFA 2FBXA 1NJZA 4B9TA 1CXQA 1RDCA 3LZJA 1Z25A 5JS2A 4OKEA 1C0TA 2RPIA 3MECA 1S9GA 3VQ6A 4CJWA 4E1NA 1Q9XA 2G8VA 5FRMA 3HJFA 3S9HA 3K5OA 1JXBA 1ASWA 1QQCA 3L8BA 4E7KA 4DTMA 2NUBA 3NHGA 3SYZA 4OPKA 1RNHA 2ATQA 4N47A 4CIGA 3TABA 3KLEA 4HUGA 3ZT0A 4CESA 1TK0A 3TI0A 3O3GA 4CGDA 3U3GA 2JGUA 1L3UA 4DWIA 4B9NA 4F8RA 4B8CA 4CF2A 3TAEA 2PZSA 3RR8A 3AVHA 3CFPA 3I0RA 3CFRA 3OY9A 5I42A 1VSJA 5CYQA 2FBYA 2B6AA 5CY4A 1U47A 3FFIA 3RMDA 4H4MA 3VQDA 3SCXA 2G8FA 4I2QA 2P1JA 2OPRA 2P51A 1JL1A 3AA3A 4FW1A 4RW9A 2KZMA 1VRUA 4EP5A 4GMJB 3DYAA 4B9MA 3SUQA 4DSKA 1YTAA 1ZBFA 4W5TA 3OYAA 4GW6A 3OJSA 1BL3A 4ID5A 4CEEA 1IKWA 3ZT4A 2F96A 2Z1IA 3JYTA 3B6OA 4Z4IA 4N76A 1X9SA 4TSXA 1TGOA 1DTTA 2DFHA 4ID1A 2DTUA 1LAVA 4E7LA 2DFFA 1YTUA 4C8KA 4WE1A 2BE2A 2E6MA 3LWMA 1BISA 1C1CA 3LAMA 1YVUA 3TWHA 2OA8A 4I9QA 2HHTA 3AVJA 4DS4A 4IKFA 4DU3A 3NE6A 1SUQA 1WLJA 1XC9A 1RT5A 3O4NA 4FJIA 2LSNA 3NF8A 3V9XA 4CJ4A 2A1SA 4NYFA 4FLWA 3QINA 3KLFA 1J5OA 4FJJA 2QKBA 4FJHA 3VQEA 3LZIA 4ELUA 4HCBA 1L3SA 4EZ6A 2XY8A 2B5JA 1HJRA 1SKWA 1JL2A 1SL0A 2KFZA 2XRIA 4DTOA 4FJ8A 1S1TA 3MEDA 5HRSA 2X78A 3RTVA 4N56A 4H8KA 1HNVA 4PA1A 1ZBLA 4XIUA 1HRHA 4KTQA 3RWUA 3AO1A 3DRSA 5CZ1A 2O4GA 1RT6A 4YFUA 2IOCA 4W5RA 3SQ4A 3ZSYA 4L8RB 4CE9A 4KHWA 2R7YA 1X9MA 1TKDA 4N41A 1HQEA 2RKIA 2Z1HA 1KSPA 3P1GA 3QESA 2OZMA 4E1MA 3MEEA 4CEFA 1C6VA 1WSJA 4KFBA 3OS1A 2HW3A 3VQ4A 2PYLA 4IFVA 3NDKA 3HP6A 1RBVA 4QCLA 3AVFA 5KTQA 4LY7A 3OYBA 3MXIA 1NKBA 1D9DA 2F8SA 2VWKA 4Q0BA 3AVLA 4DTUA 3OYDA 2IGIA 1FKOA 3HXMA 4C8OA 3BGRA 1S6PA 4O4GA 4FJ5A 4NCAA 4RW8A 3TAQA 2BDPA 4CJSA 4CK2A 4W5QA 3L2UA 3THVA 4O55A 2FC0A 4DFMA 1SL1A 4F3TA 4DTRA 4FK0A 2B4JA 2YNIA 2Z1JA 3AA5X 4OGEA 4Z0UA 4B9LA 4DSIA 3TR8A 3QLHA 3K5LA 3TAFA 2RF2A 4CEQA 3DLEA 3O3FA 1Q8IA 4OKKA 1RCHA 4Y1DA 4CJVA 3ULDA 4FLZA 1T03A 4DQIA 4ICLA 2Y1JA 4LD0A 4AHSA 3PX4A 2E6LA 2GUIA 2HHXA 1WSIA 3OYLA 3LP0A 4PY5A 2VG6A 3SPYA 4HCCA 3VQAA 2DY4A 1CXUA 3LPTA 4IBNA 4IFYA 4HVJA 5CYMA 4DTPA 4DSEA 3B6PA 2G8WA 1ASVA 4PQUA 4CGIA 3AV9A 4DMNA 2HHVA 3AVIA 1NK8A 2HVHA 2G8UA 1QE1A 3NAEA 4M3WA 3P83D 3KJVA 1HPZA 3AVKA 2ZE2A 1T8EA 1C1BA 3QO9A 1ZBIA 3TARA 5J2PA 3SI6A 3KIOA 3SV3A 1JLCA 3AVNA 2FBTA 3K2PA 4M41A 3KK1A 4HHTA 2XY5A 4F2RA 3OYHA 4AHRA 3OYKA 4HUFA 4CFCA 3K58A 3SNNA 1SV5A 4CFBA 4KPYA 1LWFA 3AA4A 1IKXA 3I0SA 1HMVA 1BI4A 3NGYA 4AH9A 3QERA 4NYNA 4M3YA 1BIZA 3T1AA 4OPJA 1NK0A 1KTQA 3VQ7A 3M8PA 4Q5VA 2P5OA 4KHUA 1QS4A 5EU7A 5T7BA 1N5YA 4DSJA 4LSLA 3O3HA 3OYIA 2IC3A 1QTMA 1DLOA 3ZSVA 1JLEA 5FROA 3QEIA 4CFAA 3DLKA 1RBSA 4CGHA 4BDYA 1KVBA 5HP1A 4DG1A 4CF1A 3VA3A 4CJPA 3DLBA 3QEPA 2YNGA 1X1PA 2ETJA 3BDPA 4FK2A 3D0PA 4YNQA 1EX4A 1LWEA 4E0DA 1VSMA 4QAGA 1TL3A 4BE1A 4CEZA 3NF6A 4DTNA 4CEDA 1JLAA 3IG1A 3VQQA 1RTDA 2BANA 4FZZA 4B9VA 4FVMA 5KGXA 3ASMA 4MQ3A 4CIEA 3O4QA 4KV8A 3DI6A 3G0ZA 5KRTA 3SQ2A 3TAPA 1BCMA 2BGGA 4F4KA 3C95A 2HMIA 3M8SA 1GOCA 2YKMA 1UAXA 4JS5A 3RR7A 3AVAA 4UQGA 4FJMA 3NGIA 1X9WA 3PO4A 4Z4EA 1ZBHA 4FJ9A 3HPHA 1J9AA 3OYNA 1GOBA 4RW6A 3PX0A 4J2DA 3I8DA 3MXJA 2DFEA 3VQPA 1W9HA 5FDLA 2QK9A 4KB1A 2XO7A 3DLGA 3KK3A 1TKXA 1Q9YA 4EZ9A 4M3UA 1IO2A 1T7PA 2YNFA 3CM5A 1KFSA 3ZT3A 4ELTA 1J54A 4E89A 1WSEA 1VSEA 4G1QA 1ITGA 3HVRA 1XHZA 1TK5A 1FKPA 1WSGA 3M8QA 1QSSA 4B9SA 1LAWA 1RBUA 3CQ8A 5CZ2A 4RW4A 2KQ2A 4CJEA 2YHBA 4DFPA 1RT3A 2PY5A 4FZYA 4DTJA 3SV4A 1UWBA 2HHWA 5HRNA 1Z26A 3PV8A 4FJLA 4KHQA 4M3ZA 4Z4FA 4IG0A 3OS2A 1UA1A 1KFDA 3NF9A 1C1AA 2X74A 1SKRA 4I7FA 4CJ5A 1ZYQA 4CHNA 2G8HA 1RDDA 3RMCA 1MU2A 3IRXA 1FK9A 2G8KA 3HP9A 3KTQA 4FLTA 4JS4A 2O4IA 4CK1A 3L3VA 3NGZA 1TAUA 3TANA 3LAKA 3V9UA 3L2QA 4E19A 4DQRA 3EZ5A 1WAJA 3LP2A 1EXQA 3NFAA 1HYVA 4I9LA 2D5RA 3RRHA 2OZSA 1IKYA 3DOLA 4DU1A 4BE0A 4PWDA 1W0HA 4FM0A 1YT3A 1A5WA 1XI1A 1D8YA 4M3TA 1RDAA 3V1RA 1K6YA 1REVA 2YKNA 4LH5A 3KKSA 4FXDA 3QIOA 3V9SA 4CGGA 3F73A 4RW7A 3HPGA 4BDZA 1B9FA 2HHQA 1DTQA 1XWLA 3DM2A 1EETA 3C6TA 1O1WA 3DOKA 4AILC 2A1RA 1S9EA 4NCBA 3NH0A 1G15A 1L5UA 1NJWA 2RN2A 1TKTA 4KAZA 4NCGA 4C8MA 3QEWA 3H08A 3ZSXA 5K14A 4ZTJA 3SZ2A 2HB5A 2X6SA 4CGJA 1B9DA 3RRGA 1RTJA 1KVCA 4F2SA 4Z4CA 3OYJA 3SUOA 3VN5A 4W5NA 3ZT1A 3L2RA 5J1EA 4CHPA 1NJYA 2QKKA 3C6UA 4E7IA 2X6NA 3HL8A 1NK5A 4CF8A 5SWMA 5JS1A 2D0AA 1N6QA 4CJUA 1TVRA 4CERA 4B9UA 1LWCA 3KK2A 3AO5A 4H4OA 1C0UA 1RDBA 4FJGA 4KI6A 3V6DA 3U3YA 4DLGA 3AVCA 1U49A 1TKZA 3WNHA 1NK7A 1I39A 3VQ9A 1F21A 3QEXA 3RMBA 4C8LA 2Y1IA 4F3OA 1BCOA 4EP4A 4FLXA 4BWJA 3VQBA 3VQCA 1JKHA 2I5JA 1ZBUA 3OYEA 1WNSA 3SQ1A 3PY8A 4E3SA 1VSLA 4DU4A 1WSFA 4CJ3A 5HRRA 1BGXT 3HSTB 3L2WA 4FYDA 1JXEA 4J2AA 3WNGA 1RBRA 4BACA 3DMJA 2YHAA 1S1WA 4CEOA 1IKVA 2KW4A 4OJRA 1NJXA 4KI4A 3MEGA 4CGFA 2ITGA 3LP3A 2GV9A 5DK5A 3CYMA 4GVMA 3SPZA 4KREA 5C25A 2Q3SA 4CJTA 4FJXA 5FRNA 4CJQA 4M3RA 4FM2A 2HNDA 2JLEA 3T19A
chains in the Genus database with same CATH superfamily
2E1YA 1RTHA 2QXLA 3A8YA 4CECA 1KC8O 5HLFA 5MLCQ 3RMAA 4FM1A 2BTFA 3D45A 4OKJA 1RT1A 5AQSA 5AQKA 5FLXO 4CD3A 3DXKA 2W42A 1HNIA 1H1VA 2Q97A 3NH2A 3QBXA 3V9ZA 5KQ8A 2E2NA 3AVBA 3K5NA 2O8EA 4WFNL 1NK6A 4DV5K 4JRPA 3CETA 3A5LC 4JKBA 5KI6A 4OGCA 4KHNA 3O1WA 1QSYA 3N4QA 1RT7A 4DCHA 3LM9A 3LL3A 4HTUA 4ILJA 1BHLA 2P9KA 2YNHA 3FLCO 3G6EN 1A5XA 3SMSA 3KLGA 3CJ9A 4DQSA 1KRPA 4ISFA 4DR5K 1VQ6N 4PKHA 1TL1A 3O4WA 4J2BA 1VQMN 1BUPA 1U48A 3FFKB 4FZXC 2EX3A 3D2FA 4FO0A 3QEVA 2WOMA 4FWPA 1IJJA 4B3OA 3SQ0A 3HVTA 4V19S 4DF4A 4CJKA 3S3OA 1LV5A 4K8ZA 4DF8A 4Z4HA 4ELVA 4B1YB 2OYQA 2QM1A 2HHSA 4BRCA 3L4IA 5C24A 5HROA 1YXQA 4OPAA 1RT2A 1KD1O 1SL2A 3WXKA 4OLBA 4KRFA 3BUZB 4X62K 2FLOA 4N5SA 4KO0A 4BRAA 1JLFA 1YAGA 3GL1A 4U67L 5D3GA 2KFNA 1BG3A 5J2QA 2HHHK 5M1PA 3VGLA 4KTZA 4CEAA 2VG7A 3VEOA 3SJJA 3H1VX 1DGKN 4MFBA 4AHTA 4O0IA 2YV0X 1S22A 4LSNA 3ZSOA 3A2FA 4JI1K 4PL7A 3L4QA 1HYSA 1WSHA 4J8FA 4CIFA 3HYFA 2OPPA 4KKOA 4FLYA 3CCJN 1NBWA 3E66A 5LMUK 5J2NA 4BRFA 1U45A 2P9IA 3QNOA 2HVIA 3B8AX 1NLVA 1Z05A 3S41A 2UU9K 3LP1A 5AQQA 1N33K 3K5MA 1QSLA 3HTVA 1ASUA 4KB0A 2QXFA 4QS8A 3SUPA 1S9GA 4E1NA 4EFHA 1GLCG 1ASWA 3L8BA 4E7KA 2NUBA 3CCRN 4AF1A 4OPKA 2QWQA 4HUGA 3O5BA 4CESA 4WQ5A 2KHOA 4CGDA 3U3GA 2JGUA 5AZJB 3TAEA 3RR8A 3EE8A 3UKUB 5CYQA 1WBDA 2VGNA 2B6AA 3RMDA 3H3OB 2GUPA 3VQDA 3SCXA 3MN5A 2NNWA 4RW9A 5DM7L 3AA3A 1VRUA 4QS9A 4F9OA 3FZKA 4WQ4A 2I7PA 2F96A 4TSXA 1TGOA 4ID1A 3QICA 3PIPL 4E7LA 3T1HK 3VEXA 4C8KA 4WE1A 4JAXA 1XUPO 3R9PA 3EKSA 4DKWA 2OA8A 4DS4A 1RT5A 3O4NA 4FJIA 1VAZA 2A1SA 4BC5A 3QINA 1J5OA 1NM1A 1TUYA 1OVYA 3CI5A 5F2RA 4FJHA 3K9KA 3O80A 3LZIA 1WB9A 4HCBA 2XY8A 3WEEB 4X65K 1VQ5N 3MEDA 5HRSA 2X78A 4DV3K 3A5NC 4JV5K 3TTFA 4YFUA 2IOCA 4L8RB 1TKDA 3J7YP 4A2BA 1X9MA 1HQEA 4N41A 3TPQA 2ZJPL 2NRZA 3P1GA 3QESA 1VQKN 2NRWA 3NDKA 3HP6A 5AQVA 5KTQA 1VQ7N 1NKBA 4U7BA 1VHXA 5AQTA 4DTUA 5ADXA 2IGIA 5ADXH 4YHHK 4O4GA 4EHTA 4NCAA 4CVNE 4DFMA 3SLCA 5JVHL 4FK0A 4FWLA 2YNIA 4FSVA 3QLHA 2YJFA 3TAFA 3DLEA 4OKKA 1T03A 2O8CA 5BPNA 2Y1JA 4LD0A 4RWTA 5AFUA 1WSIA 5AQWA 3LP0A 4PY5A 2QEXN 2DY4A 4HCCA 1CXUA 1GLJO 3LPTA 4IFYA 5CYMA 5GINA 3B6PA 4DMNA 2HHVA 2QWOA 3HSCA 3VEZA 2HVHA 4M3WA 3KJVA 1BOTO 2ZE2A 1C1BA 4BY9C 1ZBIA 3J8AA 2YCHA 2G8KA 5J2PA 3SI6A 3SV3A 3NMUA 2FBTA 4HHTA 4M41A 4F2RA 5AQHA 1SZ2A 4HUFA 4CFCA 4CFBA 1YJWN 1LWFA 1IKXA 1BWFO 3ULEA 4M3YA 3T1AA 5AQRA 4OPJA 2E1ZA 3RVCA 3M8PA 4IJAA 2E2OA 3J7ZO 4PHTX 4NXNK 3QEIA 1JLEA 3OBYA 2F7TA 5FPNA 4DG1A 3VA3A 3SBTA 3QEPA 2P9LA 1SAZA 4FK2A 3PLAA 1EX4A 4B3RK 4MO4A 1TL3A 4CEZA 3NF6A 4DTNA 3IG1A 2QWMA 1RTDA 3CQYA 2BANA 4DR3K 4B9VA 4HTLA 4MQ3A 3G0ZA 1ZC6A 3FZLA 2P9NA 1YI2N 2FSKA 2YJEA 1UAXA 4IDHA 1X9WA 3HPHA 1J9AA 1J6ZA 2YHWA 3JXUA 1GOBA 4RW6A 4J2DA 3I8DA 2W40A 5FDLA 1IG8A 4KB1A 3OW2M 1K8KA 5JMVA 5AQFA 4BVPA 3CM5A 1QQNA 4E89A 3HVRA 2UUBK 4B9SA 1LAWA 3ZEUB 2KQ2A 3ATVA 4DFPA 4EHUA 1W97L 3PV8A 4FJLA 3AY9A 2V52B 1BU6O 3NF9A 5AQNA 1C1AA 3ZX3A 3BZCA 3H46O 1RDDA 3T69A 4FLTA 4LFAK 4CK1A 3L3VA 3LAKA 3NVKA 4CD1A 3V9UA 4PL8A 2QWRA 2VWBA 1EXQA 2OZSA 4IZ9A 2OANA 1XI1A 1YT3A 1A5WA 2WC9A 1RDAA 4IOXA 1K6YA 4DHYA 1HPMA 1YITN 4LH5A 3KWIA 3QIOA 4CGGA 4RW7A 3HPGA 1XWLA 3DM2A 5EOYA 4AILC 3DOKA 2A1RA 1S9EA 1NJWA 3QEWA 1C0FA 4MDAA 5K14A 2HBMA 5H1SQ 2X6SA 3SZ2A 3RRGA 1RTJA 4MLHA 2AP1A 3VN5A 3L2RA 4BR5A 3A5MC 2QKKA 3NVMA 3HL8A 1TYQB 4DB3A 3O1BA 1N6QA 4E1JA 4B9UA 5AZIA 1LWCA 1SS6A 3ZYYX 1C0UA 4FJGA 3V6DA 4H03B 4M7XA 3ZETB 2A42A 4YOTA 3QEXA 1F21A 3VEVA 4K25A 4ILGB 4DU4A 3DXMB 3H1QA 1BGXT 1JXEA 1S3XA 3DMJA 3VESA 3DLLL 2KW4A 1NJXA 4KI4A 3P4IA 1RFQA 5DK5A 4KHPK 2D0OA 3CYMA 1XQSC 4CJTA 3N4PA 2PFUA 4CJQA 1EQYA 2GELA 3T19A 2G8IA 1VQNN 2O8FA 4BG8A 3P38A 4BRIA 3IAYA 4BRMA 3UKRA 2VG5A 4BRNA 3MWTA 2UXBK 5C2FA 3THYB 3V81A 2CGKA 2W41A 5KPZA 4DTXA 4KHYA 3U6FA 1VQ8N 3CJ7A 1Q18A 4DR7K 5BPMA 1HKCA 3HM9A 5HL7L 3AO3A 1XNQK 4MDBA 1U6ZA 1OVQA 1S5JA 3KLHA 3MN7A 2ZWHA 3V9WA 3MX5A 3WNFA 2UYTA 4M63C 2HHUA 1JCEA 4NLBA 2NRHA 2FSJA 4JI8K 2QWNA 1EP4A 4FWRA 4H5WA 4BQLA 3L2VA 4YOUA 1YHQN 4DS5A 4M45A 1EWRA 4FJKA 3HT3A 4MO5A 1IBLK 2Q0RA 3KKRA 5HRPA 4PUOA 3ID6A 3MCAB 4H0YB 3EYZA 3SUNA 2WONA 1NK0A 1S1VA 3OYGA 1KAZA 1BIUA 1RILA 3U4LA 4DFJA 4JD2B 5FRNA 3CD6N 2GTDA 3DLRA 5E41A 3QIPA 1TAQA 3UIQA 3LWLA 3HI0A 3O9RA 3TAMA 3K59A 4E7HA 3E9LA 3BP8A 3I56N 4A5AA 3K57A 2AA4A 4BC3A 1VSIA 5HOOA 1KCFA 3ZSQA 5AQMA 4NXMK 3V4IA 3VA0A 1T44A 2V7ZA 3OYMA 4CHQA 3NBPA 3PSFA 4JRQA 3PX6A 3HO1A 3LDOA 4CF9A 1L3TA 4K43A 2P9PB 1LCUA 4B1WB 2JWKA 3O9SA 4CHZA 4AHUA 1ESVA 3C94A 5BREA 2NRXA 3P5JA 4RG8A 1GLDG 2FBVA 4CJRA 4GNIA 4DQPA 2O8DB 3LPUA 1RBTA 4LFCK 3D2EA 1NKEA 2IDOA 3GDQA 1QHTA 1LW2A 2A6AA 4G9ZA 4AQYK 4CCHA 4NO7A 4GV6A 2HMPA 1JLGA 4FW2A 1T6CA 4B8AB 4QOZB 1RTIA 3VERA 3V1OA 1BI4B 2HF4A 1NJZA 1CXQA 1W7AA 3RSEB 2RPIA 3OA9A 2NLXA 3VQ6A 4CJWA 1DT9A 5B8HA 3K5OA 2Q1NA 4DTMA 1RNHA 4YDUA 3KLEA 4FPAA 1OH6A 2WFBA 3TI0A 3SJHA 1L3UA 4DWIA 4B9NA 4IEEA 3CC2N 3AVHA 3CFPA 3OY9A 4DV4K 1K8AO 3C6AA 4BRQA 1MWKA 4JHDB 5AQZA 2FBYA 3FFIA 4H4MA 4CZLA 2G8FA 2FF3B 2P1JA 4BG9A 4DV2K 4JI0K 1ZBFA 4RCHA 2QW9A 1NMNA 4GW6A 3OJSA 4ID5A 2ZM6K 2FSNA 3B6OA 1EO1A 2DFHA 1NGGA 4BRDA 1NGDA 2E6MA 3KK7A 2V7YA 1ATNA 1R59O 3AVJA 4DU3A 1SUQA 1XC9A 3V9XA 4CJ4A 4FLWA 1KAXA 3KLFA 4FJJA 1BA1A 3GE1A 3H45C 3ENHA 1L3SA 3SK3A 4LF9K 3DAWA 1IBKK 1SKWA 1JL2A 2KFZA 2XRIA 4FJ8A 1S1TA 3SAFA 3RTVA 4H8KA 1ZBLA 1HRHA 2WUSA 1LOTB 3DRSA 5CZ1A 3SQ4A 4W5RA 4CE9A 4KHWA 3DWLA 1GLBG 3CXCM 3T1YK 5IWAK 4E1MA 3MEEA 3WXLA 1C6VA 4FL9A 5LMNK 2IVNA 4IFVA 4A59A 4LY7A 2F8SA 4LC9B 4JI5K 2VWKA 3TTCA 1QZ6A 4WFBL 4BRPA 4FVUA 2VYPA 4BR2A 4H0VB 1S6PA 3TAQA 3R6MA 4CK2A 3THVA 4O55A 3O6WA 2B4JA 2FXUA 4IWVA 4OPHA 1YF5L 2CGJA 4CEQA 4X64K 3CCEN 3O3FA 3LDLA 3MX2A 4CJVA 3ULDA 4DQIA 3FE1A 3MN9A 3SBGA 4FLZA 4ICLA 2E6LA 4WF9L 2QA4N 2HHXA 4DR2K 3CMAN 3TSPA 4DTPA 1QZ5A 1QHAA 2OCEA 2NZTA 4JKFA 2G8WA 4CGIA 1ZBSA 3AV9A 4RTFD 1QE1A 5FPEA 3P83D 2PAVA 3KIOA 1JLCA 3AVNA 4O8UA 3K2PA 1Q81O 3OYHA 3HOTA 3OYKA 3SNNA 1SV5A 1T6DA 3NGYA 5AQPA 4AH9A 3QERA 1KTQA 4Q5VA 3BF3A 5EU7A 1N32K 4JKAA 4DSJA 3OYIA 2HF3A 2IC3A 2QWLA 1QTMA 4A2AA 4BR0A 5JLFA 4GKKK 3C7NA 5FROA 3DLKA 1RBSA 4ISGA 4BQZA 3CJAA 1KVBA 5HP1A 4CF1A 3DLBA 3I33A 1O13A 5AZJA 5C12A 4E0DA 4BE1A 4CZFA 1HKBA 1X3MA 2CH5A 4CEDA 5C10A 1XMOK 3UKUA 5KGXA 1Q82O 4CIEA 4KV8A 3DI6A 3AARA 2UUAK 1BCMA 2HMIA 3A0IX 3M8SA 3AVAA 1ZBHA 4B9QA 4YORA 3PX0A 3VQPA 3A5OC 1QQOA 1W9HA 2E2QA 3DLGA 4M3UA 1IO2A 2YI1A 5AJ3K 1WSEA 1VSEA 4G1QA 1TK5A 1MWMA 1RBUA 5CZ2A 2PY5A 1RT3A 4IFEA 5HRNA 1N8RO 3D7EO 1UA1A 2X74A 1SKRA 2I7NA 5EY4A 4CJ5A 2OTJN 3RMCA 1FK9A 5GAEP 4H0XB 3WUHA 4DQRA 3LP2A 3WEEA 3NFAA 4I9LA 1NGAA 4B3MK 2E88A 1IKYA 3DOLA 4BE0A 3U9ZA 1W0HA 1NGFA 1D8YA 3E1YA 3GOIA 3V1RA 1REVA 5BR8K 2YKNA 3KKSA 4LFBK 4JKGB 2F9WA 1B9FA 3C6TA 3LDNA 1VQON 2RN2A 1TKTA 4KAZA 4NCGA 3ZSXA 2HB5A 2VQFK 4O5FA 1KVCA 4Z4CA 3OYJA 3O9UA 5J1EA 4CHPA 1NJYA 3VMFB 4CJUA 5AFUH 1TVRA 4CERA 3AO5A 3U3YA 4DLGA 3M6GA 5KPTA 3VQ9A 3RMBA 4FLXA 3VQBA 1JKHA 1ZBUA 2ASOA 3PY8A 2PBDA 3VOVA 4AM6A 2P9UB 3HSTB 1ATRA 4J2AA 3WNGA 1X3NA 2YHAA 4CEOA 1VQ9N 3LP3A 4GVMA 2HBLA 4MLEA 3QB0A 4M3RA 2HNDA 1TK8A 3CJ1A 3JSMA 3VQ5A 4E7JA 3HM8A 5E26A 3KD5E 5J2MA 3QBWA 4PKGA 4K42A 2WBNA 3MCPA 4W5OA 5M1FA 3ZSWA 3M8RA 1Y97A 4JK8A 4O44A 1K9MO 4DSLA 4L3QA 5CE3A 3KD1E 1IV0A 4FK4A 2VWJA 4GV9A 3KLIA 2KTQA 1HQUA 3WXMB 1D9FA 3GG4A 4C8NA 4CZMA 1BO5O 1D5AA 1IH7A 5LL6Z 3ZT2A 1KAYA 4J2EA 1E4GT 2D0CA 1HNWK 4OLAA 1NOYA 3KWGA 4KTWA 3ZCMA 3VENA 2ZJQL 4KHSA 4AHCA 3THWB 1SQKA 2PYJA 3WNEA 3HK2A 3ZEUA 3IS9A 4X66K 1VK0A 4AHVA 3V1QA 3EEQA 5AQYA 1XC3A 5BN9A 1YJNN 1K73O 2HNYA 3MAQA 3OYFA 3LALA 1NG9A 4CHOA 1OH8A 1YJ9N 3PUFA 4B1XB 3ZX0A 3OS0A 1HYZA 3QNNA 3CFOA 1C0MA 1VQLN 2HBKA 4DQ8A 4IO9L 4BWMA 4DFKA 4O5BA 1NGCA 1HLUA 3NH1A 3ALYA 2IAJA 3IFRA 1U4BA 1SKSA 1CZBA 2H3GX 4B3TK 4DSFA 1B92A 2ZQBA 5KGWA 3L3UA 3LM2A 4B08A 4M3XA 5I3UA 1VSDA 2P9SB 4BDPA 3I8BA 3OJUA 1R0AA 5EX5A 1BA0A 1J53A 5AQUA 1S1UA 4YY3K 1N36K 4DV1K 3AAPA 3PSIA 3AO2A 3TAGA 1MA9B 2XY7A 2O8BB 4FLUA 1V4SA 2DPNA 1TYQA 2ASMA 3AVGA 2OPSA 1RDWX 2IVPA 2F8TA 2XHBA 4YOYA 3ZETA 5IT9O 1KLMA 2Q36A 4XH4A 3J80O 1GOAA 1TV6A 1NKCA 3ID8A 4CZEA 3H6EA 3ITHA 3DRRA 2E4LA 4K8XA 3ISNC 4H5RA 3F9KA 1M90O 4DR6K 3DXMA 3QETA 3AO4A 2AJQA 1EKEA 5C15A 3LDSA 1FW6A 1W2BM 3MXMA 2UUCK 4A57A 1RDCA 4H5NA 5JS2A 3VF2A 4OKEA 1C0TA 3MECA 2G8VA 1Q9XA 5FRMA 2D0PA 1JXBA 3NHGA 3F5TA 1OH7A 2A3ZA 4N47A 4CZIA 3ZT0A 4XEIA 1TK0A 3THYA 1KQSM 4LF6K 4B8CA 4CF2A 2VQEK 4FWOA 1VSJA 3AGRA 5CY4A 3IMXA 1U47A 1ZXOA 3CC7N 5JICA 4I2QA 2P51A 5CR4A 1JL1A 3U9DA 3MDQA 4EP5A 4GMJB 4B9MA 3SUQA 4DSKA 4W5TA 3WT0A 1BL3A 3ZT4A 3CPWM 4BRGA 3SMPA 4N76A 1JCFA 1LAVA 3O9TA 1Y64A 2DFFA 1YTUA 4IO8A 1C1CA 3LAMA 1YVUA 3R3LA 4KH4A 3TWHA 4I9QA 2HHTA 3NE6A 2QWPA 3Q7CA 3HZ6A 4NYFA 3ZX2A 1DKGD 1TUUA 4IOCL 3VQEA 4BR4A 4B3SK 2B5JA 3FZHA 1HJRA 3VTHA 3KVGA 2NRRA 1SL0A 3THXB 2VGMA 1HNVA 4KTQA 3AO1A 4JD2A 2O4GA 1RT6A 2E20A 3R8EA 2Z1HA 4CZKA 1KSPA 2OZMA 1WSJA 4KFBA 5ELZA 3M5RA 2HW3A 2PYLA 4QCLA 3AVFA 5FPMA 3OYBA 3MXIA 3OTOK 4GV3A 3IKMA 4WQ5C 1FKOA 4C8OA 3G4SN 4CJSA 1SL1A 3P39A 2FC0A 3CCLN 4F3TA 4DTRA 2Z1JA 4OGEA 1IBMK 2P9PA 4B9LA 4DSIA 5EVZA 3TR8A 3K5LA 5LY3A 1YVNA 4R79A 1U2VB 2D1KA 3CC4N 4AHSA 2GEMA 4K0KK 4A62A 2E5LK 3VGMA 2NRVA 3VTIA 2VG6A 2O8DA 3OHRA 3VQAA 4HVJA 4DSEA 2GWJA 2ITMA 4LF8K 3AVIA 2YHYA 2NRTA 5C0YA 2G8UA 1NJIO 5AQLA 1T8EA 4CW7B 4I6MA 4K41A 3P31A 5GAHP 4DR4K 1YIJN 3O08A 3HBTA 1HR0K 1HMVA 1BI4A 4IJNA 4NYNA 1BIZA 3AGKA 3GBTA 2P5OA 3RSEA 5FPDA 4KHUA 4NB4A 4WFAL 4DR1K 1N5YA 5E84A 4Y0WA 3MWPA 4CGHA 4BDYA 3CF5L 3EZWA 2ZGZA 3BDPA 3DXKB 3JS6A 4YNQA 3D0PA 3CHWA 1VSMA 3VQQA 4FVMA 3ASMA 3O4QA 2UXDK 3TAPA 4JHDA 1HJOA 2O8EB 1ILYA 3RR7A 4UQGA 4FJMA 4ILHA 3PO4A 4Z4EA 2E2PA 2CGLA 3OYNA 2HSTA 4JK7A 5JLHA 3VGKA 1TKXA 2P9KB 4EZ9A 1T7PA 3ZT3A 4ELTA 1NGHA 1J54A 1XHZA 1GLLO 3M8QA 2Q2RA 3CQ8A 2HOEA 4DV7K 4FZYA 4CJEA 4JKCA 2RHKA 1UWBA 2GWKA 2JWLA 4C1NK 3D2FB 4M3ZA 2W6KA 4Z4FA 4IG0A 3CCMN 4BRLA 4CHNA 1MU2A 3IRXA 5JVGL 3HP9A 4OX9K 4Z94A 1HKGA 4E19A 1WAJA 3RRHA 1VQ4N 4PWDA 4WYBA 5GADP 4FXDA 3EKUA 5M1OA 4JN4A 4BDZA 2HHQA 1EETA 3QFPA 4IOAL 3VF6A 3CIPA 1NGJA 5A2QO 2J4RA 4C8MA 5M1QA 2A5XA 3H08A 1D4XA 3OBWA 5GIPA 3R1XA 5M1NA 1B9DA 3VETA 4BRHA 3SUOA 5AQOA 4W5NA 3ZT1A 4BR7A 4E7IA 2X6NA 2D0AA 3TTDA 2W6LA 5M1KA 3CCUN 4FWNA 4KI6A 4H4OA 3TSQA 3BF1A 1QQMA 4BC2A 1TKZA 4BGAA 1ATSA 1NK7A 3HRGA 1I39A 1BCOA 4EP4A 3VQCA 2I5JA 2ZGYA 3OYEA 3K9JA 1VSLA 3G25A 1WSFA 4CJ3A 3TSUA 5BR9A 4PKIA 4OO1J 2P9IB 2IIRA 3L2WA 4FYDA 4C1NI 3DJCA 1RBRA 4FWQA 4BACA 3M1FA 1S1WA 2EWSA 2ITGA 3SPZA 4KREA 4FM2A 2JLEA 1G99A 1UA0A 5C2DA 2OTLN 3VPZA 4FJ7A 2D4WA 1S6QA 1WN7A 3LANA 2OPQA 3EL2A 3C7NB 3HPOA 2XY6A 4DQQA 4ZTFA 1JLQA 3OYCA 1WUAA 1NK9A 3J81O 1E4FT 1JLBA 1S1XA 3PO5A 1NWKA 3CJBA 4BRKA 3E01A 2HBJA 3NCIA 4ZHRA 4LF4K 2VCPA 4Y1CA 5SZTA 4CJLA 3C0BA 5BRHA 1RT4A 3OVNA 3IDHA 1KLNA 4OVLA 2ZD1A 5TKWA 1L3VA 4IG3A 4YOVA 4O0JA 4FWSA 2EHGA 1CZAN 1VSHA 4LH4A 1S72N 2CH6A 3FZFA 3ATUA 4FCYA 3ZSZA 5DMRA 4R5PA 4HUEA 1I94K 3VF4A 4JLHA 3LDPA 2ZJRL 5HBMA 4CFDA 2P5GA 3D6RA 4DLEA 1OH5A 4Z4GA 2ASPA 3DRPA 4FLVA 3VQ8A 4JI4K 4FPBA 5GAGP 4M42A 4DV0K 1C0GA 1NK4A 4CHYA 4IDKA 1P90A 1BQMA 5C42A 2F4VK 1XHXA 4CF0A 4I2PA 1I3AA 3F9MA 1OKJA 2D0BA 1LW0A 2GX9A 4O8KA 3IUCA 4JKGA 2Z1GA 3KZBA 1JCGA 3S3MA 3U8XA 1HX1A 4FJNA 3AVMA 2KKZA 2HNZA 4CEBA 1UOCA 1U04A 1GLFO 2Q31A 1CZ9A 1Z6RA 3FGUA 1NMDA 5CHIA 4JI3K 1NGEA 1T05A 4LF5K 2ZF5O 3EN9A 5BRFA 1EWQA 3T3FA 2IS3A 3CM6A 4WCEL 2UXCK 1BDGA 1A5VA 5LJVA 2KZZA 4XH5A 1FXXA 2O8CB 1VSKA 3O8MA 1IG9A 4CK3A 3DLHA 3EY1A 3NF7A 1P8ZA 4DUYK 3AA2A 4CJFA 5BPLA 1WAFA 4CBUA 5KRSA 3CG7A 3T7ZA 2E8AA 3ZSRA 3CERA 1KVAA 1NOZA 1VRTA 1CLQA 3WQTA 4CZGA 2BH1A 3M3ZA 5LJWA 3G10A 3QFUA 4BE2A 1BQNA 5KPRA 2P9UA 4GVEA 2Q0UA 2GBZA 1HUXA 3S3NA 4DTSA 4BR9A 3I55N 3ULEB 1VSFA 2FBXA 4M7YA 4B9TA 3LZJA 4FOEA 5GIOA 1Z25A 3CCQN 3HJFA 3S9HA 1QQCA 3MN6A 3SYZA 1HNXK 3C65A 2ATQA 4CIGA 3TABA 2F9TA 4NLCA 4A5BA 2P9LB 1VQPN 3QDKA 3W0LA 3O3GA 4H5TA 4F8RA 2PZSA 4GY2B 4JKDA 3I0RA 3CFRA 4CZHA 5I42A 2P9NB 1NU0A 1KXPA 3EO3A 3CQXA 2V51B 1FJGK 3G71N 3H3NO 2OPRA 2KZMA 5AQXA 4FW1A 3CCSN 3BY5A 3DYAA 1YTAA 3OYAA 1J5EK 1K8KB 4CEEA 1IKWA 2Z1IA 3JYTA 4Z4IA 4B1VA 1X9SA 2YX6A 3K0SA 1DTTA 2DTUA 3THWA 3VEWA 1Q86O 1E3MA 1X9JA 2BE2A 3LWMA 1BISA 4B1UB 4IKFA 1WLJA 3E9PA 2LSNA 3NF8A 3WQUA 3BZKA 1NGIA 3CMEN 2QKBA 4C23A 5DM6L 1N34K 4ELUA 5F0XA 3L0QA 4DTOA 4N56A 4PA1A 4XIUA 3RWUA 1QVFM 3HOSA 3ZSYA 2R7YA 2RKIA 1WBBA 4CEFA 3OS1A 3VQ4A 4CJ7A 2P9SA 1RBVA 3SAGA 4AM7A 4YDUC 4Q0BA 1D9DA 3AVLA 2KLAA 3OYDA 3HXMA 3BGRA 4FJ5A 4RW8A 2BDPA 3L2UA 4W5QA 3ZLJA 2O8BA 1GLEG 4Z0UA 3AA5X 1M1KO 4BREA 4JEPA 4YOXA 2RF2A 1XNRK 4BROA 1Q8IA 1RCHA 4Y1DA 5AZIB 3TU5A 2WTUA 3PX4A 4CBXA 2GUIA 1JJ2M 3WXJA 4JNEA 3OYLA 3SPYA 4FOIA 4IBNA 3WXIA 1ASVA 4PQUA 1NK8A 2RE2A 4CBWA 1HPZA 3AVKA 4KH5A 3QO9A 3ENOA 3TARA 2HHWA 3W3DA 3CCVN 3KK1A 2YHXA 2XY5A 4DUZK 4AHRA 3K58A 5AQGA 4KPYA 3AA4A 3I0SA 4BC4A 2FF6A 1RGIA 3L6QA 3VQ7A 1QS4A 5T7BA 4LSLA 3O3HA 5EXWA 1DLOA 2O8FB 3ZSVA 4CFAA 1MDUB 3AAQA 3UKRB 4CJPA 4LF7K 3ENBA 2YNGA 1X1PA 4KH6A 2ETJA 4JKHA 3PIOL 1LWEA 3C6HA 4QAGA 1JLAA 4FZZA 4ISEA 5KRTA 4GKJK 3SQ2A 2BGGA 4F4KA 3C95A 1GOCA 2YKMA 3CPEA 4IXCA 4JS5A 5BRDA 3FZMA 4EAHD 3NGIA 4H0OA 4FJ9A 2QTDA 2QK9A 3MXJA 2DFEA 5F1XA 3F2KA 2XO7A 3KK3A 4DV6K 1Q9YA 2YNFA 1KFSA 1ITGA 4H5VA 5KQDA 3CJCA 1FKPA 1WSGA 1QSSA 3SAHA 4JI7K 1YUWA 5AR0A 3E9OA 4RW4A 2YHBA 4DTJA 3SV4A 4FWMA 1Z26A 1NNEA 4KHQA 1HNZK 3OS2A 2BUPA 1KFDA 4I7FA 3QMLA 3Q7BA 1ZYQA 2G8HA 3KTQA 4CI6A 4JS4A 2O4IA 1TAUA 3NGZA 3TANA 4FWKA 3L2QA 5I9EB 4UY8O 5BN8A 3EZ5A 1HYVA 2D5RA 3UE5A 3THXA 4DU1A 4XH1A 4BVOA 3JAMO 4HWIA 4JYAK 4FM0A 4M3TA 3J7AP 1NGBA 5TKYA 3V9SA 3LDQA 3F73A 4H0PA 3MK6A 1DTQA 1O1WA 4H0TB 2QI2A 4NCBA 1XMQK 3NH0A 3BEXA 1G15A 1L5UA 1RDUA 4ZTJA 4B1ZA 4QS7A 4CGJA 4CZJA 1V4TA 1DEJA 4F2SA 5AQIA 2IVOA 3C6UA 4JKEA 4JI6K 1NK5A 4CF8A 3MMVA 5SWMA 5JS1A 4KBOA 1U2VA 4WQ4C 2A41A 3KK2A 1RDBA 3EE9A 4JI2K 3UB5A 4BGBA 3AVCA 1U49A 4A61A 3FR0A 3WNHA 3D2EB 4F3OA 4C8LA 4EIAA 2Y1IA 4BWJA 3SQ1A 1WNSA 4E3SA 5HRRA 1QVGM 1GLAG 1T3VA 4YOWA 1IKVA 4OJRA 1WOQA 3MEGA 3KHYA 4I6MB 5AQJA 4CGFA 2GV9A 3O9QA 2A40A 5C25A 2Q3SA 4JK9A 4FJXA 3VEYA 1Q7YO 4EZ6A 4IEIA 3NAEA
chains in the Genus database with same CATH topology
1TK8A 1RTHA 3JSMA 3VQ5A 1UA0A 4E7JA 4CECA 4FJ7A 2G8IA 1S6QA 1WN7A 3LANA 5HLFA 3IAYA 3KD5E 2OPQA 3RMAA 5J2MA 2VG5A 4FM1A 3D45A 4OKJA 4W5OA 1RT1A 3V81A 3ZSWA 3HPOA 3M8RA 1Y97A 2XY6A 2W42A 4DQQA 4ZTFA 1JLQA 1HNIA 4O44A 3NH2A 3OYCA 4DSLA 3V9ZA 1NK9A 4DTXA 4KHYA 3U6FA 3KD1E 4FK4A 2VWJA 3KLIA 1JLBA 1S1XA 3PO5A 3AVBA 2KTQA 1HQUA 3E01A 3K5NA 3HM9A 1NK6A 1D9FA 3NCIA 4C8NA 4ZHRA 4JRPA 5KI6A 4OGCA 4KHNA 1D5AA 4Y1CA 3AO3A 1IH7A 5SZTA 3ZT2A 1QSYA 4CJLA 1RT7A 1S5JA 3KLHA 4J2EA 2D0CA 1RT4A 4HTUA 3V9WA 4OLAA 1BHLA 3OVNA 1NOYA 3WNFA 4KTWA 2YNHA 2HHUA 3ZCMA 1KLNA 4OVLA 1A5XA 2ZD1A 1L3VA 4KHSA 3KLGA 4IG3A 4AHCA 4DQSA 1KRPA 4O0JA 2PYJA 3WNEA 2EHGA 3HK2A 1TL1A 1EP4A 3IS9A 4J2BA 1VK0A 1VSHA 4AHVA 3V1QA 1U48A 4FZXC 3L2VA 2EX3A 4LH4A 2HNYA 3MAQA 3OYFA 3LALA 3QEVA 4DS5A 4CHOA 2WOMA 4M45A 4FJKA 4FCYA 3ZSZA 5DMRA 4R5PA 3HT3A 4B3OA 4HUEA 3PUFA 3SQ0A 4JLHA 3OS0A 1HYZA 3HVTA 3QNNA 3KKRA 5HBMA 3CFOA 1C0MA 4CFDA 5HRPA 4PUOA 2P5GA 4DLEA 4Z4GA 3EYZA 4DF4A 3DRPA 3SUNA 2WONA 4BWMA 4CJKA 4DFKA 4FLVA 4O5BA 3VQ8A 1S1VA 3OYGA 3S3OA 4M42A 3NH1A 1LV5A 4K8ZA 1BIUA 3ALYA 1NK4A 4DF8A 1RILA 2IAJA 4CHYA 4DFJA 4IDKA 1U4BA 1SKSA 1CZBA 1BQMA 4Z4HA 5C42A 3DLRA 1XHXA 4CF0A 4I2PA 5E41A 3QIPA 1TAQA 4ELVA 4DSFA 3UIQA 1B92A 1I3AA 2ZQBA 3LWLA 2D0BA 1LW0A 5KGWA 2OYQA 2HHSA 3L3UA 3TAMA 2Z1GA 3K59A 4E7HA 5C24A 4B08A 5HROA 4M3XA 3S3MA 1RT2A 5I3UA 1SL2A 1VSDA 4BDPA 3OJUA 1R0AA 4FJNA 3AVMA 4OLBA 4KRFA 3K57A 2HNZA 4N5SA 4CEBA 1VSIA 1KCFA 1J53A 1UOCA 4KO0A 3ZSQA 1U04A 1JLFA 1S1UA 3V4IA 3VA0A 1CZ9A 3OYMA 4JRQA 4CHQA 3NBPA 3PX6A 3AO2A 5D3GA 3HO1A 2KFNA 3TAGA 2XY7A 4CF9A 5J2QA 1T05A 1L3TA 4KTZA 4CEAA 2VG7A 3T3FA 2IS3A 3CM6A 3SJJA 4FLUA 1A5VA 4MFBA 4AHTA 4O0IA 2YV0X 2KZZA 3AVGA 1FXXA 4CHZA 1VSKA 4AHUA 4LSNA 2OPSA 3C94A 1IG9A 4CK3A 3DLHA 3P5JA 4RG8A 3EY1A 3NF7A 2F8TA 2FBVA 3ZSOA 3A2FA 3AA2A 4CJFA 4CJRA 2XHBA 4DQPA 1HYSA 1WAFA 5KRSA 3LPUA 1RBTA 3CG7A 1WSHA 1KLMA 3ZSRA 1KVAA 4CIFA 1NKEA 1GOAA 1NOZA 1TV6A 1VRTA 2IDOA 2OPPA 3HYFA 4KKOA 4FLYA 1NKCA 1CLQA 3ITHA 3DRRA 1QHTA 2E4LA 4K8XA 1LW2A 3ISNC 3G10A 4CCHA 4BE2A 3F9KA 1BQNA 5J2NA 1U45A 3QETA 3AO4A 2AJQA 1EKEA 1JLGA 4FW2A 3QNOA 2HVIA 4B8AB 4QOZB 3LDSA 1RTIA 3LP1A 2GBZA 3V1OA 3K5MA 3S3NA 1QSLA 4DTSA 1ASUA 1BI4B 3MXMA 4KB0A 2QXFA 3SUPA 1VSFA 2FBXA 1NJZA 4B9TA 1CXQA 1RDCA 3LZJA 1Z25A 5JS2A 4OKEA 1C0TA 2RPIA 3MECA 1S9GA 3VQ6A 4CJWA 4E1NA 1Q9XA 2G8VA 5FRMA 3HJFA 3S9HA 3K5OA 1JXBA 1ASWA 1QQCA 3L8BA 4E7KA 4DTMA 2NUBA 3NHGA 3SYZA 4OPKA 1RNHA 2ATQA 4N47A 4CIGA 3TABA 3KLEA 4HUGA 3ZT0A 4CESA 1TK0A 3TI0A 3O3GA 4CGDA 3U3GA 2JGUA 1L3UA 4DWIA 4B9NA 4F8RA 4B8CA 4CF2A 3TAEA 2PZSA 3RR8A 3AVHA 3CFPA 3I0RA 3CFRA 3OY9A 5I42A 1VSJA 5CYQA 2FBYA 2B6AA 5CY4A 1U47A 3FFIA 3RMDA 4H4MA 3VQDA 3SCXA 2G8FA 4I2QA 2P1JA 2OPRA 2P51A 1JL1A 3AA3A 4FW1A 4RW9A 2KZMA 1VRUA 4EP5A 4GMJB 3DYAA 4B9MA 3SUQA 4DSKA 1YTAA 1ZBFA 4W5TA 3OYAA 4GW6A 3OJSA 1BL3A 4ID5A 4CEEA 1IKWA 3ZT4A 2F96A 2Z1IA 3JYTA 3B6OA 4Z4IA 4N76A 1X9SA 4TSXA 1TGOA 1DTTA 2DFHA 4ID1A 2DTUA 1LAVA 4E7LA 2DFFA 1YTUA 4C8KA 4WE1A 2BE2A 2E6MA 3LWMA 1BISA 1C1CA 3LAMA 1YVUA 3TWHA 2OA8A 4I9QA 2HHTA 3AVJA 4DS4A 4IKFA 4DU3A 3NE6A 1SUQA 1WLJA 1XC9A 1RT5A 3O4NA 4FJIA 2LSNA 3NF8A 3V9XA 4CJ4A 2A1SA 4NYFA 4FLWA 3QINA 3KLFA 1J5OA 4FJJA 2QKBA 4FJHA 3VQEA 3LZIA 4ELUA 4HCBA 1L3SA 4EZ6A 2XY8A 2B5JA 1HJRA 1SKWA 1JL2A 1SL0A 2KFZA 2XRIA 4DTOA 4FJ8A 1S1TA 3MEDA 5HRSA 2X78A 3RTVA 4N56A 4H8KA 1HNVA 4PA1A 1ZBLA 4XIUA 1HRHA 4KTQA 3RWUA 3AO1A 3DRSA 5CZ1A 2O4GA 1RT6A 4YFUA 2IOCA 4W5RA 3SQ4A 3ZSYA 4L8RB 4CE9A 4KHWA 2R7YA 1X9MA 1TKDA 4N41A 1HQEA 2RKIA 2Z1HA 1KSPA 3P1GA 3QESA 2OZMA 4E1MA 3MEEA 4CEFA 1C6VA 1WSJA 4KFBA 3OS1A 2HW3A 3VQ4A 2PYLA 4IFVA 3NDKA 3HP6A 1RBVA 4QCLA 3AVFA 5KTQA 4LY7A 3OYBA 3MXIA 1NKBA 1D9DA 2F8SA 2VWKA 4Q0BA 3AVLA 4DTUA 3OYDA 2IGIA 1FKOA 3HXMA 4C8OA 3BGRA 1S6PA 4O4GA 4FJ5A 4NCAA 4RW8A 3TAQA 2BDPA 4CJSA 4CK2A 4W5QA 3L2UA 3THVA 4O55A 2FC0A 4DFMA 1SL1A 4F3TA 4DTRA 4FK0A 2B4JA 2YNIA 2Z1JA 3AA5X 4OGEA 4Z0UA 4B9LA 4DSIA 3TR8A 3QLHA 3K5LA 3TAFA 2RF2A 4CEQA 3DLEA 3O3FA 1Q8IA 4OKKA 1RCHA 4Y1DA 4CJVA 3ULDA 4FLZA 1T03A 4DQIA 4ICLA 2Y1JA 4LD0A 4AHSA 3PX4A 2E6LA 2GUIA 2HHXA 1WSIA 3OYLA 3LP0A 4PY5A 2VG6A 3SPYA 4HCCA 3VQAA 2DY4A 1CXUA 3LPTA 4IBNA 4IFYA 4HVJA 5CYMA 4DTPA 4DSEA 3B6PA 2G8WA 1ASVA 4PQUA 4CGIA 3AV9A 4DMNA 2HHVA 3AVIA 1NK8A 2HVHA 2G8UA 1QE1A 3NAEA 4M3WA 3P83D 3KJVA 1HPZA 3AVKA 2ZE2A 1T8EA 1C1BA 3QO9A 1ZBIA 3TARA 5J2PA 3SI6A 3KIOA 3SV3A 1JLCA 3AVNA 2FBTA 3K2PA 4M41A 3KK1A 4HHTA 2XY5A 4F2RA 3OYHA 4AHRA 3OYKA 4HUFA 4CFCA 3K58A 3SNNA 1SV5A 4CFBA 4KPYA 1LWFA 3AA4A 1IKXA 3I0SA 1HMVA 1BI4A 3NGYA 4AH9A 3QERA 4NYNA 4M3YA 1BIZA 3T1AA 4OPJA 1NK0A 1KTQA 3VQ7A 3M8PA 4Q5VA 2P5OA 4KHUA 1QS4A 5EU7A 5T7BA 1N5YA 4DSJA 4LSLA 3O3HA 3OYIA 2IC3A 1QTMA 1DLOA 3ZSVA 1JLEA 5FROA 3QEIA 4CFAA 3DLKA 1RBSA 4CGHA 4BDYA 1KVBA 5HP1A 4DG1A 4CF1A 3VA3A 4CJPA 3DLBA 3QEPA 2YNGA 1X1PA 2ETJA 3BDPA 4FK2A 3D0PA 4YNQA 1EX4A 1LWEA 4E0DA 1VSMA 4QAGA 1TL3A 4BE1A 4CEZA 3NF6A 4DTNA 4CEDA 1JLAA 3IG1A 3VQQA 1RTDA 2BANA 4FZZA 4B9VA 4FVMA 5KGXA 3ASMA 4MQ3A 4CIEA 3O4QA 4KV8A 3DI6A 3G0ZA 5KRTA 3SQ2A 3TAPA 1BCMA 2BGGA 4F4KA 3C95A 2HMIA 3M8SA 1GOCA 2YKMA 1UAXA 4JS5A 3RR7A 3AVAA 4UQGA 4FJMA 3NGIA 1X9WA 3PO4A 4Z4EA 1ZBHA 4FJ9A 3HPHA 1J9AA 3OYNA 1GOBA 4RW6A 3PX0A 4J2DA 3I8DA 3MXJA 2DFEA 3VQPA 1W9HA 5FDLA 2QK9A 4KB1A 2XO7A 3DLGA 3KK3A 1TKXA 1Q9YA 4EZ9A 4M3UA 1IO2A 1T7PA 2YNFA 3CM5A 1KFSA 3ZT3A 4ELTA 1J54A 4E89A 1WSEA 1VSEA 4G1QA 1ITGA 3HVRA 1XHZA 1TK5A 1FKPA 1WSGA 3M8QA 1QSSA 4B9SA 1LAWA 1RBUA 3CQ8A 5CZ2A 4RW4A 2KQ2A 4CJEA 2YHBA 4DFPA 1RT3A 2PY5A 4FZYA 4DTJA 3SV4A 1UWBA 2HHWA 5HRNA 1Z26A 3PV8A 4FJLA 4KHQA 4M3ZA 4Z4FA 4IG0A 3OS2A 1UA1A 1KFDA 3NF9A 1C1AA 2X74A 1SKRA 4I7FA 4CJ5A 1ZYQA 4CHNA 2G8HA 1RDDA 3RMCA 1MU2A 3IRXA 1FK9A 2G8KA 3HP9A 3KTQA 4FLTA 4JS4A 2O4IA 4CK1A 3L3VA 3NGZA 1TAUA 3TANA 3LAKA 3V9UA 3L2QA 4E19A 4DQRA 3EZ5A 1WAJA 3LP2A 1EXQA 3NFAA 1HYVA 4I9LA 2D5RA 3RRHA 2OZSA 1IKYA 3DOLA 4DU1A 4BE0A 4PWDA 1W0HA 4FM0A 1YT3A 1A5WA 1XI1A 1D8YA 4M3TA 1RDAA 3V1RA 1K6YA 1REVA 2YKNA 4LH5A 3KKSA 4FXDA 3QIOA 3V9SA 4CGGA 3F73A 4RW7A 3HPGA 4BDZA 1B9FA 2HHQA 1DTQA 1XWLA 3DM2A 1EETA 3C6TA 1O1WA 3DOKA 4AILC 2A1RA 1S9EA 4NCBA 3NH0A 1G15A 1L5UA 1NJWA 2RN2A 1TKTA 4KAZA 4NCGA 4C8MA 3QEWA 3H08A 3ZSXA 5K14A 4ZTJA 3SZ2A 2HB5A 2X6SA 4CGJA 1B9DA 3RRGA 1RTJA 1KVCA 4F2SA 4Z4CA 3OYJA 3SUOA 3VN5A 4W5NA 3ZT1A 3L2RA 5J1EA 4CHPA 1NJYA 2QKKA 3C6UA 4E7IA 2X6NA 3HL8A 1NK5A 4CF8A 5SWMA 5JS1A 2D0AA 1N6QA 4CJUA 1TVRA 4CERA 4B9UA 1LWCA 3KK2A 3AO5A 4H4OA 1C0UA 1RDBA 4FJGA 4KI6A 3V6DA 3U3YA 4DLGA 3AVCA 1U49A 1TKZA 3WNHA 1NK7A 1I39A 3VQ9A 1F21A 3QEXA 3RMBA 4C8LA 2Y1IA 4F3OA 1BCOA 4EP4A 4FLXA 4BWJA 3VQBA 3VQCA 1JKHA 2I5JA 1ZBUA 3OYEA 1WNSA 3SQ1A 3PY8A 4E3SA 1VSLA 4DU4A 1WSFA 4CJ3A 5HRRA 1BGXT 3HSTB 3L2WA 4FYDA 1JXEA 4J2AA 3WNGA 1RBRA 4BACA 3DMJA 2YHAA 1S1WA 4CEOA 1IKVA 2KW4A 4OJRA 1NJXA 4KI4A 3MEGA 4CGFA 2ITGA 3LP3A 2GV9A 5DK5A 3CYMA 4GVMA 3SPZA 4KREA 5C25A 2Q3SA 4CJTA 4FJXA 5FRNA 4CJQA 4M3RA 4FM2A 2HNDA 2JLEA 3T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK8 A;  1RTH A;  3JSM A;  3VQ5 A;  1UA0 A;  4E7J A;  4CEC A;  4FJ7 A;  2G8I A;  1S6Q A;  1WN7 A;  3LAN A;  5HLF A;  3IAY A;  3KD5 E;  2OPQ A;  3RMA A;  5J2M A;  2VG5 A;  4FM1 A;  3D45 A;  4OKJ A;  4W5O A;  1RT1 A;  3V81 A;  3ZSW A;  3HPO A;  3M8R A;  1Y97 A;  2XY6 A;  2W42 A;  4DQQ A;  4ZTF A;  1JLQ A;  1HNI A;  4O44 A;  3NH2 A;  3OYC A;  4DSL A;  3V9Z A;  1NK9 A;  4DTX A;  4KHY A;  3U6F A;  3KD1 E;  4FK4 A;  2VWJ A;  3KLI A;  1JLB A;  1S1X A;  3PO5 A;  3AVB A;  2KTQ A;  1HQU A;  3E01 A;  3K5N A;  3HM9 A;  1NK6 A;  1D9F A;  3NCI A;  4C8N A;  4ZHR A;  4JRP A;  5KI6 A;  4OGC A;  4KHN A;  1D5A A;  4Y1C A;  3AO3 A;  1IH7 A;  5SZT A;  3ZT2 A;  1QSY A;  4CJL A;  1RT7 A;  1S5J A;  3KLH A;  4J2E A;  2D0C A;  1RT4 A;  4HTU A;  3V9W A;  4OLA A;  1BHL A;  3OVN A;  1NOY A;  3WNF A;  4KTW A;  2YNH A;  2HHU A;  3ZCM A;  1KLN A;  4OVL A;  1A5X A;  2ZD1 A;  1L3V A;  4KHS A;  3KLG A;  4IG3 A;  4AHC A;  4DQS A;  1KRP A;  4O0J A;  2PYJ A;  3WNE A;  2EHG A;  3HK2 A;  1TL1 A;  1EP4 A;  3IS9 A;  4J2B A;  1VK0 A;  1VSH A;  4AHV A;  3V1Q A;  1U48 A;  4FZX C;  3L2V A;  2EX3 A;  4LH4 A;  2HNY A;  3MAQ A;  3OYF A;  3LAL A;  3QEV A;  4DS5 A;  4CHO A;  2WOM A;  4M45 A;  4FJK A;  4FCY A;  3ZSZ A;  5DMR A;  4R5P A;  3HT3 A;  4B3O A;  4HUE A;  3PUF A;  3SQ0 A;  4JLH A;  3OS0 A;  1HYZ A;  3HVT A;  3QNN A;  3KKR A;  5HBM A;  3CFO A;  1C0M A;  4CFD A;  5HRP A;  4PUO A;  2P5G A;  4DLE A;  4Z4G A;  3EYZ A;  4DF4 A;  3DRP A;  3SUN A;  2WON A;  4BWM A;  4CJK A;  4DFK A;  4FLV A;  4O5B A;  3VQ8 A;  1S1V A;  3OYG A;  3S3O A;  4M42 A;  3NH1 A;  1LV5 A;  4K8Z A;  1BIU A;  3ALY A;  1NK4 A;  4DF8 A;  1RIL A;  2IAJ A;  4CHY A;  4DFJ A;  4IDK A;  1U4B A;  1SKS A;  1CZB A;  1BQM A;  4Z4H A;  5C42 A;  3DLR A;  1XHX A;  4CF0 A;  4I2P A;  5E41 A;  3QIP A;  1TAQ A;  4ELV A;  4DSF A;  3UIQ A;  1B92 A;  1I3A A;  2ZQB A;  3LWL A;  2D0B A;  1LW0 A;  5KGW A;  2OYQ A;  2HHS A;  3L3U A;  3TAM A;  2Z1G A;  3K59 A;  4E7H A;  5C24 A;  4B08 A;  5HRO A;  4M3X A;  3S3M A;  1RT2 A;  5I3U A;  1SL2 A;  1VSD A;  4BDP A;  3OJU A;  1R0A A;  4FJN A;  3AVM A;  4OLB A;  4KRF A;  3K57 A;  2HNZ A;  4N5S A;  4CEB A;  1VSI A;  1KCF A;  1J53 A;  1UOC A;  4KO0 A;  3ZSQ A;  1U04 A;  1JLF A;  1S1U A;  3V4I A;  3VA0 A;  1CZ9 A;  3OYM A;  4JRQ A;  4CHQ A;  3NBP A;  3PX6 A;  3AO2 A;  5D3G A;  3HO1 A;  2KFN A;  3TAG A;  2XY7 A;  4CF9 A;  5J2Q A;  1T05 A;  1L3T A;  4KTZ A;  4CEA A;  2VG7 A;  3T3F A;  2IS3 A;  3CM6 A;  3SJJ A;  4FLU A;  1A5V A;  4MFB A;  4AHT A;  4O0I A;  2YV0 X;  2KZZ A;  3AVG A;  1FXX A;  4CHZ A;  1VSK A;  4AHU A;  4LSN A;  2OPS A;  3C94 A;  1IG9 A;  4CK3 A;  3DLH A;  3P5J A;  4RG8 A;  3EY1 A;  3NF7 A;  2F8T A;  2FBV A;  3ZSO A;  3A2F A;  3AA2 A;  4CJF A;  4CJR A;  2XHB A;  4DQP A;  1HYS A;  1WAF A;  5KRS A;  3LPU A;  1RBT A;  3CG7 A;  1WSH A;  1KLM A;  3ZSR A;  1KVA A;  4CIF A;  1NKE A;  1GOA A;  1NOZ A;  1TV6 A;  1VRT A;  2IDO A;  2OPP A;  3HYF A;  4KKO A;  4FLY A;  1NKC A;  1CLQ A;  3ITH A;  3DRR A;  1QHT A;  2E4L A;  4K8X A;  1LW2 A;  3ISN C;  3G10 A;  4CCH A;  4BE2 A;  3F9K A;  1BQN A;  5J2N A;  1U45 A;  3QET A;  3AO4 A;  2AJQ A;  1EKE A;  1JLG A;  4FW2 A;  3QNO A;  2HVI A;  4B8A B;  4QOZ B;  3LDS A;  1RTI A;  3LP1 A;  2GBZ A;  3V1O A;  3K5M A;  3S3N A;  1QSL A;  4DTS A;  1ASU A;  1BI4 B;  3MXM A;  4KB0 A;  2QXF A;  3SUP A;  1VSF A;  2FBX A;  1NJZ A;  4B9T A;  1CXQ A;  1RDC A;  3LZJ A;  1Z25 A;  5JS2 A;  4OKE A;  1C0T A;  2RPI A;  3MEC A;  1S9G A;  3VQ6 A;  4CJW A;  4E1N A;  1Q9X A;  2G8V A;  5FRM A;  3HJF A;  3S9H A;  3K5O A;  1JXB A;  1ASW A;  1QQC A;  3L8B A;  4E7K A;  4DTM A;  2NUB A;  3NHG A;  3SYZ A;  4OPK A;  1RNH A;  2ATQ A;  4N47 A;  4CIG A;  3TAB A;  3KLE A;  4HUG A;  3ZT0 A;  4CES A;  1TK0 A;  3TI0 A;  3O3G A;  4CGD A;  3U3G A;  2JGU A;  1L3U A;  4DWI A;  4B9N A;  4F8R A;  4B8C A;  4CF2 A;  3TAE A;  2PZS A;  3RR8 A;  3AVH A;  3CFP A;  3I0R A;  3CFR A;  3OY9 A;  5I42 A;  1VSJ A;  5CYQ A;  2FBY A;  2B6A A;  5CY4 A;  1U47 A;  3FFI A;  3RMD A;  4H4M A;  3VQD A;  3SCX A;  2G8F A;  4I2Q A;  2P1J A;  2OPR A;  2P51 A;  1JL1 A;  3AA3 A;  4FW1 A;  4RW9 A;  2KZM A;  1VRU A;  4EP5 A;  4GMJ B;  3DYA A;  4B9M A;  3SUQ A;  4DSK A;  1YTA A;  1ZBF A;  4W5T A;  3OYA A;  4GW6 A;  3OJS A;  1BL3 A;  4ID5 A;  4CEE A;  1IKW A;  3ZT4 A;  2F96 A;  2Z1I A;  3JYT A;  3B6O A;  4Z4I A;  4N76 A;  1X9S A;  4TSX A;  1TGO A;  1DTT A;  2DFH A;  4ID1 A;  2DTU A;  1LAV A;  4E7L A;  2DFF A;  1YTU A;  4C8K A;  4WE1 A;  2BE2 A;  2E6M A;  3LWM A;  1BIS A;  1C1C A;  3LAM A;  1YVU A;  3TWH A;  2OA8 A;  4I9Q A;  2HHT A;  3AVJ A;  4DS4 A;  4IKF A;  4DU3 A;  3NE6 A;  1SUQ A;  1WLJ A;  1XC9 A;  1RT5 A;  3O4N A;  4FJI A;  2LSN A;  3NF8 A;  3V9X A;  4CJ4 A;  2A1S A;  4NYF A;  4FLW A;  3QIN A;  3KLF A;  1J5O A;  4FJJ A;  2QKB A;  4FJH A;  3VQE A;  3LZI A;  4ELU A;  4HCB A;  1L3S A;  4EZ6 A;  2XY8 A;  2B5J A;  1HJR A;  1SKW A;  1JL2 A;  1SL0 A;  2KFZ A;  2XRI A;  4DTO A;  4FJ8 A;  1S1T A;  3MED A;  5HRS A;  2X78 A;  3RTV A;  4N56 A;  4H8K A;  1HNV A;  4PA1 A;  1ZBL A;  4XIU A;  1HRH A;  4KTQ A;  3RWU A;  3AO1 A;  3DRS A;  5CZ1 A;  2O4G A;  1RT6 A;  4YFU A;  2IOC A;  4W5R A;  3SQ4 A;  3ZSY A;  4L8R B;  4CE9 A;  4KHW A;  2R7Y A;  1X9M A;  1TKD A;  4N41 A;  1HQE A;  2RKI A;  2Z1H A;  1KSP A;  3P1G A;  3QES A;  2OZM A;  4E1M A;  3MEE A;  4CEF A;  1C6V A;  1WSJ A;  4KFB A;  3OS1 A;  2HW3 A;  3VQ4 A;  2PYL A;  4IFV A;  3NDK A;  3HP6 A;  1RBV A;  4QCL A;  3AVF A;  5KTQ A;  4LY7 A;  3OYB A;  3MXI A;  1NKB A;  1D9D A;  2F8S A;  2VWK A;  4Q0B A;  3AVL A;  4DTU A;  3OYD A;  2IGI A;  1FKO A;  3HXM A;  4C8O A;  3BGR A;  1S6P A;  4O4G A;  4FJ5 A;  4NCA A;  4RW8 A;  3TAQ A;  2BDP A;  4CJS A;  4CK2 A;  4W5Q A;  3L2U A;  3THV A;  4O55 A;  2FC0 A;  4DFM A;  1SL1 A;  4F3T A;  4DTR A;  4FK0 A;  2B4J A;  2YNI A;  2Z1J A;  3AA5 X;  4OGE A;  4Z0U A;  4B9L A;  4DSI A;  3TR8 A;  3QLH A;  3K5L A;  3TAF A;  2RF2 A;  4CEQ A;  3DLE A;  3O3F A;  1Q8I A;  4OKK A;  1RCH A;  4Y1D A;  4CJV A;  3ULD A;  4FLZ A;  1T03 A;  4DQI A;  4ICL A;  2Y1J A;  4LD0 A;  4AHS A;  3PX4 A;  2E6L A;  2GUI A;  2HHX A;  1WSI A;  3OYL A;  3LP0 A;  4PY5 A;  2VG6 A;  3SPY A;  4HCC A;  3VQA A;  2DY4 A;  1CXU A;  3LPT A;  4IBN A;  4IFY A;  4HVJ A;  5CYM A;  4DTP A;  4DSE A;  3B6P A;  2G8W A;  1ASV A;  4PQU A;  4CGI A;  3AV9 A;  4DMN A;  2HHV A;  3AVI A;  1NK8 A;  2HVH A;  2G8U A;  1QE1 A;  3NAE A;  4M3W A;  3P83 D;  3KJV A;  1HPZ A;  3AVK A;  2ZE2 A;  1T8E A;  1C1B A;  3QO9 A;  1ZBI A;  3TAR A;  5J2P A;  3SI6 A;  3KIO A;  3SV3 A;  1JLC A;  3AVN A;  2FBT A;  3K2P A;  4M41 A;  3KK1 A;  4HHT A;  2XY5 A;  4F2R A;  3OYH A;  4AHR A;  3OYK A;  4HUF A;  4CFC A;  3K58 A;  3SNN A;  1SV5 A;  4CFB A;  4KPY A;  1LWF A;  3AA4 A;  1IKX A;  3I0S A;  1HMV A;  1BI4 A;  3NGY A;  4AH9 A;  3QER A;  4NYN A;  4M3Y A;  1BIZ A;  3T1A A;  4OPJ A;  1NK0 A;  1KTQ A;  3VQ7 A;  3M8P A;  4Q5V A;  2P5O A;  4KHU A;  1QS4 A;  5EU7 A;  5T7B A;  1N5Y A;  4DSJ A;  4LSL A;  3O3H A;  3OYI A;  2IC3 A;  1QTM A;  1DLO A;  3ZSV A;  1JLE A;  5FRO A;  3QEI A;  4CFA A;  3DLK A;  1RBS A;  4CGH A;  4BDY A;  1KVB A;  5HP1 A;  4DG1 A;  4CF1 A;  3VA3 A;  4CJP A;  3DLB A;  3QEP A;  2YNG A;  1X1P A;  2ETJ A;  3BDP A;  4FK2 A;  3D0P A;  4YNQ A;  1EX4 A;  1LWE A;  4E0D A;  1VSM A;  4QAG A;  1TL3 A;  4BE1 A;  4CEZ A;  3NF6 A;  4DTN A;  4CED A;  1JLA A;  3IG1 A;  3VQQ A;  1RTD A;  2BAN A;  4FZZ A;  4B9V A;  4FVM A;  5KGX A;  3ASM A;  4MQ3 A;  4CIE A;  3O4Q A;  4KV8 A;  3DI6 A;  3G0Z A;  5KRT A;  3SQ2 A;  3TAP A;  1BCM A;  2BGG A;  4F4K A;  3C95 A;  2HMI A;  3M8S A;  1GOC A;  2YKM A;  1UAX A;  4JS5 A;  3RR7 A;  3AVA A;  4UQG A;  4FJM A;  3NGI A;  1X9W A;  3PO4 A;  4Z4E A;  1ZBH A;  4FJ9 A;  3HPH A;  1J9A A;  3OYN A;  1GOB A;  4RW6 A;  3PX0 A;  4J2D A;  3I8D A;  3MXJ A;  2DFE A;  3VQP A;  1W9H A;  5FDL A;  2QK9 A;  4KB1 A;  2XO7 A;  3DLG A;  3KK3 A;  1TKX A;  1Q9Y A;  4EZ9 A;  4M3U A;  1IO2 A;  1T7P A;  2YNF A;  3CM5 A;  1KFS A;  3ZT3 A;  4ELT A;  1J54 A;  4E89 A;  1WSE A;  1VSE A;  4G1Q A;  1ITG A;  3HVR A;  1XHZ A;  1TK5 A;  1FKP A;  1WSG A;  3M8Q A;  1QSS A;  4B9S A;  1LAW A;  1RBU A;  3CQ8 A;  5CZ2 A;  4RW4 A;  2KQ2 A;  4CJE A;  2YHB A;  4DFP A;  1RT3 A;  2PY5 A;  4FZY A;  4DTJ A;  3SV4 A;  1UWB A;  2HHW A;  5HRN A;  1Z26 A;  3PV8 A;  4FJL A;  4KHQ A;  4M3Z A;  4Z4F A;  4IG0 A;  3OS2 A;  1UA1 A;  1KFD A;  3NF9 A;  1C1A A;  2X74 A;  1SKR A;  4I7F A;  4CJ5 A;  1ZYQ A;  4CHN A;  2G8H A;  1RDD A;  3RMC A;  1MU2 A;  3IRX A;  1FK9 A;  2G8K A;  3HP9 A;  3KTQ A;  4FLT A;  4JS4 A;  2O4I A;  4CK1 A;  3L3V A;  3NGZ A;  1TAU A;  3TAN A;  3LAK A;  3V9U A;  3L2Q A;  4E19 A;  4DQR A;  3EZ5 A;  1WAJ A;  3LP2 A;  1EXQ A;  3NFA A;  1HYV A;  4I9L A;  2D5R A;  3RRH A;  2OZS A;  1IKY A;  3DOL A;  4DU1 A;  4BE0 A;  4PWD A;  1W0H A;  4FM0 A;  1YT3 A;  1A5W A;  1XI1 A;  1D8Y A;  4M3T A;  1RDA A;  3V1R A;  1K6Y A;  1REV A;  2YKN A;  4LH5 A;  3KKS A;  4FXD A;  3QIO A;  3V9S A;  4CGG A;  3F73 A;  4RW7 A;  3HPG A;  4BDZ A;  1B9F A;  2HHQ A;  1DTQ A;  1XWL A;  3DM2 A;  1EET A;  3C6T A;  1O1W A;  3DOK A;  4AIL C;  2A1R A;  1S9E A;  4NCB A;  3NH0 A;  1G15 A;  1L5U A;  1NJW A;  2RN2 A;  1TKT A;  4KAZ A;  4NCG A;  4C8M A;  3QEW A;  3H08 A;  3ZSX A;  5K14 A;  4ZTJ A;  3SZ2 A;  2HB5 A;  2X6S A;  4CGJ A;  1B9D A;  3RRG A;  1RTJ A;  1KVC A;  4F2S A;  4Z4C A;  3OYJ A;  3SUO A;  3VN5 A;  4W5N A;  3ZT1 A;  3L2R A;  5J1E A;  4CHP A;  1NJY A;  2QKK A;  3C6U A;  4E7I A;  2X6N A;  3HL8 A;  1NK5 A;  4CF8 A;  5SWM A;  5JS1 A;  2D0A A;  1N6Q A;  4CJU A;  1TVR A;  4CER A;  4B9U A;  1LWC A;  3KK2 A;  3AO5 A;  4H4O A;  1C0U A;  1RDB A;  4FJG A;  4KI6 A;  3V6D A;  3U3Y A;  4DLG A;  3AVC A;  1U49 A;  1TKZ A;  3WNH A;  1NK7 A;  1I39 A;  3VQ9 A;  1F21 A;  3QEX A;  3RMB A;  4C8L A;  2Y1I A;  4F3O A;  1BCO A;  4EP4 A;  4FLX A;  4BWJ A;  3VQB A;  3VQC A;  1JKH A;  2I5J A;  1ZBU A;  3OYE A;  1WNS A;  3SQ1 A;  3PY8 A;  4E3S A;  1VSL A;  4DU4 A;  1WSF A;  4CJ3 A;  5HRR A;  1BGX T;  3HST B;  3L2W A;  4FYD A;  1JXE A;  4J2A A;  3WNG A;  1RBR A;  4BAC A;  3DMJ A;  2YHA A;  1S1W A;  4CEO A;  1IKV A;  2KW4 A;  4OJR A;  1NJX A;  4KI4 A;  3MEG A;  4CGF A;  2ITG A;  3LP3 A;  2GV9 A;  5DK5 A;  3CYM A;  4GVM A;  3SPZ A;  4KRE A;  5C25 A;  2Q3S A;  4CJT A;  4FJX A;  5FRN A;  4CJQ A;  4M3R A;  4FM2 A;  2HND A;  2JLE A;  3T19 A; 
#chains in the Genus database with same CATH topology
 2E1Y A;  1RTH A;  2QXL A;  3A8Y A;  4CEC A;  1KC8 O;  5HLF A;  5MLC Q;  3RMA A;  4FM1 A;  2BTF A;  3D45 A;  4OKJ A;  1RT1 A;  5AQS A;  5AQK A;  5FLX O;  4CD3 A;  3DXK A;  2W42 A;  1HNI A;  1H1V A;  2Q97 A;  3NH2 A;  3QBX A;  3V9Z A;  5KQ8 A;  2E2N A;  3AVB A;  3K5N A;  2O8E A;  4WFN L;  1NK6 A;  4DV5 K;  4JRP A;  3CET A;  3A5L C;  4JKB A;  5KI6 A;  4OGC A;  4KHN A;  3O1W A;  1QSY A;  3N4Q A;  1RT7 A;  4DCH A;  3LM9 A;  3LL3 A;  4HTU A;  4ILJ A;  1BHL A;  2P9K A;  2YNH A;  3FLC O;  3G6E N;  1A5X A;  3SMS A;  3KLG A;  3CJ9 A;  4DQS A;  1KRP A;  4ISF A;  4DR5 K;  1VQ6 N;  4PKH A;  1TL1 A;  3O4W A;  4J2B A;  1VQM N;  1BUP A;  1U48 A;  3FFK B;  4FZX C;  2EX3 A;  3D2F A;  4FO0 A;  3QEV A;  2WOM A;  4FWP A;  1IJJ A;  4B3O A;  3SQ0 A;  3HVT A;  4V19 S;  4DF4 A;  4CJK A;  3S3O A;  1LV5 A;  4K8Z A;  4DF8 A;  4Z4H A;  4ELV A;  4B1Y B;  2OYQ A;  2QM1 A;  2HHS A;  4BRC A;  3L4I A;  5C24 A;  5HRO A;  1YXQ A;  4OPA A;  1RT2 A;  1KD1 O;  1SL2 A;  3WXK A;  4OLB A;  4KRF A;  3BUZ B;  4X62 K;  2FLO A;  4N5S A;  4KO0 A;  4BRA A;  1JLF A;  1YAG A;  3GL1 A;  4U67 L;  5D3G A;  2KFN A;  1BG3 A;  5J2Q A;  2HHH K;  5M1P A;  3VGL A;  4KTZ A;  4CEA A;  2VG7 A;  3VEO A;  3SJJ A;  3H1V X;  1DGK N;  4MFB A;  4AHT A;  4O0I A;  2YV0 X;  1S22 A;  4LSN A;  3ZSO A;  3A2F A;  4JI1 K;  4PL7 A;  3L4Q A;  1HYS A;  1WSH A;  4J8F A;  4CIF A;  3HYF A;  2OPP A;  4KKO A;  4FLY A;  3CCJ N;  1NBW A;  3E66 A;  5LMU K;  5J2N A;  4BRF A;  1U45 A;  2P9I A;  3QNO A;  2HVI A;  3B8A X;  1NLV A;  1Z05 A;  3S41 A;  2UU9 K;  3LP1 A;  5AQQ A;  1N33 K;  3K5M A;  1QSL A;  3HTV A;  1ASU A;  4KB0 A;  2QXF A;  4QS8 A;  3SUP A;  1S9G A;  4E1N A;  4EFH A;  1GLC G;  1ASW A;  3L8B A;  4E7K A;  2NUB A;  3CCR N;  4AF1 A;  4OPK A;  2QWQ A;  4HUG A;  3O5B A;  4CES A;  4WQ5 A;  2KHO A;  4CGD A;  3U3G A;  2JGU A;  5AZJ B;  3TAE A;  3RR8 A;  3EE8 A;  3UKU B;  5CYQ A;  1WBD A;  2VGN A;  2B6A A;  3RMD A;  3H3O B;  2GUP A;  3VQD A;  3SCX A;  3MN5 A;  2NNW A;  4RW9 A;  5DM7 L;  3AA3 A;  1VRU A;  4QS9 A;  4F9O A;  3FZK A;  4WQ4 A;  2I7P A;  2F96 A;  4TSX A;  1TGO A;  4ID1 A;  3QIC A;  3PIP L;  4E7L A;  3T1H K;  3VEX A;  4C8K A;  4WE1 A;  4JAX A;  1XUP O;  3R9P A;  3EKS A;  4DKW A;  2OA8 A;  4DS4 A;  1RT5 A;  3O4N A;  4FJI A;  1VAZ A;  2A1S A;  4BC5 A;  3QIN A;  1J5O A;  1NM1 A;  1TUY A;  1OVY A;  3CI5 A;  5F2R A;  4FJH A;  3K9K A;  3O80 A;  3LZI A;  1WB9 A;  4HCB A;  2XY8 A;  3WEE B;  4X65 K;  1VQ5 N;  3MED A;  5HRS A;  2X78 A;  4DV3 K;  3A5N C;  4JV5 K;  3TTF A;  4YFU A;  2IOC A;  4L8R B;  1TKD A;  3J7Y P;  4A2B A;  1X9M A;  1HQE A;  4N41 A;  3TPQ A;  2ZJP L;  2NRZ A;  3P1G A;  3QES A;  1VQK N;  2NRW A;  3NDK A;  3HP6 A;  5AQV A;  5KTQ A;  1VQ7 N;  1NKB A;  4U7B A;  1VHX A;  5AQT A;  4DTU A;  5ADX A;  2IGI A;  5ADX H;  4YHH K;  4O4G A;  4EHT A;  4NCA A;  4CVN E;  4DFM A;  3SLC A;  5JVH L;  4FK0 A;  4FWL A;  2YNI A;  4FSV A;  3QLH A;  2YJF A;  3TAF A;  3DLE A;  4OKK A;  1T03 A;  2O8C A;  5BPN A;  2Y1J A;  4LD0 A;  4RWT A;  5AFU A;  1WSI A;  5AQW A;  3LP0 A;  4PY5 A;  2QEX N;  2DY4 A;  4HCC A;  1CXU A;  1GLJ O;  3LPT A;  4IFY A;  5CYM A;  5GIN A;  3B6P A;  4DMN A;  2HHV A;  2QWO A;  3HSC A;  3VEZ A;  2HVH A;  4M3W A;  3KJV A;  1BOT O;  2ZE2 A;  1C1B A;  4BY9 C;  1ZBI A;  3J8A A;  2YCH A;  2G8K A;  5J2P A;  3SI6 A;  3SV3 A;  3NMU A;  2FBT A;  4HHT A;  4M41 A;  4F2R A;  5AQH A;  1SZ2 A;  4HUF A;  4CFC A;  4CFB A;  1YJW N;  1LWF A;  1IKX A;  1BWF O;  3ULE A;  4M3Y A;  3T1A A;  5AQR A;  4OPJ A;  2E1Z A;  3RVC A;  3M8P A;  4IJA A;  2E2O A;  3J7Z O;  4PHT X;  4NXN K;  3QEI A;  1JLE A;  3OBY A;  2F7T A;  5FPN A;  4DG1 A;  3VA3 A;  3SBT A;  3QEP A;  2P9L A;  1SAZ A;  4FK2 A;  3PLA A;  1EX4 A;  4B3R K;  4MO4 A;  1TL3 A;  4CEZ A;  3NF6 A;  4DTN A;  3IG1 A;  2QWM A;  1RTD A;  3CQY A;  2BAN A;  4DR3 K;  4B9V A;  4HTL A;  4MQ3 A;  3G0Z A;  1ZC6 A;  3FZL A;  2P9N A;  1YI2 N;  2FSK A;  2YJE A;  1UAX A;  4IDH A;  1X9W A;  3HPH A;  1J9A A;  1J6Z A;  2YHW A;  3JXU A;  1GOB A;  4RW6 A;  4J2D A;  3I8D A;  2W40 A;  5FDL A;  1IG8 A;  4KB1 A;  3OW2 M;  1K8K A;  5JMV A;  5AQF A;  4BVP A;  3CM5 A;  1QQN A;  4E89 A;  3HVR A;  2UUB K;  4B9S A;  1LAW A;  3ZEU B;  2KQ2 A;  3ATV A;  4DFP A;  4EHU A;  1W97 L;  3PV8 A;  4FJL A;  3AY9 A;  2V52 B;  1BU6 O;  3NF9 A;  5AQN A;  1C1A A;  3ZX3 A;  3BZC A;  3H46 O;  1RDD A;  3T69 A;  4FLT A;  4LFA K;  4CK1 A;  3L3V A;  3LAK A;  3NVK A;  4CD1 A;  3V9U A;  4PL8 A;  2QWR A;  2VWB A;  1EXQ A;  2OZS A;  4IZ9 A;  2OAN A;  1XI1 A;  1YT3 A;  1A5W A;  2WC9 A;  1RDA A;  4IOX A;  1K6Y A;  4DHY A;  1HPM A;  1YIT N;  4LH5 A;  3KWI A;  3QIO A;  4CGG A;  4RW7 A;  3HPG A;  1XWL A;  3DM2 A;  5EOY A;  4AIL C;  3DOK A;  2A1R A;  1S9E A;  1NJW A;  3QEW A;  1C0F A;  4MDA A;  5K14 A;  2HBM A;  5H1S Q;  2X6S A;  3SZ2 A;  3RRG A;  1RTJ A;  4MLH A;  2AP1 A;  3VN5 A;  3L2R A;  4BR5 A;  3A5M C;  2QKK A;  3NVM A;  3HL8 A;  1TYQ B;  4DB3 A;  3O1B A;  1N6Q A;  4E1J A;  4B9U A;  5AZI A;  1LWC A;  1SS6 A;  3ZYY X;  1C0U A;  4FJG A;  3V6D A;  4H03 B;  4M7X A;  3ZET B;  2A42 A;  4YOT A;  3QEX A;  1F21 A;  3VEV A;  4K25 A;  4ILG B;  4DU4 A;  3DXM B;  3H1Q A;  1BGX T;  1JXE A;  1S3X A;  3DMJ A;  3VES A;  3DLL L;  2KW4 A;  1NJX A;  4KI4 A;  3P4I A;  1RFQ A;  5DK5 A;  4KHP K;  2D0O A;  3CYM A;  1XQS C;  4CJT A;  3N4P A;  2PFU A;  4CJQ A;  1EQY A;  2GEL A;  3T19 A;  2G8I A;  1VQN N;  2O8F A;  4BG8 A;  3P38 A;  4BRI A;  3IAY A;  4BRM A;  3UKR A;  2VG5 A;  4BRN A;  3MWT A;  2UXB K;  5C2F A;  3THY B;  3V81 A;  2CGK A;  2W41 A;  5KPZ A;  4DTX A;  4KHY A;  3U6F A;  1VQ8 N;  3CJ7 A;  1Q18 A;  4DR7 K;  5BPM A;  1HKC A;  3HM9 A;  5HL7 L;  3AO3 A;  1XNQ K;  4MDB A;  1U6Z A;  1OVQ A;  1S5J A;  3KLH A;  3MN7 A;  2ZWH A;  3V9W A;  3MX5 A;  3WNF A;  2UYT A;  4M63 C;  2HHU A;  1JCE A;  4NLB A;  2NRH A;  2FSJ A;  4JI8 K;  2QWN A;  1EP4 A;  4FWR A;  4H5W A;  4BQL A;  3L2V A;  4YOU A;  1YHQ N;  4DS5 A;  4M45 A;  1EWR A;  4FJK A;  3HT3 A;  4MO5 A;  1IBL K;  2Q0R A;  3KKR A;  5HRP A;  4PUO A;  3ID6 A;  3MCA B;  4H0Y B;  3EYZ A;  3SUN A;  2WON A;  1NK0 A;  1S1V A;  3OYG A;  1KAZ A;  1BIU A;  1RIL A;  3U4L A;  4DFJ A;  4JD2 B;  5FRN A;  3CD6 N;  2GTD A;  3DLR A;  5E41 A;  3QIP A;  1TAQ A;  3UIQ A;  3LWL A;  3HI0 A;  3O9R A;  3TAM A;  3K59 A;  4E7H A;  3E9L A;  3BP8 A;  3I56 N;  4A5A A;  3K57 A;  2AA4 A;  4BC3 A;  1VSI A;  5HOO A;  1KCF A;  3ZSQ A;  5AQM A;  4NXM K;  3V4I A;  3VA0 A;  1T44 A;  2V7Z A;  3OYM A;  4CHQ A;  3NBP A;  3PSF A;  4JRQ A;  3PX6 A;  3HO1 A;  3LDO A;  4CF9 A;  1L3T A;  4K43 A;  2P9P B;  1LCU A;  4B1W B;  2JWK A;  3O9S A;  4CHZ A;  4AHU A;  1ESV A;  3C94 A;  5BRE A;  2NRX A;  3P5J A;  4RG8 A;  1GLD G;  2FBV A;  4CJR A;  4GNI A;  4DQP A;  2O8D B;  3LPU A;  1RBT A;  4LFC K;  3D2E A;  1NKE A;  2IDO A;  3GDQ A;  1QHT A;  1LW2 A;  2A6A A;  4G9Z A;  4AQY K;  4CCH A;  4NO7 A;  4GV6 A;  2HMP A;  1JLG A;  4FW2 A;  1T6C A;  4B8A B;  4QOZ B;  1RTI A;  3VER A;  3V1O A;  1BI4 B;  2HF4 A;  1NJZ A;  1CXQ A;  1W7A A;  3RSE B;  2RPI A;  3OA9 A;  2NLX A;  3VQ6 A;  4CJW A;  1DT9 A;  5B8H A;  3K5O A;  2Q1N A;  4DTM A;  1RNH A;  4YDU A;  3KLE A;  4FPA A;  1OH6 A;  2WFB A;  3TI0 A;  3SJH A;  1L3U A;  4DWI A;  4B9N A;  4IEE A;  3CC2 N;  3AVH A;  3CFP A;  3OY9 A;  4DV4 K;  1K8A O;  3C6A A;  4BRQ A;  1MWK A;  4JHD B;  5AQZ A;  2FBY A;  3FFI A;  4H4M A;  4CZL A;  2G8F A;  2FF3 B;  2P1J A;  4BG9 A;  4DV2 K;  4JI0 K;  1ZBF A;  4RCH A;  2QW9 A;  1NMN A;  4GW6 A;  3OJS A;  4ID5 A;  2ZM6 K;  2FSN A;  3B6O A;  1EO1 A;  2DFH A;  1NGG A;  4BRD A;  1NGD A;  2E6M A;  3KK7 A;  2V7Y A;  1ATN A;  1R59 O;  3AVJ A;  4DU3 A;  1SUQ A;  1XC9 A;  3V9X A;  4CJ4 A;  4FLW A;  1KAX A;  3KLF A;  4FJJ A;  1BA1 A;  3GE1 A;  3H45 C;  3ENH A;  1L3S A;  3SK3 A;  4LF9 K;  3DAW A;  1IBK K;  1SKW A;  1JL2 A;  2KFZ A;  2XRI A;  4FJ8 A;  1S1T A;  3SAF A;  3RTV A;  4H8K A;  1ZBL A;  1HRH A;  2WUS A;  1LOT B;  3DRS A;  5CZ1 A;  3SQ4 A;  4W5R A;  4CE9 A;  4KHW A;  3DWL A;  1GLB G;  3CXC M;  3T1Y K;  5IWA K;  4E1M A;  3MEE A;  3WXL A;  1C6V A;  4FL9 A;  5LMN K;  2IVN A;  4IFV A;  4A59 A;  4LY7 A;  2F8S A;  4LC9 B;  4JI5 K;  2VWK A;  3TTC A;  1QZ6 A;  4WFB L;  4BRP A;  4FVU A;  2VYP A;  4BR2 A;  4H0V B;  1S6P A;  3TAQ A;  3R6M A;  4CK2 A;  3THV A;  4O55 A;  3O6W A;  2B4J A;  2FXU A;  4IWV A;  4OPH A;  1YF5 L;  2CGJ A;  4CEQ A;  4X64 K;  3CCE N;  3O3F A;  3LDL A;  3MX2 A;  4CJV A;  3ULD A;  4DQI A;  3FE1 A;  3MN9 A;  3SBG A;  4FLZ A;  4ICL A;  2E6L A;  4WF9 L;  2QA4 N;  2HHX A;  4DR2 K;  3CMA N;  3TSP A;  4DTP A;  1QZ5 A;  1QHA A;  2OCE A;  2NZT A;  4JKF A;  2G8W A;  4CGI A;  1ZBS A;  3AV9 A;  4RTF D;  1QE1 A;  5FPE A;  3P83 D;  2PAV A;  3KIO A;  1JLC A;  3AVN A;  4O8U A;  3K2P A;  1Q81 O;  3OYH A;  3HOT A;  3OYK A;  3SNN A;  1SV5 A;  1T6D A;  3NGY A;  5AQP A;  4AH9 A;  3QER A;  1KTQ A;  4Q5V A;  3BF3 A;  5EU7 A;  1N32 K;  4JKA A;  4DSJ A;  3OYI A;  2HF3 A;  2IC3 A;  2QWL A;  1QTM A;  4A2A A;  4BR0 A;  5JLF A;  4GKK K;  3C7N A;  5FRO A;  3DLK A;  1RBS A;  4ISG A;  4BQZ A;  3CJA A;  1KVB A;  5HP1 A;  4CF1 A;  3DLB A;  3I33 A;  1O13 A;  5AZJ A;  5C12 A;  4E0D A;  4BE1 A;  4CZF A;  1HKB A;  1X3M A;  2CH5 A;  4CED A;  5C10 A;  1XMO K;  3UKU A;  5KGX A;  1Q82 O;  4CIE A;  4KV8 A;  3DI6 A;  3AAR A;  2UUA K;  1BCM A;  2HMI A;  3A0I X;  3M8S A;  3AVA A;  1ZBH A;  4B9Q A;  4YOR A;  3PX0 A;  3VQP A;  3A5O C;  1QQO A;  1W9H A;  2E2Q A;  3DLG A;  4M3U A;  1IO2 A;  2YI1 A;  5AJ3 K;  1WSE A;  1VSE A;  4G1Q A;  1TK5 A;  1MWM A;  1RBU A;  5CZ2 A;  2PY5 A;  1RT3 A;  4IFE A;  5HRN A;  1N8R O;  3D7E O;  1UA1 A;  2X74 A;  1SKR A;  2I7N A;  5EY4 A;  4CJ5 A;  2OTJ N;  3RMC A;  1FK9 A;  5GAE P;  4H0X B;  3WUH A;  4DQR A;  3LP2 A;  3WEE A;  3NFA A;  4I9L A;  1NGA A;  4B3M K;  2E88 A;  1IKY A;  3DOL A;  4BE0 A;  3U9Z A;  1W0H A;  1NGF A;  1D8Y A;  3E1Y A;  3GOI A;  3V1R A;  1REV A;  5BR8 K;  2YKN A;  3KKS A;  4LFB K;  4JKG B;  2F9W A;  1B9F A;  3C6T A;  3LDN A;  1VQO N;  2RN2 A;  1TKT A;  4KAZ A;  4NCG A;  3ZSX A;  2HB5 A;  2VQF K;  4O5F A;  1KVC A;  4Z4C A;  3OYJ A;  3O9U A;  5J1E A;  4CHP A;  1NJY A;  3VMF B;  4CJU A;  5AFU H;  1TVR A;  4CER A;  3AO5 A;  3U3Y A;  4DLG A;  3M6G A;  5KPT A;  3VQ9 A;  3RMB A;  4FLX A;  3VQB A;  1JKH A;  1ZBU A;  2ASO A;  3PY8 A;  2PBD A;  3VOV A;  4AM6 A;  2P9U B;  3HST B;  1ATR A;  4J2A A;  3WNG A;  1X3N A;  2YHA A;  4CEO A;  1VQ9 N;  3LP3 A;  4GVM A;  2HBL A;  4MLE A;  3QB0 A;  4M3R A;  2HND A;  1TK8 A;  3CJ1 A;  3JSM A;  3VQ5 A;  4E7J A;  3HM8 A;  5E26 A;  3KD5 E;  5J2M A;  3QBW A;  4PKG A;  4K42 A;  2WBN A;  3MCP A;  4W5O A;  5M1F A;  3ZSW A;  3M8R A;  1Y97 A;  4JK8 A;  4O44 A;  1K9M O;  4DSL A;  4L3Q A;  5CE3 A;  3KD1 E;  1IV0 A;  4FK4 A;  2VWJ A;  4GV9 A;  3KLI A;  2KTQ A;  1HQU A;  3WXM B;  1D9F A;  3GG4 A;  4C8N A;  4CZM A;  1BO5 O;  1D5A A;  1IH7 A;  5LL6 Z;  3ZT2 A;  1KAY A;  4J2E A;  1E4G T;  2D0C A;  1HNW K;  4OLA A;  1NOY A;  3KWG A;  4KTW A;  3ZCM A;  3VEN A;  2ZJQ L;  4KHS A;  4AHC A;  3THW B;  1SQK A;  2PYJ A;  3WNE A;  3HK2 A;  3ZEU A;  3IS9 A;  4X66 K;  1VK0 A;  4AHV A;  3V1Q A;  3EEQ A;  5AQY A;  1XC3 A;  5BN9 A;  1YJN N;  1K73 O;  2HNY A;  3MAQ A;  3OYF A;  3LAL A;  1NG9 A;  4CHO A;  1OH8 A;  1YJ9 N;  3PUF A;  4B1X B;  3ZX0 A;  3OS0 A;  1HYZ A;  3QNN A;  3CFO A;  1C0M A;  1VQL N;  2HBK A;  4DQ8 A;  4IO9 L;  4BWM A;  4DFK A;  4O5B A;  1NGC A;  1HLU A;  3NH1 A;  3ALY A;  2IAJ A;  3IFR A;  1U4B A;  1SKS A;  1CZB A;  2H3G X;  4B3T K;  4DSF A;  1B92 A;  2ZQB A;  5KGW A;  3L3U A;  3LM2 A;  4B08 A;  4M3X A;  5I3U A;  1VSD A;  2P9S B;  4BDP A;  3I8B A;  3OJU A;  1R0A A;  5EX5 A;  1BA0 A;  1J53 A;  5AQU A;  1S1U A;  4YY3 K;  1N36 K;  4DV1 K;  3AAP A;  3PSI A;  3AO2 A;  3TAG A;  1MA9 B;  2XY7 A;  2O8B B;  4FLU A;  1V4S A;  2DPN A;  1TYQ A;  2ASM A;  3AVG A;  2OPS A;  1RDW X;  2IVP A;  2F8T A;  2XHB A;  4YOY A;  3ZET A;  5IT9 O;  1KLM A;  2Q36 A;  4XH4 A;  3J80 O;  1GOA A;  1TV6 A;  1NKC A;  3ID8 A;  4CZE A;  3H6E A;  3ITH A;  3DRR A;  2E4L A;  4K8X A;  3ISN C;  4H5R A;  3F9K A;  1M90 O;  4DR6 K;  3DXM A;  3QET A;  3AO4 A;  2AJQ A;  1EKE A;  5C15 A;  3LDS A;  1FW6 A;  1W2B M;  3MXM A;  2UUC K;  4A57 A;  1RDC A;  4H5N A;  5JS2 A;  3VF2 A;  4OKE A;  1C0T A;  3MEC A;  2G8V A;  1Q9X A;  5FRM A;  2D0P A;  1JXB A;  3NHG A;  3F5T A;  1OH7 A;  2A3Z A;  4N47 A;  4CZI A;  3ZT0 A;  4XEI A;  1TK0 A;  3THY A;  1KQS M;  4LF6 K;  4B8C A;  4CF2 A;  2VQE K;  4FWO A;  1VSJ A;  3AGR A;  5CY4 A;  3IMX A;  1U47 A;  1ZXO A;  3CC7 N;  5JIC A;  4I2Q A;  2P51 A;  5CR4 A;  1JL1 A;  3U9D A;  3MDQ A;  4EP5 A;  4GMJ B;  4B9M A;  3SUQ A;  4DSK A;  4W5T A;  3WT0 A;  1BL3 A;  3ZT4 A;  3CPW M;  4BRG A;  3SMP A;  4N76 A;  1JCF A;  1LAV A;  3O9T A;  1Y64 A;  2DFF A;  1YTU A;  4IO8 A;  1C1C A;  3LAM A;  1YVU A;  3R3L A;  4KH4 A;  3TWH A;  4I9Q A;  2HHT A;  3NE6 A;  2QWP A;  3Q7C A;  3HZ6 A;  4NYF A;  3ZX2 A;  1DKG D;  1TUU A;  4IOC L;  3VQE A;  4BR4 A;  4B3S K;  2B5J A;  3FZH A;  1HJR A;  3VTH A;  3KVG A;  2NRR A;  1SL0 A;  3THX B;  2VGM A;  1HNV A;  4KTQ A;  3AO1 A;  4JD2 A;  2O4G A;  1RT6 A;  2E20 A;  3R8E A;  2Z1H A;  4CZK A;  1KSP A;  2OZM A;  1WSJ A;  4KFB A;  5ELZ A;  3M5R A;  2HW3 A;  2PYL A;  4QCL A;  3AVF A;  5FPM A;  3OYB A;  3MXI A;  3OTO K;  4GV3 A;  3IKM A;  4WQ5 C;  1FKO A;  4C8O A;  3G4S N;  4CJS A;  1SL1 A;  3P39 A;  2FC0 A;  3CCL N;  4F3T A;  4DTR A;  2Z1J A;  4OGE A;  1IBM K;  2P9P A;  4B9L A;  4DSI A;  5EVZ A;  3TR8 A;  3K5L A;  5LY3 A;  1YVN A;  4R79 A;  1U2V B;  2D1K A;  3CC4 N;  4AHS A;  2GEM A;  4K0K K;  4A62 A;  2E5L K;  3VGM A;  2NRV A;  3VTI A;  2VG6 A;  2O8D A;  3OHR A;  3VQA A;  4HVJ A;  4DSE A;  2GWJ A;  2ITM A;  4LF8 K;  3AVI A;  2YHY A;  2NRT A;  5C0Y A;  2G8U A;  1NJI O;  5AQL A;  1T8E A;  4CW7 B;  4I6M A;  4K41 A;  3P31 A;  5GAH P;  4DR4 K;  1YIJ N;  3O08 A;  3HBT A;  1HR0 K;  1HMV A;  1BI4 A;  4IJN A;  4NYN A;  1BIZ A;  3AGK A;  3GBT A;  2P5O A;  3RSE A;  5FPD A;  4KHU A;  4NB4 A;  4WFA L;  4DR1 K;  1N5Y A;  5E84 A;  4Y0W A;  3MWP A;  4CGH A;  4BDY A;  3CF5 L;  3EZW A;  2ZGZ A;  3BDP A;  3DXK B;  3JS6 A;  4YNQ A;  3D0P A;  3CHW A;  1VSM A;  3VQQ A;  4FVM A;  3ASM A;  3O4Q A;  2UXD K;  3TAP A;  4JHD A;  1HJO A;  2O8E B;  1ILY A;  3RR7 A;  4UQG A;  4FJM A;  4ILH A;  3PO4 A;  4Z4E A;  2E2P A;  2CGL A;  3OYN A;  2HST A;  4JK7 A;  5JLH A;  3VGK A;  1TKX A;  2P9K B;  4EZ9 A;  1T7P A;  3ZT3 A;  4ELT A;  1NGH A;  1J54 A;  1XHZ A;  1GLL O;  3M8Q A;  2Q2R A;  3CQ8 A;  2HOE A;  4DV7 K;  4FZY A;  4CJE A;  4JKC A;  2RHK A;  1UWB A;  2GWK A;  2JWL A;  4C1N K;  3D2F B;  4M3Z A;  2W6K A;  4Z4F A;  4IG0 A;  3CCM N;  4BRL A;  4CHN A;  1MU2 A;  3IRX A;  5JVG L;  3HP9 A;  4OX9 K;  4Z94 A;  1HKG A;  4E19 A;  1WAJ A;  3RRH A;  1VQ4 N;  4PWD A;  4WYB A;  5GAD P;  4FXD A;  3EKU A;  5M1O A;  4JN4 A;  4BDZ A;  2HHQ A;  1EET A;  3QFP A;  4IOA L;  3VF6 A;  3CIP A;  1NGJ A;  5A2Q O;  2J4R A;  4C8M A;  5M1Q A;  2A5X A;  3H08 A;  1D4X A;  3OBW A;  5GIP A;  3R1X A;  5M1N A;  1B9D A;  3VET A;  4BRH A;  3SUO A;  5AQO A;  4W5N A;  3ZT1 A;  4BR7 A;  4E7I A;  2X6N A;  2D0A A;  3TTD A;  2W6L A;  5M1K A;  3CCU N;  4FWN A;  4KI6 A;  4H4O A;  3TSQ A;  3BF1 A;  1QQM A;  4BC2 A;  1TKZ A;  4BGA A;  1ATS A;  1NK7 A;  3HRG A;  1I39 A;  1BCO A;  4EP4 A;  3VQC A;  2I5J A;  2ZGY A;  3OYE A;  3K9J A;  1VSL A;  3G25 A;  1WSF A;  4CJ3 A;  3TSU A;  5BR9 A;  4PKI A;  4OO1 J;  2P9I B;  2IIR A;  3L2W A;  4FYD A;  4C1N I;  3DJC A;  1RBR A;  4FWQ A;  4BAC A;  3M1F A;  1S1W A;  2EWS A;  2ITG A;  3SPZ A;  4KRE A;  4FM2 A;  2JLE A;  1G99 A;  1UA0 A;  5C2D A;  2OTL N;  3VPZ A;  4FJ7 A;  2D4W A;  1S6Q A;  1WN7 A;  3LAN A;  2OPQ A;  3EL2 A;  3C7N B;  3HPO A;  2XY6 A;  4DQQ A;  4ZTF A;  1JLQ A;  3OYC A;  1WUA A;  1NK9 A;  3J81 O;  1E4F T;  1JLB A;  1S1X A;  3PO5 A;  1NWK A;  3CJB A;  4BRK A;  3E01 A;  2HBJ A;  3NCI A;  4ZHR A;  4LF4 K;  2VCP A;  4Y1C A;  5SZT A;  4CJL A;  3C0B A;  5BRH A;  1RT4 A;  3OVN A;  3IDH A;  1KLN A;  4OVL A;  2ZD1 A;  5TKW A;  1L3V A;  4IG3 A;  4YOV A;  4O0J A;  4FWS A;  2EHG A;  1CZA N;  1VSH A;  4LH4 A;  1S72 N;  2CH6 A;  3FZF A;  3ATU A;  4FCY A;  3ZSZ A;  5DMR A;  4R5P A;  4HUE A;  1I94 K;  3VF4 A;  4JLH A;  3LDP A;  2ZJR L;  5HBM A;  4CFD A;  2P5G A;  3D6R A;  4DLE A;  1OH5 A;  4Z4G A;  2ASP A;  3DRP A;  4FLV A;  3VQ8 A;  4JI4 K;  4FPB A;  5GAG P;  4M42 A;  4DV0 K;  1C0G A;  1NK4 A;  4CHY A;  4IDK A;  1P90 A;  1BQM A;  5C42 A;  2F4V K;  1XHX A;  4CF0 A;  4I2P A;  1I3A A;  3F9M A;  1OKJ A;  2D0B A;  1LW0 A;  2GX9 A;  4O8K A;  3IUC A;  4JKG A;  2Z1G A;  3KZB A;  1JCG A;  3S3M A;  3U8X A;  1HX1 A;  4FJN A;  3AVM A;  2KKZ A;  2HNZ A;  4CEB A;  1UOC A;  1U04 A;  1GLF O;  2Q31 A;  1CZ9 A;  1Z6R A;  3FGU A;  1NMD A;  5CHI A;  4JI3 K;  1NGE A;  1T05 A;  4LF5 K;  2ZF5 O;  3EN9 A;  5BRF A;  1EWQ A;  3T3F A;  2IS3 A;  3CM6 A;  4WCE L;  2UXC K;  1BDG A;  1A5V A;  5LJV A;  2KZZ A;  4XH5 A;  1FXX A;  2O8C B;  1VSK A;  3O8M A;  1IG9 A;  4CK3 A;  3DLH A;  3EY1 A;  3NF7 A;  1P8Z A;  4DUY K;  3AA2 A;  4CJF A;  5BPL A;  1WAF A;  4CBU A;  5KRS A;  3CG7 A;  3T7Z A;  2E8A A;  3ZSR A;  3CER A;  1KVA A;  1NOZ A;  1VRT A;  1CLQ A;  3WQT A;  4CZG A;  2BH1 A;  3M3Z A;  5LJW A;  3G10 A;  3QFU A;  4BE2 A;  1BQN A;  5KPR A;  2P9U A;  4GVE A;  2Q0U A;  2GBZ A;  1HUX A;  3S3N A;  4DTS A;  4BR9 A;  3I55 N;  3ULE B;  1VSF A;  2FBX A;  4M7Y A;  4B9T A;  3LZJ A;  4FOE A;  5GIO A;  1Z25 A;  3CCQ N;  3HJF A;  3S9H A;  1QQC A;  3MN6 A;  3SYZ A;  1HNX K;  3C65 A;  2ATQ A;  4CIG A;  3TAB A;  2F9T A;  4NLC A;  4A5B A;  2P9L B;  1VQP N;  3QDK A;  3W0L A;  3O3G A;  4H5T A;  4F8R A;  2PZS A;  4GY2 B;  4JKD A;  3I0R A;  3CFR A;  4CZH A;  5I42 A;  2P9N B;  1NU0 A;  1KXP A;  3EO3 A;  3CQX A;  2V51 B;  1FJG K;  3G71 N;  3H3N O;  2OPR A;  2KZM A;  5AQX A;  4FW1 A;  3CCS N;  3BY5 A;  3DYA A;  1YTA A;  3OYA A;  1J5E K;  1K8K B;  4CEE A;  1IKW A;  2Z1I A;  3JYT A;  4Z4I A;  4B1V A;  1X9S A;  2YX6 A;  3K0S A;  1DTT A;  2DTU A;  3THW A;  3VEW A;  1Q86 O;  1E3M A;  1X9J A;  2BE2 A;  3LWM A;  1BIS A;  4B1U B;  4IKF A;  1WLJ A;  3E9P A;  2LSN A;  3NF8 A;  3WQU A;  3BZK A;  1NGI A;  3CME N;  2QKB A;  4C23 A;  5DM6 L;  1N34 K;  4ELU A;  5F0X A;  3L0Q A;  4DTO A;  4N56 A;  4PA1 A;  4XIU A;  3RWU A;  1QVF M;  3HOS A;  3ZSY A;  2R7Y A;  2RKI A;  1WBB A;  4CEF A;  3OS1 A;  3VQ4 A;  4CJ7 A;  2P9S A;  1RBV A;  3SAG A;  4AM7 A;  4YDU C;  4Q0B A;  1D9D A;  3AVL A;  2KLA A;  3OYD A;  3HXM A;  3BGR A;  4FJ5 A;  4RW8 A;  2BDP A;  3L2U A;  4W5Q A;  3ZLJ A;  2O8B A;  1GLE G;  4Z0U A;  3AA5 X;  1M1K O;  4BRE A;  4JEP A;  4YOX A;  2RF2 A;  1XNR K;  4BRO A;  1Q8I A;  1RCH A;  4Y1D A;  5AZI B;  3TU5 A;  2WTU A;  3PX4 A;  4CBX A;  2GUI A;  1JJ2 M;  3WXJ A;  4JNE A;  3OYL A;  3SPY A;  4FOI A;  4IBN A;  3WXI A;  1ASV A;  4PQU A;  1NK8 A;  2RE2 A;  4CBW A;  1HPZ A;  3AVK A;  4KH5 A;  3QO9 A;  3ENO A;  3TAR A;  2HHW A;  3W3D A;  3CCV N;  3KK1 A;  2YHX A;  2XY5 A;  4DUZ K;  4AHR A;  3K58 A;  5AQG A;  4KPY A;  3AA4 A;  3I0S A;  4BC4 A;  2FF6 A;  1RGI A;  3L6Q A;  3VQ7 A;  1QS4 A;  5T7B A;  4LSL A;  3O3H A;  5EXW A;  1DLO A;  2O8F B;  3ZSV A;  4CFA A;  1MDU B;  3AAQ A;  3UKR B;  4CJP A;  4LF7 K;  3ENB A;  2YNG A;  1X1P A;  4KH6 A;  2ETJ A;  4JKH A;  3PIO L;  1LWE A;  3C6H A;  4QAG A;  1JLA A;  4FZZ A;  4ISE A;  5KRT A;  4GKJ K;  3SQ2 A;  2BGG A;  4F4K A;  3C95 A;  1GOC A;  2YKM A;  3CPE A;  4IXC A;  4JS5 A;  5BRD A;  3FZM A;  4EAH D;  3NGI A;  4H0O A;  4FJ9 A;  2QTD A;  2QK9 A;  3MXJ A;  2DFE A;  5F1X A;  3F2K A;  2XO7 A;  3KK3 A;  4DV6 K;  1Q9Y A;  2YNF A;  1KFS A;  1ITG A;  4H5V A;  5KQD A;  3CJC A;  1FKP A;  1WSG A;  1QSS A;  3SAH A;  4JI7 K;  1YUW A;  5AR0 A;  3E9O A;  4RW4 A;  2YHB A;  4DTJ A;  3SV4 A;  4FWM A;  1Z26 A;  1NNE A;  4KHQ A;  1HNZ K;  3OS2 A;  2BUP A;  1KFD A;  4I7F A;  3QML A;  3Q7B A;  1ZYQ A;  2G8H A;  3KTQ A;  4CI6 A;  4JS4 A;  2O4I A;  1TAU A;  3NGZ A;  3TAN A;  4FWK A;  3L2Q A;  5I9E B;  4UY8 O;  5BN8 A;  3EZ5 A;  1HYV A;  2D5R A;  3UE5 A;  3THX A;  4DU1 A;  4XH1 A;  4BVO A;  3JAM O;  4HWI A;  4JYA K;  4FM0 A;  4M3T A;  3J7A P;  1NGB A;  5TKY A;  3V9S A;  3LDQ A;  3F73 A;  4H0P A;  3MK6 A;  1DTQ A;  1O1W A;  4H0T B;  2QI2 A;  4NCB A;  1XMQ K;  3NH0 A;  3BEX A;  1G15 A;  1L5U A;  1RDU A;  4ZTJ A;  4B1Z A;  4QS7 A;  4CGJ A;  4CZJ A;  1V4T A;  1DEJ A;  4F2S A;  5AQI A;  2IVO A;  3C6U A;  4JKE A;  4JI6 K;  1NK5 A;  4CF8 A;  3MMV A;  5SWM A;  5JS1 A;  4KBO A;  1U2V A;  4WQ4 C;  2A41 A;  3KK2 A;  1RDB A;  3EE9 A;  4JI2 K;  3UB5 A;  4BGB A;  3AVC A;  1U49 A;  4A61 A;  3FR0 A;  3WNH A;  3D2E B;  4F3O A;  4C8L A;  4EIA A;  2Y1I A;  4BWJ A;  3SQ1 A;  1WNS A;  4E3S A;  5HRR A;  1QVG M;  1GLA G;  1T3V A;  4YOW A;  1IKV A;  4OJR A;  1WOQ A;  3MEG A;  3KHY A;  4I6M B;  5AQJ A;  4CGF A;  2GV9 A;  3O9Q A;  2A40 A;  5C25 A;  2Q3S A;  4JK9 A;  4FJX A;  3VEY A;  1Q7Y O;  4EZ6 A;  4IEI A;  3NAE A; 
#chains in the Genus database with same CATH homology
 1TK8 A;  1RTH A;  3JSM A;  3VQ5 A;  1UA0 A;  4E7J A;  4CEC A;  4FJ7 A;  2G8I A;  1S6Q A;  1WN7 A;  3LAN A;  5HLF A;  3IAY A;  3KD5 E;  2OPQ A;  3RMA A;  5J2M A;  2VG5 A;  4FM1 A;  3D45 A;  4OKJ A;  4W5O A;  1RT1 A;  3V81 A;  3ZSW A;  3HPO A;  3M8R A;  1Y97 A;  2XY6 A;  2W42 A;  4DQQ A;  4ZTF A;  1JLQ A;  1HNI A;  4O44 A;  3NH2 A;  3OYC A;  4DSL A;  3V9Z A;  1NK9 A;  4DTX A;  4KHY A;  3U6F A;  3KD1 E;  4FK4 A;  2VWJ A;  3KLI A;  1JLB A;  1S1X A;  3PO5 A;  3AVB A;  2KTQ A;  1HQU A;  3E01 A;  3K5N A;  3HM9 A;  1NK6 A;  1D9F A;  3NCI A;  4C8N A;  4ZHR A;  4JRP A;  5KI6 A;  4OGC A;  4KHN A;  1D5A A;  4Y1C A;  3AO3 A;  1IH7 A;  5SZT A;  3ZT2 A;  1QSY A;  4CJL A;  1RT7 A;  1S5J A;  3KLH A;  4J2E A;  2D0C A;  1RT4 A;  4HTU A;  3V9W A;  4OLA A;  1BHL A;  3OVN A;  1NOY A;  3WNF A;  4KTW A;  2YNH A;  2HHU A;  3ZCM A;  1KLN A;  4OVL A;  1A5X A;  2ZD1 A;  1L3V A;  4KHS A;  3KLG A;  4IG3 A;  4AHC A;  4DQS A;  1KRP A;  4O0J A;  2PYJ A;  3WNE A;  2EHG A;  3HK2 A;  1TL1 A;  1EP4 A;  3IS9 A;  4J2B A;  1VK0 A;  1VSH A;  4AHV A;  3V1Q A;  1U48 A;  4FZX C;  3L2V A;  2EX3 A;  4LH4 A;  2HNY A;  3MAQ A;  3OYF A;  3LAL A;  3QEV A;  4DS5 A;  4CHO A;  2WOM A;  4M45 A;  4FJK A;  4FCY A;  3ZSZ A;  5DMR A;  4R5P A;  3HT3 A;  4B3O A;  4HUE A;  3PUF A;  3SQ0 A;  4JLH A;  3OS0 A;  1HYZ A;  3HVT A;  3QNN A;  3KKR A;  5HBM A;  3CFO A;  1C0M A;  4CFD A;  5HRP A;  4PUO A;  2P5G A;  4DLE A;  4Z4G A;  3EYZ A;  4DF4 A;  3DRP A;  3SUN A;  2WON A;  4BWM A;  4CJK A;  4DFK A;  4FLV A;  4O5B A;  3VQ8 A;  1S1V A;  3OYG A;  3S3O A;  4M42 A;  3NH1 A;  1LV5 A;  4K8Z A;  1BIU A;  3ALY A;  1NK4 A;  4DF8 A;  1RIL A;  2IAJ A;  4CHY A;  4DFJ A;  4IDK A;  1U4B A;  1SKS A;  1CZB A;  1BQM A;  4Z4H A;  5C42 A;  3DLR A;  1XHX A;  4CF0 A;  4I2P A;  5E41 A;  3QIP A;  1TAQ A;  4ELV A;  4DSF A;  3UIQ A;  1B92 A;  1I3A A;  2ZQB A;  3LWL A;  2D0B A;  1LW0 A;  5KGW A;  2OYQ A;  2HHS A;  3L3U A;  3TAM A;  2Z1G A;  3K59 A;  4E7H A;  5C24 A;  4B08 A;  5HRO A;  4M3X A;  3S3M A;  1RT2 A;  5I3U A;  1SL2 A;  1VSD A;  4BDP A;  3OJU A;  1R0A A;  4FJN A;  3AVM A;  4OLB A;  4KRF A;  3K57 A;  2HNZ A;  4N5S A;  4CEB A;  1VSI A;  1KCF A;  1J53 A;  1UOC A;  4KO0 A;  3ZSQ A;  1U04 A;  1JLF A;  1S1U A;  3V4I A;  3VA0 A;  1CZ9 A;  3OYM A;  4JRQ A;  4CHQ A;  3NBP A;  3PX6 A;  3AO2 A;  5D3G A;  3HO1 A;  2KFN A;  3TAG A;  2XY7 A;  4CF9 A;  5J2Q A;  1T05 A;  1L3T A;  4KTZ A;  4CEA A;  2VG7 A;  3T3F A;  2IS3 A;  3CM6 A;  3SJJ A;  4FLU A;  1A5V A;  4MFB A;  4AHT A;  4O0I A;  2YV0 X;  2KZZ A;  3AVG A;  1FXX A;  4CHZ A;  1VSK A;  4AHU A;  4LSN A;  2OPS A;  3C94 A;  1IG9 A;  4CK3 A;  3DLH A;  3P5J A;  4RG8 A;  3EY1 A;  3NF7 A;  2F8T A;  2FBV A;  3ZSO A;  3A2F A;  3AA2 A;  4CJF A;  4CJR A;  2XHB A;  4DQP A;  1HYS A;  1WAF A;  5KRS A;  3LPU A;  1RBT A;  3CG7 A;  1WSH A;  1KLM A;  3ZSR A;  1KVA A;  4CIF A;  1NKE A;  1GOA A;  1NOZ A;  1TV6 A;  1VRT A;  2IDO A;  2OPP A;  3HYF A;  4KKO A;  4FLY A;  1NKC A;  1CLQ A;  3ITH A;  3DRR A;  1QHT A;  2E4L A;  4K8X A;  1LW2 A;  3ISN C;  3G10 A;  4CCH A;  4BE2 A;  3F9K A;  1BQN A;  5J2N A;  1U45 A;  3QET A;  3AO4 A;  2AJQ A;  1EKE A;  1JLG A;  4FW2 A;  3QNO A;  2HVI A;  4B8A B;  4QOZ B;  3LDS A;  1RTI A;  3LP1 A;  2GBZ A;  3V1O A;  3K5M A;  3S3N A;  1QSL A;  4DTS A;  1ASU A;  1BI4 B;  3MXM A;  4KB0 A;  2QXF A;  3SUP A;  1VSF A;  2FBX A;  1NJZ A;  4B9T A;  1CXQ A;  1RDC A;  3LZJ A;  1Z25 A;  5JS2 A;  4OKE A;  1C0T A;  2RPI A;  3MEC A;  1S9G A;  3VQ6 A;  4CJW A;  4E1N A;  1Q9X A;  2G8V A;  5FRM A;  3HJF A;  3S9H A;  3K5O A;  1JXB A;  1ASW A;  1QQC A;  3L8B A;  4E7K A;  4DTM A;  2NUB A;  3NHG A;  3SYZ A;  4OPK A;  1RNH A;  2ATQ A;  4N47 A;  4CIG A;  3TAB A;  3KLE A;  4HUG A;  3ZT0 A;  4CES A;  1TK0 A;  3TI0 A;  3O3G A;  4CGD A;  3U3G A;  2JGU A;  1L3U A;  4DWI A;  4B9N A;  4F8R A;  4B8C A;  4CF2 A;  3TAE A;  2PZS A;  3RR8 A;  3AVH A;  3CFP A;  3I0R A;  3CFR A;  3OY9 A;  5I42 A;  1VSJ A;  5CYQ A;  2FBY A;  2B6A A;  5CY4 A;  1U47 A;  3FFI A;  3RMD A;  4H4M A;  3VQD A;  3SCX A;  2G8F A;  4I2Q A;  2P1J A;  2OPR A;  2P51 A;  1JL1 A;  3AA3 A;  4FW1 A;  4RW9 A;  2KZM A;  1VRU A;  4EP5 A;  4GMJ B;  3DYA A;  4B9M A;  3SUQ A;  4DSK A;  1YTA A;  1ZBF A;  4W5T A;  3OYA A;  4GW6 A;  3OJS A;  1BL3 A;  4ID5 A;  4CEE A;  1IKW A;  3ZT4 A;  2F96 A;  2Z1I A;  3JYT A;  3B6O A;  4Z4I A;  4N76 A;  1X9S A;  4TSX A;  1TGO A;  1DTT A;  2DFH A;  4ID1 A;  2DTU A;  1LAV A;  4E7L A;  2DFF A;  1YTU A;  4C8K A;  4WE1 A;  2BE2 A;  2E6M A;  3LWM A;  1BIS A;  1C1C A;  3LAM A;  1YVU A;  3TWH A;  2OA8 A;  4I9Q A;  2HHT A;  3AVJ A;  4DS4 A;  4IKF A;  4DU3 A;  3NE6 A;  1SUQ A;  1WLJ A;  1XC9 A;  1RT5 A;  3O4N A;  4FJI A;  2LSN A;  3NF8 A;  3V9X A;  4CJ4 A;  2A1S A;  4NYF A;  4FLW A;  3QIN A;  3KLF A;  1J5O A;  4FJJ A;  2QKB A;  4FJH A;  3VQE A;  3LZI A;  4ELU A;  4HCB A;  1L3S A;  4EZ6 A;  2XY8 A;  2B5J A;  1HJR A;  1SKW A;  1JL2 A;  1SL0 A;  2KFZ A;  2XRI A;  4DTO A;  4FJ8 A;  1S1T A;  3MED A;  5HRS A;  2X78 A;  3RTV A;  4N56 A;  4H8K A;  1HNV A;  4PA1 A;  1ZBL A;  4XIU A;  1HRH A;  4KTQ A;  3RWU A;  3AO1 A;  3DRS A;  5CZ1 A;  2O4G A;  1RT6 A;  4YFU A;  2IOC A;  4W5R A;  3SQ4 A;  3ZSY A;  4L8R B;  4CE9 A;  4KHW A;  2R7Y A;  1X9M A;  1TKD A;  4N41 A;  1HQE A;  2RKI A;  2Z1H A;  1KSP A;  3P1G A;  3QES A;  2OZM A;  4E1M A;  3MEE A;  4CEF A;  1C6V A;  1WSJ A;  4KFB A;  3OS1 A;  2HW3 A;  3VQ4 A;  2PYL A;  4IFV A;  3NDK A;  3HP6 A;  1RBV A;  4QCL A;  3AVF A;  5KTQ A;  4LY7 A;  3OYB A;  3MXI A;  1NKB A;  1D9D A;  2F8S A;  2VWK A;  4Q0B A;  3AVL A;  4DTU A;  3OYD A;  2IGI A;  1FKO A;  3HXM A;  4C8O A;  3BGR A;  1S6P A;  4O4G A;  4FJ5 A;  4NCA A;  4RW8 A;  3TAQ A;  2BDP A;  4CJS A;  4CK2 A;  4W5Q A;  3L2U A;  3THV A;  4O55 A;  2FC0 A;  4DFM A;  1SL1 A;  4F3T A;  4DTR A;  4FK0 A;  2B4J A;  2YNI A;  2Z1J A;  3AA5 X;  4OGE A;  4Z0U A;  4B9L A;  4DSI A;  3TR8 A;  3QLH A;  3K5L A;  3TAF A;  2RF2 A;  4CEQ A;  3DLE A;  3O3F A;  1Q8I A;  4OKK A;  1RCH A;  4Y1D A;  4CJV A;  3ULD A;  4FLZ A;  1T03 A;  4DQI A;  4ICL A;  2Y1J A;  4LD0 A;  4AHS A;  3PX4 A;  2E6L A;  2GUI A;  2HHX A;  1WSI A;  3OYL A;  3LP0 A;  4PY5 A;  2VG6 A;  3SPY A;  4HCC A;  3VQA A;  2DY4 A;  1CXU A;  3LPT A;  4IBN A;  4IFY A;  4HVJ A;  5CYM A;  4DTP A;  4DSE A;  3B6P A;  2G8W A;  1ASV A;  4PQU A;  4CGI A;  3AV9 A;  4DMN A;  2HHV A;  3AVI A;  1NK8 A;  2HVH A;  2G8U A;  1QE1 A;  3NAE A;  4M3W A;  3P83 D;  3KJV A;  1HPZ A;  3AVK A;  2ZE2 A;  1T8E A;  1C1B A;  3QO9 A;  1ZBI A;  3TAR A;  5J2P A;  3SI6 A;  3KIO A;  3SV3 A;  1JLC A;  3AVN A;  2FBT A;  3K2P A;  4M41 A;  3KK1 A;  4HHT A;  2XY5 A;  4F2R A;  3OYH A;  4AHR A;  3OYK A;  4HUF A;  4CFC A;  3K58 A;  3SNN A;  1SV5 A;  4CFB A;  4KPY A;  1LWF A;  3AA4 A;  1IKX A;  3I0S A;  1HMV A;  1BI4 A;  3NGY A;  4AH9 A;  3QER A;  4NYN A;  4M3Y A;  1BIZ A;  3T1A A;  4OPJ A;  1NK0 A;  1KTQ A;  3VQ7 A;  3M8P A;  4Q5V A;  2P5O A;  4KHU A;  1QS4 A;  5EU7 A;  5T7B A;  1N5Y A;  4DSJ A;  4LSL A;  3O3H A;  3OYI A;  2IC3 A;  1QTM A;  1DLO A;  3ZSV A;  1JLE A;  5FRO A;  3QEI A;  4CFA A;  3DLK A;  1RBS A;  4CGH A;  4BDY A;  1KVB A;  5HP1 A;  4DG1 A;  4CF1 A;  3VA3 A;  4CJP A;  3DLB A;  3QEP A;  2YNG A;  1X1P A;  2ETJ A;  3BDP A;  4FK2 A;  3D0P A;  4YNQ A;  1EX4 A;  1LWE A;  4E0D A;  1VSM A;  4QAG A;  1TL3 A;  4BE1 A;  4CEZ A;  3NF6 A;  4DTN A;  4CED A;  1JLA A;  3IG1 A;  3VQQ A;  1RTD A;  2BAN A;  4FZZ A;  4B9V A;  4FVM A;  5KGX A;  3ASM A;  4MQ3 A;  4CIE A;  3O4Q A;  4KV8 A;  3DI6 A;  3G0Z A;  5KRT A;  3SQ2 A;  3TAP A;  1BCM A;  2BGG A;  4F4K A;  3C95 A;  2HMI A;  3M8S A;  1GOC A;  2YKM A;  1UAX A;  4JS5 A;  3RR7 A;  3AVA A;  4UQG A;  4FJM A;  3NGI A;  1X9W A;  3PO4 A;  4Z4E A;  1ZBH A;  4FJ9 A;  3HPH A;  1J9A A;  3OYN A;  1GOB A;  4RW6 A;  3PX0 A;  4J2D A;  3I8D A;  3MXJ A;  2DFE A;  3VQP A;  1W9H A;  5FDL A;  2QK9 A;  4KB1 A;  2XO7 A;  3DLG A;  3KK3 A;  1TKX A;  1Q9Y A;  4EZ9 A;  4M3U A;  1IO2 A;  1T7P A;  2YNF A;  3CM5 A;  1KFS A;  3ZT3 A;  4ELT A;  1J54 A;  4E89 A;  1WSE A;  1VSE A;  4G1Q A;  1ITG A;  3HVR A;  1XHZ A;  1TK5 A;  1FKP A;  1WSG A;  3M8Q A;  1QSS A;  4B9S A;  1LAW A;  1RBU A;  3CQ8 A;  5CZ2 A;  4RW4 A;  2KQ2 A;  4CJE A;  2YHB A;  4DFP A;  1RT3 A;  2PY5 A;  4FZY A;  4DTJ A;  3SV4 A;  1UWB A;  2HHW A;  5HRN A;  1Z26 A;  3PV8 A;  4FJL A;  4KHQ A;  4M3Z A;  4Z4F A;  4IG0 A;  3OS2 A;  1UA1 A;  1KFD A;  3NF9 A;  1C1A A;  2X74 A;  1SKR A;  4I7F A;  4CJ5 A;  1ZYQ A;  4CHN A;  2G8H A;  1RDD A;  3RMC A;  1MU2 A;  3IRX A;  1FK9 A;  2G8K A;  3HP9 A;  3KTQ A;  4FLT A;  4JS4 A;  2O4I A;  4CK1 A;  3L3V A;  3NGZ A;  1TAU A;  3TAN A;  3LAK A;  3V9U A;  3L2Q A;  4E19 A;  4DQR A;  3EZ5 A;  1WAJ A;  3LP2 A;  1EXQ A;  3NFA A;  1HYV A;  4I9L A;  2D5R A;  3RRH A;  2OZS A;  1IKY A;  3DOL A;  4DU1 A;  4BE0 A;  4PWD A;  1W0H A;  4FM0 A;  1YT3 A;  1A5W A;  1XI1 A;  1D8Y A;  4M3T A;  1RDA A;  3V1R A;  1K6Y A;  1REV A;  2YKN A;  4LH5 A;  3KKS A;  4FXD A;  3QIO A;  3V9S A;  4CGG A;  3F73 A;  4RW7 A;  3HPG A;  4BDZ A;  1B9F A;  2HHQ A;  1DTQ A;  1XWL A;  3DM2 A;  1EET A;  3C6T A;  1O1W A;  3DOK A;  4AIL C;  2A1R A;  1S9E A;  4NCB A;  3NH0 A;  1G15 A;  1L5U A;  1NJW A;  2RN2 A;  1TKT A;  4KAZ A;  4NCG A;  4C8M A;  3QEW A;  3H08 A;  3ZSX A;  5K14 A;  4ZTJ A;  3SZ2 A;  2HB5 A;  2X6S A;  4CGJ A;  1B9D A;  3RRG A;  1RTJ A;  1KVC A;  4F2S A;  4Z4C A;  3OYJ A;  3SUO A;  3VN5 A;  4W5N A;  3ZT1 A;  3L2R A;  5J1E A;  4CHP A;  1NJY A;  2QKK A;  3C6U A;  4E7I A;  2X6N A;  3HL8 A;  1NK5 A;  4CF8 A;  5SWM A;  5JS1 A;  2D0A A;  1N6Q A;  4CJU A;  1TVR A;  4CER A;  4B9U A;  1LWC A;  3KK2 A;  3AO5 A;  4H4O A;  1C0U A;  1RDB A;  4FJG A;  4KI6 A;  3V6D A;  3U3Y A;  4DLG A;  3AVC A;  1U49 A;  1TKZ A;  3WNH A;  1NK7 A;  1I39 A;  3VQ9 A;  1F21 A;  3QEX A;  3RMB A;  4C8L A;  2Y1I A;  4F3O A;  1BCO A;  4EP4 A;  4FLX A;  4BWJ A;  3VQB A;  3VQC A;  1JKH A;  2I5J A;  1ZBU A;  3OYE A;  1WNS A;  3SQ1 A;  3PY8 A;  4E3S A;  1VSL A;  4DU4 A;  1WSF A;  4CJ3 A;  5HRR A;  1BGX T;  3HST B;  3L2W A;  4FYD A;  1JXE A;  4J2A A;  3WNG A;  1RBR A;  4BAC A;  3DMJ A;  2YHA A;  1S1W A;  4CEO A;  1IKV A;  2KW4 A;  4OJR A;  1NJX A;  4KI4 A;  3MEG A;  4CGF A;  2ITG A;  3LP3 A;  2GV9 A;  5DK5 A;  3CYM A;  4GVM A;  3SPZ A;  4KRE A;  5C25 A;  2Q3S A;  4CJT A;  4FJX A;  5FRN A;  4CJQ A;  4M3R A;  4FM2 A;  2HND A;  2JLE A;  3T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...