1VSIA

Asv integrase core domain with ca(ii) cofactor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
146
structure length
145
Chain Sequence
b'GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
total genus 51
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsiA00
1XI1A 2RF2A 1BI4A 4AHUA 4F3OA 4FW2A 1NKCA 4CJPA 4BDPA 1NK4A 1NJXA 3M8SA 3K57A 4LD0A 1SKSA 3MAQA 1W9HA 4FJ8A 4ELUA 2P1JA 3MEGA 1X1PA 4IG3A 3LZJA 4BE2A 4LSLA 1ZBFA 3KK2A 2PYLA 3RR7A 4CK1A 4B9NA 5FDLA 5J1EA 3TAQA 3I0SA 1BQMA 2KZZA 1RTHA 4BWMA 3QESA 2ZE2A 3M8PA 1NK9A 4DSJA 1UAXA 2X6NA 1VSDA 4F8RA 3QNNA 2O4IA 1DLOA 3KIOA 5C25A 3KLIA 3VQ7A 1BHLA 4KB0A 3HK2A 5C42A 2XO7A 4AHSA 4FM1A 1CZ9A 4CEBA 3QEWA 2BDPA 4EZ9A 4M3ZA 2XY7A 3QIPA 3S9HA 2E4LA 2LSNA 2WONA 2HNDA 4HCCA 3SQ4A 1X9WA 4ELTA 1FK9A 3FFIA 4CGHA 1IH7A 3QNOA 3V1QA 1Q9XA 3KLGA 1RDCA 2Z1HA 4CEEA 3DLHA 2RKIA 3LP2A 1S6QA 4CGFA 1NJYA 1RT6A 3L2QA 1D9FA 3HPOA 3OYNA 3HL8A 4AH9A 1U49A 5FRNA 3K59A 2G8IA 3TAGA 1J9AA 4CJVA 1JLQA 4KAZA 2IC3A 2RPIA 2I5JA 4KV8A 1T8EA 1NK0A 4F3TA 1WAJA 1RTIA 4HHTA 1LWCA 5CY4A 4XIUA 4CECA 3ZT0A 5KGWA 4CFCA 1TAUA 3TANA 2YKMA 1HQEA 1BIZA 3KTQA 3KLEA 4K8ZA 5D3GA 1QQCA 1QSSA 2NUBA 4CIFA 4KHWA 4K8XA 4ELVA 2ETJA 2G8KA 2QXFA 1RBTA 4OKKA 3BGRA 4AILC 4CGDA 4IBNA 4YNQA 4KKOA 5HRPA 3C95A 4KTWA 4E7JA 1WNSA 1KLNA 1I3AA 3MEDA 3NFAA 1JLAA 1U48A 4KRFA 1JKHA 3CM5A 4E0DA 1C0UA 3LPUA 3LP3A 3ISNC 4CK2A 2HMIA 4BE0A 3K5NA 4O44A 3KD1E 3DLBA 2OZSA 4DFKA 1C1CA 4M41A 4C8NA 1HMVA 3P5JA 5HBMA 1A5VA 4DQSA 3HP6A 3AVAA 4H4OA 4FLXA 2HHVA 1B9FA 3IAYA 2KQ2A 2KW4A 5DMRA 4BACA 3V9ZA 4JS4A 3OJSA 1WSIA 3PX6A 4J2AA 2R7YA 4E3SA 2X78A 2EHGA 4OKEA 5JS1A 2QK9A 3PV8A 3OYAA 1EX4A 1ZBHA 2X74A 1S9GA 4FJMA 4O0IA 3PO4A 2HB5A 5HRRA 4CJ4A 3T3FA 2D0BA 1C0TA 3LALA 3AVGA 4LH4A 4YFUA 3NCIA 3LZIA 3RRHA 2BANA 3TABA 1KFSA 1D8YA 3K2PA 1RBSA 1RBUA 3LDSA 2G8WA 1A5WA 3DMJA 2PYJA 4DF4A 3RMBA 1WSHA 3C6TA 4JLHA 1U45A 2HNYA 4CEZA 1JL1A 4CFAA 5KTQA 2YKNA 3AVIA 3L3VA 4H4MA 1WSJA 3OS0A 3OYJA 4MQ3A 4UQGA 4N76A 2HHUA 2E6MA 1TGOA 1LAVA 4W5QA 4J2EA 1VSJA 4RG8A 3B6PA 4E19A 4DLGA 3P1GA 1YVUA 4CJLA 3OYHA 3HVRA 1LWEA 1VSFA 1VRTA 2VG7A 1TK0A 3G0ZA 3HP9A 4O0JA 4NYNA 4NYFA 1C6VA 3VQDA 3OYFA 1SL0A 1NK6A 3MEEA 4E7IA 2G8UA 1RDBA 4KHSA 4JRQA 2XHBA 2PZSA 3JSMA 4G1QA 4CEFA 1NK5A 2WOMA 4IDKA 1XHZA 5SZTA 3V9WA 2VG6A 1SL2A 3TAFA 2D0AA 1EP4A 1C0MA 4F2RA 4DTXA 1G15A 3THVA 1R0AA 4CJ5A 3V9SA 2KZMA 3VQ9A 2OPPA 3K5MA 3L8BA 1KTQA 3LWMA 2JLEA 3S3NA 3MXMA 1D9DA 2HVIA 4FZZA 1A5XA 4NCBA 4W5OA 1HNVA 1NOZA 3QINA 3L2WA 4Z4CA 4OLAA 1IKVA 4KI6A 4N56A 1JLGA 3MXIA 1NKBA 1VSHA 3HVTA 3MXJA 4CHZA 3AVBA 4CFBA 4B3OA 4DTOA 1RBRA 1KRPA 3VQCA 4GMJB 3QETA 4FLWA 1JLEA 2IAJA 4MFBA 3ZCMA 3NGIA 3AVNA 4CF1A 1HYZA 1RDDA 4EP5A 1VSKA 2IOCA 1N5YA 4CHYA 2DFHA 3AO4A 3DOLA 3QERA 3MECA 3HPHA 1QSYA 2VWJA 3RTVA 4DQRA 3VQ4A 1U47A 4RW4A 1WAFA 3ALYA 2W42A 3KKRA 4CHPA 3I0RA 4DQQA 4FVMA 3VQQA 3QEIA 1S1WA 1BQNA 1MU2A 1HQUA 3QEXA 1KVAA 3JYTA 3OYLA 1B9DA 3QEPA 4QOZB 1S9EA 1JLFA 2KFNA 1T03A 5KGXA 3V4IA 3VQEA 1T7PA 4W5NA 4I9QA 4KHQA 3ULDA 3AVFA 4PWDA 1HJRA 3SQ0A 4N5SA 1NK7A 4CJUA 1REVA 3I8DA 2VWKA 4DTSA 2JGUA 4DTNA 1UA1A 2B6AA 4KO0A 4Z0UA 3QO9A 5J2PA 4QAGA 3CFRA 4DU3A 4Q0BA 1JL2A 2Y1IA 4J2DA 1TKZA 4CJKA 3AVLA 4OGCA 4FCYA 4OGEA 3V9UA 4FK4A 4FXDA 2GUIA 3RMDA 3TI0A 1S5JA 3OYMA 3OYKA 1N6QA 3VQPA 3SQ2A 4DTPA 1B92A 4DF8A 1Z26A 1TL1A 4RW7A 4CJRA 1IKXA 1VSEA 2E6LA 3RMAA 3S3MA 1SKRA 3ZSRA 4AHTA 4FW1A 3HT3A 2YHAA 4B08A 1Y97A 3OJUA 4LSNA 4BDYA 4DTMA 3O3GA 1NJWA 1TK5A 1RT4A 4N47A 2G8HA 3PUFA 4WE1A 3CFOA 1RDAA 4FYDA 2F96A 4E1MA 3KJVA 4FLZA 2BE2A 3LAMA 4FJIA 1S1UA 1VRUA 4M45A 4QCLA 4CHQA 2ZD1A 3NBPA 2B4JA 3NH1A 1BL3A 1C1AA 4DFPA 1HNIA 3DI6A 3IRXA 5KI6A 2A1SA 4M3UA 5HRNA 3ZSXA 2B5JA 1KVBA 1UA0A 4KREA 3ASMA 4DFMA 3AA4A 2XY6A 4BDZA 1JLCA 1U4BA 4DSIA 3L2VA 3VQ5A 4CF9A 1ITGA 1WSFA 3OYDA 3QIOA 3VQ6A 4KTZA 3V9XA 2P51A 3NF8A 3PY8A 4RW6A 3DLGA 1XC9A 4L8RB 1JXEA 4CEOA 4HTUA 3TR8A 3M8RA 1GOAA 3ZSZA 2Y1JA 3LP1A 5HP1A 4KPYA 2OPQA 3AVHA 3LP0A 4CJWA 1EETA 1RT7A 2EX3A 1U04A 4EP4A 3SJJA 4HUEA 4DFJA 2FBYA 4EZ6A 2D5RA 4ZTFA 4FJGA 4DSKA 4FJHA 4Z4IA 3V1RA 1BISA 4RW8A 3EY1A 4J2BA 4Z4EA 5DK5A 3LANA 1RCHA 4KTQA 4FJJA 3AVCA 1VSIA 5KRSA 2XRIA 3EYZA 1LW2A 4E7LA 2PY5A 3F9KA 3IG1A 3E01A 4FM2A 1ASVA 5J2QA 1L5UA 1FKOA 4H8KA 2QKBA 3TWHA 4ID1A 4DMNA 1VSMA 4E1NA 3VA0A 1QSLA 4B9SA 4KHYA 3C94A 4W5TA 1J54A 1XWLA 4JRPA 3RWUA 2F8TA 1ZYQA 1WSGA 4FJKA 3ZT3A 1NKEA 4Y1CA 5CYMA 5E41A 3G10A 1GOCA 3SI6A 1ZBUA 4RW9A 3OYCA 5CZ1A 4FJLA 3H08A 4N41A 4CJTA 4DSEA 3C6UA 3TAPA 3KLHA 1J5OA 3VQAA 1K6YA 4DU4A 1DTTA 4OPKA 1UWBA 3O4QA 2FBVA 3K5LA 2ITGA 3KD5E 3P83D 3WNHA 4Z4HA 3DRPA 3NE6A 4AHCA 3OYEA 3O3HA 1VK0A 2YNFA 1QTMA 3VA3A 3BDPA 4DU1A 4CJSA 1LW0A 3DYAA 4BWJA 3SUPA 4FK0A 4CJFA 3PX0A 3VQ8A 1ZBIA 4M3TA 1BGXT 4I7FA 2KFZA 2DY4A 4FJ9A 4CF2A 1S1XA 1YTAA 1CLQA 4CJEA 2DFFA 3CM6A 1RT5A 3L2RA 2AJQA 4CJ3A 3DLEA 4HUGA 3SPYA 5EU7A 3LAKA 1Z25A 3HXMA 2IDOA 2A1RA 1X9SA 4DQIA 4NCAA 3OS2A 1FKPA 1F21A 5JS2A 4CHOA 4FJNA 4R5PA 4PQUA 1RILA 3VQBA 4DTRA 4FLYA 4M3YA 3WNGA 2YV0X 2YNHA 1ASWA 3AO5A 4DG1A 5CZ2A 2IS3A 3NAEA 2HHWA 4B9TA 2ZQBA 3F73A 5FROA 4HCBA 3LWLA 2ATQA 4FJXA 2OPSA 3OVNA 3ITHA 3VN5A 4LY7A 3KLFA 2X6SA 4CGGA 4AHVA 1FXXA 1S1TA 5K14A 1GOBA 3D0PA 1RBVA 5I42A 3UIQA 4HVJA 2P5GA 1CZBA 3B6OA 2Z1IA 4PA1A 1EXQA 2DFEA 4BE1A 4DSLA 5C24A 2D0CA 4M3WA 2HHTA 1C1BA 1TAQA 4B9UA 2OYQA 3SYZA 2FBXA 3AVKA 3KKSA 4OPJA 1IKWA 2XY8A 1XHXA 4DS5A 3V6DA 1NJZA 4FK2A 2VG5A 2DTUA 4FJ5A 1VSLA 3U3GA 5T7BA 1WLJA 3KK1A 3ZSVA 2Z1GA 3S3OA 3PO5A 3U6FA 4DS4A 1IKYA 4CESA 1IO2A 1BCOA 2RN2A 2G8VA 1TL3A 4F2SA 1J53A 1KFDA 3AA2A 4FZXC 2YNIA 3SCXA 4CIEA 3LPTA 4DTUA 1IG9A 1CXQA 1NK8A 5HLFA 2OZMA 1QHTA 3NGZA 3NH0A 5HROA 3ZSOA 3DRSA 3NF9A 4B8AB 3OY9A 3U3YA 4M3XA 1D5AA 1WN7A 3HPGA 2P5OA 4CEQA 4GW6A 4KFBA 4O4GA 4FLTA 1KSPA 3EZ5A 3NH2A 1YTUA 4KHUA 3DLRA 4DSFA 1L3UA 1TKTA 3O3FA 4JS5A 3NF7A 3DOKA 1DTQA 1I39A 3ZSQA 4M3RA 4Y1DA 2O4GA 4CF0A 4I2PA 4OKJA 3TARA 4CGIA 2IGIA 1SUQA 3AVMA 4O55A 3HM9A 3NF6A 2G8FA 3SQ1A 2HHSA 1TVRA 3DM2A 3T1AA 1EKEA 1TK8A 1SKWA 4KB1A 1CXUA 3PX4A 2HW3A 3OS1A 4KI4A 5I3UA 3ZT1A 4OJRA 4ZTJA 4NCGA 1W0HA 4DQPA 4DWIA 2GBZA 4I9LA 2FC0A 4PY5A 3RR8A 4Z4FA 1WSEA 3OYBA 4FLVA 1BCMA 3SUNA 1RTDA 3CQ8A 1QS4A 4HUFA 3RMCA 2XY5A 4B9MA 1L3VA 1ZBLA 4DLEA 4FJ7A 3K5OA 3CYMA 3NHGA 4B9LA 4B9VA 4CF8A 4ZHRA 1LAWA 1KCFA 1NOYA 4OLBA 3HJFA 3M8QA 3K58A 3NGYA 4CK3A 5SWMA 1L3SA 3NDKA 1S1VA 1YT3A 2FBTA 4IFYA 4CEDA 1SV5A 1Q9YA 4IKFA 3SV4A 1O1WA 3ZT2A 1HYVA 3SUQA 1QE1A 4CHNA 2KTQA 3DRRA 4CJQA 2HNZA 5HRSA 5J2NA 4IG0A 4W5RA 3RRGA 4FM0A 3O4NA 4IFVA 3HYFA 3QLHA 3AA5X 1HPZA 3HSTB 1L3TA 2GV9A 3T19A 4E7HA 4LH5A 4FLUA 2Q3SA 4Z4GA 4E89A 3AO1A 3AO3A 3WNFA 1S6PA 4KHNA 1BIUA 4C8MA 3V1OA 4ID5A 3L2UA 4CEAA 3KK3A 3V81A 1RT2A 1TV6A 3AVJA 2BGGA 2QKKA 4Q5VA 3HO1A 1LWFA 4CFDA 2YHBA 1TKDA 2YNGA 4CE9A 1HRHA 4TSXA 2Z1JA 1SL1A 5J2MA 2HHXA 3SZ2A 4E7KA 3AA3A 4O5BA 2HVHA 1ASUA 4AHRA 5KRTA 3CFPA 3SUOA 4CGJA 2HHQA 3D45A 1LV5A 4C8LA 4CCHA 4FZYA 1JLBA 3QEVA 5FRMA 3TAMA 3DLKA 3ZT4A 3SNNA 3SV3A 3AV9A 1KVCA 1Q8IA 2OPRA 3ZSWA 4B8CA 1TKXA 5CYQA 4F4KA 2F8SA 1RT3A 3L3UA 4OVLA 1UOCA 3ZSYA 3OYGA 3A2FA 4C8OA 1KLMA 4CIGA 3WNEA 3SPZA 1BI4B 1X9MA 1RNHA 3IS9A 3TAEA 4M42A 3CG7A 3AO2A 2OA8A 4GVMA 1HYSA 4CERA 1T05A 1JXBA 1RTJA 4I2QA 4ICLA 4DTJA 1RT1A 4PUOA 3OYIA 4C8KA
chains in the Genus database with same CATH superfamily
4F3OA 4AHUA 4QS7A 4WF9L 4DB3A 3K57A 4FJ8A 1X1PA 1ZBFA 2QWMA 4B9NA 4IO8A 1XMOK 1SS6A 3HBTA 2KZZA 4JI8K 3O6WA 4I6MB 5I9EB 4A2BA 3J81O 1VSDA 4F8RA 1HNWK 3VQ7A 4B3RK 4KB0A 2GTDA 4FM1A 3QEWA 3QIPA 2E4LA 4CZFA 4HCCA 3SQ4A 3FFIA 1VQON 5GAHP 1RFQA 3KLGA 3DLHA 2AA4A 2RKIA 1NJYA 4RWTA 1D9FA 3ZX2A 2WC9A 1U49A 3DXKB 2RHKA 2RPIA 1T8EA 5KGWA 4BRIA 4QS9A 3TANA 3ZEUA 4NLBA 4FWSA 4A62A 1QQCA 2NUBA 1GLJO 3DAWA 2ZJPL 2G8KA 2QXFA 1RBTA 4AILC 4IBNA 1K73O 4CVNE 2Q31A 3MWTA 5HRPA 5GIOA 3C95A 4E7JA 1KLNA 3LPUA 4YOVA 2HMIA 3K5NA 4C8NA 5HBMA 3HP6A 2HHVA 1OVQA 3IKMA 3IAYA 1P8ZA 2KQ2A 1XUPO 3TSPA 3PX6A 4E3SA 3FE1A 4OKEA 3OYAA 4FJMA 4O0IA 2HB5A 3AVGA 5M1OA 3VERA 3WEEA 1RBSA 1RBUA 2G8WA 3DMJA 2W41A 2V7ZA 1U45A 2HNYA 4CEZA 1JL1A 3D2FB 4CFAA 3L3VA 4H4MA 2A3ZA 4GNIA 4CZEA 1C0GA 4N76A 4NB4A 1LAVA 4W5QA 1VSJA 3EKSA 4DLGA 3OYHA 4DV0K 3HVRA 1LWEA 1VSFA 3MN9A 1TK0A 3HP9A 2NRZA 2ZF5O 4FWQA 2I7PA 1JCFA 2J4RA 4MDAA 3VQDA 3MEEA 1RDBA 3FLCO 1SL2A 4KH5A 4DTXA 3THVA 1R0AA 3O9SA 3VESA 3V9SA 1S72N 2P9KA 4BG8A 3QBWA 3K5MA 4B9QA 4WFBL 5EY4A 5BPNA 2HVIA 3VEZA 1ZC6A 1JCEA 3BY5A 4FZZA 1Q7YO 4W5OA 2P9SB 1HNVA 3O4WA 4H0OA 4Z4CA 4KI6A 1JLGA 1NKBA 3AVBA 4CFBA 1MWKA 4GMJB 4JI0K 3RSEA 4MFBA 5JICA 4CF1A 1NGIA 1VSKA 3OBYA 3GL1A 2IOCA 4JD2B 1N5YA 3HI0A 3HSCA 1QSYA 5CR4A 3T1YK 4DQRA 4ILHA 4GKJK 4CHPA 3I0RA 4CZKA 5AQHA 1MU2A 2HMPA 3ATUA 4FPAA 3ZX3A 3OYLA 1B9DA 4QOZB 1N33K 1S9EA 5KGXA 3V4IA 1T7PA 3SAHA 5DM6L 4KHQA 4I6MA 5AZJA 3AVFA 3UKRA 2JGUA 5J2PA 4DU3A 5BRDA 2JWKA 3C0BA 1TKZA 3V9UA 4OGEA 2DPNA 3RMDA 3OYKA 1N6QA 3ULEB 1B92A 3TSUA 4DF8A 3HOTA 3O9UA 2E6LA 3CJ7A 4AHTA 2Q0RA 4MDBA 3VPZA 4B08A 1VHXA 4BDYA 3G6EN 3TPQA 1RT4A 4DUZK 1I94K 4FLZA 4M45A 1IV0A 3D6RA 5AQTA 1HNIA 2OANA 5B8HA 2XY6A 3L2VA 4B1XB 1ITGA 5KQ8A 4IEIA 3VQ6A 3V9XA 4ILJA 4IXCA 5AQFA 4L8RB 3VEVA 1NGJA 3LP0A 1KXPA 3I8BA 5M1KA 1RT7A 2EX3A 1U04A 3WQTA 2NZTA 2FBYA 4PL8A 4Z4EA 4RW8A 2KLAA 2P9UA 4H5RA 3LANA 4KTQA 4WQ4C 5AQJA 2XRIA 3IG1A 3E01A 4FM2A 1L5UA 3J7AP 2QKBA 2YJFA 4B9SA 1QSLA 4KHYA 4W5TA 1XWLA 3RWUA 1ZYQA 3ZT3A 4Y1CA 5E41A 2HHXA 4E1JA 3VF6A 4RW9A 1N8RO 3TAPA 5ADXA 4DU4A 3OBWA 4IOCL 3O4QA 3MX5A 3H1VX 3O80A 4BGBA 3P83D 1N36K 1BU6O 2ZGZA 1NWKA 2YNFA 1QTMA 3VA3A 4DHYA 4M3TA 2D4WA 2KFZA 4I7FA 2F4VK 4FJ9A 4CF2A 4BC2A 2FF3B 4A61A 2AJQA 3DLEA 2A1RA 3OS2A 4CHOA 1F21A 5BRHA 4JAXA 4JKEA 4DTRA 1T44A 2UXDK 1P90A 2IS3A 4DQ8A 4B9TA 3F73A 3RVCA 3KLFA 2HOEA 2P9NB 3D0PA 4NO7A 4YOYA 4QCLA 4M3WA 1EXQA 3AAQA 5LJVA 2FLOA 4CBUA 1TAQA 2VGMA 2OYQA 4DCHA 5FPEA 3ID6A 4CBWA 3CCEN 1XHXA 1D4XA 3V6DA 1NJZA 2VG5A 1VSLA 3H6EA 5FPDA 3ZSVA 3PO5A 3S3OA 3U6FA 1NMNA 1IKYA 2RN2A 4F2SA 2CH5A 1J53A 1KFDA 3AA2A 2YNIA 2HF3A 5GADP 2P9IB 1NK8A 2OZMA 3E9PA 3NGZA 4MLHA 3VGKA 4B8AB 3DRSA 3U3YA 2E20A 4O4GA 2QTDA 4FLTA 1NGCA 3DJCA 4B1YB 4UY8O 4OKJA 4R79A 2IGIA 1SUQA 3HM9A 3DM2A 1VQ7N 2HW3A 4KI4A 3BF3A 4OJRA 1EWQA 1W0HA 3CPWM 2GBZA 1YF5L 1WSEA 3O1WA 3OYBA 2JWLA 5AQUA 3CQ8A 1VQKN 4H5TA 1ZBLA 1L3VA 4PKIA 1NOYA 3M8QA 3O8MA 5SWMA 2FBTA 2W6LA 3SV4A 4CD1A 1QE1A 2BTFA 5J2NA 3QICA 3O4NA 4K43A 1HPZA 4BRHA 5FLXO 1KC8O 4Z4GA 2UUBK 3AO1A 4G9ZA 4LC9B 2Q0UA 3V1OA 3CI5A 4ID5A 5C15A 3KK3A 4CW7B 3IFRA 2H3GX 3F9MA 4DV5K 3DLLL 4B1UB 3CCVN 4GY2B 1KD1O 5LMUK 1DEJA 2HVHA 1ASUA 4AHRA 2V51B 4XH1A 4CGJA 2O8BA 3QEVA 5EOYA 5FRMA 5E84A 3ZT4A 5AFUA 2P9LB 3ZSWA 3L3UA 3R9PA 3A2FA 4CIGA 4JI1K 3IS9A 4M42A 5AQKA 3KHYA 4M63C 3T69A 2AP1A 4BRFA 4DTJA 2V7YA 2UXCK 3ZLJA 1NKCA 1QQMA 4BDPA 1NK4A 1NJXA 3JXUA 4LD0A 1SKSA 2FSKA 1W9HA 3C6HA 3MEGA 4IG3A 4BE2A 3LZJA 1K8AO 3RR7A 1GLEG 2QWPA 3I0SA 4C1NI 5AQMA 1BQMA 4AM7A 1RTHA 3P38A 1E3MA 3KZBA 3M8PA 5IT9O 5C10A 3LL3A 1UAXA 1FW6A 3NVKA 1NGGA 3KIOA 1M90O 1NGHA 5AQQA 2XO7A 1Q18A 2BDPA 2XY7A 3EO3A 3S9HA 2LSNA 4ELTA 1ATNA 2Z1HA 3LP2A 3PIOL 3HL8A 3UKUA 4BRAA 3VENA 4KAZA 2IC3A 1N34K 4KV8A 1MWMA 1NK0A 5CY4A 4XIUA 3R1XA 4CECA 2NNWA 1TAUA 2YKMA 1BIZA 3KTQA 3KLEA 4K8ZA 5D3GA 4JK8A 1TUUA 3P31A 4ELVA 2ETJA 4JKGA 1V4TA 5EXWA 3PSFA 4KKOA 4JI2K 2ZWHA 2NRWA 3M5RA 3LP3A 4JKBA 2WFBA 4O44A 4B1ZA 1C1CA 1HMVA 1BO5O 4HTLA 3AVAA 1B9FA 1W97L 3V9ZA 3WEEB 2R7YA 2EHGA 5JS1A 1EX4A 2X74A 3PO4A 4K0KK 4CJ4A 3T3FA 3CHWA 4IJNA 4MO4A 1C0TA 3LALA 4YFUA 3RRHA 1IBLK 4CZMA 3ENOA 5AQLA 3RMBA 1Z6RA 4FL9A 3O08A 4K25A 5KTQA 5DM7L 4BRNA 1NLVA 3OYJA 2HHUA 3B6PA 4WCEL 4WQ4A 2VG7A 3AGKA 3MN6A 3TSQA 4LFAK 4FXDA 2G8UA 4BRMA 1SL0A 2P9KB 3GBTA 3CJ9A 2HHHK 2PAVA 3JSMA 2NLXA 2WOMA 4IDKA 5HL7L 2VG6A 2E1YA 1BOTO 5LJWA 4F9OA 2KZMA 4CJ5A 2OPPA 5F2RA 2JLEA 1D9DA 3MXMA 4OPHA 4OO1J 1YVNA 3RSEB 4JK9A 1A5XA 4B3TK 4OLAA 1IKVA 3MXIA 2QM1A 1VSHA 3HVTA 4CHZA 3SAGA 1RBRA 2NRXA 3VEOA 2IAJA 3FZHA 1HYZA 2A6AA 4YOTA 3AO4A 4CHYA 2O8EA 4FWLA 3MX2A 3VQ4A 5AZJB 4DQQA 4FVMA 3T1HK 3UKRB 1BQNA 2E2OA 1Z05A 4BY9C 2KFNA 3QMLA 4BQZA 4I9QA 4O5FA 1NK7A 1SAZA 1EQYA 4DTSA 3I8DA 4ILGB 4KO0A 4M7YA 4DR6K 3GOIA 1JL2A 2ASOA 2Y1IA 1U2VA 4J2DA 1QZ6A 4FK4A 3TI0A 5AQRA 3BZKA 3VQPA 4NLCA 2GUPA 1Z26A 5AQVA 4BRCA 3A5LC 3C7NA 3ZSRA 2YCHA 4YY3K 5MLCQ 4N47A 1YITN 2F96A 3R6MA 2BE2A 3CJCA 5AZIA 1VRUA 3J8AA 5M1QA 1VQ8N 2YI1A 1IG8A 1C1AA 3DI6A 3MWPA 4LF7K 5HRNA 4KREA 3AA4A 3CJAA 1JLCA 2QWLA 4AQYK 1WSFA 3QIOA 3FGUA 2CGLA 4RW6A 5JLHA 4HTUA 2P9UB 3M8RA 1GOAA 5HP1A 3O1BA 2OPQA 3H45C 4JKDA 1EETA 4EP4A 4FJGA 4ZTFA 4Z4IA 4IWVA 2VGNA 3BF1A 3U9ZA 3V1RA 4J2BA 5DK5A 5KRSA 4BRKA 5BPMA 3EYZA 4JN4A 5J2QA 4H8KA 1HUXA 1DGKN 1VSMA 4E1NA 3CCQN 3VA0A 3HM8A 2FSJA 4DR4K 1J54A 4H03B 3SI6A 1ZBUA 4FJLA 3H08A 3C6UA 3KLHA 3C65A 1G99A 4LF4K 4EFHA 2PFUA 5C0YA 4Z4HA 3NE6A 1LW0A 4BWJA 4FK0A 1ZBIA 1GLLO 4MO5A 2DY4A 3AAPA 1S1XA 4BG9A 3EZWA 4BREA 4CJEA 2DFFA 3LDNA 2YJEA 1NGDA 2F7TA 4HUGA 4RCHA 5EX5A 3SPYA 1X9SA 1Z25A 5JS2A 3VGLA 3E66A 1RILA 3HOSA 4FLYA 1N32K 1ASWA 2GWJA 5ADXH 3NAEA 2HHWA 3OVNA 3ITHA 3P39A 5A2QO 1S1TA 4KHPK 5K14A 4HVJA 4IOAL 2Z1IA 3B6OA 4FWMA 3I56N 2DFEA 4BE1A 2HHTA 2VCPA 5BR9A 1C1BA 4B9UA 3THXA 2E8AA 3AVKA 5AR0A 4GV6A 3WT0A 1YI2N 1HJOA 2FSNA 4FJ5A 5JLFA 4NXNK 5T7BA 3KK1A 2W6KA 4K41A 5AQPA 4JI6K 1Q82O 4DS4A 4CESA 1GLAG 2G8VA 1BCOA 3VOVA 3D2EA 5KPZA 4FZXC 1MDUB 4DTUA 4FWOA 4Y0WA 1ILYA 3NF9A 4M3XA 3MN7A 2ZGYA 3I55N 2QWRA 3WXLA 3EZ5A 5BREA 4DSFA 1TKTA 3O3FA 1VQNN 1U6ZA 1I39A 4M3RA 3CIPA 4BVPA 4I2PA 4CGIA 4O55A 1OH6A 3NF6A 4FO0A 3T1AA 5KPTA 1TK8A 4X62K 1NU0A 3OS1A 5I3UA 4DQPA 1HNXK 4XH5A 2FC0A 2YHYA 5CE3A 3O5BA 5M1PA 3SLCA 1E4FT 4IZ9A 4FJ7A 3NHGA 4B9LA 1JJ2M 4B9VA 4CF8A 4OLBA 3HJFA 3K58A 3F5TA 4YOUA 4EIAA 4M7XA 1Q9YA 3GE1A 3ZT2A 1HYVA 2Q1NA 5HRSA 2HNZA 2IVOA 4IG0A 4W5RA 3CF5L 4FM0A 4IFVA 3LDOA 3QLHA 5GAEP 2GV9A 3T19A 4E7HA 1RDWX 4BRQA 2GEMA 3AO3A 3WNFA 5JVHL 5F0XA 4C8MA 4A5AA 1RT2A 3W3DA 3AVJA 1K8KA 2BGGA 2O8BB 2QKKA 4Q5VA 3OW2M 1TKDA 1YHQN 4BR0A 4CCHA 3F2KA 4LF5K 1TYQA 2WUSA 1KVCA 4BR5A 1TKXA 1OVYA 3G4SN 3ZSYA 1UOCA 4CZHA 2ZJRL 1KLMA 3WNEA 5BN8A 3CG7A 3AO2A 1J6ZA 4CERA 2PBDA 4DKWA 4U7BA 4ICLA 3OYIA 4EHUA 4GVEA 4C8KA 1XI1A 2RF2A 3AARA 4FW2A 2HBLA 4RTFD 3G71N 4YORA 3QFUA 3J7ZO 2KKZA 2PYLA 2E88A 5FDLA 5J1EA 3I33A 3IMXA 3LM9A 1NJIO 4OX9K 1VQLN 4FWNA 1NK9A 4DSJA 2X6NA 3QBXA 3QNNA 2O4IA 1KAZA 4AHSA 4EZ9A 4CEBA 3THWA 4M3ZA 1ATSA 3A5OC 3VMFB 3UKUB 1ZXOA 2WONA 1C0FA 4ISFA 1FK9A 4CGHA 1IH7A 3QNOA 3FZFA 1Q9XA 1RDCA 3B8AX 4CEEA 4K8XA 3HPOA 2G8IA 3TAGA 1J9AA 4CJVA 3OTOK 1JLQA 3KVGA 4CZIA 2I5JA 1WAJA 1RTIA 4HHTA 4JKGB 3EN9A 3U9DA 3ZT0A 3CC2N 4CFCA 1QSSA 3A0IX 4KHWA 3VTIA 4OKKA 4YNQA 3CJ1A 2WBNA 3OA9A 3SMSA 4KTWA 4B3MK 2YX6A 1ZBSA 4EAHD 1U48A 4CK2A 5KPRA 4X65K 1QZ5A 4A2AA 1VAZA 3DLBA 4M41A 4HWIA 4IO9L 4H4OA 4H0PA 3CCMN 4J2AA 2X78A 2A5XA 2VQEK 3PV8A 1Y64A 1ZBHA 1YUWA 2HBMA 3ENBA 4IJAA 2HSTA 3NCIA 3LZIA 1YAGA 3BP8A 3ATVA 3TABA 1KFSA 1D8YA 3K2PA 1GLBG 3LDSA 2PYJA 4DV2K 4OPAA 3AVIA 5AQZA 4H5NA 5BR8K 4DV4K 1TGOA 4E19A 3P1GA 1YVUA 3CMAN 1VRTA 4ISEA 2QA4N 4PKHA 2P9PA 1K9MO 4O0JA 4NYNA 3OYFA 1C6VA 4E7IA 3W0LA 3QDKA 1R59O 4JRQA 2XHBA 4DR2K 1NK5A 4CEFA 1XHZA 4IFEA 4H0XB 4BRDA 5SZTA 3V9WA 3TAFA 1EP4A 2UYTA 1G15A 2HBKA 3VQ9A 1VQMN 3L8BA 3S3NA 2D0PA 4NCBA 4BC5A 4EHTA 2O8EB 4B3OA 4DTOA 5LY3A 1KRPA 3QETA 4FLWA 3ZCMA 1GLCG 3NGIA 3CCLN 3AVNA 4EP5A 4CBXA 5AQXA 1T6DA 3QERA 3DOLA 3MECA 3HPHA 2A41A 1NMDA 3RTVA 3SBTA 1WAFA 3ALYA 2W42A 3KKRA 4K42A 3GG4A 3VQQA 3QEIA 1WBBA 1HKCA 1X3NA 4PHTX 3QEPA 2O8FA 4WYBA 3D7EO 1T03A 4H0YB 2O8CA 1U2VB 1NBWA 3ULDA 4H5VA 2ITMA 1HJRA 2VWKA 3O9RA 4Z0UA 4Q0BA 4CD3A 3CFRA 1YIJN 4JKHA 5BRFA 2A42A 2GX9A 3C7NB 3WXJA 4CJKA 3FZMA 4JI5K 4DV7K 1OH5A 2GUIA 2KHOA 3OHRA 3OYMA 3QFPA 4O8KA 3SQ2A 3H1QA 4RW7A 3VEYA 1VSEA 3RMAA 1SKRA 5AZIB 3HT3A 4LF9K 1YJ9N 3OJUA 2IVPA 4A5BA 4DTMA 1WOQA 3O3GA 3VGMA 1NJWA 1TK5A 4LF8K 2G8HA 4BRLA 1YJNN 4FYDA 3LAMA 1S1UA 4GKKK 4PL7A 2ZD1A 2B4JA 1BL3A 4DFPA 2QEXN 3IRXA 1X3MA 4M3UA 3JS6A 3ZSXA 1OKJA 1UA0A 1BG3A 4GV9A 4DFMA 4BDZA 3DXMA 1U4BA 4DSIA 4CF9A 3OYDA 2P51A 3NF8A 4BQLA 3DLGA 1JXEA 3UE5A 3NVMA 3CCSN 3ZSZA 3LP1A 3G25A 4KPYA 4B1VA 3SJHA 3SJJA 4MLEA 4DFJA 3EE9A 4EZ6A 2D5RA 4DSKA 4FJHA 1XC3A 1BISA 3EY1A 2Q97A 3A5MC 1RCHA 4FWRA 1GLDG 1NG9A 1VSIA 2QI2A 3ZYYX 4E7LA 4BR9A 3F9KA 3SBGA 3EE8A 1ASVA 3C6AA 3TWHA 3ZETA 4ID1A 3K9KA 4KH4A 3L0QA 4JRPA 2F8TA 2CH6A 1XNQK 1OH8A 1NGFA 1NKEA 5CYMA 4J2EA 3G10A 1GOCA 4N41A 5AQNA 3VQAA 4DR1K 3R8EA 4OPKA 1UWBA 4JEPA 5AJ3K 2FBVA 2RE2A 3WNHA 3DRPA 2NRRA 4AHCA 2OTJN 3WUHA 4CZLA 3OYEA 3BDPA 4DU1A 4CJSA 3DYAA 4CJFA 2CGKA 5TKWA 3VQ8A 3PX0A 1BGXT 1YTAA 1FJGK 1CLQA 3L2RA 2NRHA 5EU7A 3LAKA 4YOXA 3HXMA 4YOWA 4NCAA 4FJNA 4R5PA 1Q81O 4PQUA 2D1KA 1XMQK 4YDUA 3AO5A 4DG1A 5CZ2A 4DV6K 2ZQBA 4DV1K 4HCBA 2ATQA 3E1YA 2OPSA 3THXB 2X6SA 4CGGA 2Q2RA 5KQDA 1VQ4N 4JHDA 1YXQA 1FXXA 5HOOA 3SK3A 1GOBA 1RBVA 4PA1A 1X9JA 4DSLA 5C24A 1VQPN 3SYZA 3H3OB 3HZ6A 3J7YP 3D2EB 2Z1GA 3M6GA 1IO2A 1TL3A 4FOEA 4CIEA 3LPTA 5TKYA 1IG9A 1QVGM 5HLFA 1QHTA 3NH0A 2WTUA 5HROA 2YHWA 3OY9A 3KK7A 1WN7A 2QWQA 4CEQA 1M1KO 4KFBA 2GELA 3JAMO 1KSPA 5M1FA 4KHUA 1BA1A 3DLRA 1L3UA 4GV3A 4JS5A 2BH1A 1DTQA 4C23A 3ZSQA 4Y1DA 1CZAN 2O4GA 4CF0A 4BVOA 3AVMA 3VETA 1XQSC 5M1NA 3SQ1A 2HHSA 1SKWA 1EKEA 3ZT1A 4ZTJA 4DWIA 4I9LA 2Q36A 4PY5A 4Z4FA 2F9TA 4FWPA 2W40A 1BCMA 3SUNA 1RTDA 4HUFA 3RMCA 3THYA 2XY5A 3K9JA 2GWKA 3K5OA 1LAWA 3LM2A 4V19S 2O8DA 1V4SA 2VYPA 4CK3A 1L3SA 4JI7K 1S1VA 3CQYA 4CEDA 4IFYA 1QVFM 1SV5A 4XEIA 4BR2A 4CHNA 3DRRA 4CJQA 3S41A 1T3VA 3VTHA 1K8KB 1L3TA 3L6QA 4JNEA 5FPNA 4LH5A 4CI6A 2OTLN 1TV6A 5JVGL 1RDUA 1ESVA 3HO1A 4CFDA 1RGIA 1TYQB 2YNGA 4CE9A 3TTDA 1HRHA 3FFKB 3SZ2A 3AA3A 3CPEA 3VEXA 5KRTA 1TUYA 2HHQA 3NMUA 3WQUA 4C8LA 4KH6A 4FZYA 4KBOA 5AQIA 3TAMA 4X64K 1Q8IA 4F4KA 5CYQA 1RT3A 4OVLA 4C8OA 1X9MA 5IWAK 3TAEA 2OA8A 1HYSA 3PSIA 4I2QA 5AQSA 3CETA 1IBKK 3CJBA 1VQ5N 1BI4A 3QB0A 3TU5A 4CJPA 3M8SA 1ATRA 3FR0A 3BUZB 5E26A 4QS8A 3MAQA 4ELUA 2P1JA 4LSLA 3KK2A 4CK1A 2OCEA 1WB9A 3TAQA 3THWB 2HBJA 4BWMA 3QESA 2ZE2A 1DLOA 5C25A 3KLIA 1BHLA 3HK2A 5C42A 4BC4A 1CZ9A 4JI4K 3ZX0A 1HKBA 2HNDA 1X9WA 2UUAK 3V1QA 4ISGA 5GIPA 3CQXA 4CGFA 1S6QA 1RT6A 3L2QA 5FRNA 3OYNA 4AH9A 1NGEA 3K59A 3T7ZA 3WXMB 4F3TA 3MCPA 1LWCA 3EKUA 4FWKA 2NRVA 4WFAL 1HQEA 3PIPL 1VQ9N 4CZGA 5LL6Z 1XNRK 3CXCM 3DXKA 5AQOA 4CIFA 3BEXA 4J8FA 1NNEA 3BGRA 4CGDA 4C1NK 2D0OA 1NGBA 3O9QA 4L3QA 1WNSA 1I3AA 3MEDA 3NFAA 1JLAA 4KRFA 1JKHA 3CM5A 5BN9A 1C0UA 4E0DA 3ISNC 5ELZA 3WXIA 4BE0A 3KD1E 2OZSA 4LFBK 4DFKA 2ZM6K 3P5JA 1A5VA 4DQSA 4FLXA 2KW4A 5DMRA 4BACA 1EO1A 4JS4A 3OJSA 1WSIA 3AGRA 2QK9A 1S9GA 3IDHA 3N4PA 1BUPA 2QWOA 2V52B 5HRRA 4A57A 1BDGA 2D0BA 4LH4A 3A8YA 2BANA 2ZJQL 1A5WA 3U8XA 4DF4A 1QHAA 1WSHA 3C6TA 4JLHA 2YKNA 2P9PB 1WSJA 1DKGD 3OS0A 4MQ3A 4UQGA 1HPMA 2E6MA 3EL2A 4RG8A 1S22A 4CJLA 4AM6A 3KWIA 3P4IA 3D2FA 4YHHK 3G0ZA 4NYFA 1NK6A 4XH4A 4KHSA 3CD6N 4H0VB 4AF1A 2PZSA 4G1QA 4YDUC 4F2RA 2D0AA 1C0MA 3U4LA 1S3XA 1IBMK 1KTQA 3LWMA 4LFCK 5JMVA 2FXUA 3QINA 1NOZA 3L2WA 4N56A 4JV5K 3MXJA 4BRPA 3VQCA 4NXMK 1JLEA 3AY9A 1HKGA 4WQ5A 1KQSM 1RDDA 3VF2A 2P9SA 5GINA 2DFHA 4PKGA 3H46O 2O8FB 2VWJA 1E4GT 2O8CB 1U47A 4RW4A 5AFUH 4A59A 1S1WA 4JD2A 1HQUA 3QEXA 1KVAA 3JYTA 1JLFA 1HX1A 3VQEA 4W5NA 1HR0K 4PWDA 3SQ0A 4N5SA 4BROA 4CJUA 1REVA 4DTNA 1UA1A 2HF4A 2B6AA 1BA0A 3QO9A 4QAGA 3AVLA 4OGCA 4FCYA 3BZCA 2EWSA 5C2FA 1S5JA 4DR3K 3TTFA 4DTPA 1MA9B 1TL1A 4DR5K 4CJRA 1IKXA 4CZJA 3LDQA 3S3MA 1WUAA 4FW1A 3SMPA 2YHAA 1Y97A 4LSNA 3ULEA 3PUFA 4WE1A 3CFOA 1RDAA 4FJIA 4E1MA 3KJVA 1VQ6N 1NGAA 3DXMB 3MDQA 4CHQA 3NBPA 3PLAA 4Z94A 3NH1A 3CC7N 5KI6A 2A1SA 2IVNA 3HTVA 2B5JA 1KVBA 2VWBA 3ASMA 3LDPA 3VQ5A 3MN5A 2UXBK 3UB5A 5LMNK 4KTZA 3PY8A 4CJ7A 1XC9A 4CEOA 3TR8A 2Y1JA 2YHXA 3AVHA 4CJWA 3Q7CA 5FPMA 1GLFO 4HUEA 3TTCA 5BPLA 3ZETB 1H1VA 4FVUA 1QQNA 4JK7A 4FJJA 3AVCA 2PY5A 1LW2A 1FKOA 1T6CA 4JKFA 3FZKA 4DMNA 4JYAK 3C94A 5GAGP 2UUCK 1WSGA 4FJKA 3J80O 3OYCA 2QW9A 5CZ1A 4CJTA 4DSEA 1J5OA 1K6YA 1DTTA 2E2NA 3K5LA 2ITGA 4H0TB 3KD5E 1JCGA 3K0SA 3ENHA 3O3HA 1VK0A 3L4IA 2VQFK 3SUPA 3MCAB 3MK6A 4DR7K 3CERA 1O13A 1KAXA 3L4QA 4BR7A 3CM6A 1RT5A 4CJ3A 4DUYK 3O9TA 4FOIA 2IDOA 4DQIA 1FKPA 1HNZK 3VQBA 4M3YA 3WNGA 2YV0X 2YNHA 4JHDB 3CCJN 5FROA 3LWLA 4FJXA 3VN5A 4LY7A 5AQWA 4AHVA 5I42A 3UIQA 2P5GA 1CZBA 2IIRA 2D0CA 1SZ2A 2FBXA 4X66K 4BR4A 2E2PA 2P9NA 1NM1A 5EVZA 3KKSA 4OPJA 1IKWA 2XY8A 4DS5A 4FK2A 2DTUA 3U3GA 1WLJA 2CGJA 5F1XA 3EEQA 3IUCA 5AQGA 3HRGA 2ASMA 3SCXA 1CXQA 4BRGA 2I7NA 1KAYA 4LF6K 2QXLA 3ZSOA 3ZEUB 4IOXA 1D5AA 3HPGA 4B1WB 2P5OA 3CCRN 4GW6A 2P9IA 3VF4A 2E5LK 3NH2A 1YTUA 3DWLA 1OH7A 3NF7A 3DOKA 3Q7BA 1LCUA 3TARA 2F9WA 4B3SK 2G8FA 1TVRA 4U67L 4KB1A 3THYB 1CXUA 3PX4A 1BWFO 4NCGA 4JKAA 3N4QA 3RR8A 2O8DB 4FSVA 4FLVA 3M3ZA 4JI3K 4B9MA 1QS4A 3MMVA 1DT9A 4DLEA 2BUPA 3CYMA 1SQKA 4ZHRA 3CCUN 1KCFA 1WBDA 3NGYA 4IEEA 3NDKA 1YT3A 4IKFA 1QQOA 2E2QA 1O1WA 3SUQA 3KWGA 1IJJA 1LOTB 4WFNL 3RRGA 2KTQA 3M1FA 2QWNA 2ASPA 3SAFA 3CC4N 1J5EK 3HYFA 3AA5X 3HSTB 1W7AA 3LDLA 1YJWN 3R3LA 4FLUA 2Q3SA 4E89A 4BGAA 1S6PA 3E9LA 4KHNA 1BIUA 3H3NO 3L2UA 4CEAA 1HLUA 3V81A 1W2BM 4FPBA 2FF6A 5C12A 4IDHA 1LWFA 2YHBA 4DV3K 1EWRA 4TSXA 2E1ZA 2Z1JA 1SL1A 5H1SQ 5J2MA 5CHIA 3E9OA 5C2DA 4E7KA 4O5BA 2UU9K 3CFPA 3SUOA 3ID8A 3D45A 1LV5A 3VEWA 4WQ5C 5AQYA 1JLBA 3DLKA 2NRTA 3SV3A 3SNNA 3AV9A 3FZLA 4B8CA 2OPRA 1Q86O 3GDQA 2F8SA 3WXKA 3OYGA 2A40A 3SPZA 1BI4B 1RNHA 4BC3A 4GVMA 4O8UA 1T05A 2P9LA 1JXBA 1RTJA 3CMEN 1RT1A 4H5WA 4JKCA 4PUOA 3A5NC
chains in the Genus database with same CATH topology
1XI1A 2RF2A 1BI4A 4AHUA 4F3OA 4FW2A 1NKCA 4CJPA 4BDPA 1NK4A 1NJXA 3M8SA 3K57A 4LD0A 1SKSA 3MAQA 1W9HA 4FJ8A 4ELUA 2P1JA 3MEGA 1X1PA 4IG3A 3LZJA 4BE2A 4LSLA 1ZBFA 3KK2A 2PYLA 3RR7A 4CK1A 4B9NA 5FDLA 5J1EA 3TAQA 3I0SA 1BQMA 2KZZA 1RTHA 4BWMA 3QESA 2ZE2A 3M8PA 1NK9A 4DSJA 1UAXA 2X6NA 1VSDA 4F8RA 3QNNA 2O4IA 1DLOA 3KIOA 5C25A 3KLIA 3VQ7A 1BHLA 4KB0A 3HK2A 5C42A 2XO7A 4AHSA 4FM1A 1CZ9A 4CEBA 3QEWA 2BDPA 4EZ9A 4M3ZA 2XY7A 3QIPA 3S9HA 2E4LA 2LSNA 2WONA 2HNDA 4HCCA 3SQ4A 1X9WA 4ELTA 1FK9A 3FFIA 4CGHA 1IH7A 3QNOA 3V1QA 1Q9XA 3KLGA 1RDCA 2Z1HA 4CEEA 3DLHA 2RKIA 3LP2A 1S6QA 4CGFA 1NJYA 1RT6A 3L2QA 1D9FA 3HPOA 3OYNA 3HL8A 4AH9A 1U49A 5FRNA 3K59A 2G8IA 3TAGA 1J9AA 4CJVA 1JLQA 4KAZA 2IC3A 2RPIA 2I5JA 4KV8A 1T8EA 1NK0A 4F3TA 1WAJA 1RTIA 4HHTA 1LWCA 5CY4A 4XIUA 4CECA 3ZT0A 5KGWA 4CFCA 1TAUA 3TANA 2YKMA 1HQEA 1BIZA 3KTQA 3KLEA 4K8ZA 5D3GA 1QQCA 1QSSA 2NUBA 4CIFA 4KHWA 4K8XA 4ELVA 2ETJA 2G8KA 2QXFA 1RBTA 4OKKA 3BGRA 4AILC 4CGDA 4IBNA 4YNQA 4KKOA 5HRPA 3C95A 4KTWA 4E7JA 1WNSA 1KLNA 1I3AA 3MEDA 3NFAA 1JLAA 1U48A 4KRFA 1JKHA 3CM5A 4E0DA 1C0UA 3LPUA 3LP3A 3ISNC 4CK2A 2HMIA 4BE0A 3K5NA 4O44A 3KD1E 3DLBA 2OZSA 4DFKA 1C1CA 4M41A 4C8NA 1HMVA 3P5JA 5HBMA 1A5VA 4DQSA 3HP6A 3AVAA 4H4OA 4FLXA 2HHVA 1B9FA 3IAYA 2KQ2A 2KW4A 5DMRA 4BACA 3V9ZA 4JS4A 3OJSA 1WSIA 3PX6A 4J2AA 2R7YA 4E3SA 2X78A 2EHGA 4OKEA 5JS1A 2QK9A 3PV8A 3OYAA 1EX4A 1ZBHA 2X74A 1S9GA 4FJMA 4O0IA 3PO4A 2HB5A 5HRRA 4CJ4A 3T3FA 2D0BA 1C0TA 3LALA 3AVGA 4LH4A 4YFUA 3NCIA 3LZIA 3RRHA 2BANA 3TABA 1KFSA 1D8YA 3K2PA 1RBSA 1RBUA 3LDSA 2G8WA 1A5WA 3DMJA 2PYJA 4DF4A 3RMBA 1WSHA 3C6TA 4JLHA 1U45A 2HNYA 4CEZA 1JL1A 4CFAA 5KTQA 2YKNA 3AVIA 3L3VA 4H4MA 1WSJA 3OS0A 3OYJA 4MQ3A 4UQGA 4N76A 2HHUA 2E6MA 1TGOA 1LAVA 4W5QA 4J2EA 1VSJA 4RG8A 3B6PA 4E19A 4DLGA 3P1GA 1YVUA 4CJLA 3OYHA 3HVRA 1LWEA 1VSFA 1VRTA 2VG7A 1TK0A 3G0ZA 3HP9A 4O0JA 4NYNA 4NYFA 1C6VA 3VQDA 3OYFA 1SL0A 1NK6A 3MEEA 4E7IA 2G8UA 1RDBA 4KHSA 4JRQA 2XHBA 2PZSA 3JSMA 4G1QA 4CEFA 1NK5A 2WOMA 4IDKA 1XHZA 5SZTA 3V9WA 2VG6A 1SL2A 3TAFA 2D0AA 1EP4A 1C0MA 4F2RA 4DTXA 1G15A 3THVA 1R0AA 4CJ5A 3V9SA 2KZMA 3VQ9A 2OPPA 3K5MA 3L8BA 1KTQA 3LWMA 2JLEA 3S3NA 3MXMA 1D9DA 2HVIA 4FZZA 1A5XA 4NCBA 4W5OA 1HNVA 1NOZA 3QINA 3L2WA 4Z4CA 4OLAA 1IKVA 4KI6A 4N56A 1JLGA 3MXIA 1NKBA 1VSHA 3HVTA 3MXJA 4CHZA 3AVBA 4CFBA 4B3OA 4DTOA 1RBRA 1KRPA 3VQCA 4GMJB 3QETA 4FLWA 1JLEA 2IAJA 4MFBA 3ZCMA 3NGIA 3AVNA 4CF1A 1HYZA 1RDDA 4EP5A 1VSKA 2IOCA 1N5YA 4CHYA 2DFHA 3AO4A 3DOLA 3QERA 3MECA 3HPHA 1QSYA 2VWJA 3RTVA 4DQRA 3VQ4A 1U47A 4RW4A 1WAFA 3ALYA 2W42A 3KKRA 4CHPA 3I0RA 4DQQA 4FVMA 3VQQA 3QEIA 1S1WA 1BQNA 1MU2A 1HQUA 3QEXA 1KVAA 3JYTA 3OYLA 1B9DA 3QEPA 4QOZB 1S9EA 1JLFA 2KFNA 1T03A 5KGXA 3V4IA 3VQEA 1T7PA 4W5NA 4I9QA 4KHQA 3ULDA 3AVFA 4PWDA 1HJRA 3SQ0A 4N5SA 1NK7A 4CJUA 1REVA 3I8DA 2VWKA 4DTSA 2JGUA 4DTNA 1UA1A 2B6AA 4KO0A 4Z0UA 3QO9A 5J2PA 4QAGA 3CFRA 4DU3A 4Q0BA 1JL2A 2Y1IA 4J2DA 1TKZA 4CJKA 3AVLA 4OGCA 4FCYA 4OGEA 3V9UA 4FK4A 4FXDA 2GUIA 3RMDA 3TI0A 1S5JA 3OYMA 3OYKA 1N6QA 3VQPA 3SQ2A 4DTPA 1B92A 4DF8A 1Z26A 1TL1A 4RW7A 4CJRA 1IKXA 1VSEA 2E6LA 3RMAA 3S3MA 1SKRA 3ZSRA 4AHTA 4FW1A 3HT3A 2YHAA 4B08A 1Y97A 3OJUA 4LSNA 4BDYA 4DTMA 3O3GA 1NJWA 1TK5A 1RT4A 4N47A 2G8HA 3PUFA 4WE1A 3CFOA 1RDAA 4FYDA 2F96A 4E1MA 3KJVA 4FLZA 2BE2A 3LAMA 4FJIA 1S1UA 1VRUA 4M45A 4QCLA 4CHQA 2ZD1A 3NBPA 2B4JA 3NH1A 1BL3A 1C1AA 4DFPA 1HNIA 3DI6A 3IRXA 5KI6A 2A1SA 4M3UA 5HRNA 3ZSXA 2B5JA 1KVBA 1UA0A 4KREA 3ASMA 4DFMA 3AA4A 2XY6A 4BDZA 1JLCA 1U4BA 4DSIA 3L2VA 3VQ5A 4CF9A 1ITGA 1WSFA 3OYDA 3QIOA 3VQ6A 4KTZA 3V9XA 2P51A 3NF8A 3PY8A 4RW6A 3DLGA 1XC9A 4L8RB 1JXEA 4CEOA 4HTUA 3TR8A 3M8RA 1GOAA 3ZSZA 2Y1JA 3LP1A 5HP1A 4KPYA 2OPQA 3AVHA 3LP0A 4CJWA 1EETA 1RT7A 2EX3A 1U04A 4EP4A 3SJJA 4HUEA 4DFJA 2FBYA 4EZ6A 2D5RA 4ZTFA 4FJGA 4DSKA 4FJHA 4Z4IA 3V1RA 1BISA 4RW8A 3EY1A 4J2BA 4Z4EA 5DK5A 3LANA 1RCHA 4KTQA 4FJJA 3AVCA 1VSIA 5KRSA 2XRIA 3EYZA 1LW2A 4E7LA 2PY5A 3F9KA 3IG1A 3E01A 4FM2A 1ASVA 5J2QA 1L5UA 1FKOA 4H8KA 2QKBA 3TWHA 4ID1A 4DMNA 1VSMA 4E1NA 3VA0A 1QSLA 4B9SA 4KHYA 3C94A 4W5TA 1J54A 1XWLA 4JRPA 3RWUA 2F8TA 1ZYQA 1WSGA 4FJKA 3ZT3A 1NKEA 4Y1CA 5CYMA 5E41A 3G10A 1GOCA 3SI6A 1ZBUA 4RW9A 3OYCA 5CZ1A 4FJLA 3H08A 4N41A 4CJTA 4DSEA 3C6UA 3TAPA 3KLHA 1J5OA 3VQAA 1K6YA 4DU4A 1DTTA 4OPKA 1UWBA 3O4QA 2FBVA 3K5LA 2ITGA 3KD5E 3P83D 3WNHA 4Z4HA 3DRPA 3NE6A 4AHCA 3OYEA 3O3HA 1VK0A 2YNFA 1QTMA 3VA3A 3BDPA 4DU1A 4CJSA 1LW0A 3DYAA 4BWJA 3SUPA 4FK0A 4CJFA 3PX0A 3VQ8A 1ZBIA 4M3TA 1BGXT 4I7FA 2KFZA 2DY4A 4FJ9A 4CF2A 1S1XA 1YTAA 1CLQA 4CJEA 2DFFA 3CM6A 1RT5A 3L2RA 2AJQA 4CJ3A 3DLEA 4HUGA 3SPYA 5EU7A 3LAKA 1Z25A 3HXMA 2IDOA 2A1RA 1X9SA 4DQIA 4NCAA 3OS2A 1FKPA 1F21A 5JS2A 4CHOA 4FJNA 4R5PA 4PQUA 1RILA 3VQBA 4DTRA 4FLYA 4M3YA 3WNGA 2YV0X 2YNHA 1ASWA 3AO5A 4DG1A 5CZ2A 2IS3A 3NAEA 2HHWA 4B9TA 2ZQBA 3F73A 5FROA 4HCBA 3LWLA 2ATQA 4FJXA 2OPSA 3OVNA 3ITHA 3VN5A 4LY7A 3KLFA 2X6SA 4CGGA 4AHVA 1FXXA 1S1TA 5K14A 1GOBA 3D0PA 1RBVA 5I42A 3UIQA 4HVJA 2P5GA 1CZBA 3B6OA 2Z1IA 4PA1A 1EXQA 2DFEA 4BE1A 4DSLA 5C24A 2D0CA 4M3WA 2HHTA 1C1BA 1TAQA 4B9UA 2OYQA 3SYZA 2FBXA 3AVKA 3KKSA 4OPJA 1IKWA 2XY8A 1XHXA 4DS5A 3V6DA 1NJZA 4FK2A 2VG5A 2DTUA 4FJ5A 1VSLA 3U3GA 5T7BA 1WLJA 3KK1A 3ZSVA 2Z1GA 3S3OA 3PO5A 3U6FA 4DS4A 1IKYA 4CESA 1IO2A 1BCOA 2RN2A 2G8VA 1TL3A 4F2SA 1J53A 1KFDA 3AA2A 4FZXC 2YNIA 3SCXA 4CIEA 3LPTA 4DTUA 1IG9A 1CXQA 1NK8A 5HLFA 2OZMA 1QHTA 3NGZA 3NH0A 5HROA 3ZSOA 3DRSA 3NF9A 4B8AB 3OY9A 3U3YA 4M3XA 1D5AA 1WN7A 3HPGA 2P5OA 4CEQA 4GW6A 4KFBA 4O4GA 4FLTA 1KSPA 3EZ5A 3NH2A 1YTUA 4KHUA 3DLRA 4DSFA 1L3UA 1TKTA 3O3FA 4JS5A 3NF7A 3DOKA 1DTQA 1I39A 3ZSQA 4M3RA 4Y1DA 2O4GA 4CF0A 4I2PA 4OKJA 3TARA 4CGIA 2IGIA 1SUQA 3AVMA 4O55A 3HM9A 3NF6A 2G8FA 3SQ1A 2HHSA 1TVRA 3DM2A 3T1AA 1EKEA 1TK8A 1SKWA 4KB1A 1CXUA 3PX4A 2HW3A 3OS1A 4KI4A 5I3UA 3ZT1A 4OJRA 4ZTJA 4NCGA 1W0HA 4DQPA 4DWIA 2GBZA 4I9LA 2FC0A 4PY5A 3RR8A 4Z4FA 1WSEA 3OYBA 4FLVA 1BCMA 3SUNA 1RTDA 3CQ8A 1QS4A 4HUFA 3RMCA 2XY5A 4B9MA 1L3VA 1ZBLA 4DLEA 4FJ7A 3K5OA 3CYMA 3NHGA 4B9LA 4B9VA 4CF8A 4ZHRA 1LAWA 1KCFA 1NOYA 4OLBA 3HJFA 3M8QA 3K58A 3NGYA 4CK3A 5SWMA 1L3SA 3NDKA 1S1VA 1YT3A 2FBTA 4IFYA 4CEDA 1SV5A 1Q9YA 4IKFA 3SV4A 1O1WA 3ZT2A 1HYVA 3SUQA 1QE1A 4CHNA 2KTQA 3DRRA 4CJQA 2HNZA 5HRSA 5J2NA 4IG0A 4W5RA 3RRGA 4FM0A 3O4NA 4IFVA 3HYFA 3QLHA 3AA5X 1HPZA 3HSTB 1L3TA 2GV9A 3T19A 4E7HA 4LH5A 4FLUA 2Q3SA 4Z4GA 4E89A 3AO1A 3AO3A 3WNFA 1S6PA 4KHNA 1BIUA 4C8MA 3V1OA 4ID5A 3L2UA 4CEAA 3KK3A 3V81A 1RT2A 1TV6A 3AVJA 2BGGA 2QKKA 4Q5VA 3HO1A 1LWFA 4CFDA 2YHBA 1TKDA 2YNGA 4CE9A 1HRHA 4TSXA 2Z1JA 1SL1A 5J2MA 2HHXA 3SZ2A 4E7KA 3AA3A 4O5BA 2HVHA 1ASUA 4AHRA 5KRTA 3CFPA 3SUOA 4CGJA 2HHQA 3D45A 1LV5A 4C8LA 4CCHA 4FZYA 1JLBA 3QEVA 5FRMA 3TAMA 3DLKA 3ZT4A 3SNNA 3SV3A 3AV9A 1KVCA 1Q8IA 2OPRA 3ZSWA 4B8CA 1TKXA 5CYQA 4F4KA 2F8SA 1RT3A 3L3UA 4OVLA 1UOCA 3ZSYA 3OYGA 3A2FA 4C8OA 1KLMA 4CIGA 3WNEA 3SPZA 1BI4B 1X9MA 1RNHA 3IS9A 3TAEA 4M42A 3CG7A 3AO2A 2OA8A 4GVMA 1HYSA 4CERA 1T05A 1JXBA 1RTJA 4I2QA 4ICLA 4DTJA 1RT1A 4PUOA 3OYIA 4C8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XI1 A;  2RF2 A;  1BI4 A;  4AHU A;  4F3O A;  4FW2 A;  1NKC A;  4CJP A;  4BDP A;  1NK4 A;  1NJX A;  3M8S A;  3K57 A;  4LD0 A;  1SKS A;  3MAQ A;  1W9H A;  4FJ8 A;  4ELU A;  2P1J A;  3MEG A;  1X1P A;  4IG3 A;  3LZJ A;  4BE2 A;  4LSL A;  1ZBF A;  3KK2 A;  2PYL A;  3RR7 A;  4CK1 A;  4B9N A;  5FDL A;  5J1E A;  3TAQ A;  3I0S A;  1BQM A;  2KZZ A;  1RTH A;  4BWM A;  3QES A;  2ZE2 A;  3M8P A;  1NK9 A;  4DSJ A;  1UAX A;  2X6N A;  1VSD A;  4F8R A;  3QNN A;  2O4I A;  1DLO A;  3KIO A;  5C25 A;  3KLI A;  3VQ7 A;  1BHL A;  4KB0 A;  3HK2 A;  5C42 A;  2XO7 A;  4AHS A;  4FM1 A;  1CZ9 A;  4CEB A;  3QEW A;  2BDP A;  4EZ9 A;  4M3Z A;  2XY7 A;  3QIP A;  3S9H A;  2E4L A;  2LSN A;  2WON A;  2HND A;  4HCC A;  3SQ4 A;  1X9W A;  4ELT A;  1FK9 A;  3FFI A;  4CGH A;  1IH7 A;  3QNO A;  3V1Q A;  1Q9X A;  3KLG A;  1RDC A;  2Z1H A;  4CEE A;  3DLH A;  2RKI A;  3LP2 A;  1S6Q A;  4CGF A;  1NJY A;  1RT6 A;  3L2Q A;  1D9F A;  3HPO A;  3OYN A;  3HL8 A;  4AH9 A;  1U49 A;  5FRN A;  3K59 A;  2G8I A;  3TAG A;  1J9A A;  4CJV A;  1JLQ A;  4KAZ A;  2IC3 A;  2RPI A;  2I5J A;  4KV8 A;  1T8E A;  1NK0 A;  4F3T A;  1WAJ A;  1RTI A;  4HHT A;  1LWC A;  5CY4 A;  4XIU A;  4CEC A;  3ZT0 A;  5KGW A;  4CFC A;  1TAU A;  3TAN A;  2YKM A;  1HQE A;  1BIZ A;  3KTQ A;  3KLE A;  4K8Z A;  5D3G A;  1QQC A;  1QSS A;  2NUB A;  4CIF A;  4KHW A;  4K8X A;  4ELV A;  2ETJ A;  2G8K A;  2QXF A;  1RBT A;  4OKK A;  3BGR A;  4AIL C;  4CGD A;  4IBN A;  4YNQ A;  4KKO A;  5HRP A;  3C95 A;  4KTW A;  4E7J A;  1WNS A;  1KLN A;  1I3A A;  3MED A;  3NFA A;  1JLA A;  1U48 A;  4KRF A;  1JKH A;  3CM5 A;  4E0D A;  1C0U A;  3LPU A;  3LP3 A;  3ISN C;  4CK2 A;  2HMI A;  4BE0 A;  3K5N A;  4O44 A;  3KD1 E;  3DLB A;  2OZS A;  4DFK A;  1C1C A;  4M41 A;  4C8N A;  1HMV A;  3P5J A;  5HBM A;  1A5V A;  4DQS A;  3HP6 A;  3AVA A;  4H4O A;  4FLX A;  2HHV A;  1B9F A;  3IAY A;  2KQ2 A;  2KW4 A;  5DMR A;  4BAC A;  3V9Z A;  4JS4 A;  3OJS A;  1WSI A;  3PX6 A;  4J2A A;  2R7Y A;  4E3S A;  2X78 A;  2EHG A;  4OKE A;  5JS1 A;  2QK9 A;  3PV8 A;  3OYA A;  1EX4 A;  1ZBH A;  2X74 A;  1S9G A;  4FJM A;  4O0I A;  3PO4 A;  2HB5 A;  5HRR A;  4CJ4 A;  3T3F A;  2D0B A;  1C0T A;  3LAL A;  3AVG A;  4LH4 A;  4YFU A;  3NCI A;  3LZI A;  3RRH A;  2BAN A;  3TAB A;  1KFS A;  1D8Y A;  3K2P A;  1RBS A;  1RBU A;  3LDS A;  2G8W A;  1A5W A;  3DMJ A;  2PYJ A;  4DF4 A;  3RMB A;  1WSH A;  3C6T A;  4JLH A;  1U45 A;  2HNY A;  4CEZ A;  1JL1 A;  4CFA A;  5KTQ A;  2YKN A;  3AVI A;  3L3V A;  4H4M A;  1WSJ A;  3OS0 A;  3OYJ A;  4MQ3 A;  4UQG A;  4N76 A;  2HHU A;  2E6M A;  1TGO A;  1LAV A;  4W5Q A;  4J2E A;  1VSJ A;  4RG8 A;  3B6P A;  4E19 A;  4DLG A;  3P1G A;  1YVU A;  4CJL A;  3OYH A;  3HVR A;  1LWE A;  1VSF A;  1VRT A;  2VG7 A;  1TK0 A;  3G0Z A;  3HP9 A;  4O0J A;  4NYN A;  4NYF A;  1C6V A;  3VQD A;  3OYF A;  1SL0 A;  1NK6 A;  3MEE A;  4E7I A;  2G8U A;  1RDB A;  4KHS A;  4JRQ A;  2XHB A;  2PZS A;  3JSM A;  4G1Q A;  4CEF A;  1NK5 A;  2WOM A;  4IDK A;  1XHZ A;  5SZT A;  3V9W A;  2VG6 A;  1SL2 A;  3TAF A;  2D0A A;  1EP4 A;  1C0M A;  4F2R A;  4DTX A;  1G15 A;  3THV A;  1R0A A;  4CJ5 A;  3V9S A;  2KZM A;  3VQ9 A;  2OPP A;  3K5M A;  3L8B A;  1KTQ A;  3LWM A;  2JLE A;  3S3N A;  3MXM A;  1D9D A;  2HVI A;  4FZZ A;  1A5X A;  4NCB A;  4W5O A;  1HNV A;  1NOZ A;  3QIN A;  3L2W A;  4Z4C A;  4OLA A;  1IKV A;  4KI6 A;  4N56 A;  1JLG A;  3MXI A;  1NKB A;  1VSH A;  3HVT A;  3MXJ A;  4CHZ A;  3AVB A;  4CFB A;  4B3O A;  4DTO A;  1RBR A;  1KRP A;  3VQC A;  4GMJ B;  3QET A;  4FLW A;  1JLE A;  2IAJ A;  4MFB A;  3ZCM A;  3NGI A;  3AVN A;  4CF1 A;  1HYZ A;  1RDD A;  4EP5 A;  1VSK A;  2IOC A;  1N5Y A;  4CHY A;  2DFH A;  3AO4 A;  3DOL A;  3QER A;  3MEC A;  3HPH A;  1QSY A;  2VWJ A;  3RTV A;  4DQR A;  3VQ4 A;  1U47 A;  4RW4 A;  1WAF A;  3ALY A;  2W42 A;  3KKR A;  4CHP A;  3I0R A;  4DQQ A;  4FVM A;  3VQQ A;  3QEI A;  1S1W A;  1BQN A;  1MU2 A;  1HQU A;  3QEX A;  1KVA A;  3JYT A;  3OYL A;  1B9D A;  3QEP A;  4QOZ B;  1S9E A;  1JLF A;  2KFN A;  1T03 A;  5KGX A;  3V4I A;  3VQE A;  1T7P A;  4W5N A;  4I9Q A;  4KHQ A;  3ULD A;  3AVF A;  4PWD A;  1HJR A;  3SQ0 A;  4N5S A;  1NK7 A;  4CJU A;  1REV A;  3I8D A;  2VWK A;  4DTS A;  2JGU A;  4DTN A;  1UA1 A;  2B6A A;  4KO0 A;  4Z0U A;  3QO9 A;  5J2P A;  4QAG A;  3CFR A;  4DU3 A;  4Q0B A;  1JL2 A;  2Y1I A;  4J2D A;  1TKZ A;  4CJK A;  3AVL A;  4OGC A;  4FCY A;  4OGE A;  3V9U A;  4FK4 A;  4FXD A;  2GUI A;  3RMD A;  3TI0 A;  1S5J A;  3OYM A;  3OYK A;  1N6Q A;  3VQP A;  3SQ2 A;  4DTP A;  1B92 A;  4DF8 A;  1Z26 A;  1TL1 A;  4RW7 A;  4CJR A;  1IKX A;  1VSE A;  2E6L A;  3RMA A;  3S3M A;  1SKR A;  3ZSR A;  4AHT A;  4FW1 A;  3HT3 A;  2YHA A;  4B08 A;  1Y97 A;  3OJU A;  4LSN A;  4BDY A;  4DTM A;  3O3G A;  1NJW A;  1TK5 A;  1RT4 A;  4N47 A;  2G8H A;  3PUF A;  4WE1 A;  3CFO A;  1RDA A;  4FYD A;  2F96 A;  4E1M A;  3KJV A;  4FLZ A;  2BE2 A;  3LAM A;  4FJI A;  1S1U A;  1VRU A;  4M45 A;  4QCL A;  4CHQ A;  2ZD1 A;  3NBP A;  2B4J A;  3NH1 A;  1BL3 A;  1C1A A;  4DFP A;  1HNI A;  3DI6 A;  3IRX A;  5KI6 A;  2A1S A;  4M3U A;  5HRN A;  3ZSX A;  2B5J A;  1KVB A;  1UA0 A;  4KRE A;  3ASM A;  4DFM A;  3AA4 A;  2XY6 A;  4BDZ A;  1JLC A;  1U4B A;  4DSI A;  3L2V A;  3VQ5 A;  4CF9 A;  1ITG A;  1WSF A;  3OYD A;  3QIO A;  3VQ6 A;  4KTZ A;  3V9X A;  2P51 A;  3NF8 A;  3PY8 A;  4RW6 A;  3DLG A;  1XC9 A;  4L8R B;  1JXE A;  4CEO A;  4HTU A;  3TR8 A;  3M8R A;  1GOA A;  3ZSZ A;  2Y1J A;  3LP1 A;  5HP1 A;  4KPY A;  2OPQ A;  3AVH A;  3LP0 A;  4CJW A;  1EET A;  1RT7 A;  2EX3 A;  1U04 A;  4EP4 A;  3SJJ A;  4HUE A;  4DFJ A;  2FBY A;  4EZ6 A;  2D5R A;  4ZTF A;  4FJG A;  4DSK A;  4FJH A;  4Z4I A;  3V1R A;  1BIS A;  4RW8 A;  3EY1 A;  4J2B A;  4Z4E A;  5DK5 A;  3LAN A;  1RCH A;  4KTQ A;  4FJJ A;  3AVC A;  1VSI A;  5KRS A;  2XRI A;  3EYZ A;  1LW2 A;  4E7L A;  2PY5 A;  3F9K A;  3IG1 A;  3E01 A;  4FM2 A;  1ASV A;  5J2Q A;  1L5U A;  1FKO A;  4H8K A;  2QKB A;  3TWH A;  4ID1 A;  4DMN A;  1VSM A;  4E1N A;  3VA0 A;  1QSL A;  4B9S A;  4KHY A;  3C94 A;  4W5T A;  1J54 A;  1XWL A;  4JRP A;  3RWU A;  2F8T A;  1ZYQ A;  1WSG A;  4FJK A;  3ZT3 A;  1NKE A;  4Y1C A;  5CYM A;  5E41 A;  3G10 A;  1GOC A;  3SI6 A;  1ZBU A;  4RW9 A;  3OYC A;  5CZ1 A;  4FJL A;  3H08 A;  4N41 A;  4CJT A;  4DSE A;  3C6U A;  3TAP A;  3KLH A;  1J5O A;  3VQA A;  1K6Y A;  4DU4 A;  1DTT A;  4OPK A;  1UWB A;  3O4Q A;  2FBV A;  3K5L A;  2ITG A;  3KD5 E;  3P83 D;  3WNH A;  4Z4H A;  3DRP A;  3NE6 A;  4AHC A;  3OYE A;  3O3H A;  1VK0 A;  2YNF A;  1QTM A;  3VA3 A;  3BDP A;  4DU1 A;  4CJS A;  1LW0 A;  3DYA A;  4BWJ A;  3SUP A;  4FK0 A;  4CJF A;  3PX0 A;  3VQ8 A;  1ZBI A;  4M3T A;  1BGX T;  4I7F A;  2KFZ A;  2DY4 A;  4FJ9 A;  4CF2 A;  1S1X A;  1YTA A;  1CLQ A;  4CJE A;  2DFF A;  3CM6 A;  1RT5 A;  3L2R A;  2AJQ A;  4CJ3 A;  3DLE A;  4HUG A;  3SPY A;  5EU7 A;  3LAK A;  1Z25 A;  3HXM A;  2IDO A;  2A1R A;  1X9S A;  4DQI A;  4NCA A;  3OS2 A;  1FKP A;  1F21 A;  5JS2 A;  4CHO A;  4FJN A;  4R5P A;  4PQU A;  1RIL A;  3VQB A;  4DTR A;  4FLY A;  4M3Y A;  3WNG A;  2YV0 X;  2YNH A;  1ASW A;  3AO5 A;  4DG1 A;  5CZ2 A;  2IS3 A;  3NAE A;  2HHW A;  4B9T A;  2ZQB A;  3F73 A;  5FRO A;  4HCB A;  3LWL A;  2ATQ A;  4FJX A;  2OPS A;  3OVN A;  3ITH A;  3VN5 A;  4LY7 A;  3KLF A;  2X6S A;  4CGG A;  4AHV A;  1FXX A;  1S1T A;  5K14 A;  1GOB A;  3D0P A;  1RBV A;  5I42 A;  3UIQ A;  4HVJ A;  2P5G A;  1CZB A;  3B6O A;  2Z1I A;  4PA1 A;  1EXQ A;  2DFE A;  4BE1 A;  4DSL A;  5C24 A;  2D0C A;  4M3W A;  2HHT A;  1C1B A;  1TAQ A;  4B9U A;  2OYQ A;  3SYZ A;  2FBX A;  3AVK A;  3KKS A;  4OPJ A;  1IKW A;  2XY8 A;  1XHX A;  4DS5 A;  3V6D A;  1NJZ A;  4FK2 A;  2VG5 A;  2DTU A;  4FJ5 A;  1VSL A;  3U3G A;  5T7B A;  1WLJ A;  3KK1 A;  3ZSV A;  2Z1G A;  3S3O A;  3PO5 A;  3U6F A;  4DS4 A;  1IKY A;  4CES A;  1IO2 A;  1BCO A;  2RN2 A;  2G8V A;  1TL3 A;  4F2S A;  1J53 A;  1KFD A;  3AA2 A;  4FZX C;  2YNI A;  3SCX A;  4CIE A;  3LPT A;  4DTU A;  1IG9 A;  1CXQ A;  1NK8 A;  5HLF A;  2OZM A;  1QHT A;  3NGZ A;  3NH0 A;  5HRO A;  3ZSO A;  3DRS A;  3NF9 A;  4B8A B;  3OY9 A;  3U3Y A;  4M3X A;  1D5A A;  1WN7 A;  3HPG A;  2P5O A;  4CEQ A;  4GW6 A;  4KFB A;  4O4G A;  4FLT A;  1KSP A;  3EZ5 A;  3NH2 A;  1YTU A;  4KHU A;  3DLR A;  4DSF A;  1L3U A;  1TKT A;  3O3F A;  4JS5 A;  3NF7 A;  3DOK A;  1DTQ A;  1I39 A;  3ZSQ A;  4M3R A;  4Y1D A;  2O4G A;  4CF0 A;  4I2P A;  4OKJ A;  3TAR A;  4CGI A;  2IGI A;  1SUQ A;  3AVM A;  4O55 A;  3HM9 A;  3NF6 A;  2G8F A;  3SQ1 A;  2HHS A;  1TVR A;  3DM2 A;  3T1A A;  1EKE A;  1TK8 A;  1SKW A;  4KB1 A;  1CXU A;  3PX4 A;  2HW3 A;  3OS1 A;  4KI4 A;  5I3U A;  3ZT1 A;  4OJR A;  4ZTJ A;  4NCG A;  1W0H A;  4DQP A;  4DWI A;  2GBZ A;  4I9L A;  2FC0 A;  4PY5 A;  3RR8 A;  4Z4F A;  1WSE A;  3OYB A;  4FLV A;  1BCM A;  3SUN A;  1RTD A;  3CQ8 A;  1QS4 A;  4HUF A;  3RMC A;  2XY5 A;  4B9M A;  1L3V A;  1ZBL A;  4DLE A;  4FJ7 A;  3K5O A;  3CYM A;  3NHG A;  4B9L A;  4B9V A;  4CF8 A;  4ZHR A;  1LAW A;  1KCF A;  1NOY A;  4OLB A;  3HJF A;  3M8Q A;  3K58 A;  3NGY A;  4CK3 A;  5SWM A;  1L3S A;  3NDK A;  1S1V A;  1YT3 A;  2FBT A;  4IFY A;  4CED A;  1SV5 A;  1Q9Y A;  4IKF A;  3SV4 A;  1O1W A;  3ZT2 A;  1HYV A;  3SUQ A;  1QE1 A;  4CHN A;  2KTQ A;  3DRR A;  4CJQ A;  2HNZ A;  5HRS A;  5J2N A;  4IG0 A;  4W5R A;  3RRG A;  4FM0 A;  3O4N A;  4IFV A;  3HYF A;  3QLH A;  3AA5 X;  1HPZ A;  3HST B;  1L3T A;  2GV9 A;  3T19 A;  4E7H A;  4LH5 A;  4FLU A;  2Q3S A;  4Z4G A;  4E89 A;  3AO1 A;  3AO3 A;  3WNF A;  1S6P A;  4KHN A;  1BIU A;  4C8M A;  3V1O A;  4ID5 A;  3L2U A;  4CEA A;  3KK3 A;  3V81 A;  1RT2 A;  1TV6 A;  3AVJ A;  2BGG A;  2QKK A;  4Q5V A;  3HO1 A;  1LWF A;  4CFD A;  2YHB A;  1TKD A;  2YNG A;  4CE9 A;  1HRH A;  4TSX A;  2Z1J A;  1SL1 A;  5J2M A;  2HHX A;  3SZ2 A;  4E7K A;  3AA3 A;  4O5B A;  2HVH A;  1ASU A;  4AHR A;  5KRT A;  3CFP A;  3SUO A;  4CGJ A;  2HHQ A;  3D45 A;  1LV5 A;  4C8L A;  4CCH A;  4FZY A;  1JLB A;  3QEV A;  5FRM A;  3TAM A;  3DLK A;  3ZT4 A;  3SNN A;  3SV3 A;  3AV9 A;  1KVC A;  1Q8I A;  2OPR A;  3ZSW A;  4B8C A;  1TKX A;  5CYQ A;  4F4K A;  2F8S A;  1RT3 A;  3L3U A;  4OVL A;  1UOC A;  3ZSY A;  3OYG A;  3A2F A;  4C8O A;  1KLM A;  4CIG A;  3WNE A;  3SPZ A;  1BI4 B;  1X9M A;  1RNH A;  3IS9 A;  3TAE A;  4M42 A;  3CG7 A;  3AO2 A;  2OA8 A;  4GVM A;  1HYS A;  4CER A;  1T05 A;  1JXB A;  1RTJ A;  4I2Q A;  4ICL A;  4DTJ A;  1RT1 A;  4PUO A;  3OYI A;  4C8K A; 
#chains in the Genus database with same CATH topology
 4F3O A;  4AHU A;  4QS7 A;  4WF9 L;  4DB3 A;  3K57 A;  4FJ8 A;  1X1P A;  1ZBF A;  2QWM A;  4B9N A;  4IO8 A;  1XMO K;  1SS6 A;  3HBT A;  2KZZ A;  4JI8 K;  3O6W A;  4I6M B;  5I9E B;  4A2B A;  3J81 O;  1VSD A;  4F8R A;  1HNW K;  3VQ7 A;  4B3R K;  4KB0 A;  2GTD A;  4FM1 A;  3QEW A;  3QIP A;  2E4L A;  4CZF A;  4HCC A;  3SQ4 A;  3FFI A;  1VQO N;  5GAH P;  1RFQ A;  3KLG A;  3DLH A;  2AA4 A;  2RKI A;  1NJY A;  4RWT A;  1D9F A;  3ZX2 A;  2WC9 A;  1U49 A;  3DXK B;  2RHK A;  2RPI A;  1T8E A;  5KGW A;  4BRI A;  4QS9 A;  3TAN A;  3ZEU A;  4NLB A;  4FWS A;  4A62 A;  1QQC A;  2NUB A;  1GLJ O;  3DAW A;  2ZJP L;  2G8K A;  2QXF A;  1RBT A;  4AIL C;  4IBN A;  1K73 O;  4CVN E;  2Q31 A;  3MWT A;  5HRP A;  5GIO A;  3C95 A;  4E7J A;  1KLN A;  3LPU A;  4YOV A;  2HMI A;  3K5N A;  4C8N A;  5HBM A;  3HP6 A;  2HHV A;  1OVQ A;  3IKM A;  3IAY A;  1P8Z A;  2KQ2 A;  1XUP O;  3TSP A;  3PX6 A;  4E3S A;  3FE1 A;  4OKE A;  3OYA A;  4FJM A;  4O0I A;  2HB5 A;  3AVG A;  5M1O A;  3VER A;  3WEE A;  1RBS A;  1RBU A;  2G8W A;  3DMJ A;  2W41 A;  2V7Z A;  1U45 A;  2HNY A;  4CEZ A;  1JL1 A;  3D2F B;  4CFA A;  3L3V A;  4H4M A;  2A3Z A;  4GNI A;  4CZE A;  1C0G A;  4N76 A;  4NB4 A;  1LAV A;  4W5Q A;  1VSJ A;  3EKS A;  4DLG A;  3OYH A;  4DV0 K;  3HVR A;  1LWE A;  1VSF A;  3MN9 A;  1TK0 A;  3HP9 A;  2NRZ A;  2ZF5 O;  4FWQ A;  2I7P A;  1JCF A;  2J4R A;  4MDA A;  3VQD A;  3MEE A;  1RDB A;  3FLC O;  1SL2 A;  4KH5 A;  4DTX A;  3THV A;  1R0A A;  3O9S A;  3VES A;  3V9S A;  1S72 N;  2P9K A;  4BG8 A;  3QBW A;  3K5M A;  4B9Q A;  4WFB L;  5EY4 A;  5BPN A;  2HVI A;  3VEZ A;  1ZC6 A;  1JCE A;  3BY5 A;  4FZZ A;  1Q7Y O;  4W5O A;  2P9S B;  1HNV A;  3O4W A;  4H0O A;  4Z4C A;  4KI6 A;  1JLG A;  1NKB A;  3AVB A;  4CFB A;  1MWK A;  4GMJ B;  4JI0 K;  3RSE A;  4MFB A;  5JIC A;  4CF1 A;  1NGI A;  1VSK A;  3OBY A;  3GL1 A;  2IOC A;  4JD2 B;  1N5Y A;  3HI0 A;  3HSC A;  1QSY A;  5CR4 A;  3T1Y K;  4DQR A;  4ILH A;  4GKJ K;  4CHP A;  3I0R A;  4CZK A;  5AQH A;  1MU2 A;  2HMP A;  3ATU A;  4FPA A;  3ZX3 A;  3OYL A;  1B9D A;  4QOZ B;  1N33 K;  1S9E A;  5KGX A;  3V4I A;  1T7P A;  3SAH A;  5DM6 L;  4KHQ A;  4I6M A;  5AZJ A;  3AVF A;  3UKR A;  2JGU A;  5J2P A;  4DU3 A;  5BRD A;  2JWK A;  3C0B A;  1TKZ A;  3V9U A;  4OGE A;  2DPN A;  3RMD A;  3OYK A;  1N6Q A;  3ULE B;  1B92 A;  3TSU A;  4DF8 A;  3HOT A;  3O9U A;  2E6L A;  3CJ7 A;  4AHT A;  2Q0R A;  4MDB A;  3VPZ A;  4B08 A;  1VHX A;  4BDY A;  3G6E N;  3TPQ A;  1RT4 A;  4DUZ K;  1I94 K;  4FLZ A;  4M45 A;  1IV0 A;  3D6R A;  5AQT A;  1HNI A;  2OAN A;  5B8H A;  2XY6 A;  3L2V A;  4B1X B;  1ITG A;  5KQ8 A;  4IEI A;  3VQ6 A;  3V9X A;  4ILJ A;  4IXC A;  5AQF A;  4L8R B;  3VEV A;  1NGJ A;  3LP0 A;  1KXP A;  3I8B A;  5M1K A;  1RT7 A;  2EX3 A;  1U04 A;  3WQT A;  2NZT A;  2FBY A;  4PL8 A;  4Z4E A;  4RW8 A;  2KLA A;  2P9U A;  4H5R A;  3LAN A;  4KTQ A;  4WQ4 C;  5AQJ A;  2XRI A;  3IG1 A;  3E01 A;  4FM2 A;  1L5U A;  3J7A P;  2QKB A;  2YJF A;  4B9S A;  1QSL A;  4KHY A;  4W5T A;  1XWL A;  3RWU A;  1ZYQ A;  3ZT3 A;  4Y1C A;  5E41 A;  2HHX A;  4E1J A;  3VF6 A;  4RW9 A;  1N8R O;  3TAP A;  5ADX A;  4DU4 A;  3OBW A;  4IOC L;  3O4Q A;  3MX5 A;  3H1V X;  3O80 A;  4BGB A;  3P83 D;  1N36 K;  1BU6 O;  2ZGZ A;  1NWK A;  2YNF A;  1QTM A;  3VA3 A;  4DHY A;  4M3T A;  2D4W A;  2KFZ A;  4I7F A;  2F4V K;  4FJ9 A;  4CF2 A;  4BC2 A;  2FF3 B;  4A61 A;  2AJQ A;  3DLE A;  2A1R A;  3OS2 A;  4CHO A;  1F21 A;  5BRH A;  4JAX A;  4JKE A;  4DTR A;  1T44 A;  2UXD K;  1P90 A;  2IS3 A;  4DQ8 A;  4B9T A;  3F73 A;  3RVC A;  3KLF A;  2HOE A;  2P9N B;  3D0P A;  4NO7 A;  4YOY A;  4QCL A;  4M3W A;  1EXQ A;  3AAQ A;  5LJV A;  2FLO A;  4CBU A;  1TAQ A;  2VGM A;  2OYQ A;  4DCH A;  5FPE A;  3ID6 A;  4CBW A;  3CCE N;  1XHX A;  1D4X A;  3V6D A;  1NJZ A;  2VG5 A;  1VSL A;  3H6E A;  5FPD A;  3ZSV A;  3PO5 A;  3S3O A;  3U6F A;  1NMN A;  1IKY A;  2RN2 A;  4F2S A;  2CH5 A;  1J53 A;  1KFD A;  3AA2 A;  2YNI A;  2HF3 A;  5GAD P;  2P9I B;  1NK8 A;  2OZM A;  3E9P A;  3NGZ A;  4MLH A;  3VGK A;  4B8A B;  3DRS A;  3U3Y A;  2E20 A;  4O4G A;  2QTD A;  4FLT A;  1NGC A;  3DJC A;  4B1Y B;  4UY8 O;  4OKJ A;  4R79 A;  2IGI A;  1SUQ A;  3HM9 A;  3DM2 A;  1VQ7 N;  2HW3 A;  4KI4 A;  3BF3 A;  4OJR A;  1EWQ A;  1W0H A;  3CPW M;  2GBZ A;  1YF5 L;  1WSE A;  3O1W A;  3OYB A;  2JWL A;  5AQU A;  3CQ8 A;  1VQK N;  4H5T A;  1ZBL A;  1L3V A;  4PKI A;  1NOY A;  3M8Q A;  3O8M A;  5SWM A;  2FBT A;  2W6L A;  3SV4 A;  4CD1 A;  1QE1 A;  2BTF A;  5J2N A;  3QIC A;  3O4N A;  4K43 A;  1HPZ A;  4BRH A;  5FLX O;  1KC8 O;  4Z4G A;  2UUB K;  3AO1 A;  4G9Z A;  4LC9 B;  2Q0U A;  3V1O A;  3CI5 A;  4ID5 A;  5C15 A;  3KK3 A;  4CW7 B;  3IFR A;  2H3G X;  3F9M A;  4DV5 K;  3DLL L;  4B1U B;  3CCV N;  4GY2 B;  1KD1 O;  5LMU K;  1DEJ A;  2HVH A;  1ASU A;  4AHR A;  2V51 B;  4XH1 A;  4CGJ A;  2O8B A;  3QEV A;  5EOY A;  5FRM A;  5E84 A;  3ZT4 A;  5AFU A;  2P9L B;  3ZSW A;  3L3U A;  3R9P A;  3A2F A;  4CIG A;  4JI1 K;  3IS9 A;  4M42 A;  5AQK A;  3KHY A;  4M63 C;  3T69 A;  2AP1 A;  4BRF A;  4DTJ A;  2V7Y A;  2UXC K;  3ZLJ A;  1NKC A;  1QQM A;  4BDP A;  1NK4 A;  1NJX A;  3JXU A;  4LD0 A;  1SKS A;  2FSK A;  1W9H A;  3C6H A;  3MEG A;  4IG3 A;  4BE2 A;  3LZJ A;  1K8A O;  3RR7 A;  1GLE G;  2QWP A;  3I0S A;  4C1N I;  5AQM A;  1BQM A;  4AM7 A;  1RTH A;  3P38 A;  1E3M A;  3KZB A;  3M8P A;  5IT9 O;  5C10 A;  3LL3 A;  1UAX A;  1FW6 A;  3NVK A;  1NGG A;  3KIO A;  1M90 O;  1NGH A;  5AQQ A;  2XO7 A;  1Q18 A;  2BDP A;  2XY7 A;  3EO3 A;  3S9H A;  2LSN A;  4ELT A;  1ATN A;  2Z1H A;  3LP2 A;  3PIO L;  3HL8 A;  3UKU A;  4BRA A;  3VEN A;  4KAZ A;  2IC3 A;  1N34 K;  4KV8 A;  1MWM A;  1NK0 A;  5CY4 A;  4XIU A;  3R1X A;  4CEC A;  2NNW A;  1TAU A;  2YKM A;  1BIZ A;  3KTQ A;  3KLE A;  4K8Z A;  5D3G A;  4JK8 A;  1TUU A;  3P31 A;  4ELV A;  2ETJ A;  4JKG A;  1V4T A;  5EXW A;  3PSF A;  4KKO A;  4JI2 K;  2ZWH A;  2NRW A;  3M5R A;  3LP3 A;  4JKB A;  2WFB A;  4O44 A;  4B1Z A;  1C1C A;  1HMV A;  1BO5 O;  4HTL A;  3AVA A;  1B9F A;  1W97 L;  3V9Z A;  3WEE B;  2R7Y A;  2EHG A;  5JS1 A;  1EX4 A;  2X74 A;  3PO4 A;  4K0K K;  4CJ4 A;  3T3F A;  3CHW A;  4IJN A;  4MO4 A;  1C0T A;  3LAL A;  4YFU A;  3RRH A;  1IBL K;  4CZM A;  3ENO A;  5AQL A;  3RMB A;  1Z6R A;  4FL9 A;  3O08 A;  4K25 A;  5KTQ A;  5DM7 L;  4BRN A;  1NLV A;  3OYJ A;  2HHU A;  3B6P A;  4WCE L;  4WQ4 A;  2VG7 A;  3AGK A;  3MN6 A;  3TSQ A;  4LFA K;  4FXD A;  2G8U A;  4BRM A;  1SL0 A;  2P9K B;  3GBT A;  3CJ9 A;  2HHH K;  2PAV A;  3JSM A;  2NLX A;  2WOM A;  4IDK A;  5HL7 L;  2VG6 A;  2E1Y A;  1BOT O;  5LJW A;  4F9O A;  2KZM A;  4CJ5 A;  2OPP A;  5F2R A;  2JLE A;  1D9D A;  3MXM A;  4OPH A;  4OO1 J;  1YVN A;  3RSE B;  4JK9 A;  1A5X A;  4B3T K;  4OLA A;  1IKV A;  3MXI A;  2QM1 A;  1VSH A;  3HVT A;  4CHZ A;  3SAG A;  1RBR A;  2NRX A;  3VEO A;  2IAJ A;  3FZH A;  1HYZ A;  2A6A A;  4YOT A;  3AO4 A;  4CHY A;  2O8E A;  4FWL A;  3MX2 A;  3VQ4 A;  5AZJ B;  4DQQ A;  4FVM A;  3T1H K;  3UKR B;  1BQN A;  2E2O A;  1Z05 A;  4BY9 C;  2KFN A;  3QML A;  4BQZ A;  4I9Q A;  4O5F A;  1NK7 A;  1SAZ A;  1EQY A;  4DTS A;  3I8D A;  4ILG B;  4KO0 A;  4M7Y A;  4DR6 K;  3GOI A;  1JL2 A;  2ASO A;  2Y1I A;  1U2V A;  4J2D A;  1QZ6 A;  4FK4 A;  3TI0 A;  5AQR A;  3BZK A;  3VQP A;  4NLC A;  2GUP A;  1Z26 A;  5AQV A;  4BRC A;  3A5L C;  3C7N A;  3ZSR A;  2YCH A;  4YY3 K;  5MLC Q;  4N47 A;  1YIT N;  2F96 A;  3R6M A;  2BE2 A;  3CJC A;  5AZI A;  1VRU A;  3J8A A;  5M1Q A;  1VQ8 N;  2YI1 A;  1IG8 A;  1C1A A;  3DI6 A;  3MWP A;  4LF7 K;  5HRN A;  4KRE A;  3AA4 A;  3CJA A;  1JLC A;  2QWL A;  4AQY K;  1WSF A;  3QIO A;  3FGU A;  2CGL A;  4RW6 A;  5JLH A;  4HTU A;  2P9U B;  3M8R A;  1GOA A;  5HP1 A;  3O1B A;  2OPQ A;  3H45 C;  4JKD A;  1EET A;  4EP4 A;  4FJG A;  4ZTF A;  4Z4I A;  4IWV A;  2VGN A;  3BF1 A;  3U9Z A;  3V1R A;  4J2B A;  5DK5 A;  5KRS A;  4BRK A;  5BPM A;  3EYZ A;  4JN4 A;  5J2Q A;  4H8K A;  1HUX A;  1DGK N;  1VSM A;  4E1N A;  3CCQ N;  3VA0 A;  3HM8 A;  2FSJ A;  4DR4 K;  1J54 A;  4H03 B;  3SI6 A;  1ZBU A;  4FJL A;  3H08 A;  3C6U A;  3KLH A;  3C65 A;  1G99 A;  4LF4 K;  4EFH A;  2PFU A;  5C0Y A;  4Z4H A;  3NE6 A;  1LW0 A;  4BWJ A;  4FK0 A;  1ZBI A;  1GLL O;  4MO5 A;  2DY4 A;  3AAP A;  1S1X A;  4BG9 A;  3EZW A;  4BRE A;  4CJE A;  2DFF A;  3LDN A;  2YJE A;  1NGD A;  2F7T A;  4HUG A;  4RCH A;  5EX5 A;  3SPY A;  1X9S A;  1Z25 A;  5JS2 A;  3VGL A;  3E66 A;  1RIL A;  3HOS A;  4FLY A;  1N32 K;  1ASW A;  2GWJ A;  5ADX H;  3NAE A;  2HHW A;  3OVN A;  3ITH A;  3P39 A;  5A2Q O;  1S1T A;  4KHP K;  5K14 A;  4HVJ A;  4IOA L;  2Z1I A;  3B6O A;  4FWM A;  3I56 N;  2DFE A;  4BE1 A;  2HHT A;  2VCP A;  5BR9 A;  1C1B A;  4B9U A;  3THX A;  2E8A A;  3AVK A;  5AR0 A;  4GV6 A;  3WT0 A;  1YI2 N;  1HJO A;  2FSN A;  4FJ5 A;  5JLF A;  4NXN K;  5T7B A;  3KK1 A;  2W6K A;  4K41 A;  5AQP A;  4JI6 K;  1Q82 O;  4DS4 A;  4CES A;  1GLA G;  2G8V A;  1BCO A;  3VOV A;  3D2E A;  5KPZ A;  4FZX C;  1MDU B;  4DTU A;  4FWO A;  4Y0W A;  1ILY A;  3NF9 A;  4M3X A;  3MN7 A;  2ZGY A;  3I55 N;  2QWR A;  3WXL A;  3EZ5 A;  5BRE A;  4DSF A;  1TKT A;  3O3F A;  1VQN N;  1U6Z A;  1I39 A;  4M3R A;  3CIP A;  4BVP A;  4I2P A;  4CGI A;  4O55 A;  1OH6 A;  3NF6 A;  4FO0 A;  3T1A A;  5KPT A;  1TK8 A;  4X62 K;  1NU0 A;  3OS1 A;  5I3U A;  4DQP A;  1HNX K;  4XH5 A;  2FC0 A;  2YHY A;  5CE3 A;  3O5B A;  5M1P A;  3SLC A;  1E4F T;  4IZ9 A;  4FJ7 A;  3NHG A;  4B9L A;  1JJ2 M;  4B9V A;  4CF8 A;  4OLB A;  3HJF A;  3K58 A;  3F5T A;  4YOU A;  4EIA A;  4M7X A;  1Q9Y A;  3GE1 A;  3ZT2 A;  1HYV A;  2Q1N A;  5HRS A;  2HNZ A;  2IVO A;  4IG0 A;  4W5R A;  3CF5 L;  4FM0 A;  4IFV A;  3LDO A;  3QLH A;  5GAE P;  2GV9 A;  3T19 A;  4E7H A;  1RDW X;  4BRQ A;  2GEM A;  3AO3 A;  3WNF A;  5JVH L;  5F0X A;  4C8M A;  4A5A A;  1RT2 A;  3W3D A;  3AVJ A;  1K8K A;  2BGG A;  2O8B B;  2QKK A;  4Q5V A;  3OW2 M;  1TKD A;  1YHQ N;  4BR0 A;  4CCH A;  3F2K A;  4LF5 K;  1TYQ A;  2WUS A;  1KVC A;  4BR5 A;  1TKX A;  1OVY A;  3G4S N;  3ZSY A;  1UOC A;  4CZH A;  2ZJR L;  1KLM A;  3WNE A;  5BN8 A;  3CG7 A;  3AO2 A;  1J6Z A;  4CER A;  2PBD A;  4DKW A;  4U7B A;  4ICL A;  3OYI A;  4EHU A;  4GVE A;  4C8K A;  1XI1 A;  2RF2 A;  3AAR A;  4FW2 A;  2HBL A;  4RTF D;  3G71 N;  4YOR A;  3QFU A;  3J7Z O;  2KKZ A;  2PYL A;  2E88 A;  5FDL A;  5J1E A;  3I33 A;  3IMX A;  3LM9 A;  1NJI O;  4OX9 K;  1VQL N;  4FWN A;  1NK9 A;  4DSJ A;  2X6N A;  3QBX A;  3QNN A;  2O4I A;  1KAZ A;  4AHS A;  4EZ9 A;  4CEB A;  3THW A;  4M3Z A;  1ATS A;  3A5O C;  3VMF B;  3UKU B;  1ZXO A;  2WON A;  1C0F A;  4ISF A;  1FK9 A;  4CGH A;  1IH7 A;  3QNO A;  3FZF A;  1Q9X A;  1RDC A;  3B8A X;  4CEE A;  4K8X A;  3HPO A;  2G8I A;  3TAG A;  1J9A A;  4CJV A;  3OTO K;  1JLQ A;  3KVG A;  4CZI A;  2I5J A;  1WAJ A;  1RTI A;  4HHT A;  4JKG B;  3EN9 A;  3U9D A;  3ZT0 A;  3CC2 N;  4CFC A;  1QSS A;  3A0I X;  4KHW A;  3VTI A;  4OKK A;  4YNQ A;  3CJ1 A;  2WBN A;  3OA9 A;  3SMS A;  4KTW A;  4B3M K;  2YX6 A;  1ZBS A;  4EAH D;  1U48 A;  4CK2 A;  5KPR A;  4X65 K;  1QZ5 A;  4A2A A;  1VAZ A;  3DLB A;  4M41 A;  4HWI A;  4IO9 L;  4H4O A;  4H0P A;  3CCM N;  4J2A A;  2X78 A;  2A5X A;  2VQE K;  3PV8 A;  1Y64 A;  1ZBH A;  1YUW A;  2HBM A;  3ENB A;  4IJA A;  2HST A;  3NCI A;  3LZI A;  1YAG A;  3BP8 A;  3ATV A;  3TAB A;  1KFS A;  1D8Y A;  3K2P A;  1GLB G;  3LDS A;  2PYJ A;  4DV2 K;  4OPA A;  3AVI A;  5AQZ A;  4H5N A;  5BR8 K;  4DV4 K;  1TGO A;  4E19 A;  3P1G A;  1YVU A;  3CMA N;  1VRT A;  4ISE A;  2QA4 N;  4PKH A;  2P9P A;  1K9M O;  4O0J A;  4NYN A;  3OYF A;  1C6V A;  4E7I A;  3W0L A;  3QDK A;  1R59 O;  4JRQ A;  2XHB A;  4DR2 K;  1NK5 A;  4CEF A;  1XHZ A;  4IFE A;  4H0X B;  4BRD A;  5SZT A;  3V9W A;  3TAF A;  1EP4 A;  2UYT A;  1G15 A;  2HBK A;  3VQ9 A;  1VQM N;  3L8B A;  3S3N A;  2D0P A;  4NCB A;  4BC5 A;  4EHT A;  2O8E B;  4B3O A;  4DTO A;  5LY3 A;  1KRP A;  3QET A;  4FLW A;  3ZCM A;  1GLC G;  3NGI A;  3CCL N;  3AVN A;  4EP5 A;  4CBX A;  5AQX A;  1T6D A;  3QER A;  3DOL A;  3MEC A;  3HPH A;  2A41 A;  1NMD A;  3RTV A;  3SBT A;  1WAF A;  3ALY A;  2W42 A;  3KKR A;  4K42 A;  3GG4 A;  3VQQ A;  3QEI A;  1WBB A;  1HKC A;  1X3N A;  4PHT X;  3QEP A;  2O8F A;  4WYB A;  3D7E O;  1T03 A;  4H0Y B;  2O8C A;  1U2V B;  1NBW A;  3ULD A;  4H5V A;  2ITM A;  1HJR A;  2VWK A;  3O9R A;  4Z0U A;  4Q0B A;  4CD3 A;  3CFR A;  1YIJ N;  4JKH A;  5BRF A;  2A42 A;  2GX9 A;  3C7N B;  3WXJ A;  4CJK A;  3FZM A;  4JI5 K;  4DV7 K;  1OH5 A;  2GUI A;  2KHO A;  3OHR A;  3OYM A;  3QFP A;  4O8K A;  3SQ2 A;  3H1Q A;  4RW7 A;  3VEY A;  1VSE A;  3RMA A;  1SKR A;  5AZI B;  3HT3 A;  4LF9 K;  1YJ9 N;  3OJU A;  2IVP A;  4A5B A;  4DTM A;  1WOQ A;  3O3G A;  3VGM A;  1NJW A;  1TK5 A;  4LF8 K;  2G8H A;  4BRL A;  1YJN N;  4FYD A;  3LAM A;  1S1U A;  4GKK K;  4PL7 A;  2ZD1 A;  2B4J A;  1BL3 A;  4DFP A;  2QEX N;  3IRX A;  1X3M A;  4M3U A;  3JS6 A;  3ZSX A;  1OKJ A;  1UA0 A;  1BG3 A;  4GV9 A;  4DFM A;  4BDZ A;  3DXM A;  1U4B A;  4DSI A;  4CF9 A;  3OYD A;  2P51 A;  3NF8 A;  4BQL A;  3DLG A;  1JXE A;  3UE5 A;  3NVM A;  3CCS N;  3ZSZ A;  3LP1 A;  3G25 A;  4KPY A;  4B1V A;  3SJH A;  3SJJ A;  4MLE A;  4DFJ A;  3EE9 A;  4EZ6 A;  2D5R A;  4DSK A;  4FJH A;  1XC3 A;  1BIS A;  3EY1 A;  2Q97 A;  3A5M C;  1RCH A;  4FWR A;  1GLD G;  1NG9 A;  1VSI A;  2QI2 A;  3ZYY X;  4E7L A;  4BR9 A;  3F9K A;  3SBG A;  3EE8 A;  1ASV A;  3C6A A;  3TWH A;  3ZET A;  4ID1 A;  3K9K A;  4KH4 A;  3L0Q A;  4JRP A;  2F8T A;  2CH6 A;  1XNQ K;  1OH8 A;  1NGF A;  1NKE A;  5CYM A;  4J2E A;  3G10 A;  1GOC A;  4N41 A;  5AQN A;  3VQA A;  4DR1 K;  3R8E A;  4OPK A;  1UWB A;  4JEP A;  5AJ3 K;  2FBV A;  2RE2 A;  3WNH A;  3DRP A;  2NRR A;  4AHC A;  2OTJ N;  3WUH A;  4CZL A;  3OYE A;  3BDP A;  4DU1 A;  4CJS A;  3DYA A;  4CJF A;  2CGK A;  5TKW A;  3VQ8 A;  3PX0 A;  1BGX T;  1YTA A;  1FJG K;  1CLQ A;  3L2R A;  2NRH A;  5EU7 A;  3LAK A;  4YOX A;  3HXM A;  4YOW A;  4NCA A;  4FJN A;  4R5P A;  1Q81 O;  4PQU A;  2D1K A;  1XMQ K;  4YDU A;  3AO5 A;  4DG1 A;  5CZ2 A;  4DV6 K;  2ZQB A;  4DV1 K;  4HCB A;  2ATQ A;  3E1Y A;  2OPS A;  3THX B;  2X6S A;  4CGG A;  2Q2R A;  5KQD A;  1VQ4 N;  4JHD A;  1YXQ A;  1FXX A;  5HOO A;  3SK3 A;  1GOB A;  1RBV A;  4PA1 A;  1X9J A;  4DSL A;  5C24 A;  1VQP N;  3SYZ A;  3H3O B;  3HZ6 A;  3J7Y P;  3D2E B;  2Z1G A;  3M6G A;  1IO2 A;  1TL3 A;  4FOE A;  4CIE A;  3LPT A;  5TKY A;  1IG9 A;  1QVG M;  5HLF A;  1QHT A;  3NH0 A;  2WTU A;  5HRO A;  2YHW A;  3OY9 A;  3KK7 A;  1WN7 A;  2QWQ A;  4CEQ A;  1M1K O;  4KFB A;  2GEL A;  3JAM O;  1KSP A;  5M1F A;  4KHU A;  1BA1 A;  3DLR A;  1L3U A;  4GV3 A;  4JS5 A;  2BH1 A;  1DTQ A;  4C23 A;  3ZSQ A;  4Y1D A;  1CZA N;  2O4G A;  4CF0 A;  4BVO A;  3AVM A;  3VET A;  1XQS C;  5M1N A;  3SQ1 A;  2HHS A;  1SKW A;  1EKE A;  3ZT1 A;  4ZTJ A;  4DWI A;  4I9L A;  2Q36 A;  4PY5 A;  4Z4F A;  2F9T A;  4FWP A;  2W40 A;  1BCM A;  3SUN A;  1RTD A;  4HUF A;  3RMC A;  3THY A;  2XY5 A;  3K9J A;  2GWK A;  3K5O A;  1LAW A;  3LM2 A;  4V19 S;  2O8D A;  1V4S A;  2VYP A;  4CK3 A;  1L3S A;  4JI7 K;  1S1V A;  3CQY A;  4CED A;  4IFY A;  1QVF M;  1SV5 A;  4XEI A;  4BR2 A;  4CHN A;  3DRR A;  4CJQ A;  3S41 A;  1T3V A;  3VTH A;  1K8K B;  1L3T A;  3L6Q A;  4JNE A;  5FPN A;  4LH5 A;  4CI6 A;  2OTL N;  1TV6 A;  5JVG L;  1RDU A;  1ESV A;  3HO1 A;  4CFD A;  1RGI A;  1TYQ B;  2YNG A;  4CE9 A;  3TTD A;  1HRH A;  3FFK B;  3SZ2 A;  3AA3 A;  3CPE A;  3VEX A;  5KRT A;  1TUY A;  2HHQ A;  3NMU A;  3WQU A;  4C8L A;  4KH6 A;  4FZY A;  4KBO A;  5AQI A;  3TAM A;  4X64 K;  1Q8I A;  4F4K A;  5CYQ A;  1RT3 A;  4OVL A;  4C8O A;  1X9M A;  5IWA K;  3TAE A;  2OA8 A;  1HYS A;  3PSI A;  4I2Q A;  5AQS A;  3CET A;  1IBK K;  3CJB A;  1VQ5 N;  1BI4 A;  3QB0 A;  3TU5 A;  4CJP A;  3M8S A;  1ATR A;  3FR0 A;  3BUZ B;  5E26 A;  4QS8 A;  3MAQ A;  4ELU A;  2P1J A;  4LSL A;  3KK2 A;  4CK1 A;  2OCE A;  1WB9 A;  3TAQ A;  3THW B;  2HBJ A;  4BWM A;  3QES A;  2ZE2 A;  1DLO A;  5C25 A;  3KLI A;  1BHL A;  3HK2 A;  5C42 A;  4BC4 A;  1CZ9 A;  4JI4 K;  3ZX0 A;  1HKB A;  2HND A;  1X9W A;  2UUA K;  3V1Q A;  4ISG A;  5GIP A;  3CQX A;  4CGF A;  1S6Q A;  1RT6 A;  3L2Q A;  5FRN A;  3OYN A;  4AH9 A;  1NGE A;  3K59 A;  3T7Z A;  3WXM B;  4F3T A;  3MCP A;  1LWC A;  3EKU A;  4FWK A;  2NRV A;  4WFA L;  1HQE A;  3PIP L;  1VQ9 N;  4CZG A;  5LL6 Z;  1XNR K;  3CXC M;  3DXK A;  5AQO A;  4CIF A;  3BEX A;  4J8F A;  1NNE A;  3BGR A;  4CGD A;  4C1N K;  2D0O A;  1NGB A;  3O9Q A;  4L3Q A;  1WNS A;  1I3A A;  3MED A;  3NFA A;  1JLA A;  4KRF A;  1JKH A;  3CM5 A;  5BN9 A;  1C0U A;  4E0D A;  3ISN C;  5ELZ A;  3WXI A;  4BE0 A;  3KD1 E;  2OZS A;  4LFB K;  4DFK A;  2ZM6 K;  3P5J A;  1A5V A;  4DQS A;  4FLX A;  2KW4 A;  5DMR A;  4BAC A;  1EO1 A;  4JS4 A;  3OJS A;  1WSI A;  3AGR A;  2QK9 A;  1S9G A;  3IDH A;  3N4P A;  1BUP A;  2QWO A;  2V52 B;  5HRR A;  4A57 A;  1BDG A;  2D0B A;  4LH4 A;  3A8Y A;  2BAN A;  2ZJQ L;  1A5W A;  3U8X A;  4DF4 A;  1QHA A;  1WSH A;  3C6T A;  4JLH A;  2YKN A;  2P9P B;  1WSJ A;  1DKG D;  3OS0 A;  4MQ3 A;  4UQG A;  1HPM A;  2E6M A;  3EL2 A;  4RG8 A;  1S22 A;  4CJL A;  4AM6 A;  3KWI A;  3P4I A;  3D2F A;  4YHH K;  3G0Z A;  4NYF A;  1NK6 A;  4XH4 A;  4KHS A;  3CD6 N;  4H0V B;  4AF1 A;  2PZS A;  4G1Q A;  4YDU C;  4F2R A;  2D0A A;  1C0M A;  3U4L A;  1S3X A;  1IBM K;  1KTQ A;  3LWM A;  4LFC K;  5JMV A;  2FXU A;  3QIN A;  1NOZ A;  3L2W A;  4N56 A;  4JV5 K;  3MXJ A;  4BRP A;  3VQC A;  4NXM K;  1JLE A;  3AY9 A;  1HKG A;  4WQ5 A;  1KQS M;  1RDD A;  3VF2 A;  2P9S A;  5GIN A;  2DFH A;  4PKG A;  3H46 O;  2O8F B;  2VWJ A;  1E4G T;  2O8C B;  1U47 A;  4RW4 A;  5AFU H;  4A59 A;  1S1W A;  4JD2 A;  1HQU A;  3QEX A;  1KVA A;  3JYT A;  1JLF A;  1HX1 A;  3VQE A;  4W5N A;  1HR0 K;  4PWD A;  3SQ0 A;  4N5S A;  4BRO A;  4CJU A;  1REV A;  4DTN A;  1UA1 A;  2HF4 A;  2B6A A;  1BA0 A;  3QO9 A;  4QAG A;  3AVL A;  4OGC A;  4FCY A;  3BZC A;  2EWS A;  5C2F A;  1S5J A;  4DR3 K;  3TTF A;  4DTP A;  1MA9 B;  1TL1 A;  4DR5 K;  4CJR A;  1IKX A;  4CZJ A;  3LDQ A;  3S3M A;  1WUA A;  4FW1 A;  3SMP A;  2YHA A;  1Y97 A;  4LSN A;  3ULE A;  3PUF A;  4WE1 A;  3CFO A;  1RDA A;  4FJI A;  4E1M A;  3KJV A;  1VQ6 N;  1NGA A;  3DXM B;  3MDQ A;  4CHQ A;  3NBP A;  3PLA A;  4Z94 A;  3NH1 A;  3CC7 N;  5KI6 A;  2A1S A;  2IVN A;  3HTV A;  2B5J A;  1KVB A;  2VWB A;  3ASM A;  3LDP A;  3VQ5 A;  3MN5 A;  2UXB K;  3UB5 A;  5LMN K;  4KTZ A;  3PY8 A;  4CJ7 A;  1XC9 A;  4CEO A;  3TR8 A;  2Y1J A;  2YHX A;  3AVH A;  4CJW A;  3Q7C A;  5FPM A;  1GLF O;  4HUE A;  3TTC A;  5BPL A;  3ZET B;  1H1V A;  4FVU A;  1QQN A;  4JK7 A;  4FJJ A;  3AVC A;  2PY5 A;  1LW2 A;  1FKO A;  1T6C A;  4JKF A;  3FZK A;  4DMN A;  4JYA K;  3C94 A;  5GAG P;  2UUC K;  1WSG A;  4FJK A;  3J80 O;  3OYC A;  2QW9 A;  5CZ1 A;  4CJT A;  4DSE A;  1J5O A;  1K6Y A;  1DTT A;  2E2N A;  3K5L A;  2ITG A;  4H0T B;  3KD5 E;  1JCG A;  3K0S A;  3ENH A;  3O3H A;  1VK0 A;  3L4I A;  2VQF K;  3SUP A;  3MCA B;  3MK6 A;  4DR7 K;  3CER A;  1O13 A;  1KAX A;  3L4Q A;  4BR7 A;  3CM6 A;  1RT5 A;  4CJ3 A;  4DUY K;  3O9T A;  4FOI A;  2IDO A;  4DQI A;  1FKP A;  1HNZ K;  3VQB A;  4M3Y A;  3WNG A;  2YV0 X;  2YNH A;  4JHD B;  3CCJ N;  5FRO A;  3LWL A;  4FJX A;  3VN5 A;  4LY7 A;  5AQW A;  4AHV A;  5I42 A;  3UIQ A;  2P5G A;  1CZB A;  2IIR A;  2D0C A;  1SZ2 A;  2FBX A;  4X66 K;  4BR4 A;  2E2P A;  2P9N A;  1NM1 A;  5EVZ A;  3KKS A;  4OPJ A;  1IKW A;  2XY8 A;  4DS5 A;  4FK2 A;  2DTU A;  3U3G A;  1WLJ A;  2CGJ A;  5F1X A;  3EEQ A;  3IUC A;  5AQG A;  3HRG A;  2ASM A;  3SCX A;  1CXQ A;  4BRG A;  2I7N A;  1KAY A;  4LF6 K;  2QXL A;  3ZSO A;  3ZEU B;  4IOX A;  1D5A A;  3HPG A;  4B1W B;  2P5O A;  3CCR N;  4GW6 A;  2P9I A;  3VF4 A;  2E5L K;  3NH2 A;  1YTU A;  3DWL A;  1OH7 A;  3NF7 A;  3DOK A;  3Q7B A;  1LCU A;  3TAR A;  2F9W A;  4B3S K;  2G8F A;  1TVR A;  4U67 L;  4KB1 A;  3THY B;  1CXU A;  3PX4 A;  1BWF O;  4NCG A;  4JKA A;  3N4Q A;  3RR8 A;  2O8D B;  4FSV A;  4FLV A;  3M3Z A;  4JI3 K;  4B9M A;  1QS4 A;  3MMV A;  1DT9 A;  4DLE A;  2BUP A;  3CYM A;  1SQK A;  4ZHR A;  3CCU N;  1KCF A;  1WBD A;  3NGY A;  4IEE A;  3NDK A;  1YT3 A;  4IKF A;  1QQO A;  2E2Q A;  1O1W A;  3SUQ A;  3KWG A;  1IJJ A;  1LOT B;  4WFN L;  3RRG A;  2KTQ A;  3M1F A;  2QWN A;  2ASP A;  3SAF A;  3CC4 N;  1J5E K;  3HYF A;  3AA5 X;  3HST B;  1W7A A;  3LDL A;  1YJW N;  3R3L A;  4FLU A;  2Q3S A;  4E89 A;  4BGA A;  1S6P A;  3E9L A;  4KHN A;  1BIU A;  3H3N O;  3L2U A;  4CEA A;  1HLU A;  3V81 A;  1W2B M;  4FPB A;  2FF6 A;  5C12 A;  4IDH A;  1LWF A;  2YHB A;  4DV3 K;  1EWR A;  4TSX A;  2E1Z A;  2Z1J A;  1SL1 A;  5H1S Q;  5J2M A;  5CHI A;  3E9O A;  5C2D A;  4E7K A;  4O5B A;  2UU9 K;  3CFP A;  3SUO A;  3ID8 A;  3D45 A;  1LV5 A;  3VEW A;  4WQ5 C;  5AQY A;  1JLB A;  3DLK A;  2NRT A;  3SV3 A;  3SNN A;  3AV9 A;  3FZL A;  4B8C A;  2OPR A;  1Q86 O;  3GDQ A;  2F8S A;  3WXK A;  3OYG A;  2A40 A;  3SPZ A;  1BI4 B;  1RNH A;  4BC3 A;  4GVM A;  4O8U A;  1T05 A;  2P9L A;  1JXB A;  1RTJ A;  3CME N;  1RT1 A;  4H5W A;  4JKC A;  4PUO A;  3A5N C; 
#chains in the Genus database with same CATH homology
 1XI1 A;  2RF2 A;  1BI4 A;  4AHU A;  4F3O A;  4FW2 A;  1NKC A;  4CJP A;  4BDP A;  1NK4 A;  1NJX A;  3M8S A;  3K57 A;  4LD0 A;  1SKS A;  3MAQ A;  1W9H A;  4FJ8 A;  4ELU A;  2P1J A;  3MEG A;  1X1P A;  4IG3 A;  3LZJ A;  4BE2 A;  4LSL A;  1ZBF A;  3KK2 A;  2PYL A;  3RR7 A;  4CK1 A;  4B9N A;  5FDL A;  5J1E A;  3TAQ A;  3I0S A;  1BQM A;  2KZZ A;  1RTH A;  4BWM A;  3QES A;  2ZE2 A;  3M8P A;  1NK9 A;  4DSJ A;  1UAX A;  2X6N A;  1VSD A;  4F8R A;  3QNN A;  2O4I A;  1DLO A;  3KIO A;  5C25 A;  3KLI A;  3VQ7 A;  1BHL A;  4KB0 A;  3HK2 A;  5C42 A;  2XO7 A;  4AHS A;  4FM1 A;  1CZ9 A;  4CEB A;  3QEW A;  2BDP A;  4EZ9 A;  4M3Z A;  2XY7 A;  3QIP A;  3S9H A;  2E4L A;  2LSN A;  2WON A;  2HND A;  4HCC A;  3SQ4 A;  1X9W A;  4ELT A;  1FK9 A;  3FFI A;  4CGH A;  1IH7 A;  3QNO A;  3V1Q A;  1Q9X A;  3KLG A;  1RDC A;  2Z1H A;  4CEE A;  3DLH A;  2RKI A;  3LP2 A;  1S6Q A;  4CGF A;  1NJY A;  1RT6 A;  3L2Q A;  1D9F A;  3HPO A;  3OYN A;  3HL8 A;  4AH9 A;  1U49 A;  5FRN A;  3K59 A;  2G8I A;  3TAG A;  1J9A A;  4CJV A;  1JLQ A;  4KAZ A;  2IC3 A;  2RPI A;  2I5J A;  4KV8 A;  1T8E A;  1NK0 A;  4F3T A;  1WAJ A;  1RTI A;  4HHT A;  1LWC A;  5CY4 A;  4XIU A;  4CEC A;  3ZT0 A;  5KGW A;  4CFC A;  1TAU A;  3TAN A;  2YKM A;  1HQE A;  1BIZ A;  3KTQ A;  3KLE A;  4K8Z A;  5D3G A;  1QQC A;  1QSS A;  2NUB A;  4CIF A;  4KHW A;  4K8X A;  4ELV A;  2ETJ A;  2G8K A;  2QXF A;  1RBT A;  4OKK A;  3BGR A;  4AIL C;  4CGD A;  4IBN A;  4YNQ A;  4KKO A;  5HRP A;  3C95 A;  4KTW A;  4E7J A;  1WNS A;  1KLN A;  1I3A A;  3MED A;  3NFA A;  1JLA A;  1U48 A;  4KRF A;  1JKH A;  3CM5 A;  4E0D A;  1C0U A;  3LPU A;  3LP3 A;  3ISN C;  4CK2 A;  2HMI A;  4BE0 A;  3K5N A;  4O44 A;  3KD1 E;  3DLB A;  2OZS A;  4DFK A;  1C1C A;  4M41 A;  4C8N A;  1HMV A;  3P5J A;  5HBM A;  1A5V A;  4DQS A;  3HP6 A;  3AVA A;  4H4O A;  4FLX A;  2HHV A;  1B9F A;  3IAY A;  2KQ2 A;  2KW4 A;  5DMR A;  4BAC A;  3V9Z A;  4JS4 A;  3OJS A;  1WSI A;  3PX6 A;  4J2A A;  2R7Y A;  4E3S A;  2X78 A;  2EHG A;  4OKE A;  5JS1 A;  2QK9 A;  3PV8 A;  3OYA A;  1EX4 A;  1ZBH A;  2X74 A;  1S9G A;  4FJM A;  4O0I A;  3PO4 A;  2HB5 A;  5HRR A;  4CJ4 A;  3T3F A;  2D0B A;  1C0T A;  3LAL A;  3AVG A;  4LH4 A;  4YFU A;  3NCI A;  3LZI A;  3RRH A;  2BAN A;  3TAB A;  1KFS A;  1D8Y A;  3K2P A;  1RBS A;  1RBU A;  3LDS A;  2G8W A;  1A5W A;  3DMJ A;  2PYJ A;  4DF4 A;  3RMB A;  1WSH A;  3C6T A;  4JLH A;  1U45 A;  2HNY A;  4CEZ A;  1JL1 A;  4CFA A;  5KTQ A;  2YKN A;  3AVI A;  3L3V A;  4H4M A;  1WSJ A;  3OS0 A;  3OYJ A;  4MQ3 A;  4UQG A;  4N76 A;  2HHU A;  2E6M A;  1TGO A;  1LAV A;  4W5Q A;  4J2E A;  1VSJ A;  4RG8 A;  3B6P A;  4E19 A;  4DLG A;  3P1G A;  1YVU A;  4CJL A;  3OYH A;  3HVR A;  1LWE A;  1VSF A;  1VRT A;  2VG7 A;  1TK0 A;  3G0Z A;  3HP9 A;  4O0J A;  4NYN A;  4NYF A;  1C6V A;  3VQD A;  3OYF A;  1SL0 A;  1NK6 A;  3MEE A;  4E7I A;  2G8U A;  1RDB A;  4KHS A;  4JRQ A;  2XHB A;  2PZS A;  3JSM A;  4G1Q A;  4CEF A;  1NK5 A;  2WOM A;  4IDK A;  1XHZ A;  5SZT A;  3V9W A;  2VG6 A;  1SL2 A;  3TAF A;  2D0A A;  1EP4 A;  1C0M A;  4F2R A;  4DTX A;  1G15 A;  3THV A;  1R0A A;  4CJ5 A;  3V9S A;  2KZM A;  3VQ9 A;  2OPP A;  3K5M A;  3L8B A;  1KTQ A;  3LWM A;  2JLE A;  3S3N A;  3MXM A;  1D9D A;  2HVI A;  4FZZ A;  1A5X A;  4NCB A;  4W5O A;  1HNV A;  1NOZ A;  3QIN A;  3L2W A;  4Z4C A;  4OLA A;  1IKV A;  4KI6 A;  4N56 A;  1JLG A;  3MXI A;  1NKB A;  1VSH A;  3HVT A;  3MXJ A;  4CHZ A;  3AVB A;  4CFB A;  4B3O A;  4DTO A;  1RBR A;  1KRP A;  3VQC A;  4GMJ B;  3QET A;  4FLW A;  1JLE A;  2IAJ A;  4MFB A;  3ZCM A;  3NGI A;  3AVN A;  4CF1 A;  1HYZ A;  1RDD A;  4EP5 A;  1VSK A;  2IOC A;  1N5Y A;  4CHY A;  2DFH A;  3AO4 A;  3DOL A;  3QER A;  3MEC A;  3HPH A;  1QSY A;  2VWJ A;  3RTV A;  4DQR A;  3VQ4 A;  1U47 A;  4RW4 A;  1WAF A;  3ALY A;  2W42 A;  3KKR A;  4CHP A;  3I0R A;  4DQQ A;  4FVM A;  3VQQ A;  3QEI A;  1S1W A;  1BQN A;  1MU2 A;  1HQU A;  3QEX A;  1KVA A;  3JYT A;  3OYL A;  1B9D A;  3QEP A;  4QOZ B;  1S9E A;  1JLF A;  2KFN A;  1T03 A;  5KGX A;  3V4I A;  3VQE A;  1T7P A;  4W5N A;  4I9Q A;  4KHQ A;  3ULD A;  3AVF A;  4PWD A;  1HJR A;  3SQ0 A;  4N5S A;  1NK7 A;  4CJU A;  1REV A;  3I8D A;  2VWK A;  4DTS A;  2JGU A;  4DTN A;  1UA1 A;  2B6A A;  4KO0 A;  4Z0U A;  3QO9 A;  5J2P A;  4QAG A;  3CFR A;  4DU3 A;  4Q0B A;  1JL2 A;  2Y1I A;  4J2D A;  1TKZ A;  4CJK A;  3AVL A;  4OGC A;  4FCY A;  4OGE A;  3V9U A;  4FK4 A;  4FXD A;  2GUI A;  3RMD A;  3TI0 A;  1S5J A;  3OYM A;  3OYK A;  1N6Q A;  3VQP A;  3SQ2 A;  4DTP A;  1B92 A;  4DF8 A;  1Z26 A;  1TL1 A;  4RW7 A;  4CJR A;  1IKX A;  1VSE A;  2E6L A;  3RMA A;  3S3M A;  1SKR A;  3ZSR A;  4AHT A;  4FW1 A;  3HT3 A;  2YHA A;  4B08 A;  1Y97 A;  3OJU A;  4LSN A;  4BDY A;  4DTM A;  3O3G A;  1NJW A;  1TK5 A;  1RT4 A;  4N47 A;  2G8H A;  3PUF A;  4WE1 A;  3CFO A;  1RDA A;  4FYD A;  2F96 A;  4E1M A;  3KJV A;  4FLZ A;  2BE2 A;  3LAM A;  4FJI A;  1S1U A;  1VRU A;  4M45 A;  4QCL A;  4CHQ A;  2ZD1 A;  3NBP A;  2B4J A;  3NH1 A;  1BL3 A;  1C1A A;  4DFP A;  1HNI A;  3DI6 A;  3IRX A;  5KI6 A;  2A1S A;  4M3U A;  5HRN A;  3ZSX A;  2B5J A;  1KVB A;  1UA0 A;  4KRE A;  3ASM A;  4DFM A;  3AA4 A;  2XY6 A;  4BDZ A;  1JLC A;  1U4B A;  4DSI A;  3L2V A;  3VQ5 A;  4CF9 A;  1ITG A;  1WSF A;  3OYD A;  3QIO A;  3VQ6 A;  4KTZ A;  3V9X A;  2P51 A;  3NF8 A;  3PY8 A;  4RW6 A;  3DLG A;  1XC9 A;  4L8R B;  1JXE A;  4CEO A;  4HTU A;  3TR8 A;  3M8R A;  1GOA A;  3ZSZ A;  2Y1J A;  3LP1 A;  5HP1 A;  4KPY A;  2OPQ A;  3AVH A;  3LP0 A;  4CJW A;  1EET A;  1RT7 A;  2EX3 A;  1U04 A;  4EP4 A;  3SJJ A;  4HUE A;  4DFJ A;  2FBY A;  4EZ6 A;  2D5R A;  4ZTF A;  4FJG A;  4DSK A;  4FJH A;  4Z4I A;  3V1R A;  1BIS A;  4RW8 A;  3EY1 A;  4J2B A;  4Z4E A;  5DK5 A;  3LAN A;  1RCH A;  4KTQ A;  4FJJ A;  3AVC A;  1VSI A;  5KRS A;  2XRI A;  3EYZ A;  1LW2 A;  4E7L A;  2PY5 A;  3F9K A;  3IG1 A;  3E01 A;  4FM2 A;  1ASV A;  5J2Q A;  1L5U A;  1FKO A;  4H8K A;  2QKB A;  3TWH A;  4ID1 A;  4DMN A;  1VSM A;  4E1N A;  3VA0 A;  1QSL A;  4B9S A;  4KHY A;  3C94 A;  4W5T A;  1J54 A;  1XWL A;  4JRP A;  3RWU A;  2F8T A;  1ZYQ A;  1WSG A;  4FJK A;  3ZT3 A;  1NKE A;  4Y1C A;  5CYM A;  5E41 A;  3G10 A;  1GOC A;  3SI6 A;  1ZBU A;  4RW9 A;  3OYC A;  5CZ1 A;  4FJL A;  3H08 A;  4N41 A;  4CJT A;  4DSE A;  3C6U A;  3TAP A;  3KLH A;  1J5O A;  3VQA A;  1K6Y A;  4DU4 A;  1DTT A;  4OPK A;  1UWB A;  3O4Q A;  2FBV A;  3K5L A;  2ITG A;  3KD5 E;  3P83 D;  3WNH A;  4Z4H A;  3DRP A;  3NE6 A;  4AHC A;  3OYE A;  3O3H A;  1VK0 A;  2YNF A;  1QTM A;  3VA3 A;  3BDP A;  4DU1 A;  4CJS A;  1LW0 A;  3DYA A;  4BWJ A;  3SUP A;  4FK0 A;  4CJF A;  3PX0 A;  3VQ8 A;  1ZBI A;  4M3T A;  1BGX T;  4I7F A;  2KFZ A;  2DY4 A;  4FJ9 A;  4CF2 A;  1S1X A;  1YTA A;  1CLQ A;  4CJE A;  2DFF A;  3CM6 A;  1RT5 A;  3L2R A;  2AJQ A;  4CJ3 A;  3DLE A;  4HUG A;  3SPY A;  5EU7 A;  3LAK A;  1Z25 A;  3HXM A;  2IDO A;  2A1R A;  1X9S A;  4DQI A;  4NCA A;  3OS2 A;  1FKP A;  1F21 A;  5JS2 A;  4CHO A;  4FJN A;  4R5P A;  4PQU A;  1RIL A;  3VQB A;  4DTR A;  4FLY A;  4M3Y A;  3WNG A;  2YV0 X;  2YNH A;  1ASW A;  3AO5 A;  4DG1 A;  5CZ2 A;  2IS3 A;  3NAE A;  2HHW A;  4B9T A;  2ZQB A;  3F73 A;  5FRO A;  4HCB A;  3LWL A;  2ATQ A;  4FJX A;  2OPS A;  3OVN A;  3ITH A;  3VN5 A;  4LY7 A;  3KLF A;  2X6S A;  4CGG A;  4AHV A;  1FXX A;  1S1T A;  5K14 A;  1GOB A;  3D0P A;  1RBV A;  5I42 A;  3UIQ A;  4HVJ A;  2P5G A;  1CZB A;  3B6O A;  2Z1I A;  4PA1 A;  1EXQ A;  2DFE A;  4BE1 A;  4DSL A;  5C24 A;  2D0C A;  4M3W A;  2HHT A;  1C1B A;  1TAQ A;  4B9U A;  2OYQ A;  3SYZ A;  2FBX A;  3AVK A;  3KKS A;  4OPJ A;  1IKW A;  2XY8 A;  1XHX A;  4DS5 A;  3V6D A;  1NJZ A;  4FK2 A;  2VG5 A;  2DTU A;  4FJ5 A;  1VSL A;  3U3G A;  5T7B A;  1WLJ A;  3KK1 A;  3ZSV A;  2Z1G A;  3S3O A;  3PO5 A;  3U6F A;  4DS4 A;  1IKY A;  4CES A;  1IO2 A;  1BCO A;  2RN2 A;  2G8V A;  1TL3 A;  4F2S A;  1J53 A;  1KFD A;  3AA2 A;  4FZX C;  2YNI A;  3SCX A;  4CIE A;  3LPT A;  4DTU A;  1IG9 A;  1CXQ A;  1NK8 A;  5HLF A;  2OZM A;  1QHT A;  3NGZ A;  3NH0 A;  5HRO A;  3ZSO A;  3DRS A;  3NF9 A;  4B8A B;  3OY9 A;  3U3Y A;  4M3X A;  1D5A A;  1WN7 A;  3HPG A;  2P5O A;  4CEQ A;  4GW6 A;  4KFB A;  4O4G A;  4FLT A;  1KSP A;  3EZ5 A;  3NH2 A;  1YTU A;  4KHU A;  3DLR A;  4DSF A;  1L3U A;  1TKT A;  3O3F A;  4JS5 A;  3NF7 A;  3DOK A;  1DTQ A;  1I39 A;  3ZSQ A;  4M3R A;  4Y1D A;  2O4G A;  4CF0 A;  4I2P A;  4OKJ A;  3TAR A;  4CGI A;  2IGI A;  1SUQ A;  3AVM A;  4O55 A;  3HM9 A;  3NF6 A;  2G8F A;  3SQ1 A;  2HHS A;  1TVR A;  3DM2 A;  3T1A A;  1EKE A;  1TK8 A;  1SKW A;  4KB1 A;  1CXU A;  3PX4 A;  2HW3 A;  3OS1 A;  4KI4 A;  5I3U A;  3ZT1 A;  4OJR A;  4ZTJ A;  4NCG A;  1W0H A;  4DQP A;  4DWI A;  2GBZ A;  4I9L A;  2FC0 A;  4PY5 A;  3RR8 A;  4Z4F A;  1WSE A;  3OYB A;  4FLV A;  1BCM A;  3SUN A;  1RTD A;  3CQ8 A;  1QS4 A;  4HUF A;  3RMC A;  2XY5 A;  4B9M A;  1L3V A;  1ZBL A;  4DLE A;  4FJ7 A;  3K5O A;  3CYM A;  3NHG A;  4B9L A;  4B9V A;  4CF8 A;  4ZHR A;  1LAW A;  1KCF A;  1NOY A;  4OLB A;  3HJF A;  3M8Q A;  3K58 A;  3NGY A;  4CK3 A;  5SWM A;  1L3S A;  3NDK A;  1S1V A;  1YT3 A;  2FBT A;  4IFY A;  4CED A;  1SV5 A;  1Q9Y A;  4IKF A;  3SV4 A;  1O1W A;  3ZT2 A;  1HYV A;  3SUQ A;  1QE1 A;  4CHN A;  2KTQ A;  3DRR A;  4CJQ A;  2HNZ A;  5HRS A;  5J2N A;  4IG0 A;  4W5R A;  3RRG A;  4FM0 A;  3O4N A;  4IFV A;  3HYF A;  3QLH A;  3AA5 X;  1HPZ A;  3HST B;  1L3T A;  2GV9 A;  3T19 A;  4E7H A;  4LH5 A;  4FLU A;  2Q3S A;  4Z4G A;  4E89 A;  3AO1 A;  3AO3 A;  3WNF A;  1S6P A;  4KHN A;  1BIU A;  4C8M A;  3V1O A;  4ID5 A;  3L2U A;  4CEA A;  3KK3 A;  3V81 A;  1RT2 A;  1TV6 A;  3AVJ A;  2BGG A;  2QKK A;  4Q5V A;  3HO1 A;  1LWF A;  4CFD A;  2YHB A;  1TKD A;  2YNG A;  4CE9 A;  1HRH A;  4TSX A;  2Z1J A;  1SL1 A;  5J2M A;  2HHX A;  3SZ2 A;  4E7K A;  3AA3 A;  4O5B A;  2HVH A;  1ASU A;  4AHR A;  5KRT A;  3CFP A;  3SUO A;  4CGJ A;  2HHQ A;  3D45 A;  1LV5 A;  4C8L A;  4CCH A;  4FZY A;  1JLB A;  3QEV A;  5FRM A;  3TAM A;  3DLK A;  3ZT4 A;  3SNN A;  3SV3 A;  3AV9 A;  1KVC A;  1Q8I A;  2OPR A;  3ZSW A;  4B8C A;  1TKX A;  5CYQ A;  4F4K A;  2F8S A;  1RT3 A;  3L3U A;  4OVL A;  1UOC A;  3ZSY A;  3OYG A;  3A2F A;  4C8O A;  1KLM A;  4CIG A;  3WNE A;  3SPZ A;  1BI4 B;  1X9M A;  1RNH A;  3IS9 A;  3TAE A;  4M42 A;  3CG7 A;  3AO2 A;  2OA8 A;  4GVM A;  1HYS A;  4CER A;  1T05 A;  1JXB A;  1RTJ A;  4I2Q A;  4ICL A;  4DTJ A;  1RT1 A;  4PUO A;  3OYI A;  4C8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...