4CK3A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck3A00
1LV5A 5J2PA 4WE1A 2OPQA 4I9LA 2B6AA 4J2AA 2WOMA 4O44A 4H4MA 1RT1A 2IOCA 1HQEA 3TANA 2Z1HA 2G8IA 4KB0A 3T3FA 3JSMA 4FW1A 3LZJA 1JLEA 4FVMA 4FK0A 3L3VA 5CYMA 5C24A 3RWUA 4CIEA 1RT5A 3WNFA 4CF1A 1S1WA 1QSSA 1KVCA 3AVFA 4CF2A 2DFHA 1TK8A 4B9LA 2D0AA 3V1QA 4CGGA 4F3OA 5J2NA 1LW2A 3PX4A 2HHUA 1NOYA 4ELVA 1TL1A 1TAQA 1JLCA 2O4GA 4GMJB 3V81A 4HTUA 5SZTA 2P5GA 2F8TA 3TR8A 3SUPA 1VSLA 2ATQA 3AO5A 4IG0A 5DMRA 5HP1A 1JXEA 2ZE2A 3WNGA 3TI0A 3LP2A 4IFYA 1REVA 2IAJA 3VQ4A 4BACA 1WNSA 4KTZA 1XHXA 1UA0A 4FK4A 1YTUA 1K6YA 2RKIA 3AA5X 1TVRA 3LP1A 4DFPA 4PA1A 4DQSA 4YFUA 4CESA 3NCIA 2XO7A 1S6PA 4DTOA 5KI6A 3KLEA 5J2MA 2HNZA 1ITGA 4HVJA 3RMCA 3QEPA 1VSHA 4B9MA 3V9WA 3P83D 3ZCMA 1RBVA 3CYMA 3DYAA 4DSLA 5D3GA 4YNQA 1HJRA 1S1UA 2LSNA 2KFNA 3HP6A 4Z4HA 3LZIA 3ZSVA 1LW0A 4FLYA 1D9DA 4ELTA 2IS3A 3BGRA 4F2RA 4L8RB 2NUBA 4CF9A 2GV9A 3G10A 3QNNA 4FJKA 4F3TA 4DQQA 4FLZA 4FJXA 1EP4A 4PY5A 3L2UA 1JLQA 3HVRA 4JLHA 3VQ5A 3HM9A 1VRUA 3QNOA 1U49A 1VSEA 3O3GA 4NCBA 1SL1A 1KVAA 1VSFA 3AVLA 4EZ6A 3RMBA 3EY1A 4ZTFA 3KKRA 4DF8A 3LAKA 4CJTA 1U45A 1C1CA 2X6NA 4N41A 3P1GA 2KZMA 3IRXA 4E19A 4CEFA 1CZ9A 3KLGA 2Y1IA 3RRGA 4OKKA 3U6FA 5EU7A 3O4NA 5HROA 3OS1A 1RT7A 4OGEA 2R7YA 4FLXA 3V6DA 3BDPA 4C8OA 2E6LA 2PYJA 2YNHA 3SUNA 2O4IA 1X9MA 4W5QA 1HPZA 3OYDA 4B3OA 4EP4A 4FW2A 3KK3A 1ZBUA 3IG1A 1BI4A 3KK2A 1S1TA 4DSIA 3OYKA 4EZ9A 1RDDA 2HHVA 4JS5A 4IKFA 1RBSA 3K5OA 4CJ4A 1UOCA 4KB1A 1QE1A 4BE1A 3ZT3A 1J9AA 3WNHA 3AVJA 4CGFA 4W5TA 4C8MA 3TWHA 1BHLA 4FLVA 1ZBLA 1ZBHA 4I2QA 3LP0A 3EZ5A 1RT4A 3NF6A 3TARA 5CZ1A 2XY8A 2B5JA 3OYLA 1KFSA 3I0SA 1IG9A 4KPYA 5JS1A 2ETJA 1GOBA 2YV0X 4OVLA 1J53A 1NK5A 3QIOA 2KZZA 3P5JA 4OJRA 4H8KA 3NBPA 4LSNA 3F73A 3U3GA 3PUFA 3SQ2A 3SUOA 3THVA 2JLEA 3T19A 4CEOA 4DTUA 1NK8A 1T8EA 2I5JA 1BCMA 4CCHA 1C0UA 1TL3A 4Z0UA 3VQ9A 3LDSA 3OJSA 3WNEA 4DS5A 5FRMA 3CM6A 4BDZA 4DS4A 4B9SA 1SV5A 3ZSOA 3ITHA 1HNIA 2YKMA 4LH5A 1C0TA 4BE0A 4DLEA 4AH9A 4CHYA 1EKEA 3PY8A 4N76A 4DSEA 3SV3A 3VQ6A 3LANA 2FBTA 3NE6A 3TAGA 4FYDA 1BISA 1C1BA 5I42A 3DLHA 3AO1A 4OPJA 3O3HA 1WSFA 3TAPA 3AO4A 1B92A 1X9WA 4FJIA 1G15A 3SI6A 1D9FA 3G0ZA 4E7JA 1J5OA 3RRHA 3O3FA 2X78A 4XIUA 3NH0A 1SKWA 1HYSA 2KTQA 3DRSA 4FLWA 4CJWA 3VQCA 3QEVA 3OVNA 4CJRA 3V9XA 2XY6A 4FK2A 4J2EA 3TAFA 2HW3A 1VSDA 1TKTA 1L3TA 3DI6A 3C6UA 2Z1GA 3OYCA 3SPZA 1JLFA 3ISNC 2E4LA 2Q3SA 5HRPA 3K5NA 1XWLA 4KHQA 4CEDA 1XC9A 4FJ5A 1J54A 3KD1E 2HHQA 1Y97A 3NH2A 4NYFA 4B08A 4CJUA 5SWMA 3V9SA 4DTNA 4DTPA 4HCBA 4I2PA 4QAGA 3NGYA 3QLHA 1RDCA 4N56A 3KLHA 1RBUA 2KQ2A 4FLTA 3NGZA 4ZTJA 2BE2A 2VWKA 3V1RA 3L8BA 3DMJA 4CHNA 1S6QA 1IKXA 4E7KA 1TK5A 1R0AA 3ZT0A 3OYGA 1A5VA 1DTTA 2YNGA 4O4GA 4C8KA 3F9KA 2FBVA 3OYJA 1TKXA 1LAWA 2PY5A 4DG1A 1QSYA 3HYFA 1S1VA 3DLGA 3UIQA 4ICLA 3VN5A 4RW8A 1U4BA 4MFBA 4HUGA 1QS4A 2BANA 3V9ZA 4CHQA 2G8UA 3RMDA 3ALYA 3PX6A 3IAYA 1NJZA 4CFCA 4E89A 1X1PA 5HBMA 3LPUA 1UWBA 4DU1A 3TAQA 4W5OA 3SQ0A 2G8HA 3DOLA 3I0RA 3K5LA 3NAEA 1RBRA 4FJGA 3FFIA 4C8LA 1LWEA 1QTMA 3OYAA 4OPKA 4CGJA 2OPPA 2ZD1A 1JLAA 5KGXA 3MEDA 4AHRA 3I8DA 4DTRA 4DSJA 4KHWA 2HNYA 1HYZA 3AVCA 4AHVA 1KFDA 1L5UA 4BDPA 2WONA 4ID5A 2OA8A 1WN7A 4GW6A 2HMIA 5T7BA 4CHPA 5JS2A 4M41A 1D8YA 1KTQA 3KKSA 1I3AA 4RW9A 3CFRA 1DLOA 1NK9A 1T03A 3NGIA 3U3YA 1TKDA 5HRRA 2G8VA 5DK5A 4KRFA 2P1JA 5CY4A 4CGHA 3OYFA 3AA4A 2YNFA 3OS0A 3MXIA 3EYZA 1NJWA 1U04A 2VWJA 3HVTA 3M8RA 4DTSA 4FXDA 4KHSA 4OKEA 5HRNA 1U47A 1RTHA 3C94A 1NKBA 1YVUA 5I3UA 2G8WA 4TSXA 4O0JA 2Y1JA 1TK0A 4M3XA 4DSFA 1RDBA 3NHGA 2OZSA 4JRPA 3V4IA 1JXBA 4CE9A 4PWDA 4CEBA 2DY4A 1HNVA 3VQEA 4CFBA 1IKYA 3NF7A 3CFOA 4E1NA 4DF4A 3RR7A 1BI4B 1RBTA 3QETA 4AHTA 3AV9A 1KLMA 4CJPA 4M3RA 1SL0A 4I9QA 3C6TA 1CZBA 4OGCA 2XRIA 2YNIA 1L3SA 4CF8A 2HB5A 4CJEA 3PO5A 3LPTA 4CHZA 3K58A 3JYTA 2PYLA 4HHTA 4N47A 3AO2A 1A5XA 5FRNA 3VQDA 5KGWA 2D0BA 1I39A 3AVAA 4OKJA 5HRSA 4N5SA 4CJ3A 4M3YA 3LAMA 1CXUA 3OYEA 3LWLA 1SKSA 4FLUA 3OY9A 4Y1CA 3DLRA 4KI6A 1W9HA 4G1QA 3TAMA 4B9NA 4Z4EA 3CFPA 4OLBA 2RN2A 4FCYA 4FM2A 4B9VA 4CFDA 2RF2A 1RILA 4LH4A 3LALA 4CF0A 3HK2A 4ELUA 3AA2A 4DFMA 4FJJA 1IH7A 4FJ8A 1BIZA 2F8SA 1C0MA 1RCHA 1B9DA 3AVIA 3MXJA 3QIPA 4KV8A 4Z4CA 4F4KA 3M8PA 4B8CA 4FJNA 3SPYA 4NYNA 1ASUA 4FJHA 1VSMA 3QINA 1SL2A 4Q5VA 3AVBA 3L2QA 1QSLA 2HHTA 4DMNA 4RW4A 1IKWA 4CJFA 1JLBA 3DLBA 4K8XA 1HYVA 4DU4A 4E7LA 2HVIA 4DQRA 4J2DA 2JGUA 4CGIA 4FJMA 2YHBA 3SZ2A 1WAJA 4Z4FA 4Q0BA 1RT6A 3DOKA 2VG5A 3ZT2A 2QKKA 3VA0A 1ZYQA 2P5OA 1BQNA 2QKBA 4M45A 3HXMA 1Q8IA 1DTQA 3S3NA 1SKRA 1CLQA 3HL8A 4CFAA 3VQBA 3ZSXA 3MECA 3OJUA 4DTMA 1Q9YA 1Q9XA 1RT2A 3HJFA 3AVMA 4BDYA 1Z26A 3CM5A 1D5AA 2DTUA 2VG7A 4DTXA 4IDKA 4F2SA 1FKOA 1W0HA 1YTAA 3DM2A 4KFBA 3KTQA 4M3WA 1TGOA 4E3SA 4JS4A 4CHOA 4KO0A 2P51A 4KAZA 2A1SA 3V1OA 1S5JA 4FJLA 4AHUA 2HHXA 3K57A 4DTJA 1YT3A 3CQ8A 3ZSRA 3L2VA 1B9FA 1XI1A 3KD5E 4M3TA 3AO3A 1WSEA 1WAFA 2A1RA 1HRHA 3K59A 1NKCA 1RT3A 1NJYA 3MEEA 3RMAA 1S9GA 4LSLA 4DSKA 4E1MA 1A5WA 3OYBA 3SNNA 3QEIA 2BDPA 1WSGA 4R5PA 1KCFA 2RPIA 4KKOA 4AHCA 4UQGA 2F96A 4RW6A 3M8QA 3NDKA 1C6VA 4IFVA 1VSIA 4DU3A 1XHZA 4FM0A 5J2QA 4CK2A 3H08A 1NK6A 4QCLA 3C95A 3QO9A 3QERA 2FBXA 4W5NA 2IGIA 1QHTA 2HHWA 1BGXT 1HMVA 1IKVA 3M8SA 1T05A 4CEAA 1BQMA 4ID1A 3HO1A 2QK9A 1FXXA 1JL1A 4K8ZA 5KRTA 1NKEA 2BGGA 3PX0A 4O5BA 3AA3A 3SUQA 2FC0A 3DLKA 3KIOA 3K2PA 4CJVA 1EETA 1MU2A 3OYHA 3B6PA 3SV4A 3HPHA 3ZSZA 3SJJA 1GOAA 1ASWA 4LD0A 3RR8A 3ZT4A 1NJXA 2IC3A 1S1XA 4DQIA 3L2WA 3SCXA 1Z25A 4F8RA 4PQUA 1FK9A 1JLGA 4IBNA 2G8FA 2GBZA 2EHGA 2HVHA 4CECA 1WSJA 5C42A 4BE2A 4DFJA 1C1AA 1RTIA 1NK7A 3SYZA 3VQ8A 3KJVA 2ITGA 3DRRA 1TV6A 2EX3A 1TKZA 2YKNA 1KVBA 3NH1A 4KTQA 3SQ1A 3MAQA 1ZBFA 3AVNA 3T1AA 2OYQA 3SQ4A 3B6OA 2E6MA 3NF8A 1N5YA 4ZHRA 3ZSQA 1KSPA 4M3UA 4DQPA 2B4JA 1QQCA 4RW7A 1KRPA 4KHYA 4B9TA 3VA3A 1SUQA 3ULDA 4RG8A 3VQ7A 3NF9A 5HLFA 4NCGA 4B8AB 4KI4A 1BL3A 1EXQA 4O0IA 3ZT1A 1VRTA 3OYMA 2OPRA 3AVHA 4CEZA 2HNDA 4BWMA 3LWMA 1U48A 3VQPA 2XY5A 5E41A 2AJQA 3CG7A 3ZSWA 2X6SA 4HUEA 4MQ3A 3DLEA 1RTJA 4E7IA 4O55A 1HQUA 1UAXA 4CERA 1X9SA 4NCAA 4CIFA 1LAVA 3IS9A 1LWCA 3MEGA 4I7FA 4Z4IA 3HSTB 4KTWA 1EX4A 2W42A 3L3UA 5KTQA 3VQAA 4FZXC 4J2BA 3LP3A 2XHBA 4KHNA 1BIUA 3AVKA 2XY7A 1L3UA 1IO2A 4HUFA 3L2RA 4DLGA 3QESA 3KLFA 2KW4A 4C8NA 5CZ2A 1NK0A 4KREA 1ASVA 1WSHA 4CEEA 4CJLA 4FM1A 4IG3A 3K5MA 4B9UA 4E0DA 2KFZA 4GVMA 4FJ9A 1BCOA 2GUIA 1VK0A 1KLNA 3D0PA 4CGDA 2OZMA 4KHUA 4H4OA 1JL2A 2YHAA 4AHSA 2X74A 3HPOA 3TABA 1CXQA 1RDAA 3MXMA 5FROA 4Y1DA 3OS2A 1ZBIA 1JKHA 4CK1A 1F21A 1NOZA 1UA1A 1NK4A 3V9UA 3VQQA 3ZSYA 2HHSA 4BWJA 4FJ7A 2Z1IA 4E7HA 3RTVA 2DFEA 1RTDA 4FZZA 3S3OA 3S9HA 4CJ5A 3QEWA 3DRPA 4CEQA 3OYNA 3ASMA 1WLJA 3KK1A 5C25A 4DFKA 4OLAA 4FZYA 3PV8A 3NFAA 2QXFA 4JRQA 1WSIA 4HCCA 4Z4GA 3HP9A 4EP5A 4CK3A 2OPSA 5KRSA 5CYQA 3O4QA 1N6QA 3E01A 1VSJA 4PUOA 2D0CA 4AILC 1L3VA 4M3ZA 4QOZB 4M42A 1LWFA 1O1WA 2FBYA 1S9EA 4DWIA 4LY7A 1VSKA 2VG6A 3OYIA 3QEXA 3TAEA 2DFFA 4CIGA 3S3MA 1RNHA 2PZSA 1FKPA 5J1EA 5K14A 2Z1JA 3AVGA 2G8KA 3A2FA 5FDLA 4W5RA 3HPGA 2IDOA 3D45A 3KLIA 4CJSA 3PO4A 2D5RA 4CJKA 1T7PA 4CJQA 2ZQBA 3HT3A 1GOCA 1TAUA
chains in the Genus database with same CATH superfamily
1LV5A 5J2PA 4J2AA 1RT1A 2IOCA 1HQEA 4XH4A 3TANA 4JK9A 3FLCO 2HBKA 1QQOA 4KB0A 3NVMA 2PBDA 3WNFA 1S1WA 3AVFA 2DFHA 3V1QA 3CCRN 3JS6A 4GKJK 5M1NA 3FR0A 5EX5A 4LF4K 1REVA 1UA0A 3VQ4A 4JKAA 1K6YA 2RKIA 3LP1A 1OKJA 3E9LA 3K9KA 4H0OA 1T44A 4V19S 4IWVA 5KI6A 3O5BA 3KLEA 5J2MA 5AQKA 3QEPA 3V9WA 3GG4A 1RBVA 5BPMA 4DSLA 4CZJA 4CW7B 5FPMA 2I7PA 3C0BA 4FLYA 1T3VA 3TU5A 3BGRA 3QDKA 1YAGA 4PL7A 4F2RA 4L8RB 2GV9A 3QNNA 4FJKA 2Q31A 3VEWA 4FLZA 1EP4A 3D2FB 3HVRA 3CCEN 4JLHA 3VQ5A 1OVQA 5AJ3K 1VSEA 4NCBA 1HKCA 1VSFA 3AVLA 4CJTA 2JWKA 1DGKN 4E19A 3U6FA 3O4NA 3BEXA 3OA9A 2WTUA 3OS1A 1SZ2A 1BG3A 4C8OA 3V6DA 3CCMN 2E6LA 3SUNA 2O4IA 4W5QA 3KK3A 3SBGA 1VQ5N 1V4SA 4EZ9A 1NNEA 4GVEA 4IKFA 1QE1A 4CBXA 1IBLK 5ELZA 3ZT3A 3KZBA 3AVJA 1ZBHA 4CD1A 1MA9B 3C6AA 3OYLA 2O8CA 4DR1K 1J53A 1KD1O 3W0LA 4BG8A 2HOEA 2E2PA 3PUFA 2ZJPL 1BCMA 5AQNA 3VQ9A 3WNEA 5FRMA 4DS4A 5M1OA 3DJCA 2YKMA 3PY8A 4O8UA 3K9JA 5AZJA 3LANA 4DR3K 3TAGA 4FYDA 4MLEA 1BO5O 5JICA 3TAPA 1U2VB 2QWRA 3AO4A 1X9WA 3SI6A 3RRHA 3O3FA 2X78A 4BR7A 3ID8A 2KTQA 3QEVA 4FLWA 4CJWA 3VQCA 3V9XA 4J2EA 2HW3A 1VSDA 1J5EK 5AQZA 2Z1GA 4NB4A 1XNRK 2E4LA 4NXNK 4B1XB 4KHQA 2HHQA 3I33A 4B08A 4CJUA 3V9SA 4DTNA 4QAGA 1TKDA 4FWLA 4ZTJA 4DHYA 5M1KA 3DMJA 1S6QA 4E7KA 2A42A 1SQKA 1T6CA 3OYGA 2YNGA 3RSEB 3OYJA 2NRXA 4FWRA 3BY5A 3HYFA 1NMDA 2QXLA 3EL2A 1QS4A 3V9ZA 3PLAA 2G8UA 3FZKA 1K73O 3CD6N 4B9SA 3LPUA 1UWBA 3THXB 3CMEN 4JI6K 2QW9A 4CGJA 5AFUA 4AHVA 1KFDA 1L5UA 4IOAL 1WN7A 4GW6A 5T7BA 1Q82O 2VWBA 4CD3A 1C0GA 1BUPA 4DKWA 5HRRA 5DK5A 4KRFA 1HUXA 2HBJA 1ILYA 2VWJA 3M8RA 4DTSA 4OO1J 2Y1JA 1Y64A 1RDBA 3I55N 2OZSA 4JRPA 1JXBA 4CE9A 4CEBA 3WEEA 4CFBA 3CFOA 1YVNA 1RBTA 3QETA 4CJPA 1KLMA 3VGKA 1ZC6A 4WQ5A 2YNIA 1L3SA 2HB5A 3J81O 3K58A 3JYTA 2CGJA 5AQTA 2ZGYA 1MDUB 1I39A 2FSNA 4OKJA 3LAMA 4U7BA 4DV1K 2J4RA 5KPRA 3FGUA 1EWRA 4H0TB 2W6LA 4GV6A 2DPNA 4WQ5C 3CFPA 4OLBA 3BF3A 1NWKA 4ISEA 4A5BA 3HZ6A 4BRDA 2AA4A 4CF0A 1YJ9N 4DFMA 1BIZA 3DXKA 5ADXH 1C0MA 1RCHA 1B9DA 5DM7L 5AZJB 4BR4A 3O6WA 3SPYA 4FJHA 4K42A 1SL2A 1QSLA 2HHTA 4DMNA 1IKWA 4AQYK 1JLBA 4DU4A 4PL8A 4DQRA 2JGUA 1N32K 1WAJA 3HRGA 4Q0BA 3DOKA 2QWPA 2QKKA 1ZYQA 4CI6A 4YOWA 4M45A 3VTHA 2QWOA 2Q36A 3DXMB 4KBOA 4K0KK 1RT2A 4JHDA 3KWGA 2D0PA 3SBTA 3JAMO 3PIPL 1LOTB 5EY4A 4KHPK 1MWMA 4M3WA 1GLBG 4CHOA 4IJNA 1KAXA 2P51A 5BN9A 1NGGA 2PAVA 3VEXA 2HHXA 4E1JA 3AO3A 5I9EB 1NKCA 4B1YB 3E66A 3QEIA 1KCFA 4AHCA 4DUZK 4RW6A 2NLXA 3CF5L 3MCAB 1C6VA 4DU3A 1NJIO 4BGBA 3QO9A 1NGHA 1X9JA 4W5NA 2VCPA 1HMVA 1IKVA 3ATVA 3H46O 1T05A 1KAZA 4FWSA 3HO1A 5KRTA 1SAZA 3T1YK 4FOEA 2VQFK 1EETA 3OYHA 3SV4A 3ZSZA 4H5WA 5MLCQ 3F9MA 1NJXA 2IC3A 1HJOA 1IBKK 3L2WA 1Z25A 4PQUA 2GBZA 4F9OA 4GY2B 3AGRA 1NK7A 3F5TA 1GLCG 3KJVA 4KTQA 1TKZA 3SQ1A 3SQ4A 1GLEG 3U4LA 2QA4N 3ZSQA 4M3UA 3S41A 4B9TA 3ULDA 5HLFA 3A5OC 1VRTA 3LWMA 2HNDA 5E41A 3ZSWA 4HUEA 2QWQA 5C15A 4NCAA 2UYTA 4CIFA 1LAVA 3AGKA 1GLJO 1EX4A 3L3UA 3VQAA 1BIUA 1YJNN 4YDUA 1HR0K 2RHKA 3QESA 3N4PA 4DLGA 5CZ2A 3VETA 1WSHA 4E0DA 4FJ9A 3GBTA 4MO5A 5M1QA 3DXKB 4BGAA 4KHUA 4H4OA 1YI2N 3HI0A 3TABA 4YDUC 3MXMA 1ZBIA 4FWMA 1F21A 1NK4A 4BWJA 4IEEA 4FZZA 3S3OA 3S9HA 3DRPA 3ASMA 4DFKA 5C12A 1YIJN 5BPNA 2YCHA 2P9SA 3G6EN 3IMXA 4DR2K 5CYQA 2W6KA 3E01A 1N6QA 2JWLA 3VERA 1HKBA 2ASPA 1YHQN 4DWIA 3S3MA 1VSKA 2VG6A 3OYIA 3QEXA 1FKPA 5J1EA 5K14A 1VQON 4JI1K 4CJSA 2D5RA 4CJKA 4CJQA 2A41A 1GOCA 4WE1A 5TKYA 5BREA 2WOMA 4FO0A 2FSKA 4CZKA 3T3FA 4FW1A 4FVMA 4FK0A 2PFUA 5C24A 5CYMA 4DV0K 3RWUA 4CIEA 3OBWA 2GX9A 1KVCA 4JKHA 4CJ7A 2NRHA 4B9LA 2HHUA 5J2NA 3G71N 1TAQA 5AQOA 4HTUA 2NRRA 2P5GA 2F8TA 1E3MA 3TI0A 3SMPA 3BUZB 3LP2A 4BACA 3CCLN 4B3MK 1TVRA 1VAZA 4CESA 1SS6A 4X64K 1S6PA 4DTOA 2HNZA 1ITGA 4HVJA 5ADXA 3P83D 3CYMA 3DYAA 2FF6A 5D3GA 3P39A 4YNQA 1HJRA 3LZIA 2QWNA 3CXCM 1S3XA 1Q7YO 5AQIA 3H3OB 4FJXA 4YHHK 3T7ZA 3L2UA 3QNOA 1U49A 3QBWA 1S72N 1SL1A 5AQFA 3J8AA 2A6AA 3KKRA 2HSTA 1WUAA 2X6NA 2YJEA 2KZMA 4BRMA 1N34K 3RRGA 2OCEA 4OKKA 5EU7A 5GAEP 1RT7A 2H3GX 3EO3A 5CHIA 3KK2A 5GADP 1KXPA 3OYKA 2HHVA 2P9NA 4JS5A 3KVGA 5HL7L 3D2EB 4KB1A 4W5TA 5IWAK 1ZBLA 4FLVA 5M1PA 3LP0A 1RT4A 1K9MO 3I0SA 3CJAA 4JN4A 4BR9A 4H0XB 4OJRA 4H8KA 3THWA 3NBPA 4LSNA 3F73A 3O9RA 3SQ2A 2ZJQL 1OH7A 1T8EA 1FJGK 2WC9A 4M7YA 5KPZA 3OJSA 4BRFA 3CM6A 2P9SB 4LH5A 3H3NO 4AH9A 3SV3A 3VQ6A 4ISFA 3TTCA 1NM1A 1BISA 1C1BA 5I42A 3DLHA 3O3HA 1WSFA 4NLCA 1B92A 1MWKA 4BR5A 5FPNA 4BRKA 1J5OA 3DAWA 4XIUA 1HYSA 3OVNA 1TKTA 2QM1A 3BP8A 3C6UA 1L3TA 1M1KO 4JYAK 5LMNK 3ISNC 2Q3SA 4EIAA 4B3SK 1XWLA 4YOTA 1XC9A 3KD1E 4GKKK 4A57A 5SWMA 2Q0RA 3THYA 4HCBA 4FLTA 1RDCA 1RBUA 2KQ2A 3NGZA 3L8BA 4CHNA 2UU9K 1DTTA 5AQGA 2Q2RA 5AQSA 4C8KA 3F9KA 1H1VA 1TKXA 4HWIA 2PY5A 3DLGA 3UIQA 4RW8A 2W40A 1HLUA 1U4BA 1VQ7N 2FSJA 1CZAN 4CFCA 4E89A 3TAQA 4BRCA 5LMUK 1RBRA 4C8LA 1LWEA 1QVGM 2ZD1A 1JLAA 4JK7A 3MEDA 5KGXA 2HNYA 1HYZA 3GL1A 2OA8A 3WUHA 2HMIA 3HOSA 4JI2K 5JS2A 4M41A 3U8XA 3ZYYX 1I94K 4JD2B 3CFRA 1DLOA 1NK9A 1T03A 3U3YA 1IG8A 2G8VA 2IIRA 1GLAG 5CY4A 4CGHA 5JMVA 3OS0A 1WB9A 1NJWA 1U04A 3EZWA 3C94A 1NKBA 1YVUA 2G8WA 4TSXA 4M3XA 5AQJA 3CCQN 3UB5A 4WFNL 3QMLA 1J6ZA 5AQRA 1X3MA 4JV5K 4NLBA 2I7NA 4LFBK 2DY4A 4DF4A 3RR7A 4DV4K 4I6MB 3VEZA 2ITMA 3OW2M 4DUYK 5AZIA 3LPTA 4H0PA 3ZX3A 3SK3A 5H1SQ 4HHTA 3AO2A 3AVAA 3THWB 3ZLJA 4FLUA 3OY9A 4IXCA 4B9NA 4Z4EA 4FCYA 4B9QA 4WF9L 2RF2A 2ZWHA 4FJ8A 4JEPA 4Z94A 4DV6K 3AVIA 2F9TA 4B8CA 3EE8A 2KLAA 3HSCA 4H0YB 4K8XA 3DLBA 1HYVA 2HVIA 4CGIA 4FJMA 2YHBA 5JVGL 5JLHA 1RT6A 4A2BA 4BRPA 3VA0A 4LF7K 3A5MC 3TPQA 2P5OA 1BQNA 2E8AA 4C1NK 3HXMA 3D6RA 1Q9XA 3LM9A 2CGKA 3MECA 4BC5A 4DTMA 4IFEA 4BDYA 3AARA 3CM5A 1TUYA 4JS4A 1BOTO 4KAZA 2A1SA 3M3ZA 4CZGA 4FJLA 2IVNA 3BZCA 2A5XA 4DTJA 1XI1A 2QTDA 1B9FA 3CJ1A 1ZXOA 2A1RA 3K59A 3CI5A 5M1FA 1S9GA 4E1MA 3CHWA 1A5WA 2BDPA 1WSGA 4R5PA 4UQGA 1ATRA 2YI1A 3FZLA 4X62K 4IFVA 3J80O 3VESA 1NGAA 3IDHA 3MMVA 2CGLA 3QERA 2IGIA 3GE1A 1QHTA 4MLHA 1ATSA 3CJCA 4JKCA 4CEAA 1N8RO 1BQMA 2GEMA 4ID1A 2A3ZA 4JKEA 3ZX2A 1JL1A 4K8ZA 3CQXA 4FPAA 3C7NA 3SUQA 3DLKA 2E1ZA 3K2PA 3KIOA 4CJVA 1RFQA 3B6PA 3RR8A 4DQIA 4F8RA 3SCXA 1N36K 1ZBSA 2D0OA 4BC4A 2HVHA 1WSJA 5GIPA 3VTIA 4BVPA 2E2OA 2ITGA 5KQDA 3IKMA 2EX3A 5JLFA 4BVOA 4DV2K 3FZHA 2D4WA 3T1AA 1RGIA 1N5YA 1LCUA 4DQPA 2YHXA 1QQCA 4RW7A 1KRPA 2QEXN 4R79A 2O8DA 3WQTA 3O9SA 3ZT1A 4M7XA 1NBWA 4CEZA 1K8AO 1XC3A 4BWMA 4H5NA 5AZIB 3CG7A 2X6SA 3BZKA 3T1HK 4MQ3A 1RTJA 1VQPN 4O55A 1HQUA 1UAXA 3MWTA 1X9SA 2O8CB 3HSTB 2W42A 4MO4A 5KTQA 4FZXC 4J2BA 3LP3A 2XHBA 4KHNA 1JCFA 2XY7A 1L3UA 1IO2A 4IEIA 4C8NA 2EWSA 1WBBA 1ASVA 4FWQA 3VGMA 4FVUA 4CJLA 4IG3A 4B9UA 2KFZA 1BCOA 2GUIA 1BA1A 1VK0A 1KLNA 2YHAA 4FSVA 4UY8O 4AHSA 2X74A 1S22A 3MX2A 1CXQA 2P9KA 1RDAA 5BN8A 3SMSA 5FROA 4EHUA 1JCEA 3V9UA 3VQQA 3MK6A 2DFEA 1NMNA 3OYNA 1WLJA 3KK1A 5C25A 3PV8A 3NFAA 4JRQA 1O13A 4CK3A 4LF9K 3QFPA 5TKWA 4M3ZA 4QOZB 2FBYA 3I8BA 1S9EA 3TAEA 2DFFA 3CJ9A 3UKUA 3CCJN 2Z1JA 3TSQA 3LL3A 3ZEUA 4W5RA 5B8HA 1GLLO 4EFHA 1T7PA 3KK7A 3HT3A 3L4QA 1VHXA 3WXIA 1Z6RA 2YHYA 4O44A 5EXWA 3OTOK 2Z1HA 3G25A 4K41A 3LZJA 2W41A 4LF8K 4A62A 1RT5A 4IZ9A 1YITN 4CF1A 1QSSA 3CMAN 4CF2A 1TK8A 2D0AA 4CGGA 3D7EO 1NG9A 4F3OA 4ELVA 4GMJB 3SAHA 1EQYA 5SZTA 3TR8A 5HP1A 1VSLA 2ATQA 3WNGA 4IFYA 1YTUA 4BRGA 4KTZA 1XHXA 3C7NB 3AA5X 4PA1A 4DQSA 3WT0A 2XO7A 5FPDA 4YOYA 4B9MA 3ZCMA 3O8MA 2Q97A 1S1UA 2LSNA 2KFNA 3HP6A 1LW0A 4ELTA 3BF1A 4CF9A 3SAGA 3G10A 4OPAA 1NGFA 5AQUA 4DQQA 3WEEB 3GDQA 1JLQA 2O8DB 3WXMB 3HM9A 4C23A 4PKHA 4A5AA 2E20A 3RMBA 3EY1A 1NGIA 4DF8A 3LAKA 5F0XA 1U45A 1C1CA 4N41A 3P1GA 3VEOA 2NRTA 3Q7CA 3MCPA 3KWIA 3LDLA 1EO1A 3BDPA 4FLXA 1DKGD 1X9MA 3OYDA 1HPZA 4FW2A 3IG1A 1BI4A 4JI8K 3MN6A 4DSIA 1RDDA 1Z05A 3CIPA 1RBSA 1QZ5A 3VPZA 2UXBK 4BE1A 4CGFA 3VF6A 3FE1A 3EZ5A 3ULEA 3TARA 2XY8A 4DV3K 1KFSA 4KPYA 4OVLA 3VOVA 3K0SA 4B1UB 1NK5A 1YXQA 3QIOA 3ID6A 1OH5A 2KZZA 3DWLA 3U3GA 4CBUA 2P9IA 4DTUA 4GV3A 2P9PA 5HOOA 1C0UA 1W7AA 3EEQA 1IJJA 4BREA 3O9UA 1ATNA 4DS5A 4IO8A 1SV5A 3ZSOA 1NGEA 1C0TA 4XH1A 4N76A 4DSEA 2FBTA 4JHDB 3NE6A 3AAPA 3UKUB 4JKFA 3AO1A 4OPJA 2CH5A 4FJIA 1D9FA 3G0ZA 4E7JA 1SKWA 3DRSA 2XY6A 4CJRA 3DI6A 4OPHA 3OYCA 3SPZA 1JLFA 1YUWA 3CCSN 5HRPA 4MDAA 3SLCA 3K5NA 2F7TA 4CEDA 3AAQA 4FJ5A 1J54A 1E4GT 4J8FA 1JCGA 2GTDA 4DTPA 4I2PA 3NGYA 3QLHA 3KLHA 4B1VA 2BE2A 3WXKA 5AQHA 1R0AA 2RE2A 3ENBA 4O4GA 1GLDG 3PSFA 4BROA 2FBVA 3ENHA 3R3LA 4BC2A 2ZM6K 4DG1A 4H5RA 1QSYA 3H6EA 3VN5A 4FWOA 3L4IA 4MFBA 4HUGA 3UE5A 2BANA 4NO7A 1YF5L 1NJZA 5HBMA 4DU1A 2G8HA 4W5OA 4BQLA 3EE9A 4AM6A 3FFIA 4RCHA 2OPPA 3Q7BA 3I8DA 4KHWA 4AHRA 4DSJA 3EKSA 3OHRA 3EKUA 3A5NC 2WONA 4ID5A 2GWJA 4PHTX 1OH6A 4QS7A 4BR0A 1D8YA 1I3AA 3L6QA 4H0VB 2ZF5O 1NU0A 2HBMA 2P1JA 3AY9A 3OYFA 2YNFA 3VF4A 1VQLN 1K8KA 4FOIA 4RWTA 3HVTA 3CPEA 4FXDA 3O9QA 5AQQA 1RTHA 4O0JA 1TK0A 4DSFA 4KH4A 4U67L 1XMOK 3V4IA 3D2FA 1HNVA 1IKYA 3R1XA 1BI4B 4LF6K 4AHTA 4M3RA 4IJAA 2O8FA 4I9QA 1E4FT 4OGCA 2XRIA 2UUCK 3VF2A 3SAFA 1EWQA 4CJEA 3PO5A 4CHZA 3ULEB 4YOVA 5FRNA 3O1BA 2D0BA 1NGJA 5HRSA 4CJ3A 1CXUA 3OYEA 3LWLA 2P9IB 4Y1CA 2QWLA 3DLRA 2BUPA 1W9HA 4G1QA 2P9PB 3QFUA 5AQVA 4FM2A 4B9VA 4CFDA 3OBYA 3MWPA 3HK2A 4FJJA 3AA2A 1IH7A 2F8SA 4YY3K 3MXJA 4F4KA 1WOQA 3M8PA 4FJNA 1ASUA 4DV7K 4CZLA 3QINA 4YORA 2V7YA 3NVKA 2GELA 3QBXA 4RW4A 4CJFA 4O5FA 4J2DA 3SJHA 4KH5A 1VQMN 3FZFA 2VG5A 3WXJA 1KQSM 2QKBA 3VENA 5KPTA 5KQ8A 3S3NA 2NRWA 1SKRA 1CLQA 5BR8K 3HL8A 3VEVA 2KHOA 4CFAA 3ZSXA 1Q9YA 5GINA 3AVMA 1QQMA 1Z26A 2DTUA 2F9WA 4DTXA 4F2SA 1FKOA 1NGDA 3DM2A 4KFBA 5BPLA 1U2VA 4FWNA 1VQ9N 4KO0A 1YJWN 5AR0A 4BRIA 1S5JA 5LJWA 3K57A 1YT3A 1P8ZA 3ZSRA 4M3TA 3U9ZA 3QB0A 1NJYA 3MEEA 3RMAA 4DSKA 4WCEL 4JI5K 2RPIA 4KKOA 1Q86O 2F96A 2WFBA 3NDKA 4EHTA 5J2QA 2CH6A 4CK2A 3H08A 1NK6A 3C95A 4K25A 4ILHA 2Q0UA 3RSEA 5GAHP 3CETA 4RTFD 3I56N 3O80A 2HHWA 5C0YA 1JJ2M 2QK9A 1FXXA 1NKEA 2E2NA 3EN9A 3PX0A 4FPBA 5DM6L 1TYQA 5F2RA 1MU2A 2NRVA 1ASWA 4LD0A 1S1XA 2OTJN 1KAYA 1JLGA 3THXA 1K8KB 4BE2A 4DFJA 1C1AA 3SYZA 4NXMK 3TTDA 4JI0K 1TV6A 2YKNA 1ZBFA 3AVNA 4B3TK 2E2QA 3B6OA 4CZEA 4ZHRA 1KSPA 3E9OA 2B4JA 1D4XA 2YHWA 2IVPA 4BRNA 4JK8A 3VA3A 4BRQA 5AQYA 4RG8A 3HBTA 5AQPA 2P9NB 4KI4A 2O8FB 1EXQA 5LJVA 4O0IA 1N33K 2XY5A 1XQSC 3UKRA 3VEYA 3DLEA 1W2BM 3MX5A 4CERA 4H5VA 3IS9A 3MEGA 4Z4IA 4KTWA 4DB3A 1V4TA 3O1WA 3G4SN 3L2RA 1NK0A 2V51B 2VYPA 4JKDA 4CEEA 4GVMA 2UUAK 4L3QA 3O4WA 1NGCA 4XH5A 1TUUA 2VQEK 2AP1A 3OS2A 1JKHA 4CK1A 1NOZA 4PKGA 3ZSYA 2HHSA 4E7HA 3MDQA 1RTDA 4OX9K 4B1ZA 3QEWA 4CEQA 2NNWA 4OLAA 2QXFA 1WSIA 4DQ8A 1RDWX 4HCCA 4Z4GA 3HP9A 3TTFA 4EP5A 2OPSA 5KRSA 3O4QA 1VSJA 4JNEA 4AILC 4PUOA 3THYB 4M42A 1LWFA 1O1WA 1RNHA 1VQ6N 3AVGA 3A2FA 1HNWK 2IDOA 3D45A 3LDPA 3PO4A 5GIOA 2ZQBA 3C65A 1XUPO 4WYBA 3M6GA 5AQWA 5C2DA 2OPQA 4I9LA 2B6AA 3HOTA 4DR7K 4H4MA 2G8IA 1IBMK 3DXMA 3JSMA 2OANA 1JLEA 4JI7K 3L3VA 4BRHA 2O8EA 4BY9C 4K43A 3PSIA 1LW2A 1NOYA 1TL1A 1JLCA 2O4GA 3V81A 5E26A 1GLFO 3ENOA 3SUPA 3AO5A 4IG0A 4ILGB 5DMRA 1JXEA 2ZE2A 2ZGZA 1WBDA 5C2FA 2IAJA 1WNSA 4FK4A 1TYQB 4DFPA 3O08A 4YFUA 4AM7A 3NCIA 4B1WB 3RMCA 1VSHA 1BWFO 4JKBA 5EVZA 3JXUA 1U6ZA 4Z4HA 1QVFM 3ZSVA 1D9DA 2IS3A 2NUBA 2GWKA 3U9DA 3ZETA 4F3TA 3H1QA 4YOUA 2HF3A 2YX6A 4PY5A 2HBLA 5C10A 1VRUA 3O3GA 1T6DA 1KVAA 4H03B 4EAHD 4EZ6A 4ZTFA 2HF4A 4CZHA 1HX1A 3UKRB 4G9ZA 1G99A 2E5LK 3IRXA 5LL6Z 4CBWA 4CEFA 1CZ9A 3KLGA 2Y1IA 1C0FA 5BRHA 3LDQA 4BR2A 5HROA 4OGEA 2R7YA 2PYJA 2YNHA 4B3OA 4EP4A 1ZBUA 4M63C 3H45C 1S1TA 3ATUA 5JVHL 3K5OA 4CJ4A 4GV9A 1UOCA 1Q18A 1J9AA 3WNHA 3TWHA 1DEJA 4C8MA 1BHLA 1HKGA 3FZMA 4I2QA 4A59A 2HHHK 3NF6A 5BR9A 5CZ1A 2B5JA 4HTLA 1IG9A 5JS1A 2ETJA 1GOBA 2YV0X 3TSPA 3P5JA 3LDNA 4DR4K 4IO9L 3SUOA 3THVA 3PIOL 2JLEA 3T19A 4O8KA 2HMPA 4CEOA 1NK8A 2I5JA 1KC8O 1TL3A 4Z0UA 4CCHA 3LDSA 3MN5A 4CZMA 4BDZA 3ITHA 1HNIA 4BE0A 4DLEA 4FWKA 4CHYA 1EKEA 5AQMA 4DR5K 1G15A 3KHYA 3NH0A 2WUSA 4FK2A 3TAFA 1DT9A 2ASMA 5BRDA 1HNXK 4QS9A 1Y97A 2P9UA 3NH2A 4NYFA 3C6HA 3B8AX 4CZFA 4N56A 3PX4A 2O8EB 2VWKA 3V1RA 2NZTA 1IKXA 5EOYA 5CE3A 3J7YP 1TK5A 1BDGA 3WXLA 3A8YA 4JAXA 3ZT0A 1A5VA 1QZ6A 3DLLL 1LAWA 4JKGA 1S1VA 3J7ZO 4ICLA 2A40A 2E1YA 4LF5K 3CCUN 3H1VX 4A2AA 4CHQA 3RMDA 3ALYA 3PX6A 3IAYA 1X1PA 3CPWM 3SQ0A 3DOLA 3I0RA 3K5LA 3NAEA 1VQ4N 4FJGA 4IDHA 2QI2A 1QTMA 3OYAA 4OPKA 2FF3B 4DTRA 5A2QO 3T69A 3AVCA 3HTVA 4BDPA 3ZETB 4MDBA 4CHPA 1KTQA 3KKSA 5F1XA 4B3RK 4RW9A 3NGIA 4IOXA 1OVYA 3CQYA 3AA4A 3MXIA 2UUBK 3EYZA 3GOIA 4KHSA 4OKEA 5HRNA 1U47A 5I3UA 4CVNE 1NGBA 4GNIA 3N4QA 3NHGA 1RDUA 4LC9B 4PWDA 4FL9A 3MN7A 3VQEA 3NF7A 1P90A 4E1NA 1R59O 2ZJRL 3AV9A 2VGNA 3E1YA 1SL0A 3C6TA 1CZBA 4WQ4A 1X3NA 3ZX0A 3L0QA 2VGMA 4CF8A 2PYLA 4ISGA 4N47A 1A5XA 2P9KB 3VQDA 5KGWA 4N5SA 4M3YA 2E88A 1SKSA 4WQ4C 3TSUA 4KI6A 3F2KA 3A5LC 3TAMA 4X65K 5BRFA 2V52B 2RN2A 1BA0A 4ILJA 3D2EA 1RILA 4LH4A 3LALA 2Q1NA 4ELUA 3FFKB 3QIPA 4KV8A 4Z4CA 4NYNA 1VSMA 2O8BA 4Q5VA 3AVBA 3L2QA 2KKZA 3LM2A 1XMQK 3ZEUB 1QQNA 1Q81O 3SZ2A 4Z4FA 4YOXA 2IVOA 4X66K 5E84A 3ZT2A 3CC7N 4BRLA 4CZIA 1Q8IA 1DTQA 2FXUA 2P9UB 4KH6A 3VQBA 3OJUA 3CC4N 3HJFA 2UXCK 4DR6K 4BQZA 1D5AA 3CC2N 2VG7A 4IDKA 2P9LA 1W0HA 3KTQA 1YTAA 5IT9O 1TGOA 3R6MA 4E3SA 3LDOA 3R9PA 3V1OA 4AHUA 5FPEA 3CQ8A 1FW6A 3L2VA 3CERA 3KD5E 1WSEA 4A61A 1WAFA 4JKGB 1HRHA 1RT3A 5LY3A 5CR4A 3VGLA 3P38A 1HNZK 1ESVA 3O9TA 4LSLA 4BC3A 1QHAA 3SNNA 3OYBA 3M8QA 4WFAL 1XHZA 1VSIA 4FM0A 3E9PA 4QCLA 2FBXA 5AQXA 2BH1A 1BGXT 3M8SA 4QS8A 2BGGA 4O5BA 3AA3A 2FC0A 2BTFA 4LFAK 4LFCK 3HPHA 4H5TA 3SJJA 1GOAA 3ZT4A 4AF1A 1FK9A 4IBNA 2G8FA 2EHGA 4CECA 5C42A 1RTIA 3A0IX 3VQ8A 3DRRA 3NH1A 1KVBA 4DV5K 3MAQA 5GAGP 4BRAA 2OYQA 2E6MA 1XNQK 3NMUA 4IOCL 3NF8A 3MN9A 3P31A 1W97L 3M1FA 4KHYA 4JD2A 1SUQA 3VQ7A 3NF9A 4NCGA 4JI4K 4B8AB 1BL3A 3OYMA 2OPRA 3AVHA 1U48A 3VQPA 4DCHA 1VQKN 2AJQA 3R8EA 4Y0WA 1VQ8N 4JI3K 5AQLA 3CCVN 2V7ZA 3CJBA 2GUPA 4E7IA 4C1NI 3QICA 3IUCA 1LWCA 4I7FA 2QWMA 1OH8A 3WQUA 3AVKA 2YJFA 4HUFA 3KLFA 2KW4A 4KREA 4FM1A 3K5MA 4I6MA 2WBNA 3J7AP 3CJ7A 2F4VK 3RVCA 3D0PA 4CGDA 2OZMA 4XEIA 1M90O 1JL2A 3HPOA 3P4IA 2O8BB 2UXDK 3VMFB 4Y1DA 2FLOA 4PKIA 5AFUH 1UA1A 4FJ7A 2Z1IA 3RTVA 5FLXO 4CJ5A 4FZYA 1VQNN 2OTLN 4BG9A 2ASOA 1IV0A 1NLVA 3HM8A 2D0CA 4WFBL 1L3VA 4FWPA 4LY7A 1HPMA 3IFRA 2P9LB 4CIGA 2PZSA 3W3DA 2D1KA 2G8KA 5FDLA 3HPGA 3KLIA 3M5RA 4E7LA 1TAUA 1BU6O 2NRZA
chains in the Genus database with same CATH topology
1LV5A 5J2PA 4WE1A 2OPQA 4I9LA 2B6AA 4J2AA 2WOMA 4O44A 4H4MA 1RT1A 2IOCA 1HQEA 3TANA 2Z1HA 2G8IA 4KB0A 3T3FA 3JSMA 4FW1A 3LZJA 1JLEA 4FVMA 4FK0A 3L3VA 5CYMA 5C24A 3RWUA 4CIEA 1RT5A 3WNFA 4CF1A 1S1WA 1QSSA 1KVCA 3AVFA 4CF2A 2DFHA 1TK8A 4B9LA 2D0AA 3V1QA 4CGGA 4F3OA 5J2NA 1LW2A 3PX4A 2HHUA 1NOYA 4ELVA 1TL1A 1TAQA 1JLCA 2O4GA 4GMJB 3V81A 4HTUA 5SZTA 2P5GA 2F8TA 3TR8A 3SUPA 1VSLA 2ATQA 3AO5A 4IG0A 5DMRA 5HP1A 1JXEA 2ZE2A 3WNGA 3TI0A 3LP2A 4IFYA 1REVA 2IAJA 3VQ4A 4BACA 1WNSA 4KTZA 1XHXA 1UA0A 4FK4A 1YTUA 1K6YA 2RKIA 3AA5X 1TVRA 3LP1A 4DFPA 4PA1A 4DQSA 4YFUA 4CESA 3NCIA 2XO7A 1S6PA 4DTOA 5KI6A 3KLEA 5J2MA 2HNZA 1ITGA 4HVJA 3RMCA 3QEPA 1VSHA 4B9MA 3V9WA 3P83D 3ZCMA 1RBVA 3CYMA 3DYAA 4DSLA 5D3GA 4YNQA 1HJRA 1S1UA 2LSNA 2KFNA 3HP6A 4Z4HA 3LZIA 3ZSVA 1LW0A 4FLYA 1D9DA 4ELTA 2IS3A 3BGRA 4F2RA 4L8RB 2NUBA 4CF9A 2GV9A 3G10A 3QNNA 4FJKA 4F3TA 4DQQA 4FLZA 4FJXA 1EP4A 4PY5A 3L2UA 1JLQA 3HVRA 4JLHA 3VQ5A 3HM9A 1VRUA 3QNOA 1U49A 1VSEA 3O3GA 4NCBA 1SL1A 1KVAA 1VSFA 3AVLA 4EZ6A 3RMBA 3EY1A 4ZTFA 3KKRA 4DF8A 3LAKA 4CJTA 1U45A 1C1CA 2X6NA 4N41A 3P1GA 2KZMA 3IRXA 4E19A 4CEFA 1CZ9A 3KLGA 2Y1IA 3RRGA 4OKKA 3U6FA 5EU7A 3O4NA 5HROA 3OS1A 1RT7A 4OGEA 2R7YA 4FLXA 3V6DA 3BDPA 4C8OA 2E6LA 2PYJA 2YNHA 3SUNA 2O4IA 1X9MA 4W5QA 1HPZA 3OYDA 4B3OA 4EP4A 4FW2A 3KK3A 1ZBUA 3IG1A 1BI4A 3KK2A 1S1TA 4DSIA 3OYKA 4EZ9A 1RDDA 2HHVA 4JS5A 4IKFA 1RBSA 3K5OA 4CJ4A 1UOCA 4KB1A 1QE1A 4BE1A 3ZT3A 1J9AA 3WNHA 3AVJA 4CGFA 4W5TA 4C8MA 3TWHA 1BHLA 4FLVA 1ZBLA 1ZBHA 4I2QA 3LP0A 3EZ5A 1RT4A 3NF6A 3TARA 5CZ1A 2XY8A 2B5JA 3OYLA 1KFSA 3I0SA 1IG9A 4KPYA 5JS1A 2ETJA 1GOBA 2YV0X 4OVLA 1J53A 1NK5A 3QIOA 2KZZA 3P5JA 4OJRA 4H8KA 3NBPA 4LSNA 3F73A 3U3GA 3PUFA 3SQ2A 3SUOA 3THVA 2JLEA 3T19A 4CEOA 4DTUA 1NK8A 1T8EA 2I5JA 1BCMA 4CCHA 1C0UA 1TL3A 4Z0UA 3VQ9A 3LDSA 3OJSA 3WNEA 4DS5A 5FRMA 3CM6A 4BDZA 4DS4A 4B9SA 1SV5A 3ZSOA 3ITHA 1HNIA 2YKMA 4LH5A 1C0TA 4BE0A 4DLEA 4AH9A 4CHYA 1EKEA 3PY8A 4N76A 4DSEA 3SV3A 3VQ6A 3LANA 2FBTA 3NE6A 3TAGA 4FYDA 1BISA 1C1BA 5I42A 3DLHA 3AO1A 4OPJA 3O3HA 1WSFA 3TAPA 3AO4A 1B92A 1X9WA 4FJIA 1G15A 3SI6A 1D9FA 3G0ZA 4E7JA 1J5OA 3RRHA 3O3FA 2X78A 4XIUA 3NH0A 1SKWA 1HYSA 2KTQA 3DRSA 4FLWA 4CJWA 3VQCA 3QEVA 3OVNA 4CJRA 3V9XA 2XY6A 4FK2A 4J2EA 3TAFA 2HW3A 1VSDA 1TKTA 1L3TA 3DI6A 3C6UA 2Z1GA 3OYCA 3SPZA 1JLFA 3ISNC 2E4LA 2Q3SA 5HRPA 3K5NA 1XWLA 4KHQA 4CEDA 1XC9A 4FJ5A 1J54A 3KD1E 2HHQA 1Y97A 3NH2A 4NYFA 4B08A 4CJUA 5SWMA 3V9SA 4DTNA 4DTPA 4HCBA 4I2PA 4QAGA 3NGYA 3QLHA 1RDCA 4N56A 3KLHA 1RBUA 2KQ2A 4FLTA 3NGZA 4ZTJA 2BE2A 2VWKA 3V1RA 3L8BA 3DMJA 4CHNA 1S6QA 1IKXA 4E7KA 1TK5A 1R0AA 3ZT0A 3OYGA 1A5VA 1DTTA 2YNGA 4O4GA 4C8KA 3F9KA 2FBVA 3OYJA 1TKXA 1LAWA 2PY5A 4DG1A 1QSYA 3HYFA 1S1VA 3DLGA 3UIQA 4ICLA 3VN5A 4RW8A 1U4BA 4MFBA 4HUGA 1QS4A 2BANA 3V9ZA 4CHQA 2G8UA 3RMDA 3ALYA 3PX6A 3IAYA 1NJZA 4CFCA 4E89A 1X1PA 5HBMA 3LPUA 1UWBA 4DU1A 3TAQA 4W5OA 3SQ0A 2G8HA 3DOLA 3I0RA 3K5LA 3NAEA 1RBRA 4FJGA 3FFIA 4C8LA 1LWEA 1QTMA 3OYAA 4OPKA 4CGJA 2OPPA 2ZD1A 1JLAA 5KGXA 3MEDA 4AHRA 3I8DA 4DTRA 4DSJA 4KHWA 2HNYA 1HYZA 3AVCA 4AHVA 1KFDA 1L5UA 4BDPA 2WONA 4ID5A 2OA8A 1WN7A 4GW6A 2HMIA 5T7BA 4CHPA 5JS2A 4M41A 1D8YA 1KTQA 3KKSA 1I3AA 4RW9A 3CFRA 1DLOA 1NK9A 1T03A 3NGIA 3U3YA 1TKDA 5HRRA 2G8VA 5DK5A 4KRFA 2P1JA 5CY4A 4CGHA 3OYFA 3AA4A 2YNFA 3OS0A 3MXIA 3EYZA 1NJWA 1U04A 2VWJA 3HVTA 3M8RA 4DTSA 4FXDA 4KHSA 4OKEA 5HRNA 1U47A 1RTHA 3C94A 1NKBA 1YVUA 5I3UA 2G8WA 4TSXA 4O0JA 2Y1JA 1TK0A 4M3XA 4DSFA 1RDBA 3NHGA 2OZSA 4JRPA 3V4IA 1JXBA 4CE9A 4PWDA 4CEBA 2DY4A 1HNVA 3VQEA 4CFBA 1IKYA 3NF7A 3CFOA 4E1NA 4DF4A 3RR7A 1BI4B 1RBTA 3QETA 4AHTA 3AV9A 1KLMA 4CJPA 4M3RA 1SL0A 4I9QA 3C6TA 1CZBA 4OGCA 2XRIA 2YNIA 1L3SA 4CF8A 2HB5A 4CJEA 3PO5A 3LPTA 4CHZA 3K58A 3JYTA 2PYLA 4HHTA 4N47A 3AO2A 1A5XA 5FRNA 3VQDA 5KGWA 2D0BA 1I39A 3AVAA 4OKJA 5HRSA 4N5SA 4CJ3A 4M3YA 3LAMA 1CXUA 3OYEA 3LWLA 1SKSA 4FLUA 3OY9A 4Y1CA 3DLRA 4KI6A 1W9HA 4G1QA 3TAMA 4B9NA 4Z4EA 3CFPA 4OLBA 2RN2A 4FCYA 4FM2A 4B9VA 4CFDA 2RF2A 1RILA 4LH4A 3LALA 4CF0A 3HK2A 4ELUA 3AA2A 4DFMA 4FJJA 1IH7A 4FJ8A 1BIZA 2F8SA 1C0MA 1RCHA 1B9DA 3AVIA 3MXJA 3QIPA 4KV8A 4Z4CA 4F4KA 3M8PA 4B8CA 4FJNA 3SPYA 4NYNA 1ASUA 4FJHA 1VSMA 3QINA 1SL2A 4Q5VA 3AVBA 3L2QA 1QSLA 2HHTA 4DMNA 4RW4A 1IKWA 4CJFA 1JLBA 3DLBA 4K8XA 1HYVA 4DU4A 4E7LA 2HVIA 4DQRA 4J2DA 2JGUA 4CGIA 4FJMA 2YHBA 3SZ2A 1WAJA 4Z4FA 4Q0BA 1RT6A 3DOKA 2VG5A 3ZT2A 2QKKA 3VA0A 1ZYQA 2P5OA 1BQNA 2QKBA 4M45A 3HXMA 1Q8IA 1DTQA 3S3NA 1SKRA 1CLQA 3HL8A 4CFAA 3VQBA 3ZSXA 3MECA 3OJUA 4DTMA 1Q9YA 1Q9XA 1RT2A 3HJFA 3AVMA 4BDYA 1Z26A 3CM5A 1D5AA 2DTUA 2VG7A 4DTXA 4IDKA 4F2SA 1FKOA 1W0HA 1YTAA 3DM2A 4KFBA 3KTQA 4M3WA 1TGOA 4E3SA 4JS4A 4CHOA 4KO0A 2P51A 4KAZA 2A1SA 3V1OA 1S5JA 4FJLA 4AHUA 2HHXA 3K57A 4DTJA 1YT3A 3CQ8A 3ZSRA 3L2VA 1B9FA 1XI1A 3KD5E 4M3TA 3AO3A 1WSEA 1WAFA 2A1RA 1HRHA 3K59A 1NKCA 1RT3A 1NJYA 3MEEA 3RMAA 1S9GA 4LSLA 4DSKA 4E1MA 1A5WA 3OYBA 3SNNA 3QEIA 2BDPA 1WSGA 4R5PA 1KCFA 2RPIA 4KKOA 4AHCA 4UQGA 2F96A 4RW6A 3M8QA 3NDKA 1C6VA 4IFVA 1VSIA 4DU3A 1XHZA 4FM0A 5J2QA 4CK2A 3H08A 1NK6A 4QCLA 3C95A 3QO9A 3QERA 2FBXA 4W5NA 2IGIA 1QHTA 2HHWA 1BGXT 1HMVA 1IKVA 3M8SA 1T05A 4CEAA 1BQMA 4ID1A 3HO1A 2QK9A 1FXXA 1JL1A 4K8ZA 5KRTA 1NKEA 2BGGA 3PX0A 4O5BA 3AA3A 3SUQA 2FC0A 3DLKA 3KIOA 3K2PA 4CJVA 1EETA 1MU2A 3OYHA 3B6PA 3SV4A 3HPHA 3ZSZA 3SJJA 1GOAA 1ASWA 4LD0A 3RR8A 3ZT4A 1NJXA 2IC3A 1S1XA 4DQIA 3L2WA 3SCXA 1Z25A 4F8RA 4PQUA 1FK9A 1JLGA 4IBNA 2G8FA 2GBZA 2EHGA 2HVHA 4CECA 1WSJA 5C42A 4BE2A 4DFJA 1C1AA 1RTIA 1NK7A 3SYZA 3VQ8A 3KJVA 2ITGA 3DRRA 1TV6A 2EX3A 1TKZA 2YKNA 1KVBA 3NH1A 4KTQA 3SQ1A 3MAQA 1ZBFA 3AVNA 3T1AA 2OYQA 3SQ4A 3B6OA 2E6MA 3NF8A 1N5YA 4ZHRA 3ZSQA 1KSPA 4M3UA 4DQPA 2B4JA 1QQCA 4RW7A 1KRPA 4KHYA 4B9TA 3VA3A 1SUQA 3ULDA 4RG8A 3VQ7A 3NF9A 5HLFA 4NCGA 4B8AB 4KI4A 1BL3A 1EXQA 4O0IA 3ZT1A 1VRTA 3OYMA 2OPRA 3AVHA 4CEZA 2HNDA 4BWMA 3LWMA 1U48A 3VQPA 2XY5A 5E41A 2AJQA 3CG7A 3ZSWA 2X6SA 4HUEA 4MQ3A 3DLEA 1RTJA 4E7IA 4O55A 1HQUA 1UAXA 4CERA 1X9SA 4NCAA 4CIFA 1LAVA 3IS9A 1LWCA 3MEGA 4I7FA 4Z4IA 3HSTB 4KTWA 1EX4A 2W42A 3L3UA 5KTQA 3VQAA 4FZXC 4J2BA 3LP3A 2XHBA 4KHNA 1BIUA 3AVKA 2XY7A 1L3UA 1IO2A 4HUFA 3L2RA 4DLGA 3QESA 3KLFA 2KW4A 4C8NA 5CZ2A 1NK0A 4KREA 1ASVA 1WSHA 4CEEA 4CJLA 4FM1A 4IG3A 3K5MA 4B9UA 4E0DA 2KFZA 4GVMA 4FJ9A 1BCOA 2GUIA 1VK0A 1KLNA 3D0PA 4CGDA 2OZMA 4KHUA 4H4OA 1JL2A 2YHAA 4AHSA 2X74A 3HPOA 3TABA 1CXQA 1RDAA 3MXMA 5FROA 4Y1DA 3OS2A 1ZBIA 1JKHA 4CK1A 1F21A 1NOZA 1UA1A 1NK4A 3V9UA 3VQQA 3ZSYA 2HHSA 4BWJA 4FJ7A 2Z1IA 4E7HA 3RTVA 2DFEA 1RTDA 4FZZA 3S3OA 3S9HA 4CJ5A 3QEWA 3DRPA 4CEQA 3OYNA 3ASMA 1WLJA 3KK1A 5C25A 4DFKA 4OLAA 4FZYA 3PV8A 3NFAA 2QXFA 4JRQA 1WSIA 4HCCA 4Z4GA 3HP9A 4EP5A 4CK3A 2OPSA 5KRSA 5CYQA 3O4QA 1N6QA 3E01A 1VSJA 4PUOA 2D0CA 4AILC 1L3VA 4M3ZA 4QOZB 4M42A 1LWFA 1O1WA 2FBYA 1S9EA 4DWIA 4LY7A 1VSKA 2VG6A 3OYIA 3QEXA 3TAEA 2DFFA 4CIGA 3S3MA 1RNHA 2PZSA 1FKPA 5J1EA 5K14A 2Z1JA 3AVGA 2G8KA 3A2FA 5FDLA 4W5RA 3HPGA 2IDOA 3D45A 3KLIA 4CJSA 3PO4A 2D5RA 4CJKA 1T7PA 4CJQA 2ZQBA 3HT3A 1GOCA 1TAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV5 A;  5J2P A;  4WE1 A;  2OPQ A;  4I9L A;  2B6A A;  4J2A A;  2WOM A;  4O44 A;  4H4M A;  1RT1 A;  2IOC A;  1HQE A;  3TAN A;  2Z1H A;  2G8I A;  4KB0 A;  3T3F A;  3JSM A;  4FW1 A;  3LZJ A;  1JLE A;  4FVM A;  4FK0 A;  3L3V A;  5CYM A;  5C24 A;  3RWU A;  4CIE A;  1RT5 A;  3WNF A;  4CF1 A;  1S1W A;  1QSS A;  1KVC A;  3AVF A;  4CF2 A;  2DFH A;  1TK8 A;  4B9L A;  2D0A A;  3V1Q A;  4CGG A;  4F3O A;  5J2N A;  1LW2 A;  3PX4 A;  2HHU A;  1NOY A;  4ELV A;  1TL1 A;  1TAQ A;  1JLC A;  2O4G A;  4GMJ B;  3V81 A;  4HTU A;  5SZT A;  2P5G A;  2F8T A;  3TR8 A;  3SUP A;  1VSL A;  2ATQ A;  3AO5 A;  4IG0 A;  5DMR A;  5HP1 A;  1JXE A;  2ZE2 A;  3WNG A;  3TI0 A;  3LP2 A;  4IFY A;  1REV A;  2IAJ A;  3VQ4 A;  4BAC A;  1WNS A;  4KTZ A;  1XHX A;  1UA0 A;  4FK4 A;  1YTU A;  1K6Y A;  2RKI A;  3AA5 X;  1TVR A;  3LP1 A;  4DFP A;  4PA1 A;  4DQS A;  4YFU A;  4CES A;  3NCI A;  2XO7 A;  1S6P A;  4DTO A;  5KI6 A;  3KLE A;  5J2M A;  2HNZ A;  1ITG A;  4HVJ A;  3RMC A;  3QEP A;  1VSH A;  4B9M A;  3V9W A;  3P83 D;  3ZCM A;  1RBV A;  3CYM A;  3DYA A;  4DSL A;  5D3G A;  4YNQ A;  1HJR A;  1S1U A;  2LSN A;  2KFN A;  3HP6 A;  4Z4H A;  3LZI A;  3ZSV A;  1LW0 A;  4FLY A;  1D9D A;  4ELT A;  2IS3 A;  3BGR A;  4F2R A;  4L8R B;  2NUB A;  4CF9 A;  2GV9 A;  3G10 A;  3QNN A;  4FJK A;  4F3T A;  4DQQ A;  4FLZ A;  4FJX A;  1EP4 A;  4PY5 A;  3L2U A;  1JLQ A;  3HVR A;  4JLH A;  3VQ5 A;  3HM9 A;  1VRU A;  3QNO A;  1U49 A;  1VSE A;  3O3G A;  4NCB A;  1SL1 A;  1KVA A;  1VSF A;  3AVL A;  4EZ6 A;  3RMB A;  3EY1 A;  4ZTF A;  3KKR A;  4DF8 A;  3LAK A;  4CJT A;  1U45 A;  1C1C A;  2X6N A;  4N41 A;  3P1G A;  2KZM A;  3IRX A;  4E19 A;  4CEF A;  1CZ9 A;  3KLG A;  2Y1I A;  3RRG A;  4OKK A;  3U6F A;  5EU7 A;  3O4N A;  5HRO A;  3OS1 A;  1RT7 A;  4OGE A;  2R7Y A;  4FLX A;  3V6D A;  3BDP A;  4C8O A;  2E6L A;  2PYJ A;  2YNH A;  3SUN A;  2O4I A;  1X9M A;  4W5Q A;  1HPZ A;  3OYD A;  4B3O A;  4EP4 A;  4FW2 A;  3KK3 A;  1ZBU A;  3IG1 A;  1BI4 A;  3KK2 A;  1S1T A;  4DSI A;  3OYK A;  4EZ9 A;  1RDD A;  2HHV A;  4JS5 A;  4IKF A;  1RBS A;  3K5O A;  4CJ4 A;  1UOC A;  4KB1 A;  1QE1 A;  4BE1 A;  3ZT3 A;  1J9A A;  3WNH A;  3AVJ A;  4CGF A;  4W5T A;  4C8M A;  3TWH A;  1BHL A;  4FLV A;  1ZBL A;  1ZBH A;  4I2Q A;  3LP0 A;  3EZ5 A;  1RT4 A;  3NF6 A;  3TAR A;  5CZ1 A;  2XY8 A;  2B5J A;  3OYL A;  1KFS A;  3I0S A;  1IG9 A;  4KPY A;  5JS1 A;  2ETJ A;  1GOB A;  2YV0 X;  4OVL A;  1J53 A;  1NK5 A;  3QIO A;  2KZZ A;  3P5J A;  4OJR A;  4H8K A;  3NBP A;  4LSN A;  3F73 A;  3U3G A;  3PUF A;  3SQ2 A;  3SUO A;  3THV A;  2JLE A;  3T19 A;  4CEO A;  4DTU A;  1NK8 A;  1T8E A;  2I5J A;  1BCM A;  4CCH A;  1C0U A;  1TL3 A;  4Z0U A;  3VQ9 A;  3LDS A;  3OJS A;  3WNE A;  4DS5 A;  5FRM A;  3CM6 A;  4BDZ A;  4DS4 A;  4B9S A;  1SV5 A;  3ZSO A;  3ITH A;  1HNI A;  2YKM A;  4LH5 A;  1C0T A;  4BE0 A;  4DLE A;  4AH9 A;  4CHY A;  1EKE A;  3PY8 A;  4N76 A;  4DSE A;  3SV3 A;  3VQ6 A;  3LAN A;  2FBT A;  3NE6 A;  3TAG A;  4FYD A;  1BIS A;  1C1B A;  5I42 A;  3DLH A;  3AO1 A;  4OPJ A;  3O3H A;  1WSF A;  3TAP A;  3AO4 A;  1B92 A;  1X9W A;  4FJI A;  1G15 A;  3SI6 A;  1D9F A;  3G0Z A;  4E7J A;  1J5O A;  3RRH A;  3O3F A;  2X78 A;  4XIU A;  3NH0 A;  1SKW A;  1HYS A;  2KTQ A;  3DRS A;  4FLW A;  4CJW A;  3VQC A;  3QEV A;  3OVN A;  4CJR A;  3V9X A;  2XY6 A;  4FK2 A;  4J2E A;  3TAF A;  2HW3 A;  1VSD A;  1TKT A;  1L3T A;  3DI6 A;  3C6U A;  2Z1G A;  3OYC A;  3SPZ A;  1JLF A;  3ISN C;  2E4L A;  2Q3S A;  5HRP A;  3K5N A;  1XWL A;  4KHQ A;  4CED A;  1XC9 A;  4FJ5 A;  1J54 A;  3KD1 E;  2HHQ A;  1Y97 A;  3NH2 A;  4NYF A;  4B08 A;  4CJU A;  5SWM A;  3V9S A;  4DTN A;  4DTP A;  4HCB A;  4I2P A;  4QAG A;  3NGY A;  3QLH A;  1RDC A;  4N56 A;  3KLH A;  1RBU A;  2KQ2 A;  4FLT A;  3NGZ A;  4ZTJ A;  2BE2 A;  2VWK A;  3V1R A;  3L8B A;  3DMJ A;  4CHN A;  1S6Q A;  1IKX A;  4E7K A;  1TK5 A;  1R0A A;  3ZT0 A;  3OYG A;  1A5V A;  1DTT A;  2YNG A;  4O4G A;  4C8K A;  3F9K A;  2FBV A;  3OYJ A;  1TKX A;  1LAW A;  2PY5 A;  4DG1 A;  1QSY A;  3HYF A;  1S1V A;  3DLG A;  3UIQ A;  4ICL A;  3VN5 A;  4RW8 A;  1U4B A;  4MFB A;  4HUG A;  1QS4 A;  2BAN A;  3V9Z A;  4CHQ A;  2G8U A;  3RMD A;  3ALY A;  3PX6 A;  3IAY A;  1NJZ A;  4CFC A;  4E89 A;  1X1P A;  5HBM A;  3LPU A;  1UWB A;  4DU1 A;  3TAQ A;  4W5O A;  3SQ0 A;  2G8H A;  3DOL A;  3I0R A;  3K5L A;  3NAE A;  1RBR A;  4FJG A;  3FFI A;  4C8L A;  1LWE A;  1QTM A;  3OYA A;  4OPK A;  4CGJ A;  2OPP A;  2ZD1 A;  1JLA A;  5KGX A;  3MED A;  4AHR A;  3I8D A;  4DTR A;  4DSJ A;  4KHW A;  2HNY A;  1HYZ A;  3AVC A;  4AHV A;  1KFD A;  1L5U A;  4BDP A;  2WON A;  4ID5 A;  2OA8 A;  1WN7 A;  4GW6 A;  2HMI A;  5T7B A;  4CHP A;  5JS2 A;  4M41 A;  1D8Y A;  1KTQ A;  3KKS A;  1I3A A;  4RW9 A;  3CFR A;  1DLO A;  1NK9 A;  1T03 A;  3NGI A;  3U3Y A;  1TKD A;  5HRR A;  2G8V A;  5DK5 A;  4KRF A;  2P1J A;  5CY4 A;  4CGH A;  3OYF A;  3AA4 A;  2YNF A;  3OS0 A;  3MXI A;  3EYZ A;  1NJW A;  1U04 A;  2VWJ A;  3HVT A;  3M8R A;  4DTS A;  4FXD A;  4KHS A;  4OKE A;  5HRN A;  1U47 A;  1RTH A;  3C94 A;  1NKB A;  1YVU A;  5I3U A;  2G8W A;  4TSX A;  4O0J A;  2Y1J A;  1TK0 A;  4M3X A;  4DSF A;  1RDB A;  3NHG A;  2OZS A;  4JRP A;  3V4I A;  1JXB A;  4CE9 A;  4PWD A;  4CEB A;  2DY4 A;  1HNV A;  3VQE A;  4CFB A;  1IKY A;  3NF7 A;  3CFO A;  4E1N A;  4DF4 A;  3RR7 A;  1BI4 B;  1RBT A;  3QET A;  4AHT A;  3AV9 A;  1KLM A;  4CJP A;  4M3R A;  1SL0 A;  4I9Q A;  3C6T A;  1CZB A;  4OGC A;  2XRI A;  2YNI A;  1L3S A;  4CF8 A;  2HB5 A;  4CJE A;  3PO5 A;  3LPT A;  4CHZ A;  3K58 A;  3JYT A;  2PYL A;  4HHT A;  4N47 A;  3AO2 A;  1A5X A;  5FRN A;  3VQD A;  5KGW A;  2D0B A;  1I39 A;  3AVA A;  4OKJ A;  5HRS A;  4N5S A;  4CJ3 A;  4M3Y A;  3LAM A;  1CXU A;  3OYE A;  3LWL A;  1SKS A;  4FLU A;  3OY9 A;  4Y1C A;  3DLR A;  4KI6 A;  1W9H A;  4G1Q A;  3TAM A;  4B9N A;  4Z4E A;  3CFP A;  4OLB A;  2RN2 A;  4FCY A;  4FM2 A;  4B9V A;  4CFD A;  2RF2 A;  1RIL A;  4LH4 A;  3LAL A;  4CF0 A;  3HK2 A;  4ELU A;  3AA2 A;  4DFM A;  4FJJ A;  1IH7 A;  4FJ8 A;  1BIZ A;  2F8S A;  1C0M A;  1RCH A;  1B9D A;  3AVI A;  3MXJ A;  3QIP A;  4KV8 A;  4Z4C A;  4F4K A;  3M8P A;  4B8C A;  4FJN A;  3SPY A;  4NYN A;  1ASU A;  4FJH A;  1VSM A;  3QIN A;  1SL2 A;  4Q5V A;  3AVB A;  3L2Q A;  1QSL A;  2HHT A;  4DMN A;  4RW4 A;  1IKW A;  4CJF A;  1JLB A;  3DLB A;  4K8X A;  1HYV A;  4DU4 A;  4E7L A;  2HVI A;  4DQR A;  4J2D A;  2JGU A;  4CGI A;  4FJM A;  2YHB A;  3SZ2 A;  1WAJ A;  4Z4F A;  4Q0B A;  1RT6 A;  3DOK A;  2VG5 A;  3ZT2 A;  2QKK A;  3VA0 A;  1ZYQ A;  2P5O A;  1BQN A;  2QKB A;  4M45 A;  3HXM A;  1Q8I A;  1DTQ A;  3S3N A;  1SKR A;  1CLQ A;  3HL8 A;  4CFA A;  3VQB A;  3ZSX A;  3MEC A;  3OJU A;  4DTM A;  1Q9Y A;  1Q9X A;  1RT2 A;  3HJF A;  3AVM A;  4BDY A;  1Z26 A;  3CM5 A;  1D5A A;  2DTU A;  2VG7 A;  4DTX A;  4IDK A;  4F2S A;  1FKO A;  1W0H A;  1YTA A;  3DM2 A;  4KFB A;  3KTQ A;  4M3W A;  1TGO A;  4E3S A;  4JS4 A;  4CHO A;  4KO0 A;  2P51 A;  4KAZ A;  2A1S A;  3V1O A;  1S5J A;  4FJL A;  4AHU A;  2HHX A;  3K57 A;  4DTJ A;  1YT3 A;  3CQ8 A;  3ZSR A;  3L2V A;  1B9F A;  1XI1 A;  3KD5 E;  4M3T A;  3AO3 A;  1WSE A;  1WAF A;  2A1R A;  1HRH A;  3K59 A;  1NKC A;  1RT3 A;  1NJY A;  3MEE A;  3RMA A;  1S9G A;  4LSL A;  4DSK A;  4E1M A;  1A5W A;  3OYB A;  3SNN A;  3QEI A;  2BDP A;  1WSG A;  4R5P A;  1KCF A;  2RPI A;  4KKO A;  4AHC A;  4UQG A;  2F96 A;  4RW6 A;  3M8Q A;  3NDK A;  1C6V A;  4IFV A;  1VSI A;  4DU3 A;  1XHZ A;  4FM0 A;  5J2Q A;  4CK2 A;  3H08 A;  1NK6 A;  4QCL A;  3C95 A;  3QO9 A;  3QER A;  2FBX A;  4W5N A;  2IGI A;  1QHT A;  2HHW A;  1BGX T;  1HMV A;  1IKV A;  3M8S A;  1T05 A;  4CEA A;  1BQM A;  4ID1 A;  3HO1 A;  2QK9 A;  1FXX A;  1JL1 A;  4K8Z A;  5KRT A;  1NKE A;  2BGG A;  3PX0 A;  4O5B A;  3AA3 A;  3SUQ A;  2FC0 A;  3DLK A;  3KIO A;  3K2P A;  4CJV A;  1EET A;  1MU2 A;  3OYH A;  3B6P A;  3SV4 A;  3HPH A;  3ZSZ A;  3SJJ A;  1GOA A;  1ASW A;  4LD0 A;  3RR8 A;  3ZT4 A;  1NJX A;  2IC3 A;  1S1X A;  4DQI A;  3L2W A;  3SCX A;  1Z25 A;  4F8R A;  4PQU A;  1FK9 A;  1JLG A;  4IBN A;  2G8F A;  2GBZ A;  2EHG A;  2HVH A;  4CEC A;  1WSJ A;  5C42 A;  4BE2 A;  4DFJ A;  1C1A A;  1RTI A;  1NK7 A;  3SYZ A;  3VQ8 A;  3KJV A;  2ITG A;  3DRR A;  1TV6 A;  2EX3 A;  1TKZ A;  2YKN A;  1KVB A;  3NH1 A;  4KTQ A;  3SQ1 A;  3MAQ A;  1ZBF A;  3AVN A;  3T1A A;  2OYQ A;  3SQ4 A;  3B6O A;  2E6M A;  3NF8 A;  1N5Y A;  4ZHR A;  3ZSQ A;  1KSP A;  4M3U A;  4DQP A;  2B4J A;  1QQC A;  4RW7 A;  1KRP A;  4KHY A;  4B9T A;  3VA3 A;  1SUQ A;  3ULD A;  4RG8 A;  3VQ7 A;  3NF9 A;  5HLF A;  4NCG A;  4B8A B;  4KI4 A;  1BL3 A;  1EXQ A;  4O0I A;  3ZT1 A;  1VRT A;  3OYM A;  2OPR A;  3AVH A;  4CEZ A;  2HND A;  4BWM A;  3LWM A;  1U48 A;  3VQP A;  2XY5 A;  5E41 A;  2AJQ A;  3CG7 A;  3ZSW A;  2X6S A;  4HUE A;  4MQ3 A;  3DLE A;  1RTJ A;  4E7I A;  4O55 A;  1HQU A;  1UAX A;  4CER A;  1X9S A;  4NCA A;  4CIF A;  1LAV A;  3IS9 A;  1LWC A;  3MEG A;  4I7F A;  4Z4I A;  3HST B;  4KTW A;  1EX4 A;  2W42 A;  3L3U A;  5KTQ A;  3VQA A;  4FZX C;  4J2B A;  3LP3 A;  2XHB A;  4KHN A;  1BIU A;  3AVK A;  2XY7 A;  1L3U A;  1IO2 A;  4HUF A;  3L2R A;  4DLG A;  3QES A;  3KLF A;  2KW4 A;  4C8N A;  5CZ2 A;  1NK0 A;  4KRE A;  1ASV A;  1WSH A;  4CEE A;  4CJL A;  4FM1 A;  4IG3 A;  3K5M A;  4B9U A;  4E0D A;  2KFZ A;  4GVM A;  4FJ9 A;  1BCO A;  2GUI A;  1VK0 A;  1KLN A;  3D0P A;  4CGD A;  2OZM A;  4KHU A;  4H4O A;  1JL2 A;  2YHA A;  4AHS A;  2X74 A;  3HPO A;  3TAB A;  1CXQ A;  1RDA A;  3MXM A;  5FRO A;  4Y1D A;  3OS2 A;  1ZBI A;  1JKH A;  4CK1 A;  1F21 A;  1NOZ A;  1UA1 A;  1NK4 A;  3V9U A;  3VQQ A;  3ZSY A;  2HHS A;  4BWJ A;  4FJ7 A;  2Z1I A;  4E7H A;  3RTV A;  2DFE A;  1RTD A;  4FZZ A;  3S3O A;  3S9H A;  4CJ5 A;  3QEW A;  3DRP A;  4CEQ A;  3OYN A;  3ASM A;  1WLJ A;  3KK1 A;  5C25 A;  4DFK A;  4OLA A;  4FZY A;  3PV8 A;  3NFA A;  2QXF A;  4JRQ A;  1WSI A;  4HCC A;  4Z4G A;  3HP9 A;  4EP5 A;  4CK3 A;  2OPS A;  5KRS A;  5CYQ A;  3O4Q A;  1N6Q A;  3E01 A;  1VSJ A;  4PUO A;  2D0C A;  4AIL C;  1L3V A;  4M3Z A;  4QOZ B;  4M42 A;  1LWF A;  1O1W A;  2FBY A;  1S9E A;  4DWI A;  4LY7 A;  1VSK A;  2VG6 A;  3OYI A;  3QEX A;  3TAE A;  2DFF A;  4CIG A;  3S3M A;  1RNH A;  2PZS A;  1FKP A;  5J1E A;  5K14 A;  2Z1J A;  3AVG A;  2G8K A;  3A2F A;  5FDL A;  4W5R A;  3HPG A;  2IDO A;  3D45 A;  3KLI A;  4CJS A;  3PO4 A;  2D5R A;  4CJK A;  1T7P A;  4CJQ A;  2ZQB A;  3HT3 A;  1GOC A;  1TAU A; 
#chains in the Genus database with same CATH topology
 1LV5 A;  5J2P A;  4J2A A;  1RT1 A;  2IOC A;  1HQE A;  4XH4 A;  3TAN A;  4JK9 A;  3FLC O;  2HBK A;  1QQO A;  4KB0 A;  3NVM A;  2PBD A;  3WNF A;  1S1W A;  3AVF A;  2DFH A;  3V1Q A;  3CCR N;  3JS6 A;  4GKJ K;  5M1N A;  3FR0 A;  5EX5 A;  4LF4 K;  1REV A;  1UA0 A;  3VQ4 A;  4JKA A;  1K6Y A;  2RKI A;  3LP1 A;  1OKJ A;  3E9L A;  3K9K A;  4H0O A;  1T44 A;  4V19 S;  4IWV A;  5KI6 A;  3O5B A;  3KLE A;  5J2M A;  5AQK A;  3QEP A;  3V9W A;  3GG4 A;  1RBV A;  5BPM A;  4DSL A;  4CZJ A;  4CW7 B;  5FPM A;  2I7P A;  3C0B A;  4FLY A;  1T3V A;  3TU5 A;  3BGR A;  3QDK A;  1YAG A;  4PL7 A;  4F2R A;  4L8R B;  2GV9 A;  3QNN A;  4FJK A;  2Q31 A;  3VEW A;  4FLZ A;  1EP4 A;  3D2F B;  3HVR A;  3CCE N;  4JLH A;  3VQ5 A;  1OVQ A;  5AJ3 K;  1VSE A;  4NCB A;  1HKC A;  1VSF A;  3AVL A;  4CJT A;  2JWK A;  1DGK N;  4E19 A;  3U6F A;  3O4N A;  3BEX A;  3OA9 A;  2WTU A;  3OS1 A;  1SZ2 A;  1BG3 A;  4C8O A;  3V6D A;  3CCM N;  2E6L A;  3SUN A;  2O4I A;  4W5Q A;  3KK3 A;  3SBG A;  1VQ5 N;  1V4S A;  4EZ9 A;  1NNE A;  4GVE A;  4IKF A;  1QE1 A;  4CBX A;  1IBL K;  5ELZ A;  3ZT3 A;  3KZB A;  3AVJ A;  1ZBH A;  4CD1 A;  1MA9 B;  3C6A A;  3OYL A;  2O8C A;  4DR1 K;  1J53 A;  1KD1 O;  3W0L A;  4BG8 A;  2HOE A;  2E2P A;  3PUF A;  2ZJP L;  1BCM A;  5AQN A;  3VQ9 A;  3WNE A;  5FRM A;  4DS4 A;  5M1O A;  3DJC A;  2YKM A;  3PY8 A;  4O8U A;  3K9J A;  5AZJ A;  3LAN A;  4DR3 K;  3TAG A;  4FYD A;  4MLE A;  1BO5 O;  5JIC A;  3TAP A;  1U2V B;  2QWR A;  3AO4 A;  1X9W A;  3SI6 A;  3RRH A;  3O3F A;  2X78 A;  4BR7 A;  3ID8 A;  2KTQ A;  3QEV A;  4FLW A;  4CJW A;  3VQC A;  3V9X A;  4J2E A;  2HW3 A;  1VSD A;  1J5E K;  5AQZ A;  2Z1G A;  4NB4 A;  1XNR K;  2E4L A;  4NXN K;  4B1X B;  4KHQ A;  2HHQ A;  3I33 A;  4B08 A;  4CJU A;  3V9S A;  4DTN A;  4QAG A;  1TKD A;  4FWL A;  4ZTJ A;  4DHY A;  5M1K A;  3DMJ A;  1S6Q A;  4E7K A;  2A42 A;  1SQK A;  1T6C A;  3OYG A;  2YNG A;  3RSE B;  3OYJ A;  2NRX A;  4FWR A;  3BY5 A;  3HYF A;  1NMD A;  2QXL A;  3EL2 A;  1QS4 A;  3V9Z A;  3PLA A;  2G8U A;  3FZK A;  1K73 O;  3CD6 N;  4B9S A;  3LPU A;  1UWB A;  3THX B;  3CME N;  4JI6 K;  2QW9 A;  4CGJ A;  5AFU A;  4AHV A;  1KFD A;  1L5U A;  4IOA L;  1WN7 A;  4GW6 A;  5T7B A;  1Q82 O;  2VWB A;  4CD3 A;  1C0G A;  1BUP A;  4DKW A;  5HRR A;  5DK5 A;  4KRF A;  1HUX A;  2HBJ A;  1ILY A;  2VWJ A;  3M8R A;  4DTS A;  4OO1 J;  2Y1J A;  1Y64 A;  1RDB A;  3I55 N;  2OZS A;  4JRP A;  1JXB A;  4CE9 A;  4CEB A;  3WEE A;  4CFB A;  3CFO A;  1YVN A;  1RBT A;  3QET A;  4CJP A;  1KLM A;  3VGK A;  1ZC6 A;  4WQ5 A;  2YNI A;  1L3S A;  2HB5 A;  3J81 O;  3K58 A;  3JYT A;  2CGJ A;  5AQT A;  2ZGY A;  1MDU B;  1I39 A;  2FSN A;  4OKJ A;  3LAM A;  4U7B A;  4DV1 K;  2J4R A;  5KPR A;  3FGU A;  1EWR A;  4H0T B;  2W6L A;  4GV6 A;  2DPN A;  4WQ5 C;  3CFP A;  4OLB A;  3BF3 A;  1NWK A;  4ISE A;  4A5B A;  3HZ6 A;  4BRD A;  2AA4 A;  4CF0 A;  1YJ9 N;  4DFM A;  1BIZ A;  3DXK A;  5ADX H;  1C0M A;  1RCH A;  1B9D A;  5DM7 L;  5AZJ B;  4BR4 A;  3O6W A;  3SPY A;  4FJH A;  4K42 A;  1SL2 A;  1QSL A;  2HHT A;  4DMN A;  1IKW A;  4AQY K;  1JLB A;  4DU4 A;  4PL8 A;  4DQR A;  2JGU A;  1N32 K;  1WAJ A;  3HRG A;  4Q0B A;  3DOK A;  2QWP A;  2QKK A;  1ZYQ A;  4CI6 A;  4YOW A;  4M45 A;  3VTH A;  2QWO A;  2Q36 A;  3DXM B;  4KBO A;  4K0K K;  1RT2 A;  4JHD A;  3KWG A;  2D0P A;  3SBT A;  3JAM O;  3PIP L;  1LOT B;  5EY4 A;  4KHP K;  1MWM A;  4M3W A;  1GLB G;  4CHO A;  4IJN A;  1KAX A;  2P51 A;  5BN9 A;  1NGG A;  2PAV A;  3VEX A;  2HHX A;  4E1J A;  3AO3 A;  5I9E B;  1NKC A;  4B1Y B;  3E66 A;  3QEI A;  1KCF A;  4AHC A;  4DUZ K;  4RW6 A;  2NLX A;  3CF5 L;  3MCA B;  1C6V A;  4DU3 A;  1NJI O;  4BGB A;  3QO9 A;  1NGH A;  1X9J A;  4W5N A;  2VCP A;  1HMV A;  1IKV A;  3ATV A;  3H46 O;  1T05 A;  1KAZ A;  4FWS A;  3HO1 A;  5KRT A;  1SAZ A;  3T1Y K;  4FOE A;  2VQF K;  1EET A;  3OYH A;  3SV4 A;  3ZSZ A;  4H5W A;  5MLC Q;  3F9M A;  1NJX A;  2IC3 A;  1HJO A;  1IBK K;  3L2W A;  1Z25 A;  4PQU A;  2GBZ A;  4F9O A;  4GY2 B;  3AGR A;  1NK7 A;  3F5T A;  1GLC G;  3KJV A;  4KTQ A;  1TKZ A;  3SQ1 A;  3SQ4 A;  1GLE G;  3U4L A;  2QA4 N;  3ZSQ A;  4M3U A;  3S41 A;  4B9T A;  3ULD A;  5HLF A;  3A5O C;  1VRT A;  3LWM A;  2HND A;  5E41 A;  3ZSW A;  4HUE A;  2QWQ A;  5C15 A;  4NCA A;  2UYT A;  4CIF A;  1LAV A;  3AGK A;  1GLJ O;  1EX4 A;  3L3U A;  3VQA A;  1BIU A;  1YJN N;  4YDU A;  1HR0 K;  2RHK A;  3QES A;  3N4P A;  4DLG A;  5CZ2 A;  3VET A;  1WSH A;  4E0D A;  4FJ9 A;  3GBT A;  4MO5 A;  5M1Q A;  3DXK B;  4BGA A;  4KHU A;  4H4O A;  1YI2 N;  3HI0 A;  3TAB A;  4YDU C;  3MXM A;  1ZBI A;  4FWM A;  1F21 A;  1NK4 A;  4BWJ A;  4IEE A;  4FZZ A;  3S3O A;  3S9H A;  3DRP A;  3ASM A;  4DFK A;  5C12 A;  1YIJ N;  5BPN A;  2YCH A;  2P9S A;  3G6E N;  3IMX A;  4DR2 K;  5CYQ A;  2W6K A;  3E01 A;  1N6Q A;  2JWL A;  3VER A;  1HKB A;  2ASP A;  1YHQ N;  4DWI A;  3S3M A;  1VSK A;  2VG6 A;  3OYI A;  3QEX A;  1FKP A;  5J1E A;  5K14 A;  1VQO N;  4JI1 K;  4CJS A;  2D5R A;  4CJK A;  4CJQ A;  2A41 A;  1GOC A;  4WE1 A;  5TKY A;  5BRE A;  2WOM A;  4FO0 A;  2FSK A;  4CZK A;  3T3F A;  4FW1 A;  4FVM A;  4FK0 A;  2PFU A;  5C24 A;  5CYM A;  4DV0 K;  3RWU A;  4CIE A;  3OBW A;  2GX9 A;  1KVC A;  4JKH A;  4CJ7 A;  2NRH A;  4B9L A;  2HHU A;  5J2N A;  3G71 N;  1TAQ A;  5AQO A;  4HTU A;  2NRR A;  2P5G A;  2F8T A;  1E3M A;  3TI0 A;  3SMP A;  3BUZ B;  3LP2 A;  4BAC A;  3CCL N;  4B3M K;  1TVR A;  1VAZ A;  4CES A;  1SS6 A;  4X64 K;  1S6P A;  4DTO A;  2HNZ A;  1ITG A;  4HVJ A;  5ADX A;  3P83 D;  3CYM A;  3DYA A;  2FF6 A;  5D3G A;  3P39 A;  4YNQ A;  1HJR A;  3LZI A;  2QWN A;  3CXC M;  1S3X A;  1Q7Y O;  5AQI A;  3H3O B;  4FJX A;  4YHH K;  3T7Z A;  3L2U A;  3QNO A;  1U49 A;  3QBW A;  1S72 N;  1SL1 A;  5AQF A;  3J8A A;  2A6A A;  3KKR A;  2HST A;  1WUA A;  2X6N A;  2YJE A;  2KZM A;  4BRM A;  1N34 K;  3RRG A;  2OCE A;  4OKK A;  5EU7 A;  5GAE P;  1RT7 A;  2H3G X;  3EO3 A;  5CHI A;  3KK2 A;  5GAD P;  1KXP A;  3OYK A;  2HHV A;  2P9N A;  4JS5 A;  3KVG A;  5HL7 L;  3D2E B;  4KB1 A;  4W5T A;  5IWA K;  1ZBL A;  4FLV A;  5M1P A;  3LP0 A;  1RT4 A;  1K9M O;  3I0S A;  3CJA A;  4JN4 A;  4BR9 A;  4H0X B;  4OJR A;  4H8K A;  3THW A;  3NBP A;  4LSN A;  3F73 A;  3O9R A;  3SQ2 A;  2ZJQ L;  1OH7 A;  1T8E A;  1FJG K;  2WC9 A;  4M7Y A;  5KPZ A;  3OJS A;  4BRF A;  3CM6 A;  2P9S B;  4LH5 A;  3H3N O;  4AH9 A;  3SV3 A;  3VQ6 A;  4ISF A;  3TTC A;  1NM1 A;  1BIS A;  1C1B A;  5I42 A;  3DLH A;  3O3H A;  1WSF A;  4NLC A;  1B92 A;  1MWK A;  4BR5 A;  5FPN A;  4BRK A;  1J5O A;  3DAW A;  4XIU A;  1HYS A;  3OVN A;  1TKT A;  2QM1 A;  3BP8 A;  3C6U A;  1L3T A;  1M1K O;  4JYA K;  5LMN K;  3ISN C;  2Q3S A;  4EIA A;  4B3S K;  1XWL A;  4YOT A;  1XC9 A;  3KD1 E;  4GKK K;  4A57 A;  5SWM A;  2Q0R A;  3THY A;  4HCB A;  4FLT A;  1RDC A;  1RBU A;  2KQ2 A;  3NGZ A;  3L8B A;  4CHN A;  2UU9 K;  1DTT A;  5AQG A;  2Q2R A;  5AQS A;  4C8K A;  3F9K A;  1H1V A;  1TKX A;  4HWI A;  2PY5 A;  3DLG A;  3UIQ A;  4RW8 A;  2W40 A;  1HLU A;  1U4B A;  1VQ7 N;  2FSJ A;  1CZA N;  4CFC A;  4E89 A;  3TAQ A;  4BRC A;  5LMU K;  1RBR A;  4C8L A;  1LWE A;  1QVG M;  2ZD1 A;  1JLA A;  4JK7 A;  3MED A;  5KGX A;  2HNY A;  1HYZ A;  3GL1 A;  2OA8 A;  3WUH A;  2HMI A;  3HOS A;  4JI2 K;  5JS2 A;  4M41 A;  3U8X A;  3ZYY X;  1I94 K;  4JD2 B;  3CFR A;  1DLO A;  1NK9 A;  1T03 A;  3U3Y A;  1IG8 A;  2G8V A;  2IIR A;  1GLA G;  5CY4 A;  4CGH A;  5JMV A;  3OS0 A;  1WB9 A;  1NJW A;  1U04 A;  3EZW A;  3C94 A;  1NKB A;  1YVU A;  2G8W A;  4TSX A;  4M3X A;  5AQJ A;  3CCQ N;  3UB5 A;  4WFN L;  3QML A;  1J6Z A;  5AQR A;  1X3M A;  4JV5 K;  4NLB A;  2I7N A;  4LFB K;  2DY4 A;  4DF4 A;  3RR7 A;  4DV4 K;  4I6M B;  3VEZ A;  2ITM A;  3OW2 M;  4DUY K;  5AZI A;  3LPT A;  4H0P A;  3ZX3 A;  3SK3 A;  5H1S Q;  4HHT A;  3AO2 A;  3AVA A;  3THW B;  3ZLJ A;  4FLU A;  3OY9 A;  4IXC A;  4B9N A;  4Z4E A;  4FCY A;  4B9Q A;  4WF9 L;  2RF2 A;  2ZWH A;  4FJ8 A;  4JEP A;  4Z94 A;  4DV6 K;  3AVI A;  2F9T A;  4B8C A;  3EE8 A;  2KLA A;  3HSC A;  4H0Y B;  4K8X A;  3DLB A;  1HYV A;  2HVI A;  4CGI A;  4FJM A;  2YHB A;  5JVG L;  5JLH A;  1RT6 A;  4A2B A;  4BRP A;  3VA0 A;  4LF7 K;  3A5M C;  3TPQ A;  2P5O A;  1BQN A;  2E8A A;  4C1N K;  3HXM A;  3D6R A;  1Q9X A;  3LM9 A;  2CGK A;  3MEC A;  4BC5 A;  4DTM A;  4IFE A;  4BDY A;  3AAR A;  3CM5 A;  1TUY A;  4JS4 A;  1BOT O;  4KAZ A;  2A1S A;  3M3Z A;  4CZG A;  4FJL A;  2IVN A;  3BZC A;  2A5X A;  4DTJ A;  1XI1 A;  2QTD A;  1B9F A;  3CJ1 A;  1ZXO A;  2A1R A;  3K59 A;  3CI5 A;  5M1F A;  1S9G A;  4E1M A;  3CHW A;  1A5W A;  2BDP A;  1WSG A;  4R5P A;  4UQG A;  1ATR A;  2YI1 A;  3FZL A;  4X62 K;  4IFV A;  3J80 O;  3VES A;  1NGA A;  3IDH A;  3MMV A;  2CGL A;  3QER A;  2IGI A;  3GE1 A;  1QHT A;  4MLH A;  1ATS A;  3CJC A;  4JKC A;  4CEA A;  1N8R O;  1BQM A;  2GEM A;  4ID1 A;  2A3Z A;  4JKE A;  3ZX2 A;  1JL1 A;  4K8Z A;  3CQX A;  4FPA A;  3C7N A;  3SUQ A;  3DLK A;  2E1Z A;  3K2P A;  3KIO A;  4CJV A;  1RFQ A;  3B6P A;  3RR8 A;  4DQI A;  4F8R A;  3SCX A;  1N36 K;  1ZBS A;  2D0O A;  4BC4 A;  2HVH A;  1WSJ A;  5GIP A;  3VTI A;  4BVP A;  2E2O A;  2ITG A;  5KQD A;  3IKM A;  2EX3 A;  5JLF A;  4BVO A;  4DV2 K;  3FZH A;  2D4W A;  3T1A A;  1RGI A;  1N5Y A;  1LCU A;  4DQP A;  2YHX A;  1QQC A;  4RW7 A;  1KRP A;  2QEX N;  4R79 A;  2O8D A;  3WQT A;  3O9S A;  3ZT1 A;  4M7X A;  1NBW A;  4CEZ A;  1K8A O;  1XC3 A;  4BWM A;  4H5N A;  5AZI B;  3CG7 A;  2X6S A;  3BZK A;  3T1H K;  4MQ3 A;  1RTJ A;  1VQP N;  4O55 A;  1HQU A;  1UAX A;  3MWT A;  1X9S A;  2O8C B;  3HST B;  2W42 A;  4MO4 A;  5KTQ A;  4FZX C;  4J2B A;  3LP3 A;  2XHB A;  4KHN A;  1JCF A;  2XY7 A;  1L3U A;  1IO2 A;  4IEI A;  4C8N A;  2EWS A;  1WBB A;  1ASV A;  4FWQ A;  3VGM A;  4FVU A;  4CJL A;  4IG3 A;  4B9U A;  2KFZ A;  1BCO A;  2GUI A;  1BA1 A;  1VK0 A;  1KLN A;  2YHA A;  4FSV A;  4UY8 O;  4AHS A;  2X74 A;  1S22 A;  3MX2 A;  1CXQ A;  2P9K A;  1RDA A;  5BN8 A;  3SMS A;  5FRO A;  4EHU A;  1JCE A;  3V9U A;  3VQQ A;  3MK6 A;  2DFE A;  1NMN A;  3OYN A;  1WLJ A;  3KK1 A;  5C25 A;  3PV8 A;  3NFA A;  4JRQ A;  1O13 A;  4CK3 A;  4LF9 K;  3QFP A;  5TKW A;  4M3Z A;  4QOZ B;  2FBY A;  3I8B A;  1S9E A;  3TAE A;  2DFF A;  3CJ9 A;  3UKU A;  3CCJ N;  2Z1J A;  3TSQ A;  3LL3 A;  3ZEU A;  4W5R A;  5B8H A;  1GLL O;  4EFH A;  1T7P A;  3KK7 A;  3HT3 A;  3L4Q A;  1VHX A;  3WXI A;  1Z6R A;  2YHY A;  4O44 A;  5EXW A;  3OTO K;  2Z1H A;  3G25 A;  4K41 A;  3LZJ A;  2W41 A;  4LF8 K;  4A62 A;  1RT5 A;  4IZ9 A;  1YIT N;  4CF1 A;  1QSS A;  3CMA N;  4CF2 A;  1TK8 A;  2D0A A;  4CGG A;  3D7E O;  1NG9 A;  4F3O A;  4ELV A;  4GMJ B;  3SAH A;  1EQY A;  5SZT A;  3TR8 A;  5HP1 A;  1VSL A;  2ATQ A;  3WNG A;  4IFY A;  1YTU A;  4BRG A;  4KTZ A;  1XHX A;  3C7N B;  3AA5 X;  4PA1 A;  4DQS A;  3WT0 A;  2XO7 A;  5FPD A;  4YOY A;  4B9M A;  3ZCM A;  3O8M A;  2Q97 A;  1S1U A;  2LSN A;  2KFN A;  3HP6 A;  1LW0 A;  4ELT A;  3BF1 A;  4CF9 A;  3SAG A;  3G10 A;  4OPA A;  1NGF A;  5AQU A;  4DQQ A;  3WEE B;  3GDQ A;  1JLQ A;  2O8D B;  3WXM B;  3HM9 A;  4C23 A;  4PKH A;  4A5A A;  2E20 A;  3RMB A;  3EY1 A;  1NGI A;  4DF8 A;  3LAK A;  5F0X A;  1U45 A;  1C1C A;  4N41 A;  3P1G A;  3VEO A;  2NRT A;  3Q7C A;  3MCP A;  3KWI A;  3LDL A;  1EO1 A;  3BDP A;  4FLX A;  1DKG D;  1X9M A;  3OYD A;  1HPZ A;  4FW2 A;  3IG1 A;  1BI4 A;  4JI8 K;  3MN6 A;  4DSI A;  1RDD A;  1Z05 A;  3CIP A;  1RBS A;  1QZ5 A;  3VPZ A;  2UXB K;  4BE1 A;  4CGF A;  3VF6 A;  3FE1 A;  3EZ5 A;  3ULE A;  3TAR A;  2XY8 A;  4DV3 K;  1KFS A;  4KPY A;  4OVL A;  3VOV A;  3K0S A;  4B1U B;  1NK5 A;  1YXQ A;  3QIO A;  3ID6 A;  1OH5 A;  2KZZ A;  3DWL A;  3U3G A;  4CBU A;  2P9I A;  4DTU A;  4GV3 A;  2P9P A;  5HOO A;  1C0U A;  1W7A A;  3EEQ A;  1IJJ A;  4BRE A;  3O9U A;  1ATN A;  4DS5 A;  4IO8 A;  1SV5 A;  3ZSO A;  1NGE A;  1C0T A;  4XH1 A;  4N76 A;  4DSE A;  2FBT A;  4JHD B;  3NE6 A;  3AAP A;  3UKU B;  4JKF A;  3AO1 A;  4OPJ A;  2CH5 A;  4FJI A;  1D9F A;  3G0Z A;  4E7J A;  1SKW A;  3DRS A;  2XY6 A;  4CJR A;  3DI6 A;  4OPH A;  3OYC A;  3SPZ A;  1JLF A;  1YUW A;  3CCS N;  5HRP A;  4MDA A;  3SLC A;  3K5N A;  2F7T A;  4CED A;  3AAQ A;  4FJ5 A;  1J54 A;  1E4G T;  4J8F A;  1JCG A;  2GTD A;  4DTP A;  4I2P A;  3NGY A;  3QLH A;  3KLH A;  4B1V A;  2BE2 A;  3WXK A;  5AQH A;  1R0A A;  2RE2 A;  3ENB A;  4O4G A;  1GLD G;  3PSF A;  4BRO A;  2FBV A;  3ENH A;  3R3L A;  4BC2 A;  2ZM6 K;  4DG1 A;  4H5R A;  1QSY A;  3H6E A;  3VN5 A;  4FWO A;  3L4I A;  4MFB A;  4HUG A;  3UE5 A;  2BAN A;  4NO7 A;  1YF5 L;  1NJZ A;  5HBM A;  4DU1 A;  2G8H A;  4W5O A;  4BQL A;  3EE9 A;  4AM6 A;  3FFI A;  4RCH A;  2OPP A;  3Q7B A;  3I8D A;  4KHW A;  4AHR A;  4DSJ A;  3EKS A;  3OHR A;  3EKU A;  3A5N C;  2WON A;  4ID5 A;  2GWJ A;  4PHT X;  1OH6 A;  4QS7 A;  4BR0 A;  1D8Y A;  1I3A A;  3L6Q A;  4H0V B;  2ZF5 O;  1NU0 A;  2HBM A;  2P1J A;  3AY9 A;  3OYF A;  2YNF A;  3VF4 A;  1VQL N;  1K8K A;  4FOI A;  4RWT A;  3HVT A;  3CPE A;  4FXD A;  3O9Q A;  5AQQ A;  1RTH A;  4O0J A;  1TK0 A;  4DSF A;  4KH4 A;  4U67 L;  1XMO K;  3V4I A;  3D2F A;  1HNV A;  1IKY A;  3R1X A;  1BI4 B;  4LF6 K;  4AHT A;  4M3R A;  4IJA A;  2O8F A;  4I9Q A;  1E4F T;  4OGC A;  2XRI A;  2UUC K;  3VF2 A;  3SAF A;  1EWQ A;  4CJE A;  3PO5 A;  4CHZ A;  3ULE B;  4YOV A;  5FRN A;  3O1B A;  2D0B A;  1NGJ A;  5HRS A;  4CJ3 A;  1CXU A;  3OYE A;  3LWL A;  2P9I B;  4Y1C A;  2QWL A;  3DLR A;  2BUP A;  1W9H A;  4G1Q A;  2P9P B;  3QFU A;  5AQV A;  4FM2 A;  4B9V A;  4CFD A;  3OBY A;  3MWP A;  3HK2 A;  4FJJ A;  3AA2 A;  1IH7 A;  2F8S A;  4YY3 K;  3MXJ A;  4F4K A;  1WOQ A;  3M8P A;  4FJN A;  1ASU A;  4DV7 K;  4CZL A;  3QIN A;  4YOR A;  2V7Y A;  3NVK A;  2GEL A;  3QBX A;  4RW4 A;  4CJF A;  4O5F A;  4J2D A;  3SJH A;  4KH5 A;  1VQM N;  3FZF A;  2VG5 A;  3WXJ A;  1KQS M;  2QKB A;  3VEN A;  5KPT A;  5KQ8 A;  3S3N A;  2NRW A;  1SKR A;  1CLQ A;  5BR8 K;  3HL8 A;  3VEV A;  2KHO A;  4CFA A;  3ZSX A;  1Q9Y A;  5GIN A;  3AVM A;  1QQM A;  1Z26 A;  2DTU A;  2F9W A;  4DTX A;  4F2S A;  1FKO A;  1NGD A;  3DM2 A;  4KFB A;  5BPL A;  1U2V A;  4FWN A;  1VQ9 N;  4KO0 A;  1YJW N;  5AR0 A;  4BRI A;  1S5J A;  5LJW A;  3K57 A;  1YT3 A;  1P8Z A;  3ZSR A;  4M3T A;  3U9Z A;  3QB0 A;  1NJY A;  3MEE A;  3RMA A;  4DSK A;  4WCE L;  4JI5 K;  2RPI A;  4KKO A;  1Q86 O;  2F96 A;  2WFB A;  3NDK A;  4EHT A;  5J2Q A;  2CH6 A;  4CK2 A;  3H08 A;  1NK6 A;  3C95 A;  4K25 A;  4ILH A;  2Q0U A;  3RSE A;  5GAH P;  3CET A;  4RTF D;  3I56 N;  3O80 A;  2HHW A;  5C0Y A;  1JJ2 M;  2QK9 A;  1FXX A;  1NKE A;  2E2N A;  3EN9 A;  3PX0 A;  4FPB A;  5DM6 L;  1TYQ A;  5F2R A;  1MU2 A;  2NRV A;  1ASW A;  4LD0 A;  1S1X A;  2OTJ N;  1KAY A;  1JLG A;  3THX A;  1K8K B;  4BE2 A;  4DFJ A;  1C1A A;  3SYZ A;  4NXM K;  3TTD A;  4JI0 K;  1TV6 A;  2YKN A;  1ZBF A;  3AVN A;  4B3T K;  2E2Q A;  3B6O A;  4CZE A;  4ZHR A;  1KSP A;  3E9O A;  2B4J A;  1D4X A;  2YHW A;  2IVP A;  4BRN A;  4JK8 A;  3VA3 A;  4BRQ A;  5AQY A;  4RG8 A;  3HBT A;  5AQP A;  2P9N B;  4KI4 A;  2O8F B;  1EXQ A;  5LJV A;  4O0I A;  1N33 K;  2XY5 A;  1XQS C;  3UKR A;  3VEY A;  3DLE A;  1W2B M;  3MX5 A;  4CER A;  4H5V A;  3IS9 A;  3MEG A;  4Z4I A;  4KTW A;  4DB3 A;  1V4T A;  3O1W A;  3G4S N;  3L2R A;  1NK0 A;  2V51 B;  2VYP A;  4JKD A;  4CEE A;  4GVM A;  2UUA K;  4L3Q A;  3O4W A;  1NGC A;  4XH5 A;  1TUU A;  2VQE K;  2AP1 A;  3OS2 A;  1JKH A;  4CK1 A;  1NOZ A;  4PKG A;  3ZSY A;  2HHS A;  4E7H A;  3MDQ A;  1RTD A;  4OX9 K;  4B1Z A;  3QEW A;  4CEQ A;  2NNW A;  4OLA A;  2QXF A;  1WSI A;  4DQ8 A;  1RDW X;  4HCC A;  4Z4G A;  3HP9 A;  3TTF A;  4EP5 A;  2OPS A;  5KRS A;  3O4Q A;  1VSJ A;  4JNE A;  4AIL C;  4PUO A;  3THY B;  4M42 A;  1LWF A;  1O1W A;  1RNH A;  1VQ6 N;  3AVG A;  3A2F A;  1HNW K;  2IDO A;  3D45 A;  3LDP A;  3PO4 A;  5GIO A;  2ZQB A;  3C65 A;  1XUP O;  4WYB A;  3M6G A;  5AQW A;  5C2D A;  2OPQ A;  4I9L A;  2B6A A;  3HOT A;  4DR7 K;  4H4M A;  2G8I A;  1IBM K;  3DXM A;  3JSM A;  2OAN A;  1JLE A;  4JI7 K;  3L3V A;  4BRH A;  2O8E A;  4BY9 C;  4K43 A;  3PSI A;  1LW2 A;  1NOY A;  1TL1 A;  1JLC A;  2O4G A;  3V81 A;  5E26 A;  1GLF O;  3ENO A;  3SUP A;  3AO5 A;  4IG0 A;  4ILG B;  5DMR A;  1JXE A;  2ZE2 A;  2ZGZ A;  1WBD A;  5C2F A;  2IAJ A;  1WNS A;  4FK4 A;  1TYQ B;  4DFP A;  3O08 A;  4YFU A;  4AM7 A;  3NCI A;  4B1W B;  3RMC A;  1VSH A;  1BWF O;  4JKB A;  5EVZ A;  3JXU A;  1U6Z A;  4Z4H A;  1QVF M;  3ZSV A;  1D9D A;  2IS3 A;  2NUB A;  2GWK A;  3U9D A;  3ZET A;  4F3T A;  3H1Q A;  4YOU A;  2HF3 A;  2YX6 A;  4PY5 A;  2HBL A;  5C10 A;  1VRU A;  3O3G A;  1T6D A;  1KVA A;  4H03 B;  4EAH D;  4EZ6 A;  4ZTF A;  2HF4 A;  4CZH A;  1HX1 A;  3UKR B;  4G9Z A;  1G99 A;  2E5L K;  3IRX A;  5LL6 Z;  4CBW A;  4CEF A;  1CZ9 A;  3KLG A;  2Y1I A;  1C0F A;  5BRH A;  3LDQ A;  4BR2 A;  5HRO A;  4OGE A;  2R7Y A;  2PYJ A;  2YNH A;  4B3O A;  4EP4 A;  1ZBU A;  4M63 C;  3H45 C;  1S1T A;  3ATU A;  5JVH L;  3K5O A;  4CJ4 A;  4GV9 A;  1UOC A;  1Q18 A;  1J9A A;  3WNH A;  3TWH A;  1DEJ A;  4C8M A;  1BHL A;  1HKG A;  3FZM A;  4I2Q A;  4A59 A;  2HHH K;  3NF6 A;  5BR9 A;  5CZ1 A;  2B5J A;  4HTL A;  1IG9 A;  5JS1 A;  2ETJ A;  1GOB A;  2YV0 X;  3TSP A;  3P5J A;  3LDN A;  4DR4 K;  4IO9 L;  3SUO A;  3THV A;  3PIO L;  2JLE A;  3T19 A;  4O8K A;  2HMP A;  4CEO A;  1NK8 A;  2I5J A;  1KC8 O;  1TL3 A;  4Z0U A;  4CCH A;  3LDS A;  3MN5 A;  4CZM A;  4BDZ A;  3ITH A;  1HNI A;  4BE0 A;  4DLE A;  4FWK A;  4CHY A;  1EKE A;  5AQM A;  4DR5 K;  1G15 A;  3KHY A;  3NH0 A;  2WUS A;  4FK2 A;  3TAF A;  1DT9 A;  2ASM A;  5BRD A;  1HNX K;  4QS9 A;  1Y97 A;  2P9U A;  3NH2 A;  4NYF A;  3C6H A;  3B8A X;  4CZF A;  4N56 A;  3PX4 A;  2O8E B;  2VWK A;  3V1R A;  2NZT A;  1IKX A;  5EOY A;  5CE3 A;  3J7Y P;  1TK5 A;  1BDG A;  3WXL A;  3A8Y A;  4JAX A;  3ZT0 A;  1A5V A;  1QZ6 A;  3DLL L;  1LAW A;  4JKG A;  1S1V A;  3J7Z O;  4ICL A;  2A40 A;  2E1Y A;  4LF5 K;  3CCU N;  3H1V X;  4A2A A;  4CHQ A;  3RMD A;  3ALY A;  3PX6 A;  3IAY A;  1X1P A;  3CPW M;  3SQ0 A;  3DOL A;  3I0R A;  3K5L A;  3NAE A;  1VQ4 N;  4FJG A;  4IDH A;  2QI2 A;  1QTM A;  3OYA A;  4OPK A;  2FF3 B;  4DTR A;  5A2Q O;  3T69 A;  3AVC A;  3HTV A;  4BDP A;  3ZET B;  4MDB A;  4CHP A;  1KTQ A;  3KKS A;  5F1X A;  4B3R K;  4RW9 A;  3NGI A;  4IOX A;  1OVY A;  3CQY A;  3AA4 A;  3MXI A;  2UUB K;  3EYZ A;  3GOI A;  4KHS A;  4OKE A;  5HRN A;  1U47 A;  5I3U A;  4CVN E;  1NGB A;  4GNI A;  3N4Q A;  3NHG A;  1RDU A;  4LC9 B;  4PWD A;  4FL9 A;  3MN7 A;  3VQE A;  3NF7 A;  1P90 A;  4E1N A;  1R59 O;  2ZJR L;  3AV9 A;  2VGN A;  3E1Y A;  1SL0 A;  3C6T A;  1CZB A;  4WQ4 A;  1X3N A;  3ZX0 A;  3L0Q A;  2VGM A;  4CF8 A;  2PYL A;  4ISG A;  4N47 A;  1A5X A;  2P9K B;  3VQD A;  5KGW A;  4N5S A;  4M3Y A;  2E88 A;  1SKS A;  4WQ4 C;  3TSU A;  4KI6 A;  3F2K A;  3A5L C;  3TAM A;  4X65 K;  5BRF A;  2V52 B;  2RN2 A;  1BA0 A;  4ILJ A;  3D2E A;  1RIL A;  4LH4 A;  3LAL A;  2Q1N A;  4ELU A;  3FFK B;  3QIP A;  4KV8 A;  4Z4C A;  4NYN A;  1VSM A;  2O8B A;  4Q5V A;  3AVB A;  3L2Q A;  2KKZ A;  3LM2 A;  1XMQ K;  3ZEU B;  1QQN A;  1Q81 O;  3SZ2 A;  4Z4F A;  4YOX A;  2IVO A;  4X66 K;  5E84 A;  3ZT2 A;  3CC7 N;  4BRL A;  4CZI A;  1Q8I A;  1DTQ A;  2FXU A;  2P9U B;  4KH6 A;  3VQB A;  3OJU A;  3CC4 N;  3HJF A;  2UXC K;  4DR6 K;  4BQZ A;  1D5A A;  3CC2 N;  2VG7 A;  4IDK A;  2P9L A;  1W0H A;  3KTQ A;  1YTA A;  5IT9 O;  1TGO A;  3R6M A;  4E3S A;  3LDO A;  3R9P A;  3V1O A;  4AHU A;  5FPE A;  3CQ8 A;  1FW6 A;  3L2V A;  3CER A;  3KD5 E;  1WSE A;  4A61 A;  1WAF A;  4JKG B;  1HRH A;  1RT3 A;  5LY3 A;  5CR4 A;  3VGL A;  3P38 A;  1HNZ K;  1ESV A;  3O9T A;  4LSL A;  4BC3 A;  1QHA A;  3SNN A;  3OYB A;  3M8Q A;  4WFA L;  1XHZ A;  1VSI A;  4FM0 A;  3E9P A;  4QCL A;  2FBX A;  5AQX A;  2BH1 A;  1BGX T;  3M8S A;  4QS8 A;  2BGG A;  4O5B A;  3AA3 A;  2FC0 A;  2BTF A;  4LFA K;  4LFC K;  3HPH A;  4H5T A;  3SJJ A;  1GOA A;  3ZT4 A;  4AF1 A;  1FK9 A;  4IBN A;  2G8F A;  2EHG A;  4CEC A;  5C42 A;  1RTI A;  3A0I X;  3VQ8 A;  3DRR A;  3NH1 A;  1KVB A;  4DV5 K;  3MAQ A;  5GAG P;  4BRA A;  2OYQ A;  2E6M A;  1XNQ K;  3NMU A;  4IOC L;  3NF8 A;  3MN9 A;  3P31 A;  1W97 L;  3M1F A;  4KHY A;  4JD2 A;  1SUQ A;  3VQ7 A;  3NF9 A;  4NCG A;  4JI4 K;  4B8A B;  1BL3 A;  3OYM A;  2OPR A;  3AVH A;  1U48 A;  3VQP A;  4DCH A;  1VQK N;  2AJQ A;  3R8E A;  4Y0W A;  1VQ8 N;  4JI3 K;  5AQL A;  3CCV N;  2V7Z A;  3CJB A;  2GUP A;  4E7I A;  4C1N I;  3QIC A;  3IUC A;  1LWC A;  4I7F A;  2QWM A;  1OH8 A;  3WQU A;  3AVK A;  2YJF A;  4HUF A;  3KLF A;  2KW4 A;  4KRE A;  4FM1 A;  3K5M A;  4I6M A;  2WBN A;  3J7A P;  3CJ7 A;  2F4V K;  3RVC A;  3D0P A;  4CGD A;  2OZM A;  4XEI A;  1M90 O;  1JL2 A;  3HPO A;  3P4I A;  2O8B B;  2UXD K;  3VMF B;  4Y1D A;  2FLO A;  4PKI A;  5AFU H;  1UA1 A;  4FJ7 A;  2Z1I A;  3RTV A;  5FLX O;  4CJ5 A;  4FZY A;  1VQN N;  2OTL N;  4BG9 A;  2ASO A;  1IV0 A;  1NLV A;  3HM8 A;  2D0C A;  4WFB L;  1L3V A;  4FWP A;  4LY7 A;  1HPM A;  3IFR A;  2P9L B;  4CIG A;  2PZS A;  3W3D A;  2D1K A;  2G8K A;  5FDL A;  3HPG A;  3KLI A;  3M5R A;  4E7L A;  1TAU A;  1BU6 O;  2NRZ A; 
#chains in the Genus database with same CATH homology
 1LV5 A;  5J2P A;  4WE1 A;  2OPQ A;  4I9L A;  2B6A A;  4J2A A;  2WOM A;  4O44 A;  4H4M A;  1RT1 A;  2IOC A;  1HQE A;  3TAN A;  2Z1H A;  2G8I A;  4KB0 A;  3T3F A;  3JSM A;  4FW1 A;  3LZJ A;  1JLE A;  4FVM A;  4FK0 A;  3L3V A;  5CYM A;  5C24 A;  3RWU A;  4CIE A;  1RT5 A;  3WNF A;  4CF1 A;  1S1W A;  1QSS A;  1KVC A;  3AVF A;  4CF2 A;  2DFH A;  1TK8 A;  4B9L A;  2D0A A;  3V1Q A;  4CGG A;  4F3O A;  5J2N A;  1LW2 A;  3PX4 A;  2HHU A;  1NOY A;  4ELV A;  1TL1 A;  1TAQ A;  1JLC A;  2O4G A;  4GMJ B;  3V81 A;  4HTU A;  5SZT A;  2P5G A;  2F8T A;  3TR8 A;  3SUP A;  1VSL A;  2ATQ A;  3AO5 A;  4IG0 A;  5DMR A;  5HP1 A;  1JXE A;  2ZE2 A;  3WNG A;  3TI0 A;  3LP2 A;  4IFY A;  1REV A;  2IAJ A;  3VQ4 A;  4BAC A;  1WNS A;  4KTZ A;  1XHX A;  1UA0 A;  4FK4 A;  1YTU A;  1K6Y A;  2RKI A;  3AA5 X;  1TVR A;  3LP1 A;  4DFP A;  4PA1 A;  4DQS A;  4YFU A;  4CES A;  3NCI A;  2XO7 A;  1S6P A;  4DTO A;  5KI6 A;  3KLE A;  5J2M A;  2HNZ A;  1ITG A;  4HVJ A;  3RMC A;  3QEP A;  1VSH A;  4B9M A;  3V9W A;  3P83 D;  3ZCM A;  1RBV A;  3CYM A;  3DYA A;  4DSL A;  5D3G A;  4YNQ A;  1HJR A;  1S1U A;  2LSN A;  2KFN A;  3HP6 A;  4Z4H A;  3LZI A;  3ZSV A;  1LW0 A;  4FLY A;  1D9D A;  4ELT A;  2IS3 A;  3BGR A;  4F2R A;  4L8R B;  2NUB A;  4CF9 A;  2GV9 A;  3G10 A;  3QNN A;  4FJK A;  4F3T A;  4DQQ A;  4FLZ A;  4FJX A;  1EP4 A;  4PY5 A;  3L2U A;  1JLQ A;  3HVR A;  4JLH A;  3VQ5 A;  3HM9 A;  1VRU A;  3QNO A;  1U49 A;  1VSE A;  3O3G A;  4NCB A;  1SL1 A;  1KVA A;  1VSF A;  3AVL A;  4EZ6 A;  3RMB A;  3EY1 A;  4ZTF A;  3KKR A;  4DF8 A;  3LAK A;  4CJT A;  1U45 A;  1C1C A;  2X6N A;  4N41 A;  3P1G A;  2KZM A;  3IRX A;  4E19 A;  4CEF A;  1CZ9 A;  3KLG A;  2Y1I A;  3RRG A;  4OKK A;  3U6F A;  5EU7 A;  3O4N A;  5HRO A;  3OS1 A;  1RT7 A;  4OGE A;  2R7Y A;  4FLX A;  3V6D A;  3BDP A;  4C8O A;  2E6L A;  2PYJ A;  2YNH A;  3SUN A;  2O4I A;  1X9M A;  4W5Q A;  1HPZ A;  3OYD A;  4B3O A;  4EP4 A;  4FW2 A;  3KK3 A;  1ZBU A;  3IG1 A;  1BI4 A;  3KK2 A;  1S1T A;  4DSI A;  3OYK A;  4EZ9 A;  1RDD A;  2HHV A;  4JS5 A;  4IKF A;  1RBS A;  3K5O A;  4CJ4 A;  1UOC A;  4KB1 A;  1QE1 A;  4BE1 A;  3ZT3 A;  1J9A A;  3WNH A;  3AVJ A;  4CGF A;  4W5T A;  4C8M A;  3TWH A;  1BHL A;  4FLV A;  1ZBL A;  1ZBH A;  4I2Q A;  3LP0 A;  3EZ5 A;  1RT4 A;  3NF6 A;  3TAR A;  5CZ1 A;  2XY8 A;  2B5J A;  3OYL A;  1KFS A;  3I0S A;  1IG9 A;  4KPY A;  5JS1 A;  2ETJ A;  1GOB A;  2YV0 X;  4OVL A;  1J53 A;  1NK5 A;  3QIO A;  2KZZ A;  3P5J A;  4OJR A;  4H8K A;  3NBP A;  4LSN A;  3F73 A;  3U3G A;  3PUF A;  3SQ2 A;  3SUO A;  3THV A;  2JLE A;  3T19 A;  4CEO A;  4DTU A;  1NK8 A;  1T8E A;  2I5J A;  1BCM A;  4CCH A;  1C0U A;  1TL3 A;  4Z0U A;  3VQ9 A;  3LDS A;  3OJS A;  3WNE A;  4DS5 A;  5FRM A;  3CM6 A;  4BDZ A;  4DS4 A;  4B9S A;  1SV5 A;  3ZSO A;  3ITH A;  1HNI A;  2YKM A;  4LH5 A;  1C0T A;  4BE0 A;  4DLE A;  4AH9 A;  4CHY A;  1EKE A;  3PY8 A;  4N76 A;  4DSE A;  3SV3 A;  3VQ6 A;  3LAN A;  2FBT A;  3NE6 A;  3TAG A;  4FYD A;  1BIS A;  1C1B A;  5I42 A;  3DLH A;  3AO1 A;  4OPJ A;  3O3H A;  1WSF A;  3TAP A;  3AO4 A;  1B92 A;  1X9W A;  4FJI A;  1G15 A;  3SI6 A;  1D9F A;  3G0Z A;  4E7J A;  1J5O A;  3RRH A;  3O3F A;  2X78 A;  4XIU A;  3NH0 A;  1SKW A;  1HYS A;  2KTQ A;  3DRS A;  4FLW A;  4CJW A;  3VQC A;  3QEV A;  3OVN A;  4CJR A;  3V9X A;  2XY6 A;  4FK2 A;  4J2E A;  3TAF A;  2HW3 A;  1VSD A;  1TKT A;  1L3T A;  3DI6 A;  3C6U A;  2Z1G A;  3OYC A;  3SPZ A;  1JLF A;  3ISN C;  2E4L A;  2Q3S A;  5HRP A;  3K5N A;  1XWL A;  4KHQ A;  4CED A;  1XC9 A;  4FJ5 A;  1J54 A;  3KD1 E;  2HHQ A;  1Y97 A;  3NH2 A;  4NYF A;  4B08 A;  4CJU A;  5SWM A;  3V9S A;  4DTN A;  4DTP A;  4HCB A;  4I2P A;  4QAG A;  3NGY A;  3QLH A;  1RDC A;  4N56 A;  3KLH A;  1RBU A;  2KQ2 A;  4FLT A;  3NGZ A;  4ZTJ A;  2BE2 A;  2VWK A;  3V1R A;  3L8B A;  3DMJ A;  4CHN A;  1S6Q A;  1IKX A;  4E7K A;  1TK5 A;  1R0A A;  3ZT0 A;  3OYG A;  1A5V A;  1DTT A;  2YNG A;  4O4G A;  4C8K A;  3F9K A;  2FBV A;  3OYJ A;  1TKX A;  1LAW A;  2PY5 A;  4DG1 A;  1QSY A;  3HYF A;  1S1V A;  3DLG A;  3UIQ A;  4ICL A;  3VN5 A;  4RW8 A;  1U4B A;  4MFB A;  4HUG A;  1QS4 A;  2BAN A;  3V9Z A;  4CHQ A;  2G8U A;  3RMD A;  3ALY A;  3PX6 A;  3IAY A;  1NJZ A;  4CFC A;  4E89 A;  1X1P A;  5HBM A;  3LPU A;  1UWB A;  4DU1 A;  3TAQ A;  4W5O A;  3SQ0 A;  2G8H A;  3DOL A;  3I0R A;  3K5L A;  3NAE A;  1RBR A;  4FJG A;  3FFI A;  4C8L A;  1LWE A;  1QTM A;  3OYA A;  4OPK A;  4CGJ A;  2OPP A;  2ZD1 A;  1JLA A;  5KGX A;  3MED A;  4AHR A;  3I8D A;  4DTR A;  4DSJ A;  4KHW A;  2HNY A;  1HYZ A;  3AVC A;  4AHV A;  1KFD A;  1L5U A;  4BDP A;  2WON A;  4ID5 A;  2OA8 A;  1WN7 A;  4GW6 A;  2HMI A;  5T7B A;  4CHP A;  5JS2 A;  4M41 A;  1D8Y A;  1KTQ A;  3KKS A;  1I3A A;  4RW9 A;  3CFR A;  1DLO A;  1NK9 A;  1T03 A;  3NGI A;  3U3Y A;  1TKD A;  5HRR A;  2G8V A;  5DK5 A;  4KRF A;  2P1J A;  5CY4 A;  4CGH A;  3OYF A;  3AA4 A;  2YNF A;  3OS0 A;  3MXI A;  3EYZ A;  1NJW A;  1U04 A;  2VWJ A;  3HVT A;  3M8R A;  4DTS A;  4FXD A;  4KHS A;  4OKE A;  5HRN A;  1U47 A;  1RTH A;  3C94 A;  1NKB A;  1YVU A;  5I3U A;  2G8W A;  4TSX A;  4O0J A;  2Y1J A;  1TK0 A;  4M3X A;  4DSF A;  1RDB A;  3NHG A;  2OZS A;  4JRP A;  3V4I A;  1JXB A;  4CE9 A;  4PWD A;  4CEB A;  2DY4 A;  1HNV A;  3VQE A;  4CFB A;  1IKY A;  3NF7 A;  3CFO A;  4E1N A;  4DF4 A;  3RR7 A;  1BI4 B;  1RBT A;  3QET A;  4AHT A;  3AV9 A;  1KLM A;  4CJP A;  4M3R A;  1SL0 A;  4I9Q A;  3C6T A;  1CZB A;  4OGC A;  2XRI A;  2YNI A;  1L3S A;  4CF8 A;  2HB5 A;  4CJE A;  3PO5 A;  3LPT A;  4CHZ A;  3K58 A;  3JYT A;  2PYL A;  4HHT A;  4N47 A;  3AO2 A;  1A5X A;  5FRN A;  3VQD A;  5KGW A;  2D0B A;  1I39 A;  3AVA A;  4OKJ A;  5HRS A;  4N5S A;  4CJ3 A;  4M3Y A;  3LAM A;  1CXU A;  3OYE A;  3LWL A;  1SKS A;  4FLU A;  3OY9 A;  4Y1C A;  3DLR A;  4KI6 A;  1W9H A;  4G1Q A;  3TAM A;  4B9N A;  4Z4E A;  3CFP A;  4OLB A;  2RN2 A;  4FCY A;  4FM2 A;  4B9V A;  4CFD A;  2RF2 A;  1RIL A;  4LH4 A;  3LAL A;  4CF0 A;  3HK2 A;  4ELU A;  3AA2 A;  4DFM A;  4FJJ A;  1IH7 A;  4FJ8 A;  1BIZ A;  2F8S A;  1C0M A;  1RCH A;  1B9D A;  3AVI A;  3MXJ A;  3QIP A;  4KV8 A;  4Z4C A;  4F4K A;  3M8P A;  4B8C A;  4FJN A;  3SPY A;  4NYN A;  1ASU A;  4FJH A;  1VSM A;  3QIN A;  1SL2 A;  4Q5V A;  3AVB A;  3L2Q A;  1QSL A;  2HHT A;  4DMN A;  4RW4 A;  1IKW A;  4CJF A;  1JLB A;  3DLB A;  4K8X A;  1HYV A;  4DU4 A;  4E7L A;  2HVI A;  4DQR A;  4J2D A;  2JGU A;  4CGI A;  4FJM A;  2YHB A;  3SZ2 A;  1WAJ A;  4Z4F A;  4Q0B A;  1RT6 A;  3DOK A;  2VG5 A;  3ZT2 A;  2QKK A;  3VA0 A;  1ZYQ A;  2P5O A;  1BQN A;  2QKB A;  4M45 A;  3HXM A;  1Q8I A;  1DTQ A;  3S3N A;  1SKR A;  1CLQ A;  3HL8 A;  4CFA A;  3VQB A;  3ZSX A;  3MEC A;  3OJU A;  4DTM A;  1Q9Y A;  1Q9X A;  1RT2 A;  3HJF A;  3AVM A;  4BDY A;  1Z26 A;  3CM5 A;  1D5A A;  2DTU A;  2VG7 A;  4DTX A;  4IDK A;  4F2S A;  1FKO A;  1W0H A;  1YTA A;  3DM2 A;  4KFB A;  3KTQ A;  4M3W A;  1TGO A;  4E3S A;  4JS4 A;  4CHO A;  4KO0 A;  2P51 A;  4KAZ A;  2A1S A;  3V1O A;  1S5J A;  4FJL A;  4AHU A;  2HHX A;  3K57 A;  4DTJ A;  1YT3 A;  3CQ8 A;  3ZSR A;  3L2V A;  1B9F A;  1XI1 A;  3KD5 E;  4M3T A;  3AO3 A;  1WSE A;  1WAF A;  2A1R A;  1HRH A;  3K59 A;  1NKC A;  1RT3 A;  1NJY A;  3MEE A;  3RMA A;  1S9G A;  4LSL A;  4DSK A;  4E1M A;  1A5W A;  3OYB A;  3SNN A;  3QEI A;  2BDP A;  1WSG A;  4R5P A;  1KCF A;  2RPI A;  4KKO A;  4AHC A;  4UQG A;  2F96 A;  4RW6 A;  3M8Q A;  3NDK A;  1C6V A;  4IFV A;  1VSI A;  4DU3 A;  1XHZ A;  4FM0 A;  5J2Q A;  4CK2 A;  3H08 A;  1NK6 A;  4QCL A;  3C95 A;  3QO9 A;  3QER A;  2FBX A;  4W5N A;  2IGI A;  1QHT A;  2HHW A;  1BGX T;  1HMV A;  1IKV A;  3M8S A;  1T05 A;  4CEA A;  1BQM A;  4ID1 A;  3HO1 A;  2QK9 A;  1FXX A;  1JL1 A;  4K8Z A;  5KRT A;  1NKE A;  2BGG A;  3PX0 A;  4O5B A;  3AA3 A;  3SUQ A;  2FC0 A;  3DLK A;  3KIO A;  3K2P A;  4CJV A;  1EET A;  1MU2 A;  3OYH A;  3B6P A;  3SV4 A;  3HPH A;  3ZSZ A;  3SJJ A;  1GOA A;  1ASW A;  4LD0 A;  3RR8 A;  3ZT4 A;  1NJX A;  2IC3 A;  1S1X A;  4DQI A;  3L2W A;  3SCX A;  1Z25 A;  4F8R A;  4PQU A;  1FK9 A;  1JLG A;  4IBN A;  2G8F A;  2GBZ A;  2EHG A;  2HVH A;  4CEC A;  1WSJ A;  5C42 A;  4BE2 A;  4DFJ A;  1C1A A;  1RTI A;  1NK7 A;  3SYZ A;  3VQ8 A;  3KJV A;  2ITG A;  3DRR A;  1TV6 A;  2EX3 A;  1TKZ A;  2YKN A;  1KVB A;  3NH1 A;  4KTQ A;  3SQ1 A;  3MAQ A;  1ZBF A;  3AVN A;  3T1A A;  2OYQ A;  3SQ4 A;  3B6O A;  2E6M A;  3NF8 A;  1N5Y A;  4ZHR A;  3ZSQ A;  1KSP A;  4M3U A;  4DQP A;  2B4J A;  1QQC A;  4RW7 A;  1KRP A;  4KHY A;  4B9T A;  3VA3 A;  1SUQ A;  3ULD A;  4RG8 A;  3VQ7 A;  3NF9 A;  5HLF A;  4NCG A;  4B8A B;  4KI4 A;  1BL3 A;  1EXQ A;  4O0I A;  3ZT1 A;  1VRT A;  3OYM A;  2OPR A;  3AVH A;  4CEZ A;  2HND A;  4BWM A;  3LWM A;  1U48 A;  3VQP A;  2XY5 A;  5E41 A;  2AJQ A;  3CG7 A;  3ZSW A;  2X6S A;  4HUE A;  4MQ3 A;  3DLE A;  1RTJ A;  4E7I A;  4O55 A;  1HQU A;  1UAX A;  4CER A;  1X9S A;  4NCA A;  4CIF A;  1LAV A;  3IS9 A;  1LWC A;  3MEG A;  4I7F A;  4Z4I A;  3HST B;  4KTW A;  1EX4 A;  2W42 A;  3L3U A;  5KTQ A;  3VQA A;  4FZX C;  4J2B A;  3LP3 A;  2XHB A;  4KHN A;  1BIU A;  3AVK A;  2XY7 A;  1L3U A;  1IO2 A;  4HUF A;  3L2R A;  4DLG A;  3QES A;  3KLF A;  2KW4 A;  4C8N A;  5CZ2 A;  1NK0 A;  4KRE A;  1ASV A;  1WSH A;  4CEE A;  4CJL A;  4FM1 A;  4IG3 A;  3K5M A;  4B9U A;  4E0D A;  2KFZ A;  4GVM A;  4FJ9 A;  1BCO A;  2GUI A;  1VK0 A;  1KLN A;  3D0P A;  4CGD A;  2OZM A;  4KHU A;  4H4O A;  1JL2 A;  2YHA A;  4AHS A;  2X74 A;  3HPO A;  3TAB A;  1CXQ A;  1RDA A;  3MXM A;  5FRO A;  4Y1D A;  3OS2 A;  1ZBI A;  1JKH A;  4CK1 A;  1F21 A;  1NOZ A;  1UA1 A;  1NK4 A;  3V9U A;  3VQQ A;  3ZSY A;  2HHS A;  4BWJ A;  4FJ7 A;  2Z1I A;  4E7H A;  3RTV A;  2DFE A;  1RTD A;  4FZZ A;  3S3O A;  3S9H A;  4CJ5 A;  3QEW A;  3DRP A;  4CEQ A;  3OYN A;  3ASM A;  1WLJ A;  3KK1 A;  5C25 A;  4DFK A;  4OLA A;  4FZY A;  3PV8 A;  3NFA A;  2QXF A;  4JRQ A;  1WSI A;  4HCC A;  4Z4G A;  3HP9 A;  4EP5 A;  4CK3 A;  2OPS A;  5KRS A;  5CYQ A;  3O4Q A;  1N6Q A;  3E01 A;  1VSJ A;  4PUO A;  2D0C A;  4AIL C;  1L3V A;  4M3Z A;  4QOZ B;  4M42 A;  1LWF A;  1O1W A;  2FBY A;  1S9E A;  4DWI A;  4LY7 A;  1VSK A;  2VG6 A;  3OYI A;  3QEX A;  3TAE A;  2DFF A;  4CIG A;  3S3M A;  1RNH A;  2PZS A;  1FKP A;  5J1E A;  5K14 A;  2Z1J A;  3AVG A;  2G8K A;  3A2F A;  5FDL A;  4W5R A;  3HPG A;  2IDO A;  3D45 A;  3KLI A;  4CJS A;  3PO4 A;  2D5R A;  4CJK A;  1T7P A;  4CJQ A;  2ZQB A;  3HT3 A;  1GOC A;  1TAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...