4CK3A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck3A00
3U3GA 1RTHA 1SL1A 1JXEA 4BE0A 1HNVA 1L3UA 3MXJA 3I0RA 4CGDA 3ZSQA 3QEWA 3CFOA 3K57A 1U45A 1JLAA 4NYFA 4G1QA 2OYQA 1YTUA 4AH9A 3K2PA 3LAKA 3AVLA 3C95A 3LPUA 4CFCA 4CIGA 4CJKA 3EZ5A 1B9DA 1TAQA 3AVCA 3AVHA 3MEGA 1W0HA 4DU3A 4KPYA 2DFHA 4QOZB 1KVAA 3E01A 2JLEA 2GV9A 3SI6A 1IKYA 5CYQA 2XHBA 4F2SA 1CZ9A 4DSFA 3KLFA 3I8DA 5J2PA 1BL3A 1IH7A 1LW2A 2NUBA 2YKMA 1BI4B 3PV8A 4FJIA 4KRFA 1WSFA 4BE2A 2DY4A 1X9MA 4N5SA 3OYLA 1S1TA 4BDZA 2KZZA 1N6QA 1TAUA 3V9XA 1KCFA 1KTQA 3RMDA 4B9VA 3PO4A 3OS2A 4C8LA 2IGIA 3AVKA 1RTJA 4BDPA 2I5JA 4Z4EA 2XRIA 2PYJA 4FJGA 2RPIA 2VWKA 4FM1A 1ASWA 3AVBA 3VQPA 5DMRA 3IRXA 4DTUA 1SL0A 1NK6A 1J9AA 1RILA 4DQRA 4IFYA 1C1AA 1HJRA 1HQUA 3SV4A 2G8VA 3KK2A 1SV5A 4CHYA 1JLEA 1RT6A 2KQ2A 4CEQA 4CHQA 5J2NA 2IDOA 1VSLA 3VQQA 4CEAA 3HVRA 4IG0A 3AA5X 4DLEA 1LV5A 2P5OA 4DMNA 1ASUA 3P83D 5HRSA 4M3WA 3O3HA 4CEEA 3LALA 1YTAA 3IG1A 3U6FA 3ASMA 4FLZA 4LH5A 1HQEA 3TI0A 1ZBHA 2G8IA 4DFKA 4KHYA 3QEXA 4PWDA 3TABA 3EY1A 2WONA 3DLRA 2G8WA 3HO1A 3QINA 4QAGA 1BIZA 4E0DA 4Z4GA 4CK1A 2VG7A 1RDAA 3SUPA 4AHCA 4HVJA 3K5OA 2F8SA 1BCOA 1XI1A 2Z1JA 2ETJA 2GBZA 3K59A 3V9ZA 4CJEA 1VSIA 4CGJA 4C8MA 4OKEA 1UOCA 4Q5VA 3LZJA 1NKEA 2R7YA 1T05A 2AJQA 1ASVA 2X78A 4CEZA 1WSJA 4LD0A 2G8HA 1F21A 1JKHA 1NJZA 3OS1A 1NK7A 5HROA 1L3VA 1REVA 1TKTA 5J2MA 1S1UA 3KK3A 3NDKA 3HK2A 4K8XA 4O55A 3L2UA 4M3XA 4EZ9A 4DTRA 4NCBA 1WLJA 4B8AB 1Q9XA 3SPYA 1TKZA 1RT5A 3O4QA 4AHTA 2VWJA 3SUNA 4CF0A 4FLUA 4JRPA 1EETA 4GVMA 2KZMA 1BCMA 1Z26A 4UQGA 2YHAA 1B9FA 3OYFA 1BI4A 1WAJA 3ZSVA 2KTQA 1RT2A 4NYNA 3RTVA 1QE1A 4DU4A 4FYDA 3LANA 4DU1A 3RMBA 3KD5E 5FRNA 3WNGA 5HBMA 2Q3SA 1S5JA 1RTDA 3DLHA 4W5NA 3SUOA 4I2PA 2YNGA 3CM6A 2HB5A 1C6VA 2OZMA 3SQ0A 5T7BA 3OYIA 2XO7A 1QSLA 1KFSA 4DFPA 1X9WA 1CLQA 4FM0A 1WNSA 3KIOA 3OYMA 5FDLA 3KLEA 3FFIA 3WNHA 5I42A 4O4GA 1A5XA 3NF6A 1T8EA 3AO2A 2Y1IA 4DSIA 3DLEA 3CM5A 5E41A 4B08A 3MXIA 3L2VA 1S1VA 3DOKA 1HYSA 2RN2A 4XIUA 2QKBA 2HMIA 4KREA 2ZD1A 3L2QA 4FJXA 4BWJA 3JSMA 4B9NA 3ZT1A 2BE2A 1BGXT 4ZHRA 4H4OA 3ZT2A 4KB0A 4IG3A 4CJVA 4LY7A 4OKJA 4Y1CA 4CJWA 4E19A 4FLTA 3RMAA 1WAFA 5KRSA 4BDYA 3NF9A 4EP4A 4FJ9A 1BHLA 4KHUA 3VA0A 2IC3A 1LW0A 4CJ5A 3ULDA 2B5JA 1VRUA 4OLBA 3KLIA 4E7HA 4J2DA 1TL3A 3VQ5A 4MFBA 1S6PA 5SZTA 4JRQA 4B9SA 1EX4A 2ATQA 3CQ8A 3V9WA 4J2EA 3HPGA 3L8BA 1RDBA 4HHTA 4DTJA 4W5OA 4AHVA 1FXXA 1XWLA 2HNZA 1NK4A 3KLHA 3KKRA 4FK4A 1SL2A 4B9TA 2EX3A 4DQQA 1FK9A 2QXFA 4RW6A 1RBSA 4DQIA 4PY5A 4KKOA 4B8CA 4KI4A 1JXBA 1FKOA 3QO9A 3ZSRA 3UIQA 3T19A 2HHUA 3NAEA 4W5TA 1UA1A 1RT7A 3MECA 3NGZA 3VA3A 4KFBA 5CZ2A 3PY8A 4FLVA 2HHXA 1JLGA 2VG5A 2PY5A 4M3TA 1WSIA 4DS4A 5SWMA 1D5AA 3KLGA 5HRPA 1N5YA 4M3RA 3OYAA 4H4MA 1J5OA 3TAQA 4CJLA 1TKDA 1ZBFA 2QK9A 1BQNA 3VQ7A 4HTUA 4DSJA 4CHPA 4FW1A 4Y1DA 4Z0UA 1U49A 3AA4A 2HHVA 2HHWA 1VK0A 1FKPA 3WNFA 1QSSA 1SKRA 1WSHA 5J2QA 4EZ6A 2O4GA 1IKXA 3KTQA 3AV9A 3HL8A 1WSEA 3M8QA 3NFAA 1ZBLA 4CIEA 2FC0A 4I7FA 5EU7A 4FJHA 3LZIA 4DS5A 3SQ4A 1RT4A 3KKSA 4E7KA 3MXMA 4ELTA 4PQUA 1QS4A 3ZSWA 1JLFA 3OJSA 4AHRA 4CHNA 4FJLA 1YVUA 3DRPA 1IKVA 5C42A 2ITGA 1RT1A 4JS4A 4W5RA 2A1RA 3TARA 1J53A 3V81A 4DTXA 5I3UA 1R0AA 4Z4IA 4CF2A 4F8RA 4FZZA 4CF9A 4O44A 5CZ1A 1WN7A 3DRSA 3ZCMA 4O0IA 3VQEA 2P1JA 3SPZA 4CFBA 2Y1JA 4CJUA 2X74A 4DTMA 1S9GA 1U4BA 1U48A 4ELVA 4ICLA 5KGWA 2YNFA 3SQ2A 3RMCA 3S3OA 3O3FA 3S3MA 3P5JA 4CF1A 1G15A 2E6MA 4OVLA 4DG1A 3V9UA 3BGRA 3QIOA 4DTSA 1NK5A 5D3GA 3EYZA 4DQSA 3OYBA 1NOZA 4HCCA 4DTNA 2FBXA 3NH1A 3DOLA 4FXDA 2GUIA 3RRHA 1ZYQA 1UA0A 4KTZA 1RTIA 3V4IA 4CESA 3O4NA 5CYMA 3DRRA 1O1WA 4KI6A 4EP5A 1DTQA 3LP2A 5FROA 2B6AA 4DF8A 1KVBA 5KGXA 1RT3A 2PZSA 1J54A 4TSXA 3DLBA 4FLYA 1BIUA 3LP1A 5HRNA 1RNHA 4YNQA 3NBPA 1CZBA 3VQ8A 3JYTA 4AHUA 4CGGA 4E7LA 1GOCA 3LP0A 1SKSA 3HP9A 3OYGA 4DLGA 4C8KA 4WE1A 4M3YA 4BWMA 1EP4A 4LSNA 3OYKA 3LP3A 4M41A 3L2RA 2IOCA 4OGEA 3HM9A 3D0PA 4Z4CA 3AO1A 2D5RA 1JLQA 3AVGA 2D0AA 4FLWA 3KK1A 3S3NA 2E6LA 3AA3A 3DI6A 3I0SA 3QIPA 4E89A 3AO4A 1KVCA 4PUOA 4CEBA 4FW2A 3VQ4A 1JL2A 3NH2A 3M8RA 3OYNA 2YNIA 3OVNA 4DTOA 3PX0A 2DTUA 4DSKA 2P5GA 3SJJA 4RW7A 4CK3A 1GOBA 4CFAA 1TK0A 4DQPA 4FJ8A 1VSDA 3NGYA 1IO2A 1C1BA 1DLOA 2ZE2A 2IAJA 3M8PA 1TK8A 4M3ZA 4H8KA 1K6YA 4CHOA 4KHNA 1JL1A 4CGIA 1IG9A 2KFZA 2G8UA 3TAFA 3NGIA 4E1NA 4E3SA 3VQDA 4L8RB 3OYHA 1TKXA 2HHSA 1QTMA 3M8SA 4DF4A 1TK5A 4MQ3A 2FBTA 4C8OA 4DSLA 2FBYA 3A2FA 4FJ7A 1QQCA 5KTQA 1L5UA 3NF7A 3AO3A 3OYEA 4ZTJA 3TAMA 4CJQA 3LWMA 3ZT3A 3HPOA 1RCHA 5J1EA 4CEOA 4M45A 3L3VA 3DLKA 3U3YA 3QEVA 1A5VA 3DM2A 4B9LA 5JS1A 3SNNA 1X9SA 3HPHA 3HVTA 5HLFA 1LAVA 2QKKA 2B4JA 4OJRA 4FM2A 2F96A 1CXQA 3OJUA 4B9MA 3AVJA 1Z25A 2OPQA 3IS9A 1YT3A 2BANA 4RW4A 4HUFA 4J2AA 4DSEA 3SUQA 1NKBA 2RKIA 2DFFA 3B6OA 2LSNA 3RRGA 3HT3A 1XC9A 4KTWA 1NJXA 3IAYA 1UAXA 3AVIA 4N56A 4JS5A 3V1OA 1T03A 3O3GA 4CECA 1HYVA 1X1PA 3RR8A 3QEIA 4JLHA 1HRHA 3ZSYA 5KRTA 4M42A 4KHSA 3OYCA 5CY4A 5K14A 4N47A 4CFDA 2OPSA 3VQ6A 1LWFA 1C1CA 1GOAA 1CXUA 4AHSA 1JLCA 3NCIA 3TWHA 1C0TA 1HYZA 1MU2A 2OA8A 4KTQA 4FVMA 4RW9A 4E7IA 2O4IA 2EHGA 4ID5A 1XHZA 1LWEA 2XY8A 3NH0A 4KO0A 3ZSOA 3TANA 1NOYA 2OPPA 2XY7A 5JS2A 3QERA 3AVFA 1KLNA 4FJMA 4DFJA 1SUQA 2Z1IA 4BACA 2W42A 4I2QA 1XHXA 4GMJB 4PA1A 3HXMA 4K8ZA 1VSKA 1BQMA 4Z4FA 1RBRA 1HNIA 4NCGA 3RWUA 4ELUA 4F4KA 2OPRA 4GW6A 4CJRA 4FJNA 2HHQA 1QSYA 3CFPA 1T7PA 3ZT0A 3MEEA 3F73A 3T1AA 1LWCA 4CGFA 4AILC 4CGHA 1JLBA 3VQAA 5C25A 1HMVA 1D9FA 4KAZA 3QESA 3AVNA 3RR7A 1ZBIA 3DMJA 3TAPA 4KV8A 2A1SA 1RBTA 3V1QA 4CJ3A 3OY9A 3KJVA 3LWLA 3K58A 3SV3A 2D0CA 2P51A 2Z1GA 3SYZA 3V6DA 4CE9A 1D9DA 3V9SA 4FJ5A 4IKFA 2BGGA 4BE1A 3SQ1A 2XY5A 2YHBA 3PO5A 2VG6A 3VQBA 5KI6A 4OKKA 4HCBA 3B6PA 1C0UA 4IBNA 1TL1A 4FZXC 4KHQA 3MAQA 4FJKA 4FZYA 3TAEA 4CJPA 4DFMA 1B92A 3DYAA 1TV6A 4YFUA 2YV0X 2D0BA 2YKNA 3QETA 3THVA 1KLMA 3VQ9A 4CEDA 3HP6A 3L2WA 4LH4A 2KW4A 1KSPA 1KFDA 3AO5A 3PX6A 2HW3A 1BISA 1Q8IA 3ALYA 3AVMA 3G10A 1NKCA 4CHZA 2WOMA 1S1XA 5C24A 3BDPA 5DK5A 1HPZA 4M3UA 1TGOA 1UWBA 3VN5A 1U04A 2G8FA 4DWIA 4N41A 2HVIA 4KB1A 2JGUA 1VSEA 4CJ4A 3NE6A 3P1GA 4J2BA 4CJTA 2Z1HA 3HYFA 4FJJA 3MEDA 5FRMA 4FK2A 3ZSZA 2HHTA 2RF2A 4CIFA 4E1MA 3WNEA 4ZTFA 3OYJA 2XY6A 1S6QA 3DLGA 4F3TA 4QCLA 3LPTA 3D45A 4I9LA 3VQCA 4CJFA 3NHGA 3PX4A 2IS3A 3C94A 3HSTB 3AA2A 3NF8A 5HP1A 1EKEA 2HNYA 4FK0A 4HUGA 3PUFA 3QEPA 3AVAA 1NJWA 1I39A 1IKWA 3L3UA 3V1RA 4CERA 4O5BA 4Z4HA 3QNOA 3TR8A 3ISNC 1SKWA 1L3TA 1C0MA 2KFNA 3K5MA 4OPJA 4OPKA 1U47A 3LDSA 4E7JA 4W5QA 2F8TA 4FLXA 4R5PA 2PYLA 4HUEA 3TAGA 3SZ2A 1VSMA 2OZSA 3SCXA 2YNHA 1NJYA 1RDDA 1S9EA 3F9KA 2E4LA 1Q9YA 3C6UA 3ITHA 4CCHA 4F3OA 3G0ZA 1NK9A 3T3FA 1RBVA 4RW8A 3CFRA 1RDCA 4IDKA 4B3OA 4B9UA 1A5WA 2HNDA 2HVHA 1QHTA 1VSFA 1LAWA 1NK8A 4F2RA 4I9QA 4OGCA 1L3SA 1DTTA 3CG7A 4DTPA 3K5LA 4RG8A 3C6TA 4C8NA 3KD1E 4CF8A 1ZBUA 1VSJA 1W9HA 3QLHA 1Y97A 4CK2A 1TVRA 3H08A 1I3AA 4CJSA 4CEFA 1S1WA 2FBVA 2DFEA 2X6NA 4LSLA 4FCYA 1D8YA 5HRRA 4NCAA 1EXQA 4IFVA 1KRPA 2X6SA 1RBUA 4N76A 3QNNA 1ITGA 1VRTA 1VSHA 3S9HA 4Q0BA 3OS0A 1NK0A 3K5NA 3LAMA 3ZT4A 3HJFA 4OLAA 4O0JA 2BDPA 4KHWA 2G8KA 2ZQBA 4ID1A 1WSGA 3ZSXA 3CYMA 3OYDA
chains in the Genus database with same CATH superfamily
3R8EA 1RTHA 1LOTB 3VF6A 3MXJA 4BC4A 3I0RA 3BUZB 5B8HA 3CCVN 3K57A 1JLAA 4BRIA 4AH9A 3LAKA 2FSNA 3C95A 4BQZA 4CIGA 4DKWA 3NMUA 1TAQA 3AVCA 1HLUA 2JLEA 5CYQA 4WQ4C 3KLFA 1LW2A 3SMPA 1N32K 1WSFA 1YAGA 4BE2A 1NLVA 3MX5A 4BDZA 1N6QA 1KCFA 3RSEB 2IGIA 4PL8A 4FJGA 2O8DB 1HKCA 3VQPA 4QS7A 1YUWA 4JV5K 4IFYA 3CJ1A 2G8VA 3KK2A 1P90A 3ATUA 1BO5O 2GWKA 3HI0A 5AQPA 3P83D 5HRSA 3CQYA 2V7ZA 1YTAA 3HM8A 1QZ6A 1U2VA 4PWDA 2G8IA 1ATNA 1ZBHA 4DFKA 3QEXA 4DR4K 3TABA 3DLRA 1BIZA 3KVGA 3VENA 4E0DA 4DQ8A 4CK1A 1YF5L 4IFEA 4EAHD 3CCLN 2Z1JA 2W40A 2AP1A 3V9ZA 1M1KO 4OKEA 5GAHP 1W97L 1YJWN 1T05A 1XMQK 2X78A 2YCHA 3CJ9A 3FZMA 3CMAN 2ZJQL 2A5XA 3DXKB 4IJAA 4XEIA 3L2UA 1VQMN 2P9PB 2NRTA 4QS9A 1YXQA 4H0YB 3SAFA 3SPYA 1Q9XA 4DR6K 2HOEA 1BCMA 3GG4A 4UQGA 2YHAA 1B9FA 3OYFA 1WAJA 2JWKA 4BRNA 1QE1A 3PSFA 3G6EN 3THXB 1NGGA 2E1YA 1VHXA 2QI2A 3L4QA 5HBMA 4EFHA 1GLLO 1S5JA 3SUOA 4ISGA 2OZMA 3SQ0A 1BOTO 1QSLA 2XO7A 4DFPA 5BR9A 3FFIA 4DV0K 1T8EA 1X3MA 2Q1NA 3AO2A 4O5FA 3DLEA 3L2VA 3WEEB 4XIUA 2HMIA 1NG9A 2ZD1A 3L2QA 3JSMA 3J8AA 4H0VB 4CJVA 4E19A 4Y1CA 4FLTA 3RMAA 1BU6O 1WAFA 3TU5A 4FWKA 4FJ9A 1BHLA 2NZTA 1LW0A 4CJ5A 3ULDA 4OLBA 2HSTA 3ENOA 4MFBA 1S6PA 4JRQA 3WUHA 4YHHK 4AHVA 1FXXA 1XWLA 5LY3A 3KKRA 2OTJN 4DQQA 1XNQK 1NGBA 4PY5A 3GDQA 3AGKA 1C0GA 3H3NO 3T19A 1DEJA 4BGBA 4W5TA 3CD6N 2A40A 3VA3A 4KFBA 5CZ2A 4FLVA 3VGMA 3FZKA 1HR0K 2O8CB 3OW2M 5KPTA 4WQ4A 4BR9A 1J6ZA 1HNXK 1TKDA 3VQ7A 4DSJA 4FW1A 5CE3A 3SJHA 5FPDA 4MDAA 5EXWA 5GIOA 1QSSA 4EZ6A 2PAVA 3THWB 5EU7A 3VETA 5AZJB 1RT4A 3EKSA 3KKSA 4E7KA 3MXMA 1QS4A 4H5VA 4CHNA 3NVMA 4NLBA 4JK8A 4J8FA 4W5RA 4LF8K 3CJAA 3O9SA 4M63C 3P38A 5AQIA 4DTXA 4I6MA 1SAZA 4F8RA 4FZZA 5CZ1A 5JVHL 4CFBA 3UKRA 1U4BA 1U48A 3R3LA 4GV9A 4DG1A 1WOQA 4HCCA 1NOZA 4FXDA 1ZYQA 1IV0A 5KQDA 3DRRA 4WFNL 4KI6A 1Q7YO 3LM9A 1J54A 4CVNE 3LP1A 3NBPA 3JYTA 4CGGA 1SKSA 4DLGA 4GNIA 4M3YA 4FOEA 2P9KB 3A5LC 2IVOA 4DR5K 1O13A 4G9ZA 3L2RA 1DT9A 4OGEA 3D0PA 3AA3A 3I0SA 1TYQB 3QICA 1KVCA 4PHTX 4DTOA 3M8RA 1JL2A 5I9EB 4RW7A 5JMVA 4ISFA 1GOBA 5FLXO 3D2EA 1IO2A 1C1BA 2QW9A 4JKFA 2QEXN 4A2BA 4M3ZA 2P9NA 3C7NB 1IBKK 3ZLJA 3TAFA 1JCFA 4E1NA 3OYHA 2HHSA 4DF4A 3T1HK 4DSLA 1QQCA 3VERA 4JKGA 2UUCK 3LWMA 3B8AX 5BRDA 5AQTA 2QM1A 4M45A 3L3VA 3DLKA 5BN8A 1A5VA 3DM2A 3ULEA 1NGFA 4X66K 4BC3A 3HPHA 3HVTA 4BVPA 2B4JA 1CXQA 3OJUA 4B9MA 3BF3A 1Z25A 3IS9A 4RW4A 4HUFA 4J2AA 2VCPA 1XUPO 2RKIA 2P9UA 4JD2B 1Z05A 2LSNA 1UAXA 4PKHA 4N56A 4JS5A 3V1OA 1Q18A 1MDUB 3QEIA 3ZSYA 2ZF5O 4N47A 3AAQA 5E26A 2P9LB 3M6GA 1JLCA 3JAMO 2OA8A 2FF3B 5CHIA 3TANA 2UXCK 4YY3K 2OPPA 4GY2B 2XY7A 5JS2A 3QERA 2YX6A 2Q0RA 1IBMK 4NB4A 4DFJA 4C1NK 2Z1IA 4GMJB 3BZCA 4BRKA 4OPHA 4ELUA 1V4SA 4F4KA 4GW6A 5EVZA 3MEEA 4CGFA 1TUUA 3VQAA 1HMVA 2HBJA 3OBYA 1ZBIA 4KV8A 3KJVA 3V1QA 4CJ3A 3V6DA 2D0CA 2Z1GA 4Z94A 4FJ5A 2XY5A 2YHBA 3VQBA 5KI6A 1YI2N 1C0UA 2O8BB 3TAEA 4CJPA 4DFMA 4YFUA 2YV0X 3P31A 2ITMA 3THVA 2V51B 1KLMA 3VQ9A 4CEDA 2UXDK 1QHAA 1K73O 1OH5A 1KSPA 1KFDA 3TTDA 2HHHK 2HW3A 1Q8IA 3E9LA 4IOAL 1T6DA 2WOMA 3BDPA 4BY9C 3MK6A 1BDGA 4DWIA 4FVUA 3CXCM 4CJ4A 4IO8A 3P1GA 1KAXA 3OBWA 3HYFA 3MEDA 5BREA 3L6QA 2HHTA 2NRXA 3FGUA 3ID6A 2RF2A 4BRFA 3WNEA 3OYJA 4B9QA 1S6QA 4FPBA 3VQCA 3PX4A 2O8FB 3C94A 3UE5A 4BQLA 1EKEA 2HNYA 4B1XB 3ZETA 1Q82O 1NJWA 1IKWA 4JKHA 4CD1A 1OH7A 4Z4HA 2CGJA 4OPAA 1C0MA 3D6RA 4E7JA 4W5QA 1YITN 4R5PA 4HUEA 2CGKA 2YJFA 2YNHA 1NJYA 1RDDA 2V7YA 1Q9YA 4F3OA 3ITHA 3G0ZA 1NBWA 3A8YA 4RW8A 1KAYA 3CIPA 2ASMA 1A5WA 4RCHA 1Y64A 1NU0A 3H6EA 4CZIA 4OO1J 1QHTA 5KQ8A 1DTTA 3BEXA 2Q31A 2IVPA 3KD1E 5H1SQ 3DXMA 1W9HA 3QLHA 4CBXA 1HX1A 1U6ZA 4LFAK 1TVRA 2X6NA 3W3DA 2UUBK 4N76A 3QNNA 1VAZA 1ITGA 3S9HA 3LDOA 3DWLA 4KH6A 4BRQA 4B3MK 4O0JA 2BDPA 3ZSXA 3HZ6A 1EQYA 1L3UA 3BP8A 4CGDA 3CFOA 1U45A 2OYQA 4BROA 1YTUA 3K2PA 3LPUA 4ILJA 4A5BA 4CFCA 4KPYA 1B9DA 5M1QA 1K8KA 2GV9A 2P9IB 3CETA 2E2QA 2XHBA 4F2SA 4DSFA 1BL3A 1IH7A 5CR4A 2NUBA 3PV8A 2F4VK 2YHWA 4B9VA 3VTIA 4JHDB 4BDPA 4CZLA 2XRIA 4LFCK 5DMRA 3IRXA 1RILA 4DQRA 1HJRA 3SV4A 1SV5A 1JLEA 1RT6A 3VQQA 3HVRA 4CEAA 4DLEA 2I7NA 4IG0A 4BC2A 2BUPA 2NLXA 4CEEA 4E1JA 3CPEA 1YIJN 4LH5A 1HQEA 4KHYA 3WT0A 3H3OB 2WONA 2G8WA 2VG7A 1RDAA 3WQUA 2GBZA 3N4PA 4CJEA 3IDHA 1XMOK 1VSIA 4C8MA 4Q5VA 2QWOA 5GAEP 5F1XA 3LZJA 1NKEA 4H0PA 3OHRA 2AJQA 4CEZA 1WSJA 1JKHA 4BR5A 1JCEA 3OS1A 2W6KA 3KZBA 5HROA 3KK7A 1REVA 1TKTA 5J2MA 3F9MA 3KK3A 4O55A 4M3XA 4BRCA 3ENHA 4NXMK 4DTRA 1WLJA 1I94K 1RT5A 4DV3K 2HF3A 3SUNA 3UB5A 1BI4A 2KTQA 2QWRA 4X64K 3RTVA 4FYDA 4DU4A 3D2FB 5AQSA 4WFBL 1XC3A 3KD5E 5FRNA 2Q3SA 4BRAA 4FO0A 1NGIA 4I2PA 2YNGA 4JK7A 1VQ7N 1KFSA 3OYIA 4UY8O 4H5TA 4B3SK 5LMUK 1EWRA 2Y1IA 2YI1A 3C6HA 4GV6A 4JI0K 3O9QA 1Q81O 1BA0A 2CH5A 5TKYA 3BZKA 1NJIO 3ZT1A 4B9NA 1OKJA 2BE2A 1BGXT 4H4OA 4IG3A 1MA9B 3O1BA 4WQ5C 3EKUA 4BDYA 1VQ5N 3NF9A 4EP4A 2F7TA 2B5JA 4DHYA 4E7HA 5AQWA 3F2KA 5SZTA 1EX4A 3CQ8A 4CW7B 3U9ZA 3V9WA 4J2EA 3HPGA 3L8BA 1RDBA 4DTJA 2HNZA 3VEWA 4FK4A 4FWOA 1SL2A 4RW6A 1HNWK 1FKOA 3QO9A 3ZSRA 2D0PA 5JICA 2HHUA 3NAEA 3J7YP 1RT7A 5ADXA 3NGZA 3PY8A 4GVEA 2VG5A 3KLGA 5HRPA 1J5OA 3TAQA 4CJLA 3C0BA 4HTUA 4QS8A 4Y1DA 3AA4A 3CJ7A 2PBDA 1FKPA 2BTFA 1E4FT 1IKXA 1ZBLA 3DJCA 3E66A 3VGKA 4B1ZA 3O9UA 4JKDA 4CZKA 4PQUA 3OJSA 4M7XA 4AHRA 4FJLA 1YVUA 5C42A 2ITGA 3VEOA 4JS4A 3EEQA 3O6WA 4DV5K 5I3UA 1R0AA 4H0XB 2GEMA 2RHKA 4CF2A 4GKKK 4O44A 3DRSA 4O0IA 2P1JA 3SPZA 1QVGM 3O5BA 3NVKA 1FJGK 3RMCA 1X3NA 4FPAA 3S3OA 3O9RA 3QDKA 4CF1A 3BY5A 4OVLA 3QIOA 4DTSA 3EYZA 4B1UB 3TSPA 2GUIA 3RRHA 4KTZA 5KPZA 3V4IA 1T44A 5CYMA 4FWSA 3LP2A 4DF8A 1RT3A 5DM7L 4TSXA 3DLBA 5FPEA 1BIUA 4YNQA 3ZEUA 4PL7A 1CZBA 4E7LA 3LP0A 5FPMA 3L0QA 4PKGA 2VYPA 4M41A 3OYKA 2IOCA 5F2RA 3SAHA 4YOYA 3OTOK 2RE2A 1VQ8N 1KAZA 4WYBA 4PUOA 3OYNA 2YNIA 3OVNA 4DSKA 2P5GA 1YHQN 3A0IX 4CK3A 4CFAA 4DQPA 1VSDA 3E9OA 3M8PA 1DLOA 2IAJA 1HPMA 4CHOA 1NMDA 3O4WA 3CJBA 3NGIA 3VQDA 1TKXA 1QTMA 4C8OA 1TK5A 2FBTA 5KTQA 3AO3A 2VGNA 4O8KA 5C15A 3TAMA 3P39A 3HPOA 4CEOA 3CC4N 3QEVA 4B9LA 2YHXA 3CMEN 2NRHA 2E5LK 1W2BM 2NRVA 3B6OA 1XC9A 4KTWA 1NJXA 2KZZA 1NGEA 5AFUA 3O3GA 3BF1A 4CECA 5CY4A 5AQJA 5EX5A 1GOAA 4FWQA 1C0TA 3N4QA 4A5AA 3HOTA 1XHZA 3K0SA 1LWEA 1NOYA 1C0FA 4KO0A 2CH6A 3THYA 2W42A 1XHXA 5A2QO 4PA1A 2V52B 4K8ZA 3MX2A 1BQMA 2WFBA 4BR4A 3M3ZA 2QWNA 3O80A 4Z4FA 3U4LA 1N33K 2OPRA 4CJRA 2HHQA 5AQKA 1T7PA 3UKUB 3HBTA 1LWCA 4O8UA 5C25A 4KAZA 5M1OA 1GLFO 1NGDA 1RBTA 3K58A 1NKCA 2P51A 2O8EA 2VG6A 4IWVA 4HCBA 4NLCA 3I8BA 3Q7BA 3DYAA 2UU9K 1NGCA 3QETA 4MLEA 4IEIA 1WB9A 3FZFA 4YOWA 5HL7L 5AZIB 4JKBA 5AQUA 4F9OA 4CHZA 4NXNK 5BPLA 1TGOA 5JLHA 1UWBA 1S22A 1U04A 2G8FA 4N41A 4KB1A 1RDWX 2JGUA 3GBTA 4C1NI 4EHUA 3NE6A 1DKGD 4J2BA 4CJTA 2Z1HA 4FJJA 4CZEA 2E2NA 4WF9L 1BG3A 3I55N 1QZ5A 4ZTFA 1GLAG 3DLGA 3LM2A 2OTLN 1CZAN 3D7EO 4I9LA 4ILHA 3NHGA 3HSTB 3AA2A 4BRHA 4EIAA 3AVAA 4ISEA 3L3UA 4CERA 2QA4N 1SKWA 4CZHA 1L3TA 2NRWA 3VF2A 1MWMA 4OPJA 1U47A 3TAGA 4Y0WA 2NRRA 1QQMA 5AJ3K 4FSVA 2E4LA 4M7YA 4H03B 4AF1A 3VTHA 4K41A 4BC5A 5AQQA 1VSFA 1L3SA 4DTPA 1U2VB 4C8NA 2CGLA 3LL3A 1ZBUA 4H0TB 5AQFA 4YOXA 5BRHA 4CK2A 4CJSA 2E20A 4FCYA 4NCAA 4IFVA 1VQKN 4BRDA 1VSHA 3OS0A 1NK0A 3HJFA 5JLFA 4IXCA 1WSGA 1OVQA 4LF6K 5AR0A 3GE1A 1NK8A 3CI5A 3PLAA 4BE0A 2GUPA 3ZSQA 4B3RK 4BR0A 4NYFA 1T6CA 4G1QA 2ZJRL 1KQSM 4CJKA 4BG8A 2DTUA 4IDHA 3MEGA 2DFHA 3E01A 3SI6A 4DB3A 4KRFA 1X9MA 3OYLA 1TAUA 3V9XA 3RMDA 1KTQA 3PO4A 4C8LA 4JK9A 3F5TA 1RTJA 3AVKA 2I5JA 5GINA 2VQFK 5DM6L 4DTUA 2VWKA 4FJIA 2DY4A 3AVBA 1NK6A 4KHPK 2P9SA 1J9AA 1C1AA 4CHYA 4JI8K 4CEQA 4CHQA 5J2NA 3MMVA 2IDOA 1SQKA 3AA5X 4JI3K 2P5OA 1ASUA 3LALA 3IG1A 2J4RA 3K9KA 3U6FA 1Q86O 3TI0A 4IO9L 4BREA 3MWTA 5M1KA 4MO4A 1QVFM 3EY1A 3CHWA 3QINA 4Z4GA 4U67L 2F8SA 3SUPA 3K59A 1N8RO 1BA1A 3CCEN 3CCUN 3J7AP 1YJNN 4FL9A 3MCAB 1ASVA 4LFBK 3G25A 1F21A 4FWMA 1NK7A 2A41A 1OVYA 4BRMA 3KWGA 3NDKA 3HK2A 1KXPA 4EZ9A 1HKBA 4NCBA 4B8AB 1TKZA 3O4QA 1ZBSA 4JRPA 2VWBA 4GVMA 5AQMA 1G99A 4IOXA 3ZSVA 4NYNA 4DU1A 5IWAK 3RSEA 3WNGA 1RTDA 1VQ9N 2HMPA 2O8DA 2HB5A 4FM0A 1WNSA 3KIOA 5FDLA 3KLEA 5I42A 4O4GA 4CZJA 3NF6A 1VQ4N 4DSIA 2KKZA 3CM5A 5E41A 1VQLN 4JEPA 4B08A 3MXIA 1HYSA 2RN2A 2Q97A 4KREA 4I6MB 4FJXA 1MWKA 4LC9B 4H5RA 1RDUA 5C2DA 3PIOL 4KB0A 3GOIA 1N34K 3ENBA 4LY7A 3WQTA 5KRSA 4A61A 1ZC6A 4KHUA 2IC3A 2FXUA 3KLIA 2QWPA 1TL3A 3VQ5A 3C6AA 1WBBA 2ATQA 4CBUA 1YJ9N 4HHTA 3WXMB 3KLHA 2VQEK 4B9TA 2ZGYA 1FK9A 2QXFA 3DXKA 3HTVA 4KKOA 4KI4A 1XQSC 1JJ2M 1NGJA 2A42A 2P9PA 3UIQA 1GLEG 1UA1A 3PIPL 2HHXA 2QWLA 4M3TA 3ID8A 2OANA 4DS4A 5SWMA 3PSIA 4M3RA 4K43A 4WCEL 3MN6A 1HNZK 1ZBFA 2QK9A 3THXA 2KLAA 4Z0UA 1U49A 2HHVA 3EO3A 3WNFA 1SKRA 1WSHA 5J2QA 3D2EB 3C65A 1WSEA 3HL8A 3M8QA 3NFAA 3QMLA 3WXJA 4I7FA 4CIEA 3LZIA 4BR2A 5AQRA 4DUZK 4HTLA 4DS5A 2P9NB 4LF4K 3ZSWA 1ATRA 3DRPA 1IKVA 3WEEA 4JKGB 3QBXA 3V81A 3S41A 4CF9A 1K9MO 3ZCMA 1WN7A 2H3GX 3VQEA 3VOVA 3IKMA 3ULEB 4CJUA 2X74A 1S9GA 4ICLA 2YNFA 3KWIA 3T69A 3P5JA 1NJZA 5BPMA 3V9UA 1NK5A 3OYBA 4DTNA 3NH1A 2P9UB 5EY4A 4CESA 2Q36A 3R9PA 1O1WA 1DTQA 5FROA 4A59A 4X62K 3AY9A 4A62A 3HRGA 2PZSA 4FLYA 5BN9A 4AHUA 1GOCA 4XH1A 4CI6A 3HP9A 3OYGA 4C8KA 4WE1A 4LF7K 3QFPA 4LSNA 2O8CA 3L4IA 1JLQA 3S3NA 2WBNA 3DI6A 3QIPA 3HSCA 1HJOA 5E84A 4CEBA 3NH2A 3PX0A 4BRGA 2FLOA 3O08A 3I33A 1GLCG 5KPRA 1TK0A 4FJ8A 3THWA 3NGYA 3G4SN 1GLJO 1GLDG 4B3TK 1TK8A 4H8KA 3RVCA 3UKUA 4FOIA 4CGIA 2FSJA 2KFZA 2G8UA 5AZJA 5F0XA 3M8SA 4MQ3A 3A2FA 2QWMA 4YORA 1L5UA 3NF7A 3ZT3A 5JVGL 1RCHA 1YVNA 3U3YA 4DCHA 3R1XA 3MDQA 5JS1A 3SNNA 1X9SA 1GLBG 1LAVA 2HBMA 4DV2K 4FM2A 3AGRA 3AVJA 2BANA 4DSEA 2NRZA 2DFFA 2Q0UA 3RRGA 3HT3A 3IAYA 3AVIA 1BWFO 1RFQA 1T03A 1X1PA 4JLHA 1HRHA 5KRTA 4KHSA 2WTUA 5K14A 1NGAA 2OPSA 1S72N 1LWFA 1C1CA 4CZMA 3LDPA 1E4GT 1CXUA 4AHSA 4KTQA 3NCIA 3CCMN 1HYZA 2E8AA 4E7IA 2O4IA 2EHGA 2P9KA 2GELA 3EZWA 3ZSOA 1VQ6N 3QFUA 3AVFA 4FJMA 1SUQA 3MN9A 4BACA 3HXMA 1TYQA 4H5WA 4JI5K 3ZETB 4V19S 3RWUA 1S3XA 4FJNA 1QSYA 3ZT0A 3K9JA 1H1VA 3T1AA 1RGIA 1JLBA 3WXKA 1D9FA 3QESA 1NNEA 3C7NA 4FWPA 3TAPA 4A57A 2A1SA 3OY9A 3Q7CA 3LWLA 3CCQN 3J81O 5ADXH 4IKFA 2BGGA 1D9DA 1LCUA 4BE1A 2JWLA 4OKKA 3B6PA 4BRPA 4FZXC 4KHQA 4FZYA 1B92A 1TV6A 3LDQA 2QTDA 3A5NC 4BG9A 3TTFA 3W0LA 3L2WA 4LH4A 3DXMB 5TKWA 1BISA 3ALYA 1DGKN 3G10A 1VQNN 3FFKB 3SBTA 1S1XA 1HPZA 4JD2A 2ZJPL 4M3UA 3VN5A 2YHYA 5LJVA 3M1FA 3I56N 5C10A 2HF4A 5FRMA 4FK2A 3ZSZA 2P9LA 1Z6RA 5AQOA 1J5EK 2F9TA 5BR8K 3D45A 4CJFA 4DV1K 2IS3A 2UYTA 3NF8A 1K8KB 5HP1A 4HUGA 3QEPA 3DAWA 3H1QA 1I39A 1JCGA 2FF6A 4O5BA 3ISNC 3CCJN 2PFUA 3QBWA 3VEZA 3K5MA 4FLXA 4DV4K 3SZ2A 1WBDA 3VMFB 1S9EA 3H45C 4K25A 5C12A 5GADP 4PKIA 3T3FA 5ELZA 5AQZA 4IDKA 4B9UA 5AQGA 2GX9A 2HVHA 2O8BA 2GTDA 1LAWA 4I9QA 4F2RA 4XH4A 3U8XA 1NM1A 4CF8A 5BRFA 4WQ5A 1VSJA 3CCSN 4JKCA 3H08A 1I3AA 4CEFA 1S1WA 3SK3A 4IEEA 2DFEA 4LSLA 3VESA 1D8YA 1EXQA 1KRPA 3QB0A 3CCRN 4DUYK 1VRTA 4ILGB 3ZT4A 4OLAA 4KHWA 5LMNK 2G8KA 4ID1A 3H1VX 3CYMA 4CZFA 3OYDA 3U3GA 1SL1A 1JXEA 1HNVA 1D4XA 3ZX0A 3QEWA 2WUSA 4CBWA 3TTCA 1XNRK 3AVLA 1ESVA 3EE8A 3EZ5A 2O8FA 3AVHA 4DU3A 1W0HA 4QOZB 1KVAA 1HKGA 1IKYA 1EWQA 4DR3K 1CZ9A 5J2PA 3I8DA 1FW6A 4MLHA 1OH6A 5M1PA 2YKMA 5AFUH 1BI4B 4CD3A 1ILYA 5M1FA 4N5SA 1S1TA 3CQXA 5AQXA 3OS2A 4JI2K 4OX9K 4Z4EA 2PYJA 2RPIA 4FM1A 1ASWA 4LF9K 1SL0A 4CZGA 1HQUA 2KQ2A 1VSLA 3T1YK 1LV5A 2ZM6K 3TPQA 4DMNA 4M3WA 3O3HA 4KBOA 3ASMA 4FLZA 3CC7N 3EE9A 3P4IA 1IG8A 4FWLA 5LJWA 3CC2N 3HO1A 3AARA 2GWJA 4QAGA 3FZHA 4AHCA 4HVJA 3K5OA 1BCOA 1XI1A 2ETJA 4DV7K 2IIRA 3FR0A 2Q2RA 4CGJA 1UOCA 2R7YA 4YOUA 5EOYA 4LD0A 2G8HA 5LL6Z 3U9DA 3O8MA 1L3VA 1S1UA 3SAGA 4K8XA 2QWQA 4YDUC 2I7PA 2P9IA 4AHTA 2VWJA 4CF0A 4FLUA 3LDNA 1EETA 2KZMA 3SBGA 1Z26A 4EHTA 1RT2A 2HBLA 4RWTA 3A5MC 3LANA 4JI6K 3RMBA 3EN9A 4JHDA 4W5NA 3ZYYX 2HBKA 3E1YA 3CM6A 4DV6K 1C6VA 5T7BA 1X9WA 3T7ZA 3OYMA 3WNHA 1A5XA 4K42A 1TUYA 5AQVA 3GL1A 4WFAL 1S1VA 3DOKA 4YOTA 2QKBA 1K8AO 4BWJA 3IMXA 4BR7A 3SMSA 4IJNA 3HOSA 1QQNA 4ZHRA 3ZT2A 4KH4A 4OKJA 4CJWA 1WUAA 3VA0A 5MLCQ 1SS6A 1KC8O 1VRUA 4J2DA 4B9SA 3JXUA 2UXBK 1NK4A 2WC9A 4W5OA 2KHOA 2EX3A 1RBSA 4CJ7A 4DQIA 3ZEUB 4B8CA 1JXBA 3FE1A 4C23A 3MECA 4X65K 1JLGA 2E88A 2PY5A 1WSIA 1P8ZA 4BGAA 2D4WA 4JKAA 1D5AA 5GIPA 1N5YA 3OYAA 4H4MA 3D2FA 3VEXA 1BQNA 4CHPA 3ZX3A 1VK0A 4GKJK 3KHYA 2O4GA 3KTQA 3AV9A 4FJHA 2FC0A 3SQ4A 3A5OC 1KD1O 4ELTA 2E2OA 1JLFA 4YOVA 1BUPA 1RT1A 2A1RA 4L3QA 3TARA 1J53A 3FZLA 1ATSA 4Z4IA 2Y1JA 4DTMA 4ELVA 5KGWA 3SQ2A 3S3MA 3O3FA 3CPWM 4Q0BA 1G15A 2E6MA 3O1WA 5D3GA 3BGRA 3CERA 3H46O 3TSQA 4DQSA 2FBXA 3DOLA 5M1NA 1UA0A 1NWKA 1RTIA 3O4NA 1IJJA 4MDBA 3MWPA 5AQHA 4EP5A 4JI7K 4JI1K 2B6AA 1KVBA 5KGXA 4B1WB 5HRNA 1RNHA 3VQ8A 3G71N 4JN4A 2IVNA 3THYB 4BWMA 1EP4A 4YDUA 3VEYA 3LP3A 3HM9A 2OCEA 4Z4CA 3AO1A 4JYAK 2D5RA 2D0OA 3AVGA 2D0AA 4FLWA 3KK1A 2E6LA 4NO7A 4E89A 3AO4A 4FW2A 3VQ4A 3SLCA 1W7AA 3SJJA 1QQOA 4AM7A 1V4TA 2ZE2A 3CJCA 1K6YA 4KHNA 4H5NA 1JL1A 2ZWHA 1IG9A 4MO5A 4E3SA 4L8RB 1X9JA 5AQYA 4B1VA 2FBYA 4FJ7A 1E3MA 4AM6A 2O8EB 5FPNA 3OYEA 4AQYK 4ZTJA 4HWIA 2W6LA 4CJQA 2A3ZA 5J1EA 1VQPN 3UKRB 2QXLA 3WXLA 3AAPA 5AQNA 5HLFA 2QKKA 4OJRA 4RTFD 2F96A 4JNEA 2OPQA 3M5RA 1YT3A 3O9TA 2A6AA 2EWSA 4U7BA 2D1KA 2E2PA 3SUQA 1NKBA 5C2FA 1IBLK 1N36K 3RR8A 3VEVA 1HYVA 4M42A 3OYCA 4CFDA 5HOOA 3VQ6A 2VGMA 3TWHA 1MU2A 4FVMA 4RW9A 4ID5A 2NNWA 4K0KK 2XY8A 3NH0A 5C0YA 5AQLA 1KLNA 4GV3A 4I2QA 1VQON 1VSKA 1RBRA 4DR1K 1HNIA 4NCGA 4JI4K 2FSKA 3CFPA 3F73A 3J7ZO 4AILC 4CGHA 2ASPA 3AVNA 3RR7A 3DMJA 5GAGP 3SV3A 3SYZA 1CLQA 4BRLA 2HHWA 4CE9A 3V9SA 3SQ1A 3PO5A 3LDLA 2AA4A 4IBNA 4XH5A 1TL1A 1EO1A 3MAQA 3VPZA 4FJKA 1ZXOA 4FWRA 5IT9O 4IZ9A 2D0BA 2YKNA 3HP6A 3VGLA 2KW4A 4DR2K 3AO5A 3MN7A 3PX6A 2ZGZA 3AVMA 1NMNA 2E1ZA 5C24A 5DK5A 3ZX2A 4FWNA 2HVIA 1VSEA 3R6MA 4KH5A 3WXIA 3TSUA 2BH1A 1OH8A 4CIFA 4E1MA 3OA9A 2XY6A 2W41A 4R79A 4F3TA 4QCLA 3LPTA 2F9WA 3JS6A 2UUAK 4FK0A 3PUFA 3V1RA 4LF5K 3VF4A 3QNOA 3TR8A 3CF5L 2KFNA 3IUCA 4OPKA 2YJEA 3ATVA 3LDSA 2F8TA 1NGHA 3DLLL 2PYLA 3J80O 1VSMA 2OZSA 3SCXA 3F9KA 2P9SB 1HUXA 3C6UA 4CCHA 1NK9A 1RBVA 2DPNA 3IFRA 3MN5A 3CFRA 1RDCA 4JKEA 4B3OA 2HNDA 3FLCO 4OGCA 3CG7A 3K5LA 4RG8A 3C6TA 5BPNA 2ASOA 4IOCL 4DR7K 1Y97A 5AZIA 4H0OA 2FBVA 5HRRA 2X6SA 1RBUA 1SZ2A 4B1YB 1M90O 1R59O 4BVOA 3K5NA 3LAMA 4A2AA 2ZQBA 3EL2A 1T3VA 3DLHA 3MCPA 4JAXA 3E9PA
chains in the Genus database with same CATH topology
3U3GA 1RTHA 1SL1A 1JXEA 4BE0A 1HNVA 1L3UA 3MXJA 3I0RA 4CGDA 3ZSQA 3QEWA 3CFOA 3K57A 1U45A 1JLAA 4NYFA 4G1QA 2OYQA 1YTUA 4AH9A 3K2PA 3LAKA 3AVLA 3C95A 3LPUA 4CFCA 4CIGA 4CJKA 3EZ5A 1B9DA 1TAQA 3AVCA 3AVHA 3MEGA 1W0HA 4DU3A 4KPYA 2DFHA 4QOZB 1KVAA 3E01A 2JLEA 2GV9A 3SI6A 1IKYA 5CYQA 2XHBA 4F2SA 1CZ9A 4DSFA 3KLFA 3I8DA 5J2PA 1BL3A 1IH7A 1LW2A 2NUBA 2YKMA 1BI4B 3PV8A 4FJIA 4KRFA 1WSFA 4BE2A 2DY4A 1X9MA 4N5SA 3OYLA 1S1TA 4BDZA 2KZZA 1N6QA 1TAUA 3V9XA 1KCFA 1KTQA 3RMDA 4B9VA 3PO4A 3OS2A 4C8LA 2IGIA 3AVKA 1RTJA 4BDPA 2I5JA 4Z4EA 2XRIA 2PYJA 4FJGA 2RPIA 2VWKA 4FM1A 1ASWA 3AVBA 3VQPA 5DMRA 3IRXA 4DTUA 1SL0A 1NK6A 1J9AA 1RILA 4DQRA 4IFYA 1C1AA 1HJRA 1HQUA 3SV4A 2G8VA 3KK2A 1SV5A 4CHYA 1JLEA 1RT6A 2KQ2A 4CEQA 4CHQA 5J2NA 2IDOA 1VSLA 3VQQA 4CEAA 3HVRA 4IG0A 3AA5X 4DLEA 1LV5A 2P5OA 4DMNA 1ASUA 3P83D 5HRSA 4M3WA 3O3HA 4CEEA 3LALA 1YTAA 3IG1A 3U6FA 3ASMA 4FLZA 4LH5A 1HQEA 3TI0A 1ZBHA 2G8IA 4DFKA 4KHYA 3QEXA 4PWDA 3TABA 3EY1A 2WONA 3DLRA 2G8WA 3HO1A 3QINA 4QAGA 1BIZA 4E0DA 4Z4GA 4CK1A 2VG7A 1RDAA 3SUPA 4AHCA 4HVJA 3K5OA 2F8SA 1BCOA 1XI1A 2Z1JA 2ETJA 2GBZA 3K59A 3V9ZA 4CJEA 1VSIA 4CGJA 4C8MA 4OKEA 1UOCA 4Q5VA 3LZJA 1NKEA 2R7YA 1T05A 2AJQA 1ASVA 2X78A 4CEZA 1WSJA 4LD0A 2G8HA 1F21A 1JKHA 1NJZA 3OS1A 1NK7A 5HROA 1L3VA 1REVA 1TKTA 5J2MA 1S1UA 3KK3A 3NDKA 3HK2A 4K8XA 4O55A 3L2UA 4M3XA 4EZ9A 4DTRA 4NCBA 1WLJA 4B8AB 1Q9XA 3SPYA 1TKZA 1RT5A 3O4QA 4AHTA 2VWJA 3SUNA 4CF0A 4FLUA 4JRPA 1EETA 4GVMA 2KZMA 1BCMA 1Z26A 4UQGA 2YHAA 1B9FA 3OYFA 1BI4A 1WAJA 3ZSVA 2KTQA 1RT2A 4NYNA 3RTVA 1QE1A 4DU4A 4FYDA 3LANA 4DU1A 3RMBA 3KD5E 5FRNA 3WNGA 5HBMA 2Q3SA 1S5JA 1RTDA 3DLHA 4W5NA 3SUOA 4I2PA 2YNGA 3CM6A 2HB5A 1C6VA 2OZMA 3SQ0A 5T7BA 3OYIA 2XO7A 1QSLA 1KFSA 4DFPA 1X9WA 1CLQA 4FM0A 1WNSA 3KIOA 3OYMA 5FDLA 3KLEA 3FFIA 3WNHA 5I42A 4O4GA 1A5XA 3NF6A 1T8EA 3AO2A 2Y1IA 4DSIA 3DLEA 3CM5A 5E41A 4B08A 3MXIA 3L2VA 1S1VA 3DOKA 1HYSA 2RN2A 4XIUA 2QKBA 2HMIA 4KREA 2ZD1A 3L2QA 4FJXA 4BWJA 3JSMA 4B9NA 3ZT1A 2BE2A 1BGXT 4ZHRA 4H4OA 3ZT2A 4KB0A 4IG3A 4CJVA 4LY7A 4OKJA 4Y1CA 4CJWA 4E19A 4FLTA 3RMAA 1WAFA 5KRSA 4BDYA 3NF9A 4EP4A 4FJ9A 1BHLA 4KHUA 3VA0A 2IC3A 1LW0A 4CJ5A 3ULDA 2B5JA 1VRUA 4OLBA 3KLIA 4E7HA 4J2DA 1TL3A 3VQ5A 4MFBA 1S6PA 5SZTA 4JRQA 4B9SA 1EX4A 2ATQA 3CQ8A 3V9WA 4J2EA 3HPGA 3L8BA 1RDBA 4HHTA 4DTJA 4W5OA 4AHVA 1FXXA 1XWLA 2HNZA 1NK4A 3KLHA 3KKRA 4FK4A 1SL2A 4B9TA 2EX3A 4DQQA 1FK9A 2QXFA 4RW6A 1RBSA 4DQIA 4PY5A 4KKOA 4B8CA 4KI4A 1JXBA 1FKOA 3QO9A 3ZSRA 3UIQA 3T19A 2HHUA 3NAEA 4W5TA 1UA1A 1RT7A 3MECA 3NGZA 3VA3A 4KFBA 5CZ2A 3PY8A 4FLVA 2HHXA 1JLGA 2VG5A 2PY5A 4M3TA 1WSIA 4DS4A 5SWMA 1D5AA 3KLGA 5HRPA 1N5YA 4M3RA 3OYAA 4H4MA 1J5OA 3TAQA 4CJLA 1TKDA 1ZBFA 2QK9A 1BQNA 3VQ7A 4HTUA 4DSJA 4CHPA 4FW1A 4Y1DA 4Z0UA 1U49A 3AA4A 2HHVA 2HHWA 1VK0A 1FKPA 3WNFA 1QSSA 1SKRA 1WSHA 5J2QA 4EZ6A 2O4GA 1IKXA 3KTQA 3AV9A 3HL8A 1WSEA 3M8QA 3NFAA 1ZBLA 4CIEA 2FC0A 4I7FA 5EU7A 4FJHA 3LZIA 4DS5A 3SQ4A 1RT4A 3KKSA 4E7KA 3MXMA 4ELTA 4PQUA 1QS4A 3ZSWA 1JLFA 3OJSA 4AHRA 4CHNA 4FJLA 1YVUA 3DRPA 1IKVA 5C42A 2ITGA 1RT1A 4JS4A 4W5RA 2A1RA 3TARA 1J53A 3V81A 4DTXA 5I3UA 1R0AA 4Z4IA 4CF2A 4F8RA 4FZZA 4CF9A 4O44A 5CZ1A 1WN7A 3DRSA 3ZCMA 4O0IA 3VQEA 2P1JA 3SPZA 4CFBA 2Y1JA 4CJUA 2X74A 4DTMA 1S9GA 1U4BA 1U48A 4ELVA 4ICLA 5KGWA 2YNFA 3SQ2A 3RMCA 3S3OA 3O3FA 3S3MA 3P5JA 4CF1A 1G15A 2E6MA 4OVLA 4DG1A 3V9UA 3BGRA 3QIOA 4DTSA 1NK5A 5D3GA 3EYZA 4DQSA 3OYBA 1NOZA 4HCCA 4DTNA 2FBXA 3NH1A 3DOLA 4FXDA 2GUIA 3RRHA 1ZYQA 1UA0A 4KTZA 1RTIA 3V4IA 4CESA 3O4NA 5CYMA 3DRRA 1O1WA 4KI6A 4EP5A 1DTQA 3LP2A 5FROA 2B6AA 4DF8A 1KVBA 5KGXA 1RT3A 2PZSA 1J54A 4TSXA 3DLBA 4FLYA 1BIUA 3LP1A 5HRNA 1RNHA 4YNQA 3NBPA 1CZBA 3VQ8A 3JYTA 4AHUA 4CGGA 4E7LA 1GOCA 3LP0A 1SKSA 3HP9A 3OYGA 4DLGA 4C8KA 4WE1A 4M3YA 4BWMA 1EP4A 4LSNA 3OYKA 3LP3A 4M41A 3L2RA 2IOCA 4OGEA 3HM9A 3D0PA 4Z4CA 3AO1A 2D5RA 1JLQA 3AVGA 2D0AA 4FLWA 3KK1A 3S3NA 2E6LA 3AA3A 3DI6A 3I0SA 3QIPA 4E89A 3AO4A 1KVCA 4PUOA 4CEBA 4FW2A 3VQ4A 1JL2A 3NH2A 3M8RA 3OYNA 2YNIA 3OVNA 4DTOA 3PX0A 2DTUA 4DSKA 2P5GA 3SJJA 4RW7A 4CK3A 1GOBA 4CFAA 1TK0A 4DQPA 4FJ8A 1VSDA 3NGYA 1IO2A 1C1BA 1DLOA 2ZE2A 2IAJA 3M8PA 1TK8A 4M3ZA 4H8KA 1K6YA 4CHOA 4KHNA 1JL1A 4CGIA 1IG9A 2KFZA 2G8UA 3TAFA 3NGIA 4E1NA 4E3SA 3VQDA 4L8RB 3OYHA 1TKXA 2HHSA 1QTMA 3M8SA 4DF4A 1TK5A 4MQ3A 2FBTA 4C8OA 4DSLA 2FBYA 3A2FA 4FJ7A 1QQCA 5KTQA 1L5UA 3NF7A 3AO3A 3OYEA 4ZTJA 3TAMA 4CJQA 3LWMA 3ZT3A 3HPOA 1RCHA 5J1EA 4CEOA 4M45A 3L3VA 3DLKA 3U3YA 3QEVA 1A5VA 3DM2A 4B9LA 5JS1A 3SNNA 1X9SA 3HPHA 3HVTA 5HLFA 1LAVA 2QKKA 2B4JA 4OJRA 4FM2A 2F96A 1CXQA 3OJUA 4B9MA 3AVJA 1Z25A 2OPQA 3IS9A 1YT3A 2BANA 4RW4A 4HUFA 4J2AA 4DSEA 3SUQA 1NKBA 2RKIA 2DFFA 3B6OA 2LSNA 3RRGA 3HT3A 1XC9A 4KTWA 1NJXA 3IAYA 1UAXA 3AVIA 4N56A 4JS5A 3V1OA 1T03A 3O3GA 4CECA 1HYVA 1X1PA 3RR8A 3QEIA 4JLHA 1HRHA 3ZSYA 5KRTA 4M42A 4KHSA 3OYCA 5CY4A 5K14A 4N47A 4CFDA 2OPSA 3VQ6A 1LWFA 1C1CA 1GOAA 1CXUA 4AHSA 1JLCA 3NCIA 3TWHA 1C0TA 1HYZA 1MU2A 2OA8A 4KTQA 4FVMA 4RW9A 4E7IA 2O4IA 2EHGA 4ID5A 1XHZA 1LWEA 2XY8A 3NH0A 4KO0A 3ZSOA 3TANA 1NOYA 2OPPA 2XY7A 5JS2A 3QERA 3AVFA 1KLNA 4FJMA 4DFJA 1SUQA 2Z1IA 4BACA 2W42A 4I2QA 1XHXA 4GMJB 4PA1A 3HXMA 4K8ZA 1VSKA 1BQMA 4Z4FA 1RBRA 1HNIA 4NCGA 3RWUA 4ELUA 4F4KA 2OPRA 4GW6A 4CJRA 4FJNA 2HHQA 1QSYA 3CFPA 1T7PA 3ZT0A 3MEEA 3F73A 3T1AA 1LWCA 4CGFA 4AILC 4CGHA 1JLBA 3VQAA 5C25A 1HMVA 1D9FA 4KAZA 3QESA 3AVNA 3RR7A 1ZBIA 3DMJA 3TAPA 4KV8A 2A1SA 1RBTA 3V1QA 4CJ3A 3OY9A 3KJVA 3LWLA 3K58A 3SV3A 2D0CA 2P51A 2Z1GA 3SYZA 3V6DA 4CE9A 1D9DA 3V9SA 4FJ5A 4IKFA 2BGGA 4BE1A 3SQ1A 2XY5A 2YHBA 3PO5A 2VG6A 3VQBA 5KI6A 4OKKA 4HCBA 3B6PA 1C0UA 4IBNA 1TL1A 4FZXC 4KHQA 3MAQA 4FJKA 4FZYA 3TAEA 4CJPA 4DFMA 1B92A 3DYAA 1TV6A 4YFUA 2YV0X 2D0BA 2YKNA 3QETA 3THVA 1KLMA 3VQ9A 4CEDA 3HP6A 3L2WA 4LH4A 2KW4A 1KSPA 1KFDA 3AO5A 3PX6A 2HW3A 1BISA 1Q8IA 3ALYA 3AVMA 3G10A 1NKCA 4CHZA 2WOMA 1S1XA 5C24A 3BDPA 5DK5A 1HPZA 4M3UA 1TGOA 1UWBA 3VN5A 1U04A 2G8FA 4DWIA 4N41A 2HVIA 4KB1A 2JGUA 1VSEA 4CJ4A 3NE6A 3P1GA 4J2BA 4CJTA 2Z1HA 3HYFA 4FJJA 3MEDA 5FRMA 4FK2A 3ZSZA 2HHTA 2RF2A 4CIFA 4E1MA 3WNEA 4ZTFA 3OYJA 2XY6A 1S6QA 3DLGA 4F3TA 4QCLA 3LPTA 3D45A 4I9LA 3VQCA 4CJFA 3NHGA 3PX4A 2IS3A 3C94A 3HSTB 3AA2A 3NF8A 5HP1A 1EKEA 2HNYA 4FK0A 4HUGA 3PUFA 3QEPA 3AVAA 1NJWA 1I39A 1IKWA 3L3UA 3V1RA 4CERA 4O5BA 4Z4HA 3QNOA 3TR8A 3ISNC 1SKWA 1L3TA 1C0MA 2KFNA 3K5MA 4OPJA 4OPKA 1U47A 3LDSA 4E7JA 4W5QA 2F8TA 4FLXA 4R5PA 2PYLA 4HUEA 3TAGA 3SZ2A 1VSMA 2OZSA 3SCXA 2YNHA 1NJYA 1RDDA 1S9EA 3F9KA 2E4LA 1Q9YA 3C6UA 3ITHA 4CCHA 4F3OA 3G0ZA 1NK9A 3T3FA 1RBVA 4RW8A 3CFRA 1RDCA 4IDKA 4B3OA 4B9UA 1A5WA 2HNDA 2HVHA 1QHTA 1VSFA 1LAWA 1NK8A 4F2RA 4I9QA 4OGCA 1L3SA 1DTTA 3CG7A 4DTPA 3K5LA 4RG8A 3C6TA 4C8NA 3KD1E 4CF8A 1ZBUA 1VSJA 1W9HA 3QLHA 1Y97A 4CK2A 1TVRA 3H08A 1I3AA 4CJSA 4CEFA 1S1WA 2FBVA 2DFEA 2X6NA 4LSLA 4FCYA 1D8YA 5HRRA 4NCAA 1EXQA 4IFVA 1KRPA 2X6SA 1RBUA 4N76A 3QNNA 1ITGA 1VRTA 1VSHA 3S9HA 4Q0BA 3OS0A 1NK0A 3K5NA 3LAMA 3ZT4A 3HJFA 4OLAA 4O0JA 2BDPA 4KHWA 2G8KA 2ZQBA 4ID1A 1WSGA 3ZSXA 3CYMA 3OYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3G A;  1RTH A;  1SL1 A;  1JXE A;  4BE0 A;  1HNV A;  1L3U A;  3MXJ A;  3I0R A;  4CGD A;  3ZSQ A;  3QEW A;  3CFO A;  3K57 A;  1U45 A;  1JLA A;  4NYF A;  4G1Q A;  2OYQ A;  1YTU A;  4AH9 A;  3K2P A;  3LAK A;  3AVL A;  3C95 A;  3LPU A;  4CFC A;  4CIG A;  4CJK A;  3EZ5 A;  1B9D A;  1TAQ A;  3AVC A;  3AVH A;  3MEG A;  1W0H A;  4DU3 A;  4KPY A;  2DFH A;  4QOZ B;  1KVA A;  3E01 A;  2JLE A;  2GV9 A;  3SI6 A;  1IKY A;  5CYQ A;  2XHB A;  4F2S A;  1CZ9 A;  4DSF A;  3KLF A;  3I8D A;  5J2P A;  1BL3 A;  1IH7 A;  1LW2 A;  2NUB A;  2YKM A;  1BI4 B;  3PV8 A;  4FJI A;  4KRF A;  1WSF A;  4BE2 A;  2DY4 A;  1X9M A;  4N5S A;  3OYL A;  1S1T A;  4BDZ A;  2KZZ A;  1N6Q A;  1TAU A;  3V9X A;  1KCF A;  1KTQ A;  3RMD A;  4B9V A;  3PO4 A;  3OS2 A;  4C8L A;  2IGI A;  3AVK A;  1RTJ A;  4BDP A;  2I5J A;  4Z4E A;  2XRI A;  2PYJ A;  4FJG A;  2RPI A;  2VWK A;  4FM1 A;  1ASW A;  3AVB A;  3VQP A;  5DMR A;  3IRX A;  4DTU A;  1SL0 A;  1NK6 A;  1J9A A;  1RIL A;  4DQR A;  4IFY A;  1C1A A;  1HJR A;  1HQU A;  3SV4 A;  2G8V A;  3KK2 A;  1SV5 A;  4CHY A;  1JLE A;  1RT6 A;  2KQ2 A;  4CEQ A;  4CHQ A;  5J2N A;  2IDO A;  1VSL A;  3VQQ A;  4CEA A;  3HVR A;  4IG0 A;  3AA5 X;  4DLE A;  1LV5 A;  2P5O A;  4DMN A;  1ASU A;  3P83 D;  5HRS A;  4M3W A;  3O3H A;  4CEE A;  3LAL A;  1YTA A;  3IG1 A;  3U6F A;  3ASM A;  4FLZ A;  4LH5 A;  1HQE A;  3TI0 A;  1ZBH A;  2G8I A;  4DFK A;  4KHY A;  3QEX A;  4PWD A;  3TAB A;  3EY1 A;  2WON A;  3DLR A;  2G8W A;  3HO1 A;  3QIN A;  4QAG A;  1BIZ A;  4E0D A;  4Z4G A;  4CK1 A;  2VG7 A;  1RDA A;  3SUP A;  4AHC A;  4HVJ A;  3K5O A;  2F8S A;  1BCO A;  1XI1 A;  2Z1J A;  2ETJ A;  2GBZ A;  3K59 A;  3V9Z A;  4CJE A;  1VSI A;  4CGJ A;  4C8M A;  4OKE A;  1UOC A;  4Q5V A;  3LZJ A;  1NKE A;  2R7Y A;  1T05 A;  2AJQ A;  1ASV A;  2X78 A;  4CEZ A;  1WSJ A;  4LD0 A;  2G8H A;  1F21 A;  1JKH A;  1NJZ A;  3OS1 A;  1NK7 A;  5HRO A;  1L3V A;  1REV A;  1TKT A;  5J2M A;  1S1U A;  3KK3 A;  3NDK A;  3HK2 A;  4K8X A;  4O55 A;  3L2U A;  4M3X A;  4EZ9 A;  4DTR A;  4NCB A;  1WLJ A;  4B8A B;  1Q9X A;  3SPY A;  1TKZ A;  1RT5 A;  3O4Q A;  4AHT A;  2VWJ A;  3SUN A;  4CF0 A;  4FLU A;  4JRP A;  1EET A;  4GVM A;  2KZM A;  1BCM A;  1Z26 A;  4UQG A;  2YHA A;  1B9F A;  3OYF A;  1BI4 A;  1WAJ A;  3ZSV A;  2KTQ A;  1RT2 A;  4NYN A;  3RTV A;  1QE1 A;  4DU4 A;  4FYD A;  3LAN A;  4DU1 A;  3RMB A;  3KD5 E;  5FRN A;  3WNG A;  5HBM A;  2Q3S A;  1S5J A;  1RTD A;  3DLH A;  4W5N A;  3SUO A;  4I2P A;  2YNG A;  3CM6 A;  2HB5 A;  1C6V A;  2OZM A;  3SQ0 A;  5T7B A;  3OYI A;  2XO7 A;  1QSL A;  1KFS A;  4DFP A;  1X9W A;  1CLQ A;  4FM0 A;  1WNS A;  3KIO A;  3OYM A;  5FDL A;  3KLE A;  3FFI A;  3WNH A;  5I42 A;  4O4G A;  1A5X A;  3NF6 A;  1T8E A;  3AO2 A;  2Y1I A;  4DSI A;  3DLE A;  3CM5 A;  5E41 A;  4B08 A;  3MXI A;  3L2V A;  1S1V A;  3DOK A;  1HYS A;  2RN2 A;  4XIU A;  2QKB A;  2HMI A;  4KRE A;  2ZD1 A;  3L2Q A;  4FJX A;  4BWJ A;  3JSM A;  4B9N A;  3ZT1 A;  2BE2 A;  1BGX T;  4ZHR A;  4H4O A;  3ZT2 A;  4KB0 A;  4IG3 A;  4CJV A;  4LY7 A;  4OKJ A;  4Y1C A;  4CJW A;  4E19 A;  4FLT A;  3RMA A;  1WAF A;  5KRS A;  4BDY A;  3NF9 A;  4EP4 A;  4FJ9 A;  1BHL A;  4KHU A;  3VA0 A;  2IC3 A;  1LW0 A;  4CJ5 A;  3ULD A;  2B5J A;  1VRU A;  4OLB A;  3KLI A;  4E7H A;  4J2D A;  1TL3 A;  3VQ5 A;  4MFB A;  1S6P A;  5SZT A;  4JRQ A;  4B9S A;  1EX4 A;  2ATQ A;  3CQ8 A;  3V9W A;  4J2E A;  3HPG A;  3L8B A;  1RDB A;  4HHT A;  4DTJ A;  4W5O A;  4AHV A;  1FXX A;  1XWL A;  2HNZ A;  1NK4 A;  3KLH A;  3KKR A;  4FK4 A;  1SL2 A;  4B9T A;  2EX3 A;  4DQQ A;  1FK9 A;  2QXF A;  4RW6 A;  1RBS A;  4DQI A;  4PY5 A;  4KKO A;  4B8C A;  4KI4 A;  1JXB A;  1FKO A;  3QO9 A;  3ZSR A;  3UIQ A;  3T19 A;  2HHU A;  3NAE A;  4W5T A;  1UA1 A;  1RT7 A;  3MEC A;  3NGZ A;  3VA3 A;  4KFB A;  5CZ2 A;  3PY8 A;  4FLV A;  2HHX A;  1JLG A;  2VG5 A;  2PY5 A;  4M3T A;  1WSI A;  4DS4 A;  5SWM A;  1D5A A;  3KLG A;  5HRP A;  1N5Y A;  4M3R A;  3OYA A;  4H4M A;  1J5O A;  3TAQ A;  4CJL A;  1TKD A;  1ZBF A;  2QK9 A;  1BQN A;  3VQ7 A;  4HTU A;  4DSJ A;  4CHP A;  4FW1 A;  4Y1D A;  4Z0U A;  1U49 A;  3AA4 A;  2HHV A;  2HHW A;  1VK0 A;  1FKP A;  3WNF A;  1QSS A;  1SKR A;  1WSH A;  5J2Q A;  4EZ6 A;  2O4G A;  1IKX A;  3KTQ A;  3AV9 A;  3HL8 A;  1WSE A;  3M8Q A;  3NFA A;  1ZBL A;  4CIE A;  2FC0 A;  4I7F A;  5EU7 A;  4FJH A;  3LZI A;  4DS5 A;  3SQ4 A;  1RT4 A;  3KKS A;  4E7K A;  3MXM A;  4ELT A;  4PQU A;  1QS4 A;  3ZSW A;  1JLF A;  3OJS A;  4AHR A;  4CHN A;  4FJL A;  1YVU A;  3DRP A;  1IKV A;  5C42 A;  2ITG A;  1RT1 A;  4JS4 A;  4W5R A;  2A1R A;  3TAR A;  1J53 A;  3V81 A;  4DTX A;  5I3U A;  1R0A A;  4Z4I A;  4CF2 A;  4F8R A;  4FZZ A;  4CF9 A;  4O44 A;  5CZ1 A;  1WN7 A;  3DRS A;  3ZCM A;  4O0I A;  3VQE A;  2P1J A;  3SPZ A;  4CFB A;  2Y1J A;  4CJU A;  2X74 A;  4DTM A;  1S9G A;  1U4B A;  1U48 A;  4ELV A;  4ICL A;  5KGW A;  2YNF A;  3SQ2 A;  3RMC A;  3S3O A;  3O3F A;  3S3M A;  3P5J A;  4CF1 A;  1G15 A;  2E6M A;  4OVL A;  4DG1 A;  3V9U A;  3BGR A;  3QIO A;  4DTS A;  1NK5 A;  5D3G A;  3EYZ A;  4DQS A;  3OYB A;  1NOZ A;  4HCC A;  4DTN A;  2FBX A;  3NH1 A;  3DOL A;  4FXD A;  2GUI A;  3RRH A;  1ZYQ A;  1UA0 A;  4KTZ A;  1RTI A;  3V4I A;  4CES A;  3O4N A;  5CYM A;  3DRR A;  1O1W A;  4KI6 A;  4EP5 A;  1DTQ A;  3LP2 A;  5FRO A;  2B6A A;  4DF8 A;  1KVB A;  5KGX A;  1RT3 A;  2PZS A;  1J54 A;  4TSX A;  3DLB A;  4FLY A;  1BIU A;  3LP1 A;  5HRN A;  1RNH A;  4YNQ A;  3NBP A;  1CZB A;  3VQ8 A;  3JYT A;  4AHU A;  4CGG A;  4E7L A;  1GOC A;  3LP0 A;  1SKS A;  3HP9 A;  3OYG A;  4DLG A;  4C8K A;  4WE1 A;  4M3Y A;  4BWM A;  1EP4 A;  4LSN A;  3OYK A;  3LP3 A;  4M41 A;  3L2R A;  2IOC A;  4OGE A;  3HM9 A;  3D0P A;  4Z4C A;  3AO1 A;  2D5R A;  1JLQ A;  3AVG A;  2D0A A;  4FLW A;  3KK1 A;  3S3N A;  2E6L A;  3AA3 A;  3DI6 A;  3I0S A;  3QIP A;  4E89 A;  3AO4 A;  1KVC A;  4PUO A;  4CEB A;  4FW2 A;  3VQ4 A;  1JL2 A;  3NH2 A;  3M8R A;  3OYN A;  2YNI A;  3OVN A;  4DTO A;  3PX0 A;  2DTU A;  4DSK A;  2P5G A;  3SJJ A;  4RW7 A;  4CK3 A;  1GOB A;  4CFA A;  1TK0 A;  4DQP A;  4FJ8 A;  1VSD A;  3NGY A;  1IO2 A;  1C1B A;  1DLO A;  2ZE2 A;  2IAJ A;  3M8P A;  1TK8 A;  4M3Z A;  4H8K A;  1K6Y A;  4CHO A;  4KHN A;  1JL1 A;  4CGI A;  1IG9 A;  2KFZ A;  2G8U A;  3TAF A;  3NGI A;  4E1N A;  4E3S A;  3VQD A;  4L8R B;  3OYH A;  1TKX A;  2HHS A;  1QTM A;  3M8S A;  4DF4 A;  1TK5 A;  4MQ3 A;  2FBT A;  4C8O A;  4DSL A;  2FBY A;  3A2F A;  4FJ7 A;  1QQC A;  5KTQ A;  1L5U A;  3NF7 A;  3AO3 A;  3OYE A;  4ZTJ A;  3TAM A;  4CJQ A;  3LWM A;  3ZT3 A;  3HPO A;  1RCH A;  5J1E A;  4CEO A;  4M45 A;  3L3V A;  3DLK A;  3U3Y A;  3QEV A;  1A5V A;  3DM2 A;  4B9L A;  5JS1 A;  3SNN A;  1X9S A;  3HPH A;  3HVT A;  5HLF A;  1LAV A;  2QKK A;  2B4J A;  4OJR A;  4FM2 A;  2F96 A;  1CXQ A;  3OJU A;  4B9M A;  3AVJ A;  1Z25 A;  2OPQ A;  3IS9 A;  1YT3 A;  2BAN A;  4RW4 A;  4HUF A;  4J2A A;  4DSE A;  3SUQ A;  1NKB A;  2RKI A;  2DFF A;  3B6O A;  2LSN A;  3RRG A;  3HT3 A;  1XC9 A;  4KTW A;  1NJX A;  3IAY A;  1UAX A;  3AVI A;  4N56 A;  4JS5 A;  3V1O A;  1T03 A;  3O3G A;  4CEC A;  1HYV A;  1X1P A;  3RR8 A;  3QEI A;  4JLH A;  1HRH A;  3ZSY A;  5KRT A;  4M42 A;  4KHS A;  3OYC A;  5CY4 A;  5K14 A;  4N47 A;  4CFD A;  2OPS A;  3VQ6 A;  1LWF A;  1C1C A;  1GOA A;  1CXU A;  4AHS A;  1JLC A;  3NCI A;  3TWH A;  1C0T A;  1HYZ A;  1MU2 A;  2OA8 A;  4KTQ A;  4FVM A;  4RW9 A;  4E7I A;  2O4I A;  2EHG A;  4ID5 A;  1XHZ A;  1LWE A;  2XY8 A;  3NH0 A;  4KO0 A;  3ZSO A;  3TAN A;  1NOY A;  2OPP A;  2XY7 A;  5JS2 A;  3QER A;  3AVF A;  1KLN A;  4FJM A;  4DFJ A;  1SUQ A;  2Z1I A;  4BAC A;  2W42 A;  4I2Q A;  1XHX A;  4GMJ B;  4PA1 A;  3HXM A;  4K8Z A;  1VSK A;  1BQM A;  4Z4F A;  1RBR A;  1HNI A;  4NCG A;  3RWU A;  4ELU A;  4F4K A;  2OPR A;  4GW6 A;  4CJR A;  4FJN A;  2HHQ A;  1QSY A;  3CFP A;  1T7P A;  3ZT0 A;  3MEE A;  3F73 A;  3T1A A;  1LWC A;  4CGF A;  4AIL C;  4CGH A;  1JLB A;  3VQA A;  5C25 A;  1HMV A;  1D9F A;  4KAZ A;  3QES A;  3AVN A;  3RR7 A;  1ZBI A;  3DMJ A;  3TAP A;  4KV8 A;  2A1S A;  1RBT A;  3V1Q A;  4CJ3 A;  3OY9 A;  3KJV A;  3LWL A;  3K58 A;  3SV3 A;  2D0C A;  2P51 A;  2Z1G A;  3SYZ A;  3V6D A;  4CE9 A;  1D9D A;  3V9S A;  4FJ5 A;  4IKF A;  2BGG A;  4BE1 A;  3SQ1 A;  2XY5 A;  2YHB A;  3PO5 A;  2VG6 A;  3VQB A;  5KI6 A;  4OKK A;  4HCB A;  3B6P A;  1C0U A;  4IBN A;  1TL1 A;  4FZX C;  4KHQ A;  3MAQ A;  4FJK A;  4FZY A;  3TAE A;  4CJP A;  4DFM A;  1B92 A;  3DYA A;  1TV6 A;  4YFU A;  2YV0 X;  2D0B A;  2YKN A;  3QET A;  3THV A;  1KLM A;  3VQ9 A;  4CED A;  3HP6 A;  3L2W A;  4LH4 A;  2KW4 A;  1KSP A;  1KFD A;  3AO5 A;  3PX6 A;  2HW3 A;  1BIS A;  1Q8I A;  3ALY A;  3AVM A;  3G10 A;  1NKC A;  4CHZ A;  2WOM A;  1S1X A;  5C24 A;  3BDP A;  5DK5 A;  1HPZ A;  4M3U A;  1TGO A;  1UWB A;  3VN5 A;  1U04 A;  2G8F A;  4DWI A;  4N41 A;  2HVI A;  4KB1 A;  2JGU A;  1VSE A;  4CJ4 A;  3NE6 A;  3P1G A;  4J2B A;  4CJT A;  2Z1H A;  3HYF A;  4FJJ A;  3MED A;  5FRM A;  4FK2 A;  3ZSZ A;  2HHT A;  2RF2 A;  4CIF A;  4E1M A;  3WNE A;  4ZTF A;  3OYJ A;  2XY6 A;  1S6Q A;  3DLG A;  4F3T A;  4QCL A;  3LPT A;  3D45 A;  4I9L A;  3VQC A;  4CJF A;  3NHG A;  3PX4 A;  2IS3 A;  3C94 A;  3HST B;  3AA2 A;  3NF8 A;  5HP1 A;  1EKE A;  2HNY A;  4FK0 A;  4HUG A;  3PUF A;  3QEP A;  3AVA A;  1NJW A;  1I39 A;  1IKW A;  3L3U A;  3V1R A;  4CER A;  4O5B A;  4Z4H A;  3QNO A;  3TR8 A;  3ISN C;  1SKW A;  1L3T A;  1C0M A;  2KFN A;  3K5M A;  4OPJ A;  4OPK A;  1U47 A;  3LDS A;  4E7J A;  4W5Q A;  2F8T A;  4FLX A;  4R5P A;  2PYL A;  4HUE A;  3TAG A;  3SZ2 A;  1VSM A;  2OZS A;  3SCX A;  2YNH A;  1NJY A;  1RDD A;  1S9E A;  3F9K A;  2E4L A;  1Q9Y A;  3C6U A;  3ITH A;  4CCH A;  4F3O A;  3G0Z A;  1NK9 A;  3T3F A;  1RBV A;  4RW8 A;  3CFR A;  1RDC A;  4IDK A;  4B3O A;  4B9U A;  1A5W A;  2HND A;  2HVH A;  1QHT A;  1VSF A;  1LAW A;  1NK8 A;  4F2R A;  4I9Q A;  4OGC A;  1L3S A;  1DTT A;  3CG7 A;  4DTP A;  3K5L A;  4RG8 A;  3C6T A;  4C8N A;  3KD1 E;  4CF8 A;  1ZBU A;  1VSJ A;  1W9H A;  3QLH A;  1Y97 A;  4CK2 A;  1TVR A;  3H08 A;  1I3A A;  4CJS A;  4CEF A;  1S1W A;  2FBV A;  2DFE A;  2X6N A;  4LSL A;  4FCY A;  1D8Y A;  5HRR A;  4NCA A;  1EXQ A;  4IFV A;  1KRP A;  2X6S A;  1RBU A;  4N76 A;  3QNN A;  1ITG A;  1VRT A;  1VSH A;  3S9H A;  4Q0B A;  3OS0 A;  1NK0 A;  3K5N A;  3LAM A;  3ZT4 A;  3HJF A;  4OLA A;  4O0J A;  2BDP A;  4KHW A;  2G8K A;  2ZQB A;  4ID1 A;  1WSG A;  3ZSX A;  3CYM A;  3OYD A; 
#chains in the Genus database with same CATH topology
 3R8E A;  1RTH A;  1LOT B;  3VF6 A;  3MXJ A;  4BC4 A;  3I0R A;  3BUZ B;  5B8H A;  3CCV N;  3K57 A;  1JLA A;  4BRI A;  4AH9 A;  3LAK A;  2FSN A;  3C95 A;  4BQZ A;  4CIG A;  4DKW A;  3NMU A;  1TAQ A;  3AVC A;  1HLU A;  2JLE A;  5CYQ A;  4WQ4 C;  3KLF A;  1LW2 A;  3SMP A;  1N32 K;  1WSF A;  1YAG A;  4BE2 A;  1NLV A;  3MX5 A;  4BDZ A;  1N6Q A;  1KCF A;  3RSE B;  2IGI A;  4PL8 A;  4FJG A;  2O8D B;  1HKC A;  3VQP A;  4QS7 A;  1YUW A;  4JV5 K;  4IFY A;  3CJ1 A;  2G8V A;  3KK2 A;  1P90 A;  3ATU A;  1BO5 O;  2GWK A;  3HI0 A;  5AQP A;  3P83 D;  5HRS A;  3CQY A;  2V7Z A;  1YTA A;  3HM8 A;  1QZ6 A;  1U2V A;  4PWD A;  2G8I A;  1ATN A;  1ZBH A;  4DFK A;  3QEX A;  4DR4 K;  3TAB A;  3DLR A;  1BIZ A;  3KVG A;  3VEN A;  4E0D A;  4DQ8 A;  4CK1 A;  1YF5 L;  4IFE A;  4EAH D;  3CCL N;  2Z1J A;  2W40 A;  2AP1 A;  3V9Z A;  1M1K O;  4OKE A;  5GAH P;  1W97 L;  1YJW N;  1T05 A;  1XMQ K;  2X78 A;  2YCH A;  3CJ9 A;  3FZM A;  3CMA N;  2ZJQ L;  2A5X A;  3DXK B;  4IJA A;  4XEI A;  3L2U A;  1VQM N;  2P9P B;  2NRT A;  4QS9 A;  1YXQ A;  4H0Y B;  3SAF A;  3SPY A;  1Q9X A;  4DR6 K;  2HOE A;  1BCM A;  3GG4 A;  4UQG A;  2YHA A;  1B9F A;  3OYF A;  1WAJ A;  2JWK A;  4BRN A;  1QE1 A;  3PSF A;  3G6E N;  3THX B;  1NGG A;  2E1Y A;  1VHX A;  2QI2 A;  3L4Q A;  5HBM A;  4EFH A;  1GLL O;  1S5J A;  3SUO A;  4ISG A;  2OZM A;  3SQ0 A;  1BOT O;  1QSL A;  2XO7 A;  4DFP A;  5BR9 A;  3FFI A;  4DV0 K;  1T8E A;  1X3M A;  2Q1N A;  3AO2 A;  4O5F A;  3DLE A;  3L2V A;  3WEE B;  4XIU A;  2HMI A;  1NG9 A;  2ZD1 A;  3L2Q A;  3JSM A;  3J8A A;  4H0V B;  4CJV A;  4E19 A;  4Y1C A;  4FLT A;  3RMA A;  1BU6 O;  1WAF A;  3TU5 A;  4FWK A;  4FJ9 A;  1BHL A;  2NZT A;  1LW0 A;  4CJ5 A;  3ULD A;  4OLB A;  2HST A;  3ENO A;  4MFB A;  1S6P A;  4JRQ A;  3WUH A;  4YHH K;  4AHV A;  1FXX A;  1XWL A;  5LY3 A;  3KKR A;  2OTJ N;  4DQQ A;  1XNQ K;  1NGB A;  4PY5 A;  3GDQ A;  3AGK A;  1C0G A;  3H3N O;  3T19 A;  1DEJ A;  4BGB A;  4W5T A;  3CD6 N;  2A40 A;  3VA3 A;  4KFB A;  5CZ2 A;  4FLV A;  3VGM A;  3FZK A;  1HR0 K;  2O8C B;  3OW2 M;  5KPT A;  4WQ4 A;  4BR9 A;  1J6Z A;  1HNX K;  1TKD A;  3VQ7 A;  4DSJ A;  4FW1 A;  5CE3 A;  3SJH A;  5FPD A;  4MDA A;  5EXW A;  5GIO A;  1QSS A;  4EZ6 A;  2PAV A;  3THW B;  5EU7 A;  3VET A;  5AZJ B;  1RT4 A;  3EKS A;  3KKS A;  4E7K A;  3MXM A;  1QS4 A;  4H5V A;  4CHN A;  3NVM A;  4NLB A;  4JK8 A;  4J8F A;  4W5R A;  4LF8 K;  3CJA A;  3O9S A;  4M63 C;  3P38 A;  5AQI A;  4DTX A;  4I6M A;  1SAZ A;  4F8R A;  4FZZ A;  5CZ1 A;  5JVH L;  4CFB A;  3UKR A;  1U4B A;  1U48 A;  3R3L A;  4GV9 A;  4DG1 A;  1WOQ A;  4HCC A;  1NOZ A;  4FXD A;  1ZYQ A;  1IV0 A;  5KQD A;  3DRR A;  4WFN L;  4KI6 A;  1Q7Y O;  3LM9 A;  1J54 A;  4CVN E;  3LP1 A;  3NBP A;  3JYT A;  4CGG A;  1SKS A;  4DLG A;  4GNI A;  4M3Y A;  4FOE A;  2P9K B;  3A5L C;  2IVO A;  4DR5 K;  1O13 A;  4G9Z A;  3L2R A;  1DT9 A;  4OGE A;  3D0P A;  3AA3 A;  3I0S A;  1TYQ B;  3QIC A;  1KVC A;  4PHT X;  4DTO A;  3M8R A;  1JL2 A;  5I9E B;  4RW7 A;  5JMV A;  4ISF A;  1GOB A;  5FLX O;  3D2E A;  1IO2 A;  1C1B A;  2QW9 A;  4JKF A;  2QEX N;  4A2B A;  4M3Z A;  2P9N A;  3C7N B;  1IBK K;  3ZLJ A;  3TAF A;  1JCF A;  4E1N A;  3OYH A;  2HHS A;  4DF4 A;  3T1H K;  4DSL A;  1QQC A;  3VER A;  4JKG A;  2UUC K;  3LWM A;  3B8A X;  5BRD A;  5AQT A;  2QM1 A;  4M45 A;  3L3V A;  3DLK A;  5BN8 A;  1A5V A;  3DM2 A;  3ULE A;  1NGF A;  4X66 K;  4BC3 A;  3HPH A;  3HVT A;  4BVP A;  2B4J A;  1CXQ A;  3OJU A;  4B9M A;  3BF3 A;  1Z25 A;  3IS9 A;  4RW4 A;  4HUF A;  4J2A A;  2VCP A;  1XUP O;  2RKI A;  2P9U A;  4JD2 B;  1Z05 A;  2LSN A;  1UAX A;  4PKH A;  4N56 A;  4JS5 A;  3V1O A;  1Q18 A;  1MDU B;  3QEI A;  3ZSY A;  2ZF5 O;  4N47 A;  3AAQ A;  5E26 A;  2P9L B;  3M6G A;  1JLC A;  3JAM O;  2OA8 A;  2FF3 B;  5CHI A;  3TAN A;  2UXC K;  4YY3 K;  2OPP A;  4GY2 B;  2XY7 A;  5JS2 A;  3QER A;  2YX6 A;  2Q0R A;  1IBM K;  4NB4 A;  4DFJ A;  4C1N K;  2Z1I A;  4GMJ B;  3BZC A;  4BRK A;  4OPH A;  4ELU A;  1V4S A;  4F4K A;  4GW6 A;  5EVZ A;  3MEE A;  4CGF A;  1TUU A;  3VQA A;  1HMV A;  2HBJ A;  3OBY A;  1ZBI A;  4KV8 A;  3KJV A;  3V1Q A;  4CJ3 A;  3V6D A;  2D0C A;  2Z1G A;  4Z94 A;  4FJ5 A;  2XY5 A;  2YHB A;  3VQB A;  5KI6 A;  1YI2 N;  1C0U A;  2O8B B;  3TAE A;  4CJP A;  4DFM A;  4YFU A;  2YV0 X;  3P31 A;  2ITM A;  3THV A;  2V51 B;  1KLM A;  3VQ9 A;  4CED A;  2UXD K;  1QHA A;  1K73 O;  1OH5 A;  1KSP A;  1KFD A;  3TTD A;  2HHH K;  2HW3 A;  1Q8I A;  3E9L A;  4IOA L;  1T6D A;  2WOM A;  3BDP A;  4BY9 C;  3MK6 A;  1BDG A;  4DWI A;  4FVU A;  3CXC M;  4CJ4 A;  4IO8 A;  3P1G A;  1KAX A;  3OBW A;  3HYF A;  3MED A;  5BRE A;  3L6Q A;  2HHT A;  2NRX A;  3FGU A;  3ID6 A;  2RF2 A;  4BRF A;  3WNE A;  3OYJ A;  4B9Q A;  1S6Q A;  4FPB A;  3VQC A;  3PX4 A;  2O8F B;  3C94 A;  3UE5 A;  4BQL A;  1EKE A;  2HNY A;  4B1X B;  3ZET A;  1Q82 O;  1NJW A;  1IKW A;  4JKH A;  4CD1 A;  1OH7 A;  4Z4H A;  2CGJ A;  4OPA A;  1C0M A;  3D6R A;  4E7J A;  4W5Q A;  1YIT N;  4R5P A;  4HUE A;  2CGK A;  2YJF A;  2YNH A;  1NJY A;  1RDD A;  2V7Y A;  1Q9Y A;  4F3O A;  3ITH A;  3G0Z A;  1NBW A;  3A8Y A;  4RW8 A;  1KAY A;  3CIP A;  2ASM A;  1A5W A;  4RCH A;  1Y64 A;  1NU0 A;  3H6E A;  4CZI A;  4OO1 J;  1QHT A;  5KQ8 A;  1DTT A;  3BEX A;  2Q31 A;  2IVP A;  3KD1 E;  5H1S Q;  3DXM A;  1W9H A;  3QLH A;  4CBX A;  1HX1 A;  1U6Z A;  4LFA K;  1TVR A;  2X6N A;  3W3D A;  2UUB K;  4N76 A;  3QNN A;  1VAZ A;  1ITG A;  3S9H A;  3LDO A;  3DWL A;  4KH6 A;  4BRQ A;  4B3M K;  4O0J A;  2BDP A;  3ZSX A;  3HZ6 A;  1EQY A;  1L3U A;  3BP8 A;  4CGD A;  3CFO A;  1U45 A;  2OYQ A;  4BRO A;  1YTU A;  3K2P A;  3LPU A;  4ILJ A;  4A5B A;  4CFC A;  4KPY A;  1B9D A;  5M1Q A;  1K8K A;  2GV9 A;  2P9I B;  3CET A;  2E2Q A;  2XHB A;  4F2S A;  4DSF A;  1BL3 A;  1IH7 A;  5CR4 A;  2NUB A;  3PV8 A;  2F4V K;  2YHW A;  4B9V A;  3VTI A;  4JHD B;  4BDP A;  4CZL A;  2XRI A;  4LFC K;  5DMR A;  3IRX A;  1RIL A;  4DQR A;  1HJR A;  3SV4 A;  1SV5 A;  1JLE A;  1RT6 A;  3VQQ A;  3HVR A;  4CEA A;  4DLE A;  2I7N A;  4IG0 A;  4BC2 A;  2BUP A;  2NLX A;  4CEE A;  4E1J A;  3CPE A;  1YIJ N;  4LH5 A;  1HQE A;  4KHY A;  3WT0 A;  3H3O B;  2WON A;  2G8W A;  2VG7 A;  1RDA A;  3WQU A;  2GBZ A;  3N4P A;  4CJE A;  3IDH A;  1XMO K;  1VSI A;  4C8M A;  4Q5V A;  2QWO A;  5GAE P;  5F1X A;  3LZJ A;  1NKE A;  4H0P A;  3OHR A;  2AJQ A;  4CEZ A;  1WSJ A;  1JKH A;  4BR5 A;  1JCE A;  3OS1 A;  2W6K A;  3KZB A;  5HRO A;  3KK7 A;  1REV A;  1TKT A;  5J2M A;  3F9M A;  3KK3 A;  4O55 A;  4M3X A;  4BRC A;  3ENH A;  4NXM K;  4DTR A;  1WLJ A;  1I94 K;  1RT5 A;  4DV3 K;  2HF3 A;  3SUN A;  3UB5 A;  1BI4 A;  2KTQ A;  2QWR A;  4X64 K;  3RTV A;  4FYD A;  4DU4 A;  3D2F B;  5AQS A;  4WFB L;  1XC3 A;  3KD5 E;  5FRN A;  2Q3S A;  4BRA A;  4FO0 A;  1NGI A;  4I2P A;  2YNG A;  4JK7 A;  1VQ7 N;  1KFS A;  3OYI A;  4UY8 O;  4H5T A;  4B3S K;  5LMU K;  1EWR A;  2Y1I A;  2YI1 A;  3C6H A;  4GV6 A;  4JI0 K;  3O9Q A;  1Q81 O;  1BA0 A;  2CH5 A;  5TKY A;  3BZK A;  1NJI O;  3ZT1 A;  4B9N A;  1OKJ A;  2BE2 A;  1BGX T;  4H4O A;  4IG3 A;  1MA9 B;  3O1B A;  4WQ5 C;  3EKU A;  4BDY A;  1VQ5 N;  3NF9 A;  4EP4 A;  2F7T A;  2B5J A;  4DHY A;  4E7H A;  5AQW A;  3F2K A;  5SZT A;  1EX4 A;  3CQ8 A;  4CW7 B;  3U9Z A;  3V9W A;  4J2E A;  3HPG A;  3L8B A;  1RDB A;  4DTJ A;  2HNZ A;  3VEW A;  4FK4 A;  4FWO A;  1SL2 A;  4RW6 A;  1HNW K;  1FKO A;  3QO9 A;  3ZSR A;  2D0P A;  5JIC A;  2HHU A;  3NAE A;  3J7Y P;  1RT7 A;  5ADX A;  3NGZ A;  3PY8 A;  4GVE A;  2VG5 A;  3KLG A;  5HRP A;  1J5O A;  3TAQ A;  4CJL A;  3C0B A;  4HTU A;  4QS8 A;  4Y1D A;  3AA4 A;  3CJ7 A;  2PBD A;  1FKP A;  2BTF A;  1E4F T;  1IKX A;  1ZBL A;  3DJC A;  3E66 A;  3VGK A;  4B1Z A;  3O9U A;  4JKD A;  4CZK A;  4PQU A;  3OJS A;  4M7X A;  4AHR A;  4FJL A;  1YVU A;  5C42 A;  2ITG A;  3VEO A;  4JS4 A;  3EEQ A;  3O6W A;  4DV5 K;  5I3U A;  1R0A A;  4H0X B;  2GEM A;  2RHK A;  4CF2 A;  4GKK K;  4O44 A;  3DRS A;  4O0I A;  2P1J A;  3SPZ A;  1QVG M;  3O5B A;  3NVK A;  1FJG K;  3RMC A;  1X3N A;  4FPA A;  3S3O A;  3O9R A;  3QDK A;  4CF1 A;  3BY5 A;  4OVL A;  3QIO A;  4DTS A;  3EYZ A;  4B1U B;  3TSP A;  2GUI A;  3RRH A;  4KTZ A;  5KPZ A;  3V4I A;  1T44 A;  5CYM A;  4FWS A;  3LP2 A;  4DF8 A;  1RT3 A;  5DM7 L;  4TSX A;  3DLB A;  5FPE A;  1BIU A;  4YNQ A;  3ZEU A;  4PL7 A;  1CZB A;  4E7L A;  3LP0 A;  5FPM A;  3L0Q A;  4PKG A;  2VYP A;  4M41 A;  3OYK A;  2IOC A;  5F2R A;  3SAH A;  4YOY A;  3OTO K;  2RE2 A;  1VQ8 N;  1KAZ A;  4WYB A;  4PUO A;  3OYN A;  2YNI A;  3OVN A;  4DSK A;  2P5G A;  1YHQ N;  3A0I X;  4CK3 A;  4CFA A;  4DQP A;  1VSD A;  3E9O A;  3M8P A;  1DLO A;  2IAJ A;  1HPM A;  4CHO A;  1NMD A;  3O4W A;  3CJB A;  3NGI A;  3VQD A;  1TKX A;  1QTM A;  4C8O A;  1TK5 A;  2FBT A;  5KTQ A;  3AO3 A;  2VGN A;  4O8K A;  5C15 A;  3TAM A;  3P39 A;  3HPO A;  4CEO A;  3CC4 N;  3QEV A;  4B9L A;  2YHX A;  3CME N;  2NRH A;  2E5L K;  1W2B M;  2NRV A;  3B6O A;  1XC9 A;  4KTW A;  1NJX A;  2KZZ A;  1NGE A;  5AFU A;  3O3G A;  3BF1 A;  4CEC A;  5CY4 A;  5AQJ A;  5EX5 A;  1GOA A;  4FWQ A;  1C0T A;  3N4Q A;  4A5A A;  3HOT A;  1XHZ A;  3K0S A;  1LWE A;  1NOY A;  1C0F A;  4KO0 A;  2CH6 A;  3THY A;  2W42 A;  1XHX A;  5A2Q O;  4PA1 A;  2V52 B;  4K8Z A;  3MX2 A;  1BQM A;  2WFB A;  4BR4 A;  3M3Z A;  2QWN A;  3O80 A;  4Z4F A;  3U4L A;  1N33 K;  2OPR A;  4CJR A;  2HHQ A;  5AQK A;  1T7P A;  3UKU B;  3HBT A;  1LWC A;  4O8U A;  5C25 A;  4KAZ A;  5M1O A;  1GLF O;  1NGD A;  1RBT A;  3K58 A;  1NKC A;  2P51 A;  2O8E A;  2VG6 A;  4IWV A;  4HCB A;  4NLC A;  3I8B A;  3Q7B A;  3DYA A;  2UU9 K;  1NGC A;  3QET A;  4MLE A;  4IEI A;  1WB9 A;  3FZF A;  4YOW A;  5HL7 L;  5AZI B;  4JKB A;  5AQU A;  4F9O A;  4CHZ A;  4NXN K;  5BPL A;  1TGO A;  5JLH A;  1UWB A;  1S22 A;  1U04 A;  2G8F A;  4N41 A;  4KB1 A;  1RDW X;  2JGU A;  3GBT A;  4C1N I;  4EHU A;  3NE6 A;  1DKG D;  4J2B A;  4CJT A;  2Z1H A;  4FJJ A;  4CZE A;  2E2N A;  4WF9 L;  1BG3 A;  3I55 N;  1QZ5 A;  4ZTF A;  1GLA G;  3DLG A;  3LM2 A;  2OTL N;  1CZA N;  3D7E O;  4I9L A;  4ILH A;  3NHG A;  3HST B;  3AA2 A;  4BRH A;  4EIA A;  3AVA A;  4ISE A;  3L3U A;  4CER A;  2QA4 N;  1SKW A;  4CZH A;  1L3T A;  2NRW A;  3VF2 A;  1MWM A;  4OPJ A;  1U47 A;  3TAG A;  4Y0W A;  2NRR A;  1QQM A;  5AJ3 K;  4FSV A;  2E4L A;  4M7Y A;  4H03 B;  4AF1 A;  3VTH A;  4K41 A;  4BC5 A;  5AQQ A;  1VSF A;  1L3S A;  4DTP A;  1U2V B;  4C8N A;  2CGL A;  3LL3 A;  1ZBU A;  4H0T B;  5AQF A;  4YOX A;  5BRH A;  4CK2 A;  4CJS A;  2E20 A;  4FCY A;  4NCA A;  4IFV A;  1VQK N;  4BRD A;  1VSH A;  3OS0 A;  1NK0 A;  3HJF A;  5JLF A;  4IXC A;  1WSG A;  1OVQ A;  4LF6 K;  5AR0 A;  3GE1 A;  1NK8 A;  3CI5 A;  3PLA A;  4BE0 A;  2GUP A;  3ZSQ A;  4B3R K;  4BR0 A;  4NYF A;  1T6C A;  4G1Q A;  2ZJR L;  1KQS M;  4CJK A;  4BG8 A;  2DTU A;  4IDH A;  3MEG A;  2DFH A;  3E01 A;  3SI6 A;  4DB3 A;  4KRF A;  1X9M A;  3OYL A;  1TAU A;  3V9X A;  3RMD A;  1KTQ A;  3PO4 A;  4C8L A;  4JK9 A;  3F5T A;  1RTJ A;  3AVK A;  2I5J A;  5GIN A;  2VQF K;  5DM6 L;  4DTU A;  2VWK A;  4FJI A;  2DY4 A;  3AVB A;  1NK6 A;  4KHP K;  2P9S A;  1J9A A;  1C1A A;  4CHY A;  4JI8 K;  4CEQ A;  4CHQ A;  5J2N A;  3MMV A;  2IDO A;  1SQK A;  3AA5 X;  4JI3 K;  2P5O A;  1ASU A;  3LAL A;  3IG1 A;  2J4R A;  3K9K A;  3U6F A;  1Q86 O;  3TI0 A;  4IO9 L;  4BRE A;  3MWT A;  5M1K A;  4MO4 A;  1QVF M;  3EY1 A;  3CHW A;  3QIN A;  4Z4G A;  4U67 L;  2F8S A;  3SUP A;  3K59 A;  1N8R O;  1BA1 A;  3CCE N;  3CCU N;  3J7A P;  1YJN N;  4FL9 A;  3MCA B;  1ASV A;  4LFB K;  3G25 A;  1F21 A;  4FWM A;  1NK7 A;  2A41 A;  1OVY A;  4BRM A;  3KWG A;  3NDK A;  3HK2 A;  1KXP A;  4EZ9 A;  1HKB A;  4NCB A;  4B8A B;  1TKZ A;  3O4Q A;  1ZBS A;  4JRP A;  2VWB A;  4GVM A;  5AQM A;  1G99 A;  4IOX A;  3ZSV A;  4NYN A;  4DU1 A;  5IWA K;  3RSE A;  3WNG A;  1RTD A;  1VQ9 N;  2HMP A;  2O8D A;  2HB5 A;  4FM0 A;  1WNS A;  3KIO A;  5FDL A;  3KLE A;  5I42 A;  4O4G A;  4CZJ A;  3NF6 A;  1VQ4 N;  4DSI A;  2KKZ A;  3CM5 A;  5E41 A;  1VQL N;  4JEP A;  4B08 A;  3MXI A;  1HYS A;  2RN2 A;  2Q97 A;  4KRE A;  4I6M B;  4FJX A;  1MWK A;  4LC9 B;  4H5R A;  1RDU A;  5C2D A;  3PIO L;  4KB0 A;  3GOI A;  1N34 K;  3ENB A;  4LY7 A;  3WQT A;  5KRS A;  4A61 A;  1ZC6 A;  4KHU A;  2IC3 A;  2FXU A;  3KLI A;  2QWP A;  1TL3 A;  3VQ5 A;  3C6A A;  1WBB A;  2ATQ A;  4CBU A;  1YJ9 N;  4HHT A;  3WXM B;  3KLH A;  2VQE K;  4B9T A;  2ZGY A;  1FK9 A;  2QXF A;  3DXK A;  3HTV A;  4KKO A;  4KI4 A;  1XQS C;  1JJ2 M;  1NGJ A;  2A42 A;  2P9P A;  3UIQ A;  1GLE G;  1UA1 A;  3PIP L;  2HHX A;  2QWL A;  4M3T A;  3ID8 A;  2OAN A;  4DS4 A;  5SWM A;  3PSI A;  4M3R A;  4K43 A;  4WCE L;  3MN6 A;  1HNZ K;  1ZBF A;  2QK9 A;  3THX A;  2KLA A;  4Z0U A;  1U49 A;  2HHV A;  3EO3 A;  3WNF A;  1SKR A;  1WSH A;  5J2Q A;  3D2E B;  3C65 A;  1WSE A;  3HL8 A;  3M8Q A;  3NFA A;  3QML A;  3WXJ A;  4I7F A;  4CIE A;  3LZI A;  4BR2 A;  5AQR A;  4DUZ K;  4HTL A;  4DS5 A;  2P9N B;  4LF4 K;  3ZSW A;  1ATR A;  3DRP A;  1IKV A;  3WEE A;  4JKG B;  3QBX A;  3V81 A;  3S41 A;  4CF9 A;  1K9M O;  3ZCM A;  1WN7 A;  2H3G X;  3VQE A;  3VOV A;  3IKM A;  3ULE B;  4CJU A;  2X74 A;  1S9G A;  4ICL A;  2YNF A;  3KWI A;  3T69 A;  3P5J A;  1NJZ A;  5BPM A;  3V9U A;  1NK5 A;  3OYB A;  4DTN A;  3NH1 A;  2P9U B;  5EY4 A;  4CES A;  2Q36 A;  3R9P A;  1O1W A;  1DTQ A;  5FRO A;  4A59 A;  4X62 K;  3AY9 A;  4A62 A;  3HRG A;  2PZS A;  4FLY A;  5BN9 A;  4AHU A;  1GOC A;  4XH1 A;  4CI6 A;  3HP9 A;  3OYG A;  4C8K A;  4WE1 A;  4LF7 K;  3QFP A;  4LSN A;  2O8C A;  3L4I A;  1JLQ A;  3S3N A;  2WBN A;  3DI6 A;  3QIP A;  3HSC A;  1HJO A;  5E84 A;  4CEB A;  3NH2 A;  3PX0 A;  4BRG A;  2FLO A;  3O08 A;  3I33 A;  1GLC G;  5KPR A;  1TK0 A;  4FJ8 A;  3THW A;  3NGY A;  3G4S N;  1GLJ O;  1GLD G;  4B3T K;  1TK8 A;  4H8K A;  3RVC A;  3UKU A;  4FOI A;  4CGI A;  2FSJ A;  2KFZ A;  2G8U A;  5AZJ A;  5F0X A;  3M8S A;  4MQ3 A;  3A2F A;  2QWM A;  4YOR A;  1L5U A;  3NF7 A;  3ZT3 A;  5JVG L;  1RCH A;  1YVN A;  3U3Y A;  4DCH A;  3R1X A;  3MDQ A;  5JS1 A;  3SNN A;  1X9S A;  1GLB G;  1LAV A;  2HBM A;  4DV2 K;  4FM2 A;  3AGR A;  3AVJ A;  2BAN A;  4DSE A;  2NRZ A;  2DFF A;  2Q0U A;  3RRG A;  3HT3 A;  3IAY A;  3AVI A;  1BWF O;  1RFQ A;  1T03 A;  1X1P A;  4JLH A;  1HRH A;  5KRT A;  4KHS A;  2WTU A;  5K14 A;  1NGA A;  2OPS A;  1S72 N;  1LWF A;  1C1C A;  4CZM A;  3LDP A;  1E4G T;  1CXU A;  4AHS A;  4KTQ A;  3NCI A;  3CCM N;  1HYZ A;  2E8A A;  4E7I A;  2O4I A;  2EHG A;  2P9K A;  2GEL A;  3EZW A;  3ZSO A;  1VQ6 N;  3QFU A;  3AVF A;  4FJM A;  1SUQ A;  3MN9 A;  4BAC A;  3HXM A;  1TYQ A;  4H5W A;  4JI5 K;  3ZET B;  4V19 S;  3RWU A;  1S3X A;  4FJN A;  1QSY A;  3ZT0 A;  3K9J A;  1H1V A;  3T1A A;  1RGI A;  1JLB A;  3WXK A;  1D9F A;  3QES A;  1NNE A;  3C7N A;  4FWP A;  3TAP A;  4A57 A;  2A1S A;  3OY9 A;  3Q7C A;  3LWL A;  3CCQ N;  3J81 O;  5ADX H;  4IKF A;  2BGG A;  1D9D A;  1LCU A;  4BE1 A;  2JWL A;  4OKK A;  3B6P A;  4BRP A;  4FZX C;  4KHQ A;  4FZY A;  1B92 A;  1TV6 A;  3LDQ A;  2QTD A;  3A5N C;  4BG9 A;  3TTF A;  3W0L A;  3L2W A;  4LH4 A;  3DXM B;  5TKW A;  1BIS A;  3ALY A;  1DGK N;  3G10 A;  1VQN N;  3FFK B;  3SBT A;  1S1X A;  1HPZ A;  4JD2 A;  2ZJP L;  4M3U A;  3VN5 A;  2YHY A;  5LJV A;  3M1F A;  3I56 N;  5C10 A;  2HF4 A;  5FRM A;  4FK2 A;  3ZSZ A;  2P9L A;  1Z6R A;  5AQO A;  1J5E K;  2F9T A;  5BR8 K;  3D45 A;  4CJF A;  4DV1 K;  2IS3 A;  2UYT A;  3NF8 A;  1K8K B;  5HP1 A;  4HUG A;  3QEP A;  3DAW A;  3H1Q A;  1I39 A;  1JCG A;  2FF6 A;  4O5B A;  3ISN C;  3CCJ N;  2PFU A;  3QBW A;  3VEZ A;  3K5M A;  4FLX A;  4DV4 K;  3SZ2 A;  1WBD A;  3VMF B;  1S9E A;  3H45 C;  4K25 A;  5C12 A;  5GAD P;  4PKI A;  3T3F A;  5ELZ A;  5AQZ A;  4IDK A;  4B9U A;  5AQG A;  2GX9 A;  2HVH A;  2O8B A;  2GTD A;  1LAW A;  4I9Q A;  4F2R A;  4XH4 A;  3U8X A;  1NM1 A;  4CF8 A;  5BRF A;  4WQ5 A;  1VSJ A;  3CCS N;  4JKC A;  3H08 A;  1I3A A;  4CEF A;  1S1W A;  3SK3 A;  4IEE A;  2DFE A;  4LSL A;  3VES A;  1D8Y A;  1EXQ A;  1KRP A;  3QB0 A;  3CCR N;  4DUY K;  1VRT A;  4ILG B;  3ZT4 A;  4OLA A;  4KHW A;  5LMN K;  2G8K A;  4ID1 A;  3H1V X;  3CYM A;  4CZF A;  3OYD A;  3U3G A;  1SL1 A;  1JXE A;  1HNV A;  1D4X A;  3ZX0 A;  3QEW A;  2WUS A;  4CBW A;  3TTC A;  1XNR K;  3AVL A;  1ESV A;  3EE8 A;  3EZ5 A;  2O8F A;  3AVH A;  4DU3 A;  1W0H A;  4QOZ B;  1KVA A;  1HKG A;  1IKY A;  1EWQ A;  4DR3 K;  1CZ9 A;  5J2P A;  3I8D A;  1FW6 A;  4MLH A;  1OH6 A;  5M1P A;  2YKM A;  5AFU H;  1BI4 B;  4CD3 A;  1ILY A;  5M1F A;  4N5S A;  1S1T A;  3CQX A;  5AQX A;  3OS2 A;  4JI2 K;  4OX9 K;  4Z4E A;  2PYJ A;  2RPI A;  4FM1 A;  1ASW A;  4LF9 K;  1SL0 A;  4CZG A;  1HQU A;  2KQ2 A;  1VSL A;  3T1Y K;  1LV5 A;  2ZM6 K;  3TPQ A;  4DMN A;  4M3W A;  3O3H A;  4KBO A;  3ASM A;  4FLZ A;  3CC7 N;  3EE9 A;  3P4I A;  1IG8 A;  4FWL A;  5LJW A;  3CC2 N;  3HO1 A;  3AAR A;  2GWJ A;  4QAG A;  3FZH A;  4AHC A;  4HVJ A;  3K5O A;  1BCO A;  1XI1 A;  2ETJ A;  4DV7 K;  2IIR A;  3FR0 A;  2Q2R A;  4CGJ A;  1UOC A;  2R7Y A;  4YOU A;  5EOY A;  4LD0 A;  2G8H A;  5LL6 Z;  3U9D A;  3O8M A;  1L3V A;  1S1U A;  3SAG A;  4K8X A;  2QWQ A;  4YDU C;  2I7P A;  2P9I A;  4AHT A;  2VWJ A;  4CF0 A;  4FLU A;  3LDN A;  1EET A;  2KZM A;  3SBG A;  1Z26 A;  4EHT A;  1RT2 A;  2HBL A;  4RWT A;  3A5M C;  3LAN A;  4JI6 K;  3RMB A;  3EN9 A;  4JHD A;  4W5N A;  3ZYY X;  2HBK A;  3E1Y A;  3CM6 A;  4DV6 K;  1C6V A;  5T7B A;  1X9W A;  3T7Z A;  3OYM A;  3WNH A;  1A5X A;  4K42 A;  1TUY A;  5AQV A;  3GL1 A;  4WFA L;  1S1V A;  3DOK A;  4YOT A;  2QKB A;  1K8A O;  4BWJ A;  3IMX A;  4BR7 A;  3SMS A;  4IJN A;  3HOS A;  1QQN A;  4ZHR A;  3ZT2 A;  4KH4 A;  4OKJ A;  4CJW A;  1WUA A;  3VA0 A;  5MLC Q;  1SS6 A;  1KC8 O;  1VRU A;  4J2D A;  4B9S A;  3JXU A;  2UXB K;  1NK4 A;  2WC9 A;  4W5O A;  2KHO A;  2EX3 A;  1RBS A;  4CJ7 A;  4DQI A;  3ZEU B;  4B8C A;  1JXB A;  3FE1 A;  4C23 A;  3MEC A;  4X65 K;  1JLG A;  2E88 A;  2PY5 A;  1WSI A;  1P8Z A;  4BGA A;  2D4W A;  4JKA A;  1D5A A;  5GIP A;  1N5Y A;  3OYA A;  4H4M A;  3D2F A;  3VEX A;  1BQN A;  4CHP A;  3ZX3 A;  1VK0 A;  4GKJ K;  3KHY A;  2O4G A;  3KTQ A;  3AV9 A;  4FJH A;  2FC0 A;  3SQ4 A;  3A5O C;  1KD1 O;  4ELT A;  2E2O A;  1JLF A;  4YOV A;  1BUP A;  1RT1 A;  2A1R A;  4L3Q A;  3TAR A;  1J53 A;  3FZL A;  1ATS A;  4Z4I A;  2Y1J A;  4DTM A;  4ELV A;  5KGW A;  3SQ2 A;  3S3M A;  3O3F A;  3CPW M;  4Q0B A;  1G15 A;  2E6M A;  3O1W A;  5D3G A;  3BGR A;  3CER A;  3H46 O;  3TSQ A;  4DQS A;  2FBX A;  3DOL A;  5M1N A;  1UA0 A;  1NWK A;  1RTI A;  3O4N A;  1IJJ A;  4MDB A;  3MWP A;  5AQH A;  4EP5 A;  4JI7 K;  4JI1 K;  2B6A A;  1KVB A;  5KGX A;  4B1W B;  5HRN A;  1RNH A;  3VQ8 A;  3G71 N;  4JN4 A;  2IVN A;  3THY B;  4BWM A;  1EP4 A;  4YDU A;  3VEY A;  3LP3 A;  3HM9 A;  2OCE A;  4Z4C A;  3AO1 A;  4JYA K;  2D5R A;  2D0O A;  3AVG A;  2D0A A;  4FLW A;  3KK1 A;  2E6L A;  4NO7 A;  4E89 A;  3AO4 A;  4FW2 A;  3VQ4 A;  3SLC A;  1W7A A;  3SJJ A;  1QQO A;  4AM7 A;  1V4T A;  2ZE2 A;  3CJC A;  1K6Y A;  4KHN A;  4H5N A;  1JL1 A;  2ZWH A;  1IG9 A;  4MO5 A;  4E3S A;  4L8R B;  1X9J A;  5AQY A;  4B1V A;  2FBY A;  4FJ7 A;  1E3M A;  4AM6 A;  2O8E B;  5FPN A;  3OYE A;  4AQY K;  4ZTJ A;  4HWI A;  2W6L A;  4CJQ A;  2A3Z A;  5J1E A;  1VQP N;  3UKR B;  2QXL A;  3WXL A;  3AAP A;  5AQN A;  5HLF A;  2QKK A;  4OJR A;  4RTF D;  2F96 A;  4JNE A;  2OPQ A;  3M5R A;  1YT3 A;  3O9T A;  2A6A A;  2EWS A;  4U7B A;  2D1K A;  2E2P A;  3SUQ A;  1NKB A;  5C2F A;  1IBL K;  1N36 K;  3RR8 A;  3VEV A;  1HYV A;  4M42 A;  3OYC A;  4CFD A;  5HOO A;  3VQ6 A;  2VGM A;  3TWH A;  1MU2 A;  4FVM A;  4RW9 A;  4ID5 A;  2NNW A;  4K0K K;  2XY8 A;  3NH0 A;  5C0Y A;  5AQL A;  1KLN A;  4GV3 A;  4I2Q A;  1VQO N;  1VSK A;  1RBR A;  4DR1 K;  1HNI A;  4NCG A;  4JI4 K;  2FSK A;  3CFP A;  3F73 A;  3J7Z O;  4AIL C;  4CGH A;  2ASP A;  3AVN A;  3RR7 A;  3DMJ A;  5GAG P;  3SV3 A;  3SYZ A;  1CLQ A;  4BRL A;  2HHW A;  4CE9 A;  3V9S A;  3SQ1 A;  3PO5 A;  3LDL A;  2AA4 A;  4IBN A;  4XH5 A;  1TL1 A;  1EO1 A;  3MAQ A;  3VPZ A;  4FJK A;  1ZXO A;  4FWR A;  5IT9 O;  4IZ9 A;  2D0B A;  2YKN A;  3HP6 A;  3VGL A;  2KW4 A;  4DR2 K;  3AO5 A;  3MN7 A;  3PX6 A;  2ZGZ A;  3AVM A;  1NMN A;  2E1Z A;  5C24 A;  5DK5 A;  3ZX2 A;  4FWN A;  2HVI A;  1VSE A;  3R6M A;  4KH5 A;  3WXI A;  3TSU A;  2BH1 A;  1OH8 A;  4CIF A;  4E1M A;  3OA9 A;  2XY6 A;  2W41 A;  4R79 A;  4F3T A;  4QCL A;  3LPT A;  2F9W A;  3JS6 A;  2UUA K;  4FK0 A;  3PUF A;  3V1R A;  4LF5 K;  3VF4 A;  3QNO A;  3TR8 A;  3CF5 L;  2KFN A;  3IUC A;  4OPK A;  2YJE A;  3ATV A;  3LDS A;  2F8T A;  1NGH A;  3DLL L;  2PYL A;  3J80 O;  1VSM A;  2OZS A;  3SCX A;  3F9K A;  2P9S B;  1HUX A;  3C6U A;  4CCH A;  1NK9 A;  1RBV A;  2DPN A;  3IFR A;  3MN5 A;  3CFR A;  1RDC A;  4JKE A;  4B3O A;  2HND A;  3FLC O;  4OGC A;  3CG7 A;  3K5L A;  4RG8 A;  3C6T A;  5BPN A;  2ASO A;  4IOC L;  4DR7 K;  1Y97 A;  5AZI A;  4H0O A;  2FBV A;  5HRR A;  2X6S A;  1RBU A;  1SZ2 A;  4B1Y B;  1M90 O;  1R59 O;  4BVO A;  3K5N A;  3LAM A;  4A2A A;  2ZQB A;  3EL2 A;  1T3V A;  3DLH A;  3MCP A;  4JAX A;  3E9P A; 
#chains in the Genus database with same CATH homology
 3U3G A;  1RTH A;  1SL1 A;  1JXE A;  4BE0 A;  1HNV A;  1L3U A;  3MXJ A;  3I0R A;  4CGD A;  3ZSQ A;  3QEW A;  3CFO A;  3K57 A;  1U45 A;  1JLA A;  4NYF A;  4G1Q A;  2OYQ A;  1YTU A;  4AH9 A;  3K2P A;  3LAK A;  3AVL A;  3C95 A;  3LPU A;  4CFC A;  4CIG A;  4CJK A;  3EZ5 A;  1B9D A;  1TAQ A;  3AVC A;  3AVH A;  3MEG A;  1W0H A;  4DU3 A;  4KPY A;  2DFH A;  4QOZ B;  1KVA A;  3E01 A;  2JLE A;  2GV9 A;  3SI6 A;  1IKY A;  5CYQ A;  2XHB A;  4F2S A;  1CZ9 A;  4DSF A;  3KLF A;  3I8D A;  5J2P A;  1BL3 A;  1IH7 A;  1LW2 A;  2NUB A;  2YKM A;  1BI4 B;  3PV8 A;  4FJI A;  4KRF A;  1WSF A;  4BE2 A;  2DY4 A;  1X9M A;  4N5S A;  3OYL A;  1S1T A;  4BDZ A;  2KZZ A;  1N6Q A;  1TAU A;  3V9X A;  1KCF A;  1KTQ A;  3RMD A;  4B9V A;  3PO4 A;  3OS2 A;  4C8L A;  2IGI A;  3AVK A;  1RTJ A;  4BDP A;  2I5J A;  4Z4E A;  2XRI A;  2PYJ A;  4FJG A;  2RPI A;  2VWK A;  4FM1 A;  1ASW A;  3AVB A;  3VQP A;  5DMR A;  3IRX A;  4DTU A;  1SL0 A;  1NK6 A;  1J9A A;  1RIL A;  4DQR A;  4IFY A;  1C1A A;  1HJR A;  1HQU A;  3SV4 A;  2G8V A;  3KK2 A;  1SV5 A;  4CHY A;  1JLE A;  1RT6 A;  2KQ2 A;  4CEQ A;  4CHQ A;  5J2N A;  2IDO A;  1VSL A;  3VQQ A;  4CEA A;  3HVR A;  4IG0 A;  3AA5 X;  4DLE A;  1LV5 A;  2P5O A;  4DMN A;  1ASU A;  3P83 D;  5HRS A;  4M3W A;  3O3H A;  4CEE A;  3LAL A;  1YTA A;  3IG1 A;  3U6F A;  3ASM A;  4FLZ A;  4LH5 A;  1HQE A;  3TI0 A;  1ZBH A;  2G8I A;  4DFK A;  4KHY A;  3QEX A;  4PWD A;  3TAB A;  3EY1 A;  2WON A;  3DLR A;  2G8W A;  3HO1 A;  3QIN A;  4QAG A;  1BIZ A;  4E0D A;  4Z4G A;  4CK1 A;  2VG7 A;  1RDA A;  3SUP A;  4AHC A;  4HVJ A;  3K5O A;  2F8S A;  1BCO A;  1XI1 A;  2Z1J A;  2ETJ A;  2GBZ A;  3K59 A;  3V9Z A;  4CJE A;  1VSI A;  4CGJ A;  4C8M A;  4OKE A;  1UOC A;  4Q5V A;  3LZJ A;  1NKE A;  2R7Y A;  1T05 A;  2AJQ A;  1ASV A;  2X78 A;  4CEZ A;  1WSJ A;  4LD0 A;  2G8H A;  1F21 A;  1JKH A;  1NJZ A;  3OS1 A;  1NK7 A;  5HRO A;  1L3V A;  1REV A;  1TKT A;  5J2M A;  1S1U A;  3KK3 A;  3NDK A;  3HK2 A;  4K8X A;  4O55 A;  3L2U A;  4M3X A;  4EZ9 A;  4DTR A;  4NCB A;  1WLJ A;  4B8A B;  1Q9X A;  3SPY A;  1TKZ A;  1RT5 A;  3O4Q A;  4AHT A;  2VWJ A;  3SUN A;  4CF0 A;  4FLU A;  4JRP A;  1EET A;  4GVM A;  2KZM A;  1BCM A;  1Z26 A;  4UQG A;  2YHA A;  1B9F A;  3OYF A;  1BI4 A;  1WAJ A;  3ZSV A;  2KTQ A;  1RT2 A;  4NYN A;  3RTV A;  1QE1 A;  4DU4 A;  4FYD A;  3LAN A;  4DU1 A;  3RMB A;  3KD5 E;  5FRN A;  3WNG A;  5HBM A;  2Q3S A;  1S5J A;  1RTD A;  3DLH A;  4W5N A;  3SUO A;  4I2P A;  2YNG A;  3CM6 A;  2HB5 A;  1C6V A;  2OZM A;  3SQ0 A;  5T7B A;  3OYI A;  2XO7 A;  1QSL A;  1KFS A;  4DFP A;  1X9W A;  1CLQ A;  4FM0 A;  1WNS A;  3KIO A;  3OYM A;  5FDL A;  3KLE A;  3FFI A;  3WNH A;  5I42 A;  4O4G A;  1A5X A;  3NF6 A;  1T8E A;  3AO2 A;  2Y1I A;  4DSI A;  3DLE A;  3CM5 A;  5E41 A;  4B08 A;  3MXI A;  3L2V A;  1S1V A;  3DOK A;  1HYS A;  2RN2 A;  4XIU A;  2QKB A;  2HMI A;  4KRE A;  2ZD1 A;  3L2Q A;  4FJX A;  4BWJ A;  3JSM A;  4B9N A;  3ZT1 A;  2BE2 A;  1BGX T;  4ZHR A;  4H4O A;  3ZT2 A;  4KB0 A;  4IG3 A;  4CJV A;  4LY7 A;  4OKJ A;  4Y1C A;  4CJW A;  4E19 A;  4FLT A;  3RMA A;  1WAF A;  5KRS A;  4BDY A;  3NF9 A;  4EP4 A;  4FJ9 A;  1BHL A;  4KHU A;  3VA0 A;  2IC3 A;  1LW0 A;  4CJ5 A;  3ULD A;  2B5J A;  1VRU A;  4OLB A;  3KLI A;  4E7H A;  4J2D A;  1TL3 A;  3VQ5 A;  4MFB A;  1S6P A;  5SZT A;  4JRQ A;  4B9S A;  1EX4 A;  2ATQ A;  3CQ8 A;  3V9W A;  4J2E A;  3HPG A;  3L8B A;  1RDB A;  4HHT A;  4DTJ A;  4W5O A;  4AHV A;  1FXX A;  1XWL A;  2HNZ A;  1NK4 A;  3KLH A;  3KKR A;  4FK4 A;  1SL2 A;  4B9T A;  2EX3 A;  4DQQ A;  1FK9 A;  2QXF A;  4RW6 A;  1RBS A;  4DQI A;  4PY5 A;  4KKO A;  4B8C A;  4KI4 A;  1JXB A;  1FKO A;  3QO9 A;  3ZSR A;  3UIQ A;  3T19 A;  2HHU A;  3NAE A;  4W5T A;  1UA1 A;  1RT7 A;  3MEC A;  3NGZ A;  3VA3 A;  4KFB A;  5CZ2 A;  3PY8 A;  4FLV A;  2HHX A;  1JLG A;  2VG5 A;  2PY5 A;  4M3T A;  1WSI A;  4DS4 A;  5SWM A;  1D5A A;  3KLG A;  5HRP A;  1N5Y A;  4M3R A;  3OYA A;  4H4M A;  1J5O A;  3TAQ A;  4CJL A;  1TKD A;  1ZBF A;  2QK9 A;  1BQN A;  3VQ7 A;  4HTU A;  4DSJ A;  4CHP A;  4FW1 A;  4Y1D A;  4Z0U A;  1U49 A;  3AA4 A;  2HHV A;  2HHW A;  1VK0 A;  1FKP A;  3WNF A;  1QSS A;  1SKR A;  1WSH A;  5J2Q A;  4EZ6 A;  2O4G A;  1IKX A;  3KTQ A;  3AV9 A;  3HL8 A;  1WSE A;  3M8Q A;  3NFA A;  1ZBL A;  4CIE A;  2FC0 A;  4I7F A;  5EU7 A;  4FJH A;  3LZI A;  4DS5 A;  3SQ4 A;  1RT4 A;  3KKS A;  4E7K A;  3MXM A;  4ELT A;  4PQU A;  1QS4 A;  3ZSW A;  1JLF A;  3OJS A;  4AHR A;  4CHN A;  4FJL A;  1YVU A;  3DRP A;  1IKV A;  5C42 A;  2ITG A;  1RT1 A;  4JS4 A;  4W5R A;  2A1R A;  3TAR A;  1J53 A;  3V81 A;  4DTX A;  5I3U A;  1R0A A;  4Z4I A;  4CF2 A;  4F8R A;  4FZZ A;  4CF9 A;  4O44 A;  5CZ1 A;  1WN7 A;  3DRS A;  3ZCM A;  4O0I A;  3VQE A;  2P1J A;  3SPZ A;  4CFB A;  2Y1J A;  4CJU A;  2X74 A;  4DTM A;  1S9G A;  1U4B A;  1U48 A;  4ELV A;  4ICL A;  5KGW A;  2YNF A;  3SQ2 A;  3RMC A;  3S3O A;  3O3F A;  3S3M A;  3P5J A;  4CF1 A;  1G15 A;  2E6M A;  4OVL A;  4DG1 A;  3V9U A;  3BGR A;  3QIO A;  4DTS A;  1NK5 A;  5D3G A;  3EYZ A;  4DQS A;  3OYB A;  1NOZ A;  4HCC A;  4DTN A;  2FBX A;  3NH1 A;  3DOL A;  4FXD A;  2GUI A;  3RRH A;  1ZYQ A;  1UA0 A;  4KTZ A;  1RTI A;  3V4I A;  4CES A;  3O4N A;  5CYM A;  3DRR A;  1O1W A;  4KI6 A;  4EP5 A;  1DTQ A;  3LP2 A;  5FRO A;  2B6A A;  4DF8 A;  1KVB A;  5KGX A;  1RT3 A;  2PZS A;  1J54 A;  4TSX A;  3DLB A;  4FLY A;  1BIU A;  3LP1 A;  5HRN A;  1RNH A;  4YNQ A;  3NBP A;  1CZB A;  3VQ8 A;  3JYT A;  4AHU A;  4CGG A;  4E7L A;  1GOC A;  3LP0 A;  1SKS A;  3HP9 A;  3OYG A;  4DLG A;  4C8K A;  4WE1 A;  4M3Y A;  4BWM A;  1EP4 A;  4LSN A;  3OYK A;  3LP3 A;  4M41 A;  3L2R A;  2IOC A;  4OGE A;  3HM9 A;  3D0P A;  4Z4C A;  3AO1 A;  2D5R A;  1JLQ A;  3AVG A;  2D0A A;  4FLW A;  3KK1 A;  3S3N A;  2E6L A;  3AA3 A;  3DI6 A;  3I0S A;  3QIP A;  4E89 A;  3AO4 A;  1KVC A;  4PUO A;  4CEB A;  4FW2 A;  3VQ4 A;  1JL2 A;  3NH2 A;  3M8R A;  3OYN A;  2YNI A;  3OVN A;  4DTO A;  3PX0 A;  2DTU A;  4DSK A;  2P5G A;  3SJJ A;  4RW7 A;  4CK3 A;  1GOB A;  4CFA A;  1TK0 A;  4DQP A;  4FJ8 A;  1VSD A;  3NGY A;  1IO2 A;  1C1B A;  1DLO A;  2ZE2 A;  2IAJ A;  3M8P A;  1TK8 A;  4M3Z A;  4H8K A;  1K6Y A;  4CHO A;  4KHN A;  1JL1 A;  4CGI A;  1IG9 A;  2KFZ A;  2G8U A;  3TAF A;  3NGI A;  4E1N A;  4E3S A;  3VQD A;  4L8R B;  3OYH A;  1TKX A;  2HHS A;  1QTM A;  3M8S A;  4DF4 A;  1TK5 A;  4MQ3 A;  2FBT A;  4C8O A;  4DSL A;  2FBY A;  3A2F A;  4FJ7 A;  1QQC A;  5KTQ A;  1L5U A;  3NF7 A;  3AO3 A;  3OYE A;  4ZTJ A;  3TAM A;  4CJQ A;  3LWM A;  3ZT3 A;  3HPO A;  1RCH A;  5J1E A;  4CEO A;  4M45 A;  3L3V A;  3DLK A;  3U3Y A;  3QEV A;  1A5V A;  3DM2 A;  4B9L A;  5JS1 A;  3SNN A;  1X9S A;  3HPH A;  3HVT A;  5HLF A;  1LAV A;  2QKK A;  2B4J A;  4OJR A;  4FM2 A;  2F96 A;  1CXQ A;  3OJU A;  4B9M A;  3AVJ A;  1Z25 A;  2OPQ A;  3IS9 A;  1YT3 A;  2BAN A;  4RW4 A;  4HUF A;  4J2A A;  4DSE A;  3SUQ A;  1NKB A;  2RKI A;  2DFF A;  3B6O A;  2LSN A;  3RRG A;  3HT3 A;  1XC9 A;  4KTW A;  1NJX A;  3IAY A;  1UAX A;  3AVI A;  4N56 A;  4JS5 A;  3V1O A;  1T03 A;  3O3G A;  4CEC A;  1HYV A;  1X1P A;  3RR8 A;  3QEI A;  4JLH A;  1HRH A;  3ZSY A;  5KRT A;  4M42 A;  4KHS A;  3OYC A;  5CY4 A;  5K14 A;  4N47 A;  4CFD A;  2OPS A;  3VQ6 A;  1LWF A;  1C1C A;  1GOA A;  1CXU A;  4AHS A;  1JLC A;  3NCI A;  3TWH A;  1C0T A;  1HYZ A;  1MU2 A;  2OA8 A;  4KTQ A;  4FVM A;  4RW9 A;  4E7I A;  2O4I A;  2EHG A;  4ID5 A;  1XHZ A;  1LWE A;  2XY8 A;  3NH0 A;  4KO0 A;  3ZSO A;  3TAN A;  1NOY A;  2OPP A;  2XY7 A;  5JS2 A;  3QER A;  3AVF A;  1KLN A;  4FJM A;  4DFJ A;  1SUQ A;  2Z1I A;  4BAC A;  2W42 A;  4I2Q A;  1XHX A;  4GMJ B;  4PA1 A;  3HXM A;  4K8Z A;  1VSK A;  1BQM A;  4Z4F A;  1RBR A;  1HNI A;  4NCG A;  3RWU A;  4ELU A;  4F4K A;  2OPR A;  4GW6 A;  4CJR A;  4FJN A;  2HHQ A;  1QSY A;  3CFP A;  1T7P A;  3ZT0 A;  3MEE A;  3F73 A;  3T1A A;  1LWC A;  4CGF A;  4AIL C;  4CGH A;  1JLB A;  3VQA A;  5C25 A;  1HMV A;  1D9F A;  4KAZ A;  3QES A;  3AVN A;  3RR7 A;  1ZBI A;  3DMJ A;  3TAP A;  4KV8 A;  2A1S A;  1RBT A;  3V1Q A;  4CJ3 A;  3OY9 A;  3KJV A;  3LWL A;  3K58 A;  3SV3 A;  2D0C A;  2P51 A;  2Z1G A;  3SYZ A;  3V6D A;  4CE9 A;  1D9D A;  3V9S A;  4FJ5 A;  4IKF A;  2BGG A;  4BE1 A;  3SQ1 A;  2XY5 A;  2YHB A;  3PO5 A;  2VG6 A;  3VQB A;  5KI6 A;  4OKK A;  4HCB A;  3B6P A;  1C0U A;  4IBN A;  1TL1 A;  4FZX C;  4KHQ A;  3MAQ A;  4FJK A;  4FZY A;  3TAE A;  4CJP A;  4DFM A;  1B92 A;  3DYA A;  1TV6 A;  4YFU A;  2YV0 X;  2D0B A;  2YKN A;  3QET A;  3THV A;  1KLM A;  3VQ9 A;  4CED A;  3HP6 A;  3L2W A;  4LH4 A;  2KW4 A;  1KSP A;  1KFD A;  3AO5 A;  3PX6 A;  2HW3 A;  1BIS A;  1Q8I A;  3ALY A;  3AVM A;  3G10 A;  1NKC A;  4CHZ A;  2WOM A;  1S1X A;  5C24 A;  3BDP A;  5DK5 A;  1HPZ A;  4M3U A;  1TGO A;  1UWB A;  3VN5 A;  1U04 A;  2G8F A;  4DWI A;  4N41 A;  2HVI A;  4KB1 A;  2JGU A;  1VSE A;  4CJ4 A;  3NE6 A;  3P1G A;  4J2B A;  4CJT A;  2Z1H A;  3HYF A;  4FJJ A;  3MED A;  5FRM A;  4FK2 A;  3ZSZ A;  2HHT A;  2RF2 A;  4CIF A;  4E1M A;  3WNE A;  4ZTF A;  3OYJ A;  2XY6 A;  1S6Q A;  3DLG A;  4F3T A;  4QCL A;  3LPT A;  3D45 A;  4I9L A;  3VQC A;  4CJF A;  3NHG A;  3PX4 A;  2IS3 A;  3C94 A;  3HST B;  3AA2 A;  3NF8 A;  5HP1 A;  1EKE A;  2HNY A;  4FK0 A;  4HUG A;  3PUF A;  3QEP A;  3AVA A;  1NJW A;  1I39 A;  1IKW A;  3L3U A;  3V1R A;  4CER A;  4O5B A;  4Z4H A;  3QNO A;  3TR8 A;  3ISN C;  1SKW A;  1L3T A;  1C0M A;  2KFN A;  3K5M A;  4OPJ A;  4OPK A;  1U47 A;  3LDS A;  4E7J A;  4W5Q A;  2F8T A;  4FLX A;  4R5P A;  2PYL A;  4HUE A;  3TAG A;  3SZ2 A;  1VSM A;  2OZS A;  3SCX A;  2YNH A;  1NJY A;  1RDD A;  1S9E A;  3F9K A;  2E4L A;  1Q9Y A;  3C6U A;  3ITH A;  4CCH A;  4F3O A;  3G0Z A;  1NK9 A;  3T3F A;  1RBV A;  4RW8 A;  3CFR A;  1RDC A;  4IDK A;  4B3O A;  4B9U A;  1A5W A;  2HND A;  2HVH A;  1QHT A;  1VSF A;  1LAW A;  1NK8 A;  4F2R A;  4I9Q A;  4OGC A;  1L3S A;  1DTT A;  3CG7 A;  4DTP A;  3K5L A;  4RG8 A;  3C6T A;  4C8N A;  3KD1 E;  4CF8 A;  1ZBU A;  1VSJ A;  1W9H A;  3QLH A;  1Y97 A;  4CK2 A;  1TVR A;  3H08 A;  1I3A A;  4CJS A;  4CEF A;  1S1W A;  2FBV A;  2DFE A;  2X6N A;  4LSL A;  4FCY A;  1D8Y A;  5HRR A;  4NCA A;  1EXQ A;  4IFV A;  1KRP A;  2X6S A;  1RBU A;  4N76 A;  3QNN A;  1ITG A;  1VRT A;  1VSH A;  3S9H A;  4Q0B A;  3OS0 A;  1NK0 A;  3K5N A;  3LAM A;  3ZT4 A;  3HJF A;  4OLA A;  4O0J A;  2BDP A;  4KHW A;  2G8K A;  2ZQB A;  4ID1 A;  1WSG A;  3ZSX A;  3CYM A;  3OYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...