4CK3A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck3A00
4JS5A 2JGUA 3UIQA 2D0CA 3L3UA 4M3TA 3OYHA 4FJKA 3OYLA 1UA1A 2O4GA 3KLIA 5KI6A 3HXMA 4FLUA 4KREA 3AA3A 4CGGA 3DYAA 5FRMA 1DTQA 3SUNA 3AA4A 1WLJA 1QSSA 3NCIA 1DLOA 4CEFA 2QK9A 3ZSYA 4N56A 4Z4HA 4CJWA 3MECA 5KGWA 2DFHA 4CEAA 3VA3A 1LAVA 2BE2A 4O4GA 4FM2A 1ZBUA 4E7LA 3ZSXA 4CK3A 2VWKA 1RBUA 4Q0BA 1HMVA 3L2VA 4W5NA 3IG1A 2YNIA 3VQ5A 4CF9A 4BWJA 4N41A 1RILA 1EKEA 4M3RA 1XHZA 1SKSA 4FJ5A 3F73A 3HP6A 2A1RA 4RG8A 1X9MA 3NF7A 4OGCA 4CF2A 3BDPA 3K57A 4I2QA 2ZQBA 3CM5A 1WSEA 4HUFA 1U48A 3PV8A 2PZSA 3I8DA 2ZD1A 3RWUA 3QIPA 1S6PA 3D45A 4NYNA 4CJRA 4DTNA 3QEWA 3S9HA 4B9NA 3C95A 1JLFA 1Z25A 3HPHA 1CXQA 3EY1A 4E7HA 2ITGA 1NK4A 4FW1A 3AO1A 2Z1GA 1RT7A 2XO7A 2HW3A 4PY5A 4LSLA 1VSHA 3OYAA 1J53A 4DTUA 4KI6A 4QAGA 5CZ2A 2KZZA 1NKCA 1BGXT 1TKZA 3OJUA 3RRHA 3LZIA 3JYTA 4M42A 1RBVA 3TAMA 3MXIA 4FZYA 1LW2A 2BDPA 1C0UA 4UQGA 4BE0A 4PUOA 4DTRA 1VK0A 1BCOA 4E19A 1GOCA 3OS0A 4C8OA 1EETA 3AO3A 3KLFA 5HLFA 3HPOA 3KTQA 3WNHA 1LWFA 3L2QA 4CIGA 2E6MA 2XY6A 3WNEA 4BE2A 1W9HA 1XC9A 1KCFA 3ZSOA 3AVAA 4CJFA 4IKFA 3RR8A 4FJMA 4KHQA 2PYJA 5DMRA 4H4OA 2KZMA 1S1TA 2VG7A 3K5LA 3S3NA 4DSEA 3AVCA 3KIOA 1A5WA 4ELVA 4DSIA 1NK0A 4CFAA 1QSYA 1L3SA 1D8YA 3U6FA 4CJVA 3V9SA 1I39A 1YVUA 4DWIA 4B9VA 3QEXA 1QQCA 1S9EA 4KHSA 4KI4A 1S5JA 4DTSA 3RRGA 1C1BA 3AVIA 2HHQA 3DRSA 3RMAA 1QS4A 3M8PA 3QEPA 1TK5A 3QNOA 4FLZA 1L3VA 1WAJA 5CYQA 2W42A 3V1QA 4WE1A 1U4BA 2HHWA 4CJ5A 3HJFA 4AHVA 3F9KA 4IFVA 5JS2A 3DM2A 1BQMA 3DRPA 3ZSQA 4Y1DA 3ZCMA 1QSLA 2QKKA 1CZBA 1HYZA 3ZSWA 1ZBIA 4NCBA 1WN7A 2G8WA 2YHAA 4E0DA 4B3OA 4CHYA 4RW7A 3NGZA 1DTTA 4CJSA 1RT3A 4F4KA 4DF4A 3KKRA 1TAUA 2ZE2A 4CFDA 3V1OA 4GW6A 4CERA 2FC0A 3SCXA 1KRPA 4AHRA 1RTIA 3FFIA 3JSMA 4FJLA 2OPPA 3WNFA 3SUOA 4TSXA 3SYZA 4R5PA 4Z4EA 3AO5A 1W0HA 3S3MA 4FZXC 4FK0A 3SUPA 1Y97A 3LPUA 3OYMA 3NF9A 1BISA 2HB5A 3RR7A 1FXXA 2JLEA 2X6SA 4AHSA 3U3YA 2Z1HA 5CZ1A 2XHBA 3MAQA 4KKOA 4LD0A 4CHPA 3TANA 3KLEA 3QLHA 1S6QA 4MFBA 1FKOA 4DU4A 1SKRA 3DLRA 4PQUA 2HHUA 3OYGA 3HK2A 4BACA 1BCMA 2B6AA 2YNFA 3O4NA 1B9FA 4CEZA 3NHGA 4CEDA 3L2RA 3TAFA 1KLNA 3KLHA 1T7PA 3P5JA 1GOBA 1ASVA 1WSJA 5K14A 4J2BA 1VSIA 4OGEA 4AHTA 4CJEA 4CJTA 4OKEA 3HVRA 1TKDA 1NK6A 2LSNA 1FK9A 2YNGA 5HRRA 3RTVA 1CLQA 2X78A 1I3AA 2FBTA 3O3HA 4CHZA 3CFRA 3SUQA 1WSHA 2IS3A 1Z26A 3QETA 1SL0A 1L5UA 3DOLA 2BANA 2WOMA 3NF6A 1T8EA 2OYQA 3HL8A 1J9AA 1NK9A 4DSKA 1S1UA 1LW0A 3KK1A 3SQ0A 4CESA 1RT5A 3OS2A 3IS9A 4NYFA 3AVMA 3QINA 4IDKA 5C25A 2Y1IA 4ZTFA 1T05A 3NH0A 1JL2A 2RN2A 4CK2A 1VSFA 3VQQA 4C8KA 4J2EA 4KV8A 4F2SA 1D9DA 1BI4A 1KLMA 3K5OA 3QIOA 1VSKA 3H08A 1JLGA 3V81A 4FLXA 5J2QA 3B6OA 2HMIA 1ASUA 2YHBA 4DLEA 5J2PA 3OYBA 3HM9A 1JLAA 3MEEA 3I0SA 4IBNA 3QERA 1N6QA 2O4IA 4DTPA 3KK2A 3M8RA 4M3ZA 1C0MA 4F3TA 1RT1A 5SZTA 1C1AA 4KB1A 4N76A 3SNNA 4NCGA 4E7IA 4CEQA 3G10A 1RDAA 3HSTB 4HCCA 2G8VA 1C0TA 3VQCA 4OLAA 1YT3A 3CM6A 3M8QA 2HNYA 3LDSA 1X1PA 4CEBA 2P5OA 4OPJA 1HNVA 4E7KA 1VRUA 3TR8A 4FJ7A 4FM1A 1UAXA 5FROA 3LANA 1L3UA 3VQBA 4E1NA 1NKBA 4FJGA 4JLHA 3LP1A 1BHLA 1S1XA 1ZBHA 4DF8A 1CXUA 3LPTA 4CHQA 2F8SA 4J2DA 1JLEA 3HPGA 4AH9A 1HJRA 3QEVA 3ZT3A 4CF1A 2FBYA 3CYMA 3HP9A 4FLWA 3SQ1A 3KD5E 4HCBA 4KO0A 3ZT1A 1XWLA 4LY7A 4RW9A 3OYIA 4ID1A 3RMBA 1XI1A 1NK5A 4CIFA 3O3GA 3C94A 3AVHA 3LZJA 2IC3A 3KJVA 3TAQA 3BGRA 1R0AA 3KD1E 4KHNA 4EZ6A 1K6YA 1RCHA 2B4JA 3DLGA 3LALA 5HRPA 4DS4A 3M8SA 3T19A 4I7FA 1KVBA 4HVJA 4E7JA 4FXDA 2KW4A 3DMJA 4CJPA 4DTOA 4CJUA 3TARA 1BL3A 3KLGA 4DU3A 3S3OA 1WSIA 3I0RA 4PA1A 1QE1A 3ULDA 3IAYA 4K8XA 3AO2A 2PYLA 5JS1A 1NJYA 2P51A 3K59A 4MQ3A 1NJXA 1QHTA 5J1EA 2ATQA 4O0JA 3VN5A 4YNQA 1L3TA 4W5QA 3SZ2A 3ZSRA 1KVCA 3LP2A 4M3YA 3O3FA 4M45A 3P1GA 3DLEA 4HHTA 1C6VA 1HQUA 1RDBA 5KTQA 4IG3A 4ZHRA 1X9WA 2HVIA 3DLKA 3AV9A 4IG0A 4CE9A 3NGIA 3SI6A 1RT2A 1TKTA 3OYDA 4E3SA 5C42A 4F2RA 3CFOA 4CHOA 4DFMA 4Y1CA 3AVKA 3VQ9A 1U47A 3NE6A 1HQEA 1O1WA 2XRIA 1RBSA 1EX4A 2XY8A 4KRFA 2OPQA 4FW2A 3A2FA 3ZT0A 3LWMA 4CFBA 3V9UA 5KRTA 4FCYA 3OYJA 1N5YA 3V9ZA 1B92A 3T3FA 1G15A 2FBXA 4CJ3A 3OYNA 2G8HA 2GV9A 4FVMA 4GVMA 3L2UA 1LV5A 4JRPA 3THVA 3V9WA 3LP3A 3ZSZA 3QEIA 4HTUA 4HUEA 4C8NA 2OPRA 1SKWA 4DLGA 3MXJA 4H8KA 3L8BA 2Q3SA 3SPYA 4FJIA 3ZT4A 3PX4A 1HNIA 1VRTA 4I9LA 3PX6A 3MEGA 1LAWA 1SL2A 4NCAA 2OA8A 3ASMA 2B5JA 4Z4GA 4E1MA 1YTAA 1D5AA 3VQ6A 3VQ8A 1Q8IA 4B9LA 2G8IA 2HVHA 3VQ7A 2RKIA 2X6NA 2Y1JA 1TVRA 3V9XA 5I42A 4BWMA 1EP4A 4DQRA 4CJKA 4Z4FA 2AJQA 4DFJA 4KFBA 3TI0A 1JLCA 3V6DA 1ZBFA 3NH2A 1LWCA 2IOCA 1F21A 4I2PA 3VQAA 4BDZA 4I9QA 4FJNA 4KAZA 1JKHA 4JRQA 3QNNA 4DQPA 5HRNA 1ASWA 2YKNA 4CEOA 1IKWA 4KTWA 4N47A 3K58A 4DG1A 1RNHA 5KRSA 3K2PA 4GMJB 2DFEA 3PO4A 4E89A 1RT6A 3D0PA 4C8LA 4ELUA 1FKPA 2IDOA 3OYEA 2E4LA 1BI4B 4DS5A 3NGYA 2KQ2A 1GOAA 1TKXA 2EX3A 3V1RA 1BIUA 1HPZA 5SWMA 4CK1A 4HUGA 4KB0A 4KTQA 3HO1A 1WAFA 1C1CA 1TV6A 2G8KA 2RF2A 4W5RA 4KHYA 3VA0A 3PUFA 3K5MA 3HVTA 2KTQA 4JS4A 4KHWA 1Q9YA 1KVAA 4CF8A 3PO5A 2F8TA 5E41A 4RW4A 4M3XA 2P1JA 1IKXA 2YNHA 5D3GA 2QKBA 3ZT2A 2YKMA 2DFFA 1LWEA 4OKKA 4Z0UA 3OYCA 4FJXA 4CGHA 5T7BA 2BGGA 4O55A 2HHXA 5I3UA 5HBMA 3LAMA 3CFPA 2HHTA 2WONA 3DRRA 4BE1A 4KPYA 4OJRA 1TK8A 3TAEA 1UOCA 1TAQA 3K5NA 1NOZA 4ZTJA 3AA5X 1RDDA 3L2WA 2F96A 4FYDA 1U04A 1ITGA 4BDPA 4ELTA 3AVGA 1YTUA 3HYFA 5KGXA 2RPIA 4ICLA 3LP0A 4CGJA 4CJ4A 1BIZA 1U45A 2PY5A 4L8RB 2E6LA 4KHUA 1UA0A 5HP1A 2VG6A 2G8FA 3B6PA 1HRHA 1RBTA 3EZ5A 1ZBLA 1SV5A 4CGFA 3OYKA 1ZYQA 1KFDA 4DFPA 1JLBA 4DQIA 4OKJA 4G1QA 4YFUA 1JXBA 2HHSA 2KFNA 5FDLA 3DI6A 3DOKA 3MEDA 1IH7A 1T03A 3SV4A 2VWJA 3QO9A 2HNDA 1J54A 1BQNA 4CJQA 1VSMA 3VQPA 3TAGA 4CJLA 1S1VA 2GBZA 3AVLA 4DSFA 3E01A 1D9FA 4FZZA 4OLBA 1RTJA 3TAPA 3O4QA 3NH1A 1NJZA 4M3WA 2HHVA 2IAJA 3EYZA 3SQ2A 1RTDA 1QTMA 3CG7A 1WNSA 1J5OA 4AHUA 4DSJA 3L3VA 2KFZA 4CEEA 3LWLA 4CCHA 4DQQA 5FRNA 4OVLA 2A1SA 5CYMA 5DK5A 4FM0A 4EP4A 3DLHA 1SUQA 1WSGA 4M41A 3OYFA 3T1AA 1IO2A 1KSPA 4AILC 1KFSA 2YV0X 4H4MA 1NOYA 3QESA 4CECA 4DTXA 4Z4IA 3OJSA 4DTMA 3CQ8A 1MU2A 2HNZA 2DY4A 1SL1A 3AVFA 4ID5A 4O5BA 1EXQA 3AO4A 3SJJA 4RW6A 3U3GA 4B9TA 3ALYA 4CGIA 3V4IA 2P5GA 4DMNA 4W5TA 4DSLA 1VSDA 4DTJA 3KKSA 1JL1A 1VSEA 1VSLA 1RDCA 1WSFA 2I5JA 1NKEA 3PY8A 1JXEA 3ISNC 2FBVA 5HRSA 1UWBA 4RW8A 2OZMA 4F8RA 3VQEA 4EP5A 4XIUA 1S9GA 5EU7A 4FLYA 2D0BA 4C8MA 3NFAA 4QOZB 1RTHA 2IGIA 4IFYA 1A5XA 3AA2A 4O0IA 1TGOA 1VSJA 4CF0A 3NF8A 3SQ4A 1B9DA 1S1WA 3MXMA 2QXFA 2XY5A 3RMDA 1HYSA 4FJ8A 3KK3A 4DFKA 4AHCA 3NAEA 4DQSA 1RBRA 3OS1A 3ITHA 4M3UA 5CY4A 2R7YA 3AVJA 1CZ9A 2D0AA 3TWHA 2VG5A 1TL3A 3IRXA 4W5OA 3NDKA 2OZSA 4EZ9A 1XHXA 4O44A 1HYVA 2OPSA 3AVBA 1Q9XA 4KTZA 4B08A 4B9SA 3C6TA 4CHNA 2X74A 1JLQA 3NBPA 5J2MA 3SPZA 1X9SA 4PWDA 1TK0A 4B8CA 4FK2A 4QCLA 4CFCA 1REVA 4Q5VA 4Z4CA 4BDYA 3DLBA 2D5RA 3G0ZA 1A5VA 1RT4A 3VQDA 3ZSVA 4OPKA 5HROA 4B9UA 4LSNA 5J2NA 1IG9A 4LH4A 4B8AB 4DU1A 1NK7A 4B9MA 3VQ4A 1NJWA 1IKYA 1NK8A 3OY9A 3SV3A 3TABA 3OVNA 4K8ZA 1IKVA 4FJ9A 4F3OA 3P83D 4J2AA 2Z1JA 2GUIA 3C6UA 1U49A 4LH5A 4FLVA 3LAKA 3WNGA 4CIEA 4CGDA 2ETJA 4N5SA 2Z1IA 5C24A 3PX0A 3HT3A 2G8UA 3RMCA 4FJHA 4FK4A 4FLTA 1TL1A 2XY7A 1KTQA 2DTUA 2EHGA 2NUBA 4FJJA 3AVNA
chains in the Genus database with same CATH superfamily
3CJ1A 4FJKA 2VYPA 3HXMA 4FLUA 4KREA 3AA3A 4CGGA 1HNZK 3AA4A 2IIRA 3F5TA 4CEAA 2VWKA 4BC4A 1HMVA 4DKWA 5AQMA 3VQ5A 1XHZA 4A62A 3J7YP 1YAGA 1WB9A 1U48A 3LDNA 4HUFA 1YJWN 4AM7A 3D45A 4BROA 4NYNA 3FZLA 3UKUA 2GWKA 3QEWA 3S9HA 2O8FA 4G9ZA 3HPHA 1ILYA 3HRGA 3CJCA 4LSLA 1VSHA 3OYAA 1J53A 4DTUA 4QAGA 1NKCA 3LZIA 3JYTA 2Q0UA 3TAMA 3MXIA 2P9LB 1C0UA 4UQGA 3ULEB 3FZKA 5H1SQ 4E19A 5EX5A 4LFCK 5HLFA 3HPOA 3WNHA 2XY6A 4BE2A 1W9HA 4FWNA 4K0KK 3DJCA 3AVAA 5ADXH 3CC4N 2V7ZA 3AGRA 3ATVA 4DSEA 4DSIA 5LJVA 3T69A 3U6FA 4YHHK 3V9SA 4DWIA 1QQCA 5KPRA 3VF2A 5KQ8A 3DXKB 1WUAA 4YOUA 3A5OC 5IWAK 2OTJN 4FLZA 2W42A 2HHWA 3M6GA 1WOQA 1N33K 3CERA 3ZSQA 3L6QA 4JK8A 2O8CB 1CZBA 1HYZA 3FR0A 5AQKA 4BRAA 1ZBIA 3KVGA 1X9JA 5AQSA 3QBXA 4DV7K 3VOVA 3NGZA 1DTTA 5AQIA 4F4KA 1TAUA 4GW6A 4CERA 2FC0A 3OBYA 1RTIA 4DUZK 3WNFA 4TSXA 3TPQA 3AO5A 1W7AA 4FK0A 3OYMA 4WFNL 1FXXA 3VGMA 4B1UB 2JLEA 3C6AA 5JICA 4AHSA 1MWKA 4H0VB 2Z1HA 5CZ1A 2P9SB 4LFBK 1S6QA 1N32K 3VEOA 5BR9A 1ASVA 1GOBA 1HKGA 3E9LA 4PL7A 1VSIA 4CJEA 1TKDA 3MN5A 4RCHA 2LSNA 1FK9A 1Z6RA 3MCAB 3EO3A 5E26A 4CZJA 3QETA 2CGJA 1SL0A 2WOMA 5AQQA 3HL8A 4JEPA 4CESA 3OS2A 3AVMA 4IDKA 5C25A 2JWKA 3NH0A 4CK2A 4V19S 4KV8A 3HSCA 3H08A 4ILGB 1JLGA 1Y64A 3V81A 4FLXA 4JK7A 1ASUA 3PIPL 4DLEA 5BPLA 3ENOA 4WF9L 3LDQA 4KB1A 1VAZA 4NCGA 5EXWA 3G10A 1RDAA 1X3MA 2G8VA 4AQYK 3LDSA 2HNYA 4CEBA 3SAFA 4OPJA 1HNVA 4Z4EA 1VRUA 3TR8A 3WXIA 2ZGYA 3DXMB 4E1NA 3VEYA 3LP1A 1BHLA 1R59O 3LPTA 5BPMA 3HPGA 3ZT3A 3KD5E 3HP9A 4HCBA 1NGEA 4X64K 4KO0A 1YVNA 3ZT1A 1XI1A 1NK5A 3ENBA 2QWQA 5EVZA 3AVHA 3LZJA 1R0AA 1HNWK 2A41A 4JKCA 1YITN 4I7FA 3UE5A 2KW4A 4CJUA 3TARA 2QWLA 1WSIA 4PA1A 3ULDA 4BRDA 2YHYA 3MK6A 4ISFA 3K59A 3U9DA 2AP1A 4FWLA 2W6KA 1NJXA 4JKGA 4W5QA 2GX9A 1C6VA 1HQUA 1RDBA 4L3QA 2HVIA 1G99A 4CE9A 3NGIA 3IKMA 4F2RA 3CPEA 4OX9K 1U47A 4KRFA 3NVMA 4FW2A 4CFBA 2VQEK 4F9OA 4FCYA 3OYJA 1NGGA 1N5YA 2FBXA 3OYNA 2P9NA 2G8HA 5M1QA 3V9WA 3WEEB 4BRFA 3AGKA 5C12A 3HTVA 1GLAG 4HTUA 4JI2K 4B3TK 3MXJA 3ZT4A 4YOTA 2IVOA 3PX4A 1KXPA 4DR7K 3MEGA 1LAWA 3A5MC 2ZJQL 5M1KA 4Z4GA 4E1MA 1D5AA 2NRXA 2NZTA 1BUPA 3H6EA 2HVHA 3ZETB 3VQ7A 1TVRA 3V9XA 3H3OB 4BWMA 4Z4FA 1JLCA 5TKWA 3S41A 3NH2A 2IOCA 4I2PA 3VQAA 1JKHA 4JRQA 4DQPA 5ADXA 1NGJA 4CEOA 1Q86O 4N47A 3PO4A 1MA9B 1U2VB 2DFEA 1VQ6N 1MWMA 1FKPA 4DV6K 3OYEA 4DV4K 4FWPA 1GOAA 1TKXA 4HUGA 1NMDA 4IFEA 4KTQA 3HO1A 1WAFA 3Q7CA 2RF2A 3K5MA 2KTQA 3EKUA 4FWQA 3A5NC 3A5LC 3KWIA 3H3NO 1NNEA 4RW4A 4M3XA 2YCHA 5D3GA 2NRRA 2QWRA 3ZT2A 2YKMA 1YUWA 2DFFA 3GOIA 3OYCA 3I56N 4FJXA 2BGGA 2P9PA 1SQKA 2E5LK 4GV9A 3LAMA 2WONA 2ZJRL 4KPYA 3TAEA 1UOCA 2CH5A 4FOEA 3O9RA 4JI6K 4HWIA 4BRMA 1GLLO 3AA5X 3O8MA 4YOWA 3L2WA 3O9QA 2HBMA 3HOTA 5KGXA 2RPIA 4JI4K 4CJ4A 4KHUA 1BIZA 4JKAA 1RBTA 1ZBLA 1SV5A 4CGFA 1ZYQA 4DFPA 1HR0K 1KAYA 4OKJA 4FWKA 4AF1A 1IV0A 5TKYA 1SAZA 3O4WA 1S1VA 4IOAL 1D9FA 1RTJA 1D4XA 5DK5A 4EP4A 1SUQA 4C1NI 3SMPA 2O8EB 3O08A 2E2NA 3SBGA 1NOYA 2D0OA 3QESA 4Z4IA 4DTMA 1MU2A 5LL6Z 5BR8K 1MDUB 4O5BA 1T44A 2UXDK 1Q7YO 2GELA 2I7NA 4B9TA 3ALYA 4CGIA 1CZAN 4BG9A 2P5GA 3MN7A 4EFHA 4DTJA 1VSEA 1RDCA 1WSFA 1ZC6A 3FLCO 3ISNC 2FBVA 1YJNN 3CHWA 3WQTA 4F8RA 3H1VX 1S9GA 4FLYA 2D0BA 1RTHA 3AA2A 4BG8A 2QXLA 2FSKA 1H1VA 2FXUA 2UU9K 4BRIA 3MXMA 4BRGA 4DQSA 5DM6L 1CZ9A 2OZSA 3NDKA 4EZ9A 4RWTA 1XHXA 4O44A 1OH8A 1HYVA 1C0GA 2PBDA 2JWLA 3EKSA 1X9SA 3LDLA 3HBTA 4A5AA 4KH4A 3QFUA 3ZSVA 4OPKA 1OKJA 3TSQA 2QI2A 4JI0K 1NK7A 2A3ZA 4X62K 2QA4N 1IKYA 1NK8A 1S72N 3JAMO 3OY9A 3EN9A 4J2AA 2GUIA 1E4FT 1BA1A 4GKKK 4CGDA 3BF1A 2Z1IA 5C0YA 3PX0A 4FK4A 4BRPA 1J5EK 2XY7A 1KTQA 1SZ2A 2BH1A 4FJJA 4JI1K 3CD6N 1EO1A 3OYHA 3T7ZA 3OYLA 2O4GA 1UA1A 2O8FB 3IMXA 5FRMA 3TSUA 1JCGA 3NCIA 1DLOA 3ZSYA 3MECA 3RSEA 4FM2A 1RBUA 4W5NA 2YNIA 4N41A 1EKEA 4M3RA 3F73A 3CCEN 4RG8A 1X9MA 3CCRN 3BDPA 4KBOA 2ZQBA 2PZSA 3I8DA 4H0TB 4FJ5A 2IVPA 1HLUA 5A2QO 3EY1A 2O8DA 3H45C 1NK4A 2Z1GA 3VEZA 2XO7A 2A5XA 2HW3A 4A2BA 4KI6A 1VQ7N 1I94K 1TKZA 3OJUA 2UXBK 1N34K 3JXUA 4M42A 4FZYA 3C7NB 4BE0A 4DTRA 1BCOA 3CF5L 3OS0A 1EETA 4JKFA 3KTQA 3L2QA 1XC9A 4FJMA 4KHQA 5DMRA 4CJ7A 1S1TA 1DT9A 3PSFA 4YDUA 5AZIB 4CFAA 1S22A 1NK0A 2UUCK 4JHDB 4CJVA 1YVUA 4B9VA 2ZGZA 4YOYA 4KI4A 3R8EA 1C1BA 1GLBG 4DQ8A 2HHQA 5BRHA 3RMAA 3M8PA 2YJEA 3QB0A 1TK5A 4I6MB 5EOYA 3O5BA 3DRPA 2QWOA 2FF3B 4BC2A 5F1XA 4BC5A 1W2BM 4IJAA 4RW7A 4PHTX 2Q2RA 4M7XA 1RT3A 4DF4A 3KKRA 2ZE2A 3UKUB 3SCXA 3FFIA 2OPPA 4JD2A 3TTCA 3BF3A 4FZXC 4LF6K 3RR7A 1BISA 4RTFD 3VPZA 2X6SA 3GDQA 1O13A 2XHBA 3TANA 2HHUA 4DU4A 1FKOA 4BACA 3O4NA 5AR0A 1T7PA 4BR5A 5GAHP 3L0QA 4H0YB 5AQFA 4OGEA 4AHTA 4CZKA 3FZFA 3I55N 4YOVA 2FBTA 4CHZA 3EEQA 4NLCA 1L5UA 3DOLA 2BANA 3NF6A 1NK9A 5KPZA 3SQ0A 3IS9A 2Y1IA 3QINA 4C8KA 3DAWA 5JMVA 1D9DA 1QQNA 1KLMA 3K5OA 3UB5A 1VHXA 4DR2K 4DUYK 5J2QA 3B6OA 2HMIA 3THWA 4JHDA 5J2PA 1HKBA 3MEEA 4JNEA 3AAQA 4IBNA 3KK2A 3M8RA 1C0MA 4F3TA 4MDBA 4WQ5C 3SNNA 4E7IA 4BR0A 2Q31A 3CM6A 4E7KA 3LANA 3VQBA 1NKBA 4JLHA 3E9PA 3C7NA 3N4PA 4AH9A 2QTDA 3RMBA 2E2QA 2Q1NA 2O8DB 2IC3A 2VGNA 3KJVA 3TAQA 3KD1E 4KHNA 3AY9A 1K6YA 1RCHA 5F2RA 2B4JA 3M8SA 4CZGA 3E9OA 5AQPA 4HVJA 4E7JA 5CE3A 1T6DA 3S3OA 3I0RA 1QE1A 1YXQA 1GLDG 5JS1A 1NJYA 1HPMA 2ATQA 3VN5A 1RDUA 3ZX0A 1NU0A 3J7AP 1KVCA 4M3YA 3O3FA 1K8KB 3P1GA 3MX2A 4HHTA 3CMEN 3DLKA 4JD2B 4E3SA 1ATSA 4CHOA 3I33A 4Y1CA 3VQ9A 3WT0A 1HQEA 1O1WA 2XRIA 3G71N 4BVOA 3OTOK 3V9UA 3LWMA 5KRTA 3V9ZA 4BY9C 4JAXA 3FZHA 5KQDA 2GV9A 3O80A 4MDAA 4JRPA 3LP3A 4MLEA 3D7EO 3EE9A 4C8NA 4DLGA 4H8KA 3AAPA 2HOEA 1VRTA 1FJGK 1SL2A 4FOIA 2OA8A 3VQ8A 4B9LA 2G8IA 2RKIA 1YJ9N 2ITMA 2RHKA 4DQRA 1HKCA 1ZXOA 4CJKA 2AJQA 4KFBA 3V6DA 4B1YB 4FJNA 4I9QA 4EIAA 3U8XA 3GE1A 4OPHA 2YKNA 1IKWA 1ATNA 3K58A 4DG1A 1RNHA 4LFAK 3WXLA 4E89A 3D0PA 3VEXA 2P9SA 2V7YA 4DS5A 3NGYA 3V1RA 1GLCG 4FWOA 1BIUA 5SWMA 4CK1A 2FF6A 1C1CA 1E4GT 3VESA 5MLCQ 4Z94A 4KHWA 4CF8A 3VEWA 3U4LA 2P1JA 3ZLJA 1LWEA 3H1QA 1NGBA 4EAHD 5T7BA 1N36K 1XNQK 2NRZA 5HBMA 3WUHA 3UKRB 3DLLL 1BOTO 4H5WA 1NOZA 1U04A 1YTUA 3AVGA 3A8YA 3C65A 3L4QA 1W97L 2E6LA 3O9SA 3K9JA 3MMVA 2Q36A 2VG6A 3CC7N 3B6PA 2F9TA 1KFDA 1JLBA 1Z05A 4G1QA 4YFUA 3E1YA 5M1NA 1IH7A 2VWJA 1ATRA 2HNDA 1J54A 3TAGA 1VSMA 2GBZA 3E01A 2HHVA 4XH4A 1RTDA 3CG7A 3OA9A 4B1VA 4AHUA 4YOXA 4CZLA 3LWLA 4DQQA 4OVLA 2A1SA 4FM0A 4DSKA 2P9IA 4NCBA 3T1AA 1IO2A 2E2OA 1KSPA 2YV0X 2HHHK 3MCPA 4DTXA 3OJSA 3CQ8A 2HNZA 1SL1A 3AVFA 3ID8A 4DCHA 1EXQA 3SJJA 1JCEA 3PLAA 4DMNA 4DSLA 1JL1A 3K9KA 4JKBA 2I5JA 1NKEA 3PY8A 1JXEA 1YI2N 1NBWA 1UWBA 1E3MA 3VF6A 5M1PA 4BQZA 3R6MA 4C8MA 3ZX3A 3SBTA 5BRFA 4O0IA 1TGOA 2OCEA 2HMPA 4CF0A 4UY8O 3CQYA 1VQ8N 2QXFA 3RSEB 2XY5A 4IOCL 4FJ8A 3KK3A 3NAEA 4HTLA 3OS1A 1NGCA 4CZMA 2R7YA 2P9UA 1BG3A 3AVJA 3FGUA 4B1ZA 2UUBK 2E88A 2OPSA 1Q9XA 4B08A 4DR5K 4B9SA 2O8BB 1GLJO 1JLQA 1HX1A 1TK0A 4B8CA 2KLAA 4QCLA 4CFCA 3G25A 3T1YK 4CBXA 3G0ZA 4LF9K 1A5VA 3VQDA 4B9UA 4YORA 5J2NA 1IG9A 4LC9B 3C0BA 1NGDA 4DV2K 3SV3A 4K8ZA 4YDUC 1IKVA 3P83D 3TU5A 3BP8A 4O5FA 5C24A 2G8UA 3HT3A 1VQMN 3RMCA 4FJHA 1NGAA 2EHGA 4BRHA 3AVNA 5BPNA 2JGUA 3UIQA 3O1BA 4IO9L 5KI6A 4BRCA 2F7TA 3J81O 4YY3K 3THWB 2D0PA 3U9ZA 4CBWA 1WLJA 1QSSA 4CEFA 2QK9A 3CIPA 4N56A 4Z4HA 4CJWA 3QFPA 2DFHA 1LAVA 2VCPA 4O4GA 1FW6A 4CK3A 1DGKN 2QM1A 3IG1A 3MN9A 4CF9A 4BWJA 1RILA 4M63C 1SKSA 4WCEL 3HP6A 4B1WB 4JI8K 2UYTA 3NF7A 4JKHA 4OGCA 4DB3A 4KH5A 1WSEA 4C23A 1OVYA 2ZD1A 1WBBA 4CJRA 1S6PA 4LF7K 1JLFA 1Z25A 4DR1K 1CXQA 4E7HA 1VQON 1KAZA 2NRWA 3WQUA 4FW1A 1QQOA 1VQPN 3AO1A 4BREA 1RT7A 4GKJK 4PY5A 1RGIA 3FFKB 5AQHA 4X65K 5CZ2A 4DV5K 3M5RA 3RRHA 3LM2A 1RBVA 3LL3A 1LW2A 4IZ9A 1T6CA 3K0SA 4DR3K 1VK0A 4ISGA 3JS6A 1GOCA 2ASOA 3KLFA 2PFUA 1LWFA 3D2FA 4IWVA 3KK7A 1YHQN 4O8KA 5FPDA 3RR8A 4H4OA 2KZMA 4E1JA 2VG7A 3S3NA 4ELVA 1A5WA 1QSYA 3N4QA 1D8YA 3NVKA 2WBNA 2D4WA 5LY3A 3CETA 4QS7A 5AFUA 3SAGA 5JVGL 1S5JA 3RRGA 4B3MK 3IUCA 1QS4A 1YIJN 1YF5L 3QNOA 1L3VA 1WBDA 1U4BA 4CJ5A 1XC3A 3F9KA 5JS2A 3DM2A 1BQMA 1TUUA 1QSLA 2QKKA 3MN6A 3ZSWA 3BY5A 1WN7A 2G8WA 2YHAA 4E0DA 4O8UA 4GVEA 3P39A 4CJSA 2WTUA 5CHIA 4CFDA 3V1OA 4U7BA 1KRPA 4AHRA 3JSMA 4FJLA 3ZX2A 3VEVA 3SUOA 4R5PA 1W0HA 4JKDA 3S3MA 3LPUA 3CJAA 3NF9A 4JKGB 3C6HA 3U3YA 1NGFA 2GTDA 5C2FA 4KH6A 1P90A 3MAQA 4KKOA 3ZYYX 1QQMA 3MWTA 4LD0A 3UKRA 4CHPA 2V52B 4IDHA 2VGMA 2A42A 3HK2A 1BCMA 2B6AA 3NHGA 3HJFA 1B9FA 4CEZA 3VGLA 3KLHA 3P5JA 1WSJA 4J2BA 3VETA 5CR4A 4OKEA 3HVRA 1NK6A 3F9MA 1CLQA 1I3AA 3MX5A 3SUQA 4JV5K 1WSHA 2IS3A 2O8CA 2QWPA 1NMNA 1T8EA 1J9AA 4K25A 1S1UA 4CD1A 2GEMA 4NYFA 4ZTFA 2RN2A 3IDHA 3VTIA 1VQNN 1LCUA 3DXKA 1M90O 1VSKA 5EY4A 2A6AA 2YHBA 3OYBA 5AQWA 3SJHA 1JLAA 3HM9A 3QERA 1N6QA 3NMUA 2O4IA 4DTPA 4IEIA 3D6RA 4M3ZA 4BR7A 1RT1A 5SZTA 1C1AA 4N76A 1K9MO 2EWSA 4J8FA 2P5OA 1UAXA 1L3UA 4I6MA 3P38A 1S1XA 1ZBHA 4DF8A 1CXUA 4JKEA 2P9IB 1JLEA 2WUSA 3QEVA 3WEEA 4CZEA 3OYIA 2NRTA 4ID1A 3TTFA 2GWJA 3C94A 2GUPA 3BGRA 1VQ9N 3DLGA 5HRPA 1KAXA 4K42A 3FE1A 4PKGA 3DMJA 4CJPA 4DTOA 1IBKK 1BL3A 4EHUA 3KLGA 4K8XA 3AO2A 2P51A 4DV1K 4MQ3A 5J1EA 5F0XA 3EZWA 3SZ2A 3ZSRA 4LF4K 3J8AA 3IFRA 3LP2A 4M45A 3OW2M 4BR2A 3CCLN 4IG3A 2ASPA 3THXA 3AV9A 3SI6A 1TKTA 3OHRA 2OANA 3CJ9A 2YI1A 2A40A 3NE6A 2XY8A 4FL9A 2OPQA 4B9QA 3A2FA 1K73O 3T3FA 1G15A 1GLEG 5C2DA 1LV5A 4FVMA 4GVMA 3THVA 4PL8A 4BGAA 3KWGA 1Q82O 3D2FB 4HUEA 4CW7B 2OPRA 2WC9A 1SKWA 5AQGA 3L8BA 3SPYA 4CVNE 2O8EA 1HNIA 3WXMB 2BUPA 3PX6A 2E1YA 3ASMA 3VQ6A 1Q8IA 5AFUH 4EHTA 5HOOA 3TTDA 1N8RO 1F21A 3QNNA 1ASWA 3CCVN 3CC2N 2P9KB 5KRSA 3VGKA 5AQJA 3R9PA 4C8LA 4ELUA 3G6EN 3LDOA 1XNRK 2KQ2A 4A57A 2EX3A 4KB0A 1HPZA 1LOTB 1TV6A 3ATUA 1V4TA 4KHYA 4H5VA 3PUFA 3HVTA 4JS4A 1KVAA 3HI0A 2ZWHA 2F8TA 1XQSC 5E41A 5JLHA 1IKXA 1BO5O 2YNHA 1QVGM 4Z0UA 4CGHA 5I3UA 3CFPA 2HHTA 5AQLA 3DRRA 5FLXO 1VQ4N 2CH6A 1TAQA 5DM7L 3K5NA 4CZHA 2F96A 4WFAL 1ITGA 4BDPA 3HYFA 4MO4A 3LP0A 3GG4A 2G8FA 1U2VA 4A59A 1JXBA 2HHSA 5FDLA 4NXMK 3DI6A 3DOKA 3MEDA 4FPBA 4CJQA 1SS6A 4CJLA 5M1OA 3F2KA 1NJZA 4OLBA 3O4QA 2IAJA 3EYZA 3SQ2A 1QVFM 1QTMA 1RDWX 4MO5A 1J5OA 4DSJA 4DR4K 3L3VA 4OO1J 2KFZA 3THXB 4WQ4A 3HOSA 1IBLK 3VTHA 4CCHA 1HNXK 3L4IA 4M41A 4AILC 5HL7L 3O6WA 4CECA 1P8ZA 2FSNA 1IJJA 1GLFO 3AO4A 2P9NB 2PAVA 4RW6A 3U3GA 4CI6A 3V4IA 5IT9O 2E1ZA 3CCJN 1VSDA 3KKSA 3CJ7A 4DV0K 2HF3A 2OZMA 4DHYA 3VERA 3VQEA 4EP5A 4XIUA 2KHOA 4A2AA 4IFYA 1A5XA 1VSJA 4BRKA 3A0IX 3W3DA 1XUPO 1B9DA 5B8HA 4DR6K 3ULEA 2P9LA 3RMDA 1HYSA 4DFKA 4AHCA 2I7PA 4CZIA 2BTFA 1K8AO 3O1WA 1OH6A 4M3UA 5CY4A 3SK3A 3IRXA 4W5OA 4B3SK 5BREA 3ZEUA 3AVBA 2P9PB 4KTZA 1J6ZA 3C6TA 5AQNA 2X74A 3NBPA 4BRLA 4AM6A 4PWDA 2NNWA 2FSJA 4FK2A 4Q5VA 1REVA 3DLBA 2D5RA 3M3ZA 4LSNA 3CQXA 5I9EB 5AQTA 3VENA 4B9MA 3VQ4A 1NJWA 4H0XB 3TABA 3G4SN 3EE8A 4F3OA 2ZM6K 3C6UA 5LMUK 4FLVA 3LAKA 3WNGA 4IEEA 1KC8O 3QMLA 4FLTA 1TL1A 1NGIA 3CPWM 2NUBA 2FBYA 4BC3A 4GV6A 4JS5A 4A5BA 4M3TA 2D0CA 3L3UA 4H5NA 3KLIA 1OH5A 3DYAA 3CCMN 1DTQA 3SUNA 2J4RA 4NO7A 5GADP 2WFBA 5KGWA 3VA3A 2BE2A 4E7LA 1ZBUA 4KHPK 3ZSXA 4Q0BA 3L2VA 1KQSM 2A1RA 3QBWA 3PIOL 4CF2A 3K57A 4I2QA 3CM5A 3WXKA 3W0LA 3PV8A 1JJ2M 3BEXA 1QZ6A 3RWUA 3QIPA 4DTNA 4B9NA 2HSTA 3C95A 2Q97A 4IO8A 1XMOK 2ITGA 2E20A 4LF5K 5BN9A 4OPAA 2KZZA 5AJ3K 1BGXT 5FPEA 2BDPA 4BQLA 4PUOA 5AZJB 4M7YA 4C8OA 3AO3A 1OH7A 2D1KA 4CIGA 2E6MA 3WNEA 1TUYA 5BN8A 4ILHA 2F9WA 1KCFA 3ZSOA 4CJFA 4IKFA 5E84A 2PYJA 3CCQN 3K5LA 3CXCM 3AVCA 3KIOA 2HBJA 4ILJA 1L3SA 4H5RA 1I39A 3QEXA 4FVUA 2QW9A 1S9EA 2P9UB 4KHSA 4DTSA 1S3XA 3AVIA 3PSIA 3VF4A 2QWMA 1RFQA 5GINA 3CI5A 1M1KO 3DRSA 1K8KA 3QEPA 3DXMA 1WAJA 5CYQA 3RVCA 3V1QA 4WE1A 3CCSN 4NLBA 4AHVA 4IFVA 4B1XB 3CCUN 3R1XA 4Y1DA 3ZCMA 4BVPA 2UXCK 1NG9A 3GL1A 4B3OA 4CHYA 3D2EB 4NB4A 3H46O 3I8BA 1VQ5N 4GY2B 3SYZA 1ZBSA 5JLFA 3J80O 4IOXA 3SUPA 1Y97A 5BRDA 2HB5A 3Q7BA 4FSVA 3KLEA 3QLHA 4MFBA 1SKRA 3DLRA 4PQUA 3OYGA 3ENHA 2YNFA 1KLNA 4CEDA 3L2RA 3TAFA 4JI7K 2F4VK 5K14A 2W41A 4CJTA 2NLXA 4Y0WA 1DKGD 2YNGA 5HRRA 3RTVA 4B3RK 2X78A 3O3HA 3CFRA 3WXJA 3MDQA 1Z26A 2OYQA 4C1NK 1LW0A 3KK1A 3P4IA 1RT5A 4FXDA 1T05A 1JL2A 1VSFA 3VQQA 4J2EA 4F2SA 5AQUA 4GV3A 1BI4A 3QIOA 2HBKA 5LJWA 1TYQA 1IG8A 4K41A 5GAEP 5LMNK 3I0SA 3OBWA 4WYBA 5FPMA 3ZEUB 2W40A 2O8BA 2ZJPL 3HZ6A 4CEQA 4H0PA 3HSTB 3P31A 4HCCA 1XMQK 4FPAA 1C0TA 3VQCA 2CGLA 1YT3A 3M8QA 1X1PA 4QS8A 4FJ7A 4FM1A 2V51B 5FROA 4FJGA 5AQZA 4CHQA 2NRHA 2F8SA 4J2DA 2KKZA 3BZCA 2DPNA 5GIPA 1HJRA 3SQ1A 4CF1A 3CYMA 4FLWA 2NRVA 1VQKN 1XWLA 4LY7A 4RW9A 4JI5K 4CIFA 3O3GA 3FZMA 4FWRA 4EZ6A 3EL2A 5C10A 2ZF5O 3LALA 4DS4A 3T19A 3ID6A 1KVBA 4FWSA 4H03B 5AQXA 4DU3A 3THYB 3IAYA 4NXNK 3MWPA 4BRNA 2PYLA 3B8AX 1QHTA 4O0JA 4YNQA 1L3TA 1X3NA 2YX6A 2AA4A 4XH1A 1ESVA 4DV3K 3DLEA 5KTQA 4ZHRA 1X9WA 4IG0A 5KPTA 4L8RB 3THYA 1RT2A 3OYDA 4XH5A 5C42A 3CFOA 4DFMA 4X66K 3T1HK 3AVKA 4WQ4C 1RBSA 1EX4A 3LM9A 1KD1O 1TYQB 5AZIA 3D2EA 2W6LA 3CJBA 3ZT0A 3QDKA 1B92A 2H3GX 4CJ3A 3L2UA 4XEIA 3ZSZA 3J7ZO 3BUZB 5AQRA 2VQFK 3QEIA 2Q3SA 3SAHA 4FJIA 4I9LA 4FO0A 4NCAA 2B5JA 1YTAA 1NM1A 1QZ5A 3SLCA 4IJNA 2X6NA 2Y1JA 3TSPA 5I42A 1EP4A 4DFJA 3TI0A 1ZBFA 4ISEA 1LWCA 4BDZA 4KAZA 1Q81O 5HRNA 4BR4A 3R3LA 4KTWA 3K2PA 4GMJB 3ZETA 1HUXA 1RT6A 2IDOA 3M1FA 4GNIA 4U67L 5ELZA 2E4LA 1BI4B 2E8AA 3KHYA 3VMFB 4FWMA 1HJOA 2HBLA 2YJFA 3DWLA 2G8KA 4W5RA 3VA0A 1EQYA 2FLOA 1Q9YA 3PO5A 1NWKA 5AQVA 4R79A 2QKBA 4OKKA 4O55A 2HHXA 1NLVA 1NJIO 4BE1A 4OJRA 1TK8A 4BGBA 3KZBA 4ZTJA 4CBUA 1RDDA 4FYDA 4ELTA 4ICLA 1U45A 4CGJA 1Q18A 4JN4A 1UA0A 5HP1A 4WFBL 1HRHA 3EZ5A 3O9UA 3OYKA 4DQIA 2HF4A 3SMSA 2KFNA 2P9KA 1T03A 3O9TA 3SV4A 3QO9A 1BQNA 3VQPA 4CZFA 4LF8K 3AVLA 4DSFA 4FZZA 3TAPA 3NH1A 2Q0RA 4M3WA 1WNSA 4CEEA 5FRNA 5AZJA 5CYMA 1DEJA 3AARA 3DLHA 1WSGA 3OYFA 1KFSA 4H4MA 2YHWA 4PKIA 1BU6O 3BZKA 2DY4A 1T3VA 4WQ5A 4ID5A 1VQLN 3GBTA 4K43A 2QEXN 1IBMK 2CGKA 3QICA 4W5TA 1NGHA 5GAGP 5C15A 3E66A 4A61A 1VSLA 1U6ZA 5HRSA 4BRQA 4RW8A 4MLHA 3LDPA 5EU7A 4CD3A 3NFAA 5AQOA 4QOZB 2IGIA 3HM8A 4PKHA 2VWBA 4H0OA 4JK9A 4QS9A 1EWQA 3NF8A 1BWFO 3SQ4A 1S1WA 4BR9A 1C0FA 1RBRA 3ITHA 3TWHA 4OLAA 2D0AA 2VG5A 1TL3A 2YHXA 2QWNA 2OTLN 2RE2A 1BA0A 4CHNA 3CMAN 5J2MA 3SPZA 1BDGA 2UUAK 4BDYA 4Z4CA 1RT4A 5AQYA 5HROA 2IVNA 4LH4A 1QHAA 2E2PA 4B8AB 4DU1A 5M1FA 1OVQA 4IXCA 5FPNA 3OVNA 5GIOA 4JI3K 4FJ9A 5JVHL 2Z1JA 1U49A 4LH5A 1EWRA 2ASMA 4CIEA 2ETJA 4N5SA 4H5TA 1JCFA 1V4SA 2DTUA 2PY5A 4JYAK
chains in the Genus database with same CATH topology
4JS5A 2JGUA 3UIQA 2D0CA 3L3UA 4M3TA 3OYHA 4FJKA 3OYLA 1UA1A 2O4GA 3KLIA 5KI6A 3HXMA 4FLUA 4KREA 3AA3A 4CGGA 3DYAA 5FRMA 1DTQA 3SUNA 3AA4A 1WLJA 1QSSA 3NCIA 1DLOA 4CEFA 2QK9A 3ZSYA 4N56A 4Z4HA 4CJWA 3MECA 5KGWA 2DFHA 4CEAA 3VA3A 1LAVA 2BE2A 4O4GA 4FM2A 1ZBUA 4E7LA 3ZSXA 4CK3A 2VWKA 1RBUA 4Q0BA 1HMVA 3L2VA 4W5NA 3IG1A 2YNIA 3VQ5A 4CF9A 4BWJA 4N41A 1RILA 1EKEA 4M3RA 1XHZA 1SKSA 4FJ5A 3F73A 3HP6A 2A1RA 4RG8A 1X9MA 3NF7A 4OGCA 4CF2A 3BDPA 3K57A 4I2QA 2ZQBA 3CM5A 1WSEA 4HUFA 1U48A 3PV8A 2PZSA 3I8DA 2ZD1A 3RWUA 3QIPA 1S6PA 3D45A 4NYNA 4CJRA 4DTNA 3QEWA 3S9HA 4B9NA 3C95A 1JLFA 1Z25A 3HPHA 1CXQA 3EY1A 4E7HA 2ITGA 1NK4A 4FW1A 3AO1A 2Z1GA 1RT7A 2XO7A 2HW3A 4PY5A 4LSLA 1VSHA 3OYAA 1J53A 4DTUA 4KI6A 4QAGA 5CZ2A 2KZZA 1NKCA 1BGXT 1TKZA 3OJUA 3RRHA 3LZIA 3JYTA 4M42A 1RBVA 3TAMA 3MXIA 4FZYA 1LW2A 2BDPA 1C0UA 4UQGA 4BE0A 4PUOA 4DTRA 1VK0A 1BCOA 4E19A 1GOCA 3OS0A 4C8OA 1EETA 3AO3A 3KLFA 5HLFA 3HPOA 3KTQA 3WNHA 1LWFA 3L2QA 4CIGA 2E6MA 2XY6A 3WNEA 4BE2A 1W9HA 1XC9A 1KCFA 3ZSOA 3AVAA 4CJFA 4IKFA 3RR8A 4FJMA 4KHQA 2PYJA 5DMRA 4H4OA 2KZMA 1S1TA 2VG7A 3K5LA 3S3NA 4DSEA 3AVCA 3KIOA 1A5WA 4ELVA 4DSIA 1NK0A 4CFAA 1QSYA 1L3SA 1D8YA 3U6FA 4CJVA 3V9SA 1I39A 1YVUA 4DWIA 4B9VA 3QEXA 1QQCA 1S9EA 4KHSA 4KI4A 1S5JA 4DTSA 3RRGA 1C1BA 3AVIA 2HHQA 3DRSA 3RMAA 1QS4A 3M8PA 3QEPA 1TK5A 3QNOA 4FLZA 1L3VA 1WAJA 5CYQA 2W42A 3V1QA 4WE1A 1U4BA 2HHWA 4CJ5A 3HJFA 4AHVA 3F9KA 4IFVA 5JS2A 3DM2A 1BQMA 3DRPA 3ZSQA 4Y1DA 3ZCMA 1QSLA 2QKKA 1CZBA 1HYZA 3ZSWA 1ZBIA 4NCBA 1WN7A 2G8WA 2YHAA 4E0DA 4B3OA 4CHYA 4RW7A 3NGZA 1DTTA 4CJSA 1RT3A 4F4KA 4DF4A 3KKRA 1TAUA 2ZE2A 4CFDA 3V1OA 4GW6A 4CERA 2FC0A 3SCXA 1KRPA 4AHRA 1RTIA 3FFIA 3JSMA 4FJLA 2OPPA 3WNFA 3SUOA 4TSXA 3SYZA 4R5PA 4Z4EA 3AO5A 1W0HA 3S3MA 4FZXC 4FK0A 3SUPA 1Y97A 3LPUA 3OYMA 3NF9A 1BISA 2HB5A 3RR7A 1FXXA 2JLEA 2X6SA 4AHSA 3U3YA 2Z1HA 5CZ1A 2XHBA 3MAQA 4KKOA 4LD0A 4CHPA 3TANA 3KLEA 3QLHA 1S6QA 4MFBA 1FKOA 4DU4A 1SKRA 3DLRA 4PQUA 2HHUA 3OYGA 3HK2A 4BACA 1BCMA 2B6AA 2YNFA 3O4NA 1B9FA 4CEZA 3NHGA 4CEDA 3L2RA 3TAFA 1KLNA 3KLHA 1T7PA 3P5JA 1GOBA 1ASVA 1WSJA 5K14A 4J2BA 1VSIA 4OGEA 4AHTA 4CJEA 4CJTA 4OKEA 3HVRA 1TKDA 1NK6A 2LSNA 1FK9A 2YNGA 5HRRA 3RTVA 1CLQA 2X78A 1I3AA 2FBTA 3O3HA 4CHZA 3CFRA 3SUQA 1WSHA 2IS3A 1Z26A 3QETA 1SL0A 1L5UA 3DOLA 2BANA 2WOMA 3NF6A 1T8EA 2OYQA 3HL8A 1J9AA 1NK9A 4DSKA 1S1UA 1LW0A 3KK1A 3SQ0A 4CESA 1RT5A 3OS2A 3IS9A 4NYFA 3AVMA 3QINA 4IDKA 5C25A 2Y1IA 4ZTFA 1T05A 3NH0A 1JL2A 2RN2A 4CK2A 1VSFA 3VQQA 4C8KA 4J2EA 4KV8A 4F2SA 1D9DA 1BI4A 1KLMA 3K5OA 3QIOA 1VSKA 3H08A 1JLGA 3V81A 4FLXA 5J2QA 3B6OA 2HMIA 1ASUA 2YHBA 4DLEA 5J2PA 3OYBA 3HM9A 1JLAA 3MEEA 3I0SA 4IBNA 3QERA 1N6QA 2O4IA 4DTPA 3KK2A 3M8RA 4M3ZA 1C0MA 4F3TA 1RT1A 5SZTA 1C1AA 4KB1A 4N76A 3SNNA 4NCGA 4E7IA 4CEQA 3G10A 1RDAA 3HSTB 4HCCA 2G8VA 1C0TA 3VQCA 4OLAA 1YT3A 3CM6A 3M8QA 2HNYA 3LDSA 1X1PA 4CEBA 2P5OA 4OPJA 1HNVA 4E7KA 1VRUA 3TR8A 4FJ7A 4FM1A 1UAXA 5FROA 3LANA 1L3UA 3VQBA 4E1NA 1NKBA 4FJGA 4JLHA 3LP1A 1BHLA 1S1XA 1ZBHA 4DF8A 1CXUA 3LPTA 4CHQA 2F8SA 4J2DA 1JLEA 3HPGA 4AH9A 1HJRA 3QEVA 3ZT3A 4CF1A 2FBYA 3CYMA 3HP9A 4FLWA 3SQ1A 3KD5E 4HCBA 4KO0A 3ZT1A 1XWLA 4LY7A 4RW9A 3OYIA 4ID1A 3RMBA 1XI1A 1NK5A 4CIFA 3O3GA 3C94A 3AVHA 3LZJA 2IC3A 3KJVA 3TAQA 3BGRA 1R0AA 3KD1E 4KHNA 4EZ6A 1K6YA 1RCHA 2B4JA 3DLGA 3LALA 5HRPA 4DS4A 3M8SA 3T19A 4I7FA 1KVBA 4HVJA 4E7JA 4FXDA 2KW4A 3DMJA 4CJPA 4DTOA 4CJUA 3TARA 1BL3A 3KLGA 4DU3A 3S3OA 1WSIA 3I0RA 4PA1A 1QE1A 3ULDA 3IAYA 4K8XA 3AO2A 2PYLA 5JS1A 1NJYA 2P51A 3K59A 4MQ3A 1NJXA 1QHTA 5J1EA 2ATQA 4O0JA 3VN5A 4YNQA 1L3TA 4W5QA 3SZ2A 3ZSRA 1KVCA 3LP2A 4M3YA 3O3FA 4M45A 3P1GA 3DLEA 4HHTA 1C6VA 1HQUA 1RDBA 5KTQA 4IG3A 4ZHRA 1X9WA 2HVIA 3DLKA 3AV9A 4IG0A 4CE9A 3NGIA 3SI6A 1RT2A 1TKTA 3OYDA 4E3SA 5C42A 4F2RA 3CFOA 4CHOA 4DFMA 4Y1CA 3AVKA 3VQ9A 1U47A 3NE6A 1HQEA 1O1WA 2XRIA 1RBSA 1EX4A 2XY8A 4KRFA 2OPQA 4FW2A 3A2FA 3ZT0A 3LWMA 4CFBA 3V9UA 5KRTA 4FCYA 3OYJA 1N5YA 3V9ZA 1B92A 3T3FA 1G15A 2FBXA 4CJ3A 3OYNA 2G8HA 2GV9A 4FVMA 4GVMA 3L2UA 1LV5A 4JRPA 3THVA 3V9WA 3LP3A 3ZSZA 3QEIA 4HTUA 4HUEA 4C8NA 2OPRA 1SKWA 4DLGA 3MXJA 4H8KA 3L8BA 2Q3SA 3SPYA 4FJIA 3ZT4A 3PX4A 1HNIA 1VRTA 4I9LA 3PX6A 3MEGA 1LAWA 1SL2A 4NCAA 2OA8A 3ASMA 2B5JA 4Z4GA 4E1MA 1YTAA 1D5AA 3VQ6A 3VQ8A 1Q8IA 4B9LA 2G8IA 2HVHA 3VQ7A 2RKIA 2X6NA 2Y1JA 1TVRA 3V9XA 5I42A 4BWMA 1EP4A 4DQRA 4CJKA 4Z4FA 2AJQA 4DFJA 4KFBA 3TI0A 1JLCA 3V6DA 1ZBFA 3NH2A 1LWCA 2IOCA 1F21A 4I2PA 3VQAA 4BDZA 4I9QA 4FJNA 4KAZA 1JKHA 4JRQA 3QNNA 4DQPA 5HRNA 1ASWA 2YKNA 4CEOA 1IKWA 4KTWA 4N47A 3K58A 4DG1A 1RNHA 5KRSA 3K2PA 4GMJB 2DFEA 3PO4A 4E89A 1RT6A 3D0PA 4C8LA 4ELUA 1FKPA 2IDOA 3OYEA 2E4LA 1BI4B 4DS5A 3NGYA 2KQ2A 1GOAA 1TKXA 2EX3A 3V1RA 1BIUA 1HPZA 5SWMA 4CK1A 4HUGA 4KB0A 4KTQA 3HO1A 1WAFA 1C1CA 1TV6A 2G8KA 2RF2A 4W5RA 4KHYA 3VA0A 3PUFA 3K5MA 3HVTA 2KTQA 4JS4A 4KHWA 1Q9YA 1KVAA 4CF8A 3PO5A 2F8TA 5E41A 4RW4A 4M3XA 2P1JA 1IKXA 2YNHA 5D3GA 2QKBA 3ZT2A 2YKMA 2DFFA 1LWEA 4OKKA 4Z0UA 3OYCA 4FJXA 4CGHA 5T7BA 2BGGA 4O55A 2HHXA 5I3UA 5HBMA 3LAMA 3CFPA 2HHTA 2WONA 3DRRA 4BE1A 4KPYA 4OJRA 1TK8A 3TAEA 1UOCA 1TAQA 3K5NA 1NOZA 4ZTJA 3AA5X 1RDDA 3L2WA 2F96A 4FYDA 1U04A 1ITGA 4BDPA 4ELTA 3AVGA 1YTUA 3HYFA 5KGXA 2RPIA 4ICLA 3LP0A 4CGJA 4CJ4A 1BIZA 1U45A 2PY5A 4L8RB 2E6LA 4KHUA 1UA0A 5HP1A 2VG6A 2G8FA 3B6PA 1HRHA 1RBTA 3EZ5A 1ZBLA 1SV5A 4CGFA 3OYKA 1ZYQA 1KFDA 4DFPA 1JLBA 4DQIA 4OKJA 4G1QA 4YFUA 1JXBA 2HHSA 2KFNA 5FDLA 3DI6A 3DOKA 3MEDA 1IH7A 1T03A 3SV4A 2VWJA 3QO9A 2HNDA 1J54A 1BQNA 4CJQA 1VSMA 3VQPA 3TAGA 4CJLA 1S1VA 2GBZA 3AVLA 4DSFA 3E01A 1D9FA 4FZZA 4OLBA 1RTJA 3TAPA 3O4QA 3NH1A 1NJZA 4M3WA 2HHVA 2IAJA 3EYZA 3SQ2A 1RTDA 1QTMA 3CG7A 1WNSA 1J5OA 4AHUA 4DSJA 3L3VA 2KFZA 4CEEA 3LWLA 4CCHA 4DQQA 5FRNA 4OVLA 2A1SA 5CYMA 5DK5A 4FM0A 4EP4A 3DLHA 1SUQA 1WSGA 4M41A 3OYFA 3T1AA 1IO2A 1KSPA 4AILC 1KFSA 2YV0X 4H4MA 1NOYA 3QESA 4CECA 4DTXA 4Z4IA 3OJSA 4DTMA 3CQ8A 1MU2A 2HNZA 2DY4A 1SL1A 3AVFA 4ID5A 4O5BA 1EXQA 3AO4A 3SJJA 4RW6A 3U3GA 4B9TA 3ALYA 4CGIA 3V4IA 2P5GA 4DMNA 4W5TA 4DSLA 1VSDA 4DTJA 3KKSA 1JL1A 1VSEA 1VSLA 1RDCA 1WSFA 2I5JA 1NKEA 3PY8A 1JXEA 3ISNC 2FBVA 5HRSA 1UWBA 4RW8A 2OZMA 4F8RA 3VQEA 4EP5A 4XIUA 1S9GA 5EU7A 4FLYA 2D0BA 4C8MA 3NFAA 4QOZB 1RTHA 2IGIA 4IFYA 1A5XA 3AA2A 4O0IA 1TGOA 1VSJA 4CF0A 3NF8A 3SQ4A 1B9DA 1S1WA 3MXMA 2QXFA 2XY5A 3RMDA 1HYSA 4FJ8A 3KK3A 4DFKA 4AHCA 3NAEA 4DQSA 1RBRA 3OS1A 3ITHA 4M3UA 5CY4A 2R7YA 3AVJA 1CZ9A 2D0AA 3TWHA 2VG5A 1TL3A 3IRXA 4W5OA 3NDKA 2OZSA 4EZ9A 1XHXA 4O44A 1HYVA 2OPSA 3AVBA 1Q9XA 4KTZA 4B08A 4B9SA 3C6TA 4CHNA 2X74A 1JLQA 3NBPA 5J2MA 3SPZA 1X9SA 4PWDA 1TK0A 4B8CA 4FK2A 4QCLA 4CFCA 1REVA 4Q5VA 4Z4CA 4BDYA 3DLBA 2D5RA 3G0ZA 1A5VA 1RT4A 3VQDA 3ZSVA 4OPKA 5HROA 4B9UA 4LSNA 5J2NA 1IG9A 4LH4A 4B8AB 4DU1A 1NK7A 4B9MA 3VQ4A 1NJWA 1IKYA 1NK8A 3OY9A 3SV3A 3TABA 3OVNA 4K8ZA 1IKVA 4FJ9A 4F3OA 3P83D 4J2AA 2Z1JA 2GUIA 3C6UA 1U49A 4LH5A 4FLVA 3LAKA 3WNGA 4CIEA 4CGDA 2ETJA 4N5SA 2Z1IA 5C24A 3PX0A 3HT3A 2G8UA 3RMCA 4FJHA 4FK4A 4FLTA 1TL1A 2XY7A 1KTQA 2DTUA 2EHGA 2NUBA 4FJJA 3AVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JS5 A;  2JGU A;  3UIQ A;  2D0C A;  3L3U A;  4M3T A;  3OYH A;  4FJK A;  3OYL A;  1UA1 A;  2O4G A;  3KLI A;  5KI6 A;  3HXM A;  4FLU A;  4KRE A;  3AA3 A;  4CGG A;  3DYA A;  5FRM A;  1DTQ A;  3SUN A;  3AA4 A;  1WLJ A;  1QSS A;  3NCI A;  1DLO A;  4CEF A;  2QK9 A;  3ZSY A;  4N56 A;  4Z4H A;  4CJW A;  3MEC A;  5KGW A;  2DFH A;  4CEA A;  3VA3 A;  1LAV A;  2BE2 A;  4O4G A;  4FM2 A;  1ZBU A;  4E7L A;  3ZSX A;  4CK3 A;  2VWK A;  1RBU A;  4Q0B A;  1HMV A;  3L2V A;  4W5N A;  3IG1 A;  2YNI A;  3VQ5 A;  4CF9 A;  4BWJ A;  4N41 A;  1RIL A;  1EKE A;  4M3R A;  1XHZ A;  1SKS A;  4FJ5 A;  3F73 A;  3HP6 A;  2A1R A;  4RG8 A;  1X9M A;  3NF7 A;  4OGC A;  4CF2 A;  3BDP A;  3K57 A;  4I2Q A;  2ZQB A;  3CM5 A;  1WSE A;  4HUF A;  1U48 A;  3PV8 A;  2PZS A;  3I8D A;  2ZD1 A;  3RWU A;  3QIP A;  1S6P A;  3D45 A;  4NYN A;  4CJR A;  4DTN A;  3QEW A;  3S9H A;  4B9N A;  3C95 A;  1JLF A;  1Z25 A;  3HPH A;  1CXQ A;  3EY1 A;  4E7H A;  2ITG A;  1NK4 A;  4FW1 A;  3AO1 A;  2Z1G A;  1RT7 A;  2XO7 A;  2HW3 A;  4PY5 A;  4LSL A;  1VSH A;  3OYA A;  1J53 A;  4DTU A;  4KI6 A;  4QAG A;  5CZ2 A;  2KZZ A;  1NKC A;  1BGX T;  1TKZ A;  3OJU A;  3RRH A;  3LZI A;  3JYT A;  4M42 A;  1RBV A;  3TAM A;  3MXI A;  4FZY A;  1LW2 A;  2BDP A;  1C0U A;  4UQG A;  4BE0 A;  4PUO A;  4DTR A;  1VK0 A;  1BCO A;  4E19 A;  1GOC A;  3OS0 A;  4C8O A;  1EET A;  3AO3 A;  3KLF A;  5HLF A;  3HPO A;  3KTQ A;  3WNH A;  1LWF A;  3L2Q A;  4CIG A;  2E6M A;  2XY6 A;  3WNE A;  4BE2 A;  1W9H A;  1XC9 A;  1KCF A;  3ZSO A;  3AVA A;  4CJF A;  4IKF A;  3RR8 A;  4FJM A;  4KHQ A;  2PYJ A;  5DMR A;  4H4O A;  2KZM A;  1S1T A;  2VG7 A;  3K5L A;  3S3N A;  4DSE A;  3AVC A;  3KIO A;  1A5W A;  4ELV A;  4DSI A;  1NK0 A;  4CFA A;  1QSY A;  1L3S A;  1D8Y A;  3U6F A;  4CJV A;  3V9S A;  1I39 A;  1YVU A;  4DWI A;  4B9V A;  3QEX A;  1QQC A;  1S9E A;  4KHS A;  4KI4 A;  1S5J A;  4DTS A;  3RRG A;  1C1B A;  3AVI A;  2HHQ A;  3DRS A;  3RMA A;  1QS4 A;  3M8P A;  3QEP A;  1TK5 A;  3QNO A;  4FLZ A;  1L3V A;  1WAJ A;  5CYQ A;  2W42 A;  3V1Q A;  4WE1 A;  1U4B A;  2HHW A;  4CJ5 A;  3HJF A;  4AHV A;  3F9K A;  4IFV A;  5JS2 A;  3DM2 A;  1BQM A;  3DRP A;  3ZSQ A;  4Y1D A;  3ZCM A;  1QSL A;  2QKK A;  1CZB A;  1HYZ A;  3ZSW A;  1ZBI A;  4NCB A;  1WN7 A;  2G8W A;  2YHA A;  4E0D A;  4B3O A;  4CHY A;  4RW7 A;  3NGZ A;  1DTT A;  4CJS A;  1RT3 A;  4F4K A;  4DF4 A;  3KKR A;  1TAU A;  2ZE2 A;  4CFD A;  3V1O A;  4GW6 A;  4CER A;  2FC0 A;  3SCX A;  1KRP A;  4AHR A;  1RTI A;  3FFI A;  3JSM A;  4FJL A;  2OPP A;  3WNF A;  3SUO A;  4TSX A;  3SYZ A;  4R5P A;  4Z4E A;  3AO5 A;  1W0H A;  3S3M A;  4FZX C;  4FK0 A;  3SUP A;  1Y97 A;  3LPU A;  3OYM A;  3NF9 A;  1BIS A;  2HB5 A;  3RR7 A;  1FXX A;  2JLE A;  2X6S A;  4AHS A;  3U3Y A;  2Z1H A;  5CZ1 A;  2XHB A;  3MAQ A;  4KKO A;  4LD0 A;  4CHP A;  3TAN A;  3KLE A;  3QLH A;  1S6Q A;  4MFB A;  1FKO A;  4DU4 A;  1SKR A;  3DLR A;  4PQU A;  2HHU A;  3OYG A;  3HK2 A;  4BAC A;  1BCM A;  2B6A A;  2YNF A;  3O4N A;  1B9F A;  4CEZ A;  3NHG A;  4CED A;  3L2R A;  3TAF A;  1KLN A;  3KLH A;  1T7P A;  3P5J A;  1GOB A;  1ASV A;  1WSJ A;  5K14 A;  4J2B A;  1VSI A;  4OGE A;  4AHT A;  4CJE A;  4CJT A;  4OKE A;  3HVR A;  1TKD A;  1NK6 A;  2LSN A;  1FK9 A;  2YNG A;  5HRR A;  3RTV A;  1CLQ A;  2X78 A;  1I3A A;  2FBT A;  3O3H A;  4CHZ A;  3CFR A;  3SUQ A;  1WSH A;  2IS3 A;  1Z26 A;  3QET A;  1SL0 A;  1L5U A;  3DOL A;  2BAN A;  2WOM A;  3NF6 A;  1T8E A;  2OYQ A;  3HL8 A;  1J9A A;  1NK9 A;  4DSK A;  1S1U A;  1LW0 A;  3KK1 A;  3SQ0 A;  4CES A;  1RT5 A;  3OS2 A;  3IS9 A;  4NYF A;  3AVM A;  3QIN A;  4IDK A;  5C25 A;  2Y1I A;  4ZTF A;  1T05 A;  3NH0 A;  1JL2 A;  2RN2 A;  4CK2 A;  1VSF A;  3VQQ A;  4C8K A;  4J2E A;  4KV8 A;  4F2S A;  1D9D A;  1BI4 A;  1KLM A;  3K5O A;  3QIO A;  1VSK A;  3H08 A;  1JLG A;  3V81 A;  4FLX A;  5J2Q A;  3B6O A;  2HMI A;  1ASU A;  2YHB A;  4DLE A;  5J2P A;  3OYB A;  3HM9 A;  1JLA A;  3MEE A;  3I0S A;  4IBN A;  3QER A;  1N6Q A;  2O4I A;  4DTP A;  3KK2 A;  3M8R A;  4M3Z A;  1C0M A;  4F3T A;  1RT1 A;  5SZT A;  1C1A A;  4KB1 A;  4N76 A;  3SNN A;  4NCG A;  4E7I A;  4CEQ A;  3G10 A;  1RDA A;  3HST B;  4HCC A;  2G8V A;  1C0T A;  3VQC A;  4OLA A;  1YT3 A;  3CM6 A;  3M8Q A;  2HNY A;  3LDS A;  1X1P A;  4CEB A;  2P5O A;  4OPJ A;  1HNV A;  4E7K A;  1VRU A;  3TR8 A;  4FJ7 A;  4FM1 A;  1UAX A;  5FRO A;  3LAN A;  1L3U A;  3VQB A;  4E1N A;  1NKB A;  4FJG A;  4JLH A;  3LP1 A;  1BHL A;  1S1X A;  1ZBH A;  4DF8 A;  1CXU A;  3LPT A;  4CHQ A;  2F8S A;  4J2D A;  1JLE A;  3HPG A;  4AH9 A;  1HJR A;  3QEV A;  3ZT3 A;  4CF1 A;  2FBY A;  3CYM A;  3HP9 A;  4FLW A;  3SQ1 A;  3KD5 E;  4HCB A;  4KO0 A;  3ZT1 A;  1XWL A;  4LY7 A;  4RW9 A;  3OYI A;  4ID1 A;  3RMB A;  1XI1 A;  1NK5 A;  4CIF A;  3O3G A;  3C94 A;  3AVH A;  3LZJ A;  2IC3 A;  3KJV A;  3TAQ A;  3BGR A;  1R0A A;  3KD1 E;  4KHN A;  4EZ6 A;  1K6Y A;  1RCH A;  2B4J A;  3DLG A;  3LAL A;  5HRP A;  4DS4 A;  3M8S A;  3T19 A;  4I7F A;  1KVB A;  4HVJ A;  4E7J A;  4FXD A;  2KW4 A;  3DMJ A;  4CJP A;  4DTO A;  4CJU A;  3TAR A;  1BL3 A;  3KLG A;  4DU3 A;  3S3O A;  1WSI A;  3I0R A;  4PA1 A;  1QE1 A;  3ULD A;  3IAY A;  4K8X A;  3AO2 A;  2PYL A;  5JS1 A;  1NJY A;  2P51 A;  3K59 A;  4MQ3 A;  1NJX A;  1QHT A;  5J1E A;  2ATQ A;  4O0J A;  3VN5 A;  4YNQ A;  1L3T A;  4W5Q A;  3SZ2 A;  3ZSR A;  1KVC A;  3LP2 A;  4M3Y A;  3O3F A;  4M45 A;  3P1G A;  3DLE A;  4HHT A;  1C6V A;  1HQU A;  1RDB A;  5KTQ A;  4IG3 A;  4ZHR A;  1X9W A;  2HVI A;  3DLK A;  3AV9 A;  4IG0 A;  4CE9 A;  3NGI A;  3SI6 A;  1RT2 A;  1TKT A;  3OYD A;  4E3S A;  5C42 A;  4F2R A;  3CFO A;  4CHO A;  4DFM A;  4Y1C A;  3AVK A;  3VQ9 A;  1U47 A;  3NE6 A;  1HQE A;  1O1W A;  2XRI A;  1RBS A;  1EX4 A;  2XY8 A;  4KRF A;  2OPQ A;  4FW2 A;  3A2F A;  3ZT0 A;  3LWM A;  4CFB A;  3V9U A;  5KRT A;  4FCY A;  3OYJ A;  1N5Y A;  3V9Z A;  1B92 A;  3T3F A;  1G15 A;  2FBX A;  4CJ3 A;  3OYN A;  2G8H A;  2GV9 A;  4FVM A;  4GVM A;  3L2U A;  1LV5 A;  4JRP A;  3THV A;  3V9W A;  3LP3 A;  3ZSZ A;  3QEI A;  4HTU A;  4HUE A;  4C8N A;  2OPR A;  1SKW A;  4DLG A;  3MXJ A;  4H8K A;  3L8B A;  2Q3S A;  3SPY A;  4FJI A;  3ZT4 A;  3PX4 A;  1HNI A;  1VRT A;  4I9L A;  3PX6 A;  3MEG A;  1LAW A;  1SL2 A;  4NCA A;  2OA8 A;  3ASM A;  2B5J A;  4Z4G A;  4E1M A;  1YTA A;  1D5A A;  3VQ6 A;  3VQ8 A;  1Q8I A;  4B9L A;  2G8I A;  2HVH A;  3VQ7 A;  2RKI A;  2X6N A;  2Y1J A;  1TVR A;  3V9X A;  5I42 A;  4BWM A;  1EP4 A;  4DQR A;  4CJK A;  4Z4F A;  2AJQ A;  4DFJ A;  4KFB A;  3TI0 A;  1JLC A;  3V6D A;  1ZBF A;  3NH2 A;  1LWC A;  2IOC A;  1F21 A;  4I2P A;  3VQA A;  4BDZ A;  4I9Q A;  4FJN A;  4KAZ A;  1JKH A;  4JRQ A;  3QNN A;  4DQP A;  5HRN A;  1ASW A;  2YKN A;  4CEO A;  1IKW A;  4KTW A;  4N47 A;  3K58 A;  4DG1 A;  1RNH A;  5KRS A;  3K2P A;  4GMJ B;  2DFE A;  3PO4 A;  4E89 A;  1RT6 A;  3D0P A;  4C8L A;  4ELU A;  1FKP A;  2IDO A;  3OYE A;  2E4L A;  1BI4 B;  4DS5 A;  3NGY A;  2KQ2 A;  1GOA A;  1TKX A;  2EX3 A;  3V1R A;  1BIU A;  1HPZ A;  5SWM A;  4CK1 A;  4HUG A;  4KB0 A;  4KTQ A;  3HO1 A;  1WAF A;  1C1C A;  1TV6 A;  2G8K A;  2RF2 A;  4W5R A;  4KHY A;  3VA0 A;  3PUF A;  3K5M A;  3HVT A;  2KTQ A;  4JS4 A;  4KHW A;  1Q9Y A;  1KVA A;  4CF8 A;  3PO5 A;  2F8T A;  5E41 A;  4RW4 A;  4M3X A;  2P1J A;  1IKX A;  2YNH A;  5D3G A;  2QKB A;  3ZT2 A;  2YKM A;  2DFF A;  1LWE A;  4OKK A;  4Z0U A;  3OYC A;  4FJX A;  4CGH A;  5T7B A;  2BGG A;  4O55 A;  2HHX A;  5I3U A;  5HBM A;  3LAM A;  3CFP A;  2HHT A;  2WON A;  3DRR A;  4BE1 A;  4KPY A;  4OJR A;  1TK8 A;  3TAE A;  1UOC A;  1TAQ A;  3K5N A;  1NOZ A;  4ZTJ A;  3AA5 X;  1RDD A;  3L2W A;  2F96 A;  4FYD A;  1U04 A;  1ITG A;  4BDP A;  4ELT A;  3AVG A;  1YTU A;  3HYF A;  5KGX A;  2RPI A;  4ICL A;  3LP0 A;  4CGJ A;  4CJ4 A;  1BIZ A;  1U45 A;  2PY5 A;  4L8R B;  2E6L A;  4KHU A;  1UA0 A;  5HP1 A;  2VG6 A;  2G8F A;  3B6P A;  1HRH A;  1RBT A;  3EZ5 A;  1ZBL A;  1SV5 A;  4CGF A;  3OYK A;  1ZYQ A;  1KFD A;  4DFP A;  1JLB A;  4DQI A;  4OKJ A;  4G1Q A;  4YFU A;  1JXB A;  2HHS A;  2KFN A;  5FDL A;  3DI6 A;  3DOK A;  3MED A;  1IH7 A;  1T03 A;  3SV4 A;  2VWJ A;  3QO9 A;  2HND A;  1J54 A;  1BQN A;  4CJQ A;  1VSM A;  3VQP A;  3TAG A;  4CJL A;  1S1V A;  2GBZ A;  3AVL A;  4DSF A;  3E01 A;  1D9F A;  4FZZ A;  4OLB A;  1RTJ A;  3TAP A;  3O4Q A;  3NH1 A;  1NJZ A;  4M3W A;  2HHV A;  2IAJ A;  3EYZ A;  3SQ2 A;  1RTD A;  1QTM A;  3CG7 A;  1WNS A;  1J5O A;  4AHU A;  4DSJ A;  3L3V A;  2KFZ A;  4CEE A;  3LWL A;  4CCH A;  4DQQ A;  5FRN A;  4OVL A;  2A1S A;  5CYM A;  5DK5 A;  4FM0 A;  4EP4 A;  3DLH A;  1SUQ A;  1WSG A;  4M41 A;  3OYF A;  3T1A A;  1IO2 A;  1KSP A;  4AIL C;  1KFS A;  2YV0 X;  4H4M A;  1NOY A;  3QES A;  4CEC A;  4DTX A;  4Z4I A;  3OJS A;  4DTM A;  3CQ8 A;  1MU2 A;  2HNZ A;  2DY4 A;  1SL1 A;  3AVF A;  4ID5 A;  4O5B A;  1EXQ A;  3AO4 A;  3SJJ A;  4RW6 A;  3U3G A;  4B9T A;  3ALY A;  4CGI A;  3V4I A;  2P5G A;  4DMN A;  4W5T A;  4DSL A;  1VSD A;  4DTJ A;  3KKS A;  1JL1 A;  1VSE A;  1VSL A;  1RDC A;  1WSF A;  2I5J A;  1NKE A;  3PY8 A;  1JXE A;  3ISN C;  2FBV A;  5HRS A;  1UWB A;  4RW8 A;  2OZM A;  4F8R A;  3VQE A;  4EP5 A;  4XIU A;  1S9G A;  5EU7 A;  4FLY A;  2D0B A;  4C8M A;  3NFA A;  4QOZ B;  1RTH A;  2IGI A;  4IFY A;  1A5X A;  3AA2 A;  4O0I A;  1TGO A;  1VSJ A;  4CF0 A;  3NF8 A;  3SQ4 A;  1B9D A;  1S1W A;  3MXM A;  2QXF A;  2XY5 A;  3RMD A;  1HYS A;  4FJ8 A;  3KK3 A;  4DFK A;  4AHC A;  3NAE A;  4DQS A;  1RBR A;  3OS1 A;  3ITH A;  4M3U A;  5CY4 A;  2R7Y A;  3AVJ A;  1CZ9 A;  2D0A A;  3TWH A;  2VG5 A;  1TL3 A;  3IRX A;  4W5O A;  3NDK A;  2OZS A;  4EZ9 A;  1XHX A;  4O44 A;  1HYV A;  2OPS A;  3AVB A;  1Q9X A;  4KTZ A;  4B08 A;  4B9S A;  3C6T A;  4CHN A;  2X74 A;  1JLQ A;  3NBP A;  5J2M A;  3SPZ A;  1X9S A;  4PWD A;  1TK0 A;  4B8C A;  4FK2 A;  4QCL A;  4CFC A;  1REV A;  4Q5V A;  4Z4C A;  4BDY A;  3DLB A;  2D5R A;  3G0Z A;  1A5V A;  1RT4 A;  3VQD A;  3ZSV A;  4OPK A;  5HRO A;  4B9U A;  4LSN A;  5J2N A;  1IG9 A;  4LH4 A;  4B8A B;  4DU1 A;  1NK7 A;  4B9M A;  3VQ4 A;  1NJW A;  1IKY A;  1NK8 A;  3OY9 A;  3SV3 A;  3TAB A;  3OVN A;  4K8Z A;  1IKV A;  4FJ9 A;  4F3O A;  3P83 D;  4J2A A;  2Z1J A;  2GUI A;  3C6U A;  1U49 A;  4LH5 A;  4FLV A;  3LAK A;  3WNG A;  4CIE A;  4CGD A;  2ETJ A;  4N5S A;  2Z1I A;  5C24 A;  3PX0 A;  3HT3 A;  2G8U A;  3RMC A;  4FJH A;  4FK4 A;  4FLT A;  1TL1 A;  2XY7 A;  1KTQ A;  2DTU A;  2EHG A;  2NUB A;  4FJJ A;  3AVN A; 
#chains in the Genus database with same CATH topology
 3CJ1 A;  4FJK A;  2VYP A;  3HXM A;  4FLU A;  4KRE A;  3AA3 A;  4CGG A;  1HNZ K;  3AA4 A;  2IIR A;  3F5T A;  4CEA A;  2VWK A;  4BC4 A;  1HMV A;  4DKW A;  5AQM A;  3VQ5 A;  1XHZ A;  4A62 A;  3J7Y P;  1YAG A;  1WB9 A;  1U48 A;  3LDN A;  4HUF A;  1YJW N;  4AM7 A;  3D45 A;  4BRO A;  4NYN A;  3FZL A;  3UKU A;  2GWK A;  3QEW A;  3S9H A;  2O8F A;  4G9Z A;  3HPH A;  1ILY A;  3HRG A;  3CJC A;  4LSL A;  1VSH A;  3OYA A;  1J53 A;  4DTU A;  4QAG A;  1NKC A;  3LZI A;  3JYT A;  2Q0U A;  3TAM A;  3MXI A;  2P9L B;  1C0U A;  4UQG A;  3ULE B;  3FZK A;  5H1S Q;  4E19 A;  5EX5 A;  4LFC K;  5HLF A;  3HPO A;  3WNH A;  2XY6 A;  4BE2 A;  1W9H A;  4FWN A;  4K0K K;  3DJC A;  3AVA A;  5ADX H;  3CC4 N;  2V7Z A;  3AGR A;  3ATV A;  4DSE A;  4DSI A;  5LJV A;  3T69 A;  3U6F A;  4YHH K;  3V9S A;  4DWI A;  1QQC A;  5KPR A;  3VF2 A;  5KQ8 A;  3DXK B;  1WUA A;  4YOU A;  3A5O C;  5IWA K;  2OTJ N;  4FLZ A;  2W42 A;  2HHW A;  3M6G A;  1WOQ A;  1N33 K;  3CER A;  3ZSQ A;  3L6Q A;  4JK8 A;  2O8C B;  1CZB A;  1HYZ A;  3FR0 A;  5AQK A;  4BRA A;  1ZBI A;  3KVG A;  1X9J A;  5AQS A;  3QBX A;  4DV7 K;  3VOV A;  3NGZ A;  1DTT A;  5AQI A;  4F4K A;  1TAU A;  4GW6 A;  4CER A;  2FC0 A;  3OBY A;  1RTI A;  4DUZ K;  3WNF A;  4TSX A;  3TPQ A;  3AO5 A;  1W7A A;  4FK0 A;  3OYM A;  4WFN L;  1FXX A;  3VGM A;  4B1U B;  2JLE A;  3C6A A;  5JIC A;  4AHS A;  1MWK A;  4H0V B;  2Z1H A;  5CZ1 A;  2P9S B;  4LFB K;  1S6Q A;  1N32 K;  3VEO A;  5BR9 A;  1ASV A;  1GOB A;  1HKG A;  3E9L A;  4PL7 A;  1VSI A;  4CJE A;  1TKD A;  3MN5 A;  4RCH A;  2LSN A;  1FK9 A;  1Z6R A;  3MCA B;  3EO3 A;  5E26 A;  4CZJ A;  3QET A;  2CGJ A;  1SL0 A;  2WOM A;  5AQQ A;  3HL8 A;  4JEP A;  4CES A;  3OS2 A;  3AVM A;  4IDK A;  5C25 A;  2JWK A;  3NH0 A;  4CK2 A;  4V19 S;  4KV8 A;  3HSC A;  3H08 A;  4ILG B;  1JLG A;  1Y64 A;  3V81 A;  4FLX A;  4JK7 A;  1ASU A;  3PIP L;  4DLE A;  5BPL A;  3ENO A;  4WF9 L;  3LDQ A;  4KB1 A;  1VAZ A;  4NCG A;  5EXW A;  3G10 A;  1RDA A;  1X3M A;  2G8V A;  4AQY K;  3LDS A;  2HNY A;  4CEB A;  3SAF A;  4OPJ A;  1HNV A;  4Z4E A;  1VRU A;  3TR8 A;  3WXI A;  2ZGY A;  3DXM B;  4E1N A;  3VEY A;  3LP1 A;  1BHL A;  1R59 O;  3LPT A;  5BPM A;  3HPG A;  3ZT3 A;  3KD5 E;  3HP9 A;  4HCB A;  1NGE A;  4X64 K;  4KO0 A;  1YVN A;  3ZT1 A;  1XI1 A;  1NK5 A;  3ENB A;  2QWQ A;  5EVZ A;  3AVH A;  3LZJ A;  1R0A A;  1HNW K;  2A41 A;  4JKC A;  1YIT N;  4I7F A;  3UE5 A;  2KW4 A;  4CJU A;  3TAR A;  2QWL A;  1WSI A;  4PA1 A;  3ULD A;  4BRD A;  2YHY A;  3MK6 A;  4ISF A;  3K59 A;  3U9D A;  2AP1 A;  4FWL A;  2W6K A;  1NJX A;  4JKG A;  4W5Q A;  2GX9 A;  1C6V A;  1HQU A;  1RDB A;  4L3Q A;  2HVI A;  1G99 A;  4CE9 A;  3NGI A;  3IKM A;  4F2R A;  3CPE A;  4OX9 K;  1U47 A;  4KRF A;  3NVM A;  4FW2 A;  4CFB A;  2VQE K;  4F9O A;  4FCY A;  3OYJ A;  1NGG A;  1N5Y A;  2FBX A;  3OYN A;  2P9N A;  2G8H A;  5M1Q A;  3V9W A;  3WEE B;  4BRF A;  3AGK A;  5C12 A;  3HTV A;  1GLA G;  4HTU A;  4JI2 K;  4B3T K;  3MXJ A;  3ZT4 A;  4YOT A;  2IVO A;  3PX4 A;  1KXP A;  4DR7 K;  3MEG A;  1LAW A;  3A5M C;  2ZJQ L;  5M1K A;  4Z4G A;  4E1M A;  1D5A A;  2NRX A;  2NZT A;  1BUP A;  3H6E A;  2HVH A;  3ZET B;  3VQ7 A;  1TVR A;  3V9X A;  3H3O B;  4BWM A;  4Z4F A;  1JLC A;  5TKW A;  3S41 A;  3NH2 A;  2IOC A;  4I2P A;  3VQA A;  1JKH A;  4JRQ A;  4DQP A;  5ADX A;  1NGJ A;  4CEO A;  1Q86 O;  4N47 A;  3PO4 A;  1MA9 B;  1U2V B;  2DFE A;  1VQ6 N;  1MWM A;  1FKP A;  4DV6 K;  3OYE A;  4DV4 K;  4FWP A;  1GOA A;  1TKX A;  4HUG A;  1NMD A;  4IFE A;  4KTQ A;  3HO1 A;  1WAF A;  3Q7C A;  2RF2 A;  3K5M A;  2KTQ A;  3EKU A;  4FWQ A;  3A5N C;  3A5L C;  3KWI A;  3H3N O;  1NNE A;  4RW4 A;  4M3X A;  2YCH A;  5D3G A;  2NRR A;  2QWR A;  3ZT2 A;  2YKM A;  1YUW A;  2DFF A;  3GOI A;  3OYC A;  3I56 N;  4FJX A;  2BGG A;  2P9P A;  1SQK A;  2E5L K;  4GV9 A;  3LAM A;  2WON A;  2ZJR L;  4KPY A;  3TAE A;  1UOC A;  2CH5 A;  4FOE A;  3O9R A;  4JI6 K;  4HWI A;  4BRM A;  1GLL O;  3AA5 X;  3O8M A;  4YOW A;  3L2W A;  3O9Q A;  2HBM A;  3HOT A;  5KGX A;  2RPI A;  4JI4 K;  4CJ4 A;  4KHU A;  1BIZ A;  4JKA A;  1RBT A;  1ZBL A;  1SV5 A;  4CGF A;  1ZYQ A;  4DFP A;  1HR0 K;  1KAY A;  4OKJ A;  4FWK A;  4AF1 A;  1IV0 A;  5TKY A;  1SAZ A;  3O4W A;  1S1V A;  4IOA L;  1D9F A;  1RTJ A;  1D4X A;  5DK5 A;  4EP4 A;  1SUQ A;  4C1N I;  3SMP A;  2O8E B;  3O08 A;  2E2N A;  3SBG A;  1NOY A;  2D0O A;  3QES A;  4Z4I A;  4DTM A;  1MU2 A;  5LL6 Z;  5BR8 K;  1MDU B;  4O5B A;  1T44 A;  2UXD K;  1Q7Y O;  2GEL A;  2I7N A;  4B9T A;  3ALY A;  4CGI A;  1CZA N;  4BG9 A;  2P5G A;  3MN7 A;  4EFH A;  4DTJ A;  1VSE A;  1RDC A;  1WSF A;  1ZC6 A;  3FLC O;  3ISN C;  2FBV A;  1YJN N;  3CHW A;  3WQT A;  4F8R A;  3H1V X;  1S9G A;  4FLY A;  2D0B A;  1RTH A;  3AA2 A;  4BG8 A;  2QXL A;  2FSK A;  1H1V A;  2FXU A;  2UU9 K;  4BRI A;  3MXM A;  4BRG A;  4DQS A;  5DM6 L;  1CZ9 A;  2OZS A;  3NDK A;  4EZ9 A;  4RWT A;  1XHX A;  4O44 A;  1OH8 A;  1HYV A;  1C0G A;  2PBD A;  2JWL A;  3EKS A;  1X9S A;  3LDL A;  3HBT A;  4A5A A;  4KH4 A;  3QFU A;  3ZSV A;  4OPK A;  1OKJ A;  3TSQ A;  2QI2 A;  4JI0 K;  1NK7 A;  2A3Z A;  4X62 K;  2QA4 N;  1IKY A;  1NK8 A;  1S72 N;  3JAM O;  3OY9 A;  3EN9 A;  4J2A A;  2GUI A;  1E4F T;  1BA1 A;  4GKK K;  4CGD A;  3BF1 A;  2Z1I A;  5C0Y A;  3PX0 A;  4FK4 A;  4BRP A;  1J5E K;  2XY7 A;  1KTQ A;  1SZ2 A;  2BH1 A;  4FJJ A;  4JI1 K;  3CD6 N;  1EO1 A;  3OYH A;  3T7Z A;  3OYL A;  2O4G A;  1UA1 A;  2O8F B;  3IMX A;  5FRM A;  3TSU A;  1JCG A;  3NCI A;  1DLO A;  3ZSY A;  3MEC A;  3RSE A;  4FM2 A;  1RBU A;  4W5N A;  2YNI A;  4N41 A;  1EKE A;  4M3R A;  3F73 A;  3CCE N;  4RG8 A;  1X9M A;  3CCR N;  3BDP A;  4KBO A;  2ZQB A;  2PZS A;  3I8D A;  4H0T B;  4FJ5 A;  2IVP A;  1HLU A;  5A2Q O;  3EY1 A;  2O8D A;  3H45 C;  1NK4 A;  2Z1G A;  3VEZ A;  2XO7 A;  2A5X A;  2HW3 A;  4A2B A;  4KI6 A;  1VQ7 N;  1I94 K;  1TKZ A;  3OJU A;  2UXB K;  1N34 K;  3JXU A;  4M42 A;  4FZY A;  3C7N B;  4BE0 A;  4DTR A;  1BCO A;  3CF5 L;  3OS0 A;  1EET A;  4JKF A;  3KTQ A;  3L2Q A;  1XC9 A;  4FJM A;  4KHQ A;  5DMR A;  4CJ7 A;  1S1T A;  1DT9 A;  3PSF A;  4YDU A;  5AZI B;  4CFA A;  1S22 A;  1NK0 A;  2UUC K;  4JHD B;  4CJV A;  1YVU A;  4B9V A;  2ZGZ A;  4YOY A;  4KI4 A;  3R8E A;  1C1B A;  1GLB G;  4DQ8 A;  2HHQ A;  5BRH A;  3RMA A;  3M8P A;  2YJE A;  3QB0 A;  1TK5 A;  4I6M B;  5EOY A;  3O5B A;  3DRP A;  2QWO A;  2FF3 B;  4BC2 A;  5F1X A;  4BC5 A;  1W2B M;  4IJA A;  4RW7 A;  4PHT X;  2Q2R A;  4M7X A;  1RT3 A;  4DF4 A;  3KKR A;  2ZE2 A;  3UKU B;  3SCX A;  3FFI A;  2OPP A;  4JD2 A;  3TTC A;  3BF3 A;  4FZX C;  4LF6 K;  3RR7 A;  1BIS A;  4RTF D;  3VPZ A;  2X6S A;  3GDQ A;  1O13 A;  2XHB A;  3TAN A;  2HHU A;  4DU4 A;  1FKO A;  4BAC A;  3O4N A;  5AR0 A;  1T7P A;  4BR5 A;  5GAH P;  3L0Q A;  4H0Y B;  5AQF A;  4OGE A;  4AHT A;  4CZK A;  3FZF A;  3I55 N;  4YOV A;  2FBT A;  4CHZ A;  3EEQ A;  4NLC A;  1L5U A;  3DOL A;  2BAN A;  3NF6 A;  1NK9 A;  5KPZ A;  3SQ0 A;  3IS9 A;  2Y1I A;  3QIN A;  4C8K A;  3DAW A;  5JMV A;  1D9D A;  1QQN A;  1KLM A;  3K5O A;  3UB5 A;  1VHX A;  4DR2 K;  4DUY K;  5J2Q A;  3B6O A;  2HMI A;  3THW A;  4JHD A;  5J2P A;  1HKB A;  3MEE A;  4JNE A;  3AAQ A;  4IBN A;  3KK2 A;  3M8R A;  1C0M A;  4F3T A;  4MDB A;  4WQ5 C;  3SNN A;  4E7I A;  4BR0 A;  2Q31 A;  3CM6 A;  4E7K A;  3LAN A;  3VQB A;  1NKB A;  4JLH A;  3E9P A;  3C7N A;  3N4P A;  4AH9 A;  2QTD A;  3RMB A;  2E2Q A;  2Q1N A;  2O8D B;  2IC3 A;  2VGN A;  3KJV A;  3TAQ A;  3KD1 E;  4KHN A;  3AY9 A;  1K6Y A;  1RCH A;  5F2R A;  2B4J A;  3M8S A;  4CZG A;  3E9O A;  5AQP A;  4HVJ A;  4E7J A;  5CE3 A;  1T6D A;  3S3O A;  3I0R A;  1QE1 A;  1YXQ A;  1GLD G;  5JS1 A;  1NJY A;  1HPM A;  2ATQ A;  3VN5 A;  1RDU A;  3ZX0 A;  1NU0 A;  3J7A P;  1KVC A;  4M3Y A;  3O3F A;  1K8K B;  3P1G A;  3MX2 A;  4HHT A;  3CME N;  3DLK A;  4JD2 B;  4E3S A;  1ATS A;  4CHO A;  3I33 A;  4Y1C A;  3VQ9 A;  3WT0 A;  1HQE A;  1O1W A;  2XRI A;  3G71 N;  4BVO A;  3OTO K;  3V9U A;  3LWM A;  5KRT A;  3V9Z A;  4BY9 C;  4JAX A;  3FZH A;  5KQD A;  2GV9 A;  3O80 A;  4MDA A;  4JRP A;  3LP3 A;  4MLE A;  3D7E O;  3EE9 A;  4C8N A;  4DLG A;  4H8K A;  3AAP A;  2HOE A;  1VRT A;  1FJG K;  1SL2 A;  4FOI A;  2OA8 A;  3VQ8 A;  4B9L A;  2G8I A;  2RKI A;  1YJ9 N;  2ITM A;  2RHK A;  4DQR A;  1HKC A;  1ZXO A;  4CJK A;  2AJQ A;  4KFB A;  3V6D A;  4B1Y B;  4FJN A;  4I9Q A;  4EIA A;  3U8X A;  3GE1 A;  4OPH A;  2YKN A;  1IKW A;  1ATN A;  3K58 A;  4DG1 A;  1RNH A;  4LFA K;  3WXL A;  4E89 A;  3D0P A;  3VEX A;  2P9S A;  2V7Y A;  4DS5 A;  3NGY A;  3V1R A;  1GLC G;  4FWO A;  1BIU A;  5SWM A;  4CK1 A;  2FF6 A;  1C1C A;  1E4G T;  3VES A;  5MLC Q;  4Z94 A;  4KHW A;  4CF8 A;  3VEW A;  3U4L A;  2P1J A;  3ZLJ A;  1LWE A;  3H1Q A;  1NGB A;  4EAH D;  5T7B A;  1N36 K;  1XNQ K;  2NRZ A;  5HBM A;  3WUH A;  3UKR B;  3DLL L;  1BOT O;  4H5W A;  1NOZ A;  1U04 A;  1YTU A;  3AVG A;  3A8Y A;  3C65 A;  3L4Q A;  1W97 L;  2E6L A;  3O9S A;  3K9J A;  3MMV A;  2Q36 A;  2VG6 A;  3CC7 N;  3B6P A;  2F9T A;  1KFD A;  1JLB A;  1Z05 A;  4G1Q A;  4YFU A;  3E1Y A;  5M1N A;  1IH7 A;  2VWJ A;  1ATR A;  2HND A;  1J54 A;  3TAG A;  1VSM A;  2GBZ A;  3E01 A;  2HHV A;  4XH4 A;  1RTD A;  3CG7 A;  3OA9 A;  4B1V A;  4AHU A;  4YOX A;  4CZL A;  3LWL A;  4DQQ A;  4OVL A;  2A1S A;  4FM0 A;  4DSK A;  2P9I A;  4NCB A;  3T1A A;  1IO2 A;  2E2O A;  1KSP A;  2YV0 X;  2HHH K;  3MCP A;  4DTX A;  3OJS A;  3CQ8 A;  2HNZ A;  1SL1 A;  3AVF A;  3ID8 A;  4DCH A;  1EXQ A;  3SJJ A;  1JCE A;  3PLA A;  4DMN A;  4DSL A;  1JL1 A;  3K9K A;  4JKB A;  2I5J A;  1NKE A;  3PY8 A;  1JXE A;  1YI2 N;  1NBW A;  1UWB A;  1E3M A;  3VF6 A;  5M1P A;  4BQZ A;  3R6M A;  4C8M A;  3ZX3 A;  3SBT A;  5BRF A;  4O0I A;  1TGO A;  2OCE A;  2HMP A;  4CF0 A;  4UY8 O;  3CQY A;  1VQ8 N;  2QXF A;  3RSE B;  2XY5 A;  4IOC L;  4FJ8 A;  3KK3 A;  3NAE A;  4HTL A;  3OS1 A;  1NGC A;  4CZM A;  2R7Y A;  2P9U A;  1BG3 A;  3AVJ A;  3FGU A;  4B1Z A;  2UUB K;  2E88 A;  2OPS A;  1Q9X A;  4B08 A;  4DR5 K;  4B9S A;  2O8B B;  1GLJ O;  1JLQ A;  1HX1 A;  1TK0 A;  4B8C A;  2KLA A;  4QCL A;  4CFC A;  3G25 A;  3T1Y K;  4CBX A;  3G0Z A;  4LF9 K;  1A5V A;  3VQD A;  4B9U A;  4YOR A;  5J2N A;  1IG9 A;  4LC9 B;  3C0B A;  1NGD A;  4DV2 K;  3SV3 A;  4K8Z A;  4YDU C;  1IKV A;  3P83 D;  3TU5 A;  3BP8 A;  4O5F A;  5C24 A;  2G8U A;  3HT3 A;  1VQM N;  3RMC A;  4FJH A;  1NGA A;  2EHG A;  4BRH A;  3AVN A;  5BPN A;  2JGU A;  3UIQ A;  3O1B A;  4IO9 L;  5KI6 A;  4BRC A;  2F7T A;  3J81 O;  4YY3 K;  3THW B;  2D0P A;  3U9Z A;  4CBW A;  1WLJ A;  1QSS A;  4CEF A;  2QK9 A;  3CIP A;  4N56 A;  4Z4H A;  4CJW A;  3QFP A;  2DFH A;  1LAV A;  2VCP A;  4O4G A;  1FW6 A;  4CK3 A;  1DGK N;  2QM1 A;  3IG1 A;  3MN9 A;  4CF9 A;  4BWJ A;  1RIL A;  4M63 C;  1SKS A;  4WCE L;  3HP6 A;  4B1W B;  4JI8 K;  2UYT A;  3NF7 A;  4JKH A;  4OGC A;  4DB3 A;  4KH5 A;  1WSE A;  4C23 A;  1OVY A;  2ZD1 A;  1WBB A;  4CJR A;  1S6P A;  4LF7 K;  1JLF A;  1Z25 A;  4DR1 K;  1CXQ A;  4E7H A;  1VQO N;  1KAZ A;  2NRW A;  3WQU A;  4FW1 A;  1QQO A;  1VQP N;  3AO1 A;  4BRE A;  1RT7 A;  4GKJ K;  4PY5 A;  1RGI A;  3FFK B;  5AQH A;  4X65 K;  5CZ2 A;  4DV5 K;  3M5R A;  3RRH A;  3LM2 A;  1RBV A;  3LL3 A;  1LW2 A;  4IZ9 A;  1T6C A;  3K0S A;  4DR3 K;  1VK0 A;  4ISG A;  3JS6 A;  1GOC A;  2ASO A;  3KLF A;  2PFU A;  1LWF A;  3D2F A;  4IWV A;  3KK7 A;  1YHQ N;  4O8K A;  5FPD A;  3RR8 A;  4H4O A;  2KZM A;  4E1J A;  2VG7 A;  3S3N A;  4ELV A;  1A5W A;  1QSY A;  3N4Q A;  1D8Y A;  3NVK A;  2WBN A;  2D4W A;  5LY3 A;  3CET A;  4QS7 A;  5AFU A;  3SAG A;  5JVG L;  1S5J A;  3RRG A;  4B3M K;  3IUC A;  1QS4 A;  1YIJ N;  1YF5 L;  3QNO A;  1L3V A;  1WBD A;  1U4B A;  4CJ5 A;  1XC3 A;  3F9K A;  5JS2 A;  3DM2 A;  1BQM A;  1TUU A;  1QSL A;  2QKK A;  3MN6 A;  3ZSW A;  3BY5 A;  1WN7 A;  2G8W A;  2YHA A;  4E0D A;  4O8U A;  4GVE A;  3P39 A;  4CJS A;  2WTU A;  5CHI A;  4CFD A;  3V1O A;  4U7B A;  1KRP A;  4AHR A;  3JSM A;  4FJL A;  3ZX2 A;  3VEV A;  3SUO A;  4R5P A;  1W0H A;  4JKD A;  3S3M A;  3LPU A;  3CJA A;  3NF9 A;  4JKG B;  3C6H A;  3U3Y A;  1NGF A;  2GTD A;  5C2F A;  4KH6 A;  1P90 A;  3MAQ A;  4KKO A;  3ZYY X;  1QQM A;  3MWT A;  4LD0 A;  3UKR A;  4CHP A;  2V52 B;  4IDH A;  2VGM A;  2A42 A;  3HK2 A;  1BCM A;  2B6A A;  3NHG A;  3HJF A;  1B9F A;  4CEZ A;  3VGL A;  3KLH A;  3P5J A;  1WSJ A;  4J2B A;  3VET A;  5CR4 A;  4OKE A;  3HVR A;  1NK6 A;  3F9M A;  1CLQ A;  1I3A A;  3MX5 A;  3SUQ A;  4JV5 K;  1WSH A;  2IS3 A;  2O8C A;  2QWP A;  1NMN A;  1T8E A;  1J9A A;  4K25 A;  1S1U A;  4CD1 A;  2GEM A;  4NYF A;  4ZTF A;  2RN2 A;  3IDH A;  3VTI A;  1VQN N;  1LCU A;  3DXK A;  1M90 O;  1VSK A;  5EY4 A;  2A6A A;  2YHB A;  3OYB A;  5AQW A;  3SJH A;  1JLA A;  3HM9 A;  3QER A;  1N6Q A;  3NMU A;  2O4I A;  4DTP A;  4IEI A;  3D6R A;  4M3Z A;  4BR7 A;  1RT1 A;  5SZT A;  1C1A A;  4N76 A;  1K9M O;  2EWS A;  4J8F A;  2P5O A;  1UAX A;  1L3U A;  4I6M A;  3P38 A;  1S1X A;  1ZBH A;  4DF8 A;  1CXU A;  4JKE A;  2P9I B;  1JLE A;  2WUS A;  3QEV A;  3WEE A;  4CZE A;  3OYI A;  2NRT A;  4ID1 A;  3TTF A;  2GWJ A;  3C94 A;  2GUP A;  3BGR A;  1VQ9 N;  3DLG A;  5HRP A;  1KAX A;  4K42 A;  3FE1 A;  4PKG A;  3DMJ A;  4CJP A;  4DTO A;  1IBK K;  1BL3 A;  4EHU A;  3KLG A;  4K8X A;  3AO2 A;  2P51 A;  4DV1 K;  4MQ3 A;  5J1E A;  5F0X A;  3EZW A;  3SZ2 A;  3ZSR A;  4LF4 K;  3J8A A;  3IFR A;  3LP2 A;  4M45 A;  3OW2 M;  4BR2 A;  3CCL N;  4IG3 A;  2ASP A;  3THX A;  3AV9 A;  3SI6 A;  1TKT A;  3OHR A;  2OAN A;  3CJ9 A;  2YI1 A;  2A40 A;  3NE6 A;  2XY8 A;  4FL9 A;  2OPQ A;  4B9Q A;  3A2F A;  1K73 O;  3T3F A;  1G15 A;  1GLE G;  5C2D A;  1LV5 A;  4FVM A;  4GVM A;  3THV A;  4PL8 A;  4BGA A;  3KWG A;  1Q82 O;  3D2F B;  4HUE A;  4CW7 B;  2OPR A;  2WC9 A;  1SKW A;  5AQG A;  3L8B A;  3SPY A;  4CVN E;  2O8E A;  1HNI A;  3WXM B;  2BUP A;  3PX6 A;  2E1Y A;  3ASM A;  3VQ6 A;  1Q8I A;  5AFU H;  4EHT A;  5HOO A;  3TTD A;  1N8R O;  1F21 A;  3QNN A;  1ASW A;  3CCV N;  3CC2 N;  2P9K B;  5KRS A;  3VGK A;  5AQJ A;  3R9P A;  4C8L A;  4ELU A;  3G6E N;  3LDO A;  1XNR K;  2KQ2 A;  4A57 A;  2EX3 A;  4KB0 A;  1HPZ A;  1LOT B;  1TV6 A;  3ATU A;  1V4T A;  4KHY A;  4H5V A;  3PUF A;  3HVT A;  4JS4 A;  1KVA A;  3HI0 A;  2ZWH A;  2F8T A;  1XQS C;  5E41 A;  5JLH A;  1IKX A;  1BO5 O;  2YNH A;  1QVG M;  4Z0U A;  4CGH A;  5I3U A;  3CFP A;  2HHT A;  5AQL A;  3DRR A;  5FLX O;  1VQ4 N;  2CH6 A;  1TAQ A;  5DM7 L;  3K5N A;  4CZH A;  2F96 A;  4WFA L;  1ITG A;  4BDP A;  3HYF A;  4MO4 A;  3LP0 A;  3GG4 A;  2G8F A;  1U2V A;  4A59 A;  1JXB A;  2HHS A;  5FDL A;  4NXM K;  3DI6 A;  3DOK A;  3MED A;  4FPB A;  4CJQ A;  1SS6 A;  4CJL A;  5M1O A;  3F2K A;  1NJZ A;  4OLB A;  3O4Q A;  2IAJ A;  3EYZ A;  3SQ2 A;  1QVF M;  1QTM A;  1RDW X;  4MO5 A;  1J5O A;  4DSJ A;  4DR4 K;  3L3V A;  4OO1 J;  2KFZ A;  3THX B;  4WQ4 A;  3HOS A;  1IBL K;  3VTH A;  4CCH A;  1HNX K;  3L4I A;  4M41 A;  4AIL C;  5HL7 L;  3O6W A;  4CEC A;  1P8Z A;  2FSN A;  1IJJ A;  1GLF O;  3AO4 A;  2P9N B;  2PAV A;  4RW6 A;  3U3G A;  4CI6 A;  3V4I A;  5IT9 O;  2E1Z A;  3CCJ N;  1VSD A;  3KKS A;  3CJ7 A;  4DV0 K;  2HF3 A;  2OZM A;  4DHY A;  3VER A;  3VQE A;  4EP5 A;  4XIU A;  2KHO A;  4A2A A;  4IFY A;  1A5X A;  1VSJ A;  4BRK A;  3A0I X;  3W3D A;  1XUP O;  1B9D A;  5B8H A;  4DR6 K;  3ULE A;  2P9L A;  3RMD A;  1HYS A;  4DFK A;  4AHC A;  2I7P A;  4CZI A;  2BTF A;  1K8A O;  3O1W A;  1OH6 A;  4M3U A;  5CY4 A;  3SK3 A;  3IRX A;  4W5O A;  4B3S K;  5BRE A;  3ZEU A;  3AVB A;  2P9P B;  4KTZ A;  1J6Z A;  3C6T A;  5AQN A;  2X74 A;  3NBP A;  4BRL A;  4AM6 A;  4PWD A;  2NNW A;  2FSJ A;  4FK2 A;  4Q5V A;  1REV A;  3DLB A;  2D5R A;  3M3Z A;  4LSN A;  3CQX A;  5I9E B;  5AQT A;  3VEN A;  4B9M A;  3VQ4 A;  1NJW A;  4H0X B;  3TAB A;  3G4S N;  3EE8 A;  4F3O A;  2ZM6 K;  3C6U A;  5LMU K;  4FLV A;  3LAK A;  3WNG A;  4IEE A;  1KC8 O;  3QML A;  4FLT A;  1TL1 A;  1NGI A;  3CPW M;  2NUB A;  2FBY A;  4BC3 A;  4GV6 A;  4JS5 A;  4A5B A;  4M3T A;  2D0C A;  3L3U A;  4H5N A;  3KLI A;  1OH5 A;  3DYA A;  3CCM N;  1DTQ A;  3SUN A;  2J4R A;  4NO7 A;  5GAD P;  2WFB A;  5KGW A;  3VA3 A;  2BE2 A;  4E7L A;  1ZBU A;  4KHP K;  3ZSX A;  4Q0B A;  3L2V A;  1KQS M;  2A1R A;  3QBW A;  3PIO L;  4CF2 A;  3K57 A;  4I2Q A;  3CM5 A;  3WXK A;  3W0L A;  3PV8 A;  1JJ2 M;  3BEX A;  1QZ6 A;  3RWU A;  3QIP A;  4DTN A;  4B9N A;  2HST A;  3C95 A;  2Q97 A;  4IO8 A;  1XMO K;  2ITG A;  2E20 A;  4LF5 K;  5BN9 A;  4OPA A;  2KZZ A;  5AJ3 K;  1BGX T;  5FPE A;  2BDP A;  4BQL A;  4PUO A;  5AZJ B;  4M7Y A;  4C8O A;  3AO3 A;  1OH7 A;  2D1K A;  4CIG A;  2E6M A;  3WNE A;  1TUY A;  5BN8 A;  4ILH A;  2F9W A;  1KCF A;  3ZSO A;  4CJF A;  4IKF A;  5E84 A;  2PYJ A;  3CCQ N;  3K5L A;  3CXC M;  3AVC A;  3KIO A;  2HBJ A;  4ILJ A;  1L3S A;  4H5R A;  1I39 A;  3QEX A;  4FVU A;  2QW9 A;  1S9E A;  2P9U B;  4KHS A;  4DTS A;  1S3X A;  3AVI A;  3PSI A;  3VF4 A;  2QWM A;  1RFQ A;  5GIN A;  3CI5 A;  1M1K O;  3DRS A;  1K8K A;  3QEP A;  3DXM A;  1WAJ A;  5CYQ A;  3RVC A;  3V1Q A;  4WE1 A;  3CCS N;  4NLB A;  4AHV A;  4IFV A;  4B1X B;  3CCU N;  3R1X A;  4Y1D A;  3ZCM A;  4BVP A;  2UXC K;  1NG9 A;  3GL1 A;  4B3O A;  4CHY A;  3D2E B;  4NB4 A;  3H46 O;  3I8B A;  1VQ5 N;  4GY2 B;  3SYZ A;  1ZBS A;  5JLF A;  3J80 O;  4IOX A;  3SUP A;  1Y97 A;  5BRD A;  2HB5 A;  3Q7B A;  4FSV A;  3KLE A;  3QLH A;  4MFB A;  1SKR A;  3DLR A;  4PQU A;  3OYG A;  3ENH A;  2YNF A;  1KLN A;  4CED A;  3L2R A;  3TAF A;  4JI7 K;  2F4V K;  5K14 A;  2W41 A;  4CJT A;  2NLX A;  4Y0W A;  1DKG D;  2YNG A;  5HRR A;  3RTV A;  4B3R K;  2X78 A;  3O3H A;  3CFR A;  3WXJ A;  3MDQ A;  1Z26 A;  2OYQ A;  4C1N K;  1LW0 A;  3KK1 A;  3P4I A;  1RT5 A;  4FXD A;  1T05 A;  1JL2 A;  1VSF A;  3VQQ A;  4J2E A;  4F2S A;  5AQU A;  4GV3 A;  1BI4 A;  3QIO A;  2HBK A;  5LJW A;  1TYQ A;  1IG8 A;  4K41 A;  5GAE P;  5LMN K;  3I0S A;  3OBW A;  4WYB A;  5FPM A;  3ZEU B;  2W40 A;  2O8B A;  2ZJP L;  3HZ6 A;  4CEQ A;  4H0P A;  3HST B;  3P31 A;  4HCC A;  1XMQ K;  4FPA A;  1C0T A;  3VQC A;  2CGL A;  1YT3 A;  3M8Q A;  1X1P A;  4QS8 A;  4FJ7 A;  4FM1 A;  2V51 B;  5FRO A;  4FJG A;  5AQZ A;  4CHQ A;  2NRH A;  2F8S A;  4J2D A;  2KKZ A;  3BZC A;  2DPN A;  5GIP A;  1HJR A;  3SQ1 A;  4CF1 A;  3CYM A;  4FLW A;  2NRV A;  1VQK N;  1XWL A;  4LY7 A;  4RW9 A;  4JI5 K;  4CIF A;  3O3G A;  3FZM A;  4FWR A;  4EZ6 A;  3EL2 A;  5C10 A;  2ZF5 O;  3LAL A;  4DS4 A;  3T19 A;  3ID6 A;  1KVB A;  4FWS A;  4H03 B;  5AQX A;  4DU3 A;  3THY B;  3IAY A;  4NXN K;  3MWP A;  4BRN A;  2PYL A;  3B8A X;  1QHT A;  4O0J A;  4YNQ A;  1L3T A;  1X3N A;  2YX6 A;  2AA4 A;  4XH1 A;  1ESV A;  4DV3 K;  3DLE A;  5KTQ A;  4ZHR A;  1X9W A;  4IG0 A;  5KPT A;  4L8R B;  3THY A;  1RT2 A;  3OYD A;  4XH5 A;  5C42 A;  3CFO A;  4DFM A;  4X66 K;  3T1H K;  3AVK A;  4WQ4 C;  1RBS A;  1EX4 A;  3LM9 A;  1KD1 O;  1TYQ B;  5AZI A;  3D2E A;  2W6L A;  3CJB A;  3ZT0 A;  3QDK A;  1B92 A;  2H3G X;  4CJ3 A;  3L2U A;  4XEI A;  3ZSZ A;  3J7Z O;  3BUZ B;  5AQR A;  2VQF K;  3QEI A;  2Q3S A;  3SAH A;  4FJI A;  4I9L A;  4FO0 A;  4NCA A;  2B5J A;  1YTA A;  1NM1 A;  1QZ5 A;  3SLC A;  4IJN A;  2X6N A;  2Y1J A;  3TSP A;  5I42 A;  1EP4 A;  4DFJ A;  3TI0 A;  1ZBF A;  4ISE A;  1LWC A;  4BDZ A;  4KAZ A;  1Q81 O;  5HRN A;  4BR4 A;  3R3L A;  4KTW A;  3K2P A;  4GMJ B;  3ZET A;  1HUX A;  1RT6 A;  2IDO A;  3M1F A;  4GNI A;  4U67 L;  5ELZ A;  2E4L A;  1BI4 B;  2E8A A;  3KHY A;  3VMF B;  4FWM A;  1HJO A;  2HBL A;  2YJF A;  3DWL A;  2G8K A;  4W5R A;  3VA0 A;  1EQY A;  2FLO A;  1Q9Y A;  3PO5 A;  1NWK A;  5AQV A;  4R79 A;  2QKB A;  4OKK A;  4O55 A;  2HHX A;  1NLV A;  1NJI O;  4BE1 A;  4OJR A;  1TK8 A;  4BGB A;  3KZB A;  4ZTJ A;  4CBU A;  1RDD A;  4FYD A;  4ELT A;  4ICL A;  1U45 A;  4CGJ A;  1Q18 A;  4JN4 A;  1UA0 A;  5HP1 A;  4WFB L;  1HRH A;  3EZ5 A;  3O9U A;  3OYK A;  4DQI A;  2HF4 A;  3SMS A;  2KFN A;  2P9K A;  1T03 A;  3O9T A;  3SV4 A;  3QO9 A;  1BQN A;  3VQP A;  4CZF A;  4LF8 K;  3AVL A;  4DSF A;  4FZZ A;  3TAP A;  3NH1 A;  2Q0R A;  4M3W A;  1WNS A;  4CEE A;  5FRN A;  5AZJ A;  5CYM A;  1DEJ A;  3AAR A;  3DLH A;  1WSG A;  3OYF A;  1KFS A;  4H4M A;  2YHW A;  4PKI A;  1BU6 O;  3BZK A;  2DY4 A;  1T3V A;  4WQ5 A;  4ID5 A;  1VQL N;  3GBT A;  4K43 A;  2QEX N;  1IBM K;  2CGK A;  3QIC A;  4W5T A;  1NGH A;  5GAG P;  5C15 A;  3E66 A;  4A61 A;  1VSL A;  1U6Z A;  5HRS A;  4BRQ A;  4RW8 A;  4MLH A;  3LDP A;  5EU7 A;  4CD3 A;  3NFA A;  5AQO A;  4QOZ B;  2IGI A;  3HM8 A;  4PKH A;  2VWB A;  4H0O A;  4JK9 A;  4QS9 A;  1EWQ A;  3NF8 A;  1BWF O;  3SQ4 A;  1S1W A;  4BR9 A;  1C0F A;  1RBR A;  3ITH A;  3TWH A;  4OLA A;  2D0A A;  2VG5 A;  1TL3 A;  2YHX A;  2QWN A;  2OTL N;  2RE2 A;  1BA0 A;  4CHN A;  3CMA N;  5J2M A;  3SPZ A;  1BDG A;  2UUA K;  4BDY A;  4Z4C A;  1RT4 A;  5AQY A;  5HRO A;  2IVN A;  4LH4 A;  1QHA A;  2E2P A;  4B8A B;  4DU1 A;  5M1F A;  1OVQ A;  4IXC A;  5FPN A;  3OVN A;  5GIO A;  4JI3 K;  4FJ9 A;  5JVH L;  2Z1J A;  1U49 A;  4LH5 A;  1EWR A;  2ASM A;  4CIE A;  2ETJ A;  4N5S A;  4H5T A;  1JCF A;  1V4S A;  2DTU A;  2PY5 A;  4JYA K; 
#chains in the Genus database with same CATH homology
 4JS5 A;  2JGU A;  3UIQ A;  2D0C A;  3L3U A;  4M3T A;  3OYH A;  4FJK A;  3OYL A;  1UA1 A;  2O4G A;  3KLI A;  5KI6 A;  3HXM A;  4FLU A;  4KRE A;  3AA3 A;  4CGG A;  3DYA A;  5FRM A;  1DTQ A;  3SUN A;  3AA4 A;  1WLJ A;  1QSS A;  3NCI A;  1DLO A;  4CEF A;  2QK9 A;  3ZSY A;  4N56 A;  4Z4H A;  4CJW A;  3MEC A;  5KGW A;  2DFH A;  4CEA A;  3VA3 A;  1LAV A;  2BE2 A;  4O4G A;  4FM2 A;  1ZBU A;  4E7L A;  3ZSX A;  4CK3 A;  2VWK A;  1RBU A;  4Q0B A;  1HMV A;  3L2V A;  4W5N A;  3IG1 A;  2YNI A;  3VQ5 A;  4CF9 A;  4BWJ A;  4N41 A;  1RIL A;  1EKE A;  4M3R A;  1XHZ A;  1SKS A;  4FJ5 A;  3F73 A;  3HP6 A;  2A1R A;  4RG8 A;  1X9M A;  3NF7 A;  4OGC A;  4CF2 A;  3BDP A;  3K57 A;  4I2Q A;  2ZQB A;  3CM5 A;  1WSE A;  4HUF A;  1U48 A;  3PV8 A;  2PZS A;  3I8D A;  2ZD1 A;  3RWU A;  3QIP A;  1S6P A;  3D45 A;  4NYN A;  4CJR A;  4DTN A;  3QEW A;  3S9H A;  4B9N A;  3C95 A;  1JLF A;  1Z25 A;  3HPH A;  1CXQ A;  3EY1 A;  4E7H A;  2ITG A;  1NK4 A;  4FW1 A;  3AO1 A;  2Z1G A;  1RT7 A;  2XO7 A;  2HW3 A;  4PY5 A;  4LSL A;  1VSH A;  3OYA A;  1J53 A;  4DTU A;  4KI6 A;  4QAG A;  5CZ2 A;  2KZZ A;  1NKC A;  1BGX T;  1TKZ A;  3OJU A;  3RRH A;  3LZI A;  3JYT A;  4M42 A;  1RBV A;  3TAM A;  3MXI A;  4FZY A;  1LW2 A;  2BDP A;  1C0U A;  4UQG A;  4BE0 A;  4PUO A;  4DTR A;  1VK0 A;  1BCO A;  4E19 A;  1GOC A;  3OS0 A;  4C8O A;  1EET A;  3AO3 A;  3KLF A;  5HLF A;  3HPO A;  3KTQ A;  3WNH A;  1LWF A;  3L2Q A;  4CIG A;  2E6M A;  2XY6 A;  3WNE A;  4BE2 A;  1W9H A;  1XC9 A;  1KCF A;  3ZSO A;  3AVA A;  4CJF A;  4IKF A;  3RR8 A;  4FJM A;  4KHQ A;  2PYJ A;  5DMR A;  4H4O A;  2KZM A;  1S1T A;  2VG7 A;  3K5L A;  3S3N A;  4DSE A;  3AVC A;  3KIO A;  1A5W A;  4ELV A;  4DSI A;  1NK0 A;  4CFA A;  1QSY A;  1L3S A;  1D8Y A;  3U6F A;  4CJV A;  3V9S A;  1I39 A;  1YVU A;  4DWI A;  4B9V A;  3QEX A;  1QQC A;  1S9E A;  4KHS A;  4KI4 A;  1S5J A;  4DTS A;  3RRG A;  1C1B A;  3AVI A;  2HHQ A;  3DRS A;  3RMA A;  1QS4 A;  3M8P A;  3QEP A;  1TK5 A;  3QNO A;  4FLZ A;  1L3V A;  1WAJ A;  5CYQ A;  2W42 A;  3V1Q A;  4WE1 A;  1U4B A;  2HHW A;  4CJ5 A;  3HJF A;  4AHV A;  3F9K A;  4IFV A;  5JS2 A;  3DM2 A;  1BQM A;  3DRP A;  3ZSQ A;  4Y1D A;  3ZCM A;  1QSL A;  2QKK A;  1CZB A;  1HYZ A;  3ZSW A;  1ZBI A;  4NCB A;  1WN7 A;  2G8W A;  2YHA A;  4E0D A;  4B3O A;  4CHY A;  4RW7 A;  3NGZ A;  1DTT A;  4CJS A;  1RT3 A;  4F4K A;  4DF4 A;  3KKR A;  1TAU A;  2ZE2 A;  4CFD A;  3V1O A;  4GW6 A;  4CER A;  2FC0 A;  3SCX A;  1KRP A;  4AHR A;  1RTI A;  3FFI A;  3JSM A;  4FJL A;  2OPP A;  3WNF A;  3SUO A;  4TSX A;  3SYZ A;  4R5P A;  4Z4E A;  3AO5 A;  1W0H A;  3S3M A;  4FZX C;  4FK0 A;  3SUP A;  1Y97 A;  3LPU A;  3OYM A;  3NF9 A;  1BIS A;  2HB5 A;  3RR7 A;  1FXX A;  2JLE A;  2X6S A;  4AHS A;  3U3Y A;  2Z1H A;  5CZ1 A;  2XHB A;  3MAQ A;  4KKO A;  4LD0 A;  4CHP A;  3TAN A;  3KLE A;  3QLH A;  1S6Q A;  4MFB A;  1FKO A;  4DU4 A;  1SKR A;  3DLR A;  4PQU A;  2HHU A;  3OYG A;  3HK2 A;  4BAC A;  1BCM A;  2B6A A;  2YNF A;  3O4N A;  1B9F A;  4CEZ A;  3NHG A;  4CED A;  3L2R A;  3TAF A;  1KLN A;  3KLH A;  1T7P A;  3P5J A;  1GOB A;  1ASV A;  1WSJ A;  5K14 A;  4J2B A;  1VSI A;  4OGE A;  4AHT A;  4CJE A;  4CJT A;  4OKE A;  3HVR A;  1TKD A;  1NK6 A;  2LSN A;  1FK9 A;  2YNG A;  5HRR A;  3RTV A;  1CLQ A;  2X78 A;  1I3A A;  2FBT A;  3O3H A;  4CHZ A;  3CFR A;  3SUQ A;  1WSH A;  2IS3 A;  1Z26 A;  3QET A;  1SL0 A;  1L5U A;  3DOL A;  2BAN A;  2WOM A;  3NF6 A;  1T8E A;  2OYQ A;  3HL8 A;  1J9A A;  1NK9 A;  4DSK A;  1S1U A;  1LW0 A;  3KK1 A;  3SQ0 A;  4CES A;  1RT5 A;  3OS2 A;  3IS9 A;  4NYF A;  3AVM A;  3QIN A;  4IDK A;  5C25 A;  2Y1I A;  4ZTF A;  1T05 A;  3NH0 A;  1JL2 A;  2RN2 A;  4CK2 A;  1VSF A;  3VQQ A;  4C8K A;  4J2E A;  4KV8 A;  4F2S A;  1D9D A;  1BI4 A;  1KLM A;  3K5O A;  3QIO A;  1VSK A;  3H08 A;  1JLG A;  3V81 A;  4FLX A;  5J2Q A;  3B6O A;  2HMI A;  1ASU A;  2YHB A;  4DLE A;  5J2P A;  3OYB A;  3HM9 A;  1JLA A;  3MEE A;  3I0S A;  4IBN A;  3QER A;  1N6Q A;  2O4I A;  4DTP A;  3KK2 A;  3M8R A;  4M3Z A;  1C0M A;  4F3T A;  1RT1 A;  5SZT A;  1C1A A;  4KB1 A;  4N76 A;  3SNN A;  4NCG A;  4E7I A;  4CEQ A;  3G10 A;  1RDA A;  3HST B;  4HCC A;  2G8V A;  1C0T A;  3VQC A;  4OLA A;  1YT3 A;  3CM6 A;  3M8Q A;  2HNY A;  3LDS A;  1X1P A;  4CEB A;  2P5O A;  4OPJ A;  1HNV A;  4E7K A;  1VRU A;  3TR8 A;  4FJ7 A;  4FM1 A;  1UAX A;  5FRO A;  3LAN A;  1L3U A;  3VQB A;  4E1N A;  1NKB A;  4FJG A;  4JLH A;  3LP1 A;  1BHL A;  1S1X A;  1ZBH A;  4DF8 A;  1CXU A;  3LPT A;  4CHQ A;  2F8S A;  4J2D A;  1JLE A;  3HPG A;  4AH9 A;  1HJR A;  3QEV A;  3ZT3 A;  4CF1 A;  2FBY A;  3CYM A;  3HP9 A;  4FLW A;  3SQ1 A;  3KD5 E;  4HCB A;  4KO0 A;  3ZT1 A;  1XWL A;  4LY7 A;  4RW9 A;  3OYI A;  4ID1 A;  3RMB A;  1XI1 A;  1NK5 A;  4CIF A;  3O3G A;  3C94 A;  3AVH A;  3LZJ A;  2IC3 A;  3KJV A;  3TAQ A;  3BGR A;  1R0A A;  3KD1 E;  4KHN A;  4EZ6 A;  1K6Y A;  1RCH A;  2B4J A;  3DLG A;  3LAL A;  5HRP A;  4DS4 A;  3M8S A;  3T19 A;  4I7F A;  1KVB A;  4HVJ A;  4E7J A;  4FXD A;  2KW4 A;  3DMJ A;  4CJP A;  4DTO A;  4CJU A;  3TAR A;  1BL3 A;  3KLG A;  4DU3 A;  3S3O A;  1WSI A;  3I0R A;  4PA1 A;  1QE1 A;  3ULD A;  3IAY A;  4K8X A;  3AO2 A;  2PYL A;  5JS1 A;  1NJY A;  2P51 A;  3K59 A;  4MQ3 A;  1NJX A;  1QHT A;  5J1E A;  2ATQ A;  4O0J A;  3VN5 A;  4YNQ A;  1L3T A;  4W5Q A;  3SZ2 A;  3ZSR A;  1KVC A;  3LP2 A;  4M3Y A;  3O3F A;  4M45 A;  3P1G A;  3DLE A;  4HHT A;  1C6V A;  1HQU A;  1RDB A;  5KTQ A;  4IG3 A;  4ZHR A;  1X9W A;  2HVI A;  3DLK A;  3AV9 A;  4IG0 A;  4CE9 A;  3NGI A;  3SI6 A;  1RT2 A;  1TKT A;  3OYD A;  4E3S A;  5C42 A;  4F2R A;  3CFO A;  4CHO A;  4DFM A;  4Y1C A;  3AVK A;  3VQ9 A;  1U47 A;  3NE6 A;  1HQE A;  1O1W A;  2XRI A;  1RBS A;  1EX4 A;  2XY8 A;  4KRF A;  2OPQ A;  4FW2 A;  3A2F A;  3ZT0 A;  3LWM A;  4CFB A;  3V9U A;  5KRT A;  4FCY A;  3OYJ A;  1N5Y A;  3V9Z A;  1B92 A;  3T3F A;  1G15 A;  2FBX A;  4CJ3 A;  3OYN A;  2G8H A;  2GV9 A;  4FVM A;  4GVM A;  3L2U A;  1LV5 A;  4JRP A;  3THV A;  3V9W A;  3LP3 A;  3ZSZ A;  3QEI A;  4HTU A;  4HUE A;  4C8N A;  2OPR A;  1SKW A;  4DLG A;  3MXJ A;  4H8K A;  3L8B A;  2Q3S A;  3SPY A;  4FJI A;  3ZT4 A;  3PX4 A;  1HNI A;  1VRT A;  4I9L A;  3PX6 A;  3MEG A;  1LAW A;  1SL2 A;  4NCA A;  2OA8 A;  3ASM A;  2B5J A;  4Z4G A;  4E1M A;  1YTA A;  1D5A A;  3VQ6 A;  3VQ8 A;  1Q8I A;  4B9L A;  2G8I A;  2HVH A;  3VQ7 A;  2RKI A;  2X6N A;  2Y1J A;  1TVR A;  3V9X A;  5I42 A;  4BWM A;  1EP4 A;  4DQR A;  4CJK A;  4Z4F A;  2AJQ A;  4DFJ A;  4KFB A;  3TI0 A;  1JLC A;  3V6D A;  1ZBF A;  3NH2 A;  1LWC A;  2IOC A;  1F21 A;  4I2P A;  3VQA A;  4BDZ A;  4I9Q A;  4FJN A;  4KAZ A;  1JKH A;  4JRQ A;  3QNN A;  4DQP A;  5HRN A;  1ASW A;  2YKN A;  4CEO A;  1IKW A;  4KTW A;  4N47 A;  3K58 A;  4DG1 A;  1RNH A;  5KRS A;  3K2P A;  4GMJ B;  2DFE A;  3PO4 A;  4E89 A;  1RT6 A;  3D0P A;  4C8L A;  4ELU A;  1FKP A;  2IDO A;  3OYE A;  2E4L A;  1BI4 B;  4DS5 A;  3NGY A;  2KQ2 A;  1GOA A;  1TKX A;  2EX3 A;  3V1R A;  1BIU A;  1HPZ A;  5SWM A;  4CK1 A;  4HUG A;  4KB0 A;  4KTQ A;  3HO1 A;  1WAF A;  1C1C A;  1TV6 A;  2G8K A;  2RF2 A;  4W5R A;  4KHY A;  3VA0 A;  3PUF A;  3K5M A;  3HVT A;  2KTQ A;  4JS4 A;  4KHW A;  1Q9Y A;  1KVA A;  4CF8 A;  3PO5 A;  2F8T A;  5E41 A;  4RW4 A;  4M3X A;  2P1J A;  1IKX A;  2YNH A;  5D3G A;  2QKB A;  3ZT2 A;  2YKM A;  2DFF A;  1LWE A;  4OKK A;  4Z0U A;  3OYC A;  4FJX A;  4CGH A;  5T7B A;  2BGG A;  4O55 A;  2HHX A;  5I3U A;  5HBM A;  3LAM A;  3CFP A;  2HHT A;  2WON A;  3DRR A;  4BE1 A;  4KPY A;  4OJR A;  1TK8 A;  3TAE A;  1UOC A;  1TAQ A;  3K5N A;  1NOZ A;  4ZTJ A;  3AA5 X;  1RDD A;  3L2W A;  2F96 A;  4FYD A;  1U04 A;  1ITG A;  4BDP A;  4ELT A;  3AVG A;  1YTU A;  3HYF A;  5KGX A;  2RPI A;  4ICL A;  3LP0 A;  4CGJ A;  4CJ4 A;  1BIZ A;  1U45 A;  2PY5 A;  4L8R B;  2E6L A;  4KHU A;  1UA0 A;  5HP1 A;  2VG6 A;  2G8F A;  3B6P A;  1HRH A;  1RBT A;  3EZ5 A;  1ZBL A;  1SV5 A;  4CGF A;  3OYK A;  1ZYQ A;  1KFD A;  4DFP A;  1JLB A;  4DQI A;  4OKJ A;  4G1Q A;  4YFU A;  1JXB A;  2HHS A;  2KFN A;  5FDL A;  3DI6 A;  3DOK A;  3MED A;  1IH7 A;  1T03 A;  3SV4 A;  2VWJ A;  3QO9 A;  2HND A;  1J54 A;  1BQN A;  4CJQ A;  1VSM A;  3VQP A;  3TAG A;  4CJL A;  1S1V A;  2GBZ A;  3AVL A;  4DSF A;  3E01 A;  1D9F A;  4FZZ A;  4OLB A;  1RTJ A;  3TAP A;  3O4Q A;  3NH1 A;  1NJZ A;  4M3W A;  2HHV A;  2IAJ A;  3EYZ A;  3SQ2 A;  1RTD A;  1QTM A;  3CG7 A;  1WNS A;  1J5O A;  4AHU A;  4DSJ A;  3L3V A;  2KFZ A;  4CEE A;  3LWL A;  4CCH A;  4DQQ A;  5FRN A;  4OVL A;  2A1S A;  5CYM A;  5DK5 A;  4FM0 A;  4EP4 A;  3DLH A;  1SUQ A;  1WSG A;  4M41 A;  3OYF A;  3T1A A;  1IO2 A;  1KSP A;  4AIL C;  1KFS A;  2YV0 X;  4H4M A;  1NOY A;  3QES A;  4CEC A;  4DTX A;  4Z4I A;  3OJS A;  4DTM A;  3CQ8 A;  1MU2 A;  2HNZ A;  2DY4 A;  1SL1 A;  3AVF A;  4ID5 A;  4O5B A;  1EXQ A;  3AO4 A;  3SJJ A;  4RW6 A;  3U3G A;  4B9T A;  3ALY A;  4CGI A;  3V4I A;  2P5G A;  4DMN A;  4W5T A;  4DSL A;  1VSD A;  4DTJ A;  3KKS A;  1JL1 A;  1VSE A;  1VSL A;  1RDC A;  1WSF A;  2I5J A;  1NKE A;  3PY8 A;  1JXE A;  3ISN C;  2FBV A;  5HRS A;  1UWB A;  4RW8 A;  2OZM A;  4F8R A;  3VQE A;  4EP5 A;  4XIU A;  1S9G A;  5EU7 A;  4FLY A;  2D0B A;  4C8M A;  3NFA A;  4QOZ B;  1RTH A;  2IGI A;  4IFY A;  1A5X A;  3AA2 A;  4O0I A;  1TGO A;  1VSJ A;  4CF0 A;  3NF8 A;  3SQ4 A;  1B9D A;  1S1W A;  3MXM A;  2QXF A;  2XY5 A;  3RMD A;  1HYS A;  4FJ8 A;  3KK3 A;  4DFK A;  4AHC A;  3NAE A;  4DQS A;  1RBR A;  3OS1 A;  3ITH A;  4M3U A;  5CY4 A;  2R7Y A;  3AVJ A;  1CZ9 A;  2D0A A;  3TWH A;  2VG5 A;  1TL3 A;  3IRX A;  4W5O A;  3NDK A;  2OZS A;  4EZ9 A;  1XHX A;  4O44 A;  1HYV A;  2OPS A;  3AVB A;  1Q9X A;  4KTZ A;  4B08 A;  4B9S A;  3C6T A;  4CHN A;  2X74 A;  1JLQ A;  3NBP A;  5J2M A;  3SPZ A;  1X9S A;  4PWD A;  1TK0 A;  4B8C A;  4FK2 A;  4QCL A;  4CFC A;  1REV A;  4Q5V A;  4Z4C A;  4BDY A;  3DLB A;  2D5R A;  3G0Z A;  1A5V A;  1RT4 A;  3VQD A;  3ZSV A;  4OPK A;  5HRO A;  4B9U A;  4LSN A;  5J2N A;  1IG9 A;  4LH4 A;  4B8A B;  4DU1 A;  1NK7 A;  4B9M A;  3VQ4 A;  1NJW A;  1IKY A;  1NK8 A;  3OY9 A;  3SV3 A;  3TAB A;  3OVN A;  4K8Z A;  1IKV A;  4FJ9 A;  4F3O A;  3P83 D;  4J2A A;  2Z1J A;  2GUI A;  3C6U A;  1U49 A;  4LH5 A;  4FLV A;  3LAK A;  3WNG A;  4CIE A;  4CGD A;  2ETJ A;  4N5S A;  2Z1I A;  5C24 A;  3PX0 A;  3HT3 A;  2G8U A;  3RMC A;  4FJH A;  4FK4 A;  4FLT A;  1TL1 A;  2XY7 A;  1KTQ A;  2DTU A;  2EHG A;  2NUB A;  4FJJ A;  3AVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...