4CK3A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ck3A00
1WSHA 3BDPA 4F3OA 1RBVA 3RWUA 1ZBIA 1LW0A 3L3VA 3OYKA 2KQ2A 1NK8A 3QIOA 1XC9A 5HRSA 2OYQA 3QNOA 3VQPA 4DTPA 4Z4IA 4B9NA 4KTZA 4JRPA 2JLEA 4B9VA 1NKEA 2IGIA 3AVHA 3OJUA 2D0BA 4BE1A 2B5JA 4DTNA 4E1NA 1W0HA 4DTRA 3DM2A 3OYHA 3HK2A 2F96A 1L3VA 4RW8A 2HHXA 1U47A 3NF9A 3CG7A 3ISNC 4FW2A 4CJTA 3PX6A 4KHUA 1DTQA 4CEQA 4CF8A 4W5RA 3AO2A 1D5AA 1EKEA 3KLGA 2EHGA 1BCOA 3SZ2A 1S1VA 2IC3A 1YT3A 1BIZA 3OYLA 1NJXA 3IAYA 4B08A 1C1BA 4LSLA 1ZBUA 5J2PA 1QHTA 1WNSA 4CJ5A 3WNEA 3OYNA 3CYMA 2OZSA 4FJMA 1S6QA 1TAUA 3QEWA 5CZ2A 1RT3A 5J1EA 1HMVA 4CFBA 3UIQA 3VQ4A 1TAQA 2Q3SA 2EX3A 3ULDA 2VWKA 4OJRA 4HTUA 4AHVA 2AJQA 1VSFA 1VSHA 4MQ3A 4AHSA 1LV5A 3DLRA 4Z4EA 5J2NA 4E7LA 4CK3A 3MXIA 1U49A 2KFZA 1JXEA 4W5QA 3RRHA 3QESA 3VQ8A 3C6UA 4CF1A 2XY6A 3F73A 1NJZA 1WSFA 4KB0A 3TAPA 3OS0A 3KKRA 2R7YA 1JLQA 4LSNA 1BGXT 2KZZA 5FDLA 3DYAA 4CJSA 5CYQA 2HVHA 1RBRA 1VSEA 3AVJA 1HPZA 3RMBA 4FJLA 4J2BA 4PY5A 5I3UA 4CFAA 3DLGA 4HUEA 1D9FA 3U6FA 2OA8A 1VRUA 4CJFA 3HP9A 3KKSA 3KLEA 4C8NA 3LALA 3FFIA 4GVMA 4O0JA 3TAQA 3NHGA 1S1UA 1JLBA 4M41A 2BGGA 2Z1HA 3LP1A 1REVA 3D45A 3NFAA 4RW6A 4KI4A 4O0IA 3LWMA 1FXXA 1C6VA 1T8EA 3LAKA 2FBYA 2IDOA 3V4IA 1BIUA 2DFEA 5JS1A 1GOAA 4CIGA 1RT7A 4CE9A 2VG6A 1ZBHA 1KLNA 3DOKA 3T1AA 4DSFA 4ZTFA 3HPOA 4EZ6A 4OLBA 3U3GA 4K8XA 2BDPA 2DFHA 3QEPA 3ZSOA 3MXJA 3BGRA 4DTXA 4NCGA 4M3XA 2ZE2A 1LAVA 4CIFA 3TWHA 2D5RA 3LWLA 4B9MA 4FJ5A 4CGDA 2Z1JA 1CZ9A 3IG1A 3PUFA 3K5LA 5KI6A 1KVAA 4CHNA 3KJVA 2VG5A 4Y1CA 3VN5A 5T7BA 1IKVA 3MEEA 4FLTA 4DSLA 3VQAA 4E19A 4CGIA 5HRPA 3QETA 1KFDA 2WONA 2YKMA 2YKNA 3VQ5A 4CGFA 3NE6A 4B9UA 5D3GA 5FRNA 3EY1A 2HMIA 3U3YA 2NUBA 4DFPA 1SL1A 3LPUA 3OYGA 1QSSA 2A1RA 1NK7A 3LP2A 3EZ5A 3VQQA 1S1TA 4CJUA 1GOCA 3ZT1A 4I9LA 4UQGA 1LWEA 2B4JA 3OS2A 3SCXA 4Z4CA 1IKYA 2I5JA 4N47A 4CHPA 3EYZA 4FLZA 1N6QA 1RT4A 3K5OA 3PO4A 4CCHA 4CGGA 1HYSA 1RILA 2ATQA 4DTSA 1B9FA 1EETA 3B6OA 1SL0A 1J53A 4IFYA 3HPHA 2RF2A 3RTVA 3HVRA 2G8FA 1Z26A 5DMRA 4B8CA 3QEXA 4KHNA 3HM9A 5HRNA 4CJWA 4ZTJA 1YTUA 1KSPA 4CGHA 2HHSA 3O3GA 1J54A 4ZHRA 3SPZA 2YNHA 4KFBA 4M3ZA 1ASUA 4R5PA 2Y1IA 2E6MA 3M8SA 4EP5A 4OKJA 3HXMA 3QEIA 1X9MA 4M42A 1NJYA 2O4IA 3ITHA 4K8ZA 4CESA 4E7JA 3SYZA 1VSJA 1ZBFA 4OKEA 4E1MA 4I2QA 3PY8A 4DQIA 3TABA 3DRRA 1NK0A 1IKXA 4DWIA 2D0CA 1IH7A 4FLUA 1I39A 1WSJA 1BISA 3SUNA 3KLHA 3SJJA 4FM2A 4DQQA 1BHLA 1WN7A 1NJWA 4PWDA 5EU7A 1XHXA 4JS4A 1RDBA 3G0ZA 4M45A 5C25A 1MU2A 4DTMA 4BDPA 2DTUA 3NF6A 3AVCA 2KFNA 3K5NA 4FCYA 1IO2A 1JLAA 5CY4A 3OYJA 3V6DA 2PYLA 3ZT2A 3DLBA 2G8VA 1RCHA 1J9AA 4CJLA 4KHSA 4PA1A 3ZT0A 3OYAA 2XRIA 4Z4FA 2HNYA 4H8KA 3HPGA 4FM0A 3T19A 4KAZA 4FXDA 1KTQA 4LD0A 3THVA 1UA1A 5C24A 4NCAA 1XWLA 1SKWA 4QCLA 1LAWA 2YNFA 3PX0A 3NDKA 4JS5A 3OVNA 4BDZA 1VK0A 2HNDA 3AA5X 4F3TA 3TAFA 3RMCA 4FK0A 1RBUA 2XY8A 3V1QA 4CJKA 4CF0A 4CF9A 1X1PA 3OJSA 4FLVA 1ZBLA 4DLGA 2HB5A 4M3WA 4FJNA 1FK9A 1S1WA 1C1AA 1VRTA 4I7FA 5KRSA 3CM5A 2LSNA 4F4KA 2XHBA 1L5UA 1TKDA 1NK4A 3A2FA 2HW3A 2HHTA 2G8IA 3S3OA 2BE2A 4DSIA 3DOLA 3V9XA 4OVLA 4E7HA 1RT5A 3AO5A 4AHUA 3QEVA 5HRRA 4B9LA 1RTJA 1QSYA 3AA4A 1RTHA 4CHYA 3LDSA 1SKRA 3VQ6A 4FK2A 4CEOA 1RNHA 4IDKA 4CHOA 4CEEA 4IG3A 3CFPA 3SV4A 4KREA 2G8WA 1TK5A 3L2QA 1BI4A 3NF8A 4E0DA 2RPIA 3ZSXA 2QKBA 3L2VA 3QLHA 2OPQA 1TK8A 4JRQA 1LW2A 3OYIA 3NAEA 4DF4A 2IAJA 5I42A 3JSMA 3NF7A 1RDDA 2BANA 4RW4A 4E89A 3L2RA 1CZBA 4FJXA 1CXUA 3S9HA 3RR7A 4F8RA 3CQ8A 4NYFA 4ID5A 1B9DA 3QERA 3G10A 4FYDA 4EP4A 4FZYA 1L3UA 2HNZA 1C0MA 1TKZA 3V1OA 4CJVA 5FROA 4HCCA 4CEFA 4CK1A 3SI6A 1HYZA 2HHWA 4FM1A 4B9SA 4ELVA 4DMNA 5SWMA 4RG8A 2JGUA 5JS2A 4FJKA 4ELUA 2YHAA 4AHTA 3O3FA 4EZ9A 3AA3A 5SZTA 4LY7A 3DLEA 3LP0A 2RN2A 4CJPA 4DLEA 3O4NA 4DTJA 3SQ1A 2OZMA 4CEDA 1KVCA 1CLQA 3WNGA 3KTQA 1KVBA 3IS9A 3WNHA 4Q5VA 3MAQA 4BE0A 2HHQA 1O1WA 3QIPA 3C95A 4RW9A 2P5OA 4GMJB 4O4GA 3CFOA 3OYBA 1FKPA 4N5SA 2YHBA 4QOZB 3ZCMA 1JLGA 1YVUA 3LAMA 1U4BA 1GOBA 1RT2A 3HSTB 4IG0A 4B3OA 3M8PA 2A1SA 1LWCA 2OPSA 3VQDA 2YNGA 4DFMA 3AO3A 3AVFA 4ID1A 3K5MA 3KLIA 3KLFA 3VQCA 2RKIA 3HT3A 2Z1GA 4OKKA 4FLXA 4FK4A 4KV8A 3KIOA 4DTOA 4HVJA 3I8DA 4BWMA 1N5YA 3AVIA 4FJGA 3O4QA 3V9WA 4M3YA 2PZSA 1U04A 3VA0A 4LH5A 2ITGA 4B8AB 2X6NA 1X9SA 4DQSA 3VQEA 3DI6A 1WSIA 2FBTA 4CJEA 3K59A 1TL1A 2OPPA 3VA3A 3P1GA 1A5VA 1TKTA 3LP3A 1J5OA 3HYFA 1UWBA 1UA0A 1Q9YA 1C0UA 1U48A 3D0PA 3VQ9A 1S1XA 1WAFA 3LPTA 5HLFA 1EX4A 4IFVA 4CJ3A 1JKHA 4C8MA 4E3SA 2X6SA 1S5JA 1HNIA 1X9WA 4CEBA 4DG1A 1RT1A 2D0AA 4KKOA 3OYDA 1B92A 3E01A 4FLYA 4MFBA 1C1CA 4FW1A 1UOCA 1XHZA 3V1RA 4DF8A 2P51A 3I0SA 3HO1A 1TK0A 4RW7A 1YTAA 3QO9A 3NBPA 5HBMA 1RTDA 3ZSYA 3RMAA 3I0RA 1NKBA 1W9HA 2P1JA 3AVMA 3KK3A 4AILC 5J2QA 3NCIA 1QSLA 2FBVA 4CJ4A 1LWFA 5CYMA 3OYFA 4C8OA 4IKFA 3C94A 3ZSZA 4FJHA 1BL3A 1KRPA 4I9QA 4H4OA 1BI4B 1HYVA 3LANA 4GW6A 3IRXA 4M3UA 4O55A 3NH1A 3KK2A 1HJRA 1A5WA 1QE1A 4W5OA 3O3HA 1L3SA 1VSIA 3ZSQA 2HHVA 3WNFA 3K57A 2VWJA 3PX4A 3VQ7A 1EP4A 5DK5A 3MEGA 4HUFA 2QXFA 3H08A 3L2WA 1SL2A 1IG9A 3QNNA 1NOZA 4KHYA 3ALYA 4B9TA 3AVKA 1U45A 3SUQA 4BDYA 4CERA 1S9GA 4Y1DA 3NGIA 4CFDA 4BACA 3V9SA 1NKCA 4C8LA 2PY5A 4FJ7A 5HP1A 1JL1A 4CF2A 3NGYA 3ZSVA 3AVLA 3OYMA 4AH9A 1Q9XA 3ZSRA 2XY5A 4CK2A 4OPKA 3SUOA 2ZD1A 4N41A 4KTWA 1DTTA 3M8QA 4FLWA 4LH4A 2G8KA 1KCFA 1SUQA 5FRMA 1HNVA 3SV3A 4CHZA 1TVRA 1RDAA 2VG7A 3CM6A 3HL8A 1L3TA 1SV5A 4J2AA 3F9KA 3RR8A 5KRTA 4IBNA 4M3RA 4KRFA 4W5NA 1BQMA 4J2DA 3JYTA 4FVMA 2HHUA 1JLCA 3AVAA 2Z1IA 4KB1A 2O4GA 3L2UA 2DFFA 5C42A 3DLHA 4YNQA 2OPRA 1VSMA 3AO4A 4DFJA 4ELTA 1HQUA 4E7IA 3M8RA 1TL3A 1I3AA 4KPYA 4FJJA 3MEDA 4OGEA 1RTIA 1Y97A 4WE1A 3TAEA 2E6LA 3MECA 4DU3A 1ASWA 1T05A 3HJFA 1ITGA 3MXMA 3V81A 4DS4A 1KFSA 2WOMA 1S6PA 4XIUA 3SQ2A 3SQ4A 4FZXC 3RMDA 1WLJA 5J2MA 3T3FA 2XY7A 4CEZA 4F2SA 4FJIA 2W42A 4HCBA 3TR8A 3VQBA 3PO5A 1QTMA 4KHQA 5KGXA 4OPJA 3AA2A 4QAGA 4DFKA 4FJ9A 1RDCA 3V9UA 4FJ8A 3HP6A 5KGWA 4O44A 3DRSA 2DY4A 1TGOA 3TAMA 4DSKA 4CGJA 3KD1E 4DQRA 4JLHA 2G8HA 1WAJA 2YV0X 2FC0A 3ZT4A 3DMJA 2IS3A 1QS4A 2ZQBA 4CFCA 2YNIA 4O5BA 3CFRA 3SNNA 4PUOA 1T03A 2F8SA 1WSEA 1RBSA 3HVTA 4C8KA 1JXBA 1TV6A 4E7KA 4L8RB 3AV9A 1VSLA 4AHRA 1NK6A 4CJRA 2XO7A 4DU4A 1Z25A 5E41A 1SKSA 4BWJA 4DTUA 3LZJA 2G8UA 4DQPA 2Y1JA 4CEAA 4KI6A 1K6YA 5HROA 1HRHA 1NK5A 1KLMA 3P83D 5KTQA 3C6TA 2B6AA 3AVNA 3LZIA 4N76A 1CXQA 1RT6A 4DSEA 3L3UA 3SUPA 2P5GA 2ETJA 1HQEA 4TSXA 1A5XA 2FBXA 3AO1A 3B6PA 1JLFA 1S9EA 2X74A 4G1QA 3TANA 1T7PA 2KZMA 1ZYQA 1FKOA 1NK9A 1JLEA 1RBTA 4H4MA 4NCBA 3K2PA 3ZT3A 4N56A 3KK1A 1JL2A 3QINA 3TARA 3S3NA 1C0TA 4FZZA 3NH2A 2X78A 3DRPA 4AHCA 4Z4GA 1BCMA 2QKKA 3ASMA 1QQCA 1VSKA 3AVBA 1BQNA 3ZSWA 4DU1A 1VSDA 2KW4A 3SQ0A 3S3MA 1XI1A 4DSJA 4W5TA 4OLAA 1UAXA 3SPYA 4Z0UA 3KD5E 2IOCA 1WSGA 3NH0A 1F21A 4KO0A 2GUIA 3NGZA 1G15A 5CZ1A 1D9DA 4KTQA 4CECA 4ICLA 3K58A 3PV8A 3OYCA 2PYJA 1D8YA 4BE2A 4OGCA 1ASVA 2QK9A 4YFUA 4F2RA 1NOYA 1DLOA 3P5JA 4CJQA 3AVGA 4I2PA 4CHQA 1IKWA 3L8BA 4HHTA 2E4LA 1TKXA 1Q8IA 5K14A 3TAGA 4NYNA 3TI0A 4PQUA 3V9ZA 4Z4HA 4Q0BA 4M3TA 2KTQA 3RRGA 4J2EA 4KHWA 4HUGA 4DS5A 3DLKA 1R0AA 2HVIA 2GV9A 2F8TA 3OYEA 4CIEA 3OY9A 1EXQA 3OS1A 2GBZA
chains in the Genus database with same CATH superfamily
4ISEA 3ZLJA 1RBVA 3RWUA 4IWVA 1ZBIA 4OPAA 4B1UB 3WEEB 1NK8A 4V19S 5HRSA 3QNOA 3P31A 2VWBA 2IGIA 3AVHA 3AAPA 1JCEA 4X66K 4E1NA 3H6EA 3CG7A 4KHUA 3BDPA 4CF8A 1D9FA 2EHGA 1S1VA 2IC3A 1NJXA 1ZBUA 4H0TB 1WNSA 2P9KA 3WNEA 3OYNA 2OZSA 3HZ6A 5AQWA 5CZ2A 3ID8A 4CFBA 3UIQA 4O8UA 3D2EA 1VSFA 4E7LA 3MXIA 2KFZA 1NGHA 3QESA 2XY6A 3VQ8A 2EWSA 2D0OA 4M7YA 3TAPA 2O8CB 1BU6O 2O8FB 4U67L 3ZETA 4CJSA 1RBRA 3RMBA 4XH5A 1HPZA 3KWGA 4J2BA 4CFAA 2V7YA 1HX1A 2OA8A 1VRUA 3D2FB 3CJ1A 2OTJN 4C8NA 4GVMA 3TAQA 1JLBA 2NRTA 2HF3A 3LP1A 3KK7A 1C6VA 1J5EK 4H5NA 1GOAA 2NRZA 4CIGA 1G99A 1HPMA 3DXKA 2P9UA 4CZFA 2BDPA 3BZCA 4NCGA 5AQQA 4M7XA 2D5RA 3MDQA 4BRAA 3MCPA 1KVAA 1N8RO 4X64K 1V4TA 3MEEA 2WTUA 5AZJA 3QETA 2WONA 2YKMA 3NE6A 3GL1A 5D3GA 4JI3K 3AGRA 4JKCA 2HBJA 4BROA 3TPQA 5EY4A 1QSSA 3LP2A 1S1TA 4K41A 1OVYA 4I9LA 3ZT1A 3PIPL 1LWEA 4FWLA 4B3TK 1KAYA 4N47A 1N6QA 4FLZA 3K5OA 1RILA 4DTSA 2O8DB 1B9FA 3JXUA 2HOEA 3HPHA 3QEXA 1JCFA 2WFBA 2D0PA 3LDNA 4CJWA 2UU9K 1KSPA 4LFCK 2VGMA 4LF5K 5AQFA 4DR7K 4LC9B 2ZWHA 5B8HA 3VEOA 3M8SA 4M42A 2P9KB 1NJYA 2O4IA 3EZWA 2JWKA 1KQSM 1VSJA 3SAFA 4DV3K 4I2QA 3IUCA 2W6LA 1IH7A 4FLUA 1JCGA 5AQGA 4ISFA 1BHLA 2E2OA 4WQ4A 1XHXA 3KVGA 4JS4A 4CZKA 2KFNA 1P90A 3DXMA 3V6DA 4BR9A 3ZETB 5AFUA 1RCHA 3ZT0A 2XRIA 3OW2M 3CCRN 1Q18A 1KTQA 2QWLA 4LD0A 3W0LA 3KWIA 1XWLA 1SKWA 2YNFA 3FZLA 4JS5A 3IKMA 4FK0A 3CIPA 1RBUA 1QZ5A 2VCPA 3OJSA 3MMVA 3I56N 3SAGA 4DLGA 2HB5A 1FK9A 2GTDA 3DXKB 2P9UB 4A2BA 4BVOA 1C1AA 1Q81O 5E26A 4F4KA 4IOAL 5KQDA 2HHTA 4DSIA 3DOLA 3V9XA 4WF9L 4AHUA 5HRRA 4FWKA 1RTJA 1YJWN 4GV3A 4JI0K 5AZJB 4FK2A 4CEOA 4BRGA 3H45C 1TK5A 1BI4A 4DR5K 3QLHA 1LW2A 3OYIA 3CCLN 2QXLA 3BP8A 3WQUA 1WB9A 4H0PA 1U2VA 4E89A 5JVHL 2YJFA 3CQ8A 1B9DA 2ZGYA 1CZAN 4FO0A 1C0MA 5I9EB 3V1OA 3NVMA 3H46O 5FROA 3GE1A 1W97L 4CEFA 3SI6A 1HYZA 2HHWA 1EQYA 2QWMA 2YHAA 5JLFA 3VERA 2A5XA 5M1FA 4LY7A 1YVNA 3O4NA 2OZMA 3IS9A 4BR2A 1OVQA 4Q5VA 5KPRA 3C95A 4GMJB 3CFOA 3OYBA 3NMUA 2YHBA 4CVNE 4QOZB 1YVUA 3LAMA 3CCUN 1U4BA 3HSTB 4OX9K 4BRCA 1LWCA 4DFMA 3DXMB 1T3VA 4FK4A 2O8BA 4KV8A 4CZJA 3QMLA 4HVJA 3O4QA 3V9WA 3T69A 1U04A 3VA0A 2ITGA 4YDUA 2X6NA 3CQXA 1X9SA 1TKTA 1C0FA 4FSVA 2NRHA 1J5OA 3HYFA 5BREA 4CBUA 3D0PA 3TTDA 1HKCA 1HNZK 1JKHA 2X6SA 3CJAA 5AQHA 2D0AA 3H3NO 1VQON 5AQTA 1C1CA 1XHZA 4DF8A 2P51A 3CC2N 3UE5A 2F9TA 3P4IA 3VF4A 3CXCM 2OCEA 4PL8A 3ZSYA 1BG3A 3SBTA 2P1JA 4NXMK 4XH1A 4QS8A 4DV7K 5J2QA 4CJ4A 3OYFA 5CYMA 2P9LA 4C8OA 5GIPA 3O9SA 4H4OA 1BI4B 4LF7K 2BUPA 1A5WA 3O3HA 4YOVA 2QWOA 2HHVA 3PX4A 4M3ZA 1EP4A 1U2VB 2QXFA 4BVPA 4K25A 1HKBA 3H3OB 4CERA 1S9GA 2UYTA 4BACA 1NKCA 3CMEN 4BG8A 1JL1A 4CF2A 3NGYA 3ZSVA 1VQ5N 1OH8A 2XY5A 3SUOA 4N41A 5FRMA 1KCFA 2D1KA 1HNVA 4CHZA 1RDAA 2VG7A 1E3MA 1SV5A 1ATNA 1VQ8N 5EXWA 3RR8A 5KRTA 4BRKA 4Y0WA 4M3RA 3L4IA 4WQ4C 4A61A 2Z1IA 1FW6A 4A62A 3L2UA 2DFFA 5C42A 1NG9A 2ZGZA 2YI1A 3EKUA 3M8RA 1TYQA 2GEMA 4KPYA 4FJJA 3MEDA 4GKJK 4IEEA 5BRDA 1RTIA 3HJFA 4DS4A 4YY3K 3DLLL 3ENBA 3SQ4A 2XY7A 4F2SA 2W6KA 5BR9A 4JI6K 2O8BB 1QTMA 4AF1A 4QAGA 4FJ9A 1RDCA 4BRHA 4FJ8A 2FSJA 3A5NC 5KGWA 4O44A 3DRSA 1C0GA 3CERA 4H5TA 4CGJA 4JLHA 3CFRA 1T03A 5AZIA 1RBSA 1NK6A 4CJRA 3O1WA 3R3LA 3U8XA 2DPNA 5FPDA 4KI6A 1K6YA 5HROA 1NK5A 1DEJA 5KTQA 3C6TA 3O8MA 2B6AA 3THYA 4IJAA 3LZIA 3L3UA 2ETJA 3W3DA 3B6PA 2KZMA 2CGJA 5AQMA 1T7PA 4CZLA 2A3ZA 4H4MA 3K2PA 4FZZA 3J8AA 3NH2A 1BCMA 2QKKA 3ASMA 3AVBA 3ZSWA 4FJNA 1XI1A 3SQ0A 4OLAA 3CJCA 2HW3A 3A5OC 4IZ9A 4W5TA 3SPYA 2IOCA 2V51B 3TSUA 2HF4A 4CECA 4NLCA 4ICLA 3PV8A 3OYCA 3J80O 1D8YA 4BE2A 1ASVA 4H5WA 3E9PA 4F2RA 1WOQA 3P5JA 4CJQA 4CHQA 1IBMK 3CCSN 2E4LA 1Q8IA 5K14A 3TAGA 2WUSA 4Z4HA 4G9ZA 4J8FA 5M1NA 4EIAA 2KTQA 4HUGA 3SJHA 4BRFA 4NO7A 5C15A 4M63C 4CIEA 2QM1A 4FWPA 1EXQA 2GWKA 3VTHA 3OS1A 4GVEA 4DR2K 5DM7L 5FPEA 3THWB 3HI0A 4F3OA 3OYKA 3L3VA 5EOYA 3VQPA 4DTPA 4KTZA 1ATSA 4JRPA 1TYQB 3O1BA 2P9SB 4PKHA 3WXIA 4JD2A 2D0BA 2NRWA 3ULEA 5MLCQ 4DTRA 3HK2A 4YDUC 2ASMA 1U47A 3NF9A 3PX6A 3WUHA 1DTQA 5FPMA 4CEQA 3SZ2A 3AO2A 1D5AA 4E7IA 1EWQA 4BREA 4CJ5A 3QEWA 2FF6A 1RT3A 2Q3SA 3TTFA 3CD6N 2AJQA 5AZIB 4BQZA 1Z6RA 4E1JA 5AQYA 3ZYYX 4ILHA 3RRHA 1VQKN 1N32K 3SBGA 1BGXT 5M1KA 2HVHA 4DCHA 3THYB 3CCMN 5I3UA 4B9QA 4HUEA 4RCHA 3I8BA 4CJFA 3HP9A 5A2QO 3KKSA 2VGNA 3FFIA 4O0JA 1OH6A 2IVOA 1REVA 4KI4A 1GLDG 1FXXA 2IDOA 2DFEA 4BRIA 1KD1O 4CE9A 5BPNA 4OLBA 1NGJA 3U3GA 5C2FA 4K8XA 3HM8A 3BGRA 4M3XA 2ZE2A 3QFPA 4B9MA 3K5LA 2Z1JA 4IO9L 3M1FA 4Y1CA 4DSLA 5HRPA 1KFDA 4B9UA 3U3YA 1ZBSA 3D2FA 4HTLA 2A1RA 3PLAA 1NK7A 3JS6A 3VQQA 2B4JA 3OS2A 3SCXA 4Z4CA 4CHPA 4FOEA 1RT4A 3R1XA 4L3QA 2F9WA 3E1YA 2E5LK 3ULEB 3M6GA 4JK8A 3THXB 2RF2A 3UKUA 2G8FA 3VF2A 2PAVA 3VGKA 4C23A 2IIRA 3K9JA 2HHSA 1NMDA 3VF6A 3LDLA 3SPZA 2YNHA 1VHXA 4R5PA 2Y1IA 5GAGP 4OKJA 3ITHA 4K8ZA 3SYZA 5GADP 1ZBFA 3TABA 1NK0A 3CQYA 4DWIA 5JMVA 3F9MA 3WXKA 3KLHA 1NGCA 1N36K 3FFKB 4H0VB 4DQQA 4GY2B 3G0ZA 4M45A 1KXPA 5C25A 3NF6A 3EN9A 2O8DA 1JLAA 3R9PA 3OYJA 1DKGD 4CJLA 1VQ4N 4PA1A 3OYAA 4H8KA 4BC5A 3ZX2A 1SQKA 4CD1A 4KAZA 4BRQA 3J7ZO 1UA1A 1R59O 4EHUA 1X3MA 4F3TA 1SZ2A 3UKRA 4CJKA 3VPZA 4CF9A 2QWRA 3VEYA 1W2BM 4JI8K 2XHBA 1L5UA 4DV2K 1TKDA 1TUYA 2ITMA 4DV6K 4H0XB 1X9JA 2G8IA 4E7HA 1RT5A 3QEVA 4B9LA 3BEXA 3TSPA 5BPLA 4CEEA 3SV4A 1I94K 1XMOK 3ZSXA 3L2VA 4KBOA 4A5BA 4JRQA 1HNWK 4KHPK 2IAJA 5I42A 2KHOA 1Q86O 3DWLA 5BRFA 3L2RA 3RR7A 3IFRA 1O13A 3MK6A 4JI4K 4EP4A 2W40A 2JWLA 5LJWA 3UKUB 5AQSA 4DMNA 5SWMA 2JGUA 4FWSA 3O3FA 3AA3A 3LP0A 4CJPA 4BRMA 3VETA 3MAQA 1BDGA 4BRPA 1O1WA 1RFQA 2FSKA 3N4PA 4LF6K 1RGIA 4LF9K 2AP1A 5M1PA 4B3OA 4I6MA 4EHTA 3M8PA 3J7YP 4K42A 3ATVA 1KC8O 3AVFA 3FE1A 3JAMO 3HT3A 1HUXA 4OKKA 4B1XB 3KIOA 4DTOA 3I8DA 5LMUK 4M3YA 3BUZB 2Q0RA 3MN5A 4LH5A 3O9UA 4B8AB 4A5AA 3VQEA 1WSIA 1YAGA 1A5VA 2NNWA 1QQNA 3E9OA 1C0UA 3UKRB 3VQ9A 1P8ZA 1BOTO 1WAFA 3LPTA 1M1KO 1SAZA 1X9WA 1S5JA 1HNIA 4CEBA 4DG1A 1BUPA 4B1WB 3E01A 4FLYA 5GIOA 4FW1A 1UOCA 3SLCA 4CZMA 2E20A 1K8KA 3NBPA 3EE8A 3I0RA 1NKBA 4JI2K 3KK3A 2FBVA 1LWFA 4FJHA 3ZSZA 4R79A 3CC4N 1KRPA 4EFHA 3ZX0A 3LANA 5AQPA 4M3UA 4JKFA 4O55A 4ILGB 5E84A 4CBWA 4FWMA 1L3SA 4GKKK 3K57A 2VWJA 3VQ7A 5DK5A 3MEGA 1ESVA 4HUFA 3H08A 3L2WA 4LFAK 4KHYA 4B9TA 4OO1J 3AVKA 3VEVA 1U45A 2Q0UA 1GLJO 4Y1DA 3NGIA 3V9SA 1GLLO 1DGKN 4CK2A 1YF5L 3G4SN 3I55N 2ZD1A 1DTTA 3M8QA 2G8KA 1SUQA 3AY9A 3SV3A 3CM6A 3HL8A 1L3TA 3F9KA 3OHRA 3ID6A 4IOCL 2P9NA 1BQMA 4JI1K 1BA1A 1JLCA 2HHUA 4KB1A 3T7ZA 3AO4A 4F9OA 4DV0K 1TL3A 5EX5A 4I6MB 4OGEA 3TAEA 1T6CA 3J81O 3OBYA 2V52B 2PBDA 1ITGA 5CE3A 3V81A 5ADXH 4XIUA 1S6PA 3SQ2A 3HSCA 1WLJA 5J2MA 4HCBA 4JKBA 3PO5A 4B3MK 2QA4N 4H0OA 1TGOA 1NNEA 3TAMA 3O5BA 1BA0A 4DSKA 4EAHD 2VQFK 2FC0A 3ZT4A 4CFCA 2ZQBA 1ZC6A 4O5BA 2QTDA 3HVTA 3AV9A 4AHRA 1KAXA 4OPHA 3L6QA 4DTUA 5AQKA 3CC7N 1MDUB 1HRHA 4U7BA 1KLMA 3P83D 4BRLA 3AVNA 1K8KB 1CXQA 1RT6A 1A5XA 3AO1A 2X74A 4FPAA 1NK9A 1JLEA 4CJ7A 4JI5K 4N56A 3KK1A 3QINA 3S3NA 2X78A 4UY8O 4AHCA 4Z4GA 1VSKA 2KW4A 3S3MA 1UAXA 4Z0UA 3VENA 2GUIA 3R6MA 5CZ1A 3O9QA 3P38A 4BRDA 3VTIA 3SK3A 4OGCA 2QK9A 4YFUA 1YJNN 4PKGA 4HHTA 1TKXA 3TI0A 4PQUA 2FXUA 3HRGA 4B1ZA 2KLAA 4A57A 1K9MO 4JKDA 1R0AA 1E4FT 2P9NB 1WSHA 2FSNA 3SAHA 1LW0A 1OH5A 4DR3K 3QIOA 1XC9A 2OYQA 2E2PA 1VQ6N 3OJUA 2B5JA 4JN4A 4DTNA 2ZJPL 2F96A 1L3VA 3O9RA 4GNIA 2QEXN 3C6HA 3KLGA 4IDHA 1EKEA 2CGKA 3IAYA 3OYLA 3WQTA 3OA9A 1C1BA 5J2PA 5LL6Z 2Q31A 5BN8A 1QHTA 2CH5A 4JKAA 1MWMA 3CYMA 4FJMA 3H1QA 4WQ5A 5J1EA 1HMVA 1TAQA 4MLEA 3THWA 2EX3A 3ULDA 3P39A 4KH5A 4AHVA 5HL7L 1VSHA 4MQ3A 1M90O 4AHSA 4Z4EA 5J2NA 1TUUA 4CK3A 1U49A 4DR1K 1YXQA 4W5QA 4CF1A 2HBLA 1NJZA 3F73A 1WSFA 2P9SA 3TTCA 1NBWA 3KKRA 2NRVA 5FDLA 3DYAA 5CYQA 4JEPA 3AVJA 4FJLA 5KPTA 3VESA 2H3GX 3CJBA 3F2KA 3KLEA 3E9LA 1ZXOA 3LALA 1S3XA 4BR7A 4DV4K 3C6AA 1VQ7N 2ZJRL 3CETA 2BGGA 2Z1HA 4BC2A 3NFAA 3LDQA 3WXLA 4RW6A 4O0IA 1NGFA 3DJCA 5BR8K 3LWMA 3LAKA 2F4VK 3U9ZA 3V4IA 2P9IB 1KLNA 3LDPA 4ZTFA 4EZ6A 4LFBK 4FWNA 4IXCA 3QEPA 3MXJA 1K73O 1LAVA 3TWHA 4FJ5A 4CGDA 1CZ9A 3IG1A 3PUFA 1N33K 3NVKA 3QB0A 5T7BA 4FLTA 1NGAA 3EY1A 2HMIA 2NUBA 5AFUH 1S72N 3OYGA 3CI5A 1SS6A 4O5FA 3EZ5A 4CJUA 1GOCA 2FLOA 2ASOA 2UUAK 4MLHA 3EYZA 1IKYA 2I5JA 3GG4A 3QBXA 3PO4A 4CCHA 1HYSA 4BQLA 2ATQA 1V4SA 3WXJA 1EETA 3B6OA 4HWIA 2E8AA 1J53A 4CBXA 5DMRA 4B8CA 4KHNA 5HRNA 3C7NA 5AQJA 4ZTJA 3O3GA 1J54A 4ZHRA 1ASUA 3HXMA 2ZM6K 3QEIA 1X9MA 1VQNN 4WFNL 4OKEA 2VYPA 4E1MA 1YITN 4QCLA 3DRRA 4CZHA 2Q97A 1WSJA 1BISA 3SUNA 3SJJA 3MN7A 4FM2A 1NJWA 4PWDA 4WFBL 4DTMA 1YHQN 4BDPA 4LF8K 1MWKA 3K5NA 4FCYA 5CY4A 2YHYA 4K43A 2G8VA 1J9AA 4KHSA 3THXA 4X65K 2GWJA 3VGLA 5H1SQ 3HPGA 4NB4A 1YI2N 3C65A 5CR4A 4FXDA 3THVA 3BF3A 5BPMA 1LAWA 3PX0A 3O9TA 4NLBA 3NDKA 4BDZA 3ZEUA 3TAFA 2OTLN 2XY8A 1RDUA 1GLEG 4CF0A 1X1PA 4M3WA 3DAWA 1S1WA 2BTFA 5KRSA 3K0SA 3S3OA 1YIJN 2BE2A 2GELA 3U4LA 2O8EA 2ASPA 1RTHA 5KPZA 5LJVA 3LDSA 1SKRA 3VQ6A 1RNHA 4IDKA 3CFPA 3QDKA 4BGBA 4KREA 2G8WA 2WBNA 3L2QA 3MWTA 3NF8A 2OPQA 3NAEA 3GDQA 3LL3A 1RDDA 3CJ7A 4FJXA 5AQRA 1MA9B 1RDWX 1CXUA 4F8RA 3QERA 3MX5A 4JV5K 3CCEN 3CCJN 2HNZA 1TKZA 3C7NB 4CK1A 4FM1A 4ELVA 5AR0A 4FJKA 4YOXA 3VEXA 4ELUA 4AHTA 5SZTA 4DLEA 3N4QA 3DLEA 2RN2A 4DTJA 4CEDA 1KVCA 1KVBA 3WNHA 3QIPA 4RW9A 4O4GA 3RSEA 2UXBK 1EO1A 4NXNK 4IO8A 4N5SA 2Q1NA 1JLGA 3TU5A 2QW9A 1GOBA 5DM6L 2A1SA 2A41A 5AQNA 1GLFO 2W41A 2YNGA 2UUCK 5GINA 3K5MA 4MDBA 3KLFA 3VEWA 2RKIA 4JK9A 2Z1GA 5F2RA 3FZKA 1NWKA 1N5YA 4BWMA 3AVIA 4H0YB 3K59A 4CJEA 2OPPA 3VA3A 3FLCO 2NRXA 3ZX3A 3LP3A 1UWBA 4JKGA 1Q9YA 3KHYA 3ZEUB 5GAEP 3ENOA 1U48A 2FF3B 1EX4A 4ISGA 4C8MA 4E3SA 3C0BA 1QQMA 1NGIA 4YOTA 4MFBA 4DR6K 3V1RA 4RWTA 2O8EB 4WCEL 1TK0A 1HNXK 4RW7A 1YTAA 5AQUA 5HBMA 4KH4A 3RMAA 5AQOA 3AVMA 2P9PA 3NCIA 4JYAK 3C94A 3QFUA 1BL3A 4DV1K 2QWNA 3R8EA 3IRXA 3NH1A 3KK2A 3CPWM 1HJRA 1H1VA 4W5OA 5AQZA 3BZKA 3WNFA 4DV5K 2RHKA 1SL2A 1NOZA 4FPBA 3FZFA 1VQPN 3EO3A 5AJ3K 1HJOA 2PY5A 4FJ7A 1NMNA 4B3SK 1NGBA 3AVLA 4CW7B 4AH9A 1Q9XA 3ZSRA 1XNRK 4OPKA 3G25A 4KTWA 2VQEK 4BRNA 3EL2A 4LH4A 5C0YA 3H1VX 4FVUA 4DUYK 3LM2A 3QICA 4IBNA 4W5NA 5TKWA 4H5RA 3RSEB 3JYTA 4QS9A 3AVAA 2O4GA 1WBBA 4ELTA 4YNQA 2OPRA 1VSMA 3MX2A 4H03B 4DFJA 1NGDA 1IJJA 1I3AA 3ATUA 4JKHA 2NLXA 5F0XA 4FWQA 1Y97A 3T1HK 1T6DA 2E6LA 3MECA 4DQ8A 4C1NK 1KAZA 3VOVA 3MXMA 1KFSA 3WXMB 2WOMA 4FZXC 2YJEA 3RMDA 4JK7A 1EWRA 4FJIA 4CEZA 2W42A 3TR8A 3VQBA 4DFKA 3HP6A 2DY4A 4ILJA 5TKYA 2Q36A 3G6EN 4MO4A 3KD1E 4DQRA 4JKGB 5GAHP 3BF1A 2YV0X 4BG9A 2IS3A 2YNIA 1WSEA 3GOIA 3AAQA 4C8KA 1TV6A 1VSLA 3Q7CA 4DU4A 2BH1A 5C2DA 4FWOA 2I7NA 4N76A 3LM9A 2P5GA 3SUPA 1HQEA 2FBXA 3TANA 1JLFA 2P9PB 3HTVA 1FKOA 5C10A 4JAXA 3TARA 1C0TA 3DRPA 1ATRA 3E66A 1VSDA 1NJIO 4DSJA 3KD5E 3NGZA 1F21A 4MDAA 1BO5O 4KTQA 3D7EO 5ELZA 3K58A 3AGKA 3AVGA 4I2PA 3L8BA 1DT9A 3V9ZA 5JLHA 4Q0BA 4M3TA 4J2EA 3D6RA 3L4QA 2HSTA 3OYEA 4JHDA 4IEIA 4WYBA 2GBZA 2E1ZA 3D2EB 4PL7A 4YOWA 2KQ2A 1FJGK 5C12A 3LDOA 4Z4IA 4B9NA 2HBKA 5FLXO 2JLEA 4B9VA 1NKEA 2HMPA 1W7AA 4CI6A 4BE1A 4LF4K 1W0HA 3DM2A 3EEQA 4YOUA 3OYHA 2ZJQL 3FR0A 3MCAB 4RW8A 1XQSC 4CD3A 4BR4A 2HHXA 3KZBA 1NLVA 3ISNC 4CJTA 4FW2A 1XC3A 2UXCK 2UXDK 2HBMA 3A5MC 4W5RA 1BCOA 4GV9A 3ENHA 1YT3A 1BIZA 4B08A 4LSLA 1S6QA 1TAUA 1QVGM 1HKGA 3VQ4A 4A59A 4JI7K 2VWKA 4OJRA 4HTUA 1QQOA 2HHHK 1LV5A 3DLRA 3T1YK 5HOOA 1JXEA 4KB0A 3C6UA 5BRHA 4BGAA 3OS0A 5LMNK 5AQXA 2R7YA 1JLQA 4LSNA 2KZZA 3Q7BA 5AQIA 2UUBK 1VSEA 4PY5A 3U9DA 3DLGA 1NU0A 1J6ZA 3MN6A 3U6FA 4DKWA 3NHGA 1S1UA 5IT9O 4M41A 3QBWA 5M1QA 3O4WA 3D45A 2E88A 1T8EA 1Z05A 2FBYA 1BIUA 1RT7A 1ZBHA 2VG6A 3DOKA 3T1AA 4DSFA 3HPOA 2DFHA 3ZSOA 4DTXA 1GLCG 3HOTA 4CIFA 5JICA 3LWLA 3OTOK 5KI6A 4CHNA 3KJVA 2VG5A 3VN5A 1IKVA 4BR0A 1GLBG 3VQAA 4CGIA 4E19A 3VMFB 1IG8A 5FRNA 2YKNA 3VQ5A 4CGFA 1XNQK 4JHDB 2QI2A 4DFPA 1SL1A 3LPUA 3OBWA 3EE9A 1OKJA 2F7TA 3O08A 4UQGA 2YCHA 3CHWA 4QS7A 4A2AA 4YORA 5JVGL 4CGGA 2P9IA 2YHXA 1T44A 1SL0A 3CMAN 4IFYA 4CZIA 3RTVA 3HVRA 1Z26A 3IDHA 4IJNA 3HM9A 1YTUA 4CGHA 4YHHK 4KFBA 4AM6A 1NM1A 2E6MA 4EP5A 4CESA 4E7JA 3PY8A 2HHQA 4DQIA 1IKXA 2V7ZA 2D0CA 4B3RK 1I39A 2CGLA 1GLAG 1WN7A 1Q82O 5EU7A 1RDBA 1MU2A 2DTUA 1XUPO 3AVCA 4WFAL 1IO2A 3DLBA 2PYLA 3ZT2A 3S41A 4JNEA 4JKEA 3CJ9A 3RVCA 4CZEA 2HNYA 4Z4FA 4FM0A 2A6AA 3T19A 1JJ2M 1VAZA 5C24A 4NCAA 4B1YB 3OVNA 3CCVN 1VK0A 2HNDA 3AA5X 3F5TA 3RMCA 3V1QA 4FLVA 1ZBLA 2GX9A 1VRTA 4I7FA 3VGMA 3CM5A 2LSNA 4AM7A 1NK4A 3A2FA 3O6WA 3MN9A 4OVLA 3WT0A 3AO5A 3FZMA 1QSYA 3AA4A 4CHYA 1QVFM 2Q2RA 4CHOA 4IG3A 4E0DA 2RPIA 2QKBA 1TK8A 5JS1A 4DF4A 3J7AP 3JSMA 3NF7A 4FWRA 2BANA 4RW4A 1D4XA 1CZBA 3S9HA 3M5RA 4DB3A 4NYFA 4ID5A 4FYDA 5IWAK 3G10A 3CCQN 4FZYA 1L3UA 3FZHA 4CJVA 4HCCA 4XEIA 4B9SA 1K8AO 4RG8A 1Y64A 5JS2A 4EZ9A 1CLQA 2I7PA 3SQ1A 2E2QA 4RTFD 3WNGA 3KTQA 4XH4A 4BE0A 4PHTX 2P5OA 2NRRA 1FKPA 3HBTA 3GBTA 3ZCMA 1RT2A 2J4RA 4IG0A 4CZGA 4FOIA 1LOTB 1E4GT 4BC4A 2OPSA 3VQDA 1HR0K 3AO3A 4X62K 4ID1A 5CHIA 2ZF5O 3KLIA 3HOSA 3VQCA 4H5VA 4FLXA 4BR5A 4FJGA 2P9LB 2PZSA 1IV0A 4DQSA 3PIOL 3DI6A 2FBTA 3CF5L 1TL1A 3P1GA 1UA0A 2GUPA 5HLFA 1S1XA 4IFVA 2WC9A 4CJ3A 1NGGA 3L0QA 1RT1A 4KKOA 3OYDA 4FL9A 3SMPA 1B92A 3M3ZA 4K0KK 1OH7A 3I0SA 1YJ9N 3A0IX 3HO1A 3QO9A 5KQ8A 1RTDA 4O8KA 1W9HA 4AILC 1QSLA 4DUZK 2IVNA 4IKFA 2NZTA 4I9QA 1HYVA 1QZ6A 4GW6A 1QE1A 1VSIA 3ZSQA 3PSFA 1QHAA 1IG9A 3QNNA 1HLUA 3ALYA 1X3NA 4PKIA 3SUQA 4BDYA 4C8LA 4CFDA 5HP1A 3FGUA 3OYMA 1S22A 2YHWA 2D4WA 1Q7YO 1WBDA 4FLWA 2YX6A 3AARA 1TVRA 2OANA 4J2AA 2A42A 2E2NA 5EVZA 2IVPA 4KRFA 1N34K 4DR4K 3MWPA 4J2DA 4FVMA 3WEEA 5AQLA 4BY9C 3DLHA 1BWFO 4DHYA 1HQUA 2PFUA 4IOXA 3I33A 1VQMN 3SMSA 4WE1A 3K9KA 4DU3A 1ASWA 1T05A 2QWPA 3T3FA 1XMQK 3VEZA 4KHQA 5KGXA 4OPJA 3AA2A 3V9UA 4WQ5C 1YUWA 5M1OA 2AA4A 2G8HA 1IBLK 3O80A 1WAJA 2E1YA 3DMJA 1QS4A 3A8YA 1U6ZA 3SNNA 4PUOA 3BY5A 2F8SA 4L8RB 1JXBA 4E7KA 4IFEA 2XO7A 1Z25A 5E41A 1SKSA 4BWJA 4MO5A 3LZJA 2G8UA 4DQPA 2Y1JA 1WUAA 4YOYA 4KH6A 2O8CA 2O8FA 4CEAA 1LCUA 3EKSA 5F1XA 4DSEA 4TSXA 2QWQA 4G1QA 4B1VA 1S9EA 3A5LC 1ZYQA 4C1NI 1RBTA 5LY3A 4NCBA 3ZT3A 1JL2A 2KKZA 4AQYK 1QQCA 5FPNA 1BQNA 4DU1A 5ADXA 1WSGA 2RE2A 3CPEA 4KO0A 3NH0A 1D9DA 1G15A 4JD2B 3IMXA 4GV6A 4Z94A 5AQVA 3TSQA 2PYJA 5BN9A 2A40A 1VQ9N 1NOYA 1DLOA 4BC3A 1IKWA 3G71N 4NYNA 1ILYA 3PSIA 2CH6A 3RRGA 4KHWA 3UB5A 4DS5A 3DLKA 2HVIA 1IBKK 2GV9A 2F8TA 3OY9A 3B8AX 1VQLN 1NGEA
chains in the Genus database with same CATH topology
1WSHA 3BDPA 4F3OA 1RBVA 3RWUA 1ZBIA 1LW0A 3L3VA 3OYKA 2KQ2A 1NK8A 3QIOA 1XC9A 5HRSA 2OYQA 3QNOA 3VQPA 4DTPA 4Z4IA 4B9NA 4KTZA 4JRPA 2JLEA 4B9VA 1NKEA 2IGIA 3AVHA 3OJUA 2D0BA 4BE1A 2B5JA 4DTNA 4E1NA 1W0HA 4DTRA 3DM2A 3OYHA 3HK2A 2F96A 1L3VA 4RW8A 2HHXA 1U47A 3NF9A 3CG7A 3ISNC 4FW2A 4CJTA 3PX6A 4KHUA 1DTQA 4CEQA 4CF8A 4W5RA 3AO2A 1D5AA 1EKEA 3KLGA 2EHGA 1BCOA 3SZ2A 1S1VA 2IC3A 1YT3A 1BIZA 3OYLA 1NJXA 3IAYA 4B08A 1C1BA 4LSLA 1ZBUA 5J2PA 1QHTA 1WNSA 4CJ5A 3WNEA 3OYNA 3CYMA 2OZSA 4FJMA 1S6QA 1TAUA 3QEWA 5CZ2A 1RT3A 5J1EA 1HMVA 4CFBA 3UIQA 3VQ4A 1TAQA 2Q3SA 2EX3A 3ULDA 2VWKA 4OJRA 4HTUA 4AHVA 2AJQA 1VSFA 1VSHA 4MQ3A 4AHSA 1LV5A 3DLRA 4Z4EA 5J2NA 4E7LA 4CK3A 3MXIA 1U49A 2KFZA 1JXEA 4W5QA 3RRHA 3QESA 3VQ8A 3C6UA 4CF1A 2XY6A 3F73A 1NJZA 1WSFA 4KB0A 3TAPA 3OS0A 3KKRA 2R7YA 1JLQA 4LSNA 1BGXT 2KZZA 5FDLA 3DYAA 4CJSA 5CYQA 2HVHA 1RBRA 1VSEA 3AVJA 1HPZA 3RMBA 4FJLA 4J2BA 4PY5A 5I3UA 4CFAA 3DLGA 4HUEA 1D9FA 3U6FA 2OA8A 1VRUA 4CJFA 3HP9A 3KKSA 3KLEA 4C8NA 3LALA 3FFIA 4GVMA 4O0JA 3TAQA 3NHGA 1S1UA 1JLBA 4M41A 2BGGA 2Z1HA 3LP1A 1REVA 3D45A 3NFAA 4RW6A 4KI4A 4O0IA 3LWMA 1FXXA 1C6VA 1T8EA 3LAKA 2FBYA 2IDOA 3V4IA 1BIUA 2DFEA 5JS1A 1GOAA 4CIGA 1RT7A 4CE9A 2VG6A 1ZBHA 1KLNA 3DOKA 3T1AA 4DSFA 4ZTFA 3HPOA 4EZ6A 4OLBA 3U3GA 4K8XA 2BDPA 2DFHA 3QEPA 3ZSOA 3MXJA 3BGRA 4DTXA 4NCGA 4M3XA 2ZE2A 1LAVA 4CIFA 3TWHA 2D5RA 3LWLA 4B9MA 4FJ5A 4CGDA 2Z1JA 1CZ9A 3IG1A 3PUFA 3K5LA 5KI6A 1KVAA 4CHNA 3KJVA 2VG5A 4Y1CA 3VN5A 5T7BA 1IKVA 3MEEA 4FLTA 4DSLA 3VQAA 4E19A 4CGIA 5HRPA 3QETA 1KFDA 2WONA 2YKMA 2YKNA 3VQ5A 4CGFA 3NE6A 4B9UA 5D3GA 5FRNA 3EY1A 2HMIA 3U3YA 2NUBA 4DFPA 1SL1A 3LPUA 3OYGA 1QSSA 2A1RA 1NK7A 3LP2A 3EZ5A 3VQQA 1S1TA 4CJUA 1GOCA 3ZT1A 4I9LA 4UQGA 1LWEA 2B4JA 3OS2A 3SCXA 4Z4CA 1IKYA 2I5JA 4N47A 4CHPA 3EYZA 4FLZA 1N6QA 1RT4A 3K5OA 3PO4A 4CCHA 4CGGA 1HYSA 1RILA 2ATQA 4DTSA 1B9FA 1EETA 3B6OA 1SL0A 1J53A 4IFYA 3HPHA 2RF2A 3RTVA 3HVRA 2G8FA 1Z26A 5DMRA 4B8CA 3QEXA 4KHNA 3HM9A 5HRNA 4CJWA 4ZTJA 1YTUA 1KSPA 4CGHA 2HHSA 3O3GA 1J54A 4ZHRA 3SPZA 2YNHA 4KFBA 4M3ZA 1ASUA 4R5PA 2Y1IA 2E6MA 3M8SA 4EP5A 4OKJA 3HXMA 3QEIA 1X9MA 4M42A 1NJYA 2O4IA 3ITHA 4K8ZA 4CESA 4E7JA 3SYZA 1VSJA 1ZBFA 4OKEA 4E1MA 4I2QA 3PY8A 4DQIA 3TABA 3DRRA 1NK0A 1IKXA 4DWIA 2D0CA 1IH7A 4FLUA 1I39A 1WSJA 1BISA 3SUNA 3KLHA 3SJJA 4FM2A 4DQQA 1BHLA 1WN7A 1NJWA 4PWDA 5EU7A 1XHXA 4JS4A 1RDBA 3G0ZA 4M45A 5C25A 1MU2A 4DTMA 4BDPA 2DTUA 3NF6A 3AVCA 2KFNA 3K5NA 4FCYA 1IO2A 1JLAA 5CY4A 3OYJA 3V6DA 2PYLA 3ZT2A 3DLBA 2G8VA 1RCHA 1J9AA 4CJLA 4KHSA 4PA1A 3ZT0A 3OYAA 2XRIA 4Z4FA 2HNYA 4H8KA 3HPGA 4FM0A 3T19A 4KAZA 4FXDA 1KTQA 4LD0A 3THVA 1UA1A 5C24A 4NCAA 1XWLA 1SKWA 4QCLA 1LAWA 2YNFA 3PX0A 3NDKA 4JS5A 3OVNA 4BDZA 1VK0A 2HNDA 3AA5X 4F3TA 3TAFA 3RMCA 4FK0A 1RBUA 2XY8A 3V1QA 4CJKA 4CF0A 4CF9A 1X1PA 3OJSA 4FLVA 1ZBLA 4DLGA 2HB5A 4M3WA 4FJNA 1FK9A 1S1WA 1C1AA 1VRTA 4I7FA 5KRSA 3CM5A 2LSNA 4F4KA 2XHBA 1L5UA 1TKDA 1NK4A 3A2FA 2HW3A 2HHTA 2G8IA 3S3OA 2BE2A 4DSIA 3DOLA 3V9XA 4OVLA 4E7HA 1RT5A 3AO5A 4AHUA 3QEVA 5HRRA 4B9LA 1RTJA 1QSYA 3AA4A 1RTHA 4CHYA 3LDSA 1SKRA 3VQ6A 4FK2A 4CEOA 1RNHA 4IDKA 4CHOA 4CEEA 4IG3A 3CFPA 3SV4A 4KREA 2G8WA 1TK5A 3L2QA 1BI4A 3NF8A 4E0DA 2RPIA 3ZSXA 2QKBA 3L2VA 3QLHA 2OPQA 1TK8A 4JRQA 1LW2A 3OYIA 3NAEA 4DF4A 2IAJA 5I42A 3JSMA 3NF7A 1RDDA 2BANA 4RW4A 4E89A 3L2RA 1CZBA 4FJXA 1CXUA 3S9HA 3RR7A 4F8RA 3CQ8A 4NYFA 4ID5A 1B9DA 3QERA 3G10A 4FYDA 4EP4A 4FZYA 1L3UA 2HNZA 1C0MA 1TKZA 3V1OA 4CJVA 5FROA 4HCCA 4CEFA 4CK1A 3SI6A 1HYZA 2HHWA 4FM1A 4B9SA 4ELVA 4DMNA 5SWMA 4RG8A 2JGUA 5JS2A 4FJKA 4ELUA 2YHAA 4AHTA 3O3FA 4EZ9A 3AA3A 5SZTA 4LY7A 3DLEA 3LP0A 2RN2A 4CJPA 4DLEA 3O4NA 4DTJA 3SQ1A 2OZMA 4CEDA 1KVCA 1CLQA 3WNGA 3KTQA 1KVBA 3IS9A 3WNHA 4Q5VA 3MAQA 4BE0A 2HHQA 1O1WA 3QIPA 3C95A 4RW9A 2P5OA 4GMJB 4O4GA 3CFOA 3OYBA 1FKPA 4N5SA 2YHBA 4QOZB 3ZCMA 1JLGA 1YVUA 3LAMA 1U4BA 1GOBA 1RT2A 3HSTB 4IG0A 4B3OA 3M8PA 2A1SA 1LWCA 2OPSA 3VQDA 2YNGA 4DFMA 3AO3A 3AVFA 4ID1A 3K5MA 3KLIA 3KLFA 3VQCA 2RKIA 3HT3A 2Z1GA 4OKKA 4FLXA 4FK4A 4KV8A 3KIOA 4DTOA 4HVJA 3I8DA 4BWMA 1N5YA 3AVIA 4FJGA 3O4QA 3V9WA 4M3YA 2PZSA 1U04A 3VA0A 4LH5A 2ITGA 4B8AB 2X6NA 1X9SA 4DQSA 3VQEA 3DI6A 1WSIA 2FBTA 4CJEA 3K59A 1TL1A 2OPPA 3VA3A 3P1GA 1A5VA 1TKTA 3LP3A 1J5OA 3HYFA 1UWBA 1UA0A 1Q9YA 1C0UA 1U48A 3D0PA 3VQ9A 1S1XA 1WAFA 3LPTA 5HLFA 1EX4A 4IFVA 4CJ3A 1JKHA 4C8MA 4E3SA 2X6SA 1S5JA 1HNIA 1X9WA 4CEBA 4DG1A 1RT1A 2D0AA 4KKOA 3OYDA 1B92A 3E01A 4FLYA 4MFBA 1C1CA 4FW1A 1UOCA 1XHZA 3V1RA 4DF8A 2P51A 3I0SA 3HO1A 1TK0A 4RW7A 1YTAA 3QO9A 3NBPA 5HBMA 1RTDA 3ZSYA 3RMAA 3I0RA 1NKBA 1W9HA 2P1JA 3AVMA 3KK3A 4AILC 5J2QA 3NCIA 1QSLA 2FBVA 4CJ4A 1LWFA 5CYMA 3OYFA 4C8OA 4IKFA 3C94A 3ZSZA 4FJHA 1BL3A 1KRPA 4I9QA 4H4OA 1BI4B 1HYVA 3LANA 4GW6A 3IRXA 4M3UA 4O55A 3NH1A 3KK2A 1HJRA 1A5WA 1QE1A 4W5OA 3O3HA 1L3SA 1VSIA 3ZSQA 2HHVA 3WNFA 3K57A 2VWJA 3PX4A 3VQ7A 1EP4A 5DK5A 3MEGA 4HUFA 2QXFA 3H08A 3L2WA 1SL2A 1IG9A 3QNNA 1NOZA 4KHYA 3ALYA 4B9TA 3AVKA 1U45A 3SUQA 4BDYA 4CERA 1S9GA 4Y1DA 3NGIA 4CFDA 4BACA 3V9SA 1NKCA 4C8LA 2PY5A 4FJ7A 5HP1A 1JL1A 4CF2A 3NGYA 3ZSVA 3AVLA 3OYMA 4AH9A 1Q9XA 3ZSRA 2XY5A 4CK2A 4OPKA 3SUOA 2ZD1A 4N41A 4KTWA 1DTTA 3M8QA 4FLWA 4LH4A 2G8KA 1KCFA 1SUQA 5FRMA 1HNVA 3SV3A 4CHZA 1TVRA 1RDAA 2VG7A 3CM6A 3HL8A 1L3TA 1SV5A 4J2AA 3F9KA 3RR8A 5KRTA 4IBNA 4M3RA 4KRFA 4W5NA 1BQMA 4J2DA 3JYTA 4FVMA 2HHUA 1JLCA 3AVAA 2Z1IA 4KB1A 2O4GA 3L2UA 2DFFA 5C42A 3DLHA 4YNQA 2OPRA 1VSMA 3AO4A 4DFJA 4ELTA 1HQUA 4E7IA 3M8RA 1TL3A 1I3AA 4KPYA 4FJJA 3MEDA 4OGEA 1RTIA 1Y97A 4WE1A 3TAEA 2E6LA 3MECA 4DU3A 1ASWA 1T05A 3HJFA 1ITGA 3MXMA 3V81A 4DS4A 1KFSA 2WOMA 1S6PA 4XIUA 3SQ2A 3SQ4A 4FZXC 3RMDA 1WLJA 5J2MA 3T3FA 2XY7A 4CEZA 4F2SA 4FJIA 2W42A 4HCBA 3TR8A 3VQBA 3PO5A 1QTMA 4KHQA 5KGXA 4OPJA 3AA2A 4QAGA 4DFKA 4FJ9A 1RDCA 3V9UA 4FJ8A 3HP6A 5KGWA 4O44A 3DRSA 2DY4A 1TGOA 3TAMA 4DSKA 4CGJA 3KD1E 4DQRA 4JLHA 2G8HA 1WAJA 2YV0X 2FC0A 3ZT4A 3DMJA 2IS3A 1QS4A 2ZQBA 4CFCA 2YNIA 4O5BA 3CFRA 3SNNA 4PUOA 1T03A 2F8SA 1WSEA 1RBSA 3HVTA 4C8KA 1JXBA 1TV6A 4E7KA 4L8RB 3AV9A 1VSLA 4AHRA 1NK6A 4CJRA 2XO7A 4DU4A 1Z25A 5E41A 1SKSA 4BWJA 4DTUA 3LZJA 2G8UA 4DQPA 2Y1JA 4CEAA 4KI6A 1K6YA 5HROA 1HRHA 1NK5A 1KLMA 3P83D 5KTQA 3C6TA 2B6AA 3AVNA 3LZIA 4N76A 1CXQA 1RT6A 4DSEA 3L3UA 3SUPA 2P5GA 2ETJA 1HQEA 4TSXA 1A5XA 2FBXA 3AO1A 3B6PA 1JLFA 1S9EA 2X74A 4G1QA 3TANA 1T7PA 2KZMA 1ZYQA 1FKOA 1NK9A 1JLEA 1RBTA 4H4MA 4NCBA 3K2PA 3ZT3A 4N56A 3KK1A 1JL2A 3QINA 3TARA 3S3NA 1C0TA 4FZZA 3NH2A 2X78A 3DRPA 4AHCA 4Z4GA 1BCMA 2QKKA 3ASMA 1QQCA 1VSKA 3AVBA 1BQNA 3ZSWA 4DU1A 1VSDA 2KW4A 3SQ0A 3S3MA 1XI1A 4DSJA 4W5TA 4OLAA 1UAXA 3SPYA 4Z0UA 3KD5E 2IOCA 1WSGA 3NH0A 1F21A 4KO0A 2GUIA 3NGZA 1G15A 5CZ1A 1D9DA 4KTQA 4CECA 4ICLA 3K58A 3PV8A 3OYCA 2PYJA 1D8YA 4BE2A 4OGCA 1ASVA 2QK9A 4YFUA 4F2RA 1NOYA 1DLOA 3P5JA 4CJQA 3AVGA 4I2PA 4CHQA 1IKWA 3L8BA 4HHTA 2E4LA 1TKXA 1Q8IA 5K14A 3TAGA 4NYNA 3TI0A 4PQUA 3V9ZA 4Z4HA 4Q0BA 4M3TA 2KTQA 3RRGA 4J2EA 4KHWA 4HUGA 4DS5A 3DLKA 1R0AA 2HVIA 2GV9A 2F8TA 3OYEA 4CIEA 3OY9A 1EXQA 3OS1A 2GBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSH A;  3BDP A;  4F3O A;  1RBV A;  3RWU A;  1ZBI A;  1LW0 A;  3L3V A;  3OYK A;  2KQ2 A;  1NK8 A;  3QIO A;  1XC9 A;  5HRS A;  2OYQ A;  3QNO A;  3VQP A;  4DTP A;  4Z4I A;  4B9N A;  4KTZ A;  4JRP A;  2JLE A;  4B9V A;  1NKE A;  2IGI A;  3AVH A;  3OJU A;  2D0B A;  4BE1 A;  2B5J A;  4DTN A;  4E1N A;  1W0H A;  4DTR A;  3DM2 A;  3OYH A;  3HK2 A;  2F96 A;  1L3V A;  4RW8 A;  2HHX A;  1U47 A;  3NF9 A;  3CG7 A;  3ISN C;  4FW2 A;  4CJT A;  3PX6 A;  4KHU A;  1DTQ A;  4CEQ A;  4CF8 A;  4W5R A;  3AO2 A;  1D5A A;  1EKE A;  3KLG A;  2EHG A;  1BCO A;  3SZ2 A;  1S1V A;  2IC3 A;  1YT3 A;  1BIZ A;  3OYL A;  1NJX A;  3IAY A;  4B08 A;  1C1B A;  4LSL A;  1ZBU A;  5J2P A;  1QHT A;  1WNS A;  4CJ5 A;  3WNE A;  3OYN A;  3CYM A;  2OZS A;  4FJM A;  1S6Q A;  1TAU A;  3QEW A;  5CZ2 A;  1RT3 A;  5J1E A;  1HMV A;  4CFB A;  3UIQ A;  3VQ4 A;  1TAQ A;  2Q3S A;  2EX3 A;  3ULD A;  2VWK A;  4OJR A;  4HTU A;  4AHV A;  2AJQ A;  1VSF A;  1VSH A;  4MQ3 A;  4AHS A;  1LV5 A;  3DLR A;  4Z4E A;  5J2N A;  4E7L A;  4CK3 A;  3MXI A;  1U49 A;  2KFZ A;  1JXE A;  4W5Q A;  3RRH A;  3QES A;  3VQ8 A;  3C6U A;  4CF1 A;  2XY6 A;  3F73 A;  1NJZ A;  1WSF A;  4KB0 A;  3TAP A;  3OS0 A;  3KKR A;  2R7Y A;  1JLQ A;  4LSN A;  1BGX T;  2KZZ A;  5FDL A;  3DYA A;  4CJS A;  5CYQ A;  2HVH A;  1RBR A;  1VSE A;  3AVJ A;  1HPZ A;  3RMB A;  4FJL A;  4J2B A;  4PY5 A;  5I3U A;  4CFA A;  3DLG A;  4HUE A;  1D9F A;  3U6F A;  2OA8 A;  1VRU A;  4CJF A;  3HP9 A;  3KKS A;  3KLE A;  4C8N A;  3LAL A;  3FFI A;  4GVM A;  4O0J A;  3TAQ A;  3NHG A;  1S1U A;  1JLB A;  4M41 A;  2BGG A;  2Z1H A;  3LP1 A;  1REV A;  3D45 A;  3NFA A;  4RW6 A;  4KI4 A;  4O0I A;  3LWM A;  1FXX A;  1C6V A;  1T8E A;  3LAK A;  2FBY A;  2IDO A;  3V4I A;  1BIU A;  2DFE A;  5JS1 A;  1GOA A;  4CIG A;  1RT7 A;  4CE9 A;  2VG6 A;  1ZBH A;  1KLN A;  3DOK A;  3T1A A;  4DSF A;  4ZTF A;  3HPO A;  4EZ6 A;  4OLB A;  3U3G A;  4K8X A;  2BDP A;  2DFH A;  3QEP A;  3ZSO A;  3MXJ A;  3BGR A;  4DTX A;  4NCG A;  4M3X A;  2ZE2 A;  1LAV A;  4CIF A;  3TWH A;  2D5R A;  3LWL A;  4B9M A;  4FJ5 A;  4CGD A;  2Z1J A;  1CZ9 A;  3IG1 A;  3PUF A;  3K5L A;  5KI6 A;  1KVA A;  4CHN A;  3KJV A;  2VG5 A;  4Y1C A;  3VN5 A;  5T7B A;  1IKV A;  3MEE A;  4FLT A;  4DSL A;  3VQA A;  4E19 A;  4CGI A;  5HRP A;  3QET A;  1KFD A;  2WON A;  2YKM A;  2YKN A;  3VQ5 A;  4CGF A;  3NE6 A;  4B9U A;  5D3G A;  5FRN A;  3EY1 A;  2HMI A;  3U3Y A;  2NUB A;  4DFP A;  1SL1 A;  3LPU A;  3OYG A;  1QSS A;  2A1R A;  1NK7 A;  3LP2 A;  3EZ5 A;  3VQQ A;  1S1T A;  4CJU A;  1GOC A;  3ZT1 A;  4I9L A;  4UQG A;  1LWE A;  2B4J A;  3OS2 A;  3SCX A;  4Z4C A;  1IKY A;  2I5J A;  4N47 A;  4CHP A;  3EYZ A;  4FLZ A;  1N6Q A;  1RT4 A;  3K5O A;  3PO4 A;  4CCH A;  4CGG A;  1HYS A;  1RIL A;  2ATQ A;  4DTS A;  1B9F A;  1EET A;  3B6O A;  1SL0 A;  1J53 A;  4IFY A;  3HPH A;  2RF2 A;  3RTV A;  3HVR A;  2G8F A;  1Z26 A;  5DMR A;  4B8C A;  3QEX A;  4KHN A;  3HM9 A;  5HRN A;  4CJW A;  4ZTJ A;  1YTU A;  1KSP A;  4CGH A;  2HHS A;  3O3G A;  1J54 A;  4ZHR A;  3SPZ A;  2YNH A;  4KFB A;  4M3Z A;  1ASU A;  4R5P A;  2Y1I A;  2E6M A;  3M8S A;  4EP5 A;  4OKJ A;  3HXM A;  3QEI A;  1X9M A;  4M42 A;  1NJY A;  2O4I A;  3ITH A;  4K8Z A;  4CES A;  4E7J A;  3SYZ A;  1VSJ A;  1ZBF A;  4OKE A;  4E1M A;  4I2Q A;  3PY8 A;  4DQI A;  3TAB A;  3DRR A;  1NK0 A;  1IKX A;  4DWI A;  2D0C A;  1IH7 A;  4FLU A;  1I39 A;  1WSJ A;  1BIS A;  3SUN A;  3KLH A;  3SJJ A;  4FM2 A;  4DQQ A;  1BHL A;  1WN7 A;  1NJW A;  4PWD A;  5EU7 A;  1XHX A;  4JS4 A;  1RDB A;  3G0Z A;  4M45 A;  5C25 A;  1MU2 A;  4DTM A;  4BDP A;  2DTU A;  3NF6 A;  3AVC A;  2KFN A;  3K5N A;  4FCY A;  1IO2 A;  1JLA A;  5CY4 A;  3OYJ A;  3V6D A;  2PYL A;  3ZT2 A;  3DLB A;  2G8V A;  1RCH A;  1J9A A;  4CJL A;  4KHS A;  4PA1 A;  3ZT0 A;  3OYA A;  2XRI A;  4Z4F A;  2HNY A;  4H8K A;  3HPG A;  4FM0 A;  3T19 A;  4KAZ A;  4FXD A;  1KTQ A;  4LD0 A;  3THV A;  1UA1 A;  5C24 A;  4NCA A;  1XWL A;  1SKW A;  4QCL A;  1LAW A;  2YNF A;  3PX0 A;  3NDK A;  4JS5 A;  3OVN A;  4BDZ A;  1VK0 A;  2HND A;  3AA5 X;  4F3T A;  3TAF A;  3RMC A;  4FK0 A;  1RBU A;  2XY8 A;  3V1Q A;  4CJK A;  4CF0 A;  4CF9 A;  1X1P A;  3OJS A;  4FLV A;  1ZBL A;  4DLG A;  2HB5 A;  4M3W A;  4FJN A;  1FK9 A;  1S1W A;  1C1A A;  1VRT A;  4I7F A;  5KRS A;  3CM5 A;  2LSN A;  4F4K A;  2XHB A;  1L5U A;  1TKD A;  1NK4 A;  3A2F A;  2HW3 A;  2HHT A;  2G8I A;  3S3O A;  2BE2 A;  4DSI A;  3DOL A;  3V9X A;  4OVL A;  4E7H A;  1RT5 A;  3AO5 A;  4AHU A;  3QEV A;  5HRR A;  4B9L A;  1RTJ A;  1QSY A;  3AA4 A;  1RTH A;  4CHY A;  3LDS A;  1SKR A;  3VQ6 A;  4FK2 A;  4CEO A;  1RNH A;  4IDK A;  4CHO A;  4CEE A;  4IG3 A;  3CFP A;  3SV4 A;  4KRE A;  2G8W A;  1TK5 A;  3L2Q A;  1BI4 A;  3NF8 A;  4E0D A;  2RPI A;  3ZSX A;  2QKB A;  3L2V A;  3QLH A;  2OPQ A;  1TK8 A;  4JRQ A;  1LW2 A;  3OYI A;  3NAE A;  4DF4 A;  2IAJ A;  5I42 A;  3JSM A;  3NF7 A;  1RDD A;  2BAN A;  4RW4 A;  4E89 A;  3L2R A;  1CZB A;  4FJX A;  1CXU A;  3S9H A;  3RR7 A;  4F8R A;  3CQ8 A;  4NYF A;  4ID5 A;  1B9D A;  3QER A;  3G10 A;  4FYD A;  4EP4 A;  4FZY A;  1L3U A;  2HNZ A;  1C0M A;  1TKZ A;  3V1O A;  4CJV A;  5FRO A;  4HCC A;  4CEF A;  4CK1 A;  3SI6 A;  1HYZ A;  2HHW A;  4FM1 A;  4B9S A;  4ELV A;  4DMN A;  5SWM A;  4RG8 A;  2JGU A;  5JS2 A;  4FJK A;  4ELU A;  2YHA A;  4AHT A;  3O3F A;  4EZ9 A;  3AA3 A;  5SZT A;  4LY7 A;  3DLE A;  3LP0 A;  2RN2 A;  4CJP A;  4DLE A;  3O4N A;  4DTJ A;  3SQ1 A;  2OZM A;  4CED A;  1KVC A;  1CLQ A;  3WNG A;  3KTQ A;  1KVB A;  3IS9 A;  3WNH A;  4Q5V A;  3MAQ A;  4BE0 A;  2HHQ A;  1O1W A;  3QIP A;  3C95 A;  4RW9 A;  2P5O A;  4GMJ B;  4O4G A;  3CFO A;  3OYB A;  1FKP A;  4N5S A;  2YHB A;  4QOZ B;  3ZCM A;  1JLG A;  1YVU A;  3LAM A;  1U4B A;  1GOB A;  1RT2 A;  3HST B;  4IG0 A;  4B3O A;  3M8P A;  2A1S A;  1LWC A;  2OPS A;  3VQD A;  2YNG A;  4DFM A;  3AO3 A;  3AVF A;  4ID1 A;  3K5M A;  3KLI A;  3KLF A;  3VQC A;  2RKI A;  3HT3 A;  2Z1G A;  4OKK A;  4FLX A;  4FK4 A;  4KV8 A;  3KIO A;  4DTO A;  4HVJ A;  3I8D A;  4BWM A;  1N5Y A;  3AVI A;  4FJG A;  3O4Q A;  3V9W A;  4M3Y A;  2PZS A;  1U04 A;  3VA0 A;  4LH5 A;  2ITG A;  4B8A B;  2X6N A;  1X9S A;  4DQS A;  3VQE A;  3DI6 A;  1WSI A;  2FBT A;  4CJE A;  3K59 A;  1TL1 A;  2OPP A;  3VA3 A;  3P1G A;  1A5V A;  1TKT A;  3LP3 A;  1J5O A;  3HYF A;  1UWB A;  1UA0 A;  1Q9Y A;  1C0U A;  1U48 A;  3D0P A;  3VQ9 A;  1S1X A;  1WAF A;  3LPT A;  5HLF A;  1EX4 A;  4IFV A;  4CJ3 A;  1JKH A;  4C8M A;  4E3S A;  2X6S A;  1S5J A;  1HNI A;  1X9W A;  4CEB A;  4DG1 A;  1RT1 A;  2D0A A;  4KKO A;  3OYD A;  1B92 A;  3E01 A;  4FLY A;  4MFB A;  1C1C A;  4FW1 A;  1UOC A;  1XHZ A;  3V1R A;  4DF8 A;  2P51 A;  3I0S A;  3HO1 A;  1TK0 A;  4RW7 A;  1YTA A;  3QO9 A;  3NBP A;  5HBM A;  1RTD A;  3ZSY A;  3RMA A;  3I0R A;  1NKB A;  1W9H A;  2P1J A;  3AVM A;  3KK3 A;  4AIL C;  5J2Q A;  3NCI A;  1QSL A;  2FBV A;  4CJ4 A;  1LWF A;  5CYM A;  3OYF A;  4C8O A;  4IKF A;  3C94 A;  3ZSZ A;  4FJH A;  1BL3 A;  1KRP A;  4I9Q A;  4H4O A;  1BI4 B;  1HYV A;  3LAN A;  4GW6 A;  3IRX A;  4M3U A;  4O55 A;  3NH1 A;  3KK2 A;  1HJR A;  1A5W A;  1QE1 A;  4W5O A;  3O3H A;  1L3S A;  1VSI A;  3ZSQ A;  2HHV A;  3WNF A;  3K57 A;  2VWJ A;  3PX4 A;  3VQ7 A;  1EP4 A;  5DK5 A;  3MEG A;  4HUF A;  2QXF A;  3H08 A;  3L2W A;  1SL2 A;  1IG9 A;  3QNN A;  1NOZ A;  4KHY A;  3ALY A;  4B9T A;  3AVK A;  1U45 A;  3SUQ A;  4BDY A;  4CER A;  1S9G A;  4Y1D A;  3NGI A;  4CFD A;  4BAC A;  3V9S A;  1NKC A;  4C8L A;  2PY5 A;  4FJ7 A;  5HP1 A;  1JL1 A;  4CF2 A;  3NGY A;  3ZSV A;  3AVL A;  3OYM A;  4AH9 A;  1Q9X A;  3ZSR A;  2XY5 A;  4CK2 A;  4OPK A;  3SUO A;  2ZD1 A;  4N41 A;  4KTW A;  1DTT A;  3M8Q A;  4FLW A;  4LH4 A;  2G8K A;  1KCF A;  1SUQ A;  5FRM A;  1HNV A;  3SV3 A;  4CHZ A;  1TVR A;  1RDA A;  2VG7 A;  3CM6 A;  3HL8 A;  1L3T A;  1SV5 A;  4J2A A;  3F9K A;  3RR8 A;  5KRT A;  4IBN A;  4M3R A;  4KRF A;  4W5N A;  1BQM A;  4J2D A;  3JYT A;  4FVM A;  2HHU A;  1JLC A;  3AVA A;  2Z1I A;  4KB1 A;  2O4G A;  3L2U A;  2DFF A;  5C42 A;  3DLH A;  4YNQ A;  2OPR A;  1VSM A;  3AO4 A;  4DFJ A;  4ELT A;  1HQU A;  4E7I A;  3M8R A;  1TL3 A;  1I3A A;  4KPY A;  4FJJ A;  3MED A;  4OGE A;  1RTI A;  1Y97 A;  4WE1 A;  3TAE A;  2E6L A;  3MEC A;  4DU3 A;  1ASW A;  1T05 A;  3HJF A;  1ITG A;  3MXM A;  3V81 A;  4DS4 A;  1KFS A;  2WOM A;  1S6P A;  4XIU A;  3SQ2 A;  3SQ4 A;  4FZX C;  3RMD A;  1WLJ A;  5J2M A;  3T3F A;  2XY7 A;  4CEZ A;  4F2S A;  4FJI A;  2W42 A;  4HCB A;  3TR8 A;  3VQB A;  3PO5 A;  1QTM A;  4KHQ A;  5KGX A;  4OPJ A;  3AA2 A;  4QAG A;  4DFK A;  4FJ9 A;  1RDC A;  3V9U A;  4FJ8 A;  3HP6 A;  5KGW A;  4O44 A;  3DRS A;  2DY4 A;  1TGO A;  3TAM A;  4DSK A;  4CGJ A;  3KD1 E;  4DQR A;  4JLH A;  2G8H A;  1WAJ A;  2YV0 X;  2FC0 A;  3ZT4 A;  3DMJ A;  2IS3 A;  1QS4 A;  2ZQB A;  4CFC A;  2YNI A;  4O5B A;  3CFR A;  3SNN A;  4PUO A;  1T03 A;  2F8S A;  1WSE A;  1RBS A;  3HVT A;  4C8K A;  1JXB A;  1TV6 A;  4E7K A;  4L8R B;  3AV9 A;  1VSL A;  4AHR A;  1NK6 A;  4CJR A;  2XO7 A;  4DU4 A;  1Z25 A;  5E41 A;  1SKS A;  4BWJ A;  4DTU A;  3LZJ A;  2G8U A;  4DQP A;  2Y1J A;  4CEA A;  4KI6 A;  1K6Y A;  5HRO A;  1HRH A;  1NK5 A;  1KLM A;  3P83 D;  5KTQ A;  3C6T A;  2B6A A;  3AVN A;  3LZI A;  4N76 A;  1CXQ A;  1RT6 A;  4DSE A;  3L3U A;  3SUP A;  2P5G A;  2ETJ A;  1HQE A;  4TSX A;  1A5X A;  2FBX A;  3AO1 A;  3B6P A;  1JLF A;  1S9E A;  2X74 A;  4G1Q A;  3TAN A;  1T7P A;  2KZM A;  1ZYQ A;  1FKO A;  1NK9 A;  1JLE A;  1RBT A;  4H4M A;  4NCB A;  3K2P A;  3ZT3 A;  4N56 A;  3KK1 A;  1JL2 A;  3QIN A;  3TAR A;  3S3N A;  1C0T A;  4FZZ A;  3NH2 A;  2X78 A;  3DRP A;  4AHC A;  4Z4G A;  1BCM A;  2QKK A;  3ASM A;  1QQC A;  1VSK A;  3AVB A;  1BQN A;  3ZSW A;  4DU1 A;  1VSD A;  2KW4 A;  3SQ0 A;  3S3M A;  1XI1 A;  4DSJ A;  4W5T A;  4OLA A;  1UAX A;  3SPY A;  4Z0U A;  3KD5 E;  2IOC A;  1WSG A;  3NH0 A;  1F21 A;  4KO0 A;  2GUI A;  3NGZ A;  1G15 A;  5CZ1 A;  1D9D A;  4KTQ A;  4CEC A;  4ICL A;  3K58 A;  3PV8 A;  3OYC A;  2PYJ A;  1D8Y A;  4BE2 A;  4OGC A;  1ASV A;  2QK9 A;  4YFU A;  4F2R A;  1NOY A;  1DLO A;  3P5J A;  4CJQ A;  3AVG A;  4I2P A;  4CHQ A;  1IKW A;  3L8B A;  4HHT A;  2E4L A;  1TKX A;  1Q8I A;  5K14 A;  3TAG A;  4NYN A;  3TI0 A;  4PQU A;  3V9Z A;  4Z4H A;  4Q0B A;  4M3T A;  2KTQ A;  3RRG A;  4J2E A;  4KHW A;  4HUG A;  4DS5 A;  3DLK A;  1R0A A;  2HVI A;  2GV9 A;  2F8T A;  3OYE A;  4CIE A;  3OY9 A;  1EXQ A;  3OS1 A;  2GBZ A; 
#chains in the Genus database with same CATH topology
 4ISE A;  3ZLJ A;  1RBV A;  3RWU A;  4IWV A;  1ZBI A;  4OPA A;  4B1U B;  3WEE B;  1NK8 A;  4V19 S;  5HRS A;  3QNO A;  3P31 A;  2VWB A;  2IGI A;  3AVH A;  3AAP A;  1JCE A;  4X66 K;  4E1N A;  3H6E A;  3CG7 A;  4KHU A;  3BDP A;  4CF8 A;  1D9F A;  2EHG A;  1S1V A;  2IC3 A;  1NJX A;  1ZBU A;  4H0T B;  1WNS A;  2P9K A;  3WNE A;  3OYN A;  2OZS A;  3HZ6 A;  5AQW A;  5CZ2 A;  3ID8 A;  4CFB A;  3UIQ A;  4O8U A;  3D2E A;  1VSF A;  4E7L A;  3MXI A;  2KFZ A;  1NGH A;  3QES A;  2XY6 A;  3VQ8 A;  2EWS A;  2D0O A;  4M7Y A;  3TAP A;  2O8C B;  1BU6 O;  2O8F B;  4U67 L;  3ZET A;  4CJS A;  1RBR A;  3RMB A;  4XH5 A;  1HPZ A;  3KWG A;  4J2B A;  4CFA A;  2V7Y A;  1HX1 A;  2OA8 A;  1VRU A;  3D2F B;  3CJ1 A;  2OTJ N;  4C8N A;  4GVM A;  3TAQ A;  1JLB A;  2NRT A;  2HF3 A;  3LP1 A;  3KK7 A;  1C6V A;  1J5E K;  4H5N A;  1GOA A;  2NRZ A;  4CIG A;  1G99 A;  1HPM A;  3DXK A;  2P9U A;  4CZF A;  2BDP A;  3BZC A;  4NCG A;  5AQQ A;  4M7X A;  2D5R A;  3MDQ A;  4BRA A;  3MCP A;  1KVA A;  1N8R O;  4X64 K;  1V4T A;  3MEE A;  2WTU A;  5AZJ A;  3QET A;  2WON A;  2YKM A;  3NE6 A;  3GL1 A;  5D3G A;  4JI3 K;  3AGR A;  4JKC A;  2HBJ A;  4BRO A;  3TPQ A;  5EY4 A;  1QSS A;  3LP2 A;  1S1T A;  4K41 A;  1OVY A;  4I9L A;  3ZT1 A;  3PIP L;  1LWE A;  4FWL A;  4B3T K;  1KAY A;  4N47 A;  1N6Q A;  4FLZ A;  3K5O A;  1RIL A;  4DTS A;  2O8D B;  1B9F A;  3JXU A;  2HOE A;  3HPH A;  3QEX A;  1JCF A;  2WFB A;  2D0P A;  3LDN A;  4CJW A;  2UU9 K;  1KSP A;  4LFC K;  2VGM A;  4LF5 K;  5AQF A;  4DR7 K;  4LC9 B;  2ZWH A;  5B8H A;  3VEO A;  3M8S A;  4M42 A;  2P9K B;  1NJY A;  2O4I A;  3EZW A;  2JWK A;  1KQS M;  1VSJ A;  3SAF A;  4DV3 K;  4I2Q A;  3IUC A;  2W6L A;  1IH7 A;  4FLU A;  1JCG A;  5AQG A;  4ISF A;  1BHL A;  2E2O A;  4WQ4 A;  1XHX A;  3KVG A;  4JS4 A;  4CZK A;  2KFN A;  1P90 A;  3DXM A;  3V6D A;  4BR9 A;  3ZET B;  5AFU A;  1RCH A;  3ZT0 A;  2XRI A;  3OW2 M;  3CCR N;  1Q18 A;  1KTQ A;  2QWL A;  4LD0 A;  3W0L A;  3KWI A;  1XWL A;  1SKW A;  2YNF A;  3FZL A;  4JS5 A;  3IKM A;  4FK0 A;  3CIP A;  1RBU A;  1QZ5 A;  2VCP A;  3OJS A;  3MMV A;  3I56 N;  3SAG A;  4DLG A;  2HB5 A;  1FK9 A;  2GTD A;  3DXK B;  2P9U B;  4A2B A;  4BVO A;  1C1A A;  1Q81 O;  5E26 A;  4F4K A;  4IOA L;  5KQD A;  2HHT A;  4DSI A;  3DOL A;  3V9X A;  4WF9 L;  4AHU A;  5HRR A;  4FWK A;  1RTJ A;  1YJW N;  4GV3 A;  4JI0 K;  5AZJ B;  4FK2 A;  4CEO A;  4BRG A;  3H45 C;  1TK5 A;  1BI4 A;  4DR5 K;  3QLH A;  1LW2 A;  3OYI A;  3CCL N;  2QXL A;  3BP8 A;  3WQU A;  1WB9 A;  4H0P A;  1U2V A;  4E89 A;  5JVH L;  2YJF A;  3CQ8 A;  1B9D A;  2ZGY A;  1CZA N;  4FO0 A;  1C0M A;  5I9E B;  3V1O A;  3NVM A;  3H46 O;  5FRO A;  3GE1 A;  1W97 L;  4CEF A;  3SI6 A;  1HYZ A;  2HHW A;  1EQY A;  2QWM A;  2YHA A;  5JLF A;  3VER A;  2A5X A;  5M1F A;  4LY7 A;  1YVN A;  3O4N A;  2OZM A;  3IS9 A;  4BR2 A;  1OVQ A;  4Q5V A;  5KPR A;  3C95 A;  4GMJ B;  3CFO A;  3OYB A;  3NMU A;  2YHB A;  4CVN E;  4QOZ B;  1YVU A;  3LAM A;  3CCU N;  1U4B A;  3HST B;  4OX9 K;  4BRC A;  1LWC A;  4DFM A;  3DXM B;  1T3V A;  4FK4 A;  2O8B A;  4KV8 A;  4CZJ A;  3QML A;  4HVJ A;  3O4Q A;  3V9W A;  3T69 A;  1U04 A;  3VA0 A;  2ITG A;  4YDU A;  2X6N A;  3CQX A;  1X9S A;  1TKT A;  1C0F A;  4FSV A;  2NRH A;  1J5O A;  3HYF A;  5BRE A;  4CBU A;  3D0P A;  3TTD A;  1HKC A;  1HNZ K;  1JKH A;  2X6S A;  3CJA A;  5AQH A;  2D0A A;  3H3N O;  1VQO N;  5AQT A;  1C1C A;  1XHZ A;  4DF8 A;  2P51 A;  3CC2 N;  3UE5 A;  2F9T A;  3P4I A;  3VF4 A;  3CXC M;  2OCE A;  4PL8 A;  3ZSY A;  1BG3 A;  3SBT A;  2P1J A;  4NXM K;  4XH1 A;  4QS8 A;  4DV7 K;  5J2Q A;  4CJ4 A;  3OYF A;  5CYM A;  2P9L A;  4C8O A;  5GIP A;  3O9S A;  4H4O A;  1BI4 B;  4LF7 K;  2BUP A;  1A5W A;  3O3H A;  4YOV A;  2QWO A;  2HHV A;  3PX4 A;  4M3Z A;  1EP4 A;  1U2V B;  2QXF A;  4BVP A;  4K25 A;  1HKB A;  3H3O B;  4CER A;  1S9G A;  2UYT A;  4BAC A;  1NKC A;  3CME N;  4BG8 A;  1JL1 A;  4CF2 A;  3NGY A;  3ZSV A;  1VQ5 N;  1OH8 A;  2XY5 A;  3SUO A;  4N41 A;  5FRM A;  1KCF A;  2D1K A;  1HNV A;  4CHZ A;  1RDA A;  2VG7 A;  1E3M A;  1SV5 A;  1ATN A;  1VQ8 N;  5EXW A;  3RR8 A;  5KRT A;  4BRK A;  4Y0W A;  4M3R A;  3L4I A;  4WQ4 C;  4A61 A;  2Z1I A;  1FW6 A;  4A62 A;  3L2U A;  2DFF A;  5C42 A;  1NG9 A;  2ZGZ A;  2YI1 A;  3EKU A;  3M8R A;  1TYQ A;  2GEM A;  4KPY A;  4FJJ A;  3MED A;  4GKJ K;  4IEE A;  5BRD A;  1RTI A;  3HJF A;  4DS4 A;  4YY3 K;  3DLL L;  3ENB A;  3SQ4 A;  2XY7 A;  4F2S A;  2W6K A;  5BR9 A;  4JI6 K;  2O8B B;  1QTM A;  4AF1 A;  4QAG A;  4FJ9 A;  1RDC A;  4BRH A;  4FJ8 A;  2FSJ A;  3A5N C;  5KGW A;  4O44 A;  3DRS A;  1C0G A;  3CER A;  4H5T A;  4CGJ A;  4JLH A;  3CFR A;  1T03 A;  5AZI A;  1RBS A;  1NK6 A;  4CJR A;  3O1W A;  3R3L A;  3U8X A;  2DPN A;  5FPD A;  4KI6 A;  1K6Y A;  5HRO A;  1NK5 A;  1DEJ A;  5KTQ A;  3C6T A;  3O8M A;  2B6A A;  3THY A;  4IJA A;  3LZI A;  3L3U A;  2ETJ A;  3W3D A;  3B6P A;  2KZM A;  2CGJ A;  5AQM A;  1T7P A;  4CZL A;  2A3Z A;  4H4M A;  3K2P A;  4FZZ A;  3J8A A;  3NH2 A;  1BCM A;  2QKK A;  3ASM A;  3AVB A;  3ZSW A;  4FJN A;  1XI1 A;  3SQ0 A;  4OLA A;  3CJC A;  2HW3 A;  3A5O C;  4IZ9 A;  4W5T A;  3SPY A;  2IOC A;  2V51 B;  3TSU A;  2HF4 A;  4CEC A;  4NLC A;  4ICL A;  3PV8 A;  3OYC A;  3J80 O;  1D8Y A;  4BE2 A;  1ASV A;  4H5W A;  3E9P A;  4F2R A;  1WOQ A;  3P5J A;  4CJQ A;  4CHQ A;  1IBM K;  3CCS N;  2E4L A;  1Q8I A;  5K14 A;  3TAG A;  2WUS A;  4Z4H A;  4G9Z A;  4J8F A;  5M1N A;  4EIA A;  2KTQ A;  4HUG A;  3SJH A;  4BRF A;  4NO7 A;  5C15 A;  4M63 C;  4CIE A;  2QM1 A;  4FWP A;  1EXQ A;  2GWK A;  3VTH A;  3OS1 A;  4GVE A;  4DR2 K;  5DM7 L;  5FPE A;  3THW B;  3HI0 A;  4F3O A;  3OYK A;  3L3V A;  5EOY A;  3VQP A;  4DTP A;  4KTZ A;  1ATS A;  4JRP A;  1TYQ B;  3O1B A;  2P9S B;  4PKH A;  3WXI A;  4JD2 A;  2D0B A;  2NRW A;  3ULE A;  5MLC Q;  4DTR A;  3HK2 A;  4YDU C;  2ASM A;  1U47 A;  3NF9 A;  3PX6 A;  3WUH A;  1DTQ A;  5FPM A;  4CEQ A;  3SZ2 A;  3AO2 A;  1D5A A;  4E7I A;  1EWQ A;  4BRE A;  4CJ5 A;  3QEW A;  2FF6 A;  1RT3 A;  2Q3S A;  3TTF A;  3CD6 N;  2AJQ A;  5AZI B;  4BQZ A;  1Z6R A;  4E1J A;  5AQY A;  3ZYY X;  4ILH A;  3RRH A;  1VQK N;  1N32 K;  3SBG A;  1BGX T;  5M1K A;  2HVH A;  4DCH A;  3THY B;  3CCM N;  5I3U A;  4B9Q A;  4HUE A;  4RCH A;  3I8B A;  4CJF A;  3HP9 A;  5A2Q O;  3KKS A;  2VGN A;  3FFI A;  4O0J A;  1OH6 A;  2IVO A;  1REV A;  4KI4 A;  1GLD G;  1FXX A;  2IDO A;  2DFE A;  4BRI A;  1KD1 O;  4CE9 A;  5BPN A;  4OLB A;  1NGJ A;  3U3G A;  5C2F A;  4K8X A;  3HM8 A;  3BGR A;  4M3X A;  2ZE2 A;  3QFP A;  4B9M A;  3K5L A;  2Z1J A;  4IO9 L;  3M1F A;  4Y1C A;  4DSL A;  5HRP A;  1KFD A;  4B9U A;  3U3Y A;  1ZBS A;  3D2F A;  4HTL A;  2A1R A;  3PLA A;  1NK7 A;  3JS6 A;  3VQQ A;  2B4J A;  3OS2 A;  3SCX A;  4Z4C A;  4CHP A;  4FOE A;  1RT4 A;  3R1X A;  4L3Q A;  2F9W A;  3E1Y A;  2E5L K;  3ULE B;  3M6G A;  4JK8 A;  3THX B;  2RF2 A;  3UKU A;  2G8F A;  3VF2 A;  2PAV A;  3VGK A;  4C23 A;  2IIR A;  3K9J A;  2HHS A;  1NMD A;  3VF6 A;  3LDL A;  3SPZ A;  2YNH A;  1VHX A;  4R5P A;  2Y1I A;  5GAG P;  4OKJ A;  3ITH A;  4K8Z A;  3SYZ A;  5GAD P;  1ZBF A;  3TAB A;  1NK0 A;  3CQY A;  4DWI A;  5JMV A;  3F9M A;  3WXK A;  3KLH A;  1NGC A;  1N36 K;  3FFK B;  4H0V B;  4DQQ A;  4GY2 B;  3G0Z A;  4M45 A;  1KXP A;  5C25 A;  3NF6 A;  3EN9 A;  2O8D A;  1JLA A;  3R9P A;  3OYJ A;  1DKG D;  4CJL A;  1VQ4 N;  4PA1 A;  3OYA A;  4H8K A;  4BC5 A;  3ZX2 A;  1SQK A;  4CD1 A;  4KAZ A;  4BRQ A;  3J7Z O;  1UA1 A;  1R59 O;  4EHU A;  1X3M A;  4F3T A;  1SZ2 A;  3UKR A;  4CJK A;  3VPZ A;  4CF9 A;  2QWR A;  3VEY A;  1W2B M;  4JI8 K;  2XHB A;  1L5U A;  4DV2 K;  1TKD A;  1TUY A;  2ITM A;  4DV6 K;  4H0X B;  1X9J A;  2G8I A;  4E7H A;  1RT5 A;  3QEV A;  4B9L A;  3BEX A;  3TSP A;  5BPL A;  4CEE A;  3SV4 A;  1I94 K;  1XMO K;  3ZSX A;  3L2V A;  4KBO A;  4A5B A;  4JRQ A;  1HNW K;  4KHP K;  2IAJ A;  5I42 A;  2KHO A;  1Q86 O;  3DWL A;  5BRF A;  3L2R A;  3RR7 A;  3IFR A;  1O13 A;  3MK6 A;  4JI4 K;  4EP4 A;  2W40 A;  2JWL A;  5LJW A;  3UKU B;  5AQS A;  4DMN A;  5SWM A;  2JGU A;  4FWS A;  3O3F A;  3AA3 A;  3LP0 A;  4CJP A;  4BRM A;  3VET A;  3MAQ A;  1BDG A;  4BRP A;  1O1W A;  1RFQ A;  2FSK A;  3N4P A;  4LF6 K;  1RGI A;  4LF9 K;  2AP1 A;  5M1P A;  4B3O A;  4I6M A;  4EHT A;  3M8P A;  3J7Y P;  4K42 A;  3ATV A;  1KC8 O;  3AVF A;  3FE1 A;  3JAM O;  3HT3 A;  1HUX A;  4OKK A;  4B1X B;  3KIO A;  4DTO A;  3I8D A;  5LMU K;  4M3Y A;  3BUZ B;  2Q0R A;  3MN5 A;  4LH5 A;  3O9U A;  4B8A B;  4A5A A;  3VQE A;  1WSI A;  1YAG A;  1A5V A;  2NNW A;  1QQN A;  3E9O A;  1C0U A;  3UKR B;  3VQ9 A;  1P8Z A;  1BOT O;  1WAF A;  3LPT A;  1M1K O;  1SAZ A;  1X9W A;  1S5J A;  1HNI A;  4CEB A;  4DG1 A;  1BUP A;  4B1W B;  3E01 A;  4FLY A;  5GIO A;  4FW1 A;  1UOC A;  3SLC A;  4CZM A;  2E20 A;  1K8K A;  3NBP A;  3EE8 A;  3I0R A;  1NKB A;  4JI2 K;  3KK3 A;  2FBV A;  1LWF A;  4FJH A;  3ZSZ A;  4R79 A;  3CC4 N;  1KRP A;  4EFH A;  3ZX0 A;  3LAN A;  5AQP A;  4M3U A;  4JKF A;  4O55 A;  4ILG B;  5E84 A;  4CBW A;  4FWM A;  1L3S A;  4GKK K;  3K57 A;  2VWJ A;  3VQ7 A;  5DK5 A;  3MEG A;  1ESV A;  4HUF A;  3H08 A;  3L2W A;  4LFA K;  4KHY A;  4B9T A;  4OO1 J;  3AVK A;  3VEV A;  1U45 A;  2Q0U A;  1GLJ O;  4Y1D A;  3NGI A;  3V9S A;  1GLL O;  1DGK N;  4CK2 A;  1YF5 L;  3G4S N;  3I55 N;  2ZD1 A;  1DTT A;  3M8Q A;  2G8K A;  1SUQ A;  3AY9 A;  3SV3 A;  3CM6 A;  3HL8 A;  1L3T A;  3F9K A;  3OHR A;  3ID6 A;  4IOC L;  2P9N A;  1BQM A;  4JI1 K;  1BA1 A;  1JLC A;  2HHU A;  4KB1 A;  3T7Z A;  3AO4 A;  4F9O A;  4DV0 K;  1TL3 A;  5EX5 A;  4I6M B;  4OGE A;  3TAE A;  1T6C A;  3J81 O;  3OBY A;  2V52 B;  2PBD A;  1ITG A;  5CE3 A;  3V81 A;  5ADX H;  4XIU A;  1S6P A;  3SQ2 A;  3HSC A;  1WLJ A;  5J2M A;  4HCB A;  4JKB A;  3PO5 A;  4B3M K;  2QA4 N;  4H0O A;  1TGO A;  1NNE A;  3TAM A;  3O5B A;  1BA0 A;  4DSK A;  4EAH D;  2VQF K;  2FC0 A;  3ZT4 A;  4CFC A;  2ZQB A;  1ZC6 A;  4O5B A;  2QTD A;  3HVT A;  3AV9 A;  4AHR A;  1KAX A;  4OPH A;  3L6Q A;  4DTU A;  5AQK A;  3CC7 N;  1MDU B;  1HRH A;  4U7B A;  1KLM A;  3P83 D;  4BRL A;  3AVN A;  1K8K B;  1CXQ A;  1RT6 A;  1A5X A;  3AO1 A;  2X74 A;  4FPA A;  1NK9 A;  1JLE A;  4CJ7 A;  4JI5 K;  4N56 A;  3KK1 A;  3QIN A;  3S3N A;  2X78 A;  4UY8 O;  4AHC A;  4Z4G A;  1VSK A;  2KW4 A;  3S3M A;  1UAX A;  4Z0U A;  3VEN A;  2GUI A;  3R6M A;  5CZ1 A;  3O9Q A;  3P38 A;  4BRD A;  3VTI A;  3SK3 A;  4OGC A;  2QK9 A;  4YFU A;  1YJN N;  4PKG A;  4HHT A;  1TKX A;  3TI0 A;  4PQU A;  2FXU A;  3HRG A;  4B1Z A;  2KLA A;  4A57 A;  1K9M O;  4JKD A;  1R0A A;  1E4F T;  2P9N B;  1WSH A;  2FSN A;  3SAH A;  1LW0 A;  1OH5 A;  4DR3 K;  3QIO A;  1XC9 A;  2OYQ A;  2E2P A;  1VQ6 N;  3OJU A;  2B5J A;  4JN4 A;  4DTN A;  2ZJP L;  2F96 A;  1L3V A;  3O9R A;  4GNI A;  2QEX N;  3C6H A;  3KLG A;  4IDH A;  1EKE A;  2CGK A;  3IAY A;  3OYL A;  3WQT A;  3OA9 A;  1C1B A;  5J2P A;  5LL6 Z;  2Q31 A;  5BN8 A;  1QHT A;  2CH5 A;  4JKA A;  1MWM A;  3CYM A;  4FJM A;  3H1Q A;  4WQ5 A;  5J1E A;  1HMV A;  1TAQ A;  4MLE A;  3THW A;  2EX3 A;  3ULD A;  3P39 A;  4KH5 A;  4AHV A;  5HL7 L;  1VSH A;  4MQ3 A;  1M90 O;  4AHS A;  4Z4E A;  5J2N A;  1TUU A;  4CK3 A;  1U49 A;  4DR1 K;  1YXQ A;  4W5Q A;  4CF1 A;  2HBL A;  1NJZ A;  3F73 A;  1WSF A;  2P9S A;  3TTC A;  1NBW A;  3KKR A;  2NRV A;  5FDL A;  3DYA A;  5CYQ A;  4JEP A;  3AVJ A;  4FJL A;  5KPT A;  3VES A;  2H3G X;  3CJB A;  3F2K A;  3KLE A;  3E9L A;  1ZXO A;  3LAL A;  1S3X A;  4BR7 A;  4DV4 K;  3C6A A;  1VQ7 N;  2ZJR L;  3CET A;  2BGG A;  2Z1H A;  4BC2 A;  3NFA A;  3LDQ A;  3WXL A;  4RW6 A;  4O0I A;  1NGF A;  3DJC A;  5BR8 K;  3LWM A;  3LAK A;  2F4V K;  3U9Z A;  3V4I A;  2P9I B;  1KLN A;  3LDP A;  4ZTF A;  4EZ6 A;  4LFB K;  4FWN A;  4IXC A;  3QEP A;  3MXJ A;  1K73 O;  1LAV A;  3TWH A;  4FJ5 A;  4CGD A;  1CZ9 A;  3IG1 A;  3PUF A;  1N33 K;  3NVK A;  3QB0 A;  5T7B A;  4FLT A;  1NGA A;  3EY1 A;  2HMI A;  2NUB A;  5AFU H;  1S72 N;  3OYG A;  3CI5 A;  1SS6 A;  4O5F A;  3EZ5 A;  4CJU A;  1GOC A;  2FLO A;  2ASO A;  2UUA K;  4MLH A;  3EYZ A;  1IKY A;  2I5J A;  3GG4 A;  3QBX A;  3PO4 A;  4CCH A;  1HYS A;  4BQL A;  2ATQ A;  1V4S A;  3WXJ A;  1EET A;  3B6O A;  4HWI A;  2E8A A;  1J53 A;  4CBX A;  5DMR A;  4B8C A;  4KHN A;  5HRN A;  3C7N A;  5AQJ A;  4ZTJ A;  3O3G A;  1J54 A;  4ZHR A;  1ASU A;  3HXM A;  2ZM6 K;  3QEI A;  1X9M A;  1VQN N;  4WFN L;  4OKE A;  2VYP A;  4E1M A;  1YIT N;  4QCL A;  3DRR A;  4CZH A;  2Q97 A;  1WSJ A;  1BIS A;  3SUN A;  3SJJ A;  3MN7 A;  4FM2 A;  1NJW A;  4PWD A;  4WFB L;  4DTM A;  1YHQ N;  4BDP A;  4LF8 K;  1MWK A;  3K5N A;  4FCY A;  5CY4 A;  2YHY A;  4K43 A;  2G8V A;  1J9A A;  4KHS A;  3THX A;  4X65 K;  2GWJ A;  3VGL A;  5H1S Q;  3HPG A;  4NB4 A;  1YI2 N;  3C65 A;  5CR4 A;  4FXD A;  3THV A;  3BF3 A;  5BPM A;  1LAW A;  3PX0 A;  3O9T A;  4NLB A;  3NDK A;  4BDZ A;  3ZEU A;  3TAF A;  2OTL N;  2XY8 A;  1RDU A;  1GLE G;  4CF0 A;  1X1P A;  4M3W A;  3DAW A;  1S1W A;  2BTF A;  5KRS A;  3K0S A;  3S3O A;  1YIJ N;  2BE2 A;  2GEL A;  3U4L A;  2O8E A;  2ASP A;  1RTH A;  5KPZ A;  5LJV A;  3LDS A;  1SKR A;  3VQ6 A;  1RNH A;  4IDK A;  3CFP A;  3QDK A;  4BGB A;  4KRE A;  2G8W A;  2WBN A;  3L2Q A;  3MWT A;  3NF8 A;  2OPQ A;  3NAE A;  3GDQ A;  3LL3 A;  1RDD A;  3CJ7 A;  4FJX A;  5AQR A;  1MA9 B;  1RDW X;  1CXU A;  4F8R A;  3QER A;  3MX5 A;  4JV5 K;  3CCE N;  3CCJ N;  2HNZ A;  1TKZ A;  3C7N B;  4CK1 A;  4FM1 A;  4ELV A;  5AR0 A;  4FJK A;  4YOX A;  3VEX A;  4ELU A;  4AHT A;  5SZT A;  4DLE A;  3N4Q A;  3DLE A;  2RN2 A;  4DTJ A;  4CED A;  1KVC A;  1KVB A;  3WNH A;  3QIP A;  4RW9 A;  4O4G A;  3RSE A;  2UXB K;  1EO1 A;  4NXN K;  4IO8 A;  4N5S A;  2Q1N A;  1JLG A;  3TU5 A;  2QW9 A;  1GOB A;  5DM6 L;  2A1S A;  2A41 A;  5AQN A;  1GLF O;  2W41 A;  2YNG A;  2UUC K;  5GIN A;  3K5M A;  4MDB A;  3KLF A;  3VEW A;  2RKI A;  4JK9 A;  2Z1G A;  5F2R A;  3FZK A;  1NWK A;  1N5Y A;  4BWM A;  3AVI A;  4H0Y B;  3K59 A;  4CJE A;  2OPP A;  3VA3 A;  3FLC O;  2NRX A;  3ZX3 A;  3LP3 A;  1UWB A;  4JKG A;  1Q9Y A;  3KHY A;  3ZEU B;  5GAE P;  3ENO A;  1U48 A;  2FF3 B;  1EX4 A;  4ISG A;  4C8M A;  4E3S A;  3C0B A;  1QQM A;  1NGI A;  4YOT A;  4MFB A;  4DR6 K;  3V1R A;  4RWT A;  2O8E B;  4WCE L;  1TK0 A;  1HNX K;  4RW7 A;  1YTA A;  5AQU A;  5HBM A;  4KH4 A;  3RMA A;  5AQO A;  3AVM A;  2P9P A;  3NCI A;  4JYA K;  3C94 A;  3QFU A;  1BL3 A;  4DV1 K;  2QWN A;  3R8E A;  3IRX A;  3NH1 A;  3KK2 A;  3CPW M;  1HJR A;  1H1V A;  4W5O A;  5AQZ A;  3BZK A;  3WNF A;  4DV5 K;  2RHK A;  1SL2 A;  1NOZ A;  4FPB A;  3FZF A;  1VQP N;  3EO3 A;  5AJ3 K;  1HJO A;  2PY5 A;  4FJ7 A;  1NMN A;  4B3S K;  1NGB A;  3AVL A;  4CW7 B;  4AH9 A;  1Q9X A;  3ZSR A;  1XNR K;  4OPK A;  3G25 A;  4KTW A;  2VQE K;  4BRN A;  3EL2 A;  4LH4 A;  5C0Y A;  3H1V X;  4FVU A;  4DUY K;  3LM2 A;  3QIC A;  4IBN A;  4W5N A;  5TKW A;  4H5R A;  3RSE B;  3JYT A;  4QS9 A;  3AVA A;  2O4G A;  1WBB A;  4ELT A;  4YNQ A;  2OPR A;  1VSM A;  3MX2 A;  4H03 B;  4DFJ A;  1NGD A;  1IJJ A;  1I3A A;  3ATU A;  4JKH A;  2NLX A;  5F0X A;  4FWQ A;  1Y97 A;  3T1H K;  1T6D A;  2E6L A;  3MEC A;  4DQ8 A;  4C1N K;  1KAZ A;  3VOV A;  3MXM A;  1KFS A;  3WXM B;  2WOM A;  4FZX C;  2YJE A;  3RMD A;  4JK7 A;  1EWR A;  4FJI A;  4CEZ A;  2W42 A;  3TR8 A;  3VQB A;  4DFK A;  3HP6 A;  2DY4 A;  4ILJ A;  5TKY A;  2Q36 A;  3G6E N;  4MO4 A;  3KD1 E;  4DQR A;  4JKG B;  5GAH P;  3BF1 A;  2YV0 X;  4BG9 A;  2IS3 A;  2YNI A;  1WSE A;  3GOI A;  3AAQ A;  4C8K A;  1TV6 A;  1VSL A;  3Q7C A;  4DU4 A;  2BH1 A;  5C2D A;  4FWO A;  2I7N A;  4N76 A;  3LM9 A;  2P5G A;  3SUP A;  1HQE A;  2FBX A;  3TAN A;  1JLF A;  2P9P B;  3HTV A;  1FKO A;  5C10 A;  4JAX A;  3TAR A;  1C0T A;  3DRP A;  1ATR A;  3E66 A;  1VSD A;  1NJI O;  4DSJ A;  3KD5 E;  3NGZ A;  1F21 A;  4MDA A;  1BO5 O;  4KTQ A;  3D7E O;  5ELZ A;  3K58 A;  3AGK A;  3AVG A;  4I2P A;  3L8B A;  1DT9 A;  3V9Z A;  5JLH A;  4Q0B A;  4M3T A;  4J2E A;  3D6R A;  3L4Q A;  2HST A;  3OYE A;  4JHD A;  4IEI A;  4WYB A;  2GBZ A;  2E1Z A;  3D2E B;  4PL7 A;  4YOW A;  2KQ2 A;  1FJG K;  5C12 A;  3LDO A;  4Z4I A;  4B9N A;  2HBK A;  5FLX O;  2JLE A;  4B9V A;  1NKE A;  2HMP A;  1W7A A;  4CI6 A;  4BE1 A;  4LF4 K;  1W0H A;  3DM2 A;  3EEQ A;  4YOU A;  3OYH A;  2ZJQ L;  3FR0 A;  3MCA B;  4RW8 A;  1XQS C;  4CD3 A;  4BR4 A;  2HHX A;  3KZB A;  1NLV A;  3ISN C;  4CJT A;  4FW2 A;  1XC3 A;  2UXC K;  2UXD K;  2HBM A;  3A5M C;  4W5R A;  1BCO A;  4GV9 A;  3ENH A;  1YT3 A;  1BIZ A;  4B08 A;  4LSL A;  1S6Q A;  1TAU A;  1QVG M;  1HKG A;  3VQ4 A;  4A59 A;  4JI7 K;  2VWK A;  4OJR A;  4HTU A;  1QQO A;  2HHH K;  1LV5 A;  3DLR A;  3T1Y K;  5HOO A;  1JXE A;  4KB0 A;  3C6U A;  5BRH A;  4BGA A;  3OS0 A;  5LMN K;  5AQX A;  2R7Y A;  1JLQ A;  4LSN A;  2KZZ A;  3Q7B A;  5AQI A;  2UUB K;  1VSE A;  4PY5 A;  3U9D A;  3DLG A;  1NU0 A;  1J6Z A;  3MN6 A;  3U6F A;  4DKW A;  3NHG A;  1S1U A;  5IT9 O;  4M41 A;  3QBW A;  5M1Q A;  3O4W A;  3D45 A;  2E88 A;  1T8E A;  1Z05 A;  2FBY A;  1BIU A;  1RT7 A;  1ZBH A;  2VG6 A;  3DOK A;  3T1A A;  4DSF A;  3HPO A;  2DFH A;  3ZSO A;  4DTX A;  1GLC G;  3HOT A;  4CIF A;  5JIC A;  3LWL A;  3OTO K;  5KI6 A;  4CHN A;  3KJV A;  2VG5 A;  3VN5 A;  1IKV A;  4BR0 A;  1GLB G;  3VQA A;  4CGI A;  4E19 A;  3VMF B;  1IG8 A;  5FRN A;  2YKN A;  3VQ5 A;  4CGF A;  1XNQ K;  4JHD B;  2QI2 A;  4DFP A;  1SL1 A;  3LPU A;  3OBW A;  3EE9 A;  1OKJ A;  2F7T A;  3O08 A;  4UQG A;  2YCH A;  3CHW A;  4QS7 A;  4A2A A;  4YOR A;  5JVG L;  4CGG A;  2P9I A;  2YHX A;  1T44 A;  1SL0 A;  3CMA N;  4IFY A;  4CZI A;  3RTV A;  3HVR A;  1Z26 A;  3IDH A;  4IJN A;  3HM9 A;  1YTU A;  4CGH A;  4YHH K;  4KFB A;  4AM6 A;  1NM1 A;  2E6M A;  4EP5 A;  4CES A;  4E7J A;  3PY8 A;  2HHQ A;  4DQI A;  1IKX A;  2V7Z A;  2D0C A;  4B3R K;  1I39 A;  2CGL A;  1GLA G;  1WN7 A;  1Q82 O;  5EU7 A;  1RDB A;  1MU2 A;  2DTU A;  1XUP O;  3AVC A;  4WFA L;  1IO2 A;  3DLB A;  2PYL A;  3ZT2 A;  3S41 A;  4JNE A;  4JKE A;  3CJ9 A;  3RVC A;  4CZE A;  2HNY A;  4Z4F A;  4FM0 A;  2A6A A;  3T19 A;  1JJ2 M;  1VAZ A;  5C24 A;  4NCA A;  4B1Y B;  3OVN A;  3CCV N;  1VK0 A;  2HND A;  3AA5 X;  3F5T A;  3RMC A;  3V1Q A;  4FLV A;  1ZBL A;  2GX9 A;  1VRT A;  4I7F A;  3VGM A;  3CM5 A;  2LSN A;  4AM7 A;  1NK4 A;  3A2F A;  3O6W A;  3MN9 A;  4OVL A;  3WT0 A;  3AO5 A;  3FZM A;  1QSY A;  3AA4 A;  4CHY A;  1QVF M;  2Q2R A;  4CHO A;  4IG3 A;  4E0D A;  2RPI A;  2QKB A;  1TK8 A;  5JS1 A;  4DF4 A;  3J7A P;  3JSM A;  3NF7 A;  4FWR A;  2BAN A;  4RW4 A;  1D4X A;  1CZB A;  3S9H A;  3M5R A;  4DB3 A;  4NYF A;  4ID5 A;  4FYD A;  5IWA K;  3G10 A;  3CCQ N;  4FZY A;  1L3U A;  3FZH A;  4CJV A;  4HCC A;  4XEI A;  4B9S A;  1K8A O;  4RG8 A;  1Y64 A;  5JS2 A;  4EZ9 A;  1CLQ A;  2I7P A;  3SQ1 A;  2E2Q A;  4RTF D;  3WNG A;  3KTQ A;  4XH4 A;  4BE0 A;  4PHT X;  2P5O A;  2NRR A;  1FKP A;  3HBT A;  3GBT A;  3ZCM A;  1RT2 A;  2J4R A;  4IG0 A;  4CZG A;  4FOI A;  1LOT B;  1E4G T;  4BC4 A;  2OPS A;  3VQD A;  1HR0 K;  3AO3 A;  4X62 K;  4ID1 A;  5CHI A;  2ZF5 O;  3KLI A;  3HOS A;  3VQC A;  4H5V A;  4FLX A;  4BR5 A;  4FJG A;  2P9L B;  2PZS A;  1IV0 A;  4DQS A;  3PIO L;  3DI6 A;  2FBT A;  3CF5 L;  1TL1 A;  3P1G A;  1UA0 A;  2GUP A;  5HLF A;  1S1X A;  4IFV A;  2WC9 A;  4CJ3 A;  1NGG A;  3L0Q A;  1RT1 A;  4KKO A;  3OYD A;  4FL9 A;  3SMP A;  1B92 A;  3M3Z A;  4K0K K;  1OH7 A;  3I0S A;  1YJ9 N;  3A0I X;  3HO1 A;  3QO9 A;  5KQ8 A;  1RTD A;  4O8K A;  1W9H A;  4AIL C;  1QSL A;  4DUZ K;  2IVN A;  4IKF A;  2NZT A;  4I9Q A;  1HYV A;  1QZ6 A;  4GW6 A;  1QE1 A;  1VSI A;  3ZSQ A;  3PSF A;  1QHA A;  1IG9 A;  3QNN A;  1HLU A;  3ALY A;  1X3N A;  4PKI A;  3SUQ A;  4BDY A;  4C8L A;  4CFD A;  5HP1 A;  3FGU A;  3OYM A;  1S22 A;  2YHW A;  2D4W A;  1Q7Y O;  1WBD A;  4FLW A;  2YX6 A;  3AAR A;  1TVR A;  2OAN A;  4J2A A;  2A42 A;  2E2N A;  5EVZ A;  2IVP A;  4KRF A;  1N34 K;  4DR4 K;  3MWP A;  4J2D A;  4FVM A;  3WEE A;  5AQL A;  4BY9 C;  3DLH A;  1BWF O;  4DHY A;  1HQU A;  2PFU A;  4IOX A;  3I33 A;  1VQM N;  3SMS A;  4WE1 A;  3K9K A;  4DU3 A;  1ASW A;  1T05 A;  2QWP A;  3T3F A;  1XMQ K;  3VEZ A;  4KHQ A;  5KGX A;  4OPJ A;  3AA2 A;  3V9U A;  4WQ5 C;  1YUW A;  5M1O A;  2AA4 A;  2G8H A;  1IBL K;  3O80 A;  1WAJ A;  2E1Y A;  3DMJ A;  1QS4 A;  3A8Y A;  1U6Z A;  3SNN A;  4PUO A;  3BY5 A;  2F8S A;  4L8R B;  1JXB A;  4E7K A;  4IFE A;  2XO7 A;  1Z25 A;  5E41 A;  1SKS A;  4BWJ A;  4MO5 A;  3LZJ A;  2G8U A;  4DQP A;  2Y1J A;  1WUA A;  4YOY A;  4KH6 A;  2O8C A;  2O8F A;  4CEA A;  1LCU A;  3EKS A;  5F1X A;  4DSE A;  4TSX A;  2QWQ A;  4G1Q A;  4B1V A;  1S9E A;  3A5L C;  1ZYQ A;  4C1N I;  1RBT A;  5LY3 A;  4NCB A;  3ZT3 A;  1JL2 A;  2KKZ A;  4AQY K;  1QQC A;  5FPN A;  1BQN A;  4DU1 A;  5ADX A;  1WSG A;  2RE2 A;  3CPE A;  4KO0 A;  3NH0 A;  1D9D A;  1G15 A;  4JD2 B;  3IMX A;  4GV6 A;  4Z94 A;  5AQV A;  3TSQ A;  2PYJ A;  5BN9 A;  2A40 A;  1VQ9 N;  1NOY A;  1DLO A;  4BC3 A;  1IKW A;  3G71 N;  4NYN A;  1ILY A;  3PSI A;  2CH6 A;  3RRG A;  4KHW A;  3UB5 A;  4DS5 A;  3DLK A;  2HVI A;  1IBK K;  2GV9 A;  2F8T A;  3OY9 A;  3B8A X;  1VQL N;  1NGE A; 
#chains in the Genus database with same CATH homology
 1WSH A;  3BDP A;  4F3O A;  1RBV A;  3RWU A;  1ZBI A;  1LW0 A;  3L3V A;  3OYK A;  2KQ2 A;  1NK8 A;  3QIO A;  1XC9 A;  5HRS A;  2OYQ A;  3QNO A;  3VQP A;  4DTP A;  4Z4I A;  4B9N A;  4KTZ A;  4JRP A;  2JLE A;  4B9V A;  1NKE A;  2IGI A;  3AVH A;  3OJU A;  2D0B A;  4BE1 A;  2B5J A;  4DTN A;  4E1N A;  1W0H A;  4DTR A;  3DM2 A;  3OYH A;  3HK2 A;  2F96 A;  1L3V A;  4RW8 A;  2HHX A;  1U47 A;  3NF9 A;  3CG7 A;  3ISN C;  4FW2 A;  4CJT A;  3PX6 A;  4KHU A;  1DTQ A;  4CEQ A;  4CF8 A;  4W5R A;  3AO2 A;  1D5A A;  1EKE A;  3KLG A;  2EHG A;  1BCO A;  3SZ2 A;  1S1V A;  2IC3 A;  1YT3 A;  1BIZ A;  3OYL A;  1NJX A;  3IAY A;  4B08 A;  1C1B A;  4LSL A;  1ZBU A;  5J2P A;  1QHT A;  1WNS A;  4CJ5 A;  3WNE A;  3OYN A;  3CYM A;  2OZS A;  4FJM A;  1S6Q A;  1TAU A;  3QEW A;  5CZ2 A;  1RT3 A;  5J1E A;  1HMV A;  4CFB A;  3UIQ A;  3VQ4 A;  1TAQ A;  2Q3S A;  2EX3 A;  3ULD A;  2VWK A;  4OJR A;  4HTU A;  4AHV A;  2AJQ A;  1VSF A;  1VSH A;  4MQ3 A;  4AHS A;  1LV5 A;  3DLR A;  4Z4E A;  5J2N A;  4E7L A;  4CK3 A;  3MXI A;  1U49 A;  2KFZ A;  1JXE A;  4W5Q A;  3RRH A;  3QES A;  3VQ8 A;  3C6U A;  4CF1 A;  2XY6 A;  3F73 A;  1NJZ A;  1WSF A;  4KB0 A;  3TAP A;  3OS0 A;  3KKR A;  2R7Y A;  1JLQ A;  4LSN A;  1BGX T;  2KZZ A;  5FDL A;  3DYA A;  4CJS A;  5CYQ A;  2HVH A;  1RBR A;  1VSE A;  3AVJ A;  1HPZ A;  3RMB A;  4FJL A;  4J2B A;  4PY5 A;  5I3U A;  4CFA A;  3DLG A;  4HUE A;  1D9F A;  3U6F A;  2OA8 A;  1VRU A;  4CJF A;  3HP9 A;  3KKS A;  3KLE A;  4C8N A;  3LAL A;  3FFI A;  4GVM A;  4O0J A;  3TAQ A;  3NHG A;  1S1U A;  1JLB A;  4M41 A;  2BGG A;  2Z1H A;  3LP1 A;  1REV A;  3D45 A;  3NFA A;  4RW6 A;  4KI4 A;  4O0I A;  3LWM A;  1FXX A;  1C6V A;  1T8E A;  3LAK A;  2FBY A;  2IDO A;  3V4I A;  1BIU A;  2DFE A;  5JS1 A;  1GOA A;  4CIG A;  1RT7 A;  4CE9 A;  2VG6 A;  1ZBH A;  1KLN A;  3DOK A;  3T1A A;  4DSF A;  4ZTF A;  3HPO A;  4EZ6 A;  4OLB A;  3U3G A;  4K8X A;  2BDP A;  2DFH A;  3QEP A;  3ZSO A;  3MXJ A;  3BGR A;  4DTX A;  4NCG A;  4M3X A;  2ZE2 A;  1LAV A;  4CIF A;  3TWH A;  2D5R A;  3LWL A;  4B9M A;  4FJ5 A;  4CGD A;  2Z1J A;  1CZ9 A;  3IG1 A;  3PUF A;  3K5L A;  5KI6 A;  1KVA A;  4CHN A;  3KJV A;  2VG5 A;  4Y1C A;  3VN5 A;  5T7B A;  1IKV A;  3MEE A;  4FLT A;  4DSL A;  3VQA A;  4E19 A;  4CGI A;  5HRP A;  3QET A;  1KFD A;  2WON A;  2YKM A;  2YKN A;  3VQ5 A;  4CGF A;  3NE6 A;  4B9U A;  5D3G A;  5FRN A;  3EY1 A;  2HMI A;  3U3Y A;  2NUB A;  4DFP A;  1SL1 A;  3LPU A;  3OYG A;  1QSS A;  2A1R A;  1NK7 A;  3LP2 A;  3EZ5 A;  3VQQ A;  1S1T A;  4CJU A;  1GOC A;  3ZT1 A;  4I9L A;  4UQG A;  1LWE A;  2B4J A;  3OS2 A;  3SCX A;  4Z4C A;  1IKY A;  2I5J A;  4N47 A;  4CHP A;  3EYZ A;  4FLZ A;  1N6Q A;  1RT4 A;  3K5O A;  3PO4 A;  4CCH A;  4CGG A;  1HYS A;  1RIL A;  2ATQ A;  4DTS A;  1B9F A;  1EET A;  3B6O A;  1SL0 A;  1J53 A;  4IFY A;  3HPH A;  2RF2 A;  3RTV A;  3HVR A;  2G8F A;  1Z26 A;  5DMR A;  4B8C A;  3QEX A;  4KHN A;  3HM9 A;  5HRN A;  4CJW A;  4ZTJ A;  1YTU A;  1KSP A;  4CGH A;  2HHS A;  3O3G A;  1J54 A;  4ZHR A;  3SPZ A;  2YNH A;  4KFB A;  4M3Z A;  1ASU A;  4R5P A;  2Y1I A;  2E6M A;  3M8S A;  4EP5 A;  4OKJ A;  3HXM A;  3QEI A;  1X9M A;  4M42 A;  1NJY A;  2O4I A;  3ITH A;  4K8Z A;  4CES A;  4E7J A;  3SYZ A;  1VSJ A;  1ZBF A;  4OKE A;  4E1M A;  4I2Q A;  3PY8 A;  4DQI A;  3TAB A;  3DRR A;  1NK0 A;  1IKX A;  4DWI A;  2D0C A;  1IH7 A;  4FLU A;  1I39 A;  1WSJ A;  1BIS A;  3SUN A;  3KLH A;  3SJJ A;  4FM2 A;  4DQQ A;  1BHL A;  1WN7 A;  1NJW A;  4PWD A;  5EU7 A;  1XHX A;  4JS4 A;  1RDB A;  3G0Z A;  4M45 A;  5C25 A;  1MU2 A;  4DTM A;  4BDP A;  2DTU A;  3NF6 A;  3AVC A;  2KFN A;  3K5N A;  4FCY A;  1IO2 A;  1JLA A;  5CY4 A;  3OYJ A;  3V6D A;  2PYL A;  3ZT2 A;  3DLB A;  2G8V A;  1RCH A;  1J9A A;  4CJL A;  4KHS A;  4PA1 A;  3ZT0 A;  3OYA A;  2XRI A;  4Z4F A;  2HNY A;  4H8K A;  3HPG A;  4FM0 A;  3T19 A;  4KAZ A;  4FXD A;  1KTQ A;  4LD0 A;  3THV A;  1UA1 A;  5C24 A;  4NCA A;  1XWL A;  1SKW A;  4QCL A;  1LAW A;  2YNF A;  3PX0 A;  3NDK A;  4JS5 A;  3OVN A;  4BDZ A;  1VK0 A;  2HND A;  3AA5 X;  4F3T A;  3TAF A;  3RMC A;  4FK0 A;  1RBU A;  2XY8 A;  3V1Q A;  4CJK A;  4CF0 A;  4CF9 A;  1X1P A;  3OJS A;  4FLV A;  1ZBL A;  4DLG A;  2HB5 A;  4M3W A;  4FJN A;  1FK9 A;  1S1W A;  1C1A A;  1VRT A;  4I7F A;  5KRS A;  3CM5 A;  2LSN A;  4F4K A;  2XHB A;  1L5U A;  1TKD A;  1NK4 A;  3A2F A;  2HW3 A;  2HHT A;  2G8I A;  3S3O A;  2BE2 A;  4DSI A;  3DOL A;  3V9X A;  4OVL A;  4E7H A;  1RT5 A;  3AO5 A;  4AHU A;  3QEV A;  5HRR A;  4B9L A;  1RTJ A;  1QSY A;  3AA4 A;  1RTH A;  4CHY A;  3LDS A;  1SKR A;  3VQ6 A;  4FK2 A;  4CEO A;  1RNH A;  4IDK A;  4CHO A;  4CEE A;  4IG3 A;  3CFP A;  3SV4 A;  4KRE A;  2G8W A;  1TK5 A;  3L2Q A;  1BI4 A;  3NF8 A;  4E0D A;  2RPI A;  3ZSX A;  2QKB A;  3L2V A;  3QLH A;  2OPQ A;  1TK8 A;  4JRQ A;  1LW2 A;  3OYI A;  3NAE A;  4DF4 A;  2IAJ A;  5I42 A;  3JSM A;  3NF7 A;  1RDD A;  2BAN A;  4RW4 A;  4E89 A;  3L2R A;  1CZB A;  4FJX A;  1CXU A;  3S9H A;  3RR7 A;  4F8R A;  3CQ8 A;  4NYF A;  4ID5 A;  1B9D A;  3QER A;  3G10 A;  4FYD A;  4EP4 A;  4FZY A;  1L3U A;  2HNZ A;  1C0M A;  1TKZ A;  3V1O A;  4CJV A;  5FRO A;  4HCC A;  4CEF A;  4CK1 A;  3SI6 A;  1HYZ A;  2HHW A;  4FM1 A;  4B9S A;  4ELV A;  4DMN A;  5SWM A;  4RG8 A;  2JGU A;  5JS2 A;  4FJK A;  4ELU A;  2YHA A;  4AHT A;  3O3F A;  4EZ9 A;  3AA3 A;  5SZT A;  4LY7 A;  3DLE A;  3LP0 A;  2RN2 A;  4CJP A;  4DLE A;  3O4N A;  4DTJ A;  3SQ1 A;  2OZM A;  4CED A;  1KVC A;  1CLQ A;  3WNG A;  3KTQ A;  1KVB A;  3IS9 A;  3WNH A;  4Q5V A;  3MAQ A;  4BE0 A;  2HHQ A;  1O1W A;  3QIP A;  3C95 A;  4RW9 A;  2P5O A;  4GMJ B;  4O4G A;  3CFO A;  3OYB A;  1FKP A;  4N5S A;  2YHB A;  4QOZ B;  3ZCM A;  1JLG A;  1YVU A;  3LAM A;  1U4B A;  1GOB A;  1RT2 A;  3HST B;  4IG0 A;  4B3O A;  3M8P A;  2A1S A;  1LWC A;  2OPS A;  3VQD A;  2YNG A;  4DFM A;  3AO3 A;  3AVF A;  4ID1 A;  3K5M A;  3KLI A;  3KLF A;  3VQC A;  2RKI A;  3HT3 A;  2Z1G A;  4OKK A;  4FLX A;  4FK4 A;  4KV8 A;  3KIO A;  4DTO A;  4HVJ A;  3I8D A;  4BWM A;  1N5Y A;  3AVI A;  4FJG A;  3O4Q A;  3V9W A;  4M3Y A;  2PZS A;  1U04 A;  3VA0 A;  4LH5 A;  2ITG A;  4B8A B;  2X6N A;  1X9S A;  4DQS A;  3VQE A;  3DI6 A;  1WSI A;  2FBT A;  4CJE A;  3K59 A;  1TL1 A;  2OPP A;  3VA3 A;  3P1G A;  1A5V A;  1TKT A;  3LP3 A;  1J5O A;  3HYF A;  1UWB A;  1UA0 A;  1Q9Y A;  1C0U A;  1U48 A;  3D0P A;  3VQ9 A;  1S1X A;  1WAF A;  3LPT A;  5HLF A;  1EX4 A;  4IFV A;  4CJ3 A;  1JKH A;  4C8M A;  4E3S A;  2X6S A;  1S5J A;  1HNI A;  1X9W A;  4CEB A;  4DG1 A;  1RT1 A;  2D0A A;  4KKO A;  3OYD A;  1B92 A;  3E01 A;  4FLY A;  4MFB A;  1C1C A;  4FW1 A;  1UOC A;  1XHZ A;  3V1R A;  4DF8 A;  2P51 A;  3I0S A;  3HO1 A;  1TK0 A;  4RW7 A;  1YTA A;  3QO9 A;  3NBP A;  5HBM A;  1RTD A;  3ZSY A;  3RMA A;  3I0R A;  1NKB A;  1W9H A;  2P1J A;  3AVM A;  3KK3 A;  4AIL C;  5J2Q A;  3NCI A;  1QSL A;  2FBV A;  4CJ4 A;  1LWF A;  5CYM A;  3OYF A;  4C8O A;  4IKF A;  3C94 A;  3ZSZ A;  4FJH A;  1BL3 A;  1KRP A;  4I9Q A;  4H4O A;  1BI4 B;  1HYV A;  3LAN A;  4GW6 A;  3IRX A;  4M3U A;  4O55 A;  3NH1 A;  3KK2 A;  1HJR A;  1A5W A;  1QE1 A;  4W5O A;  3O3H A;  1L3S A;  1VSI A;  3ZSQ A;  2HHV A;  3WNF A;  3K57 A;  2VWJ A;  3PX4 A;  3VQ7 A;  1EP4 A;  5DK5 A;  3MEG A;  4HUF A;  2QXF A;  3H08 A;  3L2W A;  1SL2 A;  1IG9 A;  3QNN A;  1NOZ A;  4KHY A;  3ALY A;  4B9T A;  3AVK A;  1U45 A;  3SUQ A;  4BDY A;  4CER A;  1S9G A;  4Y1D A;  3NGI A;  4CFD A;  4BAC A;  3V9S A;  1NKC A;  4C8L A;  2PY5 A;  4FJ7 A;  5HP1 A;  1JL1 A;  4CF2 A;  3NGY A;  3ZSV A;  3AVL A;  3OYM A;  4AH9 A;  1Q9X A;  3ZSR A;  2XY5 A;  4CK2 A;  4OPK A;  3SUO A;  2ZD1 A;  4N41 A;  4KTW A;  1DTT A;  3M8Q A;  4FLW A;  4LH4 A;  2G8K A;  1KCF A;  1SUQ A;  5FRM A;  1HNV A;  3SV3 A;  4CHZ A;  1TVR A;  1RDA A;  2VG7 A;  3CM6 A;  3HL8 A;  1L3T A;  1SV5 A;  4J2A A;  3F9K A;  3RR8 A;  5KRT A;  4IBN A;  4M3R A;  4KRF A;  4W5N A;  1BQM A;  4J2D A;  3JYT A;  4FVM A;  2HHU A;  1JLC A;  3AVA A;  2Z1I A;  4KB1 A;  2O4G A;  3L2U A;  2DFF A;  5C42 A;  3DLH A;  4YNQ A;  2OPR A;  1VSM A;  3AO4 A;  4DFJ A;  4ELT A;  1HQU A;  4E7I A;  3M8R A;  1TL3 A;  1I3A A;  4KPY A;  4FJJ A;  3MED A;  4OGE A;  1RTI A;  1Y97 A;  4WE1 A;  3TAE A;  2E6L A;  3MEC A;  4DU3 A;  1ASW A;  1T05 A;  3HJF A;  1ITG A;  3MXM A;  3V81 A;  4DS4 A;  1KFS A;  2WOM A;  1S6P A;  4XIU A;  3SQ2 A;  3SQ4 A;  4FZX C;  3RMD A;  1WLJ A;  5J2M A;  3T3F A;  2XY7 A;  4CEZ A;  4F2S A;  4FJI A;  2W42 A;  4HCB A;  3TR8 A;  3VQB A;  3PO5 A;  1QTM A;  4KHQ A;  5KGX A;  4OPJ A;  3AA2 A;  4QAG A;  4DFK A;  4FJ9 A;  1RDC A;  3V9U A;  4FJ8 A;  3HP6 A;  5KGW A;  4O44 A;  3DRS A;  2DY4 A;  1TGO A;  3TAM A;  4DSK A;  4CGJ A;  3KD1 E;  4DQR A;  4JLH A;  2G8H A;  1WAJ A;  2YV0 X;  2FC0 A;  3ZT4 A;  3DMJ A;  2IS3 A;  1QS4 A;  2ZQB A;  4CFC A;  2YNI A;  4O5B A;  3CFR A;  3SNN A;  4PUO A;  1T03 A;  2F8S A;  1WSE A;  1RBS A;  3HVT A;  4C8K A;  1JXB A;  1TV6 A;  4E7K A;  4L8R B;  3AV9 A;  1VSL A;  4AHR A;  1NK6 A;  4CJR A;  2XO7 A;  4DU4 A;  1Z25 A;  5E41 A;  1SKS A;  4BWJ A;  4DTU A;  3LZJ A;  2G8U A;  4DQP A;  2Y1J A;  4CEA A;  4KI6 A;  1K6Y A;  5HRO A;  1HRH A;  1NK5 A;  1KLM A;  3P83 D;  5KTQ A;  3C6T A;  2B6A A;  3AVN A;  3LZI A;  4N76 A;  1CXQ A;  1RT6 A;  4DSE A;  3L3U A;  3SUP A;  2P5G A;  2ETJ A;  1HQE A;  4TSX A;  1A5X A;  2FBX A;  3AO1 A;  3B6P A;  1JLF A;  1S9E A;  2X74 A;  4G1Q A;  3TAN A;  1T7P A;  2KZM A;  1ZYQ A;  1FKO A;  1NK9 A;  1JLE A;  1RBT A;  4H4M A;  4NCB A;  3K2P A;  3ZT3 A;  4N56 A;  3KK1 A;  1JL2 A;  3QIN A;  3TAR A;  3S3N A;  1C0T A;  4FZZ A;  3NH2 A;  2X78 A;  3DRP A;  4AHC A;  4Z4G A;  1BCM A;  2QKK A;  3ASM A;  1QQC A;  1VSK A;  3AVB A;  1BQN A;  3ZSW A;  4DU1 A;  1VSD A;  2KW4 A;  3SQ0 A;  3S3M A;  1XI1 A;  4DSJ A;  4W5T A;  4OLA A;  1UAX A;  3SPY A;  4Z0U A;  3KD5 E;  2IOC A;  1WSG A;  3NH0 A;  1F21 A;  4KO0 A;  2GUI A;  3NGZ A;  1G15 A;  5CZ1 A;  1D9D A;  4KTQ A;  4CEC A;  4ICL A;  3K58 A;  3PV8 A;  3OYC A;  2PYJ A;  1D8Y A;  4BE2 A;  4OGC A;  1ASV A;  2QK9 A;  4YFU A;  4F2R A;  1NOY A;  1DLO A;  3P5J A;  4CJQ A;  3AVG A;  4I2P A;  4CHQ A;  1IKW A;  3L8B A;  4HHT A;  2E4L A;  1TKX A;  1Q8I A;  5K14 A;  3TAG A;  4NYN A;  3TI0 A;  4PQU A;  3V9Z A;  4Z4H A;  4Q0B A;  4M3T A;  2KTQ A;  3RRG A;  4J2E A;  4KHW A;  4HUG A;  4DS5 A;  3DLK A;  1R0A A;  2HVI A;  2GV9 A;  2F8T A;  3OYE A;  4CIE A;  3OY9 A;  1EXQ A;  3OS1 A;  2GBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...