2VQEK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqeK00
1XNRK 3J7YP 4LF5K 4JI2K 2F4VK 2UXDK 1XMOK 4DV4K 4B3RK 2UUCK 5LL6Z 4X65K 1HR0K 4V19S 2UXBK 3J81O 3JAMO 2HHHK 4LF4K 4X62K 5A2QO 1N36K 5IT9O 1XMQK 4LFAK 4DR5K 4LF9K 4DUZK 1HNZK 4JI5K 2UU9K 4X64K 3OTOK 1HNWK 4JYAK 5LMNK 2UXCK 4DV0K 4DV6K 4JI0K 4B3MK 1XNQK 4CVNE 4DV3K 4LF8K 4DV7K 2ZM6K 4JI7K 4DR1K 1N34K 2UUBK 1IBKK 3J7AP 4LFBK 4DR6K 4LFCK 4GKJK 3T1YK 5AJ3K 4B3TK 5BR8K 4NXMK 4YHHK 1IBLK 1N33K 4GKKK 4DV2K 4JI8K 4JI4K 3J80O 4DR3K 4DR7K 4JI1K 5IWAK 1I94K 4JI6K 4JI3K 4B3SK 1N32K 5FLXO 1HNXK 1IBMK 2VQEK 4CW7B 2VQFK 1FJGK 4X66K 4LF7K 4JV5K 4DV1K 4DV5K 4K0KK 4KHPK 1J5EK 2E5LK 4DR4K 2UUAK 4NXNK 4DR2K 5LMUK 4YY3K 4LF6K 4AQYK 4OX9K 4DUYK 3T1HK
chains in the Genus database with same CATH superfamily
2OPQA 3THYB 3OYDA 4FM2A 4JKFA 1GLDG 4WQ5C 3WNEA 1VQPN 1U04A 1NGIA 5AQQA 4BDZA 4FLVA 2UUCK 1NG9A 3WNGA 4F3TA 1D8YA 3S41A 3JS6A 2G8IA 5EVZA 3KLIA 5AQTA 1TKZA 5ADXH 1NMNA 2AP1A 3RMDA 2KHOA 3ID8A 5LJVA 3SUNA 2O8CA 1EX4A 3CQXA 4DUZK 3LP1A 5E84A 4JKGA 4WE1A 1ESVA 2GELA 1CXUA 3PX0A 3J7ZO 2DFHA 3VEXA 5KPZA 3THXB 4E7HA 3EZWA 4B3MK 4IZ9A 5EXWA 1XNQK 2Z1JA 4JRQA 4DCHA 5FPEA 2JGUA 1N34K 4IFVA 4C1NI 3L2VA 4E1JA 5AQFA 1T03A 4R5PA 1S9GA 4BR4A 3IS9A 5AJ3K 4EZ9A 1VAZA 4BRFA 4OGEA 3TAFA 1BG3A 1JJ2M 4CZHA 1J54A 1HPZA 4C8NA 2A1RA 4GKKK 4DV2K 2HMPA 3GOIA 1OH5A 4LSLA 4CJ7A 1S5JA 4IDKA 4J2EA 3PY8A 5M1FA 1MA9B 3TR8A 3PIOL 3H1VX 4B3SK 1BI4A 1ZBHA 1N32K 5LY3A 3SJJA 3AVFA 3SAGA 1RDDA 2QWQA 2PY5A 2E2OA 1W97L 1N8RO 3MWTA 4BR0A 3DRSA 3LP2A 3JYTA 3B6PA 3FZHA 3TAQA 3CQ8A 2RHKA 3LM9A 3SQ1A 2HW3A 3VF4A 4UQGA 3G10A 4FLTA 2XY8A 1RBUA 4NYFA 3HPHA 3CG7A 1YTUA 3O9SA 3TWHA 1YAGA 1KAZA 3ZSVA 1VHXA 4CK3A 1IKWA 1XNRK 4XEIA 1QS4A 4PKGA 4FVUA 1LW0A 1XMOK 1ITGA 4O5BA 2YKMA 4FWQA 3O1BA 4M3UA 3W0LA 2F9WA 4DTMA 1TL3A 2GBZA 1J53A 4QS9A 3BZCA 3C0BA 5A2QO 1WSJA 2ZD1A 1LOTB 4B8AB 2DPNA 3KZBA 1O13A 4IOXA 3NF9A 4K42A 3CPWM 4H5NA 1TYQB 5K14A 1VQ8N 3WEEA 5BRFA 1LAVA 4FJ7A 4N47A 4DV0K 2V7YA 3E9OA 3KWGA 4B9LA 4CBXA 3EYZA 5EY4A 3VQ6A 2EWSA 2VWJA 4CJRA 1RNHA 3M3ZA 4C8MA 3GDQA 1CZAN 2E6LA 2YHXA 4KBOA 5FDLA 5CZ1A 4B9TA 2D0PA 5AZIA 1RBTA 4CEOA 3DRRA 3CCQN 2FC0A 3LDSA 5JVHL 3DLRA 2NRZA 3IDHA 1DLOA 2ASOA 3CJCA 4B1VA 4WF9L 3C95A 4B3OA 5F0XA 2ZE2A 1ZC6A 5AQNA 4BG9A 1R0AA 1KLMA 4PL8A 1RDAA 3SK3A 2B6AA 3THWB 4O4GA 1EXQA 3P1GA 5IWAK 3QETA 5C12A 1BQNA 1ZBSA 2JWKA 3BY5A 3SPYA 2Q97A 4DFMA 5D3GA 4LF7K 2YNFA 3KK1A 2RKIA 4FPAA 3WXIA 3K59A 4BWMA 3DWLA 1NMDA 4QCLA 4LD0A 1LV5A 4YORA 3QNNA 3EZ5A 4PA1A 3DXMB 3T1HK 3AVHA 5HBMA 1BQMA 1K8KA 3SZ2A 3N4PA 1O1WA 2QK9A 2HBJA 1WOQA 1XI1A 3BF1A 1C0GA 3KHYA 5BPNA 5ADXA 1NK9A 2RN2A 1YJWN 4CJ4A 3CIPA 3HL8A 3F5TA 4M3RA 4PL7A 3CJ9A 5AFUH 3F2KA 2Z1IA 3SLCA 3QBWA 2HMIA 4BGBA 5CE3A 1S1WA 3KK3A 1EQYA 4E7LA 5J2QA 3OS2A 4FJNA 3L2WA 3VQQA 5DM7L 2V51B 2VYPA 3BDPA 3H3NO 4B1XB 2YNIA 1VSHA 3MX2A 1NGDA 4JLHA 2IAJA 2ZQBA 4CHYA 3VQ4A 3CCEN 4ISFA 1Q9YA 4IKFA 3HZ6A 3AA2A 4CK1A 3EN9A 1T8EA 3SQ2A 4Z4FA 5CYMA 3AA5X 3NGZA 1W9HA 4IXCA 3AARA 4J2BA 5LJWA 1JXEA 1MWMA 4BGAA 2XHBA 3NFAA 3ULDA 5C25A 3OW2M 2NRVA 3EO3A 3C6TA 3VQEA 2CH6A 1BIUA 2O8CB 2KW4A 4B9SA 3CMEN 4JI1K 1VQLN 4ISEA 1TKXA 1NLVA 4HCCA 1A5VA 3E66A 5AQOA 2IS3A 3K0SA 3TU5A 1EWRA 3TTDA 2A5XA 2VQFK 5BRHA 3HP6A 1KTQA 4DV5K 5BN8A 3OBWA 4ZTJA 4BROA 2WOMA 4MLHA 2FBYA 2I7PA 2PZSA 3BEXA 3MN7A 4IEEA 3NF7A 1L3SA 1C1CA 1WLJA 3T7ZA 3KWIA 4IFEA 3OYCA 4CZIA 2P9SA 3OHRA 2FSNA 1TAQA 1R59O 1S1VA 3HXMA 1S1UA 5M1PA 3CFRA 3OJSA 3VQ7A 4FL9A 4FLZA 5AQIA 4LC9B 4V19S 1D4XA 3ALYA 2ETJA 1U48A 3VEZA 3D2FA 2ATQA 2QI2A 1C6VA 1JLAA 3M5RA 3SBGA 3WXLA 5I3UA 1W2BM 4GV9A 4CGIA 2P9IA 1FKPA 5BPLA 1BA0A 1IH7A 3SUOA 1RT3A 2FBVA 5AQLA 4EZ6A 4NCAA 2HB5A 1BCOA 1VQMN 2P9PA 4K43A 1NK6A 4PKHA 3ZETA 4JI7K 2NNWA 4IBNA 4CZFA 3HOTA 4FJ8A 4H8KA 3A0IX 4BREA 4GW6A 1YVNA 5EOYA 1FKOA 5BR8K 1TGOA 1WSIA 2VG6A 4FJ9A 3CFPA 4KTZA 2I5JA 1A5XA 3I0RA 3KD5E 4BQZA 4J8FA 3OYBA 5B8HA 4IJAA 2ZJRL 1X9WA 1S22A 2Z1HA 1NGAA 4RW6A 3WEEB 4FWPA 3O8MA 3OA9A 4CF2A 1ZBLA 3OS0A 1U4BA 3ZT2A 3FR0A 3CMAN 1QSSA 1JLEA 3CC2N 1X9MA 3O1WA 1KAYA 3C7NA 5AQJA 1Q18A 1RT4A 2RE2A 3FE1A 4BE2A 4KH6A 3KD1E 4GV6A 1E4FT 3EKUA 2GWJA 3O6WA 1RFQA 1CZBA 2E5LK 4A5AA 5GAHP 3A5OC 4NXNK 3OVNA 2G8VA 2NUBA 4DTRA 1HJOA 5AZIB 1JLBA 5KPTA 4UY8O 4CZMA 1RBSA 5BRDA 3O3HA 4M45A 5C24A 5HP1A 1TK0A 1RDCA 3VQCA 3ZT3A 1N5YA 4B9QA 4H0VB 5AFUA 4FZZA 3WNFA 1HJRA 2YI1A 4CESA 4A2BA 3DLKA 3CC7N 2UXBK 5DMRA 4BC2A 1JCEA 4CERA 3O4QA 4R79A 3JAMO 4DB3A 3TI0A 3NVMA 1SZ2A 3HM8A 3CCMN 3E9LA 1VQKN 2PYLA 3DLBA 4JKHA 1S6QA 4HHTA 4JI5K 4QS8A 4XH4A 4PUOA 3KIOA 3CCJN 4EHUA 4KV8A 4GVMA 3LZJA 4YDUC 3T19A 4FJJA 1SUQA 3HYFA 2KQ2A 4NCGA 1EKEA 1FK9A 1VQ9N 1S6PA 4TSXA 2B4JA 4MO4A 4A59A 4PHTX 1VSFA 3AO3A 4LFCK 4GKJK 2F8SA 1K73O 5SZTA 1BHLA 4YOWA 1D9FA 5C15A 1X3MA 4FOEA 3QO9A 3SAHA 4O0IA 5DK5A 3O5BA 2QWOA 3HBTA 4JI4K 4CEEA 2O8DA 3AO5A 3CXCM 4XH5A 4CHPA 2HF4A 4OPHA 4CBWA 1TK8A 4JI3K 4JK8A 2HHVA 4DTNA 1VRUA 4CW7B 4IJNA 3MN9A 3SV3A 1QVGM 4DV1K 1SKRA 4Y1CA 3KKSA 3AVJA 3KLEA 1HRHA 2Q0RA 4IDHA 3VA0A 3ZX0A 2ZF5O 3HJFA 2GWKA 3S3MA 4PQUA 2WFBA 3VESA 4XIUA 1H1VA 4G1QA 1MU2A 3OJUA 4IFYA 1JLCA 5KRSA 4H0YB 4JAXA 2GTDA 5KRTA 4RW4A 4FO0A 3Q7BA 3HRGA 4FJLA 1RT2A 3CCSN 5FRMA 4I2QA 4Y1DA 4AHRA 3HSCA 3V6DA 1P90A 4JRPA 3MXMA 4E7JA 3VQ5A 3C65A 1KD1O 3KLFA 5FPNA 1QQMA 2O8FA 5AQKA 1UOCA 1T7PA 1VSEA 2FLOA 4O0JA 1HUXA 2P9LB 5JS2A 4Z94A 3V9SA 5J2NA 1XMQK 2YV0X 4MDBA 1YT3A 2HNYA 4CBUA 5J1EA 4A57A 1NJXA 3CCRN 3L6QA 3RR7A 4E1NA 2XY7A 3KK2A 5BREA 3ZX2A 2QXLA 4BDYA 3E9PA 3F73A 3KTQA 3RVCA 2A40A 2P9SB 1LAWA 3NH2A 1NOZA 3LM2A 5HRPA 1GLBG 4DFKA 4W5RA 4HUGA 3HM9A 2X6SA 2QWLA 1X9SA 3J7AP 4FXDA 3T1YK 4ZHRA 3U3YA 2O8EB 3H6EA 2HBLA 1GLCG 3QERA 4GNIA 3NCIA 4KREA 2O4IA 3D2FB 3EKSA 1ASWA 3VQ8A 3PV8A 4DTUA 1DT9A 3DLEA 4BG8A 2FBXA 1Y64A 3U8XA 3TAPA 3ZSQA 2YKNA 4IO9L 4MDAA 4CEQA 5C10A 2P9IB 4YOYA 4DLGA 3PX4A 4CGFA 3HP9A 3L4QA 3TAMA 3D6RA 4CGHA 3V9UA 2QA4N 4B9NA 1JLQA 3FZKA 4JKEA 3V1OA 2E2PA 4MQ3A 3MEGA 1Q8IA 5C42A 3ZETB 4CJVA 3WXJA 4IG0A 1IO2A 1U2VA 3CJAA 5JS1A 3I8DA 1KFSA 4BY9C 3HPGA 1BUPA 4DTSA 1KAXA 1Y97A 1ASUA 4KHQA 1WUAA 5KGWA 4O55A 3ZX3A 3A2FA 4DUYK 4JKBA 1VQ6N 1NJZA 1WNSA 3VF2A 5FROA 4DQQA 3CM5A 4CIGA 4DFPA 4OPAA 4AILC 3SPZA 2CGLA 2P9KA 3C6HA 2OZMA 5ELZA 4FWMA 2PBDA 4HVJA 4H0TB 4BC3A 1SV5A 5AZJB 4BRNA 3K57A 4FLWA 4LF4K 1K6YA 3L3UA 4KI6A 2HSTA 4NLBA 5KPRA 4OPKA 1YI2N 3ZYYX 4KH5A 3EEQA 1HNVA 4E7KA 2P5OA 4CGDA 3VERA 5GAEP 4M41A 3ENOA 1ZXOA 3AVNA 4F2RA 3THVA 4DV3K 5AQUA 4FSVA 2VG7A 5KTQA 2QEXN 4KHNA 3D7EO 3NDKA 1ATSA 3ZLJA 1IBKK 3MDQA 2HNDA 3CM6A 3O9TA 4IOAL 2BUPA 3L2RA 1GLLO 4FLYA 4BVOA 3KLGA 4FWOA 3UKUB 2VCPA 2EHGA 3UE5A 1XHZA 3L2QA 1KRPA 4FZXC 5GIOA 3K9JA 4I6MA 3I55N 3MN6A 3AA3A 4BE0A 4DR3K 3NMUA 4QS7A 4DKWA 3SJHA 3DXKA 1MDUB 3Q7CA 4JD2B 3ENBA 2KFNA 1RTHA 4DF8A 1NK8A 3VPZA 1DTQA 3QINA 1RBRA 4KFBA 3ITHA 3MEDA 4LH5A 1KFDA 3S3OA 3KJVA 3AVLA 2KLAA 3QNOA 4FJIA 2XY5A 2OPRA 4MO5A 4E19A 3FGUA 4GV3A 2NZTA 2FSKA 4RTFD 3BP8A 1QZ6A 2P51A 3AVBA 3OYJA 3EE8A 3D2EA 1WBDA 4N5SA 4H5TA 3CD6N 3AAPA 3HPOA 1SQKA 3KKRA 3SBTA 4CEDA 1RCHA 3ZSWA 1NGFA 1HQEA 4BRHA 2JLEA 5LL6Z 2WC9A 4C8OA 2KTQA 5KGXA 4KH4A 1VSIA 3I0SA 3OYHA 4ELTA 5DM6L 2ZJQL 4X62K 4FM1A 4LFAK 4KI4A 4H4MA 4CJKA 4BRGA 3AY9A 3O4WA 1WSGA 3AO1A 3R9PA 3C6AA 1VQ7N 2YHBA 1IG8A 4JYAK 4JEPA 4PKIA 1SKSA 1SL1A 2IIRA 1SL2A 3MCPA 1HKCA 3AVKA 3T3FA 1T05A 4JS5A 4Z0UA 3MXIA 2GUIA 4QOZB 2UUBK 2O4GA 3NHGA 2QXFA 3VF6A 1C0UA 2QWNA 1WAFA 5HLFA 4B3TK 3R3LA 4AF1A 3FZLA 2A6AA 4DSKA 3T69A 1IBLK 2E88A 3L0QA 3A5NC 1Z6RA 4GVEA 5M1OA 1NK0A 3LAMA 1VQNN 1W7AA 4FM0A 2CGJA 4Z4EA 1JCFA 4AHSA 5AQVA 3I56N 3HI0A 4CJLA 1RDUA 3QIOA 3WUHA 3LANA 1SAZA 4CJWA 4CJPA 1KCFA 4BACA 3V1RA 4DLEA 2P9NA 4JK7A 1BO5O 3ISNC 1KVBA 1FJGK 2VGMA 3IAYA 4I9QA 4K0KK 3D45A 3QIPA 4CJUA 1LWCA 4CJ5A 3I8BA 3MK6A 3DLGA 4E7IA 3BGRA 3G71N 3MECA 1RBVA 3R1XA 2KZZA 4NB4A 2WUSA 2E4LA 3RTVA 4BRAA 4Z4HA 5HROA 4JKGB 3TTCA 3CETA 4Z4IA 3FFIA 1ZBIA 3VTIA 4BR2A 1QQCA 4ELUA 3PLAA 4CZEA 4H03B 3VEWA 3DYAA 5E26A 2Q2RA 2G8KA 5TKWA 3AVMA 1NK7A 5JICA 3AA4A 3VEOA 3AAQA 4X65K 5AQYA 5GINA 4YFUA 3O3GA 1D5AA 5HRRA 1HKBA 4B8CA 4EP4A 4B08A 2KZMA 2D5RA 1QSLA 1JL1A 1ASVA 4WYBA 2FXUA 5IT9O 3K2PA 4HWIA 4LF9K 3EL2A 4OGCA 5E41A 2ITGA 2OCEA 1J9AA 1YF5L 3ZSYA 2OTJN 5C0YA 1ATNA 2G8UA 4ISGA 2E6MA 4WQ4A 3LPUA 1BI4B 1JL2A 3ZSZA 5HOOA 2ZM6K 2AA4A 3WXMB 3M8SA 4CF8A 4G9ZA 4DMNA 5FPDA 2IVNA 4E0DA 3M8PA 2P9KB 2GV9A 3L8BA 4W5NA 2O8BA 1QQNA 4H5VA 4RG8A 4ID1A 5AR0A 1DKGD 1JXBA 4E3SA 4BWJA 1A5WA 2YCHA 4IG3A 1Q86O 2RPIA 4FW1A 4HTUA 3NE6A 3L2UA 1F21A 2DY4A 2NRTA 4Y0WA 5I42A 4M7YA 3K5OA 3G4SN 3THXA 2HOEA 5AQXA 3VGLA 3DM2A 1Q9XA 2ZGYA 4IO8A 1GLEG 3CPEA 3PIPL 1RT7A 3O9UA 3IFRA 2D1KA 1E4GT 3R8EA 4M63C 4X66K 4OO1J 4OLAA 1IG9A 2KFZA 3OYAA 2E2NA 3EE9A 4CZJA 2BTFA 4O5FA 3VQDA 2AJQA 1D9DA 1LWFA 4CHZA 1BOTO 4H0OA 3QESA 4O44A 3TAEA 1C0TA 4CHOA 3RRHA 4JI2K 5CY4A 2UXDK 1T6CA 3H45C 5AQZA 1VSMA 4FJ5A 3DXKB 4KHYA 3SNNA 4CEAA 1HR0K 2VWBA 4HCBA 3CERA 5HL7L 4K8XA 1NGJA 3LZIA 1OH6A 2IOCA 2HVHA 3TANA 4QAGA 3OYNA 1IKYA 1C1BA 3CCLN 3W3DA 1TKDA 5CZ2A 1T3VA 1HYSA 1NGEA 1NJWA 3LAKA 3VA3A 3OTOK 1TV6A 4FPBA 1HNWK 3DMJA 4DQ8A 5AQSA 3QEVA 1WSFA 4FWRA 1XC3A 3H3OB 4BC4A 4BR7A 4JK9A 2NRXA 1RDWX 2GEMA 2I7NA 4WCEL 4B9UA 3D2EB 1ZBFA 5JLHA 1N6QA 1S1TA 2YNHA 4LFBK 2BANA 1TK5A 1HQUA 2YHWA 4CIEA 3TARA 4WQ5A 1XHXA 5F1XA 2FBTA 4Q0BA 2Y1IA 4M3ZA 3F9MA 5C2DA 1WSEA 1QHTA 1B9FA 3ZSOA 1K8KB 1SL0A 3HVTA 3QB0A 4YOXA 2WTUA 1V4SA 3SCXA 4KRFA 5F2RA 4DU3A 1OKJA 3E1YA 3NGYA 3MAQA 4JKCA 4J2AA 2W41A 3JSMA 1L3TA 3QEPA 2QM1A 3IRXA 4DR4K 2IVOA 3AVGA 2ITMA 4RWTA 3N4QA 3OYMA 3OYGA 3V1QA 4HUEA 1BISA 3FFKB 1YVUA 1WAJA 2YHAA 4H0PA 5AQMA 3PSFA 1BGXT 3ASMA 1YTAA 3CCUN 4CHNA 3RMCA 3THWA 4RCHA 2F4VK 3HK2A 3LP3A 1L5UA 1BWFO 3BUZB 4CJTA 4A61A 1LCUA 2PFUA 4I2PA 3UKRA 1MWKA 4RW8A 4DTJA 1JLGA 3RR8A 1BL3A 3IG1A 2CH5A 4HUFA 4FWNA 3TAGA 2HHHK 1N36K 3M8QA 4DFJA 3QFPA 4C23A 1NGGA 3NF8A 4Z4CA 2FF3B 2HHUA 3U3GA 1UA1A 4DQRA 2CGKA 4FJXA 1QQOA 1YIJN 3DXMA 4FLXA 3R6MA 4CEZA 4FOIA 1X1PA 3P4IA 4AH9A 4FVMA 1VQ5N 4A2AA 5BR9A 4YNQA 3HOSA 1Z05A 4AHTA 3L4IA 4DTOA 3OYEA 2BGGA 3F9KA 1KLNA 4FZYA 3ZSRA 4BRIA 4RW7A 1JLFA 4EHTA 3CHWA 4U67L 5C2FA 2A42A 3IMXA 4NXMK 3I33A 3C94A 3ZEUA 2DTUA 1OVYA 1KVCA 1EO1A 2X6NA 1N33K 4EFHA 1U6ZA 4LSNA 4JI8K 4CEFA 3J80O 3PUFA 4I7FA 3DJCA 4YOTA 2F96A 1TVRA 1J5OA 4ILJA 5JVGL 2ZWHA 3O9RA 5FLXO 1IBMK 1CZ9A 1B9DA 3SI6A 4JN4A 3L3VA 4JNEA 5HRNA 3FZMA 4LH4A 4BRKA 1IKVA 4H5RA 1WN7A 4JKAA 4B1WB 1VSDA 1FXXA 2IVPA 1HYZA 2UUAK 2HBKA 3VQ9A 3O9QA 3AGRA 4IOCL 3U9DA 3WQUA 2O8BB 5M1KA 4I9LA 4CHQA 3DLHA 1XWLA 3DOLA 4OX9K 2E8AA 4AM7A 1EWQA 1RILA 4BR9A 3QEIA 1GLAG 3SV4A 2P9PB 3DOKA 1XUPO 4CFDA 1M1KO 4M3XA 1NGBA 2F9TA 1IJJA 3GE1A 4B9MA 5KQDA 3JXUA 3ZSXA 3CI5A 3SAFA 4FJHA 3ZCMA 4BC5A 4XH1A 2VGNA 2OA8A 3WNHA 1NGHA 3MCAB 3SUPA 3HO1A 4OKEA 3VTHA 1VQ4N 3B8AX 1DEJA 4FWLA 3OYFA 3ZT0A 1GOCA 1WSHA 1I3AA 4BRPA 3DRPA 1REVA 3G25A 5LMNK 4ILHA 2E20A 1WB9A 4KTQA 2HNZA 2IDOA 3MN5A 3E01A 4YOUA 2D0AA 2W40A 4DTPA 4DR1K 3VGKA 4BDPA 3LDLA 1L3VA 3C7NB 5I9EB 3AO4A 4CCHA 4CECA 3CQYA 3VMFB 1HNIA 2QWRA 5HRSA 4ZTFA 1IV0A 5BPMA 2Q0UA 4CF1A 4O8KA 4KAZA 3DAWA 3H1QA 1KXPA 4BRMA 2QWPA 2EX3A 4CK2A 1RT1A 5KI6A 1QE1A 4ELVA 4KB0A 3NBPA 2VG5A 2X78A 3H08A 1L3UA 4RW9A 4DSFA 3SQ4A 5EX5A 4FWKA 4ICLA 4CF9A 1QHAA 4OLBA 1QZ5A 2G8WA 2D0CA 4F4KA 2OTLN 4FCYA 3P31A 3SQ0A 2RF2A 1J5EK 4N76A 1DTTA 3QMLA 3RWUA 1C0MA 5CHIA 4WFNL 3VGMA 4A5BA 2IGIA 4K25A 3NAEA 1NM1A 3J7YP 3FZFA 5FPMA 4CJFA 5AQPA 4WFBL 4J2DA 3S3NA 2DFFA 4IEIA 1P8ZA 2ASPA 4FJMA 2ASMA 3V9XA 2Q31A 3C6UA 2QWMA 2OPSA 3J81O 1NJYA 5FRNA 2H3GX 1VSKA 2J4RA 3MEEA 1CXQA 1NOYA 4M3YA 4FYDA 3NF6A 1KQSM 4DTXA 1B92A 3RSEA 2O8DB 4B1YB 2A41A 2NRWA 4AHUA 1BIZA 1S3XA 5M1QA 2UXCK 4CZGA 4FJKA 4DV6K 3QDKA 3G0ZA 1BCMA 1HX1A 2Q1NA 1BA1A 1TKTA 1YUWA 4DV7K 4JHDA 1I39A 4KKOA 1G15A 4KTWA 4KHSA 4CGJA 4OPJA 2W42A 1RDBA 1DGKN 4KO0A 3UKRB 3BF3A 4M3TA 2YX6A 4K41A 3LDPA 3QICA 1V4TA 1K8AO 5M1NA 2OZSA 3A8YA 4LY7A 1VQON 2W6LA 3K5MA 3SYZA 1UWBA 2LSNA 3EY1A 4OKKA 3S9HA 1S72N 5GIPA 1OH7A 3IUCA 5AQGA 3VQPA 3V9ZA 3CCVN 2Q3SA 3VQBA 5GAGP 1RGIA 3LL3A 1HNXK 3SMSA 3P5JA 1OH8A 4W5QA 3OS1A 3HTVA 4FJGA 3K9KA 3ULEA 4CJ3A 2P9UA 4DF4A 3QFUA 1GOAA 2YHYA 1T6DA 3PSIA 3RMAA 2O8FB 1GOBA 3GBTA 1RT5A 4F3OA 1GLFO 4PWDA 2BDPA 5T7BA 1JKHA 4BRCA 3ZEUB 3TABA 3K58A 1IKXA 1TUYA 5KQ8A 1Q81O 2NLXA 2XO7A 1CLQA 1YHQN 4JKDA 4DSLA 3ATUA 3A5LC 4FWSA 4MLEA 1RTIA 4DV4K 3OYIA 4NO7A 4CZKA 3LDNA 4H0XB 3IKMA 4DSIA 4JS4A 4DHYA 1UAXA 1Q82O 3V81A 5MLCQ 4L3QA 4MFBA 3OY9A 1NKCA 3UIQA 4BRDA 1TUUA 3P38A 4B9VA 2V7ZA 2UU9K 3P39A 4ILGB 3MXJA 1C1AA 2V52B 2E1ZA 4E89A 3QLHA 4C1NK 3U6FA 3AVIA 4F2SA 3VEVA 1E3MA 3AGKA 1YITN 4W5TA 3MX5A 1EETA 4W5OA 4LF8K 2PYJA 2D0OA 3KLHA 3HSTB 1KC8O 1KSPA 3CJ1A 3H46O 4DSEA 3MWPA 1U2VB 2HHWA 2KKZA 4FK2A 2P9LA 5J2MA 2XY6A 1KVAA 4OJRA 1NK5A 2QTDA 3THYA 2UYTA 3AV9A 1SS6A 1S9EA 3CF5L 1Z26A 2FSJA 4DR7K 1K9MO 3V9WA 4KB1A 1ILYA 3ZT4A 4CGGA 1I94K 3O80A 4FW2A 4CIFA 3G6EN 4OVLA 2G8HA 1NKBA 3OYKA 1SKWA 2JWLA 1HPMA 4BQLA 4CJSA 4WFAL 3TTFA 4KHPK 2QW9A 4EP5A 4YDUA 2O8EA 2IC3A 2HHSA 1VK0A 2FF6A 4AHCA 4YOVA 4B1ZA 2P5GA 1FW6A 4Q5VA 4DS4A 1WBBA 1YJNN 1NGCA 4F9OA 1U45A 5TKYA 3NH0A 3OBYA 4ID5A 3RMBA 2E2QA 3GG4A 4LF5K 1G99A 4M7XA 2OPPA 2YJFA 2NRHA 4O8UA 2YJEA 4DWIA 2D0BA 1YXQA 3ZT1A 3LDQA 4DS5A 4M42A 5AQWA 1NK4A 1M90O 3SUQA 5CYQA 4AM6A 4DG1A 1S1XA 3LPTA 4NLCA 4DR5K 4FLUA 4HTLA 4BRQA 5BN9A 3VEYA 4I6MB 1BDGA 4DSJA 4KHUA 1RTJA 1NNEA 4DU4A 4X64K 2P1JA 1GLJO 1RTDA 2W6KA 2HHQA 5EU7A 4L8RB 1HMVA 3UB5A 2A1SA 3AVCA 4BVPA 3M8RA 2A3ZA 4F8RA 2GX9A 3ID6A 1W0HA 3VQAA 4C8KA 3VETA 4CFAA 1VRTA 3LALA 3NVKA 3DI6A 5AZJA 4DR6K 3OYLA 3U9ZA 3K5NA 1VSLA 3A5MC 5AQHA 1OVQA 4H4OA 1TAUA 4E1MA 4N56A 2HVIA 2HHTA 3ENHA 5SWMA 3LP0A 4BE1A 1Z25A 3PO5A 3U4LA 3QEWA 3LWLA 3O08A 2Y1JA 2WBNA 3TPQA 1XC9A 1NU0A 2X74A 3HT3A 3GL1A 3DLLL 1NBWA 3RSEB 2R7YA 2BE2A 4DU1A 4AHVA 3PO4A 4OKJA 2Q36A 4CJEA 5J2PA 3CC4N 2PAVA 3VN5A 3M6GA 2VQEK 4NCBA 2VWKA 4M3WA 2B5JA 1VSJA 3NH1A 3FLCO 4FK4A 1T44A 2HHXA 3WT0A 4JHDB 3CYMA 4C8LA 4U7BA 3KK7A 1TYQA 4WQ4C 4CEBA 2ZJPL 2GUPA 3UKUA 4DR2K 5JMVA 4EIAA 3AO2A 5LMUK 4YY3K 3QEXA 3WXKA 2OYQA 4IWVA 2HBMA 4GY2B 4DQPA 2QKBA 3MMVA 3RRGA 1EP4A 4NYNA 1RT6A 2DFEA 4BRLA 3KVGA 5CR4A 1ZBUA 2HF3A 4JD2A 1XQSC 3NGIA 4B3RK 4DQIA 1U47A 2D4WA 3O4NA 3M1FA 1TL1A 3HVRA 4K8ZA 3D0PA 1YJ9N 1NJIO 3VOVA 4H5WA 4CFCA 1BU6O 3LDOA 4PY5A 4CD1A 3ULEB 2P9UB 4Z4GA 3LWMA 1X9JA 2F7TA 2F8TA 1HNZK 3ATVA 3P83D 1ZYQA 4FK0A 3WQTA 5H1SQ 1NKEA 1X3NA 4JI0K 4CVNE 1J6ZA 5GADP 2NRRA 4CD3A 4B1UB 5JLFA 4KPYA 2P9NB 3TSUA 4N41A 1QVFM 1UA0A 4CZLA 2OANA 1QTMA 4CJQA 4CF0A 1JCGA 5AQRA 2E1YA 3T1AA 3TSQA 4A62A 3BZKA 3AVAA 4YHHK 1LW2A 3PX6A 2XRIA 3K5LA 3J8AA 3V4IA 1NWKA 3SMPA 1QSYA 1C0FA 4JI6K 3CJ7A 4EAHD 2QKKA 2Z1GA 4DQSA 1U49A 3O3FA 4CI6A 1ATRA 3VENA 4JV5K 2YNGA 4CE9A 2ZGZA 1Q7YO 4KHWA 4GMJB 2WONA 1HYVA 3CFOA 4BR5A 3B6OA 1LWEA 2BH1A 2G8FA 4CFBA 3QBXA 4LF6K 4AQYK 1HKGA 3CJBA 3TSPA 1HLUA
chains in the Genus database with same CATH topology
1XNRK 3J7YP 4LF5K 4JI2K 2F4VK 2UXDK 1XMOK 4DV4K 4B3RK 2UUCK 5LL6Z 4X65K 1HR0K 4V19S 2UXBK 3J81O 3JAMO 2HHHK 4LF4K 4X62K 5A2QO 1N36K 5IT9O 1XMQK 4LFAK 4DR5K 4LF9K 4DUZK 1HNZK 4JI5K 2UU9K 4X64K 3OTOK 1HNWK 4JYAK 5LMNK 2UXCK 4DV0K 4DV6K 4JI0K 4B3MK 1XNQK 4CVNE 4DV3K 4LF8K 4DV7K 2ZM6K 4JI7K 4DR1K 1N34K 2UUBK 1IBKK 3J7AP 4LFBK 4DR6K 4LFCK 4GKJK 3T1YK 5AJ3K 4B3TK 5BR8K 4NXMK 4YHHK 1IBLK 1N33K 4GKKK 4DV2K 4JI8K 4JI4K 3J80O 4DR3K 4DR7K 4JI1K 5IWAK 1I94K 4JI6K 4JI3K 4B3SK 1N32K 5FLXO 1HNXK 1IBMK 2VQEK 4CW7B 2VQFK 1FJGK 4X66K 4LF7K 4JV5K 4DV1K 4DV5K 4K0KK 4KHPK 1J5EK 2E5LK 4DR4K 2UUAK 4NXNK 4DR2K 5LMUK 4YY3K 4LF6K 4AQYK 4OX9K 4DUYK 3T1HK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR K;  3J7Y P;  4LF5 K;  4JI2 K;  2F4V K;  2UXD K;  1XMO K;  4DV4 K;  4B3R K;  2UUC K;  5LL6 Z;  4X65 K;  1HR0 K;  4V19 S;  2UXB K;  3J81 O;  3JAM O;  2HHH K;  4LF4 K;  4X62 K;  5A2Q O;  1N36 K;  5IT9 O;  1XMQ K;  4LFA K;  4DR5 K;  4LF9 K;  4DUZ K;  1HNZ K;  4JI5 K;  2UU9 K;  4X64 K;  3OTO K;  1HNW K;  4JYA K;  5LMN K;  2UXC K;  4DV0 K;  4DV6 K;  4JI0 K;  4B3M K;  1XNQ K;  4CVN E;  4DV3 K;  4LF8 K;  4DV7 K;  2ZM6 K;  4JI7 K;  4DR1 K;  1N34 K;  2UUB K;  1IBK K;  3J7A P;  4LFB K;  4DR6 K;  4LFC K;  4GKJ K;  3T1Y K;  5AJ3 K;  4B3T K;  5BR8 K;  4NXM K;  4YHH K;  1IBL K;  1N33 K;  4GKK K;  4DV2 K;  4JI8 K;  4JI4 K;  3J80 O;  4DR3 K;  4DR7 K;  4JI1 K;  5IWA K;  1I94 K;  4JI6 K;  4JI3 K;  4B3S K;  1N32 K;  5FLX O;  1HNX K;  1IBM K;  2VQE K;  4CW7 B;  2VQF K;  1FJG K;  4X66 K;  4LF7 K;  4JV5 K;  4DV1 K;  4DV5 K;  4K0K K;  4KHP K;  1J5E K;  2E5L K;  4DR4 K;  2UUA K;  4NXN K;  4DR2 K;  5LMU K;  4YY3 K;  4LF6 K;  4AQY K;  4OX9 K;  4DUY K;  3T1H K; 
#chains in the Genus database with same CATH topology
 2OPQ A;  3THY B;  3OYD A;  4FM2 A;  4JKF A;  1GLD G;  4WQ5 C;  3WNE A;  1VQP N;  1U04 A;  1NGI A;  5AQQ A;  4BDZ A;  4FLV A;  2UUC K;  1NG9 A;  3WNG A;  4F3T A;  1D8Y A;  3S41 A;  3JS6 A;  2G8I A;  5EVZ A;  3KLI A;  5AQT A;  1TKZ A;  5ADX H;  1NMN A;  2AP1 A;  3RMD A;  2KHO A;  3ID8 A;  5LJV A;  3SUN A;  2O8C A;  1EX4 A;  3CQX A;  4DUZ K;  3LP1 A;  5E84 A;  4JKG A;  4WE1 A;  1ESV A;  2GEL A;  1CXU A;  3PX0 A;  3J7Z O;  2DFH A;  3VEX A;  5KPZ A;  3THX B;  4E7H A;  3EZW A;  4B3M K;  4IZ9 A;  5EXW A;  1XNQ K;  2Z1J A;  4JRQ A;  4DCH A;  5FPE A;  2JGU A;  1N34 K;  4IFV A;  4C1N I;  3L2V A;  4E1J A;  5AQF A;  1T03 A;  4R5P A;  1S9G A;  4BR4 A;  3IS9 A;  5AJ3 K;  4EZ9 A;  1VAZ A;  4BRF A;  4OGE A;  3TAF A;  1BG3 A;  1JJ2 M;  4CZH A;  1J54 A;  1HPZ A;  4C8N A;  2A1R A;  4GKK K;  4DV2 K;  2HMP A;  3GOI A;  1OH5 A;  4LSL A;  4CJ7 A;  1S5J A;  4IDK A;  4J2E A;  3PY8 A;  5M1F A;  1MA9 B;  3TR8 A;  3PIO L;  3H1V X;  4B3S K;  1BI4 A;  1ZBH A;  1N32 K;  5LY3 A;  3SJJ A;  3AVF A;  3SAG A;  1RDD A;  2QWQ A;  2PY5 A;  2E2O A;  1W97 L;  1N8R O;  3MWT A;  4BR0 A;  3DRS A;  3LP2 A;  3JYT A;  3B6P A;  3FZH A;  3TAQ A;  3CQ8 A;  2RHK A;  3LM9 A;  3SQ1 A;  2HW3 A;  3VF4 A;  4UQG A;  3G10 A;  4FLT A;  2XY8 A;  1RBU A;  4NYF A;  3HPH A;  3CG7 A;  1YTU A;  3O9S A;  3TWH A;  1YAG A;  1KAZ A;  3ZSV A;  1VHX A;  4CK3 A;  1IKW A;  1XNR K;  4XEI A;  1QS4 A;  4PKG A;  4FVU A;  1LW0 A;  1XMO K;  1ITG A;  4O5B A;  2YKM A;  4FWQ A;  3O1B A;  4M3U A;  3W0L A;  2F9W A;  4DTM A;  1TL3 A;  2GBZ A;  1J53 A;  4QS9 A;  3BZC A;  3C0B A;  5A2Q O;  1WSJ A;  2ZD1 A;  1LOT B;  4B8A B;  2DPN A;  3KZB A;  1O13 A;  4IOX A;  3NF9 A;  4K42 A;  3CPW M;  4H5N A;  1TYQ B;  5K14 A;  1VQ8 N;  3WEE A;  5BRF A;  1LAV A;  4FJ7 A;  4N47 A;  4DV0 K;  2V7Y A;  3E9O A;  3KWG A;  4B9L A;  4CBX A;  3EYZ A;  5EY4 A;  3VQ6 A;  2EWS A;  2VWJ A;  4CJR A;  1RNH A;  3M3Z A;  4C8M A;  3GDQ A;  1CZA N;  2E6L A;  2YHX A;  4KBO A;  5FDL A;  5CZ1 A;  4B9T A;  2D0P A;  5AZI A;  1RBT A;  4CEO A;  3DRR A;  3CCQ N;  2FC0 A;  3LDS A;  5JVH L;  3DLR A;  2NRZ A;  3IDH A;  1DLO A;  2ASO A;  3CJC A;  4B1V A;  4WF9 L;  3C95 A;  4B3O A;  5F0X A;  2ZE2 A;  1ZC6 A;  5AQN A;  4BG9 A;  1R0A A;  1KLM A;  4PL8 A;  1RDA A;  3SK3 A;  2B6A A;  3THW B;  4O4G A;  1EXQ A;  3P1G A;  5IWA K;  3QET A;  5C12 A;  1BQN A;  1ZBS A;  2JWK A;  3BY5 A;  3SPY A;  2Q97 A;  4DFM A;  5D3G A;  4LF7 K;  2YNF A;  3KK1 A;  2RKI A;  4FPA A;  3WXI A;  3K59 A;  4BWM A;  3DWL A;  1NMD A;  4QCL A;  4LD0 A;  1LV5 A;  4YOR A;  3QNN A;  3EZ5 A;  4PA1 A;  3DXM B;  3T1H K;  3AVH A;  5HBM A;  1BQM A;  1K8K A;  3SZ2 A;  3N4P A;  1O1W A;  2QK9 A;  2HBJ A;  1WOQ A;  1XI1 A;  3BF1 A;  1C0G A;  3KHY A;  5BPN A;  5ADX A;  1NK9 A;  2RN2 A;  1YJW N;  4CJ4 A;  3CIP A;  3HL8 A;  3F5T A;  4M3R A;  4PL7 A;  3CJ9 A;  5AFU H;  3F2K A;  2Z1I A;  3SLC A;  3QBW A;  2HMI A;  4BGB A;  5CE3 A;  1S1W A;  3KK3 A;  1EQY A;  4E7L A;  5J2Q A;  3OS2 A;  4FJN A;  3L2W A;  3VQQ A;  5DM7 L;  2V51 B;  2VYP A;  3BDP A;  3H3N O;  4B1X B;  2YNI A;  1VSH A;  3MX2 A;  1NGD A;  4JLH A;  2IAJ A;  2ZQB A;  4CHY A;  3VQ4 A;  3CCE N;  4ISF A;  1Q9Y A;  4IKF A;  3HZ6 A;  3AA2 A;  4CK1 A;  3EN9 A;  1T8E A;  3SQ2 A;  4Z4F A;  5CYM A;  3AA5 X;  3NGZ A;  1W9H A;  4IXC A;  3AAR A;  4J2B A;  5LJW A;  1JXE A;  1MWM A;  4BGA A;  2XHB A;  3NFA A;  3ULD A;  5C25 A;  3OW2 M;  2NRV A;  3EO3 A;  3C6T A;  3VQE A;  2CH6 A;  1BIU A;  2O8C B;  2KW4 A;  4B9S A;  3CME N;  4JI1 K;  1VQL N;  4ISE A;  1TKX A;  1NLV A;  4HCC A;  1A5V A;  3E66 A;  5AQO A;  2IS3 A;  3K0S A;  3TU5 A;  1EWR A;  3TTD A;  2A5X A;  2VQF K;  5BRH A;  3HP6 A;  1KTQ A;  4DV5 K;  5BN8 A;  3OBW A;  4ZTJ A;  4BRO A;  2WOM A;  4MLH A;  2FBY A;  2I7P A;  2PZS A;  3BEX A;  3MN7 A;  4IEE A;  3NF7 A;  1L3S A;  1C1C A;  1WLJ A;  3T7Z A;  3KWI A;  4IFE A;  3OYC A;  4CZI A;  2P9S A;  3OHR A;  2FSN A;  1TAQ A;  1R59 O;  1S1V A;  3HXM A;  1S1U A;  5M1P A;  3CFR A;  3OJS A;  3VQ7 A;  4FL9 A;  4FLZ A;  5AQI A;  4LC9 B;  4V19 S;  1D4X A;  3ALY A;  2ETJ A;  1U48 A;  3VEZ A;  3D2F A;  2ATQ A;  2QI2 A;  1C6V A;  1JLA A;  3M5R A;  3SBG A;  3WXL A;  5I3U A;  1W2B M;  4GV9 A;  4CGI A;  2P9I A;  1FKP A;  5BPL A;  1BA0 A;  1IH7 A;  3SUO A;  1RT3 A;  2FBV A;  5AQL A;  4EZ6 A;  4NCA A;  2HB5 A;  1BCO A;  1VQM N;  2P9P A;  4K43 A;  1NK6 A;  4PKH A;  3ZET A;  4JI7 K;  2NNW A;  4IBN A;  4CZF A;  3HOT A;  4FJ8 A;  4H8K A;  3A0I X;  4BRE A;  4GW6 A;  1YVN A;  5EOY A;  1FKO A;  5BR8 K;  1TGO A;  1WSI A;  2VG6 A;  4FJ9 A;  3CFP A;  4KTZ A;  2I5J A;  1A5X A;  3I0R A;  3KD5 E;  4BQZ A;  4J8F A;  3OYB A;  5B8H A;  4IJA A;  2ZJR L;  1X9W A;  1S22 A;  2Z1H A;  1NGA A;  4RW6 A;  3WEE B;  4FWP A;  3O8M A;  3OA9 A;  4CF2 A;  1ZBL A;  3OS0 A;  1U4B A;  3ZT2 A;  3FR0 A;  3CMA N;  1QSS A;  1JLE A;  3CC2 N;  1X9M A;  3O1W A;  1KAY A;  3C7N A;  5AQJ A;  1Q18 A;  1RT4 A;  2RE2 A;  3FE1 A;  4BE2 A;  4KH6 A;  3KD1 E;  4GV6 A;  1E4F T;  3EKU A;  2GWJ A;  3O6W A;  1RFQ A;  1CZB A;  2E5L K;  4A5A A;  5GAH P;  3A5O C;  4NXN K;  3OVN A;  2G8V A;  2NUB A;  4DTR A;  1HJO A;  5AZI B;  1JLB A;  5KPT A;  4UY8 O;  4CZM A;  1RBS A;  5BRD A;  3O3H A;  4M45 A;  5C24 A;  5HP1 A;  1TK0 A;  1RDC A;  3VQC A;  3ZT3 A;  1N5Y A;  4B9Q A;  4H0V B;  5AFU A;  4FZZ A;  3WNF A;  1HJR A;  2YI1 A;  4CES A;  4A2B A;  3DLK A;  3CC7 N;  2UXB K;  5DMR A;  4BC2 A;  1JCE A;  4CER A;  3O4Q A;  4R79 A;  3JAM O;  4DB3 A;  3TI0 A;  3NVM A;  1SZ2 A;  3HM8 A;  3CCM N;  3E9L A;  1VQK N;  2PYL A;  3DLB A;  4JKH A;  1S6Q A;  4HHT A;  4JI5 K;  4QS8 A;  4XH4 A;  4PUO A;  3KIO A;  3CCJ N;  4EHU A;  4KV8 A;  4GVM A;  3LZJ A;  4YDU C;  3T19 A;  4FJJ A;  1SUQ A;  3HYF A;  2KQ2 A;  4NCG A;  1EKE A;  1FK9 A;  1VQ9 N;  1S6P A;  4TSX A;  2B4J A;  4MO4 A;  4A59 A;  4PHT X;  1VSF A;  3AO3 A;  4LFC K;  4GKJ K;  2F8S A;  1K73 O;  5SZT A;  1BHL A;  4YOW A;  1D9F A;  5C15 A;  1X3M A;  4FOE A;  3QO9 A;  3SAH A;  4O0I A;  5DK5 A;  3O5B A;  2QWO A;  3HBT A;  4JI4 K;  4CEE A;  2O8D A;  3AO5 A;  3CXC M;  4XH5 A;  4CHP A;  2HF4 A;  4OPH A;  4CBW A;  1TK8 A;  4JI3 K;  4JK8 A;  2HHV A;  4DTN A;  1VRU A;  4CW7 B;  4IJN A;  3MN9 A;  3SV3 A;  1QVG M;  4DV1 K;  1SKR A;  4Y1C A;  3KKS A;  3AVJ A;  3KLE A;  1HRH A;  2Q0R A;  4IDH A;  3VA0 A;  3ZX0 A;  2ZF5 O;  3HJF A;  2GWK A;  3S3M A;  4PQU A;  2WFB A;  3VES A;  4XIU A;  1H1V A;  4G1Q A;  1MU2 A;  3OJU A;  4IFY A;  1JLC A;  5KRS A;  4H0Y B;  4JAX A;  2GTD A;  5KRT A;  4RW4 A;  4FO0 A;  3Q7B A;  3HRG A;  4FJL A;  1RT2 A;  3CCS N;  5FRM A;  4I2Q A;  4Y1D A;  4AHR A;  3HSC A;  3V6D A;  1P90 A;  4JRP A;  3MXM A;  4E7J A;  3VQ5 A;  3C65 A;  1KD1 O;  3KLF A;  5FPN A;  1QQM A;  2O8F A;  5AQK A;  1UOC A;  1T7P A;  1VSE A;  2FLO A;  4O0J A;  1HUX A;  2P9L B;  5JS2 A;  4Z94 A;  3V9S A;  5J2N A;  1XMQ K;  2YV0 X;  4MDB A;  1YT3 A;  2HNY A;  4CBU A;  5J1E A;  4A57 A;  1NJX A;  3CCR N;  3L6Q A;  3RR7 A;  4E1N A;  2XY7 A;  3KK2 A;  5BRE A;  3ZX2 A;  2QXL A;  4BDY A;  3E9P A;  3F73 A;  3KTQ A;  3RVC A;  2A40 A;  2P9S B;  1LAW A;  3NH2 A;  1NOZ A;  3LM2 A;  5HRP A;  1GLB G;  4DFK A;  4W5R A;  4HUG A;  3HM9 A;  2X6S A;  2QWL A;  1X9S A;  3J7A P;  4FXD A;  3T1Y K;  4ZHR A;  3U3Y A;  2O8E B;  3H6E A;  2HBL A;  1GLC G;  3QER A;  4GNI A;  3NCI A;  4KRE A;  2O4I A;  3D2F B;  3EKS A;  1ASW A;  3VQ8 A;  3PV8 A;  4DTU A;  1DT9 A;  3DLE A;  4BG8 A;  2FBX A;  1Y64 A;  3U8X A;  3TAP A;  3ZSQ A;  2YKN A;  4IO9 L;  4MDA A;  4CEQ A;  5C10 A;  2P9I B;  4YOY A;  4DLG A;  3PX4 A;  4CGF A;  3HP9 A;  3L4Q A;  3TAM A;  3D6R A;  4CGH A;  3V9U A;  2QA4 N;  4B9N A;  1JLQ A;  3FZK A;  4JKE A;  3V1O A;  2E2P A;  4MQ3 A;  3MEG A;  1Q8I A;  5C42 A;  3ZET B;  4CJV A;  3WXJ A;  4IG0 A;  1IO2 A;  1U2V A;  3CJA A;  5JS1 A;  3I8D A;  1KFS A;  4BY9 C;  3HPG A;  1BUP A;  4DTS A;  1KAX A;  1Y97 A;  1ASU A;  4KHQ A;  1WUA A;  5KGW A;  4O55 A;  3ZX3 A;  3A2F A;  4DUY K;  4JKB A;  1VQ6 N;  1NJZ A;  1WNS A;  3VF2 A;  5FRO A;  4DQQ A;  3CM5 A;  4CIG A;  4DFP A;  4OPA A;  4AIL C;  3SPZ A;  2CGL A;  2P9K A;  3C6H A;  2OZM A;  5ELZ A;  4FWM A;  2PBD A;  4HVJ A;  4H0T B;  4BC3 A;  1SV5 A;  5AZJ B;  4BRN A;  3K57 A;  4FLW A;  4LF4 K;  1K6Y A;  3L3U A;  4KI6 A;  2HST A;  4NLB A;  5KPR A;  4OPK A;  1YI2 N;  3ZYY X;  4KH5 A;  3EEQ A;  1HNV A;  4E7K A;  2P5O A;  4CGD A;  3VER A;  5GAE P;  4M41 A;  3ENO A;  1ZXO A;  3AVN A;  4F2R A;  3THV A;  4DV3 K;  5AQU A;  4FSV A;  2VG7 A;  5KTQ A;  2QEX N;  4KHN A;  3D7E O;  3NDK A;  1ATS A;  3ZLJ A;  1IBK K;  3MDQ A;  2HND A;  3CM6 A;  3O9T A;  4IOA L;  2BUP A;  3L2R A;  1GLL O;  4FLY A;  4BVO A;  3KLG A;  4FWO A;  3UKU B;  2VCP A;  2EHG A;  3UE5 A;  1XHZ A;  3L2Q A;  1KRP A;  4FZX C;  5GIO A;  3K9J A;  4I6M A;  3I55 N;  3MN6 A;  3AA3 A;  4BE0 A;  4DR3 K;  3NMU A;  4QS7 A;  4DKW A;  3SJH A;  3DXK A;  1MDU B;  3Q7C A;  4JD2 B;  3ENB A;  2KFN A;  1RTH A;  4DF8 A;  1NK8 A;  3VPZ A;  1DTQ A;  3QIN A;  1RBR A;  4KFB A;  3ITH A;  3MED A;  4LH5 A;  1KFD A;  3S3O A;  3KJV A;  3AVL A;  2KLA A;  3QNO A;  4FJI A;  2XY5 A;  2OPR A;  4MO5 A;  4E19 A;  3FGU A;  4GV3 A;  2NZT A;  2FSK A;  4RTF D;  3BP8 A;  1QZ6 A;  2P51 A;  3AVB A;  3OYJ A;  3EE8 A;  3D2E A;  1WBD A;  4N5S A;  4H5T A;  3CD6 N;  3AAP A;  3HPO A;  1SQK A;  3KKR A;  3SBT A;  4CED A;  1RCH A;  3ZSW A;  1NGF A;  1HQE A;  4BRH A;  2JLE A;  5LL6 Z;  2WC9 A;  4C8O A;  2KTQ A;  5KGX A;  4KH4 A;  1VSI A;  3I0S A;  3OYH A;  4ELT A;  5DM6 L;  2ZJQ L;  4X62 K;  4FM1 A;  4LFA K;  4KI4 A;  4H4M A;  4CJK A;  4BRG A;  3AY9 A;  3O4W A;  1WSG A;  3AO1 A;  3R9P A;  3C6A A;  1VQ7 N;  2YHB A;  1IG8 A;  4JYA K;  4JEP A;  4PKI A;  1SKS A;  1SL1 A;  2IIR A;  1SL2 A;  3MCP A;  1HKC A;  3AVK A;  3T3F A;  1T05 A;  4JS5 A;  4Z0U A;  3MXI A;  2GUI A;  4QOZ B;  2UUB K;  2O4G A;  3NHG A;  2QXF A;  3VF6 A;  1C0U A;  2QWN A;  1WAF A;  5HLF A;  4B3T K;  3R3L A;  4AF1 A;  3FZL A;  2A6A A;  4DSK A;  3T69 A;  1IBL K;  2E88 A;  3L0Q A;  3A5N C;  1Z6R A;  4GVE A;  5M1O A;  1NK0 A;  3LAM A;  1VQN N;  1W7A A;  4FM0 A;  2CGJ A;  4Z4E A;  1JCF A;  4AHS A;  5AQV A;  3I56 N;  3HI0 A;  4CJL A;  1RDU A;  3QIO A;  3WUH A;  3LAN A;  1SAZ A;  4CJW A;  4CJP A;  1KCF A;  4BAC A;  3V1R A;  4DLE A;  2P9N A;  4JK7 A;  1BO5 O;  3ISN C;  1KVB A;  1FJG K;  2VGM A;  3IAY A;  4I9Q A;  4K0K K;  3D45 A;  3QIP A;  4CJU A;  1LWC A;  4CJ5 A;  3I8B A;  3MK6 A;  3DLG A;  4E7I A;  3BGR A;  3G71 N;  3MEC A;  1RBV A;  3R1X A;  2KZZ A;  4NB4 A;  2WUS A;  2E4L A;  3RTV A;  4BRA A;  4Z4H A;  5HRO A;  4JKG B;  3TTC A;  3CET A;  4Z4I A;  3FFI A;  1ZBI A;  3VTI A;  4BR2 A;  1QQC A;  4ELU A;  3PLA A;  4CZE A;  4H03 B;  3VEW A;  3DYA A;  5E26 A;  2Q2R A;  2G8K A;  5TKW A;  3AVM A;  1NK7 A;  5JIC A;  3AA4 A;  3VEO A;  3AAQ A;  4X65 K;  5AQY A;  5GIN A;  4YFU A;  3O3G A;  1D5A A;  5HRR A;  1HKB A;  4B8C A;  4EP4 A;  4B08 A;  2KZM A;  2D5R A;  1QSL A;  1JL1 A;  1ASV A;  4WYB A;  2FXU A;  5IT9 O;  3K2P A;  4HWI A;  4LF9 K;  3EL2 A;  4OGC A;  5E41 A;  2ITG A;  2OCE A;  1J9A A;  1YF5 L;  3ZSY A;  2OTJ N;  5C0Y A;  1ATN A;  2G8U A;  4ISG A;  2E6M A;  4WQ4 A;  3LPU A;  1BI4 B;  1JL2 A;  3ZSZ A;  5HOO A;  2ZM6 K;  2AA4 A;  3WXM B;  3M8S A;  4CF8 A;  4G9Z A;  4DMN A;  5FPD A;  2IVN A;  4E0D A;  3M8P A;  2P9K B;  2GV9 A;  3L8B A;  4W5N A;  2O8B A;  1QQN A;  4H5V A;  4RG8 A;  4ID1 A;  5AR0 A;  1DKG D;  1JXB A;  4E3S A;  4BWJ A;  1A5W A;  2YCH A;  4IG3 A;  1Q86 O;  2RPI A;  4FW1 A;  4HTU A;  3NE6 A;  3L2U A;  1F21 A;  2DY4 A;  2NRT A;  4Y0W A;  5I42 A;  4M7Y A;  3K5O A;  3G4S N;  3THX A;  2HOE A;  5AQX A;  3VGL A;  3DM2 A;  1Q9X A;  2ZGY A;  4IO8 A;  1GLE G;  3CPE A;  3PIP L;  1RT7 A;  3O9U A;  3IFR A;  2D1K A;  1E4G T;  3R8E A;  4M63 C;  4X66 K;  4OO1 J;  4OLA A;  1IG9 A;  2KFZ A;  3OYA A;  2E2N A;  3EE9 A;  4CZJ A;  2BTF A;  4O5F A;  3VQD A;  2AJQ A;  1D9D A;  1LWF A;  4CHZ A;  1BOT O;  4H0O A;  3QES A;  4O44 A;  3TAE A;  1C0T A;  4CHO A;  3RRH A;  4JI2 K;  5CY4 A;  2UXD K;  1T6C A;  3H45 C;  5AQZ A;  1VSM A;  4FJ5 A;  3DXK B;  4KHY A;  3SNN A;  4CEA A;  1HR0 K;  2VWB A;  4HCB A;  3CER A;  5HL7 L;  4K8X A;  1NGJ A;  3LZI A;  1OH6 A;  2IOC A;  2HVH A;  3TAN A;  4QAG A;  3OYN A;  1IKY A;  1C1B A;  3CCL N;  3W3D A;  1TKD A;  5CZ2 A;  1T3V A;  1HYS A;  1NGE A;  1NJW A;  3LAK A;  3VA3 A;  3OTO K;  1TV6 A;  4FPB A;  1HNW K;  3DMJ A;  4DQ8 A;  5AQS A;  3QEV A;  1WSF A;  4FWR A;  1XC3 A;  3H3O B;  4BC4 A;  4BR7 A;  4JK9 A;  2NRX A;  1RDW X;  2GEM A;  2I7N A;  4WCE L;  4B9U A;  3D2E B;  1ZBF A;  5JLH A;  1N6Q A;  1S1T A;  2YNH A;  4LFB K;  2BAN A;  1TK5 A;  1HQU A;  2YHW A;  4CIE A;  3TAR A;  4WQ5 A;  1XHX A;  5F1X A;  2FBT A;  4Q0B A;  2Y1I A;  4M3Z A;  3F9M A;  5C2D A;  1WSE A;  1QHT A;  1B9F A;  3ZSO A;  1K8K B;  1SL0 A;  3HVT A;  3QB0 A;  4YOX A;  2WTU A;  1V4S A;  3SCX A;  4KRF A;  5F2R A;  4DU3 A;  1OKJ A;  3E1Y A;  3NGY A;  3MAQ A;  4JKC A;  4J2A A;  2W41 A;  3JSM A;  1L3T A;  3QEP A;  2QM1 A;  3IRX A;  4DR4 K;  2IVO A;  3AVG A;  2ITM A;  4RWT A;  3N4Q A;  3OYM A;  3OYG A;  3V1Q A;  4HUE A;  1BIS A;  3FFK B;  1YVU A;  1WAJ A;  2YHA A;  4H0P A;  5AQM A;  3PSF A;  1BGX T;  3ASM A;  1YTA A;  3CCU N;  4CHN A;  3RMC A;  3THW A;  4RCH A;  2F4V K;  3HK2 A;  3LP3 A;  1L5U A;  1BWF O;  3BUZ B;  4CJT A;  4A61 A;  1LCU A;  2PFU A;  4I2P A;  3UKR A;  1MWK A;  4RW8 A;  4DTJ A;  1JLG A;  3RR8 A;  1BL3 A;  3IG1 A;  2CH5 A;  4HUF A;  4FWN A;  3TAG A;  2HHH K;  1N36 K;  3M8Q A;  4DFJ A;  3QFP A;  4C23 A;  1NGG A;  3NF8 A;  4Z4C A;  2FF3 B;  2HHU A;  3U3G A;  1UA1 A;  4DQR A;  2CGK A;  4FJX A;  1QQO A;  1YIJ N;  3DXM A;  4FLX A;  3R6M A;  4CEZ A;  4FOI A;  1X1P A;  3P4I A;  4AH9 A;  4FVM A;  1VQ5 N;  4A2A A;  5BR9 A;  4YNQ A;  3HOS A;  1Z05 A;  4AHT A;  3L4I A;  4DTO A;  3OYE A;  2BGG A;  3F9K A;  1KLN A;  4FZY A;  3ZSR A;  4BRI A;  4RW7 A;  1JLF A;  4EHT A;  3CHW A;  4U67 L;  5C2F A;  2A42 A;  3IMX A;  4NXM K;  3I33 A;  3C94 A;  3ZEU A;  2DTU A;  1OVY A;  1KVC A;  1EO1 A;  2X6N A;  1N33 K;  4EFH A;  1U6Z A;  4LSN A;  4JI8 K;  4CEF A;  3J80 O;  3PUF A;  4I7F A;  3DJC A;  4YOT A;  2F96 A;  1TVR A;  1J5O A;  4ILJ A;  5JVG L;  2ZWH A;  3O9R A;  5FLX O;  1IBM K;  1CZ9 A;  1B9D A;  3SI6 A;  4JN4 A;  3L3V A;  4JNE A;  5HRN A;  3FZM A;  4LH4 A;  4BRK A;  1IKV A;  4H5R A;  1WN7 A;  4JKA A;  4B1W B;  1VSD A;  1FXX A;  2IVP A;  1HYZ A;  2UUA K;  2HBK A;  3VQ9 A;  3O9Q A;  3AGR A;  4IOC L;  3U9D A;  3WQU A;  2O8B B;  5M1K A;  4I9L A;  4CHQ A;  3DLH A;  1XWL A;  3DOL A;  4OX9 K;  2E8A A;  4AM7 A;  1EWQ A;  1RIL A;  4BR9 A;  3QEI A;  1GLA G;  3SV4 A;  2P9P B;  3DOK A;  1XUP O;  4CFD A;  1M1K O;  4M3X A;  1NGB A;  2F9T A;  1IJJ A;  3GE1 A;  4B9M A;  5KQD A;  3JXU A;  3ZSX A;  3CI5 A;  3SAF A;  4FJH A;  3ZCM A;  4BC5 A;  4XH1 A;  2VGN A;  2OA8 A;  3WNH A;  1NGH A;  3MCA B;  3SUP A;  3HO1 A;  4OKE A;  3VTH A;  1VQ4 N;  3B8A X;  1DEJ A;  4FWL A;  3OYF A;  3ZT0 A;  1GOC A;  1WSH A;  1I3A A;  4BRP A;  3DRP A;  1REV A;  3G25 A;  5LMN K;  4ILH A;  2E20 A;  1WB9 A;  4KTQ A;  2HNZ A;  2IDO A;  3MN5 A;  3E01 A;  4YOU A;  2D0A A;  2W40 A;  4DTP A;  4DR1 K;  3VGK A;  4BDP A;  3LDL A;  1L3V A;  3C7N B;  5I9E B;  3AO4 A;  4CCH A;  4CEC A;  3CQY A;  3VMF B;  1HNI A;  2QWR A;  5HRS A;  4ZTF A;  1IV0 A;  5BPM A;  2Q0U A;  4CF1 A;  4O8K A;  4KAZ A;  3DAW A;  3H1Q A;  1KXP A;  4BRM A;  2QWP A;  2EX3 A;  4CK2 A;  1RT1 A;  5KI6 A;  1QE1 A;  4ELV A;  4KB0 A;  3NBP A;  2VG5 A;  2X78 A;  3H08 A;  1L3U A;  4RW9 A;  4DSF A;  3SQ4 A;  5EX5 A;  4FWK A;  4ICL A;  4CF9 A;  1QHA A;  4OLB A;  1QZ5 A;  2G8W A;  2D0C A;  4F4K A;  2OTL N;  4FCY A;  3P31 A;  3SQ0 A;  2RF2 A;  1J5E K;  4N76 A;  1DTT A;  3QML A;  3RWU A;  1C0M A;  5CHI A;  4WFN L;  3VGM A;  4A5B A;  2IGI A;  4K25 A;  3NAE A;  1NM1 A;  3J7Y P;  3FZF A;  5FPM A;  4CJF A;  5AQP A;  4WFB L;  4J2D A;  3S3N A;  2DFF A;  4IEI A;  1P8Z A;  2ASP A;  4FJM A;  2ASM A;  3V9X A;  2Q31 A;  3C6U A;  2QWM A;  2OPS A;  3J81 O;  1NJY A;  5FRN A;  2H3G X;  1VSK A;  2J4R A;  3MEE A;  1CXQ A;  1NOY A;  4M3Y A;  4FYD A;  3NF6 A;  1KQS M;  4DTX A;  1B92 A;  3RSE A;  2O8D B;  4B1Y B;  2A41 A;  2NRW A;  4AHU A;  1BIZ A;  1S3X A;  5M1Q A;  2UXC K;  4CZG A;  4FJK A;  4DV6 K;  3QDK A;  3G0Z A;  1BCM A;  1HX1 A;  2Q1N A;  1BA1 A;  1TKT A;  1YUW A;  4DV7 K;  4JHD A;  1I39 A;  4KKO A;  1G15 A;  4KTW A;  4KHS A;  4CGJ A;  4OPJ A;  2W42 A;  1RDB A;  1DGK N;  4KO0 A;  3UKR B;  3BF3 A;  4M3T A;  2YX6 A;  4K41 A;  3LDP A;  3QIC A;  1V4T A;  1K8A O;  5M1N A;  2OZS A;  3A8Y A;  4LY7 A;  1VQO N;  2W6L A;  3K5M A;  3SYZ A;  1UWB A;  2LSN A;  3EY1 A;  4OKK A;  3S9H A;  1S72 N;  5GIP A;  1OH7 A;  3IUC A;  5AQG A;  3VQP A;  3V9Z A;  3CCV N;  2Q3S A;  3VQB A;  5GAG P;  1RGI A;  3LL3 A;  1HNX K;  3SMS A;  3P5J A;  1OH8 A;  4W5Q A;  3OS1 A;  3HTV A;  4FJG A;  3K9K A;  3ULE A;  4CJ3 A;  2P9U A;  4DF4 A;  3QFU A;  1GOA A;  2YHY A;  1T6D A;  3PSI A;  3RMA A;  2O8F B;  1GOB A;  3GBT A;  1RT5 A;  4F3O A;  1GLF O;  4PWD A;  2BDP A;  5T7B A;  1JKH A;  4BRC A;  3ZEU B;  3TAB A;  3K58 A;  1IKX A;  1TUY A;  5KQ8 A;  1Q81 O;  2NLX A;  2XO7 A;  1CLQ A;  1YHQ N;  4JKD A;  4DSL A;  3ATU A;  3A5L C;  4FWS A;  4MLE A;  1RTI A;  4DV4 K;  3OYI A;  4NO7 A;  4CZK A;  3LDN A;  4H0X B;  3IKM A;  4DSI A;  4JS4 A;  4DHY A;  1UAX A;  1Q82 O;  3V81 A;  5MLC Q;  4L3Q A;  4MFB A;  3OY9 A;  1NKC A;  3UIQ A;  4BRD A;  1TUU A;  3P38 A;  4B9V A;  2V7Z A;  2UU9 K;  3P39 A;  4ILG B;  3MXJ A;  1C1A A;  2V52 B;  2E1Z A;  4E89 A;  3QLH A;  4C1N K;  3U6F A;  3AVI A;  4F2S A;  3VEV A;  1E3M A;  3AGK A;  1YIT N;  4W5T A;  3MX5 A;  1EET A;  4W5O A;  4LF8 K;  2PYJ A;  2D0O A;  3KLH A;  3HST B;  1KC8 O;  1KSP A;  3CJ1 A;  3H46 O;  4DSE A;  3MWP A;  1U2V B;  2HHW A;  2KKZ A;  4FK2 A;  2P9L A;  5J2M A;  2XY6 A;  1KVA A;  4OJR A;  1NK5 A;  2QTD A;  3THY A;  2UYT A;  3AV9 A;  1SS6 A;  1S9E A;  3CF5 L;  1Z26 A;  2FSJ A;  4DR7 K;  1K9M O;  3V9W A;  4KB1 A;  1ILY A;  3ZT4 A;  4CGG A;  1I94 K;  3O80 A;  4FW2 A;  4CIF A;  3G6E N;  4OVL A;  2G8H A;  1NKB A;  3OYK A;  1SKW A;  2JWL A;  1HPM A;  4BQL A;  4CJS A;  4WFA L;  3TTF A;  4KHP K;  2QW9 A;  4EP5 A;  4YDU A;  2O8E A;  2IC3 A;  2HHS A;  1VK0 A;  2FF6 A;  4AHC A;  4YOV A;  4B1Z A;  2P5G A;  1FW6 A;  4Q5V A;  4DS4 A;  1WBB A;  1YJN N;  1NGC A;  4F9O A;  1U45 A;  5TKY A;  3NH0 A;  3OBY A;  4ID5 A;  3RMB A;  2E2Q A;  3GG4 A;  4LF5 K;  1G99 A;  4M7X A;  2OPP A;  2YJF A;  2NRH A;  4O8U A;  2YJE A;  4DWI A;  2D0B A;  1YXQ A;  3ZT1 A;  3LDQ A;  4DS5 A;  4M42 A;  5AQW A;  1NK4 A;  1M90 O;  3SUQ A;  5CYQ A;  4AM6 A;  4DG1 A;  1S1X A;  3LPT A;  4NLC A;  4DR5 K;  4FLU A;  4HTL A;  4BRQ A;  5BN9 A;  3VEY A;  4I6M B;  1BDG A;  4DSJ A;  4KHU A;  1RTJ A;  1NNE A;  4DU4 A;  4X64 K;  2P1J A;  1GLJ O;  1RTD A;  2W6K A;  2HHQ A;  5EU7 A;  4L8R B;  1HMV A;  3UB5 A;  2A1S A;  3AVC A;  4BVP A;  3M8R A;  2A3Z A;  4F8R A;  2GX9 A;  3ID6 A;  1W0H A;  3VQA A;  4C8K A;  3VET A;  4CFA A;  1VRT A;  3LAL A;  3NVK A;  3DI6 A;  5AZJ A;  4DR6 K;  3OYL A;  3U9Z A;  3K5N A;  1VSL A;  3A5M C;  5AQH A;  1OVQ A;  4H4O A;  1TAU A;  4E1M A;  4N56 A;  2HVI A;  2HHT A;  3ENH A;  5SWM A;  3LP0 A;  4BE1 A;  1Z25 A;  3PO5 A;  3U4L A;  3QEW A;  3LWL A;  3O08 A;  2Y1J A;  2WBN A;  3TPQ A;  1XC9 A;  1NU0 A;  2X74 A;  3HT3 A;  3GL1 A;  3DLL L;  1NBW A;  3RSE B;  2R7Y A;  2BE2 A;  4DU1 A;  4AHV A;  3PO4 A;  4OKJ A;  2Q36 A;  4CJE A;  5J2P A;  3CC4 N;  2PAV A;  3VN5 A;  3M6G A;  2VQE K;  4NCB A;  2VWK A;  4M3W A;  2B5J A;  1VSJ A;  3NH1 A;  3FLC O;  4FK4 A;  1T44 A;  2HHX A;  3WT0 A;  4JHD B;  3CYM A;  4C8L A;  4U7B A;  3KK7 A;  1TYQ A;  4WQ4 C;  4CEB A;  2ZJP L;  2GUP A;  3UKU A;  4DR2 K;  5JMV A;  4EIA A;  3AO2 A;  5LMU K;  4YY3 K;  3QEX A;  3WXK A;  2OYQ A;  4IWV A;  2HBM A;  4GY2 B;  4DQP A;  2QKB A;  3MMV A;  3RRG A;  1EP4 A;  4NYN A;  1RT6 A;  2DFE A;  4BRL A;  3KVG A;  5CR4 A;  1ZBU A;  2HF3 A;  4JD2 A;  1XQS C;  3NGI A;  4B3R K;  4DQI A;  1U47 A;  2D4W A;  3O4N A;  3M1F A;  1TL1 A;  3HVR A;  4K8Z A;  3D0P A;  1YJ9 N;  1NJI O;  3VOV A;  4H5W A;  4CFC A;  1BU6 O;  3LDO A;  4PY5 A;  4CD1 A;  3ULE B;  2P9U B;  4Z4G A;  3LWM A;  1X9J A;  2F7T A;  2F8T A;  1HNZ K;  3ATV A;  3P83 D;  1ZYQ A;  4FK0 A;  3WQT A;  5H1S Q;  1NKE A;  1X3N A;  4JI0 K;  4CVN E;  1J6Z A;  5GAD P;  2NRR A;  4CD3 A;  4B1U B;  5JLF A;  4KPY A;  2P9N B;  3TSU A;  4N41 A;  1QVF M;  1UA0 A;  4CZL A;  2OAN A;  1QTM A;  4CJQ A;  4CF0 A;  1JCG A;  5AQR A;  2E1Y A;  3T1A A;  3TSQ A;  4A62 A;  3BZK A;  3AVA A;  4YHH K;  1LW2 A;  3PX6 A;  2XRI A;  3K5L A;  3J8A A;  3V4I A;  1NWK A;  3SMP A;  1QSY A;  1C0F A;  4JI6 K;  3CJ7 A;  4EAH D;  2QKK A;  2Z1G A;  4DQS A;  1U49 A;  3O3F A;  4CI6 A;  1ATR A;  3VEN A;  4JV5 K;  2YNG A;  4CE9 A;  2ZGZ A;  1Q7Y O;  4KHW A;  4GMJ B;  2WON A;  1HYV A;  3CFO A;  4BR5 A;  3B6O A;  1LWE A;  2BH1 A;  2G8F A;  4CFB A;  3QBX A;  4LF6 K;  4AQY K;  1HKG A;  3CJB A;  3TSP A;  1HLU A; 
#chains in the Genus database with same CATH homology
 1XNR K;  3J7Y P;  4LF5 K;  4JI2 K;  2F4V K;  2UXD K;  1XMO K;  4DV4 K;  4B3R K;  2UUC K;  5LL6 Z;  4X65 K;  1HR0 K;  4V19 S;  2UXB K;  3J81 O;  3JAM O;  2HHH K;  4LF4 K;  4X62 K;  5A2Q O;  1N36 K;  5IT9 O;  1XMQ K;  4LFA K;  4DR5 K;  4LF9 K;  4DUZ K;  1HNZ K;  4JI5 K;  2UU9 K;  4X64 K;  3OTO K;  1HNW K;  4JYA K;  5LMN K;  2UXC K;  4DV0 K;  4DV6 K;  4JI0 K;  4B3M K;  1XNQ K;  4CVN E;  4DV3 K;  4LF8 K;  4DV7 K;  2ZM6 K;  4JI7 K;  4DR1 K;  1N34 K;  2UUB K;  1IBK K;  3J7A P;  4LFB K;  4DR6 K;  4LFC K;  4GKJ K;  3T1Y K;  5AJ3 K;  4B3T K;  5BR8 K;  4NXM K;  4YHH K;  1IBL K;  1N33 K;  4GKK K;  4DV2 K;  4JI8 K;  4JI4 K;  3J80 O;  4DR3 K;  4DR7 K;  4JI1 K;  5IWA K;  1I94 K;  4JI6 K;  4JI3 K;  4B3S K;  1N32 K;  5FLX O;  1HNX K;  1IBM K;  2VQE K;  4CW7 B;  2VQF K;  1FJG K;  4X66 K;  4LF7 K;  4JV5 K;  4DV1 K;  4DV5 K;  4K0K K;  4KHP K;  1J5E K;  2E5L K;  4DR4 K;  2UUA K;  4NXN K;  4DR2 K;  5LMU K;  4YY3 K;  4LF6 K;  4AQY K;  4OX9 K;  4DUY K;  3T1H K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...