2VQEK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqeK00
4DV1K 4K0KK 1HNWK 4GKJK 5IWAK 4DV0K 3T1HK 1IBLK 2UUAK 4NXNK 2UXCK 2UUCK 4DV3K 3J80O 3T1YK 4JI5K 2VQEK 3J7YP 4DR6K 2UUBK 4DUYK 4LFCK 4DV7K 4DR7K 4X66K 4JI7K 1XMQK 4JV5K 4LF9K 4X62K 1HR0K 1FJGK 1N33K 4DR3K 1N32K 4V19S 1IBKK 5LL6Z 4JI4K 5BR8K 2UU9K 5FLXO 4X65K 4DR2K 4JI8K 5AJ3K 4LF4K 3OTOK 3JAMO 4JI6K 4DUZK 4JI0K 4B3RK 4KHPK 1XNQK 4JYAK 4NXMK 2UXDK 3J81O 4GKKK 4B3MK 4B3SK 4LF5K 1N36K 4DV2K 4DR5K 2E5LK 2ZM6K 4DR1K 1HNZK 5A2QO 1IBMK 5LMNK 1I94K 4DR4K 3J7AP 4B3TK 4OX9K 2VQFK 4YY3K 2UXBK 4DV5K 4JI1K 4LFAK 4CVNE 4DV6K 2HHHK 5IT9O 4AQYK 5LMUK 1N34K 4LF8K 1XNRK 4YHHK 2F4VK 4JI2K 1HNXK 4CW7B 4DV4K 4JI3K 4LF7K 4X64K 1XMOK 1J5EK 4LF6K 4LFBK
chains in the Genus database with same CATH superfamily
4CJWA 4H5WA 5EX5A 1NWKA 1ILYA 2YHXA 3O9UA 4DV3K 3IMXA 1L3SA 3SUOA 1HMVA 1G15A 3S41A 2GX9A 3SAGA 3OS2A 4HVJA 1P90A 3FFKB 1W7AA 1S3XA 2HF3A 3QEXA 2YHWA 1KRPA 1IV0A 5HRSA 3CCJN 3JSMA 3I33A 4FW1A 1N5YA 2ZGZA 1YJ9N 4MO5A 4IOAL 4LFCK 3LDLA 3ZX0A 3ISNC 2BH1A 1YTUA 2QWMA 3CF5L 2OPRA 2NNWA 3VETA 3PIPL 3NGIA 2Y1JA 1N33K 4M3YA 2E2PA 1M1KO 3HM8A 1JCGA 1L3UA 4TSXA 1FW6A 5C2DA 5AQVA 4B3OA 4E1MA 3SPZA 4MDAA 3LP3A 4BE2A 3SV3A 4B1WB 2FBVA 3HTVA 3GE1A 4BR5A 4FJ9A 2E88A 3H08A 2O8CB 3J8AA 4KV8A 3TARA 1BCMA 5ADXA 3K58A 3RRHA 3VF2A 4CJSA 3TU5A 1H1VA 1SAZA 4FLVA 5AQFA 4DR5K 4CJFA 1Q86O 3LP1A 2E5LK 3H3NO 4GV6A 5AQKA 4A57A 3QLHA 1LWFA 1KCFA 5LMNK 3V9ZA 5BRHA 5AQQA 2O8DA 4JLHA 4KO0A 3AO3A 5J2MA 3IAYA 1NK9A 2QXLA 4BRCA 4A62A 1CXQA 5BREA 4AILC 3QERA 5GAHP 2O8EA 4CJQA 2YNIA 4FWLA 5LMUK 4FM1A 2QEXN 1RDAA 3QFUA 4FPAA 4YOYA 1KAZA 3SUNA 1C1AA 2YJFA 1TAQA 2O8FA 1TUUA 3OBWA 3CJCA 4DB3A 2HHUA 4Y1CA 4H0VB 2JWLA 3NF6A 3DLEA 1LW2A 3CG7A 3CYMA 4XH5A 1O1WA 4DU1A 1E4GT 2F8SA 4C8KA 2FBTA 5KGWA 2GUIA 2KKZA 5DM6L 4DR6K 2HF4A 2B6AA 4CJEA 3TTDA 3SQ4A 2RPIA 4O0IA 4F2SA 3L3UA 5AQIA 1J6ZA 5C0YA 2DFFA 4FVMA 1NK6A 3DWLA 1NGBA 4DLGA 5E84A 3R8EA 3OS1A 4DQRA 1YI2N 1HR0K 3MXMA 2W6KA 1K73O 2YV0X 2Q0UA 1BU6O 4CHZA 1VQMN 4DFMA 2BTFA 4CIGA 2LSNA 4GVMA 3ZSVA 3LDQA 4K25A 3W3DA 2HB5A 1RCHA 3O4WA 4BG9A 5D3GA 2KFNA 4NB4A 4LF4K 5F2RA 2G8VA 3DLHA 3EZ5A 3D6RA 4H8KA 1IKWA 1Q82O 3L6QA 4YOTA 2NRTA 2VYPA 3VEVA 4B9TA 3QNNA 5BPNA 4FOEA 4Z4EA 1T7PA 1U2VA 4W5OA 4BDPA 2F8TA 2V7ZA 3IFRA 1RT5A 4XH1A 3E66A 3C7NB 5ELZA 4W5NA 1RTDA 5LJWA 1HQEA 4DR4K 1IKVA 4BDZA 4FYDA 5FPDA 1CZAN 2VWBA 5AQZA 4YY3K 1EP4A 4O55A 1SV5A 3AAPA 3SYZA 1QHTA 1RT6A 1N6QA 1G99A 2WOMA 3ITHA 4FW2A 4CJTA 4AQYK 1S1WA 4CK2A 4OLAA 1U6ZA 1WSIA 4UY8O 1DLOA 1GLEG 3VQQA 3Q7BA 5T7BA 4NLBA 5FPNA 1D4XA 5FRNA 3U3YA 2P9LB 3MX2A 3K59A 2YHBA 4PKHA 1TL1A 4ID5A 4DQPA 3RMDA 1GLLO 1KFSA 2DY4A 4FLYA 3LM2A 3TTCA 3OS0A 3TSPA 1T3VA 1WN7A 3T1YK 2YJEA 1KLMA 2IC3A 2VGMA 1RFQA 1LOTB 1VQ6N 3H3OB 1GLAG 1D8YA 1JXEA 5DK5A 3P39A 4EHUA 1RT4A 2ATQA 4BR4A 3DLGA 1NOYA 4M3ZA 4DUYK 4CECA 4W5QA 1C0GA 4DV7K 4FVUA 4KI4A 1JLFA 5BRFA 4B1XB 4CF9A 4C8NA 4AHCA 3ZT2A 1IO2A 1NGDA 4E7HA 2ZJRL 1DTQA 1U49A 4FPBA 2Z1HA 1JJ2M 1SQKA 3MECA 1Z6RA 4QS9A 3CCSN 3AV9A 3WQTA 5HRNA 5EU7A 1CZ9A 3NVMA 1GLBG 4FJMA 2VCPA 1GLJO 5JLFA 1QSSA 3C7NA 3PX6A 2HHXA 3OTOK 1VSKA 3LWLA 3NVKA 4B3RK 4YDUC 3CFOA 2QXFA 4I2QA 3VQDA 4JHDA 5J2NA 1Y64A 3G6EN 3UIQA 2FXUA 2HMPA 3RVCA 3AVAA 5HP1A 1CLQA 2AA4A 1MU2A 1VQON 3KK3A 1K8KA 1JLQA 2IS3A 3FR0A 3OJUA 4KTWA 2W42A 3RR8A 1ZBFA 4Q5VA 3E01A 1ESVA 3NF9A 3VEYA 4BC3A 4NO7A 1JL1A 1WB9A 4YOVA 2G8KA 2FSNA 5AQMA 3VA3A 4H5RA 4UQGA 4OGCA 4EZ9A 2E20A 4BQLA 1XWLA 4CZEA 1KTQA 2IOCA 3K2PA 4IO9L 4CJVA 5KPTA 4FM2A 2HBKA 3HT3A 4JI3K 3CCRN 3VQ4A 3TPQA 5C24A 4CFCA 4O8UA 4CIFA 5H1SQ 1HKGA 4DU3A 4DV1K 3CIPA 4W5RA 2YHAA 3VN5A 1Q9YA 1JLBA 1P8ZA 3KLHA 3N4PA 4JKFA 5JVHL 4KFBA 4MQ3A 5KPRA 4JI5K 3VMFB 1X9MA 2HHQA 3WEEA 1B9DA 3A8YA 4CEZA 3TR8A 4BG8A 4BRIA 5FPMA 1Z05A 3O3FA 3M5RA 3THXB 1GOCA 3IG1A 2WC9A 3TSUA 3ULDA 2EX3A 4WQ4A 2GV9A 1VSEA 2E8AA 4DR7K 2BGGA 4X66K 3CM6A 3VTIA 1K6YA 2YNGA 5GADP 5CY4A 3D2FB 3H1VX 4WFAL 3I8DA 1ZBUA 2BDPA 4CHYA 2B4JA 2HHSA 3O4QA 1HNIA 4DLEA 3AVCA 1BI4A 2GWJA 3AA3A 4DSFA 3THVA 2QM1A 1OH7A 5GAGP 3OYIA 2EHGA 5AQNA 4IOCL 3LWMA 3VQ8A 5AJ3K 1RBSA 1RT3A 3LAKA 4JI6K 1BUPA 4A61A 4NCAA 4DTOA 4FO0A 1B9FA 3V9XA 1LAVA 1BA1A 3J81O 1TVRA 3AO1A 5J1EA 4B8CA 4J2EA 3OA9A 3I55N 3K5MA 3ZX3A 4DFJA 4CEFA 1IKXA 4FZYA 3VERA 2ZWHA 1W9HA 3NF8A 2E2QA 3FLCO 4IJAA 3I8BA 3ZLJA 4B1ZA 3CXCM 4JI1K 4DF4A 1ZBHA 1WSHA 4DV6K 1WSGA 2KLAA 4C8MA 4FSVA 4L8RB 2KZMA 1XNRK 2F4VK 1T05A 3S3NA 4KHWA 4IWVA 1SKRA 3CCEN 3DOLA 4WE1A 3RMCA 3C95A 3EE8A 1R0AA 4O44A 3LPTA 4A59A 3THXA 3SV4A 4GW6A 5IWAK 1ZC6A 2IVPA 3PO5A 4BRHA 3QNOA 2HMIA 5LJVA 1RILA 1BA0A 1VQ4N 5KQDA 5JS2A 1D9FA 3QMLA 4OVLA 3D2FA 1ATNA 3CCQN 3IS9A 3KLFA 2ZJPL 4CD1A 5I42A 4ILJA 3MN5A 4CK3A 2WONA 3SK3A 2GTDA 1NJIO 1C0MA 4CZKA 3NGZA 2HOEA 1W97L 1SZ2A 5JICA 3KJVA 5HBMA 4FWNA 2DFEA 3T1AA 4X62K 1YVNA 2DFHA 3KLIA 3I0SA 3VA0A 2OZSA 2G8HA 3HP9A 4JAXA 4MDBA 4DR3K 1NJWA 1SL2A 1K8AO 4O0JA 3WQUA 1JLCA 4FJIA 1KXPA 3HSTB 4JI8K 2F96A 2FBXA 3T69A 3L2RA 3AVBA 4OJRA 5AQLA 2NRZA 2P9UB 3RSEA 3HVTA 2P9NA 3SNNA 3ZSRA 4BRLA 1YT3A 4M7XA 3OYHA 4I6MA 3WXKA 3KD5E 1REVA 3TSQA 4LSLA 3GBTA 3DXMA 5AZJA 4DV2K 5AFUH 4MO4A 4WFNL 1KVAA 1IJJA 4CBXA 3ID6A 5M1PA 4ISEA 4DR1K 1IBMK 1ASWA 3LP2A 4FK4A 4CHNA 2HHTA 3R1XA 1X9WA 4BC5A 1YJWN 3DXKB 4AF1A 1VSFA 2ASMA 2VGNA 1BWFO 4EAHD 4CVNE 1TK5A 3PV8A 2D1KA 3EE9A 2ITMA 5B8HA 1CZBA 1J5OA 2XHBA 4DV4K 4LY7A 4CZIA 1KVBA 3IUCA 4LH5A 2E6MA 3OW2M 3CM5A 4BRNA 4CJLA 1VRTA 3KK1A 1X1PA 1Q7YO 4B1YB 1FK9A 4JKEA 1TL3A 3KTQA 1QZ6A 1TYQA 4CGFA 1KQSM 3T1HK 3WNFA 1GOBA 2P9SA 3E1YA 4CF2A 1L3VA 3DRPA 3LALA 2KHOA 1RTHA 4BRFA 3PX0A 3KHYA 3KD1E 2VQEK 3VQPA 4PUOA 4KB1A 3WNEA 3HPOA 1TKDA 4DG1A 3C6HA 2E4LA 4BR0A 2H3GX 3EL2A 5AZIB 1TKTA 3E9LA 4OLBA 5BPLA 2QI2A 3E9PA 4ZTFA 4CK1A 4FWRA 3HYFA 4B1VA 4BE0A 3S9HA 4KTQA 1VAZA 3AA5X 1NKBA 3SPYA 2V52B 2YKMA 4H0YB 1IBKK 5CZ1A 3BGRA 4DSIA 1LCUA 3FGUA 2E6LA 2P9PB 1VQ5N 4CEBA 3NE6A 4DF8A 3BF3A 1VHXA 2JWKA 2G8WA 4KB0A 4JI0K 3THYA 5GINA 1T6DA 2ASOA 1KSPA 2G8FA 2OANA 1HJRA 5BN9A 3KLGA 4M3WA 2GELA 3DM2A 2XY6A 3EEQA 5FRMA 1C0FA 4OPJA 5DM7L 3G25A 5BN8A 4OPAA 4E1JA 1HLUA 3ENBA 4LH4A 3IRXA 2I7NA 1DKGD 4B3TK 5BPMA 3DLLL 4CJPA 3SJHA 1RGIA 1ZYQA 3OYGA 2KW4A 2X6NA 1S5JA 2OTJN 1Q81O 4DTXA 1JLEA 4JD2B 3CHWA 2Q31A 3HK2A 3S3OA 1C0UA 2CGLA 3QETA 4DSLA 5AQTA 3P5JA 5BR9A 4FK2A 4RW8A 5DMRA 3K9KA 4E7KA 3QIOA 2A40A 4FWMA 1BHLA 3K9JA 4N47A 4RW4A 3A2FA 1XHZA 4YOXA 2Z1IA 4FLUA 2GUPA 3V4IA 1WLJA 1JCEA 3KK2A 3CFPA 4CIEA 3SBGA 4HUFA 1RTJA 4BVPA 1ASUA 4PA1A 5KRSA 4JRPA 4H5NA 4F8RA 3M6GA 4K8ZA 1DEJA 1S1VA 4C8LA 2D0AA 4DQ8A 2CGKA 3WNHA 5JLHA 4K41A 5EVZA 2P9PA 3MMVA 5GIPA 1XMQK 3R9PA 4I2PA 3ATVA 1WAJA 4CEEA 3AVNA 4KAZA 4ILGB 2ZJQL 4OO1J 4V19S 3ZYYX 4JI4K 1SKSA 3CI5A 2D5RA 2FF3B 2UU9K 4F3TA 4X65K 5EY4A 3KVGA 3JAMO 1YHQN 4JK7A 1Y97A 1ZXOA 4E19A 3K5OA 4JS5A 3VF6A 3TABA 2RN2A 4IBNA 4CJKA 3CQ8A 1JKHA 3CC7N 4DHYA 4H03B 4EZ6A 4FWKA 5FDLA 2O8CA 1JL2A 2AP1A 5M1QA 1WSEA 1U45A 2FC0A 2ZM6K 2GWKA 4HHTA 3UKRB 4N56A 1BCOA 3AARA 2BANA 5C2FA 4Q0BA 4CJ3A 2QWPA 3NMUA 5M1OA 4WFBL 3PUFA 3OHRA 3UKUB 4XH4A 4NLCA 5KQ8A 2HHHK 1XI1A 3WT0A 4LF8K 4KHYA 1S9EA 3LP0A 1VQLN 4E1NA 4KHUA 3NH1A 3U6FA 2P9IB 1IG8A 3VQCA 2RKIA 3P38A 4Z0UA 4ISGA 3QIPA 4BE1A 1L3TA 3VTHA 2OYQA 4JKBA 3O9SA 2Q0RA 3HP6A 1DTTA 1TK8A 1TKXA 4BRDA 4DTRA 3VQEA 4MLHA 4Z4FA 3L4IA 1GLDG 4F2RA 1NGGA 1RDWX 3NCIA 1QSYA 1TKZA 3GG4A 4GY2B 4HCCA 1TUYA 2VWKA 3LAMA 3V9WA 3ZT4A 4QCLA 1YTAA 3M8SA 1X9SA 2WUSA 5KTQA 1Q9XA 4FLTA 5E26A 3O08A 3L4QA 3WNGA 4F4KA 4LC9B 4ICLA 1NK5A 4RW9A 3O9TA 2P9KB 4B08A 4PL8A 3W0LA 1EKEA 3VEWA 3ZEUB 3LZIA 1EWQA 2GEMA 5I3UA 1XNQK 3VQ9A 3MWPA 4Z4HA 4PQUA 1NKEA 3VQAA 5JMVA 2QWOA 4E0DA 4IOXA 4RCHA 3WXIA 1T6CA 3NGYA 1VQNN 3UB5A 2HBLA 3C6AA 5A2QO 4BRPA 1ZBLA 3NBPA 2AJQA 4W5TA 3ID8A 4G1QA 4JKCA 1A5VA 4YDUA 4KBOA 3V9UA 3LZJA 1X9JA 3C94A 2QKKA 3MX5A 4LFAK 1DT9A 4F9OA 3ZETB 3LM9A 3HM9A 3O5BA 2JGUA 2IVOA 4BRAA 2YKNA 4IDHA 2ZQBA 4M3RA 4O5BA 3CJ7A 1NJZA 2QTDA 1QQMA 4CD3A 5FPEA 3CQXA 2NRWA 4PKGA 3QEWA 3SQ0A 3HZ6A 2I5JA 3MCPA 4FLZA 1BQMA 1I39A 2NRXA 4DTPA 2UXCK 4OPHA 5F0XA 3QDKA 1D5AA 2P9LA 4DFPA 3J80O 3P4IA 5K14A 2OCEA 3TWHA 3ULEB 1WUAA 3U3GA 4G9ZA 3MCAB 3FE1A 3VENA 4M63C 1EETA 3DMJA 3FZMA 3SMPA 3AO2A 5CE3A 4JI7K 4R79A 4NCGA 2OTLN 4NYFA 4L3QA 4A5AA 4B8AB 3O3HA 4DTJA 4J2DA 3CCUN 4FZZA 2J4RA 3L3VA 5KPZA 5KRTA 3T3FA 3MK6A 3SUQA 4CFBA 3MXIA 3G71N 2PYLA 3KZBA 4U67L 3SJJA 5FLXO 4WF9L 5C25A 1BQNA 4KH4A 4ZHRA 4HCBA 3MXJA 4WYBA 1VSMA 3DJCA 4CEAA 1NLVA 2DTUA 1S1TA 1YUWA 2D0PA 4H4MA 2HBJA 1HNZK 3ENOA 3CFRA 3ZETA 5AR0A 3AGRA 4CEQA 4WQ4C 3F5TA 1NGEA 3EO3A 3BY5A 3ASMA 1NGHA 5C10A 1N8RO 4LD0A 3MWTA 3KWGA 3AVMA 4J2AA 2P51A 4FJLA 4JI2K 4DTMA 1NGFA 4M3UA 3AA2A 2CH6A 3HVRA 3SI6A 4KKOA 4BROA 1ITGA 1SL1A 4NYNA 1EXQA 2ETJA 4DCHA 3HOTA 3O1WA 2QK9A 4ZTJA 1SS6A 4CI6A 4DV0K 3C65A 4BRGA 4JKGB 3FZHA 1HYZA 5SZTA 3V6DA 1WBDA 4FJGA 1J9AA 4OKEA 1OVYA 5HRPA 2A5XA 5GIOA 3ZT1A 1MWMA 4E3SA 1E4FT 4FWPA 1KAYA 4Z94A 1X3NA 4K8XA 1WNSA 2E2OA 1YITN 1MWKA 3HI0A 1EQYA 1Q18A 3QEIA 3TAGA 3ENHA 4QAGA 3OYNA 4Y1DA 3EZWA 1VQ9N 4RWTA 2CGJA 2OA8A 3MN7A 3KK7A 3C6TA 3KLEA 4DQQA 3CJBA 4PHTX 1S22A 2VG6A 3DRSA 1WAFA 3ZSOA 4CJRA 4DTUA 1HQUA 4K43A 3WXMB 4KPYA 3FZFA 5BR8K 1XC9A 4B9QA 2WFBA 4C8OA 3CPEA 4BRMA 2A42A 3H1QA 2QWLA 2VG5A 3WUHA 4YOWA 4FXDA 2RHKA 2FSKA 4AHUA 2OPPA 3VESA 3P31A 2PYJA 3VF4A 1NMDA 4B3SK 2I7PA 3LANA 2JLEA 1QHAA 4JKDA 4EP5A 2O8BB 1QQOA 4AM7A 1NGAA 2X74A 3CJ1A 2NUBA 5AQHA 3N4QA 1NJXA 4RG8A 3U9ZA 4CERA 4LSNA 3WXLA 4OX9K 5AQWA 2O4GA 3U4LA 3AA4A 3K57A 4GVEA 3K5NA 2F9WA 3AY9A 1QVGM 3D2EB 3RR7A 5HRRA 4WCEL 1N34K 4AM6A 3SAFA 3SQ2A 4CJUA 4JKHA 4KH6A 4O8KA 5AFUA 3FZKA 4PKIA 3I0RA 4WQ5A 3LDSA 3AVLA 2F9TA 4HUEA 1ASVA 4X64K 3QB0A 3A5OC 4IFEA 1JXBA 3OYBA 4N41A 4FJJA 3VPZA 1D9DA 1Z25A 1HNWK 4AHVA 1MA9B 3O6WA 3F73A 1J54A 2XO7A 3V1OA 3KWIA 3SCXA 1KD1O 2WBNA 1U4BA 3RMBA 3M1FA 3TAFA 3PX4A 3AVFA 2VG7A 1RBTA 5HLFA 2PY5A 1S9GA 4IG3A 1NGCA 4GV3A 2B5JA 4QOZB 3SUPA 2QKBA 3VQ7A 4FZXC 3ZT0A 1Q8IA 2QWRA 3THWB 4Y0WA 3KIOA 4Z4CA 4BACA 4CZJA 1HNVA 4J8FA 4E7IA 3HOSA 2XY5A 4NCBA 4DKWA 1NK8A 4R5PA 1U47A 4H0PA 2RE2A 4DSEA 4A2AA 4EHTA 2A1RA 4MLEA 1J53A 2YNFA 1B92A 3SZ2A 4M7YA 2W6LA 3HBTA 1C1BA 1FKOA 2E1ZA 4E7LA 5C42A 3NFAA 3NAEA 2Q3SA 3BZCA 5LY3A 4DUZK 4I9QA 4OPKA 3QO9A 4NXMK 3MEGA 1VSIA 1V4TA 4GKKK 4BR2A 2RF2A 4O5FA 4DS5A 4ILHA 2P9UA 2V7YA 3PSFA 3U8XA 4IZ9A 1SKWA 3EYZA 4DSKA 2FF6A 3D2EA 2O8DB 4AH9A 1E3MA 1ATRA 3NF7A 3QESA 4JKAA 1C1CA 1T44A 2E2NA 1HUXA 1HPZA 3LPUA 3OYDA 1NM1A 4KI6A 1W0HA 2A3ZA 2O8EB 5M1KA 2VQFK 2UXBK 3F9MA 4DV5K 1HYSA 3PY8A 3CETA 5F1XA 4H0OA 3D7EO 3SMSA 4OKKA 4CHOA 2O8FB 3VQ6A 1NBWA 4DS4A 4DTNA 3DXKA 1HNXK 1NK0A 4BQZA 4BC4A 1BO5O 4KRFA 3DI6A 3HJFA 5I9EB 3GL1A 3TAEA 4LF7K 2ASPA 3GDQA 5J2PA 1XMOK 3CPWM 1LW0A 4LF6K 2Q97A 5AQYA 4HTLA 1T8EA 4K0KK 3TAMA 4BRQA 2G8UA 2E1YA 1FKPA 4CFAA 3NH2A 2UUAK 5KGXA 4NXNK 2UUCK 2HSTA 3OJSA 4FK0A 1KAXA 3PO4A 5AQRA 3THWA 5E41A 1EO1A 1VRUA 4H0XB 2D0OA 3HSCA 3WXJA 4IXCA 3CCMN 1Z26A 4M45A 1RTIA 1NU0A 3OYAA 3O8MA 3AVGA 3DLBA 1NGIA 2QW9A 4C1NK 5AZIA 1TV6A 3AO4A 4H0TB 3I56N 5ADXH 3VEOA 2QA4N 1TK0A 1QQCA 1W2BM 1L5UA 1S1XA 3VEXA 2W40A 1UOCA 4BR7A 4BC2A 1NGJA 3MAQA 1ZBSA 4ELUA 3EKUA 4CEDA 1XUPO 3VEZA 1LAWA 1QE1A 4JS4A 3CQYA 4JRQA 3VOVA 3ZSXA 1EX4A 3MEDA 4E89A 4CCHA 2HNDA 1U2VB 4KTZA 2YI1A 4JYAK 1U48A 3NHGA 2W41A 1UAXA 3PSIA 5TKYA 5JVGL 2HNZA 5AQJA 2YNHA 3BF1A 4JEPA 1S6QA 4CGGA 4BGBA 3LDOA 3JXUA 4AHRA 1T03A 1VK0A 1CXUA 4FLXA 4DU4A 3CJ9A 3L0QA 3CMAN 4FJKA 4M42A 3J7AP 5AQOA 2VWJA 1YJNN 4F3OA 1R59O 4HUGA 2WTUA 3NDKA 4CJ7A 3V1QA 1K9MO 2PFUA 4CGJA 2HVIA 5IT9O 2NZTA 4ID1A 3OY9A 5C12A 3TAPA 1VSDA 2P1JA 2R7YA 4JD2A 4HWIA 1RDCA 3MN9A 4CZLA 3O80A 4M3XA 4CFDA 3P83D 2ZGYA 3LDNA 4LFBK 3JS6A 1NKCA 4EIAA 4B9SA 1IKYA 4EFHA 3H45C 4DQSA 1DGKN 1WSJA 3V9SA 2G8IA 3G4SN 1NK4A 5HROA 1NG9A 4AHSA 2XY8A 4CZFA 2Y1IA 1LWEA 3J7YP 2PAVA 3DRRA 4IEIA 2KZZA 5JS1A 4FLWA 4FWQA 2EWSA 4XIUA 3OYMA 1VSLA 4ELTA 1GOAA 1QSLA 1LWCA 5CYMA 2A1SA 3T7ZA 4BGAA 1FJGK 1EWRA 3MDQA 5TKWA 1HRHA 4IKFA 2Z1JA 3OYKA 1QVFM 2D4WA 3KKSA 1O13A 3SAHA 4JHDB 4B9VA 3OYFA 3VGKA 3AVHA 4CF0A 3A5NC 5AQPA 1HPMA 1TAUA 1X3MA 4CHQA 1K8KB 3M8RA 4KHPK 5C15A 4FOIA 2HNYA 3C0BA 2UXDK 2NLXA 1QTMA 1RBRA 3O4NA 1BISA 1UWBA 2OPQA 1A5WA 1XHXA 4B9MA 3DLRA 1BIZA 3CCVN 4CBUA 1YAGA 2D0BA 1QZ5A 2CH5A 3UKRA 2IIRA 3O9QA 3G0ZA 1VSHA 2BUPA 2V51B 3BZKA 4BDYA 1S72N 3B8AX 4IFYA 3AGKA 3UKUA 3HPGA 1IG9A 1WSFA 1YIJN 1YXQA 4KH5A 1RBVA 4B9UA 2KFZA 1J5EK 2YX6A 3DLKA 4JN4A 3AAQA 4YNQA 1IBLK 4FJ8A 3WEEB 3BP8A 3MEEA 3L2UA 3L8BA 2P9IA 4H5TA 4RW6A 2X6SA 3ATUA 3RTVA 1SUQA 4H5VA 3CCLN 2A41A 3VQ5A 2IVNA 2NRVA 3EN9A 3J7ZO 5SWMA 4HTUA 2KTQA 2UUBK 3KKRA 4RW7A 4A2BA 2OZMA 4BRKA 1U04A 2IGIA 3Q7CA 4E7JA 2P5OA 2GBZA 1BI4B 3CJAA 4JV5K 4N76A 2KQ2A 3HL8A 1RT1A 3QBWA 3AO5A 5AQUA 4IO8A 4BREA 5CYQA 1I3AA 1RBUA 1N32K 4PY5A 3O9RA 4IFVA 1TGOA 4FJNA 5LL6Z 3OYLA 1M90O 3OVNA 3GOIA 2P9KA 3QICA 4YORA 3FFIA 4DTSA 4GV9A 1WBBA 3L2QA 1S6PA 3M8PA 3R6MA 3ZEUA 1HKCA 5MLCQ 3JYTA 3DYAA 5BRDA 4FWOA 3OYEA 5M1FA 3ZSWA 4BVOA 4LF5K 1RNHA 3TTFA 1N36K 4CGHA 2HVHA 2FSJA 1C0TA 4N5SA 4Z4GA 2Q2RA 1I94K 1RDDA 1SL0A 4DFKA 2UYTA 5GAEP 1KC8O 3QEVA 4K42A 3L2VA 1HKBA 3CERA 4DQIA 4DWIA 1HYVA 3S3MA 3EY1A 3CMEN 1WOQA 2HW3A 4GMJB 4B9LA 1HJOA 4ELVA 4KHNA 4CZHA 3AVKA 1ATSA 5KI6A 4GNIA 3H6EA 3EKSA 4BR9A 1JCFA 1BOTO 1BL3A 4JK9A 3AVIA 3TANA 1JLAA 3V81A 1HX1A 4GKJK 4IDKA 1UA1A 3SQ1A 1NNEA 2NRHA 3ZT3A 5AQXA 5J2QA 4CZGA 3M8QA 4PL7A 2PBDA 1UA0A 3FZLA 4CF1A 1RT2A 3CD6N 3LDPA 1NJYA 3O1BA 2Q36A 1V4SA 4ISFA 3ZX2A 4U7BA 1QS4A 4M41A 4YFUA 3VQBA 1RDBA 3ULEA 3V1RA 4J2BA 4KHSA 4A5BA 4I9LA 3D45A 4LF9K 4Z4IA 3D0PA 4QS8A 4CESA 4PWDA 1OKJA 4CF8A 4CGDA 3RMAA 4CE9A 1NOZA 1XQSC 3RSEB 2P9NB 1KFDA 4O4GA 4I6MB 3NH0A 1NK7A 2ITGA 1IH7A 3DXMB 3G10A 3LL3A 5AZJB 1QQNA 4FJHA 2HHWA 1YF5L 5CHIA 3CC2N 3A5LC 1KLNA 4B3MK 3QBXA 3OYCA 3PLAA 4CJ5A 1OH6A 4BY9C 2Q1NA 3BUZB 3F9KA 4XEIA 4CZMA 4IEEA 5HL7L 4B1UB 3HRGA 2F7TA 4KHQA 1RT7A 4CBWA 4CHPA 1BGXT 3IDHA 4CGIA 2YHYA 3B6PA 2A6AA 4IJNA 4FJ7A 2XY7A 3VGLA 3L2WA 3OYJA 4FJXA 3T19A 3F2KA 5FROA 3E9OA 5CR4A 3U9DA 4CW7B 2YCHA 3K5LA 3AVJA 1BIUA 1OH8A 4M3TA 1TYQB 3IKMA 4MFBA 2NRRA 4BWJA 4DMNA 2P9SB 3P1GA 3RWUA 1BDGA 1VQ7N 4C1NI 4IG0A 3BEXA 3ALYA 3TI0A 1VQKN 2IAJA 1ZBIA 3DOKA 4FL9A 1YVUA 4H4OA 3CC4N 4FCYA 5M1NA 3HPHA 1NMNA 1F21A 4CJ4A 2QWNA 2ZF5O 4JKGA 4C23A 4EP4A 3UE5A 2HBMA 2BE2A 4RTFD 4FWSA 5HOOA 5AQGA 3M3ZA 1VQPN 2PZSA 4JNEA 1JLGA 4KREA 1BG3A 1A5XA 1GLCG 2ZE2A 1MDUB 1XC3A 3SBTA 2OPSA 3B6OA 3A0IX 2XRIA 3ZSQA 2QWQA 2ZD1A 4WQ5C 3HXMA 3OBYA 5CZ2A 3ZCMA 5AQSA 3THYB 3BDPA 1RDUA 3H46O 4DR2K 3R3LA 3MN6A 3ZSYA 4FJ5A 4OKJA 3QINA 4BWMA 5EXWA 2IDOA 2P5GA 3A5MC 2DPNA 5EOYA 1OH5A 2O4IA 4AHTA 4YOUA 1KVCA 3SLCA 1OVQA 2FLOA 3QEPA 2X78A 2O8BA 2D0CA 3O3GA 4OGEA 1LV5A 3HO1A 4QS7A 4DSJA 1GLFO 3RRGA 3QFPA 1C6VA 4FM0A 1VSJA 3PIOL 3ZSZA 1S1UA 4YHHK 4B9NA 3TAQA 2Z1GA 3DAWA 3K0SA 4I7FA 1VQ8N 4JK8A 3C6UA 4CEOA 2HHVA 1FXXA 3VGMA 2FBYA
chains in the Genus database with same CATH topology
4DV1K 4K0KK 1HNWK 4GKJK 5IWAK 4DV0K 3T1HK 1IBLK 2UUAK 4NXNK 2UXCK 2UUCK 4DV3K 3J80O 3T1YK 4JI5K 2VQEK 3J7YP 4DR6K 2UUBK 4DUYK 4LFCK 4DV7K 4DR7K 4X66K 4JI7K 1XMQK 4JV5K 4LF9K 4X62K 1HR0K 1FJGK 1N33K 4DR3K 1N32K 4V19S 1IBKK 5LL6Z 4JI4K 5BR8K 2UU9K 5FLXO 4X65K 4DR2K 4JI8K 5AJ3K 4LF4K 3OTOK 3JAMO 4JI6K 4DUZK 4JI0K 4B3RK 4KHPK 1XNQK 4JYAK 4NXMK 2UXDK 3J81O 4GKKK 4B3MK 4B3SK 4LF5K 1N36K 4DV2K 4DR5K 2E5LK 2ZM6K 4DR1K 1HNZK 5A2QO 1IBMK 5LMNK 1I94K 4DR4K 3J7AP 4B3TK 4OX9K 2VQFK 4YY3K 2UXBK 4DV5K 4JI1K 4LFAK 4CVNE 4DV6K 2HHHK 5IT9O 4AQYK 5LMUK 1N34K 4LF8K 1XNRK 4YHHK 2F4VK 4JI2K 1HNXK 4CW7B 4DV4K 4JI3K 4LF7K 4X64K 1XMOK 1J5EK 4LF6K 4LFBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 K;  4K0K K;  1HNW K;  4GKJ K;  5IWA K;  4DV0 K;  3T1H K;  1IBL K;  2UUA K;  4NXN K;  2UXC K;  2UUC K;  4DV3 K;  3J80 O;  3T1Y K;  4JI5 K;  2VQE K;  3J7Y P;  4DR6 K;  2UUB K;  4DUY K;  4LFC K;  4DV7 K;  4DR7 K;  4X66 K;  4JI7 K;  1XMQ K;  4JV5 K;  4LF9 K;  4X62 K;  1HR0 K;  1FJG K;  1N33 K;  4DR3 K;  1N32 K;  4V19 S;  1IBK K;  5LL6 Z;  4JI4 K;  5BR8 K;  2UU9 K;  5FLX O;  4X65 K;  4DR2 K;  4JI8 K;  5AJ3 K;  4LF4 K;  3OTO K;  3JAM O;  4JI6 K;  4DUZ K;  4JI0 K;  4B3R K;  4KHP K;  1XNQ K;  4JYA K;  4NXM K;  2UXD K;  3J81 O;  4GKK K;  4B3M K;  4B3S K;  4LF5 K;  1N36 K;  4DV2 K;  4DR5 K;  2E5L K;  2ZM6 K;  4DR1 K;  1HNZ K;  5A2Q O;  1IBM K;  5LMN K;  1I94 K;  4DR4 K;  3J7A P;  4B3T K;  4OX9 K;  2VQF K;  4YY3 K;  2UXB K;  4DV5 K;  4JI1 K;  4LFA K;  4CVN E;  4DV6 K;  2HHH K;  5IT9 O;  4AQY K;  5LMU K;  1N34 K;  4LF8 K;  1XNR K;  4YHH K;  2F4V K;  4JI2 K;  1HNX K;  4CW7 B;  4DV4 K;  4JI3 K;  4LF7 K;  4X64 K;  1XMO K;  1J5E K;  4LF6 K;  4LFB K; 
#chains in the Genus database with same CATH topology
 4CJW A;  4H5W A;  5EX5 A;  1NWK A;  1ILY A;  2YHX A;  3O9U A;  4DV3 K;  3IMX A;  1L3S A;  3SUO A;  1HMV A;  1G15 A;  3S41 A;  2GX9 A;  3SAG A;  3OS2 A;  4HVJ A;  1P90 A;  3FFK B;  1W7A A;  1S3X A;  2HF3 A;  3QEX A;  2YHW A;  1KRP A;  1IV0 A;  5HRS A;  3CCJ N;  3JSM A;  3I33 A;  4FW1 A;  1N5Y A;  2ZGZ A;  1YJ9 N;  4MO5 A;  4IOA L;  4LFC K;  3LDL A;  3ZX0 A;  3ISN C;  2BH1 A;  1YTU A;  2QWM A;  3CF5 L;  2OPR A;  2NNW A;  3VET A;  3PIP L;  3NGI A;  2Y1J A;  1N33 K;  4M3Y A;  2E2P A;  1M1K O;  3HM8 A;  1JCG A;  1L3U A;  4TSX A;  1FW6 A;  5C2D A;  5AQV A;  4B3O A;  4E1M A;  3SPZ A;  4MDA A;  3LP3 A;  4BE2 A;  3SV3 A;  4B1W B;  2FBV A;  3HTV A;  3GE1 A;  4BR5 A;  4FJ9 A;  2E88 A;  3H08 A;  2O8C B;  3J8A A;  4KV8 A;  3TAR A;  1BCM A;  5ADX A;  3K58 A;  3RRH A;  3VF2 A;  4CJS A;  3TU5 A;  1H1V A;  1SAZ A;  4FLV A;  5AQF A;  4DR5 K;  4CJF A;  1Q86 O;  3LP1 A;  2E5L K;  3H3N O;  4GV6 A;  5AQK A;  4A57 A;  3QLH A;  1LWF A;  1KCF A;  5LMN K;  3V9Z A;  5BRH A;  5AQQ A;  2O8D A;  4JLH A;  4KO0 A;  3AO3 A;  5J2M A;  3IAY A;  1NK9 A;  2QXL A;  4BRC A;  4A62 A;  1CXQ A;  5BRE A;  4AIL C;  3QER A;  5GAH P;  2O8E A;  4CJQ A;  2YNI A;  4FWL A;  5LMU K;  4FM1 A;  2QEX N;  1RDA A;  3QFU A;  4FPA A;  4YOY A;  1KAZ A;  3SUN A;  1C1A A;  2YJF A;  1TAQ A;  2O8F A;  1TUU A;  3OBW A;  3CJC A;  4DB3 A;  2HHU A;  4Y1C A;  4H0V B;  2JWL A;  3NF6 A;  3DLE A;  1LW2 A;  3CG7 A;  3CYM A;  4XH5 A;  1O1W A;  4DU1 A;  1E4G T;  2F8S A;  4C8K A;  2FBT A;  5KGW A;  2GUI A;  2KKZ A;  5DM6 L;  4DR6 K;  2HF4 A;  2B6A A;  4CJE A;  3TTD A;  3SQ4 A;  2RPI A;  4O0I A;  4F2S A;  3L3U A;  5AQI A;  1J6Z A;  5C0Y A;  2DFF A;  4FVM A;  1NK6 A;  3DWL A;  1NGB A;  4DLG A;  5E84 A;  3R8E A;  3OS1 A;  4DQR A;  1YI2 N;  1HR0 K;  3MXM A;  2W6K A;  1K73 O;  2YV0 X;  2Q0U A;  1BU6 O;  4CHZ A;  1VQM N;  4DFM A;  2BTF A;  4CIG A;  2LSN A;  4GVM A;  3ZSV A;  3LDQ A;  4K25 A;  3W3D A;  2HB5 A;  1RCH A;  3O4W A;  4BG9 A;  5D3G A;  2KFN A;  4NB4 A;  4LF4 K;  5F2R A;  2G8V A;  3DLH A;  3EZ5 A;  3D6R A;  4H8K A;  1IKW A;  1Q82 O;  3L6Q A;  4YOT A;  2NRT A;  2VYP A;  3VEV A;  4B9T A;  3QNN A;  5BPN A;  4FOE A;  4Z4E A;  1T7P A;  1U2V A;  4W5O A;  4BDP A;  2F8T A;  2V7Z A;  3IFR A;  1RT5 A;  4XH1 A;  3E66 A;  3C7N B;  5ELZ A;  4W5N A;  1RTD A;  5LJW A;  1HQE A;  4DR4 K;  1IKV A;  4BDZ A;  4FYD A;  5FPD A;  1CZA N;  2VWB A;  5AQZ A;  4YY3 K;  1EP4 A;  4O55 A;  1SV5 A;  3AAP A;  3SYZ A;  1QHT A;  1RT6 A;  1N6Q A;  1G99 A;  2WOM A;  3ITH A;  4FW2 A;  4CJT A;  4AQY K;  1S1W A;  4CK2 A;  4OLA A;  1U6Z A;  1WSI A;  4UY8 O;  1DLO A;  1GLE G;  3VQQ A;  3Q7B A;  5T7B A;  4NLB A;  5FPN A;  1D4X A;  5FRN A;  3U3Y A;  2P9L B;  3MX2 A;  3K59 A;  2YHB A;  4PKH A;  1TL1 A;  4ID5 A;  4DQP A;  3RMD A;  1GLL O;  1KFS A;  2DY4 A;  4FLY A;  3LM2 A;  3TTC A;  3OS0 A;  3TSP A;  1T3V A;  1WN7 A;  3T1Y K;  2YJE A;  1KLM A;  2IC3 A;  2VGM A;  1RFQ A;  1LOT B;  1VQ6 N;  3H3O B;  1GLA G;  1D8Y A;  1JXE A;  5DK5 A;  3P39 A;  4EHU A;  1RT4 A;  2ATQ A;  4BR4 A;  3DLG A;  1NOY A;  4M3Z A;  4DUY K;  4CEC A;  4W5Q A;  1C0G A;  4DV7 K;  4FVU A;  4KI4 A;  1JLF A;  5BRF A;  4B1X B;  4CF9 A;  4C8N A;  4AHC A;  3ZT2 A;  1IO2 A;  1NGD A;  4E7H A;  2ZJR L;  1DTQ A;  1U49 A;  4FPB A;  2Z1H A;  1JJ2 M;  1SQK A;  3MEC A;  1Z6R A;  4QS9 A;  3CCS N;  3AV9 A;  3WQT A;  5HRN A;  5EU7 A;  1CZ9 A;  3NVM A;  1GLB G;  4FJM A;  2VCP A;  1GLJ O;  5JLF A;  1QSS A;  3C7N A;  3PX6 A;  2HHX A;  3OTO K;  1VSK A;  3LWL A;  3NVK A;  4B3R K;  4YDU C;  3CFO A;  2QXF A;  4I2Q A;  3VQD A;  4JHD A;  5J2N A;  1Y64 A;  3G6E N;  3UIQ A;  2FXU A;  2HMP A;  3RVC A;  3AVA A;  5HP1 A;  1CLQ A;  2AA4 A;  1MU2 A;  1VQO N;  3KK3 A;  1K8K A;  1JLQ A;  2IS3 A;  3FR0 A;  3OJU A;  4KTW A;  2W42 A;  3RR8 A;  1ZBF A;  4Q5V A;  3E01 A;  1ESV A;  3NF9 A;  3VEY A;  4BC3 A;  4NO7 A;  1JL1 A;  1WB9 A;  4YOV A;  2G8K A;  2FSN A;  5AQM A;  3VA3 A;  4H5R A;  4UQG A;  4OGC A;  4EZ9 A;  2E20 A;  4BQL A;  1XWL A;  4CZE A;  1KTQ A;  2IOC A;  3K2P A;  4IO9 L;  4CJV A;  5KPT A;  4FM2 A;  2HBK A;  3HT3 A;  4JI3 K;  3CCR N;  3VQ4 A;  3TPQ A;  5C24 A;  4CFC A;  4O8U A;  4CIF A;  5H1S Q;  1HKG A;  4DU3 A;  4DV1 K;  3CIP A;  4W5R A;  2YHA A;  3VN5 A;  1Q9Y A;  1JLB A;  1P8Z A;  3KLH A;  3N4P A;  4JKF A;  5JVH L;  4KFB A;  4MQ3 A;  5KPR A;  4JI5 K;  3VMF B;  1X9M A;  2HHQ A;  3WEE A;  1B9D A;  3A8Y A;  4CEZ A;  3TR8 A;  4BG8 A;  4BRI A;  5FPM A;  1Z05 A;  3O3F A;  3M5R A;  3THX B;  1GOC A;  3IG1 A;  2WC9 A;  3TSU A;  3ULD A;  2EX3 A;  4WQ4 A;  2GV9 A;  1VSE A;  2E8A A;  4DR7 K;  2BGG A;  4X66 K;  3CM6 A;  3VTI A;  1K6Y A;  2YNG A;  5GAD P;  5CY4 A;  3D2F B;  3H1V X;  4WFA L;  3I8D A;  1ZBU A;  2BDP A;  4CHY A;  2B4J A;  2HHS A;  3O4Q A;  1HNI A;  4DLE A;  3AVC A;  1BI4 A;  2GWJ A;  3AA3 A;  4DSF A;  3THV A;  2QM1 A;  1OH7 A;  5GAG P;  3OYI A;  2EHG A;  5AQN A;  4IOC L;  3LWM A;  3VQ8 A;  5AJ3 K;  1RBS A;  1RT3 A;  3LAK A;  4JI6 K;  1BUP A;  4A61 A;  4NCA A;  4DTO A;  4FO0 A;  1B9F A;  3V9X A;  1LAV A;  1BA1 A;  3J81 O;  1TVR A;  3AO1 A;  5J1E A;  4B8C A;  4J2E A;  3OA9 A;  3I55 N;  3K5M A;  3ZX3 A;  4DFJ A;  4CEF A;  1IKX A;  4FZY A;  3VER A;  2ZWH A;  1W9H A;  3NF8 A;  2E2Q A;  3FLC O;  4IJA A;  3I8B A;  3ZLJ A;  4B1Z A;  3CXC M;  4JI1 K;  4DF4 A;  1ZBH A;  1WSH A;  4DV6 K;  1WSG A;  2KLA A;  4C8M A;  4FSV A;  4L8R B;  2KZM A;  1XNR K;  2F4V K;  1T05 A;  3S3N A;  4KHW A;  4IWV A;  1SKR A;  3CCE N;  3DOL A;  4WE1 A;  3RMC A;  3C95 A;  3EE8 A;  1R0A A;  4O44 A;  3LPT A;  4A59 A;  3THX A;  3SV4 A;  4GW6 A;  5IWA K;  1ZC6 A;  2IVP A;  3PO5 A;  4BRH A;  3QNO A;  2HMI A;  5LJV A;  1RIL A;  1BA0 A;  1VQ4 N;  5KQD A;  5JS2 A;  1D9F A;  3QML A;  4OVL A;  3D2F A;  1ATN A;  3CCQ N;  3IS9 A;  3KLF A;  2ZJP L;  4CD1 A;  5I42 A;  4ILJ A;  3MN5 A;  4CK3 A;  2WON A;  3SK3 A;  2GTD A;  1NJI O;  1C0M A;  4CZK A;  3NGZ A;  2HOE A;  1W97 L;  1SZ2 A;  5JIC A;  3KJV A;  5HBM A;  4FWN A;  2DFE A;  3T1A A;  4X62 K;  1YVN A;  2DFH A;  3KLI A;  3I0S A;  3VA0 A;  2OZS A;  2G8H A;  3HP9 A;  4JAX A;  4MDB A;  4DR3 K;  1NJW A;  1SL2 A;  1K8A O;  4O0J A;  3WQU A;  1JLC A;  4FJI A;  1KXP A;  3HST B;  4JI8 K;  2F96 A;  2FBX A;  3T69 A;  3L2R A;  3AVB A;  4OJR A;  5AQL A;  2NRZ A;  2P9U B;  3RSE A;  3HVT A;  2P9N A;  3SNN A;  3ZSR A;  4BRL A;  1YT3 A;  4M7X A;  3OYH A;  4I6M A;  3WXK A;  3KD5 E;  1REV A;  3TSQ A;  4LSL A;  3GBT A;  3DXM A;  5AZJ A;  4DV2 K;  5AFU H;  4MO4 A;  4WFN L;  1KVA A;  1IJJ A;  4CBX A;  3ID6 A;  5M1P A;  4ISE A;  4DR1 K;  1IBM K;  1ASW A;  3LP2 A;  4FK4 A;  4CHN A;  2HHT A;  3R1X A;  1X9W A;  4BC5 A;  1YJW N;  3DXK B;  4AF1 A;  1VSF A;  2ASM A;  2VGN A;  1BWF O;  4EAH D;  4CVN E;  1TK5 A;  3PV8 A;  2D1K A;  3EE9 A;  2ITM A;  5B8H A;  1CZB A;  1J5O A;  2XHB A;  4DV4 K;  4LY7 A;  4CZI A;  1KVB A;  3IUC A;  4LH5 A;  2E6M A;  3OW2 M;  3CM5 A;  4BRN A;  4CJL A;  1VRT A;  3KK1 A;  1X1P A;  1Q7Y O;  4B1Y B;  1FK9 A;  4JKE A;  1TL3 A;  3KTQ A;  1QZ6 A;  1TYQ A;  4CGF A;  1KQS M;  3T1H K;  3WNF A;  1GOB A;  2P9S A;  3E1Y A;  4CF2 A;  1L3V A;  3DRP A;  3LAL A;  2KHO A;  1RTH A;  4BRF A;  3PX0 A;  3KHY A;  3KD1 E;  2VQE K;  3VQP A;  4PUO A;  4KB1 A;  3WNE A;  3HPO A;  1TKD A;  4DG1 A;  3C6H A;  2E4L A;  4BR0 A;  2H3G X;  3EL2 A;  5AZI B;  1TKT A;  3E9L A;  4OLB A;  5BPL A;  2QI2 A;  3E9P A;  4ZTF A;  4CK1 A;  4FWR A;  3HYF A;  4B1V A;  4BE0 A;  3S9H A;  4KTQ A;  1VAZ A;  3AA5 X;  1NKB A;  3SPY A;  2V52 B;  2YKM A;  4H0Y B;  1IBK K;  5CZ1 A;  3BGR A;  4DSI A;  1LCU A;  3FGU A;  2E6L A;  2P9P B;  1VQ5 N;  4CEB A;  3NE6 A;  4DF8 A;  3BF3 A;  1VHX A;  2JWK A;  2G8W A;  4KB0 A;  4JI0 K;  3THY A;  5GIN A;  1T6D A;  2ASO A;  1KSP A;  2G8F A;  2OAN A;  1HJR A;  5BN9 A;  3KLG A;  4M3W A;  2GEL A;  3DM2 A;  2XY6 A;  3EEQ A;  5FRM A;  1C0F A;  4OPJ A;  5DM7 L;  3G25 A;  5BN8 A;  4OPA A;  4E1J A;  1HLU A;  3ENB A;  4LH4 A;  3IRX A;  2I7N A;  1DKG D;  4B3T K;  5BPM A;  3DLL L;  4CJP A;  3SJH A;  1RGI A;  1ZYQ A;  3OYG A;  2KW4 A;  2X6N A;  1S5J A;  2OTJ N;  1Q81 O;  4DTX A;  1JLE A;  4JD2 B;  3CHW A;  2Q31 A;  3HK2 A;  3S3O A;  1C0U A;  2CGL A;  3QET A;  4DSL A;  5AQT A;  3P5J A;  5BR9 A;  4FK2 A;  4RW8 A;  5DMR A;  3K9K A;  4E7K A;  3QIO A;  2A40 A;  4FWM A;  1BHL A;  3K9J A;  4N47 A;  4RW4 A;  3A2F A;  1XHZ A;  4YOX A;  2Z1I A;  4FLU A;  2GUP A;  3V4I A;  1WLJ A;  1JCE A;  3KK2 A;  3CFP A;  4CIE A;  3SBG A;  4HUF A;  1RTJ A;  4BVP A;  1ASU A;  4PA1 A;  5KRS A;  4JRP A;  4H5N A;  4F8R A;  3M6G A;  4K8Z A;  1DEJ A;  1S1V A;  4C8L A;  2D0A A;  4DQ8 A;  2CGK A;  3WNH A;  5JLH A;  4K41 A;  5EVZ A;  2P9P A;  3MMV A;  5GIP A;  1XMQ K;  3R9P A;  4I2P A;  3ATV A;  1WAJ A;  4CEE A;  3AVN A;  4KAZ A;  4ILG B;  2ZJQ L;  4OO1 J;  4V19 S;  3ZYY X;  4JI4 K;  1SKS A;  3CI5 A;  2D5R A;  2FF3 B;  2UU9 K;  4F3T A;  4X65 K;  5EY4 A;  3KVG A;  3JAM O;  1YHQ N;  4JK7 A;  1Y97 A;  1ZXO A;  4E19 A;  3K5O A;  4JS5 A;  3VF6 A;  3TAB A;  2RN2 A;  4IBN A;  4CJK A;  3CQ8 A;  1JKH A;  3CC7 N;  4DHY A;  4H03 B;  4EZ6 A;  4FWK A;  5FDL A;  2O8C A;  1JL2 A;  2AP1 A;  5M1Q A;  1WSE A;  1U45 A;  2FC0 A;  2ZM6 K;  2GWK A;  4HHT A;  3UKR B;  4N56 A;  1BCO A;  3AAR A;  2BAN A;  5C2F A;  4Q0B A;  4CJ3 A;  2QWP A;  3NMU A;  5M1O A;  4WFB L;  3PUF A;  3OHR A;  3UKU B;  4XH4 A;  4NLC A;  5KQ8 A;  2HHH K;  1XI1 A;  3WT0 A;  4LF8 K;  4KHY A;  1S9E A;  3LP0 A;  1VQL N;  4E1N A;  4KHU A;  3NH1 A;  3U6F A;  2P9I B;  1IG8 A;  3VQC A;  2RKI A;  3P38 A;  4Z0U A;  4ISG A;  3QIP A;  4BE1 A;  1L3T A;  3VTH A;  2OYQ A;  4JKB A;  3O9S A;  2Q0R A;  3HP6 A;  1DTT A;  1TK8 A;  1TKX A;  4BRD A;  4DTR A;  3VQE A;  4MLH A;  4Z4F A;  3L4I A;  1GLD G;  4F2R A;  1NGG A;  1RDW X;  3NCI A;  1QSY A;  1TKZ A;  3GG4 A;  4GY2 B;  4HCC A;  1TUY A;  2VWK A;  3LAM A;  3V9W A;  3ZT4 A;  4QCL A;  1YTA A;  3M8S A;  1X9S A;  2WUS A;  5KTQ A;  1Q9X A;  4FLT A;  5E26 A;  3O08 A;  3L4Q A;  3WNG A;  4F4K A;  4LC9 B;  4ICL A;  1NK5 A;  4RW9 A;  3O9T A;  2P9K B;  4B08 A;  4PL8 A;  3W0L A;  1EKE A;  3VEW A;  3ZEU B;  3LZI A;  1EWQ A;  2GEM A;  5I3U A;  1XNQ K;  3VQ9 A;  3MWP A;  4Z4H A;  4PQU A;  1NKE A;  3VQA A;  5JMV A;  2QWO A;  4E0D A;  4IOX A;  4RCH A;  3WXI A;  1T6C A;  3NGY A;  1VQN N;  3UB5 A;  2HBL A;  3C6A A;  5A2Q O;  4BRP A;  1ZBL A;  3NBP A;  2AJQ A;  4W5T A;  3ID8 A;  4G1Q A;  4JKC A;  1A5V A;  4YDU A;  4KBO A;  3V9U A;  3LZJ A;  1X9J A;  3C94 A;  2QKK A;  3MX5 A;  4LFA K;  1DT9 A;  4F9O A;  3ZET B;  3LM9 A;  3HM9 A;  3O5B A;  2JGU A;  2IVO A;  4BRA A;  2YKN A;  4IDH A;  2ZQB A;  4M3R A;  4O5B A;  3CJ7 A;  1NJZ A;  2QTD A;  1QQM A;  4CD3 A;  5FPE A;  3CQX A;  2NRW A;  4PKG A;  3QEW A;  3SQ0 A;  3HZ6 A;  2I5J A;  3MCP A;  4FLZ A;  1BQM A;  1I39 A;  2NRX A;  4DTP A;  2UXC K;  4OPH A;  5F0X A;  3QDK A;  1D5A A;  2P9L A;  4DFP A;  3J80 O;  3P4I A;  5K14 A;  2OCE A;  3TWH A;  3ULE B;  1WUA A;  3U3G A;  4G9Z A;  3MCA B;  3FE1 A;  3VEN A;  4M63 C;  1EET A;  3DMJ A;  3FZM A;  3SMP A;  3AO2 A;  5CE3 A;  4JI7 K;  4R79 A;  4NCG A;  2OTL N;  4NYF A;  4L3Q A;  4A5A A;  4B8A B;  3O3H A;  4DTJ A;  4J2D A;  3CCU N;  4FZZ A;  2J4R A;  3L3V A;  5KPZ A;  5KRT A;  3T3F A;  3MK6 A;  3SUQ A;  4CFB A;  3MXI A;  3G71 N;  2PYL A;  3KZB A;  4U67 L;  3SJJ A;  5FLX O;  4WF9 L;  5C25 A;  1BQN A;  4KH4 A;  4ZHR A;  4HCB A;  3MXJ A;  4WYB A;  1VSM A;  3DJC A;  4CEA A;  1NLV A;  2DTU A;  1S1T A;  1YUW A;  2D0P A;  4H4M A;  2HBJ A;  1HNZ K;  3ENO A;  3CFR A;  3ZET A;  5AR0 A;  3AGR A;  4CEQ A;  4WQ4 C;  3F5T A;  1NGE A;  3EO3 A;  3BY5 A;  3ASM A;  1NGH A;  5C10 A;  1N8R O;  4LD0 A;  3MWT A;  3KWG A;  3AVM A;  4J2A A;  2P51 A;  4FJL A;  4JI2 K;  4DTM A;  1NGF A;  4M3U A;  3AA2 A;  2CH6 A;  3HVR A;  3SI6 A;  4KKO A;  4BRO A;  1ITG A;  1SL1 A;  4NYN A;  1EXQ A;  2ETJ A;  4DCH A;  3HOT A;  3O1W A;  2QK9 A;  4ZTJ A;  1SS6 A;  4CI6 A;  4DV0 K;  3C65 A;  4BRG A;  4JKG B;  3FZH A;  1HYZ A;  5SZT A;  3V6D A;  1WBD A;  4FJG A;  1J9A A;  4OKE A;  1OVY A;  5HRP A;  2A5X A;  5GIO A;  3ZT1 A;  1MWM A;  4E3S A;  1E4F T;  4FWP A;  1KAY A;  4Z94 A;  1X3N A;  4K8X A;  1WNS A;  2E2O A;  1YIT N;  1MWK A;  3HI0 A;  1EQY A;  1Q18 A;  3QEI A;  3TAG A;  3ENH A;  4QAG A;  3OYN A;  4Y1D A;  3EZW A;  1VQ9 N;  4RWT A;  2CGJ A;  2OA8 A;  3MN7 A;  3KK7 A;  3C6T A;  3KLE A;  4DQQ A;  3CJB A;  4PHT X;  1S22 A;  2VG6 A;  3DRS A;  1WAF A;  3ZSO A;  4CJR A;  4DTU A;  1HQU A;  4K43 A;  3WXM B;  4KPY A;  3FZF A;  5BR8 K;  1XC9 A;  4B9Q A;  2WFB A;  4C8O A;  3CPE A;  4BRM A;  2A42 A;  3H1Q A;  2QWL A;  2VG5 A;  3WUH A;  4YOW A;  4FXD A;  2RHK A;  2FSK A;  4AHU A;  2OPP A;  3VES A;  3P31 A;  2PYJ A;  3VF4 A;  1NMD A;  4B3S K;  2I7P A;  3LAN A;  2JLE A;  1QHA A;  4JKD A;  4EP5 A;  2O8B B;  1QQO A;  4AM7 A;  1NGA A;  2X74 A;  3CJ1 A;  2NUB A;  5AQH A;  3N4Q A;  1NJX A;  4RG8 A;  3U9Z A;  4CER A;  4LSN A;  3WXL A;  4OX9 K;  5AQW A;  2O4G A;  3U4L A;  3AA4 A;  3K57 A;  4GVE A;  3K5N A;  2F9W A;  3AY9 A;  1QVG M;  3D2E B;  3RR7 A;  5HRR A;  4WCE L;  1N34 K;  4AM6 A;  3SAF A;  3SQ2 A;  4CJU A;  4JKH A;  4KH6 A;  4O8K A;  5AFU A;  3FZK A;  4PKI A;  3I0R A;  4WQ5 A;  3LDS A;  3AVL A;  2F9T A;  4HUE A;  1ASV A;  4X64 K;  3QB0 A;  3A5O C;  4IFE A;  1JXB A;  3OYB A;  4N41 A;  4FJJ A;  3VPZ A;  1D9D A;  1Z25 A;  1HNW K;  4AHV A;  1MA9 B;  3O6W A;  3F73 A;  1J54 A;  2XO7 A;  3V1O A;  3KWI A;  3SCX A;  1KD1 O;  2WBN A;  1U4B A;  3RMB A;  3M1F A;  3TAF A;  3PX4 A;  3AVF A;  2VG7 A;  1RBT A;  5HLF A;  2PY5 A;  1S9G A;  4IG3 A;  1NGC A;  4GV3 A;  2B5J A;  4QOZ B;  3SUP A;  2QKB A;  3VQ7 A;  4FZX C;  3ZT0 A;  1Q8I A;  2QWR A;  3THW B;  4Y0W A;  3KIO A;  4Z4C A;  4BAC A;  4CZJ A;  1HNV A;  4J8F A;  4E7I A;  3HOS A;  2XY5 A;  4NCB A;  4DKW A;  1NK8 A;  4R5P A;  1U47 A;  4H0P A;  2RE2 A;  4DSE A;  4A2A A;  4EHT A;  2A1R A;  4MLE A;  1J53 A;  2YNF A;  1B92 A;  3SZ2 A;  4M7Y A;  2W6L A;  3HBT A;  1C1B A;  1FKO A;  2E1Z A;  4E7L A;  5C42 A;  3NFA A;  3NAE A;  2Q3S A;  3BZC A;  5LY3 A;  4DUZ K;  4I9Q A;  4OPK A;  3QO9 A;  4NXM K;  3MEG A;  1VSI A;  1V4T A;  4GKK K;  4BR2 A;  2RF2 A;  4O5F A;  4DS5 A;  4ILH A;  2P9U A;  2V7Y A;  3PSF A;  3U8X A;  4IZ9 A;  1SKW A;  3EYZ A;  4DSK A;  2FF6 A;  3D2E A;  2O8D B;  4AH9 A;  1E3M A;  1ATR A;  3NF7 A;  3QES A;  4JKA A;  1C1C A;  1T44 A;  2E2N A;  1HUX A;  1HPZ A;  3LPU A;  3OYD A;  1NM1 A;  4KI6 A;  1W0H A;  2A3Z A;  2O8E B;  5M1K A;  2VQF K;  2UXB K;  3F9M A;  4DV5 K;  1HYS A;  3PY8 A;  3CET A;  5F1X A;  4H0O A;  3D7E O;  3SMS A;  4OKK A;  4CHO A;  2O8F B;  3VQ6 A;  1NBW A;  4DS4 A;  4DTN A;  3DXK A;  1HNX K;  1NK0 A;  4BQZ A;  4BC4 A;  1BO5 O;  4KRF A;  3DI6 A;  3HJF A;  5I9E B;  3GL1 A;  3TAE A;  4LF7 K;  2ASP A;  3GDQ A;  5J2P A;  1XMO K;  3CPW M;  1LW0 A;  4LF6 K;  2Q97 A;  5AQY A;  4HTL A;  1T8E A;  4K0K K;  3TAM A;  4BRQ A;  2G8U A;  2E1Y A;  1FKP A;  4CFA A;  3NH2 A;  2UUA K;  5KGX A;  4NXN K;  2UUC K;  2HST A;  3OJS A;  4FK0 A;  1KAX A;  3PO4 A;  5AQR A;  3THW A;  5E41 A;  1EO1 A;  1VRU A;  4H0X B;  2D0O A;  3HSC A;  3WXJ A;  4IXC A;  3CCM N;  1Z26 A;  4M45 A;  1RTI A;  1NU0 A;  3OYA A;  3O8M A;  3AVG A;  3DLB A;  1NGI A;  2QW9 A;  4C1N K;  5AZI A;  1TV6 A;  3AO4 A;  4H0T B;  3I56 N;  5ADX H;  3VEO A;  2QA4 N;  1TK0 A;  1QQC A;  1W2B M;  1L5U A;  1S1X A;  3VEX A;  2W40 A;  1UOC A;  4BR7 A;  4BC2 A;  1NGJ A;  3MAQ A;  1ZBS A;  4ELU A;  3EKU A;  4CED A;  1XUP O;  3VEZ A;  1LAW A;  1QE1 A;  4JS4 A;  3CQY A;  4JRQ A;  3VOV A;  3ZSX A;  1EX4 A;  3MED A;  4E89 A;  4CCH A;  2HND A;  1U2V B;  4KTZ A;  2YI1 A;  4JYA K;  1U48 A;  3NHG A;  2W41 A;  1UAX A;  3PSI A;  5TKY A;  5JVG L;  2HNZ A;  5AQJ A;  2YNH A;  3BF1 A;  4JEP A;  1S6Q A;  4CGG A;  4BGB A;  3LDO A;  3JXU A;  4AHR A;  1T03 A;  1VK0 A;  1CXU A;  4FLX A;  4DU4 A;  3CJ9 A;  3L0Q A;  3CMA N;  4FJK A;  4M42 A;  3J7A P;  5AQO A;  2VWJ A;  1YJN N;  4F3O A;  1R59 O;  4HUG A;  2WTU A;  3NDK A;  4CJ7 A;  3V1Q A;  1K9M O;  2PFU A;  4CGJ A;  2HVI A;  5IT9 O;  2NZT A;  4ID1 A;  3OY9 A;  5C12 A;  3TAP A;  1VSD A;  2P1J A;  2R7Y A;  4JD2 A;  4HWI A;  1RDC A;  3MN9 A;  4CZL A;  3O80 A;  4M3X A;  4CFD A;  3P83 D;  2ZGY A;  3LDN A;  4LFB K;  3JS6 A;  1NKC A;  4EIA A;  4B9S A;  1IKY A;  4EFH A;  3H45 C;  4DQS A;  1DGK N;  1WSJ A;  3V9S A;  2G8I A;  3G4S N;  1NK4 A;  5HRO A;  1NG9 A;  4AHS A;  2XY8 A;  4CZF A;  2Y1I A;  1LWE A;  3J7Y P;  2PAV A;  3DRR A;  4IEI A;  2KZZ A;  5JS1 A;  4FLW A;  4FWQ A;  2EWS A;  4XIU A;  3OYM A;  1VSL A;  4ELT A;  1GOA A;  1QSL A;  1LWC A;  5CYM A;  2A1S A;  3T7Z A;  4BGA A;  1FJG K;  1EWR A;  3MDQ A;  5TKW A;  1HRH A;  4IKF A;  2Z1J A;  3OYK A;  1QVF M;  2D4W A;  3KKS A;  1O13 A;  3SAH A;  4JHD B;  4B9V A;  3OYF A;  3VGK A;  3AVH A;  4CF0 A;  3A5N C;  5AQP A;  1HPM A;  1TAU A;  1X3M A;  4CHQ A;  1K8K B;  3M8R A;  4KHP K;  5C15 A;  4FOI A;  2HNY A;  3C0B A;  2UXD K;  2NLX A;  1QTM A;  1RBR A;  3O4N A;  1BIS A;  1UWB A;  2OPQ A;  1A5W A;  1XHX A;  4B9M A;  3DLR A;  1BIZ A;  3CCV N;  4CBU A;  1YAG A;  2D0B A;  1QZ5 A;  2CH5 A;  3UKR A;  2IIR A;  3O9Q A;  3G0Z A;  1VSH A;  2BUP A;  2V51 B;  3BZK A;  4BDY A;  1S72 N;  3B8A X;  4IFY A;  3AGK A;  3UKU A;  3HPG A;  1IG9 A;  1WSF A;  1YIJ N;  1YXQ A;  4KH5 A;  1RBV A;  4B9U A;  2KFZ A;  1J5E K;  2YX6 A;  3DLK A;  4JN4 A;  3AAQ A;  4YNQ A;  1IBL K;  4FJ8 A;  3WEE B;  3BP8 A;  3MEE A;  3L2U A;  3L8B A;  2P9I A;  4H5T A;  4RW6 A;  2X6S A;  3ATU A;  3RTV A;  1SUQ A;  4H5V A;  3CCL N;  2A41 A;  3VQ5 A;  2IVN A;  2NRV A;  3EN9 A;  3J7Z O;  5SWM A;  4HTU A;  2KTQ A;  2UUB K;  3KKR A;  4RW7 A;  4A2B A;  2OZM A;  4BRK A;  1U04 A;  2IGI A;  3Q7C A;  4E7J A;  2P5O A;  2GBZ A;  1BI4 B;  3CJA A;  4JV5 K;  4N76 A;  2KQ2 A;  3HL8 A;  1RT1 A;  3QBW A;  3AO5 A;  5AQU A;  4IO8 A;  4BRE A;  5CYQ A;  1I3A A;  1RBU A;  1N32 K;  4PY5 A;  3O9R A;  4IFV A;  1TGO A;  4FJN A;  5LL6 Z;  3OYL A;  1M90 O;  3OVN A;  3GOI A;  2P9K A;  3QIC A;  4YOR A;  3FFI A;  4DTS A;  4GV9 A;  1WBB A;  3L2Q A;  1S6P A;  3M8P A;  3R6M A;  3ZEU A;  1HKC A;  5MLC Q;  3JYT A;  3DYA A;  5BRD A;  4FWO A;  3OYE A;  5M1F A;  3ZSW A;  4BVO A;  4LF5 K;  1RNH A;  3TTF A;  1N36 K;  4CGH A;  2HVH A;  2FSJ A;  1C0T A;  4N5S A;  4Z4G A;  2Q2R A;  1I94 K;  1RDD A;  1SL0 A;  4DFK A;  2UYT A;  5GAE P;  1KC8 O;  3QEV A;  4K42 A;  3L2V A;  1HKB A;  3CER A;  4DQI A;  4DWI A;  1HYV A;  3S3M A;  3EY1 A;  3CME N;  1WOQ A;  2HW3 A;  4GMJ B;  4B9L A;  1HJO A;  4ELV A;  4KHN A;  4CZH A;  3AVK A;  1ATS A;  5KI6 A;  4GNI A;  3H6E A;  3EKS A;  4BR9 A;  1JCF A;  1BOT O;  1BL3 A;  4JK9 A;  3AVI A;  3TAN A;  1JLA A;  3V81 A;  1HX1 A;  4GKJ K;  4IDK A;  1UA1 A;  3SQ1 A;  1NNE A;  2NRH A;  3ZT3 A;  5AQX A;  5J2Q A;  4CZG A;  3M8Q A;  4PL7 A;  2PBD A;  1UA0 A;  3FZL A;  4CF1 A;  1RT2 A;  3CD6 N;  3LDP A;  1NJY A;  3O1B A;  2Q36 A;  1V4S A;  4ISF A;  3ZX2 A;  4U7B A;  1QS4 A;  4M41 A;  4YFU A;  3VQB A;  1RDB A;  3ULE A;  3V1R A;  4J2B A;  4KHS A;  4A5B A;  4I9L A;  3D45 A;  4LF9 K;  4Z4I A;  3D0P A;  4QS8 A;  4CES A;  4PWD A;  1OKJ A;  4CF8 A;  4CGD A;  3RMA A;  4CE9 A;  1NOZ A;  1XQS C;  3RSE B;  2P9N B;  1KFD A;  4O4G A;  4I6M B;  3NH0 A;  1NK7 A;  2ITG A;  1IH7 A;  3DXM B;  3G10 A;  3LL3 A;  5AZJ B;  1QQN A;  4FJH A;  2HHW A;  1YF5 L;  5CHI A;  3CC2 N;  3A5L C;  1KLN A;  4B3M K;  3QBX A;  3OYC A;  3PLA A;  4CJ5 A;  1OH6 A;  4BY9 C;  2Q1N A;  3BUZ B;  3F9K A;  4XEI A;  4CZM A;  4IEE A;  5HL7 L;  4B1U B;  3HRG A;  2F7T A;  4KHQ A;  1RT7 A;  4CBW A;  4CHP A;  1BGX T;  3IDH A;  4CGI A;  2YHY A;  3B6P A;  2A6A A;  4IJN A;  4FJ7 A;  2XY7 A;  3VGL A;  3L2W A;  3OYJ A;  4FJX A;  3T19 A;  3F2K A;  5FRO A;  3E9O A;  5CR4 A;  3U9D A;  4CW7 B;  2YCH A;  3K5L A;  3AVJ A;  1BIU A;  1OH8 A;  4M3T A;  1TYQ B;  3IKM A;  4MFB A;  2NRR A;  4BWJ A;  4DMN A;  2P9S B;  3P1G A;  3RWU A;  1BDG A;  1VQ7 N;  4C1N I;  4IG0 A;  3BEX A;  3ALY A;  3TI0 A;  1VQK N;  2IAJ A;  1ZBI A;  3DOK A;  4FL9 A;  1YVU A;  4H4O A;  3CC4 N;  4FCY A;  5M1N A;  3HPH A;  1NMN A;  1F21 A;  4CJ4 A;  2QWN A;  2ZF5 O;  4JKG A;  4C23 A;  4EP4 A;  3UE5 A;  2HBM A;  2BE2 A;  4RTF D;  4FWS A;  5HOO A;  5AQG A;  3M3Z A;  1VQP N;  2PZS A;  4JNE A;  1JLG A;  4KRE A;  1BG3 A;  1A5X A;  1GLC G;  2ZE2 A;  1MDU B;  1XC3 A;  3SBT A;  2OPS A;  3B6O A;  3A0I X;  2XRI A;  3ZSQ A;  2QWQ A;  2ZD1 A;  4WQ5 C;  3HXM A;  3OBY A;  5CZ2 A;  3ZCM A;  5AQS A;  3THY B;  3BDP A;  1RDU A;  3H46 O;  4DR2 K;  3R3L A;  3MN6 A;  3ZSY A;  4FJ5 A;  4OKJ A;  3QIN A;  4BWM A;  5EXW A;  2IDO A;  2P5G A;  3A5M C;  2DPN A;  5EOY A;  1OH5 A;  2O4I A;  4AHT A;  4YOU A;  1KVC A;  3SLC A;  1OVQ A;  2FLO A;  3QEP A;  2X78 A;  2O8B A;  2D0C A;  3O3G A;  4OGE A;  1LV5 A;  3HO1 A;  4QS7 A;  4DSJ A;  1GLF O;  3RRG A;  3QFP A;  1C6V A;  4FM0 A;  1VSJ A;  3PIO L;  3ZSZ A;  1S1U A;  4YHH K;  4B9N A;  3TAQ A;  2Z1G A;  3DAW A;  3K0S A;  4I7F A;  1VQ8 N;  4JK8 A;  3C6U A;  4CEO A;  2HHV A;  1FXX A;  3VGM A;  2FBY A; 
#chains in the Genus database with same CATH homology
 4DV1 K;  4K0K K;  1HNW K;  4GKJ K;  5IWA K;  4DV0 K;  3T1H K;  1IBL K;  2UUA K;  4NXN K;  2UXC K;  2UUC K;  4DV3 K;  3J80 O;  3T1Y K;  4JI5 K;  2VQE K;  3J7Y P;  4DR6 K;  2UUB K;  4DUY K;  4LFC K;  4DV7 K;  4DR7 K;  4X66 K;  4JI7 K;  1XMQ K;  4JV5 K;  4LF9 K;  4X62 K;  1HR0 K;  1FJG K;  1N33 K;  4DR3 K;  1N32 K;  4V19 S;  1IBK K;  5LL6 Z;  4JI4 K;  5BR8 K;  2UU9 K;  5FLX O;  4X65 K;  4DR2 K;  4JI8 K;  5AJ3 K;  4LF4 K;  3OTO K;  3JAM O;  4JI6 K;  4DUZ K;  4JI0 K;  4B3R K;  4KHP K;  1XNQ K;  4JYA K;  4NXM K;  2UXD K;  3J81 O;  4GKK K;  4B3M K;  4B3S K;  4LF5 K;  1N36 K;  4DV2 K;  4DR5 K;  2E5L K;  2ZM6 K;  4DR1 K;  1HNZ K;  5A2Q O;  1IBM K;  5LMN K;  1I94 K;  4DR4 K;  3J7A P;  4B3T K;  4OX9 K;  2VQF K;  4YY3 K;  2UXB K;  4DV5 K;  4JI1 K;  4LFA K;  4CVN E;  4DV6 K;  2HHH K;  5IT9 O;  4AQY K;  5LMU K;  1N34 K;  4LF8 K;  1XNR K;  4YHH K;  2F4V K;  4JI2 K;  1HNX K;  4CW7 B;  4DV4 K;  4JI3 K;  4LF7 K;  4X64 K;  1XMO K;  1J5E K;  4LF6 K;  4LFB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...