2VQEK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqeK00
4DR7K 2UUAK 4DV5K 3OTOK 4JV5K 5FLXO 4JI2K 1N34K 4B3RK 4LF6K 4JI3K 4DR1K 2UXDK 4DV3K 1XMOK 4AQYK 2UUCK 2F4VK 5IWAK 4DR5K 4DR2K 1FJGK 1HNXK 2VQFK 2UU9K 4DV6K 1N36K 4X64K 2UXCK 4NXMK 4DV1K 4JI4K 4YHHK 4JI5K 1HNZK 5LMNK 5AJ3K 1XNRK 5IT9O 4JI0K 2ZM6K 1IBMK 3J7AP 1J5EK 4DV4K 1HR0K 4DV7K 4JI6K 4V19S 3JAMO 4KHPK 2E5LK 4GKKK 3T1HK 4LFCK 4X62K 4LF9K 4DR6K 4LFAK 4DR3K 4LFBK 1XNQK 4LF8K 4CVNE 4LF7K 5BR8K 4X65K 1N32K 4OX9K 3T1YK 2UXBK 4DR4K 4DV2K 4X66K 4LF4K 3J7YP 4JI7K 4LF5K 1IBLK 4YY3K 4K0KK 1N33K 1I94K 3J80O 1IBKK 4B3TK 4CW7B 1HNWK 2VQEK 4B3MK 5LL6Z 2UUBK 5LMUK 4DUYK 4JYAK 4GKJK 1XMQK 4NXNK 5A2QO 4B3SK 3J81O 2HHHK 4JI8K 4JI1K 4DUZK 4DV0K
chains in the Genus database with same CATH superfamily
3ENBA 4EP4A 4DV5K 1VSEA 1JLEA 5B8HA 3M3ZA 3L4IA 1BDGA 4CF0A 2HMIA 4JKFA 4A2AA 2OPPA 5JVHL 5GINA 3O6WA 3K57A 1N34K 2I5JA 1S1XA 2IAJA 4BWJA 2Q31A 1X3MA 1TKDA 1QSYA 1MDUB 4IO8A 3OYCA 4KO0A 3PY8A 3EE8A 2P9UB 3ZX0A 4CE9A 4I6MB 4FLWA 5AQNA 2G8UA 2GELA 1VQ4N 5KTQA 3AO2A 3QICA 2CGKA 3K9JA 1XNRK 4JI0K 5E41A 4M41A 3G6EN 3U3YA 3SYZA 3KK2A 4BDZA 4Z94A 4PQUA 1WSIA 3P39A 3AO5A 3DM2A 3PX4A 1IG8A 3FGUA 3D2EB 4MDAA 4DR3K 3ZT4A 1NGGA 2HHTA 4XIUA 3KK7A 3ZLJA 3VQ8A 5AQXA 4ILGB 1EKEA 4OKKA 4CIFA 1FK9A 3EE9A 3CC4N 3J7YP 1FXXA 2VG7A 3O3HA 2HNDA 4LH4A 2O4IA 5FDLA 2P9KA 1RDCA 5AQVA 1TKXA 3F2KA 2BUPA 3RWUA 4CHNA 4FWQA 4CIGA 4YOWA 3CIPA 4N56A 3OYKA 3SZ2A 1J5OA 1WN7A 4QS9A 2QM1A 3A5MC 1U04A 4CZGA 4B3SK 1NMDA 1KLMA 4RW6A 3O9RA 3M5RA 4JI1K 3L3UA 1BWFO 3C7NA 3W3DA 4QAGA 3OTOK 3DLGA 3RTVA 2XY6A 1Q9YA 1C0FA 4CHPA 3DXKB 5BN8A 2BDPA 4WF9L 4DFPA 1E4GT 5I3UA 2HF3A 4EFHA 1GLDG 3DRPA 4BRCA 4Z4HA 4YFUA 1LW0A 1KVAA 3WXIA 2O8FA 2YKMA 1C0MA 1VSDA 4BE0A 3TSUA 4R5PA 4BRMA 2FBYA 1OKJA 4JI5K 5LMNK 1QVGM 3VQ4A 2AJQA 2QXFA 1GLFO 2A41A 1YITN 2OZMA 3GL1A 4XH4A 4CGJA 3NFAA 1LOTB 3WNGA 3HTVA 4PKGA 4LFCK 3JXUA 3C94A 3L2RA 1KSPA 1IH7A 3PUFA 2QWLA 3O3FA 3N4QA 3N4PA 4NYFA 4WQ4C 5HLFA 5EVZA 2V52B 4FYDA 4LFBK 4DFJA 3THVA 1BA1A 3L6QA 4JS4A 3TTFA 5JLFA 4ID5A 4AHCA 3QIOA 1HPZA 4FWPA 3R1XA 4ELTA 4PY5A 1J53A 2I7PA 2E6LA 3D2FB 4B9NA 3LM2A 4DQQA 4DCHA 4DG1A 2IIRA 2P9IB 2ITMA 5C42A 4FZXC 2P1JA 4NCGA 1GLCG 4AHSA 4EHTA 2FXUA 2UYTA 4E1NA 3H46O 3NF9A 3SAFA 1HKCA 4ZTJA 2QWQA 5AQKA 1RDBA 2XY7A 3VA0A 3ZSRA 3LANA 2UUBK 2DFFA 5AZIB 1LCUA 1WBBA 2W40A 5ADXH 2WC9A 5M1NA 4DUZK 1BUPA 4FM0A 3NGZA 5AQQA 4AHRA 1ITGA 2HNZA 3CM5A 2NUBA 5AZJA 2E20A 5J2QA 4DFKA 2VG6A 2NRVA 1KFSA 1SV5A 2HW3A 3I0SA 4FJNA 3HPHA 4E7HA 3ZEUA 4CGGA 1L3VA 2QW9A 1HUXA 3NBPA 4DQIA 2QWPA 3C6AA 1HNXK 2XO7A 1VK0A 3SAHA 1VQ5N 3CMEN 2E8AA 3VGLA 4U67L 3P5JA 4JKAA 1RDUA 2KW4A 3LWLA 4CHQA 1RT5A 1NOZA 4YHHK 1RTJA 3WQTA 2WTUA 2HHUA 4C1NK 3ASMA 5AFUA 4ISGA 2E1YA 1VSFA 3MMVA 3CJCA 1HYSA 3ID6A 3LP3A 3AVHA 2NNWA 2YNIA 4XEIA 3EY1A 3MEDA 1SAZA 5HL7L 3V81A 4DTNA 2D0OA 3NAEA 3ZYYX 4OX9K 5GADP 1OH7A 2BANA 1YTUA 2QA4N 1KD1O 4I2PA 4OPKA 4JI7K 4M3YA 1S1VA 1VQON 4FJKA 1J54A 3KLGA 2DY4A 2X6SA 3DOKA 3PSFA 5BPLA 4BVPA 5ELZA 5KQ8A 4F2RA 4A2BA 1RTIA 1YTAA 1BHLA 3A8YA 5GIPA 1KVBA 4AHTA 5DMRA 2HSTA 3IFRA 1B9DA 4FPBA 3E66A 4OO1J 1JXBA 2V7ZA 4DQPA 5HBMA 4FL9A 3CFOA 3WNHA 3K5LA 3CG7A 1HYVA 2HB5A 5AQHA 4KPYA 4CJUA 4CD1A 4A59A 3IRXA 4ELVA 5FRMA 3PV8A 4CJTA 5BRDA 1JXEA 2DPNA 3D2FA 3DXMB 3VGMA 3CHWA 4JD2B 4OVLA 4CFBA 3EN9A 2HBJA 5EX5A 1RT6A 4JHDB 4B9UA 1SZ2A 1U2VB 4B9MA 2X6NA 1HPMA 1YXQA 3ZT2A 3QFUA 3VERA 3FZKA 3VF6A 4BR2A 3OYEA 2RHKA 3RMAA 3AGRA 3KTQA 2D0AA 3GDQA 2Q0RA 3UKUA 3DRRA 1G15A 3V6DA 3SV3A 4IFVA 3P38A 4E7JA 3CFPA 3SUOA 4EHUA 4L3QA 3ULEB 4CJPA 4C8OA 2PAVA 3ISNC 4AH9A 1MWKA 3KK1A 3MXIA 2ASOA 3T1AA 3RR7A 2A1SA 3SQ1A 3VEVA 4RCHA 2W6KA 3FZHA 4OJRA 4DR6K 4DTUA 2O8BB 4EP5A 4BQZA 3CYMA 3H3NO 5HP1A 1VSLA 3TAEA 2VWBA 3ENHA 1ZBIA 3NF6A 4JKCA 4DTPA 4HHTA 3OYHA 2KKZA 4DF8A 1JLQA 3A5OC 3HVTA 1EWQA 1M1KO 2RPIA 2QKKA 1JCFA 1TL1A 2FBVA 3AVNA 3HT3A 1EP4A 2XY8A 3B6OA 3HPGA 3UKRA 4RTFD 3MX5A 2OPQA 4CFDA 3LP1A 2HF4A 3MECA 1C1CA 2CGJA 1TK0A 3B6PA 1J6ZA 3WNFA 4J2EA 3VENA 1NGFA 3H6EA 3AVJA 4FWSA 1XMQK 3KLHA 4BR0A 3HM8A 5AQJA 4ILJA 4DV0K 4FWRA 4CGDA 4JKBA 3KD1E 3ZSYA 3QEPA 1KCFA 4CZFA 2E2NA 3CJ9A 2IVNA 2F9TA 3AARA 4IJNA 2QWMA 3VQDA 1NJWA 3C0BA 4B8CA 4N41A 3K2PA 2P9NB 4JI3K 4H0OA 4DS5A 4H5NA 3TAGA 5AZJB 3V9XA 4AHUA 1A5WA 2ITGA 1K8AO 5C25A 3EEQA 4DR5K 4PA1A 3AA3A 3KLEA 1HNVA 3D2EA 3RR8A 1QHAA 4DF4A 4DV1K 3R3LA 5EXWA 4RW9A 4KHWA 1U4BA 5LJWA 1HNZK 4CHYA 4YOYA 2KTQA 4M3TA 3A2FA 3SI6A 2HHVA 2D0BA 2FBXA 3NH2A 4FCYA 1X9SA 3ULEA 4WYBA 2KZZA 4W5NA 4HTLA 4W5TA 1B92A 3LL3A 4CGIA 1BI4A 2NRWA 3NHGA 4CZJA 1QQCA 2F9WA 4JLHA 4AILC 4KH6A 3ENOA 3VQ9A 1X1PA 4DTJA 1CZ9A 2RN2A 4OGEA 4LSLA 5KI6A 3CC7N 1TGOA 3NH0A 2GBZA 2FLOA 4BE1A 3MX2A 4UY8O 4AHVA 1N33K 1IG9A 1X9MA 3KWGA 4MO4A 2O8EA 3J8AA 3O80A 1LWFA 3AA4A 4MDBA 4CIEA 1QZ6A 3I55N 3DLBA 1JKHA 1GOAA 5F1XA 3EZ5A 4OPHA 3OYNA 3BF3A 4WFAL 1Q81O 4WFBL 1HYZA 2QWRA 4NYNA 3V1RA 3VF2A 3HXMA 5EU7A 1BA0A 2B4JA 2Z1JA 2YHBA 3AVBA 1TV6A 1A5VA 5F2RA 4F2SA 1C6VA 4I7FA 5C2FA 1ZYQA 1ZBUA 4C1NI 3MWPA 1NMNA 4FJ8A 1EXQA 1EWRA 1MWMA 4BRDA 3V1QA 1NK0A 1Y64A 4DQ8A 1EX4A 3VEZA 1XHZA 4ISFA 1HJRA 2P9SA 3M6GA 1M90O 3OYJA 4JKHA 4CJ5A 4NXMK 3T19A 2YKNA 4JK7A 4F8RA 2IC3A 3JS6A 4JI4K 4KHUA 4I9LA 4FLXA 3FFIA 1YUWA 3O9SA 1SKSA 3MEEA 3UIQA 4Z4GA 3KIOA 4Y0WA 2HVIA 5KRTA 1HR0K 2Q2RA 4CERA 4KHPK 1X9JA 3AVLA 3EKUA 4DFMA 1BQNA 2E2QA 3L2QA 1Q82O 4FJXA 3G10A 4I2QA 1RBUA 3CETA 4A5BA 4MQ3A 4FWKA 4KREA 4RW8A 2HMPA 3ZSXA 4BR9A 3MCAB 4J8FA 2Q97A 3SPZA 3E9OA 1FW6A 5K14A 3K5NA 3PIPL 3MEGA 4X66K 1W97L 4JHDA 1CZAN 3SCXA 1RNHA 1NGIA 1L3UA 2F7TA 4JKEA 3F5TA 2YJFA 4C8NA 4Q5VA 3KKRA 3AO1A 3U4LA 3MN6A 3M1FA 3QESA 3O9TA 3U3GA 4LC9B 4YOVA 2JLEA 3OYMA 1VHXA 3WT0A 1LW2A 4FVUA 3IS9A 5CZ1A 3ATVA 3AVMA 2HHHK 4KB0A 4I9QA 3DOLA 1WSJA 4B1ZA 3SUNA 1CLQA 3BP8A 5MLCQ 3CJ7A 2UUAK 4H0VB 1RBSA 3F9KA 5EY4A 3EKSA 3OYAA 5KGXA 2QK9A 1Q9XA 3L2UA 3QERA 5BPNA 3RMBA 3TSQA 2BTFA 4KTZA 4OPAA 4IG3A 3LWMA 3GOIA 5KPZA 2D1KA 3U8XA 3F73A 4KHYA 3K0SA 4JD2A 1S1UA 1LV5A 5AQMA 2BH1A 3NGYA 1S1WA 2WOMA 2NRHA 4BGBA 3ZSOA 1VRTA 3K9KA 2X78A 3DRSA 3TWHA 2E6MA 3LDPA 1NKEA 1S6QA 4GV3A 1NOYA 3L8BA 3UKUB 3ZEUB 2GTDA 3DXKA 1QTMA 5C15A 4KH4A 1RT3A 3ZETB 1NLVA 3HK2A 1FKOA 1K9MO 3CCEN 4BRPA 2P9UA 3RMCA 5KGWA 1VQ8N 4DTMA 4BRHA 1GOCA 3CPEA 4QCLA 3CCQN 3SK3A 3V4IA 3OJUA 1OH6A 3R6MA 1TKTA 3ZX3A 2Z1GA 4X65K 3CF5L 3MCPA 4KV8A 3FLCO 1B9FA 3VTHA 4DR4K 3G4SN 5HRNA 4CEBA 1XC9A 1GLLO 4DKWA 3LDSA 1GLAG 3CMAN 4FM2A 2WBNA 4E7LA 3SQ4A 3T7ZA 4CBXA 5SWMA 5CY4A 3O5BA 3KWIA 3NGIA 4MLEA 3VMFB 2IOCA 2NZTA 5BRHA 5DM7L 1IKXA 3H1VX 1NJXA 3O1BA 2ASMA 1BIZA 3SPYA 4IXCA 3BGRA 4G9ZA 4H0PA 4Z4EA 3VQ6A 4M42A 4IBNA 4EIAA 2E4LA 4K42A 1HX1A 4DWIA 4PL7A 1UAXA 4Z0UA 4DU3A 5AR0A 2G8WA 4DR7K 3VEOA 3WXLA 3HSCA 3UB5A 3LZJA 1VQPN 2P9KB 2Q1NA 1ZBFA 3LP0A 3TPQA 4GV9A 5GAEP 5CYQA 2GX9A 4FPAA 1BI4B 4B3RK 4GY2B 1GOBA 1L3SA 4YOUA 2A1RA 2F4VK 2YHWA 1JJ2M 5IWAK 2OA8A 4CHZA 4FJGA 4CJWA 1O1WA 4HCBA 4F3TA 3NVKA 1N36K 3IKMA 2P9LA 4CEZA 3ATUA 1U47A 4F3OA 1W9HA 3O4NA 3PLAA 5CR4A 5FPEA 2RE2A 3NDKA 4FO0A 3K5OA 1KLNA 1Q7YO 3DXMA 1DGKN 4HCCA 4IOAL 3MXMA 2ZM6K 5TKWA 4IFYA 1REVA 1Q18A 1VRUA 2G8HA 4A61A 2XY5A 3D0PA 2P51A 3CQ8A 3HBTA 3QEWA 4CD3A 3UE5A 3LAKA 1QE1A 4B9QA 4C8MA 1WSHA 2YJEA 4AM7A 5AQFA 4GNIA 4LFAK 4N5SA 1OH8A 4H5RA 4CK2A 4CJ4A 2PY5A 2IVOA 3KJVA 4FLVA 1RILA 2YHXA 1RBTA 2YNFA 2E2OA 5TKYA 4YOXA 4IWVA 1JLFA 1ZBHA 4JS5A 3VETA 4M3WA 1D4XA 4FJIA 3HVRA 4LF5K 3OJSA 2F96A 2JWLA 4FJMA 4WQ5A 2G8VA 1I94K 3CD6N 1DTTA 2P9NA 1QQNA 1ZBLA 4IDHA 3V9SA 2P9IA 4CEOA 1CZBA 4H5TA 2KHOA 1MA9B 1QS4A 4CF9A 3LDNA 2ZJQL 3ALYA 3C6UA 1WAFA 2VYPA 3S9HA 1QHTA 3UKRB 4CGFA 1GLJO 4GMJB 3Q7BA 2YCHA 3EYZA 1NK4A 4JK8A 2CGLA 3FZMA 4CEQA 3THYB 4FOIA 4DR1K 4KHNA 3BY5A 2UXDK 4O55A 1I39A 4RW7A 1UWBA 4AQYK 2ZWHA 1F21A 3AV9A 1I3AA 1HQUA 2HBMA 4FW2A 4BDYA 1RTHA 4FJ9A 2UU9K 4J2DA 4FWLA 2DTUA 1E4FT 2QKBA 4AM6A 4O0IA 1V4TA 4JRQA 1NGBA 3C6HA 1X9WA 4CBWA 4EZ9A 4FVMA 1GLEG 2P9PA 2PFUA 3K59A 1IBMK 4PWDA 2VG5A 1XHXA 1Q86O 3H08A 2E5LK 3PO4A 1NGDA 3O4QA 1ZBSA 2P9PB 4X62K 5J2PA 4DTOA 1TYQB 2OCEA 2Y1JA 5AQGA 3QNNA 3CCLN 2O8DA 5DM6L 2EHGA 1IV0A 4BY9C 4LF8K 2GV9A 4CJEA 4FLYA 3V9ZA 4CEEA 5C10A 4K41A 3TAMA 4FLTA 1MU2A 1NGJA 2HBKA 2HBLA 4FWNA 4JAXA 1YHQN 4MFBA 3QEIA 5JICA 3SBTA 1NGAA 2KLAA 3DLKA 4IDKA 3V9WA 4J2BA 3I8BA 3C6TA 3VTIA 2Q36A 1XI1A 4YY3K 4O8UA 3JYTA 5C2DA 1IO2A 4BG8A 1VSMA 3GG4A 4CEAA 3OW2M 3D6RA 4UQGA 1L3TA 3GE1A 1ASUA 2O8BA 1ATSA 4WE1A 4DSEA 4BDPA 3HZ6A 1T03A 3S3OA 5C0YA 2WONA 3CCUN 4CJFA 4FXDA 4HWIA 1S5JA 1WAJA 3TARA 3S3NA 4JKGB 3QETA 1YJWN 1RBRA 2O8EB 1BOTO 3I33A 4DQSA 2P9SB 1ATNA 3SMPA 3NF8A 4FSVA 3RRGA 4DV3K 3KLIA 3VQ7A 1HKBA 3THWB 1WNSA 3HJFA 1TYQA 4G1QA 3SLCA 4Z4CA 4DTSA 3TABA 4B1XB 2VWJA 3THXA 4E1JA 3OS1A 2E1ZA 3H3OB 2OPSA 3AA2A 3LZIA 3CCRN 3DLLL 4DSFA 2OANA 1D9FA 1EETA 2WUSA 4Z4IA 1CXQA 4PHTX 2FSJA 2Q0UA 3QBXA 3O08A 4H5VA 1J5EK 3HYFA 1LAVA 1VSKA 4B9TA 4DLGA 2ZJRL 3DLHA 4DHYA 1BGXT 4KTWA 4BWMA 2QI2A 4DU1A 4GW6A 5F0XA 1S9EA 2XHBA 3IAYA 1WSEA 3U9ZA 3M8QA 1QQOA 1VQLN 3GBTA 3VEWA 3OS0A 2JWKA 1TK8A 4CK3A 3EO3A 4KI4A 5CHIA 2FC0A 4LF7K 4PUOA 4M3RA 3HL8A 3LAMA 3CJBA 4B9VA 4E1MA 2VGNA 4O0JA 1SL0A 1D8YA 3HP9A 3I56N 5KPRA 4OGCA 1RGIA 2GWJA 4IJAA 3WEEA 5GAGP 1VQNN 3M8SA 1UA0A 3TI0A 1KAZA 2YI1A 2QXLA 3RMDA 1NK6A 4W5QA 1S22A 2JGUA 4B1UB 3HPOA 4CW7B 1HNWK 3AVKA 5LL6Z 3AAPA 2GUIA 4YOTA 4DU4A 2ETJA 3TAFA 5AQTA 4K8XA 4M45A 5A2QO 1HLUA 3ULDA 3QINA 4M7XA 1WBDA 3A5NC 4CZHA 3FZFA 4K43A 1K8KA 5LJVA 1U49A 4ELUA 3HRGA 3WEEB 4CJRA 4E7KA 1VQKN 3DAWA 5SZTA 4BRKA 4KH5A 3OBWA 3BEXA 1ESVA 3LP2A 2W41A 4JI2K 3P31A 3VESA 2PYJA 1QVFM 3A0IX 4OKEA 4M7YA 2QTDA 4JEPA 3IDHA 1VAZA 1ZXOA 5M1PA 2ASPA 1BU6O 2UXCK 1NU0A 4XH1A 2HOEA 4YNQA 3CCVN 3S3MA 3VPZA 4M3XA 2P9LB 1W2BM 1Z6RA 4XH5A 3MK6A 3CCSN 5E84A 1OVYA 5AQUA 1DLOA 3OYLA 3HO1A 4IEIA 3H45C 3J7AP 5I42A 1RT2A 4DV7K 4FJJA 4DTXA 3ZSVA 3HOSA 3QIPA 3TAPA 2Y1IA 4CJ3A 4WQ5C 5M1KA 4N47A 4BRAA 4BR7A 1FKPA 3DMJA 3MN7A 4O4GA 3HI0A 4CESA 3K58A 1RT1A 3MN5A 2ZE2A 2KQ2A 1RDDA 2BGGA 4H8KA 2G8KA 4FOEA 2FF3B 3KZBA 1BISA 1JLGA 4FLUA 1TAUA 3OYIA 3CFRA 4GV6A 4CECA 3C7NB 2VWKA 4W5RA 3AVFA 4CJSA 4BC2A 1IBLK 3KKSA 1YT3A 3DYAA 3RSEA 5J1EA 4E0DA 4IFEA 4CJQA 1D5AA 3LPTA 4E7IA 1S3XA 2G8IA 1VQ6N 5HRPA 4CF1A 1WLJA 3E1YA 1XQSC 4KHSA 4KKOA 4CZLA 4B3MK 3HSTB 4BRNA 4NXNK 1VSJA 3VQ5A 1NK7A 2YHAA 2CH5A 2QWNA 4O5FA 2D5RA 5J2MA 1BQMA 4QS8A 1IKYA 3W0LA 5JVGL 1N5YA 3TSPA 1YF5L 2H3GX 3S41A 4HUEA 4FJLA 3AA5X 2HHXA 4H0TB 1D9DA 1KC8O 2EWSA 3ID8A 3M8PA 3L2VA 1KQSM 3PO5A 1BIUA 3ITHA 4JKDA 1VQ9N 3BDPA 2PYLA 3OYGA 3C95A 2X74A 1S72N 4FJ5A 1NK9A 5CYMA 5E26A 2FSNA 4A62A 3VQCA 4LSNA 1VQMN 5AQZA 4DS4A 5JS2A 4O5BA 1BO5O 4BC5A 5D3GA 1OH5A 2YX6A 5H1SQ 3HOTA 3PIOL 3VA3A 1NGHA 5FPMA 1IKWA 4LY7A 1YAGA 4KAZA 5BRFA 5AQWA 1HJOA 3SNNA 3IG1A 4PKHA 3CQYA 4DTRA 4V19S 3RSEB 4U7BA 4NCBA 3E9PA 1C0TA 1YVNA 2ZD1A 2A3ZA 3OYFA 4FZZA 2V7YA 5DK5A 4IZ9A 1WB9A 3KD5E 3BUZB 4AF1A 4KHQA 1LWCA 5T7BA 4CJ7A 5HRSA 4BRFA 2HHWA 1HKGA 4EZ6A 5AQPA 3VQPA 1EQYA 2A5XA 4IEEA 2FF6A 5AZIA 3SV4A 1C0GA 4DV2K 3QNOA 4KBOA 4BG9A 3SAGA 4BRLA 3U9DA 3FFKB 3MXJA 1C0UA 1IKVA 3P4IA 3K5MA 4OLBA 2LSNA 4DLEA 1WSGA 3AVAA 2NRRA 3I0RA 5JMVA 4B9SA 1ILYA 3HP6A 2A6AA 3SJJA 3J80O 3ZSWA 4B3TK 3R9PA 4FLZA 4FZYA 5GAHP 3P83D 1WUAA 3C65A 1S9GA 4GKJK 3OVNA 3THYA 1N8RO 2DFEA 1RTDA 1CXUA 4JI8K 3DI6A 1T05A 4ISEA 1E3MA 2XRIA 4H4MA 1LAWA 3VQAA 4KI6A 4FK2A 1X3NA 1C1BA 2AP1A 2ZGZA 2IS3A 4HUGA 5BPMA 3CERA 2IVPA 3VEXA 1UOCA 3M8RA 3SQ0A 3IUCA 1OVQA 1ZC6A 3CQXA 3VQQA 3RRHA 3VF4A 1R59O 4B1YB 1G99A 4GVEA 4B1VA 1QSLA 2KFNA 1O13A 1YJNN 3AO3A 4C23A 5GIOA 4DSJA 1XWLA 3QEVA 4QOZB 3DLEA 4OKJA 4KRFA 3O4WA 4BACA 1S6PA 5BN9A 1TUYA 5KQDA 5HRRA 2RF2A 3D7EO 3AVCA 4CZEA 3OY9A 2Z1IA 5AJ3K 2GEMA 4K8ZA 2B6AA 1EO1A 1TL3A 3OBYA 1TAQA 4H0XB 2YNHA 4H5WA 5FPDA 1GLBG 3T1HK 1VSIA 4IG0A 3WXJA 4J2AA 1HNIA 4CJVA 3CCMN 4E3SA 1YJ9N 3ZX2A 2ZQBA 1RFQA 3PSIA 2O8FB 1N32K 3SQ2A 2D4WA 3KHYA 5CZ2A 2PZSA 4ID1A 2E2PA 4LH5A 1JL2A 2OYQA 4CFAA 1SKRA 3NCIA 3RVCA 5C12A 2IGIA 2NRTA 1YVUA 4DMNA 3J7ZO 4BRIA 4L8RB 3L4QA 4BC4A 2NLXA 3SUQA 1T7PA 1Z05A 4DSLA 3NH1A 3I8DA 2Z1HA 4B3OA 1KXPA 2B5JA 3LDQA 4JKGA 4CK1A 5M1FA 3ZSQA 2VQEK 2CH6A 5JLHA 5LMUK 3P1GA 1T44A 2KFZA 1SKWA 2F8SA 3EZWA 1BL3A 1A5XA 4IKFA 1DT9A 4MLHA 1RDWX 3VOVA 4O8KA 4JNEA 4E19A 3KLFA 2D0PA 3LDOA 4WFNL 4ICLA 3CC2N 1HMVA 1JCGA 3CPWM 3THWA 2KZMA 4FM1A 4BVOA 4ZHRA 3SBGA 3FR0A 2A42A 2P5GA 2Q3SA 3OA9A 3TTCA 1V4SA 2OZSA 1NK8A 2O8CA 4Q0BA 5BREA 4HTUA 2ATQA 5ADXA 3VQEA 4BGAA 1RCHA 1XMOK 3QB0A 2UUCK 4YORA 4FJ7A 1NKBA 3CCJN 4BR4A 4MO5A 3MWTA 2ZGYA 1FJGK 1IJJA 2VQFK 1YI2N 4RW4A 4DV6K 4H4OA 2YHYA 2HVHA 4F9OA 4CGHA 4B1WB 5LY3A 5HOOA 1C1AA 3TR8A 1T6CA 4NB4A 4C8LA 1DKGD 1W7AA 4DV4K 3WQUA 4JI6K 3WNEA 1TVRA 4CZKA 5AQSA 2OPRA 1SS6A 1KRPA 2F8TA 3NMUA 3V9UA 3ZETA 3QBWA 1U6ZA 1HRHA 3SJHA 3VGKA 1RT7A 3BZCA 3WUHA 2NRXA 4CCHA 3KVGA 4F4KA 5JS1A 3MN9A 3LM9A 3O9QA 2RKIA 1NK5A 1T8EA 1T6DA 2NRZA 4GVMA 3PX6A 5HROA 4IOXA 3T1YK 3NF7A 4ILHA 3VEYA 4CJLA 4LD0A 4CZIA 3TTDA 1Y97A 4CI6A 3QMLA 2YNGA 2QEXN 1KAXA 3QO9A 3E01A 4A57A 3NE6A 4NLCA 1K6YA 2PBDA 3OS2A 4OPJA 3AO4A 4YDUC 1N6QA 2VGMA 1BCOA 3QDKA 5FRNA 4O44A 3R8EA 3A5LC 5KPTA 1NJZA 1NG9A 1SQKA 1NJYA 3TANA 1VSHA 3THXB 1H1VA 3CJ1A 1U48A 4H03B 3ZT1A 4BRQA 1NJIO 5J2NA 4JRPA 4NCAA 5AQOA 3Q7CA 4CF8A 4ZTFA 4JV5K 3VQBA 3QLHA 1ASWA 1VQ7N 4I6MA 4DSIA 1K73O 4CEDA 1KFDA 3FZLA 2ZJPL 1XUPO 3CM6A 5I9EB 1YIJN 5M1OA 5AQYA 2IDOA 2FBTA 3CI5A 3O1WA 4PKIA 3WXKA 2QWOA 4B08A 3AVGA 1P8ZA 4CZMA 4CFCA 5EOYA 3O8MA 4RG8A 4HVJA 2P5OA 4DQRA 4TSXA 1SUQA 2HNYA 1NWKA 3F9MA 5C24A 2OTJN 5IT9O 2V51B 3AY9A 1SL2A 1NBWA 3MDQA 4EAHD 4N76A 1UA1A 3JAMO 4BRGA 4M63C 4GKKK 3EL2A 1JLBA 1NGEA 3T69A 4CF2A 3PX0A 3KK3A 4W5OA 4LF9K 3NVMA 4WQ4A 1XNQK 1QZ5A 1WSFA 5AQLA 4CVNE 1KAYA 1P90A 2VCPA 4FWOA 3CJAA 2HHQA 1WOQA 2EX3A 4DSKA 3ZCMA 4CBUA 2DFHA 3E9LA 4LF4K 1S1TA 1DTQA 3L3VA 1TKZA 2WFBA 3AAQA 3JSMA 2O4GA 1NM1A 3L0QA 4Y1CA 3BZKA 1IBKK 4R79A 1RDAA 1KVCA 4JYAK 1RT4A 2AA4A 1BCMA 2R7YA 3MAQA 1DEJA 1U2VA 3G71N 4K25A 4A5AA 1T3VA 2YV0X 1QQMA 1Z25A 4QS7A 5FLXO 3ZSZA 3H1QA 4Y1DA 3U6FA 5FPNA 4Z4FA 5AFUH 1ASVA 3L2WA 3LALA 4M3UA 4BE2A 4YDUA 3CXCM 1NKCA 1BG3A 5KRSA 4LF6K 2W42A 4CHOA 4E89A 2A40A 5M1QA 3V1OA 4C8KA 1NNEA 5CE3A 3SUPA 4NO7A 3WXMB 3O3GA 4IO9L 4DR2K 2O8DB 1QSSA 3TU5A 2G8FA 1XC3A 4IOCL 1Q8IA 4X64K 4FK4A 1R0AA 2D0CA 3LPUA 1KTQA 2I7NA 4BQLA 4FJHA 2O8CB 2ZF5O 3DWLA 4B9LA 1L5UA 4FK0A 2W6LA 4BC3A 3QEXA 3TAQA 2OTLN 5FROA 4CJKA 5BR9A 3VN5A 4PL8A 3DJCA 1NGCA 5AQIA 4H0YB 2GWKA 1TUUA 3B8AX 1W0HA 1SL1A 3O9UA 1JL1A 3D45A 4B8AB 2BE2A 3G25A 4RWTA 4JN4A 5BR8K 1HQEA 3SMSA 2UXBK 4JK9A 4NLBA 2E88A 1TK5A 2FSKA 4OLAA 2HHSA 3QFPA 1U45A 2GUPA 4BR5A 4M3ZA 3ZT0A 1K8KB 4WCEL 3T3FA 4K0KK 3DLRA 5AQRA 4BROA 1JLCA 4DB3A 3ZT3A 3FE1A 1LWEA 3AVIA 4FWMA 4HUFA 3HM9A 3OYBA 1Z26A 1JLAA 4KB1A 1RBVA 4CEFA 4KFBA 4DUYK 3BF1A 4FW1A 3LDLA 2J4RA 3OHRA 3OYDA 1J9AA 1JCEA 3J81O 3G0ZA 4BREA 4KTQA 1ATRA 3IMXA 3AGKA
chains in the Genus database with same CATH topology
4DR7K 2UUAK 4DV5K 3OTOK 4JV5K 5FLXO 4JI2K 1N34K 4B3RK 4LF6K 4JI3K 4DR1K 2UXDK 4DV3K 1XMOK 4AQYK 2UUCK 2F4VK 5IWAK 4DR5K 4DR2K 1FJGK 1HNXK 2VQFK 2UU9K 4DV6K 1N36K 4X64K 2UXCK 4NXMK 4DV1K 4JI4K 4YHHK 4JI5K 1HNZK 5LMNK 5AJ3K 1XNRK 5IT9O 4JI0K 2ZM6K 1IBMK 3J7AP 1J5EK 4DV4K 1HR0K 4DV7K 4JI6K 4V19S 3JAMO 4KHPK 2E5LK 4GKKK 3T1HK 4LFCK 4X62K 4LF9K 4DR6K 4LFAK 4DR3K 4LFBK 1XNQK 4LF8K 4CVNE 4LF7K 5BR8K 4X65K 1N32K 4OX9K 3T1YK 2UXBK 4DR4K 4DV2K 4X66K 4LF4K 3J7YP 4JI7K 4LF5K 1IBLK 4YY3K 4K0KK 1N33K 1I94K 3J80O 1IBKK 4B3TK 4CW7B 1HNWK 2VQEK 4B3MK 5LL6Z 2UUBK 5LMUK 4DUYK 4JYAK 4GKJK 1XMQK 4NXNK 5A2QO 4B3SK 3J81O 2HHHK 4JI8K 4JI1K 4DUZK 4DV0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 K;  2UUA K;  4DV5 K;  3OTO K;  4JV5 K;  5FLX O;  4JI2 K;  1N34 K;  4B3R K;  4LF6 K;  4JI3 K;  4DR1 K;  2UXD K;  4DV3 K;  1XMO K;  4AQY K;  2UUC K;  2F4V K;  5IWA K;  4DR5 K;  4DR2 K;  1FJG K;  1HNX K;  2VQF K;  2UU9 K;  4DV6 K;  1N36 K;  4X64 K;  2UXC K;  4NXM K;  4DV1 K;  4JI4 K;  4YHH K;  4JI5 K;  1HNZ K;  5LMN K;  5AJ3 K;  1XNR K;  5IT9 O;  4JI0 K;  2ZM6 K;  1IBM K;  3J7A P;  1J5E K;  4DV4 K;  1HR0 K;  4DV7 K;  4JI6 K;  4V19 S;  3JAM O;  4KHP K;  2E5L K;  4GKK K;  3T1H K;  4LFC K;  4X62 K;  4LF9 K;  4DR6 K;  4LFA K;  4DR3 K;  4LFB K;  1XNQ K;  4LF8 K;  4CVN E;  4LF7 K;  5BR8 K;  4X65 K;  1N32 K;  4OX9 K;  3T1Y K;  2UXB K;  4DR4 K;  4DV2 K;  4X66 K;  4LF4 K;  3J7Y P;  4JI7 K;  4LF5 K;  1IBL K;  4YY3 K;  4K0K K;  1N33 K;  1I94 K;  3J80 O;  1IBK K;  4B3T K;  4CW7 B;  1HNW K;  2VQE K;  4B3M K;  5LL6 Z;  2UUB K;  5LMU K;  4DUY K;  4JYA K;  4GKJ K;  1XMQ K;  4NXN K;  5A2Q O;  4B3S K;  3J81 O;  2HHH K;  4JI8 K;  4JI1 K;  4DUZ K;  4DV0 K; 
#chains in the Genus database with same CATH topology
 3ENB A;  4EP4 A;  4DV5 K;  1VSE A;  1JLE A;  5B8H A;  3M3Z A;  3L4I A;  1BDG A;  4CF0 A;  2HMI A;  4JKF A;  4A2A A;  2OPP A;  5JVH L;  5GIN A;  3O6W A;  3K57 A;  1N34 K;  2I5J A;  1S1X A;  2IAJ A;  4BWJ A;  2Q31 A;  1X3M A;  1TKD A;  1QSY A;  1MDU B;  4IO8 A;  3OYC A;  4KO0 A;  3PY8 A;  3EE8 A;  2P9U B;  3ZX0 A;  4CE9 A;  4I6M B;  4FLW A;  5AQN A;  2G8U A;  2GEL A;  1VQ4 N;  5KTQ A;  3AO2 A;  3QIC A;  2CGK A;  3K9J A;  1XNR K;  4JI0 K;  5E41 A;  4M41 A;  3G6E N;  3U3Y A;  3SYZ A;  3KK2 A;  4BDZ A;  4Z94 A;  4PQU A;  1WSI A;  3P39 A;  3AO5 A;  3DM2 A;  3PX4 A;  1IG8 A;  3FGU A;  3D2E B;  4MDA A;  4DR3 K;  3ZT4 A;  1NGG A;  2HHT A;  4XIU A;  3KK7 A;  3ZLJ A;  3VQ8 A;  5AQX A;  4ILG B;  1EKE A;  4OKK A;  4CIF A;  1FK9 A;  3EE9 A;  3CC4 N;  3J7Y P;  1FXX A;  2VG7 A;  3O3H A;  2HND A;  4LH4 A;  2O4I A;  5FDL A;  2P9K A;  1RDC A;  5AQV A;  1TKX A;  3F2K A;  2BUP A;  3RWU A;  4CHN A;  4FWQ A;  4CIG A;  4YOW A;  3CIP A;  4N56 A;  3OYK A;  3SZ2 A;  1J5O A;  1WN7 A;  4QS9 A;  2QM1 A;  3A5M C;  1U04 A;  4CZG A;  4B3S K;  1NMD A;  1KLM A;  4RW6 A;  3O9R A;  3M5R A;  4JI1 K;  3L3U A;  1BWF O;  3C7N A;  3W3D A;  4QAG A;  3OTO K;  3DLG A;  3RTV A;  2XY6 A;  1Q9Y A;  1C0F A;  4CHP A;  3DXK B;  5BN8 A;  2BDP A;  4WF9 L;  4DFP A;  1E4G T;  5I3U A;  2HF3 A;  4EFH A;  1GLD G;  3DRP A;  4BRC A;  4Z4H A;  4YFU A;  1LW0 A;  1KVA A;  3WXI A;  2O8F A;  2YKM A;  1C0M A;  1VSD A;  4BE0 A;  3TSU A;  4R5P A;  4BRM A;  2FBY A;  1OKJ A;  4JI5 K;  5LMN K;  1QVG M;  3VQ4 A;  2AJQ A;  2QXF A;  1GLF O;  2A41 A;  1YIT N;  2OZM A;  3GL1 A;  4XH4 A;  4CGJ A;  3NFA A;  1LOT B;  3WNG A;  3HTV A;  4PKG A;  4LFC K;  3JXU A;  3C94 A;  3L2R A;  1KSP A;  1IH7 A;  3PUF A;  2QWL A;  3O3F A;  3N4Q A;  3N4P A;  4NYF A;  4WQ4 C;  5HLF A;  5EVZ A;  2V52 B;  4FYD A;  4LFB K;  4DFJ A;  3THV A;  1BA1 A;  3L6Q A;  4JS4 A;  3TTF A;  5JLF A;  4ID5 A;  4AHC A;  3QIO A;  1HPZ A;  4FWP A;  3R1X A;  4ELT A;  4PY5 A;  1J53 A;  2I7P A;  2E6L A;  3D2F B;  4B9N A;  3LM2 A;  4DQQ A;  4DCH A;  4DG1 A;  2IIR A;  2P9I B;  2ITM A;  5C42 A;  4FZX C;  2P1J A;  4NCG A;  1GLC G;  4AHS A;  4EHT A;  2FXU A;  2UYT A;  4E1N A;  3H46 O;  3NF9 A;  3SAF A;  1HKC A;  4ZTJ A;  2QWQ A;  5AQK A;  1RDB A;  2XY7 A;  3VA0 A;  3ZSR A;  3LAN A;  2UUB K;  2DFF A;  5AZI B;  1LCU A;  1WBB A;  2W40 A;  5ADX H;  2WC9 A;  5M1N A;  4DUZ K;  1BUP A;  4FM0 A;  3NGZ A;  5AQQ A;  4AHR A;  1ITG A;  2HNZ A;  3CM5 A;  2NUB A;  5AZJ A;  2E20 A;  5J2Q A;  4DFK A;  2VG6 A;  2NRV A;  1KFS A;  1SV5 A;  2HW3 A;  3I0S A;  4FJN A;  3HPH A;  4E7H A;  3ZEU A;  4CGG A;  1L3V A;  2QW9 A;  1HUX A;  3NBP A;  4DQI A;  2QWP A;  3C6A A;  1HNX K;  2XO7 A;  1VK0 A;  3SAH A;  1VQ5 N;  3CME N;  2E8A A;  3VGL A;  4U67 L;  3P5J A;  4JKA A;  1RDU A;  2KW4 A;  3LWL A;  4CHQ A;  1RT5 A;  1NOZ A;  4YHH K;  1RTJ A;  3WQT A;  2WTU A;  2HHU A;  4C1N K;  3ASM A;  5AFU A;  4ISG A;  2E1Y A;  1VSF A;  3MMV A;  3CJC A;  1HYS A;  3ID6 A;  3LP3 A;  3AVH A;  2NNW A;  2YNI A;  4XEI A;  3EY1 A;  3MED A;  1SAZ A;  5HL7 L;  3V81 A;  4DTN A;  2D0O A;  3NAE A;  3ZYY X;  4OX9 K;  5GAD P;  1OH7 A;  2BAN A;  1YTU A;  2QA4 N;  1KD1 O;  4I2P A;  4OPK A;  4JI7 K;  4M3Y A;  1S1V A;  1VQO N;  4FJK A;  1J54 A;  3KLG A;  2DY4 A;  2X6S A;  3DOK A;  3PSF A;  5BPL A;  4BVP A;  5ELZ A;  5KQ8 A;  4F2R A;  4A2B A;  1RTI A;  1YTA A;  1BHL A;  3A8Y A;  5GIP A;  1KVB A;  4AHT A;  5DMR A;  2HST A;  3IFR A;  1B9D A;  4FPB A;  3E66 A;  4OO1 J;  1JXB A;  2V7Z A;  4DQP A;  5HBM A;  4FL9 A;  3CFO A;  3WNH A;  3K5L A;  3CG7 A;  1HYV A;  2HB5 A;  5AQH A;  4KPY A;  4CJU A;  4CD1 A;  4A59 A;  3IRX A;  4ELV A;  5FRM A;  3PV8 A;  4CJT A;  5BRD A;  1JXE A;  2DPN A;  3D2F A;  3DXM B;  3VGM A;  3CHW A;  4JD2 B;  4OVL A;  4CFB A;  3EN9 A;  2HBJ A;  5EX5 A;  1RT6 A;  4JHD B;  4B9U A;  1SZ2 A;  1U2V B;  4B9M A;  2X6N A;  1HPM A;  1YXQ A;  3ZT2 A;  3QFU A;  3VER A;  3FZK A;  3VF6 A;  4BR2 A;  3OYE A;  2RHK A;  3RMA A;  3AGR A;  3KTQ A;  2D0A A;  3GDQ A;  2Q0R A;  3UKU A;  3DRR A;  1G15 A;  3V6D A;  3SV3 A;  4IFV A;  3P38 A;  4E7J A;  3CFP A;  3SUO A;  4EHU A;  4L3Q A;  3ULE B;  4CJP A;  4C8O A;  2PAV A;  3ISN C;  4AH9 A;  1MWK A;  3KK1 A;  3MXI A;  2ASO A;  3T1A A;  3RR7 A;  2A1S A;  3SQ1 A;  3VEV A;  4RCH A;  2W6K A;  3FZH A;  4OJR A;  4DR6 K;  4DTU A;  2O8B B;  4EP5 A;  4BQZ A;  3CYM A;  3H3N O;  5HP1 A;  1VSL A;  3TAE A;  2VWB A;  3ENH A;  1ZBI A;  3NF6 A;  4JKC A;  4DTP A;  4HHT A;  3OYH A;  2KKZ A;  4DF8 A;  1JLQ A;  3A5O C;  3HVT A;  1EWQ A;  1M1K O;  2RPI A;  2QKK A;  1JCF A;  1TL1 A;  2FBV A;  3AVN A;  3HT3 A;  1EP4 A;  2XY8 A;  3B6O A;  3HPG A;  3UKR A;  4RTF D;  3MX5 A;  2OPQ A;  4CFD A;  3LP1 A;  2HF4 A;  3MEC A;  1C1C A;  2CGJ A;  1TK0 A;  3B6P A;  1J6Z A;  3WNF A;  4J2E A;  3VEN A;  1NGF A;  3H6E A;  3AVJ A;  4FWS A;  1XMQ K;  3KLH A;  4BR0 A;  3HM8 A;  5AQJ A;  4ILJ A;  4DV0 K;  4FWR A;  4CGD A;  4JKB A;  3KD1 E;  3ZSY A;  3QEP A;  1KCF A;  4CZF A;  2E2N A;  3CJ9 A;  2IVN A;  2F9T A;  3AAR A;  4IJN A;  2QWM A;  3VQD A;  1NJW A;  3C0B A;  4B8C A;  4N41 A;  3K2P A;  2P9N B;  4JI3 K;  4H0O A;  4DS5 A;  4H5N A;  3TAG A;  5AZJ B;  3V9X A;  4AHU A;  1A5W A;  2ITG A;  1K8A O;  5C25 A;  3EEQ A;  4DR5 K;  4PA1 A;  3AA3 A;  3KLE A;  1HNV A;  3D2E A;  3RR8 A;  1QHA A;  4DF4 A;  4DV1 K;  3R3L A;  5EXW A;  4RW9 A;  4KHW A;  1U4B A;  5LJW A;  1HNZ K;  4CHY A;  4YOY A;  2KTQ A;  4M3T A;  3A2F A;  3SI6 A;  2HHV A;  2D0B A;  2FBX A;  3NH2 A;  4FCY A;  1X9S A;  3ULE A;  4WYB A;  2KZZ A;  4W5N A;  4HTL A;  4W5T A;  1B92 A;  3LL3 A;  4CGI A;  1BI4 A;  2NRW A;  3NHG A;  4CZJ A;  1QQC A;  2F9W A;  4JLH A;  4AIL C;  4KH6 A;  3ENO A;  3VQ9 A;  1X1P A;  4DTJ A;  1CZ9 A;  2RN2 A;  4OGE A;  4LSL A;  5KI6 A;  3CC7 N;  1TGO A;  3NH0 A;  2GBZ A;  2FLO A;  4BE1 A;  3MX2 A;  4UY8 O;  4AHV A;  1N33 K;  1IG9 A;  1X9M A;  3KWG A;  4MO4 A;  2O8E A;  3J8A A;  3O80 A;  1LWF A;  3AA4 A;  4MDB A;  4CIE A;  1QZ6 A;  3I55 N;  3DLB A;  1JKH A;  1GOA A;  5F1X A;  3EZ5 A;  4OPH A;  3OYN A;  3BF3 A;  4WFA L;  1Q81 O;  4WFB L;  1HYZ A;  2QWR A;  4NYN A;  3V1R A;  3VF2 A;  3HXM A;  5EU7 A;  1BA0 A;  2B4J A;  2Z1J A;  2YHB A;  3AVB A;  1TV6 A;  1A5V A;  5F2R A;  4F2S A;  1C6V A;  4I7F A;  5C2F A;  1ZYQ A;  1ZBU A;  4C1N I;  3MWP A;  1NMN A;  4FJ8 A;  1EXQ A;  1EWR A;  1MWM A;  4BRD A;  3V1Q A;  1NK0 A;  1Y64 A;  4DQ8 A;  1EX4 A;  3VEZ A;  1XHZ A;  4ISF A;  1HJR A;  2P9S A;  3M6G A;  1M90 O;  3OYJ A;  4JKH A;  4CJ5 A;  4NXM K;  3T19 A;  2YKN A;  4JK7 A;  4F8R A;  2IC3 A;  3JS6 A;  4JI4 K;  4KHU A;  4I9L A;  4FLX A;  3FFI A;  1YUW A;  3O9S A;  1SKS A;  3MEE A;  3UIQ A;  4Z4G A;  3KIO A;  4Y0W A;  2HVI A;  5KRT A;  1HR0 K;  2Q2R A;  4CER A;  4KHP K;  1X9J A;  3AVL A;  3EKU A;  4DFM A;  1BQN A;  2E2Q A;  3L2Q A;  1Q82 O;  4FJX A;  3G10 A;  4I2Q A;  1RBU A;  3CET A;  4A5B A;  4MQ3 A;  4FWK A;  4KRE A;  4RW8 A;  2HMP A;  3ZSX A;  4BR9 A;  3MCA B;  4J8F A;  2Q97 A;  3SPZ A;  3E9O A;  1FW6 A;  5K14 A;  3K5N A;  3PIP L;  3MEG A;  4X66 K;  1W97 L;  4JHD A;  1CZA N;  3SCX A;  1RNH A;  1NGI A;  1L3U A;  2F7T A;  4JKE A;  3F5T A;  2YJF A;  4C8N A;  4Q5V A;  3KKR A;  3AO1 A;  3U4L A;  3MN6 A;  3M1F A;  3QES A;  3O9T A;  3U3G A;  4LC9 B;  4YOV A;  2JLE A;  3OYM A;  1VHX A;  3WT0 A;  1LW2 A;  4FVU A;  3IS9 A;  5CZ1 A;  3ATV A;  3AVM A;  2HHH K;  4KB0 A;  4I9Q A;  3DOL A;  1WSJ A;  4B1Z A;  3SUN A;  1CLQ A;  3BP8 A;  5MLC Q;  3CJ7 A;  2UUA K;  4H0V B;  1RBS A;  3F9K A;  5EY4 A;  3EKS A;  3OYA A;  5KGX A;  2QK9 A;  1Q9X A;  3L2U A;  3QER A;  5BPN A;  3RMB A;  3TSQ A;  2BTF A;  4KTZ A;  4OPA A;  4IG3 A;  3LWM A;  3GOI A;  5KPZ A;  2D1K A;  3U8X A;  3F73 A;  4KHY A;  3K0S A;  4JD2 A;  1S1U A;  1LV5 A;  5AQM A;  2BH1 A;  3NGY A;  1S1W A;  2WOM A;  2NRH A;  4BGB A;  3ZSO A;  1VRT A;  3K9K A;  2X78 A;  3DRS A;  3TWH A;  2E6M A;  3LDP A;  1NKE A;  1S6Q A;  4GV3 A;  1NOY A;  3L8B A;  3UKU B;  3ZEU B;  2GTD A;  3DXK A;  1QTM A;  5C15 A;  4KH4 A;  1RT3 A;  3ZET B;  1NLV A;  3HK2 A;  1FKO A;  1K9M O;  3CCE N;  4BRP A;  2P9U A;  3RMC A;  5KGW A;  1VQ8 N;  4DTM A;  4BRH A;  1GOC A;  3CPE A;  4QCL A;  3CCQ N;  3SK3 A;  3V4I A;  3OJU A;  1OH6 A;  3R6M A;  1TKT A;  3ZX3 A;  2Z1G A;  4X65 K;  3CF5 L;  3MCP A;  4KV8 A;  3FLC O;  1B9F A;  3VTH A;  4DR4 K;  3G4S N;  5HRN A;  4CEB A;  1XC9 A;  1GLL O;  4DKW A;  3LDS A;  1GLA G;  3CMA N;  4FM2 A;  2WBN A;  4E7L A;  3SQ4 A;  3T7Z A;  4CBX A;  5SWM A;  5CY4 A;  3O5B A;  3KWI A;  3NGI A;  4MLE A;  3VMF B;  2IOC A;  2NZT A;  5BRH A;  5DM7 L;  1IKX A;  3H1V X;  1NJX A;  3O1B A;  2ASM A;  1BIZ A;  3SPY A;  4IXC A;  3BGR A;  4G9Z A;  4H0P A;  4Z4E A;  3VQ6 A;  4M42 A;  4IBN A;  4EIA A;  2E4L A;  4K42 A;  1HX1 A;  4DWI A;  4PL7 A;  1UAX A;  4Z0U A;  4DU3 A;  5AR0 A;  2G8W A;  4DR7 K;  3VEO A;  3WXL A;  3HSC A;  3UB5 A;  3LZJ A;  1VQP N;  2P9K B;  2Q1N A;  1ZBF A;  3LP0 A;  3TPQ A;  4GV9 A;  5GAE P;  5CYQ A;  2GX9 A;  4FPA A;  1BI4 B;  4B3R K;  4GY2 B;  1GOB A;  1L3S A;  4YOU A;  2A1R A;  2F4V K;  2YHW A;  1JJ2 M;  5IWA K;  2OA8 A;  4CHZ A;  4FJG A;  4CJW A;  1O1W A;  4HCB A;  4F3T A;  3NVK A;  1N36 K;  3IKM A;  2P9L A;  4CEZ A;  3ATU A;  1U47 A;  4F3O A;  1W9H A;  3O4N A;  3PLA A;  5CR4 A;  5FPE A;  2RE2 A;  3NDK A;  4FO0 A;  3K5O A;  1KLN A;  1Q7Y O;  3DXM A;  1DGK N;  4HCC A;  4IOA L;  3MXM A;  2ZM6 K;  5TKW A;  4IFY A;  1REV A;  1Q18 A;  1VRU A;  2G8H A;  4A61 A;  2XY5 A;  3D0P A;  2P51 A;  3CQ8 A;  3HBT A;  3QEW A;  4CD3 A;  3UE5 A;  3LAK A;  1QE1 A;  4B9Q A;  4C8M A;  1WSH A;  2YJE A;  4AM7 A;  5AQF A;  4GNI A;  4LFA K;  4N5S A;  1OH8 A;  4H5R A;  4CK2 A;  4CJ4 A;  2PY5 A;  2IVO A;  3KJV A;  4FLV A;  1RIL A;  2YHX A;  1RBT A;  2YNF A;  2E2O A;  5TKY A;  4YOX A;  4IWV A;  1JLF A;  1ZBH A;  4JS5 A;  3VET A;  4M3W A;  1D4X A;  4FJI A;  3HVR A;  4LF5 K;  3OJS A;  2F96 A;  2JWL A;  4FJM A;  4WQ5 A;  2G8V A;  1I94 K;  3CD6 N;  1DTT A;  2P9N A;  1QQN A;  1ZBL A;  4IDH A;  3V9S A;  2P9I A;  4CEO A;  1CZB A;  4H5T A;  2KHO A;  1MA9 B;  1QS4 A;  4CF9 A;  3LDN A;  2ZJQ L;  3ALY A;  3C6U A;  1WAF A;  2VYP A;  3S9H A;  1QHT A;  3UKR B;  4CGF A;  1GLJ O;  4GMJ B;  3Q7B A;  2YCH A;  3EYZ A;  1NK4 A;  4JK8 A;  2CGL A;  3FZM A;  4CEQ A;  3THY B;  4FOI A;  4DR1 K;  4KHN A;  3BY5 A;  2UXD K;  4O55 A;  1I39 A;  4RW7 A;  1UWB A;  4AQY K;  2ZWH A;  1F21 A;  3AV9 A;  1I3A A;  1HQU A;  2HBM A;  4FW2 A;  4BDY A;  1RTH A;  4FJ9 A;  2UU9 K;  4J2D A;  4FWL A;  2DTU A;  1E4F T;  2QKB A;  4AM6 A;  4O0I A;  1V4T A;  4JRQ A;  1NGB A;  3C6H A;  1X9W A;  4CBW A;  4EZ9 A;  4FVM A;  1GLE G;  2P9P A;  2PFU A;  3K59 A;  1IBM K;  4PWD A;  2VG5 A;  1XHX A;  1Q86 O;  3H08 A;  2E5L K;  3PO4 A;  1NGD A;  3O4Q A;  1ZBS A;  2P9P B;  4X62 K;  5J2P A;  4DTO A;  1TYQ B;  2OCE A;  2Y1J A;  5AQG A;  3QNN A;  3CCL N;  2O8D A;  5DM6 L;  2EHG A;  1IV0 A;  4BY9 C;  4LF8 K;  2GV9 A;  4CJE A;  4FLY A;  3V9Z A;  4CEE A;  5C10 A;  4K41 A;  3TAM A;  4FLT A;  1MU2 A;  1NGJ A;  2HBK A;  2HBL A;  4FWN A;  4JAX A;  1YHQ N;  4MFB A;  3QEI A;  5JIC A;  3SBT A;  1NGA A;  2KLA A;  3DLK A;  4IDK A;  3V9W A;  4J2B A;  3I8B A;  3C6T A;  3VTI A;  2Q36 A;  1XI1 A;  4YY3 K;  4O8U A;  3JYT A;  5C2D A;  1IO2 A;  4BG8 A;  1VSM A;  3GG4 A;  4CEA A;  3OW2 M;  3D6R A;  4UQG A;  1L3T A;  3GE1 A;  1ASU A;  2O8B A;  1ATS A;  4WE1 A;  4DSE A;  4BDP A;  3HZ6 A;  1T03 A;  3S3O A;  5C0Y A;  2WON A;  3CCU N;  4CJF A;  4FXD A;  4HWI A;  1S5J A;  1WAJ A;  3TAR A;  3S3N A;  4JKG B;  3QET A;  1YJW N;  1RBR A;  2O8E B;  1BOT O;  3I33 A;  4DQS A;  2P9S B;  1ATN A;  3SMP A;  3NF8 A;  4FSV A;  3RRG A;  4DV3 K;  3KLI A;  3VQ7 A;  1HKB A;  3THW B;  1WNS A;  3HJF A;  1TYQ A;  4G1Q A;  3SLC A;  4Z4C A;  4DTS A;  3TAB A;  4B1X B;  2VWJ A;  3THX A;  4E1J A;  3OS1 A;  2E1Z A;  3H3O B;  2OPS A;  3AA2 A;  3LZI A;  3CCR N;  3DLL L;  4DSF A;  2OAN A;  1D9F A;  1EET A;  2WUS A;  4Z4I A;  1CXQ A;  4PHT X;  2FSJ A;  2Q0U A;  3QBX A;  3O08 A;  4H5V A;  1J5E K;  3HYF A;  1LAV A;  1VSK A;  4B9T A;  4DLG A;  2ZJR L;  3DLH A;  4DHY A;  1BGX T;  4KTW A;  4BWM A;  2QI2 A;  4DU1 A;  4GW6 A;  5F0X A;  1S9E A;  2XHB A;  3IAY A;  1WSE A;  3U9Z A;  3M8Q A;  1QQO A;  1VQL N;  3GBT A;  3VEW A;  3OS0 A;  2JWK A;  1TK8 A;  4CK3 A;  3EO3 A;  4KI4 A;  5CHI A;  2FC0 A;  4LF7 K;  4PUO A;  4M3R A;  3HL8 A;  3LAM A;  3CJB A;  4B9V A;  4E1M A;  2VGN A;  4O0J A;  1SL0 A;  1D8Y A;  3HP9 A;  3I56 N;  5KPR A;  4OGC A;  1RGI A;  2GWJ A;  4IJA A;  3WEE A;  5GAG P;  1VQN N;  3M8S A;  1UA0 A;  3TI0 A;  1KAZ A;  2YI1 A;  2QXL A;  3RMD A;  1NK6 A;  4W5Q A;  1S22 A;  2JGU A;  4B1U B;  3HPO A;  4CW7 B;  1HNW K;  3AVK A;  5LL6 Z;  3AAP A;  2GUI A;  4YOT A;  4DU4 A;  2ETJ A;  3TAF A;  5AQT A;  4K8X A;  4M45 A;  5A2Q O;  1HLU A;  3ULD A;  3QIN A;  4M7X A;  1WBD A;  3A5N C;  4CZH A;  3FZF A;  4K43 A;  1K8K A;  5LJV A;  1U49 A;  4ELU A;  3HRG A;  3WEE B;  4CJR A;  4E7K A;  1VQK N;  3DAW A;  5SZT A;  4BRK A;  4KH5 A;  3OBW A;  3BEX A;  1ESV A;  3LP2 A;  2W41 A;  4JI2 K;  3P31 A;  3VES A;  2PYJ A;  1QVF M;  3A0I X;  4OKE A;  4M7Y A;  2QTD A;  4JEP A;  3IDH A;  1VAZ A;  1ZXO A;  5M1P A;  2ASP A;  1BU6 O;  2UXC K;  1NU0 A;  4XH1 A;  2HOE A;  4YNQ A;  3CCV N;  3S3M A;  3VPZ A;  4M3X A;  2P9L B;  1W2B M;  1Z6R A;  4XH5 A;  3MK6 A;  3CCS N;  5E84 A;  1OVY A;  5AQU A;  1DLO A;  3OYL A;  3HO1 A;  4IEI A;  3H45 C;  3J7A P;  5I42 A;  1RT2 A;  4DV7 K;  4FJJ A;  4DTX A;  3ZSV A;  3HOS A;  3QIP A;  3TAP A;  2Y1I A;  4CJ3 A;  4WQ5 C;  5M1K A;  4N47 A;  4BRA A;  4BR7 A;  1FKP A;  3DMJ A;  3MN7 A;  4O4G A;  3HI0 A;  4CES A;  3K58 A;  1RT1 A;  3MN5 A;  2ZE2 A;  2KQ2 A;  1RDD A;  2BGG A;  4H8K A;  2G8K A;  4FOE A;  2FF3 B;  3KZB A;  1BIS A;  1JLG A;  4FLU A;  1TAU A;  3OYI A;  3CFR A;  4GV6 A;  4CEC A;  3C7N B;  2VWK A;  4W5R A;  3AVF A;  4CJS A;  4BC2 A;  1IBL K;  3KKS A;  1YT3 A;  3DYA A;  3RSE A;  5J1E A;  4E0D A;  4IFE A;  4CJQ A;  1D5A A;  3LPT A;  4E7I A;  1S3X A;  2G8I A;  1VQ6 N;  5HRP A;  4CF1 A;  1WLJ A;  3E1Y A;  1XQS C;  4KHS A;  4KKO A;  4CZL A;  4B3M K;  3HST B;  4BRN A;  4NXN K;  1VSJ A;  3VQ5 A;  1NK7 A;  2YHA A;  2CH5 A;  2QWN A;  4O5F A;  2D5R A;  5J2M A;  1BQM A;  4QS8 A;  1IKY A;  3W0L A;  5JVG L;  1N5Y A;  3TSP A;  1YF5 L;  2H3G X;  3S41 A;  4HUE A;  4FJL A;  3AA5 X;  2HHX A;  4H0T B;  1D9D A;  1KC8 O;  2EWS A;  3ID8 A;  3M8P A;  3L2V A;  1KQS M;  3PO5 A;  1BIU A;  3ITH A;  4JKD A;  1VQ9 N;  3BDP A;  2PYL A;  3OYG A;  3C95 A;  2X74 A;  1S72 N;  4FJ5 A;  1NK9 A;  5CYM A;  5E26 A;  2FSN A;  4A62 A;  3VQC A;  4LSN A;  1VQM N;  5AQZ A;  4DS4 A;  5JS2 A;  4O5B A;  1BO5 O;  4BC5 A;  5D3G A;  1OH5 A;  2YX6 A;  5H1S Q;  3HOT A;  3PIO L;  3VA3 A;  1NGH A;  5FPM A;  1IKW A;  4LY7 A;  1YAG A;  4KAZ A;  5BRF A;  5AQW A;  1HJO A;  3SNN A;  3IG1 A;  4PKH A;  3CQY A;  4DTR A;  4V19 S;  3RSE B;  4U7B A;  4NCB A;  3E9P A;  1C0T A;  1YVN A;  2ZD1 A;  2A3Z A;  3OYF A;  4FZZ A;  2V7Y A;  5DK5 A;  4IZ9 A;  1WB9 A;  3KD5 E;  3BUZ B;  4AF1 A;  4KHQ A;  1LWC A;  5T7B A;  4CJ7 A;  5HRS A;  4BRF A;  2HHW A;  1HKG A;  4EZ6 A;  5AQP A;  3VQP A;  1EQY A;  2A5X A;  4IEE A;  2FF6 A;  5AZI A;  3SV4 A;  1C0G A;  4DV2 K;  3QNO A;  4KBO A;  4BG9 A;  3SAG A;  4BRL A;  3U9D A;  3FFK B;  3MXJ A;  1C0U A;  1IKV A;  3P4I A;  3K5M A;  4OLB A;  2LSN A;  4DLE A;  1WSG A;  3AVA A;  2NRR A;  3I0R A;  5JMV A;  4B9S A;  1ILY A;  3HP6 A;  2A6A A;  3SJJ A;  3J80 O;  3ZSW A;  4B3T K;  3R9P A;  4FLZ A;  4FZY A;  5GAH P;  3P83 D;  1WUA A;  3C65 A;  1S9G A;  4GKJ K;  3OVN A;  3THY A;  1N8R O;  2DFE A;  1RTD A;  1CXU A;  4JI8 K;  3DI6 A;  1T05 A;  4ISE A;  1E3M A;  2XRI A;  4H4M A;  1LAW A;  3VQA A;  4KI6 A;  4FK2 A;  1X3N A;  1C1B A;  2AP1 A;  2ZGZ A;  2IS3 A;  4HUG A;  5BPM A;  3CER A;  2IVP A;  3VEX A;  1UOC A;  3M8R A;  3SQ0 A;  3IUC A;  1OVQ A;  1ZC6 A;  3CQX A;  3VQQ A;  3RRH A;  3VF4 A;  1R59 O;  4B1Y B;  1G99 A;  4GVE A;  4B1V A;  1QSL A;  2KFN A;  1O13 A;  1YJN N;  3AO3 A;  4C23 A;  5GIO A;  4DSJ A;  1XWL A;  3QEV A;  4QOZ B;  3DLE A;  4OKJ A;  4KRF A;  3O4W A;  4BAC A;  1S6P A;  5BN9 A;  1TUY A;  5KQD A;  5HRR A;  2RF2 A;  3D7E O;  3AVC A;  4CZE A;  3OY9 A;  2Z1I A;  5AJ3 K;  2GEM A;  4K8Z A;  2B6A A;  1EO1 A;  1TL3 A;  3OBY A;  1TAQ A;  4H0X B;  2YNH A;  4H5W A;  5FPD A;  1GLB G;  3T1H K;  1VSI A;  4IG0 A;  3WXJ A;  4J2A A;  1HNI A;  4CJV A;  3CCM N;  4E3S A;  1YJ9 N;  3ZX2 A;  2ZQB A;  1RFQ A;  3PSI A;  2O8F B;  1N32 K;  3SQ2 A;  2D4W A;  3KHY A;  5CZ2 A;  2PZS A;  4ID1 A;  2E2P A;  4LH5 A;  1JL2 A;  2OYQ A;  4CFA A;  1SKR A;  3NCI A;  3RVC A;  5C12 A;  2IGI A;  2NRT A;  1YVU A;  4DMN A;  3J7Z O;  4BRI A;  4L8R B;  3L4Q A;  4BC4 A;  2NLX A;  3SUQ A;  1T7P A;  1Z05 A;  4DSL A;  3NH1 A;  3I8D A;  2Z1H A;  4B3O A;  1KXP A;  2B5J A;  3LDQ A;  4JKG A;  4CK1 A;  5M1F A;  3ZSQ A;  2VQE K;  2CH6 A;  5JLH A;  5LMU K;  3P1G A;  1T44 A;  2KFZ A;  1SKW A;  2F8S A;  3EZW A;  1BL3 A;  1A5X A;  4IKF A;  1DT9 A;  4MLH A;  1RDW X;  3VOV A;  4O8K A;  4JNE A;  4E19 A;  3KLF A;  2D0P A;  3LDO A;  4WFN L;  4ICL A;  3CC2 N;  1HMV A;  1JCG A;  3CPW M;  3THW A;  2KZM A;  4FM1 A;  4BVO A;  4ZHR A;  3SBG A;  3FR0 A;  2A42 A;  2P5G A;  2Q3S A;  3OA9 A;  3TTC A;  1V4S A;  2OZS A;  1NK8 A;  2O8C A;  4Q0B A;  5BRE A;  4HTU A;  2ATQ A;  5ADX A;  3VQE A;  4BGA A;  1RCH A;  1XMO K;  3QB0 A;  2UUC K;  4YOR A;  4FJ7 A;  1NKB A;  3CCJ N;  4BR4 A;  4MO5 A;  3MWT A;  2ZGY A;  1FJG K;  1IJJ A;  2VQF K;  1YI2 N;  4RW4 A;  4DV6 K;  4H4O A;  2YHY A;  2HVH A;  4F9O A;  4CGH A;  4B1W B;  5LY3 A;  5HOO A;  1C1A A;  3TR8 A;  1T6C A;  4NB4 A;  4C8L A;  1DKG D;  1W7A A;  4DV4 K;  3WQU A;  4JI6 K;  3WNE A;  1TVR A;  4CZK A;  5AQS A;  2OPR A;  1SS6 A;  1KRP A;  2F8T A;  3NMU A;  3V9U A;  3ZET A;  3QBW A;  1U6Z A;  1HRH A;  3SJH A;  3VGK A;  1RT7 A;  3BZC A;  3WUH A;  2NRX A;  4CCH A;  3KVG A;  4F4K A;  5JS1 A;  3MN9 A;  3LM9 A;  3O9Q A;  2RKI A;  1NK5 A;  1T8E A;  1T6D A;  2NRZ A;  4GVM A;  3PX6 A;  5HRO A;  4IOX A;  3T1Y K;  3NF7 A;  4ILH A;  3VEY A;  4CJL A;  4LD0 A;  4CZI A;  3TTD A;  1Y97 A;  4CI6 A;  3QML A;  2YNG A;  2QEX N;  1KAX A;  3QO9 A;  3E01 A;  4A57 A;  3NE6 A;  4NLC A;  1K6Y A;  2PBD A;  3OS2 A;  4OPJ A;  3AO4 A;  4YDU C;  1N6Q A;  2VGM A;  1BCO A;  3QDK A;  5FRN A;  4O44 A;  3R8E A;  3A5L C;  5KPT A;  1NJZ A;  1NG9 A;  1SQK A;  1NJY A;  3TAN A;  1VSH A;  3THX B;  1H1V A;  3CJ1 A;  1U48 A;  4H03 B;  3ZT1 A;  4BRQ A;  1NJI O;  5J2N A;  4JRP A;  4NCA A;  5AQO A;  3Q7C A;  4CF8 A;  4ZTF A;  4JV5 K;  3VQB A;  3QLH A;  1ASW A;  1VQ7 N;  4I6M A;  4DSI A;  1K73 O;  4CED A;  1KFD A;  3FZL A;  2ZJP L;  1XUP O;  3CM6 A;  5I9E B;  1YIJ N;  5M1O A;  5AQY A;  2IDO A;  2FBT A;  3CI5 A;  3O1W A;  4PKI A;  3WXK A;  2QWO A;  4B08 A;  3AVG A;  1P8Z A;  4CZM A;  4CFC A;  5EOY A;  3O8M A;  4RG8 A;  4HVJ A;  2P5O A;  4DQR A;  4TSX A;  1SUQ A;  2HNY A;  1NWK A;  3F9M A;  5C24 A;  2OTJ N;  5IT9 O;  2V51 B;  3AY9 A;  1SL2 A;  1NBW A;  3MDQ A;  4EAH D;  4N76 A;  1UA1 A;  3JAM O;  4BRG A;  4M63 C;  4GKK K;  3EL2 A;  1JLB A;  1NGE A;  3T69 A;  4CF2 A;  3PX0 A;  3KK3 A;  4W5O A;  4LF9 K;  3NVM A;  4WQ4 A;  1XNQ K;  1QZ5 A;  1WSF A;  5AQL A;  4CVN E;  1KAY A;  1P90 A;  2VCP A;  4FWO A;  3CJA A;  2HHQ A;  1WOQ A;  2EX3 A;  4DSK A;  3ZCM A;  4CBU A;  2DFH A;  3E9L A;  4LF4 K;  1S1T A;  1DTQ A;  3L3V A;  1TKZ A;  2WFB A;  3AAQ A;  3JSM A;  2O4G A;  1NM1 A;  3L0Q A;  4Y1C A;  3BZK A;  1IBK K;  4R79 A;  1RDA A;  1KVC A;  4JYA K;  1RT4 A;  2AA4 A;  1BCM A;  2R7Y A;  3MAQ A;  1DEJ A;  1U2V A;  3G71 N;  4K25 A;  4A5A A;  1T3V A;  2YV0 X;  1QQM A;  1Z25 A;  4QS7 A;  5FLX O;  3ZSZ A;  3H1Q A;  4Y1D A;  3U6F A;  5FPN A;  4Z4F A;  5AFU H;  1ASV A;  3L2W A;  3LAL A;  4M3U A;  4BE2 A;  4YDU A;  3CXC M;  1NKC A;  1BG3 A;  5KRS A;  4LF6 K;  2W42 A;  4CHO A;  4E89 A;  2A40 A;  5M1Q A;  3V1O A;  4C8K A;  1NNE A;  5CE3 A;  3SUP A;  4NO7 A;  3WXM B;  3O3G A;  4IO9 L;  4DR2 K;  2O8D B;  1QSS A;  3TU5 A;  2G8F A;  1XC3 A;  4IOC L;  1Q8I A;  4X64 K;  4FK4 A;  1R0A A;  2D0C A;  3LPU A;  1KTQ A;  2I7N A;  4BQL A;  4FJH A;  2O8C B;  2ZF5 O;  3DWL A;  4B9L A;  1L5U A;  4FK0 A;  2W6L A;  4BC3 A;  3QEX A;  3TAQ A;  2OTL N;  5FRO A;  4CJK A;  5BR9 A;  3VN5 A;  4PL8 A;  3DJC A;  1NGC A;  5AQI A;  4H0Y B;  2GWK A;  1TUU A;  3B8A X;  1W0H A;  1SL1 A;  3O9U A;  1JL1 A;  3D45 A;  4B8A B;  2BE2 A;  3G25 A;  4RWT A;  4JN4 A;  5BR8 K;  1HQE A;  3SMS A;  2UXB K;  4JK9 A;  4NLB A;  2E88 A;  1TK5 A;  2FSK A;  4OLA A;  2HHS A;  3QFP A;  1U45 A;  2GUP A;  4BR5 A;  4M3Z A;  3ZT0 A;  1K8K B;  4WCE L;  3T3F A;  4K0K K;  3DLR A;  5AQR A;  4BRO A;  1JLC A;  4DB3 A;  3ZT3 A;  3FE1 A;  1LWE A;  3AVI A;  4FWM A;  4HUF A;  3HM9 A;  3OYB A;  1Z26 A;  1JLA A;  4KB1 A;  1RBV A;  4CEF A;  4KFB A;  4DUY K;  3BF1 A;  4FW1 A;  3LDL A;  2J4R A;  3OHR A;  3OYD A;  1J9A A;  1JCE A;  3J81 O;  3G0Z A;  4BRE A;  4KTQ A;  1ATR A;  3IMX A;  3AGK A; 
#chains in the Genus database with same CATH homology
 4DR7 K;  2UUA K;  4DV5 K;  3OTO K;  4JV5 K;  5FLX O;  4JI2 K;  1N34 K;  4B3R K;  4LF6 K;  4JI3 K;  4DR1 K;  2UXD K;  4DV3 K;  1XMO K;  4AQY K;  2UUC K;  2F4V K;  5IWA K;  4DR5 K;  4DR2 K;  1FJG K;  1HNX K;  2VQF K;  2UU9 K;  4DV6 K;  1N36 K;  4X64 K;  2UXC K;  4NXM K;  4DV1 K;  4JI4 K;  4YHH K;  4JI5 K;  1HNZ K;  5LMN K;  5AJ3 K;  1XNR K;  5IT9 O;  4JI0 K;  2ZM6 K;  1IBM K;  3J7A P;  1J5E K;  4DV4 K;  1HR0 K;  4DV7 K;  4JI6 K;  4V19 S;  3JAM O;  4KHP K;  2E5L K;  4GKK K;  3T1H K;  4LFC K;  4X62 K;  4LF9 K;  4DR6 K;  4LFA K;  4DR3 K;  4LFB K;  1XNQ K;  4LF8 K;  4CVN E;  4LF7 K;  5BR8 K;  4X65 K;  1N32 K;  4OX9 K;  3T1Y K;  2UXB K;  4DR4 K;  4DV2 K;  4X66 K;  4LF4 K;  3J7Y P;  4JI7 K;  4LF5 K;  1IBL K;  4YY3 K;  4K0K K;  1N33 K;  1I94 K;  3J80 O;  1IBK K;  4B3T K;  4CW7 B;  1HNW K;  2VQE K;  4B3M K;  5LL6 Z;  2UUB K;  5LMU K;  4DUY K;  4JYA K;  4GKJ K;  1XMQ K;  4NXN K;  5A2Q O;  4B3S K;  3J81 O;  2HHH K;  4JI8 K;  4JI1 K;  4DUZ K;  4DV0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...