2VQEK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqeK00
4JI4K 4DV7K 2VQEK 2UUAK 4LF6K 5A2QO 1XNRK 4LFCK 5AJ3K 2VQFK 3T1YK 1HR0K 4DV4K 4DUYK 4X62K 1XNQK 2E5LK 4DR3K 3J81O 1IBKK 2ZM6K 4B3TK 4YHHK 5IWAK 2F4VK 1N34K 3J80O 4JI2K 3J7YP 4NXMK 4DV6K 2UXBK 4AQYK 2UUBK 1I94K 1IBMK 4NXNK 4CVNE 1HNXK 4X66K 4X64K 3T1HK 4JI8K 4GKJK 4LF8K 4CW7B 1J5EK 4GKKK 3JAMO 4YY3K 2HHHK 4DV5K 1N33K 4JI6K 4DV2K 4JYAK 1N36K 1HNWK 4DR4K 4B3RK 2UUCK 4DUZK 4KHPK 2UU9K 4DR1K 1FJGK 4DR6K 4JI0K 4JI7K 3OTOK 2UXCK 4DR7K 5LMUK 4DR2K 1HNZK 4K0KK 4LF4K 4LFBK 5BR8K 1XMOK 5LMNK 4DV3K 2UXDK 4DV1K 4JI3K 4V19S 4B3MK 4LF5K 4OX9K 4DV0K 4JV5K 5LL6Z 4LFAK 4LF9K 1XMQK 5FLXO 5IT9O 4LF7K 4JI1K 3J7AP 4DR5K 4JI5K 1IBLK 1N32K 4B3SK 4X65K
chains in the Genus database with same CATH superfamily
2WFBA 1BI4A 3U3YA 1QHTA 3VQCA 3VQ6A 1U45A 4OJRA 4IO8A 1EQYA 1JLBA 1HMVA 1SQKA 3CC2N 4YFUA 1GLBG 2OCEA 3J81O 2JWLA 5GINA 5GAHP 2CGKA 3K9JA 4NCBA 1GLJO 5FRMA 2EX3A 3J7YP 3BDPA 4F3TA 4ILJA 2Y1IA 3LDQA 3SV3A 3TTDA 2FSKA 3CERA 2ATQA 4M42A 3D2FA 3PO4A 4CJTA 4B9MA 1RTJA 1Q18A 2D0PA 5AZJA 4FWOA 1GOBA 4CE9A 3I0RA 1JLGA 4CERA 2HHHK 1ASUA 2VG5A 3R6MA 2VWKA 3CFPA 3THYA 2VCPA 1Q82O 5CZ1A 1C1AA 2E2PA 3OVNA 3SAHA 4CGFA 4B3RK 4FJNA 1XWLA 2IS3A 4OLBA 2HHWA 1GLFO 4BRMA 4CJWA 3K58A 4E1NA 4B9NA 4JI0K 1U4BA 4CZGA 4WQ4C 3MCPA 3G4SN 4CFDA 3TAFA 1CZ9A 3TWHA 4IKFA 1IJJA 4HUGA 2A1RA 5EOYA 4OX9K 1HYVA 4JV5K 4Z4IA 3MMVA 4IO9L 4AILC 1ZBIA 4DQRA 3TARA 4LFAK 3RR7A 4CJVA 2D0CA 1GLCG 3ITHA 2IC3A 2RHKA 1NK8A 3ENHA 4BR0A 2AP1A 3E66A 3H45C 1QQCA 1IBLK 3QFUA 3NH2A 3KKRA 4WQ5C 2Q0RA 3RMAA 2ZE2A 1BDGA 4EHUA 3O4WA 4HTUA 2VQFK 3D2EB 4CBUA 2QWRA 1KVAA 1SKSA 3TSUA 3FZFA 4DFMA 5KPZA 2E5LK 3C7NA 2DTUA 2Q3SA 3B8AX 1NGDA 1RDAA 1WB9A 4U67L 3SAGA 4KFBA 3F2KA 4PKGA 1WN7A 1IBKK 4KH6A 4CEFA 2F4VK 3RVCA 2I7NA 1KCFA 4JI2K 5AQPA 5AR0A 2E8AA 3MX5A 2RN2A 3TABA 2O8EA 3L3UA 3LM9A 5F0XA 5DK5A 3C6TA 1NKEA 2G8UA 5FDLA 5J2PA 3HTVA 5AQIA 1BA0A 1VQ5N 1V4TA 3BP8A 1S1WA 3PSFA 3N4PA 3E9LA 1QTMA 5J2NA 1S1UA 3O9TA 3QNNA 2RKIA 3OYAA 1XQSC 3SJJA 4F3OA 4FZYA 4DTRA 1YTUA 4DR4K 2UUCK 4QCLA 4FJXA 3O4NA 4CESA 4E19A 2R7YA 4JKFA 4B3OA 1NMDA 3P5JA 1IKXA 2FSNA 4QS8A 4BC4A 3V9ZA 1GLAG 1B9DA 2QWMA 4XEIA 1FK9A 5LMUK 4K0KK 1OVQA 2P9LB 2AA4A 2NRVA 2XO7A 1VQLN 2PYJA 3CETA 4E7JA 3QERA 2QWOA 4XIUA 3C6AA 3BF3A 1DEJA 2X6NA 4XH4A 4DU4A 3KZBA 3GBTA 2P9KB 3TTCA 4DSJA 4PUOA 3PX0A 1S1TA 3TAEA 3L2WA 3VMFB 4LF7K 4FVMA 5D3GA 3F5TA 1X9WA 3G25A 1H1VA 4FL9A 4DTJA 2ZJPL 3JSMA 3ZYYX 4BQZA 1TKXA 4JKEA 3M8PA 5GIPA 3ZX2A 4CEOA 1HR0K 4JS5A 2O8BA 4I9QA 2O8FB 1C6VA 2NRHA 3PX6A 4CEQA 3EO3A 3NBPA 3U8XA 2QW9A 3TPQA 2AJQA 4RTFD 5J1EA 4JKGB 2NNWA 5IWAK 4BRFA 4KI6A 2QKKA 4I9LA 3BZCA 3M8RA 5EVZA 3CFRA 1TV6A 5LJVA 3MXMA 3TSPA 4Y1DA 4DU1A 3O5BA 4YNQA 5AQJA 2CGJA 4A2AA 4EIAA 3QEXA 3FLCO 4PY5A 2FF3B 3QLHA 1HPZA 3K57A 3DXKB 3L0QA 1TKTA 3K5MA 4GMJB 3JAMO 3C6HA 1C0GA 3NGIA 4F9OA 3ULDA 4KAZA 4B9TA 2ZGZA 1ESVA 1EXQA 4DV2K 4Y1CA 4W5OA 1K73O 5GIOA 1RT6A 1RTIA 1LCUA 3UIQA 2ITGA 4OLAA 4IFEA 1RDDA 4WQ4A 4CJLA 2BGGA 4FJ5A 5CHIA 4FPAA 3ZT1A 3WXIA 4DQSA 2HHUA 3LL3A 4U7BA 4E0DA 4FK0A 4EFHA 1U2VA 1T05A 2QEXN 2PBDA 1VQ6N 1W9HA 4FJJA 4JKCA 3JYTA 5BN9A 3R8EA 4DV1K 3T69A 3S9HA 2E1YA 2Q31A 4LSNA 3M3ZA 5AQGA 4BG8A 3VTIA 3RSEA 5BN8A 4F4KA 3O3HA 2HBMA 2IVPA 1LW2A 4WQ5A 4FWQA 3AO3A 5SZTA 3O1WA 5FLXO 1YXQA 5M1OA 2YJEA 1RTHA 3VQ5A 5M1QA 3I55N 4CIEA 4JI5K 3SYZA 3Q7CA 3TU5A 4CJ7A 1T7PA 4M3TA 2VQEK 3CG7A 3AVCA 2QWPA 2XY8A 1D9DA 5C12A 3S3OA 2QTDA 3TAPA 3KWIA 4CJEA 2GELA 1ZBLA 1N8RO 3R3LA 3ZSQA 4HUFA 3FE1A 3M8SA 1L3TA 5KQ8A 2B6AA 5KPTA 4CIGA 3SUNA 3K9KA 4FJGA 4DSEA 2O8CA 4FM1A 4M3ZA 1YT3A 4IZ9A 2F9TA 1DT9A 3PO5A 1BO5O 4DSLA 2FBYA 4PA1A 1KAXA 4FYDA 5SWMA 4PQUA 2KFNA 1IO2A 1HKCA 3KK3A 4CFAA 4K25A 1RT5A 3V4IA 4YY3K 4CZEA 1I3AA 4I2QA 3ULEB 4GVEA 3O8MA 4DTOA 3T19A 1IG8A 4DG1A 4BE1A 1QSYA 4BR5A 4MFBA 1CXQA 2WUSA 2E6MA 4PL7A 1HNIA 4CEBA 5HLFA 5C25A 1S6PA 4ZTJA 4RW9A 4CI6A 4FJ8A 3Q7BA 5LJWA 4M3WA 2BUPA 2GUPA 1E3MA 4CZIA 3ALYA 3WXKA 3VN5A 4A5BA 3I56N 3QEVA 3EE8A 3VEWA 3F9KA 3AA3A 1JLEA 3BZKA 1HLUA 1NG9A 1D5AA 3AARA 5LMNK 1NGCA 1A5WA 3O80A 1X3NA 4ISGA 4KTWA 2BH1A 2YV0X 1NJXA 1XUPO 1JCEA 5FROA 1Z26A 1Q9XA 1VRTA 3O9RA 5C10A 1BWFO 5FPEA 4BY9C 4FWNA 4DTXA 4BC2A 2A3ZA 5FPNA 3CJBA 1KLNA 5H1SQ 1HJOA 1YAGA 2IAJA 3AVIA 1U49A 3NHGA 4GNIA 3SQ1A 4CF0A 3VEYA 3PLAA 1GLLO 2NLXA 3ZT2A 1R59O 3VEOA 4M3UA 3T1YK 5BPLA 4Z4GA 1DKGD 1Q86O 4DTSA 5AQLA 5BRDA 2CH6A 4FOEA 1L3SA 1L5UA 5ADXH 4DR3K 5EY4A 1Q9YA 3UKUB 3TI0A 4FLYA 1HPMA 3E9OA 4CZMA 2FBXA 3QDKA 4CJFA 3AVBA 4H03B 4CZFA 4CHOA 1RILA 4H5WA 2I5JA 3O3FA 4DQIA 3SBGA 1RNHA 2HHQA 3MN7A 1BUPA 3DLGA 3DXMB 1DTTA 3ENBA 2RPIA 3MEGA 4IG0A 4JI8K 3AVFA 1JLCA 1TGOA 3FZMA 4RCHA 3LDOA 3P1GA 3OY9A 1KLMA 1RGIA 1HJRA 2OPSA 4BR4A 1ZYQA 4PKIA 3SQ4A 4C8KA 2XRIA 3HZ6A 4BWJA 4JI6K 4QS7A 3OYMA 1N36K 2E2NA 3NMUA 1KAZA 4E1JA 5HRNA 3NGYA 1LOTB 1DGKN 1S9EA 4AHUA 1TUUA 5KRSA 2D4WA 4DSFA 4Z0UA 4HCBA 3CCQN 4K43A 2VYPA 4G1QA 4DQPA 3NF9A 3OW2M 4FLUA 1NGHA 1JXBA 1C0UA 3HP6A 2YHXA 2J4RA 4B3MK 1BG3A 1KAYA 3CCRN 3FR0A 5HRPA 1REVA 4NLBA 2PY5A 4CEEA 3GL1A 4EP5A 3VEZA 4IOXA 3QINA 3K5OA 1ATRA 3MWPA 3ZLJA 4BC5A 4KI4A 4RW4A 1EWRA 2D5RA 2YHBA 2B5JA 4AF1A 3U6FA 3HI0A 2RE2A 3TAGA 4CJSA 4FOIA 2CH5A 4H5RA 3V9SA 3KD1E 2HHTA 4LY7A 4H0XB 2XY5A 4JHDB 3QIPA 3HPOA 1RT7A 5AJ3K 3QICA 4DV4K 4H0PA 2QXFA 3SUPA 1P90A 1Z25A 3THXB 4O5FA 1KFSA 3L6QA 4CECA 2YKNA 4MLHA 1SKWA 2DPNA 1QVGM 2F7TA 5EU7A 1E4GT 1DTQA 4AHVA 3VQ7A 5DM6L 4DF8A 2ZGYA 4DV6K 3DRSA 2G8KA 3HYFA 5HBMA 3JS6A 4R79A 4HTLA 3DLBA 4B1WB 4CJPA 4NXNK 3KK7A 1Q7YO 3CMEN 1T3VA 4JS4A 4J2AA 2HF3A 3NE6A 2E6LA 1HUXA 4JK9A 3FZKA 3LP0A 3QBXA 4I6MA 2OPPA 3WXLA 5C42A 1LW0A 4CF1A 4FJKA 4CD3A 3DAWA 3CJ9A 3CCSN 3S41A 3E9PA 4DV5K 3OA9A 4H5NA 4C8OA 4EZ6A 4DFPA 2D1KA 3LWMA 4HVJA 2VWJA 2W40A 1JLFA 2DFHA 1YVUA 3QEWA 4ELTA 4KHPK 1A5XA 4N47A 4B1YB 4WCEL 3HVRA 1UA0A 5FPMA 1NJYA 5HOOA 2OANA 3DJCA 3VGLA 4EHTA 3OYEA 2YNHA 3D45A 4LFBK 1QE1A 4BGAA 3CD6N 3HPHA 1YJNN 3ZETB 1BCOA 2XY6A 4YOWA 4C8MA 5C0YA 5AFUA 4A62A 3LPTA 5AQOA 2HHVA 4DWIA 3OYBA 2HBKA 1ATSA 2IIRA 4JKBA 3IS9A 4C23A 4JKDA 1RDBA 1MWMA 1ZBSA 4X65K 4FK2A 2ITMA 1QHAA 5ELZA 4E7HA 4LF6K 2HBLA 1JL2A 3RWUA 3CQYA 1JXEA 1NKBA 1SL2A 4BGBA 2GWKA 2P9NB 5JS2A 4DKWA 1KRPA 1HX1A 4A2BA 4CGDA 1S72N 1VQ8N 4B8AB 4N76A 5AQMA 3SQ0A 3ZSRA 1M1KO 4DHYA 2HVHA 3H6EA 5KGXA 3WT0A 4FWPA 2OTLN 1G15A 1LAVA 3SCXA 1RFQA 1D9FA 4N41A 2UXBK 4MO4A 4Y0WA 5CY4A 3AVGA 3O1BA 1RT4A 2B4JA 3BF1A 1BHLA 2VGMA 2PZSA 4DS5A 4JNEA 4CEAA 5AQYA 2GUIA 1HNXK 4BRQA 1WSHA 1W7AA 4X64K 4CJUA 5AZJB 4GKKK 2O8DB 1F21A 1T6DA 2P9LA 4DU3A 1NGAA 3MK6A 4GY2B 4CJ4A 4EP4A 3O9UA 4M3RA 4CHZA 3A0IX 2Z1IA 1BCMA 1XC3A 2P9KA 1BQNA 3ZT3A 4GW6A 4FLXA 1LWFA 2HOEA 3CYMA 4HUEA 2W41A 1FXXA 3F9MA 4DR1K 4OKEA 1NGIA 3LDLA 2QA4N 4H8KA 3MCAB 1VRUA 4H0OA 4A5AA 2A42A 1LWEA 4GV9A 3OYFA 4ISFA 1A5VA 4PHTX 1NJZA 4FZXC 4ILHA 4I2PA 3L2QA 3DI6A 3SPZA 3RMCA 4JI3K 4V19S 2O8FA 4ILGB 3RRHA 3MXJA 3MXIA 2FC0A 3OYDA 4JKHA 4J2EA 2VG6A 4CZKA 2OYQA 1MDUB 5C2DA 4JKGA 1XHXA 4ELUA 3DLHA 4OPAA 3CCUN 3SV4A 3NH0A 3D6RA 5F2RA 2P9UB 3NAEA 1EP4A 3E1YA 3OYKA 3ZCMA 3UE5A 4CIFA 3C7NB 3SBTA 3MEEA 5HRRA 1X1PA 3DXKA 4BRCA 4OPKA 1HQEA 5C24A 4B3TK 3O6WA 3SMPA 4WFAL 1WSEA 1ILYA 1C1CA 3TTFA 4DF4A 4RW8A 2HMPA 4W5TA 2UUBK 2O4GA 1BOTO 4WYBA 1WBBA 2LSNA 4BE0A 4FLWA 4DMNA 5M1FA 3A5OC 3M8QA 4O0JA 4OGEA 3LALA 1U6ZA 2HVIA 1C0TA 4DTMA 1J5EK 4FCYA 3NH1A 2HHSA 1NBWA 1UWBA 3DYAA 4BDYA 4JYAK 5AQUA 4B1UB 3SI6A 1HNWK 1D8YA 3QESA 1Z05A 4NYNA 1Q81O 4F2SA 4H0TB 3DM2A 1RT3A 1X9MA 4YDUC 4CZHA 4M7YA 1OH7A 2YKMA 3H3OB 4JRQA 4JK8A 4IOCL 4OPJA 2ZF5O 1E4FT 3QFPA 4LF4K 1X9SA 4UQGA 3OYIA 5AQKA 4JAXA 2WC9A 4AM7A 1J6ZA 4E7LA 1HKGA 3ENOA 5B8HA 4BVPA 4J8FA 1KC8O 1J9AA 3B6OA 4BE2A 4LF9K 1TAQA 3LAMA 3HOTA 2YX6A 3VQDA 4CCHA 3H08A 3HO1A 4DLGA 3FZLA 1ZBHA 5CYMA 3AGRA 3AV9A 4IJNA 4A59A 1TK0A 3I33A 4H5VA 1IH7A 3QBWA 3WXJA 4N5SA 1RT2A 3I0SA 4DS4A 2F8SA 3SQ2A 3O3GA 3EZWA 1R0AA 2IDOA 1L3VA 1BIUA 3BEXA 4DCHA 3DOKA 3ZSOA 3QMLA 3NGZA 5T7BA 2FSJA 4CGHA 3L2UA 4Z4EA 3U3GA 4CK2A 4ID1A 1G99A 4IEIA 2QWLA 1P8ZA 3ULEA 3C65A 3NF6A 1NMNA 2Q36A 3L4IA 4NXMK 4AQYK 5AQNA 3SNNA 1IBMK 2QKBA 4BG9A 3V1RA 5BPMA 3D7EO 4IG3A 1S6QA 3M1FA 3WQTA 3FFKB 1VQKN 2E88A 3T3FA 1K8KA 3T1HK 2YJFA 3BUZB 4AM6A 1TL3A 4BVOA 4KB0A 4FWLA 1WSFA 2RF2A 3KD5E 3AVKA 4JEPA 1X9JA 1D4XA 3R9PA 1J53A 5HL7L 1GLDG 1T03A 3W3DA 3WNEA 3NVKA 1VK0A 5KRTA 3CCVN 2GBZA 5MLCQ 3ZSXA 4NYFA 3MECA 2G8FA 3CC4N 2I7PA 3KVGA 3THWB 3PIPL 1X3MA 3VGMA 3AVMA 1VQPN 5LY3A 4M45A 5I42A 3CQXA 3AA5X 3DMJA 4CBXA 2UXDK 1I39A 3GOIA 3H3NO 4AH9A 3CIPA 3VEVA 3AGKA 4NB4A 4KHWA 1JL1A 4RG8A 3SUOA 3CPEA 5F1XA 1QQMA 1QVFM 5J2QA 4B9UA 1SAZA 1VQNN 3EY1A 4BREA 1NOZA 3KJVA 2ZJRL 5FPDA 2OA8A 4M3YA 2KZZA 1CXUA 3ZSZA 2KLAA 2UUAK 1QQOA 1TYQB 3L3VA 4M7XA 5HROA 2W42A 1HKBA 4DUYK 3HRGA 4WE1A 1O13A 3VENA 1VSKA 1NNEA 3E01A 5DMRA 3LWLA 4O55A 3ZSWA 3LZJA 1SKRA 2YNIA 1S5JA 1S3XA 4MQ3A 1RBTA 1VSLA 4B08A 5M1NA 2QM1A 4OKJA 5AZIA 4XH5A 5BREA 3HK2A 1I94K 4FJHA 3IUCA 4B8CA 1EKEA 3SPYA 1T6CA 4CHYA 2P5GA 4F2RA 4IDKA 1U47A 4KV8A 3LM2A 1SV5A 3H1QA 4M41A 3V9WA 5K14A 3U4LA 2E2QA 5BR9A 1TK5A 4QOZB 3SJHA 1TKDA 3UB5A 1SZ2A 4GVMA 2FXUA 3AO5A 1U04A 3AO1A 1OH6A 3NVMA 4YDUA 4PWDA 3FFIA 3A2FA 1RDCA 4FWRA 5AQFA 1S1VA 3ID8A 1SL1A 1KVCA 1NGJA 3VPZA 3EEQA 4JLHA 3P83D 1MA9B 3WEEB 3UKRB 1SS6A 2PYLA 3B6PA 4FM0A 3V6DA 3QIOA 3I8BA 3FGUA 4OPHA 3VQEA 2A41A 2A40A 4JHDA 3WNGA 3OYCA 1SL0A 4FZZA 5KI6A 4YOVA 4W5NA 4ELVA 2A6AA 4BR2A 4LF5K 1VSIA 2YHYA 3OYNA 4DFKA 3ZX0A 3BY5A 3LAKA 4KKOA 4O0IA 3K0SA 3THXA 3V81A 3OS2A 3TANA 3VF2A 4B1VA 1WOQA 4LC9B 1JLQA 4QS9A 2P9PB 4LSLA 4Z4FA 1CZAN 1N32K 3C0BA 4FJ9A 4CK1A 3THVA 1T44A 2VWBA 4C8NA 4FJLA 5AQWA 1GOCA 3SLCA 3HL8A 1QSSA 4FWKA 1WSJA 3ISNC 5CR4A 1EWQA 3EE9A 1JCGA 4JK7A 4ID5A 1TVRA 1RT1A 3EKSA 4LH4A 3CQ8A 3U9ZA 4ZTFA 4YHHK 4Q0BA 4OKKA 2ASPA 3KIOA 4DLEA 3SAFA 1NK4A 3LP3A 3P38A 4CHQA 4CHNA 3LZIA 2OPQA 2HMIA 5E26A 2O4IA 4CFCA 3MN9A 1BQMA 2WOMA 3BGRA 2NZTA 4H0YB 5GAEP 1BA1A 4E7KA 3WNHA 1VSDA 3OJUA 1XC9A 3OS0A 4FVUA 1TKZA 4GKJK 3V9XA 2XY7A 3HSCA 4BRHA 1GOAA 2P9SB 1N5YA 1HNVA 2ETJA 3SUQA 4O5BA 3A8YA 3TAMA 3I8DA 1NK6A 4NO7A 2FBVA 2P9IB 1RTDA 3ZETA 4F8RA 3VGKA 2ZJQL 4LD0A 3S3NA 5JVHL 3ZT0A 1EX4A 4KRFA 3CJAA 2IGIA 4KREA 5KGWA 1BISA 5E41A 3AY9A 1UAXA 3VQAA 4KBOA 3HOSA 4DR7K 4HHTA 2OZMA 1JCFA 4O8UA 4CJ5A 4BACA 5BR8K 1XMOK 3VTHA 4B9QA 4WFBL 1VSEA 3SK3A 2P1JA 3P39A 3TR8A 2P9NA 3CF5L 4R5PA 3HSTB 2GWJA 4BR7A 1EETA 3G10A 3HT3A 4AHRA 3MEDA 2D0AA 1KSPA 1N6QA 2W6KA 4JD2B 3U9DA 3J7ZO 4H0VB 1L3UA 4DR5K 1NGBA 3ZEUB 2G8IA 1M90O 2PAVA 3RTVA 2KTQA 5A2QO 4DTUA 3D2EA 3VF4A 1RBVA 3V9UA 4BC3A 3C94A 1NK7A 3K2PA 5GADP 3AO4A 3OYGA 2DFFA 3C95A 1YITN 1Y64A 2O8DA 1RBSA 5KPRA 2D0BA 2G8WA 2HSTA 1WSGA 1GLEG 2X6SA 3QO9A 5KQDA 2IVNA 1YVNA 2KW4A 3VESA 1BI4B 4DFJA 3WUHA 3ID6A 3A5LC 3RRGA 2V51B 4KHUA 1WAJA 1VAZA 3V1OA 4CD1A 4KH4A 5JICA 2ZQBA 4CGIA 4KH5A 4I6MB 3CCMN 3L8BA 1VQMN 1VQ7N 1VSFA 1WUAA 4M3XA 3H1VX 1WNSA 2FLOA 4K41A 1IKWA 4BROA 4DTNA 2E1ZA 3SZ2A 2G8VA 1QZ6A 3DLLL 4XH1A 3AA2A 4JN4A 3VQQA 3QEIA 4FWMA 1HYZA 2UYTA 4FJIA 1VSMA 2NRXA 5AQTA 1NJIO 4DUZK 2BE2A 3D2FB 3CHWA 2QWQA 2Q2RA 3VEXA 1YJWN 4DR6K 3A5MC 4JI7K 1NGEA 1NU0A 1NM1A 4K8XA 1QZ5A 1WAFA 2P5OA 2GX9A 1CLQA 3GE1A 4PL8A 3DRPA 5I3UA 3CM5A 4DR2K 3QB0A 1HNZK 4FLVA 3THYB 1LWCA 1K6YA 2P9UA 4CHPA 4UY8O 3IG1A 1QS4A 4IFYA 5J2MA 4IOAL 4C1NK 3NF8A 3VF6A 2FBTA 1JLAA 3EN9A 2Y1JA 1IKYA 3W0LA 3VETA 2IVOA 4IXCA 4BR9A 3J7AP 3CPWM 3L4QA 3F73A 4B3SK 2OTJN 5C15A 4JI4K 2V52B 2HB5A 4CJ3A 4CJRA 3G6EN 3CI5A 4BDPA 4EZ9A 3VOVA 1XNRK 4LFCK 4BQLA 1WSIA 4FWSA 3ASMA 3ZT4A 2GTDA 1MWKA 4X62K 1S9GA 3T7ZA 3V1QA 2OZSA 2V7ZA 1ASVA 3S3MA 1C0FA 3GG4A 1OKJA 3NFAA 3OHRA 4TSXA 3TAQA 2KFZA 2HNZA 5GAGP 4KPYA 4CEZA 3J80O 1WLJA 3QNOA 4Z94A 5DM7L 4CJQA 1ZBUA 1JJ2M 3IRXA 3MN6A 4MLEA 4CF8A 3CJ1A 4H5TA 1YF5L 4KHYA 5JS1A 1V4SA 1Z6RA 2NRZA 3DLRA 1IV0A 3O9SA 3IKMA 2V7YA 2EHGA 4WF9L 1W97L 2HNDA 4LF8K 4KHQA 4CF9A 1C0MA 4CEDA 3DOLA 1OVYA 3CCEN 1VSHA 1IKVA 1XI1A 3L2VA 4KTZA 4BRKA 3P31A 5BRFA 1NGGA 4DQQA 3NF7A 1NWKA 2O8EB 1RBRA 5CE3A 4BRAA 2P51A 2GV9A 1XHZA 3OYJA 4JRPA 5BRHA 4FPBA 3EKUA 1FJGK 2BTFA 2VGNA 4K8ZA 3CJCA 3EZ5A 2UXCK 3AVJA 2X78A 1NJWA 4RW6A 2A5XA 3TSQA 1ITGA 3KHYA 4Z4HA 3KK1A 4E1MA 2WTUA 5JMVA 5M1KA 5AQRA 3C6UA 3J8AA 3H46O 2ZWHA 4CZLA 1UOCA 3K5NA 1FKOA 2NUBA 3O4QA 3AAQA 4BRPA 4GV6A 1LAWA 4B9SA 1NLVA 2NRTA 4FO0A 3T1AA 4DB3A 4DSKA 3RMDA 3QEPA 2HW3A 3VQBA 3OJSA 3PUFA 4DQ8A 2YHAA 1VSJA 3ZSVA 4CK3A 3KLHA 2YCHA 4FSVA 1XNQK 4YOTA 5I9EB 3JXUA 1TL1A 4C1NI 3WQUA 3A5NC 1KVBA 4B1XB 4IFVA 1C1BA 2DFEA 3WNFA 4J2BA 5FRNA 2IOCA 2ZM6K 3PIOL 2Q97A 4CBWA 2ZD1A 4ISEA 1N34K 2HNYA 1O1WA 5CYQA 1YIJN 1BGXT 2HBJA 5HP1A 5TKWA 3KWGA 3DWLA 3D0PA 1NKCA 2Q0UA 2O8BB 4MDAA 4FXDA 4GV3A 4ICLA 4X66K 3KLIA 1RBUA 5M1PA 2Z1JA 3PV8A 4CW7B 3THWA 2QWNA 1KXPA 1TK8A 4FLZA 2JWKA 3AVAA 1HQUA 4NCGA 3G0ZA 1YHQN 1IG9A 1DLOA 2Q1NA 3AVHA 3AO2A 1NK0A 4E7IA 4KHSA 3MN5A 2A1SA 3O08A 2YHWA 1B92A 3O9QA 2HF4A 4N56A 2F8TA 2YI1A 5CZ2A 1KD1O 3N4QA 1VQ9N 1TYQA 1W0HA 4DV3K 1ZC6A 3ATUA 4LH5A 3QETA 4DV0K 5E84A 3CCLN 3P4IA 5TKYA 4RW7A 4IDHA 3VERA 3KTQA 4A61A 1VQON 2CGLA 4B1ZA 4HCCA 4QAGA 3OYHA 3DLKA 2DY4A 4OO1J 4B9LA 5IT9O 4IBNA 2X74A 2G8HA 2YNFA 4JI1K 4J2DA 2KZMA 2D0OA 1U2VB 1CZBA 2Z1GA 4BRLA 4Z4CA 4DV7K 3LPUA 4KHNA 3CJ7A 4PKHA 1Q8IA 4BRNA 4IWVA 3IMXA 5EX5A 4H4MA 4ZHRA 4BDZA 1K9MO 5BPNA 3RSEB 1BIZA 4DSIA 2E4LA 2VG7A 1EO1A 3OS1A 4AHTA 4BRGA 3KLGA 2KHOA 1U48A 1WBDA 4OVLA 3UKUA 4E89A 3AA4A 4FW1A 1HYSA 2E2OA 3ZSYA 4YORA 4CFBA 3K5LA 4FM2A 4BRIA 2Z1HA 1QQNA 3HVTA 4Q5VA 4CVNE 2F96A 4W5QA 1Y97A 4OGCA 1LV5A 4FK4A 1BU6O 3DXMA 4IEEA 4DTPA 2JLEA 1K8KB 1RDWX 2BANA 3M5RA 3KKSA 1VQ4N 1FW6A 4B9VA 3WEEA 3UKRA 1ASWA 3PX4A 1N33K 2O8CB 4YOXA 3RR8A 4MO5A 3LP2A 3CXCM 1KQSM 1SUQA 3M6GA 3CC7N 1S22A 1HRHA 3SMSA 4AHSA 3KLEA 5AQSA 1UA1A 2UU9K 3OYLA 4L3QA 3LDNA 3OBWA 3CMAN 1YTAA 4G9ZA 3OTOK 3VA3A 4RWTA 3CM6A 3HPGA 2OPRA 2WBNA 1RCHA 5KTQA 2P9PA 3LDSA 4A57A 4WFNL 3AVLA 1VHXA 4KTQA 4KB1A 1BL3A 3DLEA 3VQ9A 4CGJA 4O44A 2NRWA 1S1XA 2E20A 3VQ4A 2ASMA 3CCJN 2ASOA 4C8LA 5LL6Z 4O8KA 4KO0A 2QXLA 4FJ7A 3IAYA 1NGFA 4O4GA 3VQPA 3HBTA 4NCAA 3AVNA 4H4OA 3PSIA 4K42A 5AQQA 3G71N 5AQHA 1MU2A 1K8AO 3PY8A 3ZX3A 1NK9A 1ZXOA 1KTQA 3HM8A 2QI2A 3IFRA 5EXWA 3HP9A 2XHBA 4IJAA 3FZHA 3MAQA 3DRRA 4BRDA 4CZJA 4BWMA 3EL2A 4CGGA 3HXMA 4I7FA 4JKAA 4FLTA 5AQXA 2F9WA 3CFOA 4FW2A 2P9SA 1FKPA 2BDPA 3KK2A 3VA0A 5JLHA 2NRRA 3HM9A 2P9IA 5AZIB 3VQ8A 1YJ9N 3EYZA 1OH5A 3IDHA 1B9FA 4M63C 2WONA 1OH8A 1KFDA 1NK5A 5AFUH 5HRSA 1TUYA 2EWSA 4YOUA 3HJFA 4HWIA 4CJKA 4MDBA 2QK9A 2YNGA 4NLCA 4FJMA 2HHXA 3LP1A 3L2RA 3OBYA 1ZBFA 5JLFA 3LDPA 3NCIA 1RDUA 3AAPA 2H3GX 2W6LA 4CF2A 1JKHA 3RMBA 2KKZA 2KQ2A 4YOYA 1YI2N 4AHCA 1T8EA 3R1XA 4JD2A 1YUWA 3MDQA 4L8RB 3MWTA 3ZEUA 1NOYA 5C2FA 4W5RA 1J5OA 1ATNA 2GEMA 5AQZA 2JGUA 3K59A 3LANA 3ATVA 2FF6A 3GDQA 1W2BM 3NDKA 5JVGL 1XMQK 5ADXA 3WXMB 5AQVA 3KLFA 3MX2A 1TAUA 4EAHD 2PFUA 1J54A 4E3SA 1QSLA
chains in the Genus database with same CATH topology
4JI4K 4DV7K 2VQEK 2UUAK 4LF6K 5A2QO 1XNRK 4LFCK 5AJ3K 2VQFK 3T1YK 1HR0K 4DV4K 4DUYK 4X62K 1XNQK 2E5LK 4DR3K 3J81O 1IBKK 2ZM6K 4B3TK 4YHHK 5IWAK 2F4VK 1N34K 3J80O 4JI2K 3J7YP 4NXMK 4DV6K 2UXBK 4AQYK 2UUBK 1I94K 1IBMK 4NXNK 4CVNE 1HNXK 4X66K 4X64K 3T1HK 4JI8K 4GKJK 4LF8K 4CW7B 1J5EK 4GKKK 3JAMO 4YY3K 2HHHK 4DV5K 1N33K 4JI6K 4DV2K 4JYAK 1N36K 1HNWK 4DR4K 4B3RK 2UUCK 4DUZK 4KHPK 2UU9K 4DR1K 1FJGK 4DR6K 4JI0K 4JI7K 3OTOK 2UXCK 4DR7K 5LMUK 4DR2K 1HNZK 4K0KK 4LF4K 4LFBK 5BR8K 1XMOK 5LMNK 4DV3K 2UXDK 4DV1K 4JI3K 4V19S 4B3MK 4LF5K 4OX9K 4DV0K 4JV5K 5LL6Z 4LFAK 4LF9K 1XMQK 5FLXO 5IT9O 4LF7K 4JI1K 3J7AP 4DR5K 4JI5K 1IBLK 1N32K 4B3SK 4X65K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 K;  4DV7 K;  2VQE K;  2UUA K;  4LF6 K;  5A2Q O;  1XNR K;  4LFC K;  5AJ3 K;  2VQF K;  3T1Y K;  1HR0 K;  4DV4 K;  4DUY K;  4X62 K;  1XNQ K;  2E5L K;  4DR3 K;  3J81 O;  1IBK K;  2ZM6 K;  4B3T K;  4YHH K;  5IWA K;  2F4V K;  1N34 K;  3J80 O;  4JI2 K;  3J7Y P;  4NXM K;  4DV6 K;  2UXB K;  4AQY K;  2UUB K;  1I94 K;  1IBM K;  4NXN K;  4CVN E;  1HNX K;  4X66 K;  4X64 K;  3T1H K;  4JI8 K;  4GKJ K;  4LF8 K;  4CW7 B;  1J5E K;  4GKK K;  3JAM O;  4YY3 K;  2HHH K;  4DV5 K;  1N33 K;  4JI6 K;  4DV2 K;  4JYA K;  1N36 K;  1HNW K;  4DR4 K;  4B3R K;  2UUC K;  4DUZ K;  4KHP K;  2UU9 K;  4DR1 K;  1FJG K;  4DR6 K;  4JI0 K;  4JI7 K;  3OTO K;  2UXC K;  4DR7 K;  5LMU K;  4DR2 K;  1HNZ K;  4K0K K;  4LF4 K;  4LFB K;  5BR8 K;  1XMO K;  5LMN K;  4DV3 K;  2UXD K;  4DV1 K;  4JI3 K;  4V19 S;  4B3M K;  4LF5 K;  4OX9 K;  4DV0 K;  4JV5 K;  5LL6 Z;  4LFA K;  4LF9 K;  1XMQ K;  5FLX O;  5IT9 O;  4LF7 K;  4JI1 K;  3J7A P;  4DR5 K;  4JI5 K;  1IBL K;  1N32 K;  4B3S K;  4X65 K; 
#chains in the Genus database with same CATH topology
 2WFB A;  1BI4 A;  3U3Y A;  1QHT A;  3VQC A;  3VQ6 A;  1U45 A;  4OJR A;  4IO8 A;  1EQY A;  1JLB A;  1HMV A;  1SQK A;  3CC2 N;  4YFU A;  1GLB G;  2OCE A;  3J81 O;  2JWL A;  5GIN A;  5GAH P;  2CGK A;  3K9J A;  4NCB A;  1GLJ O;  5FRM A;  2EX3 A;  3J7Y P;  3BDP A;  4F3T A;  4ILJ A;  2Y1I A;  3LDQ A;  3SV3 A;  3TTD A;  2FSK A;  3CER A;  2ATQ A;  4M42 A;  3D2F A;  3PO4 A;  4CJT A;  4B9M A;  1RTJ A;  1Q18 A;  2D0P A;  5AZJ A;  4FWO A;  1GOB A;  4CE9 A;  3I0R A;  1JLG A;  4CER A;  2HHH K;  1ASU A;  2VG5 A;  3R6M A;  2VWK A;  3CFP A;  3THY A;  2VCP A;  1Q82 O;  5CZ1 A;  1C1A A;  2E2P A;  3OVN A;  3SAH A;  4CGF A;  4B3R K;  4FJN A;  1XWL A;  2IS3 A;  4OLB A;  2HHW A;  1GLF O;  4BRM A;  4CJW A;  3K58 A;  4E1N A;  4B9N A;  4JI0 K;  1U4B A;  4CZG A;  4WQ4 C;  3MCP A;  3G4S N;  4CFD A;  3TAF A;  1CZ9 A;  3TWH A;  4IKF A;  1IJJ A;  4HUG A;  2A1R A;  5EOY A;  4OX9 K;  1HYV A;  4JV5 K;  4Z4I A;  3MMV A;  4IO9 L;  4AIL C;  1ZBI A;  4DQR A;  3TAR A;  4LFA K;  3RR7 A;  4CJV A;  2D0C A;  1GLC G;  3ITH A;  2IC3 A;  2RHK A;  1NK8 A;  3ENH A;  4BR0 A;  2AP1 A;  3E66 A;  3H45 C;  1QQC A;  1IBL K;  3QFU A;  3NH2 A;  3KKR A;  4WQ5 C;  2Q0R A;  3RMA A;  2ZE2 A;  1BDG A;  4EHU A;  3O4W A;  4HTU A;  2VQF K;  3D2E B;  4CBU A;  2QWR A;  1KVA A;  1SKS A;  3TSU A;  3FZF A;  4DFM A;  5KPZ A;  2E5L K;  3C7N A;  2DTU A;  2Q3S A;  3B8A X;  1NGD A;  1RDA A;  1WB9 A;  4U67 L;  3SAG A;  4KFB A;  3F2K A;  4PKG A;  1WN7 A;  1IBK K;  4KH6 A;  4CEF A;  2F4V K;  3RVC A;  2I7N A;  1KCF A;  4JI2 K;  5AQP A;  5AR0 A;  2E8A A;  3MX5 A;  2RN2 A;  3TAB A;  2O8E A;  3L3U A;  3LM9 A;  5F0X A;  5DK5 A;  3C6T A;  1NKE A;  2G8U A;  5FDL A;  5J2P A;  3HTV A;  5AQI A;  1BA0 A;  1VQ5 N;  1V4T A;  3BP8 A;  1S1W A;  3PSF A;  3N4P A;  3E9L A;  1QTM A;  5J2N A;  1S1U A;  3O9T A;  3QNN A;  2RKI A;  3OYA A;  1XQS C;  3SJJ A;  4F3O A;  4FZY A;  4DTR A;  1YTU A;  4DR4 K;  2UUC K;  4QCL A;  4FJX A;  3O4N A;  4CES A;  4E19 A;  2R7Y A;  4JKF A;  4B3O A;  1NMD A;  3P5J A;  1IKX A;  2FSN A;  4QS8 A;  4BC4 A;  3V9Z A;  1GLA G;  1B9D A;  2QWM A;  4XEI A;  1FK9 A;  5LMU K;  4K0K K;  1OVQ A;  2P9L B;  2AA4 A;  2NRV A;  2XO7 A;  1VQL N;  2PYJ A;  3CET A;  4E7J A;  3QER A;  2QWO A;  4XIU A;  3C6A A;  3BF3 A;  1DEJ A;  2X6N A;  4XH4 A;  4DU4 A;  3KZB A;  3GBT A;  2P9K B;  3TTC A;  4DSJ A;  4PUO A;  3PX0 A;  1S1T A;  3TAE A;  3L2W A;  3VMF B;  4LF7 K;  4FVM A;  5D3G A;  3F5T A;  1X9W A;  3G25 A;  1H1V A;  4FL9 A;  4DTJ A;  2ZJP L;  3JSM A;  3ZYY X;  4BQZ A;  1TKX A;  4JKE A;  3M8P A;  5GIP A;  3ZX2 A;  4CEO A;  1HR0 K;  4JS5 A;  2O8B A;  4I9Q A;  2O8F B;  1C6V A;  2NRH A;  3PX6 A;  4CEQ A;  3EO3 A;  3NBP A;  3U8X A;  2QW9 A;  3TPQ A;  2AJQ A;  4RTF D;  5J1E A;  4JKG B;  2NNW A;  5IWA K;  4BRF A;  4KI6 A;  2QKK A;  4I9L A;  3BZC A;  3M8R A;  5EVZ A;  3CFR A;  1TV6 A;  5LJV A;  3MXM A;  3TSP A;  4Y1D A;  4DU1 A;  3O5B A;  4YNQ A;  5AQJ A;  2CGJ A;  4A2A A;  4EIA A;  3QEX A;  3FLC O;  4PY5 A;  2FF3 B;  3QLH A;  1HPZ A;  3K57 A;  3DXK B;  3L0Q A;  1TKT A;  3K5M A;  4GMJ B;  3JAM O;  3C6H A;  1C0G A;  3NGI A;  4F9O A;  3ULD A;  4KAZ A;  4B9T A;  2ZGZ A;  1ESV A;  1EXQ A;  4DV2 K;  4Y1C A;  4W5O A;  1K73 O;  5GIO A;  1RT6 A;  1RTI A;  1LCU A;  3UIQ A;  2ITG A;  4OLA A;  4IFE A;  1RDD A;  4WQ4 A;  4CJL A;  2BGG A;  4FJ5 A;  5CHI A;  4FPA A;  3ZT1 A;  3WXI A;  4DQS A;  2HHU A;  3LL3 A;  4U7B A;  4E0D A;  4FK0 A;  4EFH A;  1U2V A;  1T05 A;  2QEX N;  2PBD A;  1VQ6 N;  1W9H A;  4FJJ A;  4JKC A;  3JYT A;  5BN9 A;  3R8E A;  4DV1 K;  3T69 A;  3S9H A;  2E1Y A;  2Q31 A;  4LSN A;  3M3Z A;  5AQG A;  4BG8 A;  3VTI A;  3RSE A;  5BN8 A;  4F4K A;  3O3H A;  2HBM A;  2IVP A;  1LW2 A;  4WQ5 A;  4FWQ A;  3AO3 A;  5SZT A;  3O1W A;  5FLX O;  1YXQ A;  5M1O A;  2YJE A;  1RTH A;  3VQ5 A;  5M1Q A;  3I55 N;  4CIE A;  4JI5 K;  3SYZ A;  3Q7C A;  3TU5 A;  4CJ7 A;  1T7P A;  4M3T A;  2VQE K;  3CG7 A;  3AVC A;  2QWP A;  2XY8 A;  1D9D A;  5C12 A;  3S3O A;  2QTD A;  3TAP A;  3KWI A;  4CJE A;  2GEL A;  1ZBL A;  1N8R O;  3R3L A;  3ZSQ A;  4HUF A;  3FE1 A;  3M8S A;  1L3T A;  5KQ8 A;  2B6A A;  5KPT A;  4CIG A;  3SUN A;  3K9K A;  4FJG A;  4DSE A;  2O8C A;  4FM1 A;  4M3Z A;  1YT3 A;  4IZ9 A;  2F9T A;  1DT9 A;  3PO5 A;  1BO5 O;  4DSL A;  2FBY A;  4PA1 A;  1KAX A;  4FYD A;  5SWM A;  4PQU A;  2KFN A;  1IO2 A;  1HKC A;  3KK3 A;  4CFA A;  4K25 A;  1RT5 A;  3V4I A;  4YY3 K;  4CZE A;  1I3A A;  4I2Q A;  3ULE B;  4GVE A;  3O8M A;  4DTO A;  3T19 A;  1IG8 A;  4DG1 A;  4BE1 A;  1QSY A;  4BR5 A;  4MFB A;  1CXQ A;  2WUS A;  2E6M A;  4PL7 A;  1HNI A;  4CEB A;  5HLF A;  5C25 A;  1S6P A;  4ZTJ A;  4RW9 A;  4CI6 A;  4FJ8 A;  3Q7B A;  5LJW A;  4M3W A;  2BUP A;  2GUP A;  1E3M A;  4CZI A;  3ALY A;  3WXK A;  3VN5 A;  4A5B A;  3I56 N;  3QEV A;  3EE8 A;  3VEW A;  3F9K A;  3AA3 A;  1JLE A;  3BZK A;  1HLU A;  1NG9 A;  1D5A A;  3AAR A;  5LMN K;  1NGC A;  1A5W A;  3O80 A;  1X3N A;  4ISG A;  4KTW A;  2BH1 A;  2YV0 X;  1NJX A;  1XUP O;  1JCE A;  5FRO A;  1Z26 A;  1Q9X A;  1VRT A;  3O9R A;  5C10 A;  1BWF O;  5FPE A;  4BY9 C;  4FWN A;  4DTX A;  4BC2 A;  2A3Z A;  5FPN A;  3CJB A;  1KLN A;  5H1S Q;  1HJO A;  1YAG A;  2IAJ A;  3AVI A;  1U49 A;  3NHG A;  4GNI A;  3SQ1 A;  4CF0 A;  3VEY A;  3PLA A;  1GLL O;  2NLX A;  3ZT2 A;  1R59 O;  3VEO A;  4M3U A;  3T1Y K;  5BPL A;  4Z4G A;  1DKG D;  1Q86 O;  4DTS A;  5AQL A;  5BRD A;  2CH6 A;  4FOE A;  1L3S A;  1L5U A;  5ADX H;  4DR3 K;  5EY4 A;  1Q9Y A;  3UKU B;  3TI0 A;  4FLY A;  1HPM A;  3E9O A;  4CZM A;  2FBX A;  3QDK A;  4CJF A;  3AVB A;  4H03 B;  4CZF A;  4CHO A;  1RIL A;  4H5W A;  2I5J A;  3O3F A;  4DQI A;  3SBG A;  1RNH A;  2HHQ A;  3MN7 A;  1BUP A;  3DLG A;  3DXM B;  1DTT A;  3ENB A;  2RPI A;  3MEG A;  4IG0 A;  4JI8 K;  3AVF A;  1JLC A;  1TGO A;  3FZM A;  4RCH A;  3LDO A;  3P1G A;  3OY9 A;  1KLM A;  1RGI A;  1HJR A;  2OPS A;  4BR4 A;  1ZYQ A;  4PKI A;  3SQ4 A;  4C8K A;  2XRI A;  3HZ6 A;  4BWJ A;  4JI6 K;  4QS7 A;  3OYM A;  1N36 K;  2E2N A;  3NMU A;  1KAZ A;  4E1J A;  5HRN A;  3NGY A;  1LOT B;  1DGK N;  1S9E A;  4AHU A;  1TUU A;  5KRS A;  2D4W A;  4DSF A;  4Z0U A;  4HCB A;  3CCQ N;  4K43 A;  2VYP A;  4G1Q A;  4DQP A;  3NF9 A;  3OW2 M;  4FLU A;  1NGH A;  1JXB A;  1C0U A;  3HP6 A;  2YHX A;  2J4R A;  4B3M K;  1BG3 A;  1KAY A;  3CCR N;  3FR0 A;  5HRP A;  1REV A;  4NLB A;  2PY5 A;  4CEE A;  3GL1 A;  4EP5 A;  3VEZ A;  4IOX A;  3QIN A;  3K5O A;  1ATR A;  3MWP A;  3ZLJ A;  4BC5 A;  4KI4 A;  4RW4 A;  1EWR A;  2D5R A;  2YHB A;  2B5J A;  4AF1 A;  3U6F A;  3HI0 A;  2RE2 A;  3TAG A;  4CJS A;  4FOI A;  2CH5 A;  4H5R A;  3V9S A;  3KD1 E;  2HHT A;  4LY7 A;  4H0X B;  2XY5 A;  4JHD B;  3QIP A;  3HPO A;  1RT7 A;  5AJ3 K;  3QIC A;  4DV4 K;  4H0P A;  2QXF A;  3SUP A;  1P90 A;  1Z25 A;  3THX B;  4O5F A;  1KFS A;  3L6Q A;  4CEC A;  2YKN A;  4MLH A;  1SKW A;  2DPN A;  1QVG M;  2F7T A;  5EU7 A;  1E4G T;  1DTQ A;  4AHV A;  3VQ7 A;  5DM6 L;  4DF8 A;  2ZGY A;  4DV6 K;  3DRS A;  2G8K A;  3HYF A;  5HBM A;  3JS6 A;  4R79 A;  4HTL A;  3DLB A;  4B1W B;  4CJP A;  4NXN K;  3KK7 A;  1Q7Y O;  3CME N;  1T3V A;  4JS4 A;  4J2A A;  2HF3 A;  3NE6 A;  2E6L A;  1HUX A;  4JK9 A;  3FZK A;  3LP0 A;  3QBX A;  4I6M A;  2OPP A;  3WXL A;  5C42 A;  1LW0 A;  4CF1 A;  4FJK A;  4CD3 A;  3DAW A;  3CJ9 A;  3CCS N;  3S41 A;  3E9P A;  4DV5 K;  3OA9 A;  4H5N A;  4C8O A;  4EZ6 A;  4DFP A;  2D1K A;  3LWM A;  4HVJ A;  2VWJ A;  2W40 A;  1JLF A;  2DFH A;  1YVU A;  3QEW A;  4ELT A;  4KHP K;  1A5X A;  4N47 A;  4B1Y B;  4WCE L;  3HVR A;  1UA0 A;  5FPM A;  1NJY A;  5HOO A;  2OAN A;  3DJC A;  3VGL A;  4EHT A;  3OYE A;  2YNH A;  3D45 A;  4LFB K;  1QE1 A;  4BGA A;  3CD6 N;  3HPH A;  1YJN N;  3ZET B;  1BCO A;  2XY6 A;  4YOW A;  4C8M A;  5C0Y A;  5AFU A;  4A62 A;  3LPT A;  5AQO A;  2HHV A;  4DWI A;  3OYB A;  2HBK A;  1ATS A;  2IIR A;  4JKB A;  3IS9 A;  4C23 A;  4JKD A;  1RDB A;  1MWM A;  1ZBS A;  4X65 K;  4FK2 A;  2ITM A;  1QHA A;  5ELZ A;  4E7H A;  4LF6 K;  2HBL A;  1JL2 A;  3RWU A;  3CQY A;  1JXE A;  1NKB A;  1SL2 A;  4BGB A;  2GWK A;  2P9N B;  5JS2 A;  4DKW A;  1KRP A;  1HX1 A;  4A2B A;  4CGD A;  1S72 N;  1VQ8 N;  4B8A B;  4N76 A;  5AQM A;  3SQ0 A;  3ZSR A;  1M1K O;  4DHY A;  2HVH A;  3H6E A;  5KGX A;  3WT0 A;  4FWP A;  2OTL N;  1G15 A;  1LAV A;  3SCX A;  1RFQ A;  1D9F A;  4N41 A;  2UXB K;  4MO4 A;  4Y0W A;  5CY4 A;  3AVG A;  3O1B A;  1RT4 A;  2B4J A;  3BF1 A;  1BHL A;  2VGM A;  2PZS A;  4DS5 A;  4JNE A;  4CEA A;  5AQY A;  2GUI A;  1HNX K;  4BRQ A;  1WSH A;  1W7A A;  4X64 K;  4CJU A;  5AZJ B;  4GKK K;  2O8D B;  1F21 A;  1T6D A;  2P9L A;  4DU3 A;  1NGA A;  3MK6 A;  4GY2 B;  4CJ4 A;  4EP4 A;  3O9U A;  4M3R A;  4CHZ A;  3A0I X;  2Z1I A;  1BCM A;  1XC3 A;  2P9K A;  1BQN A;  3ZT3 A;  4GW6 A;  4FLX A;  1LWF A;  2HOE A;  3CYM A;  4HUE A;  2W41 A;  1FXX A;  3F9M A;  4DR1 K;  4OKE A;  1NGI A;  3LDL A;  2QA4 N;  4H8K A;  3MCA B;  1VRU A;  4H0O A;  4A5A A;  2A42 A;  1LWE A;  4GV9 A;  3OYF A;  4ISF A;  1A5V A;  4PHT X;  1NJZ A;  4FZX C;  4ILH A;  4I2P A;  3L2Q A;  3DI6 A;  3SPZ A;  3RMC A;  4JI3 K;  4V19 S;  2O8F A;  4ILG B;  3RRH A;  3MXJ A;  3MXI A;  2FC0 A;  3OYD A;  4JKH A;  4J2E A;  2VG6 A;  4CZK A;  2OYQ A;  1MDU B;  5C2D A;  4JKG A;  1XHX A;  4ELU A;  3DLH A;  4OPA A;  3CCU N;  3SV4 A;  3NH0 A;  3D6R A;  5F2R A;  2P9U B;  3NAE A;  1EP4 A;  3E1Y A;  3OYK A;  3ZCM A;  3UE5 A;  4CIF A;  3C7N B;  3SBT A;  3MEE A;  5HRR A;  1X1P A;  3DXK A;  4BRC A;  4OPK A;  1HQE A;  5C24 A;  4B3T K;  3O6W A;  3SMP A;  4WFA L;  1WSE A;  1ILY A;  1C1C A;  3TTF A;  4DF4 A;  4RW8 A;  2HMP A;  4W5T A;  2UUB K;  2O4G A;  1BOT O;  4WYB A;  1WBB A;  2LSN A;  4BE0 A;  4FLW A;  4DMN A;  5M1F A;  3A5O C;  3M8Q A;  4O0J A;  4OGE A;  3LAL A;  1U6Z A;  2HVI A;  1C0T A;  4DTM A;  1J5E K;  4FCY A;  3NH1 A;  2HHS A;  1NBW A;  1UWB A;  3DYA A;  4BDY A;  4JYA K;  5AQU A;  4B1U B;  3SI6 A;  1HNW K;  1D8Y A;  3QES A;  1Z05 A;  4NYN A;  1Q81 O;  4F2S A;  4H0T B;  3DM2 A;  1RT3 A;  1X9M A;  4YDU C;  4CZH A;  4M7Y A;  1OH7 A;  2YKM A;  3H3O B;  4JRQ A;  4JK8 A;  4IOC L;  4OPJ A;  2ZF5 O;  1E4F T;  3QFP A;  4LF4 K;  1X9S A;  4UQG A;  3OYI A;  5AQK A;  4JAX A;  2WC9 A;  4AM7 A;  1J6Z A;  4E7L A;  1HKG A;  3ENO A;  5B8H A;  4BVP A;  4J8F A;  1KC8 O;  1J9A A;  3B6O A;  4BE2 A;  4LF9 K;  1TAQ A;  3LAM A;  3HOT A;  2YX6 A;  3VQD A;  4CCH A;  3H08 A;  3HO1 A;  4DLG A;  3FZL A;  1ZBH A;  5CYM A;  3AGR A;  3AV9 A;  4IJN A;  4A59 A;  1TK0 A;  3I33 A;  4H5V A;  1IH7 A;  3QBW A;  3WXJ A;  4N5S A;  1RT2 A;  3I0S A;  4DS4 A;  2F8S A;  3SQ2 A;  3O3G A;  3EZW A;  1R0A A;  2IDO A;  1L3V A;  1BIU A;  3BEX A;  4DCH A;  3DOK A;  3ZSO A;  3QML A;  3NGZ A;  5T7B A;  2FSJ A;  4CGH A;  3L2U A;  4Z4E A;  3U3G A;  4CK2 A;  4ID1 A;  1G99 A;  4IEI A;  2QWL A;  1P8Z A;  3ULE A;  3C65 A;  3NF6 A;  1NMN A;  2Q36 A;  3L4I A;  4NXM K;  4AQY K;  5AQN A;  3SNN A;  1IBM K;  2QKB A;  4BG9 A;  3V1R A;  5BPM A;  3D7E O;  4IG3 A;  1S6Q A;  3M1F A;  3WQT A;  3FFK B;  1VQK N;  2E88 A;  3T3F A;  1K8K A;  3T1H K;  2YJF A;  3BUZ B;  4AM6 A;  1TL3 A;  4BVO A;  4KB0 A;  4FWL A;  1WSF A;  2RF2 A;  3KD5 E;  3AVK A;  4JEP A;  1X9J A;  1D4X A;  3R9P A;  1J53 A;  5HL7 L;  1GLD G;  1T03 A;  3W3D A;  3WNE A;  3NVK A;  1VK0 A;  5KRT A;  3CCV N;  2GBZ A;  5MLC Q;  3ZSX A;  4NYF A;  3MEC A;  2G8F A;  3CC4 N;  2I7P A;  3KVG A;  3THW B;  3PIP L;  1X3M A;  3VGM A;  3AVM A;  1VQP N;  5LY3 A;  4M45 A;  5I42 A;  3CQX A;  3AA5 X;  3DMJ A;  4CBX A;  2UXD K;  1I39 A;  3GOI A;  3H3N O;  4AH9 A;  3CIP A;  3VEV A;  3AGK A;  4NB4 A;  4KHW A;  1JL1 A;  4RG8 A;  3SUO A;  3CPE A;  5F1X A;  1QQM A;  1QVF M;  5J2Q A;  4B9U A;  1SAZ A;  1VQN N;  3EY1 A;  4BRE A;  1NOZ A;  3KJV A;  2ZJR L;  5FPD A;  2OA8 A;  4M3Y A;  2KZZ A;  1CXU A;  3ZSZ A;  2KLA A;  2UUA K;  1QQO A;  1TYQ B;  3L3V A;  4M7X A;  5HRO A;  2W42 A;  1HKB A;  4DUY K;  3HRG A;  4WE1 A;  1O13 A;  3VEN A;  1VSK A;  1NNE A;  3E01 A;  5DMR A;  3LWL A;  4O55 A;  3ZSW A;  3LZJ A;  1SKR A;  2YNI A;  1S5J A;  1S3X A;  4MQ3 A;  1RBT A;  1VSL A;  4B08 A;  5M1N A;  2QM1 A;  4OKJ A;  5AZI A;  4XH5 A;  5BRE A;  3HK2 A;  1I94 K;  4FJH A;  3IUC A;  4B8C A;  1EKE A;  3SPY A;  1T6C A;  4CHY A;  2P5G A;  4F2R A;  4IDK A;  1U47 A;  4KV8 A;  3LM2 A;  1SV5 A;  3H1Q A;  4M41 A;  3V9W A;  5K14 A;  3U4L A;  2E2Q A;  5BR9 A;  1TK5 A;  4QOZ B;  3SJH A;  1TKD A;  3UB5 A;  1SZ2 A;  4GVM A;  2FXU A;  3AO5 A;  1U04 A;  3AO1 A;  1OH6 A;  3NVM A;  4YDU A;  4PWD A;  3FFI A;  3A2F A;  1RDC A;  4FWR A;  5AQF A;  1S1V A;  3ID8 A;  1SL1 A;  1KVC A;  1NGJ A;  3VPZ A;  3EEQ A;  4JLH A;  3P83 D;  1MA9 B;  3WEE B;  3UKR B;  1SS6 A;  2PYL A;  3B6P A;  4FM0 A;  3V6D A;  3QIO A;  3I8B A;  3FGU A;  4OPH A;  3VQE A;  2A41 A;  2A40 A;  4JHD A;  3WNG A;  3OYC A;  1SL0 A;  4FZZ A;  5KI6 A;  4YOV A;  4W5N A;  4ELV A;  2A6A A;  4BR2 A;  4LF5 K;  1VSI A;  2YHY A;  3OYN A;  4DFK A;  3ZX0 A;  3BY5 A;  3LAK A;  4KKO A;  4O0I A;  3K0S A;  3THX A;  3V81 A;  3OS2 A;  3TAN A;  3VF2 A;  4B1V A;  1WOQ A;  4LC9 B;  1JLQ A;  4QS9 A;  2P9P B;  4LSL A;  4Z4F A;  1CZA N;  1N32 K;  3C0B A;  4FJ9 A;  4CK1 A;  3THV A;  1T44 A;  2VWB A;  4C8N A;  4FJL A;  5AQW A;  1GOC A;  3SLC A;  3HL8 A;  1QSS A;  4FWK A;  1WSJ A;  3ISN C;  5CR4 A;  1EWQ A;  3EE9 A;  1JCG A;  4JK7 A;  4ID5 A;  1TVR A;  1RT1 A;  3EKS A;  4LH4 A;  3CQ8 A;  3U9Z A;  4ZTF A;  4YHH K;  4Q0B A;  4OKK A;  2ASP A;  3KIO A;  4DLE A;  3SAF A;  1NK4 A;  3LP3 A;  3P38 A;  4CHQ A;  4CHN A;  3LZI A;  2OPQ A;  2HMI A;  5E26 A;  2O4I A;  4CFC A;  3MN9 A;  1BQM A;  2WOM A;  3BGR A;  2NZT A;  4H0Y B;  5GAE P;  1BA1 A;  4E7K A;  3WNH A;  1VSD A;  3OJU A;  1XC9 A;  3OS0 A;  4FVU A;  1TKZ A;  4GKJ K;  3V9X A;  2XY7 A;  3HSC A;  4BRH A;  1GOA A;  2P9S B;  1N5Y A;  1HNV A;  2ETJ A;  3SUQ A;  4O5B A;  3A8Y A;  3TAM A;  3I8D A;  1NK6 A;  4NO7 A;  2FBV A;  2P9I B;  1RTD A;  3ZET A;  4F8R A;  3VGK A;  2ZJQ L;  4LD0 A;  3S3N A;  5JVH L;  3ZT0 A;  1EX4 A;  4KRF A;  3CJA A;  2IGI A;  4KRE A;  5KGW A;  1BIS A;  5E41 A;  3AY9 A;  1UAX A;  3VQA A;  4KBO A;  3HOS A;  4DR7 K;  4HHT A;  2OZM A;  1JCF A;  4O8U A;  4CJ5 A;  4BAC A;  5BR8 K;  1XMO K;  3VTH A;  4B9Q A;  4WFB L;  1VSE A;  3SK3 A;  2P1J A;  3P39 A;  3TR8 A;  2P9N A;  3CF5 L;  4R5P A;  3HST B;  2GWJ A;  4BR7 A;  1EET A;  3G10 A;  3HT3 A;  4AHR A;  3MED A;  2D0A A;  1KSP A;  1N6Q A;  2W6K A;  4JD2 B;  3U9D A;  3J7Z O;  4H0V B;  1L3U A;  4DR5 K;  1NGB A;  3ZEU B;  2G8I A;  1M90 O;  2PAV A;  3RTV A;  2KTQ A;  5A2Q O;  4DTU A;  3D2E A;  3VF4 A;  1RBV A;  3V9U A;  4BC3 A;  3C94 A;  1NK7 A;  3K2P A;  5GAD P;  3AO4 A;  3OYG A;  2DFF A;  3C95 A;  1YIT N;  1Y64 A;  2O8D A;  1RBS A;  5KPR A;  2D0B A;  2G8W A;  2HST A;  1WSG A;  1GLE G;  2X6S A;  3QO9 A;  5KQD A;  2IVN A;  1YVN A;  2KW4 A;  3VES A;  1BI4 B;  4DFJ A;  3WUH A;  3ID6 A;  3A5L C;  3RRG A;  2V51 B;  4KHU A;  1WAJ A;  1VAZ A;  3V1O A;  4CD1 A;  4KH4 A;  5JIC A;  2ZQB A;  4CGI A;  4KH5 A;  4I6M B;  3CCM N;  3L8B A;  1VQM N;  1VQ7 N;  1VSF A;  1WUA A;  4M3X A;  3H1V X;  1WNS A;  2FLO A;  4K41 A;  1IKW A;  4BRO A;  4DTN A;  2E1Z A;  3SZ2 A;  2G8V A;  1QZ6 A;  3DLL L;  4XH1 A;  3AA2 A;  4JN4 A;  3VQQ A;  3QEI A;  4FWM A;  1HYZ A;  2UYT A;  4FJI A;  1VSM A;  2NRX A;  5AQT A;  1NJI O;  4DUZ K;  2BE2 A;  3D2F B;  3CHW A;  2QWQ A;  2Q2R A;  3VEX A;  1YJW N;  4DR6 K;  3A5M C;  4JI7 K;  1NGE A;  1NU0 A;  1NM1 A;  4K8X A;  1QZ5 A;  1WAF A;  2P5O A;  2GX9 A;  1CLQ A;  3GE1 A;  4PL8 A;  3DRP A;  5I3U A;  3CM5 A;  4DR2 K;  3QB0 A;  1HNZ K;  4FLV A;  3THY B;  1LWC A;  1K6Y A;  2P9U A;  4CHP A;  4UY8 O;  3IG1 A;  1QS4 A;  4IFY A;  5J2M A;  4IOA L;  4C1N K;  3NF8 A;  3VF6 A;  2FBT A;  1JLA A;  3EN9 A;  2Y1J A;  1IKY A;  3W0L A;  3VET A;  2IVO A;  4IXC A;  4BR9 A;  3J7A P;  3CPW M;  3L4Q A;  3F73 A;  4B3S K;  2OTJ N;  5C15 A;  4JI4 K;  2V52 B;  2HB5 A;  4CJ3 A;  4CJR A;  3G6E N;  3CI5 A;  4BDP A;  4EZ9 A;  3VOV A;  1XNR K;  4LFC K;  4BQL A;  1WSI A;  4FWS A;  3ASM A;  3ZT4 A;  2GTD A;  1MWK A;  4X62 K;  1S9G A;  3T7Z A;  3V1Q A;  2OZS A;  2V7Z A;  1ASV A;  3S3M A;  1C0F A;  3GG4 A;  1OKJ A;  3NFA A;  3OHR A;  4TSX A;  3TAQ A;  2KFZ A;  2HNZ A;  5GAG P;  4KPY A;  4CEZ A;  3J80 O;  1WLJ A;  3QNO A;  4Z94 A;  5DM7 L;  4CJQ A;  1ZBU A;  1JJ2 M;  3IRX A;  3MN6 A;  4MLE A;  4CF8 A;  3CJ1 A;  4H5T A;  1YF5 L;  4KHY A;  5JS1 A;  1V4S A;  1Z6R A;  2NRZ A;  3DLR A;  1IV0 A;  3O9S A;  3IKM A;  2V7Y A;  2EHG A;  4WF9 L;  1W97 L;  2HND A;  4LF8 K;  4KHQ A;  4CF9 A;  1C0M A;  4CED A;  3DOL A;  1OVY A;  3CCE N;  1VSH A;  1IKV A;  1XI1 A;  3L2V A;  4KTZ A;  4BRK A;  3P31 A;  5BRF A;  1NGG A;  4DQQ A;  3NF7 A;  1NWK A;  2O8E B;  1RBR A;  5CE3 A;  4BRA A;  2P51 A;  2GV9 A;  1XHZ A;  3OYJ A;  4JRP A;  5BRH A;  4FPB A;  3EKU A;  1FJG K;  2BTF A;  2VGN A;  4K8Z A;  3CJC A;  3EZ5 A;  2UXC K;  3AVJ A;  2X78 A;  1NJW A;  4RW6 A;  2A5X A;  3TSQ A;  1ITG A;  3KHY A;  4Z4H A;  3KK1 A;  4E1M A;  2WTU A;  5JMV A;  5M1K A;  5AQR A;  3C6U A;  3J8A A;  3H46 O;  2ZWH A;  4CZL A;  1UOC A;  3K5N A;  1FKO A;  2NUB A;  3O4Q A;  3AAQ A;  4BRP A;  4GV6 A;  1LAW A;  4B9S A;  1NLV A;  2NRT A;  4FO0 A;  3T1A A;  4DB3 A;  4DSK A;  3RMD A;  3QEP A;  2HW3 A;  3VQB A;  3OJS A;  3PUF A;  4DQ8 A;  2YHA A;  1VSJ A;  3ZSV A;  4CK3 A;  3KLH A;  2YCH A;  4FSV A;  1XNQ K;  4YOT A;  5I9E B;  3JXU A;  1TL1 A;  4C1N I;  3WQU A;  3A5N C;  1KVB A;  4B1X B;  4IFV A;  1C1B A;  2DFE A;  3WNF A;  4J2B A;  5FRN A;  2IOC A;  2ZM6 K;  3PIO L;  2Q97 A;  4CBW A;  2ZD1 A;  4ISE A;  1N34 K;  2HNY A;  1O1W A;  5CYQ A;  1YIJ N;  1BGX T;  2HBJ A;  5HP1 A;  5TKW A;  3KWG A;  3DWL A;  3D0P A;  1NKC A;  2Q0U A;  2O8B B;  4MDA A;  4FXD A;  4GV3 A;  4ICL A;  4X66 K;  3KLI A;  1RBU A;  5M1P A;  2Z1J A;  3PV8 A;  4CW7 B;  3THW A;  2QWN A;  1KXP A;  1TK8 A;  4FLZ A;  2JWK A;  3AVA A;  1HQU A;  4NCG A;  3G0Z A;  1YHQ N;  1IG9 A;  1DLO A;  2Q1N A;  3AVH A;  3AO2 A;  1NK0 A;  4E7I A;  4KHS A;  3MN5 A;  2A1S A;  3O08 A;  2YHW A;  1B92 A;  3O9Q A;  2HF4 A;  4N56 A;  2F8T A;  2YI1 A;  5CZ2 A;  1KD1 O;  3N4Q A;  1VQ9 N;  1TYQ A;  1W0H A;  4DV3 K;  1ZC6 A;  3ATU A;  4LH5 A;  3QET A;  4DV0 K;  5E84 A;  3CCL N;  3P4I A;  5TKY A;  4RW7 A;  4IDH A;  3VER A;  3KTQ A;  4A61 A;  1VQO N;  2CGL A;  4B1Z A;  4HCC A;  4QAG A;  3OYH A;  3DLK A;  2DY4 A;  4OO1 J;  4B9L A;  5IT9 O;  4IBN A;  2X74 A;  2G8H A;  2YNF A;  4JI1 K;  4J2D A;  2KZM A;  2D0O A;  1U2V B;  1CZB A;  2Z1G A;  4BRL A;  4Z4C A;  4DV7 K;  3LPU A;  4KHN A;  3CJ7 A;  4PKH A;  1Q8I A;  4BRN A;  4IWV A;  3IMX A;  5EX5 A;  4H4M A;  4ZHR A;  4BDZ A;  1K9M O;  5BPN A;  3RSE B;  1BIZ A;  4DSI A;  2E4L A;  2VG7 A;  1EO1 A;  3OS1 A;  4AHT A;  4BRG A;  3KLG A;  2KHO A;  1U48 A;  1WBD A;  4OVL A;  3UKU A;  4E89 A;  3AA4 A;  4FW1 A;  1HYS A;  2E2O A;  3ZSY A;  4YOR A;  4CFB A;  3K5L A;  4FM2 A;  4BRI A;  2Z1H A;  1QQN A;  3HVT A;  4Q5V A;  4CVN E;  2F96 A;  4W5Q A;  1Y97 A;  4OGC A;  1LV5 A;  4FK4 A;  1BU6 O;  3DXM A;  4IEE A;  4DTP A;  2JLE A;  1K8K B;  1RDW X;  2BAN A;  3M5R A;  3KKS A;  1VQ4 N;  1FW6 A;  4B9V A;  3WEE A;  3UKR A;  1ASW A;  3PX4 A;  1N33 K;  2O8C B;  4YOX A;  3RR8 A;  4MO5 A;  3LP2 A;  3CXC M;  1KQS M;  1SUQ A;  3M6G A;  3CC7 N;  1S22 A;  1HRH A;  3SMS A;  4AHS A;  3KLE A;  5AQS A;  1UA1 A;  2UU9 K;  3OYL A;  4L3Q A;  3LDN A;  3OBW A;  3CMA N;  1YTA A;  4G9Z A;  3OTO K;  3VA3 A;  4RWT A;  3CM6 A;  3HPG A;  2OPR A;  2WBN A;  1RCH A;  5KTQ A;  2P9P A;  3LDS A;  4A57 A;  4WFN L;  3AVL A;  1VHX A;  4KTQ A;  4KB1 A;  1BL3 A;  3DLE A;  3VQ9 A;  4CGJ A;  4O44 A;  2NRW A;  1S1X A;  2E20 A;  3VQ4 A;  2ASM A;  3CCJ N;  2ASO A;  4C8L A;  5LL6 Z;  4O8K A;  4KO0 A;  2QXL A;  4FJ7 A;  3IAY A;  1NGF A;  4O4G A;  3VQP A;  3HBT A;  4NCA A;  3AVN A;  4H4O A;  3PSI A;  4K42 A;  5AQQ A;  3G71 N;  5AQH A;  1MU2 A;  1K8A O;  3PY8 A;  3ZX3 A;  1NK9 A;  1ZXO A;  1KTQ A;  3HM8 A;  2QI2 A;  3IFR A;  5EXW A;  3HP9 A;  2XHB A;  4IJA A;  3FZH A;  3MAQ A;  3DRR A;  4BRD A;  4CZJ A;  4BWM A;  3EL2 A;  4CGG A;  3HXM A;  4I7F A;  4JKA A;  4FLT A;  5AQX A;  2F9W A;  3CFO A;  4FW2 A;  2P9S A;  1FKP A;  2BDP A;  3KK2 A;  3VA0 A;  5JLH A;  2NRR A;  3HM9 A;  2P9I A;  5AZI B;  3VQ8 A;  1YJ9 N;  3EYZ A;  1OH5 A;  3IDH A;  1B9F A;  4M63 C;  2WON A;  1OH8 A;  1KFD A;  1NK5 A;  5AFU H;  5HRS A;  1TUY A;  2EWS A;  4YOU A;  3HJF A;  4HWI A;  4CJK A;  4MDB A;  2QK9 A;  2YNG A;  4NLC A;  4FJM A;  2HHX A;  3LP1 A;  3L2R A;  3OBY A;  1ZBF A;  5JLF A;  3LDP A;  3NCI A;  1RDU A;  3AAP A;  2H3G X;  2W6L A;  4CF2 A;  1JKH A;  3RMB A;  2KKZ A;  2KQ2 A;  4YOY A;  1YI2 N;  4AHC A;  1T8E A;  3R1X A;  4JD2 A;  1YUW A;  3MDQ A;  4L8R B;  3MWT A;  3ZEU A;  1NOY A;  5C2F A;  4W5R A;  1J5O A;  1ATN A;  2GEM A;  5AQZ A;  2JGU A;  3K59 A;  3LAN A;  3ATV A;  2FF6 A;  3GDQ A;  1W2B M;  3NDK A;  5JVG L;  1XMQ K;  5ADX A;  3WXM B;  5AQV A;  3KLF A;  3MX2 A;  1TAU A;  4EAH D;  2PFU A;  1J54 A;  4E3S A;  1QSL A; 
#chains in the Genus database with same CATH homology
 4JI4 K;  4DV7 K;  2VQE K;  2UUA K;  4LF6 K;  5A2Q O;  1XNR K;  4LFC K;  5AJ3 K;  2VQF K;  3T1Y K;  1HR0 K;  4DV4 K;  4DUY K;  4X62 K;  1XNQ K;  2E5L K;  4DR3 K;  3J81 O;  1IBK K;  2ZM6 K;  4B3T K;  4YHH K;  5IWA K;  2F4V K;  1N34 K;  3J80 O;  4JI2 K;  3J7Y P;  4NXM K;  4DV6 K;  2UXB K;  4AQY K;  2UUB K;  1I94 K;  1IBM K;  4NXN K;  4CVN E;  1HNX K;  4X66 K;  4X64 K;  3T1H K;  4JI8 K;  4GKJ K;  4LF8 K;  4CW7 B;  1J5E K;  4GKK K;  3JAM O;  4YY3 K;  2HHH K;  4DV5 K;  1N33 K;  4JI6 K;  4DV2 K;  4JYA K;  1N36 K;  1HNW K;  4DR4 K;  4B3R K;  2UUC K;  4DUZ K;  4KHP K;  2UU9 K;  4DR1 K;  1FJG K;  4DR6 K;  4JI0 K;  4JI7 K;  3OTO K;  2UXC K;  4DR7 K;  5LMU K;  4DR2 K;  1HNZ K;  4K0K K;  4LF4 K;  4LFB K;  5BR8 K;  1XMO K;  5LMN K;  4DV3 K;  2UXD K;  4DV1 K;  4JI3 K;  4V19 S;  4B3M K;  4LF5 K;  4OX9 K;  4DV0 K;  4JV5 K;  5LL6 Z;  4LFA K;  4LF9 K;  1XMQ K;  5FLX O;  5IT9 O;  4LF7 K;  4JI1 K;  3J7A P;  4DR5 K;  4JI5 K;  1IBL K;  1N32 K;  4B3S K;  4X65 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...