4DR2K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr2K00
1FJGK 3J7AP 1N36K 4DR6K 3J81O 4DR3K 1IBMK 4DV6K 4DR4K 4JI8K 1I94K 1IBKK 5BR8K 4CW7B 4DV3K 4YY3K 3J80O 4JYAK 4LFBK 3J7YP 5AJ3K 4DUZK 2UXDK 5IT9O 5LMUK 4JI0K 4LF4K 5IWAK 4LF6K 4LF5K 3JAMO 1HR0K 4GKKK 4YHHK 4JI1K 4CVNE 2UXCK 4DV1K 5FLXO 2UU9K 4DV2K 1N34K 1N33K 1XNRK 4DR2K 4DV5K 4X65K 4JI4K 2VQEK 4DUYK 1IBLK 3T1HK 4JI6K 4JI3K 2UXBK 4LF8K 2E5LK 4LF9K 4B3MK 4AQYK 4KHPK 4X64K 4JV5K 4NXMK 4JI7K 5LMNK 5LL6Z 3T1YK 4DR5K 1HNWK 3OTOK 2VQFK 4V19S 4DV4K 4B3RK 4OX9K 2ZM6K 2UUBK 1XMOK 4B3SK 4GKJK 4DR7K 4JI2K 4DV7K 2HHHK 1J5EK 4LFCK 1XMQK 2UUAK 2UUCK 1HNXK 4K0KK 4B3TK 4DR1K 4X66K 4LF7K 5A2QO 1HNZK 4LFAK 1N32K 4DV0K 4X62K 4NXNK 2F4VK 4JI5K 1XNQK
chains in the Genus database with same CATH superfamily
3L6QA 4AM7A 3F2KA 3O1WA 4MLHA 3U3GA 2QA4N 1EWRA 4CBXA 3V6DA 5GAGP 1SL2A 1IBMK 3CJAA 5AQPA 3KJVA 3VETA 5FPMA 3CCRN 1WSFA 1P8ZA 4M3TA 1BU6O 3KK7A 3IS9A 1GOCA 2YNFA 4IO9L 1OH7A 4FJNA 3RR7A 3MCPA 1IV0A 2Q3SA 2QTDA 4DS5A 3ATUA 4M63C 1C1AA 2QWQA 1XHZA 4C8KA 1IG8A 1VSHA 2HHUA 4DV5K 2YJEA 3RSEB 3D0PA 3R1XA 2QKBA 3CCSN 3NF8A 5AQSA 2NUBA 4H4MA 4KAZA 3FZMA 4OO1J 5HLFA 3HO1A 3CPEA 4FWOA 4CZHA 4IKFA 5AQZA 2ZGYA 2D4WA 4B1XB 3FR0A 4EZ9A 5CY4A 2ASPA 3ZSXA 4JD2B 1HNWK 4DTPA 2PYLA 5DK5A 3SBTA 4OGCA 3T3FA 4B9QA 5C42A 3F73A 4DS4A 3P31A 1OH6A 2O8DB 3VQQA 2ZJPL 1SUQA 4M3UA 1VQ6N 4CGGA 2AP1A 2I5JA 1RT4A 3TARA 4AHUA 3EE8A 2ASMA 3LWMA 4FLYA 4CK3A 4KHWA 4DTXA 2YNGA 3OBWA 2P9KB 3PLAA 4Z94A 2PYJA 3BEXA 1HNZK 1Z25A 1EWQA 4OPAA 4DTSA 1IO2A 3OYDA 3IUCA 3KLGA 5AFUH 4WQ4A 3R9PA 2X74A 1BO5O 5M1QA 3QNOA 1QHAA 3QO9A 4A59A 2CGKA 3PUFA 2WOMA 1HUXA 4FOEA 3SMPA 3OJSA 1KFDA 3VEZA 1FKOA 1LW2A 5I9EB 1WBDA 3C6HA 1WSJA 1NGEA 3U9ZA 4A61A 3DRRA 1K9MO 1VQLN 1SKSA 3I56N 1TKZA 4CIEA 4M3XA 2IOCA 3NGYA 2BTFA 2ITGA 2D1KA 2Z1HA 1BGXT 4ELTA 1YTAA 2KZMA 3ZSQA 3VEOA 3NAEA 5AQKA 1XNRK 1NWKA 2YKMA 1RDAA 3HPGA 4L8RB 4C8MA 3S3NA 4B9SA 1ZBLA 4DSJA 4WQ5A 1QS4A 3ZETA 4IO8A 1NJIO 1BIZA 1J9AA 4FPAA 4BC2A 2HHSA 1BL3A 3THWA 3HTVA 3NVMA 5SWMA 2JLEA 1HNIA 1VAZA 3NDKA 1JJ2M 2VG6A 4KI4A 4FL9A 3OTOK 2VQFK 4MO5A 1WAJA 2QWNA 3O9SA 4FXDA 3ZETB 1W2BM 1RT6A 3VEVA 3VENA 3PIPL 1OVYA 1XQSC 4CF2A 2BDPA 2O8CA 3O9TA 5ADXA 3PIOL 5BPMA 1YIJN 3M3ZA 4FZYA 3THWB 1J5EK 5BN9A 3MXIA 3LAMA 4ELVA 1VRUA 1ILYA 5J2QA 4B3TK 2RN2A 4YDUA 1T3VA 2VWBA 3AVNA 4AHRA 1ZC6A 3P5JA 4CK1A 4DLGA 3H45C 4BRLA 4CK2A 1X9JA 1C0FA 1VSIA 2AA4A 3I33A 3LL3A 2O8CB 4IEIA 1OH8A 4H5RA 4FK2A 4IEEA 2HMPA 3ZSRA 4FJ5A 4BRHA 1GLEG 3GL1A 3G25A 4AH9A 2QEXN 1NGGA 1QTMA 4XEIA 1KAYA 2A40A 5GINA 5FPNA 4FJ9A 4J2DA 4JKGA 4JI0K 4E89A 3EYZA 1WUAA 3SQ0A 1W0HA 4CFCA 5GAEP 3AO2A 1NMDA 5GADP 1RDBA 3E01A 2O8FA 4CGDA 1TYQA 3IAYA 3AA4A 3GDQA 1Q81O 2E6MA 3TAFA 4CHNA 4GW6A 3JSMA 3SV4A 4MO4A 4MFBA 5C2DA 1H1VA 3SPZA 2FSKA 3C65A 1MWKA 3AGRA 3VOVA 1RBSA 2HHWA 4FM2A 3CJCA 1FK9A 3GOIA 3KHYA 4CJWA 3SYZA 3CERA 3E1YA 5ELZA 3HP9A 3MXMA 4XH5A 4U67L 4YFUA 3BP8A 1TYQB 5LMNK 3V9WA 3T1YK 2ZGZA 2WFBA 4M7XA 3T1AA 3EL2A 3H3OB 4V19S 4F2RA 2FF3B 3AVAA 1WB9A 4B3SK 2KZZA 4FLXA 5GIPA 5TKWA 3ZT1A 1RT5A 3CMAN 3FZFA 4RW8A 3AV9A 3A5OC 2HHHK 3F5TA 3C94A 4K8ZA 1XMQK 2UUAK 3VQAA 4BVPA 2ZE2A 4WCEL 4G1QA 4K0KK 1JLCA 5EY4A 1TL1A 5BR9A 4WFAL 4JRQA 1RT3A 3SZ2A 4DTNA 3HM8A 3H1VX 4W5OA 4IOAL 3LWLA 1NK6A 4M3WA 2UYTA 1QSYA 3CM6A 2GUPA 3GBTA 3OYAA 5TKYA 1YHQN 3OYMA 4GMJB 2NLXA 4M3RA 4C8LA 4CW7B 4HCBA 2A5XA 5AQLA 3FGUA 2QI2A 3WXMB 3S3MA 2HHXA 4KH4A 2ASOA 2XO7A 3SV3A 4B9VA 4HCCA 1LCUA 3O9RA 2IGIA 3ZYYX 5JLFA 2NRVA 4JLHA 5BRHA 5KPRA 1M1KO 3HZ6A 2IVPA 3D2FA 3MXJA 4KTWA 4JI1K 4FJHA 2A41A 3CCJN 3QEPA 2O4GA 4K41A 4FWSA 2XRIA 2KLAA 1TKTA 3MN9A 1NOYA 4CZKA 2W42A 3OYNA 4FM1A 1YI2N 3ITHA 1IG9A 4DSIA 2E5LK 5SZTA 2PY5A 3WQUA 1B9DA 3ZT2A 5KRTA 1N8RO 3EZWA 4RW7A 4CJQA 2G8FA 4TSXA 2E4LA 2ZD1A 4A5BA 1EP4A 4N5SA 1U4BA 3A5NC 1B9FA 3KD5E 3O1BA 4FW2A 3TAMA 5J2PA 4B1UB 1JLBA 2Q1NA 3BY5A 5CYMA 2XY5A 3CCLN 3NF6A 4FCYA 3RRGA 1XMOK 4DF8A 4CEAA 2VGNA 3TPQA 1J54A 3IKMA 1XUPO 1YJ9N 3CIPA 4KV8A 2OZMA 4E7JA 4G9ZA 3MECA 1Z05A 1IKWA 3FE1A 1TVRA 1RTHA 4R5PA 3P38A 1VQMN 3VPZA 3THXB 1D9FA 2KKZA 3C7NB 3O4WA 3OYKA 1WSHA 3G71N 1KD1O 1RDWX 4IDHA 4CZEA 3MWPA 3TAPA 3F9KA 3KLEA 1XC9A 2DFHA 1SKWA 1N36K 3HSCA 2H3GX 3L4IA 1U47A 3WXIA 4AM6A 4DR3K 1LOTB 1TK8A 4BC5A 4JI8K 4K43A 3CYMA 2A42A 2O4IA 4CBUA 3V81A 1NK8A 3HT3A 4DV3K 4BACA 3WEEB 3EE9A 5AQWA 3G6EN 3KWGA 4CE9A 4IWVA 1BISA 4W5RA 1W97L 3WQTA 2YHWA 4CJ3A 3KIOA 4JNEA 5FRMA 3VTIA 4LF5K 4HTUA 4JHDA 3FLCO 4FWKA 2PAVA 1S6QA 2F96A 2PBDA 2UU9K 2QW9A 4FZZA 4EP5A 4N56A 5M1FA 3DLLL 3N4QA 3TTCA 1U45A 4FK0A 1NNEA 1NK5A 3V9ZA 3THVA 2VQEK 4CECA 3NH2A 1DEJA 4XIUA 1IBLK 5C25A 3AVIA 3AVBA 3CJ9A 3WNEA 2B5JA 4J2EA 3QFPA 4BE1A 3HP6A 1WSGA 4JHDB 3AAQA 4KB0A 3CI5A 3LM9A 1TL3A 3I55N 3TTFA 1X9MA 3QDKA 1A5WA 1ZBUA 3VQ6A 2E2QA 4BR4A 3BF1A 3ULDA 4B1YB 2GELA 4YOVA 1R59O 4CZJA 2HF3A 5M1OA 4EHTA 3OYIA 3I0SA 2A1RA 2G8KA 3OYEA 2HW3A 3QEWA 1N5YA 3PSIA 4E7KA 5C10A 2EX3A 4Y1DA 4UY8O 4LFCK 4CF9A 1ASUA 2E2NA 1NGAA 1KSPA 5GAHP 3SMSA 1SQKA 4WFNL 2DFEA 2E1YA 4LF7K 3UKUA 3TABA 3GG4A 4CGIA 1RBVA 4FLTA 3A5LC 4Z4HA 4DV0K 1HLUA 3QMLA 2IIRA 4EZ6A 2OYQA 5JICA 2NRRA 4CCHA 4JKHA 2HNYA 4E3SA 2NRTA 4KPYA 1C1BA 3O4QA 5M1KA 2QWRA 5E84A 4BRGA 4H0OA 4DQQA 3DXMA 2QWPA 3J80O 1XC3A 3ZX0A 1Q7YO 5ADXH 1NG9A 4I9LA 3CG7A 4F9OA 5KI6A 4IJNA 5BN8A 1QZ6A 4E1NA 2BANA 3H1QA 5AQQA 4FWPA 1WSIA 1GLFO 3TSPA 1WLJA 2P9PB 1KVCA 3HYFA 4WQ4C 4DSKA 2V52B 1BCOA 1NK7A 4Q0BA 3KVGA 3CHWA 4R79A 4DTUA 2ZJQL 3DXMB 3VQPA 4B1ZA 1JL2A 3MEDA 4JK7A 4DU4A 3DJCA 4K8XA 4PY5A 3SAGA 4W5TA 4YOXA 4CJVA 4PKGA 1VSJA 4EIAA 4RW4A 4OLBA 3HOTA 1NJZA 4DFJA 2HHTA 3U6FA 4NXMK 3U3YA 3NVKA 3KTQA 2VWKA 1WAFA 5M1NA 1D5AA 3VGKA 4B9LA 1J53A 1S72N 2GTDA 4PWDA 1SS6A 4B3RK 5KRSA 3D45A 4ZHRA 4BRCA 4OX9K 4B8CA 3L2WA 4C1NK 4FYDA 1U04A 1ZXOA 4WQ5C 3CC2N 1JLEA 3ZX2A 1RBRA 4CGJA 1C0MA 2Q97A 2HHQA 4C23A 4YOTA 4AHVA 3QERA 3CC7N 3QNNA 1HNXK 1QQOA 4BDZA 3CJ7A 1YAGA 1KAXA 4Y1CA 2OTJN 3HK2A 2D5RA 3M8RA 3HVRA 1C0UA 1RCHA 1ZBFA 3MEEA 3CF5L 4DF4A 4HTLA 4OPJA 3QFUA 3K59A 3QINA 3IMXA 2QXLA 1DKGD 4F2SA 3DWLA 1T8EA 4UQGA 4DTOA 1HJOA 4ILGB 4IG3A 3CFOA 1KVBA 5J2MA 2P5OA 1T03A 3O5BA 4CZLA 1R0AA 2GUIA 2B4JA 3I0RA 3CPWM 1T6DA 5HBMA 3T69A 4RW6A 3SI6A 4NCBA 4BR5A 4NYNA 4DU3A 1JLAA 5M1PA 3SPYA 1VK0A 4YDUC 2OPRA 4JS5A 2JGUA 2KQ2A 1K8AO 2F7TA 2X78A 1HNVA 2YX6A 4O0JA 5JVHL 1QVFM 4KO0A 5CZ2A 1Q9YA 4J8FA 3PO5A 5HROA 2ZQBA 2WTUA 4CEEA 4WF9L 1KFSA 2D0BA 3O3FA 5C0YA 3MWTA 1LW0A 4JRPA 1DLOA 1RILA 4Z0UA 4CIFA 4FLWA 3LDPA 1E4GT 1VQPN 1BWFO 4X64K 4DKWA 5BRDA 2ZJRL 2Y1IA 2E20A 2OCEA 3CM5A 5CHIA 4DTJA 1NGFA 3AVJA 4O4GA 5C2FA 1UWBA 5CYQA 4BRQA 2CGLA 4CZFA 3NHGA 3LZJA 1CZ9A 4CHZA 3Q7CA 3L4QA 4NB4A 2FC0A 1VSMA 4HUEA 4CF1A 3DLGA 2YV0X 1QSSA 4A5AA 3SBGA 1EO1A 4I9QA 2FSNA 4N76A 3NGZA 4KRFA 3VA0A 1FXXA 1GOBA 4DSEA 5MLCQ 4CJ4A 2HVHA 1JCEA 2GWJA 3WXKA 1TK0A 4GV6A 4NLBA 3VEYA 1S1WA 4H0PA 2KFZA 3A8YA 1KRPA 4LC9B 3VQ4A 1YT3A 3HBTA 5BPNA 4BE0A 1L3SA 1YJNN 1RTDA 1S9EA 1N32K 4FJLA 2I7NA 3P39A 2P9IA 4NLCA 4Y0WA 1VQ9N 3MX2A 1XNQK 1MA9B 3ATVA 4DQ8A 2QWMA 3ZT3A 1NJXA 4KTQA 3B8AX 4CBWA 1BDGA 1G15A 3VA3A 2HF4A 1VQNN 2AJQA 4DFKA 2Z1IA 4JS4A 3DLKA 2OPSA 2IS3A 5AQFA 4AHTA 2NZTA 1SKRA 4OKJA 2E8AA 2RHKA 3TANA 2RPIA 3AA3A 1Z6RA 2HMIA 1Q82O 1KTQA 3AVHA 3VN5A 1JCFA 4FWNA 2NRHA 3JAMO 4M45A 4ISEA 4GKKK 4YHHK 4B3OA 2F9TA 3R6MA 4KH5A 3MDQA 4E7HA 1X1PA 3CFRA 5HRPA 4CD3A 1L3VA 2FSJA 5AQJA 4CGFA 1LWCA 4M7YA 3VTHA 4DFMA 3ASMA 2XHBA 4O5BA 3ZEUA 3VQ7A 1P90A 3A5MC 4KHNA 3F9MA 2EHGA 1J6ZA 5LJWA 1NLVA 3VMFB 2QK9A 2ETJA 3DXKA 4BY9C 5LL6Z 2KHOA 5E26A 3PX6A 4FWMA 1TV6A 2QWOA 4I2QA 4CJUA 1NK0A 4BG8A 2W41A 3VEWA 4JKGB 2WBNA 3SNNA 2UUBK 1K6YA 4KBOA 1OH5A 1VQON 1ATSA 1TGOA 1TUYA 3ZEUB 3RMBA 4B1WB 1BG3A 1BQNA 2YJFA 1U48A 5EXWA 1S9GA 1VQKN 2O8FB 1T6CA 1QQCA 3NGIA 1RDDA 1RT1A 3K2PA 2GV9A 1FW6A 4DR1K 5AQUA 4B08A 4JKEA 3G0ZA 3ZSYA 4BDYA 1EX4A 4DQSA 3KK3A 3AVMA 3AVKA 4MDBA 3DOKA 3P1GA 4F8RA 4KFBA 4M3YA 1OKJA 1I94K 3B6OA 3KKRA 5C15A 1M90O 5JMVA 3ZSZA 2OPQA 3MCAB 3ZX3A 4H4OA 3UE5A 3J7YP 4DWIA 5IT9O 4BROA 4WE1A 5LMUK 4NO7A 4E1MA 4I6MA 2D0AA 5FROA 1A5VA 4EP4A 1HR0K 4CJEA 3SQ1A 4H5WA 3TTDA 1U2VA 2OTLN 3SJHA 3AVFA 4BGAA 4DV2K 2GBZA 3TAGA 4B8AB 4DR2K 1TUUA 2QM1A 4GV9A 4ZTJA 4OJRA 4FWQA 4W5QA 1X9WA 1K8KA 4JI3K 3L2VA 3RR8A 3TR8A 2IC3A 3PV8A 4B3MK 4JK8A 4IBNA 5HP1A 1I3AA 4CEQA 4NYFA 1IJJA 4J2AA 3OA9A 1CXUA 4AHSA 4ELUA 4FVMA 3BUZB 4A62A 3SUNA 1U2VB 3M5RA 3THYA 3LAKA 1T7PA 1RBTA 3D6RA 3WNGA 3HXMA 2HHVA 1SZ2A 1TKDA 3CC4N 3DMJA 3LM2A 4LSNA 4KHSA 1S1UA 3QESA 3OYLA 4BRPA 1REVA 1SL1A 4OKKA 4HUFA 3V4IA 2WUSA 4JAXA 3OYHA 1NJYA 4JI2K 4M41A 5AQYA 5HRNA 3D2FB 1TKXA 4BWJA 3SQ2A 3M6GA 5BRFA 3JXUA 4AF1A 4FOIA 3THYB 5KPTA 2G8UA 2J4RA 4FJ8A 4H5VA 1BI4A 3QBXA 4YOYA 3ZCMA 4X62K 4BR0A 3O80A 3VQEA 1ASVA 5JS2A 3L2UA 5FRNA 5LY3A 3E9LA 4ILJA 1FJGK 2XY7A 1RNHA 3KK1A 5DM7L 2A1SA 1HX1A 5EU7A 4MDAA 3V9UA 1RDCA 4PL7A 3AA2A 2OPPA 1QSLA 3VQBA 1YITN 3LPTA 1BI4B 2W6LA 3VF4A 4PHTX 2JWLA 4LFBK 4H0VB 1YTUA 4B9TA 1KAZA 5EVZA 3OYFA 2ZWHA 3KLIA 4BRKA 4LF6K 3NBPA 3MN7A 1L5UA 1WSEA 3MMVA 3AAPA 4CZGA 4DTMA 1HMVA 4LH5A 3W0LA 4CVNE 3D7EO 4B9UA 4N47A 4XH1A 3P83D 3L2QA 2P9SA 3HPHA 4H0TB 4A2BA 3LDQA 4RG8A 3VQDA 3KLFA 3T1HK 1VSDA 3L8BA 2VYPA 4CJRA 4NCGA 3EO3A 4LF9K 1N6QA 4JKDA 1BCMA 3KD1E 4FWRA 1NMNA 2B6AA 3V1RA 5EX5A 3LZIA 3LDOA 4BREA 4FJGA 4Z4IA 1DTTA 1KVAA 3ENHA 2CH5A 3IRXA 1XWLA 4BC3A 4AILC 4EAHD 1HPMA 3C0BA 3DLBA 1JCGA 4DR7K 3M8PA 3LALA 5AQHA 3LDSA 3C6UA 3VQCA 3O08A 4KHUA 2YHBA 4PL8A 2W40A 2G8WA 3CJBA 5AQOA 4BR7A 3VGLA 3OS2A 4O8UA 3D2EA 1V4TA 2W6KA 4LFAK 4FLVA 4FZXC 4FJXA 1KLMA 4CHOA 4CFAA 3SQ4A 1YXQA 2ITMA 3VF6A 1U6ZA 2JWKA 5F0XA 5BPLA 4F3OA 4Q5VA 1VHXA 4DR6K 4PKHA 4IFYA 4DLEA 4JKBA 2IVNA 1B92A 4CD1A 5BR8K 1C1CA 2YHAA 1FKPA 3BZKA 4ILHA 4CHPA 3V9XA 4PQUA 2P9NA 5GIOA 1D4XA 2HNDA 1V4SA 3WT0A 3TU5A 3OVNA 3AVCA 3DRSA 3NMUA 5DMRA 3IFRA 4BRAA 3NF7A 3DLEA 5JLHA 3S41A 1BA0A 3HL8A 2YHXA 1E4FT 4A57A 3VERA 2OANA 4K42A 1GLJO 1MWMA 3CQ8A 4FLUA 2G8VA 4PUOA 4N41A 3AO1A 3DOLA 3K5LA 1EETA 4BR9A 2P9NB 4B9MA 1S1VA 3UKUB 1HKBA 5D3GA 4W5NA 1O13A 5J2NA 4M3ZA 4PA1A 2NRWA 2FBXA 2EWSA 3JYTA 3U8XA 2FF6A 1RDUA 1VSEA 1XHXA 4ISGA 4CERA 1IKXA 1X3MA 3ZSOA 4ICLA 2OZSA 1HRHA 3OJUA 4DR5K 5I3UA 1BOTO 1Q8IA 5F1XA 2X6NA 3O3HA 1EQYA 2KFNA 1LWFA 3B6PA 3NH0A 3QICA 4KH6A 4BRIA 4BWMA 1QZ5A 4EFHA 4CIGA 4U7BA 1S1TA 4JKAA 4OVLA 1YJWN 1BQMA 3OS0A 3NF9A 4FPBA 1E3MA 1GLCG 1ZBIA 1BUPA 3I8DA 4DV7K 3Q7BA 4BQZA 2F8TA 2QWLA 2HB5A 4IDKA 5CZ1A 3CCVN 1IKYA 2QXFA 1RT2A 2OA8A 1HPZA 5AQRA 3RSEA 4Z4EA 3RRHA 4IOCL 1IKVA 5H1SQ 1CZBA 3QEVA 4KKOA 3PY8A 1KLNA 5AQMA 4CI6A 4H5TA 4CF0A 3HSTB 1YF5L 3L3UA 5HRSA 3RMCA 2YKNA 3TWHA 1C0GA 3H46O 4JD2A 4BVOA 3FZKA 3KK2A 3K57A 1YVUA 4OLAA 4JYAK 5K14A 3EKUA 3TAEA 4DUZK 1TK5A 3QLHA 4YOWA 2O8DA 4KHQA 4DSLA 4IFVA 4CJLA 4CJTA 3O3GA 3DLRA 2HBMA 1CLQA 3E9OA 1SV5A 2HBJA 5T7BA 4H0XB 2P9KA 3ID8A 4ID1A 3L2RA 1NK4A 3VQ8A 3KZBA 3CFPA 4BRMA 2P9UA 3QEIA 4DUYK 2UXBK 2Z1GA 2I7PA 4BG9A 1DTQA 1MDUB 1T44A 3EEQA 1T05A 1Q86O 4AQYK 2HOEA 3CD6N 4E7IA 3HJFA 2WC9A 3M8QA 4JV5K 1WN7A 4BQLA 4LD0A 2QKKA 3SUOA 3K9JA 4CJ7A 4OPHA 1RT7A 3LP2A 3R8EA 2BE2A 3K9KA 1ZBSA 3DLHA 4F4KA 1GOAA 3J7ZO 3MX5A 2YI1A 4YOUA 4I2PA 4FJKA 3NCIA 4WYBA 1ESVA 2P9UB 5B8HA 1D9DA 4CJ5A 2CGJA 5AQVA 1CXQA 3QETA 3ZLJA 1RTJA 4XH4A 1NGIA 2BUPA 2D0PA 3ID6A 3AO3A 4MQ3A 4QS8A 1HKCA 2RF2A 4BRNA 1L3TA 4FLZA 5AZJA 4CZIA 2RKIA 1RBUA 2V7YA 2Q36A 1Q9XA 3IDHA 1MU2A 5AQGA 1GLBG 1VQ7N 1QHTA 1TAUA 4CEBA 4KHYA 4L3QA 3J7AP 4CJKA 1BA1A 2Y1JA 3IG1A 5AZJB 4DR4K 1IBKK 1S3XA 4B9NA 2IAJA 3EKSA 2F9WA 5C12A 1UOCA 3K5NA 3WNFA 3ENOA 2HVIA 3VEXA 4FO0A 5AQXA 1RFQA 5FPDA 3C6TA 4FK4A 2XY6A 2VG7A 3WUHA 4LF4K 1NGHA 1XI1A 4HHTA 2HSTA 2GEMA 5IWAK 3RWUA 4DSFA 3TI0A 2X6SA 1LWEA 3CCUN 5FDLA 5EOYA 5HOOA 3OYCA 4DV1K 5FLXO 3G10A 1NJWA 3BDPA 1Z26A 2D0OA 2NRZA 3AVLA 1RTIA 4X65K 1X3NA 3OYGA 3EZ5A 4IZ9A 3FFIA 3LANA 4JI6K 4E1JA 1NKCA 4FJIA 2VWJA 4LF8K 2P9IB 3AA5X 4J2BA 4K25A 5F2RA 1HQEA 3V9SA 1D8YA 2Q0UA 4ISFA 3N4PA 1Q18A 3LDLA 4ZTFA 4PKIA 4CEOA 3W3DA 4BRDA 4H8KA 1GLDG 1VQ4N 2D0CA 4DQRA 3OYBA 1S6PA 3V1QA 4DV4K 3H3NO 4OGEA 5KGWA 3UB5A 5AQIA 3K58A 3AGKA 4CJPA 3I8BA 1HYVA 3BGRA 5HL7L 5DM6L 3ZSVA 2DFFA 1G99A 4DQPA 2Q0RA 3KKSA 1OVQA 1F21A 1JLGA 2NRXA 4X66K 5A2QO 4YORA 3GE1A 4FM0A 4H0YB 4AHCA 4DHYA 1Y97A 4QS9A 4QS7A 4Z4GA 1YVNA 5HRRA 5LJVA 5I42A 1HYSA 2E88A 2NNWA 4JKFA 1NGCA 4CESA 1QQNA 2O8EA 5KPZA 4DV6K 2FXUA 3TSQA 1LAVA 4C8OA 1J5OA 3DXKB 3NH1A 3SJJA 3CCQN 3VGMA 2HBKA 3ZT4A 1TAQA 4KTZA 3K5OA 5AJ3K 1NKBA 3LP1A 4IFEA 1C0TA 2G8HA 1ZYQA 3UIQA 5FPEA 3OY9A 3PX0A 2O8EB 3OYJA 4DU1A 3AY9A 1JXEA 3MN6A 3DI6A 1N33K 5J1EA 1EKEA 3MN5A 3FZHA 3SUQA 3O9UA 4QAGA 1ATRA 3O6WA 4DCHA 1VSFA 4FJJA 3MEGA 3L3VA 1NGJA 2DPNA 3AVGA 3CQYA 3PX4A 1I39A 3CMEN 2V7ZA 3TSUA 4HUGA 4CEFA 5CE3A 4GVMA 5KGXA 2G8IA 3O8MA 5AFUA 3CQXA 4CFBA 4LSLA 3L0QA 5AR0A 4CGHA 1RGIA 4KI6A 3PSFA 2RE2A 2XY8A 2IDOA 2A6AA 3ENBA 1X9SA 4DB3A 3AO5A 4EHUA 1DGKN 1IH7A 1Y64A 4I6MB 3HPOA 3UKRA 1UA1A 1CZAN 5KQDA 5E41A 3HVTA 2P5GA 2CH6A 4DQIA 2UUCK 3PO4A 4DFPA 2FLOA 1A5XA 2YNIA 3CXCM 4JEPA 1VQ5N 3H08A 3ZSWA 1W7AA 3U4LA 1SAZA 4Z4FA 2E1ZA 5JS1A 2YNHA 2DY4A 1K8KB 1K73O 3NE6A 3SLCA 4JI5K 2E2PA 3KWIA 1VSLA 3UKRB 4DTRA 3KLHA 4IJAA 4E0DA 1S22A 1BHLA 1VRTA 1HKGA 2YCHA 3J81O 2IVOA 1WNSA 3OS1A 3A0IX 1QQMA 2FBTA 3J8AA 4FWLA 3AO4A 1WBBA 4JK9A 1HQUA 2Q2RA 4YY3K 1NM1A 2PFUA 4FJMA 4FJ7A 2P51A 4I7FA 3OBYA 2VCPA 4RTFD 4A2AA 3HM9A 3H6EA 3TAQA 3QEXA 3M8SA 2P9LA 2VGMA 4HWIA 4BE2A 1QVGM 3ULEA 1O1WA 3S9HA 1KCFA 3RTVA 3P4IA 4FVUA 2ATQA 3MAQA 3QIOA 2UXCK 1W9HA 1N34K 4CEZA 2VG5A 2KTQA 1VQ8N 2V51B 4H5NA 4JN4A 2LSNA 4CF8A 1NKEA 3DRPA 3THXA 4GVEA 1LV5A 3C7NA 4H03B 3VESA 3WXJA 4BGBA 3OW2M 2BH1A 3K5MA 2GX9A 3FZLA 3C6AA 2P9LB 2ZF5O 2F8SA 4KHPK 3ULEB 1NBWA 1NK9A 1HYZA 3C95A 4CJSA 3EN9A 4RCHA 3O9QA 4JI7K 2E2OA 4C8NA 3DM2A 2BGGA 2WONA 2A3ZA 3QBWA 4BDPA 3E9PA 3WEEA 2PZSA 1NOZA 4RWTA 4YNQA 5KQ8A 4Z4CA 3SAHA 2ZM6K 3CJ1A 3CETA 3OHRA 4E19A 4CEDA 1C6VA 3QIPA 3NFAA 4CFDA 4IXCA 4LY7A 3MK6A 3CCEN 3ISNC 3SCXA 3E66A 1WOQA 3R3LA 5CR4A 3CCMN 4LH4A 1EXQA 4M42A 3HRGA 4O44A 3BF3A 2P9SB 1QE1A 3DAWA 1S1XA 2Z1JA 1S5JA 3VQ5A 5BREA 3SUPA 1GLAG 1DT9A 3G4SN 2HBLA 4QOZB 1NGDA 4GY2B 4E7LA 1GLLO 3RVCA 4FSVA 1NGBA 4CHQA 4CZMA 1BIUA 4DG1A 4FW1A 3HI0A 3T19A 1SL0A 3LPUA 3SK3A 1JL1A 1HJRA 4IOXA 2UXDK 3BZCA 5AQTA 4B1VA 2R7YA 4ID5A 4BR2A 1UA0A 4MLEA 3S3OA 4GNIA 3SAFA 4NCAA 2DTUA 1UAXA 3O4NA 1U49A 3LP3A 4HVJA 4WFBL 3T7ZA 1JLFA 4IG0A 3D2EB 3JS6A 3RMDA 4KREA 3VQ9A 4JI4K 4O5FA 1VSKA 3ZT0A 1L3UA 3V1OA 2HNZA 4OPKA 5AQNA 1ATNA 3WXLA 4KB1A 3WNHA 3DYAA 2YHYA 2E6LA 5AZIA 3U9DA 3FFKB 3RMAA 3A2FA 5C24A 3M1FA 4F3TA 5JVGL 4O55A 1KXPA 2O8BA 2GWKA 3HOSA 1KC8O 3LDNA 4QCLA 4O8KA 2P1JA 4BRFA 4C1NI 4OKEA 1JXBA 4GKJK 4CHYA 1LAWA 2KW4A 4JKCA 4BC4A 2P9PA 2Q31A 4DMNA 2FBYA 3K0SA 5KTQA 5AZIB 1ZBHA 4O0IA 1KQSM 1ASWA 4CJFA 1ITGA 3LP0A 1JKHA 3ALYA 2O8BB 2FBVA 3AARA 1NU0A 4RW9A 1JLQA 3QB0A 3EY1A 4GV3A 4NXNK 2F4VK 1YUWA 3VF2A
chains in the Genus database with same CATH topology
1FJGK 3J7AP 1N36K 4DR6K 3J81O 4DR3K 1IBMK 4DV6K 4DR4K 4JI8K 1I94K 1IBKK 5BR8K 4CW7B 4DV3K 4YY3K 3J80O 4JYAK 4LFBK 3J7YP 5AJ3K 4DUZK 2UXDK 5IT9O 5LMUK 4JI0K 4LF4K 5IWAK 4LF6K 4LF5K 3JAMO 1HR0K 4GKKK 4YHHK 4JI1K 4CVNE 2UXCK 4DV1K 5FLXO 2UU9K 4DV2K 1N34K 1N33K 1XNRK 4DR2K 4DV5K 4X65K 4JI4K 2VQEK 4DUYK 1IBLK 3T1HK 4JI6K 4JI3K 2UXBK 4LF8K 2E5LK 4LF9K 4B3MK 4AQYK 4KHPK 4X64K 4JV5K 4NXMK 4JI7K 5LMNK 5LL6Z 3T1YK 4DR5K 1HNWK 3OTOK 2VQFK 4V19S 4DV4K 4B3RK 4OX9K 2ZM6K 2UUBK 1XMOK 4B3SK 4GKJK 4DR7K 4JI2K 4DV7K 2HHHK 1J5EK 4LFCK 1XMQK 2UUAK 2UUCK 1HNXK 4K0KK 4B3TK 4DR1K 4X66K 4LF7K 5A2QO 1HNZK 4LFAK 1N32K 4DV0K 4X62K 4NXNK 2F4VK 4JI5K 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG K;  3J7A P;  1N36 K;  4DR6 K;  3J81 O;  4DR3 K;  1IBM K;  4DV6 K;  4DR4 K;  4JI8 K;  1I94 K;  1IBK K;  5BR8 K;  4CW7 B;  4DV3 K;  4YY3 K;  3J80 O;  4JYA K;  4LFB K;  3J7Y P;  5AJ3 K;  4DUZ K;  2UXD K;  5IT9 O;  5LMU K;  4JI0 K;  4LF4 K;  5IWA K;  4LF6 K;  4LF5 K;  3JAM O;  1HR0 K;  4GKK K;  4YHH K;  4JI1 K;  4CVN E;  2UXC K;  4DV1 K;  5FLX O;  2UU9 K;  4DV2 K;  1N34 K;  1N33 K;  1XNR K;  4DR2 K;  4DV5 K;  4X65 K;  4JI4 K;  2VQE K;  4DUY K;  1IBL K;  3T1H K;  4JI6 K;  4JI3 K;  2UXB K;  4LF8 K;  2E5L K;  4LF9 K;  4B3M K;  4AQY K;  4KHP K;  4X64 K;  4JV5 K;  4NXM K;  4JI7 K;  5LMN K;  5LL6 Z;  3T1Y K;  4DR5 K;  1HNW K;  3OTO K;  2VQF K;  4V19 S;  4DV4 K;  4B3R K;  4OX9 K;  2ZM6 K;  2UUB K;  1XMO K;  4B3S K;  4GKJ K;  4DR7 K;  4JI2 K;  4DV7 K;  2HHH K;  1J5E K;  4LFC K;  1XMQ K;  2UUA K;  2UUC K;  1HNX K;  4K0K K;  4B3T K;  4DR1 K;  4X66 K;  4LF7 K;  5A2Q O;  1HNZ K;  4LFA K;  1N32 K;  4DV0 K;  4X62 K;  4NXN K;  2F4V K;  4JI5 K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 3L6Q A;  4AM7 A;  3F2K A;  3O1W A;  4MLH A;  3U3G A;  2QA4 N;  1EWR A;  4CBX A;  3V6D A;  5GAG P;  1SL2 A;  1IBM K;  3CJA A;  5AQP A;  3KJV A;  3VET A;  5FPM A;  3CCR N;  1WSF A;  1P8Z A;  4M3T A;  1BU6 O;  3KK7 A;  3IS9 A;  1GOC A;  2YNF A;  4IO9 L;  1OH7 A;  4FJN A;  3RR7 A;  3MCP A;  1IV0 A;  2Q3S A;  2QTD A;  4DS5 A;  3ATU A;  4M63 C;  1C1A A;  2QWQ A;  1XHZ A;  4C8K A;  1IG8 A;  1VSH A;  2HHU A;  4DV5 K;  2YJE A;  3RSE B;  3D0P A;  3R1X A;  2QKB A;  3CCS N;  3NF8 A;  5AQS A;  2NUB A;  4H4M A;  4KAZ A;  3FZM A;  4OO1 J;  5HLF A;  3HO1 A;  3CPE A;  4FWO A;  4CZH A;  4IKF A;  5AQZ A;  2ZGY A;  2D4W A;  4B1X B;  3FR0 A;  4EZ9 A;  5CY4 A;  2ASP A;  3ZSX A;  4JD2 B;  1HNW K;  4DTP A;  2PYL A;  5DK5 A;  3SBT A;  4OGC A;  3T3F A;  4B9Q A;  5C42 A;  3F73 A;  4DS4 A;  3P31 A;  1OH6 A;  2O8D B;  3VQQ A;  2ZJP L;  1SUQ A;  4M3U A;  1VQ6 N;  4CGG A;  2AP1 A;  2I5J A;  1RT4 A;  3TAR A;  4AHU A;  3EE8 A;  2ASM A;  3LWM A;  4FLY A;  4CK3 A;  4KHW A;  4DTX A;  2YNG A;  3OBW A;  2P9K B;  3PLA A;  4Z94 A;  2PYJ A;  3BEX A;  1HNZ K;  1Z25 A;  1EWQ A;  4OPA A;  4DTS A;  1IO2 A;  3OYD A;  3IUC A;  3KLG A;  5AFU H;  4WQ4 A;  3R9P A;  2X74 A;  1BO5 O;  5M1Q A;  3QNO A;  1QHA A;  3QO9 A;  4A59 A;  2CGK A;  3PUF A;  2WOM A;  1HUX A;  4FOE A;  3SMP A;  3OJS A;  1KFD A;  3VEZ A;  1FKO A;  1LW2 A;  5I9E B;  1WBD A;  3C6H A;  1WSJ A;  1NGE A;  3U9Z A;  4A61 A;  3DRR A;  1K9M O;  1VQL N;  1SKS A;  3I56 N;  1TKZ A;  4CIE A;  4M3X A;  2IOC A;  3NGY A;  2BTF A;  2ITG A;  2D1K A;  2Z1H A;  1BGX T;  4ELT A;  1YTA A;  2KZM A;  3ZSQ A;  3VEO A;  3NAE A;  5AQK A;  1XNR K;  1NWK A;  2YKM A;  1RDA A;  3HPG A;  4L8R B;  4C8M A;  3S3N A;  4B9S A;  1ZBL A;  4DSJ A;  4WQ5 A;  1QS4 A;  3ZET A;  4IO8 A;  1NJI O;  1BIZ A;  1J9A A;  4FPA A;  4BC2 A;  2HHS A;  1BL3 A;  3THW A;  3HTV A;  3NVM A;  5SWM A;  2JLE A;  1HNI A;  1VAZ A;  3NDK A;  1JJ2 M;  2VG6 A;  4KI4 A;  4FL9 A;  3OTO K;  2VQF K;  4MO5 A;  1WAJ A;  2QWN A;  3O9S A;  4FXD A;  3ZET B;  1W2B M;  1RT6 A;  3VEV A;  3VEN A;  3PIP L;  1OVY A;  1XQS C;  4CF2 A;  2BDP A;  2O8C A;  3O9T A;  5ADX A;  3PIO L;  5BPM A;  1YIJ N;  3M3Z A;  4FZY A;  3THW B;  1J5E K;  5BN9 A;  3MXI A;  3LAM A;  4ELV A;  1VRU A;  1ILY A;  5J2Q A;  4B3T K;  2RN2 A;  4YDU A;  1T3V A;  2VWB A;  3AVN A;  4AHR A;  1ZC6 A;  3P5J A;  4CK1 A;  4DLG A;  3H45 C;  4BRL A;  4CK2 A;  1X9J A;  1C0F A;  1VSI A;  2AA4 A;  3I33 A;  3LL3 A;  2O8C B;  4IEI A;  1OH8 A;  4H5R A;  4FK2 A;  4IEE A;  2HMP A;  3ZSR A;  4FJ5 A;  4BRH A;  1GLE G;  3GL1 A;  3G25 A;  4AH9 A;  2QEX N;  1NGG A;  1QTM A;  4XEI A;  1KAY A;  2A40 A;  5GIN A;  5FPN A;  4FJ9 A;  4J2D A;  4JKG A;  4JI0 K;  4E89 A;  3EYZ A;  1WUA A;  3SQ0 A;  1W0H A;  4CFC A;  5GAE P;  3AO2 A;  1NMD A;  5GAD P;  1RDB A;  3E01 A;  2O8F A;  4CGD A;  1TYQ A;  3IAY A;  3AA4 A;  3GDQ A;  1Q81 O;  2E6M A;  3TAF A;  4CHN A;  4GW6 A;  3JSM A;  3SV4 A;  4MO4 A;  4MFB A;  5C2D A;  1H1V A;  3SPZ A;  2FSK A;  3C65 A;  1MWK A;  3AGR A;  3VOV A;  1RBS A;  2HHW A;  4FM2 A;  3CJC A;  1FK9 A;  3GOI A;  3KHY A;  4CJW A;  3SYZ A;  3CER A;  3E1Y A;  5ELZ A;  3HP9 A;  3MXM A;  4XH5 A;  4U67 L;  4YFU A;  3BP8 A;  1TYQ B;  5LMN K;  3V9W A;  3T1Y K;  2ZGZ A;  2WFB A;  4M7X A;  3T1A A;  3EL2 A;  3H3O B;  4V19 S;  4F2R A;  2FF3 B;  3AVA A;  1WB9 A;  4B3S K;  2KZZ A;  4FLX A;  5GIP A;  5TKW A;  3ZT1 A;  1RT5 A;  3CMA N;  3FZF A;  4RW8 A;  3AV9 A;  3A5O C;  2HHH K;  3F5T A;  3C94 A;  4K8Z A;  1XMQ K;  2UUA K;  3VQA A;  4BVP A;  2ZE2 A;  4WCE L;  4G1Q A;  4K0K K;  1JLC A;  5EY4 A;  1TL1 A;  5BR9 A;  4WFA L;  4JRQ A;  1RT3 A;  3SZ2 A;  4DTN A;  3HM8 A;  3H1V X;  4W5O A;  4IOA L;  3LWL A;  1NK6 A;  4M3W A;  2UYT A;  1QSY A;  3CM6 A;  2GUP A;  3GBT A;  3OYA A;  5TKY A;  1YHQ N;  3OYM A;  4GMJ B;  2NLX A;  4M3R A;  4C8L A;  4CW7 B;  4HCB A;  2A5X A;  5AQL A;  3FGU A;  2QI2 A;  3WXM B;  3S3M A;  2HHX A;  4KH4 A;  2ASO A;  2XO7 A;  3SV3 A;  4B9V A;  4HCC A;  1LCU A;  3O9R A;  2IGI A;  3ZYY X;  5JLF A;  2NRV A;  4JLH A;  5BRH A;  5KPR A;  1M1K O;  3HZ6 A;  2IVP A;  3D2F A;  3MXJ A;  4KTW A;  4JI1 K;  4FJH A;  2A41 A;  3CCJ N;  3QEP A;  2O4G A;  4K41 A;  4FWS A;  2XRI A;  2KLA A;  1TKT A;  3MN9 A;  1NOY A;  4CZK A;  2W42 A;  3OYN A;  4FM1 A;  1YI2 N;  3ITH A;  1IG9 A;  4DSI A;  2E5L K;  5SZT A;  2PY5 A;  3WQU A;  1B9D A;  3ZT2 A;  5KRT A;  1N8R O;  3EZW A;  4RW7 A;  4CJQ A;  2G8F A;  4TSX A;  2E4L A;  2ZD1 A;  4A5B A;  1EP4 A;  4N5S A;  1U4B A;  3A5N C;  1B9F A;  3KD5 E;  3O1B A;  4FW2 A;  3TAM A;  5J2P A;  4B1U B;  1JLB A;  2Q1N A;  3BY5 A;  5CYM A;  2XY5 A;  3CCL N;  3NF6 A;  4FCY A;  3RRG A;  1XMO K;  4DF8 A;  4CEA A;  2VGN A;  3TPQ A;  1J54 A;  3IKM A;  1XUP O;  1YJ9 N;  3CIP A;  4KV8 A;  2OZM A;  4E7J A;  4G9Z A;  3MEC A;  1Z05 A;  1IKW A;  3FE1 A;  1TVR A;  1RTH A;  4R5P A;  3P38 A;  1VQM N;  3VPZ A;  3THX B;  1D9F A;  2KKZ A;  3C7N B;  3O4W A;  3OYK A;  1WSH A;  3G71 N;  1KD1 O;  1RDW X;  4IDH A;  4CZE A;  3MWP A;  3TAP A;  3F9K A;  3KLE A;  1XC9 A;  2DFH A;  1SKW A;  1N36 K;  3HSC A;  2H3G X;  3L4I A;  1U47 A;  3WXI A;  4AM6 A;  4DR3 K;  1LOT B;  1TK8 A;  4BC5 A;  4JI8 K;  4K43 A;  3CYM A;  2A42 A;  2O4I A;  4CBU A;  3V81 A;  1NK8 A;  3HT3 A;  4DV3 K;  4BAC A;  3WEE B;  3EE9 A;  5AQW A;  3G6E N;  3KWG A;  4CE9 A;  4IWV A;  1BIS A;  4W5R A;  1W97 L;  3WQT A;  2YHW A;  4CJ3 A;  3KIO A;  4JNE A;  5FRM A;  3VTI A;  4LF5 K;  4HTU A;  4JHD A;  3FLC O;  4FWK A;  2PAV A;  1S6Q A;  2F96 A;  2PBD A;  2UU9 K;  2QW9 A;  4FZZ A;  4EP5 A;  4N56 A;  5M1F A;  3DLL L;  3N4Q A;  3TTC A;  1U45 A;  4FK0 A;  1NNE A;  1NK5 A;  3V9Z A;  3THV A;  2VQE K;  4CEC A;  3NH2 A;  1DEJ A;  4XIU A;  1IBL K;  5C25 A;  3AVI A;  3AVB A;  3CJ9 A;  3WNE A;  2B5J A;  4J2E A;  3QFP A;  4BE1 A;  3HP6 A;  1WSG A;  4JHD B;  3AAQ A;  4KB0 A;  3CI5 A;  3LM9 A;  1TL3 A;  3I55 N;  3TTF A;  1X9M A;  3QDK A;  1A5W A;  1ZBU A;  3VQ6 A;  2E2Q A;  4BR4 A;  3BF1 A;  3ULD A;  4B1Y B;  2GEL A;  4YOV A;  1R59 O;  4CZJ A;  2HF3 A;  5M1O A;  4EHT A;  3OYI A;  3I0S A;  2A1R A;  2G8K A;  3OYE A;  2HW3 A;  3QEW A;  1N5Y A;  3PSI A;  4E7K A;  5C10 A;  2EX3 A;  4Y1D A;  4UY8 O;  4LFC K;  4CF9 A;  1ASU A;  2E2N A;  1NGA A;  1KSP A;  5GAH P;  3SMS A;  1SQK A;  4WFN L;  2DFE A;  2E1Y A;  4LF7 K;  3UKU A;  3TAB A;  3GG4 A;  4CGI A;  1RBV A;  4FLT A;  3A5L C;  4Z4H A;  4DV0 K;  1HLU A;  3QML A;  2IIR A;  4EZ6 A;  2OYQ A;  5JIC A;  2NRR A;  4CCH A;  4JKH A;  2HNY A;  4E3S A;  2NRT A;  4KPY A;  1C1B A;  3O4Q A;  5M1K A;  2QWR A;  5E84 A;  4BRG A;  4H0O A;  4DQQ A;  3DXM A;  2QWP A;  3J80 O;  1XC3 A;  3ZX0 A;  1Q7Y O;  5ADX H;  1NG9 A;  4I9L A;  3CG7 A;  4F9O A;  5KI6 A;  4IJN A;  5BN8 A;  1QZ6 A;  4E1N A;  2BAN A;  3H1Q A;  5AQQ A;  4FWP A;  1WSI A;  1GLF O;  3TSP A;  1WLJ A;  2P9P B;  1KVC A;  3HYF A;  4WQ4 C;  4DSK A;  2V52 B;  1BCO A;  1NK7 A;  4Q0B A;  3KVG A;  3CHW A;  4R79 A;  4DTU A;  2ZJQ L;  3DXM B;  3VQP A;  4B1Z A;  1JL2 A;  3MED A;  4JK7 A;  4DU4 A;  3DJC A;  4K8X A;  4PY5 A;  3SAG A;  4W5T A;  4YOX A;  4CJV A;  4PKG A;  1VSJ A;  4EIA A;  4RW4 A;  4OLB A;  3HOT A;  1NJZ A;  4DFJ A;  2HHT A;  3U6F A;  4NXM K;  3U3Y A;  3NVK A;  3KTQ A;  2VWK A;  1WAF A;  5M1N A;  1D5A A;  3VGK A;  4B9L A;  1J53 A;  1S72 N;  2GTD A;  4PWD A;  1SS6 A;  4B3R K;  5KRS A;  3D45 A;  4ZHR A;  4BRC A;  4OX9 K;  4B8C A;  3L2W A;  4C1N K;  4FYD A;  1U04 A;  1ZXO A;  4WQ5 C;  3CC2 N;  1JLE A;  3ZX2 A;  1RBR A;  4CGJ A;  1C0M A;  2Q97 A;  2HHQ A;  4C23 A;  4YOT A;  4AHV A;  3QER A;  3CC7 N;  3QNN A;  1HNX K;  1QQO A;  4BDZ A;  3CJ7 A;  1YAG A;  1KAX A;  4Y1C A;  2OTJ N;  3HK2 A;  2D5R A;  3M8R A;  3HVR A;  1C0U A;  1RCH A;  1ZBF A;  3MEE A;  3CF5 L;  4DF4 A;  4HTL A;  4OPJ A;  3QFU A;  3K59 A;  3QIN A;  3IMX A;  2QXL A;  1DKG D;  4F2S A;  3DWL A;  1T8E A;  4UQG A;  4DTO A;  1HJO A;  4ILG B;  4IG3 A;  3CFO A;  1KVB A;  5J2M A;  2P5O A;  1T03 A;  3O5B A;  4CZL A;  1R0A A;  2GUI A;  2B4J A;  3I0R A;  3CPW M;  1T6D A;  5HBM A;  3T69 A;  4RW6 A;  3SI6 A;  4NCB A;  4BR5 A;  4NYN A;  4DU3 A;  1JLA A;  5M1P A;  3SPY A;  1VK0 A;  4YDU C;  2OPR A;  4JS5 A;  2JGU A;  2KQ2 A;  1K8A O;  2F7T A;  2X78 A;  1HNV A;  2YX6 A;  4O0J A;  5JVH L;  1QVF M;  4KO0 A;  5CZ2 A;  1Q9Y A;  4J8F A;  3PO5 A;  5HRO A;  2ZQB A;  2WTU A;  4CEE A;  4WF9 L;  1KFS A;  2D0B A;  3O3F A;  5C0Y A;  3MWT A;  1LW0 A;  4JRP A;  1DLO A;  1RIL A;  4Z0U A;  4CIF A;  4FLW A;  3LDP A;  1E4G T;  1VQP N;  1BWF O;  4X64 K;  4DKW A;  5BRD A;  2ZJR L;  2Y1I A;  2E20 A;  2OCE A;  3CM5 A;  5CHI A;  4DTJ A;  1NGF A;  3AVJ A;  4O4G A;  5C2F A;  1UWB A;  5CYQ A;  4BRQ A;  2CGL A;  4CZF A;  3NHG A;  3LZJ A;  1CZ9 A;  4CHZ A;  3Q7C A;  3L4Q A;  4NB4 A;  2FC0 A;  1VSM A;  4HUE A;  4CF1 A;  3DLG A;  2YV0 X;  1QSS A;  4A5A A;  3SBG A;  1EO1 A;  4I9Q A;  2FSN A;  4N76 A;  3NGZ A;  4KRF A;  3VA0 A;  1FXX A;  1GOB A;  4DSE A;  5MLC Q;  4CJ4 A;  2HVH A;  1JCE A;  2GWJ A;  3WXK A;  1TK0 A;  4GV6 A;  4NLB A;  3VEY A;  1S1W A;  4H0P A;  2KFZ A;  3A8Y A;  1KRP A;  4LC9 B;  3VQ4 A;  1YT3 A;  3HBT A;  5BPN A;  4BE0 A;  1L3S A;  1YJN N;  1RTD A;  1S9E A;  1N32 K;  4FJL A;  2I7N A;  3P39 A;  2P9I A;  4NLC A;  4Y0W A;  1VQ9 N;  3MX2 A;  1XNQ K;  1MA9 B;  3ATV A;  4DQ8 A;  2QWM A;  3ZT3 A;  1NJX A;  4KTQ A;  3B8A X;  4CBW A;  1BDG A;  1G15 A;  3VA3 A;  2HF4 A;  1VQN N;  2AJQ A;  4DFK A;  2Z1I A;  4JS4 A;  3DLK A;  2OPS A;  2IS3 A;  5AQF A;  4AHT A;  2NZT A;  1SKR A;  4OKJ A;  2E8A A;  2RHK A;  3TAN A;  2RPI A;  3AA3 A;  1Z6R A;  2HMI A;  1Q82 O;  1KTQ A;  3AVH A;  3VN5 A;  1JCF A;  4FWN A;  2NRH A;  3JAM O;  4M45 A;  4ISE A;  4GKK K;  4YHH K;  4B3O A;  2F9T A;  3R6M A;  4KH5 A;  3MDQ A;  4E7H A;  1X1P A;  3CFR A;  5HRP A;  4CD3 A;  1L3V A;  2FSJ A;  5AQJ A;  4CGF A;  1LWC A;  4M7Y A;  3VTH A;  4DFM A;  3ASM A;  2XHB A;  4O5B A;  3ZEU A;  3VQ7 A;  1P90 A;  3A5M C;  4KHN A;  3F9M A;  2EHG A;  1J6Z A;  5LJW A;  1NLV A;  3VMF B;  2QK9 A;  2ETJ A;  3DXK A;  4BY9 C;  5LL6 Z;  2KHO A;  5E26 A;  3PX6 A;  4FWM A;  1TV6 A;  2QWO A;  4I2Q A;  4CJU A;  1NK0 A;  4BG8 A;  2W41 A;  3VEW A;  4JKG B;  2WBN A;  3SNN A;  2UUB K;  1K6Y A;  4KBO A;  1OH5 A;  1VQO N;  1ATS A;  1TGO A;  1TUY A;  3ZEU B;  3RMB A;  4B1W B;  1BG3 A;  1BQN A;  2YJF A;  1U48 A;  5EXW A;  1S9G A;  1VQK N;  2O8F B;  1T6C A;  1QQC A;  3NGI A;  1RDD A;  1RT1 A;  3K2P A;  2GV9 A;  1FW6 A;  4DR1 K;  5AQU A;  4B08 A;  4JKE A;  3G0Z A;  3ZSY A;  4BDY A;  1EX4 A;  4DQS A;  3KK3 A;  3AVM A;  3AVK A;  4MDB A;  3DOK A;  3P1G A;  4F8R A;  4KFB A;  4M3Y A;  1OKJ A;  1I94 K;  3B6O A;  3KKR A;  5C15 A;  1M90 O;  5JMV A;  3ZSZ A;  2OPQ A;  3MCA B;  3ZX3 A;  4H4O A;  3UE5 A;  3J7Y P;  4DWI A;  5IT9 O;  4BRO A;  4WE1 A;  5LMU K;  4NO7 A;  4E1M A;  4I6M A;  2D0A A;  5FRO A;  1A5V A;  4EP4 A;  1HR0 K;  4CJE A;  3SQ1 A;  4H5W A;  3TTD A;  1U2V A;  2OTL N;  3SJH A;  3AVF A;  4BGA A;  4DV2 K;  2GBZ A;  3TAG A;  4B8A B;  4DR2 K;  1TUU A;  2QM1 A;  4GV9 A;  4ZTJ A;  4OJR A;  4FWQ A;  4W5Q A;  1X9W A;  1K8K A;  4JI3 K;  3L2V A;  3RR8 A;  3TR8 A;  2IC3 A;  3PV8 A;  4B3M K;  4JK8 A;  4IBN A;  5HP1 A;  1I3A A;  4CEQ A;  4NYF A;  1IJJ A;  4J2A A;  3OA9 A;  1CXU A;  4AHS A;  4ELU A;  4FVM A;  3BUZ B;  4A62 A;  3SUN A;  1U2V B;  3M5R A;  3THY A;  3LAK A;  1T7P A;  1RBT A;  3D6R A;  3WNG A;  3HXM A;  2HHV A;  1SZ2 A;  1TKD A;  3CC4 N;  3DMJ A;  3LM2 A;  4LSN A;  4KHS A;  1S1U A;  3QES A;  3OYL A;  4BRP A;  1REV A;  1SL1 A;  4OKK A;  4HUF A;  3V4I A;  2WUS A;  4JAX A;  3OYH A;  1NJY A;  4JI2 K;  4M41 A;  5AQY A;  5HRN A;  3D2F B;  1TKX A;  4BWJ A;  3SQ2 A;  3M6G A;  5BRF A;  3JXU A;  4AF1 A;  4FOI A;  3THY B;  5KPT A;  2G8U A;  2J4R A;  4FJ8 A;  4H5V A;  1BI4 A;  3QBX A;  4YOY A;  3ZCM A;  4X62 K;  4BR0 A;  3O80 A;  3VQE A;  1ASV A;  5JS2 A;  3L2U A;  5FRN A;  5LY3 A;  3E9L A;  4ILJ A;  1FJG K;  2XY7 A;  1RNH A;  3KK1 A;  5DM7 L;  2A1S A;  1HX1 A;  5EU7 A;  4MDA A;  3V9U A;  1RDC A;  4PL7 A;  3AA2 A;  2OPP A;  1QSL A;  3VQB A;  1YIT N;  3LPT A;  1BI4 B;  2W6L A;  3VF4 A;  4PHT X;  2JWL A;  4LFB K;  4H0V B;  1YTU A;  4B9T A;  1KAZ A;  5EVZ A;  3OYF A;  2ZWH A;  3KLI A;  4BRK A;  4LF6 K;  3NBP A;  3MN7 A;  1L5U A;  1WSE A;  3MMV A;  3AAP A;  4CZG A;  4DTM A;  1HMV A;  4LH5 A;  3W0L A;  4CVN E;  3D7E O;  4B9U A;  4N47 A;  4XH1 A;  3P83 D;  3L2Q A;  2P9S A;  3HPH A;  4H0T B;  4A2B A;  3LDQ A;  4RG8 A;  3VQD A;  3KLF A;  3T1H K;  1VSD A;  3L8B A;  2VYP A;  4CJR A;  4NCG A;  3EO3 A;  4LF9 K;  1N6Q A;  4JKD A;  1BCM A;  3KD1 E;  4FWR A;  1NMN A;  2B6A A;  3V1R A;  5EX5 A;  3LZI A;  3LDO A;  4BRE A;  4FJG A;  4Z4I A;  1DTT A;  1KVA A;  3ENH A;  2CH5 A;  3IRX A;  1XWL A;  4BC3 A;  4AIL C;  4EAH D;  1HPM A;  3C0B A;  3DLB A;  1JCG A;  4DR7 K;  3M8P A;  3LAL A;  5AQH A;  3LDS A;  3C6U A;  3VQC A;  3O08 A;  4KHU A;  2YHB A;  4PL8 A;  2W40 A;  2G8W A;  3CJB A;  5AQO A;  4BR7 A;  3VGL A;  3OS2 A;  4O8U A;  3D2E A;  1V4T A;  2W6K A;  4LFA K;  4FLV A;  4FZX C;  4FJX A;  1KLM A;  4CHO A;  4CFA A;  3SQ4 A;  1YXQ A;  2ITM A;  3VF6 A;  1U6Z A;  2JWK A;  5F0X A;  5BPL A;  4F3O A;  4Q5V A;  1VHX A;  4DR6 K;  4PKH A;  4IFY A;  4DLE A;  4JKB A;  2IVN A;  1B92 A;  4CD1 A;  5BR8 K;  1C1C A;  2YHA A;  1FKP A;  3BZK A;  4ILH A;  4CHP A;  3V9X A;  4PQU A;  2P9N A;  5GIO A;  1D4X A;  2HND A;  1V4S A;  3WT0 A;  3TU5 A;  3OVN A;  3AVC A;  3DRS A;  3NMU A;  5DMR A;  3IFR A;  4BRA A;  3NF7 A;  3DLE A;  5JLH A;  3S41 A;  1BA0 A;  3HL8 A;  2YHX A;  1E4F T;  4A57 A;  3VER A;  2OAN A;  4K42 A;  1GLJ O;  1MWM A;  3CQ8 A;  4FLU A;  2G8V A;  4PUO A;  4N41 A;  3AO1 A;  3DOL A;  3K5L A;  1EET A;  4BR9 A;  2P9N B;  4B9M A;  1S1V A;  3UKU B;  1HKB A;  5D3G A;  4W5N A;  1O13 A;  5J2N A;  4M3Z A;  4PA1 A;  2NRW A;  2FBX A;  2EWS A;  3JYT A;  3U8X A;  2FF6 A;  1RDU A;  1VSE A;  1XHX A;  4ISG A;  4CER A;  1IKX A;  1X3M A;  3ZSO A;  4ICL A;  2OZS A;  1HRH A;  3OJU A;  4DR5 K;  5I3U A;  1BOT O;  1Q8I A;  5F1X A;  2X6N A;  3O3H A;  1EQY A;  2KFN A;  1LWF A;  3B6P A;  3NH0 A;  3QIC A;  4KH6 A;  4BRI A;  4BWM A;  1QZ5 A;  4EFH A;  4CIG A;  4U7B A;  1S1T A;  4JKA A;  4OVL A;  1YJW N;  1BQM A;  3OS0 A;  3NF9 A;  4FPB A;  1E3M A;  1GLC G;  1ZBI A;  1BUP A;  3I8D A;  4DV7 K;  3Q7B A;  4BQZ A;  2F8T A;  2QWL A;  2HB5 A;  4IDK A;  5CZ1 A;  3CCV N;  1IKY A;  2QXF A;  1RT2 A;  2OA8 A;  1HPZ A;  5AQR A;  3RSE A;  4Z4E A;  3RRH A;  4IOC L;  1IKV A;  5H1S Q;  1CZB A;  3QEV A;  4KKO A;  3PY8 A;  1KLN A;  5AQM A;  4CI6 A;  4H5T A;  4CF0 A;  3HST B;  1YF5 L;  3L3U A;  5HRS A;  3RMC A;  2YKN A;  3TWH A;  1C0G A;  3H46 O;  4JD2 A;  4BVO A;  3FZK A;  3KK2 A;  3K57 A;  1YVU A;  4OLA A;  4JYA K;  5K14 A;  3EKU A;  3TAE A;  4DUZ K;  1TK5 A;  3QLH A;  4YOW A;  2O8D A;  4KHQ A;  4DSL A;  4IFV A;  4CJL A;  4CJT A;  3O3G A;  3DLR A;  2HBM A;  1CLQ A;  3E9O A;  1SV5 A;  2HBJ A;  5T7B A;  4H0X B;  2P9K A;  3ID8 A;  4ID1 A;  3L2R A;  1NK4 A;  3VQ8 A;  3KZB A;  3CFP A;  4BRM A;  2P9U A;  3QEI A;  4DUY K;  2UXB K;  2Z1G A;  2I7P A;  4BG9 A;  1DTQ A;  1MDU B;  1T44 A;  3EEQ A;  1T05 A;  1Q86 O;  4AQY K;  2HOE A;  3CD6 N;  4E7I A;  3HJF A;  2WC9 A;  3M8Q A;  4JV5 K;  1WN7 A;  4BQL A;  4LD0 A;  2QKK A;  3SUO A;  3K9J A;  4CJ7 A;  4OPH A;  1RT7 A;  3LP2 A;  3R8E A;  2BE2 A;  3K9K A;  1ZBS A;  3DLH A;  4F4K A;  1GOA A;  3J7Z O;  3MX5 A;  2YI1 A;  4YOU A;  4I2P A;  4FJK A;  3NCI A;  4WYB A;  1ESV A;  2P9U B;  5B8H A;  1D9D A;  4CJ5 A;  2CGJ A;  5AQV A;  1CXQ A;  3QET A;  3ZLJ A;  1RTJ A;  4XH4 A;  1NGI A;  2BUP A;  2D0P A;  3ID6 A;  3AO3 A;  4MQ3 A;  4QS8 A;  1HKC A;  2RF2 A;  4BRN A;  1L3T A;  4FLZ A;  5AZJ A;  4CZI A;  2RKI A;  1RBU A;  2V7Y A;  2Q36 A;  1Q9X A;  3IDH A;  1MU2 A;  5AQG A;  1GLB G;  1VQ7 N;  1QHT A;  1TAU A;  4CEB A;  4KHY A;  4L3Q A;  3J7A P;  4CJK A;  1BA1 A;  2Y1J A;  3IG1 A;  5AZJ B;  4DR4 K;  1IBK K;  1S3X A;  4B9N A;  2IAJ A;  3EKS A;  2F9W A;  5C12 A;  1UOC A;  3K5N A;  3WNF A;  3ENO A;  2HVI A;  3VEX A;  4FO0 A;  5AQX A;  1RFQ A;  5FPD A;  3C6T A;  4FK4 A;  2XY6 A;  2VG7 A;  3WUH A;  4LF4 K;  1NGH A;  1XI1 A;  4HHT A;  2HST A;  2GEM A;  5IWA K;  3RWU A;  4DSF A;  3TI0 A;  2X6S A;  1LWE A;  3CCU N;  5FDL A;  5EOY A;  5HOO A;  3OYC A;  4DV1 K;  5FLX O;  3G10 A;  1NJW A;  3BDP A;  1Z26 A;  2D0O A;  2NRZ A;  3AVL A;  1RTI A;  4X65 K;  1X3N A;  3OYG A;  3EZ5 A;  4IZ9 A;  3FFI A;  3LAN A;  4JI6 K;  4E1J A;  1NKC A;  4FJI A;  2VWJ A;  4LF8 K;  2P9I B;  3AA5 X;  4J2B A;  4K25 A;  5F2R A;  1HQE A;  3V9S A;  1D8Y A;  2Q0U A;  4ISF A;  3N4P A;  1Q18 A;  3LDL A;  4ZTF A;  4PKI A;  4CEO A;  3W3D A;  4BRD A;  4H8K A;  1GLD G;  1VQ4 N;  2D0C A;  4DQR A;  3OYB A;  1S6P A;  3V1Q A;  4DV4 K;  3H3N O;  4OGE A;  5KGW A;  3UB5 A;  5AQI A;  3K58 A;  3AGK A;  4CJP A;  3I8B A;  1HYV A;  3BGR A;  5HL7 L;  5DM6 L;  3ZSV A;  2DFF A;  1G99 A;  4DQP A;  2Q0R A;  3KKS A;  1OVQ A;  1F21 A;  1JLG A;  2NRX A;  4X66 K;  5A2Q O;  4YOR A;  3GE1 A;  4FM0 A;  4H0Y B;  4AHC A;  4DHY A;  1Y97 A;  4QS9 A;  4QS7 A;  4Z4G A;  1YVN A;  5HRR A;  5LJV A;  5I42 A;  1HYS A;  2E88 A;  2NNW A;  4JKF A;  1NGC A;  4CES A;  1QQN A;  2O8E A;  5KPZ A;  4DV6 K;  2FXU A;  3TSQ A;  1LAV A;  4C8O A;  1J5O A;  3DXK B;  3NH1 A;  3SJJ A;  3CCQ N;  3VGM A;  2HBK A;  3ZT4 A;  1TAQ A;  4KTZ A;  3K5O A;  5AJ3 K;  1NKB A;  3LP1 A;  4IFE A;  1C0T A;  2G8H A;  1ZYQ A;  3UIQ A;  5FPE A;  3OY9 A;  3PX0 A;  2O8E B;  3OYJ A;  4DU1 A;  3AY9 A;  1JXE A;  3MN6 A;  3DI6 A;  1N33 K;  5J1E A;  1EKE A;  3MN5 A;  3FZH A;  3SUQ A;  3O9U A;  4QAG A;  1ATR A;  3O6W A;  4DCH A;  1VSF A;  4FJJ A;  3MEG A;  3L3V A;  1NGJ A;  2DPN A;  3AVG A;  3CQY A;  3PX4 A;  1I39 A;  3CME N;  2V7Z A;  3TSU A;  4HUG A;  4CEF A;  5CE3 A;  4GVM A;  5KGX A;  2G8I A;  3O8M A;  5AFU A;  3CQX A;  4CFB A;  4LSL A;  3L0Q A;  5AR0 A;  4CGH A;  1RGI A;  4KI6 A;  3PSF A;  2RE2 A;  2XY8 A;  2IDO A;  2A6A A;  3ENB A;  1X9S A;  4DB3 A;  3AO5 A;  4EHU A;  1DGK N;  1IH7 A;  1Y64 A;  4I6M B;  3HPO A;  3UKR A;  1UA1 A;  1CZA N;  5KQD A;  5E41 A;  3HVT A;  2P5G A;  2CH6 A;  4DQI A;  2UUC K;  3PO4 A;  4DFP A;  2FLO A;  1A5X A;  2YNI A;  3CXC M;  4JEP A;  1VQ5 N;  3H08 A;  3ZSW A;  1W7A A;  3U4L A;  1SAZ A;  4Z4F A;  2E1Z A;  5JS1 A;  2YNH A;  2DY4 A;  1K8K B;  1K73 O;  3NE6 A;  3SLC A;  4JI5 K;  2E2P A;  3KWI A;  1VSL A;  3UKR B;  4DTR A;  3KLH A;  4IJA A;  4E0D A;  1S22 A;  1BHL A;  1VRT A;  1HKG A;  2YCH A;  3J81 O;  2IVO A;  1WNS A;  3OS1 A;  3A0I X;  1QQM A;  2FBT A;  3J8A A;  4FWL A;  3AO4 A;  1WBB A;  4JK9 A;  1HQU A;  2Q2R A;  4YY3 K;  1NM1 A;  2PFU A;  4FJM A;  4FJ7 A;  2P51 A;  4I7F A;  3OBY A;  2VCP A;  4RTF D;  4A2A A;  3HM9 A;  3H6E A;  3TAQ A;  3QEX A;  3M8S A;  2P9L A;  2VGM A;  4HWI A;  4BE2 A;  1QVG M;  3ULE A;  1O1W A;  3S9H A;  1KCF A;  3RTV A;  3P4I A;  4FVU A;  2ATQ A;  3MAQ A;  3QIO A;  2UXC K;  1W9H A;  1N34 K;  4CEZ A;  2VG5 A;  2KTQ A;  1VQ8 N;  2V51 B;  4H5N A;  4JN4 A;  2LSN A;  4CF8 A;  1NKE A;  3DRP A;  3THX A;  4GVE A;  1LV5 A;  3C7N A;  4H03 B;  3VES A;  3WXJ A;  4BGB A;  3OW2 M;  2BH1 A;  3K5M A;  2GX9 A;  3FZL A;  3C6A A;  2P9L B;  2ZF5 O;  2F8S A;  4KHP K;  3ULE B;  1NBW A;  1NK9 A;  1HYZ A;  3C95 A;  4CJS A;  3EN9 A;  4RCH A;  3O9Q A;  4JI7 K;  2E2O A;  4C8N A;  3DM2 A;  2BGG A;  2WON A;  2A3Z A;  3QBW A;  4BDP A;  3E9P A;  3WEE A;  2PZS A;  1NOZ A;  4RWT A;  4YNQ A;  5KQ8 A;  4Z4C A;  3SAH A;  2ZM6 K;  3CJ1 A;  3CET A;  3OHR A;  4E19 A;  4CED A;  1C6V A;  3QIP A;  3NFA A;  4CFD A;  4IXC A;  4LY7 A;  3MK6 A;  3CCE N;  3ISN C;  3SCX A;  3E66 A;  1WOQ A;  3R3L A;  5CR4 A;  3CCM N;  4LH4 A;  1EXQ A;  4M42 A;  3HRG A;  4O44 A;  3BF3 A;  2P9S B;  1QE1 A;  3DAW A;  1S1X A;  2Z1J A;  1S5J A;  3VQ5 A;  5BRE A;  3SUP A;  1GLA G;  1DT9 A;  3G4S N;  2HBL A;  4QOZ B;  1NGD A;  4GY2 B;  4E7L A;  1GLL O;  3RVC A;  4FSV A;  1NGB A;  4CHQ A;  4CZM A;  1BIU A;  4DG1 A;  4FW1 A;  3HI0 A;  3T19 A;  1SL0 A;  3LPU A;  3SK3 A;  1JL1 A;  1HJR A;  4IOX A;  2UXD K;  3BZC A;  5AQT A;  4B1V A;  2R7Y A;  4ID5 A;  4BR2 A;  1UA0 A;  4MLE A;  3S3O A;  4GNI A;  3SAF A;  4NCA A;  2DTU A;  1UAX A;  3O4N A;  1U49 A;  3LP3 A;  4HVJ A;  4WFB L;  3T7Z A;  1JLF A;  4IG0 A;  3D2E B;  3JS6 A;  3RMD A;  4KRE A;  3VQ9 A;  4JI4 K;  4O5F A;  1VSK A;  3ZT0 A;  1L3U A;  3V1O A;  2HNZ A;  4OPK A;  5AQN A;  1ATN A;  3WXL A;  4KB1 A;  3WNH A;  3DYA A;  2YHY A;  2E6L A;  5AZI A;  3U9D A;  3FFK B;  3RMA A;  3A2F A;  5C24 A;  3M1F A;  4F3T A;  5JVG L;  4O55 A;  1KXP A;  2O8B A;  2GWK A;  3HOS A;  1KC8 O;  3LDN A;  4QCL A;  4O8K A;  2P1J A;  4BRF A;  4C1N I;  4OKE A;  1JXB A;  4GKJ K;  4CHY A;  1LAW A;  2KW4 A;  4JKC A;  4BC4 A;  2P9P A;  2Q31 A;  4DMN A;  2FBY A;  3K0S A;  5KTQ A;  5AZI B;  1ZBH A;  4O0I A;  1KQS M;  1ASW A;  4CJF A;  1ITG A;  3LP0 A;  1JKH A;  3ALY A;  2O8B B;  2FBV A;  3AAR A;  1NU0 A;  4RW9 A;  1JLQ A;  3QB0 A;  3EY1 A;  4GV3 A;  4NXN K;  2F4V K;  1YUW A;  3VF2 A; 
#chains in the Genus database with same CATH homology
 1FJG K;  3J7A P;  1N36 K;  4DR6 K;  3J81 O;  4DR3 K;  1IBM K;  4DV6 K;  4DR4 K;  4JI8 K;  1I94 K;  1IBK K;  5BR8 K;  4CW7 B;  4DV3 K;  4YY3 K;  3J80 O;  4JYA K;  4LFB K;  3J7Y P;  5AJ3 K;  4DUZ K;  2UXD K;  5IT9 O;  5LMU K;  4JI0 K;  4LF4 K;  5IWA K;  4LF6 K;  4LF5 K;  3JAM O;  1HR0 K;  4GKK K;  4YHH K;  4JI1 K;  4CVN E;  2UXC K;  4DV1 K;  5FLX O;  2UU9 K;  4DV2 K;  1N34 K;  1N33 K;  1XNR K;  4DR2 K;  4DV5 K;  4X65 K;  4JI4 K;  2VQE K;  4DUY K;  1IBL K;  3T1H K;  4JI6 K;  4JI3 K;  2UXB K;  4LF8 K;  2E5L K;  4LF9 K;  4B3M K;  4AQY K;  4KHP K;  4X64 K;  4JV5 K;  4NXM K;  4JI7 K;  5LMN K;  5LL6 Z;  3T1Y K;  4DR5 K;  1HNW K;  3OTO K;  2VQF K;  4V19 S;  4DV4 K;  4B3R K;  4OX9 K;  2ZM6 K;  2UUB K;  1XMO K;  4B3S K;  4GKJ K;  4DR7 K;  4JI2 K;  4DV7 K;  2HHH K;  1J5E K;  4LFC K;  1XMQ K;  2UUA K;  2UUC K;  1HNX K;  4K0K K;  4B3T K;  4DR1 K;  4X66 K;  4LF7 K;  5A2Q O;  1HNZ K;  4LFA K;  1N32 K;  4DV0 K;  4X62 K;  4NXN K;  2F4V K;  4JI5 K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...