4DR2K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr2K00
4DV4K 4DV7K 2UUBK 2F4VK 4YY3K 5LL6Z 2UUAK 4JV5K 4LFBK 1HNWK 4GKKK 3J81O 1IBLK 4DV1K 4JI4K 4DR7K 4JI6K 5LMUK 1IBKK 4JI0K 4DR1K 4JI1K 1N33K 2VQEK 4X65K 4NXMK 4LF4K 4YHHK 1N32K 2UXCK 4X62K 4LF8K 4DR3K 2UXBK 4DV0K 4B3TK 2UXDK 4AQYK 1XMQK 1HNXK 4NXNK 3JAMO 4B3SK 4GKJK 4CW7B 1J5EK 4X66K 4CVNE 4JI7K 2UUCK 3J7AP 3OTOK 4JI8K 4DR2K 4LF9K 3J80O 1N36K 1N34K 4X64K 4DV2K 4DV3K 5AJ3K 1FJGK 2ZM6K 2UU9K 3T1HK 1HR0K 4JI3K 5LMNK 5FLXO 4DV5K 4DUYK 2E5LK 4LFCK 5IWAK 5A2QO 4LF7K 4B3MK 5BR8K 2HHHK 1XNRK 4JYAK 1XMOK 4K0KK 4LF6K 5IT9O 4OX9K 4DV6K 4JI2K 4KHPK 1I94K 1HNZK 4LF5K 4DR4K 4LFAK 4DR6K 1IBMK 1XNQK 4JI5K 3J7YP 2VQFK 4DUZK 4V19S 4DR5K 4B3RK 3T1YK
chains in the Genus database with same CATH superfamily
3AVBA 3LAKA 4DTUA 1M1KO 2OPQA 3MMVA 5EY4A 1YTUA 3L6QA 3PUFA 5M1NA 4B9VA 2B6AA 5KRSA 3L2QA 4KB0A 2X78A 1S3XA 1O13A 2GELA 1GLCG 1RT1A 3UIQA 1KXPA 3CM6A 2E6MA 3LDQA 4EHUA 1EX4A 1RBUA 4JHDA 4B9MA 3DI6A 3LAMA 4M45A 3LDNA 3TTCA 4DSFA 3GOIA 1ZYQA 2XHBA 1SS6A 1EKEA 5BRDA 3V9XA 1LCUA 3NH1A 1D9FA 4JRPA 2PY5A 3LWLA 5AFUH 4HCCA 3Q7BA 1EETA 2NRRA 4IWVA 1LAWA 3O9QA 1VSLA 3HM8A 4Z4EA 1NKBA 1LWEA 5AZIA 2G8KA 4B3SK 3FE1A 5KGWA 3AA2A 4JI7K 2P9KB 4CEEA 1ZBHA 1J5OA 1MWKA 1YIJN 4BG8A 3OJUA 3SBGA 1E3MA 4DQ8A 2QWQA 3A5LC 4YDUC 2VG5A 3GG4A 4JAXA 1UOCA 1IKVA 3IMXA 4OGEA 3AV9A 4Z4CA 5AJ3K 2CGKA 2GV9A 4NCBA 5CR4A 3U9DA 3O6WA 5BPLA 1SL1A 4C8LA 4E89A 4EHTA 3HO1A 1KFDA 3H45C 4BDZA 3DLHA 3WEEA 3VN5A 3I55N 4LF7K 3IKMA 4YOYA 4CJKA 3B6OA 3C6AA 2FLOA 3SBTA 4FVMA 3UB5A 3CC2N 3ATVA 4RW8A 2P9LB 4L3QA 4FXDA 4FJKA 1WAJA 3SPYA 1Y97A 2QWOA 1ZBSA 4LY7A 5JVHL 3KKSA 5BRFA 1KC8O 1WBBA 3ISNC 1Z05A 5FPEA 3LZIA 4ICLA 3ID6A 4PKHA 3OYFA 1JJ2M 1FK9A 3NCIA 3S3OA 4YY3K 2HBMA 1BOTO 3U4LA 2XY5A 4ELTA 2KZMA 1BA1A 2HF3A 3OHRA 1IBLK 3HP6A 1UA1A 4AM7A 3AA5X 4C1NK 3FLCO 3MN5A 1N5YA 2ZJQL 3DXMB 3KJVA 3CHWA 4E7HA 1NGGA 5AQSA 5HOOA 1LWFA 5BPNA 1RTIA 2E2OA 5JMVA 2AA4A 4KI4A 3J8AA 5ELZA 2BTFA 2KHOA 4DSJA 4UY8O 2F8TA 1DTQA 3MWTA 4CZKA 2OCEA 4QAGA 3OYCA 2FBYA 3MXJA 4NLBA 3TTDA 3NGZA 4FJHA 1ZBLA 1X3NA 1VSFA 5TKWA 4I6MB 1T6CA 3SQ2A 3B8AX 4BRMA 4DLEA 5EU7A 3VQ4A 3THXA 1IV0A 3VQBA 2W42A 4E7LA 3VGMA 4O44A 1S9GA 1KLNA 3BP8A 4LF9K 4XIUA 3ZSVA 2O8CB 3CFPA 5AFUA 3PO5A 4QCLA 3FZHA 1TAQA 4H0PA 5AQRA 5F0XA 4CF0A 2VG6A 1W7AA 3NH2A 3DLKA 4CEFA 3QERA 2YHBA 3VQPA 3NMUA 3CJBA 2D0AA 2EX3A 2J4RA 2O8DA 5AR0A 3NE6A 3O9SA 4MFBA 4OLBA 2Q3SA 2E8AA 1L5UA 1XNRK 4WFBL 1QVGM 4JI2K 5HRPA 4IOAL 1RBSA 2Z1HA 2W41A 1CXUA 4TSXA 3I33A 2P9IA 1XNQK 1E4FT 2PYJA 3AO1A 4CERA 3AO5A 4CGFA 2HNDA 4IZ9A 4C8MA 2VQFK 2A6AA 2G8UA 1KD1O 4DR5K 1HQEA 3FZMA 3RSEB 4BG9A 2HHXA 1LW2A 4WQ4C 4C23A 3I8BA 2R7YA 4CK1A 1ZXOA 3TTFA 4B9NA 2DFEA 3QIOA 4DMNA 3UE5A 1NGJA 4BDYA 4CFBA 1XWLA 3E9OA 2QWRA 2NRXA 2HHVA 3O1WA 4NB4A 3D45A 2P9KA 4G9ZA 2NRWA 5GAHP 3AVMA 2A42A 3ZT4A 4DWIA 2HOEA 2Y1IA 1Q9XA 3SPZA 1VSIA 3CCRN 3KLEA 5FROA 4Z94A 4FWMA 3O4NA 3AAQA 1VRUA 3IDHA 2JWLA 4ILGB 1Q9YA 1NK8A 2GUPA 3WUHA 5AQMA 4CZJA 2HW3A 5FRNA 1T03A 1QTMA 3HOTA 1XHZA 2NRZA 2JGUA 2V7ZA 3QETA 3I56N 4DS4A 1HLUA 5JS2A 3L3VA 3AA3A 4M3TA 4GY2B 3M8RA 3LANA 1VSHA 1SV5A 3O9TA 1EO1A 2O8BB 3CI5A 3VPZA 2E6LA 3VQ6A 3ZETB 5C24A 1S1UA 4CHQA 2E2QA 3CFOA 4FSVA 4CHOA 3THWB 3SQ1A 1X9MA 2DFHA 4IEEA 4DFJA 3PX0A 4CF2A 1GOBA 1NBWA 3KLIA 4N5SA 3ZT1A 2FF3B 4CEOA 4L8RB 3CETA 3OYAA 5AQTA 1VAZA 1Q7YO 4LF5K 3OYHA 1WNSA 1REVA 3TANA 4EZ9A 2GTDA 3DXMA 4KHUA 3QICA 3C95A 3J7YP 3OBWA 3VQAA 4IG3A 3QNNA 4FLXA 5E26A 2YNFA 4E1JA 3JSMA 3NAEA 3DJCA 5KRTA 1BCMA 2AJQA 3S9HA 4RW9A 5K14A 3SUPA 2QM1A 3M5RA 4CZFA 4FM0A 5J2NA 3GBTA 4F2RA 2GEMA 3L4QA 3H1VX 2V7YA 1SL2A 3ZLJA 4FJ9A 3A0IX 1NNEA 1S1VA 3F9MA 4JI0K 5LJVA 3KWIA 3ASMA 2XY8A 3BZCA 3CXCM 2EHGA 5M1OA 4YNQA 2YNIA 2HBKA 3C0BA 4YHHK 2P5OA 1N32K 1FKPA 2O8CA 3V1QA 1RBTA 5FPNA 5EX5A 4M41A 3CD6N 1KSPA 3P83D 1BA0A 4ELVA 4OO1J 3RMBA 4IFVA 2QXLA 3OS1A 2GUIA 4DQRA 4WCEL 4FWOA 4HWIA 3W0LA 3JAMO 5J2QA 4O8UA 4B8CA 2FSJA 3AARA 5CYMA 1DTTA 1E4GT 4CZHA 4CF8A 2B4JA 2DFFA 3VF6A 3OTOK 3ZT2A 1F21A 1TL3A 2DTUA 1DEJA 3V1OA 4ZHRA 1RDBA 3DLRA 3H46O 3MX2A 3O08A 2RKIA 3MWPA 2ASMA 4DTNA 4DQSA 5BN8A 2O8EB 2PFUA 4EZ6A 5AQWA 1GLEG 3LALA 1VQ6N 3RSEA 3AY9A 5BR8K 1OVYA 4RW4A 4K0KK 3SAGA 2GWJA 2E1ZA 3RMAA 4Z4HA 3NGIA 1XQSC 1Y64A 1T7PA 5CYQA 1TUYA 2BANA 3LDPA 2P9NA 4FK0A 3UKRB 3WNGA 4WYBA 1DLOA 1RDUA 1VQON 3EL2A 1ZBIA 4JKBA 4NCGA 5I3UA 2F8SA 4DLGA 4OPJA 4KBOA 4KO0A 1NM1A 1BHLA 3OJSA 1Q82O 3VQ7A 1ASVA 1N6QA 1KRPA 3CC4N 3O80A 1Q81O 4FWPA 5C10A 1NGCA 1B9DA 4Z0UA 4AH9A 2RHKA 3U9ZA 4IKFA 3ENHA 1NLVA 2Q1NA 3WT0A 3SZ2A 4F2SA 1RDCA 2IOCA 1NGIA 3E9PA 1NGBA 4FLVA 3MX5A 3TSPA 4YOWA 3O1BA 3BZKA 4H03B 1RT2A 4DTRA 2A40A 3OW2M 4LF8K 5FRMA 3BEXA 2O8BA 1HJOA 4IG0A 4JKFA 5KTQA 1HNXK 3ZETA 3LP1A 3E1YA 2A5XA 3E01A 5AQQA 3VMFB 5JICA 4ID1A 4FLZA 2VWKA 2OTLN 3HVRA 4DTSA 4CVNE 4M42A 4DKWA 3T1AA 4O5BA 3HXMA 3AVJA 4B9LA 2Y1JA 2ZGYA 3I0RA 3HJFA 3OA9A 2ZWHA 3DRPA 4KFBA 4M7XA 3U8XA 3QEWA 3CJ1A 4O0IA 4G1QA 3QO9A 4FWSA 2ZM6K 1EWQA 4JI3K 5EVZA 4FM1A 4KPYA 4IJNA 3ULEA 1NKEA 4BR7A 3TARA 4CEZA 4DFKA 2P1JA 1VQ9N 4LF6K 1KVCA 4DQIA 2NUBA 2Q31A 3TR8A 4IOCL 3AVFA 4DR4K 3AA4A 4FW2A 5C25A 1G15A 1U04A 1DGKN 1RNHA 1IO2A 4CFCA 1SKSA 1FXXA 2O4IA 3PV8A 1L3SA 3C7NA 4WE1A 2D0BA 3KK7A 4DV7K 1NK4A 2UUBK 5BR9A 1JCGA 4BRNA 4YOXA 2FF6A 2OZSA 3QBXA 3NBPA 1XC9A 1C0TA 4E3SA 4DTPA 3RMDA 3HOSA 1KVBA 2F9TA 3RMCA 4CHYA 2OPSA 3RRGA 4K8ZA 4HUFA 5LMUK 1RTJA 5HL7L 1LWCA 3I0SA 3T7ZA 4CGIA 4FZXC 3PIOL 3P5JA 3TAQA 3C6UA 4DQPA 1KAZA 3VQCA 4B1XB 2WTUA 1NWKA 3KZBA 4NXMK 3ZX3A 4FWQA 4ZTJA 3VEOA 3CCJN 4WQ4A 2HBLA 1LW0A 4BY9C 3T3FA 3CFRA 4B3TK 4JKHA 4FWLA 1K6YA 4BR4A 4CZIA 3D7EO 4U67L 2LSNA 4CHPA 3G25A 4DTJA 4CBXA 2UUCK 3G0ZA 1LOTB 1S5JA 5C2DA 1YHQN 1IKXA 3HZ6A 4CZLA 4I9LA 4FJGA 3TWHA 2HHUA 2OA8A 1RTHA 1C1AA 1N34K 1C0UA 5FPMA 1IKWA 1T05A 4CIFA 2NRVA 1ZBFA 4CIGA 3ZSYA 5AQXA 3UKRA 5I9EB 2P9SB 3MEDA 5BREA 4J2AA 2IAJA 1HR0K 3LP0A 4BRGA 4KH5A 3VENA 1B92A 3V81A 2ZJRL 3DAWA 4JKGB 1NJXA 3O3HA 1HPZA 1BWFO 2E20A 4FK4A 3ITHA 4PKGA 4FOEA 3CQ8A 1RTDA 1RFQA 4F9OA 5C42A 3KLGA 1WAFA 3AVAA 4EP4A 2JLEA 3M8QA 4IFYA 4DU1A 4Q0BA 4MO4A 2ZQBA 5H1SQ 5I42A 1BGXT 4MO5A 3SK3A 4KTQA 4M3ZA 1HQUA 3U3YA 3VQ5A 1U45A 1WSEA 3P1GA 2IGIA 4FLWA 4DTMA 1LV5A 4JV5K 3HRGA 1RT4A 3AVNA 4XH4A 3VEWA 1U2VB 3AO4A 1J53A 4PKIA 4DR7K 4FLYA 3KK2A 3FZKA 3C65A 2QTDA 1MDUB 3OYIA 4CBWA 4MDBA 1EXQA 1DKGD 4YOUA 3IS9A 1VQLN 2O8FA 1QSLA 1HKCA 2YJEA 1JLCA 4B1UB 4JKEA 1MA9B 3OYMA 4DB3A 5DM6L 4J2DA 4Y1CA 3THYA 1S22A 1JXEA 1RDWX 1NK9A 3L2UA 4FJ8A 2KFNA 4CW7B 4H5TA 3R8EA 2BH1A 2D0CA 3VQ8A 4H5WA 3VESA 5C12A 1IG8A 4B9TA 3A2FA 1J54A 4FJ5A 1VQ7N 4BRCA 4W5NA 1NG9A 4IO9L 4BRPA 1XC3A 1EQYA 4LH5A 1KQSM 5AQLA 3V9ZA 2OYQA 1YF5L 1K8KB 3DLLL 3C94A 4AILC 1I39A 5CZ1A 1NKCA 4JN4A 1I94K 3C6TA 4KHNA 5FPDA 1B9FA 1S1WA 3SUQA 1KFSA 2QEXN 2G8FA 4O4GA 4HTLA 4W5RA 3KK3A 5GIPA 4H0YB 3KTQA 1YVUA 1C0MA 3RWUA 4J8FA 3TAMA 3OYNA 1BI4A 4H0OA 3CJ7A 3TAEA 2RPIA 4DV4K 1UA0A 3LDLA 3CQXA 4B8AB 4CHZA 4KREA 2KFZA 5MLCQ 4H5NA 3U3GA 1NK5A 5E41A 3MK6A 4BREA 4KKOA 4FVUA 1ITGA 2YNHA 1YITN 1L3UA 3D2FB 4A61A 4CJQA 3DYAA 4FLUA 5JS1A 1ILYA 1VQKN 3SV3A 4GNIA 4W5QA 4PUOA 2D5RA 3ID8A 1FW6A 3DRSA 1RT7A 1N33K 1VQNN 1P90A 4R79A 3VQDA 4BRDA 4DTXA 4A5AA 3O9UA 4CGHA 1V4TA 1BQNA 2P9SA 4K43A 4FO0A 1MWMA 4WFAL 4NXNK 3EY1A 1GLBG 3OYKA 1J6ZA 2A41A 1WSJA 4MLEA 3KK1A 1OH7A 5JLFA 2KLAA 4A59A 2D0OA 5M1QA 2WOMA 3LDOA 4JRQA 4FJMA 4FJXA 4JKGA 4GVEA 1C1CA 3D6RA 1N36K 4DV2K 4GV3A 2IS3A 3EEQA 2G8VA 5JVGL 1C0GA 3WQTA 3V6DA 2F9WA 5FLXO 3BUZB 1D4XA 2XO7A 3EZWA 1S9EA 4FM2A 3NGYA 1YT3A 4JYAK 2GWKA 4CBUA 2KQ2A 1CZBA 4DSIA 2P9LA 1SKWA 3HPHA 3HK2A 3RRHA 4BRLA 4K41A 2BGGA 1GLJO 3A5OC 3ZSZA 1U2VA 2IVNA 4ZTFA 3CCMN 5TKYA 4FPBA 4AHSA 4B1ZA 4OPHA 1ATRA 3WNFA 2D1KA 3CF5L 3ZSWA 4EIAA 5C0YA 1TK0A 2F7TA 2W6LA 3A5MC 4BQZA 5GAGP 4OPKA 2UUAK 4LFBK 5AQZA 5HROA 3EZ5A 4FK2A 4C1NI 2YHXA 3VEVA 4J2BA 5AQJA 1NU0A 4N41A 3P4IA 4B9QA 1LAVA 4JI4K 4CIEA 4DU4A 3VTIA 4JI6K 4CJLA 4CJSA 4C8KA 3WXJA 4GV9A 4J2EA 3WNEA 3K5MA 3VQEA 2QA4N 2NLXA 2UXCK 3CJ9A 4PL7A 3R1XA 3WXKA 1RT5A 3KVGA 2UXBK 4DV0K 4YFUA 1I3AA 2QWLA 2UXDK 4AQYK 1YJ9N 2O4GA 1L3TA 4H5RA 1NGAA 3DLBA 3HI0A 4H0TB 4CEAA 4KTWA 2YHWA 1QHTA 4C8NA 2VCPA 4NYNA 4I6MA 3VQQA 4XH5A 3VEZA 1NOZA 1IKYA 5AQGA 5KQ8A 4HHTA 2RE2A 3CMEN 2XY7A 5EOYA 3TU5A 5BPMA 1H1VA 2QK9A 2E4LA 2HMPA 1P8ZA 4CHNA 1W2BM 1IH7A 3F73A 5LMNK 4JS5A 4DV5K 3WXMB 4BR5A 4OKKA 4BROA 5AQOA 3FFIA 3UKUB 1V4SA 1CZAN 1QVFM 1JLFA 4ISEA 4BWMA 3AVHA 4JLHA 3QIPA 1XMOK 4MDAA 1OH5A 1RT3A 4WQ5A 4DV6K 3IAYA 2IC3A 3SQ4A 4KHPK 4O8KA 4RWTA 3P39A 4PWDA 3S3NA 3D2FA 5M1PA 3V1RA 3L0QA 4CJTA 4CK2A 1W97L 4OKEA 4PA1A 1HJRA 4B3RK 1VSKA 3AO3A 1T3VA 4KTZA 2QW9A 1RDAA 2HBJA 1GLLO 3W3DA 3N4QA 2B5JA 1JXBA 5CZ2A 4H5VA 4KHWA 1OKJA 5KPZA 3CERA 3A5NC 4O5FA 4PL8A 3OY9A 3B6PA 4FPAA 3NH0A 2QXFA 3SNNA 3K9JA 5DM7L 1CZ9A 3R3LA 3EE8A 4BGAA 3VA0A 3VETA 4YORA 2YHAA 3OS0A 4KHSA 5HP1A 3TAGA 4CD3A 4DR1K 1TV6A 3I8DA 3OYGA 3EKUA 4BR2A 4AHCA 3VGKA 4LF4K 3CPWM 4I2PA 3LPUA 4WF9L 5J1EA 2ZE2A 3FZFA 2P9UB 3SI6A 4B9SA 2E1YA 4QS7A 2VGNA 3JYTA 3MCAB 4BRHA 1K9MO 2I5JA 3KLFA 1TK5A 1QQOA 3O3GA 4BRAA 4CEQA 1IG9A 2AP1A 4XH1A 3VEYA 4QOZB 5HRSA 2WONA 1HPMA 5AZIB 3S41A 3O3FA 3CCEN 5HBMA 3K0SA 1GOAA 1VQ5N 3NHGA 4NO7A 3DLEA 4B1VA 4CGDA 4GW6A 1RDDA 2HVIA 4JI8K 2NRTA 4IXCA 3NFAA 3HPGA 3U6FA 4QS9A 3IFRA 4DV3K 3BGRA 4HUEA 2QWPA 3OVNA 4DHYA 2QKKA 4BVOA 4JS4A 4FCYA 3NF6A 3E66A 3THWA 1ZC6A 3HL8A 4AHRA 2VG7A 2OPPA 3KIOA 1NK7A 2HHSA 2NRHA 2HHHK 2QWNA 5AZJB 4E7JA 1C0FA 3DM2A 4CJPA 4BRKA 1TKTA 1TYQB 4M3XA 2DPNA 4Z4GA 3QB0A 1JLGA 3WXLA 3WNHA 3OYLA 3HVTA 1NJWA 1A5WA 3QEXA 1T44A 2HB5A 3P31A 1WSFA 4DTOA 2CGJA 4KRFA 3ENBA 2JWKA 2F4VK 2OANA 4DG1A 3EE9A 1BCOA 3KLHA 2Q0UA 5HRNA 1U49A 4UQGA 5HRRA 4BRFA 4PY5A 3DLGA 5D3GA 3C6HA 4OGCA 4B1YB 3DOKA 3VEXA 1NJZA 4CCHA 4FJLA 4AHUA 4OVLA 4KHYA 4DU3A 3AVLA 2G8HA 3V4IA 4OPAA 1A5VA 1QS4A 1VHXA 2Z1GA 1UWBA 3ZSRA 1TKDA 3PSFA 2NZTA 4Y0WA 3KKRA 4DR3K 3ALYA 4K42A 3CC7N 3SYZA 1GLDG 1BL3A 1VSJA 3NVKA 4M3RA 3QMLA 1QSYA 3O4QA 4AHTA 1KCFA 4B08A 3UKUA 1J5EK 3CJAA 3THXB 1K73O 3J7AP 3ZSQA 4DFMA 3ZYYX 4RCHA 3F9KA 3HP9A 3KD5E 1JKHA 1R0AA 3VQ9A 4JD2B 1A5XA 3AVIA 2HHTA 3L4IA 5BN9A 4LD0A 4IJAA 5LJWA 3CMAN 3QEIA 2O8EA 4A2AA 5DK5A 2YCHA 2O8DB 4LFCK 5A2QO 3K5OA 3MN7A 3MN6A 4DF4A 2KZZA 3G10A 4E1NA 4H8KA 3CM5A 3CCQN 4E0DA 4WQ5C 4F3TA 3BF3A 3OYJA 1XUPO 1TVRA 3O5BA 4H4MA 3N4PA 3FR0A 4NYFA 1WB9A 1RGIA 3K5NA 4DR6K 1GLFO 2P9IB 3V9SA 4BACA 3F2KA 2NNWA 1YJNN 2WFBA 4ILJA 4KV8A 4V19S 4KHQA 3HM9A 3E9LA 4F8RA 3BY5A 2ZF5O 2PBDA 2HNYA 5LL6Z 5J2MA 2P9UA 1KAXA 4Q5VA 1WOQA 5E84A 1M90O 3FFKB 4E19A 3ZEUB 3CCUN 4N76A 1YTAA 3TPQA 1L3VA 4BC4A 4CEBA 3SUOA 5CE3A 5AQPA 2X6SA 4RTFD 4JI1K 2WC9A 3CQYA 4CGJA 4DSEA 4MLHA 2HNZA 1KAYA 3T19A 3ZCMA 4CJFA 3V9UA 3IG1A 4FJ7A 5F1XA 1U47A 4LC9B 2HVHA 2PYLA 4JKAA 2BDPA 3ZT0A 3EYZA 1YJWN 1ATSA 1U48A 2G8IA 4OJRA 2KW4A 2PZSA 4CF9A 2Z1IA 3IUCA 4AF1A 4BC3A 2I7NA 3VGLA 1RBRA 1QQCA 1W0HA 3HSTB 1JLEA 5AZJA 4C8OA 3FGUA 1RT6A 4AM6A 3TAPA 1RILA 1TYQA 2Q2RA 4CECA 4K8XA 3ULDA 4CJ3A 5HLFA 1S1XA 3G4SN 4LSLA 1O1WA 1C6VA 2FSKA 3CYMA 3DRRA 5C2FA 1WSHA 2VGMA 3CCSN 3PX4A 1K8AO 4CJEA 3HT3A 3T69A 1BU6O 3KWGA 5ADXH 4HTUA 3G71N 1N8RO 1KVAA 1NGHA 4N47A 2ASOA 1J9AA 3ATUA 3MEEA 3WXIA 1NOYA 4M3YA 4KH4A 3QDKA 5AQNA 2XY6A 1YAGA 3F5TA 2DY4A 2ITGA 4H4OA 4GV6A 3TAFA 1HKGA 3LL3A 1QZ6A 2VWJA 3MEGA 2FBVA 1HYZA 4CE9A 4FYDA 1T6DA 4F4KA 3G6EN 1XI1A 1S6PA 1Q86O 3SJHA 4JI5K 4DF8A 1OH6A 4CZEA 1QQNA 1BUPA 1X9SA 1D5AA 3VF4A 1WBDA 4CJWA 4CD1A 2CH6A 4IOXA 4PHTX 2CGLA 3DMJA 5GINA 1NMNA 4BGBA 1HNWK 4GKKK 4CZGA 1QSSA 3J81O 3TABA 5GAEP 4LH4A 1VSEA 3DOLA 3H3NO 2IVPA 4DV1K 5AQFA 5GIOA 1ASUA 2CH5A 2E2NA 3QFUA 3RVCA 1BISA 2A1SA 5DMRA 4CJ7A 4BE1A 4DQQA 1Z26A 3AGKA 4H0VB 4BWJA 2VQEK 1YUWA 3K9KA 3TI0A 3OYDA 4YOVA 1EP4A 3OYBA 1U6ZA 4RW7A 2XRIA 5SWMA 2ATQA 4JD2A 4JK9A 4E1MA 4Z4FA 4ELUA 3L2RA 1XMQK 5EXWA 4CJ5A 3M1FA 4IO8A 3HPOA 3S3MA 3GDQA 4HVJA 4GKJK 2RN2A 4FJIA 4OLAA 4A62A 1HNIA 1HRHA 5LY3A 4FWKA 1T8EA 5AQHA 1X1PA 3OYEA 1BIUA 3H6EA 3SLCA 3CCVN 2A1RA 3SUNA 4M7YA 4B1WB 2QI2A 4EP5A 2HMIA 3OBYA 2UU9K 1MU2A 3AVCA 1TKXA 1ATNA 4RG8A 3LP3A 5IWAK 1WSGA 1S6QA 1ESVA 4B3MK 1GLAG 1TK8A 1RBVA 2A3ZA 4OKJA 1VSMA 4FWRA 3SAHA 1QQMA 5J2PA 3PLAA 3ZEUA 5M1KA 4Y1DA 2Q97A 5C15A 4E7IA 2P9NB 4IEIA 1TUUA 1DT9A 4K25A 5ADXA 3RR8A 2YJFA 3QBWA 4JKDA 2V51B 4ID5A 4JEPA 3MECA 4FZYA 4M63C 3LZJA 2W6KA 4CJ4A 4BR9A 2OTJN 4F3OA 4CJUA 4HCBA 1NK6A 1W9HA 1WUAA 4ISFA 2IDOA 4IBNA 4CF1A 2WBNA 5F2RA 1JL2A 1OVQA 1NGDA 3BDPA 1VK0A 3L8BA 2GBZA 1IBKK 4CI6A 1TAUA 2Z1JA 3MN9A 2BE2A 3M3ZA 2P9PB 1BDGA 1YXQA 3PSIA 4BE0A 3A8YA 4A5BA 2EWSA 3K59A 5KI6A 2W40A 3PY8A 3AAPA 3HBTA 3R9PA 5BRHA 1VRTA 3O9RA 3VF2A 3HSCA 4FOIA 1ASWA 1HYSA 4A2BA 4CK3A 3QINA 1BO5O 2RF2A 2UYTA 3RTVA 4NCAA 3ZT3A 1VQ4N 4A57A 4JK7A 2OZMA 1CLQA 3SAFA 4BE2A 1WSIA 3P38A 2H3GX 3ZSOA 4KH6A 4M3UA 2F96A 4MQ3A 1X9JA 4O0JA 5M1FA 1JCFA 3MXIA 3SJJA 3PX6A 1JCEA 1SUQA 1HKBA 4DSLA 3M8PA 4FJNA 1Q8IA 4JNEA 1FJGK 2FBTA 1JLQA 1HYVA 2HF4A 3HYFA 5AQYA 3T1HK 3DXKB 2YKMA 1NMDA 2QWMA 3ULEB 2FBXA 1K8KA 3DWLA 4BVPA 1D8YA 4O55A 3M8SA 1Z25A 4B9UA 3VA3A 4DSKA 5IT9O 1SKRA 3H1QA 4OX9K 4FLTA 1EWRA 1QE1A 2WUSA 2BUPA 5T7BA 2KTQA 4BC2A 2X74A 2G8WA 4XEIA 1IBMK 3JXUA 4I7FA 4W5TA 4ILHA 1SZ2A 3CPEA 3SV4A 3VOVA 1CXQA 3D2EB 3C7NB 2Q0RA 3SMSA 1HMVA 4CJRA 3TSQA 4GVMA 4Z4IA 2HHQA 1SL0A 3TSUA 3WQUA 4KB1A 1VQMN 5KPTA 2YNGA 3AVGA 5KPRA 1XHXA 1G99A 2HHWA 5GADP 3V9WA 2E2PA 5KQDA 3LPTA 4AHVA 5KGXA 4BRQA 4X62K 1ZBUA 4JKCA 2YI1A 2P51A 4HUGA 3MAQA 3MCPA 3QEPA 1NK0A 1FKOA 5AQKA 5FDLA 4CFDA 2P5GA 4DS5A 4FW1A 4CESA 4JHDB 4FZZA 4CFAA 1QHAA 1BQMA 4GMJB 1BG3A 4KI6A 1VQPN 4YDUA 4DR2K 4YOTA 4KAZA 3J80O 2HSTA 1VQ8N 4CJVA 4X64K 3NF7A 2YHYA 3K2PA 4WFNL 3CCLN 3ZX0A 3NDKA 4N56A 4DUYK 3EN9A 4EFHA 3RR7A 2E5LK 2PAVA 1BIZA 3EO3A 1SQKA 3PO4A 4QS8A 3AVKA 4BR0A 3LWMA 3ZSXA 1D9DA 1S1TA 2IIRA 1VSDA 5AQIA 4EAHD 4U7BA 1HNZK 3FZLA 1JL1A 4FWNA 5SZTA 4JK8A 4LFAK 3K57A 3LM9A 2X6NA 3NVMA 3KHYA 5AQVA 3SCXA 4W5OA 3J7ZO 2P9PA 3R6MA 2ETJA 2FXUA 3PIPL 3WEEB 3NF8A 3O4WA 3T1YK 4PQUA 2ZJPL 1KLMA 4IDKA 2V52B 2ITMA 3MXMA 1OH8A 3CJCA 4CEDA 1HNVA 3SMPA 1YI2N 3QLHA 4DFPA 1NJIO 1U4BA 4B3OA 1Q18A 3THVA 3OS2A 3D0PA 4RW6A 2QKBA 4BQLA 3AGRA 3QNOA 3GL1A 3M6GA 1TL1A 4IDHA 2FC0A 3O8MA 1X9WA 3AO2A 4X65K 1SAZA 3L2WA 2O8FB 4LSNA 3H08A 2VYPA 3L2VA 3CIPA 4CGGA 1KTQA 4R5PA 3LM2A 3MDQA 3Q7CA 3DXKA 2E88A 3THYB 1RCHA 2YX6A 4DCHA 3NF9A 3LDSA 1TGOA 2YV0X 3HTVA 4X66K 1WLJA 3KD1E 4BRIA 3QFPA 3QESA 4BDPA 1Z6RA 4H0XB 2D0PA 2D4WA 4I9QA 2IVOA 3ENOA 1C1BA 3LP2A 3K58A 3BF1A 2GX9A 2YKNA 1JLBA 3CG7A 5CY4A 1TKZA 5CHIA 1JLAA 3QEVA 1HUXA 5B8HA 1GOCA 2OPRA 3IRXA 2ASPA 3VTHA 2I7PA 3JS6A 1X3MA 1HX1A 4FL9A 4FJJA 3D2EA 2FSNA 2VWBA 3L3UA 4M3WA 2Q36A 3GE1A 1UAXA 4IFEA 1QZ5A 1NJYA 2KKZA 3VERA 4ISGA 5AQUA 2ZD1A 1YVNA 4I2QA 1R59O 3H3OB 3K5LA 2ZGZA 3ZX2A 1NGEA 4DUZK 5JLHA 1IJJA 4CZMA 4BC5A 4E7KA 3SQ0A 1NGFA 1S72N 1WN7A 4NLCA 3EKSA 1BI4B
chains in the Genus database with same CATH topology
4DV4K 4DV7K 2UUBK 2F4VK 4YY3K 5LL6Z 2UUAK 4JV5K 4LFBK 1HNWK 4GKKK 3J81O 1IBLK 4DV1K 4JI4K 4DR7K 4JI6K 5LMUK 1IBKK 4JI0K 4DR1K 4JI1K 1N33K 2VQEK 4X65K 4NXMK 4LF4K 4YHHK 1N32K 2UXCK 4X62K 4LF8K 4DR3K 2UXBK 4DV0K 4B3TK 2UXDK 4AQYK 1XMQK 1HNXK 4NXNK 3JAMO 4B3SK 4GKJK 4CW7B 1J5EK 4X66K 4CVNE 4JI7K 2UUCK 3J7AP 3OTOK 4JI8K 4DR2K 4LF9K 3J80O 1N36K 1N34K 4X64K 4DV2K 4DV3K 5AJ3K 1FJGK 2ZM6K 2UU9K 3T1HK 1HR0K 4JI3K 5LMNK 5FLXO 4DV5K 4DUYK 2E5LK 4LFCK 5IWAK 5A2QO 4LF7K 4B3MK 5BR8K 2HHHK 1XNRK 4JYAK 1XMOK 4K0KK 4LF6K 5IT9O 4OX9K 4DV6K 4JI2K 4KHPK 1I94K 1HNZK 4LF5K 4DR4K 4LFAK 4DR6K 1IBMK 1XNQK 4JI5K 3J7YP 2VQFK 4DUZK 4V19S 4DR5K 4B3RK 3T1YK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 K;  4DV7 K;  2UUB K;  2F4V K;  4YY3 K;  5LL6 Z;  2UUA K;  4JV5 K;  4LFB K;  1HNW K;  4GKK K;  3J81 O;  1IBL K;  4DV1 K;  4JI4 K;  4DR7 K;  4JI6 K;  5LMU K;  1IBK K;  4JI0 K;  4DR1 K;  4JI1 K;  1N33 K;  2VQE K;  4X65 K;  4NXM K;  4LF4 K;  4YHH K;  1N32 K;  2UXC K;  4X62 K;  4LF8 K;  4DR3 K;  2UXB K;  4DV0 K;  4B3T K;  2UXD K;  4AQY K;  1XMQ K;  1HNX K;  4NXN K;  3JAM O;  4B3S K;  4GKJ K;  4CW7 B;  1J5E K;  4X66 K;  4CVN E;  4JI7 K;  2UUC K;  3J7A P;  3OTO K;  4JI8 K;  4DR2 K;  4LF9 K;  3J80 O;  1N36 K;  1N34 K;  4X64 K;  4DV2 K;  4DV3 K;  5AJ3 K;  1FJG K;  2ZM6 K;  2UU9 K;  3T1H K;  1HR0 K;  4JI3 K;  5LMN K;  5FLX O;  4DV5 K;  4DUY K;  2E5L K;  4LFC K;  5IWA K;  5A2Q O;  4LF7 K;  4B3M K;  5BR8 K;  2HHH K;  1XNR K;  4JYA K;  1XMO K;  4K0K K;  4LF6 K;  5IT9 O;  4OX9 K;  4DV6 K;  4JI2 K;  4KHP K;  1I94 K;  1HNZ K;  4LF5 K;  4DR4 K;  4LFA K;  4DR6 K;  1IBM K;  1XNQ K;  4JI5 K;  3J7Y P;  2VQF K;  4DUZ K;  4V19 S;  4DR5 K;  4B3R K;  3T1Y K; 
#chains in the Genus database with same CATH topology
 3AVB A;  3LAK A;  4DTU A;  1M1K O;  2OPQ A;  3MMV A;  5EY4 A;  1YTU A;  3L6Q A;  3PUF A;  5M1N A;  4B9V A;  2B6A A;  5KRS A;  3L2Q A;  4KB0 A;  2X78 A;  1S3X A;  1O13 A;  2GEL A;  1GLC G;  1RT1 A;  3UIQ A;  1KXP A;  3CM6 A;  2E6M A;  3LDQ A;  4EHU A;  1EX4 A;  1RBU A;  4JHD A;  4B9M A;  3DI6 A;  3LAM A;  4M45 A;  3LDN A;  3TTC A;  4DSF A;  3GOI A;  1ZYQ A;  2XHB A;  1SS6 A;  1EKE A;  5BRD A;  3V9X A;  1LCU A;  3NH1 A;  1D9F A;  4JRP A;  2PY5 A;  3LWL A;  5AFU H;  4HCC A;  3Q7B A;  1EET A;  2NRR A;  4IWV A;  1LAW A;  3O9Q A;  1VSL A;  3HM8 A;  4Z4E A;  1NKB A;  1LWE A;  5AZI A;  2G8K A;  4B3S K;  3FE1 A;  5KGW A;  3AA2 A;  4JI7 K;  2P9K B;  4CEE A;  1ZBH A;  1J5O A;  1MWK A;  1YIJ N;  4BG8 A;  3OJU A;  3SBG A;  1E3M A;  4DQ8 A;  2QWQ A;  3A5L C;  4YDU C;  2VG5 A;  3GG4 A;  4JAX A;  1UOC A;  1IKV A;  3IMX A;  4OGE A;  3AV9 A;  4Z4C A;  5AJ3 K;  2CGK A;  2GV9 A;  4NCB A;  5CR4 A;  3U9D A;  3O6W A;  5BPL A;  1SL1 A;  4C8L A;  4E89 A;  4EHT A;  3HO1 A;  1KFD A;  3H45 C;  4BDZ A;  3DLH A;  3WEE A;  3VN5 A;  3I55 N;  4LF7 K;  3IKM A;  4YOY A;  4CJK A;  3B6O A;  3C6A A;  2FLO A;  3SBT A;  4FVM A;  3UB5 A;  3CC2 N;  3ATV A;  4RW8 A;  2P9L B;  4L3Q A;  4FXD A;  4FJK A;  1WAJ A;  3SPY A;  1Y97 A;  2QWO A;  1ZBS A;  4LY7 A;  5JVH L;  3KKS A;  5BRF A;  1KC8 O;  1WBB A;  3ISN C;  1Z05 A;  5FPE A;  3LZI A;  4ICL A;  3ID6 A;  4PKH A;  3OYF A;  1JJ2 M;  1FK9 A;  3NCI A;  3S3O A;  4YY3 K;  2HBM A;  1BOT O;  3U4L A;  2XY5 A;  4ELT A;  2KZM A;  1BA1 A;  2HF3 A;  3OHR A;  1IBL K;  3HP6 A;  1UA1 A;  4AM7 A;  3AA5 X;  4C1N K;  3FLC O;  3MN5 A;  1N5Y A;  2ZJQ L;  3DXM B;  3KJV A;  3CHW A;  4E7H A;  1NGG A;  5AQS A;  5HOO A;  1LWF A;  5BPN A;  1RTI A;  2E2O A;  5JMV A;  2AA4 A;  4KI4 A;  3J8A A;  5ELZ A;  2BTF A;  2KHO A;  4DSJ A;  4UY8 O;  2F8T A;  1DTQ A;  3MWT A;  4CZK A;  2OCE A;  4QAG A;  3OYC A;  2FBY A;  3MXJ A;  4NLB A;  3TTD A;  3NGZ A;  4FJH A;  1ZBL A;  1X3N A;  1VSF A;  5TKW A;  4I6M B;  1T6C A;  3SQ2 A;  3B8A X;  4BRM A;  4DLE A;  5EU7 A;  3VQ4 A;  3THX A;  1IV0 A;  3VQB A;  2W42 A;  4E7L A;  3VGM A;  4O44 A;  1S9G A;  1KLN A;  3BP8 A;  4LF9 K;  4XIU A;  3ZSV A;  2O8C B;  3CFP A;  5AFU A;  3PO5 A;  4QCL A;  3FZH A;  1TAQ A;  4H0P A;  5AQR A;  5F0X A;  4CF0 A;  2VG6 A;  1W7A A;  3NH2 A;  3DLK A;  4CEF A;  3QER A;  2YHB A;  3VQP A;  3NMU A;  3CJB A;  2D0A A;  2EX3 A;  2J4R A;  2O8D A;  5AR0 A;  3NE6 A;  3O9S A;  4MFB A;  4OLB A;  2Q3S A;  2E8A A;  1L5U A;  1XNR K;  4WFB L;  1QVG M;  4JI2 K;  5HRP A;  4IOA L;  1RBS A;  2Z1H A;  2W41 A;  1CXU A;  4TSX A;  3I33 A;  2P9I A;  1XNQ K;  1E4F T;  2PYJ A;  3AO1 A;  4CER A;  3AO5 A;  4CGF A;  2HND A;  4IZ9 A;  4C8M A;  2VQF K;  2A6A A;  2G8U A;  1KD1 O;  4DR5 K;  1HQE A;  3FZM A;  3RSE B;  4BG9 A;  2HHX A;  1LW2 A;  4WQ4 C;  4C23 A;  3I8B A;  2R7Y A;  4CK1 A;  1ZXO A;  3TTF A;  4B9N A;  2DFE A;  3QIO A;  4DMN A;  3UE5 A;  1NGJ A;  4BDY A;  4CFB A;  1XWL A;  3E9O A;  2QWR A;  2NRX A;  2HHV A;  3O1W A;  4NB4 A;  3D45 A;  2P9K A;  4G9Z A;  2NRW A;  5GAH P;  3AVM A;  2A42 A;  3ZT4 A;  4DWI A;  2HOE A;  2Y1I A;  1Q9X A;  3SPZ A;  1VSI A;  3CCR N;  3KLE A;  5FRO A;  4Z94 A;  4FWM A;  3O4N A;  3AAQ A;  1VRU A;  3IDH A;  2JWL A;  4ILG B;  1Q9Y A;  1NK8 A;  2GUP A;  3WUH A;  5AQM A;  4CZJ A;  2HW3 A;  5FRN A;  1T03 A;  1QTM A;  3HOT A;  1XHZ A;  2NRZ A;  2JGU A;  2V7Z A;  3QET A;  3I56 N;  4DS4 A;  1HLU A;  5JS2 A;  3L3V A;  3AA3 A;  4M3T A;  4GY2 B;  3M8R A;  3LAN A;  1VSH A;  1SV5 A;  3O9T A;  1EO1 A;  2O8B B;  3CI5 A;  3VPZ A;  2E6L A;  3VQ6 A;  3ZET B;  5C24 A;  1S1U A;  4CHQ A;  2E2Q A;  3CFO A;  4FSV A;  4CHO A;  3THW B;  3SQ1 A;  1X9M A;  2DFH A;  4IEE A;  4DFJ A;  3PX0 A;  4CF2 A;  1GOB A;  1NBW A;  3KLI A;  4N5S A;  3ZT1 A;  2FF3 B;  4CEO A;  4L8R B;  3CET A;  3OYA A;  5AQT A;  1VAZ A;  1Q7Y O;  4LF5 K;  3OYH A;  1WNS A;  1REV A;  3TAN A;  4EZ9 A;  2GTD A;  3DXM A;  4KHU A;  3QIC A;  3C95 A;  3J7Y P;  3OBW A;  3VQA A;  4IG3 A;  3QNN A;  4FLX A;  5E26 A;  2YNF A;  4E1J A;  3JSM A;  3NAE A;  3DJC A;  5KRT A;  1BCM A;  2AJQ A;  3S9H A;  4RW9 A;  5K14 A;  3SUP A;  2QM1 A;  3M5R A;  4CZF A;  4FM0 A;  5J2N A;  3GBT A;  4F2R A;  2GEM A;  3L4Q A;  3H1V X;  2V7Y A;  1SL2 A;  3ZLJ A;  4FJ9 A;  3A0I X;  1NNE A;  1S1V A;  3F9M A;  4JI0 K;  5LJV A;  3KWI A;  3ASM A;  2XY8 A;  3BZC A;  3CXC M;  2EHG A;  5M1O A;  4YNQ A;  2YNI A;  2HBK A;  3C0B A;  4YHH K;  2P5O A;  1N32 K;  1FKP A;  2O8C A;  3V1Q A;  1RBT A;  5FPN A;  5EX5 A;  4M41 A;  3CD6 N;  1KSP A;  3P83 D;  1BA0 A;  4ELV A;  4OO1 J;  3RMB A;  4IFV A;  2QXL A;  3OS1 A;  2GUI A;  4DQR A;  4WCE L;  4FWO A;  4HWI A;  3W0L A;  3JAM O;  5J2Q A;  4O8U A;  4B8C A;  2FSJ A;  3AAR A;  5CYM A;  1DTT A;  1E4G T;  4CZH A;  4CF8 A;  2B4J A;  2DFF A;  3VF6 A;  3OTO K;  3ZT2 A;  1F21 A;  1TL3 A;  2DTU A;  1DEJ A;  3V1O A;  4ZHR A;  1RDB A;  3DLR A;  3H46 O;  3MX2 A;  3O08 A;  2RKI A;  3MWP A;  2ASM A;  4DTN A;  4DQS A;  5BN8 A;  2O8E B;  2PFU A;  4EZ6 A;  5AQW A;  1GLE G;  3LAL A;  1VQ6 N;  3RSE A;  3AY9 A;  5BR8 K;  1OVY A;  4RW4 A;  4K0K K;  3SAG A;  2GWJ A;  2E1Z A;  3RMA A;  4Z4H A;  3NGI A;  1XQS C;  1Y64 A;  1T7P A;  5CYQ A;  1TUY A;  2BAN A;  3LDP A;  2P9N A;  4FK0 A;  3UKR B;  3WNG A;  4WYB A;  1DLO A;  1RDU A;  1VQO N;  3EL2 A;  1ZBI A;  4JKB A;  4NCG A;  5I3U A;  2F8S A;  4DLG A;  4OPJ A;  4KBO A;  4KO0 A;  1NM1 A;  1BHL A;  3OJS A;  1Q82 O;  3VQ7 A;  1ASV A;  1N6Q A;  1KRP A;  3CC4 N;  3O80 A;  1Q81 O;  4FWP A;  5C10 A;  1NGC A;  1B9D A;  4Z0U A;  4AH9 A;  2RHK A;  3U9Z A;  4IKF A;  3ENH A;  1NLV A;  2Q1N A;  3WT0 A;  3SZ2 A;  4F2S A;  1RDC A;  2IOC A;  1NGI A;  3E9P A;  1NGB A;  4FLV A;  3MX5 A;  3TSP A;  4YOW A;  3O1B A;  3BZK A;  4H03 B;  1RT2 A;  4DTR A;  2A40 A;  3OW2 M;  4LF8 K;  5FRM A;  3BEX A;  2O8B A;  1HJO A;  4IG0 A;  4JKF A;  5KTQ A;  1HNX K;  3ZET A;  3LP1 A;  3E1Y A;  2A5X A;  3E01 A;  5AQQ A;  3VMF B;  5JIC A;  4ID1 A;  4FLZ A;  2VWK A;  2OTL N;  3HVR A;  4DTS A;  4CVN E;  4M42 A;  4DKW A;  3T1A A;  4O5B A;  3HXM A;  3AVJ A;  4B9L A;  2Y1J A;  2ZGY A;  3I0R A;  3HJF A;  3OA9 A;  2ZWH A;  3DRP A;  4KFB A;  4M7X A;  3U8X A;  3QEW A;  3CJ1 A;  4O0I A;  4G1Q A;  3QO9 A;  4FWS A;  2ZM6 K;  1EWQ A;  4JI3 K;  5EVZ A;  4FM1 A;  4KPY A;  4IJN A;  3ULE A;  1NKE A;  4BR7 A;  3TAR A;  4CEZ A;  4DFK A;  2P1J A;  1VQ9 N;  4LF6 K;  1KVC A;  4DQI A;  2NUB A;  2Q31 A;  3TR8 A;  4IOC L;  3AVF A;  4DR4 K;  3AA4 A;  4FW2 A;  5C25 A;  1G15 A;  1U04 A;  1DGK N;  1RNH A;  1IO2 A;  4CFC A;  1SKS A;  1FXX A;  2O4I A;  3PV8 A;  1L3S A;  3C7N A;  4WE1 A;  2D0B A;  3KK7 A;  4DV7 K;  1NK4 A;  2UUB K;  5BR9 A;  1JCG A;  4BRN A;  4YOX A;  2FF6 A;  2OZS A;  3QBX A;  3NBP A;  1XC9 A;  1C0T A;  4E3S A;  4DTP A;  3RMD A;  3HOS A;  1KVB A;  2F9T A;  3RMC A;  4CHY A;  2OPS A;  3RRG A;  4K8Z A;  4HUF A;  5LMU K;  1RTJ A;  5HL7 L;  1LWC A;  3I0S A;  3T7Z A;  4CGI A;  4FZX C;  3PIO L;  3P5J A;  3TAQ A;  3C6U A;  4DQP A;  1KAZ A;  3VQC A;  4B1X B;  2WTU A;  1NWK A;  3KZB A;  4NXM K;  3ZX3 A;  4FWQ A;  4ZTJ A;  3VEO A;  3CCJ N;  4WQ4 A;  2HBL A;  1LW0 A;  4BY9 C;  3T3F A;  3CFR A;  4B3T K;  4JKH A;  4FWL A;  1K6Y A;  4BR4 A;  4CZI A;  3D7E O;  4U67 L;  2LSN A;  4CHP A;  3G25 A;  4DTJ A;  4CBX A;  2UUC K;  3G0Z A;  1LOT B;  1S5J A;  5C2D A;  1YHQ N;  1IKX A;  3HZ6 A;  4CZL A;  4I9L A;  4FJG A;  3TWH A;  2HHU A;  2OA8 A;  1RTH A;  1C1A A;  1N34 K;  1C0U A;  5FPM A;  1IKW A;  1T05 A;  4CIF A;  2NRV A;  1ZBF A;  4CIG A;  3ZSY A;  5AQX A;  3UKR A;  5I9E B;  2P9S B;  3MED A;  5BRE A;  4J2A A;  2IAJ A;  1HR0 K;  3LP0 A;  4BRG A;  4KH5 A;  3VEN A;  1B92 A;  3V81 A;  2ZJR L;  3DAW A;  4JKG B;  1NJX A;  3O3H A;  1HPZ A;  1BWF O;  2E20 A;  4FK4 A;  3ITH A;  4PKG A;  4FOE A;  3CQ8 A;  1RTD A;  1RFQ A;  4F9O A;  5C42 A;  3KLG A;  1WAF A;  3AVA A;  4EP4 A;  2JLE A;  3M8Q A;  4IFY A;  4DU1 A;  4Q0B A;  4MO4 A;  2ZQB A;  5H1S Q;  5I42 A;  1BGX T;  4MO5 A;  3SK3 A;  4KTQ A;  4M3Z A;  1HQU A;  3U3Y A;  3VQ5 A;  1U45 A;  1WSE A;  3P1G A;  2IGI A;  4FLW A;  4DTM A;  1LV5 A;  4JV5 K;  3HRG A;  1RT4 A;  3AVN A;  4XH4 A;  3VEW A;  1U2V B;  3AO4 A;  1J53 A;  4PKI A;  4DR7 K;  4FLY A;  3KK2 A;  3FZK A;  3C65 A;  2QTD A;  1MDU B;  3OYI A;  4CBW A;  4MDB A;  1EXQ A;  1DKG D;  4YOU A;  3IS9 A;  1VQL N;  2O8F A;  1QSL A;  1HKC A;  2YJE A;  1JLC A;  4B1U B;  4JKE A;  1MA9 B;  3OYM A;  4DB3 A;  5DM6 L;  4J2D A;  4Y1C A;  3THY A;  1S22 A;  1JXE A;  1RDW X;  1NK9 A;  3L2U A;  4FJ8 A;  2KFN A;  4CW7 B;  4H5T A;  3R8E A;  2BH1 A;  2D0C A;  3VQ8 A;  4H5W A;  3VES A;  5C12 A;  1IG8 A;  4B9T A;  3A2F A;  1J54 A;  4FJ5 A;  1VQ7 N;  4BRC A;  4W5N A;  1NG9 A;  4IO9 L;  4BRP A;  1XC3 A;  1EQY A;  4LH5 A;  1KQS M;  5AQL A;  3V9Z A;  2OYQ A;  1YF5 L;  1K8K B;  3DLL L;  3C94 A;  4AIL C;  1I39 A;  5CZ1 A;  1NKC A;  4JN4 A;  1I94 K;  3C6T A;  4KHN A;  5FPD A;  1B9F A;  1S1W A;  3SUQ A;  1KFS A;  2QEX N;  2G8F A;  4O4G A;  4HTL A;  4W5R A;  3KK3 A;  5GIP A;  4H0Y B;  3KTQ A;  1YVU A;  1C0M A;  3RWU A;  4J8F A;  3TAM A;  3OYN A;  1BI4 A;  4H0O A;  3CJ7 A;  3TAE A;  2RPI A;  4DV4 K;  1UA0 A;  3LDL A;  3CQX A;  4B8A B;  4CHZ A;  4KRE A;  2KFZ A;  5MLC Q;  4H5N A;  3U3G A;  1NK5 A;  5E41 A;  3MK6 A;  4BRE A;  4KKO A;  4FVU A;  1ITG A;  2YNH A;  1YIT N;  1L3U A;  3D2F B;  4A61 A;  4CJQ A;  3DYA A;  4FLU A;  5JS1 A;  1ILY A;  1VQK N;  3SV3 A;  4GNI A;  4W5Q A;  4PUO A;  2D5R A;  3ID8 A;  1FW6 A;  3DRS A;  1RT7 A;  1N33 K;  1VQN N;  1P90 A;  4R79 A;  3VQD A;  4BRD A;  4DTX A;  4A5A A;  3O9U A;  4CGH A;  1V4T A;  1BQN A;  2P9S A;  4K43 A;  4FO0 A;  1MWM A;  4WFA L;  4NXN K;  3EY1 A;  1GLB G;  3OYK A;  1J6Z A;  2A41 A;  1WSJ A;  4MLE A;  3KK1 A;  1OH7 A;  5JLF A;  2KLA A;  4A59 A;  2D0O A;  5M1Q A;  2WOM A;  3LDO A;  4JRQ A;  4FJM A;  4FJX A;  4JKG A;  4GVE A;  1C1C A;  3D6R A;  1N36 K;  4DV2 K;  4GV3 A;  2IS3 A;  3EEQ A;  2G8V A;  5JVG L;  1C0G A;  3WQT A;  3V6D A;  2F9W A;  5FLX O;  3BUZ B;  1D4X A;  2XO7 A;  3EZW A;  1S9E A;  4FM2 A;  3NGY A;  1YT3 A;  4JYA K;  2GWK A;  4CBU A;  2KQ2 A;  1CZB A;  4DSI A;  2P9L A;  1SKW A;  3HPH A;  3HK2 A;  3RRH A;  4BRL A;  4K41 A;  2BGG A;  1GLJ O;  3A5O C;  3ZSZ A;  1U2V A;  2IVN A;  4ZTF A;  3CCM N;  5TKY A;  4FPB A;  4AHS A;  4B1Z A;  4OPH A;  1ATR A;  3WNF A;  2D1K A;  3CF5 L;  3ZSW A;  4EIA A;  5C0Y A;  1TK0 A;  2F7T A;  2W6L A;  3A5M C;  4BQZ A;  5GAG P;  4OPK A;  2UUA K;  4LFB K;  5AQZ A;  5HRO A;  3EZ5 A;  4FK2 A;  4C1N I;  2YHX A;  3VEV A;  4J2B A;  5AQJ A;  1NU0 A;  4N41 A;  3P4I A;  4B9Q A;  1LAV A;  4JI4 K;  4CIE A;  4DU4 A;  3VTI A;  4JI6 K;  4CJL A;  4CJS A;  4C8K A;  3WXJ A;  4GV9 A;  4J2E A;  3WNE A;  3K5M A;  3VQE A;  2QA4 N;  2NLX A;  2UXC K;  3CJ9 A;  4PL7 A;  3R1X A;  3WXK A;  1RT5 A;  3KVG A;  2UXB K;  4DV0 K;  4YFU A;  1I3A A;  2QWL A;  2UXD K;  4AQY K;  1YJ9 N;  2O4G A;  1L3T A;  4H5R A;  1NGA A;  3DLB A;  3HI0 A;  4H0T B;  4CEA A;  4KTW A;  2YHW A;  1QHT A;  4C8N A;  2VCP A;  4NYN A;  4I6M A;  3VQQ A;  4XH5 A;  3VEZ A;  1NOZ A;  1IKY A;  5AQG A;  5KQ8 A;  4HHT A;  2RE2 A;  3CME N;  2XY7 A;  5EOY A;  3TU5 A;  5BPM A;  1H1V A;  2QK9 A;  2E4L A;  2HMP A;  1P8Z A;  4CHN A;  1W2B M;  1IH7 A;  3F73 A;  5LMN K;  4JS5 A;  4DV5 K;  3WXM B;  4BR5 A;  4OKK A;  4BRO A;  5AQO A;  3FFI A;  3UKU B;  1V4S A;  1CZA N;  1QVF M;  1JLF A;  4ISE A;  4BWM A;  3AVH A;  4JLH A;  3QIP A;  1XMO K;  4MDA A;  1OH5 A;  1RT3 A;  4WQ5 A;  4DV6 K;  3IAY A;  2IC3 A;  3SQ4 A;  4KHP K;  4O8K A;  4RWT A;  3P39 A;  4PWD A;  3S3N A;  3D2F A;  5M1P A;  3V1R A;  3L0Q A;  4CJT A;  4CK2 A;  1W97 L;  4OKE A;  4PA1 A;  1HJR A;  4B3R K;  1VSK A;  3AO3 A;  1T3V A;  4KTZ A;  2QW9 A;  1RDA A;  2HBJ A;  1GLL O;  3W3D A;  3N4Q A;  2B5J A;  1JXB A;  5CZ2 A;  4H5V A;  4KHW A;  1OKJ A;  5KPZ A;  3CER A;  3A5N C;  4O5F A;  4PL8 A;  3OY9 A;  3B6P A;  4FPA A;  3NH0 A;  2QXF A;  3SNN A;  3K9J A;  5DM7 L;  1CZ9 A;  3R3L A;  3EE8 A;  4BGA A;  3VA0 A;  3VET A;  4YOR A;  2YHA A;  3OS0 A;  4KHS A;  5HP1 A;  3TAG A;  4CD3 A;  4DR1 K;  1TV6 A;  3I8D A;  3OYG A;  3EKU A;  4BR2 A;  4AHC A;  3VGK A;  4LF4 K;  3CPW M;  4I2P A;  3LPU A;  4WF9 L;  5J1E A;  2ZE2 A;  3FZF A;  2P9U B;  3SI6 A;  4B9S A;  2E1Y A;  4QS7 A;  2VGN A;  3JYT A;  3MCA B;  4BRH A;  1K9M O;  2I5J A;  3KLF A;  1TK5 A;  1QQO A;  3O3G A;  4BRA A;  4CEQ A;  1IG9 A;  2AP1 A;  4XH1 A;  3VEY A;  4QOZ B;  5HRS A;  2WON A;  1HPM A;  5AZI B;  3S41 A;  3O3F A;  3CCE N;  5HBM A;  3K0S A;  1GOA A;  1VQ5 N;  3NHG A;  4NO7 A;  3DLE A;  4B1V A;  4CGD A;  4GW6 A;  1RDD A;  2HVI A;  4JI8 K;  2NRT A;  4IXC A;  3NFA A;  3HPG A;  3U6F A;  4QS9 A;  3IFR A;  4DV3 K;  3BGR A;  4HUE A;  2QWP A;  3OVN A;  4DHY A;  2QKK A;  4BVO A;  4JS4 A;  4FCY A;  3NF6 A;  3E66 A;  3THW A;  1ZC6 A;  3HL8 A;  4AHR A;  2VG7 A;  2OPP A;  3KIO A;  1NK7 A;  2HHS A;  2NRH A;  2HHH K;  2QWN A;  5AZJ B;  4E7J A;  1C0F A;  3DM2 A;  4CJP A;  4BRK A;  1TKT A;  1TYQ B;  4M3X A;  2DPN A;  4Z4G A;  3QB0 A;  1JLG A;  3WXL A;  3WNH A;  3OYL A;  3HVT A;  1NJW A;  1A5W A;  3QEX A;  1T44 A;  2HB5 A;  3P31 A;  1WSF A;  4DTO A;  2CGJ A;  4KRF A;  3ENB A;  2JWK A;  2F4V K;  2OAN A;  4DG1 A;  3EE9 A;  1BCO A;  3KLH A;  2Q0U A;  5HRN A;  1U49 A;  4UQG A;  5HRR A;  4BRF A;  4PY5 A;  3DLG A;  5D3G A;  3C6H A;  4OGC A;  4B1Y B;  3DOK A;  3VEX A;  1NJZ A;  4CCH A;  4FJL A;  4AHU A;  4OVL A;  4KHY A;  4DU3 A;  3AVL A;  2G8H A;  3V4I A;  4OPA A;  1A5V A;  1QS4 A;  1VHX A;  2Z1G A;  1UWB A;  3ZSR A;  1TKD A;  3PSF A;  2NZT A;  4Y0W A;  3KKR A;  4DR3 K;  3ALY A;  4K42 A;  3CC7 N;  3SYZ A;  1GLD G;  1BL3 A;  1VSJ A;  3NVK A;  4M3R A;  3QML A;  1QSY A;  3O4Q A;  4AHT A;  1KCF A;  4B08 A;  3UKU A;  1J5E K;  3CJA A;  3THX B;  1K73 O;  3J7A P;  3ZSQ A;  4DFM A;  3ZYY X;  4RCH A;  3F9K A;  3HP9 A;  3KD5 E;  1JKH A;  1R0A A;  3VQ9 A;  4JD2 B;  1A5X A;  3AVI A;  2HHT A;  3L4I A;  5BN9 A;  4LD0 A;  4IJA A;  5LJW A;  3CMA N;  3QEI A;  2O8E A;  4A2A A;  5DK5 A;  2YCH A;  2O8D B;  4LFC K;  5A2Q O;  3K5O A;  3MN7 A;  3MN6 A;  4DF4 A;  2KZZ A;  3G10 A;  4E1N A;  4H8K A;  3CM5 A;  3CCQ N;  4E0D A;  4WQ5 C;  4F3T A;  3BF3 A;  3OYJ A;  1XUP O;  1TVR A;  3O5B A;  4H4M A;  3N4P A;  3FR0 A;  4NYF A;  1WB9 A;  1RGI A;  3K5N A;  4DR6 K;  1GLF O;  2P9I B;  3V9S A;  4BAC A;  3F2K A;  2NNW A;  1YJN N;  2WFB A;  4ILJ A;  4KV8 A;  4V19 S;  4KHQ A;  3HM9 A;  3E9L A;  4F8R A;  3BY5 A;  2ZF5 O;  2PBD A;  2HNY A;  5LL6 Z;  5J2M A;  2P9U A;  1KAX A;  4Q5V A;  1WOQ A;  5E84 A;  1M90 O;  3FFK B;  4E19 A;  3ZEU B;  3CCU N;  4N76 A;  1YTA A;  3TPQ A;  1L3V A;  4BC4 A;  4CEB A;  3SUO A;  5CE3 A;  5AQP A;  2X6S A;  4RTF D;  4JI1 K;  2WC9 A;  3CQY A;  4CGJ A;  4DSE A;  4MLH A;  2HNZ A;  1KAY A;  3T19 A;  3ZCM A;  4CJF A;  3V9U A;  3IG1 A;  4FJ7 A;  5F1X A;  1U47 A;  4LC9 B;  2HVH A;  2PYL A;  4JKA A;  2BDP A;  3ZT0 A;  3EYZ A;  1YJW N;  1ATS A;  1U48 A;  2G8I A;  4OJR A;  2KW4 A;  2PZS A;  4CF9 A;  2Z1I A;  3IUC A;  4AF1 A;  4BC3 A;  2I7N A;  3VGL A;  1RBR A;  1QQC A;  1W0H A;  3HST B;  1JLE A;  5AZJ A;  4C8O A;  3FGU A;  1RT6 A;  4AM6 A;  3TAP A;  1RIL A;  1TYQ A;  2Q2R A;  4CEC A;  4K8X A;  3ULD A;  4CJ3 A;  5HLF A;  1S1X A;  3G4S N;  4LSL A;  1O1W A;  1C6V A;  2FSK A;  3CYM A;  3DRR A;  5C2F A;  1WSH A;  2VGM A;  3CCS N;  3PX4 A;  1K8A O;  4CJE A;  3HT3 A;  3T69 A;  1BU6 O;  3KWG A;  5ADX H;  4HTU A;  3G71 N;  1N8R O;  1KVA A;  1NGH A;  4N47 A;  2ASO A;  1J9A A;  3ATU A;  3MEE A;  3WXI A;  1NOY A;  4M3Y A;  4KH4 A;  3QDK A;  5AQN A;  2XY6 A;  1YAG A;  3F5T A;  2DY4 A;  2ITG A;  4H4O A;  4GV6 A;  3TAF A;  1HKG A;  3LL3 A;  1QZ6 A;  2VWJ A;  3MEG A;  2FBV A;  1HYZ A;  4CE9 A;  4FYD A;  1T6D A;  4F4K A;  3G6E N;  1XI1 A;  1S6P A;  1Q86 O;  3SJH A;  4JI5 K;  4DF8 A;  1OH6 A;  4CZE A;  1QQN A;  1BUP A;  1X9S A;  1D5A A;  3VF4 A;  1WBD A;  4CJW A;  4CD1 A;  2CH6 A;  4IOX A;  4PHT X;  2CGL A;  3DMJ A;  5GIN A;  1NMN A;  4BGB A;  1HNW K;  4GKK K;  4CZG A;  1QSS A;  3J81 O;  3TAB A;  5GAE P;  4LH4 A;  1VSE A;  3DOL A;  3H3N O;  2IVP A;  4DV1 K;  5AQF A;  5GIO A;  1ASU A;  2CH5 A;  2E2N A;  3QFU A;  3RVC A;  1BIS A;  2A1S A;  5DMR A;  4CJ7 A;  4BE1 A;  4DQQ A;  1Z26 A;  3AGK A;  4H0V B;  4BWJ A;  2VQE K;  1YUW A;  3K9K A;  3TI0 A;  3OYD A;  4YOV A;  1EP4 A;  3OYB A;  1U6Z A;  4RW7 A;  2XRI A;  5SWM A;  2ATQ A;  4JD2 A;  4JK9 A;  4E1M A;  4Z4F A;  4ELU A;  3L2R A;  1XMQ K;  5EXW A;  4CJ5 A;  3M1F A;  4IO8 A;  3HPO A;  3S3M A;  3GDQ A;  4HVJ A;  4GKJ K;  2RN2 A;  4FJI A;  4OLA A;  4A62 A;  1HNI A;  1HRH A;  5LY3 A;  4FWK A;  1T8E A;  5AQH A;  1X1P A;  3OYE A;  1BIU A;  3H6E A;  3SLC A;  3CCV N;  2A1R A;  3SUN A;  4M7Y A;  4B1W B;  2QI2 A;  4EP5 A;  2HMI A;  3OBY A;  2UU9 K;  1MU2 A;  3AVC A;  1TKX A;  1ATN A;  4RG8 A;  3LP3 A;  5IWA K;  1WSG A;  1S6Q A;  1ESV A;  4B3M K;  1GLA G;  1TK8 A;  1RBV A;  2A3Z A;  4OKJ A;  1VSM A;  4FWR A;  3SAH A;  1QQM A;  5J2P A;  3PLA A;  3ZEU A;  5M1K A;  4Y1D A;  2Q97 A;  5C15 A;  4E7I A;  2P9N B;  4IEI A;  1TUU A;  1DT9 A;  4K25 A;  5ADX A;  3RR8 A;  2YJF A;  3QBW A;  4JKD A;  2V51 B;  4ID5 A;  4JEP A;  3MEC A;  4FZY A;  4M63 C;  3LZJ A;  2W6K A;  4CJ4 A;  4BR9 A;  2OTJ N;  4F3O A;  4CJU A;  4HCB A;  1NK6 A;  1W9H A;  1WUA A;  4ISF A;  2IDO A;  4IBN A;  4CF1 A;  2WBN A;  5F2R A;  1JL2 A;  1OVQ A;  1NGD A;  3BDP A;  1VK0 A;  3L8B A;  2GBZ A;  1IBK K;  4CI6 A;  1TAU A;  2Z1J A;  3MN9 A;  2BE2 A;  3M3Z A;  2P9P B;  1BDG A;  1YXQ A;  3PSI A;  4BE0 A;  3A8Y A;  4A5B A;  2EWS A;  3K59 A;  5KI6 A;  2W40 A;  3PY8 A;  3AAP A;  3HBT A;  3R9P A;  5BRH A;  1VRT A;  3O9R A;  3VF2 A;  3HSC A;  4FOI A;  1ASW A;  1HYS A;  4A2B A;  4CK3 A;  3QIN A;  1BO5 O;  2RF2 A;  2UYT A;  3RTV A;  4NCA A;  3ZT3 A;  1VQ4 N;  4A57 A;  4JK7 A;  2OZM A;  1CLQ A;  3SAF A;  4BE2 A;  1WSI A;  3P38 A;  2H3G X;  3ZSO A;  4KH6 A;  4M3U A;  2F96 A;  4MQ3 A;  1X9J A;  4O0J A;  5M1F A;  1JCF A;  3MXI A;  3SJJ A;  3PX6 A;  1JCE A;  1SUQ A;  1HKB A;  4DSL A;  3M8P A;  4FJN A;  1Q8I A;  4JNE A;  1FJG K;  2FBT A;  1JLQ A;  1HYV A;  2HF4 A;  3HYF A;  5AQY A;  3T1H K;  3DXK B;  2YKM A;  1NMD A;  2QWM A;  3ULE B;  2FBX A;  1K8K A;  3DWL A;  4BVP A;  1D8Y A;  4O55 A;  3M8S A;  1Z25 A;  4B9U A;  3VA3 A;  4DSK A;  5IT9 O;  1SKR A;  3H1Q A;  4OX9 K;  4FLT A;  1EWR A;  1QE1 A;  2WUS A;  2BUP A;  5T7B A;  2KTQ A;  4BC2 A;  2X74 A;  2G8W A;  4XEI A;  1IBM K;  3JXU A;  4I7F A;  4W5T A;  4ILH A;  1SZ2 A;  3CPE A;  3SV4 A;  3VOV A;  1CXQ A;  3D2E B;  3C7N B;  2Q0R A;  3SMS A;  1HMV A;  4CJR A;  3TSQ A;  4GVM A;  4Z4I A;  2HHQ A;  1SL0 A;  3TSU A;  3WQU A;  4KB1 A;  1VQM N;  5KPT A;  2YNG A;  3AVG A;  5KPR A;  1XHX A;  1G99 A;  2HHW A;  5GAD P;  3V9W A;  2E2P A;  5KQD A;  3LPT A;  4AHV A;  5KGX A;  4BRQ A;  4X62 K;  1ZBU A;  4JKC A;  2YI1 A;  2P51 A;  4HUG A;  3MAQ A;  3MCP A;  3QEP A;  1NK0 A;  1FKO A;  5AQK A;  5FDL A;  4CFD A;  2P5G A;  4DS5 A;  4FW1 A;  4CES A;  4JHD B;  4FZZ A;  4CFA A;  1QHA A;  1BQM A;  4GMJ B;  1BG3 A;  4KI6 A;  1VQP N;  4YDU A;  4DR2 K;  4YOT A;  4KAZ A;  3J80 O;  2HST A;  1VQ8 N;  4CJV A;  4X64 K;  3NF7 A;  2YHY A;  3K2P A;  4WFN L;  3CCL N;  3ZX0 A;  3NDK A;  4N56 A;  4DUY K;  3EN9 A;  4EFH A;  3RR7 A;  2E5L K;  2PAV A;  1BIZ A;  3EO3 A;  1SQK A;  3PO4 A;  4QS8 A;  3AVK A;  4BR0 A;  3LWM A;  3ZSX A;  1D9D A;  1S1T A;  2IIR A;  1VSD A;  5AQI A;  4EAH D;  4U7B A;  1HNZ K;  3FZL A;  1JL1 A;  4FWN A;  5SZT A;  4JK8 A;  4LFA K;  3K57 A;  3LM9 A;  2X6N A;  3NVM A;  3KHY A;  5AQV A;  3SCX A;  4W5O A;  3J7Z O;  2P9P A;  3R6M A;  2ETJ A;  2FXU A;  3PIP L;  3WEE B;  3NF8 A;  3O4W A;  3T1Y K;  4PQU A;  2ZJP L;  1KLM A;  4IDK A;  2V52 B;  2ITM A;  3MXM A;  1OH8 A;  3CJC A;  4CED A;  1HNV A;  3SMP A;  1YI2 N;  3QLH A;  4DFP A;  1NJI O;  1U4B A;  4B3O A;  1Q18 A;  3THV A;  3OS2 A;  3D0P A;  4RW6 A;  2QKB A;  4BQL A;  3AGR A;  3QNO A;  3GL1 A;  3M6G A;  1TL1 A;  4IDH A;  2FC0 A;  3O8M A;  1X9W A;  3AO2 A;  4X65 K;  1SAZ A;  3L2W A;  2O8F B;  4LSN A;  3H08 A;  2VYP A;  3L2V A;  3CIP A;  4CGG A;  1KTQ A;  4R5P A;  3LM2 A;  3MDQ A;  3Q7C A;  3DXK A;  2E88 A;  3THY B;  1RCH A;  2YX6 A;  4DCH A;  3NF9 A;  3LDS A;  1TGO A;  2YV0 X;  3HTV A;  4X66 K;  1WLJ A;  3KD1 E;  4BRI A;  3QFP A;  3QES A;  4BDP A;  1Z6R A;  4H0X B;  2D0P A;  2D4W A;  4I9Q A;  2IVO A;  3ENO A;  1C1B A;  3LP2 A;  3K58 A;  3BF1 A;  2GX9 A;  2YKN A;  1JLB A;  3CG7 A;  5CY4 A;  1TKZ A;  5CHI A;  1JLA A;  3QEV A;  1HUX A;  5B8H A;  1GOC A;  2OPR A;  3IRX A;  2ASP A;  3VTH A;  2I7P A;  3JS6 A;  1X3M A;  1HX1 A;  4FL9 A;  4FJJ A;  3D2E A;  2FSN A;  2VWB A;  3L3U A;  4M3W A;  2Q36 A;  3GE1 A;  1UAX A;  4IFE A;  1QZ5 A;  1NJY A;  2KKZ A;  3VER A;  4ISG A;  5AQU A;  2ZD1 A;  1YVN A;  4I2Q A;  1R59 O;  3H3O B;  3K5L A;  2ZGZ A;  3ZX2 A;  1NGE A;  4DUZ K;  5JLH A;  1IJJ A;  4CZM A;  4BC5 A;  4E7K A;  3SQ0 A;  1NGF A;  1S72 N;  1WN7 A;  4NLC A;  3EKS A;  1BI4 B; 
#chains in the Genus database with same CATH homology
 4DV4 K;  4DV7 K;  2UUB K;  2F4V K;  4YY3 K;  5LL6 Z;  2UUA K;  4JV5 K;  4LFB K;  1HNW K;  4GKK K;  3J81 O;  1IBL K;  4DV1 K;  4JI4 K;  4DR7 K;  4JI6 K;  5LMU K;  1IBK K;  4JI0 K;  4DR1 K;  4JI1 K;  1N33 K;  2VQE K;  4X65 K;  4NXM K;  4LF4 K;  4YHH K;  1N32 K;  2UXC K;  4X62 K;  4LF8 K;  4DR3 K;  2UXB K;  4DV0 K;  4B3T K;  2UXD K;  4AQY K;  1XMQ K;  1HNX K;  4NXN K;  3JAM O;  4B3S K;  4GKJ K;  4CW7 B;  1J5E K;  4X66 K;  4CVN E;  4JI7 K;  2UUC K;  3J7A P;  3OTO K;  4JI8 K;  4DR2 K;  4LF9 K;  3J80 O;  1N36 K;  1N34 K;  4X64 K;  4DV2 K;  4DV3 K;  5AJ3 K;  1FJG K;  2ZM6 K;  2UU9 K;  3T1H K;  1HR0 K;  4JI3 K;  5LMN K;  5FLX O;  4DV5 K;  4DUY K;  2E5L K;  4LFC K;  5IWA K;  5A2Q O;  4LF7 K;  4B3M K;  5BR8 K;  2HHH K;  1XNR K;  4JYA K;  1XMO K;  4K0K K;  4LF6 K;  5IT9 O;  4OX9 K;  4DV6 K;  4JI2 K;  4KHP K;  1I94 K;  1HNZ K;  4LF5 K;  4DR4 K;  4LFA K;  4DR6 K;  1IBM K;  1XNQ K;  4JI5 K;  3J7Y P;  2VQF K;  4DUZ K;  4V19 S;  4DR5 K;  4B3R K;  3T1Y K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...