4DR2K

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 29
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dr2K00
4X62K 3OTOK 4V19S 4B3RK 1XMOK 4JI6K 4LF4K 1IBMK 4DR7K 4CW7B 1IBLK 4DR2K 1HNZK 2ZM6K 4DV4K 2UUAK 5LMUK 2UUCK 3T1YK 3J7YP 1XNRK 4LFAK 1HR0K 5A2QO 4B3MK 1N34K 4JI0K 4KHPK 4DUZK 1J5EK 4OX9K 4LF6K 4YHHK 4DR6K 4DV1K 3J7AP 1IBKK 4JI1K 5AJ3K 2UXBK 4X66K 3JAMO 4B3TK 4K0KK 4DV3K 4NXMK 3J80O 4JV5K 1HNXK 1N33K 5LL6Z 4X64K 2HHHK 2E5LK 4GKJK 2UU9K 4X65K 3T1HK 4DR5K 4JYAK 4GKKK 4YY3K 2UXCK 4B3SK 4LF5K 4CVNE 4DV7K 4LF9K 4DV6K 5FLXO 1HNWK 1FJGK 5IT9O 2F4VK 4LF8K 2VQFK 4DV0K 4DR3K 4JI4K 5BR8K 4DR1K 4JI3K 4AQYK 4DUYK 2UXDK 3J81O 4LFCK 1N32K 1XNQK 4DR4K 2UUBK 4LF7K 2VQEK 5LMNK 4DV5K 4NXNK 1N36K 4DV2K 4JI2K 4JI5K 4LFBK 1XMQK 1I94K 4JI7K 4JI8K 5IWAK
chains in the Genus database with same CATH superfamily
4ELUA 2DFHA 1C0UA 1YAGA 3SQ2A 5BPLA 5BN8A 3LAMA 1EP4A 1VQPN 1KTQA 4BACA 3CCVN 4M41A 4OPJA 2YCHA 1JLFA 3THWA 3AA3A 2IDOA 4DTSA 1UWBA 1P90A 1VRTA 4LH4A 4B3MK 5GAEP 3VQQA 2GWJA 1J5EK 4CEBA 1D9FA 1K73O 1IBKK 4CHNA 3NVKA 4FCYA 4BG9A 3LP3A 2WONA 2F8TA 4B8CA 3BZCA 2YHYA 4GY2B 2P9IA 5I42A 2B5JA 2G8WA 3D2EA 1OH6A 3CCMN 1RCHA 3ZYYX 1GLBG 4FWMA 4IWVA 3ZEUA 2E5LK 4CJ5A 3KK7A 1LOTB 3AO5A 5AQNA 4KHSA 1GLAG 2JGUA 4DSIA 4FJXA 3HM9A 4H0OA 4YOWA 4Z4GA 3DLKA 4CZIA 1C1BA 3FR0A 4HCBA 3CJAA 3VA0A 2P9LB 4OO1J 3TU5A 4UQGA 1NK5A 1DTQA 5JS2A 1NGCA 1C0MA 4H5VA 3EEQA 4ELVA 3WNHA 2ATQA 4JKCA 2W41A 3QINA 4CJ4A 3ITHA 4FM1A 3SYZA 4U67L 1RTDA 4IDKA 1WSFA 3NBPA 4BE0A 1TK0A 1T03A 4KH5A 3KKRA 4A57A 1WUAA 3O4QA 4MO5A 4ISFA 3E9PA 4DV5K 1FKOA 1JLQA 1SKSA 1VHXA 3GL1A 5AQYA 3RR8A 3TAPA 1QSLA 4I7FA 3QO9A 3VPZA 5AZJA 5IWAK 4CHOA 3LDQA 3G6EN 3AVAA 1BISA 3QDKA 5J2PA 4CZGA 3QFPA 1KC8O 2UYTA 1WNSA 1YT3A 4B9SA 4PHTX 4Z4HA 2FSKA 3VA3A 3QNNA 4FPBA 3BY5A 1BIZA 3NF6A 1VQMN 1RNHA 3DRSA 3O4WA 1NLVA 5KRTA 3EN9A 1IG8A 2IVPA 2QKBA 1UA0A 2P9SA 2HF3A 1QSYA 3AVIA 2O8EB 3CJ9A 3O9UA 4A59A 3SUOA 3MK6A 3JS6A 5HP1A 3ZLJA 5DM7L 3VEXA 2BE2A 3L2RA 3OYGA 1WAJA 3J80O 5LL6Z 4AHRA 4MDBA 3CFRA 3CCLN 4FLUA 2HOEA 4A62A 1NJYA 4BREA 2RPIA 2OTJN 3O3FA 2EHGA 3WXKA 5GAGP 2E1ZA 4FZZA 1L3UA 3VQBA 4CHQA 4YOUA 4AILC 4DTRA 1X9MA 2V52B 4BRPA 1XC3A 1T8EA 4M3XA 4LC9B 2XO7A 4BE2A 1HJRA 5M1OA 2E4LA 3ZX0A 3SPYA 3F9KA 1BOTO 4CECA 1T7PA 5AQQA 4FLVA 1TV6A 2E2OA 3ATVA 3WEEB 4KHNA 3IFRA 3EO3A 2VCPA 3G10A 4HHTA 5JVGL 1QQNA 4GMJB 1VAZA 1RDCA 1TL1A 2PYLA 4KB0A 1EETA 1QSSA 4JAXA 1WSJA 4R5PA 2RKIA 2PFUA 1XWLA 4IJNA 4DV2K 4PKGA 4G9ZA 5GIPA 2AJQA 2I7NA 2ETJA 4IDHA 1U45A 3HK2A 5AQKA 3AGKA 4B9QA 1B92A 4C1NK 2HHQA 3ENOA 3U8XA 5JLFA 4HTLA 3NHGA 1ASVA 3HPOA 3AARA 2O8BA 3ZT3A 5CZ2A 4DHYA 2UUAK 3ZT2A 1VQLN 1D9DA 5J2NA 1VSEA 1NGHA 5KQDA 1VRUA 4RCHA 1NGIA 4O55A 5CHIA 3HVTA 2WC9A 4KHPK 4DQ8A 1C0TA 2HHWA 4IOXA 2GWKA 3RVCA 4BDPA 4CF0A 4JI1K 4OKKA 5AZIB 3B8AX 4M3RA 3SQ0A 4DSJA 2HW3A 3FE1A 5AQSA 2NZTA 4BR7A 4C8KA 1S1UA 3EKSA 1LWCA 4CEOA 1NJIO 4EIAA 2FXUA 3ID8A 1FW6A 1I3AA 3KJVA 4I9LA 3OS1A 1EX4A 3W3DA 1UOCA 5AQRA 2QK9A 4B3SK 3DOKA 1JKHA 3CHWA 3FZKA 5KTQA 2Y1IA 3ISNC 4E7JA 1P8ZA 4LF9K 3AVFA 5JVHL 2WOMA 1J53A 4RW9A 5D3GA 3PO4A 4B1YB 2P9KA 3KLFA 2WBNA 3V81A 1Q9XA 1DLOA 1X9WA 1KAYA 3L2QA 1GOCA 3CIPA 4KH6A 4JKGB 2Q31A 1X3NA 2O8DB 2Z1HA 1RTHA 1JCEA 3U4LA 1YHQN 3SI6A 3V9WA 3AO4A 1LCUA 2HF4A 1BDGA 4JN4A 4CJKA 5LMNK 1VQ9N 3A5LC 3P83D 3NH2A 4JI2K 4JI5K 3DWLA 1Y97A 4XEIA 4JI8K 4BRIA 3THWB 3E1YA 5F1XA 3HSTB 2A6AA 1GLDG 1Q82O 1HJOA 2O4GA 4KHQA 3E66A 4O0JA 3C6UA 4BRDA 2ASOA 2HMPA 4J2DA 3C0BA 4DQIA 4KHYA 3VEZA 2V7ZA 4JNEA 4CHPA 1VQ4N 1F21A 3KLIA 1KSPA 3SNNA 4DTPA 5GADP 3D2EB 3AVNA 5A2QO 5JLHA 2B4JA 3DOLA 3O8MA 3ZEUB 1HKBA 1ZBLA 3OY9A 1N5YA 1NM1A 4IO9L 4KHWA 3NCIA 2PBDA 3HP6A 3MEEA 1C1CA 3VMFB 3CERA 2IGIA 4F2RA 4MLHA 3UKUA 1W0HA 3UE5A 4RW8A 4ISEA 4AHTA 3KTQA 4IXCA 3C94A 3TAEA 1U47A 4L8RB 3DLGA 3QICA 4M42A 2HHHK 4HVJA 3IUCA 5FPEA 3T69A 4FWOA 4HUGA 3SUQA 4BR2A 3PSIA 2IOCA 2HHVA 3CQ8A 2OPSA 4NCGA 4WQ5C 4LF5K 4DV7K 1VQKN 3AVKA 2HBLA 5AQOA 4E0DA 4YOVA 4O0IA 4ISGA 4B1ZA 3SBGA 2VYPA 4DU1A 4GV9A 1NMDA 2RE2A 4MQ3A 1FJGK 2ZWHA 2HSTA 3AO2A 1YJWN 4C8LA 4JI4K 1CLQA 1VSKA 3O9SA 4WQ5A 2NRRA 3PX6A 4EZ6A 1ATRA 3CM5A 4DUYK 1OH8A 1DTTA 5AZJB 3PIOL 3EYZA 5FPDA 2OPRA 2IAJA 4LFCK 1GOBA 1RGIA 3LL3A 4LSLA 4Z4EA 3JXUA 1NK6A 2Z1IA 4NXNK 3QIOA 1CZBA 4BWJA 5HL7L 3L4QA 4BWMA 4R79A 3SZ2A 5CE3A 4NLBA 1RDDA 1VQ8N 3CJ1A 2ZJPL 3SAHA 2E1YA 1XMOK 3R9PA 2YKMA 4DTJA 1HYVA 2P9PB 1RT7A 4K43A 1VQNN 4CW7B 4CGIA 1Q7YO 5M1KA 2OA8A 1HNZK 5ADXH 4K25A 3K5MA 3I8DA 3PV8A 3LANA 1BQMA 3ALYA 4DSKA 3ATUA 1ASUA 1J6ZA 1FKPA 4KV8A 1L5UA 3TAMA 1HR0K 4BRNA 3U9DA 2HVIA 3NVMA 5E26A 1RT5A 4OLAA 3S3MA 2FSNA 2O8FA 2ZE2A 2P5GA 3K5NA 4BRCA 4BRHA 1DT9A 1RFQA 4IFYA 1VSIA 3AVJA 3FFIA 2V51B 4MDAA 3WXMB 1WAFA 3HSCA 5GIOA 2YHWA 4JV5K 4DWIA 3OYJA 1LWEA 2ZF5O 1NJWA 3U6FA 3QMLA 5AQPA 5ADXA 4FLTA 3OYCA 3HPGA 3SK3A 3AO3A 4OGCA 2FBVA 3L0QA 4FZXC 4H03B 3LDPA 4JS5A 3B6OA 4BRGA 2OZMA 2DFFA 3UB5A 1DEJA 1K8AO 5SZTA 5IT9O 4EZ9A 3TPQA 4LF8K 1HNIA 4K8ZA 4FSVA 3SQ1A 1KLMA 1Z25A 1ZXOA 3H3NO 4BC4A 1MWKA 3C7NA 4BRAA 5BR8K 3OYBA 3O3HA 1NNEA 4N76A 2XY7A 4CJRA 5TKYA 5BRFA 4CGJA 2X78A 3J81O 4O8UA 4O5BA 4BGBA 3CCEN 4FW2A 5HRPA 3KLGA 1SKWA 2NLXA 2O8BB 1H1VA 3DLBA 1OH5A 4CF9A 4DQRA 4HUEA 5LJWA 3SV3A 1CZ9A 4IEEA 3SMPA 2RHKA 1REVA 3JSMA 1XQSC 1QHAA 2FF6A 1S9GA 2BH1A 3ZSZA 4H0YB 1OH7A 1W2BM 3NAEA 4FK4A 4A5BA 2ZJQL 5CYQA 1NBWA 4YFUA 4W5TA 4B9VA 1XHZA 4W5OA 4A2BA 2A40A 1NGEA 3V9XA 2OZSA 4JKEA 3PUFA 1N34K 1RT4A 3PX4A 3H6EA 4NYFA 2KW4A 3HTVA 4YHHK 4A2AA 3RRHA 5AQJA 3CC7N 3SAFA 3O3GA 4YOXA 5C25A 4CI6A 4DLEA 3AA2A 4B3TK 2D5RA 4NXMK 3CXCM 1L3VA 4H5WA 4DF4A 5AQMA 5DM6L 4PL7A 3KK3A 3OW2M 1N33K 3G25A 4CFBA 2P9KB 4M3TA 1S1XA 1A5XA 2F9TA 4FJJA 2GUIA 5FRNA 2AA4A 3H45C 4B8AB 1TGOA 1JXEA 4DTNA 5E84A 5AQVA 3OYFA 3M3ZA 3A0IX 3FZHA 4BC5A 4DS4A 3TANA 4O5FA 3QBWA 3MN9A 1VSDA 2G8UA 3A5NC 4DQQA 4GV6A 3VQDA 3LPUA 3VESA 5JICA 1QQCA 4E1MA 3LDNA 2BDPA 1BIUA 4BR0A 4JKHA 1NKBA 4BDYA 3FZFA 2UXDK 1NK7A 5EVZA 1C0GA 3C95A 4AHUA 4JKFA 3O9RA 1HUXA 1KD1O 3KLEA 1EO1A 1LV5A 3TI0A 5B8HA 4E1NA 3CQYA 5GINA 5FDLA 1MA9B 3R1XA 4BG8A 4K41A 1I39A 1WBDA 2H3GX 2XY6A 3TSUA 3CD6N 1X1PA 1YF5L 3D7EO 3SAGA 5FPNA 1RDAA 3R6MA 3H3OB 4B1XB 4W5QA 4CIFA 3OYDA 1JLCA 4UY8O 3QFUA 5HROA 3U3YA 3G4SN 2WFBA 1RT3A 1RDUA 4NLCA 3UKUB 3MXIA 2YKNA 4E7IA 4B08A 4PL8A 2YJEA 4J2EA 1JLEA 3E9OA 1NK4A 2IVOA 3VGLA 4DKWA 2GEMA 4LF6K 3AVBA 3I55N 3KWIA 3VF4A 3L6QA 2LSNA 3N4QA 5BPMA 4K0KK 1RTJA 4I2QA 2HNZA 3D0PA 4FJIA 4FK0A 2G8VA 3SCXA 4FVUA 3K2PA 1IKYA 2NRXA 1S9EA 1IKVA 1WN7A 3AVCA 1WBBA 4YOYA 1R59O 2P9PA 3MMVA 4CZMA 2YHBA 4RTFD 3SMSA 3K57A 1ZBHA 4AM7A 3AAPA 3V4IA 5DMRA 1QZ5A 4EFHA 2OCEA 2GTDA 2FF3B 4FL9A 3H46O 3VEWA 4DCHA 1E4GT 1MU2A 2QWNA 2VQFK 1HQUA 2E8AA 1VSMA 3H1QA 1BO5O 3AO1A 1BQNA 4OGEA 4DTUA 2QWMA 3ASMA 3HOSA 3CI5A 3GG4A 3T3FA 4FJKA 1EWQA 1J9AA 4DLGA 4FZYA 3QERA 4FJNA 3VQEA 1HMVA 3DMJA 3R3LA 4PWDA 1YTAA 4KAZA 3V1OA 3WNGA 3BEXA 4RW4A 2A1RA 2F4VK 4X62K 1HX1A 1SL0A 3ZT1A 1NK8A 3L2WA 1OVYA 2I5JA 4BGAA 3CCUN 1NGDA 3EZWA 4CF1A 1LWFA 3PY8A 3MAQA 2ASPA 3GE1A 3QEPA 4DF8A 3DJCA 1YUWA 3D6RA 2O8FB 3MECA 2BGGA 3DRRA 2VG6A 3OHRA 1KLNA 1S1WA 2Q36A 1KRPA 4NO7A 4CE9A 4JEPA 3SQ4A 1MWMA 1GLLO 2YHXA 4M3YA 2GELA 2CGKA 2KKZA 3M8PA 1M90O 4CJTA 2HBKA 2NUBA 3QEVA 3RSEA 2QW9A 4KRFA 5AFUA 4OPAA 3AA4A 4CHZA 3A5OC 4B9TA 1SQKA 1HKCA 2V7YA 1K8KA 4BC3A 2JWKA 4K42A 3GDQA 3C7NB 2BTFA 3I8BA 3LWLA 1T6CA 4FLZA 4NB4A 1Q18A 4LSNA 2QWLA 2IC3A 1NGFA 3N4PA 1O1WA 5LJVA 4JK7A 2EWSA 1ZBIA 1S6PA 5AQWA 1UAXA 2E2NA 5GAHP 4KBOA 3HM8A 4CK1A 3CCSN 1HNWK 4WQ4A 3WQTA 1U48A 4JS4A 2VWJA 4FWKA 4BRMA 4DFKA 3T7ZA 2A1SA 4KTWA 4ELTA 3F73A 4M7YA 3O4NA 1ZBSA 2QWQA 4WFNL 4FO0A 4OKJA 1BL3A 2HHUA 4DG1A 4OPHA 4DS5A 5AQFA 1HLUA 3RTVA 1U2VB 3IAYA 3CMEN 3E9LA 3QBXA 5KQ8A 3M8QA 4CZJA 4LF7K 2YHAA 2HB5A 3SPZA 1BA0A 1C0FA 1MDUB 4XH5A 5LY3A 1ZBFA 3L2VA 3TAQA 1QVFM 4XH1A 2OPPA 2IVNA 2HHXA 1WLJA 4V19S 2XRIA 3AGRA 4BVPA 1C1AA 4FWRA 3PLAA 4FPAA 4DR7K 3QLHA 3WQUA 4DR2K 1K9MO 3L3UA 1WSEA 5C10A 1A5WA 4FJ9A 4ID5A 3T1YK 4W5NA 4QAGA 3VQ5A 3U9ZA 4C1NI 4CGHA 4IFVA 4JI0K 2P9NB 1BWFO 3QEIA 3CJCA 4KHUA 3MX5A 3WNFA 3QIPA 4AHCA 5CYMA 3NF8A 3T19A 2E6MA 2DPNA 2ZD1A 4X66K 4AM6A 3CMAN 3IDHA 4IZ9A 3P31A 1D4XA 4MLEA 1JCFA 2D1KA 1RDBA 3SUPA 4BRKA 1VK0A 2Z1JA 4JLHA 5BPNA 4YDUC 2UU9K 3OYNA 3I0RA 3O1WA 4GKKK 5KI6A 1IKXA 2UXCK 3A5MC 4JRQA 4H4MA 4I6MA 2PYJA 2NRWA 4CJUA 4YNQA 1NOZA 4GV3A 1NK0A 3HT3A 4N41A 4CJEA 1UA1A 2WUSA 1SV5A 4YDUA 4CBUA 4PQUA 4DV0K 2Q0UA 3G71N 3QESA 1YXQA 3DI6A 1S1VA 1NOYA 2CH5A 2CGLA 2NRHA 5F0XA 2OTLN 4BY9C 3FGUA 1GLEG 1SUQA 5C2DA 4BRQA 2O4IA 1Q9YA 1Z26A 1N32K 4M7XA 2CGJA 2D0PA 2UUBK 1SKRA 2E6LA 5BRDA 2W6KA 1R0AA 3OYMA 1YI2N 3OYIA 4CFAA 3L2UA 4PKIA 3BDPA 3M1FA 4Y1CA 3PIPL 1QVGM 3CCJN 2YJFA 5I9EB 4FLYA 4EHUA 4B3RK 2AP1A 4QS9A 4CJ7A 3ULEA 1EXQA 3VEVA 3LZIA 3C65A 4LF4K 4QS7A 4AH9A 3ZCMA 4CFDA 1L3TA 2QWRA 3CYMA 4QOZB 5I3UA 3HJFA 2F9WA 4RG8A 3QEXA 1FK9A 3LM2A 4CIGA 3BGRA 1NKEA 3ZT4A 3AV9A 3NFAA 3K58A 1S5JA 4LFAK 1XUPO 1ZBUA 3M8SA 4F3TA 1NGAA 3MN7A 2VGNA 5AQLA 4CK2A 5C42A 3HYFA 2KHOA 5HBMA 2KQ2A 1KVBA 1BHLA 1EWRA 5BN9A 3RMCA 2UXBK 3DM2A 2YV0X 5AQZA 2YNGA 1JCGA 2X6NA 1HYSA 1RBSA 3E01A 1VSJA 3DYAA 3ZSRA 2B6AA 2XHBA 2O8CB 2KFNA 5H1SQ 4KTQA 5CY4A 3ID6A 4B9UA 3W0LA 4DU4A 5BRHA 1U4BA 1S3XA 4DMNA 3DAWA 4CVNE 3PX0A 4WCEL 3OVNA 1W97L 4CGFA 1KAXA 4CEZA 1TKZA 4FLXA 3O9TA 3MX2A 3ZSWA 1BI4A 3CJ7A 3M6GA 4C8MA 4DR1K 1YVUA 3NF9A 3SV4A 3T1AA 3I56N 1HNVA 1XHXA 4N56A 4YOTA 4CBXA 3RR7A 2E20A 5M1PA 2ITMA 2NNWA 3DLHA 3ULDA 4QS8A 2QXLA 1TKXA 4OVLA 4DU3A 1E4FT 3WXJA 3EE8A 3NE6A 4FOIA 4LFBK 1W9HA 3BF1A 1V4TA 2VG5A 3O80A 4AF1A 3K9JA 3THYB 4Q5VA 4FJLA 1RT2A 2D0BA 4NYNA 4OKEA 3VF2A 1L3SA 1A5VA 5TKWA 3HZ6A 4BR4A 4CD1A 4N47A 3K9KA 5EX5A 3DXKA 1RBUA 4FWSA 3RSEB 4E89A 1XNRK 3FZMA 1TK5A 3KD1E 4JD2A 2F8SA 1X3MA 3LDLA 4M3ZA 5M1NA 3NH0A 5F2RA 3VTIA 4JKBA 5KPRA 2PZSA 2X6SA 3O6WA 4DQSA 1K8KB 1U2VA 2ZJRL 4DR6K 3V1RA 3TTDA 3L3VA 4BDZA 1XI1A 1IG9A 2Q3SA 4KH4A 1K6YA 4RW6A 1G99A 4BRLA 1HPMA 3IKMA 3KLHA 3DLEA 4H0XB 4WYBA 2HNYA 5KGXA 4CEDA 4CEAA 2A41A 4YY3K 1FXXA 2KTQA 1KCFA 3VEYA 1LW2A 3NGYA 5AQUA 5E41A 3CFPA 4WFBL 3LALA 4IOAL 1RT1A 4H8KA 4KI6A 4CGDA 1KVAA 2GX9A 3THVA 5FLXO 4ICLA 3LPTA 3C6AA 4K8XA 4Y1DA 3MXJA 1KFDA 1B9FA 4OJRA 2R7YA 3J7ZO 4H0PA 1SZ2A 1JLAA 2P9NA 4B1UB 2QTDA 2P9UA 2FC0A 2QM1A 3OYLA 1VQON 1DGKN 3OA9A 5AQXA 2KFZA 3MDQA 1KQSM 4KREA 3KK2A 4FWPA 4KKOA 2E2PA 4NCBA 3AAQA 3WUHA 3KIOA 2FLOA 1RBVA 4TSXA 3LAKA 3OYHA 2J4RA 5CZ1A 3VQ8A 4Z4IA 4GW6A 5AQIA 1SAZA 3RMBA 2JWLA 1IO2A 3F5TA 1JL1A 4O4GA 4ILGB 3R8EA 1HQEA 1Q81O 3NDKA 3A2FA 2UUCK 4DSLA 3D45A 1OVQA 4C8OA 3HBTA 5BR9A 1VSLA 5J2QA 3WNEA 4FWNA 3THXA 3DXMB 2YX6A 5HOOA 2YI1A 1U04A 4FM0A 3VTHA 4DUZK 1S6QA 3OS2A 2PY5A 3LWMA 3NMUA 5C2FA 3EKUA 4DV1K 4FJHA 3OYEA 3EY1A 1YTUA 1NJXA 4I6MB 5FRMA 4FW1A 4IFEA 1NGBA 3PSFA 4CF2A 3QNOA 2QA4N 3TWHA 1ZYQA 3G0ZA 2EX3A 1WOQA 2Y1JA 4F9OA 4CEFA 1ZC6A 4HUFA 1WB9A 1GLCG 3S3OA 1HPZA 5FROA 1QTMA 3FFKB 5HLFA 5AQGA 3TAFA 1BUPA 4H0VB 3MWPA 1NKCA 1YVNA 1ITGA 1D8YA 4EP4A 3OYKA 2G8IA 3VERA 5MLCQ 5M1FA 4FJ5A 3TABA 4E19A 4W5RA 5T7BA 5KPTA 1CXUA 3M8RA 3KK1A 5BREA 4Z4CA 5J2MA 3BZKA 3UKRA 3V6DA 1CXQA 1RILA 1BA1A 3M5RA 1B9DA 3VQ4A 1KVCA 4C8NA 4BR5A 1BU6O 3P38A 5HRNA 1XNQK 3ULEB 4A5AA 1YIJN 2O8CA 4DFJA 1Q86O 2VWKA 3C6TA 4XH4A 4HCCA 2WTUA 3HPHA 3EL2A 3IRXA 3NF7A 1NG9A 1I94K 2QXFA 4FM2A 4DFMA 3RMAA 5EU7A 1NWKA 3KD5E 1CZAN 4IG0A 4L3QA 3P1GA 3NGIA 5HRRA 2Z1GA 4FYDA 3CPEA 2FSJA 1HYZA 3ZETA 4JI6K 4IKFA 4M3UA 4CJ3A 3WT0A 1G15A 4RW7A 3ENBA 4XIUA 5HRSA 4DV4K 3QEWA 1JLBA 5LMUK 3EE9A 2QKKA 4CF8A 2W40A 3S41A 2FBTA 3C6HA 4PA1A 3MEGA 2W42A 1KAZA 2ZGYA 4M63C 1QQOA 5EOYA 3SBTA 4I9QA 5AFUH 3BUZB 4CZFA 2G8FA 3OBYA 5C12A 3CC4N 3CETA 1C6VA 5AR0A 3Q7BA 4JHDB 1BCMA 3VQ9A 2E88A 4E7KA 1TYQB 4OPKA 3VQPA 4GVMA 4N5SA 1U49A 1T6DA 2I7PA 3MN6A 3TARA 4X64K 3P5JA 4YORA 3FLCO 2OYQA 4CZHA 4JK8A 4GKJK 3THYA 1IV0A 3T1HK 4CJPA 3IG1A 3OYAA 4JRPA 4GNIA 2BANA 3D2FA 3S3NA 2FBYA 4DSEA 1BI4B 2DFEA 3AA5X 2HBJA 3VEOA 2QI2A 2HNDA 5JS1A 1LAVA 1BGXT 4ZTFA 4FXDA 3K0SA 2D0AA 1ASWA 3P39A 4JKDA 3QETA 2Q0RA 2IS3A 4E1JA 3CF5L 1VQ7N 2F7TA 4ZTJA 2GUPA 4E7HA 3AVMA 2CH6A 2OANA 4A61A 4KB1A 4FJMA 1GOAA 3A8YA 4WQ4C 3ZSOA 3LDSA 1WSHA 1S1TA 3SLCA 4FWQA 4CHYA 1TVRA 1E3MA 3ENHA 3CQXA 5KRSA 3SJJA 4CZEA 3WXIA 3MN5A 4FOEA 4LD0A 1JLGA 3CJBA 3MCPA 4B1WB 4Z94A 1VQ5N 2VQEK 3EZ5A 3MEDA 4WFAL 1TK8A 1IJJA 2HMIA 3DXKB 4CZKA 4BR9A 1WSIA 4CCHA 2YNFA 4GVEA 4DTXA 2D4WA 4BC2A 1GLFO 3OTOK 4MO4A 4M45A 2HVHA 4JD2B 4O44A 4E7LA 1BG3A 1EKEA 2Q2RA 4CD3A 4RWTA 3OBWA 3NGZA 3IS9A 3K5OA 4CJSA 3NH1A 3OS0A 3F9MA 4EHTA 4B9MA 3ZSXA 2ZM6K 3BF3A 3I0SA 1QS4A 1RT6A 2DTUA 1U6ZA 2VGMA 3AVHA 3HP9A 4CEQA 1ATSA 1S72N 2VWBA 1T05A 4OX9K 3CCQN 3PO5A 5KPZA 1JXBA 4AHSA 2YNIA 2QWPA 3VF6A 4IO8A 3HO1A 3JAMO 4IEIA 2DY4A 5FPMA 3QB0A 5C15A 4B9LA 4DQPA 1ILYA 2A5XA 2ASMA 3HI0A 4ZHRA 4BQZA 1WSGA 4E3SA 2GV9A 2NRVA 3ZT0A 3VQ6A 3K59A 2ZQBA 4ILJA 2P9UB 1TL3A 4CGGA 4J2BA 3CCRN 1M1KO 4BVOA 3V9UA 4DV6K 1YITN 4ID1A 1TKDA 2A3ZA 3I33A 2IIRA 4CIEA 4KI4A 3F2KA 3TSPA 3DXMA 3U3GA 3LP0A 4B1VA 4BROA 3AVGA 2KZMA 4AQYK 4U7BA 1DKGD 4CJLA 3TR8A 3WXLA 4PUOA 1J54A 4JK9A 4HWIA 1RDWX 2P9LA 3IMXA 4JKAA 4O8KA 3O5BA 4CEEA 1N6QA 3VGMA 2P9IB 3RRGA 2QEXN 4DSFA 1QQMA 2BUPA 4JI7K 3LP2A 4M3WA 3VGKA 2RN2A 1TAUA 3THXB 4AHVA 3K5LA 1TUUA 2A42A 3BP8A 4WE1A 1IBLK 1W7AA 1QHTA 3DLRA 3VQCA 1GLJO 3KVGA 3J7YP 4F2SA 4BRFA 3DRPA 1NJZA 2RF2A 5EXWA 3V9ZA 4Z4FA 1VSHA 4FK2A 1Q8IA 3VENA 4IG3A 3SJHA 4BQLA 1SL2A 2HHTA 3J7AP 4C23A 2KLAA 4F3OA 3ZSYA 2KZZA 3HRGA 4CFCA 3MCAB 4PY5A 3L8BA 1HRHA 3LM9A 3HOTA 2JLEA 2O8EA 1HNXK 1RBRA 5C24A 4FWLA 4QCLA 4MFBA 1KXPA 4X65K 4DR5K 1S22A 1OKJA 3H08A 4IJAA 2D0OA 2PAVA 3TSQA 3LZJA 4F4KA 1N8RO 4H5NA 3UKRB 3CC2N 3OJSA 2W6LA 3TTFA 4FJ8A 1T3VA 1TKTA 4DFPA 4DTMA 3RMDA 1QE1A 5JMVA 1IKWA 1J5OA 3CFOA 3GBTA 5DK5A 3OJUA 4DR3K 2FBXA 4B3OA 5KGWA 4CJQA 1X9JA 2P9SB 3CM6A 3B6PA 4JI3K 1NK9A 2NRTA 4J8FA 4LY7A 4Z0UA 1SL1A 1D5AA 1KFSA 1ESVA 4WF9L 4JHDA 4EP5A 2Q1NA 1TYQA 4DR4K 4J2AA 3ZETB 3VETA 2OPQA 4CBWA 1Z05A 3ZX3A 2QWOA 2GBZA 4H4OA 3ZSQA 3LDOA 4EAHD 3WEEA 4PKHA 3TAGA 3AY9A 3TTCA 4CZLA 1X9SA 1HKGA 2NRZA 3MXMA 3DLLL 1TUYA 1NGGA 3O9QA 3V9SA 3HL8A 1IBMK 1NMNA 4KO0A 5ELZA 4LH5A 2XY5A 1YJ9N 1JL2A 2XY8A 4IBNA 4HTUA 3KWGA 3ZX2A 2ZGZA 4CJWA 3JYTA 5CR4A 1LW0A 2G8KA 4BE1A 2YNHA 4DTOA 2P5OA 2G8HA 4Q0BA 3KKSA 5AJ3K 3D2FB 4KPYA 4CESA 2HBMA 4NCAA 4DV3K 1XC9A 3ZSVA 3O08A 1LAWA 2VG7A 3VOVA 4ILHA 5C0YA 4F8RA 1QZ6A 1BCOA 4JYAK 4KTZA 4KFBA 1NGJA 4CJFA 2F96A 4FLWA 4CJVA 3SUNA 4CK3A 5SWMA 1V4SA 5AQTA 5AZIA 1ATNA 4B9NA 4FJ7A 2Q97A 2X74A 1TAQA 3P4IA 3HVRA 1O13A 3MWTA 4H5TA 1RTIA 3CPWM 3L4IA 3FZLA 1Y64A 4OLBA 3V1QA 1T44A 3GOIA 3Q7CA 1NU0A 1JJ2M 3KZBA 4G1QA 4FJGA 1Z6RA 3HXMA 4IOCL 2P51A 3UIQA 5EY4A 1VSFA 3H1VX 3KHYA 1VQ6N 3VQAA 4H0TB 1EQYA 4H5RA 5K14A 2E2QA 5J1EA 2D0CA 3J8AA 4I2PA 3AVLA 2HHSA 4FVMA 1N36K 4JKGA 3CG7A 3LP1A 3S9HA 3RWUA 3VN5A 1IH7A 4DB3A 1XMQK 3O1BA 5M1QA 1RBTA 1SS6A 4Y0WA 5AQHA 2O8DA 4CERA 3VQ7A 2ITGA 1YJNN 2P1JA
chains in the Genus database with same CATH topology
4X62K 3OTOK 4V19S 4B3RK 1XMOK 4JI6K 4LF4K 1IBMK 4DR7K 4CW7B 1IBLK 4DR2K 1HNZK 2ZM6K 4DV4K 2UUAK 5LMUK 2UUCK 3T1YK 3J7YP 1XNRK 4LFAK 1HR0K 5A2QO 4B3MK 1N34K 4JI0K 4KHPK 4DUZK 1J5EK 4OX9K 4LF6K 4YHHK 4DR6K 4DV1K 3J7AP 1IBKK 4JI1K 5AJ3K 2UXBK 4X66K 3JAMO 4B3TK 4K0KK 4DV3K 4NXMK 3J80O 4JV5K 1HNXK 1N33K 5LL6Z 4X64K 2HHHK 2E5LK 4GKJK 2UU9K 4X65K 3T1HK 4DR5K 4JYAK 4GKKK 4YY3K 2UXCK 4B3SK 4LF5K 4CVNE 4DV7K 4LF9K 4DV6K 5FLXO 1HNWK 1FJGK 5IT9O 2F4VK 4LF8K 2VQFK 4DV0K 4DR3K 4JI4K 5BR8K 4DR1K 4JI3K 4AQYK 4DUYK 2UXDK 3J81O 4LFCK 1N32K 1XNQK 4DR4K 2UUBK 4LF7K 2VQEK 5LMNK 4DV5K 4NXNK 1N36K 4DV2K 4JI2K 4JI5K 4LFBK 1XMQK 1I94K 4JI7K 4JI8K 5IWAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 K;  3OTO K;  4V19 S;  4B3R K;  1XMO K;  4JI6 K;  4LF4 K;  1IBM K;  4DR7 K;  4CW7 B;  1IBL K;  4DR2 K;  1HNZ K;  2ZM6 K;  4DV4 K;  2UUA K;  5LMU K;  2UUC K;  3T1Y K;  3J7Y P;  1XNR K;  4LFA K;  1HR0 K;  5A2Q O;  4B3M K;  1N34 K;  4JI0 K;  4KHP K;  4DUZ K;  1J5E K;  4OX9 K;  4LF6 K;  4YHH K;  4DR6 K;  4DV1 K;  3J7A P;  1IBK K;  4JI1 K;  5AJ3 K;  2UXB K;  4X66 K;  3JAM O;  4B3T K;  4K0K K;  4DV3 K;  4NXM K;  3J80 O;  4JV5 K;  1HNX K;  1N33 K;  5LL6 Z;  4X64 K;  2HHH K;  2E5L K;  4GKJ K;  2UU9 K;  4X65 K;  3T1H K;  4DR5 K;  4JYA K;  4GKK K;  4YY3 K;  2UXC K;  4B3S K;  4LF5 K;  4CVN E;  4DV7 K;  4LF9 K;  4DV6 K;  5FLX O;  1HNW K;  1FJG K;  5IT9 O;  2F4V K;  4LF8 K;  2VQF K;  4DV0 K;  4DR3 K;  4JI4 K;  5BR8 K;  4DR1 K;  4JI3 K;  4AQY K;  4DUY K;  2UXD K;  3J81 O;  4LFC K;  1N32 K;  1XNQ K;  4DR4 K;  2UUB K;  4LF7 K;  2VQE K;  5LMN K;  4DV5 K;  4NXN K;  1N36 K;  4DV2 K;  4JI2 K;  4JI5 K;  4LFB K;  1XMQ K;  1I94 K;  4JI7 K;  4JI8 K;  5IWA K; 
#chains in the Genus database with same CATH topology
 4ELU A;  2DFH A;  1C0U A;  1YAG A;  3SQ2 A;  5BPL A;  5BN8 A;  3LAM A;  1EP4 A;  1VQP N;  1KTQ A;  4BAC A;  3CCV N;  4M41 A;  4OPJ A;  2YCH A;  1JLF A;  3THW A;  3AA3 A;  2IDO A;  4DTS A;  1UWB A;  1P90 A;  1VRT A;  4LH4 A;  4B3M K;  5GAE P;  3VQQ A;  2GWJ A;  1J5E K;  4CEB A;  1D9F A;  1K73 O;  1IBK K;  4CHN A;  3NVK A;  4FCY A;  4BG9 A;  3LP3 A;  2WON A;  2F8T A;  4B8C A;  3BZC A;  2YHY A;  4GY2 B;  2P9I A;  5I42 A;  2B5J A;  2G8W A;  3D2E A;  1OH6 A;  3CCM N;  1RCH A;  3ZYY X;  1GLB G;  4FWM A;  4IWV A;  3ZEU A;  2E5L K;  4CJ5 A;  3KK7 A;  1LOT B;  3AO5 A;  5AQN A;  4KHS A;  1GLA G;  2JGU A;  4DSI A;  4FJX A;  3HM9 A;  4H0O A;  4YOW A;  4Z4G A;  3DLK A;  4CZI A;  1C1B A;  3FR0 A;  4HCB A;  3CJA A;  3VA0 A;  2P9L B;  4OO1 J;  3TU5 A;  4UQG A;  1NK5 A;  1DTQ A;  5JS2 A;  1NGC A;  1C0M A;  4H5V A;  3EEQ A;  4ELV A;  3WNH A;  2ATQ A;  4JKC A;  2W41 A;  3QIN A;  4CJ4 A;  3ITH A;  4FM1 A;  3SYZ A;  4U67 L;  1RTD A;  4IDK A;  1WSF A;  3NBP A;  4BE0 A;  1TK0 A;  1T03 A;  4KH5 A;  3KKR A;  4A57 A;  1WUA A;  3O4Q A;  4MO5 A;  4ISF A;  3E9P A;  4DV5 K;  1FKO A;  1JLQ A;  1SKS A;  1VHX A;  3GL1 A;  5AQY A;  3RR8 A;  3TAP A;  1QSL A;  4I7F A;  3QO9 A;  3VPZ A;  5AZJ A;  5IWA K;  4CHO A;  3LDQ A;  3G6E N;  3AVA A;  1BIS A;  3QDK A;  5J2P A;  4CZG A;  3QFP A;  1KC8 O;  2UYT A;  1WNS A;  1YT3 A;  4B9S A;  4PHT X;  4Z4H A;  2FSK A;  3VA3 A;  3QNN A;  4FPB A;  3BY5 A;  1BIZ A;  3NF6 A;  1VQM N;  1RNH A;  3DRS A;  3O4W A;  1NLV A;  5KRT A;  3EN9 A;  1IG8 A;  2IVP A;  2QKB A;  1UA0 A;  2P9S A;  2HF3 A;  1QSY A;  3AVI A;  2O8E B;  3CJ9 A;  3O9U A;  4A59 A;  3SUO A;  3MK6 A;  3JS6 A;  5HP1 A;  3ZLJ A;  5DM7 L;  3VEX A;  2BE2 A;  3L2R A;  3OYG A;  1WAJ A;  3J80 O;  5LL6 Z;  4AHR A;  4MDB A;  3CFR A;  3CCL N;  4FLU A;  2HOE A;  4A62 A;  1NJY A;  4BRE A;  2RPI A;  2OTJ N;  3O3F A;  2EHG A;  3WXK A;  5GAG P;  2E1Z A;  4FZZ A;  1L3U A;  3VQB A;  4CHQ A;  4YOU A;  4AIL C;  4DTR A;  1X9M A;  2V52 B;  4BRP A;  1XC3 A;  1T8E A;  4M3X A;  4LC9 B;  2XO7 A;  4BE2 A;  1HJR A;  5M1O A;  2E4L A;  3ZX0 A;  3SPY A;  3F9K A;  1BOT O;  4CEC A;  1T7P A;  5AQQ A;  4FLV A;  1TV6 A;  2E2O A;  3ATV A;  3WEE B;  4KHN A;  3IFR A;  3EO3 A;  2VCP A;  3G10 A;  4HHT A;  5JVG L;  1QQN A;  4GMJ B;  1VAZ A;  1RDC A;  1TL1 A;  2PYL A;  4KB0 A;  1EET A;  1QSS A;  4JAX A;  1WSJ A;  4R5P A;  2RKI A;  2PFU A;  1XWL A;  4IJN A;  4DV2 K;  4PKG A;  4G9Z A;  5GIP A;  2AJQ A;  2I7N A;  2ETJ A;  4IDH A;  1U45 A;  3HK2 A;  5AQK A;  3AGK A;  4B9Q A;  1B92 A;  4C1N K;  2HHQ A;  3ENO A;  3U8X A;  5JLF A;  4HTL A;  3NHG A;  1ASV A;  3HPO A;  3AAR A;  2O8B A;  3ZT3 A;  5CZ2 A;  4DHY A;  2UUA K;  3ZT2 A;  1VQL N;  1D9D A;  5J2N A;  1VSE A;  1NGH A;  5KQD A;  1VRU A;  4RCH A;  1NGI A;  4O55 A;  5CHI A;  3HVT A;  2WC9 A;  4KHP K;  4DQ8 A;  1C0T A;  2HHW A;  4IOX A;  2GWK A;  3RVC A;  4BDP A;  4CF0 A;  4JI1 K;  4OKK A;  5AZI B;  3B8A X;  4M3R A;  3SQ0 A;  4DSJ A;  2HW3 A;  3FE1 A;  5AQS A;  2NZT A;  4BR7 A;  4C8K A;  1S1U A;  3EKS A;  1LWC A;  4CEO A;  1NJI O;  4EIA A;  2FXU A;  3ID8 A;  1FW6 A;  1I3A A;  3KJV A;  4I9L A;  3OS1 A;  1EX4 A;  3W3D A;  1UOC A;  5AQR A;  2QK9 A;  4B3S K;  3DOK A;  1JKH A;  3CHW A;  3FZK A;  5KTQ A;  2Y1I A;  3ISN C;  4E7J A;  1P8Z A;  4LF9 K;  3AVF A;  5JVH L;  2WOM A;  1J53 A;  4RW9 A;  5D3G A;  3PO4 A;  4B1Y B;  2P9K A;  3KLF A;  2WBN A;  3V81 A;  1Q9X A;  1DLO A;  1X9W A;  1KAY A;  3L2Q A;  1GOC A;  3CIP A;  4KH6 A;  4JKG B;  2Q31 A;  1X3N A;  2O8D B;  2Z1H A;  1RTH A;  1JCE A;  3U4L A;  1YHQ N;  3SI6 A;  3V9W A;  3AO4 A;  1LCU A;  2HF4 A;  1BDG A;  4JN4 A;  4CJK A;  5LMN K;  1VQ9 N;  3A5L C;  3P83 D;  3NH2 A;  4JI2 K;  4JI5 K;  3DWL A;  1Y97 A;  4XEI A;  4JI8 K;  4BRI A;  3THW B;  3E1Y A;  5F1X A;  3HST B;  2A6A A;  1GLD G;  1Q82 O;  1HJO A;  2O4G A;  4KHQ A;  3E66 A;  4O0J A;  3C6U A;  4BRD A;  2ASO A;  2HMP A;  4J2D A;  3C0B A;  4DQI A;  4KHY A;  3VEZ A;  2V7Z A;  4JNE A;  4CHP A;  1VQ4 N;  1F21 A;  3KLI A;  1KSP A;  3SNN A;  4DTP A;  5GAD P;  3D2E B;  3AVN A;  5A2Q O;  5JLH A;  2B4J A;  3DOL A;  3O8M A;  3ZEU B;  1HKB A;  1ZBL A;  3OY9 A;  1N5Y A;  1NM1 A;  4IO9 L;  4KHW A;  3NCI A;  2PBD A;  3HP6 A;  3MEE A;  1C1C A;  3VMF B;  3CER A;  2IGI A;  4F2R A;  4MLH A;  3UKU A;  1W0H A;  3UE5 A;  4RW8 A;  4ISE A;  4AHT A;  3KTQ A;  4IXC A;  3C94 A;  3TAE A;  1U47 A;  4L8R B;  3DLG A;  3QIC A;  4M42 A;  2HHH K;  4HVJ A;  3IUC A;  5FPE A;  3T69 A;  4FWO A;  4HUG A;  3SUQ A;  4BR2 A;  3PSI A;  2IOC A;  2HHV A;  3CQ8 A;  2OPS A;  4NCG A;  4WQ5 C;  4LF5 K;  4DV7 K;  1VQK N;  3AVK A;  2HBL A;  5AQO A;  4E0D A;  4YOV A;  4O0I A;  4ISG A;  4B1Z A;  3SBG A;  2VYP A;  4DU1 A;  4GV9 A;  1NMD A;  2RE2 A;  4MQ3 A;  1FJG K;  2ZWH A;  2HST A;  3AO2 A;  1YJW N;  4C8L A;  4JI4 K;  1CLQ A;  1VSK A;  3O9S A;  4WQ5 A;  2NRR A;  3PX6 A;  4EZ6 A;  1ATR A;  3CM5 A;  4DUY K;  1OH8 A;  1DTT A;  5AZJ B;  3PIO L;  3EYZ A;  5FPD A;  2OPR A;  2IAJ A;  4LFC K;  1GOB A;  1RGI A;  3LL3 A;  4LSL A;  4Z4E A;  3JXU A;  1NK6 A;  2Z1I A;  4NXN K;  3QIO A;  1CZB A;  4BWJ A;  5HL7 L;  3L4Q A;  4BWM A;  4R79 A;  3SZ2 A;  5CE3 A;  4NLB A;  1RDD A;  1VQ8 N;  3CJ1 A;  2ZJP L;  3SAH A;  2E1Y A;  1XMO K;  3R9P A;  2YKM A;  4DTJ A;  1HYV A;  2P9P B;  1RT7 A;  4K43 A;  1VQN N;  4CW7 B;  4CGI A;  1Q7Y O;  5M1K A;  2OA8 A;  1HNZ K;  5ADX H;  4K25 A;  3K5M A;  3I8D A;  3PV8 A;  3LAN A;  1BQM A;  3ALY A;  4DSK A;  3ATU A;  1ASU A;  1J6Z A;  1FKP A;  4KV8 A;  1L5U A;  3TAM A;  1HR0 K;  4BRN A;  3U9D A;  2HVI A;  3NVM A;  5E26 A;  1RT5 A;  4OLA A;  3S3M A;  2FSN A;  2O8F A;  2ZE2 A;  2P5G A;  3K5N A;  4BRC A;  4BRH A;  1DT9 A;  1RFQ A;  4IFY A;  1VSI A;  3AVJ A;  3FFI A;  2V51 B;  4MDA A;  3WXM B;  1WAF A;  3HSC A;  5GIO A;  2YHW A;  4JV5 K;  4DWI A;  3OYJ A;  1LWE A;  2ZF5 O;  1NJW A;  3U6F A;  3QML A;  5AQP A;  5ADX A;  4FLT A;  3OYC A;  3HPG A;  3SK3 A;  3AO3 A;  4OGC A;  2FBV A;  3L0Q A;  4FZX C;  4H03 B;  3LDP A;  4JS5 A;  3B6O A;  4BRG A;  2OZM A;  2DFF A;  3UB5 A;  1DEJ A;  1K8A O;  5SZT A;  5IT9 O;  4EZ9 A;  3TPQ A;  4LF8 K;  1HNI A;  4K8Z A;  4FSV A;  3SQ1 A;  1KLM A;  1Z25 A;  1ZXO A;  3H3N O;  4BC4 A;  1MWK A;  3C7N A;  4BRA A;  5BR8 K;  3OYB A;  3O3H A;  1NNE A;  4N76 A;  2XY7 A;  4CJR A;  5TKY A;  5BRF A;  4CGJ A;  2X78 A;  3J81 O;  4O8U A;  4O5B A;  4BGB A;  3CCE N;  4FW2 A;  5HRP A;  3KLG A;  1SKW A;  2NLX A;  2O8B B;  1H1V A;  3DLB A;  1OH5 A;  4CF9 A;  4DQR A;  4HUE A;  5LJW A;  3SV3 A;  1CZ9 A;  4IEE A;  3SMP A;  2RHK A;  1REV A;  3JSM A;  1XQS C;  1QHA A;  2FF6 A;  1S9G A;  2BH1 A;  3ZSZ A;  4H0Y B;  1OH7 A;  1W2B M;  3NAE A;  4FK4 A;  4A5B A;  2ZJQ L;  5CYQ A;  1NBW A;  4YFU A;  4W5T A;  4B9V A;  1XHZ A;  4W5O A;  4A2B A;  2A40 A;  1NGE A;  3V9X A;  2OZS A;  4JKE A;  3PUF A;  1N34 K;  1RT4 A;  3PX4 A;  3H6E A;  4NYF A;  2KW4 A;  3HTV A;  4YHH K;  4A2A A;  3RRH A;  5AQJ A;  3CC7 N;  3SAF A;  3O3G A;  4YOX A;  5C25 A;  4CI6 A;  4DLE A;  3AA2 A;  4B3T K;  2D5R A;  4NXM K;  3CXC M;  1L3V A;  4H5W A;  4DF4 A;  5AQM A;  5DM6 L;  4PL7 A;  3KK3 A;  3OW2 M;  1N33 K;  3G25 A;  4CFB A;  2P9K B;  4M3T A;  1S1X A;  1A5X A;  2F9T A;  4FJJ A;  2GUI A;  5FRN A;  2AA4 A;  3H45 C;  4B8A B;  1TGO A;  1JXE A;  4DTN A;  5E84 A;  5AQV A;  3OYF A;  3M3Z A;  3A0I X;  3FZH A;  4BC5 A;  4DS4 A;  3TAN A;  4O5F A;  3QBW A;  3MN9 A;  1VSD A;  2G8U A;  3A5N C;  4DQQ A;  4GV6 A;  3VQD A;  3LPU A;  3VES A;  5JIC A;  1QQC A;  4E1M A;  3LDN A;  2BDP A;  1BIU A;  4BR0 A;  4JKH A;  1NKB A;  4BDY A;  3FZF A;  2UXD K;  1NK7 A;  5EVZ A;  1C0G A;  3C95 A;  4AHU A;  4JKF A;  3O9R A;  1HUX A;  1KD1 O;  3KLE A;  1EO1 A;  1LV5 A;  3TI0 A;  5B8H A;  4E1N A;  3CQY A;  5GIN A;  5FDL A;  1MA9 B;  3R1X A;  4BG8 A;  4K41 A;  1I39 A;  1WBD A;  2H3G X;  2XY6 A;  3TSU A;  3CD6 N;  1X1P A;  1YF5 L;  3D7E O;  3SAG A;  5FPN A;  1RDA A;  3R6M A;  3H3O B;  4B1X B;  4W5Q A;  4CIF A;  3OYD A;  1JLC A;  4UY8 O;  3QFU A;  5HRO A;  3U3Y A;  3G4S N;  2WFB A;  1RT3 A;  1RDU A;  4NLC A;  3UKU B;  3MXI A;  2YKN A;  4E7I A;  4B08 A;  4PL8 A;  2YJE A;  4J2E A;  1JLE A;  3E9O A;  1NK4 A;  2IVO A;  3VGL A;  4DKW A;  2GEM A;  4LF6 K;  3AVB A;  3I55 N;  3KWI A;  3VF4 A;  3L6Q A;  2LSN A;  3N4Q A;  5BPM A;  4K0K K;  1RTJ A;  4I2Q A;  2HNZ A;  3D0P A;  4FJI A;  4FK0 A;  2G8V A;  3SCX A;  4FVU A;  3K2P A;  1IKY A;  2NRX A;  1S9E A;  1IKV A;  1WN7 A;  3AVC A;  1WBB A;  4YOY A;  1R59 O;  2P9P A;  3MMV A;  4CZM A;  2YHB A;  4RTF D;  3SMS A;  3K57 A;  1ZBH A;  4AM7 A;  3AAP A;  3V4I A;  5DMR A;  1QZ5 A;  4EFH A;  2OCE A;  2GTD A;  2FF3 B;  4FL9 A;  3H46 O;  3VEW A;  4DCH A;  1E4G T;  1MU2 A;  2QWN A;  2VQF K;  1HQU A;  2E8A A;  1VSM A;  3H1Q A;  1BO5 O;  3AO1 A;  1BQN A;  4OGE A;  4DTU A;  2QWM A;  3ASM A;  3HOS A;  3CI5 A;  3GG4 A;  3T3F A;  4FJK A;  1EWQ A;  1J9A A;  4DLG A;  4FZY A;  3QER A;  4FJN A;  3VQE A;  1HMV A;  3DMJ A;  3R3L A;  4PWD A;  1YTA A;  4KAZ A;  3V1O A;  3WNG A;  3BEX A;  4RW4 A;  2A1R A;  2F4V K;  4X62 K;  1HX1 A;  1SL0 A;  3ZT1 A;  1NK8 A;  3L2W A;  1OVY A;  2I5J A;  4BGA A;  3CCU N;  1NGD A;  3EZW A;  4CF1 A;  1LWF A;  3PY8 A;  3MAQ A;  2ASP A;  3GE1 A;  3QEP A;  4DF8 A;  3DJC A;  1YUW A;  3D6R A;  2O8F B;  3MEC A;  2BGG A;  3DRR A;  2VG6 A;  3OHR A;  1KLN A;  1S1W A;  2Q36 A;  1KRP A;  4NO7 A;  4CE9 A;  4JEP A;  3SQ4 A;  1MWM A;  1GLL O;  2YHX A;  4M3Y A;  2GEL A;  2CGK A;  2KKZ A;  3M8P A;  1M90 O;  4CJT A;  2HBK A;  2NUB A;  3QEV A;  3RSE A;  2QW9 A;  4KRF A;  5AFU A;  4OPA A;  3AA4 A;  4CHZ A;  3A5O C;  4B9T A;  1SQK A;  1HKC A;  2V7Y A;  1K8K A;  4BC3 A;  2JWK A;  4K42 A;  3GDQ A;  3C7N B;  2BTF A;  3I8B A;  3LWL A;  1T6C A;  4FLZ A;  4NB4 A;  1Q18 A;  4LSN A;  2QWL A;  2IC3 A;  1NGF A;  3N4P A;  1O1W A;  5LJV A;  4JK7 A;  2EWS A;  1ZBI A;  1S6P A;  5AQW A;  1UAX A;  2E2N A;  5GAH P;  4KBO A;  3HM8 A;  4CK1 A;  3CCS N;  1HNW K;  4WQ4 A;  3WQT A;  1U48 A;  4JS4 A;  2VWJ A;  4FWK A;  4BRM A;  4DFK A;  3T7Z A;  2A1S A;  4KTW A;  4ELT A;  3F73 A;  4M7Y A;  3O4N A;  1ZBS A;  2QWQ A;  4WFN L;  4FO0 A;  4OKJ A;  1BL3 A;  2HHU A;  4DG1 A;  4OPH A;  4DS5 A;  5AQF A;  1HLU A;  3RTV A;  1U2V B;  3IAY A;  3CME N;  3E9L A;  3QBX A;  5KQ8 A;  3M8Q A;  4CZJ A;  4LF7 K;  2YHA A;  2HB5 A;  3SPZ A;  1BA0 A;  1C0F A;  1MDU B;  4XH5 A;  5LY3 A;  1ZBF A;  3L2V A;  3TAQ A;  1QVF M;  4XH1 A;  2OPP A;  2IVN A;  2HHX A;  1WLJ A;  4V19 S;  2XRI A;  3AGR A;  4BVP A;  1C1A A;  4FWR A;  3PLA A;  4FPA A;  4DR7 K;  3QLH A;  3WQU A;  4DR2 K;  1K9M O;  3L3U A;  1WSE A;  5C10 A;  1A5W A;  4FJ9 A;  4ID5 A;  3T1Y K;  4W5N A;  4QAG A;  3VQ5 A;  3U9Z A;  4C1N I;  4CGH A;  4IFV A;  4JI0 K;  2P9N B;  1BWF O;  3QEI A;  3CJC A;  4KHU A;  3MX5 A;  3WNF A;  3QIP A;  4AHC A;  5CYM A;  3NF8 A;  3T19 A;  2E6M A;  2DPN A;  2ZD1 A;  4X66 K;  4AM6 A;  3CMA N;  3IDH A;  4IZ9 A;  3P31 A;  1D4X A;  4MLE A;  1JCF A;  2D1K A;  1RDB A;  3SUP A;  4BRK A;  1VK0 A;  2Z1J A;  4JLH A;  5BPN A;  4YDU C;  2UU9 K;  3OYN A;  3I0R A;  3O1W A;  4GKK K;  5KI6 A;  1IKX A;  2UXC K;  3A5M C;  4JRQ A;  4H4M A;  4I6M A;  2PYJ A;  2NRW A;  4CJU A;  4YNQ A;  1NOZ A;  4GV3 A;  1NK0 A;  3HT3 A;  4N41 A;  4CJE A;  1UA1 A;  2WUS A;  1SV5 A;  4YDU A;  4CBU A;  4PQU A;  4DV0 K;  2Q0U A;  3G71 N;  3QES A;  1YXQ A;  3DI6 A;  1S1V A;  1NOY A;  2CH5 A;  2CGL A;  2NRH A;  5F0X A;  2OTL N;  4BY9 C;  3FGU A;  1GLE G;  1SUQ A;  5C2D A;  4BRQ A;  2O4I A;  1Q9Y A;  1Z26 A;  1N32 K;  4M7X A;  2CGJ A;  2D0P A;  2UUB K;  1SKR A;  2E6L A;  5BRD A;  2W6K A;  1R0A A;  3OYM A;  1YI2 N;  3OYI A;  4CFA A;  3L2U A;  4PKI A;  3BDP A;  3M1F A;  4Y1C A;  3PIP L;  1QVG M;  3CCJ N;  2YJF A;  5I9E B;  4FLY A;  4EHU A;  4B3R K;  2AP1 A;  4QS9 A;  4CJ7 A;  3ULE A;  1EXQ A;  3VEV A;  3LZI A;  3C65 A;  4LF4 K;  4QS7 A;  4AH9 A;  3ZCM A;  4CFD A;  1L3T A;  2QWR A;  3CYM A;  4QOZ B;  5I3U A;  3HJF A;  2F9W A;  4RG8 A;  3QEX A;  1FK9 A;  3LM2 A;  4CIG A;  3BGR A;  1NKE A;  3ZT4 A;  3AV9 A;  3NFA A;  3K58 A;  1S5J A;  4LFA K;  1XUP O;  1ZBU A;  3M8S A;  4F3T A;  1NGA A;  3MN7 A;  2VGN A;  5AQL A;  4CK2 A;  5C42 A;  3HYF A;  2KHO A;  5HBM A;  2KQ2 A;  1KVB A;  1BHL A;  1EWR A;  5BN9 A;  3RMC A;  2UXB K;  3DM2 A;  2YV0 X;  5AQZ A;  2YNG A;  1JCG A;  2X6N A;  1HYS A;  1RBS A;  3E01 A;  1VSJ A;  3DYA A;  3ZSR A;  2B6A A;  2XHB A;  2O8C B;  2KFN A;  5H1S Q;  4KTQ A;  5CY4 A;  3ID6 A;  4B9U A;  3W0L A;  4DU4 A;  5BRH A;  1U4B A;  1S3X A;  4DMN A;  3DAW A;  4CVN E;  3PX0 A;  4WCE L;  3OVN A;  1W97 L;  4CGF A;  1KAX A;  4CEZ A;  1TKZ A;  4FLX A;  3O9T A;  3MX2 A;  3ZSW A;  1BI4 A;  3CJ7 A;  3M6G A;  4C8M A;  4DR1 K;  1YVU A;  3NF9 A;  3SV4 A;  3T1A A;  3I56 N;  1HNV A;  1XHX A;  4N56 A;  4YOT A;  4CBX A;  3RR7 A;  2E20 A;  5M1P A;  2ITM A;  2NNW A;  3DLH A;  3ULD A;  4QS8 A;  2QXL A;  1TKX A;  4OVL A;  4DU3 A;  1E4F T;  3WXJ A;  3EE8 A;  3NE6 A;  4FOI A;  4LFB K;  1W9H A;  3BF1 A;  1V4T A;  2VG5 A;  3O80 A;  4AF1 A;  3K9J A;  3THY B;  4Q5V A;  4FJL A;  1RT2 A;  2D0B A;  4NYN A;  4OKE A;  3VF2 A;  1L3S A;  1A5V A;  5TKW A;  3HZ6 A;  4BR4 A;  4CD1 A;  4N47 A;  3K9K A;  5EX5 A;  3DXK A;  1RBU A;  4FWS A;  3RSE B;  4E89 A;  1XNR K;  3FZM A;  1TK5 A;  3KD1 E;  4JD2 A;  2F8S A;  1X3M A;  3LDL A;  4M3Z A;  5M1N A;  3NH0 A;  5F2R A;  3VTI A;  4JKB A;  5KPR A;  2PZS A;  2X6S A;  3O6W A;  4DQS A;  1K8K B;  1U2V A;  2ZJR L;  4DR6 K;  3V1R A;  3TTD A;  3L3V A;  4BDZ A;  1XI1 A;  1IG9 A;  2Q3S A;  4KH4 A;  1K6Y A;  4RW6 A;  1G99 A;  4BRL A;  1HPM A;  3IKM A;  3KLH A;  3DLE A;  4H0X B;  4WYB A;  2HNY A;  5KGX A;  4CED A;  4CEA A;  2A41 A;  4YY3 K;  1FXX A;  2KTQ A;  1KCF A;  3VEY A;  1LW2 A;  3NGY A;  5AQU A;  5E41 A;  3CFP A;  4WFB L;  3LAL A;  4IOA L;  1RT1 A;  4H8K A;  4KI6 A;  4CGD A;  1KVA A;  2GX9 A;  3THV A;  5FLX O;  4ICL A;  3LPT A;  3C6A A;  4K8X A;  4Y1D A;  3MXJ A;  1KFD A;  1B9F A;  4OJR A;  2R7Y A;  3J7Z O;  4H0P A;  1SZ2 A;  1JLA A;  2P9N A;  4B1U B;  2QTD A;  2P9U A;  2FC0 A;  2QM1 A;  3OYL A;  1VQO N;  1DGK N;  3OA9 A;  5AQX A;  2KFZ A;  3MDQ A;  1KQS M;  4KRE A;  3KK2 A;  4FWP A;  4KKO A;  2E2P A;  4NCB A;  3AAQ A;  3WUH A;  3KIO A;  2FLO A;  1RBV A;  4TSX A;  3LAK A;  3OYH A;  2J4R A;  5CZ1 A;  3VQ8 A;  4Z4I A;  4GW6 A;  5AQI A;  1SAZ A;  3RMB A;  2JWL A;  1IO2 A;  3F5T A;  1JL1 A;  4O4G A;  4ILG B;  3R8E A;  1HQE A;  1Q81 O;  3NDK A;  3A2F A;  2UUC K;  4DSL A;  3D45 A;  1OVQ A;  4C8O A;  3HBT A;  5BR9 A;  1VSL A;  5J2Q A;  3WNE A;  4FWN A;  3THX A;  3DXM B;  2YX6 A;  5HOO A;  2YI1 A;  1U04 A;  4FM0 A;  3VTH A;  4DUZ K;  1S6Q A;  3OS2 A;  2PY5 A;  3LWM A;  3NMU A;  5C2F A;  3EKU A;  4DV1 K;  4FJH A;  3OYE A;  3EY1 A;  1YTU A;  1NJX A;  4I6M B;  5FRM A;  4FW1 A;  4IFE A;  1NGB A;  3PSF A;  4CF2 A;  3QNO A;  2QA4 N;  3TWH A;  1ZYQ A;  3G0Z A;  2EX3 A;  1WOQ A;  2Y1J A;  4F9O A;  4CEF A;  1ZC6 A;  4HUF A;  1WB9 A;  1GLC G;  3S3O A;  1HPZ A;  5FRO A;  1QTM A;  3FFK B;  5HLF A;  5AQG A;  3TAF A;  1BUP A;  4H0V B;  3MWP A;  1NKC A;  1YVN A;  1ITG A;  1D8Y A;  4EP4 A;  3OYK A;  2G8I A;  3VER A;  5MLC Q;  5M1F A;  4FJ5 A;  3TAB A;  4E19 A;  4W5R A;  5T7B A;  5KPT A;  1CXU A;  3M8R A;  3KK1 A;  5BRE A;  4Z4C A;  5J2M A;  3BZK A;  3UKR A;  3V6D A;  1CXQ A;  1RIL A;  1BA1 A;  3M5R A;  1B9D A;  3VQ4 A;  1KVC A;  4C8N A;  4BR5 A;  1BU6 O;  3P38 A;  5HRN A;  1XNQ K;  3ULE B;  4A5A A;  1YIJ N;  2O8C A;  4DFJ A;  1Q86 O;  2VWK A;  3C6T A;  4XH4 A;  4HCC A;  2WTU A;  3HPH A;  3EL2 A;  3IRX A;  3NF7 A;  1NG9 A;  1I94 K;  2QXF A;  4FM2 A;  4DFM A;  3RMA A;  5EU7 A;  1NWK A;  3KD5 E;  1CZA N;  4IG0 A;  4L3Q A;  3P1G A;  3NGI A;  5HRR A;  2Z1G A;  4FYD A;  3CPE A;  2FSJ A;  1HYZ A;  3ZET A;  4JI6 K;  4IKF A;  4M3U A;  4CJ3 A;  3WT0 A;  1G15 A;  4RW7 A;  3ENB A;  4XIU A;  5HRS A;  4DV4 K;  3QEW A;  1JLB A;  5LMU K;  3EE9 A;  2QKK A;  4CF8 A;  2W40 A;  3S41 A;  2FBT A;  3C6H A;  4PA1 A;  3MEG A;  2W42 A;  1KAZ A;  2ZGY A;  4M63 C;  1QQO A;  5EOY A;  3SBT A;  4I9Q A;  5AFU H;  3BUZ B;  4CZF A;  2G8F A;  3OBY A;  5C12 A;  3CC4 N;  3CET A;  1C6V A;  5AR0 A;  3Q7B A;  4JHD B;  1BCM A;  3VQ9 A;  2E88 A;  4E7K A;  1TYQ B;  4OPK A;  3VQP A;  4GVM A;  4N5S A;  1U49 A;  1T6D A;  2I7P A;  3MN6 A;  3TAR A;  4X64 K;  3P5J A;  4YOR A;  3FLC O;  2OYQ A;  4CZH A;  4JK8 A;  4GKJ K;  3THY A;  1IV0 A;  3T1H K;  4CJP A;  3IG1 A;  3OYA A;  4JRP A;  4GNI A;  2BAN A;  3D2F A;  3S3N A;  2FBY A;  4DSE A;  1BI4 B;  2DFE A;  3AA5 X;  2HBJ A;  3VEO A;  2QI2 A;  2HND A;  5JS1 A;  1LAV A;  1BGX T;  4ZTF A;  4FXD A;  3K0S A;  2D0A A;  1ASW A;  3P39 A;  4JKD A;  3QET A;  2Q0R A;  2IS3 A;  4E1J A;  3CF5 L;  1VQ7 N;  2F7T A;  4ZTJ A;  2GUP A;  4E7H A;  3AVM A;  2CH6 A;  2OAN A;  4A61 A;  4KB1 A;  4FJM A;  1GOA A;  3A8Y A;  4WQ4 C;  3ZSO A;  3LDS A;  1WSH A;  1S1T A;  3SLC A;  4FWQ A;  4CHY A;  1TVR A;  1E3M A;  3ENH A;  3CQX A;  5KRS A;  3SJJ A;  4CZE A;  3WXI A;  3MN5 A;  4FOE A;  4LD0 A;  1JLG A;  3CJB A;  3MCP A;  4B1W B;  4Z94 A;  1VQ5 N;  2VQE K;  3EZ5 A;  3MED A;  4WFA L;  1TK8 A;  1IJJ A;  2HMI A;  3DXK B;  4CZK A;  4BR9 A;  1WSI A;  4CCH A;  2YNF A;  4GVE A;  4DTX A;  2D4W A;  4BC2 A;  1GLF O;  3OTO K;  4MO4 A;  4M45 A;  2HVH A;  4JD2 B;  4O44 A;  4E7L A;  1BG3 A;  1EKE A;  2Q2R A;  4CD3 A;  4RWT A;  3OBW A;  3NGZ A;  3IS9 A;  3K5O A;  4CJS A;  3NH1 A;  3OS0 A;  3F9M A;  4EHT A;  4B9M A;  3ZSX A;  2ZM6 K;  3BF3 A;  3I0S A;  1QS4 A;  1RT6 A;  2DTU A;  1U6Z A;  2VGM A;  3AVH A;  3HP9 A;  4CEQ A;  1ATS A;  1S72 N;  2VWB A;  1T05 A;  4OX9 K;  3CCQ N;  3PO5 A;  5KPZ A;  1JXB A;  4AHS A;  2YNI A;  2QWP A;  3VF6 A;  4IO8 A;  3HO1 A;  3JAM O;  4IEI A;  2DY4 A;  5FPM A;  3QB0 A;  5C15 A;  4B9L A;  4DQP A;  1ILY A;  2A5X A;  2ASM A;  3HI0 A;  4ZHR A;  4BQZ A;  1WSG A;  4E3S A;  2GV9 A;  2NRV A;  3ZT0 A;  3VQ6 A;  3K59 A;  2ZQB A;  4ILJ A;  2P9U B;  1TL3 A;  4CGG A;  4J2B A;  3CCR N;  1M1K O;  4BVO A;  3V9U A;  4DV6 K;  1YIT N;  4ID1 A;  1TKD A;  2A3Z A;  3I33 A;  2IIR A;  4CIE A;  4KI4 A;  3F2K A;  3TSP A;  3DXM A;  3U3G A;  3LP0 A;  4B1V A;  4BRO A;  3AVG A;  2KZM A;  4AQY K;  4U7B A;  1DKG D;  4CJL A;  3TR8 A;  3WXL A;  4PUO A;  1J54 A;  4JK9 A;  4HWI A;  1RDW X;  2P9L A;  3IMX A;  4JKA A;  4O8K A;  3O5B A;  4CEE A;  1N6Q A;  3VGM A;  2P9I B;  3RRG A;  2QEX N;  4DSF A;  1QQM A;  2BUP A;  4JI7 K;  3LP2 A;  4M3W A;  3VGK A;  2RN2 A;  1TAU A;  3THX B;  4AHV A;  3K5L A;  1TUU A;  2A42 A;  3BP8 A;  4WE1 A;  1IBL K;  1W7A A;  1QHT A;  3DLR A;  3VQC A;  1GLJ O;  3KVG A;  3J7Y P;  4F2S A;  4BRF A;  3DRP A;  1NJZ A;  2RF2 A;  5EXW A;  3V9Z A;  4Z4F A;  1VSH A;  4FK2 A;  1Q8I A;  3VEN A;  4IG3 A;  3SJH A;  4BQL A;  1SL2 A;  2HHT A;  3J7A P;  4C23 A;  2KLA A;  4F3O A;  3ZSY A;  2KZZ A;  3HRG A;  4CFC A;  3MCA B;  4PY5 A;  3L8B A;  1HRH A;  3LM9 A;  3HOT A;  2JLE A;  2O8E A;  1HNX K;  1RBR A;  5C24 A;  4FWL A;  4QCL A;  4MFB A;  1KXP A;  4X65 K;  4DR5 K;  1S22 A;  1OKJ A;  3H08 A;  4IJA A;  2D0O A;  2PAV A;  3TSQ A;  3LZJ A;  4F4K A;  1N8R O;  4H5N A;  3UKR B;  3CC2 N;  3OJS A;  2W6L A;  3TTF A;  4FJ8 A;  1T3V A;  1TKT A;  4DFP A;  4DTM A;  3RMD A;  1QE1 A;  5JMV A;  1IKW A;  1J5O A;  3CFO A;  3GBT A;  5DK5 A;  3OJU A;  4DR3 K;  2FBX A;  4B3O A;  5KGW A;  4CJQ A;  1X9J A;  2P9S B;  3CM6 A;  3B6P A;  4JI3 K;  1NK9 A;  2NRT A;  4J8F A;  4LY7 A;  4Z0U A;  1SL1 A;  1D5A A;  1KFS A;  1ESV A;  4WF9 L;  4JHD A;  4EP5 A;  2Q1N A;  1TYQ A;  4DR4 K;  4J2A A;  3ZET B;  3VET A;  2OPQ A;  4CBW A;  1Z05 A;  3ZX3 A;  2QWO A;  2GBZ A;  4H4O A;  3ZSQ A;  3LDO A;  4EAH D;  3WEE A;  4PKH A;  3TAG A;  3AY9 A;  3TTC A;  4CZL A;  1X9S A;  1HKG A;  2NRZ A;  3MXM A;  3DLL L;  1TUY A;  1NGG A;  3O9Q A;  3V9S A;  3HL8 A;  1IBM K;  1NMN A;  4KO0 A;  5ELZ A;  4LH5 A;  2XY5 A;  1YJ9 N;  1JL2 A;  2XY8 A;  4IBN A;  4HTU A;  3KWG A;  3ZX2 A;  2ZGZ A;  4CJW A;  3JYT A;  5CR4 A;  1LW0 A;  2G8K A;  4BE1 A;  2YNH A;  4DTO A;  2P5O A;  2G8H A;  4Q0B A;  3KKS A;  5AJ3 K;  3D2F B;  4KPY A;  4CES A;  2HBM A;  4NCA A;  4DV3 K;  1XC9 A;  3ZSV A;  3O08 A;  1LAW A;  2VG7 A;  3VOV A;  4ILH A;  5C0Y A;  4F8R A;  1QZ6 A;  1BCO A;  4JYA K;  4KTZ A;  4KFB A;  1NGJ A;  4CJF A;  2F96 A;  4FLW A;  4CJV A;  3SUN A;  4CK3 A;  5SWM A;  1V4S A;  5AQT A;  5AZI A;  1ATN A;  4B9N A;  4FJ7 A;  2Q97 A;  2X74 A;  1TAQ A;  3P4I A;  3HVR A;  1O13 A;  3MWT A;  4H5T A;  1RTI A;  3CPW M;  3L4I A;  3FZL A;  1Y64 A;  4OLB A;  3V1Q A;  1T44 A;  3GOI A;  3Q7C A;  1NU0 A;  1JJ2 M;  3KZB A;  4G1Q A;  4FJG A;  1Z6R A;  3HXM A;  4IOC L;  2P51 A;  3UIQ A;  5EY4 A;  1VSF A;  3H1V X;  3KHY A;  1VQ6 N;  3VQA A;  4H0T B;  1EQY A;  4H5R A;  5K14 A;  2E2Q A;  5J1E A;  2D0C A;  3J8A A;  4I2P A;  3AVL A;  2HHS A;  4FVM A;  1N36 K;  4JKG A;  3CG7 A;  3LP1 A;  3S9H A;  3RWU A;  3VN5 A;  1IH7 A;  4DB3 A;  1XMQ K;  3O1B A;  5M1Q A;  1RBT A;  1SS6 A;  4Y0W A;  5AQH A;  2O8D A;  4CER A;  3VQ7 A;  2ITG A;  1YJN N;  2P1J A; 
#chains in the Genus database with same CATH homology
 4X62 K;  3OTO K;  4V19 S;  4B3R K;  1XMO K;  4JI6 K;  4LF4 K;  1IBM K;  4DR7 K;  4CW7 B;  1IBL K;  4DR2 K;  1HNZ K;  2ZM6 K;  4DV4 K;  2UUA K;  5LMU K;  2UUC K;  3T1Y K;  3J7Y P;  1XNR K;  4LFA K;  1HR0 K;  5A2Q O;  4B3M K;  1N34 K;  4JI0 K;  4KHP K;  4DUZ K;  1J5E K;  4OX9 K;  4LF6 K;  4YHH K;  4DR6 K;  4DV1 K;  3J7A P;  1IBK K;  4JI1 K;  5AJ3 K;  2UXB K;  4X66 K;  3JAM O;  4B3T K;  4K0K K;  4DV3 K;  4NXM K;  3J80 O;  4JV5 K;  1HNX K;  1N33 K;  5LL6 Z;  4X64 K;  2HHH K;  2E5L K;  4GKJ K;  2UU9 K;  4X65 K;  3T1H K;  4DR5 K;  4JYA K;  4GKK K;  4YY3 K;  2UXC K;  4B3S K;  4LF5 K;  4CVN E;  4DV7 K;  4LF9 K;  4DV6 K;  5FLX O;  1HNW K;  1FJG K;  5IT9 O;  2F4V K;  4LF8 K;  2VQF K;  4DV0 K;  4DR3 K;  4JI4 K;  5BR8 K;  4DR1 K;  4JI3 K;  4AQY K;  4DUY K;  2UXD K;  3J81 O;  4LFC K;  1N32 K;  1XNQ K;  4DR4 K;  2UUB K;  4LF7 K;  2VQE K;  5LMN K;  4DV5 K;  4NXN K;  1N36 K;  4DV2 K;  4JI2 K;  4JI5 K;  4LFB K;  1XMQ K;  1I94 K;  4JI7 K;  4JI8 K;  5IWA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...