3NF7A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf7A00
2GUIA 3LDSA 1BIUA 3QNNA 3MECA 4CGFA 5HRPA 5CYQA 4DTJA 3TR8A 1RT1A 4KRFA 1WSJA 5HRRA 3ZSVA 3PX6A 4JS4A 3SQ1A 3QERA 3AVKA 3DLKA 4J2BA 4FJNA 1VSKA 3P5JA 2XY8A 3KIOA 1IO2A 2XRIA 4KB1A 2EX3A 4CHPA 3TAGA 2XY7A 3MXMA 1NOZA 2VWJA 1RT2A 1G15A 3AVJA 3LANA 2YNFA 4CJFA 4DU1A 4E3SA 3MEGA 4RG8A 3RMBA 3PO4A 1KTQA 4DTUA 1L3SA 4PWDA 2Y1JA 4FZYA 3NHGA 3L3UA 2B5JA 3NGYA 4CJQA 4EP4A 4N56A 3VQBA 3ZSRA 3CFRA 4M42A 4KO0A 1HYSA 4Z4EA 1TVRA 1VSLA 1U47A 3HK2A 4CIEA 4Z4HA 4C8MA 1BQMA 2YV0X 1NJYA 1JXBA 4IKFA 4DFPA 4DQQA 2IS3A 3TAMA 1ASUA 3OYBA 4O5BA 4C8NA 2P5OA 4B8CA 3ZSZA 4Q0BA 3SUNA 1S1VA 4O55A 3KLEA 4DTMA 3CFOA 3NF7A 1D9FA 1EETA 2G8HA 3KKSA 3CQ8A 2P51A 4RW4A 1U4BA 1RT5A 1C0MA 1CXQA 3ZSQA 5J1EA 1UA0A 4QOZB 1GOAA 1LWCA 1FXXA 3SI6A 3K5LA 3L8BA 3OYNA 2XY6A 4PQUA 3OJSA 1CLQA 4AHRA 3RRHA 3DLGA 1Z26A 4N47A 1QQCA 5CY4A 3NGZA 2DTUA 1C1AA 5JS1A 5D3GA 4CF9A 4KI4A 1Z25A 1JL2A 2HNZA 4CFCA 4FCYA 4Z4IA 4QCLA 3O4NA 4DTRA 2PYJA 3HO1A 1NK9A 1UA1A 4HUFA 3UIQA 1JLCA 1I39A 4CEAA 4CF2A 2B6AA 3ASMA 3DLRA 3SNNA 3AVGA 1TK8A 1D9DA 1KVBA 3BDPA 1ASWA 1QS4A 1RTJA 4FLVA 2WOMA 2FC0A 4LSNA 1QSYA 1RDDA 3VA0A 2IAJA 1NKEA 3DRPA 3DOLA 2HNDA 2VG7A 4HUGA 4DSFA 4CGHA 2OPQA 3MXIA 5DMRA 1SKRA 2NUBA 4LH5A 2HHUA 4FJJA 3QEXA 3WNHA 1J5OA 3G0ZA 2IDOA 5FDLA 3QEWA 2O4IA 3AO2A 4BWJA 3RTVA 4M3YA 2YHAA 4DSKA 4E0DA 3KD1E 3SPYA 3SQ2A 4B9MA 5I42A 4CGDA 3KTQA 4KPYA 3SV4A 5J2NA 4H8KA 3QIPA 3OY9A 4B9UA 1RDAA 3L2QA 3LWMA 1BI4A 1EP4A 4M45A 4CJPA 4DU3A 3OYJA 4GW6A 4FJKA 4FJIA 4KHUA 4BDZA 2YKNA 1NK6A 2FBVA 1TGOA 4KTWA 3M8SA 1JLAA 4W5OA 4DU4A 4CEEA 1HQUA 2HNYA 3O3GA 3TWHA 2HHSA 1U04A 3OYHA 3QNOA 1NK7A 1XC9A 3NCIA 3DLEA 3RR8A 2YNGA 3IS9A 1WLJA 4O44A 4ZTFA 1NKCA 3LP2A 2XO7A 3SPZA 4M41A 3VQ7A 3SUQA 3HPOA 4FLZA 4OKEA 4BE0A 3THVA 4OGCA 4CJ4A 4DS4A 2Y1IA 1VRTA 2OPSA 3ISNC 1S6PA 4IFYA 4ELTA 4AHCA 1RNHA 4FJXA 1QE1A 3NDKA 4FZZA 3HSTB 1I3AA 4E89A 4DTSA 1IKXA 1HQEA 4FK2A 3F73A 4CERA 1TAUA 3D45A 4FJHA 3VQ9A 4CHOA 1RTDA 3QEIA 1UAXA 3EY1A 2QKBA 4DQIA 3TAQA 4OVLA 4KAZA 5K14A 4HCCA 2KZZA 4FLWA 4M3WA 2OZMA 1N5YA 2ETJA 3HPGA 2G8UA 4IBNA 1VSMA 3OS0A 2QK9A 1BL3A 4DTXA 1VRUA 4CFAA 2YKMA 1TL1A 1BIZA 1RT4A 4FLXA 5HLFA 5SWMA 1B9FA 4B3OA 3C6UA 3OYDA 3V9WA 4OPKA 4FJGA 1RILA 1YTAA 4IG3A 3PX4A 1LAVA 3RMAA 4Q5VA 2HHQA 3BGRA 3O3FA 1HYZA 4KKOA 2BE2A 4FJ8A 1TK5A 3VQPA 4N5SA 2F8SA 2HHTA 1TAQA 2HVHA 2IOCA 3ZSYA 3KLIA 4E7IA 3DLHA 3EZ5A 3AVHA 1BCMA 4JRPA 4I2PA 2QKKA 3AVAA 3HP9A 4CHYA 2GBZA 3AVIA 1JLQA 4GVMA 2BDPA 3ZSXA 3F9KA 3ZT2A 3OYIA 3AA2A 1TKDA 2HW3A 1K6YA 2VWKA 3G10A 4C8KA 1LW2A 5T7BA 4FZXC 4CEQA 4OKJA 4HCBA 2WONA 4CJTA 3LPTA 3OYFA 1DLOA 5KRSA 1WAJA 4ELVA 4E1NA 1X1PA 3OJUA 1S1XA 1NJZA 4O0IA 4CHQA 2D0AA 1VSJA 2OPPA 3H08A 4B9LA 4LH4A 1KRPA 1WAFA 2RF2A 2RPIA 4MQ3A 1T7PA 1C0UA 1RT7A 3E01A 3OVNA 5HRNA 4AH9A 5J2QA 3HXMA 1XHZA 3ZT0A 4F3TA 4LSLA 1B92A 4UQGA 4AILC 1C1BA 1KFSA 3DLBA 3M8PA 4H4MA 1TKTA 4WE1A 2YNIA 3K5OA 4TSXA 1WSEA 3MXJA 3VQ5A 3HT3A 4DF4A 3SUOA 1IKVA 4I2QA 2E6LA 4M3UA 1QHTA 4NCBA 5HRSA 1HNVA 3DOKA 3AVMA 1VSIA 1J53A 1SUQA 1XWLA 3V6DA 3I8DA 3NF9A 3RWUA 4DFKA 1FK9A 2X74A 4CJSA 3L2UA 3C6TA 5KGWA 1RTHA 4E7HA 5SZTA 1R0AA 1CZBA 3LZJA 3K57A 1HYVA 1O1WA 4B9SA 2AJQA 3OS2A 4KHYA 4M3ZA 4FJ7A 2B4JA 2A1SA 1REVA 2ZQBA 3KKRA 1EXQA 2KTQA 1B9DA 3CG7A 2OYQA 3OYKA 4CGGA 1WSGA 1T8EA 4KHNA 1WSIA 3JSMA 4DWIA 4DQRA 4ELUA 2A1RA 4L8RB 1CXUA 4CE9A 2Z1IA 4K8ZA 3D0PA 4DSLA 5FROA 4RW8A 3AVFA 2FBYA 3LP1A 3KLGA 1Q9YA 1C6VA 1S9GA 4H4OA 4FW1A 4B8AB 1Q9XA 5KI6A 1SV5A 1S6QA 4GMJB 3P83D 4CJEA 5C25A 3M8RA 1N6QA 2G8VA 1IKWA 1JLFA 5FRNA 3SZ2A 4CJ5A 4AHTA 3QO9A 3TARA 4OPJA 5JS2A 3ALYA 2FBXA 1A5XA 1NK8A 1S1TA 2X6NA 3QIOA 3OYAA 3V81A 2YHBA 4AHVA 4BDPA 3NH2A 1HMVA 1JXEA 2Z1HA 4CEFA 3NAEA 1X9WA 3DI6A 4BE1A 3RR7A 4PUOA 3LAMA 4RW6A 2YNHA 3IAYA 4PY5A 4B9TA 3SCXA 4O4GA 3O4QA 3I0SA 4AHSA 4C8LA 3V9UA 3QLHA 4CFBA 3L2WA 3HPHA 3U6FA 1ZYQA 1NJXA 3K59A 4EZ9A 1CZ9A 1NK4A 3HJFA 1L5UA 1W0HA 3ITHA 4BE2A 1KVAA 1ZBLA 2D5RA 3AA4A 1FKOA 3DYAA 1SL0A 4ID5A 1SL2A 1RBSA 2PYLA 3AO3A 3AVCA 1DTQA 4Y1CA 3QEPA 1WSHA 3IG1A 4R5PA 2Z1JA 3IRXA 3WNFA 3RMDA 3QINA 5I3UA 1KSPA 2BANA 3VA3A 1GOBA 1XI1A 1ZBHA 3K2PA 4W5NA 1D5AA 3VQAA 1KCFA 1X9SA 2DFHA 3TI0A 3KLFA 3K58A 3TAPA 3PO5A 4JRQA 4FM2A 3S9HA 1IH7A 4DMNA 3MEDA 3VQ4A 1U45A 4CJ3A 2OZSA 1ASVA 1VK0A 4QAGA 1BISA 1HPZA 3HP6A 3QESA 1D8YA 4OLAA 3LP0A 4F4KA 1QSLA 4CHNA 3DMJA 3U3YA 2X6SA 3TAFA 4FJLA 3ZSOA 4CECA 1W9HA 3NFAA 2GV9A 1ITGA 2VG5A 3VN5A 4CF1A 5CZ1A 3I0RA 4M3RA 1NKBA 4FLTA 3C94A 2OA8A 4KHSA 1J54A 4E19A 1KLNA 1Q8IA 2DFEA 3AVBA 2G8WA 1S5JA 2VG6A 1NOYA 4CCHA 1RT3A 1S9EA 4DFJA 1HRHA 2ZD1A 4CIGA 4KI6A 4CJUA 3HYFA 3OYEA 3AO5A 3KK2A 4J2DA 3A2FA 1EKEA 4I9QA 3L2VA 4N41A 3OYLA 4IG0A 3P1GA 4CJVA 4FJMA 4CEDA 5C42A 2HMIA 4CEZA 4ZTJA 2DY4A 3PUFA 4HUEA 3AO1A 4CK1A 3AO4A 1IKYA 1BCOA 3DRRA 2HB5A 1SKSA 4J2EA 3NH0A 4O0JA 4I9LA 4CJLA 1WNSA 3VQCA 1LAWA 4EP5A 4PA1A 1ZBUA 1NK0A 1QTMA 4OGEA 4Z4FA 5DK5A 3S3NA 3AVLA 4CJWA 3ZCMA 3S3MA 3SUPA 4CIFA 1RT6A 4JLHA 4CF0A 1L3UA 2G8KA 4FM1A 3KD5E 2RN2A 1RDCA 4FK4A 3HL8A 5FRMA 4FLUA 3AA3A 4I7FA 4ZHRA 1ZBFA 3U3GA 2W42A 4CGIA 3RMCA 4KREA 4B9VA 3DRSA 1NJWA 3PX0A 1NK5A 3ZT3A 3C95A 1Y97A 3V9ZA 4DSIA 3NH1A 3OYCA 3K5MA 4NCAA 1U49A 1LW0A 3LZIA 4ICLA 4E1MA 4HTUA 4BDYA 3QEVA 1U48A 3CM6A 1C0TA 4CGJA 4NYNA 3L2RA 1RBUA 1GOCA 4MFBA 4Z0UA 3KK1A 2F96A 3EYZA 3T3FA 3RRGA 4EZ6A 4N76A 4M3TA 4CF8A 3CM5A 3V1QA 2P5GA 1JLBA 1T05A 3SQ0A 3ZT1A 5CZ2A 4Y1DA 3T1AA 3LALA 5HBMA 4FM0A 1RBVA 1KFDA 4B08A 2HVIA 4HVJA 1UOCA 1UWBA 1S1UA 1S1WA 1XHXA 3O3HA 4K8XA 4OLBA 2HHVA 4DG1A 3WNEA 4W5RA 3NE6A 1L3TA 4FK0A 3ULDA 2E6MA 4F2SA 2LSNA 4ID1A 5KRTA 4CJRA 4KTQA 3AA5X 2X78A 4CK3A 4E7JA 3LP3A 1QSSA 4B9NA 3DM2A 2D0CA 1VSEA 2RKIA 5CYMA 4XIUA 3HVRA 4DQSA 5EU7A 2R7YA 3HM9A 1TK0A 2F8TA 3CYMA 2ATQA 4FVMA 4CEBA 3KLHA 4RW9A 1VSDA 3V9XA 1L3VA 3AV9A 2KQ2A 2KFZA 4G1QA 3M8QA 1IG9A 3OYGA 1HJRA 1JLGA 4LD0A 2G8IA 2DFFA 4E7LA 3V1OA 4CEOA 2QXFA 1LV5A 4YFUA 4CHZA 4IFVA 1BQNA 3OYMA 4DTNA 1WSFA 1DTTA 2Z1GA 4KHQA 2JLEA 4CESA 4YNQA 2OPRA 1YT3A 1RDBA 4JS5A 1RBRA 4DSEA 3V1RA 4DFMA 2KW4A 5KTQA 4DLEA 4FW2A 4FLYA 3HVTA 3CFPA 1J9AA 1HNIA 5HROA 3MEEA 2KZMA 5HP1A 2JGUA 1C1CA 2BGGA 3V9SA 4LY7A 3V4IA 4OJRA 1MU2A 1RBTA 3KJVA 3VQEA 5J2PA 1TKZA 5E41A 4C8OA 2FBTA 4W5TA 1BHLA 2E4LA 2G8FA 2O4GA 2KFNA 4HHTA 1EX4A 1JL1A 4F2RA 1ZBIA 2HHWA 4DS5A 4CK2A 4FYDA 4BACA 4KTZA 3NGIA 2D0BA 1JLEA 4NCGA 1YVUA 3OS1A 2PY5A 3VQ8A 4KHWA 1KLMA 1LWFA 4FJ9A 4FXDA 2XHBA 2EHGA 4E7KA 5C24A 4W5QA 3L3VA 3VQDA 5J2MA 3TAEA 3MAQA 4M3XA 1TL3A 3T19A 3NF6A 4DQPA 1VSHA 2IGIA 3ZSWA 3B6PA 2ITGA 3LAKA 5KGXA 4CJKA 4DLGA 3S3OA 1YTUA 3NF8A 1A5VA 4DF8A 3VQQA 4F3OA 4Z4GA 2HHXA 3LPUA 3SQ4A 3B6OA 3LWLA 1F21A 1RTIA 4AHUA 3SV3A 1BGXT 4Z4CA 4OKKA 1LWEA 1VSFA 1SL1A 3TABA 2PZSA 3QETA 1FKPA 1TV6A 3JYTA 4IDKA 1RCHA 2Q3SA 1BI4B 3ZT4A 1TKXA 4FJ5A 1X9MA 3K5NA 4KB0A 4NYFA 3SJJA 1KVCA 3AVNA 3NBPA 3WNGA 3PV8A 4F8RA 1SKWA 2XY5A 4CFDA 2ZE2A 2P1JA 4RW7A 3VQ6A 4DTOA 4DSJA 3KK3A 3PY8A 3FFIA 1T03A 1WN7A 1A5WA 3TANA 4KV8A 4DTPA 4BWMA 1JKHA 3SYZA 2I5JA 2IC3A 4J2AA 4KFBA
chains in the Genus database with same CATH superfamily
3LDSA 1T6DA 1KAXA 4E1JA 3R8EA 3TU5A 3TR8A 4BRLA 2A6AA 3D2FB 3DLKA 3EE9A 5IWAK 3EKSA 3C0BA 1QVFM 4CHPA 4QS7A 1NOZA 2E1ZA 1G15A 3AVJA 4CJFA 3RMBA 3PO4A 3MEGA 3DWLA 4DTUA 3VEOA 4JN4A 3WQTA 3NHGA 2B5JA 4CJQA 3ZSRA 3W3DA 4YOTA 5E84A 1VSLA 4WFAL 3CCUN 4Z4HA 3T1HK 4C8MA 1R59O 2YV0X 4BRPA 4DQQA 2QWMA 1QQOA 4C8NA 2P5OA 5AQRA 3SUNA 4O55A 3NF7A 3SLCA 5KQDA 3ZSQA 1UA0A 2FXUA 4QOZB 1WOQA 2AP1A 3CPEA 3OJSA 1CLQA 3CETA 3LDPA 5D3GA 3PIPL 1Z25A 2HNZA 4CZJA 3K0SA 3BP8A 4FCYA 4Z4IA 3HO1A 4IFEA 1JLCA 4CF2A 1WUAA 3SMSA 3ASMA 5C0YA 2QA4N 1ASWA 1QS4A 5JVHL 3VA0A 3DRPA 3DOLA 5LMUK 4HUGA 1NGCA 4DSFA 2OPQA 2Q0RA 3MXIA 5DMRA 3JAMO 1SKRA 1LCUA 3VOVA 2YCHA 2JWKA 1NGGA 1VQMN 3G0ZA 3QEWA 2O4IA 3EE8A 5C10A 4PL7A 3R3LA 4IXCA 4H03B 3SPYA 3CC2N 4MO4A 4CZKA 4KPYA 3FE1A 3LWMA 1TYQA 1EP4A 4CJPA 4BRNA 3FLCO 5AQIA 5F0XA 4FSVA 4KHUA 3MCPA 2YKNA 4W5OA 4X62K 1NNEA 3VEXA 2HHSA 4BRIA 3OYHA 1NK7A 5JMVA 5FLXO 3DLEA 4YORA 1VQ8N 4ZTFA 5EOYA 2XO7A 3SPZA 3G71N 1U2VA 4BVPA 3I56N 4OKEA 1VRTA 2OPSA 3J7AP 2PBDA 5CR4A 4GV6A 3NDKA 4A5AA 4FZZA 2Q31A 3F73A 1T3VA 3D45A 3VQ9A 4CHOA 3T7ZA 4DQIA 1ATRA 3AARA 3GL1A 4AF1A 3LM2A 3ID6A 4M3WA 4IBNA 1VSMA 3T1YK 1FW6A 4H5RA 4B3OA 1YTAA 2HHQA 4FJ8A 2BE2A 1TK5A 1NMNA 2WFBA 4BREA 5M1FA 3ZSYA 2BUPA 3EZ5A 3C6HA 2QKKA 3AVAA 4GVMA 3F9KA 1VQNN 3G10A 4C8KA 4JK8A 2H3GX 4CEQA 2WONA 3OYFA 4K25A 3TTDA 1X1PA 1NJZA 4DR2K 2D0AA 2RF2A 1T7PA 1C0UA 5HRNA 4LF9K 4LSLA 1B92A 4UQGA 4AILC 3KVGA 2HBJA 2F9WA 1TKTA 2UYTA 4WE1A 2YNIA 1WSEA 5LMNK 3OHRA 1GLEG 5FPNA 4G9ZA 3A5LC 1VQ6N 5HRSA 2UUCK 3DOKA 4QS9A 2NRTA 1J53A 3CMAN 3DXMA 4EFHA 4EAHD 2AJQA 3QB0A 3M6GA 1EXQA 2KTQA 1B9DA 3VF4A 1NLVA 4ELUA 4DR6K 2E2NA 1CXUA 4K8ZA 4IO9L 3D0PA 3L6QA 5AQVA 2FBYA 4H4OA 4FW1A 1QZ5A 3P83D 3M8RA 1JLFA 3VF2A 4AHTA 3TARA 3MK6A 3CD6N 5JS2A 3ALYA 2X6NA 4K43A 1JXEA 4BE1A 3IAYA 4B9TA 1OKJA 3O4QA 1Q7YO 2I7PA 3QLHA 3HPHA 1NM1A 3E1YA 1CZ9A 5AQNA 1RDWX 1L5UA 1W0HA 4PL8A 4H0TB 4BRHA 1BA1A 4B1UB 2CGLA 1SL0A 4ID5A 4DHYA 1DTQA 3G25A 4CBWA 3THWA 4R5PA 3IRXA 3CERA 3QINA 2BANA 1XI1A 3K2PA 5ADXH 1J5EK 3TI0A 2WC9A 3VQ4A 2OZSA 3HP6A 1D8YA 3LDLA 3H45C 3U3YA 5F1XA 4K42A 4JD2B 4B1WB 2GV9A 1ITGA 2VG5A 1ZXOA 2ZGZA 1NKBA 4FLTA 2OA8A 2AA4A 1IBLK 3BZKA 3A5NC 5CHIA 3ZEUA 3QMLA 1HRHA 2ZD1A 4CJUA 3KK2A 3FFKB 4N41A 2WUSA 4FJMA 1QQNA 3W0LA 4CEZA 3P39A 4V19S 4BQZA 3P4IA 3J81O 3VERA 1LOTB 1NMDA 3CC7N 1WNSA 1QTMA 1ZBUA 2NRZA 2P9LA 4JI2K 2V52B 2D0PA 5TKWA 3UKUA 1RT6A 1OVYA 1RDCA 4B1ZA 4ZHRA 2W42A 1ZBFA 4B9VA 3RVCA 1QZ6A 3K9KA 3PX0A 1NJWA 3C6AA 3V9ZA 4DSIA 3NH1A 3K5MA 4DV0K 1LW0A 4ICLA 3O8MA 1U48A 2P9IB 4CGJA 3J7YP 3L2RA 1RBUA 2VQEK 2P9KB 4Z0UA 1N33K 4M3TA 4K0KK 3CXCM 1JLBA 3SQ0A 3ZT1A 5M1NA 3LALA 5HBMA 1RBVA 3PSFA 4HVJA 1UOCA 1S1WA 3UKUB 4OLBA 4CBUA 3WNEA 3MN6A 3ULDA 2LSNA 5KRTA 3QICA 3U9DA 4BRGA 4CJRA 1T6CA 3E9OA 4JKGB 3LP3A 3EO3A 5GIPA 4DQSA 4XIUA 3GE1A 2UXCK 1E4GT 2O8EB 2ATQA 4CEBA 5GIOA 4RW9A 3KLHA 1MWKA 3V9XA 4YY3K 2NLXA 3GG4A 4Z94A 3THXB 2FSJA 2ASMA 4LD0A 2G8IA 3MN9A 2DFFA 4E7LA 3H3OB 5AQHA 2HBKA 4FPBA 4IFVA 1WSFA 4KHQA 4YNQA 4CZEA 2ZJQL 5AZIB 2QEXN 2E2QA 1RGIA 3CCLN 5KTQA 4FW2A 1C1CA 4DV1K 4O8KA 4LY7A 4IOXA 1IBMK 1RBTA 4DCHA 2NRRA 3QFPA 4HHTA 1EX4A 1SS6A 1ZBIA 2HHWA 3R1XA 2YJEA 5BPNA 5MLCQ 4KTZA 3NGIA 3ATUA 4NCGA 3VPZA 5GAHP 3D2EB 2P9UB 4PKIA 2XHBA 5J2MA 5JICA 4M3XA 2KKZA 3EL2A 2IGIA 5AFUH 5AQXA 1YTUA 3NF8A 1A5VA 4H5NA 3CJAA 4F3OA 3SQ4A 2ZWHA 1F21A 1RTIA 1SQKA 1BGXT 2FF6A 1LWEA 3I8BA 3MWPA 1FKPA 5BN8A 3JYTA 1RCHA 5BPMA 4KB0A 1NGDA 4NYFA 1KVCA 1RDUA 3NBPA 2F8TA 4F8RA 2P1JA 3KK3A 1A5WA 1YJWN 3H46O 4KV8A 3VEWA 2OTJN 3WXJA 4J2AA 4DV7K 3P38A 5HRPA 5HOOA 1EWQA 4KRFA 5AQOA 3ZSVA 3PX6A 4JS4A 3AVKA 4FJNA 4J2BA 1VSKA 3KIOA 2PFUA 2XRIA 4KB1A 2EX3A 3DAWA 2ZJRL 1DT9A 5DM6L 2VWJA 1RT2A 1TK0A 3LANA 1XQSC 4A61A 4PWDA 5BR8K 1HYSA 3E66A 2HBMA 4KO0A 3WXLA 1TVRA 2PAVA 3O9UA 4IKFA 4DFPA 3TAMA 4O5BA 1S1VA 3KLEA 4DTMA 1HLUA 1EETA 3KKSA 3CQ8A 3KHYA 2P51A 4RW4A 1U4BA 1RT5A 3WXMB 5J1EA 1LWCA 4PQUA 1I94K 4OX9K 4LFCK 2DTUA 5JS1A 4JNEA 5FPEA 1XC3A 3CC4N 3WEEA 4QCLA 3O4NA 3THYA 4YOXA 1UA1A 4H5VA 4CEAA 2B6AA 3DXKB 1VQ5N 3AVGA 1TK8A 4JHDB 5BPLA 1RTJA 4FLVA 2WOMA 1RDDA 1NKEA 2IAJA 5GADP 3ENHA 4JI7K 4KH6A 2HHUA 3JS6A 4FJJA 1E3MA 3AO2A 1ATNA 3U4LA 1BOTO 3WEEB 3SQ2A 4FWPA 4CGDA 5J2NA 1RDAA 4HWIA 1BI4A 4DU3A 3HOSA 4BDZA 3NVKA 4DU4A 4GKKK 5KPZA 1C0GA 3QNOA 3EEQA 4BGBA 3RR8A 1WLJA 1HX1A 4GV9A 3VQ7A 3SUQA 3THVA 4OGCA 4DS4A 2Y1IA 1TUYA 3FZHA 1RNHA 1H1VA 4FJXA 4KHPK 3HSTB 4E89A 4L3QA 4FK2A 2P9NA 1UAXA 3E9LA 3TAQA 4RTFD 4KAZA 3O9QA 1N5YA 5AQLA 4NB4A 1KAYA 4DTXA 1YUWA 4CFAA 1TL1A 1QVGM 1BIZA 1RT4A 3UB5A 4LF6K 3OYDA 4UY8O 4OPKA 1RILA 4IG3A 1D4XA 3PX4A 1LAVA 2HHTA 4CJ7A 3VQPA 1TAQA 2HVHA 3KLIA 4WQ4C 4XH5A 4B1VA 1S3XA 4CHYA 5BRFA 1K8AO 2CH5A 3OYIA 2HW3A 1VQPN 2P9NB 1K6YA 5HL7L 1LW2A 5T7BA 5AJ3K 4HCBA 1DLOA 3OJUA 4O0IA 4DKWA 3O9SA 3R6MA 1VSJA 2OPPA 4CHQA 1WAFA 2CGKA 1RT7A 3OVNA 3E01A 4AH9A 1E4FT 4NO7A 3VGKA 3ZT0A 4F3TA 4I6MB 5CE3A 5AQFA 4DR3K 3HT3A 1NK9A 3MXJA 4M3UA 3SUOA 4FWNA 4I2QA 2NZTA 1YHQN 2WTUA 1HNVA 3O1BA 2W6LA 1SUQA 1XWLA 3I8DA 3NF9A 2HMPA 2X74A 4CJSA 3JXUA 4BRAA 1OH8A 1R0AA 2GUPA 3M3ZA 3K57A 3OS2A 3VGLA 4FWMA 1OH6A 3IDHA 1K8KB 3KKRA 4CD1A 3OYKA 1T8EA 1WSGA 1WSIA 4DWIA 4PHTX 3WUHA 2D4WA 2Z1IA 4DSLA 4EHUA 3LP1A 4DV3K 4FJGA 5GAEP 5KI6A 1SV5A 1S6QA 4GMJB 5C25A 1IBKK 4H0OA 5C2DA 5LJWA 2FBXA 1S1TA 3MX5A 3VETA 3OYAA 1JCFA 3WT0A 2ITMA 4BDPA 1VQ4N 5ELZA 1VQ7N 1NWKA 1X9WA 2Z1HA 3DI6A 5M1OA 3RR7A 3LAMA 1M90O 4BR2A 4AHSA 2HF3A 4U7BA 1GLDG 2DPNA 3U6FA 4EZ9A 3HBTA 4WQ5C 5TKYA 3ITHA 1KVAA 4KH5A 3CJCA 2D5RA 4C23A 2GELA 3DYAA 3ATVA 1N32K 3CQYA 4YOVA 1Z6RA 3AVCA 3WXKA 3BZCA 5GAGP 3IG1A 3CJ7A 3RMDA 3WNFA 3SJHA 2A5XA 4B1XB 1ZBHA 4QS8A 1D5AA 1X9SA 1KCFA 4BRDA 3KLFA 4JRQA 4FM2A 1U45A 1VK0A 4QAGA 3R9PA 2NRHA 1HPZA 3QESA 2O8BB 4OLAA 4CZIA 3LP0A 3FGUA 4CHNA 3CJ9A 3CCRN 2X6SA 4GNIA 3SK3A 3NFAA 3VN5A 3O80A 4CZGA 1IG8A 5M1QA 1Q8IA 1CZAN 3MDQA 2DFEA 3TSPA 2G8WA 1S5JA 3CCVN 2VG6A 4K41A 1S9EA 1X3NA 4KI6A 2O8FB 4U67L 4XEIA 1EKEA 2NNWA 4I9QA 2RE2A 3OYLA 3P1GA 4CEDA 3PUFA 4CK1A 5JLFA 3DRRA 1SKSA 5AQTA 4J2EA 5H1SQ 4OO1J 4PA1A 5DK5A 1ILYA 3SUPA 2G8KA 4DV2K 3KD5E 3O9RA 1JCEA 4YDUC 1SZ2A 3J8AA 3CCJN 3K9JA 3TTCA 4FLUA 4I7FA 4LF4K 3DRSA 2QWLA 2E2PA 2F4VK 1NK5A 5AQZA 3OYCA 4YOYA 4NCAA 4FO0A 4HTUA 1OH7A 1ATSA 4DQ8A 1GOCA 3KK1A 3AAQA 3T3FA 2VCPA 4N76A 4EZ6A 2GEMA 4CF8A 5AR0A 3ZYYX 3RSEB 4FM0A 1QHAA 3HOTA 1OH5A 5M1KA 3O3HA 4K8XA 4DG1A 1HJOA 3NE6A 4C1NK 1GLCG 4ID1A 4JI8K 4KTQA 3AA5X 2FLOA 2X78A 4CK3A 1YJNN 3DM2A 4ILHA 5CYMA 3HVRA 2YX6A 4FWKA 3O5BA 4MO5A 3AV9A 2KFZA 4MLHA 3AAPA 3OYGA 2Q36A 1JLGA 3G6EN 3LDQA 2E1YA 4ISFA 4YFUA 4CHZA 4DTNA 1BO5O 3KK7A 4NLCA 4OPAA 1RBRA 4DLEA 4FLYA 1HNIA 3MEEA 4JD2A 4JKFA 5BREA 3CPWM 3V4IA 3TTFA 1T44A 3KJVA 5J2PA 4GY2B 4IEEA 1BHLA 3VMFB 5BRHA 3TSQA 4JKHA 4FPAA 4DB3A 3OA9A 4WYBA 1LWFA 4FJ9A 5C24A 4W5QA 3VQDA 3MAQA 4X65K 3NF6A 2QM1A 3IUCA 3ZSWA 3LAKA 3Q7BA 5KGXA 4NXNK 3S3OA 2QI2A 2HHXA 3B6OA 4WCEL 2W41A 3SV3A 4Z4CA 1DEJA 1VSFA 3KZBA 2PZSA 4JI0K 2Q3SA 2D1KA 3ZT4A 4GKJK 2F9TA 1X9MA 1YXQA 3CJ1A 3PV8A 1SKWA 2XY5A 4DSJA 2P9IA 3PY8A 2P9KA 4MDBA 1BWFO 4DTPA 2G8UA 2I5JA 3A5OC 2E8AA 3CCSN 1NGBA 5GINA 3QNNA 3MECA 4CGFA 5BR9A 1GLBG 5CYQA 1RT1A 1WSJA 5HRRA 3SQ1A 3PLAA 2O8DB 2XY8A 1M1KO 1IO2A 2GTDA 3MXMA 3TAGA 1HUXA 4E3SA 2YNFA 4LFAK 4JKGA 4JKEA 1KTQA 5KPTA 4EP4A 4DV6K 3VQBA 4FVUA 2O8EA 3HRGA 4CIEA 3O4WA 1JXBA 3THXA 2FSNA 2QTDA 4IZ9A 1XUPO 1D9FA 3VEVA 2UU9K 3UKRA 1C0MA 1CXQA 5AZIA 1GLLO 4WF9L 3ULEB 1FXXA 2E2OA 3N4QA 3FZFA 4WQ5A 1C0FA 4AHRA 4N47A 1Z26A 1GLAG 3NGZA 1P8ZA 4BRKA 1C1AA 1JL2A 2ZGYA 4B1YB 3I55N 4DTRA 2PYJA 1HNWK 1I39A 1YIJN 3DLRA 1Z05A 4JI6K 1D9DA 2HHHK 4BRMA 2FC0A 4LSNA 1QSYA 2O8CB 1VQLN 3ZX3A 3PSIA 3D2EA 2VG7A 3ZX0A 2P9UA 3C65A 4CGHA 3UKRB 4LH5A 3O08A 3OTOK 5FDLA 2A42A 4BGAA 4A57A 3RTVA 4JK9A 4E0DA 3IKMA 3KD1E 1BA0A 2Q2RA 5AZJA 4YHHK 3SV4A 4H8KA 2FSKA 4M45A 2A40A 4GW6A 1KAZA 1TGOA 2FBVA 1JLAA 4A62A 2HNYA 3O3GA 3NCIA 1DKGD 2YNGA 4O44A 1NKCA 4M41A 2ZM6K 4FLZA 4BE0A 1S6PA 4IFYA 2NRWA 3J7ZO 4ELTA 5EXWA 1I3AA 1HQEA 4YDUA 5AZJB 4CERA 1TAUA 1N8RO 5JLHA 3QEIA 5IT9O 3EY1A 2QKBA 4B3RK 4OVLA 5K14A 2ZJPL 1JCGA 1GLFO 3A8YA 3LDOA 1VQKN 4JI3K 5C15A 4JKBA 2ETJA 3HPGA 3OS0A 4JV5K 4WFNL 1YVNA 2YKMA 3FZKA 1V4TA 2E20A 5SWMA 1B9FA 1S22A 3RMAA 1RFQA 3O3FA 2OTLN 2F8SA 1K73O 4N5SA 1WB9A 3CIPA 2IOCA 3LL3A 3CMEN 3DLHA 3AVHA 4I2PA 4BRCA 3EZWA 4BC3A 3HP9A 3QDKA 1JLQA 3ZSXA 1TKDA 3AA2A 3ENOA 4FZXC 4OKJA 2HSTA 4CJTA 2VWBA 5KRSA 1WAJA 4X64K 3HI0A 4E1NA 3OW2M 3P31A 3OBWA 4ISEA 4LH4A 2RPIA 1XHZA 3DXKA 2W6KA 4GVEA 1SAZA 4JHDA 1KFSA 2A3ZA 3DLBA 2BH1A 1EQYA 4R79A 1IKVA 3EKUA 1QHTA 3F9MA 3VEYA 4DFKA 1FK9A 5AQQA 3L2UA 1MDUB 4H0XB 5KGWA 1W97L 5SZTA 4E7HA 1CZBA 4B9SA 1W7AA 2B4JA 2A1SA 2HOEA 3MX2A 2OYQA 4CGGA 3O6WA 4DQRA 1HKCA 1EWRA 4FWOA 2ASOA 4B3MK 3VENA 5FROA 4RW8A 3AVFA 3KLGA 4FJIA 4B8AB 4DV4K 4A59A 2ASPA 5FRNA 1FJGK 3SZ2A 4CJ5A 5A2QO 1ESVA 2F7TA 1A5XA 1NK8A 3CQXA 4CZMA 4CEFA 5C2FA 5KPRA 4PUOA 1OVQA 4PY5A 2QXLA 4JI1K 4O4GA 3I0SA 4DR1K 1ZYQA 3K59A 2UXBK 3HM8A 1G99A 4BE2A 3GBTA 3T69A 4DR5K 3ENBA 1FKOA 2PYLA 4M7YA 3QEPA 1WSHA 3SMPA 4CVNE 1KSPA 3EN9A 3VA3A 4IOCL 4BRQA 4W5NA 3PO5A 3K58A 3TAPA 1ASVA 4LF7K 1QSLA 3DMJA 1YITN 2ZF5O 3M1FA 3TAFA 3H3NO 3ZSOA 5JVGL 1VAZA 3DJCA 2JWLA 3ID8A 3I0RA 5CZ1A 4AQYK 4M3RA 4I6MA 2GX9A 1KLNA 4LFBK 4OPHA 2V51B 1NOYA 4CCHA 4DFJA 4CIGA 4BQLA 3AO5A 3A2FA 4HTLA 4IG0A 3VEZA 3CF5L 5C42A 4BVOA 1IKYA 1BCOA 2HB5A 4JKCA 3NH0A 1K8KA 4I9LA 4O0JA 3VQCA 4CJLA 4EP5A 2NRXA 2Q97A 4Z4FA 2P9SB 5AQJA 3F5TA 1K9MO 3ZCMA 2FF3B 1ZBSA 4CIFA 1DGKN 4CF0A 4FM1A 2QWQA 3Q7CA 4FOIA 5FRMA 2VGNA 3N4PA 3U3GA 4CGIA 3ZT3A 3C7NB 4CW7B 1U49A 3LZIA 4BDYA 3CM6A 5LY3A 3EYZA 3MWTA 3V1QA 2P5GA 1T05A 3MN7A 4DR7K 4Y1DA 1NGJA 2OCEA 1UWBA 2HHVA 4H5TA 3E9PA 4W5RA 1ZC6A 4FK0A 1KQSM 2E6MA 4F2SA 1BDGA 3HZ6A 4E7JA 1QSSA 4MLEA 4B9NA 4ISGA 2D0CA 1VSEA 2RKIA 3H1QA 5EU7A 2V7ZA 2R7YA 3HM9A 3CYMA 5AQYA 4A2AA 1VSDA 5F2RA 4BC2A 1L3VA 4G1QA 1GLJO 4H0YB 1HJRA 3L0QA 3V1OA 4BC5A 2HVIA 3OYMA 1DTTA 2Z1GA 4LF8K 4CESA 2OPRA 2O8BA 1HPMA 4JS5A 4X66K 5BRDA 4DSEA 3V1RA 4DFMA 4IO8A 3CCMN 4JYAK 3HVTA 1J9AA 4NXMK 5HP1A 2BGGA 1VHXA 2WBNA 4RCHA 4AM6A 2FBTA 2E4LA 2G8FA 2O4GA 2KFNA 4Y0WA 1JL1A 4DS5A 2O8FA 4JAXA 4XH4A 2D0BA 1JLEA 5AQGA 1YVUA 2PY5A 4KHWA 1S72N 1KLMA 4KH4A 2Q0UA 3SBGA 3TAEA 3L3VA 3H1VX 1TL3A 3T19A 4DQPA 3B6PA 2ITGA 2BTFA 4CJKA 3KWIA 4DF8A 4Z4GA 2VGMA 1XMQK 4CBXA 3LWLA 1EO1A 4LC9B 4FWQA 3CJBA 1SL1A 3TABA 2RHKA 3HSCA 3QETA 1TV6A 1HKGA 3NVMA 1N36K 1TYQB 3WQUA 5ADXA 4M7XA 2EWSA 3SJJA 3QBXA 3WNGA 5FPMA 4CFDA 2ZE2A 3VQ6A 4DTOA 1WN7A 3TANA 1QQMA 4BRFA 1WBBA 1JKHA 3QIPA 4CEOA 1U2VB 2GUIA 1BIUA 3I33A 4DTJA 3RSEA 1TUUA 2KHOA 3QERA 1HR0K 3P5JA 1KC8O 2XY7A 2J4RA 4B3SK 4DU1A 2YJFA 4RG8A 4FOEA 1L3SA 2Y1JA 4FZYA 2VYPA 3L3UA 3NGYA 1XNQK 4N56A 4M42A 3CFRA 3BY5A 4IJAA 4Z4EA 3HK2A 1U47A 2GWKA 1BQMA 4H5WA 1NJYA 2IS3A 3OYBA 1ASUA 3BF3A 4B8CA 3ZSZA 4Q0BA 1YJ9N 3CFOA 2G8HA 4JI5K 2V7YA 1WBDA 3FZMA 2VQFK 1GOAA 1YAGA 3SI6A 3AGKA 3K5LA 3OYNA 3L8BA 2XY6A 3RRHA 3DLGA 1QQCA 5CY4A 4GV3A 1P90A 4CF9A 4KI4A 4M63C 1NGEA 4CFCA 4PKHA 3O1WA 1XMOK 2KLAA 2QW9A 4HUFA 3UIQA 1NGIA 2E88A 3SNNA 3OBYA 1KVBA 3BDPA 3F2KA 2IVNA 2HNDA 1IV0A 2NUBA 2YHXA 4J8FA 3QEXA 4ILGB 2I7NA 3WNHA 1J5OA 2IDOA 4BWJA 4M3YA 3DXMB 2YHAA 4DSKA 3S41A 1U6ZA 4B9MA 5I42A 4B3TK 3KTQA 3OY9A 4B9UA 4WQ4A 3L2QA 5EY4A 5EX5A 4B9QA 3OYJA 4FJKA 4CD3A 1NK6A 4KTWA 3M8SA 4FWRA 3CCEN 3SAFA 4CEEA 1HQUA 3TWHA 1U04A 2Q1NA 1XC9A 3IS9A 3L4QA 3LDNA 2QWPA 3LP2A 3BF1A 3HPOA 3H6EA 1NGFA 3FZLA 4CJ4A 5DM7L 3ISNC 4AHCA 2O8DA 1QE1A 4DTSA 1IKXA 4JI4K 2P9PA 1YI2N 4JKDA 4FJHA 1RTDA 1YF5L 4HCCA 2KZZA 4FLWA 2OZMA 2QK9A 3GDQA 1BL3A 1VRUA 3MMVA 4FLXA 5HLFA 5AFUA 3C6UA 3V9WA 5LL6Z 4O8UA 3O9TA 1BUPA 4Q5VA 2D0OA 3BGRA 1HYZA 4KKOA 1VQ9N 2E5LK 3DLLL 5AQUA 4E7IA 3SAHA 4BG8A 1BCMA 4JRPA 3THWB 1KXPA 2P9PB 2GBZA 3ULEA 3AVIA 2BDPA 4CI6A 2IIRA 4O5FA 3ZT2A 2VWKA 4JKAA 4BR9A 5C12A 2QWNA 3LPTA 3KWGA 4FWLA 4ELVA 1S1XA 4B9LA 5FPDA 3H08A 1KRPA 4PKGA 4MQ3A 4BR7A 5J2QA 3HXMA 5AQWA 1C1BA 3D6RA 3M8PA 4BG9A 4H4MA 4CZFA 4TSXA 3K5OA 3VQ5A 4DF4A 2O8CA 4FL9A 1NJIO 2E6LA 4NCBA 3ZEUB 4AM7A 1KD1O 3MCAB 4WFBL 3AVMA 1VSIA 3V6DA 3RWUA 3C6TA 1RTHA 4C1NI 3LZJA 1HYVA 1O1WA 3MN5A 4KHYA 4M3ZA 4FJ7A 1REVA 2ZQBA 2OANA 3G4SN 3CG7A 3U8XA 4JEPA 2P9LB 4KHNA 3CI5A 3JSMA 1BU6O 2A1RA 1X3MA 1NBWA 4L8RB 3A5MC 4CE9A 2CGJA 1N34K 1J6ZA 4H0VB 1Q81O 1Q9YA 1C6VA 1S9GA 1Q9XA 1N6QA 1HKBA 4CJEA 2UUBK 2G8VA 1IKWA 4CZHA 5LJVA 3QO9A 4OPJA 5BN9A 3GOIA 3QIOA 3V81A 4A2BA 2YHBA 4AHVA 3NH2A 1NU0A 1HMVA 3NAEA 1V4SA 4IJNA 4DUZK 4RW6A 2YNHA 3SCXA 3AY9A 4C8LA 5AQPA 3V9UA 4CFBA 3L2WA 3VTIA 1NJXA 1NK4A 4BC4A 3HJFA 1ZBLA 1W2BM 2YI1A 3AA4A 4BR5A 3BEXA 3UE5A 1SL2A 1RBSA 3AGRA 3AO3A 4Y1CA 2HF4A 2Z1JA 5I3UA 1GOBA 3L4IA 3VQAA 3QFUA 2DFHA 3S9HA 3WXIA 1IH7A 5AQMA 4DMNA 3MEDA 4F9OA 4CJ3A 4FWSA 1BISA 3LM9A 4F4KA 4IWVA 4FJLA 4BR4A 4CECA 1W9HA 4CF1A 3C94A 4KHSA 1J54A 2YHYA 3IFRA 4E19A 2NRVA 3AVBA 1RT3A 4DR4K 3HTVA 5E26A 2YHWA 3ZETA 3HYFA 3OYEA 4J2DA 4BROA 5EVZA 3D7EO 5AQSA 3L2VA 4IDHA 4CJVA 2DY4A 4DUYK 2HMIA 4ZTJA 4LF5K 3CHWA 3AO1A 4HUEA 3ZLJA 3AO4A 3SBTA 3BUZB 3IMXA 1LAWA 5AQKA 1NK0A 4OGEA 1Q82O 3S3NA 4IEIA 3AVLA 4CJWA 3S3MA 3TPQA 3M5RA 1L3UA 4JLHA 2RN2A 4FK4A 1NGAA 3HL8A 3B8AX 3AA3A 1HNZK 4DV5K 2QWRA 3RMCA 4KREA 3C95A 3ZETB 1Y97A 4CZLA 4ILJA 5I9EB 4E1MA 3QEVA 1C0TA 4NYNA 4MFBA 4YOUA 1JJ2M 2F96A 3RRGA 3CM5A 5KQ8A 5CZ2A 4XH1A 3T1AA 4H0PA 4B08A 1KFDA 1S1UA 1XHXA 3VTHA 4BY9C 3VF6A 1L3TA 2W40A 3VGMA 2A41A 5M1PA 5B8HA 1Q86O 1MWMA 3U9ZA 3A0IX 4JK7A 4FVMA 2QWOA 4EIAA 4NLBA 2KQ2A 1IG9A 3M8QA 1NG9A 3NMUA 2QXFA 1LV5A 4A5BA 1BQNA 2JLEA 1Y64A 3PIOL 1YT3A 1RDBA 2KW4A 2CH6A 5HROA 3CFPA 2KZMA 2JGUA 3V9SA 4OJRA 1MU2A 3J80O 2UUAK 4BR0A 3ZX2A 3VQEA 1TKZA 5E41A 1VQON 4C8OA 4RWTA 4W5TA 3THYB 1NGHA 4KBOA 2UXDK 1Q18A 1HNXK 4F2RA 1XNRK 4CK2A 1O13A 4BACA 4FYDA 2GWJA 3QBWA 3OS1A 3VQ8A 4FXDA 2EHGA 4E7KA 2IVPA 4EHTA 1VSHA 3TSUA 3FR0A 4DLGA 3CCQN 2P9SA 1X9JA 3VESA 1IJJA 3VQQA 3D2FA 3LPUA 4AHUA 4OKKA 2IVOA 4IDKA 1MA9B 1BI4B 1TKXA 4FJ5A 3K5NA 3C7NA 4YOWA 3AVNA 1BG3A 4RW7A 4IOAL 4MDAA 3FFIA 1T03A 3SAGA 2HBLA 4BWMA 3SYZA 2IC3A 4KFBA
chains in the Genus database with same CATH topology
2GUIA 3LDSA 1BIUA 3QNNA 3MECA 4CGFA 5HRPA 5CYQA 4DTJA 3TR8A 1RT1A 4KRFA 1WSJA 5HRRA 3ZSVA 3PX6A 4JS4A 3SQ1A 3QERA 3AVKA 3DLKA 4J2BA 4FJNA 1VSKA 3P5JA 2XY8A 3KIOA 1IO2A 2XRIA 4KB1A 2EX3A 4CHPA 3TAGA 2XY7A 3MXMA 1NOZA 2VWJA 1RT2A 1G15A 3AVJA 3LANA 2YNFA 4CJFA 4DU1A 4E3SA 3MEGA 4RG8A 3RMBA 3PO4A 1KTQA 4DTUA 1L3SA 4PWDA 2Y1JA 4FZYA 3NHGA 3L3UA 2B5JA 3NGYA 4CJQA 4EP4A 4N56A 3VQBA 3ZSRA 3CFRA 4M42A 4KO0A 1HYSA 4Z4EA 1TVRA 1VSLA 1U47A 3HK2A 4CIEA 4Z4HA 4C8MA 1BQMA 2YV0X 1NJYA 1JXBA 4IKFA 4DFPA 4DQQA 2IS3A 3TAMA 1ASUA 3OYBA 4O5BA 4C8NA 2P5OA 4B8CA 3ZSZA 4Q0BA 3SUNA 1S1VA 4O55A 3KLEA 4DTMA 3CFOA 3NF7A 1D9FA 1EETA 2G8HA 3KKSA 3CQ8A 2P51A 4RW4A 1U4BA 1RT5A 1C0MA 1CXQA 3ZSQA 5J1EA 1UA0A 4QOZB 1GOAA 1LWCA 1FXXA 3SI6A 3K5LA 3L8BA 3OYNA 2XY6A 4PQUA 3OJSA 1CLQA 4AHRA 3RRHA 3DLGA 1Z26A 4N47A 1QQCA 5CY4A 3NGZA 2DTUA 1C1AA 5JS1A 5D3GA 4CF9A 4KI4A 1Z25A 1JL2A 2HNZA 4CFCA 4FCYA 4Z4IA 4QCLA 3O4NA 4DTRA 2PYJA 3HO1A 1NK9A 1UA1A 4HUFA 3UIQA 1JLCA 1I39A 4CEAA 4CF2A 2B6AA 3ASMA 3DLRA 3SNNA 3AVGA 1TK8A 1D9DA 1KVBA 3BDPA 1ASWA 1QS4A 1RTJA 4FLVA 2WOMA 2FC0A 4LSNA 1QSYA 1RDDA 3VA0A 2IAJA 1NKEA 3DRPA 3DOLA 2HNDA 2VG7A 4HUGA 4DSFA 4CGHA 2OPQA 3MXIA 5DMRA 1SKRA 2NUBA 4LH5A 2HHUA 4FJJA 3QEXA 3WNHA 1J5OA 3G0ZA 2IDOA 5FDLA 3QEWA 2O4IA 3AO2A 4BWJA 3RTVA 4M3YA 2YHAA 4DSKA 4E0DA 3KD1E 3SPYA 3SQ2A 4B9MA 5I42A 4CGDA 3KTQA 4KPYA 3SV4A 5J2NA 4H8KA 3QIPA 3OY9A 4B9UA 1RDAA 3L2QA 3LWMA 1BI4A 1EP4A 4M45A 4CJPA 4DU3A 3OYJA 4GW6A 4FJKA 4FJIA 4KHUA 4BDZA 2YKNA 1NK6A 2FBVA 1TGOA 4KTWA 3M8SA 1JLAA 4W5OA 4DU4A 4CEEA 1HQUA 2HNYA 3O3GA 3TWHA 2HHSA 1U04A 3OYHA 3QNOA 1NK7A 1XC9A 3NCIA 3DLEA 3RR8A 2YNGA 3IS9A 1WLJA 4O44A 4ZTFA 1NKCA 3LP2A 2XO7A 3SPZA 4M41A 3VQ7A 3SUQA 3HPOA 4FLZA 4OKEA 4BE0A 3THVA 4OGCA 4CJ4A 4DS4A 2Y1IA 1VRTA 2OPSA 3ISNC 1S6PA 4IFYA 4ELTA 4AHCA 1RNHA 4FJXA 1QE1A 3NDKA 4FZZA 3HSTB 1I3AA 4E89A 4DTSA 1IKXA 1HQEA 4FK2A 3F73A 4CERA 1TAUA 3D45A 4FJHA 3VQ9A 4CHOA 1RTDA 3QEIA 1UAXA 3EY1A 2QKBA 4DQIA 3TAQA 4OVLA 4KAZA 5K14A 4HCCA 2KZZA 4FLWA 4M3WA 2OZMA 1N5YA 2ETJA 3HPGA 2G8UA 4IBNA 1VSMA 3OS0A 2QK9A 1BL3A 4DTXA 1VRUA 4CFAA 2YKMA 1TL1A 1BIZA 1RT4A 4FLXA 5HLFA 5SWMA 1B9FA 4B3OA 3C6UA 3OYDA 3V9WA 4OPKA 4FJGA 1RILA 1YTAA 4IG3A 3PX4A 1LAVA 3RMAA 4Q5VA 2HHQA 3BGRA 3O3FA 1HYZA 4KKOA 2BE2A 4FJ8A 1TK5A 3VQPA 4N5SA 2F8SA 2HHTA 1TAQA 2HVHA 2IOCA 3ZSYA 3KLIA 4E7IA 3DLHA 3EZ5A 3AVHA 1BCMA 4JRPA 4I2PA 2QKKA 3AVAA 3HP9A 4CHYA 2GBZA 3AVIA 1JLQA 4GVMA 2BDPA 3ZSXA 3F9KA 3ZT2A 3OYIA 3AA2A 1TKDA 2HW3A 1K6YA 2VWKA 3G10A 4C8KA 1LW2A 5T7BA 4FZXC 4CEQA 4OKJA 4HCBA 2WONA 4CJTA 3LPTA 3OYFA 1DLOA 5KRSA 1WAJA 4ELVA 4E1NA 1X1PA 3OJUA 1S1XA 1NJZA 4O0IA 4CHQA 2D0AA 1VSJA 2OPPA 3H08A 4B9LA 4LH4A 1KRPA 1WAFA 2RF2A 2RPIA 4MQ3A 1T7PA 1C0UA 1RT7A 3E01A 3OVNA 5HRNA 4AH9A 5J2QA 3HXMA 1XHZA 3ZT0A 4F3TA 4LSLA 1B92A 4UQGA 4AILC 1C1BA 1KFSA 3DLBA 3M8PA 4H4MA 1TKTA 4WE1A 2YNIA 3K5OA 4TSXA 1WSEA 3MXJA 3VQ5A 3HT3A 4DF4A 3SUOA 1IKVA 4I2QA 2E6LA 4M3UA 1QHTA 4NCBA 5HRSA 1HNVA 3DOKA 3AVMA 1VSIA 1J53A 1SUQA 1XWLA 3V6DA 3I8DA 3NF9A 3RWUA 4DFKA 1FK9A 2X74A 4CJSA 3L2UA 3C6TA 5KGWA 1RTHA 4E7HA 5SZTA 1R0AA 1CZBA 3LZJA 3K57A 1HYVA 1O1WA 4B9SA 2AJQA 3OS2A 4KHYA 4M3ZA 4FJ7A 2B4JA 2A1SA 1REVA 2ZQBA 3KKRA 1EXQA 2KTQA 1B9DA 3CG7A 2OYQA 3OYKA 4CGGA 1WSGA 1T8EA 4KHNA 1WSIA 3JSMA 4DWIA 4DQRA 4ELUA 2A1RA 4L8RB 1CXUA 4CE9A 2Z1IA 4K8ZA 3D0PA 4DSLA 5FROA 4RW8A 3AVFA 2FBYA 3LP1A 3KLGA 1Q9YA 1C6VA 1S9GA 4H4OA 4FW1A 4B8AB 1Q9XA 5KI6A 1SV5A 1S6QA 4GMJB 3P83D 4CJEA 5C25A 3M8RA 1N6QA 2G8VA 1IKWA 1JLFA 5FRNA 3SZ2A 4CJ5A 4AHTA 3QO9A 3TARA 4OPJA 5JS2A 3ALYA 2FBXA 1A5XA 1NK8A 1S1TA 2X6NA 3QIOA 3OYAA 3V81A 2YHBA 4AHVA 4BDPA 3NH2A 1HMVA 1JXEA 2Z1HA 4CEFA 3NAEA 1X9WA 3DI6A 4BE1A 3RR7A 4PUOA 3LAMA 4RW6A 2YNHA 3IAYA 4PY5A 4B9TA 3SCXA 4O4GA 3O4QA 3I0SA 4AHSA 4C8LA 3V9UA 3QLHA 4CFBA 3L2WA 3HPHA 3U6FA 1ZYQA 1NJXA 3K59A 4EZ9A 1CZ9A 1NK4A 3HJFA 1L5UA 1W0HA 3ITHA 4BE2A 1KVAA 1ZBLA 2D5RA 3AA4A 1FKOA 3DYAA 1SL0A 4ID5A 1SL2A 1RBSA 2PYLA 3AO3A 3AVCA 1DTQA 4Y1CA 3QEPA 1WSHA 3IG1A 4R5PA 2Z1JA 3IRXA 3WNFA 3RMDA 3QINA 5I3UA 1KSPA 2BANA 3VA3A 1GOBA 1XI1A 1ZBHA 3K2PA 4W5NA 1D5AA 3VQAA 1KCFA 1X9SA 2DFHA 3TI0A 3KLFA 3K58A 3TAPA 3PO5A 4JRQA 4FM2A 3S9HA 1IH7A 4DMNA 3MEDA 3VQ4A 1U45A 4CJ3A 2OZSA 1ASVA 1VK0A 4QAGA 1BISA 1HPZA 3HP6A 3QESA 1D8YA 4OLAA 3LP0A 4F4KA 1QSLA 4CHNA 3DMJA 3U3YA 2X6SA 3TAFA 4FJLA 3ZSOA 4CECA 1W9HA 3NFAA 2GV9A 1ITGA 2VG5A 3VN5A 4CF1A 5CZ1A 3I0RA 4M3RA 1NKBA 4FLTA 3C94A 2OA8A 4KHSA 1J54A 4E19A 1KLNA 1Q8IA 2DFEA 3AVBA 2G8WA 1S5JA 2VG6A 1NOYA 4CCHA 1RT3A 1S9EA 4DFJA 1HRHA 2ZD1A 4CIGA 4KI6A 4CJUA 3HYFA 3OYEA 3AO5A 3KK2A 4J2DA 3A2FA 1EKEA 4I9QA 3L2VA 4N41A 3OYLA 4IG0A 3P1GA 4CJVA 4FJMA 4CEDA 5C42A 2HMIA 4CEZA 4ZTJA 2DY4A 3PUFA 4HUEA 3AO1A 4CK1A 3AO4A 1IKYA 1BCOA 3DRRA 2HB5A 1SKSA 4J2EA 3NH0A 4O0JA 4I9LA 4CJLA 1WNSA 3VQCA 1LAWA 4EP5A 4PA1A 1ZBUA 1NK0A 1QTMA 4OGEA 4Z4FA 5DK5A 3S3NA 3AVLA 4CJWA 3ZCMA 3S3MA 3SUPA 4CIFA 1RT6A 4JLHA 4CF0A 1L3UA 2G8KA 4FM1A 3KD5E 2RN2A 1RDCA 4FK4A 3HL8A 5FRMA 4FLUA 3AA3A 4I7FA 4ZHRA 1ZBFA 3U3GA 2W42A 4CGIA 3RMCA 4KREA 4B9VA 3DRSA 1NJWA 3PX0A 1NK5A 3ZT3A 3C95A 1Y97A 3V9ZA 4DSIA 3NH1A 3OYCA 3K5MA 4NCAA 1U49A 1LW0A 3LZIA 4ICLA 4E1MA 4HTUA 4BDYA 3QEVA 1U48A 3CM6A 1C0TA 4CGJA 4NYNA 3L2RA 1RBUA 1GOCA 4MFBA 4Z0UA 3KK1A 2F96A 3EYZA 3T3FA 3RRGA 4EZ6A 4N76A 4M3TA 4CF8A 3CM5A 3V1QA 2P5GA 1JLBA 1T05A 3SQ0A 3ZT1A 5CZ2A 4Y1DA 3T1AA 3LALA 5HBMA 4FM0A 1RBVA 1KFDA 4B08A 2HVIA 4HVJA 1UOCA 1UWBA 1S1UA 1S1WA 1XHXA 3O3HA 4K8XA 4OLBA 2HHVA 4DG1A 3WNEA 4W5RA 3NE6A 1L3TA 4FK0A 3ULDA 2E6MA 4F2SA 2LSNA 4ID1A 5KRTA 4CJRA 4KTQA 3AA5X 2X78A 4CK3A 4E7JA 3LP3A 1QSSA 4B9NA 3DM2A 2D0CA 1VSEA 2RKIA 5CYMA 4XIUA 3HVRA 4DQSA 5EU7A 2R7YA 3HM9A 1TK0A 2F8TA 3CYMA 2ATQA 4FVMA 4CEBA 3KLHA 4RW9A 1VSDA 3V9XA 1L3VA 3AV9A 2KQ2A 2KFZA 4G1QA 3M8QA 1IG9A 3OYGA 1HJRA 1JLGA 4LD0A 2G8IA 2DFFA 4E7LA 3V1OA 4CEOA 2QXFA 1LV5A 4YFUA 4CHZA 4IFVA 1BQNA 3OYMA 4DTNA 1WSFA 1DTTA 2Z1GA 4KHQA 2JLEA 4CESA 4YNQA 2OPRA 1YT3A 1RDBA 4JS5A 1RBRA 4DSEA 3V1RA 4DFMA 2KW4A 5KTQA 4DLEA 4FW2A 4FLYA 3HVTA 3CFPA 1J9AA 1HNIA 5HROA 3MEEA 2KZMA 5HP1A 2JGUA 1C1CA 2BGGA 3V9SA 4LY7A 3V4IA 4OJRA 1MU2A 1RBTA 3KJVA 3VQEA 5J2PA 1TKZA 5E41A 4C8OA 2FBTA 4W5TA 1BHLA 2E4LA 2G8FA 2O4GA 2KFNA 4HHTA 1EX4A 1JL1A 4F2RA 1ZBIA 2HHWA 4DS5A 4CK2A 4FYDA 4BACA 4KTZA 3NGIA 2D0BA 1JLEA 4NCGA 1YVUA 3OS1A 2PY5A 3VQ8A 4KHWA 1KLMA 1LWFA 4FJ9A 4FXDA 2XHBA 2EHGA 4E7KA 5C24A 4W5QA 3L3VA 3VQDA 5J2MA 3TAEA 3MAQA 4M3XA 1TL3A 3T19A 3NF6A 4DQPA 1VSHA 2IGIA 3ZSWA 3B6PA 2ITGA 3LAKA 5KGXA 4CJKA 4DLGA 3S3OA 1YTUA 3NF8A 1A5VA 4DF8A 3VQQA 4F3OA 4Z4GA 2HHXA 3LPUA 3SQ4A 3B6OA 3LWLA 1F21A 1RTIA 4AHUA 3SV3A 1BGXT 4Z4CA 4OKKA 1LWEA 1VSFA 1SL1A 3TABA 2PZSA 3QETA 1FKPA 1TV6A 3JYTA 4IDKA 1RCHA 2Q3SA 1BI4B 3ZT4A 1TKXA 4FJ5A 1X9MA 3K5NA 4KB0A 4NYFA 3SJJA 1KVCA 3AVNA 3NBPA 3WNGA 3PV8A 4F8RA 1SKWA 2XY5A 4CFDA 2ZE2A 2P1JA 4RW7A 3VQ6A 4DTOA 4DSJA 3KK3A 3PY8A 3FFIA 1T03A 1WN7A 1A5WA 3TANA 4KV8A 4DTPA 4BWMA 1JKHA 3SYZA 2I5JA 2IC3A 4J2AA 4KFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUI A;  3LDS A;  1BIU A;  3QNN A;  3MEC A;  4CGF A;  5HRP A;  5CYQ A;  4DTJ A;  3TR8 A;  1RT1 A;  4KRF A;  1WSJ A;  5HRR A;  3ZSV A;  3PX6 A;  4JS4 A;  3SQ1 A;  3QER A;  3AVK A;  3DLK A;  4J2B A;  4FJN A;  1VSK A;  3P5J A;  2XY8 A;  3KIO A;  1IO2 A;  2XRI A;  4KB1 A;  2EX3 A;  4CHP A;  3TAG A;  2XY7 A;  3MXM A;  1NOZ A;  2VWJ A;  1RT2 A;  1G15 A;  3AVJ A;  3LAN A;  2YNF A;  4CJF A;  4DU1 A;  4E3S A;  3MEG A;  4RG8 A;  3RMB A;  3PO4 A;  1KTQ A;  4DTU A;  1L3S A;  4PWD A;  2Y1J A;  4FZY A;  3NHG A;  3L3U A;  2B5J A;  3NGY A;  4CJQ A;  4EP4 A;  4N56 A;  3VQB A;  3ZSR A;  3CFR A;  4M42 A;  4KO0 A;  1HYS A;  4Z4E A;  1TVR A;  1VSL A;  1U47 A;  3HK2 A;  4CIE A;  4Z4H A;  4C8M A;  1BQM A;  2YV0 X;  1NJY A;  1JXB A;  4IKF A;  4DFP A;  4DQQ A;  2IS3 A;  3TAM A;  1ASU A;  3OYB A;  4O5B A;  4C8N A;  2P5O A;  4B8C A;  3ZSZ A;  4Q0B A;  3SUN A;  1S1V A;  4O55 A;  3KLE A;  4DTM A;  3CFO A;  3NF7 A;  1D9F A;  1EET A;  2G8H A;  3KKS A;  3CQ8 A;  2P51 A;  4RW4 A;  1U4B A;  1RT5 A;  1C0M A;  1CXQ A;  3ZSQ A;  5J1E A;  1UA0 A;  4QOZ B;  1GOA A;  1LWC A;  1FXX A;  3SI6 A;  3K5L A;  3L8B A;  3OYN A;  2XY6 A;  4PQU A;  3OJS A;  1CLQ A;  4AHR A;  3RRH A;  3DLG A;  1Z26 A;  4N47 A;  1QQC A;  5CY4 A;  3NGZ A;  2DTU A;  1C1A A;  5JS1 A;  5D3G A;  4CF9 A;  4KI4 A;  1Z25 A;  1JL2 A;  2HNZ A;  4CFC A;  4FCY A;  4Z4I A;  4QCL A;  3O4N A;  4DTR A;  2PYJ A;  3HO1 A;  1NK9 A;  1UA1 A;  4HUF A;  3UIQ A;  1JLC A;  1I39 A;  4CEA A;  4CF2 A;  2B6A A;  3ASM A;  3DLR A;  3SNN A;  3AVG A;  1TK8 A;  1D9D A;  1KVB A;  3BDP A;  1ASW A;  1QS4 A;  1RTJ A;  4FLV A;  2WOM A;  2FC0 A;  4LSN A;  1QSY A;  1RDD A;  3VA0 A;  2IAJ A;  1NKE A;  3DRP A;  3DOL A;  2HND A;  2VG7 A;  4HUG A;  4DSF A;  4CGH A;  2OPQ A;  3MXI A;  5DMR A;  1SKR A;  2NUB A;  4LH5 A;  2HHU A;  4FJJ A;  3QEX A;  3WNH A;  1J5O A;  3G0Z A;  2IDO A;  5FDL A;  3QEW A;  2O4I A;  3AO2 A;  4BWJ A;  3RTV A;  4M3Y A;  2YHA A;  4DSK A;  4E0D A;  3KD1 E;  3SPY A;  3SQ2 A;  4B9M A;  5I42 A;  4CGD A;  3KTQ A;  4KPY A;  3SV4 A;  5J2N A;  4H8K A;  3QIP A;  3OY9 A;  4B9U A;  1RDA A;  3L2Q A;  3LWM A;  1BI4 A;  1EP4 A;  4M45 A;  4CJP A;  4DU3 A;  3OYJ A;  4GW6 A;  4FJK A;  4FJI A;  4KHU A;  4BDZ A;  2YKN A;  1NK6 A;  2FBV A;  1TGO A;  4KTW A;  3M8S A;  1JLA A;  4W5O A;  4DU4 A;  4CEE A;  1HQU A;  2HNY A;  3O3G A;  3TWH A;  2HHS A;  1U04 A;  3OYH A;  3QNO A;  1NK7 A;  1XC9 A;  3NCI A;  3DLE A;  3RR8 A;  2YNG A;  3IS9 A;  1WLJ A;  4O44 A;  4ZTF A;  1NKC A;  3LP2 A;  2XO7 A;  3SPZ A;  4M41 A;  3VQ7 A;  3SUQ A;  3HPO A;  4FLZ A;  4OKE A;  4BE0 A;  3THV A;  4OGC A;  4CJ4 A;  4DS4 A;  2Y1I A;  1VRT A;  2OPS A;  3ISN C;  1S6P A;  4IFY A;  4ELT A;  4AHC A;  1RNH A;  4FJX A;  1QE1 A;  3NDK A;  4FZZ A;  3HST B;  1I3A A;  4E89 A;  4DTS A;  1IKX A;  1HQE A;  4FK2 A;  3F73 A;  4CER A;  1TAU A;  3D45 A;  4FJH A;  3VQ9 A;  4CHO A;  1RTD A;  3QEI A;  1UAX A;  3EY1 A;  2QKB A;  4DQI A;  3TAQ A;  4OVL A;  4KAZ A;  5K14 A;  4HCC A;  2KZZ A;  4FLW A;  4M3W A;  2OZM A;  1N5Y A;  2ETJ A;  3HPG A;  2G8U A;  4IBN A;  1VSM A;  3OS0 A;  2QK9 A;  1BL3 A;  4DTX A;  1VRU A;  4CFA A;  2YKM A;  1TL1 A;  1BIZ A;  1RT4 A;  4FLX A;  5HLF A;  5SWM A;  1B9F A;  4B3O A;  3C6U A;  3OYD A;  3V9W A;  4OPK A;  4FJG A;  1RIL A;  1YTA A;  4IG3 A;  3PX4 A;  1LAV A;  3RMA A;  4Q5V A;  2HHQ A;  3BGR A;  3O3F A;  1HYZ A;  4KKO A;  2BE2 A;  4FJ8 A;  1TK5 A;  3VQP A;  4N5S A;  2F8S A;  2HHT A;  1TAQ A;  2HVH A;  2IOC A;  3ZSY A;  3KLI A;  4E7I A;  3DLH A;  3EZ5 A;  3AVH A;  1BCM A;  4JRP A;  4I2P A;  2QKK A;  3AVA A;  3HP9 A;  4CHY A;  2GBZ A;  3AVI A;  1JLQ A;  4GVM A;  2BDP A;  3ZSX A;  3F9K A;  3ZT2 A;  3OYI A;  3AA2 A;  1TKD A;  2HW3 A;  1K6Y A;  2VWK A;  3G10 A;  4C8K A;  1LW2 A;  5T7B A;  4FZX C;  4CEQ A;  4OKJ A;  4HCB A;  2WON A;  4CJT A;  3LPT A;  3OYF A;  1DLO A;  5KRS A;  1WAJ A;  4ELV A;  4E1N A;  1X1P A;  3OJU A;  1S1X A;  1NJZ A;  4O0I A;  4CHQ A;  2D0A A;  1VSJ A;  2OPP A;  3H08 A;  4B9L A;  4LH4 A;  1KRP A;  1WAF A;  2RF2 A;  2RPI A;  4MQ3 A;  1T7P A;  1C0U A;  1RT7 A;  3E01 A;  3OVN A;  5HRN A;  4AH9 A;  5J2Q A;  3HXM A;  1XHZ A;  3ZT0 A;  4F3T A;  4LSL A;  1B92 A;  4UQG A;  4AIL C;  1C1B A;  1KFS A;  3DLB A;  3M8P A;  4H4M A;  1TKT A;  4WE1 A;  2YNI A;  3K5O A;  4TSX A;  1WSE A;  3MXJ A;  3VQ5 A;  3HT3 A;  4DF4 A;  3SUO A;  1IKV A;  4I2Q A;  2E6L A;  4M3U A;  1QHT A;  4NCB A;  5HRS A;  1HNV A;  3DOK A;  3AVM A;  1VSI A;  1J53 A;  1SUQ A;  1XWL A;  3V6D A;  3I8D A;  3NF9 A;  3RWU A;  4DFK A;  1FK9 A;  2X74 A;  4CJS A;  3L2U A;  3C6T A;  5KGW A;  1RTH A;  4E7H A;  5SZT A;  1R0A A;  1CZB A;  3LZJ A;  3K57 A;  1HYV A;  1O1W A;  4B9S A;  2AJQ A;  3OS2 A;  4KHY A;  4M3Z A;  4FJ7 A;  2B4J A;  2A1S A;  1REV A;  2ZQB A;  3KKR A;  1EXQ A;  2KTQ A;  1B9D A;  3CG7 A;  2OYQ A;  3OYK A;  4CGG A;  1WSG A;  1T8E A;  4KHN A;  1WSI A;  3JSM A;  4DWI A;  4DQR A;  4ELU A;  2A1R A;  4L8R B;  1CXU A;  4CE9 A;  2Z1I A;  4K8Z A;  3D0P A;  4DSL A;  5FRO A;  4RW8 A;  3AVF A;  2FBY A;  3LP1 A;  3KLG A;  1Q9Y A;  1C6V A;  1S9G A;  4H4O A;  4FW1 A;  4B8A B;  1Q9X A;  5KI6 A;  1SV5 A;  1S6Q A;  4GMJ B;  3P83 D;  4CJE A;  5C25 A;  3M8R A;  1N6Q A;  2G8V A;  1IKW A;  1JLF A;  5FRN A;  3SZ2 A;  4CJ5 A;  4AHT A;  3QO9 A;  3TAR A;  4OPJ A;  5JS2 A;  3ALY A;  2FBX A;  1A5X A;  1NK8 A;  1S1T A;  2X6N A;  3QIO A;  3OYA A;  3V81 A;  2YHB A;  4AHV A;  4BDP A;  3NH2 A;  1HMV A;  1JXE A;  2Z1H A;  4CEF A;  3NAE A;  1X9W A;  3DI6 A;  4BE1 A;  3RR7 A;  4PUO A;  3LAM A;  4RW6 A;  2YNH A;  3IAY A;  4PY5 A;  4B9T A;  3SCX A;  4O4G A;  3O4Q A;  3I0S A;  4AHS A;  4C8L A;  3V9U A;  3QLH A;  4CFB A;  3L2W A;  3HPH A;  3U6F A;  1ZYQ A;  1NJX A;  3K59 A;  4EZ9 A;  1CZ9 A;  1NK4 A;  3HJF A;  1L5U A;  1W0H A;  3ITH A;  4BE2 A;  1KVA A;  1ZBL A;  2D5R A;  3AA4 A;  1FKO A;  3DYA A;  1SL0 A;  4ID5 A;  1SL2 A;  1RBS A;  2PYL A;  3AO3 A;  3AVC A;  1DTQ A;  4Y1C A;  3QEP A;  1WSH A;  3IG1 A;  4R5P A;  2Z1J A;  3IRX A;  3WNF A;  3RMD A;  3QIN A;  5I3U A;  1KSP A;  2BAN A;  3VA3 A;  1GOB A;  1XI1 A;  1ZBH A;  3K2P A;  4W5N A;  1D5A A;  3VQA A;  1KCF A;  1X9S A;  2DFH A;  3TI0 A;  3KLF A;  3K58 A;  3TAP A;  3PO5 A;  4JRQ A;  4FM2 A;  3S9H A;  1IH7 A;  4DMN A;  3MED A;  3VQ4 A;  1U45 A;  4CJ3 A;  2OZS A;  1ASV A;  1VK0 A;  4QAG A;  1BIS A;  1HPZ A;  3HP6 A;  3QES A;  1D8Y A;  4OLA A;  3LP0 A;  4F4K A;  1QSL A;  4CHN A;  3DMJ A;  3U3Y A;  2X6S A;  3TAF A;  4FJL A;  3ZSO A;  4CEC A;  1W9H A;  3NFA A;  2GV9 A;  1ITG A;  2VG5 A;  3VN5 A;  4CF1 A;  5CZ1 A;  3I0R A;  4M3R A;  1NKB A;  4FLT A;  3C94 A;  2OA8 A;  4KHS A;  1J54 A;  4E19 A;  1KLN A;  1Q8I A;  2DFE A;  3AVB A;  2G8W A;  1S5J A;  2VG6 A;  1NOY A;  4CCH A;  1RT3 A;  1S9E A;  4DFJ A;  1HRH A;  2ZD1 A;  4CIG A;  4KI6 A;  4CJU A;  3HYF A;  3OYE A;  3AO5 A;  3KK2 A;  4J2D A;  3A2F A;  1EKE A;  4I9Q A;  3L2V A;  4N41 A;  3OYL A;  4IG0 A;  3P1G A;  4CJV A;  4FJM A;  4CED A;  5C42 A;  2HMI A;  4CEZ A;  4ZTJ A;  2DY4 A;  3PUF A;  4HUE A;  3AO1 A;  4CK1 A;  3AO4 A;  1IKY A;  1BCO A;  3DRR A;  2HB5 A;  1SKS A;  4J2E A;  3NH0 A;  4O0J A;  4I9L A;  4CJL A;  1WNS A;  3VQC A;  1LAW A;  4EP5 A;  4PA1 A;  1ZBU A;  1NK0 A;  1QTM A;  4OGE A;  4Z4F A;  5DK5 A;  3S3N A;  3AVL A;  4CJW A;  3ZCM A;  3S3M A;  3SUP A;  4CIF A;  1RT6 A;  4JLH A;  4CF0 A;  1L3U A;  2G8K A;  4FM1 A;  3KD5 E;  2RN2 A;  1RDC A;  4FK4 A;  3HL8 A;  5FRM A;  4FLU A;  3AA3 A;  4I7F A;  4ZHR A;  1ZBF A;  3U3G A;  2W42 A;  4CGI A;  3RMC A;  4KRE A;  4B9V A;  3DRS A;  1NJW A;  3PX0 A;  1NK5 A;  3ZT3 A;  3C95 A;  1Y97 A;  3V9Z A;  4DSI A;  3NH1 A;  3OYC A;  3K5M A;  4NCA A;  1U49 A;  1LW0 A;  3LZI A;  4ICL A;  4E1M A;  4HTU A;  4BDY A;  3QEV A;  1U48 A;  3CM6 A;  1C0T A;  4CGJ A;  4NYN A;  3L2R A;  1RBU A;  1GOC A;  4MFB A;  4Z0U A;  3KK1 A;  2F96 A;  3EYZ A;  3T3F A;  3RRG A;  4EZ6 A;  4N76 A;  4M3T A;  4CF8 A;  3CM5 A;  3V1Q A;  2P5G A;  1JLB A;  1T05 A;  3SQ0 A;  3ZT1 A;  5CZ2 A;  4Y1D A;  3T1A A;  3LAL A;  5HBM A;  4FM0 A;  1RBV A;  1KFD A;  4B08 A;  2HVI A;  4HVJ A;  1UOC A;  1UWB A;  1S1U A;  1S1W A;  1XHX A;  3O3H A;  4K8X A;  4OLB A;  2HHV A;  4DG1 A;  3WNE A;  4W5R A;  3NE6 A;  1L3T A;  4FK0 A;  3ULD A;  2E6M A;  4F2S A;  2LSN A;  4ID1 A;  5KRT A;  4CJR A;  4KTQ A;  3AA5 X;  2X78 A;  4CK3 A;  4E7J A;  3LP3 A;  1QSS A;  4B9N A;  3DM2 A;  2D0C A;  1VSE A;  2RKI A;  5CYM A;  4XIU A;  3HVR A;  4DQS A;  5EU7 A;  2R7Y A;  3HM9 A;  1TK0 A;  2F8T A;  3CYM A;  2ATQ A;  4FVM A;  4CEB A;  3KLH A;  4RW9 A;  1VSD A;  3V9X A;  1L3V A;  3AV9 A;  2KQ2 A;  2KFZ A;  4G1Q A;  3M8Q A;  1IG9 A;  3OYG A;  1HJR A;  1JLG A;  4LD0 A;  2G8I A;  2DFF A;  4E7L A;  3V1O A;  4CEO A;  2QXF A;  1LV5 A;  4YFU A;  4CHZ A;  4IFV A;  1BQN A;  3OYM A;  4DTN A;  1WSF A;  1DTT A;  2Z1G A;  4KHQ A;  2JLE A;  4CES A;  4YNQ A;  2OPR A;  1YT3 A;  1RDB A;  4JS5 A;  1RBR A;  4DSE A;  3V1R A;  4DFM A;  2KW4 A;  5KTQ A;  4DLE A;  4FW2 A;  4FLY A;  3HVT A;  3CFP A;  1J9A A;  1HNI A;  5HRO A;  3MEE A;  2KZM A;  5HP1 A;  2JGU A;  1C1C A;  2BGG A;  3V9S A;  4LY7 A;  3V4I A;  4OJR A;  1MU2 A;  1RBT A;  3KJV A;  3VQE A;  5J2P A;  1TKZ A;  5E41 A;  4C8O A;  2FBT A;  4W5T A;  1BHL A;  2E4L A;  2G8F A;  2O4G A;  2KFN A;  4HHT A;  1EX4 A;  1JL1 A;  4F2R A;  1ZBI A;  2HHW A;  4DS5 A;  4CK2 A;  4FYD A;  4BAC A;  4KTZ A;  3NGI A;  2D0B A;  1JLE A;  4NCG A;  1YVU A;  3OS1 A;  2PY5 A;  3VQ8 A;  4KHW A;  1KLM A;  1LWF A;  4FJ9 A;  4FXD A;  2XHB A;  2EHG A;  4E7K A;  5C24 A;  4W5Q A;  3L3V A;  3VQD A;  5J2M A;  3TAE A;  3MAQ A;  4M3X A;  1TL3 A;  3T19 A;  3NF6 A;  4DQP A;  1VSH A;  2IGI A;  3ZSW A;  3B6P A;  2ITG A;  3LAK A;  5KGX A;  4CJK A;  4DLG A;  3S3O A;  1YTU A;  3NF8 A;  1A5V A;  4DF8 A;  3VQQ A;  4F3O A;  4Z4G A;  2HHX A;  3LPU A;  3SQ4 A;  3B6O A;  3LWL A;  1F21 A;  1RTI A;  4AHU A;  3SV3 A;  1BGX T;  4Z4C A;  4OKK A;  1LWE A;  1VSF A;  1SL1 A;  3TAB A;  2PZS A;  3QET A;  1FKP A;  1TV6 A;  3JYT A;  4IDK A;  1RCH A;  2Q3S A;  1BI4 B;  3ZT4 A;  1TKX A;  4FJ5 A;  1X9M A;  3K5N A;  4KB0 A;  4NYF A;  3SJJ A;  1KVC A;  3AVN A;  3NBP A;  3WNG A;  3PV8 A;  4F8R A;  1SKW A;  2XY5 A;  4CFD A;  2ZE2 A;  2P1J A;  4RW7 A;  3VQ6 A;  4DTO A;  4DSJ A;  3KK3 A;  3PY8 A;  3FFI A;  1T03 A;  1WN7 A;  1A5W A;  3TAN A;  4KV8 A;  4DTP A;  4BWM A;  1JKH A;  3SYZ A;  2I5J A;  2IC3 A;  4J2A A;  4KFB A; 
#chains in the Genus database with same CATH topology
 3LDS A;  1T6D A;  1KAX A;  4E1J A;  3R8E A;  3TU5 A;  3TR8 A;  4BRL A;  2A6A A;  3D2F B;  3DLK A;  3EE9 A;  5IWA K;  3EKS A;  3C0B A;  1QVF M;  4CHP A;  4QS7 A;  1NOZ A;  2E1Z A;  1G15 A;  3AVJ A;  4CJF A;  3RMB A;  3PO4 A;  3MEG A;  3DWL A;  4DTU A;  3VEO A;  4JN4 A;  3WQT A;  3NHG A;  2B5J A;  4CJQ A;  3ZSR A;  3W3D A;  4YOT A;  5E84 A;  1VSL A;  4WFA L;  3CCU N;  4Z4H A;  3T1H K;  4C8M A;  1R59 O;  2YV0 X;  4BRP A;  4DQQ A;  2QWM A;  1QQO A;  4C8N A;  2P5O A;  5AQR A;  3SUN A;  4O55 A;  3NF7 A;  3SLC A;  5KQD A;  3ZSQ A;  1UA0 A;  2FXU A;  4QOZ B;  1WOQ A;  2AP1 A;  3CPE A;  3OJS A;  1CLQ A;  3CET A;  3LDP A;  5D3G A;  3PIP L;  1Z25 A;  2HNZ A;  4CZJ A;  3K0S A;  3BP8 A;  4FCY A;  4Z4I A;  3HO1 A;  4IFE A;  1JLC A;  4CF2 A;  1WUA A;  3SMS A;  3ASM A;  5C0Y A;  2QA4 N;  1ASW A;  1QS4 A;  5JVH L;  3VA0 A;  3DRP A;  3DOL A;  5LMU K;  4HUG A;  1NGC A;  4DSF A;  2OPQ A;  2Q0R A;  3MXI A;  5DMR A;  3JAM O;  1SKR A;  1LCU A;  3VOV A;  2YCH A;  2JWK A;  1NGG A;  1VQM N;  3G0Z A;  3QEW A;  2O4I A;  3EE8 A;  5C10 A;  4PL7 A;  3R3L A;  4IXC A;  4H03 B;  3SPY A;  3CC2 N;  4MO4 A;  4CZK A;  4KPY A;  3FE1 A;  3LWM A;  1TYQ A;  1EP4 A;  4CJP A;  4BRN A;  3FLC O;  5AQI A;  5F0X A;  4FSV A;  4KHU A;  3MCP A;  2YKN A;  4W5O A;  4X62 K;  1NNE A;  3VEX A;  2HHS A;  4BRI A;  3OYH A;  1NK7 A;  5JMV A;  5FLX O;  3DLE A;  4YOR A;  1VQ8 N;  4ZTF A;  5EOY A;  2XO7 A;  3SPZ A;  3G71 N;  1U2V A;  4BVP A;  3I56 N;  4OKE A;  1VRT A;  2OPS A;  3J7A P;  2PBD A;  5CR4 A;  4GV6 A;  3NDK A;  4A5A A;  4FZZ A;  2Q31 A;  3F73 A;  1T3V A;  3D45 A;  3VQ9 A;  4CHO A;  3T7Z A;  4DQI A;  1ATR A;  3AAR A;  3GL1 A;  4AF1 A;  3LM2 A;  3ID6 A;  4M3W A;  4IBN A;  1VSM A;  3T1Y K;  1FW6 A;  4H5R A;  4B3O A;  1YTA A;  2HHQ A;  4FJ8 A;  2BE2 A;  1TK5 A;  1NMN A;  2WFB A;  4BRE A;  5M1F A;  3ZSY A;  2BUP A;  3EZ5 A;  3C6H A;  2QKK A;  3AVA A;  4GVM A;  3F9K A;  1VQN N;  3G10 A;  4C8K A;  4JK8 A;  2H3G X;  4CEQ A;  2WON A;  3OYF A;  4K25 A;  3TTD A;  1X1P A;  1NJZ A;  4DR2 K;  2D0A A;  2RF2 A;  1T7P A;  1C0U A;  5HRN A;  4LF9 K;  4LSL A;  1B92 A;  4UQG A;  4AIL C;  3KVG A;  2HBJ A;  2F9W A;  1TKT A;  2UYT A;  4WE1 A;  2YNI A;  1WSE A;  5LMN K;  3OHR A;  1GLE G;  5FPN A;  4G9Z A;  3A5L C;  1VQ6 N;  5HRS A;  2UUC K;  3DOK A;  4QS9 A;  2NRT A;  1J53 A;  3CMA N;  3DXM A;  4EFH A;  4EAH D;  2AJQ A;  3QB0 A;  3M6G A;  1EXQ A;  2KTQ A;  1B9D A;  3VF4 A;  1NLV A;  4ELU A;  4DR6 K;  2E2N A;  1CXU A;  4K8Z A;  4IO9 L;  3D0P A;  3L6Q A;  5AQV A;  2FBY A;  4H4O A;  4FW1 A;  1QZ5 A;  3P83 D;  3M8R A;  1JLF A;  3VF2 A;  4AHT A;  3TAR A;  3MK6 A;  3CD6 N;  5JS2 A;  3ALY A;  2X6N A;  4K43 A;  1JXE A;  4BE1 A;  3IAY A;  4B9T A;  1OKJ A;  3O4Q A;  1Q7Y O;  2I7P A;  3QLH A;  3HPH A;  1NM1 A;  3E1Y A;  1CZ9 A;  5AQN A;  1RDW X;  1L5U A;  1W0H A;  4PL8 A;  4H0T B;  4BRH A;  1BA1 A;  4B1U B;  2CGL A;  1SL0 A;  4ID5 A;  4DHY A;  1DTQ A;  3G25 A;  4CBW A;  3THW A;  4R5P A;  3IRX A;  3CER A;  3QIN A;  2BAN A;  1XI1 A;  3K2P A;  5ADX H;  1J5E K;  3TI0 A;  2WC9 A;  3VQ4 A;  2OZS A;  3HP6 A;  1D8Y A;  3LDL A;  3H45 C;  3U3Y A;  5F1X A;  4K42 A;  4JD2 B;  4B1W B;  2GV9 A;  1ITG A;  2VG5 A;  1ZXO A;  2ZGZ A;  1NKB A;  4FLT A;  2OA8 A;  2AA4 A;  1IBL K;  3BZK A;  3A5N C;  5CHI A;  3ZEU A;  3QML A;  1HRH A;  2ZD1 A;  4CJU A;  3KK2 A;  3FFK B;  4N41 A;  2WUS A;  4FJM A;  1QQN A;  3W0L A;  4CEZ A;  3P39 A;  4V19 S;  4BQZ A;  3P4I A;  3J81 O;  3VER A;  1LOT B;  1NMD A;  3CC7 N;  1WNS A;  1QTM A;  1ZBU A;  2NRZ A;  2P9L A;  4JI2 K;  2V52 B;  2D0P A;  5TKW A;  3UKU A;  1RT6 A;  1OVY A;  1RDC A;  4B1Z A;  4ZHR A;  2W42 A;  1ZBF A;  4B9V A;  3RVC A;  1QZ6 A;  3K9K A;  3PX0 A;  1NJW A;  3C6A A;  3V9Z A;  4DSI A;  3NH1 A;  3K5M A;  4DV0 K;  1LW0 A;  4ICL A;  3O8M A;  1U48 A;  2P9I B;  4CGJ A;  3J7Y P;  3L2R A;  1RBU A;  2VQE K;  2P9K B;  4Z0U A;  1N33 K;  4M3T A;  4K0K K;  3CXC M;  1JLB A;  3SQ0 A;  3ZT1 A;  5M1N A;  3LAL A;  5HBM A;  1RBV A;  3PSF A;  4HVJ A;  1UOC A;  1S1W A;  3UKU B;  4OLB A;  4CBU A;  3WNE A;  3MN6 A;  3ULD A;  2LSN A;  5KRT A;  3QIC A;  3U9D A;  4BRG A;  4CJR A;  1T6C A;  3E9O A;  4JKG B;  3LP3 A;  3EO3 A;  5GIP A;  4DQS A;  4XIU A;  3GE1 A;  2UXC K;  1E4G T;  2O8E B;  2ATQ A;  4CEB A;  5GIO A;  4RW9 A;  3KLH A;  1MWK A;  3V9X A;  4YY3 K;  2NLX A;  3GG4 A;  4Z94 A;  3THX B;  2FSJ A;  2ASM A;  4LD0 A;  2G8I A;  3MN9 A;  2DFF A;  4E7L A;  3H3O B;  5AQH A;  2HBK A;  4FPB A;  4IFV A;  1WSF A;  4KHQ A;  4YNQ A;  4CZE A;  2ZJQ L;  5AZI B;  2QEX N;  2E2Q A;  1RGI A;  3CCL N;  5KTQ A;  4FW2 A;  1C1C A;  4DV1 K;  4O8K A;  4LY7 A;  4IOX A;  1IBM K;  1RBT A;  4DCH A;  2NRR A;  3QFP A;  4HHT A;  1EX4 A;  1SS6 A;  1ZBI A;  2HHW A;  3R1X A;  2YJE A;  5BPN A;  5MLC Q;  4KTZ A;  3NGI A;  3ATU A;  4NCG A;  3VPZ A;  5GAH P;  3D2E B;  2P9U B;  4PKI A;  2XHB A;  5J2M A;  5JIC A;  4M3X A;  2KKZ A;  3EL2 A;  2IGI A;  5AFU H;  5AQX A;  1YTU A;  3NF8 A;  1A5V A;  4H5N A;  3CJA A;  4F3O A;  3SQ4 A;  2ZWH A;  1F21 A;  1RTI A;  1SQK A;  1BGX T;  2FF6 A;  1LWE A;  3I8B A;  3MWP A;  1FKP A;  5BN8 A;  3JYT A;  1RCH A;  5BPM A;  4KB0 A;  1NGD A;  4NYF A;  1KVC A;  1RDU A;  3NBP A;  2F8T A;  4F8R A;  2P1J A;  3KK3 A;  1A5W A;  1YJW N;  3H46 O;  4KV8 A;  3VEW A;  2OTJ N;  3WXJ A;  4J2A A;  4DV7 K;  3P38 A;  5HRP A;  5HOO A;  1EWQ A;  4KRF A;  5AQO A;  3ZSV A;  3PX6 A;  4JS4 A;  3AVK A;  4FJN A;  4J2B A;  1VSK A;  3KIO A;  2PFU A;  2XRI A;  4KB1 A;  2EX3 A;  3DAW A;  2ZJR L;  1DT9 A;  5DM6 L;  2VWJ A;  1RT2 A;  1TK0 A;  3LAN A;  1XQS C;  4A61 A;  4PWD A;  5BR8 K;  1HYS A;  3E66 A;  2HBM A;  4KO0 A;  3WXL A;  1TVR A;  2PAV A;  3O9U A;  4IKF A;  4DFP A;  3TAM A;  4O5B A;  1S1V A;  3KLE A;  4DTM A;  1HLU A;  1EET A;  3KKS A;  3CQ8 A;  3KHY A;  2P51 A;  4RW4 A;  1U4B A;  1RT5 A;  3WXM B;  5J1E A;  1LWC A;  4PQU A;  1I94 K;  4OX9 K;  4LFC K;  2DTU A;  5JS1 A;  4JNE A;  5FPE A;  1XC3 A;  3CC4 N;  3WEE A;  4QCL A;  3O4N A;  3THY A;  4YOX A;  1UA1 A;  4H5V A;  4CEA A;  2B6A A;  3DXK B;  1VQ5 N;  3AVG A;  1TK8 A;  4JHD B;  5BPL A;  1RTJ A;  4FLV A;  2WOM A;  1RDD A;  1NKE A;  2IAJ A;  5GAD P;  3ENH A;  4JI7 K;  4KH6 A;  2HHU A;  3JS6 A;  4FJJ A;  1E3M A;  3AO2 A;  1ATN A;  3U4L A;  1BOT O;  3WEE B;  3SQ2 A;  4FWP A;  4CGD A;  5J2N A;  1RDA A;  4HWI A;  1BI4 A;  4DU3 A;  3HOS A;  4BDZ A;  3NVK A;  4DU4 A;  4GKK K;  5KPZ A;  1C0G A;  3QNO A;  3EEQ A;  4BGB A;  3RR8 A;  1WLJ A;  1HX1 A;  4GV9 A;  3VQ7 A;  3SUQ A;  3THV A;  4OGC A;  4DS4 A;  2Y1I A;  1TUY A;  3FZH A;  1RNH A;  1H1V A;  4FJX A;  4KHP K;  3HST B;  4E89 A;  4L3Q A;  4FK2 A;  2P9N A;  1UAX A;  3E9L A;  3TAQ A;  4RTF D;  4KAZ A;  3O9Q A;  1N5Y A;  5AQL A;  4NB4 A;  1KAY A;  4DTX A;  1YUW A;  4CFA A;  1TL1 A;  1QVG M;  1BIZ A;  1RT4 A;  3UB5 A;  4LF6 K;  3OYD A;  4UY8 O;  4OPK A;  1RIL A;  4IG3 A;  1D4X A;  3PX4 A;  1LAV A;  2HHT A;  4CJ7 A;  3VQP A;  1TAQ A;  2HVH A;  3KLI A;  4WQ4 C;  4XH5 A;  4B1V A;  1S3X A;  4CHY A;  5BRF A;  1K8A O;  2CH5 A;  3OYI A;  2HW3 A;  1VQP N;  2P9N B;  1K6Y A;  5HL7 L;  1LW2 A;  5T7B A;  5AJ3 K;  4HCB A;  1DLO A;  3OJU A;  4O0I A;  4DKW A;  3O9S A;  3R6M A;  1VSJ A;  2OPP A;  4CHQ A;  1WAF A;  2CGK A;  1RT7 A;  3OVN A;  3E01 A;  4AH9 A;  1E4F T;  4NO7 A;  3VGK A;  3ZT0 A;  4F3T A;  4I6M B;  5CE3 A;  5AQF A;  4DR3 K;  3HT3 A;  1NK9 A;  3MXJ A;  4M3U A;  3SUO A;  4FWN A;  4I2Q A;  2NZT A;  1YHQ N;  2WTU A;  1HNV A;  3O1B A;  2W6L A;  1SUQ A;  1XWL A;  3I8D A;  3NF9 A;  2HMP A;  2X74 A;  4CJS A;  3JXU A;  4BRA A;  1OH8 A;  1R0A A;  2GUP A;  3M3Z A;  3K57 A;  3OS2 A;  3VGL A;  4FWM A;  1OH6 A;  3IDH A;  1K8K B;  3KKR A;  4CD1 A;  3OYK A;  1T8E A;  1WSG A;  1WSI A;  4DWI A;  4PHT X;  3WUH A;  2D4W A;  2Z1I A;  4DSL A;  4EHU A;  3LP1 A;  4DV3 K;  4FJG A;  5GAE P;  5KI6 A;  1SV5 A;  1S6Q A;  4GMJ B;  5C25 A;  1IBK K;  4H0O A;  5C2D A;  5LJW A;  2FBX A;  1S1T A;  3MX5 A;  3VET A;  3OYA A;  1JCF A;  3WT0 A;  2ITM A;  4BDP A;  1VQ4 N;  5ELZ A;  1VQ7 N;  1NWK A;  1X9W A;  2Z1H A;  3DI6 A;  5M1O A;  3RR7 A;  3LAM A;  1M90 O;  4BR2 A;  4AHS A;  2HF3 A;  4U7B A;  1GLD G;  2DPN A;  3U6F A;  4EZ9 A;  3HBT A;  4WQ5 C;  5TKY A;  3ITH A;  1KVA A;  4KH5 A;  3CJC A;  2D5R A;  4C23 A;  2GEL A;  3DYA A;  3ATV A;  1N32 K;  3CQY A;  4YOV A;  1Z6R A;  3AVC A;  3WXK A;  3BZC A;  5GAG P;  3IG1 A;  3CJ7 A;  3RMD A;  3WNF A;  3SJH A;  2A5X A;  4B1X B;  1ZBH A;  4QS8 A;  1D5A A;  1X9S A;  1KCF A;  4BRD A;  3KLF A;  4JRQ A;  4FM2 A;  1U45 A;  1VK0 A;  4QAG A;  3R9P A;  2NRH A;  1HPZ A;  3QES A;  2O8B B;  4OLA A;  4CZI A;  3LP0 A;  3FGU A;  4CHN A;  3CJ9 A;  3CCR N;  2X6S A;  4GNI A;  3SK3 A;  3NFA A;  3VN5 A;  3O80 A;  4CZG A;  1IG8 A;  5M1Q A;  1Q8I A;  1CZA N;  3MDQ A;  2DFE A;  3TSP A;  2G8W A;  1S5J A;  3CCV N;  2VG6 A;  4K41 A;  1S9E A;  1X3N A;  4KI6 A;  2O8F B;  4U67 L;  4XEI A;  1EKE A;  2NNW A;  4I9Q A;  2RE2 A;  3OYL A;  3P1G A;  4CED A;  3PUF A;  4CK1 A;  5JLF A;  3DRR A;  1SKS A;  5AQT A;  4J2E A;  5H1S Q;  4OO1 J;  4PA1 A;  5DK5 A;  1ILY A;  3SUP A;  2G8K A;  4DV2 K;  3KD5 E;  3O9R A;  1JCE A;  4YDU C;  1SZ2 A;  3J8A A;  3CCJ N;  3K9J A;  3TTC A;  4FLU A;  4I7F A;  4LF4 K;  3DRS A;  2QWL A;  2E2P A;  2F4V K;  1NK5 A;  5AQZ A;  3OYC A;  4YOY A;  4NCA A;  4FO0 A;  4HTU A;  1OH7 A;  1ATS A;  4DQ8 A;  1GOC A;  3KK1 A;  3AAQ A;  3T3F A;  2VCP A;  4N76 A;  4EZ6 A;  2GEM A;  4CF8 A;  5AR0 A;  3ZYY X;  3RSE B;  4FM0 A;  1QHA A;  3HOT A;  1OH5 A;  5M1K A;  3O3H A;  4K8X A;  4DG1 A;  1HJO A;  3NE6 A;  4C1N K;  1GLC G;  4ID1 A;  4JI8 K;  4KTQ A;  3AA5 X;  2FLO A;  2X78 A;  4CK3 A;  1YJN N;  3DM2 A;  4ILH A;  5CYM A;  3HVR A;  2YX6 A;  4FWK A;  3O5B A;  4MO5 A;  3AV9 A;  2KFZ A;  4MLH A;  3AAP A;  3OYG A;  2Q36 A;  1JLG A;  3G6E N;  3LDQ A;  2E1Y A;  4ISF A;  4YFU A;  4CHZ A;  4DTN A;  1BO5 O;  3KK7 A;  4NLC A;  4OPA A;  1RBR A;  4DLE A;  4FLY A;  1HNI A;  3MEE A;  4JD2 A;  4JKF A;  5BRE A;  3CPW M;  3V4I A;  3TTF A;  1T44 A;  3KJV A;  5J2P A;  4GY2 B;  4IEE A;  1BHL A;  3VMF B;  5BRH A;  3TSQ A;  4JKH A;  4FPA A;  4DB3 A;  3OA9 A;  4WYB A;  1LWF A;  4FJ9 A;  5C24 A;  4W5Q A;  3VQD A;  3MAQ A;  4X65 K;  3NF6 A;  2QM1 A;  3IUC A;  3ZSW A;  3LAK A;  3Q7B A;  5KGX A;  4NXN K;  3S3O A;  2QI2 A;  2HHX A;  3B6O A;  4WCE L;  2W41 A;  3SV3 A;  4Z4C A;  1DEJ A;  1VSF A;  3KZB A;  2PZS A;  4JI0 K;  2Q3S A;  2D1K A;  3ZT4 A;  4GKJ K;  2F9T A;  1X9M A;  1YXQ A;  3CJ1 A;  3PV8 A;  1SKW A;  2XY5 A;  4DSJ A;  2P9I A;  3PY8 A;  2P9K A;  4MDB A;  1BWF O;  4DTP A;  2G8U A;  2I5J A;  3A5O C;  2E8A A;  3CCS N;  1NGB A;  5GIN A;  3QNN A;  3MEC A;  4CGF A;  5BR9 A;  1GLB G;  5CYQ A;  1RT1 A;  1WSJ A;  5HRR A;  3SQ1 A;  3PLA A;  2O8D B;  2XY8 A;  1M1K O;  1IO2 A;  2GTD A;  3MXM A;  3TAG A;  1HUX A;  4E3S A;  2YNF A;  4LFA K;  4JKG A;  4JKE A;  1KTQ A;  5KPT A;  4EP4 A;  4DV6 K;  3VQB A;  4FVU A;  2O8E A;  3HRG A;  4CIE A;  3O4W A;  1JXB A;  3THX A;  2FSN A;  2QTD A;  4IZ9 A;  1XUP O;  1D9F A;  3VEV A;  2UU9 K;  3UKR A;  1C0M A;  1CXQ A;  5AZI A;  1GLL O;  4WF9 L;  3ULE B;  1FXX A;  2E2O A;  3N4Q A;  3FZF A;  4WQ5 A;  1C0F A;  4AHR A;  4N47 A;  1Z26 A;  1GLA G;  3NGZ A;  1P8Z A;  4BRK A;  1C1A A;  1JL2 A;  2ZGY A;  4B1Y B;  3I55 N;  4DTR A;  2PYJ A;  1HNW K;  1I39 A;  1YIJ N;  3DLR A;  1Z05 A;  4JI6 K;  1D9D A;  2HHH K;  4BRM A;  2FC0 A;  4LSN A;  1QSY A;  2O8C B;  1VQL N;  3ZX3 A;  3PSI A;  3D2E A;  2VG7 A;  3ZX0 A;  2P9U A;  3C65 A;  4CGH A;  3UKR B;  4LH5 A;  3O08 A;  3OTO K;  5FDL A;  2A42 A;  4BGA A;  4A57 A;  3RTV A;  4JK9 A;  4E0D A;  3IKM A;  3KD1 E;  1BA0 A;  2Q2R A;  5AZJ A;  4YHH K;  3SV4 A;  4H8K A;  2FSK A;  4M45 A;  2A40 A;  4GW6 A;  1KAZ A;  1TGO A;  2FBV A;  1JLA A;  4A62 A;  2HNY A;  3O3G A;  3NCI A;  1DKG D;  2YNG A;  4O44 A;  1NKC A;  4M41 A;  2ZM6 K;  4FLZ A;  4BE0 A;  1S6P A;  4IFY A;  2NRW A;  3J7Z O;  4ELT A;  5EXW A;  1I3A A;  1HQE A;  4YDU A;  5AZJ B;  4CER A;  1TAU A;  1N8R O;  5JLH A;  3QEI A;  5IT9 O;  3EY1 A;  2QKB A;  4B3R K;  4OVL A;  5K14 A;  2ZJP L;  1JCG A;  1GLF O;  3A8Y A;  3LDO A;  1VQK N;  4JI3 K;  5C15 A;  4JKB A;  2ETJ A;  3HPG A;  3OS0 A;  4JV5 K;  4WFN L;  1YVN A;  2YKM A;  3FZK A;  1V4T A;  2E20 A;  5SWM A;  1B9F A;  1S22 A;  3RMA A;  1RFQ A;  3O3F A;  2OTL N;  2F8S A;  1K73 O;  4N5S A;  1WB9 A;  3CIP A;  2IOC A;  3LL3 A;  3CME N;  3DLH A;  3AVH A;  4I2P A;  4BRC A;  3EZW A;  4BC3 A;  3HP9 A;  3QDK A;  1JLQ A;  3ZSX A;  1TKD A;  3AA2 A;  3ENO A;  4FZX C;  4OKJ A;  2HST A;  4CJT A;  2VWB A;  5KRS A;  1WAJ A;  4X64 K;  3HI0 A;  4E1N A;  3OW2 M;  3P31 A;  3OBW A;  4ISE A;  4LH4 A;  2RPI A;  1XHZ A;  3DXK A;  2W6K A;  4GVE A;  1SAZ A;  4JHD A;  1KFS A;  2A3Z A;  3DLB A;  2BH1 A;  1EQY A;  4R79 A;  1IKV A;  3EKU A;  1QHT A;  3F9M A;  3VEY A;  4DFK A;  1FK9 A;  5AQQ A;  3L2U A;  1MDU B;  4H0X B;  5KGW A;  1W97 L;  5SZT A;  4E7H A;  1CZB A;  4B9S A;  1W7A A;  2B4J A;  2A1S A;  2HOE A;  3MX2 A;  2OYQ A;  4CGG A;  3O6W A;  4DQR A;  1HKC A;  1EWR A;  4FWO A;  2ASO A;  4B3M K;  3VEN A;  5FRO A;  4RW8 A;  3AVF A;  3KLG A;  4FJI A;  4B8A B;  4DV4 K;  4A59 A;  2ASP A;  5FRN A;  1FJG K;  3SZ2 A;  4CJ5 A;  5A2Q O;  1ESV A;  2F7T A;  1A5X A;  1NK8 A;  3CQX A;  4CZM A;  4CEF A;  5C2F A;  5KPR A;  4PUO A;  1OVQ A;  4PY5 A;  2QXL A;  4JI1 K;  4O4G A;  3I0S A;  4DR1 K;  1ZYQ A;  3K59 A;  2UXB K;  3HM8 A;  1G99 A;  4BE2 A;  3GBT A;  3T69 A;  4DR5 K;  3ENB A;  1FKO A;  2PYL A;  4M7Y A;  3QEP A;  1WSH A;  3SMP A;  4CVN E;  1KSP A;  3EN9 A;  3VA3 A;  4IOC L;  4BRQ A;  4W5N A;  3PO5 A;  3K58 A;  3TAP A;  1ASV A;  4LF7 K;  1QSL A;  3DMJ A;  1YIT N;  2ZF5 O;  3M1F A;  3TAF A;  3H3N O;  3ZSO A;  5JVG L;  1VAZ A;  3DJC A;  2JWL A;  3ID8 A;  3I0R A;  5CZ1 A;  4AQY K;  4M3R A;  4I6M A;  2GX9 A;  1KLN A;  4LFB K;  4OPH A;  2V51 B;  1NOY A;  4CCH A;  4DFJ A;  4CIG A;  4BQL A;  3AO5 A;  3A2F A;  4HTL A;  4IG0 A;  3VEZ A;  3CF5 L;  5C42 A;  4BVO A;  1IKY A;  1BCO A;  2HB5 A;  4JKC A;  3NH0 A;  1K8K A;  4I9L A;  4O0J A;  3VQC A;  4CJL A;  4EP5 A;  2NRX A;  2Q97 A;  4Z4F A;  2P9S B;  5AQJ A;  3F5T A;  1K9M O;  3ZCM A;  2FF3 B;  1ZBS A;  4CIF A;  1DGK N;  4CF0 A;  4FM1 A;  2QWQ A;  3Q7C A;  4FOI A;  5FRM A;  2VGN A;  3N4P A;  3U3G A;  4CGI A;  3ZT3 A;  3C7N B;  4CW7 B;  1U49 A;  3LZI A;  4BDY A;  3CM6 A;  5LY3 A;  3EYZ A;  3MWT A;  3V1Q A;  2P5G A;  1T05 A;  3MN7 A;  4DR7 K;  4Y1D A;  1NGJ A;  2OCE A;  1UWB A;  2HHV A;  4H5T A;  3E9P A;  4W5R A;  1ZC6 A;  4FK0 A;  1KQS M;  2E6M A;  4F2S A;  1BDG A;  3HZ6 A;  4E7J A;  1QSS A;  4MLE A;  4B9N A;  4ISG A;  2D0C A;  1VSE A;  2RKI A;  3H1Q A;  5EU7 A;  2V7Z A;  2R7Y A;  3HM9 A;  3CYM A;  5AQY A;  4A2A A;  1VSD A;  5F2R A;  4BC2 A;  1L3V A;  4G1Q A;  1GLJ O;  4H0Y B;  1HJR A;  3L0Q A;  3V1O A;  4BC5 A;  2HVI A;  3OYM A;  1DTT A;  2Z1G A;  4LF8 K;  4CES A;  2OPR A;  2O8B A;  1HPM A;  4JS5 A;  4X66 K;  5BRD A;  4DSE A;  3V1R A;  4DFM A;  4IO8 A;  3CCM N;  4JYA K;  3HVT A;  1J9A A;  4NXM K;  5HP1 A;  2BGG A;  1VHX A;  2WBN A;  4RCH A;  4AM6 A;  2FBT A;  2E4L A;  2G8F A;  2O4G A;  2KFN A;  4Y0W A;  1JL1 A;  4DS5 A;  2O8F A;  4JAX A;  4XH4 A;  2D0B A;  1JLE A;  5AQG A;  1YVU A;  2PY5 A;  4KHW A;  1S72 N;  1KLM A;  4KH4 A;  2Q0U A;  3SBG A;  3TAE A;  3L3V A;  3H1V X;  1TL3 A;  3T19 A;  4DQP A;  3B6P A;  2ITG A;  2BTF A;  4CJK A;  3KWI A;  4DF8 A;  4Z4G A;  2VGM A;  1XMQ K;  4CBX A;  3LWL A;  1EO1 A;  4LC9 B;  4FWQ A;  3CJB A;  1SL1 A;  3TAB A;  2RHK A;  3HSC A;  3QET A;  1TV6 A;  1HKG A;  3NVM A;  1N36 K;  1TYQ B;  3WQU A;  5ADX A;  4M7X A;  2EWS A;  3SJJ A;  3QBX A;  3WNG A;  5FPM A;  4CFD A;  2ZE2 A;  3VQ6 A;  4DTO A;  1WN7 A;  3TAN A;  1QQM A;  4BRF A;  1WBB A;  1JKH A;  3QIP A;  4CEO A;  1U2V B;  2GUI A;  1BIU A;  3I33 A;  4DTJ A;  3RSE A;  1TUU A;  2KHO A;  3QER A;  1HR0 K;  3P5J A;  1KC8 O;  2XY7 A;  2J4R A;  4B3S K;  4DU1 A;  2YJF A;  4RG8 A;  4FOE A;  1L3S A;  2Y1J A;  4FZY A;  2VYP A;  3L3U A;  3NGY A;  1XNQ K;  4N56 A;  4M42 A;  3CFR A;  3BY5 A;  4IJA A;  4Z4E A;  3HK2 A;  1U47 A;  2GWK A;  1BQM A;  4H5W A;  1NJY A;  2IS3 A;  3OYB A;  1ASU A;  3BF3 A;  4B8C A;  3ZSZ A;  4Q0B A;  1YJ9 N;  3CFO A;  2G8H A;  4JI5 K;  2V7Y A;  1WBD A;  3FZM A;  2VQF K;  1GOA A;  1YAG A;  3SI6 A;  3AGK A;  3K5L A;  3OYN A;  3L8B A;  2XY6 A;  3RRH A;  3DLG A;  1QQC A;  5CY4 A;  4GV3 A;  1P90 A;  4CF9 A;  4KI4 A;  4M63 C;  1NGE A;  4CFC A;  4PKH A;  3O1W A;  1XMO K;  2KLA A;  2QW9 A;  4HUF A;  3UIQ A;  1NGI A;  2E88 A;  3SNN A;  3OBY A;  1KVB A;  3BDP A;  3F2K A;  2IVN A;  2HND A;  1IV0 A;  2NUB A;  2YHX A;  4J8F A;  3QEX A;  4ILG B;  2I7N A;  3WNH A;  1J5O A;  2IDO A;  4BWJ A;  4M3Y A;  3DXM B;  2YHA A;  4DSK A;  3S41 A;  1U6Z A;  4B9M A;  5I42 A;  4B3T K;  3KTQ A;  3OY9 A;  4B9U A;  4WQ4 A;  3L2Q A;  5EY4 A;  5EX5 A;  4B9Q A;  3OYJ A;  4FJK A;  4CD3 A;  1NK6 A;  4KTW A;  3M8S A;  4FWR A;  3CCE N;  3SAF A;  4CEE A;  1HQU A;  3TWH A;  1U04 A;  2Q1N A;  1XC9 A;  3IS9 A;  3L4Q A;  3LDN A;  2QWP A;  3LP2 A;  3BF1 A;  3HPO A;  3H6E A;  1NGF A;  3FZL A;  4CJ4 A;  5DM7 L;  3ISN C;  4AHC A;  2O8D A;  1QE1 A;  4DTS A;  1IKX A;  4JI4 K;  2P9P A;  1YI2 N;  4JKD A;  4FJH A;  1RTD A;  1YF5 L;  4HCC A;  2KZZ A;  4FLW A;  2OZM A;  2QK9 A;  3GDQ A;  1BL3 A;  1VRU A;  3MMV A;  4FLX A;  5HLF A;  5AFU A;  3C6U A;  3V9W A;  5LL6 Z;  4O8U A;  3O9T A;  1BUP A;  4Q5V A;  2D0O A;  3BGR A;  1HYZ A;  4KKO A;  1VQ9 N;  2E5L K;  3DLL L;  5AQU A;  4E7I A;  3SAH A;  4BG8 A;  1BCM A;  4JRP A;  3THW B;  1KXP A;  2P9P B;  2GBZ A;  3ULE A;  3AVI A;  2BDP A;  4CI6 A;  2IIR A;  4O5F A;  3ZT2 A;  2VWK A;  4JKA A;  4BR9 A;  5C12 A;  2QWN A;  3LPT A;  3KWG A;  4FWL A;  4ELV A;  1S1X A;  4B9L A;  5FPD A;  3H08 A;  1KRP A;  4PKG A;  4MQ3 A;  4BR7 A;  5J2Q A;  3HXM A;  5AQW A;  1C1B A;  3D6R A;  3M8P A;  4BG9 A;  4H4M A;  4CZF A;  4TSX A;  3K5O A;  3VQ5 A;  4DF4 A;  2O8C A;  4FL9 A;  1NJI O;  2E6L A;  4NCB A;  3ZEU B;  4AM7 A;  1KD1 O;  3MCA B;  4WFB L;  3AVM A;  1VSI A;  3V6D A;  3RWU A;  3C6T A;  1RTH A;  4C1N I;  3LZJ A;  1HYV A;  1O1W A;  3MN5 A;  4KHY A;  4M3Z A;  4FJ7 A;  1REV A;  2ZQB A;  2OAN A;  3G4S N;  3CG7 A;  3U8X A;  4JEP A;  2P9L B;  4KHN A;  3CI5 A;  3JSM A;  1BU6 O;  2A1R A;  1X3M A;  1NBW A;  4L8R B;  3A5M C;  4CE9 A;  2CGJ A;  1N34 K;  1J6Z A;  4H0V B;  1Q81 O;  1Q9Y A;  1C6V A;  1S9G A;  1Q9X A;  1N6Q A;  1HKB A;  4CJE A;  2UUB K;  2G8V A;  1IKW A;  4CZH A;  5LJV A;  3QO9 A;  4OPJ A;  5BN9 A;  3GOI A;  3QIO A;  3V81 A;  4A2B A;  2YHB A;  4AHV A;  3NH2 A;  1NU0 A;  1HMV A;  3NAE A;  1V4S A;  4IJN A;  4DUZ K;  4RW6 A;  2YNH A;  3SCX A;  3AY9 A;  4C8L A;  5AQP A;  3V9U A;  4CFB A;  3L2W A;  3VTI A;  1NJX A;  1NK4 A;  4BC4 A;  3HJF A;  1ZBL A;  1W2B M;  2YI1 A;  3AA4 A;  4BR5 A;  3BEX A;  3UE5 A;  1SL2 A;  1RBS A;  3AGR A;  3AO3 A;  4Y1C A;  2HF4 A;  2Z1J A;  5I3U A;  1GOB A;  3L4I A;  3VQA A;  3QFU A;  2DFH A;  3S9H A;  3WXI A;  1IH7 A;  5AQM A;  4DMN A;  3MED A;  4F9O A;  4CJ3 A;  4FWS A;  1BIS A;  3LM9 A;  4F4K A;  4IWV A;  4FJL A;  4BR4 A;  4CEC A;  1W9H A;  4CF1 A;  3C94 A;  4KHS A;  1J54 A;  2YHY A;  3IFR A;  4E19 A;  2NRV A;  3AVB A;  1RT3 A;  4DR4 K;  3HTV A;  5E26 A;  2YHW A;  3ZET A;  3HYF A;  3OYE A;  4J2D A;  4BRO A;  5EVZ A;  3D7E O;  5AQS A;  3L2V A;  4IDH A;  4CJV A;  2DY4 A;  4DUY K;  2HMI A;  4ZTJ A;  4LF5 K;  3CHW A;  3AO1 A;  4HUE A;  3ZLJ A;  3AO4 A;  3SBT A;  3BUZ B;  3IMX A;  1LAW A;  5AQK A;  1NK0 A;  4OGE A;  1Q82 O;  3S3N A;  4IEI A;  3AVL A;  4CJW A;  3S3M A;  3TPQ A;  3M5R A;  1L3U A;  4JLH A;  2RN2 A;  4FK4 A;  1NGA A;  3HL8 A;  3B8A X;  3AA3 A;  1HNZ K;  4DV5 K;  2QWR A;  3RMC A;  4KRE A;  3C95 A;  3ZET B;  1Y97 A;  4CZL A;  4ILJ A;  5I9E B;  4E1M A;  3QEV A;  1C0T A;  4NYN A;  4MFB A;  4YOU A;  1JJ2 M;  2F96 A;  3RRG A;  3CM5 A;  5KQ8 A;  5CZ2 A;  4XH1 A;  3T1A A;  4H0P A;  4B08 A;  1KFD A;  1S1U A;  1XHX A;  3VTH A;  4BY9 C;  3VF6 A;  1L3T A;  2W40 A;  3VGM A;  2A41 A;  5M1P A;  5B8H A;  1Q86 O;  1MWM A;  3U9Z A;  3A0I X;  4JK7 A;  4FVM A;  2QWO A;  4EIA A;  4NLB A;  2KQ2 A;  1IG9 A;  3M8Q A;  1NG9 A;  3NMU A;  2QXF A;  1LV5 A;  4A5B A;  1BQN A;  2JLE A;  1Y64 A;  3PIO L;  1YT3 A;  1RDB A;  2KW4 A;  2CH6 A;  5HRO A;  3CFP A;  2KZM A;  2JGU A;  3V9S A;  4OJR A;  1MU2 A;  3J80 O;  2UUA K;  4BR0 A;  3ZX2 A;  3VQE A;  1TKZ A;  5E41 A;  1VQO N;  4C8O A;  4RWT A;  4W5T A;  3THY B;  1NGH A;  4KBO A;  2UXD K;  1Q18 A;  1HNX K;  4F2R A;  1XNR K;  4CK2 A;  1O13 A;  4BAC A;  4FYD A;  2GWJ A;  3QBW A;  3OS1 A;  3VQ8 A;  4FXD A;  2EHG A;  4E7K A;  2IVP A;  4EHT A;  1VSH A;  3TSU A;  3FR0 A;  4DLG A;  3CCQ N;  2P9S A;  1X9J A;  3VES A;  1IJJ A;  3VQQ A;  3D2F A;  3LPU A;  4AHU A;  4OKK A;  2IVO A;  4IDK A;  1MA9 B;  1BI4 B;  1TKX A;  4FJ5 A;  3K5N A;  3C7N A;  4YOW A;  3AVN A;  1BG3 A;  4RW7 A;  4IOA L;  4MDA A;  3FFI A;  1T03 A;  3SAG A;  2HBL A;  4BWM A;  3SYZ A;  2IC3 A;  4KFB A; 
#chains in the Genus database with same CATH homology
 2GUI A;  3LDS A;  1BIU A;  3QNN A;  3MEC A;  4CGF A;  5HRP A;  5CYQ A;  4DTJ A;  3TR8 A;  1RT1 A;  4KRF A;  1WSJ A;  5HRR A;  3ZSV A;  3PX6 A;  4JS4 A;  3SQ1 A;  3QER A;  3AVK A;  3DLK A;  4J2B A;  4FJN A;  1VSK A;  3P5J A;  2XY8 A;  3KIO A;  1IO2 A;  2XRI A;  4KB1 A;  2EX3 A;  4CHP A;  3TAG A;  2XY7 A;  3MXM A;  1NOZ A;  2VWJ A;  1RT2 A;  1G15 A;  3AVJ A;  3LAN A;  2YNF A;  4CJF A;  4DU1 A;  4E3S A;  3MEG A;  4RG8 A;  3RMB A;  3PO4 A;  1KTQ A;  4DTU A;  1L3S A;  4PWD A;  2Y1J A;  4FZY A;  3NHG A;  3L3U A;  2B5J A;  3NGY A;  4CJQ A;  4EP4 A;  4N56 A;  3VQB A;  3ZSR A;  3CFR A;  4M42 A;  4KO0 A;  1HYS A;  4Z4E A;  1TVR A;  1VSL A;  1U47 A;  3HK2 A;  4CIE A;  4Z4H A;  4C8M A;  1BQM A;  2YV0 X;  1NJY A;  1JXB A;  4IKF A;  4DFP A;  4DQQ A;  2IS3 A;  3TAM A;  1ASU A;  3OYB A;  4O5B A;  4C8N A;  2P5O A;  4B8C A;  3ZSZ A;  4Q0B A;  3SUN A;  1S1V A;  4O55 A;  3KLE A;  4DTM A;  3CFO A;  3NF7 A;  1D9F A;  1EET A;  2G8H A;  3KKS A;  3CQ8 A;  2P51 A;  4RW4 A;  1U4B A;  1RT5 A;  1C0M A;  1CXQ A;  3ZSQ A;  5J1E A;  1UA0 A;  4QOZ B;  1GOA A;  1LWC A;  1FXX A;  3SI6 A;  3K5L A;  3L8B A;  3OYN A;  2XY6 A;  4PQU A;  3OJS A;  1CLQ A;  4AHR A;  3RRH A;  3DLG A;  1Z26 A;  4N47 A;  1QQC A;  5CY4 A;  3NGZ A;  2DTU A;  1C1A A;  5JS1 A;  5D3G A;  4CF9 A;  4KI4 A;  1Z25 A;  1JL2 A;  2HNZ A;  4CFC A;  4FCY A;  4Z4I A;  4QCL A;  3O4N A;  4DTR A;  2PYJ A;  3HO1 A;  1NK9 A;  1UA1 A;  4HUF A;  3UIQ A;  1JLC A;  1I39 A;  4CEA A;  4CF2 A;  2B6A A;  3ASM A;  3DLR A;  3SNN A;  3AVG A;  1TK8 A;  1D9D A;  1KVB A;  3BDP A;  1ASW A;  1QS4 A;  1RTJ A;  4FLV A;  2WOM A;  2FC0 A;  4LSN A;  1QSY A;  1RDD A;  3VA0 A;  2IAJ A;  1NKE A;  3DRP A;  3DOL A;  2HND A;  2VG7 A;  4HUG A;  4DSF A;  4CGH A;  2OPQ A;  3MXI A;  5DMR A;  1SKR A;  2NUB A;  4LH5 A;  2HHU A;  4FJJ A;  3QEX A;  3WNH A;  1J5O A;  3G0Z A;  2IDO A;  5FDL A;  3QEW A;  2O4I A;  3AO2 A;  4BWJ A;  3RTV A;  4M3Y A;  2YHA A;  4DSK A;  4E0D A;  3KD1 E;  3SPY A;  3SQ2 A;  4B9M A;  5I42 A;  4CGD A;  3KTQ A;  4KPY A;  3SV4 A;  5J2N A;  4H8K A;  3QIP A;  3OY9 A;  4B9U A;  1RDA A;  3L2Q A;  3LWM A;  1BI4 A;  1EP4 A;  4M45 A;  4CJP A;  4DU3 A;  3OYJ A;  4GW6 A;  4FJK A;  4FJI A;  4KHU A;  4BDZ A;  2YKN A;  1NK6 A;  2FBV A;  1TGO A;  4KTW A;  3M8S A;  1JLA A;  4W5O A;  4DU4 A;  4CEE A;  1HQU A;  2HNY A;  3O3G A;  3TWH A;  2HHS A;  1U04 A;  3OYH A;  3QNO A;  1NK7 A;  1XC9 A;  3NCI A;  3DLE A;  3RR8 A;  2YNG A;  3IS9 A;  1WLJ A;  4O44 A;  4ZTF A;  1NKC A;  3LP2 A;  2XO7 A;  3SPZ A;  4M41 A;  3VQ7 A;  3SUQ A;  3HPO A;  4FLZ A;  4OKE A;  4BE0 A;  3THV A;  4OGC A;  4CJ4 A;  4DS4 A;  2Y1I A;  1VRT A;  2OPS A;  3ISN C;  1S6P A;  4IFY A;  4ELT A;  4AHC A;  1RNH A;  4FJX A;  1QE1 A;  3NDK A;  4FZZ A;  3HST B;  1I3A A;  4E89 A;  4DTS A;  1IKX A;  1HQE A;  4FK2 A;  3F73 A;  4CER A;  1TAU A;  3D45 A;  4FJH A;  3VQ9 A;  4CHO A;  1RTD A;  3QEI A;  1UAX A;  3EY1 A;  2QKB A;  4DQI A;  3TAQ A;  4OVL A;  4KAZ A;  5K14 A;  4HCC A;  2KZZ A;  4FLW A;  4M3W A;  2OZM A;  1N5Y A;  2ETJ A;  3HPG A;  2G8U A;  4IBN A;  1VSM A;  3OS0 A;  2QK9 A;  1BL3 A;  4DTX A;  1VRU A;  4CFA A;  2YKM A;  1TL1 A;  1BIZ A;  1RT4 A;  4FLX A;  5HLF A;  5SWM A;  1B9F A;  4B3O A;  3C6U A;  3OYD A;  3V9W A;  4OPK A;  4FJG A;  1RIL A;  1YTA A;  4IG3 A;  3PX4 A;  1LAV A;  3RMA A;  4Q5V A;  2HHQ A;  3BGR A;  3O3F A;  1HYZ A;  4KKO A;  2BE2 A;  4FJ8 A;  1TK5 A;  3VQP A;  4N5S A;  2F8S A;  2HHT A;  1TAQ A;  2HVH A;  2IOC A;  3ZSY A;  3KLI A;  4E7I A;  3DLH A;  3EZ5 A;  3AVH A;  1BCM A;  4JRP A;  4I2P A;  2QKK A;  3AVA A;  3HP9 A;  4CHY A;  2GBZ A;  3AVI A;  1JLQ A;  4GVM A;  2BDP A;  3ZSX A;  3F9K A;  3ZT2 A;  3OYI A;  3AA2 A;  1TKD A;  2HW3 A;  1K6Y A;  2VWK A;  3G10 A;  4C8K A;  1LW2 A;  5T7B A;  4FZX C;  4CEQ A;  4OKJ A;  4HCB A;  2WON A;  4CJT A;  3LPT A;  3OYF A;  1DLO A;  5KRS A;  1WAJ A;  4ELV A;  4E1N A;  1X1P A;  3OJU A;  1S1X A;  1NJZ A;  4O0I A;  4CHQ A;  2D0A A;  1VSJ A;  2OPP A;  3H08 A;  4B9L A;  4LH4 A;  1KRP A;  1WAF A;  2RF2 A;  2RPI A;  4MQ3 A;  1T7P A;  1C0U A;  1RT7 A;  3E01 A;  3OVN A;  5HRN A;  4AH9 A;  5J2Q A;  3HXM A;  1XHZ A;  3ZT0 A;  4F3T A;  4LSL A;  1B92 A;  4UQG A;  4AIL C;  1C1B A;  1KFS A;  3DLB A;  3M8P A;  4H4M A;  1TKT A;  4WE1 A;  2YNI A;  3K5O A;  4TSX A;  1WSE A;  3MXJ A;  3VQ5 A;  3HT3 A;  4DF4 A;  3SUO A;  1IKV A;  4I2Q A;  2E6L A;  4M3U A;  1QHT A;  4NCB A;  5HRS A;  1HNV A;  3DOK A;  3AVM A;  1VSI A;  1J53 A;  1SUQ A;  1XWL A;  3V6D A;  3I8D A;  3NF9 A;  3RWU A;  4DFK A;  1FK9 A;  2X74 A;  4CJS A;  3L2U A;  3C6T A;  5KGW A;  1RTH A;  4E7H A;  5SZT A;  1R0A A;  1CZB A;  3LZJ A;  3K57 A;  1HYV A;  1O1W A;  4B9S A;  2AJQ A;  3OS2 A;  4KHY A;  4M3Z A;  4FJ7 A;  2B4J A;  2A1S A;  1REV A;  2ZQB A;  3KKR A;  1EXQ A;  2KTQ A;  1B9D A;  3CG7 A;  2OYQ A;  3OYK A;  4CGG A;  1WSG A;  1T8E A;  4KHN A;  1WSI A;  3JSM A;  4DWI A;  4DQR A;  4ELU A;  2A1R A;  4L8R B;  1CXU A;  4CE9 A;  2Z1I A;  4K8Z A;  3D0P A;  4DSL A;  5FRO A;  4RW8 A;  3AVF A;  2FBY A;  3LP1 A;  3KLG A;  1Q9Y A;  1C6V A;  1S9G A;  4H4O A;  4FW1 A;  4B8A B;  1Q9X A;  5KI6 A;  1SV5 A;  1S6Q A;  4GMJ B;  3P83 D;  4CJE A;  5C25 A;  3M8R A;  1N6Q A;  2G8V A;  1IKW A;  1JLF A;  5FRN A;  3SZ2 A;  4CJ5 A;  4AHT A;  3QO9 A;  3TAR A;  4OPJ A;  5JS2 A;  3ALY A;  2FBX A;  1A5X A;  1NK8 A;  1S1T A;  2X6N A;  3QIO A;  3OYA A;  3V81 A;  2YHB A;  4AHV A;  4BDP A;  3NH2 A;  1HMV A;  1JXE A;  2Z1H A;  4CEF A;  3NAE A;  1X9W A;  3DI6 A;  4BE1 A;  3RR7 A;  4PUO A;  3LAM A;  4RW6 A;  2YNH A;  3IAY A;  4PY5 A;  4B9T A;  3SCX A;  4O4G A;  3O4Q A;  3I0S A;  4AHS A;  4C8L A;  3V9U A;  3QLH A;  4CFB A;  3L2W A;  3HPH A;  3U6F A;  1ZYQ A;  1NJX A;  3K59 A;  4EZ9 A;  1CZ9 A;  1NK4 A;  3HJF A;  1L5U A;  1W0H A;  3ITH A;  4BE2 A;  1KVA A;  1ZBL A;  2D5R A;  3AA4 A;  1FKO A;  3DYA A;  1SL0 A;  4ID5 A;  1SL2 A;  1RBS A;  2PYL A;  3AO3 A;  3AVC A;  1DTQ A;  4Y1C A;  3QEP A;  1WSH A;  3IG1 A;  4R5P A;  2Z1J A;  3IRX A;  3WNF A;  3RMD A;  3QIN A;  5I3U A;  1KSP A;  2BAN A;  3VA3 A;  1GOB A;  1XI1 A;  1ZBH A;  3K2P A;  4W5N A;  1D5A A;  3VQA A;  1KCF A;  1X9S A;  2DFH A;  3TI0 A;  3KLF A;  3K58 A;  3TAP A;  3PO5 A;  4JRQ A;  4FM2 A;  3S9H A;  1IH7 A;  4DMN A;  3MED A;  3VQ4 A;  1U45 A;  4CJ3 A;  2OZS A;  1ASV A;  1VK0 A;  4QAG A;  1BIS A;  1HPZ A;  3HP6 A;  3QES A;  1D8Y A;  4OLA A;  3LP0 A;  4F4K A;  1QSL A;  4CHN A;  3DMJ A;  3U3Y A;  2X6S A;  3TAF A;  4FJL A;  3ZSO A;  4CEC A;  1W9H A;  3NFA A;  2GV9 A;  1ITG A;  2VG5 A;  3VN5 A;  4CF1 A;  5CZ1 A;  3I0R A;  4M3R A;  1NKB A;  4FLT A;  3C94 A;  2OA8 A;  4KHS A;  1J54 A;  4E19 A;  1KLN A;  1Q8I A;  2DFE A;  3AVB A;  2G8W A;  1S5J A;  2VG6 A;  1NOY A;  4CCH A;  1RT3 A;  1S9E A;  4DFJ A;  1HRH A;  2ZD1 A;  4CIG A;  4KI6 A;  4CJU A;  3HYF A;  3OYE A;  3AO5 A;  3KK2 A;  4J2D A;  3A2F A;  1EKE A;  4I9Q A;  3L2V A;  4N41 A;  3OYL A;  4IG0 A;  3P1G A;  4CJV A;  4FJM A;  4CED A;  5C42 A;  2HMI A;  4CEZ A;  4ZTJ A;  2DY4 A;  3PUF A;  4HUE A;  3AO1 A;  4CK1 A;  3AO4 A;  1IKY A;  1BCO A;  3DRR A;  2HB5 A;  1SKS A;  4J2E A;  3NH0 A;  4O0J A;  4I9L A;  4CJL A;  1WNS A;  3VQC A;  1LAW A;  4EP5 A;  4PA1 A;  1ZBU A;  1NK0 A;  1QTM A;  4OGE A;  4Z4F A;  5DK5 A;  3S3N A;  3AVL A;  4CJW A;  3ZCM A;  3S3M A;  3SUP A;  4CIF A;  1RT6 A;  4JLH A;  4CF0 A;  1L3U A;  2G8K A;  4FM1 A;  3KD5 E;  2RN2 A;  1RDC A;  4FK4 A;  3HL8 A;  5FRM A;  4FLU A;  3AA3 A;  4I7F A;  4ZHR A;  1ZBF A;  3U3G A;  2W42 A;  4CGI A;  3RMC A;  4KRE A;  4B9V A;  3DRS A;  1NJW A;  3PX0 A;  1NK5 A;  3ZT3 A;  3C95 A;  1Y97 A;  3V9Z A;  4DSI A;  3NH1 A;  3OYC A;  3K5M A;  4NCA A;  1U49 A;  1LW0 A;  3LZI A;  4ICL A;  4E1M A;  4HTU A;  4BDY A;  3QEV A;  1U48 A;  3CM6 A;  1C0T A;  4CGJ A;  4NYN A;  3L2R A;  1RBU A;  1GOC A;  4MFB A;  4Z0U A;  3KK1 A;  2F96 A;  3EYZ A;  3T3F A;  3RRG A;  4EZ6 A;  4N76 A;  4M3T A;  4CF8 A;  3CM5 A;  3V1Q A;  2P5G A;  1JLB A;  1T05 A;  3SQ0 A;  3ZT1 A;  5CZ2 A;  4Y1D A;  3T1A A;  3LAL A;  5HBM A;  4FM0 A;  1RBV A;  1KFD A;  4B08 A;  2HVI A;  4HVJ A;  1UOC A;  1UWB A;  1S1U A;  1S1W A;  1XHX A;  3O3H A;  4K8X A;  4OLB A;  2HHV A;  4DG1 A;  3WNE A;  4W5R A;  3NE6 A;  1L3T A;  4FK0 A;  3ULD A;  2E6M A;  4F2S A;  2LSN A;  4ID1 A;  5KRT A;  4CJR A;  4KTQ A;  3AA5 X;  2X78 A;  4CK3 A;  4E7J A;  3LP3 A;  1QSS A;  4B9N A;  3DM2 A;  2D0C A;  1VSE A;  2RKI A;  5CYM A;  4XIU A;  3HVR A;  4DQS A;  5EU7 A;  2R7Y A;  3HM9 A;  1TK0 A;  2F8T A;  3CYM A;  2ATQ A;  4FVM A;  4CEB A;  3KLH A;  4RW9 A;  1VSD A;  3V9X A;  1L3V A;  3AV9 A;  2KQ2 A;  2KFZ A;  4G1Q A;  3M8Q A;  1IG9 A;  3OYG A;  1HJR A;  1JLG A;  4LD0 A;  2G8I A;  2DFF A;  4E7L A;  3V1O A;  4CEO A;  2QXF A;  1LV5 A;  4YFU A;  4CHZ A;  4IFV A;  1BQN A;  3OYM A;  4DTN A;  1WSF A;  1DTT A;  2Z1G A;  4KHQ A;  2JLE A;  4CES A;  4YNQ A;  2OPR A;  1YT3 A;  1RDB A;  4JS5 A;  1RBR A;  4DSE A;  3V1R A;  4DFM A;  2KW4 A;  5KTQ A;  4DLE A;  4FW2 A;  4FLY A;  3HVT A;  3CFP A;  1J9A A;  1HNI A;  5HRO A;  3MEE A;  2KZM A;  5HP1 A;  2JGU A;  1C1C A;  2BGG A;  3V9S A;  4LY7 A;  3V4I A;  4OJR A;  1MU2 A;  1RBT A;  3KJV A;  3VQE A;  5J2P A;  1TKZ A;  5E41 A;  4C8O A;  2FBT A;  4W5T A;  1BHL A;  2E4L A;  2G8F A;  2O4G A;  2KFN A;  4HHT A;  1EX4 A;  1JL1 A;  4F2R A;  1ZBI A;  2HHW A;  4DS5 A;  4CK2 A;  4FYD A;  4BAC A;  4KTZ A;  3NGI A;  2D0B A;  1JLE A;  4NCG A;  1YVU A;  3OS1 A;  2PY5 A;  3VQ8 A;  4KHW A;  1KLM A;  1LWF A;  4FJ9 A;  4FXD A;  2XHB A;  2EHG A;  4E7K A;  5C24 A;  4W5Q A;  3L3V A;  3VQD A;  5J2M A;  3TAE A;  3MAQ A;  4M3X A;  1TL3 A;  3T19 A;  3NF6 A;  4DQP A;  1VSH A;  2IGI A;  3ZSW A;  3B6P A;  2ITG A;  3LAK A;  5KGX A;  4CJK A;  4DLG A;  3S3O A;  1YTU A;  3NF8 A;  1A5V A;  4DF8 A;  3VQQ A;  4F3O A;  4Z4G A;  2HHX A;  3LPU A;  3SQ4 A;  3B6O A;  3LWL A;  1F21 A;  1RTI A;  4AHU A;  3SV3 A;  1BGX T;  4Z4C A;  4OKK A;  1LWE A;  1VSF A;  1SL1 A;  3TAB A;  2PZS A;  3QET A;  1FKP A;  1TV6 A;  3JYT A;  4IDK A;  1RCH A;  2Q3S A;  1BI4 B;  3ZT4 A;  1TKX A;  4FJ5 A;  1X9M A;  3K5N A;  4KB0 A;  4NYF A;  3SJJ A;  1KVC A;  3AVN A;  3NBP A;  3WNG A;  3PV8 A;  4F8R A;  1SKW A;  2XY5 A;  4CFD A;  2ZE2 A;  2P1J A;  4RW7 A;  3VQ6 A;  4DTO A;  4DSJ A;  3KK3 A;  3PY8 A;  3FFI A;  1T03 A;  1WN7 A;  1A5W A;  3TAN A;  4KV8 A;  4DTP A;  4BWM A;  1JKH A;  3SYZ A;  2I5J A;  2IC3 A;  4J2A A;  4KFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...