3NF7A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf7A00
1RTDA 5KRSA 4CECA 2KFZA 1U04A 4OPKA 1XHZA 1UWBA 2O4GA 4FZYA 1S1TA 5JS1A 1UOCA 1HQEA 4DTSA 4Z4FA 4CJPA 3LP0A 4CEFA 2QKKA 4I9QA 1IKWA 3SUOA 3ZSXA 4FJ7A 2YV0X 4CHZA 3OYNA 4KO0A 1NK5A 1TKDA 4CGHA 4KFBA 1RDCA 1JLQA 2B5JA 4KHUA 3VQ4A 4PQUA 4CJ5A 1WNSA 5HRNA 4E7LA 3OYBA 4DTJA 3F9KA 3SUQA 1JLEA 4FJJA 4N47A 4DU3A 2OPSA 1NK9A 1D9DA 1WLJA 4M3ZA 1CLQA 3ZSRA 1A5XA 3HT3A 4NCAA 1BIUA 3AA5X 4CERA 2Q3SA 3QEXA 3HM9A 2GV9A 3AVFA 1U48A 3TAQA 3T19A 4KREA 3DLEA 1HYVA 4IG0A 4BWMA 1T8EA 4CJRA 5JS2A 1IKVA 4DTPA 1WN7A 2FBVA 4FVMA 3SQ4A 3ZSWA 4CF1A 4DFPA 4O5BA 3WNHA 4W5RA 3RTVA 1QSSA 1RBVA 3K5MA 3SV4A 2PYJA 3VQ6A 1EETA 4JRPA 3TAFA 3RR7A 4BE0A 1SL1A 1HRHA 3JYTA 3L2RA 3MXMA 1YT3A 3CYMA 4Z4CA 4H4MA 3O3HA 3LP1A 3ZT0A 1BI4B 3G10A 3AVLA 3OYEA 4FJXA 3S3OA 1FK9A 4N41A 1IH7A 4JRQA 4C8MA 1VSFA 1Z25A 2FC0A 4DG1A 5KGWA 2WOMA 2VWJA 1U45A 3M8RA 1NJZA 1HYSA 5KRTA 3RRGA 1BCMA 4I9LA 2G8IA 1RBTA 4CJLA 3OJSA 4J2EA 1BIZA 1S9GA 3V9SA 4IG3A 1KSPA 3PX6A 4F3TA 3V9UA 1IKXA 1BGXT 4DFKA 3V9XA 5J2MA 1SL2A 1RBRA 1D8YA 4DQIA 2O4IA 2BGGA 1C0TA 2FBYA 1C1AA 4CF2A 1HJRA 1KCFA 4FW1A 4OLBA 1BI4A 3OJUA 3O4NA 1C1CA 3WNGA 5HLFA 4EZ9A 3MEEA 1VSKA 4DFJA 3AVJA 3FFIA 4DTOA 4KAZA 2D0AA 4J2BA 3RMCA 4PUOA 4ELTA 1RDBA 4FJ5A 2G8KA 3AA4A 5CZ1A 1ITGA 3AVBA 1JL2A 5E41A 1RBSA 1TKXA 2ZQBA 3O3FA 4H8KA 1TAUA 1GOBA 3B6PA 1VSEA 3K58A 1RT2A 1TK0A 3IRXA 4E7JA 3L2VA 3ZCMA 4CJWA 1WSGA 3BDPA 4OKKA 3OYDA 3QEPA 1TKTA 3AVIA 2LSNA 3AO2A 3DLKA 5HRPA 4DTMA 3SI6A 1U47A 5CY4A 1KVAA 3TI0A 1SV5A 1RTJA 2HNYA 2OPRA 5CYQA 1D9FA 4CJUA 1ZBLA 4PWDA 4CESA 4FM2A 3DM2A 1KVBA 2HHTA 3ASMA 3WNEA 4CFBA 3L2WA 4CF0A 1LV5A 3A2FA 2ETJA 4R5PA 1JLCA 3DLGA 3HO1A 3P1GA 1L3VA 1QS4A 4OGEA 4CJSA 4K8XA 1HNIA 3OYMA 5J1EA 4HVJA 1NKBA 1YVUA 4DU4A 3L8BA 3TAPA 3QIPA 2YKNA 4FJNA 4B8AB 4LH5A 4KHSA 3NH1A 4E89A 1QE1A 1NKCA 2BANA 1T05A 3TARA 4CJQA 3D0PA 4FJHA 4YFUA 1BCOA 4CE9A 4OPJA 4CHPA 1UAXA 3P5JA 4F2SA 3ALYA 3TR8A 2A1RA 4OGCA 4CGDA 3U3YA 2ZD1A 1Q9YA 1RCHA 3HJFA 3QEWA 2IGIA 3DLRA 1FKPA 1RT4A 4I2PA 1VRUA 2Z1HA 1S5JA 3M8PA 5K14A 3ZT1A 4O0JA 3V9ZA 3V81A 3O4QA 4FLVA 2HW3A 4CK3A 3QEIA 1DLOA 1KFDA 3JSMA 1X1PA 3NFAA 4RW9A 3SV3A 2GBZA 4FLYA 2X6NA 3NHGA 4DSIA 4OLAA 3H08A 3HK2A 1N6QA 4B8CA 3VA0A 4DTUA 3L2UA 2QK9A 4BDZA 4Z4EA 1RT7A 1KLMA 5CZ2A 2HVHA 2OPPA 1B9FA 3SQ0A 1U49A 1SKRA 1YTUA 1JLAA 4C8NA 4KHQA 4CF9A 4CGGA 4K8ZA 3ZSZA 3AA2A 3SCXA 3DRRA 3VN5A 3QNOA 4RW4A 3NF6A 4CIFA 4LD0A 1J9AA 1CXQA 4E1NA 1EKEA 3KIOA 4HUGA 1ZBIA 3NH2A 2KW4A 4CJ4A 4CCHA 3OYLA 3KK3A 4FJGA 1ZBFA 4XIUA 4BDYA 3P83D 4NYNA 4CJKA 4J2AA 4AHSA 1CZ9A 1EX4A 4RW6A 4DFMA 4AILC 2HHQA 1VSIA 1DTQA 3TAGA 1HQUA 4IBNA 3RRHA 1K6YA 2ITGA 3NH0A 1LWFA 4FYDA 5D3GA 3SQ2A 1YTAA 2OZMA 5C24A 4FLUA 2G8HA 3M8SA 3PUFA 4LSNA 1SUQA 4W5OA 2RPIA 2YHAA 3L2QA 1T03A 3OYHA 2OA8A 3HYFA 4NCGA 1NJYA 4C8LA 2DFHA 3MEGA 2KZZA 1XHXA 3AO3A 3IS9A 4B9LA 5HROA 4KRFA 2NUBA 2VG6A 3AVMA 4W5NA 4E1MA 3HP9A 1HPZA 2XY6A 4JS4A 4DSEA 2IAJA 3SPZA 4G1QA 3KLEA 3AVHA 1QHTA 5I3UA 3SYZA 2XHBA 2YNGA 3S3NA 3QERA 2XY7A 4DMNA 4KI4A 3HXMA 1NOZA 3OYGA 2ATQA 3SQ1A 3OVNA 3CQ8A 3LWMA 1RDDA 1RT5A 3B6OA 4LY7A 3C6TA 4Z4IA 2DFEA 2RKIA 3EYZA 2XY8A 2XY5A 3AO1A 3MECA 3NBPA 4CFDA 3CFOA 3VQ9A 3T3FA 3HSTB 1TVRA 4CHYA 4FZXC 4NYFA 3AO4A 3TWHA 4E7HA 4AHVA 1KVCA 2XO7A 4AH9A 4QAGA 2F96A 2R7YA 1C0UA 5HRRA 1L5UA 4B9TA 1TKZA 2Z1GA 3AVGA 4CGJA 3KLGA 4FK0A 3CM6A 4BE1A 1JLBA 1G15A 1REVA 3KD1E 4KB0A 1A5WA 3M8QA 3K5NA 4C8KA 4BE2A 1RDAA 1RT3A 2WONA 3QO9A 2F8TA 2HHXA 4FJLA 4CIEA 5KI6A 4B3OA 4DWIA 3OY9A 4HUEA 1JLFA 2DY4A 4UQGA 1VRTA 2QXFA 3AVCA 4M3WA 4HUFA 4FXDA 4RW8A 4QCLA 3KD5E 2IDOA 3VQBA 3U6FA 4EZ6A 1J54A 1SKSA 4M42A 1HNVA 3E01A 1A5VA 5FROA 3HPGA 4KB1A 1DTTA 4O44A 1VSHA 3DRPA 1B92A 3NDKA 1S1XA 3NE6A 3T1AA 1TAQA 3VQDA 4DTXA 4CHNA 4ZTJA 2G8FA 3KTQA 1B9DA 3QLHA 4FJIA 1VSMA 1WAFA 4HHTA 1UA0A 3BGRA 4OKEA 4BWJA 3ZSQA 5DK5A 3VQAA 4MQ3A 4ZHRA 4JLHA 4GMJB 3F73A 2OPQA 3SUNA 4FLTA 1NK6A 4CEDA 1VSLA 2KQ2A 4AHRA 3C6UA 3VQQA 2D0BA 3DOKA 3SNNA 1VSJA 4O0IA 1RTIA 1NOYA 4E7IA 1LW0A 3VQCA 4CGFA 4FJKA 3I8DA 4CEZA 2W42A 3U3GA 3QETA 4GVMA 3AVKA 2AJQA 3S9HA 2VG7A 5EU7A 3KK1A 3HVRA 3L3UA 3ZT2A 4E19A 3KKRA 4ICLA 1WSHA 5KTQA 1NJXA 2VG5A 2P51A 4AHUA 1QQCA 2RF2A 4Q5VA 1GOAA 3AA3A 3NF7A 4FM0A 3NCIA 4DTRA 4ELVA 3IG1A 4CK2A 1NK8A 5J2QA 2YHBA 4CFAA 2E6LA 3RR8A 5HRSA 4OKJA 1D5AA 1MU2A 4E3SA 3RMBA 2VWKA 1S6PA 2EX3A 3K2PA 4LH4A 4ELUA 4B08A 2HVIA 2YKMA 3PX0A 4DQPA 1ZBHA 4KTZA 4DS4A 1JXBA 1W9HA 3C95A 1C0MA 2IOCA 3DOLA 3TAEA 1ASVA 1XC9A 2BDPA 4KI6A 4BACA 3NAEA 2GUIA 1XWLA 4FCYA 2F8SA 4M3XA 1IKYA 3OS2A 4I2QA 2IS3A 1WSIA 1LW2A 3OYKA 3AO5A 4CHQA 1JXEA 1WSEA 4Y1CA 1TK5A 1C1BA 4O4GA 3C94A 4AHTA 2P5OA 4L8RB 4QOZB 4ID1A 3OYJA 1S1WA 1S6QA 3G0ZA 4TSXA 5FDLA 1IG9A 1FKOA 2G8VA 2X6SA 3OYIA 4DU1A 4CGIA 4CEAA 3K59A 4N5SA 2HHSA 3LALA 2B6AA 3QESA 3VQEA 3ISNC 4CIGA 4M3RA 4KKOA 1R0AA 3I0RA 3TABA 4OVLA 2HNDA 4CJFA 4GW6A 1BQMA 1Q8IA 3RMDA 1L3TA 5J2NA 3D45A 4F2RA 3LP3A 4IFYA 3THVA 1KFSA 3OS1A 4PA1A 3ZSYA 2PYLA 4CEBA 4FK2A 3TANA 1XI1A 4EP5A 5KGXA 1TL3A 3DMJA 3PX4A 3NGZA 4DSJA 4AHCA 4N56A 1S9EA 3O3GA 4J2DA 4RW7A 3QIOA 5SWMA 1RT1A 1O1WA 4FLXA 3DLBA 2A1SA 3PV8A 4KHYA 1T7PA 4DLGA 4FZZA 4FJ8A 2ZE2A 2P5GA 2HNZA 4E0DA 2JLEA 2G8WA 1BL3A 3RWUA 5T7BA 2DFFA 4CJ3A 2KZMA 3VQ5A 4F4KA 1C6VA 3NF9A 2XRIA 1LAWA 1RBUA 4F3OA 2X78A 1RT6A 1VSDA 3V9WA 1JKHA 3UIQA 4B9MA 3KLIA 4B9SA 2E6MA 3LAMA 3HPOA 2DTUA 5FRNA 4KV8A 2OYQA 2Z1IA 4DLEA 3ULDA 1KTQA 3VA3A 2HHVA 1VK0A 4IFVA 4I7FA 5C25A 2YNFA 4DSFA 1KRPA 3LZJA 2D5RA 3AV9A 1JL1A 3CG7A 3SUPA 3KKSA 3AVNA 4KTQA 4PY5A 2RN2A 1L3SA 3L3VA 2FBXA 5C42A 5J2PA 3SPYA 3S3MA 1QSLA 3VQ7A 1RILA 4CFCA 4B9NA 3TAMA 2BE2A 2I5JA 4CK1A 4JS5A 5HBMA 4HTUA 3LANA 1NK0A 2IC3A 1WSJA 3DLHA 3RMAA 1IO2A 3LZIA 3OYCA 4DSKA 1X9WA 3V1QA 1Q9XA 2HHWA 3DYAA 1HYZA 1X9MA 1N5YA 1W0HA 1I39A 4FK4A 1WAJA 1NJWA 4Z4GA 2QKBA 4OJRA 3V1OA 3ZSVA 4O55A 3ZSOA 4Z4HA 3MEDA 4FW2A 3CFRA 4ID5A 3I0SA 3ITHA 4CHOA 3EZ5A 1CZBA 1LWEA 4M41A 3DI6A 1WSFA 4EP4A 3HVTA 3OYAA 1LAVA 2JGUA 2Z1JA 4F8RA 1BISA 3LP2A 3VQ8A 3EY1A 2YNIA 3LDSA 1X9SA 1S1VA 4FLZA 2EHGA 1GOCA 2YNHA 3V4IA 4B9UA 4HCBA 4FLWA 3SJJA 1ASWA 5DMRA 5CYMA 5SZTA 3NGYA 4Z0UA 1F21A 3IAYA 1JLGA 3MXJA 3NGIA 3V6DA 1NKEA 4N76A 4FJMA 4IDKA 4LSLA 4BDPA 2KTQA 1L3UA 4E7KA 1QSYA 5FRMA 1TL1A 3CM5A 4FJ9A 2P1JA 4M3UA 3KLHA 1S1UA 4CJTA 1U4BA 3PY8A 1FXXA 3HL8A 4RG8A 4DQQA 2OZSA 5HP1A 4B9VA 3SZ2A 1J5OA 1KLNA 2PZSA 4KHNA 4H4OA 2HMIA 3QEVA 1SKWA 4KHWA 1LWCA 4DS5A 3LWLA 1EP4A 1HMVA 4DTNA 4KPYA 4M3YA 4CEEA 4M45A 1RTHA 3OS0A 3LAKA 2Y1IA 3OYFA 1EXQA 1I3AA 2D0CA 1NK7A 3QNNA 1BHLA 4KTWA 4WE1A 1ZBUA 3WNFA 4CEOA 4C8OA 3V1RA 1BQNA 4W5TA 3KLFA 1SL0A 3PO5A 4CJEA 5I42A 4HCCA 4NCBA 4MFBA 3PO4A 4DQRA 1RNHA 3LPUA 1ASUA 3KJVA 3K57A 2Y1JA 4FM1A 4CJVA 1ZYQA 4CF8A 2PY5A 3DRSA 2B4JA 3QINA 4DSLA 1J53A 1TGOA 3KK2A 4DF4A 1UA1A 2KFNA 4YNQA 2HHUA 3K5LA 2FBTA 3MAQA 3NF8A 4Y1DA 2HB5A 3AVAA 3ZT4A 1Y97A 1CXUA 3K5OA 4CEQA 3HP6A 3CFPA 4DF8A 4ZTFA 1TK8A 4M3TA 1QTMA 2E4LA 4IKFA 3VQPA 4Q0BA 1Z26A 2X74A 3LPTA 4DQSA 1TV6A 4W5QA 1NK4A 3MXIA 3ZT3A 2G8UA 3HPHA
chains in the Genus database with same CATH superfamily
4DR1K 2KFZA 1ILYA 4OPKA 1S1TA 4DTSA 1HQEA 3E9OA 2IVPA 3ZSXA 4YY3K 2O8FB 1JCFA 5BR9A 5HRNA 3OYBA 1JLEA 4H0TB 5C12A 2AA4A 4DU3A 3SK3A 1Q7YO 4FO0A 3A0IX 1U48A 3D2EB 1HYVA 2RE2A 4IG0A 1T8EA 2O8FA 3DXKB 1IKVA 4BQZA 4DTPA 1HKCA 3BP8A 3ZSWA 4DFPA 4O5BA 1TUUA 4W5RA 1NG9A 1VQ6N 3SV4A 1EETA 2A42A 5ELZA 3JYTA 1YT3A 3O3HA 3IMXA 2DPNA 3KWIA 4FJXA 4JKBA 4BC5A 1H1VA 4I6MB 3D2EA 3S41A 1NJZA 3DXKA 1HYSA 4I9LA 1RBTA 4J2EA 1BIZA 2NRXA 3PX6A 4BRQA 3P31A 5BR8K 3V9XA 1SL2A 4EAHD 4BRLA 5IWAK 2BGGA 1QQMA 4JN4A 4Y0WA 3T1HK 4JI3K 2A6AA 4FWNA 1KCFA 3OJUA 1C1CA 3U8XA 5HLFA 1S22A 3MEEA 4I6MA 1VSKA 4K25A 2D0AA 3RMCA 4PUOA 3CJCA 4ELTA 1RDBA 3K9KA 3AGRA 3AVBA 5E41A 4H8KA 1GOBA 3VGMA 1RT2A 4ISEA 3K0SA 1N32K 3O6WA 1WOQA 3AVIA 3AO2A 3O80A 1KD1O 1KVAA 3TI0A 4UY8O 1ZBLA 3ENOA 3DM2A 3O9SA 1GLFO 3L2WA 4CF0A 3LM9A 4R5PA 2NNWA 3P1GA 4OGEA 4HVJA 1VQPN 1YVUA 3DWLA 5LMUK 3TAPA 3QIPA 4FJNA 2E88A 3NH1A 5I9EB 1NKCA 3TARA 4CJQA 2HBLA 4CE9A 4YOYA 4B3TK 1DGKN 4DR2K 4I2PA 1VRUA 2Z1HA 1S5JA 5K14A 2P9KB 3QBXA 3ZT1A 3O4QA 4FLVA 2CGJA 2EWSA 2GBZA 4FLYA 4DSIA 1WBDA 5AQJA 5BRHA 1J6ZA 4OPAA 1JLAA 4CD3A 5BRFA 5KQDA 1R59O 2P9UA 4CGGA 1BA0A 2P9KA 3VN5A 4RW4A 1EQYA 4Z94A 3NF6A 5EX5A 1CXQA 1HKBA 4YOTA 2KW4A 3NH2A 4FJGA 3Q7BA 1ZBFA 4NYNA 4AHSA 4RW6A 4DFMA 4BY9C 1YJ9N 1HQUA 4IBNA 3NH0A 1LWFA 5D3GA 4BGBA 5C24A 2YHXA 1T3VA 3PUFA 3KVGA 3ULEB 3OYHA 4NCGA 4B1WB 2QWOA 4C8LA 2DFHA 3ZYYX 4DV5K 3AO3A 4B9LA 3AVMA 4W5NA 1HPZA 5BREA 3O1BA 3AVHA 2YNGA 1ZC6A 4DMNA 4IFEA 1RT5A 4LY7A 4Z4IA 3ULEA 3O1WA 1GLCG 3EYZA 2E1ZA 3W0LA 4MDAA 3T3FA 5ADXH 1BG3A 1NNEA 3ZETB 4A57A 4X65K 5AQKA 2IVNA 4B9TA 1K8KB 4BE1A 5AQLA 3KD1E 3P38A 4KH5A 3QO9A 4FJLA 4CIEA 2KKZA 3AVCA 4JD2B 2HOEA 3ZETA 4EZ6A 1MA9B 1SKSA 1HNVA 2A5XA 1A5VA 1K8KA 4A5AA 1B92A 4BRCA 3NDKA 3U9ZA 1B9DA 1VSMA 1UA0A 2W6LA 4NO7A 4PL7A 3PLAA 4YHHK 1OH6A 4CEDA 3VQQA 3SNNA 5AQQA 1NOYA 4WFBL 1LW0A 3VQCA 2QW9A 3F5TA 3QETA 3VEWA 3L3UA 3ZT2A 3KKRA 4ICLA 1SS6A 1NJXA 1GOAA 3NCIA 1P90A 1NK8A 2YHBA 3PSIA 4WQ5A 4BRIA 1D5AA 3LM2A 3RMBA 5C10A 4LH4A 5C2FA 3G4SN 4PKGA 1W9HA 3O5BA 5F0XA 3IDHA 4KI6A 4BACA 4O5FA 4LF9K 1XWLA 1EO1A 2GWKA 4I2QA 1WSIA 4PL8A 4EHTA 1WSEA 4Y1CA 1TK5A 4O4GA 1M1KO 4QOZB 3OYJA 4FWOA 3CHWA 1Q86O 2X6SA 1YIJN 4CGIA 4N5SA 2ZWHA 3VQEA 1O13A 3HSCA 3I0RA 3TABA 4OVLA 3EEQA 5J2NA 4LF7K 3CJBA 1VQKN 3OS1A 3PX4A 3NGZA 3WXKA 1BDGA 2H3GX 2FSJA 1S9EA 3O3GA 4RW7A 4KHPK 4FLXA 3KWGA 3PV8A 4J8FA 4DR5K 1W2BM 4FJ8A 3QICA 2NRWA 4FWMA 4CZMA 2QWLA 3RWUA 4M7YA 4DV7K 2BTFA 4F4KA 4BRFA 4H0VB 4B1UB 3QFPA 2WFBA 3LL3A 3V9WA 3GOIA 3GG4A 1JKHA 3CETA 3T7ZA 3UIQA 4B9SA 3LDPA 3E66A 4IFVA 4DSFA 4PY5A 4KTQA 5EOYA 1QSLA 2FBXA 5J2PA 1RILA 4ILJA 4BR7A 3I8BA 4B9NA 2RHKA 1U2VB 4NLCA 1IO2A 2CGLA 4H0XB 4IJNA 1Q9XA 3CJ9A 3EO3A 1N5YA 4Z4GA 1WAJA 1E3MA 2QKBA 3ZSVA 4FW2A 3CFRA 2P9PB 4JK7A 3R8EA 4M41A 3DI6A 5GAGP 1VQNN 5GAEP 2Q36A 1LAVA 3CJAA 2UUAK 4F8RA 5AR0A 1X9SA 1N33K 2EHGA 3QFUA 5CYMA 4H03B 5AQNA 1NKEA 3V6DA 1YJNN 4N76A 2Q0UA 2ZJQL 2P9PA 3UE5A 1OH7A 4M3UA 3E9LA 3MX2A 3SMSA 2YX6A 2OZSA 4JK9A 5HP1A 3OW2M 5MLCQ 1LWCA 4JHDB 2V7ZA 4BR4A 4DS5A 3THYB 1NGCA 5E84A 2Q97A 3OYFA 1EXQA 1NK7A 5EXWA 3WNFA 3HOSA 3V1RA 4W5TA 3H1QA 3PO5A 1ATSA 3F9MA 4FM1A 4CJVA 4DKWA 2PY5A 3NMUA 3ZX0A 1J5EK 4DSLA 4JHDA 3K5LA 3VENA 3K9JA 3NF8A 3CFPA 4ZTFA 4BC3A 3E9PA 3BZKA 4LF4K 3VQPA 4DQSA 1NK4A 2G8UA 3AAPA 3HPHA 1Y64A 1MWKA 1N36K 1W97L 1XHZA 4FZYA 1UOCA 2FF6A 3LDNA 1NMDA 5BPLA 4BG8A 4FJ7A 1OKJA 1GLLO 2YV0X 3OYNA 2B5JA 1HJOA 3I56N 1IBLK 1FW6A 2QWPA 3BUZB 1HLUA 4FJJA 4N47A 5GAHP 2CGKA 3J7ZO 1WLJA 3ZSRA 3HT3A 4NCAA 1BIUA 4F9OA 4X62K 4CERA 4KH6A 3QEXA 3T19A 3DLEA 1HNWK 4CJRA 2FBVA 4WQ4C 4CF1A 1QSSA 4CJ7A 3TAFA 3RR7A 4BE0A 1HRHA 3VEXA 3L2RA 1QHAA 4C1NI 4IJAA 1NU0A 2QWMA 3LP1A 3AVLA 3H6EA 4RTFD 1Z25A 4DG1A 1YITN 1BO5O 1U45A 2VWJA 5KRTA 3RRGA 2G8IA 4CJLA 5AZIB 4IG3A 2UXCK 4MO5A 1KSPA 5H1SQ 1RBRA 3LDOA 1VQ8N 4CZGA 4FOEA 2A40A 3VERA 1C1AA 4AM6A 4FW1A 2WBNA 3MCPA 3WNGA 4GV6A 3AVJA 4J2BA 4HWIA 3O9UA 5AZIA 4FJ5A 2Q0RA 3AA4A 1ITGA 1TAUA 2ZQBA 3E1YA 1VSEA 1TK0A 3IRXA 3UB5A 4E7JA 4DR7K 3SAHA 3BDPA 4OKKA 3EE8A 5AQGA 3UKUB 2LSNA 3DLKA 4A61A 2OPRA 4A5BA 1D9FA 2HHTA 2QWRA 3LDQA 3WNEA 4CFBA 3D7EO 3CCRN 2ETJA 4XH4A 3HO1A 3DLGA 1L3VA 5AFUH 4CJSA 1HNIA 3OYMA 1XC3A 4DU4A 3R3LA 4KHSA 3CF5L 4E89A 3UKUA 1QE1A 4FJHA 4YFUA 1BCOA 4OPJA 4CHPA 1UAXA 5HL7L 2BH1A 5AQIA 4CGDA 1Q9YA 3TPQA 3QEWA 3DLRA 3M8PA 2UXBK 1ATRA 4KBOA 2HW3A 5M1NA 1X1PA 4JKCA 4OLAA 2GWJA 3H08A 4B8CA 2AP1A 4BDZA 1KLMA 5CZ2A 2HBKA 1B9FA 3SQ0A 1U49A 4U7BA 4CF9A 2GEMA 4K8ZA 4BR5A 3AA2A 4CIFA 4LD0A 1IBMK 4BRGA 3OA9A 4BGAA 4BRKA 4FL9A 2NRHA 5E26A 4BROA 2HHQA 3TAGA 4DR6K 3CIPA 4BC2A 3RRHA 1K6YA 4FYDA 1YTAA 2OZMA 5IT9O 2G8HA 4FLUA 3THXB 3M8SA 2E8AA 2RPIA 1YUWA 4JKEA 2W41A 5AQWA 4E1MA 2XY6A 4DSEA 3FR0A 1NLVA 4G1QA 3UKRB 3KLEA 1P8ZA 2J4RA 3FZMA 4BVPA 2ZGZA 1NGAA 2XY7A 4JI7K 1NOZA 3THXA 3SQ1A 3CQ8A 3M3ZA 2DFEA 2XY8A 3AO1A 3MECA 3CFOA 3VQ9A 3HSTB 1TVRA 4CHYA 5M1PA 1ATNA 3UKRA 5HOOA 1C0UA 5HRRA 4A62A 2Z1GA 3AVGA 4QS7A 5AQHA 1G15A 3M8QA 3K5NA 2I7NA 4AQYK 3G6EN 2F7TA 2F8TA 4GNIA 3DJCA 2GTDA 3OY9A 1JLFA 2DY4A 4UQGA 4M3WA 4BRHA 3MDQA 4HUFA 4NXNK 1OH5A 3JAMO 1J54A 4M42A 3E01A 5FROA 1DTTA 1VSHA 3DRPA 3T1AA 2G8FA 3VQDA 4DTXA 4CHNA 4FJIA 3WUHA 3ATUA 4HHTA 5KQ8A 4BWJA 3VQAA 4JLHA 4GMJB 2OPQA 5AQFA 1VQ4N 3C6UA 1BA1A 3DOKA 3H3NO 5AQSA 1VSJA 4O0IA 4GKJK 3I8DA 2W42A 3U3GA 4K0KK 2AJQA 3AVKA 3VGKA 5FPMA 2VG7A 3KK1A 3HVRA 3CQYA 1NGGA 1KC8O 2V7YA 4YORA 4DTRA 1OVYA 4CK2A 1BUPA 1RDWX 2E6LA 4DV0K 5HRSA 3RR8A 3H1VX 3EE9A 5FPNA 1S6PA 4LF8K 4ELUA 4DS4A 3FE1A 1C0MA 4GV3A 3DOLA 1YF5L 3TAEA 1ASVA 1VHXA 2GUIA 4FCYA 5BN8A 4M3XA 2P9LB 3WQTA 2IS3A 3OYKA 5KPZA 4L8RB 4FWRA 1IG9A 3SBTA 2G8VA 4CEAA 4FOIA 3U9DA 4BR9A 3ISNC 3W3DA 3L4QA 4KKOA 2P9LA 1MDUB 4GW6A 3D45A 4F2RA 3LP3A 3THVA 4DQ8A 3J80O 5JMVA 2PYLA 4YOXA 3VMFB 5KGXA 2E5LK 3QIOA 5SWMA 1RT1A 1O1WA 3DLBA 4KHYA 3VEZA 5JICA 1T7PA 4DLGA 4FZZA 2ZE2A 5TKYA 4MLHA 2JLEA 1BL3A 4ISFA 1QVFM 3WT0A 4CJ3A 3NF9A 1SZ2A 4CZKA 3BEXA 1X3NA 3MWPA 3LAMA 2DTUA 1NMNA 4IDHA 3PSFA 4LC9B 2Z1IA 4DLEA 3ULDA 1KTQA 1Q82O 1KRPA 2D5RA 1JL1A 3SUPA 2ZM6K 3L3VA 4JI1K 3VQ7A 4GVEA 3TAMA 2BE2A 4CK1A 4LF5K 4JS5A 1Z05A 3QB0A 2W40A 5AQUA 1EWRA 3TSUA 2Q1NA 3GDQA 3LZIA 3WXJA 3F2KA 1NGFA 4OX9K 3DYAA 1X9MA 1W0HA 4OJRA 3V1OA 2Q2RA 4FPBA 4K42A 4O55A 3ZSOA 5JLFA 4ID5A 3HI0A 3ITHA 3EZ5A 1CZBA 3CERA 4H5RA 3C6HA 2WTUA 3HVTA 2JGUA 4WCEL 5B8HA 2ZJPL 3LDSA 3FLCO 2O8DB 4FLZA 2UUCK 4FLWA 1JCEA 1NBWA 2GX9A 4Z0UA 2D4WA 3NGIA 4H0YB 4JD2A 4BDPA 4LSLA 1L3UA 4E7KA 3CM5A 3D6RA 1VQON 1FXXA 4CZIA 4DQQA 4M63C 4OPHA 1J5OA 2PZSA 4KHNA 4KHWA 2HMIA 3QEVA 1HMVA 4KPYA 3CQXA 2Y1IA 3LAKA 1I3AA 4H5TA 3QNNA 1HPMA 4KTWA 4CZHA 1ZBUA 4CEOA 4C8OA 4RWTA 4QS8A 5BPNA 5I42A 1QQNA 3K57A 1ASUA 1ZYQA 3KK2A 1TGOA 4DF4A 1UA1A 2KFNA 4NB4A 1EWQA 1XUPO 3VTHA 4Y1DA 4WQ4A 3VTIA 2E2NA 3AVAA 3HP6A 4CEQA 4DF8A 1TK8A 4M3TA 3RVCA 1QTMA 2E4LA 4Q0BA 4W5QA 1NGDA 4DV4K 3RMAA 1IG8A 4XH5A 4CECA 3MWTA 1UWBA 2O4GA 1E4GT 3PIOL 3LP0A 2QKKA 4I9QA 3SUOA 5DM6L 4C1NK 4CHZA 1TKDA 1IV0A 4KFBA 1RDCA 3Q7CA 3VQ4A 1WNSA 4LF6K 1ZBSA 3F9KA 3O9RA 2QEXN 1NK9A 3O4WA 3AVFA 4LFBK 4BWMA 5AQXA 4JK8A 4KH4A 1XMQK 3SQ4A 3WNHA 3RTVA 1RBVA 3K5MA 3CCQN 3VQ6A 5JVGL 3CYMA 3N4QA 4Z4CA 4H4MA 4BR2A 4BQLA 3DXMB 4C23A 3ZT0A 1BI4B 3OYEA 2PAVA 3P39A 4N41A 3CCLN 4PHTX 1IH7A 4JRQA 4C8MA 1TYQB 1XQSC 5M1OA 5KGWA 2WOMA 3HRGA 1LOTB 3M8RA 3OJSA 2PBDA 1S9GA 1GLBG 4F3TA 3V9UA 1BGXT 1D8YA 1DEJA 4CZLA 3ZX2A 3SLCA 3DXMA 1BI4A 1U2VA 1TYQA 4DTOA 2YHWA 2VGMA 5GADP 2E20A 2G8KA 1TKXA 3K58A 3D2FB 4CW7B 1QZ5A 3EN9A 3CPEA 3HBTA 3ZCMA 4CJWA 5HRPA 3OTOK 1U47A 4DTMA 2NRVA 3CCSN 2E2OA 4EFHA 1SV5A 1RTJA 2HNYA 3B8AX 4PWDA 2ZF5O 4CESA 4JKHA 1KVBA 2BUPA 1LV5A 3A2FA 1JLCA 1QS4A 4K8XA 5J1EA 3L8BA 2P9NB 2BANA 1T05A 3D0PA 1N34K 4YDUC 2UYTA 3CC7N 4F2SA 4X64K 2A1RA 3THYA 4OGCA 2ZD1A 1RCHA 2WC9A 3C6AA 1NGHA 1FKPA 4E1JA 4EHUA 4JKFA 1VQ5N 3FZFA 4JKGB 4O0JA 3V81A 2D0PA 1TUYA 2P9NA 2O8EB 4CK3A 3QEIA 1BWFO 3JSMA 4RW9A 3NFAA 2X6NA 1SQKA 1ZXOA 1N6QA 4GV9A 5LY3A 4DTUA 3H45C 4Z4EA 2HVHA 1M90O 1YJWN 5C0YA 4WYBA 2I7PA 1YTUA 3WEEB 4NLBA 3ZSZA 4BRAA 3SCXA 1MWMA 3DRRA 4JKGA 3QNOA 4E1NA 3KIOA 4ISGA 4BR0A 4HUGA 4CCHA 4CJ4A 2JWKA 3OYLA 3KK3A 2OTJN 4XIUA 4JI8K 3P83D 4CJKA 3CI5A 3J7YP 1CZ9A 1EX4A 2QTDA 1DTQA 4IOCL 4CVNE 3CJ1A 3WEEA 4LSNA 1SUQA 4W5OA 1T03A 3L2QA 1K73O 1KQSM 3IS9A 4X66K 2VG6A 1Q81O 4JS4A 1RDUA 2IAJA 4WFAL 4JV5K 4ILGB 2QI2A 1QHTA 5C2DA 2XHBA 4A59A 3HXMA 3CXCM 3OYGA 2ATQA 4H0PA 3OVNA 3CMAN 3B6OA 3C6TA 2E2PA 2RKIA 3NBPA 4V19S 4CFDA 4IWVA 4DUZK 5AQMA 5EY4A 3AO4A 4E7HA 4MLEA 4AH9A 2R7YA 2E1YA 5LL6Z 1TKZA 4CGJA 3KLGA 4FK0A 3CM6A 1REVA 4HTLA 1A5WA 3C65A 4BE2A 2WONA 3T69A 3I33A 5KI6A 3O9QA 3L4IA 4RCHA 4RW8A 1I94K 4QCLA 2YJEA 3AY9A 4H0OA 3EKUA 3HPGA 3H3OB 4O44A 3SBGA 4XH1A 3CPWM 3O08A 1TAQA 3KTQA 1WAFA 4OKEA 3ZSQA 3VETA 4FWQA 5GIPA 4MO4A 4ZHRA 4WF9L 3F73A 2OANA 4H5NA 5C15A 4OO1J 1NK6A 4AHRA 2ZGYA 2D0BA 3GL1A 1RTIA 4E7IA 3WXIA 1S3XA 4CGFA 4CEZA 3HTVA 2ITMA 5EU7A 2HSTA 4E19A 3G71N 5EVZA 5KTQA 2VG5A 4AHUA 1QQCA 4Q5VA 1LCUA 3AA3A 3M6GA 4CFAA 5LJWA 4OKJA 2W6KA 1MU2A 4E3SA 3MX5A 2VWKA 4CBWA 2HVIA 1NGIA 4DQPA 4KTZA 1OVQA 4GY2B 3C95A 1XMOK 2IOCA 1YVNA 3A8YA 5F1XA 1XC9A 4BRNA 2CH6A 1IKYA 5A2QO 3OS2A 1LW2A 3RSEB 3QDKA 3TTDA 4JKDA 1JXEA 4L3QA 1C1BA 3C94A 5AZJB 4B1YB 1S1WA 5M1FA 1S6QA 4TSXA 1FKOA 5AQTA 3OYIA 4DV1K 4DU1A 2HHSA 3K59A 5AJ3K 1NGJA 3A5NC 4M3RA 3BY5A 1KAXA 2HNDA 3RSEA 1BQMA 1Q8IA 3MK6A 4PA1A 5AZJA 4CEBA 4DUYK 1XI1A 1TL3A 3DMJA 3KZBA 4AHCA 4N56A 4FWSA 1HNXK 3LDLA 4M7XA 4IOAL 2HNZA 4E0DA 3VOVA 4LFAK 5T7BA 2DFFA 2KZMA 3A5LC 4YOVA 1C6VA 2XRIA 3FZLA 2NZTA 1RT6A 3KK7A 3OHRA 1RGIA 4B9MA 3KLIA 3HPOA 2NRZA 4KV8A 2HHVA 3VA3A 1VK0A 4BRDA 4I7FA 5C25A 2UU9K 3AV9A 4B1ZA 3MN5A 1VAZA 2RN2A 1K8AO 3S3MA 5AQPA 4CFCA 3EKSA 5HBMA 4HTUA 2UUBK 5JLHA 1XNQK 3LANA 2IC3A 3FZKA 4B9QA 5BN9A 3VGLA 3OYCA 2QWQA 3WQUA 3V1QA 2HHWA 1HYZA 3SAGA 4FK4A 1I39A 1NJWA 1U6ZA 2HBJA 5AFUA 3DLLL 4CHOA 1HR0K 2FXUA 4K41A 1WSFA 2GELA 4EP4A 4DR3K 3OYAA 2IIRA 2Z1JA 3LP2A 3TSQA 2YNIA 5CE3A 1S1VA 2YNHA 3MN7A 3V4IA 1OH8A 4B9UA 4YOWA 5DMRA 1BU6O 1NWKA 5SZTA 1F21A 4A2AA 3IAYA 3EL2A 3MXJA 4FJMA 4IDKA 1QSYA 4WFNL 5F2RA 4FJ9A 3IUCA 3KLHA 1S1UA 2F9TA 1QQOA 1HUXA 3HL8A 4RG8A 1T6CA 4DV3K 1HX1A 4JI5K 3SZ2A 3N4PA 1KLNA 4BVOA 4DTNA 2HMPA 1RFQA 4M3YA 4CEEA 4M45A 1RTHA 5BPMA 1NJIO 2QWNA 4QS9A 2QXLA 1Z6RA 1BHLA 3MMVA 4WE1A 5GINA 1BQNA 1SL0A 4CJEA 5CHIA 1X9JA 4HCCA 4MFBA 5JVHL 3PO4A 4DQRA 1RNHA 3LPUA 2Q31A 4B1XB 3G25A 3DRSA 2B4JA 1J53A 2HHUA 3SJHA 3MAQA 2HB5A 1CXUA 2P9UB 4PKHA 4BRPA 2VYPA 3LPTA 3CMEN 3DAWA 1FJGK 3ZT3A 1YXQA 1RTDA 5KRSA 1D4XA 1U04A 2HF4A 5JS1A 3CCMN 4Z4FA 3R9PA 4CJPA 3C7NB 1YI2N 4CEFA 1XNRK 1IKWA 4CZJA 1NK5A 4KO0A 4CGHA 1JLQA 1Q18A 4KHUA 4JAXA 4PQUA 4CJ5A 3ENBA 4E7LA 4DTJA 3SUQA 4G9ZA 2VQEK 1K9MO 2OPSA 3HZ6A 2O8BB 1D9DA 4M3ZA 1CLQA 3BZCA 3A5OC 1A5XA 3AA5X 3C7NA 3OBWA 2Q3SA 3WXMB 3HM9A 2GV9A 2QM1A 3TAQA 4KREA 2YHYA 1E4FT 5JS2A 1WN7A 4FVMA 3M1FA 3AARA 3M5RA 2PYJA 4JRPA 2FSNA 3MCAB 3VEVA 1SL1A 3NVMA 4CI6A 3MXMA 2O8BA 3SAFA 2P9SB 3G10A 2YJFA 3S3OA 1FK9A 3EZWA 3FGUA 3VF2A 1VSFA 2FC0A 4DCHA 3CCUN 1BCMA 2CH5A 3V9SA 3FFKB 1IKXA 4DFKA 1YAGA 5J2MA 2O4IA 4DQIA 3PIPL 1C0TA 1G99A 2FBYA 4YDUA 5AQOA 4CF2A 1HJRA 4OLBA 2P9SA 3O4NA 4EZ9A 2HHHK 5AQYA 4DFJA 2VGNA 3FFIA 4KAZA 5CZ1A 1JL2A 1RBSA 3O3FA 3B6PA 4CBUA 4BREA 1GLJO 3L2VA 3VEOA 1VQLN 3IKMA 1WSGA 3OYDA 3QEPA 4JNEA 1YHQN 1TKTA 4IOXA 4CZFA 1DT9A 3U4LA 3SI6A 5CY4A 3SMPA 3VEYA 5CYQA 4CJUA 2O8DA 4FM2A 3MN6A 2D1KA 3ASMA 5TKWA 3T1YK 1NKBA 4MDBA 2YKNA 4B8AB 4LH5A 1C0GA 1JCGA 3TTFA 3QBWA 3THWB 4JYAK 3P5JA 3ALYA 3TR8A 2QA4N 1KXPA 3U3YA 3HJFA 2IGIA 1RT4A 3CD6N 4R79A 1KAZA 1IBKK 4EIAA 3V9ZA 1DLOA 1KFDA 4B3MK 2VCPA 3SV3A 3NHGA 3AGKA 1T44A 3HK2A 3VA0A 2PFUA 4IXCA 3THWA 3L2UA 2QK9A 4IEIA 1RT7A 2KHOA 2OPPA 1SKRA 4ILHA 1N8RO 3JXUA 4C8NA 4KHQA 4JKAA 3GE1A 1J9AA 4A2BA 1EKEA 1ZBIA 3ZX3A 5ADXA 1QZ6A 3FZHA 4BDYA 5LMNK 4BC4A 4J2AA 2YI1A 4AM7A 4AILC 4FPAA 1VSIA 3HM8A 5AQVA 4BG9A 2ITGA 5BRDA 3SQ2A 4O8KA 3O8MA 2A3ZA 2ASMA 2YHAA 4H5WA 2OA8A 3HYFA 1NJYA 3MEGA 2KZZA 1XHXA 4KRFA 5HROA 2NUBA 1V4TA 4NXMK 3HP9A 4B1VA 3SPZA 3VESA 5I3UA 3I55N 3SYZA 3S3NA 3CCVN 2V51B 3QERA 4DB3A 4KI4A 4CD1A 4FWKA 2ASOA 5M1KA 2FLOA 3CC2N 4K43A 1RDDA 3LWMA 5LJVA 3H46O 3OBYA 2P9IB 1DKGD 2XY5A 5FLXO 4U67L 4FZXC 4NYFA 3TWHA 4JI2K 4AHVA 1KVCA 5FPDA 2XO7A 4QAGA 2F96A 1L5UA 4JI0K 2HBMA 4YOUA 1JLBA 1BOTO 2V52B 4KB0A 4C8KA 3CJ7A 3ID6A 1RDAA 1RT3A 3ZEUB 1C0FA 2HHXA 4IO8A 4B3OA 4DWIA 4PKIA 2P9IA 4HUEA 2FF3B 1VRTA 2QXFA 4IZ9A 4FXDA 2O8CB 3KD5E 2IDOA 3VQBA 3U6FA 4B3SK 1NM1A 1WUAA 4KB1A 3MN9A 2NLXA 5KPRA 1S1XA 3NE6A 4ZTJA 1WBBA 4LFCK 3QLHA 3WXLA 3BGRA 3KHYA 3ZEUA 3ZLJA 5DK5A 4MQ3A 3SUNA 4FLTA 4BRMA 4IO9L 1VSLA 2KQ2A 2NRTA 5M1QA 4FVUA 2O8CA 3J81O 3D2FA 4GKKK 4FJKA 4H5VA 4GVMA 3S9HA 2VQFK 1WSHA 3C0BA 2P51A 1ESVA 4JI6K 2RF2A 3NF7A 4FM0A 4DR4K 4ELVA 3IG1A 3J7AP 5J2QA 1V4SA 2EX3A 4O8UA 3K2PA 4B08A 2GUPA 2YKMA 3CC4N 3PX0A 3JS6A 1ZBHA 1JXBA 2HF3A 2D0OA 2BDPA 3NAEA 4FSVA 2F8SA 1IJJA 4DV2K 2E2QA 2UXDK 3AO5A 4CHQA 4AHTA 2P5OA 1SAZA 4ID1A 3G0ZA 3ENHA 5FDLA 2O8EA 3ATVA 3VF4A 3LALA 2B6AA 3QESA 4CIGA 1R0AA 4CBXA 1W7AA 1VQ7N 4CJFA 1L3TA 1T6DA 3RMDA 4IFYA 1KFSA 2NRRA 3ZSYA 4FK2A 3BF3A 3TANA 4EP5A 4WQ5C 4DSJA 3TSPA 4J2DA 3NVKA 2A1SA 2WUSA 3A5MC 2F4VK 2P5GA 2G8WA 3VQ5A 1LAWA 1RBUA 2A41A 4F3OA 2X78A 1VSDA 3VF6A 3P4IA 5GIOA 2E6MA 2ZJRL 5FRNA 2OYQA 1HKGA 2YNFA 3LZJA 3CG7A 3KKSA 1GLEG 3AVNA 1S72N 3QMLA 1L3SA 3SPYA 5C42A 2I5JA 2JWLA 1NK0A 1WSJA 2F9WA 1QVGM 3DLHA 4FWLA 4DSKA 1X9WA 3VPZA 5AQRA 4Z4HA 3MEDA 3I0SA 4AF1A 1CZAN 1GLDG 1LWEA 1VQ9N 2IVOA 1BISA 3VQ8A 3EY1A 1GOCA 4HCBA 3SJJA 1ASWA 4IEEA 3NGYA 3O9TA 1JLGA 5KPTA 2KTQA 3BF1A 5FRMA 4B3RK 1TL1A 5DM7L 1VQMN 2P1JA 3ID8A 4CJTA 1U4BA 3PY8A 4DV6K 2ASPA 4B9VA 3L6QA 5AQZA 4H4OA 1SKWA 1NGEA 3IFRA 3LWLA 1EP4A 3J8AA 3R6MA 4JEPA 3OS0A 3GBTA 3CCJN 1JJ2M 2D0CA 3TU5A 1GLAG 2KLAA 4DHYA 5FPEA 3KLFA 4NCBA 1X3MA 3KJVA 2Y1JA 4CF8A 2OTLN 5CR4A 3QINA 4XEIA 2VWBA 4JI4K 4YNQA 1KAYA 2FBTA 1NGBA 4CZEA 4FWPA 3ZT4A 1Y97A 3K5OA 2FSKA 3L0QA 2OCEA 1HNZK 4IKFA 3AAQA 3R1XA 3HOTA 1Z26A 2X74A 3CCEN 2YCHA 1TV6A 3MXIA 1WB9A 3TTCA
chains in the Genus database with same CATH topology
1RTDA 5KRSA 4CECA 2KFZA 1U04A 4OPKA 1XHZA 1UWBA 2O4GA 4FZYA 1S1TA 5JS1A 1UOCA 1HQEA 4DTSA 4Z4FA 4CJPA 3LP0A 4CEFA 2QKKA 4I9QA 1IKWA 3SUOA 3ZSXA 4FJ7A 2YV0X 4CHZA 3OYNA 4KO0A 1NK5A 1TKDA 4CGHA 4KFBA 1RDCA 1JLQA 2B5JA 4KHUA 3VQ4A 4PQUA 4CJ5A 1WNSA 5HRNA 4E7LA 3OYBA 4DTJA 3F9KA 3SUQA 1JLEA 4FJJA 4N47A 4DU3A 2OPSA 1NK9A 1D9DA 1WLJA 4M3ZA 1CLQA 3ZSRA 1A5XA 3HT3A 4NCAA 1BIUA 3AA5X 4CERA 2Q3SA 3QEXA 3HM9A 2GV9A 3AVFA 1U48A 3TAQA 3T19A 4KREA 3DLEA 1HYVA 4IG0A 4BWMA 1T8EA 4CJRA 5JS2A 1IKVA 4DTPA 1WN7A 2FBVA 4FVMA 3SQ4A 3ZSWA 4CF1A 4DFPA 4O5BA 3WNHA 4W5RA 3RTVA 1QSSA 1RBVA 3K5MA 3SV4A 2PYJA 3VQ6A 1EETA 4JRPA 3TAFA 3RR7A 4BE0A 1SL1A 1HRHA 3JYTA 3L2RA 3MXMA 1YT3A 3CYMA 4Z4CA 4H4MA 3O3HA 3LP1A 3ZT0A 1BI4B 3G10A 3AVLA 3OYEA 4FJXA 3S3OA 1FK9A 4N41A 1IH7A 4JRQA 4C8MA 1VSFA 1Z25A 2FC0A 4DG1A 5KGWA 2WOMA 2VWJA 1U45A 3M8RA 1NJZA 1HYSA 5KRTA 3RRGA 1BCMA 4I9LA 2G8IA 1RBTA 4CJLA 3OJSA 4J2EA 1BIZA 1S9GA 3V9SA 4IG3A 1KSPA 3PX6A 4F3TA 3V9UA 1IKXA 1BGXT 4DFKA 3V9XA 5J2MA 1SL2A 1RBRA 1D8YA 4DQIA 2O4IA 2BGGA 1C0TA 2FBYA 1C1AA 4CF2A 1HJRA 1KCFA 4FW1A 4OLBA 1BI4A 3OJUA 3O4NA 1C1CA 3WNGA 5HLFA 4EZ9A 3MEEA 1VSKA 4DFJA 3AVJA 3FFIA 4DTOA 4KAZA 2D0AA 4J2BA 3RMCA 4PUOA 4ELTA 1RDBA 4FJ5A 2G8KA 3AA4A 5CZ1A 1ITGA 3AVBA 1JL2A 5E41A 1RBSA 1TKXA 2ZQBA 3O3FA 4H8KA 1TAUA 1GOBA 3B6PA 1VSEA 3K58A 1RT2A 1TK0A 3IRXA 4E7JA 3L2VA 3ZCMA 4CJWA 1WSGA 3BDPA 4OKKA 3OYDA 3QEPA 1TKTA 3AVIA 2LSNA 3AO2A 3DLKA 5HRPA 4DTMA 3SI6A 1U47A 5CY4A 1KVAA 3TI0A 1SV5A 1RTJA 2HNYA 2OPRA 5CYQA 1D9FA 4CJUA 1ZBLA 4PWDA 4CESA 4FM2A 3DM2A 1KVBA 2HHTA 3ASMA 3WNEA 4CFBA 3L2WA 4CF0A 1LV5A 3A2FA 2ETJA 4R5PA 1JLCA 3DLGA 3HO1A 3P1GA 1L3VA 1QS4A 4OGEA 4CJSA 4K8XA 1HNIA 3OYMA 5J1EA 4HVJA 1NKBA 1YVUA 4DU4A 3L8BA 3TAPA 3QIPA 2YKNA 4FJNA 4B8AB 4LH5A 4KHSA 3NH1A 4E89A 1QE1A 1NKCA 2BANA 1T05A 3TARA 4CJQA 3D0PA 4FJHA 4YFUA 1BCOA 4CE9A 4OPJA 4CHPA 1UAXA 3P5JA 4F2SA 3ALYA 3TR8A 2A1RA 4OGCA 4CGDA 3U3YA 2ZD1A 1Q9YA 1RCHA 3HJFA 3QEWA 2IGIA 3DLRA 1FKPA 1RT4A 4I2PA 1VRUA 2Z1HA 1S5JA 3M8PA 5K14A 3ZT1A 4O0JA 3V9ZA 3V81A 3O4QA 4FLVA 2HW3A 4CK3A 3QEIA 1DLOA 1KFDA 3JSMA 1X1PA 3NFAA 4RW9A 3SV3A 2GBZA 4FLYA 2X6NA 3NHGA 4DSIA 4OLAA 3H08A 3HK2A 1N6QA 4B8CA 3VA0A 4DTUA 3L2UA 2QK9A 4BDZA 4Z4EA 1RT7A 1KLMA 5CZ2A 2HVHA 2OPPA 1B9FA 3SQ0A 1U49A 1SKRA 1YTUA 1JLAA 4C8NA 4KHQA 4CF9A 4CGGA 4K8ZA 3ZSZA 3AA2A 3SCXA 3DRRA 3VN5A 3QNOA 4RW4A 3NF6A 4CIFA 4LD0A 1J9AA 1CXQA 4E1NA 1EKEA 3KIOA 4HUGA 1ZBIA 3NH2A 2KW4A 4CJ4A 4CCHA 3OYLA 3KK3A 4FJGA 1ZBFA 4XIUA 4BDYA 3P83D 4NYNA 4CJKA 4J2AA 4AHSA 1CZ9A 1EX4A 4RW6A 4DFMA 4AILC 2HHQA 1VSIA 1DTQA 3TAGA 1HQUA 4IBNA 3RRHA 1K6YA 2ITGA 3NH0A 1LWFA 4FYDA 5D3GA 3SQ2A 1YTAA 2OZMA 5C24A 4FLUA 2G8HA 3M8SA 3PUFA 4LSNA 1SUQA 4W5OA 2RPIA 2YHAA 3L2QA 1T03A 3OYHA 2OA8A 3HYFA 4NCGA 1NJYA 4C8LA 2DFHA 3MEGA 2KZZA 1XHXA 3AO3A 3IS9A 4B9LA 5HROA 4KRFA 2NUBA 2VG6A 3AVMA 4W5NA 4E1MA 3HP9A 1HPZA 2XY6A 4JS4A 4DSEA 2IAJA 3SPZA 4G1QA 3KLEA 3AVHA 1QHTA 5I3UA 3SYZA 2XHBA 2YNGA 3S3NA 3QERA 2XY7A 4DMNA 4KI4A 3HXMA 1NOZA 3OYGA 2ATQA 3SQ1A 3OVNA 3CQ8A 3LWMA 1RDDA 1RT5A 3B6OA 4LY7A 3C6TA 4Z4IA 2DFEA 2RKIA 3EYZA 2XY8A 2XY5A 3AO1A 3MECA 3NBPA 4CFDA 3CFOA 3VQ9A 3T3FA 3HSTB 1TVRA 4CHYA 4FZXC 4NYFA 3AO4A 3TWHA 4E7HA 4AHVA 1KVCA 2XO7A 4AH9A 4QAGA 2F96A 2R7YA 1C0UA 5HRRA 1L5UA 4B9TA 1TKZA 2Z1GA 3AVGA 4CGJA 3KLGA 4FK0A 3CM6A 4BE1A 1JLBA 1G15A 1REVA 3KD1E 4KB0A 1A5WA 3M8QA 3K5NA 4C8KA 4BE2A 1RDAA 1RT3A 2WONA 3QO9A 2F8TA 2HHXA 4FJLA 4CIEA 5KI6A 4B3OA 4DWIA 3OY9A 4HUEA 1JLFA 2DY4A 4UQGA 1VRTA 2QXFA 3AVCA 4M3WA 4HUFA 4FXDA 4RW8A 4QCLA 3KD5E 2IDOA 3VQBA 3U6FA 4EZ6A 1J54A 1SKSA 4M42A 1HNVA 3E01A 1A5VA 5FROA 3HPGA 4KB1A 1DTTA 4O44A 1VSHA 3DRPA 1B92A 3NDKA 1S1XA 3NE6A 3T1AA 1TAQA 3VQDA 4DTXA 4CHNA 4ZTJA 2G8FA 3KTQA 1B9DA 3QLHA 4FJIA 1VSMA 1WAFA 4HHTA 1UA0A 3BGRA 4OKEA 4BWJA 3ZSQA 5DK5A 3VQAA 4MQ3A 4ZHRA 4JLHA 4GMJB 3F73A 2OPQA 3SUNA 4FLTA 1NK6A 4CEDA 1VSLA 2KQ2A 4AHRA 3C6UA 3VQQA 2D0BA 3DOKA 3SNNA 1VSJA 4O0IA 1RTIA 1NOYA 4E7IA 1LW0A 3VQCA 4CGFA 4FJKA 3I8DA 4CEZA 2W42A 3U3GA 3QETA 4GVMA 3AVKA 2AJQA 3S9HA 2VG7A 5EU7A 3KK1A 3HVRA 3L3UA 3ZT2A 4E19A 3KKRA 4ICLA 1WSHA 5KTQA 1NJXA 2VG5A 2P51A 4AHUA 1QQCA 2RF2A 4Q5VA 1GOAA 3AA3A 3NF7A 4FM0A 3NCIA 4DTRA 4ELVA 3IG1A 4CK2A 1NK8A 5J2QA 2YHBA 4CFAA 2E6LA 3RR8A 5HRSA 4OKJA 1D5AA 1MU2A 4E3SA 3RMBA 2VWKA 1S6PA 2EX3A 3K2PA 4LH4A 4ELUA 4B08A 2HVIA 2YKMA 3PX0A 4DQPA 1ZBHA 4KTZA 4DS4A 1JXBA 1W9HA 3C95A 1C0MA 2IOCA 3DOLA 3TAEA 1ASVA 1XC9A 2BDPA 4KI6A 4BACA 3NAEA 2GUIA 1XWLA 4FCYA 2F8SA 4M3XA 1IKYA 3OS2A 4I2QA 2IS3A 1WSIA 1LW2A 3OYKA 3AO5A 4CHQA 1JXEA 1WSEA 4Y1CA 1TK5A 1C1BA 4O4GA 3C94A 4AHTA 2P5OA 4L8RB 4QOZB 4ID1A 3OYJA 1S1WA 1S6QA 3G0ZA 4TSXA 5FDLA 1IG9A 1FKOA 2G8VA 2X6SA 3OYIA 4DU1A 4CGIA 4CEAA 3K59A 4N5SA 2HHSA 3LALA 2B6AA 3QESA 3VQEA 3ISNC 4CIGA 4M3RA 4KKOA 1R0AA 3I0RA 3TABA 4OVLA 2HNDA 4CJFA 4GW6A 1BQMA 1Q8IA 3RMDA 1L3TA 5J2NA 3D45A 4F2RA 3LP3A 4IFYA 3THVA 1KFSA 3OS1A 4PA1A 3ZSYA 2PYLA 4CEBA 4FK2A 3TANA 1XI1A 4EP5A 5KGXA 1TL3A 3DMJA 3PX4A 3NGZA 4DSJA 4AHCA 4N56A 1S9EA 3O3GA 4J2DA 4RW7A 3QIOA 5SWMA 1RT1A 1O1WA 4FLXA 3DLBA 2A1SA 3PV8A 4KHYA 1T7PA 4DLGA 4FZZA 4FJ8A 2ZE2A 2P5GA 2HNZA 4E0DA 2JLEA 2G8WA 1BL3A 3RWUA 5T7BA 2DFFA 4CJ3A 2KZMA 3VQ5A 4F4KA 1C6VA 3NF9A 2XRIA 1LAWA 1RBUA 4F3OA 2X78A 1RT6A 1VSDA 3V9WA 1JKHA 3UIQA 4B9MA 3KLIA 4B9SA 2E6MA 3LAMA 3HPOA 2DTUA 5FRNA 4KV8A 2OYQA 2Z1IA 4DLEA 3ULDA 1KTQA 3VA3A 2HHVA 1VK0A 4IFVA 4I7FA 5C25A 2YNFA 4DSFA 1KRPA 3LZJA 2D5RA 3AV9A 1JL1A 3CG7A 3SUPA 3KKSA 3AVNA 4KTQA 4PY5A 2RN2A 1L3SA 3L3VA 2FBXA 5C42A 5J2PA 3SPYA 3S3MA 1QSLA 3VQ7A 1RILA 4CFCA 4B9NA 3TAMA 2BE2A 2I5JA 4CK1A 4JS5A 5HBMA 4HTUA 3LANA 1NK0A 2IC3A 1WSJA 3DLHA 3RMAA 1IO2A 3LZIA 3OYCA 4DSKA 1X9WA 3V1QA 1Q9XA 2HHWA 3DYAA 1HYZA 1X9MA 1N5YA 1W0HA 1I39A 4FK4A 1WAJA 1NJWA 4Z4GA 2QKBA 4OJRA 3V1OA 3ZSVA 4O55A 3ZSOA 4Z4HA 3MEDA 4FW2A 3CFRA 4ID5A 3I0SA 3ITHA 4CHOA 3EZ5A 1CZBA 1LWEA 4M41A 3DI6A 1WSFA 4EP4A 3HVTA 3OYAA 1LAVA 2JGUA 2Z1JA 4F8RA 1BISA 3LP2A 3VQ8A 3EY1A 2YNIA 3LDSA 1X9SA 1S1VA 4FLZA 2EHGA 1GOCA 2YNHA 3V4IA 4B9UA 4HCBA 4FLWA 3SJJA 1ASWA 5DMRA 5CYMA 5SZTA 3NGYA 4Z0UA 1F21A 3IAYA 1JLGA 3MXJA 3NGIA 3V6DA 1NKEA 4N76A 4FJMA 4IDKA 4LSLA 4BDPA 2KTQA 1L3UA 4E7KA 1QSYA 5FRMA 1TL1A 3CM5A 4FJ9A 2P1JA 4M3UA 3KLHA 1S1UA 4CJTA 1U4BA 3PY8A 1FXXA 3HL8A 4RG8A 4DQQA 2OZSA 5HP1A 4B9VA 3SZ2A 1J5OA 1KLNA 2PZSA 4KHNA 4H4OA 2HMIA 3QEVA 1SKWA 4KHWA 1LWCA 4DS5A 3LWLA 1EP4A 1HMVA 4DTNA 4KPYA 4M3YA 4CEEA 4M45A 1RTHA 3OS0A 3LAKA 2Y1IA 3OYFA 1EXQA 1I3AA 2D0CA 1NK7A 3QNNA 1BHLA 4KTWA 4WE1A 1ZBUA 3WNFA 4CEOA 4C8OA 3V1RA 1BQNA 4W5TA 3KLFA 1SL0A 3PO5A 4CJEA 5I42A 4HCCA 4NCBA 4MFBA 3PO4A 4DQRA 1RNHA 3LPUA 1ASUA 3KJVA 3K57A 2Y1JA 4FM1A 4CJVA 1ZYQA 4CF8A 2PY5A 3DRSA 2B4JA 3QINA 4DSLA 1J53A 1TGOA 3KK2A 4DF4A 1UA1A 2KFNA 4YNQA 2HHUA 3K5LA 2FBTA 3MAQA 3NF8A 4Y1DA 2HB5A 3AVAA 3ZT4A 1Y97A 1CXUA 3K5OA 4CEQA 3HP6A 3CFPA 4DF8A 4ZTFA 1TK8A 4M3TA 1QTMA 2E4LA 4IKFA 3VQPA 4Q0BA 1Z26A 2X74A 3LPTA 4DQSA 1TV6A 4W5QA 1NK4A 3MXIA 3ZT3A 2G8UA 3HPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTD A;  5KRS A;  4CEC A;  2KFZ A;  1U04 A;  4OPK A;  1XHZ A;  1UWB A;  2O4G A;  4FZY A;  1S1T A;  5JS1 A;  1UOC A;  1HQE A;  4DTS A;  4Z4F A;  4CJP A;  3LP0 A;  4CEF A;  2QKK A;  4I9Q A;  1IKW A;  3SUO A;  3ZSX A;  4FJ7 A;  2YV0 X;  4CHZ A;  3OYN A;  4KO0 A;  1NK5 A;  1TKD A;  4CGH A;  4KFB A;  1RDC A;  1JLQ A;  2B5J A;  4KHU A;  3VQ4 A;  4PQU A;  4CJ5 A;  1WNS A;  5HRN A;  4E7L A;  3OYB A;  4DTJ A;  3F9K A;  3SUQ A;  1JLE A;  4FJJ A;  4N47 A;  4DU3 A;  2OPS A;  1NK9 A;  1D9D A;  1WLJ A;  4M3Z A;  1CLQ A;  3ZSR A;  1A5X A;  3HT3 A;  4NCA A;  1BIU A;  3AA5 X;  4CER A;  2Q3S A;  3QEX A;  3HM9 A;  2GV9 A;  3AVF A;  1U48 A;  3TAQ A;  3T19 A;  4KRE A;  3DLE A;  1HYV A;  4IG0 A;  4BWM A;  1T8E A;  4CJR A;  5JS2 A;  1IKV A;  4DTP A;  1WN7 A;  2FBV A;  4FVM A;  3SQ4 A;  3ZSW A;  4CF1 A;  4DFP A;  4O5B A;  3WNH A;  4W5R A;  3RTV A;  1QSS A;  1RBV A;  3K5M A;  3SV4 A;  2PYJ A;  3VQ6 A;  1EET A;  4JRP A;  3TAF A;  3RR7 A;  4BE0 A;  1SL1 A;  1HRH A;  3JYT A;  3L2R A;  3MXM A;  1YT3 A;  3CYM A;  4Z4C A;  4H4M A;  3O3H A;  3LP1 A;  3ZT0 A;  1BI4 B;  3G10 A;  3AVL A;  3OYE A;  4FJX A;  3S3O A;  1FK9 A;  4N41 A;  1IH7 A;  4JRQ A;  4C8M A;  1VSF A;  1Z25 A;  2FC0 A;  4DG1 A;  5KGW A;  2WOM A;  2VWJ A;  1U45 A;  3M8R A;  1NJZ A;  1HYS A;  5KRT A;  3RRG A;  1BCM A;  4I9L A;  2G8I A;  1RBT A;  4CJL A;  3OJS A;  4J2E A;  1BIZ A;  1S9G A;  3V9S A;  4IG3 A;  1KSP A;  3PX6 A;  4F3T A;  3V9U A;  1IKX A;  1BGX T;  4DFK A;  3V9X A;  5J2M A;  1SL2 A;  1RBR A;  1D8Y A;  4DQI A;  2O4I A;  2BGG A;  1C0T A;  2FBY A;  1C1A A;  4CF2 A;  1HJR A;  1KCF A;  4FW1 A;  4OLB A;  1BI4 A;  3OJU A;  3O4N A;  1C1C A;  3WNG A;  5HLF A;  4EZ9 A;  3MEE A;  1VSK A;  4DFJ A;  3AVJ A;  3FFI A;  4DTO A;  4KAZ A;  2D0A A;  4J2B A;  3RMC A;  4PUO A;  4ELT A;  1RDB A;  4FJ5 A;  2G8K A;  3AA4 A;  5CZ1 A;  1ITG A;  3AVB A;  1JL2 A;  5E41 A;  1RBS A;  1TKX A;  2ZQB A;  3O3F A;  4H8K A;  1TAU A;  1GOB A;  3B6P A;  1VSE A;  3K58 A;  1RT2 A;  1TK0 A;  3IRX A;  4E7J A;  3L2V A;  3ZCM A;  4CJW A;  1WSG A;  3BDP A;  4OKK A;  3OYD A;  3QEP A;  1TKT A;  3AVI A;  2LSN A;  3AO2 A;  3DLK A;  5HRP A;  4DTM A;  3SI6 A;  1U47 A;  5CY4 A;  1KVA A;  3TI0 A;  1SV5 A;  1RTJ A;  2HNY A;  2OPR A;  5CYQ A;  1D9F A;  4CJU A;  1ZBL A;  4PWD A;  4CES A;  4FM2 A;  3DM2 A;  1KVB A;  2HHT A;  3ASM A;  3WNE A;  4CFB A;  3L2W A;  4CF0 A;  1LV5 A;  3A2F A;  2ETJ A;  4R5P A;  1JLC A;  3DLG A;  3HO1 A;  3P1G A;  1L3V A;  1QS4 A;  4OGE A;  4CJS A;  4K8X A;  1HNI A;  3OYM A;  5J1E A;  4HVJ A;  1NKB A;  1YVU A;  4DU4 A;  3L8B A;  3TAP A;  3QIP A;  2YKN A;  4FJN A;  4B8A B;  4LH5 A;  4KHS A;  3NH1 A;  4E89 A;  1QE1 A;  1NKC A;  2BAN A;  1T05 A;  3TAR A;  4CJQ A;  3D0P A;  4FJH A;  4YFU A;  1BCO A;  4CE9 A;  4OPJ A;  4CHP A;  1UAX A;  3P5J A;  4F2S A;  3ALY A;  3TR8 A;  2A1R A;  4OGC A;  4CGD A;  3U3Y A;  2ZD1 A;  1Q9Y A;  1RCH A;  3HJF A;  3QEW A;  2IGI A;  3DLR A;  1FKP A;  1RT4 A;  4I2P A;  1VRU A;  2Z1H A;  1S5J A;  3M8P A;  5K14 A;  3ZT1 A;  4O0J A;  3V9Z A;  3V81 A;  3O4Q A;  4FLV A;  2HW3 A;  4CK3 A;  3QEI A;  1DLO A;  1KFD A;  3JSM A;  1X1P A;  3NFA A;  4RW9 A;  3SV3 A;  2GBZ A;  4FLY A;  2X6N A;  3NHG A;  4DSI A;  4OLA A;  3H08 A;  3HK2 A;  1N6Q A;  4B8C A;  3VA0 A;  4DTU A;  3L2U A;  2QK9 A;  4BDZ A;  4Z4E A;  1RT7 A;  1KLM A;  5CZ2 A;  2HVH A;  2OPP A;  1B9F A;  3SQ0 A;  1U49 A;  1SKR A;  1YTU A;  1JLA A;  4C8N A;  4KHQ A;  4CF9 A;  4CGG A;  4K8Z A;  3ZSZ A;  3AA2 A;  3SCX A;  3DRR A;  3VN5 A;  3QNO A;  4RW4 A;  3NF6 A;  4CIF A;  4LD0 A;  1J9A A;  1CXQ A;  4E1N A;  1EKE A;  3KIO A;  4HUG A;  1ZBI A;  3NH2 A;  2KW4 A;  4CJ4 A;  4CCH A;  3OYL A;  3KK3 A;  4FJG A;  1ZBF A;  4XIU A;  4BDY A;  3P83 D;  4NYN A;  4CJK A;  4J2A A;  4AHS A;  1CZ9 A;  1EX4 A;  4RW6 A;  4DFM A;  4AIL C;  2HHQ A;  1VSI A;  1DTQ A;  3TAG A;  1HQU A;  4IBN A;  3RRH A;  1K6Y A;  2ITG A;  3NH0 A;  1LWF A;  4FYD A;  5D3G A;  3SQ2 A;  1YTA A;  2OZM A;  5C24 A;  4FLU A;  2G8H A;  3M8S A;  3PUF A;  4LSN A;  1SUQ A;  4W5O A;  2RPI A;  2YHA A;  3L2Q A;  1T03 A;  3OYH A;  2OA8 A;  3HYF A;  4NCG A;  1NJY A;  4C8L A;  2DFH A;  3MEG A;  2KZZ A;  1XHX A;  3AO3 A;  3IS9 A;  4B9L A;  5HRO A;  4KRF A;  2NUB A;  2VG6 A;  3AVM A;  4W5N A;  4E1M A;  3HP9 A;  1HPZ A;  2XY6 A;  4JS4 A;  4DSE A;  2IAJ A;  3SPZ A;  4G1Q A;  3KLE A;  3AVH A;  1QHT A;  5I3U A;  3SYZ A;  2XHB A;  2YNG A;  3S3N A;  3QER A;  2XY7 A;  4DMN A;  4KI4 A;  3HXM A;  1NOZ A;  3OYG A;  2ATQ A;  3SQ1 A;  3OVN A;  3CQ8 A;  3LWM A;  1RDD A;  1RT5 A;  3B6O A;  4LY7 A;  3C6T A;  4Z4I A;  2DFE A;  2RKI A;  3EYZ A;  2XY8 A;  2XY5 A;  3AO1 A;  3MEC A;  3NBP A;  4CFD A;  3CFO A;  3VQ9 A;  3T3F A;  3HST B;  1TVR A;  4CHY A;  4FZX C;  4NYF A;  3AO4 A;  3TWH A;  4E7H A;  4AHV A;  1KVC A;  2XO7 A;  4AH9 A;  4QAG A;  2F96 A;  2R7Y A;  1C0U A;  5HRR A;  1L5U A;  4B9T A;  1TKZ A;  2Z1G A;  3AVG A;  4CGJ A;  3KLG A;  4FK0 A;  3CM6 A;  4BE1 A;  1JLB A;  1G15 A;  1REV A;  3KD1 E;  4KB0 A;  1A5W A;  3M8Q A;  3K5N A;  4C8K A;  4BE2 A;  1RDA A;  1RT3 A;  2WON A;  3QO9 A;  2F8T A;  2HHX A;  4FJL A;  4CIE A;  5KI6 A;  4B3O A;  4DWI A;  3OY9 A;  4HUE A;  1JLF A;  2DY4 A;  4UQG A;  1VRT A;  2QXF A;  3AVC A;  4M3W A;  4HUF A;  4FXD A;  4RW8 A;  4QCL A;  3KD5 E;  2IDO A;  3VQB A;  3U6F A;  4EZ6 A;  1J54 A;  1SKS A;  4M42 A;  1HNV A;  3E01 A;  1A5V A;  5FRO A;  3HPG A;  4KB1 A;  1DTT A;  4O44 A;  1VSH A;  3DRP A;  1B92 A;  3NDK A;  1S1X A;  3NE6 A;  3T1A A;  1TAQ A;  3VQD A;  4DTX A;  4CHN A;  4ZTJ A;  2G8F A;  3KTQ A;  1B9D A;  3QLH A;  4FJI A;  1VSM A;  1WAF A;  4HHT A;  1UA0 A;  3BGR A;  4OKE A;  4BWJ A;  3ZSQ A;  5DK5 A;  3VQA A;  4MQ3 A;  4ZHR A;  4JLH A;  4GMJ B;  3F73 A;  2OPQ A;  3SUN A;  4FLT A;  1NK6 A;  4CED A;  1VSL A;  2KQ2 A;  4AHR A;  3C6U A;  3VQQ A;  2D0B A;  3DOK A;  3SNN A;  1VSJ A;  4O0I A;  1RTI A;  1NOY A;  4E7I A;  1LW0 A;  3VQC A;  4CGF A;  4FJK A;  3I8D A;  4CEZ A;  2W42 A;  3U3G A;  3QET A;  4GVM A;  3AVK A;  2AJQ A;  3S9H A;  2VG7 A;  5EU7 A;  3KK1 A;  3HVR A;  3L3U A;  3ZT2 A;  4E19 A;  3KKR A;  4ICL A;  1WSH A;  5KTQ A;  1NJX A;  2VG5 A;  2P51 A;  4AHU A;  1QQC A;  2RF2 A;  4Q5V A;  1GOA A;  3AA3 A;  3NF7 A;  4FM0 A;  3NCI A;  4DTR A;  4ELV A;  3IG1 A;  4CK2 A;  1NK8 A;  5J2Q A;  2YHB A;  4CFA A;  2E6L A;  3RR8 A;  5HRS A;  4OKJ A;  1D5A A;  1MU2 A;  4E3S A;  3RMB A;  2VWK A;  1S6P A;  2EX3 A;  3K2P A;  4LH4 A;  4ELU A;  4B08 A;  2HVI A;  2YKM A;  3PX0 A;  4DQP A;  1ZBH A;  4KTZ A;  4DS4 A;  1JXB A;  1W9H A;  3C95 A;  1C0M A;  2IOC A;  3DOL A;  3TAE A;  1ASV A;  1XC9 A;  2BDP A;  4KI6 A;  4BAC A;  3NAE A;  2GUI A;  1XWL A;  4FCY A;  2F8S A;  4M3X A;  1IKY A;  3OS2 A;  4I2Q A;  2IS3 A;  1WSI A;  1LW2 A;  3OYK A;  3AO5 A;  4CHQ A;  1JXE A;  1WSE A;  4Y1C A;  1TK5 A;  1C1B A;  4O4G A;  3C94 A;  4AHT A;  2P5O A;  4L8R B;  4QOZ B;  4ID1 A;  3OYJ A;  1S1W A;  1S6Q A;  3G0Z A;  4TSX A;  5FDL A;  1IG9 A;  1FKO A;  2G8V A;  2X6S A;  3OYI A;  4DU1 A;  4CGI A;  4CEA A;  3K59 A;  4N5S A;  2HHS A;  3LAL A;  2B6A A;  3QES A;  3VQE A;  3ISN C;  4CIG A;  4M3R A;  4KKO A;  1R0A A;  3I0R A;  3TAB A;  4OVL A;  2HND A;  4CJF A;  4GW6 A;  1BQM A;  1Q8I A;  3RMD A;  1L3T A;  5J2N A;  3D45 A;  4F2R A;  3LP3 A;  4IFY A;  3THV A;  1KFS A;  3OS1 A;  4PA1 A;  3ZSY A;  2PYL A;  4CEB A;  4FK2 A;  3TAN A;  1XI1 A;  4EP5 A;  5KGX A;  1TL3 A;  3DMJ A;  3PX4 A;  3NGZ A;  4DSJ A;  4AHC A;  4N56 A;  1S9E A;  3O3G A;  4J2D A;  4RW7 A;  3QIO A;  5SWM A;  1RT1 A;  1O1W A;  4FLX A;  3DLB A;  2A1S A;  3PV8 A;  4KHY A;  1T7P A;  4DLG A;  4FZZ A;  4FJ8 A;  2ZE2 A;  2P5G A;  2HNZ A;  4E0D A;  2JLE A;  2G8W A;  1BL3 A;  3RWU A;  5T7B A;  2DFF A;  4CJ3 A;  2KZM A;  3VQ5 A;  4F4K A;  1C6V A;  3NF9 A;  2XRI A;  1LAW A;  1RBU A;  4F3O A;  2X78 A;  1RT6 A;  1VSD A;  3V9W A;  1JKH A;  3UIQ A;  4B9M A;  3KLI A;  4B9S A;  2E6M A;  3LAM A;  3HPO A;  2DTU A;  5FRN A;  4KV8 A;  2OYQ A;  2Z1I A;  4DLE A;  3ULD A;  1KTQ A;  3VA3 A;  2HHV A;  1VK0 A;  4IFV A;  4I7F A;  5C25 A;  2YNF A;  4DSF A;  1KRP A;  3LZJ A;  2D5R A;  3AV9 A;  1JL1 A;  3CG7 A;  3SUP A;  3KKS A;  3AVN A;  4KTQ A;  4PY5 A;  2RN2 A;  1L3S A;  3L3V A;  2FBX A;  5C42 A;  5J2P A;  3SPY A;  3S3M A;  1QSL A;  3VQ7 A;  1RIL A;  4CFC A;  4B9N A;  3TAM A;  2BE2 A;  2I5J A;  4CK1 A;  4JS5 A;  5HBM A;  4HTU A;  3LAN A;  1NK0 A;  2IC3 A;  1WSJ A;  3DLH A;  3RMA A;  1IO2 A;  3LZI A;  3OYC A;  4DSK A;  1X9W A;  3V1Q A;  1Q9X A;  2HHW A;  3DYA A;  1HYZ A;  1X9M A;  1N5Y A;  1W0H A;  1I39 A;  4FK4 A;  1WAJ A;  1NJW A;  4Z4G A;  2QKB A;  4OJR A;  3V1O A;  3ZSV A;  4O55 A;  3ZSO A;  4Z4H A;  3MED A;  4FW2 A;  3CFR A;  4ID5 A;  3I0S A;  3ITH A;  4CHO A;  3EZ5 A;  1CZB A;  1LWE A;  4M41 A;  3DI6 A;  1WSF A;  4EP4 A;  3HVT A;  3OYA A;  1LAV A;  2JGU A;  2Z1J A;  4F8R A;  1BIS A;  3LP2 A;  3VQ8 A;  3EY1 A;  2YNI A;  3LDS A;  1X9S A;  1S1V A;  4FLZ A;  2EHG A;  1GOC A;  2YNH A;  3V4I A;  4B9U A;  4HCB A;  4FLW A;  3SJJ A;  1ASW A;  5DMR A;  5CYM A;  5SZT A;  3NGY A;  4Z0U A;  1F21 A;  3IAY A;  1JLG A;  3MXJ A;  3NGI A;  3V6D A;  1NKE A;  4N76 A;  4FJM A;  4IDK A;  4LSL A;  4BDP A;  2KTQ A;  1L3U A;  4E7K A;  1QSY A;  5FRM A;  1TL1 A;  3CM5 A;  4FJ9 A;  2P1J A;  4M3U A;  3KLH A;  1S1U A;  4CJT A;  1U4B A;  3PY8 A;  1FXX A;  3HL8 A;  4RG8 A;  4DQQ A;  2OZS A;  5HP1 A;  4B9V A;  3SZ2 A;  1J5O A;  1KLN A;  2PZS A;  4KHN A;  4H4O A;  2HMI A;  3QEV A;  1SKW A;  4KHW A;  1LWC A;  4DS5 A;  3LWL A;  1EP4 A;  1HMV A;  4DTN A;  4KPY A;  4M3Y A;  4CEE A;  4M45 A;  1RTH A;  3OS0 A;  3LAK A;  2Y1I A;  3OYF A;  1EXQ A;  1I3A A;  2D0C A;  1NK7 A;  3QNN A;  1BHL A;  4KTW A;  4WE1 A;  1ZBU A;  3WNF A;  4CEO A;  4C8O A;  3V1R A;  1BQN A;  4W5T A;  3KLF A;  1SL0 A;  3PO5 A;  4CJE A;  5I42 A;  4HCC A;  4NCB A;  4MFB A;  3PO4 A;  4DQR A;  1RNH A;  3LPU A;  1ASU A;  3KJV A;  3K57 A;  2Y1J A;  4FM1 A;  4CJV A;  1ZYQ A;  4CF8 A;  2PY5 A;  3DRS A;  2B4J A;  3QIN A;  4DSL A;  1J53 A;  1TGO A;  3KK2 A;  4DF4 A;  1UA1 A;  2KFN A;  4YNQ A;  2HHU A;  3K5L A;  2FBT A;  3MAQ A;  3NF8 A;  4Y1D A;  2HB5 A;  3AVA A;  3ZT4 A;  1Y97 A;  1CXU A;  3K5O A;  4CEQ A;  3HP6 A;  3CFP A;  4DF8 A;  4ZTF A;  1TK8 A;  4M3T A;  1QTM A;  2E4L A;  4IKF A;  3VQP A;  4Q0B A;  1Z26 A;  2X74 A;  3LPT A;  4DQS A;  1TV6 A;  4W5Q A;  1NK4 A;  3MXI A;  3ZT3 A;  2G8U A;  3HPH A; 
#chains in the Genus database with same CATH topology
 4DR1 K;  2KFZ A;  1ILY A;  4OPK A;  1S1T A;  4DTS A;  1HQE A;  3E9O A;  2IVP A;  3ZSX A;  4YY3 K;  2O8F B;  1JCF A;  5BR9 A;  5HRN A;  3OYB A;  1JLE A;  4H0T B;  5C12 A;  2AA4 A;  4DU3 A;  3SK3 A;  1Q7Y O;  4FO0 A;  3A0I X;  1U48 A;  3D2E B;  1HYV A;  2RE2 A;  4IG0 A;  1T8E A;  2O8F A;  3DXK B;  1IKV A;  4BQZ A;  4DTP A;  1HKC A;  3BP8 A;  3ZSW A;  4DFP A;  4O5B A;  1TUU A;  4W5R A;  1NG9 A;  1VQ6 N;  3SV4 A;  1EET A;  2A42 A;  5ELZ A;  3JYT A;  1YT3 A;  3O3H A;  3IMX A;  2DPN A;  3KWI A;  4FJX A;  4JKB A;  4BC5 A;  1H1V A;  4I6M B;  3D2E A;  3S41 A;  1NJZ A;  3DXK A;  1HYS A;  4I9L A;  1RBT A;  4J2E A;  1BIZ A;  2NRX A;  3PX6 A;  4BRQ A;  3P31 A;  5BR8 K;  3V9X A;  1SL2 A;  4EAH D;  4BRL A;  5IWA K;  2BGG A;  1QQM A;  4JN4 A;  4Y0W A;  3T1H K;  4JI3 K;  2A6A A;  4FWN A;  1KCF A;  3OJU A;  1C1C A;  3U8X A;  5HLF A;  1S22 A;  3MEE A;  4I6M A;  1VSK A;  4K25 A;  2D0A A;  3RMC A;  4PUO A;  3CJC A;  4ELT A;  1RDB A;  3K9K A;  3AGR A;  3AVB A;  5E41 A;  4H8K A;  1GOB A;  3VGM A;  1RT2 A;  4ISE A;  3K0S A;  1N32 K;  3O6W A;  1WOQ A;  3AVI A;  3AO2 A;  3O80 A;  1KD1 O;  1KVA A;  3TI0 A;  4UY8 O;  1ZBL A;  3ENO A;  3DM2 A;  3O9S A;  1GLF O;  3L2W A;  4CF0 A;  3LM9 A;  4R5P A;  2NNW A;  3P1G A;  4OGE A;  4HVJ A;  1VQP N;  1YVU A;  3DWL A;  5LMU K;  3TAP A;  3QIP A;  4FJN A;  2E88 A;  3NH1 A;  5I9E B;  1NKC A;  3TAR A;  4CJQ A;  2HBL A;  4CE9 A;  4YOY A;  4B3T K;  1DGK N;  4DR2 K;  4I2P A;  1VRU A;  2Z1H A;  1S5J A;  5K14 A;  2P9K B;  3QBX A;  3ZT1 A;  3O4Q A;  4FLV A;  2CGJ A;  2EWS A;  2GBZ A;  4FLY A;  4DSI A;  1WBD A;  5AQJ A;  5BRH A;  1J6Z A;  4OPA A;  1JLA A;  4CD3 A;  5BRF A;  5KQD A;  1R59 O;  2P9U A;  4CGG A;  1BA0 A;  2P9K A;  3VN5 A;  4RW4 A;  1EQY A;  4Z94 A;  3NF6 A;  5EX5 A;  1CXQ A;  1HKB A;  4YOT A;  2KW4 A;  3NH2 A;  4FJG A;  3Q7B A;  1ZBF A;  4NYN A;  4AHS A;  4RW6 A;  4DFM A;  4BY9 C;  1YJ9 N;  1HQU A;  4IBN A;  3NH0 A;  1LWF A;  5D3G A;  4BGB A;  5C24 A;  2YHX A;  1T3V A;  3PUF A;  3KVG A;  3ULE B;  3OYH A;  4NCG A;  4B1W B;  2QWO A;  4C8L A;  2DFH A;  3ZYY X;  4DV5 K;  3AO3 A;  4B9L A;  3AVM A;  4W5N A;  1HPZ A;  5BRE A;  3O1B A;  3AVH A;  2YNG A;  1ZC6 A;  4DMN A;  4IFE A;  1RT5 A;  4LY7 A;  4Z4I A;  3ULE A;  3O1W A;  1GLC G;  3EYZ A;  2E1Z A;  3W0L A;  4MDA A;  3T3F A;  5ADX H;  1BG3 A;  1NNE A;  3ZET B;  4A57 A;  4X65 K;  5AQK A;  2IVN A;  4B9T A;  1K8K B;  4BE1 A;  5AQL A;  3KD1 E;  3P38 A;  4KH5 A;  3QO9 A;  4FJL A;  4CIE A;  2KKZ A;  3AVC A;  4JD2 B;  2HOE A;  3ZET A;  4EZ6 A;  1MA9 B;  1SKS A;  1HNV A;  2A5X A;  1A5V A;  1K8K A;  4A5A A;  1B92 A;  4BRC A;  3NDK A;  3U9Z A;  1B9D A;  1VSM A;  1UA0 A;  2W6L A;  4NO7 A;  4PL7 A;  3PLA A;  4YHH K;  1OH6 A;  4CED A;  3VQQ A;  3SNN A;  5AQQ A;  1NOY A;  4WFB L;  1LW0 A;  3VQC A;  2QW9 A;  3F5T A;  3QET A;  3VEW A;  3L3U A;  3ZT2 A;  3KKR A;  4ICL A;  1SS6 A;  1NJX A;  1GOA A;  3NCI A;  1P90 A;  1NK8 A;  2YHB A;  3PSI A;  4WQ5 A;  4BRI A;  1D5A A;  3LM2 A;  3RMB A;  5C10 A;  4LH4 A;  5C2F A;  3G4S N;  4PKG A;  1W9H A;  3O5B A;  5F0X A;  3IDH A;  4KI6 A;  4BAC A;  4O5F A;  4LF9 K;  1XWL A;  1EO1 A;  2GWK A;  4I2Q A;  1WSI A;  4PL8 A;  4EHT A;  1WSE A;  4Y1C A;  1TK5 A;  4O4G A;  1M1K O;  4QOZ B;  3OYJ A;  4FWO A;  3CHW A;  1Q86 O;  2X6S A;  1YIJ N;  4CGI A;  4N5S A;  2ZWH A;  3VQE A;  1O13 A;  3HSC A;  3I0R A;  3TAB A;  4OVL A;  3EEQ A;  5J2N A;  4LF7 K;  3CJB A;  1VQK N;  3OS1 A;  3PX4 A;  3NGZ A;  3WXK A;  1BDG A;  2H3G X;  2FSJ A;  1S9E A;  3O3G A;  4RW7 A;  4KHP K;  4FLX A;  3KWG A;  3PV8 A;  4J8F A;  4DR5 K;  1W2B M;  4FJ8 A;  3QIC A;  2NRW A;  4FWM A;  4CZM A;  2QWL A;  3RWU A;  4M7Y A;  4DV7 K;  2BTF A;  4F4K A;  4BRF A;  4H0V B;  4B1U B;  3QFP A;  2WFB A;  3LL3 A;  3V9W A;  3GOI A;  3GG4 A;  1JKH A;  3CET A;  3T7Z A;  3UIQ A;  4B9S A;  3LDP A;  3E66 A;  4IFV A;  4DSF A;  4PY5 A;  4KTQ A;  5EOY A;  1QSL A;  2FBX A;  5J2P A;  1RIL A;  4ILJ A;  4BR7 A;  3I8B A;  4B9N A;  2RHK A;  1U2V B;  4NLC A;  1IO2 A;  2CGL A;  4H0X B;  4IJN A;  1Q9X A;  3CJ9 A;  3EO3 A;  1N5Y A;  4Z4G A;  1WAJ A;  1E3M A;  2QKB A;  3ZSV A;  4FW2 A;  3CFR A;  2P9P B;  4JK7 A;  3R8E A;  4M41 A;  3DI6 A;  5GAG P;  1VQN N;  5GAE P;  2Q36 A;  1LAV A;  3CJA A;  2UUA K;  4F8R A;  5AR0 A;  1X9S A;  1N33 K;  2EHG A;  3QFU A;  5CYM A;  4H03 B;  5AQN A;  1NKE A;  3V6D A;  1YJN N;  4N76 A;  2Q0U A;  2ZJQ L;  2P9P A;  3UE5 A;  1OH7 A;  4M3U A;  3E9L A;  3MX2 A;  3SMS A;  2YX6 A;  2OZS A;  4JK9 A;  5HP1 A;  3OW2 M;  5MLC Q;  1LWC A;  4JHD B;  2V7Z A;  4BR4 A;  4DS5 A;  3THY B;  1NGC A;  5E84 A;  2Q97 A;  3OYF A;  1EXQ A;  1NK7 A;  5EXW A;  3WNF A;  3HOS A;  3V1R A;  4W5T A;  3H1Q A;  3PO5 A;  1ATS A;  3F9M A;  4FM1 A;  4CJV A;  4DKW A;  2PY5 A;  3NMU A;  3ZX0 A;  1J5E K;  4DSL A;  4JHD A;  3K5L A;  3VEN A;  3K9J A;  3NF8 A;  3CFP A;  4ZTF A;  4BC3 A;  3E9P A;  3BZK A;  4LF4 K;  3VQP A;  4DQS A;  1NK4 A;  2G8U A;  3AAP A;  3HPH A;  1Y64 A;  1MWK A;  1N36 K;  1W97 L;  1XHZ A;  4FZY A;  1UOC A;  2FF6 A;  3LDN A;  1NMD A;  5BPL A;  4BG8 A;  4FJ7 A;  1OKJ A;  1GLL O;  2YV0 X;  3OYN A;  2B5J A;  1HJO A;  3I56 N;  1IBL K;  1FW6 A;  2QWP A;  3BUZ B;  1HLU A;  4FJJ A;  4N47 A;  5GAH P;  2CGK A;  3J7Z O;  1WLJ A;  3ZSR A;  3HT3 A;  4NCA A;  1BIU A;  4F9O A;  4X62 K;  4CER A;  4KH6 A;  3QEX A;  3T19 A;  3DLE A;  1HNW K;  4CJR A;  2FBV A;  4WQ4 C;  4CF1 A;  1QSS A;  4CJ7 A;  3TAF A;  3RR7 A;  4BE0 A;  1HRH A;  3VEX A;  3L2R A;  1QHA A;  4C1N I;  4IJA A;  1NU0 A;  2QWM A;  3LP1 A;  3AVL A;  3H6E A;  4RTF D;  1Z25 A;  4DG1 A;  1YIT N;  1BO5 O;  1U45 A;  2VWJ A;  5KRT A;  3RRG A;  2G8I A;  4CJL A;  5AZI B;  4IG3 A;  2UXC K;  4MO5 A;  1KSP A;  5H1S Q;  1RBR A;  3LDO A;  1VQ8 N;  4CZG A;  4FOE A;  2A40 A;  3VER A;  1C1A A;  4AM6 A;  4FW1 A;  2WBN A;  3MCP A;  3WNG A;  4GV6 A;  3AVJ A;  4J2B A;  4HWI A;  3O9U A;  5AZI A;  4FJ5 A;  2Q0R A;  3AA4 A;  1ITG A;  1TAU A;  2ZQB A;  3E1Y A;  1VSE A;  1TK0 A;  3IRX A;  3UB5 A;  4E7J A;  4DR7 K;  3SAH A;  3BDP A;  4OKK A;  3EE8 A;  5AQG A;  3UKU B;  2LSN A;  3DLK A;  4A61 A;  2OPR A;  4A5B A;  1D9F A;  2HHT A;  2QWR A;  3LDQ A;  3WNE A;  4CFB A;  3D7E O;  3CCR N;  2ETJ A;  4XH4 A;  3HO1 A;  3DLG A;  1L3V A;  5AFU H;  4CJS A;  1HNI A;  3OYM A;  1XC3 A;  4DU4 A;  3R3L A;  4KHS A;  3CF5 L;  4E89 A;  3UKU A;  1QE1 A;  4FJH A;  4YFU A;  1BCO A;  4OPJ A;  4CHP A;  1UAX A;  5HL7 L;  2BH1 A;  5AQI A;  4CGD A;  1Q9Y A;  3TPQ A;  3QEW A;  3DLR A;  3M8P A;  2UXB K;  1ATR A;  4KBO A;  2HW3 A;  5M1N A;  1X1P A;  4JKC A;  4OLA A;  2GWJ A;  3H08 A;  4B8C A;  2AP1 A;  4BDZ A;  1KLM A;  5CZ2 A;  2HBK A;  1B9F A;  3SQ0 A;  1U49 A;  4U7B A;  4CF9 A;  2GEM A;  4K8Z A;  4BR5 A;  3AA2 A;  4CIF A;  4LD0 A;  1IBM K;  4BRG A;  3OA9 A;  4BGA A;  4BRK A;  4FL9 A;  2NRH A;  5E26 A;  4BRO A;  2HHQ A;  3TAG A;  4DR6 K;  3CIP A;  4BC2 A;  3RRH A;  1K6Y A;  4FYD A;  1YTA A;  2OZM A;  5IT9 O;  2G8H A;  4FLU A;  3THX B;  3M8S A;  2E8A A;  2RPI A;  1YUW A;  4JKE A;  2W41 A;  5AQW A;  4E1M A;  2XY6 A;  4DSE A;  3FR0 A;  1NLV A;  4G1Q A;  3UKR B;  3KLE A;  1P8Z A;  2J4R A;  3FZM A;  4BVP A;  2ZGZ A;  1NGA A;  2XY7 A;  4JI7 K;  1NOZ A;  3THX A;  3SQ1 A;  3CQ8 A;  3M3Z A;  2DFE A;  2XY8 A;  3AO1 A;  3MEC A;  3CFO A;  3VQ9 A;  3HST B;  1TVR A;  4CHY A;  5M1P A;  1ATN A;  3UKR A;  5HOO A;  1C0U A;  5HRR A;  4A62 A;  2Z1G A;  3AVG A;  4QS7 A;  5AQH A;  1G15 A;  3M8Q A;  3K5N A;  2I7N A;  4AQY K;  3G6E N;  2F7T A;  2F8T A;  4GNI A;  3DJC A;  2GTD A;  3OY9 A;  1JLF A;  2DY4 A;  4UQG A;  4M3W A;  4BRH A;  3MDQ A;  4HUF A;  4NXN K;  1OH5 A;  3JAM O;  1J54 A;  4M42 A;  3E01 A;  5FRO A;  1DTT A;  1VSH A;  3DRP A;  3T1A A;  2G8F A;  3VQD A;  4DTX A;  4CHN A;  4FJI A;  3WUH A;  3ATU A;  4HHT A;  5KQ8 A;  4BWJ A;  3VQA A;  4JLH A;  4GMJ B;  2OPQ A;  5AQF A;  1VQ4 N;  3C6U A;  1BA1 A;  3DOK A;  3H3N O;  5AQS A;  1VSJ A;  4O0I A;  4GKJ K;  3I8D A;  2W42 A;  3U3G A;  4K0K K;  2AJQ A;  3AVK A;  3VGK A;  5FPM A;  2VG7 A;  3KK1 A;  3HVR A;  3CQY A;  1NGG A;  1KC8 O;  2V7Y A;  4YOR A;  4DTR A;  1OVY A;  4CK2 A;  1BUP A;  1RDW X;  2E6L A;  4DV0 K;  5HRS A;  3RR8 A;  3H1V X;  3EE9 A;  5FPN A;  1S6P A;  4LF8 K;  4ELU A;  4DS4 A;  3FE1 A;  1C0M A;  4GV3 A;  3DOL A;  1YF5 L;  3TAE A;  1ASV A;  1VHX A;  2GUI A;  4FCY A;  5BN8 A;  4M3X A;  2P9L B;  3WQT A;  2IS3 A;  3OYK A;  5KPZ A;  4L8R B;  4FWR A;  1IG9 A;  3SBT A;  2G8V A;  4CEA A;  4FOI A;  3U9D A;  4BR9 A;  3ISN C;  3W3D A;  3L4Q A;  4KKO A;  2P9L A;  1MDU B;  4GW6 A;  3D45 A;  4F2R A;  3LP3 A;  3THV A;  4DQ8 A;  3J80 O;  5JMV A;  2PYL A;  4YOX A;  3VMF B;  5KGX A;  2E5L K;  3QIO A;  5SWM A;  1RT1 A;  1O1W A;  3DLB A;  4KHY A;  3VEZ A;  5JIC A;  1T7P A;  4DLG A;  4FZZ A;  2ZE2 A;  5TKY A;  4MLH A;  2JLE A;  1BL3 A;  4ISF A;  1QVF M;  3WT0 A;  4CJ3 A;  3NF9 A;  1SZ2 A;  4CZK A;  3BEX A;  1X3N A;  3MWP A;  3LAM A;  2DTU A;  1NMN A;  4IDH A;  3PSF A;  4LC9 B;  2Z1I A;  4DLE A;  3ULD A;  1KTQ A;  1Q82 O;  1KRP A;  2D5R A;  1JL1 A;  3SUP A;  2ZM6 K;  3L3V A;  4JI1 K;  3VQ7 A;  4GVE A;  3TAM A;  2BE2 A;  4CK1 A;  4LF5 K;  4JS5 A;  1Z05 A;  3QB0 A;  2W40 A;  5AQU A;  1EWR A;  3TSU A;  2Q1N A;  3GDQ A;  3LZI A;  3WXJ A;  3F2K A;  1NGF A;  4OX9 K;  3DYA A;  1X9M A;  1W0H A;  4OJR A;  3V1O A;  2Q2R A;  4FPB A;  4K42 A;  4O55 A;  3ZSO A;  5JLF A;  4ID5 A;  3HI0 A;  3ITH A;  3EZ5 A;  1CZB A;  3CER A;  4H5R A;  3C6H A;  2WTU A;  3HVT A;  2JGU A;  4WCE L;  5B8H A;  2ZJP L;  3LDS A;  3FLC O;  2O8D B;  4FLZ A;  2UUC K;  4FLW A;  1JCE A;  1NBW A;  2GX9 A;  4Z0U A;  2D4W A;  3NGI A;  4H0Y B;  4JD2 A;  4BDP A;  4LSL A;  1L3U A;  4E7K A;  3CM5 A;  3D6R A;  1VQO N;  1FXX A;  4CZI A;  4DQQ A;  4M63 C;  4OPH A;  1J5O A;  2PZS A;  4KHN A;  4KHW A;  2HMI A;  3QEV A;  1HMV A;  4KPY A;  3CQX A;  2Y1I A;  3LAK A;  1I3A A;  4H5T A;  3QNN A;  1HPM A;  4KTW A;  4CZH A;  1ZBU A;  4CEO A;  4C8O A;  4RWT A;  4QS8 A;  5BPN A;  5I42 A;  1QQN A;  3K57 A;  1ASU A;  1ZYQ A;  3KK2 A;  1TGO A;  4DF4 A;  1UA1 A;  2KFN A;  4NB4 A;  1EWQ A;  1XUP O;  3VTH A;  4Y1D A;  4WQ4 A;  3VTI A;  2E2N A;  3AVA A;  3HP6 A;  4CEQ A;  4DF8 A;  1TK8 A;  4M3T A;  3RVC A;  1QTM A;  2E4L A;  4Q0B A;  4W5Q A;  1NGD A;  4DV4 K;  3RMA A;  1IG8 A;  4XH5 A;  4CEC A;  3MWT A;  1UWB A;  2O4G A;  1E4G T;  3PIO L;  3LP0 A;  2QKK A;  4I9Q A;  3SUO A;  5DM6 L;  4C1N K;  4CHZ A;  1TKD A;  1IV0 A;  4KFB A;  1RDC A;  3Q7C A;  3VQ4 A;  1WNS A;  4LF6 K;  1ZBS A;  3F9K A;  3O9R A;  2QEX N;  1NK9 A;  3O4W A;  3AVF A;  4LFB K;  4BWM A;  5AQX A;  4JK8 A;  4KH4 A;  1XMQ K;  3SQ4 A;  3WNH A;  3RTV A;  1RBV A;  3K5M A;  3CCQ N;  3VQ6 A;  5JVG L;  3CYM A;  3N4Q A;  4Z4C A;  4H4M A;  4BR2 A;  4BQL A;  3DXM B;  4C23 A;  3ZT0 A;  1BI4 B;  3OYE A;  2PAV A;  3P39 A;  4N41 A;  3CCL N;  4PHT X;  1IH7 A;  4JRQ A;  4C8M A;  1TYQ B;  1XQS C;  5M1O A;  5KGW A;  2WOM A;  3HRG A;  1LOT B;  3M8R A;  3OJS A;  2PBD A;  1S9G A;  1GLB G;  4F3T A;  3V9U A;  1BGX T;  1D8Y A;  1DEJ A;  4CZL A;  3ZX2 A;  3SLC A;  3DXM A;  1BI4 A;  1U2V A;  1TYQ A;  4DTO A;  2YHW A;  2VGM A;  5GAD P;  2E20 A;  2G8K A;  1TKX A;  3K58 A;  3D2F B;  4CW7 B;  1QZ5 A;  3EN9 A;  3CPE A;  3HBT A;  3ZCM A;  4CJW A;  5HRP A;  3OTO K;  1U47 A;  4DTM A;  2NRV A;  3CCS N;  2E2O A;  4EFH A;  1SV5 A;  1RTJ A;  2HNY A;  3B8A X;  4PWD A;  2ZF5 O;  4CES A;  4JKH A;  1KVB A;  2BUP A;  1LV5 A;  3A2F A;  1JLC A;  1QS4 A;  4K8X A;  5J1E A;  3L8B A;  2P9N B;  2BAN A;  1T05 A;  3D0P A;  1N34 K;  4YDU C;  2UYT A;  3CC7 N;  4F2S A;  4X64 K;  2A1R A;  3THY A;  4OGC A;  2ZD1 A;  1RCH A;  2WC9 A;  3C6A A;  1NGH A;  1FKP A;  4E1J A;  4EHU A;  4JKF A;  1VQ5 N;  3FZF A;  4JKG B;  4O0J A;  3V81 A;  2D0P A;  1TUY A;  2P9N A;  2O8E B;  4CK3 A;  3QEI A;  1BWF O;  3JSM A;  4RW9 A;  3NFA A;  2X6N A;  1SQK A;  1ZXO A;  1N6Q A;  4GV9 A;  5LY3 A;  4DTU A;  3H45 C;  4Z4E A;  2HVH A;  1M90 O;  1YJW N;  5C0Y A;  4WYB A;  2I7P A;  1YTU A;  3WEE B;  4NLB A;  3ZSZ A;  4BRA A;  3SCX A;  1MWM A;  3DRR A;  4JKG A;  3QNO A;  4E1N A;  3KIO A;  4ISG A;  4BR0 A;  4HUG A;  4CCH A;  4CJ4 A;  2JWK A;  3OYL A;  3KK3 A;  2OTJ N;  4XIU A;  4JI8 K;  3P83 D;  4CJK A;  3CI5 A;  3J7Y P;  1CZ9 A;  1EX4 A;  2QTD A;  1DTQ A;  4IOC L;  4CVN E;  3CJ1 A;  3WEE A;  4LSN A;  1SUQ A;  4W5O A;  1T03 A;  3L2Q A;  1K73 O;  1KQS M;  3IS9 A;  4X66 K;  2VG6 A;  1Q81 O;  4JS4 A;  1RDU A;  2IAJ A;  4WFA L;  4JV5 K;  4ILG B;  2QI2 A;  1QHT A;  5C2D A;  2XHB A;  4A59 A;  3HXM A;  3CXC M;  3OYG A;  2ATQ A;  4H0P A;  3OVN A;  3CMA N;  3B6O A;  3C6T A;  2E2P A;  2RKI A;  3NBP A;  4V19 S;  4CFD A;  4IWV A;  4DUZ K;  5AQM A;  5EY4 A;  3AO4 A;  4E7H A;  4MLE A;  4AH9 A;  2R7Y A;  2E1Y A;  5LL6 Z;  1TKZ A;  4CGJ A;  3KLG A;  4FK0 A;  3CM6 A;  1REV A;  4HTL A;  1A5W A;  3C65 A;  4BE2 A;  2WON A;  3T69 A;  3I33 A;  5KI6 A;  3O9Q A;  3L4I A;  4RCH A;  4RW8 A;  1I94 K;  4QCL A;  2YJE A;  3AY9 A;  4H0O A;  3EKU A;  3HPG A;  3H3O B;  4O44 A;  3SBG A;  4XH1 A;  3CPW M;  3O08 A;  1TAQ A;  3KTQ A;  1WAF A;  4OKE A;  3ZSQ A;  3VET A;  4FWQ A;  5GIP A;  4MO4 A;  4ZHR A;  4WF9 L;  3F73 A;  2OAN A;  4H5N A;  5C15 A;  4OO1 J;  1NK6 A;  4AHR A;  2ZGY A;  2D0B A;  3GL1 A;  1RTI A;  4E7I A;  3WXI A;  1S3X A;  4CGF A;  4CEZ A;  3HTV A;  2ITM A;  5EU7 A;  2HST A;  4E19 A;  3G71 N;  5EVZ A;  5KTQ A;  2VG5 A;  4AHU A;  1QQC A;  4Q5V A;  1LCU A;  3AA3 A;  3M6G A;  4CFA A;  5LJW A;  4OKJ A;  2W6K A;  1MU2 A;  4E3S A;  3MX5 A;  2VWK A;  4CBW A;  2HVI A;  1NGI A;  4DQP A;  4KTZ A;  1OVQ A;  4GY2 B;  3C95 A;  1XMO K;  2IOC A;  1YVN A;  3A8Y A;  5F1X A;  1XC9 A;  4BRN A;  2CH6 A;  1IKY A;  5A2Q O;  3OS2 A;  1LW2 A;  3RSE B;  3QDK A;  3TTD A;  4JKD A;  1JXE A;  4L3Q A;  1C1B A;  3C94 A;  5AZJ B;  4B1Y B;  1S1W A;  5M1F A;  1S6Q A;  4TSX A;  1FKO A;  5AQT A;  3OYI A;  4DV1 K;  4DU1 A;  2HHS A;  3K59 A;  5AJ3 K;  1NGJ A;  3A5N C;  4M3R A;  3BY5 A;  1KAX A;  2HND A;  3RSE A;  1BQM A;  1Q8I A;  3MK6 A;  4PA1 A;  5AZJ A;  4CEB A;  4DUY K;  1XI1 A;  1TL3 A;  3DMJ A;  3KZB A;  4AHC A;  4N56 A;  4FWS A;  1HNX K;  3LDL A;  4M7X A;  4IOA L;  2HNZ A;  4E0D A;  3VOV A;  4LFA K;  5T7B A;  2DFF A;  2KZM A;  3A5L C;  4YOV A;  1C6V A;  2XRI A;  3FZL A;  2NZT A;  1RT6 A;  3KK7 A;  3OHR A;  1RGI A;  4B9M A;  3KLI A;  3HPO A;  2NRZ A;  4KV8 A;  2HHV A;  3VA3 A;  1VK0 A;  4BRD A;  4I7F A;  5C25 A;  2UU9 K;  3AV9 A;  4B1Z A;  3MN5 A;  1VAZ A;  2RN2 A;  1K8A O;  3S3M A;  5AQP A;  4CFC A;  3EKS A;  5HBM A;  4HTU A;  2UUB K;  5JLH A;  1XNQ K;  3LAN A;  2IC3 A;  3FZK A;  4B9Q A;  5BN9 A;  3VGL A;  3OYC A;  2QWQ A;  3WQU A;  3V1Q A;  2HHW A;  1HYZ A;  3SAG A;  4FK4 A;  1I39 A;  1NJW A;  1U6Z A;  2HBJ A;  5AFU A;  3DLL L;  4CHO A;  1HR0 K;  2FXU A;  4K41 A;  1WSF A;  2GEL A;  4EP4 A;  4DR3 K;  3OYA A;  2IIR A;  2Z1J A;  3LP2 A;  3TSQ A;  2YNI A;  5CE3 A;  1S1V A;  2YNH A;  3MN7 A;  3V4I A;  1OH8 A;  4B9U A;  4YOW A;  5DMR A;  1BU6 O;  1NWK A;  5SZT A;  1F21 A;  4A2A A;  3IAY A;  3EL2 A;  3MXJ A;  4FJM A;  4IDK A;  1QSY A;  4WFN L;  5F2R A;  4FJ9 A;  3IUC A;  3KLH A;  1S1U A;  2F9T A;  1QQO A;  1HUX A;  3HL8 A;  4RG8 A;  1T6C A;  4DV3 K;  1HX1 A;  4JI5 K;  3SZ2 A;  3N4P A;  1KLN A;  4BVO A;  4DTN A;  2HMP A;  1RFQ A;  4M3Y A;  4CEE A;  4M45 A;  1RTH A;  5BPM A;  1NJI O;  2QWN A;  4QS9 A;  2QXL A;  1Z6R A;  1BHL A;  3MMV A;  4WE1 A;  5GIN A;  1BQN A;  1SL0 A;  4CJE A;  5CHI A;  1X9J A;  4HCC A;  4MFB A;  5JVH L;  3PO4 A;  4DQR A;  1RNH A;  3LPU A;  2Q31 A;  4B1X B;  3G25 A;  3DRS A;  2B4J A;  1J53 A;  2HHU A;  3SJH A;  3MAQ A;  2HB5 A;  1CXU A;  2P9U B;  4PKH A;  4BRP A;  2VYP A;  3LPT A;  3CME N;  3DAW A;  1FJG K;  3ZT3 A;  1YXQ A;  1RTD A;  5KRS A;  1D4X A;  1U04 A;  2HF4 A;  5JS1 A;  3CCM N;  4Z4F A;  3R9P A;  4CJP A;  3C7N B;  1YI2 N;  4CEF A;  1XNR K;  1IKW A;  4CZJ A;  1NK5 A;  4KO0 A;  4CGH A;  1JLQ A;  1Q18 A;  4KHU A;  4JAX A;  4PQU A;  4CJ5 A;  3ENB A;  4E7L A;  4DTJ A;  3SUQ A;  4G9Z A;  2VQE K;  1K9M O;  2OPS A;  3HZ6 A;  2O8B B;  1D9D A;  4M3Z A;  1CLQ A;  3BZC A;  3A5O C;  1A5X A;  3AA5 X;  3C7N A;  3OBW A;  2Q3S A;  3WXM B;  3HM9 A;  2GV9 A;  2QM1 A;  3TAQ A;  4KRE A;  2YHY A;  1E4F T;  5JS2 A;  1WN7 A;  4FVM A;  3M1F A;  3AAR A;  3M5R A;  2PYJ A;  4JRP A;  2FSN A;  3MCA B;  3VEV A;  1SL1 A;  3NVM A;  4CI6 A;  3MXM A;  2O8B A;  3SAF A;  2P9S B;  3G10 A;  2YJF A;  3S3O A;  1FK9 A;  3EZW A;  3FGU A;  3VF2 A;  1VSF A;  2FC0 A;  4DCH A;  3CCU N;  1BCM A;  2CH5 A;  3V9S A;  3FFK B;  1IKX A;  4DFK A;  1YAG A;  5J2M A;  2O4I A;  4DQI A;  3PIP L;  1C0T A;  1G99 A;  2FBY A;  4YDU A;  5AQO A;  4CF2 A;  1HJR A;  4OLB A;  2P9S A;  3O4N A;  4EZ9 A;  2HHH K;  5AQY A;  4DFJ A;  2VGN A;  3FFI A;  4KAZ A;  5CZ1 A;  1JL2 A;  1RBS A;  3O3F A;  3B6P A;  4CBU A;  4BRE A;  1GLJ O;  3L2V A;  3VEO A;  1VQL N;  3IKM A;  1WSG A;  3OYD A;  3QEP A;  4JNE A;  1YHQ N;  1TKT A;  4IOX A;  4CZF A;  1DT9 A;  3U4L A;  3SI6 A;  5CY4 A;  3SMP A;  3VEY A;  5CYQ A;  4CJU A;  2O8D A;  4FM2 A;  3MN6 A;  2D1K A;  3ASM A;  5TKW A;  3T1Y K;  1NKB A;  4MDB A;  2YKN A;  4B8A B;  4LH5 A;  1C0G A;  1JCG A;  3TTF A;  3QBW A;  3THW B;  4JYA K;  3P5J A;  3ALY A;  3TR8 A;  2QA4 N;  1KXP A;  3U3Y A;  3HJF A;  2IGI A;  1RT4 A;  3CD6 N;  4R79 A;  1KAZ A;  1IBK K;  4EIA A;  3V9Z A;  1DLO A;  1KFD A;  4B3M K;  2VCP A;  3SV3 A;  3NHG A;  3AGK A;  1T44 A;  3HK2 A;  3VA0 A;  2PFU A;  4IXC A;  3THW A;  3L2U A;  2QK9 A;  4IEI A;  1RT7 A;  2KHO A;  2OPP A;  1SKR A;  4ILH A;  1N8R O;  3JXU A;  4C8N A;  4KHQ A;  4JKA A;  3GE1 A;  1J9A A;  4A2B A;  1EKE A;  1ZBI A;  3ZX3 A;  5ADX A;  1QZ6 A;  3FZH A;  4BDY A;  5LMN K;  4BC4 A;  4J2A A;  2YI1 A;  4AM7 A;  4AIL C;  4FPA A;  1VSI A;  3HM8 A;  5AQV A;  4BG9 A;  2ITG A;  5BRD A;  3SQ2 A;  4O8K A;  3O8M A;  2A3Z A;  2ASM A;  2YHA A;  4H5W A;  2OA8 A;  3HYF A;  1NJY A;  3MEG A;  2KZZ A;  1XHX A;  4KRF A;  5HRO A;  2NUB A;  1V4T A;  4NXM K;  3HP9 A;  4B1V A;  3SPZ A;  3VES A;  5I3U A;  3I55 N;  3SYZ A;  3S3N A;  3CCV N;  2V51 B;  3QER A;  4DB3 A;  4KI4 A;  4CD1 A;  4FWK A;  2ASO A;  5M1K A;  2FLO A;  3CC2 N;  4K43 A;  1RDD A;  3LWM A;  5LJV A;  3H46 O;  3OBY A;  2P9I B;  1DKG D;  2XY5 A;  5FLX O;  4U67 L;  4FZX C;  4NYF A;  3TWH A;  4JI2 K;  4AHV A;  1KVC A;  5FPD A;  2XO7 A;  4QAG A;  2F96 A;  1L5U A;  4JI0 K;  2HBM A;  4YOU A;  1JLB A;  1BOT O;  2V52 B;  4KB0 A;  4C8K A;  3CJ7 A;  3ID6 A;  1RDA A;  1RT3 A;  3ZEU B;  1C0F A;  2HHX A;  4IO8 A;  4B3O A;  4DWI A;  4PKI A;  2P9I A;  4HUE A;  2FF3 B;  1VRT A;  2QXF A;  4IZ9 A;  4FXD A;  2O8C B;  3KD5 E;  2IDO A;  3VQB A;  3U6F A;  4B3S K;  1NM1 A;  1WUA A;  4KB1 A;  3MN9 A;  2NLX A;  5KPR A;  1S1X A;  3NE6 A;  4ZTJ A;  1WBB A;  4LFC K;  3QLH A;  3WXL A;  3BGR A;  3KHY A;  3ZEU A;  3ZLJ A;  5DK5 A;  4MQ3 A;  3SUN A;  4FLT A;  4BRM A;  4IO9 L;  1VSL A;  2KQ2 A;  2NRT A;  5M1Q A;  4FVU A;  2O8C A;  3J81 O;  3D2F A;  4GKK K;  4FJK A;  4H5V A;  4GVM A;  3S9H A;  2VQF K;  1WSH A;  3C0B A;  2P51 A;  1ESV A;  4JI6 K;  2RF2 A;  3NF7 A;  4FM0 A;  4DR4 K;  4ELV A;  3IG1 A;  3J7A P;  5J2Q A;  1V4S A;  2EX3 A;  4O8U A;  3K2P A;  4B08 A;  2GUP A;  2YKM A;  3CC4 N;  3PX0 A;  3JS6 A;  1ZBH A;  1JXB A;  2HF3 A;  2D0O A;  2BDP A;  3NAE A;  4FSV A;  2F8S A;  1IJJ A;  4DV2 K;  2E2Q A;  2UXD K;  3AO5 A;  4CHQ A;  4AHT A;  2P5O A;  1SAZ A;  4ID1 A;  3G0Z A;  3ENH A;  5FDL A;  2O8E A;  3ATV A;  3VF4 A;  3LAL A;  2B6A A;  3QES A;  4CIG A;  1R0A A;  4CBX A;  1W7A A;  1VQ7 N;  4CJF A;  1L3T A;  1T6D A;  3RMD A;  4IFY A;  1KFS A;  2NRR A;  3ZSY A;  4FK2 A;  3BF3 A;  3TAN A;  4EP5 A;  4WQ5 C;  4DSJ A;  3TSP A;  4J2D A;  3NVK A;  2A1S A;  2WUS A;  3A5M C;  2F4V K;  2P5G A;  2G8W A;  3VQ5 A;  1LAW A;  1RBU A;  2A41 A;  4F3O A;  2X78 A;  1VSD A;  3VF6 A;  3P4I A;  5GIO A;  2E6M A;  2ZJR L;  5FRN A;  2OYQ A;  1HKG A;  2YNF A;  3LZJ A;  3CG7 A;  3KKS A;  1GLE G;  3AVN A;  1S72 N;  3QML A;  1L3S A;  3SPY A;  5C42 A;  2I5J A;  2JWL A;  1NK0 A;  1WSJ A;  2F9W A;  1QVG M;  3DLH A;  4FWL A;  4DSK A;  1X9W A;  3VPZ A;  5AQR A;  4Z4H A;  3MED A;  3I0S A;  4AF1 A;  1CZA N;  1GLD G;  1LWE A;  1VQ9 N;  2IVO A;  1BIS A;  3VQ8 A;  3EY1 A;  1GOC A;  4HCB A;  3SJJ A;  1ASW A;  4IEE A;  3NGY A;  3O9T A;  1JLG A;  5KPT A;  2KTQ A;  3BF1 A;  5FRM A;  4B3R K;  1TL1 A;  5DM7 L;  1VQM N;  2P1J A;  3ID8 A;  4CJT A;  1U4B A;  3PY8 A;  4DV6 K;  2ASP A;  4B9V A;  3L6Q A;  5AQZ A;  4H4O A;  1SKW A;  1NGE A;  3IFR A;  3LWL A;  1EP4 A;  3J8A A;  3R6M A;  4JEP A;  3OS0 A;  3GBT A;  3CCJ N;  1JJ2 M;  2D0C A;  3TU5 A;  1GLA G;  2KLA A;  4DHY A;  5FPE A;  3KLF A;  4NCB A;  1X3M A;  3KJV A;  2Y1J A;  4CF8 A;  2OTL N;  5CR4 A;  3QIN A;  4XEI A;  2VWB A;  4JI4 K;  4YNQ A;  1KAY A;  2FBT A;  1NGB A;  4CZE A;  4FWP A;  3ZT4 A;  1Y97 A;  3K5O A;  2FSK A;  3L0Q A;  2OCE A;  1HNZ K;  4IKF A;  3AAQ A;  3R1X A;  3HOT A;  1Z26 A;  2X74 A;  3CCE N;  2YCH A;  1TV6 A;  3MXI A;  1WB9 A;  3TTC A; 
#chains in the Genus database with same CATH homology
 1RTD A;  5KRS A;  4CEC A;  2KFZ A;  1U04 A;  4OPK A;  1XHZ A;  1UWB A;  2O4G A;  4FZY A;  1S1T A;  5JS1 A;  1UOC A;  1HQE A;  4DTS A;  4Z4F A;  4CJP A;  3LP0 A;  4CEF A;  2QKK A;  4I9Q A;  1IKW A;  3SUO A;  3ZSX A;  4FJ7 A;  2YV0 X;  4CHZ A;  3OYN A;  4KO0 A;  1NK5 A;  1TKD A;  4CGH A;  4KFB A;  1RDC A;  1JLQ A;  2B5J A;  4KHU A;  3VQ4 A;  4PQU A;  4CJ5 A;  1WNS A;  5HRN A;  4E7L A;  3OYB A;  4DTJ A;  3F9K A;  3SUQ A;  1JLE A;  4FJJ A;  4N47 A;  4DU3 A;  2OPS A;  1NK9 A;  1D9D A;  1WLJ A;  4M3Z A;  1CLQ A;  3ZSR A;  1A5X A;  3HT3 A;  4NCA A;  1BIU A;  3AA5 X;  4CER A;  2Q3S A;  3QEX A;  3HM9 A;  2GV9 A;  3AVF A;  1U48 A;  3TAQ A;  3T19 A;  4KRE A;  3DLE A;  1HYV A;  4IG0 A;  4BWM A;  1T8E A;  4CJR A;  5JS2 A;  1IKV A;  4DTP A;  1WN7 A;  2FBV A;  4FVM A;  3SQ4 A;  3ZSW A;  4CF1 A;  4DFP A;  4O5B A;  3WNH A;  4W5R A;  3RTV A;  1QSS A;  1RBV A;  3K5M A;  3SV4 A;  2PYJ A;  3VQ6 A;  1EET A;  4JRP A;  3TAF A;  3RR7 A;  4BE0 A;  1SL1 A;  1HRH A;  3JYT A;  3L2R A;  3MXM A;  1YT3 A;  3CYM A;  4Z4C A;  4H4M A;  3O3H A;  3LP1 A;  3ZT0 A;  1BI4 B;  3G10 A;  3AVL A;  3OYE A;  4FJX A;  3S3O A;  1FK9 A;  4N41 A;  1IH7 A;  4JRQ A;  4C8M A;  1VSF A;  1Z25 A;  2FC0 A;  4DG1 A;  5KGW A;  2WOM A;  2VWJ A;  1U45 A;  3M8R A;  1NJZ A;  1HYS A;  5KRT A;  3RRG A;  1BCM A;  4I9L A;  2G8I A;  1RBT A;  4CJL A;  3OJS A;  4J2E A;  1BIZ A;  1S9G A;  3V9S A;  4IG3 A;  1KSP A;  3PX6 A;  4F3T A;  3V9U A;  1IKX A;  1BGX T;  4DFK A;  3V9X A;  5J2M A;  1SL2 A;  1RBR A;  1D8Y A;  4DQI A;  2O4I A;  2BGG A;  1C0T A;  2FBY A;  1C1A A;  4CF2 A;  1HJR A;  1KCF A;  4FW1 A;  4OLB A;  1BI4 A;  3OJU A;  3O4N A;  1C1C A;  3WNG A;  5HLF A;  4EZ9 A;  3MEE A;  1VSK A;  4DFJ A;  3AVJ A;  3FFI A;  4DTO A;  4KAZ A;  2D0A A;  4J2B A;  3RMC A;  4PUO A;  4ELT A;  1RDB A;  4FJ5 A;  2G8K A;  3AA4 A;  5CZ1 A;  1ITG A;  3AVB A;  1JL2 A;  5E41 A;  1RBS A;  1TKX A;  2ZQB A;  3O3F A;  4H8K A;  1TAU A;  1GOB A;  3B6P A;  1VSE A;  3K58 A;  1RT2 A;  1TK0 A;  3IRX A;  4E7J A;  3L2V A;  3ZCM A;  4CJW A;  1WSG A;  3BDP A;  4OKK A;  3OYD A;  3QEP A;  1TKT A;  3AVI A;  2LSN A;  3AO2 A;  3DLK A;  5HRP A;  4DTM A;  3SI6 A;  1U47 A;  5CY4 A;  1KVA A;  3TI0 A;  1SV5 A;  1RTJ A;  2HNY A;  2OPR A;  5CYQ A;  1D9F A;  4CJU A;  1ZBL A;  4PWD A;  4CES A;  4FM2 A;  3DM2 A;  1KVB A;  2HHT A;  3ASM A;  3WNE A;  4CFB A;  3L2W A;  4CF0 A;  1LV5 A;  3A2F A;  2ETJ A;  4R5P A;  1JLC A;  3DLG A;  3HO1 A;  3P1G A;  1L3V A;  1QS4 A;  4OGE A;  4CJS A;  4K8X A;  1HNI A;  3OYM A;  5J1E A;  4HVJ A;  1NKB A;  1YVU A;  4DU4 A;  3L8B A;  3TAP A;  3QIP A;  2YKN A;  4FJN A;  4B8A B;  4LH5 A;  4KHS A;  3NH1 A;  4E89 A;  1QE1 A;  1NKC A;  2BAN A;  1T05 A;  3TAR A;  4CJQ A;  3D0P A;  4FJH A;  4YFU A;  1BCO A;  4CE9 A;  4OPJ A;  4CHP A;  1UAX A;  3P5J A;  4F2S A;  3ALY A;  3TR8 A;  2A1R A;  4OGC A;  4CGD A;  3U3Y A;  2ZD1 A;  1Q9Y A;  1RCH A;  3HJF A;  3QEW A;  2IGI A;  3DLR A;  1FKP A;  1RT4 A;  4I2P A;  1VRU A;  2Z1H A;  1S5J A;  3M8P A;  5K14 A;  3ZT1 A;  4O0J A;  3V9Z A;  3V81 A;  3O4Q A;  4FLV A;  2HW3 A;  4CK3 A;  3QEI A;  1DLO A;  1KFD A;  3JSM A;  1X1P A;  3NFA A;  4RW9 A;  3SV3 A;  2GBZ A;  4FLY A;  2X6N A;  3NHG A;  4DSI A;  4OLA A;  3H08 A;  3HK2 A;  1N6Q A;  4B8C A;  3VA0 A;  4DTU A;  3L2U A;  2QK9 A;  4BDZ A;  4Z4E A;  1RT7 A;  1KLM A;  5CZ2 A;  2HVH A;  2OPP A;  1B9F A;  3SQ0 A;  1U49 A;  1SKR A;  1YTU A;  1JLA A;  4C8N A;  4KHQ A;  4CF9 A;  4CGG A;  4K8Z A;  3ZSZ A;  3AA2 A;  3SCX A;  3DRR A;  3VN5 A;  3QNO A;  4RW4 A;  3NF6 A;  4CIF A;  4LD0 A;  1J9A A;  1CXQ A;  4E1N A;  1EKE A;  3KIO A;  4HUG A;  1ZBI A;  3NH2 A;  2KW4 A;  4CJ4 A;  4CCH A;  3OYL A;  3KK3 A;  4FJG A;  1ZBF A;  4XIU A;  4BDY A;  3P83 D;  4NYN A;  4CJK A;  4J2A A;  4AHS A;  1CZ9 A;  1EX4 A;  4RW6 A;  4DFM A;  4AIL C;  2HHQ A;  1VSI A;  1DTQ A;  3TAG A;  1HQU A;  4IBN A;  3RRH A;  1K6Y A;  2ITG A;  3NH0 A;  1LWF A;  4FYD A;  5D3G A;  3SQ2 A;  1YTA A;  2OZM A;  5C24 A;  4FLU A;  2G8H A;  3M8S A;  3PUF A;  4LSN A;  1SUQ A;  4W5O A;  2RPI A;  2YHA A;  3L2Q A;  1T03 A;  3OYH A;  2OA8 A;  3HYF A;  4NCG A;  1NJY A;  4C8L A;  2DFH A;  3MEG A;  2KZZ A;  1XHX A;  3AO3 A;  3IS9 A;  4B9L A;  5HRO A;  4KRF A;  2NUB A;  2VG6 A;  3AVM A;  4W5N A;  4E1M A;  3HP9 A;  1HPZ A;  2XY6 A;  4JS4 A;  4DSE A;  2IAJ A;  3SPZ A;  4G1Q A;  3KLE A;  3AVH A;  1QHT A;  5I3U A;  3SYZ A;  2XHB A;  2YNG A;  3S3N A;  3QER A;  2XY7 A;  4DMN A;  4KI4 A;  3HXM A;  1NOZ A;  3OYG A;  2ATQ A;  3SQ1 A;  3OVN A;  3CQ8 A;  3LWM A;  1RDD A;  1RT5 A;  3B6O A;  4LY7 A;  3C6T A;  4Z4I A;  2DFE A;  2RKI A;  3EYZ A;  2XY8 A;  2XY5 A;  3AO1 A;  3MEC A;  3NBP A;  4CFD A;  3CFO A;  3VQ9 A;  3T3F A;  3HST B;  1TVR A;  4CHY A;  4FZX C;  4NYF A;  3AO4 A;  3TWH A;  4E7H A;  4AHV A;  1KVC A;  2XO7 A;  4AH9 A;  4QAG A;  2F96 A;  2R7Y A;  1C0U A;  5HRR A;  1L5U A;  4B9T A;  1TKZ A;  2Z1G A;  3AVG A;  4CGJ A;  3KLG A;  4FK0 A;  3CM6 A;  4BE1 A;  1JLB A;  1G15 A;  1REV A;  3KD1 E;  4KB0 A;  1A5W A;  3M8Q A;  3K5N A;  4C8K A;  4BE2 A;  1RDA A;  1RT3 A;  2WON A;  3QO9 A;  2F8T A;  2HHX A;  4FJL A;  4CIE A;  5KI6 A;  4B3O A;  4DWI A;  3OY9 A;  4HUE A;  1JLF A;  2DY4 A;  4UQG A;  1VRT A;  2QXF A;  3AVC A;  4M3W A;  4HUF A;  4FXD A;  4RW8 A;  4QCL A;  3KD5 E;  2IDO A;  3VQB A;  3U6F A;  4EZ6 A;  1J54 A;  1SKS A;  4M42 A;  1HNV A;  3E01 A;  1A5V A;  5FRO A;  3HPG A;  4KB1 A;  1DTT A;  4O44 A;  1VSH A;  3DRP A;  1B92 A;  3NDK A;  1S1X A;  3NE6 A;  3T1A A;  1TAQ A;  3VQD A;  4DTX A;  4CHN A;  4ZTJ A;  2G8F A;  3KTQ A;  1B9D A;  3QLH A;  4FJI A;  1VSM A;  1WAF A;  4HHT A;  1UA0 A;  3BGR A;  4OKE A;  4BWJ A;  3ZSQ A;  5DK5 A;  3VQA A;  4MQ3 A;  4ZHR A;  4JLH A;  4GMJ B;  3F73 A;  2OPQ A;  3SUN A;  4FLT A;  1NK6 A;  4CED A;  1VSL A;  2KQ2 A;  4AHR A;  3C6U A;  3VQQ A;  2D0B A;  3DOK A;  3SNN A;  1VSJ A;  4O0I A;  1RTI A;  1NOY A;  4E7I A;  1LW0 A;  3VQC A;  4CGF A;  4FJK A;  3I8D A;  4CEZ A;  2W42 A;  3U3G A;  3QET A;  4GVM A;  3AVK A;  2AJQ A;  3S9H A;  2VG7 A;  5EU7 A;  3KK1 A;  3HVR A;  3L3U A;  3ZT2 A;  4E19 A;  3KKR A;  4ICL A;  1WSH A;  5KTQ A;  1NJX A;  2VG5 A;  2P51 A;  4AHU A;  1QQC A;  2RF2 A;  4Q5V A;  1GOA A;  3AA3 A;  3NF7 A;  4FM0 A;  3NCI A;  4DTR A;  4ELV A;  3IG1 A;  4CK2 A;  1NK8 A;  5J2Q A;  2YHB A;  4CFA A;  2E6L A;  3RR8 A;  5HRS A;  4OKJ A;  1D5A A;  1MU2 A;  4E3S A;  3RMB A;  2VWK A;  1S6P A;  2EX3 A;  3K2P A;  4LH4 A;  4ELU A;  4B08 A;  2HVI A;  2YKM A;  3PX0 A;  4DQP A;  1ZBH A;  4KTZ A;  4DS4 A;  1JXB A;  1W9H A;  3C95 A;  1C0M A;  2IOC A;  3DOL A;  3TAE A;  1ASV A;  1XC9 A;  2BDP A;  4KI6 A;  4BAC A;  3NAE A;  2GUI A;  1XWL A;  4FCY A;  2F8S A;  4M3X A;  1IKY A;  3OS2 A;  4I2Q A;  2IS3 A;  1WSI A;  1LW2 A;  3OYK A;  3AO5 A;  4CHQ A;  1JXE A;  1WSE A;  4Y1C A;  1TK5 A;  1C1B A;  4O4G A;  3C94 A;  4AHT A;  2P5O A;  4L8R B;  4QOZ B;  4ID1 A;  3OYJ A;  1S1W A;  1S6Q A;  3G0Z A;  4TSX A;  5FDL A;  1IG9 A;  1FKO A;  2G8V A;  2X6S A;  3OYI A;  4DU1 A;  4CGI A;  4CEA A;  3K59 A;  4N5S A;  2HHS A;  3LAL A;  2B6A A;  3QES A;  3VQE A;  3ISN C;  4CIG A;  4M3R A;  4KKO A;  1R0A A;  3I0R A;  3TAB A;  4OVL A;  2HND A;  4CJF A;  4GW6 A;  1BQM A;  1Q8I A;  3RMD A;  1L3T A;  5J2N A;  3D45 A;  4F2R A;  3LP3 A;  4IFY A;  3THV A;  1KFS A;  3OS1 A;  4PA1 A;  3ZSY A;  2PYL A;  4CEB A;  4FK2 A;  3TAN A;  1XI1 A;  4EP5 A;  5KGX A;  1TL3 A;  3DMJ A;  3PX4 A;  3NGZ A;  4DSJ A;  4AHC A;  4N56 A;  1S9E A;  3O3G A;  4J2D A;  4RW7 A;  3QIO A;  5SWM A;  1RT1 A;  1O1W A;  4FLX A;  3DLB A;  2A1S A;  3PV8 A;  4KHY A;  1T7P A;  4DLG A;  4FZZ A;  4FJ8 A;  2ZE2 A;  2P5G A;  2HNZ A;  4E0D A;  2JLE A;  2G8W A;  1BL3 A;  3RWU A;  5T7B A;  2DFF A;  4CJ3 A;  2KZM A;  3VQ5 A;  4F4K A;  1C6V A;  3NF9 A;  2XRI A;  1LAW A;  1RBU A;  4F3O A;  2X78 A;  1RT6 A;  1VSD A;  3V9W A;  1JKH A;  3UIQ A;  4B9M A;  3KLI A;  4B9S A;  2E6M A;  3LAM A;  3HPO A;  2DTU A;  5FRN A;  4KV8 A;  2OYQ A;  2Z1I A;  4DLE A;  3ULD A;  1KTQ A;  3VA3 A;  2HHV A;  1VK0 A;  4IFV A;  4I7F A;  5C25 A;  2YNF A;  4DSF A;  1KRP A;  3LZJ A;  2D5R A;  3AV9 A;  1JL1 A;  3CG7 A;  3SUP A;  3KKS A;  3AVN A;  4KTQ A;  4PY5 A;  2RN2 A;  1L3S A;  3L3V A;  2FBX A;  5C42 A;  5J2P A;  3SPY A;  3S3M A;  1QSL A;  3VQ7 A;  1RIL A;  4CFC A;  4B9N A;  3TAM A;  2BE2 A;  2I5J A;  4CK1 A;  4JS5 A;  5HBM A;  4HTU A;  3LAN A;  1NK0 A;  2IC3 A;  1WSJ A;  3DLH A;  3RMA A;  1IO2 A;  3LZI A;  3OYC A;  4DSK A;  1X9W A;  3V1Q A;  1Q9X A;  2HHW A;  3DYA A;  1HYZ A;  1X9M A;  1N5Y A;  1W0H A;  1I39 A;  4FK4 A;  1WAJ A;  1NJW A;  4Z4G A;  2QKB A;  4OJR A;  3V1O A;  3ZSV A;  4O55 A;  3ZSO A;  4Z4H A;  3MED A;  4FW2 A;  3CFR A;  4ID5 A;  3I0S A;  3ITH A;  4CHO A;  3EZ5 A;  1CZB A;  1LWE A;  4M41 A;  3DI6 A;  1WSF A;  4EP4 A;  3HVT A;  3OYA A;  1LAV A;  2JGU A;  2Z1J A;  4F8R A;  1BIS A;  3LP2 A;  3VQ8 A;  3EY1 A;  2YNI A;  3LDS A;  1X9S A;  1S1V A;  4FLZ A;  2EHG A;  1GOC A;  2YNH A;  3V4I A;  4B9U A;  4HCB A;  4FLW A;  3SJJ A;  1ASW A;  5DMR A;  5CYM A;  5SZT A;  3NGY A;  4Z0U A;  1F21 A;  3IAY A;  1JLG A;  3MXJ A;  3NGI A;  3V6D A;  1NKE A;  4N76 A;  4FJM A;  4IDK A;  4LSL A;  4BDP A;  2KTQ A;  1L3U A;  4E7K A;  1QSY A;  5FRM A;  1TL1 A;  3CM5 A;  4FJ9 A;  2P1J A;  4M3U A;  3KLH A;  1S1U A;  4CJT A;  1U4B A;  3PY8 A;  1FXX A;  3HL8 A;  4RG8 A;  4DQQ A;  2OZS A;  5HP1 A;  4B9V A;  3SZ2 A;  1J5O A;  1KLN A;  2PZS A;  4KHN A;  4H4O A;  2HMI A;  3QEV A;  1SKW A;  4KHW A;  1LWC A;  4DS5 A;  3LWL A;  1EP4 A;  1HMV A;  4DTN A;  4KPY A;  4M3Y A;  4CEE A;  4M45 A;  1RTH A;  3OS0 A;  3LAK A;  2Y1I A;  3OYF A;  1EXQ A;  1I3A A;  2D0C A;  1NK7 A;  3QNN A;  1BHL A;  4KTW A;  4WE1 A;  1ZBU A;  3WNF A;  4CEO A;  4C8O A;  3V1R A;  1BQN A;  4W5T A;  3KLF A;  1SL0 A;  3PO5 A;  4CJE A;  5I42 A;  4HCC A;  4NCB A;  4MFB A;  3PO4 A;  4DQR A;  1RNH A;  3LPU A;  1ASU A;  3KJV A;  3K57 A;  2Y1J A;  4FM1 A;  4CJV A;  1ZYQ A;  4CF8 A;  2PY5 A;  3DRS A;  2B4J A;  3QIN A;  4DSL A;  1J53 A;  1TGO A;  3KK2 A;  4DF4 A;  1UA1 A;  2KFN A;  4YNQ A;  2HHU A;  3K5L A;  2FBT A;  3MAQ A;  3NF8 A;  4Y1D A;  2HB5 A;  3AVA A;  3ZT4 A;  1Y97 A;  1CXU A;  3K5O A;  4CEQ A;  3HP6 A;  3CFP A;  4DF8 A;  4ZTF A;  1TK8 A;  4M3T A;  1QTM A;  2E4L A;  4IKF A;  3VQP A;  4Q0B A;  1Z26 A;  2X74 A;  3LPT A;  4DQS A;  1TV6 A;  4W5Q A;  1NK4 A;  3MXI A;  3ZT3 A;  2G8U A;  3HPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...