3NF7A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf7A00
3HT3A 3PO4A 3OYFA 2KZZA 4J2BA 3VQEA 3G10A 4J2AA 4C8OA 1Q9YA 3RMAA 3VQ6A 3SQ0A 3I8DA 5J2NA 4EZ6A 4CGDA 4CGIA 3I0RA 4CJLA 3L2WA 2XY6A 4GVMA 2VWJA 5KGXA 1RDDA 4CGHA 3SUPA 3ZSWA 2YNFA 4AH9A 1SKRA 1TV6A 1S6PA 4CJPA 3OYKA 4FW1A 2OPPA 3L2VA 3V9UA 4Y1CA 1NJZA 5CZ2A 3DOLA 1TKXA 2VG6A 4ID5A 3V4IA 3IAYA 4KO0A 1LWFA 4E1NA 3DMJA 4O44A 2F8SA 1X9WA 4XIUA 2B4JA 1QS4A 4E7KA 4DQIA 4FJNA 1JLBA 2RPIA 4CEEA 4OVLA 2VG7A 3LP2A 4E3SA 2PYLA 3SNNA 3SPZA 3QINA 3QLHA 3CYMA 1DTTA 3MEDA 1CXQA 4LY7A 4PQUA 4FLZA 3NCIA 3AO1A 3OYHA 3TAFA 4DLEA 2A1RA 2B6AA 2OA8A 3RRGA 4R5PA 3NF8A 4CK3A 3DLBA 1L5UA 5KRTA 3SV3A 4CF8A 4O0JA 4FJHA 2DTUA 4FZZA 2HNYA 4Z4EA 4FYDA 1TL1A 3AO4A 4NYNA 3AVLA 1RBUA 4FJIA 4B9NA 3OS1A 2HW3A 4M3RA 3TABA 3ZSZA 4NCBA 3QIPA 1ZYQA 4C8NA 4EP4A 3HL8A 2E6MA 1C1CA 2FBVA 1S1UA 4ZTFA 4CJ5A 4KHUA 3M8SA 3HPHA 1VSFA 5J2QA 3DI6A 3F9KA 3ISNC 4I2QA 4F3OA 4KTQA 2OZSA 4CESA 3NBPA 1UWBA 2Z1IA 1U49A 1TK0A 1NOZA 3D0PA 3H08A 3OYCA 1HJRA 1RNHA 4DFKA 3AVBA 1S1XA 1VSIA 4FM0A 4G1QA 1FKPA 1REVA 3KLIA 3AA2A 4E1MA 4EP5A 3C94A 1KLNA 3NF6A 3VQQA 4DTNA 2IS3A 1SKSA 1C1AA 1WLJA 3K58A 4E0DA 4FK2A 4KTWA 4KHNA 5D3GA 4W5NA 1BL3A 3DLGA 4W5OA 1LW2A 1NOYA 1NKEA 1XHZA 1QSYA 3HSTB 1JLQA 4CIFA 1TAQA 3VQBA 1O1WA 2OZMA 1RDAA 1IKVA 1IH7A 3AVFA 2HHWA 1J9AA 4CEDA 3VQCA 4GMJB 4FLYA 3BDPA 4Z4IA 3QNNA 2HMIA 4KI4A 4KREA 1KVAA 3AA4A 3OYEA 3EZ5A 4DQRA 4CFBA 2E4LA 5HRPA 3LAKA 4B08A 4KB0A 1LAWA 3EYZA 1NK6A 1EX4A 4BDPA 1J5OA 5FRMA 4M41A 3NE6A 4DS4A 1C6VA 3V1OA 4CJFA 1KVBA 1NK7A 4RW7A 1MU2A 2EHGA 4IFVA 3K59A 1G15A 3T3FA 4B3OA 3AVGA 3HM9A 1BI4A 1I39A 3CFPA 4CFDA 1JLEA 3O3GA 3G0ZA 4FW2A 4DTPA 4DFMA 5HP1A 3DOKA 4I9LA 1NJWA 1QE1A 3RMBA 4DU4A 2D0AA 1TK8A 3KK3A 1HRHA 3AA3A 4NCGA 4OPJA 3QERA 1VSKA 1HYSA 3S3MA 4BWMA 3KIOA 2QKKA 3IS9A 3PY8A 3K5LA 1GOCA 4CF1A 4QCLA 4FZYA 4OGEA 3AA5X 3PO5A 1NJYA 4B9MA 3LPUA 4IFYA 3HPGA 3AO5A 2F96A 1HMVA 3AVIA 1VSMA 4FJXA 1J53A 4M3ZA 4KRFA 3OYGA 3OVNA 1BCOA 3V9SA 3SQ2A 3DLRA 3SI6A 1YVUA 2GBZA 4K8XA 4RW8A 1L3SA 4FLWA 3C6TA 4F8RA 3WNGA 4OLBA 2BE2A 3PUFA 1U4BA 2ITGA 1HYVA 4B9UA 4OLAA 4CJWA 3MXIA 4KKOA 3NDKA 4FJ5A 1XWLA 4F2RA 1FKOA 1BISA 5I3UA 3HO1A 3U3YA 1RTDA 2IDOA 3CQ8A 2JLEA 1GOAA 4F4KA 5HROA 4CF0A 4CF9A 3LP0A 4CK1A 2BDPA 1TKTA 4ELUA 3O3HA 1LWEA 3WNEA 1VSDA 2YV0X 4C8MA 3AVJA 3K5MA 4CK2A 1RT7A 1S5JA 4FJ9A 5HRSA 4KI6A 1IKXA 4FLTA 1VRTA 2XY7A 1RT4A 4ID1A 4LD0A 5JS2A 2DFHA 4DQSA 1N6QA 4E19A 4IKFA 2HHSA 3CM5A 1W9HA 3OJSA 1BIZA 3ITHA 4DQQA 4AHCA 4EZ9A 3B6PA 5FDLA 3AVKA 5KGWA 4Q5VA 3SYZA 4Z0UA 1ASUA 4QAGA 1NK5A 2PZSA 4UQGA 3F73A 4BE0A 5I42A 3HP9A 1YTAA 2IGIA 1TKDA 1I3AA 3VQ8A 3OYIA 2ETJA 4CJRA 1S6QA 1SL1A 4DG1A 1NJXA 3HK2A 4B9VA 3AVMA 2HHUA 4CHNA 4HVJA 2G8FA 2Z1GA 1UA0A 1HQUA 1TKZA 4CJ4A 3OYAA 1S1WA 1HPZA 3SJJA 1RBRA 2QXFA 3ALYA 1VSHA 2XY5A 1ITGA 1KRPA 3AO3A 5C25A 3HJFA 1T05A 3QEVA 1EXQA 1GOBA 1KFDA 3NHGA 4PA1A 4CGJA 3DRSA 1BQMA 3SCXA 3TAPA 1JL2A 2KQ2A 3MXJA 3NH0A 1D9FA 4KTZA 3SPYA 1J54A 1RBVA 4CEOA 1QTMA 4NCAA 5FRNA 3O4QA 4CJ3A 4OKJA 1NKCA 2KZMA 3RTVA 4H4MA 4O4GA 2D0BA 4IG3A 3V1RA 3MEGA 4HCCA 3OYLA 4JRQA 2GV9A 3NH2A 4H4OA 3ZSQA 4CFCA 2XHBA 4DU1A 3RMDA 3THVA 4C8KA 2X78A 4MQ3A 3ULDA 4PY5A 3ZT3A 4DMNA 4AHUA 1RDCA 3VN5A 4CJUA 3CM6A 2G8HA 4FJ8A 3ZSOA 3KTQA 1F21A 1KTQA 3D45A 2DY4A 1XI1A 3NF7A 4WE1A 4KHYA 3V9XA 2Y1IA 2RN2A 3VQDA 3NGIA 3QNOA 2Y1JA 4DF8A 2ZD1A 1B92A 4IDKA 1D9DA 2G8IA 2KTQA 4FZXC 3RMCA 4IG0A 4RW4A 1WSFA 3TAMA 3SV4A 3I0SA 2HVIA 3LALA 2XY8A 1JL1A 4E7LA 2EX3A 3ZCMA 3SZ2A 2YNHA 3LWLA 3DLHA 2QKBA 4I9QA 2NUBA 3DLKA 1C0UA 3P1GA 2X6SA 2D5RA 5CZ1A 3OYBA 3K2PA 3VQ7A 3S3OA 1T8EA 4Z4FA 1TAUA 4I7FA 3U6FA 2O4IA 4FJJA 3MECA 2IAJA 4YNQA 2WOMA 5HRNA 2BGGA 2Q3SA 5E41A 2ZQBA 2XO7A 4BDYA 1L3VA 3ZT0A 2FBYA 3KJVA 5CYMA 2X6NA 4CF2A 4AHRA 5HRRA 4LH4A 4CJEA 4W5RA 3TANA 4RW6A 3WNFA 4LSNA 3K57A 1FK9A 4CJTA 4DTJA 1NK9A 1S1TA 4ELTA 1C1BA 1KSPA 4M42A 4FXDA 1JLAA 1U48A 4DFPA 1NK0A 3AVCA 4M3YA 2YNIA 1U47A 4DTOA 4ICLA 1CLQA 1YT3A 3CFOA 1L3UA 1T03A 2P5OA 4Z4CA 3AV9A 4CFAA 3ZSVA 1U04A 3AVNA 2IOCA 1C0MA 4E7HA 4Z4GA 3RWUA 3AO2A 3T1AA 2W42A 1WSHA 3DYAA 3L2UA 2GUIA 4O5BA 1R0AA 1JKHA 4C8LA 3SUNA 4HHTA 3P83D 3VQ9A 1BHLA 4I2PA 2YNGA 3A2FA 3OYDA 1WSIA 4CECA 3LAMA 2RF2A 1RT3A 3C6UA 4J2DA 4CJSA 1LAVA 3O4NA 1Z25A 1ZBFA 4KAZA 4Q0BA 4IBNA 3QESA 2IC3A 4KHWA 4KHSA 4PUOA 4M3XA 1A5WA 4CCHA 2HNDA 3PV8A 1B9DA 3OS2A 4FM1A 1JLGA 1Y97A 4M3TA 3LANA 4DU3A 3P5JA 4CHYA 1ASVA 4HTUA 3TWHA 2YKMA 1SL0A 1HNVA 4O55A 1D5AA 2HNZA 2RKIA 2E6LA 1VSLA 1QQCA 3LP3A 4CE9A 3KLEA 3KKRA 4DFJA 1ZBIA 4DSKA 3E01A 3V81A 3TARA 4DSIA 1X9MA 1UOCA 3KLHA 3M8RA 5HBMA 3OYJA 3SQ4A 2OPQA 1NKBA 1YTUA 1RT1A 2F8TA 1C0TA 4LH5A 3LZIA 1RILA 4KV8A 3JSMA 1RBTA 1JLCA 3ZT1A 4AHSA 2D0CA 4CGFA 4DF4A 2YKNA 3U3GA 3HP6A 5KRSA 3MEEA 1KFSA 1TL3A 3DM2A 1S1VA 4RW9A 1A5VA 3T19A 5J1EA 1SUQA 4F2SA 2R7YA 4OKKA 2G8UA 1BGXT 2PY5A 4CEFA 1N5YA 1RTHA 2A1SA 4E7IA 1KCFA 2FBTA 4H8KA 3OYMA 4FLUA 2ZE2A 1Z26A 1DLOA 2OPRA 3DRRA 3DRPA 4N5SA 1CXUA 1BQNA 3NAEA 1RT6A 4FLXA 4BACA 1EP4A 1RTIA 3HVTA 3HPOA 1ZBLA 4DWIA 1X9SA 1RT2A 1D8YA 3HYFA 4HCBA 1S9GA 5KI6A 5T7BA 1JXEA 4OGCA 3QEXA 2I5JA 1RT5A 4TSXA 4FJLA 2O4GA 1IKWA 1HYZA 3OS0A 1X1PA 3M8PA 2KFNA 1DTQA 4L8RB 3ZSRA 4Z4HA 4FK4A 4M45A 5KTQA 3RR8A 3UIQA 3FFIA 3QEPA 3DLEA 1EETA 4GW6A 4CEQA 1WN7A 4CEBA 3QETA 2HHXA 4FJKA 3V9ZA 4KPYA 5J2PA 1IG9A 2WONA 5J2MA 3S9HA 4HUGA 4KHQA 1BCMA 4RG8A 4CIGA 3O3FA 3V9WA 1RTJA 2Z1HA 3VQ4A 1VRUA 3MAQA 4BE2A 4M3WA 1TGOA 3RR7A 3QIOA 1Q9XA 1WSEA 1JLFA 1KVCA 5K14A 2XRIA 4FVMA 2VG5A 1CZ9A 4BWJA 4YFUA 4DSEA 2PYJA 1ZBHA 2P1JA 1HNIA 3LP1A 3CG7A 3L3VA 3KK2A 4CEZA 3L2RA 4JS4A 3NGZA 5EU7A 4ZHRA 3VQ5A 5HLFA 1EKEA 1RCHA 4FM2A 3VQPA 3PX6A 3V6DA 3OJUA 3L8BA 3B6OA 4N41A 2P51A 2YHBA 3VQAA 4O0IA 4DTUA 3LWMA 2B5JA 2Z1JA 1K6YA 2DFFA 4E7JA 3EY1A 4DTMA 4B9SA 1S9EA 2FBXA 2DFEA 1UA1A 4FK0A 1IO2A 4CGGA 1IKYA 4PWDA 3ASMA 3KD5E 3V1QA 4B8CA 4AILC 1WAFA 3VA0A 5SZTA 1TK5A 4DQPA 4ZTJA 4K8ZA 3VA3A 2KFZA 4QOZB 3NFAA 4DS5A 3M8QA 3QEWA 4W5TA 1L3TA 3NF9A 1XC9A 4B9TA 4CJQA 4JS5A 3BGRA 5FROA 5C42A 4DTRA 3K5OA 3SUOA 2HB5A 3KKSA 4OJRA 5SWMA 1SL2A 4F3TA 1LWCA 4ELVA 4J2EA 2G8VA 3LPTA 4B8AB 4N47A 4CHQA 3L3UA 1BI4B 5CYQA 3ZT4A 4FCYA 4BDZA 4CIEA 2P5GA 1XHXA 1WNSA 4HUEA 1LW0A 4JRPA 1CZBA 2HHQA 3TAEA 1ZBUA 2AJQA 1Q8IA 3RRHA 1B9FA 1WSGA 4AHVA 4DSLA 3QEIA 2YHAA 3LZJA 2HHVA 3QO9A 4B9LA 4Y1DA 4N56A 1TVRA 5DK5A 1QHTA 4N76A 4AHTA 4CHOA 2G8KA 1KLMA 3TI0A 4CEAA 3IG1A 1ASWA 4LSLA 5JS1A 3PX4A 3KD1E 4KFBA 4CERA 2X74A 4DTXA 4FJMA 4FJ7A 3NH1A 1BIUA 4CJVA 3OYNA 3HXMA 4E89A 4BE1A 3AVHA 3OY9A 3SQ1A 1VSEA 3TAQA 4DSJA 3CFRA 1WAJA 5CY4A 4W5QA 1JXBA 2JGUA 4CHPA 3LDSA 4HUFA 3K5NA 4DLGA 2G8WA 4M3UA 1UAXA 2BANA 1LV5A 3KLGA 1RBSA 1VK0A 4MFBA 3HVRA 4CJKA 2OYQA 3TAGA 3SUQA 1SKWA 2KW4A 3JYTA 1NK4A 5C24A 3ZT2A 3TR8A 4NYFA 1T7PA 1WSJA 1RDBA 5DMRA 4DTSA 2ATQA 2OPSA 3IRXA 4JLHA 3WNHA 4CHZA 3ZSXA 3PX0A 1W0HA 4FJGA 4OPKA 3AVAA 4FLVA 3MXMA 2QK9A 2VWKA 3C95A 1U45A 3KK1A 1QSSA 2FC0A 1FXXA 4KB1A 2HVHA 3L2QA 3ZSYA 3S3NA 1A5XA 4OKEA 3KLFA 1SV5A 1QSLA 1NK8A 1VSJA 4DSFA 1HQEA 2HHTA 2LSNA 3NGYA
chains in the Genus database with same CATH superfamily
4J2BA 4J2AA 4EZ6A 3JXUA 1XNQK 5ELZA 4CGIA 3I0RA 1NGAA 4CJLA 1RDDA 1SKRA 4M7XA 5F0XA 3EKUA 1QHAA 1S6PA 3OYKA 3L2VA 1NJZA 1KQSM 4ISEA 2O8FB 3DJCA 3MN9A 2FSNA 4KO0A 4H5TA 2V7YA 4O44A 1X9WA 3TU5A 2B4JA 1QS4A 4DQIA 2RPIA 4O5FA 2VG7A 3LP2A 1ZC6A 1VQLN 3WXLA 2KLAA 3NCIA 3OYHA 2OA8A 3I8BA 4CF8A 2HNYA 2ZJPL 3K0SA 1P90A 1RBUA 3O9QA 4B9NA 5EXWA 4M3RA 3VF6A 3TABA 3QIPA 4H03B 2E6MA 1C1CA 2FBVA 5BPMA 4CJ5A 4FPAA 3F9KA 1OH5A 4CESA 1EWQA 2QXLA 1U49A 5AQIA 3H3NO 4DFKA 1S1XA 3QFUA 3ID6A 3C94A 4DTNA 3UKRB 4X66K 1WLJA 4FK2A 3HRGA 1NOYA 4WCEL 1QSYA 4YOVA 1J6ZA 1YHQN 3VQBA 1O1WA 1IKVA 1BU6O 2HHWA 1J9AA 2NRXA 3VQCA 4FLYA 4GV9A 3W3DA 1D4XA 4CFBA 3F2KA 4K41A 5C12A 4H5RA 4O8UA 5I9EB 1NK6A 2RE2A 3NE6A 3R3LA 4RW7A 5FPNA 3CFPA 4CI6A 4CFDA 1NM1A 2HMPA 2QWMA 3G0ZA 3O3GA 3CCQN 3DOKA 3KZBA 4DU4A 1HRHA 4DCHA 5BR9A 1Z6RA 2QKKA 3PY8A 2BUPA 1NJYA 1BDGA 2F96A 3AVIA 4FJXA 2A3ZA 4DV6K 4DV1K 5M1OA 3GG4A 4FLWA 3C6TA 2Q97A 3PUFA 1DT9A 3RSEA 3NVKA 2ITGA 4CJWA 1NG9A 3MXIA 5I3UA 4WYBA 3SAHA 1RTDA 2IDOA 2QWRA 1TYQA 4ILHA 3KWGA 1EWRA 3LP0A 4JKAA 1TKTA 4FOIA 1LWEA 3WNEA 1S72N 2YV0X 4DR6K 3AVJA 4YOXA 2F7TA 2ZGYA 1RT7A 4FJ9A 4CVNE 1RT4A 1NNEA 1VHXA 3M1FA 4FWPA 4DQSA 4E19A 3CM5A 1OH6A 1XMQK 1BIZA 3ITHA 4DQQA 2D4WA 5KGWA 1ASUA 1YXQA 4JN4A 3C7NB 4UQGA 4A2BA 1I3AA 1SL1A 3CD6N 4DG1A 2UXDK 3HK2A 2HHUA 1T6CA 5LL6Z 4CHNA 4MLHA 4FPBA 4BY9C 3OYAA 3IMXA 3SJJA 1ESVA 5M1KA 1ITGA 4FWOA 3TSPA 1VQ7N 3AO3A 5BREA 5JICA 1EXQA 5GINA 3ATVA 1KFDA 3SCXA 1BQMA 3C65A 3N4PA 1D9FA 1VQ5N 4CEOA 1RBVA 3DLLL 4I6MB 1QTMA 4NCAA 1NKCA 3O5BA 2D0BA 2QI2A 2P9IB 2F4VK 3T69A 3NH2A 3ZSQA 4CFCA 2X78A 4MQ3A 3ULDA 3TTFA 1RDCA 2G8HA 4HTLA 1F21A 3D45A 3CMAN 3NF7A 2HBJA 1Q18A 2JWLA 3CIPA 4DF8A 1B92A 3E66A 1D9DA 4PHTX 5AQZA 4IG0A 3SV4A 2HVIA 2XY8A 3G71N 3AGKA 1N32K 2YNHA 3LWLA 2PAVA 1FJGK 2Q0RA 2P9KA 2D5RA 1T8EA 4BG9A 3VQ7A 5TKWA 3CJ7A 1S3XA 5HRNA 2FSJA 5BPLA 3ZT0A 2Q31A 4CF2A 4LH4A 3LDOA 4W5RA 2KHOA 3WNFA 1FK9A 4CJTA 5LMUK 4ISFA 2O8BB 4FL9A 1U48A 4H0XB 1Q7YO 4DFPA 1RDUA 2YNIA 1CLQA 1T03A 4BVOA 3AV9A 3AVNA 2QWQA 2GTDA 3EE8A 4E7HA 4Z4GA 5C0YA 2W42A 1VQON 1MA9B 3L2UA 3CC4N 1R0AA 1JKHA 4H0TB 3SUNA 4HHTA 3P83D 3BF3A 3EO3A 3VQ9A 4I2PA 4GV6A 3A2FA 3EL2A 4CJSA 3THXA 1LAVA 3O4NA 1Z25A 4H0YB 4PUOA 1HR0K 1A5WA 3PV8A 3OS2A 1Y97A 1MWKA 1H1VA 1NGBA 1ASVA 4CHYA 4HTUA 3TWHA 4EHUA 3QDKA 4FSVA 1FW6A 1HNVA 4O55A 2RKIA 2E6LA 1ZBIA 3BEXA 3EEQA 3E01A 4G9ZA 1UOCA 1YTUA 3OYJA 2F8TA 3VF4A 2P9NA 2UUCK 4FWNA 1RBTA 1JLCA 2E5LK 3ZT1A 5CHIA 2YKNA 3U3GA 2VWBA 4MDBA 3DM2A 4YOYA 5J1EA 4F2SA 3K9KA 4OKKA 2G8UA 1BGXT 2PY5A 4E7IA 2D1KA 2NZTA 1KCFA 2PBDA 1T44A 3DXMB 4FLUA 3DRRA 2IIRA 5DM6L 3M3ZA 1EP4A 1ZBLA 3HPOA 3A5OC 3HYFA 5AZJA 4OGCA 4H5NA 4TSXA 4FWKA 1RFQA 2O4GA 4JD2A 3M8PA 4A57A 3NMUA 3C7NA 4M45A 3UIQA 3QEPA 4NXMK 4GW6A 2V52B 3WUHA 4ILJA 2J4RA 3OW2M 4RWTA 3BZKA 4CIGA 3O3FA 1O13A 2Z1HA 3MAQA 1VRUA 4JKHA 1W7AA 4KHPK 1WSEA 1KVCA 5K14A 2XRIA 3L0QA 3A8YA 2O8DB 5C15A 4BWJA 1ZBHA 2PYJA 2P1JA 4BVPA 1WBBA 3O8MA 3L3VA 4CEZA 3L2RA 3VQ5A 1EKEA 3T1YK 3TSQA 3D2FB 4LFAK 3B6OA 3DWLA 5AQNA 4XEIA 3EKSA 4B9SA 1S9EA 2FBXA 4FK0A 4BGAA 1IKYA 3ASMA 4MO5A 5AJ3K 4AILC 3VGMA 3VA0A 4K8ZA 2UU9K 4F9OA 4QOZB 3NFAA 4JHDB 3M8QA 4QS9A 4DS5A 1SS6A 4W5TA 4B9TA 5FROA 3H1QA 5SWMA 1LWCA 4ELVA 2G8VA 4N47A 4FCYA 5CYQA 4MDAA 4CIEA 3BP8A 4IZ9A 1LW0A 1CZBA 3OTOK 2HHQA 3TAEA 1QZ6A 1KXPA 3EE9A 1OH8A 3ZYYX 2HHVA 1TUUA 5AQQA 4B9LA 4L3QA 4N76A 4IOAL 4IO8A 4QS8A 4CHOA 3ZX3A 4CEAA 3IG1A 3UE5A 1K9MO 4JI3K 4KFBA 4DTXA 1G99A 4MO4A 3DXKB 3TAQA 3AVHA 4IO9L 2JGUA 4DLGA 3K5NA 3WQUA 3QMLA 1OVYA 3I33A 1LV5A 1RBSA 4CJKA 3TAGA 4DV7K 3SUQA 1SKWA 1NK4A 3TR8A 1WSJA 4DTSA 3OBWA 2OPSA 3IRXA 1QVFM 5AQWA 4YOUA 1IV0A 2HF4A 3AAPA 1BG3A 2VWKA 1U45A 3KK1A 1QSSA 4OKEA 1NK8A 1HQEA 4CD1A 3THYB 3PO4A 2NNWA 4C8OA 2A41A 1Q9YA 3RMAA 3SQ0A 3I8DA 2YHWA 4CGDA 2XY6A 3L2WA 4GVMA 5KGXA 1Z05A 1TV6A 4CJPA 2OPPA 4Y1CA 1Y64A 4BR7A 4FWMA 5KQ8A 3DOLA 1TKXA 2E88A 3O9SA 4FJNA 4CEEA 2NLXA 2E1YA 5EOYA 3SNNA 3CQYA 3QINA 2HSTA 5DM7L 4FLZA 3AO1A 3IDHA 3TAFA 2B6AA 4CK3A 3DLBA 3P31A 3SV3A 2DTUA 4FZZA 1VQ6N 4FYDA 1TL1A 1YITN 4FJIA 3OS1A 2HW3A 3VOVA 3ZSZA 3MN7A 3HL8A 4ZTFA 1MDUB 3M8SA 4KTQA 2OZSA 4BR2A 3NBPA 4C1NK 2Z1IA 2YJFA 3OYCA 4BR5A 3WQTA 1REVA 4IWVA 1KLNA 3AARA 4BREA 3J7ZO 1NMDA 4H5WA 1RDAA 3HOTA 2QA4N 4EIAA 4WFBL 2YJEA 1DGKN 4KI4A 4JKFA 1KVAA 1VQ9N 2P9UA 4DQRA 5HRPA 3O9UA 1EX4A 1NK7A 1KVBA 4JKDA 2WBNA 1MU2A 3CCRN 1G15A 3T3FA 1C0GA 3AVGA 5HP1A 3TPQA 4I9LA 1QE1A 1YVNA 3U8XA 4O8KA 4WQ4C 3T7ZA 3KK3A 3KIOA 3RSEB 4CF1A 1JCGA 4FZYA 4OGEA 3AA5X 3PO5A 5FPEA 1VSMA 4XH1A 3OVNA 1BCOA 3DLRA 3MN5A 4B1ZA 3D6RA 4CZMA 1E3MA 4IJNA 1TYQB 3DXKA 4F8RA 2E2OA 4CZHA 4OLAA 3NVMA 2QWLA 4KKOA 2V51B 3MWTA 4FJ5A 1XWLA 1FKOA 1BISA 4ILGB 3U3YA 4JKBA 5HROA 2BDPA 4CF9A 4CK1A 4ELUA 3O3HA 5KQDA 1BWFO 1VSDA 5BN8A 4C8MA 3D2EB 5IWAK 5GAHP 1IKXA 2OTLN 2DFHA 1N6QA 2HHSA 3THYA 1W9HA 3OJSA 1E4FT 2CGLA 3C6AA 4EZ9A 3TTDA 3B6PA 4XH5A 4Q5VA 1YJNN 4Z0UA 4QAGA 3OA9A 3ULEA 4BRDA 2PZSA 1K8KA 3HP9A 4LFBK 2ETJA 4B9VA 3AVMA 1UA0A 4FO0A 1TKZA 4BC5A 5JLFA 1S1WA 3M6GA 1RBRA 3ALYA 1VSHA 1KRPA 3HJFA 5C25A 5FPDA 3S41A 1GOBA 2EWSA 3MMVA 4PL8A 3J8AA 4BQLA 3DRSA 1JL2A 3SBTA 2KQ2A 3MXJA 4JAXA 3SPYA 5FRNA 3O4QA 4B3SK 4OKJA 2KZMA 1ATNA 4YDUC 1ILYA 4H4OA 4B1UB 4C8KA 3THVA 3ZT3A 4DMNA 4AHUA 4FJ8A 3ZSOA 4B3RK 1KTQA 3Q7BA 3CHWA 2P9KB 1XI1A 3QBXA 4JI4K 4KHYA 3NGIA 2ASOA 2Y1JA 4CZFA 2G8IA 5MLCQ 5F1XA 5LJVA 1WSFA 4JI6K 1M90O 1JL1A 1NWKA 3ZCMA 1GLCG 5CZ1A 3S3OA 1RGIA 3U6FA 4FJJA 4H0PA 2IAJA 3A5MC 4A5AA 4DV2K 4IEIA 1LCUA 5CYMA 1HJOA 4RW6A 4DTJA 1JLAA 1VQKN 1NK0A 1GLEG 4M3YA 1QQMA 3AGRA 1YT3A 4J8FA 1L3UA 4Z4CA 4CFAA 1U04A 3THXB 2P9SA 3SAGA 3RWUA 3AO2A 3KWIA 2OCEA 3U9DA 4KH6A 4A5BA 1NGEA 4AQYK 3CJCA 2VCPA 3R1XA 1U6ZA 4CECA 2RF2A 4BC2A 1ZBFA 2VQFK 2P9PA 2HNDA 2W6LA 2QWOA 4JI8K 2P9NB 3KHYA 4M3TA 4DU3A 1GLFO 2HNZA 4DFJA 5EY4A 1VSLA 1QQCA 3VESA 3ZETA 3MN6A 4BRIA 3V81A 3TARA 5H1SQ 3DAWA 1NKBA 1RT1A 1I94K 3LZIA 5AZJB 3M5RA 4DF4A 2VGNA 4CD3A 1A5VA 4LF7K 4JD2B 3IUCA 4CEFA 3J80O 1RTHA 3D2EA 2HBKA 3OYMA 2ZE2A 3UB5A 1CXUA 1BQNA 2PFUA 3BZCA 5T7BA 4Y0WA 3QEXA 1RT5A 2IVNA 3H6EA 3FZMA 5AQVA 1IKWA 3OS0A 3O08A 3CQXA 1Q82O 4JI7K 1OKJA 4Z4HA 1EETA 3SJHA 2BH1A 3PSIA 4BRAA 3QETA 3V9ZA 4H0VB 2WONA 4KHQA 4HUGA 3V9WA 3OBYA 4B3MK 1TGOA 1Q9XA 1HNWK 2QW9A 1CZ9A 3QICA 4YFUA 5F2RA 2UXCK 3LP1A 3KK2A 5EU7A 5HLFA 4FM2A 3PX6A 3OJUA 4O0IA 3VERA 1X3MA 4CBWA 3O80A 2FSKA 3EY1A 3E9PA 4CGGA 3KD5E 4LF5K 2KFZA 4ZTJA 4BROA 4BRKA 3VA3A 3QEWA 3MCPA 1T6DA 4E1JA 1YJWN 1L3TA 4JK8A 1XC9A 1GLDG 1VQPN 3QB0A 4CJQA 4JS5A 5KPRA 3K5OA 2HB5A 3KKSA 5BPNA 3LPTA 1BI4B 1V4SA 3VPZA 5A2QO 4BDZA 2P5GA 3VGKA 3GBTA 1WNSA 4M63C 4BR9A 2QWNA 3CCJN 3L6QA 3RRHA 3CXCM 3QEIA 2RHKA 4DUYK 4K43A 4N56A 1S22A 5DK5A 4GKJK 1KLMA 2YI1A 3PX4A 3KD1E 1HLUA 1ATSA 4CERA 4DR2K 4FJMA 3NH1A 1BIUA 4CJVA 4LF6K 3O6WA 4E89A 3CFRA 5CY4A 4W5QA 4CHPA 3CCUN 1IBKK 2HOEA 4BR0A 4BRPA 1W2BM 3HVRA 1EO1A 2KW4A 1NGHA 4X62K 5C2DA 5C24A 5DMRA 1RDBA 4FOEA 2I7PA 3PX0A 1W0HA 4OPKA 3AVAA 4FLVA 2Q2RA 2E2PA 3RVCA 2E2QA 3L2QA 4YOTA 1SV5A 1QSLA 3CJBA 1ZXOA 1VSJA 2HHTA 4WQ5A 2LSNA 2O8EA 4JK9A 3OYFA 2KZZA 3VQEA 3JAMO 3VQ6A 1DKGD 4C23A 4CGHA 3SUPA 5ADXH 3CCVN 4IFEA 3HBTA 5CZ2A 1Q81O 2VG6A 5LJWA 4ID5A 1LWFA 4E1NA 2F8SA 2FF3B 4E7KA 4B9QA 3C0BA 3VF2A 3PLAA 4WFAL 4K0KK 2PYLA 3QLHA 4DR7K 1DTTA 4PQUA 3CPEA 3VEZA 2A1RA 1NJIO 4R5PA 3NF8A 2AA4A 1L5UA 4FJHA 3CI5A 3GDQA 2ZJQL 3W0LA 1NBWA 4KHUA 3GL1A 1VSFA 4F3OA 4I2QA 4CZLA 2UYTA 2A5XA 1NOZA 3H08A 1HJRA 1RNHA 3SK3A 5AQFA 3AVBA 5GAGP 4FM0A 1KAXA 4G1QA 1FKPA 5M1QA 4H0OA 4U7BA 3UKUA 4E0DA 1NMNA 2WC9A 2P9UB 4IXCA 4KHNA 5D3GA 3DLGA 4FWSA 5AQSA 3I55N 1XHZA 1XMOK 3MX2A 4CIFA 1KD1O 4A62A 4DKWA 3E9LA 2ITMA 1TUYA 1M1KO 1YIJN 1BUPA 3BDPA 4Z4IA 3QNNA 1WOQA 3AA4A 4MLEA 2ASPA 3LAKA 4B08A 3EYZA 4BDPA 3CCSN 1X3NA 1C6VA 3V1OA 3B8AX 2EHGA 1NLVA 3HM9A 1BI4A 1I39A 4Z94A 4FW2A 4DFMA 3LL3A 1NJWA 1NGJA 2QWPA 3JS6A 1TK8A 3AA3A 3QERA 1VSKA 4BWMA 4DUZK 3IS9A 2QTDA 3CJAA 4B1YB 3K5LA 4QCLA 3H46O 4PKGA 4BRGA 3HPGA 1QQOA 3AO5A 1HMVA 4OPAA 1J53A 4KRFA 1HKCA 3E1YA 3SQ2A 2W40A 3SI6A 1YVUA 2GBZA 1VQ8N 4RW8A 5KPTA 1L3SA 3U4LA 1U4BA 2YCHA 1X9JA 4B9UA 1HYVA 3N4QA 3NDKA 3O9TA 5AR0A 3HO1A 4IJAA 5AQXA 3CQ8A 2JLEA 1GOAA 4F4KA 4JI0K 4CF0A 1GLAG 3FZHA 3MWPA 3ULEB 1K8KB 3K5MA 4DR1K 3TSUA 1S5JA 5B8HA 1VRTA 5AQHA 2XY7A 4ID1A 1EQYA 2NRRA 2UUAK 4IKFA 3R9PA 5FDLA 5JVHL 1NK5A 3VEVA 2IVOA 4BE0A 1TKDA 2IGIA 2H3GX 3OYIA 3VQ8A 4CJRA 1S6QA 1NJXA 4B3TK 4K42A 3AY9A 2G8FA 2Z1GA 1HQUA 1HNZK 3O1WA 1N34K 4CJ4A 5AQRA 3J7AP 3VEYA 2QXFA 3P39A 2XY5A 2F9TA 1E4GT 1IJJA 4JYAK 1T05A 3BF1A 3NHGA 4KH5A 4CGJA 2HF3A 3H45C 4KTZA 3CF5L 4CJ3A 3RTVA 3MK6A 4IG3A 3OYLA 3O9RA 2XHBA 3BUZB 3CCLN 1YUWA 4CJUA 4DV0K 3CM6A 1RDWX 3KTQA 2DY4A 1BO5O 2RN2A 3VQDA 3QNOA 1HPMA 2ZD1A 4IDKA 5AQTA 2KTQA 3K9JA 3RMCA 4X65K 4RTFD 1ZBSA 3TTCA 4CJ7A 4E7LA 5C2FA 3DLHA 4I9QA 3DLKA 1C0UA 3P1GA 3OYBA 3CCEN 3K2PA 1TAUA 3WXMB 3CERA 2O4IA 5AQPA 3MECA 4YNQA 2P9SB 3PIOL 3IFRA 2FBYA 4BRMA 5HRRA 4CJEA 1NK9A 4ELTA 4JKGA 1S1TA 1C1BA 4H5VA 5GIOA 3AVCA 1U47A 4NB4A 3CFOA 1JCFA 2P5OA 3HOSA 2IOCA 5GADP 4GV3A 2GUPA 2P9PB 3T1AA 5M1NA 3PIPL 1WSHA 3CJ9A 1Q86O 3VTIA 4C8LA 1NGFA 4YY3K 1BHLA 5AZIA 2YNGA 3OYDA 4X64K 1WSIA 4YOWA 3U9ZA 4BRNA 3ZETB 4KAZA 4R79A 4Q0BA 4IBNA 4DR4K 2IC3A 2O8CA 1BA0A 3CC7N 2YHXA 1IG8A 3ENBA 5AQOA 4FM1A 1JLGA 5AQYA 3GOIA 3LANA 3G6EN 3P5JA 4C1NI 2YKMA 1SL0A 2Q36A 4LC9B 3SBGA 2CH6A 5ADXA 4JI1K 2HHHK 4DSIA 1X9MA 3KLHA 3WEEB 3M8RA 5HBMA 2OPQA 4LH5A 2A42A 1RILA 3LDNA 4AHSA 4CGFA 5M1FA 5KRSA 3VMFB 4RW9A 1SUQA 2R7YA 4BR4A 1N5YA 4JKEA 2A1SA 1XC3A 1NGIA 2FBTA 1Z26A 4FLXA 4OX9K 3HVTA 1D8YA 4HCBA 5KI6A 1JXEA 2I5JA 2NRVA 3MX5A 1VQ4N 1N8RO 2KFNA 3EZWA 3FFIA 3DLEA 4BGBA 4EAHD 4CEBA 2HHXA 1ATRA 2D0PA 2Q0UA 1IG9A 1BCMA 2GELA 3VQ4A 4M3WA 3P38A 3RR7A 3I56N 1JLFA 1K8AO 4FVMA 1MWMA 2P9LA 2VG5A 4DSEA 4PL7A 1DEJA 3CG7A 4JS4A 4A2AA 1QZ5A 5BRDA 3VQAA 2B5JA 4E7JA 2DFFA 4DTMA 1IO2A 3V1QA 1T3VA 1WAFA 2OANA 3VEOA 5SZTA 3KVGA 4DQPA 1QQNA 3NF9A 4DTRA 3LM2A 4F3TA 4J2EA 4CHQA 3ZT4A 3FZKA 4HUEA 4JRPA 3QFPA 5EX5A 1ZBUA 5AQJA 3ZX0A 2AJQA 1NGCA 1Q8IA 1B9FA 2WUSA 4DSLA 3LZJA 3QO9A 5JMVA 5JVGL 4AHTA 1SZ2A 4CZKA 2X74A 3CETA 4FJ7A 3OYNA 3SQ1A 1VSEA 4JI5K 1WAJA 3LDSA 4HUFA 2G8WA 3VTHA 1UAXA 3FLCO 5AFUH 2BANA 1K73O 2CH5A 4XH4A 3JYTA 3ZEUA 1QVGM 3CJ1A 2O8EB 1XQSC 3WNHA 4B1WB 4CHZA 3ZSXA 1HNXK 4FJGA 2QK9A 3C95A 2IVPA 2NRWA 2HVHA 2ZGZA 2HBMA 1A5XA 3KLFA 2DPNA 3A5LC 1N33K 4DSFA 3LDQA 3HT3A 5E26A 2Q1NA 3G10A 5J2NA 2FLOA 1U2VA 5HL7L 3A0IX 3WEEA 2VWJA 4IOCL 3ZSWA 2YNFA 4AH9A 1J5EK 4CZIA 1GLJO 4FW1A 3V9UA 2UXBK 3MCAB 3HTVA 4GNIA 3V4IA 3IAYA 1HKGA 5E84A 3DMJA 4XIUA 1IBLK 1JLBA 3IKMA 4OVLA 1KC8O 3L4IA 2W41A 5JLHA 4E3SA 3SPZA 3CYMA 3MEDA 5BRFA 1CXQA 4LY7A 3CMEN 4JKCA 4DLEA 2WFBA 3RRGA 1NGDA 1KAZA 4HWIA 2O8FA 5KRTA 2W6KA 4LF8K 4O0JA 1P8ZA 4CW7B 4Z4EA 3AO4A 4NYNA 3AVLA 4NCBA 1ZYQA 4C8NA 3UKUB 4EP4A 1WB9A 1S1UA 3HPHA 5J2QA 3DI6A 3HSCA 3ISNC 3FZLA 4NLCA 1UWBA 1TK0A 3FZFA 3D0PA 1OH7A 1VSIA 1YJ9N 3KLIA 4E1MA 3AA2A 4EP5A 3NF6A 3VQQA 3CC2N 5EVZA 2IS3A 1SKSA 1C1AA 3K58A 4KTWA 5GIPA 1BL3A 4W5NA 4W5OA 1LW2A 1NKEA 3HSTB 1JLQA 1TAQA 2ZF5O 2OZMA 3WT0A 1XUPO 2OTJN 1IH7A 3AVFA 4CEDA 4GMJB 3H3OB 3MDQA 1HKBA 2D0OA 2HMIA 4PKIA 3UKRA 4KREA 4IOXA 3OYEA 3AAQA 3EZ5A 3SMSA 2E4LA 4KB0A 1LAWA 2V7ZA 5AQGA 1J5OA 4DB3A 4M41A 4U67L 5FRMA 4DS4A 4CJFA 4DV5K 3HI0A 4IFVA 3K59A 1C0FA 4B3OA 1VQNN 1JLEA 3VEXA 2VGMA 4DTPA 4LF9K 1GLBG 3ENOA 3RMBA 2D0AA 5BR8K 4NCGA 4OPJA 1HYSA 3S3MA 3VEWA 3ENHA 1GOCA 3VENA 2YHYA 4B9MA 3LPUA 4IFYA 1SAZA 5CE3A 4M3ZA 4A59A 2AP1A 3OYGA 3V9SA 4GY2B 1SQKA 4UY8O 2KKZA 4K8XA 2VYPA 3WNGA 2WTUA 4OLBA 2BE2A 2JWKA 3D7EO 4NO7A 4CZEA 4F2RA 5TKYA 4GKKK 3C6HA 1JJ2M 3Q7CA 4CZJA 2FF6A 4OPHA 4CK2A 4FWQA 3HZ6A 5HRSA 2HBLA 4KI6A 3F5TA 4FLTA 2UUBK 4LD0A 5JS2A 4JI2K 1CZAN 3SMPA 4FWRA 3T1HK 4AHCA 3AVKA 3SYZA 3ATUA 2E2NA 3F73A 2A6AA 5I42A 1YTAA 4LF4K 4HVJA 4YORA 1IBMK 4BRLA 5HOOA 5AQLA 1HPZA 4BRQA 3QEVA 4NXNK 4FWLA 4PA1A 4BG8A 4BC4A 3TAPA 2VQEK 3NH0A 3LDPA 2A40A 2E8AA 1J54A 4WQ4A 4H4MA 4O4GA 3V1RA 3MEGA 4HCCA 4JRQA 2GV9A 2E1ZA 5M1PA 4DU1A 3RMDA 4EHTA 3R6MA 4PY5A 3VGLA 5LMNK 3VN5A 3ID8A 2NRZA 4I6MA 4WE1A 3V9XA 2Y1IA 5LY3A 4LFCK 1OVQA 4FZXC 2P9IA 4RW4A 1WUAA 3TAMA 3I0SA 3LALA 4BRHA 4JKGB 2E20A 2EX3A 3SZ2A 2BTFA 3QBWA 2QKBA 2NUBA 4CZGA 2X6SA 4Z4FA 3ZLJA 4I7FA 4ISGA 4AF1A 4M7YA 2WOMA 4NLBA 2BGGA 2Q3SA 4IEEA 2ZQBA 5E41A 2XO7A 4BDYA 3SLCA 4B1XB 4DV4K 3KJVA 1L3VA 2X6NA 4AHRA 3TANA 3K57A 4LSNA 1KSPA 4M42A 4FXDA 4DTOA 4ICLA 5AZIB 1LOTB 1BA1A 4DHYA 3ZSVA 4BQZA 1C0MA 5AFUA 4BRCA 2O8CB 1VAZA 3DYAA 2O8BA 2GUIA 4O5BA 5AQKA 3LAMA 1RT3A 2QM1A 3C6UA 4J2DA 4K25A 4YHHK 1HUXA 2GEMA 3KK7A 3QESA 4M3XA 4KHSA 3THWB 1B9DA 2CGKA 4YDUA 1N36K 5GAEP 4CE9A 1D5AA 3KLEA 3LP3A 3KKRA 3E9OA 4DSKA 3L4QA 3SQ4A 3FGUA 2F9WA 3HM8A 1C0TA 4RCHA 4DR5K 1W97L 2I7NA 4KV8A 3JSMA 4KH4A 2D0CA 3HP6A 1KAYA 3MEEA 1KFSA 1TL3A 1S1VA 3T19A 4AM7A 1NU0A 4JEPA 3WXKA 4H8KA 1YF5L 1JCEA 3DRPA 1DLOA 2OPRA 3NAEA 4CCHA 4N5SA 4KHWA 1RT6A 4PKHA 3WXJA 2ZM6K 1RTIA 4BACA 4DWIA 1X9SA 1NGGA 1RT2A 3FR0A 1S9GA 4KBOA 4WFNL 1WBDA 1GLLO 3R8EA 4A61A 4FJLA 2ASMA 2ZWHA 1HYZA 1X1PA 1DTQA 4L8RB 3ZSRA 2P9LB 3G25A 5KTQA 3RR8A 4FK4A 4CEQA 3DXMA 1WN7A 3LM9A 5FLXO 4FJKA 4KPYA 1XNRK 5J2PA 5J2MA 2YX6A 3S9HA 4RG8A 2ZJRL 3PSFA 3J81O 1RTJA 4BE2A 5KPZA 5BRHA 3QIOA 3GE1A 4WF9L 4V19S 4JK7A 1HNIA 5CR4A 3NGZA 4FVUA 3WXIA 4ZHRA 4IDHA 4QS7A 4BC3A 3BY5A 1RCHA 2GX9A 4CBUA 3VQPA 3V6DA 3L8BA 1VQMN 4WQ5C 4N41A 2P51A 2YHBA 4DR3K 4DTUA 3LWMA 2Z1JA 1K6YA 2O8DA 1UA1A 2DFEA 4EFHA 4PWDA 2FXUA 4B8CA 4AM6A 1TK5A 3D2FA 4B1VA 3A5NC 3P4IA 5FPMA 3BGRA 3LDLA 3VETA 5C42A 3SUOA 1SL2A 4OJRA 4DV3K 4B8AB 3L3UA 3SAFA 1XHXA 5IT9O 3EN9A 1HX1A 5C10A 1YI2N 4JHDA 1WSGA 4AHVA 5BN9A 2YHAA 4Y1DA 2CGJA 1TVRA 1QHTA 2G8KA 3TI0A 3FFKB 1ASWA 4LSLA 3ZEUB 5JS1A 4BRFA 3HXMA 4BE1A 4DSJA 3OY9A 5AQUA 1JXBA 4M3UA 3J7YP 3O1BA 3ZX2A 3KLGA 1VK0A 4MFBA 4CBXA 2OYQA 1YAGA 4JV5K 5AQMA 3ZT2A 1BOTO 4NYFA 1T7PA 2ATQA 3OHRA 4JLHA 1V4TA 3H1VX 1R59O 4OO1J 3MXMA 1U2VB 4JNEA 3F9MA 3THWA 2GWKA 4GVEA 2FC0A 1FXXA 2NRHA 3CCMN 4KB1A 3FE1A 3O4WA 3ZSYA 3S3NA 3CPWM 2GWJA 4DQ8A 3G4SN 2QEXN 3NGYA 2NRTA
chains in the Genus database with same CATH topology
3HT3A 3PO4A 3OYFA 2KZZA 4J2BA 3VQEA 3G10A 4J2AA 4C8OA 1Q9YA 3RMAA 3VQ6A 3SQ0A 3I8DA 5J2NA 4EZ6A 4CGDA 4CGIA 3I0RA 4CJLA 3L2WA 2XY6A 4GVMA 2VWJA 5KGXA 1RDDA 4CGHA 3SUPA 3ZSWA 2YNFA 4AH9A 1SKRA 1TV6A 1S6PA 4CJPA 3OYKA 4FW1A 2OPPA 3L2VA 3V9UA 4Y1CA 1NJZA 5CZ2A 3DOLA 1TKXA 2VG6A 4ID5A 3V4IA 3IAYA 4KO0A 1LWFA 4E1NA 3DMJA 4O44A 2F8SA 1X9WA 4XIUA 2B4JA 1QS4A 4E7KA 4DQIA 4FJNA 1JLBA 2RPIA 4CEEA 4OVLA 2VG7A 3LP2A 4E3SA 2PYLA 3SNNA 3SPZA 3QINA 3QLHA 3CYMA 1DTTA 3MEDA 1CXQA 4LY7A 4PQUA 4FLZA 3NCIA 3AO1A 3OYHA 3TAFA 4DLEA 2A1RA 2B6AA 2OA8A 3RRGA 4R5PA 3NF8A 4CK3A 3DLBA 1L5UA 5KRTA 3SV3A 4CF8A 4O0JA 4FJHA 2DTUA 4FZZA 2HNYA 4Z4EA 4FYDA 1TL1A 3AO4A 4NYNA 3AVLA 1RBUA 4FJIA 4B9NA 3OS1A 2HW3A 4M3RA 3TABA 3ZSZA 4NCBA 3QIPA 1ZYQA 4C8NA 4EP4A 3HL8A 2E6MA 1C1CA 2FBVA 1S1UA 4ZTFA 4CJ5A 4KHUA 3M8SA 3HPHA 1VSFA 5J2QA 3DI6A 3F9KA 3ISNC 4I2QA 4F3OA 4KTQA 2OZSA 4CESA 3NBPA 1UWBA 2Z1IA 1U49A 1TK0A 1NOZA 3D0PA 3H08A 3OYCA 1HJRA 1RNHA 4DFKA 3AVBA 1S1XA 1VSIA 4FM0A 4G1QA 1FKPA 1REVA 3KLIA 3AA2A 4E1MA 4EP5A 3C94A 1KLNA 3NF6A 3VQQA 4DTNA 2IS3A 1SKSA 1C1AA 1WLJA 3K58A 4E0DA 4FK2A 4KTWA 4KHNA 5D3GA 4W5NA 1BL3A 3DLGA 4W5OA 1LW2A 1NOYA 1NKEA 1XHZA 1QSYA 3HSTB 1JLQA 4CIFA 1TAQA 3VQBA 1O1WA 2OZMA 1RDAA 1IKVA 1IH7A 3AVFA 2HHWA 1J9AA 4CEDA 3VQCA 4GMJB 4FLYA 3BDPA 4Z4IA 3QNNA 2HMIA 4KI4A 4KREA 1KVAA 3AA4A 3OYEA 3EZ5A 4DQRA 4CFBA 2E4LA 5HRPA 3LAKA 4B08A 4KB0A 1LAWA 3EYZA 1NK6A 1EX4A 4BDPA 1J5OA 5FRMA 4M41A 3NE6A 4DS4A 1C6VA 3V1OA 4CJFA 1KVBA 1NK7A 4RW7A 1MU2A 2EHGA 4IFVA 3K59A 1G15A 3T3FA 4B3OA 3AVGA 3HM9A 1BI4A 1I39A 3CFPA 4CFDA 1JLEA 3O3GA 3G0ZA 4FW2A 4DTPA 4DFMA 5HP1A 3DOKA 4I9LA 1NJWA 1QE1A 3RMBA 4DU4A 2D0AA 1TK8A 3KK3A 1HRHA 3AA3A 4NCGA 4OPJA 3QERA 1VSKA 1HYSA 3S3MA 4BWMA 3KIOA 2QKKA 3IS9A 3PY8A 3K5LA 1GOCA 4CF1A 4QCLA 4FZYA 4OGEA 3AA5X 3PO5A 1NJYA 4B9MA 3LPUA 4IFYA 3HPGA 3AO5A 2F96A 1HMVA 3AVIA 1VSMA 4FJXA 1J53A 4M3ZA 4KRFA 3OYGA 3OVNA 1BCOA 3V9SA 3SQ2A 3DLRA 3SI6A 1YVUA 2GBZA 4K8XA 4RW8A 1L3SA 4FLWA 3C6TA 4F8RA 3WNGA 4OLBA 2BE2A 3PUFA 1U4BA 2ITGA 1HYVA 4B9UA 4OLAA 4CJWA 3MXIA 4KKOA 3NDKA 4FJ5A 1XWLA 4F2RA 1FKOA 1BISA 5I3UA 3HO1A 3U3YA 1RTDA 2IDOA 3CQ8A 2JLEA 1GOAA 4F4KA 5HROA 4CF0A 4CF9A 3LP0A 4CK1A 2BDPA 1TKTA 4ELUA 3O3HA 1LWEA 3WNEA 1VSDA 2YV0X 4C8MA 3AVJA 3K5MA 4CK2A 1RT7A 1S5JA 4FJ9A 5HRSA 4KI6A 1IKXA 4FLTA 1VRTA 2XY7A 1RT4A 4ID1A 4LD0A 5JS2A 2DFHA 4DQSA 1N6QA 4E19A 4IKFA 2HHSA 3CM5A 1W9HA 3OJSA 1BIZA 3ITHA 4DQQA 4AHCA 4EZ9A 3B6PA 5FDLA 3AVKA 5KGWA 4Q5VA 3SYZA 4Z0UA 1ASUA 4QAGA 1NK5A 2PZSA 4UQGA 3F73A 4BE0A 5I42A 3HP9A 1YTAA 2IGIA 1TKDA 1I3AA 3VQ8A 3OYIA 2ETJA 4CJRA 1S6QA 1SL1A 4DG1A 1NJXA 3HK2A 4B9VA 3AVMA 2HHUA 4CHNA 4HVJA 2G8FA 2Z1GA 1UA0A 1HQUA 1TKZA 4CJ4A 3OYAA 1S1WA 1HPZA 3SJJA 1RBRA 2QXFA 3ALYA 1VSHA 2XY5A 1ITGA 1KRPA 3AO3A 5C25A 3HJFA 1T05A 3QEVA 1EXQA 1GOBA 1KFDA 3NHGA 4PA1A 4CGJA 3DRSA 1BQMA 3SCXA 3TAPA 1JL2A 2KQ2A 3MXJA 3NH0A 1D9FA 4KTZA 3SPYA 1J54A 1RBVA 4CEOA 1QTMA 4NCAA 5FRNA 3O4QA 4CJ3A 4OKJA 1NKCA 2KZMA 3RTVA 4H4MA 4O4GA 2D0BA 4IG3A 3V1RA 3MEGA 4HCCA 3OYLA 4JRQA 2GV9A 3NH2A 4H4OA 3ZSQA 4CFCA 2XHBA 4DU1A 3RMDA 3THVA 4C8KA 2X78A 4MQ3A 3ULDA 4PY5A 3ZT3A 4DMNA 4AHUA 1RDCA 3VN5A 4CJUA 3CM6A 2G8HA 4FJ8A 3ZSOA 3KTQA 1F21A 1KTQA 3D45A 2DY4A 1XI1A 3NF7A 4WE1A 4KHYA 3V9XA 2Y1IA 2RN2A 3VQDA 3NGIA 3QNOA 2Y1JA 4DF8A 2ZD1A 1B92A 4IDKA 1D9DA 2G8IA 2KTQA 4FZXC 3RMCA 4IG0A 4RW4A 1WSFA 3TAMA 3SV4A 3I0SA 2HVIA 3LALA 2XY8A 1JL1A 4E7LA 2EX3A 3ZCMA 3SZ2A 2YNHA 3LWLA 3DLHA 2QKBA 4I9QA 2NUBA 3DLKA 1C0UA 3P1GA 2X6SA 2D5RA 5CZ1A 3OYBA 3K2PA 3VQ7A 3S3OA 1T8EA 4Z4FA 1TAUA 4I7FA 3U6FA 2O4IA 4FJJA 3MECA 2IAJA 4YNQA 2WOMA 5HRNA 2BGGA 2Q3SA 5E41A 2ZQBA 2XO7A 4BDYA 1L3VA 3ZT0A 2FBYA 3KJVA 5CYMA 2X6NA 4CF2A 4AHRA 5HRRA 4LH4A 4CJEA 4W5RA 3TANA 4RW6A 3WNFA 4LSNA 3K57A 1FK9A 4CJTA 4DTJA 1NK9A 1S1TA 4ELTA 1C1BA 1KSPA 4M42A 4FXDA 1JLAA 1U48A 4DFPA 1NK0A 3AVCA 4M3YA 2YNIA 1U47A 4DTOA 4ICLA 1CLQA 1YT3A 3CFOA 1L3UA 1T03A 2P5OA 4Z4CA 3AV9A 4CFAA 3ZSVA 1U04A 3AVNA 2IOCA 1C0MA 4E7HA 4Z4GA 3RWUA 3AO2A 3T1AA 2W42A 1WSHA 3DYAA 3L2UA 2GUIA 4O5BA 1R0AA 1JKHA 4C8LA 3SUNA 4HHTA 3P83D 3VQ9A 1BHLA 4I2PA 2YNGA 3A2FA 3OYDA 1WSIA 4CECA 3LAMA 2RF2A 1RT3A 3C6UA 4J2DA 4CJSA 1LAVA 3O4NA 1Z25A 1ZBFA 4KAZA 4Q0BA 4IBNA 3QESA 2IC3A 4KHWA 4KHSA 4PUOA 4M3XA 1A5WA 4CCHA 2HNDA 3PV8A 1B9DA 3OS2A 4FM1A 1JLGA 1Y97A 4M3TA 3LANA 4DU3A 3P5JA 4CHYA 1ASVA 4HTUA 3TWHA 2YKMA 1SL0A 1HNVA 4O55A 1D5AA 2HNZA 2RKIA 2E6LA 1VSLA 1QQCA 3LP3A 4CE9A 3KLEA 3KKRA 4DFJA 1ZBIA 4DSKA 3E01A 3V81A 3TARA 4DSIA 1X9MA 1UOCA 3KLHA 3M8RA 5HBMA 3OYJA 3SQ4A 2OPQA 1NKBA 1YTUA 1RT1A 2F8TA 1C0TA 4LH5A 3LZIA 1RILA 4KV8A 3JSMA 1RBTA 1JLCA 3ZT1A 4AHSA 2D0CA 4CGFA 4DF4A 2YKNA 3U3GA 3HP6A 5KRSA 3MEEA 1KFSA 1TL3A 3DM2A 1S1VA 4RW9A 1A5VA 3T19A 5J1EA 1SUQA 4F2SA 2R7YA 4OKKA 2G8UA 1BGXT 2PY5A 4CEFA 1N5YA 1RTHA 2A1SA 4E7IA 1KCFA 2FBTA 4H8KA 3OYMA 4FLUA 2ZE2A 1Z26A 1DLOA 2OPRA 3DRRA 3DRPA 4N5SA 1CXUA 1BQNA 3NAEA 1RT6A 4FLXA 4BACA 1EP4A 1RTIA 3HVTA 3HPOA 1ZBLA 4DWIA 1X9SA 1RT2A 1D8YA 3HYFA 4HCBA 1S9GA 5KI6A 5T7BA 1JXEA 4OGCA 3QEXA 2I5JA 1RT5A 4TSXA 4FJLA 2O4GA 1IKWA 1HYZA 3OS0A 1X1PA 3M8PA 2KFNA 1DTQA 4L8RB 3ZSRA 4Z4HA 4FK4A 4M45A 5KTQA 3RR8A 3UIQA 3FFIA 3QEPA 3DLEA 1EETA 4GW6A 4CEQA 1WN7A 4CEBA 3QETA 2HHXA 4FJKA 3V9ZA 4KPYA 5J2PA 1IG9A 2WONA 5J2MA 3S9HA 4HUGA 4KHQA 1BCMA 4RG8A 4CIGA 3O3FA 3V9WA 1RTJA 2Z1HA 3VQ4A 1VRUA 3MAQA 4BE2A 4M3WA 1TGOA 3RR7A 3QIOA 1Q9XA 1WSEA 1JLFA 1KVCA 5K14A 2XRIA 4FVMA 2VG5A 1CZ9A 4BWJA 4YFUA 4DSEA 2PYJA 1ZBHA 2P1JA 1HNIA 3LP1A 3CG7A 3L3VA 3KK2A 4CEZA 3L2RA 4JS4A 3NGZA 5EU7A 4ZHRA 3VQ5A 5HLFA 1EKEA 1RCHA 4FM2A 3VQPA 3PX6A 3V6DA 3OJUA 3L8BA 3B6OA 4N41A 2P51A 2YHBA 3VQAA 4O0IA 4DTUA 3LWMA 2B5JA 2Z1JA 1K6YA 2DFFA 4E7JA 3EY1A 4DTMA 4B9SA 1S9EA 2FBXA 2DFEA 1UA1A 4FK0A 1IO2A 4CGGA 1IKYA 4PWDA 3ASMA 3KD5E 3V1QA 4B8CA 4AILC 1WAFA 3VA0A 5SZTA 1TK5A 4DQPA 4ZTJA 4K8ZA 3VA3A 2KFZA 4QOZB 3NFAA 4DS5A 3M8QA 3QEWA 4W5TA 1L3TA 3NF9A 1XC9A 4B9TA 4CJQA 4JS5A 3BGRA 5FROA 5C42A 4DTRA 3K5OA 3SUOA 2HB5A 3KKSA 4OJRA 5SWMA 1SL2A 4F3TA 1LWCA 4ELVA 4J2EA 2G8VA 3LPTA 4B8AB 4N47A 4CHQA 3L3UA 1BI4B 5CYQA 3ZT4A 4FCYA 4BDZA 4CIEA 2P5GA 1XHXA 1WNSA 4HUEA 1LW0A 4JRPA 1CZBA 2HHQA 3TAEA 1ZBUA 2AJQA 1Q8IA 3RRHA 1B9FA 1WSGA 4AHVA 4DSLA 3QEIA 2YHAA 3LZJA 2HHVA 3QO9A 4B9LA 4Y1DA 4N56A 1TVRA 5DK5A 1QHTA 4N76A 4AHTA 4CHOA 2G8KA 1KLMA 3TI0A 4CEAA 3IG1A 1ASWA 4LSLA 5JS1A 3PX4A 3KD1E 4KFBA 4CERA 2X74A 4DTXA 4FJMA 4FJ7A 3NH1A 1BIUA 4CJVA 3OYNA 3HXMA 4E89A 4BE1A 3AVHA 3OY9A 3SQ1A 1VSEA 3TAQA 4DSJA 3CFRA 1WAJA 5CY4A 4W5QA 1JXBA 2JGUA 4CHPA 3LDSA 4HUFA 3K5NA 4DLGA 2G8WA 4M3UA 1UAXA 2BANA 1LV5A 3KLGA 1RBSA 1VK0A 4MFBA 3HVRA 4CJKA 2OYQA 3TAGA 3SUQA 1SKWA 2KW4A 3JYTA 1NK4A 5C24A 3ZT2A 3TR8A 4NYFA 1T7PA 1WSJA 1RDBA 5DMRA 4DTSA 2ATQA 2OPSA 3IRXA 4JLHA 3WNHA 4CHZA 3ZSXA 3PX0A 1W0HA 4FJGA 4OPKA 3AVAA 4FLVA 3MXMA 2QK9A 2VWKA 3C95A 1U45A 3KK1A 1QSSA 2FC0A 1FXXA 4KB1A 2HVHA 3L2QA 3ZSYA 3S3NA 1A5XA 4OKEA 3KLFA 1SV5A 1QSLA 1NK8A 1VSJA 4DSFA 1HQEA 2HHTA 2LSNA 3NGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HT3 A;  3PO4 A;  3OYF A;  2KZZ A;  4J2B A;  3VQE A;  3G10 A;  4J2A A;  4C8O A;  1Q9Y A;  3RMA A;  3VQ6 A;  3SQ0 A;  3I8D A;  5J2N A;  4EZ6 A;  4CGD A;  4CGI A;  3I0R A;  4CJL A;  3L2W A;  2XY6 A;  4GVM A;  2VWJ A;  5KGX A;  1RDD A;  4CGH A;  3SUP A;  3ZSW A;  2YNF A;  4AH9 A;  1SKR A;  1TV6 A;  1S6P A;  4CJP A;  3OYK A;  4FW1 A;  2OPP A;  3L2V A;  3V9U A;  4Y1C A;  1NJZ A;  5CZ2 A;  3DOL A;  1TKX A;  2VG6 A;  4ID5 A;  3V4I A;  3IAY A;  4KO0 A;  1LWF A;  4E1N A;  3DMJ A;  4O44 A;  2F8S A;  1X9W A;  4XIU A;  2B4J A;  1QS4 A;  4E7K A;  4DQI A;  4FJN A;  1JLB A;  2RPI A;  4CEE A;  4OVL A;  2VG7 A;  3LP2 A;  4E3S A;  2PYL A;  3SNN A;  3SPZ A;  3QIN A;  3QLH A;  3CYM A;  1DTT A;  3MED A;  1CXQ A;  4LY7 A;  4PQU A;  4FLZ A;  3NCI A;  3AO1 A;  3OYH A;  3TAF A;  4DLE A;  2A1R A;  2B6A A;  2OA8 A;  3RRG A;  4R5P A;  3NF8 A;  4CK3 A;  3DLB A;  1L5U A;  5KRT A;  3SV3 A;  4CF8 A;  4O0J A;  4FJH A;  2DTU A;  4FZZ A;  2HNY A;  4Z4E A;  4FYD A;  1TL1 A;  3AO4 A;  4NYN A;  3AVL A;  1RBU A;  4FJI A;  4B9N A;  3OS1 A;  2HW3 A;  4M3R A;  3TAB A;  3ZSZ A;  4NCB A;  3QIP A;  1ZYQ A;  4C8N A;  4EP4 A;  3HL8 A;  2E6M A;  1C1C A;  2FBV A;  1S1U A;  4ZTF A;  4CJ5 A;  4KHU A;  3M8S A;  3HPH A;  1VSF A;  5J2Q A;  3DI6 A;  3F9K A;  3ISN C;  4I2Q A;  4F3O A;  4KTQ A;  2OZS A;  4CES A;  3NBP A;  1UWB A;  2Z1I A;  1U49 A;  1TK0 A;  1NOZ A;  3D0P A;  3H08 A;  3OYC A;  1HJR A;  1RNH A;  4DFK A;  3AVB A;  1S1X A;  1VSI A;  4FM0 A;  4G1Q A;  1FKP A;  1REV A;  3KLI A;  3AA2 A;  4E1M A;  4EP5 A;  3C94 A;  1KLN A;  3NF6 A;  3VQQ A;  4DTN A;  2IS3 A;  1SKS A;  1C1A A;  1WLJ A;  3K58 A;  4E0D A;  4FK2 A;  4KTW A;  4KHN A;  5D3G A;  4W5N A;  1BL3 A;  3DLG A;  4W5O A;  1LW2 A;  1NOY A;  1NKE A;  1XHZ A;  1QSY A;  3HST B;  1JLQ A;  4CIF A;  1TAQ A;  3VQB A;  1O1W A;  2OZM A;  1RDA A;  1IKV A;  1IH7 A;  3AVF A;  2HHW A;  1J9A A;  4CED A;  3VQC A;  4GMJ B;  4FLY A;  3BDP A;  4Z4I A;  3QNN A;  2HMI A;  4KI4 A;  4KRE A;  1KVA A;  3AA4 A;  3OYE A;  3EZ5 A;  4DQR A;  4CFB A;  2E4L A;  5HRP A;  3LAK A;  4B08 A;  4KB0 A;  1LAW A;  3EYZ A;  1NK6 A;  1EX4 A;  4BDP A;  1J5O A;  5FRM A;  4M41 A;  3NE6 A;  4DS4 A;  1C6V A;  3V1O A;  4CJF A;  1KVB A;  1NK7 A;  4RW7 A;  1MU2 A;  2EHG A;  4IFV A;  3K59 A;  1G15 A;  3T3F A;  4B3O A;  3AVG A;  3HM9 A;  1BI4 A;  1I39 A;  3CFP A;  4CFD A;  1JLE A;  3O3G A;  3G0Z A;  4FW2 A;  4DTP A;  4DFM A;  5HP1 A;  3DOK A;  4I9L A;  1NJW A;  1QE1 A;  3RMB A;  4DU4 A;  2D0A A;  1TK8 A;  3KK3 A;  1HRH A;  3AA3 A;  4NCG A;  4OPJ A;  3QER A;  1VSK A;  1HYS A;  3S3M A;  4BWM A;  3KIO A;  2QKK A;  3IS9 A;  3PY8 A;  3K5L A;  1GOC A;  4CF1 A;  4QCL A;  4FZY A;  4OGE A;  3AA5 X;  3PO5 A;  1NJY A;  4B9M A;  3LPU A;  4IFY A;  3HPG A;  3AO5 A;  2F96 A;  1HMV A;  3AVI A;  1VSM A;  4FJX A;  1J53 A;  4M3Z A;  4KRF A;  3OYG A;  3OVN A;  1BCO A;  3V9S A;  3SQ2 A;  3DLR A;  3SI6 A;  1YVU A;  2GBZ A;  4K8X A;  4RW8 A;  1L3S A;  4FLW A;  3C6T A;  4F8R A;  3WNG A;  4OLB A;  2BE2 A;  3PUF A;  1U4B A;  2ITG A;  1HYV A;  4B9U A;  4OLA A;  4CJW A;  3MXI A;  4KKO A;  3NDK A;  4FJ5 A;  1XWL A;  4F2R A;  1FKO A;  1BIS A;  5I3U A;  3HO1 A;  3U3Y A;  1RTD A;  2IDO A;  3CQ8 A;  2JLE A;  1GOA A;  4F4K A;  5HRO A;  4CF0 A;  4CF9 A;  3LP0 A;  4CK1 A;  2BDP A;  1TKT A;  4ELU A;  3O3H A;  1LWE A;  3WNE A;  1VSD A;  2YV0 X;  4C8M A;  3AVJ A;  3K5M A;  4CK2 A;  1RT7 A;  1S5J A;  4FJ9 A;  5HRS A;  4KI6 A;  1IKX A;  4FLT A;  1VRT A;  2XY7 A;  1RT4 A;  4ID1 A;  4LD0 A;  5JS2 A;  2DFH A;  4DQS A;  1N6Q A;  4E19 A;  4IKF A;  2HHS A;  3CM5 A;  1W9H A;  3OJS A;  1BIZ A;  3ITH A;  4DQQ A;  4AHC A;  4EZ9 A;  3B6P A;  5FDL A;  3AVK A;  5KGW A;  4Q5V A;  3SYZ A;  4Z0U A;  1ASU A;  4QAG A;  1NK5 A;  2PZS A;  4UQG A;  3F73 A;  4BE0 A;  5I42 A;  3HP9 A;  1YTA A;  2IGI A;  1TKD A;  1I3A A;  3VQ8 A;  3OYI A;  2ETJ A;  4CJR A;  1S6Q A;  1SL1 A;  4DG1 A;  1NJX A;  3HK2 A;  4B9V A;  3AVM A;  2HHU A;  4CHN A;  4HVJ A;  2G8F A;  2Z1G A;  1UA0 A;  1HQU A;  1TKZ A;  4CJ4 A;  3OYA A;  1S1W A;  1HPZ A;  3SJJ A;  1RBR A;  2QXF A;  3ALY A;  1VSH A;  2XY5 A;  1ITG A;  1KRP A;  3AO3 A;  5C25 A;  3HJF A;  1T05 A;  3QEV A;  1EXQ A;  1GOB A;  1KFD A;  3NHG A;  4PA1 A;  4CGJ A;  3DRS A;  1BQM A;  3SCX A;  3TAP A;  1JL2 A;  2KQ2 A;  3MXJ A;  3NH0 A;  1D9F A;  4KTZ A;  3SPY A;  1J54 A;  1RBV A;  4CEO A;  1QTM A;  4NCA A;  5FRN A;  3O4Q A;  4CJ3 A;  4OKJ A;  1NKC A;  2KZM A;  3RTV A;  4H4M A;  4O4G A;  2D0B A;  4IG3 A;  3V1R A;  3MEG A;  4HCC A;  3OYL A;  4JRQ A;  2GV9 A;  3NH2 A;  4H4O A;  3ZSQ A;  4CFC A;  2XHB A;  4DU1 A;  3RMD A;  3THV A;  4C8K A;  2X78 A;  4MQ3 A;  3ULD A;  4PY5 A;  3ZT3 A;  4DMN A;  4AHU A;  1RDC A;  3VN5 A;  4CJU A;  3CM6 A;  2G8H A;  4FJ8 A;  3ZSO A;  3KTQ A;  1F21 A;  1KTQ A;  3D45 A;  2DY4 A;  1XI1 A;  3NF7 A;  4WE1 A;  4KHY A;  3V9X A;  2Y1I A;  2RN2 A;  3VQD A;  3NGI A;  3QNO A;  2Y1J A;  4DF8 A;  2ZD1 A;  1B92 A;  4IDK A;  1D9D A;  2G8I A;  2KTQ A;  4FZX C;  3RMC A;  4IG0 A;  4RW4 A;  1WSF A;  3TAM A;  3SV4 A;  3I0S A;  2HVI A;  3LAL A;  2XY8 A;  1JL1 A;  4E7L A;  2EX3 A;  3ZCM A;  3SZ2 A;  2YNH A;  3LWL A;  3DLH A;  2QKB A;  4I9Q A;  2NUB A;  3DLK A;  1C0U A;  3P1G A;  2X6S A;  2D5R A;  5CZ1 A;  3OYB A;  3K2P A;  3VQ7 A;  3S3O A;  1T8E A;  4Z4F A;  1TAU A;  4I7F A;  3U6F A;  2O4I A;  4FJJ A;  3MEC A;  2IAJ A;  4YNQ A;  2WOM A;  5HRN A;  2BGG A;  2Q3S A;  5E41 A;  2ZQB A;  2XO7 A;  4BDY A;  1L3V A;  3ZT0 A;  2FBY A;  3KJV A;  5CYM A;  2X6N A;  4CF2 A;  4AHR A;  5HRR A;  4LH4 A;  4CJE A;  4W5R A;  3TAN A;  4RW6 A;  3WNF A;  4LSN A;  3K57 A;  1FK9 A;  4CJT A;  4DTJ A;  1NK9 A;  1S1T A;  4ELT A;  1C1B A;  1KSP A;  4M42 A;  4FXD A;  1JLA A;  1U48 A;  4DFP A;  1NK0 A;  3AVC A;  4M3Y A;  2YNI A;  1U47 A;  4DTO A;  4ICL A;  1CLQ A;  1YT3 A;  3CFO A;  1L3U A;  1T03 A;  2P5O A;  4Z4C A;  3AV9 A;  4CFA A;  3ZSV A;  1U04 A;  3AVN A;  2IOC A;  1C0M A;  4E7H A;  4Z4G A;  3RWU A;  3AO2 A;  3T1A A;  2W42 A;  1WSH A;  3DYA A;  3L2U A;  2GUI A;  4O5B A;  1R0A A;  1JKH A;  4C8L A;  3SUN A;  4HHT A;  3P83 D;  3VQ9 A;  1BHL A;  4I2P A;  2YNG A;  3A2F A;  3OYD A;  1WSI A;  4CEC A;  3LAM A;  2RF2 A;  1RT3 A;  3C6U A;  4J2D A;  4CJS A;  1LAV A;  3O4N A;  1Z25 A;  1ZBF A;  4KAZ A;  4Q0B A;  4IBN A;  3QES A;  2IC3 A;  4KHW A;  4KHS A;  4PUO A;  4M3X A;  1A5W A;  4CCH A;  2HND A;  3PV8 A;  1B9D A;  3OS2 A;  4FM1 A;  1JLG A;  1Y97 A;  4M3T A;  3LAN A;  4DU3 A;  3P5J A;  4CHY A;  1ASV A;  4HTU A;  3TWH A;  2YKM A;  1SL0 A;  1HNV A;  4O55 A;  1D5A A;  2HNZ A;  2RKI A;  2E6L A;  1VSL A;  1QQC A;  3LP3 A;  4CE9 A;  3KLE A;  3KKR A;  4DFJ A;  1ZBI A;  4DSK A;  3E01 A;  3V81 A;  3TAR A;  4DSI A;  1X9M A;  1UOC A;  3KLH A;  3M8R A;  5HBM A;  3OYJ A;  3SQ4 A;  2OPQ A;  1NKB A;  1YTU A;  1RT1 A;  2F8T A;  1C0T A;  4LH5 A;  3LZI A;  1RIL A;  4KV8 A;  3JSM A;  1RBT A;  1JLC A;  3ZT1 A;  4AHS A;  2D0C A;  4CGF A;  4DF4 A;  2YKN A;  3U3G A;  3HP6 A;  5KRS A;  3MEE A;  1KFS A;  1TL3 A;  3DM2 A;  1S1V A;  4RW9 A;  1A5V A;  3T19 A;  5J1E A;  1SUQ A;  4F2S A;  2R7Y A;  4OKK A;  2G8U A;  1BGX T;  2PY5 A;  4CEF A;  1N5Y A;  1RTH A;  2A1S A;  4E7I A;  1KCF A;  2FBT A;  4H8K A;  3OYM A;  4FLU A;  2ZE2 A;  1Z26 A;  1DLO A;  2OPR A;  3DRR A;  3DRP A;  4N5S A;  1CXU A;  1BQN A;  3NAE A;  1RT6 A;  4FLX A;  4BAC A;  1EP4 A;  1RTI A;  3HVT A;  3HPO A;  1ZBL A;  4DWI A;  1X9S A;  1RT2 A;  1D8Y A;  3HYF A;  4HCB A;  1S9G A;  5KI6 A;  5T7B A;  1JXE A;  4OGC A;  3QEX A;  2I5J A;  1RT5 A;  4TSX A;  4FJL A;  2O4G A;  1IKW A;  1HYZ A;  3OS0 A;  1X1P A;  3M8P A;  2KFN A;  1DTQ A;  4L8R B;  3ZSR A;  4Z4H A;  4FK4 A;  4M45 A;  5KTQ A;  3RR8 A;  3UIQ A;  3FFI A;  3QEP A;  3DLE A;  1EET A;  4GW6 A;  4CEQ A;  1WN7 A;  4CEB A;  3QET A;  2HHX A;  4FJK A;  3V9Z A;  4KPY A;  5J2P A;  1IG9 A;  2WON A;  5J2M A;  3S9H A;  4HUG A;  4KHQ A;  1BCM A;  4RG8 A;  4CIG A;  3O3F A;  3V9W A;  1RTJ A;  2Z1H A;  3VQ4 A;  1VRU A;  3MAQ A;  4BE2 A;  4M3W A;  1TGO A;  3RR7 A;  3QIO A;  1Q9X A;  1WSE A;  1JLF A;  1KVC A;  5K14 A;  2XRI A;  4FVM A;  2VG5 A;  1CZ9 A;  4BWJ A;  4YFU A;  4DSE A;  2PYJ A;  1ZBH A;  2P1J A;  1HNI A;  3LP1 A;  3CG7 A;  3L3V A;  3KK2 A;  4CEZ A;  3L2R A;  4JS4 A;  3NGZ A;  5EU7 A;  4ZHR A;  3VQ5 A;  5HLF A;  1EKE A;  1RCH A;  4FM2 A;  3VQP A;  3PX6 A;  3V6D A;  3OJU A;  3L8B A;  3B6O A;  4N41 A;  2P51 A;  2YHB A;  3VQA A;  4O0I A;  4DTU A;  3LWM A;  2B5J A;  2Z1J A;  1K6Y A;  2DFF A;  4E7J A;  3EY1 A;  4DTM A;  4B9S A;  1S9E A;  2FBX A;  2DFE A;  1UA1 A;  4FK0 A;  1IO2 A;  4CGG A;  1IKY A;  4PWD A;  3ASM A;  3KD5 E;  3V1Q A;  4B8C A;  4AIL C;  1WAF A;  3VA0 A;  5SZT A;  1TK5 A;  4DQP A;  4ZTJ A;  4K8Z A;  3VA3 A;  2KFZ A;  4QOZ B;  3NFA A;  4DS5 A;  3M8Q A;  3QEW A;  4W5T A;  1L3T A;  3NF9 A;  1XC9 A;  4B9T A;  4CJQ A;  4JS5 A;  3BGR A;  5FRO A;  5C42 A;  4DTR A;  3K5O A;  3SUO A;  2HB5 A;  3KKS A;  4OJR A;  5SWM A;  1SL2 A;  4F3T A;  1LWC A;  4ELV A;  4J2E A;  2G8V A;  3LPT A;  4B8A B;  4N47 A;  4CHQ A;  3L3U A;  1BI4 B;  5CYQ A;  3ZT4 A;  4FCY A;  4BDZ A;  4CIE A;  2P5G A;  1XHX A;  1WNS A;  4HUE A;  1LW0 A;  4JRP A;  1CZB A;  2HHQ A;  3TAE A;  1ZBU A;  2AJQ A;  1Q8I A;  3RRH A;  1B9F A;  1WSG A;  4AHV A;  4DSL A;  3QEI A;  2YHA A;  3LZJ A;  2HHV A;  3QO9 A;  4B9L A;  4Y1D A;  4N56 A;  1TVR A;  5DK5 A;  1QHT A;  4N76 A;  4AHT A;  4CHO A;  2G8K A;  1KLM A;  3TI0 A;  4CEA A;  3IG1 A;  1ASW A;  4LSL A;  5JS1 A;  3PX4 A;  3KD1 E;  4KFB A;  4CER A;  2X74 A;  4DTX A;  4FJM A;  4FJ7 A;  3NH1 A;  1BIU A;  4CJV A;  3OYN A;  3HXM A;  4E89 A;  4BE1 A;  3AVH A;  3OY9 A;  3SQ1 A;  1VSE A;  3TAQ A;  4DSJ A;  3CFR A;  1WAJ A;  5CY4 A;  4W5Q A;  1JXB A;  2JGU A;  4CHP A;  3LDS A;  4HUF A;  3K5N A;  4DLG A;  2G8W A;  4M3U A;  1UAX A;  2BAN A;  1LV5 A;  3KLG A;  1RBS A;  1VK0 A;  4MFB A;  3HVR A;  4CJK A;  2OYQ A;  3TAG A;  3SUQ A;  1SKW A;  2KW4 A;  3JYT A;  1NK4 A;  5C24 A;  3ZT2 A;  3TR8 A;  4NYF A;  1T7P A;  1WSJ A;  1RDB A;  5DMR A;  4DTS A;  2ATQ A;  2OPS A;  3IRX A;  4JLH A;  3WNH A;  4CHZ A;  3ZSX A;  3PX0 A;  1W0H A;  4FJG A;  4OPK A;  3AVA A;  4FLV A;  3MXM A;  2QK9 A;  2VWK A;  3C95 A;  1U45 A;  3KK1 A;  1QSS A;  2FC0 A;  1FXX A;  4KB1 A;  2HVH A;  3L2Q A;  3ZSY A;  3S3N A;  1A5X A;  4OKE A;  3KLF A;  1SV5 A;  1QSL A;  1NK8 A;  1VSJ A;  4DSF A;  1HQE A;  2HHT A;  2LSN A;  3NGY A; 
#chains in the Genus database with same CATH topology
 4J2B A;  4J2A A;  4EZ6 A;  3JXU A;  1XNQ K;  5ELZ A;  4CGI A;  3I0R A;  1NGA A;  4CJL A;  1RDD A;  1SKR A;  4M7X A;  5F0X A;  3EKU A;  1QHA A;  1S6P A;  3OYK A;  3L2V A;  1NJZ A;  1KQS M;  4ISE A;  2O8F B;  3DJC A;  3MN9 A;  2FSN A;  4KO0 A;  4H5T A;  2V7Y A;  4O44 A;  1X9W A;  3TU5 A;  2B4J A;  1QS4 A;  4DQI A;  2RPI A;  4O5F A;  2VG7 A;  3LP2 A;  1ZC6 A;  1VQL N;  3WXL A;  2KLA A;  3NCI A;  3OYH A;  2OA8 A;  3I8B A;  4CF8 A;  2HNY A;  2ZJP L;  3K0S A;  1P90 A;  1RBU A;  3O9Q A;  4B9N A;  5EXW A;  4M3R A;  3VF6 A;  3TAB A;  3QIP A;  4H03 B;  2E6M A;  1C1C A;  2FBV A;  5BPM A;  4CJ5 A;  4FPA A;  3F9K A;  1OH5 A;  4CES A;  1EWQ A;  2QXL A;  1U49 A;  5AQI A;  3H3N O;  4DFK A;  1S1X A;  3QFU A;  3ID6 A;  3C94 A;  4DTN A;  3UKR B;  4X66 K;  1WLJ A;  4FK2 A;  3HRG A;  1NOY A;  4WCE L;  1QSY A;  4YOV A;  1J6Z A;  1YHQ N;  3VQB A;  1O1W A;  1IKV A;  1BU6 O;  2HHW A;  1J9A A;  2NRX A;  3VQC A;  4FLY A;  4GV9 A;  3W3D A;  1D4X A;  4CFB A;  3F2K A;  4K41 A;  5C12 A;  4H5R A;  4O8U A;  5I9E B;  1NK6 A;  2RE2 A;  3NE6 A;  3R3L A;  4RW7 A;  5FPN A;  3CFP A;  4CI6 A;  4CFD A;  1NM1 A;  2HMP A;  2QWM A;  3G0Z A;  3O3G A;  3CCQ N;  3DOK A;  3KZB A;  4DU4 A;  1HRH A;  4DCH A;  5BR9 A;  1Z6R A;  2QKK A;  3PY8 A;  2BUP A;  1NJY A;  1BDG A;  2F96 A;  3AVI A;  4FJX A;  2A3Z A;  4DV6 K;  4DV1 K;  5M1O A;  3GG4 A;  4FLW A;  3C6T A;  2Q97 A;  3PUF A;  1DT9 A;  3RSE A;  3NVK A;  2ITG A;  4CJW A;  1NG9 A;  3MXI A;  5I3U A;  4WYB A;  3SAH A;  1RTD A;  2IDO A;  2QWR A;  1TYQ A;  4ILH A;  3KWG A;  1EWR A;  3LP0 A;  4JKA A;  1TKT A;  4FOI A;  1LWE A;  3WNE A;  1S72 N;  2YV0 X;  4DR6 K;  3AVJ A;  4YOX A;  2F7T A;  2ZGY A;  1RT7 A;  4FJ9 A;  4CVN E;  1RT4 A;  1NNE A;  1VHX A;  3M1F A;  4FWP A;  4DQS A;  4E19 A;  3CM5 A;  1OH6 A;  1XMQ K;  1BIZ A;  3ITH A;  4DQQ A;  2D4W A;  5KGW A;  1ASU A;  1YXQ A;  4JN4 A;  3C7N B;  4UQG A;  4A2B A;  1I3A A;  1SL1 A;  3CD6 N;  4DG1 A;  2UXD K;  3HK2 A;  2HHU A;  1T6C A;  5LL6 Z;  4CHN A;  4MLH A;  4FPB A;  4BY9 C;  3OYA A;  3IMX A;  3SJJ A;  1ESV A;  5M1K A;  1ITG A;  4FWO A;  3TSP A;  1VQ7 N;  3AO3 A;  5BRE A;  5JIC A;  1EXQ A;  5GIN A;  3ATV A;  1KFD A;  3SCX A;  1BQM A;  3C65 A;  3N4P A;  1D9F A;  1VQ5 N;  4CEO A;  1RBV A;  3DLL L;  4I6M B;  1QTM A;  4NCA A;  1NKC A;  3O5B A;  2D0B A;  2QI2 A;  2P9I B;  2F4V K;  3T69 A;  3NH2 A;  3ZSQ A;  4CFC A;  2X78 A;  4MQ3 A;  3ULD A;  3TTF A;  1RDC A;  2G8H A;  4HTL A;  1F21 A;  3D45 A;  3CMA N;  3NF7 A;  2HBJ A;  1Q18 A;  2JWL A;  3CIP A;  4DF8 A;  1B92 A;  3E66 A;  1D9D A;  4PHT X;  5AQZ A;  4IG0 A;  3SV4 A;  2HVI A;  2XY8 A;  3G71 N;  3AGK A;  1N32 K;  2YNH A;  3LWL A;  2PAV A;  1FJG K;  2Q0R A;  2P9K A;  2D5R A;  1T8E A;  4BG9 A;  3VQ7 A;  5TKW A;  3CJ7 A;  1S3X A;  5HRN A;  2FSJ A;  5BPL A;  3ZT0 A;  2Q31 A;  4CF2 A;  4LH4 A;  3LDO A;  4W5R A;  2KHO A;  3WNF A;  1FK9 A;  4CJT A;  5LMU K;  4ISF A;  2O8B B;  4FL9 A;  1U48 A;  4H0X B;  1Q7Y O;  4DFP A;  1RDU A;  2YNI A;  1CLQ A;  1T03 A;  4BVO A;  3AV9 A;  3AVN A;  2QWQ A;  2GTD A;  3EE8 A;  4E7H A;  4Z4G A;  5C0Y A;  2W42 A;  1VQO N;  1MA9 B;  3L2U A;  3CC4 N;  1R0A A;  1JKH A;  4H0T B;  3SUN A;  4HHT A;  3P83 D;  3BF3 A;  3EO3 A;  3VQ9 A;  4I2P A;  4GV6 A;  3A2F A;  3EL2 A;  4CJS A;  3THX A;  1LAV A;  3O4N A;  1Z25 A;  4H0Y B;  4PUO A;  1HR0 K;  1A5W A;  3PV8 A;  3OS2 A;  1Y97 A;  1MWK A;  1H1V A;  1NGB A;  1ASV A;  4CHY A;  4HTU A;  3TWH A;  4EHU A;  3QDK A;  4FSV A;  1FW6 A;  1HNV A;  4O55 A;  2RKI A;  2E6L A;  1ZBI A;  3BEX A;  3EEQ A;  3E01 A;  4G9Z A;  1UOC A;  1YTU A;  3OYJ A;  2F8T A;  3VF4 A;  2P9N A;  2UUC K;  4FWN A;  1RBT A;  1JLC A;  2E5L K;  3ZT1 A;  5CHI A;  2YKN A;  3U3G A;  2VWB A;  4MDB A;  3DM2 A;  4YOY A;  5J1E A;  4F2S A;  3K9K A;  4OKK A;  2G8U A;  1BGX T;  2PY5 A;  4E7I A;  2D1K A;  2NZT A;  1KCF A;  2PBD A;  1T44 A;  3DXM B;  4FLU A;  3DRR A;  2IIR A;  5DM6 L;  3M3Z A;  1EP4 A;  1ZBL A;  3HPO A;  3A5O C;  3HYF A;  5AZJ A;  4OGC A;  4H5N A;  4TSX A;  4FWK A;  1RFQ A;  2O4G A;  4JD2 A;  3M8P A;  4A57 A;  3NMU A;  3C7N A;  4M45 A;  3UIQ A;  3QEP A;  4NXM K;  4GW6 A;  2V52 B;  3WUH A;  4ILJ A;  2J4R A;  3OW2 M;  4RWT A;  3BZK A;  4CIG A;  3O3F A;  1O13 A;  2Z1H A;  3MAQ A;  1VRU A;  4JKH A;  1W7A A;  4KHP K;  1WSE A;  1KVC A;  5K14 A;  2XRI A;  3L0Q A;  3A8Y A;  2O8D B;  5C15 A;  4BWJ A;  1ZBH A;  2PYJ A;  2P1J A;  4BVP A;  1WBB A;  3O8M A;  3L3V A;  4CEZ A;  3L2R A;  3VQ5 A;  1EKE A;  3T1Y K;  3TSQ A;  3D2F B;  4LFA K;  3B6O A;  3DWL A;  5AQN A;  4XEI A;  3EKS A;  4B9S A;  1S9E A;  2FBX A;  4FK0 A;  4BGA A;  1IKY A;  3ASM A;  4MO5 A;  5AJ3 K;  4AIL C;  3VGM A;  3VA0 A;  4K8Z A;  2UU9 K;  4F9O A;  4QOZ B;  3NFA A;  4JHD B;  3M8Q A;  4QS9 A;  4DS5 A;  1SS6 A;  4W5T A;  4B9T A;  5FRO A;  3H1Q A;  5SWM A;  1LWC A;  4ELV A;  2G8V A;  4N47 A;  4FCY A;  5CYQ A;  4MDA A;  4CIE A;  3BP8 A;  4IZ9 A;  1LW0 A;  1CZB A;  3OTO K;  2HHQ A;  3TAE A;  1QZ6 A;  1KXP A;  3EE9 A;  1OH8 A;  3ZYY X;  2HHV A;  1TUU A;  5AQQ A;  4B9L A;  4L3Q A;  4N76 A;  4IOA L;  4IO8 A;  4QS8 A;  4CHO A;  3ZX3 A;  4CEA A;  3IG1 A;  3UE5 A;  1K9M O;  4JI3 K;  4KFB A;  4DTX A;  1G99 A;  4MO4 A;  3DXK B;  3TAQ A;  3AVH A;  4IO9 L;  2JGU A;  4DLG A;  3K5N A;  3WQU A;  3QML A;  1OVY A;  3I33 A;  1LV5 A;  1RBS A;  4CJK A;  3TAG A;  4DV7 K;  3SUQ A;  1SKW A;  1NK4 A;  3TR8 A;  1WSJ A;  4DTS A;  3OBW A;  2OPS A;  3IRX A;  1QVF M;  5AQW A;  4YOU A;  1IV0 A;  2HF4 A;  3AAP A;  1BG3 A;  2VWK A;  1U45 A;  3KK1 A;  1QSS A;  4OKE A;  1NK8 A;  1HQE A;  4CD1 A;  3THY B;  3PO4 A;  2NNW A;  4C8O A;  2A41 A;  1Q9Y A;  3RMA A;  3SQ0 A;  3I8D A;  2YHW A;  4CGD A;  2XY6 A;  3L2W A;  4GVM A;  5KGX A;  1Z05 A;  1TV6 A;  4CJP A;  2OPP A;  4Y1C A;  1Y64 A;  4BR7 A;  4FWM A;  5KQ8 A;  3DOL A;  1TKX A;  2E88 A;  3O9S A;  4FJN A;  4CEE A;  2NLX A;  2E1Y A;  5EOY A;  3SNN A;  3CQY A;  3QIN A;  2HST A;  5DM7 L;  4FLZ A;  3AO1 A;  3IDH A;  3TAF A;  2B6A A;  4CK3 A;  3DLB A;  3P31 A;  3SV3 A;  2DTU A;  4FZZ A;  1VQ6 N;  4FYD A;  1TL1 A;  1YIT N;  4FJI A;  3OS1 A;  2HW3 A;  3VOV A;  3ZSZ A;  3MN7 A;  3HL8 A;  4ZTF A;  1MDU B;  3M8S A;  4KTQ A;  2OZS A;  4BR2 A;  3NBP A;  4C1N K;  2Z1I A;  2YJF A;  3OYC A;  4BR5 A;  3WQT A;  1REV A;  4IWV A;  1KLN A;  3AAR A;  4BRE A;  3J7Z O;  1NMD A;  4H5W A;  1RDA A;  3HOT A;  2QA4 N;  4EIA A;  4WFB L;  2YJE A;  1DGK N;  4KI4 A;  4JKF A;  1KVA A;  1VQ9 N;  2P9U A;  4DQR A;  5HRP A;  3O9U A;  1EX4 A;  1NK7 A;  1KVB A;  4JKD A;  2WBN A;  1MU2 A;  3CCR N;  1G15 A;  3T3F A;  1C0G A;  3AVG A;  5HP1 A;  3TPQ A;  4I9L A;  1QE1 A;  1YVN A;  3U8X A;  4O8K A;  4WQ4 C;  3T7Z A;  3KK3 A;  3KIO A;  3RSE B;  4CF1 A;  1JCG A;  4FZY A;  4OGE A;  3AA5 X;  3PO5 A;  5FPE A;  1VSM A;  4XH1 A;  3OVN A;  1BCO A;  3DLR A;  3MN5 A;  4B1Z A;  3D6R A;  4CZM A;  1E3M A;  4IJN A;  1TYQ B;  3DXK A;  4F8R A;  2E2O A;  4CZH A;  4OLA A;  3NVM A;  2QWL A;  4KKO A;  2V51 B;  3MWT A;  4FJ5 A;  1XWL A;  1FKO A;  1BIS A;  4ILG B;  3U3Y A;  4JKB A;  5HRO A;  2BDP A;  4CF9 A;  4CK1 A;  4ELU A;  3O3H A;  5KQD A;  1BWF O;  1VSD A;  5BN8 A;  4C8M A;  3D2E B;  5IWA K;  5GAH P;  1IKX A;  2OTL N;  2DFH A;  1N6Q A;  2HHS A;  3THY A;  1W9H A;  3OJS A;  1E4F T;  2CGL A;  3C6A A;  4EZ9 A;  3TTD A;  3B6P A;  4XH5 A;  4Q5V A;  1YJN N;  4Z0U A;  4QAG A;  3OA9 A;  3ULE A;  4BRD A;  2PZS A;  1K8K A;  3HP9 A;  4LFB K;  2ETJ A;  4B9V A;  3AVM A;  1UA0 A;  4FO0 A;  1TKZ A;  4BC5 A;  5JLF A;  1S1W A;  3M6G A;  1RBR A;  3ALY A;  1VSH A;  1KRP A;  3HJF A;  5C25 A;  5FPD A;  3S41 A;  1GOB A;  2EWS A;  3MMV A;  4PL8 A;  3J8A A;  4BQL A;  3DRS A;  1JL2 A;  3SBT A;  2KQ2 A;  3MXJ A;  4JAX A;  3SPY A;  5FRN A;  3O4Q A;  4B3S K;  4OKJ A;  2KZM A;  1ATN A;  4YDU C;  1ILY A;  4H4O A;  4B1U B;  4C8K A;  3THV A;  3ZT3 A;  4DMN A;  4AHU A;  4FJ8 A;  3ZSO A;  4B3R K;  1KTQ A;  3Q7B A;  3CHW A;  2P9K B;  1XI1 A;  3QBX A;  4JI4 K;  4KHY A;  3NGI A;  2ASO A;  2Y1J A;  4CZF A;  2G8I A;  5MLC Q;  5F1X A;  5LJV A;  1WSF A;  4JI6 K;  1M90 O;  1JL1 A;  1NWK A;  3ZCM A;  1GLC G;  5CZ1 A;  3S3O A;  1RGI A;  3U6F A;  4FJJ A;  4H0P A;  2IAJ A;  3A5M C;  4A5A A;  4DV2 K;  4IEI A;  1LCU A;  5CYM A;  1HJO A;  4RW6 A;  4DTJ A;  1JLA A;  1VQK N;  1NK0 A;  1GLE G;  4M3Y A;  1QQM A;  3AGR A;  1YT3 A;  4J8F A;  1L3U A;  4Z4C A;  4CFA A;  1U04 A;  3THX B;  2P9S A;  3SAG A;  3RWU A;  3AO2 A;  3KWI A;  2OCE A;  3U9D A;  4KH6 A;  4A5B A;  1NGE A;  4AQY K;  3CJC A;  2VCP A;  3R1X A;  1U6Z A;  4CEC A;  2RF2 A;  4BC2 A;  1ZBF A;  2VQF K;  2P9P A;  2HND A;  2W6L A;  2QWO A;  4JI8 K;  2P9N B;  3KHY A;  4M3T A;  4DU3 A;  1GLF O;  2HNZ A;  4DFJ A;  5EY4 A;  1VSL A;  1QQC A;  3VES A;  3ZET A;  3MN6 A;  4BRI A;  3V81 A;  3TAR A;  5H1S Q;  3DAW A;  1NKB A;  1RT1 A;  1I94 K;  3LZI A;  5AZJ B;  3M5R A;  4DF4 A;  2VGN A;  4CD3 A;  1A5V A;  4LF7 K;  4JD2 B;  3IUC A;  4CEF A;  3J80 O;  1RTH A;  3D2E A;  2HBK A;  3OYM A;  2ZE2 A;  3UB5 A;  1CXU A;  1BQN A;  2PFU A;  3BZC A;  5T7B A;  4Y0W A;  3QEX A;  1RT5 A;  2IVN A;  3H6E A;  3FZM A;  5AQV A;  1IKW A;  3OS0 A;  3O08 A;  3CQX A;  1Q82 O;  4JI7 K;  1OKJ A;  4Z4H A;  1EET A;  3SJH A;  2BH1 A;  3PSI A;  4BRA A;  3QET A;  3V9Z A;  4H0V B;  2WON A;  4KHQ A;  4HUG A;  3V9W A;  3OBY A;  4B3M K;  1TGO A;  1Q9X A;  1HNW K;  2QW9 A;  1CZ9 A;  3QIC A;  4YFU A;  5F2R A;  2UXC K;  3LP1 A;  3KK2 A;  5EU7 A;  5HLF A;  4FM2 A;  3PX6 A;  3OJU A;  4O0I A;  3VER A;  1X3M A;  4CBW A;  3O80 A;  2FSK A;  3EY1 A;  3E9P A;  4CGG A;  3KD5 E;  4LF5 K;  2KFZ A;  4ZTJ A;  4BRO A;  4BRK A;  3VA3 A;  3QEW A;  3MCP A;  1T6D A;  4E1J A;  1YJW N;  1L3T A;  4JK8 A;  1XC9 A;  1GLD G;  1VQP N;  3QB0 A;  4CJQ A;  4JS5 A;  5KPR A;  3K5O A;  2HB5 A;  3KKS A;  5BPN A;  3LPT A;  1BI4 B;  1V4S A;  3VPZ A;  5A2Q O;  4BDZ A;  2P5G A;  3VGK A;  3GBT A;  1WNS A;  4M63 C;  4BR9 A;  2QWN A;  3CCJ N;  3L6Q A;  3RRH A;  3CXC M;  3QEI A;  2RHK A;  4DUY K;  4K43 A;  4N56 A;  1S22 A;  5DK5 A;  4GKJ K;  1KLM A;  2YI1 A;  3PX4 A;  3KD1 E;  1HLU A;  1ATS A;  4CER A;  4DR2 K;  4FJM A;  3NH1 A;  1BIU A;  4CJV A;  4LF6 K;  3O6W A;  4E89 A;  3CFR A;  5CY4 A;  4W5Q A;  4CHP A;  3CCU N;  1IBK K;  2HOE A;  4BR0 A;  4BRP A;  1W2B M;  3HVR A;  1EO1 A;  2KW4 A;  1NGH A;  4X62 K;  5C2D A;  5C24 A;  5DMR A;  1RDB A;  4FOE A;  2I7P A;  3PX0 A;  1W0H A;  4OPK A;  3AVA A;  4FLV A;  2Q2R A;  2E2P A;  3RVC A;  2E2Q A;  3L2Q A;  4YOT A;  1SV5 A;  1QSL A;  3CJB A;  1ZXO A;  1VSJ A;  2HHT A;  4WQ5 A;  2LSN A;  2O8E A;  4JK9 A;  3OYF A;  2KZZ A;  3VQE A;  3JAM O;  3VQ6 A;  1DKG D;  4C23 A;  4CGH A;  3SUP A;  5ADX H;  3CCV N;  4IFE A;  3HBT A;  5CZ2 A;  1Q81 O;  2VG6 A;  5LJW A;  4ID5 A;  1LWF A;  4E1N A;  2F8S A;  2FF3 B;  4E7K A;  4B9Q A;  3C0B A;  3VF2 A;  3PLA A;  4WFA L;  4K0K K;  2PYL A;  3QLH A;  4DR7 K;  1DTT A;  4PQU A;  3CPE A;  3VEZ A;  2A1R A;  1NJI O;  4R5P A;  3NF8 A;  2AA4 A;  1L5U A;  4FJH A;  3CI5 A;  3GDQ A;  2ZJQ L;  3W0L A;  1NBW A;  4KHU A;  3GL1 A;  1VSF A;  4F3O A;  4I2Q A;  4CZL A;  2UYT A;  2A5X A;  1NOZ A;  3H08 A;  1HJR A;  1RNH A;  3SK3 A;  5AQF A;  3AVB A;  5GAG P;  4FM0 A;  1KAX A;  4G1Q A;  1FKP A;  5M1Q A;  4H0O A;  4U7B A;  3UKU A;  4E0D A;  1NMN A;  2WC9 A;  2P9U B;  4IXC A;  4KHN A;  5D3G A;  3DLG A;  4FWS A;  5AQS A;  3I55 N;  1XHZ A;  1XMO K;  3MX2 A;  4CIF A;  1KD1 O;  4A62 A;  4DKW A;  3E9L A;  2ITM A;  1TUY A;  1M1K O;  1YIJ N;  1BUP A;  3BDP A;  4Z4I A;  3QNN A;  1WOQ A;  3AA4 A;  4MLE A;  2ASP A;  3LAK A;  4B08 A;  3EYZ A;  4BDP A;  3CCS N;  1X3N A;  1C6V A;  3V1O A;  3B8A X;  2EHG A;  1NLV A;  3HM9 A;  1BI4 A;  1I39 A;  4Z94 A;  4FW2 A;  4DFM A;  3LL3 A;  1NJW A;  1NGJ A;  2QWP A;  3JS6 A;  1TK8 A;  3AA3 A;  3QER A;  1VSK A;  4BWM A;  4DUZ K;  3IS9 A;  2QTD A;  3CJA A;  4B1Y B;  3K5L A;  4QCL A;  3H46 O;  4PKG A;  4BRG A;  3HPG A;  1QQO A;  3AO5 A;  1HMV A;  4OPA A;  1J53 A;  4KRF A;  1HKC A;  3E1Y A;  3SQ2 A;  2W40 A;  3SI6 A;  1YVU A;  2GBZ A;  1VQ8 N;  4RW8 A;  5KPT A;  1L3S A;  3U4L A;  1U4B A;  2YCH A;  1X9J A;  4B9U A;  1HYV A;  3N4Q A;  3NDK A;  3O9T A;  5AR0 A;  3HO1 A;  4IJA A;  5AQX A;  3CQ8 A;  2JLE A;  1GOA A;  4F4K A;  4JI0 K;  4CF0 A;  1GLA G;  3FZH A;  3MWP A;  3ULE B;  1K8K B;  3K5M A;  4DR1 K;  3TSU A;  1S5J A;  5B8H A;  1VRT A;  5AQH A;  2XY7 A;  4ID1 A;  1EQY A;  2NRR A;  2UUA K;  4IKF A;  3R9P A;  5FDL A;  5JVH L;  1NK5 A;  3VEV A;  2IVO A;  4BE0 A;  1TKD A;  2IGI A;  2H3G X;  3OYI A;  3VQ8 A;  4CJR A;  1S6Q A;  1NJX A;  4B3T K;  4K42 A;  3AY9 A;  2G8F A;  2Z1G A;  1HQU A;  1HNZ K;  3O1W A;  1N34 K;  4CJ4 A;  5AQR A;  3J7A P;  3VEY A;  2QXF A;  3P39 A;  2XY5 A;  2F9T A;  1E4G T;  1IJJ A;  4JYA K;  1T05 A;  3BF1 A;  3NHG A;  4KH5 A;  4CGJ A;  2HF3 A;  3H45 C;  4KTZ A;  3CF5 L;  4CJ3 A;  3RTV A;  3MK6 A;  4IG3 A;  3OYL A;  3O9R A;  2XHB A;  3BUZ B;  3CCL N;  1YUW A;  4CJU A;  4DV0 K;  3CM6 A;  1RDW X;  3KTQ A;  2DY4 A;  1BO5 O;  2RN2 A;  3VQD A;  3QNO A;  1HPM A;  2ZD1 A;  4IDK A;  5AQT A;  2KTQ A;  3K9J A;  3RMC A;  4X65 K;  4RTF D;  1ZBS A;  3TTC A;  4CJ7 A;  4E7L A;  5C2F A;  3DLH A;  4I9Q A;  3DLK A;  1C0U A;  3P1G A;  3OYB A;  3CCE N;  3K2P A;  1TAU A;  3WXM B;  3CER A;  2O4I A;  5AQP A;  3MEC A;  4YNQ A;  2P9S B;  3PIO L;  3IFR A;  2FBY A;  4BRM A;  5HRR A;  4CJE A;  1NK9 A;  4ELT A;  4JKG A;  1S1T A;  1C1B A;  4H5V A;  5GIO A;  3AVC A;  1U47 A;  4NB4 A;  3CFO A;  1JCF A;  2P5O A;  3HOS A;  2IOC A;  5GAD P;  4GV3 A;  2GUP A;  2P9P B;  3T1A A;  5M1N A;  3PIP L;  1WSH A;  3CJ9 A;  1Q86 O;  3VTI A;  4C8L A;  1NGF A;  4YY3 K;  1BHL A;  5AZI A;  2YNG A;  3OYD A;  4X64 K;  1WSI A;  4YOW A;  3U9Z A;  4BRN A;  3ZET B;  4KAZ A;  4R79 A;  4Q0B A;  4IBN A;  4DR4 K;  2IC3 A;  2O8C A;  1BA0 A;  3CC7 N;  2YHX A;  1IG8 A;  3ENB A;  5AQO A;  4FM1 A;  1JLG A;  5AQY A;  3GOI A;  3LAN A;  3G6E N;  3P5J A;  4C1N I;  2YKM A;  1SL0 A;  2Q36 A;  4LC9 B;  3SBG A;  2CH6 A;  5ADX A;  4JI1 K;  2HHH K;  4DSI A;  1X9M A;  3KLH A;  3WEE B;  3M8R A;  5HBM A;  2OPQ A;  4LH5 A;  2A42 A;  1RIL A;  3LDN A;  4AHS A;  4CGF A;  5M1F A;  5KRS A;  3VMF B;  4RW9 A;  1SUQ A;  2R7Y A;  4BR4 A;  1N5Y A;  4JKE A;  2A1S A;  1XC3 A;  1NGI A;  2FBT A;  1Z26 A;  4FLX A;  4OX9 K;  3HVT A;  1D8Y A;  4HCB A;  5KI6 A;  1JXE A;  2I5J A;  2NRV A;  3MX5 A;  1VQ4 N;  1N8R O;  2KFN A;  3EZW A;  3FFI A;  3DLE A;  4BGB A;  4EAH D;  4CEB A;  2HHX A;  1ATR A;  2D0P A;  2Q0U A;  1IG9 A;  1BCM A;  2GEL A;  3VQ4 A;  4M3W A;  3P38 A;  3RR7 A;  3I56 N;  1JLF A;  1K8A O;  4FVM A;  1MWM A;  2P9L A;  2VG5 A;  4DSE A;  4PL7 A;  1DEJ A;  3CG7 A;  4JS4 A;  4A2A A;  1QZ5 A;  5BRD A;  3VQA A;  2B5J A;  4E7J A;  2DFF A;  4DTM A;  1IO2 A;  3V1Q A;  1T3V A;  1WAF A;  2OAN A;  3VEO A;  5SZT A;  3KVG A;  4DQP A;  1QQN A;  3NF9 A;  4DTR A;  3LM2 A;  4F3T A;  4J2E A;  4CHQ A;  3ZT4 A;  3FZK A;  4HUE A;  4JRP A;  3QFP A;  5EX5 A;  1ZBU A;  5AQJ A;  3ZX0 A;  2AJQ A;  1NGC A;  1Q8I A;  1B9F A;  2WUS A;  4DSL A;  3LZJ A;  3QO9 A;  5JMV A;  5JVG L;  4AHT A;  1SZ2 A;  4CZK A;  2X74 A;  3CET A;  4FJ7 A;  3OYN A;  3SQ1 A;  1VSE A;  4JI5 K;  1WAJ A;  3LDS A;  4HUF A;  2G8W A;  3VTH A;  1UAX A;  3FLC O;  5AFU H;  2BAN A;  1K73 O;  2CH5 A;  4XH4 A;  3JYT A;  3ZEU A;  1QVG M;  3CJ1 A;  2O8E B;  1XQS C;  3WNH A;  4B1W B;  4CHZ A;  3ZSX A;  1HNX K;  4FJG A;  2QK9 A;  3C95 A;  2IVP A;  2NRW A;  2HVH A;  2ZGZ A;  2HBM A;  1A5X A;  3KLF A;  2DPN A;  3A5L C;  1N33 K;  4DSF A;  3LDQ A;  3HT3 A;  5E26 A;  2Q1N A;  3G10 A;  5J2N A;  2FLO A;  1U2V A;  5HL7 L;  3A0I X;  3WEE A;  2VWJ A;  4IOC L;  3ZSW A;  2YNF A;  4AH9 A;  1J5E K;  4CZI A;  1GLJ O;  4FW1 A;  3V9U A;  2UXB K;  3MCA B;  3HTV A;  4GNI A;  3V4I A;  3IAY A;  1HKG A;  5E84 A;  3DMJ A;  4XIU A;  1IBL K;  1JLB A;  3IKM A;  4OVL A;  1KC8 O;  3L4I A;  2W41 A;  5JLH A;  4E3S A;  3SPZ A;  3CYM A;  3MED A;  5BRF A;  1CXQ A;  4LY7 A;  3CME N;  4JKC A;  4DLE A;  2WFB A;  3RRG A;  1NGD A;  1KAZ A;  4HWI A;  2O8F A;  5KRT A;  2W6K A;  4LF8 K;  4O0J A;  1P8Z A;  4CW7 B;  4Z4E A;  3AO4 A;  4NYN A;  3AVL A;  4NCB A;  1ZYQ A;  4C8N A;  3UKU B;  4EP4 A;  1WB9 A;  1S1U A;  3HPH A;  5J2Q A;  3DI6 A;  3HSC A;  3ISN C;  3FZL A;  4NLC A;  1UWB A;  1TK0 A;  3FZF A;  3D0P A;  1OH7 A;  1VSI A;  1YJ9 N;  3KLI A;  4E1M A;  3AA2 A;  4EP5 A;  3NF6 A;  3VQQ A;  3CC2 N;  5EVZ A;  2IS3 A;  1SKS A;  1C1A A;  3K58 A;  4KTW A;  5GIP A;  1BL3 A;  4W5N A;  4W5O A;  1LW2 A;  1NKE A;  3HST B;  1JLQ A;  1TAQ A;  2ZF5 O;  2OZM A;  3WT0 A;  1XUP O;  2OTJ N;  1IH7 A;  3AVF A;  4CED A;  4GMJ B;  3H3O B;  3MDQ A;  1HKB A;  2D0O A;  2HMI A;  4PKI A;  3UKR A;  4KRE A;  4IOX A;  3OYE A;  3AAQ A;  3EZ5 A;  3SMS A;  2E4L A;  4KB0 A;  1LAW A;  2V7Z A;  5AQG A;  1J5O A;  4DB3 A;  4M41 A;  4U67 L;  5FRM A;  4DS4 A;  4CJF A;  4DV5 K;  3HI0 A;  4IFV A;  3K59 A;  1C0F A;  4B3O A;  1VQN N;  1JLE A;  3VEX A;  2VGM A;  4DTP A;  4LF9 K;  1GLB G;  3ENO A;  3RMB A;  2D0A A;  5BR8 K;  4NCG A;  4OPJ A;  1HYS A;  3S3M A;  3VEW A;  3ENH A;  1GOC A;  3VEN A;  2YHY A;  4B9M A;  3LPU A;  4IFY A;  1SAZ A;  5CE3 A;  4M3Z A;  4A59 A;  2AP1 A;  3OYG A;  3V9S A;  4GY2 B;  1SQK A;  4UY8 O;  2KKZ A;  4K8X A;  2VYP A;  3WNG A;  2WTU A;  4OLB A;  2BE2 A;  2JWK A;  3D7E O;  4NO7 A;  4CZE A;  4F2R A;  5TKY A;  4GKK K;  3C6H A;  1JJ2 M;  3Q7C A;  4CZJ A;  2FF6 A;  4OPH A;  4CK2 A;  4FWQ A;  3HZ6 A;  5HRS A;  2HBL A;  4KI6 A;  3F5T A;  4FLT A;  2UUB K;  4LD0 A;  5JS2 A;  4JI2 K;  1CZA N;  3SMP A;  4FWR A;  3T1H K;  4AHC A;  3AVK A;  3SYZ A;  3ATU A;  2E2N A;  3F73 A;  2A6A A;  5I42 A;  1YTA A;  4LF4 K;  4HVJ A;  4YOR A;  1IBM K;  4BRL A;  5HOO A;  5AQL A;  1HPZ A;  4BRQ A;  3QEV A;  4NXN K;  4FWL A;  4PA1 A;  4BG8 A;  4BC4 A;  3TAP A;  2VQE K;  3NH0 A;  3LDP A;  2A40 A;  2E8A A;  1J54 A;  4WQ4 A;  4H4M A;  4O4G A;  3V1R A;  3MEG A;  4HCC A;  4JRQ A;  2GV9 A;  2E1Z A;  5M1P A;  4DU1 A;  3RMD A;  4EHT A;  3R6M A;  4PY5 A;  3VGL A;  5LMN K;  3VN5 A;  3ID8 A;  2NRZ A;  4I6M A;  4WE1 A;  3V9X A;  2Y1I A;  5LY3 A;  4LFC K;  1OVQ A;  4FZX C;  2P9I A;  4RW4 A;  1WUA A;  3TAM A;  3I0S A;  3LAL A;  4BRH A;  4JKG B;  2E20 A;  2EX3 A;  3SZ2 A;  2BTF A;  3QBW A;  2QKB A;  2NUB A;  4CZG A;  2X6S A;  4Z4F A;  3ZLJ A;  4I7F A;  4ISG A;  4AF1 A;  4M7Y A;  2WOM A;  4NLB A;  2BGG A;  2Q3S A;  4IEE A;  2ZQB A;  5E41 A;  2XO7 A;  4BDY A;  3SLC A;  4B1X B;  4DV4 K;  3KJV A;  1L3V A;  2X6N A;  4AHR A;  3TAN A;  3K57 A;  4LSN A;  1KSP A;  4M42 A;  4FXD A;  4DTO A;  4ICL A;  5AZI B;  1LOT B;  1BA1 A;  4DHY A;  3ZSV A;  4BQZ A;  1C0M A;  5AFU A;  4BRC A;  2O8C B;  1VAZ A;  3DYA A;  2O8B A;  2GUI A;  4O5B A;  5AQK A;  3LAM A;  1RT3 A;  2QM1 A;  3C6U A;  4J2D A;  4K25 A;  4YHH K;  1HUX A;  2GEM A;  3KK7 A;  3QES A;  4M3X A;  4KHS A;  3THW B;  1B9D A;  2CGK A;  4YDU A;  1N36 K;  5GAE P;  4CE9 A;  1D5A A;  3KLE A;  3LP3 A;  3KKR A;  3E9O A;  4DSK A;  3L4Q A;  3SQ4 A;  3FGU A;  2F9W A;  3HM8 A;  1C0T A;  4RCH A;  4DR5 K;  1W97 L;  2I7N A;  4KV8 A;  3JSM A;  4KH4 A;  2D0C A;  3HP6 A;  1KAY A;  3MEE A;  1KFS A;  1TL3 A;  1S1V A;  3T19 A;  4AM7 A;  1NU0 A;  4JEP A;  3WXK A;  4H8K A;  1YF5 L;  1JCE A;  3DRP A;  1DLO A;  2OPR A;  3NAE A;  4CCH A;  4N5S A;  4KHW A;  1RT6 A;  4PKH A;  3WXJ A;  2ZM6 K;  1RTI A;  4BAC A;  4DWI A;  1X9S A;  1NGG A;  1RT2 A;  3FR0 A;  1S9G A;  4KBO A;  4WFN L;  1WBD A;  1GLL O;  3R8E A;  4A61 A;  4FJL A;  2ASM A;  2ZWH A;  1HYZ A;  1X1P A;  1DTQ A;  4L8R B;  3ZSR A;  2P9L B;  3G25 A;  5KTQ A;  3RR8 A;  4FK4 A;  4CEQ A;  3DXM A;  1WN7 A;  3LM9 A;  5FLX O;  4FJK A;  4KPY A;  1XNR K;  5J2P A;  5J2M A;  2YX6 A;  3S9H A;  4RG8 A;  2ZJR L;  3PSF A;  3J81 O;  1RTJ A;  4BE2 A;  5KPZ A;  5BRH A;  3QIO A;  3GE1 A;  4WF9 L;  4V19 S;  4JK7 A;  1HNI A;  5CR4 A;  3NGZ A;  4FVU A;  3WXI A;  4ZHR A;  4IDH A;  4QS7 A;  4BC3 A;  3BY5 A;  1RCH A;  2GX9 A;  4CBU A;  3VQP A;  3V6D A;  3L8B A;  1VQM N;  4WQ5 C;  4N41 A;  2P51 A;  2YHB A;  4DR3 K;  4DTU A;  3LWM A;  2Z1J A;  1K6Y A;  2O8D A;  1UA1 A;  2DFE A;  4EFH A;  4PWD A;  2FXU A;  4B8C A;  4AM6 A;  1TK5 A;  3D2F A;  4B1V A;  3A5N C;  3P4I A;  5FPM A;  3BGR A;  3LDL A;  3VET A;  5C42 A;  3SUO A;  1SL2 A;  4OJR A;  4DV3 K;  4B8A B;  3L3U A;  3SAF A;  1XHX A;  5IT9 O;  3EN9 A;  1HX1 A;  5C10 A;  1YI2 N;  4JHD A;  1WSG A;  4AHV A;  5BN9 A;  2YHA A;  4Y1D A;  2CGJ A;  1TVR A;  1QHT A;  2G8K A;  3TI0 A;  3FFK B;  1ASW A;  4LSL A;  3ZEU B;  5JS1 A;  4BRF A;  3HXM A;  4BE1 A;  4DSJ A;  3OY9 A;  5AQU A;  1JXB A;  4M3U A;  3J7Y P;  3O1B A;  3ZX2 A;  3KLG A;  1VK0 A;  4MFB A;  4CBX A;  2OYQ A;  1YAG A;  4JV5 K;  5AQM A;  3ZT2 A;  1BOT O;  4NYF A;  1T7P A;  2ATQ A;  3OHR A;  4JLH A;  1V4T A;  3H1V X;  1R59 O;  4OO1 J;  3MXM A;  1U2V B;  4JNE A;  3F9M A;  3THW A;  2GWK A;  4GVE A;  2FC0 A;  1FXX A;  2NRH A;  3CCM N;  4KB1 A;  3FE1 A;  3O4W A;  3ZSY A;  3S3N A;  3CPW M;  2GWJ A;  4DQ8 A;  3G4S N;  2QEX N;  3NGY A;  2NRT A; 
#chains in the Genus database with same CATH homology
 3HT3 A;  3PO4 A;  3OYF A;  2KZZ A;  4J2B A;  3VQE A;  3G10 A;  4J2A A;  4C8O A;  1Q9Y A;  3RMA A;  3VQ6 A;  3SQ0 A;  3I8D A;  5J2N A;  4EZ6 A;  4CGD A;  4CGI A;  3I0R A;  4CJL A;  3L2W A;  2XY6 A;  4GVM A;  2VWJ A;  5KGX A;  1RDD A;  4CGH A;  3SUP A;  3ZSW A;  2YNF A;  4AH9 A;  1SKR A;  1TV6 A;  1S6P A;  4CJP A;  3OYK A;  4FW1 A;  2OPP A;  3L2V A;  3V9U A;  4Y1C A;  1NJZ A;  5CZ2 A;  3DOL A;  1TKX A;  2VG6 A;  4ID5 A;  3V4I A;  3IAY A;  4KO0 A;  1LWF A;  4E1N A;  3DMJ A;  4O44 A;  2F8S A;  1X9W A;  4XIU A;  2B4J A;  1QS4 A;  4E7K A;  4DQI A;  4FJN A;  1JLB A;  2RPI A;  4CEE A;  4OVL A;  2VG7 A;  3LP2 A;  4E3S A;  2PYL A;  3SNN A;  3SPZ A;  3QIN A;  3QLH A;  3CYM A;  1DTT A;  3MED A;  1CXQ A;  4LY7 A;  4PQU A;  4FLZ A;  3NCI A;  3AO1 A;  3OYH A;  3TAF A;  4DLE A;  2A1R A;  2B6A A;  2OA8 A;  3RRG A;  4R5P A;  3NF8 A;  4CK3 A;  3DLB A;  1L5U A;  5KRT A;  3SV3 A;  4CF8 A;  4O0J A;  4FJH A;  2DTU A;  4FZZ A;  2HNY A;  4Z4E A;  4FYD A;  1TL1 A;  3AO4 A;  4NYN A;  3AVL A;  1RBU A;  4FJI A;  4B9N A;  3OS1 A;  2HW3 A;  4M3R A;  3TAB A;  3ZSZ A;  4NCB A;  3QIP A;  1ZYQ A;  4C8N A;  4EP4 A;  3HL8 A;  2E6M A;  1C1C A;  2FBV A;  1S1U A;  4ZTF A;  4CJ5 A;  4KHU A;  3M8S A;  3HPH A;  1VSF A;  5J2Q A;  3DI6 A;  3F9K A;  3ISN C;  4I2Q A;  4F3O A;  4KTQ A;  2OZS A;  4CES A;  3NBP A;  1UWB A;  2Z1I A;  1U49 A;  1TK0 A;  1NOZ A;  3D0P A;  3H08 A;  3OYC A;  1HJR A;  1RNH A;  4DFK A;  3AVB A;  1S1X A;  1VSI A;  4FM0 A;  4G1Q A;  1FKP A;  1REV A;  3KLI A;  3AA2 A;  4E1M A;  4EP5 A;  3C94 A;  1KLN A;  3NF6 A;  3VQQ A;  4DTN A;  2IS3 A;  1SKS A;  1C1A A;  1WLJ A;  3K58 A;  4E0D A;  4FK2 A;  4KTW A;  4KHN A;  5D3G A;  4W5N A;  1BL3 A;  3DLG A;  4W5O A;  1LW2 A;  1NOY A;  1NKE A;  1XHZ A;  1QSY A;  3HST B;  1JLQ A;  4CIF A;  1TAQ A;  3VQB A;  1O1W A;  2OZM A;  1RDA A;  1IKV A;  1IH7 A;  3AVF A;  2HHW A;  1J9A A;  4CED A;  3VQC A;  4GMJ B;  4FLY A;  3BDP A;  4Z4I A;  3QNN A;  2HMI A;  4KI4 A;  4KRE A;  1KVA A;  3AA4 A;  3OYE A;  3EZ5 A;  4DQR A;  4CFB A;  2E4L A;  5HRP A;  3LAK A;  4B08 A;  4KB0 A;  1LAW A;  3EYZ A;  1NK6 A;  1EX4 A;  4BDP A;  1J5O A;  5FRM A;  4M41 A;  3NE6 A;  4DS4 A;  1C6V A;  3V1O A;  4CJF A;  1KVB A;  1NK7 A;  4RW7 A;  1MU2 A;  2EHG A;  4IFV A;  3K59 A;  1G15 A;  3T3F A;  4B3O A;  3AVG A;  3HM9 A;  1BI4 A;  1I39 A;  3CFP A;  4CFD A;  1JLE A;  3O3G A;  3G0Z A;  4FW2 A;  4DTP A;  4DFM A;  5HP1 A;  3DOK A;  4I9L A;  1NJW A;  1QE1 A;  3RMB A;  4DU4 A;  2D0A A;  1TK8 A;  3KK3 A;  1HRH A;  3AA3 A;  4NCG A;  4OPJ A;  3QER A;  1VSK A;  1HYS A;  3S3M A;  4BWM A;  3KIO A;  2QKK A;  3IS9 A;  3PY8 A;  3K5L A;  1GOC A;  4CF1 A;  4QCL A;  4FZY A;  4OGE A;  3AA5 X;  3PO5 A;  1NJY A;  4B9M A;  3LPU A;  4IFY A;  3HPG A;  3AO5 A;  2F96 A;  1HMV A;  3AVI A;  1VSM A;  4FJX A;  1J53 A;  4M3Z A;  4KRF A;  3OYG A;  3OVN A;  1BCO A;  3V9S A;  3SQ2 A;  3DLR A;  3SI6 A;  1YVU A;  2GBZ A;  4K8X A;  4RW8 A;  1L3S A;  4FLW A;  3C6T A;  4F8R A;  3WNG A;  4OLB A;  2BE2 A;  3PUF A;  1U4B A;  2ITG A;  1HYV A;  4B9U A;  4OLA A;  4CJW A;  3MXI A;  4KKO A;  3NDK A;  4FJ5 A;  1XWL A;  4F2R A;  1FKO A;  1BIS A;  5I3U A;  3HO1 A;  3U3Y A;  1RTD A;  2IDO A;  3CQ8 A;  2JLE A;  1GOA A;  4F4K A;  5HRO A;  4CF0 A;  4CF9 A;  3LP0 A;  4CK1 A;  2BDP A;  1TKT A;  4ELU A;  3O3H A;  1LWE A;  3WNE A;  1VSD A;  2YV0 X;  4C8M A;  3AVJ A;  3K5M A;  4CK2 A;  1RT7 A;  1S5J A;  4FJ9 A;  5HRS A;  4KI6 A;  1IKX A;  4FLT A;  1VRT A;  2XY7 A;  1RT4 A;  4ID1 A;  4LD0 A;  5JS2 A;  2DFH A;  4DQS A;  1N6Q A;  4E19 A;  4IKF A;  2HHS A;  3CM5 A;  1W9H A;  3OJS A;  1BIZ A;  3ITH A;  4DQQ A;  4AHC A;  4EZ9 A;  3B6P A;  5FDL A;  3AVK A;  5KGW A;  4Q5V A;  3SYZ A;  4Z0U A;  1ASU A;  4QAG A;  1NK5 A;  2PZS A;  4UQG A;  3F73 A;  4BE0 A;  5I42 A;  3HP9 A;  1YTA A;  2IGI A;  1TKD A;  1I3A A;  3VQ8 A;  3OYI A;  2ETJ A;  4CJR A;  1S6Q A;  1SL1 A;  4DG1 A;  1NJX A;  3HK2 A;  4B9V A;  3AVM A;  2HHU A;  4CHN A;  4HVJ A;  2G8F A;  2Z1G A;  1UA0 A;  1HQU A;  1TKZ A;  4CJ4 A;  3OYA A;  1S1W A;  1HPZ A;  3SJJ A;  1RBR A;  2QXF A;  3ALY A;  1VSH A;  2XY5 A;  1ITG A;  1KRP A;  3AO3 A;  5C25 A;  3HJF A;  1T05 A;  3QEV A;  1EXQ A;  1GOB A;  1KFD A;  3NHG A;  4PA1 A;  4CGJ A;  3DRS A;  1BQM A;  3SCX A;  3TAP A;  1JL2 A;  2KQ2 A;  3MXJ A;  3NH0 A;  1D9F A;  4KTZ A;  3SPY A;  1J54 A;  1RBV A;  4CEO A;  1QTM A;  4NCA A;  5FRN A;  3O4Q A;  4CJ3 A;  4OKJ A;  1NKC A;  2KZM A;  3RTV A;  4H4M A;  4O4G A;  2D0B A;  4IG3 A;  3V1R A;  3MEG A;  4HCC A;  3OYL A;  4JRQ A;  2GV9 A;  3NH2 A;  4H4O A;  3ZSQ A;  4CFC A;  2XHB A;  4DU1 A;  3RMD A;  3THV A;  4C8K A;  2X78 A;  4MQ3 A;  3ULD A;  4PY5 A;  3ZT3 A;  4DMN A;  4AHU A;  1RDC A;  3VN5 A;  4CJU A;  3CM6 A;  2G8H A;  4FJ8 A;  3ZSO A;  3KTQ A;  1F21 A;  1KTQ A;  3D45 A;  2DY4 A;  1XI1 A;  3NF7 A;  4WE1 A;  4KHY A;  3V9X A;  2Y1I A;  2RN2 A;  3VQD A;  3NGI A;  3QNO A;  2Y1J A;  4DF8 A;  2ZD1 A;  1B92 A;  4IDK A;  1D9D A;  2G8I A;  2KTQ A;  4FZX C;  3RMC A;  4IG0 A;  4RW4 A;  1WSF A;  3TAM A;  3SV4 A;  3I0S A;  2HVI A;  3LAL A;  2XY8 A;  1JL1 A;  4E7L A;  2EX3 A;  3ZCM A;  3SZ2 A;  2YNH A;  3LWL A;  3DLH A;  2QKB A;  4I9Q A;  2NUB A;  3DLK A;  1C0U A;  3P1G A;  2X6S A;  2D5R A;  5CZ1 A;  3OYB A;  3K2P A;  3VQ7 A;  3S3O A;  1T8E A;  4Z4F A;  1TAU A;  4I7F A;  3U6F A;  2O4I A;  4FJJ A;  3MEC A;  2IAJ A;  4YNQ A;  2WOM A;  5HRN A;  2BGG A;  2Q3S A;  5E41 A;  2ZQB A;  2XO7 A;  4BDY A;  1L3V A;  3ZT0 A;  2FBY A;  3KJV A;  5CYM A;  2X6N A;  4CF2 A;  4AHR A;  5HRR A;  4LH4 A;  4CJE A;  4W5R A;  3TAN A;  4RW6 A;  3WNF A;  4LSN A;  3K57 A;  1FK9 A;  4CJT A;  4DTJ A;  1NK9 A;  1S1T A;  4ELT A;  1C1B A;  1KSP A;  4M42 A;  4FXD A;  1JLA A;  1U48 A;  4DFP A;  1NK0 A;  3AVC A;  4M3Y A;  2YNI A;  1U47 A;  4DTO A;  4ICL A;  1CLQ A;  1YT3 A;  3CFO A;  1L3U A;  1T03 A;  2P5O A;  4Z4C A;  3AV9 A;  4CFA A;  3ZSV A;  1U04 A;  3AVN A;  2IOC A;  1C0M A;  4E7H A;  4Z4G A;  3RWU A;  3AO2 A;  3T1A A;  2W42 A;  1WSH A;  3DYA A;  3L2U A;  2GUI A;  4O5B A;  1R0A A;  1JKH A;  4C8L A;  3SUN A;  4HHT A;  3P83 D;  3VQ9 A;  1BHL A;  4I2P A;  2YNG A;  3A2F A;  3OYD A;  1WSI A;  4CEC A;  3LAM A;  2RF2 A;  1RT3 A;  3C6U A;  4J2D A;  4CJS A;  1LAV A;  3O4N A;  1Z25 A;  1ZBF A;  4KAZ A;  4Q0B A;  4IBN A;  3QES A;  2IC3 A;  4KHW A;  4KHS A;  4PUO A;  4M3X A;  1A5W A;  4CCH A;  2HND A;  3PV8 A;  1B9D A;  3OS2 A;  4FM1 A;  1JLG A;  1Y97 A;  4M3T A;  3LAN A;  4DU3 A;  3P5J A;  4CHY A;  1ASV A;  4HTU A;  3TWH A;  2YKM A;  1SL0 A;  1HNV A;  4O55 A;  1D5A A;  2HNZ A;  2RKI A;  2E6L A;  1VSL A;  1QQC A;  3LP3 A;  4CE9 A;  3KLE A;  3KKR A;  4DFJ A;  1ZBI A;  4DSK A;  3E01 A;  3V81 A;  3TAR A;  4DSI A;  1X9M A;  1UOC A;  3KLH A;  3M8R A;  5HBM A;  3OYJ A;  3SQ4 A;  2OPQ A;  1NKB A;  1YTU A;  1RT1 A;  2F8T A;  1C0T A;  4LH5 A;  3LZI A;  1RIL A;  4KV8 A;  3JSM A;  1RBT A;  1JLC A;  3ZT1 A;  4AHS A;  2D0C A;  4CGF A;  4DF4 A;  2YKN A;  3U3G A;  3HP6 A;  5KRS A;  3MEE A;  1KFS A;  1TL3 A;  3DM2 A;  1S1V A;  4RW9 A;  1A5V A;  3T19 A;  5J1E A;  1SUQ A;  4F2S A;  2R7Y A;  4OKK A;  2G8U A;  1BGX T;  2PY5 A;  4CEF A;  1N5Y A;  1RTH A;  2A1S A;  4E7I A;  1KCF A;  2FBT A;  4H8K A;  3OYM A;  4FLU A;  2ZE2 A;  1Z26 A;  1DLO A;  2OPR A;  3DRR A;  3DRP A;  4N5S A;  1CXU A;  1BQN A;  3NAE A;  1RT6 A;  4FLX A;  4BAC A;  1EP4 A;  1RTI A;  3HVT A;  3HPO A;  1ZBL A;  4DWI A;  1X9S A;  1RT2 A;  1D8Y A;  3HYF A;  4HCB A;  1S9G A;  5KI6 A;  5T7B A;  1JXE A;  4OGC A;  3QEX A;  2I5J A;  1RT5 A;  4TSX A;  4FJL A;  2O4G A;  1IKW A;  1HYZ A;  3OS0 A;  1X1P A;  3M8P A;  2KFN A;  1DTQ A;  4L8R B;  3ZSR A;  4Z4H A;  4FK4 A;  4M45 A;  5KTQ A;  3RR8 A;  3UIQ A;  3FFI A;  3QEP A;  3DLE A;  1EET A;  4GW6 A;  4CEQ A;  1WN7 A;  4CEB A;  3QET A;  2HHX A;  4FJK A;  3V9Z A;  4KPY A;  5J2P A;  1IG9 A;  2WON A;  5J2M A;  3S9H A;  4HUG A;  4KHQ A;  1BCM A;  4RG8 A;  4CIG A;  3O3F A;  3V9W A;  1RTJ A;  2Z1H A;  3VQ4 A;  1VRU A;  3MAQ A;  4BE2 A;  4M3W A;  1TGO A;  3RR7 A;  3QIO A;  1Q9X A;  1WSE A;  1JLF A;  1KVC A;  5K14 A;  2XRI A;  4FVM A;  2VG5 A;  1CZ9 A;  4BWJ A;  4YFU A;  4DSE A;  2PYJ A;  1ZBH A;  2P1J A;  1HNI A;  3LP1 A;  3CG7 A;  3L3V A;  3KK2 A;  4CEZ A;  3L2R A;  4JS4 A;  3NGZ A;  5EU7 A;  4ZHR A;  3VQ5 A;  5HLF A;  1EKE A;  1RCH A;  4FM2 A;  3VQP A;  3PX6 A;  3V6D A;  3OJU A;  3L8B A;  3B6O A;  4N41 A;  2P51 A;  2YHB A;  3VQA A;  4O0I A;  4DTU A;  3LWM A;  2B5J A;  2Z1J A;  1K6Y A;  2DFF A;  4E7J A;  3EY1 A;  4DTM A;  4B9S A;  1S9E A;  2FBX A;  2DFE A;  1UA1 A;  4FK0 A;  1IO2 A;  4CGG A;  1IKY A;  4PWD A;  3ASM A;  3KD5 E;  3V1Q A;  4B8C A;  4AIL C;  1WAF A;  3VA0 A;  5SZT A;  1TK5 A;  4DQP A;  4ZTJ A;  4K8Z A;  3VA3 A;  2KFZ A;  4QOZ B;  3NFA A;  4DS5 A;  3M8Q A;  3QEW A;  4W5T A;  1L3T A;  3NF9 A;  1XC9 A;  4B9T A;  4CJQ A;  4JS5 A;  3BGR A;  5FRO A;  5C42 A;  4DTR A;  3K5O A;  3SUO A;  2HB5 A;  3KKS A;  4OJR A;  5SWM A;  1SL2 A;  4F3T A;  1LWC A;  4ELV A;  4J2E A;  2G8V A;  3LPT A;  4B8A B;  4N47 A;  4CHQ A;  3L3U A;  1BI4 B;  5CYQ A;  3ZT4 A;  4FCY A;  4BDZ A;  4CIE A;  2P5G A;  1XHX A;  1WNS A;  4HUE A;  1LW0 A;  4JRP A;  1CZB A;  2HHQ A;  3TAE A;  1ZBU A;  2AJQ A;  1Q8I A;  3RRH A;  1B9F A;  1WSG A;  4AHV A;  4DSL A;  3QEI A;  2YHA A;  3LZJ A;  2HHV A;  3QO9 A;  4B9L A;  4Y1D A;  4N56 A;  1TVR A;  5DK5 A;  1QHT A;  4N76 A;  4AHT A;  4CHO A;  2G8K A;  1KLM A;  3TI0 A;  4CEA A;  3IG1 A;  1ASW A;  4LSL A;  5JS1 A;  3PX4 A;  3KD1 E;  4KFB A;  4CER A;  2X74 A;  4DTX A;  4FJM A;  4FJ7 A;  3NH1 A;  1BIU A;  4CJV A;  3OYN A;  3HXM A;  4E89 A;  4BE1 A;  3AVH A;  3OY9 A;  3SQ1 A;  1VSE A;  3TAQ A;  4DSJ A;  3CFR A;  1WAJ A;  5CY4 A;  4W5Q A;  1JXB A;  2JGU A;  4CHP A;  3LDS A;  4HUF A;  3K5N A;  4DLG A;  2G8W A;  4M3U A;  1UAX A;  2BAN A;  1LV5 A;  3KLG A;  1RBS A;  1VK0 A;  4MFB A;  3HVR A;  4CJK A;  2OYQ A;  3TAG A;  3SUQ A;  1SKW A;  2KW4 A;  3JYT A;  1NK4 A;  5C24 A;  3ZT2 A;  3TR8 A;  4NYF A;  1T7P A;  1WSJ A;  1RDB A;  5DMR A;  4DTS A;  2ATQ A;  2OPS A;  3IRX A;  4JLH A;  3WNH A;  4CHZ A;  3ZSX A;  3PX0 A;  1W0H A;  4FJG A;  4OPK A;  3AVA A;  4FLV A;  3MXM A;  2QK9 A;  2VWK A;  3C95 A;  1U45 A;  3KK1 A;  1QSS A;  2FC0 A;  1FXX A;  4KB1 A;  2HVH A;  3L2Q A;  3ZSY A;  3S3N A;  1A5X A;  4OKE A;  3KLF A;  1SV5 A;  1QSL A;  1NK8 A;  1VSJ A;  4DSF A;  1HQE A;  2HHT A;  2LSN A;  3NGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...