4FVUA

Structural basis for the dsrna specificity of the lassa virus np exonuclease
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
208
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIAGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoprotein
publication title Structural Basis for the dsRNA Specificity of the Lassa Virus NP Exonuclease.
pubmed doi rcsb
source organism Lassa virus josiah
molecule tags Hydrolase/rna
total genus 51
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4fvuA01
4FVUA 3MX5A 4GV9A 4G9ZA 3R3LA 3Q7CA 4GV3A 4GV6A 3Q7BA 4GVEA 3MX2A 3MWTA 3MWPA
chains in the Genus database with same CATH superfamily
3ZEUB 4KB0A 4WQ5C 1J5EK 1FK9A 2HF4A 3VGMA 3E9PA 1HKCA 2ZM6K 3PX0A 4B9TA 1TGOA 4PKIA 4FYDA 4W5QA 3HRGA 4KI6A 5M1PA 1B92A 5F2RA 4O5BA 4O44A 1IG8A 4DLEA 1ZYQA 3CI5A 1NOYA 1QQOA 4DU4A 3TTDA 4Z94A 4FCYA 1JL1A 4H0TB 2G8FA 3CPEA 1UAXA 2RN2A 3L2QA 3N4QA 1HX1A 4JK9A 4IJAA 1EXQA 1RT6A 5HRSA 3KK2A 3NGYA 4M41A 3MXIA 1WSFA 3DMJA 3V1QA 1K73O 4FW2A 4ELUA 4DTRA 1XMOK 2HVHA 1W9HA 1Q18A 1JLEA 2KHOA 3GE1A 3VQ7A 1IBMK 2O8DA 1NGDA 1IKVA 3LAKA 4F9OA 3KLFA 1HJRA 2R7YA 4JKHA 4GY2B 4IXCA 4PA1A 3DRRA 5M1NA 1SUQA 1EKEA 2CGKA 3OYDA 2IVNA 3CMEN 4M7XA 4QS7A 1EWRA 3G10A 3K5OA 4U7BA 1NK7A 4JI3K 2O8FB 1NJWA 3T1AA 1VQPN 4CZIA 3OYJA 3J7YP 5CY4A 3SUOA 3TPQA 5AQFA 3K2PA 3ZSWA 4H5WA 4JI0K 4Z0UA 3NH1A 5K14A 2QWNA 3RWUA 3NCIA 1W2BM 3RMDA 4Q5VA 5AQHA 4F2RA 4CIFA 3C6TA 3ZT1A 4O0IA 4B1WB 4K25A 3WXKA 1RNHA 4JI1K 2V7ZA 4CF8A 3KLIA 5KRSA 1ZBFA 4PL8A 5CZ1A 3AA4A 4C8MA 4ICLA 1NJYA 1Z25A 3PY8A 3OS2A 4FJLA 3G25A 4K8XA 1OH6A 4X65K 4QOZB 4C8OA 1LWCA 4CJ4A 4Q0BA 4QCLA 3EKUA 5AQYA 4LF5K 2IS3A 2W6KA 4KTWA 4C8LA 3M8QA 5C24A 1LWEA 2HVIA 1MWMA 2XY6A 3AA5X 4AH9A 3CCUN 3SZ2A 3ZT0A 3O4WA 3QO9A 5F0XA 3CHWA 3MECA 3K57A 2D0OA 1MDUB 4CI6A 5D3GA 3HPOA 2HHSA 5HOOA 2IC3A 2O8DB 2OCEA 4DQSA 3UKUA 4BY9C 1C1AA 4FPBA 3CCQN 3AO2A 2HHUA 2VGNA 2G8IA 2JLEA 2HHQA 3EN9A 3CJ1A 5GAEP 1SZ2A 4N76A 2ZE2A 3VQ4A 4KI4A 4DR1K 4FLTA 3SUPA 3T69A 4OPAA 5J2PA 1TKZA 2B6AA 1H1VA 4B08A 1HYSA 4CZGA 3VQDA 3BF1A 3NH2A 2P5OA 1A5WA 4OJRA 2A6AA 4FJ9A 3VMFB 3KKRA 3R8EA 2YKMA 1Q7YO 3TI0A 4MO5A 4F4KA 3AVKA 4FWKA 1JLQA 4FWRA 4DV3K 2O8BA 4OVLA 2QXFA 4B3SK 3M5RA 1TAUA 2JWKA 3A5LC 4CHPA 4KHSA 3SPZA 3CCSN 1EWQA 4H0XB 4BGAA 4DF8A 2OPRA 1KLMA 1G15A 3HVTA 4H5NA 3MWPA 3C6HA 1BDGA 1T6CA 1X9JA 1P8ZA 2F7TA 4H03B 4W5TA 3V6DA 1SL2A 3V9ZA 1YJ9N 2VG7A 2P5GA 4FK0A 3AGKA 1S9GA 4BE0A 2OZMA 3VEOA 4WFBL 5AQJA 4HVJA 1Q86O 1X3MA 2I5JA 4FLVA 2IGIA 4ELTA 1UA0A 3HTVA 2ITMA 1HNXK 4JKDA 1ATSA 4E1JA 3MXMA 1YXQA 3EZWA 5AQUA 1RT7A 1U47A 3OVNA 4FLXA 3UKUB 3I0SA 2PYLA 3SI6A 4NCGA 4ZTFA 2YNHA 3TAGA 3VTHA 2XY7A 3HBTA 3CIPA 4AHRA 4JI6K 3A2FA 4CF9A 3CCLN 3HPHA 4DF4A 4FK2A 4CF1A 2HNYA 1WAJA 3D2FA 1U45A 3D6RA 4EZ6A 4XIUA 3HZ6A 4DSIA 3QBWA 4DTPA 1RT1A 4KPYA 3EE8A 1CXUA 3SQ2A 3JS6A 3LZIA 2P9KA 3IMXA 5JLFA 4F3TA 3VEXA 1VQ4N 2XY5A 4H0YB 3TTFA 1VQ8N 1NLVA 5JVHL 3VQAA 3PX4A 1JLGA 1NM1A 3DLHA 2O8BB 1KVCA 4O8KA 4DLGA 4JAXA 4YOTA 3THXA 2YI1A 3NE6A 4I9QA 1GLDG 5KI6A 2XRIA 3K58A 3OYGA 1I39A 4B8AB 3CXCM 3CF5L 3ZSQA 4I7FA 4YDUA 2YHWA 1WSEA 1WNSA 2YNGA 3MEDA 5EVZA 1NGIA 1B9DA 3T7ZA 5HP1A 2E2NA 4H5RA 3DWLA 4DUZK 3ALYA 2E8AA 3VESA 3L2VA 1U48A 2ZGZA 1NJXA 3V9SA 3P83D 3VQEA 4H5VA 4UY8O 3LZJA 1S6QA 1GOAA 4FJ7A 1FXXA 4DFMA 1BQNA 1NKEA 4GVEA 4JI8K 3ZSYA 3OYAA 3QEPA 2X78A 4FLUA 1T8EA 3LDPA 5AQIA 4B9LA 3A5MC 5TKWA 5JS2A 3CQ8A 3SK3A 4NCBA 3D2FB 4KB1A 4BGBA 3M8SA 3LDOA 4DUYK 3WEEA 4NLCA 5LMUK 1ASWA 4DSFA 4LD0A 4JKGA 2P9KB 4DSKA 5BPMA 3T1HK 3MK6A 1K6YA 1XC9A 3CFOA 3ENOA 3OS0A 5J2QA 4BR5A 2I7NA 3AAPA 2GWKA 1OH7A 1RDUA 4C8NA 3QEXA 3UKRA 4X62K 2FBYA 2HHTA 4O4GA 3THXB 2D0CA 3DLEA 3KHYA 3LAMA 1RGIA 3NF7A 4WE1A 3HI0A 1L3VA 3OYLA 1NJIO 1KC8O 4PL7A 3JXUA 1RBSA 4H8KA 3SUNA 4N41A 1ZXOA 5AFUH 3KKSA 1VSIA 5AQMA 5EU7A 1LAVA 4FZZA 2Q31A 4PY5A 1BGXT 3P1GA 1XMQK 1HR0K 4CEFA 3G71N 3RVCA 4LH4A 2KLAA 4H4MA 3I0RA 4WYBA 1V4SA 4AM7A 5HL7L 4B3RK 4BQLA 4CCHA 2D0AA 4DU1A 4CJUA 3LP3A 2PFUA 4EHTA 1I3AA 1BQMA 4BREA 3AO4A 1KSPA 3OBWA 2G8HA 2DFFA 2E1ZA 4WQ4A 1RT2A 2OPSA 3CC4N 4Y1CA 1HNIA 1BUPA 4W5RA 4JKAA 1YIJN 2F8SA 5KQDA 3LDLA 2VWKA 3VN5A 5AQXA 3HXMA 1QVFM 3CD6N 1N5YA 4B9MA 3O9SA 3WQUA 4BRLA 4ELVA 1ATNA 1W0HA 2PBDA 4J2DA 2RE2A 4CZHA 3PSIA 5EY4A 3FZFA 4DU3A 1OH5A 3OYHA 3T3FA 2P9IA 1WSHA 4K41A 4JKGB 2PZSA 5AQSA 2ZJRL 3L2RA 3IRXA 2QI2A 1RBUA 3OBYA 4CBWA 1T03A 2VWBA 4K8ZA 1L3TA 3AVAA 4DR5K 4DTNA 3UKRB 4C8KA 3OYFA 1NMNA 2QTDA 4KTZA 1BI4B 3NVMA 3EL2A 1RDCA 5LJWA 1NNEA 5J2MA 2IAJA 2FC0A 2J4RA 2V7YA 1QHAA 5C2FA 1L5UA 5KGWA 3L6QA 3EEQA 4CJQA 3QNNA 4IFEA 1CZ9A 4JI2K 4H0VB 2QA4N 3MX5A 1KFDA 1QSLA 1HKGA 4CJPA 3PO5A 1MU2A 3SMSA 2QW9A 3NDKA 4DTUA 5FROA 4CGJA 4QS9A 3I56N 1QZ5A 5C42A 1K8AO 3MEGA 4H0PA 3TAFA 2A5XA 4OKKA 2F96A 2QEXN 2VG5A 1JCFA 1K9MO 5BN8A 3R3LA 1WSGA 3JSMA 1JCGA 3OYNA 5BRHA 2FBVA 3KD5E 4KH5A 4ISFA 4CGGA 4CHOA 4FWSA 2W6LA 3A8YA 1N32K 2VQFK 4B1ZA 4IEIA 5EX5A 1QZ6A 4JKCA 4JV5K 2UXCK 4FLWA 1TKXA 3LANA 3MAQA 2P9IB 2NLXA 3TR8A 2ATQA 2I7PA 2RPIA 3FZKA 2ZJPL 1IG9A 1VQLN 2FF3B 3L8BA 4J8FA 4WFNL 3WXMB 4KFBA 4Z4HA 1C6VA 3VQ9A 4DKWA 4DQIA 1EQYA 3VEYA 3O5BA 3NAEA 2Z1HA 2UU9K 3P5JA 1S3XA 5SWMA 4PQUA 2A40A 4DTOA 4DFPA 2Y1JA 2QWPA 5CYQA 3DOKA 1R0AA 2P9SA 2NRRA 1GOCA 4OX9K 3LWLA 4CVNE 1FW6A 2ASOA 4M42A 4BRQA 4CD1A 2F9WA 3LP0A 5I9EB 4YOXA 5CZ2A 2ZQBA 2FSJA 4E1NA 4A62A 4IFYA 3I8BA 4CJRA 3OS1A 5DMRA 4XH1A 4B1UB 3HSTB 2UXBK 4OKJA 1Y64A 3AO1A 3CC2N 4BE1A 2OZSA 1NGGA 3OY9A 3L3VA 5TKYA 1LV5A 3NGZA 3KLEA 1NK9A 3VQPA 1ZBHA 4DV2K 2QKKA 4IOAL 2ZWHA 4F8RA 4LF9K 1GLBG 4WCEL 2GTDA 4IFVA 4JN4A 2Q2RA 1U2VA 3K5LA 3KZBA 1O1WA 3NMUA 3NFAA 5JS1A 3WXJA 4IDHA 5J1EA 4Z4CA 2EWSA 2QWOA 1OH8A 2NRTA 4ZHRA 2QXLA 3NH0A 1CLQA 1OVYA 3O4NA 3UB5A 4YOVA 3VF6A 2DPNA 2OA8A 2WBNA 4O55A 4DB3A 1J6ZA 1RTIA 4FM2A 1TL3A 4PKHA 3ZX2A 4B9NA 1X9WA 4JEPA 2BGGA 4CEOA 2UYTA 4FPAA 3KWIA 2QWRA 4L3QA 3WXIA 4FWPA 4BRCA 2P9SB 5FDLA 4HWIA 5M1OA 4BDPA 4R79A 4DFJA 2QWQA 4E3SA 2A41A 2GX9A 2WC9A 3A5NC 3C65A 4LC9B 2ZGYA 5C0YA 5KPZA 1VAZA 1ZBUA 3LPUA 4MFBA 3OJUA 1YVNA 1IKXA 4GW6A 4WQ5A 3U8XA 3WT0A 5HRNA 4GVMA 1YAGA 4FZYA 4TSXA 1ASUA 1KVAA 1VSKA 4DTSA 1NGEA 4MDBA 1D9FA 5LJVA 5GIOA 1XQSC 4CHZA 4FLZA 1U04A 1S9EA 3P31A 4MDAA 1WOQA 2E2PA 3I8DA 5E84A 4RW9A 1IH7A 3O8MA 4CZJA 1VK0A 5HLFA 3TWHA 1ZBLA 3HPGA 5C25A 3OYEA 3MN6A 4DMNA 4DCHA 4FLYA 5FPEA 2BE2A 4J2BA 2UUCK 2B4JA 4CIGA 3BY5A 3FZMA 5JICA 1U2VB 3RR7A 4EAHD 4GKKK 3M3ZA 3CJBA 3WNEA 3O1BA 1KAYA 5AQQA 3ZSZA 1NKBA 3RR8A 1KFSA 4FVMA 4CJTA 4RW7A 4JI7K 5EXWA 2YJEA 2G8KA 1BL3A 4LH5A 1NWKA 3HK2A 5BPNA 3IKMA 4JKFA 4E0DA 3PUFA 1HPZA 4BDYA 3IDHA 1TUYA 1RT5A 5DM7L 4KH6A 2KW4A 4IG0A 3H45C 2RHKA 4FSVA 1Q9YA 3QETA 1HRHA 1M90O 3VA3A 3IS9A 1DT9A 4RW8A 4M3ZA 1XNQK 3KLHA 3DOLA 4DV1K 1KAZA 4O5FA 4CBXA 3RMCA 5KQ8A 1JJ2M 2P9UA 1GOBA 1SL1A 3VEWA 1NGAA 4UQGA 1KQSM 4RWTA 4NXNK 4FWNA 1YF5L 4DG1A 2HBKA 3F9KA 4I2QA 1X1PA 2P9NA 3ZSXA 2FBTA 2ZJQL 3HT3A 4KHUA 3CYMA 4FJJA 3CCVN 2OPPA 4BC3A 4OPJA 1RILA 5AZIA 1HUXA 5GAHP 3SAHA 3ASMA 1SL0A 4JKEA 3AVMA 3LP2A 4OPHA 3HVRA 3IAYA 4AHTA 1BIUA 2NRXA 4DTMA 3HOTA 2E88A 2VCPA 2P9LA 5FPDA 2E2OA 4NXMK 1VQNN 3ENBA 1EP4A 3S3NA 4FL9A 1S1TA 5FRMA 2G8WA 2P51A 3P4IA 4BWMA 4ILJA 4NYNA 3MCPA 5AQZA 2VWJA 3L4IA 3TARA 2V52B 1HQEA 3H46O 1GLJO 4MLHA 4HTLA 2IVPA 1NU0A 1SKRA 1S6PA 4KHPK 2GBZA 1N34K 1TKTA 1YVUA 3MN7A 2KZMA 3PSFA 4BQZA 4DV4K 1S22A 3VGKA 1QQNA 3EZ5A 3CMAN 2EHGA 3MN5A 3SV4A 3V81A 2UXDK 1HMVA 4B3TK 4DS4A 1UWBA 4CEBA 4A61A 2OPQA 5ADXA 4CK1A 5M1KA 3G4SN 2CH5A 2HNDA 2A1RA 1X9MA 4H0OA 2O4GA 3SLCA 2WFBA 3CETA 3SAFA 4CZLA 2YV0X 1NMDA 1BG3A 2P9UB 5FLXO 2Q97A 1VQ6N 3JAMO 1SAZA 1SKWA 4OGEA 3LDQA 1RBRA 1XUPO 4M7YA 5CR4A 1IV0A 1D5AA 2NRHA 2P9NB 4O8UA 3QEVA 1KXPA 3U9ZA 4B1XB 3U3YA 3RSEA 2GV9A 1DTTA 3ID6A 1S1WA 4DQPA 4K42A 5I3UA 5AZIB 3VF4A 1TK8A 1YT3A 2Q0RA 2FSKA 2BTFA 2PAVA 1LCUA 3ZT2A 3S41A 1D4XA 1BA0A 1BOTO 5AQWA 4HTUA 1K8KA 4NCAA 3TSUA 1XHZA 4BR4A 3K5NA 2P9LB 1ZC6A 1NJZA 5KPTA 1C0FA 3QICA 4KBOA 2Q1NA 5CYMA 2V51B 3K59A 1XC3A 2NNWA 3F5TA 5LMNK 2BH1A 4CE9A 3SPYA 2OTLN 2Q0UA 3VQ6A 3DLLL 2KFNA 1QSSA 4ILGB 4DSJA 1T44A 3H6EA 3V9XA 3CJAA 2NZTA 1VQKN 2GEMA 1BISA 5GAGP 2AJQA 2NRWA 3ATUA 1T6DA 1LWFA 1X9SA 2HF3A 2IVOA 3QERA 2E5LK 5JLHA 4ID5A 4BR9A 2P1JA 1C0TA 4Z4FA 5AZJA 4WQ4C 3DRPA 4FJKA 1KVBA 1RDDA 3UIQA 1LAWA 5BRFA 3PLAA 3CJ7A 3ZX0A 3AV9A 3FGUA 4X66K 4NYFA 3QB0A 4HCBA 4B9UA 1QE1A 4DV6K 4JRQA 3THWA 3RTVA 5C12A 5BREA 5IWAK 3ENHA 4C1NK 1HYVA 3CM5A 4DR2K 3ITHA 2LSNA 4BRNA 4ZTJA 1RTJA 2JGUA 4YHHK 3AO5A 1QTMA 3HYFA 4CBUA 3C94A 4C23A 5FRNA 3CPWM 3RSEB 2X74A 4AILC 5DK5A 3ZX3A 3EO3A 3S3OA 1DGKN 4IO9L 1BI4A 1HPMA 4C1NI 3TAEA 3RMAA 3GOIA 1K8KB 5FPMA 2KKZA 2D0PA 4E89A 3CCRN 3AVNA 1WAFA 4H4OA 4FJGA 3TSQA 2QWLA 3E9OA 1VRUA 2YHXA 3BF3A 3AVCA 3BDPA 4DFKA 5M1QA 3MXJA 1UA1A 1DTQA 4FK4A 2AA4A 1VQ7N 4PKGA 4B1VA 4BRMA 3B6PA 3ZCMA 4E7IA 2DFHA 4U67L 3DI6A 4EZ9A 4WF9L 3D0PA 1RCHA 3Q7CA 4FOIA 1C0UA 4AHUA 1YITN 3AARA 1NK5A 1CZBA 4HUEA 1T3VA 3SBTA 4AHSA 2NUBA 5AZJB 1KLNA 4DR7K 4CZEA 4AM6A 1KCFA 2YCHA 3BP8A 3ISNC 4FJHA 4OGCA 3E01A 4NB4A 3CCEN 3DXKB 1ZBIA 3QLHA 2JWLA 1SKSA 5IT9O 1DLOA 2YJFA 3THWB 5GIPA 4JS4A 3U9DA 1J54A 4M3XA 5ELZA 4DR4K 4CFDA 4BC4A 1HNVA 5LY3A 1D8YA 3AVGA 3O80A 4A2BA 3ATVA 3AVIA 5AQNA 1KRPA 1Z6RA 4FOEA 3W3DA 1N8RO 2GELA 4LF6K 3AVJA 4AHCA 2P9PA 3H1VX 2NRVA 4M3WA 3T19A 3J7ZO 1VSDA 3R1XA 1DEJA 3DLRA 4JI5K 3ZETA 4JNEA 1JKHA 1TYQA 4E7LA 3WNGA 3R6MA 3BZKA 3VQCA 4A5AA 4YOWA 1S1XA 5F1XA 3B6OA 2VG6A 4CIEA 2KFZA 5KGXA 4FZXC 3A0IX 1E3MA 3KTQA 3QESA 3TAMA 4CHQA 5I42A 1A5XA 5CHIA 1YUWA 2O8CA 2YKNA 1VSEA 3VA0A 3MEEA 2HHHK 3VTIA 5BRDA 1JXEA 3J81O 4J2EA 3KK3A 2YX6A 1CXQA 1LW2A 4IJNA 5SZTA 1NK6A 4JLHA 1T7PA 2WOMA 4YFUA 2UUAK 4A57A 1BA1A 4CW7B 4B3MK 4MO4A 1CZAN 4I2PA 3WUHA 3HM9A 3AAQA 3IFRA 2VQEK 3NF8A 4M3TA 1E4FT 2CGLA 2A1SA 2QK9A 3FLCO 1NOZA 3D7EO 2FLOA 1VSLA 2ZF5O 2Z1JA 3AGRA 2RKIA 3R9PA 3M6GA 3WNFA 1M1KO 2GWJA 3VEZA 4CFAA 1TVRA 1RT3A 1VQ9N 3D2EA 4DSEA 1WSIA 3OA9A 3CC7N 1C1BA 1FKOA 1Q81O 3U4LA 3A5OC 1BU6O 4IDKA 5KPRA 2NRZA 2X6NA 1KTQA 4DTXA 4BRIA 3QBXA 4BC5A 4M3RA 3SQ1A 4OO1J 3V1OA 1NBWA 2P9PB 2BDPA 3O3FA 3IG1A 1RTHA 1TAQA 4BR7A 2RF2A 1C0GA 3O3HA 1NG9A 4KREA 4DQQA 3ZETB 3L0QA 1TYQB 3M8RA 2EX3A 4DTJA 1VQON 3CERA 3THVA 3VGLA 1HLUA 1RDWX 2YNFA 1VSFA 3TABA 5A2QO 3HP9A 1UOCA 4V19S 2G8VA 2D1KA 4FWOA 4CZMA 3QFUA 3THYB 1A5VA 4W5OA 3SBGA 3PIOL 3NBPA 2O8CB 3VETA 4QS8A 3KD1E 2D0BA 5HBMA 3FZLA 3ZT3A 3MDQA 3TTCA 1N6QA 3LDNA 3O9QA 4RG8A 3O08A 1MA9B 2ASPA 3MMVA 2O8EA 4CJKA 3AVFA 4MLEA 3ZSVA 4CJ3A 3HO1A 5C10A 3MCAB 3C6UA 4OLAA 1R59O 1JLFA 1Q9XA 1SV5A 3F2KA 3TSPA 3ULEA 2OANA 4XEIA 5J2NA 3D2EB 2Z1GA 4KAZA 4JYAK 2FF6A 1JLBA 4JS5A 3C0BA 4FM0A 2CGJA 4OLBA 3W0LA 3L3UA 4Y1DA 5EOYA 3SNNA 4LFAK 4K0KK 5E41A 4FWLA 4PUOA 4PWDA 4IKFA 2XO7A 5DM6L 3CQXA 2E6LA 3H1QA 4CHNA 4HHTA 4PHTX 1LOTB 2X6SA 4CFCA 4CJSA 3AVHA 4RW4A 5KRTA 4DV7K 4F2SA 3AVBA 2YHYA 2VYPA 3VERA 3D45A 2WTUA 1JLAA 3V9UA 1NK0A 4HUFA 2HMPA 5AQVA 2DY4A 1VHXA 1FKPA 4CJEA 2Q3SA 4EHUA 2HBLA 2A3ZA 3VENA 4ILHA 2F9TA 2IOCA 1WN7A 4A2AA 3U3GA 5BN9A 1RFQA 4L8RB 4X64K 3ZSRA 3OYIA 1GLAG 4CZFA 4IOCL 1XI1A 3BZCA 5AQLA 1WLJA 4BROA 1O13A 4CK3A 3SCXA 3LWMA 2F8TA 4DHYA 1WB9A 2HB5A 4EFHA 5H1SQ 2O8EB 1RT4A 3C95A 1NGHA 3BGRA 3KIOA 3UE5A 1WUAA 1ILYA 4BWJA 5HROA 3EE9A 4QAGA 4CJWA 1JCEA 3O9RA 1SQKA 3OTOK 1S72N 1HYZA 4FM1A 3MX2A 3ULEB 4NLBA 3PIPL 3QNOA 1WBBA 3BEXA 2WONA 3FR0A 4LSLA 3L4QA 4J2AA 4IWVA 3SV3A 4M63C 1SS6A 3O1WA 5AFUA 3AVLA 5CE3A 4KO0A 4FJMA 4EP5A 1YI2N 3RMBA 2KZZA 1QS4A 2YHBA 2GUPA 3MN9A 4BACA 1VQ5N 1JL2A 3K9KA 1IO2A 4XH5A 1C0MA 4DV0K 3KWGA 1IBKK 1P90A 3PX6A 1NGBA 2PYJA 1HNZK 3NF9A 2D5RA 3K5MA 4GMJB 3SJHA 1BCOA 3ZT4A 3HL8A 1J9AA 2BUPA 1U4BA 3ULDA 2UUBK 4IBNA 4LF8K 1ZBSA 4IO8A 4A5BA 1IKYA 4CF0A 1EETA 4FW1A 3O4QA 4ISEA 3DJCA 4B8CA 3LP1A 1BCMA 3EYZA 4JK8A 5C2DA 5M1FA 3FFIA 5C15A 4Z4EA 3QFPA 2HW3A 3V9WA 4LF4K 3HOSA 5JVGL 1N33K 1Z26A 4YOYA 3ZSOA 3SQ4A 1RDBA 3BUZB 1C1CA 3WQTA 1GLEG 3C7NA 3CCMN 4DWIA 4IG3A 3QIOA 3DM2A 3SJJA 3VQ8A 4BG8A 1JLCA 4KKOA 3J8AA 2HBJA 4NO7A 4CEZA 3CFPA 4BRKA 4RTFD 5GADP 3CFRA 4KRFA 3SAGA 4YDUC 3OW2M 3VQ5A 3M1FA 5HRRA 4ID1A 4B9VA 3VEVA 3V4IA 1TUUA 3H3OB 3I33A 3GDQA 5BPLA 3CM6A 1FJGK 2YHAA 4HCCA 1E4GT 4CF2A 4DV5K 4BRPA 4CECA 4R5PA 4RW6A 3RRGA 1Q8IA 2B5JA 4JD2A 1HQUA 4DQ8A 4YY3K 4FXDA 1W97L 4M3UA 1I94K 4OKEA 4O0JA 1GLLO 4FJXA 3CJCA 2IDOA 3HSCA 3PO4A 2KQ2A 4WFAL 1IKWA 1TKDA 3B8AX 1WBDA 3S9HA 3O9TA 5KTQA 3K0SA 4FJ5A 4F3OA 4KHNA 1YTUA 3M8PA 1QQCA 2HHWA 4Z4GA 1QVGM 1LW0A 4AQYK 4FWQA 4FJNA 2CH6A 1VSJA 2W42A 2Z1IA 4M3YA 1D9DA 3WNHA 4N56A 5AR0A 1RDAA 4CFBA 2ASMA 2FSNA 3OHRA 4CGDA 4JRPA 1TK0A 3C7NB 2E1YA 1BHLA 1V4TA 1G99A 5AQKA 1OKJA 4KV8A 3IUCA 1Y97A 2E2QA 5AQTA 4K43A 3F73A 1VRTA 3ZLJA 4YOUA 1IJJA 2AP1A 1QQMA 4N47A 4M45A 3MWTA 3AY9A 3SQ0A 2ITGA 2Q36A 3VQQA 3GL1A 4KHWA 2HHXA 1DKGD 1NGCA 3P38A 5AJ3K 5HRPA 3OYBA 3VOVA 3P39A 3E9LA 4GKJK 3EY1A 1REVA 3Q7BA 1RBVA 4I9LA 1YHQN 3HM8A 1S1VA 2FBXA 3TU5A 3NHGA 4JD2B 3OYKA 1XWLA 3TANA 4E7JA 2G8UA 4LF7K 3GG4A 4Z4IA 3OYMA 1ITGA 4GV9A 4AHVA 1QSYA 4BVPA 3KK1A 1L3UA 5B8HA 4GV3A 4CGIA 2IIRA 2F4VK 3DXKA 4BVOA 4CJ7A 2H3GX 1NGJA 4Y0WA 3SMPA 1OVQA 2BANA 4CGHA 2E6MA 4CGFA 3T1YK 5LL6Z 3ID8A 3QDKA 2HMIA 4HUGA 2W40A 2ZD1A 1NK4A 4LY7A 1VQMN 4GV6A 3KK7A 4A59A 2W41A 2QWMA 4CEEA 4E19A 3CCJN 3J7AP 4CEDA 1NK8A 3TAQA 5BR9A 1KAXA 2A42A 3K9JA 5T7BA 4GNIA 2XHBA 1ATRA 4BR2A 1ESVA 3PV8A 3DLBA 3HP6A 2DTUA 4H5TA 4E7KA 1L3SA 3U6FA 4I6MA 3LPTA 4DSLA 3DAWA 1ASVA 3NF6A 3SUQA 2O4IA 2OYQA 4BRAA 3I55N 4XH4A 1RTDA 2QKBA 1W7AA 4JKBA 4CJFA 1YJWN 3S3MA 4CZKA 2E4LA 5GINA 2D4WA 4RCHA 5MLCQ 3G0ZA 1BWFO 4G1QA 4FWMA 4CEAA 4OPKA 4B3OA 3CG7A 3G6EN 3CJ9A 2HHVA 1Z05A 3LM2A 4B9SA 1MWKA 2VGMA 1U49A 1GLCG 4BC2A 1WSJA 2DFEA 2WUSA 1KD1O 1S5JA 4BRDA 3C6AA 1HJOA 3NVKA 4CJLA 3F9MA 4CERA 1RBTA 3JYTA 1F21A 3VF2A 4DQRA 4G9ZA 3TAPA 4BR0A 3E66A 4B1YB 1S1UA 1NGFA 3LDSA 3L2UA 2OTJN 4CJ5A 3WEEB 3WXLA 3SYZA 1J53A 2GUIA 4BDZA 5E26A 3OJSA 4CD3A 4CHYA 4BRHA 4LFBK 3QIPA 2Y1IA 4KHQA 1XNRK 3QMLA 3VPZA 4IEEA 3CQYA 3DLGA 2FXUA 4I6MB 1BO5O 1T05A 4YNQA 1Q82O 3FZHA 1IBLK 3DXMA 3AA2A 4BRGA 3OYCA 4KTQA 4BE2A 4BRFA 3GBTA 1YJNN 3LM9A 4ISGA 3RRHA 3THYA 3QINA 4JHDA 4LSNA 5AQPA 4IZ9A 1QHTA 3KJVA 3ZEUA 4FO0A 3QEWA 5AQOA 5FPNA 4YORA 1EX4A 2ETJA 1NKCA 3H08A 4IOXA 5AQRA 2HNZA 3E1YA 1TL1A 2QM1A 2XY8A 4DR3K 3J80O 3O3GA 2PY5A 5ADXH 3H3NO 1HKBA 2HOEA 3AO3A 1YTAA 4E7HA 3ZYYX 3L2WA 4FJ8A 1X3NA 4DS5A 4CK2A 1J5OA 3EKSA 4KH4A 3FE1A 3N4PA 2HBMA 3QEIA 3O9UA 1TK5A 1HNWK 2KTQA 4JI4K 1U6ZA 4LFCK 4AF1A 3AA3A 1EO1A 2HSTA 5JMVA 3LALA 4N5SA 1B9FA 4EP4A 4CJVA 2E20A 1VSMA 1XHXA 4MQ3A 4W5NA 4E1MA 4FJIA 1VSHA 3VQBA 4EIAA 3KLGA 4CEQA 1BIZA 3DYAA 3FFKB 3DLKA 3LL3A 4DR6K 3NGIA 2YNIA 1JXBA 1TV6A 2O8FA 3DXMB 4KHYA 3V1RA 4FVUA 5BR8K 3HJFA 3KVGA 4B9QA 1GLFO 5AQGA 4JHDB 1N36K 3O6WA 4BG9A 4JK7A 3DRSA 4CESA
chains in the Genus database with same CATH topology
3ZEUB 3S41A 3O9SA 1YI2N 1D4XA 4WQ5C 1BA0A 3WQUA 4BRLA 1BOTO 2HF4A 5AQWA 1K8KA 3VGMA 1ATNA 3E9PA 3TSUA 2PBDA 2GUPA 3MN9A 2RE2A 1VQ5N 4BR4A 4CZHA 2P9LB 3K9KA 4XH5A 1ZC6A 1HKCA 5AQXA 3FZFA 5EY4A 5KPTA 1C0FA 3QICA 4PKIA 3KWGA 4KBOA 2Q1NA 1P90A 1NGBA 2P9IA 4K41A 2V51B 3HRGA 4JKGB 5M1PA 5AQSA 5F2RA 1XC3A 2ZJRL 2NNWA 3F5TA 3SJHA 1IG8A 2QI2A 2BH1A 2BUPA 3OBYA 4CBWA 2OTLN 2Q0UA 3CI5A 3DLLL 1QQOA 2VWBA 1ZBSA 4IO8A 3TTDA 4A5BA 4ILGB 4Z94A 4ISEA 1T44A 3DJCA 3H6EA 4H0TB 3CJAA 2NZTA 1VQKN 2GEMA 3UKRB 4JK8A 5GAGP 3CPEA 2NRWA 2QTDA 3ATUA 3N4QA 1T6DA 5C2DA 1HX1A 4JK9A 4IJAA 2HF3A 5M1FA 3NVMA 2IVOA 3EL2A 5JLHA 5LJWA 4BR9A 5C15A 2J4RA 1K73O 2V7YA 3QFPA 5AZJA 1QHAA 5C2FA 4WQ4C 3HOSA 5JVGL 1Q18A 4YOYA 2KHOA 3GE1A 3L6QA 5BRFA 3BUZB 3CCMN 3WQTA 1GLEG 1NGDA 3C7NA 3PLAA 3CJ7A 3ZX0A 3FGUA 4IFEA 4H0VB 4BG8A 2QA4N 3QB0A 3MX5A 3J8AA 4F9OA 2HBJA 1HKGA 4NO7A 4JKHA 4GY2B 4BRKA 4IXCA 4RTFD 5GADP 5M1NA 3SMSA 3SAGA 2QW9A 4YDUC 2CGKA 5BREA 3ENHA 4C1NK 5C12A 2IVNA 3OW2M 3M1FA 4QS9A 3I56N 3CMEN 4M7XA 4QS7A 1QZ5A 4BRNA 4U7BA 3VEVA 1K8AO 4H0PA 1VQPN 1TUUA 2A5XA 3H3OB 3I33A 4CBUA 4CZIA 4C23A 3GDQA 2QEXN 3TPQA 5BPLA 1JCFA 3CPWM 1K9MO 5BN8A 3RSEB 3R3LA 5AQFA 3ZX3A 1JCGA 3EO3A 1DGKN 4IO9L 1E4GT 1HPMA 5BRHA 4H5WA 4BRPA 2QWNA 4KH5A 4C1NI 4ISFA 1W2BM 3GOIA 4JD2A 1K8KB 5FPMA 4FWSA 2KKZA 3A8YA 2D0PA 5AQHA 4DQ8A 3CCRN 1W97L 4B1ZA 4IEIA 5EX5A 1QZ6A 1GLLO 4JKCA 4B1WB 4K25A 3WXKA 3TSQA 2P9IB 2NLXA 2QWLA 2V7ZA 2I7PA 3E9OA 3FZKA 2ZJPL 1VQLN 2YHXA 2FF3B 3CJCA 4PL8A 3BF3A 3HSCA 4J8FA 4WFNL 3WXMB 4WFAL 5M1QA 3B8AX 4DKWA 3O9TA 2AA4A 1VQ7N 4PKGA 1EQYA 3VEYA 3G25A 3O5BA 4B1VA 4BRMA 1S3XA 2A40A 3EKUA 2QWPA 4U67L 5AQYA 1QVGM 4WF9L 2P9SA 2NRRA 1MWMA 3Q7CA 4FWQA 4FOIA 1YITN 2CH6A 3AARA 2ASOA 3CCUN 3O4WA 4BRQA 4CD1A 3CHWA 2F9WA 5F0XA 5I9EB 2D0OA 1T3VA 4YOXA 1MDUB 4CI6A 3SBTA 5AZJB 2FSJA 5AR0A 4A62A 2ASMA 2FSNA 5HOOA 3OHRA 4CZEA 4AM6A 2YCHA 3BP8A 3I8BA 3C7NB 2E1YA 4NB4A 3UKUA 4BY9C 1V4TA 1G99A 4FPBA 4XH1A 3DXKB 5AQKA 3CCQN 1OKJA 3CCEN 2JWLA 4B1UB 2VGNA 3IUCA 2E2QA 5AQTA 1Y64A 3EN9A 3CJ1A 4K43A 1SZ2A 5GAEP 2YJFA 3CC2N 5GIPA 4YOUA 3U9DA 1IJJA 2AP1A 1NGGA 1QQMA 5ELZA 4BC4A 5TKYA 3MWTA 3T69A 3AY9A 5LY3A 4OPAA 3O80A 4A2BA 3ATVA 5AQNA 2Q36A 1Z6RA 4FOEA 3W3DA 1N8RO 2GELA 3GL1A 1H1VA 2P9PA 3H1VX 4CZGA 4IOAL 2NRVA 3BF1A 2ZWHA 3J7ZO 3R1XA 1DKGD 1GLBG 1NGCA 1DEJA 3P38A 4WCEL 3VOVA 2A6AA 3P39A 3ZETA 2GTDA 3E9LA 4JN4A 4JNEA 2Q2RA 1TYQA 3VMFB 1U2VA 3R8EA 3KZBA 3Q7BA 3NMUA 3R6MA 1YHQN 3HM8A 3TU5A 1Q7YO 3WXJA 4MO5A 4JD2B 4IDHA 4A5AA 4YOWA 4FWKA 4FWRA 3GG4A 5F1XA 2EWSA 2QWOA 2NRTA 2QXLA 4GV9A 4BVPA 4GV3A 5B8HA 1OVYA 2IIRA 3A0IX 3DXKA 3UB5A 3M5RA 4BVOA 4CJ7A 2H3GX 2JWKA 1NGJA 3A5LC 4YOVA 4Y0WA 3VF6A 2DPNA 4H0XB 3SMPA 4BGAA 3CCSN 2WBNA 4DB3A 5CHIA 4H5NA 1J6ZA 1YUWA 3ID8A 3QDKA 3MWPA 3C6HA 2W40A 3VTIA 4PKHA 1BDGA 3ZX2A 1T6CA 1X9JA 1P8ZA 2F7TA 4H03B 5BRDA 2YX6A 4IJNA 4JEPA 1VQMN 4GV6A 3KK7A 4A59A 2W41A 2QWMA 2UYTA 1YJ9N 3AGKA 4A57A 3CCJN 4FPAA 3KWIA 2QWRA 4L3QA 1BA1A 3VEOA 3WXIA 5BR9A 4FWPA 1KAXA 4WFBL 4MO4A 1CZAN 4BRCA 5AQJA 2P9SB 2A42A 4HWIA 1Q86O 3K9JA 3WUHA 5M1OA 3AAQA 3IFRA 4R79A 1X3MA 2QWQA 1E4FT 2CGLA 4GNIA 1ATRA 4BR2A 1ESVA 2A41A 3FLCO 2GX9A 2WC9A 3A5NC 3C65A 3D7EO 3HTVA 4LC9B 2ITMA 2FLOA 3CD6N 2ZGYA 5C0YA 4JKDA 1ATSA 4E1JA 1VAZA 4H5TA 5KPZA 2ZF5O 3AGRA 4I6MA 1YXQA 3R9PA 3M6GA 3EZWA 5AQUA 1YVNA 3DAWA 1M1KO 4BRAA 3UKUB 2GWJA 4WQ5A 3VEZA 3U8XA 4XH4A 3WT0A 3I55N 1VQ9N 3D2EA 3VTHA 1YAGA 3HBTA 3CIPA 3OA9A 1NGEA 3CC7N 4MDBA 5LJVA 5GIOA 1XQSC 4JKBA 1YJWN 1Q81O 3CCLN 3U4LA 3P31A 4MDAA 1WOQA 2E2PA 3A5OC 5E84A 4CZKA 1BU6O 5KPRA 3O8MA 2NRZA 5GINA 4CZJA 2D4WA 4RCHA 5MLCQ 4BRIA 3D2FA 3QBXA 4BC5A 4OO1J 3D6RA 1BWFO 4FWMA 1NBWA 2P9PB 3HZ6A 3MN6A 4DCHA 3QBWA 3G6EN 3CJ9A 5FPEA 3EE8A 4BR7A 1Z05A 3JS6A 3LM2A 2P9KA 1C0GA 1MWKA 2VGMA 3IMXA 5JLFA 1GLCG 3ZETB 3VEXA 3L0QA 4BC2A 3FZMA 1TYQB 5JICA 1VQ4N 1U2VB 4EAHD 2WUSA 3M3ZA 3CJBA 1KD1O 4H0YB 3O1BA 3C6AA 1KAYA 3TTFA 4BRDA 3CERA 1HJOA 1VQON 1VQ8N 1NLVA 5AQQA 3VGLA 5JVHL 1HLUA 1RDWX 3NVKA 1NM1A 3F9MA 5EXWA 4O8KA 2YJEA 4JAXA 4YOTA 3VF2A 2D1KA 4FWOA 2YI1A 4CZMA 3QFUA 1NWKA 3SBGA 5BPNA 3IKMA 4JKFA 4G9ZA 1GLDG 3PIOL 3VETA 3IDHA 4BR0A 4QS8A 1TUYA 3E66A 4B1YB 5DM7L 4KH6A 3H45C 2RHKA 4FSVA 3FZLA 1NGFA 3CXCM 3CF5L 3MDQA 3TTCA 1M90O 4YDUA 2OTJN 3LDNA 3WEEB 2YHWA 1DT9A 3O9QA 3WXLA 5EVZA 1NGIA 3T7ZA 2E2NA 4H5RA 5E26A 3O08A 3DWLA 1MA9B 2ASPA 3MMVA 1KAZA 4CD3A 2E8AA 4O5FA 3VESA 4MLEA 4BRHA 4CBXA 5C10A 5KQ8A 1JJ2M 2ZGZA 3MCAB 2P9UA 3VEWA 1NGAA 3QMLA 3VPZA 4IEEA 3CQYA 4H5VA 4RWTA 1KQSM 4FWNA 1YF5L 4UY8O 2HBKA 2FXUA 4I6MB 1BO5O 2P9NA 1R59O 1Q82O 3FZHA 3F2KA 3DXMA 2ZJQL 4BRGA 3TSPA 3ULEA 2OANA 4XEIA 4GVEA 4BRFA 3D2EB 3GBTA 1YJNN 2FF6A 3LM9A 4ISGA 3CCVN 4BC3A 4JHDA 5AZIA 1HUXA 5AQPA 5GAHP 3C0BA 4IZ9A 3SAHA 2CGJA 3LDPA 4JKEA 3ZEUA 3W0LA 4FO0A 4OPHA 5AQIA 5EOYA 5AQOA 5FPNA 4YORA 3A5MC 2NRXA 5TKWA 4FWLA 3SK3A 3HOTA 2E88A 2VCPA 3D2FB 4IOXA 5AQRA 3CQXA 4BGBA 5DM6L 3E1YA 2P9LA 3LDOA 3WEEA 5FPDA 2E2OA 3H1QA 4NLCA 1VQNN 2QM1A 3ENBA 4FL9A 4PHTX 4JKGA 1LOTB 2P9KB 5ADXH 5BPMA 3H3NO 3MK6A 1HKBA 3P4IA 2YHYA 2HOEA 4ILJA 2VYPA 3MCPA 5AQZA 3ENOA 3VERA 3L4IA 2V52B 3H46O 1GLJO 4MLHA 4HTLA 2IVPA 4BR5A 2I7NA 2HMPA 3AAPA 5AQVA 3ZYYX 2GWKA 1X3NA 3MN7A 4EHUA 2HBLA 2A3ZA 1RDUA 3VENA 4ILHA 2F9TA 4BQZA 3UKRA 1S22A 3EKSA 4KH4A 3FE1A 3VGKA 1QQNA 2HBMA 3N4PA 4A2AA 3CMAN 3O9UA 5BN9A 1RFQA 3MN5A 3KHYA 1GLAG 1RGIA 4CZFA 1U6ZA 4AF1A 4IOCL 1EO1A 2HSTA 5JMVA 5AQLA 3HI0A 1NJIO 1KC8O 4PL7A 3JXUA 4A61A 4BROA 1O13A 1ZXOA 5AFUH 5AQMA 5ADXA 4DHYA 2Q31A 2E20A 5M1KA 3G4SN 2CH5A 4EFHA 5H1SQ 3G71N 4H0OA 3RVCA 4EIAA 2KLAA 3SLCA 2WFBA 3CETA 4WYBA 4CZLA 1V4SA 4AM7A 3SAFA 1NMDA 5HL7L 1NGHA 1BG3A 2P9UB 4BQLA 3UE5A 2Q97A 3FFKB 1WUAA 1VQ6N 3LL3A 1SAZA 1ILYA 3EE9A 3LDQA 1XUPO 4M7YA 5CR4A 2NRHA 2P9NB 1JCEA 4EHTA 2PFUA 1SQKA 3O9RA 3DXMB 1S72N 4O8UA 3MX2A 3ULEB 4BREA 4FVUA 3OBWA 4NLBA 1KXPA 2E1ZA 3U9ZA 4B1XB 3KVGA 4WQ4A 4B9QA 1GLFO 3PIPL 3BEXA 3RSEA 3FR0A 3CC4N 3L4QA 1BUPA 5AQGA 4JKAA 3ID6A 4IWVA 4K42A 4JHDB 5AZIB 1YIJN 3VF4A 3O6WA 4M63C 4BG9A 3LDLA 5KQDA 4JK7A 2Q0RA 1SS6A 3O1WA 5AFUA 2FSKA 2BTFA 2PAVA 1LCUA 5CE3A 1QVFM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FVU A;  3MX5 A;  4GV9 A;  4G9Z A;  3R3L A;  3Q7C A;  4GV3 A;  4GV6 A;  3Q7B A;  4GVE A;  3MX2 A;  3MWT A;  3MWP A; 
#chains in the Genus database with same CATH topology
 3ZEU B;  4KB0 A;  4WQ5 C;  1J5E K;  1FK9 A;  2HF4 A;  3VGM A;  3E9P A;  1HKC A;  2ZM6 K;  3PX0 A;  4B9T A;  1TGO A;  4PKI A;  4FYD A;  4W5Q A;  3HRG A;  4KI6 A;  5M1P A;  1B92 A;  5F2R A;  4O5B A;  4O44 A;  1IG8 A;  4DLE A;  1ZYQ A;  3CI5 A;  1NOY A;  1QQO A;  4DU4 A;  3TTD A;  4Z94 A;  4FCY A;  1JL1 A;  4H0T B;  2G8F A;  3CPE A;  1UAX A;  2RN2 A;  3L2Q A;  3N4Q A;  1HX1 A;  4JK9 A;  4IJA A;  1EXQ A;  1RT6 A;  5HRS A;  3KK2 A;  3NGY A;  4M41 A;  3MXI A;  1WSF A;  3DMJ A;  3V1Q A;  1K73 O;  4FW2 A;  4ELU A;  4DTR A;  1XMO K;  2HVH A;  1W9H A;  1Q18 A;  1JLE A;  2KHO A;  3GE1 A;  3VQ7 A;  1IBM K;  2O8D A;  1NGD A;  1IKV A;  3LAK A;  4F9O A;  3KLF A;  1HJR A;  2R7Y A;  4JKH A;  4GY2 B;  4IXC A;  4PA1 A;  3DRR A;  5M1N A;  1SUQ A;  1EKE A;  2CGK A;  3OYD A;  2IVN A;  3CME N;  4M7X A;  4QS7 A;  1EWR A;  3G10 A;  3K5O A;  4U7B A;  1NK7 A;  4JI3 K;  2O8F B;  1NJW A;  3T1A A;  1VQP N;  4CZI A;  3OYJ A;  3J7Y P;  5CY4 A;  3SUO A;  3TPQ A;  5AQF A;  3K2P A;  3ZSW A;  4H5W A;  4JI0 K;  4Z0U A;  3NH1 A;  5K14 A;  2QWN A;  3RWU A;  3NCI A;  1W2B M;  3RMD A;  4Q5V A;  5AQH A;  4F2R A;  4CIF A;  3C6T A;  3ZT1 A;  4O0I A;  4B1W B;  4K25 A;  3WXK A;  1RNH A;  4JI1 K;  2V7Z A;  4CF8 A;  3KLI A;  5KRS A;  1ZBF A;  4PL8 A;  5CZ1 A;  3AA4 A;  4C8M A;  4ICL A;  1NJY A;  1Z25 A;  3PY8 A;  3OS2 A;  4FJL A;  3G25 A;  4K8X A;  1OH6 A;  4X65 K;  4QOZ B;  4C8O A;  1LWC A;  4CJ4 A;  4Q0B A;  4QCL A;  3EKU A;  5AQY A;  4LF5 K;  2IS3 A;  2W6K A;  4KTW A;  4C8L A;  3M8Q A;  5C24 A;  1LWE A;  2HVI A;  1MWM A;  2XY6 A;  3AA5 X;  4AH9 A;  3CCU N;  3SZ2 A;  3ZT0 A;  3O4W A;  3QO9 A;  5F0X A;  3CHW A;  3MEC A;  3K57 A;  2D0O A;  1MDU B;  4CI6 A;  5D3G A;  3HPO A;  2HHS A;  5HOO A;  2IC3 A;  2O8D B;  2OCE A;  4DQS A;  3UKU A;  4BY9 C;  1C1A A;  4FPB A;  3CCQ N;  3AO2 A;  2HHU A;  2VGN A;  2G8I A;  2JLE A;  2HHQ A;  3EN9 A;  3CJ1 A;  5GAE P;  1SZ2 A;  4N76 A;  2ZE2 A;  3VQ4 A;  4KI4 A;  4DR1 K;  4FLT A;  3SUP A;  3T69 A;  4OPA A;  5J2P A;  1TKZ A;  2B6A A;  1H1V A;  4B08 A;  1HYS A;  4CZG A;  3VQD A;  3BF1 A;  3NH2 A;  2P5O A;  1A5W A;  4OJR A;  2A6A A;  4FJ9 A;  3VMF B;  3KKR A;  3R8E A;  2YKM A;  1Q7Y O;  3TI0 A;  4MO5 A;  4F4K A;  3AVK A;  4FWK A;  1JLQ A;  4FWR A;  4DV3 K;  2O8B A;  4OVL A;  2QXF A;  4B3S K;  3M5R A;  1TAU A;  2JWK A;  3A5L C;  4CHP A;  4KHS A;  3SPZ A;  3CCS N;  1EWQ A;  4H0X B;  4BGA A;  4DF8 A;  2OPR A;  1KLM A;  1G15 A;  3HVT A;  4H5N A;  3MWP A;  3C6H A;  1BDG A;  1T6C A;  1X9J A;  1P8Z A;  2F7T A;  4H03 B;  4W5T A;  3V6D A;  1SL2 A;  3V9Z A;  1YJ9 N;  2VG7 A;  2P5G A;  4FK0 A;  3AGK A;  1S9G A;  4BE0 A;  2OZM A;  3VEO A;  4WFB L;  5AQJ A;  4HVJ A;  1Q86 O;  1X3M A;  2I5J A;  4FLV A;  2IGI A;  4ELT A;  1UA0 A;  3HTV A;  2ITM A;  1HNX K;  4JKD A;  1ATS A;  4E1J A;  3MXM A;  1YXQ A;  3EZW A;  5AQU A;  1RT7 A;  1U47 A;  3OVN A;  4FLX A;  3UKU B;  3I0S A;  2PYL A;  3SI6 A;  4NCG A;  4ZTF A;  2YNH A;  3TAG A;  3VTH A;  2XY7 A;  3HBT A;  3CIP A;  4AHR A;  4JI6 K;  3A2F A;  4CF9 A;  3CCL N;  3HPH A;  4DF4 A;  4FK2 A;  4CF1 A;  2HNY A;  1WAJ A;  3D2F A;  1U45 A;  3D6R A;  4EZ6 A;  4XIU A;  3HZ6 A;  4DSI A;  3QBW A;  4DTP A;  1RT1 A;  4KPY A;  3EE8 A;  1CXU A;  3SQ2 A;  3JS6 A;  3LZI A;  2P9K A;  3IMX A;  5JLF A;  4F3T A;  3VEX A;  1VQ4 N;  2XY5 A;  4H0Y B;  3TTF A;  1VQ8 N;  1NLV A;  5JVH L;  3VQA A;  3PX4 A;  1JLG A;  1NM1 A;  3DLH A;  2O8B B;  1KVC A;  4O8K A;  4DLG A;  4JAX A;  4YOT A;  3THX A;  2YI1 A;  3NE6 A;  4I9Q A;  1GLD G;  5KI6 A;  2XRI A;  3K58 A;  3OYG A;  1I39 A;  4B8A B;  3CXC M;  3CF5 L;  3ZSQ A;  4I7F A;  4YDU A;  2YHW A;  1WSE A;  1WNS A;  2YNG A;  3MED A;  5EVZ A;  1NGI A;  1B9D A;  3T7Z A;  5HP1 A;  2E2N A;  4H5R A;  3DWL A;  4DUZ K;  3ALY A;  2E8A A;  3VES A;  3L2V A;  1U48 A;  2ZGZ A;  1NJX A;  3V9S A;  3P83 D;  3VQE A;  4H5V A;  4UY8 O;  3LZJ A;  1S6Q A;  1GOA A;  4FJ7 A;  1FXX A;  4DFM A;  1BQN A;  1NKE A;  4GVE A;  4JI8 K;  3ZSY A;  3OYA A;  3QEP A;  2X78 A;  4FLU A;  1T8E A;  3LDP A;  5AQI A;  4B9L A;  3A5M C;  5TKW A;  5JS2 A;  3CQ8 A;  3SK3 A;  4NCB A;  3D2F B;  4KB1 A;  4BGB A;  3M8S A;  3LDO A;  4DUY K;  3WEE A;  4NLC A;  5LMU K;  1ASW A;  4DSF A;  4LD0 A;  4JKG A;  2P9K B;  4DSK A;  5BPM A;  3T1H K;  3MK6 A;  1K6Y A;  1XC9 A;  3CFO A;  3ENO A;  3OS0 A;  5J2Q A;  4BR5 A;  2I7N A;  3AAP A;  2GWK A;  1OH7 A;  1RDU A;  4C8N A;  3QEX A;  3UKR A;  4X62 K;  2FBY A;  2HHT A;  4O4G A;  3THX B;  2D0C A;  3DLE A;  3KHY A;  3LAM A;  1RGI A;  3NF7 A;  4WE1 A;  3HI0 A;  1L3V A;  3OYL A;  1NJI O;  1KC8 O;  4PL7 A;  3JXU A;  1RBS A;  4H8K A;  3SUN A;  4N41 A;  1ZXO A;  5AFU H;  3KKS A;  1VSI A;  5AQM A;  5EU7 A;  1LAV A;  4FZZ A;  2Q31 A;  4PY5 A;  1BGX T;  3P1G A;  1XMQ K;  1HR0 K;  4CEF A;  3G71 N;  3RVC A;  4LH4 A;  2KLA A;  4H4M A;  3I0R A;  4WYB A;  1V4S A;  4AM7 A;  5HL7 L;  4B3R K;  4BQL A;  4CCH A;  2D0A A;  4DU1 A;  4CJU A;  3LP3 A;  2PFU A;  4EHT A;  1I3A A;  1BQM A;  4BRE A;  3AO4 A;  1KSP A;  3OBW A;  2G8H A;  2DFF A;  2E1Z A;  4WQ4 A;  1RT2 A;  2OPS A;  3CC4 N;  4Y1C A;  1HNI A;  1BUP A;  4W5R A;  4JKA A;  1YIJ N;  2F8S A;  5KQD A;  3LDL A;  2VWK A;  3VN5 A;  5AQX A;  3HXM A;  1QVF M;  3CD6 N;  1N5Y A;  4B9M A;  3O9S A;  3WQU A;  4BRL A;  4ELV A;  1ATN A;  1W0H A;  2PBD A;  4J2D A;  2RE2 A;  4CZH A;  3PSI A;  5EY4 A;  3FZF A;  4DU3 A;  1OH5 A;  3OYH A;  3T3F A;  2P9I A;  1WSH A;  4K41 A;  4JKG B;  2PZS A;  5AQS A;  2ZJR L;  3L2R A;  3IRX A;  2QI2 A;  1RBU A;  3OBY A;  4CBW A;  1T03 A;  2VWB A;  4K8Z A;  1L3T A;  3AVA A;  4DR5 K;  4DTN A;  3UKR B;  4C8K A;  3OYF A;  1NMN A;  2QTD A;  4KTZ A;  1BI4 B;  3NVM A;  3EL2 A;  1RDC A;  5LJW A;  1NNE A;  5J2M A;  2IAJ A;  2FC0 A;  2J4R A;  2V7Y A;  1QHA A;  5C2F A;  1L5U A;  5KGW A;  3L6Q A;  3EEQ A;  4CJQ A;  3QNN A;  4IFE A;  1CZ9 A;  4JI2 K;  4H0V B;  2QA4 N;  3MX5 A;  1KFD A;  1QSL A;  1HKG A;  4CJP A;  3PO5 A;  1MU2 A;  3SMS A;  2QW9 A;  3NDK A;  4DTU A;  5FRO A;  4CGJ A;  4QS9 A;  3I56 N;  1QZ5 A;  5C42 A;  1K8A O;  3MEG A;  4H0P A;  3TAF A;  2A5X A;  4OKK A;  2F96 A;  2QEX N;  2VG5 A;  1JCF A;  1K9M O;  5BN8 A;  3R3L A;  1WSG A;  3JSM A;  1JCG A;  3OYN A;  5BRH A;  2FBV A;  3KD5 E;  4KH5 A;  4ISF A;  4CGG A;  4CHO A;  4FWS A;  2W6L A;  3A8Y A;  1N32 K;  2VQF K;  4B1Z A;  4IEI A;  5EX5 A;  1QZ6 A;  4JKC A;  4JV5 K;  2UXC K;  4FLW A;  1TKX A;  3LAN A;  3MAQ A;  2P9I B;  2NLX A;  3TR8 A;  2ATQ A;  2I7P A;  2RPI A;  3FZK A;  2ZJP L;  1IG9 A;  1VQL N;  2FF3 B;  3L8B A;  4J8F A;  4WFN L;  3WXM B;  4KFB A;  4Z4H A;  1C6V A;  3VQ9 A;  4DKW A;  4DQI A;  1EQY A;  3VEY A;  3O5B A;  3NAE A;  2Z1H A;  2UU9 K;  3P5J A;  1S3X A;  5SWM A;  4PQU A;  2A40 A;  4DTO A;  4DFP A;  2Y1J A;  2QWP A;  5CYQ A;  3DOK A;  1R0A A;  2P9S A;  2NRR A;  1GOC A;  4OX9 K;  3LWL A;  4CVN E;  1FW6 A;  2ASO A;  4M42 A;  4BRQ A;  4CD1 A;  2F9W A;  3LP0 A;  5I9E B;  4YOX A;  5CZ2 A;  2ZQB A;  2FSJ A;  4E1N A;  4A62 A;  4IFY A;  3I8B A;  4CJR A;  3OS1 A;  5DMR A;  4XH1 A;  4B1U B;  3HST B;  2UXB K;  4OKJ A;  1Y64 A;  3AO1 A;  3CC2 N;  4BE1 A;  2OZS A;  1NGG A;  3OY9 A;  3L3V A;  5TKY A;  1LV5 A;  3NGZ A;  3KLE A;  1NK9 A;  3VQP A;  1ZBH A;  4DV2 K;  2QKK A;  4IOA L;  2ZWH A;  4F8R A;  4LF9 K;  1GLB G;  4WCE L;  2GTD A;  4IFV A;  4JN4 A;  2Q2R A;  1U2V A;  3K5L A;  3KZB A;  1O1W A;  3NMU A;  3NFA A;  5JS1 A;  3WXJ A;  4IDH A;  5J1E A;  4Z4C A;  2EWS A;  2QWO A;  1OH8 A;  2NRT A;  4ZHR A;  2QXL A;  3NH0 A;  1CLQ A;  1OVY A;  3O4N A;  3UB5 A;  4YOV A;  3VF6 A;  2DPN A;  2OA8 A;  2WBN A;  4O55 A;  4DB3 A;  1J6Z A;  1RTI A;  4FM2 A;  1TL3 A;  4PKH A;  3ZX2 A;  4B9N A;  1X9W A;  4JEP A;  2BGG A;  4CEO A;  2UYT A;  4FPA A;  3KWI A;  2QWR A;  4L3Q A;  3WXI A;  4FWP A;  4BRC A;  2P9S B;  5FDL A;  4HWI A;  5M1O A;  4BDP A;  4R79 A;  4DFJ A;  2QWQ A;  4E3S A;  2A41 A;  2GX9 A;  2WC9 A;  3A5N C;  3C65 A;  4LC9 B;  2ZGY A;  5C0Y A;  5KPZ A;  1VAZ A;  1ZBU A;  3LPU A;  4MFB A;  3OJU A;  1YVN A;  1IKX A;  4GW6 A;  4WQ5 A;  3U8X A;  3WT0 A;  5HRN A;  4GVM A;  1YAG A;  4FZY A;  4TSX A;  1ASU A;  1KVA A;  1VSK A;  4DTS A;  1NGE A;  4MDB A;  1D9F A;  5LJV A;  5GIO A;  1XQS C;  4CHZ A;  4FLZ A;  1U04 A;  1S9E A;  3P31 A;  4MDA A;  1WOQ A;  2E2P A;  3I8D A;  5E84 A;  4RW9 A;  1IH7 A;  3O8M A;  4CZJ A;  1VK0 A;  5HLF A;  3TWH A;  1ZBL A;  3HPG A;  5C25 A;  3OYE A;  3MN6 A;  4DMN A;  4DCH A;  4FLY A;  5FPE A;  2BE2 A;  4J2B A;  2UUC K;  2B4J A;  4CIG A;  3BY5 A;  3FZM A;  5JIC A;  1U2V B;  3RR7 A;  4EAH D;  4GKK K;  3M3Z A;  3CJB A;  3WNE A;  3O1B A;  1KAY A;  5AQQ A;  3ZSZ A;  1NKB A;  3RR8 A;  1KFS A;  4FVM A;  4CJT A;  4RW7 A;  4JI7 K;  5EXW A;  2YJE A;  2G8K A;  1BL3 A;  4LH5 A;  1NWK A;  3HK2 A;  5BPN A;  3IKM A;  4JKF A;  4E0D A;  3PUF A;  1HPZ A;  4BDY A;  3IDH A;  1TUY A;  1RT5 A;  5DM7 L;  4KH6 A;  2KW4 A;  4IG0 A;  3H45 C;  2RHK A;  4FSV A;  1Q9Y A;  3QET A;  1HRH A;  1M90 O;  3VA3 A;  3IS9 A;  1DT9 A;  4RW8 A;  4M3Z A;  1XNQ K;  3KLH A;  3DOL A;  4DV1 K;  1KAZ A;  4O5F A;  4CBX A;  3RMC A;  5KQ8 A;  1JJ2 M;  2P9U A;  1GOB A;  1SL1 A;  3VEW A;  1NGA A;  4UQG A;  1KQS M;  4RWT A;  4NXN K;  4FWN A;  1YF5 L;  4DG1 A;  2HBK A;  3F9K A;  4I2Q A;  1X1P A;  2P9N A;  3ZSX A;  2FBT A;  2ZJQ L;  3HT3 A;  4KHU A;  3CYM A;  4FJJ A;  3CCV N;  2OPP A;  4BC3 A;  4OPJ A;  1RIL A;  5AZI A;  1HUX A;  5GAH P;  3SAH A;  3ASM A;  1SL0 A;  4JKE A;  3AVM A;  3LP2 A;  4OPH A;  3HVR A;  3IAY A;  4AHT A;  1BIU A;  2NRX A;  4DTM A;  3HOT A;  2E88 A;  2VCP A;  2P9L A;  5FPD A;  2E2O A;  4NXM K;  1VQN N;  3ENB A;  1EP4 A;  3S3N A;  4FL9 A;  1S1T A;  5FRM A;  2G8W A;  2P51 A;  3P4I A;  4BWM A;  4ILJ A;  4NYN A;  3MCP A;  5AQZ A;  2VWJ A;  3L4I A;  3TAR A;  2V52 B;  1HQE A;  3H46 O;  1GLJ O;  4MLH A;  4HTL A;  2IVP A;  1NU0 A;  1SKR A;  1S6P A;  4KHP K;  2GBZ A;  1N34 K;  1TKT A;  1YVU A;  3MN7 A;  2KZM A;  3PSF A;  4BQZ A;  4DV4 K;  1S22 A;  3VGK A;  1QQN A;  3EZ5 A;  3CMA N;  2EHG A;  3MN5 A;  3SV4 A;  3V81 A;  2UXD K;  1HMV A;  4B3T K;  4DS4 A;  1UWB A;  4CEB A;  4A61 A;  2OPQ A;  5ADX A;  4CK1 A;  5M1K A;  3G4S N;  2CH5 A;  2HND A;  2A1R A;  1X9M A;  4H0O A;  2O4G A;  3SLC A;  2WFB A;  3CET A;  3SAF A;  4CZL A;  2YV0 X;  1NMD A;  1BG3 A;  2P9U B;  5FLX O;  2Q97 A;  1VQ6 N;  3JAM O;  1SAZ A;  1SKW A;  4OGE A;  3LDQ A;  1RBR A;  1XUP O;  4M7Y A;  5CR4 A;  1IV0 A;  1D5A A;  2NRH A;  2P9N B;  4O8U A;  3QEV A;  1KXP A;  3U9Z A;  4B1X B;  3U3Y A;  3RSE A;  2GV9 A;  1DTT A;  3ID6 A;  1S1W A;  4DQP A;  4K42 A;  5I3U A;  5AZI B;  3VF4 A;  1TK8 A;  1YT3 A;  2Q0R A;  2FSK A;  2BTF A;  2PAV A;  1LCU A;  3ZT2 A;  3S41 A;  1D4X A;  1BA0 A;  1BOT O;  5AQW A;  4HTU A;  1K8K A;  4NCA A;  3TSU A;  1XHZ A;  4BR4 A;  3K5N A;  2P9L B;  1ZC6 A;  1NJZ A;  5KPT A;  1C0F A;  3QIC A;  4KBO A;  2Q1N A;  5CYM A;  2V51 B;  3K59 A;  1XC3 A;  2NNW A;  3F5T A;  5LMN K;  2BH1 A;  4CE9 A;  3SPY A;  2OTL N;  2Q0U A;  3VQ6 A;  3DLL L;  2KFN A;  1QSS A;  4ILG B;  4DSJ A;  1T44 A;  3H6E A;  3V9X A;  3CJA A;  2NZT A;  1VQK N;  2GEM A;  1BIS A;  5GAG P;  2AJQ A;  2NRW A;  3ATU A;  1T6D A;  1LWF A;  1X9S A;  2HF3 A;  2IVO A;  3QER A;  2E5L K;  5JLH A;  4ID5 A;  4BR9 A;  2P1J A;  1C0T A;  4Z4F A;  5AZJ A;  4WQ4 C;  3DRP A;  4FJK A;  1KVB A;  1RDD A;  3UIQ A;  1LAW A;  5BRF A;  3PLA A;  3CJ7 A;  3ZX0 A;  3AV9 A;  3FGU A;  4X66 K;  4NYF A;  3QB0 A;  4HCB A;  4B9U A;  1QE1 A;  4DV6 K;  4JRQ A;  3THW A;  3RTV A;  5C12 A;  5BRE A;  5IWA K;  3ENH A;  4C1N K;  1HYV A;  3CM5 A;  4DR2 K;  3ITH A;  2LSN A;  4BRN A;  4ZTJ A;  1RTJ A;  2JGU A;  4YHH K;  3AO5 A;  1QTM A;  3HYF A;  4CBU A;  3C94 A;  4C23 A;  5FRN A;  3CPW M;  3RSE B;  2X74 A;  4AIL C;  5DK5 A;  3ZX3 A;  3EO3 A;  3S3O A;  1DGK N;  4IO9 L;  1BI4 A;  1HPM A;  4C1N I;  3TAE A;  3RMA A;  3GOI A;  1K8K B;  5FPM A;  2KKZ A;  2D0P A;  4E89 A;  3CCR N;  3AVN A;  1WAF A;  4H4O A;  4FJG A;  3TSQ A;  2QWL A;  3E9O A;  1VRU A;  2YHX A;  3BF3 A;  3AVC A;  3BDP A;  4DFK A;  5M1Q A;  3MXJ A;  1UA1 A;  1DTQ A;  4FK4 A;  2AA4 A;  1VQ7 N;  4PKG A;  4B1V A;  4BRM A;  3B6P A;  3ZCM A;  4E7I A;  2DFH A;  4U67 L;  3DI6 A;  4EZ9 A;  4WF9 L;  3D0P A;  1RCH A;  3Q7C A;  4FOI A;  1C0U A;  4AHU A;  1YIT N;  3AAR A;  1NK5 A;  1CZB A;  4HUE A;  1T3V A;  3SBT A;  4AHS A;  2NUB A;  5AZJ B;  1KLN A;  4DR7 K;  4CZE A;  4AM6 A;  1KCF A;  2YCH A;  3BP8 A;  3ISN C;  4FJH A;  4OGC A;  3E01 A;  4NB4 A;  3CCE N;  3DXK B;  1ZBI A;  3QLH A;  2JWL A;  1SKS A;  5IT9 O;  1DLO A;  2YJF A;  3THW B;  5GIP A;  4JS4 A;  3U9D A;  1J54 A;  4M3X A;  5ELZ A;  4DR4 K;  4CFD A;  4BC4 A;  1HNV A;  5LY3 A;  1D8Y A;  3AVG A;  3O80 A;  4A2B A;  3ATV A;  3AVI A;  5AQN A;  1KRP A;  1Z6R A;  4FOE A;  3W3D A;  1N8R O;  2GEL A;  4LF6 K;  3AVJ A;  4AHC A;  2P9P A;  3H1V X;  2NRV A;  4M3W A;  3T19 A;  3J7Z O;  1VSD A;  3R1X A;  1DEJ A;  3DLR A;  4JI5 K;  3ZET A;  4JNE A;  1JKH A;  1TYQ A;  4E7L A;  3WNG A;  3R6M A;  3BZK A;  3VQC A;  4A5A A;  4YOW A;  1S1X A;  5F1X A;  3B6O A;  2VG6 A;  4CIE A;  2KFZ A;  5KGX A;  4FZX C;  3A0I X;  1E3M A;  3KTQ A;  3QES A;  3TAM A;  4CHQ A;  5I42 A;  1A5X A;  5CHI A;  1YUW A;  2O8C A;  2YKN A;  1VSE A;  3VA0 A;  3MEE A;  2HHH K;  3VTI A;  5BRD A;  1JXE A;  3J81 O;  4J2E A;  3KK3 A;  2YX6 A;  1CXQ A;  1LW2 A;  4IJN A;  5SZT A;  1NK6 A;  4JLH A;  1T7P A;  2WOM A;  4YFU A;  2UUA K;  4A57 A;  1BA1 A;  4CW7 B;  4B3M K;  4MO4 A;  1CZA N;  4I2P A;  3WUH A;  3HM9 A;  3AAQ A;  3IFR A;  2VQE K;  3NF8 A;  4M3T A;  1E4F T;  2CGL A;  2A1S A;  2QK9 A;  3FLC O;  1NOZ A;  3D7E O;  2FLO A;  1VSL A;  2ZF5 O;  2Z1J A;  3AGR A;  2RKI A;  3R9P A;  3M6G A;  3WNF A;  1M1K O;  2GWJ A;  3VEZ A;  4CFA A;  1TVR A;  1RT3 A;  1VQ9 N;  3D2E A;  4DSE A;  1WSI A;  3OA9 A;  3CC7 N;  1C1B A;  1FKO A;  1Q81 O;  3U4L A;  3A5O C;  1BU6 O;  4IDK A;  5KPR A;  2NRZ A;  2X6N A;  1KTQ A;  4DTX A;  4BRI A;  3QBX A;  4BC5 A;  4M3R A;  3SQ1 A;  4OO1 J;  3V1O A;  1NBW A;  2P9P B;  2BDP A;  3O3F A;  3IG1 A;  1RTH A;  1TAQ A;  4BR7 A;  2RF2 A;  1C0G A;  3O3H A;  1NG9 A;  4KRE A;  4DQQ A;  3ZET B;  3L0Q A;  1TYQ B;  3M8R A;  2EX3 A;  4DTJ A;  1VQO N;  3CER A;  3THV A;  3VGL A;  1HLU A;  1RDW X;  2YNF A;  1VSF A;  3TAB A;  5A2Q O;  3HP9 A;  1UOC A;  4V19 S;  2G8V A;  2D1K A;  4FWO A;  4CZM A;  3QFU A;  3THY B;  1A5V A;  4W5O A;  3SBG A;  3PIO L;  3NBP A;  2O8C B;  3VET A;  4QS8 A;  3KD1 E;  2D0B A;  5HBM A;  3FZL A;  3ZT3 A;  3MDQ A;  3TTC A;  1N6Q A;  3LDN A;  3O9Q A;  4RG8 A;  3O08 A;  1MA9 B;  2ASP A;  3MMV A;  2O8E A;  4CJK A;  3AVF A;  4MLE A;  3ZSV A;  4CJ3 A;  3HO1 A;  5C10 A;  3MCA B;  3C6U A;  4OLA A;  1R59 O;  1JLF A;  1Q9X A;  1SV5 A;  3F2K A;  3TSP A;  3ULE A;  2OAN A;  4XEI A;  5J2N A;  3D2E B;  2Z1G A;  4KAZ A;  4JYA K;  2FF6 A;  1JLB A;  4JS5 A;  3C0B A;  4FM0 A;  2CGJ A;  4OLB A;  3W0L A;  3L3U A;  4Y1D A;  5EOY A;  3SNN A;  4LFA K;  4K0K K;  5E41 A;  4FWL A;  4PUO A;  4PWD A;  4IKF A;  2XO7 A;  5DM6 L;  3CQX A;  2E6L A;  3H1Q A;  4CHN A;  4HHT A;  4PHT X;  1LOT B;  2X6S A;  4CFC A;  4CJS A;  3AVH A;  4RW4 A;  5KRT A;  4DV7 K;  4F2S A;  3AVB A;  2YHY A;  2VYP A;  3VER A;  3D45 A;  2WTU A;  1JLA A;  3V9U A;  1NK0 A;  4HUF A;  2HMP A;  5AQV A;  2DY4 A;  1VHX A;  1FKP A;  4CJE A;  2Q3S A;  4EHU A;  2HBL A;  2A3Z A;  3VEN A;  4ILH A;  2F9T A;  2IOC A;  1WN7 A;  4A2A A;  3U3G A;  5BN9 A;  1RFQ A;  4L8R B;  4X64 K;  3ZSR A;  3OYI A;  1GLA G;  4CZF A;  4IOC L;  1XI1 A;  3BZC A;  5AQL A;  1WLJ A;  4BRO A;  1O13 A;  4CK3 A;  3SCX A;  3LWM A;  2F8T A;  4DHY A;  1WB9 A;  2HB5 A;  4EFH A;  5H1S Q;  2O8E B;  1RT4 A;  3C95 A;  1NGH A;  3BGR A;  3KIO A;  3UE5 A;  1WUA A;  1ILY A;  4BWJ A;  5HRO A;  3EE9 A;  4QAG A;  4CJW A;  1JCE A;  3O9R A;  1SQK A;  3OTO K;  1S72 N;  1HYZ A;  4FM1 A;  3MX2 A;  3ULE B;  4NLB A;  3PIP L;  3QNO A;  1WBB A;  3BEX A;  2WON A;  3FR0 A;  4LSL A;  3L4Q A;  4J2A A;  4IWV A;  3SV3 A;  4M63 C;  1SS6 A;  3O1W A;  5AFU A;  3AVL A;  5CE3 A;  4KO0 A;  4FJM A;  4EP5 A;  1YI2 N;  3RMB A;  2KZZ A;  1QS4 A;  2YHB A;  2GUP A;  3MN9 A;  4BAC A;  1VQ5 N;  1JL2 A;  3K9K A;  1IO2 A;  4XH5 A;  1C0M A;  4DV0 K;  3KWG A;  1IBK K;  1P90 A;  3PX6 A;  1NGB A;  2PYJ A;  1HNZ K;  3NF9 A;  2D5R A;  3K5M A;  4GMJ B;  3SJH A;  1BCO A;  3ZT4 A;  3HL8 A;  1J9A A;  2BUP A;  1U4B A;  3ULD A;  2UUB K;  4IBN A;  4LF8 K;  1ZBS A;  4IO8 A;  4A5B A;  1IKY A;  4CF0 A;  1EET A;  4FW1 A;  3O4Q A;  4ISE A;  3DJC A;  4B8C A;  3LP1 A;  1BCM A;  3EYZ A;  4JK8 A;  5C2D A;  5M1F A;  3FFI A;  5C15 A;  4Z4E A;  3QFP A;  2HW3 A;  3V9W A;  4LF4 K;  3HOS A;  5JVG L;  1N33 K;  1Z26 A;  4YOY A;  3ZSO A;  3SQ4 A;  1RDB A;  3BUZ B;  1C1C A;  3WQT A;  1GLE G;  3C7N A;  3CCM N;  4DWI A;  4IG3 A;  3QIO A;  3DM2 A;  3SJJ A;  3VQ8 A;  4BG8 A;  1JLC A;  4KKO A;  3J8A A;  2HBJ A;  4NO7 A;  4CEZ A;  3CFP A;  4BRK A;  4RTF D;  5GAD P;  3CFR A;  4KRF A;  3SAG A;  4YDU C;  3OW2 M;  3VQ5 A;  3M1F A;  5HRR A;  4ID1 A;  4B9V A;  3VEV A;  3V4I A;  1TUU A;  3H3O B;  3I33 A;  3GDQ A;  5BPL A;  3CM6 A;  1FJG K;  2YHA A;  4HCC A;  1E4G T;  4CF2 A;  4DV5 K;  4BRP A;  4CEC A;  4R5P A;  4RW6 A;  3RRG A;  1Q8I A;  2B5J A;  4JD2 A;  1HQU A;  4DQ8 A;  4YY3 K;  4FXD A;  1W97 L;  4M3U A;  1I94 K;  4OKE A;  4O0J A;  1GLL O;  4FJX A;  3CJC A;  2IDO A;  3HSC A;  3PO4 A;  2KQ2 A;  4WFA L;  1IKW A;  1TKD A;  3B8A X;  1WBD A;  3S9H A;  3O9T A;  5KTQ A;  3K0S A;  4FJ5 A;  4F3O A;  4KHN A;  1YTU A;  3M8P A;  1QQC A;  2HHW A;  4Z4G A;  1QVG M;  1LW0 A;  4AQY K;  4FWQ A;  4FJN A;  2CH6 A;  1VSJ A;  2W42 A;  2Z1I A;  4M3Y A;  1D9D A;  3WNH A;  4N56 A;  5AR0 A;  1RDA A;  4CFB A;  2ASM A;  2FSN A;  3OHR A;  4CGD A;  4JRP A;  1TK0 A;  3C7N B;  2E1Y A;  1BHL A;  1V4T A;  1G99 A;  5AQK A;  1OKJ A;  4KV8 A;  3IUC A;  1Y97 A;  2E2Q A;  5AQT A;  4K43 A;  3F73 A;  1VRT A;  3ZLJ A;  4YOU A;  1IJJ A;  2AP1 A;  1QQM A;  4N47 A;  4M45 A;  3MWT A;  3AY9 A;  3SQ0 A;  2ITG A;  2Q36 A;  3VQQ A;  3GL1 A;  4KHW A;  2HHX A;  1DKG D;  1NGC A;  3P38 A;  5AJ3 K;  5HRP A;  3OYB A;  3VOV A;  3P39 A;  3E9L A;  4GKJ K;  3EY1 A;  1REV A;  3Q7B A;  1RBV A;  4I9L A;  1YHQ N;  3HM8 A;  1S1V A;  2FBX A;  3TU5 A;  3NHG A;  4JD2 B;  3OYK A;  1XWL A;  3TAN A;  4E7J A;  2G8U A;  4LF7 K;  3GG4 A;  4Z4I A;  3OYM A;  1ITG A;  4GV9 A;  4AHV A;  1QSY A;  4BVP A;  3KK1 A;  1L3U A;  5B8H A;  4GV3 A;  4CGI A;  2IIR A;  2F4V K;  3DXK A;  4BVO A;  4CJ7 A;  2H3G X;  1NGJ A;  4Y0W A;  3SMP A;  1OVQ A;  2BAN A;  4CGH A;  2E6M A;  4CGF A;  3T1Y K;  5LL6 Z;  3ID8 A;  3QDK A;  2HMI A;  4HUG A;  2W40 A;  2ZD1 A;  1NK4 A;  4LY7 A;  1VQM N;  4GV6 A;  3KK7 A;  4A59 A;  2W41 A;  2QWM A;  4CEE A;  4E19 A;  3CCJ N;  3J7A P;  4CED A;  1NK8 A;  3TAQ A;  5BR9 A;  1KAX A;  2A42 A;  3K9J A;  5T7B A;  4GNI A;  2XHB A;  1ATR A;  4BR2 A;  1ESV A;  3PV8 A;  3DLB A;  3HP6 A;  2DTU A;  4H5T A;  4E7K A;  1L3S A;  3U6F A;  4I6M A;  3LPT A;  4DSL A;  3DAW A;  1ASV A;  3NF6 A;  3SUQ A;  2O4I A;  2OYQ A;  4BRA A;  3I55 N;  4XH4 A;  1RTD A;  2QKB A;  1W7A A;  4JKB A;  4CJF A;  1YJW N;  3S3M A;  4CZK A;  2E4L A;  5GIN A;  2D4W A;  4RCH A;  5MLC Q;  3G0Z A;  1BWF O;  4G1Q A;  4FWM A;  4CEA A;  4OPK A;  4B3O A;  3CG7 A;  3G6E N;  3CJ9 A;  2HHV A;  1Z05 A;  3LM2 A;  4B9S A;  1MWK A;  2VGM A;  1U49 A;  1GLC G;  4BC2 A;  1WSJ A;  2DFE A;  2WUS A;  1KD1 O;  1S5J A;  4BRD A;  3C6A A;  1HJO A;  3NVK A;  4CJL A;  3F9M A;  4CER A;  1RBT A;  3JYT A;  1F21 A;  3VF2 A;  4DQR A;  4G9Z A;  3TAP A;  4BR0 A;  3E66 A;  4B1Y B;  1S1U A;  1NGF A;  3LDS A;  3L2U A;  2OTJ N;  4CJ5 A;  3WEE B;  3WXL A;  3SYZ A;  1J53 A;  2GUI A;  4BDZ A;  5E26 A;  3OJS A;  4CD3 A;  4CHY A;  4BRH A;  4LFB K;  3QIP A;  2Y1I A;  4KHQ A;  1XNR K;  3QML A;  3VPZ A;  4IEE A;  3CQY A;  3DLG A;  2FXU A;  4I6M B;  1BO5 O;  1T05 A;  4YNQ A;  1Q82 O;  3FZH A;  1IBL K;  3DXM A;  3AA2 A;  4BRG A;  3OYC A;  4KTQ A;  4BE2 A;  4BRF A;  3GBT A;  1YJN N;  3LM9 A;  4ISG A;  3RRH A;  3THY A;  3QIN A;  4JHD A;  4LSN A;  5AQP A;  4IZ9 A;  1QHT A;  3KJV A;  3ZEU A;  4FO0 A;  3QEW A;  5AQO A;  5FPN A;  4YOR A;  1EX4 A;  2ETJ A;  1NKC A;  3H08 A;  4IOX A;  5AQR A;  2HNZ A;  3E1Y A;  1TL1 A;  2QM1 A;  2XY8 A;  4DR3 K;  3J80 O;  3O3G A;  2PY5 A;  5ADX H;  3H3N O;  1HKB A;  2HOE A;  3AO3 A;  1YTA A;  4E7H A;  3ZYY X;  3L2W A;  4FJ8 A;  1X3N A;  4DS5 A;  4CK2 A;  1J5O A;  3EKS A;  4KH4 A;  3FE1 A;  3N4P A;  2HBM A;  3QEI A;  3O9U A;  1TK5 A;  1HNW K;  2KTQ A;  4JI4 K;  1U6Z A;  4LFC K;  4AF1 A;  3AA3 A;  1EO1 A;  2HST A;  5JMV A;  3LAL A;  4N5S A;  1B9F A;  4EP4 A;  4CJV A;  2E20 A;  1VSM A;  1XHX A;  4MQ3 A;  4W5N A;  4E1M A;  4FJI A;  1VSH A;  3VQB A;  4EIA A;  3KLG A;  4CEQ A;  1BIZ A;  3DYA A;  3FFK B;  3DLK A;  3LL3 A;  4DR6 K;  3NGI A;  2YNI A;  1JXB A;  1TV6 A;  2O8F A;  3DXM B;  4KHY A;  3V1R A;  4FVU A;  5BR8 K;  3HJF A;  3KVG A;  4B9Q A;  1GLF O;  5AQG A;  4JHD B;  1N36 K;  3O6W A;  4BG9 A;  4JK7 A;  3DRS A;  4CES A; 
#chains in the Genus database with same CATH homology
 3ZEU B;  3S41 A;  3O9S A;  1YI2 N;  1D4X A;  4WQ5 C;  1BA0 A;  3WQU A;  4BRL A;  1BOT O;  2HF4 A;  5AQW A;  1K8K A;  3VGM A;  1ATN A;  3E9P A;  3TSU A;  2PBD A;  2GUP A;  3MN9 A;  2RE2 A;  1VQ5 N;  4BR4 A;  4CZH A;  2P9L B;  3K9K A;  4XH5 A;  1ZC6 A;  1HKC A;  5AQX A;  3FZF A;  5EY4 A;  5KPT A;  1C0F A;  3QIC A;  4PKI A;  3KWG A;  4KBO A;  2Q1N A;  1P90 A;  1NGB A;  2P9I A;  4K41 A;  2V51 B;  3HRG A;  4JKG B;  5M1P A;  5AQS A;  5F2R A;  1XC3 A;  2ZJR L;  2NNW A;  3F5T A;  3SJH A;  1IG8 A;  2QI2 A;  2BH1 A;  2BUP A;  3OBY A;  4CBW A;  2OTL N;  2Q0U A;  3CI5 A;  3DLL L;  1QQO A;  2VWB A;  1ZBS A;  4IO8 A;  3TTD A;  4A5B A;  4ILG B;  4Z94 A;  4ISE A;  1T44 A;  3DJC A;  3H6E A;  4H0T B;  3CJA A;  2NZT A;  1VQK N;  2GEM A;  3UKR B;  4JK8 A;  5GAG P;  3CPE A;  2NRW A;  2QTD A;  3ATU A;  3N4Q A;  1T6D A;  5C2D A;  1HX1 A;  4JK9 A;  4IJA A;  2HF3 A;  5M1F A;  3NVM A;  2IVO A;  3EL2 A;  5JLH A;  5LJW A;  4BR9 A;  5C15 A;  2J4R A;  1K73 O;  2V7Y A;  3QFP A;  5AZJ A;  1QHA A;  5C2F A;  4WQ4 C;  3HOS A;  5JVG L;  1Q18 A;  4YOY A;  2KHO A;  3GE1 A;  3L6Q A;  5BRF A;  3BUZ B;  3CCM N;  3WQT A;  1GLE G;  1NGD A;  3C7N A;  3PLA A;  3CJ7 A;  3ZX0 A;  3FGU A;  4IFE A;  4H0V B;  4BG8 A;  2QA4 N;  3QB0 A;  3MX5 A;  3J8A A;  4F9O A;  2HBJ A;  1HKG A;  4NO7 A;  4JKH A;  4GY2 B;  4BRK A;  4IXC A;  4RTF D;  5GAD P;  5M1N A;  3SMS A;  3SAG A;  2QW9 A;  4YDU C;  2CGK A;  5BRE A;  3ENH A;  4C1N K;  5C12 A;  2IVN A;  3OW2 M;  3M1F A;  4QS9 A;  3I56 N;  3CME N;  4M7X A;  4QS7 A;  1QZ5 A;  4BRN A;  4U7B A;  3VEV A;  1K8A O;  4H0P A;  1VQP N;  1TUU A;  2A5X A;  3H3O B;  3I33 A;  4CBU A;  4CZI A;  4C23 A;  3GDQ A;  2QEX N;  3TPQ A;  5BPL A;  1JCF A;  3CPW M;  1K9M O;  5BN8 A;  3RSE B;  3R3L A;  5AQF A;  3ZX3 A;  1JCG A;  3EO3 A;  1DGK N;  4IO9 L;  1E4G T;  1HPM A;  5BRH A;  4H5W A;  4BRP A;  2QWN A;  4KH5 A;  4C1N I;  4ISF A;  1W2B M;  3GOI A;  4JD2 A;  1K8K B;  5FPM A;  4FWS A;  2KKZ A;  3A8Y A;  2D0P A;  5AQH A;  4DQ8 A;  3CCR N;  1W97 L;  4B1Z A;  4IEI A;  5EX5 A;  1QZ6 A;  1GLL O;  4JKC A;  4B1W B;  4K25 A;  3WXK A;  3TSQ A;  2P9I B;  2NLX A;  2QWL A;  2V7Z A;  2I7P A;  3E9O A;  3FZK A;  2ZJP L;  1VQL N;  2YHX A;  2FF3 B;  3CJC A;  4PL8 A;  3BF3 A;  3HSC A;  4J8F A;  4WFN L;  3WXM B;  4WFA L;  5M1Q A;  3B8A X;  4DKW A;  3O9T A;  2AA4 A;  1VQ7 N;  4PKG A;  1EQY A;  3VEY A;  3G25 A;  3O5B A;  4B1V A;  4BRM A;  1S3X A;  2A40 A;  3EKU A;  2QWP A;  4U67 L;  5AQY A;  1QVG M;  4WF9 L;  2P9S A;  2NRR A;  1MWM A;  3Q7C A;  4FWQ A;  4FOI A;  1YIT N;  2CH6 A;  3AAR A;  2ASO A;  3CCU N;  3O4W A;  4BRQ A;  4CD1 A;  3CHW A;  2F9W A;  5F0X A;  5I9E B;  2D0O A;  1T3V A;  4YOX A;  1MDU B;  4CI6 A;  3SBT A;  5AZJ B;  2FSJ A;  5AR0 A;  4A62 A;  2ASM A;  2FSN A;  5HOO A;  3OHR A;  4CZE A;  4AM6 A;  2YCH A;  3BP8 A;  3I8B A;  3C7N B;  2E1Y A;  4NB4 A;  3UKU A;  4BY9 C;  1V4T A;  1G99 A;  4FPB A;  4XH1 A;  3DXK B;  5AQK A;  3CCQ N;  1OKJ A;  3CCE N;  2JWL A;  4B1U B;  2VGN A;  3IUC A;  2E2Q A;  5AQT A;  1Y64 A;  3EN9 A;  3CJ1 A;  4K43 A;  1SZ2 A;  5GAE P;  2YJF A;  3CC2 N;  5GIP A;  4YOU A;  3U9D A;  1IJJ A;  2AP1 A;  1NGG A;  1QQM A;  5ELZ A;  4BC4 A;  5TKY A;  3MWT A;  3T69 A;  3AY9 A;  5LY3 A;  4OPA A;  3O80 A;  4A2B A;  3ATV A;  5AQN A;  2Q36 A;  1Z6R A;  4FOE A;  3W3D A;  1N8R O;  2GEL A;  3GL1 A;  1H1V A;  2P9P A;  3H1V X;  4CZG A;  4IOA L;  2NRV A;  3BF1 A;  2ZWH A;  3J7Z O;  3R1X A;  1DKG D;  1GLB G;  1NGC A;  1DEJ A;  3P38 A;  4WCE L;  3VOV A;  2A6A A;  3P39 A;  3ZET A;  2GTD A;  3E9L A;  4JN4 A;  4JNE A;  2Q2R A;  1TYQ A;  3VMF B;  1U2V A;  3R8E A;  3KZB A;  3Q7B A;  3NMU A;  3R6M A;  1YHQ N;  3HM8 A;  3TU5 A;  1Q7Y O;  3WXJ A;  4MO5 A;  4JD2 B;  4IDH A;  4A5A A;  4YOW A;  4FWK A;  4FWR A;  3GG4 A;  5F1X A;  2EWS A;  2QWO A;  2NRT A;  2QXL A;  4GV9 A;  4BVP A;  4GV3 A;  5B8H A;  1OVY A;  2IIR A;  3A0I X;  3DXK A;  3UB5 A;  3M5R A;  4BVO A;  4CJ7 A;  2H3G X;  2JWK A;  1NGJ A;  3A5L C;  4YOV A;  4Y0W A;  3VF6 A;  2DPN A;  4H0X B;  3SMP A;  4BGA A;  3CCS N;  2WBN A;  4DB3 A;  5CHI A;  4H5N A;  1J6Z A;  1YUW A;  3ID8 A;  3QDK A;  3MWP A;  3C6H A;  2W40 A;  3VTI A;  4PKH A;  1BDG A;  3ZX2 A;  1T6C A;  1X9J A;  1P8Z A;  2F7T A;  4H03 B;  5BRD A;  2YX6 A;  4IJN A;  4JEP A;  1VQM N;  4GV6 A;  3KK7 A;  4A59 A;  2W41 A;  2QWM A;  2UYT A;  1YJ9 N;  3AGK A;  4A57 A;  3CCJ N;  4FPA A;  3KWI A;  2QWR A;  4L3Q A;  1BA1 A;  3VEO A;  3WXI A;  5BR9 A;  4FWP A;  1KAX A;  4WFB L;  4MO4 A;  1CZA N;  4BRC A;  5AQJ A;  2P9S B;  2A42 A;  4HWI A;  1Q86 O;  3K9J A;  3WUH A;  5M1O A;  3AAQ A;  3IFR A;  4R79 A;  1X3M A;  2QWQ A;  1E4F T;  2CGL A;  4GNI A;  1ATR A;  4BR2 A;  1ESV A;  2A41 A;  3FLC O;  2GX9 A;  2WC9 A;  3A5N C;  3C65 A;  3D7E O;  3HTV A;  4LC9 B;  2ITM A;  2FLO A;  3CD6 N;  2ZGY A;  5C0Y A;  4JKD A;  1ATS A;  4E1J A;  1VAZ A;  4H5T A;  5KPZ A;  2ZF5 O;  3AGR A;  4I6M A;  1YXQ A;  3R9P A;  3M6G A;  3EZW A;  5AQU A;  1YVN A;  3DAW A;  1M1K O;  4BRA A;  3UKU B;  2GWJ A;  4WQ5 A;  3VEZ A;  3U8X A;  4XH4 A;  3WT0 A;  3I55 N;  1VQ9 N;  3D2E A;  3VTH A;  1YAG A;  3HBT A;  3CIP A;  3OA9 A;  1NGE A;  3CC7 N;  4MDB A;  5LJV A;  5GIO A;  1XQS C;  4JKB A;  1YJW N;  1Q81 O;  3CCL N;  3U4L A;  3P31 A;  4MDA A;  1WOQ A;  2E2P A;  3A5O C;  5E84 A;  4CZK A;  1BU6 O;  5KPR A;  3O8M A;  2NRZ A;  5GIN A;  4CZJ A;  2D4W A;  4RCH A;  5MLC Q;  4BRI A;  3D2F A;  3QBX A;  4BC5 A;  4OO1 J;  3D6R A;  1BWF O;  4FWM A;  1NBW A;  2P9P B;  3HZ6 A;  3MN6 A;  4DCH A;  3QBW A;  3G6E N;  3CJ9 A;  5FPE A;  3EE8 A;  4BR7 A;  1Z05 A;  3JS6 A;  3LM2 A;  2P9K A;  1C0G A;  1MWK A;  2VGM A;  3IMX A;  5JLF A;  1GLC G;  3ZET B;  3VEX A;  3L0Q A;  4BC2 A;  3FZM A;  1TYQ B;  5JIC A;  1VQ4 N;  1U2V B;  4EAH D;  2WUS A;  3M3Z A;  3CJB A;  1KD1 O;  4H0Y B;  3O1B A;  3C6A A;  1KAY A;  3TTF A;  4BRD A;  3CER A;  1HJO A;  1VQO N;  1VQ8 N;  1NLV A;  5AQQ A;  3VGL A;  5JVH L;  1HLU A;  1RDW X;  3NVK A;  1NM1 A;  3F9M A;  5EXW A;  4O8K A;  2YJE A;  4JAX A;  4YOT A;  3VF2 A;  2D1K A;  4FWO A;  2YI1 A;  4CZM A;  3QFU A;  1NWK A;  3SBG A;  5BPN A;  3IKM A;  4JKF A;  4G9Z A;  1GLD G;  3PIO L;  3VET A;  3IDH A;  4BR0 A;  4QS8 A;  1TUY A;  3E66 A;  4B1Y B;  5DM7 L;  4KH6 A;  3H45 C;  2RHK A;  4FSV A;  3FZL A;  1NGF A;  3CXC M;  3CF5 L;  3MDQ A;  3TTC A;  1M90 O;  4YDU A;  2OTJ N;  3LDN A;  3WEE B;  2YHW A;  1DT9 A;  3O9Q A;  3WXL A;  5EVZ A;  1NGI A;  3T7Z A;  2E2N A;  4H5R A;  5E26 A;  3O08 A;  3DWL A;  1MA9 B;  2ASP A;  3MMV A;  1KAZ A;  4CD3 A;  2E8A A;  4O5F A;  3VES A;  4MLE A;  4BRH A;  4CBX A;  5C10 A;  5KQ8 A;  1JJ2 M;  2ZGZ A;  3MCA B;  2P9U A;  3VEW A;  1NGA A;  3QML A;  3VPZ A;  4IEE A;  3CQY A;  4H5V A;  4RWT A;  1KQS M;  4FWN A;  1YF5 L;  4UY8 O;  2HBK A;  2FXU A;  4I6M B;  1BO5 O;  2P9N A;  1R59 O;  1Q82 O;  3FZH A;  3F2K A;  3DXM A;  2ZJQ L;  4BRG A;  3TSP A;  3ULE A;  2OAN A;  4XEI A;  4GVE A;  4BRF A;  3D2E B;  3GBT A;  1YJN N;  2FF6 A;  3LM9 A;  4ISG A;  3CCV N;  4BC3 A;  4JHD A;  5AZI A;  1HUX A;  5AQP A;  5GAH P;  3C0B A;  4IZ9 A;  3SAH A;  2CGJ A;  3LDP A;  4JKE A;  3ZEU A;  3W0L A;  4FO0 A;  4OPH A;  5AQI A;  5EOY A;  5AQO A;  5FPN A;  4YOR A;  3A5M C;  2NRX A;  5TKW A;  4FWL A;  3SK3 A;  3HOT A;  2E88 A;  2VCP A;  3D2F B;  4IOX A;  5AQR A;  3CQX A;  4BGB A;  5DM6 L;  3E1Y A;  2P9L A;  3LDO A;  3WEE A;  5FPD A;  2E2O A;  3H1Q A;  4NLC A;  1VQN N;  2QM1 A;  3ENB A;  4FL9 A;  4PHT X;  4JKG A;  1LOT B;  2P9K B;  5ADX H;  5BPM A;  3H3N O;  3MK6 A;  1HKB A;  3P4I A;  2YHY A;  2HOE A;  4ILJ A;  2VYP A;  3MCP A;  5AQZ A;  3ENO A;  3VER A;  3L4I A;  2V52 B;  3H46 O;  1GLJ O;  4MLH A;  4HTL A;  2IVP A;  4BR5 A;  2I7N A;  2HMP A;  3AAP A;  5AQV A;  3ZYY X;  2GWK A;  1X3N A;  3MN7 A;  4EHU A;  2HBL A;  2A3Z A;  1RDU A;  3VEN A;  4ILH A;  2F9T A;  4BQZ A;  3UKR A;  1S22 A;  3EKS A;  4KH4 A;  3FE1 A;  3VGK A;  1QQN A;  2HBM A;  3N4P A;  4A2A A;  3CMA N;  3O9U A;  5BN9 A;  1RFQ A;  3MN5 A;  3KHY A;  1GLA G;  1RGI A;  4CZF A;  1U6Z A;  4AF1 A;  4IOC L;  1EO1 A;  2HST A;  5JMV A;  5AQL A;  3HI0 A;  1NJI O;  1KC8 O;  4PL7 A;  3JXU A;  4A61 A;  4BRO A;  1O13 A;  1ZXO A;  5AFU H;  5AQM A;  5ADX A;  4DHY A;  2Q31 A;  2E20 A;  5M1K A;  3G4S N;  2CH5 A;  4EFH A;  5H1S Q;  3G71 N;  4H0O A;  3RVC A;  4EIA A;  2KLA A;  3SLC A;  2WFB A;  3CET A;  4WYB A;  4CZL A;  1V4S A;  4AM7 A;  3SAF A;  1NMD A;  5HL7 L;  1NGH A;  1BG3 A;  2P9U B;  4BQL A;  3UE5 A;  2Q97 A;  3FFK B;  1WUA A;  1VQ6 N;  3LL3 A;  1SAZ A;  1ILY A;  3EE9 A;  3LDQ A;  1XUP O;  4M7Y A;  5CR4 A;  2NRH A;  2P9N B;  1JCE A;  4EHT A;  2PFU A;  1SQK A;  3O9R A;  3DXM B;  1S72 N;  4O8U A;  3MX2 A;  3ULE B;  4BRE A;  4FVU A;  3OBW A;  4NLB A;  1KXP A;  2E1Z A;  3U9Z A;  4B1X B;  3KVG A;  4WQ4 A;  4B9Q A;  1GLF O;  3PIP L;  3BEX A;  3RSE A;  3FR0 A;  3CC4 N;  3L4Q A;  1BUP A;  5AQG A;  4JKA A;  3ID6 A;  4IWV A;  4K42 A;  4JHD B;  5AZI B;  1YIJ N;  3VF4 A;  3O6W A;  4M63 C;  4BG9 A;  3LDL A;  5KQD A;  4JK7 A;  2Q0R A;  1SS6 A;  3O1W A;  5AFU A;  2FSK A;  2BTF A;  2PAV A;  1LCU A;  5CE3 A;  1QVF M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...