4FVUA

Structural basis for the dsrna specificity of the lassa virus np exonuclease
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
208
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIAGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the dsRNA Specificity of the Lassa Virus NP Exonuclease.
pubmed doi rcsb
source organism Lassa virus josiah
molecule tags Hydrolase/rna
molecule keywords Nucleoprotein
total genus 51
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4fvuA01
3MX5A 3MX2A 3MWTA 3Q7BA 4GV6A 4G9ZA 4GV3A 4GV9A 3Q7CA 4FVUA 3R3LA 4GVEA 3MWPA
chains in the Genus database with same CATH superfamily
4HUFA 2P9NB 1QQMA 3THYB 3THWB 3P31A 1X1PA 4BVOA 4BRAA 1TYQB 4DSKA 2HBJA 1S6PA 3L4IA 3E66A 3V1OA 1JCEA 3F9KA 5JVHL 2BE2A 2HOEA 4TSXA 3AO5A 5CY4A 4DV0K 4OLBA 3O8MA 4KPYA 4CF2A 3LP2A 1BU6O 3VTHA 1SZ2A 4EZ9A 4FLVA 4GKJK 3ENOA 2VG6A 2JLEA 5HL7L 4CFBA 4M41A 2B4JA 1T03A 4LFCK 2P9UA 3PSIA 4M3WA 1DLOA 2D0BA 3M8QA 4FVMA 1K9MO 3MECA 1KSPA 4QS7A 2VGNA 4CZFA 1VQKN 4X66K 3AAPA 1NOZA 4FJLA 3OYCA 1YVNA 3GOIA 1RILA 3CCLN 4FM2A 3KK1A 2VGMA 4DFMA 4B8CA 3VEVA 2G8UA 2O4GA 4FO0A 4A5AA 3GBTA 3CETA 4WQ4A 1V4TA 3KHYA 3VA0A 1Z25A 5KPTA 3HSTB 3QNOA 1N6QA 3EN9A 3KK7A 5DM6L 5CYQA 3QLHA 5FPEA 5EVZA 3SUNA 3N4QA 5M1KA 3FZMA 4IKFA 2P9SA 4DV2K 4AILC 3NH1A 4BQZA 3NMUA 2YHWA 3M5RA 4KHPK 4DV7K 1LV5A 3PX6A 3H1QA 5HLFA 4CZHA 3L8BA 4EFHA 4RW8A 3E1YA 4FWSA 4LF6K 3RRGA 5LMNK 3ZT4A 1KVAA 4MLEA 4CJQA 5C2FA 3CF5L 3VERA 1O13A 5BRHA 3J7AP 1JL2A 4FZXC 4B3RK 3OYLA 1QVGM 3K0SA 1DTQA 1VAZA 3BF1A 3SZ2A 1RDWX 2RE2A 1MWKA 4DQQA 4AHSA 3EZWA 1SS6A 1VQ4N 4ILJA 1MWMA 4OX9K 1LOTB 2HB5A 2VQFK 5EY4A 1VQON 4YOTA 4Z0UA 2D0PA 3CCSN 3DM2A 3THWA 4DQPA 2UU9K 3A5MC 1VSDA 1KRPA 3L3VA 3LAKA 4JN4A 2HNYA 1RBVA 3WEEB 3ZT3A 4J2DA 3VQBA 2O8EA 3DMJA 5AQWA 3I55N 3AA4A 4B9SA 4OGCA 1JCFA 4EP4A 4AM7A 3KIOA 3BF3A 5AFUA 1W97L 5JS2A 4CJ3A 4MDAA 2P9IA 4BDPA 2RN2A 2VYPA 4DG1A 1FK9A 4DV5K 3K5LA 1WNSA 4BRDA 4KAZA 1IH7A 1HKCA 1QHAA 2P9PB 4BRIA 3JXUA 4JKDA 4B9NA 4FJGA 2D0AA 3AVMA 4DU3A 4OKEA 1BHLA 4M63C 3ZCMA 3BUZB 1S6QA 2HHSA 3AVKA 5FRNA 1ATRA 3A0IX 5CZ1A 2HHXA 4OGEA 1KTQA 4CFDA 4NLCA 4B1YB 2O8CB 1HPMA 4BC2A 2HHWA 1WLJA 1Z6RA 1ASUA 3QBWA 2HBLA 3LDOA 1S9EA 1NKCA 5C12A 1LWFA 3MMVA 3ITHA 4CJEA 3DLGA 4CJUA 1N5YA 4YOUA 2GV9A 4PL7A 2BDPA 3TTCA 3F5TA 4I9QA 4CGFA 5KTQA 3C94A 4Z4IA 1VSJA 3IDHA 1F21A 1C0TA 2Q31A 3C6TA 3AARA 4JKCA 3CI5A 3U9DA 4DSFA 3LZIA 5KPRA 2WUSA 4CHNA 1ZBSA 3M6GA 5AQXA 1WOQA 4F2RA 4UQGA 3O9RA 1HKBA 1FW6A 1GLBG 4HUEA 4CBUA 1NGGA 3KWIA 2B6AA 4B1WB 4BREA 3U9ZA 5LY3A 5E84A 1T8EA 2DFHA 2ZGZA 2HMIA 3ZT2A 4OO1J 4B9LA 4DWIA 4IFYA 5EX5A 3L6QA 3ZX0A 4H0XB 1YVUA 4LY7A 1RTIA 3OY9A 3MK6A 2NRVA 4JI4K 3M8RA 3DXMB 1VQ8N 3TSUA 2FLOA 3P38A 1NKEA 3V1QA 3AVGA 3RWUA 3OYNA 3LM2A 1D5AA 3VPZA 1JL1A 1K8AO 3O6WA 1X9JA 3KJVA 2JWKA 4LH5A 3VEOA 1C6VA 2A41A 3K5MA 1NG9A 2ZF5O 2BANA 1IV0A 4YOYA 2YNHA 1SL1A 2NZTA 5BREA 4FM0A 1NMDA 2P9IB 4FJIA 3QEXA 3I8BA 4FM1A 3CIPA 3MDQA 3SJJA 3V9ZA 3VF2A 2IOCA 4KH6A 2JGUA 1I94K 5FPDA 2P5GA 3DLHA 3F2KA 5HBMA 3NVMA 3CCQN 3S3OA 4NYNA 3NH2A 4FW1A 4FWKA 1C1BA 2HF4A 3EY1A 1U47A 4DTSA 1SUQA 2IC3A 1L3TA 3RMAA 3T19A 4Z94A 4R5PA 2FBYA 1WSGA 4IFVA 1QQOA 1WAFA 3DXKA 2NRRA 3KLFA 3ZSZA 2VG5A 1SL0A 4O8UA 4DLGA 3O4NA 3A5NC 5SWMA 4DQSA 3J7YP 5AJ3K 3JAMO 1M90O 1XQSC 1X9MA 4JHDA 4BC5A 1TV6A 4O0IA 4Y1CA 2A3ZA 3FR0A 2FF6A 3SI6A 2YNGA 5JS1A 1NGHA 4PKHA 2FSKA 3HM8A 3SNNA 4L8RB 2QM1A 4PQUA 2HSTA 4EAHD 3SK3A 1SAZA 3TPQA 3ID6A 1UA1A 4CJLA 2FSNA 3CD6N 2UUBK 1RGIA 4KHSA 3DLKA 4CEZA 4AQYK 3PSFA 3QEPA 1T7PA 3MXJA 3ZSRA 3HBTA 3CM6A 2ZGYA 2NRWA 4W5RA 3QIPA 3SYZA 4HWIA 4E7JA 5C0YA 2OPPA 3VQ4A 3J80O 1DTTA 1HJOA 4F9OA 3CC4N 1RTDA 4GV9A 3ULEA 2VQEK 2YKNA 3FGUA 2HVHA 2G8FA 5LJVA 5LMUK 2W6KA 3AVJA 3E9LA 3DYAA 3RR7A 2QWOA 3I33A 1CLQA 4IBNA 4FJMA 2NNWA 4CZLA 3MAQA 5AQQA 4JRQA 4E0DA 2NUBA 5LL6Z 4OPHA 4B08A 2EWSA 3AA2A 1VK0A 2DFEA 1VQPN 2A1SA 3O9QA 2AA4A 1VQLN 4FJHA 4N47A 4ISFA 2W6LA 5JMVA 4M3UA 3U3YA 2YV0X 4K0KK 2QXFA 5AZIB 2HHQA 3L2RA 1W2BM 1IBKK 2YKMA 4GNIA 3SUOA 4E7HA 4JKAA 4KB0A 1JJ2M 3ISNC 5J1EA 1ZC6A 5GAGP 4DTPA 4IEIA 4GV3A 4JKBA 4BC4A 2Z1JA 1BOTO 2F4VK 4KI4A 4A62A 3CJBA 4JKGA 3LPUA 3MWPA 4FK4A 4DQ8A 3QINA 4F4KA 3EO3A 5F2RA 4J2EA 3KLHA 3OYKA 2O4IA 2QW9A 2E6MA 4JHDB 3QERA 3ZSWA 2KKZA 3ZX2A 4GVMA 2OTJN 5IT9O 3OYEA 4B3OA 4H0YB 4O5BA 1KCFA 1SQKA 3VQ7A 1NNEA 1RDCA 1LAWA 1UAXA 4KI6A 4O0JA 3ZSQA 3LWMA 4CHYA 1JXEA 4IO9L 1YJ9N 1GLAG 4PWDA 5GADP 2YJEA 1S9GA 1WUAA 2P9KA 3UIQA 1RT2A 3EEQA 3LDNA 2VWBA 5M1PA 1T44A 1WBBA 1LAVA 2XY6A 2G8KA 2F9TA 3DRRA 5FPNA 4CGDA 3VQEA 4BRQA 2PY5A 4H5RA 4FXDA 4F3TA 4JEPA 4C23A 2NRZA 3NF6A 5BPLA 1WSEA 1S72N 1BIZA 3CQ8A 5DMRA 4DHYA 4WQ4C 5BN9A 5HRSA 3AVNA 1ZBUA 4EHUA 4FOEA 4NCAA 1G99A 3OBYA 1HYSA 3L2QA 1C0GA 4DLEA 1EX4A 2E20A 3I8DA 1B9DA 2OYQA 1U48A 2IIRA 5K14A 1ZBIA 2F7TA 3ASMA 3O1WA 4YFUA 2XO7A 3TARA 1KAXA 2OTLN 3OVNA 4FLTA 1NGFA 3G10A 4CHZA 2V7YA 4FJ7A 3R6MA 3VQ6A 4YOXA 1VRUA 3GG4A 3V81A 1VSEA 3DLRA 2YX6A 2O8CA 3NAEA 4PA1A 2KZMA 3EZ5A 1HNVA 3TI0A 3P1GA 3ZLJA 3UKRB 3HJFA 2IVOA 3MEEA 4YDUC 5BR8K 1HX1A 3O3GA 1J9AA 3CQYA 4Y0WA 4IFEA 2Z1IA 1YF5L 1ZYQA 4RW9A 1QHTA 3H46O 3MXMA 4OVLA 4DF8A 1ZXOA 3KZBA 4DFJA 4EZ6A 1J54A 3N4PA 3HRGA 4X64K 3P4IA 3DLBA 1SV5A 3CPEA 2A1RA 3SPZA 3LANA 4LH4A 4JK8A 2RF2A 1RBSA 4H5TA 3TU5A 3C6UA 1ESVA 4BGBA 3DOKA 1ZBLA 3CYMA 4DU1A 4CJWA 1HR0K 3B8AX 1OKJA 3R3LA 2V51B 4H0TB 3ID8A 4CHPA 5BR9A 3D2FB 3G0ZA 3OTOK 1NGEA 2YJFA 3OJUA 5C25A 1EXQA 5M1NA 3BP8A 1BA1A 3JSMA 2HMPA 3FE1A 3P5JA 1ASWA 1TUYA 2A40A 2UXDK 4M7XA 2P9PA 1EWQA 2ITGA 3H6EA 2YHYA 1FJGK 5KRSA 1IBMK 3VQQA 4FZYA 2NRTA 4ICLA 3KTQA 1X3MA 2QK9A 2O8FA 1BO5O 2XRIA 4YOVA 1QE1A 4BROA 1BDGA 3EKUA 2QWRA 4JI2K 2O8EB 3IMXA 3MN5A 4M3TA 3MN9A 4RW4A 1Q9YA 3K5OA 1QSLA 3VEYA 1EWRA 3HXMA 1TK5A 4CEEA 1NWKA 2FBTA 3NGZA 3TAPA 3PX4A 4N76A 2E2OA 3WXIA 4FWNA 2D0OA 2OZSA 4DTRA 3LDPA 3CJAA 4JD2A 1N8RO 4JNEA 4QS9A 3K2PA 3AVLA 5KQ8A 3SMSA 4WF9L 3K5NA 2OPRA 1NJYA 2UUCK 2PBDA 1QTMA 1KVCA 5AQZA 4BRPA 4F8RA 1Q9XA 3OYHA 4JRPA 2ZJQL 4A57A 1XUPO 1LCUA 4CEDA 3VQPA 1TKZA 2D4WA 3DAWA 3CCEN 5AQUA 3DXMA 2Q0UA 2JWLA 3JYTA 4HHTA 2GWKA 3C7NA 2GUPA 3U6FA 1SKRA 2GWJA 2Y1IA 2QWLA 1U45A 3D7EO 4KTQA 1CXUA 5J2MA 1IKYA 1D9DA 5DK5A 1U04A 3PV8A 3ENBA 4BR5A 4CZEA 3MX5A 5KI6A 1Y97A 1KAZA 4BRLA 2E2NA 4N5SA 4DR1K 1N34K 4N41A 4K42A 4PL8A 3CMEN 1IKWA 4JI3K 1GLEG 3HT3A 4FSVA 3O9SA 3TTDA 3OW2M 1U49A 3NE6A 4FJXA 1C1AA 1NBWA 2OCEA 3V1RA 2O8DA 2HVIA 2X6NA 4JKGB 4LD0A 3S3MA 4BQLA 2BGGA 2IGIA 4DTXA 1Q8IA 2QTDA 3RMCA 2D1KA 3BZCA 1HRHA 1ASVA 4MFBA 4FJKA 1A5VA 3NF7A 3AGKA 4E89A 2DY4A 4BRGA 3AVCA 4JI6K 1VSMA 4ILGB 5I42A 2ZQBA 3LDLA 3OA9A 2YI1A 1TL1A 3ULEB 3K9JA 3VESA 2W42A 2Q2RA 3RRHA 3RSEA 4H0VB 4JI1K 5AQJA 5M1QA 1OH8A 1BCMA 3CFPA 2OPQA 5JLFA 4WFAL 1RTHA 3CMAN 1CXQA 4B8AB 3QEIA 3V9UA 1QSSA 1A5XA 3SUPA 4Z4EA 1TYQA 2J4RA 3ULDA 4IO8A 4NB4A 2CH6A 2E8AA 3KLGA 1HQUA 3SCXA 4CESA 3VGLA 3NF8A 5I9EB 3CJ9A 1MDUB 1NGIA 4O8KA 4DR3K 3EE9A 3VQCA 1RDBA 3O4WA 1JLCA 3SBTA 1EO1A 4DR2K 1JLBA 1KC8O 4AM6A 1TKXA 4QOZB 1I3AA 4XH5A 2OA8A 2CGJA 4ID5A 4N56A 1YT3A 4KHWA 3ATUA 2IDOA 4JKFA 2P9LB 2CGLA 4KB1A 3HM9A 2F8TA 3LM9A 4CHOA 4GV6A 2EX3A 1NM1A 2CH5A 3SAHA 2PAVA 4Z4GA 2QEXN 1QSYA 3BZKA 4OPAA 3OBWA 5CYMA 4DSLA 3VGKA 4ELUA 1KLNA 5MLCQ 3HP9A 1TKDA 4CGIA 1LW0A 3PUFA 5CHIA 1NOYA 4C1NK 5ELZA 3IKMA 2PYJA 2WBNA 4EIAA 2HBKA 2H3GX 4X62K 4UY8O 1VQMN 3QETA 1WSJA 4CEFA 4I9LA 4YDUA 1JLQA 3P39A 3CXCM 1M1KO 3HSCA 3QICA 4FW2A 3WXJA 4CERA 3LP0A 1JLGA 4LC9B 3RMBA 1Q81O 4E1NA 4FWPA 2B5JA 3W3DA 1GOCA 3TR8A 2E88A 3HPOA 4JK7A 2HHTA 3I56N 4FLZA 1XI1A 1S22A 1L3UA 1VQNN 3KLEA 3SQ4A 1E4FT 3H3NO 3QFUA 5JVGL 1NK4A 3PO5A 4C8KA 1HNZK 1IKVA 3QNNA 4KH5A 4ISEA 2ZM6K 5BPNA 4L3QA 1ZBFA 1NGAA 2ZD1A 4CEBA 3AO2A 1C0MA 4FJ9A 3EL2A 1KFSA 4HCBA 4ZHRA 4DR5K 5E41A 1EKEA 4M7YA 2ETJA 3MEGA 2OPSA 1RT5A 1GLCG 3OYIA 3TSPA 1D9FA 4G9ZA 1IKXA 4DV6K 5AQRA 4AHVA 3G4SN 2BUPA 4NCBA 2HNZA 1R59O 2G8VA 4BRMA 3SQ2A 4OLAA 4CBWA 4JD2B 1BIUA 3E01A 1T6DA 4OJRA 4RG8A 3VETA 3GE1A 5F1XA 4A59A 1XHZA 3HPHA 2UUAK 5JICA 3SUQA 1CZAN 1NGBA 3ALYA 3AV9A 3CCUN 1QZ6A 4KKOA 4LF4K 5JLHA 5ADXH 1ILYA 3AO4A 3W0LA 1IO2A 4K8ZA 3WT0A 1WBDA 3VA3A 3U3GA 4KHUA 4DTJA 1YJWN 3V9SA 2E5LK 1XHXA 5FPMA 3G25A 2RHKA 3HK2A 4FJ5A 4B3MK 4YY3K 3L4QA 1Z26A 1BL3A 1RCHA 2KQ2A 3UKRA 3NBPA 2YNFA 3FZKA 4BG9A 5HP1A 5M1FA 3WNEA 2V52B 4BE1A 4GMJB 1YAGA 3ZT1A 3AAQA 4OKKA 2X78A 2PYLA 4QS8A 3CC7N 4CF1A 4H5NA 2ZJRL 3OJSA 3OYAA 3WQUA 4CK3A 5HRRA 4JI0K 4F2SA 1HQEA 1NK0A 3QBXA 4FVUA 4CW7B 4BRFA 3O1BA 4FJNA 3TSQA 2E6LA 4FJJA 1HNIA 4K8XA 4FLUA 4WE1A 3LP3A 3CM5A 1BG3A 3R1XA 3LAMA 4IEEA 4W5QA 3ZSXA 4I6MB 3KD5E 1T6CA 4LSNA 1IBLK 1GOBA 3RMDA 4CJSA 1W9HA 4CEAA 1G15A 2OANA 4AH9A 4CI6A 4IDKA 3L3UA 4KTWA 3O80A 4JS4A 2HHUA 4BRKA 5AZIA 3KWGA 5HRNA 4CZMA 3OYMA 2RKIA 3T1YK 5AQHA 4OPJA 5AFUH 1QQCA 1TK8A 2I7NA 3U4LA 4IJNA 4CJ5A 1W0HA 1LWEA 2Q0RA 2HBMA 4BGAA 4LF5K 2P9KB 3TAEA 1JXBA 4W5OA 3ZSOA 1TAQA 4BWJA 3SQ0A 3C6AA 4CZKA 3ZETB 4IOAL 3FFKB 5TKWA 4DFKA 4DF4A 4DQRA 1K8KA 5AQMA 4AHCA 2YHAA 3GL1A 4GW6A 3CQXA 4FLYA 3T69A 2GBZA 2NRHA 4CF9A 4DR7K 4DU4A 3A8YA 4IG0A 3CERA 4CJKA 4NO7A 4K41A 3VQDA 4CHQA 3PO4A 4DS5A 4ELTA 4U7BA 2WOMA 3S9HA 4J2BA 1H1VA 3MCAB 4FYDA 1NKBA 3D45A 4IOXA 5KPZA 3L2VA 3VF6A 4PHTX 5AQNA 4C1NI 4CIEA 4FLXA 2O8BA 1NK8A 1TAUA 1KQSM 3AVHA 4KHYA 4NXMK 2PZSA 4AHUA 4O5FA 4LF9K 2OZMA 4CEQA 3CFRA 3MN6A 3VGMA 4IJAA 1Z05A 4MDBA 4OKJA 3AA3A 4WFNL 3SMPA 1NJXA 3NGIA 3C95A 5AQTA 1SKSA 5J2QA 3H45C 5HOOA 3SAFA 2PFUA 1B9FA 2KZZA 5FRMA 4DSEA 4M3RA 3MXIA 4B9TA 4HCCA 2F8SA 5AQYA 2VCPA 4DCHA 3NDKA 3HO1A 4YHHK 2HHVA 3SAGA 4KBOA 2W40A 1HLUA 3EKSA 5IWAK 1YJNN 4EHTA 3MCPA 1P90A 3D2EA 1OVYA 3K9KA 2HHHK 1U6ZA 2QA4N 2V7ZA 4MO5A 1JLFA 2IVNA 3VOVA 1Q86O 3TABA 1VSIA 1NJZA 2FF3B 1ATNA 3O9TA 1HNWK 5BRFA 3S3NA 3SQ1A 5I3UA 4ILHA 1YIJN 3K58A 5KRTA 5AQSA 2Q3SA 2HW3A 1GLDG 5GIPA 3HTVA 2ASPA 3HOSA 4BE0A 3VENA 4BRNA 1JCGA 2ZE2A 3M3ZA 4PY5A 3VQ5A 2DFFA 3RTVA 1DT9A 4ISGA 5GINA 1Q82O 1TUUA 3QDKA 1VQ7N 4CGGA 3CJ1A 2P1JA 5CZ2A 3IFRA 1U2VB 3IG1A 1MU2A 3ENHA 2WTUA 3M8PA 5AQIA 3PLAA 3C7NB 4DUZK 4KO0A 2O8BB 2RPIA 3VQ8A 1OH6A 3FLCO 2VWKA 3KK3A 4G1QA 3G6EN 4H5VA 2ATQA 3SBGA 4RW7A 1JKHA 4I7FA 3WNFA 4FOIA 3V6DA 3J7ZO 4IXCA 4CD1A 4NCGA 3RSEB 1S1XA 3FZHA 3AO1A 1JLEA 3BDPA 5AQGA 3THVA 3ZSYA 3LPTA 1BCOA 4CF0A 1HKGA 5E26A 1TK0A 4J8FA 4BR2A 1VQ6N 3VMFB 4FCYA 4U67L 4IZ9A 5AQOA 4BR4A 3D2FA 3B6OA 3AVBA 3HL8A 4Z4FA 1RDUA 1T3VA 1KAYA 2DTUA 5ADXA 2KW4A 3QMLA 1TL3A 3ZEUA 2P9SB 5C2DA 3OS2A 4H03B 3T1HK 2O8DB 3OHRA 5C24A 3C6HA 4CFCA 1J5EK 5A2QO 4DSIA 3CCVN 3VN5A 3LDQA 3TANA 1XMQK 1S3XA 3SPYA 3OYJA 4Z4CA 1BISA 1DGKN 4BACA 5AQKA 5M1OA 1RDAA 2KLAA 3LDSA 3CC2N 3AVAA 3HVTA 4JI8K 4JKEA 2QWQA 1BI4B 4JV5K 3PX0A 1L5UA 4JK9A 3D6RA 3L0QA 4CZGA 4M45A 1D8YA 1VSHA 3KLIA 3GDQA 4H5WA 4BDYA 1S1UA 3H3OB 3MEDA 3ZETA 3CG7A 5FLXO 2IVPA 4WFBL 5AQFA 1UA0A 3J81O 1RTJA 5AZJB 4E1MA 2P9UB 2A5XA 4H4OA 2GEMA 4DFPA 2BH1A 4CD3A 2P9LA 3NH0A 3IAYA 4F3OA 3UKUB 1NK9A 3DRSA 4JYAK 1U4BA 3K57A 1FKPA 4BY9C 1QVFM 3H08A 2G8HA 1VHXA 1HYZA 2Q36A 4CF8A 2BTFA 1IJJA 1ITGA 4PKIA 1IG8A 1QQNA 1RFQA 3VQAA 3ZSVA 1SKWA 3AVIA 4HUGA 4DQIA 4FK0A 4DV3K 1U2VA 4O55A 1BGXT 1FKOA 3THYA 4NYFA 4GVEA 4RWTA 4ZTJA 2P9NA 3HPGA 5AQPA 4BVPA 2E4LA 4B9QA 3THXB 4FZZA 4CJ4A 2Z1GA 5T7BA 1RT4A 4DTMA 4FPAA 3VEZA 1YI2N 1NK5A 2KTQA 4WQ5C 3WNHA 1TVRA 4XH4A 4FWQA 1WSFA 4M42A 2KHOA 1XC3A 1C0FA 2E1ZA 3OS1A 2QI2A 1RT1A 4LF8K 5AZJA 3V4IA 4BR7A 5GIOA 1L3SA 4M3ZA 4MLHA 4BR0A 1NGCA 3ZX3A 3FFIA 4KTZA 4MQ3A 3O3FA 3MX2A 3EE8A 4I2PA 1VRTA 4KH4A 3VEXA 1WAJA 4EP5A 1QZ5A 5TKYA 2IAJA 3JS6A 2QWMA 1RDDA 4A61A 2GUIA 4B9MA 2ZJPL 4DTOA 3UE5A 1YUWA 4M3YA 3RR8A 3M8SA 4NLBA 1DEJA 2YHBA 4BR9A 4CJFA 3NFAA 4RCHA 3QB0A 4WCEL 1REVA 3OYFA 3A5LC 3SV4A 3WXKA 5D3GA 3WNGA 3KKRA 4PUOA 3KVGA 4DMNA 3O4QA 5HROA 1BQNA 1RT6A 1N33K 3THXA 4CGHA 4IDHA 3F73A 2P5OA 3QEVA 5BPMA 4KREA 1XNRK 1KD1O 3IUCA 3E9PA 3OYDA 4JLHA 3O08A 1WN7A 1CZBA 1A5WA 3D2EB 1NK6A 4K25A 1NJWA 2FC0A 1RBTA 3OYBA 1K6YA 2O8FB 5EXWA 3DJCA 4E1JA 4DSJA 3FZLA 4DS4A 2GELA 3BGRA 4W5TA 4E3SA 3LWLA 3CCMN 3NF9A 3QIOA 1S1WA 2KFNA 2XY8A 4PKGA 4LSLA 1LWCA 2A6AA 1HYVA 3WQTA 4C8OA 1YTUA 1WSHA 4IWVA 1HMVA 3BEXA 3DXKB 3SLCA 2I7PA 3NCIA 1BA0A 1C1CA 3HOTA 4W5NA 2YNIA 4CFAA 4I6MA 1KVBA 1YTAA 4QCLA 1NMNA 4CJTA 2QWPA 2ZWHA 4JI7K 4IG3A 5C15A 1V4SA 5AR0A 1YXQA 4DB3A 4JS5A 1L3VA 4DV4K 3AGRA 5EOYA 3QO9A 3LL3A 4FK2A 1I39A 2WONA 2AJQA 4V19S 2D5RA 3NHGA 4A2BA 5KGWA 4B9UA 3BY5A 1NGJA 3I0RA 2FXUA 4J2AA 3KD1E 3TAFA 3WEEA 1GLJO 3ATVA 4FWOA 5F0XA 4ZTFA 3G71N 2UXCK 4FPBA 2NLXA 1HNXK 3AA5X 4B1XB 4XIUA 1WB9A 2DPNA 1E3MA 1BQMA 3A2FA 1S5JA 3HP6A 4CK1A 4O4GA 2I5JA 3LZJA 4B1VA 1QS4A 4AF1A 1NK7A 3P83D 4FL9A 1S1VA 5AQVA 5LJWA 1NLVA 1N36K 1UOCA 2ITMA 3DI6A 1T05A 3TAMA 4QAGA 3PIOL 4CGJA 4CIFA 3CJ7A 4CVNE 1XNQK 2IS3A 5C42A 3WUHA 5KQDA 4B3TK 2WC9A 1HJRA 4DTNA 2WFBA 3AY9A 1BUPA 1GLFO 4Q5VA 2G8WA 4BRHA 1C0UA 1OH7A 1GOAA 4M3XA 1IG9A 3WXMB 4C8MA 3CCJN 3CCRN 3V9XA 5J2PA 3NGYA 2QKBA 5FROA 1RT7A 4CEOA 3CPWM 5FDLA 4CZIA 1OVQA 3TTFA 2P51A 2D0CA 2Y1JA 3R9PA 3O9UA 5CR4A 1HUXA 5KGXA 3A5OC 4HVJA 3VEWA 2HF3A 1NJIO 1MA9B 3DWLA 3LP1A 2ASMA 2KFZA 1OH5A 3PIPL 4H0OA 3VF4A 3UKUA 1J6ZA 4K43A 5BN8A 4YORA 2QWNA 4DR4K 3E9OA 5BRDA 5B8HA 3O5BA 1RNHA 1LW2A 1P8ZA 2Z1HA 3DLEA 3T3FA 3I0SA 1KLMA 1O1WA 1YHQN 1R0AA 1DKGD 3T7ZA 4ID1A 4B9VA 3LALA 2E1YA 2AP1A 2VG7A 3ZT0A 1EQYA 3DOLA 1TGOA 2LSNA 5GAHP 3CFOA 2A42A 1RBRA 4E7LA 2ASOA 1HPZA 4HTUA 2XY7A 1Q18A 4CJVA 3PY8A 4CIGA 1KFDA 4Y1DA 1N32K 2CGKA 2VWJA 2UYTA 3VQ9A 4DKWA 4CECA 5SZTA 3QEWA 1EP4A 4I2QA 3OS0A 5AQLA 4BWMA 3L2UA 4DV1K 4A2AA 1EETA 3MN7A 3QESA 1J5OA 2GX9A 2W41A 1W7AA 1SL2A 3AO3A 4CJ7A 4YNQA 1VQ5N 1E4GT 4WQ5A 1VSFA 1XC9A 1Y64A 4KHNA 2Q97A 3KKSA 1FXXA 3HZ6A 4H4MA 1JLAA 2FBXA 4OPKA 4GKKK 3H1VX 2X74A 4H8KA 1K8KB 3CJCA 4LF7K 4FWLA 4LFBK 3TAQA 2YHXA 2HNDA 4JAXA 3UB5A 2R7YA 3WXLA 4A5BA 5CE3A 4JI5K 5H1SQ 4FJ8A 3B6PA 1X9WA 1B92A 4RW6A 5DM7L 4Q0BA 1BWFO 1K73O 4KFBA 4GY2B 4YOWA 3DLLL 4FLWA 3L2WA 1WSIA 1VQ9N 3SJHA 1TKTA 3VTIA 4AHRA 3EYZA 5J2NA 4FWMA 4RTFD 2FBVA 2G8IA 4LFAK 4E7KA 1RT3A 4X65K 4KRFA 5EU7A 4NXNK 3MWTA 3Q7BA 1CZ9A 1NU0A 1RBUA 1J53A 1VSLA 4KHQA 3C65A 3IRXA 4WYBA 2X6SA 3ZEUB 1ZBHA 2NRXA 4IOCL 1NGDA 1ATSA 3S41A 4CZJA 2E2PA 2QXLA 4B1UB 3HI0A 4XEIA 4ELVA 1X3NA 3V9WA 4DUYK 4CJPA 3AVFA 4BE2A 4E19A 2GTDA 5GAEP 4AHTA 4B1ZA 5C10A 4BRCA 4R79A 4CE9A 3IS9A 3O3HA 3SV3A 2FSJA 1XMOK 3NVKA 3K59A 4KV8A 1Q7YO 4B3SK 3TAGA 2EHGA 4C8NA 3Q7CA 3KK2A 4JKHA 1S1TA 3DRPA 4CK2A 2F9WA 3R8EA 3HVRA 2QKKA 1GLLO 1UWBA 2XHBA 4C8LA 2E2QA 1BI4A 4CCHA 3M1FA 3ZYYX 3FZFA 3T1AA 4CJRA 3TWHA 4O44A 2UXBK 3C0BA 3F9MA 5HRPA 3QFPA 2Q1NA 3CHWA 4MO4A 3D0PA 4BG8A 1X9SA 1D4XA 3OYGA 4CBXA 4Z4HA 1XWLA 1VSKA 4BC3A 4HTLA 4DTUA 3HYFA 4DR6K 4BDZA 3U8XA 4H0PA 2XY5A 1KXPA 2F96A 2YCHA 4FWRA 4E7IA 1YITN 3RVCA 4XH1A 3J8AA
chains in the Genus database with same CATH topology
2P9NB 1QQMA 4JK7A 1U2VA 3I56N 4A62A 3CJBA 4JKGA 3P31A 4GVEA 1S22A 3MWPA 4BVOA 4RWTA 1VQNN 2P9NA 5AQPA 4BVPA 1E4FT 4DQ8A 4BRAA 3H3NO 1TYQB 3EO3A 5F2RA 4B9QA 2HBJA 3QFUA 3L4IA 5JVGL 3E66A 1JCEA 2QW9A 5JVHL 4FPAA 3VEZA 4KH5A 2HOEA 1YI2N 4JHDB 4WQ5C 3O8MA 4ISEA 1BU6O 3VTHA 4XH4A 1SZ2A 2KKZA 4FWQA 5BPNA 3ENOA 4L3QA 2KHOA 3ZX2A 1XC3A 2OTJN 1NGAA 1C0FA 2E1ZA 5HL7L 2QI2A 4H0YB 3EL2A 2P9UA 5AZJA 4BR7A 5GIOA 4MLHA 4BR0A 1NGCA 3ZX3A 1SQKA 4M7YA 3MX2A 3EE8A 1K9MO 4QS7A 2VGNA 4CZFA 4KH4A 3VEXA 1VQKN 3AAPA 1QZ5A 5TKYA 1GLCG 3TSPA 4G9ZA 3JS6A 4IO9L 2QWMA 1YJ9N 1YVNA 1GLAG 3GOIA 5AQRA 4A61A 2ZJPL 5GADP 2YJEA 3CCLN 3UE5A 1YUWA 3G4SN 1WUAA 2VGMA 2P9KA 4BC4A 2BUPA 3LDNA 1R59O 4NLBA 1DEJA 2VWBA 5M1PA 4BR9A 3VEVA 1T44A 4FO0A 4BRMA 4A5AA 4RCHA 3GBTA 3QB0A 2F9TA 3CETA 4JD2B 4CBWA 4WCEL 1T6DA 1V4TA 3KHYA 4WQ4A 3GE1A 3VETA 4A59A 5FPNA 5F1XA 3A5LC 5KPTA 3WXKA 4BRQA 3EN9A 4H5RA 5JICA 3KK7A 4JEPA 4C23A 3KVGA 5DM6L 2NRZA 5BPLA 1CZAN 1NGBA 4IDHA 1QZ6A 3CCUN 1S72N 5JLHA 5ADXH 4DHYA 5EVZA 4WQ4C 5BN9A 3W0LA 5BPMA 5FPEA 1ILYA 4EHUA 4FOEA 3N4QA 1KD1O 3IUCA 1G99A 3E9PA 3FZMA 2P9SA 3WT0A 3OBYA 5M1KA 3NMUA 4BQZA 1C0GA 2YHWA 3M5RA 1YJWN 2E20A 3O08A 5FPMA 3G25A 2RHKA 2IIRA 3H1QA 3L4QA 4CZHA 3D2EB 3UKRA 4EFHA 2F7TA 3O1WA 4K25A 3E1YA 3FZKA 4FWSA 4BG9A 5M1FA 2V52B 1KAXA 2OTLN 1YAGA 5EXWA 3DJCA 4E1JA 4MLEA 3FZLA 3AAQA 5C2FA 1NGFA 2GELA 3CF5L 2V7YA 4QS8A 3R6MA 1O13A 3VERA 5BRHA 3CCMN 3CC7N 4YOXA 1QVGM 4PKGA 1VAZA 4H5NA 2A6AA 2ZJRL 3WQTA 3GG4A 3BF1A 4IWVA 1RDWX 3WQUA 2RE2A 3BEXA 3DXKB 2YX6A 1MWKA 3SLCA 2I7PA 3EZWA 1SS6A 1VQ4N 1BA0A 4ILJA 1MWMA 3QBXA 4FVUA 4BRFA 1LOTB 3O1BA 3UKRB 5EY4A 1VQON 2IVOA 4YOTA 3TSQA 3HOTA 2D0PA 4YDUC 3CCSN 1HX1A 4I6MA 3CQYA 4Y0WA 4IFEA 1BG3A 1YF5L 3A5MC 3R1XA 2QWPA 4IEEA 3H46O 2ZWHA 4I6MB 4JN4A 1T6CA 3WEEB 1ZXOA 5C15A 1V4SA 5AR0A 1YXQA 4DB3A 3KZBA 3N4PA 2OANA 5AQWA 3HRGA 4CI6A 3I55N 1JCFA 4AM7A 3AGRA 3BF3A 5AFUA 3P4IA 5EOYA 1W97L 3CPEA 3LL3A 3O80A 4JK8A 4BRKA 5AZIA 4MDAA 3KWGA 4H5TA 2P9IA 2VYPA 4A2BA 3TU5A 4CZMA 3J8AA 5AQHA 5AFUH 1ESVA 4BGBA 1NGJA 2FXUA 2I7NA 3U4LA 4IJNA 4BRDA 1HKCA 2Q0RA 1GLJO 2HBMA 1QHAA 2P9PB 3ATVA 3WEEA 3B8AX 3JXUA 1OKJA 2P9KB 4FWOA 4BRIA 5F0XA 3R3LA 3G71N 4JKDA 2V51B 3C6AA 4CZKA 4FPBA 2NLXA 4H0TB 3ID8A 3ZETB 4B1XB 4IOAL 2DPNA 4M63C 3FFKB 5TKWA 5BR9A 3BUZB 1K8KA 3D2FB 3GL1A 5AQMA 1NGEA 2YJFA 1ATRA 3A0IX 3CQXA 4B1VA 5M1NA 4AF1A 3BP8A 1BA1A 3T69A 2HMPA 4FL9A 3FE1A 5LJWA 4NLCA 5AQVA 1TUYA 2A40A 2NRHA 1HPMA 4B1YB 4BC2A 1NLVA 1Z6RA 4M7XA 3A8YA 2ITMA 3CERA 2P9PA 3QBWA 2HBLA 3LDOA 4NO7A 3H6EA 4K41A 2YHYA 5C12A 3PIOL 3CJ7A 3MMVA 4YOUA 4U7BA 2NRTA 5KQDA 3WUHA 1X3MA 2WC9A 4PL7A 1H1VA 3MCAB 3F5TA 3TTCA 2WFBA 3AY9A 1BO5O 1BUPA 1GLFO 4IOXA 5KPZA 4YOVA 3VF6A 4BROA 1BDGA 3IDHA 4BRHA 3EKUA 2QWRA 2Q31A 5AQNA 4PHTX 3AARA 4JKCA 3CI5A 3U9DA 4C1NI 3IMXA 3MN5A 3MN9A 1KQSM 5KPRA 2WUSA 3WXMB 1ZBSA 3M6GA 5AQXA 3VEYA 3CCJN 1WOQA 3CCRN 4O5FA 3CPWM 1NWKA 3O9RA 1HKBA 3MN6A 4CZIA 3TTFA 3VGMA 4IJAA 1Z05A 4MDBA 4WFNL 3SMPA 1GLBG 3R9PA 2E2OA 3O9UA 3WXIA 1NGGA 3KWIA 5CR4A 4CBUA 1HUXA 4FWNA 3A5OC 3VEWA 4B1WB 2HF3A 5AQTA 4BREA 2D0OA 1MA9B 3U9ZA 3DWLA 5LY3A 1NJIO 2ASMA 3H45C 3LDPA 5E84A 3CJAA 3SAFA 5HOOA 4JD2A 3PIPL 2PFUA 2ZGZA 1N8RO 4JNEA 4QS9A 5KQ8A 4OO1J 4H0OA 3SMSA 3VF4A 4WF9L 3UKUA 1J6ZA 5EX5A 3L6QA 4K43A 3ZX0A 5BN8A 5AQYA 2PBDA 4H0XB 2VCPA 4YORA 4DCHA 2QWNA 3E9OA 5BRDA 3SAGA 5B8HA 3O5BA 5AQZA 4BRPA 4KBOA 2W40A 1HLUA 3EKSA 1P8ZA 3MK6A 1YJNN 2ZJQL 4A57A 4EHTA 1XUPO 3MCPA 1P90A 1LCUA 2NRVA 3D2EA 1OVYA 2D4WA 3DAWA 3K9KA 3CCEN 3DXMB 5AQUA 1VQ8N 3TSUA 1U6ZA 2FLOA 3DXMA 2QA4N 2Q0UA 3P38A 2JWLA 2V7ZA 1YHQN 4MO5A 2GWKA 2IVNA 1DKGD 3C7NA 3T7ZA 2GUPA 3VOVA 1Q86O 2GWJA 2E1YA 2QWLA 2AP1A 3LM2A 3D7EO 3VPZA 1K8AO 1EQYA 3O6WA 1X9JA 2FF3B 1ATNA 3O9TA 5GAHP 2JWKA 3ENBA 2A42A 5BRFA 3VEOA 4BR5A 4CZEA 2A41A 3MX5A 4ILHA 2ASOA 2ZF5O 1KAZA 1YIJN 4BRLA 2E2NA 4YOYA 1Q18A 4K42A 5AQSA 4PL8A 2NZTA 3CMEN 5BREA 2CGKA 2UYTA 1NMDA 2P9IB 4DKWA 1GLEG 1GLDG 3I8BA 3CIPA 3HTVA 5GIPA 4FSVA 3MDQA 2ASPA 3O9SA 3HOSA 3VENA 5AQLA 3VF2A 3TTDA 4KH6A 4BRNA 1JCGA 3OW2M 3M3ZA 4A2AA 1NBWA 1DT9A 3MN7A 4ISGA 5GINA 1Q82O 1TUUA 5FPDA 3QDKA 1VQ7N 2GX9A 3CJ1A 3F2KA 2W41A 4JKGB 3NVMA 3IFRA 1U2VB 4BQLA 4CJ7A 3CCQN 3ENHA 5AQIA 1VQ5N 3PLAA 3C7NB 4FWKA 1E4GT 2QTDA 2HF4A 4WQ5A 1Y64A 2Q97A 2D1KA 3HZ6A 4BGAA 3FLCO 3H1VX 4Z94A 1K8KB 3AGKA 3CJCA 3G6EN 4H5VA 4FWLA 3SBGA 2YHXA 4BRGA 4JAXA 1QQOA 4FOIA 4ILGB 3UB5A 3DXKA 2NRRA 3WXLA 3LDLA 3OA9A 3J7ZO 4O8UA 2YI1A 4IXCA 4CD1A 3A5NC 4A5BA 5CE3A 3ULEB 3K9JA 3RSEB 5H1SQ 3VESA 2Q2RA 3RSEA 4H0VB 1M90O 1XQSC 3FZHA 5DM7L 5AQJA 1BWFO 1K73O 5M1QA 4JHDA 4BC5A 5AQGA 4GY2B 4YOWA 2A3ZA 3FR0A 3DLLL 2FF6A 5JLFA 4WFAL 1VQ9N 1HKGA 5E26A 3SJHA 3VTIA 4J8FA 4BR2A 3CMAN 1VQ6N 4FWMA 1NGHA 3VMFB 4RTFD 4PKHA 2FSKA 3HM8A 4U67L 1TYQA 2QM1A 4IZ9A 5AQOA 2J4RA 2HSTA 4BR4A 4EAHD 3MWTA 3D2FA 3Q7BA 4IO8A 4NB4A 2CH6A 2E8AA 1SAZA 3SK3A 3ID6A 3TPQA 1RDUA 2FSNA 3C65A 1T3VA 3VGLA 1RGIA 4WYBA 3CD6N 3ZEUB 1KAYA 5ADXA 2NRXA 3CJ9A 5I9EB 1MDUB 3QMLA 4IOCL 3ZEUA 1NGDA 2P9SB 1NGIA 5C2DA 1ATSA 4O8KA 3S41A 2E2PA 2QXLA 4CZJA 4B1UB 3HI0A 4XEIA 4H03B 3EE9A 1X3NA 3HBTA 3OHRA 2ZGYA 3C6HA 3O4WA 3SBTA 2NRWA 1EO1A 3CCVN 3LDQA 1S3XA 1KC8O 4AM6A 4HWIA 5C0YA 4XH5A 1DGKN 2CGJA 2GTDA 5GAEP 4B1ZA 5C10A 5AQKA 3ATUA 5M1OA 1HJOA 4F9OA 4BRCA 3CC4N 4JKFA 2P9LB 4GV9A 2KLAA 4R79A 2CGLA 3CC2N 3LM9A 2FSJA 3ULEA 3NVKA 4GV6A 1NM1A 2CH5A 3FGUA 3SAHA 2PAVA 2QEXN 4OPAA 1Q7YO 3OBWA 2QWQA 4JKEA 5LJVA 3VGKA 3Q7CA 3E9LA 4JKHA 4JK9A 2QWOA 3D6RA 3I33A 3L0QA 4CZGA 2F9WA 3R8EA 5MLCQ 1GLLO 2NNWA 4CZLA 3GDQA 2E2QA 4H5WA 5AQQA 3H3OB 3ZETA 4OPHA 3M1FA 5CHIA 2IVPA 3ZYYX 2EWSA 3FZFA 5AQFA 4WFBL 5ELZA 4C1NK 1VQPN 3IKMA 5AZJB 2P9UB 3O9QA 2A5XA 2AA4A 2GEMA 3C0BA 2BH1A 3F9MA 2WBNA 3QFPA 2Q1NA 3CHWA 4MO4A 4EIAA 4CD3A 2HBKA 1VQLN 2H3GX 4ISFA 4BG8A 2P9LA 5JMVA 1D4XA 3UKUB 4UY8O 1VQMN 4CBXA 4BY9C 1QVFM 4BC3A 5AZIB 4HTLA 4YDUA 2Q36A 3P39A 2BTFA 3CXCM 1W2BM 1M1KO 4GNIA 1IJJA 3HSCA 4JKAA 3QICA 3U8XA 3WXJA 4PKIA 4H0PA 1IG8A 1JJ2M 4LC9B 1QQNA 1RFQA 1Q81O 1KXPA 2YCHA 4FWRA 4FWPA 3W3DA 1ZC6A 5GAGP 4IEIA 1YITN 4JKBA 4GV3A 3RVCA 4XH1A 2E88A 1BOTO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX5 A;  3MX2 A;  3MWT A;  3Q7B A;  4GV6 A;  4G9Z A;  4GV3 A;  4GV9 A;  3Q7C A;  4FVU A;  3R3L A;  4GVE A;  3MWP A; 
#chains in the Genus database with same CATH topology
 4HUF A;  2P9N B;  1QQM A;  3THY B;  3THW B;  3P31 A;  1X1P A;  4BVO A;  4BRA A;  1TYQ B;  4DSK A;  2HBJ A;  1S6P A;  3L4I A;  3E66 A;  3V1O A;  1JCE A;  3F9K A;  5JVH L;  2BE2 A;  2HOE A;  4TSX A;  3AO5 A;  5CY4 A;  4DV0 K;  4OLB A;  3O8M A;  4KPY A;  4CF2 A;  3LP2 A;  1BU6 O;  3VTH A;  1SZ2 A;  4EZ9 A;  4FLV A;  4GKJ K;  3ENO A;  2VG6 A;  2JLE A;  5HL7 L;  4CFB A;  4M41 A;  2B4J A;  1T03 A;  4LFC K;  2P9U A;  3PSI A;  4M3W A;  1DLO A;  2D0B A;  3M8Q A;  4FVM A;  1K9M O;  3MEC A;  1KSP A;  4QS7 A;  2VGN A;  4CZF A;  1VQK N;  4X66 K;  3AAP A;  1NOZ A;  4FJL A;  3OYC A;  1YVN A;  3GOI A;  1RIL A;  3CCL N;  4FM2 A;  3KK1 A;  2VGM A;  4DFM A;  4B8C A;  3VEV A;  2G8U A;  2O4G A;  4FO0 A;  4A5A A;  3GBT A;  3CET A;  4WQ4 A;  1V4T A;  3KHY A;  3VA0 A;  1Z25 A;  5KPT A;  3HST B;  3QNO A;  1N6Q A;  3EN9 A;  3KK7 A;  5DM6 L;  5CYQ A;  3QLH A;  5FPE A;  5EVZ A;  3SUN A;  3N4Q A;  5M1K A;  3FZM A;  4IKF A;  2P9S A;  4DV2 K;  4AIL C;  3NH1 A;  4BQZ A;  3NMU A;  2YHW A;  3M5R A;  4KHP K;  4DV7 K;  1LV5 A;  3PX6 A;  3H1Q A;  5HLF A;  4CZH A;  3L8B A;  4EFH A;  4RW8 A;  3E1Y A;  4FWS A;  4LF6 K;  3RRG A;  5LMN K;  3ZT4 A;  1KVA A;  4MLE A;  4CJQ A;  5C2F A;  3CF5 L;  3VER A;  1O13 A;  5BRH A;  3J7A P;  1JL2 A;  4FZX C;  4B3R K;  3OYL A;  1QVG M;  3K0S A;  1DTQ A;  1VAZ A;  3BF1 A;  3SZ2 A;  1RDW X;  2RE2 A;  1MWK A;  4DQQ A;  4AHS A;  3EZW A;  1SS6 A;  1VQ4 N;  4ILJ A;  1MWM A;  4OX9 K;  1LOT B;  2HB5 A;  2VQF K;  5EY4 A;  1VQO N;  4YOT A;  4Z0U A;  2D0P A;  3CCS N;  3DM2 A;  3THW A;  4DQP A;  2UU9 K;  3A5M C;  1VSD A;  1KRP A;  3L3V A;  3LAK A;  4JN4 A;  2HNY A;  1RBV A;  3WEE B;  3ZT3 A;  4J2D A;  3VQB A;  2O8E A;  3DMJ A;  5AQW A;  3I55 N;  3AA4 A;  4B9S A;  4OGC A;  1JCF A;  4EP4 A;  4AM7 A;  3KIO A;  3BF3 A;  5AFU A;  1W97 L;  5JS2 A;  4CJ3 A;  4MDA A;  2P9I A;  4BDP A;  2RN2 A;  2VYP A;  4DG1 A;  1FK9 A;  4DV5 K;  3K5L A;  1WNS A;  4BRD A;  4KAZ A;  1IH7 A;  1HKC A;  1QHA A;  2P9P B;  4BRI A;  3JXU A;  4JKD A;  4B9N A;  4FJG A;  2D0A A;  3AVM A;  4DU3 A;  4OKE A;  1BHL A;  4M63 C;  3ZCM A;  3BUZ B;  1S6Q A;  2HHS A;  3AVK A;  5FRN A;  1ATR A;  3A0I X;  5CZ1 A;  2HHX A;  4OGE A;  1KTQ A;  4CFD A;  4NLC A;  4B1Y B;  2O8C B;  1HPM A;  4BC2 A;  2HHW A;  1WLJ A;  1Z6R A;  1ASU A;  3QBW A;  2HBL A;  3LDO A;  1S9E A;  1NKC A;  5C12 A;  1LWF A;  3MMV A;  3ITH A;  4CJE A;  3DLG A;  4CJU A;  1N5Y A;  4YOU A;  2GV9 A;  4PL7 A;  2BDP A;  3TTC A;  3F5T A;  4I9Q A;  4CGF A;  5KTQ A;  3C94 A;  4Z4I A;  1VSJ A;  3IDH A;  1F21 A;  1C0T A;  2Q31 A;  3C6T A;  3AAR A;  4JKC A;  3CI5 A;  3U9D A;  4DSF A;  3LZI A;  5KPR A;  2WUS A;  4CHN A;  1ZBS A;  3M6G A;  5AQX A;  1WOQ A;  4F2R A;  4UQG A;  3O9R A;  1HKB A;  1FW6 A;  1GLB G;  4HUE A;  4CBU A;  1NGG A;  3KWI A;  2B6A A;  4B1W B;  4BRE A;  3U9Z A;  5LY3 A;  5E84 A;  1T8E A;  2DFH A;  2ZGZ A;  2HMI A;  3ZT2 A;  4OO1 J;  4B9L A;  4DWI A;  4IFY A;  5EX5 A;  3L6Q A;  3ZX0 A;  4H0X B;  1YVU A;  4LY7 A;  1RTI A;  3OY9 A;  3MK6 A;  2NRV A;  4JI4 K;  3M8R A;  3DXM B;  1VQ8 N;  3TSU A;  2FLO A;  3P38 A;  1NKE A;  3V1Q A;  3AVG A;  3RWU A;  3OYN A;  3LM2 A;  1D5A A;  3VPZ A;  1JL1 A;  1K8A O;  3O6W A;  1X9J A;  3KJV A;  2JWK A;  4LH5 A;  3VEO A;  1C6V A;  2A41 A;  3K5M A;  1NG9 A;  2ZF5 O;  2BAN A;  1IV0 A;  4YOY A;  2YNH A;  1SL1 A;  2NZT A;  5BRE A;  4FM0 A;  1NMD A;  2P9I B;  4FJI A;  3QEX A;  3I8B A;  4FM1 A;  3CIP A;  3MDQ A;  3SJJ A;  3V9Z A;  3VF2 A;  2IOC A;  4KH6 A;  2JGU A;  1I94 K;  5FPD A;  2P5G A;  3DLH A;  3F2K A;  5HBM A;  3NVM A;  3CCQ N;  3S3O A;  4NYN A;  3NH2 A;  4FW1 A;  4FWK A;  1C1B A;  2HF4 A;  3EY1 A;  1U47 A;  4DTS A;  1SUQ A;  2IC3 A;  1L3T A;  3RMA A;  3T19 A;  4Z94 A;  4R5P A;  2FBY A;  1WSG A;  4IFV A;  1QQO A;  1WAF A;  3DXK A;  2NRR A;  3KLF A;  3ZSZ A;  2VG5 A;  1SL0 A;  4O8U A;  4DLG A;  3O4N A;  3A5N C;  5SWM A;  4DQS A;  3J7Y P;  5AJ3 K;  3JAM O;  1M90 O;  1XQS C;  1X9M A;  4JHD A;  4BC5 A;  1TV6 A;  4O0I A;  4Y1C A;  2A3Z A;  3FR0 A;  2FF6 A;  3SI6 A;  2YNG A;  5JS1 A;  1NGH A;  4PKH A;  2FSK A;  3HM8 A;  3SNN A;  4L8R B;  2QM1 A;  4PQU A;  2HST A;  4EAH D;  3SK3 A;  1SAZ A;  3TPQ A;  3ID6 A;  1UA1 A;  4CJL A;  2FSN A;  3CD6 N;  2UUB K;  1RGI A;  4KHS A;  3DLK A;  4CEZ A;  4AQY K;  3PSF A;  3QEP A;  1T7P A;  3MXJ A;  3ZSR A;  3HBT A;  3CM6 A;  2ZGY A;  2NRW A;  4W5R A;  3QIP A;  3SYZ A;  4HWI A;  4E7J A;  5C0Y A;  2OPP A;  3VQ4 A;  3J80 O;  1DTT A;  1HJO A;  4F9O A;  3CC4 N;  1RTD A;  4GV9 A;  3ULE A;  2VQE K;  2YKN A;  3FGU A;  2HVH A;  2G8F A;  5LJV A;  5LMU K;  2W6K A;  3AVJ A;  3E9L A;  3DYA A;  3RR7 A;  2QWO A;  3I33 A;  1CLQ A;  4IBN A;  4FJM A;  2NNW A;  4CZL A;  3MAQ A;  5AQQ A;  4JRQ A;  4E0D A;  2NUB A;  5LL6 Z;  4OPH A;  4B08 A;  2EWS A;  3AA2 A;  1VK0 A;  2DFE A;  1VQP N;  2A1S A;  3O9Q A;  2AA4 A;  1VQL N;  4FJH A;  4N47 A;  4ISF A;  2W6L A;  5JMV A;  4M3U A;  3U3Y A;  2YV0 X;  4K0K K;  2QXF A;  5AZI B;  2HHQ A;  3L2R A;  1W2B M;  1IBK K;  2YKM A;  4GNI A;  3SUO A;  4E7H A;  4JKA A;  4KB0 A;  1JJ2 M;  3ISN C;  5J1E A;  1ZC6 A;  5GAG P;  4DTP A;  4IEI A;  4GV3 A;  4JKB A;  4BC4 A;  2Z1J A;  1BOT O;  2F4V K;  4KI4 A;  4A62 A;  3CJB A;  4JKG A;  3LPU A;  3MWP A;  4FK4 A;  4DQ8 A;  3QIN A;  4F4K A;  3EO3 A;  5F2R A;  4J2E A;  3KLH A;  3OYK A;  2O4I A;  2QW9 A;  2E6M A;  4JHD B;  3QER A;  3ZSW A;  2KKZ A;  3ZX2 A;  4GVM A;  2OTJ N;  5IT9 O;  3OYE A;  4B3O A;  4H0Y B;  4O5B A;  1KCF A;  1SQK A;  3VQ7 A;  1NNE A;  1RDC A;  1LAW A;  1UAX A;  4KI6 A;  4O0J A;  3ZSQ A;  3LWM A;  4CHY A;  1JXE A;  4IO9 L;  1YJ9 N;  1GLA G;  4PWD A;  5GAD P;  2YJE A;  1S9G A;  1WUA A;  2P9K A;  3UIQ A;  1RT2 A;  3EEQ A;  3LDN A;  2VWB A;  5M1P A;  1T44 A;  1WBB A;  1LAV A;  2XY6 A;  2G8K A;  2F9T A;  3DRR A;  5FPN A;  4CGD A;  3VQE A;  4BRQ A;  2PY5 A;  4H5R A;  4FXD A;  4F3T A;  4JEP A;  4C23 A;  2NRZ A;  3NF6 A;  5BPL A;  1WSE A;  1S72 N;  1BIZ A;  3CQ8 A;  5DMR A;  4DHY A;  4WQ4 C;  5BN9 A;  5HRS A;  3AVN A;  1ZBU A;  4EHU A;  4FOE A;  4NCA A;  1G99 A;  3OBY A;  1HYS A;  3L2Q A;  1C0G A;  4DLE A;  1EX4 A;  2E20 A;  3I8D A;  1B9D A;  2OYQ A;  1U48 A;  2IIR A;  5K14 A;  1ZBI A;  2F7T A;  3ASM A;  3O1W A;  4YFU A;  2XO7 A;  3TAR A;  1KAX A;  2OTL N;  3OVN A;  4FLT A;  1NGF A;  3G10 A;  4CHZ A;  2V7Y A;  4FJ7 A;  3R6M A;  3VQ6 A;  4YOX A;  1VRU A;  3GG4 A;  3V81 A;  1VSE A;  3DLR A;  2YX6 A;  2O8C A;  3NAE A;  4PA1 A;  2KZM A;  3EZ5 A;  1HNV A;  3TI0 A;  3P1G A;  3ZLJ A;  3UKR B;  3HJF A;  2IVO A;  3MEE A;  4YDU C;  5BR8 K;  1HX1 A;  3O3G A;  1J9A A;  3CQY A;  4Y0W A;  4IFE A;  2Z1I A;  1YF5 L;  1ZYQ A;  4RW9 A;  1QHT A;  3H46 O;  3MXM A;  4OVL A;  4DF8 A;  1ZXO A;  3KZB A;  4DFJ A;  4EZ6 A;  1J54 A;  3N4P A;  3HRG A;  4X64 K;  3P4I A;  3DLB A;  1SV5 A;  3CPE A;  2A1R A;  3SPZ A;  3LAN A;  4LH4 A;  4JK8 A;  2RF2 A;  1RBS A;  4H5T A;  3TU5 A;  3C6U A;  1ESV A;  4BGB A;  3DOK A;  1ZBL A;  3CYM A;  4DU1 A;  4CJW A;  1HR0 K;  3B8A X;  1OKJ A;  3R3L A;  2V51 B;  4H0T B;  3ID8 A;  4CHP A;  5BR9 A;  3D2F B;  3G0Z A;  3OTO K;  1NGE A;  2YJF A;  3OJU A;  5C25 A;  1EXQ A;  5M1N A;  3BP8 A;  1BA1 A;  3JSM A;  2HMP A;  3FE1 A;  3P5J A;  1ASW A;  1TUY A;  2A40 A;  2UXD K;  4M7X A;  2P9P A;  1EWQ A;  2ITG A;  3H6E A;  2YHY A;  1FJG K;  5KRS A;  1IBM K;  3VQQ A;  4FZY A;  2NRT A;  4ICL A;  3KTQ A;  1X3M A;  2QK9 A;  2O8F A;  1BO5 O;  2XRI A;  4YOV A;  1QE1 A;  4BRO A;  1BDG A;  3EKU A;  2QWR A;  4JI2 K;  2O8E B;  3IMX A;  3MN5 A;  4M3T A;  3MN9 A;  4RW4 A;  1Q9Y A;  3K5O A;  1QSL A;  3VEY A;  1EWR A;  3HXM A;  1TK5 A;  4CEE A;  1NWK A;  2FBT A;  3NGZ A;  3TAP A;  3PX4 A;  4N76 A;  2E2O A;  3WXI A;  4FWN A;  2D0O A;  2OZS A;  4DTR A;  3LDP A;  3CJA A;  4JD2 A;  1N8R O;  4JNE A;  4QS9 A;  3K2P A;  3AVL A;  5KQ8 A;  3SMS A;  4WF9 L;  3K5N A;  2OPR A;  1NJY A;  2UUC K;  2PBD A;  1QTM A;  1KVC A;  5AQZ A;  4BRP A;  4F8R A;  1Q9X A;  3OYH A;  4JRP A;  2ZJQ L;  4A57 A;  1XUP O;  1LCU A;  4CED A;  3VQP A;  1TKZ A;  2D4W A;  3DAW A;  3CCE N;  5AQU A;  3DXM A;  2Q0U A;  2JWL A;  3JYT A;  4HHT A;  2GWK A;  3C7N A;  2GUP A;  3U6F A;  1SKR A;  2GWJ A;  2Y1I A;  2QWL A;  1U45 A;  3D7E O;  4KTQ A;  1CXU A;  5J2M A;  1IKY A;  1D9D A;  5DK5 A;  1U04 A;  3PV8 A;  3ENB A;  4BR5 A;  4CZE A;  3MX5 A;  5KI6 A;  1Y97 A;  1KAZ A;  4BRL A;  2E2N A;  4N5S A;  4DR1 K;  1N34 K;  4N41 A;  4K42 A;  4PL8 A;  3CME N;  1IKW A;  4JI3 K;  1GLE G;  3HT3 A;  4FSV A;  3O9S A;  3TTD A;  3OW2 M;  1U49 A;  3NE6 A;  4FJX A;  1C1A A;  1NBW A;  2OCE A;  3V1R A;  2O8D A;  2HVI A;  2X6N A;  4JKG B;  4LD0 A;  3S3M A;  4BQL A;  2BGG A;  2IGI A;  4DTX A;  1Q8I A;  2QTD A;  3RMC A;  2D1K A;  3BZC A;  1HRH A;  1ASV A;  4MFB A;  4FJK A;  1A5V A;  3NF7 A;  3AGK A;  4E89 A;  2DY4 A;  4BRG A;  3AVC A;  4JI6 K;  1VSM A;  4ILG B;  5I42 A;  2ZQB A;  3LDL A;  3OA9 A;  2YI1 A;  1TL1 A;  3ULE B;  3K9J A;  3VES A;  2W42 A;  2Q2R A;  3RRH A;  3RSE A;  4H0V B;  4JI1 K;  5AQJ A;  5M1Q A;  1OH8 A;  1BCM A;  3CFP A;  2OPQ A;  5JLF A;  4WFA L;  1RTH A;  3CMA N;  1CXQ A;  4B8A B;  3QEI A;  3V9U A;  1QSS A;  1A5X A;  3SUP A;  4Z4E A;  1TYQ A;  2J4R A;  3ULD A;  4IO8 A;  4NB4 A;  2CH6 A;  2E8A A;  3KLG A;  1HQU A;  3SCX A;  4CES A;  3VGL A;  3NF8 A;  5I9E B;  3CJ9 A;  1MDU B;  1NGI A;  4O8K A;  4DR3 K;  3EE9 A;  3VQC A;  1RDB A;  3O4W A;  1JLC A;  3SBT A;  1EO1 A;  4DR2 K;  1JLB A;  1KC8 O;  4AM6 A;  1TKX A;  4QOZ B;  1I3A A;  4XH5 A;  2OA8 A;  2CGJ A;  4ID5 A;  4N56 A;  1YT3 A;  4KHW A;  3ATU A;  2IDO A;  4JKF A;  2P9L B;  2CGL A;  4KB1 A;  3HM9 A;  2F8T A;  3LM9 A;  4CHO A;  4GV6 A;  2EX3 A;  1NM1 A;  2CH5 A;  3SAH A;  2PAV A;  4Z4G A;  2QEX N;  1QSY A;  3BZK A;  4OPA A;  3OBW A;  5CYM A;  4DSL A;  3VGK A;  4ELU A;  1KLN A;  5MLC Q;  3HP9 A;  1TKD A;  4CGI A;  1LW0 A;  3PUF A;  5CHI A;  1NOY A;  4C1N K;  5ELZ A;  3IKM A;  2PYJ A;  2WBN A;  4EIA A;  2HBK A;  2H3G X;  4X62 K;  4UY8 O;  1VQM N;  3QET A;  1WSJ A;  4CEF A;  4I9L A;  4YDU A;  1JLQ A;  3P39 A;  3CXC M;  1M1K O;  3HSC A;  3QIC A;  4FW2 A;  3WXJ A;  4CER A;  3LP0 A;  1JLG A;  4LC9 B;  3RMB A;  1Q81 O;  4E1N A;  4FWP A;  2B5J A;  3W3D A;  1GOC A;  3TR8 A;  2E88 A;  3HPO A;  4JK7 A;  2HHT A;  3I56 N;  4FLZ A;  1XI1 A;  1S22 A;  1L3U A;  1VQN N;  3KLE A;  3SQ4 A;  1E4F T;  3H3N O;  3QFU A;  5JVG L;  1NK4 A;  3PO5 A;  4C8K A;  1HNZ K;  1IKV A;  3QNN A;  4KH5 A;  4ISE A;  2ZM6 K;  5BPN A;  4L3Q A;  1ZBF A;  1NGA A;  2ZD1 A;  4CEB A;  3AO2 A;  1C0M A;  4FJ9 A;  3EL2 A;  1KFS A;  4HCB A;  4ZHR A;  4DR5 K;  5E41 A;  1EKE A;  4M7Y A;  2ETJ A;  3MEG A;  2OPS A;  1RT5 A;  1GLC G;  3OYI A;  3TSP A;  1D9F A;  4G9Z A;  1IKX A;  4DV6 K;  5AQR A;  4AHV A;  3G4S N;  2BUP A;  4NCB A;  2HNZ A;  1R59 O;  2G8V A;  4BRM A;  3SQ2 A;  4OLA A;  4CBW A;  4JD2 B;  1BIU A;  3E01 A;  1T6D A;  4OJR A;  4RG8 A;  3VET A;  3GE1 A;  5F1X A;  4A59 A;  1XHZ A;  3HPH A;  2UUA K;  5JIC A;  3SUQ A;  1CZA N;  1NGB A;  3ALY A;  3AV9 A;  3CCU N;  1QZ6 A;  4KKO A;  4LF4 K;  5JLH A;  5ADX H;  1ILY A;  3AO4 A;  3W0L A;  1IO2 A;  4K8Z A;  3WT0 A;  1WBD A;  3VA3 A;  3U3G A;  4KHU A;  4DTJ A;  1YJW N;  3V9S A;  2E5L K;  1XHX A;  5FPM A;  3G25 A;  2RHK A;  3HK2 A;  4FJ5 A;  4B3M K;  4YY3 K;  3L4Q A;  1Z26 A;  1BL3 A;  1RCH A;  2KQ2 A;  3UKR A;  3NBP A;  2YNF A;  3FZK A;  4BG9 A;  5HP1 A;  5M1F A;  3WNE A;  2V52 B;  4BE1 A;  4GMJ B;  1YAG A;  3ZT1 A;  3AAQ A;  4OKK A;  2X78 A;  2PYL A;  4QS8 A;  3CC7 N;  4CF1 A;  4H5N A;  2ZJR L;  3OJS A;  3OYA A;  3WQU A;  4CK3 A;  5HRR A;  4JI0 K;  4F2S A;  1HQE A;  1NK0 A;  3QBX A;  4FVU A;  4CW7 B;  4BRF A;  3O1B A;  4FJN A;  3TSQ A;  2E6L A;  4FJJ A;  1HNI A;  4K8X A;  4FLU A;  4WE1 A;  3LP3 A;  3CM5 A;  1BG3 A;  3R1X A;  3LAM A;  4IEE A;  4W5Q A;  3ZSX A;  4I6M B;  3KD5 E;  1T6C A;  4LSN A;  1IBL K;  1GOB A;  3RMD A;  4CJS A;  1W9H A;  4CEA A;  1G15 A;  2OAN A;  4AH9 A;  4CI6 A;  4IDK A;  3L3U A;  4KTW A;  3O80 A;  4JS4 A;  2HHU A;  4BRK A;  5AZI A;  3KWG A;  5HRN A;  4CZM A;  3OYM A;  2RKI A;  3T1Y K;  5AQH A;  4OPJ A;  5AFU H;  1QQC A;  1TK8 A;  2I7N A;  3U4L A;  4IJN A;  4CJ5 A;  1W0H A;  1LWE A;  2Q0R A;  2HBM A;  4BGA A;  4LF5 K;  2P9K B;  3TAE A;  1JXB A;  4W5O A;  3ZSO A;  1TAQ A;  4BWJ A;  3SQ0 A;  3C6A A;  4CZK A;  3ZET B;  4IOA L;  3FFK B;  5TKW A;  4DFK A;  4DF4 A;  4DQR A;  1K8K A;  5AQM A;  4AHC A;  2YHA A;  3GL1 A;  4GW6 A;  3CQX A;  4FLY A;  3T69 A;  2GBZ A;  2NRH A;  4CF9 A;  4DR7 K;  4DU4 A;  3A8Y A;  4IG0 A;  3CER A;  4CJK A;  4NO7 A;  4K41 A;  3VQD A;  4CHQ A;  3PO4 A;  4DS5 A;  4ELT A;  4U7B A;  2WOM A;  3S9H A;  4J2B A;  1H1V A;  3MCA B;  4FYD A;  1NKB A;  3D45 A;  4IOX A;  5KPZ A;  3L2V A;  3VF6 A;  4PHT X;  5AQN A;  4C1N I;  4CIE A;  4FLX A;  2O8B A;  1NK8 A;  1TAU A;  1KQS M;  3AVH A;  4KHY A;  4NXM K;  2PZS A;  4AHU A;  4O5F A;  4LF9 K;  2OZM A;  4CEQ A;  3CFR A;  3MN6 A;  3VGM A;  4IJA A;  1Z05 A;  4MDB A;  4OKJ A;  3AA3 A;  4WFN L;  3SMP A;  1NJX A;  3NGI A;  3C95 A;  5AQT A;  1SKS A;  5J2Q A;  3H45 C;  5HOO A;  3SAF A;  2PFU A;  1B9F A;  2KZZ A;  5FRM A;  4DSE A;  4M3R A;  3MXI A;  4B9T A;  4HCC A;  2F8S A;  5AQY A;  2VCP A;  4DCH A;  3NDK A;  3HO1 A;  4YHH K;  2HHV A;  3SAG A;  4KBO A;  2W40 A;  1HLU A;  3EKS A;  5IWA K;  1YJN N;  4EHT A;  3MCP A;  1P90 A;  3D2E A;  1OVY A;  3K9K A;  2HHH K;  1U6Z A;  2QA4 N;  2V7Z A;  4MO5 A;  1JLF A;  2IVN A;  3VOV A;  1Q86 O;  3TAB A;  1VSI A;  1NJZ A;  2FF3 B;  1ATN A;  3O9T A;  1HNW K;  5BRF A;  3S3N A;  3SQ1 A;  5I3U A;  4ILH A;  1YIJ N;  3K58 A;  5KRT A;  5AQS A;  2Q3S A;  2HW3 A;  1GLD G;  5GIP A;  3HTV A;  2ASP A;  3HOS A;  4BE0 A;  3VEN A;  4BRN A;  1JCG A;  2ZE2 A;  3M3Z A;  4PY5 A;  3VQ5 A;  2DFF A;  3RTV A;  1DT9 A;  4ISG A;  5GIN A;  1Q82 O;  1TUU A;  3QDK A;  1VQ7 N;  4CGG A;  3CJ1 A;  2P1J A;  5CZ2 A;  3IFR A;  1U2V B;  3IG1 A;  1MU2 A;  3ENH A;  2WTU A;  3M8P A;  5AQI A;  3PLA A;  3C7N B;  4DUZ K;  4KO0 A;  2O8B B;  2RPI A;  3VQ8 A;  1OH6 A;  3FLC O;  2VWK A;  3KK3 A;  4G1Q A;  3G6E N;  4H5V A;  2ATQ A;  3SBG A;  4RW7 A;  1JKH A;  4I7F A;  3WNF A;  4FOI A;  3V6D A;  3J7Z O;  4IXC A;  4CD1 A;  4NCG A;  3RSE B;  1S1X A;  3FZH A;  3AO1 A;  1JLE A;  3BDP A;  5AQG A;  3THV A;  3ZSY A;  3LPT A;  1BCO A;  4CF0 A;  1HKG A;  5E26 A;  1TK0 A;  4J8F A;  4BR2 A;  1VQ6 N;  3VMF B;  4FCY A;  4U67 L;  4IZ9 A;  5AQO A;  4BR4 A;  3D2F A;  3B6O A;  3AVB A;  3HL8 A;  4Z4F A;  1RDU A;  1T3V A;  1KAY A;  2DTU A;  5ADX A;  2KW4 A;  3QML A;  1TL3 A;  3ZEU A;  2P9S B;  5C2D A;  3OS2 A;  4H03 B;  3T1H K;  2O8D B;  3OHR A;  5C24 A;  3C6H A;  4CFC A;  1J5E K;  5A2Q O;  4DSI A;  3CCV N;  3VN5 A;  3LDQ A;  3TAN A;  1XMQ K;  1S3X A;  3SPY A;  3OYJ A;  4Z4C A;  1BIS A;  1DGK N;  4BAC A;  5AQK A;  5M1O A;  1RDA A;  2KLA A;  3LDS A;  3CC2 N;  3AVA A;  3HVT A;  4JI8 K;  4JKE A;  2QWQ A;  1BI4 B;  4JV5 K;  3PX0 A;  1L5U A;  4JK9 A;  3D6R A;  3L0Q A;  4CZG A;  4M45 A;  1D8Y A;  1VSH A;  3KLI A;  3GDQ A;  4H5W A;  4BDY A;  1S1U A;  3H3O B;  3MED A;  3ZET A;  3CG7 A;  5FLX O;  2IVP A;  4WFB L;  5AQF A;  1UA0 A;  3J81 O;  1RTJ A;  5AZJ B;  4E1M A;  2P9U B;  2A5X A;  4H4O A;  2GEM A;  4DFP A;  2BH1 A;  4CD3 A;  2P9L A;  3NH0 A;  3IAY A;  4F3O A;  3UKU B;  1NK9 A;  3DRS A;  4JYA K;  1U4B A;  3K57 A;  1FKP A;  4BY9 C;  1QVF M;  3H08 A;  2G8H A;  1VHX A;  1HYZ A;  2Q36 A;  4CF8 A;  2BTF A;  1IJJ A;  1ITG A;  4PKI A;  1IG8 A;  1QQN A;  1RFQ A;  3VQA A;  3ZSV A;  1SKW A;  3AVI A;  4HUG A;  4DQI A;  4FK0 A;  4DV3 K;  1U2V A;  4O55 A;  1BGX T;  1FKO A;  3THY A;  4NYF A;  4GVE A;  4RWT A;  4ZTJ A;  2P9N A;  3HPG A;  5AQP A;  4BVP A;  2E4L A;  4B9Q A;  3THX B;  4FZZ A;  4CJ4 A;  2Z1G A;  5T7B A;  1RT4 A;  4DTM A;  4FPA A;  3VEZ A;  1YI2 N;  1NK5 A;  2KTQ A;  4WQ5 C;  3WNH A;  1TVR A;  4XH4 A;  4FWQ A;  1WSF A;  4M42 A;  2KHO A;  1XC3 A;  1C0F A;  2E1Z A;  3OS1 A;  2QI2 A;  1RT1 A;  4LF8 K;  5AZJ A;  3V4I A;  4BR7 A;  5GIO A;  1L3S A;  4M3Z A;  4MLH A;  4BR0 A;  1NGC A;  3ZX3 A;  3FFI A;  4KTZ A;  4MQ3 A;  3O3F A;  3MX2 A;  3EE8 A;  4I2P A;  1VRT A;  4KH4 A;  3VEX A;  1WAJ A;  4EP5 A;  1QZ5 A;  5TKY A;  2IAJ A;  3JS6 A;  2QWM A;  1RDD A;  4A61 A;  2GUI A;  4B9M A;  2ZJP L;  4DTO A;  3UE5 A;  1YUW A;  4M3Y A;  3RR8 A;  3M8S A;  4NLB A;  1DEJ A;  2YHB A;  4BR9 A;  4CJF A;  3NFA A;  4RCH A;  3QB0 A;  4WCE L;  1REV A;  3OYF A;  3A5L C;  3SV4 A;  3WXK A;  5D3G A;  3WNG A;  3KKR A;  4PUO A;  3KVG A;  4DMN A;  3O4Q A;  5HRO A;  1BQN A;  1RT6 A;  1N33 K;  3THX A;  4CGH A;  4IDH A;  3F73 A;  2P5O A;  3QEV A;  5BPM A;  4KRE A;  1XNR K;  1KD1 O;  3IUC A;  3E9P A;  3OYD A;  4JLH A;  3O08 A;  1WN7 A;  1CZB A;  1A5W A;  3D2E B;  1NK6 A;  4K25 A;  1NJW A;  2FC0 A;  1RBT A;  3OYB A;  1K6Y A;  2O8F B;  5EXW A;  3DJC A;  4E1J A;  4DSJ A;  3FZL A;  4DS4 A;  2GEL A;  3BGR A;  4W5T A;  4E3S A;  3LWL A;  3CCM N;  3NF9 A;  3QIO A;  1S1W A;  2KFN A;  2XY8 A;  4PKG A;  4LSL A;  1LWC A;  2A6A A;  1HYV A;  3WQT A;  4C8O A;  1YTU A;  1WSH A;  4IWV A;  1HMV A;  3BEX A;  3DXK B;  3SLC A;  2I7P A;  3NCI A;  1BA0 A;  1C1C A;  3HOT A;  4W5N A;  2YNI A;  4CFA A;  4I6M A;  1KVB A;  1YTA A;  4QCL A;  1NMN A;  4CJT A;  2QWP A;  2ZWH A;  4JI7 K;  4IG3 A;  5C15 A;  1V4S A;  5AR0 A;  1YXQ A;  4DB3 A;  4JS5 A;  1L3V A;  4DV4 K;  3AGR A;  5EOY A;  3QO9 A;  3LL3 A;  4FK2 A;  1I39 A;  2WON A;  2AJQ A;  4V19 S;  2D5R A;  3NHG A;  4A2B A;  5KGW A;  4B9U A;  3BY5 A;  1NGJ A;  3I0R A;  2FXU A;  4J2A A;  3KD1 E;  3TAF A;  3WEE A;  1GLJ O;  3ATV A;  4FWO A;  5F0X A;  4ZTF A;  3G71 N;  2UXC K;  4FPB A;  2NLX A;  1HNX K;  3AA5 X;  4B1X B;  4XIU A;  1WB9 A;  2DPN A;  1E3M A;  1BQM A;  3A2F A;  1S5J A;  3HP6 A;  4CK1 A;  4O4G A;  2I5J A;  3LZJ A;  4B1V A;  1QS4 A;  4AF1 A;  1NK7 A;  3P83 D;  4FL9 A;  1S1V A;  5AQV A;  5LJW A;  1NLV A;  1N36 K;  1UOC A;  2ITM A;  3DI6 A;  1T05 A;  3TAM A;  4QAG A;  3PIO L;  4CGJ A;  4CIF A;  3CJ7 A;  4CVN E;  1XNQ K;  2IS3 A;  5C42 A;  3WUH A;  5KQD A;  4B3T K;  2WC9 A;  1HJR A;  4DTN A;  2WFB A;  3AY9 A;  1BUP A;  1GLF O;  4Q5V A;  2G8W A;  4BRH A;  1C0U A;  1OH7 A;  1GOA A;  4M3X A;  1IG9 A;  3WXM B;  4C8M A;  3CCJ N;  3CCR N;  3V9X A;  5J2P A;  3NGY A;  2QKB A;  5FRO A;  1RT7 A;  4CEO A;  3CPW M;  5FDL A;  4CZI A;  1OVQ A;  3TTF A;  2P51 A;  2D0C A;  2Y1J A;  3R9P A;  3O9U A;  5CR4 A;  1HUX A;  5KGX A;  3A5O C;  4HVJ A;  3VEW A;  2HF3 A;  1NJI O;  1MA9 B;  3DWL A;  3LP1 A;  2ASM A;  2KFZ A;  1OH5 A;  3PIP L;  4H0O A;  3VF4 A;  3UKU A;  1J6Z A;  4K43 A;  5BN8 A;  4YOR A;  2QWN A;  4DR4 K;  3E9O A;  5BRD A;  5B8H A;  3O5B A;  1RNH A;  1LW2 A;  1P8Z A;  2Z1H A;  3DLE A;  3T3F A;  3I0S A;  1KLM A;  1O1W A;  1YHQ N;  1R0A A;  1DKG D;  3T7Z A;  4ID1 A;  4B9V A;  3LAL A;  2E1Y A;  2AP1 A;  2VG7 A;  3ZT0 A;  1EQY A;  3DOL A;  1TGO A;  2LSN A;  5GAH P;  3CFO A;  2A42 A;  1RBR A;  4E7L A;  2ASO A;  1HPZ A;  4HTU A;  2XY7 A;  1Q18 A;  4CJV A;  3PY8 A;  4CIG A;  1KFD A;  4Y1D A;  1N32 K;  2CGK A;  2VWJ A;  2UYT A;  3VQ9 A;  4DKW A;  4CEC A;  5SZT A;  3QEW A;  1EP4 A;  4I2Q A;  3OS0 A;  5AQL A;  4BWM A;  3L2U A;  4DV1 K;  4A2A A;  1EET A;  3MN7 A;  3QES A;  1J5O A;  2GX9 A;  2W41 A;  1W7A A;  1SL2 A;  3AO3 A;  4CJ7 A;  4YNQ A;  1VQ5 N;  1E4G T;  4WQ5 A;  1VSF A;  1XC9 A;  1Y64 A;  4KHN A;  2Q97 A;  3KKS A;  1FXX A;  3HZ6 A;  4H4M A;  1JLA A;  2FBX A;  4OPK A;  4GKK K;  3H1V X;  2X74 A;  4H8K A;  1K8K B;  3CJC A;  4LF7 K;  4FWL A;  4LFB K;  3TAQ A;  2YHX A;  2HND A;  4JAX A;  3UB5 A;  2R7Y A;  3WXL A;  4A5B A;  5CE3 A;  4JI5 K;  5H1S Q;  4FJ8 A;  3B6P A;  1X9W A;  1B92 A;  4RW6 A;  5DM7 L;  4Q0B A;  1BWF O;  1K73 O;  4KFB A;  4GY2 B;  4YOW A;  3DLL L;  4FLW A;  3L2W A;  1WSI A;  1VQ9 N;  3SJH A;  1TKT A;  3VTI A;  4AHR A;  3EYZ A;  5J2N A;  4FWM A;  4RTF D;  2FBV A;  2G8I A;  4LFA K;  4E7K A;  1RT3 A;  4X65 K;  4KRF A;  5EU7 A;  4NXN K;  3MWT A;  3Q7B A;  1CZ9 A;  1NU0 A;  1RBU A;  1J53 A;  1VSL A;  4KHQ A;  3C65 A;  3IRX A;  4WYB A;  2X6S A;  3ZEU B;  1ZBH A;  2NRX A;  4IOC L;  1NGD A;  1ATS A;  3S41 A;  4CZJ A;  2E2P A;  2QXL A;  4B1U B;  3HI0 A;  4XEI A;  4ELV A;  1X3N A;  3V9W A;  4DUY K;  4CJP A;  3AVF A;  4BE2 A;  4E19 A;  2GTD A;  5GAE P;  4AHT A;  4B1Z A;  5C10 A;  4BRC A;  4R79 A;  4CE9 A;  3IS9 A;  3O3H A;  3SV3 A;  2FSJ A;  1XMO K;  3NVK A;  3K59 A;  4KV8 A;  1Q7Y O;  4B3S K;  3TAG A;  2EHG A;  4C8N A;  3Q7C A;  3KK2 A;  4JKH A;  1S1T A;  3DRP A;  4CK2 A;  2F9W A;  3R8E A;  3HVR A;  2QKK A;  1GLL O;  1UWB A;  2XHB A;  4C8L A;  2E2Q A;  1BI4 A;  4CCH A;  3M1F A;  3ZYY X;  3FZF A;  3T1A A;  4CJR A;  3TWH A;  4O44 A;  2UXB K;  3C0B A;  3F9M A;  5HRP A;  3QFP A;  2Q1N A;  3CHW A;  4MO4 A;  3D0P A;  4BG8 A;  1X9S A;  1D4X A;  3OYG A;  4CBX A;  4Z4H A;  1XWL A;  1VSK A;  4BC3 A;  4HTL A;  4DTU A;  3HYF A;  4DR6 K;  4BDZ A;  3U8X A;  4H0P A;  2XY5 A;  1KXP A;  2F96 A;  2YCH A;  4FWR A;  4E7I A;  1YIT N;  3RVC A;  4XH1 A;  3J8A A; 
#chains in the Genus database with same CATH homology
 2P9N B;  1QQM A;  4JK7 A;  1U2V A;  3I56 N;  4A62 A;  3CJB A;  4JKG A;  3P31 A;  4GVE A;  1S22 A;  3MWP A;  4BVO A;  4RWT A;  1VQN N;  2P9N A;  5AQP A;  4BVP A;  1E4F T;  4DQ8 A;  4BRA A;  3H3N O;  1TYQ B;  3EO3 A;  5F2R A;  4B9Q A;  2HBJ A;  3QFU A;  3L4I A;  5JVG L;  3E66 A;  1JCE A;  2QW9 A;  5JVH L;  4FPA A;  3VEZ A;  4KH5 A;  2HOE A;  1YI2 N;  4JHD B;  4WQ5 C;  3O8M A;  4ISE A;  1BU6 O;  3VTH A;  4XH4 A;  1SZ2 A;  2KKZ A;  4FWQ A;  5BPN A;  3ENO A;  4L3Q A;  2KHO A;  3ZX2 A;  1XC3 A;  2OTJ N;  1NGA A;  1C0F A;  2E1Z A;  5HL7 L;  2QI2 A;  4H0Y B;  3EL2 A;  2P9U A;  5AZJ A;  4BR7 A;  5GIO A;  4MLH A;  4BR0 A;  1NGC A;  3ZX3 A;  1SQK A;  4M7Y A;  3MX2 A;  3EE8 A;  1K9M O;  4QS7 A;  2VGN A;  4CZF A;  4KH4 A;  3VEX A;  1VQK N;  3AAP A;  1QZ5 A;  5TKY A;  1GLC G;  3TSP A;  4G9Z A;  3JS6 A;  4IO9 L;  2QWM A;  1YJ9 N;  1YVN A;  1GLA G;  3GOI A;  5AQR A;  4A61 A;  2ZJP L;  5GAD P;  2YJE A;  3CCL N;  3UE5 A;  1YUW A;  3G4S N;  1WUA A;  2VGM A;  2P9K A;  4BC4 A;  2BUP A;  3LDN A;  1R59 O;  4NLB A;  1DEJ A;  2VWB A;  5M1P A;  4BR9 A;  3VEV A;  1T44 A;  4FO0 A;  4BRM A;  4A5A A;  4RCH A;  3GBT A;  3QB0 A;  2F9T A;  3CET A;  4JD2 B;  4CBW A;  4WCE L;  1T6D A;  1V4T A;  3KHY A;  4WQ4 A;  3GE1 A;  3VET A;  4A59 A;  5FPN A;  5F1X A;  3A5L C;  5KPT A;  3WXK A;  4BRQ A;  3EN9 A;  4H5R A;  5JIC A;  3KK7 A;  4JEP A;  4C23 A;  3KVG A;  5DM6 L;  2NRZ A;  5BPL A;  1CZA N;  1NGB A;  4IDH A;  1QZ6 A;  3CCU N;  1S72 N;  5JLH A;  5ADX H;  4DHY A;  5EVZ A;  4WQ4 C;  5BN9 A;  3W0L A;  5BPM A;  5FPE A;  1ILY A;  4EHU A;  4FOE A;  3N4Q A;  1KD1 O;  3IUC A;  1G99 A;  3E9P A;  3FZM A;  2P9S A;  3WT0 A;  3OBY A;  5M1K A;  3NMU A;  4BQZ A;  1C0G A;  2YHW A;  3M5R A;  1YJW N;  2E20 A;  3O08 A;  5FPM A;  3G25 A;  2RHK A;  2IIR A;  3H1Q A;  3L4Q A;  4CZH A;  3D2E B;  3UKR A;  4EFH A;  2F7T A;  3O1W A;  4K25 A;  3E1Y A;  3FZK A;  4FWS A;  4BG9 A;  5M1F A;  2V52 B;  1KAX A;  2OTL N;  1YAG A;  5EXW A;  3DJC A;  4E1J A;  4MLE A;  3FZL A;  3AAQ A;  5C2F A;  1NGF A;  2GEL A;  3CF5 L;  2V7Y A;  4QS8 A;  3R6M A;  1O13 A;  3VER A;  5BRH A;  3CCM N;  3CC7 N;  4YOX A;  1QVG M;  4PKG A;  1VAZ A;  4H5N A;  2A6A A;  2ZJR L;  3WQT A;  3GG4 A;  3BF1 A;  4IWV A;  1RDW X;  3WQU A;  2RE2 A;  3BEX A;  3DXK B;  2YX6 A;  1MWK A;  3SLC A;  2I7P A;  3EZW A;  1SS6 A;  1VQ4 N;  1BA0 A;  4ILJ A;  1MWM A;  3QBX A;  4FVU A;  4BRF A;  1LOT B;  3O1B A;  3UKR B;  5EY4 A;  1VQO N;  2IVO A;  4YOT A;  3TSQ A;  3HOT A;  2D0P A;  4YDU C;  3CCS N;  1HX1 A;  4I6M A;  3CQY A;  4Y0W A;  4IFE A;  1BG3 A;  1YF5 L;  3A5M C;  3R1X A;  2QWP A;  4IEE A;  3H46 O;  2ZWH A;  4I6M B;  4JN4 A;  1T6C A;  3WEE B;  1ZXO A;  5C15 A;  1V4S A;  5AR0 A;  1YXQ A;  4DB3 A;  3KZB A;  3N4P A;  2OAN A;  5AQW A;  3HRG A;  4CI6 A;  3I55 N;  1JCF A;  4AM7 A;  3AGR A;  3BF3 A;  5AFU A;  3P4I A;  5EOY A;  1W97 L;  3CPE A;  3LL3 A;  3O80 A;  4JK8 A;  4BRK A;  5AZI A;  4MDA A;  3KWG A;  4H5T A;  2P9I A;  2VYP A;  4A2B A;  3TU5 A;  4CZM A;  3J8A A;  5AQH A;  5AFU H;  1ESV A;  4BGB A;  1NGJ A;  2FXU A;  2I7N A;  3U4L A;  4IJN A;  4BRD A;  1HKC A;  2Q0R A;  1GLJ O;  2HBM A;  1QHA A;  2P9P B;  3ATV A;  3WEE A;  3B8A X;  3JXU A;  1OKJ A;  2P9K B;  4FWO A;  4BRI A;  5F0X A;  3R3L A;  3G71 N;  4JKD A;  2V51 B;  3C6A A;  4CZK A;  4FPB A;  2NLX A;  4H0T B;  3ID8 A;  3ZET B;  4B1X B;  4IOA L;  2DPN A;  4M63 C;  3FFK B;  5TKW A;  5BR9 A;  3BUZ B;  1K8K A;  3D2F B;  3GL1 A;  5AQM A;  1NGE A;  2YJF A;  1ATR A;  3A0I X;  3CQX A;  4B1V A;  5M1N A;  4AF1 A;  3BP8 A;  1BA1 A;  3T69 A;  2HMP A;  4FL9 A;  3FE1 A;  5LJW A;  4NLC A;  5AQV A;  1TUY A;  2A40 A;  2NRH A;  1HPM A;  4B1Y B;  4BC2 A;  1NLV A;  1Z6R A;  4M7X A;  3A8Y A;  2ITM A;  3CER A;  2P9P A;  3QBW A;  2HBL A;  3LDO A;  4NO7 A;  3H6E A;  4K41 A;  2YHY A;  5C12 A;  3PIO L;  3CJ7 A;  3MMV A;  4YOU A;  4U7B A;  2NRT A;  5KQD A;  3WUH A;  1X3M A;  2WC9 A;  4PL7 A;  1H1V A;  3MCA B;  3F5T A;  3TTC A;  2WFB A;  3AY9 A;  1BO5 O;  1BUP A;  1GLF O;  4IOX A;  5KPZ A;  4YOV A;  3VF6 A;  4BRO A;  1BDG A;  3IDH A;  4BRH A;  3EKU A;  2QWR A;  2Q31 A;  5AQN A;  4PHT X;  3AAR A;  4JKC A;  3CI5 A;  3U9D A;  4C1N I;  3IMX A;  3MN5 A;  3MN9 A;  1KQS M;  5KPR A;  2WUS A;  3WXM B;  1ZBS A;  3M6G A;  5AQX A;  3VEY A;  3CCJ N;  1WOQ A;  3CCR N;  4O5F A;  3CPW M;  1NWK A;  3O9R A;  1HKB A;  3MN6 A;  4CZI A;  3TTF A;  3VGM A;  4IJA A;  1Z05 A;  4MDB A;  4WFN L;  3SMP A;  1GLB G;  3R9P A;  2E2O A;  3O9U A;  3WXI A;  1NGG A;  3KWI A;  5CR4 A;  4CBU A;  1HUX A;  4FWN A;  3A5O C;  3VEW A;  4B1W B;  2HF3 A;  5AQT A;  4BRE A;  2D0O A;  1MA9 B;  3U9Z A;  3DWL A;  5LY3 A;  1NJI O;  2ASM A;  3H45 C;  3LDP A;  5E84 A;  3CJA A;  3SAF A;  5HOO A;  4JD2 A;  3PIP L;  2PFU A;  2ZGZ A;  1N8R O;  4JNE A;  4QS9 A;  5KQ8 A;  4OO1 J;  4H0O A;  3SMS A;  3VF4 A;  4WF9 L;  3UKU A;  1J6Z A;  5EX5 A;  3L6Q A;  4K43 A;  3ZX0 A;  5BN8 A;  5AQY A;  2PBD A;  4H0X B;  2VCP A;  4YOR A;  4DCH A;  2QWN A;  3E9O A;  5BRD A;  3SAG A;  5B8H A;  3O5B A;  5AQZ A;  4BRP A;  4KBO A;  2W40 A;  1HLU A;  3EKS A;  1P8Z A;  3MK6 A;  1YJN N;  2ZJQ L;  4A57 A;  4EHT A;  1XUP O;  3MCP A;  1P90 A;  1LCU A;  2NRV A;  3D2E A;  1OVY A;  2D4W A;  3DAW A;  3K9K A;  3CCE N;  3DXM B;  5AQU A;  1VQ8 N;  3TSU A;  1U6Z A;  2FLO A;  3DXM A;  2QA4 N;  2Q0U A;  3P38 A;  2JWL A;  2V7Z A;  1YHQ N;  4MO5 A;  2GWK A;  2IVN A;  1DKG D;  3C7N A;  3T7Z A;  2GUP A;  3VOV A;  1Q86 O;  2GWJ A;  2E1Y A;  2QWL A;  2AP1 A;  3LM2 A;  3D7E O;  3VPZ A;  1K8A O;  1EQY A;  3O6W A;  1X9J A;  2FF3 B;  1ATN A;  3O9T A;  5GAH P;  2JWK A;  3ENB A;  2A42 A;  5BRF A;  3VEO A;  4BR5 A;  4CZE A;  2A41 A;  3MX5 A;  4ILH A;  2ASO A;  2ZF5 O;  1KAZ A;  1YIJ N;  4BRL A;  2E2N A;  4YOY A;  1Q18 A;  4K42 A;  5AQS A;  4PL8 A;  2NZT A;  3CME N;  5BRE A;  2CGK A;  2UYT A;  1NMD A;  2P9I B;  4DKW A;  1GLE G;  1GLD G;  3I8B A;  3CIP A;  3HTV A;  5GIP A;  4FSV A;  3MDQ A;  2ASP A;  3O9S A;  3HOS A;  3VEN A;  5AQL A;  3VF2 A;  3TTD A;  4KH6 A;  4BRN A;  1JCG A;  3OW2 M;  3M3Z A;  4A2A A;  1NBW A;  1DT9 A;  3MN7 A;  4ISG A;  5GIN A;  1Q82 O;  1TUU A;  5FPD A;  3QDK A;  1VQ7 N;  2GX9 A;  3CJ1 A;  3F2K A;  2W41 A;  4JKG B;  3NVM A;  3IFR A;  1U2V B;  4BQL A;  4CJ7 A;  3CCQ N;  3ENH A;  5AQI A;  1VQ5 N;  3PLA A;  3C7N B;  4FWK A;  1E4G T;  2QTD A;  2HF4 A;  4WQ5 A;  1Y64 A;  2Q97 A;  2D1K A;  3HZ6 A;  4BGA A;  3FLC O;  3H1V X;  4Z94 A;  1K8K B;  3AGK A;  3CJC A;  3G6E N;  4H5V A;  4FWL A;  3SBG A;  2YHX A;  4BRG A;  4JAX A;  1QQO A;  4FOI A;  4ILG B;  3UB5 A;  3DXK A;  2NRR A;  3WXL A;  3LDL A;  3OA9 A;  3J7Z O;  4O8U A;  2YI1 A;  4IXC A;  4CD1 A;  3A5N C;  4A5B A;  5CE3 A;  3ULE B;  3K9J A;  3RSE B;  5H1S Q;  3VES A;  2Q2R A;  3RSE A;  4H0V B;  1M90 O;  1XQS C;  3FZH A;  5DM7 L;  5AQJ A;  1BWF O;  1K73 O;  5M1Q A;  4JHD A;  4BC5 A;  5AQG A;  4GY2 B;  4YOW A;  2A3Z A;  3FR0 A;  3DLL L;  2FF6 A;  5JLF A;  4WFA L;  1VQ9 N;  1HKG A;  5E26 A;  3SJH A;  3VTI A;  4J8F A;  4BR2 A;  3CMA N;  1VQ6 N;  4FWM A;  1NGH A;  3VMF B;  4RTF D;  4PKH A;  2FSK A;  3HM8 A;  4U67 L;  1TYQ A;  2QM1 A;  4IZ9 A;  5AQO A;  2J4R A;  2HST A;  4BR4 A;  4EAH D;  3MWT A;  3D2F A;  3Q7B A;  4IO8 A;  4NB4 A;  2CH6 A;  2E8A A;  1SAZ A;  3SK3 A;  3ID6 A;  3TPQ A;  1RDU A;  2FSN A;  3C65 A;  1T3V A;  3VGL A;  1RGI A;  4WYB A;  3CD6 N;  3ZEU B;  1KAY A;  5ADX A;  2NRX A;  3CJ9 A;  5I9E B;  1MDU B;  3QML A;  4IOC L;  3ZEU A;  1NGD A;  2P9S B;  1NGI A;  5C2D A;  1ATS A;  4O8K A;  3S41 A;  2E2P A;  2QXL A;  4CZJ A;  4B1U B;  3HI0 A;  4XEI A;  4H03 B;  3EE9 A;  1X3N A;  3HBT A;  3OHR A;  2ZGY A;  3C6H A;  3O4W A;  3SBT A;  2NRW A;  1EO1 A;  3CCV N;  3LDQ A;  1S3X A;  1KC8 O;  4AM6 A;  4HWI A;  5C0Y A;  4XH5 A;  1DGK N;  2CGJ A;  2GTD A;  5GAE P;  4B1Z A;  5C10 A;  5AQK A;  3ATU A;  5M1O A;  1HJO A;  4F9O A;  4BRC A;  3CC4 N;  4JKF A;  2P9L B;  4GV9 A;  2KLA A;  4R79 A;  2CGL A;  3CC2 N;  3LM9 A;  2FSJ A;  3ULE A;  3NVK A;  4GV6 A;  1NM1 A;  2CH5 A;  3FGU A;  3SAH A;  2PAV A;  2QEX N;  4OPA A;  1Q7Y O;  3OBW A;  2QWQ A;  4JKE A;  5LJV A;  3VGK A;  3Q7C A;  3E9L A;  4JKH A;  4JK9 A;  2QWO A;  3D6R A;  3I33 A;  3L0Q A;  4CZG A;  2F9W A;  3R8E A;  5MLC Q;  1GLL O;  2NNW A;  4CZL A;  3GDQ A;  2E2Q A;  4H5W A;  5AQQ A;  3H3O B;  3ZET A;  4OPH A;  3M1F A;  5CHI A;  2IVP A;  3ZYY X;  2EWS A;  3FZF A;  5AQF A;  4WFB L;  5ELZ A;  4C1N K;  1VQP N;  3IKM A;  5AZJ B;  2P9U B;  3O9Q A;  2A5X A;  2AA4 A;  2GEM A;  3C0B A;  2BH1 A;  3F9M A;  2WBN A;  3QFP A;  2Q1N A;  3CHW A;  4MO4 A;  4EIA A;  4CD3 A;  2HBK A;  1VQL N;  2H3G X;  4ISF A;  4BG8 A;  2P9L A;  5JMV A;  1D4X A;  3UKU B;  4UY8 O;  1VQM N;  4CBX A;  4BY9 C;  1QVF M;  4BC3 A;  5AZI B;  4HTL A;  4YDU A;  2Q36 A;  3P39 A;  2BTF A;  3CXC M;  1W2B M;  1M1K O;  4GNI A;  1IJJ A;  3HSC A;  4JKA A;  3QIC A;  3U8X A;  3WXJ A;  4PKI A;  4H0P A;  1IG8 A;  1JJ2 M;  4LC9 B;  1QQN A;  1RFQ A;  1Q81 O;  1KXP A;  2YCH A;  4FWR A;  4FWP A;  3W3D A;  1ZC6 A;  5GAG P;  4IEI A;  1YIT N;  4JKB A;  4GV3 A;  3RVC A;  4XH1 A;  2E88 A;  1BOT O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...