4FVUA

Structural basis for the dsrna specificity of the lassa virus np exonuclease
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
208
Chain Sequence
GFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIAGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNVLRAVLPRDMVFRTSTPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/rna
molecule keywords Nucleoprotein
publication title Structural Basis for the dsRNA Specificity of the Lassa Virus NP Exonuclease.
pubmed doi rcsb
source organism Lassa virus josiah
total genus 51
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17290 Arena_ncap_C Arenavirus nucleocapsid C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4fvuA01
3MX5A 4GV6A 4GV3A 4GVEA 3MWPA 4FVUA 3Q7BA 3R3LA 3MX2A 4GV9A 4G9ZA 3MWTA 3Q7CA
chains in the Genus database with same CATH superfamily
5EOYA 4JYAK 1ZBUA 5KPRA 4DV7K 4BRIA 1J6ZA 3OYMA 4BRPA 4DR3K 4KHWA 4JV5K 3UB5A 4A59A 4JKFA 3PX0A 1L3TA 2BANA 3AA3A 2E6LA 5C15A 4GKKK 2D0BA 2E88A 4JI6K 3M6GA 4CZIA 1UAXA 4ILJA 2D4WA 3THYA 3E01A 2OTJN 3PO4A 1EWQA 2YHWA 1DKGD 4BQZA 1BCMA 2UXBK 4O5BA 3VPZA 2O8BA 4Q0BA 1E4GT 2IVPA 1U04A 3TTFA 3C7NA 4DUZK 3KZBA 1BI4B 2HW3A 1K8KA 1J9AA 4QS8A 1IJJA 3QESA 3F73A 4DV5K 3V81A 2FBYA 1A5VA 1EX4A 4XH5A 2QA4N 1V4SA 4KH5A 3P5JA 5ADXH 2V51B 1VQON 2O4GA 1P90A 5EVZA 3TAMA 1RDBA 4CI6A 4LSNA 4BC4A 3T19A 4M7XA 2BGGA 3OYAA 3WNHA 3DMJA 4FOIA 5LJWA 3QBXA 5C25A 4BR9A 5IWAK 3ALYA 5M1NA 3JSMA 2PZSA 3C65A 2WUSA 2UYTA 3AARA 4YNQA 3CIPA 2ZD1A 4DFMA 5CZ2A 1KD1O 2H3GX 3ZEUB 3MEGA 3O08A 5CY4A 2WONA 4RWTA 3AO4A 4NLCA 4IO9L 1NJWA 5AQFA 1JL1A 1U48A 4QOZB 3M8QA 3NVKA 3SUPA 1O1WA 1KAXA 3IKMA 1KLNA 3PUFA 2ITMA 1GLEG 3AGKA 4CK2A 5M1KA 4CE9A 4MLHA 5M1FA 3IMXA 2ZQBA 2A6AA 4B9NA 1E4FT 1X3NA 1T6CA 4A5AA 1WSJA 2XY8A 2QEXN 4NXMK 1K73O 2KLAA 3B6OA 1VSJA 5C42A 1IBLK 2CGLA 5KGWA 4NYNA 3OYJA 1JXBA 1MWKA 1QQOA 1HQUA 4ELUA 4F4KA 4CJSA 2QM1A 1MA9B 3E9LA 4RG8A 1N6QA 4HUGA 3HO1A 1RT2A 4LFAK 3MN6A 1DGKN 3LM2A 4LF6K 2HHVA 3RWUA 3SYZA 1BISA 4FWRA 3ATVA 3SV4A 3O3FA 2A1SA 3MWPA 2NRZA 4KHQA 4CEAA 4CFAA 3K5OA 1G99A 4PUOA 3G6EN 3O9SA 4W5RA 4DR6K 3ZT1A 4FWLA 1VSIA 2A42A 3KKRA 3QETA 3P38A 1WAJA 3SQ0A 2ZJRL 3TPQA 1VSKA 1SKWA 4XH1A 5AQXA 1GLBG 3PSIA 3U3YA 3ZCMA 1VAZA 1FKOA 3SPYA 2RN2A 3WQUA 3NGYA 1SZ2A 1XC3A 4J2AA 3OY9A 3S3MA 4LSLA 3DJCA 5BN9A 3G25A 4B1VA 1TVRA 1RDDA 3WEEA 4CBUA 5MLCQ 4BGBA 3O4WA 2D0AA 1NJZA 3SI6A 3S3NA 1L3SA 4UQGA 3NAEA 1IG9A 4OKJA 4CEEA 3ZSQA 3CXCM 2HSTA 5HRRA 1ATRA 1X9WA 3TSUA 3VEVA 4DTNA 5J2PA 4N41A 4AHRA 4FLUA 2GTDA 1MWMA 2P9IB 4R79A 1JXEA 2P9PB 5JVGL 5GINA 3D7EO 4Z4EA 5M1OA 4OPJA 3CCQN 3WT0A 2W41A 1NGAA 4OGEA 3DOKA 5BR9A 3VEOA 4I6MB 4FSVA 1YUWA 3OJUA 1RT3A 4A62A 4KPYA 4JK7A 1KSPA 4FW2A 3L2RA 1NG9A 2KZMA 3SJJA 1T8EA 4CHOA 4FXDA 3QNNA 2GV9A 2HMIA 4F9OA 3DRSA 3VQPA 1WN7A 1Q9YA 1TL3A 2FXUA 1EWRA 3LWLA 3ZETA 3FFIA 1HUXA 3QB0A 4JK8A 1OVYA 3K2PA 3L4IA 2Q3SA 2YJFA 5JVHL 4WQ5C 3SUOA 3EZWA 3KK7A 2P9PA 1U2VA 3KVGA 3CYMA 3Q7BA 5C2DA 3OYLA 1NMNA 2ZM6K 1DTQA 4H0YB 2VCPA 1SL1A 1C0GA 4GNIA 4DB3A 4M3TA 1JCGA 1C1BA 1VSFA 2QWPA 1TYQB 1YI2N 4OPHA 2HF4A 4PA1A 3H6EA 2P5OA 4I6MA 2A1RA 2ZWHA 1TL1A 2E5LK 3O80A 3VGKA 4FJMA 4IDKA 2I5JA 4M3UA 4BRQA 4QAGA 4NCGA 3SAFA 3HYFA 3B8AX 2NNWA 4ID5A 5KRTA 1RBRA 1WBBA 4BRCA 2HHWA 4WE1A 4CW7B 3AVNA 3GG4A 4WFNL 1HQEA 3KKSA 4CEFA 3CJ7A 3P83D 4BR7A 3DRRA 3U9DA 5BRDA 1BCOA 4CZJA 5JICA 3SCXA 4PQUA 3CCJN 1NJIO 2JGUA 3VQ5A 5KI6A 3VQ4A 2RPIA 3N4QA 3HVRA 3PV8A 2E1YA 3NBPA 1X9SA 3J81O 1S9EA 3LP2A 5HRNA 3O1BA 4C1NK 3M8RA 1QZ6A 5FPEA 4DQRA 1QZ5A 3HI0A 1TYQA 2WOMA 2O8CB 4DHYA 1VSLA 3WNFA 1S1TA 1LWCA 4ILHA 5DM6L 1ESVA 1XNQK 3VF6A 2QWQA 3SMSA 1TV6A 3PLAA 2CH5A 4IFVA 3R9PA 4DCHA 3M8SA 3CJ1A 4Z4CA 3T3FA 4YHHK 4KTQA 2P9UB 3VQBA 2ZF5O 3I8DA 4E89A 4KHNA 4ISGA 3LAMA 4Q5VA 4AILC 1IG8A 3U3GA 1ILYA 1ASWA 4AF1A 2VWJA 3QEWA 5AQYA 4OKEA 3HTVA 2OYQA 3U6FA 3F2KA 3CMEN 4CEBA 1GOBA 3WNEA 2UXCK 4CD1A 3DXKA 2QWMA 3W3DA 4BE0A 1IO2A 4IJAA 3LAKA 1K8AO 1TKXA 3HVTA 4EIAA 3B6PA 3ZT2A 5JMVA 2O8CA 4FWOA 4A57A 2KFZA 4LH5A 4IO8A 2R7YA 1NOYA 1NGCA 5CHIA 1NKCA 1L3VA 4JD2B 5F2RA 4B3TK 1BWFO 4ICLA 2FBTA 4JI8K 2JWKA 3PSFA 4H4OA 4IKFA 2G8HA 1GOAA 4F2RA 2HNYA 3SAGA 3MK6A 3TSPA 1XMQK 1XC9A 4B8AB 2QXFA 3K5NA 3TTCA 2NZTA 5AFUA 4JRPA 1OH8A 2QWOA 4HTLA 4M3YA 3FZLA 4CGIA 3QIOA 2AP1A 3HOSA 2IVOA 2QTDA 2YV0X 1HR0K 2P51A 3CI5A 4BVOA 1DEJA 4B08A 1LWEA 1F21A 4GMJB 3T7ZA 3HJFA 1NKEA 1KAZA 1M90O 4U67L 1LW2A 3AVKA 3CETA 4JK9A 1Z25A 4DKWA 3C6UA 3KWIA 4K0KK 3V6DA 1QHAA 5DK5A 3CQXA 1C0MA 3O1WA 2HHQA 3K58A 2QWLA 1C1CA 3L2WA 1VQ8N 4JD2A 5FRNA 1RILA 3NCIA 5FRMA 3Q7CA 1GLJO 1VQ7N 3LDPA 3P31A 2P1JA 5AZIB 4FZYA 1UA1A 3DYAA 4BDZA 3AVGA 4B9LA 3EO3A 3MX5A 4EFHA 3ZX0A 4LD0A 2CGJA 3VA0A 4IEEA 4OX9K 1BL3A 4FJJA 4CJRA 3RR8A 1LOTB 4YOXA 1YIJN 3G0ZA 2F4VK 4HHTA 3SJHA 2NRVA 4H0OA 5KQ8A 3H46O 2I7NA 3SUNA 5KQDA 5BRHA 5HRSA 4H0TB 1K9MO 2QW9A 2LSNA 2ASMA 3ZSOA 1YJWN 4CJTA 4N56A 4DV0K 2UUCK 3RR7A 3M1FA 1EETA 3MMVA 3CHWA 1P8ZA 3CFPA 4E1MA 2V7ZA 5AQIA 1RT7A 4WQ4A 3L4QA 3VEYA 3HSCA 3THWA 3LDOA 4CZLA 3DLGA 1HKCA 3MEDA 3E9PA 2D1KA 5AZIA 5KRSA 3DRPA 1CZAN 4Z4HA 4CECA 3JXUA 4H0PA 4DTOA 4DSFA 3R3LA 1GLCG 3EYZA 3ZYYX 3DAWA 3NGZA 4BROA 2G8UA 4BREA 3GOIA 3NMUA 4KB0A 3O9RA 1KFDA 1SV5A 4DV6K 1RFQA 1NGFA 3TAQA 4E1NA 4I2PA 2E1ZA 1NK8A 1S1XA 4M63C 2YHYA 4I7FA 2Y1JA 4OLBA 3C6AA 4DSJA 4E7IA 4E7HA 4DQSA 3LL3A 3BY5A 3SMPA 4KB1A 1JLEA 1GLAG 4B1ZA 2OTLN 2BDPA 3A5LC 4CGGA 3BGRA 1QSYA 4MDBA 4JI3K 4JEPA 4ZHRA 5EXWA 5CYQA 4BC2A 1S72N 3S41A 4J2EA 3MDQA 1NNEA 1VQ4N 1NK9A 3VQEA 2V52B 4GY2B 4IFYA 4EHTA 1CZBA 4IEIA 2HNZA 1OH5A 1QHTA 3O9TA 3CCEN 4EZ6A 4CVNE 2O8FB 4YDUA 3K9JA 1T05A 2FBXA 3P1GA 1RBVA 4OJRA 2OPSA 4DSIA 1VHXA 2XY5A 3ZLJA 2PYLA 2QKBA 4X66K 3E1YA 2G8KA 5TKYA 4CEDA 3TWHA 3QNOA 4EAHD 4A2BA 4O44A 3L8BA 3KK2A 1WBDA 4CJWA 4R5PA 3O3GA 3THVA 2NUBA 2Q31A 3L2VA 4ID1A 3IRXA 3SQ1A 3OBYA 1T03A 4CK3A 1C0TA 4YOTA 2YCHA 4K25A 4FK0A 4FJLA 1RBTA 1N33K 4J2BA 4DU3A 1D5AA 3VQQA 4V19S 1C6VA 3V9ZA 4MQ3A 4FM1A 3AAQA 2HBKA 3HT3A 2P9KB 3KLHA 1BI4A 3BZCA 4N5SA 2FC0A 1YJ9N 3HP6A 1RGIA 3IAYA 4RW7A 3NH2A 1HPMA 1VQ6N 3ID6A 2ZJPL 3CJAA 4X65K 1WSFA 2B4JA 4JAXA 3J7YP 3ZSVA 3OA9A 1JLCA 5M1PA 4DLGA 4JHDB 4FJNA 4L8RB 4CIGA 2FSKA 3OVNA 4KH6A 2Z1HA 3AGRA 2X74A 1GLFO 3LDLA 4E19A 4GVMA 3WXJA 4DTMA 4M42A 3BUZB 2OZMA 1VSMA 3OTOK 1S22A 3QICA 4C1NI 3LWMA 3OYEA 1YVNA 1HYSA 2W40A 2YX6A 5AQWA 3ZEUA 1BG3A 3MWTA 1RDAA 3FR0A 1VRUA 4I2QA 4B9SA 4J8FA 4AH9A 2P9KA 4FJXA 4H5WA 3MN9A 4MO5A 4YOVA 5LMUK 3CJCA 1ITGA 3AVAA 2D0CA 5HBMA 4C8LA 4H4MA 1TUYA 4BWMA 4LF8K 4O8KA 1T44A 5AJ3K 4HUFA 5KPTA 3L0QA 2A3ZA 4CGJA 4FJGA 3QLHA 2E2OA 2WC9A 4CHZA 4JHDA 2X78A 4B1UB 3LM9A 4ZTJA 1XHZA 1XI1A 1NGBA 3OBWA 2EHGA 2E2QA 4H0VB 2WFBA 2YHXA 3SZ2A 3RMDA 4F8RA 2E2PA 3I56N 4XH4A 5AQNA 4JNEA 2RHKA 3CFRA 3CM6A 4QS7A 1E3MA 2O8DB 1RT5A 5AQOA 1YT3A 2NRHA 4CJQA 3OYGA 1B92A 3VENA 4CJLA 2D5RA 2NRTA 4I9QA 4BG8A 1FKPA 3H08A 2KFNA 1REVA 4GV3A 2Z1IA 1HMVA 1T6DA 4DR5K 3CCRN 3F5TA 4JKEA 3NH0A 3SK3A 1GLDG 2F9TA 4KI4A 4DU1A 1N8RO 1BIZA 2VQFK 3VGMA 5AQRA 5HL7L 4JI4K 1Z05A 2NLXA 4Z4FA 3C94A 4AHVA 3NF9A 3TANA 1EXQA 2OPQA 3R8EA 1Q81O 3BEXA 4Y1DA 1RTHA 4K8ZA 2Z1JA 1W97L 1NKBA 1QQMA 4WQ4C 2YNGA 3VEXA 2A5XA 2BUPA 5CE3A 4K8XA 3L6QA 3AVLA 3V9XA 2IGIA 4LF7K 3AVBA 3PY8A 2EX3A 2OCEA 5T7BA 2HOEA 1VQKN 3H1VX 1JL2A 4Z94A 4CD3A 3OYCA 3TAPA 1EQYA 4A61A 3A5OC 1RT6A 1HNZK 3CF5L 1BHLA 2D0OA 3PX4A 1WB9A 1NJYA 3AVCA 3VQ6A 4DLEA 4LF5K 3CG7A 5HP1A 3L3VA 4DF8A 2IIRA 3LP0A 2XRIA 4C23A 3K59A 3T1HK 1U45A 3RSEB 3UIQA 3H3NO 4BRKA 3T1AA 4DV4K 2A41A 4KTWA 3U4LA 1VQLN 4ELTA 3LDNA 1S6PA 4A5BA 4JKCA 3ZT3A 3CC7N 2Q36A 2OA8A 4CJFA 2P9IA 2D0PA 4DTPA 4FJ7A 5GADP 4FVUA 3ZSRA 4J2DA 2WBNA 4AHSA 1NGHA 2GWKA 3SPZA 3P39A 2WTUA 1RTDA 1BU6O 1RT1A 2YNFA 3O4NA 2Q0RA 1NMDA 3V1OA 4CHPA 3NH1A 3VEWA 4QCLA 1VRTA 3QBWA 4PKGA 4YDUC 5KGXA 1RNHA 3ID8A 3QEPA 3HK2A 3KD5E 3HPHA 1X3MA 4TSXA 1IBKK 4CHQA 5FLXO 1J5OA 3RVCA 4M3WA 1VQNN 1XNRK 4M3ZA 4ZTFA 3I33A 2G8VA 4IFEA 3M3ZA 3A5NC 1X9JA 3QEVA 3RSEA 5E41A 5FPNA 1I94K 3DXMB 2ETJA 1WSHA 5ADXA 1XMOK 1IBMK 1RDWX 4DQ8A 4MFBA 3CJ9A 5M1QA 1NGGA 1N5YA 2ASOA 4CF9A 1RBSA 4Z0UA 3RMCA 1Q9XA 4CHYA 3T1YK 3SUQA 2P9NB 4FLXA 2OPRA 1QVFM 3MXIA 2E6MA 2Q97A 4IOAL 1NU0A 4F3TA 3EKUA 1X1PA 4N76A 4YY3K 4JRQA 1HX1A 1T7PA 4LC9B 3QINA 1BA1A 4FLVA 2OZSA 3DLKA 4RCHA 5KTQA 3OYKA 3S9HA 2HB5A 3D0PA 1S6QA 4CCHA 4K41A 3CMAN 4JI1K 3EY1A 1ZC6A 1L5UA 3GE1A 2AA4A 3F9MA 4DV3K 4CERA 4PKHA 4BGAA 1J53A 3J8AA 4DV2K 1A5XA 3TTDA 5AQPA 3I55N 4CGHA 2PAVA 3DXMA 5I9EB 3D45A 4CBXA 3NGIA 3K5MA 5AQTA 1S9GA 1ZBHA 4DV1K 4AM7A 2ASPA 4DTUA 2E2NA 4B8CA 4E1JA 2W42A 2FSNA 4CJKA 3LDQA 2UUBK 5I42A 1J54A 1R0AA 1SAZA 4ISEA 1CXUA 2KHOA 2NRWA 2P9NA 3ZSWA 3R1XA 3EZ5A 3HOTA 4DUYK 3HPGA 4BG9A 4OPKA 3MEEA 4HTUA 1NGEA 2Q0UA 3HM8A 4DQIA 3NF8A 4DR1K 3K5LA 3PX6A 4CJPA 1B9DA 2P9SB 1EO1A 1WSEA 4FJ8A 1JLQA 5CR4A 4DSEA 5LJVA 3RMAA 4IG0A 4LF4K 3RMBA 1HNVA 2EWSA 1YJNN 1CXQA 4GKJK 5GAGP 2P9UA 4H5VA 5J2QA 5B8HA 2FBVA 1OVQA 1KRPA 3OYBA 3LPUA 4W5QA 1S5JA 1KFSA 3RRHA 5AQZA 4B1XB 3NF7A 3O4QA 1KQSM 3VQ7A 2FLOA 3ULEB 5C2FA 5DM7L 4FZZA 2HHHK 1ATNA 3M8PA 3VEZA 4DTSA 1YTUA 1VK0A 1NJXA 3QEXA 4H0XB 3NE6A 4X64K 3GDQA 3UE5A 2UXDK 2P9SA 1GLLO 4FWKA 5GIPA 3NHGA 3KLFA 4HUEA 4B3MK 3CPEA 4XIUA 4CESA 2O8EB 2PYJA 4DSKA 3V1QA 2OPPA 4E7LA 4CJ5A 5FPDA 5EY4A 3CC4N 1ZBFA 4OKKA 4FO0A 3I0SA 1W7AA 4QS9A 3WXKA 3AAPA 2GUIA 1KLMA 1G15A 5AQLA 2RE2A 3V9UA 4B9UA 4YORA 1O13A 4YOWA 5TKWA 3LANA 4KH4A 1W9HA 4KKOA 4O8UA 3THXB 1YHQN 1YAGA 3MX2A 4HCCA 1IKYA 3ULEA 3OHRA 2AJQA 1QVGM 4H5NA 4OVLA 3EN9A 1N36K 2BTFA 2KQ2A 3DI6A 4DMNA 3JS6A 3DLHA 1TK0A 4LFCK 4KI6A 3OS1A 4FM0A 1S1WA 4AQYK 3QERA 3AA4A 4H03B 1QTMA 3VTHA 4FWMA 1U4BA 3BF1A 4YFUA 5BPLA 4WFAL 1W0HA 3CCVN 3QIPA 4W5NA 3J80O 1TK5A 4MLEA 4C8KA 4FLZA 4FLTA 4KRFA 4B9MA 2QWRA 1VSEA 3ZX3A 2O8EA 3K9KA 4MO4A 2I7PA 3WXMB 2NRRA 4BC5A 3TU5A 2KZZA 4KHYA 2IAJA 5AQMA 1JLGA 3G4SN 1IKXA 1N32K 1LAVA 2Y1IA 5BR8K 3A8YA 3CCLN 2DY4A 1QQNA 4GV9A 2VYPA 3KIOA 1KAYA 3VGLA 1QSSA 1C0FA 1KC8O 4G9ZA 4Z4IA 4CJUA 2ZGZA 4BE2A 1JJ2M 3THYB 3AVFA 4CF0A 3EE8A 4BRGA 4JI7K 3BZKA 4GW6A 1S1VA 5H1SQ 2QWNA 2B6AA 2G8IA 2VWBA 3H45C 3THXA 4LF9K 3WXLA 2BH1A 4NLBA 4WCEL 2UU9K 5F1XA 4FK2A 1T3VA 4CFDA 5D3GA 1WOQA 5EX5A 4DWIA 1NK4A 4HVJA 1EKEA 4BR2A 4DTRA 4C8NA 1VQ9N 5E84A 1XHXA 1UOCA 4DQPA 1K8KB 1OH6A 4E3SA 4B9VA 4E0DA 3HSTB 2YKMA 5I3UA 4BR0A 1QE1A 3E66A 5EU7A 4IG3A 1NM1A 4PL7A 3KLGA 3ENOA 3AO1A 3WXIA 3VN5A 4FZXC 1RBUA 5GAEP 1Y97A 2W6KA 3TABA 1Y64A 4BRMA 2J4RA 3FLCO 3F9KA 3LP1A 3TARA 3L2QA 4CZGA 4DTXA 1HYZA 1C0UA 4CK1A 4M3RA 2G8WA 2HVHA 2JWLA 1EP4A 2VG7A 5HROA 2PY5A 4FL9A 3OYNA 4FPBA 4JN4A 2P5GA 1YF5L 4BACA 3PIPL 1BO5O 4L3QA 4WQ5A 3VQ9A 4CJEA 4CZHA 3DLLL 4DF4A 2HF3A 4F2SA 3CQ8A 1NWKA 4B9TA 4CFCA 1I39A 4CGFA 2HVIA 2OANA 3SBTA 3ZSYA 4H8KA 4M45A 3SAHA 3C0BA 1KVCA 2YNIA 5KPZA 4PL8A 1D9FA 4DFJA 2RKIA 3TAGA 3AO2A 4FWQA 2VGMA 4BR5A 1ASUA 4YOUA 4HWIA 3KWGA 1VQMN 4B1YB 3MECA 4Z4GA 4CIFA 1BIUA 2F9WA 4JKHA 3TAFA 4O0IA 2Q2RA 3IG1A 2QXLA 1I3AA 3DLRA 3AA2A 3VF4A 3KJVA 3O3HA 4FOEA 2P9LB 3MXJA 4CFBA 4BDPA 5C12A 4KHPK 4CF1A 3CERA 4GVEA 5C24A 3MN5A 5FPMA 2V7YA 3EEQA 5A2QO 3VESA 2O8FA 2YHAA 4DS5A 1BOTO 3H1QA 4FYDA 3OS2A 1NK6A 3TI0A 5LY3A 3FZHA 1K6YA 2VWKA 1HNWK 2HBMA 4B3SK 3D2FB 3ENHA 2PBDA 1NK0A 3D6RA 3CQYA 3A2FA 4BC3A 1XUPO 5BN8A 4C8OA 2PFUA 3AY9A 2GUPA 1HNIA 1Q7YO 3DLBA 4LH4A 5AQKA 3MCAB 3FGUA 2GWJA 2KKZA 1SL0A 3O5BA 1LW0A 4AM6A 4CZFA 1HNXK 4OPAA 4IZ9A 2GX9A 4BRLA 3OYDA 3V9WA 4CJ4A 1TGOA 4YOYA 2P9LA 3RRGA 2KW4A 3C95A 1BA0A 1FK9A 4KO0A 1TUUA 3HM9A 3CCMN 1OKJA 4RTFD 5CYMA 4M7YA 1HRHA 4M3XA 4NCAA 1TK8A 1NGDA 4FJIA 3DM2A 1VQ5N 3PIOL 5JS2A 4DU4A 2YHBA 3GBTA 2YJEA 3IS9A 1CZ9A 3UKRB 4ILGB 3WEEB 1D9DA 3D2FA 4O55A 4LY7A 4WFBL 3CD6N 4JS5A 1ASVA 3NF6A 4EHUA 3HP9A 5JLHA 4FVMA 1V4TA 3AVIA 2G8FA 4FJ5A 1YITN 3VETA 4NO7A 5JLFA 4NXNK 4IBNA 4FM2A 3ENBA 4JI5K 5GAHP 2JLEA 1DTTA 1SQKA 3OYIA 4DR2K 4AHCA 5AFUH 3EE9A 3VTIA 4CIEA 4KBOA 1UWBA 4HCBA 3MN7A 4FJHA 1LV5A 2QKKA 1NGIA 4C8MA 3QDKA 1SKSA 4F3OA 1SS6A 1XQSC 4FJ9A 2F7TA 1H1VA 2FF6A 5BPMA 4OLAA 3K0SA 1OH7A 3SBGA 3WUHA 4E7JA 1S1UA 3VOVA 3QFUA 3UKRA 3HL8A 3AVHA 3HBTA 3PO5A 1VSDA 4FPAA 4CZKA 5BPNA 1NGJA 3W0LA 3KD1E 5BRFA 3ZT0A 4JKGB 4CEOA 1U49A 1WSGA 3KK1A 2O8DA 4XEIA 3FZFA 3ZETB 3SNNA 1BDGA 1JLFA 2HMPA 2ZE2A 4FW1A 4BR4A 1FXXA 3DLEA 2F8TA 4WF9L 3ATUA 3EKSA 3OYHA 1HJOA 4X62K 3HZ6A 1HKGA 3VF2A 2YI1A 4KTZA 4B1WB 2IS3A 3SV3A 1L3UA 1WLJA 1U2VB 2X6SA 2UUAK 4PWDA 3NVMA 1Q86O 4NCBA 2RF2A 4BWJA 2ITGA 3MCPA 3L2UA 1NK7A 3ZX2A 4BRNA 5AQQA 1JCEA 3HXMA 4PKIA 4E7KA 1SUQA 3TAEA 3J7AP 4B3RK 2IC3A 2GBZA 4BRHA 3TSQA 2E4LA 5AZJB 1VQPN 1YVUA 3CM5A 1M1KO 1X9MA 3WQTA 3OS0A 1Z6RA 1SL2A 3AA5X 4K43A 1ZYQA 4NYFA 3QEIA 1N34K 3BF3A 5AQUA 4JLHA 1NBWA 3D2EB 3FE1A 4CBWA 1ZBLA 1WAFA 3JAMO 4OO1J 4FCYA 1DLOA 1KTQA 4JKGA 2B5JA 5CZ1A 4IOXA 1IV0A 1KCFA 4Y1CA 1TAUA 1W2BM 3HPOA 3KLEA 1JKHA 5J1EA 5J2MA 1KVBA 3CPWM 3A5MC 4NB4A 4DFPA 2XY6A 1HJRA 2DTUA 1RTIA 4BE1A 3V4IA 4CEQA 1YXQA 2BE2A 2GELA 3C6HA 5AR0A 1BQNA 4FWSA 1DT9A 4KHSA 5E26A 3ZSXA 3ASMA 5AZJA 4RW8A 4DFKA 4RW9A 3ISNC 1KVAA 4RW6A 3I0RA 4Y0WA 4O0JA 4W5OA 3D2EA 1HLUA 3G10A 1A5WA 1JLBA 3V1RA 3NFAA 4OGCA 4B3OA 4KFBA 1IKWA 3M5RA 3O8MA 3VQ8A 2Q1NA 3AV9A 2E20A 2XO7A 1ZXOA 3N4PA 2O4IA 3WNGA 4IJNA 3AO3A 4RW4A 4MDAA 4W5TA 3K57A 4KV8A 1TKZA 1U6ZA 4EP4A 4BDYA 4AHTA 1LAWA 4IWVA 4ISFA 4G1QA 4KAZA 2F8SA 4DR7K 4FWPA 4AHUA 2NRXA 3V9SA 3DXKB 2QI2A 4N47A 4FLWA 3ITHA 2KTQA 5J2NA 3J7ZO 1NK5A 5K14A 4DTJA 4ELVA 1RDUA 3VMFB 1Q8IA 5C10A 5AQJA 4KHUA 5HOOA 3NDKA 4BQLA 4CZEA 5FROA 3T69A 1RDCA 1J5EK 2VGNA 3LALA 2YKNA 1CLQA 3L3UA 2HBLA 3G71N 3MAQA 4EP5A 2ATQA 1TKTA 1WUAA 5GIOA 5SZTA 4JKAA 3UKUB 1Q18A 3CCUN 1RTJA 3BP8A 3O6WA 5IT9O 2VG6A 1WNSA 3VQDA 3QFPA 1QQCA 3SLCA 5F0XA 4FK4A 3KK3A 4JI2K 3VQCA 3LP3A 4IOCL 2ZGYA 4WYBA 2XHBA 3AO5A 1HKBA 3EL2A 4I9LA 1IH7A 1RCHA 3U9ZA 4DG1A 4JS4A 5AQHA 3VA3A 2VG5A 2IVNA 4IDHA 4DQQA 1WSIA 3KTQA 3ULDA 3JYTA 3LZIA 3IFRA 3LZJA 1Z26A 3OJSA 1QS4A 1NLVA 3FFKB 1BQMA 4CF8A 2HHTA 3O9QA 4H5RA 4M41A 3MXMA 3CC2N 5LL6Z 5FDLA 4O4GA 4CGDA 2QK9A 3R6MA 4JKBA 2HNDA 2YNHA 3S3OA 2DFFA 1FW6A 4U7BA 3I8BA 1XWLA 4O5FA 4H5TA 1ZBSA 4IXCA 4CJ3A 3UKUA 4PY5A 5AQGA 3DOLA 2CH6A 3SQ2A 4DR4K 4JKDA 2HHSA 4LFBK 1B9FA 3CJBA 3E9OA 5SWMA 3C6TA 2IOCA 4BVPA 3HRGA 2F96A 2XY7A 1ZBIA 3U8XA 4CJ7A 3SQ4A 5BREA 1U47A 2HHUA 1GOCA 5HRPA 1LCUA 5C0YA 3FZKA 1R59O 4BRDA 3FZMA 5LMNK 1TKDA 3QMLA 3LPTA 3CFOA 1D4XA 1BGXT 2GEMA 4EZ9A 4GV6A 3DWLA 1HPZA 1ATSA 1RT4A 3AVMA 4CHNA 4CEZA 4FLYA 2X6NA 5ELZA 4BY9C 3THWB 5AQSA 3BDPA 5HLFA 2HBJA 1S3XA 3IDHA 3ZSZA 1TAQA 4A2AA 3LDSA 1FJGK 1SKRA 3AVJA 4BRFA 2DPNA 2FF3B 1QSLA 1UA0A 1MDUB 3A0IX 1D8YA 4K42A 2CGKA 3TR8A 1HYVA 5JS1A 2VQEK 2ZJQL 1Q82O 3H3OB 3GL1A 3KLIA 3CCSN 1JCFA 2E8AA 2IDOA 2HHXA 4FWNA 2DFHA 4UY8O 4CJVA 4PHTX 1C1AA 1IKVA 4JI0K 3ZT4A 4BRAA 3RTVA 3QO9A 3O9UA 4FJKA 1JLAA 4CF2A 2A40A 1MU2A 1VSHA 2W6LA 4B9QA 3OYFA 4DSLA 3P4IA 2DFEA 3IUCA 2O8BB 1KXPA 3OW2M 4KREA 4DS4A 3VQAA 2Z1GA 3KHYA 1YTAA 1LWFA 5DMRA 1BUPA 3C7NB 3VERA 4CZMA 1NOZA 2FSJA 5AQVA
chains in the Genus database with same CATH topology
2P9IA 5EOYA 2D0PA 5KPRA 1BA0A 5GADP 4FVUA 4BRIA 1J6ZA 1NGCA 5CHIA 2WBNA 4BRPA 1TUUA 4JD2B 5F2RA 1NGHA 1BWFO 2GWKA 3CCMN 1OKJA 4RTFD 2JWKA 3UB5A 4A59A 3P39A 4JKFA 1BU6O 4M7YA 1NGDA 3SAGA 2Q0RA 3MK6A 1VQ5N 1NMDA 3PIOL 5C15A 3TSPA 3VEWA 3GBTA 3QBWA 2YJEA 4PKGA 4YDUC 2E88A 3ID8A 3M6GA 4CZIA 4ILJA 3UKRB 2D4WA 4ILGB 2NZTA 3TTCA 5AFUA 1X3MA 3WEEB 3D2FA 2OTJN 2QWOA 4HTLA 1VQNN 3RVCA 3FZLA 3I33A 4WFBL 3CD6N 2AP1A 2YHWA 1DKGD 4EHUA 4IFEA 3HOSA 3M3ZA 2IVOA 3A5NC 2QTDA 1V4TA 1X9JA 4BQZA 5JLHA 3CI5A 3RSEA 4BVOA 5FPNA 1DEJA 1YITN 3DXMB 3VETA 3VPZA 4NO7A 5ADXA 5JLFA 1E4GT 3ENBA 2IVPA 3T7ZA 1RDWX 1KAZA 4DQ8A 1M90O 3CJ9A 5M1QA 4U67L 1NGGA 5GAHP 3CETA 4JK9A 3TTFA 4DKWA 2ASOA 1SQKA 3C7NA 3KZBA 3KWIA 5AFUH 1QHAA 3EE9A 3VTIA 1K8KA 3CQXA 4KBOA 4QS8A 1IJJA 3O1WA 2P9NB 2QWLA 3MN7A 1QVFM 2Q97A 4IOAL 1VQ8N 4XH5A 2QA4N 4JD2A 1NGIA 3EKUA 1V4SA 4KH5A 3QDKA 5ADXH 2V51B 1VQON 1SS6A 1P90A 3Q7CA 1XQSC 5EVZA 1GLJO 1HX1A 2F7TA 1VQ7N 1H1VA 3LDPA 3P31A 1BA1A 2FF6A 4LC9B 4CI6A 5BPMA 4BC4A 5AZIB 4M7XA 3SBGA 3WUHA 3EO3A 3MX5A 4RCHA 4EFHA 3ZX0A 4FOIA 3VOVA 2CGJA 3QFUA 3UKRA 5LJWA 3QBXA 4BR9A 4K41A 4IEEA 3CMAN 5M1NA 3HBTA 1ZC6A 4FPAA 3GE1A 3C65A 4CZKA 2AA4A 1NGJA 2WUSA 3F9MA 3W0LA 5BPNA 4PKHA 1LOTB 2UYTA 4BGAA 5BRFA 4YOXA 1YIJN 3J8AA 4JKGB 3AARA 3CIPA 3TTDA 5AQPA 3I55N 4XEIA 3FZFA 3ZETB 2PAVA 1BDGA 2HMPA 3DXMA 5I9EB 3SJHA 2NRVA 4BR4A 4H0OA 1KD1O 2H3GX 3ZEUB 4CBXA 5KQ8A 3H46O 2I7NA 5AQTA 3ATUA 3EKSA 5BRHA 5KQDA 4H0TB 3O08A 4WF9L 1K9MO 1HJOA 2QW9A 3HZ6A 1HKGA 3VF2A 4RWTA 2ASMA 4AM7A 2ASPA 1YJWN 2YI1A 4B1WB 2E2NA 4E1JA 4NLCA 4IO9L 2FSNA 5AQFA 3LDQA 3NVKA 3M1FA 3MMVA 3CHWA 1U2VB 1SAZA 4ISEA 1KAXA 1P8ZA 3IKMA 3NVMA 1Q86O 2ITMA 2KHOA 2V7ZA 2NRWA 2P9NA 5AQIA 1GLEG 3R1XA 3MCPA 4WQ4A 3AGKA 3HOTA 3L4QA 3VEYA 5M1KA 4MLHA 3ZX2A 5M1FA 3IMXA 4BRNA 3HSCA 3LDOA 5AQQA 1JCEA 4BG9A 4PKIA 4CZLA 2A6AA 1HKCA 1E4FT 1NGEA 3E9PA 2D1KA 5AZJB 2Q0UA 1X3NA 3HM8A 3TSQA 4BRHA 1VQPN 1T6CA 5AZIA 1M1KO 3WQTA 4A5AA 1Z6RA 1CZAN 4K43A 2P9SB 1EO1A 3BF3A 5AQUA 3JXUA 4H0PA 2QEXN 3R3LA 1GLCG 1NBWA 3ZYYX 3D2EB 3DAWA 3FE1A 4CBWA 2KLAA 4BROA 1K73O 5CR4A 4BREA 3GOIA 3NMUA 4OO1J 2CGLA 3O9RA 5LJVA 1QQOA 1MWKA 1RFQA 1NGFA 4JKGA 2EWSA 2QM1A 1YJNN 4IOXA 1MA9B 3E9LA 1W2BM 2E1ZA 5GAGP 2P9UA 4H5VA 5B8HA 4M63C 3MN6A 2YHYA 1DGKN 3LM2A 3A5MC 3CPWM 3C6AA 4NB4A 5AQZA 4B1XB 3LL3A 1KQSM 3SMPA 4FWRA 2FLOA 3ULEB 3ATVA 5C2FA 5DM7L 4B1ZA 1GLAG 1ATNA 2OTLN 1YXQA 3A5LC 2GELA 3VEZA 4MDBA 3C6HA 3MWPA 2NRZA 5AR0A 4JEPA 4FWSA 5EXWA 4BC2A 1S72N 1DT9A 3S41A 1G99A 5E26A 4H0XB 5AZJA 3MDQA 1VQ4N 3G6EN 3GDQA 3O9SA 3UE5A 2V52B 4GY2B 4FWLA 2P9SA 1GLLO 4FWKA 4Y0WA 4EHTA 5GIPA 2A42A 4IEIA 3CPEA 3P38A 3D2EA 1HLUA 2ZJRL 3O9TA 3TPQA 3CCEN 5FPDA 3CC4N 5EY4A 4YDUA 4XH1A 3K9JA 5AQXA 3M5RA 1GLBG 3O8MA 4FO0A 1VAZA 2Q1NA 2E20A 4QS9A 1ZXOA 3WQUA 3E1YA 3N4PA 3WXKA 3AAPA 5TKYA 1SZ2A 4IJNA 1XC3A 5AQLA 4A2BA 4EAHD 4MDAA 3DJCA 2RE2A 5BN9A 3G25A 4YORA 4B1VA 1O13A 4YOWA 5TKWA 2Q31A 4KH4A 1U6ZA 3WEEA 4CBUA 4O8UA 4BGBA 5MLCQ 3O4WA 1YHQN 4IWVA 1YAGA 3MX2A 3OBYA 4ISFA 3ULEA 3OHRA 1QVGM 4H5NA 3EN9A 2YCHA 2BTFA 2NRXA 4FWPA 4YOTA 3DXKB 4K25A 2QI2A 3JS6A 3CXCM 2HSTA 3J7ZO 1ATRA 3TSUA 4H03B 3VEVA 1RDUA 3VTHA 4FWMA 3VMFB 5C10A 5AQJA 3BF1A 2GTDA 3AAQA 5BPLA 5HOOA 4BQLA 4CZEA 4WFAL 1MWMA 3CCVN 2HBKA 2P9KB 4MLEA 2P9IB 3T69A 2VGNA 4R79A 2QWRA 3ZX3A 2P9PB 3K9KA 4MO4A 2I7PA 3WXMB 2NRRA 4BC5A 5JVGL 1YJ9N 3TU5A 1RGIA 2HBLA 5AQMA 3G71N 3G4SN 1HPMA 1VQ6N 3ID6A 5GIOA 1WUAA 2ZJPL 3CJAA 5GINA 3A8YA 3D7EO 3CCLN 4JKAA 1QQNA 4GV9A 5M1OA 4JAXA 2VYPA 3UKUB 1Q18A 3CCUN 1KAYA 3BP8A 3OA9A 3O6WA 3VGLA 5M1PA 3CCQN 1C0FA 4JHDB 1KC8O 3WT0A 2W41A 4G9ZA 2FSKA 2ZGZA 1NGAA 3QFPA 4KH6A 1JJ2M 5F0XA 3SLCA 3AGRA 5BR9A 3EE8A 3VEOA 4I6MB 4FSVA 1YUWA 4BRGA 4A62A 1GLFO 4IOCL 3LDLA 4JK7A 2ZGYA 5H1SQ 2QWNA 4WYBA 3WXJA 2VWBA 3H45C 3BUZB 2BH1A 1HKBA 3EL2A 4NLBA 3U9ZA 3WXLA 4WCEL 5F1XA 5AQHA 2IVNA 1T3VA 1S22A 4IDHA 4F9OA 3QICA 4C1NI 1WOQA 5EX5A 1YVNA 2W40A 3IFRA 2FXUA 2YX6A 5AQWA 3ZETA 1NLVA 3FFKB 4BR2A 1HUXA 1VQ9N 5E84A 3ZEUA 1BG3A 3QB0A 4JK8A 3MWTA 1OVYA 3FR0A 3L4IA 3O9QA 1K8KB 4H5RA 2YJFA 5JVHL 4J8FA 3CC2N 2P9KA 4WQ5C 4BR0A 4H5WA 3E66A 3MN9A 3R6MA 3EZWA 4JKBA 3KK7A 1NM1A 2P9PA 1U2VA 3KVGA 4MO5A 4PL7A 3Q7BA 5C2DA 4YOYA 3ENOA 4YOVA 3WXIA 3CJCA 4U7BA 3I8BA 4H0YB 2VCPA 4O5FA 4H5TA 5GAEP 1ZBSA 4IXCA 1TUYA 1C0GA 4O8KA 1T44A 1Y64A 4GNIA 3UKUA 4BRMA 4DB3A 2J4RA 3FLCO 5AQGA 1JCGA 3L0QA 2A3ZA 5KPTA 2WC9A 2E2OA 2CH6A 2QWPA 4JHDA 1TYQB 4CZGA 1YI2N 4B1UB 3LM9A 4OPHA 2HF4A 1NGBA 3H6EA 3OBWA 4H0VB 2E2QA 4JKDA 2WFBA 2YHXA 4I6MA 2E2PA 2ZWHA 2JWLA 3E9OA 3CJBA 3O80A 4XH4A 3VGKA 3I56N 5AQNA 4FL9A 4JNEA 2RHKA 4FPBA 4JN4A 3HRGA 1YF5L 4QS7A 4BRQA 4BVPA 3SAFA 1BO5O 3PIPL 4L3QA 3U8XA 3B8AX 2NNWA 4CJ7A 4BRCA 4WQ5A 5BREA 4CZHA 3DLLL 5AQOA 2HF3A 2NRHA 3GG4A 4WFNL 1NWKA 3VENA 1LCUA 2NRTA 5C0YA 3CJ7A 3FZKA 4BG8A 1R59O 4BRDA 3FZMA 4BR7A 3U9DA 5BRDA 3QMLA 2OANA 4GV3A 3SBTA 4CZJA 5JICA 3CCJN 1T6DA 3CCRN 3SAHA 1D4XA 3C0BA 3F5TA 2GEMA 1NJIO 4JKEA 5KPZA 4PL8A 4GV6A 3SK3A 1GLDG 3DWLA 2F9TA 1ATSA 1N8RO 4FWQA 3N4QA 2VGMA 3VGMA 4YOUA 5ELZA 5AQRA 5AQSA 4BR5A 5HL7L 2E1YA 4HWIA 1Z05A 4BY9C 2NLXA 3KWGA 2HBJA 1VQMN 1S3XA 3IDHA 4B1YB 4A2AA 3R8EA 3O1BA 4C1NK 1Q81O 1QZ6A 3BEXA 5FPEA 2F9WA 4BRFA 4JKHA 1QZ5A 2DPNA 1W97L 3HI0A 1TYQA 2Q2RA 1QQMA 2FF3B 2QXLA 4WQ4C 3VEXA 3VF4A 2A5XA 1MDUB 3A0IX 2BUPA 4FOEA 2P9LB 2CGKA 4K42A 3L6QA 5CE3A 4DHYA 2ZJQL 5C12A 4ILHA 5DM6L 1Q82O 1ESVA 3CERA 3H3OB 4GVEA 3GL1A 3VF6A 3CCSN 2QWQA 2HOEA 3MN5A 5FPMA 3SMSA 1JCFA 2V7YA 3H1VX 1VQKN 2E8AA 3VESA 3PLAA 4Z94A 4FWNA 4CD3A 1BOTO 2CH5A 1EQYA 3H1QA 3R9PA 3CJ1A 3A5OC 4A61A 4DCHA 4UY8O 2P9UB 2ZF5O 3CF5L 4PHTX 2D0OA 4ISGA 5LY3A 3FZHA 1IG8A 4BRAA 1ILYA 2HBMA 3O9UA 3D2FB 3ENHA 2PBDA 3D6RA 4AF1A 2A40A 2IIRA 3CQYA 4C23A 4BC3A 1XUPO 5AQYA 5BN8A 2PFUA 3HTVA 3AY9A 2GUPA 3F2KA 3CMEN 3RSEB 4B9QA 1Q7YO 5AQKA 3MCAB 3P4IA 3H3NO 3FGUA 4BRKA 3IUCA 2GWJA 3DXKA 1KXPA 4CD1A 3OW2M 2A41A 2KKZA 3O5BA 3U4LA 1VQLN 3LDNA 3KHYA 4AM6A 1BUPA 2QWMA 4CZFA 3W3DA 4A5BA 3C7NB 4IJAA 4JKCA 3VERA 4OPAA 4IZ9A 2GX9A 4BRLA 4CZMA 1K8AO 3CC7N 4EIAA 2Q36A 5JMVA 2FSJA 5AQVA 4FWOA 4A57A 2P9LA 4IO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX5 A;  4GV6 A;  4GV3 A;  4GVE A;  3MWP A;  4FVU A;  3Q7B A;  3R3L A;  3MX2 A;  4GV9 A;  4G9Z A;  3MWT A;  3Q7C A; 
#chains in the Genus database with same CATH topology
 5EOY A;  4JYA K;  1ZBU A;  5KPR A;  4DV7 K;  4BRI A;  1J6Z A;  3OYM A;  4BRP A;  4DR3 K;  4KHW A;  4JV5 K;  3UB5 A;  4A59 A;  4JKF A;  3PX0 A;  1L3T A;  2BAN A;  3AA3 A;  2E6L A;  5C15 A;  4GKK K;  2D0B A;  2E88 A;  4JI6 K;  3M6G A;  4CZI A;  1UAX A;  4ILJ A;  2D4W A;  3THY A;  3E01 A;  2OTJ N;  3PO4 A;  1EWQ A;  2YHW A;  1DKG D;  4BQZ A;  1BCM A;  2UXB K;  4O5B A;  3VPZ A;  2O8B A;  4Q0B A;  1E4G T;  2IVP A;  1U04 A;  3TTF A;  3C7N A;  4DUZ K;  3KZB A;  1BI4 B;  2HW3 A;  1K8K A;  1J9A A;  4QS8 A;  1IJJ A;  3QES A;  3F73 A;  4DV5 K;  3V81 A;  2FBY A;  1A5V A;  1EX4 A;  4XH5 A;  2QA4 N;  1V4S A;  4KH5 A;  3P5J A;  5ADX H;  2V51 B;  1VQO N;  2O4G A;  1P90 A;  5EVZ A;  3TAM A;  1RDB A;  4CI6 A;  4LSN A;  4BC4 A;  3T19 A;  4M7X A;  2BGG A;  3OYA A;  3WNH A;  3DMJ A;  4FOI A;  5LJW A;  3QBX A;  5C25 A;  4BR9 A;  5IWA K;  3ALY A;  5M1N A;  3JSM A;  2PZS A;  3C65 A;  2WUS A;  2UYT A;  3AAR A;  4YNQ A;  3CIP A;  2ZD1 A;  4DFM A;  5CZ2 A;  1KD1 O;  2H3G X;  3ZEU B;  3MEG A;  3O08 A;  5CY4 A;  2WON A;  4RWT A;  3AO4 A;  4NLC A;  4IO9 L;  1NJW A;  5AQF A;  1JL1 A;  1U48 A;  4QOZ B;  3M8Q A;  3NVK A;  3SUP A;  1O1W A;  1KAX A;  3IKM A;  1KLN A;  3PUF A;  2ITM A;  1GLE G;  3AGK A;  4CK2 A;  5M1K A;  4CE9 A;  4MLH A;  5M1F A;  3IMX A;  2ZQB A;  2A6A A;  4B9N A;  1E4F T;  1X3N A;  1T6C A;  4A5A A;  1WSJ A;  2XY8 A;  2QEX N;  4NXM K;  1K73 O;  2KLA A;  3B6O A;  1VSJ A;  5C42 A;  1IBL K;  2CGL A;  5KGW A;  4NYN A;  3OYJ A;  1JXB A;  1MWK A;  1QQO A;  1HQU A;  4ELU A;  4F4K A;  4CJS A;  2QM1 A;  1MA9 B;  3E9L A;  4RG8 A;  1N6Q A;  4HUG A;  3HO1 A;  1RT2 A;  4LFA K;  3MN6 A;  1DGK N;  3LM2 A;  4LF6 K;  2HHV A;  3RWU A;  3SYZ A;  1BIS A;  4FWR A;  3ATV A;  3SV4 A;  3O3F A;  2A1S A;  3MWP A;  2NRZ A;  4KHQ A;  4CEA A;  4CFA A;  3K5O A;  1G99 A;  4PUO A;  3G6E N;  3O9S A;  4W5R A;  4DR6 K;  3ZT1 A;  4FWL A;  1VSI A;  2A42 A;  3KKR A;  3QET A;  3P38 A;  1WAJ A;  3SQ0 A;  2ZJR L;  3TPQ A;  1VSK A;  1SKW A;  4XH1 A;  5AQX A;  1GLB G;  3PSI A;  3U3Y A;  3ZCM A;  1VAZ A;  1FKO A;  3SPY A;  2RN2 A;  3WQU A;  3NGY A;  1SZ2 A;  1XC3 A;  4J2A A;  3OY9 A;  3S3M A;  4LSL A;  3DJC A;  5BN9 A;  3G25 A;  4B1V A;  1TVR A;  1RDD A;  3WEE A;  4CBU A;  5MLC Q;  4BGB A;  3O4W A;  2D0A A;  1NJZ A;  3SI6 A;  3S3N A;  1L3S A;  4UQG A;  3NAE A;  1IG9 A;  4OKJ A;  4CEE A;  3ZSQ A;  3CXC M;  2HST A;  5HRR A;  1ATR A;  1X9W A;  3TSU A;  3VEV A;  4DTN A;  5J2P A;  4N41 A;  4AHR A;  4FLU A;  2GTD A;  1MWM A;  2P9I B;  4R79 A;  1JXE A;  2P9P B;  5JVG L;  5GIN A;  3D7E O;  4Z4E A;  5M1O A;  4OPJ A;  3CCQ N;  3WT0 A;  2W41 A;  1NGA A;  4OGE A;  3DOK A;  5BR9 A;  3VEO A;  4I6M B;  4FSV A;  1YUW A;  3OJU A;  1RT3 A;  4A62 A;  4KPY A;  4JK7 A;  1KSP A;  4FW2 A;  3L2R A;  1NG9 A;  2KZM A;  3SJJ A;  1T8E A;  4CHO A;  4FXD A;  3QNN A;  2GV9 A;  2HMI A;  4F9O A;  3DRS A;  3VQP A;  1WN7 A;  1Q9Y A;  1TL3 A;  2FXU A;  1EWR A;  3LWL A;  3ZET A;  3FFI A;  1HUX A;  3QB0 A;  4JK8 A;  1OVY A;  3K2P A;  3L4I A;  2Q3S A;  2YJF A;  5JVH L;  4WQ5 C;  3SUO A;  3EZW A;  3KK7 A;  2P9P A;  1U2V A;  3KVG A;  3CYM A;  3Q7B A;  5C2D A;  3OYL A;  1NMN A;  2ZM6 K;  1DTQ A;  4H0Y B;  2VCP A;  1SL1 A;  1C0G A;  4GNI A;  4DB3 A;  4M3T A;  1JCG A;  1C1B A;  1VSF A;  2QWP A;  1TYQ B;  1YI2 N;  4OPH A;  2HF4 A;  4PA1 A;  3H6E A;  2P5O A;  4I6M A;  2A1R A;  2ZWH A;  1TL1 A;  2E5L K;  3O80 A;  3VGK A;  4FJM A;  4IDK A;  2I5J A;  4M3U A;  4BRQ A;  4QAG A;  4NCG A;  3SAF A;  3HYF A;  3B8A X;  2NNW A;  4ID5 A;  5KRT A;  1RBR A;  1WBB A;  4BRC A;  2HHW A;  4WE1 A;  4CW7 B;  3AVN A;  3GG4 A;  4WFN L;  1HQE A;  3KKS A;  4CEF A;  3CJ7 A;  3P83 D;  4BR7 A;  3DRR A;  3U9D A;  5BRD A;  1BCO A;  4CZJ A;  5JIC A;  3SCX A;  4PQU A;  3CCJ N;  1NJI O;  2JGU A;  3VQ5 A;  5KI6 A;  3VQ4 A;  2RPI A;  3N4Q A;  3HVR A;  3PV8 A;  2E1Y A;  3NBP A;  1X9S A;  3J81 O;  1S9E A;  3LP2 A;  5HRN A;  3O1B A;  4C1N K;  3M8R A;  1QZ6 A;  5FPE A;  4DQR A;  1QZ5 A;  3HI0 A;  1TYQ A;  2WOM A;  2O8C B;  4DHY A;  1VSL A;  3WNF A;  1S1T A;  1LWC A;  4ILH A;  5DM6 L;  1ESV A;  1XNQ K;  3VF6 A;  2QWQ A;  3SMS A;  1TV6 A;  3PLA A;  2CH5 A;  4IFV A;  3R9P A;  4DCH A;  3M8S A;  3CJ1 A;  4Z4C A;  3T3F A;  4YHH K;  4KTQ A;  2P9U B;  3VQB A;  2ZF5 O;  3I8D A;  4E89 A;  4KHN A;  4ISG A;  3LAM A;  4Q5V A;  4AIL C;  1IG8 A;  3U3G A;  1ILY A;  1ASW A;  4AF1 A;  2VWJ A;  3QEW A;  5AQY A;  4OKE A;  3HTV A;  2OYQ A;  3U6F A;  3F2K A;  3CME N;  4CEB A;  1GOB A;  3WNE A;  2UXC K;  4CD1 A;  3DXK A;  2QWM A;  3W3D A;  4BE0 A;  1IO2 A;  4IJA A;  3LAK A;  1K8A O;  1TKX A;  3HVT A;  4EIA A;  3B6P A;  3ZT2 A;  5JMV A;  2O8C A;  4FWO A;  4A57 A;  2KFZ A;  4LH5 A;  4IO8 A;  2R7Y A;  1NOY A;  1NGC A;  5CHI A;  1NKC A;  1L3V A;  4JD2 B;  5F2R A;  4B3T K;  1BWF O;  4ICL A;  2FBT A;  4JI8 K;  2JWK A;  3PSF A;  4H4O A;  4IKF A;  2G8H A;  1GOA A;  4F2R A;  2HNY A;  3SAG A;  3MK6 A;  3TSP A;  1XMQ K;  1XC9 A;  4B8A B;  2QXF A;  3K5N A;  3TTC A;  2NZT A;  5AFU A;  4JRP A;  1OH8 A;  2QWO A;  4HTL A;  4M3Y A;  3FZL A;  4CGI A;  3QIO A;  2AP1 A;  3HOS A;  2IVO A;  2QTD A;  2YV0 X;  1HR0 K;  2P51 A;  3CI5 A;  4BVO A;  1DEJ A;  4B08 A;  1LWE A;  1F21 A;  4GMJ B;  3T7Z A;  3HJF A;  1NKE A;  1KAZ A;  1M90 O;  4U67 L;  1LW2 A;  3AVK A;  3CET A;  4JK9 A;  1Z25 A;  4DKW A;  3C6U A;  3KWI A;  4K0K K;  3V6D A;  1QHA A;  5DK5 A;  3CQX A;  1C0M A;  3O1W A;  2HHQ A;  3K58 A;  2QWL A;  1C1C A;  3L2W A;  1VQ8 N;  4JD2 A;  5FRN A;  1RIL A;  3NCI A;  5FRM A;  3Q7C A;  1GLJ O;  1VQ7 N;  3LDP A;  3P31 A;  2P1J A;  5AZI B;  4FZY A;  1UA1 A;  3DYA A;  4BDZ A;  3AVG A;  4B9L A;  3EO3 A;  3MX5 A;  4EFH A;  3ZX0 A;  4LD0 A;  2CGJ A;  3VA0 A;  4IEE A;  4OX9 K;  1BL3 A;  4FJJ A;  4CJR A;  3RR8 A;  1LOT B;  4YOX A;  1YIJ N;  3G0Z A;  2F4V K;  4HHT A;  3SJH A;  2NRV A;  4H0O A;  5KQ8 A;  3H46 O;  2I7N A;  3SUN A;  5KQD A;  5BRH A;  5HRS A;  4H0T B;  1K9M O;  2QW9 A;  2LSN A;  2ASM A;  3ZSO A;  1YJW N;  4CJT A;  4N56 A;  4DV0 K;  2UUC K;  3RR7 A;  3M1F A;  1EET A;  3MMV A;  3CHW A;  1P8Z A;  3CFP A;  4E1M A;  2V7Z A;  5AQI A;  1RT7 A;  4WQ4 A;  3L4Q A;  3VEY A;  3HSC A;  3THW A;  3LDO A;  4CZL A;  3DLG A;  1HKC A;  3MED A;  3E9P A;  2D1K A;  5AZI A;  5KRS A;  3DRP A;  1CZA N;  4Z4H A;  4CEC A;  3JXU A;  4H0P A;  4DTO A;  4DSF A;  3R3L A;  1GLC G;  3EYZ A;  3ZYY X;  3DAW A;  3NGZ A;  4BRO A;  2G8U A;  4BRE A;  3GOI A;  3NMU A;  4KB0 A;  3O9R A;  1KFD A;  1SV5 A;  4DV6 K;  1RFQ A;  1NGF A;  3TAQ A;  4E1N A;  4I2P A;  2E1Z A;  1NK8 A;  1S1X A;  4M63 C;  2YHY A;  4I7F A;  2Y1J A;  4OLB A;  3C6A A;  4DSJ A;  4E7I A;  4E7H A;  4DQS A;  3LL3 A;  3BY5 A;  3SMP A;  4KB1 A;  1JLE A;  1GLA G;  4B1Z A;  2OTL N;  2BDP A;  3A5L C;  4CGG A;  3BGR A;  1QSY A;  4MDB A;  4JI3 K;  4JEP A;  4ZHR A;  5EXW A;  5CYQ A;  4BC2 A;  1S72 N;  3S41 A;  4J2E A;  3MDQ A;  1NNE A;  1VQ4 N;  1NK9 A;  3VQE A;  2V52 B;  4GY2 B;  4IFY A;  4EHT A;  1CZB A;  4IEI A;  2HNZ A;  1OH5 A;  1QHT A;  3O9T A;  3CCE N;  4EZ6 A;  4CVN E;  2O8F B;  4YDU A;  3K9J A;  1T05 A;  2FBX A;  3P1G A;  1RBV A;  4OJR A;  2OPS A;  4DSI A;  1VHX A;  2XY5 A;  3ZLJ A;  2PYL A;  2QKB A;  4X66 K;  3E1Y A;  2G8K A;  5TKY A;  4CED A;  3TWH A;  3QNO A;  4EAH D;  4A2B A;  4O44 A;  3L8B A;  3KK2 A;  1WBD A;  4CJW A;  4R5P A;  3O3G A;  3THV A;  2NUB A;  2Q31 A;  3L2V A;  4ID1 A;  3IRX A;  3SQ1 A;  3OBY A;  1T03 A;  4CK3 A;  1C0T A;  4YOT A;  2YCH A;  4K25 A;  4FK0 A;  4FJL A;  1RBT A;  1N33 K;  4J2B A;  4DU3 A;  1D5A A;  3VQQ A;  4V19 S;  1C6V A;  3V9Z A;  4MQ3 A;  4FM1 A;  3AAQ A;  2HBK A;  3HT3 A;  2P9K B;  3KLH A;  1BI4 A;  3BZC A;  4N5S A;  2FC0 A;  1YJ9 N;  3HP6 A;  1RGI A;  3IAY A;  4RW7 A;  3NH2 A;  1HPM A;  1VQ6 N;  3ID6 A;  2ZJP L;  3CJA A;  4X65 K;  1WSF A;  2B4J A;  4JAX A;  3J7Y P;  3ZSV A;  3OA9 A;  1JLC A;  5M1P A;  4DLG A;  4JHD B;  4FJN A;  4L8R B;  4CIG A;  2FSK A;  3OVN A;  4KH6 A;  2Z1H A;  3AGR A;  2X74 A;  1GLF O;  3LDL A;  4E19 A;  4GVM A;  3WXJ A;  4DTM A;  4M42 A;  3BUZ B;  2OZM A;  1VSM A;  3OTO K;  1S22 A;  3QIC A;  4C1N I;  3LWM A;  3OYE A;  1YVN A;  1HYS A;  2W40 A;  2YX6 A;  5AQW A;  3ZEU A;  1BG3 A;  3MWT A;  1RDA A;  3FR0 A;  1VRU A;  4I2Q A;  4B9S A;  4J8F A;  4AH9 A;  2P9K A;  4FJX A;  4H5W A;  3MN9 A;  4MO5 A;  4YOV A;  5LMU K;  3CJC A;  1ITG A;  3AVA A;  2D0C A;  5HBM A;  4C8L A;  4H4M A;  1TUY A;  4BWM A;  4LF8 K;  4O8K A;  1T44 A;  5AJ3 K;  4HUF A;  5KPT A;  3L0Q A;  2A3Z A;  4CGJ A;  4FJG A;  3QLH A;  2E2O A;  2WC9 A;  4CHZ A;  4JHD A;  2X78 A;  4B1U B;  3LM9 A;  4ZTJ A;  1XHZ A;  1XI1 A;  1NGB A;  3OBW A;  2EHG A;  2E2Q A;  4H0V B;  2WFB A;  2YHX A;  3SZ2 A;  3RMD A;  4F8R A;  2E2P A;  3I56 N;  4XH4 A;  5AQN A;  4JNE A;  2RHK A;  3CFR A;  3CM6 A;  4QS7 A;  1E3M A;  2O8D B;  1RT5 A;  5AQO A;  1YT3 A;  2NRH A;  4CJQ A;  3OYG A;  1B92 A;  3VEN A;  4CJL A;  2D5R A;  2NRT A;  4I9Q A;  4BG8 A;  1FKP A;  3H08 A;  2KFN A;  1REV A;  4GV3 A;  2Z1I A;  1HMV A;  1T6D A;  4DR5 K;  3CCR N;  3F5T A;  4JKE A;  3NH0 A;  3SK3 A;  1GLD G;  2F9T A;  4KI4 A;  4DU1 A;  1N8R O;  1BIZ A;  2VQF K;  3VGM A;  5AQR A;  5HL7 L;  4JI4 K;  1Z05 A;  2NLX A;  4Z4F A;  3C94 A;  4AHV A;  3NF9 A;  3TAN A;  1EXQ A;  2OPQ A;  3R8E A;  1Q81 O;  3BEX A;  4Y1D A;  1RTH A;  4K8Z A;  2Z1J A;  1W97 L;  1NKB A;  1QQM A;  4WQ4 C;  2YNG A;  3VEX A;  2A5X A;  2BUP A;  5CE3 A;  4K8X A;  3L6Q A;  3AVL A;  3V9X A;  2IGI A;  4LF7 K;  3AVB A;  3PY8 A;  2EX3 A;  2OCE A;  5T7B A;  2HOE A;  1VQK N;  3H1V X;  1JL2 A;  4Z94 A;  4CD3 A;  3OYC A;  3TAP A;  1EQY A;  4A61 A;  3A5O C;  1RT6 A;  1HNZ K;  3CF5 L;  1BHL A;  2D0O A;  3PX4 A;  1WB9 A;  1NJY A;  3AVC A;  3VQ6 A;  4DLE A;  4LF5 K;  3CG7 A;  5HP1 A;  3L3V A;  4DF8 A;  2IIR A;  3LP0 A;  2XRI A;  4C23 A;  3K59 A;  3T1H K;  1U45 A;  3RSE B;  3UIQ A;  3H3N O;  4BRK A;  3T1A A;  4DV4 K;  2A41 A;  4KTW A;  3U4L A;  1VQL N;  4ELT A;  3LDN A;  1S6P A;  4A5B A;  4JKC A;  3ZT3 A;  3CC7 N;  2Q36 A;  2OA8 A;  4CJF A;  2P9I A;  2D0P A;  4DTP A;  4FJ7 A;  5GAD P;  4FVU A;  3ZSR A;  4J2D A;  2WBN A;  4AHS A;  1NGH A;  2GWK A;  3SPZ A;  3P39 A;  2WTU A;  1RTD A;  1BU6 O;  1RT1 A;  2YNF A;  3O4N A;  2Q0R A;  1NMD A;  3V1O A;  4CHP A;  3NH1 A;  3VEW A;  4QCL A;  1VRT A;  3QBW A;  4PKG A;  4YDU C;  5KGX A;  1RNH A;  3ID8 A;  3QEP A;  3HK2 A;  3KD5 E;  3HPH A;  1X3M A;  4TSX A;  1IBK K;  4CHQ A;  5FLX O;  1J5O A;  3RVC A;  4M3W A;  1VQN N;  1XNR K;  4M3Z A;  4ZTF A;  3I33 A;  2G8V A;  4IFE A;  3M3Z A;  3A5N C;  1X9J A;  3QEV A;  3RSE A;  5E41 A;  5FPN A;  1I94 K;  3DXM B;  2ETJ A;  1WSH A;  5ADX A;  1XMO K;  1IBM K;  1RDW X;  4DQ8 A;  4MFB A;  3CJ9 A;  5M1Q A;  1NGG A;  1N5Y A;  2ASO A;  4CF9 A;  1RBS A;  4Z0U A;  3RMC A;  1Q9X A;  4CHY A;  3T1Y K;  3SUQ A;  2P9N B;  4FLX A;  2OPR A;  1QVF M;  3MXI A;  2E6M A;  2Q97 A;  4IOA L;  1NU0 A;  4F3T A;  3EKU A;  1X1P A;  4N76 A;  4YY3 K;  4JRQ A;  1HX1 A;  1T7P A;  4LC9 B;  3QIN A;  1BA1 A;  4FLV A;  2OZS A;  3DLK A;  4RCH A;  5KTQ A;  3OYK A;  3S9H A;  2HB5 A;  3D0P A;  1S6Q A;  4CCH A;  4K41 A;  3CMA N;  4JI1 K;  3EY1 A;  1ZC6 A;  1L5U A;  3GE1 A;  2AA4 A;  3F9M A;  4DV3 K;  4CER A;  4PKH A;  4BGA A;  1J53 A;  3J8A A;  4DV2 K;  1A5X A;  3TTD A;  5AQP A;  3I55 N;  4CGH A;  2PAV A;  3DXM A;  5I9E B;  3D45 A;  4CBX A;  3NGI A;  3K5M A;  5AQT A;  1S9G A;  1ZBH A;  4DV1 K;  4AM7 A;  2ASP A;  4DTU A;  2E2N A;  4B8C A;  4E1J A;  2W42 A;  2FSN A;  4CJK A;  3LDQ A;  2UUB K;  5I42 A;  1J54 A;  1R0A A;  1SAZ A;  4ISE A;  1CXU A;  2KHO A;  2NRW A;  2P9N A;  3ZSW A;  3R1X A;  3EZ5 A;  3HOT A;  4DUY K;  3HPG A;  4BG9 A;  4OPK A;  3MEE A;  4HTU A;  1NGE A;  2Q0U A;  3HM8 A;  4DQI A;  3NF8 A;  4DR1 K;  3K5L A;  3PX6 A;  4CJP A;  1B9D A;  2P9S B;  1EO1 A;  1WSE A;  4FJ8 A;  1JLQ A;  5CR4 A;  4DSE A;  5LJV A;  3RMA A;  4IG0 A;  4LF4 K;  3RMB A;  1HNV A;  2EWS A;  1YJN N;  1CXQ A;  4GKJ K;  5GAG P;  2P9U A;  4H5V A;  5J2Q A;  5B8H A;  2FBV A;  1OVQ A;  1KRP A;  3OYB A;  3LPU A;  4W5Q A;  1S5J A;  1KFS A;  3RRH A;  5AQZ A;  4B1X B;  3NF7 A;  3O4Q A;  1KQS M;  3VQ7 A;  2FLO A;  3ULE B;  5C2F A;  5DM7 L;  4FZZ A;  2HHH K;  1ATN A;  3M8P A;  3VEZ A;  4DTS A;  1YTU A;  1VK0 A;  1NJX A;  3QEX A;  4H0X B;  3NE6 A;  4X64 K;  3GDQ A;  3UE5 A;  2UXD K;  2P9S A;  1GLL O;  4FWK A;  5GIP A;  3NHG A;  3KLF A;  4HUE A;  4B3M K;  3CPE A;  4XIU A;  4CES A;  2O8E B;  2PYJ A;  4DSK A;  3V1Q A;  2OPP A;  4E7L A;  4CJ5 A;  5FPD A;  5EY4 A;  3CC4 N;  1ZBF A;  4OKK A;  4FO0 A;  3I0S A;  1W7A A;  4QS9 A;  3WXK A;  3AAP A;  2GUI A;  1KLM A;  1G15 A;  5AQL A;  2RE2 A;  3V9U A;  4B9U A;  4YOR A;  1O13 A;  4YOW A;  5TKW A;  3LAN A;  4KH4 A;  1W9H A;  4KKO A;  4O8U A;  3THX B;  1YHQ N;  1YAG A;  3MX2 A;  4HCC A;  1IKY A;  3ULE A;  3OHR A;  2AJQ A;  1QVG M;  4H5N A;  4OVL A;  3EN9 A;  1N36 K;  2BTF A;  2KQ2 A;  3DI6 A;  4DMN A;  3JS6 A;  3DLH A;  1TK0 A;  4LFC K;  4KI6 A;  3OS1 A;  4FM0 A;  1S1W A;  4AQY K;  3QER A;  3AA4 A;  4H03 B;  1QTM A;  3VTH A;  4FWM A;  1U4B A;  3BF1 A;  4YFU A;  5BPL A;  4WFA L;  1W0H A;  3CCV N;  3QIP A;  4W5N A;  3J80 O;  1TK5 A;  4MLE A;  4C8K A;  4FLZ A;  4FLT A;  4KRF A;  4B9M A;  2QWR A;  1VSE A;  3ZX3 A;  2O8E A;  3K9K A;  4MO4 A;  2I7P A;  3WXM B;  2NRR A;  4BC5 A;  3TU5 A;  2KZZ A;  4KHY A;  2IAJ A;  5AQM A;  1JLG A;  3G4S N;  1IKX A;  1N32 K;  1LAV A;  2Y1I A;  5BR8 K;  3A8Y A;  3CCL N;  2DY4 A;  1QQN A;  4GV9 A;  2VYP A;  3KIO A;  1KAY A;  3VGL A;  1QSS A;  1C0F A;  1KC8 O;  4G9Z A;  4Z4I A;  4CJU A;  2ZGZ A;  4BE2 A;  1JJ2 M;  3THY B;  3AVF A;  4CF0 A;  3EE8 A;  4BRG A;  4JI7 K;  3BZK A;  4GW6 A;  1S1V A;  5H1S Q;  2QWN A;  2B6A A;  2G8I A;  2VWB A;  3H45 C;  3THX A;  4LF9 K;  3WXL A;  2BH1 A;  4NLB A;  4WCE L;  2UU9 K;  5F1X A;  4FK2 A;  1T3V A;  4CFD A;  5D3G A;  1WOQ A;  5EX5 A;  4DWI A;  1NK4 A;  4HVJ A;  1EKE A;  4BR2 A;  4DTR A;  4C8N A;  1VQ9 N;  5E84 A;  1XHX A;  1UOC A;  4DQP A;  1K8K B;  1OH6 A;  4E3S A;  4B9V A;  4E0D A;  3HST B;  2YKM A;  5I3U A;  4BR0 A;  1QE1 A;  3E66 A;  5EU7 A;  4IG3 A;  1NM1 A;  4PL7 A;  3KLG A;  3ENO A;  3AO1 A;  3WXI A;  3VN5 A;  4FZX C;  1RBU A;  5GAE P;  1Y97 A;  2W6K A;  3TAB A;  1Y64 A;  4BRM A;  2J4R A;  3FLC O;  3F9K A;  3LP1 A;  3TAR A;  3L2Q A;  4CZG A;  4DTX A;  1HYZ A;  1C0U A;  4CK1 A;  4M3R A;  2G8W A;  2HVH A;  2JWL A;  1EP4 A;  2VG7 A;  5HRO A;  2PY5 A;  4FL9 A;  3OYN A;  4FPB A;  4JN4 A;  2P5G A;  1YF5 L;  4BAC A;  3PIP L;  1BO5 O;  4L3Q A;  4WQ5 A;  3VQ9 A;  4CJE A;  4CZH A;  3DLL L;  4DF4 A;  2HF3 A;  4F2S A;  3CQ8 A;  1NWK A;  4B9T A;  4CFC A;  1I39 A;  4CGF A;  2HVI A;  2OAN A;  3SBT A;  3ZSY A;  4H8K A;  4M45 A;  3SAH A;  3C0B A;  1KVC A;  2YNI A;  5KPZ A;  4PL8 A;  1D9F A;  4DFJ A;  2RKI A;  3TAG A;  3AO2 A;  4FWQ A;  2VGM A;  4BR5 A;  1ASU A;  4YOU A;  4HWI A;  3KWG A;  1VQM N;  4B1Y B;  3MEC A;  4Z4G A;  4CIF A;  1BIU A;  2F9W A;  4JKH A;  3TAF A;  4O0I A;  2Q2R A;  3IG1 A;  2QXL A;  1I3A A;  3DLR A;  3AA2 A;  3VF4 A;  3KJV A;  3O3H A;  4FOE A;  2P9L B;  3MXJ A;  4CFB A;  4BDP A;  5C12 A;  4KHP K;  4CF1 A;  3CER A;  4GVE A;  5C24 A;  3MN5 A;  5FPM A;  2V7Y A;  3EEQ A;  5A2Q O;  3VES A;  2O8F A;  2YHA A;  4DS5 A;  1BOT O;  3H1Q A;  4FYD A;  3OS2 A;  1NK6 A;  3TI0 A;  5LY3 A;  3FZH A;  1K6Y A;  2VWK A;  1HNW K;  2HBM A;  4B3S K;  3D2F B;  3ENH A;  2PBD A;  1NK0 A;  3D6R A;  3CQY A;  3A2F A;  4BC3 A;  1XUP O;  5BN8 A;  4C8O A;  2PFU A;  3AY9 A;  2GUP A;  1HNI A;  1Q7Y O;  3DLB A;  4LH4 A;  5AQK A;  3MCA B;  3FGU A;  2GWJ A;  2KKZ A;  1SL0 A;  3O5B A;  1LW0 A;  4AM6 A;  4CZF A;  1HNX K;  4OPA A;  4IZ9 A;  2GX9 A;  4BRL A;  3OYD A;  3V9W A;  4CJ4 A;  1TGO A;  4YOY A;  2P9L A;  3RRG A;  2KW4 A;  3C95 A;  1BA0 A;  1FK9 A;  4KO0 A;  1TUU A;  3HM9 A;  3CCM N;  1OKJ A;  4RTF D;  5CYM A;  4M7Y A;  1HRH A;  4M3X A;  4NCA A;  1TK8 A;  1NGD A;  4FJI A;  3DM2 A;  1VQ5 N;  3PIO L;  5JS2 A;  4DU4 A;  2YHB A;  3GBT A;  2YJE A;  3IS9 A;  1CZ9 A;  3UKR B;  4ILG B;  3WEE B;  1D9D A;  3D2F A;  4O55 A;  4LY7 A;  4WFB L;  3CD6 N;  4JS5 A;  1ASV A;  3NF6 A;  4EHU A;  3HP9 A;  5JLH A;  4FVM A;  1V4T A;  3AVI A;  2G8F A;  4FJ5 A;  1YIT N;  3VET A;  4NO7 A;  5JLF A;  4NXN K;  4IBN A;  4FM2 A;  3ENB A;  4JI5 K;  5GAH P;  2JLE A;  1DTT A;  1SQK A;  3OYI A;  4DR2 K;  4AHC A;  5AFU H;  3EE9 A;  3VTI A;  4CIE A;  4KBO A;  1UWB A;  4HCB A;  3MN7 A;  4FJH A;  1LV5 A;  2QKK A;  1NGI A;  4C8M A;  3QDK A;  1SKS A;  4F3O A;  1SS6 A;  1XQS C;  4FJ9 A;  2F7T A;  1H1V A;  2FF6 A;  5BPM A;  4OLA A;  3K0S A;  1OH7 A;  3SBG A;  3WUH A;  4E7J A;  1S1U A;  3VOV A;  3QFU A;  3UKR A;  3HL8 A;  3AVH A;  3HBT A;  3PO5 A;  1VSD A;  4FPA A;  4CZK A;  5BPN A;  1NGJ A;  3W0L A;  3KD1 E;  5BRF A;  3ZT0 A;  4JKG B;  4CEO A;  1U49 A;  1WSG A;  3KK1 A;  2O8D A;  4XEI A;  3FZF A;  3ZET B;  3SNN A;  1BDG A;  1JLF A;  2HMP A;  2ZE2 A;  4FW1 A;  4BR4 A;  1FXX A;  3DLE A;  2F8T A;  4WF9 L;  3ATU A;  3EKS A;  3OYH A;  1HJO A;  4X62 K;  3HZ6 A;  1HKG A;  3VF2 A;  2YI1 A;  4KTZ A;  4B1W B;  2IS3 A;  3SV3 A;  1L3U A;  1WLJ A;  1U2V B;  2X6S A;  2UUA K;  4PWD A;  3NVM A;  1Q86 O;  4NCB A;  2RF2 A;  4BWJ A;  2ITG A;  3MCP A;  3L2U A;  1NK7 A;  3ZX2 A;  4BRN A;  5AQQ A;  1JCE A;  3HXM A;  4PKI A;  4E7K A;  1SUQ A;  3TAE A;  3J7A P;  4B3R K;  2IC3 A;  2GBZ A;  4BRH A;  3TSQ A;  2E4L A;  5AZJ B;  1VQP N;  1YVU A;  3CM5 A;  1M1K O;  1X9M A;  3WQT A;  3OS0 A;  1Z6R A;  1SL2 A;  3AA5 X;  4K43 A;  1ZYQ A;  4NYF A;  3QEI A;  1N34 K;  3BF3 A;  5AQU A;  4JLH A;  1NBW A;  3D2E B;  3FE1 A;  4CBW A;  1ZBL A;  1WAF A;  3JAM O;  4OO1 J;  4FCY A;  1DLO A;  1KTQ A;  4JKG A;  2B5J A;  5CZ1 A;  4IOX A;  1IV0 A;  1KCF A;  4Y1C A;  1TAU A;  1W2B M;  3HPO A;  3KLE A;  1JKH A;  5J1E A;  5J2M A;  1KVB A;  3CPW M;  3A5M C;  4NB4 A;  4DFP A;  2XY6 A;  1HJR A;  2DTU A;  1RTI A;  4BE1 A;  3V4I A;  4CEQ A;  1YXQ A;  2BE2 A;  2GEL A;  3C6H A;  5AR0 A;  1BQN A;  4FWS A;  1DT9 A;  4KHS A;  5E26 A;  3ZSX A;  3ASM A;  5AZJ A;  4RW8 A;  4DFK A;  4RW9 A;  3ISN C;  1KVA A;  4RW6 A;  3I0R A;  4Y0W A;  4O0J A;  4W5O A;  3D2E A;  1HLU A;  3G10 A;  1A5W A;  1JLB A;  3V1R A;  3NFA A;  4OGC A;  4B3O A;  4KFB A;  1IKW A;  3M5R A;  3O8M A;  3VQ8 A;  2Q1N A;  3AV9 A;  2E20 A;  2XO7 A;  1ZXO A;  3N4P A;  2O4I A;  3WNG A;  4IJN A;  3AO3 A;  4RW4 A;  4MDA A;  4W5T A;  3K57 A;  4KV8 A;  1TKZ A;  1U6Z A;  4EP4 A;  4BDY A;  4AHT A;  1LAW A;  4IWV A;  4ISF A;  4G1Q A;  4KAZ A;  2F8S A;  4DR7 K;  4FWP A;  4AHU A;  2NRX A;  3V9S A;  3DXK B;  2QI2 A;  4N47 A;  4FLW A;  3ITH A;  2KTQ A;  5J2N A;  3J7Z O;  1NK5 A;  5K14 A;  4DTJ A;  4ELV A;  1RDU A;  3VMF B;  1Q8I A;  5C10 A;  5AQJ A;  4KHU A;  5HOO A;  3NDK A;  4BQL A;  4CZE A;  5FRO A;  3T69 A;  1RDC A;  1J5E K;  2VGN A;  3LAL A;  2YKN A;  1CLQ A;  3L3U A;  2HBL A;  3G71 N;  3MAQ A;  4EP5 A;  2ATQ A;  1TKT A;  1WUA A;  5GIO A;  5SZT A;  4JKA A;  3UKU B;  1Q18 A;  3CCU N;  1RTJ A;  3BP8 A;  3O6W A;  5IT9 O;  2VG6 A;  1WNS A;  3VQD A;  3QFP A;  1QQC A;  3SLC A;  5F0X A;  4FK4 A;  3KK3 A;  4JI2 K;  3VQC A;  3LP3 A;  4IOC L;  2ZGY A;  4WYB A;  2XHB A;  3AO5 A;  1HKB A;  3EL2 A;  4I9L A;  1IH7 A;  1RCH A;  3U9Z A;  4DG1 A;  4JS4 A;  5AQH A;  3VA3 A;  2VG5 A;  2IVN A;  4IDH A;  4DQQ A;  1WSI A;  3KTQ A;  3ULD A;  3JYT A;  3LZI A;  3IFR A;  3LZJ A;  1Z26 A;  3OJS A;  1QS4 A;  1NLV A;  3FFK B;  1BQM A;  4CF8 A;  2HHT A;  3O9Q A;  4H5R A;  4M41 A;  3MXM A;  3CC2 N;  5LL6 Z;  5FDL A;  4O4G A;  4CGD A;  2QK9 A;  3R6M A;  4JKB A;  2HND A;  2YNH A;  3S3O A;  2DFF A;  1FW6 A;  4U7B A;  3I8B A;  1XWL A;  4O5F A;  4H5T A;  1ZBS A;  4IXC A;  4CJ3 A;  3UKU A;  4PY5 A;  5AQG A;  3DOL A;  2CH6 A;  3SQ2 A;  4DR4 K;  4JKD A;  2HHS A;  4LFB K;  1B9F A;  3CJB A;  3E9O A;  5SWM A;  3C6T A;  2IOC A;  4BVP A;  3HRG A;  2F96 A;  2XY7 A;  1ZBI A;  3U8X A;  4CJ7 A;  3SQ4 A;  5BRE A;  1U47 A;  2HHU A;  1GOC A;  5HRP A;  1LCU A;  5C0Y A;  3FZK A;  1R59 O;  4BRD A;  3FZM A;  5LMN K;  1TKD A;  3QML A;  3LPT A;  3CFO A;  1D4X A;  1BGX T;  2GEM A;  4EZ9 A;  4GV6 A;  3DWL A;  1HPZ A;  1ATS A;  1RT4 A;  3AVM A;  4CHN A;  4CEZ A;  4FLY A;  2X6N A;  5ELZ A;  4BY9 C;  3THW B;  5AQS A;  3BDP A;  5HLF A;  2HBJ A;  1S3X A;  3IDH A;  3ZSZ A;  1TAQ A;  4A2A A;  3LDS A;  1FJG K;  1SKR A;  3AVJ A;  4BRF A;  2DPN A;  2FF3 B;  1QSL A;  1UA0 A;  1MDU B;  3A0I X;  1D8Y A;  4K42 A;  2CGK A;  3TR8 A;  1HYV A;  5JS1 A;  2VQE K;  2ZJQ L;  1Q82 O;  3H3O B;  3GL1 A;  3KLI A;  3CCS N;  1JCF A;  2E8A A;  2IDO A;  2HHX A;  4FWN A;  2DFH A;  4UY8 O;  4CJV A;  4PHT X;  1C1A A;  1IKV A;  4JI0 K;  3ZT4 A;  4BRA A;  3RTV A;  3QO9 A;  3O9U A;  4FJK A;  1JLA A;  4CF2 A;  2A40 A;  1MU2 A;  1VSH A;  2W6L A;  4B9Q A;  3OYF A;  4DSL A;  3P4I A;  2DFE A;  3IUC A;  2O8B B;  1KXP A;  3OW2 M;  4KRE A;  4DS4 A;  3VQA A;  2Z1G A;  3KHY A;  1YTA A;  1LWF A;  5DMR A;  1BUP A;  3C7N B;  3VER A;  4CZM A;  1NOZ A;  2FSJ A;  5AQV A; 
#chains in the Genus database with same CATH homology
 2P9I A;  5EOY A;  2D0P A;  5KPR A;  1BA0 A;  5GAD P;  4FVU A;  4BRI A;  1J6Z A;  1NGC A;  5CHI A;  2WBN A;  4BRP A;  1TUU A;  4JD2 B;  5F2R A;  1NGH A;  1BWF O;  2GWK A;  3CCM N;  1OKJ A;  4RTF D;  2JWK A;  3UB5 A;  4A59 A;  3P39 A;  4JKF A;  1BU6 O;  4M7Y A;  1NGD A;  3SAG A;  2Q0R A;  3MK6 A;  1VQ5 N;  1NMD A;  3PIO L;  5C15 A;  3TSP A;  3VEW A;  3GBT A;  3QBW A;  2YJE A;  4PKG A;  4YDU C;  2E88 A;  3ID8 A;  3M6G A;  4CZI A;  4ILJ A;  3UKR B;  2D4W A;  4ILG B;  2NZT A;  3TTC A;  5AFU A;  1X3M A;  3WEE B;  3D2F A;  2OTJ N;  2QWO A;  4HTL A;  1VQN N;  3RVC A;  3FZL A;  3I33 A;  4WFB L;  3CD6 N;  2AP1 A;  2YHW A;  1DKG D;  4EHU A;  4IFE A;  3HOS A;  3M3Z A;  2IVO A;  3A5N C;  2QTD A;  1V4T A;  1X9J A;  4BQZ A;  5JLH A;  3CI5 A;  3RSE A;  4BVO A;  5FPN A;  1DEJ A;  1YIT N;  3DXM B;  3VET A;  3VPZ A;  4NO7 A;  5ADX A;  5JLF A;  1E4G T;  3ENB A;  2IVP A;  3T7Z A;  1RDW X;  1KAZ A;  4DQ8 A;  1M90 O;  3CJ9 A;  5M1Q A;  4U67 L;  1NGG A;  5GAH P;  3CET A;  4JK9 A;  3TTF A;  4DKW A;  2ASO A;  1SQK A;  3C7N A;  3KZB A;  3KWI A;  5AFU H;  1QHA A;  3EE9 A;  3VTI A;  1K8K A;  3CQX A;  4KBO A;  4QS8 A;  1IJJ A;  3O1W A;  2P9N B;  2QWL A;  3MN7 A;  1QVF M;  2Q97 A;  4IOA L;  1VQ8 N;  4XH5 A;  2QA4 N;  4JD2 A;  1NGI A;  3EKU A;  1V4S A;  4KH5 A;  3QDK A;  5ADX H;  2V51 B;  1VQO N;  1SS6 A;  1P90 A;  3Q7C A;  1XQS C;  5EVZ A;  1GLJ O;  1HX1 A;  2F7T A;  1VQ7 N;  1H1V A;  3LDP A;  3P31 A;  1BA1 A;  2FF6 A;  4LC9 B;  4CI6 A;  5BPM A;  4BC4 A;  5AZI B;  4M7X A;  3SBG A;  3WUH A;  3EO3 A;  3MX5 A;  4RCH A;  4EFH A;  3ZX0 A;  4FOI A;  3VOV A;  2CGJ A;  3QFU A;  3UKR A;  5LJW A;  3QBX A;  4BR9 A;  4K41 A;  4IEE A;  3CMA N;  5M1N A;  3HBT A;  1ZC6 A;  4FPA A;  3GE1 A;  3C65 A;  4CZK A;  2AA4 A;  1NGJ A;  2WUS A;  3F9M A;  3W0L A;  5BPN A;  4PKH A;  1LOT B;  2UYT A;  4BGA A;  5BRF A;  4YOX A;  1YIJ N;  3J8A A;  4JKG B;  3AAR A;  3CIP A;  3TTD A;  5AQP A;  3I55 N;  4XEI A;  3FZF A;  3ZET B;  2PAV A;  1BDG A;  2HMP A;  3DXM A;  5I9E B;  3SJH A;  2NRV A;  4BR4 A;  4H0O A;  1KD1 O;  2H3G X;  3ZEU B;  4CBX A;  5KQ8 A;  3H46 O;  2I7N A;  5AQT A;  3ATU A;  3EKS A;  5BRH A;  5KQD A;  4H0T B;  3O08 A;  4WF9 L;  1K9M O;  1HJO A;  2QW9 A;  3HZ6 A;  1HKG A;  3VF2 A;  4RWT A;  2ASM A;  4AM7 A;  2ASP A;  1YJW N;  2YI1 A;  4B1W B;  2E2N A;  4E1J A;  4NLC A;  4IO9 L;  2FSN A;  5AQF A;  3LDQ A;  3NVK A;  3M1F A;  3MMV A;  3CHW A;  1U2V B;  1SAZ A;  4ISE A;  1KAX A;  1P8Z A;  3IKM A;  3NVM A;  1Q86 O;  2ITM A;  2KHO A;  2V7Z A;  2NRW A;  2P9N A;  5AQI A;  1GLE G;  3R1X A;  3MCP A;  4WQ4 A;  3AGK A;  3HOT A;  3L4Q A;  3VEY A;  5M1K A;  4MLH A;  3ZX2 A;  5M1F A;  3IMX A;  4BRN A;  3HSC A;  3LDO A;  5AQQ A;  1JCE A;  4BG9 A;  4PKI A;  4CZL A;  2A6A A;  1HKC A;  1E4F T;  1NGE A;  3E9P A;  2D1K A;  5AZJ B;  2Q0U A;  1X3N A;  3HM8 A;  3TSQ A;  4BRH A;  1VQP N;  1T6C A;  5AZI A;  1M1K O;  3WQT A;  4A5A A;  1Z6R A;  1CZA N;  4K43 A;  2P9S B;  1EO1 A;  3BF3 A;  5AQU A;  3JXU A;  4H0P A;  2QEX N;  3R3L A;  1GLC G;  1NBW A;  3ZYY X;  3D2E B;  3DAW A;  3FE1 A;  4CBW A;  2KLA A;  4BRO A;  1K73 O;  5CR4 A;  4BRE A;  3GOI A;  3NMU A;  4OO1 J;  2CGL A;  3O9R A;  5LJV A;  1QQO A;  1MWK A;  1RFQ A;  1NGF A;  4JKG A;  2EWS A;  2QM1 A;  1YJN N;  4IOX A;  1MA9 B;  3E9L A;  1W2B M;  2E1Z A;  5GAG P;  2P9U A;  4H5V A;  5B8H A;  4M63 C;  3MN6 A;  2YHY A;  1DGK N;  3LM2 A;  3A5M C;  3CPW M;  3C6A A;  4NB4 A;  5AQZ A;  4B1X B;  3LL3 A;  1KQS M;  3SMP A;  4FWR A;  2FLO A;  3ULE B;  3ATV A;  5C2F A;  5DM7 L;  4B1Z A;  1GLA G;  1ATN A;  2OTL N;  1YXQ A;  3A5L C;  2GEL A;  3VEZ A;  4MDB A;  3C6H A;  3MWP A;  2NRZ A;  5AR0 A;  4JEP A;  4FWS A;  5EXW A;  4BC2 A;  1S72 N;  1DT9 A;  3S41 A;  1G99 A;  5E26 A;  4H0X B;  5AZJ A;  3MDQ A;  1VQ4 N;  3G6E N;  3GDQ A;  3O9S A;  3UE5 A;  2V52 B;  4GY2 B;  4FWL A;  2P9S A;  1GLL O;  4FWK A;  4Y0W A;  4EHT A;  5GIP A;  2A42 A;  4IEI A;  3CPE A;  3P38 A;  3D2E A;  1HLU A;  2ZJR L;  3O9T A;  3TPQ A;  3CCE N;  5FPD A;  3CC4 N;  5EY4 A;  4YDU A;  4XH1 A;  3K9J A;  5AQX A;  3M5R A;  1GLB G;  3O8M A;  4FO0 A;  1VAZ A;  2Q1N A;  2E20 A;  4QS9 A;  1ZXO A;  3WQU A;  3E1Y A;  3N4P A;  3WXK A;  3AAP A;  5TKY A;  1SZ2 A;  4IJN A;  1XC3 A;  5AQL A;  4A2B A;  4EAH D;  4MDA A;  3DJC A;  2RE2 A;  5BN9 A;  3G25 A;  4YOR A;  4B1V A;  1O13 A;  4YOW A;  5TKW A;  2Q31 A;  4KH4 A;  1U6Z A;  3WEE A;  4CBU A;  4O8U A;  4BGB A;  5MLC Q;  3O4W A;  1YHQ N;  4IWV A;  1YAG A;  3MX2 A;  3OBY A;  4ISF A;  3ULE A;  3OHR A;  1QVG M;  4H5N A;  3EN9 A;  2YCH A;  2BTF A;  2NRX A;  4FWP A;  4YOT A;  3DXK B;  4K25 A;  2QI2 A;  3JS6 A;  3CXC M;  2HST A;  3J7Z O;  1ATR A;  3TSU A;  4H03 B;  3VEV A;  1RDU A;  3VTH A;  4FWM A;  3VMF B;  5C10 A;  5AQJ A;  3BF1 A;  2GTD A;  3AAQ A;  5BPL A;  5HOO A;  4BQL A;  4CZE A;  4WFA L;  1MWM A;  3CCV N;  2HBK A;  2P9K B;  4MLE A;  2P9I B;  3T69 A;  2VGN A;  4R79 A;  2QWR A;  3ZX3 A;  2P9P B;  3K9K A;  4MO4 A;  2I7P A;  3WXM B;  2NRR A;  4BC5 A;  5JVG L;  1YJ9 N;  3TU5 A;  1RGI A;  2HBL A;  5AQM A;  3G71 N;  3G4S N;  1HPM A;  1VQ6 N;  3ID6 A;  5GIO A;  1WUA A;  2ZJP L;  3CJA A;  5GIN A;  3A8Y A;  3D7E O;  3CCL N;  4JKA A;  1QQN A;  4GV9 A;  5M1O A;  4JAX A;  2VYP A;  3UKU B;  1Q18 A;  3CCU N;  1KAY A;  3BP8 A;  3OA9 A;  3O6W A;  3VGL A;  5M1P A;  3CCQ N;  1C0F A;  4JHD B;  1KC8 O;  3WT0 A;  2W41 A;  4G9Z A;  2FSK A;  2ZGZ A;  1NGA A;  3QFP A;  4KH6 A;  1JJ2 M;  5F0X A;  3SLC A;  3AGR A;  5BR9 A;  3EE8 A;  3VEO A;  4I6M B;  4FSV A;  1YUW A;  4BRG A;  4A62 A;  1GLF O;  4IOC L;  3LDL A;  4JK7 A;  2ZGY A;  5H1S Q;  2QWN A;  4WYB A;  3WXJ A;  2VWB A;  3H45 C;  3BUZ B;  2BH1 A;  1HKB A;  3EL2 A;  4NLB A;  3U9Z A;  3WXL A;  4WCE L;  5F1X A;  5AQH A;  2IVN A;  1T3V A;  1S22 A;  4IDH A;  4F9O A;  3QIC A;  4C1N I;  1WOQ A;  5EX5 A;  1YVN A;  2W40 A;  3IFR A;  2FXU A;  2YX6 A;  5AQW A;  3ZET A;  1NLV A;  3FFK B;  4BR2 A;  1HUX A;  1VQ9 N;  5E84 A;  3ZEU A;  1BG3 A;  3QB0 A;  4JK8 A;  3MWT A;  1OVY A;  3FR0 A;  3L4I A;  3O9Q A;  1K8K B;  4H5R A;  2YJF A;  5JVH L;  4J8F A;  3CC2 N;  2P9K A;  4WQ5 C;  4BR0 A;  4H5W A;  3E66 A;  3MN9 A;  3R6M A;  3EZW A;  4JKB A;  3KK7 A;  1NM1 A;  2P9P A;  1U2V A;  3KVG A;  4MO5 A;  4PL7 A;  3Q7B A;  5C2D A;  4YOY A;  3ENO A;  4YOV A;  3WXI A;  3CJC A;  4U7B A;  3I8B A;  4H0Y B;  2VCP A;  4O5F A;  4H5T A;  5GAE P;  1ZBS A;  4IXC A;  1TUY A;  1C0G A;  4O8K A;  1T44 A;  1Y64 A;  4GNI A;  3UKU A;  4BRM A;  4DB3 A;  2J4R A;  3FLC O;  5AQG A;  1JCG A;  3L0Q A;  2A3Z A;  5KPT A;  2WC9 A;  2E2O A;  2CH6 A;  2QWP A;  4JHD A;  1TYQ B;  4CZG A;  1YI2 N;  4B1U B;  3LM9 A;  4OPH A;  2HF4 A;  1NGB A;  3H6E A;  3OBW A;  4H0V B;  2E2Q A;  4JKD A;  2WFB A;  2YHX A;  4I6M A;  2E2P A;  2ZWH A;  2JWL A;  3E9O A;  3CJB A;  3O80 A;  4XH4 A;  3VGK A;  3I56 N;  5AQN A;  4FL9 A;  4JNE A;  2RHK A;  4FPB A;  4JN4 A;  3HRG A;  1YF5 L;  4QS7 A;  4BRQ A;  4BVP A;  3SAF A;  1BO5 O;  3PIP L;  4L3Q A;  3U8X A;  3B8A X;  2NNW A;  4CJ7 A;  4BRC A;  4WQ5 A;  5BRE A;  4CZH A;  3DLL L;  5AQO A;  2HF3 A;  2NRH A;  3GG4 A;  4WFN L;  1NWK A;  3VEN A;  1LCU A;  2NRT A;  5C0Y A;  3CJ7 A;  3FZK A;  4BG8 A;  1R59 O;  4BRD A;  3FZM A;  4BR7 A;  3U9D A;  5BRD A;  3QML A;  2OAN A;  4GV3 A;  3SBT A;  4CZJ A;  5JIC A;  3CCJ N;  1T6D A;  3CCR N;  3SAH A;  1D4X A;  3C0B A;  3F5T A;  2GEM A;  1NJI O;  4JKE A;  5KPZ A;  4PL8 A;  4GV6 A;  3SK3 A;  1GLD G;  3DWL A;  2F9T A;  1ATS A;  1N8R O;  4FWQ A;  3N4Q A;  2VGM A;  3VGM A;  4YOU A;  5ELZ A;  5AQR A;  5AQS A;  4BR5 A;  5HL7 L;  2E1Y A;  4HWI A;  1Z05 A;  4BY9 C;  2NLX A;  3KWG A;  2HBJ A;  1VQM N;  1S3X A;  3IDH A;  4B1Y B;  4A2A A;  3R8E A;  3O1B A;  4C1N K;  1Q81 O;  1QZ6 A;  3BEX A;  5FPE A;  2F9W A;  4BRF A;  4JKH A;  1QZ5 A;  2DPN A;  1W97 L;  3HI0 A;  1TYQ A;  2Q2R A;  1QQM A;  2FF3 B;  2QXL A;  4WQ4 C;  3VEX A;  3VF4 A;  2A5X A;  1MDU B;  3A0I X;  2BUP A;  4FOE A;  2P9L B;  2CGK A;  4K42 A;  3L6Q A;  5CE3 A;  4DHY A;  2ZJQ L;  5C12 A;  4ILH A;  5DM6 L;  1Q82 O;  1ESV A;  3CER A;  3H3O B;  4GVE A;  3GL1 A;  3VF6 A;  3CCS N;  2QWQ A;  2HOE A;  3MN5 A;  5FPM A;  3SMS A;  1JCF A;  2V7Y A;  3H1V X;  1VQK N;  2E8A A;  3VES A;  3PLA A;  4Z94 A;  4FWN A;  4CD3 A;  1BOT O;  2CH5 A;  1EQY A;  3H1Q A;  3R9P A;  3CJ1 A;  3A5O C;  4A61 A;  4DCH A;  4UY8 O;  2P9U B;  2ZF5 O;  3CF5 L;  4PHT X;  2D0O A;  4ISG A;  5LY3 A;  3FZH A;  1IG8 A;  4BRA A;  1ILY A;  2HBM A;  3O9U A;  3D2F B;  3ENH A;  2PBD A;  3D6R A;  4AF1 A;  2A40 A;  2IIR A;  3CQY A;  4C23 A;  4BC3 A;  1XUP O;  5AQY A;  5BN8 A;  2PFU A;  3HTV A;  3AY9 A;  2GUP A;  3F2K A;  3CME N;  3RSE B;  4B9Q A;  1Q7Y O;  5AQK A;  3MCA B;  3P4I A;  3H3N O;  3FGU A;  4BRK A;  3IUC A;  2GWJ A;  3DXK A;  1KXP A;  4CD1 A;  3OW2 M;  2A41 A;  2KKZ A;  3O5B A;  3U4L A;  1VQL N;  3LDN A;  3KHY A;  4AM6 A;  1BUP A;  2QWM A;  4CZF A;  3W3D A;  4A5B A;  3C7N B;  4IJA A;  4JKC A;  3VER A;  4OPA A;  4IZ9 A;  2GX9 A;  4BRL A;  4CZM A;  1K8A O;  3CC7 N;  4EIA A;  2Q36 A;  5JMV A;  2FSJ A;  5AQV A;  4FWO A;  4A57 A;  2P9L A;  4IO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...