4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
3AA3A 2KFNA 3G6XA 4O55A 5C5JA 1WNEA 1BI4B 3I0SB 3DRSB 3VQQA 4K4ZA 1U04A 3SCXA 5KFYA 1S1WA 1KTQA 4RW6B 1VSHA 4DQQA 4PUOB 4K4YA 1C0UA 3DOKA 1JXBA 4JLHA 4MH8A 3T5HA 3AO1A 3HP6A 5L9XA 1S1XA 3MAQA 2OZMA 4LQ3A 4NCBA 2O4GA 2OPSA 4RW4B 1JXEA 4HKQA 4E7LA 3M8SA 3PJWA 4IDKA 3NBPA 4KRFA 2YKMA 4O3OA 4RW7A 5HP1B 1D0EA 3DYAA 3QNNA 3KD1E 5FRNA 1C1BA 2FBTA 1RTIB 1TGOA 1ZBUA 3HVTA 4DU3A 5KFAA 3TAQA 3AVFA 2YV0X 3TAMB 3M8PB 3SQ0A 3DRPA 1C0TA 3V4IB 3PW0A 3H40A 5KFIA 4NLWA 5I42B 5KT4A 2R2SA 3CFPA 4FJLA 4F2SA 5I3UA 1WSEA 1UA1A 4KAZA 3JYTA 2Z1IA 3HVAA 1LWFA 4ELTA 3TAGA 4O3QA 2XY5A 2C28A 4FK4A 3UIQA 4O4RA 1LV5A 4BDYA 4ECTA 4YMEA 4I7FB 4FJ8A 3K5OA 3D5MA 4Q44A 1RA7A 3SJJA 3K5MA 1VSDA 5KG7A 4DLGA 2WB4A 4MK7A 1S6QA 4FVMA 4CIFA 4CJEA 3FRZA 3TAEA 3DRRA 5EU7A 1IKYA 1QTMA 4FLVA 3SNNA 2WHOA 1QE1B 3V81B 1VSEA 3RRGA 2FLNA 2AX0A 3CDUA 5KG3A 3CDWA 1HARA 1EKEA 4YR0A 2IM3A 1Q8IA 4AHTA 4FM0A 4URSA 4FJ9A 4EZ9A 2FJWA 1T7PA 3BGRA 5J2PA 2J6TA 3ALYA 3HK2A 4NLQA 3HL8A 1IKWB 2F96A 5HBMA 4E89A 4O44B 5KFQA 4R5PA 4W5RA 1GOCA 2AJQA 4O3SA 4CE9A 1SKSA 3VA3A 2HAIA 1RT3A 3AV9A 3TI0A 4B9SA 5F9LA 4KE5A 5KGWA 1TK5A 2YNHA 1ZBFA 4CEQA 1YT3A 1X9SA 3V6HA 2Z1HA 3BQ0A 4QWAA 1RDCA 4C8NA 4DL4A 1A5VA 2FLPA 1S49A 3CJ4A 2XGPA 1RTHA 3A2FA 4Q45A 3KLFB 1C1AA 5KT2A 5JS2A 1QAJA 2YNGA 4DF4A 5EDWA 4YP3A 1JLAB 4WFXA 4J9MA 3NGIA 2W8KA 2HVHA 3ZSOA 2HMIA 1RTDA 4ZP7A 3H4BA 2G8HA 1J5OB 3V6KA 4O3NA 4DTSA 4FK0A 1RTJB 3RMCA 1NJWA 1D5AA 4ELVA 1JLCA 3KLVA 3DLHA 3JSMA 4DFKA 1JX4A 1KRPA 2AGQA 3RBEA 2ILZA 3SZ2A 4F4KA 3RR7A 5JXSA 5DGAA 4Q43A 4N5SA 4KHRA 2XO7A 4KFBB 4DL5A 1NK7A 3SYZA 3K57A 5F8NA 3GV5B 3CM5A 2C2RA 3EPIA 2IOCA 4UQGA 1ASVA 4BE1A 4OLAA 3VQAA 3OL8A 1NKEA 3KHGA 3MEDA 4XPEA 4F8RA 5F9NA 4H4MA 2E9ZA 3CVKA 4OGCA 4MIAA 4RW9B 4MFBA 1JLBB 3U3YA 5DG9A 4U6PA 3NGYA 4CJLA 1S1TA 3SUOA 3MFIA 2LSNA 2YKNB 4CHPA 3PX4A 3V6DA 3UQSA 3Q8QB 2DFHA 1LAVA 1GX5A 2D0AA 3M9OB 4ZP6A 3VN5A 4F4XA 1T94A 3VA0A 5C24B 5DLFA 4JUZA 3V9UA 4I2QB 4DS4A 4E0DA 5FRMA 2RKIB 3OHAA 4ED7A 4CCHA 4NRTA 3MR2A 3LP2A 4ZTJA 3DI6B 4LQ9A 4PQUA 2W9CB 3CJ5A 3CFOA 4YFUA 1KHVA 3KK3B 1KSPA 4NYZA 1S97A 3KK2B 5J2NA 1VRUA 4FJ7A 2IDOA 3ZT1A 3CDEA 4ZP9A 1CXQA 4M3RA 4BWMA 3HT3A 1ZETA 3QEVA 4ECRA 1RYRA 3RTVA 4W5NA 3NF9A 2GIRA 2OH2A 2J6SA 2W9BA 1Q9YA 4DFMA 4WZQA 4ECVA 2VG6B 5KFVA 1HNVB 5K14A 3HJFA 5KFBA 4K4XA 3HP9A 4TY8A 3OL7A 3HYFA 4CHQA 1NKCA 3RMDA 2PYJA 4KHQA 3NF6A 2P1JA 4YR2A 3VQSA 4ECQA 4KTWA 1UWBA 2E9RX 4CJWA 4HHTA 3O4NA 3LZIA 3NF8A 1MU2A 1Z4UA 1J54A 2YNFB 4CGFA 4RNOA 3OYNA 2F8SA 2VG5A 5CZ1A 3TABA 4IH7A 1HYZA 1TQLA 3AO4A 1WN7A 1RT2A 3QIOA 4KHYA 4M95A 3O3GA 4NCGB 4J9OA 2OPPB 1JLFB 1NJXA 1W0HA 1TL3B 4TSXA 4IG3A 4FBUA 5HRPA 4OL8A 2R7YA 2WONA 4IG0B 2ATLA 4FJMA 2DFEA 4HCCA 1RBTA 5CYMA 2RF2B 1SKWA 1Z25A 3FFIA 2IAJB 3WNHA 1VSIA 3NH0A 3SUQA 1JKHA 1N5YB 4PWDA 3I0RA 2HW3A 1RT5A 3UDLA 1RAJA 1TK8A 1FXXA 3N6LA 2XY6A 1NJYA 3I8DA 2ZE2A 4TYAA 2YHBA 3G6YA 1O1WA 5EUHA 1CZ9A 3L3VA 5HROA 3H4DA 4OKKA 1BQNA 5D3GB 4I2PB 4J9RA 3ICLA 1RNHA 5C42A 3OYBA 3K58A 1HPZA 4OKJA 1W25A 1DTQA 3LP1B 4JRQA 1A5WA 4ZVEA 3QIPA 2PYLA 3AVLA 1TAQA 3KJVA 1XWLA 3AVCA 1T03A 4CGHA 4J9LA 4K4TA 4Y3CA 3S3OA 1GOAA 1BQMA 2JEJA 3C6UA 3SPZA 3LAMA 1SH0A 3KLHB 4Y1DA 4O0IA 2HB5A 4WZMA 5CY4A 4KV8B 1S9FA 1WSGA 3LP3A 1T3NA 3DLKB 3ZSWA 2QXFA 1LW0A 1BISA 1HMVA 5KFLA 1RT6A 3UR0A 2V4RA 1LW2A 4B08A 4F2RA 2HNZA 4CK1A 4H4OA 2R8KA 3QLHB 4E1MA 3B6PA 2HHSA 3ITHB 4M42A 4DL6A 4NZ0A 1L3UA 3KLGA 1B9FA 1TV6B 3MEGB 3H2LA 4G1QA 1D8YA 4CGJA 2HHVA 3DLGA 5F8LA 4DL2A 2KQ2A 1XHZA 4B9NA 3BQ2A 4FXDA 4URQU 3KTQA 1R0AA 2BR0A 4DL3A 1S1VB 2JEFA 2R8GA 4CGIA 4CF1A 4F4WA 4BACA 1RA6A 3KIOA 3RWUA 1XR6A 3UPFA 1IKVA 2D5RA 2W7PA 4KKOB 1U4BA 4MKAA 4HUFA 1NK0A 5F8MA 5KFPA 3DMJB 3AVHA 1EETB 5KI6A 5L1LA 4CJRA 3B6OA 2HNDA 4B3OB 4B9LA 2IM2A 3RB3A 3CIZA 1C6VA 2F8TA 3MEEA 2RN2A 1ZTWA 1BIUA 1X9WA 3CWJA 1RDRA 5J1EA 4LSLB 1C0UB 3DOKB 2XHBA 5KFFA 2P5GA 4ICLA 4DSJA 3CYMA 2GIQA 3SI8A 4ID5A 2OPSB 3RB0A 4QWEA 4RW8B 2DTUA 5FDLB 4NLGA 4RUCA 2AGOA 4CFAA 4KO0A 4IDKB 3VQ6A 1TAUA 3DLEA 1EXQA 4RW7B 4ZVGA 4E3SA 1KLMB 4H54A 3ULDA 1N6QA 3DYAB 4HTUA 4ECUA 2X6NA 4CJ3A 1S1UA 5KFNA 1C1BB 5CYQA 4J9KA 2BGGA 5KT6A 4LH5A 2ASJA 3HVTB 1HJRA 1EP4A 1KFSA 4I9LA 1SUQA 3OL6A 4JV2A 1C0TB 1RCHA 4NYFA 3PVXA 3BR9A 4FM2A 5C25A 3E01A 4ZP8A 2BQ3A 4YR3A 1RDBA 3KK1A 3GQCA 1MMLA 1Z26A 4ZMMA 2G8WA 5I3UB 1S9GA 1A5XA 1DLOA 1IKXA 3ASMA 2HHXA 3RAQA 4KAIA 2UVVA 2VG7B 2B5JA 1LAWA 2R2RA 4F4YA 1HYSA 5F8JA 1SV5B 4WE1A 4IKAA 1C1CA 3N6NA 4CJSA 3AVGA 4N56A 3AVMA 3BQ1A 3G0ZA 2DPIA 1VRTA 2FC0A 2XY8A 3EZ5A 1WSFA 1S5JA 3NE6A 4DTNA 3HVWA 3GILA 5KFUA 3DRSA 2Y1JA 1L3VA 3ZT4A 3BSAA 4PUOA 2WK4A 4NLSA 2XGQA 2EC0A 2KW4A 3TWHA 4PY5A 5DMRA 2ITGA 1FK9A 4RW4A 5L1IA 2GC8A 1K6YA 2X74A 1NHUA 1RBRA 1JLGA 1DTTB 1RT4A 1LWCA 4NLYA 2I5JA 4Z4FA 4JV0A 1QHTA 2VWJA 4BWJA 5HP1A 1EX4A 3BGRB 1UOCA 3E51A 5J2PB 1RTIA 2OPQB 5HBMB 4OPKA 3QO9B 4C8KA 1RT3B 4CHNA 3M8PA 4DQSA 4YNQA 3D28A 2UUWA 3KHLA 2YNHB 4NLTA 2V0NA 1S48A 4KHSA 2VA3A 4CK3A 4DTJA 1IH7A 3OYMA 3L3UA 1U09A 2OA8A 2P51A 4IFVA 3Q8SB 4OVLA 1KFDA 2IS3A 3KLIA 4XIUA 1RTHB 1WLJA 4DSIA 2YNGB 5KG0A 2AWZA 5KFEA 5SWMA 1GX6A 5F8GA 4I7FA 1JLQB 4W5QA 2JEGA 2HMIB 1RTDB 2ZD1B 4ECYA 3HO1A 4WXOA 1L3SA 2B6AB 4DU4A 1T05A 4EYIB 1YVFA 2P5OA 1JLCB 1L5UA 4J9PA 2PZSA 4DG1B 3JSMB 3M8QB 4B9TA 4N41A 3T5KA 3NAEA 3P1GA 4JS4A 2Z1GA 1QE1A 1CSJA 5J2MA 4RNMA 3KMQA 3V81A 3NMAA 4TQSA 4G3IA 2JLEA 1IO2A 4FLUA 5HRRA 3KKRA 4AHCA 1G15A 3ZSYA 3OS2A 1KHWA 3GIKA 1XC9A 4OLBA 4K4VA 2RPIA 4CESA 1NHVA 4GVMA 3QEXA 4CJPA 3NH1A 4R8UB 4M3WA 4H8KA 1IKWA 3MEDB 4O44A 1HQUA 4H4MB 4W5OA 3V9WA 4DF8A 3TAFA 4MFBB 3U3GA 1S1TB 4RU9A 4ZPAA 3OLAA 4K50A 3RB6A 3V6DB 4ECSA 5HLFA 1S6PA 5DQHA 4FS2A 3QEPA 1XHXA 1RBUA 3PW2A 4GC6A 3NDKA 2A1RA 4DTXA 1KVBA 1W9HA 1D9FA 3KLFA 3HPHA 2XCPA 5KGXA 4X2BA 3HPGA 3K5NA 4AILC 4CEEA 3NH2A 4K4SA 4WFZA 4B9VA 2BE2A 3LALA 4IRDA 4GMJB 3LP2B 4ED2A 4KHNA 3MXJA 2FJVA 4DWIA 3O4QA 3OYFA 1NJZA 1XR7A 3P83D 3SQ1A 4DTRA 3U6FA 4EYHB 3S3NA 4OKEA 4CJFA 2IC3A 2ASDA 4WFYA 1B92A 2BQRA 1VRUB 4N76A 4ZTFA 1GOBA 3DOLA 3RMAA 4HUGA 2QE5A 1SKRA 1U48A 4KFBA 2XC9A 1BGXT 3TQ1A 3WNGA 3S3MA 4J9NA 2R2TA 3H5YA 1ZYQA 4J2EA 4LSNA 1VSJA 2W9BB 4M3UA 4DFPA 3IGVA 2C22A 2KFZA 1ZTTA 3MECA 3NCIA 3SPYA 5K14B 2XCAA 2ILYA 4E7KA 4B9MA 3QZ8A 2VWKA 1JLEA 1KCFA 2HHQA 4FJNA 4NLPA 3PV8A 4M3XA 1BIZA 3K59A 1UWBB 2QKKA 4CK2A 5J2QB 4ECZA 1LWEB 4HYKA 1L3TA 2W8LA 4QCLA 3SV4A 1S4FA 5F8IA 4K8XA 2FVQA 2VG5B 3DLRA 3BDPA 5KFGA 5KFJA 5C24A 2R8IA 3RBDA 3O3FA 2GBZA 4Z0UA 4W5TA 4ELUA 3KLEA 1S9EA 2YNIB 3PW5A 4WYWA 4BDZA 3KOAA 2X78A 2EHGA 4IG3B 3ZT2A 3QNOA 3DI6A 2IBKA 4J2BA 4L8RB 3FQLA 5T7BA 4FM1A 2IA6A 2UVUA 3OSPA 3OSNA 4ZPBA 3KK3A 3FFIB 4CFCA 2IM0A 1RYSA 3HVRA 4XO0A 5KG4A 4PWDB 4MIBA 3I0RB 3OYHA 5KFMA 1RT5B 4DLEA 3H98A 5EWEA 3QZ7A 3IG1A 1HNIA 2ZE2B 1WAJA 1TVRA 3ISNC 5KT7A 2O4IA 4Y2AA 4DSEA 3GIIA 2XI2A 2FBVA 3PJXA 5C42B 4ZVFA 2DFFA 4I9QA 3PO4A 3HKWA 5KFDA 1TKXB 3Q8RB 5JUMA 2VG6A 2BANB 1FKPA 4CEDA 1DTQB 3BSNA 2UUTA 1VSLA 1J9AA 4DSLA 1HQEA 3WNFA 3QIPB 4KB1A 3KJVB 3AA5X 3OYIA 4K4UA 3L8BA 4DSFA 1D9DA 1BQMB 3C6UB 3CJ2A 4KHUA 4O4GA 4KPYA 4CHZA 1RT1B 1LW0B 3HXMA 4RNFA 4NLDA 2YNFA 3AVAA 1HMVB 1RT6B 3GV8B 4ZHRA 2XRIA 2HNZB 4ED6A 4H4OB 3RAXA 1NK4A 3OVNA 1RBSA 4NCGA 4HCBA 2OPPA 1JLFA 3M9NB 3IS9A 3QIDA 3KLGB 2RDIA 4URGA 3CFRA 3T5JA 4G1QB 1I3AA 3DLGB 3DM2B 1RDDA 3T3FA 4Z4IA 3AVKA 4DQIA 3V6JA 4KSEB 1ASUA 4NLOA 2AQ4A 3AVNA 3VQEA 3SI6A 2JC1A 1QQCA 5KFOA 2OPRA 3AO3A 2IAJA 3FQKA 3BJYA 2WOMB 4DTMA 1IKVB 2QV6A 3TR8A 3ZSXA 3H08A 4RG8A 4C8OA 1X1PA 4DQRA 5JS1A 1KVCA 1FKOB 5DG8A 3QINA 2HNYA 3OHBA 1TP7A 3OYAA 4CEZA 1S0NA 1C0MA 3F73A 3NHGA 3C95A 3C6TA 2EX3A 3MEEB 5KFZA 3IRXB 3LDSA 2XY7A 2R8HA 4NYNA 3KKSA 4FLWA 3AA2A 4Q0BA 3AVJA 3BSCA 2FVSA 2C2DA 1REVA 1ZBIA 4TN2A 3MR3A 3LP1A 2JGUA 2QK9A 4O3RA 3ZT0A 3PUFA 3OYGA 1NK8A 2NUBA 4M41A 3VQ9A 4M3YA 4KO0B 4TXSA 3PX0A 3PW7A 3TVKA 1BCOA 4RNNA 3PY8A 3DLEB 5F8HA 3I5BA 4NRUA 3PW4A 4O0JA 4FW2A 3TANA 3FSIA 2I1RA 4CJVA 3GYNA 3NGZA 1I39A 2G8VA 1S1UB 5CYQB 2IJNA 4F3TA 5DQIA 3LANA 1S1WB 1RT7A 3EPGA 3L2WA 4AHRA 3AA4A 2D0BA 3CJ3A 3H5SA 1EP4B 1SUQB 3OJUA 1S1XB 3QLHA 4CJ5A 5KFWA 2J6UA 3LP0A 3ITHA 4DEZA 3BSOA 5KG1A 5C25B 3E01B 1TV6A 1OS5A 3G6VA 3V9XA 3K2PA 3KK1B 4N47A 3NBPB 1S9GB 2IMWP 3LAKA 2YKMB 3RB4A 2UVRA 5HRNA 2GUIA 2B5JB 1S1VA 4BE2A 2D3UA 2F8EX 2V4QA 3OYLA 5KTQA 1HYSB 2HWHA 4QPXA 4DS5A 1TKTA 3S9HA 1UAXA 1C1CB 4M94A 3L2VA 4IFYA 3IAYA 4WXWA 3CG7A 4BDPA 4EBCA 2E4LA 5EWFA 3OS0A 1EETA 3DRPB 1SH3A 4J9QA 4B3OA 1TL1A 4BE0A 1VRTB 3V9ZA 4OGEA 2AGPA 4Z4EA 4E7HA 5DG7A 3JYTB 4LSLA 4J2AA 3FDSA 1LWFB 1TKZA 4IOBA 4EBDA 1N56A 3GV7B 3MXMA 4DMNA 1FK9B 3N6MA 2O5DA 4RW8A 2D7SA 5FDLA 1JLGB 4F50A 3GIJA 1RT4B 1LWCB 4AHUA 4CJKA 1T8EA 2I5JB 5KG2A 4E19A 5CZ2A 5T14A 2XWYA 3SQ2A 1KLMA 1S6QB 4O5BA 1IG9A 2E9TA 2KZZA 1BI4A 4CF8A 2V9WA 4JS5A 3I0SA 3DRRB 2G8KA 4FJGA 2ETJA 4RW6A 1NOZA 1IKYB 4B8AB 5KFCA 1NK5A 1HYVA 4CGDA 4CEAA 3M8RA 1SL1A 1BL3A 3QGGA 4CF0A 4KB7A 3AVBA 4DQPA 2HHTA 3NAIA 4IFVB 4NLVA 4Q8FA 3KLIB 3QYYA 2VG7A 1S0OA 4FLZA 3ZT3A 1ZBLA 1SV5A 2FJXA 4R5PB 4Z4HA 1CLQA 1VSMA 1NOYA 4EO6A 3LPTA 4JRPA 3OYKA 3TAMA 1T05B 2G8UA 3V4IA 2FLLA 4EP5A 4NLUA 4EBEA 2YHAA 5I42A 1RDAA 4K8ZA 1CXUA 1JIHA 1C2PA 5KFSA 3O3HA 1D1UA 4CGGA 3QGHA 4CEFA 3HPOA 4ED1A 5J2MB 1NK9A 3QEIA 4CJTA 2PY5A 4B9UA 2ZKUA 3CJ0A 5KT5A 4IBNA 1WSJA 4IR9A 1DTTA 2KZMA 3K5LA 3NKYA 5KRTA 4ZPCA 1SL0A 4B8CA 3OL9A 4KTQA 1HRHA 1B9DA 3SQ4A 4Y34A 2OPQA 1HQUB 4CHOA 3QO9A 3LPUA 5EWGA 1N4LA 1WAFA 4AH9A 4MQ3A 5HLFB 3DDKA 4PA1A 3ZSVA 1S6PB 2W42A 4GC7A 1QSSA 5KFKA 3QGIA 2IJFA 2BQUA 4EP4A 3G86A 2G8FA 2ASLA 3RRHA 3OS1A 3I5AA 2AX1A 3PX6A 4OJRA 2Z1JA 4CF9A 2E6LA 4U7CA 4R0EA 1JLQA 3OYCA 4E1NA 2ZD1A 2E6MA 2BE2B 4FJKA 4LD0A 2B6AA 4KREA 4CIEA 2BRKA 3H5XA 2Q3SA 4FS1A 4QWDA 4XPCA 2DY4A 2CJQA 4CHYA 4IH6A 4DG1A 3OLBA 2IC3B 3M8QA 3RR8A 4ZPDA 4FW1A 2HHWA 4FJHA 3TAPA 1UA0A 3C94A 4MK9A 4K4WA 3VQBA 3DOLB 2UVWA 2ATQA 3KD5E 1JLAA 4TY9A 3H59A 4CEBA 3HSTB 3BREA 3OYDA 4QW8A 4RUAA 5HRSA 4DU1A 4LSNB 1QAIA 4CECA 1J53A 3L2UA 1J5OA 4PQUB 3MECB 1RTJA 3MR5A 4Y1CA 4ED8A 4ECXA 2AU0A 1Y97A 4R8UA 1TK0A 1JLEB 1JL2A 1NKBA 4IH5A 4FZZA 1S10A 4E7JA 4KTZA 3V1OA 5J2NB 3P5JA 4DL7A 1VSKA 2XI3A 1X9MA 4FK2A 4FZXC 4FZYA 3H5UA 1F21A 4ZVHA 1BCMA 5KFTA 4OPJA 4ED3A 3GIMA 4M45A 1TKDA 4KI4A 5KRSA 4IQXA 4M3TA 4NCAA 4QOZB 2G8IA 4QWBA 3PR5B 4FJIA 1JXLA 3KLEB 1S9EB 5L1KA 2WCXA 2IGIA 3M9MB 3L2QA 4TY8B 4DTOA 4M3ZA 4ED0A 3EY1A 4KBIA 4RW9A 2CKWA 1S0MA 1JLBA 5KFRA 3EYZA 3I5CA 4RNHA 2YKNA 2QKBA 4J2DA 4DSKA 1YTAA 4C8LA 3NF7A 1NK6A 1VK0A 3SV3A 1QSLA 1MU2B 4F4ZA 3AO5A 5E41A 5KG5A 1XR5A 4Q5VA 4AHVA 4ID1A 3ZSRA 1RT2B 3VQ7A 3IG1B 1HNIB 4I2QA 1TVRB 1WSHA 3NAHA 1Q9XA 2JC0A 2FVCA 3D0PA 1ASWA 2RKIA 3VQ4A 1U49A 5FROA 5KG6A 3PR4A 5KFXA 2FVPA 2WONB 2VA2A 4EZ6A 5SZTA 4FLTA 4CERA 1FKPB 2BDPA 5CYMB 2W9CA 3MF5A 2OYQA 4IR1A 1HQEB 3NL0A 2ZQBA 3MFHA 4WYLA 3RMBA 3ZCMA 2OZSA 1JKHB 3T19A 4TYBA 3KK2A 2D41A 3VQCA 4AHSA 4O4GB 1YTUA 5J2QA 4FJJA 1LWEA 4FBTA 3IGNA 4CF2A 5HROB 3HHKA 1BQNB 4QAGA 4HUEA 4ZHRB 4JV1A 1HPZB 1HNVA 2YNIA 3MXIA 3IS9B 2RDJA 3L2RA 3NGDA 1T03B 5DLGA 3V1QA 3LZJA 3QETA 4NLXA 3AO2A 3KHRA 2HHUA 5DQGA 4CIGA 4MKBA 5DGBA 4KB0A 4CFBA 1QSYA 2B43A 2OPRB 2W9AA 3SFGA 2FBYA 3VQDA 3ZSQA 4DTPA 4EEYA 1K1QA 4FYDA 1LW2B 4IRKA 1JL1A 4CJ4A 3LWMA 4CEOA 4F3OA 4KI6A 2HNYB 3PO5A 4KHMA 4DTUA 3C6TB 4NLRA 3T1AA 4QWCA 1TL3A 3ZSZA 3D45A 2X6SA 4Q0BB 2JEIA 3VQPA 4YQWA 4Z4CA 4IG0A 1REVB 1R0AB 1TKXA 2D0CA 2BANA 2RF2A 1N48A 4FJ5A 2DPJA 4CJQA 4ECWA 2ALZA 1KVAA 1N5YA 1SH2A 1WNSA 3OY9A 4FJXA 2IM1A 3SUNA 4LH4A 4CFDA 3CQ8A 4FLXA 2HNDB 1RBVA 2GV9A 3V1RA 1QS4A 1RT1A 2B4JA 3KMSA 2W7OA 1QUVA 2FVRA 4Y2CA 1RT7B 5D3GA 5J1EB 3CO9A 4I2PA 1XI1A 5KT3A 3LWLA 5KFHA 4E7IA 1U47A 3F9KA 3QEWA 4FLYA 1YVUA 4ICLB 3VQ5A 3QERA 4O3PA 2WRMA 3EZUA 4J9SA 3T5LA 2C2EA 2Y1IA 4KHWA 3CM6A 3LP0B 5L1JA 3HM9A 4IKFA 3MTKA 4ID5B 2D3ZA 3Q8PB 2FBXA 3NFAA 4QW9A 3ISND 4LY7A 3DM2A 3PZPA 4C8MA 1U45A 4DFJA 1I6JA 3KLHA 3TARA 3SUPA 2HWIA 1N6QB 4KV8A 1RILA 3DLKA 2KTQA 1VSFA 1NNDA 4HVJA 4FCYA 1SL2A 1TKTB 2HVIA 3AVIA 3PHEA 2WTFA 4Z4GA 2WOMA 4IFYB 1IM4A 1WSIA 1ZBHA 3OJSA 1FKOA 2A1SA 3KHHA 1TL1B 4TQRA 4TLRA 3V9SA 3MEGA 3IRXA 1BHLA 3DLBA 3OYJA 1DLOB 3WNEA 3MR6A 1IKXB 4Q8EA 4GW6A 1TKZB 4EO8A 3VQ8A 3OYEA 1KLNA 4RZRA 5DK5A 4IRCA 3QESA 3KNAA 3THVA 2BRLA 3G10A 3SFUA 4WE1B 2R2UA 1ITGA 1K1SA 3IN5A 1CZBA 4KKOA 4CJUA 4MK8A 3DMJA 2R8JA
chains in the Genus database with same CATH superfamily
3AA3A 5ETVA 3G6XA 2CXEA 4O55A 1WNEA 1JJCB 5AQXA 3VQTA 2K06A 4PXBA 3DRSB 3IC1A 2D74B 5KFYA 1KTQA 4JK8A 1JXBA 2E1RA 3AO1A 2JVRA 3O1WA 3VALA 1IBMF 3MMCB 4OZJA 5E0OA 1OVQA 2UXCJ 3M8SA 1RHUB 2QYGA 3FUYA 1SJ1A 2YJEA 3NEKA 4M63A 1KN6A 2J7UA 3CXCR 1JK9B 4LMZA 3PYGA 4LF5F 4NPOA 2IVYA 1KQFB 4QU7A 1RTIB 3DLLL 2YPYA 4B02A 4JI8J 3TAQA 3TAMB 3M8PB 3SQ0A 1HX1A 4F0HA 4A46A 3PW0A 1HNZJ 5KFIA 4NLWA 3BEGB 4Q7AA 3MWTA 3SQOP 3SMPA 3MR7A 4ZIVA 2R2SA 4AFFA 2LEAA 3R5GA 2VASA 1S77D 4FJLA 1WSEA 3OFFA 1G3OA 3EDRB 3UW1A 2XY5A 2C28A 2Q31A 4FK4A 4N7TA 4ANCA 5IV4A 4YY3K 4BDYA 3FKBA 2YHWA 2VFVA 4JKGA 1U0HA 4JI1F 5CA5A 3K5OA 1SPBP 4DX7A 4PXEA 1RA7A 3W63A 1N34J 4MK7A 4CJEA 3T1YK 4Y65A 3TAEA 3A1YG 2VB6A 1IKYA 2JRSA 1Q7YT 2POKA 2GGPA 1AXQA 1SJRA 3FE1A 1VSEA 3D0IE 3RVCA 1U2VA 4V19X 1H0HB 2AX0A 3CDUA 3CDWA 2EKYA 3CD6N 1HWLA 2IM3A 1Z6RA 3PSFA 1OMSA 1FW6A 1Q8IA 1U6ZA 4AHTA 4FM0A 2DGVA 4URSA 4IXCA 2C3OA 3ALYA 3QT7A 4U96A 3HK2A 4B3SF 4ZVOB 4AE5A 2MSSA 3CPWM 4E89A 4HEA9 4R5PA 4YOXA 4CE9A 1MWKA 2NRRA 3T6JA 1RT3A 4M5GA 2BTFA 1I5OB 3KZBA 4FVUA 2LEBA 5F9LA 4CEQA 3Q0AA 4C2MA 1Y4ZB 3CJTA 4DL4A 4NOHA 2FLPA 1S49A 4M5DA 1MW7A 4DF4A 4A8XA 1F2HA 1JLAB 2W8KA 2HVHA 4EHUA 4PQAA 4ZP7A 3W2WA 4DR1F 3R1LA 2M0GB 1RTJB 2IHR1 1KP6A 4ELVA 1JLCA 1TTHB 2N4DA 3KLVA 1QQMA 2JLFA 1CQNA 1KRPA 2MKSA 2AYGA 4MDBA 5DGAA 3SDEB 4N5SA 1X3MA 4KHRA 5LMNK 4QYZK 3FZBA 4DL5A 3BGUA 3WQPA 3QSYB 4H5VA 3VESA 4WP8A 2E1CA 3CM5A 2P9SA 2IOCA 5E2QA 1ASVA 3J7YU 4GY2B 4JV5J 3CCZA 2D3O1 2J9DE 2B4PA 1FRHA 4MIAA 5ETKA 1VIXA 3W64A 1YTYA 4RW9B 1PJ7A 4U8VA 3NGYA 2HEKA 3LM2A 2LSNA 1GMUA 4RCHA 3ZNJ1 2W4PA 3CJQA 4ZP6A 3JQMA 3H2UB 3AARA 4UOCA 3UNGC 4F4XA 3VA0A 3UD3P 1SIWB 5DLFA 5IT0A 4JKDA 3GJQB 2K8GA 3M1VB 4E0DA 1N0VC 3G87A 3KJFB 3M7VA 3OHAA 3GPAA 2Q0UA 3UKUA 5KQ8A 1H7XA 4Z7CA 3DI6B 4LF4J 3CMAN 4PQUA 4JI4F 1KHVA 3UKRA 1FX4A 3BEXA 4NXMJ 5IZHA 2KU7A 4USKA 2YTCA 4DV3K 3MX2A 4FJ7A 3NS6A 2O8EB 3ZT1A 3K5PA 4BWMA 2A10A 1ZETA 4LF6K 4FWSA 2GFFA 2CPFA 2YWHA 2GIRA 3C2PA 2W9BA 2H5IB 3ZO7A 1O51A 4WZQA 2IDLA 3HP9A 5LOQA 5ETSA 4NB4A 3HYFA 3RMDA 2PYJA 3NF6A 2P1JA 3KJNB 3DLJA 4ECQA 4FF1A 2L41A 1UWBA 2PO4A 1B0VA 3A4TA 1Y3JA 3BO4A 3LZIA 3JXUA 1J54A 2YNFB 3FEXB 1ATNA 2F8SA 4IH7A 3MM5A 1B7FA 1RT2A 4UOFA 4IOCQ 5D4NA 4ETXA 4E1JA 1RZMA 2ATCB 2OPPB 1JLFB 3ZTRA 3Q86A 3FZKA 1WOPA 2OMOA 2P6TA 1SVDA 1TL3B 3V4MA 4AL5A 1KVKA 1H38A 4UT4A 2R7YA 2OTLN 1FE4A 4I1TA 1SJ3P 2Y0BB 3WBZA 1RBTA 5CYMA 1Z25A 4CDIA 3MI7X 3RYLA 4WCEQ 4PWDA 2Q97A 2C1EB 1TK8A 3M2RA 3N6LA 2XY6A 2ZE2A 4DOZA 5AJ3J 1NZ8A 5HROA 4BVPA 1BQNA 3VEOA 2VQEK 3D6FB 2QJ3A 2K3IA 1P8ZA 4EU0A 4K7QA 3U9ZA 3QQCD 4IOAL 1HPZA 4OKJA 1Y5NB 3VTIA 5F3ZA 3QIPA 4GRSA 1XWLA 1O13A 1IV0A 4J9LA 3CCUS 2V8GA 1S57A 2W24A 4DV6K 3M30A 2HB5A 2XMUA 2Z8QA 2CVEA 3FRYA 3DLKB 3HT0A 2NS1B 1LXNA 3IWXA 3R7NB 4B08A 4CK1A 2HIQA 3QLHB 2W7AA 3B6PA 3H20A 3ITHB 1E6VA 4DL6A 4NZ0A 3KLGA 1UP1A 1B9FA 4F4AA 1IWAA 4G1QA 4Q2MA 2HHVA 3VF0B 3NWGA 2KQ2A 1XHZA 2F3JA 3BQ2A 2NXNA 3H42A 3KTQA 2BE7D 1R0AA 5M1PA 1IVZA 2JEFA 4ZCLA 1U1QA 5GIPA 3RWUA 3O80A 1IKVA 1AUSL 2D5RA 4KKOB 2W7PA 4DPWA 2M70A 5KFPA 1O6XA 2QLJB 4AQYF 1EETB 1IG8A 4L76A 2A6OA 4OYAA 2NXEA 3RB3A 1M5SA 2F9TA 4IJNA 3MEEA 1BIUA 1X9WA 4X4RA 1RDRA 1UW4A 5J1EA 1C0UB 2XHBA 4UY8T 4ICLA 4JKBA 2RAQA 3D1QA 3CYMA 4ID5A 3RB0A 2DTUA 2AGOA 1Y9OA 1K8KB 2OP5A 3LL3A 2MY8A 4LRDA 4RW7B 4QPTA 3ULDA 3OTOJ 3ZZYA 5F3TA 4AYBD 4YB6A 4CJ3A 1C1BB 5CYQA 2DB1A 3NNHA 2DGTA 1RXOB 2RRAA 5M2PA 3A3PB 3HVTB 1HJRA 3OHRA 3OL6A 3G4SS 4PXCA 2HBYB 2SXLA 3M05A 4BROA 4ZP8A 4YR3A 5KPZA 3KK1A 1HNXJ 1MMLA 5D15A 5I3UB 2V8VA 1A5XA 4CBUA 2HHXA 1SZ2A 2DRDA 3BF3A 1RCXB 4N8OA 3VAHA 3K17A 4DUTA 2LQ8A 1R0CB 2HRTA 2J76E 1SV5B 2LP4A 4IKAA 1C1CA 4LIRA 4ES1A 1DQ9A 3CTRA 3U9DA 4YS2A 3AVMA 3BQ1A 3G71N 2CJ9A 1MWQA 4BR7A 3HZGA 2DNNA 2WSEC 1NSQA 3MMBB 3THXA 2FC0A 1S5JA 5KFUA 4K59A 4JI5J 5AQNA 3BSAA 2MTLA 4PUOA 2UXBJ 5M2RA 2KW4A 2CJXB 2XZDB 3ZNUA 5IM0B 4WK1A 3I9ZA 5DMRA 4WFNL 3ZZRA 2X74A 3I82A 1LWCA 5G4DA 2I5JA 4Z4FA 4B3RJ 2PEHA 2R42A 2G1DA 1UOCA 3BGRB 3E51A 5J2PB 2R4FA 1GXLA 2FYXA 5GMEA 2MZRA 2MKKA 2V67A 2OPQB 5B0FA 3B8AX 2MZSA 3GZ7A 3R1HA 3BBFA 1R8PA 4JAXA 4C8KA 4CHNA 1BXNA 4YNQA 2UUWA 4LF8K 2YNHB 4B1YB 1S48A 1KQKA 5JMNA 4JKAA 3B78A 4CK3A 2M8DB 4BRNA 1IH7A 2GMLA 1ZAXA 1MWMA 4QIVA 1KFDA 4C4WA 4R25A 2DXFA 4XIUA 1RTHB 2K7JA 4DSIA 2YNGB 5AXNA 2Y1RI 2AWZA 3DLLQ 5SWMA 3G82B 5F8GA 1WB9A 4I7FA 2JEGA 2ZD1B 3HO1A 4JI0F 1PAUB 1T05A 1VLYA 1BA0A 2VBZA 1YVFA 5CD4H 1JNZB 1L5UA 5ELZA 4B9TA 3NAEA 3AY9A 1U0SA 2NZCA 1QE1A 1CSJA 5B0CA 1CLFA 1P9QC 4G3IA 4FOEA 3VHQA 2NRVA 2HBMA 3GR1A 4DPYA 1VLOA 4A57A 3SSQA 2VPXB 3EVOA 4KHPF 1A9NB 3WXKA 2J8AA 3SCLE 3IMQJ 1NHVA 4ZLJA 1XNRF 3VGTA 3QEXA 4CJPA 3NH1A 2F9DA 3CQXA 1ZM4A 4H8KA 3MEDB 1EB0A 3BPSP 4HH1A 1IR2A 1P9YA 3BKTA 1YJ9N 3HZ6A 3OLAA 5E3AA 2I2YA 2ZH6A 2QM1A 2XLJA 2D0OA 3P6YC 4LRBA 3UDCA 1UKUA 4HWIA 4FS2A 3UCUP 3QEPA 1XHXA 1M90T 2QWNA 3BB5A 1HIYA 2Z56B 3TUPA 1UJ4A 1W9HA 3BBBA 2GCFA 3HPHA 2XCPA 4IWVA 1ZXOA 3NMUA 4Z94A 4B9VA 3LALA 2PC6A 4GMJB 3LP2B 5AQQA 3MXJA 2FJVA 3KYLA 3ZETA 1YIJN 2Y9HA 1P27B 2QMXA 4BR5A 5AQRA 1N32J 1NDKA 5GAGU 3F41A 4EYHB 4FWNA 4DR7K 2IC3A 2ASDA 4WFYA 2AEMA 2I7PA 4H0YB 4N76A 2MZ1A 3EVMA 3DOLA 1U48A 2NXJA 4CQ1A 1CJKA 3FFKB 3S3MA 3CGIA 1EHWA 2R2TA 1SAZA 2HMPA 4MTPA 3U1MA 4M3UA 4DFPA 1AYEA 3O1LA 3EVWA 1ZTTA 4P7VA 3MECA 3CMQA 2K3KA 3OD2A 2DGXA 3SPYA 2H51B 1VJQA 2XCAA 2ILYA 3I9V9 3QZ8A 2VWKA 2NRTA 1MG7A 4UUWA 1F1BB 4M3XA 3FZFA 3IO1A 1BIZA 1VQ7S 2GVZA 3HKZD 1W2BM 2A18A 3SV4A 3QBWA 2F4VK 2CPYA 1S4FA 2JWLA 1UVNA 4K8XA 1V3ZA 4CZIA 4ZJOA 5KFGA 5LSOA 3IBFB 2R8IA 3RBDA 2YNIB 2MKYA 3A8EA 3ET6A 1WSRA 2CNLB 4AL7A 2JWKA 3M2VA 1RAGB 4IG3B 4J2BA 5F0UA 2RUSA 4PKGA 4DR3K 4K42A 3UCZP 1WF1A 3QT5A 3KK3A 1M1GA 1S7IA 5L8RC 2ADCA 2ITMA 4C1NI 1P90A 4IYQA 4CFCA 5KPRA 1VDHA 2JWNA 5KFMA 1RT5B 1WKLA 1K47A 3OVAA 3J7ZT 3GB0A 3H98A 3IG1A 3CB4A 4BS2A 1V5IB 4KRWA 1M5KC 4PZVA 4MJKA 1ATRA 2HVDA 1R6YA 3PJXA 4ZVFA 3NMRA 2YPZA 2B7CB 2UUBJ 3HKWA 2BZ2A 1FKPA 4H4KA 3AGRA 4CEDA 1VSLA 4B3MK 4DSLA 2YX6A 4KB1A 4A8FA 1D9DA 2RS8A 2DEJA 5CCMA 3C6UB 4KHUA 2MGZA 2LDIA 1IBLK 5AR0A 2CQ3A 4RNFA 1HMVB 2UYTA 2Q43A 2HNZB 4C11B 3HSZA 3OVSA 2DXDA 4X4SA 4DR6K 4TLQA 3IWNC 4NCGA 3BGLA 4HCBA 2ZKTA 3QIDA 3GTYX 3T5JA 1HKBA 4MMOA 2ASOA 1RDDA 4G1IA 1YZ7A 3MGJA 2W2NP 2CNKB 3BR8A 4LSZB 3V6JA 4CZHA 3CJKA 1RTZA 4BRIA 4C0OC 2VONA 3VQEA 2GWJA 1QQCA 5KFOA 3R7BB 2AMCB 2IAJA 4WQ5C 5EGYA 3Q7CA 4DTMA 2M9KA 3JTNA 3H08A 3MPDA 4RG8A 3VTHA 1X9JA 2AEFA 1KVCA 1FKOB 1E6YA 1HNWK 1TP7A 5BR8F 3Q7BA 3OYAA 2D69A 3I56S 2EX3A 3ZZZA 3PM9A 4UUXA 3KKSA 4CLTA 3AA2A 4OX9J 1RAOA 4CT8A 4DPXA 2C2DA 1REVA 2E5JA 5HVGA 1VQ6N 1TL7A 2JGUA 4FKYA 3MTJA 2YH0A 4J5OA 4X65F 3PUFA 3VQ9A 4M3YA 4DV1J 3D6TB 3PW7A 1CC7A 5F8HA 2H3GX 5M1NA 4NRUA 4IOXA 3PW4A 3O2IA 4O0JA 4DUYF 4MKVA 3TANA 3I55N 3QBXA 2IBOA 3GYNA 3NGZA 3HMJG 3M6VA 1S1UB 2KL8A 5IFMA 5DQIA 5HJYA 5A2QY 2MQPA 3CJ3A 1PILA 4IOAQ 3H5SA 1YBUA 3UVJA 2YHXA 5IQ6A 2QA4G 4NO7A 3BSOA 2V6AA 4WTYA 5DS7A 1PCAA 4ISGA 4BCAA 4N47A 1S9GB 4B3TK 2ROPA 3RB4A 4NYOA 3I4PA 5HRNA 3W3DA 2D3UA 4ZVTB 3OYLA 1F3FA 2HWHA 4QPXA 5LMUF 4IFYA 3I6PA 4G6VB 1VC6A 3CG7A 4NXNF 4EBCA 5GMDA 3FJ2A 2VQFF 1IBMJ 3GG0A 5DJBA 3TJAA 3NCQA 2G9OA 4OHWA 4BE0A 1VRTB 2LYVA 3HFZB 2NUUG 1VQMS 3ZTOA 3M1FA 2AGPA 4Z4EA 4OYWA 1T9XA 4XH5A 4CZFA 1NGBA 3MZIA 1WUAA 3CCRN 4LSLA 4J2AA 3FDSA 4IOBA 4LF5J 2YKQA 1M5OC 2R7VA 3R7SB 3MXMA 2CGLA 2DNYA 3N6MA 2O5DA 4RW8A 4JKGB 5FDLA 3D9BA 4H0TB 2A6MA 1M5VC 1T8EA 2K1RA 2NXUA 3MCAB 3FBBA 3PSIA 1NGFA 3FCHA 2ZOFA 3SQ2A 2CQGA 3DGVA 3MWBA 4KH6A 2KZZA 1V5VA 2V9WA 4C3KA 1YJNS 1JCFA 1IKYB 4B8AB 2J8SA 4V19S 3NVMA 1BL3A 4JI1J 4YHHF 4BC3A 3MCPA 2BJEA 1HW9A 2AEJA 1JB0C 2E1PA 2NYHA 2ZHOA 1B0TA 4YOEA 1KC8T 4CO2A 5FPEA 1F60B 1N33K 3CIMA 2E5LJ 1HWKA 4NLVA 2IVFB 4Q8FA 4ALZA 3O9RA 3BGFA 2HZVA 3QYYA 1S0OA 4DB3A 4R5PB 4W90B 1SIZA 4DV0K 5ITHA 1M1KO 3K7RA 3EKUA 4GMKA 4EP5A 3PEHA 2OEJA 1RDAA 2UXDK 3W7BA 1RWUA 2I9SA 1W7WA 3QGHA 4DV5F 5DDRC 5K8MA 3HPOA 3DXKB 1K73T 5J2MB 1Y7PA 4B3SJ 4QU6A 5D0GA 1G99A 2PY5A 2A40A 3FR0A 1CJVA 4RUBA 4PL7A 4F3MA 1WSJA 1H2TZ 3W2WB 2RQCA 3H6EA 3H45C 1SL0A 2HZAA 5DDOC 2ZZMA 3A8KA 3OL9A 2HF4A 1HRHA 1VI7A 3O8MA 5DM7L 4X66F 3SIPB 4CHOA 1RABB 4BR4A 2DNRA 2LMIA 3LPUA 5EWGA 3CCMS 4WFNQ 4CLYA 2R7OA 3WT0A 4DR1J 3QGIA 3G86A 2G8FA 1BWVA 1ZBTA 4LT6A 3I5AA 2AX1A 1GAOA 4DN0A 2C3UA 4L3NA 3KWGA 4FO0A 2O8FA 1HD1A 4OZ1A 1A7GE 5H9EK 3W5XA 3FMBA 3UE5A 1XNQJ 2BE2B 4CD1A 3D6HB 4LD0A 2B6AA 2CJQA 3DOMB 3AJ2A 2CJBA 4ZPDA 1EJ7L 1NBWA 4F0KA 1TUWA 3EZOA 4MK9A 3KD5E 1LQ9A 3HOTA 4TY9A 5H9FJ 3H59A 5IT9U 2BACA 2BVZA 1X5SA 4RUAA 3UKUB 3T6BA 3CCES 1QAIA 2Q6BA 3C16A 2HIYA 2XMWA 3L2UA 1HKAA 1J5OA 4KGZB 4PQUB 3OTBA 2EW9A 2FZKB 2KFYA 3V1OA 1SQGA 5ADXH 5AQSA 3P5JA 4ZJQA 2XI3A 1X9MA 2EFQA 2ZJPL 4FZYA 3H5UA 3KG0A 2ZM6K 4X4QA 1TUGB 3TA0A 3EXCX 4FXWA 1G1XA 1NH8A 1N5VA 5F1XA 2GA7A 2PA8D 3BUZB 4M3TA 4NCAA 1YI2N 4WK3A 1OY8A 4JI4J 8ATCB 5L1KA 2PAVA 4DR5K 2IGIA 5BRHA 4DTOA 4HTLA 2V2ZA 4M3ZA 2V69A 4ED0A 3EL2A 3EY1A 1T11A 2CKWA 1S0MA 3J7ZO 1UVIA 3L9ZA 3O6QA 3I5CA 3S8SA 5JLFA 1UFKA 4JB8B 4TU7A 5EOYA 4DSKA 3A0IX 3NF7A 3CF5L 3SV3A 5HL7L 3EGWB 4WBFA 2DNHA 5KG5A 1UL3A 2BJ7A 4Q5VA 3MM5B 1RT2B 4RL1A 3VF2A 2J4RA 1HNIB 4I2QA 1R27B 1TVRB 3R5DA 3AJ1A 1WSHA 4OI0A 2KN4A 1Q1KA 1ASWA 3MN6A 1XQSC 1NPKA 2RKIA 5B0AA 5FROA 5CHCB 2OANA 5LMNF 1FKAF 3K9JA 4EZ6A 2HQ3A 3PYDA 2KKHA 4CYUA 5CYMB 4ED5A 2ZGZA 5BPNA 1N52B 2OYQA 3CCWA 1HQEB 4IR1A 2XULA 3SMZA 4N77A 3M2RB 2GMJA 3VQCA 3HTVA 1V9OA 3WEEA 1YTUA 4MO5A 5J2QA 4Y0WA 4WFAL 5IC4B 4FBTA 3IGNA 2RRBA 4L75A 5HROB 1Q79A 1BQNB 2HQIA 2BBEA 1WORA 5ETRA 4EK2A 4RPFA 3MOJB 4HUEA 4ZHRB 2DGWA 4JV1A 2C2ZB 1HPZB 3OTDA 3ENWA 1NZAA 3FBCA 2RJZA 3IS9B 2PI5A 3IBCB 3LGNA 2X3GA 4P74A 3L3CA 3PYEA 4AXIA 4ZLNA 4DV7F 2VOPA 4YB5A 2BH1A 3M30B 1OVYA 5DGBA 3PNIA 3DXSX 2HPUA 3CCSS 2V51B 4DTPA 2VCPA 1K1QA 4DCHA 4FYDA 4IRKA 1HLWA 3MPVA 2CQ1A 4CI0B 4F3OA 3CCVN 2HNYB 2V50A 3PO5A 2WVEA 4KHMA 4P72A 2BM0A 1VQ4S 3C6TB 4NLRA 2HS0A 3D45A 2X6SA 1UCNA 1SC6A 1R59O 3UN2A 1R0AB 1TKXA 2RF2A 3TO8A 2ROGA 3NNAA 3CCLN 1IR0A 4ECWA 2ALZA 1RJJA 3HULA 1N5YA 2IYIA 3OY9A 5GAEU 3PIOQ 4LH4A 1U2CA 1FXLA 3CQ8A 4FLXA 1SBRA 1QS4A 3VAFA 2V5HG 2HRUA 1RT1A 2B4JA 2X1FA 1QUVA 4Y2CA 5J1EB 4DUZJ 3LWLA 1RQ0A 1U47A 4FLYA 2UXCK 4ICLB 3QERA 4O3PA 3MM6A 3R2CJ 2ACMA 4ID5B 4KGXB 1Q86T 4MO4A 3NFAA 3ENVA 1DARA 3QT6A 3VAMA 3ISND 4AQYJ 3OT9A 3WXJA 1I6JA 2Q1LA 1QDUB 1X4HA 4WQ4A 3QWUA 5FIIA 4ZPVR 4JI8K 1QY7A 2F63A 1WOOA 4FCYA 5FPMA 1SL2A 1TKTB 1HI1A 1NAQA 3Q23A 3MMAA 2WOMA 2GX9A 4D3HA 1HNZK 1IBKJ 3C7NB 2MLZA 3WXIA 1KONA 4QBUA 5CYJA 4AL6A 2AA4A 5IXUA 4JKEA 1RAFB 3WNEA 2C2MB 3MCSA 4MDAA 1TKZB 2H4WB 3UE2A 3OYEA 4CM2A 2QWMA 1KLNA 4RZRA 2EK1A 1VQ9S 3EJMA 2VQEF 5ADXA 3THVA 1XQIA 1FTCA 2BRLA 3G10A 2KG0A 1N34K 2N4CA 2ZHBA 2CPJA 3IN5A 4QQBA 4Y6IA 2R8JA 4NLCA 2F7VA 1VHIA 1KD1T 1KC8O 1RGVA 1RU2A 2L3MA 1GLCG 3I0SB 4K4ZA 1RWVB 1S1WA 1VSHA 4RW6B 4DV6F 4DQQA 4ISFA 4O8KA 3VOVA 2HFUA 4OI4A 4Y0FA 4PUOB 5AQPA 4K4YA 3DOKA 2F40A 4JLHA 5AE3A 2X1GA 2DGUA 3DWLA 4BC2A 2LQ9A 3PJWA 4IDKA 1K9MO 4JK7A 4KRFA 3CDBA 1WDDA 3U8XA 3RAMA 4NI2B 2L9DA 2ZZTA 4O3OA 4EUVA 5IT9O 2DHHA 2J9DA 4DZDA 3QNNA 2KDOA 2O8CA 2FBTA 1AROP 1ZZNA 1K0VA 1K73O 3SEOA 3AVFA 3MPUB 3SQGB 1C0TA 3LGHA 3V4IB 2BKPA 1R8AA 2JFDA 3H40A 2YWKA 5I42B 2KT5A 5MLCQ 2UUCJ 4PWWA 3LF0A 4KAZA 1UA1A 3TAGA 1GMWA 3OVBA 3UO0A 1LV5A 1ZAVA 4CZLA 2BW7A 2YHYA 4JD2A 2KVIA 3GP9A 4I7FB 4FJ8A 4Q44A 1RUSA 3I96A 3SJJA 4DLGA 5KG7A 1TL5A 4FNIA 4JBCA 3A3NB 4DBQA 4CIFA 2GAGC 4M7YA 3RG6A 2AT1B 3OXGA 4PEOA 3BF4A 1QE1B 3KUHA 3L4IA 4KR0B 2CNOB 1B7YB 2GVDA 2HVEA 4YR0A 4C48A 3MURP 4JNEA 4A8OA 3OA9A 4JV5K 4DHYA 1GNKA 4C98A 4FJ9A 4EZ9A 4FYXB 3ZZ0A 2J6TA 1FI4A 3FGUA 2F96A 5HBMA 4FWMA 1ROFA 1GOCA 2GQQA 2KT2A 2KT3A 4DU7A 2PMWA 3AV9A 3TI0A 4DPUA 3GFXA 1ZBFA 1YT3A 1X9SA 3CHWA 4KHPJ 3EUNA 4KIAA 2Z1HA 1RDCA 4UF4A 4YOTA 3CJ4A 2NCKL 4ILLA 4Q45A 3A2FA 2MY7A 1QAJA 3DKDA 5EDWA 5HMXA 2JSXA 2GS8A 4LF4K 4J9MA 5ETQA 3O5BA 4V1Ak 1RTDA 2ZWHA 3ATUA 1GMWD 1FRXA 1XMOF 3BP8A 3VENA 4NXMK 4GO7X 5B0GA 3W9JA 4P9SA 1NJWA 3IM9A 4OJ1A 1X4AA 5BJRA 1JX4A 2G0JA 2AGQA 3SZ2A 1QZ5A 3LM9A 3FCWA 3R5BA 3MM7A 2Y3YA 2PSZA 2XO7A 4OHXA 4LF2A 1WG1A 3B54A 4FVCA 3AJDA 5D4OA 4GKJF 3SYZA 3SAGA 4LF8F 3GWCA 3C66A 4CZKA 4USJC 3MOZA 3EPIA 2ABYA 2KJVA 3FEZA 4BE1A 1KEKA 3VQAA 3KHGA 5DM7Q 4F8RA 2YCHA 4H4MA 4H5TA 2E9ZA 3CVKA 4GVLA 4OGCA 3DCAA 3M8WA 1JLBB 2HGMA 3U3YA 5DG9A 1S1TA 1U02A 1YVNA 3SUOA 3MFIA 2YKNB 2V8DA 3VGSA 3Q8QB 3M9OB 1T94A 3BS9A 2R7UA 2YJFA 2VFSA 3ENBA 5H1SV 3X3UA 3V9UA 4NYPA 3ET6B 3DRXA 1GT8A 1NWKA 2WTUA 4CZGA 3PFEA 4NRTA 3J81U 4ZTJA 2V63A 1JMTA 2PA3A 2XHWA 3M2UA 2ZC4A 2OJ3A 3JS6A 4LBPA 4MAKA 3R9PA 1FJCA 3CJ5A 5D0HA 3KK3B 1RE1B 2Q6CA 3M6WA 4O23A 1TMJA 5AJ3K 3KK2B 3WZ0A 2IDOA 4ZN1A 3ILLA 4M3RA 3HT3A 1VQ5N 3QEVA 4ECRA 1RYRA 4OJHA 3OUYA 4W5NA 3NF9A 1CC8A 3VEZA 1SCJB 1RKJA 4XDDA 4DV2F 4DFMA 5KOWA 5D78A 2DNGA 5KFVA 1KVIA 1HNVB 5K14A 5KFBA 4K4XA 3POTB 4TY8A 2FQQB 2ZH5A 2H5JB 3EGVA 1NKCA 4KHQA 2IPOB 2NSBA 1KQSM 4X64F 3FNNA 1HWIA 2E9RX 1T6DA 4LRAA 1MU2A 1Z4UA 4CZJA 3RJMB 1DY3A 3DGPA 3LQVA 1YXQA 1HYZA 3ILIA 1EQ0A 1WN7A 4KHYA 4M95A 4P71A 4YUDA 4NCGB 1NGEA 3B6BA 2G4BA 4H4KC 2MXYA 3GE1A 3THPA 2IIRA 4FN5A 2WONA 2ATLA 4FJMA 2DFEA 4HCCA 4OV1A 2Q3PA 1SKWA 5C0YA 3VAGA 3FFIA 2IAJB 4TU9A 1VSIA 2J0WA 4KYZA 3QRPA 2ZHAA 4FYVB 3SUQA 1RWOB 5KAKA 2GW8A 1YRTA 1VHFA 2VBWA 1E6YB 3TJ9A 1LOTB 2V2VA 3B4MA 4TYAA 3G6YA 4ZS6A 3FZHA 5EUHA 1CZ9A 1DKGD 4PKHA 3H4DA 4OKKA 2O67A 4BRAA 2E66A 1K8AT 5D3GB 3M4XA 2E29A 2LDYA 1PBAA 1RNHA 2G1HA 4DN9A 4U67L 1QHAA 3K58A 2HBJA 2F4VF 1DTQA 1A5WA 2PYLA 1TAQA 3KJVA 4CGHA 1T03A 2E7XA 3WC2A 1H98A 4NE9C 3OTOK 4K4TA 4Y3CA 3S3OA 1GOAA 1BQMA 1QVFM 4GVEA 1SH0A 2E7WA 2QL7B 4WFAQ 5BR8J 2M7SA 1WSGA 3LP3A 1WKKA 4HTIA 4OO1J 1LW0A 2V4RA 2CGKA 4UY85 4H4OA 3UVJB 4L73A 3N5FA 2KHDA 2C3MA 1HNXK 5CR4A 2A3JA 2ASMA 4A2AA 1L3UA 2FY8A 3H2LA 4CGJA 4L72B 5LT5A 4B9NA 4RU2A 4DUYJ 4URQU 4PHTX 2BR0A 1JCEA 4CGIA 5EVZA 4BACA 1JJ2M 1XR6A 2EBGA 2E1ZA 1TYQA 3HSCA 4BQLA 2O66A 4MKAA 1NK0A 1UFWA 4B3MF 4JI5K 1ZM3A 2HNDA 1XIQA 5HQ8A 1P1TA 1Y0HA 2UXBK 3CIZA 3PRVA 3CC2S 3CWJA 3QPIA 2DNKA 1JJ4A 4G1PA 4LSLB 4B1XB 1WG5A 2VFUA 1TFYA 1FFSB 2OPSB 4QWEA 4RW8B 5FDLB 4B3RK 2I8EA 5LMUJ 4NLGA 4CFAA 4NXNJ 4FPBA 3VQ6A 1UPMB 1TAUA 2VQFJ 2K1RB 2RRNA 2AJ2A 3RBZA 3VEXA 1EXQA 1LOUA 4BR9A 2BKOA 5GADI 2VH7A 4JK9A 3NY0A 1HL6A 3DYAB 5RUBA 4HTUA 4ECUA 4AUKA 3ILJA 1Q53A 4J9KA 3KWIA 2BGGA 1G7CB 4CZMA 2ASJA 4CO5A 1RBAA 5GAHU 4FPRA 4ETZA 2EPIA 1KFSA 3MAAB 1QVGR 4I9LA 3W60A 3K0SA 2V9KA 2P6SA 3OFHA 1BLUA 4JI2F 3R5JB 1FDDA 1FJEB 3G4SN 4JHDA 3TTCA 5C25A 3G9CA 1Z26A 1ZM2A 4OYMA 1DLOA 3ASMA 3RAQA 2HK2A 2B5JA 5D4LA 4F4YA 1HYSA 2MLXA 4H0OA 1NMDA 3L4BC 4WE1A 3P4UB 4N56A 4E98A 2F7TA 3ULHA 5B0DA 1NU0A 2XLIA 3OTEA 1X5OA 3EZ5A 3GILA 3GMGA 3M32B 5C2FA 4B1UB 2EC0A 4FPIA 2M4MA 3R27A 2CPXA 3CETA 3OW2R 3TVYA 4RW4A 1NHUA 2QC3A 2VU5A 1RBRA 1JLGA 2PEBA 1TFWA 3THWB 4NLYA 5JVHL 2DR8A 4I69A 5D4PA 5H1SQ 1H72C 2FF6A 3FVYA 1QHTA 5AQYA 3HX9A 1EX4A 2VPYB 3IAM9 3VZHA 2W2OP 3A5OC 3J81O 3CJ8A 3N4PA 4DV5J 2FC8A 1VQPS 4Z2XA 3T9NA 5M1QA 3CD6S 1ZA2B 4NLTA 2V0NA 1NEEA 2XNQA 5AQHA 4X4TA 1OO0B 2LXUA 3TTDA 1UVJA 3H90A 1U09A 2OA8A 4IFVA 4OVLA 3KLIA 3TZXA 3FC9A 1WLJA 3ADAC 4QR2A 1ICEB 4X66J 4F25A 1GX6A 4M5LA 3QJPA 2HQCA 4ES2A 2HMIB 1AUDA 4ECYA 1L3SA 3ATVA 4H03B 2B6AB 3M8YA 1YHQN 1N32K 3N9UC 4A2BA 1Q8LA 4CZEA 3HHEA 2P5OA 1MWYA 4J9PA 1KTVA 3JSMB 4N41A 3CCQN 2WSCC 3KMQA 1KVJA 2BV3A 1IO2A 3KKRA 4ILRA 3ZSYA 3OS2A 4DHVA 5A2QU 4OI3A 3GIKA 3RBXA 1RK8A 2QXLA 2RPIA 4CESA 2CQ0A 5BYRA 2A2DA 1EO1A 2B9EA 1H3DA 4KC5A 4W5OA 4MFBB 1NXIA 2YX1A 4RU9A 1YF5L 3ENHA 4OIXA 2DXEA 4P2MA 4BRGA 4I64A 4K50A 2E20A 1BUXA 3V6DB 2CPDA 5HLFA 2FY1A 5AQGA 2ZBQA 2WBNA 4ZN3A 4FNHA 1UFLA 3EGNA 2WVFA 4AD6A 4CTAA 1RBUA 2P9NB 4YEAA 2CWXA 1IJJA 1U1NA 2HKEA 2UU9F 1KVBA 4GKKK 4LFBF 3KLFA 3WC0A 3ZTPA 3K5NA 4AILC 4CEEA 4G9ZA 1KR4A 1HR0F 1CJUA 4DDFA 2JHEA 2IVNA 4IRDA 1SJQA 2L48A 4ED2A 2LEPA 5HO4A 3O5TB 5AQWA 1HWUA 3C19A 2D1CA 2OUGA 2MQLA 4DR4J 1SQKA 4RLEA 3P83D 3SQ1A 2B9YA 3P45B 3U6FA 4OKEA 3TQEA 4CJFA 4DQ8A 3BZCA 2E88A 1RACB 3OR1A 1VRUB 1GFWB 4ZTFA 1HD0A 3ID8A 2ADBA 2XC9A 2O8BB 3JTPA 2FLOA 5DO2A 2UUBK 4BRQA 4P2XA 1HWJA 4J2EA 1VSJA 2QFJA 1YRUA 3IGVA 4DCPB 2C22A 2QZ8A 2CJKA 3KG4A 4CYUB 1OQ3A 1FF2A 4J90A 2PFDA 1OYEA 1JLEA 1KCFA 3HCXA 4BG8A 4FJNA 4NLPA 2VD3A 4M1KA 4IDHA 3NNCA 3C6HA 3WEEB 1F5BA 2QKKA 5J2QB 1VQ7N 4ZPWR 2W8LA 2XSJB 2MHEA 2HQGA 3ZFVA 5F8IA 4OX7A 2FVQA 2VG5B 3BDPA 3DLRA 2CA9A 3HHLA 4JKFA 2P9LB 4B17A 2V4JB 4Z0UA 4ELUA 3KLEA 3HHDA 2HBQB 3MPWA 3HFKA 2BEFA 2Y8YA 3CJ7A 3LGMA 1LEOA 2IBKA 1WJ9A 5CXTA 3FQLA 4M5NA 5CAAA 2DHSA 2HHHJ 5AQIA 2IA6A 1LNQA 3OSPA 4EHTA 1U1PA 1VQ8S 1R43A 1T44A 1R7IA 3GFHA 2HF3A 2RU9A 3I0RB 3TX0A 3OYHA 4ILGB 2GX8A 3QZ7A 3LPYA 1WAJA 3CNQP 4QYRA 3ISNC 2NNWA 4OX9K 2O4IA 3MM8A 1FFWB 1UMJA 4DV7J 5HVFA 4UZBA 5BR9A 3QGPA 5C42B 2VBXA 5KFDA 1TKXB 4DV1K 2VG6A 2OD6A 5IV3A 3IRWP 1RHRB 2HS3A 4ZVQB 3AAPA 3L8BA 3GYXB 2B56A 4DSFA 1EWQA 5JVGQ 1HW8A 1FVQA 4KPYA 4F0MA 1RT1B 1BC6A 3HXMA 2OI2A 1RT6B 3GV8B 4FF3A 1NB7A 3H1VX 2ROEA 2VPWB 4FWLA 2YQ1A 2V34A 3RAXA 3I8BA 1XC3A 2QA4S 1PYTA 3MM6B 1RBSA 5E5NA 5IQQA 3M9NB 3CFRA 1APSA 1I3AA 3HHLD 3DLGB 2JH3A 4KSEB 3SCKE 1ASUA 5K5MA 2AQ4A 4JI7F 4CBXA 2HQDA 3SI6A 1IBMK 3BJYA 2XLKA 2WOMB 1QTNB 3KWMA 3O9QA 2IRUA 3NOGA 5JS1A 2LLZA 2GO8A 3QINA 4CEZA 2AYEA 1S0NA 3PFOA 1C0MA 3NHGA 3LDNA 4LF5K 3QJJA 1U1OA 4K0KF 4HT7A 4NA3A 4EGLA 4KJIA 3IA0A 1J2VA 2UZAA 1MROA 4TN2A 2XWXA 3I33A 3FBEA 2NRWA 3ZT0A 2EXUA 4WQ4C 1NK8A 2CAJA 2NUBA 4KO0B 4TXSA 3PX0A 1IQZA 3TVKA 4RNNA 3DLEB 3ETOA 2CH6A 2CUYA 2CQ4A 1IWGA 1NBEB 3C3LA 2G8VA 1S1WB 3NS7B 1RT7A 3L2WA 4ZVUB 3AA4A 4JI1K 2D0BA 4OQJA 1EP4B 4KGKA 1SUQB 2UUAF 3LO3A 3LDLA 7FDRA 2AW0A 5KFWA 2J6UA 3T1HJ 1XTZA 1X4CA 2FHJA 4XEIA 1HJOA 1R0BG 2E5LK 3E01B 2Q36A 4F26A 2LKZA 3GOIA 2CWKA 1LK7A 4BHQA 3CULA 2EI5A 2UVRA 5E7OB 2FHMA 3C14A 4BE2A 2F8EX 2E5GA 1RB0A 2RB7A 1BU6O 4M94A 3L2VA 3IAYA 4XAKA 3D2FA 1FDAA 5LJ3Y 1SQEA 3CMES 4ITSA 5EWFA 4J9QA 2A41A 4B3OA 1UJ5A 3V9ZA 5K8OA 5IT9Y 4B3SK 1VQMN 1UZDA 3MPYA 3PEJA 2VODA 2P9PB 4FWOA 1N56A 1N5QA 2HHPA 4DMNA 1FK9B 1YJVA 1VISA 2D7SA 4I6YA 2CQDA 1FWKA 1RT4B 4B1VA 1YLXA 4AHUA 5KG2A 2KYZA 2EFOA 3CSKA 2XWYA 1KLMA 4MIWA 4ZDNA 1RBLA 2DIUA 3TEHB 2DBBA 2DTJA 2DKOB 1GLEG 1X0PA 1YJNN 1OSDA 4JI8F 5GADP 1F5AA 1REGX 3Q8UA 4DR1K 1Z1ZA 3QGGA 1HNZF 2GVDB 2CPEA 4KB7A 4DKWA 2BOPA 2HHTA 3NAIA 4IZ9A 3NGRA 1DQ8A 2GAHC 1EZZB 5HQMA 3QFPA 2FHJD 4ZCIA 1Q8BA 4ZITA 4BR2A 1XNQK 1NPPA 1A6LA 4W98A 1ZBLA 2CFXA 4Z4HA 1NOYA 3CEDA 3TJ8A 4JRPA 4OHYA 3TAMA 2EG2A 5FLXY 2VGNA 4KH5A 1H2UX 3VR1A 1GK8A 2IRXA 1RWXB 2W2PP 4CGGA 4YDXA 3EICA 1F2GA 2H48B 5H9FK 1FXRA 3D0GE 3D2EB 1YITS 3QEIA 2DO0A 2ZKUA 4IBNA 1N0UA 3K5LA 5KRTA 2ZUAA 3OBIA 1NGAA 2QO3A 1B9DA 2QTWA 3SQ4A 5EY4A 4WFBL 4Y34A 1HQUB 1XMQF 4Q2LA 3QO9A 3U1NA 5LXYA 1BO5O 3MM7B 6AT1B 1N4LA 3SLCA 1WAFA 2RUGA 1S6PB 2W42A 3V5RA 1QSSA 4JI4K 2IJFA 3OS1A 3UD4P 1XMOJ 2WZ1A 4ERDA 3ZZPA 4LFAF 5DDQC 3QMLA 4OJRA 2BJDA 3A8IA 3J7YI 3H0PA 4U7CA 1FD8A 1YJ9S 5CZXA 3OYCA 2M5YA 2I0XA 2K7KA 3I87A 4UOHA 2BRKA 3H5XA 2HFVA 2COLA 2IVMA 3K89A 1OH7A 1VQKS 2P5VA 2C3YA 4IH6A 4GKJJ 2P9KA 4DG1A 3M8QA 5C7PA 3CERA 4FJHA 5LJVA 1UA0A 2ZZNA 1VFJA 4YB7A 1U2FA 2ATQA 1GLAG 2QX0A 2B7BB 1JLAA 1QQNA 4X4UA 4CEBA 1VQLS 3OYDA 2DGSA 4DU1A 1IBCB 1B4SA 4LSNB 2G0IA 1LKZA 2KHOA 4CECA 1SI9A 2EK6A 3HSGA 3DRYA 4JI3F 1RTJA 2GJ2A 1NLVA 4ED8A 4ECXA 3AOBA 4R8UA 1KNZA 1NKBA 1AFIA 4KTZA 3OBYA 1FA0A 5HOOA 3VGVA 1F21A 2ZJQL 1Y5IB 4ZVHA 5IOLA 3GIMA 3OXFA 2BYCA 3PR5B 3P3DA 2LVWA 2LU2A 3Q24A 4LREA 1S9EB 4LBIA 1RISA 3F56A 1YK9A 4M5JA 3L2QA 4TY8B 2JVOA 4LR8A 3TUIC 2XG8A 2QA2A 4KBIA 4RW9A 1J5EF 5KFRA 2FSJA 1OH6A 1RCOB 3CW2C 2EC2A 2LCWA 4J2DA 5DM6Q 1RDWX 4CW7B 4C8LA 1NK6A 2MMYA 1MU2B 1QSLA 3CJCA 2WC9A 4GV3A 4F4ZA 3AO5A 1DURA 4GO5X 1XR5A 4DV2J 1URRA 2DNLA 4AHVA 4ID1A 2I38A 2VJUA 4KH4A 2XMVA 1ZBSA 3UI3A 2E2PA 1RFQA 3M1VA 4QIFA 2FVCA 2V8PA 2Y1LB 1Q4RA 2GHPA 2P9EA 5KG6A 3GFYA 2V2KA 4X64J 3RSEB 2FVPA 2WONB 2VA2A 5SZTA 4CERA 3KNGA 4ES3A 3RMBA 4ZVSB 5AQMA 3T19A 4LR7A 2QWRA 4O4GB 1QLNA 1DHMA 1LWEA 4DUZK 2YH1A 2XYGB 3R1XA 2DGOA 4CF2A 2OSQA 4OI1A 1MMDA 3HHKA 2B8PA 3SXLA 4BC4A 3H2VE 2BJ8A 3FZMA 1U6FA 1Y00A 1WC1A 2ACYA 4AQYK 2ZH4A 1CJTB 2RDJA 3L2RA 1IQTA 1N36F 2F9JA 1T03B 1UEUA 1OWXA 3O44A 2B0GA 4ILHA 2GZOA 3AO2A 2V7ZA 2HHUA 3VAKA 1UEVA 1IBKK 1FRMA 2FHOB 3CJ9A 4LFCF 2OPRB 1BHNA 4OYXA 4EEYA 3CCSN 5HAOA 1TMMA 2Q2RA 1JL1A 4CJ4A 4CEOA 2RE2A 3PHTA 4KI6A 1F6TA 2CQCA 2KRBA 3AB2B 1Q78A 2QLWA 5HATA 5TKYA 4QWCA 3T1AA 1FJGF 1TL3A 1FEEA 1VQ4N 4Q0BB 2GO9A 2JEIA 3VQPA 2DCLA 2Z0GA 4C23A 4JEPA 4M8LA 2I7NA 3UNYA 3FGVA 1LWXA 2C2KB 3VCDA 1KVAA 1X4DA 1TYQB 1SH2A 2H9ZA 3G96A 3SUNA 1S0VA 2HNDB 3J7A1 2GV9A 5G0RA 3HFVA 1TZ0A 1WTBA 2R7SA 1RHJB 2VBYA 4KGMA 4AM6A 5KFHA 4E7IA 3QEWA 1MN9A 1VQ6S 4A62A 2GUPA 3O6WA 3WQUA 3T41A 2C2EA 3MN7A 3CM6A 3LP0B 3HM9A 4IKFA 3MTKA 3SAHA 3Q8PB 2ASPA 4QW9A 1DGKN 3C8YA 4DFJA 4A8MP 4Y00A 1HHSA 3SUPA 2E1MC 3DLKA 3OFGA 2KTQA 1VSFA 1NNDA 2HVIA 3PHEA 3D67A 2XO6A 4LR9A 3G6EN 3L7OA 5AQFA 3D54A 2UUCK 3CXCM 3E66A 1QQOA 1TL1B 4UTGA 1I3OB 2XMMA 3V9SA 1BHLA 1NM2A 3I31A 3AD7C 3OYJA 1DLOB 1WTFA 2CZVC 2CG8A 4LIWA 4Q8EA 2OD4A 4GW6A 1RKIA 5AE1A 5DK5A 3KNAA 4FZVA 1VQ9N 4K25A 4WE1B 3VGKA 1X4FA 2ZBRA 3OR2B 4KKOA 2JOQA 4CJUA 4MK8A 4JI2J 1YG0A 2IJRA 5DRKA 5U47A 3DFEA 3QRRA 5C5JA 3CCRS 1BI4B 1JCGA 3R8EA 4K2XA 3VQQA 3S7RA 3SCXA 1U04A 4FKXA 3D1HA 3MX5A 1C0UA 4MH8A 3U27A 1T3VA 3T5HA 3HP6A 5L9XA 1PC5A 3MAQA 2OZMA 2E7VA 4JI0K 1W26A 4LQ3A 4NCBA 1B99A 2O4GA 4GV6A 5SUHA 4RW4B 1JXEA 4HKQA 4E7LA 1BE4A 2WB1D 3NBPA 2YX4A 1K8KA 1SC1B 5BRFA 4RW7A 2ZBIA 3MCNA 2FSKA 4Y2KA 2F8MA 2RHKA 4CO3A 5K20B 1RHMB 1C1BA 4GV9A 3F0NA 2Z57B 4CNZA 5M1OA 3CCJN 1TGOA 4KH0B 2QMWA 2OMLA 3HVTA 1X5PA 5KFAA 1HBMB 2E1YA 2YV0X 4KHPK 2UV8G 4BGBA 3AOAA 4HI2A 4I67A 3AH6A 1H6KX 3CFPA 4A8KA 4F2SA 1OH5A 2BUNA 5I3UA 2DR5A 2Z1IA 3HVAA 1LWFA 3J81Y 3FSXA 1K0TA 4F04B 3VGMA 4PXDA 3UIQA 3ETMA 4C7QA 4ECTA 4YMEA 1ZOTA 3O9TA 3NGTA 4PCQA 2DR7A 3D5MA 3QRQA 4DR2F 1YDLA 2G0CA 2DPNA 1VSDA 4B3RF 1CS4B 3HDSA 4LRFA 2VICA 3MMBA 5DDPC 3FRZA 2MKIA 3DRRA 5A6PA 2P9UA 1QTMA 2QSWA 4FLVA 5AXKA 1NGJA 2E44A 4TVAB 2ZC3A 2OKQA 5IM0A 3RRGA 2FLNA 2CZ9A 2QG9B 5KG3A 2H4YB 1EKEA 3QDKA 3SJHA 2A6AA 1FO1A 3EKSA 5I9EB 4QR1A 3BGRA 5J2PA 2N3LA 3NLCA 4OYOA 3A8JA 2MSTA 4H0XB 5KFQA 3WXLA 2AJQA 2L9WA 4O3SA 2R7WA 4H5WA 2G2YA 1SKSA 1KS2A 2HAIA 1Q8KA 1NSAA 3QNWB 4V19J 2WVDA 2YNHA 1AZSA 4FYYB 3M6UA 2HFOA 5BXIA 3V6HA 2WAQD 5E3PA 4FF4A 4O0NA 3R6MA 3BQ0A 4QWAA 3C0BA 2WSFC 4ANDA 4FP9A 2XGPA 1RTHA 3KLFB 5T7LA 5KT2A 5JS2A 2YNGA 4X62F 1M1KT 2CIMA 1E4GT 4HT5A 1U8SA 4WFXA 4QIWD 3G82A 3NGIA 1S12A 5DZ6A 1EARA 2W6LA 3TSQA 4FK0A 2DNQA 1D5AA 2Q66A 5JICA 2HRYA 1PGZA 3J7AP 2MQOA 3R6LB 1ZPVA 3MD3A 2UU9J 4F4KA 3THYB 3U02A 4LFBJ 3AD9C 4Q43A 3O9SA 4BR0A 2NRZA 3BM7A 3CPWR 2R9LA 5K8PA 2HGLA 1HR0J 5A8KA 3WDOA 2DIVA 3CD0A 4C6AA 1Q81O 4DX6A 2AV5A 3GV5B 1SQFA 1WC4A 4UQGA 3H1QA 1D4XA 4WFBQ 2H54B 1TL4A 1NKEA 2IVPA 2F4FA 3MEDA 5EX3A 5F9NA 5AZJB 1OQ6A 1ZM9A 2LU1A 5LL6d 3KK7A 5AQKA 1CULB 5F41A 3HJVA 3UQSA 3D1OA 2VC1A 3D3CJ 1LAVA 2DFHA 1GX5A 3J7YP 4DV4F 5AQLA 2DHGA 1YJRA 5IT4A 3HHLB 3G8QA 4JUZA 4QIEA 4IOCL 1NNEA 1V4SA 5FRMA 2AZ3A 2HBKA 5HVHA 5HMYA 4HR2A 4LF9F 3MR2A 3LP2A 1ACMB 1YZ6A 1E3MA 5IWAF 2XM3A 2W9CB 4YFUA 3ENOA 1KSPA 3W5ZA 3JB9k 3LPEA 5A8RB 5FJ4A 1QM9A 4WCEL 5J2NA 1X8DA 2DY9A 5KPTA 4NMLA 4ZP9A 3HHLC 2LFVA 5E26A 1VQOS 1Y3KA 3TSPA 2DITA 3IM8A 3JQKA 3IUCA 3DAWA 1R89A 2J6SA 4BRDA 1DRZA 3MDQA 2VG6B 5C15A 2BJ3A 2ZH9A 3HJFA 2KXFA 1NU4A 4LF7F 2F1FA 4FWKA 3OL7A 4GKKJ 5BR8K 2KLAA 4M5IA 4CNYA 4CHQA 3TP2A 1YJUA 1U7LA 4YR2A 3VQSA 4C9DA 3UR3C 4I6MA 5LL6Z 1FD2A 4CJWA 2DD8S 3O4NA 4HHTA 4OFZA 2ZJQQ 3UN5A 4CGFA 4RNOA 1RSCA 3FZ2A 3OYNA 3AA9A 3G25A 5CZ1A 1TQLA 3AO4A 2Z2LA 3EZWA 5AE2A 3QIOA 4QJVA 3O3GA 1WD6A 1E4FT 3L95X 4BRPA 3D2WA 4DUYK 3AOCA 4K5SA 5TKWA 5EXWA 4IG3A 1Q5YA 1I1GA 3VVUA 3L4QA 1WHYA 2VKZG 4OL8A 3BDEA 2Q79A 4A4JA 4IG0B 1ZH5A 2JL9A 1YGYA 1SXLA 3I32A 1DFDA 4UW2A 3QFUA 5B0BA 2NLWA 4DMZA 2NQPA 1G6BA 4HTJA 3NH0A 1JKHA 2W4DA 1RT5A 4DU8A 3VVTA 3UDLA 1RDUA 1BMQB 1FXXA 4QR0A 1WEXA 2DGQA 3EE3A 2YHBA 3AD8C 1O1WA 3L3VA 2DRAA 4WYBA 3GJTB 1WI8A 3C65A 2FD2A 2CPZA 4I2PB 1OY9A 3ICLA 2QFIA 3AQOA 3C46A 5LMUK 2VYPA 4JI7J 4NXNK 1W25A 2YQ0A 2VQFK 3CCLS 2J0XA 4ZVEA 2GWKA 3T9ZA 3PKYA 5EX0A 3NS5A 2JEJA 1MDUB 1ZC6A 3C6UA 3SPZA 3TU5A 4RJVA 3KLHB 5CY4A 1DEJA 4KV8B 1S9FA 4WU2A 1U8WA 1I94F 1T3NA 1JWWA 4K0KJ 1BISA 1HMVA 5KFLA 3UR0A 2RHQB 1S5ZA 2HNZA 4C11A 2R8KA 4E1MA 3CD7A 2Q0RA 1WC6A 2HHSA 4BRCA 3P5BP 3MEGB 3CIPA 1M1HA 4CLFA 5F8LA 4DL2A 3MCMA 4OX6A 5EX5A 2VFTA 3KDOA 4U9RA 5J1PA 4FXDA 2J0QD 1IR1A 2R8GA 4CF1A 4F4WA 3KIOA 2DEIA 2M2BA 3B4DA 5ADZA 3UPFA 4DV1F 4M7XA 2UUAJ 4I6WA 1U4BA 2L08A 2AJ4A 5F8MA 3DMJB 4M5HA 3AVHA 3GJRB 5KI6A 4CJRA 3A13A 5CABA 4B3OB 4B9LA 2IM2A 4CT9A 1C6VA 2F8TA 2AJ1A 1ZTWA 1PIEA 3CC2N 3VMFB 2P5GA 2Z30B 4DSJA 1F9HA 7AT1B 3BN7A 1GLFO 3KDNA 2GIQA 4PL8A 3WUHA 2J0SD 5LY3A 2DCUB 3BH6B 3ID6A 1EKRA 1NJIT 4X4OA 4DV5K 1KLMB 4H54A 1U1MA 1N6QA 3IR6B 3CC4S 2JJ4D 3UN3A 3R9LA 1S1UA 5KFNA 1VS3A 1OH8A 1FNOA 1EQMA 1NCLA 2XQCA 2QGFB 4JV2A 1RCHA 4CLWA 4NYFA 3BR9A 5CCLA 1NGDA 2BQ3A 1T95A 2FF3B 3QT8A 2G8WA 1S9GA 5E3QA 4X66K 1IKXA 2YWFA 4KAIA 2UVVA 4JI6F 1LAWA 4E8UA 4M63C 2R2RA 3L7PA 5F8JA 2JLGA 4CLSA 1U0HB 3IDHA 4OPAA 4CLLA 4WF9L 3AVGA 3K8VA 4C3MA 3LA0A 2AD9A 2AYBA 3CCTA 4XK8C 1QUPA 1VRTA 4KQZA 2XY8A 1WSFA 4DTNA 1Y10A 2J9CA 1L3VA 3IWLA 4MLEA 2GGPB 1DZ5A 2WK4A 4NLSA 3TWHA 5CZVA 2MQNA 4PYDA 1U2VB 2A5XA 4CO1A 5L1IA 1ELOA 2GC8A 4ZK7M 2LA4A 1K6YA 2E2OA 1NPRA 1RAIB 4HHUA 1IN0A 3GBTA 4JV0A 1RWNB 2E5LF 5HP1A 2RVJA 3JAMU 4J91A 2DK2A 4OLOA 3QMQA 4JYAF 4Z7YA 3IBWA 1FVSA 1AT1B 4ZLPA 3C15A 5B7WA 2BOAA 3QO9B 1RT3B 1VQPN 1Q18A 1K9MT 2E5IA 1OJ4A 4LVOP 4GVBA 3KHLA 1X60A 4KHSA 3MUVP 4DTJA 3LH2S 3L3UA 2LXFA 3Q8SB 2YQ3A 3RZAA 4M5DB 2MKCA 1BOTO 5JMVA 5KG0A 1Z05A 4ZVPB 2NSCA 1XMQJ 3HSJA 4DR4K 4OZ5A 3MMJA 3NGUA 3JSBA 5K8NA 4WXOA 2DNZA 4JN4A 3KFWX 4OZNA 4C1NK 4EYIB 4A8SA 3TOQA 1F9EB 4ZKAA 2N7CA 3M6GA 1JLCB 2P9KB 4C0BA 2XSFA 4DG1B 2OFGX 3IFRA 3M8QB 3F5TA 2HBRB 5HMZA 2HSTA 3DXKA 1SC3B 5J2MA 4LFAJ 4BVOA 4RNMA 3GU0A 3V81A 3NMAA 4TQSA 3PLAA 2EBEA 2OELA 1LK5A 4AHCA 1G15A 2D0PA 1MA9B 2DNMA 2DISA 1XC9A 1CPZA 4OLBA 1VBYA 4GVMA 2P9SB 3S01A 3V2UC 4R8UB 4M3WA 2FGOA 1IKWA 5BPMA 4O44A 3V9WA 3U3GA 2CPIA 1XNQF 4F67A 5L39A 4YY3F 4ZPAA 5D77A 1RU1A 4NZ7A 1RHKB 2QEXN 4MKYA 3PKMA 2AKWB 1DBDA 5DQHA 3WX8A 3QAEA 4FOIA 5BPLA 2QWOA 4USMA 3T1YF 4JI3J 4DTXA 1D9FA 4DJBA 5KGXA 3HPGA 2AIRB 4XH4A 3NH2A 2X1AA 3EX7B 2HHHK 2BE2A 3IMXA 4KHNA 2EG1A 3OYFA 2R7XA 2U1AA 3LDPA 3DOMA 3UKRB 4DTRA 1NSKL 4QOTA 3S3NA 4YDUA 1MNEA 1B92A 3BO2A 3NRBA 2BQRA 4ILJA 4AM7A 2ZNZA 3M6XA 1GOBA 2OIHA 3VGLA 1XMBA 3RMAA 4HUGA 4DV7K 1SKRA 4KFBA 4BGAA 3WNGA 1J5EJ 2HFSA 4CZCA 4J9NA 1HI0P 4PG7A 5GAGP 3W1YC 1P1LA 2W9BB 1X3NA 2KFZA 4BLGA 1WC5A 2QSFA 3L6QA 4WKYA 3NGSA 1KQGB 2HHQA 2XYHB 2AHOB 4EAHD 1NDLA 1VQ5S 1F3VA 1UWBB 2Q1NA 4J7CA 1LWEB 3HF5A 3TEGA 1WEZA 3CC7S 5A8WA 3ZXWA 2VHGA 1RAAB 4DL0C 2V52B 5C24A 3O3FA 1X31C 3QBCA 5E3RA 5FLXU 4W5TA 3UB5A 2GV1A 3PW5A 4WYWA 2RILA 4W4MA 3KOAA 2FSNA 2X78A 2EHGA 3JSRA 4XTTA 1N5TA 5T7BA 3BH7B 4FM1A 1RLCL 1NB2A 1VQNS 2XYPB 2UVUA 1NDPA 5EHHA 3PDNA 2AYMA 2IM0A 1VQ8N 5KG4A 4PWDB 4MIBA 5B09A 4RWTA 4L74A 2IRYA 5EWEA 1HNIA 2ZE2B 1T9WA 1TVRA 1N36J 3THTA 3ZC4A 2XNRA 2DR6A 3AHPA 5A76A 4DSEA 3GIIA 2MQMA 2FBVA 1YKWA 2DFFA 3US5A 1W2BR 3PO4A 3N5BA 3Q8RB 1BG3A 1NGCA 3BSNA 4LFCJ 3PTWA 1VBZA 1HQEA 3WNFA 3QIPB 1T3OA 2MYFA 2B9WA 4K4UA 3IAS9 4CLPA 5GAEI 5A0YA 5G0RB 4CHZA 1FJGJ 3KVGA 1S79A 2RSQA 4NLDA 3AVAA 1PKUA 3T1HK 4ZHRA 2OEMA 2A1BA 1F9FA 1TELA 3LOUA 1HFEL 3D68A 1NK4A 2QA1A 1D09B 2R3VA 2B8QA 1E6VB 3IS9A 3KLGB 2QA4N 2OTJN 4DV3F 4URGA 1URNA 3AAQA 4E2FB 4G1QB 1ZPWX 4BQZA