4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
1C2PA 2XY5A 3OYJA 4JRPA 3DRRA 5EWEA 5HP1A 1UWBB 5F8MA 1YT3A 4WFZA 4DL6A 4KE5A 2GIQA 2W42A 1JKHA 3KHRA 4M3XA 2HNZB 4XO0A 5J2QA 3CFRA 2XI2A 1REVA 1GOAA 5J1EB 3PR4A 5KFQA 3QETA 1GOCA 2VG6B 1LW2A 4ZP7A 3T1AA 2HNYA 4QCLA 1MU2B 5I3UB 3E01B 1RTDA 2HHUA 3VQ5A 1S6PB 1XWLA 1A5VA 4URQU 1C6VA 4TSXA 1Z26A 1LW0A 1JL1A 4WXWA 2HHWA 5KFHA 4DQPA 3RRHA 3KHGA 4ECVA 1RT2B 3H5SA 1KHVA 4I2QB 3KLEB 2AWZA 1YTAA 2I1RA 2HW3A 2OA8A 3NKYA 4DSEA 4O3OA 4AH9A 2ILZA 4FS1A 4IR9A 2EC0A 4DSFA 4FW2A 1ZBLA 1WNEA 3RRGA 3NGDA 1EETA 1NK9A 3M8PA 4CK2A 1O1WA 4WYWA 1S9FA 2D0CA 4CJVA 3C6TB 4NLSA 4CEAA 4DTRA 1DLOB 2O5DA 4Y2AA 3HM9A 4EEYA 2FLNA 3CO9A 3MTKA 3KHHA 2BRLA 3SNNA 2G8WA 5KFXA 1RTHA 3AVMA 3HSTB 5KFSA 3NDKA 3SI6A 3V9SA 3D5MA 4DWIA 1S48A 3D0PA 4IFVA 3GV7B 4O4GA 3HVAA 3BR9A 2C2EA 4M3UA 4FLVA 3KK3B 1XR6A 2V9WA 3C95A 1RTHB 1D0EA 4RW9B 4DQSA 5KFMA 3OS1A 5C24A 3NFAA 3DLEA 4W5QA 3G10A 2OZSA 2BE2B 2UUWA 3EPIA 2FBTA 2FBYA 1LAWA 2WONB 2YNIA 4CHZA 4WXOA 3U3GA 2YV0X 3RMBA 3PW2A 3CJ4A 3DYAA 3U6FA 4Q45A 4DQQA 4WE1B 4MQ3A 5KFIA 4RNHA 1S1XA 3RB3A 4ZVGA 3BREA 2R2SA 3AA4A 4O3NA 5JUMA 4CFBA 3VN5A 4BWMA 3MAQA 1TKTB 4W5RA 1Q9XA 3IN5A 3KHLA 4J9QA 3DLRA 1LW0B 1HRHA 3ISND 4DTMA 3TAMB 3MXJA 1IO2A 3ZSXA 1S6PA 4QPXA 1TL3B 3PVXA 1KLMA 1TK0A 4CHYA 3QNNA 4LY7A 4FM1A 4DU3A 3HKWA 2HAIA 1R0AA 4KO0A 1REVB 3RB4A 4KREA 3S3MA 4E1MA 2XC9A 4KPYA 2YNGB 2RDJA 4OGEA 2IJFA 3BGRB 4KAIA 4IFYB 2ZKUA 3LDSA 4DS4A 4LSNB 3TABA 4Q44A 3AVAA 1RT3A 4M41A 3GILA 4M45A 3OYEA 3N6MA 3VA3A 4JS5A 3M9OB 2BQ3A 2Y1IA 4DLGA 4CK3A 4OKJA 4ZPAA 5KT3A 2YNFB 2G8KA 4CJUA 3OYDA 4KB7A 3ZSRA 4M42A 3LP0A 1EETB 3EZ5A 1XC9A 2PZSA 4HYKA 4N5SA 1FK9B 4DL3A 3AVIA 4ED0A 4N47A 3AO1A 1IG9A 4WYLA 2PYJA 3Q8RB 3MECB 4C8MA 4FJ5A 1LWCA 3OLBA 2HVIA 2Q3SA 5J2NB 3PW7A 3OYBA 4NLYA 4QW8A 4W5TA 1TAUA 4F4KA 4LQ9A 3NHGA 4FJ8A 4ZVHA 3KLEA 1HNVA 5KI6A 2AGQA 1YVUA 4UQGA 3KD5E 4CEOA 3KJVB 2JEIA 4I7FA 3DLGB 5KG6A 4E19A 1G15A 3K5LA 5L9XA 5KG2A 4IG3A 1KSPA 4HKQA 2FBXA 1RTDB 3E01A 4J2BA 3QGGA 1ITGA 3K57A 4HTUA 1KRPA 2HNYB 4MFBA 2W9CA 5KFJA 2BQUA 1NK7A 4TY8B 4IRCA 3B6OA 4DL4A 1JLEB 2X78A 2W9BA 4ZHRB 2HNZA 4KHNA 5KG1A 1ZBFA 3LPTA 3V9WA 3SUOA 4DSKA 3VQSA 1U47A 1VRUB 5E41A 1D1UA 4CHOA 4E7IA 3HVRA 3PW5A 4JUZA 1RBTA 2OPRA 1C0MA 4NCGB 4M3RA 4ZHRA 1L3TA 1JLEA 1C1AA 2A1SA 3HVWA 3ITHB 3T5JA 3V1QA 4ZTJA 1U4BA 4TY8A 2WOMA 1NK4A 2D3UA 3M8QA 3DOKB 1N6QB 2XO7A 2IM3A 4YR3A 2XGPA 3UDLA 3KNAA 1TKDA 2G8VA 3RAQA 3CYMA 1LWFB 1BI4B 3C6UB 2W9AA 3AVGA 4JV2A 3MR3A 2HVHA 1CLQA 2FVPA 4KTWA 5EU7A 3BJYA 3CDEA 2D41A 4BDZA 3UR0A 3AO3A 4DQRA 3DLKB 5KRSA 5KT7A 1NOYA 1I6JA 4CJ5A 4EP4A 4RW4B 1U49A 4ECUA 4IBNA 4ID5A 3U3YA 1FK9A 2D0AA 3QEVA 1SKRA 3KTQA 4DL7A 4F50A 3TARA 4OPJA 2P5OA 2ZD1A 1BHLA 1IKYA 4HCCA 3DLHA 4M3YA 4HUGA 5HRNA 3M8QB 4YQWA 1JLCA 2B6AA 3V6KA 3FRZA 4B9NA 2WOMB 4HUFA 5HRRA 3KMSA 3DLBA 3IRXA 4DMNA 3ZCMA 3VA0A 1NJXA 3WNGA 4GW6A 1SV5B 2C22A 2QE5A 3NAIA 1RTIB 3BGRA 4QAGA 3MEEB 3QIOA 4JS4A 3PJWA 1FXXA 1N48A 1IKWA 3GIKA 3CJ3A 4RUAA 1JLFB 2IC3B 4AHCA 1HNIB 1BGXT 3ULDA 3Q8QB 4ZP8A 4KHUA 1XHXA 5KG5A 3RBEA 4PUOB 2Z1GA 3L2WA 4Z4IA 3RR7A 3RB0A 1RBUA 4I7FB 4N56A 4I9QA 5SWMA 3VQAA 4IG0A 5L1LA 3E51A 1EXQA 5FRNA 4FJJA 4DSJA 1IKVB 2R2TA 5DQGA 3G6YA 1RDDA 3T5HA 1HQUB 2FJWA 3QEIA 3NAHA 2QXFA 4F4WA 2ATQA 1CXQA 4HUEA 1TVRB 2XCPA 3I0RB 4KHRA 3SUQA 1IM4A 5KFEA 2GUIA 4QWBA 4IDKA 4CIGA 3SUPA 1KCFA 1W0HA 1C0UA 3G6VA 5FRMA 4C8KA 3DRSB 1I39A 1QSYA 4CHPA 2VG7B 1KVCA 2DTUA 1S1UA 3T3FA 3L2VA 4H4MB 1JX4A 4Y3CA 1T05B 3DMJA 5C42A 4MIAA 4M3WA 2IA6A 4J9SA 1FKOB 1N5YB 4E3SA 5J2MB 1C1BB 2V4RA 3Q8SB 1RT4A 2C2RA 1IH7A 3HK2A 2KW4A 3HL8A 3DI6B 3FFIB 5KT5A 4EZ6A 4DL2A 3QZ7A 1BQMB 2RDIA 4Q5VA 3TAGA 3VQPA 3MEGA 3H4DA 1HJRA 2FLLA 2QV6A 1RDAA 3PJXA 2RF2A 2E4LA 4CJKA 2KZMA 4ECXA 2HB5A 3IG1A 4H4MA 4NLPA 3H5XA 5DQIA 2OYQA 1L3VA 2WRMA 2X6SA 4RW7B 3QYYA 1ZBUA 1KVAA 3M8RA 4FZXC 4KKOA 3HO1A 1ASWA 5KFVA 4Q43A 1JXLA 4J9MA 4IDKB 1Q8IA 4DS5A 4E0DA 4RUCA 2ASDA 4ZP6A 1J5OA 4KB0A 1HMVA 3NCIA 2OPPA 1HYZA 3M9MB 4RG8A 4NLGA 4PQUA 2XWYA 4RW6B 1NJZA 4URSA 3JSMA 4RW8A 4EBEA 4XPCA 1TKTA 3EYZA 3LANA 4EP5A 2IBKA 3THVA 4WFXA 1C0TA 2AU0A 1NHVA 1K1SA 1CSJA 1QE1B 5T7BA 3ZT3A 2G8UA 4RW6A 2KFNA 4URGA 2FC0A 4W5OA 2BQRA 3TAFA 4KHYA 1HYSB 3LALA 3PW0A 4R5PA 2OPQA 3EZUA 1T7PA 2AX1A 3V9XA 1J54A 1WAJA 1MU2A 3SI8A 3LP1A 3OSNA 4NLDA 2J6TA 1FKPA 2HHXA 3HHKA 4EO8A 3I0SA 4EBDA 4KBIA 1U09A 3GIIA 3TAPA 5DLGA 4E7KA 3MR2A 4RNNA 3B6PA 4O4GB 4NCBA 1LAVA 3H4BA 3DI6A 3FFIA 4NLUA 3RMDA 5KFCA 2ITGA 3ZT2A 3GIJA 2FVSA 4NYZA 4K4YA 4OL8A 4WFYA 4OKEA 4EYHB 5F8IA 3T5KA 3QINA 1UOCA 4IH6A 1RYRA 3ZT0A 3L2UA 3VQDA 4CESA 3DRSA 1WNSA 3MXIA 3MR5A 4JRQA 3MR6A 1SL2A 4FBUA 3OVNA 4QWEA 3ASMA 4RU9A 2B5JB 3IGNA 1KLNA 4C8LA 2IMWP 1NJWA 2FVRA 5DGAA 5EUHA 1S6QB 3NF9A 3KMQA 4ID5B 2JC0A 2IOCA 5F8LA 4CF9A 1TK8A 2WCXA 3ZT1A 4O0IA 5KFOA 3LPUA 2AGOA 3O3FA 4AHSA 4OLBA 5CY4A 1T8EA 1VSIA 4M95A 4FYDA 4LSLB 1DTQB 3NMAA 1S1TB 2IM0A 5KFGA 4MK8A 4FLUA 2HMIB 4PUOA 3CM5A 4ECQA 1WSFA 1S0OA 2WTFA 5FDLB 3AVKA 2A1RA 4FJ7A 5DQHA 2QKBA 3TR8A 5KFAA 4ZVEA 1NJYA 3MEDB 3OYIA 3DOKA 4CGHA 1JLFA 2IC3A 2LSNA 1Q9YA 3A2FA 2W7OA 3NF8A 4ID1A 5J2QB 4MIBA 2Z1IA 1I3AA 4DFKA 3LWMA 5EDWA 1S10A 3VQ8A 1RT5A 1RTIA 1NK8A 1RT5B 2P51A 1RT7A 2E9ZA 2Z1HA 4Z4CA 1NK0A 4J9LA 4ICLA 4B9MA 1VRUA 3PW4A 3BSCA 1CZBA 3LP3A 3PUFA 4CE9A 5DK5A 2PY5A 4PWDB 4K4WA 3L3VA 3MF5A 4CFDA 3RMAA 1NKCA 4FK0A 1BISA 3DDKA 1D9DA 4CJTA 4F3TA 1JLQB 4KI6A 1TKXA 1JLBB 2DY4A 4Q8EA 4DSLA 4DF4A 5DGBA 3RBDA 5KT2A 2HWHA 3WNFA 5C25A 3V1RA 4OVLA 4QWAA 4NLRA 2DFFA 1S1TA 1VSDA 5EWGA 2KQ2A 4RW4A 3DOLA 1S0MA 1RT1B 3VQ4A 3HXMA 5F8HA 3K5NA 4FVMA 4LD0A 3SPZA 1VSJA 2R8JA 3RTVA 2BDPA 3G0ZA 3NAEA 3MECA 1VRTA 1TV6B 3IS9A 1VSLA 5C25B 3QEPA 3OYLA 4C8OA 4Q8FA 4B8AB 4KFBB 1ZBHA 4Y34A 3PHEA 1JLBA 2JGUA 4CJ4A 3P83D 2R8IA 1QS4A 3D45A 2XY8A 3QGHA 4K4ZA 3O4QA 3KKSA 2GV9A 4TQRA 3CVKA 3QO9B 4IOBA 3OY9A 5KFDA 4ZTFA 3CJ0A 1WLJA 4M3ZA 4DG1A 3H08A 3CDWA 1TGOA 3JYTA 4PY5A 1ASVA 4IFYA 1JLGB 4J9OA 1UAXA 1HQEB 4DU4A 4L8RB 3QESA 4ECRA 5KFKA 4FLYA 3M8SA 3VQ6A 4ED3A 5C5JA 1SKSA 4EZ9A 3KK2B 3RWUA 4Z4FA 3SQ4A 4MFBB 2W9CB 4FZZA 3V6DB 5K14A 2XGQA 4CERA 1ZYQA 1IKXA 3NBPA 5KFUA 5KG4A 3GV5B 4O55A 3V9ZA 1TL3A 4IG3B 2W8KA 2ZE2A 4BE1A 4KV8A 3AVFA 1HYSA 1GX6A 3V81B 5KFZA 4TQSA 4CJ3A 1D5AA 3KJVA 3T19A 2OH2A 4EYIB 5KT4A 2QK9A 4OGCA 2RKIA 3KK1B 4FLXA 1K6YA 3S3NA 3QEXA 3DM2A 1JXBA 4U7CA 1RA7A 3RB6A 2V0NA 4I2PB 5I42A 4K8ZA 1ZETA 4E7HA 4PQUB 4CECA 4IQXA 3NH0A 1NK6A 1Z4UA 4CK1A 3BDPA 4CEBA 4BACA 4OKKA 3VQBA 1BCMA 3DYAB 3ZT4A 2ALZA 4RW7A 3HVTB 5KFFA 4Z4GA 4H8KA 1ZTWA 4W5NA 3N6NA 1N56A 3NF7A 4Z0UA 3G6XA 2VG5B 1J9AA 2IM1A 3DLEB 1TKZB 4ZVFA 3PX6A 1BCOA 3MEGB 4NRUA 4ECWA 1RT3B 2HHVA 5HROA 1RDCA 1BQNA 4NLVA 1HPZB 4ECTA 1HPZA 3KIOA 3G86A 1BQNB 4GVMA 5HBMB 1T03A 2YNGA 3V4IA 3CM6A 3M9NB 4TN2A 4Q0BA 4ZP9A 1N5YA 1TKZA 4O5BA 3QNOA 2O4IA 4KO0B 3OYKA 1R0AB 1S1UB 4AHVA 5KG0A 1QTMA 1QHTA 3ALYA 1DLOA 4CEEA 1FKPB 4O0JA 2FVQA 1C0UB 3V1OA 4HHTA 3QIDA 1GX5A 4AHTA 1KTQA 3OSPA 2RPIA 2OPQB 2O4GA 5CZ1A 1K1QA 2I5JA 3WNEA 4DU1A 4AHRA 3QEWA 1B9DA 3I0RA 4HVJA 4TYAA 4ZPDA 3L2QA 5EWFA 2D0BA 1QAJA 2P5GA 5D3GB 3KK1A 3QGIA 1TAQA 5D3GA 1QUVA 4GC6A 4B8CA 1W25A 5F8JA 4RW8B 1RT2A 1RAJA 3GYNA 4Y2CA 1NKBA 3NH2A 3BQ2A 4MKAA 1A5WA 3BQ1A 3OYAA 1J5OB 4EO6A 1B9FA 1S1XB 3SZ2A 4NLTA 1Y97A 1S49A 5DLFA 2JLEA 3NBPB 4ECZA 2Y1JA 1IKXB 4RNFA 1SH3A 4N41A 3LP2B 5KFPA 3OJSA 4DTPA 2HNDB 1T3NA 4DFMA 2VG6A 3ISNC 2UUTA 3BSAA 3OYFA 2UVUA 3KK2A 1CZ9A 5KGWA 5J1EA 2BRKA 1ZBIA 2RF2B 2G8IA 3NL0A 4Q0BB 2ATLA 3OL6A 5DMRA 3HPGA 1S4FA 3SCXA 1JLGA 3FDSA 1T03B 5HBMA 3VQ9A 2DFHA 5HP1B 4YNQA 4FXDA 4JV0A 2AJQA 3QERA 3OHAA 2ETJA 1SKWA 3VQQA 1HARA 4CIFA 1JL2A 1Z25A 5J2MA 1JIHA 4OLAA 4XPEA 1JLAB 3OYCA 5T14A 4KRFA 4K8XA 3K5MA 4DF8A 3DMJB 5C42B 1T05A 1UA1A 4KB1A 2GIRA 5L1JA 4K4UA 3SJJA 2VG5A 3EY1A 4O3QA 3CDUA 3OL8A 1RTJB 4NYNA 4CFAA 4CEQA 4CIEA 3SQ2A 3CWJA 3SFUA 3SV4A 4B3OB 2UVVA 1U45A 3SUNA 1VSKA 2B4JA 3AO5A 4B9TA 4ZPCA 4RNOA 3NH1A 3NE6A 3ZSWA 4F2RA 4DLEA 3EPGA 4J9KA 3TAQA 1TVRA 1BIUA 2XHBA 4C8NA 4CF8A 5JXSA 1WSIA 4Y1DA 2RKIB 4I2QA 2R2UA 2YKNA 1WN7A 3DOLB 4I9LA 4FM2A 3RR8A 1MMLA 2FJXA 3SQ0A 1S5JA 3KD1E 4E7LA 4FK4A 4KV8B 2XY7A 4G3IA 1SH2A 2XRIA 1LWFA 4DTSA 3NGYA 4E89A 4FJNA 5SZTA 4ELVA 3GQCA 3TAEA 5I3UA 5K14B 3ICLA 5KGXA 4CJEA 3PR5B 1C1CB 3D28A 4N76A 4CHQA 4O3SA 2E6LA 3I5BA 1YTUA 2CKWA 1JKHB 2P1JA 4NCGA 3OS0A 1S97A 2JEGA 3AVBA 4KHQA 2C2DA 1HQEA 1JXEA 4FJIA 3MEEA 4WZQA 2YNHA 3PV8A 3KLHB 3SYZA 2WK4A 2YNHB 4NLOA 3VQEA 2D3ZA 2JC1A 1SV5A 2Z1JA 1EP4A 3H5UA 2XY6A 2KZZA 3NF6A 3OS2A 3VQ7A 4O44A 2R2RA 4NLQA 3QO9A 4DFJA 3PY8A 4TY9A 3V6JA 3L8BA 1JLCB 2B6AB 1XI1A 1WAFA 2JEJA 5DG8A 3OYGA 1IKYB 5FDLA 1EKEA 3OYNA 3HJFA 1XR5A 2IAJA 1UA0A 4CJWA 3IS9B 3MXMA 3DLGA 5L1KA 3DRPA 2ZQBA 1KVBA 3RMCA 2YKNB 1LV5A 4FCYA 4FLTA 5J2PA 4YR0A 5J2NA 4CGJA 4CF0A 1S1WA 1LWCB 3TQ1A 3S9HA 3DRPB 4FZYA 3O3GA 1S6QA 4FJHA 4TXSA 2HWIA 2IAJB 4B3OA 4BDPA 1TQLA 1S9EA 4CJLA 4X2BA 1TKXB 4IRKA 1DTTA 4OPKA 3ZSVA 3F73A 4F2SA 2X6NA 3P1GA 3P5JA 5L1IA 2KTQA 4QWDA 1F21A 2B43A 4NLXA 5KFWA 4F8RA 1OS5A 4DTXA 3O4NA 3CQ8A 4O44B 4FJKA 1RT6A 2BGGA 4IH7A 3OYMA 3UIQA 2OPRB 3AVNA 3H2LA 4J9NA 1SH0A 1EP4B 2OPSA 4ED2A 1RT7B 4KTZA 4LSNA 5F9NA 3CJ2A 3KLHA 4ED8A 4FJXA 1LWEB 3C94A 1NHUA 1QSSA 2UVWA 1QSLA 5KT6A 3CFPA 2W9BB 1W9HA 3AVHA 4CCHA 3I0SB 3HP6A 1S1VB 2R8HA 2QKKA 1C1CA 2DPJA 3H40A 4MK7A 3MEDA 5KFNA 2KFZA 4IKFA 2HNDA 3LP1B 4YP3A 4KAZA 1NK5A 1RBVA 2VA3A 1KLMB 3V6HA 4R5PB 1XR7A 4O4RA 2ASLA 4TYBA 1QQCA 3AVCA 3PX4A 5JS2A 1ASUA 2YHAA 4YR2A 4PA1A 1DTQA 4LSLA 3OLAA 3N6LA 4Z4HA 4M3TA 3AO2A 1VSEA 1QE1A 3VQCA 3LZJA 2VA2A 2W7PA 4YMEA 3AVJA 5CZ2A 3KLGB 4YFUA 3KKRA 2DPIA 4NZ0A 1HMVB 1D8YA 2RN2A 4BWJA 3ZSZA 4WE1A 1NKEA 3NGZA 2B5JA 1L3SA 3MFHA 2EX3A 1TP7A 3PO5A 1WSJA 2OZMA 3BSOA 3LP0B 2WONA 4ED1A 2WB4A 4FLWA 2F8EX 4DTUA 2D5RA 4BE2A 2IS3A 5KFYA 4H4OB 3T5LA 2F96A 4F4ZA 4CGGA 3PO4A 3GV8B 3HT3A 3IG1B 2W8LA 3Q8PB 4J2EA 4KTQA 1JLAA 4RW9A 1X9MA 3QIPB 1NOZA 1VK0A 1YVFA 3KLFA 2J6UA 3SV3A 4DQIA 2CJQA 2FLPA 3AV9A 4U6PA 3KLFB 1RBSA 3FSIA 3QIPA 5KTQA 4CGFA 3OHBA 4NLWA 2YKMA 5KFBA 3AA3A 1QAIA 2VWKA 2F8SA 3RAXA 4IH5A 1TL1A 5F8NA 2VG7A 4ZPBA 4Z4EA 3KOAA 3UQSA 4GC7A 3HVTA 2AX0A 1CXUA 3LP2A 3KLIA 4R0EA 3M8PB 2XCAA 2YHBA 3ZSOA 4NCAA 3TAMA 3CFOA 2AGPA 2G8HA 4F3OA 2WHOA 3HPOA 4F4YA 3TANA 3TVKA 2E9RX 5I42B 4KHMA 4CGDA 4I2PA 2JEFA 4FK2A 3DM2B 3KLGA 5KFLA 1TK5A 1C0TB 1BL3A 1HQUA 4CEDA 3UPFA 2AQ4A 4J2AA 1IKVA 4DFPA 3V9UA 2VWJA 3JSMB 2PYLA 3AO4A 4CF1A 1RDRA 4M94A 2BR0A 1U48A 3ZSQA 4B9VA 4LQ3A 2OPPB 4FJMA 2FVCA 2ILYA 3V81A 4FJGA 4QW9A 2ZE2B 3KLVA 2R8KA 2I5JB 1X9WA 4KKOB 1VSMA 3KLIB 5KRTA 5KFRA 2R7YA 3ZSYA 1LW2B 2YNIB 3V6DA 3LZIA 4JLHA 1RCHA 1RYSA 1KFSA 4ELUA 3CG7A 2BE2A 1S1VA 1TL1B 3L3UA 4CJFA 4RZRA 2HHTA 2V4QA 2HHQA 4CEZA 5C24B 4LH5A 2YKMB 4CEFA 3I5AA 2FJVA 4BDYA 4RNMA 1RILA 2J6SA 4E7JA 4KSEB 3V4IB 1XHZA 3KK3A 3K58A 4FW1A 4CJSA 4IFVB 1BQMA 3DRRB 4CJQA 3JYTB 4J9PA 5HROB 1RT4B 1VSHA 5FROA 3O3HA 2DFEA 1X9SA 3IRXB 1C1BA 4LH4A 4JV1A 1FKOA 5KG7A 3CIZA 1KHWA 4AILC 4QOZB 4FBTA 5CYMB 2C28A 4H4OA 5F8GA 4ZMMA 3C6TA 2E6MA 4FM0A 4KI4A 2ZD1B 1S9EB 3H98A 2GC8A 4B08A 1KFDA 3OJUA 1B92A 4K4XA 1WSEA 2GBZA 4G1QB 1TV6A 4EBCA 1EX4A 3OL9A 4CHNA 1S1WB 3GIMA 3HP9A 5HRSA 3OYHA 5J2PB 4IKAA 3S3OA 1RT1A 3K2PA 2IJNA 4FJ9A 4CJRA 1S9GB 3LAKA 2D7SA 2F8TA 3K5OA 4ELTA 3CJ5A 3NGIA 4NRTA 4BE0A 4IG0B 5F9LA 4ECSA 4K4SA 3AA5X 1SL0A 3AVLA 4KHWA 3SQ1A 3H59A 1BI4A 2EHGA 4MH8A 4J2DA 1GOBA 4CF2A 4IR1A 1BIZA 3H5YA 3I5CA 4K50A 4FLZA 2ASJA 1HNIA 3MFIA 1L5UA 4XIUA 5DG7A 3HPHA 3IAYA 3ITHA 4Y1CA 2G8FA 4HCBA 3OL7A 1IKWB 2BANA 1U04A 4FJLA 3QLHA 5JS1A 1LWEA 4ICLB 1L3UA 1UWBA 1WSGA 1D9FA 2OPSB 4DL5A 3TWHA 3QLHB 1RBRA 4K4VA 2BANB 1RT6B 4DG1B 3QZ8A 4GMJB 2HHSA 3IGVA 5HRPA 4ED6A 1HYVA 4IRDA 4AHUA 4K4TA 4B9UA 4OJRA 1DTTB 1SL1A 4O3RA 3WNHA 4KHSA 2X74A 4E1NA 4ECYA 4DTOA 3AA2A 3FQLA 1RA6A 1S0NA 3PX0A 1RNHA 4KFBA 1SUQA 1RDBA 5KG3A 2HMIA 4QWCA 2IM2A 3LWLA 2IGIA 4DTJA 1VRTB 1WSHA 4MK9A 1A5XA 4CFCA 2UVRA 4CJPA 5CYQA 1NNDA 2R8GA 2NUBA 1S9GA 1HNVB 4R8UB 3F9KA 3I8DA 4H54A 5HLFB 4WZMA 4NYFA 3SPYA 5HLFA 3DLKA 4O3PA 4R8UA 1ZTTA 3BQ0A 5CYQB 3PZPA 4F4XA 4DSIA 4ED7A 2XI3A 1N4LA 3FQKA 4G1QA 3TI0A 1VSFA 3K59A 3C6UA 2FBVA 4FS2A 1SUQB 1X1PA 4DTNA 4B9LA 3HYFA 4B9SA 3LAMA 2IDOA 3L2RA 3SFGA 4MKBA 1JLQA 1J53A 5KFTA 1RTJA 2YNFA 1N6QA 5DG9A 4CGIA 3BSNA 4TLRA 4PWDA 1T94A 5CYMA 4DEZA 4J9RA 2E9TA
chains in the Genus database with same CATH superfamily
4JK7A 4IXCA 4GNIA 5U47A 2H3GX 1X31C 1E6YB 3DRRA 3O9SA 2Z2MA 3CC2S 2XZDB 4KE5A 2UXCK 1VHXA 7AT1B 1DURA 3OTDA 5AQSA 3IWXA 5G0RA 1HNWF 3W9JA 4BC4A 4CTAA 4W92B 3LGMA 3QETA 1HI0P 3PIOQ 3N9UC 2CWXA 1CS4B 3VGSA 2ERRA 2HHUA 3QSYB 3JS6A 4X4QA 1A5VA 3N79A 3CHWA 3GE9A 1JL1A 1YKWA 2HHWA 3WZ0A 5KFHA 4DQPA 3KHGA 5B8HA 2UXCJ 1IR2A 2JSXA 3HFVA 4F36A 4I2QB 2AWZA 4IOCQ 5AQFA 3RSEB 1YTAA 2I1RA 4RL1A 1GFWB 2VV5A 3T9NA 4Y0WA 3NKYA 2D0OA 2B4OA 4O3OA 3FZKA 4AH9A 2DNOA 2E44A 2G4BA 1HLUA 5CXTA 4FW2A 1N54B 1ZBLA 2BE9B 3CD6N 1WNEA 4KGVB 3RRGA 1MDUB 4ZA1A 1EETA 1NK9A 3M8PA 4LF6J 4YB1P 5GAHU 1O1WA 2A5XA 3NGUA 4ZPVR 4DV3F 2D0CA 2IJRA 1DBDA 2E5HA 4CEAA 2P5VA 2O5DA 2DRBA 1N5QA 4MYTA 2M9KA 2J9DE 5HANA 3MTKA 2RNEA 3KHHA 1KTVA 3B4DA 2BRLA 3M8WA 4PG4A 2QT7A 1J6ZA 1RTHA 3R5DA 5KFSA 3SMZA 1T6DA 4CLZA 4RO0A 4BR2A 4HI1A 3D0PA 1HBNA 3HVAA 3BR9A 4ZVOB 3Q89A 5B7WA 5BYQA 1UJ5A 1RTHB 2VOOA 2FF3B 5BR9A 2IVMA 1P90A 2F9TA 3DLEA 1YJ9N 3G10A 2CG4A 2PDAA 2CZ4A 4CLPA 1TFWA 3CCRN 3CJCA 2KXNB 4CHZA 4YOYA 3PW2A 1WB9A 4DV4J 2B3TB 2I7NA 4Q45A 2UXDF 4H5VA 2N3LA 4IOAQ 1S1XA 3RB3A 3BREA 4YY3K 1BD6A 4Z7CA 1R8PA 3AA4A 4LFAK 3O8MA 3FVYA 3VN5A 1BG3A 5DDPC 4C3LA 2DGSA 3IN5A 5HQLA 3OXLA 3Q7BA 4TLQA 4J9QA 2ZJRL 4BR4A 3D0IE 3K0JA 2UXBF 2FHMA 4X64K 4M5NA 4QPXA 4FWKA 1GXLA 1KWMA 2DNQA 1KLMA 3FEYB 5C2CA 3CCQN 4LFAJ 1WEZA 4H5WA 4LY7A 4UZBA 4FM1A 3ILJA 3EE3A 3S3MA 2YKOA 2G1HA 2ZDPA 1F1BB 5F0WA 1GLCG 2XMKA 4UUXA 5AQNA 2RDJA 2NSCA 5AE2A 4XDDA 1QVGM 2E2PA 4M41A 1CJKA 3GILA 4PXCA 4M45A 4DR2K 3F9MA 3MEKA 2MHEA 4JI8F 3IFRA 4H5RA 3JS9A 4KB7A 1GLJO 3LP0A 2ZJQL 1F0XA 1X0FA 4N77A 3FCWA 2DXFA 1AFJA 2XNRA 4B3RK 3AVIA 4ED0A 4HACB 3AO1A 5SUHA 2CQ2A 1T6CA 2ZH2A 1TL7B 5J2NB 2BV3A 4UY8O 4QW8A 4B1WB 1K8KB 1TAUA 1FWKA 1G4CA 4ZVHA 3KLEA 1HNVA 2HG4A 2NXJA 4CEOA 3DLGB 3OTOJ 1NMEB 2H48B 4LJMA 1XMQJ 3E9PA 4AUKA 2FBXA 3M8ZA 3LDOA 3UCZP 5B0AA 3K57A 4HTUA 5CYJA 1HNWK 4JI6F 5DDRC 3SMPA 3U9DA 2DHSA 4IRCA 5FLXY 3ID8A 2FTRA 2AW0A 3DHWC 4ZHRB 4TU8A 3Q8YA 4KHNA 4LF9K 5KG1A 1ZBFA 3LPTA 3C14B 3EX7B 3SUOA 4DSKA 3ETMA 2O8FA 4J7CA 5HL7Q 3PW5A 3OA9A 2HRUA 1RBTA 2M88A 3R1HA 4NCGB 3LDPA 4M3RA 2XBPA 3MGJA 1C1AA 1HBMB 4DR1J 3CF5Q 2VB6A 2OUGA 3M8QA 3DOKB 1UVKA 5HVGA 1SJ4P 5A8WA 2M8HA 3EGNA 4YR3A 4DV6J 2E20A 1PG5B 5ETNA 1TKDA 2F7VA 1NO8A 1IR0A 1LWXA 4CNZA 4U67Q 3OD2A 1BY9A 1C0FA 2FIUA 4RX6A 3BBCA 4CLKA 3TYTA 3HSZA 4KTWA 3HKZD 3TRGA 1S6OA 2KHCA 1IBLF 1VC5A 4DQRA 3AO3A 2YHYA 4ZCIA 4CJ5A 4RW4B 4ECUA 2C2KB 3VOVA 1YJNS 1FK9A 1FDAA 3RU0A 2HIYA 1SKRA 3QEVA 1FNOA 3TARA 4OPJA 3TZWA 2E8AA 4FF1A 1IKYA 5LMNK 3DLHA 5ELZA 5HRNA 3M8QB 4YQWA 1JLCA 2DNGA 2AYMA 1NDLA 2MQNA 3KMSA 4I6MA 1Y5NB 2CNKB 3ZZRA 1EKSA 1HWIA 5C2GA 3M6XA 4LBIA 3ZCMA 5HMYA 1NGBA 2ZEJA 3NAIA 3W1YC 3QIOA 1FWPA 2R7OA 1YGYA 1VRQC 2PSZA 2BH1A 2CNOB 4J37A 1RCXB 2CGKA 1HNZF 4D3GA 3CJ3A 3IWLA 4RUAA 2P9NB 2EG2A 2GHPA 2N7YA 3K8WA 5L8RC 1BGXT 3R6GB 4P7VA 2MQOA 3KWIA 2I0XA 4IOXA 2EG1A 4Z4IA 2Q6BA 3ZTQA 1ZA1B 4DPTA 4WYBA 4N56A 1RQ0A 3VQAA 3JTNA 5L9NA 5L1LA 4WK1A 1IKVB 2CPEA 2H54B 2OJ3A 3VTHA 1VIOA 1U7LA 3NAHA 2QXFA 3D0GE 4F4WA 3H6EA 2VWBA 5HOOA 3CCUS 2CQ3A 1TVRB 4CM2A 2NRRA 3M8YA 4DDFA 4HACA 4FOEA 3I0RB 4M5HA 1FCAA 3ILIA 2HBRB 1IM4A 4DV5F 4QWBA 3O9RA 5BYRA 4CZLA 3CE8A 3SUPA 3GB0A 3SAHA 4EHTA 1M1GA 2DGQA 3GCWP 3VEXA 1WDTA 3UWTA 1W0HA 2KHOA 3CC4N 1MG7A 3EDQB 4DMZA 2PEBA 1I39A 3W65A 1QSYA 4CHPA 1KVCA 2DTUA 3T3FA 3L2VA 3P3DA 2C3UA 3SSRA 1K8AO 2QL5B 5HJYA 1CC8A 5AQKA 2UU9F 2V4RA 3M32B 1MW7A 4NA3A 2ADCA 1CQMA 1U2VB 3HL8A 3QZ7A 1BQMB 2DNNA 4QBUA 3TAGA 3VQPA 2N4DA 1IN0A 1RBLA 1KNZA 2E4LA 4PEOA 2KZMA 4ECXA 4CJKA 3OW2M 4WF9L 4H4MA 3PKYA 4JKCA 4WP3A 4OV6A 1KBRA 4RW7B 3QYYA 1KVAA 3KZBA 3UVJA 2HRYA 4ZOSA 1YTYA 5KFVA 3RG6A 2L3MA 1Y7PA 3EGWB 4RUCA 2Q36A 2ASDA 3N0VA 1HMVA 1I94J 2OPPA 1HYZA 1YBUA 3GJSB 3M9MB 3THXA 3B6BA 2VIHA 4DR4J 1NJZA 4FKYA 2GMLA 3EYZA 1PILA 3CCWA 4BGBA 1QE1B 3CSKA 3FMWA 3IDHA 2KFNA 2JX2A 5AFUA 2BQRA 3TAFA 5AE1A 2QZ8A 4K8RA 2M7SA 4RPFA 2ZITA 1J54A 3ETOA 1U2FA 1WF0A 4NLDA 3MZIA 1TMJA 4DR6K 2BE7D 4M5KA 2CFXA 4EO8A 4TVAB 8AT1B 1B7FA 1WACA 4FWMA 3SMSA 4DQ8A 3MPYA 1ZM9A 4QU6A 4L3NA 1LAVA 3W5XA 3JSYA 3DI6A 4NLUA 3RMDA 4KQZA 1V4TA 3ZT2A 2FVSA 1N52B 4PPZA 5J1NA 1XMOF 2CGJA 4OKEA 1Q1KA 3MM7B 4JD2B 3L2UA 1T02A 4UZCA 1WNSA 2F1FA 4DR4K 2H4WB 4LF1A 4OZ5A 1KQFB 3M2VB 3MXIA 1SJ3P 1W7WA 3MR6A 2HVEA 4QWEA 1EIYB 3HSCA 1RGIA 5CD4A 4JI7K 3PYFA 3D9BA 3HSGA 2FVRA 5DGAA 2A2DA 1S6QB 2AF6A 4OHZA 2JC0A 4NI2B 3EMTA 4A8SA 5F8LA 4CF9A 1J2VA 2UXDK 3O08A 3LPUA 2EFNA 4RWTA 4HHJA 2E2NA 5CY4A 3R6MA 2ZHAA 4M95A 5H1SV 1FRXA 2FSNA 1YJRA 4WP9A 1WSFA 3QRRA 1RWUA 3AVKA 2A1RA 1X5OA 1NGIA 1FT8A 4ZVQB 5DQHA 3TR8A 5KFAA 3A3NB 4JI0K 3DOKA 1RLCL 3O1LA 1H74A 1N32K 2LSNA 1Q9YA 1I51B 4YY3J 4ID1A 2DR6A 2LKZA 4MIBA 1O6XA 2MQQA 1I3AA 3ZX2A 4BR7A 5EDWA 4HHHA 2XMVA 1IWAA 3M6VA 2L9DA 1HR0J 1XNQJ 1WOPA 1W97L 4K7QA 4HTIA 3BSCA 1CZBA 4JI1F 1PJ7A 2ZH1A 2A3JA 2MY8A 3L3VA 4CFDA 4KGZB 4FK0A 1DFDA 3R3TA 2KKZA 1D9DA 4F3TA 4CBWA 3OBIA 5HVHA 4C23A 4PKIA 1TKXA 1WC5A 4XH5A 3GDQA 1JLBB 5H9FJ 3IP0A 2DY4A 3ZNUA 5ETKA 4DF4A 5DGBA 3RBDA 1KR4A 1Z2LA 2O1PA 3BGOP 4ZCKA 1KQSR 5C25A 3TW0A 1T3VA 1VSDA 5AQPA 1XMBA 2CJXB 2J0XA 2KQ2A 4F0MA 1S0MA 2H51B 1RT1B 5F8HA 3K5NA 3MCNA 4FVMA 1T95A 4I0WA 1NPRA 4RBTA 4LD0A 2UU9K 3G0ZA 4ZLNA 1VRTA 3EN9A 4ES1A 1TV6B 2OMLA 1T9YA 1VLYA 1YIJS 3QEPA 1TU0B 3ZFVA 1WC6A 1SI9A 1ZBHA 1M5PC 3D45A 1SZ2A 2P9CA 1VK8A 1CVJA 2XS2A 2XY8A 4JB8B 3U9ZA 2VPXB 1F5BA 3GJQB 3KKSA 1GTEA 2ZFHA 3QO9B 1HHTP 1DARA 5KFDA 3B8AX 4ZTFA 1WLJA 4DG1A 4WCEL 1LK5A 4PY5A 2QGFB 1ASVA 1I5OB 3W64A 3C14A 5D4OA 4ZLJA 4OV1A 4EZ9A 3R3LA 5AQLA 3GOIA 4H5TA 5K14A 3ZX0A 1N33K 9RUBA 1E4GT 3NBPA 4OYOA 2CUYA 4A5AA 3V9ZA 3MM6A 2R42A 1TL3A 1Y11A 2ZE2A 4KYZA 1SS6A 3WIUA 4DBQA 3T6BA 2O8EB 1D5AA 2BMBA 3T19A 2IVOA 2OD4A 3KDNA 5KT4A 2QK9A 4OGCA 2GCFA 2J5AA 3VHQA 4P9SA 1RGVA 2W6LA 1FFSB 1N5SA 2V0NA 3RB6A 2O8BB 5ADZA 4PQUB 1R7IA 3EXYA 1OSCA 3BDPA 4CEBA 2H5IB 3VQBA 1S7IA 2CQ4A 4WIIA 2MKCA 1RWNB 4EGLA 4KHPJ 3UDVA 4Z4GA 1SAZA 1AXQA 2GHWA 3N6NA 2WC9A 3G6XA 3UKUA 4MLEA 1IBKJ 1R31A 2VODA 4ZVFA 3P31A 2HSTA 5IM0B 1IJEB 3PX6A 3Q22A 3A8YA 4RU2A 1RDCA 1B99A 1EX8A 4UTGA 3P49B 2EKNA 1U2VA 1BQNB 5HBMB 4UY85 4DCPB 1OH7A 4IZ9A 3V4IA 2QYCA 3M9NB 3SCIE 2X1BA 3QAUA 4DUTA 2O4IA 3V5RA 3TUPA 3MI7X 1R0AB 1QHTA 3ALYA 2FVQA 3DRXA 4DV1J 1NGAA 3N28A 3QIDA 1Q7YO 3KG4A 4WFAQ 4LR8A 1GX5A 4AHTA 1KTQA 3OSPA 2WVDA 5AQIA 1J27A 2RQCA 1VQ6N 2I5JA 4LF4F 4ZLPA 4HVJA 5EWFA 1GAOA 4JOUA 2UXCF 2RMLA 1XQSC 2P5GA 4UOGA 5D3GB 3RSEA 3QGIA 5D3GA 4B8CA 5F8JA 4RW8B 1OYEA 1WEYA 2Q66A 4GKKJ 4Y2CA 1NKBA 2DEIA 3HOSA 3NH2A 4NXMF 4MKAA 1A5WA 1Q16B 1W26A 2FHOB 4PWWA 5EY4A 2HVDA 4B3RF 4P52A 2DR5A 4EO6A 1S1XB 1VQ7S 3SZ2A 1ULRA 5DLFA 4LF7F 1QHAA 4ILLA 4LF5J 5KFPA 4DTPA 4HI2A 3JXOA 1UAWA 2YQ0A 2HEKA 2LVWA 1P1TA 1OPIA 3NGRA 2UVUA 3VEOA 1CZ9A 2Z0GA 2W4PA 1JMTA 4DUZF 3D3CJ 4Q0BB 3C8YA 3LQVA 1NLVA 4NLCA 2ZOFA 1RABB 5HBMA 1VISA 3BP8A 2AJQA 4YHHJ 3PKMA 1SKWA 3ZTOA 4CLTA 3IBWA 1IWGA 4DR6J 5J2MA 1H98A 4BLGA 4LF5K 4DF8A 3TA2A 2K8GA 5L1JA 1UCNA 3Q24A 3CCUN 2UUCF 3OL8A 3ZLJA 2M0GB 1REGX 3TO8A 2PBDA 1R43A 1U45A 2KJVA 1VSKA 4B9TA 1ZM2A 4F2RA 1FKAF 4J9KA 5IC6B 1FEHA 4F7VA 1PKUA 2J7UA 2GQ2A 4I2QA 2R2UA 2W1BA 3JB9k 1S76D 4NASA 1X8DA 1MMLA 2DR7A 1S5JA 3KD1E 2IYGA 2U1AA 4FK4A 4Y2MA 2HIQA 2LA6A 3AOAA 1JXVA 2Q6CA 1K9MT 4E89A 4ELVA 2XS5A 2EW9A 2DT9A 3GBTA 4YDUA 4M63A 3UO0A 3J7YP 3QDKA 1UEKA 4DUYF 4NCGA 2JEGA 4BG9A 1RE1B 3H2UB 5M1QA 2YNHA 3PV8A 1EJ7L 4JKEA 2YNHB 4NYOA 3D2FB 1SV5A 2Z1JA 2NREA 3FSYA 2XY6A 3NF6A 3VQ7A 3TU5A 1OKJA 5EN1A 2YX7A 3D67A 2R2RA 1T9XA 3PY8A 2RIJA 3QRQA 3V6JA 2B6AB 5ETRA 2CH5A 4NEZA 5LJVA 3D6RA 3OYGA 5GIOA 4M5IA 1RAAB 3E9LA 4BRQA 3HJFA 2GZOA 1YG0A 1XNQK 2I8EA 4J5OA 2MJUA 4CJWA 2IFXA 3DLGA 3MXMA 1U0HA 5F3ZA 2OSQA 1KVBA 3FUYA 1U1NA 5GAEU 2HZAA 2H5EA 3D1OA 4FLTA 1I1GA 5BXIA 5J2NA 4CF0A 2HPUA 1VAZA 1LWCB 2K06A 4YORA 1ATRA 1S99A 3MCSA 3DRPB 3POTB 4OI6A 8RUCA 2FJEB 1HX1A 4WTOB 1XERA 2IRYA 1TKXB 5K5MA 4OPKA 2J76E 1HNWJ 5LM7E 3F73A 4GRSA 2V8GA 2ZH4A 5L1IA 2A6AA 4DV7F 4DR2F 4K2XA 2DYAA 2NRHA 4F8RA 3R9PA 1P8GA 4HTJA 2F9DA 2GVZA 4CO5A 4IH7A 3AVNA 1SH0A 3MN9A 4F0HA 5GAHP 3BGFA 4IUFA 2YVSA 4ZVPB 3CC7N 2BM0A 2PGCA 4KH1B 1HBUB 3CFPA 2NR0A 2W9BB 1R8HA 1W9HA 4J90A 2KFZA 1SJ1A 1NGDA 1N8RT 3LP1B 4YP3A 1NEEA 2VA3A 1KLMB 5DM6L 4DR5K 3V6HA 1G7CB 5D6GA 4LF9J 5ETTA 2CQCA 5RUBA 4DPXA 2YHAA 1FRIA 9ATCB 4BRKA 4Z4HA 2AA4A 3AO2A 2DHHA 2EXUA 4L3KA 4X4RA 2W7PA 1HR0K 1NU0A 1YRTA 5CZ2A 3KLGB 4W90B 4B17A 4USHA 2RQMA 1SJRA 3P39A 2VFUA 2RN2A 4X4PA 3SSQA 3ZSZA 3WC2A 3FGUA 4DX7A 3KJFB 2HBMA 5C10A 3CCLS 1WSJA 2OZMA 4ANEA 1NBWA 2HQFA 3M2VA 5LMNJ 3ZZYA 4C3MA 2WB4A 2F8EX 4O8KA 2MZJA 2IS3A 3HT3A 3MAAA 1NHKL 3IG1B 3CJRA 4KTQA 2QG9B 4EAHD 3RUBL 5D4LA 3NGSA 4CQ1A 1Q8KA 2CWKA 4U6PA 5AZJB 3T6JA 1TELA 4ES3A 4V19J 4OJ3A 3FSIA 3QIPA 1WSVA 4CGFA 4TNOA 4NLWA 5KFBA 1S79A 3RAXA 4ZJQA 2AZ1A 2NZCA 2AX0A 1CXUA 3EGVA 1DQ8A 2M70A 4A59A 2CPDA 2YHBA 1NDPA 3ZSOA 4NCAA 4LREA 3G6EN 2AGPA 4F3OA 3I4HX 3D0HE 4PWUA 3H1QA 4DV2K 2O8BA 4CGDA 2MPUA 4I2PA 2V52B 2F8HA 2NUUG 3DM2B 5KFLA 1HNZK 1TK5A 4E98A 3BEXA 1RAOA 4NL5A 5GINA 1AZSB 2VWJA 2E66A 4ERDA 2JJ4D 3WXIA 4JV5K 1FRHA 2F65A 1ZM3A 4PYDA 4LQ3A 2OPPB 4R79A 4I64A 2ILYA 4FJGA 4LBPA 4CBXA 2A3ZA 1LQ9A 1VSMA 3KLIB 2YX6A 2R7YA 3FK4A 4IJNA 4M5LA 3ZSYA 4DV2J 2IVYA 1LW2B 1YUWA 2YNIB 2LDYA 2E5LF 1RCHA 4ELUA 2BE2A 1S1VA 3L3UA 1T3OA 3E66A 2HHQA 2IHR1 5C24B 4Y0FA 4CZIA 4RNMA 2MLXA 2J6SA 2E5GA 2OO4A 1LKZA 2V8HA 4GKKF 1XHZA 3KK3A 4Y2KA 4Y00A 3K58A 2DO0A 1UKUA 1BQMA 3DRRB 4GVEA 4CJQA 4USTA 5D0GA 2WW4A 4LH4A 5KG7A 1EKRA 4AILC 1N0UA 4FBTA 5CQGA 1WUAA 1Y00A 2CNNB 1RWMB 1VQ8N 3UCGA 5F8GA 4X62F 3CI5A 4JI2F 2IY5B 4ATNA 2E6MA 4FM0A 2HS0A 1S9EB 1KFDA 1URNA 1O13A 3I55N 2FJAB 3OJUA 2K2PA 5IT0A 1YDLA 2GBZA 1TV6A 3VEWA 3OL9A 4DJBA 3V2UC 3TTDA 3HP9A 5HRSA 5J2PB 3S3OA 2XZWA 4FWSA 4CJRA 5AT1B 2VGNA 1KAYA 2D7SA 2GGPB 2W4CA 2IVNA 2V8PA 4KHWA 3OTCA 4CH0S 3SQ1A 4MH8A 1PYTA 1H2UX 3JTPA 1BIZA 3VAKA 1P6TA 3I5CA 2IVPA 4K50A 2J7KA 2IYIA 4XTTA 1D4XA 4PKGA 2LQ9A 3HPHA 1ZPWX 4OX6A 3AQOA 4HCBA 1FDBA 1Q81O 2MGZB 3BN7A 1U04A 1WG4A 1LWEA 4ICLB 1B64A 3R2CJ 1NM2A 4CZJA 2B9WA 4GO5X 3TZYA 1WSGA 3C15A 1RWKB 5GVQA 3QRPA 1JWWA 2CPFA 3SDEB 3IWNC 3U8XA 3TWHA 2AP6A 5JVHL 5I3PA 2P9PB 2BANB 4ANCA 2FB0A 1GT8A 3IBFB 5HRPA 2AYEA 3LPEA 4M63C 1LOUA 4B9UA 4OJRA 3CPEA 3M1VB 4DTOA 2YY3A 1RA6A 1S0NA 4KFBA 4ED4A 2CIMA 3JSBA 3FFKB 1RDBA 1WHXA 5KG3A 3L9ZA 2EC2A 5IV3A 2WSEC 3L7PA 3W2WA 3WQTA 4F04B 1YITS 3HFKA 3CC2N 1S9GA 2P9LA 4DR7J 4C4WA 4H54A 3SPYA 1YXQA 1UP1A 3DLKA 3VZIA 5DM7L 1U1KA 3WX4A 2UP1A 1ZTTA 3BQ0A 2HVZA 2LXUA 3FCHA 4QIWD 4M1KA 4F4XA 1AT1B 4CLUA 3FQKA 1N4LA 4USJC 4G1QA 3OUYB 5JVGQ 3TI0A 3QT8A 2R4FA 2FBVA 3CF5L 4B9LA 4B9SA 3LAMA 3L2RA 1FF2A 2MQLA 2X1GA 4WU2A 1JLQA 2NXCA 2YNFA 2FSJA 4C1NK 3NCQA 3H42A 5DG9A 1NB2A 4TLRA 5CYMA 2OTLN 1UEVA 2X7IA 2E9TA 1OIAA 2DGVA 3KWMA 3CT9A 2L41A 2AYBA 2XY5A 5ETOA 4YHHF 1UL3A 2FC9A 1NH7A 5EWEA 3MOJB 2MYFA 3C16B 5F8MA 3R27A 1YT3A 4ZN3A 5L38A 3MX5A 4USMA 1JKHA 1YI2S 4XO0A 5J2QA 3CFRA 1Y5LB 3OFEA 5KPRA 4OYZA 1GOAA 3CD0A 5J1EB 1UFLA 1QTNB 1GOCA 2VG6B 4ZP7A 2GQQA 1UJ6A 1NJIT 4DR7K 3E01B 1VQ8S 3IR6B 3OVBA 3LW5C 2CNLB 1XWLA 3W3DA 3P4UB 2EVZA 4TSXA 1Z26A 4X4TA 3CCMS 3WEEB 1F2GA 4WXWA 3MM9A 3DGPA 1Z6RA 4JI1K 1XNQF 3KLEB 2RDDA 3TTFA 2ZJPL 3VQTA 1TL7A 1WC4A 4GKJJ 2GWKA 2ILZA 1LXJA 2F4VK 4FNHA 3OV7A 1GMUA 1S0VA 3PHTA 3NGDA 2YQ3A 3BKUA 3UNGC 4WYWA 4FL9A 2QWMA 2CPZA 2FHJD 3UDCA 3BEGB 1DLOB 4Y2AA 3I33A 2HURA 3CO9A 4AQYK 5ETSA 3JSRA 1S7HA 4GKJK 1CJKB 2POKA 3KK7A 3NDKA 3V9SA 3SI6A 3CCEN 2MKSA 3I8BA 3O9QA 4DWIA 1JNRB 3AAWB 1S48A 5GADI 3WBZA 3C95A 2UXDJ 4BR9A 4DQSA 4AE5A 2RE2A 5C24A 2K1RB 2HZVA 1H72C 2W25A 2FBYA 2WONB 2W2QP 2YNIA 2MY7A 1U6ZA 4FXVA 2AHOB 4BRGA 3RMBA 1NRKA 3DYAA 2EFPA 4DR1K 1DT9A 2WBRA 5CD4H 3VALA 3VEZA 1AFIA 2CZVC 4MQ3A 4RNHA 1U1LA 2PIIA 4USWA 2K3KA 2MKHA 4JKAA 4O3NA 2JFKA 3HJVA 4LRCA 3GE1A 1N32J 4CFBA 4I6AA 5M2RA 4E1JA 1YITN 1R0BG 1DJ0A 5IQ6A 1VHIA 1Q9XA 3A3OB 4JNEA 3MM9B 3KHLA 3M3ZA 3GR1A 1NWKA 3DLRA 1VQNS 3GSIA 1YBAA 1SC6A 3THTA 3TAMB 4UOCA 1QQNA 1IBLJ 2Z58B 1KVJA 2QTDA 3WDOA 4DUYJ 1RAHB 1V4SA 1TK0A 3AQPA 3THWB 3CETA 4YEAA 2HGNA 5EX0A 3AD7C 2W40A 1XNRK 4KO0A 3IXQA 4A4JA 4WTYA 2XS7A 4QS9A 5ETVA 5D0RA 3CMAN 2XC9A 2DCUB 2YNGB 4NA1A 1HFEL 2ZKUA 2ZZNA 3LDSA 4LSNB 3TABA 1VQ5N 3AVAA 4KIAA 1RT3A 1OO0B 3N6MA 3VZHA 2DO4A 4OYXA 3D3BJ 3BH7B 4Q2LA 4OKJA 4ZPAA 5A2QY 5KT3A 2YNFB 5M1KA 2QA4S 1HJOA 3M2UB 3ZSRA 3MDFA 4B3MJ 1FEEA 2WVCA 3UDEA 1EETB 3BGLA 4HYKA 1RWVB 3F0NA 1S3XA 3Q83A 4WYLA 2PYJA 5JLHA 3MECB 1BMQB 3OLBA 1JCEA 2Q3SA 3OYBA 2VBYA 4LQ9A 4YY3F 5GMKa 3NHGA 1VQPN 2MQMA 3ULHA 2HBKA 4DV3J 5KQDA 1UVJA 1YVUA 1B4SA 2JEIA 1NG9A 4I7FA 1YJUA 2GS8A 3VAGA 2GQCA 2PFFB 2C3MA 1XNRJ 2BEFA 3K5LA 4JI2J 4DV1F 1KSPA 4P6QA 4HKQA 3QICA 2QEXS 4X66K 4P72A 2UUAJ 4LF4K 1KRPA 1U1RA 3UCUP 1FVSA 2WSCC 4A61A 2BQUA 3S1TA 1KD1O 4GMKA 3SQGA 2CH6A 4MJKA 4WKYA 1Q8BA 4CTAB 4CDIA 5DETA 1E4FT 4DV5J 4DL4A 1JLEB 3EE8A 1Y3JA 3P5TL 2QM1A 1CULB 2NLXA 4I68A 3NRBA 3ZEUA 1VRUB 4NXMK 1D1UA 4P2SA 4CHOA 2QFIA 2AKWB 4AD6A 1X4CA 2AJ2A 3FCVA 3TZZA 4PL7A 2E1ZA 3CD5A 2UUAK 4ZHRA 2RRBA 1VJWA 1L3TA 3V1QA 3HVWA 1U4BA 2WOMA 4QIGA 2D3UA 1N6QB 2XO7A 1YJ7A 4EUVA 2XGPA 1FXLA 2XTJP 2NRWA 5A2QO 3KNAA 1LOTB 3VESA 3C6UB 3K2YA 2CQDA 1FNMA 1FHTA 3TJ9A 2OCEA 4DOZA 2PO4A 3UD3P 1CLQA 3POTA 2OEMA 3NS6A 3MX2A 3TSUA 3ZETA 2D3O1 3QJPA 4QIVA 2RJZA 3CDEA 1YSJA 4FZVA 4BDZA 1IM6A 1YIJN 5KT7A 1NOYA 3FMBA 1YVNA 4C0HA 4JI4J 3D1HA 2MXYA 2DGUA 4GKJF 4EP4A 2YWGA 3KXDA 2FZGB 4IBNA 1LFPA 2QFJA 1RHRB 4F50A 1ZBSA 2KM8B 3G8SA 2P5OA 3OT9A 4HCCA 5C15A 4M3YA 2M5YA 4HUGA 2B6AA 3V6KA 2JWLA 5ADXA 1QY7A 4HUFA 4ZIWA 3DC2A 1KOOA 4H03B 3T1YJ 5AQYA 5LMUJ 2A2CA 2E2OA 4Y2IA 4G6VB 4GW6A 3QAEA 1YJ9S 4PR6A 3EKSA 3CJQA 1K0TA 2QE5A 4GVBB 5F1XA 1RTIB 1X4FA 5D15A 3C7NB 2VJVA 2J9CA 1FXXA 2KKHA 2V8DA 4N8OA 1M0SA 2X3GA 4CLSA 1RP5A 3G82B 5A6PA 2VQEJ 2JVRA 3FBCA 3M6GA 3ULDA 4ZP8A 4WBFA 5F0XA 4BRIA 4J9VA 1WD6A 4KHUA 1XHXA 5KG5A 4JI4K 3RBEA 5A8RA 3RR7A 3CW2C 2WB1D 5SWMA 5IXUA 3E51A 4XAKA 1AZSA 2ZVSA 2R2TA 3C6HA 3T5HA 3QEIA 2VQEK 1CXQA 1QVGR 1KAXA 2CZ9A 1CJTB 4F25A 2C42A 4KHRA 1IVZA 1O51A 1VQNN 2NRXA 5B0FA 4IDKA 2RUSA 4CIGA 4HT7A 4A8OA 3HSJA 1C0UA 4HEA9 3GTYX 1Q79A 2HFUA 3HMJG 2VFSA 1S1UA 3AOBA 2NCKL 3QMLA 4A8MP 1JX4A 5IWAK 4F3MA 1VYAA 4M3WA 1N5YB 4E3SA 5J2MB 3C19A 5JLFA 1Q7YT 3EO3A 4LFBF 4JI3J 4OYPA 3HK2A 1FJGF 2KW4A 2ZGZA 3NVKA 5KT5A 4EZ6A 1HBNB 3MAHA 1CEZA 2RDIA 3MEGA 3H4DA 4B3SJ 1WG1A 3MPVA 2FLLA 2RF2A 3DFEA 6AT1B 4UF4A 4IO9Q 1CQNA 4NLPA 1A9NB 4EFAC 2HFVA 2B4VA 2WRMA 3THWA 5EXWA 1ZBUA 2K3IA 4NMLA 4FZXC 3KKFA 3CCRS 1J5EK 4J9MA 4ITSA 1Z2ZA 1IV0A 1J5OA 4O5FA 3DOMA 3BF4A 2ZH9A 3UD5A 4NLGA 4RG8A 5ADXH 2XWYA 4DCJB 3DHXA 2DR9A 4RW8A 1U6FA 4EBEA 1TKTA 3THVA 3EICA 1NHVA 1CSJA 2ZJPQ 1SQFA 3MOZA 4URGA 4W5OA 1QAYA 4OI1A 3CB4A 2FPHX 1BQXA 2VU5A 4LFCF 1CC7A 2ZH8A 2OPQA 3EZUA 1T7PA 2AX1A 2G0IA 1WAJA 2F4VF 1N0VC 3R97A 2J6TA 2HHXA 3HHKA 4HL9A 2UUCJ 4LBHA 2K1RA 3NG8A 1S6UA 4CVNE 3TAPA 2FJDB 4E7KA 1X60A 5FD1A 1BWVA 3B6PA 3BO4A 4LMZA 4KPCA 3FFIA 2Y8YA 3W60A 5CHIA 2PAVA 2RU3A 4NYZA 3J7A1 2AJ4A 3IKMA 4AL6A 5F8IA 3BB5A 1U1QA 3QINA 1RYRA 1ATNA 3ZT0A 3VQDA 1R8BA 4CESA 1UW4A 3DRSA 2VZ9A 4J8FA 1YQHA 3BO2A 1N34K 4C48A 5CZXA 3AOCA 1RHQB 2NS1B 4RU9A 2B5JB 5KPZA 1NMDA 1D8ZA 2IMWP 4MLHA 2C3OA 5EUHA 2HFZA 4OI3A 3KMQA 3NF9A 3ENVA 2IOCA 3H46O 4MDBA 1BA1A 1WC3A 3U1NA 1UVMA 5D0HA 4NWBA 3NS5A 2GO9A 1NH8A 3R5AA 4LSLB 1DTQB 1SQGA 5GAGP 3WEEA 2ALYB 4MK8A 4FWRA 2HMIB 5E7OB 5A8RB 4PUOA 4ZCLA 3EZOA 3GYXB 3J80U 3CM5A 4ECQA 3MM6B 4G9ZA 4L75A 1S0OA 4F02A 3Q2SC 3VEYA 3VGLA 1KQGB 4ZVEA 3IR5B 2HZCA 3CXCM 3A4TA 1YX2A 5IS2A 3NF8A 2CA9A 1TYQB 2VBZA 4OZ2A 3HHLB 1QQOA 3DWLA 2BJEA 3VQ8A 1RTIA 5IQQA 3TVZA 3L4IA 4DU7A 1RT7A 3UE5A 2Z1HA 4DZDA 4B9MA 4J9LA 1OYDA 2VCPA 4EMDA 1UJ4A 3PUFA 3AXMA 4CE9A 3E2EA 1BO5O 5LY3A 4PWDB 4K4WA 3KG1A 3MF5A 1RFQA 4NO7A 1JLQB 4AM6A 4KI6A 2BTFA 1VQSA 2MKJA 3W9IA 4Q8EA 2QA2A 2G0CA 5E84A 1P9YA 5KT2A 2HWHA 3ZZUA 3WNFA 1BLUA 3G8TA 2DVIA 1RZMA 5IFMA 2QLFB 3X3UA 1RDWX 4YOVA 4AXJA 3M30A 3WX8A 4XH1A 2IIRA 2XYPB 3VQ4A 2P2CB 4IFEA 3Q0AA 3KG0A 3NAEA 2V69A 4K41A 2Q43A 2KG0A 4B1UB 1VSLA 4DV6F 5C25B 5GAHI 4Q8FA 2LYVA 1BA0A 2QC3A 4B8AB 2HGLA 2HFSA 3VERA 5BR8K 2HF3A 1QS4A 1KVIA 4QS8A 1QQMA 1M1HA 1RU2A 4LR7A 3TEHB 4WFAL 2O8DB 3D2WA 2QWNA 2H4YB 3OY9A 2C3YA 1WTBA 1H0HB 3AY9A 1RUSA 3CDWA 4JK9A 5AQQA 1F3VA 5A0YA 3JYTA 3OFGA 4U96A 2WUSA 4IFYA 1JLGB 1ZA2B 5F2RA 3QESA 3CCTA 1EQYA 3CPWM 4BC2A 3M6UA 4ED3A 3P8BB 5DRKA 3SCKE 3EVMA 3X1LB 2V67A 3KK2B 4JV5J 3DRYA 1RBAA 3KUGA 3DLLQ 4CERA 2HBQB 2OI2A 2LEBA 5MLCV 4XDCA 1IKXA 2ZOMA 4JKGB 5KFUA 4O55A 3AARA 4QYZK 4IG3B 2W8KA 4BE1A 4KV8A 1HYSA 3V81B 2Z2LA 2R3VA 3C0BA 5HJXA 2V5HG 5M2UA 4EYIB 2QA4G 1K6YA 3QEXA 4BQLA 3G2XA 1JXBA 3GG1A 2QWOA 4FWPA 2YKAA 5LL6d 2MB0B 5I42A 4K8ZA 4E7HA 4CECA 3SLCA 1WSRA 3TUZC 2OSRA 1WKKA 3CIPA 2FGCA 4BACA 3MMAB 5I3QA 3DYAB 3HD1A 1RSCA 1VBYA 5KFFA 1VFJA 4DPYA 4MKYA 3J8AA 2HOEA 1ZTWA 1G6BA 3BS9A 3H3NO 1H3DA 1J9AA 4LRDA 1UPMB 3Q8VA 3EZWA 2BX6A 3MEGB 4ECWA 5HROA 3CUNA 1HPZB 4R0JA 3VPZA 4CRJA 1VK3A 3DJCA 2HYIB 3CM6A 4ZP9A 1N5YA 1TKZA 3VWSA 2WZ1A 3OFFA 2KM8C 5KG0A 4O0JA 1XMQF 1Z05A 3CMEN 5AR0A 3TTCA 4JI3K 2RPIA 2FHJA 5CZ1A 4DV0K 3BF3A 1RACB 1Q8LA 1K1QA 3WNEA 4DU1A 3QEWA 1DZ5A 4H0PA 4B3SK 4HDHA 2EK1A 2GUPA 4I4BA 3NLCA 2F5GA 3MMBA 2DXEA 3AHPA 1TR0A 3WXLA 3KK1A 1TAQA 1QUVA 4GC6A 4XEIA 5BPLA 2IMOA 1RT2A 3DGPB 4FYWB 2EEYA 3BQ2A 2CQBA 3BQ1A 3OXGA 4LF8J 4V19X 1BUXA 1Y97A 2YX1A 1IJFB 1U1MA 3NBPB 4ECZA 2Y1JA 2UUBK 4RNFA 4N41A 3DU5A 4KH6A 2NZTA 3ISNC 3BSAA 2Y8WA 2CPIA 3U4LA 3UKRA 5KGWA 4DX8H 3RVCA 4LF6K 3BBBA 4FWOA 1G1XA 4MYUA 5J1EA 2BRKA 2WBMA 1S5ZA 4YOWA 2G8IA 3NL0A 4C11A 4JI1J 3OBYA 5FPEA 4LF7J 3HPGA 1T03B 2DFHA 5HP1B 1WF1A 4FXDA 2LLZA 2FLOA 3HD2A 4P73A 4DR7F 4KGMA 2EI5A 4CIFA 1TUVA 1JL2A 3RZAA 4XPEA 3OYCA 5T14A 3CCJS 3K5MA 1UA1A 3DMJB 4LFAF 5F41A 3MAAB 4K4UA 3SJJA 3NCPA 4OZ1A 4BGAA 2W2PP 4U7UK 1TUUA 3SQ2A 3CWJA 2I2YA 2R7UA 2E7VA 2QYGA 3SV4A 1Q4RA 2HSEB 5AE3A 3AO5A 1BHNA 4RNOA 3KJQB 1VOMA 1HQ2A 4DLEA 1TVRA 1SB6A 4FKXA 2Q2RA 1NGJA 3Q2TC 4TU7A 4KRWA 1X9JA 2RKIB 4I6WA 1FNXH 1WN7A 2P9KB 3HBTA 3DOLB 3CDAA 1U8SA 3RR8A 2FJXA 3NEKA 3OTOK 5HI7A 4Z37A 4A2BA 3W2WB 2WTUA 5EX3A 2JHEA 1FE4A 4E7LA 1V5IB 4KV8B 4G3IA 1SH2A 1MWQA 1LWFA 3W5YA 1JJ4A 3PYDA 3NGYA 4FPAA 5I3UA 3WXKA 4I69A 3GG0A 3N4QA 4IOAL 4ER8A 1WF2A 1C1CB 2KU7A 1FERA 2I7PA 1R59O 4P71A 2WSFC 3ADAC 4S0MA 2EPIA 1YTUA 3OVSA 1UMJA 4X4SA 5AXNA 1QLNA 1ZAVA 2RD5C 3AVBA 2AEMA 1HI8A 4JKHA 1RB0A 5AQUA 3VAJA 3SYZA 3W0LA 1IQTA 2PMHA 3W63A 3T1HJ 4HLBA 4O44A 3K7RA 2XLKA 2XMTA 4ILHA 4TY9A 3L8BA 2A10A 1XI1A 3LDLA 2MKYA 1VLOA 2KH9A 2JEJA 2YWFA 4EK2A 1ROFA 1IKYB 3MPDA 1OVYA 1EKEA 4HH0A 3W66A 1NSKL 3SXLA 1MN7A 4GV6A 1XR5A 4CW7B 2AJFE 4IO8A 1TL5A 3A1YG 3PFOA 3DRPA 1I3OB 3RBZA 4PABA 3AA9A 3QB0A 1LV5A 4FCYA 3DNCA 5HSPA 4TU9A 5A8KB 3O3LA 3TQ1A 4CH7A 3BO3A 1S6QA 2M2BA 4FJHA 3GLJA 1UFWA 4TXSA 2LA4A 3OR2A 2HWIA 4MMOA 1IBKF 4B3OA 1YRXA 4BDPA 1S9EA 5F0UA 4CJLA 2C2MB 4X66J 1XIQA 4IRKA 4A8QA 3DXKB 1U8WA 2DIUA 4N7TA 3VGKA 3P5JA 2EFVA 5G4DA 2DJWA 2PC6A 4NLXA 5KFWA 4PXBA 3TUIC 3CQ8A 4FJKA 3NWRA 3UIQA 2YXLA 4CLLA 4ED2A 4PCQA 4LSNA 3KLHA 4ED8A 3GJTB 2VYPA 2V7ZA 2CAJA 3QPIA 3AODA 3HHLA 3MDQA 4KBOA 1JNZB 1M5VC 2E7XA 2F3JA 3AVHA 4CCHA 2LDIA 1VBXA 3I0SB 1PYOB 1WORA 1RCOB 1PBAA 2DPJA 3H40A 5KFNA 1HKBA 2IRXA 2GFFA 2HNDA 2ZHOA 1NK5A 4N8NA 4DXLA 2BJ3A 2PMWA 1HKGA 2ASLA 2D69A 4C6AA 1D3WA 2JH3A 4DV6K 5JS2A 4NXMJ 1DTQA 2E29A 3J7YI 4JV5F 4CWBA 1QE1A 4LFCJ 3R2DJ 2MZQA 4RLEA 2NSBA 3AVJA 3O8WA 2QWLA 4X65F 4USKA 4MAKA 4NZ0A 5GADP 2P9IB 2RS2A 4BWJA 4WE1A 2B5JA 1L3SA 3PG9A 2EX3A 1TL4A 3PO5A 1RHMB 4PPDA 2WONA 4ED1A 3ZXWA 2D5RA 4BE2A 4GKKK 1SC3B 4OO1J 5K8OA 3T5LA 4CGGA 3BKFA 4F4ZA 3PO4A 4A47A 2W8LA 3AT1B 1KP6A 2DNYA 4RW9A 1RWWB 4XH4A 3TWZA 4H5NA 3QIPB 1NOZA 1VK0A 1ILYA 5M1OA 2J6UA 3WUHA 2FLPA 3AV9A 4UT4A 4FNIA 2HK2A 3EXCX 5KTQA 4WU3A 1NDKA 1N32F 4E2FB 2FXUA 2XLIA 2YPZA 3CCJN 2F8SA 1VCTA 1TL1A 3AB4B 5F8NA 4ZPBA 4Z4EA 3KOAA 3UQSA 4GC7A 5CHCB 4BRCA 3HVTA 3MN6A 1U25A 3KLIA 4BRAA 5JJBA 4ZK7M 1UTAA 1HWKA 1U0SA 3OBWA 3CFOA 4K5RA 2G8HA 2WHOA 3HPOA 4F4YA 4CO1A 3TANA 4CZMA 5HAOA 4U7UD 4Z2XA 4KHMA 3KLGA 3WQPA 1RDUA 1HQUA 4CEDA 4DR3J 1R0CB 2AQ4A 1IKVA 1VJQA 4WWSA 3C66A 3V9UA 3GMGA 2PYLA 1RDRA 1U48A 2BOPA 5D8HB 2FVCA 3V81A 4P75A 3OXFA 3MD1A 4QW9A 4CO4A 1X9WA 1F5CA 2LECA 2DY9A 5KFRA 3I9ZA 4A5BA 2CRLA 1WBBA 3V6DA 2M52A 1FRMA 4B9QA 5KPTA 3FZHA 1RYSA 1KFSA 2WVBA 1RHJB 4X4NA 4CJFA 2ITMA 4CEZA 4DR3K 2YTCA 4BDYA 4AM7A 2CDRB 4E7JA 3V4IB 5AZJA 4CJSA 4IFVB 3JYTB 4J9PA 2XYGB 2UUBJ 2DFEA 1WDDA 1O8BA 4JI4F 5IM0A 3A8EA 3CIZA 1KHWA 4IEEA 4YDDB 3TA1A 2P9SA 4IDHA 3IA0A 3K0SA 1JJ2R 3PSIA 3C6TA 5AQHA 4BRMA 4EI2A 4KI4A 3T9ZA 3H98A 1Y0HA 1FFGB 3D6HB 2OP5A 1B92A 1KDNA 4K4XA 1WSEA 2HBLA 4G1QB 4K0KF 2MMYA 3IBCB 4FYXB 3B78A 3W3SA 4X62J 4B1XB 1N88A 2OHDA 3D4JA 3K2PA 1VQLN 2IJNA 2MSSA 1S9GB 2FYXA 3CJ5A 3M30B 3NGIA 3ATVA 3LH2S 4K4SA 3ID6A 1K47A 3L4QA 4MO4A 4U8YA 1HW9A 1BI4A 2EHGA 2DNKA 1GOBA 4FN5A 3H5YA 5AQOA 4A2AA 5K8NA 2XMAA 4CT8A 1Q5YA 2MKKA 5AJ3J 3G96A 1HNIA 2KXHA 2ACYA 3DLLL 4OYIA 2VPWB 3A5LC 1T9UA 3OL7A 2DNPA 1IKWB 2J8SA 3HI9A 1HBUA 1X3NA 2BANA 3FBBA 4FJLA 2OGUA 4NEYA 1UWBA 2DRDA 3DDIA 1D9FA 2JLFA 3LDQA 4DL5A 2O8FB 3QLHB 1RBRA 4K4VA 3NOGA 4DG1B 1FRLA 3CJKA 2V9KA 4GO7X 4IRDA 2L9NA 3CJBA 4RJVA 2GIFA 1Q53A 1IJJA 1DTTB 2MLYA 1Q18A 5L39A 3AA2A 2EBGA 3FQLA 3I32A 4M5GA 2A42A 3PX0A 1ZC6A 2IM2A 1MMDA 2QMWA 2ZJQQ 5CCLA 1VRTB 1IBMJ 1WSHA 3A8JA 4MK9A 4CFCA 4LF7K 4JI7J 1JQGA 1FVQA 4JP8A 4B3MF 1HNVB 4R8UB 3A0IX 3I8DA 3CCVS 2QW9A 5HLFB 4NYFA 1YJNN 5HLFA 2V2ZA 5T7LB 1PBUA 4QQBA 1HWUA 2QEXN 2D1KA 2RS8A 5M1NA 4OJGA 1U0HB 4ED7A 1U24A 1NPKA 3C6UA 1SUQB 3HDSA 1X1PA 2XWXA 4X4UA 1P8ZA 2A1BA 3CJTA 4M5MA 7FD1A 4JKFA 3ENBA 3HTVA 1N6QA 4H0VB 4WQ4A 4A62A 1T94A 2JWNA 4FYYB 3BKTA 5CA5A 3SBMA 3ZZPA 2BOAA 1C2PA 2F63A 2XSFA 2JNJA 2XEXA 3HHDA 3OYJA 4JRPA 2ZM6J 3D2FA 1Q0NA 3O6QA 1UWBB 4WFZA 2X3DA 2GIQA 2V51B 1RU1A 2OLWA 3CDBA 4OI4A 3KHRA 4M3XA 3PEHA 3QATA 2XI2A 1WOSA 4QIEA 1SPBP 3H8YA 1REVA 3PR4A 5KFQA 1P9QC 5C12A 3UN3A 3IMXA 2CJBA 1LW2A 3T1AA 2HNYA 4QCLA 2RILA 1DEJA 1MU2B 4O8UA 1RTDA 3R5JB 3VQ5A 1S6PB 4USUA 1B7YB 1BOTO 4OX9F 4URQU 3US5A 5AQZA 1KHVA 2X51A 4AYBD 4G1PA 4DR3F 2HW3A 2OA8A 4DSEA 3D2EB 4FS1A 4IR9A 3GWCA 2OIHA 3L09A 1VQ7N 1WOOA 4TKTA 1RKIA 2ZZMA 1HHQA 1HKAA 3AY0A 5ETLA 1AROP 5E3QA 4FP9A 3M4XA 4HDGA 2X1FA 3C6TB 1FA0A 2D9PA 4NLSA 3AFGA 4DTRA 2ZM6K 1YJVA 2CXEA 1Q95G 3HM9A 3SK3A 4EEYA 2GEMA 3MM7A 2MJNA 1NLKL 5A2QU 2AEFA 1R8AA 2R7TA 3SNNA 2BJ1A 3K8VA 1DRZA 4LVNP 5KFXA 2G8WA 3AVMA 3HSTB 3ZX3A 2B51A 2GX9A 5C2FA 1YJWN 3EVOA 3D5MA 4YOXA 4RUBA 4IFVA 3GV7B 4A8WA 4O4GA 2HQ3A 3T1HF 3HM8A 4M3UA 4FLVA 3PJ9A 2V9WA 4LF6F 7FDRA 1HD1A 5BR8F 4ES2A 1ESVA 2N82B 2MZTA 5KFMA 3OS1A 2NUHA 1JJ2M 4W5QA 3B8HA 3PEJA 2OZSA 2M4MA 3EPIA 5D0EA 4D3HA 2J4RA 2DIVA 3M2RA 3U3GA 2YV0X 4FDFA 3NGKA 5BN9A 3CJ4A 3C2PA 3QSIA 2HLUA 2HFOA 3DGVA 2R2SA 1OY8A 3NCRA 1UVLA 4P2MA 1CJTA 5B08A 4BRLA 3NNHA 1ICEB 1D9AA 2J0WA 1ZM4A 4BWMA 1KEKA 3MAQA 1KC8O 3J81O 3VR1A 2KT5A 3TA0A 4QIFA 2GTDA 2A18A 1CPZA 2YI1A 3ISND 2Q97A 1GLDG 1IO2A 3ZSXA 1S6PA 1TL3B 3FRYA 2LEAA 3NOCA 2BABA 3GFXA 4CHYA 2Q31A 4LVOP 1YI2N 3QFPA 2YWHA 2O66A 4QU7A 2COLA 1DQAA 1KVKA 1R0AA 3GSDA 1REVB 2B9EA 3EL2A 4FWQA 1UETA 2DBBA 4E1MA 5AQRA 2O8CB 2NRZA 1HNZJ 1RWXB 2HHPA 1AYEA 4OGEA 2NYIA 2IJFA 5GAEI 2XULA 4DS4A 1YJTA 1GLEG 3OYEA 1RHKB 4BS2A 3M9OB 2Y1IA 4DLGA 1R6YA 1XK8A 3DDNA 1TUGB 4CJUA 3I87A 4M42A 2D9OA 1PGZA 3AB2B 5AQVA 4WFNL 4U9RA 3SCJE 3EZ5A 1XC9A 5IT9U 2XQCA 2PZSA 2CDQA 3MCMA 3W2VB 4OPAA 4DL3A 3J7ZO 1IG9A 4X4OA 5AFUH 4C8MA 4FJ5A 1LWCA 1KS2A 1AB8A 2FDNA 4W5TA 4F4KA 1CZAN 4FJ8A 4MO5A 2N3OA 5KI6A 3PYEA 2XMMA 3KD5E 5LXYA 3J81Y 5KG6A 4CI0B 3ULEB 2VONA 1DHMA 2ZBCA 3L3CA 3E01A 4J2BA 4NZ7A 1ITGA 1X3MA 4L74A 4JYAK 4MFBA 2W9CA 3ENWA 5KFJA 1NK7A 4DV7J 4TY8B 4RUHA 3B6OA 2X78A 2HNZA 3F5TA 4C98A 3CJ9A 4QYZJ 1QJHA 1TUYA 2E5JA 5E41A 2MHNA 4CD1A 1BWEA 2BBEA 1JJHA 5MLCQ 4JUZA 2ZUAA 1W2IA 3LPYA 1MWYA 3MURP 1JLEA 3ITHB 5AQGA 4OYAA 2XYHB 1BWFO 1NK4A 4KH5A 1GK8A 3UDLA 4OZ0A 1ZXOA 1ZZNA 1R27B 3RAQA 2G8VA 3CYMA 1BI4B 1QUPA 2W9AA 1RAIB 3JQKA 3MR3A 2HVHA 4YB5A 2FVPA 5EU7A 1CJUB 1Q78A 3HOTA 2D41A 2KHDA 3UR0A 3DLKB 1K73T 3A5NC 2B8QA 3R5BA 2VH7A 2VD3A 1APSA 3PRBA 4ID5A 2VKRA 4OMFG 2D0AA 1UWAA 1M5KC 3KTQA 1QM9A 4DL7A 5BREA 4AQYJ 4JI7F 2P9EA 1OY9A 2MQPA 1EARA 1HA1A 1IBMK 4KT0C 3TZXA 2F4FA 3O2IA 3FRZA 4B9NA 2BW2A 2RU9A 4I56A 2ACMA 2NRTA 1X4EA 5HRRA 3U1MA 4KGXB 3P4IA 3IRXA 4DMNA 3VA0A 2OMOA 1F5AA 4X62K 1Q82T 3BGRA 2EBEA 1NGEA 1N48A 2QA4N 2F40A 5GMEA 3LM2A 3SAFA 4CO3A 5GIPA 2GMHA 2CGLA 4AHCA 3Q8QB 3BH6B 3ATUA 1PYSB 2V63A 3GIRA 4B1ZA 3HCXA 3IO1A 1QDUB 2VICA 3ENQA 5EX5A 1RBUA 3RB0A 4WFBQ 3RW6A 4IG0A 1EXQA 2IBOA 2XHCA 3R7NB 1KQKA 4PAAA 2YJEA 2ZDOA 3G6YA 5DQGA 1VQ4S 1RDDA 1HQUB 4ID8A 2FJWA 1UEUA 2ATQA 2BXJA 4HUEA 2ASOA 1WHWA 3RW7A 2XCPA 4FPIA 3FGVA 3IUCA 4PKDB 1NM1A 2UXBJ 1F60B 4NB4A 4KH4A 3DXMA 4K25A 5LSLA 1X4DA 2HMPA 4PXEA 3HFZB 3MTJA 2VQFK 4M7YA 3G6VA 5FRMA 2CQ0A 4UW2A 1MWZA 4JD2A 4H4MB 1G2EA 1VQ5S 1T05B 3DMJA 4AL5A 3DN9A 3E8OA 4J9SA 3WHIA 4RWXA 3Q8SB 4L6V3 2C2RA 4BG8A 3DI6B 2ROEA 4OJHA 1S72S 3CJ7A 4L3QA 4ZIVA 1HJRA 3K89A 1RDAA 2HB5A 5K9FA 4FSVA 5LJ3Y 1Y5IB 3H5XA 5DQIA 2LMIA 3G6ES 4KKOA 3HO1A 1VQMS 1ASWA 2LFVA 1HPMA 1Q8IA 4E0DA 3CC4S 2DISA 2V6AA 4ZP6A 2FSKA 3NCIA 2RHQB 4PQUA 4RW6B 2G9OA 4URSA 2LEPA 3TUJC 3LANA 1FDDA 4EP5A 2IBKA 2ZBIA 4WFXA 5GAGU 3KFWX 4LF9F 1KQSM 4ISGA 3ZT3A 4W4MA 2G8UA 4RW6A 2FC0A 2ZC4A 4WP8A 3PW0A 1B0TA 4K0KK 4R5PA 1CJVA 3VAFA 5LMUF 3AJ2A 2ZHBA 3V9XA 3C6AA 1ZH5A 4U95A 3SI8A 5BYSA 2Y0BB 4OJ1A 3ZZ0A 2DNMA 3I0SA 3LTOA 3MR7A 1U09A 1B0PA 2KVQE 3GIIA 1X4AA 1IBKK 4WCEQ 3MR2A 5DO2A 4BRPA 4RNNA 1EO1A 3H1VX 1GQEA 1MA9B 4O4GB 4BC5A 5KFCA 3HLUA 1WC1A 3GIJA 2ZJRQ 1U1OA 1IBLK 4AL7A 4EYHB 3T5KA 2LQBA 4DV2F 4V1Ak 3CJAA 1D09B 2Z2YB 1A7GE 1B0VA 2QSWA 3OVNA 2YWEA 3ASMA 2W41A 1KLNA 4C8LA 1YBTA 2EKYA 1M1KT 1U2CA 4ID5B 4QYRA 1EAYC 3GL1A 3CC7S 4HHUA 2VHGA 1TK8A 3IM9A 2WCXA 4O0IA 1FJ7A 2AGOA 3BF1A 1N33J 4AHSA 3VV2B 3GU0A 1VMBA 3R1XA 2MEWA 2L9WA 1T8EA 4FF3A 4QR2A 3SBGA 1S1TB 2KG1A 5KFGA 4YB6A 4FLUA 3VVTA 1M90T 4A46A 1CS4A 4JHDB 1F9EB 4FJ7A 2CQIA 4WFNQ 3MEDB 3RYLA 3OYIA 1XUPO 4CGHA 1NSQA 1IBCB 2DHXA 4LF8F 1CBKA 2OTLS 4LUBA 5H9EK 1ZAWA 3NY0A 4OZ3A 2Y1LB 3FZLA 1KOHA 3ENAA 2HBJA 4C0BA 1NK8A 2P51A 2E9ZA 5A0YB 5BR8J 4Z4CA 4ICLA 2MKIA 3PW4A 2GVZB 4IEIA 2QRRA 1C4CA 1KD1T 1GMWD 5DK5A 3RMAA 1BISA 2XMJA 4DV4F 2KLAA 4CJTA 2EFOA 2NQPA 3KNGA 5HATA 2XSJA 4JI8K 3DLJA 4DSLA 2KT2A 2AV5A 3V1RA 4OVLA 4QWAA 2DFFA 1S1TA 4DV0J 4RW4A 3DOLA 3TX8A 1CLFA 3HXMA 2W01A 3SPZA 1GTHA 2DPNA 4H0YB 2R8JA 3QNWB 4DR5F 5E3PA 3RTVA 4JI6K 2BDPA 1OY6A 4C1NI 4EWTA 1ATSA 1H7WA 1T9VA 4C8OA 4PRFA 2VBXA 3EDRB 4CLFA 4B3TJ 3PHEA 3MWBA 2JGUA 1YWXA 3P83D 2R8IA 4A8YA 3QGHA 3O4QA 5DM6Q 1GXUA 2A6MA 5BPMA 4TQRA 3CVKA 3FEXB 4FF2A 2NZ4A 4JYAF 2M3DA 3QWPA 3H08A 3KUHA 2YHWA 5A76A 1TGOA 4QPTA 3BN4A 3MHYA 4C3KA 4B3TF 1UAXA 1F9HA 2KO1A 2QLXA 2W4DA 4L8RB 1TZ0A 2DGOA 4ECRA 3MWPA 4FLYA 3VQ6A 1FTRA 5E5NA 1EZZB 5C5JA 4I67A 3M05A 4X65J 4Z4FA 1NNEA 3SQ4A 1M1KO 4MFBB 2W9CB 4FZZA 3T1YF 1NZ8A 2HGMA 3P5BP 2KRRA 1JK9B 4MIWA 1GLLO 2QO3A 4RR5A 1MN9A 1RKJA 3GFYA 3AVFA 5LJWA 1GX6A 3QT5A 4CLYA 3BZCA 3TR5A 5KFZA 4ZCMA 3QFWA 3DXBA 2GJ2A 2QL9B 1F2HA 2OH2A 1XC3A 2I6WA 3KK1B 3S3NA 5D4NA 3DM2A 4C9DA 2KXFA 1HNXF 4U7CA 2F4VJ 1RA7A 4I2PB 3PCOB 2UUBF 4IQXA 1V3ZA 4QR1A 3UFCX 1NK6A 1Z4UA 4CK1A 1SJQA 1N5TA 4OKKA 1BCMA 2J0SD 4LRBA 3ZT4A 2VF3A 4RW7A 4U67L 3M2RB 3IAS9 4DPUA 4BREA 2BVZA 2Q79A 5DJBA 4W5NA 4DI6A 4H0TB 1N56A 5B09A 2P9SB 3NF7A 4Z0UA 3H45C 3B82A 3DLEB 4P74A 4F0KA 1IBMF 1TKZB 4NXNJ 1M5OC 3IC1A 3U7JA 4NRUA 1NB7A 2HHVA 4OI2A 3WC0A 3AJDA 1HPZA 1RISA 3G86A