4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
2HWHA 1HNIA 3MFHA 3VQDA 3BR9A 4ICLB 3RBDA 4IRKA 1SKWA 1DLOB 4Y3CA 3CJ4A 1KLMA 4KKOA 1YTUA 1KVCA 1JX4A 5KFDA 2IMWP 4Z4HA 2D41A 2OPSA 1NHUA 2UVVA 2QKBA 5KFAA 1ASWA 5JXSA 4KPYA 3PW4A 4CJUA 4RNFA 3CIZA 3QNNA 1S1VA 2FJVA 2ITGA 1ZYQA 3QIPA 3HPHA 5CY4A 3HJFA 2WCXA 2YKNB 2WK4A 4PQUB 1R0AB 1RDCA 5KFXA 1VSHA 1QHTA 3QLHB 4DMNA 1ASVA 2R2UA 3OYJA 1MU2A 4ID1A 1S6QB 3KNAA 4ZPBA 4J9OA 1T7PA 3V6DA 2DPJA 3KJVB 2E6LA 4WFYA 1FXXA 3AA4A 3C94A 5KFYA 5C5JA 1JKHA 5KG0A 3RMBA 1CZBA 3NHGA 3T5HA 3LP1A 4NLYA 2OPSB 4DEZA 1B92A 3IN5A 5CZ1A 4NRTA 1HMVA 5KFRA 1WSGA 4JUZA 3I5AA 1OS5A 3ZSWA 3AO1A 2FBVA 4CJ5A 1UOCA 4DTXA 3K5NA 5L1KA 4J9QA 4G1QB 1S1VB 1YVFA 2GBZA 2F8TA 4OJRA 3OYAA 1ZBIA 4CJKA 1NNDA 4U7CA 3QIPB 1VRTA 1T03A 3LP2A 2OPRB 2GV9A 1SV5B 2HVHA 3M8PA 3ZT0A 4FJGA 4ED3A 2Z1HA 3MECA 4OKJA 4BDYA 3RMAA 4O44B 4ED2A 1MU2B 3G6YA 3NDKA 2BANA 3V6DB 2LSNA 2P5GA 4FJ5A 3SV4A 3OYDA 4KI4A 5KFLA 4KO0B 2G8WA 3MR3A 3TQ1A 4OKEA 3Q8PB 4TQSA 1RAJA 1S9EA 3GQCA 5J2MA 3LP1B 3KLFB 3ZSRA 3DLEB 1BI4A 1XR7A 3SCXA 3MXMA 4W5NA 1JLGA 5F8MA 3AVBA 2P1JA 1RBSA 4DTPA 2KTQA 4J9KA 4IH6A 2I1RA 4KV8A 4K8ZA 4AILC 4IR1A 5DMRA 4ZMMA 4G3IA 4K8XA 2XHBA 1SL1A 1KSPA 4CEBA 4DTMA 1ZBFA 1X9MA 3PVXA 1VRTB 3H5YA 5KFQA 3DLHA 3M8PB 5J2QB 4WXWA 1N56A 3EZ5A 4E7JA 1KHVA 1VRUA 3MECB 2D3ZA 2IJFA 2J6SA 2UVWA 5F8GA 4IFVB 2QV6A 3MEEB 3K2PA 2AGQA 3RWUA 2DTUA 2ASDA 2YNGB 4DSIA 4LSNA 2G8HA 5J1EA 4DG1A 1W25A 1IKYB 1C0MA 5EWFA 3OLAA 4CGFA 2FJXA 4AH9A 3QO9A 3MEDB 2XI2A 4RW9B 3QEXA 1S9EB 5J2MB 5JUMA 1I3AA 1BI4B 4FM1A 2B6AA 2PYLA 4J2AA 3V4IA 1JLGB 3M8QA 1A5VA 4FJMA 1RNHA 3MAQA 3N6LA 3QNOA 4TXSA 2FVPA 4RNMA 4KV8B 3H5UA 4HHTA 2VA2A 5FROA 4ZHRA 1N48A 1VSLA 1RTDA 4FS1A 4I9LA 3IRXA 4WFXA 2IGIA 3AVMA 3DDKA 2FBYA 2BQUA 4R0EA 2Z1JA 4CEFA 4B9LA 5DLGA 2DFHA 2FVRA 3AVCA 3CM5A 3LAMA 2FBXA 1XI1A 1B9DA 1EX4A 2JC0A 3KK1A 3ALYA 4FJJA 3TABA 3KK2A 3V9ZA 3G6XA 1LWCA 1GX5A 4E1NA 3ASMA 4HTUA 1DTTB 5KFPA 5J1EB 4DG1B 2X74A 1ZBHA 2P51A 4CHQA 3NF9A 3QZ8A 4GVMA 1S5JA 3SUNA 4O3PA 4NLTA 4F2SA 4DFJA 2FVQA 2HHVA 2KQ2A 3V4IB 4DTJA 1SKSA 4ECWA 1ZTWA 3H4DA 4ZTFA 2HHWA 4O3QA 4KHQA 2VWJA 4F4YA 4RG8A 2V4RA 1RTDB 2RDIA 1SH3A 3IRXB 4YNQA 4HYKA 4DL5A 1BISA 4HUFA 4ECRA 4KI6A 2UVRA 3HL8A 3ZSXA 3OY9A 3MEGA 2OPQA 1T3NA 1T05A 5FDLB 4H4MA 2JLEA 1NKEA 1L3TA 4NCGA 3MR2A 3KLVA 4FS2A 2HNDA 4W5QA 4O3SA 1LWCB 3LZJA 4R8UB 1U09A 3AVJA 1VSEA 2AGOA 4XIUA 3RB4A 4C8NA 3HSTB 4JV0A 3E51A 5FRMA 3SV3A 3SQ1A 1W0HA 1RTHA 3PR5B 3SYZA 2OPPA 4CK2A 2EHGA 1VSKA 4URGA 3OYFA 4ZP7A 4FLYA 1S9GA 3IGNA 1JLFB 3FQKA 2XY5A 4FJKA 5KFMA 5KG2A 4JV2A 4DSEA 4MQ3A 3CJ0A 2GC8A 2PYJA 2KFZA 4DL3A 2HHUA 3HPGA 1LW2A 3MEGB 3CJ5A 3MF5A 3PV8A 1C0TB 3JYTB 4ZVEA 2QKKA 2OPQB 1T05B 1RBVA 4OPKA 4H4MB 3RAQA 4CJPA 4FLXA 4J9MA 4KSEB 3TARA 4NCGB 4Y2CA 2ZD1A 1U04A 2YNHA 3ZT3A 1HNVB 3QEWA 1HJRA 3NBPA 2ATQA 4CEZA 4CJLA 4DTNA 5KFUA 3OYKA 2QE5A 3PY8A 3K5LA 4J2BA 4F4WA 5T14A 3NFAA 1A5WA 1IKVA 4QAGA 1RTHB 3P83D 3H5XA 2WB4A 2OPPB 2BQ3A 1WNEA 3HVTA 1C1CB 4EBEA 4ECSA 4RW6A 2YHBA 1S9GB 3ZSYA 2FLLA 4TQRA 3SUPA 2ZKUA 1VK0A 1GX6A 4CESA 3HYFA 3TI0A 3PHEA 4TY8B 3HK2A 1RA6A 1S1UB 5C25A 3NAIA 3CFRA 1RTJB 3CVKA 2JGUA 3KLEA 1RT4A 4URSA 5SWMA 4ZPCA 3MXIA 2R8IA 3KKRA 3GV8B 4QWCA 3SQ2A 3HKWA 2FBTA 5EU7A 1BHLA 4H8KA 4M42A 4R5PA 3NF8A 2DY4A 4KTQA 2AWZA 3L3UA 3KHGA 1N5YA 2RKIB 5KI6A 2YNHB 4RW8A 1J5OB 3THVA 1RT6A 5I3UB 5KFIA 4GMJB 4EBCA 3ISND 3DI6B 5F8HA 4ZPDA 5JS2A 4KRFA 3H98A 4LH4A 3F9KA 2IM2A 5KFBA 4WXOA 4XPEA 3BGRA 2WOMB 3QGHA 4NLWA 3HVTB 4QWAA 4RW6B 4E7HA 4GW6A 1XC9A 2BE2A 3O3HA 3RR8A 3DLRA 1XR6A 3T5JA 3WNFA 4ZVHA 2R7YA 1RT4B 3O4NA 3AVHA 4TYAA 3NGDA 1IKWA 1RT7A 4K4ZA 3M9NB 2IBKA 4NLQA 2R8JA 4Q44A 4DU3A 4MK7A 4YFUA 3E01A 3SQ4A 1LAVA 1I6JA 4DL6A 5FRNA 2AGPA 1LW0A 1C6VA 1TL1A 4I2QA 1RT6B 1F21A 4RW7B 1D9DA 4Z0UA 4E3SA 5K14B 2EX3A 4IKFA 2IAJB 1EP4A 4DTRA 3OYCA 4DTOA 1ZTTA 3OS1A 3OS2A 3SI8A 2KZZA 4FZYA 2W8LA 4CJSA 5KFOA 5C42A 3S3OA 1TKDA 1SH2A 1BIZA 4CJWA 4NCAA 2OYQA 1TAQA 3AV9A 1RCHA 4FJNA 2D0BA 5DK5A 4GC7A 2C22A 1JLQA 2Z1GA 4CGHA 3C6UA 4KAIA 2GIRA 3NGIA 3HVRA 1U45A 1S0OA 3BQ0A 4KB0A 3OYBA 3AO5A 2BRKA 2IA6A 1IKXA 2W7OA 1RT7B 4WYLA 4DLEA 5KRSA 4EP4A 1BIUA 1JLEA 4FM0A 3QEPA 5J2NA 1TL1B 3CDUA 1TKXA 3CJ2A 5DG8A 4DS5A 3OYEA 4OVLA 1NK7A 4LH5A 4LD0A 3OL7A 1IH7A 3CWJA 4OLBA 1EP4B 1IM4A 2R8GA 5DG9A 4O3RA 2WTFA 4QW9A 3FRZA 4OLAA 4RUAA 3CM6A 2BQRA 3SZ2A 3L2UA 3DYAA 3GIMA 2V9WA 1HQUB 5C42B 1NKCA 2I5JB 4DWIA 3H2LA 3HP9A 2HVIA 4CJFA 3C6UB 3QGIA 3N6NA 3VQQA 4BWMA 3P5JA 4CJEA 2YNIB 1GOBA 4EBDA 4CJ3A 3AO2A 4MFBA 4CFCA 4CFBA 3VQAA 3NCIA 3DLGA 4PUOA 1RYSA 1HNIB 5SZTA 3I0SA 4DTUA 4O55A 1KVAA 3I5BA 1KLMB 4KKOB 2CJQA 1S49A 4ED1A 3KHLA 1JLEB 2HHSA 4JRQA 4DF8A 4FW1A 3OYLA 3O3GA 2JEJA 4HUEA 4E0DA 3MTKA 1S6PA 2AU0A 4N47A 2BGGA 4FW2A 2F8SA 5HROA 2R2RA 1K6YA 4C8KA 1JLAA 1N4LA 3HT3A 2G8FA 5KG1A 3PW7A 3TWHA 4NCBA 3DYAB 5DLFA 4CIFA 3KTQA 2ZE2A 1BQMA 5KFKA 3U6FA 1DTQA 2DPIA 3K5OA 5KFTA 3NKYA 1C2PA 3AO3A 4M3ZA 3ZSOA 3T19A 3DLGB 3CDWA 2G8IA 4ECUA 3RBEA 3FDSA 5L1JA 3QERA 2AQ4A 4IRCA 4K4TA 4M3WA 3BQ1A 1J53A 4EZ9A 1S0NA 4N56A 3LAKA 4CJ4A 1JKHB 2A1SA 4EZ6A 2HHQA 4FJ9A 4ID5A 4YR0A 4CF0A 1TKTA 2B43A 4DSJA 4FJ8A 3SNNA 1K1QA 4C8MA 3EYZA 1CXQA 5KTQA 1HMVB 5F9NA 4K4WA 2FC0A 3VQBA 3ULDA 5DQHA 5L1IA 2E9ZA 4K4VA 3HO1A 5HROB 1JLAB 4DQQA 2AX1A 4IG3A 4J9PA 5DG7A 3H5SA 4B9UA 4JV1A 2JC1A 3VQ7A 4DFPA 1T03B 3QETA 2W9CA 3LP2B 3ZT1A 1WSFA 3VQEA 4IG0A 5D3GA 4TN2A 1YVUA 4CIEA 4J9RA 5KFHA 4CHZA 2B4JA 3HPOA 2W42A 1RA7A 2UUWA 4B8AB 2XY8A 1U49A 3MR5A 4CF8A 4BE1A 4Q45A 2D0CA 2BANB 3K5MA 4DQRA 4HKQA 5HBMA 4KE5A 3QESA 3PZPA 3AVFA 1U48A 4Q0BA 3G10A 2XCAA 4ID5B 4EP5A 2DFFA 4QCLA 3KK3A 4IH7A 3CG7A 5J2PA 3OSPA 2KW4A 1WAJA 4CJVA 4CHYA 3H59A 2IDOA 3OJUA 2HNZA 1JL2A 2X6NA 4K50A 4FYDA 3S9HA 3NH1A 2YHAA 3U3GA 3H4BA 4M3XA 1IO2A 3OVNA 2ILYA 3SUOA 3LP0A 4AHTA 1JXEA 4IG3B 4M3UA 2CKWA 4TLRA 2DFEA 4FJIA 2W9CB 4H4OA 4JS4A 5HRPA 1UWBA 1HYVA 3AVAA 3T5LA 3Q8RB 3KOAA 4DU4A 4CCHA 3MR6A 3AVNA 1VRUB 1LV5A 4M3YA 3PW0A 3D28A 4ECYA 5KFCA 3OSNA 2JEGA 2IC3A 3O4QA 4Z4GA 3RB3A 5HBMB 4FK4A 1S48A 4LSNB 5DGBA 3V81A 2WONA 3QO9B 1NK5A 4ZP9A 1NJWA 1TK0A 1A5XA 5J2PB 4NLOA 2B6AB 1U4BA 1TVRA 3RRGA 3M8QB 4XPCA 1HPZA 1VSMA 5HRRA 3GIIA 4B9SA 3GILA 4ECVA 4CEQA 4ZHRB 2XY6A 2YNFA 4E7LA 4AHCA 3QEIA 2C2DA 4CK1A 4YQWA 4CHOA 5KT4A 1RBUA 1X9SA 4F3TA 1TL3A 2XC9A 4ZVGA 1WN7A 4RW4A 3RMCA 4HCCA 3IGVA 3KK1B 4NLGA 3OJSA 3KHRA 1NKBA 4YR2A 4J2EA 4UQGA 4L8RB 3KK2B 3OL8A 4OGCA 3SQ0A 3DOLA 2O4GA 4M95A 5HP1A 3AVKA 2HNYA 4GC6A 1FK9A 3GIJA 3DRPA 1KTQA 2E6MA 2WONB 5EWEA 3NGZA 1RDRA 3NL0A 4FBUA 3KMSA 4F50A 3ZCMA 1X1PA 5E41A 2D0AA 3ITHA 3TVKA 3K58A 4DLGA 4IR9A 3AA2A 3V6KA 1D9FA 2HMIA 3D0PA 2R8KA 1I39A 4JLHA 5L9XA 3KLIA 3I8DA 4DTSA 3OYMA 1REVA 3HVAA 4RNNA 4E7KA 4DL7A 2D3UA 1VSFA 2XGPA 1RBTA 3WNHA 1NK0A 1JLBA 4N41A 4B8CA 4RZRA 3IG1A 3ZSZA 2IOCA 1NK8A 3UR0A 2VG7A 5CYMA 4MK8A 1HYZA 4FJ7A 2FVCA 3RAXA 3QZ7A 4NLSA 4IDKA 2UUTA 2HNDB 1BQNA 3NF7A 2G8UA 5HP1B 4DL2A 5KT3A 2FVSA 4IKAA 4QWDA 2R2SA 3NAHA 3K59A 5KT5A 2E9TA 1BCMA 3OYNA 3FQLA 3PW5A 3ITHB 3DMJA 5CYQA 1TAUA 2HMIB 4W5RA 1RDAA 5KFNA 1LWEA 1NOZA 3NH2A 4OKKA 3KLIB 4I2PA 3GIKA 3T3FA 4TYBA 3JSMA 1LW2B 2VG5A 4MIBA 1ASUA 5KT7A 1JLBB 4M3RA 3IG1B 2VG7B 5CYMB 4KBIA 4ZPAA 3KLGA 1TK5A 2ZD1B 1TK8A 4IDKB 2J6UA 4B9VA 3KD5E 2XGQA 1QE1A 3NBPB 4FCYA 4EYHB 4IBNA 4KTWA 4M94A 1C1BA 4CEEA 3TAGA 2BDPA 1J9AA 5KFVA 3CJ3A 4ECQA 1G15A 3PUFA 4C8LA 1IKVB 4IQXA 3NGYA 3TAFA 1X9WA 2WHOA 4TSXA 5KFFA 4N5SA 2ETJA 3LANA 5DQIA 1RBRA 4KTZA 4Q8FA 3RB6A 1S1TA 5CYQB 3A2FA 5KG3A 4FZZA 1LAWA 1QS4A 3OYGA 3GV5B 3UIQA 3FFIA 1NJXA 4MIAA 3ZSQA 5DQGA 1LWEB 1L3SA 5C25B 4NZ0A 3QYYA 4Y1DA 2XI3A 3KLEB 3EPGA 2OA8A 4I7FA 2C2EA 2VA3A 1BCOA 5F8NA 4FLZA 5I42A 3DRSA 2VG5B 4R5PB 3PO4A 4PWDA 4MH8A 3OYIA 1FKPA 1N5YB 5KT2A 1NK6A 1Z25A 3LPUA 2GIQA 3L2QA 4RW8B 4FJHA 4XO0A 1QAJA 1W9HA 1QE1B 1ITGA 3LZIA 4ICLA 4ZP8A 4RU9A 4OGEA 2HHXA 4B9MA 5KFWA 4Y1CA 1FKOA 4CEDA 2BRLA 3SUQA 3BGRB 1KRPA 1WSHA 1EKEA 3ISNC 4Z4CA 4WYWA 3VQ5A 4AHRA 3B6PA 3EZUA 3C6TA 3F73A 2FLNA 1J54A 1Q9YA 2ZQBA 2BE2B 2B5JA 3FFIB 4OPJA 2XY7A 2BR0A 1VSJA 4WZMA 2UVUA 4KHWA 4J2DA 1KHWA 4I7FB 1L3VA 4HUGA 4CE9A 1IKWB 2YKNA 1ZETA 2KZMA 4RNHA 4NLDA 3AVGA 4PWDB 1FKPB 3QLHA 3E01B 2C2RA 4F8RA 3KIOA 2RF2A 1LW0B 1S6QA 1SUQA 1D8YA 4I2QB 3KJVA 5EWGA 3BSOA 4KHNA 3AA5X 3V9SA 1GOAA 1CLQA 2V4QA 3CYMA 2C28A 1HARA 3TAMA 3VQPA 4K4SA 2HWIA 1FKOB 4Q43A 3H40A 1WNSA 1CZ9A 4HCBA 4ED0A 1CSJA 2G8VA 2JEIA 1VSIA 1GOCA 1XHXA 3ZSVA 3C6TB 5KFGA 1JLQB 4FLUA 1NJZA 1U47A 2B5JB 4G1QA 4KHMA 3VA0A 3LWMA 5KFZA 3MFIA 4BDZA 4FM2A 3SFUA 4Z4FA 2OPRA 3G86A 1SV5A 1IKXB 4IFYA 4IOBA 3QEVA 2HW3A 1YTAA 1JLCA 3LPTA 5KT6A 4PA1A 5L1LA 1UAXA 3DM2A 2RF2B 4O44A 3SJJA 5J2NB 3EY1A 1SUQB 4KB1A 4ZTJA 1TKXB 1Z4UA 2HB5A 4MKAA 1WSIA 4AHSA 4KO0A 4O0IA 1BL3A 1KLNA 3V6JA 1D0EA 3TAMB 1XWLA 4AHVA 4DSFA 3KLFA 3DLEA 3IS9A 3V9XA 4AHUA 1KFSA 1ZBLA 1K1SA 3FSIA 3HXMA 4KHRA 4H54A 2JEFA 1ZBUA 2W9BA 4F4XA 4YMEA 3V9WA 1MMLA 4MFBB 2IJNA 3PJXA 4LY7A 3CDEA 3HHKA 4PUOB 4KB7A 4FLTA 3S3NA 4BE0A 4IFYB 3I0SB 5F9LA 4ED6A 2W8KA 4KREA 5J2QA 2YV0X 2RPIA 1JLCB 4KHSA 3DM2B 1EETA 3BQ2A 3AA3A 4YR3A 4IFVA 4DL4A 1S6PB 3MEEA 3RB0A 3GYNA 2YNGA 3V1QA 4F4ZA 2A1RA 1IKYA 4M41A 3SFGA 4DFMA 3MEDA 4RW9A 4HVJA 4FXDA 2Y1JA 3NE6A 3EPIA 1TP7A 1D1UA 4Y34A 3HVWA 4DU1A 3IS9B 4Y2AA 4M45A 1HQEA 4O3OA 2ZE2B 1BQMB 1DTQB 4KAZA 3OHBA 3NH0A 3CFOA 3PX6A 3QGGA 2W9BB 5T7BA 2AX0A 2NUBA 4EO8A 1QUVA 3C95A 5KGWA 3RR7A 4ED7A 1KVBA 4CHPA 5F8JA 3Q8SB 1LWFA 4CGDA 4Q8EA 4NLUA 3QINA 1IG9A 1S1XA 1RT2A 3LALA 5HLFA 4Q5VA 1RT3A 4FK0A 4CEOA 4CK3A 3DLKA 1EETB 1Z26A 1TKTB 4CERA 4NYFA 5F8LA 2IM0A 3DLBA 3OL9A 1TV6A 4U6PA 1DTTA 3G0ZA 3L3VA 2OZSA 4ELVA 4OL8A 1JL1A 4J9SA 1S97A 5KFJA 4E1MA 3AVLA 4LQ3A 1HQEB 4O0JA 2F96A 2Q3SA 1VSDA 3SPYA 4IG0B 5D3GB 3M8RA 4CF2A 3V9UA 3VQ6A 3PW2A 2XCPA 3CFPA 3V6HA 4BWJA 4NLRA 4B9NA 2X78A 1UA0A 4F2RA 2XWYA 5EUHA 1LWFB 4Z4EA 4FJLA 3D5MA 2X6SA 4ZP6A 3AO4A 4QW8A 4QOZB 2ALZA 3AVIA 1S1XB 3BSCA 2VWKA 1RT2B 5HLFB 5FDLA 4Q0BB 1RT3B 5C24A 3Q8QB 3UDLA 3G6VA 3OHAA 1RTIA 3DLKB 4CFDA 1S0MA 3UPFA 3KK3B 3BDPA 3V1RA 1TGOA 3RRHA 5EDWA 2Y1IA 4R8UA 1TV6B 1C0UA 2HNZB 4J9NA 2PY5A 4NLVA 2RN2A 1NK9A 1S1WA 3LP0B 3ZT4A 4O4GA 2O4IA 2QK9A 4C8OA 3PX4A 4H4OB 4BACA 1UWBB 4KFBA 3L2VA 2HAIA 3BREA 4EO6A 1TQLA 3M9OB 4EEYA 4X2BA 1JLFA 3SPZA 2KFNA 3KKSA 2O5DA 4CGJA 3VQ9A 2IC3B 4YP3A 2IM1A 3U3YA 2PZSA 3TAQA 3MXJA 3VQSA 3NMAA 4JRPA 4IRDA 1JXLA 1C0TA 3JYTA 4RNOA 5C24B 1QSSA 3V81B 1RTIB 3PJWA 2IS3A 2F8EX 4K4XA 4IH5A 1HNVA 5DGAA 4K4YA 4CGGA 1TVRB 3UQSA 2ASLA 1HPZB 2YKMA 1C0UB 3PR4A 1S10A 4CF1A 4B3OA 4E19A 2OH2A 1SKRA 2YNFB 1S1WB 4CJRA 4O4GB 3D45A 2V0NA 5KGXA 1QSLA 1NHVA 3VA3A 3BSAA 2VG6A 1C1CA 4KFBB 4CGIA 4WE1A 4NRUA 3VN5A 3O3FA 1KCFA 1SL2A 1WSEA 2IM3A 1TL3B 2W9AA 4RW4B 3T1AA 1RT1A 1TKZA 4LQ9A 3TANA 2QXFA 2R2TA 4TY8A 1RT5A 4ED8A 1S1UA 4NLPA 1RTJA 2FLPA 3DOKA 4NYNA 3LWLA 3DOLB 4QWBA 4NLXA 3NF6A 2ILZA 2HNYB 4FZXC 1S4FA 1FK9B 3N6MA 4CECA 3DRPB 3HP6A 2HHTA 4CEAA 3S3MA 4FBTA 2R8HA 3CO9A 2RKIA 4DS4A 1WAFA 2XRIA 5CZ2A 1J5OA 5I3UA 5KG7A 2YKMB 3L2RA 1RYRA 3TAPA 3IAYA 4Z4IA 4N76A 4DFKA 1O1WA 3WNEA 4B3OB 4DSLA 3DI6A 3WNGA 1Q9XA 4FVMA 1T94A 3L2WA 4CJTA 2WOMA 1T8EA 4DQSA 1REVB 4M3TA 1EXQA 2VG6B 4MKBA 3LP3A 1XHZA 3H08A 4WE1B 4JS5A 4CJQA 5F8IA 2XO7A 4CFAA 1HRHA 4ECXA 1XR5A 1RDDA 1L5UA 3QIOA 1RT1B 1TKZB 1B9FA 4ECZA 4CIGA 1RT5B 4CHNA 3OYHA 5JS1A 1WSJA 3NAEA 1QAIA 4I9QA 3BSNA 3DOKB 4KHUA 1BQNB 3LDSA 4WFZA 3KMQA 5KRTA 4DF4A 3DRRA 3CQ8A 2OZMA 2D7SA 4QWEA 4KHYA 2Z1IA 2J6TA 3KLHA 3PO5A 5KG5A 2ASJA 4W5OA 1HYSA 3TAEA 4RW7A 1QTMA 4O4RA 3DMJB 4CF9A 4FK2A 3B6OA 5K14A 4PY5A 2IAJA 3VQCA 1N6QA 1D5AA 1NJYA 2W7PA 3TR8A 4FLWA 4I2PB 1SH0A 2GUIA 4F3OA 4RUCA 3L8BA 1L3UA 3K57A 4J9LA 3JSMB 3QIDA 4FLVA 4O5BA 3I0RA 3PX0A 4FJXA 4DQIA 4ZVFA 1QSYA 3SI6A 4F4KA 2EC0A 3V1OA 3KLGB 2G8KA 4BDPA 4LSLA 1C1BB 4WZQA 1UA1A 2RDJA 5KG4A 1SL0A 1YT3A 3OS0A 3DRRB 1DLOA 1KFDA 3RMDA 1BGXT 3M8SA 5KG6A 3KLHB 2E9RX 1NOYA 4ELTA 3VQ8A 4QPXA 2AJQA 3P1GA 3ICLA 5HRNA 3HM9A 1HYSB 1RDBA 1Y97A 3GV7B 1S1TB 3M9MB 3BJYA 1S9FA 4EYIB 2P5OA 4O3NA 1Q8IA 3KHHA 4ECTA 3OLBA 5HRSA 4K4UA 1N6QB 4ELUA 5KFEA 1C1AA 2D5RA 4DSKA 1HQUA 4MK9A 5KFSA 3VQ4A 1WLJA 3I5CA 5I42B 2I5JA 3DRSB 3ZT2A 4DQPA 4PQUA 4BE2A 3KD1E 1R0AA 4NYZA 4B9TA 4TY9A 3I0RB 2WRMA 4URQU 4E7IA 2E4LA 1RILA 2YNIA 1CXUA 1NK4A 1JIHA 4B08A 4W5TA 1JXBA 3OL6A 3RTVA 2ATLA 1QQCA 3T5KA 2FJWA 4E89A 4LSLB
chains in the Genus database with same CATH superfamily
1NGCA 3BR9A 4IRKA 1SKWA 1DLOB 3CJ4A 4KKOA 1YTUA 4DUYJ 1KC8T 2WB1D 2IMWP 5DZ7A 4Z4HA 4JEPA 4M63A 1ASWA 4CJUA 2NPFA 3R6GB 4GO7X 3MM8A 4MYTA 3H7HB 2RQ4A 1OYEA 4B9QA 1S1VA 4YHHJ 5BPNA 3PRBA 3CDAA 3L6QA 3HJFA 2HBZB 2YKNB 2CQDA 1RDCA 1UAWA 4FWRA 4OX6A 4B3RJ 2IVYA 1QHTA 2P9KB 1E6VB 2VBYA 5LJ5Y 3OYJA 4ID1A 1RAAB 4E8UA 4J9OA 4LRFA 4NPOA 1T9VA 5M2RA 2L9NA 2MQQA 3A4TA 3TYTA 2F4FA 1JKHA 5BRDA 1LK5A 4ZCMA 1CZBA 2OPSB 1UP1A 3T1YF 1B92A 3IN5A 3WC2A 5CZ1A 4YB7A 1HMVA 2HBRB 1VQ5N 1WSGA 3I5AA 3AO1A 2CADA 4CJ5A 1WJ9A 1WKKA 2B4PA 4G1QB 2B4OA 1YVFA 3CCEN 4KBOA 1NNDA 1BA1A 4PEOA 4BR2A 1YJNN 1IBKK 2HVHA 4A8WA 2ZDPA 2E2NA 2XMVA 1RLDA 4BDYA 2BW7A 4IO1A 4CWBA 4ZN1A 3G6YA 4S0MA 4USWA 2UV8G 1FJEB 3W2VA 4FJ5A 4H4KA 3SV4A 2W2OP 3LPYA 3ZZUA 2G8WA 1XMOJ 2VFRA 3BPDA 4FSVA 5A2QU 1N5TA 2O8BB 3Q8PB 4KGZB 3DLEB 3VEVA 2JDJA 3MXMA 4CNZA 2DR8A 3IM9A 4B3SK 1RBSA 2KTQA 3NOCA 2KT2A 4J9KA 1VQPN 1LKZA 4K8ZA 5ETQA 3R9LA 2M8DB 4AILC 4IR1A 1F9EB 4LF4F 1SL1A 4CEBA 2Q66A 1ZBFA 3PVXA 3ELHA 5JLHA 1YJVA 2Y0BB 3WHIA 3EZ5A 2HZAA 4AYBD 2DRAA 1VRUA 2HWTA 2KXNB 2IJFA 4U67Q 2MSSA 3TZXA 2UUBK 1VQON 1P1TA 1PJ7A 2AGQA 2DTUA 5F3TA 1XMQJ 1X0PA 2VZ9A 3OLAA 4CGFA 4A8XA 3QO9A 3MEDB 1S9EB 2CNLB 5FPDA 5J2MB 3CCUN 2EPIA 3DRYA 2B6AA 1EX8A 2VGNA 2OEKA 2YKQA 3N6LA 2B8PA 1T0TV 8RUCA 4KV8B 2CPJA 3A3PB 5BN9A 4I9LA 4P6QA 1S0VA 4JI7J 3DDKA 4B9LA 4BRLA 1IBLK 2OANA 3QMQA 3CM5A 1S79A 2ADBA 4DV0K 4L3QA 1YJNS 4GV9A 3B6BA 2JC0A 1H72C 3ALYA 3LQVA 3KK2A 2CAJA 1WC5A 1CJTA 4OJHA 5CCLA 4Y28C 1DTTB 1E4GT 5J1EB 1NJIT 3OTEA 5HAOA 2P51A 4B1UB 1CJKA 3TVZA 3QZ8A 1MDUB 2FSJA 1YK9A 1S5JA 4LF5J 3SUNA 2CQHA 2Y0SD 3DXKA 2UXDJ 3G6EN 1RAIB 3V4IB 2DGWA 4GV6A 1FRXA 2FGOA 5LOQA 2V4RA 1RTDB 4DL0C 1SH3A 1IR1A 3BM7A 4DPUA 2C3PA 3PACA 4DL5A 4KI6A 5LMNF 2XSFA 1IBMF 3HL8A 1FESA 2FSNA 4B3MK 2LDYA 1T3NA 1B0VA 2OTLN 1T05A 3VV2B 2QEXN 3UVJB 1N0VC 4K7QA 1L3TA 4B17A 3PLAA 2ZH8A 4AXIA 4NCGA 3CF5L 1RK8A 2ZVSA 4CLLA 2DHGA 1HBUB 3GCXP 1Z2LA 2ZEJA 2QA4G 2A18A 4L74A 5ETVA 1R8PA 1W0HA 5M1PA 3VENA 1FRLA 3PR5B 1PYOB 4PWUA 3E2EA 2DNMA 4URGA 4ZP7A 1F1BB 4FLYA 5TKWA 2H4WB 4BLGA 2HQCA 1TL7A 4ANEA 4JV2A 4MQ3A 4LFAF 2P9NA 3CW2C 3D1HA 4DL3A 4OFZA 2LQJA 4BGBA 4Y0WA 4ZVEA 2QKKA 1TZ0A 2OPQB 1RACB 1RBVA 2Q0RA 1YLXA 5HMZA 3J7AP 3POTA 4YOEA 3RAQA 1MWMA 3ILLA 4J9MA 5T7LB 4X4OA 4KSEB 5F2RA 2GQCA 1OWXA 1VQKS 3DDIA 2VFSA 1O5JA 1XQIA 2AT1B 1KBRA 3NBPA 2DH7A 1W2IA 3OPKA 3CIPA 2QE5A 3PY8A 3BGFA 5T14A 2ATCB 2HF3A 2V68A 1HUXA 1IKVA 2ZM6F 4DUZJ 4LIWA 1RTHB 3IR6B 3DLJA 3I31A 2WB4A 2OPPB 2BQ3A 1WNEA 1ESVA 2B4UA 4DV4J 3BR8A 4WFAL 1Y11A 1YJRA 1P6TA 1UPPA 2FLLA 2YCHA 4X4QA 4TQRA 3QNWB 2GFFA 2OMLA 3NGKA 1IR2A 1ZM2A 3O1LA 1VI7A 2X3GA 4HEA9 3CFRA 2JGUA 3KLEA 1RT4A 5SWMA 2KM8B 1DURA 2LQ5A 4U7BA 3SQ2A 5EU7A 1Q8KA 3LA0A 3M2VA 4H8KA 1Q53A 3NF8A 3R5AA 2JZ5A 3CCJN 3ENHA 2RKIB 3CCMN 1J5OB 1OMSA 3THVA 2R7VA 5AQSA 5I3UB 1RWKB 1NU4A 3BF1A 4EBCA 3DI6B 3H98A 4LRBA 3F9KA 3H1VX 4WXOA 4XPEA 1AXQA 3VR1A 1NLVA 3VTIA 2DRBA 4QWAA 2XSJB 3ZEUA 1XERA 4E7HA 1NMEB 4BR4A 2QA4N 5AXLA 3H1QA 1ZA1B 3ID8A 1U1RA 2P9PB 3H2UB 3D0GE 2DTJA 4DV2J 3K5PA 3DLRA 1XR6A 2NRHA 2F63A 3O9SA 3BKFA 5JVHQ 2PAVA 2OFHX 1IKWA 4DV5K 4K4ZA 2HHHF 4IFEA 4M5IA 3THWA 3MWBA 2IBKA 4NLQA 2R8JA 4GVLA 4DU3A 4MK7A 4YFUA 1SZ2A 2OGUA 1YJWN 2F4VK 5AQVA 1R7IA 2HRUA 1RT6B 5KPZA 1F21A 3GTYX 2OSRA 4Z0UA 4NYPA 5IS2A 2K7JA 5FJ4A 2EX3A 1EP4A 1MN7A 3OYCA 1B0TA 2IMOA 4FZYA 4CJSA 5D6GA 1YX2A 3K89A 4NCAA 2OYQA 3AV9A 4HVZA 4GNIA 3E66A 5DK5A 2C22A 3WUHA 4KAIA 2OEMA 3FZFA 4Y6IA 2OTJN 1RUSA 2ZH9A 2HS0A 1U45A 2YX7A 2GHVC 1IN0A 2R42A 2W7OA 1FHTA 1RT7B 2CJBA 5CXTA 2NXJA 1GLJO 4CT8A 5KRSA 3R1XA 1BIUA 1U6FA 2O01C 5K5MA 4FM0A 5J2NA 4YDDB 3BGOP 2VQFK 1TL1B 3CDUA 2XS2A 4O8UA 5AQZA 3OYEA 5E7OB 5H9EJ 1HBNB 1RWXB 4LD0A 2KM8C 2C2KB 1IM4A 2XYHB 4LSZB 2D3O1 4YEAA 5DG9A 4QW9A 2BUNA 4OLAA 4RUAA 3DYAA 2FGCA 3FEZA 1HQUB 5C42B 4JKHA 4PKIA 2R7UA 2OSQA 5IFMA 3K7RA 3EJMA 1NGHA 5F3ZA 2BXJA 3VQQA 2Y9HA 3P5JA 2DK2A 2QA4S 2YWHA 4MFBA 3AJ1A 2J9EA 3NCIA 4KH0B 4J8FA 2LLZA 4UOGA 4ZJLA 2GVZA 3I0SA 2BH1A 3I5BA 2CVIA 4PG5A 1SIWB 4ED1A 1G7CB 1EHWA 4AXJA 3GG4A 5BPMA 3DXMA 2IA0A 4TNOA 1IBCB 2VF3A 2F8SA 4JI4J 1K6YA 3O2IA 1JNRB 5JLFA 2G8FA 2R3VA 1ZZNA 1DTQA 3OA9A 3VAGA 4ES3A 1QD1A 2QMUB 5KFTA 3Q24A 3NKYA 2WBRA 3FZKA 4XH5A 1JK9B 3NGSA 4KR0B 2QWMA 3Q7BA 3L4IA 2OTJS 2DGQA 3QQCD 3BO3A 2JSXA 3FDSA 4IRCA 1CVJA 4K4TA 4O0NA 2H1YA 3VHQA 4CJ4A 4A46A 3VGTA 4FJ9A 2DGOA 1GMWD 3DWLA 2J9DA 2XHCA 4A8YA 4DSJA 3IKMA 1SC3B 4X62J 3SNNA 1NB7A 2J9DE 4C8MA 1UFKA 1R59O 3I56N 1CXQA 5F9NA 4C23A 5AQOA 1FNMA 3ULDA 4FOIA 3RVCA 2E9ZA 2H4YB 4CZEA 4AM7A 1NUEA 2NS1B 1FTRA 4K25A 3ZX0A 4EK2A 3O4WA 1HWJA 4B9UA 1UWAA 4BC2A 1WSFA 3A3OB 4IG0A 4NO7A 1NSAA 5B8HA 1GNKA 1VLOA 5TKYA 4N7TA 4B8AB 1U49A 2L08A 3MR5A 4CF8A 1N36K 1S59A 3GLJA 2D0CA 1WB9A 1VQ8N 3ZZOA 1ICEB 2VKZG 2DCLA 2UP1A 4Q0BA 3H20A 4DR3J 3TUIC 5LXRA 2GVDA 4IH7A 3K2YA 1Q5VA 4OHVA 3HBTA 4K50A 3S9HA 2UXBJ 1GLFO 3VQTA 3IM8A 3SUOA 1IXKA 2ZC4A 5E3PA 2DFEA 4FJIA 3QT7A 4DDFA 5HRPA 2GX9A 1JMTA 2L48A 3KOAA 4DU4A 3NEKA 3MR6A 1LV5A 3AVNA 4DPOA 4M5JA 3G82A 3HOSA 5KFCA 2IC3A 4PKDB 3O4QA 4Z4GA 3MCPA 3W3DA 5HBMB 1OY6A 1GLCG 2FJBB 1TK0A 3CNQP 4JK9A 3CCLN 1A5XA 4JN4A 2DNQA 1LOUA 2B56A 1CC7A 4NLOA 2CQPA 3G8SA 2F3JA 1HPZA 5HRRA 1RAFB 4B9SA 3I56S 3GILA 1IWGA 4J7CA 1RHUB 4CEQA 1X3NA 1FRJA 5GMEA 3ID6A 2CPYA 2YNFA 4JI5J 1Y3JA 4AE5A 2FPHX 2YBVA 1FJGF 1IQZA 4BGAA 2V2ZA 4NASA 5KT4A 1RBUA 4F3TA 1TL3A 2Y8YA 1WN7A 4FWQA 4RW4A 1G6BA 2X1AA 4HCCA 3CPWR 2OMOA 5IM0B 3A5LC 1NKBA 3OL8A 1VDHA 4OGCA 3FEXB 1O51A 4M95A 2HIYA 5HP1A 2O4GA 2QI2A 3AVKA 2HNYA 3AY9A 4AQYJ 5AE3A 2E6MA 1VQ8S 2MZTA 4RPFA 4U8YA 2ROEA 3NGZA 1I94F 3KMSA 5A8RA 1B7FA 3ZCMA 1KXPA 1HW9A 2F40A 3CB4A 3ITHA 3OBWA 2BE9B 3AA2A 3E9OA 3JSBA 3V6KA 2HMIA 3SSRA 3ZETA 4ZVRB 1I39A 5L9XA 3VF0B 1WG5A 1AW0A 1FJCA 2C1EB 1PYSB 4RNNA 2ABYA 4ZPWR 2NRWA 3HDSA 1NK0A 2D3OR 2M8HA 4B8CA 1RLCL 3MAHA 1WEYA 4DPWA 3UR0A 2VG7A 5CYMA 4JI0J 2FVCA 1IUJA 4NLSA 4IDKA 2RB7A 3H25A 2QL5B 4OJ1A 4Y65A 4TU8A 1RWMB 2OUGA 3MM5B 4DL2A 4DR4K 4G1PA 3VF4A 8AT1B 1HNXK 3NAHA 5KT5A 4LFBJ 5U47A 4C97A 3BH6B 2I9SA 3FQLA 2YH1A 3CJ9A 1VC5A 3OTOF 3PW5A 2E1ZA 3ZZRA 3VEXA 1TAUA 2LEAA 4W5RA 2O8CB 5KFNA 1LWEA 3FZMA 1IG8A 2YY3A 4PXBA 3KLIB 2V2QA 3T3FA 2E2PA 1YDLA 3F41A 4WFNL 1YGYA 1U2VA 2JNJA 3HZ6A 5KT7A 2XLIA 3G8TA 2A42A 1NM2A 2FB0A 3MXHP 1TK5A 2ZD1B 3R5JB 1EQYA 5D4PA 3D7EO 1QE1A 4EYHB 4M94A 2RHSB 1A7GE 1U2FA 1J9AA 5KFVA 1KAXA 2QTDA 5E3CA 3CJ3A 4ECQA 3A5NC 1R3NA 3TAFA 2VD3A 2IVFB 2J0QD 2W4CA 2ETJA 1R6VA 1R6YA 5GAGP 1S1TA 4FZZA 1WOPA 1LAWA 2IVOA 1N8RO 3R2DJ 2QWLA 2AEJA 3UWTA 1L3SA 5CA5A 5C25B 1TR0A 4Y1DA 3GIRA 3B8HA 1AFJA 4DXLA 1BCOA 1Y3KA 4BRDA 2Z2MA 2DNKA 2V4JA 4R5PB 4USHA 4MH8A 2KI2A 2PFDA 1F3FA 3UDVA 2HS4A 1CJVB 5L46A 2NZ4A 4RW8B 1QAJA 5LMUF 4L72B 1K8AT 4OGEA 2MYFA 5F41A 2KRRA 1CJUB 4IEIA 3A8YA 1NGGA 1KRPA 1FKAF 4CEDA 3SUQA 3BGRB 3TUJC 5BXIA 1EKEA 1HW8A 2RVJA 3M1VA 3B6PA 2BKOA 3EZUA 1J27A 4CO2A 5ADXH 3F73A 1V3RA 2FLNA 1Q9YA 4KHPK 2WVEA 3FFIB 5GMKa 2XY7A 5LMNK 2XNRA 3CT9A 3QDKA 3C19A 4WZMA 3EZWA 2DEJA 3F5TA 1HHSA 4J2DA 1RXOB 1ZM9A 2YX6A 1KHWA 4DI6A 4CE9A 2CQ2A 2Z4PA 3FC9A 1NNEA 1GXLA 1U8SA 4IZ9A 4JKBA 3RBXA 4GV3A 4F8RA 3KIOA 2RF2A 4ISEA 2ZVIA 3PYEA 5DDOC 4ED4A 2OELA 4CLUA 3KJVA 3V9SA 1CLQA 2ZC3A 3HULA 4RCHA 1K0VA 3VAHA 4FDFA 2GQ2A 3IDHA 5AQRA 1U6BA 5IWAK 3OHRA 4TLQA 2G8VA 1VSIA 4RTFD 3M2RA 3I55N 1JLQB 2B5JB 4KHMA 4X64K 4QBUA 4JD2A 5KFZA 4BRAA 4BDZA 3MPYA 3GB0A 2EFQA 2OPRA 1SV5A 1CG2A 4IO9Q 4ERDA 1GMVA 3UN2A 2UXCF 4PA1A 7AT1B 4BRQA 1FERA 4O44A 3TZYA 1QVGR 1HD0A 1SUQB 1EB0A 3MAAA 2HB5A 2GO8A 3EDRB 4LF1A 3IA0A 4K42A 4KO0A 4O0IA 2ZM6K 3DOMA 4JKFA 2QLJB 3TAMB 4CZLA 1IWAA 3QB0A 3D3CJ 3KLFA 4CLSA 3IS9A 1WBDA 4JI8K 5ETPA 1N5VA 3HXMA 4OI0A 5GIPA 4H54A 1B0PA 3HHLD 4U67L 1X4FA 1ZBUA 3V4MA 3OFEA 3OBYA 3V9WA 3UKUB 2E5LJ 4LY7A 2VV5A 1DFDA 4JYAF 1XC3A 4ZCLA 4IUFA 3VF6A 4FLTA 3S3NA 2Q97A 3KDNA 1ZAVA 5J2QA 2YV0X 2RPIA 1JLCB 1FD2A 1MWKA 1WTBA 2EFOA 1EETA 4QPTA 2A3ZA 2NXCA 1O6XA 4YR3A 4C9DA 3R97A 2C2ZB 1K0TA 2HBQB 3MEEA 1LEOA 3Q2SC 3RB0A 3GYNA 2QN6B 4U96A 2GV1A 4DFMA 1YIJN 4FXDA 4ATNA 3NE6A 1TP7A 1D1UA 3HVWA 1RADB 4CLPA 4Y2AA 2HBJA 1HQEA 4O3OA 3FBCA 1BQMB 4DKWA 3OHBA 3O08A 3DU5A 2U1AA 5BRFA 4J91A 2CQ3A 1YJ7A 2W9BB 1HR0K 4ZVQB 1P90A 1VIOA 4MLEA 3C95A 2QX0A 4OI1A 4GRSA 3Q8SB 2E2OA 1J5EJ 4DR6J 2VONA 3MMCB 4NYFA 3JTPA 3KWMA 2IM0A 5F8LA 1RHMB 2XTJP 4ZCIA 4GKKF 3L3VA 3AGRA 1BWEA 2XO6A 1K9MO 4OX9J 2BVZA 3CERA 2KO1A 2EG2A 3TA1A 5AJ3F 1S97A 3CI5A 5AZIA 2JL9A 2Z58B 2YVSA 2H3EB 3SPYA 5D3GB 2VFVA 4CF2A 2O8FB 2CGKA 3PW2A 3EL2A 4BWJA 1SI9A 2BUPA 2X78A 4HHJA 4FJLA 4DR2F 4ZP6A 1ZXOA 8ATCB 3AVIA 3R1LA 3CEDA 3BSCA 5M1NA 3HOTA 2RRNA 4C3KA 3Q8QB 1Q95G 4GVBA 2BEFA 3OHAA 1N8RT 3VALA 1S0MA 1VQMS 4YOXA 3D1QA 4H03B 2X1FA 3BF3A 2VBZA 5IT9O 2Y1IA 1TV6B 4C4WA 4YUDA 2NNWA 2QLWA 1H98A 2K06A 1S1WA 3MEKA 3N5BA 1JQGA 2O4IA 1P1LA 4WTYA 4H4OB 4KFBA 3M9OB 5IQ6A 4HHHA 4NOHA 3TOQA 2F8MA 4QQBA 2RJZA 3H3OB 4CGJA 4ZIVA 2IM1A 3VEWA 3NMAA 3R6LB 1WKJA 2QG9B 4RNOA 1OH6A 4LF8F 2C2OB 1RTIB 3FRYA 4DR7K 2M88A 2G4BA 5DGAA 4CGGA 1FDDA 1TVRB 4WKRA 2UUAK 3MI7X 5B0AA 3EX7B 3PR4A 2ZHOA 4OI2A 2WBMA 4CF1A 2B7BB 1F5BA 3U4LA 3EVWA 3QFWA 3M6UA 4A61A 3D6RA 4O4GB 3D45A 2JHEA 1QSLA 3VA3A 2DNYA 4M5LA 3MDFA 2VG6A 1V9OA 4CGIA 4WE1A 4MTPA 1FDBA 1RABB 2DT9A 5B0FA 4TY8A 1RT5A 3PM9A 1EWRA 5FLXO 3UD3P 4XDCA 4WKYA 3MCSA 1YHQS 3J7A1 1NHKL 1X31C 3DRPB 2Z2YB 3BKTA 5ETOA 4QJVA 2VIHA 1SC6A 5BR8F 3IR7B 2J0WA 3H42A 1OPZA 5KG7A 2YKMB 4N76A 1OQ6A 4X65J 3WNEA 4B3OB 1SJ1A 4N8OA 3WNGA 4HDGA 2MGZA 1Q9XA 4IJNA 3HD2A 3CCRN 5CABA 2DGXA 2WOMA 4DQSA 1REVB 3UE2A 3BPSP 4MKBA 3LP3A 4DCOB 3VVTA 1PAUB 4ZA1A 1NDCA 1RDDA 3ENWA 4DUYK 1B9FA 4USTA 3ZXWA 4IOXA 1FRHA 3NAEA 3BSNA 4Z37A 1HNWJ 3LM9A 3WEEA 1BQNB 3LDSA 2K1RA 3FGVA 3D67A 5GADI 3KMQA 5KRTA 2HGLA 1RBLA 2RS8A 2F1FA 1PJ6A 4QWEA 5C7PA 2J6TA 2Q1NA 3UO0A 4CLYA 4YHHK 3S6EA 3C65A 4H5TA 3PO5A 3N01A 4F0KA 1XNQF 3VTHA 4X4PA 1CQMA 1YITN 1KTVA 3TAEA 4RW7A 1QTMA 3N9UC 5HSPA 3B6OA 1XNRJ 4B3RK 3BZKA 2N7YA 2MHNA 5ETMA 4JNEA 2CPFA 4ILRA 1N6QA 2W7PA 1QQOA 1NLKL 3M32B 1VQ9N 5BYSA 4J9LA 7FD1A 2M9KA 5DJBA 3VETA 4ZVFA 3KLGB 2G8KA 1VMBA 2IYGA 2HURA 4WZQA 3IR5B 2RDJA 3B4DA 1QZ5A 1RSCA 4H5NA 3DRRB 1DLOA 1NSQA 3CXCR 4AFFA 1VC0A 3JB9k 3KLHB 4ELTA 1NOYA 2GW8A 2C3YA 2RUSA 2ZH4A 2QSWA 3MPUB 3PJ9A 4DX8H 4F04B 3BS9A 2G0CA 1M5KC 2E7WA 1HYSB 2CIMA 1QQNA 1MA9B 3GV7B 2MKJA 1NU0A 1T6DA 1OYDA 3KFWX 4EYIB 4O3NA 3W66A 4ECTA 4I64A 1MWYA 3D6FB 2D5RA 2VB6A 2GWKA 2PDAA 3J7Z5 4FOEA 2HPUA 3CCRS 3PRVA 2MLZA 1WLJA 2LP4A 3I5CA 1XMOK 4BE2A 3KD1E 1N33F 3I0RB 4URQU 4E7IA 5K20B 5AE2A 1GLBG 2YNIA 2HFOA 1JIHA 2AKWB 4B08A 4FO0A 1HX1A 1QQCA 1AT1B 2V8HA 4UY85 2X1GA 2LVWA 4FPAA 4LSLB 1ZBTA 3VQDA 3DAWA 4UZBA 3RBDA 4OZJA 2C3UA 2MQMA 1KVCA 1JX4A 3S8SA 2DEIA 2AW0A 3QSYB 2OPSA 2UVVA 2L3MA 1HNZF 2KXHA 2RQCA 5E2QA 1WHWA 5BR9A 4FWNA 2B7CB 4NI2B 1RU2A 1YVNA 3QNNA 4CTAB 2IJRA 2R7TA 3VMFB 2KFYA 2BJEA 5IT9Y 3TRGA 3TUZC 3M30A 2MSTA 5GAHP 4UUXA 1F2GA 4LUBA 1N32F 4PQUB 5CYJA 1R0AB 3W9HA 4NXNJ 2LU1A 4XEIA 1VSHA 3QLHB 5HVFA 4RR5A 2W2MP 5EOYA 3HSCA 2LMIA 1S72S 3DGVA 5AQHA 1DQ8A 2HRYA 2V5HG 5JVGQ 1T7PA 2EKYA 5C15A 4ILLA 1FXXA 5KFYA 2OIHA 3GP9A 2PMWA 4QYRA 1LCUA 1MWZA 3NHGA 3T5HA 4JI7K 1WC6A 3K0JA 4PYAA 3B54A 4JAXA 4RJVA 2E5IA 3MN7A 1OS5A 2LDIA 4AT1B 1OY8A 2MKKA 5L1KA 4JBCA 2GBZA 3HHDA 3OYAA 2F9WA 1PGZA 2QGFB 4CJKA 4QIFA 4U7CA 3QIPB 2VDIA 1T03A 2AJ1A 2CRLA 2GV9A 3CGIA 2RE2A 4ED3A 2E29A 1CBKA 3SIPB 4OKJA 3RMAA 4LF5K 1X7VA 4ED2A 1K8KB 1MU2B 2UXDK 2BANA 3O8MA 4K0KJ 1BG3A 4QYZJ 5D15A 1DQAA 2P5GA 2PI4A 3OYDA 4KI4A 2ZUGA 2AIRB 3PG9A 3GPAA 3MR3A 2E7VA 5G4DA 3QGPA 1UVLA 2G1HA 1S9EA 3GQCA 5J2MA 3O6QA 3M5RA 4A62A 1XR7A 4DV3F 3UI3A 4W5NA 1Q81T 3AVBA 2IRXA 2APOA 4DTPA 2KL8A 3O8WA 2I1RA 4KV8A 5DMRA 4ZMMA 4G1IA 3OVSA 2CQ1A 4PPDA 4X66J 1KSPA 2Q31A 2WBNA 3M8PB 2QT7A 2HKEA 2GGPA 4U9RA 3M8YA 1KHVA 3O5BA 3FE1A 5LMUK 3MECB 2D3ZA 2J6SA 1V3SA 5F8GA 5CZVA 2VCPA 4P2XA 1BHNA 3W8PA 2G8HA 5J1EA 1IKYB 5EWFA 2A41A 4M5DB 2MY8A 3G71N 1I3AA 1BI4B 2GIFA 5DRKA 2PYLA 4J2AA 3V4IA 2HIQA 1S77D 2NLWA 3Q0AA 2VA2A 2H54B 3C15A 1RTDA 2XBPA 4K2XA 3AVMA 1BOTO 2BQUA 4R0EA 1MSWD 3A8EA 2Z1JA 1NDLA 5DLGA 2ZJPQ 4ZDNA 2FVRA 1EQMA 5LM7E 1NGDA 1XI1A 3P31A 1WORA 1EX4A 4DUZK 3KK1A 4FJJA 3TABA 1CZAN 1WDDA 1R43A 2NQPA 2RHQB 4DV4K 3V9ZA 1ACMB 3G6XA 3BBCA 4E1NA 1HBUA 1PYTA 3B82A 4HTUA 3JAMU 4C8YA 5KFPA 2X74A 4CZGA 1IR0A 1ZBHA 5AQUA 1NH7A 1Q16B 1B64A 3OXLA 4GVMA 1W2BM 3L95X 4CO3A 4LRAA 4NLTA 3FKBA 4DFJA 2HHVA 1KVKA 4DTJA 1Y5LB 1SKSA 4JHDB 2FZKB 4WQ4A 3MM7B 4ECWA 1VQLS 2XLJA 2AF6A 2HHWA 4O3QA 2ZZTA 4F4YA 4WCEQ 4R0JA 2RDIA 1F6TA 2XEXA 4HYKA 4HUFA 4ECRA 2K2PA 3O9UA 5LJVA 3QT5A 3HFVA 2YQ0A 2OPQA 1SBRA 3TVYA 3WIVA 2JLEA 5DETA 3CCQS 1NKEA 5T7LA 4RO0A 1U0SA 2HFZA 3KLVA 3CD7A 2HNDA 1Y4ZB 4O3SA 1LWCB 1K73O 1U09A 3N28A 2NRZA 3ULEB 1VSEA 3FGUA 3NXZA 4XIUA 1VRQC 4CJ7A 2FTRA 2PD1A 3BB5A 4DV2K 2XB2D 4JV0A 3E51A 2HG4A 2ZH1A 1TL5A 1RTHA 4HT7A 2OPPA 3U1NA 4I1TA 4V19J 3IGNA 4IXCA 3MMBB 4NLCA 2E1YA 1VQ4N 2XY5A 4FJKA 1U1MA 3CJ0A 3SK3A 1FA0A 2GC8A 3HSDA 2QYGA 5LSLA 2FF3B 4PZVA 3OXFA 1JJ2M 1EWQA 5C2FA 2HYIB 2MZRA 4C6AA 3VERA 5DS7A 4FLXA 2M3DA 2QLXA 4LVNP 5GADU 5BJRA 2O8EB 1HNVB 3U27A 1X4BA 3CCWA 2CDQA 5D0RA 2CH5A 4CEZA 5KFUA 4Y00A 3KK7A 4ILJA 2E88A 3K5LA 2PEBA 4ZN3A 3JXOA 4F4WA 2MJUA 3NFAA 2QYCA 3J7ZT 1QJHA 1WD6A 2MKSA 1YI2S 2FDNA 1C1CB 4R79A 3VZHA 2YHBA 1ZZFA 1X4AA 4FKXA 1VK0A 1GX6A 4CESA 1VQSA 4UY8T 4YOVA 4RWWA 1UEVA 5FIIA 3PFOA 1N32J 1KOOA 3KKRA 4PL8A 4QWCA 2FBTA 2MDAA 3D68A 2QLBB 4BC3A 4FP9A 4M42A 3AA9A 5ETNA 2AWZA 3EGNA 4DN0A 1IBKF 2D9OA 3AOCA 2HHPA 2DYAA 1V5VA 3QBCA 2YNHB 3LF0A 1RT6A 3C46A 4BRHA 5AZJA 5KFIA 5G0RA 4GMJB 2ASPA 5AJ3K 3F0NA 1FNXH 2CNOB 3ISND 5F8HA 2ACYA 3Q7CA 4H0YB 1HI1A 2IM2A 2DITA 5KFBA 4DX6A 2DGSA 3HSZA 3FCHA 3HVTB 5C2DA 1FF2A 1GT8A 4RW6B 2XZDB 3DN9A 5BPLA 2F9JA 2BE2A 1WSVA 4B3SF 4K59A 3RZAA 3OR2B 3CC4S 4MDBA 4JB8B 1MNEA 4ZVHA 4XH4A 2R7YA 1F3VA 3AVHA 4TYAA 3T41A 3EE9A 1RT7A 4BREA 1N0UA 4JI4K 2E44A 1VS3A 3SQ4A 1I6JA 3L9ZA 3P4IA 5H9FJ 5B0EA 1LW0A 3H46O 3L0QA 1TL1A 3MM9B 5ELZA 3LDLA 1D9DA 2J7UA 1HBNA 2UUBF 2AP1A 2OI2A 5K14B 4FF4A 3AQPA 1WHXA 3VESA 3OS2A 4IO9L 2W8LA 4IDHA 5C42A 2LQ8A 1WELA 1SH2A 3O44A 1TAQA 1WOOA 1HFEL 4FJNA 4WIQA 2I38A 1EZZB 4ZVTB 2H5IB 2GIRA 4CH0S 3UD5A 3HVRA 3IC1A 4X62K 2KT3A 1S0OA 3AO5A 5EHHA 4M5GA 4NXMF 2HBMA 2CFXA 2A6OA 1FFWB 3G87A 4ZLJA 4MO4A 2EFGA 2P6SA 1HHTP 1IBLF 7FDRA 5B09A 4DV0F 2EEYA 1T11A 5BYQA 3TWZA 3CJ2A 5DG8A 4OVLA 1M90O 3AAQA 4LH5A 1QDUB 4OLBA 2P9EA 4H0TB 4KH4A 5A8KB 1UZDA 2WTFA 4F36A 2BQRA 2E5JA 3L2UA 3R5DA 3AJDA 4DV7J 2J0XA 4FNIA 3MMAB 2EC2A 5HJXA 2YWGA 4CJFA 3F44A 4DR3K 3TPQA 2NZTA 1GOBA 2V8DA 3W62A 1FD8A 3CMES 2HLUA 2CYYA 4CFCA 4CFBA 3QAEA 2UXBK 5SZTA 1VLYA 1KVAA 4KKOB 1S49A 2WVCA 4B3MF 3OW2R 2A1BA 2HHSA 2HSEB 4JRQA 1NBEB 3NMRA 3O3GA 3PSIA 1AROP 4CZHA 4E0DA 1S6PA 2B51A 2MKHA 3C16A 2AU0A 3BV8A 3R8EA 3BKUA 4N47A 1NPPA 2CPZA 1U2RA 5IT9U 3R3LA 4C8KA 3HT3A 2CWKA 5KG1A 3PW7A 1HKGA 3O1WA 4CO5A 3TWHA 4KJIA 5DLFA 3KTQA 1G1XA 1S5ZA 2ZE2A 2DPIA 3A3NB 3H45C 1C2PA 2RU3A 1F5AA 3ZSOA 9RUBA 3CDWA 1ZH5A 3CULA 4ECUA 3RBEA 4O23A 1V3ZA 2E1PA 2AQ4A 4M3WA 2VQEJ 4JI2J 4EZ9A 1S0NA 2ZNYA 1AYEA 1JKHB 2DXDA 3W65A 3D54A 4CF0A 4Z94A 1TKTA 3SMZA 4DZ6A 1JCFA 1VCTA 3MX5A 3EYZA 1HMVB 1P8GA 1RHQB 2DKOB 4UQTA 5L1IA 3FZLA 1M5VC 1JLAB 4YDUC 4FXVA 2JC1A 4DFPA 3QETA 3ZT1A 3EDQB 4AQYK 4I6MA 1FX2A 5KFHA 1UZHA 1VYAA 2W42A 1RA7A 1T95A 5JICA 5M1KA 3WX4A 4B1VA 4BE1A 2BW2A 3ILJA 2OKQA 1FEEA 2WVDA 3SMPA 3CPEA 3EVMA 5HBMA 4P72A 5E5NA 4D3GA 3PEJA 5FLXU 2CG8A 3QESA 2NYIA 3G2XA 3QT8A 3CE8A 3KJQB 4A8OA 4LMZA 3J80U 2DFFA 1E6YA 1VQ7S 4QCLA 2CJAA 4QIVA 3OSPA 2KW4A 1WAJA 3H59A 4E98A 4OYAA 2PSZA 2EG1A 2MKIA 4ETXA 3R8YA 1WOQA 3NH1A 3H4BA 4M3XA 1RAOA 3K17A 2MZ1A 4JI0K 1IO2A 1D4XA 5MAOA 3MX2A 3LP0A 4AHTA 2ZBCA 4IG3B 3MCNA 4M3UA 1VQNS 4TLRA 1ZM4A 1N33K 3ZTPA 2W9CB 5MLCV 3J81U 1UWBA 5KOXA 1HYVA 3AVAA 4UOCA 4M63C 3Q8RB 1XN9A 2AD9A 4PG8A 1VRUB 5D78A 3D28A 4KH5A 2BYCA 3CC7S 3UKRA 3OSNA 4QIWD 2JRSA 4IOAQ 3RB3A 1EAYC 1S48A 1M1KO 4P7VA 2OD4A 5BREA 4KH1B 3V81A 3QO9B 4OV6A 4ZP9A 1H1VA 3L3CA 4DV5F 4MKYA 1HWUA 2KN4A 4JK7A 2B6AB 4GKJJ 1BY9A 4XDDA 2F9TA 2F4VF 4AF1A 2VC0A 2HBLA 2YWWA 3CC2S 1TUVA 4KPCA 2ZHAA 4OO1J 2I2YA 1VJWA 4QIEA 3S7RA 3EEQA 1XJWB 3ZZTA 1SKUB 4CRJA 3N0VA 1RHRB 2E20A 1VK8A 4CHOA 4DB3A 3CETA 3W1YC 1BWFO 5A8WA 3RMCA 3ZTRA 4RLEA 3U9ZA 4DR1K 3X1LB 1ILYA 2NR0A 3KHRA 3KG0A 3PDNA 2YXLA 4UQGA 1KAZA 3KK2B 1CJTB 3DOLA 2LA6A 1NZ8A 4MO5A 2XMMA 1FK9A 3GIJA 4HACB 4C1NK 3UCUP 1CJKB 2WONB 5EWEA 1JXVA 4UZCA 2CPHA 3DXKB 2PMHA 5HN0A 4BVOA 4F50A 2UUBJ 2Q3PA 5E41A 1HQ2A 1MN9A 2HBKA 2VQFF 5JMNA 1FDNA 1SXLA 1WTFA 5LL6Z 3FSXA 4JLHA 3T9ZA 2BJ9A 3KLIA 3I8DA 3OYMA 4YB5A 1WF2A 3HVAA 2ZH3A 4E7KA 4DL7A 1VSFA 2XGPA 3WNHA 5ETSA 2FZCB 2C3MA 2OEJA 4NEZA 3DKDA 4L3KA 4CP5A 4CZFA 1NK8A 3ZSZA 2P9CA 2IOCA 4MK8A 3RAXA 2RSQA 3AOAA 3AD7C 3HMJG 2YWFA 1H2UX 3NVKA 3RSEB 2FVSA 2N4DA 2B9WA 4B1WB 3K59A 2E1MC 1BCMA 2VDHA 4YOWA 2QFJA 4LR9A 3OYNA 3EXYA 2XULA 4CLTA 2WUSA 3SDEB 3DMJA 5IT4A 3Q8UA 3OFGA 1TL7B 4PAAA 2BZ2A 1NOZA 2V8VA 4LF9J 3DXSX 3GIKA 1DBDA 4TYBA 3N5FA 1UJ6A 2QSFA 4MIBA 1ASUA 2Q1LA 1JLBB 2W2NP 4ZKAA 4OYPA 3BO4A 3POTB 5M1QA 2V7YA 1CJVA 1TK8A 3MN9A 2JVOA 2XGQA 3NBPB 1NSKL 5JJBA 4IBNA 1C1BA 2ZWOA 1ROFA 4DX7A 4UOFA 1CJUA 4I0WA 4BRMA 5H1SV 1RGIA 1IKVB 2IVPA 1VQ6S 5KFFA 3JTNA 3LANA 4KTZA 3EM1A 3RB6A 4X4TA 4ZLLA 5KG3A 1QS4A 3OYGA 4XH1A 3UIQA 3FFIA 4PWWA 4MIAA 1GMUA 3RRKA 3KLEB 3EPGA 3PHTA 4C2MA 5LL6d 3D4JA 4ZS6A 5I42A 3DRSA 3M2VB 4RX6A 3W8GA 2BMBA 1HWKA 1AA1B 5GAGI 5KT2A 3LPUA 2XZTB 3HHNB 3AD9C 5EX3A 3LZIA 2Q79A 1N36F 3OV7A 4ICLA 4ZP8A 3ATVA 4BQZA 3JSRA 1HBMB 1X9JA 1UETA 2HHXA 1U0HB 4B9MA 5KFWA 2OO4A 4K8RA 2E5LK 1Q79A 1UCNA 1UEKA 1WSHA 4ZLPA 1DKGD 6FDRA 3ILIA 1FJ7A 3ZEUB 1IJEB 4EAHD 5FPMA 2ZZNA 2B0GA 4WBFA 2GAGC 1J54A 2ZQBA 2FF6A 5JVGL 2B5JA 3ZC4A 4OPJA 5EX0A 2F8HA 5M1OA 4OZ5A 2NCKL 3GFXA 2PGCA 4I7FB 3JS9A 2R7SA 1T9TA 5GINA 1RP5A 4IJAA 4F7VA 1AFIA 1IKWB 3THWB 1UVIA 2D1KA 4PWDB 4PXEA 4DX5A 1Q5YA 1NGBA 3IP0A 3QICA 4JKAA 1S6QA 1SUQA 1P27B 2W41A 1Q7YO 4ZVSB 1YJ9S 2C28A 2FYXA 3TAMA 1WDTA 3OTBA 4P75A 4B3TJ 2HWIA 4C8ZA 2ZDOA 2E66A 1TMJA 2JEIA 1J5EK 4DR6K 1EKSA 1E3MA 3C6TB 3TUPA 1U47A 5CCMA 1I5OB 2WAQD 2M52A 2A2DA 4OLPA 2UUCJ 4CZCA 3SFUA 3V5RA 1NMNA 2BOAA 4L3NA 3QEVA 1QAYA 4OX9K 1JLCA 3LPTA 5KT6A 5HQMA 1UAXA 1KKHA 2AZ1A 5J2NB 4BHQA 1N34J 3EY1A 1XUPO 4KB1A 4ZTJA 1M5OC 3KUHA 4FWPA 3QWUA 4HI1A 4MKAA 3AOBA 1N88A 5BRHA 3OFHA 3B78A 3CCSS 3V6JA 1LFWA 1RWOB 4PHTX 1UFWA 4Q7AA 3BEXA 4DV1F 1V6HA 4WU3A 2CWXA 3JQKA 3D2EA 3DGPB 4NA2A 2JEFA 2PE8A 1RKIA 3DLLQ 2W9BA 4F4XA 4BY9C 3A8IA 2NZCA 1MMLA 2BX6A 4MFBB 2C2NA 3K9JA 4KB7A 4OZ0A 4LF6F 2GVZB 4IFYB 3I0SB 2G0IA 4ED6A 2W8KA 4KREA 1DAXA 3MMCA 4ZK7M 3DM2B 3BY5A 3SJHA 3UB5A 1Q78A 2CZ9A 4IFVA 3DXMB 3EE3A 3GE9A 5AQYA 2YNGA 1X4HA 2A1RA 2FHJD 4WQ5A 1X5PA 4R25A 4M41A 3SFGA 3THYA 4RW9A 1FT8A 4HVJA 1UTAA 4DR4F 2FUG9 1YUWA 4CZMA 3M6GA 2ZJPL 4IEEA 3KUGA 4HWIA 1HNXF 1RJJA 4CLKA 2VQFJ 5BN8A 4YB6A 1X8DA 2CGLA 1DTQB 1SC4B 3NH0A 2AEFA 2GNKA 2UV8A 2CQ4A 2QL9B 3QGGA 2GAHC 4EO8A 2SXLA 3RR7A 4ED7A 4CGDA 4NLUA 5AQLA 2GMJA 1IG9A 3IBFB 2AMCB 4Q5VA 4FK0A 2RD5C 4DR5J 4CEOA 3O9TA 1Y10A 4KGMA 3DLBA 1DJ0A 1QLNA 3OL9A 4WCEL 1TV6A 1T44A 3FFKB 2LKZA 3G0ZA 2CQ0A 2OZSA 1NGAA 1JL1A 4P71A 2M7SA 3CJTA 3EMTA 4E1MA 5F0UA 4LQ3A 4O0JA 3CQXA 4OZ1A 1VSDA 4IG0B 3M8RA 2KDOA 5HVGA 3KXDA 3V9UA 3VQ6A 3W5ZA 5ADZA 2W6LA 3V6HA 4LRDA 3R2CJ 4NXMK 2J4RA 4BR9A 1UA0A 1RQ0A 1WEXA 3WQPA 4F2RA 4KT0C 3AFGA 5EUHA 2D1CA 2X6SA 4QOZB 2KKHA 5F1XA 4X65K 2ALZA 1OKJA 5AT1B 4YN3B 1U1LA 4ZITA 3I4PA 3PTWA 5FDLA 4Q0BB 1VQKN 4JI6J 3G6VA 4OHWA 1RTIA 4A47A 5DDRC 4A5BA 4FWLA 1U26A 3UPFA 5J1PA 4ID8A 1H74A 4JKCA 2ZH7A 4R8UA 3G4SS 1NMDA 2HQIA 2IBOA 1RWUA 3BN7A 5C2GA 4NLVA 2PI5A 1NK9A 5IZHA 3M2UA 1XK8A 3NVMA 2VFTA 3WDOA 3SSSA 4HTIA 1NEEA 3ENQA 3ZT4A 4O4GA 3D0HE 1HNWK 2BABA 2G2OA 3ZX2A 3PX4A 3QT6A 1TTHB 3OR1B 3L2VA 2HAIA 1T9UA 1SQGA 2NRTA 4X2BA 4EEYA 4YY3J 1JLFA 2KFNA 4EMDA 4JV5J 3AODA 2BKPA 1NBWA 3KKSA 2Y8WA 2O5DA 4ENOA 4KHPF 2EFNA 2IC3B 4YP3A 2PZSA 5IOLA 4OYOA 5A2QO 2P9SA 4P2FA 3MXJA 1FWKA 3BGLA 2J5AA 4DMZA 4JRPA 1XNRK 1C0TA 3JYTA 5AQXA 1NAQA 2QWRA 4A48A 5C24B 5FD1A 3PJWA 1CPZA 2IS3A 2MZQA 3WQUA 2O66A 2YJFA 5AXNA 1NGJA 1HPZB 2YKMA 1Q8BA 2AEMA 1C0UB 2GCFA 3AXKA 4B3OA 4E19A 2W01A 2Z2ZA 2GQQA 2IY5B 1O13A 3AY0A 2YNFB 4CJRA 4JI3J 5KGXA 3AAPA 4P2SA 3VN5A 5IWAF 1KCFA 3T1HJ 4OMFG 2IM3A 1TL3B 4RW4B 2KYXA 3T1AA 4LF7J 3O5TB 4LQ9A 3WXJA 4G6VB 4ED8A 3NS7B 1S1UA 4NLPA 1RTJA 2FLPA 4NYNA 3LWLA 3HLUA 4Q2LA 4X64F 4H5WA 2HNYB 3HCXA 1S4FA 3N6MA 3ZLJA 3HP6A 2QA2A 4M7XA 2R8HA 3CO9A 4DS4A 4KRWA 2DVIA 9ATCB 2E1RA 4P73A 5CZ2A 3VPZA 2O67A 5A8RB 1RYRA 3IAYA 4Z4IA 3D6HB 3UD4P 4DFKA 2KXFA 4DSLA 2XYGB 1J6ZA 3I33A 2QXLA 3F2KA 3QRRA 3ZETB 4FVMA 1T94A 4CJTA 1ZM3A 3M32A 3CO0P 4M3TA 1EXQA 4UF4A 3DRXA 4USIA 4CJQA 5F8IA 2XO7A 1HRHA 4JI8F 3DFEA 1RT1B 1TKZB 1MLAA 3D7SB 1VOMA 4CHNA 3OYHA 1HI8A 1WSJA 3DOKB 1OVQA 3Q23A 1XQSC 1U1KA 4WFZA 1W7WA 5GAGU 1O0PA 3DRRA 3CQ8A 1VBKA 2D7SA 4V19X 1Q8LA 2Z1IA 4QR2A 3KLHA 5K8MA 2QO3A 1Y5IB 4RUHA 4W5OA 4PR6A 1HYSA 3LTOA 3GZ7A 4NXNK 4CF9A 4PY5A 2IAJA 3T1YJ 4PG7A 4KY3A 1NJYA 3TR8A 2A10A 2GMHA 4F3OA 2GUIA 4RUCA 1L3UA 3L8BA 2PMZD 3K9KA 4O5BA 1RCOB 3I0RA 3PX0A 1SJ3P 4DQIA 2KHOA 5E3AA 4F4KA 3JQJA 2P9UB 4ITSA 1HR0F 2DNZA 5GAEP 4BDPA 4FF1A 4LSLA 5CR4A 1QVFR 2HOEA 1YT3A 3OS0A 2X3DA 5AQQA 3M8SA 1UVJA 4FYYB 5KG6A 4QOTA 3P4UB 4JI1F 3ET6A 2J7KA 4N8NA 3TU5A 3THTA 1TYQA 4C98A 4M7YA 1Y97A 4NI2A 1S1TB 3D2FB 3KHHA 1HL6A 5HRSA 1WG1A 5C0YA 1VISA 3TX8A 2Z2LA 1GXTA 2I5JA 1TMMA 3OT9A 4PQUA 1R0AA 4NYZA 4LF4J 3MUVP 1NPKA 1RI7A 1CXUA 4YB1P 1GQEA 2ATLA 2KHDA 3T5KA 3PRDA 4U95A 2H51B 3N4QA 2MQOA 2V94A 4FKYA 3RW7A 2HWHA 2D0OA 1HNIA 3MFHA 4X4UA 1KLMA 1HJOA 3CJQA 3HHLB 1RBAA 1IV0A 5KFDA 3P38A 4X66K 2D41A 4MJKA 1NHUA 3TW0A 5KFAA 1RAEB 2C3OA 3VAFA 4KPYA 3PW4A 1JCGA 1YTYA 5D8HB 3M1VB 3TQEA 2HFSA 2R7RA 3CIZA 3THPA 3KJFB 4ANDA 2UU9F 3FBFA 4FWOA 3EUNA 3EWGA 4F02A 1RHJB 4G65A 2ITGA 1DHMA 1ZYQA 3QIPA 3HPHA 2QMXA 4I69A 3PYGA 5FPEA 5CY4A 2WCXA 3GE1A 2WK4A 2DNGA 2Q2RA 3PKMA 2YTCA 2AV5A 4NA1A 5KFXA 2MLXA 1FE0A 3OQ2A 1NZAA 1H6KX 2R2UA 3J7AN 3Q83A 1K8KA 1MU2A 3KNAA 4ZPBA 1KVJA 2R7OA 2DPJA 3KJVB 2AP6A 1B3TA 1Q82O 3LL3A 4WFYA 3AA4A 1KWMA 5C5JA 5GAHI 5KG0A 1SS6A 2H65B 4NLYA 3ZZ0A 4DEZA 3SCKE 5A2QY 1P8ZA 4TKTA 2FQQB 4Y2MA 4NRTA 4DR7F 2QFIA 4P2MA 3M2RB 1S22A 2FJDB 1Q4RA 2FBVA 2UUAF 4DTXA 3KG4A 3K5NA 5HL7Q 1ULRA 1NXIA 2F8TA 1FRIA 4OJRA 4JD2B 2HS3A 2JWKA 5RUBA 3LP2A 2OPRB 2GX8A 4CZKA 4Y0FA 1SV5B 4LVOP 2L9DA 3M8PA 3ZT0A 4FJGA 2ZHBA 4KHPJ 3M6WA 3MECA 5KOWA 3EN9A 2NLXA 4O44B 5LMNJ 1IBMJ 3CD5A 3O9QA 3NDKA 1S6UA 1QHAA 4E2FB 3V6DB 3NS5A 3QMLA 2R4FA 1KQKA 2BE7D 4KO0B 3FNNA 5LJ3Y 3DOMB 2LCWA 4M5DA 2JOQA 3MN6A 4WYBA 1RAJA 4FYWB 1RAHB 3M7VA 3LP1B 3KLFB 2DR7A 1BI4A 4Y2IA 3SCXA 5I4MA 4OJ3A 5D0GA 5SUHA 1QQMA 2P1JA 2ZJRQ 2NXNA 2RNEA 5LSRA 4G3IA 3J81j 4IOAL 2XHBA 4WFBQ 4DTMA 2Z57B 2ZF5O 3KG1A 2HMPA 4L6V3 5AQFA 2B8QA 1VRTB 3KWIA 4V19S 3OFFA 3HHLC 2GTDA 3MR7A 5J2QB 4WXWA 4LFAJ 4I6AA 1ATRA 4PKHA 3GJRB 4RKUC 1YWXA 4NLBA 4CM2A 4DUYF 5LT5A 4HDHA 4DV6K 3Q89A 3MEEB 3R6MA 3RWUA 2ASDA 4IQMA 4LSNA 2VKRA 2FJXA 2XI2A 5JUMA 5L8RC 2E8AA 3VEZA 4YHHF 3NCPA 1JLGB 3M8QA 1RNHA 3Q8YA 4H5VA 3MAQA 3TSUA 1JJHA 4LFCK 4TXSA 1U24A 1KC8O 2ZM6J 3H5UA 1UJ5A 2UYTA 1VQYA 5FROA 3MDQA 4ZHRA 1X4GA 1VSLA 3TZWA 4B3RF 2IGIA 3MCAB 2IRUA 3US5A 2FBYA 2LXUA 4CQ1A 5D4LA 4NZ6A 4DU7A 3QATA 2OFGX 1KD1O 4AL7A 3LAMA 1LQ9A 2B4VA 1YBTA 1D3WA 3X3UA 1B9DA 3ENAA 3GL1A 1H73A 5EXWA 4C3MA 2EBGA 1LWCA 1GX5A 5AQIA 3ASMA 4DG1B 4CHQA 3NF9A 3H90A 2G2ZA 1GFWB 1Q1KA 2MZSA 2ZJQQ 5LJWA 2XS5A 4F2SA 1PJ5A 2FVQA 4DJBA 2KQ2A 1APSA 2YI1A 1YJTA 1ZTWA 2DY9A 2NSBA 2PN6A 1ATNA 2H5JB 2KYZA 4KHQA 2VWJA 4RG8A 3D3BJ 4J9VA 3ZX3A 1X60A 3IRXB 4USVA 1WWHA 3NNHA 3ZSXA 1FDAA 3OY9A 5F0WA 2YHXA 5D77A 4I4BA 2GMLA 3C6HA 1FX4A 3AGKA 4WU2A 3JQMA 3SXLA 2CQGA 3R7SB 1XMOF 1S12A 2WSCC 2HQFA 2O8EA 4FS2A 1YZ6A 2HHHJ 4W5QA 3EXCX 3SQGB 2AGOA 3AA8A 4ES2A 4L75A 2WVBA 3HSTB 4FPBA 4DV1K 3OTDA 5FRMA 3SQ1A 2CG4A 1VHIA 4FPIA 3SYZA 1VIXA 4CK2A 2EFPA 2EHGA 1VSKA 3OYFA 2CXEA 2IVMA 4CI6A 4QU7A 2N3LA 4B1YB 3FQKA 3W2WB 5H9FK 4DZDA 4BRCA 4LF6K 1FW6A 3EGVA 2F7VA 2DISA 3HPGA 4FWMA 2A6MA 1DT9A 1LW2A 3MEGB 3PV8A 2D0PA 2F65A 4LBHA 1U1QA 4OPKA 3T9NA 4QS7A 1XMQF 4H4MB 3BYRA 4CJPA 2BJ3A 1F2HA 4U7UK 3HD1A 1U04A 2YNHA 3WC0A 3ZT3A 2AZ3A 3QEWA 5CQGA 2ATQA 4JOUA 3OYKA 5FPNA 4J2BA 2BJ7A 2RT3A 4QAGA 3H5XA 4H5RA 3L7UA 2MXYA 3HVTA 4EBEA 3MPVA 4ECSA 4JI7F 1PAEX 4RW6A 3K8VA 1S9GB 2W2PP 3ZSYA 3J7YP 2OP5A 2ZKUA 4MIWA 1CC8A 4ILHA 3C14B 3CMAN 3PHEA 4TY8B 5HO4A 4B1XB 4URSA 3GV8B 3ZO7A 2NREA 2ALYB 2RH3A 4H0OA 2DY4A 1MROB 3L3UA 2ACMA 4AL5A 3KHGA 1N5YA 2J7WA 5KI6A 4H0PA 2DHSA 3HFKA 4DV7K 4LF5F 4P7TA 4P10A 2UXDF 2RMLA 3G9CA 4H0XB 2M5YA 4ZPDA 2MGZB 3R27A 1ITPA 2ASMA 4LH4A 4WP8A 4MT1A 4EGLA 2WOMB 3QGHA 1WI6A 1XIQA 4ZIWA 1NJIO 3IUCA 2Y3YA 4GW6A 1FI4A 1XC9A 4OYXA 2CJ9A 4GMKA 3O3HA 3HM8A 3WNFA 4CT9A 1JCEA 3WEEB 2IRYA 1LWXA 2FJAB 2K1RB 4OYZA 3LDOA 5HMXA 4MMOA 1TL4A 1NGFA 3E01A 1LAVA 2HVEA 4DL6A 3F56A 1KAYA 4ETZA 2JLFA 4YOTA 1C6VA 2W4DA 4I2QA 2HQ3A 4C1NI 1OSCA 2YKPA 4RW7B 2HBYB 2W2QP 4FWSA 4E3SA 1NRKA 4IKFA 4RBTA 4DTRA 5A8KA 4CZIA 3Q22A 2KZZA 2DHHA 1FVQA 1BIZA 4CJWA 2VQEK 4CBXA 4JI2K 2J0SD 4CGHA 3H2VE 3NGIA 3W5YA 3CCZA 4JK8A 2PT0A 4W90B 3BQ0A 3OYBA 2BM0A 3CMAS 1MWQA 2RU9A 2JX2A 1MMNA 1IKXA 2IA6A 2ZKTA 2PEHA 4U8VA 4DLEA 1X4CA 1PBUA 4EP4A 3P5TL 3QEPA 3CD0A 1RU1A 5GAHU 3M05A 1WOSA 1TKXA 4NYOA 4DUZF 4DS5A 3DLLL 1FTCA 1FWPA 4NA3A 1NK7A 4CYUB 4DV4F 1KD1T 3OL7A 2R8GA 3FRZA 4LREA 5E0OA 3THXB 3CM6A 3CCVS 1VBZA 5C10A 5ADXA 2N4CA 4OYMA 3ISZA 5A76A 4DWIA 1H7WA 3PYDA 1X5TA 2RRAA 2HVIA 4WWSA 3C6UB 4NWBA 3N6NA 4BWMA 2YNIB 3RUBL 4CJ3A 3AO2A 2YH0A 2YWEA 2XMJA 1BLUA 4EIAA 4PUOA 1TELA 3U8XA 1P9YA 4O55A 2DGUA 3KHYA 3HI9A 1CS4A 1TU0B 1Z1ZA 3NGUA 1JJCB 4PXDA 4ANCA 1JLEB 1NG9A 3CJ8A 4DUTA 4FW1A 3OYLA 2JEJA 3MTKA 3MN5A 2R2RA 2QC3A 1JLAA 5C12A 5T41A 3AD8C 4FZVA 4NCBA 3M30B 3Q2TC 1Y9OA 1KQGB 4DV2F 4CIFA 5KFKA 3CPWM 3U6FA 3K5OA 3WIUA 3D2WA 4LR7A 1OH7A 3OVAA 2DR5A 2DHXA 1FJGJ 1KN6A 5A6PA 3AO3A 2LQ9A 4M3ZA 4GKJK 2LU2A 3DLGB 2G8IA 3QERA 1WC1A 1J53A 2J8SA 4AUKA 3LAKA 3SMSA 1VQMN 4EZ6A 2HHQA 5AQJA 4RBUA 4YR0A 1Y64A 1S6OA 2XG8A 2XWXA 5KPTA 2QWOA 2FC0A 1F9HA 4HTLA 2LEBA 5HROB 4HHUA 1I94J 4YOYA 4IG3A 3FCVA 4K2JA 1WEZA 5DG7A 3AT1B 3VQ7A 3VAKA 1T03B 5A0YA 2W9CA 2E5HA 2YWKA 1CLFA 4OYWA 2BJ1A 4J9RA 4CIEA 3NNCA 4CHZA 1ZS6A 3O1BA 2OAUA 2UUWA 2EFVA 2RAQA 2BANB 3FBEA 3K5MA 4HKQA 4F0MA 1ELOA 3PEHA 1DEJA 4BRIA 4X84A 3L7PA 2HSTA 3PZPA 3BZCA 4JI1K 4ISFA 3AVFA 4QS9A 3QPIA 3CJSA 4ALZA 3G10A 3GFHA 2XCAA 4ID5B 1DGKN 4EP5A 3NNAA 3NGTA 3KK3A 2RDDA 4CHYA 2IDOA 4A57A 3OJUA 2HNZA 3TTFA 2X6NA 4FYDA 1CQNA 4F9OA 2VWBA 1G3OA 1VQ5S 3OVNA 4W92B 1XMBA 2K3KA 1KP6A 3OTOJ 2CKWA 3FK4A 3PIPQ 3E9LA 3CCES 1PKUA 4JS4A 4PG6A 3AXMA 1UVKA 3HT0A 3ZZZA 1U1NA 2GGPB 3W5XA 1HIYA 2KVQE 4D3HA 4ZOSA 1OQ3A 4ECYA 2X51A 1YHQN 4BC9A 5DGBA 4HACA 2B9XA 2AJ0A 2WONA 1NK5A 1RHKB 3DU6A 5L38A 5LY3A 1XTZA 4JI4F 4LF9K 5J2PB 3TZZA 2IDLA 2D9PA 4XPCA 3ENOA 1VSMA 2UU9K 3CJCA 3GIIA 2WTUA 3SBMA 4ECVA 4KIAA 3C15B 1VQPS 4E7LA 1PC5A 4AHCA 1L3KA 3CJBA 2C2DA 4CK1A 3L09A 3N4WA 2EWHA 1X9SA 4GVEA 2XC9A 4ZVGA 3RBZA 4CD1A 2BJ8A 2EWSA 2O8DB 5B0GA 2DH9A 3KK1B 4NLGA 3OJSA 4X4VA 4YR2A 2K8GA 4J2EA 3R7NB 4L8RB 1YG0A 3SQ0A 1MMDA 4A59A 3MWPA 4X62F 2N3OA 1FFSB 1GTHA 3RSEA 3RW6A 5AQNA 1VQOS 3VEOA 3CJKA 3DCAA 5LMUJ 4OX7A 1BUXA 1IJJA 3BH7B 4FBUA 3HFZB 5D4NA 1R8CA 3TEHB 3CCUS 4X4SA 2D0AA 3SDEA 3TVKA 3K58A 4IR9A 1F0XA 1D9FA 3UN3A 4USJC 2R8KA 4BG9A 3UCZP 4DTSA 4FVUA 1UPMB 3LGHA 3QFPA 3PCOB 2MQPA 1AZSA 1RBTA 1JLBA 1ZA2B 4RZRA 1F5CA 1HYZA 4FJ7A 1Q18A 3A0IX 3QZ7A 4DR3F 2HNDB 3NF7A 1QUPA 5KT3A 3JSYA