4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
2BQRA 4M3RA 3JSMB 2F8SA 4H4OA 1NOYA 4N5SA 4AHUA 1JXLA 3BR9A 3H08A 4FK0A 3CJ5A 3I5AA 4OVLA 1IKVB 2WOMB 4PY5A 3LP1B 5HLFA 2HHVA 3TAMB 1QAJA 4TYBA 4K50A 3DM2B 3EPIA 2ZD1B 3OYCA 2YHAA 4LH5A 1VRUB 4CJFA 5HP1B 3HYFA 2Z1IA 4C8KA 4O3QA 1YT3A 1BCOA 3RMAA 2ZQBA 5KFPA 3F73A 1UAXA 2I5JA 4ZP6A 4ECXA 2V9WA 4I9QA 3TARA 2AU0A 2HHUA 5KFWA 4CEEA 1VRUA 1HYZA 1JLAA 3KHHA 2W9BA 4FLZA 4Z4GA 3P1GA 1LWFA 1VRTB 1R0AA 2ASDA 1NKCA 4KRFA 2J6SA 4B8AB 5F9NA 4FZXC 1UWBB 4DS4A 1WN7A 3HP6A 3V1RA 4ELTA 3HP9A 3T5LA 4FLXA 2W9AA 2DTUA 3OLBA 5KFAA 4BWJA 1L3UA 5CYQB 4PA1A 3AVNA 1EX4A 1QE1B 3LDSA 1N48A 4NLPA 3LAMA 3QLHA 4FS2A 1C0MA 4O0JA 3NH2A 3NHGA 3ZSOA 3VQAA 3D28A 4FYDA 1TKTB 1ZBLA 4M3UA 1ASUA 4Z4IA 1WSHA 3V6KA 3GQCA 5KG0A 5EWFA 4MQ3A 4CFCA 1ZBIA 1RBUA 1QSLA 4MFBA 3MFIA 4J2AA 3L3UA 3MEGA 4W5RA 3V9WA 5DQHA 3HVRA 2BE2A 2BANB 2OPPB 2R2RA 5J2PA 1TAUA 5I42A 3KD1E 4OPKA 4ECZA 4WYWA 1CXUA 4IRCA 2UVVA 4OKEA 4AHRA 5DG9A 3FFIA 1C1BB 1WSGA 1A5VA 4XPCA 1SL1A 4BE0A 3AVBA 4B08A 2YNFA 2W9BB 5CY4A 2W8KA 4CJEA 2IC3A 4U7CA 2VG5A 4OGCA 3OJSA 4C8MA 4CERA 2ETJA 3ITHB 1MU2B 4FK4A 4FJ7A 1TL1B 3DRSB 3N6NA 2ZKUA 4FJ8A 4HCCA 1TL3B 4RW7B 1Z25A 1N5YB 2FVCA 1TQLA 3TAFA 3V6DB 3ZT0A 3KD5E 1FKPB 1MMLA 3UDLA 2XY8A 2G8VA 3V6HA 4CECA 2BRLA 1J5OA 3OYBA 4U6PA 3MTKA 3AO3A 2KW4A 4HHTA 4FZYA 3VQ5A 4KAIA 4KI4A 3QGGA 3E01B 4F4XA 3KKSA 3ZT3A 3RMDA 3L2WA 1BHLA 3K5NA 4K4VA 1TV6B 1HARA 4RU9A 2UVWA 4KHQA 4K4ZA 3O4QA 4QWAA 5T14A 3C6UA 3VQBA 3O3HA 1RCHA 3M8PB 4KE5A 2HNZA 4NLUA 1JXEA 2KZZA 3BSAA 1RNHA 1BISA 3CWJA 1RT3B 1YTUA 4O3NA 1F21A 2AX1A 3IS9B 4QW9A 5HRPA 5F9LA 3S3NA 1WNSA 4LSLB 3PY8A 5HBMB 1T3NA 1SKWA 3FRZA 3ZT1A 4WZQA 3BJYA 3DOLB 4ECWA 3CJ2A 2HNZB 5J2QB 3A2FA 4CEFA 4CIEA 4FLVA 3OJUA 4H4MA 4RW8A 1RT6B 3RR7A 4OLAA 4DTMA 1S9GB 2WK4A 4WXOA 4CESA 1RILA 3E51A 4FLYA 4QWDA 2JC1A 2KZMA 2IOCA 1T03B 2YNIA 1XR5A 3U3GA 2PYJA 4C8LA 2HNDA 3OYAA 3V9UA 3NBPB 5DG8A 1S97A 1I39A 4DL6A 4MK8A 3QEPA 3AA4A 3OL7A 3GV7B 4CJTA 2OZMA 4CJWA 5F8NA 3QERA 4CHYA 3K5LA 2DFHA 5KFJA 1K1SA 2HNDB 1VSDA 1FKOB 4EZ9A 4KFBA 2AGPA 1KLMA 4WFXA 5SZTA 5KFQA 4J2EA 4RNNA 4LSNA 5KFFA 3ITHA 2FC0A 4NZ0A 3CDWA 1C6VA 4IG0A 3NGDA 2OYQA 1NKBA 4B9TA 1CSJA 1RBSA 3VQQA 5KG5A 2QKBA 1RDDA 4CHQA 2IAJB 3DYAA 5HRNA 3AA5X 3SQ4A 2QK9A 2JEGA 1RTHB 1Q9XA 3T5JA 2IBKA 3CJ0A 2EHGA 4CF8A 3OYNA 2Y1JA 4ICLA 2FJVA 2RKIB 4DU3A 4JS4A 4PWDB 3JYTA 4WZMA 1LWFB 3KK1A 5KT3A 4J2DA 4B9UA 3H4BA 2YNIB 3AVMA 4CGGA 2GUIA 4OKKA 1Q8IA 4LH4A 2HHWA 2HW3A 2RKIA 2PY5A 4EBDA 4QWEA 1SL2A 1JIHA 4I9LA 2EX3A 2VA2A 3CVKA 4Z0UA 2QKKA 4KHMA 5KG7A 3GV5B 1JLEA 3N6LA 1EP4A 4FJ5A 3HVTA 3CDEA 5J1EB 3QEWA 4O4GA 1EETA 2YKMB 1KTQA 5KG2A 2R2SA 3IG1B 4CJQA 2AGOA 3CO9A 3RMBA 5KFEA 4J9SA 4HVJA 5HLFB 3UIQA 4FJXA 2OPRA 1TVRB 3Q8RB 2GC8A 2D0AA 5KGXA 2VG5B 3GIKA 2IGIA 1C0UA 1L3VA 1U47A 3QO9B 3EZUA 1NJZA 4EBCA 3ZCMA 4O3PA 1HNIB 1JLCB 2WONB 2BQ3A 2OPRB 3NAHA 4KHUA 3IGNA 3VA0A 4ED1A 3DOKB 3CJ4A 3AVJA 1RTJA 1SKRA 2D7SA 5KFNA 4YP3A 3HVTB 1ASWA 4J9QA 1KVCA 5DMRA 3MEDA 1N5YA 3NF8A 4BE2A 3HPHA 2HMIA 3IRXB 4NLSA 5K14B 3GV8B 4KTWA 5CYMB 3C94A 4J9MA 4DSKA 1IG9A 1J9AA 4LSLA 3UR0A 4CJLA 3VQ8A 4QAGA 3AVGA 2FBTA 3V1OA 4FLUA 2B6AB 1RTIB 4DFPA 1JKHB 4IG3B 2VG7B 1SUQA 2UVUA 1RT3A 3QIPB 4K4SA 3RB4A 4CJ4A 2ASJA 2D3ZA 3LZIA 2GV9A 4AH9A 4EBEA 4Q44A 4ED2A 2JLEA 3C6UB 4DQRA 1RT4A 3HVAA 2WONA 2I1RA 3KJVB 4IQXA 4DU1A 1JLBB 4GVMA 3QYYA 4E7KA 1HQEA 1CZBA 4FJLA 3QEXA 1RAJA 2D0BA 4LSNB 1S1UA 4DL3A 5DGBA 2RPIA 4TSXA 4RW8B 3DOLA 4F4KA 5KFDA 3V1QA 1T7PA 2ZE2A 2WOMA 2D0CA 4IFVA 4HUFA 4BDYA 2RF2B 4N56A 1NHUA 2WHOA 4EO6A 1LW2B 2IJNA 3DRPB 4K4YA 5HP1A 3TAEA 1BIUA 4DTOA 3SCXA 4JV1A 4TQSA 1A5XA 5F8JA 1J54A 3SFGA 1WLJA 3AVHA 4DL5A 3PO5A 3KK1B 4DF8A 1KHVA 4R8UB 3TQ1A 3LP0A 1J53A 1GOBA 2YV0X 2UVRA 1LWEA 1KHWA 2W9CA 3BDPA 4PQUA 3QETA 4O3OA 2D3UA 3V81B 4J9OA 4E89A 4W5OA 4BACA 4R0EA 1S0OA 4EP4A 1ASVA 3S9HA 4CFBA 3K58A 1RTDB 4M41A 2XY6A 4ECYA 2ZE2B 1S48A 3KOAA 3NL0A 4X2BA 4OJRA 3MEEA 3I0SA 3UQSA 5KT7A 2F96A 3KHRA 4N47A 4F50A 3WNFA 4KHWA 4FLTA 1T05A 3LP1A 1QE1A 1N4LA 1VSEA 1OS5A 2NUBA 1ZETA 4RZRA 1KSPA 1XWLA 1W0HA 1XR6A 4CEQA 3KK2B 1L3SA 3MEEB 3BREA 2W7OA 2OPSA 3OSPA 3U3YA 4TY9A 4Q5VA 5FRMA 4DWIA 1I6JA 2Q3SA 4DQPA 4E0DA 3M8QB 4MKAA 4CHOA 3MAQA 3L2VA 2IM1A 2IJFA 2W7PA 4CF0A 4CIGA 1Z4UA 3EZ5A 4Y1DA 4F2RA 4Y2AA 3KLIB 1VRTA 1KRPA 3PUFA 3MR6A 3AA2A 2HAIA 4Z4HA 1XHXA 4NLGA 3BGRB 2HHXA 4L8RB 3DLKA 5DG7A 3ASMA 3L8BA 1C0TA 2IAJA 2Z1GA 1TKZA 5KFUA 4NRUA 3OL9A 3M9OB 3DLBA 5T7BA 4ED7A 5J1EA 3OYLA 1DTTA 4RW4B 2GBZA 1TAQA 4RNHA 3N6MA 5KFRA 4MIBA 3ZSQA 5CYMA 4Y1CA 2XC9A 2JEJA 5L1KA 4FBUA 3V6JA 4B9SA 1S1VA 1JL2A 3KK3A 3CFOA 2A1SA 1A5WA 4NLTA 2VG6A 1T05B 3HSTB 4NCGA 3QLHB 4IR9A 3DOKA 3NGIA 4NLYA 1UA0A 1S10A 4XPEA 2GIQA 4YR3A 3P83D 1NJXA 4E7IA 1U45A 3QIDA 3LWMA 4FM2A 3PZPA 4CK3A 4KO0A 4CEOA 4CJPA 1S9EA 1KLMB 3FFIB 4EYIB 4J9RA 1BI4B 2HB5A 2O4GA 1YVUA 4FJMA 5L1IA 5KFOA 4ECSA 1IKYA 1JKHA 1W25A 4QW8A 1G15A 3V9ZA 3OLAA 1KVBA 2XGQA 2UUWA 3K2PA 4FJ9A 3OY9A 2KFNA 4NLOA 3GIMA 1WSFA 3TAPA 4DTSA 4OGEA 2IM3A 4I2QB 4KV8B 4EO8A 3EYZA 4CEBA 4YR2A 3SQ1A 3KMSA 1X9SA 1T8EA 4DSIA 4NLRA 3JYTB 3SUOA 2BQUA 3IAYA 5EU7A 2HHQA 4E3SA 5KFKA 3I5BA 4ID1A 4K8ZA 4DG1B 1RDAA 1VSKA 4AHCA 3DMJB 4KKOA 4IFYA 4HYKA 1X1PA 3RR8A 2W42A 5KFXA 1JLQA 4QOZB 2OH2A 1U09A 1LWCB 1RYRA 5FDLA 1BQMA 3T5KA 4YNQA 1WSEA 4KTQA 3L3VA 1D9FA 4J9PA 5EWGA 1N56A 3BQ0A 3WNGA 2WRMA 5C42B 1RTDA 4CEZA 3VQEA 1B92A 4TYAA 3FSIA 3TANA 4CHNA 2V0NA 3S3OA 2V4QA 3OYJA 4TY8B 3FDSA 3G6VA 1LAWA 1IH7A 1HPZB 4UQGA 4HCBA 1ZBFA 3LP2A 4O5BA 3HL8A 3CJ3A 4IFYB 2FJWA 4FW2A 2G8KA 1ZTWA 2PYLA 3I0SB 1TVRA 2FBYA 1LW2A 3NAEA 2PZSA 4FM0A 3DDKA 1WAJA 4QWBA 3VQPA 1TKXA 2O4IA 5HBMA 4IFVB 3KKRA 1WSIA 3AO1A 1U49A 1QSYA 1IKVA 1DLOB 1EXQA 4G1QB 4WXWA 4E1NA 1S1VB 2WB4A 3OYDA 1X9WA 4K4TA 4DTUA 3OYHA 4ELUA 4ZP8A 4K4WA 2YNGB 5JS1A 1ZBHA 4GC7A 1D9DA 3MEDB 3SQ2A 3PO4A 3HJFA 4I2PB 3MXIA 4IH5A 4CIFA 4RW6B 3SUNA 3DLKB 4M45A 2XO7A 4ZTJA 4PQUB 2ATLA 5KG6A 4I7FA 1UWBA 3BSNA 4ZP7A 1Q9YA 3T1AA 4FJHA 4DL4A 1JLCA 5J2QA 1UA1A 4DFKA 4QWCA 5J2NB 1BCMA 2QXFA 1I3AA 3PW0A 3H2LA 3PW2A 3DI6A 3EY1A 3PX0A 3MEGB 2QE5A 4FM1A 5F8MA 3PW7A 4J9LA 4DU4A 3SPYA 4YQWA 2XHBA 1TKXB 1VSHA 3FQLA 1RT2A 2A1RA 2B5JB 2ILZA 4NYZA 3ZSZA 4FJIA 1EP4B 4DQQA 1HJRA 3SJJA 3MR5A 4FJGA 1BQNA 4WE1A 3G10A 3SV3A 1U4BA 1FXXA 2Z1JA 3M8PA 1JLBA 4KTZA 3KLEB 2XY7A 4MK9A 4EP5A 1S1WB 4F4YA 4IKAA 3AVKA 3KHLA 4AHSA 4M94A 1S0MA 2QV6A 4K4UA 4B9VA 5I3UB 2KTQA 1RBVA 1S0NA 3HKWA 3ZT2A 4ED6A 3ZSYA 5SWMA 3NMAA 2XRIA 4YR0A 4IDKB 1JX4A 4DTJA 2VG7A 3MFHA 5C5JA 1VSJA 4CJSA 3CQ8A 4KHNA 3CFPA 4NCGB 2J6UA 2KFZA 4WYLA 3ZSRA 4DG1A 4WFYA 4F3TA 3DYAB 3PW5A 4MKBA 3G0ZA 5KRTA 2GIRA 3QZ8A 4C8NA 1YTAA 4GW6A 3QEIA 2AWZA 4IRDA 3VN5A 4CGDA 4DFMA 2OPQB 2E9TA 1L5UA 2IC3B 1JLFB 1S6QA 4IR1A 3KLVA 1VSIA 1WAFA 2E6MA 4B8CA 1QSSA 2ALZA 1TKZB 3PX6A 3I8DA 2DPJA 3QZ7A 1N6QA 1S1TB 4DEZA 2V4RA 4M95A 3RAQA 5KT4A 4IH6A 3KLHB 4ZPCA 2R8KA 3TI0A 3O4NA 1NK9A 3SFUA 4TXSA 1HYSA 5C24A 5KG4A 4ELVA 1D8YA 3HHKA 3RAXA 2R8HA 4FLWA 1S9GA 4WFZA 3RRGA 4FZZA 4O4GB 3H98A 4FW1A 4URGA 5KI6A 3IG1A 3HPGA 2FJXA 4PUOA 5K14A 3H5SA 5F8GA 2E9ZA 3TR8A 4DLGA 5D3GA 1LWCA 4JLHA 4LQ3A 3VQSA 3DI6B 4ZHRA 2C2DA 3OYKA 2I5JB 4FJKA 3V6DA 2FVSA 4NRTA 3BQ1A 3IRXA 5KGWA 4O0IA 1TK0A 2DFFA 4MIAA 3LPUA 3LZJA 4ECRA 4I7FB 2B43A 1TKDA 4ZPBA 4ECQA 1L3TA 4KAZA 3K5OA 4Q43A 4KFBB 1S1TA 3SPZA 1SH0A 3LP3A 1TK5A 5J2PB 1HMVB 3SYZA 4DQSA 4LD0A 2DFEA 3RB0A 4FVMA 3CFRA 2R2TA 2OZSA 3KLHA 1RT7B 4E7LA 4B9LA 3VQ7A 2OPSB 4PWDA 1XI1A 1RTHA 4RNOA 3QNNA 3GIIA 1LAVA 2X6NA 3ICLA 4KSEB 5KFSA 2D5RA 3NH1A 1RDCA 3QGHA 2R2UA 1GX5A 3LWLA 4IKFA 4Y34A 1FKOA 1IKXA 3PV8A 4CHZA 4H54A 4DLEA 4IG0B 1D5AA 3WNEA 4O44B 4KREA 3OYFA 2P5GA 2FBXA 4TY8A 3C95A 1DTTB 4RW4A 2BDPA 3CDUA 2HVHA 4CEDA 1JXBA 3NF7A 4BWMA 4H4OB 1RT1A 2BRKA 1XC9A 2W9CB 4G3IA 4Z4FA 3V9SA 4DSJA 1RT4B 4OLBA 2FVRA 4CJUA 3PR5B 1TGOA 1NK0A 1WSJA 3KHGA 5FDLB 4E19A 2YHBA 4ECTA 1CXQA 1KCFA 3DRRB 1HQUB 1JLQB 3DRPA 4ICLB 3G6YA 1QUVA 3V4IA 1QS4A 4O44A 1RA7A 2AQ4A 1RTIA 3AO5A 2O5DA 4O3RA 1HNVA 5EWEA 3DLGB 1T94A 3SZ2A 4ED3A 3T5HA 3SI8A 1VK0A 1RBTA 4HUGA 2R8IA 3SUPA 1NOZA 5L1JA 3KIOA 3HXMA 1BL3A 4O4RA 3MXMA 3S3MA 4N41A 3KLFA 3QIOA 3OS1A 3QEVA 2OA8A 3HO1A 3E01A 3MECA 3G86A 1S1WA 4CHPA 4DQIA 4KPYA 5KFMA 4Q0BA 4E1MA 4FCYA 4URSA 3OYGA 4TN2A 3VQCA 4NLQA 3GILA 2BR0A 2VA3A 2XCPA 1C0UB 4F2SA 1BIZA 3RRHA 3I5CA 2C22A 2BANA 2OPPA 2B6AA 3H5XA 5KG3A 1O1WA 1TK8A 3TABA 4IOBA 3BQ2A 2VWJA 4J2BA 3NCIA 4Z4EA 4ZVFA 2YNGA 3OHBA 2BE2B 1NJYA 2VWKA 1IKWA 3V4IB 4JS5A 4FS1A 3LALA 4DSFA 2AGQA 2R8JA 1QQCA 3ZSVA 5JXSA 1RT5A 2AJQA 4Y3CA 2ASLA 3NE6A 4ECVA 2JEFA 1SV5A 4XIUA 2XY5A 3L2RA 1HRHA 4OL8A 1HQEB 4JV0A 3AVCA 4LQ9A 3V81A 4NCBA 2B4JA 2ZD1A 3U6FA 1LV5A 5KRSA 1RDRA 1EKEA 3KLIA 4ZVHA 3UPFA 4CK2A 1K1QA 2Z1HA 3D0PA 4K4XA 3PW4A 4I2QA 3TAQA 4KO0B 1TP7A 4DSEA 2HHTA 5HRSA 4E7HA 1NK5A 5I42B 1S1XA 2RF2A 2RDJA 3VQ9A 4BDZA 4IG3A 1Z26A 4ZTFA 1IKXB 1ZTTA 5KFTA 5D3GB 1N6QB 1NK4A 2IM2A 4RUAA 5KFCA 3OYMA 1FK9B 1EETB 2IM0A 2FBVA 4Q8EA 4TLRA 2HMIB 2P51A 3AO2A 3AVLA 5KTQA 4JRQA 3G6XA 3VQ6A 3K57A 2P5OA 2IDOA 5KFVA 3RTVA 2RDIA 1RT7A 1IKYB 3CG7A 4DFJA 4KI6A 4ECUA 3PX4A 1JLAB 2X78A 3CIZA 2C2RA 4B9NA 3QO9A 4Q0BB 4ED0A 4FJJA 1HNIA 2G8HA 3NF9A 3PJWA 4ZVGA 1BQNB 3M8QA 2C28A 4CF9A 2G8FA 2HVIA 5DLFA 3NFAA 3C6TA 1DTQB 1S49A 1S6QB 4DSLA 3IN5A 4H4MB 3TWHA 3D45A 3QNOA 1NNDA 1S6PA 3IGVA 4BE1A 4FBTA 1S1UB 4M3ZA 4IDKA 3MR2A 3M8SA 2G8WA 3RWUA 3CYMA 3ISNC 5FROA 4KHYA 3QGIA 3I0RA 3OL8A 4BDPA 3AA3A 5CZ2A 1NK6A 3LP2B 4KV8A 2CKWA 4RW9B 4NLXA 4R5PA 4M3XA 4CGIA 4DF4A 4CJRA 1C1AA 3KJVA 3ZSXA 4FJNA 3K59A 4I2PA 1B9FA 5KT5A 4KB0A 1JLGA 4QPXA 5L9XA 1T03A 1VSMA 3NGYA 3P5JA 1C1CB 3MXJA 1Y97A 5EUHA 2G8IA 1RBRA 1DLOA 1RT5B 5E41A 5DK5A 1JLEB 4JRPA 3K5MA 3QESA 4CFDA 4N76A 3LANA 3SI6A 3HPOA 5J2NA 4ZVEA 2XGPA 2YKMA 4NLWA 3OS0A 4AHTA 2X6SA 2YKNB 1TL3A 4RW7A 3Q8SB 3AO4A 3SNNA 1LW0A 5C25A 5KFYA 3THVA 3PHEA 1C0TB 3H5UA 5DQGA 4ZHRB 2R8GA 4NYNA 2JC0A 3OYEA 3WNHA 3DRRA 4HTUA 3KNAA 2RN2A 4B9MA 4CCHA 1SL0A 4R8UA 4IRKA 1UOCA 3ZSWA 3HT3A 3M8RA 2ITGA 3ALYA 3PVXA 3KLEA 3T19A 1BI4A 2DPIA 4ZMMA 5EDWA 4CJKA 3DLEA 3L2UA 3V9XA 4W5TA 4DTNA 1VSFA 2E9RX 1JL1A 3NBPA 4GC6A 4ID5A 4NYFA 4XO0A 1REVA 1RT2B 3H4DA 5F8IA 1QHTA 4TQRA 4CFAA 3T3FA 2FLNA 4R5PB 5J2MB 4ED8A 1S9EB 4CJ5A 2XWYA 3M9NB 2F8EX 3RBEA 1NK7A 4ZPAA 1IKWB 1B9DA 1FK9A 3TAGA 3VQ4A 4W5QA 4M3TA 2ATQA 3KLGB 1RA6A 5L1LA 1W9HA 4F3OA 1HPZA 4Y2CA 3NF6A 3PJXA 3VA3A 1KFSA 3ZT4A 3KTQA 4CE9A 5FRNA 1RTJB 3Q8QB 4OKJA 2XI2A 3Q8PB 2LSNA 3LP0B 4W5NA 3F9KA 2XCAA 4CF1A 1XR7A 4IBNA 1D0EA 5KFGA 3OSNA 5JS2A 5HRRA 1GOCA 4AILC 2WCXA 5HROB 3HVWA 2HNYA 5C24B 4FXDA 4RNMA 1BQMB 3QIPA 1SV5B 2KQ2A 4G1QA 1RT1B 1RDBA 2HWHA 1IM4A 3OS2A 4MFBB 4J9KA 2J6TA 3L2QA 3LAKA 3NKYA 2E6LA 5KFBA 4DTRA 5DGAA 3OYIA 4NCAA 2W8LA 4KHRA 2OPQA 4CGHA 4C8OA 3TAMA 2YNFB 3RB6A 1HQUA 4CJ3A 4E7JA 1S6PB 3AVAA 3DM2A 1X9MA 3MR3A 3SUQA 2DY4A 3HK2A 5KT2A 4CEAA 4M42A 1S1XB 1HMVA 3C6TB 5KFZA 2C2EA 3AVFA 1HYSB 4RW9A 3JSMA 2IA6A 3GYNA 3DLHA 2FLLA 2JGUA 2FLPA 2EC0A 3MECB 4DTXA 4F4WA 4DMNA 5DLGA 1BGXT 1NK8A 4MH8A 4RG8A 3DLEB 1D1UA 4F4ZA 2FVQA 4Q8FA 1WNEA 1SKSA 3SV4A 1U04A 4YMEA 2R7YA 3RB3A 3I0RB 3D5MA 2B5JA 2YNHB 2D41A 3VQDA 4WE1B 3NGZA 1YVFA 4GMJB 3OHAA 3M9MB 3AV9A 1NJWA 2WTFA 3KLGA 2ILYA 1TKTA 4ZP9A 1NKEA 5KFLA 1GX6A 1JLGB 4CF2A 4NLDA 3MF5A 4MK7A 1R0AB 1KLNA 3BGRA 3NDKA 5C42A 3CM6A 1HYVA 3QINA 2HHSA 3GIJA 1QAIA 1ITGA 5CZ1A 2E4LA 1SUQB 3OVNA 1CZ9A 5I3UA 2G8UA 4RNFA 4J9NA 3BSCA 3SQ0A 3HM9A 3CM5A 2VG6B 4CK1A 3KK2A 4LY7A 2HWIA 4RUCA 2YKNA 1KVAA 4F8RA 4B3OA 4ZPDA 1JLFA 3NH0A 1ZYQA 1K6YA 3BSOA 3H5YA 3RBDA 1VSLA 2YNHA 3DLGA 3H40A 4OPJA 1NHVA 3FQKA 5DQIA 1QTMA 1KFDA 1SH3A 4B3OB 3LPTA 4H8KA 3H59A 1REVB 4IH7A 5F8LA 1TL1A 3DRSA 3IS9A 2Y1IA 2BGGA 4Q45A 4KBIA 3NAIA 4ID5B 4CGJA 2CJQA 4JV2A 5KG1A 1SH2A 4RW6A 5HROA 4CGFA 1S4FA 5F8HA 3O3FA 4DTPA 4QCLA 5KFIA 1RT6A 4M3WA 4URQU 1RYSA 4YFUA 1LW0B 5C25B 4HUEA 1J5OB 5JUMA 1TV6A 2JEIA 4M3YA 2IMWP 3EPGA 3KK3B 1HNVB 5KFHA 2AX0A 3KLFB 1FKPA 1IO2A 3PR4A 4Z4CA 3ISND 1U48A 5KT6A 2F8TA 4FK2A 4KHSA 3DMJA 4KKOB 3RMCA 4K8XA 4CJVA 4DL7A 4DS5A 1S5JA 3O3GA 4PUOB 1MU2A 1CLQA 4EEYA 3KMQA 1GOAA 4O3SA 1DTQA 4O55A 3AVIA 2UUTA 3OL6A 4KB7A 2XI3A 2X74A 3B6OA 1S9FA 1LWEB 5J2MA 4KB1A 1C1CA 4DL2A 4NLVA 1ZBUA 3DLRA 3ULDA 3B6PA 5CYQA 4EZ6A 4AHVA 4HKQA 1C1BA 2FVPA 1C2PA 2P1JA 1XHZA 2IS3A 3TVKA 2HNYB 4JUZA 4EYHB
chains in the Genus database with same CATH superfamily
4M3RA 1HHSA 4BR7A 3AT1B 3POTB 4P73A 2UUBF 3WX8A 1P27B 3PDNA 1N0UA 4X84A 5ETSA 4YB5A 2RD5C 4ZJQA 2HHVA 3TAMB 2FF6A 3VF2A 5GAEU 4F0MA 2ZD1B 2R42A 2YHAA 1VRUB 3GMGA 2RAQA 5HP1B 4USTA 3HYFA 3W60A 3AOAA 2Z1IA 1O5JA 4DCPB 3DWLA 3MK6A 1NH8A 1KR4A 2ABYA 1WTFA 1N5VA 2ZQBA 3QRPA 1Y4ZB 2BYCA 2Q3PA 4KJIA 3PHTA 3R1HA 4ZP6A 3HKZD 2V9WA 3TARA 4X4NA 2AU0A 3CSKA 4JI0J 5KFWA 4CEEA 3WXJA 1UPPA 4OZ5A 3L3CA 2DXDA 3OTOK 1XTZA 2BJ8A 1U1RA 3CJCA 2OKQA 9RUBA 1XEZA 1NKCA 5F9NA 1UWBB 4DS4A 3HSDA 3MGJA 3I33A 1VJQA 5I4MA 4LF5K 4OJ1A 3HHLB 3MR7A 4FLXA 2CNNB 3OUYB 1CS4B 2PEHA 5B8HA 5KFAA 3M2UA 5AQSA 4Z37A 5HVHA 3CUNA 2XSJB 4NLPA 3UNGC 3CC4S 3QLHA 2Z56B 4RL1A 3NH2A 4OHYA 2NYHA 2G2YA 2LEBA 3D28A 2R3VA 3PXGa 3Q2SC 1Y5IB 2CDRB 2DR6A 5EWFA 1TUVA 4MFBA 1NRKA 4CZFA 3P45B 3AB4B 2BJ7A 3HVRA 1YJNN 3CXCM 1U1LA 4OPKA 4ECZA 2LA6A 2XWXA 4L3NA 2GX9A 4I56A 1LK5A 2Q66A 5H1SV 2I2YA 1EX8A 1A5VA 2BJ9A 1Z2LA 2PFUA 3OV7A 2Q1NA 2YNFA 2XLJA 2MXYA 4ENOA 4U7CA 2VG5A 3QAEA 3OJSA 1WEYA 4ZPTR 2DISA 1MU2B 5D6GA 4MAKA 3DJCA 4XTTA 2X3GA 3NNCA 2FVCA 3G25A 2E2QA 3HFZB 3GWCA 4ZCKA 3D66A 3UDLA 3G8QA 3C15B 4XH1A 2BZ2A 4EGLA 2EBGA 4LFBK 4QYZJ 2DR8A 3D6MB 4D3HA 2KW4A 2K1RA 2WW8A 4FZYA 5TKYA 4KI4A 2CNKB 1BU6O 5GAHP 4MO4A 3E01B 3ZT3A 4L74A 4CYUB 3D2FB 3K5NA 5BN9A 4PZVA 4DV7K 2WVDA 4K4ZA 4V19X 2VDHA 3O3HA 2LDIA 1YBUA 5RUBA 2CNOB 2HNZA 4GRSA 3ETOA 4NLUA 2O8CA 2O66A 1BISA 1RT3B 1F21A 4UTGA 2BKNA 2OO4A 3S3NA 4LSLB 1T3NA 1SKWA 2H5IB 3CXCR 3QJPA 3SK3A 4RW8A 2WK4A 4C23A 4KH4A 4WXOA 1RILA 4FLYA 1FJGF 2KZMA 1CJUB 5A76A 3GR0A 4JI4J 4DUYK 4FNHA 3PKMA 5L39A 3DRXA 3V9UA 1S97A 2CJBA 2GAGC 4P9SA 4JN4A 3GV7B 1I3OB 3HJVA 2C2NA 4TVAB 3HBTA 1NHKL 1UP1A 1XNRJ 2XZTB 2DFHA 5KFJA 2GO8A 2XM3A 4EZ9A 3GTYX 3CHWA 5KFQA 1RQ0A 2MJNA 3P5BP 3DHXA 2HIQA 4NZ0A 4HHUA 2G1DA 1VR6A 1URNA 3NGDA 4DV7J 3SLCA 4JKCA 2QKBA 4CHQA 1OH7A 1ZAWA 3G4SS 4I6MA 4FYVB 3T5JA 1HKCA 1MA9B 4CF8A 4YEAA 4CLWA 1IR1A 1K44A 2FJVA 1WUAA 4O23A 1FESA 3IP0A 1QQMA 1QVGM 4J2DA 2N4CA 2W1BA 1HR0K 2C3PA 1IBKJ 1IBMK 1GLDG 2GUIA 3BO3A 3PG9A 4LH4A 2HW3A 2EFNA 3MM5A 3OR1B 3MURP 1X3MA 5GIOA 1SL2A 5FD1A 3ILJA 3CVKA 1EARA 4KHMA 2MDAA 2RHKA 3TOQA 4FJ5A 1SC4B 3D2EB 2N3OA 4NXMF 2AGOA 3ZETA 1YBAA 5KFEA 5LSOA 1KQKA 1WC3A 4JI8K 1WHYA 3W2VB 2VL1A 4P71A 2GC8A 2VG5B 3VGLA 2CJYB 1SVDA 4DPTA 1C0UA 2BUNA 1S22A 4PEOA 3EZUA 4EBCA 3KDOA 2Z2ZA 4K59A 3VA0A 1SJ3P 4ZVOB 3HX9A 2HFOA 4ZN3A 5KFNA 2JWKA 2DNNA 4YP3A 3IAM9 3TO8A 1T95A 2B8QA 3CCEN 4X62F 3OFEA 3MEDA 3LDNA 4JI1K 1KAXA 3HPHA 3BUZB 2HS0A 4C11A 5C12A 3N5BA 4KRWA 4M5IA 1IBMJ 3HZ6A 3PRVA 3UR0A 4CJLA 1SQGA 3KG0A 4QAGA 4FPAA 3HFVA 4PG4A 1SKUB 1NWKA 3V1OA 4FLUA 4DFPA 4U67L 1JKHB 4IG3B 3UDCA 3QIPB 1I51B 3EGVA 3KJQB 3TNVA 3ZFVA 2GV9A 3LZIA 2VPZB 2XHWA 2VCPA 2RT3A 1CC7A 2U2FA 1WOPA 5MLCQ 2WONA 2I1RA 5KPZA 4IQXA 4CLYA 2VONA 1G4CA 1HI1A 5HATA 1KAZA 2F4VJ 4CLSA 2FYXA 1PJ6A 4FF2A 4FJLA 2R7XA 2PFFB 3THPA 2D0BA 2ZJRL 3W3DA 2B9XA 2MTLA 1S1UA 4BC3A 1RWXB 2CZ9A 5B08A 4USWA 2V68A 3HOTA 4BDYA 3KUHA 1N36K 4N56A 1NBWA 2WHOA 4JI2J 5H9FJ 1PKUA 3TAEA 2UU9F 4Z7YA 1WB9A 1O6XA 4JV1A 2RS8A 2AT1B 4HEA9 5F8JA 1J54A 1SQKA 3SFGA 1MSWD 1NH7A 4DL5A 5IQ6A 2MLZA 1CZAN 1KHVA 1FKAF 1NXIA 2YV0X 2GQ2A 3BDPA 3ENBA 4B3SJ 2V9KA 4K2XA 3M2VB 5DS7A 2D0PA 3ET6A 1WF2A 1VS3A 2P9UA 3KOAA 3DKDA 4KH6A 2K3IA 2CWKA 3I0SA 3NS5A 4C2MA 2HYIB 4DV0K 5KT7A 4KHWA 4NI2B 3M1VB 1T05A 2GNKA 1N4LA 4BG9A 5AXLA 4RZRA 1HHTP 1W0HA 4O8KA 3K89A 2CQDA 2OPSA 3VAKA 4X64K 2MKKA 3EVWA 5BR8J 4WU3A 2EK6A 4TY9A 4Q5VA 2Q3SA 3R2CJ 3RGIA 4E0DA 1S72S 3L2VA 1VQPN 5ADXA 4CF0A 3EZ5A 4Y2AA 4EFHA 2NLXA 3A3PB 2BOPA 5M2PA 2RRNA 3ATVA 4Z4HA 1HBNB 2HAIA 1V9OA 4IEIA 3ASMA 1C0TA 3UNYA 2IAJA 1OY8A 2YQ1A 2ZM6F 1F60B 2IVFB 5IS2A 4ED7A 2CQ4A 2W6KA 1DTTA 4WQ4C 2BJDA 1SJ1A 3CCWA 3K5PA 3NS6A 2FC8A 3ZSQA 3ID6A 2ROGA 3MDFA 2DRAA 2P9SA 4CTAA 4NLTA 2HLTA 2H1YA 3DOKA 1OYEA 2EG1A 1H72C 3O5TB 4CI0B 4BC5A 3NGIA 1UA0A 1V3SA 1VQ4S 1S77D 2B4PA 1UWAA 3FZKA 1G2EA 2MQNA 4EYIB 3FFIB 2HRTA 4J9RA 1BI4B 2HB5A 2O4GA 1YVUA 4FJMA 3EXCX 1DHMA 4ECSA 3ZNUA 4OX9F 1W25A 4B9QA 1G15A 2QWPA 3F56A 1RAIB 3OY9A 3E1YA 5IQQA 1H2VZ 1UVNA 3VTHA 3QMQA 4LBPA 4ZITA 3RBXA 4EO8A 3EYZA 4CEBA 4LVOP 4C0OC 3KMSA 4YUDA 1HBMA 3VAIA 2BQUA 4CNZA 2HHQA 5EU7A 5B0EA 4E3SA 4YOUA 1N5SA 2GMLA 4JKGA 4KKOA 2RUSA 5AQMA 4F25A 4HYKA 2W42A 4CZEA 1HR0J 2L48A 1LWCB 1VQMS 1BQMA 2DRBA 2YTCA 5D4NA 3T5KA 1NAQA 2DRDA 2R7OA 3M2VA 4FL9A 1FEEA 2WRMA 3HI9A 1EQMA 5ETRA 3O3LA 4GKJJ 3CTRA 5IT9Y 3QSIA 2V4QA 2ZZNA 4YOYA 3G6VA 5E2QA 4Q2LA 1YJNS 2O01C 3I0SB 4GKKF 2VWBA 2FBYA 4FM0A 2QWLA 4AXJA 2Z0GA 1UFKA 2GMHA 4G1QB 1HIYA 4LRAA 4K4TA 2DNLA 3AY0A 2ASMA 4FXVA 2VICA 4ELUA 3OYHA 4RKUC 2AEJA 2FJBB 4ZP8A 4I67A 4K4WA 2YNGB 4JI4K 3RSEB 2QLFB 3I96A 4GC7A 1D9DA 5F3TA 4WTOB 3PO4A 4I2PB 3TZWA 4IH5A 4ED4A 4CIFA 1SIZA 2HBQB 3FZHA 5GADP 2QWRA 3EVOA 4PQUB 1V3RA 5KG6A 4I7FA 2LDYA 4ZP7A 4FJHA 4DL4A 3G71S 1Q82O 3L95X 2Y0SD 3M2RA 4HT7A 4JI8J 4H5NA 3KHYA 2IFXA 4E98A 1GEHA 2QE5A 2ZBRA 3GPAA 3Q0AA 3MPWA 3MM6A 3PW7A 3H2VE 3BF4A 4M5HA 2KB2A 4QS9A 4BRCA 3LUYA 2XHBA 3FQLA 2CQ2A 2R9LA 3ELHA 1KTVA 2ILZA 4NYZA 4A59A 3AJ1A 2ZJPL 4FJIA 4USMA 3MR5A 2UXBJ 1B7YB 3SV3A 1U4BA 1FXXA 1RTZA 2XSJA 1U0HA 1JLBA 2LEPA 3T1YF 1WEZA 4MK9A 5BPMA 4AHSA 2WFBA 2QV6A 2VH7A 4K4UA 5I3UB 3FZLA 5K8PA 3O5BA 3ZSYA 3NMAA 3PFOA 2XRIA 4JI8F 4F04B 4OZ3A 1JX4A 1QJHA 1CJKA 5HMYA 2CPEA 4X4OA 1VSJA 2E1CA 3QT6A 3IMXA 4KHNA 2CFXA 3G82B 2KFZA 5GMDA 5K20B 4PXBA 1T3VA 4WFYA 4F3TA 3DYAB 1RDWX 3PIPQ 2OUGA 2CWXA 4LMZA 2L9NA 2F9TA 4CGDA 4DFMA 1RWOB 2OPQB 2DHSA 1JLFB 2LVWA 1WAFA 3CCJS 3I82A 1QSSA 3WXLA 1TKZB 3FBFA 2OD6A 1N6QA 4DEZA 5KT4A 5BRDA 2ZC3A 1VQ6N 2VUGA 3KLHB 2ACMA 3CD7A 3SFUA 2W40A 1Q86O 4TXSA 3T6JA 2G13A 5C24A 4ELVA 3RAXA 4WFZA 4FZZA 2Q31A 5AQFA 3H98A 3W2WB 4FW1A 3TQEA 4X4UA 4URGA 3AH6A 1VQMN 3BZCA 3CJTA 5K14A 1KQSM 1KDNA 3HRGA 1GNKA 4RU2A 2QWQA 2P9LA 3VQSA 4DV4J 1QAYA 3DXMB 4JB8B 2CPZA 2FVSA 3H7HB 4FOIA 1NDCA 4NRTA 3IRXA 1TK0A 4DR5K 1EQYA 1CQMA 1WSVA 4U67Q 5SUHA 3N79A 5D15A 1HBMB 4I7FB 3MMBB 4I6AA 4AF1A 5IT9O 4KFBB 1SH0A 1ATRA 1AA1B 3CIMA 3VTIA 3CFRA 2DFEA 1RWVB 2R2TA 2C2MB 2E1AA 4B9LA 2VBWA 2YWWA 5CYJA 2OPSB 7FDRA 4YB6A 1RTHA 1WBBA 3M3ZA 2UU9J 5AQVA 3U27A 2FGOA 1HD1A 2AYBA 4KSEB 3WBZA 1RDCA 1TYQA 3QGHA 5IV3A 4CZGA 2M88A 3W66A 1UEUA 1RAAB 3GCXP 5LMUJ 2YX1A 3OYFA 1U6BA 2P2CB 2IYIA 3SSRA 1DTTB 1E4FT 2EW9A 4BWMA 3C2PA 4AL5A 3NF7A 3FNNA 3I87A 2QT7A 4E1JA 4ZJOA 3GONA 1X4HA 2VV5A 3ZLJA 3W9IA 2N7CA 1RT4B 2E5LK 3PR5B 5GAEP 1TGOA 3HI0A 3VENA 2FY1A 2CPDA 2HK3A 3KHGA 4E19A 2M7SA 4P10A 1DJ0A 2E44A 3H45C 4U95A 2YCHA 5LT5A 1U6ZA 3M30B 3V4IA 4NXMJ 4O44A 4DR5J 3FMBA 2DEIA 4ZVSB 3AO5A 1RHRB 1FFSB 4O3RA 1HNVA 1T94A 1RHQB 3CIPA 3T5HA 1HNWJ 1FXDA 4LUBA 3CE8A 4F3MA 5AQKA 1MN9A 4HACA 1NOZA 5L1JA 3QAUA 3KIOA 3HXMA 4ISEA 1BL3A 4JBCA 4O4RA 1N8RT 3QIOA 2UV8A 4AE5A 2OA8A 3HO1A 3E01A 1S0VA 4H5VA 4DQIA 3NOCA 4KPYA 2ZDOA 1IUJA 3GILA 2XCPA 1BIZA 3C6AA 4ER8A 2BANA 3MMCA 1WG1A 5KG3A 1N34F 1W2IA 1TMJA 3J80U 4ZVFA 4USKA 4YDUA 3CJ8A 1YWXA 3MCNA 1HNZK 3V4IB 3GP9A 1KVKA 3N5FA 5A8WA 3D6FB 2HHHF 4A8FA 3MD3A 2OLWA 4A5BA 2DNHA 2WSFC 1R6VA 2MZSA 2XY5A 3QFWA 2HZCA 1EKRA 4HR2A 3ZXWA 3RUBL 2HEKA 2E88A 4OZ1A 3GL1A 4NCBA 4DR6J 3U6FA 3GJSB 1KNZA 4JI2F 5H1SQ 3UPFA 4KHPK 2ZC4A 1GMWD 2ROPA 1MROA 3LQVA 1WC5A 1XMOK 2OFHX 1NMNA 3QSYB 4I2QA 3TAQA 2DHHA 4KO0B 4DSEA 3A8YA 2IRXA 3H20A 5HRSA 1NK5A 1NCLA 2EKNA 1CVJA 4IG3A 2ACYA 4ZTFA 5KFTA 1YI2S 4B02A 1IN0A 1QVGR 4OV1A 5G0RA 5AXKA 1X0FA 1SZ2A 5KFCA 1FK9B 3I55N 3R5DA 1SJ4P 2IM0A 3FBCA 4CO5A 4TLRA 3TUJC 3W1YC 1C4CA 3C7NA 2WTUA 2IDOA 1BC6A 2GQCA 4AFFA 2M4MA 2C2KB 2H4YB 2J7KA 3J7Z5 3M1FA 1RT7A 4DR7J 4YN3B 1DQ9A 4GVBB 1RHMB 3W62A 4OHZA 2ZH4A 2B8PA 4PPDA 7AT1B 3VETA 3L4IA 4BRGA 1TELA 4DFJA 1CJTA 1UTAA 3SCKE 3PX4A 1JLAB 2GWKA 3CIZA 3LDOA 3U02A 3F0NA 3PYGA 2AMCB 2CZVC 2DY9A 3PJWA 1H38A 3HDSA 1JJ4A 2G8FA 1NZ8A 1U0HB 2EC2A 4H0PA 2F8HA 3HD2A 4WCEL 4QIWD 1FWPA 4DMZA 1DTQB 1JCGA 1S49A 1F9HA 3RRKA 4KBOA 2DT9A 5CZVA 1K8AO 1S1UB 3AA9A 1X4FA 4PG5A 3V5RA 2PBDA 3QICA 3PYFA 3E2EA 1X4GA 3ISNC 5DM7Q 4KHYA 4P2SA 1Q86T 4LF7F 2HFUA 1XQIA 3HTVA 4MDAA 3O8WA 3T41A 4DF4A 2PMZD 4ZIVA 4F02A 1JLGA 1FXLA 4QPXA 5L9XA 1T03A 4NL5A 1DAXA 2XZDB 4QU7A 3P5JA 1QQOA 1A0OB 3MN5A 2JRSA 2IDLA 1F5BA 1TFWA 2FLOA 3EO3A 4LF2A 2YI1A 4M8LA 2C3OA 4JRPA 5B0AA 5E7OB 2UUAF 2B4OA 3MX5A 3LANA 1OKJA 2IY5B 5AXNA 5AQZA 2X6SA 1FTRA 1OJ4A 3MM8A 5L8RC 1FVSA 2HVDA 3SXLA 2R8GA 3WNHA 1W7AA 4IO9Q 4CCHA 2M5YA 4R8UA 4IRKA 4JKDA 1HA1A 5KPRA 1IJFB 1UVIA 1BD6A 3M2UB 2AW0A 4B3MK 3M8RA 2NSBA 2ITGA 1AZSA 4DV7F 3R6LB 2DPIA 4B3TJ 1KONA 4CJKA 3L2UA 3V9XA 4H5TA 4KPCA 1VSFA 3E3XA 4UW2A 1JL1A 1DURA 4A62A 4GC6A 2HBKA 4NYFA 1VQKN 4XO0A 1REVA 1LXNA 1UEVA 5F8IA 4JI0F 4C1NK 1EZZB 4R5PB 2ZJQQ 4CDIA 4AL7A 2J9CA 3M9NB 2NRZA 2F8EX 5HJXA 3RBEA 3J81j 3N4PA 1FK9A 2VKZG 5AQOA 1F3VA 4JI3K 2ATQA 4DBQA 4JYAK 3C8YA 5GADU 3TVZA 1M1GA 4LR8A 3KTQA 2BACA 4UT4A 1RTJB 2KN4A 4KHPF 3Q8QB 3ENAA 3N9UC 3Q8PB 3GG4A 5M1NA 4YOVA 2J8AA 1R0BG 4OIXA 1XR7A 2NXUA 4IBNA 1D0EA 3T1HJ 1J2VA 1H73A 3I9ZA 3GBTA 4AILC 2WCXA 5HROB 3HVWA 1TL4A 3OFGA 4YS2A 2HNYA 1X0PA 2DR7A 5C24B 3MXHP 5KQ8A 5LJWA 1XBWA 3L7OA 4RNMA 1BQMB 4J37A 2FF3B 1RADB 2CPJA 5CE3A 1IM4A 4MFBB 2J6TA 1RWWB 2ZZMA 1T0TV 3NKYA 2E6LA 3OYIA 2QFJA 4FWQA 2W8LA 4OYOA 3H1QA 4C8OA 4CGHA 3SBGA 3O1WA 1V3ZA 5ETNA 2ZH9A 8RUCA 4CJ3A 4FZVA 1S6PB 3DM2A 4MDBA 1X9MA 3NG8A 1HBUA 3SUQA 4YOEA 2DY4A 4M5DB 3HK2A 1YITN 3F5TA 2NXEA 1HMVA 3C6TB 1M1HA 4CZKA 1Q7LB 4IQMA 5KFZA 3AVFA 2I7PA 4XEIA 2UUBJ 2OSRA 1HBOB 1HBNA 3DLHA 2FLPA 3SEOA 2EC0A 2W2NP 3P49B 4DTXA 2BBEA 2ZF5O 4DMNA 3FEXB 4ID8A 2A1BA 4F4ZA 2GHPA 4YMEA 2R7YA 3RB3A 1VQ6S 3J7AN 1P6TA 3H2UB 1FRHA 4DUZF 4RLEA 1CG2A 2QIFA 3MM8B 4YOWA 3KLGA 4OX8A 1TKTA 5J1PA 1WC4A 1NKEA 4BLGA 3CETA 2RH3A 3R7NB 3EL2A 2AZ3A 2D1CA 4BRDA 4OYXA 5HOOA 1IJEB 2DGXA 1RBOB 2W4CA 4L3KA 1PYSB 2V63A 3NDKA 5C42A 3Q22A 3L6QA 2HHSA 4AM7A 4K8RA 4DX5A 4RWXA 1NGGA 4A8YA 4BVOA 1SUQB 2XO6A 4O8UA 2QA2A 3P31A 3CM5A 4K7QA 1HNZJ 3D0HE 3GIRA 1BOTO 2COLA 2YKNA 4F8RA 2DVIA 3CDAA 4ZPDA 2GHWA 3LA0A 3VGUA 3BSOA 4LF9F 2MJUA 3W64A 4FPRA 3VEOA 1QTMA 1WC6A 4B3OB 3CCUS 4H8KA 5C0YA 1N34K 1REVB 1X4DA 4IH7A 5THWA 1ZPWX 3UVJA 5F8LA 1AT1B 2XLIA 3UN2A 2Y1IA 5MAOA 4ID5B 3P3DA 2PI4A 2B3TB 4JV2A 2HHHK 3WEEB 3CQYA 3EDRB 5HROA 4CGFA 1S4FA 3A5OC 4KH5A 3O3FA 4DTPA 5KFIA 3LPYA 1RYSA 4YFUA 1J5OB 3AFGA 3WIVA 2EKYA 2VPWB 4LF8K 4HHHA 3IR6B 2G2OA 4RWWA 4DHYA 3L09A 2AX0A 1I94K 2AHOB 3W2VA 2NYIA 3FMWA 4PXDA 3R3LA 4K8XA 4DL7A 2HS4A 1FE4A 4PUOB 3EZWA 1RKJA 3VEZA 1QZ5A 5BPNA 4LF7J 4O55A 3AVIA 4KB7A 4ZCIA 1QLNA 1NGIA 1S6UA 2GWJA 1UVLA 1HKBA 5K8OA 4NLVA 3IA0A 4IJNA 3C16B 1OYDA 5LOQA 5LMUK 3U9DA 4F0HA 2WBMA 1RU1A 1XHZA 2BXJA 5E3AA 2CZ4A 2BQRA 2MLXA 1Q5YA 2F8SA 4H4OA 1NOYA 1OQ6A 2GQQA 3OR2A 3BR9A 2C3YA 1CJUA 1QAJA 5AQHA 2Z2MA 1OSCA 3D3CJ 8ATCB 3MOJB 2VFTA 3G82A 3LM2A 4OQJA 5M1KA 1HQ2A 1RUSA 5KFPA 3G96A 3IAS9 4JHDA 4AD6A 4ECXA 2CQ0A 2HHUA 1U1QA 3BV8A 4BGBA 4JEPA 1ULRA 1TZ0A 4B3TF 2J6SA 3BEXA 4FZXC 3HP6A 2V2VA 1R31A 3V1RA 5GAHI 3EKSA 3HP9A 3O1BA 2E8AA 2W9AA 3KYLA 3VOVA 5HVFA 4ISFA 3OLBA 4BWJA 2BH1A 5CYQB 1QE1B 2GO9A 1FDBA 3CNQP 3KUEA 3SQOP 2E5IA 3IO1A 3NHGA 4HDGA 2RNEA 2GAHC 3HHDA 1ASUA 3FKBA 3OXGA 4N8NA 2QLXA 4BS2A 2JNJA 1KQSR 1ZBIA 4NLCA 3MFIA 3MEGA 1HI0P 1Y5NB 5BREA 3V9WA 2VFRA 5DQHA 5T7LA 2JX2A 2OPPB 2MSTA 4OV6A 2JVOA 3THXA 1VLYA 4IRCA 3KWIA 2Y9HA 3P4IA 1G1XA 5L9NA 2V50A 2QEXN 3EJMA 1C1BB 1K0VA 1WSGA 1NUEA 1ZM9A 2HQGA 5IWAJ 3R5AA 2W9BB 4K5SA 4CJEA 2IC3A 1VQLN 1CULB 3ITHB 4FK4A 4FJ7A 3UE5A 1RP5A 4FPIA 1N5YB 2WUSA 1TQLA 2YH1A 3TAFA 3ZT0A 1FKPB 3RW6A 4DZ6A 1RACB 4CECA 4KGVB 1YUWA 3K7RA 1J5OA 2XS5A 4U6PA 3NCRA 3IRWP 2KHOA 4X65J 1GLAG 3QGGA 4NZ6A 2P9IB 1WKJA 4F4XA 2MPUA 1Y5LB 4K4VA 2OTLS 4RU9A 2UVWA 2MKHA 3O4QA 4BC2A 1UMJA 3R7SB 4D3GA 2CPFA 4KE5A 2F7VA 2FJDB 1JXEA 1UVMA 3ZTRA 4IZ9A 1SQFA 2DGSA 1FXRA 1S59A 2ZKTA 4DR1J 3IS9B 4QW9A 4WQ5A 1KD1T 3PY8A 2F40A 2MQOA 4XDCA 4WZQA 2NSCA 3CF5Q 4G9ZA 1VQ5S 2KI2A 1WG4A 5J2QB 3ZO7A 4OZLA 1UFLA 2DH7A 2V51B 2AJ0A 4LFAF 2ZM6J 2DHXA 5AQQA 3CCRS 1APSA 4C8LA 2PYJA 2HNDA 3X3UA 4JI2K 2HWTA 1Q95G 2HPUA 3OYAA 1CJTB 5DG8A 1YJ9S 4MKVA 4ES1A 2DXFA 5HMZA 2BA9A 2MB0B 1FX2A 2O67A 4YDXA 4TU8A 2V34A 1NGDA 2EFQA 1H7XA 5F8NA 2UU9K 3H1VX 3QERA 4CHYA 1K1SA 3PACA 1VSDA 3IDHA 5F2RA 3D67A 1VHFA 3OTOJ 2VIHA 1R89A 2E2NA 1R7IA 4LRCA 3QMLA 5C2GA 4RNNA 4CO1A 4CQ1A 4G1IA 5K8NA 2FJEB 1C6VA 4WFAQ 1N5TA 2NR0A 4B9TA 5KG5A 3UKRB 1RDDA 1MW7A 2DO4A 4DHVA 4DZDA 5HRNA 3DYAA 2YWKA 2QK9A 3G2XA 5C2CA 2F4VF 2AYEA 1RTHB 1R59O 1VQOS 2EHGA 2Y1JA 4ICLA 4Q2MA 2RKIB 2FZGB 2RU9A 4BRMA 1LEOA 1MG7A 4WZMA 5KT3A 4B9UA 1F9FA 2HHWA 3R5CA 4PL8A 1ZBSA 1IWAA 4A5AA 1G6BA 2P8IA 3TP2A 1JIHA 2X3DA 3CCQN 1QHAA 5EGYA 4I9LA 2EX3A 4NMLA 1R8BA 4P7VA 2YQ3A 4Z0UA 2N7YA 1XMQF 1C0FA 2A2CA 5KG7A 3GV5B 3N6LA 3HZGA 2XMUA 3Q86A 4RWTA 1EETA 3AARA 3EEQA 5KG2A 3WQPA 4LT6A 3IG1B 3RMBA 4J9SA 1PC4A 1Z2ZA 4HVJA 1N32J 4DR1K 1TVRB 2PT0A 2V67A 2D0AA 2UUAK 5KGXA 2XLKA 3GIKA 2VASA 4MLHA 3PM9A 1S3XA 4OO1J 1FX4A 3G6ES 3MOZA 3AODA 2FHKA 4J5OA 2OPRB 2MZRA 4ED1A 3K8VA 3DOKB 4K0KK 3AVJA 1RTJA 1SKRA 1FF2A 3HVTB 5AQTA 3R9PA 4OJ3A 3I4PA 2MQPA 1W97L 5DMRA 3IRXB 3G87A 4NLSA 2M8DB 3C94A 3GE1A 1XMQJ 2IPOB 3M6WA 3GR1A 3VGKA 2CUYA 4DR5F 1ZM2A 2J0WA 4FF4A 4RPFA 2FBTA 1R6YA 2BE9B 2MQQA 3MM9A 2J7WA 4BR4A 4PKHA 3CO0P 4K4SA 4AH9A 4EBEA 1MWKA 2LLZA 1VC6A 2VQEJ 4ED2A 1Q8LA 1RWMB 5ADXH 1RT4A 1LFWA 2CQGA 2NXJA 4DU1A 2ZJPQ 3ZEUB 2VQFK 2IIRA 1PIEA 1RZMA 4DL3A 5DGBA 1VJWA 4TSXA 3QFUA 3GLJA 2D69A 3MPUB 4F4KA 2V69A 3DLLL 1T9VA 1EHWA 2D0CA 2CVEA 4HUFA 2VF3A 1FW6A 3TEHB 1NHUA 3UD5A 1RK8A 4I68A 4K4YA 1RAFB 4H4KC 2FXUA 4FYYB 1WLJA 4DV6K 1YRUA 2OP5A 4U8YA 1MMNA 3MCPA 3L7PA 5HQMA 5BYSA 5MLCV 1NNEA 1LWEA 1Y0HA 2W9CA 1B99A 3AOBA 3HZEA 4J9OA 1FJGJ 3T6BA 4C8YA 4W5OA 3VGTA 4X62J 4BACA 3QGPA 1S0OA 2Z8QA 3CJQA 2XY6A 3VAMA 1S48A 4CLPA 3G8TA 4WQ5C 1RLCL 3MEEA 2O8FB 3UQSA 2MSSA 3H3OB 3KHRA 3T1HF 4F50A 1PC5A 3LP1A 2KT2A 3I31A 1HWUA 1ZETA 3NVMA 3NP5A 4DR1F 4CEQA 1YXQA 3MHYA 2G1HA 3UWTA 2W7OA 3OSPA 4QBUA 4RTFD 4DWIA 1PBAA 3MM7B 4DQPA 3M8QB 5M1QA 1T9UA 3MAQA 2AYGA 1X3NA 3OHRA 3O8MA 3KLIB 2HSEB 4LBHA 1S7HA 3BGRB 1FDAA 2HHXA 2A18A 2R7SA 2Z1GA 4CM0A 4ZLPA 5T7BA 2K8GA 1GFWB 3OYLA 4RW4B 2GBZA 1TAQA 4DV2J 4BRQA 5KFRA 4MIBA 3OVBA 1TL5A 2PO4A 3JSRA 3V6JA 4B9SA 1S1VA 4F67A 1JL2A 3Q83A 3CFOA 1T05B 2G0JA 3D1QA 2F4FA 4YR3A 3IFRA 1U45A 4FM2A 4CIOA 4KO0A 1FRKA 4CJPA 1ZOTA 3CCES 3W9HA 4NLBA 2MZTA 4DX8H 3KJFB 3ENHA 3KK7A 1YG0A 1T9TA 3BGLA 1JKHA 2YH0A 4USJC 2HBMA 2HLUA 2XGQA 2UUWA 3K2PA 3CJ7A 4DV2F 4DTSA 4OGEA 4BRLA 4KV8B 2R7WA 3SQ1A 1T8EA 4YR2A 1U1NA 1QVFM 4DSIA 3TZZA 3TSUA 3JYTB 2OSQA 4I6YA 2A3JA 2BABA 2OANA 3FE1A 2R7RA 6AT1B 1XIQA 4ID1A 1HFEL 1Q81T 5ETQA 1RDAA 5BR8K 2AJ2A 3W9JA 2ZNZA 1JLQA 4QOZB 1RB0A 2OH2A 2JOQA 5IM0A 1RYRA 3I56N 2PA8D 1TMMA 3MMCB 3L3VA 5EWGA 3BQ0A 4JAXA 5FPDA 4OHWA 3R3TA 4CEZA 3VQEA 3GFZA 1B92A 4TYAA 4DUTA 2WSCC 3W7BA 3KKFA 3VMFB 3FDSA 2LA4A 4AQYJ 3FR0A 3AGKA 1YLXA 1HPZB 3JQJA 5BXIA 4IFYB 1AFJA 2G8KA 1ZTWA 1QAXA 2QGFB 1TVRA 3TPQA 1LW2A 4M5JA 3A8IA 5E3QA 2PZSA 1WAJA 4H0OA 2B0GA 1Z6RA 1GLFO 1QSYA 4KH1B 1K8KB 2VD3A 1IKVA 1DLOB 1EXQA 4WXWA 3CC2S 1X9WA 4DL0C 1SC3B 2DNKA 2H3GX 3IM8A 5H9FK 4DV1K 2I9SA 5JS1A 5HO4A 2CG8A 1ZBHA 2LKZA 2AD9A 2FSNA 1SPBP 3HHEA 1NMDA 2XO7A 2IIHA 3TA2A 3LOUA 2W4DA 1KS2A 1SXLA 1O8BA 2J0XA 1RKIA 4WWSA 2F4VK 2C2OB 2E7VA 2D3OR 1BCMA 4NA2A 5AE1A 5IT9U 3AJDA 3BPSP 3DI6A 1VHXA 2QX0A 2BTFA 4MO5A 3SPYA 1PYOB 1T3OA 1VBZA 2F65A 4YQWA 2JWLA 2RE2A 4MKYA 1SJFA 2A1RA 2R4FA 1HPMA 3ZSZA 5ETPA 3EDQB 1NM1A 4DQQA 2ZWHA 2QC3A 4WE1A 2H5JB 2JVRA 1H98A 1WJ9A 3BZKA 2R7TA 5FPMA 3IWXA 1Y00A 4KTZA 1FNXH 2B7BB 4DPXA 4WFAL 2NPIA 1S1WB 3EX7B 4IKAA 4QQBA 2K2PA 3CCLS 1S0MA 2GVDB 1F6TA 3MM5B 4B9VA 4NASA 2KTQA 5A2QY 4B1UB 3AAWB 3FBBA 4MT1A 2XB2D 1JB0C 3R5JB 3HKWA 4IJAA 2A6AA 4ED6A 1X4CA 2ZM6K 2KHDA 3SAGA 2VG7A 4Y6IA 1HNWK 3MFHA 3CCRN 4WFNQ 2KJVA 4CJSA 4J8FA 3FCVA 1N33K 4YY3F 1YJ9N 3CCSS 2VQEF 2ZOMA 1DQ8A 2DCLA 2GIRA 3THTA 1V4TA 2Z57B 5JMVA 4C8NA 4B3RF 2XG8A 3QEIA 4ITSA 1R8CA 1WUUA 2IC3B 1S6QA 1VSIA 1F0XA 4LR7A 3PX6A 3R97A 1HNZF 4M95A 2KH9A 3TWZA 4CP5A 3UFCX 4CBWA 3UDEA 4ZPCA 1U2CA 3S7RA 3TI0A 3CULA 3GFXA 3I6PA 1Y3KA 4DV2K 2E1MC 3HHKA 3MMBA 3CCMN 4FLWA 2Z2YB 4EHUA 3RRGA 4IOAQ 1F9EB 2YWGA 2B51A 4QR0A 5KI6A 3HPGA 2FJXA 1SJRA 3C14B 2HF3A 5EOYA 5F8GA 2GEMA 2NQPA 1UL3A 5D8HB 4B3RJ 3HM8A 1Y11A 3M5RA 2XNQA 3TJ9A 5BRFA 4OZ0A 2MHNA 3FZFA 1K73O 3OFFA 4CT9A 3OBWA 1NPPA 4O0IA 3CCQS 1I94J 3K9KA 4MIAA 2V5HG 3W0LA 1RWPB 3WT0A 2KG0A 1Q5VA 4ZPBA 1KOHA 3I55S 2LQ9A 2RIJA 3RAMA 2A10A 2OZSA 4LD0A 3RB0A 3KLHA 2CNLB 4E7LA 3Q24A 1VQ9S 4TLQA 3NEKA 1HKAA 2V7YA 3QNNA 2V4JA 2N82B 5EHHA 3OTOF 2RHSB 2OFGX 2D5RA 3NH1A 3ZTSA 1Q8BA 4W98A 2IDEA 2R2UA 1GX5A 2UP1A 4Y34A 1FKOA 3CCVN 3A8EA 3PV8A 4DLEA 4IG0B 3EKUA 4CLLA 2V8GA 1WC1A 4FWRA 2WBNA 4JI4F 1DT9A 5FLXY 4RW4A 3UDVA 2HVHA 4QU6A 2B4UA 5JLFA 1RT1A 3A1YG 2E66A 2JSXA 4YHHF 3MCSA 3B8AX 4Y0FA 5AQPA 3MMJA 2L08A 2VQFJ 5LSRA 2P9CA 2OAUA 2NUHA 3W8PA 5FDLB 2YHBA 4ECTA 3DRRB 2G2ZA 1JLQB 4MMOA 1OO0B 3G6YA 4YY3K 4LIWA 1M5OC 4USUA 3TJ8A 3ONQA 1IBMF 1FERA 4CH7A 3SZ2A 3TSQA 1FWLA 3SI8A 1VK0A 4NMXA 4WCEQ 1OSDA 4HUGA 2R8IA 2WVBA 4QYZK 3MMAB 1YRXA 3S3MA 4N41A 1KOOA 4CLZA 2DGWA 3QEVA 4DR4K 3NMUA 1U1PA 1GLEG 2FIUA 2Q6CA 4UUXA 3ZTPA 2E5HA 5KFMA 2YKOA 4MIWA 1U2FA 3W5XA 4FCYA 3DDIA 4TN2A 3VQCA 4NLQA 4CLTA 4WJBA 3AAQA 2BR0A 1W26A 3ATUA 4F2SA 1C0UB 1B0VA 3DRYA 4DPUA 4CZCA 3RRHA 1YIJN 5D0GA 1GH8A 3JTPA 4F9OA 4CM2A 3O9SA 2DY1A 3MM9B 4J2BA 1VLOA 3C15A 2YNGA 2BE2B 1HR0F 1ILYA 4IFEA 3LALA 2R8JA 2AJQA 2UUAJ 2VBXA 4ED5A 4ZLLA 1K8AT 1T9XA 3NE6A 2JEFA 3L2RA 8AT1B 5BPLA 2XSFA 4ATNA 3VALA 4LQ9A 3LF0A 2ZHBA 1RDRA 3SQGA 2RJZA 3FFKB 1EKEA 2KJWA 4CK2A 2QYCA 4M63A 2MQMA 1IBKF 4ILLA 3U4LA 2CPHA 2Z1HA 2X1AA 3PW4A 1VK3A 1TP7A 4I6WA 1G99A 2NPFA 2SXLA 5I42B 3MWBA 1ACMB 5A8KA 3CJBA 2MHEA 1KC8T 2RF2A 2BV3A 3PSIA 2HZAA 1N6QB 3RZAA 1NK4A 2IM2A 1R8PA 3PIOL 2DNRA 2QFIA 3Q8YA 2X7IA 3BN7A 4QZVB 4WK3A 1NM2A 4ZLNA 1KBRA 5HJYA 1VQSA 3AO2A 3AVLA 3ZTQA 3G6XA 3MPYA 2P5OA 5KFVA 4Y2IA 1LXJA 2PMWA 2C1EB 4N8OA 1YJWS 3BF1A 1XNRF 3O9RA 1IKYB 1FEHA 2P9UB 2W2QP 4KI6A 5T7LB 2C2RA 4B9NA 4GKKJ 3LW5C 5B0GA 4ED0A 1BDGA 4FJJA 2HG4A 3QDKA 4CF9A 2HVIA 2LMIA 2GVZB 2OMLA 3R5GA 2XYGB 3K2YA 3C6TA 3DOMA 2VPXB 3BKTA 1I1GA 3GU0A 1S6QB 3IN5A 1NU0A 3VAGA 4KGZB 4HACB 1SC1B 3D45A 1X4BA 1NNDA 1TL7A 4CD3A 1P90A 4M3ZA 2ZGYA 4DUYJ 4H0YB 1P9YA 1LNQA 4YHHJ 2HQFA 2G8WA 5DM6Q 3RWUA 1RHJB 1HUXA 3VF6A 1ESVA 4USHA 5GMKa 3OL8A 4X4SA 2LECA 4BDPA 1CJVA 3BR8A 2QL9B 4KV8A 2CKWA 1CS4A 3A12A 4NLXA 4R5PA 1DBDA 4LIRA 4CGIA 1NEEA 4CJRA 1PAUB 3K59A 4OMFG 4WFNL 3K8WA 3G8SA 1VQ5N 4JD2A 2I6WA 4KB0A 3OW2M 1YQHA 1VSMA 4AT1B 1Y97A 3CMES 3LGNA 1WDTA 1OVQA 1NSPA 2BUPA 4BR5A 3A3NB 5E41A 2DGTA 3WHIA 4N76A 3NGUA 2PGCA 4AHTA 2YKNB 4W4MA 1XMBA 1LW0A 3PRDA 3IBFB 3PHEA 4QJVA 1C0TB 1DGKN 4DV4K 5DQGA 4NYNA 1U8SA 5AQNA 3R9LA 4OLOA 5CZXA 1GTHA 2HF4A 1SL0A 1Q53A 2UV8G 3HT3A 5AZJA 3T19A 2BOAA 5K8MA 2GJ2A 3Q7CA 4BGAA 4DTNA 2R7QA 2ZGZA 3P8BB 3HD1A 3MN9A 1VQNN 3W63A 4NOHA 4X4QA 4I1TA 1QHTA 3T3FA 4CFAA 5J2MB 4ED8A 4CJ5A 1QZ6A 3EGNA 1NK7A 3AAPA 1X5TA 4M3TA 4DU7A 2YWEA 1RA6A 4F3OA 3NF6A 3PJXA 2W6LA 1KFSA 3G71N 1GK8A 1U02A 2RSQA 3BF3A 3MWTA 3DLLQ 4W5NA 3LP0B 2PEBA 3F9KA 2KT5A 3HSJA 5KAKA 1RBAA 5KFGA 2L9DA 5G4DA 3CJKA 5LMNJ 2RDDA 3AGRA 2KLAA 3QIPA 4FVUA 2KQ2A 1RT1B 2HWHA 3OS2A 4OLPA 3L2QA 4AQYK 1FNMA 3D9BA 1J6ZA 3LAKA 5LMUF 4DTRA 4KHRA 4R25A 3TAMA 5J1NA 5DDPC 1HQUA 3T1YJ 2JDJA 2LQJA 2E2PA 1YSJA 4LF5F 3DXKA 4CEAA 3W2WA 3TTCA 1A7GE 2LU1A 4FWKA 2IA6A 2JGUA 3MECB 2PAVA 3MPVA 1NK8A 2Q2RA 1QD1A 2ERRA 3DLEB 1D1UA 2FVQA 2CVIA 4Q8FA 4BRKA 1NGJA 1SKSA 3JAMO 3SV4A 1E6VA 1Y3JA 1XMQK 2VKRA 1BLUA 2NXNA 3D5MA 5E26A 1M5PC 3TZYA 2D41A 2FDNA 3NGZA 3M9MB 2IVMA 4JKAA 2QG9B 1KKHA 2ZVIA 2DNZA 2WTFA 3IUCA 2MMYA 3L4QA 4ZP9A 4JKGB 1N88A 5IT4A 1QVFR 1GX6A 2D3O1 4U8VA 4JK9A 1KVIA 4CF2A 4NLDA 2O3DA 4A8QA 3TTDA 2J5AA 2QSFA 3D4JA 2NREA 1KLNA 2A3ZA 5BR9A 4PWUA 2N3LA 3UB5A 2GCFA 3CM6A 1HYVA 1F2HA 1VC0A 2XMKA 1X60A 4HT5A 3NWGA 4WP8A 1QAIA 1ITGA 3VGMA 2HFVA 2G8UA 2KXHA 2XMWA 4RNFA 3Q8VA 3ZZUA 2VG6B 1A9NB 1FRIA 4Z94A 5FIIA 3HSZA 1VDHA 4LY7A 1WELA 1RI7A 4IXCA 2DKOB 1VBXA 2GA7A 2PA3A 3NLCA 2YBVA 3MCOA 4NYOA 3WX4A 2AJ4A 1ZYQA 4P75A 4CZMA 3UD4P 2MY7A 3RBDA 3W3SA 1TUGB 4BRPA 4DV4F 1FO1A 3A13A 3H40A 4UY85 4KH0B 3IWNC 5GAGI 2EPIA 1VQNS 1FA0A 3H59A 3GFYA 1TL1A 3DRSA 4HI1A 2ZNYA 3TVYA 2VFVA 4Q45A 3NAIA 4CGJA 2XMMA 4C3LA 2K7KA 3HHLA 2X1FA 2WVCA 2F9JA 5KOXA 2K1RB 4FOEA 2GVDA 1RT6A 3UVJB 3K0SA 4URQU 3EE3A 5GAGP 3JAMU 3EXYA 2IMWP 3KK3B 2QN6B 2HVZA 5KFHA 3S6EA 3PR4A 4OI4A 4Z4CA 2HQCA 5CAAA 1U48A 1RCOB 2G0IA 2F8TA 4S0MA 1VQPS 3RMCA 4CJVA 4ETZA 3A5NC 3O3GA 1ZC6A 1CLQA 4EEYA 3VERA 4DR3K 2KL8A 2OTJS 3A8JA 4Y65A 2UUTA 2PC6A 4TU9A 4DV6F 2XI3A 2L3MA 3B6OA 1LWEB 1ZBTA 5J2MA 4KB1A 4UOHA 4UQTA 3DLRA 3B6PA 4EZ6A 4AHVA 3ENVA 2AF6A 2O8DB 2WC9A 2D3UA 2HNYB 4JUZA 3NH0A 1H6KX 3JSMB 2J9DA 4NE9C 4ISGA 2P9NB 5LL6d 4AHUA 1JXLA 5E33A 4FK0A 3CJ5A 2WOMB 4PY5A 4JI3F 3LP1B 1QTNB 4TYBA 3VWSA 3OYCA 4LH5A 2KDOA 4CJFA 2XTJP 4CWBA 3UCUP 4O3QA 1YT3A 2Y1LB 2ZUGA 3MZIA 1BY9A 1UAXA 4I9QA 3MEKA 5E3CA 2DXEA 1VRUA 4DR7F 1JLAA 3R1LA 1BUXA 1RWKB 4BRHA 3W61A 3TUZC 2FZCB 4FLZA 1F5CA 2P9GA 1LWFA 1VRTB 1R0AA 2ASDA 4KRFA 2HQDA 1WN7A 1IR2A 2CJXB 1WC0A 3DC2A 4K5RA 4ELTA 2O8DA 3CJSA 2AEFA 1VQON 1L3UA 4PG8A 3AVNA 1EX4A 1M1KO 3LDSA 2RQCA 4X66F 1N48A 5HL7L 3LAMA 1HLUA 4FS2A 4G65A 4KR0B 4EWTA 1C0MA 2UYTA 4O0JA 3ZSOA 2MKJA 4BBYA 2RQ4A 1XUPO 4FYDA 1TKTB 1FHTA 1ZBLA 2A6OA 2GV1A 1KD1O 1B70B 1WSHA 3V6KA 2A41A 5AQUA 4CFCA 4LF7K 1QSLA 1RBUA 3L3UA 4U96A 2DCUB 3JTOA 2BE2A 4OI0A 2BANB 2R2RA 5J2PA 5I42A 2VFUA 2HBJA 4WYWA 4GKJF 1CXUA 4HH1A 2UVVA 4OKEA 3CD0A 4AHRA 4NA3A 1HX1A 5E3RA 1SL1A 4BE0A 4JI5F 1BE4A 3CC2N 1UETA 4B08A 2EG2A 5HAOA 3JTNA 4CZJA 4JP8A 4OGCA 2CXEA 4C8MA 4CERA 2ETJA 4QS8A 1TL1B 3DRSB 2DR9A 4AL6A 1VQ8S 4HCCA 1TL3B 4RW7B 4B3RK 4KGXB 1HI8A 5EX0A 3P38A 5IZHA 1MMLA 1M5SA 1AB8A 3V6HA 4NEYA 1BG3A 1X8DA 4OYIA 2V2KA 4MYTA 1HW9A 4LF5J 3MTKA 4A8XA 2CJ9A 1K9MO 3TU5A 4HHTA 3Q23A 4KAIA 1ICEB 1U1OA 3DHWC 4JI7F 1EJ7L 2XYHB 1GXUA 4RO0A 4PHTX 3W65A 4USVA 2QXLA 3C6UA 3VQBA 2P9EA 3M8PB 1RCHA 1K0TA 4WK1A 3GE9A 4LREA 1VISA 2A0FB 4PQAA 2KZZA 3BSAA 1RNHA 3ENWA 2FHJD 2O8EA 1RJJA 4O3NA 5F9LA 1WNSA 3FRZA 3ZT1A 3BJYA 3DOLB 3EICA 3AD8C 4MYUA 3CCLN 3CJ2A 2HNZB 3FGVA 4OI2A 4CEFA 4FLVA 1R43A 3OJUA 3RR7A 4DTMA 1S9GB 1X5PA 3DOMB 2MKIA 5KOWA 3MCAB 1Z1ZA 5G0RB 2JC1A 2IOCA 2BKPA 1T03B 2YNIA 1XR5A 3U3GA 2BJ3A 2XNRA 2VODA 1VQ7S 3OR2B 4B3SF 1FI4A 1I39A 3SDEA 3ULEB 3EMTA 2LXFA 4CJTA 4CJWA 3K5LA 1ATNA 3BS9A 1PSDA 2QA1A 3A5LC 2E7XA 4C98A 2R7UA 2AGPA 5ETKA 4OX7A 5SZTA 4J2EA 4LSNA 5BYRA 4HWIA 2X1GA 3CDWA 4CH1A 4IG0A 4ZPVR 2QO3A 2OYQA 1NKBA 2XS7A 1UCNA 1CSJA 1RBSA 3QNWB 2UUCJ 5A8WB 1F5AA 3SQ4A 2P9NA 2L41A 2JEGA 3SJHA 2YX7A 2IBKA 2H9ZA 5AQYA 1NDLA 3ZX0A 3IFEA 1XNQF 3PTWA 2W24A 5EX3A 4DU3A 3BGOP 4PWDB 3M05A 3KK1A 1JCFA 2ZOFA 3R8EA 3O6QA 3VF0B 3AVMA 1YBTA 3SDEB 1NO8A 3WEEA 2PSZA 2PY5A 4QWEA 2FQQB 3R5BA 1X7VA 4YB7A 2VA2A 2GTDA 4DKWA 4NEZA 1HWKA 1EP4A 2IVPA 5IC6B 2GFFA 3EGWB 3CPWR 3THYA 3CDEA 4LF6F 5J1EB 3QEWA 2QEXS 2R2SA 3L0QA 4CJQA 4FJXA 5HLFB 3DGPB 3Q8RB 2GMJA 2I8EA 5D0RA 4FP9A 5HMXA 1VQLS 2IGIA 1WOSA 4EHTA 3BZQA 2V7ZA 3ZYYX 1NJZA 1VQ8N 2YHWA 4O3PA 1JLCB 5CH7B 5EXWA 3NAHA 3CCVS 4KHUA 4I0WA 3K0JA 3D2FA 2R7VA 3T9NA 1G7CB 1SIWB 1RHUB 1ASWA 3EM1A 3VZHA 3EE8A 1N52B 1AXQA 1N5YA 1PCAA 3NF8A 4BE2A 5AQJA 2M2BA 5K14B 3GV8B 3OTEA 5CYMB 4TNOA 1JQGA 2DBBA 4DSKA 4LSZB 3ZZRA 4LSLA 1JWWA 4NWBA 4DQ8A 3AVGA 3MAAA 4BRNA 2B6AB 1RTIB 2HQIA 2ZWOA 3JXOA 2J0QD 2VG7B 2UVUA 2KM8B 4OX9K 3KWMA 4B1VA 3RB4A 4CJ4A 1EWQA 2ASJA 2D3ZA 5CQGA 6FDRA 1HNXF 4NXMK 1T6CA 3QB0A 5ETOA 3HT0A 3QFPA 3RW7A 3OXLA 5AT1B 3AB2B 3CI5A 4GV9A 4GVMA 3QYYA 4E7KA 1HQEA 5DM6L 5AJ3F 1OY6A 5TKWA 4JV5F 4LSNB 3CCTA 1GT8A 4M5DA 5E0OA 2XS2A 4RW8B 2GELA 3DOLA 1VQ7N 1GLBG 2Y3YA 3CJ1A 3IWLA 3IR5B 4TKTA 4EO6A 3WXIA 2IJNA 3DRPB 5HP1A 1BIUA 2P9KB 4DTOA 3D6TB 2IVYA 1A5XA 3AVHA 3PO5A 1NGCA 4LRDA 3KK1B 2HFSA 4LR9A 4UZBA 4DF8A 4LF4F 4BREA 4R8UB 3TQ1A 4K0KJ 3LP0A 1J53A 1GOBA 2VGMA 3BBCA 1KHWA 5B0CA 2AJFE 3QETA 1QUPA 4O3OA 3V81B 1LKZA 3VZIA 4E89A 4R0EA 3K58A 1RTDB 4M41A 1IM6A 4CO0A 4ECYA 2ZE2B 3NL0A 1KAYA 4X2BA 2MGZB 3KWGA 3EWGA 3DNCA 1S79A 3BBFA 1DEJA 1VAZA 4O5FA 4P2MA 2CQCA 3WNFA 3T1YK 4FLTA 3ILOA 2Q0RA 3M2RB 1OS5A 2FY8A 2NUBA 2KO1A 1KXPA 1XWLA 1IBLJ 1XR6A 2OEMA 3KK2B 3IM9A 1D8ZA 4ANEA 3JXUA 1FRXA 3U3YA 5FRMA 1I6JA 4ES2A 4MKAA 4CHOA 4JI6F 2IM1A 2IJFA 2W7PA 2KKZA 4A46A 2HFNA 3OFHA 4F2RA 3UKUA 2V8DA 4L73A 1VRTA 1KRPA 3PUFA 3MR6A 4NLGA 4L8RB 3DLKA 5DG7A 3L8BA 2BW7A 1NGBA 4OYZA 5KFUA 5E5NA 3OL9A 2P6SA 1RWUA 4W92B 3QBXA 1IBLK 4ZA1A 1WSRA 3MAAB 1X4EA 5CYMA 2JEJA 2QLJB 1NLKL 3FZ2A 5L1KA 3BYRA 2NRVA 1M1KT 3IR7B 4P2XA 1A6LA 2A1SA 4BQLA 4KT0C 3QLHB 4NLYA 3U9ZA 1S10A 4XPEA 2GIQA 5DETA 4ES3A 3P83D 1NJXA 4E7IA 1IQZA 3QIDA 3LWMA 4CK3A 4CEOA 1LK7A 3BB5A 1WOQA 4PPZA 2V52B 2YKAA 5L1IA 2ITMA 5I9EB 3R27A 3UR3C 4QW8A 3V9ZA 2ZEJA 3OLAA 2ZJRQ 2A5XA 3GIMA 5M2UA 2NUUG 4A8SA 3TAPA 4BR9A 4I2QB 4DR6F 1AZSB 1X9SA 1BO5O 3SUOA 1S4EA 1TUYA 3VPZA 4ZCMA 2E29A 3NMRA 4ILHA 3I5BA 4DG1B 1SQEA 4OYBA 4AHCA 5I3PA 4R79A 4RJVA 4IFYA 3CCMS 1URRA 4OYWA 3RR8A 1GAOA 3BGFA 5KFXA 2K7JA 5HMWA 4C48A 2YQ0A 2YXLA 1C4AA 1H2UX 1U0SA 3POTA 1WSEA 4YNQA 2XMVA 4KTQA 3H6EA 2LU2A 2CQIA 2QJ3A 2F1FA 2CJAA 3VGVA 3SAFA 2GJFA 2I0XA 4G1PA 4RX6A 2RILA 5C42B 3BGUA 1B0TA 3TANA 2U1AA 2AZ1A 1U7LA 2RUGA 3OYJA 3QRQA 1NJIO 4C4WA 4HCBA 1ZBFA 2YVSA 3LP2A 3CJ3A 2FJWA 2PYLA 1TTHB 4LFBJ 2ZH7A 3DDKA 4M5LA 3VQPA 1TKXA 3O9QA 5HBMA 1MWQA 1WSIA 3AO1A 4P74A 1U49A 1HNXK 2MQ8A 4XK8C 2DNPA 1S1VB 4DOZA 5H9EJ 3OYDA 4GO5X 4DTUA 2YWHA 3D7EO 5LXRA 3FC9A 5ITHA 3SQ2A 3HJFA 3A5MC 3D1OA 5JICA 3CD5A 4RW6B 4X64F 4JV5K 3QT8A 5D4PA 2IHR1 2PMHA 2ZHOA 4ZTJA 1WI8A 2ATLA 4PAAA 2BE7D 1WHWA 1WOOA 4DUZJ 2F9DA 5BJRA 3W5YA 3T1AA 1UAWA 5GADI 5J2QA 2KG1A 1FD2A 1HL6A 4DFKA 2Y8WA 1UFWA 4WFBL 4DXLA 4ZVTB 1YZ7A 2QXFA 4U7BA 1I3AA 3CPEA 3PW0A 2QLBB 3H2LA 3UI3A 2EWHA 3J7A1 4WP9A 3PX0A 1RBLA 5L46A 1RLDA 1E6YB 4BC9A 1N8RO 3B6BA 3CQXA 5JVGL 4DU4A 1UJ6A 3MN6A 1TKXB 4KGKA 3SMZA 1O13A 1JMTA 1YF5L 2B5JB 4NXNF 3PSFA 2P5VA 2Y8YA 4DDFA 3J7AP 3G10A 5IT0A 2Z1JA 3M8PA 1K73T 2DPNA 3FEZA 2XY7A 4EP5A 4F4YA 3JSYA 3AVKA 4M94A 1S99A 1YZ6A 4QOTA 3ENOA 1OMSA 1RBVA 2LFVA 4YR0A 1LOUA 1G3OA 5FJ4A 3J7YI 4I69A 3S01A 5D0EA 4IO9L 1YITS 5C5JA 4HTJA 1PGZA 3CFPA 4NCGB 3TA0A 3ZSRA 4GMKA 4IOAL 4DG1A 3JQMA 3AQPA 2Q0UA 4MKBA 4CBUA 5KRTA 4QR2A 3QZ8A 2AWZA 4IRDA 3VN5A 1B64A 3ILIA 2E9TA 3NS7B 4IR1A 3KLVA 2E6MA 2P9LB 4B8CA 2ALZA 2AIRB 3BN4A 2V4RA 5A8RA 2HZVA 3RAQA 4NPOA 2V4JB 3O08A 4IH6A 1HWLA 3J7YU 2OELA 2ASPA 3OUYA 3TW0A 1XERA 4UUWA 2LQBA 2R8HA 3C19A 1S9GA 2GZOA 3M6GA 1PO6A 3M7VA 5HN0A 3HSCA 3IG1A 1Q8KA 4PUOA 4JI1F 4C11B 5DM7L 3PRBA 2WSEC 4DLGA 3TR8A 5D3GA 1LWCA 1BXNA 4JLHA 4LQ3A 4ZHRA 3OYKA 5JLHA 4N77A 5E84A 2AP1A 3HHNB 4PKGA 5E3PA 1X5SA 4DV3F 3M1VA 2HBLA 3FLCO 2DFFA 1YI2N 3LZJA 4GV6A 4PKDB 2B43A 5CXTA 1TKDA 1L3TA 3B8HA 4KAZA 3K5OA 3SPZA 3LP3A 1FRJA 1RWNB 3NWRA 4DV0J 3SYZA 4FVMA 5CA5A 3LDPA 1RT7B 4YDUC 4DPOA 3VQ7A 4K43A 3OTBA 3QT7A 4RNOA 4X65K 4X62K 1LAVA 2X6NA 1PJ5A 1PG5B 1TUUA 3T7ZA 1IV0A 3WUHA 3GYGA 4B3SK 2AA4A 3G6EN 3HCXA 2Z4PA 4IKFA 3M6VA 3GG0A 1IKXA 3DCAA 4CHZA 1U8WA 2DNOA 4H54A 4UOFA 4L72B 1EB0A 2DIUA 4BR0A 1DRZA 4O44B 4KREA 2P5GA 1TL7B 1M90O 4ZVUB 4FXWA 3C95A 2BDPA 3D68A 4DV3J 2FC9A 2W4PA 2BRKA 4G3IA 3V9SA 2FVRA 4CJUA 5GMEA 4LF6K 5LJ5Y 3O2IA 5HL7Q 1AFIA 4IOXA 2EK1A 1CXQA 3D54A 3SSSA 1HQUB 3Q8UA 3F44A 3DRPA 2KT3A 1Q81O 4ICLB 2J0SD 2E20A 5IV4A 1WHVA 2E5LF 1U1MA 1WF1A 2AV5A 2GIFA 2DJWA 4ALZA 2AQ4A 1RTIA 2A2DA 5LXYA 3DLGB 1FRMA 3FRYA 2E1ZA 4ERDA 1RBTA 2GUPA 3QBWA 4ZKAA 3SUPA 4WP3A 4PL7A 4F3QA 1WI6A 1BMQB 2CH6A 1RFQA 2ASOA 5DDRC