4PWDA

Crystal structure of hiv-1 reverse transcriptase in complex with bulge-rna/dna and nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, P66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna/inhibitor
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pwdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pwdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pwdA05
3V6JA 4CFDA 2ETJA 2D0CA 3GILA 3F73A 3PZPA 1L3VA 2R7YA 1KCFA 1VSKA 3I0SA 1ASWA 3LP3A 2X78A 3CFOA 2OH2A 5I3UB 1JLAB 1ASUA 1RDRA 2VA3A 4R8UB 2BQ3A 1LW2A 4Q8EA 2KFNA 4NLRA 1KTQA 4KO0A 4OVLA 1TV6B 4ZMMA 4CEDA 1QAIA 3TAGA 2B43A 3RR8A 1S0OA 2GIQA 4J2AA 1RT2B 4Y34A 2JEGA 1RT3B 1ZBLA 1F21A 4DQQA 1WAJA 1IKXA 3NE6A 3NGIA 1EX4A 4RW6A 1HARA 4O0IA 3MEEB 1T05A 3U3YA 3T19A 2OZSA 4PWDA 1VSJA 4WXOA 4IOBA 1A5WA 3CG7A 4KFBB 4ZTJA 3K5OA 3AA5X 3QIPA 4DL3A 4FJMA 5KGXA 1NK5A 2FJXA 4NRUA 3B6OA 2YKNA 2IM0A 3KLHA 5KFKA 2I1RA 4MKAA 3MR5A 1NOZA 1T7PA 1BHLA 3OVNA 1WSGA 4BE2A 1NK6A 3N6LA 3H5UA 3BSOA 5T14A 2O4GA 4U7CA 4FVMA 3RRGA 4CE9A 3OYLA 1HYSB 5DG7A 4O3PA 3QIDA 1UA1A 3G86A 4FLYA 1TAQA 4CJ5A 4DS5A 1S1WA 5HRRA 3QESA 3MR6A 1S1TB 1N48A 4RNFA 2F8TA 3GIJA 3LDSA 4XPCA 1KRPA 3PW4A 4HUGA 4ID5B 2R2TA 4NYZA 4TYBA 3TR8A 4F3TA 1HNVB 4OJRA 3FSIA 4N5SA 4TQSA 3V9XA 4FZZA 1S6QA 4ZP7A 4IH7A 2ZE2A 4FLZA 1TKDA 1RBSA 3OYKA 2F8SA 1DTTA 1QSLA 4NZ0A 4YNQA 3CVKA 1SUQB 3IRXA 2E4LA 1K1SA 4JUZA 4KTWA 2E9ZA 1UWBB 1BIUA 3H5YA 1K6YA 3KJVB 3BQ1A 1U45A 1BCMA 2AGQA 3HJFA 4F4ZA 1NHUA 4J2BA 2PYLA 4RZRA 1QE1B 2OPRB 3CM6A 1S48A 3IS9A 5JS1A 1JLFB 5FDLA 1T03B 3KLEB 4XPEA 2RKIB 1RDAA 3FQLA 4CJUA 3DM2A 3OYEA 3MTKA 3HT3A 1VK0A 4OKEA 5CZ2A 4ECTA 1Z4UA 3AVJA 4NLOA 4DSFA 1O1WA 4FZXC 3CJ0A 2G8FA 4J2DA 4PY5A 3L2VA 2RF2A 5L9XA 4CJKA 4B9UA 2HHXA 4KB0A 4MKBA 5CYQA 1REVA 5DMRA 3OYGA 3KK3A 2IC3B 5C42B 3K57A 1VSFA 3CIZA 3JYTA 3VQSA 1HMVB 1TL1B 1HQEB 2FLNA 2HB5A 3VQ8A 3HP9A 3QLHA 4LH5A 2O4IA 1C1CA 1J5OB 2ZD1B 1JLQB 2GBZA 1QSSA 5KFEA 2HHWA 3RBDA 5KFXA 4WE1B 4DL7A 4OL8A 4ZPDA 4OGEA 1JIHA 1T94A 4CJPA 1T3NA 4HHTA 4LSNA 4FW2A 2B6AA 4CJTA 3RAQA 4EEYA 1RT7A 3DOLA 3NF9A 2I5JB 4FK0A 1HYVA 3MXMA 3D5MA 4RW4A 1OS5A 4YR2A 3OL7A 4O44A 4RW8A 4DLGA 3OS0A 4K4XA 3PO4A 3RTVA 4M3XA 3AO1A 2BQRA 3NF7A 3AVLA 3M8RA 4R0EA 4FJHA 1JLGB 3BQ0A 2HHVA 2UUTA 4ZTFA 3G6XA 1TL3A 1JXBA 2E6LA 3OS2A 5DQGA 4WZMA 4B9NA 2BGGA 3LP1B 1SKWA 4CF1A 3OYCA 4DLEA 1N6QA 4K4TA 3Q8SB 4HUFA 3OJUA 1S1XA 1S9GB 4Q0BA 5F8HA 3GV5B 1TKZA 4H54A 3ZSRA 4HTUA 2R2UA 4WYWA 1BQNA 3KK2A 4JRQA 3G0ZA 4CF8A 4ED8A 1JXEA 1D0EA 4EBEA 4LSLB 4Q8FA 4IDKB 1NK9A 3C6UB 4Z4IA 1LWEB 4FJNA 2YHAA 2C28A 3FQKA 4DSEA 4CEEA 1L3SA 4DQIA 4H8KA 4RW9A 4JS4A 1C1AA 4M94A 3PW0A 3MEGA 3AVHA 4H4MA 2AX1A 2QE5A 2HNDA 2AGOA 1LAWA 4KB1A 3HP6A 3G6VA 3DRSA 3ZSVA 5DGAA 1Q8IA 3OYFA 3T5JA 2CJQA 1LW2B 1SL2A 4GC6A 5EU7A 5DG9A 3DI6A 4RUCA 4RUAA 2XGPA 4QCLA 4KTQA 3LP0A 3TAFA 4CGDA 1TKXB 4Z4GA 1VSIA 4O4GA 4RG8A 3SV4A 1TQLA 4TY9A 3DLKA 4AHRA 4FBTA 3ISND 3QO9B 3ZSYA 1S6PB 3SUQA 4X2BA 4DTRA 2W9AA 3H98A 2RPIA 1IKXB 3SZ2A 4H4OB 3OL8A 3LPUA 4RW6B 3OL9A 4NLVA 3HL8A 1SH3A 1U4BA 1RDCA 2W8LA 1T05B 1RTDA 4DSKA 3U3GA 4PWDB 3O4NA 3CJ4A 1U04A 4NLQA 4R5PB 1J9AA 3V1OA 3QIPB 1TAUA 3KOAA 4ZP8A 3JSMB 3O3GA 4OLBA 2X6SA 4ZPCA 2YKNB 5DLFA 3KLHB 4O4RA 2ZKUA 4CFAA 1CLQA 1S49A 1RILA 4TN2A 4ZP9A 3NFAA 3L2QA 3L3UA 5DQIA 1VRTA 5J1EA 4B3OA 3F9KA 4C8OA 3L3VA 2PY5A 3PV8A 2WRMA 5CY4A 5HP1B 1RNHA 3LALA 4NLYA 3C95A 3LZIA 1S1WB 4J2EA 1VSMA 2V4QA 3H2LA 3N6MA 3I5AA 3ZT3A 1WNSA 4O3OA 4YQWA 4FW1A 2P51A 5KG6A 3UDLA 2IA6A 2IM3A 3KMSA 3WNHA 3SV3A 1Z26A 1S6QB 4FLUA 2ZE2B 2WONA 4KKOA 1KFSA 4GVMA 5KFYA 5J2NA 4CK2A 4DU1A 2AGPA 1DTTB 4K4SA 2C2DA 1C6VA 3IRXB 5KG3A 4NCAA 1N5YA 4CJSA 1HNIB 4QAGA 5HLFA 1L3UA 2ILYA 3MECA 3CWJA 1IKWA 5K14A 4G1QA 3HVTA 1S4FA 3ZSZA 2HHQA 1RBRA 4DU4A 4IKAA 4CECA 5KFWA 4KI4A 3IS9B 4IG3A 2DY4A 3K59A 3DDKA 3S9HA 1Y97A 4E7HA 2EX3A 3CDUA 3D28A 1KSPA 3DLRA 3DLEA 4NLPA 4J9KA 1SKSA 3GIIA 3QZ7A 2QKBA 1BCOA 4FLXA 4N56A 4ED2A 1BQMA 4ICLA 5J2MA 3NBPB 4FJIA 1S0MA 3ZSOA 5CYQB 1REVB 1NJWA 2G8WA 2FLLA 4CEBA 3M8QA 4DSIA 3RB3A 3WNFA 4FJ7A 3NKYA 4QWCA 3FDSA 1KHVA 2DFFA 3QLHB 4KI6A 3LAKA 1FK9B 4K4WA 1C1CB 4KE5A 4EYIB 4DL6A 3RMCA 4Q44A 2P5GA 2W9BA 4KTZA 5EDWA 3EZ5A 3C6TB 1LWCA 3QETA 2FBYA 3NAEA 3EZUA 3NH2A 4CJ4A 3CM5A 3ITHA 4LSNB 3CJ3A 3KLIA 1EETB 3MFIA 1RT7B 3DOLB 1Q9XA 3CDWA 5KFQA 3QIOA 3AVAA 4EZ9A 2YNFA 3V1RA 2DTUA 1N56A 4RW8B 1GOCA 4DTJA 1XR6A 1KVCA 1UAXA 3VQ6A 4FJKA 4NLDA 1SL0A 2BQUA 4CIGA 4DF4A 4TXSA 4DG1A 4NLGA 4LD0A 4CJRA 3KKSA 1TL3B 2Q3SA 2A1SA 3GV8B 3SQ4A 4KAZA 4NLSA 1I6JA 3Q8RB 1BI4A 1VRUA 4QPXA 1N6QB 4J9QA 1C1BA 5HRSA 2PZSA 3HSTB 2OPPA 3GQCA 2AQ4A 1TKZB 2VG7B 4CK3A 2IGIA 3DMJA 4RNNA 1BQNB 1RT5A 3CYMA 3KK2B 4I2PA 1GOAA 2VWKA 3L2UA 3LWLA 4FJJA 3U6FA 3GIMA 2VG6B 3OYDA 3TABA 4MQ3A 3H59A 4KHRA 1B9FA 2VA2A 5KFJA 5F8GA 4I2QA 5KT5A 3DLGA 4AHUA 1C0TB 4ELTA 1MMLA 4E1MA 3MEGB 4H4MB 4E1NA 3DYAA 3MXIA 3PW2A 2YNHA 3CFPA 4ELVA 4WXWA 2V0NA 3DRSB 3V6DA 3KHHA 2FLPA 4LQ3A 3CDEA 1WSEA 1HRHA 1SL1A 1ZBUA 1WSJA 1WSIA 4NCGB 1YT3A 3QINA 1NK4A 2HWIA 4DS4A 3G10A 4ECYA 2YNGA 3VQPA 1RYRA 1ZTWA 1LWFA 4BDZA 3DI6B 3PVXA 4CHOA 3LP0B 4KPYA 1RT6B 1WSHA 4I9LA 3T5LA 4B8AB 4O4GB 1RYSA 1RT1A 5KFFA 2B4JA 2B5JB 3DLKB 4IKFA 4CHNA 1ITGA 3KD5E 3S3MA 3C94A 3BGRA 3RAXA 3AO5A 1JLBB 1XHXA 2QV6A 1RTDB 5F8IA 2VG5B 1JXLA 2AWZA 3SFUA 1JLEB 4LY7A 2OPSA 2WOMA 4O3NA 1NJZA 4IFYA 3PR5B 1XHZA 4F4YA 4E7KA 1CXUA 4DQPA 3EY1A 2WHOA 2AX0A 1J53A 4I7FA 3RMBA 4WFYA 2YNIA 3NH1A 4AH9A 4DFJA 4IG0A 1DLOA 1SH2A 4OGCA 4IRCA 3QEPA 4ID1A 4B3OB 4F2SA 2OYQA 3QEVA 3EPIA 3SFGA 3CJ2A 4IRDA 4MIAA 4OPKA 1RTJA 4IFVA 4KHYA 5KFNA 3ZSXA 2Y1IA 2D7SA 4J9PA 2W42A 1NK8A 5KT7A 3M9MB 4DFMA 5FRNA 3KLFA 5KG7A 4CEZA 1JX4A 5SZTA 1S9EA 1S5JA 2WONB 3LP2A 4KKOB 3V81A 3OLBA 5J2NB 4ZVEA 3TANA 4N41A 1R0AA 2R2SA 4FK4A 1RA6A 4WZQA 1WNEA 1VSDA 2E9RX 1RAJA 1CXQA 2AJQA 4B9SA 3I0RA 5HLFB 3H5SA 1DTQA 3HPOA 3MECB 1IKWB 2IM2A 5KT3A 2DFEA 5K14B 4O0JA 3VQ9A 4AHSA 1BGXT 3OS1A 4G1QB 3HVTB 3TAMA 1JLCB 4J9NA 2G8UA 3SUPA 3KMQA 4CGHA 4YR3A 4IG3B 3VQ4A 1TGOA 1RBTA 4EP5A 3HVWA 3AVBA 3QNOA 1HQUB 4NYNA 3DLEB 1MU2A 2IAJA 2D5RA 2F8EX 4MK8A 1BQMB 2PYJA 4CEQA 5J2MB 1IKYB 3O4QA 4K4YA 1CZBA 2C22A 1D9DA 3GV7B 4JS5A 2KZZA 3M8QB 4J9OA 1KLMA 4ED7A 3NAIA 3RR7A 3ZT2A 3M9OB 2UVUA 4Z0UA 2HNZB 2W9BB 4JRPA 4AILC 3MFHA 4O3SA 1U49A 1LW0A 4KHMA 3ITHB 4M95A 3KLIB 4QWEA 4DSJA 3RB6A 3T5KA 1UOCA 2XO7A 3NHGA 3RB4A 1NHVA 5F8MA 3AVNA 3NF8A 1GOBA 1S10A 2YKMA 4WFZA 2XRIA 5KFOA 2UUWA 3OJSA 3AA2A 5KFRA 2EHGA 1TVRA 4EO8A 4DG1B 4RNOA 4CGGA 5J2QB 3ASMA 3BDPA 4E19A 3M8PA 2F96A 2O5DA 4MFBA 5D3GA 1U47A 5KT4A 1S1VB 2W9CA 1G15A 4M42A 3ICLA 3LAMA 3RBEA 4DTOA 4C8LA 2OPPB 4K4UA 4KV8B 3UR0A 3PX0A 3GYNA 4DL2A 3DMJB 3QEIA 3OHBA 1RT5B 3AO3A 5C5JA 4FZYA 4I2PB 3SQ0A 3BSCA 3LWMA 3HVRA 4CJ3A 3BSAA 2Z1GA 3S3OA 3I0SB 3MF5A 1EXQA 2ASDA 4ECUA 4R8UA 4FM2A 5F9LA 3VQ5A 4I2QB 1KFDA 5KFIA 3QEWA 2DPIA 2C2EA 2G8KA 1TV6A 4KO0B 1WLJA 5KFCA 2XI3A 4Y1DA 3UQSA 1XWLA 4CGJA 3DYAB 5KG1A 4L8RB 5KTQA 4F2RA 2YNHB 3PX4A 3TARA 3DOKA 5DGBA 2IOCA 3VQDA 3V6DB 2XCPA 5KG2A 1C0UA 5KT2A 3AVMA 1FKPA 1KHWA 3THVA 1QAJA 5JUMA 3MEEA 3AO4A 2YNGB 2HMIA 1LWFB 5KFZA 2FVCA 3V9SA 3V9ZA 4BACA 4Y1CA 4KFBA 3TAPA 1SKRA 3MR3A 1ZBIA 4RW7A 5KG5A 4ECQA 3HM9A 4J9LA 1NK0A 4ZPAA 4IR9A 2JEFA 1RT1B 3QGIA 2ATLA 4CHPA 4B9TA 5L1LA 1ZBHA 2HVIA 4M3WA 3AVGA 3GIKA 3BGRB 3KTQA 2XY7A 2D0BA 1U48A 5KFMA 1J54A 4FS2A 3TAEA 1HYSA 5KFBA 4EO6A 4MIBA 1S9FA 3SCXA 1BISA 4B9VA 3NAHA 3OLAA 5J2PA 2YNIB 1RBVA 5HRNA 4KHUA 3Q8QB 4DQSA 3AO2A 4RU9A 1DLOB 4ID5A 4FBUA 4IH6A 3HXMA 1D8YA 3Q8PB 3B6PA 4MK9A 2XI2A 1BIZA 1SUQA 1RTJB 4N76A 4IFVB 4UQGA 5L1JA 4ECRA 3I5CA 1KVAA 1HYZA 2XHBA 2HVHA 5DQHA 3OYNA 3KLFB 4E0DA 1S9EB 3K58A 3V81B 1JKHA 1T03A 3KLEA 1R0AB 3QERA 4NCBA 4C8NA 3ZT0A 5FDLB 2IJFA 4WYLA 3SQ1A 3DM2B 1GX6A 3I0RB 4ZP6A 5KI6A 1RDBA 1RTHA 1SH0A 3ZT1A 2HHSA 1JL2A 1NKCA 3NL0A 4FJ5A 1X1PA 1NNDA 3CFRA 4BE1A 2UVVA 1D9FA 3PUFA 3MEDA 1WAFA 2RF2B 4F3OA 3QGHA 2J6SA 1EP4A 3KNAA 2IM1A 4C8KA 5I42A 3TI0A 5C42A 1B9DA 2OPQA 3KK3B 3IG1A 3H4DA 4CEAA 3LANA 1D1UA 4TYAA 5C25A 3JYTB 3AA3A 3P5JA 5KFAA 2DPJA 4E3SA 4FYDA 3BJYA 1X9SA 2IAJB 4LQ9A 2ZD1A 5DK5A 1FXXA 5JS2A 4RNHA 5KG0A 4PUOA 2XWYA 3VQCA 2X74A 4ECSA 3D45A 4W5QA 1NOYA 3HKWA 4LH4A 4BDYA 4N47A 3KLVA 1TK5A 2LSNA 2B6AB 4ELUA 4FJGA 1IH7A 2BRLA 4CJWA 2I5JA 4KHQA 4FM1A 4QWAA 4RW4B 1L5UA 3AVIA 4RNMA 4O44B 1JL1A 5DG8A 2G8VA 3HK2A 2FVQA 3SI8A 4HVJA 2WK4A 1RT4A 1LW0B 5SWMA 4CF2A 3QYYA 4FLVA 2AU0A 2JC1A 2OA8A 4B9MA 4O55A 3KHGA 4DTXA 2YKMB 3E51A 1UA0A 3LP1A 1N4LA 5KT6A 3H08A 3V9WA 4CERA 2XGQA 4M3YA 5KFVA 2FBXA 1TVRB 4M3RA 2W7OA 5KRTA 2R8GA 1S1XB 1QHTA 4Q0BB 3M8PB 1YVFA 4KSEB 4ECZA 5D3GB 3H4BA 3AV9A 3LZJA 3V6KA 2W9CB 1NJXA 4MH8A 4Y3CA 4FXDA 2RDJA 1VSEA 4LSLA 4EZ6A 4J9RA 5EWFA 1A5VA 3SQ2A 4M3ZA 2UVRA 1S0NA 3T5HA 3VN5A 4FJ8A 4DTPA 4DU3A 5KFGA 3KLGA 4XO0A 3HPHA 4M3UA 4RW9B 4CIEA 1YTAA 1ZBFA 4DSLA 2ITGA 3IAYA 2HNDB 1T8EA 2GIRA 1TP7A 3SJJA 4TQRA 3S3NA 3RB0A 1C0MA 3KKRA 2WCXA 2XY5A 2WTFA 2BANA 2UVWA 4IR1A 4DF8A 1TKXA 3DOKB 1X9MA 1C0UB 4CJEA 4Z4HA 3QO9A 1QQCA 2P5OA 1S6PA 1FKPB 4CCHA 1U09A 4H4OA 3AA4A 1HPZA 2Z1JA 2HHTA 2JLEA 4M45A 4ED6A 3VA0A 2HMIB 5HBMA 4DL5A 4Y2CA 5KFDA 2IDOA 4CF0A 2XC9A 1W9HA 4QW8A 4RW7B 2BR0A 4R5PA 3DRRA 4J9MA 3A2FA 4FJ9A 4DL4A 3JSMA 3NMAA 3OHAA 2XY8A 5C24A 3P83D 3TAQA 2J6UA 3K5MA 3RRHA 2FVRA 2FJWA 4HCCA 4CFBA 3DRPA 4CJLA 2V4RA 3CJ5A 4KB7A 4HCBA 2QKKA 1VRTB 5J1EB 3V4IA 1ZTTA 4CHYA 4QW9A 2HNYA 3OYBA 5HP1A 2R8JA 4IQXA 4U6PA 1IG9A 1SV5A 5CYMA 4JV0A 3HVAA 3RWUA 4ZVFA 4E89A 4F8RA 4FK2A 3EPGA 5J2PB 4CHQA 4O3QA 3ZCMA 2IMWP 2IS3A 3M9NB 1RA7A 4W5NA 1IO2A 4KHWA 1S1UA 3T3FA 4CHZA 4FJLA 3ULDA 2FJVA 4DWIA 4YP3A 3H40A 1RTIA 4NRTA 2R8IA 4GC7A 4IBNA 4O3RA 2YHBA 4J9SA 4PA1A 4TSXA 4K4VA 4DTUA 2R8HA 4ZHRA 2BE2A 5KGWA 3V1QA 1GX5A 1HNIA 1N5YB 4TY8A 1HJRA 3P1GA 3T1AA 4QWDA 2JEJA 4BWMA 3FRZA 1KLNA 4AHCA 3FFIA 1JKHB 5HRPA 2ALZA 1YTUA 3PW5A 3ZSWA 4FS1A 5KFPA 3SUNA 3HHKA 1CSJA 3SPZA 1QS4A 3NGYA 1RTHB 3DLBA 3OY9A 1LV5A 3MEDB 4URSA 5F8NA 4ICLB 3NBPA 1IKVA 4NLWA 1EP4B 2DFHA 3N6NA 4Q5VA 5I42B 4PQUA 4Z4CA 1RBUA 4OKJA 3K5LA 4XIUA 2OPQB 3IG1B 5C25B 1KVBA 4KRFA 4C8MA 1TKTA 3MAQA 4HYKA 4E7LA 5HROA 4ZVGA 1FK9A 3MR2A 2RDIA 2FBTA 4NLUA 1Q9YA 4FLTA 4CIFA 3M8SA 3C6TA 3G6YA 3PR4A 4CK1A 4M3TA 3VQBA 4PUOB 1LWCB 4JV2A 2ASJA 3BQ2A 2GUIA 4CGFA 4FJXA 4CF9A 2GC8A 2IJNA 4IRKA 1EETA 2HW3A 5KFHA 2ATQA 5FRMA 1NKEA 3AVCA 4DEZA 2YNFB 4CEOA 3KHLA 3E01A 4CJQA 3L2RA 3WNEA 4F4WA 1RT4B 3SPYA 2X6NA 5KG4A 3HPGA 4FCYA 4CEFA 5EWGA 1RCHA 2JC0A 1ZETA 2YV0X 5KFTA 1BI4B 1VRUB 5F8JA 2OZMA 1W0HA 4F50A 1WSFA 1C1BB 2KTQA 3PHEA 1K1QA 2VG7A 3KK1A 4URGA 1FKOA 3TQ1A 2HAIA 3NH0A 1NKBA 5JXSA 4F4KA 3DLHA 4DTNA 2VG6A 3L2WA 4IH5A 2FC0A 3AVKA 4CESA 3KHRA 4NLTA 3CQ8A 4YR0A 5I3UA 1JLAA 4ECWA 5E41A 1C0TA 2BRKA 2D3ZA 2W8KA 3KLGB 3QGGA 3DLGB 3QNNA 4JV1A 4QOZB 3WNGA 3K5NA 1NK7A 1IM4A 4DQRA 4DFPA 2R2RA 1LAVA 1XR5A 3K2PA 1RT2A 3PW7A 1A5XA 3VQEA 2ASLA 3BREA 1RT3A 4NCGA 3RMDA 3QEXA 4HUEA 4GW6A 5T7BA 4E7IA 2V9WA 4MK7A 3OYIA 4AHTA 4W5RA 3PY8A 2BANB 1VSHA 1RT6A 4K8XA 2BDPA 3ZT4A 4EYHB 3KIOA 4NLXA 2B5JA 2WB4A 4URQU 2FVSA 3OYHA 3VA3A 2KFZA 4OLAA 3O3FA 3IGNA 1JLBA 1HPZB 4W5TA 3HO1A 5FROA 1RDDA 4DFKA 5HBMB 2VG5A 5F9NA 2RN2A 1VSLA 1JLEA 4AHVA 3NGZA 3DRRB 2OPSB 2WOMB 4IFYB 3VQAA 3V6HA 4W5OA 1D5AA 4EP4A 5C24B 3BSNA 4OPJA 3NCIA 1S1TA 4K4ZA 2NUBA 1ZYQA 1QTMA 4I7FB 3NDKA 4WFXA 2KQ2A 2HHUA 4TLRA 1I39A 3UIQA 4IG0B 3DRPB 1EKEA 4YMEA 2FBVA 4KHNA 3MXJA 2P1JA 1HNVA 4ECXA 3V4IB 4FLWA 2HNYB 4QWBA 5CZ1A 3SYZA 3IGVA 5L1KA 4ED1A 2ZQBA 1SV5B 5CYMB 4JLHA 3O3HA 4G3IA 3H5XA 3UPFA 4DTSA 4CJVA 2A1RA 4KREA 4F4XA 3D0PA 2QXFA 1S1UB 1UWBA 4KAIA 3I8DA 2G8IA 4ZPBA 3KJVA 1NJYA 3TWHA 3OSNA 5L1IA 1RTIB 4KBIA 4DMNA 4O5BA 2JGUA 5EUHA 3EYZA 3LP2B 5KFUA 1QE1A 2OPRA 4CGIA 4ZVHA 4HKQA 1JLFA 4CFCA 4ZHRB 2BE2B 2Z1IA 2RKIA 4KHSA 2QK9A 4ECVA 3TVKA 4TY8B 2HWHA 4OKKA 3VQQA 5KRSA 2CKWA 4Z4FA 4Q45A 1DTQB 1TK8A 1W25A 4Y2AA 4BDPA 2XY6A 3QZ8A 3I5BA 1JLCA 3SI6A 2G8HA 3V9UA 3TAMB 3FFIB 3PX6A 1B92A 3NGDA 2GV9A 4K50A 1C2PA 2JEIA 3IN5A 2IC3A 1HQUA 4BE0A 3RMAA 4ED0A 3ISNC 1HMVA 1TL1A 1HQEA 1MU2B 3OYJA 2IBKA 1TK0A 4YFUA 1J5OA 3PJWA 3AVFA 1QUVA 1L3TA 1JLQA 1IKYA 2D0AA 1IKVB 2W7PA 1XR7A 1CZ9A 4WE1A 4PQUB 5EWEA 3OL6A 5F8LA 1S97A 4BWJA 5DLGA 3ZSQA 5KFSA 1KLMB 1TKTB 2HNZA 4EBDA 4K8ZA 5HROB 1WN7A 2FVPA 5KFLA 2KZMA 1X9WA 4FM0A 1Z25A 3VQ7A 2XCAA 1JLGA 3PJXA 1XI1A 4NYFA 3OSPA 2C2RA 2D41A 3PO5A 4B08A 2Y1JA 4B8CA 3BR9A 2D3UA 4DTMA 4Q43A 2J6TA 1I3AA 3E01B 2E6MA 3CO9A 5J2QA 1S9GA 1BL3A 3L8BA 4CJFA 2VWJA 3SNNA 3OYMA 2KW4A 4GMJB 2Z1HA 1ASVA 4Z4EA 2ILZA 3ALYA 1YVUA 1S1VA 4E7JA 4MFBB 4EBCA 2E9TA 4M41A 2EC0A 2R8KA 4IDKA 3C6UA 4ED3A 1LWEA 4I9QA 3LPTA 3NF6A 3SUOA 1QSYA 3OYAA 4KV8A 1XC9A 4B9LA 3KD1E 3KK1B 3HYFA 1FKOB
chains in the Genus database with same CATH superfamily
3V6JA 1PJ5A 5C15A 4C3LA 3QATA 1W26A 3MD3A 4LF7K 1V6HA 5H1SV 3GILA 1NXIA 1ZZNA 2VONA 3LP3A 1RBAA 2OH2A 3TRGA 2DGXA 1LW2A 3J7AN 4Q8EA 1QVFR 4NMXA 4NLRA 1KTQA 4OVLA 2RNEA 4CLWA 4ZMMA 3BGUA 2VD3A 2WUSA 3BGLA 4LRDA 4USIA 1AT1B 3J7Z5 3TAGA 2GX8A 4HACA 3CETA 3H7HB 2GIQA 3AXKA 1P8GA 4U8YA 1RT3B 3HHLA 3A8IA 2V94A 1WAJA 2ZUAA 1IKXA 4X4RA 4F67A 1T05A 4U7UK 3CXCR 1A5WA 1CJUB 2VKRA 1TFWA 2XSFA 5THWA 4DL3A 5F1XA 4FJMA 4DR1K 2YKNA 3KLHA 1MN9A 5LSLA 2WW8A 3U8XA 3MMAB 2KU7A 3N6LA 4EWTA 2W25A 2O8DA 3SEOA 3BSOA 4LF5K 2O4GA 2XEXA 5AQXA 2H54B 1UA1A 1VQ4S 3D6MB 3UD4P 5BRFA 3THTA 1T9UA 2E1ZA 4C9DA 4RNFA 3GIJA 4XPCA 3E8OA 2CQ1A 2C42A 3BO2A 4X4NA 4NYZA 3KUHA 1KAXA 2F7VA 3FSIA 2DPNA 4ZP7A 4IH7A 1TKDA 1FE4A 1RBSA 2F8SA 4IEIA 4ZVPB 2NZTA 1IN0A 2DRDA 1DTTA 1SUQB 4CLPA 2E9ZA 1LXJA 1BIUA 4U95A 1YJUA 2ZITA 4NXMK 3KJVB 2BJDA 2MSSA 1KQKA 1NHUA 4J2BA 2IVNA 1CG2A 4RZRA 3ZFVA 2SXLA 4JKAA 2G2ZA 3CM6A 3R2CJ 1NJIT 3EGVA 5FDLA 1T03B 2OLWA 4G6VB 4XPEA 1RDAA 4OKEA 5CZ2A 4A48A 3Q2TC 3MD1A 3AVJA 4J2DA 1HKAA 4QU7A 3L2VA 3ELHA 4JI7J 2RF2A 3H90A 3AFGA 2QWQA 4LF6F 2HHXA 1B3TA 5BJRA 1M5OC 1BWVA 1RCXB 4RU2A 1WC1A 3RSEA 3VQSA 3EVWA 4DBQA 3HP9A 3QLHA 4TKTA 1C1CA 2BJ3A 1JLQB 2O3DA 3S6EA 3RBDA 4U67L 1T94A 1T3NA 1FRXA 1DGKN 1QY7A 1HYVA 1Y11A 3D5MA 3V4MA 3R3TA 4RW8A 1OYEA 2YPZA 3PCOB 1NLVA 4HLBA 4WFAL 3VGVA 4ANEA 1WC0A 3NF7A 3LGHA 1TUYA 1JXBA 3K17A 4X4PA 3I9V9 1B7FA 5ITHA 4HDHA 4CD3A 4DV5F 2A41A 2BGGA 4DLEA 5BYRA 4HUFA 2O8BB 3DRXA 5F8HA 2V2ZA 4HTUA 1HLWA 1MW7A 2QLBB 3G0ZA 3WIVA 4ED8A 4ZN1A 1EQ0A 1R6VA 4LSLB 4HDGA 4Q8FA 2HRUA 3THXB 3O2IA 4FJNA 4C97A 3M2UB 2YHAA 3H2UB 2OKQA 1UP1A 1YRXA 4NASA 4OI4A 1O51A 3T69A 1XNRF 4C23A 4JS4A 1NH7A 5AJ3F 3M6WA 4DX7A 2AGOA 3HP6A 3DRSA 1Q8IA 4HH1A 3OYFA 3T5JA 5JVHL 3R5BA 3G82B 4CTAA 2FQQB 1OPZA 3CMAN 5DG9A 1K9MO 4QCLA 2XGPA 1RE1B 3LP0A 1VSIA 1FW6A 4JKFA 5CZVA 2QA4N 1IWAA 3ZSYA 4DTRA 3O1WA 2W9AA 2RPIA 4FWOA 2Q66A 4H4OB 3OL8A 1ZM9A 1RDCA 5DDQC 1RTDA 4TVAB 4WYBA 1HBNB 3G4SS 1HBUB 4M1KA 4PWDB 4O5FA 4FNHA 2VPXB 2HHHJ 3MMJA 4R5PB 3QIPB 3KOAA 3VEZA 3HFZB 3JSMB 3CD5A 1FJCA 2AJ2A 1X4AA 1S49A 2LDYA 4ZP9A 4B3TK 3L2QA 4WKRA 3WXLA 3GCXP 2WRMA 4D3HA 2AZ3A 2W24A 1GXLA 1Q8BA 5HP1B 1RNHA 3DDNA 3LZIA 4KHPJ 3W8GA 3FBCA 1UFLA 2ZH4A 2F9TA 1UZHA 2PA8D 3H2LA 1XEZA 3N6MA 2XMUA 4WTOB 5BYSA 4UT4A 2MQ8A 5KG6A 4FOIA 2IM3A 2JNJA 4OYPA 3KMSA 2XS7A 3SV3A 2Q97A 2ZE2B 2WONA 5KFYA 5J2NA 2HPUA 4BRAA 3CC7N 2E5JA 2E2QA 2FJEB 2MQQA 4YOXA 2C2DA 5KG3A 1N5YA 4CJSA 4K7QA 3PRVA 4H5NA 3CCTA 5GADP 3CWJA 2I6WA 2YWFA 4V1Ak 4G1QA 4CLLA 2GJ2A 3HCXA 3N4QA 3FEYB 4CECA 5GMDA 4H0VB 4KI4A 3IS9B 2Q2RA 2DY4A 3DDKA 4LFCJ 1WHYA 4KBOA 3D28A 4NLPA 2QKBA 4PG8A 4ATNA 5H9FJ 2XLIA 3HMJG 2DRBA 4ICLA 4YB5A 3FVYA 5J2MA 5JICA 3ZX0A 3NBPB 4JI4K 5HO4A 1K9MT 2G8WA 3JAMU 4CEBA 5EGYA 4DSIA 3RB3A 3WNFA 4ZCMA 3VPZA 3UN5A 3LAKA 2DXDA 1LFPA 1FK9B 1H2VZ 4K4WA 4Q44A 2KH9A 3EZ5A 1QLNA 2HQIA 3EZUA 1M5KC 1GTHA 4CJ4A 4AQYJ 1YITN 4A62A 3KLIA 3WT0A 5KFQA 3OV7A 2H1YA 5E0OA 1DFDA 1V3ZA 2XQCA 5AT1B 4B1ZA 1UAXA 3VEOA 2M70A 5B7WA 4OX8A 5FIIA 1Q81O 4H5VA 3PIPL 3KKSA 3FCVA 5LMNK 3MPVA 1HNXK 1EWQA 2Y1RI 1RLCL 2IFXA 4MYTA 1UETA 1SJQA 2XTJP 2HSEB 4LF5F 3S01A 1KKHA 2PZSA 3VAIA 4U67Q 1YJ7A 2OPPA 2AQ4A 1TKZB 1E6VB 4CK3A 4RNNA 1FJ7A 1WC3A 1IXKA 1S7IA 4YS2A 2O8EB 4DV2K 2CQ2A 4DHVA 1Q8KA 4M5DA 3L2UA 3LWLA 3VV2B 3GIMA 3BF3A 1VAZA 4PYDA 3NS7B 4WFAQ 2B0GA 5D78A 2AP6A 2V51B 5KT5A 4AHUA 5IQ6A 4NI2B 4ELTA 2H5JB 1NZAA 1KTVA 4X65K 1OH7A 2P9KA 4JI3J 8AT1B 1D4XA 3CMES 5F0XA 3C6AA 4FPRA 4WXWA 3V6DA 1ZOTA 3OFHA 1HL6A 1GAOA 1SL1A 2N4CA 1NM2A 4QYRA 3R5AA 1V4SA 1YT3A 1PGZA 2GA7A 3I9ZA 3QINA 3VQPA 1U26A 1RYRA 1NRKA 3DI6B 3OUYA 3HD2A 1YZ6A 4LFAK 2HLUA 4I4BA 4GVEA 2QLFB 1WSHA 3UNYA 1X4FA 4O4GB 1RYSA 1RT1A 3DLKB 2IRXA 3MM5B 4IKFA 3QBXA 3Q8UA 3BGRA 2VQEK 1Q8LA 3JS6A 2GVDA 3CJKB 4LY7A 1GLAG 4O3NA 4OV6A 1U1QA 3R5CA 5JVHQ 1CXUA 1VHXA 4I7FA 2YNIA 3MM8A 4LF9J 3NH1A 3OR1A 4AH9A 4IG0A 1SH2A 2DGSA 2OJ3A 4ID1A 4CLKA 3NOCA 1IJFB 3ZZUA 2FIUA 2GGPA 1XBWA 3BH6B 3CD6N 3EPIA 1SJ3P 3SFGA 4CO0A 3CJ2A 4IRDA 4YHHK 4F25A 3VAMA 1OKJA 2RHSB 5KAKA 1GK8A 4BRGA 4KHYA 1FNOA 3UN2A 3GU0A 2OTJS 1N52B 2W1BA 5A0YA 2OTLS 4CLSA 5FRNA 3MM6A 1AUDA 2LECA 1U1NA 1JX4A 4EHUA 4KKOB 3V81A 2BUPA 4H0OA 1N5VA 2ZH5A 1R0AA 2R2SA 3MM9A 4I6AA 1VSDA 3LA0A 4ANDA 2C2KB 1U1KA 3I0RA 4TU7A 4F26A 3H5SA 2GQ2A 3HPOA 3MECB 5KT3A 4O0JA 4AHSA 4FYXB 2P9SB 1VC0A 3GYXB 5CXTA 4J9NA 2YQ3A 2F9JA 3JSBA 1RBTA 3J7AP 1PBAA 1H98A 4OYOA 1XMQK 5C2GA 2N7CA 2MZTA 3C8YA 1MU2A 5IC4B 1U1PA 2MPUA 4E98A 1EQYA 4DN9A 3U9DA 4BLGA 4KQZA 2EG1A 4PPZA 1NNEA 1IKYB 2DNNA 5EXWA 2YBVA 1H74A 5GAEP 2C22A 3D68A 1D3WA 4Z37A 2ZDOA 4J9OA 4N77A 4PR6A 1KLMA 4ED7A 3HZ6A 2GO9A 1VQ8N 3HSCA 6AT1B 4XDDA 3RR7A 1FTRA 2UVUA 2G1DA 1Y3KA 4HT5A 4JKBA 2UU9J 2W9BB 4WPAA 2QJ3A 1IR0A 4JRPA 2YPYA 3MFHA 4O3SA 4ERDA 4F3MA 3HZGA 3O5TB 2QLXA 3RB6A 2UXDK 2AYEA 2CIMA 2CDQA 2XO7A 5M1OA 1HNWJ 1S10A 4WFZA 2XRIA 1K8AT 4ZCIA 1FDBA 2N3LA 3Q8VA 3MCNA 5IV3A 2IJRA 3C3LA 4A59A 2E1PA 2XB2D 4K8RA 3PG9A 1WUAA 2KDOA 5J2QB 4F02A 2JWNA 1ZA1B 1PO6A 4QYZJ 2PSZA 3CPWR 4B3TF 1FTCA 4C8LA 2NRTA 4J91A 2P9IA 3OHRA 4M5KA 2VOOA 4KV8B 3ZX3A 3GBTA 1F60B 4EMDA 4I2PB 3OTOK 1OMSA 3CCRS 4JHDB 3P31A 3SAFA 3I0SB 2ZGZA 3M30B 4ECUA 4ZITA 4R8UA 2ZZNA 3ID6A 4FM2A 3PIPQ 3IBFB 3QEWA 2DPIA 2Z58B 2C2EA 4CQ1A 4CM0A 3UQSA 3JAMO 2YNHB 1QVGR 3DOKA 3VALA 3Q86A 1SZ2A 5ADXA 2ZJPL 4LF8K 5KG2A 2CZ4A 3H45C 2AA4A 1ATRA 3QFWA 3O9SA 1MWQA 5JUMA 3UO0A 3MEEA 3GFXA 5KFZA 4Y2IA 3TEGA 4Y1CA 3TAPA 4RBTA 1SKRA 3MR3A 3NNHA 1SQEA 2EWHA 3N9UC 1S6OA 4H0XB 3IR5B 2JEFA 4DR7K 5E3PA 5L1LA 4LBPA 2QWPA 4M3WA 2OEMA 3WC0A 3GIKA 2E88A 3KTQA 3FEZA 2D0BA 1U48A 4JI4F 2VC1A 3PEJA 1HD1A 1RAFB 4EO6A 4C0HA 4MIBA 4PXBA 1H38A 1FJGJ 3A8EA 2QI2A 4FN5A 3L4IA 3GJQB 1RBVA 5HRNA 2VC0A 3Q8QB 4Y0WA 4ALZA 4LR9A 1S59A 5A2QU 3HXMA 2DH8A 4RBVA 1X7VA 3Q24A 2OEKA 4USJC 3MHYA 1BIZA 2AT1B 3B82A 3EJMA 4ECRA 2XYHB 2PA3A 1HYZA 1HLUA 3CJ9A 2XHBA 2FHJD 2HVHA 5DQHA 3KLFB 3TTCA 2F8HA 5LMNF 1BQXA 1HNXF 1BWFO 3FGVA 2ZBCA 4NCBA 1HW8A 1U1LA 2IVFB 5ADZA 3DM2B 1RDBA 3EICA 1LFWA 2VL1A 3SLCA 1JL2A 3NL0A 4WQ4C 5HQLA 3MAAB 4I1TA 2YWKA 4FDFA 1WAFA 2CZVC 2VZ9A 1H73A 2YHWA 4DV2F 3TI0A 5JJBA 4ZKAA 3KK3B 3LANA 1VQ9S 5AZIB 1F1BB 2DJWA 3P5JA 3M1FA 5CCLA 4B3SJ 4ZVOB 3HSZA 1FXXA 3ENAA 5JS2A 3PXGa 4PUOA 2DNMA 2R7TA 4W5QA 3D45A 4BRKA 3AB2B 1D9AA 4ZJQA 3AY9A 2VQFJ 1TK5A 2B6AB 4FJGA 1IH7A 4ISEA 2BRLA 2JFDA 4KHQA 3UDCA 1R8CA 4RW4B 1TUWA 3A1YG 4O44B 1RGVA 1BA1A 4LFAF 4FL9A 3VAGA 1RT4A 5SWMA 1TMMA 4DZDA 4CF2A 2JC1A 3QGPA 1WKJA 3KNGA 2LVWA 4DTXA 2A1BA 2LP4A 3LP1A 2AMCB 2K8GA 1H72C 4K43A 4M3RA 2E1MC 1S22A 2HF3A 3GZ7A 4BRFA 5DM7L 3OBIA 1S1XB 1QHTA 3LM2A 2UUAJ 4BRLA 2QMWA 2P9CA 3H4BA 3V6KA 2CPEA 4GKJJ 4LF1A 3DNCA 1ZAXA 2LA6A 4LBIA 3CC4N 1IBKK 1M1KO 4EZ6A 1A5VA 1N36F 3VGKA 1S0NA 3T5HA 3VN5A 3GFYA 3UE2A 1KOOA 3MN9A 4WKYA 1RWXB 4IYQA 2F65A 2J7UA 3UVJB 1HA1A 1RBLA 4YHHF 2LEAA 3CB4A 3IAYA 4YDUC 1DT9A 1T8EA 3O4WA 3E3XA 2CNNB 4X4OA 2IDLA 2VFUA 4FF3A 2YH0A 1C0MA 4BG9A 4H4KA 1NGIA 2WTFA 4QZVB 4HEA9 2UVWA 4DX6A 4H4KC 2RH3A 1CULA 1JB0C 4Z4HA 3QO9A 1QQCA 2P5OA 4Y2MA 1S6PA 2K06A 3FFKB 4NO7A 1FFSB 5BYQA 5D4NA 4DR2J 1GXUA 3FBEA 2IDOA 4QW8A 2BR0A 3DXSX 5EY4A 3W65A 1XMQF 3ZXWA 2EFPA 4FJ9A 4DL4A 1KC8O 3F2KA 4C0BA 1X60A 2XY8A 3JS9A 1DHMA 2VYPA 3RRHA 1NGHA 1VISA 3CIMA 4L73A 3THWA 5DRKA 4OO1J 5TKYA 2J9EA 2QO3A 2V4RA 1WC4A 1VRTB 1FHTA 2HNYA 3OYBA 2R8JA 1IG9A 2ZJPQ 4JV0A 4DUZF 5CYMA 2CADA 2CVEA 3BO3A 2E8AA 3HVAA 3RWUA 4ZVFA 5ETOA 3J8AA 2L9DA 4X62K 4O3QA 5AFUH 3D1HA 3ZCMA 2IS3A 1IO2A 1VI7A 4S0MA 3T3FA 3HTVA 4YP3A 4PG4A 3C15B 1RTIA 2R8IA 4GC7A 4IBNA 2YHBA 4TSXA 2LQJA 4FNIA 2MQOA 1KNZA 2HFOA 3DJCA 3M4XA 3IP0A 5ELZA 2MKJA 2BVZA 4BWMA 1RLDA 4AHCA 4OPAA 3CW2C 3B54A 1YTUA 3GG1A 1YF5L 3ZSWA 3W9JA 3GONA 3SUNA 4CIOA 1CSJA 3C2PA 1D09B 4D3GA 3DLBA 4BC3A 2DO0A 3OY9A 4FPBA 2RE2A 1LV5A 1N33F 4NXNK 3PYFA 1R8AA 3MEDB 3R3LA 1RU2A 1FNXH 3PYEA 2DFHA 3VAKA 3ZYYX 3K5LA 1RBUA 3BPSP 1ZH5A 2OPQB 1UJ6A 3JXOA 3U1NA 5C25B 2HVZA 1S99A 5AZJB 1TKTA 4HYKA 3SQGA 4E7LA 4WU3A 2ZBIA 4ZVGA 3R8EA 2QL5B 2E5GA 2PAVA 2PD1A 3PHTA 3G6YA 4JV2A 3HKZD 3M32B 3VAFA 2GUIA 3NEKA 2V7YA 5ETMA 2VOPA 3L4QA 1VQ7S 4CZJA 4Z7CA 4CF9A 2GC8A 1WKLA 3MPYA 4IRKA 1EETA 1VQMS 1PSDA 3UB5A 3D6FB 1G99A 1NKEA 1KC8T 2DNLA 1YKWA 3UCZP 5A2QO 1VGYA 4G1PA 3GMGA 5GADU 3X1LB 2YNFB 2BW2A 4CEOA 1OQ3A 4CJQA 3WNEA 2X3DA 4F4WA 1RAHB 1T9YA 3OTEA 5HL7L 3R9LA 1IBLF 4FCYA 2KLAA 3OW2R 5EWGA 1KVKA 1BI4B 1NMDA 3OPKA 2KI2A 1AYEA 1WSFA 1O13A 2VG7A 3QJLA 1BC6A 1Y64A 2HQDA 2VFRA 1YJ9N 2W01A 3E1YA 4L3KA 2VKZG 3H46O 2HAIA 3IWXA 3W2VB 4DTNA 2HG4A 3L2WA 1RABB 1S12A 3AVKA 4CESA 4FF1A 2WBRA 2V67A 3CQ8A 2BABA 1NPRA 4B1YB 3G6ES 1IBCB 1TUUA 2MKCA 1C0TA 4ZN3A 3KLGB 3QGGA 3DLGB 4CZLA 1PG5B 2E2OA 5CD4A 2E29A 1XR5A 2Y3YA 1IJJA 2G4BA 3C16A 3VQEA 1Y10A 2ASLA 2J76E 2M0GB 1RT3A 4NCGA 2UXCK 3UD3P 1U2VB 2XMMA 3KJQB 4CO5A 5L46A 1JNRB 1OQ6A 3RAMA 3PKYA 3CJ8A 1Y00A 1CJUA 4A8YA 1X4EA 5HK4A 1QDUB 3ZT4A 4EYHB 4URQU 2GNKA 1KQGB 2KFZA 3UNGC 3MMAA 4NYOA 3TO8A 2MGZB 1R3NA 5FROA 5HBMB 3SBMA 2MKIA 2OPSB 2WOMB 1YX2A 3VQAA 2D9OA 4EP4A 1YBTA 1HUXA 4OPJA 2AYGA 1QTMA 3HLUA 1NDKA 1VJQA 2UZAA 1I39A 3VF0B 3GSDA 3HM8A 4IEEA 2FBVA 4KHNA 1S5ZA 4X4QA 4AL5A 4ECXA 3UKUB 2QWNA 3SYZA 3IGVA 4B3MJ 1P90A 1BUPA 1SV5B 4CJVA 1KEKA 4KREA 3WQTA 3D0PA 1S1UB 1NGJA 1V3RA 1KQSM 1RFQA 3IAM9 1PC5A 3KJVA 1CC7A 3TWHA 2HRTA 2RRAA 2DISA 2MDAA 4LT6A 2JGUA 4WTYA 5AQSA 3LP2B 3EMTA 2YXLA 4CGIA 2NUUG 5AQZA 2BE2B 2Z1IA 2RUGA 3W5YA 4OYXA 4OKKA 4DR3F 4X64J 4OI1A 2K3IA 5KRSA 4CLTA 2NLXA 4Q45A 3S8SA 1W25A 3RRKA 1ZBTA 4M5MA 2I8EA 4KYZA 3BZCA 3SI6A 3MCPA 1CEZA 1C0GA 3TAMB 2CQDA 1MMNA 1NBEB 3MMCB 3NGDA 2ZOMA 3PX6A 5FJ4A 2G0JA 3I87A 1CPZA 3N79A 1IBKF 4BE0A 4JI8F 3ISNC 1ZAWA 1LEOA 3A5NC 4LC9B 4B9QA 3H0PA 1YBUA 1EZZB 4DUYK 5AQVA 1TZ0A 3PJWA 5L9NA 1JLQA 4CDIA 4M7YA 1IKVB 2W7PA 4ED5A 3CERA 1UVLA 1S97A 4YB7A 1WKKA 4AM6A 3T41A 5DLGA 4AD6A 3ZSQA 4EBDA 4K8ZA 5HROB 5KFLA 2FVPA 2AYMA 1WN7A 2ZM6K 4LBHA 3OFGA 3JTOA 5C10A 3N4PA 2O1PA 4JKEA 3CULA 2XG8A 2ZZMA 4HH0A 2LMIA 1HNZK 1Z25A 3E66A 2AJFE 1EJ7L 1RI7A 1FVQA 2D3OR 4GV6A 3OSPA 2K2PA 5AQJA 5G0RB 2C2RA 2NXNA 2QTDA 2IIHA 4KC5A 4B8CA 2PC6A 3L4BC 4Q43A 3JSYA 3E2EA 2GZOA 1PAUB 5E84A 5ETSA 2O8BA 4YN3B 4MO4A 3C65A 3CCJN 1UEUA 2VWJA 4MT1A 3KUGA 2Z57B 4GMJB 2Z1HA 2CQCA 4Z4EA 2E1CA 4GVLA 3U9ZA 4USWA 2R8KA 4CYUB 3LPTA 3CF5L 3SUOA 4JYAF 2CH5A 3R97A 2EC2A 3CI5A 1XMOK 5GAEU 5BXIA 3AO4A 4WFNL 1WDTA 4CFDA 4X62F 1M0SA 1L3VA 4PG7A 3VGLA 1DQ9A 1X3NA 2YKAA 2RE1A 1ASWA 4PXDA 4P75A 3CFOA 1ILYA 3CT9A 5E3RA 5I3UB 1JLAB 2OTJN 4DV0K 3OR2B 1WD6A 4KO0A 5HL7Q 3CCVS 2J8AA 3KDNA 1JJ2R 5A8RA 2IDEA 1QAIA 2VJUA 4U7UD 2C2OB 4LFBF 1OH6A 2MKKA 4MAKA 2M5YA 2GHVC 2PE8A 2JLFA 3J80U 2LXIA 1ZBLA 5B0GA 1J27A 1F21A 1HHTP 3NE6A 1T3VA 1HARA 4O0IA 1HBNA 3T19A 1QJHA 2OZSA 4PWDA 3KWGA 4WXOA 1U7LA 3QT5A 3AA5X 1YUWA 4USHA 4CZKA 3QIPA 4CO4A 5KGXA 2FJXA 4NRUA 3DXKB 1K8KB 1Q82T 1XJWB 2Z30B 4MKAA 1NOZA 4NXNF 3BEXA 4BE2A 2DRAA 5T7LB 2MKYA 1HYSB 3CSKA 3R5GA 4O3PA 4YUDA 4FLYA 2ADBA 1TAQA 4CJ5A 4DS5A 4ZK7M 4Z7YA 3MR6A 2GO8A 2N4DA 3M8WA 4L6V3 1KRPA 3PW4A 4HUGA 2R2TA 4TYBA 5IT9Y 1Q18A 1RHMB 3V9XA 4FZZA 5DDPC 4FLZA 2ZE2A 4DPUA 3OYKA 3AOCA 1AXQA 3SSQA 4YDXA 4YNQA 1H7XA 3CVKA 2BX6A 4ES2A 5M2UA 4LF6J 4JUZA 4C98A 4KTWA 3WXKA 2KL8A 3M1VA 1NHKL 3G8QA 2XSJA 1HBMB 3H5YA 1K6YA 3GJTB 5KPRA 2ZEJA 1VHFA 3BQ1A 5HATA 1BCMA 1HW9A 3KHYA 4F4ZA 1CJVB 2APOA 2HIYA 3MN7A 1QE1B 1REGX 4ES3A 3FMBA 1U1OA 3IS9A 2QL9B 3KLEB 3CQXA 3FQLA 3ENQA 3FCHA 2GEMA 4CT8A 4A46A 4NPOA 2PIIA 4KB0A 3R5JB 2F3JA 3OYGA 1VSFA 3CIZA 3JYTA 3CCRN 3IR7B 1TL1B 1HQEB 3VQ8A 2HB5A 1MROA 1YJVA 3BR8A 1UW4A 1HBOB 3B4MA 4DV5J 3HHDA 2GWJA 2ZD1B 2GUPA 3SSRA 5KFEA 1FEHA 5KFXA 5BPLA 4OX6A 4OL8A 4OGEA 4RWTA 2MZRA 1NAQA 3M8ZA 3UR3C 4CJTA 1PYOB 3NF9A 3M5RA 4BQLA 2UXCF 2I5JB 4UOHA 3MXMA 1UAWA 2DCUB 2VPYB 4DLGA 4KGKA 2DR5A 4A5AA 2LLZA 4K4XA 4QQBA 3AO1A 1IV0A 1SJFA 3AGKA 1X5TA 1UZDA 2UP1A 4PL8A 3A13A 2UUTA 3G6XA 1XNRJ 5BREA 5IT0A 1UTAA 3CJQA 4WZMA 2W2QP 4B9NA 5AJ3J 3IXQA 1T3OA 1SKWA 4ZJOA 1MN7A 3QJPA 4MIWA 1S9GB 2XNQA 4Q0BA 8ATCB 3GV5B 1TKZA 1E6VA 1YXQA 4H54A 3ZSRA 2KKHA 1N54B 1RQ0A 3I82A 4WYWA 2O8EA 3OVBA 3M3ZA 4JRQA 1NZ8A 2V2VA 2KG0A 2Q1NA 3NGTA 4CVNE 3J7A1 4UOCA 2W40A 1KQFB 1NK9A 4OJGA 3Q8YA 3PSIA 1LWEB 3AARA 2Y0BB 4DSEA 1OPIA 2ZJQL 2AJ4A 3EO3A 3VF6A 4RW9A 2V68A 5AQTA 2J9DE 3OW2M 2C2MB 4ZPVR 4NZ6A 2HNDA 2ZVSA 1LAWA 2PO4A 3ZSVA 4MMOA 3D0HE 2CJQA 2BYCA 1SXLA 4JI7K 4GC6A 4JI6K 5EU7A 2I7PA 3DI6A 2WSEC 4RUCA 1S7HA 4RUAA 3L9ZA 2G2OA 2IPOB 1U0SA 4CGDA 4O4GA 3SV4A 3CF5Q 3DLKA 4AHRA 3TU5A 3ISND 2YY3A 3VTHA 3TA1A 1FJEB 3H98A 4NLVA 4LR7A 1U4BA 4EIAA 2W8LA 4WFNQ 4DQ8A 2B4OA 4DSKA 4AXJA 1UVMA 3U3GA 3FCWA 3U27A 3CJ4A 5TKWA 4U8VA 2AJ1A 3KYLA 1TAUA 3POTA 2AP1A 1N34K 4ZP8A 2X6SA 4ZPCA 2A2CA 5DLFA 2R7WA 5C12A 2VCPA 2KRRA 4TN2A 5JMNA 3W62A 4FWRA 3F9KA 1U2FA 4LJMA 1OSCA 2ROGA 3PV8A 1V4TA 4K59A 4U7BA 1DKGD 2B56A 1NPKA 3LALA 1VQNS 1NMNA 2FPHX 1RZMA 3VCDA 2OSRA 4WQ5A 2V4QA 3O9QA 2QFIA 4CZMA 1RWPB 2NRZA 2CJKA 4RJVA 1RAAB 4A8XA 3HRGA 2L9NA 1NSQA 1TL4A 1S6QB 4KKOA 4GVMA 2QLJB 4ZS6A 3IRXB 4DHYA 3B8HA 1JJ4A 1W7AA 4DZ6A 1L3UA 3P6YC 3MECA 3CMAS 2A3ZA 4U96A 2GHWA 2E5LK 2P9SA 1S4FA 2HHQA 2HBYB 2HQCA 5KOWA 2WFBA 1Q7YT 3S9HA 1Y97A 3J80O 2QA4S 2DIUA 2EX3A 5HANA 4DOZA 4JI5K 1B70B 3GIIA 2YI1A 1WG5A 1N5TA 1WHVA 1WF2A 3WQUA 5CYQB 5BR8K 4DCPB 5HVGA 1HKBA 1OY8A 4FJ7A 3NKYA 3FDSA 3JQMA 4NZ7A 2PFFB 4DV0F 4EYIB 2W9BA 2ZHOA 1NO8A 3C6TB 1LWCA 3U02A 3QETA 2H3GX 2A5XA 1QQOA 3NH2A 4NEZA 2HHHK 4LF5J 4LSNB 3CJ3A 2A10A 3M2RB 1HWKA 1ZS6A 3DOLB 1B0TA 1Q9XA 3GE9A 2A6OA 1WORA 3AVAA 3V1RA 1UWAA 3LGNA 3CJ7A 1BO5O 4CJ7A 2H9ZA 2GJIA 1VBXA 3CC7S 4NLGA 4CJRA 4BY9C 3BZKA 3GV8B 5ETRA 1GMWD 4YOWA 4ZLJA 4NLSA 5A8WA 3DWLA 3IKMA 1VRUA 3WEEB 1FX2A 4DR6F 3CPEA 1C1BA 2A18A 3WXIA 2DR8A 4I6WA 3B8AX 1EQMA 2UUBK 2BA9A 2B3TB 2QA4G 3KK2B 4I2PA 2VWKA 4BR5A 4JHDA 3U6FA 3MDQA 2L9WA 3M30A 1GMVA 2LDIA 5KFJA 2AW0A 1UW9A 2F7TA 2OD4A 3T9NA 4H4MB 3MXIA 2CA9A 3MTJA 2YNHA 4LFCK 2CPJA 3TJ9A 4ELVA 5ADXH 5CE3A 1P1TA 2V0NA 3PYGA 3KHHA 3Q89A 1Q53A 3CDEA 1NGCA 1HRHA 2EVZA 4FXWA 1VCTA 1T9WA 4MDAA 1NK4A 2QYGA 1U8WA 3G10A 1YITS 5IT9U 4PEOA 1KOHA 3PVXA 5B08A 2GFFA 3TX0A 2EG2A 2QLWA 2XNRA 1RT6B 1LQ9A 2KFYA 3T5LA 2RVJA 4CO3A 5KFFA 3C0BA 4P7TA 3TWZA 2RU3A 2B5JB 4CHNA 2AEFA 1ITGA 3C94A 1GEHA 4BVOA 2P6SA 3AO5A 1JJ2M 3ULEA 4F0MA 2QV6A 1U1MA 4C8ZA 4UUWA 4AQYK 2VG5B 3NGSA 2OGUA 2GWKA 2J9CA 1JLEB 1UVNA 1NJZA 3AJDA 3KG4A 4YDDB 2PGCA 2BJ1A 3IWLA 3CCMN 3EY1A 3O9TA 4WFYA 4HTJA 3I8BA 1FWLA 5LXYA 1SQGA 4IRCA 5J1NA 4B3OB 5ETNA 4F2SA 4A8WA 2KRBA 2LKZA 5B0CA 2UV8A 2CPFA 4AL7A 2FHOB 4OPKA 1VQ7N 3UKRA 2VFVA 1WF0A 1Q95G 2F40A 4C48A 3SCLE 4J9PA 2BM0A 3PYDA 4KH0B 2VBXA 5KT7A 3CD7A 5CR4A 3WXMB 5HVFA 1G1XA 3OFEA 3KLFA 2F4VK 5SZTA 1XIQA 4C7QA 1EIYB 1S5JA 1I94K 1WEZA 2H51B 3OLBA 2NYHA 1RWVB 4N41A 4EU0A 3ETOA 3W0LA 4WZQA 1KD1T 4M5NA 1J6ZA 1N8RO 1RAJA 1CXQA 2QA2A 5HLFB 1DTQA 5BPNA 1IKWB 4LVOP 3FUYA 4L75A 3MAAA 3MWTA 2IRYA 2Q6BA 2CQGA 3TZXA 2KT5A 1EHWA 1WOOA 3KMQA 4CGHA 4FO0A 1FX4A 4EGLA 3THYA 3AXMA 4ILMA 4EP5A 2O01C 4ZVTB 3UDVA 5AZIA 4NYNA 2VJVA 4PL7A 1ICEB 3ZZ0A 1C4CA 2F8EX 4MK8A 2R7XA 3G6EN 4O8KA 4CEQA 4CO1A 2ZUGA 2BM1A 2QW9A 1XN9A 4JD2B 1RWNB 4B3RF 3G8SA 1D9DA 3GV7B 3R6MA 4LSZB 2WBNA 2ZKTA 1I51B 3ZT2A 2MQPA 3VAHA 1TL5A 2HNZB 3IM9A 1YHQS 1YRTA 4JI6F 3BN4A 3CD6S 2M52A 4TU8A 1CQNA 4B3TJ 3KJNB 1U49A 4DU8A 2HAFA 2XLKA 1X4BA 4KHMA 3ITHB 4QWEA 4OYBA 1UOCA 3IFRA 3NHGA 3RB4A 2DNZA 5F8MA 3W2WA 5HQMA 4LF9K 1YDLA 3SJHA 5KFRA 1S79A 2B9WA 2P9GA 4EO8A 4DG1B 2E1AA 4QIFA 3CCSS 3BDPA 4E19A 2F96A 2O5DA 1N34F 4CNYA 3IR6B 5CYJA 2CQ0A 4MFBA 1U47A 4LF4J 4BC5A 4CI6A 4LRAA 4OHWA 3K2YA 4XH1A 4UY8T 1YK9A 1F6TA 3GYNA 3UVJA 4DL2A 4M5HA 3DMJB 3OHBA 2HQ3A 2M8DB 4FZYA 1PYTA 3CDAA 3MPUB 1XC3A 3HVRA 4CJ3A 3BSAA 4HTLA 2AKWB 1N8RT 3MF5A 1EXQA 2BV3A 5F9LA 3VQ5A 4G65A 3AB4B 5KFIA 1DBDA 3UDEA 1TV6A 2CQ3A 5D4LA 3FZHA 5KFCA 4Y1DA 1XWLA 4CGJA 1QZ6A 4L8RB 2WSFC 1F5BA 2M2BA 4JI4J 3QWUA 4HACB 1VQ8S 4HVZA 3H1QA 4X4VA 1PBUA 5KT2A 4AE5A 2E5LF 3PSFA 1Q86O 1JQGA 2EI5A 2DXFA 4G9ZA 2YNGB 3TJAA 3FBBA 1F0XA 3V9SA 5ETPA 2NR0A 3F44A 1O6XA 4KFBA 3I55N 2FF6A 5KG5A 1NK0A 2QRRA 3D1OA 4JI5F 3QGIA 7FD1A 4F0KA 4B9TA 3GJRB 2Q6CA 5AQUA 4CW7B 2DH9A 2UU9K 2HVIA 3Q2SC 1EAYC 2FY1A 3QMLA 1ATNA 1N5QA 1BG3A 4R25A 5KFMA 1KVJA 3VESA 3TAEA 3OVSA 5IS2A 2WW4A 3US5A 5KFBA 5BR8F 3Q83A 1S9FA 1WWHA 1P27B 1QHAA 1B0VA 4B9VA 3SMZA 4FXVA 5LMNJ 1HNXJ 4W4MA 1VYAA 4DQSA 3VTIA 4F04B 4RU9A 3ENBA 4ID5A 2DY1A 4FBUA 1LCUA 2BKPA 2GMLA 4IH6A 4CRJA 4K25A 1HPMA 1D8YA 5MLCQ 2KM8C 2QFJA 2UV8G 4N76A 1RTJB 2R7VA 3OTBA 2CRLA 1S76D 1N32K 4OYZA 2KB2A 5GIPA 2X7IA 3TUJC 3OYNA 2GHPA 4C1NI 1S9EB 4M63A 2CWKA 3G2XA 2P9UB 3ZO7A 1VK8A 3PACA 4ES1A 2NREA 3WXJA 2FJDB 5FDLB 4WYLA 5HMYA 3SQ1A 4X66K 3GLJA 2DR9A 1GX6A 2QEXS 4GO5X 2L48A 5CH7B 1X1PA 5IT9O 4I68A 1NNDA 5M1PA 3PUFA 3MEDA 4JAXA 2UUBF 2RF2B 2CJ9A 4F3OA 2R7SA 5AQHA 2J6SA 3EXYA 3U4LA 3KNAA 1IQZA 2IM1A 5DO2A 5C42A 4LFAJ 2OPQA 1BU6O 4CEAA 3H4DA 4CLYA 5C25A 5A6PA 1IM6A 1FWPA 5AZJA 4A47A 1CJTB 4E3SA 4ZPWR 2U2FA 1X9SA 3OD2A 2DGVA 1M1GA 1JCGA 2O8FB 2HBJA 2OD6A 5K8NA 4UY85 3M32A 4X4TA 3VQCA 2X74A 1NOYA 3NNAA 1IBMK 1FRHA 4LFCF 4WCEQ 4N47A 2NSBA 2LSNA 4ELUA 5I4MA 1AFJA 2Y8WA 3QICA 2OELA 2DT9A 3OBYA 1EX8A 3R7NB 2UXBK 1RWOB 3HK2A 2FVQA 1N36J 1YSJA 2WK4A 1LW0B 3BKTA 2EBGA 1FJGK 4LIRA 3QYYA 4FLVA 4PYAA 4B9MA 3ZETA 3LH2S 2BKNA 2CDRB 2YKMB 1UA0A 5MAOA 4YHHJ 3H08A 1TL7B 2HBMA 3V9WA 2XLJA 4M3YA 4LREA 5KRTA 3QDKA 3LOUA 1R6YA 2M8HA 2PN6A 3JAMY 3M8PB 3ZTPA 1YVFA 2YWGA 4F0HA 3JXUA 2K1RB 3SDEB 1VSEA 1S57A 5EWFA 2OFGX 3C7NB 4FJ8A 2ZH1A 1YWXA 3KLGA 2XMTA 2LYVA 3HPHA 4M3UA 1VJWA 1T95A 5GAEI 4DSLA 3KVGA 3EGNA 1Z2LA 3BS9A 3GFHA 2QZ8A 1TP7A 3SJJA 3JTPA 1GQEA 1JCEA 1Y3JA 1XMQJ 4NL5A 3LQVA 2KYZA 4PKGA 2FXUA 2F4VF 3N5FA 3O9UA 1U2VA 4KH1B 1QM9A 1WBBA 1OJ4A 1I94F 2XY5A 2ROPA 3CTRA 3ZC4A 5F41A 2DYAA 1VQ5S 3F56A 1TKXA 2DGQA 2J7KA 3TEHB 4CJEA 2X51A 4DUZJ 1FKPB 3TZWA 1U09A 3ZZRA 2MJNA 3MWPA 1RISA 1ESVA 3AA4A 3HHLC 1RACB 2MGZA 2Z1JA 3PJ9A 2OEJA 3AA9A 5HVHA 5HBMA 4DL5A 3R9PA 2XC9A 5FD1A 1GMWA 2VQFK 2Y0SD 4J9MA 1Y5IB 3VEVA 2LXUA 3A2FA 3MCAB 4K0KK 3NMAA 3P83D 3GOIA 3K5MA 2FVRA 2FJWA 2IVYA 4E8UA 3D66A 1DRZA 1G2EA 4OZ3A 4CHYA 3UKUA 1SPBP 1SBRA 3W1YC 3CJAA 3P96A 2DGOA 3T6BA 4U6PA 1SV5A 5IWAF 1Y4ZB 3CC4S 4E89A 2FC9A 3P5BP 4FK2A 5AQKA 5AE1A 2QA1A 5J2PB 1NM1A 4CHQA 2EFQA 4KHWA 1S1UA 3JSRA 4FJLA 1YVNA 3ULDA 3MEKA 5DDRC 3TA2A 2R7RA 3H40A 2YKOA 4NRTA 1DEJA 4O3RA 3SAHA 4PA1A 1N33J 1VQLN 4GKJK 4DTUA 2BE2A 4JKCA 3CCZA 3V1QA 1S72N 1HNIA 1N5YB 1SQFA 4BR9A 2NRVA 2RS2A 1X0PA 3P1GA 3T1AA 2JEJA 3IM8A 1FRJA 5IC6B 1GLBG 2FGCA 4F36A 4WK1A 3KZBA 5AE2A 4JI1K 1VBZA 2LU2A 3VEWA 3MMCA 3TYTA 5AQMA 1AZSB 3PW5A 2DIVA 1ITPA 4FS1A 3CCUS 3UI3A 3CUNA 1QS4A 4ZDNA 2AJ0A 2G2YA 3UCUP 1I5OB 3ULHA 2HVDA 1NDCA 4ICLB 1IKVA 1NSPA 1SC1B 2I38A 3N6NA 2P9EA 1QUPA 3DFEA 4DX8H 3IG1B 3MDFA 1MWKA 5EVZA 1P9YA 1IBLJ 5HROA 1W7WA 4QIGA 2RDIA 2HBQB 3LM9A 2FBTA 4NLUA 2B4UA 4CIFA 4DR2K 3PR4A 1K47A 5JMVA 4FSVA 4CK1A 4WF9L 2NXCA 4XK8C 4CGFA 2ASPA 1RAGB 1X31C 5GAGU 5CHIA 4V19X 2ZH6A 2HW3A 3L6QA 1UFKA 2FJAB 2G9OA 4OJ3A 1PJ6A 2W2OP 1VIOA 1VFJA 1MNEA 3SPYA 1KDNA 4P9SA 3K0JA 2OCEA 2E7VA 1RCHA 2HFNA 4CLZA 1ZA2B 3VWSA 4CYUA 2YV0X 1TFYA 2EKNA 3LDQA 2OZMA 1W0HA 2P5VA 1RHKB 2KTQA 1G7CB 4QS7A 4URGA 2RQCA 4I56A 1RSCA 3TQ1A 3WX8A 1NKBA 3LPYA 5JXSA 3TJ8A 3CHWA 1VQNN 2VG6A 2CG4A 3EDRB 2FC0A 4CBUA 3IUCA 4QJVA 2CQ4A 2WVBA 5I3UA 1JLAA 3WBZA 5L8RC 2BRKA 2D3ZA 3QNNA 4DV7K 3VR1A 4BHQA 1NK7A 1IM4A 1BD6A 4CWBA 4C1NK 4DFPA 4RBUA 1R89A 1N32F 3J81j 4P2XA 1VQON 3VQTA 3Q22A 4XTTA 4BROA 3RMDA 2G13A 4Y0FA 1U8SA 3OYIA 4AHTA 2RMLA 2KXFA 2XZWA 2MZQA 4PCQA 4K8XA 3ILJA 1M90O 2Q36A 4X66F 5L39A 1NDPA 2WB4A 2L3MA 5AQOA 4OYIA 3DXKA 5A8KA 2HMPA 3A5LC 1T11A 1JLBA 1HPZB 4W5TA 1IWGA 2NPFA 2RN2A 3CO0P 2GAHC 1VSLA 3HOSA 4AHVA 4DR5K 3L7UA 2E66A 3DRRB 1E6YB 1UCNA 3FK4A 5HMZA 1NSKL 2NRRA 3RJMB 4W5OA 1FRLA 2YWEA 4Y6IA 2A42A 2Z0GA 5C24B 3BSNA 2XS2A 4V19S 4I7FB 1S77D 3NDKA 4WFXA 1SCJB 3BBBA 3D1QA 4IG0B 3X3UA 3DRPB 4YMEA 4DR3J 2VODA 3MXJA 2AZ1A 2W4CA 1YJ9S 1IBMF 3V4IB 4FLWA 4QWBA 5E3AA 2ZQBA 4G3IA 2CUYA 3EL2A 2MB0B 1MWYA 5LM7E 4JKHA 3ZTOA 4Z94A 1HBMA 2UXBF 4ZPBA 1IBKJ 4JI8J 2MKHA 1ELOA 4RWXA 2WB1D 3A5MC 2KYXA 1VR6A 3MM6B 2VDIA 2A2DA 4O5BA 1P1LA 5EUHA 1CJVA 4IOXA 3EYZA 3IDHA 1QE1A 2GMHA 5AQNA 4ZVHA 4H5RA 4HKQA 1FO1A 4QOTA 3MM9B 4KHSA 2QK9A 4HL9A 3ILLA 3J81Y 2HWHA 3T1YK 1Y0HA 3DRYA 4Z4FA 1CC8A 1J5EK 5AQFA 1C0FA 4Y2AA 1NGBA 3QZ8A 3R1HA 2L41A 3I5BA 1JLCA 3W9IA 2QX0A 1FXLA 3V9UA 2GV9A 3C66A 4K50A 3D2FB 3ZZPA 3BB5A 3CJSA 1HQUA 3KFWX 1TL1A 2IHR1 1HQEA 1MU2B 5A2QY 4JI2K 1K0TA 4KGXB 1HBOA 4YFUA 3AVFA 1QUVA 2BEFA 1L3TA 4OZ5A 4LF7F 4GV3A 2HGMA 3NS5A 5EWEA 1K0VA 1YRUA 4Y28C 5M2RA 2ZHBA 1Q78A 3U1LA 5KFSA 1KLMB 3EVMA 2HK3A 2KZMA 3AOBA 2LEBA 2YWHA 1IR2A 3HHLD 2E7WA 4C11A 4P52A 3VQ7A 3MOZA 2XYGB 3BKUA 2GELA 4ZLPA 4JYAJ 1M1HA 3I32A 4Q2LA 3L95X 4J9UE 3QPIA 3H1VX 3PO5A 2Z2MA 9ATCB 1Q5VA 2RIJA 4DR4K 4X62J 3ZZZA 3D7EO 1I3AA 3E01B 5D0EA 4B17A 4A8KA 2BMBA 2O66A 2CPDA 3GG0A 1S9GA 3L8BA 1YJRA 3SNNA 4K0KF 4DR1F 3ALYA 1R8HA 3K9JA 3IC1A 1S1VA 4E7JA 3G96A 4M41A 3QSYB 2EC0A 3CGIA 5K9FA 4LFBJ 4ED3A 1LWEA 1F2GA 3NF6A 1QSYA 4WF9Q 4KJIA 2RQKA 2GCFA 4RR5A 2OFHX 3MZIA 3I33A 3HYFA 1WSRA 2ETJA 2D0CA 3GWCA 2LFVA 4Q2MA 4X64K 4K5SA 1KCFA 1VSKA 2P2CB 2V4JB 1RDRA 3AH6A 2VA3A 3AQPA 4R8UB 2BQ3A 4CLFA 1HWUA 2KFNA 1MDUB 1J2VA 2MMYA 2HBKA 4NXNJ 1X5OA 4KGMA 2FHKA 1TUVA 2B43A 3RR8A 4J2AA 1RT2B 5B0AA 4Y34A 3HI9A 4B02A 4NXMF 2EW9A 4NLBA 3S41A 2C3MA 2YJFA 2X1GA 1PIEA 3I4HX 3NGIA 1EX4A 4JI1F 3D7SB 3MEEB 4OYAA 3U3YA 4USKA 1VSJA 1AW0A 5M1FA 3QBWA 1UPPA 4IOBA 3CG7A 1O5JA 3K5OA 4C8YA 4RUHA 2D1KA 4J90A 2CJAA 1NK5A 1QVFM 4L3QA 2HEKA 2IM0A 3MR5A 3J7YP 1BHLA 5FLXU 1FT8A 4JK9A 3CCJS 4OIXA 4A2AA 3H5UA 3M6UA 4U7CA 3RRGA 5M1NA 5DG7A 3QIDA 5HJYA 3QQCD 2Q0RA 2VBYA 1OY9A 2B8PA 2BZ2A 5HRRA 2NPIA 2CG8A 5C0YA 1S1TB 1N48A 2F8TA 1TYQB 5LY3A 4PXEA 2L08A 1BA0A 3CXCM 1YHQN 2VB6A 3TR8A 2BKOA 4F3TA 1TTHB 4OJRA 1HR0K 2OUGA 4TQSA 3WZ0A 5AQRA 1S6QA 1Q81T 3SXLA 4OZ0A 2PDAA 3T1HK 2O8CA 1QSLA 3FE1A 3IRXA 3MPDA 4GRSA 4JBCA 2JLGA 2CVIA 3FMWA 2WVEA 3O08A 3HJFA 4UUXA 2PYLA 3CCSN 5JS1A 4DV1K 5GIOA 2HWTA 1URRA 4CJUA 1NG9A 3MTKA 3HT3A 1VK0A 1ZXOA 2QWLA 4ECTA 1Z4UA 1GNKA 1VRQC 4DSFA 3ZX2A 2G1HA 2FD2A 2UXCJ 1VQ6N 5K20B 5L9XA 3LPEA 2P9LB 4CJKA 3TVYA 3A3NB 1E4FT 4B9UA 3CD0A 1XK8A 3GCWP 5CYQA 2IC3B 1U0HA 3HFKA 4BCAA 1KN6A 1U2RA 4DV7F 3L7PA 5E5NA 3SMPA 2CAJA 2V9KA 1RJJA 2GBZA 3PM9A 1QSSA 4WE1B 4DL7A 4ZPDA 4HHTA 4LSNA 4JKDA 4FW2A 3B4DA 3P3DA 3M2RA 5M2PA 3TVZA 3RAQA 4EEYA 3DOLA 4AXIA 2G0IA 2K7KA 2HBLA 2XMVA 4FK0A 4B1VA 1OS5A 3HJVA 3OL7A 3J7ZO 2CJBA 3ZTRA 3PO4A 5EHHA 3FC9A 3RTVA 5LSRA 5H9EK 2BQRA 3AVLA 2DBBA 4R0EA 4FJHA 1JLGB 3BQ0A 4C2MA 1QD1A 2HHVA 1RWMB 3CJRA 1EB0A 3OS2A 2KT2A 2ZBRA 1ZM4A 4HHJA 3LP1B 1RWWB 3OYCA 3WEEA 4U9RA 2CJYB 2DNYA 3Q8SB 2C1EB 5C2DA 3OJUA 3V2UC 2KVQE 4B1UB 4DR5F 5M1QA 3CEDA 3MURP 1H2TZ 1ZM3A 5CA5A 4OX9K 3KK2A 4J9VA 3D9BA 3BF1A 4OYWA 2QL7B 1ATSA 4IDKB 3C6UB 2C28A 3W9HA 1FESA 4UF4A 4DQIA 4H8KA 2ZFHA 2F63A 1C1AA 2ZH8A 4M94A 4H4MA 2AX1A 2MY7A 1X9JA 4KB1A 2NXJA 3G6VA 4A5BA 2MSTA 5E7OB 5E26A 3W61A 1SL2A 5DETA 4CH1A 2J0SD 4A8SA 2YX1A 4IDHA 1U24A 4KTQA 1RAEB 3TAFA 2HLTA 5IXUA 2AHOB 2IMOA 4Z4GA 1VHIA 3M8YA 4GKKK 4MYUA 4RG8A 3T1YF 3LDPA 4Z2XA 1TQLA 4TY9A 1J5EF 4FBTA 4QIEA 1BMQB 1Q4RA 3TA0A 3QO9B 2QEXN 3ENOA 1S6PB 3BUZB 5HN0A 4RW6B 3OL9A 3HL8A 1SH3A 2LXFA 3M6GA 2PFUA 4JV5K 4FPAA 2PMZD 4NLQA 2YVSA 3BEGB 3MMBB 5K5MA 4OFZA 4JI2F 1H2UX 4O4RA 3J81U 2ABYA 4CFAA 4OZ1A 1AUSL 3L3UA 4LRBA 5DQIA 2AIRB 5J1EA 4B3OA 3R7SB 4C8OA 3L3VA 3KG1A 5CY4A 2JFKA 4ZIVA 4DV6J 1LWXA 2B9XA 3C95A 2XYPB 1S1WB 4J2EA 1SC4B 3TUPA 3G8TA 3VF4A 5AFUA 1WNSA 4C3MA 1GLLO 2M7SA 4FW1A 3NMRA 2P51A 4QPTA 3OBWA 3UDLA 2IA6A 3WNHA 2R7UA 1I1GA 1KFSA 3AD7C 1T9XA 1ACMB 2AGPA 3NGUA 4K4SA 4NCAA 4DR4F 3QFPA 4PG5A 5HLFA 2HFVA 3EGZA 2ILYA 3IFEA 1IKWA 2XHWA 3OQ2A 3ZSZA 1RBRA 4DV0J 4IKAA 4NEYA 2A3JA 3K59A 3AODA 2WVCA 1XERA 4E7HA 2X1BA 1HJOA 2QTWA 3DGPA 2F9WA 1KSPA 3DLRA 3CCLN 4J9KA 1SKSA 3QZ7A 4JOUA 3GFZA 1F2HA 3GYGA 4YB1P 3K89A 1R59O 4IZ9A 5EX3A 4FJIA 4JD2A 3ZSOA 4F9OA 3WX4A 3THPA 4X64F 1REVB 2DK2A 4FPIA 4PPDA 4CLUA 4E1JA 2DR6A 3D6RA 5FLXO 2DFFA 2P9PB 1OH8A 3SQGB 1JMTA 2P5GA 3RMCA 4JNEA 4X65F 1FDNA 4DKWA 2MHNA 4DR6J 4AUKA 3CM5A 2MQMA 3ITHA 1VQ5N 5KQ8A 1EETB 1SC3B 1RT7B 3CDWA 4USMA 4EZ9A 2DTUA 1N56A 1GOCA 4K42A 1XR6A 3E9PA 4NLDA 2COLA 4DG1A 1RTZA 2YH1A 2E7XA 3W60A 5ETTA 2OO4A 1W97L 4AM7A 5C2CA 4O0NA 1TL3B 3AD8C 2P8IA 2A1SA 2ZH7A 5AXLA 3MX2A 2DHXA 2ZOFA 1SVDA 2KO1A 2M3DA 2VQEF 3TSQA 3VZIA 4QR1A 3NMUA 2HGLA 3QBCA 1N6QB 1F9EB 3NCRA 2VUGA 2VG7B 3PKMA 2IGIA 3DMJA 2XMKA 1BQNB 3CYMA 2YTCA 2QWMA 4OJHA 2E2NA 3PDNA 1P6TA 3ZTSA 4FJJA 2ZH2A 3R1LA 3OYDA 3P38A 4NOHA 3MUTP 3TABA 4MQ3A 3H59A 4KHRA 4FKYA 3VGUA 2VA2A 4JB8B 1HR0F 2V52B 5F8GA 1C0TB 3RBZA 5AXKA 2M88A 4E1MA 5DJBA 3MEGB 2G0CA 4DV3K 3T1HF 1FDAA 2JSXA 3PW2A 2ZWHA 1YAGA 5JVGL 3SBTA 4CZEA 4HWIA 4UZBA 3SK3A 2FLPA 4LIWA 1SKUB 3C16B 3M7VA 1IR1A 1WSEA 2BUNA 4A2BA 4NCGB 5A6WA 3W64A 3P49B 2HWIA 4PWWA 2VGNA 1OVQA 2YNGA 2ZBQA 4BDZA 3HDSA 4DV1F 2HFSA 4CHOA 3W66A 4KPYA 1DQAA 3GSIA 4B8AB 2D69A 1KWMA 1SC6A 2B4JA 3CCUN 1FFGB 1UMJA 2JOQA 1VQKN 5JLHA 3S3MA 1A9NB 1ZPWX 5D4PA 4DN0A 3KUEA 1CBKA 1JXLA 3VGMA 4OLOA 3K0SA 4IFYA 3G71N 1XHZA 2LU1A 4I69A 4E7KA 1MA9B 1OO0B 4JKGB 2F1FA 2AX0A 3RMBA 3RBXA 3UFCX 3TZZA 4RLEA 2CYYA 2P9NB 4FVUA 4WP9A 5AE3A 2CQPA 3J80Y 1RTJA 4F7VA 5KFNA 3HBTA 2Y1IA 3ZSXA 2PMWA 2W42A 5FPMA 1NK8A 3M9MB 4DFMA 1P9QC 1A6LA 1GLEG 4CEZA 5GINA 1S9EA 1U6ZA 3EN9A 1HKGA 2UXDF 2P9UA 4ZVEA 5B0FA 1LKZA 4DV4K 3DDIA 1RA6A 1WNEA 4HI2A 1DAXA 2E9RX 4JK7A 1CZAN 2MQNA 1DZ5A 4B3RJ 3F9MA 4CZHA 1M1KT 1WC5A 1N0UA 1R8PA 2DFEA 5K14B 3O44A 3HVTB 3QAUA 4OX9F 3SUPA 4JI6J 4YR3A 2PMHA 1FXRA 4IG3B 3VQ4A 5B0BA 2GX9A 3EXCX 3D2EB 3HVWA 1XMBA 3QNOA 3IMQJ 2ZWPA 4OZJA 2ACYA 3AD9C 3DLEB 1Z6RA 1Z05A 1KXPA 1CJTA 2DNRA 1T6DA 2O8FA 1BQMB 3FZ2A 3W8PA 5BRDA 2PYJA 1Y7PA 3OTOF 5ETQA 4K4YA 2FSKA 1CZBA 4K2XA 3GP9A 3CCMS 3CCEN 4AF1A 2KZZA 3M8QB 1Q0NA 3J81O 5IV4A 3TR5A 1UPMB 3WHIA 1CS4B 3NAIA 1N34J 3CE8A 3M9OB 3K5PA 4YEAA 4G1IA 1WI8A 1O0PA 4XAKA 4N8OA 5HAOA 2XULA 2VPWB 1FFWB 2LCWA 2V8VA 2XMJA 5U47A 1LW0A 4GKKF 4LF2A 4LF8F 4M95A 3PLAA 5GAGI 2N82B 2A40A 5D0GA 3AVNA 1GOBA 2YKMA 2FY8A 1Q7LB 3BO4A 1TL7A 1HFEL 2UUWA 3OJSA 2H5IB 4C4WA 2DHAA 4KR0B 4JV5F 2V8HA 4RNOA 4CGGA 4P72A 1WG4A 3MK6A 3M8PA 2ATCB 3I96A 3D2WA 3O8WA 4DR7F 1R43A 3A8JA 5KT4A 1NSAA 3D54A 1G15A 2K1RA 3DOMB 3SDEA 3ICLA 2JWLA 3RBEA 4DTOA 3C7NA 2FUG9 2YQ1A 4NA2A 4BBYA 4K4UA 2BTFA 4EK2A 2YKPA 3PX0A 2E5LJ 4CD1A 1E3MA 4BRCA 1RT5B 3AO3A 2XWXA 2FF3B 3EM1A 1VS3A 2Z1GA 2UUCK 4NMLA 2ASDA 4J5OA 4I6MB 4JI5J 1SIZA 3MCSA 1KP6A 3EGWB 4I2QB 1KFDA 4BRQA 3KK7A 2BOPA 2G8KA 4ZPTR 4M5GA 4KO0B 1WLJA 5HSPA 5A8RB 3DYAB 5KG1A 1RAIB 1LNQA 3R27A 2V5HG 3CPWM 5DGBA 1KAYA 4TNOA 3LO3A 2XCPA 5BR8J 4XEIA 1WOSA 2X1AA 1NWKA 5DM7Q 2RRNA 1FKPA 4CH7A 1YBAA 4DU7A 4MDBA 2B4VA 2WZ1A 4YY3K 2B7BB 1LWFB 4IO9L 1RGIA 1ZBIA 2HZVA 1TUGB 4MKVA 4DCHA 4ZPAA 4IR9A 5DDOC 3BYPA 1RAOA 3O3LA 4QU6A 1ZBHA 5IOLA 3VENA 1Y5NB 1SJRA 2DO4A 2VICA 4ISFA 2XY7A 2E5IA 3WQPA 1VLOA 1QVGM 1J54A 3IBWA 4HI1A 3RU0A 5JVGQ 2VIHA 3H8YA 4IO1A 3NAHA 5F0WA 4CZIA 1WTFA 3OLAA 2DR7A 5J2PA 5LMUK 4WFBL 4KHUA 3AO2A 1DLOB 5HJXA 3CC2N 3M05A 3W63A 2F4FA 3O6QA 1T44A 3TPQA 4NYPA 2XI2A 6FD1A 4LF4K 1SUQA 2UUBJ 4IFVB 3FBFA 5L1JA 1FF2A 4HHHA 1LK5A 2Z56B 3I5CA 1KVAA 3M1VB 1JJCB 1JJHA 2XSJB 4CI0B 1TELA 3JQJA 4M5LA 4H0YB 2A0FB 1WJ9A 2B4PA 3K58A 2CH6A 1JNZB 5DZ6A 2GVZB 1AZSA 1T03A 3TOQA 2IJFA 3ZEUB 1T9TA 1FNMA 2DNPA 2FLOA 5KI6A 5KPTA 1FRIA 3CJBA 3J7YU 3ZT1A 1NKCA 4BGAA 4PHTX 4BE1A 1D9FA 3I55S 2Z4PA 3DXMB 3OTDA 5AQIA 3QGHA 2VWBA 3IG1A 3H6EA 1D1UA 1YGYA 3JYTB