1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
1A5VA 4DSKA 5KG2A 3AVMA 2KFZA 5K14A 3OL8A 5HRSA 4NRTA 2J6TA 1S9EA 3L2WA 5E41A 4KV8A 1XC9A 3KMSA 3UQSA 3OYGA 1C1CA 3QZ7A 3IAYA 4CJPA 5J2QA 5CY4A 4M3RA 4RNOA 4PA1A 1D1UA 2R8GA 2IC3A 4CERA 3O3FA 4FM2A 4RNHA 3DMJB 3ZCMA 1VSFA 1T05B 3H5UA 5T14A 4R5PA 1HQEA 3I0SB 3PW4A 3PHEA 4NCAA 5HP1B 3HHKA 3SV4A 3SQ0A 3MF5A 1VK0A 3V6DA 4KE5A 3GIJA 5DQHA 2YNFA 2P5OA 1QAJA 2F8TA 4DS4A 3QIPA 2OPRA 3NHGA 4W5QA 1JLQB 3SI6A 4Y1CA 3OSNA 1JLAA 1KVCA 2A1SA 1I3AA 3RR8A 1KSPA 4OPJA 5F8HA 4CHPA 2JEGA 4CCHA 4O0JA 2DFEA 3GV8B 4LH4A 4ELTA 4J9QA 3RRHA 1RBVA 4J9KA 2FBYA 4KPYA 5KGXA 4KTWA 3NDKA 4ZTFA 5KG4A 1R0AA 2W9CA 4WE1B 5KG3A 2JEIA 2OPSA 1TKZB 5KFZA 4Q43A 1RTHB 2W8LA 4QPXA 4ECTA 3H4DA 3SQ4A 3V9XA 4QWAA 4WZQA 3K5MA 3T5HA 3HP6A 3NCIA 4DU3A 4ZP9A 4NCBA 3H5XA 5KFMA 1MMLA 3V4IA 1LAVA 4CK1A 4CE9A 1HPZB 1HYVA 2B6AB 2DPJA 5J2MA 1NJYA 3RMAA 2PYJA 1RILA 3LP0A 4J2EA 4ZP7A 3QLHB 4ZVFA 4FJIA 4IG0B 1NK6A 3LAKA 4FLUA 4IH6A 2I1RA 2OPPB 5DQGA 3VN5A 5J1EA 1ZETA 3D45A 1QS4A 4MK9A 4QW8A 4ID1A 4DL2A 5J2NA 2WOMA 3KLFB 5FROA 1SKRA 5C24A 3S9HA 5DG7A 4JV2A 3AA3A 3F73A 2DTUA 4F8RA 3LP2B 4FK0A 3OYDA 1YTAA 4FJGA 2VWKA 1NJWA 1J54A 4CGGA 4BE2A 3DLEA 1U04A 4Q44A 3V1RA 3PX6A 5DGAA 2UVRA 2XY8A 3MEGB 4ED2A 4NLXA 4B9TA 3KLHA 4M95A 1S49A 3C6TB 4AHTA 4J2DA 3MXIA 1BIUA 1JL2A 2RKIA 4E1MA 4Z4EA 4IRDA 2WK4A 1VSLA 1RTDB 1BHLA 5FRMA 3ASMA 1S1UA 3CJ3A 3JSMA 1RT6B 2ATQA 4TQSA 3BGRB 3ZSOA 4ID5A 1KLNA 2HWIA 3EYZA 3AVGA 3M9NB 2AGPA 4CJTA 1SH0A 1YVUA 3QEWA 4DTXA 4KKOB 2HHTA 1JX4A 3OYBA 4Y34A 1NK5A 2LSNA 1NKCA 2HNYA 3T1AA 2E9ZA 3CJ5A 3RBEA 3GIKA 1J9AA 1S48A 3V81B 2X6SA 3NF6A 4RNNA 5FDLB 3V1OA 2BANA 2ZD1A 1ZBLA 5F8GA 1BQNB 2YNHB 2AJQA 1K1QA 2A1RA 2QV6A 1TGOA 3CM6A 3SJJA 1REVA 3QERA 5KT3A 3DRSA 5KFFA 2O4GA 4RUAA 4FJLA 4DG1A 2RF2B 4OLAA 4IOBA 3OHAA 2F8SA 1JIHA 4RUCA 4DMNA 3H4BA 4ZPBA 1LWFB 5F9LA 4Q8EA 5EWEA 3SUOA 3DM2B 4JRQA 5DLFA 5HRNA 4O44B 3U3GA 2ILZA 3PW0A 2D0CA 3N6LA 4CHQA 3AVKA 2JC0A 3ZSZA 4CK3A 1TAQA 4Z4CA 3ULDA 4PWDB 4WFZA 3OL9A 3OS2A 1BQMA 1QTMA 4EEYA 2GIRA 5KT4A 4RW4B 3HKWA 1NHUA 4AHCA 3N6MA 1RTIA 1W25A 3HSTB 3OVNA 4B9SA 3UR0A 4FYDA 2HVIA 2G8UA 4YMEA 1U48A 3QZ8A 1BIZA 4E3SA 4R8UB 2R8IA 3VQ8A 3PY8A 2IDOA 4LD0A 4O3QA 1IKWA 4O4GB 4DSEA 4N47A 4KHRA 3DOKB 1FKOB 2E6LA 4LY7A 1C0TA 4NLRA 3SYZA 4DTOA 2WONA 4FJ5A 4O3SA 4IR9A 1T8EA 4XIUA 4RNMA 3TAMA 1RT3A 4ECVA 1DLOA 1T03B 1S5JA 4Q8FA 3CM5A 1WNEA 5KGWA 3DRRB 3BQ1A 3VQ4A 4N5SA 1IKVB 1HYSB 3KJVB 1I39A 4HCBA 3DLGA 1DTTA 3IGVA 3VQDA 3L2VA 1ZTTA 2FVQA 4URQU 3L2RA 1SV5A 4CJVA 3DOLB 4YNQA 4DTMA 4FVMA 5CYMB 1UA1A 1WSJA 4Y2AA 2IM3A 3T3FA 3KLGA 2AWZA 4ICLA 4ZP8A 2RDIA 4OJRA 2XWYA 1C0UB 5KFPA 1Q9YA 4B8AB 3GYNA 2VWJA 1KFDA 1JLEA 4I7FA 4FLZA 2KQ2A 2W42A 2BRKA 5KG0A 4IRCA 3SFUA 3K59A 4B3OA 4Q0BA 2D7SA 4CF9A 1S1VA 3QINA 4CF0A 4CJ4A 2WTFA 3IGNA 3LP1B 4IFVA 3E01B 3VQ5A 5KFTA 4ELUA 5KG7A 2BDPA 1FKPB 5HLFA 3IN5A 3ZT4A 5C42A 1BISA 3I5AA 3C6UA 3QEVA 2VA3A 3KIOA 5L1JA 2ASJA 4KAIA 5J2PB 4AHVA 3KK2B 3TAPA 5EWFA 1YT3A 4NLOA 1GOAA 4HHTA 2I5JB 3MXJA 4Q45A 4K4ZA 3PO5A 1S0NA 4WZMA 2JEJA 3F9KA 5KFRA 5DGBA 2WCXA 5HRPA 4GMJB 4Z0UA 1U45A 3D5MA 2YKMB 2C2DA 4F2RA 3RWUA 1EP4B 4MFBA 1D0EA 4H4MA 4KV8B 1TKDA 3KLVA 3V9ZA 5D3GA 1ASUA 1C1CB 4KHQA 4M42A 1GX6A 1ZTWA 5J2QB 4M45A 1CZBA 1RT5A 4OPKA 4G1QA 3OLAA 1IO2A 3RB6A 2YKNA 4NCGB 2BQRA 2GBZA 4FLTA 2QE5A 3M8RA 3HM9A 4K4VA 1S6PB 2ZE2A 2VG7B 4KHWA 3PR5B 3VA0A 3EPGA 3LZJA 4FJXA 1BCMA 1S0MA 4R5PB 4URGA 5I42B 4ED0A 3PV8A 1RDCA 2Z1HA 5CZ1A 1KLMA 3PX0A 3VA3A 4B9LA 2WHOA 4CJRA 4CJ3A 3ITHA 3OL7A 3BREA 3OYIA 2BRLA 2G8HA 1EXQA 4CJWA 3SQ1A 3QNNA 4PY5A 4NLVA 3QO9A 1J5OA 2EHGA 3M8QA 4LQ9A 1S97A 3V9WA 3QIPB 4PUOA 4CGIA 3H98A 2B4JA 3ISND 5KFSA 2D0AA 2OH2A 4CEBA 1JLAB 1SKSA 1U09A 3L8BA 4ZP6A 4F3TA 3QNOA 4J9NA 4DF8A 3NMAA 3RTVA 3HVWA 4LQ3A 1XI1A 4I9QA 4M3WA 4E7LA 1RT4A 2G8FA 1TAUA 3AVAA 3SUPA 3N6NA 4FLXA 3JYTA 1SUQA 1TKXA 4NYNA 1TKTA 1UOCA 4DL7A 4DTJA 2G8IA 1J53A 3L2UA 3KLIA 2IOCA 4FJ9A 4CJEA 1R0AB 3NBPB 2BE2A 4KO0A 5KRTA 2J6SA 2PY5A 4CHNA 2YHAA 5HRRA 4DFKA 1BGXT 4WYLA 4Z4IA 1S6QA 4CF8A 2NUBA 1WSHA 4I2QA 3G6YA 1VSMA 3BQ0A 3C94A 4DTUA 1TQLA 3VQSA 3V4IB 2R8JA 1GX5A 1CXQA 4BDPA 4AHSA 5J2MB 1XR6A 5KFWA 2HWHA 4KRFA 2AGOA 3TQ1A 3VQCA 1QSYA 3D0PA 4KHYA 3FSIA 2HVHA 5I3UB 1JL1A 4B9MA 1C1BA 1QSSA 4YR0A 3NL0A 1JLCA 4ECXA 3VQ9A 3KHLA 4ECWA 4KHNA 1RT2A 1WSIA 1RDRA 2KFNA 1WN7A 1S1WA 4U6PA 4J2AA 2HW3A 2OZMA 5SWMA 4GC6A 1WSFA 3O3HA 2IGIA 1D9FA 5CYQA 3QESA 4MIBA 3LWMA 4K4XA 3M9OB 2W9AA 4KTZA 3BSOA 3DLEB 4FM1A 3UIQA 2HHXA 1LW2A 3A2FA 5KG5A 3HL8A 3DRPB 1RBTA 3KLHB 1S9GB 1N5YB 2X6NA 1Q9XA 1ZBIA 1VSEA 1XR5A 3HPGA 1VSIA 4OGCA 2RKIB 1HNIA 3VQAA 2VG5B 2Q3SA 3S3NA 2XC9A 1RT7B 1VRUA 3P1GA 3KD1E 1S1UB 1IKXA 3LANA 5EUHA 4NLDA 1NK4A 1Y97A 3K57A 3OYNA 4IRKA 4B9VA 4TN2A 5L9XA 2ILYA 3NFAA 1LWCA 4GW6A 4FLWA 2PZSA 2HHWA 3M8PA 4RW8B 4W5RA 2J6UA 2HNYB 3H2LA 3G6VA 5JUMA 1T94A 4LSLA 4AHUA 4MKAA 2BANB 3MEEA 2ZD1B 1TVRA 3B6PA 3TAFA 3OHBA 2W8KA 1SL0A 2P5GA 1X9MA 3H5SA 1HARA 5KFCA 4ZMMA 3CVKA 4DU4A 5F8MA 3KK3A 1RA7A 4O55A 5T7BA 1VRTA 2ALZA 1REVB 4IFYB 5KT5A 2RN2A 4UQGA 3TI0A 3SV3A 4O0IA 1HRHA 3S3OA 4DSFA 1RTJB 2XY5A 4C8OA 3HVAA 3SPYA 3I5BA 2E4LA 2C2RA 3ZSRA 4KFBA 3T5KA 4H4OA 3GIMA 1QE1A 3ZT0A 1WNSA 3O4NA 4KTQA 2C28A 1TK5A 4CESA 5HROB 1LWEB 4CFBA 4TY8A 3KHRA 3PZPA 3PVXA 3KLEA 4H54A 3V9UA 4OVLA 2IS3A 1SL1A 2V9WA 1B9FA 2VG6B 4M41A 1B92A 4TSXA 3LZIA 4C8NA 1EETB 4DS5A 4FW2A 1S1XA 3UPFA 1W9HA 4DL3A 1IKWB 1NJZA 3HP9A 3DLKA 3LPTA 3RAQA 4XO0A 4O3NA 3BQ2A 2WONB 3KK1B 2P51A 4IDKA 4O4RA 3TAMB 1S0OA 4GVMA 3IRXB 3OS0A 4HCCA 3OYLA 4TQRA 4NLWA 3SZ2A 2VA2A 4RW7A 3KHHA 2XHBA 3RMBA 3THVA 1JKHA 4HUGA 2EC0A 3CDEA 3I0SA 4DFPA 4I9LA 3DLBA 4NLUA 2OZSA 1DTQB 4KSEB 1RDDA 4TYBA 3KLGB 4ICLB 5HP1A 3M9MB 2X74A 3NGDA 4CJLA 5KFJA 1WSGA 3GV7B 1FK9B 2ATLA 1HMVB 4F3OA 1JLQA 4I7FB 2C22A 4CJFA 4CJUA 3TWHA 4TYAA 4CHOA 2R2UA 2YNGB 4Q0BB 3OLBA 4NLYA 4EZ9A 4ZHRB 1D8YA 1TL3A 3CQ8A 4FBTA 1K6YA 3CFPA 5HLFB 4EBCA 4RW6B 3RRGA 2R2SA 1L3VA 2R2RA 4EZ6A 3HPHA 1NK9A 5DG8A 4EYIB 3M8SA 3AVBA 5L1IA 4MKBA 1VSKA 3MXMA 5KG1A 2EX3A 3ICLA 1JXEA 4WE1A 3FRZA 2HNZB 5KFQA 1TV6B 3WNEA 1TKZA 2V4RA 3RAXA 3AO5A 3SUQA 1Q8IA 1RTHA 3IG1B 3FQKA 3PR4A 1L5UA 1HNVB 5EU7A 1HQUB 4F4WA 3KKRA 2HNDA 3AVLA 4MFBB 4Z4FA 1S4FA 3NH0A 2IMWP 1UWBA 3G10A 1RCHA 3AO1A 4KHSA 1MU2B 3FFIB 2HAIA 3QLHA 4G1QB 3K5NA 1C1AA 1FXXA 2HMIB 3AA4A 2E6MA 2OPPA 3E51A 3WNGA 4M3XA 3QIDA 1IG9A 3OJUA 2ZE2B 1RBRA 4OGEA 4BDYA 5KFEA 4KB0A 4NYFA 1IH7A 3GILA 1WAFA 3LP2A 4FJHA 1KLMB 2W7PA 4DLEA 1KTQA 4LSNB 4NZ0A 3B6OA 3WNHA 3OJSA 3KOAA 3MEGA 1HYZA 1J5OB 2KTQA 2D5RA 3M8QB 2P1JA 2XO7A 3ISNC 3V6JA 4MH8A 4PUOB 3TABA 5C25A 2E9TA 4WXOA 4HKQA 2YV0X 4N56A 3DYAA 1N6QA 1L3SA 3RBDA 1RT4B 4HTUA 3NE6A 4ECZA 2HHQA 3JYTB 3QGIA 1L3UA 1SUQB 3NGYA 3RB0A 4DQIA 1JLBB 1IKYB 1RT6A 2D3ZA 2UUWA 3BGRA 1A5XA 4HYKA 3KLIB 4BDZA 5KG6A 4DL4A 2BE2B 5SZTA 4M3TA 1W0HA 4XPEA 4IG3A 4KKOA 4CFDA 2AQ4A 3QYYA 5F8NA 4HUFA 3H40A 3KHGA 2IM0A 4ZTJA 1KFSA 4E89A 1S6QB 2IA6A 3VQEA 4URSA 4CEQA 4ED1A 3V81A 5DQIA 5FDLA 1RT1A 4Y2CA 1RYRA 1G15A 1LW0B 1BQNA 2FJXA 3WNFA 3GV5B 4L8RB 4J2BA 2ASDA 1I6JA 4IR1A 4CIFA 1Z26A 2XGQA 4IBNA 3CJ2A 2FLNA 2RF2A 4ED3A 4YFUA 4RW9A 5K14B 3SQ2A 3CDUA 1S9EB 4CF2A 3AO2A 1SH3A 3DM2A 1Z25A 5F8IA 2IC3B 3HYFA 4M3UA 5F8JA 4JS5A 3L3VA 3IS9A 4JS4A 3OYJA 3SNNA 4JUZA 3QEPA 4HUEA 3LAMA 3PW5A 4PWDA 3TANA 2OYQA 1N4LA 2F96A 4FLYA 4W5OA 4RW4A 1LW2B 2XCPA 3OS1A 3KD5E 1D9DA 4GC7A 2IJFA 1OS5A 4EO8A 1JLGA 3NGZA 1HQEB 4EO6A 3MAQA 1XHXA 4RZRA 3MR5A 4R8UA 3P5JA 4BE0A 2B5JA 4J9LA 4IQXA 4DSLA 3GIIA 2IAJA 4O4GA 2KZZA 3HVTA 1RNHA 3MECA 3BSNA 4EP4A 3ZSWA 3QGHA 3V6DB 2AX0A 5DK5A 1IKXB 3DOKA 2YNFB 1KCFA 4HVJA 4ZVGA 1A5WA 2OPRB 4DSJA 4Z4GA 3Q8RB 4KREA 2UVWA 3BSAA 1T03A 1NOZA 2FVRA 5DMRA 1N48A 2Y1IA 1WSEA 1IKVA 3T5JA 4E7HA 3KJVA 1BI4A 3H08A 3OYAA 4NLTA 4PQUA 1RBUA 3MR2A 2BQUA 4NLSA 4H8KA 4E19A 3MEEB 2W9CB 1TVRB 3NF8A 1KHWA 4FJJA 2GUIA 3S3MA 1S9FA 2D41A 2YNIA 3K2PA 2OPSB 2W9BA 1SL2A 3KK3B 4NLQA 3NAIA 3QEIA 4CEOA 5KFLA 1T7PA 4IH5A 4FK2A 4IKAA 3I5CA 3LP1A 3E01A 5KFIA 4CHYA 4H4OB 1S10A 1GOCA 3TARA 2BR0A 5JS2A 4OKJA 1FKPA 3G86A 3LP0B 1NNDA 3BJYA 2AU0A 5J2PA 1QHTA 3KK2A 2ZKUA 4CEDA 4TY8B 3GQCA 4YQWA 2I5JA 1CZ9A 3KLEB 2IM1A 5J1EB 4I2PA 1WLJA 2C2EA 4FJMA 1YVFA 4FJ7A 5J2NB 2WOMB 2BQ3A 5C24B 4QWEA 4OL8A 3LDSA 1NK8A 5KFNA 2XGPA 1VSHA 1TL1A 3CJ0A 3V6HA 1RDBA 2YKMA 4CJQA 3VQ6A 3QEXA 1EP4A 4DL5A 1S1XB 3SFGA 4DL6A 3OSPA 4LH5A 3OYKA 4E7KA 3DLKB 4C8MA 1KRPA 1S1TA 1ASVA 4MK8A 2OA8A 4MQ3A 3ZT3A 3LP3A 4IDKB 4BE1A 4NCGA 4CJKA 1IM4A 5KFBA 2RPIA 4RG8A 4DTPA 1S6PA 2FJWA 4CGDA 2VG7A 4RW7B 3CDWA 3ZT1A 1JKHB 2XCAA 3JSMB 4W5NA 2PYLA 5KFDA 4ID5B 3BDPA 5L1KA 3VQ7A 5I42A 3MFHA 4CFAA 3I0RA 5HBMA 1UAXA 3SUNA 4K8XA 4J9OA 5F9NA 3NKYA 4FCYA 3MEDA 4CEFA 4AH9A 3VQBA 3PW2A 4CEZA 5JS1A 2HHSA 4B8CA 4ED7A 3AV9A 3Q8PB 3DI6A 2R7YA 2XI2A 3L2QA 3RB4A 2G8WA 4CHZA 4E1NA 1TL3B 4BWJA 4E7IA 4IKFA 3CWJA 5FRNA 4J9MA 4FZZA 4OKKA 3KNAA 3DLRA 1EX4A 4QW9A 4BACA 3DRSB 1U4BA 4K4SA 1TK0A 4N76A 4DG1B 3NBPA 3HO1A 4KI4A 1CSJA 3Q8QB 4CGJA 4WXWA 1LAWA 2Z1IA 3HK2A 3QIOA 4KI6A 3L3UA 3AVNA 3NAEA 2IBKA 2JLEA 4U7CA 4C8LA 2X78A 2FLLA 4R0EA 1JLFA 3RMCA 2HNDB 4KHUA 3AA5X 5KI6A 3SI8A 4QWBA 1BQMB 4TLRA 1UWBB 4ED8A 4F4YA 3FDSA 4G3IA 1RTIB 4DFJA 2OPQA 2IM2A 2WB4A 1ZBUA 5I3UA 3AVIA 4DQRA 3RR7A 5KFVA 4K8ZA 3AVJA 2O5DA 3NAHA 4C8KA 4CECA 5KFYA 2G8KA 4J9PA 2Z1GA 1C0TB 4FK4A 4Y1DA 1CXUA 5KFGA 4KB1A 1KVBA 4QOZB 3CIZA 1RT3B 1DLOB 3DMJA 4ZVEA 1T05A 4F4ZA 4ECSA 4QCLA 3MR3A 5KFUA 5KTQA 3DLGB 1DTTB 3HPOA 3DRPA 2JC1A 5C25B 1SV5B 1S9GA 1N5YA 4CJ5A 5KFHA 1D5AA 3PX4A 2RDJA 1NK7A 2F8EX 2XI3A 4DWIA 3DYAB 1N6QB 5KFXA 2VG5A 3ZSVA 3TR8A 1RT7A 3EZUA 2AGQA 1BL3A 3UDLA 2DFFA 4DFMA 1SKWA 3VQQA 4M3ZA 3VQPA 1JLEB 1NKEA 5KFOA 4NLPA 4B3OB 4B9UA 1S1VB 3AVCA 4IG3B 4K4YA 4F4XA 2BGGA 4IFVB 4YR3A 1VSJA 3OL6A 4RW8A 1LV5A 4EP5A 3HJFA 4AHRA 2FBXA 4AILC 5C42B 3EPIA 4FJNA 3C6UB 2HB5A 3P83D 4CK2A 4FJ8A 3KMQA 4CFCA 2ETJA 2GV9A 1RYSA 1RT1B 2V4QA 3U3YA 3K5LA 3OYFA 2D3UA 3QETA 3MTKA 5DLGA 3ZT2A 4K4TA 4FW1A 3ZSYA 4IFYA 5C5JA 3T5LA 3Q8SB 3KKSA 3HXMA 1RTJA 4RW9B 4MIAA 2FVPA 3CG7A 1O1WA 3AA2A 4CGFA 4JV1A 4H4MB 2B43A 4FJKA 5D3GB 2JGUA 1HPZA 2B6AA 2WRMA 4M3YA 1F21A 1RT5B 3AO3A 4Y3CA 2YKNB 5HROA 3O4QA 1LWEA 4IG0A 3IS9B 3TAQA 1QQCA 1K1SA 1EKEA 3CO9A 4O3PA 1QUVA 1RA6A 4ELVA 1QAIA 2VG6A 3KLFA 5KFAA 1N56A 4TY9A 3NF7A 1QSLA 4FXDA 1JLGB 3RB3A 5CZ2A 3DDKA 4FS1A 3RMDA 2UUTA 4OKEA 1ZYQA 1EETA 3ITHB 2B5JB 3KTQA 2IAJB 3V1QA 3HVTB 3MECB 3QO9B 1KVAA 5EWGA 4QWDA 3T19A 2HHUA 4QWCA 4YP3A 2QKKA 1NHVA 2GC8A 2UVVA 1UA0A 2CKWA 3KK1A 1B9DA 3C6TA 4ZPCA 4N41A 2FBTA 3CFRA 4X2BA 4ECYA 4BWMA 5JXSA 3IRXA 1U47A 2FVCA 1RTDA 4FS2A 3AO4A 1BI4B 4F50A 3EZ5A 1TKXB 2FC0A 4CGHA 4E7JA 5KT2A 3OY9A 1TKTB 3NF9A 4PQUB 5EDWA 3ALYA 4WFYA 1XR7A 1RAJA 3I8DA 4DTNA 3H5YA 1X1PA 3LALA 4DTRA 3PO4A 1DTQA 1ASWA 4B08A 4KB7A 3PJWA 4NLGA 3G0ZA 2R2TA 4KO0B 3OYMA 4RU9A 2XRIA 1T3NA 2V0NA 1TP7A 4EBEA 2YNIB 5F8LA 3D28A 2W9BB 3TVKA 4XPCA 1NOYA 1FK9A 4YR2A 1HMVA 4WYWA 1X9WA 4I2QB 4DQSA 4QAGA 2YNGA 1XWLA 3CJ4A 4ZHRA 2FLPA 1KHVA 4CIGA 2QK9A 2YNHA 3TAEA 4DLGA 4DQPA 4J9SA 4RW6A 1WAJA 4B9NA 2IJNA 2DFHA 4F2SA 4FBUA 3G6XA 2QKBA 1ITGA 3O3GA 4K4UA 4K4WA 4CJSA 2QXFA 4EYHB 4JV0A 1C1BB 1RBSA 2GIQA 4F4KA 1JLCB 4I2PB 1RT2B 2HNZA 4FZYA 1TV6A 1LWFA 1S1WB 4W5TA 2G8VA 3IG1A 2O4IA 4RNFA 1TL1B 4O44A 1HNVA 2AX1A 2ITGA 1HQUA 4OLBA 5CYQB 3C95A 4DEZA 4DU1A 3MFIA 4MK7A 4O3RA 3DLHA 1XHZA 2R8HA 2ASLA 1NKBA 4WFXA 3ZSQA 1S1TB 2Y1JA 1MU2A 3ZSXA 3FFIA 2CJQA 1Z4UA 3HT3A 2HMIA 2JEFA 5L1LA 1HNIB 1SH2A 4FZXC 3HVRA 2KZMA 3LWLA 3K58A 3OYCA 1VRUB 4ECRA 4CIEA 3NH2A 4DQQA 2YHBA 1FKOA 4DF4A 4JLHA 1C6VA 3CYMA 1C2PA 3I0RB 5HBMB 2D0BA 4NRUA 4LSNA 4CEAA 4DTSA 1LWCB 4TXSA 4Q5VA 3DRRA 3MR6A 3V6KA 3K5OA 2FVSA 3MEDB 1HJRA 4DSIA 4O5BA 1CLQA 2FBVA 4NYZA 1HYSA 3SCXA 3M8PB 2E9RX 2DPIA 2W7OA 2DY4A 1JXLA 3DOLA 1BCOA 4ED6A 3DI6B 2UVUA 3PW7A 2HHVA 5CYMA 4Z4HA 4LSLB 2FJVA 4KHMA 1NK0A 3FQLA 3QGGA 1C0UA 4E0DA 5KFKA 3OYHA 3AVFA 1JXBA 2XY6A 1JLBA 3CFOA 3PJXA 4J9RA 3NGIA 3BSCA 3PUFA 1IKYA 3SPZA 1RDAA 3OYEA 3LPUA 1VRTB 1VSDA 3EY1A 1YTUA 4K50A 2R8KA 1GOBA 1X9SA 4ZPAA 4KAZA 4FLVA 2KW4A 4KFBB 1C0MA 2XY7A 3TAGA 5DG9A 1QE1B 4IH7A 1L3TA 4CF1A 4O3OA 3NH1A 3V9SA 4ECUA 5KT6A 3U6FA 1TK8A 1ZBHA 4FM0A 4JRPA 4EBDA 1JLFB 5KT7A 1NJXA 1LW0A 4M94A 4ZVHA 4CEEA 4ECQA 2ZQBA 1U49A 2OPQB 2Z1JA 3BR9A 3H59A 3AVHA 4ZPDA 5KRSA 4KBIA 1ZBFA
chains in the Genus database with same CATH superfamily
3CCUS 5IS2A 2B56A 2DNQA 3IM8A 3AVMA 5HRSA 4OHZA 4E98A 2V5HG 5E41A 1S77D 2HBJA 2RNEA 3SDEB 3OYGA 1C1CA 2RQMA 1MWKA 5ELZA 2R8GA 2I7NA 4CH0S 1N36J 1RKIA 2QGFB 3ZCMA 2VQFK 3N0VA 3H5UA 5T14A 3GZ7A 1UPMB 3SCLE 1P9YA 2UU9F 2VICA 3DRXA 1XN9A 1HQEA 3I0SB 3POTB 4GY2B 4PXDA 3PHEA 3I33A 3JQJA 2ZITA 3HHKA 3NY0A 2QWMA 2FJAB 3MF5A 3V6DA 2V51B 4KE5A 5IWAJ 5DQHA 2P5OA 1QAJA 3UNGC 4W5QA 2A2DA 3MEKA 2ZGZA 4Y1CA 2A1SA 3IFRA 4P72A 4LF5J 1I3AA 4PWUA 5A6PA 1UVMA 5F8HA 3HZGA 4CHPA 4XH1A 4O0JA 2LQJA 4X66J 3GV8B 2VCPA 2CH5A 1SS6A 4M63C 4ILMA 4K0KK 3ILJA 5D0GA 5KG4A 1R0AA 4L6V3 3Q8YA 2M5YA 4CH1A 2W9CA 4JKGA 2MKIA 3N5FA 1M5SA 2FHKA 2JEIA 2OPSA 2H65B 4LF8F 1TKZB 2ZOMA 2F4VF 1FF2A 4OPAA 4QPXA 3HRGA 3SQ4A 1H0HB 1FEHA 4M1KA 3CJ8A 2LQBA 3K5MA 3T5HA 2H54B 2DR9A 3H5XA 1XMOF 2J0QD 1HPZB 1NMNA 4BRPA 3VAMA 5K20B 3MN7A 3RMAA 2PYJA 2UU9J 1MWQA 4ZP7A 3I9V9 4FJIA 2XMWA 4B1ZA 3LAKA 2MQMA 2G0CA 4QIGA 5C2DA 4X62J 4JKEA 4MK9A 3DDNA 2E2OA 2UXBK 5J2NA 4JV2A 3F73A 5CE3A 4F8RA 1S5ZA 1YTAA 2VWKA 1SCJB 1U04A 3U4LA 3V1RA 4CLTA 5DGAA 4WFAL 2UVRA 3MEGB 4ED2A 2POKA 4A62A 3MHYA 4F0MA 1BE4A 6AT1B 5ETVA 1A9NB 1KQKA 3R8YA 2G9OA 4J2DA 5B0FA 3BGFA 2DR8A 4E1MA 2E5LJ 3T1HK 5GAHU 3C7NB 1R8BA 1RTDB 3MM9B 1S1UA 1RADB 3OTOJ 2ATQA 3BGRB 4LF8J 3AVGA 4DPUA 3QEWA 1WTBA 4KKOB 1E6VB 4Y34A 4NI2B 1NK5A 1PGZA 4F26A 1XMOJ 4JNEA 2HNYA 3T1AA 2E9ZA 4FXVA 2ITMA 1IWAA 1S48A 3FZKA 1RGVA 3NF6A 1YI2N 1ZBLA 3LL3A 3WX4A 3MUVP 2YNHB 1K1QA 1AROP 2RRBA 3QMLA 4ANCA 3W2VA 2W7AA 3EVMA 5KT3A 4EIAA 2O4GA 3QSIA 4RUAA 3MUTP 1TTHB 1CS4A 1Y5IB 2R7QA 1CJTA 2MZQA 2CDRB 3H4BA 5F9LA 2J9CA 5HRNA 4IZ9A 4DV0F 2O8EA 3NS6A 2JC0A 1FVSA 3N9UC 1BQMA 1E6YA 2GGPB 1DT9A 2GIRA 2AJ0A 3FRYA 3OVNA 1B0VA 1UFWA 1U48A 2UXDF 3SCKE 3CCES 3VQ8A 4LD0A 4H0YB 3R27A 4O4GB 4N47A 2BJ3A 4KHRA 1W2BM 3DOKB 4UF4A 2CXEA 1KEKA 3JQMA 3GONA 4DR5K 4AFFA 2WONA 3O80A 3SBGA 4RNMA 4WF9Q 2LA4A 1FXDA 4HI2A 1WNEA 1WG1A 2OCEA 3Q24A 4HHUA 4FL9A 2H4YB 2DGWA 3DLGA 3GR1A 3IGVA 3VQDA 4URQU 2FVQA 3L2RA 4LF7F 1GXTA 3SAHA 5CYMB 1WEYA 1WSJA 4Y2AA 2KJWA 1R8PA 2IM3A 3KLGA 4OJRA 2COLA 2XWYA 2FDNA 5KFPA 1Q9YA 1W7WA 2BKOA 4B8AB 3EKSA 2HK3A 5AQYA 1KFDA 3EXCX 4MMOA 4FLZA 2V8HA 4PG6A 2BRKA 2XBPA 3JXUA 5AQQA 3FK4A 3K59A 3SFUA 4DV3K 3BY5A 2QLWA 2C3MA 2I0XA 3E01B 4KGMA 1GLBG 5KG7A 2ABYA 1REGX 5HLFA 4XAKA 1FXLA 3HSZA 5IT9O 1BISA 3QEVA 2VA3A 2GVZA 3FBBA 4KAIA 5J2PB 4AHVA 3TAPA 3GMGA 5EWFA 1BA0A 9RUBA 3MXJA 2YXLA 2CQDA 5BPMA 1WC0A 1WF2A 3VGKA 1IBMJ 2V6AA 5KFRA 3EDRB 2LCWA 3W65A 2AP6A 4MJKA 3D5MA 3NNAA 2C2DA 1RP5A 4F2RA 5A0YB 5E5NA 4MFBA 3IR7B 4KV8B 2XS7A 2GCFA 1GX6A 1RAFB 2BEFA 1CZBA 3CW2C 2BA9A 2F8MA 4CNZA 4N8NA 3PNIA 4DN9A 4DX6A 5AQKA 3HKZD 3J80O 4RX6A 5CHIA 1IJEB 2R7WA 3R1HA 5K8PA 1DQAA 4CDIA 2DNOA 4HHJA 1QHAA 2KT2A 4K4VA 4ILGB 3PCOB 3LGMA 3UE5A 4GVLA 4CNYA 2QIFA 3I32A 2GMJA 4R5PB 3RSEB 1H1VA 1RDCA 3KZBA 5CZ1A 1KLMA 2CPYA 3LUYA 4BREA 1HLWA 4PY5A 4NLVA 2ASOA 1RHRB 3S41A 2LEAA 1FA0A 3R5JB 3M8QA 1YF5L 3QAUA 1J5EJ 1S97A 4WTOB 4FWPA 2LU2A 4AL6A 4OYMA 1JCFA 5D15A 3L8BA 4ZP6A 1YRUA 9ATCB 2P9UB 2G8FA 2MSTA 4NYNA 5T7LB 4C2MA 3J80Y 2GS8A 3TZWA 3L2UA 2MKKA 4CJEA 4KO0A 4CJ7A 4B3SF 2J6SA 3ZTRA 3VPZA 4U8VA 5HRRA 1RXOB 1T44A 2GTDA 3I6PA 4K5SA 1VQKS 1JNZB 3NWGA 4H4KC 3AD8C 2DCUB 4CF8A 4I2QA 3G6YA 5B09A 1PJ7A 5DDOC 2Q2RA 2KHCA 2QG9B 8ATCB 1ATNA 1NAQA 4JI3K 4XK8C 3VQSA 1F9HA 2GELA 2VUGA 2N4DA 2KN4A 2ZFHA 3SMPA 4AHSA 5J2MB 1XR6A 2HWHA 4KRFA 2AGOA 3CJKA 3D0PA 2XSJA 3MMBA 2HVHA 2AV5A 5ADXA 2ZZTA 4U67Q 3VF6A 1JL1A 4H0OA 2OAUA 1QSSA 1H38A 1JLCA 2V63A 2OMOA 3F2KA 1WSIA 2GX8A 4ZN3A 4U6PA 1B99A 2Q0RA 5SWMA 1N33F 1BDGA 1WELA 5DDPC 2LP4A 5CH7B 3S1TA 3F56A 4QU7A 3UD5A 3BKUA 2L08A 1V3RA 4C0OC 4EWTA 4H4KA 1LW2A 2YQ3A 2ZH7A 1S57A 2WBMA 3CIPA 1YIJS 3L7UA 5M2PA 2X6NA 1VSEA 3HPGA 3CJCA 2HIQA 4OGCA 1HNIA 5HL7Q 2Q3SA 1KC8T 1WC1A 1NGEA 4C1NI 4CT9A 1VRUA 3CC2N 4B3SJ 1S72N 4X4QA 1NDCA 3THYB 2O8CA 1WOPA 2NYHA 3MN5A 2D0PA 2A2CA 4K2XA 4V19J 3EUNA 3NFAA 2VU5A 1LWCA 1B0PA 4WJBA 2CVEA 2HHWA 2PZSA 4CZLA 2J6UA 4NE9C 4MYTA 3H2LA 2YQ0A 2WSFC 3KVGA 1YJRA 3OV7A 5LXYA 4LSLA 4AHUA 2BANB 3MEEA 1PBUA 1U6BA 3AGRA 2HF4A 3CD6S 2MJNA 3CVKA 4DU4A 3W62A 3VZHA 3V4MA 5CHCB 5T7BA 4O55A 4IFYB 1F5AA 3U27A 2BZ2A 1GMWD 4DSFA 1H7WA 5HK4A 4C8OA 4UZBA 4ED4A 4CZKA 3SPYA 2C2RA 4H4OA 2LEPA 3QJJA 1F9FA 1WNSA 1FNMA 2DCLA 3CC4N 2C28A 1GLFO 4CESA 1WOOA 3NGSA 2X3DA 5ADZA 4KRWA 4NO7A 5B0GA 2IS3A 1SL1A 1B9FA 3DC2A 2V9KA 4OI1A 3U9DA 4FP9A 1B92A 1TR0A 1EETB 4FW2A 1S1XA 5FPEA 3G71S 2DIVA 4DL3A 4X4PA 3DLKA 2ACYA 5C2CA 2MQOA 5DETA 1N5VA 1S0OA 4QYRA 2Y8YA 3IRXB 3IWLA 3OYLA 4NA2A 3RMBA 2EC0A 3OBIA 4G1IA 4USVA 4B3RF 2L9NA 2M4MA 4NLUA 2OZSA 1DTQB 1FJ7A 4CTAB 2UU9K 1YJ7A 4UOFA 1EHWA 1DRZA 2X74A 4C97A 3QBXA 3U8XA 2UXCF 1VQPS 2ATLA 1FK9B 2G13A 2N7YA 3S01A 4I7FB 5HQLA 2C22A 3G4SS 4CJFA 4CJUA 4ALZA 1VQ6S 4CHOA 4BR5A 2ZBCA 3T6JA 5DO2A 3L09A 4ZIVA 1GK8A 1YRTA 1YSJA 2HBMA 4WKRA 2R2SA 2X1GA 1X0PA 5DM6L 2HHHJ 5DJBA 5AZIB 4JI4F 3OTDA 1GQEA 1PO6A 3PG9A 2I2YA 1LK5A 4IO9Q 3WNEA 1U6FA 4EFAC 2V4RA 2A5XA 3SUQA 1RTHA 1XK8A 2HFNA 1QVGR 3PR4A 4YHHJ 1L5UA 5EU7A 1ICEB 4W92B 4F4WA 2YHWA 2HNDA 5AQSA 3TO8A 2MQPA 5FLXU 1FJGF 1RZMA 4PKIA 1S4FA 2DY1A 3NH0A 4M5JA 4LF8K 1LEOA 2F4VK 4ILRA 2HAIA 2H5EA 3AJ2A 2ZGYA 4WK3A 3O6WA 3CD0A 4YUDA 3MURP 5EX0A 3O5BA 1CULA 1XMOK 4CLYA 2PI4A 2JX2A 1X4GA 4NYFA 2Q31A 2UXCJ 1U1RA 2KB2A 1GXLA 4Z7YA 5BYSA 3LM9A 1HUXA 3GIRA 2D5RA 1X3MA 3IWNC 5IQ6A 2PFUA 2DGOA 4M5GA 3H45C 3GBTA 4N56A 4BR0A 2EFNA 2K2PA 2CADA 2BTFA 4H5NA 2A1BA 3U7JA 2VWBA 4NXMJ 1U7LA 1JLBB 1K8AO 1RT6A 5BR8J 4WIQA 2UUWA 1A5XA 4IOXA 3GG0A 2CWKA 2VASA 3ENAA 2BE2B 4KIAA 4XPEA 4IG3A 3DGPB 2DR6A 3R2CJ 4KC5A 1S79A 1RAHB 1DGKN 4HUFA 3H40A 3VQEA 3DKDA 4URSA 4AYBD 5GAEI 2VONA 4BLGA 3V81A 5DQIA 2VIHA 1RYRA 3P5TL 1G15A 3M6GA 1LW0B 2ZM6J 2YHXA 1X31C 4XH5A 4J2BA 1I94J 2CPJA 2ASDA 4Q2MA 3GJSB 5EGYA 4CIFA 2ZVSA 1S99A 1Z26A 4IBNA 1X4DA 3MZIA 5J1NA 3CJ2A 1PIEA 3SQ2A 3KWIA 1K73T 4CF2A 4J90A 3OUYA 1TYQA 3P4IA 4A8FA 3UN2A 2Y9HA 4DV4F 2M8DB 4DR7J 1IJFB 5F8JA 4JS5A 3JTOA 3P45B 3RYLA 3SNNA 3QEPA 1AZSB 4KH4A 2WC9A 1XQIA 3CCJN 4RWXA 3KD5E 3OS1A 1FX2A 2IJFA 4PG5A 3BZQA 1HQEB 3NGZA 3BO3A 4DV0K 3BBBA 4H5WA 1XHXA 3TP2A 3BPSP 2KXFA 3O08A 1VDHA 3IAM9 4AUKA 2ADBA 4YOTA 3HVTA 3AD7C 3MECA 4EP4A 3QGHA 3V6DB 2AX0A 1YUWA 4CWBA 1KCFA 4ZVGA 1XERA 2IVFB 3C6AA 1KNZA 2GEMA 2UVWA 3QT8A 3G8SA 4ER8A 2UXDK 3HZ6A 5MLCQ 1NOZA 3KDOA 1T11A 3CPEA 1WSEA 1Q5YA 4L72B 2ZBQA 4BRCA 3BF3A 2RHKA 2DGQA 4F3MA 1M5HA 5HSPA 4NLTA 1WG5A 4PQUA 4LFBF 1RBUA 3ILOA 3HSCA 2ZDOA 2H5IB 2E5IA 3CCMN 1KOOA 3FKBA 2W9CB 1KHWA 1ZC6A 3G25A 3WQUA 1S9FA 2Z30B 2D41A 2YNIA 2V2QA 2OPSB 4NA1A 4LF7K 1JJ4A 3UI3A 4LF6F 3ET6A 4LUBA 2ZVIA 1F3FA 1UZDA 5L39A 4YOVA 2XHWA 5KFLA 3L4BC 2MZSA 4CLSA 3P4UB 5KFIA 4CHYA 4DR2F 1F60B 2BR0A 2Z2MA 3DRYA 3OR1A 5JS2A 4OKJA 2FHJA 1FKPA 3G86A 3L9ZA 1U2RA 1NNDA 3QT5A 2O8BA 3D4JA 2HQCA 4AT1B 3KK2A 2ZKUA 3TU5A 2XNQA 4TY8B 4UW2A 2B4UA 2C3PA 4YQWA 1X0FA 2IM1A 3C14B 2Q0UA 3E9PA 1YVFA 3E9OA 5J2NB 2BQ3A 2YWGA 2OIHA 4QWEA 3FEYB 1NK8A 2XYHB 1SC1B 2YKMA 4CJQA 1JCGA 3R1LA 2KXHA 3OA9A 4LJMA 3J7YP 1IBKF 2LXFA 4C3LA 4UZCA 3P38A 5I9EB 2DHAA 1DFDA 3K0SA 3D68A 1OY8A 2HHPA 4JI0J 3D2EA 1IBCB 4NCGA 4YB5A 3GFZA 2VKZG 1IM4A 5KFBA 3FUYA 5C10A 2AJ4A 4DTPA 1S6PA 2VG7A 4RW7B 3ZT1A 2VFVA 4OLPA 3UNYA 3NCPA 5AQWA 1X5OA 1VC0A 5I42A 3MPVA 2CNLB 3MFHA 3OW2R 3B8AX 4IOAL 1MLAA 5HBMA 1X4FA 1HR0J 2ZJRQ 4JI2J 2IDEA 3SUNA 3NGRA 5F9NA 3NKYA 3MEDA 5CYJA 2ZH6A 5BN9A 5F0WA 3H42A 3Q8PB 4NASA 4WP3A 2B4VA 1XNQF 4ILJA 1TL3B 1RLDA 4BWJA 4E7IA 3W5YA 4JK8A 2DKOB 4J9MA 1VMBA 1EX4A 2C2NA 2ROEA 2DGSA 3DXMA 1M1GA 1U4BA 4USTA 2DGXA 1Q8LA 2M52A 2HOEA 1XC3A 3HJVA 4CGJA 4WXWA 2NUHA 1CJTB 4BHQA 3HK2A 2FUG9 3AAPA 5IFMA 1H2VZ 3AVNA 3PSFA 2FJEB 3AQOA 2ZBPA 2XG8A 4DPOA 3AH6A 3FJ2A 4C8LA 4OZ3A 5CCLA 4B3SK 2O8EB 1JLFA 1CJKA 4BS2A 4HDHA 3MWTA 2EWHA 1BQMB 1KONA 1UWBB 3FDSA 4G3IA 4B3TF 4DFJA 4PXCA 1ZBUA 1BD6A 4PG4A 4LF4F 1M90O 4K8ZA 3PIPQ 4K43A 2BV3A 3NAHA 2R7SA 2JZ5A 2CGLA 1RTZA 4DPTA 2G8KA 3RRKA 4J9PA 3I8BA 4FK4A 4Y1DA 2PA3A 3MMJA 2DBBA 2OEMA 1NU0A 2N7CA 2OMLA 5B7WA 1XNQJ 1CC8A 3DLGB 3CJSA 4Z37A 4ZJOA 3C46A 3HPOA 3H3NO 1ZAXA 1N5YA 1N33K 1D5AA 3EXYA 2WAQD 2X51A 1SAZA 1N6QB 2X7IA 3GSDA 3VEWA 3R1XA 3EZUA 1WG4A 1BL3A 2KT3A 5GAEU 3QWUA 5FPDA 3O9RA 4LRDA 3VQQA 4BGBA 4DUTA 4A8KA 5ITHA 1NSAA 2YKOA 2YX6A 4C0BA 3AVCA 4BC9A 4F4XA 5IC4B 1KBRA 1WI6A 4C0HA 2D9OA 2MTLA 2GO8A 3HHLC 2BE9B 1TFYA 1BQXA 3LDPA 2AZ3A 2DH7A 3N79A 2KHDA 4JI6J 4L76A 2HB5A 2GVZB 1BXNA 3P83D 4CK2A 3KKFA 5DDQC 1QQMA 1NXIA 5C7PA 1YKWA 2V4QA 2HYIB 1TUWA 3LA0A 2CPFA 5DLGA 1Q7YT 1CEZA 4Y2KA 1ZOTA 3NVKA 2HBRB 1GXUA 3VEOA 2B6AA 1FRMA 1V6HA 3A5MC 4X64F 3ZNUA 1K47A 1K1SA 4UUWA 2CPIA 2P9CA 3O1WA 1T9TA 4WFAQ 3W5ZA 3HHLA 2F63A 2G2OA 3D6MB 1RHQB 1U1KA 5KFAA 2NRWA 3C16A 4DPWA 3B4DA 3U1LA 1JLGB 3MMCA 3DDKA 3HCXA 2XB2D 3RMDA 2UUTA 1K8KA 4FVCA 3GCXP 3CJRA 3VQTA 2D1CA 4BC5A 2IAJB 2GJ2A 4DR1F 1QM9A 4QWDA 4QWCA 5IV3A 2LU1A 4DUYF 1S7IA 2CKWA 1N34F 3KK1A 2BJ1A 2K3IA 4QIVA 2SXLA 1ZZFA 3RGIA 3AARA 1I51B 2DPNA 1S6OA 4FS2A 2FC0A 4CGHA 4E7JA 3D6TB 2QI2A 3OY9A 5LOQA 1UJ6A 1S22A 2ZH1A 5A8RA 1X1PA 3LALA 4WU2A 4DTRA 3PO4A 1ASWA 4KB7A 4NLGA 3UR3C 1MG7A 4KO0B 1EIYB 4RU9A 1AUDA 1Y64A 3J7AP 2HBZB 3A4TA 1W7AA 2BUPA 4EBEA 5F8LA 4Y6IA 4DCJB 4XPCA 1NOYA 4B3RK 2XMAA 4WYWA 2GWKA 4CBXA 4I2QB 3MN9A 1XWLA 3CJ4A 2RE2A 4CLUA 1KHVA 2UYTA 1ESVA 4U96A 4CIGA 4KGKA 3AOBA 2UXCK 1RACB 4FF3A 1AW0A 3W8GA 2PC6A 3ZZ0A 1DQ9A 2XMTA 4FBUA 2XSJB 1HWLA 3MMBB 4EYHB 3CE8A 1V5VA 5GAGP 4PEOA 3D7EO 2GIQA 1JLCB 3WIUA 4DPXA 2A3ZA 3W9HA 3QSYB 3GE9A 2MZTA 2HNZA 4FZYA 2X1BA 4DR1J 1LWFA 2EK6A 2HGMA 4OI3A 2G8VA 1B64A 3P3DA 1HNXJ 4O44A 5RUBA 4JI4K 1HNVA 1HQUA 4OLBA 2R4FA 2V34A 4HT5A 3QJPA 3R5AA 3DLHA 1JNRB 2R8HA 3MPDA 3RBXA 2ASLA 1NGCA 1FDNA 1S1TB 1MU2A 1UJ4A 3DN9A 1HI0P 2HQFA 1Z4UA 4ZJQA 4FPAA 5LJVA 1FJGK 3M8WA 1HNIB 3OYCA 1VRUB 4ECRA 4BG9A 2WSEC 4DQQA 1FKOA 2BM1A 2KYZA 4DCHA 4FF1A 2QC3A 5AQIA 2QLXA 3CYMA 4BVPA 4DUZJ 1C2PA 4XH4A 2I9SA 2RD5C 4P6QA 1LWCB 3DRRA 1I94K 4I68A 3OHRA 5HOOA 2MYFA 2ZUGA 4O5BA 4NYZA 4GKKJ 2PT0A 2DPIA 2W7OA 2XMMA 5CR4A 1Q5VA 3K8VA 1YDLA 4ISGA 4J7CA 4J5OA 2GWJA 4LSLB 3CHWA 4FNIA 2FJBB 3QGGA 5KOWA 2AMCB 2B9EA 3H46O 5A8WB 1NH7A 5KFKA 3MX2A 3OYHA 1MROB 2XY6A 4GV3A 3MCAB 4J9RA 1IKYA 5AQRA 3SPZA 1RDAA 4DI6A 3AGKA 4JI7F 1QVFM 2C3UA 2BH1A 1OSDA 1X9SA 2FY1A 1AT1B 2E5JA 4IH7A 3FCHA 2WVCA 3TEHB 1CC7A 3U6FA 1TK8A 4S0MA 4FM0A 2Z2LA 1GMUA 3UN5A 3E3XA 3P49B 2M0GB 3MOJB 2M70A 3CC2S 1NJXA 4CYUB 1S72S 7FDRA 1SJQA 4ECQA 2IDLA 2ZQBA 3WX8A 5KRSA 2B3TB 3CT9A 4PR6A 4ZDNA 5KG2A 2KFZA 2CQHA 5E3QA 4DR6F 3W2WB 3M5RA 4JK7A 5J2QA 3R8EA 2RRAA 4JK9A 5CY4A 4M3RA 4RNOA 2IC3A 3MI7X 4CERA 4FPBA 4FM2A 1S12A 1M1KT 1NSQA 1T05B 1HBOA 1YJTA 1YBTA 3J7ZT 1JJCB 4DV4K 2I38A 3BM7A 5FLXO 3THXA 1T6DA 4PG8A 1RWMB 3AFGA 4B1UB 4ES1A 3IC1A 4PWWA 3GIJA 2IPOB 1ACMB 3CC4S 4DS4A 2OPRA 4EK2A 4BGAA 3SI6A 4KGVB 3OSNA 1KVCA 3N5BA 1L3KA 3CCUN 5GINA 5D78A 4OPJA 2DXFA 4BRQA 2JEGA 2LQ8A 4FPRA 2YKQA 4ELTA 4JI5F 2QW9A 1RBVA 3C2PA 1SIWB 1HBUA 1XIQA 4KPYA 2HVZA 3QFUA 1NDKA 5FD1A 4DV2F 3LDLA 5KFZA 4LFBK 1RTHB 4DR6J 2F3JA 1DHMA 4JV5F 3GPAA 3MPYA 4UY8T 1U2FA 3HP6A 2Q43A 2BBEA 5B0EA 3RG6A 5KFMA 1MMLA 3V4IA 1LAVA 4CK1A 4CE9A 4LF6K 5I3QA 4WQ5C 1QZ6A 2HGNA 1WI8A 1JB0C 5CCMA 4KGZB 2I1RA 4DR2K 5E26A 3W0LA 3VCDA 3VN5A 3CJQA 4ID1A 2HBKA 2MLZA 4DL2A 2WOMA 3KLFB 4K2JA 1X5TA 3MCOA 3TNVA 5DG7A 5H9EJ 4KH5A 3S9HA 2VBXA 2DTUA 2NRZA 4FK0A 1HWIA 3UVJA 3EVWA 1RGIA 4FWSA 4FJGA 4BE2A 4GV6A 5CZVA 3HOSA 1AB8A 2IBOA 5GADI 1MWYA 4EI2A 4NLXA 1HNWF 3IXQA 5BRDA 2NPIA 4B9TA 4N77A 1S49A 3PXGa 1GLCG 4JI5J 4PKGA 4PG7A 4AHTA 5EXWA 4NYPA 1ZAVA 5HJXA 2RKIA 2LMIA 1IBKK 3H1QA 2WK4A 1BHLA 5FRMA 3UE2A 3I55N 1NGAA 3ASMA 1KVJA 1KD1T 3D2FA 4WQ5A 2DGTA 1RT6B 4ID5A 1VQ8S 2HWIA 4CJTA 3JB9k 2R7VA 3W66A 4JV5J 8RUCA 3J7AN 5A8KB 1VQ4N 1QAXA 3WEEB 2XMJA 1VGYA 1CZAN 3HSJA 3ZO7A 3F9MA 2NPFA 3V81B 2X6SA 2JLGA 4RNNA 2KKZA 2V7ZA 3V1OA 2ZD1A 1BWFO 2K7KA 2OO4A 5F8GA 3VWSA 2UP1A 3TJAA 2IHR1 3CM6A 4LC9B 3F0NA 3SJJA 3QERA 1LXNA 2Z8QA 2IVMA 5D4OA 3VV2B 1XNQK 4IOBA 3OHAA 2F8SA 1CPZA 4YY3F 2BYCA 3M1VB 4O0NA 4C11A 1TMMA 4LIWA 3HT0A 3OR2A 4ZPBA 2GVDB 1GNKA 2XWXA 3U3GA 1RAOA 1HBNA 2P9GA 2ILZA 1P8ZA 3IMQJ 1EZZB 4TU9A 2E5GA 1VISA 3VGLA 2NSBA 3AVKA 3ULDA 2XULA 1Z05A 3OS2A 2ALYB 1X8DA 4EEYA 1QZ5A 4AHCA 1U0HA 4X4RA 1M5VC 3HSTB 1Y0HA 2GIFA 3ZTSA 2FJDB 4FYDA 2HVIA 2G8UA 4YMEA 4BRLA 4QQBA 5JVHQ 1HI8A 4E3SA 1LKZA 2J9EA 4OHYA 3U1NA 4AL5A 4EAHD 1IKWA 1U2CA 3MPUB 1F2HA 2GMHA 3M6UA 4B3TK 2MJUA 2VPYB 3KYLA 5E7OB 4NLRA 3TUPA 4OFZA 4LF4K 4FJ5A 1KKHA 4IR9A 1HHQA 4XIUA 3TAMA 3FMBA 4XEIA 2IYIA 2DNGA 4AXJA 3Q7CA 1HYSB 3EWGA 3VF2A 4HCBA 3MMAB 1DTTA 3L2VA 1SBRA 3W60A 5E2QA 3UKUA 4YNQA 4FWOA 4DTMA 4FVMA 1UA1A 3CTRA 4F3QA 2YKAA 1P1LA 1EQ0A 3BKFA 1C0UB 4WWSA 1Q95G 4YY3J 1RE1B 3KJQB 4CBUA 3ET6B 2ZNYA 2KQ2A 1IVZA 5HMZA 1CJUA 2P9LA 5KG0A 4IRCA 4B3OA 2D7SA 3SQOP 4USMA 4CF9A 1BC6A 3IGNA 3CCJS 3K89A 3MGJA 3EGZA 1FKPB 4P73A 5C42A 2KFYA 2O8BB 2WB1D 1Q86T 3KK2B 1N8RT 1YT3A 4M5LA 4HHTA 1ZM9A 1FNOA 4K4ZA 3PO5A 1SC6A 1S0NA 3LOUA 3CSKA 2AKWB 3F9KA 3MCMA 1HKCA 3ENBA 1Y3JA 4GMJB 5KPZA 2QA4G 4BQLA 5IOLA 2YKMB 1MWMA 6FD1A 1H2UX 2E7XA 2HWTA 4H4MA 3V9ZA 2PN6A 2JDJA 4KHQA 3BN4A 2DH8A 1CVJA 1KC8O 1V3SA 3OLAA 2YKNA 4MLEA 4NCGB 4P52A 2BQRA 4O8UA 2RMLA 3CCMS 4NPOA 1IN0A 2QE5A 2AHOB 1S6PB 2VG7B 1K44A 3LGHA 2VH7A 4OZLA 3VA0A 4X64K 2QN6B 1BCMA 1Q8BA 1S0MA 4C7QA 4BBYA 1DZ5A 5I42B 4ED0A 3HDSA 3PV8A 3M4XA 3MM7B 2MGZB 1FCAA 1M5PC 2Z1HA 2BJEA 3PX0A 1UMJA 4B9LA 2WHOA 4CJRA 4CJ3A 3AOAA 3G2XA 1PYSB 1FESA 2G8HA 2XTJP 3X1LB 1EXQA 4CJWA 3SQ1A 3QNNA 1J5OA 4TLQA 3WQTA 4LQ9A 3ZZRA 3QIPB 4PUOA 2D0AA 4CEBA 1JLAB 1SKSA 3BGLA 3W9IA 5AQLA 1U8WA 3NMAA 4M3WA 3HVWA 4I9QA 4DR1K 1OWXA 1HNZJ 1TAUA 1DAXA 2EXUA 4OYZA 3SUPA 4ES3A 2P9SA 3KK7A 1R8AA 1TKXA 5D6GA 3CF5L 4P9SA 4DUYK 1N34K 2YJEA 1P90A 4DL7A 2ZH8A 4BG8A 2DR5A 1J53A 3KLIA 3ZEUB 3FEZA 4PABA 2PY5A 1WOSA 4CHNA 2YHAA 5E84A 1U24A 2ZJPQ 4A8SA 4DFKA 4RWTA 2DNLA 1NUEA 1BMQB 1WC5A 1S6QA 2NUBA 1VSMA 2VBZA 2E1CA 3VMFB 3C94A 4CO2A 4H03B 2YWWA 1UW4A 1I1GA 1TQLA 2UUCF 3P8BB 2R8JA 4GKJF 3CD7A 3TSPA 2ZH2A 4PL8A 4B17A 4DUZK 4K59A 1QSYA 3TQ1A 3QB0A 4KHYA 5GADU 5K8NA 1ZAWA 4JKAA 3H1VX 3NL0A 5BREA 1DKGD 1D3WA 4M8LA 3ZZPA 4ECWA 4KHNA 2HVDA 2CG8A 5ETLA 1WN7A 1OVYA 1TUYA 3TR5A 2HFOA 1YZ6A 4GC6A 3MMVA 3PYFA 4DZ6A 5CYQA 3QESA 1AFIA 1VOMA 4K4XA 3BSOA 3DLEB 4IYQA 4MDBA 1WTFA 2HHXA 4NYOA 3N28A 3HL8A 3KLHB 1ZM4A 1N5YB 2GQCA 2LDIA 4YORA 3P6YC 4V19S 1VSIA 1NDLA 1ELOA 1NU4A 1QJHA 5H9FJ 3S3NA 2EEYA 5JMVA 3KD1E 2W25A 3LANA 4TU7A 4NLDA 3A5NC 1VQ7N 3K57A 3QRPA 4B9VA 2VC0A 4GW6A 4LFAJ 4FLWA 2BW7A 1YAGA 1HBMA 3SEOA 3RUBL 4GKJJ 1F1BB 2JLFA 3R6GB 4WQ4C 1FWPA 4LVNP 5JUMA 3KNGA 4CZCA 2E88A 4MKAA 3KWMA 3OHBA 4Y0WA 2HVEA 3H5SA 5KFCA 2FSKA 4ZMMA 1B0TA 4YEAA 2C2KB 3KK3A 2ALZA 1REVB 2Q6CA 2KXNB 1H7XA 3HVAA 1F5CA 2CNKB 3K2YA 3T5KA 4P75A 2HQIA 3GIMA 3ZT0A 4DCOB 3GSIA 4FVUA 1PJ6A 4JI7K 3EMTA 2PDAA 3EL2A 3BBCA 4CFBA 3KHRA 5IZHA 4N8OA 2LA6A 1IBLJ 1BWVA 1U1PA 2VGMA 3C16B 1KVKA 1G7CB 2ZZMA 4WFBQ 3LZIA 2RS2A 4DS5A 3FBEA 4A4JA 3K9JA 1NJZA 5I3PA 1Q53A 3W5XA 5AJ3F 1Y5LB 4HH0A 2WW4A 4DBQA 5CA5A 2YX1A 2CDQA 5HI7A 1JQGA 3KK1B 5HVFA 5IC6B 2V67A 2F9DA 2Q6BA 3OS0A 4LF9J 4EUVA 1UEVA 4DR6K 1Y9OA 3KHHA 4BRIA 2XHBA 1DARA 4JEPA 1QD1A 3MM6B 4DFPA 5SUHA 3DLBA 5CZXA 4KSEB 4DV3F 5GMEA 4TYBA 4ICLB 5HP1A 3VAIA 3FCWA 3VOVA 4ZITA 2YQ1A 4TNOA 4GV9A 4CJLA 3HTVA 2QLFB 1IR2A 3HSDA 4A8MP 5G4DA 1YITN 5H1SQ 3DHWC 2I6WA 3TEGA 4JBCA 2R2UA 1HJOA 4Q0BB 2P6SA 3I31A 5B8HA 1D8YA 3BGOP 4H5VA 5MLCV 3CQ8A 4H0TB 4MYUA 5LT5A 2PEHA 3CFPA 3H3OB 4JN4A 3H2VE 3ZZZA 2XZWA 2P9KA 2QMWA 3AVBA 5L1IA 2AEMA 1VSKA 4V1Ak 5IT4A 1SJ4P 5EY4A 3MXMA 5KG1A 2OD6A 3FRZA 4GVEA 2HNZB 4JI5K 3MAHA 3RAXA 4F0KA 3QJLA 3FQKA 1RWPB 4CLZA 1HNVB 3TTDA 5AJ3J 1HQUB 5B0AA 3A0IX 1S3XA 2VL1A 1UVJA 4JOUA 4Z4FA 3IR6B 3QQCD 3IBWA 3CJAA 4H0VB 4DV1F 3TVZA 1RCHA 3AO1A 1MU2B 3UW1A 4JV5K 4G1QB 5HN0A 2ZH5A 3K5NA 4DR4F 3ATUA 4A8XA 3NS5A 3QDKA 1WUUA 3TZYA 3TZXA 3AA4A 2E6MA 4WCEQ 3WNGA 3QIDA 4RLEA 2AW0A 1IG9A 2LQ9A 2ZE2B 5LMNJ 3DU5A 4BDYA 5KFEA 1FO1A 3CMAN 4KYZA 4C4WA 2ZH9A 1WAFA 3TSQA 1EQMA 4DLEA 2Q1NA 1EKRA 3H0PA 1SIZA 3OJSA 1HYZA 1PSDA 2LQ5A 3M7VA 1OO0B 2J9DE 3WHIA 3ISNC 3V6JA 4MH8A 5C25A 2FSNA 2ZBRA 2E9TA 3OVBA 1ZH5A 4TVAB 2MKCA 5HQMA 1T9YA 2YV0X 5AQZA 3TTCA 4HTUA 1RT4B 3NE6A 4ECZA 3T7ZA 3JYTB 3QGIA 2B7BB 1HNWK 1SUQB 3RB0A 2XNRA 4DQIA 3A8KA 5K9FA 1YTYA 1IKYB 2D1KA 4XDCA 3PIOL 4HYKA 1GEHA 4M3TA 1W0HA 5HANA 2DIUA 2AQ4A 3QYYA 2E1MC 1BU6O 5F8NA 2M7SA 2R42A 4PYAA 2KM8B 3KHGA 1RHKB 4Y00A 2IA6A 4Q2LA 2A41A 4EMDA 2J4RA 4ED1A 5KQDA 1OKJA 3FEXB 2NLWA 1VHXA 2FJXA 3AHPA 4L8RB 5AXMA 1CQNA 1X5SA 4M5MA 3W8PA 4CLLA 4O5FA 3S6EA 1I6JA 4IR1A 3J81Y 4FOEA 2J8AA 2XGQA 4OIXA 1NGDA 2FLNA 4RW9A 5AXNA 2CJKA 2ZOGA 2ZOFA 1SH3A 3D3BJ 4DN0A 1KWMA 1R0BG 4NZ6A 1M5OC 3Q8UA 1VQNN 2IC3B 3HYFA 3L3VA 3IS9A 1UKUA 4JS4A 3OYJA 4YY3K 2HZCA 4HUEA 3PW5A 4PWDA 3BR8A 2E2NA 2OYQA 3ZNJ1 2ASPA 4YDUC 2F96A 4FLYA 3DXKA 2ZC4A 4ZJLA 1D9DA 1R8CA 3ZETA 3LDQA 1ZPVA 1CBKA 4DR3J 2A6OA 3THXB 3BS9A 1O13A 2KG1A 3M32A 2B5JA 2XO6A 1RBLA 1KTVA 1U1OA 3BSNA 1YWXA 1IKXB 1K9MT 1WKJA 2W40A 2VF3A 4C8ZA 2DXDA 2OPRB 1SPBP 1BO5O 2DO4A 3AXMA 3EVOA 4DX7A 3ZYYX 4UTGA 2HSTA 1T03A 1Y10A 4PHTX 1N48A 2RQKA 3KJVA 1BI4A 3H08A 3QICA 3OVAA 2CUYA 1N36F 1HBUB 4LR9A 3WXLA 3MR2A 2BQUA 3NGTA 2APOA 3FLCO 4U7BA 1TVRB 1RAIB 1FEEA 4YDUA 4DPYA 5ADXH 2EBGA 4C23A 1LXJA 3BGUA 1YK9A 2QO3A 2QJ3A 2FF6A 4G9ZA 4FK2A 3VAGA 3I5CA 5IWAF 3MM5A 3TARA 1GOCA 1D8ZA 2YJFA 1YQHA 3P96A 2OJ3A 2VD3A 3M1FA 4M5HA 2U1AA 4WTYA 5JVGQ 1ATSA 2J7WA 4LF5F 3MAAA 2ZH3A 4B02A 1VHFA 4CEDA 3GQCA 2I5JA 2CG4A 2IFXA 4X66F 3KLEB 3A5LC 2DD8S 3CXCR 4I2PA 2UUAJ 1WLJA 2WOMB 2NYIA 4ZVUB 4OL8A 2XGPA 2ERRA 4BR9A 2MQQA 1YXQA 1RDBA 3VQ6A 1WC6A 1EP4A 4DL5A 3C8YA 2BUNA 1GLAG 3PYGA 4YB1P 4LH5A 4LBIA 1VQON 1IQTA 3G96A 5K8MA 4OYXA 3O8WA 4MQ3A 3TX8A 2DHSA 5F3ZA 4HWIA 4BR2A 4IDKB 4BE1A 4OX8A 4QOTA 3GJTB 2DNZA 1FVQA 4AL7A 3P5BP 1SQKA 3QNWB 1JKHB 2PYLA 3P39A 1VHIA 4ID5B 3OFGA 4CFAA 1GT8A 3I0RA 4E8UA 1FRLA 4X62F 1XUPO 2DNYA 4J9OA 1RBAA 4CEFA 1IJJA 4AH9A 3PW2A 2HHSA 2BJDA 2QEXS 4CZJA 4B8CA 4ED7A 2R7YA 2XI2A 2KKHA 3WXJA 3L2QA 2G8WA 2W41A 2XS5A 4E1NA 4B1WB 4KT0C 4HACB 4KPCA 2CQ3A 5KPRA 3CWJA 3H90A 4OKKA 4BY9C 1UVKA 1HA1A 8AT1B 2E5LF 1TK0A 4N76A 2Q1LA 2VPZB 3OTOF 2Z1IA 2CH6A 1F2GA 3L3UA 2QTWA 3A1YG 3PEHA 5H9FK 2JLEA 1HBNB 2KHOA 4DDFA 4A5BA 1HWJA 2Q3PA 2FLLA 3W7BA 3RMCA 3HI9A 1T9VA 2QRRA 4RUHA 4KHUA 3I55S 4TLRA 4DV5J 4LR8A 2F7TA 3PJ9A 3M2VB 2OPQA 3TTFA 4QIEA 2FQQB 4A5AA 2BMBA 4DQRA 3M3ZA 2UUCK 3CCWA 2AEFA 3VGSA 3R9LA 1H74A 4GKJK 1VQ4S 4OHXA 2O5DA 3R3LA 3SDEA 3EGNA 4M63A 4C8KA 2G2ZA 2P6TA 3TJ8A 4LT6A 2Z1GA 3M05A 3VTHA 4QOZB 2RRNA 3ATVA 5B0BA 2DITA 2KH9A 5BYQA 4U9RA 4ZVEA 1ZBSA 2PA8D 1M1HA 4P74A 2ZUAA 3MR3A 2ZH4A 5KFUA 5KTQA 1DTTB 2JC1A 2PD1A 3POTA 1NK7A 3UKUB 2BM0A 2F8EX 2XI3A 3DYAB 5KFXA 5AFUA 4WF9L 1EQYA 1UAWA 2VG5A 3C15A 1RT7A 3UDLA 2DFFA 4IXCA 5ETTA 2FHMA 5IV4A 3VQPA 4LRCA 1NKEA 4HEA9 2KG0A 1CJUB 4B3OB 3SXLA 2NCKL 1FJEB 3IFEA 3JAMU 1VSJA 4OYIA 3OL6A 3G8TA 4JHDB 1PCAA 3GU0A 4AHRA 2FBXA 2B8QA 1JJ2R 2BABA 1R89A 5C42B 1FNXH 3GLJA 1WOQA 2V94A 4I4BA 2FSJA 5AQUA 4FJ8A 2LKZA 1NLVA 2AYMA 2GV9A 3PSIA 3Q22A 4C6AA 4CW7B 1RT1B 3ENHA 3VEZA 2HRTA 2R7TA 1HD0A 5HMYA 1X4EA 2D3UA 2IJRA 4QYZK 5F2RA 3QETA 4QPTA 4FW1A 3ZSYA 3QAEA 3Q8SB 3HXMA 1RHJB 4X4UA 3WDOA 4JD2A 2LEBA 3AA2A 4JV1A 1HW9A 4H4MB 5AQPA 4FJKA 1HPZA 2MKJA 4M3YA 4CIOA 1Q81T 1ZM3A 4NLBA 2YKPA 3AODA 1AA1B 4Y3CA 2MHEA 4DV6F 2YKNB 3O4QA 1UETA 1LWEA 1UP1A 1PG5B 4ITSA 1EKEA 3J8AA 4YOXA 5CD4A 3CCZA 3E9LA 1WWHA 3V2UC 2VG6A 1R0CB 4TY9A 1QSLA 3GJRB 4FS1A 2J0SD 3JS6A 1FFSB 1IBMF 3V1QA 4J37A 3OTCA 2HHUA 3NVMA 2V2ZA 2IIRA 2B9WA 4I6MB 2GC8A 3TUZC 1UA0A 4JI8J 4OV6A 2ZEJA 2L9WA 4X2BA 1U47A 3C7NA 1N54B 1RTDA 2P9SB 3EZ5A 2EFQA 1SQGA 1IG8A 1TKXB 2J8SA 5AJ3K 1VJQA 2QA2A 4A48A 3M30A 3ALYA 1XR7A 1RAJA 2CIMA 3I8DA 3D1QA 4NOHA 4CBWA 1HKGA 2R2TA 1T3NA 2BXJA 2V0NA 5DDRC 1NB7A 4NI2A 2W9BB 4YR2A 4WIIA 3GL1A 4DQSA 5LMNK 2DTJA 4DV6J 2VOOA 3N01A 3R2DJ 4ZHRA 1FXRA 5CAAA 3HLUA 1J5EF 4OV1A 2MZJA 1Z1ZA 5LSLA 2QK9A 2YNHA 1IUJA 4JKBA 4MT1A 4DLGA 3QMQA 2BJ8A 2V7YA 2X3GA 4F2SA 2RUSA 3MM8A 1ITGA 4JV0A 1RBSA 5AQOA 2ZHOA 4GO7X 1DEJA 4ZCKA 4MKYA 3U02A 7FD1A 4QU6A 5ETPA 3QT6A 1TV6A 2H5JB 1N5SA 1TUUA 3IG1A 4LREA 2O4IA 1WSRA 4RNFA 1TL1B 4F02A 2AX1A 2ITGA 5CYQB 4MLHA 4U67L 3J7ZO 1Q1KA 3MFIA 4O3RA 4YDXA 4RPFA 5AXKA 1XHZA 1Y00A 1V5IB 2VJUA 2FGCA 3OXGA 2DEIA 3EGWB 3I82A 2ZHBA 3FFIA 2NLXA 2IA0A 3BF1A 2UUBJ 4A8OA 4DCPB 2HMIA 2J0XA 4RU2A 4B3MJ 1MN7A 1SH2A 2C1EB 1BUPA 4FZXC 3F5TA 3LWLA 1PJ5A 1RFQA 1OY6A 3H6EA 4DV1K 3NH2A 3ID6A 3EKUA 1X4AA 4JLHA 3NS7B 2O67A 4X65J 4DR4K 3R5CA 3JXOA 2P5VA 2R7XA 2C3OA 4Q5VA 4TXSA 3V6KA 5HL7L 3E8OA 4RO0A 4OO1J 2FBVA 3SCXA 5AR0A 2ASMA 3DI6B 5CYMA 1HWUA 4OHWA 2JWKA 3D7SB 2FJVA 3EDQB 2N4CA 3AVFA 5L8RC 2VQFJ 1JXBA 3CFOA 4UY8O 3NGIA 2DJWA 3O3LA 4I6WA 5M1QA 3OYEA 2QX0A 2PFFB 3EJMA 3T9ZA 1K8AT 4ZPAA 4FLVA 2KW4A 4X84A 2XY7A 2H1YA 1KVIA 3OBWA 1L3TA 4CF1A 4A2BA 3NH1A 2CNNB 4ECUA 5M1FA 1YJNN 4KR0B 4EBDA 4F0HA 4NB4A 4ETXA 2OANA 4M94A 3GR0A 4CLPA 3NCQA 4OYOA 1U49A 1VQ7S 3BR9A 3AVHA 4ZPDA 4OI6A 2E66A 1WSVA 3H7HB 1A5VA 5K14A 3OL8A 1S9EA 4KV8A 1XC9A 2EKNA 3UQSA 1HL6A 5F0XA 3O1LA 1D1UA 3LGNA 1S6UA 1OPZA 4C98A 2D74B 3LPEA 4RNHA 1KD1O 3DMJB 2FXUA 3AB2B 2NRVA 2IIHA 4PQAA 4HTIA 1JWWA 2WSCC 4OZ5A 5E3RA 2V8GA 4R5PA 3PM9A 4H0PA 3RSEA 2OFGX 3OXLA 4WBFA 5HP1B 3CCVN 3NOGA 3SV4A 4U7UK 2YNFA 4HTJA 1FTRA 1UFLA 3NHGA 2GHWA 2HQDA 2UXBJ 1S76D 1Q18A 2HG4A 5E3CA 3CQYA 2G0IA 1ZA2B 2JWNA 4HHHA 1SJRA 5T7LA 2F40A 4J9QA 2FZCB 3M2UA 4Y2IA 2NS1B 4Z7CA 3B82A 2P9KB 5KGXA 2EC2A 3NDKA 2H3EB 5BRHA 3MK6A 3VVTA 1VQSA 2ZWPA 1WJ9A 3T1HJ 2W2OP 1N36K 2O3DA 2W8LA 2P9NA 2Q79A 3M6VA 3CCTA 2F9WA 2P9IB 2OEKA 4BRKA 4YOUA 2W24A 4WZQA 4FN5A 4BRMA 2VZ9A 1HYVA 3BH7B 2DPJA 4IO9L 5J2MA 1NJYA 3LP0A 4J2EA 4B1XB 4ZVFA 2JSXA 4IG0B 2YHYA 1LNQA 1T6CA 4GMKA 4IH6A 1NO8A 5IWAK 1PKUA 1T95A 5J1EA 1U0SA 4G6VB 1QS4A 1GFWB 3CJTA 4QW8A 2ZWHA 2W4CA 1YITS 2VQEF 5C24A 4PXBA 2HHHF 3AA3A 4LF5K 3FZ2A 4NEYA 4LRBA 2QYCA 2OELA 3OYDA 1ZZNA 3X3UA 1J54A 4CGGA 2D4WA 1F9EB 4X66K 2XZTB 2HKEA 2XY8A 1LCUA 4PL7A 4YHHF 2EFGA 2V2VA 4M95A 1MWZA 1YBAA 3WXMB 3C6TB 1KAYA 1SKUB 2CQ4A 4FPIA 3MXIA 1BIUA 3RJMB 5M1NA 3A8EA 1QVFR 4MAKA 4Z4EA 1HLUA 2GQ2A 3CCLN 1VSLA 1GTEA 3JSMA 1RJJA 4M5DA 2PEBA 3D0IE 1KLNA 3ZSOA 3J7YI 3EYZA 2DT9A 2AGPA 1SH0A 2OTJN 1VK8A 1P1TA 4DV5K 4DTXA 1JX4A 3OYBA 2KLAA 1N8RO 2GJIA 2LSNA 1NKCA 1VLYA 3CJ5A 3RBEA 3GIKA 4X62K 4DR5J 4RJVA 2BANA 3WC0A 4CO4A 1ILYA 3CMAS 2G4BA 3CPWR 2A1RA 4OX6A 1T3VA 2QLBB 2VQEJ 1VI7A 4BROA 4FJLA 4DG1A 4NXMF 1JIHA 2IVPA 4RUCA 5BR8F 1URRA 4OHVA 4ZKAA 4NL5A 4Q8EA 1HIYA 3SUOA 1RCXB 2D0OA 3ID8A 4RTFD 5AQFA 4JRQA 2E5LK 1EARA 1VQ8N 2D0CA 5B08A 3PACA 4CHQA 3B4MA 1VLOA 3OTOK 2CPDA 3HSGA 3ZSZA 4CK3A 4PWDB 4WFZA 3SBTA 1OH6A 3A8IA 1QTMA 3RW7A 4ZA1A 3HKWA 4I6YA 5KT4A 1S0VA 4Y65A 4CLKA 1RTIA 1LOTB 4B9SA 3R3TA 3UR0A 3L3CA 5HJYA 1BIZA 1HFEL 2ZM6F 4F25A 3M32B 2R8IA 3PY8A 1J2VA 3E66A 2FB0A 2IDOA 1F0XA 1NJIT 2EPIA 1I94F 1RLCL 1M90T 1QAYA 4LY7A 3I4PA 4FSVA 1C0TA 2B51A 3SYZA 3CC7N 1D9AA 2VDHA 4O3SA 5ETOA 5GIOA 1T8EA 4ECVA 3CXCM 1T03B 1B7FA 4Q8FA 3CM5A 1X7VA 1X4BA 2A42A 2FC9A 5KGWA 2CQ2A 3JS9A 1Y11A 4N5SA 4ISEA 1RU1A 3KJVB 3R6LB 4DR7F 2HSEB 5IT0A 4C48A 3DOLB 3CCSS 4GRSA 2FPHX 4OX9J 1GTHA 3T3FA 3QGPA 1X9JA 2CZ9A 1DY3A 4ZP8A 1JMTA 1FFGB 3LW5C 3ISZA 3O4WA 4L3KA 2VWJA 3GE1A 1JLEA 4I7FA 3ULEB 1VQNS 3O9QA 2W42A 1ZPWX 4PZVA 2Z2ZA 1S1VA 4B1VA 3QINA 4CF0A 2WTFA 3WC2A 4IFVA 3QFHA 3MM5B 5KFTA 2J76E 4ELUA 1CQMA 3UCZP 1W26A 3ZT4A 1Q78A 3I5AA 3DFEA 3TA0A 4A8WA 3MAAB 2ASJA 2QL5B 1HI1A 3ONQA 4NLOA 1H72C 2I5JB 2FYXA 3AT1B 3EICA 4RWWA 4JI8K 1RCOB 2FC8A 2O01C 4IDHA 2F65A 2JEJA 2WCXA 4G65A 2Z0GA 4Z0UA 3IBFB 2C42A 1U45A 2DHXA 2DGUA 3RWUA 1EP4B 1KR4A 4DHVA 1S7HA 3G8QA 3THWA 1TKDA 1WD6A 1C1CB 1LK7A 3WQPA 3CEDA 1ZTWA 3FVYA 1UPPA 3SMZA 4JP8A 1RT5A 4OPKA 3RB6A 4WFNQ 5AQMA 4FLTA 3B6BA 3BZKA 1PAEX 2CZVC 2I8EA 4RBVA 5C0YA 3HM9A 3QT7A 3WZ0A 3Q8VA 4PXEA 3PR5B 4JI3J 4FJXA 3LZJA 3S8SA 3VHQA 4DV6K 4ZVPB 2RS8A 4OZNA 1NSKL 4URGA 2EFOA 2VPXB 1VQLN 2DEJA 3VA3A 1A6LA 1GLDG 3BREA 2BRLA 1UVLA 5LL6Z 2QSWA 3QO9A 4JB8B 3V9WA 4MKVA 2K1RA 3NGKA 3UCUP 3Q2TC 2B4JA 1UWAA 4F3TA 4J9NA 4DF8A 3AA9A 1IBMK 2DNPA 2ZJRL 3AVAA 2P2CB 1ULRA 3ENVA 3ZTPA 5DM7Q 4JI0F 1TKTA 1UOCA 2QA4N 4KQZA 2DHGA 3C6HA 1N5TA 2G8IA 2D3O1 1WEZA 2IOCA 4FJ9A 3V5RA 1R0AB 3D1OA 2BE2A 5KRTA 4JKGB 3DGPA 3ENWA 2E20A 1EB0A 1VQOS 1WHWA 1BGXT 3M8YA 5D77A 2V4JA 2NRRA 3W61A 3D0GE 3A12A 1HR0F 4JI2F 1NM2A 3JSBA 4OPHA 1R27B 5H1SV 3W1YC 3L7PA 3GG1A 4DTUA 1NGJA 1EJ7L 1YBUA 2NR0A 1GX5A 1CXQA 4BDPA 2YI1A 2EBEA 5E3AA 3NRBA 3ZTQA 2E1AA 2FF3B 4FYYB 5KFWA 5HO4A 3VQCA 1BUXA 3TQEA 3FSIA 4KH1B 3JAMO 3Q23A 1OY9A 4F7VA 4B9MA 4YR0A 4FKXA 3Q0AA 1J5EK 5F1XA 1UW9A 3VQ9A 1JJ2M 1RDRA 1G4CA 1RISA 1CLFA 3CCRN 1X3NA 2HW3A 4ZVTB 2IGIA 3DNCA 2V68A 4MIBA 3M9OB 4KTZA 1AZSA 2KDOA 1UTAA 3PIPL 3J7YU 3PKMA 3UIQA 3A2FA 5KG5A 2QMXA 4CO3A 2L48A 5GAGI 1ZBIA 2HEKA 1XR5A 1NZAA 1VQ5N 3GTYX 2PMHA 3DXBA 4W98A 1XMQF 2IY5B 3VQAA 2VG5B 3C15B 1WACA 3EEQA 1BY9A 1RT7B 1XNRF 1UJ5A 1SJ3P 4OX7A 2YH1A 3GYGA 3R7SB 1S1UB 1P8GA 3OTEA 3ZZOA 4QIFA 3JAMY 1NK4A 2FHJD 3J7Z5 1Y97A 3BO4A 4I64A 3OYNA 4TN2A 4EU0A 5L9XA 2ILYA 1VC5A 4A61A 5A6WA 4OYBA 3M8PA 2E1PA 5HAOA 3DWLA 4YS2A 2HNYB 5A2QU 2LDYA 5EN1A 3L95X 5F41A 1T94A 3G6EN 3B6PA 3OFEA 3TAFA 3RBZA 4WYBA 3FFKB 4K7QA 1HARA 2XLJA 4BCAA 3MWBA 3W2VB 3R5BA 1RA7A 4BRHA 7AT1B 5KT5A 2RN2A 4E2FB 4MTPA 3TI0A 4O0IA 2NXUA 3S3OA 1CS4B 2CYYA 2MHNA 4JD2B 3UDEA 2ZJQQ 4A8YA 1QE1A 3ZXWA 3O4NA 1KS2A 3W3DA 1MMNA 1YJVA 1TK5A 1LWEB 4JI1F 3PYDA 4TY8A 2HBYB 3PZPA 5BJRA 2AD9A 3PVXA 4CH7A 4YDDB 3C14A 4UY85 1XMQJ 4OVLA 2GHVC 3DGVA 4JI6F 1E6YB 1EX8A 2V9WA 1XNRJ 5ETSA 1E4FT 2VG6B 2RQCA 4M41A 1XJWB 3HULA 4F04B 3VETA 4TSXA 4HR2A 2CWXA 4C8NA 3BPDA 4ETZA 1NWKA 5LJ5Y 1VS3A 3VGUA 3GOIA 1G2EA 1A7GE 3LPTA 2ROGA 3KJFB 1WORA 4QR1A 3RAQA 3THPA 4XO0A 2WONB 4RR5A 2P51A 3VEVA 3NNHA 2HF3A 3PHTA 5GAHP 4OJHA 2AJFE 4F36A 5HQ8A 4USUA 2QL9B 2RT3A 4NLWA 3SZ2A 1B3TA 4RW7A 3THVA 2A10A 3QRQA 1Y4ZB 3M30B 5D0HA 3QPIA 4ES2A 2F4VJ 1O5JA 4LBHA 1RDDA 3KLGB 5THWA 3GFYA 3M9MB 3UWTA 3NGDA 3GV7B 4F3OA 1JLQA 2CGJA 4AD6A 5DZ6A 3JTNA 1HKBA 4TYAA 1S59A 1NH8A 1RWNB 3W3SA 4NLYA 4EZ9A 4ZHRB 1WB9A 2KU7A 3A3OB 4JI1J 4P2SA 1TL3A 1WBBA 2RQ4A 1H73A 4ZVQB 4FBTA 4OI2A 5L9NA 1K6YA 2FD2A 5HLFB 1L3VA 1NM1A 3R9PA 3HPHA 4JAXA 3MM8B 3AB4B 5DG8A 4EYIB 1GLLO 2EX3A 4ZCLA 3BDEA 1JXEA 2JVRA 4WE1A 2L41A 1N52B 1Y5NB 4OLOA 1G3OA 5EX3A 1TV6B 3AO5A 2HLTA 3IG1B 4CT8A 3IKMA 3CDAA 4I56A 3KKRA 3AVLA 1PBAA 4MFBB 4I6AA 2MY7A 4E1JA 3ZX3A 1UWBA 3G10A 1E4GT 3FFIB 2Z57B 3QLHA 2CPZA 2A0FB 1FXXA 2HMIB 1K9MO 3EE9A 3MDFA 2OP5A 2OPPA 3E51A 1OIAA 3IM9A 1RBRA 4OGEA 3AAWB 4NZ7A 4KB0A 3PLAA 2RHQB 1IH7A 3D1HA 2XZDB 4NMLA 3LP2A 2MZ1A 1KLMB 3GP9A 4A47A 3IDHA 4WPAA 1KTQA 4GO5X 2E2QA 4YB7A 4IEIA 1WUAA 2P8IA 4NZ0A 3WNHA 1BA1A 3N4QA 3T9NA 3KOAA 1TU0B 4U95A 2VQEK 2MXYA 1HNXF 3M8QB 2HHHK 4HH1A 2XO7A 4ZLNA 3TABA 3PKYA 4WXOA 5BYRA 1PC5A 1N6QA 3B78A 3DJCA 2DNKA 4M5NA 5IXUA 4YOEA 2HHQA 1Q4RA 3NGYA 4YHHK 2YVSA 4DXLA 5FPMA 4M5IA 4BDZA 5T41A 1YZ7A 2O1PA 2HPUA 5AE1A 3T6BA 1R31A 3BZCA 4DV0J 1RKJA 3HHLD 2IM0A 1KAXA 2GA7A 2VBYA 5KAKA 4DUZF 4CEQA 1WDDA 2MLXA 4ZS6A 1SQFA 2HS3A 2CQCA 3SSQA 5FDLA 4BC2A 4NXNF 5KPTA 5LJWA 4GKKF 2F7VA 2UXDJ 1BQNA 2A6AA 4IO1A 5K5MA 3WNFA 3GV5B 3MCPA 4NX9A 2HQGA 3CJKB 2XSFA 5D0EA 5TKWA 2RF2A 4ED3A 5K14B 2BE7D 5GAGU 1S9EB 4CM2A 3AO2A 2HFUA 1NGBA 2RDDA 5C2FA 1YVNA 3DM2A 4OX9K 4PKDB 3LO3A 3I56N 4LF7J 3HFKA 2G0JA 3NWRA 1YJWN 1TL4A 4NXMK 3PRVA 4JUZA 3LAMA 2HURA 5BR8K 3TANA 5IT9Y 1URNA 1N4LA 3VF0B 4RW4A 1LW2B 2XCPA 2B7CB 4GC7A 1JLGA 1ROFA 2BKNA 4RZRA 4Z2XA 3MR5A 2HBQB 2DR7A 4R8UA 2R7RA 4BE0A 4A8QA 4OI4A 4DSLA 4IQX