1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
2XGPA 3OYKA 1NHUA 3V1OA 3I5CA 3LPTA 4M41A 3V81B 5J1EA 1HQEA 4DTSA 5KG6A 3SFGA 3M9OB 4IQXA 4KTZA 3O4NA 1DLOB 3IN5A 3KLFA 4NLQA 4FBUA 1SL1A 1WSHA 3KLHB 4GC6A 2YKNA 2R2UA 4C8MA 1RDDA 4O3QA 2YNFB 3KK1B 3SCXA 4AHRA 3ZT1A 5DG9A 3DOLA 3DM2A 4ECUA 1S9EB 3QEPA 3BJYA 1ZBIA 2XY5A 3DI6B 4Q43A 3L8BA 3WNHA 2YHBA 2Z1GA 2J6UA 1C2PA 4KBIA 2JGUA 4JUZA 2VG5B 1K1SA 1X9SA 5KRTA 2XI3A 1ITGA 4OVLA 2BRLA 3IGVA 5KT6A 1TL3A 2WONB 3MEDB 4BWJA 2KFNA 4DSJA 1FKOA 1SL2A 2PYJA 4FK0A 2ATLA 4IKFA 4HCCA 1Y97A 3VQ9A 4EP5A 4IFVA 4ZPAA 1TV6A 4ELTA 1CZ9A 2OZMA 4DQIA 1JLQB 4K4YA 5T14A 3M8QA 4E7IA 1BQNB 5L1KA 2CJQA 1KLMA 3SI6A 4FBTA 2BQ3A 3M8PA 1ZBUA 3DLGA 3G6XA 2XY7A 4FK2A 4DEZA 4ZVFA 1RDAA 3RB6A 5J2NA 5J2PB 2WHOA 4J9SA 5F8MA 3ULDA 4DSEA 2IA6A 4FLXA 3VQQA 1J54A 1G15A 4IG0B 5EWFA 4ELUA 1K1QA 5FRNA 1KLMB 2IC3A 4ZHRA 4CJPA 3GQCA 1TVRB 5EDWA 4Z4HA 3N6NA 1D9DA 1S49A 4QAGA 4FCYA 3SQ4A 3AA3A 1IM4A 1TK8A 5J2NB 4U6PA 3LPUA 3M9NB 3H4BA 5C25A 4TQSA 3RBEA 4CJFA 2XRIA 1NOYA 3K59A 1N5YB 4N41A 2XI2A 5F9LA 4PQUB 4HYKA 5KG0A 2E6MA 3OS0A 4CJ3A 1S0MA 4ZP7A 2HB5A 1YVFA 4O0IA 3NF8A 4Z4EA 4O44A 1JLEB 4FLUA 2WTFA 1UWBB 3NGYA 5DQIA 1VSJA 2D3UA 4F3TA 2EC0A 1RTJB 1UA0A 4BE0A 1VRTA 3KHRA 4RNOA 4CESA 3OYIA 3H08A 3PW5A 3DLKB 3KIOA 1RTHB 3S3NA 4M3YA 1ZTWA 2DTUA 1UAXA 2HWIA 3NF6A 3HO1A 3Q8QB 4KSEB 1IKVA 3C95A 1ASUA 2X6SA 2XC9A 3OL6A 4KHUA 3FRZA 3AVCA 3HVAA 4GW6A 3PV8A 2HNZA 4E3SA 1TKDA 3V9SA 3DLBA 1JL2A 1XHZA 2XWYA 3DM2B 4MK9A 4F8RA 4YR2A 4KAZA 3KJVB 2B6AB 2AGPA 3KK2B 2NUBA 2DPIA 3VQ7A 4FK4A 5KFKA 4CF0A 1RAJA 5KGWA 3OYJA 3HPOA 3G0ZA 2BGGA 3PZPA 2ZD1B 5L1IA 1XWLA 3PY8A 2YNIA 4MFBA 1A5VA 3ZSWA 3K5LA 1QUVA 4YQWA 1K6YA 5KRSA 3RAQA 1RT5B 1C0MA 3NL0A 2QKBA 4FZXC 3QLHB 4ECRA 1NK0A 4MKAA 4KKOA 3MECB 3VQBA 5C25B 1C1CB 5KFMA 2FBYA 3MFHA 5L1LA 5SWMA 3LANA 3P5JA 4QOZB 3TWHA 3KLGB 3KK3B 2IM0A 2XCAA 1C0TA 3ALYA 3T5JA 3SQ0A 3PVXA 1J5OB 2HHUA 5KG3A 2F8TA 1S6PB 4K4UA 3DRPB 3G86A 3SZ2A 1C6VA 4LSNB 3BR9A 3OYFA 1C1CA 1XI1A 4WE1B 3OYEA 4CFBA 5JS1A 4GMJB 3C6TB 2HHTA 4EEYA 3THVA 3DMJA 3VQ6A 4CIEA 4EZ6A 2OPQB 3V6HA 4IFVB 3M8SA 5KFIA 3WNEA 1BL3A 3NF9A 5KFYA 3Q8SB 2HNDA 1LW0A 4O5BA 3AVGA 1RCHA 1FKOB 3KK3A 2IAJA 4K4SA 1MU2A 5J2MB 4NLXA 3ZSZA 1CZBA 1S1XA 3KJVA 3VA0A 1KVAA 2XGQA 4KKOB 1U49A 3B6PA 2PYLA 3HVTA 2RN2A 4YNQA 4E1MA 2KZMA 2B4JA 3AVLA 2LSNA 4B9SA 1N48A 3C6TA 4CHQA 5KFSA 3H5XA 3TAPA 2ASJA 4RNFA 1JL1A 3HK2A 4LH4A 1QSLA 4TLRA 3V9XA 4KB7A 5HP1B 4ZVEA 2YKNB 4LSNA 4RNMA 2IGIA 1RT1B 1R0AA 3IRXA 1T03A 4IH7A 2W9AA 5C42B 1S1UA 4QCLA 4TY8B 3DLEA 2RKIB 1JLEA 3DRSB 2AWZA 2W8LA 2HHWA 1VK0A 3ZT3A 3CJ3A 2G8UA 4IFYB 3LP1B 1RTIA 1WSJA 1IG9A 4I2QB 3DLEB 2FBVA 3OL8A 1EXQA 3V1QA 4BDZA 1ZTTA 1RTHA 3SFUA 3NAEA 4LD0A 3KLVA 4C8LA 1RT7A 3C6UA 4NCGA 5J2MA 4NRUA 2VG6A 1SV5B 5KT4A 1JKHA 2D3ZA 3PX4A 2AX0A 2RDIA 3DRSA 4Q0BB 4J9NA 4CF9A 4C8NA 4FVMA 1JLGB 3BSOA 2BANA 3BQ2A 4RW9B 4MQ3A 3VQCA 3D0PA 2C2EA 3KKSA 4W5OA 4OKJA 3FSIA 2FVCA 3QZ8A 1CXQA 4I9QA 5KT3A 3QO9B 2A1RA 1SUQA 5KFBA 1IKXB 3SI8A 1HYSB 4IG3A 3AVKA 3KLIB 3HHKA 5F8NA 5D3GB 1JLAA 4AHSA 3H98A 5DG7A 1VSFA 3HP9A 4CK1A 3OSNA 1BIZA 2HVHA 3I5AA 1C0UB 4F4ZA 2WOMA 2PY5A 1S0NA 5KFWA 2DPJA 4RNHA 3QEVA 3OS2A 3H4DA 4E7LA 4TXSA 2R8GA 2V9WA 2HNDB 1S1VA 3L3VA 3ITHA 1HQUB 4CE9A 3ZCMA 1LV5A 1FK9B 4W5RA 1RDRA 1L3SA 1LWCB 2OPSA 3G6YA 4HKQA 1HARA 3NH2A 1NJXA 2WOMB 1BCOA 2JEGA 4FJGA 4J9LA 1IO2A 3ASMA 4DFJA 3V6KA 3VQSA 2V0NA 2DY4A 1IKWB 2AX1A 2ASDA 4ZP8A 4AH9A 1HPZA 3QIPB 5KFRA 2P1JA 2W7PA 4ZPBA 3IAYA 1DLOA 1TKZB 1WNSA 4URQU 4TY9A 2C2DA 4C8KA 5J1EB 3IRXB 1T03B 2Z1JA 4KHQA 1J9AA 2G8HA 4CEQA 3RR7A 4OL8A 5F8GA 1GOCA 1KVCA 4NYNA 3OHAA 3G10A 3QZ7A 4M3RA 3K5OA 1LW2B 5HRNA 1NK4A 4M95A 2HHVA 3AVIA 1VSIA 3BGRA 4KI6A 2O4GA 2YNGB 4K4XA 4WFZA 3NGIA 1J53A 4IDKB 1LWFB 4CGDA 1Q8IA 3MECA 2DFHA 4ED7A 3AVAA 3DLKA 1SKRA 1BGXT 5F9NA 4NCAA 2P51A 3HPGA 5L9XA 2GV9A 3OYCA 2G8WA 3KKRA 3F9KA 1EETB 5EWEA 1KFDA 1ZYQA 5C5JA 2G8KA 1UOCA 3GYNA 3AVNA 2D7SA 4EYIB 2G8FA 1D0EA 3BGRB 5FRMA 1ZETA 4KO0A 3AVFA 3AA4A 3Q8PB 4DSKA 1S9EA 4FJJA 5T7BA 4FLTA 1JX4A 4O3SA 2RDJA 4N5SA 4DQPA 2B5JB 5J2QA 4IRCA 4F4WA 3L2WA 4IDKA 4DQQA 4WYLA 4Q8FA 4CECA 4HTUA 4YFUA 3H5SA 4YR0A 3M8PB 1IKVB 2JEJA 4B3OA 5KT2A 4WXWA 1TKXB 3OL9A 3TANA 4G1QB 4ZPCA 3ZSXA 1TAQA 4NRTA 5KFFA 1RBVA 3UR0A 3RB4A 4KHRA 5KFOA 3QNNA 2P5GA 3PX0A 2RF2A 3ISND 4E0DA 4DTUA 4N47A 2CKWA 3UQSA 4QWCA 1X9WA 4Y1CA 4M42A 4M3UA 4CEEA 2XO7A 3V9WA 2E9TA 4DL7A 4DSFA 1W25A 4K4WA 3NBPA 4KRFA 2RF2B 4EYHB 2AGOA 3QGHA 2KQ2A 3L2UA 2E4LA 4RW4B 3KD1E 1KTQA 3U6FA 3TI0A 1RT6B 3VQPA 3PX6A 2D0AA 4ED2A 5EU7A 4FJHA 5K14A 3MEEB 5KG4A 4J9PA 2PZSA 1JXEA 1S0OA 4CEAA 2OPSB 3LP0A 3FFIB 5KFEA 3K58A 4J2AA 5CYQB 3PO4A 5HROB 3TAMA 3MR2A 1VSMA 4M3ZA 2W9BA 4DF8A 4OKKA 3BREA 3H5YA 3RRHA 3I0RA 1ASWA 3L2RA 4BDYA 1JLAB 3NH0A 3GIIA 2BDPA 5FDLA 4F50A 3HT3A 5JS2A 1C1AA 3QO9A 4DU1A 1SKSA 2OYQA 3VQ5A 2ILYA 2IM1A 3DOLB 5DQHA 4TSXA 1WAJA 4BWMA 2JLEA 4NLTA 1YTAA 3T5HA 3OHBA 1QE1B 1EX4A 4HUFA 1JLCA 4X2BA 4FW2A 2YNGA 2FJXA 1I39A 2FVQA 4NYFA 2HNYB 3G6VA 3SUNA 3SV3A 1JKHB 3DRRB 4K8XA 4KHSA 4JV1A 4HVJA 3SPZA 2HMIA 3HP6A 1Q9XA 4FJNA 4J9MA 3TAGA 4F4KA 2F96A 3V4IA 2C28A 3BQ0A 2IC3B 4OGCA 2I5JA 5KFCA 1JLCB 4FW1A 2O5DA 4DL5A 1VSKA 1S97A 3RB3A 4URSA 3CJ4A 4O4GA 4CJVA 3PW0A 3RMAA 1I3AA 1VSLA 1KFSA 3MXIA 4K4TA 3OYHA 1T05B 4AILC 1LWCA 3M8QB 4FJXA 4FXDA 2VWKA 1QSYA 4FJ9A 4TYAA 3T19A 1L3TA 1HQEB 2OPRB 2HAIA 1TAUA 5DGAA 3QIPA 4B9MA 3N6MA 1WSIA 4NLWA 2FLLA 1O1WA 1I6JA 4DTNA 4CEDA 3AVMA 3QIOA 4RW7B 3CIZA 2UUWA 3O4QA 1DTQA 1EP4B 1QAIA 2Z1HA 4LQ9A 3GV8B 1RT6A 3ZSRA 1NK6A 4M94A 4O44B 4B8CA 4M3XA 3D5MA 2VG5A 3OLBA 5KG2A 1RDBA 4FLWA 1S1TB 2YHAA 3P1GA 1JLBB 3I8DA 4KFBA 4K4ZA 4XO0A 4BE2A 2X78A 4LH5A 4WE1A 2IAJB 4MK8A 4ID5A 4E89A 4F4YA 5KFUA 3OSPA 3DLRA 4CHOA 2UVUA 3A2FA 4W5QA 3ZSOA 4EO6A 1LWEB 4RZRA 1ZBFA 4ICLA 3MF5A 4I2PA 4J2DA 3KMQA 1IKXA 3SUPA 3OYLA 2E9RX 3AO4A 4DTOA 2OH2A 1KRPA 3O3FA 3WNGA 3CDUA 4MKBA 4NLSA 4KE5A 4XPCA 2GC8A 3SUOA 3RR8A 3DLGB 4DLGA 1RT2B 3K5NA 3SV4A 3DOKB 3AVBA 5KFQA 1YTUA 3RTVA 3NKYA 4RU9A 1U47A 3QINA 4CK3A 3TAEA 4NLRA 1WSFA 1T05A 2GIQA 3H5UA 5DG8A 4DS5A 1NK5A 3DI6A 4CFAA 3NAHA 1D9FA 4R5PA 4NCGB 5CYMB 5KG1A 4ZVGA 3PO5A 4CGIA 4PWDA 4B9TA 4IRKA 1GX5A 3KLEA 1RT1A 4WYWA 3DLHA 4HHTA 1F21A 1OS5A 4Z0UA 3KTQA 2GBZA 5HLFB 5I3UA 3LAKA 3K5MA 1WSEA 4B9VA 4CJUA 4FS1A 2AJQA 4CEBA 2W8KA 3V4IB 1KCFA 4Q8EA 5I42A 4E7HA 1S6QB 1T7PA 4TY8A 2IM3A 5DGBA 2Y1JA 4DSIA 4K4VA 4EBDA 1S5JA 4WFXA 3VA3A 2FLPA 2UVRA 4CJRA 4F4XA 4Z4GA 4I7FA 3MR5A 2R8KA 3SYZA 1S4FA 2VG7A 4JRPA 4KTQA 3BQ1A 1RBUA 1XHXA 4DL2A 3CQ8A 3EY1A 2Y1IA 1S6QA 3L2QA 4DTRA 1L5UA 1C1BA 4CHYA 2VWJA 4KB0A 3K2PA 1HQUA 3DOKA 3BSNA 4J9OA 1NK9A 1SH0A 4QPXA 1KHVA 1NOZA 1S1VB 4CEZA 3RWUA 3OYDA 1N5YA 3ZSQA 2IJFA 5C24A 1BI4A 4KV8A 1HMVB 2BQUA 3JSMB 1W9HA 2FLNA 3MEEA 3IS9B 1NJYA 2W42A 1HYVA 2HNYA 1VSEA 4ICLB 4W5TA 1QTMA 3PR4A 5CZ1A 3VQ8A 4XPEA 3CWJA 3TR8A 3RB0A 3UDLA 1FKPA 4JLHA 3AA2A 4DF4A 3LP2B 4FM1A 3PJXA 1RBRA 4RW4A 4ZMMA 4MIBA 2HW3A 4CK2A 4DFMA 4DSLA 1HNIA 3TABA 4ECWA 4NYZA 1JLBA 1W0HA 4ZHRB 3CJ0A 2XCPA 1S6PA 4EBCA 4I2PB 3HXMA 1TV6B 4ECXA 3KMSA 2F8EX 3T3FA 1S9GA 5KFZA 4B8AB 2JEIA 3C6UB 2WCXA 4FLVA 1L3UA 2R2SA 4CJ5A 3PR5B 2BRKA 5EUHA 3QERA 4ZTFA 5C24B 1BI4B 3OYAA 2WONA 1RT3B 2R2TA 5KFTA 2ZQBA 1BQNA 4WZQA 3GILA 4RW8A 1Q9YA 4XIUA 3SQ1A 2ETJA 3JYTB 2OPPA 3HL8A 5CZ2A 4MFBB 3L3UA 2D0BA 2BANB 3BSAA 4O4RA 3I0SA 4FJ5A 5C42A 2GIRA 4FJLA 2VG7B 5J2QB 3MEDA 4N56A 5HP1A 1HMVA 3ZSVA 4GVMA 1CLQA 5KFPA 4Q44A 3AO2A 2JC1A 4KO0B 3T1AA 3QEIA 4KREA 3CDEA 1QSSA 2WRMA 4DU4A 4B3OB 1JLFB 3CM6A 2OPRA 3AO3A 4OPJA 3M9MB 4AHCA 3EPGA 4CJWA 4MIAA 3WNFA 2BE2B 4ZTJA 4CHPA 1JLFA 2AU0A 3RMCA 5I3UB 4H4OA 3CJ5A 2KFZA 5KT5A 3KLEB 1IKWA 1NKEA 3NHGA 1JIHA 4ECYA 3MTKA 4F2RA 5KFXA 3Q8RB 4O55A 4K8ZA 4U7CA 4FJKA 2Z1IA 1NJWA 4PQUA 1HJRA 1EETA 3TVKA 4IG0A 1X1PA 3H2LA 2AGQA 1TL1B 3IG1A 2KZZA 1JXLA 4CFDA 2R2RA 3PW4A 3O3HA 1WAFA 2XY8A 1XR6A 3S9HA 4ED1A 2B43A 5JXSA 4CJ4A 2W9CA 5CYMA 1TVRA 3QYYA 1WN7A 4DMNA 2XHBA 3FQKA 4GC7A 4CJLA 3LP0B 3RBDA 4ECVA 4J2BA 1R0AB 1S1WA 1HNIB 4CGJA 4QW8A 4FJ8A 2YKMA 4IG3B 4B08A 1RT4A 4IR9A 3QEWA 2FVSA 3CM5A 3NBPB 2VA3A 4IH5A 3C94A 5KFJA 4WFYA 3DYAA 4J9RA 2YV0X 2R8HA 3VQAA 3ZT2A 1NKBA 3TQ1A 4KB1A 5KGXA 4FLYA 5CYQA 2YNHA 3CFOA 3KOAA 3CYMA 1U09A 3IS9A 1N56A 3LP3A 3HM9A 4M3WA 4ZVHA 4W5NA 3KLGA 2XY6A 1S10A 4CGHA 4M45A 4RW7A 3S3OA 2DFFA 3AVJA 4ED6A 3E51A 1VSDA 1TL1A 3IG1B 5F8IA 1LAVA 1TQLA 3N6LA 3H59A 2HNZB 1U4BA 4NCBA 4BDPA 3V6DB 2OA8A 4O3PA 4FZZA 3AVHA 4FLZA 4I9LA 1SKWA 1RTDA 4IFYA 3T5KA 1RNHA 4LQ3A 2FBTA 1HYSA 3AV9A 2ZD1A 5DMRA 2Q3SA 3HYFA 5FROA 3CJ2A 4FS2A 3OVNA 1N6QA 4PUOA 3NF7A 3BDPA 4Y34A 2FJVA 4HUEA 1DTTA 4J9KA 4WZMA 5HBMB 2JEFA 1HNVA 3QGGA 4ZPDA 2BQRA 4RNNA 1QHTA 3KLIA 4Y2CA 4DL4A 4OLAA 1REVA 4OPKA 4CCHA 4ELVA 4OJRA 3HPHA 4URGA 3QEXA 3U3YA 4FM0A 2HMIB 1NKCA 2I1RA 2J6TA 2RPIA 3ISNC 4RW6B 3BSCA 3V9UA 4KHNA 4NLYA 2ILZA 4IR1A 1BIUA 4EP4A 1YT3A 4BE1A 3FDSA 4ZP6A 1FK9A 3SNNA 2VG6B 2YNIB 4NLOA 4CIGA 1RA7A 2QE5A 1DTTB 4YP3A 3HVTB 4CJTA 2OPQA 2ZE2A 4CJEA 4IKAA 4K50A 2D5RA 4IOBA 1D8YA 3V6JA 2G8VA 3OJSA 3DRRA 3CG7A 1REVB 4CGFA 4QWEA 3LP2A 4ZP9A 2QV6A 3GIKA 4KFBB 2BE2A 2R8JA 1BQMA 1ASVA 1QQCA 3EZUA 5DK5A 1X9MA 4DTXA 1HPZB 4QWAA 1RA6A 1QAJA 1SH3A 3T5LA 3NE6A 3OY9A 1J5OA 2WB4A 4ID5B 3LWLA 4E7KA 4NLGA 1D5AA 1RYSA 3QESA 3FFIA 3MEGA 4WXOA 3OJUA 1DTQB 2O4IA 2ITGA 4Q5VA 2HHSA 3PW2A 3O3GA 2ZKUA 5KG5A 2J6SA 1S9FA 2ZE2B 3I0RB 3QLHA 4OKEA 1RDCA 1IKYB 4J2EA 2D41A 1D1UA 3V6DA 4OLBA 4RW9A 1GOBA 1RBSA 1CXUA 1U04A 1S1TA 2X6NA 4RW8B 1FXXA 1RBTA 1CSJA 1Z25A 1XC9A 4N76A 4EZ9A 3MEGB 4ID1A 1C0UA 1NHVA 2ALZA 1RILA 1TK5A 2HVIA 1HYZA 1U48A 4HCBA 3TAQA 5HRSA 3QETA 3UPFA 2YNHB 1LW0B 3ZT4A 1XR7A 5KFVA 4FYDA 3ICLA 4FJIA 4H4OB 4AHVA 3V9ZA 3HKWA 1GX6A 2V4QA 5DLFA 4DQRA 3P83D 3MR3A 1TGOA 5HBMA 3SQ2A 1YVUA 5HLFA 4LY7A 3KHGA 4FZYA 4PUOB 4O4GB 3PJWA 3CO9A 4PWDB 3MXJA 2W7OA 2ATQA 2HHXA 4FJMA 4DTPA 1C0TB 4QWBA 1WSGA 3D28A 1EKEA 4KHWA 3V1RA 5D3GA 2IMWP 4RW6A 4H8KA 3NGZA 4DU3A 4NLVA 3E01B 5KT7A 3JSMA 4KHMA 5KFLA 3MXMA 1NNDA 4E19A 3CFPA 4JRQA 3RRGA 1TKTA 5KFAA 1HRHA 4FM2A 5FDLB 3GV7B 4HUGA 3UIQA 1XR5A 1VRUA 2RKIA 4CIFA 4Q0BA 1LWEA 4R0EA 4F2SA 1L3VA 2W9BB 3KK2A 3OYNA 1QE1A 1N6QB 1JXBA 3M8RA 4R8UA 4Y2AA 4Q45A 2B6AA 4JV2A 2IDOA 1KSPA 4CF8A 4I7FB 2E9ZA 1S48A 2AQ4A 3E01A 3VQDA 2EX3A 1VRTB 5L1JA 3PHEA 3CFRA 3I5BA 5F8HA 1S1WB 3NDKA 3KLHA 4QWDA 4CF2A 2OPPB 2QXFA 2HHQA 1TKZA 4O3NA 2FVPA 4KPYA 5KTQA 3TAMB 2FBXA 5SZTA 3OLAA 1QS4A 4DG1A 4M3TA 2A1SA 2DFEA 3KD5E 3V81A 4ECZA 5CY4A 2IJNA 2W9CB 2X74A 3OYBA 2QK9A 1BCMA 5HRRA 1BHLA 1TP7A 4TQRA 3I0SB 4IRDA 4JS5A 4IBNA 3TARA 1S9GB 3HVWA 4B9NA 4JV0A 1Z26A 3VQ4A 4DG1B 3S3MA 5DQGA 3ZSYA 4B9UA 3ITHB 3PW7A 4DL3A 1IH7A 3NAIA 1RT3A 4Z4FA 2HWHA 4JS4A 3IGNA 4OGEA 1RT4B 4DL6A 1IKYA 3AO5A 5KFNA 1S1XB 4AHTA 4ECTA 2UVWA 4PY5A 3KHHA 1MU2B 2VA2A 3B6OA 3EPIA 3NFAA 2E6LA 4YMEA 1KHWA 2ASLA 4H4MB 3CVKA 2F8SA 1LAWA 1MMLA 4DFKA 3KK1A 1NJZA 2YNFA 4C8OA 2I5JB 1TKXA 3H40A 4CJKA 2WK4A 5I42B 5J2PA 4Y1DA 4CF1A 3EYZA 4PA1A 1A5XA 1ZBLA 1T8EA 3RMBA 1Z4UA 3RAXA 4KHYA 2YKMB 3SPYA 1B92A 1NK8A 2P5OA 1SUQB 5EWGA 1RTJA 5DLGA 2GUIA 3NH1A 3DRPA 1T94A 3HSTB 3VN5A 3L2VA 1BISA 3GIMA 4DLEA 1C1BB 1BQMB 2R7YA 3KLFB 3MAQA 2BR0A 4KTWA 2IS3A 1NK7A 1N4LA 3LAMA 4NLDA 4TYBA 4CHNA 4Z4CA 1LW2A 4CERA 5KI6A 3OYGA 3LALA 4KV8B 2C22A 2KTQA 5KFGA 5E41A 3EZ5A 5KFDA 2IOCA 3QNOA 1LWFA 4DTMA 3KNAA 1UA1A 1RTIB 1SV5A 4DS4A 1WLJA 3DDKA 1WNEA 4NLUA 1RT7B 4EBEA 3LZJA 5KG7A 4O3RA 4ED3A 1S1UB 4KAIA 5K14B 4CJSA 2JC0A 4RUAA 1KLNA 5F8JA 4I2QA 1ZBHA 4DFPA 4CEOA 1KVBA 3LP1A 3JYTA 1FKPB 4L8RB 1RTDB 3F73A 1HNVB 4NLPA 1JLQA 3NGDA 3GV5B 4MH8A 4RUCA 2UUTA 1B9DA 1GOAA 4F3OA 3VQEA 2QKKA 5HROA 4H54A 3LZIA 4ED0A 4H4MA 1T3NA 1EP4A 3U3GA 4E7JA 3LWMA 4Z4IA 1UWBA 3AO1A 4YR3A 4G1QA 2OZSA 4LSLB 1SH2A 4MK7A 1SL0A 1VSHA 4ED8A 4O3OA 4DWIA 2EHGA 3TAFA 1RT2A 3AA5X 3DMJB 5F8LA 3OYMA 4ECSA 5HRPA 3DYAB 2IM2A 4CJQA 3CDWA 4J9QA 3SJJA 4IH6A 4LSLA 3SUQA 3PUFA 3HJFA 4NZ0A 2B5JA 3OL7A 2C2RA 1TK0A 2V4RA 4O0JA 4R8UB 4AHUA 4RG8A 4Y3CA 3RMDA 3MFIA 4DTJA 4UQGA 4FJ7A 4TN2A 2R8IA 2G8IA 2FVRA 4KI4A 4B9LA 1TL3B 2IBKA 1B9FA 1TKTB 3QIDA 4CGGA 3NMAA 3FQLA 4QW9A 3LDSA 4DQSA 2KW4A 4G3IA 2FC0A 3K57A 3NCIA 4CFCA 3MR6A 5JUMA 1A5WA 4EO8A 3D45A 4E1NA 4CHZA 2UVVA 1RT5A 1U45A 4R5PB 1JLGA 4BACA 3KHLA 3OS1A 1RYRA 5KFHA 4ECQA 3GIJA 2FJWA 3QGIA 2D0CA 3ZT0A 1VRUB 4CEFA 3HVRA
chains in the Genus database with same CATH superfamily
3HFZB 1BA0A 2VPZB 3I5CA 4LF2A 1LOTB 4L3KA 3B54A 2KYXA 5J1EA 4ITSA 1N54B 4EGLA 2YPZA 2YHWA 1TUWA 4IQXA 4MKYA 4GV6A 1VRQC 4LF8J 4DPXA 3BO3A 4BG8A 3H2VE 4C8MA 2YNFB 4TLQA 3FC9A 4HACA 3AAQA 3ZT1A 1SJ3P 3DM2A 1WB9A 4RCHA 3QEPA 1S77D 1ZBIA 1SQEA 3JAMU 4JI3F 2VQEF 3WNHA 3ADAC 3CD5A 8RUCA 2XI3A 1NB7A 2BRLA 1N0VC 1WKJA 4OHVA 4YDUC 3MEDB 4BWJA 2KFNA 2Y3YA 3UCGA 3W3DA 1FKOA 4H4KA 1SL2A 2FF3B 2BM1A 3VQ9A 5HL7L 1IJJA 4IFVA 2D4WA 2P9PA 4ELTA 3O9SA 1JNZB 4NI2A 2MY7A 1SI9A 2QLBB 2E2QA 2R7WA 4E7IA 2FYXA 2D74B 2CJQA 1KLMA 3C19A 4CZIA 2R9LA 4WP3A 3M8PA 1XIQA 3G6XA 4JI3K 3LDLA 4ZVFA 1DQ9A 3POTB 5J2NA 3T69A 1FDBA 2BJDA 3LDQA 5F0XA 5ETSA 3CCTA 3M05A 5DDQC 3VQQA 3ATVA 4ZN3A 1CS4B 1YF5L 4ZHRA 2ZOGA 1HHTP 2J5AA 4QAGA 1IG8A 4FCYA 2QC3A 4U6PA 1T3VA 2M7SA 3M9NB 3RBEA 1C4CA 1IBMF 3HSDA 4DR3F 2M4MA 2XRIA 4ZCMA 2VL1A 1N5YB 4N41A 4TU8A 3ENVA 3IA0A 1XNQF 4YY3F 3MTJA 4A59A 2HBZB 3NNCA 4DV1F 1TUUA 3OS0A 4CI0B 1GXTA 2B3TB 1S0MA 2P9IB 3DHWC 2HB5A 1YVFA 4GKJK 4Z4EA 4O44A 1JLEB 3WEEB 1YRXA 1QLNA 3GZ7A 5C10A 4RBVA 4I6MA 1RTJB 1JK9B 4BE0A 2BJEA 4RNOA 4CESA 2FUG9 2PN6A 3DLLQ 1ROFA 3DLKB 2EVZA 4QIEA 1RTHB 3MI7X 1N52B 2RUSA 2DTUA 4JOUA 4KSEB 3C95A 3NRBA 2HK2A 1I94K 2X6SA 5HMWA 3OL6A 2DCLA 3P31A 2QJ3A 5HJYA 4I0WA 2HNZA 4E3SA 1RWPB 3E1YA 3PDNA 1XHZA 3G82A 4PAAA 4MK9A 2FGOA 4FWSA 4NXNJ 4KAZA 5LMUJ 2B6AB 1X4DA 3NCQA 2A6AA 3TSPA 3BR8A 5KFKA 4CF0A 1NBEB 4ILLA 1VIXA 3HPOA 1VQ6S 2BGGA 5E0OA 2ZD1B 5L1IA 3PY8A 1NGGA 1IBKK 2RHQB 2Z2YB 1QUVA 4YQWA 3ZETB 2QN6B 2NZTA 5KRSA 1C0MA 4FWNA 2QKBA 2ZEJA 3QLHB 4MKAA 4DV4K 7FD1A 2QRRA 4OLOA 1C1CB 5L1LA 4B1YB 4XK8C 2ZITA 3LOUA 1T9YA 5IWAJ 3O6WA 2PA3A 4C1NI 2F8TA 2YPYA 2C3UA 1X0FA 3BR9A 1SC4B 1R0BG 3OYEA 3ILJA 2CADA 3FZLA 1CPZA 3M6GA 2IRXA 3HZEA 4FPRA 3Q8SB 1ZOTA 3R6MA 1XNQK 3AVGA 4CM2A 4OZ3A 1T9TA 4UZCA 5GIOA 1KVAA 3UKUA 4GVLA 3B6PA 4LFCK 2KZMA 2B4JA 1T0TV 2LSNA 1XC3A 5JJBA 3C6TA 4YDUA 4FVUA 5LJ3Y 3H46O 5FPEA 1WC1A 2JLGA 1O51A 2ASJA 2GAGC 1NSAA 1R43A 1QSLA 1DRZA 2E1YA 3IRXA 4X4RA 5C42B 3DLEA 4DI6A 5CQGA 4USHA 2AWZA 2W8LA 3ULHA 1VK0A 4WWSA 4IFYB 3J7AP 3VVTA 3LGHA 1WSJA 1WDDA 3OR1B 3DLEB 1PAEX 1E3MA 3V1QA 3L4IA 4BDZA 3OTDA 1RTHA 3NAEA 2XS2A 1W2BR 2G0CA 1DFDA 4C8LA 2FIUA 1LK7A 3OR1A 4FDFA 5J2MA 1SV5B 4IO1A 2MZ1A 4Q0BB 4WP8A 4CF9A 1JLGB 3NNAA 2BANA 4N7TA 2GHVC 2DNGA 3VQCA 2E5LJ 3G9CA 1P1LA 2QX0A 1NGHA 3FSIA 3A3OB 2FVCA 1MWMA 1CXQA 3PRBA 5KT3A 5JVGQ 5D4NA 2UUBK 2A1RA 4QZVB 1DAXA 1G2EA 2XSFA 2YHYA 4WYBA 4IG3A 2W6LA 4JI0J 4DR3K 2YKAA 4XDCA 6FDRA 1A7GE 1WJ9A 1VQ9S 1HHQA 2MLXA 1KQKA 3I5AA 3I33A 3DN9A 4F4ZA 2WOMA 5DZ6A 4ZVUB 3DWLA 3J81j 2NSBA 3UKRA 3SAHA 4ILRA 3FZMA 2O66A 4EFHA 2V9WA 3GU0A 1F3FA 3ITHA 1HQUB 1FRXA 4RTFD 1FJCA 2GX9A 2GO9A 1PCAA 5GAGP 2WVEA 1FK9B 1L3SA 1RDRA 5IT9Y 2UU9K 1HWUA 2QLFB 2FC8A 4DX6A 2Y0BB 3EVMA 5HQMA 3NH2A 2DHGA 1HL6A 2WOMB 1MN7A 4FJGA 2A0FB 4KPCA 1IO2A 4AT1B 4DFJA 3SAGA 5ETQA 1WC4A 2V0NA 1IKWB 2AX1A 2XYHB 2YY3A 2E1MC 4ZP8A 4AH9A 2GHWA 2XYGB 3QRQA 3QIPB 5KFRA 4C9DA 2Y8WA 2W7PA 3AOBA 3M4XA 5K8NA 2MYFA 3CJTA 1UAWA 5GVQA 1KVIA 4C8KA 2NS1B 2Z1JA 4DR4K 4CEQA 2O8FA 3CCUN 4UT4A 1FF2A 1KVCA 2QMWA 3V2UC 2HHHF 4QYZJ 2DYAA 4NYNA 5CXTA 1B7YB 1AUDA 1OY9A 4AYBD 4NB4A 4Z7CA 1LW2B 2IDEA 3VGVA 3CJRA 1SAZA 3UD5A 3GTYX 2APOA 3NGIA 1J53A 3D4JA 4IDKB 2XLKA 1Q8IA 3MECA 1YBTA 4ED7A 3AVAA 2NSCA 3HZ6A 3DLKA 1SKRA 5F9NA 2P51A 1NO8A 5L9XA 3I31A 3R1LA 5CHIA 2Q2RA 1ZYQA 1HQ2A 3C3LA 4Y65A 3OR2A 2QA4G 4A8SA 3BGRB 1RBLA 5C15A 3TEHB 3AA4A 1HNWK 1F5BA 1S9EA 4FJJA 1R31A 4LBIA 3J7A1 1FEHA 1JX4A 2B5JB 4DV6J 4IRCA 4F4WA 2V8GA 5LMNF 4IDKA 3F56A 4DQQA 1VQMS 3O2IA 2BBEA 4HTUA 5H1SQ 2DHSA 2V63A 2V9KA 3ENAA 3UO0A 1DURA 1KN6A 4F3QA 5FLXY 2MSSA 3AJ1A 1U1MA 1NSKL 1B3TA 2JEJA 4KRWA 2VBWA 5KT2A 4WXWA 4DZ6A 2OELA 5HATA 3NWGA 3P6YC 4G1QB 2BE9B 4ZPCA 5KFFA 4I56A 3J7ZO 4BC9A 2QA2A 3Q7BA 2YCHA 2J8AA 4RBTA 4DTUA 3MOZA 4GVBA 1K8KB 1S0VA 4JI4K 4CEEA 3D2FA 3IMQJ 5KPTA 1W25A 4K4WA 3THWB 2RF2B 3NS7B 2KN4A 2Z2LA 2KQ2A 3DRXA 5ADZA 3MM9A 3L2UA 3Q8VA 1RADB 2IVNA 2DNOA 5E2QA 4ANDA 3PX6A 2M70A 4ED2A 5EU7A 3NVKA 2PZSA 1S0OA 4GRSA 3LP0A 1UKUA 3FFIB 2ZH1A 2MZTA 3PO4A 5HROB 3TAMA 1VSMA 5E7OB 1IBLF 3VF0B 3RRHA 4QOTA 1IBKF 1WOOA 4OHYA 5ETLA 1HR0K 3GIIA 2BDPA 2ILYA 1WG4A 3SBGA 1E6YA 2VFTA 1WAJA 2L3MA 3PXGa 4CLPA 4NLTA 1MA9B 1S79A 1JLCA 1BU6O 4X2BA 1VQKS 2I6WA 1OKJA 3QAEA 4KGVB 2DXEA 1JKHB 4WFNQ 5BR8F 2KM8C 2OCEA 3UW1A 9ATCB 1O13A 4OPAA 1WC3A 3SPZA 3OTCA 2WC9A 4FJNA 2MY8A 3TAGA 4LRCA 2C3PA 3LL3A 4U7UD 1U2CA 4YHHJ 2C28A 3W61A 3BQ0A 2IC3B 5AQJA 3CDBA 1YZ6A 3MPYA 3BGUA 4DL5A 3M8WA 4QS7A 3KYLA 3H7HB 4LREA 2QSFA 3MHYA 1FJGF 3GOIA 4FKYA 4AILC 4JI0K 3M8QB 4FXDA 1HD1A 2VWKA 5D4OA 2HQ3A 4TYAA 3VAIA 4ISEA 1BG3A 2H9ZA 4CZEA 2FLLA 3MM8A 4LC9B 2QWLA 3FR0A 3T6JA 2OEMA 2HS4A 2LA4A 5GAEP 4LQ9A 1RT6A 3FZFA 2HSEB 2YXLA 2QWQA 4X65F 3OLBA 3AFGA 3OFEA 4FF1A 3I8DA 2NCKL 2A42A 2MQPA 5HN0A 1ZBSA 2QFJA 1J5EK 2D3OR 2VONA 4IDHA 2VKZG 4IZ9A 2NYHA 3HHLC 4E89A 4F4YA 4JI2F 1NM2A 3CULA 1T6CA 4W5QA 1KONA 3LDNA 1RU1A 4RZRA 3A5MC 1YHQN 3VVUA 2YWFA 4JI5F 3BF3A 2HZVA 4JNEA 4FPIA 1M1HA 1LKZA 4MKBA 4KE5A 5HL7Q 3CCSS 3ZNUA 3NGSA 3RR8A 3K5NA 4EI2A 3OTEA 4DV5K 3RTVA 1U47A 2GW8A 2DRDA 3MCAB 3TAEA 1WSFA 1T05A 3GDQA 3H5UA 3OTOJ 4CFAA 4R5PA 2EBGA 4ZVGA 3QT6A 3P49B 5KQ8A 2HIYA 3CCES 1IM6A 3D0HE 1HBOA 1HHSA 1WEXA 4HHTA 3KTQA 1S5ZA 5I3UA 4B9VA 1WUUA 4CJUA 5D77A 3FRYA 5M2PA 1U6ZA 4X4QA 5AJ3F 3D6MB 3RG6A 1BHNA 4JEPA 4TY8A 2Y1JA 4K4VA 1S5JA 4WFXA 2FLPA 2UVRA 3R5DA 4IOAL 3J7ZT 3MR5A 2QA1A 4LFAJ 2CPFA 3AH6A 4LF5F 1MWQA 1WORA 1P8GA 3GFZA 1XHXA 3PFEA 3EY1A 2Y1IA 1SS6A 1TL7A 4ZKAA 4CHYA 2CQPA 4KB0A 4WFBQ 3K2PA 1OSDA 1HQUA 5DO2A 3DOKA 3BSNA 1NK9A 4NXNK 1IVZA 4CEZA 1N5YA 3JSYA 5C24A 3JSMB 3MEEA 3IS9B 3GP9A 1NJYA 3JQJA 2HNYA 1DQ8A 1VSEA 3W8PA 4ICLB 2F9TA 4JKGB 1QTMA 3PR4A 3H8YA 4L76A 4XPEA 3L7PA 3TR8A 3PG9A 1PAUB 2OUGA 3TA2A 4WTOB 3P38A 3IDHA 2DNPA 4RW4A 1HBMA 4B3RJ 1YTYA 4OZ2A 4DSLA 4ECWA 4QIGA 1JLBA 3U1NA 1ACMB 3MD1A 1S6PA 3OBYA 4I2PB 3HXMA 1U2VB 1TV6B 3KMSA 2E5HA 3T3FA 1S9GA 4NA1A 3L7UA 1IUJA 5AXLA 4B8AB 1CQNA 2WCXA 4QU7A 5CHCB 3QERA 1X0PA 2WONA 3HFVA 4WZQA 4QQBA 3GILA 2MHNA 1WI8A 2ETJA 1QVFM 5CZ2A 2D0BA 3BSAA 5C42A 2J7WA 4FJLA 1HBUA 1W97L 1NAQA 2VG7B 4H5RA 1S59A 3W65A 2FHKA 3ZSVA 4GVMA 5KFPA 4L72B 4FOIA 3AO2A 5AR0A 5B0CA 4KO0B 3QEIA 4KREA 3CDEA 1QSSA 2WRMA 1JLFB 1CULB 4Y28C 2HGNA 3CM6A 4E2FB 3NGKA 1RSCA 3A1YG 2HS3A 2A2DA 1DZ5A 3WNFA 5J1NA 4ZTJA 4HWIA 3I32A 2VH7A 4O0NA 2AU0A 2FHOB 2HFZA 1NLVA 3IC1A 5I3UB 4H4OA 4LF9F 3BN4A 1IKWA 4DPOA 4JHDB 3PTWA 3R27A 1NKEA 3RBZA 2QZ8A 4GVEA 4F2RA 5KFXA 2P9IA 3HHEA 2VJUA 4K8ZA 4BR2A 1WF2A 3NY0A 4UOFA 4JKBA 4X62K 4JB8B 4WCEL 4BROA 3D1QA 3VEVA 1Q8BA 1RZMA 2NRWA 2UUBF 2J9CA 1TL1B 1JXLA 2DITA 3PW4A 2ABYA 1HBNB 3O3HA 1VQNN 3FEZA 5G0RA 5HANA 3DKDA 1URNA 3KUHA 2GZOA 2HBKA 1WN7A 2XMMA 3VZIA 3ZZPA 5LJWA 2DXDA 1U2VA 3FQKA 1CJKB 5L38A 2LDYA 5IC4B 4J2BA 1U6BA 3EEQA 1H98A 4HEA9 2AW0A 1QQOA 4M5JA 4CGJA 3CMQA 3G6EN 3H3NO 4B08A 4DV0K 1RT4A 2FVSA 4H4KC 3NBPB 2VA3A 3DXMA 3C94A 3W9HA 1Y64A 5RUBA 4LF1A 2X51A 3CC7S 1IN0A 2ZGYA 2R8HA 2F5GA 4V19S 3ZT2A 2CYYA 4KB1A 2QLJB 4PG4A 2X1BA 3HMJG 3CFOA 3C15A 4O5FA 4NOHA 3ZC4A 4DR4J 1QHAA 1U09A 3IS9A 1N56A 4M3WA 3VENA 3QT7A 1ATSA 1S10A 3ZZOA 4JI5J 2DFFA 3KUGA 3E51A 4RJVA 5CD4H 4Q2MA 3N6LA 4NE9C 1U4BA 2DGUA 2OA8A 2FD2A 3M1FA 2UUAK 4DUZK 1DEJA 1SKWA 2W6KA 4IFYA 4DL0C 4DV2K 1RGVA 3T5KA 3Q7CA 4B3SF 2FBTA 4K7QA 5KOWA 2Z30B 4DU7A 3HOSA 1RQ0A 1UJ4A 3CPWM 3O6QA 2FJAB 4FS2A 4BRGA 2GVZB 1N6QA 4HUEA 3AODA 1WF0A 1HNVA 3R3LA 4X4SA 3AY0A 1YGYA 5FPMA 4FNHA 4Y2CA 1OWXA 2ZNZA 2VD3A 4PABA 2EW9A 4P2SA 3EGVA 1FD2A 4URGA 3SDEA 1NKCA 2HMIB 4FM0A 2J6TA 3ISNC 2L9NA 3GG4A 3V9UA 4A47A 4NLYA 2R4FA 3N4QA 1YT3A 2WVBA 4R79A 1FK9A 2Z56B 3TJAA 1M5SA 1YHQS 2YNIB 4NLOA 4ISFA 3ET6A 4NLCA 1HNWF 1FXLA 3HVTB 4CJTA 2OPQA 2ZE2A 5AQGA 3MAAA 2D5RA 2PMZD 4IOBA 2E66A 1E6YB 2G8VA 4QWEA 2HAFA 4I6AA 1N32F 4ES1A 5BN9A 1FWLA 1HPZB 4QWAA 4DR7J 1RA6A 1SH3A 4FXWA 4RUBA 4ES3A 3KG1A 4CLTA 5A2QO 2GVDB 1RUSA 1VQMN 3L95X 4ID5B 1M5VC 4E7KA 1FCAA 4NLGA 3VGUA 1NSPA 3CJKB 1RYSA 2G1HA 3DU6A 4WXOA 3OJUA 2O4IA 1XMQJ 3O8WA 5J1PA 1UPMB 3QLHA 4OKEA 2RS2A 2G13A 4OLBA 3EDRB 4HTJA 4OYAA 1S1TA 4RW8B 1FXXA 3VEXA 3FZBA 1Z25A 5E3CA 2RJZA 2YQ0A 4EMDA 1EAYC 2NUHA 4FN5A 4EZ9A 2ALZA 1HYZA 4OI2A 1U48A 2BJ9A 3TAQA 2E1ZA 1YKWA 1LW0B 2MKCA 1VK8A 3CJAA 2HFSA 2ZKTA 3HKWA 2HFUA 5DLFA 4BRAA 3MR3A 2DNRA 4LF6J 5DETA 1WOQA 5HBMA 2DGVA 4NXNF 1K44A 2X3DA 2J9EA 1LK5A 2YH0A 2HWTA 2NREA 4PUOB 4WKRA 4Z7YA 1XQSC 1D8ZA 4WFNL 4PWDB 4DV5F 2KVQE 2HPUA 4DTPA 1T9XA 4JI1J 4J91A 3HRGA 4QWBA 2FLOA 2CZVC 4HR2A 1EKEA 1EARA 3NMRA 5I3PA 2IVYA 1Y11A 2WW4A 2QWOA 5JLFA 4AM6A 2KHCA 1R8CA 3NGZA 4DU3A 4NLVA 2P9UA 3MXMA 3CFPA 3SBMA 4I6YA 3RRGA 1TKTA 1HRHA 4FM2A 3W9JA 4HUGA 2O8BA 1VRUA 3DXKA 4F2SA 5E84A 4ZPWR 3K8WA 2W9BB 1SBRA 3TPQA 3M8RA 4R8UA 4Y2AA 4B1VA 5BPLA 1FFWB 2P9UB 1PSDA 3MM7B 2HS0A 1KVKA 2JOQA 5L1JA 5EVZA 5EX0A 4YHHF 2FPHX 1BDGA 5F8HA 2JL9A 4DBQA 4QWDA 4LFCF 3BBBA 4FWOA 4FOEA 1HKGA 4L73A 2EKNA 2CH5A 2VDHA 3TUIC 3WXJA 5A2QY 5SZTA 4BLGA 3OLAA 4M3TA 2A1SA 2IRUA 3I9V9 3TR5A 5CY4A 2W9CB 2QK9A 3N28A 2KU7A 1OO0B 4KBOA 1TP7A 2KG1A 3I0SB 3MOJB 4CJ7A 3UWTA 4AL6A 3QNWB 3HVWA 4B9NA 4JV0A 1VYAA 4OYPA 2P2CB 3PW7A 4NX9A 2GUPA 1RT3A 3QPIA 4CNZA 1J5EF 4JS4A 3IGNA 5IT4A 4CVNE 1U25A 4YS2A 2HGLA 3AO5A 5KFNA 3ZX2A 4OI4A 5GAHP 3MX5A 3NFAA 3BEGB 4X66K 2YKOA 1MMLA 3SMPA 3QJJA 1NJZA 2YNFA 2I5JB 1EWRA 3CC7N 1IV0A 5KQDA 4CJKA 3TQEA 2BUPA 3OVBA 5I42B 5J2PA 2FF6A 4FF4A 3MM5A 3P45B 2OTLS 3ENBA 1CBKA 3CDAA 1B92A 4OYOA 4DV3K 1SUQB 4FWLA 5C2CA 4MJKA 4LF7F 2WBNA 2ZDPA 3UVJA 5HMXA 2HVDA 1BISA 2UXBF 3GIMA 2O1PA 3KLFB 1PBAA 4A8QA 4BR9A 1XMBA 2IS3A 3HSCA 1ITPA 3AB4B 3LAMA 4NLDA 2QXLA 4CERA 4P75A 1SPBP 1E4GT 4C8ZA 4ED5A 3S01A 4YB1P 4QIWD 3EKUA 3EZ5A 2OLWA 3MM5B 4LIWA 5KFDA 2IOCA 3QNOA 3EN9A 3W7BA 3MWTA 2QMXA 1U6FA 2QW9A 3TTCA 2O8CA 4OX7A 1H7WA 1LOUA 3J8AA 2DGTA 1WI6A 4DS4A 4M5KA 4CZGA 5LT5A 3WZ0A 1IR2A 3VR1A 3FBEA 3LZJA 2M0GB 4O3RA 3M8ZA 4KH4A 3TUZC 1GLLO 2JC0A 2M8HA 1VLOA 4I2QA 1XQIA 5H9FJ 3H1VX 2X1GA 1UJ5A 1FKPB 1X60A 3I96A 3F73A 3M2UB 3C16A 4LR7A 3NGDA 2AV5A 3OUYB 1LEOA 3CGIA 2XBPA 3KKFA 1UW9A 2CQ3A 4RUCA 5DJBA 4F3OA 3R6GB 5IQ6A 3ETMA 2QKKA 1YK9A 3MN5A 3LZIA 4ED0A 1S72S 3J80U 4LF5K 1ZC6A 4E7JA 1NBWA 2NXUA 2ZH3A 1Q8KA 3BDEA 1WACA 1PC5A 4B1WB 4Z4IA 3MM6A 1BQXA 4TNOA 3WEEA 4YR3A 1B4SA 1GLDG 1SL0A 3KXDA 1SJ4P 4ED8A 3BYPA 1JCEA 4MO4A 3W3SA 1RT2A 4CZLA 5F8LA 1FX4A 1Z6RA 2MLZA 4B3TJ 1NGAA 4BC7A 1TK0A 2IYIA 1V4TA 3T1HJ 4Y3CA 3AGRA 3RMDA 4DTJA 2DH9A 3HJVA 3FBCA 4UQGA 3OPKA 3R9PA 4KGMA 4ER8A 3MUMP 2L9WA 4KI4A 1K9MT 1WOPA 1UZDA 2IBKA 1TKTB 3QIDA 2DEIA 3ZTRA 3VCDA 4U67Q 4QW9A 3LDSA 5AFUA 4DQSA 2X1AA 2XLJA 4ZLJA 1RWXB 3MR6A 3K8VA 3WIUA 2CRLA 1Q95G 3QWPA 1QVFR 1U45A 3OFHA 3ET6B 1B70B 3EGNA 3VQTA 1JLGA 3MXHP 4GKKF 3KHLA 3OS1A 1RYRA 2W1BA 4ECQA 2N3OA 3ZT0A 2AZ3A 2KYZA 1F9EB 3HHNB 2OTJN 1NM1A 3V81B 4DTSA 5HOOA 3GFXA 2RNEA 5KG6A 4BQLA 5GADU 4KTZA 3O4NA 4QS8A 3TSUA 4NLQA 1YBAA 4ZVTB 5BYQA 4F9OA 4GC6A 5AQTA 1RDDA 1XMOJ 1UFWA 3KK1B 3C6AA 4AHRA 5SUHA 5DG9A 1Q86T 2AHOB 4ECUA 4DV7K 4DCPB 2A6OA 3BJYA 5HO4A 5K20B 3DI6B 4Q43A 1K0TA 3L8BA 2B56A 4BR7A 4A8WA 4KBIA 2JGUA 5DDOC 2C2MB 3CCQS 1R8HA 5D15A 1R59O 5AQYA 2ZJQQ 5KRTA 2HEKA 3UKUB 3IGVA 1H6KX 1HNZK 3HTVA 4WQ5C 2JFDA 1NXIA 4DSJA 1HKAA 4FK0A 4U7BA 2C2OB 1Y97A 2HFNA 2VV5A 3KZBA 2IIHA 2V94A 3BO2A 2I2YA 3TRGA 5AQUA 1TV6A 1CZ9A 4DQIA 1RAEB 1BQNB 5L1KA 1CS4A 2COLA 2QLWA 4FBTA 2BQ3A 3DLGA 2EBEA 4JBCA 3H25A 1IBLJ 3IBFB 2UZAA 1MMNA 3QBWA 2IVFB 2W4DA 1XUPO 4J9SA 5F8MA 1B64A 1M5OC 2W2QP 2XS7A 2FHJA 3WX8A 1J54A 4HI1A 5BR8K 2Z4PA 5FRNA 1KLMB 2DT9A 1N36F 4NL5A 1H2TZ 3GQCA 2J9DA 2HSTA 1D9DA 3N6NA 4Z4HA 3R7SB 2HBMA 1RB0A 1BY9A 1U2FA 3H6EA 1IM4A 1TK8A 2ZH8A 3QT5A 4UOCA 1ATRA 3WT0A 4AM7A 3WC2A 4LJMA 3H4BA 5C25A 3BKFA 1LFWA 1RISA 1NOYA 3MWPA 5EHHA 4K0KF 5F9LA 4PQUB 1U1KA 4HYKA 3MN7A 1EIYB 2NLXA 3MMBB 4KC5A 5LJVA 4AUKA 3NF8A 3FEXB 2P9NB 1UWBB 5DDRC 1RLCL 3CB4A 3TVZA 1JJ2R 1Z2ZA 2EC0A 3MWBA 4GKKJ 2LDIA 1F0XA 3N4PA 2MKJA 3G82B 3KHRA 4MO5A 2VBZA 4BHQA 3OYIA 2PT0A 3D3CJ 4A8YA 1R7IA 1YJ9N 3S3NA 4M3YA 1ZTWA 3CC4S 1RABB 2HWIA 3HO1A 3Q8QB 2CG4A 3RAMA 3AVCA 3PV8A 3QATA 3G96A 2GHPA 2RUGA 2Z0GA 1JL2A 2LXIA 3T1YJ 5AQQA 3KJVB 1ZA2B 2N4CA 1X9JA 2CPYA 1PKUA 2AGPA 2NUBA 1M1KT 1UTAA 3VQ7A 5AQPA 4M63C 4M5HA 5KGWA 2CNNB 4H5NA 4B3TF 1FFGB 1YJ9S 1B0PA 3K5LA 2ZJPQ 5AXMA 1K6YA 3THXA 4PL8A 1XNRF 2G9OA 3R6LB 3RAQA 2MMYA 4FZXC 4CP5A 2VASA 4ECRA 1NK0A 3QGPA 1JB0C 9RUBA 2CQ0A 3BO4A 3VF2A 2FBYA 2RE1A 3D7SB 3D1OA 4HH1A 5SWMA 3LANA 5D4PA 2DY9A 4DUZF 1R6VA 2XCAA 3ALYA 4CI6A 3NXZA 3PVXA 4K2XA 1VAZA 1X4CA 5KG3A 2HHUA 1S6PB 4K4UA 1Y3JA 3HI9A 1VFJA 4LSNB 4JD2A 1F2GA 4A62A 3MMAB 5JS1A 3O1WA 2DGQA 1VOMA 4M7XA 3MAAB 1XNQJ 4F3MA 3VQ6A 4EZ6A 1Q81O 2OPQB 3V6HA 2NLWA 4IFVB 3M8SA 2KXHA 4AL7A 5KFIA 1BL3A 2H3EB 2K2PA 1TTHB 1RCHA 2BOPA 3ZZRA 1S1XA 3KJVA 2KHDA 4B3SK 3VA0A 1X5TA 2QYCA 5A6PA 1U49A 3O9RA 2CA9A 3HVTA 2RN2A 4X62J 3T1HF 1N36K 4E1MA 5AQHA 3D2FB 1RHUB 2B51A 3W1YC 4CHQA 1YDLA 4RNFA 1FE4A 4PYDA 2Y0SD 4TLRA 4HVZA 3V9XA 3VZHA 4A8MP 1YRTA 1R0AA 1T03A 3QT8A 2W9AA 4QCLA 2HFOA 1ICEB 8ATCB 2GIFA 2MHEA 3DRSB 2HHWA 3CETA 2G8UA 3LP1B 3B6BA 4OIXA 3ZNJ1 2A2CA 2EKYA 3OV7A 1P27B 1ZTTA 3PKMA 3FLCO 2HLTA 1FNMA 3N4WA 3FEYB 2AP6A 2RDIA 2DRBA 3OHRA 3CCVN 3ILIA 3OR2B 4RW9B 1LWXA 1VHXA 5A8WA 2HFVA 2NNWA 3KKSA 4JI5K 2HVZA 2KT5A 3QMQA 4I9QA 4BC2A 3MMJA 7AT1B 2JHEA 2Q66A 5AQNA 1SUQA 2HF3A 2EFOA 1HYSB 3OD2A 3HHKA 4ZJQA 3JAMY 1JLAA 5DG7A 3DAWA 1VSFA 4CK1A 3T41A 4NEZA 3IAS9 2GQCA 3VEWA 1ZM4A 3WC0A 2G4BA 2AJ2A 5KFWA 2DPJA 4DR7F 4FYVB 2D9OA 3QEVA 3OS2A 3H4DA 5E3PA 4E7LA 2KH9A 4V19J 2CPDA 2E1AA 3AA8A 2HG4A 1V3RA 3G6YA 2F65A 1HARA 5BXIA 2HHPA 1NJXA 2XNRA 3ASMA 2CPJA 2PI5A 1TFWA 2DY4A 3BF1A 1HPZA 3VHQA 2P1JA 3CCMN 2KRRA 3JSBA 4PEOA 4FP9A 1WNSA 2QWRA 2K1RB 3VAFA 2HQCA 3I4HX 3F41A 3Q86A 1U8WA 5JVHQ 4IWVA 5AQRA 4K59A 4X66J 2ASOA 4KHQA 1M90O 3AQOA 4HLBA 2EEYA 5BRHA 4AF1A 4CLFA 4UQTA 4LF7J 1X8DA 3QZ7A 1U1OA 3M5RA 4DHYA 5HRNA 5LMNK 1RKJA 3O5TB 1XN9A 3CSKA 2B7BB 3AVIA 1OH6A 2O4GA 4DV3J 2ZBQA 4I69A 1LWFB 2F4VF 4GO5X 2H1YA 3R5JB 1VR6A 2RAQA 1AA1B 4NCAA 4IFEA 3HHLD 5D8HB 5M1FA 4YDXA 3OYCA 3SSQA 2G8WA 5EWEA 2BACA 2OO4A 1C0FA 3R8YA 3WIVA 1UOCA 4B3MK 1LCUA 4CH1A 1SVDA 3LM2A 2DNMA 3KFWX 2YJFA 2ZJRL 1J2VA 1PYTA 4O3SA 2RDJA 1XK8A 4C0OC 4DQPA 1A9NB 5J2QA 4JK8A 4WYLA 3OXGA 4TU9A 4YOVA 2BTFA 3ZEUB 1RBOB 1OH7A 3JTNA 3ZTQA 3I4PA 4B3OA 4OJGA 5H9EK 3OW2M 4OLPA 3TANA 3D54A 3OL9A 3CCLN 2P6SA 3EXCX 3ZSXA 4XDDA 2QTDA 4YY3J 2MKSA 5KFOA 5GAEI 2KL8A 2MZQA 4YOEA 3QNNA 2P5GA 3PX0A 5IM0B 4E0DA 2L9DA 3PYDA 4QWCA 4JI1F 1X9WA 4OFZA 4Y1CA 4YUDA 2CPZA 3V9WA 4DSFA 4DL7A 1HWKA 3K9KA 4YORA 4KRFA 3DRYA 5IM0A 3EXYA 3CUNA 1P8ZA 3RYLA 1I1GA 4P7VA 2A3JA 4ZCKA 3TI0A 2XM3A 3HBTA 4J9PA 3MEEB 3SSRA 5GADI 1MDUB 2LEAA 4CEAA 2OPSB 4MYTA 5KFEA 3IWNC 3R3TA 2JVRA 5GMEA 4EIAA 2JWNA 5LSLA 3RW7A 1TMJA 4ALZA 4DF8A 2B9YA 4A8XA 2W25A 4H0TB 3I0RA 2NYIA 2E8AA 4PQAA 1ASWA 2LVWA 4DX7A 4LR8A 5FDLA 3UE2A 4LFBK 1QDUB 3CCJS 3PKYA 3P4IA 2OYQA 2ZGZA 4KH5A 5DQHA 3DOLB 3BBCA 4TSXA 2JLEA 3FKBA 5A8RA 3J7YP 2DISA 3QJLA 1OVYA 1M1GA 2FVQA 1ZA1B 2F63A 4YDDB 3G25A 1U0HA 2VPXB 2HMIA 4UOGA 1N88A 1Q9XA 1HBOB 2J4RA 5JLHA 3CXCM 3M2UA 3MMCB 2F96A 2LFVA 1G99A 5DM7Q 4O8UA 1GEHA 1HNZJ 2O5DA 1RTZA 3ULEB 1G3OA 4PG6A 3QFHA 3PW0A 3RMAA 1I3AA 2MSTA 1VSLA 3BH6B 4CO5A 3CCRN 2M2BA 3MXIA 3NGTA 4V1Ak 2PE8A 3K2YA 4FJ9A 2HKEA 4S0MA 1ZM2A 2OPRB 5DGAA 4DV7J 4PXDA 5L9NA 3FZHA 4USVA 3D0IE 5CE3A 1I6JA 1QTNB 4CLLA 5GAEU 3QIOA 2UUWA 4OYMA 1DTQA 1EP4B 1QAIA 2Z1HA 3MM8B 1S6OA 4C97A 4O44B 2E7WA 3FMBA 2CQ4A 2VG5A 1RDBA 3L4BC 1EKSA 2Q6CA 5AZIB 1EQ0A 2V5HG 1S3XA 1P1TA 1CJUA 2PFDA 2CZ9A 2DHXA 4K4ZA 2QT7A 5ADXH 1X5PA 4LH5A 4M8LA 4X64F 4ID5A 4CO3A 4LF9K 5KFUA 3OSPA 2NZCA 2RSQA 3GYXB 3A8KA 1HLWA 4CHOA 2KDOA 1RFQA 3A2FA 3ZSOA 4EO6A 1LWEB 1ZBFA 4A48A 4ICLA 3NOGA 4J2DA 4QU6A 4EWTA 3BPSP 3GFYA 2ZHBA 3SUPA 3OYLA 3FZ2A 4PXBA 4HH0A 4WQ4C 2OH2A 3OVSA 3ELHA 3WNGA 4XPCA 5LL6Z 4PZVA 3DLGB 1RT2B 2WTUA 3DOKB 1KQGB 5E5NA 3AVBA 4E8UA 2N7YA 3DOMA 3DU5A 1YVNA 1YTUA 4RU9A 3QINA 2BW2A 4CK3A 1Q0NA 3NS6A 1XMQF 1NNEA 2GIQA 1NK5A 4DS5A 1D9FA 4NCGB 1RKIA 2JNJA 4F0HA 4H03B 2Z58B 5IWAK 3AOCA 1MROA 3MDFA 3JXUA 3UR3C 2V6AA 2IFXA 1VQNS 3M8YA 4B9TA 2N82B 1GX5A 3U1MA 3VGMA 2VFRA 3TUJC 4WYWA 3L6QA 4LFCJ 1OS5A 4Z0UA 2DHAA 2GBZA 2PFUA 2GFFA 3K5MA 2CQ2A 4FS1A 3F0NA 4CEBA 4Z94A 3V4IB 1AZSB 1GLJO 1TELA 4QIFA 1EQMA 4OX8A 5IC6B 4DSIA 4OI3A 3FJ2A 4N77A 4EBDA 2UUBJ 3WXMB 4CJRA 1F9HA 4QYRA 2DD8S 2MPUA 4AE5A 2VG7A 5A8KA 3BQ1A 1RBUA 3CQ8A 4DL2A 2IY5B 5DM6L 1S6QA 3L2QA 5GAHI 4DTRA 2B4OA 3FBFA 1C1BA 2E5GA 4H5TA 1ULRA 5CZVA 3HHDA 3KDNA 1I5OB 3RWUA 1UZHA 4C0BA 1K8KA 3NGUA 1IJEB 2AJFE 4KV8A 5FLXO 2AYBA 2MZJA 4BCAA 1MN9A 1KVJA 1W9HA 4YN3B 2HMPA 1OSCA 2P9KB 4QS9A 4DV1K 2JLFA 2ZC4A 2CPIA 3I55N 1Q82T 3VQ8A 4UY8O 3HHLB 2QYGA 4HHHA 4P2MA 1IBMK 3BKUA 3RB0A 4KIAA 1FKPA 2B9XA 4W4MA 3AA2A 1F9FA 4FM1A 2P8IA 2FDNA 1JMTA 1G1XA 3PJXA 3W66A 4BRNA 3H45C 4ZMMA 1Q7LB 3W5ZA 4DFMA 3LA0A 2KLAA 2EK6A 3D2WA 5D0RA 1W0HA 2M52A 4ZHRB 3MD3A 1PJ7A 1S7IA 2XCPA 2BEFA 3SQGA 2MQLA 5M2UA 1WF1A 2C2NA 5KFZA 2DRAA 3LW5C 4HTIA 4FLVA 4FWPA 2R2SA 3N01A 3PEJA 4LFBJ 4ZTFA 4NWBA 5C24B 2P5VA 3OYAA 1M90T 1RT3B 5KFTA 2MDAA 4H5WA 1HWLA 3JYTB 2QWMA 1IBCB 3HL8A 2BE7D 1SIZA 2RQ4A 3I0SA 1U26A 5J2QB 3CJQA 3MEDA 3RSEA 3WHIA 1KAXA 5BN8A 1CLQA 4ZPTR 3KWIA 4Q44A 4KHPF 2JZ5A 2H4YB 3T1AA 2GVDA 5MLCQ 2CNLB 4B3OB 1CZAN 2XO6A 1HNXJ 4CLSA 2IBOA 3S6EA 2VFUA 4HTLA 5K5MA 4AHCA 4CJWA 1OQ3A 2ZBCA 1HNWJ 4FPBA 4C3KA 4FYYB 2V8HA 2PEBA 3H42A 2KFZA 3A8JA 3QFWA 2MGZB 3NHGA 3LDOA 1JIHA 4ECYA 1FESA 3Q8RB 2P9NA 4FJKA 4IEIA 2CJAA 4JI6F 2N3LA 3EJMA 2YQ3A 3GJRB 2D9PA 4B17A 3H90A 5CZXA 2XY8A 2B43A 3BN7A 1X3NA 1Q7YO 5CYMA 1TVRA 1RAHB 1VQSA 4EHTA 2MKKA 3QYYA 5I4MA 5KPZA 1URRA 3UCUP 4A8OA 4A8FA 3LP0B 4NA2A 2R7XA 1X5OA 1HNIB 1W2IA 5ETRA 4F25A 2HZCA 4QW8A 1JJ4A 2CJBA 4IG3B 4ZOSA 5B7WA 4JI8F 4LFAF 4WFYA 2AKWB 3NOCA 4MLHA 3B78A 4HI2A 4ANEA 1D3WA 5CYQA 3CYMA 1Y3KA 1GLFO 4W5NA 2H51B 1Y4ZB 3KUEA 3J7Z5 1BOTO 4P10A 4M45A 1KNZA 2R7VA 4NYOA 4BRHA 4JI8J 2G0JA 3IG1B 1RJJA 5F8IA 1LAVA 3H59A 2HNZB 4NCBA 1DBDA 3U1LA 4O3PA 4X84A 4ED4A 1S4EA 1MWKA 4A4JA 2W2OP 1RNHA 3SSSA 1HYSA 5FROA 3CJ2A 4PPDA 3CCUS 4K42A 4PUOA 3NF7A 2ZH6A 2CNOB 4Y34A 1NDLA 1DTTA 3CCEN 4J9KA 1HR0F 3MR7A 2JEFA 3M6VA 3QGGA 2BQRA 2HHHJ 2XG8A 5B08A 1VCTA 2XEXA 4DCHA 3KLIA 4DL4A 3D7EO 3OBIA 5BREA 1REVA 3IWXA 2CJXB 4OPKA 1PG5B 3QEXA 3D2EB 3U3YA 2JSXA 2W41A 1JNRB 4X64J 4IR1A 1BIUA 4EP4A 1H2VZ 4NMLA 3FDSA 1YJUA 1NLKL 1X4AA 2XB2D 4CIGA 3DXKB 4BRQA 2K8GA 3Q83A 4P7TA 2UU9J 1U1NA 4CH7A 1NGFA 1NJIT 3U4LA 4G1PA 4KGKA 4WQ5A 3ZX3A 1WELA 1FRIA 2OFGX 1D8YA 2ZZMA 1MSWD 3L9ZA 3V6JA 2ZM6F 1HNXF 4PG5A 3DRRA 1BC6A 4L3NA 2Q6BA 2QV6A 1LXJA 3GIKA 3R7BB 4KFBB 1SCJB 5BYRA 1V6HA 1BQMA 2P9LA 2YI1A 3D1HA 3EZUA 1X9MA 5DK5A 4DTXA 5LSOA 3RGIA 4CBXA 4JYAJ 1QAJA 3NE6A 2XULA 4M5GA 4FWKA 1Y5NB 1KXPA 4OV6A 2VODA 3QESA 3FFIA 3MEGA 1T9VA 3FK4A 2PAVA 4ZCLA 4Q5VA 2QEXN 3PW2A 4Z37A 3O3GA 2ZKUA 4DR5K 3GLJA 1YJNS 2J6SA 1S9FA 3AAPA 3EVWA 1IKYB 3QRPA 1E6VB 3V6DA 2M8DB 1UW4A 3CCVS 1CXUA 5AQLA 1U04A 1FW6A 1W7WA 3QDKA 2VC0A 3GJQB 5AZJB 4LRAA 4N76A 3L7OA 3MEGB 4C11B 1RILA 1RHJB 5HRSA 3GE9A 1BXNA 1IWGA 3UPFA 4MYUA 1YITS 3ZT4A 4BC5A 3ICLA 3K89A 3V9ZA 1GX6A 5DDPC 2FHMA 4M5DB 1WWHA 2I7PA 2PA8D 1OJ4A 1U1PA 4HHJA 3M6UA 4KQZA 5K8MA 1YVUA 3GL1A 4O4GB 1WKKA 3MXJA 2HGMA 3R5BA 2HHXA 4FJMA 2QIFA 1C0TB 3D28A 1GTEA 2YHXA 3PIOL 2PI4A 3VEOA 2G2YA 5D3GA 4RW6A 3A5LC 3UN5A 5HVFA 4CQ1A 3RU0A 2WSFC 5KFLA 1QVGM 4E19A 1H74A 1QQNA 5ADXA 5KFAA 2X1FA 1R8PA 5FDLB 2SXLA 3CD6S 4MMOA 1OY8A 1XR5A 3UIQA 3TOQA 3E8OA 3M2VA 1LWEA 1RXOB 4JKCA 3KK2A 3OYNA 5B8HA 3OXFA 4Q45A 4JV2A 2IDOA 3MK6A 4CF8A 5F2RA 2E9ZA 1IXKA 3VQDA 1VRTB 5AXNA 2LKZA 4HL9A 4WCEQ 2OJ3A 2EFPA 1R6YA 3KLHA 2W40A 1WEYA 2OPPB 2HHQA 4W90B 1S7HA 5KTQA 2BW7A 3W60A 2DFEA 3KD5E 3H20A 3HHLA 3CIMA 4ECZA 2BJ8A 2IJNA 4LFAK 2F4VJ 1BCMA 1BHLA 2CJYB 2UUAJ 4TQRA 4G1IA 4IBNA 4D3GA 4ZPVR 1Y00A 1JCFA 3I82A 1VQ8S 3S3MA 3CCQN 2Q36A 3ITHB 1HA1A 2DNKA 5AQXA 3G4SN 2A18A 2HWHA 1RAAB 2E1PA 1N34F 3IUCA 4OGEA 4DL6A 1IKYA 3M6WA 3ZEUA 1XBWA 2DEJA 2VFSA 4AHTA 4XH4A 2NZ4A 3SCIE 1MU2B 1FT8A 3E9LA 3MM7A 1KHWA 2VQFJ 3CVKA 4OYZA 4LR9A 3EICA 2WB1D 2ATCB 3H40A 1UETA 1T95A 5EXWA 3CC4N 2ZUAA 4PA1A 2W24A 3S7RA 3RAXA 3AT1B 4OI1A 5BPMA 2G2ZA 5TKYA 1DJ0A 3WQTA 5D4LA 3GE1A 1YRUA 3NH1A 4WU3A 3PM9A 1WKLA 2B8QA 5F1XA 5JVHL 2R7YA 3MAQA 2BR0A 3MPUB 3HKZD 2KVIA 1FXRA 2FJEB 3W0LA 4CHNA 2J76E 3LM9A 1RLDA 3T9NA 3OYGA 4CO1A 1VQ7S 4KH1B 4KY3A 1KTVA 2KTQA 5KFGA 1OYEA 3JTPA 3QSYB 5IV3A 4P72A 1FD8A 1WTFA 2PMHA 3BH7B 4LF6K 3AQPA 1UA1A 4UY85 4J9UE 4X4TA 2V52B 5DM6Q 5CR4A 1RT7B 4EBEA 3J81U 5KG7A 4ED3A 1S1UB 3VAMA 4M5MA 1XEZA 3CJ7A 4KAIA 4IEEA 4OQJA 2GVZA 1PO6A 4DFPA 4CTAB 1KVBA 3C14B 5F41A 3LP1A 2XLIA 3JYTA 3BF4A 1RTDB 5FPNA 2F9JA 1R27B 2UXBK 4MH8A 4ZLNA 3DGVA 2O8DA 2UUTA 2HF4A 1B9DA 3I56N 2MKYA 4H54A 1M5HA 1FVQA 1FE0A 2XMJA 5IWAF 3U3GA 3J7YI 4ZDNA 3CQXA 1CJVA 2ZC3A 4G1QA 2RU3A 3R5AA 2I8EA 2ROPA 1A0OB 1V5VA 3SEOA 1HKBA 4H0XB 2EHGA 3TAFA 1AW0A 3SJJA 3DYAB 4CJQA 2BM0A 4ES2A 2R7UA 1P9QC 3PUFA 3GR0A 2B5JA 4CO2A 1FRMA 1NCLA 3BYRA 4OO1J 2VKRA 3SMSA 1YUWA 1RHQB 1A6LA 2GMHA 3MFIA 2NXJA 4DUYJ 1U0SA 2E5JA 4FJ7A 4ERDA 2CQBA 3EM1A 4TN2A 2R8IA 1KR4A 3UDEA 4BRDA 3ENQA 3NLCA 3ZZZA 4G6VB 3NMAA 4M7YA 2KW4A 3K57A 2FC0A 3A5NC 2DR7A 3THXB 1RHKB 5JUMA 4LVNP 4CHZA 3ATUA 3CJBA 1U24A 2G2OA 4R5PB 1VQ5N 3Q23A 4GKJF 4ZVRB 4BACA 2GQ2A 3Q2TC 5B0GA 1UMJA 1VBKA 1NWKA 4DV7F 2R7SA 1S99A 5K9FA 1VRUB 1T3OA 4CEFA 3HVRA 2Z2MA 1FTRA 2XGPA 3V1OA 3IFEA 4M41A 3MPWA 4PKGA 2QTWA 3P5BP 3QJPA 2ASPA 4DUZJ 5LMNJ 4ENOA 3SFGA 4WKYA 1XMOK 1K9MO 2NXEA 3IN5A 3KLFA 1HNZF 1SL1A 5KOXA 2K3IA 2LQJA 4CZJA 4O3QA 1X3MA 1SQFA 4WTYA 3DOLA 2XTJP 4LIRA 3TTFA 2CQCA 3SCLE 5T7LB 2XY5A 3ZTSA 4DR7K 1C2PA 4JUZA 3AOAA 3VGLA 2VG5B 4BRLA 3JQKA 4OVLA 1HIYA 4JI2K 1TL3A 1CG2A 2H3GX 3VEYA 1TL4A 3CMAN 5FJ4A 2PYJA 2ATLA 4IKFA 2JX2A 2WVDA 1U02A 5D0GA 3AB2B 3JQMA 3S1TA 1NG9A 1HPMA 2K06A 2ASYA 2BA9A 1NMNA 3TJ9A 3BBFA 4JK9A 4DCOB 1XNRJ 1JLQB 4K4YA 4DOZA 5T14A 2NXCA 3SI6A 4OZLA 1ZBUA 3IKMA 4ZIVA 3OFFA 1G4CA 4MDAA 4FK2A 4DEZA 1RDAA 5F0UA 3RB6A 2LQ9A 5J2PB 1H38A 3UCZP 1GMVA 4I67A 3S8SA 4NZ6A 4JI7J 1NGEA 4FLXA 2BKNA 3LQVA 1ELOA 4IG0B 1G15A 1OH8A 1K1QA 4NI2B 2IC3A 1TU0B 2ASMA 2GX8A 4CJPA 3A3NB 1TVRB 5EDWA 4DR5F 3BEXA 2AZ1A 3LPUA 1VQ4N 4TQSA 5IZHA 4CJFA 3H1QA 5ETTA 3RW6A 3K59A 2XI2A 3P8BB 1RDUA 4O0IA 2GWJA 4GKKK 4C98A 3NGYA 3QICA 5DQIA 1VSJA 3EDQB 4WF9L 1UA0A 1QJHA 1VRTA 3HM8A 2RVJA 4OX9F 1APSA 1VISA 5I9EB 1UAXA 1WSRA 4FL9A 3CCMS 2D0PA 1VC0A 1VQ6N 3ZTPA 2XC9A 3T1YK 3HVAA 3O9TA 2BX6A 3IM8A 5A0YB 1UL3A 2MQ8A 1SZ2A 4YR2A 2LLZA 2EG2A 3GYGA 4CLUA 3WXLA 3KK2B 2DPIA 3BY5A 4OYIA 4FK4A 3DC2A 3PZPA 1XWLA 2RRNA 2O8BB 2GAHC 4WBFA 3DHXA 2DNYA 5LMUF 3Q22A 1RT5B 5C2GA 3NL0A 4GV3A 4JAXA 3CW2C 2OFHX 3MECB 4B1UB 5KFMA 3F44A 3LO3A 2IVOA 2KKZA 3TWZA 3P5JA 4DZDA 3KK3B 2IM0A 3AA9A 5T41A 1C0TA 4BR0A 1NDPA 3T5JA 4X66F 2M88A 4U96A 1ZAXA 1AROP 1J5OB 3JTOA 4A8KA 3DRPB 1DQAA 1C6VA 5ETMA 4DR1K 3U8XA 4Y0WA 3TTDA 1VQ4S 4AQYF 2IHR1 4P73A 2POKA 4CFBA 2VQEJ 1PILA 5EX3A 4I64A 3C6TB 1VQYA 2HHTA 4EEYA 3DMJA 1N32J 2EFNA 1SJRA 4DR3J 2V50A 4IJAA 4JV5J 5KFYA 1CJKA 4O5BA 1FKOB 2ZBPA 3KK3A 2IAJA 1I94F 1CZBA 1YITN 2XGQA 4OX6A 4KKOB 1WUAA 3THWA 5IOLA 1KS2A 3AVLA 2XHWA 4B9SA 4FF2A 4WK3A 4YOWA 3IR7B 2ZH5A 1BUPA 4GMKA 2F8HA 3TAPA 3H5XA 3CJSA 2I38A 3HK2A 4LH4A 2B8PA 3O08A 5HP1B 2LEPA 4LSNA 4RNMA 4KGXB 2ZFHA 3CCZA 4TY8B 1JLEA 2B9WA 1OH5A 5HSPA 2BJ7A 2VPWB 2LA6A 3C7NB 4BC3A 3CJ3A 3LUYA 3WQPA 2E5LF 2WSCC 2DH8A 3CO0P 4I2QB 4B1ZA 4KR0B 3UE5A 1KOOA 1EXQA 2J0QD 4CZMA 3UFCX 1XMQK 3SFUA 4NXMJ 3ISZA 1JJ2M 2U1AA 4ZCIA 3KLVA 2MEWA 1RT7A 3LPYA 4NCGA 2VC1A 4AXJA 2ITMA 2OTLN 5AZJA 3UN2A 2D3ZA 1K8AO 3PX4A 4DCJB 1Q78A 2O8EB 2A40A 2VU5A 4FVMA 5HVHA 3BSOA 4MQ3A 2C2EA 4OKJA 1FNOA 1GXLA 3QZ8A 2BOAA 4XH1A 3QO9B 4DXLA 1VQOS 4IO9Q 3R2CJ 2CQGA 2ROEA 4GO7X 1J27A 1IKXB 3AD8C 4K5SA 4ZVSB 2MQNA 3KLIB 2E44A 4P71A 2LQ5A 2ZJQL 5D3GB 5M1PA 4HHUA 1QY7A 4K43A 5GAGU 2B0GA 4DN0A 2OAUA 4YOXA 4W92B 1X4EA 5AQKA 2HVHA 3ZYYX 1HI1A 1UJ6A 1FRLA 4UF4A 2PY5A 2ZWPA 1S0NA 4DV1J 4CNYA 4RNHA 2E5IA 4TXSA 2UUCJ 2R8GA 2HNDB 2IJRA 5GIPA 3L3VA 3ZZYA 4Y00A 1IBMJ 2E5LK 3RRKA 3ZCMA 1LV5A 4FWQA 4W5RA 2YX6A 2NPFA 3PEHA 4HKQA 3THTA 3SQOP 1KD1O 2R7RA 3M1VB 2JEGA 3VAKA 1GNKA 3A8YA 4J9LA 1GTHA 1HBNA 4C11A 3V6KA 3VQSA 4BVOA 3W9IA 4A2AA 2ASDA 5JMNA 3LF0A 4LMZA 4PG7A 4CZKA 5LJ5Y 1KKHA 4ZPBA 2DR5A 4J90A 3BS9A 3R97A 1TKZB 2NUUG 2I7NA 4URQU 1PC4A 4C23A 1T03B 1YJVA 3EVOA 1J9AA 3KDOA 3RR7A 2YKPA 5F8GA 1GOCA 1WSVA 2HIQA 2DXFA 3OHAA 4B1XB 1OYDA 5M1KA 1SJQA 2Y1LB 1N5SA 3K5OA 1NK4A 1WC0A 4M95A 2HHVA 2IVPA 3FFKB 1LQ9A 3BGRA 4KHPJ 1Y5IB 3G8QA 4K4XA 4XEIA 4WFZA 1VC6A 2CWXA 3DXSX 2UP1A 2DFHA 1B0TA 1D9AA 1VQON 4B3SJ 2H4WB 1CQMA 3SDEB 3HPGA 2WBMA 2GV9A 3KKRA 4JI3J 2W4CA 1KFDA 2ZBRA 4B3TK 3RZAA 1R0CB 5THWA 3GJSB 4WIIA 1MROB 1EKRA 3GYNA 1YXQA 3AVNA 2D7SA 2G8FA 1D0EA 2Q43A 4JI4J 1J6ZA 5B0EA 4CH0S 2M5YA 4LFBF 3T7ZA 3AVFA 3OVAA 3PCOB 4I68A 1VQLS 2PBDA 1F1BB 1PJ6A 4DSKA 5T7BA 4FLTA 2QI2A 4Y6IA 2HRTA 5H1SV 4QJVA 2VYPA 1CEZA 2K3KA 4ZVOB 3JXOA 1VS3A 4Q8FA 4PXCA 2UUAF 2HZAA 3CNQP 3N0VA 2ACYA 3H5SA 4YR0A 1IKVB 3FNNA 3B8HA 2YBVA 3MMVA 5CH7B 1TKXB 4N8NA 2B9EA 3G2XA 2RQCA 4DR6F 1RBVA 4GKJJ 3UR0A 2FTRA 3Q8UA 3RB4A 4K0KJ 4K25A 1GMUA 3ILOA 3M1VA 5LSRA 4C2MA 2VPYB 2RF2A 3ISND 3C6HA 4N47A 2CKWA 3UQSA 4M42A 3MN6A 2V8VA 2ADBA 2CVEA 2Z2ZA 2E9TA 5AZIA 3NBPA 1M5KC 3H3OB 2AGOA 2EFGA 4L3QA 1O5JA 1RAIB 2E4LA 2XYPB 3KD1E 3IBWA 1RT6B 1HJOA 3VQPA 2D0AA 5T7LA 3QQCD 3U9ZA 5K14A 5KG4A 1JXEA 2MKIA 4LF6F 5DM7L 3FE1A 3R8EA 3NNHA 2F3JA 1Z2LA 2B4UA 3MDQA 5AQOA 4J2AA 4A5BA 2CPEA 2YX7A 4M3ZA 4LF4K 4HDHA 3OFGA 2FZCB 1FRHA 3BREA 4X4VA 1AYEA 2L48A 1YIJN 3P3DA 5D6GA 2AD9A 3L2RA 1JLAB 4JI6K 5E3QA 2Q0RA 3HT3A 3QO9A 4DU1A 3VQ5A 2BKPA 3JB9k 4QIVA 4BWMA 5FIIA 1JJHA 1YTAA 4LT6A 3OHBA 1QE1B 4DV4J 1EX4A 2NRZA 4HUFA 3HCXA 1ZM3A 2YNGA 2FJXA 1I39A 1NDCA 4NYFA 3G6VA 3DRRB 1S57A 4K8XA 4CO4A 3ZFVA 4JV1A 4OJHA 3IAM9 1K47A 4HVJA 4PR6A 2X7IA 3PIOQ 2BABA 3HT0A 1NH7A 2GTDA 4Z2XA 4F4KA 2G0IA 4Y2IA 1MLAA 3V4IA 1AZSA 4OGCA 4TKTA 2I5JA 4DR2F 2E1RA 3SCKE 2V67A 4PKIA 1XJWB 2VZ9A 1JLCB 4LF8F 1R89A 4HACB 2AA4A 1VSKA 2V2ZA 5AE1A 4CJVA 3P5TL 2HYIB 3QB0A 1RP5A 4DHVA 3ZZTA 2VFVA 5JVGL 3G4SS 5LM7E 3L09A 1T05B 4FJXA 1FJGK 3T19A 2HAIA 3QIPA 3N6MA 1WSIA 3CCWA 4NLWA 1Q5YA 3DJCA 1O1WA 4DTNA 2W2NP 2YH1A 3DFEA 2QEXS 3AVMA 1SIWB 2EWSA 4RW7B 4P74A 1V4SA 1U0HB 3CIZA 3WXKA 1KDNA 5LOQA 3CF5L 1KQSM 5IV4A 2ZM6J 3FGVA 1NK6A 3WUHA 1X4BA 4M94A 2BXJA 3W62A 4B8CA 2Q0UA 3D5MA 4FLWA 2A41A 2UUCK 2YHAA 4DJBA 1JLBB 3O44A 3J80O 5CA5A 5AE3A 1M5PC 3G71N 4KFBA 4XO0A 1KP6A 2VBYA 4WE1A 2IAJB 3DLJA 4QBUA 3CCSN 3M32A 1N0UA 1N8RO 3JS9A 2UVUA 5H9EJ 2P9EA 5A76A 3AARA 5JICA 2HBQB 3EE8A 3KMQA 1IKXA 4JKAA 3AO4A 1RWUA 1GAOA 2LQ8A 1RCOB 3O3FA 2I0XA 1S12A 4FF3A 1UFLA 2J8SA 4MT1A 2XWXA 7FDRA 2RE2A 3SV4A 4YHHK 4XH5A 4LF4F 4B02A 1M0SA 2KO1A 3GCWP 2GELA 3DI6A 1R8AA 3NAHA 5CYMB 3SXLA 3DOMB 3PO5A 3TUPA 3P96A 4PWDA 1N5TA 2OKQA 1RT1A 4YOUA 3DLHA 5HLFB 2LP4A 1WSEA 1NU4A 1VBXA 2F9DA 4CYUB 4J37A 2W8KA 2YKQA 3UDCA 1NMDA 1KCFA 1TYQA 4YEAA 4E7HA 1S6QB 3D6FB 3BPDA 4DPYA 2IM3A 3CMEN 4M1KA 1N8RT 4Z4GA 4I7FA 2R8KA 2LYVA 1KBRA 3SYZA 1Q82O 1KC8O 4JRPA 4PHTX 4KTQA 3C65A 2RRBA 5F3ZA 1BWFO 2HURA 1PJ5A 3VGTA 4J9OA 1SH0A 1KHVA 4OJ1A 1RI7A 1S1VB 3OYDA 1AT1B 1ESVA 1P6TA 3ZSQA 2IJFA 3MGJA 2BQUA 2CJ9A 5AJ3K 4JI1K 5AQVA 3SBTA 3F5TA 1W26A 2HBJA 1RGIA 2W42A 1HYVA 1NB2A 5CZ1A 3N5FA 2GEMA 4DPTA 2DGOA 4L6V3 1WC6A 3SIPB 1N5VA 2FZGB 1WEZA 1G6BA 1LFPA 3UDLA 2N4DA 4JLHA 4O23A 2PDAA 4DR6J 1UEUA 3I55S 1G7CB 4MIBA 1HNIA 3TABA 3MUTP 4NYZA 2ZDOA 2AEFA 3H0PA 3D3BJ 2DR9A 2K1RA 4DV2F 3CJ0A 4EBCA 3A5OC 4GVBB 5M2RA 2OEKA