1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
1JXEA 4NCAA 3FFIA 3L8BA 3HT3A 3PR5B 1K1QA 2VG5A 1T05A 3QYYA 3M8QA 4IBNA 2C2DA 1RTDB 1RT6B 4K50A 1MMLA 3B6OA 4IH7A 4RNFA 4JS5A 4DTRA 3M9MB 4J9SA 3SUQA 2OH2A 5KFIA 4DL3A 4KTZA 4TLRA 1LV5A 4OPJA 1SKSA 1NK7A 3NKYA 1S6PB 3MEEB 4ZPBA 4EEYA 3QNNA 3CVKA 5L9XA 4CIEA 5L1KA 4PY5A 1RA6A 4TXSA 4ED2A 4CF0A 4DTSA 1N48A 2HWHA 1TQLA 1S10A 4KO0B 1QQCA 3ZT1A 4J9RA 1ASVA 5FROA 3V81B 1LWFB 5HROB 1SV5B 4H4OA 2UVUA 4HYKA 3ISND 3OYJA 4LH4A 1JXBA 4X2BA 2ASJA 4RNNA 5DG8A 2UVWA 3K5OA 1RTIA 2ASDA 4FZXC 4EO8A 4CK3A 4XO0A 1VK0A 4N76A 4EBCA 4KPYA 2XY8A 1KFDA 4YP3A 3PW2A 2FLNA 3S3MA 1RT1B 3V1OA 3OYGA 2FVCA 1JLBA 3BQ2A 1GOBA 3KIOA 4FZZA 3MEGB 4W5QA 1T7PA 3PHEA 1LW0B 4CERA 3DRSB 5HRRA 3NF9A 4CFDA 4PWDA 4F4ZA 1D5AA 1SKWA 5I3UA 3V9WA 3SUOA 2FC0A 3AA2A 4FJMA 1SH0A 4CEEA 4W5RA 4RW4B 3ZSVA 3RTVA 4LQ9A 3T3FA 1IKYB 4CHZA 5KT3A 1BCMA 4KFBA 5K14B 2ZKUA 3CO9A 4ECYA 1CLQA 3OS1A 3N6MA 1REVB 1LW2B 3C95A 5KG6A 1CZ9A 1C2PA 1RBRA 3PV8A 4NLWA 3RB0A 1U04A 2P1JA 2PYLA 1S1TA 3NAHA 5C5JA 1EKEA 1I6JA 3NAEA 4K4ZA 5HRPA 1BISA 4ECWA 3QO9A 3CFRA 4M3RA 1HQUB 4CHOA 4O0JA 3ISNC 1HNVB 2HNZA 2VG6A 2R2RA 1IKVA 2HVHA 4CJKA 4HCCA 4FW1A 4DQPA 4IFYA 3KMSA 1RYRA 1MU2B 4J9QA 2O5DA 4URGA 3IN5A 3HVRA 4FJGA 4OKEA 4E7JA 4B9SA 4DU3A 3VQBA 2VA2A 5SZTA 5FDLA 4PQUA 4B8AB 2W9CA 4NYFA 3SFGA 3ITHA 2KQ2A 4E7LA 2AGOA 3NF6A 3OVNA 1T03B 1XR6A 1GX6A 1SH2A 4HUGA 2RDJA 1S1VB 3T19A 3CJ3A 4ZPAA 3AVFA 5KFTA 5KGXA 1S9GB 3BSOA 1W9HA 1NKEA 3CFOA 1NK5A 4O3RA 3AVMA 3MF5A 4OLBA 5KFLA 4K4WA 2BE2A 1BL3A 2D41A 1CXUA 3LZIA 3VQDA 1NJZA 1XC9A 2GIRA 4Q5VA 4ZVGA 5D3GB 3L3VA 5KG3A 5I42B 3BSNA 2D0AA 4KSEB 4Q0BA 2F8EX 3FQLA 1S0OA 3SV3A 2IS3A 3MEDB 1Y97A 3MFIA 4FBUA 4FLUA 2LSNA 4CECA 3T5HA 4Z4HA 4F8RA 3TAMB 4KI4A 3VQQA 2O4GA 4I9QA 3PO5A 3SQ1A 3VQCA 1SL2A 4NZ0A 2HHQA 1HYSA 3VQPA 2YNIB 3O4QA 4WXWA 2EC0A 4KHQA 5KFWA 1RDCA 1Z25A 1WNEA 2V4RA 4DQQA 4LQ3A 1QAIA 2WHOA 2ITGA 3FFIB 4TN2A 2W7PA 4Q45A 3GILA 3RMAA 2HVIA 3QGGA 3AO3A 3M8QB 4EZ9A 2HHUA 4O4GA 4NRUA 5DQIA 4N47A 2FBTA 5HP1A 1S1UA 4LD0A 1L3SA 1JIHA 1NKCA 4F3TA 1KRPA 5C42A 4F4WA 3SZ2A 5C25A 4URQU 5KTQA 3QGHA 2WK4A 2HHSA 4CGJA 4E1MA 1RDDA 4KHRA 4QPXA 3NFAA 4CJUA 4TY8A 1U48A 2DY4A 3BSCA 3K59A 4MKBA 3QZ7A 2QK9A 3TAGA 4DWIA 4Q44A 3L2WA 1Q9XA 2V4QA 2Z1IA 4QWEA 5SWMA 4FM2A 1A5VA 3D0PA 3MR6A 1RT5B 1RT4A 4IDKA 2ALZA 1LAVA 2WONA 2R2SA 2AQ4A 2HNDA 4HKQA 2YNFB 4H4OB 3WNEA 5KFVA 4BE1A 1YVFA 4IKFA 2D0BA 1TL3A 3M8SA 4RZRA 1IO2A 4R5PA 1NK4A 3KLGB 5C24B 5DLFA 4WFYA 3AO4A 2WCXA 3LWLA 1RBSA 4QAGA 2X74A 4HHTA 4ZPCA 4PA1A 5CYMA 4DTPA 3HHKA 1C0MA 1JLBB 3OHBA 3TQ1A 1TV6A 1K6YA 3RR8A 2JLEA 4FLTA 1Z26A 3OL8A 2ETJA 5DG7A 2XO7A 2BDPA 4FJJA 3DLEA 1N4LA 5I3UB 3MAQA 4ECQA 4ID1A 5JS2A 3HKWA 2XGQA 2YKMA 5KT2A 2GUIA 1B9DA 3PX6A 4DTOA 3OYNA 3QEIA 1NOYA 3H4DA 3KHLA 3OJSA 3LAMA 3AA3A 4FLXA 4RNOA 4WFZA 5EWGA 1ZBLA 1BIZA 4ZP7A 3ZSOA 2JGUA 1U4BA 1U09A 1S1TB 2I5JA 4BACA 1TKTA 4U7CA 2UVRA 4O55A 1EETB 5DQGA 2QKBA 1HNIA 4CGDA 2W8KA 3RWUA 5EU7A 5KG0A 4C8NA 3SUPA 3QO9B 4OKKA 1DLOA 4ZVFA 4DF8A 1JLGA 3LAKA 2DFEA 4AHUA 2HNZB 4CIGA 5KFYA 2IDOA 2PYJA 4MFBB 4CIFA 5J2MA 4CEBA 3DI6A 4IFYB 4FJKA 3OYIA 3DYAA 2IM2A 5FDLB 4PQUB 1QTMA 4M3TA 4C8KA 3OHAA 1JX4A 4KKOA 1VSFA 3OYCA 2W9CB 4CJEA 4H54A 1HPZA 4YQWA 3ZT3A 3MFHA 4CK2A 3PR4A 5E41A 1IKXA 4IRKA 4NLQA 4WXOA 3H5SA 4O3PA 4CGHA 4CGIA 3E51A 3H08A 4EO6A 2E9TA 2W8LA 5KFPA 2IJNA 4RU9A 4NLTA 5KRTA 3UR0A 2HNYA 1B9FA 4Q0BB 2ILZA 3AVIA 2YNHA 3D5MA 4TYAA 2VA3A 2GV9A 2R7YA 2E4LA 3NBPA 1RYSA 4ELVA 4WYLA 4RW8A 4Y34A 1C1CA 4KHSA 3NCIA 5KFCA 3NH1A 3DRRA 3GYNA 3QEVA 3OL7A 4ED0A 1XWLA 1F21A 3QEWA 1TKZA 1HYSB 1YTAA 5KG5A 2OZMA 1ZBHA 5KFBA 1S6QA 4CJQA 4M41A 5CZ2A 2BR0A 4O0IA 5KT4A 1JL2A 2A1SA 5EWFA 3BR9A 4O5BA 3RAXA 4M45A 3PW4A 4QWDA 4DL4A 3NGYA 4EP5A 4O4GB 2B6AA 4CHYA 4RW9B 4DFMA 2X6SA 1NK0A 1S1UB 4FJ9A 4Z4CA 3L2QA 1HRHA 4IRCA 3DRPA 5C42B 3CYMA 5C25B 1XR7A 3HVTA 2X6NA 4DMNA 4FM0A 2IM3A 4I2PA 2F8SA 4QW9A 4KB1A 2Z1JA 4DSKA 4ZP6A 4Z4EA 1UOCA 4TY8B 4TSXA 4FJXA 1NKBA 2XC9A 4OLAA 2OYQA 1IG9A 3QINA 3KLEA 2KFNA 5JS1A 1ITGA 3K5LA 4E7HA 2RF2A 2WONB 3RRGA 3O3HA 2HNDB 1JLAA 1OS5A 4IR9A 3LALA 4DLEA 3VN5A 3O3FA 4CJLA 1L5UA 1FXXA 1TL3B 3DOKA 3PX0A 3K5MA 1A5XA 4R5PB 1SUQA 3QLHA 1KSPA 2B4JA 4ELUA 3OYFA 4NLRA 4J9MA 4CFAA 3AO1A 3QNOA 1FKPA 4KV8B 4WE1A 4KBIA 1UWBA 2BANB 1U49A 2OPSB 3EZ5A 5J1EA 4ZVEA 2ZE2B 4EP4A 5CYMB 3VQ4A 4CJFA 1NK8A 1XI1A 1TV6B 1NJYA 3GIMA 3NH0A 2ZD1A 3LPUA 3KK2A 5HBMA 3DLEB 1LWEA 4M94A 3PZPA 1D9FA 3PY8A 3VQ7A 2YKMB 5EUHA 3CJ2A 1KTQA 3MXIA 4ZP9A 2Q3SA 4MK7A 2FBVA 2P5OA 5KFOA 2GBZA 5J2PA 1WSJA 3RMBA 1JKHB 4BDPA 4FJNA 4BDYA 3C6TB 1ZBUA 3GQCA 1WLJA 3MECA 3AVHA 3S3OA 3SCXA 4FBTA 4W5NA 1TKTB 4F4YA 3LWMA 3AVCA 3DMJA 3AVJA 1HNIB 5F8LA 5KFKA 4JV2A 2R2UA 4DQRA 2XWYA 4AHSA 5DMRA 1DLOB 1VSEA 3NF8A 4N41A 1JLGB 3OYEA 4H4MA 3RMDA 1WAJA 3H98A 2PY5A 1KLNA 4IG0A 4Y3CA 1C1AA 5J2MB 5F8NA 3G6YA 1KFSA 3DDKA 3OL6A 3RB4A 4CF9A 4F3OA 5KFMA 4C8LA 1BCOA 4ECVA 4I2QA 3DLGA 1EXQA 3DYAB 3VQ9A 4K4XA 1FKOB 3VQAA 4KKOB 3OSPA 2HB5A 5KFEA 3VQEA 4LSNB 4G1QB 5KT5A 4G3IA 3IG1A 3EY1A 2IOCA 3PJWA 3UPFA 3AVLA 1HPZB 2OPPA 4KHYA 1RT7B 4CHNA 1Q9YA 1D8YA 2YNGB 3EPGA 3V4IA 4OGEA 2I1RA 2OPRA 4IH6A 3AVBA 3C6UA 4H8KA 3KHHA 1ASUA 1SL0A 3NMAA 1S4FA 1C0UA 4KAIA 3HM9A 4HCBA 2DFFA 4WZMA 5KG4A 5KFHA 3IAYA 1RTHA 4AILC 4I7FB 2HNYB 3BSAA 3KJVA 3MXJA 4CEDA 2XI3A 3SQ0A 4XPCA 2YNHB 4DSIA 3T1AA 3P1GA 4EBDA 4TQRA 2FJVA 1RTJA 4O44A 1NK6A 3OSNA 4RW8B 1BQNA 1C1CB 4IR1A 2R8GA 2RPIA 3K2PA 2EHGA 2RKIA 3EZUA 2AGQA 4IRDA 4NLGA 5J2QA 3DRRB 4JS4A 4CJSA 4CFCA 4RG8A 3TANA 3HPHA 3V9UA 5F8IA 3QIPA 3KK3A 1TKZB 2QXFA 3U3GA 4CJTA 3E01B 1JLQA 3NGZA 4FJLA 1S6QB 4C8OA 4E19A 4DQIA 1VSMA 4MK9A 3HPOA 1BHLA 3HL8A 3KTQA 4J2EA 3AVAA 2W7OA 4ICLB 1BQMA 1RBTA 3I5BA 4Q8FA 3MXMA 3CJ4A 3D45A 4FJHA 2B5JA 2ASLA 4E7IA 3LP1A 3UQSA 3D28A 2W9BA 3FSIA 3DLHA 1A5WA 2F96A 3SQ2A 3DRPB 2KFZA 5KRSA 3KNAA 3THVA 2OPQB 1JLFA 2HHTA 3HVTB 4AHRA 3DLKA 3I0RA 4ZTJA 2E6LA 2XRIA 5F8GA 4AHTA 1ZETA 1BI4A 4NLDA 1TP7A 4CEFA 1NJWA 1QHTA 2KW4A 3TWHA 2YKNA 4N56A 4MK8A 2D3ZA 5KFQA 2VG5B 1T05B 1S0NA 3KK1A 3KLEB 2O4IA 4IG3A 3ICLA 2RF2B 4DG1A 4DL6A 2V9WA 1JLAB 4ECXA 2BGGA 3KLVA 4CK1A 3SYZA 3DOKB 3WNGA 2JC1A 1S1XA 1SUQB 4RUCA 4CJRA 4RUAA 1J53A 1S1WA 2AX0A 5L1IA 3KOAA 4ECUA 3OL9A 2AU0A 1FKPB 4FLVA 4WE1B 1X9MA 1UWBB 4DSFA 3BQ0A 3SV4A 4DFPA 5J1EB 3TARA 4ED3A 1VSIA 1RCHA 1HQEA 5CYQA 4B9NA 1TKXA 1DTTA 4CJ3A 1FK9A 2FBYA 5F9NA 2ZD1B 3S9HA 1QSSA 3KK2B 1WN7A 4NRTA 2FLPA 3AA5X 3DM2A 3V6DA 4F4KA 1C0TA 5J2NA 4XIUA 2VWJA 2C2EA 4K4UA 3CJ0A 4UQGA 2BQRA 1RTIB 1W25A 2KZZA 2QKKA 3KD5E 3G86A 5J2PB 3I8DA 4QW8A 3TAEA 4BDZA 4BE0A 4NLPA 5KFAA 5F8MA 1IM4A 4DSEA 3KKSA 4HUFA 3DMJB 3B6PA 3I5CA 3Q8SB 4PWDB 2UVVA 2OA8A 4B9VA 3Q8QB 1XHZA 2J6TA 4ECZA 4KB7A 4H4MB 2IMWP 3H5UA 3T5JA 4KO0A 4RNMA 3KHGA 3H4BA 4KFBB 1KVAA 3V81A 4MIAA 3Q8RB 4JRPA 4FS1A 1SV5A 1EP4A 3AVNA 4R8UA 3DLGB 3G0ZA 4BE2A 5DLGA 4TY9A 3TAQA 4K4VA 3ZT2A 1NJXA 1YTUA 2HHWA 3ZSZA 4MQ3A 3IG1B 2R8KA 5CZ1A 4DTXA 2OPPB 2Z1GA 4CGFA 3V9XA 4EYIB 3O4NA 1HYZA 3N6NA 4EBEA 4ED7A 3L2RA 4FJ8A 3V4IB 1RT1A 4Z0UA 4GC7A 4M3ZA 4B08A 3I0SA 4DTJA 2VG6B 2OPRB 1IKVB 3MEGA 3C6UB 5DQHA 1C0UB 2UUTA 3HO1A 3TI0A 4Y1DA 3PW0A 1CZBA 4KB0A 4W5TA 3L2UA 1RTHB 4URSA 3ITHB 4WYWA 1X9SA 4YR0A 1R0AA 1RNHA 4E3SA 2BRLA 2FJWA 1RTJB 4MIBA 1QUVA 1W0HA 4O44B 4TYBA 3EYZA 3TAPA 4Y1CA 1BQNB 4CEQA 3BGRA 1J5OA 4ECRA 4FVMA 3PUFA 3RAQA 2BQUA 1JLEA 5J2QB 4IQXA 3QERA 3GIJA 2D3UA 5L1LA 3KK3B 2BE2B 3RB3A 1LWCA 2C22A 2IBKA 2VWKA 4Z4IA 4RW6A 4M95A 4K4TA 1HNVA 1IH7A 3NHGA 4CCHA 5KGWA 4FK2A 1BQMB 2DFHA 2CKWA 3WNHA 1KVBA 3G6XA 4ECSA 3EPIA 3M8RA 4FYDA 4RW7A 4FW2A 3ZSRA 4J2DA 2B5JB 2R8JA 4CE9A 1D0EA 4DTMA 1VSKA 1SL1A 3BJYA 3LDSA 3KLHA 2Y1IA 1L3TA 2R2TA 2IC3A 2HMIA 2ATLA 1JLFB 3QGIA 1TL1A 4AHCA 2EX3A 2QE5A 3V1QA 3DLKB 3I0RB 2UUWA 3O3GA 2E9ZA 4J9NA 5KFXA 4B9MA 3FRZA 3AVGA 1BI4B 1L3UA 1N6QA 3CDWA 1S9GA 3K58A 2YKNB 1WSHA 4E89A 3KK1B 4IG3B 3CJ5A 2CJQA 4DG1B 5HP1B 2IM0A 1RBVA 4CJ5A 2G8HA 2Z1HA 3QIOA 4Z4FA 3NL0A 2YHBA 4DS4A 3VA3A 4B3OA 1VRUA 3HVWA 1G15A 4ELTA 4M3XA 1S1XB 2R8HA 3NH2A 1QE1A 4NLSA 2KTQA 3VQSA 3KMQA 1S1WB 2XHBA 4E7KA 3RRHA 2WTFA 3M9OB 1TVRA 3FDSA 2RDIA 4O3OA 3SI8A 2JEJA 3JSMA 4F50A 4DLGA 3MR5A 4CGGA 1HQEB 5CYQB 4IOBA 1GOAA 1TKXB 2YV0X 3IS9A 3CM5A 1FK9B 1RT4B 4IDKB 3F73A 4LH5A 1ZTWA 2XI2A 3DM2B 2OZSA 3V6DB 2ILYA 3PVXA 4W5OA 3TABA 1C0TB 5J2NB 1C1BA 1WSEA 4C8MA 1I39A 4NLXA 5KFUA 4NLOA 3GIKA 4ECTA 4M3YA 1CSJA 3LZJA 2W42A 3RBDA 1TGOA 2IAJA 2IA6A 3T5LA 4WZQA 4O3SA 3GV5B 4CJPA 3G10A 3FQKA 3V6KA 5DK5A 1N5YA 5KFSA 1JLCA 1KVCA 4KHNA 4L8RB 2VG7A 5KG1A 1RBUA 4DU4A 5HLFA 4WFXA 1LAWA 4IFVA 2WB4A 2HW3A 2DPIA 3M9NB 1WSFA 3QEPA 5KG2A 4YR3A 1Z4UA 3HYFA 2ATQA 4KREA 3H5YA 1RT5A 4OVLA 1J9AA 1TKDA 3OLAA 3OJUA 3OS2A 5EWEA 3MR3A 1EP4B 3AO5A 2YNFA 3BDPA 4R8UB 1D9DA 4J9PA 2W9AA 4ID5A 3JYTA 3OYLA 4JLHA 3LPTA 1HJRA 4J9LA 3V1RA 3KLGA 2I5JB 5C24A 4Q8EA 1QS4A 3ZSWA 1DTQA 4F2RA 3ZSXA 1X9WA 1QSYA 1QSLA 2WRMA 5FRMA 3SI6A 1NK9A 4DL2A 4DU1A 3I0SB 1S9FA 1RDBA 2FVRA 2C28A 3OLBA 1VSLA 2G8FA 3DI6B 1QAJA 3OYDA 4FLYA 1ZTTA 2RN2A 3BQ1A 3LP0A 4CHPA 3UDLA 3NE6A 2XCAA 4HVJA 3SUNA 3CM6A 1R0AB 3CIZA 2FJXA 3BGRB 1J5OB 3V6HA 4HTUA 4BWMA 1KHWA 1IKXB 1RT3A 2F8TA 5KT7A 4FK4A 2IM1A 1JLEB 1RDRA 4K8ZA 1NNDA 1HARA 1O1WA 1EETA 4Z4GA 4FJ5A 3GIIA 2GIQA 4MH8A 4LSLA 5F8JA 4O3QA 4DFJA 1LWCB 1T8EA 3ASMA 3SQ4A 1D1UA 4RW6B 3V6JA 3OYKA 3HJFA 3ALYA 4MFBA 1NHUA 4Y2AA 2HAIA 4RW7B 3LP2A 3NBPB 3P5JA 3HXMA 1ASWA 4CJVA 1S9EA 3CFPA 4YFUA 3KLHB 4OGCA 2E9RX 2IC3B 1JXLA 4NYNA 2HMIB 2IJFA 1IKWA 4K4SA 1VSJA 1ZYQA 1TAQA 1TL1B 4M3WA 3H2LA 4FLZA 2XCPA 2D0CA 3KLIA 4NCGA 3P83D 1VRTA 4DQSA 4KHUA 5KFRA 1N6QB 1UA1A 3M8PA 3V9SA 1K1SA 2JEFA 5KFZA 3CDEA 4ZHRA 5KFDA 4CEAA 4E1NA 3SJJA 4QWAA 3QESA 1RT2A 4CEZA 4KRFA 3RB6A 2IGIA 2B6AB 4QWCA 2AX1A 4NLYA 3DLRA 3QEXA 1XR5A 3PW7A 2P5GA 3S3NA 4TQSA 4B3OB 1VRUB 4R0EA 3RBEA 3TR8A 2D5RA 5HRNA 3TVKA 1QE1B 4DSJA 4DSLA 4EYHB 1X1PA 4CJ4A 4I2PB 1HMVA 2HWIA 3ULDA 1TK8A 5DG9A 4MKAA 3DOLA 1TVRB 2J6SA 3JSMB 4B9TA 3VQ5A 3AVKA 4PUOA 2FLLA 2E6MA 3KHRA 4OPKA 3PO4A 5HRSA 3IS9B 3IRXA 3ZSQA 4CF1A 3U6FA 3SNNA 1N56A 1GX5A 1BIUA 4CEOA 4U6PA 2WOMA 1RDAA 1KLMA 1C1BB 3N6LA 3ZCMA 5KI6A 1WSGA 3NGIA 5KFNA 3IGVA 4HUEA 1RAJA 2BQ3A 3QLHB 1I3AA 4KTWA 4RW9A 2AGPA 3KLFA 3AO2A 4NCBA 4QCLA 3GV7B 3H5XA 2IAJB 3NDKA 2R8IA 3SFUA 2C2RA 2J6UA 3KKRA 5CY4A 4FCYA 1N5YB 1S5JA 1JLCB 3H59A 4O4RA 2VG7B 1YVUA 5HBMB 4ZPDA 4B9UA 5HLFB 4CFBA 4YNQA 4DS5A 2A1RA 4IFVB 1LWEB 4IKAA 3TAFA 1TK5A 4DL7A 4J2BA 4FM1A 4AH9A 2JEGA 4Q43A 3RR7A 1RTDA 1RT6A 3H40A 3Q8PB 2DPJA 3DLBA 3PW5A 1WSIA 4ID5B 3JYTB 2AWZA 4NLVA 4J9OA 5DGAA 4CHQA 1JL1A 3V9ZA 3MECB 4YR2A 4CF2A 4NLUA 1S6PA 3MEEA 3VQ6A 4JV0A 4QWBA 1DTQB 3QETA 1YT3A 4KV8A 2BANA 5L1JA 3HP9A 1GOCA 4LY7A 4B9LA 2OPSA 3QIDA 4F2SA 3UIQA 3LP3A 2ZE2A 3HPGA 4GVMA 1UAXA 4JUZA 4K4YA 1XHXA 1VSDA 3I5AA 5EDWA 4IG0B 4ZTFA 3NF7A 1LWFA 3ZSYA 2ZQBA 5HROA 3A2FA 4ED8A 4I9LA 5F8HA 4IH5A 2B43A 4I2QB 3LP0B 4DEZA 5KFGA 2JC0A 2FVQA 4DL5A 3OYBA 1S49A 1B92A 3K57A 1WAFA 5KT6A 1VSHA 1ZBFA 3K5NA 4FLWA 2QV6A 2XY6A 1S48A 4GW6A 4GC6A 4NYZA 3VA0A 1JKHA 1RA7A 1T94A 3C6TA 4ZMMA 1NHVA 3PX4A 1RT3B 2BRKA 4KI6A 1LW0A 3DRSA 2AJQA 3MTKA 4CESA 1T3NA 4KE5A 2GC8A 2KZMA 4LSLB 1SH3A 3CWJA 4XPEA 4CJWA 3LANA 3PJXA 2JEIA 3VQ8A 4RW4A 4N5SA 3GV8B 5T7BA 1IKYA 2X78A 4FXDA 3KJVB 4DFKA 5K14A 3L2VA 4E0DA 5KFFA 1REVA 2FBXA 3LP2B 2Y1JA 1LW2A 4OKJA 5JXSA 5F9LA 4KAZA 1J54A 1S9EB 1U45A 4KHWA 4JV1A 4FS2A 3QZ8A 1FKOA 4J2AA 2RKIB 4RNHA 4LSNA 1IKWB 4G1QA 4JRQA 2FVPA 3F9KA 3QIPB 4O3NA 3KLIB 4NCGB 1RT7A 1JLQB 5JUMA 3CDUA 1VRTB 1HQUA 4FJIA 2P51A 1WNSA 2YNGA 2G8UA 3SPZA 1EX4A 2G8VA 3M8PB 1ZBIA 3OS0A 4ZHRB 4OL8A 4DTUA 2HHXA 3OY9A 1RT2B 3CG7A 4F4XA 1MU2A 3HSTB 1NOZA 2G8WA 1S97A 3HP6A 3LP1B 4ED1A 3U3YA 5T14A 2W9BB 1C6VA 4OJRA 4B8CA 2NUBA 4K8XA 4I7FA 4FK0A 1TAUA 1S0MA 1Q8IA 1KCFA 1T03A 3T5KA 1L3VA 1HMVB 4YMEA 3WNFA 4AHVA 3RMCA 2DTUA 2XGPA 4M42A 1UA0A 1S1VA 5KG7A 3DOLB 3L3UA 3MR2A 4QOZB 5KFJA 4ED6A 4PUOB 2D7SA 3NGDA 2G8IA 2HHVA 2V0NA 3BREA 2G8KA 1CXQA 3ZT4A 4FZYA 3IRXB 3E01A 4FJ7A 4BWJA 4ZP8A 5D3GA 4KHMA 3C94A 4M3UA 4KTQA 2WOMB 5I42A 1RILA 1TK0A 1KLMB 3OYAA 4DF4A 1SKRA 3OYHA 2XY5A 4ICLA 3AV9A 3AA4A 3NAIA 3KD1E 4J9KA 3MEDA 3OYMA 3HK2A 5DGBA 2XY7A 4ZVHA 4DTNA 1KHVA 3TAMA 3KLFB 4EZ6A 2PZSA 2FVSA 3ZT0A 5FRNA 2OPQA 3HVAA 4CF8A 2YHAA 1BGXT 1DTTB 2YNIA 1HYVA 3IGNA 4GMJB 3SPYA 3CQ8A 1U47A 3G6VA 4Y2CA
chains in the Genus database with same CATH superfamily
1JXEA 3WQTA 4USHA 3UI3A 3E66A 4DR4J 4JKFA 3ISZA 4RPFA 4JD2B 1F3FA 4PCQA 2C2DA 1RTDB 3TVZA 1H3DA 4K50A 3CD6S 3BYPA 1NGHA 4RNFA 4DTRA 4BQLA 5KFIA 1HR0F 3M6WA 3QPIA 3ENBA 3CCUS 3ETOA 4A8XA 3J80O 3HHDA 3KUGA 4ZPBA 4EEYA 4IFEA 4A8MP 4PY5A 1N33J 3IFEA 1RA6A 4LF4F 3D7EO 1RBOB 5D15A 4OX6A 1TQLA 3JS6A 2MGZB 1QQCA 2L3MA 1ASVA 4L3KA 4WQ5A 3ATUA 2X1GA 1PJ7A 4H4OA 3D68A 4PABA 1WF1A 3J7YI 4PKIA 3OYJA 1JXBA 1QLNA 1UVKA 1VJWA 3MI7X 4A47A 3KJFB 4DPUA 4OI6A 2UVWA 2HPUA 3MM9B 4ERDA 4C11B 3AQOA 3C15A 3CJBA 2HSTA 1J5EK 1KFDA 2FLNA 3V1OA 1JLBA 1RAAB 3BQ2A 1GOBA 1E4FT 4FZZA 3MEGB 3DRSB 2RILA 4NYOA 3D2FB 2YKQA 4F4ZA 3HHEA 2RU3A 1D5AA 5I3UA 4DR5J 1WBDA 2PDAA 3TOQA 4JV5F 2HYIB 1ZAVA 3RTVA 4OJHA 3T3FA 2B51A 5FLXY 4LFAF 5EX5A 3C14A 1CLQA 3N6MA 3CCSS 4ENOA 4KHPK 5KG6A 3DHXA 1C2PA 5ETPA 3PV8A 4NLWA 2UXCF 4UY8O 4FF4A 1AROP 1S1TA 5C5JA 1EKEA 1NDCA 4K4ZA 4LF7K 2VYPA 4W98A 4R79A 3CB4A 3EE8A 4O0JA 3ISNC 2QTDA 2P9SB 2VG6A 1RWKB 4ZVUB 2CIMA 2HVHA 2PD1A 4HCCA 4FW1A 2C3OA 1RYRA 2HHHJ 3MPUB 4E7JA 3T1HK 4BR5A 3VQBA 3MM5B 2ZHAA 2CAJA 1WDDA 3ZX3A 4NYFA 2F7TA 3A12A 4UT4A 2XS7A 3ITHA 6FD1A 2AGOA 3P4IA 2RD5C 1GX6A 1SH2A 3DXBA 3CJ3A 1S9GB 3EE3A 2N7CA 2G9OA 3OVSA 2OIHA 3AVMA 4OLBA 4K4WA 1U2VA 1CXUA 3VQDA 1UZDA 3BBFA 4Q5VA 4JI0K 3GZ7A 2VONA 3WXIA 3SEOA 1JNRB 2D0AA 1O5JA 1TR0A 2QM1A 5DM6L 3A8KA 1ZH5A 3CJ1A 3MFIA 3ILJA 1YHQS 4FBUA 3RYLA 3UN2A 2CNNB 4I9QA 2F5GA 4A8SA 5A6WA 1SL2A 5E0OA 3DDNA 4NYPA 4Z2XA 4CZJA 2UUBK 4KH5A 2YNIB 2BBEA 5K8MA 2EC0A 1WF2A 5KFWA 3Q8YA 2L9WA 2V4RA 4PXBA 1VQMN 5AT1B 3US5A 3I56N 2AF6A 3FFIB 1RADB 4CZLA 1VI7A 3K9JA 1NKCA 4F3TA 1HD0A 5C25A 1RAOA 3ENOA 3GMGA 3UDVA 4URQU 4HHJA 5KTQA 1RK8A 3QGHA 2JOQA 1B0PA 4I6MA 2D9OA 2HK3A 1XJWB 5LMUF 4JI6K 4CJUA 4TY8A 4GVBB 5E3QA 3TAGA 4LR8A 3L2WA 2V4QA 4ATNA 5SWMA 3FCWA 4FM2A 3HCXA 2FB0A 2W01A 1RT4A 2WONA 1B0TA 1R8PA 5HVGA 2YNFB 2HBLA 3O9QA 3CCRN 1R3NA 4GNIA 3WNEA 4DV7K 5KFVA 4J9UE 3M2VA 5ETQA 1LOTB 5C24B 1JNZB 3H2UB 3AO4A 1MNEA 2BMBA 2WUSA 2QO3A 1X5SA 4ANEA 1M1KO 5B0CA 3IBFB 4X64F 4PA1A 3HHKA 2ZH7A 2HFSA 3VMFB 1TV6A 1K6YA 3RR8A 4B3MJ 1URRA 2ASMA 2CJKA 4PHTX 2M3DA 1N4LA 2QEXN 4YOWA 1IQZA 2MZQA 3MAQA 1FJEB 2E5LJ 4L76A 3C66A 1A7GE 2QL7B 1B9DA 3OJSA 3AA3A 3FVYA 4WFZA 4OZ1A 3R3TA 4EWTA 3MMBB 1O13A 2QLBB 3S8SA 1U4BA 2DPNA 5BRHA 3MM7B 2UU9K 1VC6A 1VQ7N 4X62J 2UVRA 3BZQA 4AFFA 2FGOA 5DQGA 3L3CA 2BTFA 2QKBA 5KG0A 3SUPA 3QO9B 1PJ6A 4OKKA 3FZ2A 3H1QA 1YJTA 1JLGA 3UD3P 4KJIA 4AHUA 5H1SV 5AQJA 9RUBA 5KFYA 2IDOA 3ZZTA 2MZJA 2ERRA 5F3ZA 4IFYB 2FZGB 3N5FA 4TVAB 5AR0A 3SLCA 3J7YP 3OYIA 3BGOP 1A0OB 3J7ZO 1T6CA 3ZTSA 3DXMB 1T9WA 2CRLA 3O2IA 4M3TA 1VSFA 3D1QA 3SSSA 2W9CB 3BBCA 2MSTA 2E5JA 2Y9HA 2V7ZA 3AY0A 3P6YC 3HHLA 4YQWA 2B9XA 1VIXA 4IOCQ 4FWMA 2F65A 2XQCA 4OHVA 2A3ZA 3EICA 1J5EF 4NLQA 5A8RB 4LC9B 3S7RA 1RUSA 4C7QA 5JJBA 3H08A 2ZJRL 1FVQA 4C1NI 4EO6A 2G2YA 2RE1A 3OTOF 2W8LA 4B1UB 4RU9A 3BPDA 4Z7CA 1W7AA 4NLTA 2HNYA 3G4SS 1B9FA 2E29A 4Q0BB 4BLGA 3ZNUA 1RWOB 2DNNA 4KGKA 2DGTA 3AVIA 2GV9A 4BC4A 2K1RA 1W2BM 1RU1A 4DPOA 1WORA 2RAQA 2CDRB 4HR2A 2K7JA 2XO6A 3DGPA 4Z7YA 2NRZA 4KHPF 2XYGB 3AOCA 4FWOA 3GYNA 4F67A 2OFGX 3QEVA 3CF5Q 3PFOA 3TA2A 1RLCL 2OZMA 4ETZA 5KFBA 4EHUA 4ED4A 3RVCA 2A1SA 3BS9A 5AQHA 4FOIA 4QWDA 2XSJB 3CMQA 4O4GB 4CHYA 4DFMA 3SDEB 5JVGQ 1NK0A 2HQCA 3L2QA 2BOAA 2H5IB 3M8ZA 4M8LA 5C42B 3A8EA 5IXUA 4MTPA 1XR7A 1LKZA 1Z05A 2X6NA 4FM0A 5AFUH 3CCLN 3GG1A 4WQ5C 4ZVPB 1UOCA 1N36K 3OR2A 4FJXA 2XC9A 2QYGA 4BRGA 4OLAA 5GVQA 1VQ9S 4MAKA 1GXTA 3KLEA 2W2MP 5JS1A 2OTJN 2RT3A 2YX6A 4WQ4A 4JKAA 2P9LB 5F1XA 3O3HA 1JLAA 2ROEA 1TUUA 2XMUA 2FJBB 1L5UA 3CCWA 4JI0F 3FBFA 1KSPA 4V19X 4NLRA 5A8KB 2H3EB 2NXNA 4CFAA 4KV8B 1RGIA 5AQFA 1AYEA 3EZ5A 4Q2MA 2ZHBA 4EP4A 2MHEA 2OKQA 1M90T 3LDOA 2HVZA 2F9DA 2ZD1A 2DNQA 3FZLA 5HBMA 3K8WA 2VQEJ 3PZPA 4KY3A 3MK6A 2JWNA 2YKMB 3CJ2A 1KTQA 2DITA 5E5NA 2GHWA 3WQUA 3NOCA 4HWIA 1UEVA 2XNRA 4CT9A 2JFKA 4Y2KA 4O8KA 3N9UC 1R31A 3L4BC 4BDPA 2LEAA 4FJNA 3CD6N 3T69A 3AVHA 3S3OA 1XQIA 1U6ZA 4LJMA 3R2DJ 3CCUN 3ENVA 2CWXA 5F8LA 4DQRA 2XWYA 2CPJA 1W2IA 3KG4A 1DLOB 1VSEA 3ZZ0A 3SAFA 3RMDA 1RISA 1WAJA 4AE5A 3H98A 5AJ3K 4B3SK 1KD1O 3GYGA 3L0QA 5F8NA 3DDKA 3OL6A 1OY6A 1C4AA 4F3OA 3G82A 4C8LA 3DLGA 3DYAB 3VQ9A 1EB0A 1UETA 3VQAA 5KFEA 1Y5IB 5KT5A 4G3IA 3EY1A 3M32B 3F5TA 3UPFA 2QMUB 2OJ3A 2AIRB 3BB5A 3R9PA 1NJIO 4QJVA 3FEYB 3RUBL 5A2QY 2NLWA 2YNGB 1WSRA 3U7JA 2EFGA 5BRDA 5D0RA 4OGEA 1AA1B 3H42A 2I1RA 2I2YA 1AFJA 2WSEC 2GAGC 2VC1A 1RHRB 2A6MA 3NMAA 3L6QA 1S4FA 3HM9A 4KAIA 4EUVA 5HATA 3HTVA 4KGVB 3IRWP 1RTHA 1WEXA 1O51A 3MXJA 3H90A 4ILMA 3UKRA 4WKYA 2YNHB 3T1AA 1FX2A 1RWVB 3CE8A 5TKWA 1RTJA 2E1YA 1BQNA 3LPYA 3IDHA 3CCSN 1C1CB 4IR1A 2R8GA 4F02A 3K2PA 2RKIA 3EZUA 2AGQA 4MO4A 4CJSA 4IOXA 1QAXA 2J9EA 3DLLL 3UVJA 4FNIA 5F8IA 2E2PA 1TKZB 1U6BA 4LFBK 1SQFA 3EGZA 1KVKA 1IBMK 3NGZA 3VAJA 4C8OA 9ATCB 4LMZA 1CC8A 4MK9A 1BHLA 3HL8A 4J2EA 3C16A 4Q8FA 3AY9A 2HSEB 3Q8UA 4OI3A 4X4TA 2HBMA 5FIIA 5ADXH 3AGKA 4E7IA 3UN3A 1BDGA 5DRKA 4MT1A 4MIWA 2WAQD 3DLHA 2Z2LA 4JK9A 3DRPB 2E5IA 5KRSA 1TL7B 1YXQA 1UL3A 3M7VA 1EJ7L 1CJKA 3O9UA 1E6VA 1S5ZA 2ACYA 4NLDA 1YX2A 1FD8A 1NJWA 1QHTA 2E20A 3MM6B 4B3RJ 2KW4A 2YKNA 3QT8A 2D3ZA 2GTDA 4PXDA 2O4IA 2ZKTA 2V9WA 1KS2A 1GMWD 4U8YA 3MMAA 5A8WB 1SBRA 3DOKB 2ZBCA 3WNGA 2GCFA 4RUCA 1M5OC 2HAFA 4YORA 1J53A 1PG5B 2AX0A 5L1IA 4ZVRB 1FKPB 4PR6A 1UWBB 1H74A 2YXLA 3SV4A 3SXLA 1YHQN 5J1EB 5JLFA 4ED3A 4OZLA 2NYHA 3PFEA 3K2YA 5KPTA 1PCAA 3LGHA 2J0WA 3DOMA 2GWKA 2ALYB 1WN7A 4NL5A 1FA0A 2UUCK 3DM2A 3Q86A 3QGPA 5HQMA 4F4KA 5J2NA 3CD0A 2F8HA 3QAUA 4XIUA 2IA0A 1M5PC 2MZTA 4JKEA 2C2EA 4UQGA 4G1PA 2Q36A 1SC4B 2Y0BB 3D66A 4YOTA 4P2MA 3KD5E 5J2PB 3TAEA 1IWGA 1ILYA 4NLPA 3KWIA 3I33A 1IM4A 3RG6A 3KKSA 2D0PA 4C2MA 3DMJB 2R7OA 4DV5F 3GB0A 1DQ8A 2HBQB 1VQ8S 3Q8QB 3O3LA 4KB7A 3DRXA 2G0JA 5D4LA 3THXB 2Y1RI 4YHHK 1N36F 4DV6J 1V3ZA 2OANA 5DDQC 3HULA 4JRPA 2MJUA 1SV5A 3HHLC 2LEPA 4IO9Q 4K4VA 1BQXA 4K5RA 3ZSZA 4DX8H 3LGMA 5CZ1A 4RU2A 4DTXA 3N6NA 4WK1A 5GADI 4JI4J 1URNA 3L2RA 4FJ8A 2V68A 2VL1A 4GC7A 2VG6B 2O8EB 5L46A 5DQHA 4GRSA 1V4SA 2UUTA 4OV6A 4YS2A 4FDFA 3BDEA 4ZPTR 4DR7K 1KKHA 1EIYB 3ITHB 1X60A 2HIYA 4YR0A 4A5AA 4E3SA 2FJWA 4H0XB 4O44B 2P2CB 4TYBA 4NPOA 3EYZA 3HX9A 4ECRA 1YUWA 3CEDA 1N34K 2V8HA 2QA4S 4ZVOB 4ISFA 1WWHA 2AYMA 2HQ3A 3O9TA 1GMUA 2E88A 1LWCA 2C2MB 2C22A 3AOBA 1RAGB 4Z4IA 4RW6A 4FWQA 2MKCA 1HNVA 3HFKA 1F5BA 3CMAS 4ECSA 4FYDA 1U1KA 4M1KA 1IBCB 3N28A 2B5JB 5G0RB 4B3SF 3VZHA 1KOHA 3W3DA 1SL1A 1BHNA 3LDSA 1L3TA 4FPRA 3THWA 2R2TA 2IVNA 5H9EK 3IR7B 1U7LA 2YWKA 4DV3J 3JSRA 3V1QA 3DLKB 3O3GA 5KFXA 4WQ4C 2AEMA 2VPWB 4OX9F 3ZETB 3EDRB 1L3UA 2DBBA 4K42A 3M30B 3BUZB 4BRIA 2AZ3A 1F9HA 2GVZB 3MD3A 2CJQA 4DG1B 2IM0A 3TJAA 4CJ5A 4FXWA 5DETA 3MAAA 3OFGA 3CMES 4H5VA 2YHBA 3TZXA 4P74A 2NRRA 4A46A 2R8HA 4U7UD 3G4SN 4UY8T 2KTQA 4ED5A 3RJMB 3A3PB 4GKKF 2XHBA 1PYTA 3M9OB 4ES3A 1WTBA 2B9EA 2RDIA 4X84A 4NLCA 2JEJA 4DLGA 1KP6A 3FZKA 3MR5A 1EQYA 4CGGA 5A76A 3SK3A 1GOAA 4G65A 2YV0X 1U25A 2EC2A 1FK9B 2CQDA 1RT4B 3O5TB 4E1JA 3NWRA 4JEPA 3TABA 3KFWX 3GFYA 4LFBF 2I0XA 3LDPA 4LF6J 1FWPA 2XEXA 1CSJA 1VQ6S 1R8BA 4EK2A 1HQ2A 1TGOA 2NYIA 3IMXA 3VCDA 2LXUA 4WZQA 3GV5B 3SBTA 1HNWF 3CPWM 5KFSA 5TKYA 5BN8A 4DBQA 5H9FK 3EWGA 5AFUA 4F0HA 3CNQP 2OSRA 5B0GA 3MMCA 2VDHA 5D6GA 3SMSA 3QEPA 2GMLA 2FJDB 2NRWA 4YOXA 1UZHA 3PIOQ 2ATQA 2JSXA 3TTFA 4LRFA 1VQ9N 1VQOS 2DHGA 3I31A 5HN0A 1RT5A 1RQ0A 4TNOA 4OVLA 2O01C 3VPZA 1X4BA 3A0IX 2RB7A 5CCMA 1HI1A 1NH7A 3NNAA 2DK2A 2E5HA 5ITHA 4Q8EA 4P10A 1DTQA 3TX8A 3FLCO 5C15A 4GV9A 1QSYA 2NUUG 3EL2A 1SQGA 1NK9A 3O80A 3FGUA 2C2NA 1KC8O 2FDNA 1OY9A 2C28A 3OLBA 3GSIA 2YVSA 4X66J 3QICA 5E26A 5LJVA 3BQ1A 1IVZA 4HVJA 3C0BA 2HRUA 1CULA 2UUCF 3FUYA 2F9WA 3BZKA 4ZN1A 3CIZA 1S22A 4OHXA 3BGRB 1J5OB 3V6HA 1IBKK 4HTUA 1RT3A 5KT7A 2IM1A 3M8YA 1C0FA 3B6BA 2JX2A 4F0MA 1NNDA 1O1WA 1EETA 2AJ4A 4NO7A 2BXJA 1RWPB 1AT1B 4DCJB 2MQQA 2DVIA 4ZCMA 3ASMA 1K8AO 4IZ9A 5BYRA 4CT8A 4ZIWA 1HJOA 5D0GA 4MFBA 4Y2AA 4MDAA 1YLXA 4O23A 3LP2A 2K3KA 4YHHF 4BRCA 4CJVA 1S9EA 4DPYA 2HS3A 3DGPB 4KGZB 2XMJA 1V3RA 2RRNA 2IJFA 1IKWA 2QYCA 2NSCA 1TL1B 2PAVA 3LM2A 5GADP 3P83D 1K47A 1VRTA 4DQSA 5HQ8A 5GINA 5KFRA 1DEJA 1N6QB 2G1HA 3V9SA 1RAFB 3VEOA 4ZHRA 4CEAA 1S72S 2XYHB 2YQ3A 3BPSP 3QESA 1IUJA 1N32F 2Q0RA 2DJWA 4CZEA 4QWCA 1FXDA 2H54B 1X31C 3DLRA 4PKHA 3SQGA 2MDAA 1NGEA 3QEXA 4JKBA 5HAOA 1Y00A 2AHOB 1R8HA 3R8YA 4DSJA 1T9UA 4DCPB 1R8CA 2HWIA 2KM8C 4DR7F 3S1TA 2Z8QA 2EFOA 2ZWPA 1K8KA 4QPTA 4DPTA 2XMVA 1XTZA 3OR2B 4BRLA 5B7WA 1D8ZA 3KHRA 3PKYA 4JI3J 5HRSA 3IRXA 3BN4A 3G71S 4DR4K 3U6FA 3SNNA 1GX5A 5JMVA 1RDAA 1HHQA 3N6LA 2XZTB 5KI6A 3QBCA 5KFNA 3IGVA 3ONQA 5AQSA 3J7ZT 3SAHA 1Q82T 4BROA 4AT1B 2CQIA 5ADXA 2QTWA 3K0SA 1WG1A 3EZWA 3NLCA 3OFEA 4USKA 2F3JA 3KLFA 3AO2A 4QCLA 2IPOB 3H5XA 3Q2TC 1TTHB 2C2RA 3VVTA 1T02A 3KKRA 1N33K 5CY4A 1K73O 1N5YB 3EKSA 2ZJQL 4JI7J 4HTIA 2VG7B 3OT9A 2MB0B 2D69A 5HBMB 4UTGA 4DS5A 2A1RA 4YEAA 1XIQA 3VV2B 3J81O 3G9CA 4C4WA 1KVIA 4X4PA 4X4NA 2BJEA 2JEGA 3POTB 3AB2B 4G1IA 2G2OA 3M6GA 2E1PA 2FD2A 5CHCB 2D3O1 2YJEA 2GO9A 3NRBA 4ID5B 1GXLA 4CHQA 5HMYA 4YR2A 2ZM6J 2P5VA 4NLUA 3P39A 1KEKA 1EARA 1YAGA 1YT3A 3VR1A 2OTLS 2W6LA 2BJ9A 2AT1B 3LP3A 4GVMA 4JYAF 1XHXA 1NMNA 2J7WA 1LWFA 3A2FA 3TP2A 1FO1A 3G82B 2HF3A 4IH5A 3TA1A 3U1LA 3LP0B 3F0NA 4DR3J 3VGVA 4CO2A 5GAEP 4BRFA 2DGXA 2PA8D 2O3DA 1DGKN 4LRDA 2VC0A 4CH7A 1LWXA 1JCFA 1B0VA 4GC6A 3J80U 2HS4A 5T7LA 5IC4B 2WVDA 4RWWA 4XDDA 1JKHA 4UUWA 2EPIA 1NHVA 5LOQA 3AHPA 2YI1A 4ZJLA 1XN9A 1LW0A 2F8MA 3O4WA 4CESA 2O8BA 1XNRK 3CWJA 2OP5A 3CT9A 4UOFA 3LANA 2FQQB 5J1NA 3VQ8A 2ZC4A 2DGVA 1VQ8N 1U1NA 3CUNA 2HHHK 1CJVB 2V51B 2J7UA 1REVA 3PYEA 5CABA 5KOXA 5F9LA 4KAZA 4FPBA 2UUAK 4F7VA 3QZ8A 2HMPA 4J2AA 2E66A 2RKIB 1SZ2A 1SJFA 4RNHA 3N4PA 1U8WA 1Y11A 2VDIA 3KLIB 1SPBP 4NI2A 3FBBA 1UEUA 3JQKA 4DV2K 2DT9A 4NA2A 5IWAJ 2FIUA 3M8PB 4CM0A 1V5VA 4DTUA 2DEJA 2HHXA 3OY9A 1OKJA 1MU2A 5GIPA 2G8WA 2BJ8A 5HSPA 1S97A 4ED1A 3H7HB 4WJBA 5D77A 1CBKA 1HNXJ 1S12A 1C6VA 1ZOTA 2NUBA 4J9VA 2FF6A 4I7FA 2AJFE 5B0BA 2ZJPQ 2FSKA 1TAUA 2LQ5A 5IQQA 1CJKB 1Q7LB 2VCPA 2Q0UA 1HMVB 3RMCA 2DTUA 4M42A 2ITMA 1S1VA 1U0HA 5KG7A 4IO9L 2OEKA 5ETKA 4QOZB 4OIXA 4ISEA 2G8IA 1IBKF 2V2KA 2V0NA 3CSKA 3BREA 2G8KA 2HLUA 2QA4N 4R0JA 3MOJB 3NY0A 2MMYA 4ZP8A 1KD1T 1FFGB 1HWUA 4M3UA 4KTQA 1TK0A 3MTJA 1KLMB 4ICLA 5AQWA 1UVMA 4I4BA 3HDSA 2NPFA 2WW4A 3OYMA 2DNZA 5LXYA 1HLUA 4OV1A 3CMAN 4JKHA 1HNZF 3MD1A 2VF3A 4ZVHA 4DTNA 3TAMA 2V4JB 2PZSA 3NNHA 1NJIT 3R5JB 2KXFA 2VPXB 3B78A 4CF8A 4DQ8A 2IMOA 2EFQA 8AT1B 3G96A 4CD3A 1X5OA 3WHIA 2XLKA 1XMQJ 2EVZA 2LA4A 1S77D 3SPYA 3CQ8A 1U47A 2WC9A 4BR0A 3G6VA 1LXNA 1QUPA 2HGMA 4EU0A 3PJ9A 4MLHA 2W41A 4IEEA 1T05A 1HHSA 1H73A 3M8QA 1WOSA 4QR1A 4IBNA 3P49B 1RT6B 4FWSA 4IH7A 4JS5A 4CNZA 2FGCA 4J9SA 3SUQA 4NXNF 1Y3JA 4DL3A 4KTZA 1F2HA 2MZSA 3R7SB 2B4UA 3CMEN 2V2ZA 3MEEB 1XNQJ 2J4RA 5M1FA 3O9SA 1FRHA 1X8DA 2KB2A 1UKUA 1Q8LA 4TXSA 2FSNA 3P3DA 4DTSA 4B3MK 1N48A 4JI6J 1M0SA 2W4DA 4J9RA 3C19A 3QT7A 3H46O 1MWKA 5HROB 1SV5B 1Z1ZA 4WU3A 2E5LK 1M5KC 2UVUA 1N54B 1F9FA 3TSPA 4YDXA 3EJMA 3R9LA 4WF9Q 4X2BA 1UEKA 1PKUA 4RNNA 5AQKA 2LKZA 4AF1A 4FZXC 3AQPA 3UCGA 4OZ0A 4N76A 4EBCA 4KPYA 1VJQA 1PAUB 1VQ5S 2Q6BA 1VQ6N 4YP3A 3PW2A 1P6TA 3S3MA 4I67A 1WI6A 3OYGA 2FVCA 3OVAA 3KIOA 1B99A 2WVCA 2E44A 5HRRA 1V9OA 2CVEA 4PWDA 1N33F 3O44A 5FJ4A 3V9WA 1SH0A 3LOUA 3LPEA 4AUKA 2Z2ZA 4CTAB 2BZ2A 3D67A 5GIOA 4LQ9A 1IKYB 3WEEA 3TUJC 3PXGa 1H6KX 3O8WA 4CHZA 1BCMA 5K14B 3OS1A 4WFAQ 2J0SD 3M1VB 4U8VA 1VQON 1RBRA 3O5BA 2AA4A 5CYJA 1X5TA 2PYLA 1WB9A 4I68A 3NAHA 2EFPA 2BEFA 2ZUGA 4ECWA 2IIRA 1HQUB 4CHOA 3JXOA 3MCOA 1HNVB 4TKTA 2BABA 4X4RA 3ZYYX 1YDLA 3KMSA 3TVYA 4DUTA 1FE0A 2B4VA 4NXMJ 4FJGA 2LCWA 2EEYA 4DU3A 4BRKA 5SZTA 4DR5F 5FDLA 3THPA 1X4EA 2EKNA 1UW4A 3SFGA 4ZPVR 3GJSB 2KQ2A 3OVNA 4BQZA 2RDJA 3AVFA 4BRAA 1W9HA 1JQGA 3CFOA 1NK5A 1U6FA 1RI7A 4O3RA 3MF5A 1NB7A 3IWNC 1Z6RA 3I9ZA 2ZVSA 2BE2A 1BL3A 3MCNA 3MMVA 3TJ9A 3LZIA 3VEZA 2VBZA 4ZVGA 4DB3A 2MYFA 3E3XA 4USIA 1FKAF 5KG3A 3MAAB 2YWFA 3UNGC 2F8EX 4EHTA 5K20B 4J91A 1S0OA 1YVNA 1VK3A 4G6VB 3PDNA 1VBYA 1Y97A 2HHHF 2CA9A 4Z4HA 2XBPA 5T41A 2O4GA 4JNEA 4FWKA 1L3KA 3D0IE 1YBAA 3MN9A 5IFMA 3A5NC 1HYSA 4B9QA 1HWKA 1RDCA 1VDHA 4DQQA 4LQ3A 1DFDA 3MWBA 4TN2A 2W7PA 2QZ8A 3NMUA 4Q45A 2Z4PA 3WX4A 4IQMA 1AUSL 3HD1A 3QRRA 3W0LA 1S72N 2HHUA 1Y5NB 4P9SA 1L3SA 1Q5YA 4NASA 1KRPA 1X5PA 3SZ2A 3SCIE 5C2CA 3OTBA 3H3NO 2LU1A 4RBTA 4DX5A 1KOOA 3HHLD 1D4XA 2BV3A 1NB2A 3S6EA 2JH3A 1NGAA 2X1AA 4A8KA 3WBZA 4F26A 4FVCA 3I9V9 1HKAA 3QZ7A 2QK9A 4PQAA 1G99A 4Q44A 3UDCA 1CG2A 4QWEA 1SJ1A 3JTNA 3MM8A 1U2RA 1A5VA 1C4CA 3MR6A 3ZZOA 1GLLO 1RT5B 4H5WA 1LAVA 1UJ5A 3R3LA 3G71N 1Z2ZA 2R9LA 4BE1A 3VGUA 4M5KA 4CLUA 1TL3A 3M8SA 4RZRA 4DPWA 1IO2A 2BKOA 4R5PA 2RMLA 5E3AA 3KK7A 4WFYA 2WCXA 4QAGA 4FZVA 1BC6A 5CYMA 4CLLA 3T1YJ 1I5OB 3TQ1A 3FZFA 4H5TA 1SB6A 4LVNP 1Z26A 3W5XA 3CETA 3NXZA 3DWLA 1J2VA 2XO7A 2BDPA 4FJJA 1PO6A 4ID1A 3HKWA 3HSJA 4FO0A 2XGQA 2KJVA 2CNOB 3UO0A 2VFVA 3PX6A 2P9UA 4DTOA 5B08A 4YOYA 3VTHA 1NOYA 4A8FA 1RDWX 3H4DA 3VGTA 2LDIA 2QL5B 5EWGA 3GCWP 3BM7A 1ZBLA 2PA3A 3UB5A 1VHXA 2I5JA 2AV5A 4DUZJ 4FOEA 4ZCLA 3MUMP 5FPEA 4O55A 1EETB 2DGQA 1ZM9A 1HNIA 4C0BA 4UOCA 2Q97A 4C8NA 4OHWA 2IYGA 4MLEA 2VASA 2OTLN 2DCUB 2HNZB 4CIGA 3FZHA 4MFBB 4B3MF 3DI6A 1TMMA 2O8FA 4PG5A 3O9RA 3ET6B 1YJWS 2GZOA 3CC2S 1P1LA 2QLJB 4PQUB 2GQ2A 2E5LF 2DO4A 2LYVA 1H0HB 2UZAA 1QHAA 4CJEA 3ATVA 4H54A 3I4HX 1HPZA 1HPMA 3TEHB 1R0CB 3PR4A 1NSQA 2RU9A 1IKXA 3FFKB 5JVHL 4IOAL 1RTZA 3W2VA 1HBNA 3NOGA 4WXOA 1KXPA 4X62F 4CGHA 4C0HA 4DR2F 2EBGA 1RAEB 3W1YC 2A40A 2FJAB 3ULHA 4GY2B 2E9TA 3SQGB 2IJNA 1QVGR 3UR0A 2I38A 5ETTA 1U2CA 2N4CA 5I4MA 4BR7A 4E8UA 2D1KA 2B7CB 2R7YA 1FNOA 2E4LA 3NBPA 5A2QO 5AQMA 3KUHA 3W2WA 2C2OB 4Y65A 1K8KB 1WSVA 1VS3A 2B9WA 3DRRA 5F2RA 3L4IA 4ED0A 3LM9A 2CUYA 1Q7YO 2ADBA 1HBMA 3WXLA 1YG0A 1S6QA 4CJQA 2QA4G 1KC8T 4YOVA 4O0IA 5KT4A 4I0WA 1JL2A 1IBMJ 4ER8A 3KG0A 4HEA9 2L9NA 4M45A 4DR6K 2AEJA 4JI5J 2NXJA 4J7CA 2W4PA 1DBDA 2VFSA 4EP5A 2H51B 1FJ7A 3F41A 1S1UB 4FJ9A 5E84A 2CJYB 4IRCA 3IR5B 3CYMA 1FEEA 2M8DB 3H20A 3OFFA 4F3QA 1N0UA 3HVTA 1QVFM 2RHQB 4RWXA 2IM3A 3I6PA 2F8SA 4QW9A 4OHZA 2Z1JA 5ETLA 3QDKA 3TA0A 5AQYA 2M9KA 3GOIA 2OYQA 2ZH9A 3D2EB 3PYGA 3KWGA 1X4FA 3QINA 4DR1J 2KFNA 3FNNA 1K8AT 2RF2A 2M0GB 4CWBA 4Y0WA 2QL9B 2HNDB 3RZAA 4GKJJ 1DQAA 3VN5A 1UPPA 1FXXA 3JQJA 2HF4A 3QLHA 3OYFA 3VAHA 3QNOA 4NA3A 4WE1A 4KBIA 5EOYA 4OYAA 2C1EB 1NGGA 3B4MA 2ZBPA 3QAEA 1XEZA 3ZX0A 2ZJPL 4X4SA 4LF9J 3VQ4A 4CJFA 1XI1A 4HH0A 4LFAJ 3VQTA 3MEKA 1YSJA 1GXUA 2LFVA 1NJYA 2F1FA 2B4PA 3KK2A 3DLEB 2IIHA 2UXCJ 4DV6K 3LGNA 3VQ7A 1DY3A 5AQUA 4LFCJ 3CJ9A 1LEOA 3MPDA 1SXLA 3M2RA 3HI0A 3MXIA 1U26A 1CVJA 3HD2A 1WHWA 4RWTA 5LL6d 1W97L 2FBVA 2GBZA 5GAHU 4UOHA 1X4AA 1LFWA 2B8QA 1NGIA 1WSJA 2SXLA 3RMBA 1JKHB 3AD8C 3H25A 4UOGA 2FPHX 3SCXA 1Y9OA 1IQTA 1SC3B 3WX8A 1TKTB 4PZVA 1Z2LA 5IV4A 4JI4K 2O8BB 1LK7A 2A2CA 2ZF5O 5IM0B 3NF8A 1F9EB 3OYEA 4H4MA 5K8NA 3T6JA 4L3NA 5B0FA 1UPMB 5J2MB 5DM6Q 3RB4A 4CF9A 3N0VA 5KFMA 2V67A 2U1AA 1NG9A 3IBWA 2KT2A 2VQEF 4C9DA 2XWXA 4KKOB 2IHR1 3OSPA 3VQEA 3W9JA 2OHDA 3PJWA 4RBUA 4KHYA 4NI2B 3OTEA 1EZZB 3W62A 1SKUB 1K73T 4JP8A 3EPGA 1VQ5N 2PEBA 2OPRA 2J0XA 4IH6A 2IYIA 2DR6A 3V4MA 1UVNA 1C0UA 2MKJA 2DIVA 3GJRB 4AQYJ 5KFHA 3R7BB 4I7FB 3Q8VA 2VHGA 2DY1A 3BSAA 3QWUA 3MR7A 3QB0A 4DSIA 2YBVA 3P1GA 2FJVA 3G87A 4OYBA 4NWBA 4RW8B 2F9JA 4WF9L 1SJ3P 4DV3K 4IRDA 4JS4A 5C2DA 4Y0FA 3CJSA 3V9UA 3QIPA 3KK3A 5L9NA 3U3GA 2X7IA 1BU6O 2VWBA 2QGFB 4E19A 4CO3A 1VSMA 3HPOA 4ICLB 3PEJA 1BQMA 4CVNE 1JMTA 2QA1A 3V2UC 1RBTA 3MOZA 3UDEA 3MXMA 2Q31A 4OYZA 1TU0B 3UQSA 5AQGA 3OA9A 2R7QA 3THVA 1JLFA 2HHTA 5H9EJ 5CCLA 1VBZA 2E6LA 2XRIA 2Q6CA 4AHTA 2VKRA 2C3UA 3J80Y 2BJ1A 2J5AA 4OI4A 4L3QA 1B70B 1QM9A 2XLIA 2QA2A 3M1FA 1ZA2B 4DN0A 4N56A 2DHHA 1S0NA 1T05B 1JJ4A 3KK1A 2JJ4D 3THYA 4IG3A 3E9LA 1QQOA 3ICLA 3SCJE 4DL6A 4M63A 4LF6K 1DT9A 4XAKA 3KLVA 5EXWA 3MN5A 1WOPA 1YJ7A 1YJUA 1AFIA 1SUQB 3F44A 4CJRA 4RUAA 2RQCA 1U1OA 3KOAA 4ECUA 1JWWA 3OL9A 5EVZA 2LQJA 3EUNA 4OYPA 4OZ5A 1OPIA 3ULEB 3J81j 1HQEA 1TZ0A 5CYQA 1BXNA 4P6QA 4B9NA 1TKXA 3LF0A 4CJ3A 4OI0A 5F9NA 2GJFA 2BE9B 4IWVA 2V50A 1HI0P 3W5YA 3AA5X 4B3TK 2HOEA 4CD1A 4XDCA 3TRGA 4B3RF 2VWJA 1QZ5A 2P9GA 2P9CA 1B4SA 3EEQA 2VUGA 4PXCA 2V94A 2CGKA 2OMOA 2ZWHA 1YGYA 3KHYA 2PMWA 1WOQA 4ZCIA 4QIFA 4DSEA 4HUFA 1HWJA 2CQ3A 1Y0HA 2KXHA 3I5CA 6AT1B 4PWDB 5I3QA 2UVVA 1UP1A 1UW9A 5H9FJ 3EX7B 1H7WA 2E1RA 5CZXA 2XMWA 2VOOA 2RJZA 3K0JA 2WZ1A 4B02A 3OVBA 5FPNA 4MIAA 5AZJB 4FS1A 1EP4A 2RVJA 4R8UA 2KDOA 4J5OA 5E3PA 5DLGA 4TY9A 4DU7A 4OFZA 4ZKAA 4C0OC 3ZT2A 1NJXA 2HHWA 3BGUA 3FCVA 3IG1B 2IFXA 2EG2A 2OPPB 2DEIA 1UFWA 3O4NA 1HYZA 2XB2D 3OTOJ 4EBEA 4ED7A 1Q4RA 3V4IB 4M3ZA 4B08A 3I0SA 3T6BA 1TUWA 3C6UB 3W63A 4JHDB 2PEHA 4CO0A 3SSRA 4Y1DA 1CZBA 4KB0A 4B1ZA 4W5TA 2FHJA 1GAOA 1WDTA 4WYWA 1X9SA 2QXLA 1Q53A 5CD4H 4B1WB 2BRLA 1D9AA 1FDNA 3HZEA 3TAPA 2HHPA 4CEQA 3B82A 2DB1A 3K8VA 1YTYA 3PUFA 3WQPA 3RAQA 1KQSR 1E4GT 4JBCA 5J2QB 1KQSM 3I82A 3WC0A 4ETXA 5L1LA 4A8OA 1VQ4S 5GAGP 1VMBA 2BE2B 5F0XA 1Q81O 2ZGYA 3HZGA 2EWSA 4MJKA 2CYYA 3DXKB 2EKYA 4X4OA 4JI4F 3NHGA 4PWWA 4KH0B 5KGWA 4FK2A 4OLPA 3G6XA 1CJTB 3EPIA 2H48B 2GV1A 3ZSRA 4CE9A 4LF1A 5AQXA 1RHUB 4RL1A 2Y1IA 2BYCA 2HFVA 3TZZA 1YJWN 4ISGA 3CC2N 2JRSA 3WZ0A 2CJBA 3GG0A 2EX3A 5E3CA 1HWLA 3TTDA 3I0RB 2UUWA 2E9ZA 4B9MA 3FRZA 2NREA 3P5BP 1BI4B 4DMZA 3PIPL 4JI3K 1VIOA 4HACB 1YITS 5EGYA 2O8CB 3CJ5A 2CPDA 5KAKA 1RACB 1PC5A 1K9MT 2M52A 2G8HA 4Z4FA 2N3OA 3BV8A 3CXCR 4DS4A 4B3OA 1VRUA 3HVWA 3CXCM 4M3XA 1S1XB 1RHQB 3NH2A 4PYAA 4OI1A 1S1WB 3AD7C 2PBDA 2H3GX 1ROFA 2WTFA 4UF4A 1FXRA 3FDSA 1HW8A 3SI8A 3JSMA 5LSLA 3THTA 4ZDNA 1SIWB 4IOBA 1RZMA 1T9VA 4DV3F 3IS9A 2M88A 2C2ZB 1CZAN 4AXJA 1ZTWA 2E1MC 2OZSA 2JFDA 3V6DB 2ILYA 3TZYA 3PVXA 1C0TB 1C1BA 2P9IB 1WG4A 4C8MA 4DV0J 3VAFA 1R89A 4ECTA 1NUEA 3E9OA 1P9YA 4W90B 2VFUA 1LNQA 1UWAA 4LRAA 2W42A 2ZM6K 3NGSA 3Q7BA 1JK9B 3T5LA 1JCGA 1OH7A 3G10A 1NDPA 5D4OA 5F3TA 3V6KA 4DN9A 5ETVA 1KVCA 1ZBSA 1JJHA 5KG1A 4DU4A 5HLFA 2MTLA 1RU2A 1LAWA 2ZNZA 4IFVA 3EN9A 2VBYA 4A4JA 3TW0A 2HW3A 4JK7A 3M9NB 5BPNA 2XG8A 3HYFA 1VHFA 3VF6A 3W66A 5MAOA 2P9UB 1WC3A 1HKCA 4DR3K 3E2EA 3OLAA 2PMHA 3MR3A 1GK8A 2OGUA 2F4VF 4DPXA 3OYLA 3BO2A 1YF5L 4JLHA 4NB4A 3KLGA 1V6HA 2I5JB 3I55S 3ZSWA 2M7SA 3MDQA 4F36A 3H2VE 3DLLQ 4F2RA 3ZSXA 1X4GA 3D6TB 3OUYA 4ILHA 4DCOB 1VGYA 4CZMA 2CQPA 2W2QP 3HFZB 2GGPA 1S9FA 3J81U 3SIPB 1NU0A 3IAM9 3DI6B 5RUBA 3BYRA 1VC5A 1NGBA 3KXDA 2RN2A 4CBUA 3UDLA 2MLYA 2XCAA 3JQMA 4P52A 5BRFA 3HMJG 1R0AB 1P8GA 3DN9A 5BYQA 4I1TA 2BM1A 2RRAA 4BWMA 1IKXB 2QLFB 2IRYA 4LBIA 2F8TA 3LQVA 1JLEB 1RDRA 4JB8B 1RHJB 1HARA 3GIIA 5EN1A 4MH8A 2C3MA 1JB0C 4X4QA 5IWAK 3BEGB 4DFJA 1R8AA 1RWMB 2NZCA 3MCPA 1D1UA 1OPZA 1XNRJ 3V6JA 3PM9A 3OYKA 2RS8A 2AJ1A 4BGBA 3HJFA 3ALYA 4AM7A 4BCAA 1NHUA 4JKGA 2FY1A 4RW7B 1HNXK 3NBPB 1FRLA 3ID6A 3P5JA 1HBOA 2CQGA 4X66F 3D54A 2HFNA 3CFPA 1YZ6A 2W24A 1GLFO 3KLHB 3GFZA 1APSA 2AZ1A 4OGCA 2E9RX 2IC3B 5L38A 1JXLA 2HMIB 1VSJA 2UUAJ 1OY8A 4C3MA 2RQMA 3NS5A 3H2LA 4H5RA 2G13A 1RKJA 2XCPA 1M1HA 3FR0A 1JJ2R 1TELA 4NCGA 4M63C 2J9CA 4KHUA 1UA1A 3A5OC 4BG9A 1CLFA 2YY3A 3KDNA 4I56A 5B0EA 4DV2J 4CEZA 2CNLB 5B09A 4KRFA 2NS1B 2IGIA 2Q1LA 1VC0A 4CLYA 1H1VA 3OHRA 3TVKA 1QE1B 3ZEUB 1NGDA 4LBHA 3AOAA 4BREA 3TYTA 5DG9A 1TVRB 2UV8G 2J6SA 3BGFA 4IUFA 2KN4A 3R1LA 3A8JA 3LO3A 2FLLA 1XMQK 3CCTA 2IDEA 3PO4A 4BGAA 3HSZA 1FDDA 1N56A 1BIUA 3CJKB 2WOMA 2HBZB 3IKMA 1P9QC 4BC9A 2MPUA 4HUEA 4QU6A 1E6YB 1RAJA 2BQ3A 3QLHB 1J27A 2NZTA 3LDNA 3SCLE 4RW9A 2MSSA 1FW6A 1RWNB 4KBOA 1U1RA 4JI8J 3UNYA 2KT5A 2IAJB 1DQ9A 2GQQA 1XNQK 3SFUA 2MXYA 1TUVA 1VQNS 1DKGD 2HFOA 4FCYA 3FSXA 1KQKA 3M2UB 1F6TA 1JLCB 1RXOB 4ZPDA 1LFPA 1NRKA 4IKAA 1OVQA 4FM1A 3O08A 1F60B 4AH9A 3M2RB 3Q83A 4WWSA 1Q16B 4JD2A 4JI3F 1RTDA 5B0DA 1T9YA 1FEHA 1K44A 3FBEA 3H40A 2DPJA 3DLBA 3ENHA 4FYXB 3JYTB 4NLVA 4J9OA 5DGAA 3V9ZA 4CF2A 2CPIA 3VQ6A 4BRMA 4QWBA 1FRKA 1VCTA 2YX4A 3N5BA 2MQ8A 4LY7A 1A6LA 1GOCA 2OPSA 3QIDA 1XMBA 4UW2A 4FWRA 1Q7YT 1RLDA 3TPQA 1UAXA 1MG7A 1HI8A 4K4YA 3CJAA 3R5DA 2MGZA 1VSDA 3I5AA 1GLEG 1NPRA 2WB1D 4JI7F 4BBYA 4ED8A 2GHVC 2RHSB 3ILOA 2KYXA 5D4NA 4DEZA 1MW7A 5LM7E 4DV1J 3NGRA 4FWLA 3AJ2A 1B92A 4PWUA 1WAFA 1VSHA 1ZBFA 2NCKL 3ZLJA 3MM9A 2QWPA 2XY6A 4C11A 4NA1A 1S48A 1BOTO 4GW6A 1BWEA 4IEIA 3NP5A 4NYZA 4P72A 3VERA 3D0HE 1T94A 3CHWA 5C2GA 4KI6A 2GVDB 2BUPA 3DRSA 3D2FA 2OFHX 2W40A 1T3NA 4KE5A 4LSLB 3O6WA 4CP5A 4XPEA 3PJXA 2IJRA 4FYYB 5T7BA 1KVJA 4NXMK 3U9DA 4AM6A 3EGWB 4OKJA 2ZC3A 4KHWA 1X9JA 4DR3F 1PJ5A 3HKZD 1WF0A 4LSNA 3DKDA 4JRQA 3SJHA 2N4DA 3F9KA 1YJNS 3QIPB 3VEXA 1V4TA 4L73A 2PMZD 1C0GA 1FD2A 4A2BA 5JUMA 3MUVP 4IXCA 2P51A 2G8UA 3SQOP 1EX4A 2Y0SD 2A3JA 2P9SA 3SAGA 3OV7A 1RT2B 3G8QA 4F4XA 3M05A 4GKKJ 3HSTB 3MM5A 4FPIA 1T0TV 1G2EA 4K8XA 3NVMA 1IBLJ 4OMFG 2Q43A 3D6MB 4FK0A 3J7YU 3QJLA 5CD4A 2WBRA 2DXFA 1RJJA 3HSGA 1KCFA 3T5KA 2YX1A 1ATNA 4USUA 4AHVA 3R27A 1LQ9A 3DOLB 3JSYA 3DAWA 2HBRB 2X3DA 1VQPS 4S0MA 4PUOB 2D7SA 3KWMA 1CXQA 2IDLA 3ZT4A 3THYB 4FZYA 4ZJQA 1FFSB 1IXKA 1VQ4N 3PSFA 2WSFC 4LRBA 4LF7F 1NZAA 1Y5LB 2MQOA 4GV6A 1JJCB 1HNWJ 1UCNA 3NAIA 4NX9A 1RCXB 1W7WA 4H03B 3HK2A 5M1OA 3JS9A 1HNXF 2PFFB 2RUGA 5EHHA 4EZ6A 1ZPVA 3T1HF 1VQSA 1YK9A 3ZT0A 5FRNA 4WKRA 2YHAA 2YNIA 2CQ2A 4CYUB 3DJCA 2QSWA 2RS2A 3W64A 3FFIA 1TYQB 3L8BA 4TU9A 3L7UA 3PR5B 4C8YA 4DV4K 2VU5A 4EIAA 2RUSA 1YITN 4FYVB 2HS0A 2MQPA 2AJ2A 1MMLA 4ZPWR 3M9MB 3EVWA 2OH2A 1OH8A 4Y28C 4Y2IA 4TLRA 1YRTA 3W65A 1HA1A 1SKSA 4OPJA 1NK7A 2VGNA 3ZZRA 1S6PB 3UD4P 3QNNA 3CVKA 3IA0A 2ZBQA 4FWPA 3T1YK 3CQXA 3QATA 5EX0A 2VJVA 4YDDB 4CF0A 3O1BA 1S10A 1I94K 3L9ZA 2DRAA 4PG4A 5C0YA 1OIAA 5HJXA 5FROA 4KR0B 1XMQF 2AP6A 2UUBF 3M4XA 5LXRA 4HYKA 1GMVA 3RRKA 2W2NP 4LH4A 3CCQS 2ASJA 3MAHA 4HHHA 2DHSA 3K5OA 3Q89A 4EO8A 3H45C 4CK3A 3QBWA 5M2RA 2QN6B 1QAYA 4DUZK 1VBKA 3UCUP 1T6DA 3UR3C 5AQOA 4EAHD 2ZBRA 4FPAA 4W5QA 3PHEA 4CERA 1XNQF 3NF9A 1FESA 4CFDA 2ZITA 2BOPA 4BR2A 1Y4ZB 4JK8A 2KG1A 1SKWA 1FRJA 5ELZA 3SUOA 5AE1A 2FC0A 4CEEA 1GQEA 4RW4B 1CS4B 4FWNA 2Q2RA 4JI6F 3P5TL 4N77A 2QI2A 3DU5A 3TSUA 3G6ES 4KFBA 4ECYA 2ZKUA 3KUEA 1WHYA 1LW2B 1NO8A 4HDGA 2HBJA 4Y2MA 1MROB 3TZWA 3RB0A 2P1JA 3MM7A 4DV7F 2P6SA 1I6JA 1N32J 4PKDB 2O8DA 3W9IA 3I55N 3I4PA 3QO9A 3CFRA 2H4WB 4P2SA 5CXTA 2FJEB 4A8WA 2NRVA 3IM9A 4ANCA 3PYFA 4OX7A 4EFAC 4CJKA 3C6AA 4IFYA 4J9QA 2O5DA 2M8HA 2VA2A 3DXMA 2PFDA 4A61A 2W9CA 1LK5A 4CO5A 3NNCA 3EVOA 4E7LA 1JCEA 1KONA 1T03B 1XR6A 2F40A 1DARA 2ZJQQ 4EGLA 4HUGA 1X4HA 1VQYA 2A18A 2EI5A 1YIJS 2ZH3A 3SCKE 4CJ7A 4ZPAA 5KFTA 3BSOA 2CJAA 4LF2A 1N5TA 3R6GB 3FC9A 5AQNA 5A8RA 4P75A 1EX8A 2D41A 3D1HA 1NJZA 2UU9F 4U95A 2GIRA 4U7UK 5D3GB 3QFWA 3L3VA 1TUGB 5I42B 4CLZA 3BSNA 4JOUA 4LIRA 4Q0BA 4JI5K 3FQLA 1NBWA 1W26A 1H98A 4V19J 8ATCB 3MEDB 4LF4K 2YWEA 2UXDJ 4CECA 3VVUA 4WFNQ 4F8RA 5EY4A 2HG4A 3VQCA 2ZFHA 3IBCB 5HMWA 1NM1A 4NZ0A 5HVHA 2PGCA 2IVOA 3PNIA 4WXWA 4QS9A 2FUG9 1WNEA 4YY3J 1QAIA 5GMEA 1Q1KA 4DR1K 2ITGA 2V69A 2A5XA 5LJ5Y 3GONA 1Q8BA 5M1PA 3DFEA 4O4GA 2L08A 4NRUA 5DQIA 4N47A 4GKJK 4DR6J 2DKOB 2YKPA 2FBTA 5A2QU 1JIHA 3I8BA 1WKLA 5C42A 4JYAJ 2BVZA 4F4WA 3MWTA 4RTFD 5KQDA 2HZVA 5JMNA 2H5EA 5JICA 2WK4A 2QMXA 1NZ8A 4E1MA 2U2FA 2GWJA 2DY9A 4LF9K 3NFAA 2BW2A 4LFAK 1HFEL 3EO3A 4DWIA 2XULA 2H1YA 4CH1A 4O8UA 4IDKA 2UXCK 2AQ4A 3MUTP 4ES2A 4H4OB 1RWXB 4LFCK 1FJCA 4IKFA 2K3IA 1WKJA 2MY8A 4KYZA 2D0BA 3R6LB 2FHOB 3KLGB 3CJRA 2UYTA 5DLFA 4DUYJ 1GLCG 3D6RA 3LWLA 1MMNA 3R5CA 3C15B 3OUYB 2X74A 4HHTA 2MKKA 4KGXB 4ZPCA 3RGIA 3ID8A 1JLBB 3OHBA 2GGPB 3TUIC 3A5LC 3OL8A 4AL6A 4OYXA 3KG1A 1VQNN 4V19S 1F2GA 5I3UB 4ECQA 1HKGA 5JS2A 3QMLA 4I6YA 4RCHA 4ILJA 2YKMA 4AL7A 3C6HA 1IJFB 3C14B 3OYNA 2FC8A 4M5JA 3KHLA 3LAMA 4FLXA 4RNOA 2ZZMA 4WYBA 2Z58B 2R42A 3FMWA 2JGUA 3E1YA 1U09A 4KH4A 3JSBA 1S1TB 4BACA 3TNVA 4U7CA 2CZVC 2YH1A 2LVWA 4CGDA 3QBXA 5EX3A 2QWQA 1DLOA 4ZVFA 5DJBA 3GJQB 3LAKA 2DFEA 3NWGA 3T1YF 5HO4A 1V5IB 2PYJA 4CIFA 3NS6A 4CEBA 1YBUA 4AQYK 4FJKA 3OFHA 1OSDA 2DIUA 4CLSA 3DYAA 2IM2A 2CDQA 1Q5VA 4C8KA 2LXIA 2ZBIA 2ZH8A 3M32A 1FRMA 3D3CJ 3ZT3A 4I6AA 3D4JA 1QTNB 4FF3A 4B17A 2R4FA 2A6OA 4IRKA 4DUZF 4A5BA 4RUHA 1R6VA 1UVIA 3A1YG 3H5SA 4O3PA 1K0TA 1U2VB 4USWA 1WTFA 4A59A 1HNZJ 3J7AP 2LQBA 1U8SA 2DNLA 4V1Ak 3BKUA 2ASYA 1NGFA 1O8BA 3BY5A 2YNHA 2ASPA 4TYAA 2VA3A 2W25A 3VAKA 1RYSA 2KKZA 4ELVA 3GYXB 4Y00A 5AJ3F 4HTJA 1XQSC 1PYSB 3HRGA 1IV0A 2WSCC 4Y34A 1C1CA 4KHSA 5THWA 3NCIA 4I64A 5KFCA 3NH1A 1RKIA 3MCAB 2DR8A 2BA9A 3OL7A 1WUAA 3QEWA 1TKZA 2PC6A 3BF1A 3F9MA 3R6MA 2R7WA 1XMOJ 1YTAA 1YJNN 4JI2J 4M41A 5CZ2A 2BR0A 4NXNJ 5H1SQ 1MDUB 5IS2A 3BR9A 4O5BA 3CJQA 3J81Y 3QFUA 2B6AA 4WCEL 4RW9B 2X6SA 1H7XA 3VGSA 4Z4CA 3BP8A 2NXEA 3DRPA 2OMLA 1SJRA 5C25B 1TL7A 1WEYA 2XMMA 4OZ2A 4E2FB 4I2PA 4KB1A 5AXKA 4I6MB 4ZP6A 4QIWD 1VHIA 1FVSA 4TY8B 1PC4A 1NKBA 3MM6A 3OPKA 3ZNJ1 1IG9A 3PSIA 3S01A 3C7NA 3QJPA 1VQPN 1ITGA 3SBGA 3K5LA 4E7HA 2P9NA 2WONB 2KO1A 3ILIA 5BN9A 4IR9A 1XK8A 5A8WA 3M2VB 3O3FA 1IBMF 2DTJA 3DOKA 2H5JB 2IVMA 3CO0P 3PX0A 3K5MA 4ID8A 3G2XA 2B4JA 4BR9A 4JI5F 4BY9C 1I51B 1GTEA 1FKPA 2ZGZA 1UWBA 1U49A 2KYZA 2OPSB 1ZA1B 5J1EA 4ZVEA 1NK8A 1RABB 1TV6B 3RAMA 3GIMA 3NH0A 4CZCA 4NLBA 4M94A 2GW8A 3PY8A 4B3TJ 4XH1A 2XZDB 5EUHA 5CE3A 4DR1F 4ZP9A 2I7PA 2C42A 4MK7A 2P5OA 4F4AA 5J2PA 2XTJP 4GKJF 4BDYA 1ZBUA 1WLJA 3MECA 4FBTA 5FD1A 4W5NA 1M5HA 3DMJA 4H0VB 3OTOK 3I96A 5KFKA 2OO4A 4XTTA 4K25A 2R2UA 5AZIA 4AHSA 1ESVA 4N41A 1JLGB 3D1OA 3THXA 3TWZA 4LF9F 2PY5A 3P45B 2HQIA 4Y3CA 1C1AA 2ZH5A 4YOUA 4G9ZA 1KFSA 1BCOA 4ECVA 2KL8A 1EXQA 2LDYA 4LFCF 5IC6B 2V52B 4LSNB 3CCQN 2KU7A 1GTHA 2IOCA 2G4BA 2CH6A 2ZDPA 4ILGB 3HHLB 4CHNA 1Q9YA 2Y1LB 4LF5J 1FE4A 2CGJA 3AVBA 2O8EA 1GLDG 4WFBL 5CQGA 4H8KA 3KHHA 2Z2MA 4RBVA 5M2PA 2DFFA 4WZMA 2A41A 2HNYB 5M1KA 2XI3A 2BE7D 4XPCA 1S6UA 2VJUA 2K1RB 2MQMA 4TQRA 3G6EN 4O44A 1NK6A 4PRFA 4QZVB 1UVJA 4HLBA 2RPIA 2EHGA 2HQDA 4Z94A 1KBRA 3RW6A 5AXLA 1M1KT 4RG8A 1WBBA 1I1GA 3HPHA 3MURP 2DR7A 4CZIA 2QXFA 4MDBA 4F25A 1SJQA 3FZMA 3AVAA 2W7OA 3W61A 4LUBA 4H0OA 2A1BA 4FJHA 2QLXA 2B5JA 2VFRA 2NQPA 5G0RA 2ROPA 1RWWB 4AQYF 4GMKA 2NUHA 1A5WA 3KNAA 3ZXWA 2N82B 3DLKA 4ZTJA 4ZITA 5F8GA 4M5GA 3ZETA 3CJCA 4CEFA 4USMA 4C23A 5A6PA 3M30A 1YIJN 4ZOSA 2YX7A 3B54A 5KFQA 1V3SA 5GADU 2G2ZA 4DL0C 3KLEB 1N34F 1S76D 2GVZA 1QZ6A 4W92B 4DG1A 1IR1A 2HZCA 2YTCA 4DV0K 1JLAB 2LEBA 4ECXA 2FHJD 2R3VA 2QWMA 1WOOA 3SYZA 7FDRA 1EHWA 2NXCA 5C2FA 3RSEA 3CD7A 3VOVA 2AU0A 2RSQA 1WHVA 2MZRA 2V6AA 3CJ7A 2LLZA 4DFPA 1NAQA 4ZS6A 3LDQA 1RCHA 1NMEB 5AQZA 5IT9U 4N8NA 1FK9A 2FBYA 4KT0C 2ZD1B 1QSSA 4R25A 1WJ9A 4EMDA 3JAMO 2WVEA 1B7YB 5DM7L 3CC4S 4K4UA 2JHEA 4OZNA 2GELA 4O0NA 2BQRA 1W25A 4EFHA 2KZZA 2QKKA 5CAAA 1Y10A 1TMJA 3I8DA 4QW8A 2JLFA 1KAZA 5JVHQ 2B56A 4IOAQ 4BG8A 2ASOA 2O66A 4C8ZA 4WP8A 3B6PA 4CLWA 4WFNL 5AQRA 5L8RC 4B9VA 2OA8A 1IM6A 1XHZA 2J6TA 3B4DA 2CQBA 3H5UA 4KO0A 4RNMA 3KHGA 3U9ZA 2XNQA 4KFBB 3M6XA 1NSPA 1KVAA 3V81A 3Q8RB 2ZWOA 4CO4A 4A8QA 2ZH4A 1ZZFA 3IR6B 3DLGB 3EVMA 1TL4A 1LXJA 3TAQA 3RW7A 1YTUA 3HSDA 4WBFA 2R8KA 4KPCA 5E7OB 4HI2A 2O8DB 4DR2J 4CGFA 4WP3A 5D8HB 3V9XA 4EYIB 2N3LA 3QT6A 4LBPA 1YZ7A 1ZAXA 2QFIA 1RT1A 4Z0UA 4DTJA 3MPVA 4JKCA 3Q24A 3M8WA 4TU8A 2V63A 1QQNA 5K8PA 3HO1A 1Q82O 4WPAA 2DHAA 1OYDA 3L2UA 4BRQA 1RTHB 1AZSA 2CJXB 4URSA 4KH1B 2VPZB 1VR6A 3UKRB 1RNHA 4CO1A 1VRQC 1VLOA 4FP9A 2RHKA 2QWRA 2FLOA 1RTJB 4MIBA 1QUVA 1W0HA 5B8HA 4J8FA 5GAEU 1BQNB 1NCLA 3BGRA 1J5OA 2BQUA 4JI1J 3QERA 3KJQB 2DR5A 3UVJB 1U0SA 3RB3A 2CQ1A 3ENWA 3FRYA 1WELA 4XH5A 2ZZNA 5FLXO 3AA9A 1DJ0A 4M95A 5DO2A 4K4TA 1RDUA 1IH7A 3BKFA 4OX8A 2DNOA 2DFHA 1SQEA 1FFWB 2CKWA 1W2BR 1KVBA 3WNHA 3C16B 3M8RA 4DX6A 1YI2S 4DJBA 1RHMB 4J2DA 3OBIA 2MZ1A 1D0EA 3QQCD 2JZ5A 2IRXA 4DTMA 1VSKA 1NMDA 3BJYA 4UZBA 4YUDA 5CR4A 2ATLA 2IBOA 5AQQA 1MSWD 1RSCA 1TL1A 4AHCA 2V5HG 4QQBA 2X3GA 3AARA 4J9NA 1E6VB 2WBMA 2DR9A 4TU7A 1N6QA 1H2UX 3CDWA 2ZH1A 5IOLA 4DI6A<