1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
1L5UA 1RT5A 3QLHB 3QZ7A 2R7YA 4OKKA 3CJ2A 3DRPA 2P1JA 3E01B 1RNHA 1S6QB 1RBUA 3V9XA 1SUQB 3TAPA 1BISA 4URQU 1TAQA 1TK0A 1EX4A 1KLMB 5F8GA 2YNFA 3OYHA 2XGPA 4H4MA 2R2TA 1SKSA 2BR0A 5KFPA 1D8YA 4DL2A 4F50A 2NUBA 4RW7B 4ECTA 1NOYA 4WZQA 4IRKA 1U09A 3ZT0A 4TLRA 3OS0A 2JC0A 3JYTA 3VQSA 2HWHA 2G8FA 1ZBIA 2W9AA 4Z4IA 4Y1DA 4J9RA 1NHUA 1GX6A 4IR9A 2UUWA 3HYFA 1LAVA 1R0AA 5F8JA 3DLEB 4CEFA 3KKSA 4KBIA 2E9TA 4RW8B 4DU1A 3KLFB 4KHUA 1T94A 3SPYA 1S9GA 1EKEA 5JS2A 1ZYQA 1WAFA 2J6UA 1IKYB 4IR1A 2IOCA 3OJUA 2G8IA 2D0BA 3AA4A 1VSLA 3VN5A 2QXFA 3LP0A 4FK4A 4O3QA 1RT1B 2EX3A 3RTVA 4B9SA 3QNOA 3KOAA 2XI2A 2XI3A 1MMLA 3OYCA 5KTQA 1NK8A 1Q9XA 3C95A 5KFDA 5T7BA 2P5GA 4JV1A 4NLVA 1NK9A 3GIMA 1N5YA 3CQ8A 5DGAA 1G15A 1C0MA 3ZT3A 4FW1A 4HKQA 4PQUA 4MKBA 4KTWA 2B6AA 3GQCA 4I7FB 3SQ0A 4MK7A 1RDDA 3AVHA 4OVLA 5KFYA 4MFBB 1RTJB 1VSIA 3HM9A 4JUZA 4I9LA 4EEYA 1NNDA 4CIGA 4N5SA 1FKOB 3H59A 1EXQA 4M3UA 5KFRA 2IC3B 4NYNA 1JLAB 3MTKA 4NLDA 5C25A 2X6NA 3DRSB 3LAKA 1GOCA 5KFHA 4ELVA 4ID5A 4DTUA 2FBXA 5J2MB 4BE2A 4NCAA 5K14A 3HVRA 3MFHA 1S1XA 3HHKA 1XHXA 3IRXB 3KLGB 4CEZA 3GIIA 4PWDA 2IJFA 1S1TB 4G3IA 2HNZB 4FJGA 1XWLA 4CGGA 2OPRB 3PJXA 3OS1A 3SI6A 3SJJA 3BJYA 3BQ2A 4W5RA 4RNOA 4C8KA 1L3VA 3DM2B 4J2DA 4O55A 4CGFA 4F3TA 4CFAA 4YR3A 1JLCB 3DOLB 4ED7A 1N6QA 3AVLA 3PR5B 5I3UB 4FS2A 4FXDA 3HJFA 1DTTB 2Z1IA 2HNDB 4K4XA 1JLFA 4NLUA 2IAJB 2C2DA 4NLQA 5KFLA 4DSIA 4NLWA 4AH9A 1ASWA 1QQCA 2WB4A 4B08A 4CFBA 4DTRA 1C1CB 2BDPA 1IKWA 3MEGA 3BQ0A 4IKFA 4KFBA 2FJXA 3LP3A 1RDCA 3QESA 1JXBA 1XHZA 4LQ3A 3KHHA 1MU2B 1TKZA 1TL3B 4GC6A 4RW6B 2YHAA 4DTSA 4RW4B 3UQSA 4RUAA 3IN5A 1NKCA 3AVKA 4E19A 3KMSA 5KFKA 4FJ9A 2YNIB 2FJVA 2DFEA 2R8HA 4EBDA 1D1UA 4KE5A 2VA2A 5CYMA 2Z1GA 4B9LA 4DSFA 2W9BB 3P83D 1D5AA 1QHTA 4DL3A 4IQXA 4FJXA 4O44A 1N48A 4BDPA 1QUVA 1T8EA 1BL3A 2GUIA 4DU4A 1XC9A 1WSHA 4LQ9A 5KT2A 2D41A 2YNHB 3KLEB 4MK9A 4CE9A 4G1QA 4DQSA 3K59A 4ZPDA 2C2RA 5FRNA 5HRRA 3OL7A 4IH6A 4IFVB 4Q8FA 4H4OB 3L2VA 3PY8A 1K1SA 1NJYA 1S6PB 1TAUA 1EETB 2VWKA 2O4GA 4N47A 4LSNB 4RNFA 2EC0A 1D9FA 1SL0A 2XCAA 2ZQBA 1SKRA 1JKHA 5FROA 3DLKB 1TP7A 4QWBA 3P5JA 5KG6A 3HP6A 3DMJB 2BE2A 5EU7A 1T05A 3N6NA 4FZYA 3SQ2A 4AHVA 1TV6A 4IG3A 4B9TA 3L8BA 4IFYB 3LZIA 3H2LA 1VK0A 4ZVHA 3S9HA 4QWEA 3VQ6A 3TAFA 2YKMA 4YP3A 2HAIA 2W42A 4K4SA 4KAZA 3NGDA 3HPGA 4B9UA 4UQGA 1C0TA 2W9CA 4J9SA 3RMDA 3MR3A 1JXLA 5C42A 1HQEA 5L1LA 1A5VA 5EWGA 2D5RA 2W8LA 3FSIA 4DL5A 1S9EA 3NAEA 4RW9B 2KZMA 2UVUA 3K5LA 3RMBA 4M3WA 3QIOA 3OYGA 5DQIA 5J2PB 3H08A 4PUOA 4ED2A 1BGXT 4FLWA 4HYKA 1HNVB 3E51A 3AVCA 2R2RA 1QE1B 3BGRA 4CHQA 4NYZA 1XI1A 5HROB 3HVAA 4KO0A 5SZTA 4ID1A 4DSLA 2BQRA 4ZP7A 2P5OA 2IMWP 3HPOA 4FLTA 1C2PA 2WONA 2XRIA 4Q43A 5KFQA 3TARA 4FYDA 2BQ3A 1N4LA 4F4WA 4O4GA 1HNIB 1YTAA 3SFUA 2FLNA 1RT4A 3IGNA 4NCBA 3PJWA 2YV0X 3LPTA 4MH8A 4ZPAA 3F73A 1JLEB 1KVCA 4WE1B 3NFAA 3G6VA 2RKIA 3RB4A 1S4FA 5HP1A 1FK9A 1RTDB 3ICLA 4Z4FA 4R5PB 4KSEB 1HYSA 2FVCA 1RT6B 1LW2B 4CHZA 3H98A 4DFJA 3KLHB 5KFXA 4QAGA 3KD1E 3QLHA 3KIOA 1JLGB 4O3PA 2WOMB 4FJIA 3E01A 1S6QA 5KG5A 2GIRA 1TKTB 3OYMA 1SUQA 3RMCA 2Q3SA 4TQSA 4XO0A 1LWCB 4CJVA 4BWJA 1KLMA 2ATLA 3G0ZA 4LSLB 2YHBA 1RT3B 4NLTA 4NLSA 3D45A 4EP4A 2ASJA 4RW7A 3SUQA 3CM6A 4DSEA 3V9UA 5E41A 1QS4A 3DYAB 4NLGA 4NRTA 4F3OA 2FVSA 4K4TA 5KFBA 3CDUA 3AO5A 3FFIB 3QYYA 3AVMA 2JEIA 3G86A 1IH7A 4ECYA 2BQUA 4EO8A 5F8LA 1J9AA 4KHYA 3NF9A 2A1RA 2G8WA 5DK5A 4OJRA 2JEGA 3DLEA 1NK6A 3GYNA 3L2WA 4TQRA 4ZTJA 3KLVA 1U48A 4RW8A 3KLFA 3ZSXA 2ZKUA 4RNMA 1ZBFA 4CK3A 2Y1IA 2OPSB 4FJNA 4XIUA 2R8KA 1GOAA 1IKYA 3O3HA 1X9MA 3Q8SB 3RWUA 4FLVA 1CXUA 1U47A 3DOKB 4JS4A 1S0MA 4ZPCA 5L1KA 4O0IA 3D28A 4F2SA 1RT1A 1S0OA 4N56A 3PW5A 3HO1A 2D3ZA 2B43A 5KT4A 4WFXA 5L1IA 1VRUB 4E7HA 3DI6B 3OVNA 1TGOA 2G8KA 3FRZA 1RTHB 2XY8A 5KG2A 2YKNB 2PY5A 2OPPB 4FJ8A 4DTOA 4DTPA 4CJLA 4IDKB 4FJ5A 3H5XA 3MR5A 4CF2A 4I7FA 3MXIA 3CJ4A 3LDSA 2ZD1B 4O5BA 1IO2A 3M9OB 4MFBA 1RTJA 3OYEA 3NDKA 4C8NA 3VQAA 1UA0A 5I42B 2YNGB 1FKOA 2G8HA 2PZSA 2IC3A 1JLAA 1BQMB 5KG1A 4DFPA 3TI0A 1TL1B 3DRSA 4TYAA 2GV9A 5KI6A 3LAMA 3SNNA 4F4ZA 3ITHB 1NK5A 5J2MA 1A5WA 3SCXA 2CKWA 3B6OA 2HHUA 3QNNA 3HKWA 3F9KA 3IRXA 4FM2A 3KLGA 1JL1A 4CF9A 4CGJA 4W5NA 2HNZA 2C22A 4CF8A 3DLRA 2OPRA 2HNYB 5HRNA 1J54A 2V0NA 3H40A 3B6PA 3DM2A 2R8JA 1LV5A 1WSJA 1U45A 3V1QA 1JLCA 3EZUA 3DOLA 4DFKA 3AVJA 5DLFA 3TR8A 5I3UA 1Z25A 4CJ3A 4HCCA 3O3FA 1DTTA 1NJXA 2C2EA 2HNDA 3MXMA 3T5KA 3S3OA 2IAJA 1UOCA 2EHGA 3RBDA 3A2FA 4EZ6A 4DTXA 2UUTA 1C1CA 4EYIB 2XWYA 5J1EB 4NRUA 4K8XA 4QPXA 3H4DA 3KK2B 1MU2A 4OGEA 3DRRB 4ECXA 2KTQA 3I0SB 3QEXA 2XY7A 1TL3A 1C1BB 3OYDA 4RW6A 4OKJA 4CJSA 4EP5A 4RW4A 1S1VB 2QV6A 3NF7A 1XR6A 1WSGA 1B9DA 1RAJA 2YNIA 3H5SA 3ZSQA 2DY4A 1BIZA 3RB3A 3I8DA 1SH0A 4F4KA 4HHTA 2RDIA 2W9BA 1RDBA 2HVIA 3PW4A 4CIEA 3ALYA 4ECWA 4MK8A 3NBPB 2UVVA 3HSTB 3SZ2A 3KJVB 2UVWA 4NLOA 2G8VA 2OH2A 1KHWA 1RA7A 1I39A 3QEIA 4I2PB 1LW0B 4EYHB 3ZSWA 3RAXA 3V1OA 2A1SA 3H5UA 2YNHA 3PW0A 3KLEA 2KW4A 3AA2A 3TAMB 4WXOA 1X1PA 4NCGB 4M94A 1YVUA 4ED3A 3LP2B 3ZSOA 3ZCMA 4AHTA 4FVMA 2OA8A 4IFVA 1XR7A 4H4OA 3NF6A 1S6PA 5KFCA 1EETA 4QW8A 4KHSA 3CG7A 4CEOA 3AV9A 3UDLA 2ZE2B 4LSNA 1F21A 4B9NA 2QE5A 2Y1JA 4CEBA 2QKKA 3OL9A 3BSNA 2VG5B 3DLKA 4Q45A 4FCYA 1T03B 1W25A 3ZT1A 4CESA 1UA1A 3DMJA 4GC7A 5KFWA 4B8AB 1CZBA 4ED0A 1BCOA 2RN2A 4IFYA 3ZSYA 3VQDA 2B5JB 1VSHA 3N6LA 1NK4A 1UWBB 4FJ7A 1S1UB 2AQ4A 1ZTWA 1S1WB 2R2UA 3NAIA 4NLRA 1WSFA 3CFOA 1U4BA 1QTMA 1T7PA 2WCXA 2HHQA 5KFGA 4CK2A 1WSIA 2BGGA 2R8GA 1ZTTA 3SV3A 4RW9A 3GIKA 1QAIA 4CEAA 4HUGA 5J2PA 5J2NB 4KHNA 1HNVA 4CEQA 4B9MA 1QE1A 5HROA 2XC9A 3NL0A 4MIAA 3V81B 4I2QB 4JS5A 2IJNA 1KCFA 1HPZB 4ZPBA 4XPCA 5DLGA 4J2EA 3V9ZA 5KRTA 2E9RX 1HNIA 4BWMA 1U49A 4CIFA 1DLOB 4J9KA 3SUNA 4KV8B 1JLEA 4E1MA 1X9SA 2DPJA 4WE1A 3L2UA 3EZ5A 3MEDB 3C6UB 3QEPA 1NOZA 3L3UA 3CDWA 4W5OA 1RTDA 3LANA 3OYBA 3SPZA 4R5PA 3V6DB 4CEEA 3U3YA 5DG8A 2RF2B 1RT6A 2E4LA 1LW2A 4KI6A 4ED1A 3KLHA 3V6JA 2C28A 1TKDA 1JLGA 3DLGB 4ECRA 2WOMA 3PHEA 4ED8A 3VQ7A 1TKTA 4EBEA 3OY9A 3RAQA 3TVKA 2HWIA 2B6AB 3H5YA 4M45A 4FW2A 4OL8A 5KFVA 3QETA 3KK1B 4KB0A 1LWCA 2IM3A 4DQQA 1K1QA 4YR2A 3NGZA 1RTIB 4CGDA 4CCHA 4E7KA 2KQ2A 4KRFA 3HVTB 1RILA 4LD0A 4LSLA 2V4QA 4EBCA 5KFNA 4K4UA 3DLHA 3G6XA 2Z1HA 1RT3A 5KT7A 4Q0BB 3ISNC 5CYQB 1T3NA 4O3SA 3DYAA 4TYBA 2HHSA 3V9WA 3T3FA 3I0RB 2AJQA 3FFIA 5KFOA 3K57A 3CJ3A 4J9NA 1JX4A 4C8LA 3IGVA 3MF5A 4HUEA 4ED6A 3OYLA 4DU3A 3K58A 2AGPA 2X78A 3WNEA 1IKVB 1C0UB 4DQRA 3AVAA 3GIJA 4QW9A 4CJ5A 1XR5A 2OPSA 3AO4A 3I5AA 3RBEA 2DTUA 2QK9A 1J53A 3OLAA 3QGGA 4RNHA 3PVXA 2D7SA 3DOKA 1SV5B 1ZETA 1Q8IA 2I1RA 3UPFA 3KK3B 1KHVA 1CLQA 1ZBUA 5KFMA 3NH1A 3IS9B 4ZHRB 2IM0A 1EP4B 3L3VA 2PYJA 1TQLA 4CF1A 1RYRA 4EZ9A 4K4YA 1HARA 3EYZA 4J9QA 4ECVA 1VRUA 3DI6A 3DLBA 4JLHA 4RUCA 3TABA 1RTHA 3Q8QB 2IDOA 2HHWA 4ELUA 4DS4A 4F8RA 1DTQB 4JV2A 3AVFA 5CZ1A 2YKNA 2OPPA 1SH2A 4DSKA 1LWEB 3MEEB 1ZBLA 1VSMA 3VA3A 4WFZA 2CJQA 4OPJA 4DMNA 1S97A 2OPQB 4IDKA 4YMEA 3T5HA 4CJWA 4RU9A 2ZD1A 1JXEA 3MR2A 4WYWA 3QEVA 1NK0A 3BR9A 5I42A 2JEFA 3M8RA 2YNGA 1BI4B 2P51A 1RBSA 3I5CA 3C6TB 3OL8A 1BQMA 3AVGA 3OS2A 1TL1A 4ECZA 1VSDA 1I3AA 3OSPA 1VSEA 2W7PA 1JLBB 3UIQA 3VA0A 3ITHA 4ICLB 2FC0A 1HMVB 2RDJA 5D3GB 4MQ3A 4DFMA 1BHLA 1QSLA 1SKWA 3AVBA 1ZBHA 2AGOA 1SL1A 3RR8A 1BQNB 1RA6A 2HNYA 3OYIA 2X74A 4KTZA 2KFZA 2FVPA 4YNQA 4M3YA 4NLYA 3ZT2A 4IG0B 1FKPB 4HUFA 1REVB 4TY9A 1VSFA 1YT3A 4JV0A 3LWLA 4YR0A 4CEDA 3QIPB 3KKRA 3C94A 3BSCA 3RR7A 4MIBA 2F96A 4H8KA 1CSJA 4F2RA 1RT2B 4GMJB 4CF0A 5KG0A 3CO9A 5JS1A 4DTMA 2XGQA 1SL2A 4B3OB 4M95A 5KFTA 3PR4A 1VSKA 3L2QA 1TK5A 3TAEA 5J1EA 3G6YA 4KKOB 3MXJA 4BE1A 2HMIB 2ATQA 5DGBA 1QSSA 3KTQA 3KK2A 3DRRA 3SV4A 1TK8A 3I0SA 1IKXB 5DQHA 3V6HA 1C1BA 5KFEA 4ZVFA 5EWEA 2HHVA 1ASVA 3LWMA 4FJKA 1S1VA 1HQUB 5JXSA 1NKBA 2ILZA 4Q44A 2B4JA 3T19A 1S9EB 3RB6A 4J9MA 3QO9B 3ZSVA 5T14A 3NMAA 3RB0A 3O3GA 1LWFB 3VQ8A 2I5JB 2FVQA 3NBPA 3IG1B 3T5JA 2X6SA 4R8UB 2GIQA 3KJVA 1KRPA 3KLIB 3BSOA 5DQGA 3WNFA 3THVA 4M3XA 4ECUA 4I2PA 4BDZA 1LW0A 4DG1B 4BE0A 4FM1A 3WNGA 1TKXB 3LP1B 2BANB 4Y34A 1JL2A 1HRHA 4CJTA 4YFUA 3TAMA 4FK0A 4NCGA 4O3NA 3LP2A 4N76A 2O5DA 4FM0A 3OL6A 5KFJA 1HJRA 3IAYA 2FVRA 1BIUA 1TVRB 5L1JA 2ZE2A 4TXSA 2AU0A 3PUFA 2QKBA 3OHBA 4ZP8A 2VG5A 1S1TA 5J2QB 1VSJA 3HXMA 2BRLA 5HBMB 3LALA 1T03A 3NHGA 1KFSA 5CZ2A 5C24B 4MKAA 3AA3A 3HP9A 4HTUA 4FLYA 3OYKA 4HCBA 2B5JA 2WK4A 3V4IB 2VG6B 1UWBA 1S10A 1S1UA 1B9FA 1S48A 4E0DA 1WNEA 1S1WA 1RBTA 4WXWA 1HYVA 4DEZA 1U04A 4O0JA 4J9PA 4QOZB 3OSNA 4K4ZA 4AHUA 4WFYA 4URSA 3T5LA 3M8PB 5KT3A 3EY1A 2ETJA 3EPIA 4GVMA 3SUOA 4ELTA 3NGIA 1OS5A 4PY5A 1FXXA 4FZZA 5J2NA 1S0NA 2AX0A 5KFZA 3AO2A 2IS3A 3V81A 2FLLA 4I2QA 5EDWA 4DF4A 3S3MA 4R0EA 5F8IA 4LH5A 4M3RA 1HPZA 3CIZA 2KFNA 2JC1A 4TY8B 4CJUA 5FRMA 5FDLB 2WTFA 2E6LA 2VG7B 5KFFA 3CJ0A 3GV7B 4L8RB 3QINA 4E7JA 1DLOA 4KV8A 3M8QB 2XO7A 1JLQB 3MECB 2HB5A 1VRTB 4CERA 2VA3A 5KT5A 3MEDA 1D9DA 3C6UA 3U3GA 1RT7B 5KFSA 4N41A 5KFUA 3V6DA 5SWMA 3H4BA 2RF2A 4H54A 1LAWA 4E1NA 4O3RA 3I5BA 3DLGA 1Z4UA 1NHVA 4IH5A 1NK7A 4CJRA 2RPIA 4FJHA 5KT6A 4CJQA 4C8MA 4K8ZA 2ASLA 1RBVA 2ITGA 3KK1A 4DLGA 4AHRA 4BDYA 1J5OB 1RDAA 5HLFB 3PX0A 1JIHA 1RTIA 4DL4A 3HVTA 3JSMB 2F8EX 3G10A 3QERA 4LY7A 1RT5B 5KFIA 3T1AA 4XPEA 3CWJA 3LPUA 2G8UA 3HVWA 3DRPB 2IM2A 4Q0BA 3QIDA 4KHMA 5CYQA 2AX1A 1C1AA 1A5XA 1KVAA 3VQBA 3P1GA 3SI8A 3I0RA 3S3NA 2DPIA 4C8OA 4Y2CA 4TSXA 2WRMA 4OKEA 2E9ZA 2YNFB 3BREA 4JRQA 4H4MB 2F8TA 4QCLA 2OYQA 1KFDA 1X9WA 1IKVA 1C0UA 3CFPA 2ALZA 3VQPA 4ZMMA 4FLUA 4FK2A 3NH0A 3BDPA 4QWAA 3SUPA 4AHSA 3K2PA 4O4RA 4NYFA 4Z0UA 4FJMA 5KG4A 3PO4A 2OZSA 3M9MB 3OYFA 5F9NA 1SV5A 3QGHA 3PV8A 4EO6A 3K5NA 4IBNA 3KK3A 3JYTB 4Q8EA 3M8SA 3IS9A 3ZT4A 4ZHRA 1EP4A 4Y1CA 4CHYA 4HVJA 4OPKA 5JUMA 3QZ8A 4CFDA 1Y97A 1BCMA 1R0AB 2AWZA 3PO5A 4B8CA 3NAHA 1N56A 1S9GB 5HRSA 1DTQA 3Q8PB 2GBZA 4M42A 4OLBA 1LWEA 3MEEA 3QGIA 1KSPA 3AVIA 3NCIA 2GC8A 1L3SA 4FS1A 5F8NA 2OPQA 3TAGA 3LP0B 2V9WA 1B92A 5KGXA 4KTQA 3NKYA 3SYZA 2UVRA 3GILA 3AA5X 3VQ9A 1BI4A 3PW7A 5KGWA 3ISND 3C6TA 1WNSA 3KHLA 2D0AA 4E7LA 4FJLA 5KRSA 2F8SA 4DL6A 3AO1A 3AO3A 1N5YB 4E7IA 3U6FA 4DTNA 4DL7A 3VQ4A 1JLBA 4ICLA 1IM4A 4ZP6A 3MAQA 4PQUB 4IH7A 1GX5A 1HMVA 4J2AA 2ASDA 4CJPA 2R2SA 5D3GA 1RYSA 1D0EA 4CGHA 1QAJA 2JGUA 2HVHA 4BACA 4GW6A 3O4QA 4ZTFA 4IRDA 4K50A 1BQNA 1ASUA 4M3ZA 1SH3A 5F8HA 2V4RA 2XHBA 3ZSZA 5C25B 3VQ5A 3VQEA 2FJWA 1S49A 2AGQA 4AILC 4IG0A 1FKPA 1REVA 3NGYA 4PA1A 4ID5B 4E3SA 4QWCA 5K14B 4X2BA 4KI4A 1O1WA 3KHRA 3CFRA 1S1XB 2D0CA 3K5MA 3QIPA 3GV5B 5DMRA 3CYMA 3SQ1A 4PWDB 4KPYA 4DQPA 3KD5E 4J2BA 4RZRA 4CJFA 4CJEA 1RT2A 4FLZA 3CVKA 2VWJA 4B3OA 2BRKA 1KLNA 4KKOA 4M3TA 3K5OA 2HMIA 4O3OA 2D3UA 1N6QB 2KZZA 3Q8RB 3OYNA 1IKXA 4FBTA 4J9LA 1K6YA 4KREA 4DQIA 4URGA 4RNNA 1HQUA 4Z4GA 1JLFB 1GOBA 1WSEA 4KHRA 5L9XA 1CXQA 5F9LA 1NJWA 1L3TA 3QO9A 1IKWB 3VQCA 3MEGB 1LWFA 4KFBB 1CZ9A 1Z26A 2I5JA 4WYLA 3V1RA 3BSAA 2HHXA 3IG1A 4R8UA 1TKZB 5F8MA 2PYLA 3KLIA 1Q9YA 3OJSA 3KMQA 4ECQA 3TQ1A 4Q5VA 3CM5A 1RCHA 5EWFA 4OGCA 3TAQA 4B9VA 2W7OA 4CJ4A 4DG1A 2DFHA 3SFGA 5DG7A 3RRGA 3NF8A 1TKXA 4F4YA 3LP1A 2BANA 4JRPA 5CY4A 3MFIA 5CYMB 4ZVGA 3PZPA 2J6SA 1S9FA 2FLPA 3HL8A 1W0HA 4Y3CA 3BQ1A 3VQQA 1IG9A 3KHGA 4CECA 1UAXA 1TVRA 3OYJA 3M9NB 4O44B 1KTQA 4FJJA 4ECSA 1NKEA 3N6MA 4FBUA 3HPHA 1I6JA 1C6VA 1QSYA 4Z4EA 3TWHA 3UR0A 4CK1A 5J2QA 4W5QA 5HBMA 4NLXA 5KG7A 4FZXC 3OHAA 1L3UA 3HK2A 3PW2A 1W9HA 4Z4HA 4M41A 4G1QB 3OLBA 5C24A 3DDKA 4Y2AA 2IGIA 4AHCA 2Z1JA 2LSNA 1HYZA 4KAIA 4CFCA 4CGIA 2W8KA 3V4IA 2OZMA 2VG6A 3D0PA 2O4IA 4KB7A 4DWIA 2JEJA 3NH2A 4K4VA 4U7CA 4W5TA 1JKHB 3L2RA 5EUHA 2XY5A 4TN2A 3FQLA 4KHQA 2E6MA 2DFFA 3M8PA 1YTUA 2IM1A 3OYAA 3SQ4A 2WHOA 2HHTA 4NZ0A 2BE2B 4CJKA 3ULDA 1T05B 4IKAA 2XCPA 4KB1A 4DTJA 4FLXA 1TV6B 4IG3B 5HRPA 4OLAA 1RBRA 3V6KA 4ZVEA 3AVNA 4YQWA 2IBKA 2YKMB 3ZSRA 2FBTA 2FBVA 4DSJA 4IOBA 4NLPA 2J6TA 2ILYA 3ASMA 4CHOA 3CDEA 2XY6A 3D5MA 1NJZA 1C0TB 2W9CB 1WLJA 5DG9A 4DS5A 1KVBA 5C42B 2JLEA 1HQEB 4TY8A 3QEWA 1YVFA 5C5JA 5FDLA 1WAJA 5KFAA 1WN7A 2VG7A 3KNAA 2IA6A 4PUOB 3M8QA 3PX6A 4WZMA 1JLQA 4DF8A 3MECA 1VRTA 3MR6A 3O4NA 1RDRA 1RT7A 3BGRB 1S5JA 4I9QA 3HT3A 4KO0B 3CJ5A 2HW3A 4IRCA 3RRHA 4E89A 4LH4A 2WONB 3FQKA 1ITGA 2R8IA 5KG3A 3GV8B 3WNHA 4QWDA 3RMAA 4O4GB 3PX4A 3NE6A 1RT4B 3TANA 4CHPA 3EPGA 4Z4CA 4DLEA 4U6PA 4RG8A 3V9SA 2FBYA 2RKIB 4F4XA 1J5OA 5HLFA 3FDSA 4ZP9A 4KHWA 5HP1B 4CHNA 1FK9B 1HYSB 4J9OA 4K4WA 3LZJA 3JSMA
chains in the Genus database with same CATH superfamily
1BWFO 1M5HA 3C6AA 1L5UA 1RT5A 4B17A 3PSIA 1WKLA 4DV0K 2IDLA 2V6AA 2P1JA 3TTFA 1RBUA 4L73A 5F1XA 1SUQB 4DR7F 2XM3A 1BISA 4URQU 2MMYA 1XNQK 1TK0A 4LF5J 2QRRA 2LEAA 4LR7A 2B3TB 5IWAK 1WEYA 3HSZA 3UD4P 2HFSA 3CDAA 5KFPA 3Q2TC 4DL2A 2ZWPA 4F50A 1P90A 2OSQA 3BEGB 4ECTA 3DDIA 3BUZB 4WZQA 4JK9A 1FEEA 4H5WA 4TLRA 3T1HK 4AXIA 3MCAB 1JJ2M 3VQSA 1IR0A 3P96A 2HWHA 3BZQA 3W8PA 2W9AA 1S99A 4ILLA 5HMXA 4Y1DA 3CETA 1NHUA 3D6RA 1VFJA 4IR9A 3U9DA 1LAVA 1R0AA 1U0HA 4NZ6A 3JS9A 2UXDJ 2CZ9A 3FK4A 4DU1A 2NREA 4NLCA 5JS2A 2G2OA 1HW9A 1WAFA 1U24A 2QWQA 1N34K 4DR4J 1IKYB 3T9NA 4BS2A 2E5LK 4DPUA 1VSLA 3LP0A 4U67Q 3R6LB 1RCXB 3N79A 1RT1B 3I32A 3RTVA 3QNOA 2J5AA 4N7TA 3KOAA 4A8SA 4RUBA 1KD1O 1IWAA 4AUKA 3OYCA 2PBDA 5KFDA 1BQXA 2P5GA 1FRKA 5AQGA 3D7EO 2AJFE 4A8FA 4DR1J 3CQ8A 1VS3A 2ATCB 1G15A 3A8IA 5MLCQ 1U2VA 1GXTA 4EAHD 3HLUA 1WDTA 1SJ4P 2GUPA 1WG1A 1RTJB 1VSIA 1RUSA 4JUZA 4N5SA 2ZJRQ 5KFRA 5C25A 2X6NA 2RB7A 3DRSB 3LAKA 2MQQA 2O8EA 2H3EB 1GOCA 1YJ9S 4ID5A 4DTUA 3UNYA 3VF2A 4NEYA 5IZHA 5K14A 1WBBA 4CT8A 2FTRA 1ULRA 3VEVA 2Y0SD 2CNKB 3IRXB 2CIMA 3KLGB 4OPHA 1ZAWA 5LL6Z 2BVZA 2IJFA 1S1TB 3TZYA 1OH5A 3NVMA 3EM1A 2OPRB 2O1PA 3SJJA 3THYA 1LEOA 3PLAA 4C8KA 4CGFA 3MWBA 4HL9A 1JLCB 3IA0A 3MM6B 3CMES 3CCUN 3T1YK 1NH8A 3PR5B 5AQUA 1VRQC 2VPXB 2I7NA 4DR5J 3QFWA 4Y0FA 1W7WA 5KFLA 1ASWA 2G4BA 1VHFA 5EX3A 4B08A 4CFBA 2OEKA 4CNZA 3C8YA 2KB2A 1MG7A 3M8ZA 3JQJA 4KGKA 4KFBA 2EXUA 4TVAB 3LP3A 3LH2S 3QESA 4ANDA 1XHZA 2WVEA 2GFFA 1MU2B 1IN0A 2AP6A 2HGLA 4ISFA 2UUAK 5M1QA 1JCEA 4E8UA 3UQSA 1U0SA 1YITN 2Q0UA 1RWUA 3KMSA 2DEJA 2NSBA 2LMIA 2O67A 2R8HA 4EBDA 4KE5A 2Z1GA 4B9LA 2H4YB 2M2BA 3P83D 1OO0B 3MN7A 4WJBA 5IT4A 2UXCF 2ERRA 3FJ2A 2PI4A 4ETXA 3WUHA 4DX5A 3R1LA 3AOCA 1R59O 1R3NA 4WU2A 2ZWOA 4LQ9A 3CJKA 4RWWA 4X4VA 2D41A 2OEMA 5JLFA 3P49B 3IDHA 1V4SA 1FRIA 4CE9A 3RAMA 4DCPB 4N77A 2N3LA 3IFRA 1K0TA 4YEAA 1H2TZ 4IH6A 4DV7F 1GT8A 3PY8A 4BC7A 4A57A 3L4IA 4RNFA 2OD6A 4KH5A 1D9FA 2D1CA 2OMOA 2XCAA 1JKHA 5E3QA 2W2PP 2RD5C 1TP7A 4DV5J 2EK1A 3P5JA 4J9UE 2BE2A 5F3TA 1VQ4S 3N6NA 3SQ2A 4AQYJ 4JAXA 4WP9A 1AW0A 2AT1B 4PKHA 4E2FB 1KC8O 4C0HA 5F2RA 5BR8F 2HHHJ 1XJWB 1HI8A 4OI2A 1QVFM 3NOGA 3ENOA 3NGDA 3LF0A 2VGNA 3HPGA 5L38A 3PJ9A 1C0TA 4J9SA 4JI0J 3MR3A 1JXLA 3MCMA 3R5DA 2J8SA 3GZ7A 2ZUGA 5A8WB 1A5VA 1V6HA 2ZOMA 1IJFB 1LCUA 3BKTA 2JLFA 3I9ZA 3N4PA 3QIOA 5DQIA 2Y3YA 4A48A 3NNAA 5F41A 4LF8J 1BGXT 4F67A 1QE1B 4NYZA 3IC1A 4OX9J 3HVAA 4DR4K 3FGUA 4ID1A 2VPYB 4H0TB 2IMWP 2HF4A 3HPOA 2M4MA 2G1DA 2XRIA 4K41A 3VAHA 4PWWA 2QN6B 5C7PA 2BQ3A 2FLNA 4NCBA 3ONQA 4JEPA 4MH8A 1I5OB 2EPIA 1JLEB 1KVCA 1MN9A 4CVNE 1RFQA 3HRGA 1RTDB 3ICLA 4Z4FA 2COLA 2FVCA 4EUVA 2LXFA 2NSCA 1X0PA 3H98A 3KHYA 3ZZ0A 1QY7A 3EVWA 5KFXA 1SPBP 5IT0A 2YWEA 2OSRA 4O3PA 4WYBA 1CQMA 4QS7A 2IRXA 1XC3A 4I6MA 5ITHA 1HI0P 1S7HA 4KHPJ 3ATUA 1VQ5N 3EUNA 1OJ4A 4JI3K 1KLMA 3GE9A 4BRFA 3QMQA 2OLWA 2QLFB 4TU7A 4DUZJ 5HL7L 3G0ZA 2DGSA 5I9EB 1VQ9S 2YHBA 2WC9A 4NLSA 5AQIA 1UZDA 4RW7A 1VC5A 3V9UA 5E41A 3EXCX 1VBKA 4OHVA 3VF0B 4F3OA 4K4TA 4JI6K 2DNOA 3AO5A 2OTJN 4KYZA 1NGGA 3QYYA 4CZEA 1FJGK 2JEIA 3G86A 4DZ6A 5ELZA 3CMAN 2YCHA 5BYRA 5F8LA 2Q2RA 4KHYA 1OPIA 1BA1A 2JEGA 3DLEA 2H3GX 1U48A 3KLFA 4GKJF 3OR1B 4CK3A 4XIUA 1GOAA 4NX9A 1SQKA 1S0MA 4ZCKA 1V4TA 1RWXB 2DKOB 4F2SA 3PCOB 5HQ8A 1S0OA 3KNGA 4FNIA 4NA2A 3PW5A 2OFHX 1HR0F 3RJMB 1BLUA 5KT4A 1KONA 4WFXA 2A2CA 2DK2A 2EWHA 4HHJA 3OVNA 2A6AA 3FRZA 1RTHB 4CH0S 1RJJA 2W7AA 4YOTA 4CNYA 2J0XA 1BE4A 5B8HA 4FJ8A 2FHJD 4IDKB 3QRPA 1W26A 3CJ4A 4B3TK 1PYSB 5D15A 4LIRA 1CBKA 4O5BA 4DOZA 2O3DA 3D6TB 4MFBA 4BREA 3TX8A 4CO5A 1UA0A 4IJNA 5I42B 1PJ5A 3AJ1A 3Q89A 5CAAA 1DGKN 4GNIA 5BXIA 4GV9A 1JLAA 5KG1A 3CE8A 1JJCB 2Q79A 4C0BA 2GV1A 2NRRA 2GV9A 5E33A 4X64K 1A5WA 1DQAA 1E3MA 2RUSA 2HHUA 3QNNA 2MQNA 3F9KA 2MLYA 3SMPA 4FM2A 2X1BA 1F3VA 3M1VB 2C22A 2M3DA 5GVQA 3VZIA 3DLRA 1FDAA 2K06A 4F4AA 2ASOA 4CLZA 1VQMS 2FJEB 3PIPL 1MN7A 4DV3K 4OI6A 3GG4A 4OYZA 4NYPA 1PKUA 5IQQA 3MM7B 1U45A 1F2GA 1TR0A 2MQMA 3DOLA 1ELOA 5DLFA 1MMDA 1O6XA 4QYZK 1CJVA 3TR8A 3AODA 3W64A 4HCCA 1ATRA 3K8VA 4DUYJ 1DTTA 4AQYK 1KWMA 2C2EA 3EWGA 3S3OA 3K0SA 1HFEL 1HBMB 3UCGA 1D8ZA 5BYSA 4DTXA 2JDJA 3H7HB 2NS1B 1OSDA 4NRUA 4ZITA 2XMWA 4K8XA 4QPXA 2ZF5O 3QDKA 3KK2B 3DRRB 4ECXA 3I0SB 2NYIA 2XY7A 1C1BB 3OYDA 4RW6A 2LKZA 3MUTP 1UTAA 4JK8A 3NF7A 1G3OA 1XR6A 3BS9A 3DRYA 1CJKA 5FPDA 2HRTA 1RAJA 2Q43A 3H5SA 4KY3A 1Y11A 2DY4A 4K2XA 4OX9K 3ULHA 4NB4A 4HHTA 3VMFB 1HX1A 2CNLB 2RDIA 3SCJE 2W9BA 1PILA 3C16A 3DFEA 3PW4A 4CIEA 4ECWA 4MK8A 4P9SA 3A8EA 4M5LA 3BKUA 3I56S 3OXLA 3KJVB 2HFUA 1HUXA 2OH2A 1KHWA 4B1YB 1I39A 3QEIA 2EEYA 4EYHB 1RWVB 4JI4F 2ZFHA 4A8YA 4QZVB 2FB0A 2HBRB 3V1OA 2YNHA 3MMCA 2KW4A 3TAMB 1X1PA 4NCGB 1YVUA 3ZSOA 3M7VA 4FVMA 1GTHA 3THWB 2OA8A 4IFVA 1H3DA 3DOMA 3CI5A 1RISA 3BV8A 3CG7A 4CEOA 5BRFA 4DDFA 2ZE2B 4LSNA 1F21A 4B9NA 2Y1JA 1KQKA 1EQMA 3HZGA 2AF6A 3DLJA 3DLKA 2D69A 4Q45A 2VWBA 4J8FA 4FCYA 5B0DA 1UA1A 4CESA 3DMJA 2LDYA 1XQSC 3K8WA 2DB1A 1SQFA 3MN5A 1IBLF 2RN2A 4DR3F 4IEEA 2V9KA 1IG8A 1NK4A 1UWBB 1UVLA 2E1MC 4NE9C 4FKYA 4FWPA 1KVIA 3UVJB 2WCXA 1W97L 2M9KA 3MMBB 4QBUA 4CK2A 2FZKB 5LJVA 4YOUA 3CXCR 4NOHA 1CS4A 4X66K 2DHHA 2NCKL 2OELA 2XYHB 3CCQS 1P9YA 4YHHJ 2LXIA 5AQYA 1GLLO 3HSJA 2HEKA 3BM7A 3AHPA 4LF4J 2FDNA 1GMVA 1IBKK 5HOOA 4MIAA 4C3KA 1X7VA 2FGOA 2D74B 4J90A 3W5ZA 4BRAA 1FDNA 4OMFG 1U1QA 2OO4A 2GHPA 3MMAB 1RDWX 4R79A 3OTOJ 8RUCA 4DV4J 4ISEA 1HNIA 1U49A 2IVFB 4J9KA 4OI0A 3M2VA 3M2UB 1NGFA 2DPJA 4WE1A 2DJWA 2DNHA 2B9YA 4PG4A 4LR9A 3R9LA 1NOZA 4W5OA 5AFUA 5AQVA 3U3YA 1SC3B 1HBNB 1VAZA 3KLHA 1MDUB 2QYCA 3KJFB 3D1OA 2F4VK 2R7OA 2XSFA 2WOMA 3C19A 3PHEA 4A4JA 1IWGA 3I8BA 3RAQA 2HWIA 3W65A 3H5YA 1YJWN 3DJCA 5LSLA 4FW2A 3QETA 3KK1B 4NA1A 2IM3A 4DQQA 4YR2A 3NVKA 4CCHA 4E7KA 2KQ2A 4YOWA 1JJHA 3BBBA 4LSLA 1YBUA 2Z1HA 1RT3A 4XH5A 1SJRA 4Q0BB 1YI2N 1DQ8A 3D66A 1T3NA 3V9WA 1RAEB 5K5MA 2AJQA 5KFOA 1ZM3A 3EE9A 1RLDA 3DNCA 2QMWA 1AYEA 2A5XA 1HA1A 4IWVA 2X78A 1MSWD 4DQRA 3AVAA 1WI6A 5AXKA 2HBZB 3VF4A 1XR5A 4EHUA 4A8MP 3RBEA 4MO5A 1J53A 4OJ1A 3QGGA 3OLAA 3PVXA 1XMOF 2D7SA 1SV5B 2KT2A 3VEZA 3W61A 2GHVC 4NA3A 1EP4B 2PYJA 4DV2J 1RYRA 3IO1A 4K4YA 1HARA 5AXLA 1UL3A 4PG7A 3DI6A 1WSRA 1Q53A 4LF6J 4JLHA 4RUCA 3GG0A 4C98A 3Q8QB 4MIWA 1DTQB 4Z7CA 5JVGL 5LM7E 3AVFA 2YKNA 1SH2A 1YRUA 4DSKA 1LWEB 5E26A 1VSMA 2CJQA 1IVZA 2FJBB 4OZ0A 4PZVA 3S01A 5D4NA 4YMEA 2OI2A 4QJVA 2BH1A 4PL7A 2ZD1A 4MYTA 1ACMB 3MR2A 1NK0A 1NBWA 2JEFA 1PJ6A 2QA4N 2P9GA 4X65K 1TL1A 4X62J 2HRYA 4YN3B 2ACMA 1VSEA 2MZTA 2FC0A 3VWSA 2EVZA 2RDJA 5D3GB 3TUJC 1QSLA 2DR7A 1S6UA 4CBUA 3SQGB 4BRQA 1VQ7N 1PGZA 3BB5A 1SL1A 1BQNB 2HNYA 1N36J 2ZVSA 5B09A 3GB0A 2X74A 4ITSA 2JSXA 4NLYA 4WP8A 4HUFA 2N4DA 4TY9A 2PO4A 3DRXA 3PKMA 1DURA 2IFXA 2H48B 1N52B 4OV1A 3LWLA 3SAGA 3HOTA 3ENAA 1HD1A 2A0FB 3WZ0A 2DHGA 3QIPB 2MKKA 1SAZA 3KKRA 4HHHA 3WIVA 3U1LA 4RUHA 2CJBA 2JX2A 3QJLA 1RT2B 3ZEUA 1TFYA 4GMJB 2KM8C 2D9OA 3CJSA 2XGQA 4B3OB 3L7UA 5KFTA 1RHUB 5ETMA 2QGFB 3G6YA 2APOA 2HMIB 2ATQA 1QSSA 1R8PA 1ZH5A 2X1FA 3W9IA 5DQHA 4CLKA 2IY5B 4ZVFA 5KFEA 3PIOL 2DXDA 1Y0HA 1U02A 2ILZA 3GPAA 3CIPA 3SBGA 4YHHK 5ADXA 1FW6A 3M32B 2B4JA 4UW2A 5GMDA 3RB6A 4J9MA 3CB4A 4WU3A 2GGPA 2OMLA 3VQ8A 2YJFA 1BHNA 4ZIWA 3VGTA 2DGVA 3G8QA 2X6SA 1KRPA 3KLIB 3BSOA 5DQGA 1FD2A 1GXLA 3THVA 1TL7A 5A8KB 4BDZA 4BE0A 1YWXA 3W2VB 2P9PB 4JI7F 3N01A 3WNGA 4CZMA 1X4CA 1Z05A 2BANB 1HRHA 4H4KC 5FJ4A 4DJBA 1M1GA 5DETA 1VQYA 3ENQA 4ZA1A 1BA0A 3CD6N 3I87A 4N76A 4C8ZA 2MGZA 3U8XA 1J5EJ 3LGMA 2FVRA 1KR4A 1Q95G 1VBYA 2QKBA 3M8YA 4NXNJ 3RGIA 4ZPWR 4ZP8A 5LSOA 2CJXB 1S1TA 3HXMA 3O6QA 2BRLA 2AP1A 3LALA 3VTIA 1DY3A 3AA3A 3RZAA 3ZETA 4FLYA 3CSKA 4HCBA 3HSGA 2WK4A 4CZJA 5AT1B 3V4IB 4LRBA 2VG6B 3UI3A 4EGLA 1S48A 3IMQJ 1ZXOA 3JAMY 3L9ZA 4DEZA 5AE3A 2QLWA 1YJNN 3JAMU 4QOZB 4K4ZA 3T5LA 1VC0A 1CVJA 4RTFD 3SUOA 4WK1A 4UF4A 4P72A 5IT9U 4PY5A 3VPZA 1FXXA 4FZZA 4LBHA 2AV5A 2VBXA 3E1YA 3QFPA 4CI0B 1N5VA 3AO2A 1NGJA 1WUAA 3KDNA 3V81A 4DF4A 5F8IA 2CAJA 4M3RA 3CIZA 2KFNA 2JC1A 4OZ1A 4CJUA 3M05A 3Q24A 1Q81O 4DV2K 1JCGA 4KBOA 5KFFA 3CJ0A 4NPOA 2J0WA 1DLOA 4LFCJ 1GFWB 2IVNA 3BGLA 1JLQB 2HB5A 1VRTB 3MEDA 3G82A 1YSJA 2ZKTA 4ZVSB 1RT7B 5AR0A 4ZJQA 3V6DA 1X4GA 4ZPTR 2MLZA 1E4GT 4H54A 4E1NA 1J27A 3B82A 3P39A 1V9OA 4O3RA 2E7VA 3DLGA 4AD6A 2Q1NA 4IH5A 4CRJA 3AD9C 4JKHA 1KQGB 2V8PA 4CJRA 1T02A 3B4DA 1RGVA 5KT6A 4C8MA 2H5IB 4K8ZA 1FXRA 1YJRA 2MZSA 4I6AA 4BDYA 5M1PA 5HLFB 4U7UD 4ERDA 2NXNA 2D3OR 2F8EX 4LY7A 4OZLA 3T1AA 4PKIA 3ZZZA 3HVWA 3DRPB 2IM2A 5CD4H 1AUSL 5CYQA 1M1HA 4B3SK 4A5BA 3SI8A 4C8OA 5L39A 2WRMA 1Q1KA 3WQTA 4XAKA 3C15B 4CM0A 2YNFB 4JRQA 2UXBJ 4WFBL 5ETRA 4QCLA 1KFDA 3UCZP 1C0UA 1FXLA 2HIYA 2CPIA 2KG1A 2DNKA 3WC0A 4QWAA 5AXNA 4AHSA 4NYFA 3J7AP 4FJMA 3PO4A 3IRWP 3OYFA 5F9NA 3QGHA 4P74A 3K5NA 3KK3A 3DGPA 3B54A 4PYDA 4Q8EA 1SCJB 2WVDA 1KS2A 2N82B 3IS9A 3EEQA 5K8PA 4OPKA 4CO3A 4OHYA 4CJ7A 3Q7BA 3GR0A 1QDUB 3SMSA 2EWSA 1N56A 3M3ZA 1S9GB 3NCRA 4JKGB 4OLBA 3QGIA 4WFNL 3AVIA 3NCIA 2NXUA 5AQLA 2WB1D 1F1BB 1VR6A 4KTQA 3NKYA 2IIHA 3NLCA 3SYZA 3HJVA 4LRDA 1Q8BA 5GIPA 3AA5X 5AQRA 2VJUA 1K73T 3PW7A 5KGWA 2VFSA 2OTLN 3C6TA 2AZ1A 5KRSA 2F8SA 1Y5NB 1TL4A 3AO3A 4E7IA 4DTNA 3VGVA 1JLBA 4TU8A 2V50A 4ICLA 4ZP6A 4XH1A 2KRBA 4PQUB 2VDHA 2ASDA 2W6KA 1D0EA 3KUEA 2JGUA 2LCWA 1M5PC 1OYEA 1VCTA 4GW6A 1NRKA 4ZK7M 3O4QA 3HI9A 4HR2A 4CTAB 2DR8A 2R9LA 1SH3A 3POTA 4PG8A 2MQLA 3K9KA 3VQEA 2FJWA 1S49A 4OYPA 4IG0A 1FKPA 4NXNK 3DHWC 2B7BB 4DB3A 5HK4A 3TA2A 4H5NA 4DV6K 3KHRA 2RU9A 3DC2A 2PSZA 2PD1A 2YVSA 3K5MA 3GV5B 4ZVPB 5DMRA 4PWDB 1YGYA 4DQPA 4J2BA 4RZRA 4H5VA 3UN5A 3NP5A 4JD2A 4JV5F 1MROA 2O8BA 3MCNA 4C3MA 1A7GE 4BRGA 4C3LA 3QT6A 2HAFA 1ZPWX 2XS7A 4O3OA 3OVAA 1SI9A 1N6QB 1Z2LA 4H4KA 2BJ8A 2YY3A 1K6YA 2BACA 4DQIA 3TP2A 3ZZTA 2F4FA 5CZXA 3BN7A 4KHRA 3DXKB 2MTLA 3IR6B 1L3TA 3QO9A 3FSXA 1IKWB 5BRHA 1LWFA 1K44A 4JI8K 2MLXA 2HHXA 5FD1A 2A6MA 1VHXA 1TKZB 2XHWA 2PYLA 3KMQA 3EX7B 4PWUA 3TQ1A 2GNKA 4FF3A 1RCHA 5LMUF 2JNJA 3TAQA 3PRBA 5AQNA 1CPZA 2DFHA 1PSDA 3WQPA 3VAJA 4U7UK 1OPZA 1SS6A 3CC2N 2ZM6K 2H5JB 1NM1A 4ZVQB 1NPPA 3PZPA 1IG9A 1Q8LA 1UAXA 2YHXA 2E66A 2OKQA 5HMYA 2MZ1A 1KTQA 4ECSA 3HPHA 1S22A 4FDFA 3O9RA 3TSQA 1I6JA 2XYPB 2R42A 1C6VA 2ZH8A 4DR7J 5J2QA 4W5QA 4A5AA 5HBMA 3CNQP 3OHAA 2R7XA 1UVNA 2XZTB 5B0EA 3HK2A 3OW2M 1W9HA 4M41A 4ZCIA 5LMNF 1UW9A 3DDKA 4LVOP 4DR6F 3KJQB 2IGIA 3WEEB 2E1RA 2Z1JA 2LSNA 3QGPA 4KAIA 4JI1F 1XMBA 2J9DA 1M1KT 3MMVA 2O8DA 3M6XA 5IC6B 4DR2K 2B8QA 4U7CA 2IRYA 4QIEA 4FKXA 5DDPC 2CPJA 3EGVA 4MTPA 4BLGA 4JI5K 1YTUA 2AKWB 1YZ6A 2QSWA 3MAAA 4KB1A 3QPIA 5C2DA 4PCQA 4OLAA 1NSQA 1FWPA 4DHVA 4KH1B 4ZVEA 2UU9F 1FRJA 1GXUA 1RACB 2ZH1A 2MQ8A 2IBKA 3ZSRA 3F5TA 4DSJA 4HWIA 1OYDA 4CHOA 2MZQA 5ADXH 1S5ZA 2NRZA 1YIJS 1KVBA 5C42B 3LM2A 5C5JA 5FDLA 1JJ2R 1SC4B 3FBBA 2DO4A 2VG7A 2QL9B 5AQMA 4N8NA 4M5MA 1NLVA 3M8QA 3MECA 5M2RA 3HT3A 2LQ8A 4GKKK 2BJDA 4FOEA 2DVIA 4H0XB 3K9JA 2C1EB 2VQFF 1Q0NA 2VBZA 3ENWA 3GJRB 1E4FT 2WONB 1NSAA 2Y8YA 4K59A 2IA0A 4G1PA 4QWDA 1LOTB 2QWPA 3PX4A 3NE6A 1RT4B 3TANA 3EPGA 1P6TA 2J9DE 4U6PA 4YY3K 1ZM4A 1V3RA 2RKIB 3EVOA 2W24A 3UKRA 1EKSA 4KHWA 4CHNA 1FK9B 2HFNA 1D09B 4J9OA 3JSMA 3ET6B 3D1HA 3QLHB 2RMLA 3QZ7A 4USMA 1RNHA 1S6QB 3HI0A 3E66A 2ZHBA 3DLLL 1U1OA 1TAQA 1YLXA 1EX4A 3Q2SC 4K0KF 1RU1A 5DDOC 2QFIA 4B02A 5SUHA 1ICEB 1Y5IB 3LGHA 3NXZA 3OFHA 4OZNA 4NXMK 3IBCB 4XTTA 3IP0A 1U09A 2MB0B 4CLUA 4J37A 3UKUB 3NGSA 3OS0A 2JC0A 5A8RA 2AJ4A 1I1GA 4P52A 4KR0B 4HTJA 1OVQA 2KHOA 3M6WA 2UUWA 1S4EA 3HYFA 1V5IB 5F8JA 1Q7YT 1AXQA 3KKSA 4KBIA 2AHOB 3RU0A 1R0BG 4LR8A 1WELA 1WORA 1ZYQA 2E20A 3D6FB 2VFVA 4GVBB 4GV6A 2B4UA 5E84A 3GJSB 3AA4A 2QXFA 4FK4A 2EX3A 5H9FJ 2RQMA 4B9SA 4LF2A 5KOXA 1BDGA 3DCAA 3D3CJ 3M30A 2FD2A 1VISA 3HULA 4QYRA 1FI4A 1UFWA 3C95A 5T7BA 4ZN3A 2UXCJ 1SJQA 1NK9A 2NRVA 2CPYA 5DGAA 4FW1A 2HZCA 4HKQA 5A0YA 5M1FA 3RSEA 3AAWB 5CR4A 3GQCA 4BR4A 4I7FB 1XTZA 4BC5A 1TYQB 4D3HA 1VQON 4OVLA 5M1NA 1EX8A 1HNWF 1S72N 1NNDA 3BBCA 1ZM2A 1FKOB 4DV7J 1EXQA 4M3UA 2XMMA 4L75A 2NNWA 2HOEA 3ZO7A 4CYUA 2GMLA 4ELVA 2XZWA 3JS6A 2W2NP 2MSTA 3SJHA 2DXEA 1Q8KA 3MK6A 2D1KA 1XMQJ 3MFHA 2W2OP 3HHKA 1XHXA 2CH6A 3P45B 1TUWA 1EO1A 2JL9A 2HNZB 3CC4S 2V34A 3OS1A 2GHWA 2X51A 3ID6A 3BJYA 3BQ2A 2RRNA 5BR8J 3W3SA 3UB5A 4CLFA 3AGRA 4B3MF 2QA2A 2I9SA 4CFAA 4MT1A 4IO1A 3Q7CA 4ED7A 3M6GA 4C7QA 3QRQA 1UVJA 3HHLB 5I3UB 3LQVA 3B8AX 1HNXF 4V19J 4FS2A 3GL1A 2HRUA 3HJFA 1HHSA 2HNDB 3D1QA 3GFYA 4HVZA 4AH9A 4BROA 2WB4A 2XS2A 2CH5A 4DTRA 1HBUA 2GW8A 2BDPA 2PE8A 1WG5A 3MEGA 3CGIA 2ADBA 1QVFR 1WEXA 4LQ3A 5JMNA 2V2KA 2ZZMA 1TL3B 4KRWA 4GC6A 4O0NA 2PFFB 4DTSA 3JXUA 4RW4B 1XNRF 4I4BA 4RUAA 2O8CA 5HAOA 1NKCA 3AVKA 3SSSA 1T44A 2IBOA 4IZ9A 2P9CA 5LY3A 3IBFB 4Q2LA 4DSFA 1YUWA 1R8BA 2GAHC 4IO9Q 4TU9A 3GFHA 2JWNA 1SQEA 3D2EA 1WJ9A 1GMUA 2LA4A 4KPCA 4O44A 4BC2A 3FEZA 1QUVA 1T8EA 1XC9A 4DU4A 4I56A 1WSHA 3SQGA 2HK3A 3R7NB 2MYFA 3G71N 2NRWA 3PYDA 3KLEB 4MK9A 3G4SS 4XK8C 4DQSA 2BE7D 4ZPDA 2G0CA 4DKWA 2CPZA 2NUUG 3OL7A 4FNHA 4A46A 4Q8FA 1S6PB 1TAUA 1EETB 2O4GA 3VALA 3A12A 1DKGD 3FCWA 1D9AA 2ZQBA 5EN1A 2J4RA 5KG6A 5KOWA 2GQQA 4LF9F 5EU7A 4C6AA 3MX2A 3BR8A 1TV6A 4DBQA 4IG3A 4IFYB 3LZIA 1KAZA 2XMAA 3H2LA 1VK0A 4ZVHA 1FHTA 3FZHA 2EC2A 1C4AA 4GKJJ 3VQ6A 3TAFA 3PSFA 2W42A 2RS2A 2XLKA 5IV4A 3G96A 3RMDA 3B6BA 2X1AA 3SMZA 2IVOA 5D6GA 2W8LA 4WCEL 4FP9A 3RVCA 2ZGZA 2V4JA 4L6V3 4WTYA 4RW9B 3JTNA 2UVUA 2BX6A 3CCJN 4Z7YA 1VQ6N 5J2PB 3H08A 1WD6A 1WB9A 5C12A 5LOQA 4PUOA 4ED2A 4QS9A 4FLWA 1HNVB 3E51A 3BGRA 5HROB 2ZNYA 4KO0A 4DSLA 3OUYB 2BQRA 2LEBA 1KDNA 3V4MA 2FIUA 2JFDA 5C2CA 2CPFA 3CCWA 2OTJS 4MKYA 1FJ7A 2A3ZA 3CMAS 3SFUA 3TZZA 3O5BA 2F7VA 5HMZA 3UDCA 3LPTA 3AFGA 3VOVA 3IBWA 4FWMA 3TPQA 4B1ZA 3RB4A 4ED4A 1S4FA 3LOUA 2R4FA 3N5BA 2VPZB 5HP1A 4F0KA 4R5PB 4PKDB 1HYSA 4K2JA 2EFGA 1RT6B 4DFJA 1LW2B 2FYXA 2W2QP 2HBQB 4HH1A 1KP6A 3KD1E 2VBYA 3JXOA 3KIOA 1JLGB 3FEXB 4CLTA 1U1NA 2OEJA 3E01A 5B0BA 2PIIA 4DV0F 5KG5A 3L7OA 2VPWB 2KKZA 1URRA 1TKTB 3OYMA 3G25A 2Q3SA 2HLUA 4TQSA 3J7AN 4XO0A 1XNQF 1D4XA 5IWAF 3G2XA 2HVEA 3ATVA 1VQ8N 4OLPA 1TMJA 1XMQK 1GQEA 1HPMA 3QWUA 3SUQA 5D4OA 2QT7A 4BG8A 3DYAB 2P9SA 2FVSA 1Q82O 2A3JA 3A8YA 3FFIB 2HYIB 3T1HF 1HBOA 4ECYA 3G87A 2GWKA 5T7LB 3W60A 2C3YA 4G65A 2HBYB 2DR9A 3L2WA 3C7NB 3VESA 3KLVA 5KPTA 4RW8A 4RNMA 3I6PA 3GJQB 4U7BA 4FJNA 4IDHA 2JOQA 1N34F 3FZLA 3Q8SB 4FLVA 3LDNA 1U47A 3DOKB 2E5LF 4ZPCA 5HVFA 3RRKA 2Z2MA 2FF3B 1UPMB 4N56A 5C0YA 1EWQA 3RYLA 2GVDB 2VH7A 4P6QA 3HO1A 4AFFA 2JRSA 1MWQA 5KAKA 3I82A 1HIYA 4M5JA 5L1IA 1VRUB 1WC6A 2ZH9A 3W9HA 1S76D 4ER8A 4PXCA 2OPPB 1FTCA 2BE9B 4JI4J 3MCSA 5AQKA 2NXEA 2AIRB 2ZBRA 1G2EA 3ZNUA 2RH3A 1X3MA 3BH6B 3NDKA 3OYEA 4C8NA 3VQAA 3LDLA 3JSRA 2RRBA 2W6LA 4IO9L 3ZZOA 2IC3A 3MTJA 4DFPA 1FJCA 3TNVA 3TI0A 3P8BB 4GV3A 3LAMA 4W90B 1BWEA 3OD2A 4F4ZA 5J2MA 3R2CJ 3SCXA 1KTVA 5AE1A 5TKYA 2FF6A 1LXNA 2CG8A 2J7UA 3PRDA 4CF9A 1IBLJ 4DR3J 5IM0A 3AJDA 5B0FA 3VTHA 1C0FA 2K2PA 3H40A 1B64A 3LPYA 4CD3A 3DM2A 3R5JB 2VONA 3H1QA 1SIWB 4B3RK 3V1QA 2BBEA 4ZPVR 4DFKA 5HVGA 3AVJA 4OYOA 2GJ2A 3T1YF 1Z25A 4CJ3A 2GX8A 3C65A 3O3FA 3GIRA 2IAJA 4LRFA 2HZVA 1QHAA 2LP4A 3RBDA 3A2FA 2YHYA 1C1CA 4EYIB 5J1EB 1N33K 4ZCLA 3H4DA 4OI1A 2AJ1A 3F9MA 3CJ7A 2KTQA 5GINA 1RWMB 2UUAF 5IFMA 1S1VB 3OR2B 1PCAA 3OTEA 1BC6A 3FBFA 1Q4RA 1NMDA 2ZH6A 2XNRA 2J9EA 1EJ7L 4RX6A 2YNIA 3ZSQA 5GAHI 3M6UA 3LDPA 3RB3A 3I8DA 1SH0A 2W40A 2LA6A 3ZZUA 1RDBA 4MAKA 2HVIA 3FLCO 3ALYA 3MDQA 4ID8A 1RZMA 3NBPB 2K7KA 5A76A 1D3WA 4NLOA 2GELA 1RA7A 4YDUC 3ZSWA 4LF7K 2XTJP 2DGWA 4YS2A 1GMWA 2A1SA 1Q5YA 5M2UA 3AA2A 4WXOA 4LRCA 4M94A 4AHTA 5ETQA 3OV7A 4H4OA 5LL6d 1N32K 4ES2A 1OH6A 4FN5A 4QW8A 3AV9A 2VUGA 3NMRA 4CEBA 1QAYA 3UD3P 2QWMA 1T03B 2MKIA 8ATCB 4JKBA 2QWRA 3VCDA 3L7PA 1CC7A 2ZC4A 4G6VB 3M2RA 3VQDA 2B5JB 4LREA 3N6LA 3IWLA 4FJ7A 1S1UB 7FD1A 3TVZA 1ZTWA 1S1WB 2RS8A 1QLNA 1DEJA 4NLRA 1QTMA 1T7PA 1WSFA 1XMOJ 2VOOA 4KH0B 3CFOA 2CQ4A 2J9CA 2W4CA 5KFGA 2E8AA 1YJWS 2NRTA 3W2WA 3TA1A 2DO0A 2R8GA 1ZTTA 3P4UB 3MM8B 2YPZA 3W0LA 4HUGA 5J2NB 3BO2A 4CO1A 2DRBA 3H42A 2E1ZA 4RR5A 4NZ7A 3EDRB 3NL0A 1NSPA 4DR4F 3VEOA 1R0CB 3H45C 4ZPBA 2KXHA 4XPCA 5GAHP 4NI2B 4J2EA 3TZWA 2PI5A 3V9ZA 5KRTA 1YBAA 1M90T 1CEZA 2E9RX 4HACB 2FLOA 1NGDA 4P71A 3J80U 1GLCG 1X9SA 4OYAA 2BW7A 2QFJA 3L2UA 3TO8A 3QEPA 5HSPA 3F2KA 2RF2B 4ED1A 3V6JA 1TKDA 4ECRA 2NUHA 3AA9A 5MLCV 2G9OA 4WQ5C 1RWOB 1M0SA 1QVGM 1CULA 2MKYA 1FX2A 1T3OA 4USTA 2H9ZA 4WF9L 3LTOA 4RWTA 4OL8A 5KFVA 1QQOA 1LWCA 4FWNA 4JKEA 5H1SQ 4JI3F 3FZBA 2P9UB 3HVTB 1RILA 5HQMA 2VQEJ 4HT5A 2V4QA 5KFNA 2DR5A 3DLHA 4K4UA 4B9QA 2AW0A 2BJEA 5KT7A 4U96A 2U2FA 1ZAXA 3D6HB 4NO7A 2XLIA 4ZLLA 2XSJB 4JKDA 3GCWP 4TYBA 2HHSA 4OV6A 3I0RB 4JI6F 3U27A 3CJ3A 3ZC4A 2QA4S 2BEFA 1FJGF 3KFWX 4ED6A 5DRKA 1EZZB 3CTRA 3K58A 1IKVB 2DTJA 9RUBA 1AZSB 4CJ5A 2GEMA 2OPSA 3AO4A 1CJUB 2QK9A 1GLFO 4RNHA 1VOMA 1PIEA 1R6VA 1QZ5A 2UV8A 1ZETA 2DHAA 3BF1A 1VQ7S 1CLQA 1ZBUA 5KFMA 1N5QA 4ZHRB 2IM0A 3A3PB 4EZ9A 4HDGA 1WHXA 2H4WB 2X7IA 3DLBA 3TABA 2Q0RA 3G6ES 4DS4A 1UJ4A 4OX6A 4ANEA 4ED5A 3E9PA 2BM0A 4RLEA 4QU6A 3VA3A 3H1VX 1CC8A 4LBPA 2LDIA 4RO0A 1B7FA 3OBYA 4OPJA 4JI7J 2OPQB 3T5HA 1VC6A 2C3UA 2E2QA 3P4IA 2F63A 3QBXA 5AZJB 3MUVP 1JXEA 4B3TF 4CP5A 2PC6A 2Q6CA 5GIOA 4JN4A 2YNGA 3FKBA 2H54B 3FRYA 3PFOA 3A4TA 1BQMA 5I4MA 1HWKA 2BUPA 4ECZA 1VSDA 3OSPA 1WC1A 3TEGA 1S6OA 4DPOA 1F6TA 3ITHA 3VA0A 2ZOGA 3GWCA 3ILJA 4X64F 1HMVB 1A9NB 4LFAK 3MZIA 1SKWA 3T7ZA 2NRXA 2X3DA 3ZZYA 4PQAA 1UW4A 5F0UA 3AVBA 2L9DA 3H0PA 3S7RA 1BMQB 2I7PA 4ZVTB 4FYVB 1X4BA 2O66A 4ZJOA 3GCXP 1GTEA 1REVB 4DV3F 1VSFA 4BCAA 2P9KA 1KVJA 2V69A 3CCVN 2PA8D 2NXCA 4PHTX 3WT0A 1VQNN 4CEDA 4FXVA 5M2PA 4DV1K 2NPIA 2Q3PA 3BSCA 1G6BA 4K8RA 4AQYF 4MIBA 1MA9B 1WKJA 1CSJA 1HWLA 3CD6S 4F26A 1TTHB 3CO9A 5JS1A 1P27B 4M95A 1T6DA 1VSKA 1UETA 3TAEA 4KKOB 5DGBA 4YDUA 4YB7A 2RUGA 4ILMA 1U1LA 1IKXB 2F9JA 3DU5A 3HTVA 2BA9A 4ZOSA 2DCUB 2E5IA 1ASVA 4FJKA 1K47A 2IDEA 3X1LB 5HJYA 4K5RA 1M5SA 3ILLA 3T19A 4FPIA 3P6YC 1S9EB 1ZOTA 3CJ1A 3HHDA 2OIHA 5T14A 3NMAA 2YHWA 3PFEA 4OX9F 2I5JB 2VFRA 1VQ9N 2UUBK 2DNZA 3T5JA 4R8UB 1H73A 1YJNS 4BRNA 2KRRA 4CO2A 3PYFA 4M3XA 4I2PA 1LW0A 2UUCF 3EE8A 2QEXN 3IXQA 1TKXB 3L3CA 1JL2A 4Y34A 4YFUA 3R3LA 9ATCB 4UOGA 1AFJA 4ZJLA 4O3NA 3LP2A 3ZFVA 3D67A 1IJEB 2EFPA 2JWKA 3P5BP 2O5DA 3NEKA 3CJCA 3GDQA 3ELHA 3OA9A 1BIUA 1TVRB 2QMXA 2EBEA 2P5VA 2GTDA 2VG5A 1OVYA 1LNQA 3I4PA 2YBVA 1GNKA 4DX6A 1AB8A 4A8XA 1ZZFA 4HTUA 1Z2ZA 3OYKA 2VQEK 4USIA 4M8LA 3KZBA 4TLQA 3MCPA 4WIQA 3I4HX 2QLJB 3FUYA 1JNZB 1RBTA 4FWRA 2ZWHA 4OZ5A 1U04A 4O0JA 1I3OB 4J9PA 3LO3A 3OSNA 1H7XA 1OSCA 3M8PB 2KT3A 4YB1P 5KT3A 3UN2A 2CVIA 4GVMA 4KQZA 1NAQA 3E9OA 3NGIA 4X66F 4Z94A 1HWIA 1OS5A 3PM9A 2PFDA 2AX0A 5BYQA 3JTOA 4IQMA 4F7VA 4M5DA 1VQPS 1VQKS 1K8KA 4WQ5A 4F25A 4I2QA 1NDLA 1IBKF 3UWTA 4F0HA 3TR5A 4LH5A 3I33A 1X60A 5HI7A 1HPZA 4V1Ak 1RK8A 2YWFA 2WTFA 2D9PA 4OYXA 1RI7A 3UCUP 1R89A 2HIQA 3QINA 1B3TA 3KWGA 3AB4B 4KV8A 4BR9A 5KPRA 1OY6A 1YG0A 1VQMN 2N3OA 4CERA 3EN9A 4WFAQ 3C6UA 1RAOA 4N41A 3TW0A 2B4OA 4MDBA 2POKA 3H4BA 3P3DA 4BC9A 3FZFA 1Z4UA 3CDBA 2F4VF 1FE4A 4QIGA 2IVYA 3CC7N 1DRZA 2ASLA 1RBVA 3O9TA 4M5IA 2ITGA 4DLGA 2ASMA 4FSVA 1T9XA 3IR5B 1J5OB 3N4QA 3PX0A 1JIHA 2DYAA 1RTIA 5DM6L 4FXWA 2DGTA 4DL4A 1ZZNA 2I38A 2VDIA 4ZDNA 3G10A 3N0VA 2FGCA 1RT5B 4C11A 2EW9A 3CWJA 2DEIA 1G7CB 3LPUA 1AFIA 1KD1T 3QIDA 1GAOA 5AQHA 3ZTSA 3T6JA 1A5XA 5HL7Q 4WWSA 2PEBA 3EO3A 1FWLA 4JV5J 3WXMB 1RWWB 3K2YA 2ZJQL 3W3DA 3WIUA 2OTLS 2KXFA 3BREA 2V67A 4UUWA 3CFPA 3ZX2A 1Q86O 3BYPA 4FK2A 4M7YA 1HNZK 2HF3A 4O4RA 4ENOA 1BO5O 2CGKA 3SQOP 3PV8A 5FLXY 4X84A 1N5SA 3NS5A 5IOLA 2CYYA 1WC0A 1X4EA 3ZT4A 5FLXU 4Y1CA 2HLTA 2GAGC 1QM9A 4MMOA 4EU0A 1R0AB 1U0HB 3MM5A 2L3MA 1SJFA 4IFEA 3CF5L 2DGQA 3NAHA 3NY0A 5HRSA 1W7AA 4OYWA 3Q8PB 4JB8B 1KAYA 5LMUJ 3MEEA 2W41A 1KSPA 2GC8A 3FZKA 3TAGA 3LP0B 2BJ1A 2V9WA 1S77D 1NGHA 1PAEX 4DXLA 5LSRA 2JWLA 3OXGA 3R7SB 5CH7B 3VGMA 4PPDA 3VQ9A 4JYAJ 2F1FA 1BI4A 3KDOA 2DPNA 1KQSM 2A6OA 4LMZA 1F5CA 2O8FA 3ISND 2D0AA 3LM9A 2C3MA 4X65F 3AO1A 5HO4A 5D0HA 4EFHA 4DL7A 3VQ4A 5ETPA 4JI2K 2Z2LA 1U2VB 1GMWD 3CQYA 1GX5A 4J2AA 3BZKA 4CJPA 2EKNA 2R2SA 5GAEI 4CGHA 1WKKA 2HVHA 5KQ8A 4BACA 3DDNA 5LMNJ 2LQ5A 3CCQN 4ZTFA 4OHXA 3CPWM 5EOYA 4QIFA 4WPAA 5E3AA 5F0XA 2QWLA 4M3ZA 4JI1J 1RSCA 2FUG9 5AJ3J 5C25B 2Z56B 2JHEA 2O8EB 1Q5VA 1K8AO 4AILC 1X5OA 4ID5B 5HATA 4DPTA 4AL5A 4AM6A 3DXBA 4AL6A 5K14B 4X2BA 1O1WA 4P7TA 3CJRA 3PIPQ 4OZJA 3CFRA 3O8WA 4USUA 3IFEA 3HBTA 3OW2R 3LUYA 3CC2S 4LF5K 1B0TA 3THYB 2UU9J 3KWMA 3SCKE 1YVNA 1PO6A 3SDEA 5GADU 4CH7A 4PXEA 1QQNA 3CCEN 4IOAQ 4Y00A 5AQTA 2KZZA 4GRSA 3OYNA 1BXNA 4FBTA 2JZ5A 4ZVUB 1HQUA 5G0RA 1GOBA 4LSZB 3J81Y 6AT1B 3H8YA 1KOHA 4YHHF 3C14A 1W2BM 2VF3A 3J81U 1EB0A 3VQCA 2BKOA 1RBAA 4KFBB 2MKSA 2UXDK 1XK8A 3C66A 2XBPA 2VQFJ 3IG1A 1AROP 1R8AA 4HTLA 2M88A 2LLZA 3ILOA 3HM8A 3ULEA 4Q5VA 4HDHA 3W1YC 3CM5A 1FRMA 5EWFA 1KC8T 1F9EB 4IOXA 1U26A 3WXIA 4DG1A 2OHDA 3LP1A 3CERA 4WFAL 3A1YG 5CY4A 2DNLA 1OH7A 2P9LA 4NL5A 3VHQA 1OY9A 2P9NA 2Z4PA 3SSQA 3VV2B 5HQLA 5GAEP 4WKYA 4J7CA 4DR1K 3NS7B 3M9NB 2BUNA 3ZTQA 4FBUA 3B8HA 1NHKL 3NCQA 4NMLA 3QSIA 3CJKB 4NLXA 5KG7A 3IMXA 3WX4A 5ETTA 3PW2A 3OLBA 4JHDA 5C24A 4OZ2A 4UUXA 3F0NA 4Y2AA 1RWPB 2MKHA 3PRVA 1HYZA 5CXTA 4CFCA 2BM1A 2K1RA 3D0PA 1X4FA 1Q16B 3P38A 3UE5A 3TQEA 4K4VA 1NM2A 1JKHB 2W01A 5AE2A 3L2RA 2XY5A 4C8YA 3FQLA 2PN6A 2E6MA 1KNZA 3BY5A 2BE2B 3GR1A 2U1AA 4HLBA 1U2CA 2DITA 4ILRA 1IBMJ 5HRPA 4X4RA 1FDDA 1NBEB 1U8SA 3E8OA 2D0PA 3ASMA 2ILYA 3QAEA 3DXMA 2ZGYA 3D5MA 1C0TB 1WLJA 4PXBA 1JNRB 4BGAA 4QOTA 3CCMS 2OUGA 3K89A 4TY8A 5GAHU 4UOCA 1YVFA 3BO3A 1WAJA 4DR5K 2QJ3A 4DV2F 3KNAA 2E44A 2IRUA 2IA6A 1RP5A 4RU2A 4JKCA 3MR6A 3O4NA 1WF2A 1H2UX 2P6SA 4DN0A 1S5JA 3MWTA 1UVIA 3CJ5A 2HW3A 3CCLS 1OWXA 4OJHA 1CLFA 2DNGA 3MM9A 4ZCMA 3RRHA 3EKSA 2YKPA 2QX0A 4E89A 5HANA 3RUBL 4CH1A 3FQKA 1NGAA 4MKVA 2HGMA 3B78A 4O23A 2J8AA 1CJTA 4AE5A 4CHPA 1HNWJ 2G13A 4Z4CA 3MN6A 4JYAK 1RAGB 4OPAA 4CBXA 3V9SA 2FBYA 2AMCB 4QR0A 3FDSA 4ZP9A 5CCMA 4W98A 2QWNA 2EBGA 3BGOP 2GMJA 3PTWA 1RLCL 3ILIA 4OKKA 3CUNA 3KG4A 1FT8A 2BJ3A 3CJ2A 2RQKA 3BDEA 1RBOB 4I6MB 4RL1A 5GMKa 2WUSA 2HQGA 3NGRA 3TAPA 4B3SF 7AT1B 5AJ3K 1B70B 1KLMB 3BO4A 2XGPA 4H4MA 2IYIA 4B3MJ 4A8OA 4AT1B 1D8YA 1PC4A 5AQWA 3K7RA 1HNXJ 2NUBA 4RW7B 4IRKA 3ZT0A 4ATNA 4DV5K 1VQOS 2F8HA 2DD8S 5EXWA 2FQQB 2GVZA 3JYTA 1VK3A 1S72S 3VEXA 3VGUA 3OT9A 1A0OB 1MWMA 2PT0A 3DLEB 2HHHK 4IOAL 4CEFA 2E9TA 3QNWB 3KLFB 5LXYA 4JI0K 1XNRJ 2IOCA 1R6YA 1WACA 2R7WA 2BV3A 2D0BA 2BJ9A 3P31A 3VN5A 5JVGQ 3UFCX 1IM6A 2HVDA 4RBTA 3FZMA 4LVNP 3O1LA 2XI2A 1IBCB 2XI3A 1YJ7A 3AXMA 1RABB 5ETKA 2A40A 4LF8K 4G1IA 5D77A 5KTQA 1Q9XA 2B4VA 4JV1A 4NLVA 3KG0A 3EZWA 3GIMA 1N5YA 1VDHA 4UZCA 3U7JA 1YF5L 3ZT3A 1Y5LB 2VFTA 4KTWA 4XEIA 2AZ3A 3C46A 1N8RO 2DY9A 2WZ1A 3SQ0A 5FIIA 4MK7A 1RDDA 2GQ2A 3FGVA 2AEJA 4MFBB 4I9LA 4CIGA 3H59A 4NYNA 3DGVA 1JLAB 2M8HA 3MPUB 3CCZA 4NXNF 4NCAA 1VBXA 3HVRA 5K8MA 2QLBB 3J7ZO 1S1XA 1BG3A 4DV6F 4LF9J 3GIIA 5F3ZA 1NJIO 4KHPK 4G3IA 3X3UA 2CQCA 4FJGA 2NYHA 1XWLA 1N8RT 4BC3A 1VK8A 2OP5A 3HFZB 1NB7A 1OH8A 2HS0A 4FF4A 4XH4A 1L3VA 4J2DA 4O55A 4DUZK 2M70A 1FTRA 2CGLA 5B0AA 3DOLB 2P9IA 3AVLA 3O44A 1CJVB 1YTYA 4FXDA 2RHQB 5C10A 3G71S 1DTTB 3A0IX 4PKGA 1IBMK 1Q79A 1JLFA 4NLUA 2C2DA 4DSIA 4NLQA 2HSEB 4PR6A 4K43A 4L76A 4OYIA 1QQCA 3PIOQ 1WF0A 5DM7L 2BOAA 2E1AA 5DZ6A 3BQ0A 2CPDA 3RBXA 1P8ZA 1JXBA 3MPDA 3KHHA 4JI8F 5AZIA 4Q7AA 2JLGA 2HVZA 4IJAA 1NDKA 3R1HA 4RW6B 2YHAA 2VYPA 3IN5A 3MOZA 3D2FA 3VAKA 1CJKB 1T95A 2NZTA 4CLYA 3FZ2A 4ZIVA 1E6VA 3FCVA 2DFEA 4JK7A 5K20B 3FCHA 1D1UA 3NMUA 2ZM6F 5CYMA 2RQ4A 2W9BB 3C16B 4QIVA 1D5AA 4O8UA 1QHTA 4DL3A 2QW9A 1TZ0A 3CCSN 2ZITA 3VVUA 1E6YA 1S79A 3V2UC 4DV0J 4BDPA 1ZC6A 5AQQA 3R6GB 1N88A 1BL3A 5JVHL 4OYMA 3BYRA 2KKHA 2E2PA 3CCJS 2DCLA 4PL8A 2YNHB 1VQ6S 1RAHB 3MMCB 1EHWA 4G1QA 5H9EJ 2C2RA 2M0GB 5IWAJ 5HRRA 3VR1A 4YDDB 2WAQD 4MLHA 1NU0A 4IFVB 3DOMB 1I94F 3VAMA 3L2VA 2NQPA 1NJYA 2VWKA 4N47A 2DISA 4LSNB 1SL0A 4DR2F 1SKRA 1LOUA 5FROA 3DLKB 3MX5A 2GS8A 3T1HJ 3HX9A 3HP6A 5FPEA 3DMJB 4JI5F 2YQ3A 1T05A 2J76E 4AHVA 5C15A 2CPEA 3BGFA 4QWEA 3US5A 2YKMA 4YP3A 2XQCA 2HAIA 1TFWA 2V8DA 3LDOA 4KIAA 1N34J 4UQGA 2Q31A 2W9CA 3OQ2A 2E5LJ 1PAUB 2JJ4D 1HQEA 2CVEA 4LFBJ 5L1LA 2QI2A 4DUYK 5EWGA 2CQHA 2RVJA 2IVPA 4DL5A 3FSIA 3FE1A 1S9EA 2V8VA 3NAEA 1CS4B 2KZMA 3WXLA 2W4PA 4Y2MA 3K5LA 3ZNJ1 3RMBA 1T9YA 3OYGA 1RE1B 1FEHA 3H6EA 2OJ3A 1IV0A 3AVCA 4IYQA 3THXA 3AD8C 1XI1A 4OJ3A 5SZTA 1X31C 4IOCL 3H90A 6FD1A 4GKKF 4ZP7A 2P5OA 1RKIA 1C2PA 4Q43A 5KFQA 4J9VA 4M1KA 1WSVA 3TARA 4FYDA 2FHJA 3GFZA 1N4LA 4F4WA 4O4GA 3JSBA 2HFOA 1HNIB 1EKRA 4FWSA 5ETNA 4BHQA 2C2MB 3PJWA 2YV0X 3W66A 1GLJO 5AQXA 3M2VB 4I69A 3F73A 4WE1B 2CDRB 3NFAA 3G6VA 4YY3F 3VAFA 1R31A 2MZRA 4XDCA 1APSA 1TUGB 4RJVA 3NS6A 2IHR1 2NPFA 2R7SA 4KSEB 3KLHB 4C1NK 4QAGA 2CQ0A 5CCLA 4BR2A 3D0IE 2WOMB 4FJIA 4JKFA 1EQ0A 1SUQA 3RMCA 1UVKA 3PEHA 3VERA 4CJVA 4BWJA 2AJ0A 1TUYA 4WQ4C 4UY8O 3EZOA 4HTIA 4BGBA 3D3BJ 4LSLB 5D0GA 4PG5A 1RT3B 3D45A 4WFBQ 3T1YJ 3ZZPA 2QG9B 3OXFA 4NXMF 2PMWA 5KFBA 2BXJA 3CPEA 3CDUA 2ZDPA 3GP9A 4GO7X 1GEHA 2ABYA 2BQUA 4EO8A 1J9AA 2M52A 2A1RA 2G8WA 2ZJPL 1P8GA 1NK6A 4R25A 4ZTJA 3TRGA 4BG9A 3JAMO 4K25A 1ZBFA 2UUAJ 5A6WA 1IKYA 3O3HA 2JH3A 3RWUA 1CXUA 2HQFA 5IT9O 4I0WA 1RT1A 1DAXA 2CQPA 2KH9A 2D3ZA 4WFNQ 4FL9A 1MLAA 3CD7A 2DY1A 3DI6B 2G8KA 3OTBA 4LF4K 2QC3A 1NZAA 2KDOA 2RHSB 3S41A 5KG2A 2YKNB 3OBWA 3EKUA 1ZBSA 1YK9A 4I67A 4DTOA 4DCJB 5EHHA 4DTPA 4CJLA 3G8TA 3H5XA 3MR5A 3OTOK 3MXIA 1YKWA 4DV4K 3LDSA 2ZD1B 4A59A 3NG8A 1IO2A 2CADA 2P2CB 1RTJA 3U1NA 4BQLA 3TJ9A 3AAQA 2ROEA 2G8HA 2PZSA 1YAGA 4ES1A 3SBTA 2PA3A 1UVMA 4LF1A 1TL1B 3DRSA 4V19X 2MKJA 3Q83A 3ZTRA 4TYAA 2DNPA 5KI6A 1RB0A 3SNNA 3O9SA 1YIJN 4Y2KA 2F3JA 3PHTA 1SIZA 1JJ4A 1ZBTA 3B6OA 1YHQS 3IRXA 3KLGA 1JL1A 2ROPA 2YI1A 2XMKA 5H9EK 4G9ZA 3QMLA 4W5NA 4CF8A 4X4SA 2OPRA 2HNYB 3AT1B 3TJ8A 1FA0A 1RKJA 5HRNA 1J54A 2V0NA 4CQ1A 1H38A 3OTDA 4CZGA 5LJ3Y 2HMPA 1JLCA 3MM6A 3EZUA 4H03B 3MR7A 4WTOB 4BR0A 1NB2A 2YWHA 1NJXA 2OFGX 3MXMA 3T5KA 4F02A 1UOCA 3ZEUB 4ZKAA 1RQ0A 1HLWA 3R6MA 2D4WA 2B7CB 2DGOA 4ES3A 2KFYA 1NPRA 4YOXA 1MU2A 3WC2A 3TX0A 4OGEA 4LFBK 3O6WA 3D6MB 1LWXA 4CD1A 4U8VA 2F8MA 4YDXA 1FDBA 4CJSA 4C48A 1VLOA 2ZOFA 3ENBA 2UZAA 1WSGA 3MD3A 2BABA 1BD6A 1QZ6A 1VJQA 2VIHA 4MYUA 4M5HA 2GGPB 1M5VC 1NNEA 2VHGA 1N54B 4LF6K 5LT5A 5A2QY 5GAEU 4BRCA 5A2QU 2VV5A 1TL7B 2V94A 4CZCA 1FO1A 1TL5A 2XHCA 2HG4A 1FWKA 2HQDA 2LECA 3PW0A 4PG6A 4JI3J 3L0QA 1RTZA 4TNOA 3R97A 1NLKL 3O2IA 5CA5A 2MGZB 1YXQA 1RDUA 1Q81T 2ZH5A 4X62K 2MZJA 4TKTA 1A6LA 3GFXA 3CO0P 3MUMP 1T9TA 2QZ8A 2Q36A 4YOEA 3OL9A 3BSNA 4UZBA 3EGNA 1V5VA 4BRIA 3R8YA 1QVGR 4JI6J 3HMJG 1U1PA 3E3XA 4GC7A 1FJGJ 2ZH3A 2QWOA 3VEWA 4L74A 1N36K 3C0BA 1YBTA 1U1RA 1BCOA 3ZETB 3ZSYA 1VSHA 2KJVA 1ZA1B 2AQ4A 2C2ZB 1MW7A 3AQPA 3EE3A 4HH0A 4FZVA 1WSIA 5A8WA 2BGGA 3N9UC 4AL7A 1F9HA 3GIKA 3JTPA 4UQTA 1S0VA 3D0GE 3K0JA 2B9XA 4DL0C 5T41A 1QE1A 3V81B 4RBUA 2V7ZA 1RXOB 4CLWA 2FJAB 2MY8A 4KJIA 1DARA 3TTDA 5CE3A 5U47A 5DLGA 3L6QA 2B8PA 4WQ4A 4B3TJ 3W9JA 4KGXB 3CC4N 1Y7PA 4BWMA 3O9UA 2BW2A 4USHA 1DLOB 2NZ4A 5AFUH 1JLEA 4E1MA 1NGCA 1N0UA 3EZ5A 1H6KX 3MEDB 3G82B 2XB2D 3L3UA 3CDWA 2ZBCA 1RTDA 3LANA 3OYBA 3V6DB 5DG8A 2E4LA 4KI6A 2C28A 3CJQA 4X64J 3HKZD 3DLGB 3JQKA 4YORA 4GO5X 2WSFC 4ED8A 3AA8A 3VQ7A 4EBEA 3OY9A 2Y9HA 2B6AB 1DZ5A 4M45A 1J2VA 2IMOA 4YB6A 1K1QA 3NGZA 3OTCA 4DV3J 5AQZA 3DLLQ 1J5EK 1NH7A 4KRFA 5EY4A 4EBCA 4WK3A 3G6XA 2E1CA 2V2ZA 1JCFA 4QYZJ 1RAIB 3NRBA 1XMQF 2QLXA 5CYQB 3JQMA 3CULA 3L4QA 3T3FA 4LJMA 4A2BA 2DH8A 2LEPA 4J9NA 1JX4A 4C8LA 3IGVA 4BRPA 4HUEA 4DU3A 2BYCA 2DR6A 2AGPA 1C0UB 4L3NA 3GIJA 4MLEA 1U1MA 3IAM9 3OR1A 1FXDA 3I5AA 4X4QA 5IQ6A 1K9MO 1Q8IA 2L41A 3KK3B 3DGPB 2IPOB 3G4SN 2Y8WA 4P2FA 2OD4A 3NH1A 3IS9B 3L3VA 3BGUA 4H0YB 1TQLA 4CF1A 1FVSA 4ALZA 4J9QA 1FJEB 5DS7A 4ECVA 4KGMA 2D3O1 1RTHA 2IDOA 3T9ZA 2HHWA 3CCVS 4U67L 3W62A 5CZ1A 1VQNS 2QXLA 2VC1A 2YPYA 3OHRA 3AXKA<