1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
2W9CA 3PX6A 1SUQA 2UVRA 3OSPA 3BSNA 4K4XA 2FVRA 3VQCA 3DLHA 4CERA 1QE1B 2D7SA 5I3UB 1S1WA 3ZSRA 4RW8B 1VSMA 1B9FA 3AVCA 4RW9B 2I5JB 3NGZA 4C8KA 4EP5A 1VRUA 4ZPAA 1QHTA 1BI4A 2GUIA 1KHWA 3LP3A 3F73A 2KFZA 1WAJA 2HHSA 5DMRA 4Z4FA 4TXSA 5DLFA 2R8KA 3T5JA 2GC8A 1VSEA 5DG8A 5CYQB 3G0ZA 3GQCA 1L3UA 3RRHA 3C6TA 4NLQA 1RTHB 1I6JA 1EP4A 4DFJA 1D8YA 4NLSA 3GIKA 1S9GA 2IJFA 1D0EA 4DLEA 2VA3A 2AQ4A 4JV2A 4JS4A 4NYZA 3PO4A 4HKQA 5DG9A 4O4GB 1FK9B 3MFIA 1LW0B 1N6QA 1SV5A 4DQIA 1NK7A 4FVMA 3K5MA 1JLFB 4QAGA 2W8KA 4EZ9A 5T7BA 4B9LA 2YHBA 3MXMA 5CZ1A 3TWHA 3HO1A 3SV3A 4DTJA 2E9TA 3NF9A 3VQPA 4RW6B 3MEDA 4R5PB 3G10A 5KFZA 4ZVEA 4Q8EA 5KT5A 2W9CB 2X6SA 3PW5A 4DFPA 1KVCA 3EYZA 4RW7A 3PW4A 4O3RA 2G8KA 1RBUA 3KKRA 5DQIA 1RA7A 4OLAA 5L1IA 4LH5A 4TY8B 4TY8A 1TV6A 2O5DA 3VN5A 3RRGA 4ELUA 3K5LA 3DRRB 2E9ZA 3TANA 4ICLA 5DGBA 2YNFA 1JXEA 2UVUA 2Z1IA 3O3GA 1S6PB 1CXUA 2IC3B 1T03A 3K2PA 2NUBA 2BQ3A 1WNSA 4N41A 4O4RA 3G6XA 3DOKA 3L3VA 4FZXC 1IM4A 1TL1A 3QYYA 4J2AA 3NHGA 1RT4A 5KFWA 3KHHA 2UVWA 4GC6A 4RUAA 1RT3A 4W5QA 4B9UA 1N56A 2QXFA 3U6FA 2V4RA 2VG5B 4RW6A 3DLEA 1ZBLA 3LP0A 4ID5A 5EWEA 1NJZA 5C25A 1DLOA 1RT7A 3K59A 1Q9YA 1EP4B 3CJ0A 3MR5A 4M3WA 4KHSA 5SWMA 5F9NA 4FJ9A 3CM5A 3DLGA 5EUHA 1RT2B 3HJFA 4W5RA 4FK2A 4R0EA 3V9ZA 3LP2B 4RW4B 1NKBA 5F9LA 1DTTB 3C94A 3SFGA 3RMAA 3OL6A 1D9FA 3SPYA 1VSKA 3OYKA 4RW8A 3TAQA 4WFXA 2C2DA 3QIPB 3NGDA 3HVWA 2KZMA 2BANB 4RNFA 1TL1B 4WXOA 3ZT1A 3MFHA 1RDAA 4HCBA 4IRCA 4E89A 5F8IA 2KW4A 2RDIA 2ZQBA 3ULDA 1C1AA 4KKOB 4URGA 2O4IA 4OGCA 5K14B 5KT7A 3MAQA 4J9SA 3MR6A 5I42A 4CHOA 1QUVA 4AHRA 2BGGA 5KFDA 2F96A 2GV9A 4DSIA 3T1AA 1RNHA 1LWCA 3MR3A 4RU9A 3NGYA 4CIEA 4BDZA 3HYFA 5KFTA 3V81B 5E41A 4CK1A 3TI0A 2AX1A 1WNEA 4NCGA 4QW8A 1HARA 4MK9A 1I39A 4IG3A 3KNAA 5HLFB 1NHUA 4NLPA 3K58A 2XCPA 1KVBA 4QCLA 1RA6A 2W8LA 4QWDA 4ZVFA 5JS2A 1A5XA 1JLAA 3BSAA 1REVA 1C1CA 1IKXA 5KFHA 3KKSA 2FVQA 1NK9A 2JEFA 4NLOA 1XI1A 1WSEA 2OPPB 1L3VA 2RKIA 1VSIA 3NH0A 2G8IA 4MIBA 3IN5A 2RPIA 3AO3A 1TKDA 4FBTA 1JXBA 2ILZA 1BCMA 3M9MB 4M3YA 3C6TB 4OKKA 2F8TA 4K4YA 1JLCA 3P5JA 1QSSA 1HNVB 3OLAA 2FBVA 4CJVA 2YKNA 3QLHB 1K6YA 4F4YA 5D3GB 4G1QB 3V1RA 2C28A 1UWBA 4ED3A 3TABA 1JKHA 1BI4B 3RAQA 3AVJA 1TVRB 4I9LA 4FLTA 2QK9A 1CLQA 5C25B 3VA3A 2RF2A 4CJPA 4FJJA 3PW0A 4EEYA 4LQ3A 3QIOA 3I5AA 2OA8A 4CJ4A 1FKOB 4Q0BB 4CFBA 3QEXA 4DSJA 3I0SB 4Q45A 1HYZA 4XIUA 3IS9A 2ZE2B 1NJWA 3SCXA 5KGXA 1Z25A 4H4MA 1T3NA 3QERA 3CJ3A 2XI2A 3S3MA 4OLBA 1KLMB 3AVIA 2XWYA 4E7KA 1TKZB 3HHKA 4WZMA 4E19A 1RCHA 2D41A 3L2WA 2E6MA 2EHGA 4B9MA 4PY5A 3H4DA 2VG7B 1C1BA 4KHWA 3OL8A 4CJQA 5DLGA 3BDPA 5KFIA 1QSLA 1HQUB 3ZSWA 3SZ2A 4DF4A 3QEIA 2OPQB 1B92A 4FW1A 4RNMA 3V9SA 4AHTA 3LPUA 1F21A 4CJUA 4BDPA 3UDLA 1SKRA 3OYHA 1OS5A 3M9NB 4BE0A 4Z4GA 1Y97A 1QS4A 1X9MA 5KFMA 1KLNA 3GV8B 5KG0A 2EX3A 1JLGA 1FKOA 3TQ1A 2ZD1A 2OZSA 4Q8FA 3PY8A 3HM9A 2HNDB 1DTQB 3QO9A 4EO6A 4JRPA 2RF2B 5J2NA 3PO5A 1RT6B 3L2UA 4O3SA 4QWCA 4LSLB 5HROB 3PW2A 1CZ9A 1RAJA 4ED2A 1HQUA 3KTQA 4FJHA 4MKAA 4AHSA 1J54A 1JLFA 3AVGA 4CFDA 1EX4A 4KAZA 2UVVA 4WYLA 4ECXA 4ZP9A 3QEPA 1LWFA 1XWLA 1T94A 1BQNB 4RNOA 4CFCA 1SH3A 1S1UB 3ZSQA 5EWGA 3H5YA 1WSFA 4CHQA 4FJXA 4O55A 4ZPCA 3Q8PB 2WONA 1YT3A 4LSNA 4E1MA 2W9BB 3UPFA 3KK3B 4IG0B 3IGVA 3SUPA 3HP6A 2Q3SA 4NZ0A 2RN2A 4QWBA 1U47A 2IDOA 1WLJA 1TKTB 1JLAB 4E0DA 4Z4HA 1KHVA 3V9UA 1QQCA 4QOZB 5KFSA 2YNGA 1ZTWA 3PW7A 3CDEA 4E7JA 2D5RA 1SL0A 3QLHA 4K8ZA 2AJQA 4EBDA 1MU2B 1Z4UA 1QE1A 1JL1A 1HMVA 3ASMA 4CF1A 3NH2A 1U4BA 4DSLA 1NKEA 3VQ4A 3OS0A 4J2DA 1Q8IA 3KLHA 3MR2A 1VSHA 1NKCA 3AVNA 4CGJA 1NJXA 1UA1A 3KIOA 1RT5A 4N56A 4Y2CA 1EETA 4R8UA 4K8XA 1S0OA 1C0MA 2R8GA 4CECA 4DU3A 5KFLA 3JSMA 3M8QA 3D5MA 1C1CB 5KFBA 1G15A 4NLDA 3OL7A 2XRIA 4F4WA 1J5OA 2D0BA 4OJRA 2G8WA 4DWIA 4KFBA 3IS9B 4CEZA 1TKTA 1TKXA 2RDJA 4E1NA 3DLRA 3OYDA 3ALYA 4M42A 3SUNA 4CGHA 1N5YA 4M3RA 5FDLA 4AH9A 3SPZA 3KK1A 3PUFA 4DTSA 3NAEA 3AVLA 4CHZA 5J1EA 2JEGA 3I0RA 3UQSA 4NCGB 1IKWB 4IKFA 3UIQA 3F9KA 4DTRA 5F8HA 5J2QA 3NKYA 2B6AA 4AHCA 2HNYA 4DS5A 4QWAA 5D3GA 4KTWA 4F50A 5F8GA 1CXQA 4I7FA 3OHBA 5HBMA 2FVCA 3BREA 3V6HA 4B9VA 3K5OA 3HXMA 2YNHA 1UOCA 1C0TB 4Y2AA 1TGOA 2WONB 1NOYA 4KKOA 1K1SA 4DSEA 2AGOA 1IG9A 4X2BA 1C0UA 1JXLA 1S9EB 1HYSB 3C6UA 4I2PA 4RG8A 4EBCA 4CEAA 5HP1B 1T05A 2B4JA 2P5OA 3CDWA 5C42B 2OPSA 4YFUA 4GW6A 4IH5A 5L1JA 3CJ2A 2D3ZA 1IKYB 3HPOA 3TAMB 1RYRA 3QNOA 4C8MA 2WOMA 3FQLA 4LD0A 4FJMA 4KO0A 3BJYA 2KFNA 2KTQA 3OL9A 2PYLA 3DRPA 4RW4A 1RILA 2OPRA 2OPQA 4LSLA 5HROA 2W7OA 1EKEA 4TSXA 4IR9A 4FJKA 2I1RA 3OVNA 4DMNA 4IH7A 4ZP7A 4WZQA 1SKWA 5KG3A 2O4GA 4M94A 1RT7B 3N6NA 3NF8A 2FJVA 4O5BA 5KFAA 3H5SA 4DTMA 3E51A 3HVAA 3CM6A 4FLXA 4EYIB 2Z1GA 1YTUA 3KLEA 1GX5A 4CGGA 4RUCA 4MIAA 2QKKA 3CJ5A 3VA0A 3M8PA 2HVIA 4I2QA 4GMJB 4DSFA 3NDKA 2G8VA 3HK2A 1TQLA 3KHRA 4J9KA 4CJFA 4G3IA 1U04A 5L1LA 4FLYA 1RTIA 4CK2A 1UA0A 1S6PA 3CIZA 4NLUA 3OLBA 1D9DA 3CVKA 2BRLA 2JC0A 4ZP6A 3MECA 1XR6A 4O3NA 4ECVA 4LY7A 3H98A 4K4ZA 2E9RX 4ZTFA 4YR3A 3RB4A 3AVMA 1DTTA 4I9QA 2HHWA 4FM0A 3PJWA 1FKPA 4DQRA 1D5AA 1NK5A 3DLBA 4CJWA 5CYQA 4PQUA 5KFQA 4CESA 1L5UA 3ZT4A 4O0IA 3RAXA 4YR0A 3ZSXA 2OPRB 4CEFA 1QTMA 3MTKA 4Y34A 3N6MA 4DTUA 4ED7A 2VG5A 3SUQA 1N48A 3DOLB 3MEGA 2R2RA 5J2PA 4J9NA 2EC0A 1RT3B 1EXQA 3JYTB 4CGFA 4B9SA 1S10A 4I7FB 1YVFA 2JLEA 4W5OA 3QGGA 1N6QB 4LQ9A 3LWMA 2ILYA 1SUQB 3ISND 2P5GA 2IS3A 1JLEA 2GIQA 1JLBB 4KB1A 1C0UB 3KLIB 4O3OA 4KHRA 1WSHA 3VQEA 2YV0X 3V81A 2IC3A 4KAIA 5KG7A 4BACA 3DLKA 1S1TA 3VQ7A 1RBTA 1VSDA 3V6JA 3BSOA 3BGRB 1U48A 1WSGA 1XR5A 3NL0A 1NK8A 3FFIB 4CF8A 4E7IA 2R2UA 4OKEA 3QIDA 4KHUA 3K57A 2XGQA 2FBTA 5JS1A 3KD5E 1TV6B 1RTIB 4CF0A 1S9FA 3TR8A 4MK8A 4TYAA 3FDSA 4Z4CA 3I0RB 3IG1A 4H4OB 4B8CA 5L1KA 3THVA 4NCBA 4Q44A 2WTFA 3HPGA 3WNGA 4R5PA 4MQ3A 5KTQA 3HT3A 4NLVA 2IBKA 4WFZA 3A2FA 4KB0A 4JRQA 3SI8A 1W9HA 2IM1A 4KFBB 3QIPA 1J9AA 5CYMA 5C24A 1S6QA 3BR9A 4HTUA 4TQRA 3RR7A 4DTXA 4WE1B 3M8QB 3ICLA 2WCXA 4AHVA 3MEEB 4K4SA 5J2MA 3V9XA 2FJWA 1N4LA 5KFRA 3RMDA 4DFMA 1BQMA 3QZ8A 1RDDA 5KFCA 2B43A 3P83D 4FXDA 1R0AB 4LH4A 4Y1DA 2FVPA 2D0CA 2HNZB 1KFDA 2OYQA 4KO0B 5KT6A 4M95A 3QESA 1HMVB 1MU2A 2QKBA 3AO5A 3AA5X 4KI6A 4XPCA 1U45A 4ZMMA 3UR0A 3EPGA 2C2EA 5T14A 3EZUA 3V6KA 3VQDA 3VQSA 2HAIA 3OYAA 4ZTJA 4B9TA 3DOKB 4F2RA 4NLRA 2LSNA 4CF2A 2CKWA 5C5JA 2ATLA 4CJKA 3LDSA 3WNEA 4ZHRB 3MF5A 1S5JA 1JLQA 1RDBA 4IFVB 4DF8A 3D0PA 1Q9XA 1RT4B 3AVHA 3KLEB 3IGNA 4DQSA 2BE2B 4CHNA 3DRSB 5SZTA 3CG7A 2FVSA 5EDWA 3H59A 4JS5A 4K4UA 4F4KA 4CEOA 1IKVA 4KE5A 3LWLA 1RBRA 3KJVB 2HHTA 5HRNA 3OY9A 2R7YA 3DRRA 2PY5A 4ECZA 3DRPB 5J2NB 1HRHA 4M3UA 4URSA 2DFEA 3NAHA 3KK2A 2KQ2A 1RTDA 4OVLA 4YR2A 3TVKA 4DL4A 4DU1A 3LAKA 3TAEA 4FLUA 1JLGB 4CFAA 3LZJA 1Z26A 4GC7A 3OSNA 3QINA 3DYAA 3T5KA 1S49A 4IDKA 1CZBA 2PYJA 4EYHB 1TAUA 1GOBA 1HNIB 2BQRA 3ITHA 5F8JA 4Q43A 2VA2A 1EETB 4R8UB 2DY4A 3I8DA 3O4NA 3M9OB 1S9EA 3NFAA 4OPKA 4FM1A 3KMSA 1S1XB 3DI6B 4IKAA 5DQHA 2DPIA 5HBMB 1ZBFA 2JGUA 4FZZA 1L3SA 1JL2A 3HVRA 1TVRA 2FLNA 4O4GA 1CSJA 2YNGB 2XY7A 3DMJB 2HHUA 2ZE2A 1VRTA 1W25A 3OJUA 2E6LA 4RW9A 3I0SA 1XHXA 2YKNB 3B6PA 2A1SA 1S9GB 4Z0UA 1S97A 3B6OA 4TQSA 2YHAA 3HP9A 1RTHA 2IAJB 2YKMA 1KTQA 4OPJA 1T05B 3KK3A 1JIHA 1T8EA 4RNHA 4F8RA 1R0AA 1ZETA 4O44B 3L2VA 2Y1JA 1TKXB 1IO2A 5FRMA 1LW2A 4TYBA 4FK0A 3U3YA 4E3SA 2D0AA 3CO9A 2G8UA 4CF9A 5KFPA 2YNHB 3L2QA 1JX4A 5J2MB 3HSTB 3AVBA 3QEVA 4WE1A 4J2EA 4ECYA 3JSMB 3QZ7A 2VWKA 4MFBB 4KB7A 4KHQA 4ZVGA 2E4LA 3BSCA 1S1XA 3DI6A 5C24B 1TAQA 5KG5A 5J2QB 2F8SA 4FK4A 4BWMA 3AVFA 2HHQA 4FJIA 2C2RA 3KLHB 4CHPA 4B3OA 5HLFA 1QAJA 2V4QA 2A1RA 2IA6A 1N5YB 4J9OA 3N6LA 3CYMA 3O3FA 4J9LA 2AGPA 4KI4A 4F2SA 1REVB 3Q8RB 1BCOA 1BL3A 2IM2A 2R8JA 3T19A 4MH8A 4YQWA 3I5BA 4B9NA 4XPEA 4EZ6A 4AILC 3ZSZA 3PHEA 3ZT2A 3LALA 4IFVA 4PA1A 2ALZA 1S48A 4ZHRA 4ED0A 1XR7A 3RR8A 4FLVA 4HUEA 4FM2A 4U7CA 4EO8A 3T5HA 3T5LA 3DM2B 2ASJA 4FBUA 4WFYA 2ETJA 3PJXA 1HQEA 3ZT0A 5EU7A 2AU0A 4NLYA 1ZYQA 1C2PA 2QE5A 3HPHA 4FZYA 5DGAA 4CEDA 4L8RB 5DQGA 3QETA 1IH7A 1TL3B 3ISNC 4PWDA 3JYTA 4DQPA 4ECRA 3NBPB 3K5NA 2W42A 1BIZA 1NOZA 2J6SA 1WAFA 1WSIA 3OYJA 3LP2A 3C95A 2HWHA 1KFSA 3E01A 3E01B 4DS4A 4CJEA 5HRSA 1RDRA 4KRFA 4QWEA 2XCAA 1JKHB 2PZSA 1B9DA 2IAJA 3DDKA 4FJ5A 3FRZA 4KTZA 2BANA 4G1QA 3RTVA 1U49A 1FKPB 2W9BA 4M3ZA 3M8SA 3SV4A 4O3QA 1JLCB 1S4FA 4IFYB 4NLXA 3GV7B 2XHBA 3SNNA 1BQNA 1HNIA 2HNZA 1LWFB 3RBDA 5KG4A 4FS1A 2G8FA 5EWFA 2R2SA 3QGHA 4DLGA 2HMIA 4Y3CA 2FBXA 1RBSA 2RKIB 4JUZA 4FJNA 3PVXA 2FBYA 3KK2B 5L9XA 2J6UA 4ECTA 4HYKA 3SQ0A 4B08A 4EP4A 1RDCA 3GYNA 3KJVA 5FRNA 4GVMA 1FXXA 4F4ZA 2WHOA 1DTQA 3QO9B 4B8AB 1SL1A 4DEZA 5KFNA 2YNFB 4KHYA 3V9WA 3CFRA 3V1OA 4FJLA 2X6NA 3IRXA 2YNIA 2WRMA 2CJQA 3V4IB 1S1TB 2AWZA 1ITGA 3KHLA 4IG3B 1GX6A 3HL8A 1RT1B 4AHUA 4TN2A 1D1UA 4M41A 4CGIA 1T03B 1I3AA 4CJRA 1JLQB 2HB5A 4CK3A 5KFOA 1LWCB 4CEBA 3MEDB 3LAMA 3GV5B 1O1WA 2IGIA 4MFBA 1HNVA 4NYFA 3RBEA 2J6TA 1L3TA 5KG6A 4DL2A 2ASDA 3LANA 1WSJA 4HHTA 4OL8A 4FW2A 4J2BA 1VSJA 4ED1A 2BR0A 4UQGA 3KD1E 2P1JA 4DL5A 1KRPA 2VG6A 3BQ2A 2G8HA 4O3PA 1VSFA 2WK4A 4W5NA 3EPIA 1A5WA 1JLEB 1HPZA 5KFKA 4IBNA 1ASVA 3D45A 2XC9A 2R2TA 4J9RA 4TLRA 2IM3A 5KFYA 2DFHA 4DU4A 4HVJA 3CWJA 4CJTA 1QSYA 1LW0A 4FLWA 1X1PA 4PQUB 1RBVA 2IMWP 4ZPDA 3OYNA 4FJ7A 4F3OA 4IH6A 5J1EB 5F8NA 4OKJA 3KK1B 2JC1A 2BQUA 1ZBUA 3H5XA 4ID1A 1NK0A 4QW9A 4RZRA 3FSIA 3MEEA 2AGQA 3AVKA 4F3TA 3NE6A 3CQ8A 2AX0A 2IOCA 4Y1CA 2P51A 1RTDB 3SI6A 5I3UA 4ECQA 3EY1A 3TARA 4N76A 1RTJB 3BGRA 3M8PB 2IJNA 2FLPA 4KSEB 3KLGA 1S0NA 3LP1B 1UAXA 3HVTB 1TP7A 2HHXA 4KV8A 3GILA 1XC9A 3SQ2A 4IFYA 3GIJA 3TAMA 4JV0A 3PR4A 5KGWA 3AA2A 4IR1A 3VQAA 2ATQA 5KFFA 3NMAA 1LWEA 3DLGB 2F8EX 3DLKB 5KFEA 3DOLA 5J2PB 1S1VA 4ELTA 3V1QA 1DLOB 5KFJA 3RB0A 3OYIA 1C0TA 1JLBA 1WN7A 2XY8A 5KT4A 4H54A 1HPZB 4YP3A 4PUOA 4DFKA 4YNQA 3NF6A 4BWJA 1GOCA 4RNNA 3QEWA 2WB4A 3HKWA 1S1UA 1S0MA 5C42A 4BE2A 5HP1A 2XO7A 3RWUA 3TAGA 1NJYA 3MEGB 2HNYB 3C6UB 4FJGA 1LV5A 3LPTA 4NLTA 3AVAA 5KG2A 4CJLA 4J9QA 4DTNA 3CFPA 3GIIA 4CJ5A 3KLGB 1RT2A 3I5CA 3MXJA 1LWEB 3OYLA 5KG1A 3L2RA 3EZ5A 4KHMA 1TK5A 1RT1A 4NRTA 1NNDA 3LP0B 4CGDA 1TK8A 4I2QB 2B6AB 1VRUB 4K4WA 2YNIB 3MECB 2JEIA 1S6QB 4DG1B 3HVTA 4RW7B 3TAPA 3KOAA 4IQXA 3BQ1A 2HVHA 4ECUA 3H40A 1NHVA 4H8KA 4ELVA 5KFXA 1HQEB 3WNHA 3IG1B 4MK7A 1ASUA 2ZKUA 3SQ1A 1LAVA 1BISA 4KPYA 2HMIB 4CE9A 1BGXT 3NF7A 2HWIA 1TKZA 3BQ0A 4WYWA 3FFIA 4CJSA 1VSLA 1SV5B 3OS1A 4M45A 4O0JA 4DL3A 3OYEA 2WOMB 3KLFB 2GBZA 3SFUA 3OYFA 4C8LA 4Q0BA 4Q5VA 4ED8A 3KLIA 4NLWA 5KT3A 4DTOA 3QNNA 3CJ4A 4FLZA 2OPSB 1ZTTA 2YKMB 3KHGA 4CCHA 3AO4A 4CHYA 4I2PB 4N5SA 3VQ9A 1HYSA 2W7PA 2VG6B 2Z1JA 4NYNA 3AV9A 2Y1IA 3ZT3A 3DMJA 3PZPA 2FC0A 3NH1A 4M3XA 3VQQA 4ECWA 1LAWA 2R8IA 4MKBA 2ASLA 3NGIA 3TAFA 3V6DA 5FROA 4K50A 1IKYA 4J9MA 3ZSVA 1S1WB 1GOAA 1VK0A 4IRDA 4CJ3A 4J9PA 1X9WA 1XHZA 1KSPA 4IG0A 1FK9A 2W9AA 3MXIA 4ZPBA 3ZSOA 3GIMA 3H2LA 4KBIA 4QPXA 4C8OA 5KI6A 4O44A 3AO1A 4N47A 3VQ5A 1IKWA 3SQ4A 1BHLA 4FYDA 3ITHB 3T3FA 2OPPA 4IRKA 1U09A 5DG7A 3U3GA 3CDUA 3OYMA 2OH2A 3G6YA 5F8LA 4Z4IA 2QV6A 2V9WA 4URQU 1ZBHA 3KLFA 1SH0A 4F4XA 1TK0A 3V6DB 3L8BA 2B5JA 3LZIA 2BRKA 4HUFA 1YTAA 4DQQA 2I5JA 1ASWA 3PR5B 3OYCA 3G6VA 1NK4A 5KRSA 2VWJA 1IKVB 4BE1A 4DL7A 5FDLB 4OGEA 3AA4A 2ZD1B 1HYVA 3V4IA 3S3OA 4NRUA 3KLVA 3IRXB 5KRTA 2XY6A 1RYSA 3OJSA 4YMEA 4FS2A 4CEQA 2IM0A 1NK6A 3S9HA 3RB6A 1ZBIA 5KT2A 4IDKB 3CFOA 3NCIA 5CY4A 2FLLA 3H4BA 3DYAB 5I42B 4DG1A 3Q8QB 4NLGA 2XGPA 3OHAA 4E7LA 2VG7A 3RB3A 5K14A 2D3UA 2Z1HA 2BDPA 1YVUA 3SUOA 3ZCMA 1SH2A 3Q8SB 3FQKA 1KLMA 1SL2A 3PX0A 4H4MB 4JV1A 4ECSA 2B5JB 2OZMA 4ZP8A 4Z4EA 4EBEA 1KVAA 4FJ8A 3O3HA 4LSNB 3IAYA 1T7PA 4PWDB 2JEJA 1SKSA 2V0NA 2DFFA 1QAIA 1VRTB 4DL6A 4FCYA 4C8NA 4CIFA 3M8RA 2UUTA 3WNFA 5KFUA 4TY9A 2BE2A 3OS2A 2KZZA 3D28A 3QGIA 4BDYA 4KTQA 1BQMB 3AO2A 3DM2A 2HHVA 2GIRA 5JUMA 1A5VA 2HW3A 1UWBB 1J53A 4KREA 1X9SA 3PX4A 3NBPA 2X78A 4WXWA 4DTPA 5JXSA 3L3UA 1TL3A 4ID5B 2XY5A 3RMBA 3DLEB 1RT6A 1BIUA 4DSKA 2UUWA 4HUGA 4W5TA 4CIGA 4IOBA 4K4TA 5DK5A 4U6PA 3KMQA 2DTUA 4PUOB 5KFGA 2X74A 3NAIA 3P1GA 2DPJA 4H4OA 1K1QA 2C22A 5CZ2A 3SJJA 4KV8B 3G86A 1HJRA 3H5UA 2XI3A 3VQ8A 4K4VA 3LP1A 1IKXB 5F8MA 1S1VB 5KFVA 4E7HA 1W0HA 1J5OB 2HNDA 4NCAA 1C1BB 4XO0A 2FJXA 3O4QA 4M3TA 3ZSYA 4CEEA 3OYBA 1RTJA 4ICLB 3VQ6A 5HRRA 4HCCA 1C6VA 3H08A 4KHNA 3OYGA 2ITGA 4JLHA 4ZVHA 3SYZA 1KCFA 2R8HA 3VQBA 5HRPA 1MMLA 3DRSA 4B3OB 3AA3A 1RT5B 3S3NA 5CYMB 3PV8A 1LW2B 3RMCA 4ED6A
chains in the Genus database with same CATH superfamily
4WFBL 5GAHP 3BSNA 4K4XA 3MOJB 3VQCA 1PGZA 3DLHA 2I5JB 1PBUA 4NXNF 4WFBQ 4EP5A 3QMQA 4ZPAA 1QHTA 2GUIA 4NA2A 2FGOA 5DMRA 1BHNA 3T5JA 3TQEA 1QM9A 5M2RA 5AQRA 5CYQB 1MG7A 1SZ2A 4ANDA 5LOQA 1RTHB 3T9ZA 3HRGA 1HL6A 3GIKA 3H0PA 2FLOA 2KM8B 1K9MO 4M7YA 4G1PA 5THWA 4BRIA 2HQIA 4YB5A 1X0PA 3C65A 5HMWA 4FZVA 3MZIA 1FD8A 1JLFB 1SJFA 1UTAA 3MMAB 3SV3A 4CI0B 3CC7N 1VQMN 1NSPA 1JMTA 3DXKA 3N5BA 4NXNJ 3CJSA 4JI2F 1BMQB 4PKIA 2G8KA 4I68A 5M1KA 3AXKA 1RA7A 2W4DA 3GSDA 5AE1A 3MMJA 3DRRB 2YCHA 3JAMY 5H9FJ 2H9ZA 2CJBA 2UVUA 3M2UA 2KG1A 5I9EB 5HATA 4DUZK 4X65J 4CZKA 2EFPA 3JS9A 1CXUA 3VF6A 1K47A 2IC3B 2MSTA 1T03A 5HAOA 2NUBA 4JN4A 1NSQA 3R5DA 4O4RA 3HHEA 4USMA 5BXIA 1TL1A 3QYYA 4FP9A 2OTLS 2VPXB 1AXQA 3NHGA 1RT4A 4EHUA 2FUG9 5I3QA 4DR4K 4JHDA 3UKUB 1QAYA 3VEWA 2UVWA 4RUAA 1X3MA 1N56A 1FDBA 4FWLA 2QLXA 3DLEA 1NH7A 3NS6A 3DKDA 1DLOA 1Q9YA 9ATCB 2QA4S 2PO4A 1FRIA 1FNOA 3MR5A 4KHSA 3J7AP 1RHRB 1RLCL 3ADAC 3HFZB 3CM5A 4C1NI 5EUHA 1RT2B 3HJFA 1ZXOA 1AROP 1BWVA 3LP2B 4BR0A 4RW4B 4CTAB 1NKBA 4F3MA 1EQYA 2HZCA 2VQFJ 1FI4A 3IBFB 5LM7E 3SPYA 2XWXA 1KVJA 3OW2R 2QWQA 2KZMA 3A8IA 3MMBA 2NRZA 1TL1B 3WC2A 3CJAA 3CEDA 3R6MA 3ZT1A 3MFHA 4HCBA 1GK8A 2ZBIA 2KW4A 3Q22A 4WF9Q 3CCUN 4C3MA 4UOHA 1CJKA 1JNZB 4URGA 3EXCX 3HZ6A 3MHYA 1X4DA 2W6KA 3OTOJ 4JYAJ 1V4TA 1S7IA 1VQ9S 4AHRA 5KFDA 2F96A 4X4PA 5T7LA 5ELZA 3A5LC 1YJNN 1P8GA 4G9ZA 2P9GA 1T6DA 4LRDA 2DBBA 2MYFA 4DPTA 4RL1A 1RU2A 1GLEG 3DJCA 4EK2A 1H2TZ 1YITN 3OFGA 4NCGA 5IV4A 3D1HA 2NPFA 4DCJB 1NHUA 4NLPA 5KAKA 2XCPA 1KVBA 1Q95G 5FLXU 3WBZA 2W8LA 1RBLA 2W7AA 1ZBSA 3A3OB 3MR7A 4DR5J 2OFHX 3BSAA 3KKSA 3BPSP 2QYCA 1XI1A 2RKIA 4BC2A 4MIBA 4JI3J 3IUCA 2CVIA 4CW7B 4LF4K 1NMDA 4M5GA 3I4PA 3W9IA 4YDUA 3BEXA 4M3YA 3BO4A 5BN9A 3VGKA 3R9PA 5F3ZA 2BKOA 2QEXS 1QSSA 2B9YA 2FBVA 3BKTA 4PG8A 1K6YA 1KP6A 4CP5A 3TABA 3MGJA 1H7XA 1C4CA 5JMVA 1JK9B 5HO4A 2DGOA 1CLQA 3VA3A 1B4SA 4O5FA 4LQ3A 3QJLA 3QIOA 4CJ4A 4Q0BB 2JLGA 3UKUA 4RU2A 5SUHA 1RWNB 4Y2MA 2FIUA 2VBXA 4XEIA 2ZE2B 1FJEB 2F4FA 5KGXA 2H4YB 4HDHA 2H4WB 2A1BA 2GMJA 3CJ3A 3S3MA 1UFWA 3AVIA 1BUXA 4RTFD 1R6VA 1OIAA 5FD1A 3HHKA 1U2VB 3L2WA 2CPYA 4PY5A 5IWAK 1R7IA 2LQBA 2GHPA 1QSLA 1HQUB 3SZ2A 1FRXA 4FW1A 3KFWX 4DV2J 4BE0A 1IG8A 1X9MA 1HWLA 1LK5A 2EX3A 4OPHA 3MMCB 2ZH5A 4JI0J 3TQ1A 2W2NP 4DUYF 2HNDB 2I8EA 1DTQB 3W0LA 3CPWM 4O3SA 1RHMB 3TP2A 2CH6A 3PW2A 1RAJA 3DXBA 3CCVN 4RX6A 2HFSA 4FJHA 2Z56B 2YX6A 4DR2K 2UUAK 1HX1A 4AHSA 1U2VA 2ZGZA 2M70A 2AHOB 1JLFA 3VEYA 1EWQA 2CQPA 4OHWA 1F9HA 5H9EJ 4ECXA 3TVZA 4DR6F 3MAAA 3UN3A 4FF2A 4Q7AA 4CFCA 4CO5A 1S1UB 3LF0A 3J7YU 3H5YA 4LFCF 1WSFA 4X66J 5FPMA 4E1MA 2RRBA 3V4MA 1RSCA 1B7YB 3IGVA 3ZX2A 3SUPA 4WIQA 2Q3SA 2RN2A 4QWBA 2DK2A 4JKBA 4ZJQA 1TKTB 4OYZA 2OEMA 4Z4HA 5KFSA 3F56A 2YNGA 5LMUK 4E7JA 4K8ZA 4EBDA 1Z4UA 4OYPA 3PYEA 1QE1A 4QOTA 1KBRA 1FW6A 4K5RA 3FZLA 1FRKA 1M1HA 2M88A 1U1QA 3EWGA 5HJXA 3AD7C 1UA1A 3SBTA 3KIOA 1RT5A 4N56A 1FVQA 5LMNK 4K8XA 2VIHA 1WSVA 3JTOA 1N33F 3PDNA 5CD4H 1NJIT 5K8OA 1C0MA 3I33A 3JAMO 2R8GA 3Q24A 4CECA 1I94F 3JSMA 1QLNA 3CD7A 4K2XA 4TU8A 1P27B 1GEHA 3SMPA 2HFUA 4BR2A 4F4WA 2HFZA 3IS9B 4CZMA 3D6TB 1X5OA 2IA0A 4L76A 1XNRK 4E1NA 3ID6A 3JXUA 3ALYA 1XNQK 3AOBA 3H46O 4M3RA 1TR0A 4DTSA 3NAEA 4IOAQ 3AVLA 2JEGA 2V51B 3P45B 4NCGB 1IKWB 1PYOB 2A2CA 1FERA 2EFNA 3UIQA 2VB6A 5J2QA 4AHCA 1BWEA 3C16A 4OYIA 4BREA 2HNYA 4F50A 5T7LB 1X7VA 3G87A 3P96A 3PRDA 3OHBA 2FVCA 4DV6F 3K5OA 2YNHA 2O3DA 2UV8G 1UOCA 1K1SA 5DM6L 4DSEA 1XERA 1YVNA 4HWIA 4I2PA 2I6WA 3KVGA 1PCAA 2ZJRL 2GFFA 3DGVA 1T05A 4ILRA 3U9ZA 5C42B 4YFUA 3AB4B 2HHHJ 2PT0A 5BREA 4CZCA 2UXBJ 2UU9F 4GKJF 4LFAK 2CPIA 3TAMB 2ZVSA 3FQLA 4LD0A 4FJMA 4KRWA 2KFNA 3MUMP 5TKWA 5KPZA 3OL9A 3FRYA 1RILA 2BVZA 2OPRA 1TL4A 3QAEA 4DMNA 5A0YA 5CCMA 4IH7A 4ZP7A 2XQCA 1SKWA 3I55N 2MMYA 4CBXA 3FMBA 4A48A 3EM1A 3W62A 2MKCA 3H5SA 4DTMA 2EFVA 4DB3A 1S72N 2ZH2A 2B9WA 1UMJA 2Z1GA 5C0YA 2LLZA 3KLEA 1GX5A 3CC4N 2KO1A 3OVAA 4RUCA 2QKKA 3VA0A 1U0SA 3M8PA 4DSFA 2CZVC 2HQGA 2FJDB 1YRXA 1XNQF 1R0CB 3JSBA 3HK2A 1IR0A 2YWHA 4J9KA 4CJFA 4G3IA 2G0JA 1TUVA 2DD8S 3FSYA 3L09A 1S0VA 1S6PA 1YKWA 2RU9A 3BN4A 2PIIA 1EAYC 2RUGA 4OI1A 1NZAA 3FFKB 4ZP6A 2JC0A 3MECA 1XR6A 4ECVA 4LY7A 3H98A 4ZTFA 2KT2A 4YR3A 3DLLQ 5D0EA 5B0BA 3UI3A 1FKPA 3HSGA 1NK5A 3DLBA 2QI2A 2RQ4A 5LXYA 5KFQA 1R8AA 1L5UA 2GJ2A 3RG6A 1UFKA 5JVHL 3NNCA 1WUAA 5EX0A 3RAXA 4YDUC 4ED7A 2VGMA 2VG5A 3FUYA 3FC9A 1RCOB 2R2RA 3MEGA 4FWQA 1RT3B 1EXQA 4GKJK 4KT0C 4CGFA 4KGZB 2LDIA 4Y6IA 3P4IA 4W5OA 1HNXF 1V4SA 4JP8A 3D3CJ 1RHKB 3DXMA 2ILYA 5A2QU 2IY5B 2P5GA 5BRFA 1W97L 1JB0C 2GIQA 3FCVA 1C0UB 2BKNA 5D4LA 1ZM3A 3FR0A 3DLKA 4AF1A 1RBTA 3LDPA 2HPUA 2AKWB 1HWKA 3VCDA 4Y0WA 1WSGA 4E7IA 3CCEN 3VF4A 4CLSA 4OKEA 4QIFA 2C3MA 3ENHA 5JS1A 2GVZB 4LRBA 4NXMK 2DKOB 4CO2A 2E5LJ 2MQPA 2V67A 4J91A 4L74A 4FXWA 3IG1A 4H4OB 2HYIB 2H5JB 3UDVA 4USKA 4NCBA 2WTFA 3MM6A 5KTQA 2QWPA 3HT3A 4P2SA 1KN6A 2IBKA 4I4BA 1V5IB 5CYMA 1J9AA 5C24A 4HTUA 1EWRA 3UNYA 4O8UA 4WE1B 1VDHA 4CTAA 5K8NA 5J2MA 1NSAA 4K4SA 3PSFA 1O6XA 1NRKA 2Q6BA 2POKA 3DLLL 3RMDA 4PG5A 1SXLA 2CNNB 1RDDA 2PGCA 1HHSA 5KFCA 4C9DA 4FXDA 2BBEA 2R7RA 4LH4A 3NGUA 4C4WA 5IFMA 2OYQA 1U1RA 1UZDA 5ADXA 2VICA 3QESA 2CXEA 3F2KA 1FEEA 3OV7A 3D7SB 2C2EA 4ZKAA 2VC1A 4DR3J 3SBGA 3IP0A 5A8RA 4CF2A 2CKWA 3M30B 5C5JA 2G4BA 2ATLA 3I56S 1HBNA 2P9PA 1PJ7A 2FHOB 4A62A 3LDSA 1MWMA 4BVPA 1S5JA 3ETMA 5HN0A 3D0PA 1FEHA 1JCFA 1XN9A 1Q7LB 1WI6A 5GVQA 1K8KB 4DHVA 4CHNA 4C2MA 3A5OC 4DQ8A 1F0XA 3SSSA 1S72S 4F9OA 2KM8C 2DHSA 3MM8B 2CQ2A 5A8WB 4JS5A 3C6HA 5IT0A 1LNQA 1IBKJ 4QS7A 2P9CA 1RBRA 5GAHU 2C3YA 5HRNA 2A40A 1JJ2M 2R7YA 3WUHA 2PY5A 3W61A 3NAHA 2KQ2A 4ATNA 2QLBB 3CJ9A 1XMBA 2CWXA 2E2PA 4GC7A 2A6MA 3VESA 3DYAA 1RZMA 1S49A 1TAUA 4A46A 1HLWA 3ITHA 1YBTA 2HHPA 3NGTA 1EETB 1HNZK 2HOEA 4NI2B 4QQBA 5LMUJ 2PE8A 1WC6A 4PL7A 1S1XB 3DI6B 1NH8A 4BGAA 2NRVA 4ZVQB 2DR6A 2QZ8A 4HL9A 3ZTSA 1NGEA 1XMQJ 3W9HA 4QYZK 1VQ7N 3CULA 4FZZA 4UY85 2O8EB 2F9DA 1TVRA 4O4GA 1CSJA 2YNGB 2XY7A 6FD1A 1CQNA 1OSDA 2JWNA 1Q82O 1NSKL 1JXVA 3O6QA 2E6LA 4TQSA 2ROEA 2IAJB 1ZBTA 2G2ZA 2XHCA 1F2HA 2CJ9A 3SMZA 2Q1LA 3THWB 1ZETA 1IO2A 4TYBA 4FK0A 1WI8A 2D0AA 3CO9A 3EGWB 4KH5A 3MAAB 2DR7A 1PIEA 4MO5A 5LL6Z 4JI5J 4KH4A 4J2EA 3I96A 3N9UC 2VWKA 4MFBB 2PEBA 1F2GA 1U7LA 1XMQF 3CDAA 5KG5A 2ZKTA 2HHQA 1XNRJ 2M8DB 2HEKA 1VQ7S 5HLFA 4DCHA 1VQNS 4JI1J 1GT8A 3O3FA 4KI4A 3CPEA 4F2SA 1REVB 2MPUA 5HJYA 3Q8RB 2PDAA 1BL3A 2DGWA 4MH8A 2IRUA 4BRQA 4XPEA 1K8KA 3H3NO 4AILC 3PHEA 1UW4A 3CJ1A 2Q43A 4IFVA 3R3LA 1HNZF 1ZAXA 3OW2M 4ZHRA 1K73T 4LFAJ 1NDCA 1IBKF 4U7CA 2P9LA 5E3QA 2ETJA 2ASPA 4HR2A 2R9LA 2FTRA 4DPOA 4M1KA 1J6ZA 5EU7A 2AU0A 1CULB 4NLYA 3GCWP 1ZYQA 4WFNQ 3HPHA 4FZYA 1VFJA 4CEDA 4JI4J 4IEIA 3QETA 1IH7A 5JVGQ 1TL3B 1DQAA 3IAS9 3CD5A 3VR1A 1WSIA 4JK7A 5B7WA 4A57A 3E01A 4CJEA 1RDRA 4KRFA 2A10A 5ETTA 4QWEA 1U2FA 1SC3B 2VZ9A 2ZZMA 2X1AA 2PZSA 4DR3F 2BJ9A 2IAJA 2C1EB 3Q8VA 3CCRS 3I56N 4JKGB 4DN0A 3CTRA 3SV4A 4PXEA 3POTA 4O3QA 5C10A 1JLCB 1UJ4A 4NLXA 1BQNA 1HNIA 3ZLJA 1LWFB 4BR4A 5ETOA 3RBDA 3EX7B 3JAMU 3KG4A 4JHDB 5EWFA 3A1YG 3M6XA 4BBYA 1X60A 4Y3CA 2FBXA 4R25A 4Q2MA 4FJNA 1SPBP 5CXTA 4F36A 2LVWA 2VFVA 2ATCB 1RDCA 2DNLA 4XK8C 3TX0A 1F6TA 2DNGA 2OJ3A 2VD3A 1SL1A 4B8AB 5KPRA 4B3TF 2YNFB 5IXUA 4GKKJ 3I6PA 3OUYA 5IC4B 1U25A 2X6NA 2JX2A 5E2QA 2BUPA 2YNIA 1MWKA 2N7YA 4IG3B 3NCQA 3HL8A 4AHUA 4CLTA 4TN2A 4ZPTR 3K8WA 2K7KA 1QZ5A 1I3AA 1JLQB 4CK3A 5MLCV 2E1AA 2EPIA 1N36K 1FHTA 1MROA 3FZFA 3BGFA 3LANA 3IFRA 2PFUA 3CDBA 4J2BA 1TZ0A 4JI5F 4ED1A 4Y65A 2VASA 3IBCB 1CC7A 2QIFA 2HK3A 1QTNB 2P1JA 4LF5J 3H2UB 2K06A 1VK8A 3JTNA 5B0GA 4B3MJ 4UZCA 2WK4A 1CVJA 4W5NA 4LFCJ 4X4TA 1JLEB 1FTRA 5M1NA 3KDOA 4IBNA 2RHKA 5F0XA 2EWHA 1X5TA 3L7OA 3D45A 4HTJA 2XC9A 1HQ2A 1G99A 2R2TA 4J5OA 3R1LA 4DV7F 3DRXA 3OXFA 4HVJA 3TZZA 3CCZA 5DS7A 2DR5A 1X1PA 2LYVA 1VQ4S 1RBVA 4ER8A 1IWAA 2IRXA 3WZ0A 4F3OA 5J1EB 5F8NA 2AEMA 2D69A 3H5XA 2AP1A 3R1XA 3PIPL 3FSIA 2AGQA 4RWTA 4NOHA 2XLKA 3A3PB 2W41A 1NPPA 2HS0A 3NE6A 3BBBA 1NDPA 2AX0A 4OYWA 4Y1CA 5IM0B 1RTDB 1RAFB 2LKZA 4ECQA 4CNYA 2DCUB 4PG6A 4A47A 2QLWA 1RTJB 4ZVUB 2IJNA 3HHDA 4JD2B 2IBOA 4DCPB 2X3GA 3MD1A 5LXRA 2B4VA 1FNXH 2HHXA 1URRA 4EWTA 1BA0A 2OKQA 1FRMA 2GVZA 4IFYA 1EZZB 4JV0A 4LFBJ 3AA2A 5DETA 3EE3A 2ATQA 3QFHA 2O1PA 3RW7A 3DXKB 3DLKB 5C2GA 3DOLA 3UW1A 2WB1D 1S1VA 4NYPA 4UUXA 3ZFVA 1EX8A 3OYIA 1Q81T 3HKZD 5KT4A 4DHYA 4YNQA 2QLJB 1EQMA 1LKZA 4Z7YA 1RGVA 2Y8YA 3QEWA 4RNNA 4B1UB 1S0MA 3AQPA 3HKWA 1VOMA 4BE2A 2XO7A 4H0PA 1TUYA 1E4GT 3N5FA 5GIOA 1ZAVA 3LPTA 3VAGA 4JKGA 1GFWB 2RJZA 1WOSA 5ITHA 2RU3A 5JICA 4DTNA 4DV4J 3T6JA 3I4HX 1HKGA 1WF2A 1Q78A 4MJKA 3VAHA 2Y0BB 2GW8A 2ZNYA 3C15A 4DX8H 3EZ5A 4KHMA 2VHGA 3ILJA 2GAHC 3UVJB 5LSLA 4I2QB 2B6AB 1VRUB 2M52A 3HSDA 2YNIB 3W1YC 1S6QB 4DG1B 4RW7B 4DV2K 1QQMA 5D4NA 5C12A 2AJ1A 2X7IA 2HVHA 4ECUA 3H40A 1FE0A 1H2UX 4BRKA 3G71N 4ELVA 3DU5A 1T44A 5KFXA 2JVRA 3WNHA 1HWUA 1PG5B 3CJ8A 1LAVA 1FD2A 2YBVA 2HSTA 3GCXP 2EC2A 1BC6A 3ISZA 2QL9B 2HRYA 5ETRA 1YDLA 1TKZA 4CZLA 1SV5B 1EIYB 3Q86A 4O0JA 1QD1A 3HOSA 1KQSM 3SFUA 4C8LA 4ED8A 3KLIA 3R5GA 4DTOA 2OPSB 3GLJA 4X65K 3BP8A 4CHYA 5K9FA 4N5SA 1HYSA 4DPXA 3OA9A 2Y1IA 4P2XA 5J1PA 4I6YA 2ASLA 3TAFA 5FROA 2F8HA 2F4VK 3UN2A 4A8SA 3ZSVA 4UY8T 1O51A 4BY9C 1S1WB 1VK0A 4IRDA 5ETNA 2CA9A 1KSPA 4FOIA 3MXIA 3R5BA 2ZJRQ 1W2IA 2G2OA 4B17A 3GIMA 4QPXA 4N47A 3VQ5A 1GXLA 1MDUB 3H8YA 3SQGB 4DR6J 5F8LA 2Q3PA 4Z4IA 1ZS6A 2V9WA 1J27A 1SH0A 2IDEA 2DYAA 3V6DB 1SJRA 5EX3A 3KJFB 2BRKA 2OUGA 1Q8LA 2WBRA 1ASWA 3C8YA 5GAEU 4B3TJ 1NK4A 4XH1A 4ES3A 2JFKA 5KQDA 4DL7A 4OGEA 2F5GA 2ZD1B 3CJRA 2R7QA 3S3OA 1V3SA 3HCXA 3VGSA 1Z6RA 5BRHA 3OUYB 3A12A 1VQMS 3CCVS 2V4JA 5EHHA 1NK6A 3RSEB 1M1KT 4IDKB 3CFOA 4LRCA 4NLGA 4E7LA 2VG7A 3CSKA 3RB3A 5K14A 2BDPA 5U47A 3ZCMA 2VJVA 2CPEA 2DNHA 3Q8SB 3FQKA 4A8YA 3PX0A 2CVEA 2HBMA 4ECSA 1XC3A 1FDNA 3KKFA 4LSNB 3F0NA 1VBYA 1OVYA 3W66A 5A8WA 4PWDB 4F67A 4CI6A 2VGNA 1UJ5A 4FCYA 4HTIA 3KDNA 5KFUA 2QX0A 2WVDA 4TY9A 4LVNP 2KZZA 3OS2A 3EICA 3HMJG 3D28A 4I67A 5KOWA 5JVHQ 1BQMB 4M7XA 2ZHBA 5AQLA 4LBPA 3TZYA 4ERDA 2Y9HA 3PX4A 3NBPA 2WBNA 2X78A 4WXWA 3QBCA 3L3UA 1TL3A 2V6AA 1DAXA 2P9KA 1RT6A 1YG0A 4IOBA 5DK5A 2VODA 4U6PA 2AP6A 4KIAA 1KOOA 2AA4A 3CJCA 1YX2A 2EXUA 3P1GA 3AJ1A 4QS9A 2P9UA 1UVJA 3G86A 2DGUA 3H5UA 2XI3A 3VQ8A 4K4VA 1IKXB 1M5OC 2L48A 5A8KB 4NMXA 4XO0A 4MYTA 2OHDA 1KC8T 1RTJA 1U6FA 4CO1A 3VQ6A 3NOGA 2EFGA 3OYGA 4JLHA 2DTJA 1KCFA 3VQBA 5D0GA 2WBMA 1I94J 2AEFA 4YDXA 1K73O 2ASOA 1N33J 1FXDA 3PV8A 1LW2B 3RMCA 3PX6A 2O8BA 3OSPA 2LDYA 3RYLA 3MMBB 2FSKA 4LR8A 2QL5B 4CERA 2D7SA 4RW8B 1H2VZ 1B9FA 3LTOA 1VSMA 4P74A 4RW9B 2IVFB 1VRUA 4L73A 1BI4A 1KHWA 2KFZA 1WAJA 1SKUB 2HHSA 4LVOP 4Z4FA 5DLFA 1Y10A 2DRDA 2M7SA 4WK1A 1HJOA 2RS8A 3MK6A 3CD6N 3GQCA 1L3UA 4BRGA 2OEJA 4NLQA 1D8YA 3NGKA 2XMTA 4NLSA 3Q2SC 1X4EA 4OI0A 4JV2A 2MZSA 4JS4A 4NYZA 3VZIA 1JJ2R 4IO9L 2XYGB 4HKQA 4I6MB 4M5KA 1CEZA 2P9IB 4O4GB 2L41A 1FK9B 1LW0B 1TUGB 1N6QA 1SV5A 5IC6B 2XS5A 4PABA 3C7NA 1XMOF 2P8IA 3LGHA 4PHTX 1LXJA 5T7BA 2FSNA 3MXMA 5CZ1A 4LSZB 3GL1A 2L08A 4K42A 4AQYF 4JI4K 3VEVA 3BY5A 3NF9A 2EKYA 4LF5F 4RW6B 4BRLA 4USJC 3MEDA 5KFZA 4ZVEA 5KT5A 4H03B 2W9CB 4DFPA 1KVCA 3EYZA 2V9KA 4RW7A 1J5EJ 4O3RA 1BDGA 2L9DA 1U0HA 3ENVA 2VQEK 5A2QO 1HW8A 3QFUA 4FVCA 4RCHA 5JJBA 2WSEC 3VN5A 3U27A 1U26A 3K5LA 3TANA 1B0VA 3MAHA 4ICLA 5DGBA 2YNFA 1JXEA 1NGFA 5AR0A 1BU6O 2ZH3A 1S6PB 3MCSA 2XSJB 3NOCA 1QVFR 4GKKF 2XEXA 3G6XA 2Q97A 3DOKA 1F3FA 1DFDA 5LMNJ 1NGAA 5AQQA 1O13A 3ZETB 4ILJA 2EKNA 3OFEA 4OHZA 1MNEA 3LA0A 2ABYA 4HTLA 1RT3A 4B9UA 4QBUA 3U6FA 2VG5B 4CLFA 3BYPA 1ZBLA 3LP0A 3O9SA 3VGTA 4B3RF 4ID5A 3W5XA 4NL5A 5C25A 3FZ2A 4FDFA 3VALA 5B0CA 4M3WA 2ZJQQ 5F9NA 1N8RO 3DLGA 2NSBA 3P38A 4FK2A 2HQFA 4JI7K 5AZJA 3C94A 4I69A 4DJBA 3QICA 3VGMA 3CCTA 1A7GE 2CQ0A 4YOEA 1FFWB 3M1VB 1VSKA 2R7UA 5L39A 4RW8A 4WFXA 1PAUB 4WIIA 3CPWR 3HVWA 1KC8O 1HWIA 2BANB 4RNFA 4WXOA 1X4AA 3MPYA 3VV2B 4IRCA 4YHHF 5F8IA 2V8VA 1VQKS 1FNMA 3T41A 4NXMJ 4OGCA 1MWYA 5KT7A 4C7QA 3CJQA 3MAQA 2GWKA 1ELOA 4PZVA 4HACB 4J9SA 2Y8WA 2A6AA 2DHAA 2BGGA 1F5BA 1WTBA 2GV9A 2QN6B 4JI2K 3WX8A 4OJHA 1LWCA 3MR3A 5A8KA 2AYEA 4CIEA 4P75A 2XNRA 4BDZA 3HYFA 3O1LA 3TI0A 2AX1A 1HARA 3D6FB 1I39A 4IG3A 5HLFB 1WWHA 1GMUA 4J8FA 1QDUB 2NR0A 3G8SA 2MZ1A 2F63A 4CLUA 4TLQA 1A5XA 2E7WA 3PXGa 4NX9A 1JLAA 1C1CA 5KFHA 2FVQA 4EAHD 2JEFA 2OPPB 1VSIA 3NH0A 5HQMA 2DNMA 2FD2A 4YB6A 2RPIA 4JI8F 3AO3A 4H0VB 4NO7A 1AZSA 2PFDA 4FBTA 4DR4F 5M1FA 1BCMA 3W8PA 4OZJA 4OKKA 2LQJA 3BKUA 1JLCA 3P5JA 1HNVB 2ZH1A 5B0FA 3MPWA 2VQFF 4GNIA 3U02A 4F4YA 5D3GB 3GP9A 4WU3A 3IFEA 2BABA 1TVRB 4JI6K 3TR5A 5AQJA 3CMEN 2O8EA 3C46A 2QA2A 1B64A 1SB6A 3PW0A 1D3WA 2M5YA 4EEYA 4NA3A 3I5AA 2YY3A 5D6GA 4CFBA 4B02A 3QEXA 3ENOA 3I0SB 3IAM9 1NJWA 3MI7X 2MKKA 1Z25A 5GINA 3QERA 2V2VA 4ISFA 2FY8A 3FSXA 1YJNS 2EBGA 2E6MA 4GVBB 3H4DA 3OL8A 4CJQA 3BDPA 3ZSWA 2QWOA 3BDEA 1VRQC 3QEIA 1VQ6S 2OPQB 1B92A 4ISEA 4RNMA 4AHTA 4CJUA 2Q6CA 2ASMA 4Z4GA 4WCEL 4BRFA 3D2FB 3ZX0A 2HQDA 1FKOA 3M1FA 1WC4A 1T3OA 3O8MA 3AA8A 3E9OA 3HM9A 4EO6A 1HKAA 4QR0A 3OT9A 2GNKA 5J2NA 3PO5A 2CQCA 4NYOA 3FKBA 3ZTPA 2CPHA 4D3GA 4IO1A 4LSLB 5HROB 2UXDF 2HHHF 3R8EA 5IV3A 1HQUA 1H73A 2CNOB 4IOCL 3SIPB 5E26A 3AVGA 1Q7YO 4NXNK 2KL8A 3GFHA 4ZP9A 4KQZA 2JOQA 4DU8A 1XWLA 2C3UA 1T94A 4RNOA 3GFXA 3LPYA 1KWMA 2QWNA 5EWGA 2B4UA 2FY1A 1IBLK 2DNRA 4O55A 3Q8PB 5H9EK 4RUHA 2OAUA 3WXJA 4D3HA 3UPFA 3U1NA 5G0RB 3M8YA 1NNEA 2QLFB 2XMUA 1TU0B 1H6KX 1U47A 2JFDA 2VDIA 1WLJA 2KKHA 4E0DA 4I6WA 5CHCB 3KG0A 2D5RA 1SL0A 4DV3K 2N4CA 1F3VA 1R3NA 3F9MA 2QT7A 5D4OA 5D77A 1HMVA 4CF1A 3NH2A 3C14A 1VQOS 4DSLA 2GQ2A 1Q8IA 2DB1A 3KLHA 3MR2A 2A5XA 1VSHA 1HI8A 2HS3A 4CGJA 1RQ0A 2PN6A 5LJ5Y 1RJJA 1EETA 2DR9A 2W2MP 2HG4A 3PG9A 1SI9A 4DU3A 2DXDA 3M8QA 3NP5A 5AJ3J 1IBMK 1WEYA 2E1ZA 2N7CA 2COLA 2ZHOA 1WORA 2OANA 3TYTA 4OJRA 2G8WA 1LWXA 1DHMA 3FBEA 4FPRA 1RGIA 1AUDA 3IRWP 5AQGA 2QFJA 3EGZA 2B8QA 2F3JA 3UQSA 4IKFA 4H5TA 3EGVA 3D6RA 4FWSA 1YJ9S 3NKYA 1FFGB 1WDTA 2IVYA 4V19J 2ZEJA 3PNIA 5D3GA 4KTWA 3KZBA 2RT3A 4N8OA 4HHUA 1CXQA 3IKMA 4RBTA 3U9DA 4DR2F 3BREA 1CQMA 3V6HA 1S76D 4H4KC 2XM3A 4OYXA 4GO7X 4Y2AA 1MLAA 5GAEI 1APSA 1HNXJ 4X2BA 5BRDA 3C6UA 2D0PA 1GAOA 4CEAA 3P5TL 4M8LA 4GW6A 3H90A 2LA6A 3S1TA 2JLFA 3CJ2A 4QIWD 2D3ZA 5DDOC 2PAVA 3OXLA 4F0KA 4JI3K 1IKYB 2DO0A 1RYRA 4C8MA 4YY3J 2VH7A 2KTQA 1P6TA 3WXMB 1N32F 3P31A 4RW4A 3H20A 3BB5A 4ZVSB 3G71S 4BRNA 4A8XA 4LSLA 5HROA 2W7OA 4WP9A 4IR9A 1WOQA 1OYEA 1RTZA 5LJ3Y 3OVNA 1NB2A 1CS4A 4DV2F 1KS2A 5KG3A 3D6HB 1RT7B 3N6NA 2MLXA 2FJVA 1RI7A 1V3RA 3Q2TC 3E51A 4FLXA 4FWMA 1FDAA 5AQYA 3K8VA 2E5HA 3AGRA 1KONA 1WC5A 3SXLA 3HHNB 4PL8A 2E88A 5C15A 4H4KA 3FZKA 3W2VA 4K0KK 2XS2A 2MQ8A 3KHRA 2HGLA 1U04A 3K89A 2XLIA 5L1LA 4L3QA 1Y11A 1UA0A 5ETMA 3SDEA 4EFAC 5E5NA 3M2UB 4NLUA 2KXNB 2XZTB 1UVLA 2XMKA 4X66K 2O8CA 4O3NA 5C2DA 2DO4A 1Q86O 4AM6A 4K4ZA 1NDKA 4OI3A 2FF6A 1CJVA 2B51A 1IBMJ 5AJ3K 2W6LA 2ZITA 2FPHX 4NA1A 1YZ6A 1QVGM 3CQYA 2A18A 2EG1A 4MIWA 4DQRA 1GTHA 4C8ZA 4CJWA 1RAIB 4PQUA 4CESA 4A8KA 4H0OA 1MSWD 2VFUA 4GKJJ 2HBJA 4Y34A 3ONQA 3SUQA 1VC6A 4FKXA 1N48A 1FWPA 5J2PA 4ETZA 4J9NA 4G1IA 4JI4F 3JYTB 2ZH7A 3I9V9 4B9SA 3ZYYX 2JLEA 3J81Y 3ULEB 3UO0A 1NGBA 3LWMA 2NZCA 2JHEA 2C2OB 1SUQB 3ISND 3TZWA 4KB1A 3HLUA 4LFAF 4KHRA 1WSHA 1LXNA 3IC1A 1HFEL 4WCEQ 1D9AA 4MLHA 3VQEA 3V81A 4OX9F 5AQTA 2XSJA 1UW9A 3AARA 1YSJA 3V6JA 4DPWA 3EE9A 2QTWA 2Y3YA 4X4UA 3NL0A 4ZPWR 2R2UA 2FBTA 2VF3A 1FKAF 1RP5A 4CF0A 5AQMA 3TR8A 4TYAA 1TUWA 3HFVA 4Z4CA 3I0RB 1LEOA 3TUPA 1CPZA 3OFHA 4B8CA 2GHVC 1N5SA 4NLVA 5C2CA 2IM1A 4KFBB 3IMXA 2Q66A 4H5RA 4A2AA 2D1KA 4AUKA 4WP3A 4K0KF 1K0VA 2HBKA 4C48A 3ICLA 4XH5A 4AHVA 2G0IA 3W5YA 3V9XA 4PCQA 2QRRA 4A2BA 2B56A 5KFRA 4KYZA 1V9OA 4RBUA 3A5NC 3D2WA 2GWJA 3QZ8A 4JI7F 3ZZ0A 4RUBA 5F0WA 1OPIA 2B43A 4CYUA 3P83D 1R0AB 4A8QA 4CT9A 2FVPA 2D0CA 4Y1DA 4NEYA 2PEHA 4USWA 5KT6A 4KR0B 1HMVB 1MU2A 3AA5X 4XPCA 8AT1B 3VOVA 4OMFG 2GA7A 4DV5K 3RVCA 5JLHA 4F25A 4TVAB 3EZUA 3V6KA 3FZBA 2DIUA 3VQSA 2LEBA 4A59A 3OYAA 3VAKA 4NLRA 3HULA 2Z2MA 2Z8QA 3WNEA 2IJRA 4ZHRB 3MF5A 1MN9A 1ZZFA 4IFVB 4EGLA 2EI5A 3AVHA 3KLEB 1HIYA 2BE2B 2J76E 4M5HA 2ZOMA 4I1TA 4H5WA 5E3RA 4F02A 4CO3A 1Y5NB 5HVHA 2ZWOA 2Q0RA 1K8AT 1UPMB 2Y1LB 1X3NA 1GLCG 3ULHA 3RAMA 4CEOA 1VGYA 1IKVA 3VGUA 1V5VA 3O9RA 3HI0A 2GUPA 2YX7A 5A2QY 2BMBA 3OY9A 4UOCA 4ECZA 1SQKA 3BF4A 1OYDA 3TVKA 3CJTA 4J9VA 4OI2A 1P8ZA 2HBQB 1GH8A 3T5KA 5K20B 4H5NA 2FJBB 2MZQA 2C3PA 1ZH5A 4EYHB 1T9XA 2X51A 1GOBA 1U2CA 1U2RA 3I8DA 4E8UA 3O4NA 3NFAA 1DZ5A 4OPKA 5CR4A 4WQ4A 4IKAA 5DQHA 2DPIA 2NXJA 1WSRA 1UEVA 1ZBFA 2DITA 3VTHA 3WIVA 1HBOB 2J0SD 4CZIA 1VHXA 1NPKA 4DV4F 3F44A 3DMJB 4X62F 4OX8A 3I0SA 2YKNB 4XH4A 1VQON 2A1SA 1AT1B 4Z0UA 2DHHA 1OPZA 1UL3A 3S6EA 3KK3A 4F8RA 1R0AA 2AZ1A 4NZ7A 4O44B 2XB2D 3U3YA 4E3SA 1ATNA 1QVFM 2YHXA 3QEVA 5KOXA 4AFFA 4ECYA 2W2QP 4KB7A 3GOIA 1RU1A 4OV6A 3BSCA 2J9DA 2YJEA 2V4JB 4ZJLA 4BRDA 3G8QA 4FK4A 4FWKA 2KB2A 2YKOA 4IJAA 2C2RA 3KLHB 1QAJA 4CLKA 5AXNA 1SC6A 2E5LF 1Z2LA 3N6LA 3CYMA 2AGPA 1Y3KA 4CZJA 3MN7A 1VHFA 1HKCA 2IM2A 3C3LA 4GV9A 1VQYA 3B78A 3UKRA 3T69A 2FHJA 3PEJA 1U24A 5D0RA 3ZSZA 2WVFA 3IM9A 3NS7B 4PA1A 2ALZA 1XR7A 1RXOB 1IJEB 3T5LA 4FBUA 4IOAL 4PPDA 2IIHA 1XMOJ 2F7TA 3ZT0A 2CQIA 3NWGA 2MB0B 5DGAA 2BJ8A 4QS8A 5AZIA 4XDDA 4FN5A 2RDDA 5CZXA 3NBPB 5FJ4A 4JYAK 3G6ES 2W42A 3AQOA 1BIZA 3DRYA 3LP2A 3J7A1 1RWPB 4DV7J 3W3DA 2ASYA 1M5SA 5ETPA 5JMNA 5BYSA 4FJ5A 3FRZA 2BANA 2YWFA 4N77A 3K17A 4KTZA 2ZZNA 2W9BA 4M3ZA 3NG8A 3E9LA 3D2FA 1G4CA 1S4FA 1T02A 2XHBA 4CVNE 1OH6A 4DR7F 1M90O 6FDRA 3AAQA 2BX6A 2KHDA 2RE1A 2R2SA 3NEKA 3S7RA 3SDEB 4DLGA 1XUPO 1RBSA 2DGTA 3ZTQA 2RKIB 2J6UA 4HYKA 4B08A 3SCJE 3GYNA 3KJVA 5FRNA 3EVOA 2BE9B 3OD2A 5EVZA 3IR5B 2KHCA 2DHGA 5KFNA 2FHJD 3V1OA 2GTDA 3TTCA 3VERA 3QJPA 1S1TB 3CCJS 2MXYA 1RT1B 3PM9A 3L4IA 2KH9A 4M41A 1I51B 4B3TK 1EKRA 4WPAA 3JS6A 4CJRA 4DI6A 2V69A 1OQ6A 4CEBA 3GV5B 3LAMA 5AQOA 1VQ5S 1HNVA 3J8AA 4DL2A 2ASDA 3H1QA 4JV5J 4OL8A 5LT5A 2PSZA 2YHYA 2F4VF 1BUPA 1VSJA 1U0HB 2BR0A 4UQGA 2IVNA 5KPTA 3KD1E 2ZH4A 1CC8A 5AE3A 4WTYA 3T1HJ 1YUWA 1VSFA 3KJQB 2MKJA 4CT8A 2CZ9A 3AD8C 5KFKA 2YWGA 3QMLA 4DV5J 1CJUB 1M1KO 4LR9A 2CQHA 2GMLA 4AL6A 3TTFA 3EUNA 1VJQA 3PACA 4LT6A 4J9RA 2XMAA 4TLRA 3UE5A 5KFYA 2VC0A 1HWJA 3ZXWA 1DGKN 4FWOA 4CJTA 1KAYA 1SJQA 5L8RC 2WZ1A 4PQUB 1WEXA 4QYZJ 2DCLA 3HD1A 3OYNA 1HPMA 1F1BB 1WKJA 4BRMA 3KK1B 1HI0P 2BQUA 3IWXA 2E5JA 1ZBUA 1RHUB 4QW9A 4RZRA 4EU0A 3TEGA 3CCMS 4UZBA 2HIYA 4F3TA 4DL0C 1G6BA 5GIPA 2ZWHA 2E2QA 1WJ9A 2IOCA 1J2VA 3HHLD 2BM1A 3Q89A 3TARA 1QQNA 1TL5A 5E84A 5H1SV 5B0EA 3BGRA 2UUBF 1ATSA 5A0YB 4WJBA 3J7ZO 4GVEA 4KSEB 2WTUA 4AL7A 1HBUB 3V2UC 2RH3A 1FA0A 1UAXA 1T9UA 2B7BB 4B1ZA 2CDRB 4KV8A 3GILA 3SAHA 4ED4A 2DY9A 5DO2A 4DV0F 2HMPA 4NLBA 3GIJA 4FPIA 4CZHA 3ZO7A 3TAMA 3BF3A 3PR4A 3M8ZA 4Z7CA 2CFXA 4F26A 3GR1A 2RHQB 3DOMB 3DNCA 2WW8A 5D8HB 1LWEA 3DLGB 5IQQA 5KFEA 2BTFA 4LR7A 2JWLA 3QRRA 4BVOA 2ZUGA 1DLOB 3W2WA 2ZH8A 4NE9C 4BRPA 2XY8A 5E0OA 5K8MA 1HPZB 4MLEA 4BC9A 4PUOA 3FZHA 1XIQA 4DFKA 3JQKA 1BY9A 4BWJA 1T11A 4RKUC 1HR0F 2WB4A 2D3O1 3B82A 2J0QD 3RWUA 1NJYA 3MEGB 2HNYB 1RBOB 3C6UB 4FJGA 2BXJA 1FCAA 4MAKA 2GGPB 3M2RA 5KG2A 2IYIA 4CJLA 4J9QA 1GLBG 2LU1A 1BOTO 2WVEA 1NGGA 5DZ6A 5DM7L 2OSQA 2YQ3A 3GTYX 5KG1A 2E5LK 1XNQJ 4DUYJ 1N33K 4JI0F 1W2BR 1NNDA 3G6EN 5IT4A 4K4WA 3B8AX 3MECB 3HVTA 3TAPA 1RDUA 2J9DE 4IQXA 4MKYA 4U7UK 3BQ1A 5F1XA 1NHVA 1PYTA 4P10A 3L3CA 1HQEB 2B4PA 2N4DA 5T41A 3OVBA 1YBAA 3HX9A 2ZKUA 2IVOA 4C6AA 4F0MA 1UWAA 2EW9A 4I64A 5L9NA 2HMIB 2JH3A 4CE9A 1BGXT 1HBMA 3KK7A 3NF7A 4WYWA 3C7NB 3FFIA 3PLAA 2IMOA 1URNA 3NVMA 3EL2A 4DL3A 4W4MA 3OTEA 3ZEUB 2WOMB 4YDDB 1WB9A 2GBZA 5BJRA 3FBBA 3DC2A 3QAUA 4Q5VA 2CG4A 4WQ5A 4NLWA 4R0JA 2NQPA 3CJ4A 2QA1A 4FLZA 3VENA 2YKMB 4P52A 2W7PA 1LFWA 4NYNA 3ULEA 3OR2B 2RRAA 3DMJA 4ECWA 4MDBA 2R8IA 3ENAA 3NGIA 1H38A 1VQKN 3GPAA 4J9MA 3CCQN 3OBIA 4CJ3A 3SAGA 4DR7K 4KHPF 4IFEA 4IG0A 2JL9A 1FK9A 4LBHA 4ZPBA 1S77D 4JI3F 1QQOA 1R31A 3H2LA 3HTVA 4C8OA 3AO1A 5F2RA 2YQ0A 1UETA 2PA8D 4FYDA 2IIRA 3T3FA 4BR7A 4IRKA 3T7ZA 2V52B 3U3GA 2OH2A 3G6YA 3WXLA 2CQDA 4ILMA 1B70B 3O2IA 4URQU 3SLCA 1TK0A 1AUSL 4S0MA 1VBKA 3LZIA 3W8GA 3R9LA 2MHEA 3MPDA 3PR5B 3G6VA 3QB0A 4M5DA 4JKAA 2QGFB 1UVKA 3TSPA 1YWXA 4OHYA 3KLVA 3IRXB 4QPTA 4UUWA 4NWBA 4YMEA 2E20A 2PI4A 3HBTA 2R3VA 2A2DA 3X3UA 1U6ZA 3IMQJ 3GR0A 3RB6A 2JDJA 1ZBIA 3H42A 3F5TA 3OTOF 3H4BA 2PC6A 2KRRA 1HBMB 4LF9K 3JTPA 3OHAA 3HSCA 4CWBA 1H0HB 2Z1HA 4YY3F 1FTCA 2J9EA 3SUOA 1X8DA 1SH2A 2I2YA 5G4DA 2ZBCA 1BG3A 3FE1A 1KLMA 3THYA 1SL2A 3IXQA 3SCIE 4JV1A 4GV3A 2B5JB 2OZMA 2E1MC 5AFUA 3RZAA 4FJ8A 4LF8J 4JKEA 3IAYA 2V0NA 1VIOA 4HHJA 4OZ3A 2DFFA 4DL6A 3WXIA 4CIFA 4C0HA 3S8SA 1SQEA 4DX7A 1YIJN 1Y7PA 4KTQA 3AO2A 3DM2A 2HHVA 2GIRA 2RQMA 1ZPWX 1UWBB 3ZTRA 3UB5A 4KREA 2MJNA 1TUUA 5JXSA 1FJCA 3MDQA 3ZZPA 3M2RB 4ID5B 3MXHP 3VZHA 3RMBA 3NMUA 2B7CB 4HDGA 1BIUA 4C3LA 2UUWA 1K8AO 4K4TA 1OKJA 1UZHA 4ZPVR 4BHQA 3ZETA 4PUOB 4M5JA 3ZZOA 5KFGA 2HFNA 2X74A 3DGPB 1KVIA 1WHYA 1HR0K 1K1QA 5CZ2A 2NRTA 1HJRA 1TYQB 4PKHA 2YXLA 5E33A 3LP1A 1S1VB 4X65F 2ZM6F 3J80Y 2HS4A 1I3OB 2HNDA 1C1BB 5A6PA 2L9WA 4YB7A 4CEEA 2J5AA 2D4WA 4HCCA 2B3TB 4OYOA 4KHNA 4K25A 4JI8K 3T1YJ 4ZVHA 2IYGA 3SYZA 3FJ2A 2IVMA 2XSFA 3DRSA 4F0HA 1T9TA 3OBYA 3UDCA 4DPUA 3O44A 2YWKA 4F7VA 1AA1B 3CERA 2RE2A 4B3SJ 4ED6A 1RB0A 2W9CA 3VGLA 1ZAWA 1IQZA 1KD1T 1FFSB 2VCPA 2UUCK 3MUTP 1S1WA 3ZSRA 3UCZP 5L46A 2NREA 4IEEA 4C98A 4O8KA 1GLLO 5FIIA 4KHPJ 2HGNA 3LP3A 4RWWA 4HH0A 1MN7A 3LQVA 1NUEA 4KJIA 1HBOA 4M63C 4YOWA 2GO9A 1HLUA 4WFAL 2MZJA 1VSEA 5DG8A 3LDNA 2QWLA 3G0ZA 3FGVA 4ZA1A 3C6TA 4CZFA 2F1FA 1T9WA 2ZH9A 3N28A 2IJFA 4FYYB 5M2UA 4DLEA 2VA3A 3MM5B 2AQ4A 1SQGA 5DG9A 3W64A 4USUA 4DQIA 4U8VA 2EK1A 4FVMA 5CE3A 2RSQA 1QHAA 2OCEA 4QAGA 4EZ9A 1KXPA 4B9LA 3OBWA 2YHBA 4YOVA 2E2NA 3H7HB 3TWHA 3HO1A 1PYSB 2UXCJ 4LUBA 1TFWA 4QJVA 4R5PB 4Q8EA 3CD6S 3U1MA 4LRAA 2X6SA 3PW5A 1VQNN 2IDLA 1NGJA 3PW4A 3OQ2A 4DOZA 4PQAA 4LBIA 5DQIA 3O9TA 2NXNA 5HQLA 5L1IA 4TY8A 1TV6A 4ZN1A 1NBWA 3RRGA 5B8HA 1VC5A 4OV1A 1K44A 2Z1IA 4CBWA 3QPIA 1BQXA 4HACA 3AHPA 4KGKA 1JCGA 3O5BA 1Q79A 3PJ9A 2ZOGA 1WNSA 2YQ1A 4DBQA 4DMZA 3AY9A 1B0TA 3MM8A 2RS2A 3CETA 3L3VA 4FZXC 2IFXA 2ZM6J 3JXOA 4PXCA 2DH8A 3NS5A 1VC0A 3RUBL 4DR6K 4P7VA 3RU0A 5KFWA 3KHHA 1G2EA 4W5QA 4L6V3 2QXFA 2JVOA 1EO1A 4ZK7M 1GLFO 2RVJA 5EWEA 2HRUA 3CJ0A 4B9QA 2Z2LA 2MY8A 3HI9A 2OGUA 3IDHA 5HVGA 1WBBA 3LO3A 3I32A 4J9UE 4DV0K 4W5RA 2I38A 1JCEA 1KNZA 3VEZA 3AA9A 3V9ZA 4CD1A 1WG4A 2GGPA 5F9LA 1DTTB 2P9IA 4Y28C 3LM2A 3SFGA 3RMAA 4FOEA 1Y00A 1ZA1B 1R59O 3POTB 1R89A 2C2DA 3QIPB 3NGDA 1SIZA 5IOLA 1K9MT 1TL7B 2DT9A 1P9QC 4E89A 2HZAA 2A3JA 3W65A 1C1AA 2J4RA 4LF8F 2O4IA 1Y5LB 3L95X 4B1YB 3A3NB 1TMJA 1I94K 1IQTA 2HFVA 4CHOA 3GYXB 2DGXA 4YHHK 4X64J 4FPAA 1RNHA 2E1CA 3EN9A 2GZOA 3VEOA 2O8BB 5KFTA 3V81B 3ILIA 4CK1A 4DV3J 4JI2J 4QW8A 3BS9A 2A6OA 1ESVA 2LEAA 2LU2A 3MM7B 2CJAA 2HGMA 1X4CA 4QCLA 1RA6A 4BQZA 4NMLA 2CJXB 5AQVA 2N82B 4QWDA 3Q23A 4AT1B 4PKGA 1REVA 2CPZA 1SJ3P 3R7BB 1IKXA 2HQCA 2HVDA 4CZEA 1GQEA 3TNVA 2MEWA 4DV6K 1NK9A 1AFJA 4NLOA 4OZ0A 1L3VA 2G8IA 3QJJA 1FDDA 1TKDA 2QSWA 4IXCA 2ILZA 1FT8A 3EGNA 1VQPS 3L4BC 1UVMA 3ZNJ1 3C6TB 4LF2A 2F8TA 2GS8A 2GQCA 3KJNB 2DY1A 1IR2A 3A13A 4CJVA 3QLHB 1GMWD 4LF4F 3V1RA 2C28A 1UWBA 1JKHA 2DNKA 1BI4B 3D2EA 2E5IA 4QIEA 1X4BA 3PFOA 4FLTA 2QK9A 2V2QA 2GX8A 5C25B 1RWXB 4CLLA 1NMNA 2RF2A 4CJPA 4ZJOA 5MLCQ 4N7TA 2OA8A 3MX5A 4ZVPB 4Q45A 3IS9A 4CM0A 2CIMA 1T3NA 4G65A 4OLBA 1KLMB 2HWTA 2XTJP 3THYB 3CCWA 2XWYA 1TKZB 2V2ZA 1UAWA 4WZMA 1RCHA 2ZFHA 4C11B 2EHGA 4B9MA 4GVBA 4KHWA 1C1BA 4C11A 4N8NA 1ZM2A 3SEOA 2CPJA 3T1YK 4K5SA 4DF4A 1WTFA 4K7QA 2DNQA 3BGUA 4BDPA 5GMKa 1YRUA 2AW0A 1Y97A 2FJEB 5KFMA 3GV8B 4JKHA 4AQYJ 5M2PA 2ZD1A 2Z2YB 4Q8FA 3PY8A 1NDLA 4JRPA 3BZQA 5F0UA 5FLXO 2RF2B 3AJ2A 4FKYA 1NZ8A 5CHIA 2EVZA 4ED2A 1RWKB 4FPBA 4IJNA 3KTQA 3X1LB 4MKAA 4B1VA 1MMDA 4CFDA 5DDPC 2UVVA 2YI1A 2CGLA 2J0XA 3BZCA 3O08A 1TELA 1WC0A 1LWFA 5B08A 2VWBA 3Q83A 1NM1A 3ZSQA 3TOQA 2HAFA 4CHQA 4FJXA 3VF2A 3TJAA 1YT3A 2WONA 2FQQB 4LSNA 2GEMA 2W9BB 1YJWN 4IG0B 4DUTA 4MO4A 1IBLJ 2Z4PA 2IDOA 1JLAB 2XMMA 3QRPA 1KHVA 2O8FA 4JI6F 4QOZB 5AXKA 4ZCKA 3PW7A 3CDEA 3RJMB 4BC5A 5HVFA 1RAHB 3QLHA 1MU2B 1VQSA 5AQKA 4JI8J 3VQ4A 3OS0A 3PYDA 3RSEA 2KXHA 4PG4A 4CYUB 1NJXA 2MQLA 1RACB 4MT1A 2OP5A 4Y2CA 3ZZRA 2QG9B 2ZHAA 3AAPA 1UJ6A 4XDCA 2ROGA 5KFLA 1RHQB 4YN3B 2W1BA 4LIRA 1G15A 4M5IA 2G1HA 1VQ8S 3S01A 2H51B 2D0BA 2H65B 4KFBA 2RDJA 3DLRA 3OYDA 2V7YA 4M42A 3SUNA 1RISA 1TL7A 3O80A 2V63A 1LQ9A 1T6CA 3KUHA 5FDLA 3QT7A 4AH9A 1RHJB 3SPZA 3KK1A 3PUFA 4A4JA 2FZKB 3MPVA 5G0RA 4CHZA 3I0RA 3TUJC 1ULRA 4DTRA 5F8HA 3M1VA 2RUSA 4GV6A 3MN5A 3DCAA 3R5JB 4DS5A 1FJ7A 3N4PA 1M5KC 2P9KB 2OD6A 3P8BB 3CCSN 4NXMF 4I7FA 5BYRA 1H72C 3BV8A 3BKFA 5L38A 5HBMA 1VMBA 4B9VA 3AY0A 3HXMA 5AQHA 4C8YA 1TGOA 2CNKB 4KKOA 3CJBA 1IG9A 1C0UA 1JXLA 1S9EB 4K41A 2BJ3A 2VV5A 4WKRA 2E66A 2P5OA 4ILHA 1RWMB 3P3DA 3AT1B 1F5AA 3BPDA 1O8BA 3LL3A 5L1JA 4OLPA 4ITSA 2AJ0A 5AQPA 4FWRA 3QNOA 2WOMA 1GLAG 3TSUA 4KO0A 2NNWA 3BJYA 3KNGA 2AMCB 1A0OB 3G96A 2J8SA 3T1HF 2OPQA 2ZM6K 4FF3A 1EKEA 4TSXA 1U02A 2PD1A 5EY4A 2E2OA 4FJKA 2I1RA 1UKUA 4LFBK 2WAQD 4M94A 1M1GA 3NF8A 3TJ9A 1PJ5A 3T6BA 2JZ5A 1BE4A 3HVAA 3D1OA 1S5ZA 1WUUA 3WQUA 3GG0A 1YTUA 5LMNF 4ETXA 4AD6A 3B4MA 2OSRA 2D9OA 3AB2B 2IRYA 3LDLA 2KRBA 4ID8A 2OTLN 3CJ5A 4I2QA 3NDKA 3R7SB 2P9NB 1TQLA 1YLXA 1EQ0A 3P39A 1H1VA 3CC2S 1RTIA 4CK2A 3D2EB 1XNRF 1RDWX 3EDRB 3ZX3A 2NZTA 3E9PA 4A5BA 2D74B 4WP8A 3CIZA 2FYXA 2ZC4A 2BRLA 1ACMB 3MDFA 3GFZA 3U4LA 1LOUA 2HHWA 3AVMA 5LL6d 4RR5A 2HBYB 1S79A 1VBZA 3P49B 1Y64A 3R6LB 1DY3A 2J7WA 3FCWA 1YJVA 4BRCA 3T9NA 2OMOA 2ZDPA 4YR0A 2OPRB 1RKIA 2KVIA 3KWIA 3N6MA 4M5MA 2CPDA 2Y0SD 2EC0A 1BXNA 1S10A 4I7FB 2UUCJ 3WIUA 2NRXA 3QGGA 1F5CA 3VVUA 4LQ9A 3SQOP 1VQLN 1JLEA 5CZVA 5AE2A 4O3OA 4DKWA 1HKBA 1YJRA 2P9LB 1GXUA 3CMAN 3QT5A 2IC3A 4OO1J 3VQ7A 4BROA 4LMZA 3BSOA 3BGRB 2HRTA 2YJFA 4F04B 1H7WA 2R7TA 1XR5A 1NK8A 3FFIB 4CF8A 2G2YA 2FSJA 1VJWA 3QIDA 3K57A 4PG7A 4RPFA 5IM0A 5E3AA 2KLAA 2AEJA 2HBRB 1QJHA 2BKPA 3J7AN 2P9NA 4CZGA 2P9UB 5L1KA 4OX9J 3HPGA 4MQ3A 2Z2ZA 1Y4ZB 3UE2A 3GBTA 4YOXA 3A2FA 4KB0A 3SMSA 4JRQA 3SI8A 1W9HA 3QIPA 1S6QA 5HMYA 3VAMA 5EX5A 3VQTA 4GRSA 3FVYA 4DTXA 4W92B 2PA3A 1P9YA 3M8QB 4U67Q 2M4MA 5E7OB 2WCXA 4BLGA 3MEEB 4EI2A 3FEZA 2FJWA 4OJ3A 4WQ4C 2RHSB 1N4LA 1IVZA 3TUIC 3IBWA 3CIMA 4BG9A 3TX8A 2B9XA 1BQMA 5AQUA 4ZCMA 2IPOB 5LSRA 3O4WA 1YXQA 1KFDA 5D15A 4KO0B 1R8BA 5GADI 2O8DB 2GIFA 4OZNA 4TNOA 5HI7A 3DXMB 4H0YB 4CLWA 2LEPA 1YK9A 1U45A 4O23A 1ICEB 4OZLA 3EPGA 4OFZA 1NXIA 3R2CJ 3O6WA 5M1PA 3VQDA 1RCXB 4B9TA 3DOKB 2LSNA 2VPZB 4AM7A 3GIRA 4BR9A 4USIA 1JLQA 4DF8A 2KG0A 2GQQA 1RT4B 5HQ8A 3IGNA 2R7XA 2W40A 3J7YP 4DQSA 2CZ4A 4EMDA 2OELA 4ZITA 5SZTA 3QSYB 1M5VC 3CG7A 2Q31A 2U2FA 1REGX 2U1AA 4FNHA 4FO0A 2MZRA 1FRLA 7AT1B 3H59A 4AQYK 4K4UA 4F4KA 4M5DB 4GMKA 3KJVB 2HHTA 1HNWK 2GO8A 4H0XB 3DRRA 2DPNA 5J2NB 3PFEA 2DFEA 2BA9A 2UV8A 4YR2A 2F40A 4DU1A 3LAKA 2XBPA 1Y9OA 4PXDA 2XNQA 1GLJO 4FLUA 2ZC3A 1Z26A 1N5QA 3OSNA 1RWUA 3O5TB 1K0TA 1IV0A 2PYJA 1RAOA 3GZ7A 2K7JA 1W2BM 3FBCA 1HNIB 5F8JA 4Q43A 2VA2A 3DHXA 4R8UB 2DY4A 4USVA 1HNXK 1S6OA 2ZJPQ 1NWKA 2PMHA 4FM1A 3KMSA 3CIPA 4OX7A 1WF0A 1CS4B 3G8TA 2VPWB 3OFFA 2M3DA 3SAFA 1S6UA 1JL2A 2MHNA 2CG8A 2FLNA 5FPEA 1MWQA 3K9JA 3BO3A 2FHMA 2HHUA 1VRTA 1W25A 4RW9A 2JRSA 3B6PA 1S9GB 4MKVA 3B6OA 3HP9A 3AOCA 1RTHA 2E8AA 4X4NA 2V68A 2YKMA 1KTQA 3EE8A 4JV5K 1GXTA 2HHHK 5B0DA 4OPJA 1T05B 5AQNA 1JIHA 1T8EA 2YPYA 2MKIA 3QATA 3L2VA 3IR6B 1TKXB 2MGZA 5FRMA 1LW2A 2FC9A 4FWPA 4CF9A 4CH0S 3DDNA 2YNHB 3HSTB 3CUNA 1W7AA 3AVBA 1OSCA 1HD0A 2NPIA 4WE1A 3JSMB 3QZ7A 3WT0A 2NCKL 2DNZA 1CG2A 4KHQA 1NM2A 4ZVGA 1WHVA 4PWUA 1S1XA 3DI6A 5C24B 3OR1B 5J2QB 2F8SA 4BWMA 3D4JA 2EWSA 2XO6A 3CCMN 1VS3A 3CGIA 2E7VA 4CHPA 4B3OA 5GADU 2IA6A 4BR5A 2Y1RI 5DM7Q 2OFGX 1YBUA 2ZNZA 4WFNL 1I5OB 1IBKK 3JSRA 3T19A