1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
3QO9B 2YNFB 1SL1A 3P1GA 5HROA 3CYMA 4KV8B 4JS4A 4QCLA 2FBXA 3IRXB 3HP9A 1D5AA 2X6SA 4C8MA 2OYQA 3WNHA 4Y3CA 1HNVB 4H4OA 3NE6A 3NKYA 5KT6A 3TAPA 2J6TA 3HVTA 3SQ1A 5KT2A 1GX6A 5CYMB 3V6DA 3NL0A 4E7JA 1U4BA 4RNFA 5I42B 2HHVA 4ECUA 3U6FA 2IJNA 4WFZA 2YKMB 2E6MA 5HROB 2Z1GA 3O3GA 2HHUA 3T5LA 1RT4A 2C2DA 1TQLA 5KT4A 2HNYA 4FS1A 1J54A 4F4KA 3CJ2A 2R7YA 4OGEA 3SYZA 1RILA 1RYSA 3TAFA 4ECQA 3TAGA 4DQRA 1LAVA 4M3UA 4XPCA 3V1QA 5KFFA 4LY7A 1IKYB 1Y97A 1C1AA 4CJRA 1ZBUA 4DWIA 3DLEA 2GIRA 4FLWA 1RTIB 4BDYA 3SV3A 1T7PA 3V1OA 4CJVA 1D8YA 2HVHA 4GC7A 4M3ZA 1SH2A 1U49A 5KFQA 1BI4A 2HHXA 1S48A 3M8QB 4RW4A 3H4DA 2WONA 1S49A 2VG5A 5KI6A 4PA1A 3MECB 3CM5A 3D28A 3SFUA 4M3XA 3H5SA 4YQWA 1S1WB 4CHNA 1C1CA 3PJXA 1RBRA 3K2PA 4ID1A 3ICLA 4K8XA 4BE2A 3I0SB 3QLHB 1C0TA 5EWFA 5JS1A 1RA6A 1Z25A 3RB3A 4IQXA 2RKIB 1LW0A 1R0AA 4IRDA 1RAJA 5J2PB 4Q45A 2BQRA 2HWIA 1KHVA 1WLJA 2ZE2A 4N47A 1VSLA 4ID5A 2FVSA 2JEIA 1LW2A 1J5OA 1S9GA 4CJKA 4J2DA 3KMQA 4Q44A 2FBTA 1WNEA 3HT3A 1IO2A 5HRPA 1VRUA 5SWMA 4ED7A 2Z1JA 1U09A 1NK7A 3CJ5A 1NK0A 3MEDA 2KQ2A 1HYVA 4KV8A 4IR1A 1UA0A 5KFXA 1N5YB 1VSKA 4WE1B 2BE2A 3DYAB 5F9NA 5J2MB 1JLQB 5C42A 4FJGA 2G8WA 4URQU 4N76A 2B6AB 1JLCB 4O4GB 4HUGA 2HNYB 1TP7A 4CEAA 3OHBA 2D0AA 3CFOA 1WSEA 1IKWA 4RW9A 3NH0A 1F21A 2OPSB 3LWLA 3DLKB 3KLEA 1NKBA 4DU3A 2XY5A 1QS4A 3GIJA 3MR6A 5DLFA 1N5YA 2DPIA 3T5KA 3PW5A 3VQCA 3M8SA 4MK7A 1TKXB 2DFHA 1N4LA 2E9RX 2KFZA 3T1AA 3RBEA 4ZTFA 3VQ7A 4K4ZA 2W9CB 1JX4A 3MXIA 4DL6A 3PHEA 3TAMB 2OPSA 3L2VA 2O4IA 3TAQA 4YFUA 3MFHA 4DQSA 2P5OA 4C8KA 4PQUA 4E7HA 1LW2B 1J5OB 1GOAA 4FJJA 5JXSA 2OPRB 2ALZA 2DFFA 3HL8A 2ZQBA 1QE1B 2W42A 1HMVB 1S1XA 4CFDA 3OLAA 1R0AB 3S9HA 4FZYA 4PUOB 1JL2A 3MXMA 4M41A 3UQSA 3M9MB 5C5JA 3N6NA 4O0IA 3QIPB 4JUZA 2HNDA 4DL4A 1YTUA 4BE0A 3ZT2A 4IKAA 4FM1A 2BANA 4Y1CA 3VQEA 4NLQA 1SKWA 4HYKA 5E41A 4DFKA 2FVQA 1DTQA 1FK9B 3PVXA 2V9WA 3BSAA 5KFVA 4PWDA 2IDOA 4I2QB 4NYNA 4QWAA 1S1XB 1C6VA 1NJWA 4CIGA 3PW7A 5KFMA 4FW2A 4TQSA 1A5VA 4QWEA 3FFIB 4CE9A 4U6PA 3AVGA 2A1RA 2JLEA 4CJEA 3I8DA 3LDSA 3CJ4A 1SH3A 4TQRA 3OYEA 2AX1A 3DRPB 4DTNA 5KFZA 2BANB 3Q8QB 4WFXA 4DFJA 3O3HA 5C24B 3PUFA 4Q0BB 2B4JA 4DLGA 2WB4A 1YT3A 3DOKB 4ICLB 4B9TA 1ZBHA 5F8MA 4CJSA 4O0JA 1QSLA 3KKSA 3PO4A 3H98A 2W7OA 1IKWB 3V81B 2GC8A 4BDZA 2HNZB 3BR9A 4NLPA 4DL5A 2OH2A 3L2WA 2F8EX 3ITHA 5C42B 1FKPA 2P1JA 4CJWA 3LPTA 5KFNA 4MK8A 1HPZB 1TKZA 4AHUA 4FJHA 3KD1E 1C0UA 2BE2B 3DYAA 5C25A 2D3UA 4Y2AA 4DU1A 3BDPA 3V81A 4XPEA 3QLHA 4DSFA 3M8PA 1ASWA 1YVUA 1LV5A 4IG0A 4KFBA 2LSNA 3ULDA 4QW8A 1QTMA 4W5RA 3ZT1A 3DLKA 1WNSA 1EP4A 4DLEA 4Z4HA 4IR9A 3AO5A 2KZMA 4DQPA 4CK3A 2BDPA 2OA8A 3DLHA 3KK3A 1X9WA 1DTTB 3CJ0A 1VSJA 3KLEB 1S1VB 1ZTWA 1C2PA 1XR5A 4I2PB 3VQ4A 4IG0B 4F4XA 1KVCA 4EP4A 2IC3B 1GX5A 2GV9A 2P51A 4FVMA 4JLHA 4AHSA 4LSNB 4Z4GA 4OLAA 4FJ7A 1BQNA 4FK4A 3KLIB 4AHCA 4NLSA 3PX4A 4CHZA 5KTQA 1TL3B 1VSMA 3WNGA 4E7LA 4RW6A 1S1WA 5J2MA 2A1SA 4KKOB 3KJVA 1U45A 4U7CA 1UAXA 2ETJA 1DLOA 3LALA 1VSDA 2OPQB 4M42A 1HQEB 4PY5A 2Y1JA 1TVRB 2RKIA 2B5JA 5HP1B 2Q3SA 4CGDA 3PW4A 5HRNA 4O44B 4W5OA 2UUTA 3DOLB 4G1QA 2X6NA 4URGA 2XGQA 1IKVB 1D1UA 4URSA 4DMNA 1HNIA 4NLYA 3DMJB 1YTAA 1RT5A 1HNVA 2R2RA 1QQCA 2EX3A 1TAUA 3ZSOA 1I39A 1KFDA 3SCXA 3TARA 1HPZA 1TKZB 4IFYA 1RTDA 4KHUA 4QOZB 1SH0A 1Q9YA 3OHAA 4IDKB 4CK1A 4B9NA 1RNHA 2P5GA 3SUQA 4YR0A 3AO4A 2VA2A 1T03A 1RT4B 2EC0A 3I5BA 4OJRA 3TR8A 3NGIA 3HSTB 4YMEA 5DG7A 3OYLA 4Y2CA 1OS5A 3LANA 1ZYQA 4TN2A 3LP2A 3OYCA 1CXQA 4YP3A 4FLZA 4FLVA 3DRRA 2VG6A 3LP0A 1QAJA 3G86A 3OYAA 3T19A 4H4OB 2Z1IA 4FZXC 2ATQA 1EETB 1RYRA 2W9BA 4KHWA 2CKWA 1QSSA 5FROA 1A5XA 2O5DA 1GOCA 2VWKA 4CF8A 2W8LA 1NJZA 2XC9A 3PO5A 3KMSA 5KG3A 2E9TA 1WAJA 4ZTJA 4DTOA 4JRQA 3MEEA 4DU4A 2IC3A 3OYKA 1HQUA 3SNNA 2R8HA 4NLVA 3NF7A 4ZPBA 5I3UB 3FDSA 1NOZA 3NCIA 1DTTA 4ECWA 4KTQA 4F4WA 2C2RA 4HTUA 1ASUA 3FSIA 4KPYA 2IJFA 1JLEB 3PR5B 4OVLA 4IFVB 1BQMA 4DFMA 3AA2A 4FJMA 1S9EB 1IG9A 3NGYA 5J1EB 3HVTB 4CFCA 1RT2A 2ASJA 2JEFA 5DQGA 5DG9A 1BCMA 2VG7B 5HBMA 4B8AB 1BISA 4OLBA 3ZSRA 5F8JA 1RT1B 2IOCA 2R8KA 3HP6A 4QPXA 4O3OA 1NK6A 1W0HA 4HCCA 3AO3A 4CJLA 4F50A 2NUBA 3HXMA 4B3OB 4ED3A 4PWDB 1J9AA 1C0TB 1JKHB 1REVA 5K14A 3A2FA 4AILC 5FRNA 2RF2B 5KT5A 1N56A 4PQUB 2WCXA 3VQAA 3GV5B 2Y1IA 3KNAA 3IS9A 4CJ4A 1BIUA 3CWJA 2ILYA 1VRTB 1XR6A 5KGWA 4CF9A 4DG1A 2BRKA 2AWZA 1NOYA 3ISND 3QNNA 4ZP6A 3AA3A 4RNMA 3C6UB 3DOLA 4K4YA 3QIPA 1X9MA 4MIAA 2OPQA 1QAIA 1DLOB 4FK2A 1TKXA 3OS2A 1JKHA 4DQIA 3S3NA 3HPHA 3E51A 3NAHA 4CEFA 2FJXA 2PYLA 1RT1A 1LWCB 4FLTA 3ZSQA 4ECSA 3C6UA 3MAQA 3GIMA 1RTDB 4DL7A 3MR3A 4F3TA 1RT2B 2HNZA 2G8UA 3DM2B 4R5PB 1UWBA 4LSLA 4B9SA 4C8OA 4GC6A 2OPPA 1JL1A 4J9LA 3QYYA 4CIFA 2B43A 4TYBA 1ITGA 2XI2A 1WAFA 2C22A 3BJYA 1NJXA 2JC0A 4EO6A 4AH9A 2W8KA 1L5UA 1EX4A 3M9OB 4ZP8A 1S6PB 4FJIA 3LAMA 1XWLA 3KKRA 5HP1A 4QAGA 4CEQA 3QIDA 3HJFA 1NKEA 1TV6B 4W5NA 5KRSA 3HVWA 4Q5VA 1KLNA 2FVPA 3DLBA 1HYZA 1JLBB 4K50A 4EEYA 2YNFA 1S5JA 3CDUA 4WYLA 5KFIA 2V4RA 2IS3A 2RDJA 1SL2A 4N41A 5J1EA 2RDIA 1JLAA 1T05B 5KFJA 4CGJA 4O4RA 1S0OA 1JLQA 4CCHA 3NBPB 3RAQA 1QSYA 2OZSA 2AU0A 4NCGA 1HYSB 3SI8A 4CJ5A 1FKOB 5KG7A 1MMLA 4DTXA 3RMBA 2BGGA 2ZD1A 4R8UA 3TWHA 5KFEA 5KFGA 2Z1HA 4IFVA 3DM2A 3QZ7A 4KFBB 2B5JB 2QE5A 4WZQA 3C94A 4RW4B 2C28A 1NK4A 4IBNA 3NH2A 3LP1A 3QEVA 5CY4A 2JEJA 4O5BA 1WSFA 3JYTA 2R2UA 5KT7A 4B9UA 4JV1A 2JC1A 2UVWA 3KK3B 1S1TB 3RMAA 4ZPDA 4FK0A 1WSGA 4ED6A 3HYFA 1B9DA 1XR7A 3E01A 3IG1B 3KLHB 2G8IA 1N48A 4FXDA 4NLGA 3QO9A 4DSEA 5KFWA 2IAJA 4NCBA 3N6MA 4TSXA 5F9LA 5DQIA 1UA1A 4FLUA 1RBTA 1RTIA 5KFAA 3UDLA 4MFBA 3KIOA 4I7FA 1RCHA 3QERA 4ED1A 4B8CA 4TYAA 3H5YA 4Q0BA 1VSIA 3NH1A 4NCAA 4FYDA 3KJVB 4R0EA 2YKMA 1XC9A 4O3NA 1RDDA 4J2BA 3ZT0A 3OYGA 3BQ1A 3IS9B 1RT5B 1L3SA 1U04A 4N5SA 2ZD1B 1JLAB 2F8TA 3RB4A 2BR0A 4E1NA 3E01B 2FVRA 3NBPA 4Q43A 2PYJA 4DSJA 3BSNA 4JV2A 1X9SA 5KG0A 4J9NA 3HHKA 3V6KA 3ZSYA 4I2PA 4NLOA 2JGUA 3AVBA 3HK2A 3ITHB 1WSIA 2XGPA 4NRUA 4YR3A 3FFIA 3JYTB 4QWBA 3QETA 3PX0A 4ZHRA 3KK1B 1RT3B 4LSNA 1KTQA 4DQQA 3DRSB 1S10A 4DSKA 3NF6A 1ZBLA 3CQ8A 4KKOA 4M45A 3P83D 2E4LA 2HHQA 4RNNA 4ZVHA 1CZBA 1C1BB 3SPYA 2PY5A 3HVRA 3IAYA 2D3ZA 1RDCA 3V6HA 2J6UA 1VRTA 3VQ9A 3OSNA 3IG1A 1L3VA 4J2EA 1RT3A 4FZZA 3DI6A 1FXXA 5KT3A 3OS0A 3GYNA 5KG4A 2FBYA 3T5HA 1RDRA 4Z4IA 4H4MB 1CLQA 1NHUA 4W5TA 4OGCA 2G8KA 4QWDA 3B6PA 3KLVA 2RN2A 1S6QB 4O4GA 3K5LA 2XHBA 3RTVA 4O3SA 1LWEA 4Y1DA 3C6TB 2HB5A 3H4BA 2BQ3A 4G3IA 1WSHA 3CG7A 3RRHA 2V4QA 3ZSZA 3NAIA 1RTJA 3OYNA 1RBVA 4TY8A 3UIQA 2XY8A 1KSPA 3MEDB 1NK5A 1HQEA 5JUMA 4H8KA 5KG6A 3VA3A 3LP2B 4ELVA 3MXJA 3G6YA 4JV0A 2BQUA 4LSLB 4WFYA 1SUQA 4KHYA 4WXWA 3M9NB 2OPPB 4FS2A 4N56A 3PJWA 1B9FA 1Z26A 3FRZA 1RTHA 1J53A 4JS5A 5DG8A 4M3WA 3MEGB 4B3OA 4GMJB 1FKPB 3NDKA 1VSFA 4MKAA 3RR8A 1BCOA 2AGOA 4ZP7A 5F8GA 4J9SA 4ECTA 3M8RA 1S6PA 1I6JA 1Q8IA 2FBVA 4NLTA 5L1LA 3LP1B 2OPRA 4BE1A 1EKEA 4KSEB 4F4ZA 3L3UA 3SUOA 4CF1A 3DDKA 3K5MA 3V9WA 2YNHA 3OL6A 1X1PA 4EP5A 2G8FA 3LZIA 5KFKA 1LWEB 2E9ZA 3G6XA 3NMAA 4KRFA 5F8IA 2W7PA 3THVA 4R5PA 4B9MA 1NK8A 2KW4A 4OKKA 4KAZA 2ZKUA 3CDEA 3CJ3A 2PZSA 1O1WA 3O3FA 4DEZA 2AJQA 2YNHB 3EYZA 5T7BA 3MTKA 4W5QA 1T8EA 3TQ1A 4CGHA 1D0EA 1TK0A 3AV9A 2FJWA 3V4IA 3K59A 3OYJA 4F8RA 5KFCA 2B6AA 2FJVA 3WNFA 1RA7A 5J2NA 4F2SA 3MF5A 3H5XA 2HMIA 3SQ0A 4EO8A 3PW0A 4RW8B 4ZHRB 5FDLA 4G1QB 2VG6B 3LP0B 3SV4A 3OYFA 1JLEA 3ZSXA 3GIIA 2IAJB 4Z4CA 1UWBB 4IH7A 1GOBA 4K4XA 1BI4B 3AO1A 3EY1A 2HVIA 5KFTA 3V4IB 3BGRA 2R8JA 3EPGA 3K57A 4HKQA 4K4TA 3DLGA 3KLGB 3QGHA 4ED0A 4WZMA 1KCFA 4I2QA 3MEEB 3G6VA 3AVIA 4KB1A 1NK9A 4RU9A 1LW0B 3GV7B 2AQ4A 1S6QA 5T14A 3H40A 5HRRA 1L3TA 5KFUA 4OKEA 2WHOA 2FC0A 2AGQA 4XO0A 4HHTA 5HLFB 2WRMA 3KLFA 2DPJA 3HO1A 2WTFA 4CJQA 4BWJA 2X74A 4DG1B 4FJLA 3V9SA 1I3AA 4Y34A 2XWYA 3TANA 3C6TA 5KG5A 4AHRA 3O4NA 2W9AA 4B08A 2YNIA 2DFEA 1C0MA 1HMVA 5KFHA 4DTJA 4ZP9A 4RNOA 1VK0A 2ITGA 4MIBA 1S0NA 4OKJA 5EUHA 3ZSWA 3I0SA 1JLCA 3HM9A 3OYDA 4EZ9A 1S1VA 3AVLA 2KZZA 3GQCA 2E6LA 3AVNA 1SUQB 1RT7B 5KFDA 4NLDA 1VRUB 4HUFA 2VG5B 2HHWA 4FLYA 2IM0A 2F8SA 3QGGA 4IH5A 4MK9A 4KI4A 1T05A 3MR5A 4LD0A 1S9EA 4FJXA 5I42A 1IKVA 4ZVFA 4CHOA 4IRKA 1JLFA 1HNIB 4CFAA 5KFOA 2GUIA 5CZ1A 3U3GA 5F8HA 3PZPA 1TVRA 4IOBA 3AVJA 3KK1A 3SJJA 3V9UA 3KD5E 5J2NB 1JXEA 4CJPA 4KTZA 1S9FA 4CGGA 3CM6A 1BQNB 2IM2A 2V0NA 4CJ3A 3L8BA 4KAIA 4TLRA 2UVVA 1CZ9A 5C25B 4EBEA 1JIHA 4CEBA 4J9KA 4NYZA 4K4WA 3FQKA 4RW7B 3OYHA 1NKCA 4F3OA 4CEZA 5DLGA 3ALYA 2I5JA 3DLRA 4BWMA 4O44A 3S3OA 4TXSA 2F96A 4ELUA 3M8PB 3QEXA 3DOKA 1HJRA 4O55A 5KG1A 2VWJA 3I5AA 3QEPA 2FLLA 3RAXA 1TKTA 5DQHA 2R8IA 3OLBA 1HYSA 4Z4EA 1IKXA 3MR2A 3RB0A 1NJYA 4DTMA 3N6LA 4O3PA 1HARA 3OL7A 4KHRA 1EXQA 4RW8A 1W9HA 1ZETA 4DS5A 2QKBA 2XCPA 2YNGA 5D3GA 4PUOA 3TVKA 3PY8A 1C0UB 1N6QB 2J6SA 4JRPA 3ASMA 4M3RA 5F8LA 4CJUA 3MFIA 1MU2B 2FVCA 3NAEA 3NHGA 4M94A 5CZ2A 4HCBA 4CGFA 3QEIA 1TK5A 4ECXA 3SUNA 5C24A 2FLPA 2IM1A 3JSMA 4CF0A 1EP4B 2HNDB 1BQMB 5CYMA 3V6DB 2XO7A 2FLNA 2GIQA 3GV8B 4KB7A 4CHYA 2HHTA 4O3RA 1S4FA 2HMIB 1XI1A 3FQLA 1RTJB 2WOMA 4YNQA 2YKNA 1XHXA 4FLXA 1QHTA 5DMRA 4CERA 4LQ9A 3PR4A 3VN5A 1QE1A 4WXOA 4CK2A 2BRLA 4ED2A 3K58A 4L8RB 1SV5A 3QINA 4CECA 5EWGA 3Q8SB 4CESA 3AA4A 4H4MA 4J9QA 4MH8A 4FBUA 4ZPAA 3M8QA 5KFYA 3CIZA 4Z4FA 3OY9A 4F4YA 4CEOA 3KHHA 4DS4A 1NNDA 3ZT3A 2OZMA 5DGBA 5KFRA 4ZVEA 3K5OA 4IKFA 3DRRB 3VQ6A 3SQ4A 3EPIA 2AGPA 2YHBA 3Q8RB 3T5JA 4KO0A 4I9LA 4DF4A 4IG3A 4FJ8A 4FCYA 4FM0A 5FDLB 4RG8A 3LZJA 3OS1A 3CDWA 4TY9A 2WOMB 4KI6A 1N6QA 2YHAA 2X78A 1Q9XA 2ATLA 3OSPA 4RUCA 2XI3A 4EYHB 4YR2A 3NGZA 3P5JA 3AVKA 1K1QA 3BREA 4Q8EA 1TK8A 1RDBA 5L1KA 3K5NA 4TY8B 4AHTA 3L2QA 4B9LA 4CJFA 1MU2A 3AVAA 5KFLA 2I5JB 4FBTA 2WK4A 4KE5A 1YVFA 3IRXA 2D0CA 2EHGA 1B92A 2I1RA 4ED8A 2R8GA 3NGDA 4O3QA 4K4UA 4DL3A 1SL0A 1UOCA 3TABA 1JLGA 1TL1B 3KHRA 1K6YA 3CFRA 3OL9A 3CO9A 4ID5B 4IG3B 4AHVA 1IKXB 4CGIA 1ZBFA 1XHZA 1L3UA 5KFSA 3ISNC 3AVHA 3I5CA 1ZBIA 4ECZA 3F9KA 4I9QA 4EZ6A 4J2AA 4DFPA 3O4QA 2YNGB 5D3GB 4KB0A 4DF8A 4KHSA 4R8UB 2HHSA 1VSHA 4EYIB 3LWMA 3GILA 4KHNA 3OYBA 4RW9B 1D9DA 3KHGA 1RT6B 3VQPA 2ILZA 4LH5A 1VSEA 3PX6A 4M3YA 3T3FA 4ECRA 4CF2A 3SFGA 3VA0A 1IM4A 2ZE2B 2JEGA 4IDKA 4CFBA 3DI6B 1U48A 3D0PA 3H08A 4CIEA 3UPFA 1T03B 2QV6A 3QEWA 5CYQB 3VQSA 3HKWA 1KVAA 5J2QB 2RPIA 4E1MA 1KLMB 4FM2A 3CVKA 1IH7A 3H59A 4ICLA 4RZRA 2QKKA 5KFPA 4CHQA 2G8VA 4DTSA 3NFAA 4KHMA 3KLHA 4I7FB 1BIZA 5EWEA 2HW3A 4Q8FA 3AA5X 5KRTA 1A5WA 4ELTA 1JLFB 3EZ5A 4F2RA 4LH4A 3I0RA 3RBDA 3OL8A 5HRSA 5KGXA 3Q8PB 4CEDA 1KLMA 2IM3A 4C8LA 2O4GA 3QESA 4J9OA 3LPUA 4KREA 1S1TA 3KLIA 3PV8A 3B6OA 4FJ9A 2DTUA 2YNIB 1TV6A 4NZ0A 3QZ8A 4E7KA 4ZVGA 3KOAA 1KVBA 3GIKA 1U47A 3NF9A 2XY6A 2WONB 4FJNA 3MECA 5KFBA 1D9FA 3D45A 3BSOA 4H54A 1RT6A 3DRSA 2VA3A 2XY7A 3OJUA 3UR0A 1RT7A 4FW1A 2KFNA 2XCAA 3AVMA 5HLFA 2QK9A 4NCGB 4CJTA 1FKOA 3JSMB 4NLWA 1WN7A 3KTQA 4FJ5A 2UVRA 3V6JA 4K8ZA 5SZTA 3VQDA 3V1RA 1IKYA 4M3TA 4HVJA 4CEEA 1SKRA 1BL3A 5FRMA 3KK2B 2HWHA 3RMCA 3SI6A 4E7IA 1NHVA 4E89A 1KRPA 2XRIA 4B9VA 2IGIA 5L1IA 1JLGB 1TL1A 3RR7A 4RUAA 3QGIA 3OYMA 3L2RA 3CFPA 3RRGA 3WNEA 4J9RA 4KTWA 1K1SA 2HAIA 4E3SA 5JS2A 3AVFA 1ZTTA 3V9ZA 1DTQB 4NLRA 2D5RA 3RB6A 4MQ3A 3G10A 4Z0UA 3H2LA 4K4VA 1RBSA 1CSJA 2YV0X 1SKSA 4NLXA 4DTPA 3U3YA 3RMDA 3G0ZA 3HPGA 5CYQA 3L2UA 5I3UA 3SZ2A 4EBDA 4HUEA 1S1UB 2D7SA 3KHLA 3KLGA 1JXLA 3DRPA 4DTUA 4LQ3A 1SV5B 2YKNB 1REVB 4DL2A 3QNOA 2KTQA 2G8HA 3VQ8A 4OPKA 3IGVA 4QW9A 3TAMA 1T3NA 2R2SA 1LWFA 3HPOA 4X2BA 1LAWA 4IRCA 4BACA 3TI0A 3L3VA 2W9BB 4CHPA 4GW6A 4ZPCA 4ECYA 3LAKA 3VQBA 2AX0A 2D0BA 3H5UA 2VG7A 5HBMB 3SQ2A 1TGOA 3OVNA 2UVUA 3IGNA 1G15A 4J9MA 4DSIA 1LWCA 1JLBA 3PW2A 2IMWP 3ZCMA 1T94A 1LWFB 3HVAA 1BHLA 4C8NA 2R2TA 3BQ2A 5K14B 1TAQA 4IH6A 4QWCA 2RF2A 2IA6A 4GVMA 1TKDA 1KFSA 2DY4A 4KO0B 4XIUA 4KBIA 5KG2A 5EU7A 3C95A 3F73A 3TAEA 5L9XA 3I0RB 4ZMMA 5DK5A 1C1CB 4E19A 4IFYB 3MEGA 2CJQA 1FK9A 1EETA 2W9CA 2C2EA 3S3MA 3QIOA 3BQ0A 3DMJA 2GBZA 3RWUA 2QXFA 4NRTA 2ASDA 1JXBA 5J2QA 3OYIA 3DLEB 3VQ5A 3NF8A 4RW7A 1KHWA 4WYWA 4BDPA 3ZSVA 1RTHB 3OJSA 1S9GB 5EDWA 5F8NA 4EBCA 5DGAA 1TL3A 2ASLA 3LP3A 5L1JA 2IBKA 4RW6B 4RNHA 4UQGA 3KK2A 3DLGB 1HQUB 1S0MA 1HRHA 4J9PA 1S1UA 1ASVA 3BGRB 1Z4UA 1RBUA 4FJKA 2UUWA 3BSCA 3SUPA 4MKBA 2D41A 4NYFA 3AO2A 4KHQA 1RDAA 4DTRA 4ECVA 3D5MA 1BGXT 1W25A 1QUVA 3EZUA 4K4SA 1WSJA 3SPZA 4OL8A 4WE1A 4M95A 4MFBB 1TKTB 3KLFB 4NLUA 4E0DA 3V9XA 3ZT4A 1C1BA 4DSLA 1CXUA 3AVCA 4OPJA 5J2PA 3IN5A 1S97A 3VQQA
chains in the Genus database with same CATH superfamily
3QO9B 3CJ1A 4HEA9 1SL1A 2BJEA 3P1GA 1S6OA 4KPCA 1S77D 1G2EA 4JS4A 2FBXA 3HP9A 4QYRA 2CH5A 2DGTA 2E1PA 3GTYX 1H7XA 3P31A 4H4OA 4TLQA 1D3WA 5F1XA 1HNZF 5KT2A 1S4EA 1GX6A 3OW2M 1HR0J 3VVTA 2KM8B 1YG0A 3FBEA 3GR1A 1GAOA 2GQ2A 4B1XB 5HROB 3W64A 2HHUA 4DPUA 1RFQA 3NS7B 4M5MA 1O0PA 1TQLA 2V7YA 2HNYA 4WKYA 3FBBA 4H0YB 2R7YA 3TYTA 3W63A 4DQRA 1LAVA 1R8CA 4XPCA 3V1QA 2RNEA 4FL9A 1C1AA 2WBMA 2KG1A 3L3CA 2DO4A 4CJRA 3D6FB 3G25A 1VQ6S 4IOAQ 4BDYA 4USKA 1FESA 3V1OA 2KM8C 2AJ1A 1T9WA 4OIXA 2DEJA 4ZA1A 4WTOB 3HLUA 2VASA 3H4DA 3M8QB 4RW4A 1TR0A 2WZ1A 3M32B 4M5LA 2VG5A 5KPRA 4PA1A 4WFAQ 2GMJA 3EMTA 3SFUA 4YQWA 4CZCA 4B3MJ 2BJ7A 3O9UA 5DO2A 1RBRA 3ZZUA 3AODA 4OHVA 3K2PA 4IWVA 3H2VE 4C0HA 4DX8H 5EWFA 3QLHB 5JS1A 3SSQA 1R0AA 3HFVA 1RAJA 3EVWA 2AP6A 5BRFA 2HWIA 4MIWA 1KHVA 3MM6B 1X4HA 1WLJA 4N47A 1UPPA 2FVSA 2JLGA 4CJKA 3OTEA 4Q44A 2VPZB 3MAAB 1WNEA 4B3SJ 1T95A 3KJQB 2LQ8A 5HRPA 2ZJQQ 1VRUA 5DM7Q 4LF8F 1U09A 4I6WA 2B4UA 4EIAA 2KQ2A 4ZCMA 1FI4A 4K59A 4KV8A 1UA0A 2XLKA 5KFXA 5BPNA 2X7IA 4MKVA 4DV0F 2W2PP 5F9NA 4CLWA 2AF6A 4C3LA 2H3GX 1WB9A 1NB7A 3W5ZA 3OTDA 1F2GA 2HVEA 5HQ8A 1RB0A 2N3LA 2D0AA 1DJ0A 4IYQA 4H4KC 3VZIA 2A3ZA 4DUZF 2DNMA 4DU3A 4JI5F 3GFYA 3MR6A 5DLFA 3TP2A 2XS7A 3PW5A 1G4CA 1CJVB 1R89A 1FWPA 3H3NO 3TA2A 3MM9A 3ENHA 4E98A 4XH4A 1NGGA 3RBEA 4ZTFA 4K4ZA 1SC6A 2W9CB 2DNLA 3CDAA 3J7ZT 1YJNS 3SDEB 2OPSA 4WF9Q 2E5IA 4HACA 3TAQA 2P5OA 2MHEA 1GOAA 1U1LA 3EGVA 1ZBTA 4ENOA 3HL8A 2ZQBA 2VU5A 4JI6F 2W42A 4FPRA 1KQSM 4USMA 1FJGF 4BR0A 2RMLA 1S1XA 4KH4A 4PUOB 4XTTA 3NS5A 5A8RB 1BA1A 3M9MB 4RO0A 2ADCA 3PSFA 1KONA 4JUZA 1QQOA 2RSQA 3OA9A 3OUYB 4FM1A 2WW4A 3NGUA 3D6HB 1SKWA 4ZVRB 2FVQA 3UNYA 1HHTP 2IDOA 2VICA 3W3SA 3MI7X 4NYNA 2WSFC 4EMDA 4QWAA 3C0BA 1C6VA 1NJWA 4YHHK 3SAGA 4OV6A 2B56A 4X66F 5C10A 3N4WA 4ES1A 4TQSA 1VGYA 4OLOA 4F7VA 1TFWA 2NUHA 3GFZA 3FFIB 3CCLS 1HNXF 4X4SA 2POKA 3B54A 2HIQA 1SH3A 2UXCK 4BC9A 2BANB 2P8IA 4WFXA 4LF5F 5IC4B 3RBZA 4TU9A 4JKAA 2B4JA 4L76A 3BB5A 4LRBA 4YHHJ 4ETZA 1YT3A 3R5DA 5CR4A 2IDEA 1QLNA 1ZBHA 1QSLA 3KKSA 1IKWB 2O66A 1P1TA 1PYSB 4DL5A 2ZDOA 3L2WA 1OYEA 2A2DA 3JSRA 5C42B 4FDFA 4PXDA 4CJWA 1W7AA 4LMZA 4XEIA 5KFNA 2UXBK 3VGKA 4MK8A 1LOUA 5AZIB 1HPZB 1TKZA 2VF3A 3KJNB 4P7VA 2BE2B 3W3DA 5C25A 4Y2AA 4DU1A 4EHUA 3V81A 1YVUA 3ULDA 3TTCA 3S6EA 5EX3A 5DDOC 1EP4A 1RTZA 4GKKK 4Z4HA 2RQCA 4IR9A 2O8DB 2GZOA 2K8GA 3AO5A 3HHDA 4M5DB 1FCAA 1RHQB 2HHHF 2BDPA 2OA8A 1HBMA 1WC3A 2BTFA 2CRLA 1Q5YA 1DTTB 2UUAF 2C2OB 3KLEB 3R1LA 1XR5A 1NLVA 1S79A 4F4XA 4EP4A 1WHWA 2GV9A 4X62K 2P51A 3QSYB 5AQMA 3MEKA 3VF2A 4OLAA 4RBTA 4CHZA 2QFJA 1TL3B 2J8SA 5LMUK 2QLWA 3KJVA 1U45A 2E5LK 4H5TA 5E2QA 4U7CA 4OFZA 2ETJA 1VSDA 4C1NK 1U1MA 3KXDA 1TVRB 4H0XB 2RKIA 1RWOB 3GG0A 2NXCA 2QIFA 1TMJA 1FA0A 5HRNA 2UUTA 4HR2A 1D1UA 4DV7F 4UY85 5HMZA 2GO8A 3DMJB 5CXTA 1YTAA 5EHHA 4CVNE 4B1ZA 5H1SV 4MDAA 2R2RA 1QQCA 2EX3A 1NGHA 3A8JA 4CH7A 1RAOA 2DCLA 1HPZA 1TKZB 1PSDA 2J7WA 3HD2A 1Q86T 4KHUA 3ZC4A 4A2AA 2A40A 4EWTA 5AQIA 3R5BA 2IVOA 2UUCK 1Q7LB 1RNHA 5LXYA 3O8MA 1AROP 2VA2A 1T03A 4BVPA 3TUIC 3OYLA 4Y2CA 3LANA 5JICA 3S41A 1QAJA 1UVKA 1JJ2R 1YTYA 2AP1A 4DR5K 2DTJA 2Z1IA 4FZXC 3K9JA 1RYRA 3CJTA 2W9BA 2L08A 2CKWA 4ZVPB 2GIFA 1XNRJ 2VWKA 3G4SN 4KH6A 4BRIA 1NJZA 4JKFA 3PO5A 3D2EB 3KMSA 5KG3A 2E9TA 1R8BA 3ATVA 1WKJA 3CCLN 5A76A 5A8KB 3EXCX 3CCWA 2NREA 3LM2A 4U7UD 1OVYA 5I3UB 1MROA 3FDSA 1NOZA 4M5KA 3HHLA 2G4BA 3GLJA 4B9QA 4F4WA 1OPIA 5B09A 3GFXA 1VBXA 5BR8K 3FSIA 2MGZA 4DFMA 1PBAA 3DDNA 1IG9A 1U2FA 4WU2A 4CFCA 5DQGA 1BCMA 2WSEC 2KKZA 3IP0A 4B8AB 4OLBA 3P5TL 3ZSRA 4O5FA 3I33A 1DZ5A 1RT1B 2XZWA 3ONQA 2IOCA 3HP6A 4QPXA 3CCTA 4FZVA 1NK6A 4ZIVA 4Z2XA 2E1YA 3K17A 3ZTOA 4F50A 4NA3A 4B3TF 4B3OB 1UVNA 1J9AA 1C0TB 2Z58B 1JKHB 1REVA 4CZMA 4AILC 4OI3A 2DBBA 5KT5A 4LFBF 4I4BA 1NAQA 1X31C 3MMCA 3A8KA 1SJ1A 6FDRA 1NBWA 4KY3A 2W6KA 3CCVN 1AB8A 1VRTB 1XR6A 1HNXK 3FCHA 2QLBB 1RABB 1X4EA 3A1YG 3LM9A 3ISND 1SKUB 4BC5A 4RNMA 4PL7A 2FSNA 4A8XA 5DZ6A 1HPMA 2QX0A 3Q89A 2L48A 2VC0A 2OMLA 5HOOA 1QAIA 1DLOB 4FK2A 1RXOB 3RSEA 2ZDPA 3S3NA 1IBMK 3HPHA 2N7CA 3WIVA 5IM0A 3E51A 1N5VA 2FJXA 1TUGB 3NEKA 4X62F 3OBYA 5EOYA 4NMXA 3MR3A 2HNZA 1VQLS 3DM2B 3VHQA 2ZC3A 2F63A 4A5BA 4C8OA 2J9EA 2YKOA 1JL1A 4TNOA 3H1QA 4NXMF 4TYBA 1VMBA 3FSYA 2HIYA 4B3RF 3GL1A 1R6VA 3SCLE 1KOHA 2YWEA 3WHIA 1QVFR 1Y5LB 3IBFB 2V8DA 1WORA 3RVCA 3QT5A 1XMQJ 2XMAA 2V94A 1BOTO 4DV1K 2R7OA 1LQ9A 1VQ8N 5KRSA 4MO4A 2YKAA 4Q5VA 1KLNA 2FVPA 3AA8A 3DLBA 4K50A 2YNFA 3CDUA 3PKYA 2V4RA 2IS3A 2I7PA 2DNNA 4LRAA 2RDJA 2PN6A 4WK3A 1QZ6A 2GEMA 3ZZTA 5KFJA 3AOBA 2EK6A 3T1HF 2FJDB 4DR1K 2QMWA 3MAAA 1QSYA 2OZSA 3FUYA 4NCGA 1HYSB 1V3RA 3ZZZA 2X51A 2D4WA 4DTXA 2UU9J 2ZD1A 3ISZA 2IVFB 4FOIA 1Q7YO 4IFVA 4YOUA 3BF3A 4PPDA 3D7EO 3C94A 2C28A 5GAGP 3NH2A 4NXNJ 2MQQA 5CY4A 1S0VA 4P10A 3SBGA 3JYTA 2R2UA 1V5VA 1LXNA 3LTOA 5IT4A 4JV1A 2JC1A 2UVWA 3KK3B 4ZPDA 1I94F 3CC2S 3JS6A 3AH6A 4C11A 1WSGA 2C2KB 1PBUA 3HYFA 4CLYA 3E01A 4AYBD 1FRJA 3GG4A 1RHKB 4FXDA 4NLGA 3VZHA 1IR2A 3TJ9A 2X1FA 5HL7Q 2IAJA 4NCBA 5BYRA 5F9LA 1UA1A 3CULA 3C19A 2ALYB 5LSOA 1OH7A 1VYAA 1H0HB 1RTIA 2HZCA 5KFAA 1WG1A 3UDLA 4YEAA 1JWWA 2HRTA 2DR9A 4TYAA 3H5YA 4Q0BA 1XQSC 1VSIA 3CHWA 3LDOA 3NH1A 4ES3A 4R0EA 4O3NA 1NJIT 3IS9B 4OPAA 4KH5A 1U04A 2EFNA 3B8HA 4BC4A 5ETOA 3EICA 1T6DA 1WDDA 2PYJA 3QB0A 4G9ZA 1X9SA 5KG0A 3U02A 1IUJA 3GIRA 3V6KA 5AXMA 2MEWA 1C0GA 1WSIA 1KQKA 5E3PA 4C98A 4YR3A 3FFIA 3L09A 3CCVS 1U8WA 1Y3JA 2W2QP 3FZHA 1UZHA 3GJRB 5IT9U 1NJIO 1OH6A 2XSFA 4Y2KA 4LSNA 1SJQA 1Y7PA 3DRSB 1S10A 4GVLA 4WFAL 1SQKA 4MTPA 3W60A 1IBMJ 3BZKA 4KKOA 2E4LA 4JD2A 2CJBA 4DUZK 4ZVHA 3MUMP 3SPYA 3HVRA 3BN7A 3V6HA 2QC3A 4FYVB 5KT3A 3OS0A 5KG4A 3JXOA 1RDRA 2MLXA 4ZJOA 1DHMA 4P2FA 4HDGA 4C9DA 4NE9C 3KLVA 2KT5A 1S6QB 2RN2A 3D6MB 3DDIA 2R42A 2VOPA 1ZA1B 3BEXA 2AEJA 5DDRC 2HB5A 3H4BA 2BQ3A 1IQZA 2NYHA 3CIMA 2CGKA 4PG4A 4DR2J 1RTJA 3M05A 2PD1A 1HWKA 1GNKA 3WT0A 3UIQA 3C16B 3MEDB 1HQEA 5JUMA 1GMWA 4DUTA 3O08A 4H8KA 5KG6A 2PDAA 3SQGB 3CQYA 3QT8A 4JKGB 2BACA 3G6YA 4CLLA 4JEPA 4LSLB 3O9QA 3V4MA 5GAEI 1SUQA 3OFFA 2DNHA 4OZLA 4WCEQ 2E2NA 4J8FA 2CH6A 1RKIA 2LXIA 2NRRA 4C0BA 5DZ7A 1VFJA 1T9XA 4Q7AA 4JS5A 5CCLA 5BYQA 1DEJA 1X0FA 4B3OA 4GMJB 2F4VK 1BWVA 4IZ9A 2FY8A 2HS3A 2OFHX 3CD5A 4MKAA 4ZP7A 2V4JA 2PMWA 3D9BA 1I6JA 4CWBA 5L1LA 3T7ZA 1K8KA 2QA2A 2DISA 3R6GB 3SUOA 1QVGM 2YNHA 1X1PA 3T1HK 4OJ1A 2QLXA 3I31A 3ILOA 1LWEB 2E9ZA 4BS2A 3HZGA 3G6XA 4DHYA 4KRFA 1B4SA 2W7PA 3THVA 4DB3A 1NK8A 2BBEA 3OPKA 1K44A 2HBZB 1YZ6A 2ZKTA 3O3FA 2DJWA 3EYZA 4JI3F 3CMAN 4IUFA 4V19X 3UDVA 1T8EA 3F9MA 1QQNA 3V4IA 2GELA 3MDQA 3OYJA 1FJGK 2ZM6J 2FJVA 2HURA 1FWKA 1RA7A 5J2NA 4F2SA 4OYBA 5C2FA 4LF4J 4B02A 2E5LF 3SQ0A 4EO8A 1FFWB 4U95A 2Q6BA 5D0RA 4DV2J 1WACA 2V7ZA 2HVZA 1N32F 3QDKA 3OYFA 1JLEA 1MWYA 5IWAJ 4H03B 5D4OA 2F5GA 3GIIA 2IYGA 1UWBB 1OIAA 1BI4B 1KTVA 2KU7A 2HHHK 1H1VA 2DRBA 4DZDA 4P7TA 2E66A 3KHYA 3AXMA 4D3GA 4HKQA 2ZJRL 4DV5K 4DR5F 1HKCA 2EKNA 4I2QA 3VEXA 4DL0C 4RU9A 3GV7B 2OLWA 4IO9L 4JP8A 3H40A 3O9SA 4DR4J 1G6BA 1UCNA 3QFUA 1NU4A 2WHOA 4XO0A 4I68A 4A8KA 1GLBG 3VESA 1WHVA 4HHTA 1NDPA 1SB6A 4CH1A 1YUWA 3KLFA 3HO1A 4CJQA 2ERRA 3HSJA 2A6AA 2HFUA 1RSCA 1VIOA 3G2XA 2XWYA 3C6TA 4LFCJ 2CQBA 4EAHD 1JJHA 4B3TK 4ZP9A 1VK0A 4QS8A 3CUNA 2QN6B 2E1CA 4OKJA 3D7SB 5EUHA 3HM9A 3OYDA 1M1KT 2W24A 2MJUA 2PA8D 4H5RA 3AVNA 3VAJA 1RT7B 3DGPB 5KFDA 3AOAA 1VRUB 2HVDA 2VG5B 3A4TA 2AYBA 2HHWA 1RGIA 5JVHL 1OMSA 4AL6A 3S01A 4M5HA 5K5MA 1T05A 3MR5A 1XBWA 1ZH5A 2NLXA 2RQKA 1D4XA 4IRKA 1JLFA 3CIPA 2GUIA 3LH2S 4B1YB 1KD1O 3MD3A 1DT9A 2LYVA 3PZPA 3CO0P 1YGYA 3W8GA 4ZVQB 3V9UA 5FLXU 1NU0A 4ZJLA 4NO7A 3MDFA 4TKTA 1BQNB 3CM6A 2IM2A 2HMPA 3QICA 5HATA 4FKYA 2ZBQA 4TLRA 2HZVA 2O8BA 3ZX3A 1JIHA 2C3YA 4PYAA 3ZEUB 5MLCV 2ZWPA 5M2RA 5FLXO 1YAGA 1GMUA 1JNZB 2W41A 4HTJA 3ALYA 4QS9A 3LDLA 2I5JA 3MM9B 2H5EA 4O44A 2JNJA 3S3OA 2F96A 4ELUA 4WBFA 3EGZA 1HD1A 5KG1A 2VWJA 4ZLNA 2FLLA 3SBTA 4C8YA 2QWPA 3IWXA 4R79A 4L75A 2VPYB 1NJYA 5A2QU 4O3PA 1IWAA 2HQIA 1EXQA 2MZTA 2QKBA 3J81U 5D3GA 4PUOA 1C0UB 1N6QB 4JRPA 2Z2LA 1VQOS 3C3LA 3W5YA 1EJ7L 3UN3A 5F8LA 4ZLJA 1MU2B 4F0KA 1NZAA 4AL7A 4X65J 3C6HA 4KQZA 3CD7A 5CZ2A 4F0HA 3ZTRA 4ECXA 1XNQF 2IM1A 4CF0A 1NMDA 1EP4B 2HNDB 3GR0A 1BHNA 4KB7A 1CS4B 3HF5A 2HRUA 4DV5J 1S4FA 4KR0B 3FEYB 4CZJA 3KJFB 1PILA 2FHKA 4L73A 2KJWA 1OVQA 1KD1T 3PR4A 1LOTB 2D3OR 3VN5A 3E66A 1WHXA 4CK2A 2YXLA 2BRLA 4ED2A 2JZ5A 5IXUA 1UFKA 4PXCA 2KFYA 2VJVA 4CZEA 1RACB 4ZPAA 3EZWA 5DS7A 3M8QA 4LC9B 2CYYA 2ZH8A 3DN9A 4F4YA 3KKFA 2FB0A 1CJVA 2HKEA 2G0IA 2NCKL 1TL5A 4PKIA 4ZVEA 3K5OA 1ZZFA 3BGOP 4IKFA 3DRRB 2KRRA 2AGPA 2OKQA 4X4TA 3EEQA 1U25A 2L9WA 2DH9A 3Q8RB 3T5JA 4KO0A 2O8CB 4DF4A 2R7UA 4CZKA 4FCYA 2F9JA 3ILLA 5EX0A 2W2MP 3NLCA 1IQTA 4KGKA 4DPWA 4CW7B 3J80Y 4YB1P 3UKUB 4YDUC 3W0LA 4N8NA 2WOMB 1F9HA 4PG6A 3CPWR 2KI2A 4RUCA 2XI3A 1N52B 3M8ZA 3CJCA 5C2CA 1SJRA 3OUYA 3AVKA 3SK3A 1K8KB 5L1KA 3L2QA 4ILLA 4B9LA 3R1XA 3AVAA 5HMXA 2R7SA 2WK4A 4KE5A 1YVFA 3IRXA 3AJ2A 2D0CA 2UZAA 2OFGX 3ETOA 4O8UA 4DV6F 1SL0A 1UOCA 2CGLA 3CCSS 1JLGA 4ZITA 3DRYA 2GW8A 4IG3B 3UE2A 4CGIA 2MZRA 1A9NB 4A2BA 1XHZA 5K9FA 5AE1A 5E7OB 4NA1A 5CHCB 4EZ6A 2XM3A 2HLTA 2FLOA 1YVNA 1P27B 4A47A 3VMFB 2GVDA 1PYTA 2XQCA 4OYIA 4CLFA 2HQFA 3W5XA 1P8GA 5D78A 4IXCA 4F36A 3OYBA 1K73T 4RW9B 3GE1A 4BY9C 3PKMA 3M2UB 3N0VA 3PX6A 4ECRA 4WWSA 4JYAJ 3LW5C 1VJQA 2CGJA 1IM4A 1EQ0A 4P9SA 4CTAB 2PEHA 1LK5A 2CPHA 1U48A 3O1WA 2O67A 3H08A 3UPFA 4WQ5C 1ZOTA 1E6VA 4PEOA 4NPOA 3NMRA 2D0OA 3L0QA 2NXUA 2F9TA 1KLMB 2BE9B 4ZN1A 4J90A 3PIPL 4O23A 4ICLA 4OHYA 4CHQA 3KLHA 1KDNA 1KN6A 2QMXA 3RRKA 3AA5X 5KRTA 4QIEA 1JLFB 2BABA 1NGAA 5AQGA 3QWPA 1R59O 2ZBCA 2HGMA 2APOA 1AW0A 1RLCL 4BRMA 2G2ZA 3UNGC 4C8LA 1ZXOA 2O4GA 4J9OA 5LMNJ 2QTDA 3VTIA 3CSKA 3QZ8A 3KOAA 2RHSB 4C3MA 4FJNA 1N36F 4WCEL 2F4FA 2V9KA 2XY7A 2YKQA 1VQPN 3W7BA 1SC1B 2N82B 4JKCA 4FW1A 1VLYA 3B4DA 2H5JB 5HLFA 4CJTA 1XN9A 5AR0A 3VR1A 4UZBA 3O9TA 1EZZB 2H51B 2Q79A 5FRMA 3RMCA 4E7IA 3NG8A 1NHVA 1GMVA 2XRIA 3G96A 3L7UA 5CZXA 2FHOB 1Y5IB 8ATCB 1QZ5A 3MURP 3RR7A 1NGJA 3O8WA 3WC0A 3OYMA 3CFPA 3RRGA 3WNEA 3N5FA 3LF0A 2LA6A 5T7LA 4J9RA 1RWPB 2HAIA 5JS2A 4C3KA 3V9ZA 1Q79A 2DO0A 1X60A 4FO0A 4NXNK 3H2LA 4O0NA 2MLZA 2HS0A 5CYQA 1VQ5N 3SZ2A 1YJ9S 3JQJA 4DXLA 4MJKA 3UD4P 1S1UB 2NZCA 2BM1A 3TU5A 1TU0B 3AD9C 2ZH7A 4DTUA 4KYZA 4LF6F 1REVB 3R8EA 3VQ8A 5AQXA 2R7RA 3TEGA 3TAMA 1LAWA 4IRCA 5CA5A 2FSJA 3L3VA 4CHPA 1IR1A 4GW6A 5D77A 2ZZMA 5AJ3J 2AX0A 2G1HA 3H5UA 2P9IB 1F0XA 2NUUG 4DMZA 5LXRA 3HRGA 4ER8A 4W92B 3OVNA 2UVUA 3IGNA 3R9PA 1SQEA 2ZH3A 4J9MA 3CD0A 4FSVA 3PW2A 4BR5A 3ZCMA 1TMMA 4X4QA 1LWFB 4OZ3A 5KOWA 3BQ2A 2ASOA 4LR7A 1ZS6A 4ATNA 4CP5A 3J7YI 4IH6A 4ZK7M 2RF2A 3O2IA 3THWA 3QPIA 4KBIA 5EU7A 3C95A 3W9HA 1U2VB 1WKKA 2G9OA 5L9XA 4ZMMA 3EM1A 5D0EA 4JKEA 5DK5A 2OELA 3PRBA 4IFYB 2HAFA 2V51B 2W9CA 1XJWB 4PG7A 3BQ0A 3GYXB 1YJWN 3QATA 2HFSA 2ASDA 5LMNK 3OYIA 2MXYA 4MLHA 3D0IE 2QM1A 5GINA 3OJSA 3N4PA 4PL8A 1DAXA 2VPWB 2E1RA 5FPDA 4EBCA 1TL3A 1QQMA 4RW6B 3DLGB 1AZSB 1S0MA 3KG4A 2MSSA 2UXCJ 3BGRB 5D4LA 3N4QA 2PFDA 1BE4A 3AO2A 1VQ7S 3SAFA 4KHQA 4DTRA 4ECVA 2KG0A 3M1VB 1QUVA 4JI1F 3NXZA 4Q2LA 2A42A 1RQ0A 4WE1A 2KRBA 4NLUA 2HBRB 3ZT4A 3V9XA 3DKDA 4RPFA 5GIOA 4PCQA 1CS4A 3AVCA 3QGPA 2FIUA 1KAZA 4AFFA 5J2PA 3VQQA 2W4DA 4GY2B 2NR0A 2FHMA 5LMUJ 2Z56B 1KQSR 4FOEA 4KV8B 3M6VA 3N79A 4AXIA 4G1IA 2X6SA 4RJVA 3WNHA 3NKYA 5KT6A 3AAQA 3BDEA 2J6TA 2B8PA 3ULEB 3TPQA 2J0WA 4JI4J 1VQ4N 3U6FA 4DR3J 1WEXA 4QU7A 1RT4A 1HFEL 5A8WA 1J54A 4F4KA 3CCUS 1RILA 4M7XA 4CYUA 3HSZA 1GLCG 3TQEA 2JRSA 2GX9A 5GAGI 2GWKA 4M5GA 2KXFA 3CJKB 2N3OA 5GAHI 3PHTA 1YXQA 5ETNA 3EZOA 2GIRA 2V2KA 3THXA 3BZQA 1T7PA 4LRDA 4CJVA 4NZ6A 1NSQA 2UUCJ 2QSFA 3EDRB 4ZN3A 1U49A 2D9OA 4PQAA 2HHXA 1S48A 3I82A 2H1YA 2KHDA 2WONA 1CJUA 1VQ9S 2CG8A 4DUYJ 3MECB 3D28A 4GKJJ 3A13A 1C1CA 3GOIA 3MPVA 2CZ4A 3I0SB 1C0TA 3VV2B 3W65A 3BN4A 1Z25A 3RB3A 3BGUA 4IQXA 4KGVB 2YTCA 4DV0K 2ZWOA 4PWUA 3WX4A 1LW2A 1S9GA 1RAHB 3G82A 3KMQA 2L3MA 3PACA 1HW8A 2G1DA 2FBTA 5HMWA 4PYDA 3HT3A 1IO2A 4LFAF 2G0JA 2YWWA 4EGLA 2Z1JA 1G1XA 1NK0A 3MEDA 3IDHA 1FVQA 2GVDB 1VAZA 1IXKA 3BBBA 3G8QA 3FMWA 4JI0F 4CNZA 3R1HA 1JMTA 5H9EJ 1HNZK 2QA1A 5A2QY 4JI7J 1JLQB 4FJGA 1NPRA 1OQ3A 5FLXY 5M1FA 2IIRA 4N76A 2RILA 3D2WA 4O4GB 4XDDA 4F4AA 1HLUA 4CEAA 2ZH6A 3UN2A 3CFOA 1WSEA 1IKWA 1CG2A 2L9DA 2ZOFA 3MM8B 2DXFA 2MHNA 2BKNA 3BYPA 2YHYA 1K47A 2Z2ZA 3DLKB 5BXIA 2HZAA 3UDEA 2FGOA 2EKYA 3OTCA 2Y8WA 3M8SA 2FZCB 3J7A1 3BF4A 2E9RX 1UEKA 3T1AA 3VQ7A 3MXIA 5MAOA 2CQ1A 4DL6A 3VF6A 1P9QC 1Q0NA 4V19S 5F0WA 3GYGA 3L2VA 1MWQA 3MFHA 4DQSA 5KQ8A 2KJVA 4E7HA 1LW2B 1KEKA 2X3GA 3HT0A 3THPA 2OPRB 2O8EA 4QYZJ 2ALZA 2DFFA 1MROB 3F0NA 4AXJA 4JI2F 3GJSB 4ZPVR 1CBKA 1JL2A 4A8QA 1N34F 4M41A 3UQSA 3TUZC 1S12A 4O0IA 3QIPB 4DL4A 1UFWA 2IRXA 2BEFA 4BE0A 3ZT2A 3EJMA 5LL6Z 4HYKA 4A48A 1CEZA 3ILIA 2ZH9A 1FK9B 1NEEA 3BSAA 5KFVA 4I2QB 1VHIA 1S1XB 2JWKA 1J2VA 1AYEA 4CIGA 2GO9A 1IV0A 1N5QA 4FW2A 1MDUB 2NLWA 4CE9A 1ESVA 5JMVA 4CJEA 1UJ6A 4TQRA 4Y00A 2J9DE 4BQLA 3Q8QB 2UXBF 3TOQA 4DFJA 1RI7A 3AJDA 1HBMB 2GQCA 2DRAA 1S7HA 5T7LB 1HWJA 1XMOF 4OYOA 5AE2A 5F8MA 3TSQA 4IQMA 1P9YA 2BOPA 5IS2A 2WVEA 5HJYA 2J4RA 3BR9A 4NLPA 4OPHA 1GXTA 2QXLA 4DV4F 2F8EX 3OXFA 1FXDA 3AD7C 2P1JA 5CQGA 4CT8A 2HQDA 3KD1E 1EIYB 3DYAA 4LBIA 2MKJA 2XMWA 3WXJA 5AQRA 1ASWA 1LV5A 4IG0A 2H9ZA 2B4OA 4QW8A 3HKZD 1IJJA 3VEOA 2E2PA 1HBNB 1WNSA 3PCOB 2HBLA 2UUBJ 4K25A 1H73A 2KZMA 4DQPA 4CK3A 4QIVA 3DLHA 3LPEA 2CNOB 3CC4N 5JMNA 1ZTWA 1C2PA 1VQKS 1F9EB 4DPOA 2ROPA 3OR1B 2FZGB 3W9IA 1VQ5S 1KVCA 4FYYB 2YX6A 4AHSA 4BBYA 4Z4GA 4FJ7A 1BQNA 4FK4A 3KLIB 3VGSA 1G99A 5KTQA 2MZ1A 5F41A 2B9YA 3PIPQ 3WNGA 1S1WA 5AQNA 3HD1A 4AF1A 1N33J 2A1SA 4CO5A 2BJDA 3PIOL 2OPQB 2LQ5A 1R8HA 2QWLA 2QL9B 3PW4A 4O44B 2RQMA 2RJZA 4DR7J 1GH8A 3BKUA 2XGQA 2QLJB 3W8PA 1M90O 4URSA 3I56S 2HFZA 1RT5A 2AYEA 4GKKF 3ZSOA 3MPYA 1KFDA 4YY3K 1R27B 4C11B 4IDKB 3HHLC 4DV3K 3FSXA 3Q8VA 4CK1A 4WPAA 3EO3A 2P5GA 3SXLA 1RT4B 4EFAC 4LF9F 3I5BA 3NGIA 4MDBA 5BR8J 3HSTB 2YVSA 2R7XA 2NZ4A 1OS5A 3DCAA 3UKRA 4TN2A 3LP2A 4CYUB 3OYCA 2A6MA 3DRRA 2VG6A 3G86A 3OYAA 4Z94A 3T19A 2B9EA 1HWLA 4GV6A 1YITN 2C3MA 1WWHA 5BREA 2P9PB 2D0PA 4KHWA 3NY0A 3WQTA 1RHUB 3THXB 1N54B 5HK4A 3FGUA 4D3HA 2CAJA 3M2RA 5D4PA 4OYMA 2FDNA 4YDUA 4FF4A 2XC9A 5B0AA 3VEYA 2HPUA 1WAJA 1NH8A 1T9UA 3P49B 2A41A 1X5OA 1NGEA 2IC3A 4KT0C 2XBPA 1E6YA 3D6TB 1GLAG 1NHKL 4ZPBA 1WOOA 4KTQA 2C2RA 4DV1F 3TSUA 2IJFA 3CCMS 2HBMA 4RR5A 3A3NB 2FJBB 3AA2A 4FJMA 5M1OA 4OJ3A 3NGYA 3ULEA 1RT2A 2ASJA 1YKWA 1NGCA 2VG7B 5HBMA 3O44A 1JCFA 3PEHA 4NB4A 3LUYA 4HCCA 3WXIA 3HXMA 3DLLQ 2OAUA 2DNKA 3D3CJ 4ED3A 3ENOA 1Q7YT 4YDDB 3A2FA 1IG8A 2Q0UA 5F0UA 1N56A 2VQFF 3VQAA 3GV5B 2V2QA 3HCXA 2Y1IA 4CJ4A 1BIUA 3CWJA 4F0MA 3TA1A 1IBLJ 4LFCK 2OI2A 4IOCQ 4OZNA 5A8RA 3DNCA 4ZP6A 2H5IB 2LQJA 3CC4S 4C1NI 1R8AA 2BV3A 3K2YA 1JKHA 4LF7K 2VONA 2W2NP 1RAGB 1H2VZ 4PKDB 2XMTA 4NI2B 2NXJA 2UXDJ 1FD2A 1LWCB 1YJWS 1DURA 3C6UA 3GIMA 4F3TA 1SPBP 1RT2B 3VETA 4PABA 2B9XA 3SMZA 1WUAA 1BA0A 4LSLA 5JVHQ 3K5PA 4AM7A 1UVIA 5ELZA 4WTYA 3R8YA 1FERA 2IA0A 1WAFA 4BC2A 3SQOP 4DI6A 2C22A 1IBCB 2ASMA 2XMUA 2JC0A 3DWLA 2W8KA 1L5UA 2RRBA 1GXUA 3LAMA 1XWLA 5HP1A 3US5A 1NKEA 4OYWA 4DR2K 3OVBA 3OT9A 2BYCA 1RBOB 1IR0A 4U67L 1JLBB 3CTRA 4ZVUB 1IJFB 5KFIA 4BRQA 1CZAN 4YOTA 2KDOA 2VV5A 3ENQA 3MD1A 4N41A 2P6TA 3CQXA 3CC7S 1TUYA 4O4RA 2MB0B 3DXSX 3NBPB 3RAQA 2MKIA 2BXJA 2AU0A 1ZPWX 4PAAA 2RB7A 2XMJA 3NVKA 3FRYA 4LUBA 5KFEA 2Z1HA 2QT7A 3K89A 5AQWA 4PXBA 2QE5A 4ZCIA 4WZQA 3O6QA 2ZBPA 2NRWA 1NK4A 1X7VA 4E2FB 1S99A 4QJVA 4PG5A 2KB2A 4GRSA 3QEVA 4GV3A 3DXKB 4O5BA 1WI8A 3H45C 2GUPA 2JFDA 3VEVA 3RMAA 4FK0A 3EE3A 4ED6A 3T1YF 2EFGA 1N48A 4E1JA 5DQIA 1RBTA 2DY1A 4MFBA 1RWKB 4FPBA 3KIOA 4I7FA 4ED1A 2CPXA 4DCPB 3KZBA 3KJVB 2YKMA 2ZNYA 4PXEA 4J2BA 3ZT0A 3BQ1A 3MMCB 1RT5B 4JOUA 4ZDNA 2B4VA 2F3JA 4N5SA 2F8TA 2BR0A 1VQSA 3E01B 1SIZA 5GAEU 3NBPA 2H3EB 4Q43A 1BY9A 1CJKB 1Q4RA 4DSJA 1O5JA 5ETKA 1RAIB 4J9NA 3HHKA 2JGUA 3MXHP 3ITHB 4DPTA 3QETA 3PX0A 3KK1B 1RT3B 1N34K 1FXRA 5A0YB 1X5TA 1FRIA 1J5EK 1NUEA 1X0PA 1IWGA 3BGLA 1PG5B 3NF6A 2DHSA 5CH7B 1HKAA 4Q2MA 4GVEA 4OX9K 5BR9A 3FZLA 5BN8A 1VK3A 1CZBA 2XHCA 2Q31A 1K73O 5AQFA 4C0OC 2MKKA 2J6UA 3VQ9A 3HMJG 1L3VA 4J2EA 3QSIA 3LDQA 4RUHA 4CBXA 3MM7B 3KDNA 4W5TA 4OGCA 2ZJPL 2MQ8A 2FQQB 3NNHA 2YWHA 3TZWA 2XHBA 4O3SA 1R0CB 2EBGA 1LWEA 5FPMA 3HI9A 3ZYYX 3AB4B 1OSCA 1N0UA 3ZSZA 5TKYA 3OYNA 4TY8A 3ZZ0A 3A3PB 3IO1A 1YJ9N 2KYZA 2QSWA 3ZZYA 3VA3A 1Q81O 3UKRB 3O4WA 4QBUA 2Y1LB 4ELVA 3MXJA 4FWKA 5JVGQ 2Y0BB 3SSSA 4WXWA 4FS2A 4N56A 3PJWA 1B9FA 2BZ2A 3CMES 4DR1F 3WBZA 1Z26A 1WOQA 3HX9A 3SJHA 1PYOB 1RTHA 1J53A 4BREA 3NDKA 3FJ2A 2O01C 1BCOA 2AGOA 3CF5Q 1RWVB 3BEGB 8RUCA 1S6PA 4M5NA 3OVAA 2V8HA 1ZZNA 1NPPA 3BO3A 2K1RB 1S72N 4DDFA 4CF1A 3K5MA 2E5HA 3OL6A 1J6ZA 4JKGA 1GEHA 5KFKA 4IOAL 4UY8O 2DNPA 2W01A 1T44A 2NZTA 4OKKA 2ZKUA 4F67A 4YDXA 2HQCA 4C23A 3CDEA 2CQ3A 3CJ3A 2PZSA 2AJQA 4JK7A 4TU7A 4C48A 2M7SA 3U4LA 2YQ3A 2GAHC 4WP3A 1D0EA 2FTRA 1TK0A 1RWNB 4JI0K 3P6YC 4GVBB 4BGBA 4DV4K 4UOHA 4F8RA 4JV5K 3WNFA 2HGNA 5B0FA 1GLJO 4BVOA 3PW0A 5FDLA 1GXLA 4DBQA 2Q36A 5AQVA 2RQ4A 2VG6B 3MUTP 4K0KF 4B3RK 1T9VA 1F5BA 2D69A 3K9KA 4IH7A 4FF2A 3AO1A 2VQEJ 4JK8A 5AQKA 1KP6A 3V4IB 1UP1A 3CERA 1U0HA 1IBKJ 2I6WA 2R8JA 3EPGA 1QM9A 1UL3A 2OTLN 2J9DA 1VQ7N 3QGHA 1FRMA 2DGWA 4ED4A 1KCFA 3R6LB 3AVIA 1NK9A 3A5NC 1LW0B 1NDCA 1S6QA 3G6ES 2OUGA 3UCUP 3X3UA 3ZTSA 4IEIA 2CJYB 3KYLA 2AV5A 3FFKB 2WRMA 1C0FA 4DPYA 2R3VA 5GMEA 4BWJA 2P9PA 5GADU 4DG1B 2XMMA 4Y34A 4A8YA 3UDCA 3CJ8A 4B08A 2YNIA 2DFEA 3PJ9A 2ZWHA 4OX9J 4DTJA 4I6MB 4JYAK 1U2VA 1NCLA 4DV7K 1JLCA 1RJJA 3J81O 2OP5A 1R6YA 3CD6S 3TZYA 5HO4A 4H5WA 2R7TA 1SUQB 4A61A 3ZO7A 1VHXA 4FLYA 1U1RA 2E1ZA 1RBAA 3M6GA 2A18A 2FGCA 1HX1A 2V2VA 3DU6A 2EW9A 3CCMN 1IKVA 1QAXA 4ZVFA 2Q66A 2GFFA 1TELA 1HNIB 4LREA 3TJ8A 4BC7A 1TVRA 5HSPA 3AVJA 3SJJA 3B4MA 3HSCA 4U8VA 4CGGA 1S9FA 1CJTB 1CVJA 1Q5VA 3L8BA 4DPXA 1NXIA 2GJIA 2R9LA 3DAWA 3RUBL 3WQPA 5C25B 1QDUB 4J9KA 4NI2A 5KPTA 3J81j 3O3LA 3FQKA 4RW7B 2DR6A 2HEKA 3AAWB 3EKSA 4BWMA 2GNKA 1WBBA 4M5DA 4O55A 1F6TA 3PXGa 3I5AA 1BG3A 1D9AA 3MR2A 4A8MP 1HARA 4QIGA 2VPXB 1VC0A 5LJ3Y 4X64J 2CDRB 4RW8A 3OR2B 1ZETA 4WP8A 1SJ3P 2P9GA 2J6SA 1SQGA 4RX6A 1ATRA 1UVMA 4NASA 4NA2A 2YWFA 4EK2A 1S7IA 3ENAA 3A5LC 3D2FA 4LF6K 4HCBA 4WF9L 2NRHA 2DGSA 3SUNA 1GLFO 3GB0A 1FKAF 3W1YC 1BQMB 4OV1A 5CYMA 2XO7A 1ICEB 3U9DA 2GIQA 2V5HG 4LF5K 4OJHA 4M5IA 4CHYA 2YHXA 2HFNA 4O3RA 2KHCA 3QRRA 1HNWF 4AM6A 1RTJB 2WOMA 1UMJA 4YNQA 4IO1A 2F65A 2J7UA 2CXEA 3OW2R 4FLXA 4CERA 2RIJA 4LQ9A 2Q43A 2BVZA 2P9SB 3CXCR 4L8RB 3Q0AA 1SV5A 3L6QA 4CECA 5EWGA 4MH8A 5AQSA 2MZQA 1VBYA 3EE9A 4Z4FA 1ZPVA 4GMKA 4JV5F 3CJRA 4CEOA 4MO5A 3B82A 3CMAS 2VWBA 3J7YP 3ZT3A 2OZMA 3MMJA 2CQ4A 3K7RA 2BOAA 4OHWA 2WSCC 2F4VF 3VQ6A 4CD1A 4A8FA 5J1NA 5KQDA 5KAKA 1TUWA 2LXUA 1EWQA 4KHPF 4IJAA 3ID6A 2X1AA 4IG3A 3NOCA 5M2UA 4FM0A 3FLCO 1PIEA 2ZH2A 2CQ0A 4YOEA 3BH7B 3AT1B 1W26A 3TR5A 4KI6A 2X78A 3OSPA 4OZ2A 1RAFB 2DNYA 4YR2A 5CD4A 4BRGA 3BREA 4BCAA 4Q8EA 2ZBIA 3C66A 3R9LA 4BG9A 3IFRA 3VF0B 2I5JB 3GG1A 2CQDA 1HHQA 3O6WA 2EFPA 4Z7CA 1E6VB 4O3QA 3RYLA 1TL1B 1K6YA 1FEEA 3OL9A 3CO9A 4ID5B 3MM7A 3OTOJ 4JI8F 2AKWB 2ZH5A 2QEXN 3AVHA 4ILJA 4DR6F 1Q1KA 3Q86A 2LEPA 4DFPA 4WJBA 2YNGB 4DF8A 4WIIA 5BPMA 4R8UB 2EI5A 2G2YA 3RJMB 4XH5A 4EYIB 3LWMA 2V67A 5G4DA 2LKZA 2XMVA 3KHGA 5AE3A 3JXUA 2PAVA 1Y10A 3P96A 4CF2A 3SFGA 3HZEA 3VA0A 5CE3A 3DI6B 4PRFA 2RU9A 4A5AA 3O5BA 2GS8A 2IMOA 1BWEA 2GGPA 4IO8A 4IFEA 3KVGA 3SMPA 3GZ7A 4BR4A 5CYQB 3F41A 2EWHA 3Q23A 2DHXA 3DRXA 1IH7A 3MMBB 2UV8G 3LDPA 3VCDA 3I4HX 1OPZA 4DN0A 4UOCA 1TL7B 2C42A 2CPJA 4KHMA 1BIZA 4A57A 1TZ0A 4Q8FA 2HW3A 1A5WA 3R3LA 4QS7A 1RHMB 5C2DA 3MPDA 1GTHA 4F2RA 3OV7A 3QBWA 4LF7F 5GMDA 5E0OA 3M5RA 3Q8PB 1Q78A 1RCOB 5F3ZA 4DV3F 1S1TA 3TWZA 3PV8A 4AUKA 5ADZA 3I6PA 4CZGA 2DTUA 5GADI 1TV6A 2YBVA 4E7KA 1KVBA 2OMOA 3GIKA 3GBTA 5JVGL 1W2BR 1G3OA 4LRFA 2MQNA 4H54A 2VA3A 1Q53A 3FK4A 2O1PA 2XCAA 1Z2LA 5E3QA 2MJNA 3CF5L 3WXLA 4BQZA 1UZDA 2IY5B 4A4JA 3M1FA 3JSMB 4C2MA 4AQYF 1OO0B 5SZTA 3A0IX 3V1RA 3D1HA 3NCRA 2B4PA 1BL3A 3KK2B 2HWHA 3WEEA 1XC3A 2OEKA 1CQNA 3VVUA 2ZFHA 1AFJA 1FF2A 2DCUB 2Z8QA 1F5AA 1YITS 5L1IA 1JLGB 4KGMA 3H2UB 4RUAA 4KRWA 1VIXA 5K20B 5GADP 4Y2IA 2E5JA 4E3SA 1ZTTA 2P9LB 4HACB 1T3OA 1ROFA 1J5EF 4MQ3A 1KR4A 3LGNA 4Z0UA 4QIWD 3ET6B 5K8NA 3HULA 1CSJA 2U1AA 3MN6A 1SKSA 4NLXA 3U3YA 3AQPA 3VGUA 3L2UA 4BGAA 2EG1A 2DIUA 4EFHA 4MYTA 1HA1A 5IFMA 1FXLA 2QWMA 3HJVA 1SV5B 2XO6A 4DL2A 1KKHA 2KTQA 1APSA 1GK8A 2E29A 3V5RA 4QW9A 2ZBRA 3HPOA 4Y28C 4YY3J 2W9BB 5F2RA 5IOLA 5C7PA 3CJSA 2XG8A 2MKSA 1JJ2M 3C6AA 2VG7A 5HBMB 2HBQB 1TGOA 2DITA 1SQFA 3QT7A 3TA0A 1LWCA 2ZZTA 1JLBA 1AT1B 4BR7A 1T94A 3HVAA 1C4AA 1NRKA 3MM8A 4C8NA 1BHLA 2LCWA 4ZLPA 1CJKA 2R2TA 5BJRA 5IZHA 5K14B 2AMCB 2EBEA 2CG4A 2IA6A 3R6MA 4GVMA 3CD6N 2FZKB 4KO0B 1FNXH 3AHPA 2K3IA 3F73A 3I0RB 4RWTA 1ZAVA 1EO1A 2PFUA 4I6AA 4FNHA 1BDGA 3S3MA 3T6BA 3QIOA 2J9CA 3LQVA 5ETQA 2QXFA 3OTOK 1Y11A 1X8DA 2AW0A 5J2QA 2GJFA 1U6FA 2Q0RA 4ILGB 3NF8A 3O80A 4PR6A 4BDPA 4WFNL 3EVMA 3SSRA 2DGVA 3LL3A 5DGAA 5AQJA 2OHDA 2RHQB 1IBLK 1EAYC 2VYPA 4LSZB 3ENBA 1HRHA 1WEZA 3Q22A 1SAZA 4BRCA 2DHGA 3OVSA 4Y0FA 3J8AA 2XS5A 4MKBA 2D41A 2GVZB 2KXNB 4USVA 5B0DA 4NYFA 2PI4A 2NYIA 1LKZA 2DGUA 1MNEA 2QI2A 3D5MA 1BGXT 2P9UA 4B1UB 4X66K 4K4SA 4Y65A 3KLFB 4Y6IA 1C1BA 3IWLA 4DSLA 1CXUA 1GT8A 1KAXA 5HL7L 3DOMB 4CDIA 3TUJC 2VCPA 3FEXB 1S97A 5FPNA 2LP4A 4P73A 2MQLA 3FEZA 4K7QA 3GSDA 3CYMA 3U27A 4QCLA 3SCJE 5AT1B 2ZUAA 3U1LA 1D5AA 1AUDA 4C8MA 1FVSA 1YK9A 2DYAA 1HNVB 5IT0A 3JTNA 4V1Ak 3NE6A 2VKRA 3E9PA 4F25A 3MMBA 1WTFA 2JL9A 1HNZJ 1WOSA 5CYMB 1U4BA 3MN5A 1HR0F 4EI2A 5I42B 2BW7A 1TL4A 3OXLA 4WFZA 2YKMB 2E6MA 2Z1GA 3O3GA 2C2DA 5KT4A 2ZC4A 4FS1A 4FWPA 3CJ2A 3QBCA 3K0JA 2XSJA 3TAFA 1UJ5A 3TAGA 4M3UA 3JQKA 3L95X 4K42A 3FVYA 2MY7A 3UWTA 4LRCA 2ZVIA 5K8PA 3HTVA 5AZJA 4DWIA 3DLEA 1VQLN 4FLWA 2AJ2A 3SV3A 1MMDA 4JKDA 1D8YA 2DR7A 2HVHA 2CPDA 4M3ZA 2RUGA 5DM7L 1BI4A 3MCMA 4YB7A 3I4PA 3PIOQ 3VGTA 1S49A 5KI6A 3CM5A 3H5SA 4B3MF 4CO1A 1S6UA 4CHNA 1FRHA 2J7KA 3SMSA 2QYCA 4ID1A 3ICLA 2P9NA 4K8XA 2OSRA 2VODA 1RA6A 2RKIB 4IRDA 2C2ZB 1U7LA 4P75A 2A3JA 4WIQA 2ZE2A 2I7NA 1VSLA 1V3SA 4ID5A 1J5OA 2WBNA 2ZNZA 3PRVA 4J2DA 3Q7CA 3R2CJ 2FF3B 2QA4N 4B3SF 4LF8J 3HDSA 3M8WA 2YH1A 4M7YA 2YQ1A 2KT3A 2KVQE 4G6VB 4IR1A 1N5YB 1BLUA 4WE1B 2BE2A 1MWMA 1PKUA 4DV0J 1VC6A 4ITSA 2CVEA 5D0GA 1FT8A 1URNA 2G8WA 3I55N 3QBXA 2K1RA 3U8XA 3HI0A 1JLCB 4HUGA 2HNYB 2DNRA 3OHBA 9ATCB 5E3RA 1EWRA 1DKGD 1GQEA 4OLPA 1F21A 3CCEN 2OPSB 4CM2A 4P72A 3S8SA 3L7PA 4ANDA 4YOXA 1KOOA 4USTA 1NKBA 4DUZJ 5B8HA 3IM9A 5RUBA 4JI5J 2XY5A 1QS4A 4CNYA 4MK7A 2ZVSA 2DFHA 1N4LA 1H2TZ 3NS6A 2KFZA 1YDLA 3FBFA 5M1NA 1OY6A 1JX4A 1QY7A 5GIPA 1HJOA 3PHEA 3TAMB 3CJQA 4L3KA 2O4IA 4YFUA 4C8KA 4PQUA 2E7WA 1J5OB 4L72B 1HNWK 2IVMA 1CJTA 4JI6J 4DR7K 1FJGJ 4YOVA 1S59A 3BGFA 2JDJA 1HMVB 4CFDA 1R0AB 3S9HA 2VOOA 3MXMA 4H0VB 4LF8K 3C14A 1ZM2A 5C5JA 3N6NA 1X4CA 4MT1A 1UW9A 2HNDA 3M2RB 1YTUA 1E4FT 2IPOB 4DR6K 2VFTA 3QJLA 1EKSA 4DFKA 2QMUB 5K8OA 3TNVA 1DTQA 2V9WA 3NGKA 2RD5C 3MPWA 4IOCL 1FE4A 4HLBA 3CCJS 3W9JA 1X9JA 3PW7A 3TJAA 4X66J 5KFMA 2GHWA 4B1WB 4HI2A 3NP5A 2CPZA 4KIAA 4U6PA 4J37A 2A1RA 1HNXJ 3I8DA 2XHWA 3DRPB 2F9DA 5KFZA 3SEOA 3QFPA 2LMIA 4LF5J 3O3HA 1BXNA 4Q0BB 3RW7A 3SIPB 4YHHF 3CXCM 3SCKE 3OHRA 2PSZA 3VWSA 4B9TA 2BKPA 3G6EN 1FD8A 5A8KA 4O0JA 3IWNC 3H98A 2HSEB 2W7OA 3V81B 2GC8A 4P71A 1RISA 1BO5O 2HSTA 4BDZA 2HNZB 4DHVA 2OH2A 1WELA 2VD3A 3TTDA 1FJEB 2OO4A 1FKPA 1FFGB 3U1MA 2A1BA 3NVMA 2WAQD 3SQGA 4BR2A 1F3VA 2D3UA 2PE8A 3BDPA 3MOZA 4XPEA 2CWXA 4N7TA 4KFBA 1RU2A 2IFXA 2QL7B 2LSNA 3MX5A 1QTMA 3L4IA 1NM1A 3T9ZA 3J7AP 3DLKA 3BKFA 2U2FA 4BRHA 4FF1A 1XMQK 2V8VA 2HHHJ 1X9WA 5LJWA 2UUAJ 1UTAA 3GCXP 1S1VB 1DGKN 2YHWA 5AQOA 4I2PB 1PC5A 4CO0A 3NWRA 1PO6A 2JFKA 4LSNB 4DR4K 4AHCA 2R7QA 3PX4A 2WC9A 1LXJA 4E7LA 1VSMA 3THYB 2Q6CA 5J2MA 4KKOB 4JB8B 3BBCA 3E1YA 1DLOA 3LALA 1HQEB 4LF9K 4PY5A 3HBTA 2H4YB 5HP1B 2Q3SA 2AYMA 4W5OA 3DOLB 2COLA 3ZZRA 4DX5A 4URGA 1ZBSA 3HFKA 1IKVB 4DV7J 5L38A 1CULA 4DMNA 1HNIA 2XLIA 4NLYA 1L3KA 1F5CA 3VALA 1HNVA 3VEWA 4X4OA 3UE5A 1FTRA 1P1LA 3TARA 1RTDA 2EFQA 5GMKa 4QOZB 4MKYA 1SH0A 1Q9YA 3IM8A 4GO5X 1M1GA 4B9NA 1CC7A 1R7IA 3AO4A 3IR6B 4K43A 4FWRA 3IBWA 2MQMA 2ATCB 1Z1ZA 5E33A 3UN5A 4H0TB 4YMEA 1U2CA 4CBUA 1ZYQA 1BMQB 4YP3A 4FLZA 3CW2C 4JI3K 1PC4A 1KQGB 4LF1A 2F9WA 1REGX 4UF4A 4H4OB 5AZJB 2YX7A 4OX8A 2ATQA 3M6WA 2XNQA 2CZVC 1QSSA 1XNRF 2SXLA 1GOCA 4CF8A 2W8LA 1RAEB 3VGVA 4EHTA 2KYXA 3CCES 1VQMN 3BH6B 4B1VA 2V63A 2A6OA 2WVCA 4DTOA 2HYIB 4KH0B 3JQMA 4DU4A 3S1TA 1UEVA 3OYKA 3CC7N 3SNNA 2R8HA 2F7TA 3VTHA 2PT0A 3NF7A 1YSJA 1SJFA 1HBUB 1R3NA 3G71N 4OYZA 2MTLA 4F02A 4MYUA 4HTUA 1ASUA 3EWGA 4KPYA 1JLEB 2AEMA 4OVLA 1BQMA 5LOQA 3QRPA 1FX4A 3IFEA 4YOWA 2NXNA 2L9NA 2P9IA 1TYQA 3KFWX 2JLFA 2AT1B 1S3XA 2PFFB 2R8KA 4O3OA 1W0HA 2VKZG 4B3TJ 4EU0A 1EB0A 4LBHA 2D1CA 4PWDB 1I5OB 4MLEA 5FRNA 2RF2B 1NZ8A 4LFBJ 2DNZA 2I9SA 2WCXA 4BRPA 1R8PA 1RWWB 3KNAA 2ILYA 1I51B 2WBRA 3POTA 5H9FK 3H46O 5ETTA 4DG1A 3P45B 3NGTA 4H5NA 1NOYA 1ZM3A 3AA3A 4K0KK 2V4JB 2HGLA 4K4YA 3QIPA 2J0QD 1UFLA 4ES2A 4MIAA 1W2IA 2OPQA 2HFVA 4DQIA 1TTHB 5LL6d 1MLAA 3D2FB 2KT2A 3WX8A 1JCEA 3NAHA 4X62J 1W7WA 4N8OA 3SDEA 2Y3YA 2GCFA 4FLTA 2ZOGA 4ECSA 4LF2A 3MAQA 3BY5A 1VI7A 4C6AA 3BPDA 1NSKL 1VQ6N 1IBKK 2RS2A 1VS3A 4B3SK 5AQYA 2GTDA 1DRZA 4B9SA 2R7VA 3D67A 2C3UA 2AEFA 2NSCA 5ETMA 5T41A 3CCSN 4ZVTB 4NXMJ 2EPIA 2BJ8A 3T41A 4B3RJ 2IYIA 4L6V3 2LXFA 3BJYA 4FWQA 1NJXA 4AH9A 3SBMA 4HTIA 3M9OB 2VQEK 1S6PB 1EX8A 3FE1A 1XMQF 4QAGA 4OX7A 4YB6A 2E8AA 3QIDA 3HJFA 2LU2A 5LJVA 1TV6B 2JWLA 3N01A 3THWB 1HYZA 2VGNA 5LT5A 4EEYA 2ZUGA 1S5JA 5EVZA 3EL2A 2O8FB 3AJ1A 1S22A 5J1EA 2RDIA 1JLAA 1T05B 3EXYA 1I1GA 2C3PA 4CCHA 1O6XA 2ACMA 4OZ5A 3T1HJ 2QA4G 4WFBQ 5M1KA 2DR8A 3SI8A 2AYGA 3DXBA 2EFVA 3RMBA 2UU9F 5M1QA 3HZ6A 2VQFK 4R8UA 3TWHA 3QMQA 4X64K 3GJQB 3V2UC 5KFGA 5L39A 2B5JB 2LEAA 4RW4B 3SCIE 3JB9k 5G0RA 4IBNA 3LP1A 4NXNF 1HWIA 3MUVP 3ZEUA 1X4GA 3HM8A 4X84A 3FMBA 4PPZA 4B9UA 1RZMA 3UR3C 1S1TB 3WXMB 1I94J 5IM0B 4FWNA 2Q2RA 1B9DA 1XR7A 1C4CA 2E2QA 4CLSA 1HHSA 4DSEA 4USIA 2JJ4D 5KFWA 2ZZNA 4TSXA 2KXHA 4OI0A 3BO2A 2CNKB 2D74B 1TL7A 4QQBA 3W61A 4ZCLA 4FYDA 2Y8YA 1XC9A 3FZFA 3OYGA 3FNNA 1X4FA 1YBUA 1JLAB 4ERDA 4E1NA 1VQPS 2FVRA 3BP8A 3HHEA 4JV2A 4CBWA 4FKXA 1Y3KA 3ILJA 4JKHA 5M1PA 3ZSYA 4I2PA 4NLOA 2IDLA 4NRUA 4QZVB 3Q2SC 3ZZPA 4YB5A 4QWBA 3RSEB 4ZHRA 3HFZB 4W4MA 1BUPA 1K8AO 2YX1A 1KTQA 4DQQA 3O9RA 3QT6A 2VGMA 4LFBK 3PYEA 1ZBLA 1IBMF 2VFUA 4M45A 4RNNA 5B0BA 5CHIA 5H9FJ 1C1BB 2Z0GA 4LVNP 4FN5A 1F60B 1RDCA 4WK1A 3OSNA 3DI6A 1FXXA 3GYNA 2FBYA 4I6YA 2AJFE 2Y9HA 2DVIA 5DM6L 4Z4IA 1CLQA 1NHUA 5AQLA 2JH3A 5JLFA 3D68A 2G8KA 5THWA 2EC2A 3J7AN 4O4GA 3KUHA 4ALZA 1V6HA 3RTVA 3QFHA 3VAMA 3C6TB 1R31A 4G3IA 3U1NA 1KVKA 3MCNA 4RLEA 3RRHA 3CG7A 4DR2F 3NAIA 2D9PA 1WEYA 3QJPA 2W40A 4ZLLA 5KOXA 1BD6A 4LR8A 1RBVA 1HR0K 3C15A 1KSPA 2XY8A 1NK5A 5F0XA 3H8YA 2QWQA 4X4NA 2MDAA 2LFVA 4U7UK 2BQUA 4WFYA 1WC5A 2BM0A 2OPPB 2IRYA 1NGDA 5AQPA 5M2PA 3FRZA 2NPIA 1VISA 2QA4S 5DG8A 1FKPB 3RR8A 1FRXA 1K8AT 4R0JA 4J9SA 4ECTA 5E84A 4NLTA 1JCGA 2OPRA 4BE1A 1MW7A 2O8EB 2A2CA 4KSEB 4F4ZA 4JBCA 3L3UA 3DDKA 4HT5A 4EP5A 3LZIA 1Q81T 4WU3A 5F8IA 5I3QA 4R5PA 4KAZA 1ILYA 1GLLO 1WOPA 3ZTQA 1ZAXA 1OH8A 1O1WA 3KUGA 1HI1A 2YNHB 4JI3J 5T7BA 1N5SA 3MTKA 3TQ1A 4H5VA 3AV9A 4NEYA 3K59A 4JI8K 5KFCA 2B6AA 2ZM6F 1X4AA 3MF5A 4LF4F 2DNGA 3B78A 1XERA 3LGHA 2E5LJ 1OY8A 2X1GA 1OQ6A 4IOXA 3VEZA 1FNOA 4DKWA 3PFOA 3M2VA 2HS4A 4DX7A 4DV2F 1N32J 2AJ0A 3SV4A 4F3QA 5IWAF 4GO7X 3ZSXA 1YJNN 4CZFA 1MN9A 4Z4CA 2QWNA 4C7QA 2MY8A 1GOBA 2J5AA 1RHJB 5FJ4A 3MTJA 1CPZA 4RBUA 3EY1A 4BHQA 1FDNA 2HVIA 5KFTA 4GVBA 1KBRA 2VB6A 4DR5J 1R43A 2H4WB 4WZMA 2BMBA 2I2YA 3G6VA 4KB1A 3CCQS 2DIVA 3R7SB 3H25A 4L3QA 3ADAC 5HRRA 1T9YA 4UZCA 3TVYA 1L3TA