1BQMA

Hiv-1 rt/hby 097
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
556
structure length
556
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 103
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqmA05
1W25A 4M45A 4RW8A 4H8KA 1VSMA 4C8OA 5D3GA 5K14B 3RB0A 3ZSQA 3IAYA 4E7KA 2VG7A 4FJGA 1U09A 4LQ3A 1L3SA 3KK2B 3HO1A 1EP4A 2VG5B 1GOCA 3NH1A 4I7FB 2O4GA 1J5OB 5KG2A 4PY5A 2XGQA 4CHNA 3DLEA 1KLNA 1SKWA 4KHUA 1C1BA 4N41A 4R8UA 4PQUA 1X9WA 1RT2B 2GBZA 1S9FA 4KV8A 1J9AA 2BANB 2G8VA 4NLRA 4PUOA 3TR8A 2ZD1A 3TAEA 4CEAA 3NMAA 1VSJA 5KT7A 2Z1IA 4HUEA 5CZ1A 4K50A 3CFOA 3JYTA 3CO9A 4E3SA 4TXSA 4QWCA 2X78A 4IFVA 1T03B 3HK2A 5L1IA 1RTDB 1R0AB 4DTJA 4KHNA 3LALA 4K8ZA 4NLOA 2HWHA 2YNFA 4AHCA 3IN5A 4EBDA 4NLQA 1Q9XA 2RF2A 2FC0A 4LSLA 1S9GB 5J2PB 4DQQA 1RT7B 4RW6A 3HJFA 2AGQA 4ECWA 3RB6A 4RNMA 4RW4B 4N76A 4XIUA 4M3XA 1TKTA 5KTQA 3V6HA 1JIHA 4C8NA 4JRPA 3ALYA 2CJQA 5KFIA 2W42A 2OH2A 3CJ5A 2P51A 4TYBA 2BGGA 4FJLA 4Q45A 1IKYB 3GQCA 3UPFA 5L1JA 5DG7A 4JV0A 4JLHA 3LP2B 2KZMA 4CHOA 3ZT2A 1RAJA 1RTIB 3CM5A 4DL4A 4JS5A 3SCXA 3TANA 2FVCA 1HYZA 3M9OB 4I9QA 2HNYA 3HVTA 3TAFA 4WE1B 4H4OA 4LQ9A 2W9AA 4GC6A 1WSIA 4O5BA 1U49A 3VQBA 3M8QA 1S6PA 1TKDA 4BWJA 3KJVA 3RRHA 2AGOA 2JGUA 2R7YA 1ZTTA 4RW9A 1DLOB 1DTQB 2OPPA 3PJXA 3V81B 3M8PB 4HCCA 1HNVB 1TAQA 4ECUA 3PX6A 4NLSA 1K1SA 4JRQA 4EZ9A 3LP0A 3MXIA 3KLIA 4K4TA 4B08A 3OYIA 4LD0A 3DYAA 3TVKA 3G6VA 4MH8A 1JLQB 5FDLA 4EZ6A 4JV2A 5HP1A 3NBPA 3KKSA 3AA5X 4DL3A 1GX5A 1IKVA 4ECYA 4Y1DA 4J9PA 3PR5B 5FROA 3NGDA 1U47A 4NLXA 2HNDB 3P83D 1S1UB 4KPYA 4ZMMA 3MEEA 4CK3A 3K59A 1RA7A 2RDJA 3MR3A 4MK7A 3T5KA 1JL2A 1NOZA 4IDKA 2HHXA 5KFFA 4FVMA 5KRSA 2P1JA 3TI0A 4YR0A 1U48A 5I42A 4CJWA 3N6NA 1BCOA 1RTJB 3KHHA 4CEQA 4DTMA 2P5GA 3SQ0A 4KHMA 1LW2B 3AVMA 3HPGA 2BDPA 4CEFA 3NE6A 4WXWA 3MR2A 1U04A 3IRXB 4FM1A 4DLEA 3RAQA 4Z4EA 2E9TA 1JXLA 5C25A 4J9NA 2A1SA 2UVWA 3BQ0A 2IJFA 3I0SB 3PZPA 5KFWA 1BI4A 3H08A 4WZMA 3QGHA 5HLFB 2V4RA 3AV9A 2DFHA 4IFYB 4TY8A 1HPZA 4B9MA 1NK4A 2HHSA 2I5JB 4ZVEA 2EHGA 3V9WA 3NFAA 2W9BA 1NOYA 1TV6B 4KO0B 4B8AB 1NKCA 2JEFA 1S5JA 3ZT4A 3HM9A 2R2SA 4ZHRA 3RB3A 5KFAA 3HVAA 3LPUA 4CEDA 3MAQA 4MKAA 5KFOA 4OPJA 4QOZB 1O1WA 3OSNA 4L8RB 5DG8A 4DU4A 5HRNA 3OYNA 3WNGA 4WFZA 5KG3A 3FDSA 2C2RA 4X2BA 5HRPA 3NF9A 4EO8A 1QTMA 3LAMA 4B9LA 5FRMA 1YTAA 2RKIA 4O4GA 1MU2B 5J2MB 1QUVA 4U7CA 3EZUA 3TAMA 4FLXA 3O3FA 1YT3A 3BDPA 4RU9A 4CGGA 1BIZA 3DRSA 4CJFA 3PW4A 4CEBA 4B9TA 2ASLA 3NGIA 4AHTA 2PYLA 3LP3A 4CGDA 2QE5A 2O4IA 1BQNA 4ZP8A 3C6TB 2E9ZA 3C6UB 1Z26A 4K8XA 5KFJA 3Q8QB 3V4IA 2ILYA 3AO4A 4DL5A 3FSIA 3BGRA 3AO1A 2JC1A 2FJVA 4U6PA 3V9UA 4KHYA 4AILC 5EWEA 1RYSA 3MEGB 1NK0A 5KFPA 4ZPAA 4M95A 4G3IA 2HNZB 3QEIA 3KIOA 4CF2A 4O3QA 1TVRB 1HQEA 5EDWA 4CEEA 2YHBA 1G15A 4RNNA 1JLFA 1D9FA 3DM2B 1WSEA 2CKWA 4HKQA 4DFMA 1IKXB 4TQRA 4HYKA 4CJUA 2OPSA 3DI6A 4ID5A 5T14A 3C95A 4FJJA 3QO9B 2XWYA 2R8JA 3VQ4A 4DQIA 3QNOA 1YVFA 4XPCA 1RTHB 4NLUA 1SL1A 4URQU 1ZYQA 2YV0X 2D0BA 5SZTA 1RDCA 1QE1B 3DOKB 1LWEA 4CJLA 4RNHA 3KLGA 4CF0A 3SYZA 3OL8A 2YNIB 2KTQA 3ZSOA 5KFZA 4WFYA 1RDDA 3I5CA 3OLBA 3PVXA 5HBMB 5KFTA 4DEZA 3ULDA 3PW5A 4DS5A 2GV9A 3QIPB 1HMVA 4FJ8A 3RTVA 1S10A 1C1AA 4YQWA 4H4MA 2YKMB 3SI8A 4CE9A 3CDUA 2ZE2A 4ED3A 2WTFA 4CF9A 2FLPA 4FLUA 3DOLB 5CYMB 4ED6A 2XI2A 4IG3A 4CJ5A 2B5JA 2ETJA 2VG6B 4ID1A 2QKKA 4MIAA 3SI6A 4O3RA 4BE1A 4FJNA 1KCFA 3AVKA 4MFBA 4NRTA 1CSJA 4QW9A 5J1EA 2B6AB 4O44A 4OVLA 3AVCA 2IOCA 4Z0UA 1S6QA 4ECXA 4IG0A 4B3OB 5KG5A 4ZP9A 2ALZA 4DQPA 4EYHB 3AO2A 1S1VA 2PYJA 5C5JA 1ASWA 1OS5A 5F9NA 2F96A 4IQXA 3PO5A 4NCGB 1TKXB 1WSJA 3G6YA 2JEJA 4CJKA 3RWUA 3CVKA 1LWFA 5C42A 3AVBA 3PR4A 1VSEA 4BWMA 2FJWA 4Y34A 3CG7A 3ZSRA 1RDAA 4ECVA 3NH2A 1SV5A 5KFXA 4FLYA 3RMDA 5C24B 3JSMB 4I9LA 2V4QA 3PW0A 5I3UA 3MECB 2BQRA 1JLBA 5DLGA 4M42A 1S1XB 3DRPB 1S1TB 2VWJA 4HUFA 5KFYA 4KHQA 3QGIA 2HWIA 4IKAA 4J2EA 2YKNB 1UAXA 1EP4B 1KHWA 2HHVA 2ASDA 2KQ2A 4ZPDA 3G6XA 4PQUB 3BREA 2ITGA 4CF8A 3KLFB 3SUNA 3HYFA 4O4RA 4PWDB 1DTTA 5KGWA 1JKHA 3FQKA 4ICLB 5DGAA 3F9KA 1ZTWA 2O5DA 1FKPA 1WAFA 3GV7B 2IGIA 1NK6A 2G8HA 2YNGB 4Y2CA 2UUWA 4HVJA 1N48A 4Z4FA 1HQUB 4WFXA 3Q8PB 1RT1B 1GOBA 1VSKA 3AVIA 3ZSWA 1LWCB 3OHBA 1ZETA 1KVAA 1JL1A 1TL1A 2DTUA 1JLCA 3PW2A 1LW0B 2HMIB 1X1PA 5KFKA 3GIKA 3SZ2A 4LSLB 3E01B 1D5AA 4ECQA 3VQPA 1C0TA 1RBSA 4DG1B 1TKTB 3Q8RB 3EY1A 1NK9A 4KTQA 4QWDA 2VA3A 2BRLA 4B9UA 2WONA 3PO4A 3LPTA 2FBVA 2IC3A 1YVUA 1A5VA 4KE5A 3OSPA 1SL2A 1IO2A 4ELVA 3SPYA 4NYFA 1ZBFA 3V9SA 2QKBA 3B6OA 3NF7A 2FBYA 3CFPA 5KG1A 1S0MA 3CYMA 1S0OA 3HVRA 3N6MA 4KB7A 3V6DB 2Y1JA 3SUQA 1IKWB 3T5JA 2F8SA 1RDRA 3M8QB 1BGXT 5K14A 2BE2B 5KFCA 1NKBA 4FLZA 3KLHB 2G8KA 3HL8A 3OYFA 3KK2A 4F8RA 3OYCA 4W5TA 4QAGA 4NLTA 1UWBB 3IGVA 3LWLA 4ZVHA 4M3ZA 2VG5A 3KK3B 3CDWA 4FJMA 4I7FA 2ZKUA 1J5OA 2WK4A 3CJ4A 4MIBA 3QLHA 4J2BA 3KLIB 1RT2A 3KK1B 5J2QB 3QEVA 4FJKA 3H4BA 1JLAB 2JEIA 2W8KA 2BANA 1S48A 1KSPA 4ED0A 2HHTA 3T5LA 5KT3A 1JLEB 5KI6A 3OS2A 1W9HA 4CJPA 1IKVB 4CGJA 2F8EX 2OPQB 2E6LA 4IRDA 1CXUA 2R8KA 4NCBA 4KHSA 3OYBA 1C6VA 1T03A 1KVCA 4FJHA 2JLEA 1F21A 3AVFA 3K58A 1BIUA 2OZMA 3GIJA 1S9EB 4F50A 1S9GA 5J2PA 1WNEA 1D9DA 4IH5A 1RT7A 1JLGB 4DL7A 1D8YA 4IR9A 4AHRA 4FZZA 4ZVGA 4RW4A 5DG9A 3DDKA 3KMQA 4HHTA 1CXQA 3VQCA 3OS1A 4URSA 4LH4A 2FLLA 4B8CA 5J2NB 3LDSA 1Q8IA 4WZQA 2AWZA 2ILZA 1HNIB 3SFUA 1T05B 1N5YB 2HVIA 3ICLA 3LP2A 2C28A 1RTIA 1NJZA 4W5NA 1HYSB 4BE2A 1NK5A 4I2QB 4RZRA 1XR6A 4OLAA 3AO3A 4DU1A 4E7IA 2WRMA 2XRIA 4IH7A 4WE1A 1N6QB 4K4ZA 4WYWA 1FK9B 3BSCA 3HXMA 2QV6A 4FYDA 3L2QA 3MR5A 1KFSA 2W9BB 2HHWA 1TAUA 4TY9A 3VQ7A 2HAIA 4RW7B 3VA3A 3D28A 4OL8A 1DLOA 4FBTA 1TK0A 1VSDA 3K5MA 1DTQA 4DMNA 4ZHRB 3V81A 1KHVA 4K4WA 3M8PA 3S3NA 4NYZA 1HNVA 3BSNA 3OYJA 2DFEA 3D0PA 4DTXA 4FW1A 2UVRA 4FCYA 2D7SA 1GOAA 2B43A 3EPGA 3DLBA 5KG6A 1RT6B 4QWBA 3RBEA 3ZSYA 4O3SA 1KLMB 4XO0A 1MMLA 3NL0A 3VQDA 2HNDA 4QCLA 4NLDA 3MTKA 2G8IA 1C0MA 1J53A 4ED2A 4M3RA 1I39A 3OYHA 1Z25A 1REVB 4DTPA 2RPIA 2IAJB 3DRSB 3OVNA 3GIMA 3H5YA 1LAVA 4Q0BB 1A5WA 4ED7A 1NNDA 1ASUA 2Y1IA 2FVPA 2HVHA 4KTZA 5KFSA 1RTJA 1NKEA 4OPKA 5KFQA 3MFIA 2YNHB 3MEDB 5DGBA 1J54A 3LANA 3PY8A 1WSFA 4M3YA 2W7PA 2Q3SA 3IRXA 3DRRB 2PZSA 3VQ5A 4K4YA 2OA8A 5F8GA 4JV1A 5DQGA 1HRHA 5KFRA 4CGFA 4MK9A 2J6TA 3SQ1A 3SUOA 3RBDA 3I0SA 4OJRA 4KRFA 3UR0A 3ZSXA 5HLFA 3AVJA 3H5SA 4E0DA 4J2AA 3G10A 4W5OA 3U3YA 3DLGB 2X6NA 4KKOB 4CFDA 4CGHA 4IFYA 5DK5A 4Y1CA 3K5LA 3SUPA 2I5JA 1D0EA 5FRNA 3H5UA 1N56A 1TV6A 4KO0A 3FRZA 3TAQA 3EPIA 4ECZA 3FFIB 4CHPA 1QHTA 1XWLA 5KT2A 3DMJB 2XY6A 3EZ5A 2IMWP 3QZ7A 1QQCA 3D5MA 3UIQA 4NYNA 4MKBA 4BDPA 4GC7A 3PJWA 3DI6B 4J9KA 4IRKA 1EETA 1VSFA 4QPXA 1BL3A 3BQ2A 3SJJA 1RT3B 2GIRA 4F3TA 4C8LA 2OPRB 1KRPA 4CJRA 3TARA 5KG4A 3DLKB 3GILA 2A1RA 1RNHA 4O55A 3KLGB 4OGCA 1RBTA 5T7BA 4ZP7A 2QXFA 4Q5VA 4IRCA 5J2MA 3NAHA 4KI4A 4CFAA 4LY7A 4DTRA 1XR7A 2W9CB 1RT4B 5HROB 3F73A 4DSFA 4FJ5A 2KFZA 1RBUA 4I2PB 1BQMB 4O0JA 5KFUA 2R8GA 3KD1E 1FXXA 4NCAA 4ZPBA 4LSNB 1NK7A 3C6TA 3HHKA 1VRUB 1TP7A 2FVQA 2HW3A 3O4QA 3Q8SB 1B92A 1FKOB 1EXQA 4DTUA 3H59A 3NGZA 2EX3A 3ITHA 3ZT0A 3NAEA 1L3UA 3QESA 1RYRA 4RUCA 2HB5A 4M3UA 2B4JA 4KSEB 3VQQA 3M8SA 1NJWA 1QSLA 1C1CB 4XPEA 1TKZB 2LSNA 2R2RA 1Q9YA 4MFBB 5E41A 3O3HA 4FM2A 5HRRA 3HP9A 4FK4A 1S1WB 3M9MB 2XCAA 4CJVA 3I0RB 4TN2A 2WOMB 1VSIA 1NJXA 3ASMA 2KFNA 4Z4GA 4YP3A 2HNZA 1SKSA 1TVRA 4NLPA 2GUIA 3NF8A 4CJQA 2IM0A 3LP1B 4IKFA 3OLAA 3IG1B 2D0CA 3FQLA 4ZP6A 4TYAA 2FJXA 4KTWA 3KLEB 2UVVA 3DM2A 4JS4A 3SNNA 3L2RA 3QGGA 1KTQA 4FLWA 4F4XA 1RT5B 1LWFB 5C42B 3MR6A 2X6SA 3AVHA 5DMRA 2JC0A 4KFBB 3A2FA 4KAIA 4Q8EA 3QEPA 2ATQA 3QO9A 3HVWA 4NLWA 4FW2A 1VRTB 1EX4A 5KG7A 2C22A 1NJYA 1A5XA 4MQ3A 4FJ7A 4K4UA 1RTHA 4DU3A 4KHRA 5KFBA 4DS4A 3THVA 4CGIA 1QE1A 1VSLA 3RRGA 4G1QB 4TLRA 4WXOA 1ITGA 2AX0A 3RMBA 2AQ4A 3PUFA 4J9QA 1JXEA 5HBMA 4Y2AA 3GV8B 5CYQB 2XI3A 1N4LA 1KFDA 3QIPA 4JUZA 4FJIA 1CZBA 1K1QA 3IS9B 1TL3A 4BACA 5F9LA 1Y97A 2UUTA 4RW8B 1SUQA 3QETA 5D3GB 3DOLA 1IM4A 4FS2A 4AHVA 4KB0A 2VG7B 4EP5A 3RMAA 4FK0A 3K5OA 4ELTA 3WNFA 4DQSA 1ZBIA 1HJRA 3PX4A 4EBEA 4CJTA 1XHXA 2HHQA 3DLEB 4Y3CA 1C1BB 4AH9A 4Q43A 4CEOA 2B6AA 4R8UB 4NLGA 4Z4HA 3LZIA 4R5PA 1C0TB 1D1UA 3NH0A 4KV8B 2Z1JA 3LZJA 3RMCA 3H4DA 1WLJA 2XY7A 4B3OA 4PUOB 2ZD1B 3SQ2A 4CESA 1C0UA 1L3VA 1QSYA 4CHZA 5KG0A 4N5SA 3L8BA 1QAIA 3D45A 5KFMA 4FJ9A 1SKRA 3JYTB 3T3FA 3PV8A 5KFEA 2IM1A 4NCGA 2D5RA 1TKXA 2IBKA 4IFVB 4M3WA 4F2RA 4OGEA 1UA1A 3CJ2A 2ZQBA 3BSOA 3G86A 4F2SA 3S9HA 1CZ9A 2YNFB 4ECRA 4IOBA 4CK2A 4KAZA 2RF2B 2R8HA 3KKRA 3WNHA 4NRUA 3SFGA 5C24A 3QINA 4CJ4A 4RW6B 2XY5A 3HPHA 4QW8A 3JSMA 3UQSA 3NHGA 4H54A 2DY4A 3MECA 1T3NA 4DSEA 1S1XA 1QSSA 4IBNA 3DRPA 2R8IA 1S1TA 2R2UA 3OL6A 3B6PA 4AHUA 3OYKA 2YKNA 3TAGA 1X9MA 4K4SA 3T1AA 2IS3A 4K4VA 5L9XA 2BQUA 3OY9A 3QLHB 4CFBA 3RAXA 1C2PA 3QEWA 4OKJA 4FK2A 3V1OA 4KBIA 3KLFA 5KT4A 2HHUA 3KHLA 4BDZA 4PWDA 3VN5A 5JXSA 4FZXC 4ICLA 4OKKA 2HNYB 3HVTB 4FBUA 4H4OB 2YNGA 4F4KA 4CEZA 4O3NA 1UOCA 1HQUA 2E9RX 1RT1A 4DF4A 1S6PB 1LWCA 2BRKA 3KJVB 4J9OA 4FLVA 2J6UA 3H98A 2VWKA 1XI1A 3S3OA 3CFRA 2QK9A 3AO5A 4RW9B 2AJQA 4C8MA 1U4BA 1LW0A 2HMIA 3DLRA 4AHSA 1RBRA 2EC0A 2OPPB 5KFGA 4F4WA 3E01A 2IM3A 3UDLA 1ZBLA 3SV4A 3LP0B 4DG1A 4HCBA 3DYAB 3AVLA 4NLYA 3KD5E 4ZVFA 1VSHA 5FDLB 2FLNA 4BDYA 4R0EA 5HP1B 3KLVA 3NBPB 4NLVA 1QAJA 4FZYA 3NAIA 2JEGA 4CHYA 4FXDA 3MEEB 3U6FA 3L2WA 1RTDA 3OYGA 1S49A 1R0AA 3QEXA 3H2LA 4M94A 1T7PA 3V6DA 4IDKB 4DL6A 2OZSA 4ZTFA 1IKWA 3CWJA 4MK8A 1WN7A 3NCIA 1IH7A 2BR0A 5I42B 2BE2A 2XGPA 3V1RA 4E19A 2GIQA 3KLHA 3OJSA 4J9MA 4LH5A 4QWEA 3OL9A 3QIDA 1NHUA 3M8RA 3NGYA 2RDIA 2RN2A 1UWBA 3SV3A 2XY8A 3KK3A 3NDKA 4RUAA 5DLFA 3V1QA 1CLQA 1BCMA 1IKYA 1RA6A 5C25B 4Q44A 4B9NA 3KK1A 5J2QA 1JLAA 1BISA 3L3VA 1BI4B 4DTSA 3P1GA 1JLEA 2OPQA 4DL2A 3ZSZA 3HSTB 4TY8B 4N56A 1HPZB 4F4ZA 2E6MA 3AVGA 2G8FA 3GIIA 1RCHA 3ZCMA 3I5AA 3HPOA 5L1KA 2FBXA 3C94A 2OYQA 3VQEA 4EEYA 1XHZA 1S9EA 3T19A 3V9XA 4B9SA 3MFHA 1JLGA 5KT5A 4Z4IA 3CQ8A 5HRSA 3O4NA 2BQ3A 5F8LA 3QYYA 3AVNA 3L2VA 1JLQA 5J2NA 3L3UA 3G0ZA 1HNIA 5KFVA 1S97A 1T05A 1N5YA 4FM0A 4FJXA 4Z4CA 2FVSA 1S1UA 4DWIA 3PW7A 4ELUA 3K57A 5EU7A 1HYSA 4DQRA 4IH6A 5F8IA 2RKIB 3AA3A 4I2QA 4O4GB 4DLGA 2X74A 3TAMB 2IM2A 1TQLA 3BSAA 1K6YA 1L3TA 1N6QA 1FK9A 2Z1GA 3MXMA 3U3GA 1BQNB 2AGPA 4CK1A 3HT3A 4RW7A 5EWGA 4E1MA 3NF6A 2E4LA 3E51A 5DQIA 1LW2A 1T94A 4OLBA 3V4IB 4ECTA 2KZZA 1NHVA 3ISND 1HARA 2I1RA 1S0NA 3BGRB 1S4FA 4EYIB 1EETB 2P5OA 3KMSA 3GYNA 3VQAA 4W5RA 5F8NA 5KGXA 1RT6A 2WHOA 4O3PA 1JXBA 2DFFA 3K2PA 4DFKA 4KI6A 1KLMA 3V9ZA 2XCPA 2XC9A 4CIGA 4ECSA 4E7LA 4CJ3A 5KFLA 1HQEB 1HYVA 3V6KA 3VQSA 5SWMA 4NZ0A 4E7HA 1JLFB 4FLTA 1B9FA 2Z1HA 1REVA 1ASVA 4M41A 2IAJA 3H40A 2G8UA 3OL7A 3TWHA 3N6LA 4ZPCA 1RILA 1WSHA 1ZBUA 4Q0BA 5CZ2A 3AA2A 2WB4A 3KHGA 4FS1A 1VK0A 2OPSB 3TAPA 4ID5B 3V6JA 2XO7A 2IJNA 3OHAA 1WNSA 3VQ6A 1L5UA 2YNHA 4CHQA 3MEDA 2ATLA 3H5XA 5F8MA 3LWMA 1SH0A 3ITHB 3SQ4A 3DRRA 4CECA 4J2DA 4K4XA 4Q8FA 1LWEB 3CJ0A 1LV5A 2AU0A 4TSXA 4WYLA 3K5NA 2C2EA 3MXJA 3L2UA 4N47A 1MU2A 4E7JA 3PX0A 3OYDA 3DLGA 3VQ9A 2J6SA 4KKOA 4C8KA 3OYAA 1HMVB 2D3ZA 3ZSVA 1XC9A 4KREA 4PA1A 3KHRA 3QERA 3CIZA 4H4MB 1KVBA 3GV5B 1LAWA 4ED1A 4BE0A 3C6UA 2V0NA 2ZE2B 2D0AA 4J9RA 3FFIA 4QWAA 3KOAA 3DMJA 3AVAA 4IG3B 3P5JA 2B5JB 1TK8A 2UVUA 4YNQA 3QNNA 4CF1A 1RBVA 3EYZA 5KFHA 3LAKA 2FVRA 4ED8A 2W7OA 3S3MA 4ZTJA 4YR3A 1RT3A 5J1EB 4O44B 2W8LA 2OPRA 4CCHA 3MEGA 2C2DA 1S6QB 3DLKA 4YR2A 2WCXA 4IG0B 4DSLA 5F8JA 4KB1A 1ZBHA 5KFNA 5F8HA 4GW6A 3IGNA 1S1VB 1IG9A 1SH3A 3MF5A 1UA0A 5CY4A 2ASJA 5KT6A 3M9NB 2V9WA 3O3GA 4YFUA 4RNOA 2DPIA 4B9VA 4HTUA 2W9CA 1RT4A 4CERA 5HROA 1IKXA 4GVMA 5JUMA 2G8WA 5L1LA 3RR7A 4CJSA 1NK8A 4CJEA 4I2PA 1BQMA 1EKEA 1I6JA 1TL3B 3PHEA 4LSNA 1YTUA 3RB4A 1WSGA 1SV5B 1SH2A 4DSJA 2IDOA 4GMJB 3CDEA 1SUQB 1VRUA 4RG8A 5I3UB 1FKOA 1JLBB 3ISNC 1I3AA 4O0IA 4HUGA 3DOKA 1JX4A 5KFDA 3TABA 1T8EA 3ZT3A 1C1CA 2KW4A 4DSIA 1TKZA 4CIFA 2YNIA 2D3UA 3VQ8A 3CJ3A 4F4YA 1S1WA 3TQ1A 4R5PB 4E1NA 3I0RA 4CIEA 2WOMA 5JS1A 1WAJA 1DTTB 5EWFA 3CM6A 1C0UB 4KHWA 1JKHB 1XR5A 3BJYA 3I5BA 2YKMA 3LP1A 2F8TA 1FKPB 4UQGA 3IG1A 3HKWA 3KLEA 5DQHA 4RNFA 2R2TA 4DFPA 5CYMA 2NUBA 1RT5A 1GX6A 2IA6A 2YHAA 3OYMA 1TL1B 2VG6A 4KFBA 2AX1A 1JLCB 3OS0A 4E89A 4W5QA 1VRTA 3VA0A 4DTNA 3RR8A 3I8DA 4EO6A 3DLHA 4DFJA 2DPJA 4DTOA 2D41A 1W0HA 5JS2A 1TGOA 4EBCA 4TQSA 4URGA 4F3OA 3HP6A 3ZT1A 4CFCA 4IR1A 4J9LA 2WONB 2GC8A 4G1QA 3BR9A 2IC3B 4DSKA 4J9SA 4OKEA 3KNAA 1TK5A 3QZ8A 3WNEA 3BQ1A 2PY5A 3NKYA 4O3OA 1Z4UA 3KTQA 5CYQA 1QS4A 1SL0A 3OYLA 1BHLA 4DF8A 3OYEA 4EP4A 5EUHA 3SPZA 2FBTA 3IS9A 5KRTA 4M3TA 2VA2A 1X9SA 4YMEA 3T5HA 3OJUA 3QIOA 1U45A 1B9DA 3AA4A 2XHBA 1RDBA
chains in the Genus database with same CATH superfamily
4ZJQA 3A4TA 4L6V3 4KY3A 3BH6B 4XH1A 2VDIA 4FNIA 5E3QA 2QWPA 1MNEA 3X1LB 4FJGA 4JI5F 6FD1A 3EMTA 2DRDA 3NH1A 5E3CA 2O4GA 2DRAA 2GCFA 1KLNA 2XEXA 4PQUA 1RT2B 3PYEA 1J9AA 3G6ES 4NX9A 2DXDA 3G8TA 4K0KJ 4NLRA 4PUOA 1RFQA 2ZD1A 4HH1A 3H1VX 3W9HA 2E8AA 2Z1IA 1NLVA 2FDNA 2RU9A 5BR8F 3JYTA 3CO9A 4E3SA 4QWCA 4JV5J 3AQOA 4LR9A 5DETA 2VQEJ 3LALA 2ZUAA 4P2XA 3MUVP 1HWIA 1RLDA 5BR9A 4H03B 2XULA 4DQQA 2NR0A 3H7HB 3RB6A 2JWNA 2KXNB 4K41A 2ADBA 4N76A 4B1XB 3M2UB 3JAMO 2MQMA 1YDLA 2W42A 3BP8A 2HQGA 4W4MA 1WKJA 1LOTB 1YG0A 2MB0B 4TYBA 1VAZA 1NM2A 2XNQA 1VQ5S 5DG7A 4EFHA 1H3DA 4JLHA 3ZT2A 1RAJA 2HFSA 3OXFA 1RTIB 1YIJS 1NGCA 4BROA 1HW8A 2PMHA 4DL4A 2NYHA 5DZ6A 3SCXA 1YBAA 4OJGA 1URNA 3SCIE 2HNYA 1UPPA 4LQ9A 1FNOA 2J0XA 1R89A 3BO3A 4JB8B 3J81O 4BWJA 3KJVA 3BR8A 3OVAA 1Q1KA 4RW9A 3W9IA 3NNAA 3V81B 3M8PB 2A2CA 5DDOC 1R8AA 4ECUA 2I6WA 4PKGA 3HHNB 4JRQA 4EZ9A 4DV6F 3P6YC 5DZ7A 2C42A 4LD0A 1FDNA 3HD2A 3TVKA 1JLQB 4EZ6A 1WC3A 3AA5X 4Y1DA 4BRKA 3NGDA 1U47A 1VQON 3H3OB 3IA0A 3LO3A 3MEEA 2ZJQL 4HT7A 4KH0B 4A8QA 4IDKA 3M2RA 2B3TB 5GMEA 3TEHB 3TI0A 3M7VA 1RP5A 5F3TA 5A8WA 3NCPA 2HFVA 5I42A 4NXMF 4CJWA 4DTMA 3SQ0A 3CE8A 4B3RK 5AJ3K 1SJ3P 3HM8A 2DD8S 2MY7A 2BDPA 1BWFO 2GEMA 3NE6A 4WXWA 1KNZA 4FM1A 4Y6IA 2E9TA 3Q8UA 2N82B 2E20A 3VF4A 4K2JA 5C25A 3CCUS 4WP8A 3UN5A 2NUUG 4Y00A 3I0SB 2DHXA 2K8GA 3QGHA 2VODA 2V4RA 1FVSA 3QFWA 1B0TA 3R8YA 5BR8J 1NK4A 4PG6A 2HHSA 3V9WA 2IVPA 3DGVA 2KXFA 4A8XA 4PYAA 2CIMA 1UPMB 1NKCA 3SDEA 3HM9A 2R2SA 2HWTA 2YHWA 1YVNA 3HT0A 4A48A 5KFAA 2Z2MA 3HVAA 3FNNA 3LPUA 2UUCK 4MKAA 3O1LA 2OTJS 4OPJA 3S41A 4CZGA 3F9MA 4DUZF 3LDNA 3OYNA 2O8DB 4FVUA 2WUSA 1E6YA 1HI8A 3NF9A 4EO8A 1AXQA 1X5SA 4O4GA 5J2MB 5A6WA 1NGFA 3F56A 1KWMA 3TAMA 3O3FA 1Q0NA 4RU9A 1BIZA 1SQGA 3DRSA 1QM9A 4OX8A 3M1FA 2PYLA 4CGDA 1VRQC 4ZP8A 2X1FA 3FC9A 2E9ZA 1QUPA 4CBXA 1FVQA 3TSQA 1YQHA 2HZCA 3MR7A 1IQZA 1HKAA 1K9MO 3UN3A 3FSIA 2EFPA 2BJ1A 2NQPA 1K0VA 3N5FA 2GVZA 2IIHA 2ATCB 1OH5A 2XNRA 4AILC 3CJBA 4OYBA 1RYSA 3MEGB 3OW2M 2UYTA 4ZPAA 5K8NA 3IBWA 2ZM6J 4G3IA 2WW8A 2YWGA 5HL7Q 5HOOA 2LQ8A 2YHBA 1YJUA 2WC9A 3PDNA 3J7AN 1JXVA 4U95A 4JI0K 4BCAA 3CCES 4HKQA 1DKGD 2JWLA 3FE1A 3FGVA 3UDVA 2FZCB 3EWGA 3DI6A 3R1XA 3C95A 3RGIA 2N3OA 1YJ7A 4MMOA 5AQPA 2ZZTA 5IT9O 3VQ4A 1UW4A 3ZC4A 4DPTA 1YBUA 2VF3A 2CJKA 2EG1A 5I3QA 3QNOA 4P9SA 2SXLA 2GZOA 1RTHB 1RKJA 3K0JA 4EK2A 1ZYQA 2EK1A 3DOKB 1LWEA 2ZNZA 4UOFA 2JJ4D 2YNIB 3IM9A 3KUHA 3U02A 3IWXA 1YUWA 3OLBA 5E5NA 1UKUA 2LCWA 3PVXA 3CMES 2D0PA 2MKKA 3VPZA 4DEZA 2HMPA 3PW5A 3VZIA 3QIPB 1HMVA 3MURP 1K44A 5H9FK 3A1YG 3MMVA 2QLWA 2YKMB 1NH7A 2FQQB 2FC9A 2HS4A 2FHJA 2I7PA 2ZE2A 3I4HX 3DDIA 3HI9A 4ED3A 4CF9A 4FLUA 4H0VB 1ZZNA 3CD0A 5CYMB 2LXFA 4YDUA 2OP5A 5TKYA 4CJ5A 3PYFA 4WIIA 4AM6A 4ID1A 2QKKA 3MM9B 2W2MP 3NCRA 4MYUA 1S3XA 3AVKA 1RWNB 4NRTA 1H6KX 1CSJA 2B6AB 4O44A 4EUVA 5CCLA 3MAAB 1BY9A 1S6QA 3HJVA 5D6GA 2LDYA 2X51A 4EYHB 1Q5YA 3AO2A 4M7XA 1UETA 5L39A 4JYAJ 1HNXK 3EGZA 3PO5A 3OR1B 4YN3B 1F5AA 1CULA 1AFJA 5KAKA 3OT9A 3G6YA 4I64A 4CJKA 2F5GA 4BY9C 2YVSA 3RWUA 1OO0B 3PR4A 2KXHA 3K5PA 1HBOB 4DR5K 4Y34A 2WSCC 5I4MA 5B0AA 3ZSRA 3A0IX 1SV5A 5U47A 3CEDA 3JSMB 4R25A 2V4QA 2KG0A 2OANA 1T0TV 1WHYA 3PW0A 3IAS9 2BQRA 4A2BA 3ILLA 2CPIA 1M1HA 3MCSA 4B9QA 4DV4K 1KHWA 2W25A 1AB8A 4USWA 1Y0HA 2YJEA 1RLCL 3BREA 1ACMB 2UUCF 4PWDB 1G7CB 3OTOJ 1FWLA 4ICLB 1KEKA 1ZTWA 5C2FA 1FKPA 3GV7B 4ZKAA 2IGIA 1PC4A 1YRXA 5J1PA 5THWA 1EZZB 4Z4FA 3Q22A 4X4RA 4DV3K 1YHQN 1RK8A 3MD3A 1HNWK 4NI2B 3UVJB 2OGUA 1LWCB 1ZETA 1TL1A 1S6OA 2DTUA 1JLCA 3PW2A 1D09B 1LW0B 1X1PA 2MSTA 2PO4A 3GIKA 3CJAA 1QQMA 2GO8A 4ECQA 3L0QA 4DR7K 4UW2A 2BBEA 4DV0K 1F2HA 1BO5O 2BRLA 4B9UA 2J0QD 3G4SN 3PO4A 3K89A 3LPTA 2IC3A 4JK9A 1P6TA 1A5VA 5H9EJ 3OSPA 4JOUA 3SPYA 3I31A 1ZBFA 3V9SA 2QKBA 2BYCA 2FBYA 4C3LA 2RU3A 5KG1A 1S0MA 3L3CA 4BRFA 2A6AA 1TFWA 3HVRA 3N6MA 1HWJA 4M5MA 4YDUC 4KB7A 2OEKA 1FDDA 3C3LA 1TYQA 2CPDA 1PAUB 4K7QA 4DR2K 1BGXT 2BJ9A 6AT1B 2P9PB 4OHVA 2G8KA 5LJ3Y 1ZOTA 3OYFA 5IZHA 4CLSA 3D2FA 3VOVA 1RZMA 4JI0F 4NLTA 3IM8A 2VG5A 1UJ4A 3CDWA 2P9UA 3W7BA 2G4BA 2ZKUA 2CQ2A 3I32A 4MIBA 2Q97A 4OJ1A 3KLIB 2NRVA 3QEVA 2NCKL 3H4BA 1Y3KA 4HDHA 2JEIA 3M6UA 2BANA 5CABA 1KSPA 1GLEG 2HHTA 3HTVA 3FFKB 3SMSA 5KI6A 2JVRA 3CF5L 3A8JA 2ZJRQ 2E7WA 1DZ5A 1KVCA 3U9ZA 3FVYA 1F21A 4BC4A 1ZA1B 4BRIA 2WVDA 4F3MA 3AVFA 1VBXA 2OZMA 3MWPA 1WHVA 4F50A 5J2PA 1HI0P 1RT7A 4WQ4A 3SBMA 3BM7A 4FZZA 1BE4A 4FWRA 5DG9A 4RW4A 5AQRA 3KMQA 3S7RA 1CXQA 1KTVA 3I33A 5C2DA 2V67A 1Q8IA 3FBBA 3CCQS 1NB7A 5GAGP 2HVEA 3ENAA 2D69A 5D4PA 4OZ0A 2E5GA 3OD2A 1MWYA 1RAOA 4ED5A 1QZ6A 2IBOA 3QBWA 2C28A 2PBDA 1U1KA 1FJ7A 5M2PA 2J9EA 4RZRA 2QWNA 4OLAA 3ZZPA 3AO3A 2O8EB 4DU1A 4E7IA 4DR4J 4HACA 4WE1A 2AD9A 1YJWN 1N6QB 3J8AA 1FK9B 3HXMA 2QV6A 4LFBJ 1S7HA 1UFKA 3W3DA 2W9BB 3QWUA 1NXIA 3T6BA 2F4VJ 4QZVB 3MHYA 2HAIA 2ZZNA 3PRBA 1SCJB 2V69A 5ETQA 3VEYA 1DLOA 1TK0A 1HNXF 1VSDA 1PSDA 3GL1A 4ZHRB 3S3NA 3SQOP 4NYZA 3D2EB 2Q6BA 1Q79A 5C2GA 2DFEA 3D0PA 1R6VA 2VQFJ 4I67A 1R0CB 4FCYA 1GOAA 1PCAA 4CLFA 4DR5F 4KH5A 5A2QU 3SAFA 2P9NA 2FZKB 3J80Y 3RBEA 3CCZA 4HH0A 1KLMB 4YDXA 5JICA 1BC6A 3B78A 5T7LB 5ETTA 2HNDA 2AMCB 3TRGA 2WVEA 4MLEA 3ADAC 3GZ7A 3VGSA 2G8IA 1J53A 3MUMP 2ZWPA 1VI7A 4ZOSA 1T9VA 1REVB 1R59O 2ZJPQ 3H46O 3QAUA 5K8PA 1VQPN 4ED7A 2MZSA 1PG5B 2ZVIA 3I96A 1T9UA 5ETKA 4KTZA 1RTJA 4JI6F 2DRBA 4RO0A 1Q82O 1VISA 3MM7A 4M5KA 3MFIA 2YNHB 2LEBA 3PY8A 4DV3F 2M3DA 2W7PA 2Z2YB 1SJ1A 3OVSA 3BN7A 4JV1A 2ZH4A 1HRHA 4BRQA 4M5JA 3SQ1A 3SUOA 4DOZA 4KRFA 5HLFA 2V51B 1UZHA 4W5OA 1A6LA 4LF9K 4KH1B 1RKIA 1MWKA 3U3YA 5ETOA 3CCSS 4CFDA 4DR7F 5DK5A 9RUBA 4DV0F 5BPNA 3LGHA 1D0EA 4WQ4C 4YOWA 2QA1A 1N56A 3I56N 1TV6A 4P6QA 3EPIA 3KZBA 4OYAA 4CHPA 2BABA 1X4HA 4WFNQ 4RLEA 5KT2A 4I4BA 3HLUA 3UIQA 2L9DA 4H5RA 3UDCA 2H4WB 1HD0A 1VSFA 4QPXA 3SJJA 1DQAA 4YOVA 2XMVA 2OPRB 4NL5A 3KG0A 5KG4A 3TARA 4I6MB 3E1YA 5M1NA 4OGCA 3JAMU 1WG1A 2DNGA 4PYDA 1TL4A 4KI4A 4DTRA 3QWPA 2C3MA 2OFHX 1XR7A 1RT4B 3TJAA 3F73A 4FJ5A 1RBUA 1BQMB 5KFUA 4NCAA 4ZPBA 4LBIA 4KRWA 3R6GB 4CZFA 1KD1O 3CCRS 1TP7A 1S12A 2R3VA 1F3FA 4XAKA 3MPUB 1FKOB 3ZO7A 4B1VA 2GQQA 2H9ZA 2EX3A 3NAEA 5K8MA 3QESA 3J81U 3VGKA 4M5GA 2X7IA 2B4JA 1RAFB 3AT1B 1F5CA 3QFHA 3VGVA 2LSNA 2DEIA 4IYQA 5E41A 3THTA 3R5AA 1VSIA 4DV7K 1J5EF 3WDOA 4B3MJ 2HNZA 3SCLE 1SKSA 3A5OC 3NF8A 3TSPA 3OLAA 1Q78A 3BDEA 3THYB 2VFTA 2U2FA 3MMAB 3AGKA 2UVVA 2PFDA 3IXQA 1W2IA 4HWIA 4JS4A 1ZZFA 3L2RA 1KTQA 4F4XA 4P10A 1WEZA 1YJNS 2E5HA 4BG9A 3GJRB 1LWFB 2XBPA 1C4CA 3MR6A 1MDUB 1VYAA 3QO9A 4FW2A 1VRTB 1RAAB 3TR5A 3UO0A 2JFKA 1X5OA 1V6HA 4FJ7A 1P1LA 4K4UA 4DS4A 1E4FT 3HSZA 2ZHAA 1HUXA 3C19A 2W4DA 3MN5A 2CDQA 5LJWA 2N3LA 3THPA 2AQ4A 2GMJA 3WZ0A 4Y2AA 2KI2A 2WBMA 2KT3A 5CYQB 1N36F 2DR5A 5CD4H 2XI3A 1MN7A 3ZZOA 1CZBA 4B02A 4JKAA 3B8HA 2QA4S 4QBUA 2VOPA 5HO4A 1Y97A 4WF9Q 3FMBA 5HN0A 4FS2A 2KHCA 3Q24A 4KB0A 2HVDA 1SJRA 4DMZA 5ETVA 4F0HA 1TZ0A 1R7IA 2XS5A 3L9ZA 1C0TB 2FF3B 3RMCA 4B3OA 4PUOB 2ZD1B 5LXRA 3SQ2A 2J9DA 3OXLA 1JJ2M 1QSYA 4N5SA 1VQ9N 1VCTA 3G25A 2RILA 3JYTB 2M7SA 3T3FA 3P3DA 2D5RA 3CJKA 4OGEA 2VFRA 3S9HA 2AHOB 2Q3PA 4GNIA 4PXCA 4LF9F 4NRUA 4KGXB 3QINA 4LR7A 2W2QP 2NNWA 2DY4A 4KYZA 4MT1A 1DJ0A 2VU5A 4IBNA 1NDCA 2B8PA 2WB1D 5M2RA 3GU0A 4OZ2A 4K4VA 3KDOA 1OJ4A 1C2PA 3RAXA 4OKJA 4FK2A 1FXDA 3AY9A 5KT4A 2HHUA 3CIPA 1XNQF 4BDZA 4R0JA 4A59A 1J5EJ 1QD1A 3VN5A 2JZ5A 4JKDA 4FZXC 2VONA 4V19S 1RAHB 5L8RC 4GKJK 2HNYB 5JLHA 2XMKA 2YNGA 4DR6J 1HQUA 2DGWA 4DF4A 3T1HK 3KJVB 4J9OA 1S77D 3AO5A 4RW9B 1S72S 2CPXA 2EC0A 1D9AA 5LSRA 4HHUA 5KFGA 4F4WA 3UDLA 4OX9F 1ZBLA 2LKZA 3MCAB 2LA6A 2OLWA 4ES3A 1OH6A 3I9V9 4WP3A 3R9LA 3BKUA 1UVIA 3HHLA 4BDYA 5IT9U 2ABYA 2LLZA 3CC4N 4FZYA 2Y0SD 3PSFA 3NAIA 2LA4A 4CHYA 3QJPA 3MEEB 3D1QA 3GMGA 2ASMA 4Z94A 1Y64A 2C3UA 1S49A 5D0RA 1X0FA 4X4NA 1T7PA 3CETA 4CZLA 3V6DA 2X3GA 4IDKB 2F9TA 1UP1A 3LPYA 3M2RB 2GAHC 3MOZA 3KG1A 3DRXA 3NCIA 3V4MA 1Q95G 1IH7A 1IBKF 2ZWHA 5I42B 1OY9A 2WVFA 2QYCA 3KLHA 2OO4A 2RVJA 3NOGA 1HNZF 1J6ZA 2XY8A 1VC5A 1BD6A 3P38A 2VL1A 4JKBA 1CLQA 5BYRA 5DDQC 2ZJPL 5C25B 4Q44A 4ES1A 5J2QA 3RJMB 1JLAA 1BISA 1NBWA 4ED4A 1TL7A 3L3VA 1I1GA 4CLKA 3RW7A 1KQKA 2NYIA 2E1PA 4JI7F 2UXDK 5D4LA 3DU6A 4BC7A 3I4PA 2OPQA 3ZSZA 2A3ZA 3A8EA 4YS2A 4F4ZA 3K9JA 4UOCA 3A3OB 3PYDA 4USHA 3GIIA 1S99A 2G8FA 1URRA 3AOBA 2FBXA 2OYQA 2MQPA 3VQEA 4DV2K 1IWAA 4BRNA 2H5IB 1X9JA 2H5EA 2PSZA 1S9EA 4E2FB 1F0XA 3V9XA 4B9SA 1M90O 1JLGA 4CBWA 3E8OA 2VIHA 2HZAA 2BQ3A 3EGVA 5LMNK 4GVLA 5BRHA 1DAXA 1FKAF 1HNIA 3TW0A 4CD3A 2PA8D 3MPYA 1NB2A 3ILJA 2GAGC 5BPMA 4WFNL 1E6YB 4FJXA 1P8GA 2DNRA 3PW7A 2GGPA 1HYSA 2C1EB 2Z2ZA 4I2QA 4O4GB 4K42A 2W4CA 4FWQA 5F0XA 3TAMB 2IM2A 3C66A 2QIFA 5EOYA 3VEXA 1M5VC 5IWAK 3BSAA 1FFWB 2NXJA 5DJBA 1NGDA 2ADCA 3U3GA 2W40A 1UEVA 1D3WA 4RW7A 5EWGA 4E1MA 5HQ8A 1F6TA 4JI2K 4JI1J 1GAOA 1LW2A 2YBVA 4ZCMA 4OLBA 3HHLC 1W2BM 2ZH2A 2ERRA 5A76A 3ZX0A 2PI5A 2Y3YA 1S4FA 2DNZA 4OX9J 3VAGA 4EYIB 2VBZA 3ZTPA 2GVZB 3C16A 4NASA 1LKZA 2E44A 5F8NA 1TUGB 3K2PA 2EPIA 3HFZB 3V9ZA 2XO6A 1KQSR 3DOMB 2JLGA 5CZXA 5DM6Q 5LSLA 3R27A 1PJ6A 3QRQA 5SWMA 2Z56B 3JS9A 5JJBA 1Y00A 2PMZD 4PL8A 2IAJA 1UWAA 4LBPA 3PG9A 3OL7A 5CZ2A 2WB4A 4FS1A 4NO7A 1VK0A 2BJ7A 1VOMA 1IBKJ 4WFAQ 2IJNA 4GKJF 2MYFA 1L5UA 2JVOA 2JH3A 4WBFA 2E7XA 1NU0A 3ITHB 4YOUA 1HNZJ 3T1HF 3DRRA 4CECA 3WEEA 4J2DA 3N5BA 1LWEB 5GADU 2CYYA 3R9PA 5D0EA 2C2EA 3MXJA 1P1TA 3L2UA 1F1BB 4PZVA 1MU2A 4E7JA 1FX4A 2DR7A 3PX0A 4OHYA 1J2VA 1WBBA 3DLGA 4JI7J 1HMVB 2B7CB 2RHKA 1NPRA 4BRHA 1KVBA 2XYHB 4ED1A 3L4BC 3C6UA 2V0NA 2ZE2B 3AJDA 4XDDA 3HSDA 5K8OA 3DMJA 1RCOB 3G8QA 3BUZB 3N01A 4ED8A 2H51B 2HGMA 1RT3A 4A47A 4O44B 2W8LA 1H98A 4WF9L 1S6QB 3CD6N 2QEXS 2DNKA 5F8HA 2RQCA 3ENBA 2MKYA 2NREA 1ZAXA 2P9GA 3MF5A 2ROPA 2ASJA 3M9NB 3GE1A 1CULB 1EKSA 3ULHA 4ANDA 4B9VA 4RBTA 1IKXA 2LQ9A 3R5CA 1FT8A 5JUMA 3DXKA 2G8WA 5L1LA 3RR7A 2VC0A 2HK2A 2DNNA 4LSNA 2ASYA 3GDQA 3RB4A 1ZBSA 5ADZA 1ZS6A 1WSGA 2UXDF 1SV5B 1R0BG 2Q66A 4GMJB 4DR1F 2WSFC 4FWPA 1SUQB 1VRUA 2QMWA 2AYBA 4RG8A 4LRAA 4K8RA 1HKGA 1CQNA 3ISNC 4O0IA 1I3AA 4HUGA 5KFDA 4DV2F 3TABA 1T8EA 1QVGM 1RBLA 2GA7A 5GAHI 1VQ7S 1UEKA 3VQ8A 3G6EN 3CJ3A 4F4YA 1S1WA 4CW7B 2A6MA 4R5PB 4E1NA 4BVOA 2A41A 4X66F 5JLFA 1LXJA 4IOCQ 4NEYA 3D0GE 4RWXA 1RWMB 1FKPB 4UQGA 1N32F 4WKYA 1PYTA 1APSA 2PD1A 3AXMA 2BH1A 3CCLN 4DFPA 4LRDA 1RT5A 1OH7A 3CD5A 1TL1B 5AQWA 4KFBA 1JLCB 2J0SD 4E89A 3MZIA 4USUA 2XQCA 2A1BA 1VQMS 4DFJA 3Q2SC 4RU2A 5CXTA 4EBCA 2C3YA 5HMWA 4DCHA 4YB5A 4QIFA 4F3OA 1U24A 1Q8KA 3Q7BA 1EHWA 2HRUA 4IR1A 4OI3A 4J9LA 2KH9A 4FL9A 2UXBK 1X4BA 1VQ5N 2E88A 2IC3B 3PIOL 4DSKA 2VUGA 2BW7A 3BYRA 1YIJN 3LF0A 1WHXA 2PY5A 2HGNA 4O3OA 2J8SA 1SL0A 3OYLA 1WSVA 2KB2A 3DAWA 2H5JB 5EUHA 3IS9A 3TA2A 5KRTA 2VBWA 4YMEA 2O8FA 3QIOA 1B9DA 3MWTA 3TPQA 2CPZA 1RDBA 4B3SJ 4H8KA 1VSMA 3ZSQA 1IN0A 3W65A 1WDTA 3D2FB 1L3SA 1H2VZ 1LFWA 4LFAK 4OZJA 1EP4A 2VG5B 2P9UB 1VLYA 3Q8YA 2ZDPA 1R8PA 4CH1A 3OUYA 4PY5A 4CHNA 4YHHF 2UUAJ 4KHUA 1C1BA 4N41A 2ASOA 2V50A 1X9WA 3EKUA 4CLUA 3KYLA 3MPVA 2BANB 3MMCA 3QBXA 3CC2S 1RE1B 4WCEL 4KGZB 4IJNA 3M6XA 5CZ1A 3CFOA 3G71N 2NXCA 4CI0B 1WUAA 2X78A 3HK2A 4DB3A 3EXYA 5L1IA 1RTDB 3CMAN 3CJCA 2A6OA 1R0AB 5AZJA 4DTJA 1C0GA 4KHNA 4FP9A 4K8ZA 4NLOA 4CD1A 3RBZA 4RCHA 4NLQA 3QQCD 2FC0A 5J2PB 5LXYA 1YLXA 1RT7B 4RW6A 2XS2A 2C2OB 3HJFA 2GMHA 4DR1J 2CQBA 4H5WA 4RW4B 2IVNA 4M3XA 1TKTA 2WBRA 2BKPA 2KYZA 4JRPA 3ALYA 4CDIA 2CJQA 5KFIA 1SC6A 1OY8A 3TTCA 4FJLA 4B3RJ 1IKYB 4ZJLA 2NXEA 4LFCK 5AJ3J 3UPFA 4JV0A 4KGVB 1RWVB 2Q0UA 3CM5A 1ZAVA 3H2VE 4G9ZA 5EX0A 3C2PA 3SXLA 2B4PA 2V2ZA 2W01A 2VGNA 4HACB 3HVTA 4OZ3A 2CG4A 4WE1B 2W9AA 1V4TA 1WSIA 4FYWB 3K9KA 5IV3A 4BR4A 4I69A 3KWMA 5EN1A 4OI6A 3H6EA 2R7YA 3DLLQ 2WVCA 1DLOB 4I56A 3KG4A 2GNKA 2UU9K 3C6AA 4ZCIA 1JMTA 3O6QA 2XZTB 4OZLA 3PX6A 3T7ZA 5EX5A 1KDNA 1K1SA 2OTJN 4CJ7A 3M3ZA 1N33J 3IC1A 2NZ4A 3K2YA 4EHTA 1KAYA 2ZF5O 4WKRA 2DR9A 1RHRB 3KKSA 1UVMA 4DL3A 1GX5A 1IKVA 3PR5B 1HR0F 2H3EB 1OYEA 2HNDB 4NLXA 3P83D 3THXB 2IYIA 1OKJA 4KPYA 2LU2A 3NOCA 4L75A 4CK3A 1RA7A 2RDJA 1RSCA 4MK7A 3AOAA 4JI3K 1E4GT 1NOZA 4ZVRB 3BEXA 5KRSA 2P1JA 4HT5A 4DUYK 4YR0A 1Q81O 1WTBA 2RQMA 2XG8A 1U48A 3PYGA 5HVGA 2P9EA 5DM6L 1RTJB 3KHHA 3VTHA 4CEQA 3MM7B 1KQSM 5HQLA 1PBUA 3ULEA 3EJMA 3R7BB 2YQ0A 4CEFA 3TVZA 2F8MA 5LMUK 3MR2A 4DLEA 4Z4EA 1ATSA 2HEKA 2E1YA 2VJVA 4K5SA 1NSQA 2FLOA 2RDDA 5HLFB 3R2DJ 4WFAL 4F02A 4BRMA 1FDBA 3T1YJ 5F2RA 1FX2A 4TY8A 3WQUA 2UV8G 2BUPA 4B9MA 4ZVEA 3NFAA 2OUGA 1NOYA 2X3DA 1TV6B 2L9NA 4B8AB 3FZ2A 4U96A 3W9JA 3CCEN 1SBRA 1S5JA 3CCJS 2GWKA 3ZT4A 3F5TA 1NMEB 2EBGA 5KOXA 1AW0A 4CEDA 5KFOA 2DB1A 1FTCA 3W5ZA 1VQYA 4DHYA 4DU4A 2PFUA 2MZ1A 4V19X 4X2BA 1EQYA 5HRPA 3EN9A 4P2MA 3LAMA 4B9LA 1S76D 3CMEN 4LFAF 1QUVA 3BDPA 4CGGA 3L6QA 3ENVA 2QTWA 4HR2A 4ANCA 4XK8C 4CJFA 3F41A 2KT2A 2YPYA 3NGIA 3LP3A 1UW9A 2EKNA 1EQMA 3PFOA 2GVDA 5JMVA 1PKUA 5KPRA 4K8XA 2AA4A 1EJ7L 2V2KA 2ILYA 1NRKA 3AO4A 4DL5A 3ZEUA 1IBMK 2P9LA 2IRYA 4LF7K 4HHJA 3VAKA 3MDQA 1B64A 3PNIA 2FJVA 2QO3A 4NMLA 4KHYA 2XLKA 5EWEA 1XMOK 4ZLPA 4LF8K 2NRXA 2QA2A 4NXNK 1KOOA 4M1KA 2HNZB 4CNZA 2LU1A 1HR0J 4O3QA 1I5OB 1FFGB 4AUKA 2WVBA 3PEJA 3U1NA 1G15A 4RNNA 4MLHA 1D9FA 1Q18A 2CWXA 4GVBA 1G3OA 4DFMA 4KH4A 4F7VA 5KPTA 2HLTA 2KRBA 4TQRA 5E3AA 5AQXA 4FF3A 2IVMA 1UVJA 3QO9B 2XWYA 2HHHJ 3VALA 4OX6A 3PM9A 2Z57B 4XPCA 4NLUA 3ZYYX 2XLIA 3BV8A 2D0BA 5SZTA 1RDCA 3G96A 4CJLA 3KLGA 1HHTP 2MHNA 1NGJA 3OL8A 2WW4A 2XHWA 2UU9F 1VQ8N 1RADB 4FF4A 4ISEA 1YAGA 3ZZTA 4CRJA 3ULDA 4DV4J 3VAIA 2GV9A 2MQOA 4FXVA 1U1RA 1U2CA 2HQIA 3CJRA 2DT9A 1S10A 3SI8A 1XNRK 2UXCJ 3UW1A 5B0EA 2V8DA 1X4FA 2FLPA 5CHIA 4FPBA 1P8ZA 5CCMA 2I8EA 2B5JA 2ETJA 3GFYA 2VG6B 4TKTA 4JI3F 3QFUA 1XTZA 1GEHA 2LP4A 3PTWA 4MFBA 4AT1B 4DUYF 5J1EA 2NZCA 3KJNB 2IOCA 4ECXA 1PBAA 4IG0A 4B3OB 1NM1A 4DQPA 2ALZA 3JS6A 4M7YA 2DTJA 4JD2A 1S1VA 3WXKA 4IJAA 2DEJA 4BHQA 2VZ9A 3N4PA 3RSEB 5F9NA 3JSBA 2F96A 3BO2A 3N28A 2EFGA 4LMZA 3CJKB 1GT8A 3ZNJ1 5C42A 1YRUA 3AVBA 4RX6A 1VSEA 2FJWA 2ZH7A 2W7AA 1CJVA 4CZJA 2XYGB 4O23A 3D66A 4KGKA 4FLYA 3H90A 3RMDA 1SC3B 2BTFA 3HI0A 1NO8A 4TVAB 2V4JA 1VFJA 3HCXA 5AFUA 4LF5K 1N5SA 5D0HA 3D6TB 4HUFA 4UOHA 4KHQA 1IBLK 1HWUA 2HBKA 1UAXA 3SSRA 3IAM9 3TVYA 4ZPDA 3G6XA 2MZJA 2ITGA 4CF8A 4O4RA 3QFPA 4K2XA 3NVMA 2CQCA 4A4JA 5GINA 1BU6O 1IJJA 2A18A 1VHIA 4JAXA 2YNGB 2UUWA 2HRTA 4QS8A 3ZFVA 1HQUB 2L48A 4FF2A 4FWMA 1GOBA 5ELZA 2CA9A 5T41A 2XB2D 1FRHA 2EKYA 2ZHOA 1MSWD 1HQ2A 4LSLB 2RMLA 3AD9C 1Q82T 1IQTA 2YTCA 4G1PA 3VETA 3R8EA 3Q8RB 2VA3A 3ILIA 3DLLL 2ZEJA 1FRJA 1YVUA 3JB9k 1WUUA 2OAUA 1DFDA 3RUBL 1C0FA 4LF7F 5BXIA 5GAEU 4ISGA 5D4OA 2DH9A 3OBIA 3PFEA 1HLWA 3V6DB 4NZ7A 2Y1JA 1XMOF 4LF8F 2XMUA 2Z30B 2F8SA 4NA3A 4U67Q 3VGLA 2KHDA 3UB5A 4BREA 3M8QB 3ZETA 4JI8J 2GW8A 3KLHB 1K8KA 4BG8A 3N4QA 4D3HA 1Q5VA 2COLA 3GPAA 3KK2A 3PXGa 3QB0A 4W92B 1HL6A 5HANA 4FJMA 1DHMA 5CD4A 2E66A 1NCLA 3ENQA 1FEHA 4FJKA 5J2QB 1JLAB 4XEIA 2W8KA 1TL7B 2OCEA 4MJKA 1S48A 4ED0A 3BPDA 5ETNA 3J7Z5 2OPQB 3HZ6A 5ETSA 5A8KB 1C6VA 2RUSA 2CG8A 2QJ3A 4UUXA 3WX4A 4IUFA 1E3MA 3FGUA 3GIJA 2HFOA 1S9EB 2D9OA 1S9GA 2VDHA 5I3PA 1D9DA 1LEOA 3D7EO 4DL7A 1JLGB 4OYIA 1KD1T 4OQJA 4AD6A 2N7CA 2DGTA 2HBJA 2RQKA 3J7YP 4CLPA 4HHTA 3VGUA 4DR3K 2FLLA 4B8CA 2YCHA 2LXUA 3LDSA 4WZQA 1HNIB 3SFUA 3OPKA 3W61A 4WIQA 2BACA 2HVIA 2VQEK 2GGPB 1U25A 1NJZA 1HYSB 4I2QB 3I82A 4F9OA 3CCSN 2P8IA 3FZLA 5HSPA 2CNOB 2QRRA 1X60A 2RRNA 2DNQA 3BZQA 5FLXO 3MGJA 2WRMA 3IP0A 1EX8A 4IH7A 1VQ6N 1TUVA 4K4ZA 1N52B 4WYWA 4RTFD 3BSCA 3AAWB 4N77A 1KFSA 3L2QA 1OQ3A 3UKRA 3SIPB 4TY9A 2K7KA 4RW7B 4CYUA 3FCHA 1MWMA 3ZTSA 3KDNA 2ZITA 4OL8A 3K5MA 1SJFA 4ZPTR 4DMNA 1KC8O 1HNVA 5ETRA 3BSNA 3OYJA 2HURA 2UVRA 1HLUA 2VICA 3JQJA 4GKKJ 3EPGA 3C16B 4QWBA 3GTYX 2IIRA 1ZXOA 3MD1A 4XO0A 4C8ZA 3NL0A 4LF5F 4QCLA 4OIXA 1QVFR 4FYYB 2MPUA 2JWKA 1KVJA 3C46A 2QWQA 2GX9A 3E66A 1IBLF 4JKFA 2EC2A 2HQFA 5GMKa 4M3RA 1T02A 4DTPA 2IAJB 1JJCB 3GIMA 4NWBA 2Y1IA 4R79A 3VR1A 5AQOA 5KFSA 3CCRN 1NKEA 4OPKA 2D3O1 3LANA 1GMWD 2POKA 2DXFA 4X84A 2Q3SA 3IRXA 4I6WA 3DRRB 2ALYB 3WEEB 3VQ5A 3G82A 5F8GA 4LUBA 5DQGA 2B9XA 2D4WA 4USKA 5KFRA 2V34A 2B8QA 4MK9A 4DL0C 3RBDA 4YB6A 1LWXA 3ZSXA 3AVJA 1GLJO 3G10A 3DLGB 1JJHA 4NZ6A 4XTTA 1OPZA 4CGHA 2RS2A 4W98A 3K5LA 4DV7J 5FRNA 4UY85 1YJNN 4U8VA 2H3GX 1QHTA 3DMJB 3W2WA 3VVUA 1QQCA 4GO5X 4BDPA 3PJWA 4J9KA 3KNGA 5GAHP 1TMMA 1BL3A 1RT3B 3EVWA 4JK7A 2GIRA 4FYVB 3O80A 5BR8K 2JL9A 3LW5C 4F3TA 4C8LA 1KRPA 4DZ6A 1H73A 2BE9B 1SQFA 5ADXA 2KFYA 3GILA 2FPHX 2QLXA 1RUSA 4O55A 4IO8A 1RBTA 4WK3A 2EFQA 1U1NA 3DC2A 4YUDA 3M2VA 4PG5A 8ATCB 4OPAA 2X1BA 3DXKB 2QA4N 1GFWB 2R8GA 3KD1E 4P74A 2AF6A 4LSNB 1N0UA 1NK7A 4A2AA 2KKHA 3IMQJ 3WXLA 4FSVA 2V9KA 1VRUB 2PI4A 2VPZB 3D4JA 3H59A 3NGZA 3TSUA 3ZT0A 2LQBA 1RYRA 3OTEA 3VQQA 4DHVA 2UP1A 4M5NA 4IEEA 2J7WA 2Y8WA 4PPDA 2V8HA 5M1KA 3O3HA 4FM2A 3HP9A 1S1WB 2XCAA 4YB7A 1KQFB 4KJIA 3EZWA 4K0KF 3CUNA 4TN2A 1ZM3A 2R42A 3IR5B 4DV1J 3IMXA 1S4EA 1T95A 4DV5J 4Z4GA 3NGTA 4NLPA 3ELHA 3FQLA 4JV5F 4ZP6A 4KTWA 1S79A 1QQNA 1V9OA 2ZOMA 4P72A 2VQEF 4FLWA 1RT5B 4AYBD 5BYQA 2X6SA 5DMRA 2JC0A 4KFBB 3A2FA 4KAIA 2CZ9A 1IR2A 2ATQA 4LF4J 1T44A 1V3ZA 2C22A 3TNVA 2AJ0A 2ZM6K 3D3CJ 1RJJA 4MQ3A 2F40A 4DU3A 2QX0A 3UR3C 1BA1A 3ZTRA 2RRBA 2P5VA 2PIIA 1VSLA 2F1FA 4TLRA 4WXOA 1ITGA 3RMBA 3TTFA 1Z2LA 1JXEA 4ENOA 3GV8B 4MO5A 3VTIA 4CZHA 3I55N 3IS9B 3A8IA 1TL3A 5IT4A 2O8FB 2XMJA 4JKEA 5F9LA 4ISFA 3MDFA 1X4AA 3RRKA 2IMOA 3OFEA 2ZBIA 3QETA 3DOLA 5M1OA 2EG2A 4AHVA 4DJBA 3CW2C 4M5HA 1P9QC 1VJWA 3QBCA 5D77A 4FK0A 3H8YA 4ELTA 4DQSA 3IR6B 3M32B 3NNHA 3K0SA 3PX4A 4GY2B 1XHXA 2HHQA 2LQJA 1Y5LB 2E5JA 3OUYB 4Y3CA 1C1BB 4Q43A 4CEOA 3LZIA 4U67L 1U26A 2A0FB 3NH0A 4L72B 4OX7A 1MMDA 1WLJA 2OSQA 4PQAA 5KG0A 1KN6A 3CJQA 5KFMA 4FJ9A 4USVA 2F9DA 1QZ5A 3PV8A 5KFEA 3ZZYA 1OH8A 1TKXA 4NPOA 1VQNN 2E2PA 4M3WA 5AQNA 2AJ4A 1UA1A 3QAEA 4F2SA 3BH7B 1CZ9A 2BZ2A 3DXBA 4ECRA 3C6HA 4IOBA 2CPYA 2G0IA 3OR2A 3WNHA 2ZFHA 1JB0C 4LJMA 1VQ4N 4RW6B 2XY5A 2QTDA 4QW8A 3DHXA 3UQSA 1NGAA 4BS2A 3RBXA 1KONA 1T3NA 1S1XA 3GR0A 1QSSA 1S1TA 2IHR1 4JYAK 3OL6A 4AHUA 3SMPA 2F9JA 3TO8A 2YKNA 3TAGA 5EY4A 3LOUA 2HBZB 3T1AA 2IS3A 5CE3A 2DR8A 1BHNA 5L9XA 2BQUA 1BOTO 3QLHB 1IBCB 4CFBA 1RHUB 3V1OA 2MLXA 1H2TZ 3Q2TC 5L46A 2FSJA 4CO5A 3EVOA 5JXSA 4A5AA 3CDBA 4OKKA 2OTLS 4KT0C 3HVTB 4FBUA 4CEZA 4O3NA 5L38A 2B9EA 1RT1A 4ILJA 2BRKA 1KQGB 4TU8A 2CJ9A 2Y1RI 2ZBRA 3NY0A 1XI1A 3S3OA 3TOQA 3CFRA 2AJQA 1U4BA 4A8KA 3P4UB 4PKIA 3E01A 2HIQA 3PHTA 3SV4A 4ANEA 5E3RA 5LL6Z 5IXUA 3OTOK 4QOTA 4HCBA 4NLYA 4ZVFA 1NGGA 4R0EA 3KLVA 2YH0A 3VAJA 5LMNJ 2XTJP 2XZDB 3LGMA 4FXDA 1MW7A 2ITMA 3U6FA 2FSKA 4YOTA 3SEOA 2O1PA 2RAQA 4M94A 2BJDA 3R5DA 3AA8A 1XQSC 3P5TL 3QSYB 3CWJA 1UCNA 1T3OA 3NWRA 1FNXH 3FEYB 3CJSA 2MJUA 5A6PA 2BR0A 1FERA 2BE2A 4BBYA 2DNMA 2NPFA 3O9SA 3V1RA 2GIQA 1PGZA 3M2UA 4J9MA 2FGOA 4ZJOA 3ULEB 5B7WA 2RN2A 1QVFM 2NXNA 4BVPA 5B09A 4RUAA 1UTAA 4YB1P 1GLAG 4HL9A 1RHQB 5CA5A 5E33A 2ZM6F 3VAMA 4IOAQ 4TY8B 4LRCA 3GG1A 2E6MA 1XMQJ 3LM9A 1RCHA 3ZCMA 3I5AA 3HPOA 1H2UX 2A5XA 3C94A 4EEYA 1BMQB 1PYOB 4P52A 2HS0A 3J7A1 3ETOA 5KT5A 3FSXA 5AE1A 5RUBA 5HRSA 4ZVOB 1NSKL 3OTBA 3VF6A 3O4NA 1P9YA 4FN5A 3QYYA 4OZ1A 4Q2MA 3L2VA 1JLQA 4YORA 3L3UA 4DPWA 2VPXB 2M2BA 1S97A 2V8PA 1T05A 1X31C 4FM0A 3D6MB 5AXLA 2H54B 2RD5C 4DWIA 4ILGB 3K57A 4DX7A 2CGKA 4DLGA 4G1IA 5D0GA 4X64J 2IRUA 2CZ4A 4N7TA 1DBDA 4L3KA 1K6YA 3MI7X 5KQ8A 1NDLA 1M5OC 3MXMA 2MKSA 1CJTA 4G65A 4ZLNA 2AGPA 4CK1A 2GVDB 3NF6A 2K1RB 1WD6A 4KQZA 1TUUA 2KZZA 1HWKA 1B70B 2PA3A 3ZEUB 2IFXA 1V3SA 3QJLA 1EETB 4DR4K 2F63A 3VQAA 4Y0WA 3BZCA 2BJ8A 4DFKA 1DQ8A 2G2YA 1Q86O 2Y0BB 4LFBK 4JKGA 2XC9A 3FEXB 1NPKA 2M52A 4CJ3A 4JYAF 1YJWS 1WOPA 5E0OA 3V6KA 3TWZA 1BUXA 3AB4B 4E7HA 3FJ2A 4FLTA 1B9FA 3JQMA 3MX2A 3HULA 4GVBB 2VOOA 2B56A 3GG0A 2G8UA 3N6LA 4ZPCA 4KPCA 3S8SA 3ZNUA 2JDJA 5AQJA 2AW0A 2DO0A 2VKRA 1S7IA 3U8XA 2RJZA 3JXUA 2ATLA 5F8MA 1A9NB 1SH0A 1RU1A 1U1OA 3R2CJ 5HQMA 4MKVA 4L3QA 1LV5A 1VQ7N 2JX2A 2MEWA 4TSXA 4FWKA 3RYLA 3HZGA 1RHKB 1FF2A 5LL6d 4ZLLA 2AEMA 5EVZA 2E1AA 2V94A 3MMBA 2J6SA 4C8KA 3OTOF 3OYAA 2D3ZA 5IT0A 1XC9A 5M1FA 3KHRA 1N0VC 1RTZA 3GV5B 1VQPS 1LAWA 4Y2MA 4BE0A 3VQTA 2Y1LB 1X5TA 2D0AA 3KOAA 2J0WA 2B5JB 1TK8A 3DJCA 2QWLA 4YNQA 1RBVA 3EYZA 5KFHA 2J4RA 4B3TJ 4F0KA 3BS9A 2CFXA 4A8MP 4EWTA 2W7OA 4WWSA 2ZGYA 4ZTJA 3J81j 3JTPA 5J1EB 4OI4A 4CCHA 3MEGA 1GXUA 5ETPA 1S0VA 3CCTA 3DLKA 3TYTA 4IG0B 4DSLA 3E9LA 4IOXA 3HX9A 5KFNA 1N5TA 1S1VB 4DUTA 1IG9A 3N0VA 2E5LJ 1UA0A 3NRBA 2V9WA 2UXBJ 4RNOA 3MOJB 4HTUA 2W9CA 3B4MA 2KHOA 3EX7B 2P9SA 4CJEA 1EIYB 4I2PA 2DIVA 3L4IA 5AQHA 1I6JA 1G2EA 3PHEA 1CJVB 4FYXB 1NMNA 4DSJA 4AQYF 2IDOA 1JCFA 3CDEA 4BRAA 5FLXU 2DH8A 1FESA 3SSSA 2M88A 5DS7A 1GK8A 2E1RA 2RIJA 4FPRA 3DOKA 3CC7S 1C1CA 4LIRA 2NXUA 1TKZA 2YNIA 2D3UA 4C3KA 2IPOB 4LSZB 2KKZA 5HVFA 2DISA 4CIEA 4DXLA 4F36A 1WAJA 2R9LA 3CM6A 1C0UB 5A0YB 5DO2A 3BJYA 2YKMA 2F8TA 1WG5A 2CNNB 3HKWA 3KLEA 4B1YB 5DQHA 3NS5A 3C15A 3MN7A 4ZVUB 3O9TA 4JEPA 2R2TA 2PAVA 5CYMA 2IA6A 1GX6A 2GQCA 3NLCA 3OYMA 1SQEA 1Q81T 4K25A 1OYDA 3L7UA 3EO3A 4BRPA 4DPXA 3I8DA 3D1OA 3DLHA 2G13A 2EFNA 2PGCA 2MGZA 2DPJA 4DTOA 2D41A 5GIPA 3ATVA 2NUHA 5LOQA 3T6JA 1Q16B 2LFVA 5AZIB 4LVOP 1FJGJ 2GC8A 4G1QA 1U2VA 2MSSA 1MWZA 2EWHA 4J9SA 4N8NA 4OKEA 3QGPA 3CXCR 3QZ8A 2P9KA 3J80O 3MN9A 2GO9A 3OR1A 4E1JA 3WNEA 3BQ1A 4ZIVA 5I9EB 4ZPWR 1YGYA 1QS4A 2NSBA 2KL8A 2NLWA 2DO4A 5DDRC 4DR4F 3SPZA 2VA2A 4JI6K 4XDCA 4LFBF 1XEZA 1FXRA 4KHPJ 4K59A 2XHBA 1FHTA 4M45A 2F4VF 3PKMA 1RQ0A 4C8OA 3RB0A 3ZETB 3HHEA 4JI4J 3IAYA 2YX7A 2VG7A 1K8KB 3D54A 2XSFA 1U09A 4OFZA 4LQ3A 1X7VA 3JXOA 3KK2B 1NEEA 3HO1A 2VQFF 1VS3A 4PWUA 3A8YA 2OI2A 2K2PA 4YOEA 5C0YA 3I8BA 5KG2A 3FCWA 2XGQA 3DLEA 1HX1A 2GHVC 4R8UA 1U8SA 1S9FA 5BN8A 5AQUA 2MLYA 1S22A 3TR8A 1WC4A 3GJTB 3UKUA 3SBGA 5KT7A 3TZZA 3V5RA 4HUEA 1FWKA 2CUYA 2HFNA 3BZKA 2ZC3A 4TXSA 4IFVA 1X0PA 4NI2A 3UVJA 1NDKA 3CJ1A 2HWHA 2YNFA 4AHCA 3FZHA 1ILYA 4EBDA 2OMOA 1FD2A 1EWRA 1M1GA 1S9GB 1JJ2R 3C14A 1Q4RA 4ECWA 4AQYJ 4IOAL 4RNMA 3IWLA 3CMQA 1VIXA 2GQ2A 1DY3A 3TX0A 3V6HA 1JIHA 4C8NA 4CO3A 4ILHA 2OH2A 1TUYA 2P51A 2ZH9A 4AFFA 4OI2A 1V3RA 4Q45A 3GQCA 1VQ9S 5L1JA 2AKWB 2ZBPA 2JHEA 1U0SA 2KZMA 4JS5A 2ROGA 4BR7A 2FVCA 3GBTA 4I9QA 4X4TA 4QPTA 3WT0A 4H4OA 3NGSA 3FMWA 3VQBA 4C4WA 1YBTA 2CJAA 3UKRB 3CCJN 1S6PA 4C0OC 1TKDA 2ASPA 3RRHA 1T6DA 2AGOA 4CYUB 2JGUA 3LGNA 1YZ7A 5D4NA 2JLFA 2OPPA 3PJXA 4QU7A 1AZSB 1HNVB 1RWOB 1B7YB 5ETMA 3LP0A 3KLIA 3UD5A 4K4TA 3DHWC 1J5EK 4B08A 3OYIA 3DYAA 3ZTQA 3G6VA 4MH8A 1RDWX 3LPEA 4J7CA 5FD1A 1Z05A 2XLJA 4JV2A 2YKAA 2P9CA 4DR6K 5HP1A 2E7VA 3H45C 4ECYA 2D0OA 3Q0AA 4BR0A 1S1UB 1H0HB 4CZCA 1AT1B 2FJDB 1X4DA 4LF6J 2GWJA 3WXMB 3Q89A 2Q0RA 3BKTA 3MR3A 1QLNA 4ETXA 3MX5A 1JL2A 1PJ5A 1YJ9N 2HHXA 5KFFA 2MKCA 4CH7A 2VBXA 3S6EA 4CO1A 2FGCA 2U1AA 1BCOA 4JHDA 1JJ4A 3TUIC 1IWGA 2R7UA 4I1TA 2P5GA 2QL5B 1RI7A 1SXLA 3AVMA 3HPGA 4C48A 2DNLA 3IRXB 2QMXA 3HD1A 3WHIA 1KVKA 2QLJB 3G82B 4J9NA 1N36K 2ZBCA 4FPIA 3BQ0A 3E9PA 5DDPC 2P9IA 5AQSA 4WZMA 3EE8A 2YKOA 4B3MF 2CJYB 3CERA 2DY1A 3EICA 2KN4A 2W9BA 2FY1A 3UWTA 1X4GA 3AD7C 3F0NA 2W6LA 2CGJA 5AQQA 3MCOA 2CNKB 2Z2LA 3W2WB 2QLFB 4ZHRA 2V6AA 2VH7A 4QYRA 4CT8A 5SUHA 3RB3A 1U1MA 3KFWX 4QOZB 4OYPA 4C11A 2MMYA 5HL7L 2YY3A 4L8RB 2H1YA 5DG8A 3FEZA 4WFZA 5KG3A 3FDSA 5GAGI 3CCMN 4KIAA 1QTMA 1PAEX 5FRMA 1S5ZA 1RWKB 5JVHQ 3M2VB 3EZUA 1HBUA 2ACYA 1YT3A 4KR0B 1MROA 2EW9A 4BLGA 3PW4A 4CEBA 4B9TA 4X4OA 4AHTA 2D3OR 2OFGX 2QE5A 1IJEB 3P4IA 1BQNA 1Z26A 3H25A 4CT9A 2OD4A 3Q8QB 4DN9A 1O0PA 3V4IA 2PE8A 2HBLA 1GLBG 4J9UE 5AQIA 1Y9OA 2GJIA 1EAYC 3ET6A 1XNQK 4U6PA 3H0PA 3V9UA 3W64A 5ITHA 2MKHA 4LF1A 1TU0B 3ATUA 1CEZA 1HHSA 3SBTA 1NK0A 4YOYA 5KFPA 2GJFA 1U1QA 4M95A 1B4SA 2QWMA 2HG4A 1W2BR 3QEIA 5AFUH 4CM0A 4JI1K 1HQEA 1XMBA 3FZFA 4KBOA 1VQLS 1JLFA 3J7ZO 3SK3A 1NNEA 4K5RA 2CKWA 4OX9K 2G2OA 2V5HG 4HYKA 4CJUA 4CNYA 1NGIA 4ID5A 4FJJA 3HSGA 4X62F 2FTRA 3G87A 1R6YA 1YVFA 4W90B 3WUHA 4A62A 4I6MA 3R5GA 4URQU 3K17A 3SSQA 3VERA 1WB9A 2CQ3A 3UCZP 5FLXY 4U7UD 2A40A 2KTQA 1RDDA 3WC2A 2FHJD 2MJNA 3D0IE 1IBKK 3RTVA 2L9WA 2BOAA 5M1PA 4J5OA 4CZIA 4DR6F 1NUEA 4CE9A 1NZ8A 2FUG9 4LIWA 3HBTA 1HNZK 1WKKA 2WTFA 2O01C 3JSRA 4F26A 3DOLB 4ED6A 4IG3A 1IXKA 5GAGU 4FVCA 2AZ3A 3OTDA 3CXCM 4MIAA 1PC5A 3SI6A 1W7WA 1KCFA 1I51B 1CC7A 4JI7K 5D78A 1O8BA 4C0BA 4QW9A 1DEJA 4MDBA 3DLJA 4ZP9A 3MM5A 2B0GA 4QYZJ 2EEYA 5C5JA 4JKHA 1N34J 3GP9A 5E84A 1TKXB 2AT1B 2QFJA 2HVZA 3EEQA 1WI6A 3P31A 2CQGA 3CVKA 1LWFA 5E3PA 3D0HE 4WYBA 3UCGA 3TQEA 5CR4A 3P49B 3CG7A 1RDAA 3G2XA 3AH6A 3LM2A 2KDOA 3TUZC 1NJIO 4KH6A 4GV3A 5I3UA 5LT5A 1JLBA 1KC8T 4M42A 1S1XB 2CJXB 3FR0A 4ES2A 1S1TB 4B1WB 2VWJA 3CD6S 1OSDA 2HWIA 3QGIA 4J2EA 2YKNB 3H2UB 2HHVA 1LFPA 2ASDA 2KQ2A 1JNZB 4EIAA 4PQUB 4L74A 2AJ2A 4O8UA 2CAJA 2G0JA 5KGWA 4OYMA 3E3XA 1JKHA 3F9KA 2O5DA 4QR2A 1NK6A 2J8AA 4BGBA 4Y2CA 3VZHA 4HVJA 1QVGR 3DU5A 3CPEA 2VD3A 1RT1B 1VSKA 2I9SA 3ZSWA 1F5BA 2DGOA 3OHBA 2ZOGA 4Q2LA 4P71A 1JL1A 4BC3A 1M1KO 4UY8O 1A0OB 3GLJA 2A42A 3FSYA 3KVGA 3MCPA 1HWLA 3E01B 1D5AA 4X62J 3LDLA 2HIYA 2ZJRL 1C0TA 2E1CA 4NYOA 3EY1A 4USTA 4DCJB 1WC6A 1HPMA 4KTQA 2GV1A 4MAKA 2WONA 2OEMA 1CJKA 2UUBJ 2FBVA 3S1TA 2GX8A 4DR3J 1SPBP 1IO2A 3M8WA 4ELVA 1WBDA 3B6OA 3GYGA 3OV7A 1XQIA 3LA0A 4PRFA 3ZZRA 1HJOA 3CCLS 4CIOA 1NPPA 1X3NA 4HDGA 3I9ZA 1RXOB 5L9NA 3SUQA 3T5JA 4ZK7M 1RDRA 1VBYA 4C1NI 2DGUA 4YY3J 5K14A 2BE2B 4DPOA 1P90A 4QS7A 4JI1F 4FLZA 3CQYA 2O66A 1F2GA 2W6KA 3FCVA 3OYCA 4W5TA 4M3ZA 2RH3A 3BPSP 4I7FA 1J5OA 3CJ4A 3PACA 7AT1B 1AROP 1WF1A 2PN6A 3DXMA 1KS2A 3IBFB 5KT3A 3OS2A 4B3SK 1W9HA 4CJPA 4IRDA 2R8KA 1N5VA 4KHSA 4WTYA 2FSNA 4QQBA 3OYBA 1NGBA 1T03A 2ZH5A 3KWGA 2OIHA 3ZZ0A 3CPWR 1LQ9A 2O67A 1I94J 2C3OA 2JSXA 2H65B 1DURA 4TLQA 4IZ9A 3K58A 2W41A 3CCVS 2UUAK 2CQ0A 7FD1A 4ZCLA 4BQZA 1WNEA 4IH5A 2EFOA 5A8WB 2DY9A 4IR9A 4XH4A 4RPFA 2ZDOA 2R4FA 3ID8A 5F41A 3VQCA 1U2FA 3BB5A 1HBNA 4X65J 1T05B 2ROEA 3NGRA 4P7VA 4MIWA 3ICLA 4KC5A 3LP2A 3G71S 2DHGA 3OFGA 5B0FA 1NK5A 2YKPA 1XR6A 4DX8H 3CMAS 1PJ7A 2GHWA 1L3KA 2O3DA 1BG3A 4DR1K 2F8HA 3M1VA 1H38A 4FYDA 5GADI 5A2QY 5ADXH 1AUSL 4M5DA 2HHWA 1CJTB 4RL1A 2CADA 4A57A 1YI2N 1TAUA 3SDEB 1NLKL 4JN4A 3BGUA 3CF5Q 1DTQA 5JVHL 4JI5J 4LR8A 1KHVA 1SI9A 2EK6A 4DTXA 2ZH6A 4FW1A 3IBCB 3MM8A 4X66K 2D7SA 1T11A 5KG6A 1JCGA 5HJYA 1N32K 2QYGA 3WQTA 4O3SA 2G1DA 4H4KA 4JKGB 1MMLA 1RAIB 5D8HB 2MQ8A 4NLDA 3MTKA 1RWWB 3U9DA 2CQIA 1FJCA 1HW9A 5KQDA 4ED2A 1I39A 3OYHA 1Z25A 2V2VA 1KXPA 2RPIA 3J80U 3DRSB 3OVNA 3H5YA 1N33K 1LAVA 2WFBA 4OZ5A 3QPIA 1NNDA 4A46A 1ASUA 3O5TB 3BF3A 2XM3A 5DGBA 1J54A 4OJ3A 2DYAA 1WSFA 1VQSA 4M3YA 2R7VA 1FRMA 4OHZA 2PZSA 4K4YA 4IQMA 2HBRB 3D7SB 3DFEA 3PRDA 2FHMA 1I3OB 3H5SA 4E0DA 1CVJA 5FPMA 2VKZG 2X6NA 3MMBB 1WHWA 4IFYA 2HBYB 4Y28C 4Y1CA 2I5JA 1O6XA 2AP1A 1VQKS 3H5UA 5HMYA 4KO0A 2J7UA 3TAQA 4ECZA 1MA9B 2FHKA 2MZQA 4RJVA 2XY6A 3KWIA 3EZ5A 3JAMY 1R31A 5ETLA 2IMWP 4YHHK 3QZ7A 3D5MA 3W2VA 2D1KA 4MKBA 3U27A 3DI6B 1FJEB 4IRKA 4DV6J 3T1YK 3BQ2A 3W8PA 4CJRA 3DLKB 2X1GA 2CQ1A 4DU7A 2A1RA 3DOMA 1RNHA 3IR7B 2J9CA 4Q5VA 5T7BA 2Z8QA 3OBWA 3NAHA 1F60B 4LY7A 1IG8A 3A3PB 3M5RA 2HQDA 5AXKA 3J81Y 2W9CB 4BRDA 3NNCA 4I68A 4DSFA 2KFZA 2P9SB 4I2PB 1FEEA 3ZX3A 2WZ1A 2DH7A 4WJBA 1FXXA 1ZM2A 5J1NA 1MG7A 2XZWA 1P27B 4B3SF 3C6TA 2W2OP 4NXMJ 1FRIA 4ZS6A 2J9DE 4BR5A 4H5NA 2RHQB 3O4QA 3Q8SB 1B92A 5F0UA 3ITHA 2VFVA 3MAHA 4H4KC 3CJ7A 5GMDA 3M30A 1WOOA 3M8SA 1NJWA 1C1CB 4XPEA 2WAQD 2UUAF 1TKZB 2Q31A 2R2RA 1Q9YA 2QLBB 4ITSA 4FK4A 3M9MB 2V8GA 3WXIA 1XN9A 3ASMA 2KFNA 3NMUA 2HS3A 1TVRA 2GUIA 4CJQA 3MM6A 3AD8C 2AIRB 4TYAA 3B4DA 3KLEB 1Y11A 1BXNA 3A13A 3DM2A 3C15B 4CWBA 3UNGC 4RR5A 3TUPA 3J7AP 1FFSB 2GELA 5FPDA 3GSDA 3GYXB 1DQ9A 4C2MA 3Q8VA 1FA0A 3R3TA 2MXYA 4GMKA 2QA4G 2QWOA 3HVWA 4NLWA 3QT6A 1GLDG 2E29A 5KG7A 4C97A 2MGZB 3HOSA 3AFGA 1A5XA 1WSRA 2HZVA 2DCLA 2M0GB 4DUZJ 4BRGA 1HR0K 3B6BA 3PIPQ 5KFBA 4ZA1A 3THVA 1QE1A 4CGIA 3SQGA 1RWPB 2QWRA 4M8LA 4EFAC 3JTNA 4B3RF 4G1QB 1U2VB 2Q1NA 5AJ3F 4RBUA 2P9KB 2KRRA 1YKWA 4ZDNA 5HBMA 4H0OA 4JU