1IKWA

Wild type hiv-1 reverse transcriptase in complex with efavirenz
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikwA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikwA05
4QWEA 3AVNA 3OJUA 5K14A 4GW6A 4PY5A 1ZTWA 4J9MA 4UQGA 3OYAA 3M8SA 2IM1A 1JX4A 3DYAB 4K4ZA 4JS4A 1LWCB 4KI4A 4G1QA 4HHTA 3OY9A 1RT7A 3VQBA 4MFBA 5KT7A 3HP6A 1T94A 4F3TA 5DG9A 4KE5A 3AO1A 4M42A 3V9WA 2W9BB 3VQDA 4K8ZA 2QKKA 4HYKA 4RW9B 1HNIB 5J2MA 2D41A 4K8XA 2JLEA 3OS1A 3HL8A 4O3QA 1BIZA 4OJRA 4CJUA 3BGRB 3SYZA 3KOAA 2YKMA 4NRUA 5KT4A 3AVFA 2YNHB 4BACA 4ZVGA 5KG0A 2PYJA 2JGUA 4M94A 4W5RA 4DSJA 3LP0A 4CIEA 2OA8A 2B6AB 1XWLA 3ALYA 3K57A 3OS0A 1KLMB 3RB0A 3D0PA 3MFIA 3DLHA 2KZZA 2OZSA 5FDLA 4KHWA 1S4FA 4ECUA 2VG7B 3NAEA 4YFUA 3V1OA 3QGIA 3KK1B 5EUHA 3K2PA 3FQLA 3V81A 3MECB 4K4YA 1S6QA 2ZE2A 5KT3A 2FJXA 3PW7A 1TL1A 2ALZA 4TLRA 3H98A 1HYVA 3HVAA 2X6NA 3WNFA 3KKSA 4DQIA 4DSLA 3T5LA 3N6NA 4N76A 4RW7A 1EKEA 1BCMA 3PHEA 3O3HA 1SKRA 4DSKA 4MK7A 2GIQA 2W9CB 4B8AB 3H2LA 3LP2B 3IRXA 3C6UA 4ZMMA 3H4BA 5KGWA 4W5TA 4CF9A 1XHZA 3ISNC 3EY1A 3MF5A 4FM2A 3QIDA 3RTVA 4DFKA 4HUEA 1X9WA 2G8HA 3QINA 4H4MA 5C42B 5KFWA 4FLWA 4JRPA 3PO4A 2QXFA 4CF2A 5CYMB 3BJYA 1S49A 1VSEA 2WOMB 3AVMA 3LP1B 4MH8A 4BE2A 2OPPA 4H4OB 4CJQA 3SUNA 1TVRA 3OS2A 3KLGA 3ZT4A 1S0OA 3CM5A 1KCFA 1G15A 4M3RA 5KG7A 3BREA 3V6JA 4RW8B 4O3OA 4WYWA 1NK7A 4AHVA 2ZD1B 4B9TA 3K5MA 3VQEA 2HHQA 4NLDA 3CJ3A 3MAQA 4CFBA 1FKOA 1RTHB 3TR8A 3JSMA 1CZ9A 3BDPA 1JLCB 3RMCA 2JEJA 4NZ0A 3I0SA 4CGFA 1HQEB 1JL2A 3KTQA 3CQ8A 4NCGB 5KFHA 4ECVA 1VRUB 3BSCA 4NLVA 4CJSA 5KFLA 2P5OA 4J9KA 4I7FA 3HYFA 4OKKA 5KFFA 4O44A 5KFCA 4Y1DA 3JYTA 2D0AA 3DRRA 4IDKB 3SUPA 3RMAA 3M8PA 4DMNA 3SPYA 2QK9A 3AO4A 1J5OA 3EPIA 3NCIA 4R8UB 3ZSOA 1TV6B 5KFJA 1ASVA 4OPKA 3LDSA 4CF8A 2P1JA 3HPHA 4CHZA 4Q8EA 3WNHA 3VQ4A 3IGVA 4CFDA 2RKIB 1SH3A 3ITHB 1QS4A 4HUGA 3QO9A 5KG4A 2RF2B 1MU2A 4ECXA 4FLYA 2P51A 1U04A 3OYDA 3ZSQA 5CYQA 5I3UB 4DL2A 3G0ZA 4IFVA 5J1EB 1RNHA 1K1SA 1S1VA 3V9XA 4EP4A 3ISND 3F73A 4ED3A 5T14A 2AX0A 2IAJB 3DI6A 4IRKA 2J6SA 4H8KA 2V4QA 5KGXA 2G8VA 1RT2B 5D3GB 3CVKA 4NLWA 5HRSA 3M8QA 1JL1A 1RT1B 4F4KA 2IC3A 3IG1B 4J9SA 2XGPA 4FW1A 4CJVA 3KLHB 3DDKA 4K4SA 3QNNA 1RA6A 2R8JA 5HRRA 5DG7A 4Z4HA 3NH2A 4F4YA 1U48A 1WN7A 3EZUA 1DTQA 2YHBA 4BE0A 2C22A 4KHUA 3DYAA 4B08A 4NLSA 3DLGB 2YNGA 1RILA 4B9LA 4CEBA 1DTTA 2RPIA 1FK9B 1D8YA 1JLQA 1RDBA 2DTUA 1UWBB 4LQ9A 4QPXA 5L9XA 4J9PA 3AA5X 3I5BA 1W0HA 1KRPA 1IKYB 1D0EA 4B8CA 4EEYA 4RW9A 1HNIA 3DLEB 1B9DA 1J53A 1K6YA 4EO6A 4GC6A 4ELUA 4OKJA 1JLEB 3NF9A 2GV9A 3KLEB 3CJ0A 3SQ4A 3V4IB 5C25B 1NHVA 2Z1JA 2HHVA 4ECZA 2B6AA 1GOBA 3DOKB 1KLMA 3SV4A 3GILA 4ZP9A 4DL6A 4N5SA 3RRHA 2WRMA 3QIPB 3OL6A 5KG6A 3PZPA 2VG7A 5HROB 3VQ9A 4IFYB 3RRGA 4FJ9A 3KK1A 2OPSB 3MECA 2Y1JA 3DRPA 1JKHB 4OVLA 3SZ2A 1LWFB 4MKBA 4CEAA 4CFCA 2VG6B 3E51A 3RMBA 2W8LA 1QAJA 2D0BA 3MXMA 1S9FA 4YR2A 4O0JA 3P83D 4EBCA 2VG5B 2XI2A 4DQPA 3HHKA 4Q45A 4URSA 4LH5A 3ASMA 1SUQB 1TKTB 1S9GB 1LWEB 4F2RA 1NOYA 2BDPA 4LSNB 3IAYA 3ZSZA 4WFXA 2XRIA 3V1RA 3S9HA 3SJJA 1X9MA 2W9CA 2F96A 3LP2A 4ZP7A 5DLFA 3AVHA 3SI6A 3GQCA 4ZPCA 3MR2A 3M8RA 5L1IA 1NK4A 4FBUA 3LAKA 1S0MA 4I9LA 4JV0A 3EYZA 2IM2A 3TABA 4C8LA 2G8FA 2FVCA 3H5UA 1S9EB 3QESA 4BE1A 3HP9A 4Y34A 5KFPA 4CJPA 3U6FA 5I42B 5C42A 3HVTB 4RNFA 5CYMA 3C94A 1NNDA 3ZCMA 4NLGA 4J9OA 4IRCA 3LP1A 4CGDA 2UUTA 4H4OA 3KK2B 3ZT3A 4F4WA 5F8NA 5DQGA 5DLGA 4FJ5A 2Z1IA 4EBDA 2E6MA 4NLQA 2ILYA 2HNYB 3T3FA 3QERA 3SCXA 4RW8A 5C24B 3SFUA 3ULDA 1RBSA 3V9ZA 3IN5A 1RTHA 1ZBFA 3T5JA 3RWUA 5KG2A 4CEFA 5J2QB 4ZHRB 1JLCA 3ZSYA 4KO0B 1S1TB 4I9QA 3AVLA 4NCGA 4NLXA 4WE1B 5E41A 3D5MA 1C0UB 4FJ7A 2V9WA 5L1LA 1X1PA 4J2AA 3HKWA 4RNHA 1GOCA 2FBXA 2IS3A 1Q8IA 3V9SA 3KHHA 3MEDA 4GC7A 4WYLA 2FVSA 3AVJA 3HPOA 1LV5A 1Z26A 4M95A 4IDKA 3RMDA 3MEEB 1B92A 4R8UA 3CFPA 1TV6A 1ZBHA 4RW6B 4ZP6A 4KAIA 1S1XB 4ECQA 3KHRA 2C2EA 3L2QA 1BQNB 4DL4A 4OGEA 3WNGA 3DOLB 4FCYA 2RKIA 3SI8A 3ITHA 1JLGA 1C2PA 1RCHA 3VA0A 3MEGB 2PY5A 2QE5A 2FLLA 4ED2A 4DFJA 2JEIA 5I3UA 4ZPDA 4FJXA 5J1EA 3CIZA 3SQ1A 1A5WA 1BI4B 1HPZB 3KMSA 5KG5A 3OYBA 4KV8B 3QZ8A 3UPFA 2B4JA 1TKXB 1RT2A 2WONB 4BDPA 5D3GA 1C1AA 2JC0A 3BR9A 5EDWA 1RT1A 3IG1A 1CXQA 1Y97A 2WK4A 2WCXA 3AV9A 4KB7A 3HXMA 3KLHA 4J9QA 2AGPA 4M3UA 3PR4A 2EC0A 1IO2A 2G8IA 1TKZB 3DLGA 3NAHA 1FK9A 2V4RA 2FBVA 4PQUA 3HJFA 4ELVA 4HCBA 3SUQA 4O0IA 2I1RA 1UWBA 4NLYA 1BGXT 4Z0UA 1C1BA 3TANA 4DQSA 1YTUA 2ETJA 4CJTA 1IKYA 4FLVA 4AHCA 4TY9A 1RBUA 4DTPA 1C6VA 4PUOB 3QEVA 3DLEA 1VSLA 3SQ2A 1RT4B 4ELTA 1JLEA 3FQKA 4TYAA 3KLEA 1EP4A 1B9FA 4CJEA 4FXDA 3PW0A 2HAIA 5C25A 4RG8A 3AO2A 2GC8A 1N6QA 2KFZA 4FJKA 4KHNA 3DOKA 3V1QA 4I2QA 3PJWA 1SH2A 4TN2A 3D28A 2E9ZA 3H5YA 2RN2A 3QIPA 2YNIB 1KVBA 3G6YA 2KFNA 1N56A 5HROA 1FXXA 1C0MA 3L8BA 1S10A 4IFYA 3MTKA 4QWCA 2OPSA 1SH0A 2BANA 4NLTA 3O3GA 1SL0A 1JKHA 3UIQA 3ZT1A 1LWFA 1SV5B 1ASWA 2VG6A 1NJZA 3KIOA 1TAUA 4CJ4A 3AA2A 1TQLA 1NJWA 3BSOA 3Q8SB 4K4VA 4R0EA 3RB6A 3OYIA 2XO7A 4DTXA 4KHMA 1SUQA 2WTFA 1S9GA 1LWEA 2D7SA 1ASUA 4LSNA 4FM0A 3S3NA 3RB3A 1QSYA 3T5KA 1VSHA 2XCAA 4YMEA 1TAQA 4DFMA 4ID1A 2KTQA 3KHLA 1XR6A 2RDJA 3HPGA 1NKEA 1OS5A 1S9EA 4AHSA 1RDDA 4HVJA 4ZTFA 3ICLA 4IBNA 3VN5A 1KVAA 4FLTA 3VA3A 3A2FA 1TL3B 5C5JA 5I42A 1WAJA 1L3SA 1JXLA 3HVTA 1JIHA 2XHBA 2X74A 3E01A 3NL0A 4DTRA 4MK8A 4CGIA 1NKCA 4EZ6A 4KFBB 3G86A 4W5OA 3KK2A 2BGGA 2D0CA 4DLEA 1U09A 1RTJB 2R7YA 3OHAA 1KTQA 3GIKA 2YNFB 3NE6A 1N5YA 5HP1A 2B5JB 2Q3SA 1TGOA 3V6DB 1Q9XA 1HMVB 5C24A 1S1WB 1QAIA 1EXQA 2DFEA 2R8GA 3CJ4A 3B6OA 4FLZA 1WNEA 1R0AB 4AH9A 4R5PA 2F8SA 2FBYA 1L5UA 5J2QA 4ZHRA 4RNNA 5JS1A 3OYKA 4KO0A 1LW0B 1S1TA 3HVRA 1Z4UA 2AWZA 1IG9A 4YQWA 3C95A 4WE1A 5L1KA 4DG1B 3NH1A 3AVKA 4CEDA 2VWJA 4CIFA 1C0UA 1IKVA 4IR1A 1QHTA 4CEQA 3QEIA 3AVAA 3NGDA 4M3YA 4FJMA 5KT6A 3ZSRA 3H4DA 4E89A 4Q43A 3MEEA 3OYGA 3KK3A 3OYMA 3PUFA 4CK3A 5DGAA 5DK5A 4RW6A 2UVVA 1S1XA 1BIUA 2BQ3A 1BQNA 3RBEA 3NH0A 4ECWA 1I39A 3AVBA 2IOCA 1RYSA 3VQ5A 3K59A 2UVUA 3S3OA 3MEGA 4FZXC 4Y2CA 4WZQA 1QE1B 3AA3A 5EWGA 1D9DA 1SKWA 4FLUA 4K4UA 2IA6A 5KFRA 3TAQA 1ZBIA 3TAFA 4CECA 1WSEA 2G8WA 4KRFA 1BCOA 1BI4A 1WSFA 3IS9A 1HPZA 4CIGA 5SZTA 4DSEA 4EBEA 3GYNA 4F4ZA 4KV8A 1S5JA 2WONA 3ZT2A 4LSLA 4DL7A 5DG8A 4B3OB 3LAMA 2IM0A 3ZSXA 3OYLA 4CJLA 1QQCA 1NKBA 4MIAA 1LW2B 1YVUA 2FJVA 3KKRA 4NRTA 4YR3A 3SUOA 4C8OA 5KRSA 4EZ9A 5KT5A 3NMAA 1TKZA 1NK8A 4H54A 1BISA 2I5JB 2QKBA 4XPEA 1DLOB 3QZ7A 4K50A 4FZYA 1RT3B 3VQ6A 1C1CB 2IDOA 3GIMA 2HVIA 4F4XA 2UUWA 5CZ2A 3LP3A 4WXOA 1LWCA 1XR5A 4FM1A 1JLFB 1JXEA 4DWIA 1RDRA 4KTZA 3T5HA 4FJJA 3D45A 4W5QA 4FK4A 4KHSA 2HMIB 1WSHA 3H08A 2W9BA 3G10A 4ZPAA 4CGJA 3OSPA 1SL2A 4TY8B 4EP5A 5FROA 3TAMB 2WHOA 3BGRA 1UOCA 2ASLA 4C8NA 2YNHA 5F9NA 4ZVHA 5K14B 3ZT0A 5JS2A 3TAPA 1VSDA 4K4XA 4QCLA 1I6JA 4DTUA 4DTSA 1KHWA 3QGHA 3DMJB 4FLXA 3KLIB 3OL7A 2AGOA 4MFBB 4HCCA 1NHUA 4ZPBA 4DTJA 4HUFA 3P5JA 3B6PA 2B43A 2BQUA 3Q8QB 4DS5A 4E3SA 3M9NB 3CDWA 3TAGA 1S6PB 1TP7A 4Y3CA 4RNMA 4N47A 2AU0A 1KSPA 3T1AA 1HYZA 1IKXB 1T05B 1HYSB 3RAXA 4K4TA 4CHPA 4CERA 2OPQB 4KKOB 4BWMA 3LP0B 4YP3A 1TL3A 2NUBA 4DSFA 1NK6A 4NLOA 3KLFB 3OYFA 4WFZA 4FJNA 4KB0A 3SFGA 1UA1A 4LQ3A 3NKYA 3QYYA 3OSNA 4IG3B 1NK9A 4KFBA 1TK0A 4MK9A 4DFPA 3V81B 2ZE2B 5F8JA 3OYHA 2FVPA 3CFOA 1TL1B 2FVRA 4FJGA 2YNFA 3UQSA 2OPRB 5KG3A 3HK2A 4QOZB 2KQ2A 2B5JA 3V9UA 3RR8A 4IQXA 2WOMA 3L2UA 4CHQA 3V6DA 4O5BA 3QEWA 1S1UB 3DM2B 1HMVA 1RA7A 1S1WA 3FFIB 1VSIA 2R2SA 2YV0X 3U3GA 3P1GA 1R0AA 5KFKA 1J54A 3VQCA 4Z4EA 4JS5A 1ZTTA 4DU1A 4FJHA 5CZ1A 2BQRA 2HHUA 4DL3A 2ZD1A 3HO1A 4DG1A 3F9KA 2IBKA 2UVWA 4O3PA 4KB1A 4H4MB 4HTUA 2HHSA 4NLRA 3DRSB 5KI6A 1HQEA 4TQRA 3LWMA 4WZMA 1NK5A 1U49A 4CCHA 4N56A 2HVHA 1ITGA 3K58A 1VRUA 4AILC 2X6SA 1EETB 1TK5A 2C28A 1IM4A 4WFYA 3RR7A 4IKFA 1D9FA 5KFQA 3K5NA 5HBMB 2KZMA 1ZBUA 1CXUA 3DLKB 2AJQA 4YNQA 4AHTA 1YVFA 1WLJA 1WSJA 5KFIA 5FRMA 4MKAA 5F8HA 1FKOB 3Q8PB 5SWMA 1HARA 1KHVA 3AVCA 2DPJA 4OKEA 4CHNA 2IMWP 4KHRA 2RF2A 3LALA 4LD0A 1CSJA 1NOZA 4ECTA 2A1RA 1REVB 2E9RX 3RB4A 4B3OA 4I7FB 2DFHA 4YR0A 4O44B 2KW4A 5KFBA 3OYNA 4OLBA 2IAJA 2GIRA 1T03B 3N6LA 1LAVA 2ATLA 4CF0A 4C8MA 3L3VA 5HLFB 4FVMA 1XI1A 4F50A 2HNDB 4JRQA 5F8IA 2I5JA 3OVNA 4URGA 5KFZA 1KFDA 1C1CA 3TQ1A 3VQAA 2XWYA 3GV8B 2HWHA 3SPZA 4E7IA 1TK8A 4MQ3A 4IKAA 4TXSA 1VSKA 1BQMB 1JLFA 4CJKA 4IOBA 4FBTA 3OL8A 1JLAB 3EPGA 2Z1HA 3OYJA 4CJ5A 4DTOA 1RT5B 4DTNA 3O4NA 3DI6B 2BRLA 2C2RA 2ITGA 4CHOA 2XC9A 3OJSA 4RW4B 2O5DA 2HMIA 5EWEA 3VQQA 4QWDA 4RUAA 2FBTA 1RYRA 3H40A 3M8QB 4PA1A 4KI6A 4TY8A 2R2TA 1HQUB 1RDAA 1A5XA 2YKNB 4L8RB 4ZVFA 5J2NB 3TAMA 2C2DA 1QUVA 4CK2A 4CE9A 1T8EA 5JXSA 2PYLA 3BSNA 5KFEA 4J9LA 1RT6B 1DTQB 1VSJA 4ICLB 3V4IA 2YNGB 4U7CA 2J6UA 1RAJA 3DMJA 2IJFA 1DTTB 4NCBA 4IH6A 3AVGA 3PV8A 3KLIA 1JLQB 2HW3A 2DPIA 5KFVA 1RBTA 3CWJA 2VWKA 1L3TA 5KFXA 4Q8FA 2AGQA 1QSLA 4O4RA 4DU3A 2G8KA 3KLVA 4AHRA 3NDKA 4C8KA 1S6PA 4DL5A 1RBRA 5F8MA 2W42A 2W7OA 1KLNA 2XCPA 1IKXA 1T05A 4IH7A 1HYSA 2VG5A 4JUZA 2HNZB 4RUCA 2OPQA 4KKOA 5KFAA 4NYFA 3THVA 3CDUA 4TYBA 5CY4A 2JEFA 1VRTB 4I2PB 1TKTA 2XGQA 4DU4A 1X9SA 3OHBA 4IG0B 3V6HA 1GX5A 3KLFA 1L3VA 5KFOA 5KFMA 3VQ7A 3TAEA 4FJLA 3LANA 3KJVB 2GBZA 4QWAA 4Q0BB 4IG3A 3RAQA 3PO5A 2HHWA 3CM6A 2AX1A 2WB4A 3DRPB 1CZBA 2OPRA 2CJQA 1D1UA 3GIJA 3MFHA 4QW8A 4GVMA 3PJXA 4EYIB 5EU7A 1S1UA 3DM2A 3NGIA 1S48A 2IGIA 3FFIA 3PVXA 1W9HA 2R2RA 5J2PB 3BSAA 3HSTB 2EHGA 3L2VA 3DLBA 2BRKA 2IM3A 3I0RB 5T7BA 3PX6A 2LSNA 3N6MA 4ED1A 4KREA 1KFSA 3QEPA 2HNYA 5KFUA 1YTAA 2W7PA 4E19A 4KHQA 4LY7A 4J2BA 1N4LA 3OLBA 4ECYA 3OLAA 4CJFA 1U45A 5EWFA 2D3UA 4M3WA 4K4WA 3DRSA 5F9LA 4EO8A 1LAWA 3PX0A 4FS1A 2FJWA 3QIOA 4ID5B 2XY5A 1EETA 4O3RA 5KFTA 1U4BA 4NLUA 3PY8A 3V6KA 3SV3A 1XC9A 4CJWA 4KBIA 2UVRA 5HBMA 4E7HA 2XI3A 3KHGA 5DMRA 3M9OB 3DLKA 4XO0A 3L2RA 1O1WA 2OZMA 1W25A 1WNSA 3QETA 4J2DA 5KG1A 4CEZA 2ASJA 1N48A 5F8LA 5KFSA 2R8KA 5KFDA 1T7PA 3MR3A 1HNVB 3NGYA 4XPCA 3BQ1A 1QSSA 3TI0A 3DOLA 4PWDB 2VA3A 4XIUA 1IH7A 1J9AA 3NHGA 4URQU 1REVA 3NBPB 1JLBB 1C0TB 4KAZA 3FRZA 4JV1A 3C6TB 2JC1A 4CF1A 4O4GB 1RTDB 3MEDB 1T03A 2XY6A 2DY4A 5KFGA 2R2UA 4ED6A 3QLHB 4CJRA 3H5XA 5KFNA 4CGHA 4EYHB 1TKXA 3WNEA 4BDZA 1UA0A 5HLFA 4F8RA 3OYCA 3QNOA 4DF8A 2HNDA 2PZSA 1QTMA 1T3NA 4DS4A 3KD5E 1BL3A 3KMQA 1FKPB 2X78A 3IGNA 5L1JA 1JLGB 4JV2A 3AO3A 4FW2A 1IKWB 3OL9A 1S97A 3M9MB 1BQMA 1JLAA 1GX6A 2V0NA 1RT5A 3LWLA 4B9UA 3AO5A 2E4LA 2HHTA 3QEXA 1EX4A 4RW4A 3VQPA 3NAIA 2FLPA 4HKQA 4FJ8A 3CJ5A 4O55A 4M3ZA 4FJIA 4QAGA 3PW5A 3GV5B 3RBDA 1RTIB 4B9SA 3CFRA 1NJXA 4PUOA 1HQUA 4OL8A 2YKNA 5KFYA 5J2NA 3BQ2A 4CGGA 1RT4A 5HRNA 1YT3A 2E9TA 3S3MA 2W8KA 5DGBA 3CYMA 4ZTJA 4O3NA 4FK2A 1RT6A 3I5AA 2D3ZA 2IJNA 4ICLA 2GUIA 4BWJA 4B9NA 4CK1A 4IH5A 4Z4CA 2BE2B 1JXBA 4B9MA 4PQUB 1HRHA 3MXJA 4M3XA 3BQ0A 2YNIA 4GMJB 1C1BB 3FDSA 2R8HA 3PR5B 1NJYA 4U6PA 3KNAA 4IR9A 4G1QB 1S0NA 4X2BA 3G6XA 4IRDA 3MR5A 1RT7B 4QW9A 4Y2AA 4ED7A 3H5SA 5HRPA 4B9VA 1SV5A 4Y1CA 3DLRA 2XY8A 2HWIA 5KRTA 4OLAA 1EP4B 4TQSA 2HNZA 5F8GA 5J2MB 1N6QB 4I2QB 1VRTA 4I2PA 2A1SA 2G8UA 3GIIA 1KVCA 3LPTA 1RBVA 2YKMB 1F21A 4N41A 4IG0A 4M41A 4WXWA 4F2SA 3KJVA 3SNNA 1WAFA 4Q0BA 4LH4A 1SL1A 4RU9A 4RNOA 2VA2A 2BANB 2AQ4A 4NYNA 4G3IA 1XHXA 4NYZA 2CKWA 5FDLB 3NF6A 4E7KA 2P5GA 3NFAA 1XR7A 1ZBLA 1Q9YA 2XY7A 2F8TA 2HB5A 1S6QB 1RTJA 5J2PA 3LZJA 1NK0A 3I0RA 1UAXA 5KT2A 3L2WA 3U3YA 4DSIA 3NF8A 4DQRA 3K5OA 4DF4A 1HJRA 4FZZA 3O3FA 2ATQA 1VK0A 1SKSA 4RW7B 4M3TA 4NCAA 1A5VA 3PW4A 4OPJA 4KPYA 1RDCA 1VSMA 4JLHA 3IRXB 3C6UB 1LW0A 3E01B 4MIBA 2ILZA 3CO9A 4KTQA 3QGGA 4Z4GA 1WSIA 4ZP8A 4ID5A 2ZKUA 2ASDA 1L3UA 4O3SA 4RZRA 2EX3A 1GOAA 3PX4A 4NLPA 3NF7A 4KSEB 1N5YB 4CJ3A 5DQHA 5HP1B 3G6VA 3H59A 4J9NA 1VSFA 2O4IA 2OYQA 3TWHA 2D5RA 4AHUA 4ED0A 2OPPB 5JUMA 1TVRB 1BHLA 3KLGB 1HNVA 4R5PB 3ZSWA 2J6TA 4E1NA 4KTWA 3LPUA 3K5LA 2W9AA 2JEGA 2R8IA 4PWDA 3ZSVA 4DLGA 4E7LA 4E7JA 2Y1IA 2OH2A 5DQIA 1QE1A 3HM9A 3NBPA 1JLBA 2HHXA 1IKVB 4CHYA 1C0TA 3JSMB 3KD1E 1D5AA 3C6TA 4O4GA 3T19A 3AVIA 3I0SB 1RTDA 1CLQA 4E1MA 3TVKA 3QLHA 4KHYA 1MMLA 4DTMA 3KK3B 4TSXA 3GV7B 4FK0A 2QV6A 3NGZA 4J2EA 2DFFA 4E0DA 4W5NA 4ZVEA 3L3UA 3CG7A 4F3OA 3JYTB 1LW2A 3I5CA 1FKPA 4CEEA 4ECSA 3DRRB 4FS2A 3M8PB 3TARA 1K1QA 2FC0A 3O4QA 1ZYQA 1J5OB 2RDIA 1IKWA 4CEOA 3FSIA 4Z4IA 3AA4A 3HVWA 3UDLA 1TKDA 3IS9B 4Z4FA 3SQ0A 1DLOA 4M45A 3CDEA 1RT3A 2YHAA 4QWBA 4Q44A 3QO9B 2ZQBA 1MU2B 4J9RA 2Z1GA 3MXIA 1ZETA 2O4GA 4LSLB 1RTIA 2F8EX 4Q5VA 5CYQB 2FLNA 4DEZA 4IFVB 5KTQA 3CJ2A 1S1VB 5FRNA 2E6LA 1U47A 3HT3A 3OYEA 1Z25A 4CFAA 1I3AA 2BR0A 1WSGA 3UR0A 3PW2A 3LZIA 4ED8A 2IC3B 3VQ8A 3MR6A 3I8DA 2BE2A 4BDYA 4DQQA 3EZ5A 4ECRA 4CESA 3VQSA 2FVQA 4FYDA 4OGCA 3Q8RB
chains in the Genus database with same CATH superfamily
2OD6A 3VENA 3AVNA 5K14A 4GW6A 2ZJQL 2DH8A 4J9MA 3TJ9A 2IDEA 3DYAB 4K4ZA 3HD1A 1LWCB 1X4AA 2B7BB 3U1LA 4G1QA 4HHTA 4AF1A 3GDQA 3OY9A 4WP9A 1FEHA 3ZZTA 1EARA 4DR7K 2Q1NA 2FDNA 2YJFA 3JB9k 1NEEA 1FDDA 3V9WA 1X0PA 4DV2J 5B09A 4HYKA 5J2MA 1X5SA 2VFVA 2OKQA 2HZAA 1YSJA 4CZMA 1S0VA 1BIZA 1DT9A 2PMWA 5KT4A 2PDAA 1H2TZ 5DS7A 1Q7YT 5T41A 1JQGA 2CJAA 5KG0A 1IR0A 2JGUA 2O8FB 4GO7X 2XWXA 3DLJA 8ATCB 4M5IA 3LP0A 3CT9A 3GE1A 2Q0UA 4JYAJ 4CJ7A 1BWVA 4JI3K 3OHRA 4CO1A 3FKBA 5CCMA 4EFHA 3RB0A 4BCAA 3D0PA 3MFIA 3OBIA 3DU6A 2ZGYA 3NAEA 4LFCJ 2I38A 4OZ2A 1CJTB 5EUHA 3K2PA 1I94K 2ZE2A 4NYOA 1Q82T 5KT3A 2FJXA 1R0BG 4ZLLA 1TL1A 4PEOA 4DOZA 2VL1A 2QGFB 2Q2RA 2HG4A 4DQIA 4DSLA 2G1DA 4OI1A 3FUYA 2QN6B 3NCRA 2KG1A 1SKRA 4ZN3A 3LH2S 4MK7A 4HTIA 4ZMMA 3LP2B 4DR1K 3C6UA 4U67L 2DGSA 2VBXA 4DCHA 1W26A 2DJWA 1XHZA 4DV0J 3EY1A 3MF5A 4OZ1A 2EKYA 4U67Q 1E3MA 3RU0A 1QVFR 3RW6A 1N0UA 4RUBA 1X5OA 4CLKA 3GG4A 4JRPA 3T69A 5CYMB 3KG0A 3BJYA 1VSEA 4CLZA 2WOMB 4RL1A 1WEYA 2A3JA 1WC6A 3DGVA 2CPFA 3SUNA 3FVYA 3CO0P 4C23A 3KLGA 4JKAA 2DY1A 1S0OA 2V50A 4BC9A 3ZNJ1 2P5VA 2FF6A 2VC1A 1EQMA 4O3OA 4B9TA 1U8SA 1ATSA 2YI1A 3MAQA 5H9FK 4CFBA 1I1GA 1YGYA 1ZM2A 1NGBA 2LU1A 3I0SA 4C0BA 1FT8A 4P6QA 2P2CB 3GR1A 2YX1A 4NCGB 4ECVA 2DKOB 2Z57B 2L9WA 5CR4A 2LQ8A 2PFDA 3LPYA 3N79A 3VGKA 1MG7A 4OKKA 4B3RJ 1Y3KA 3OXLA 1S12A 2HBZB 3M7VA 3DRRA 3SUPA 3M8PA 4Q7AA 3CCEN 3SPYA 2YWWA 3AO4A 3QFUA 2AEMA 5CD4H 1Z1ZA 1ASVA 4WFNL 4OPKA 4M5NA 1IJEB 4PRFA 4ALZA 3JSBA 4A8WA 4CD3A 1SH3A 3CDBA 4ECXA 2YXLA 2P51A 3ZSQA 1S57A 3BUZB 4DL2A 4IFVA 5J1EB 2LU2A 1IWAA 3R1XA 3ISND 4W90B 4ED3A 3HF5A 2BX6A 5D6GA 4DR4K 1RT2B 4C3LA 1U2VA 1YITN 4WWSA 4J9SA 2QWQA 1T9WA 1HR0F 1HD1A 1XBWA 2EFOA 1TUYA 2R8JA 3UKRA 5DG7A 3EZUA 1WUAA 4F9OA 1O13A 1U1KA 5KOWA 4H0XB 4A8MP 5IS2A 2FTRA 3ATVA 1N33F 2ZH8A 2DTUA 4M8LA 4QPXA 5L9XA 4NX9A 4P74A 5AQXA 4J9PA 3TZXA 2XB2D 3I5BA 5LSOA 4A8QA 4EEYA 5AFUH 1HNIA 4FYXB 2R7SA 3E8OA 3MWBA 2MY8A 2FY8A 2V2VA 2HWTA 1KNZA 3MCSA 3KLEB 2E2QA 3CC2N 5K8NA 3V4IB 1X4CA 1VQNN 2UUBF 4F3MA 4ECZA 3FE1A 5CXTA 1VQ9N 2AYBA 4HTLA 3FCVA 4N5SA 2MDAA 3MCAB 2PT0A 4OYZA 1NCLA 3DXKA 2RS8A 3OFFA 3RRGA 4FJ9A 1NM1A 5LY3A 2OPSB 3SZ2A 1NMEB 2VBWA 4CFCA 4L73A 1PILA 4JB8B 3MI7X 4ISGA 1UVJA 3MWPA 4M1KA 1S9FA 5E33A 3K0SA 4HT7A 2VG5B 1TELA 1X4BA 4ZPTR 1IXKA 1NOYA 4DN9A 2UUAF 3D6MB 3SJJA 5DLFA 4M5DB 3SI6A 1G4CA 4NPOA 3FZLA 2KT3A 1RDWX 1S0MA 1Q16B 4I9LA 5A2QO 3IMQJ 2Y8YA 4BE1A 1RZMA 3VEWA 5GAHI 3J7YP 1K44A 1P8GA 3HP9A 4XDDA 4Y34A 2EWHA 4CJPA 5I42B 5C42A 4AL5A 1ICEB 3ZCMA 3WUHA 4J9OA 3LP1A 4G1PA 4Y0WA 3BGLA 5IV4A 4H4OA 4LF6K 3KK2B 5IWAK 5F8NA 3M6UA 5I9EB 1KXPA 4EBDA 2HNYB 2HLUA 2CJKA 5C24B 3DOMB 1HBNB 2KLAA 4MTPA 1RBSA 2UP1A 5F2RA 1LFWA 7FDRA 2IFXA 3LDLA 3PNIA 3T5JA 4JI0J 4ZHRB 4DR6F 1MWKA 3VEXA 4KO0B 3NMUA 1WF1A 1AZSA 4X66F 2HRUA 3R6GB 2OMOA 2ASOA 3H25A 2UUCK 3QRPA 3D5MA 3TTCA 4YOWA 5IQ6A 1W97L 4FJ7A 2HF3A 5L1LA 2FJDB 2C42A 3HZEA 4RNHA 1UEVA 1GOCA 2FBXA 2IS3A 3V9SA 4DR3F 3TEGA 4GC7A 1N8RO 3HPOA 4ED4A 4BR9A 4M95A 2W40A 3TU5A 3RUBL 4BGAA 1SIZA 5ELZA 7AT1B 2ROEA 2WW4A 4RW6B 1Y00A 4GV9A 2NS1B 4NA3A 2UXBJ 2HVDA 2CJ9A 2CQIA 5EGYA 2DR8A 4FCYA 2RKIA 4LF4F 4QIEA 1JLGA 5IFMA 3FRYA 4A8KA 2LA4A 2KVIA 5AR0A 5I3UA 1UVKA 1HHQA 1GMVA 2ZWOA 3PSIA 3CIZA 3B4MA 3SQ1A 1V3SA 1HPZB 2QTDA 5CABA 4ZLNA 4Z7YA 3ULHA 2R4FA 2KXFA 3UPFA 2P9IB 1TKXB 1TFYA 1TU0B 1C1AA 3BEGB 2JC0A 3BR9A 4O0NA 4DR4F 3HSDA 4M5MA 5EX3A 1Y97A 1FNMA 2ZH2A 2PN6A 3CCSN 1FERA 2AF6A 3AV9A 1PSDA 2AGPA 3FSYA 4M3UA 4CNYA 2KM8B 1IUJA 3AY0A 2XMVA 3G2XA 3ID6A 3D6RA 3ONQA 1R8CA 1TKZB 2POKA 1K9MO 2V4RA 4PQUA 2GA7A 2HFNA 2I1RA 2QO3A 4WQ5A 3ZTOA 1YTUA 1IKYA 4JI7J 3WDOA 4YDUC 1FJEB 4DUZK 3DLEA 4I6MA 2D69A 4XH1A 4PCQA 3J81U 2WBMA 4A8YA 1QAYA 1AA1B 4ELTA 4GY2B 3PACA 3FQKA 4TYAA 2G0IA 3UD3P 2I7PA 3PW0A 5AE3A 1J6ZA 2G13A 3PIOL 5EHHA 2GC8A 2EFQA 2KFZA 3DOKA 4I2QA 1IVZA 2ZZTA 1JCEA 1SH2A 4TN2A 5JVHL 3G9CA 3QIPA 2EK6A 2YNIB 3BPSP 1KVBA 1U1NA 1FXXA 2CQ4A 1RAFB 2WUSA 3VVTA 4JI5F 1RAOA 1KQSR 4LF9K 4NLTA 1GLEG 4ANEA 4DV6K 1LWFA 1YI2S 1HBOB 1NJZA 3P5BP 1TAUA 3KIOA 2W25A 3A8JA 4QBUA 4F67A 1SJ4P 3MM5A 3LL3A 4B3SF 1WG4A 3GLJA 4RX6A 1NJWA 3BSOA 3VGMA 3JAMO 3RB6A 3CI5A 4DTXA 1SUQA 1IJFB 1LWEA 5E3QA 1YG0A 4LSNA 2D1CA 3UE5A 5GVQA 4AL7A 1VSHA 1JJCB 3HSJA 2B7CB 3AH6A 2KRRA 3K9JA 1NKEA 1S9EA 2R7RA 4HVJA 5GIPA 1F2HA 2E5IA 1KVAA 3DJCA 4WQ4A 5C2DA 4CO3A 3VA3A 5C5JA 2PO4A 1WAJA 1VQ5N 3HVTA 2VJUA 6AT1B 2XHBA 4NA1A 2M0GB 4OX6A 3NL0A 2D0OA 3G6EN 4YEAA 3LF0A 4CGIA 4EZ6A 4KFBB 4P7VA 1VQ7S 1UVIA 4J9UE 3GFZA 4LR7A 1VQ8S 3W5ZA 2R7YA 2UU9J 3QAUA 1Z6RA 4QU7A 1QVGM 3IBFB 4YOYA 1WC5A 1S1WB 1QAIA 5GADU 1WNEA 3TRGA 3ZZZA 5J2QA 4OHWA 3IWLA 3W7BA 5JS1A 3VAKA 5LM7E 3D9BA 3BDEA 4DR5F 1WB9A 1NDPA 3A5NC 2UXDK 2QYGA 4WE1A 1SJFA 3W2WA 2EFVA 4X4TA 4CEDA 2UUCF 4CIFA 2KKHA 1QHTA 1N52B 1H2VZ 2AEFA 3DXBA 3AVAA 3NGDA 2CPEA 4JKHA 1N0VC 4W4MA 5KT6A 3ZSRA 3H4DA 4Q43A 1DAXA 2NRWA 2B51A 1BIUA 2P9PA 2BQ3A 3NVMA 3NH0A 4ECWA 1I39A 4AQYF 4YOEA 3AVBA 3TEHB 3HZ6A 1M90T 2HS4A 3S3OA 3CD6N 2CPZA 3AA3A 1D9DA 4K4UA 1WDDA 4I68A 3D2EB 2J9CA 3JQKA 4CZEA 3M32B 1HKGA 2GGPA 4EBEA 4F4ZA 4FWOA 4Y28C 3U9ZA 3ZT2A 4DV4K 5IQQA 1S7IA 4DL7A 1HX1A 1PJ7A 5G0RA 5AZJB 1WF2A 2EKNA 3IR5B 2ZJRQ 3CCWA 1QQCA 1FJCA 1NKBA 4MIAA 1LW2B 1YVUA 3J8AA 1QUPA 4ENOA 5T7LA 2O8BB 4TLQA 1ZH5A 4FWPA 4RU2A 4ZVQB 4H54A 4DV5F 2IVYA 5E3CA 1NWKA 3VQ6A 1RADB 2HQCA 1C1CB 3OUYA 4U8VA 2DHHA 4F4XA 3EICA 1IBMK 4DB3A 1VHFA 3CMAS 3M2RA 4DJBA 4B1WB 2AD9A 2IIRA 1XR5A 1V6HA 4DWIA 1JJ4A 1RDRA 4KTZA 4FJJA 3OBYA 2ZBPA 3DWLA 4W5QA 3IM8A 4OI2A 4FK4A 2RJZA 4ZPAA 2DNRA 4TY8B 3J7ZO 3ULEA 1T3VA 2QA4G 1UOCA 2RHKA 3CJKB 4HACB 4ILMA 2PBDA 1VSDA 2DISA 3QAEA 3F41A 1I6JA 3IKMA 4J5OA 2HZVA 1FJGF 3L4IA 4DTSA 3KLIB 3C0BA 1U1QA 3OL7A 1NRKA 3TUZC 5D8HB 4HCCA 1NHUA 4DTJA 2HHHJ 2B9WA 1RSCA 5H1SV 5HATA 2M4MA 3IFEA 4E3SA 1GMUA 3TSPA 2HK2A 4RNMA 4C48A 3GMGA 3O9TA 1R8AA 3OTOJ 3UN5A 3RAXA 4LF8J 4CZCA 4F3QA 4KKOB 2FJEB 2ZH3A 2VQFF 1B3TA 1GLCG 3MR7A 1TL3A 2NUBA 1NK6A 3KLFB 1YJ7A 4KB0A 2DRDA 5IM0A 3QYYA 4IG3B 2FSNA 4QR1A 1NK9A 3HHDA 2M88A 4DFPA 1VQ6S 3V81B 5AQWA 2RIJA 4PPZA 1X5TA 1PBUA 1QJHA 5G4DA 1VFJA 3MCPA 4LJMA 4K0KJ 4J7CA 4YHHJ 4DPUA 2ATCB 3L2UA 3V6DA 4O5BA 1HMVA 4PAAA 2BW7A 1PYTA 4Z2XA 2YV0X 3GWCA 3P1GA 1R0AA 5KFKA 3TQEA 2QSFA 3VETA 4ZCMA 2XMUA 4GVBA 4JK8A 1XMOK 4OFZA 2BQRA 2XS7A 1VQSA 2PIIA 4DL3A 4DG1A 2FPHX 2E1PA 4WU2A 1GMWA 2Q79A 4O3PA 2DR7A 5ADZA 4H4MB 3L3CA 5KI6A 4OHZA 1HQEA 5B0EA 4WZMA 1NK5A 3MMVA 2Q1LA 2HVHA 1ITGA 2X6SA 3RR7A 4IKFA 1D9FA 1GMWD 1ZBUA 2AJQA 1RWKB 4DZ6A 1WORA 4AHTA 5BYSA 3W60A 3CGIA 1WLJA 4QR2A 4JI8J 3JSRA 2JJ4D 1YXQA 1FKOB 3D7SB 3H46O 1HARA 1RGVA 2OTLS 1NJIO 3L9ZA 4OKEA 2ZOMA 4DR2F 4RBVA 2RF2A 3LGMA 4KHPJ 4ECTA 4BC4A 2WC9A 2E9RX 2RHQB 3CDAA 4M7XA 5FLXU 1IBCB 1AUSL 4O44B 4OYWA 2KW4A 4LFBF 4CIOA 3OYNA 4OLBA 5LL6Z 4GKJF 1SVDA 3OFGA 1H0HB 2E20A 2ATLA 2YWKA 2GWKA 4CF0A 2XYPB 5HLFB 2ROGA 1G1XA 1UEUA 4JBCA 3NNAA 2MQQA 3J81O 1Y10A 1XJWB 3ZYYX 2J7WA 1T9XA 4B1ZA 4H03B 2R7UA 2AJ4A 5ETOA 4GKKK 2HWHA 2ZNZA 4YS2A 1IBMF 2PEHA 3SPZA 4IKAA 1RLDA 1D09B 4FBTA 4UF4A 2Z1HA 1NH8A 1RT5B 4DTNA 3DI6B 2VPZB 3HX9A 4CHOA 2PGCA 3ILIA 3OJSA 3VQQA 4QWDA 3SCIE 1RYRA 1IBKK 3H40A 2MKYA 4PA1A 3GR0A 1WJ9A 1A5XA 2YKNB 5J2NB 3TAMA 1F5BA 1P9QC 5JJBA 1BUXA 3CF5L 2XMJA 1QUVA 4CK2A 1T8EA 1HD0A 3EZOA 3TR5A 1DTQB 2YH1A 3WC2A 1UPMB 3EE3A 3DNCA 2XLKA 1JLQB 2DPIA 1RWXB 3VTHA 4M5KA 4XDCA 3R5GA 1VC0A 1QSLA 3H0PA 4ZCIA 3T1HJ 3EVMA 3LGHA 3KLVA 3UCZP 4C8KA 3NDKA 1TUGB 3R5BA 1HPMA 5F8MA 2W42A 4U9RA 1OSCA 1IKXA 1N5SA 4IH7A 1HYSA 4DV1K 5M1NA 4CW7B 4RUCA 5IC6B 2OPQA 3THVA 4NYFA 2JEFA 5GAEP 1RWVB 2J76E 4I2PB 4BRLA 1UPPA 1CJKB 3OHBA 3CCMN 3IMXA 3V6HA 5M1OA 4O23A 3Q22A 3KJVB 5GAHP 2PD1A 4NXNJ 5A8KA 1LWXA 2NXEA 3E66A 1Y11A 3DHWC 2MQOA 2GX8A 4NI2B 2CJQA 1D1UA 3MFHA 2E1RA 4YOXA 5MAOA 2O8EA 2IGIA 1NZAA 1W9HA 4GO5X 2R42A 3ENBA 5J2PB 4X65J 4ES3A 2CPDA 3DLBA 1B7FA 5L39A 2KHDA 2LQBA 4ED1A 1KFSA 2DEIA 5ITHA 4KHQA 3KUEA 1N4LA 1UL3A 4GV6A 2VGMA 4E98A 3OLAA 4JI2J 3O4WA 4BLGA 4CM2A 4DV7F 1BMQB 4UOCA 4AL6A 2NQPA 1LAWA 3SMZA 4G1IA 1VBZA 4B3TK 2FJWA 4LF5F 1U1RA 1EETA 3BN7A 4RR5A 2NZCA 5KFTA 1U4BA 2A40A 4BC5A 1R6VA 3PY8A 1VHIA 3SV3A 2EBEA 1HLWA 2HLTA 1IR1A 3I55S 3KHGA 4WK3A 3DLKA 5KPRA 4CEZA 3GL1A 3Q7BA 5KFDA 2UXCJ 3W62A 2KYZA 2W2PP 3MR3A 3NGYA 2VIHA 4OJ3A 4ISEA 1U1LA 2HS0A 4LRBA 1XNRF 4FL9A 1DGKN 2FYXA 1NGFA 3D2WA 2YWFA 2OTJN 3PDNA 3NHGA 3RBXA 4LRDA 4CO4A 3X1LB 4X4VA 5A8RB 4CF1A 1M1KO 2GELA 1T03A 3RW7A 4ED6A 1NSKL 4PPDA 3D0GE 4BRNA 4EYHB 3WNEA 2NCKL 1K0VA 3H1QA 1YJ9N 2BJ8A 2BE9B 2MKHA 1QTMA 2HHPA 4CI6A 3NGKA 4DCPB 4KGZB 1N32K 2ZM6J 2F8HA 3CJ7A 4JV2A 4FW2A 1IKWB 5FPEA 3M9MB 3D4JA 4JV5K 2XM3A 1BQMA 1PYOB 5A0YB 3HHEA 4JI6F 4PKHA 1WC0A 1JLAA 1GX6A 3DHXA 5BR8J 4B9UA 4FYWB 3AO5A 2E4LA 2ZZMA 1U1MA 3VCDA 1UMJA 2V67A 4M3ZA 3CCZA 3RBDA 1RTIB 4WBFA 2ZDPA 3CFRA 3CJSA 1KC8O 3R6MA 5KFYA 1R59O 2H1YA 3F2KA 5HRNA 1YT3A 5M1FA 2ZJPL 3I5AA 3OW2R 3CC7N 2LDYA 4FKXA 4DR7J 1JXBA 4XH4A 3VERA 2MQNA 2HBRB 3MXJA 2F40A 2Q6BA 2E7WA 4CVNE 4V19S 4JP8A 3D0IE 4IR9A 4G1QB 1S0NA 5FD1A 5BN9A 1SV5A 2XY8A 5AQGA 1PBAA 4Y0FA 1BY9A 4JI3J 1VJWA 4TQSA 4DV1F 3GSIA 2BBEA 5F8GA 2QWRA 5J2MB 3U1MA 1VRTA 2Q0RA 3VVUA 1DURA 3VWSA 2ZVIA 4IG0A 1YLXA 5FJ4A 1GAOA 1I94J 2VZ9A 4RWWA 1YZ7A 4LH4A 5AJ3F 1N36K 2VPWB 2VA2A 3DC2A 1J2VA 5CQGA 4IZ9A 3QBCA 1SXLA 2VC0A 3IAM9 3K8WA 4PL7A 4JYAK 2CKWA 3NF6A 3HHLC 4CH7A 2QTWA 2FZGB 3G4SN 1J27A 3BZKA 1ZBLA 5LJ3Y 4DR1J 2QW9A 1RTJA 2X1AA 3RRKA 3PG9A 4DPYA 2OSQA 1CS4B 1WOPA 1UAXA 3L2WA 3U3YA 3LA0A 4H0TB 2CH5A 3K5OA 1MA9B 3AXKA 1Q7LB 3UNYA 3WQTA 4M3TA 2AJ0A 5GAGP 6FD1A 3PW4A 4OPJA 3A12A 1MMDA 3C6UB 2Y9HA 4YN3B 1VIXA 2ILZA 4WKYA 1WSIA 1GLDG 1EO1A 4C8YA 4ID5A 1L3UA 1Z2LA 4FWKA 4O3SA 4YB1P 4RZRA 3MM8A 1R8BA 4DV0K 4L76A 1GOAA 1X60A 2V69A 4NLPA 1N5YB 5DQHA 3GJTB 5HP1B 1VJQA 2AYGA 5H9FJ 1VSFA 3CW2C 3QRRA 1V4SA 3TWHA 5IXUA 2WTUA 4AHUA 2AJ2A 5MLCQ 3FBFA 3NP5A 3B8HA 3KLGB 1HNVA 1N5QA 1RU1A 1GT8A 4E1NA 4KTWA 2VFRA 2Y1LB 2W9AA 1FRLA 2R8IA 4DLGA 4E7JA 2CQBA 5DQIA 2GMJA 4BROA 4JK7A 3NBPA 1JLBA 3FMWA 3C6TA 2D3OR 3THXB 3T19A 3I0SB 4NXMF 3TOQA 3MX2A 5GAEU 1UWAA 4E1MA 4YDDB 3QLHA 2DCUB 4FOEA 3QT7A 3FLCO 1U0SA 3PXGa 3QPIA 3GV7B 1QLNA 4CLFA 4AT1B 3NGZA 4OX9K 2GO9A 5IT9U 3ZLJA 1RBLA 3UE2A 1FKPA 2DITA 2V2QA 4QIGA 3DRRB 4B3RK 3M8PB 1K1QA 3O4QA 4ZCLA 4CEOA 1WTBA 4ITSA 2HAFA 4HI1A 4JV5F 1RT3A 2YHAA 2HQGA 4NA2A 2B9EA 3MXIA 3BKTA 2YQ3A 4NMXA 4RO0A 4LSLB 4LBHA 1UEKA 4IFVB 1NNEA 5FRNA 5KAKA 1D3WA 1YX2A 2I7NA 1OVQA 5AFUA 3V5RA 1U47A 3WXKA 3IR7B 4CFAA 3CE8A 1I3AA 3SJHA 1NU4A 2IVPA 1U2VB 2EVZA 2VFSA 3LZIA 4CBWA 3W66A 4MLHA 4DQQA 4ECRA 3N5FA 1YRTA 2B9YA 2FQQB 4FYDA 2HFUA 3UKRB 1JNZB 3HHNB 2IM1A 2JNJA 4ZJOA 3NCQA 2LXUA 4JS4A 4KI4A 2J8AA 3R27A 1RK8A 1RT7A 5D4NA 3ENOA 1UETA 3S8SA 4MFBA 3U8XA 1JWWA 3OD2A 2KI2A 4KE5A 4LF7J 1X4FA 1VDHA 4DQ8A 4K8ZA 2RB7A 1HNIB 3O9UA 4K8XA 2QWLA 4OJRA 2ZBQA 4CJUA 3BGRB 3SYZA 3EUNA 4NRUA 2QLWA 4WKRA 4DV2F 4BACA 1FTRA 3U02A 4ILJA 1HW9A 2PYJA 4LR9A 2DGQA 4WTYA 3D1QA 1AFJA 3K57A 3ALYA 3W9HA 2E2OA 1JNRB 1SQFA 3NGRA 2B56A 3DLHA 5FDLA 2ZDOA 1MWYA 2GMLA 3JS6A 2YPYA 1HHTP 2MQLA 3V1OA 1VQ4N 1RKJA 4K4YA 1S6QA 5M2UA 3PW7A 4LFCF 1I3OB 1FHTA 2X6NA 4P10A 1Q81O 3N0VA 4NLCA 4HHJA 4BY9C 4BR0A 1FW6A 2C2MB 3VAMA 2GJ2A 5C12A 2XHCA 1MWQA 4YDUA 4DSKA 3MM9A 3G71N 2BM0A 3M1FA 5KGWA 4FP9A 4LF6J 3J80O 5IWAJ 2B4UA 3KUHA 2GFFA 3ISNC 3PHTA 2V4JA 3ZEUA 4I64A 2YX4A 3THTA 3QATA 3PKMA 3HDSA 4ZOSA 5C2FA 4RWTA 3QINA 5C42B 4DV0F 5KFWA 4FLWA 3PO4A 2QXFA 2DH9A 2Z8QA 2BVZA 2R9LA 3LP1B 3CCLN 2XYHB 1NG9A 4H4OB 1TVRA 1RAGB 1CULA 1RQ0A 4EHUA 3CM5A 3CJ1A 3C16A 3PEHA 3BREA 2ZVSA 4C97A 2DBBA 3MDQA 1NK7A 4AHVA 1FRJA 3VV2B 3K5MA 2HHQA 4UZBA 3ZX0A 3SQOP 1IM6A 3CJ3A 2WSEC 3TR8A 4LSZB 4I6AA 1NB7A 3FFKB 3QMQA 3RMCA 4NZ0A 4CGFA 1AZSB 3KTQA 3IDHA 5KFHA 5K8PA 2FUG9 3VALA 2MPUA 4CJSA 2JDJA 5KFLA 2DR9A 4BQLA 2FD2A 2QC3A 4FPAA 4I7FA 2RRNA 4FWSA 4Y1DA 1ZPWX 1WKKA 2KYXA 1Q86T 3QB0A 5ETTA 3AGKA 2OAUA 2AP6A 2HSEB 4IWVA 2L08A 2QK9A 1J5OA 3E1YA 3BV8A 5AQZA 1ACMB 3OR2A 1F9EB 2R7QA 1QM9A 1TL7A 3R2DJ 2CJXB 4JI1K 2YPZA 4Q8EA 3CJCA 2OGUA 1VISA 3IGVA 2AJFE 2CQPA 2DO4A 2MKJA 2RKIB 1QS4A 4HUGA 2VOPA 3QO9A 4HH0A 1VMBA 4CD1A 4FLYA 1B7YB 4DV3J 4FDFA 3US5A 5I3UB 3G0ZA 1K1SA 1S1VA 4PKDB 3NS6A 3CCJS 5AXKA 2KHCA 4FO0A 1N8RT 2IAJB 2QWOA 2J6SA 4NZ7A 5GAGU 5KGXA 2G8VA 1IWGA 2DR5A 2IDLA 5E5NA 5HRSA 3M8QA 1JL1A 1Y5LB 3R9LA 4F4KA 1XNQK 3UDEA 1RDUA 2XSJA 3OV7A 4ZS6A 4J90A 4CJVA 1WDTA 3DGPB 3WEEB 3QNNA 4DUZJ 3C6AA 3OR1A 2KRBA 4Z4HA 3NH2A 4F4YA 1T3OA 4QYZK 4FSVA 4BE0A 1VQMN 2BABA 1DTTA 1D8YA 2JL9A 3GU0A 3CD7A 2E8AA 4O5FA 3HMJG 3UI3A 2A18A 2DNQA 3G8SA 3WXIA 3AA5X 1W0HA 3VZIA 1KRPA 1E6YB 1IKYB 2YJEA 1D0EA 4RW9A 3DLEB 1U7LA 4NL5A 2RQCA 1H98A 4H4KC 2LEAA 2YWGA 1NGJA 3O9RA 2ROPA 4OKJA 3I32A 4LF9J 2G2YA 4FWRA 3GONA 4QQBA 3KWMA 4DV6J 3SQ4A 2PC6A 2XBPA 1NHVA 4OPHA 3AD7C 2RUSA 1BXNA 2Z1JA 1T9VA 2B6AA 5BPNA 5ETVA 1GOBA 3DOKB 3SV4A 3GILA 3MN5A 4ZP9A 4R25A 1RU2A 3RRHA 2WRMA 3QIPB 3OL6A 2VG7A 4MLEA 4OYIA 2WB1D 3VQ9A 3KK1A 4OYPA 2I0XA 3DRPA 1LWFB 4MKBA 4FOIA 1S3XA 1KAYA 1QAJA 3T7ZA 3LM9A 3MM5B 3TPQA 3P83D 4EBCA 3AB2B 4DQPA 3HHKA 4Q45A 4CQ1A 2VKRA 4QIFA 3ASMA 2XO6A 1SUQB 5ETMA 1TKTB 1LWEB 4F2RA 2BDPA 4LSNB 2BUPA 3ZSZA 1NGHA 3V1RA 3S9HA 2CNLB 1X9MA 3OTEA 4EMDA 2F96A 4ZP7A 1VQON 4JKGA 1UKUA 3L7OA 2AW0A 4FBUA 4JV0A 5HL7L 2G8FA 1S9EB 5AQYA 4HLBA 3ZZOA 2VV5A 5KFPA 2MKIA 5HMYA 5HL7Q 1OQ6A 2Y8WA 1O5JA 1LFPA 3NRBA 4JKCA 3BKFA 4DPXA 2IY5B 3HVTB 2YKOA 2M70A 2GJFA 4OHVA 4NLGA 5HMZA 2O8CA 4CTAA 2UXDJ 1MSWD 1MN9A 2V8DA 3BKUA 5AQSA 4FVCA 1X9JA 2ILYA 3AODA 2AHOB 4QIWD 4IJNA 3ULDA 1SQEA 2JX2A 3V9ZA 5DM7L 3V4MA 3RWUA 2OI2A 1UVLA 5J2QB 1DHMA 5DM7Q 3MMBA 3KYLA 2MQ8A 4DPOA 4WE1B 3W2WB 4JI0F 1W7AA 1F6TA 1X7VA 4HTJA 2V9WA 2MZRA 3E2EA 4WQ5C 3C19A 2HS3A 3KHHA 3MEDA 4WYLA 1KKHA 2QEXN 3HSGA 3RMDA 4ZLJA 4V19X 3BGFA 3NS7B 3MCMA 3A5OC 2P9PB 4DL4A 4OGEA 2P9CA 4DV4J 3TUPA 3EMTA 3ZTPA 2XTJP 1C2PA 1RCHA 4P2XA 5EOYA 2UXBF 2PY5A 2QE5A 1EKSA 2V6AA 3MK6A 1WOOA 3OVAA 3AY9A 3KJNB 4K5RA 1UJ5A 3KMSA 1HBUA 2X1BA 5KG5A 4OJ1A 2GGPB 4BVOA 3J81Y 1MLAA 5HI7A 1YIJN 2B4JA 5D3GA 2XZDB 1WHXA 3CJ9A 1C4CA 1RT1A 5G0RB 3SSRA 3IG1A 5E0OA 1CXQA 5A6PA 3PFOA 3MUMP 2WK4A 4PKGA 4KB7A 4J9QA 1SC6A 1WBBA 3PR4A 5T7LB 1IO2A 1C0FA 4OYOA 2HFZA 4HDGA 3DLGA 4XTTA 2HGNA 2DGOA 2DHGA 4FNIA 1OH6A 4ELVA 4O0IA 1WI6A 4NLYA 1JJ2R 1FDNA 3OUYB 3TANA 4NZ6A 2ETJA 1ZZFA 2CPHA 2MMYA 2XS2A 4AHCA 4PUOB 3AXMA 1O51A 1V9OA 1TMMA 4DPWA 3QJPA 1IQTA 1RT4B 4JI7F 4HHUA 1KN6A 3CC7S 3DAWA 2HQDA 3CCRS 3BB5A 2UZAA 5C25A 4RG8A 4LF2A 4ZIVA 2A42A 4KHNA 3V1QA 2NR0A 5BR9A 2E9ZA 2Y3YA 3PYEA 2BOPA 1WI8A 2KFNA 1N56A 5GADI 2G1HA 5AZIB 1PYSB 1SH0A 2BANA 3VESA 5GMEA 2ZOGA 2NXCA 3UIQA 2VG6A 1R8PA 1BA1A 5AQQA 3TA0A 3EJMA 1TQLA 1NBWA 3J7ZT 3OYIA 4KHMA 1S9GA 3BO4A 1ASUA 4FM0A 3S3NA 4MDBA 1QSYA 4DN0A 2VCPA 2PFUA 1UFKA 2GW8A 3O9QA 1XR6A 3W63A 2RDJA 3CERA 2XMWA 1RDDA 4AHSA 3THWA 4ZTFA 1FRIA 2LFVA 4LF8K 3J7Z5 4FLTA 1K8AO 3A2FA 1TL3B 2QG9B 1L3SA 3QT8A 4PXBA 1H2UX 4IYQA 4DTRA 2I8EA 4MK8A 5IM0B 4JAXA 1GQEA 5F41A 3C7NB 4ILHA 4FPRA 3G86A 2BGGA 4DLEA 2D0CA 5ADXH 4B9QA 5BJRA 1FI4A 1GH8A 2EWSA 2JFDA 4FKYA 3NE6A 2Q3SA 4C1NK 3MUVP 3V6DB 2UU9F 5AQHA 1HMVB 3UDVA 1EXQA 1S59A 3B6OA 4C0HA 2NZ4A 1R0AB 4R5PA 2FBYA 4BG9A 4RNNA 2LXFA 4GVBB 1LW0B 1S1TA 3HVRA 3U1NA 3OTBA 1Z4UA 3CETA 2AWZA 4WFAL 3C95A 2X3DA 4DG1B 4B1XB 3AVKA 4WFAQ 4LVNP 3DCAA 5M1PA 1HI1A 4CEQA 1R43A 2AMCB 5DDRC 2MLXA 4M3YA 1M0SA 2P9EA 5LJ5Y 3MEEA 1ZA1B 3OYGA 3OYMA 3PUFA 1PC4A 3CTRA 5DGAA 3VGLA 1KVJA 2UVVA 5K8OA 1NUEA 1S1XA 5HAOA 1I51B 4ZPWR 2DNPA 4FPIA 2OUGA 3EL2A 3VQ5A 3MEGA 1QE1B 4HDHA 5D0RA 2IA6A 1KS2A 5KFRA 4ILLA 2VH7A 1ZBIA 4JI8K 2LVWA 1WSEA 2G8WA 1BCOA 5D4OA 3IS9A 4ZVTB 3EE8A 5SZTA 1N34J 4KV8A 3TYTA 2W4PA 2DTJA 4C0OC 3CPWM 2WONA 5DG8A 3LAMA 2IM0A 4CJLA 3ZTSA 4GKKJ 1DJ0A 3S41A 4NEZA 3C3LA 4BRQA 3R7NB 3SUOA 3CCUN 4G65A 1NK8A 3M2UB 2VODA 3O9SA 2D3O1 2QKBA 3HI0A 1IBKJ 3QZ7A 1RHRB 1U6ZA 1HWJA 4FZYA 2BE7D 1Q7YO 2RE2A 2DVIA 2UUWA 3WQPA 5EVZA 1V4TA 2P9NB 2HOEA 1LWCA 3TZZA 1RCXB 4CZFA 3M8YA 4LMZA 2CVEA 4AE5A 5M2RA 2CG4A 4KHSA 3OT9A 3SAGA 1WSHA 2FGOA 3HLUA 1T9UA 1VK3A 3G10A 3U9DA 5FROA 3TAMB 2WHOA 3D67A 2BKPA 4C8NA 1XN9A 4A8SA 5F9NA 2PA3A 2DGTA 2MKSA 4K4XA 3FJ2A 4QCLA 4F0MA 5AQRA 1U1OA 4JEPA 1S7HA 5B0GA 4FYVB 2K1RA 2BM1A 3SBMA 4ZVPB 2AGOA 4EFAC 4ZPBA 4XH5A 4HUFA 2X51A 3B6PA 2B43A 2FC8A 1CJTA 3M9NB 1YDLA 2DT9A 3CDWA 1HI8A 1WG5A 2HHHF 3T1HK 2BW2A 2AU0A 2QLFB 1IKXB 1HYSB 5D77A 3CMES 4DUTA 2EPIA 3M30A 3QWPA 2OPQB 1XK8A 4OI4A 4MYTA 2NLWA 3OTOF 1YUWA 3K89A 4M5GA 2CIMA 3O5TB 5B0DA 1CC8A 4NLOA 3TVYA 4ID8A 4X62K 1VQPS 3CJTA 3OYFA 4CDIA 4FJNA 1CJVB 2M3DA 4LQ3A 3OSNA 1DZ5A 5A8KB 3H45C 1TK0A 5F8JA 3OYHA 5F0XA 2FVRA 4FJGA 4CO0A 5D0HA 4NXNK 2YNFA 3CCVS 3NVKA 1UCNA 5KG3A 3H6EA 4QOZB 2KQ2A 2B5JA 1U2CA 4IQXA 2WOMA 3QEWA 2O8EB 2ZC4A 1VBXA 2QLBB 3N4QA 4K0KF 3FCHA 1UZHA 1XMQK 4YHHF 4PG8A 4B3TJ 4JS5A 3PYFA 2D4WA 4DU1A 4FJHA 1KD1O 4MJKA 2GAHC 4Z37A 2HHUA 3HO1A 4FF1A 2UVWA 4KB1A 5FLXY 3Q2SC 2CQDA 3LWMA 5BPLA 3IBCB 4DU7A 1EETB 2JZ5A 4GVLA 4P72A 3EE9A 5A2QU 3O2IA 3IP0A 2KZMA 2DNHA 4PABA 3DLKB 4YNQA 1LQ9A 3HHLA 1WSJA 3TTFA 3BH7B 4WCEL 4K2XA 3T6BA 1B64A 4RUHA 2V5HG 1KHVA 4TVAB 4WCEQ 1QY7A 4JI8F 2W2MP 1A6LA 2JRSA 1BQXA 2DPJA 1AB8A 3J7AP 2RQMA 3L95X 4X64K 2BKNA 4CLTA 2HFVA 3HHLD 3MCNA 2HIYA 1N32J 2PMHA 4YR0A 5CH7B 4DBQA 5KFBA 4B1UB 5K8MA 1T03B 4KHPF 2GVZA 1LAVA 2HFOA 3CC4N 1RACB 1YJWS 5DDPC 3E9PA 2AZ3A 1XI1A 1VQYA 2OO4A 4HL9A 4F50A 2CQ3A 2HBYB 3P4UB 3CCQN 1R31A 4JNEA 1KFDA 1ZAVA 4KBOA 2QWMA 1VI7A 2WVFA 2YBVA 1TK8A 2MSTA 4TXSA 2DEJA 4N7TA 1VSKA 1BQMB 3NWRA 4PG4A 3CPEA 1JLAB 4DTOA 1QD1A 4KT0C 2C2RA 2ITGA 3LO3A 3O1BA 1YZ6A 2DNZA 2HMIA 3D2FA 5EWEA 2CRLA 3T1YJ 4DXLA 3GSDA 1IBLF 3ZZPA 4USVA 1KWMA 1RDAA 2BJ3A 2VD3A 4ZVFA 3NOGA 2C2DA 5CAAA 2IJRA 4QZVB 5LMUK 2VDIA 5JXSA 3EGWB 2EG2A 3BSNA 2DIUA 5HO4A 4CBUA 3V4IA 2WW8A 3DKDA 2YNGB 3IC1A 4U7CA 4L3QA 3KJQB 2VQEK 1RAJA 3DMJA 2VBZA 4NCBA 4IH6A 1NGGA 3AVGA 3A8KA 4UZCA 2HW3A 2BXJA 1RBTA 2MSSA 2VWKA 2AGQA 4CNZA 2OSRA 2DCLA 1BWEA 4H5WA 4A62A 4OX8A 2J8SA 1KC8T 1S6PA 3ENQA 2H48B 2Z58B 3MM7B 1RJJA 4IOCL 4V19J 3CMQA 3P96A 1KLNA 2XCPA 4HT5A 2G0JA 1N36J 2GZOA 2NLXA 4IOCQ 2VG5A 3JXOA 1SI9A 4L3NA 5KFAA 4TYBA 1HNWF 1RAHB 1VRTB 3WX8A 1CQMA 2XGQA 5SUHA 4WF9L 3MHYA 4IG0B 1GX5A 1L3VA 4JKBA 5KFMA 2JLFA 2GTDA 1RHMB 1VRQC 1M1HA 3R5CA 2GBZA 2CQ2A 4NOHA 4WF9Q 3PO5A 2AX1A 1HNZK 3AD9C 2ZBIA 4AM7A 5DZ6A 4GVMA 5EU7A 1S1UA 3DM2A 1FRMA 3FFIA 3CXCM 4OZ5A 2R2RA 2GHWA 3HSTB 2DK2A 2EC2A 2HQFA 2GQ2A 2O3DA 2GVDB 2HNYA 2MB0B 3LPEA 4X65F 1YTAA 4JHDA 1RLCL 2W7PA 3DOMA 1HBNA 1W2BM 2EEYA 4QYRA 2ZHAA 4LT6A 3JAMU 3OLBA 4PL8A 4CJFA 3P4IA 1HIYA 3G25A 2CQGA 1FF2A 5EXWA 5AQLA 1OJ4A 5F9LA 1FDBA 4OJGA 1T9TA 3PX0A 1SKUB 3CJRA 4X4UA 2EFNA 4JI2F 1B99A 4ID5B 3EM1A 3WC0A 2XY5A 4OX7A 5H1SQ 3IFRA 3GPAA 4B3MK 3MM8B 4CJWA 4KBIA 2UVRA 4BRKA 5HBMA 2B4OA 4USJC 3M9OB 2E1AA 2RUGA 1O1WA 2FSKA 1BO5O 2NPFA 1WNSA 3QETA 2RE1A 4PG5A 4R79A 1OH5A 2ASJA 1HWIA 2Y1RI 4EWTA 1HNVB 4GVEA 4ZVRB 4XPCA 1QSSA 1A9NB 4K8RA 2HRYA 1TUWA 3VEVA 3SXLA 2UXCF 5HK4A 4OX9J 3MAAB 4XIUA 2CFXA 1HLUA 1CJUA 1J9AA 3NBPB 3AJDA 3G96A 1JLBB 1K8KB 5TKWA 3W8PA 2J7UA 2D1KA 3ILOA 1VLYA 3C6TB 2JC1A 2WSFC 4DUYK 2R2UA 3QLHB 2PI5A 4TU9A 4CGHA 1EHWA 4WJBA 2P9IA 1TKXA 1GXUA 2QA4N 4BDZA 2Z2ZA 3P38A 4F8RA 2DNKA 2J4RA 2HNDA 1S72N 2PZSA 2E5LJ 1EJ7L 3KD5E 3O1WA 3QWUA 4IO1A 2BUNA 3B78A 1FKPB 5LMNK 3AAWB 4U7UD 1MW7A 3CQXA 4PYAA 2H4WB 3LW5C 2MTLA 2EG1A 4Z7CA 1OQ3A 1S97A 2ZM6F 1CPZA 3FSXA 2F65A 3EEQA 1LEOA 3QEXA 1EX4A 4RW4A 2V9KA 3NAIA 3WIVA 1F2GA 4FJ8A 3CJ5A 4DMZA 4FJIA 2RHSB 2BTFA 2MY7A 1VHXA 4B9SA 5BR8F 2NNWA 2E2PA 1NJXA 2ZOFA 1HQUA 2C2OB 4IEIA 3TSUA 1RWWB 4A5BA 2AZ1A 1RFQA 4UTGA 3S3MA 2EBGA 4FK2A 3GE9A 2D3ZA 5I3PA 2GUIA 2MQPA 2CNKB 4CK1A 5DM6L 4RJVA 1W2IA 1FJGJ 2OP5A 1LNQA 2DGVA 5GADP 2CQCA 4DR7F 2YNIA 5DM6Q 1C1BB 4ER8A 1R6YA 2FLOA 2K3KA 1EWQA 2BACA 2LQ9A 1NJYA 1VAZA 1U6BA 5BYQA 4IRDA 1RT7B 1FFSB 2RAQA 5HRPA 5C2GA 4B9VA 3KZBA 1Y4ZB 4OLAA 5AQUA 3DXMB 1EP4B 3MN7A 2HNZA 3QJLA 1N6QB 4HWIA 4LF7K 4AYBD 2A1SA 3GIIA 3LPTA 4JI3F 5DJBA 2E1MC 2E5HA 1M5SA 1OO0B 1Q5YA 2H5JB 1FWPA 4M41A 2FJBB 3SNNA 1WAFA 2YQ0A 3FBCA 2Z4PA 1Y64A 4Q0BA 4RU9A 4RNOA 1I94F 3C66A 1XHXA 5FDLB 3WIUA 4E7KA 2OCEA 2P5GA 3NFAA 2ZKTA 2ADBA 1XR7A 2RRAA 1Q9YA 2VU5A 1VQLS 4OV6A 2HB5A 3HBTA 3HOSA 1S6QB 4IJAA 2F9TA 2MJUA 5BRDA 5GAEI 3I56S 4USWA 4OI0A 4DQRA 1ZXOA 4DR1F 3HI9A 1MROA 2ATQA 5FPDA 4NCAA 4ZJQA 3MWTA 3MM9B 4H4KA 1VSMA 3E01B 4RCHA 2O67A 3CO9A 3QGGA 4Z4GA 1NHKL 3K17A 3ZEUB 4ZP8A 3H8YA 2ZKUA 2ASDA 1BUPA 3RGIA 5K9FA 3K7RA 2BJ1A 3MPDA 3PX4A 1WOSA 4KSEB 4F0KA 4CJ3A 5KOXA 2VDHA 3G6VA 2M8HA 1OH7A 2GO8A 3GJRB 3H59A 4UOGA 4YB7A 3AOCA 5IT9Y 2XG8A 2GNKA 1WG1A 4USIA 2BH1A 5AQIA 1TVRB 3BO2A 4CT9A 3ZSWA 3D1OA 2J6TA 1HI0P 4F4AA 1HNXK 3K5LA 3C16B 1XTZA 2NXNA 4WU3A 3OVBA 4ZN1A 3SBGA 1PIEA 2OEJA 3H1VX 2OH2A 2LA6A 4KRWA 2ZH9A 4WP8A 4H5RA 2VPXB 2ZWPA 3ZX3A 3FK4A 4CYUA 9ATCB 1IKVB 2KT2A 1WC1A 4CHYA 1C0TA 5JLFA 1D5AA 3D2EA 4BRPA 5L46A 1IR2A 1VBKA 3AVIA 4DX6A 4LFBJ 3EKSA 4KHYA 1MMLA 3PYDA 3KK3B 2EI5A 4TSXA 4JI1J 1WUUA 5DRKA 2QV6A 4C3MA 5BN8A 2DFFA 4W5NA 1K73T 1R0CB 4BRHA 4M5HA 4NB4A 3KKFA 1LW2A 4CEEA 4ZCKA 4PHTX 3TARA 2FC0A 1D8ZA 1J5OB 1J5EJ 4V1Ak 4A4JA 3OR2B 4Z4IA 1XUPO 2YTCA 1GXLA 3KUGA 3AA4A 3UDLA 1YQHA 1TKDA 4Z4FA 1C0GA 3CDEA 1FXDA 4QWBA 3UW1A 4Q44A 3QO9B 1XNQJ 2ZQBA 2F7TA 3P39A 3MPUB 1Y7PA 2O4GA 4G6VB 2QFIA 4K7QA 5KTQA 1DQAA 1S1VB 5ETQA 3ZNUA 1YJNS 4QYZJ 2X1GA 4DV3K 3R2CJ 2CNOB 3O3LA 4UT4A 1R3NA 1Z25A 3CCUS 2F4VK 2BJ9A 1WSGA 2E44A 1S77D 2BOAA 3UVJB 1X4HA 1ELOA 4LRCA 3VQ8A 1VK8A 3O1LA 1JK9B 2AP1A 4BDYA 1GTHA 2XSJB 2DNGA 1P6TA 3A0IX 1QZ6A 2FGCA 3OR1B 1GFWB 4PY5A 1ZTWA 3OYAA 3M8SA 3T9ZA 2O1PA 1BHNA 3EGZA 3NEKA 3VQBA 1T94A 3PKYA 2UV8A 4M42A 2W9BB 3VQDA 3VAJA 4RW9B 2D41A 3HL8A 4O3QA 3LM2A 5E3AA 1KP6A 2YNHB 4JKDA 3W3SA 3GYGA 3LOUA 3TVZA 1N88A 4M94A 4DSJA 2OA8A 2B6AB 1XWLA 3OPKA 3OS0A 3TZWA 2VJVA 2OZSA 3A8EA 4ECUA 2VG7B 2VPYB 3QGIA 2JWNA 3KK1B 4PR6A 1X4DA 1ZM3A 4A48A 3O08A 3FQLA 3V81A 5AQKA 2GHVC 1S22A 2ALZA 4TLRA 3H98A 1HYVA 1IQZA 3HVAA 2A6OA 5HQ8A 4YOVA 1Q8BA 1T95A 3KKSA 2QZ8A 3T5LA 4CZLA 3N6NA 1RUSA 2VKZG 1DKGD 3R9PA 4GV3A 1BCMA 1NSAA 1H6KX 3O3HA 3SIPB 1BDGA 4B8AB 4W5TA 3R5JB 4EUVA 2QL5B 2DH7A 3A3OB 3QIDA 2Z0GA 4DFKA 1ZPVA 4LF6F 3CJQA 5IWAF 1X9WA 2G8HA 2RILA 1H72C 3FEXB 4H4MA 2LQJA 4CF2A 1CBKA 1S49A 3AVMA 3ZZYA 3F0NA 1HKBA 2O8CB 4MH8A 4LRAA 2OPPA 2NREA 4OHYA 4CTAB 4HH1A 3AFGA 4TNOA 5GAGI 2KG0A 1URRA 3OA9A 4M3RA 1SC1B 5KG7A 5HANA 5GMDA 4WYWA 1R7IA 2ZD1B 3G82A 3D3BJ 2ZH1A 2V68A 1WSRA 1FKOA 3ET6A 5KPZA 1R89A 5U47A 4YOUA 4EHTA 3BDPA 1HKAA 3C14B 3Q24A 1JL2A 3J81j 5TKYA 3VOVA 5D15A 1VRUB 5A6WA 1NXIA 4BC2A 4QR0A 2AIRB 3BEXA 3FBBA 3HYFA 4KH6A 3SCKE 3B4DA 5KFFA 4O44A 2J5AA 3UCUP 3JYTA 2D0AA 3RMAA 1NLKL 3EPIA 3NCIA 2DHAA 4GMKA 3LDSA 1UFWA 3HPHA 1U2FA 3AJ1A 3VQ4A 4AM6A 2LEBA 1QZ5A 1SAZA 2QT7A 5CYJA 3GJSB 3J7AN 2ZJRL 1EKRA 4P2SA 5CYQA 1X4EA 2ZF5O 2J9DA 2P9KA 4EP4A 1FD2A 3IO1A 2W6LA 5T14A 1HBUB 2QLJB 3DI6A 2HRTA 5LJVA 4DV3F 1NBEB 3L4BC 2V4QA 4EIAA 3FZHA 1LKZA 5D3GB 3CVKA 2AEJA 1RT1B 2IC3A 3IG1B 2XGPA 1VLOA 2YHWA 3BS9A 3JSYA 2D9OA 3BBFA 3DDKA 4K4SA 1RA6A 5HRRA 2GWJA 1U48A 1DTQA 1SQGA 4KHUA 4NLSA 3DLGB 1RILA 5CZVA 4U7BA 4DUZF 1JLQA 1DQ9A 4B17A 4LQ9A 2RQ4A 3IBWA 2ASYA 2L9DA 1Q8KA 4MKYA 2QI2A 4BRIA 1OPZA 1MN7A 2L48A 1JCGA 4EO6A 2IRUA 2DHXA 2W41A 2RD5C 2L41A 2Q66A 3H3OB 4ELUA 1YI2N 1T02A 1GLLO 2GV9A 3CJ0A 2R7OA 2YX6A 2H5IB 5C25B 3PRBA 1QVFM 4LF9F 1KLMA 4I0WA 4F02A 4IXCA 4DV6F 2HBQB 2GHPA 5KG6A 3PZPA 2XNRA 4Q2LA 4DI6A 5AQTA 4NO7A 5LXRA 4C1NI 2HK3A 3MECA 2Y1JA 1KOOA 4GRSA 4OVLA 4CEAA 5ADXA 4MO5A 2VG6B 3RMBA 2CPXA 3VHQA 2D0BA 2Q31A 1SJRA 2Q3PA 4A8XA 1LCUA 4YR2A 4O0JA 4KGXB 4JI4J 3H2VE 2YKPA 5IT0A 2BJEA 1S9GB 2K3IA 1VQ8N 4WFXA 2XRIA 4NEYA 2W9CA 1Q53A 1ROFA 1DBDA 4USMA 3AVHA 5ETRA 3MR2A 5E3RA 3EYZA 4OZ3A 2YQ1A 4H0OA 2R7XA 5HJYA 1G6BA 2RH3A 1HW8A 4C6AA 2MGZA 3BM7A 1WELA 2CA9A 4RNFA 3VAIA 4OO1J 2N82B 1UVMA 2CQ0A 3RSEA 5LSLA 4CGDA 1H74A 3ZT3A 2C3PA 5DQGA 5DDOC 2CADA 4FJ5A 2NXJA 4NMLA 2G9OA 3UR3C 4NLQA 3ZZUA 2IPOB 2XMAA 4J37A 2NRHA 3SCXA 3MZIA 2A1BA 4RW8A 4E2FB 2UXDF 3JTPA 1ZBTA 3SFUA 3C65A 3SDEA 3RAMA 3IN5A 1ILYA 1K0TA 1K8AT 1RTHA 4DX7A 3HOTA 2V2ZA 4CEFA 1JLCA 3Q8UA 1S1TB 4LBPA 4NLXA 3AOAA 5E41A 3ILJA 4NXMJ 2HGMA 2ZFHA 2Z2MA 1X1PA 2XS5A 1EAYC 4QU6A 5ETPA 1Q8IA 2MYFA 2FVSA 4U96A 3AVJA 1LV5A 5BREA 1UW9A 1EQ0A 4IDKA 3C2PA 2CH6A 4CH0S 3MEEB 3IRWP 5ETLA 1B92A 1QQOA 1HUXA 4R8UA 2NRRA 3CFPA 1TV6A 1ZBHA 3EKUA 4ZP6A 3MD1A 2DNLA 3K9KA 1UFLA 4KAIA 1S1XB 4ECQA 3L2QA 4FZVA 1AXQA 1FNOA 2OEKA 3TX0A 3DOLB 2RS2A 1QVGR 2L9NA 1T11A 3R8YA 5C0YA 3ITHA 3I9V9 1D9AA 1NGEA 3MEGB 2DPNA 3D68A 2FLLA 4ED2A 4DV4F 2KDOA 4ZPDA 1GLAG 4FJXA 3LGNA 4D3HA 3M05A 3R6LB 3O6QA 2IA0A 4OLOA 3CCES 3BF4A 4KV8B 3QZ8A 5A76A 3LQVA 2WONB 1NPPA 1N34K 4JOUA 3CMAN 4Q2MA 4A2AA 3HXMA 3KLHA 1CLFA 3ETMA 3A5MC 1ULRA 2EC0A 4PWUA 1T0TV 3S6EA 4F0HA 3B54A 3M8WA 2Y0SD 3IXQA 2VOOA 3BYPA 1HR0K 5B0FA 1FK9A 3HJFA 5C15A 1GLBG 3G87A 3QRQA 2Q36A 5GINA 4HCBA 1UWBA 5HOOA 4Z0UA 1SCJB 2FF3B 1XQSC 5HJXA 3ENWA 1YITS 4BC3A 4TY9A 2ZJQQ 1RBUA 3UD4P 4DTPA 1C6VA 1KVKA 1YRUA 2XMMA 3TNVA 1N33K 1G99A 1VSLA 4CO2A 3MPYA 1C4AA 2AT1B 1JLEA 3GJQB 2HAIA 1KQKA 4DHVA 4OZJA 2P9LB 4U7UK 2CPYA 4BC7A 2DY9A 1Q18A 2NSBA 5F3ZA 2NRTA 3H5YA 1FJ7A 5JVGL 1KQFB 2FZKB 3A3PB 3G6YA 1MNEA 3NWGA 4K2JA 5HROA 1E6VB 1NGDA 1C0MA 2UUBK 5JVGQ 4IFYA 4QWCA 5M2PA 4TKTA 3VPZA 3O3GA 4BQZA 2K1RB 1JKHA 3CJ8A 3ZT1A 1WC4A 3VAHA 2VYPA 3JTNA 3CC2S 1Q8LA 4A2BA 1OPIA 4CJ4A 2C3MA 2SXLA 1FRXA 2IYIA 1VQNS 2GAGC 1RWNB 3ENVA 3W61A 4ERDA 1VQ9S 4R0EA 2BJ7A 5AQJA 2XO7A 4X62J 1RBAA 3KDOA 3NNCA 1VQ6N 1CS4A 4CLYA 3RB3A 4DX5A 3T5KA 2XCAA 4YMEA 4DFMA 4NYPA 4ID1A 3M30B 2KO1A 2HGLA 4CH1A 2MZQA 4PG6A 1HBMA 4IBNA 3QFHA 2UUAK 2MJNA 4MO4A 2DYAA 2HQ3A 4A8FA 2JH3A 2XULA 3ADAC 1JXLA 4RBUA 1VBYA 2X74A 1XMQJ 2FIUA 1YJVA 2W7AA 4XK8C 4W5OA 3GFHA 2YNFB 1N5YA 5GMKa 5HP1A 2B5JB 2VB6A 4OIXA 1TGOA 1XMOF 1Q9XA 4FWNA 2D9PA 3NGSA 3R5AA 2DFEA 2R8GA 2ZBRA 4FLZA 1IG8A 1B4SA 4K59A 4NASA 5KQ8A 3T9NA 4DDFA 4AH9A 2F8SA 4C11A 1L5UA 1FA0A 3H20A 1RBOB 1OWXA 4YQWA 2Z2YB 2CWKA 3UB5A 3LDQA 1BU6O 1C0UA 4ZK7M 2ZWHA 4P9SA 4RWXA 4DR6K 5B0BA 2NRZA 3THXA 2OTLN 3CJBA 1FE0A 4X66K 3J80U 4P7TA 3AQOA 5RUBA 2O8DA 1UZDA 3GYXB 2H3GX 5DK5A 4X64J 2FZCB 2IVFB 3O44A 3R3LA 1KD1T 4DR3K 1BQNA 3UCGA 3RBEA 3DXSX 3MN6A 3D6FB 2ZEJA 2IOCA 3BN4A 3PLAA 3HHLB 1RYSA 3K59A 2DXDA 1YK9A 5EWGA 4M63C 4FLUA 1CVJA 1BD6A 4MT1A 1JB0C 4KRFA 1BI4A 4WFNQ 5B8HA 4LF4K 4DSEA 3GYNA 1W7WA 4USUA 2B4VA 5F0UA 3I4HX 3QMLA 4LSLA 1FRKA 2X3GA 3D6TB 3OFHA 3ZSXA 1N34F 1EWRA 1WOQA 2GVZB 1HWLA 3G8TA 2FJVA 3QICA 2CG8A 4YR3A 4EZ9A 1KQSM 3MM6A 4GKKF 3FEZA 4CZJA 6FDRA 3ID8A 1MMNA 3CIPA 1BISA 4XPEA 1ZBSA 1DLOB 1U0HA 2VONA 2J0SD 2IDOA 1Q1KA 4MYUA 2HVIA 2GQCA 3IAS9 1IBKF 4WXOA 5LMUJ 2CVIA 3CCSS 4FM1A 2O66A 4J8FA 4OPAA 1U24A 2ALYB 1TYQB 2GV1A 2KL8A 2F9JA 2I6WA 2VQEJ 2HMIB 3D2FB 1NSPA 3BF3A 3ZTQA 3R3TA 3ISZA 1I5OB 3T1YK 3BGRA 5BYRA 1X8DA 2ASLA 1X3NA 4ZVHA 5K14B 4P71A 1RAAB 5JS2A 2MKKA 3TAPA 2YY3A 4IO8A 1B70B 2ZH4A 2H5EA 3QGHA 3DMJB 4JKFA 4KPCA 4EGLA 5FPNA 3P5JA 2BYCA 2BQUA 4QS8A 2RT3A 4JI5K 1MWZA 4DS5A 4N8OA 4ZITA 3TAGA 1S6PB 3O80A 1TP7A 4Y3CA 4N47A 1WEZA 3PFEA 5HSPA 3IA0A 3M8ZA 5IOLA 3CJAA 1SPBP 4KGVB 4B3SK 4EI2A 2LECA 1HNZJ 4MKVA 4BWMA 3DRYA 3LP0B 1X5PA 4FXVA 1G2EA 1GLFO 1S5ZA 1D4XA 3ZX2A 1FDAA 2ADCA 3M4XA 1S6UA 4CLUA 1DFDA 3F56A 1UA1A 3SBTA 3T41A 2VASA 2ACMA 4MK9A 1F3VA 1R27B 2ZE2B 1RCOB 2FVPA 3CFOA 1TL1B 2FSJA 3D66A 5A2QY 1HWKA 3HK2A 1HFEL 3A3NB 1ATRA 3RR8A 2H51B 4CHQA 1S1UB 3DM2B 3Q7CA 3FFIB 2R2SA 5K5MA 2N7CA 1T6CA 3U3GA 3UDCA 1VQ5S 1J54A 3VQCA 5EX0A 3G6ES 1EX8A 1NDCA 1V5VA 2MQMA 1Q86O 2OJ3A 5AE1A 1R8HA 4OV1A 3I55N 2XZWA 5CZ1A 4B3MJ 3AA9A 1L3KA 4JHDB 5B08A 4B3TF 3F9KA 4UUWA 2C1EB