1IKWA

Wild type hiv-1 reverse transcriptase in complex with efavirenz
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikwA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikwA05
4RUAA 3S3OA 4NLSA 5KG6A 4KHNA 4DS5A 4AILC 3RR8A 4OPJA 3SPZA 4CF9A 3VQ5A 3HPOA 4W5TA 3FDSA 3Q8PB 3HVRA 4DLEA 3PJWA 3EYZA 5KG3A 3RAXA 1MU2A 4CHQA 3KIOA 2OPSA 2FBTA 1GX5A 2WRMA 5L1LA 4RW6A 3VQPA 1RT5A 1LAWA 4HVJA 2OPRA 1HJRA 4BDPA 4O4GA 3ZCMA 3FSIA 3Q8QB 3QERA 3AVGA 2WHOA 4WYLA 2VG5A 1LWCB 3DLHA 4O3QA 1WSFA 1ASUA 1FKPA 4CHOA 3V6DA 2GIRA 3ASMA 4DTOA 2HHSA 3RBDA 4E7HA 4ZPAA 4U6PA 5E41A 5C24A 2NUBA 2KW4A 2G8KA 3C6UA 4NLYA 3AO5A 3RMBA 1XHZA 3KLHA 2R8IA 5KRTA 3LP2B 1TL3A 4ID5A 5FDLA 1DTQB 3CJ5A 4GMJB 1TAQA 2DTUA 5EDWA 3MXJA 1S0OA 1JLGA 2Y1JA 3RRHA 5KFTA 4TN2A 3O4NA 1VRUB 3NBPB 2IC3B 4WFZA 5EU7A 3D45A 5DLFA 2DFEA 3KD1E 1VSFA 4DLGA 3GIMA 4CIEA 5HRRA 1WSGA 4KTZA 4O0JA 1RT1A 3LZIA 3PW4A 4NLDA 2W7OA 1S1UB 3H4BA 3NE6A 3N6NA 1QTMA 1S1TA 3L8BA 1LW0A 2GC8A 1D9FA 4ELUA 4B8AB 2HB5A 3EY1A 2CJQA 4R0EA 4OKKA 1BI4A 2A1SA 1NKCA 2WOMA 1TKTA 1OS5A 2ZKUA 4DTSA 4W5QA 1LAVA 2GBZA 1SKRA 4KB0A 5HROA 3OJSA 2QXFA 1ZETA 3SJJA 1RBUA 3K59A 4YR0A 5KGWA 1IKWA 2YV0X 4B9LA 4EBEA 4M45A 4IOBA 4E7KA 1BIUA 1RTHA 4KV8B 1TGOA 3V1OA 1TKZA 1BQMB 4FBTA 1WSEA 3SFUA 3LALA 4CJRA 4NCGB 4JRPA 3K58A 2QKBA 4HTUA 2FJWA 4LH4A 3H59A 1Q8IA 4CF1A 3VQSA 5KFFA 3OLBA 4KB1A 3ZSYA 3QETA 1RTJB 4WFXA 2F8EX 3LP0A 4F4ZA 3BDPA 4WXOA 3CO9A 4R8UB 5K14B 3OJUA 4DQSA 4NCBA 5DG8A 5KFLA 5KG1A 2BDPA 1BQNA 1D1UA 5CYMB 4IFVB 4Q44A 3PX0A 2Z1JA 2HNDB 4AHRA 4CECA 2ASLA 4DL2A 1HMVA 3M8PA 4KPYA 4QWEA 2HNZB 4NLOA 4CK1A 4K4VA 4EO6A 3CDWA 1Z25A 5EUHA 3VQ8A 1QSYA 3L3VA 3QYYA 4DSJA 1FXXA 2D3ZA 4ED1A 2UUTA 4CJ4A 3V1RA 2AJQA 1N5YA 3DLKB 4FLYA 3HVAA 4F4XA 4JUZA 1IKVA 2BE2B 3KLEB 2FVQA 1C1BA 2XCPA 3PO4A 4B3OB 4Q8FA 2IAJB 1QAJA 1KSPA 1W0HA 4QWAA 3V9ZA 4H4MB 5L1KA 4ZMMA 1HYSB 4N41A 3ITHB 3AVNA 2AWZA 4DFKA 3MFHA 3TAMA 4CHZA 4I2PA 1HNIA 4E1NA 2FLNA 3WNFA 4CHPA 2OPPA 5DQGA 4B9VA 2KFZA 3HP9A 1JLQB 3NGZA 3RB4A 4FJ9A 4Y2CA 3DOLA 1G15A 4XPCA 4ZVGA 2C22A 3ALYA 3NAIA 1ZBUA 2YNIA 1SH2A 2F8SA 4DEZA 4GC7A 3G6VA 3NL0A 5T14A 1S1WA 5DLGA 3QO9B 1RT4B 2WONA 3QEPA 1X1PA 3AVFA 2O4GA 2E9ZA 3CM6A 1U49A 3KJVA 3HVTB 2C2RA 2XY5A 1N6QA 4NLWA 4M41A 5KFDA 3QNNA 4K4UA 2A1RA 1RILA 1U04A 4BWJA 4FZYA 4DSEA 3TQ1A 1JXLA 4KHUA 5KFOA 2IA6A 4NCAA 1JKHA 1KLMA 3NBPA 2IC3A 3M8QA 4C8MA 3KTQA 1RT6B 2P5GA 3CDEA 3TVKA 1O1WA 1WNEA 4H8KA 1LWEA 4CEDA 3KMSA 3HP6A 3LZJA 1WAJA 3ZT3A 3HO1A 3E01B 1REVB 3MECB 4CFDA 2FVCA 1QSLA 2OH2A 1L5UA 4DTRA 3NF6A 3DI6A 5FRNA 4KB7A 3P5JA 4DS4A 1TKXB 1QSSA 4RNHA 3RAQA 4EYHB 4J9MA 1S9GA 4O44A 2O4IA 1FKOB 2FC0A 3V9XA 1JXBA 2HWHA 3TAQA 3T5LA 1VSEA 4DG1A 3QIDA 3EPIA 4DFMA 5HBMB 4HUFA 2IGIA 2PY5A 3HK2A 1BISA 3OYCA 5C25A 4ZTFA 1IKYB 1J5OB 5F8NA 4OLBA 3N6LA 2PYJA 3IG1A 4CIFA 2R8KA 5KT6A 3SI8A 4KTQA 4K8XA 4FJHA 4CHYA 2R8HA 4CGDA 3MEGB 1BQMA 5KG4A 3LP1A 4F2RA 3PHEA 1KFSA 2G8UA 4B9MA 5F9LA 4QW8A 3I5CA 5J2PB 3DLEB 5KFSA 4IR9A 3FQLA 2RDJA 3AVAA 2RN2A 2XO7A 3RRGA 4E7IA 1N4LA 2IM2A 4M3ZA 1S0MA 1TL1B 1X9SA 4R8UA 2B5JB 4RW7A 3H5UA 3BSAA 3VQ7A 4DTXA 1BIZA 4CFAA 3PW2A 4DSFA 3Q8SB 2DPJA 1ASWA 4M3TA 3DRPA 2QV6A 4DL7A 3UPFA 3AVIA 5KT7A 2HMIB 1SL0A 3DMJB 3IS9A 4CJTA 4DMNA 3UDLA 3TABA 4OKJA 4CJEA 4FJIA 4E7LA 4IR1A 3VQQA 1S6QA 2BE2A 1HNVB 3KK3B 3KKSA 3AVCA 3QZ8A 1JLFA 2ILYA 4E1MA 4CF0A 4HUEA 1RT7B 4Z0UA 3GV8B 3IRXA 4OGEA 1JL2A 2AX1A 3L2WA 5F8MA 1HPZB 2G8VA 4KKOA 1U45A 5D3GB 1C0UA 3CJ3A 3CFRA 3LDSA 3KLFA 3K5LA 3DOKA 1L3TA 4IG3A 1HQUA 4DTUA 4ECQA 4FLZA 4ZHRB 1NK4A 3AVLA 3ZSQA 4JS4A 3BSCA 1HQEB 4FS1A 1SH3A 4Z4CA 5DQIA 3HPGA 4E7JA 3L2RA 3VQ9A 3NCIA 2QKKA 1SUQB 4LSNB 3JYTA 1L3VA 2UVVA 2B6AA 3PW7A 1VK0A 3ZT1A 4KSEB 5DG7A 4MFBA 3RB3A 1BL3A 4AHTA 1Q9YA 1GX6A 1JLCB 1VRTA 3V81B 3HHKA 1S9EB 4KFBA 2G8HA 2IS3A 3HSTB 1EETA 3H2LA 4Z4GA 1RT3A 3D0PA 5F9NA 1IO2A 5KFKA 2R8JA 2FVSA 4NLTA 4ECXA 3VQ6A 2DPIA 4KHMA 3BQ1A 3P83D 3UR0A 3LAMA 1SV5A 2YNFA 2UUWA 3FRZA 3G10A 4EEYA 2UVUA 3ZT2A 3PUFA 4O3OA 5CZ2A 1S1XA 3H5SA 1W25A 1T05A 5KFIA 3VQCA 1RTIB 1NHVA 3QZ7A 3SQ4A 4LSLB 5CYQA 3V6KA 4YP3A 4Y3CA 2C2DA 1JLBA 4ECSA 1IKXB 3OYJA 2UVRA 4WZQA 2I5JA 1J5OA 3CDUA 4IG0B 4RNFA 3V6HA 4FLTA 2P5OA 1KTQA 2Z1IA 4DQQA 4M42A 4F4WA 1TV6A 5KFUA 4CEZA 2XY6A 4J2AA 4FK4A 1K1QA 1NKBA 3FFIB 3DM2A 1DTTA 3CM5A 1SL2A 3C94A 3NF7A 4M94A 4C8NA 1S1VA 4J9LA 4AHSA 3OYAA 3SV3A 4CEEA 4DFPA 1JXEA 3I0SA 3DRRA 1A5XA 3LP3A 4JV0A 4TY8B 3RB0A 2XY8A 1LWFB 2XCAA 3WNGA 5KFRA 4TQSA 2IMWP 1LW2A 3AVKA 1UWBA 4TYAA 4Y2AA 2XI2A 1NJWA 1GOAA 3V6JA 4FK2A 1C0TB 4CJ5A 3BGRB 2AGPA 4DQIA 4ZTJA 3V9UA 4I2QA 4CK3A 4Y1DA 2RKIB 1DLOA 4MIAA 4DL5A 3KLVA 3TWHA 2W9AA 4CJQA 3TAFA 3QIPB 3ZSXA 2WB4A 2OPQB 3WNEA 2ATQA 3DYAB 3KLGA 1KHWA 3I0RA 4NYZA 2JEFA 1WSIA 4IBNA 4RW9B 2Z1HA 3EZ5A 2KTQA 2W9BA 1FK9A 4CGIA 3LAKA 5HLFA 2VG6B 3PX4A 1C1CB 2BQ3A 2D41A 4H4OB 4WE1B 2JC1A 5KFZA 1T03A 2RDIA 4Z4IA 1RT2A 4KO0B 4B9UA 3PW5A 1RNHA 1D8YA 4ED3A 1IG9A 3EPGA 3PZPA 5KGXA 5DGAA 3NF9A 1WLJA 4ELTA 3IGVA 3V4IB 3OSPA 2BR0A 3G6YA 4I7FA 4RNNA 2RPIA 2BRKA 2FLPA 5J2QA 2E9RX 4HUGA 1RDAA 4J2BA 1JLAB 2GV9A 3KK1B 5J2MA 3SQ2A 4J2EA 4FW2A 2YHAA 1C1AA 2W8LA 2J6SA 4F3OA 3QINA 3F9KA 1YVFA 3Q8RB 3OYKA 2JEIA 1UA1A 1CZBA 2HHUA 4MK9A 1R0AA 5F8HA 3OYBA 4PWDA 4ZPCA 3L2VA 2OYQA 1ZTTA 2HNYA 4Q0BB 4Y1CA 2YNHB 3U6FA 3SQ1A 1NOZA 4IFYB 3SI6A 2VA3A 3ZSWA 1TVRA 1JLEA 1X9WA 3DLBA 3ZSOA 4FJKA 4F50A 1HYVA 4GW6A 4B9SA 4DL3A 1S49A 4UQGA 1QE1B 3CQ8A 4RW8B 2IJNA 3D5MA 2FBYA 3TARA 4NRUA 2HHXA 1ZTWA 5L9XA 2XRIA 1Y97A 1QQCA 4CE9A 3NH2A 4PQUB 3GQCA 2R2UA 5KG0A 4ED7A 4IDKA 5KFNA 3KK2A 3L2QA 3RMAA 4M3UA 5I3UA 4BACA 4C8OA 1S0NA 5DMRA 2HHQA 2RF2B 1WN7A 2ITGA 4ICLA 1BHLA 4YR2A 1D9DA 3H08A 3OYHA 4GVMA 3OL6A 1L3SA 1JX4A 3ZSVA 4ZP7A 4IQXA 3AO2A 4H54A 4ZVFA 1I3AA 4CEQA 3PR5B 3BSOA 4FJLA 4J9RA 2ETJA 5KG7A 3OVNA 2DFFA 3DLGB 2X6NA 4ZP9A 5C42B 3SQ0A 5EWFA 3QEIA 5HP1B 4TY9A 3GIKA 3MEEB 4CF8A 1RYSA 1S6PB 3AVJA 3B6OA 1RTDB 4KE5A 3PR4A 5EWGA 3DRSB 5I42B 2KQ2A 4O3NA 3OS1A 1X9MA 3UQSA 1LWCA 3TANA 4O55A 4NRTA 1HYZA 4CFCA 4HCCA 4TXSA 1BGXT 3SCXA 1VSJA 4MK7A 4DSKA 1QHTA 1XR6A 3AA4A 1CXQA 4CERA 1NHUA 3G86A 3QIOA 1RA6A 3NGDA 4PUOB 3NF8A 3QIPA 4B9NA 3TAGA 4RW4B 1NJZA 1RDBA 1ZBHA 4R5PB 3M8SA 2KZZA 2D3UA 3ICLA 1EKEA 2IDOA 3LP2A 4EZ6A 1KFDA 2DY4A 1XI1A 4QW9A 2E4LA 1DTQA 2JGUA 1VSKA 4CJVA 4DU4A 1TP7A 2W9CB 4HYKA 3CIZA 4ED2A 2FVRA 2BANB 3QLHB 1VRUA 4Z4HA 5KFCA 1MMLA 3MEDB 2FLLA 4FW1A 2ZE2B 3KLIB 4CK2A 2C2EA 2V4RA 1RDDA 4FYDA 1S1UA 1RDCA 5HRSA 3OLAA 2IM0A 3JSMB 4KHQA 2IOCA 1UAXA 3SNNA 2FBVA 1IH7A 3T5KA 5KFBA 1QAIA 1EP4B 4IRCA 2UVWA 4N47A 2YKMB 2OZMA 4RU9A 3QGHA 5J2NB 3H4DA 1S48A 5KT5A 4CGGA 4CJWA 3BQ0A 2AX0A 4DWIA 4ECTA 4CJLA 3AO1A 2WTFA 4KV8A 5KFGA 4DQRA 4OPKA 4HHTA 3OYDA 4NCGA 3CFPA 4TYBA 1T94A 2J6UA 3U3YA 3HT3A 3MR2A 3A2FA 4G1QB 1QUVA 3VQ4A 5KFPA 5KFEA 2OZSA 4DF8A 4FZXC 2JEGA 1NNDA 2I1RA 1WNSA 2HVHA 3C6TB 4DQPA 1RTJA 4K4YA 3TAPA 3SUPA 1ZBIA 3H5YA 5K14A 4PQUA 3V1QA 5CYMA 4IFVA 3I5AA 1SH0A 1RBTA 2HAIA 5SZTA 2HNDA 2XGPA 1RBVA 3LWMA 4CJSA 4K4WA 2IJFA 2D0AA 4OLAA 2HNZA 2FJXA 2D7SA 1MU2B 4ECVA 4WXWA 2OPSB 3NH0A 4QOZB 4RW6B 4FJJA 3DLKA 1RT5B 3FQKA 1KVAA 5DG9A 1IM4A 2OPRB 2EC0A 4CGHA 4EYIB 3SUOA 3M9NB 2R2TA 4O4GB 1ZYQA 2B43A 3KLEA 1NJXA 4B3OA 2IAJA 2VG5B 1NKEA 4DTMA 1Q9XA 3UIQA 4H4MA 1FKPB 1NK8A 3CG7A 4BE1A 3I8DA 1HYSA 3ITHA 4BE0A 3V6DB 3HM9A 4Q43A 1J53A 1S5JA 2VWKA 4KAIA 4CJKA 5C24B 4B8CA 5HP1A 1RBSA 3C6UB 2AQ4A 4ZP8A 4QWCA 1N48A 4K4XA 4Q45A 1NK7A 4CESA 1JLQA 3B6PA 3SZ2A 3KLHB 4ZVEA 2LSNA 3NDKA 1J54A 2ALZA 1TL3B 4ID5B 5FDLB 1K6YA 2F96A 1EXQA 3SYZA 4QCLA 1NK5A 3RMDA 3VQAA 5F8LA 5KFHA 3NFAA 5EWEA 1U47A 3MFIA 5C5JA 3IN5A 1JLGB 4BDZA 2R2SA 3QO9A 1RT4A 3MF5A 3QEWA 2XC9A 4KBIA 3HVTA 2VG7B 3NGYA 2QK9A 1SKSA 4J2DA 4QWDA 1RT1B 3TI0A 4I9QA 5KTQA 1KRPA 3QESA 1RBRA 3OL7A 1S1TB 3HYFA 1LW0B 1HRHA 3SV4A 2XWYA 4YMEA 1KLNA 3SPYA 2R7YA 3MR3A 1BI4B 1W9HA 2XI3A 3H98A 1RT6A 1A5VA 3M9MB 2WOMB 3OS0A 1TKTB 3MXMA 4FLXA 4DU1A 1D5AA 4HKQA 4LQ9A 4X2BA 3E01A 1REVA 3MECA 2HWIA 5HROB 4KHWA 1LV5A 4KREA 4ECRA 3AA5X 2YHBA 3TAEA 1IKWB 1TKXA 2ZQBA 4FM2A 4ELVA 3AO3A 4AH9A 1RCHA 4DTPA 1RAJA 3NAHA 4ED6A 1FKOA 1VSDA 1RTHB 1YVUA 4RNMA 1ITGA 2VWJA 4J9PA 2Z1GA 3NGIA 1CZ9A 5HBMA 1UOCA 2E6MA 3HL8A 4B9TA 3KHLA 4LY7A 2JEJA 4TQRA 1IKYA 4CEBA 3BQ2A 2O5DA 1ZBLA 3CJ2A 4FM0A 4J9KA 5KT3A 1BCOA 3TR8A 3LP0B 4E0DA 3MEGA 2FVPA 4Q5VA 4IRKA 3NH1A 4AHUA 3MXIA 3VN5A 3T19A 3KD5E 1BQNB 4JV1A 3HJFA 5J2PA 2KZMA 3T5HA 4ED8A 3RB6A 3DLEA 1HMVB 3M8PB 2HVIA 4LQ3A 1B92A 5KG5A 3C95A 3NAEA 4M3WA 4FJNA 4IRDA 1TL1A 4ZPBA 4MKBA 1N5YB 3I5BA 2J6TA 2B5JA 4DL4A 4URQU 5DGBA 4ECZA 1RA7A 3QGGA 1IKVB 3QGIA 3MAQA 1C1BB 4BE2A 3AV9A 5KI6A 3PY8A 3ZT4A 5KFVA 3K5NA 2BQUA 4FLWA 4CEAA 4NLVA 2HMIA 1YTUA 3DMJA 2V0NA 2E9TA 3PX6A 1XHXA 3VQBA 2YKNB 5T7BA 4C8KA 3G6XA 3TAMB 5CZ1A 3KMQA 1Z4UA 4FJMA 3DDKA 4I2PB 1HNIB 2OPPB 4EO8A 3PV8A 4W5OA 1HNVA 3KK3A 1U48A 4HCBA 4DSLA 3DOLB 4YQWA 1VSIA 1RT7A 3HKWA 3OS2A 1XC9A 4Z4EA 4FLUA 1HPZA 2YNIB 2X6SA 5KT2A 4OL8A 4FBUA 5D3GA 2ILZA 1S1WB 4FS2A 2G8IA 4K4SA 2AU0A 2OA8A 2WONB 4C8LA 2HHWA 3KJVB 4CEFA 4YNQA 4ZHRA 1NK6A 4DTNA 1N6QB 1VSHA 4JV2A 3PW0A 3U3GA 1N56A 2FBXA 1HQEA 3P1GA 3QEXA 3OYMA 5SWMA 3CJ0A 4FCYA 3KOAA 1JKHB 1KLMB 3O3GA 3M8QB 1BCMA 1T3NA 1K1SA 4FXDA 1SUQA 3AA2A 1LWEB 4LSNA 3O3FA 3ULDA 5F8GA 2VG7A 3D28A 4BDYA 4K8ZA 2XHBA 2PYLA 3AVMA 3S3NA 3DI6B 1JLCA 2D5RA 3V81A 4ECUA 5CY4A 4K50A 1S9EA 3PJXA 1S9GB 4O44B 2Q3SA 1JIHA 4CF2A 4DG1B 4OKEA 5JS2A 3SUQA 4EZ9A 4YR3A 3HVWA 2HW3A 3RR7A 5DK5A 4DFJA 4EP4A 5C25B 2P51A 3F73A 2AGQA 3OL9A 1CXUA 4FJ5A 3IG1B 4QWBA 4DU3A 1I39A 4JRQA 1I6JA 3LP1B 2IBKA 1RTIA 2BQRA 4LSLA 3NMAA 3RBEA 4CJFA 4F4YA 2BRLA 1IKXA 2ASDA 4IG0A 2E6LA 4IH7A 3PVXA 2YNGB 2EHGA 1C0MA 4XPEA 4ED0A 4JS5A 4RW7B 5FROA 4K4ZA 3FFIA 3CJ4A 2WK4A 3AVHA 5JS1A 3CFOA 3CWJA 4Y34A 3LPTA 2GUIA 2PZSA 3DRPB 4IH5A 5KG2A 3AO4A 4I9LA 4LD0A 1TAUA 3AVBA 5KFJA 3IS9B 2IM1A 5JXSA 4O4RA 2VA2A 4BWMA 4OGCA 1A5WA 1U4BA 4TY8A 4AHCA 4DSIA 4KHYA 1LWFA 5J1EB 1S6QB 1J9AA 2IM3A 4QAGA 4F8RA 4NLQA 1XR7A 3VQDA 4N76A 1JLFB 4MH8A 3IGNA 2JC0A 1F21A 1C0TA 1YT3A 1XWLA 3IRXB 3BGRA 2YKNA 4KKOB 3RMCA 1TK5A 1C6VA 4FJGA 2W7PA 3BREA 3OY9A 2RKIA 4IH6A 1C0UB 1ZBFA 2V9WA 4FLVA 3KLFB 1T8EA 3DOKB 4IG3B 1HQUB 4MIBA 3O3HA 4W5NA 4W5RA 2OPQA 3DYAA 3H5XA 2CKWA 3WNHA 3CYMA 3OYEA 4J9NA 3THVA 4RG8A 4WYWA 2X78A 4RW9A 2X74A 1TK0A 4B08A 2FJVA 3OYGA 4M3YA 3KHHA 4OVLA 3OHAA 4MQ3A 4CGFA 4CCHA 2VG6A 4Q8EA 3ZSRA 1C1CA 2XY7A 4H4OA 3OYNA 4WE1A 4OJRA 2Y1IA 4M95A 3LWLA 4KO0A 4PA1A 3JYTB 3O4QA 2B6AB 3IAYA 5KFQA 3G0ZA 4J9SA 4MFBB 4K4TA 3K57A 3MTKA 1VRTB 4KTWA 4O5BA 4NLGA 2JLEA 4KFBB 3V4IA 2ASJA 1GOCA 1EETB 1YTAA 1RT3B 2EX3A 2AGOA 3SUNA 1NJYA 4RNOA 4N5SA 1GOBA 4L8RB 4DL6A 3BSNA 3V9SA 2KFNA 2W42A 1JLAA 3KK1A 1SL1A 4TSXA 4NLUA 1SV5B 4URSA 3NKYA 4E89A 2YNFB 3DLRA 3QNOA 4RZRA 3OYLA 2QE5A 2BGGA 4CHNA 1S1XB 2P1JA 4KHRA 1XR5A 3OYFA 4O0IA 1SKWA 1T05B 1KHVA 4PY5A 4Q0BA 2YNHA 5CYQB 4IFYA 4MKAA 4FZZA 1JLBB 2HHVA 1S10A 2I5JB 2WCXA 2XGQA 3QEVA 1RDRA 4GC6A 4ZVHA 3KNAA 2ZD1B 1Z26A 1QE1A 1TV6B 3LPUA 4RW8A 1RYRA 2G8WA 3ISNC 3KKRA 4ZPDA 3DM2B 1KCFA 1DTTB 2DFHA 5F8IA 4J9QA 2R8GA 3RWUA 4IKFA 1S1VB 1JL1A 4CFBA 4FJ8A 3CVKA 4U7CA 4MK8A 2YNGA 3I0SB 3DRRB 2RF2A 4KI4A 3LANA 3N6MA 4KHSA 1NK0A 3GIJA 5HRPA 4URGA 3GYNA 1LW2B 4TLRA 1UWBB 4FM1A 3VA0A 5HRNA 3E51A 4WZMA 4CJUA 4FJ7A 2R2RA 4JLHA 3GILA 4F4KA 5FRMA 3L2UA 1S4FA 1KVCA 1TQLA 3NHGA 1EX4A 2G8FA 3ZSZA 3KHGA 5KFXA 4CJ3A 2V4QA 4I2QB 3DLGA 4EBDA 4NLPA 1DLOB 5C42A 3BR9A 3PO5A 5KRSA 5J1EA 5L1JA 2D0CA 4Z4FA 3M9OB 3MEEA 3OL8A 3GIIA 3K5OA 1S6PA 1RTDA 3KLGB 3DRSA 5I42A 3I0RB 4NLRA 4FVMA 1WSJA 5F8JA 1B9DA 4NYNA 3S3MA 2B4JA 1D0EA 2W9BB 1FK9B 5HLFB 2GIQA 1T03B 4YFUA 4ECWA 5JUMA 1RT2B 3S9HA 5KT4A 4QPXA 4PUOA 3EZUA 1L3UA 3T3FA 4RW4A 3L3UA 3M8RA 3ZT0A 4R5PA 1B9FA 1VSLA 1HARA 1KVBA 1WSHA 4EP5A 3BJYA 5KFYA 4NLXA 3VQEA 4DF4A 4ZP6A 1WAFA 4FK0A 2W9CA 4I7FB 1U09A 4ID1A 4DTJA 2BANA 3QLHA 5J2QB 3ISND 3HXMA 2F8TA 3MEDA 4F3TA 5J2MB 1UA0A 1C2PA 4RUCA 3OHBA 3HPHA 2D0BA 4XIUA 4J9OA 2ZE2A 4IKAA 3KLIA 4KI6A 3AA3A 1TK8A 3MR5A 4AHVA 1R0AB 2HHTA 4PWDB 4CIGA 3JSMA 2ATLA 4NZ0A 1NOYA 2HNYB 1ASVA 1CLQA 4N56A 4O3SA 1TKZB 3H40A 3SFGA 4KRFA 4FJXA 4G3IA 1EP4A 3GV5B 1TVRB 3MR6A 1JLEB 4E19A 2YKMA 5KFWA 4ECYA 5J2NA 1S9FA 4KAZA 4E3SA 4F2SA 3RTVA 5DQHA 3OYIA 4O3PA 4CEOA 4LH5A 1TKDA 1S97A 4O3RA 3OSNA 3KHRA 3K5MA 4EBCA 4M3XA 4NYFA 3V9WA 1CSJA 3GV7B 1NK9A 4M3RA 4G1QA 4IDKB 4WFYA 3VA3A 1T7PA 2ZD1A 2C28A 1VSMA 3KK2B 3K2PA 5KFAA 4CJPA 5I3UB 4XO0A 2W8KA 3T1AA 3C6TA 5L1IA 1QS4A 4ICLB 3T5JA 4CGJA 5KFMA
chains in the Genus database with same CATH superfamily
4LFCJ 1TYQA 4X4UA 3S3OA 4KHNA 3PIOL 4DS5A 2DNZA 3NNCA 3ZNJ1 2XM3A 4W5TA 1REGX 3Q8PB 3HVRA 4Y0WA 5KG3A 3RAXA 2P5VA 3ZTQA 4BVOA 1Q79A 2OO4A 4PG6A 4ES1A 5B0EA 4HVJA 3GOIA 1S76D 1VMBA 4OHVA 5B09A 1BU6O 3KDNA 4AM6A 2C2MB 3AVGA 2DTJA 3QT6A 1LWCB 1ASUA 4WU3A 2GIRA 2HHSA 3RBDA 4FPRA 5B0DA 1YX2A 2MSTA 5E3QA 2DR5A 3C6UA 3IAM9 2MHNA 3CC2S 1HKGA 1A7GE 5KRTA 1NB7A 3LP2B 4JI8J 4QR1A 1TL3A 2ZJQQ 3DLLL 1DTQB 4IO9Q 3CJ5A 4OHZA 4JI7J 3QQCD 1S0OA 4CLUA 4A48A 4TN2A 1VQYA 1GLEG 1VRUB 5EU7A 3ISZA 3D45A 5DLFA 3Q2SC 3T9ZA 3K0SA 4DLGA 1GLAG 3OV7A 4E2FB 5HRRA 3L95X 1WSGA 4R25A 3TA2A 3MUTP 2GJFA 2EBGA 4ILLA 5BR9A 4NLDA 4DCHA 2A3ZA 1QTMA 1HWIA 4DPWA 1D9FA 4ELUA 4NO7A 3NG8A 3EY1A 2O66A 2ACYA 2CJBA 4CT8A 2WOMA 2AJFE 1OS5A 1HNZJ 4Y2MA 4DQ8A 2ZKUA 3CCQS 3UKRB 3UN3A 1LAVA 3QATA 3VEYA 2GBZA 1SKRA 3FRYA 3RBZA 4UUWA 1WKKA 2PN6A 4YR0A 2GAGC 3D68A 3W63A 4IOBA 4KH1B 2Y0BB 4E7KA 1RTHA 2J0QD 2YWEA 1BQMB 2HSEB 4BG9A 4RTFD 2QKBA 3MMCA 4MLHA 5HL7L 3H59A 3M2RA 4LT6A 3PIPQ 4P2MA 4BY9C 3MM6A 3E2EA 3QETA 1FNOA 5CHIA 2F8EX 2AT1B 4F04B 2OEJA 3ILOA 4F4ZA 4DB3A 2HS3A 4WXOA 2BDPA 5T7LB 2MXYA 4Q44A 2B8QA 4DL2A 4OIXA 2UU9F 1HMVA 2DYAA 4QIFA 1Z2LA 2MDAA 4CNYA 5F3TA 5LMNF 1QSYA 3QYYA 2F4VF 1FXXA 2D3ZA 4YN3B 3CD0A 2AJQA 1FFSB 1N5YA 1YUWA 3DLKB 4AUKA 2YHYA 4F4XA 2AD9A 3THXB 1HPMA 3MM9A 2M2BA 3P4IA 4B1VA 1LQ9A 4IWVA 2IAJB 2XNQA 1W0HA 1R8AA 1OSCA 5AXKA 4W92B 3W5ZA 1HYSB 4QQBA 2AWZA 3B4MA 3J7Z5 2RRAA 4CHZA 3W9IA 4I2PA 4CW7B 2RQCA 1MWZA 2W6KA 5LMUK 2P9KB 5DQGA 2VC0A 1JLQB 1P8ZA 1XERA 1ZM2A 1G15A 2P9LB 1VQKS 4ZVGA 5IQQA 4WFBL 2F8SA 1XMOK 1S1WA 1RUSA 4GKKJ 3I33A 1UVKA 1X1PA 3AVFA 2ZDOA 2O4GA 3OBIA 1CULA 2E9ZA 2CZVC 3KJVA 3V2UC 2C2RA 4DUYJ 3R5GA 2RRBA 2ZM6J 3MM5B 4OJ3A 1WUUA 1XJWB 2C1EB 1BOTO 2XSJB 3PYFA 3G25A 3HFZB 5FPEA 5KFOA 4NCAA 1JKHA 2IHR1 2AJ1A 4DR1J 3IFEA 4C8MA 3KTQA 1HBNB 3OXLA 3CDEA 1WNEA 3LZJA 1VQ7N 4LF9J 3T1HF 3MECB 1NAQA 2OH2A 1OY8A 1DY3A 1GLFO 1J27A 3IUCA 1HBMA 2UUBJ 3AQOA 5C0YA 1S9GA 3ENHA 4O44A 2O4IA 1T95A 3H90A 1JXBA 2HWHA 2HF3A 3T5LA 2HMPA 1U6BA 4EUVA 5FPNA 5M1FA 5C2GA 1CJVA 2VPWB 3R8EA 2BM0A 2GHWA 4OLBA 5BXIA 1RHKB 1WOQA 3ZETA 1NDPA 3VAKA 3MEGB 4PL7A 5KG4A 4JK8A 4W98A 4EFHA 3LOUA 2FPHX 5KFSA 3B6BA 2WW8A 4ZN3A 1QVFM 3ILLA 1DJ0A 5AE2A 4M3ZA 2J9EA 1TL1B 2XS2A 4R8UA 4DR6J 4JNEA 2JFDA 3W2WA 5H1SV 3H5UA 2N7CA 4JP8A 2CPYA 4HLBA 2B0GA 2L3MA 2EEYA 2W4DA 1Q7YO 3VZIA 2O67A 2DPJA 1KC8T 2RU9A 4M5NA 3UPFA 4OPHA 5EY4A 1GXTA 5KT7A 1Q7LB 2HMIB 3CJ8A 4FPBA 2QWQA 5A0YA 4PKIA 2Z2LA 2XTJP 1XUPO 2AEJA 1S6QA 2P9PB 4CZKA 1BD6A 3GWCA 3NWRA 3WX8A 2CVIA 4LFBJ 2NUUG 2OCEA 4OGEA 1NU0A 1EKRA 3QAUA 3W3DA 2AX1A 4LRAA 5TKYA 2A0FB 3WX4A 4CH7A 4LIRA 5MAOA 1BE4A 4QS7A 3DOKA 2RS2A 3CCMN 4K43A 4JYAF 5IC4B 4DTUA 2XBPA 2RQKA 4FLZA 3H2VE 5D4PA 4DBQA 1X4AA 4P75A 3M05A 5AQQA 2O8FB 5M2PA 4X65J 1SQKA 1U1RA 4C8ZA 4N77A 4Z4CA 2V8GA 3SBGA 4KR0B 5D8HB 3M3ZA 2WFBA 4E7JA 1VISA 1G3OA 5B08A 5K8OA 3VQ9A 3NCIA 3O5TB 1YJNN 1HL6A 1L3VA 3OUYB 2B6AA 5FPMA 4CRJA 2C2NA 3RB3A 2WSEC 3GMGA 1JLCB 4NYOA 1DZ5A 1IR0A 4DR7K 2G8HA 4RU2A 1RT3A 2W01A 5F9NA 1IO2A 3VESA 4NLTA 2GHVC 5D0HA 3SCJE 3J7AP 3BUZB 2CADA 2NXJA 4KHMA 3BQ1A 2W24A 5HMYA 2YNFA 5L46A 2B3TB 2I9SA 2UVUA 1H1VA 2YHWA 5L39A 2VKRA 1S59A 1VC6A 3H5SA 2E1CA 1HLUA 5KFIA 1NHVA 4LF8K 3V6KA 3FEXB 1V3ZA 2K7KA 3EL2A 3F9MA 1JLBA 1U2FA 1IKXB 4Z7YA 1J5OA 1ZBTA 3SEOA 4OYMA 4FLTA 2UV8G 2DO0A 4M42A 3UI3A 1NB2A 2Q3PA 2ZH9A 3FFIB 1R7IA 4DDFA 2B4UA 2YKPA 4YORA 2IVPA 3IWLA 1SL2A 5HK4A 4C48A 3PSIA 4C8NA 2EI5A 2Z57B 2MGZA 4J9LA 3R5JB 2Y3YA 3SV3A 4BR4A 4CEEA 1UFKA 5EVZA 2VH7A 1D9AA 4LF7F 4H0XB 1A5XA 3SSRA 3WNGA 5KFRA 5BR8K 5EOYA 2XMAA 4R0JA 1UWBA 5HJXA 4TYAA 2Q43A 4Y2AA 2EKNA 4FK2A 3BGRB 2W6LA 2XSFA 4ZTJA 4CZHA 1CJKB 5C7PA 3EVOA 1VQ8S 2VU5A 3O80A 2RKIB 4MIAA 5CYJA 2RD5C 5CHCB 2SXLA 4Q2LA 3TAFA 4O0NA 3QIPB 2DEJA 4U95A 3WNEA 2HLUA 3TA0A 1WACA 2H65B 4M5IA 4NYZA 2E29A 5AQIA 4DCJB 2FQQB 3QBCA 4IBNA 2KTQA 1CQMA 4FNHA 3MM7A 1KOHA 2O01C 4UF4A 1YJRA 4WE1B 1YBUA 4E8UA 4KO0B 1UJ6A 3TR5A 4J7CA 2QEXN 4B9UA 2DRBA 1RNHA 1D8YA 4ED3A 4XH4A 3CCVS 4ZJLA 5DGAA 2HZVA 3HSDA 1TZ0A 1UAWA 4ELTA 3BEXA 4IDHA 4CO2A 3B54A 3I32A 2ZH3A 3TUJC 5HATA 4IO8A 2RPIA 1HBUA 4JK9A 4BQZA 3EM1A 5J2QA 1RDAA 1S77D 4GVBA 5J2MA 3SQ2A 3DWLA 3GU0A 1C1AA 1AZSA 2J6SA 1SJ4P 4UTGA 1SQFA 3P96A 5LSOA 1CZBA 4L75A 1UFLA 1R0AA 5F8HA 4KC5A 5AQLA 3VVTA 3QMQA 2V52B 4AT1B 3SIPB 3I56S 1J2VA 3SQ1A 3M6GA 4IFYB 1YRUA 1XMQK 3KJNB 3HHLB 4UT4A 1IVZA 1VBKA 1JLEA 2DY1A 1P9YA 1X9WA 3ZSOA 3VAMA 1HYVA 1G99A 1T0TV 1WELA 3CQ8A 4RW8B 3QT8A 2FBYA 4C0HA 3MD3A 3AD8C 1Y0HA 2DNPA 1Q8LA 3H2UB 4PWUA 1PSDA 4CE9A 2M4MA 3NH2A 3MI7X 4ILRA 3W1YC 1IR2A 4IDKA 3A3OB 1X9JA 4FWSA 4K8RA 2PFUA 4DR2F 5I3UA 2FHKA 1GEHA 4B3MJ 5ETQA 4A2AA 3JSRA 4KGMA 5BRHA 4NB4A 4ZP7A 4IQXA 1S7IA 4I6YA 3JTOA 2GZOA 4B3RJ 4Y65A 3J81U 2L9WA 2BABA 3O1BA 1B70B 1KR4A 4NLBA 5HI7A 2Y8WA 3OVNA 1VFJA 4ZP9A 3SQ0A 5EWFA 3D3CJ 3MEEB 1RYSA 3GFXA 3F2KA 3B6OA 2APOA 3HZ6A 1VQLN 5IM0B 1X9MA 1LWCA 2MPUA 1HYZA 3VHQA 1UVNA 4HCCA 1WF0A 4TXSA 3FSXA 1PYTA 2HVDA 1HI8A 4GKJJ 3QIOA 3NF8A 3H42A 4B9NA 1ZBHA 3M8SA 1VRQC 4WFAL 2D3UA 2QN6B 2IDOA 3LP2A 4EZ6A 1KFDA 1XI1A 1DTQA 1IJFB 2J5AA 1VSKA 4DUZK 2GX9A 4DU4A 1TP7A 1OH5A 3CIZA 2V63A 3KVGA 1VRUA 1RB0A 3VF6A 5KFCA 2YHXA 3AD9C 3J81O 5DM7L 2ZVSA 1I1GA 2FLLA 5IT0A 1FX4A 4CZEA 5LMUF 2K06A 4NXMJ 4Y2IA 4FYDA 1RDDA 3H7HB 2KB2A 2ZF5O 2DY9A 3OLAA 2ASMA 4K5RA 4ITSA 1UAXA 4M5JA 3U9ZA 3GZ7A 2FBVA 2V7YA 3T5KA 5HQLA 4IRCA 3ATVA 3UKRA 2AJ4A 2OZMA 3QGHA 3IFRA 4FKXA 1S48A 2KXFA 3HLUA 2QWOA 4CJWA 3QJJA 4L3NA 2MKCA 2AX0A 4JKCA 4ECTA 1TL5A 4USKA 4DQRA 4OPKA 3GCXP 3QAEA 1W7WA 2CJ9A 2GMHA 4I6AA 4ID8A 3U3YA 1QUPA 3UE5A 5B8HA 4DPYA 1RAOA 5IZHA 1Q5YA 4DF8A 4DX6A 4DPTA 4JI3K 2K8GA 4ZCIA 2HVHA 1X4CA 4OYWA 1WG4A 1ZBIA 3H5YA 1SKUB 4PQUA 2GJ2A 2LQ8A 1WI6A 3I5AA 1SH0A 5M1NA 2XGPA 4DV3F 3IM8A 4K4WA 4OLAA 2FJXA 5B0GA 3UKUB 1MU2B 2QSFA 2OPSB 4QIVA 4QOZB 1VQON 2P2CB 1O0PA 1ZPWX 2Y1RI 4FJJA 1SJQA 3DLKA 2B9YA 3H0PA 5DJBA 3FZ2A 1RAAB 3AGKA 1RFQA 3PNIA 3THXA 1N33K 3U1NA 3THTA 3SUOA 1ZYQA 2FIUA 1RCXB 2IAJA 4DTMA 3UIQA 3CG7A 1T9UA 3I8BA 1HYSA 1QAYA 2E2OA 4BE0A 3V6DB 3E9OA 4Q43A 3FZHA 3OXFA 3Q0AA 1ZAVA 2LYVA 5HP1A 2B9EA 5HN0A 2P9KA 1RWNB 1N48A 1NK7A 3ZX0A 1JLQA 3NDKA 1FF2A 5ETNA 3MWPA 1EXQA 3SYZA 4LF4K 2P9LA 1E6VB 1TTHB 2M70A 3VQAA 3CJQA 3GPAA 2XZDB 1RHJB 2KM8B 2N4DA 4PYDA 3IN5A 1JLGB 3SQGB 1X4BA 3DXBA 2F8MA 5M2UA 3QEWA 1VLYA 4HHJA 5J1NA 3A5MC 3A8KA 4ILGB 2YQ3A 2KH9A 3MM5A 5KTQA 1KRPA 2M7SA 4YB1P 1RBRA 3OL7A 1S1TB 2H54B 3HYFA 4F67A 4Y6IA 1K44A 2PSZA 2QMWA 3TPQA 1A5VA 2YWGA 3A3NB 2OLWA 3A13A 3OT9A 3MXMA 4FLXA 2ROGA 4DU1A 4HKQA 3JS6A 3MECA 2HWIA 1YJWN 4ECRA 3HSJA 4YOEA 1IKWB 1OQ6A 1RWUA 5GAHI 3AO3A 3NAHA 2CGKA 4OPAA 1VSDA 3CIMA 1F0XA 4RNMA 2EFGA 4RCHA 4PG4A 2GMJA 3NGIA 1RHQB 2PE8A 2DXEA 3O6QA 1S6OA 1URRA 4JB8B 4BC5A 4JKAA 1N54B 3BQ2A 4X4QA 1KNZA 3GG1A 4UY85 3TR8A 2MLYA 4UOFA 4CWBA 2X1BA 3C2PA 1Y00A 3D0HE 3MEGA 2P6SA 3NGKA 4OLOA 3NVKA 4TNOA 2KZMA 3HSZA 4ED8A 3RB6A 3CCLS 5KG5A 3C95A 4M3WA 1VDHA 1TL1A 1HWUA 4ZPBA 3OD2A 1N36F 1HD0A 4PKGA 3I5BA 2V2KA 2DVIA 3G6EN 4ECZA 5CAAA 5AQNA 1FHTA 2A1BA 4I4BA 2OEMA 4C11B 2QI2A 3P38A 1C1BB 4BE2A 5KI6A 3BP8A 4I56A 1SQGA 3ENAA 3PY8A 5BPMA 5KFVA 2FZCB 4LF8F 4FLWA 3IO1A 2HMIA 3PX6A 1XHXA 1BA0A 2YKNB 3PIOQ 5T7BA 4C8KA 4W90B 5HMWA 3OXGA 2GEMA 1OYDA 4A8KA 1QVGR 2NCKL 3JQKA 4ZLNA 2OPPB 4AXIA 5A8KB 4OYZA 2A41A 3PV8A 3K0JA 2P9PA 1U48A 3C7NB 2P9SB 2RS8A 5IV3A 1PILA 3HKWA 3OS2A 5LSLA 2D1CA 4Z4EA 4QU7A 3SAGA 4C23A 2J8SA 2V8HA 3T9NA 2YNIB 5GAGP 4IQMA 4RBUA 3KJQB 1Y5IB 2QLBB 2OA8A 3MEKA 1JJHA 1SJ1A 4YNQA 3VMFB 3NMRA 3CC7S 5HQ8A 2OD4A 3AXKA 4LF5J 2VPXB 3PW0A 2O8FA 1NH7A 5E0OA 1OKJA 5B7WA 5BR8F 4JI1F 3P1GA 1NMNA 1G6BA 3CJ0A 1P1LA 2KHOA 3OR1B 3MX2A 1KLMB 3O3GA 1BCMA 1T3NA 2E7VA 5KAKA 3DLLQ 1FESA 3CB4A 4IJAA 5ADXA 3OUYA 1QD1A 2QLJB 2PYLA 1SI9A 5CQGA 1JLCA 4ECUA 4MDBA 4J9VA 1HI1A 5CY4A 4ZITA 3QICA 4ZPWR 1T6CA 4OKEA 2GV1A 1WOPA 3KK7A 2L9NA 5CE3A 4FL9A 1SAZA 4EP4A 5ETKA 2CQHA 1X5SA 2VQFJ 3VR1A 5EXWA 3PLAA 1S99A 1GTEA 1F5BA 1BO5O 4DU3A 1I39A 4MO5A 1P8GA 3LO3A 4X64K 3LP1B 3S1TA 2BQRA 2HFVA 2FHOB 4H5NA 2LA4A 2JVRA 4PG7A 1IKXA 3LPYA 2ZHAA 2N3OA 2DHXA 4QBUA 1BLUA 4HDGA 4DV6K 3CJRA 5AQWA 2DGXA 3G8TA 4JS5A 4K4ZA 3FFIA 3KYLA 3CJ4A 3W61A 3AVHA 5JS1A 3CFOA 3AHPA 1F5AA 3Q22A 4X66K 2QL5B 4Y34A 3HHLC 1Y4ZB 3PXGa 3FGUA 4V1Ak 3VERA 5GADU 5KG2A 2YCHA 1XMQF 4ANCA 4U67L 2RE2A 3L09A 3AVBA 5KFJA 4O4RA 4OGCA 1U4BA 1VQ8N 1WSVA 3G8QA 2IM3A 1Y3JA 5IC6B 1HWKA 2AP1A 1FX2A 3KG0A 2FF6A 3DRYA 2D3OR 3KNGA 1NO8A 3DXSX 3BGRA 1XNRF 1CJKA 9RUBA 2V9KA 1C6VA 3LF0A 3OY9A 2RKIA 1T11A 3CF5L 2V9WA 3L9ZA 3KLFB 4IG3B 1VQ5S 2WSCC 3H46O 2CQ3A 3O3HA 2V2ZA 4W5RA 2MQMA 4GO7X 2UYTA 4A8QA 4NA2A 4YOXA 2O8EB 3CC4S 4WYWA 3CJSA 2FJVA 1UPMB 4OVLA 1HI0P 2VASA 4MQ3A 2XY7A 1UEKA 4WE1A 3NGUA 4OJRA 2UXDJ 3ENVA 3MWBA 4KO0A 4PA1A 3OW2M 1ATSA 2V7ZA 2R4FA 3CE8A 3G0ZA 4WFBQ 3OTOJ 3G87A 4CLZA 4MFBB 2MZ1A 2C3UA 1PC4A 1KQSM 1QDUB 1VRTB 4KTWA 2KT3A 1FJEB 1GMWD 3QGPA 1T02A 1GOCA 1YTAA 3KJFB 4DV1J 1IUJA 1NJYA 4RNOA 2C3MA 3CGIA 5K5MA 2HFNA 1ITPA 1SL1A 1VOMA 1GMWA 2MY7A 1SV5B 4E89A 1N34J 4AM7A 4P73A 1U1LA 3DLRA 1X0PA 3U02A 3HHLD 1HKCA 3OYLA 3B78A 2UUCK 4CHNA 1S1XB 1IBMK 2DHSA 4PY5A 2N4CA 1T05B 1KHVA 2HFSA 2FHJA 2E1AA 4FP9A 4IFYA 2VQEK 2R7SA 4ZLLA 3HHLA 2I38A 2I5JB 2XGQA 2E5IA 3QEVA 3KNAA 2ZD1B 2JSXA 2ROEA 1Z26A 2DR7A 1TV6B 4RW8A 5H9EJ 2NRHA 1UP1A 4ZPDA 2ERRA 1G2EA 3QNWB 1KCFA 1DTTB 4BRPA 1QZ5A 4J9QA 4EU0A 2CQGA 2NSCA 4QZVB 2F4FA 3P31A 3GSIA 2EK6A 4U7CA 1HNWJ 1NGFA 2R7OA 2YWKA 3I0SB 3EMTA 4CZJA 1NGHA 1Q0NA 4ATNA 3N6MA 3CCTA 1AT1B 3C65A 3P39A 2IRXA 3VF2A 1A9NB 4URGA 1RSCA 1R8PA 3L4IA 3E51A 4Y00A 4JLHA 3PM9A 4F4KA 3CCUS 2HFZA 4HH0A 3ZFVA 3L2UA 2E2PA 3NMUA 2HVZA 3GFYA 2EK1A 4BLGA 4WTOB 3GONA 2YQ0A 1GLLO 4EBDA 3PO5A 3U9DA 3TUZC 1Q95G 5L1JA 1K47A 4JI3F 4Z4FA 3MEEA 3OL8A 1KAZA 4NEZA 2G1HA 3KLGB 3IKMA 3I0RB 2V51B 5IM0A 2E5LJ 1WSJA 3MPDA 3HTVA 1P6TA 3S3MA 2QSWA 2ADCA 1FK9B 3EGWB 2A5XA 2GIQA 3SMPA 1NUEA 5JUMA 3LDOA 1NJIO 4PPZA 2J0SD 3LDNA 3TQEA 3T3FA 3M8RA 2MY8A 1RU1A 4JI8K 3CO0P 4EP5A 3LM2A 5KFYA 4K7QA 4DF4A 3U8XA 4ZP6A 3BH6B 4DTJA 2YKQA 3PFEA 2A10A 4OYAA 2F8TA 4F3TA 2Q0RA 4DU7A 2H3GX 1VGYA 1V5VA 4DMZA 3BM7A 1NGJA 4IKAA 2ALYB 3AA3A 1RGIA 4AHVA 2RH3A 3LGNA 2ZBQA 3MPUB 1K8KB 3I55S 2IPOB 4U9RA 2GHPA 3D2FB 1BWEA 4YB7A 5IWAF 2KM8C 2PEHA 1NOYA 4C9DA 2VWBA 4LF4F 1WD6A 1TKZB 4UOGA 1M1KT 3SFGA 2GELA 2R7XA 4UQTA 3CMEN 4G3IA 3MR6A 4WU2A 3GB0A 4KPCA 5KFWA 4ZKAA 2ZKTA 1VS3A 2YQ1A 1VHFA 3CERA 4D3GA 1NSKL 2GX8A 4WCEL 5GADI 4H0VB 4L6V3 2BOAA 4O3PA 5AQVA 1TKDA 5HMZA 3KHRA 3VZHA 5GIOA 1DFDA 1ZH5A 5L9NA 4PCQA 2UXCK 4BC4A 2X7IA 3CI5A 1FEHA 3K2YA 2C28A 1VSMA 3KK2B 3K2PA 4ZIWA 4XO0A 1LXNA 4ICLB 3LDQA 1V4SA 4BR2A 1T6DA 5DS7A 3TTFA 1R6VA 1VJQA 4OPJA 3SPZA 4CF9A 3VQ5A 5E26A 3HPOA 3FZMA 7AT1B 1BWFO 5EX5A 2ZNYA 1EB0A 3UKUA 3ENWA 1MU2A 1V9OA 5ELZA 3I96A 2OPSA 3AOBA 3IMXA 3ULEB 3VQPA 3MN9A 3PYDA 4DV2K 2ASOA 4BDPA 3ZCMA 1VQNN 1DT9A 4Y0FA 2Q97A 3Q8QB 8RUCA 1TR0A 3CJBA 2WHOA 4WYLA 2DR6A 3DLHA 2CJXB 4O3QA 1WSFA 4CD1A 3V6DA 4HI2A 3O9QA 1OMSA 4E7HA 4U6PA 4IO9L 2O1PA 1QQNA 3EGNA 4OHYA 1UVMA 4I0WA 4K0KJ 1E6VA 2BJ7A 2KDOA 3BB5A 2Z4PA 3EVWA 4GMJB 1TAQA 1RISA 1JLGA 3SQGA 3RRHA 5KFTA 1IJJA 3NBPB 2IC3B 4CTAB 2DFEA 4WTYA 4GKKK 2GVZB 1TUVA 2P6TA 4DR3J 3LQVA 3DDIA 4DUYK 4KTZA 2LA6A 1IM6A 2Z56B 1ULRA 4O0JA 3UD3P 3PW4A 4NZ7A 1S1UB 1ZZFA 1UVJA 3N6NA 1S79A 2ZDPA 1S1TA 4CLPA 3MPVA 2GC8A 3TTDA 5HVGA 4B8AB 2HB5A 2CJQA 5AQUA 1NHKL 1XIQA 2YPYA 4X62J 3R9PA 4DTSA 4W5QA 3MCOA 3A8JA 4KB0A 1HW8A 2QXFA 2X51A 4OHWA 1RBUA 3K59A 3KWIA 1ZAWA 1IKWA 4B9LA 3PYEA 3QJPA 4EBEA 1UZHA 4FXVA 2D9PA 3V1OA 3LUYA 2CVEA 1WSEA 4CJRA 4NL5A 3HSCA 1B7YB 3BO3A 2QWLA 1WBDA 1SC1B 2WAQD 4DJBA 4IEIA 2DHGA 1WTFA 1Q8IA 4CF1A 1JCEA 3NOGA 2ZWHA 2V6AA 4WP9A 2QFIA 4KB1A 3UE2A 2C3PA 2IY5B 3GLJA 4F0HA 2ZOFA 3BDPA 3EZWA 2EXUA 3CO9A 3OTEA 3OJUA 2CNKB 5KG1A 3UWTA 4USIA 5D15A 4IFVB 4WWSA 3PX0A 2Z1JA 2HNDB 2NRVA 4AHRA 4CECA 5ETLA 4QWEA 2HNZB 1MN9A 4CK1A 4K4VA 3HI9A 4EO6A 3CDWA 3A5OC 5EUHA 3V1RA 1WOSA 3FNNA 2QZ8A 2ATCB 3JAMU 4B3TJ 1YIJN 4C11A 2KI2A 2IA0A 1C1BA 2XCPA 2EFOA 1KSPA 4IOXA 1D09B 3V9ZA 2GA7A 4DV5K 5L1KA 4G1IA 4N41A 5D4NA 3AVNA 4DFKA 1IBKJ 1AFJA 1M90O 4DV4F 4BHQA 1FRIA 5ETRA 2FLNA 4JI0K 2OPPA 3CD6S 5A8KA 2BVZA 4B9VA 3C7NA 4UY8O 3PHTA 2NRWA 2P9SA 4C3KA 5AFUA 4USMA 5KQ8A 4Y2CA 3X3UA 1NDCA 2V8VA 2HFOA 2UXBK 2C22A 1NZ8A 3G8SA 3W60A 4X66F 2MQ8A 2YNIA 1SH2A 1U26A 1KWMA 3J80Y 4DEZA 3NL0A 5DDQC 2M3DA 4F3QA 1FRXA 4WYBA 2NXEA 4PYAA 3CD5A 2XY5A 2KJWA 1N0UA 3J7A1 4NLWA 3MWTA 2HBJA 4X65K 1OIAA 1RILA 1U04A 4M5MA 4DX8H 3RGIA 5F2RA 1XMBA 2CQDA 3OR1A 4MT1A 1JXLA 3JAMO 1KLMA 2UU9J 4WFAQ 2ZH1A 2P5GA 1RCOB 3FJ2A 3TVKA 1O1WA 4H8KA 3HP6A 3LDPA 3E01B 3GFHA 1QSLA 3US5A 2YX6A 4JI5K 1KQGB 3FSYA 2DGSA 4Z37A 1L5UA 3NF6A 4DN0A 4OX6A 5AQJA 2ZITA 4L3QA 1P9QC 2FY8A 4EMDA 5DM7Q 1FKOB 2FC0A 2WBNA 4JD2B 3V9XA 5AJ3K 3QIDA 1OVYA 3TX8A 2LECA 4HUFA 2IGIA 4B3SJ 4JV5J 3HK2A 3J80U 3T6JA 1IKYB 1DEJA 2PYJA 1YGYA 2NRXA 5KT6A 2E1MC 4K8XA 3FGVA 3R7SB 1VQ9N 2IYIA 1YJVA 3LP1A 1KFSA 2G8UA 4B9MA 2J7UA 1FRMA 4QW8A 4AQYJ 2JRSA 5J2PB 3FBFA 1EJ7L 3K8VA 4LR9A 3FQLA 1N4LA 4K2XA 2VPZB 2IVYA 1SJRA 1S0MA 2JOQA 4FPIA 1Q7YT 3O1LA 2Z2MA 2CPZA 3CCES 4GV6A 5E5NA 5GAEI 4M3TA 3Q8SB 4DL7A 3KKFA 3AVIA 1JK9B 4GNIA 2VQEF 3R5BA 4JI2F 1JNZB 3ZEUA 4NX9A 4DMNA 4P6QA 3UDLA 2QC3A 2KLAA 2WBMA 3J80O 1VQ4N 4E7LA 3VQQA 2BE2A 2EKYA 1XNQK 3KKSA 2C2KB 2XMVA 1VQ5N 4HEA9 4H5VA 2E20A 4HUEA 3C8YA 1RT7B 1Y5LB 3WHIA 5TKWA 4JI4J 5F8MA 1FJGF 1F3FA 1M1GA 1YVNA 2OTJN 3VALA 2FSNA 4IXCA 4ZCMA 3KLFA 1Z05A 1NLVA 4IG3A 4EHTA 5LT5A 2HOEA 1SBRA 4ZHRB 3AVLA 2GNKA 1A0OB 4LFCF 2VCPA 3G71N 1HQEB 1CG2A 2O8EA 2LEBA 2Q1NA 3VVUA 2BA9A 4F02A 4KY3A 1O13A 2CDQA 2QKKA 2F7VA 1SUQB 2RU3A 1C4AA 3J7YU 5JVHL 3E9LA 1KONA 2UVVA 1NGBA 2DRAA 2X1FA 3G4SN 5DG7A 4MFBA 4ETXA 1RP5A 2BW2A 3DFEA 1BL3A 2E88A 4AHTA 1VRTA 2B4OA 2XMWA 3V81B 3QJLA 4DR4K 4FF3A 3H2LA 4RKUC 3ETMA 1IWGA 4ILMA 5KFKA 4P71A 5I3PA 4ECXA 3MN5A 4ZA1A 1J5EJ 3TSQA 1R59O 5AXNA 3GL1A 3LAMA 1SV5A 3RW7A 3GR0A 3VGVA 5A76A 3DU6A 5AZJB 3VAHA 2W4CA 4MMOA 3A8EA 3PUFA 4P7VA 4O3OA 5CZ2A 1S1XA 2H3EB 1MN7A 1W25A 2LQJA 4JI8F 1T05A 3HHEA 2GW8A 1WF1A 3SQ4A 2HGMA 4LSLB 1I51B 4HR2A 4YP3A 1BG3A 2MKSA 2C2DA 3P8BB 3THPA 2HS4A 3T1YK 4GVLA 4ECSA 3OYJA 2UVRA 2I5JA 1MMDA 2BKOA 3O4WA 3CDUA 4DV0J 4IG0B 4RNFA 3FR0A 1GXLA 2VHGA 3CHWA 3PRVA 3DAWA 1TV6A 2BW7A 3ET6B 5KFUA 4CEZA 4ISEA 4P9SA 2AYGA 4FK4A 1NKBA 1JJ4A 4M7XA 3RUBL 1DTTA 2C3YA 3QBWA 3CM5A 3KUGA 1WF2A 2JHEA 4CJ7A 1UETA 1CC7A 3D66A 4F7VA 4LFAK 2KT5A 3SAFA 3I0SA 5FLXY 3M8YA 2G9OA 3ZYYX 3RB0A 2XY8A 2QLFB 2GMLA 2XCAA 3IR5B 4XTTA 2H48B 3CIPA 1RWXB 1H2TZ 1NJWA 4BRGA 1NPPA 2FTRA 2LVWA 2Q1LA 3L6QA 1FTCA 4B3RK 2VKZG 2KT2A 4CJ5A 2UXCF 2YH0A 3ENBA 2D9OA 3V9UA 4JKDA 4Y1DA 4G1PA 3L7PA 2QA1A 3CJKB 4CJQA 3F44A 3ZSXA 2IVFB 2ATQA 3KLGA 3I0RA 2D69A 3HULA 2GIFA 2JEFA 1X60A 2R9LA 3EZ5A 1FK9A 2XS5A 2F5GA 1E6YB 5DDPC 3J8AA 4H4OB 2JC1A 2E7XA 5KFZA 3C3LA 1HKBA 5D0EA 2VOPA 4GKJK 3CPWM 4YY3J 1JJ2R 3I6PA 2L9DA 3QB0A 3MPWA 3PZPA 4LR8A 2VFRA 3NF9A 3IGVA 2WVDA 2BR0A 1F9EB 4FYWB 1OPIA 5CR4A 2XMMA 2WVBA 5BRDA 2A2DA 2KRBA 1PG5B 1JLAB 2GV9A 1NCLA 2NQPA 4BVPA 2YHAA 2W8LA 4HVZA 4B1WB 4CZLA 1YWXA 3QINA 3F9KA 5EHHA 3TEHB 4NXMK 4C0BA 3OYKA 3P5TL 3H20A 1K8KA 2DNHA 2BJ9A 2DNYA 1BUXA 3OYBA 4JKBA 4ZPCA 3D2FA 4G6VB 2OYQA 4IOCL 1FD2A 2N3LA 2OHDA 4DCPB 1NOZA 4YDUC 1XTZA 4HH1A 1IR1A 2F4VK 4PG8A 1RGVA 1YI2N 3DLBA 3EX7B 4GKKF 5AQFA 5ITHA 1S49A 2I7NA 4ER8A 1FA0A 1RWOB 2CQCA 4DUYF 4N8OA 1K0TA 1X3MA 3R6LB 1VQPN 4L74A 5FLXO 4WQ4C 1XK8A 3NS6A 1ZTWA 4CT9A 2XRIA 1QQCA 4KHPJ 2K3KA 2CWXA 3ILJA 4TU8A 4USVA 4DR1F 4O8KA 4C3MA 2RRNA 2OKQA 3KK2A 2KXHA 4FVUA 4M3UA 3WXIA 1S0NA 5DMRA 5L38A 2ITGA 3BN4A 4ICLA 1BHLA 4YR2A 1D9DA 1NGDA 1Q78A 1B99A 4GVMA 3UNYA 1NGGA 1JX4A 2UUBF 1O8BA 3MMAB 4DCOB 3AO2A 4P72A 2L48A 1I3AA 2HWTA 3BSOA 4A8YA 2P9UB 4FJLA 1WWHA 1M5VC 2DFFA 3DLGB 7FDRA 4ANEA 3ULEA 3UDCA 4C0OC 4TY9A 4CF8A 4U67Q 4J90A 2NNWA 3AVJA 1Y7PA 1K8AO 4KIAA 5I42B 2KU7A 3Q86A 1TMMA 3VEWA 1HHTP 3OS1A 2QL9B 3TANA 4O55A 4I64A 1SC4B 3RU0A 1UFWA 4BC9A 4HHHA 4CFCA 1CBKA 1CJUB 4L3KA 3T1HK 1RABB 3ZZOA 3AA4A 1RE1B 1CXQA 2AEMA 3AA8A 3O6WA 1NHUA 1RA6A 4NYPA 3NGDA 3HF5A 4H0OA 4RW4B 1NJZA 1RKIA 3ICLA 1U1PA 2OD6A 2VUGA 2J0XA 2E4LA 3VCDA 3R6GB 3CXCR 2WSFC 4ED2A 2V34A 2K3IA 4DV5F 2CJKA 2QTWA 4YDUA 3VPZA 4CTAA 2HK3A 1MMLA 3MEDB 2GVZA 3SBMA 1DQAA 5HQMA 4M8LA 4A47A 4FW1A 2ZE2B 4BCAA 1ATRA 1XEZA 3MCPA 1S1UA 2B9WA 4LBHA 5E3PA 1RDCA 5HRSA 3T7ZA 2I0XA 3P4UB 4KHQA 3W5YA 4WQ4A 1FVQA 3EWGA 2CUYA 3HBTA 5KFBA 3CPEA 1FCAA 1QAIA 2BEFA 4NEYA 4K25A 4WJBA 3I4HX 4CI6A 1IWAA 2JZ5A 5U47A 4A4JA 4RU9A 1H73A 4FYXB 3BGOP 2G2OA 3H4DA 1GMUA 3VENA 1Q5VA 5KT5A 4EAHD 2FJAB 3D1OA 4DWIA 2FXUA 4X65F 2NRTA 3WXMB 4HHTA 3WQTA 5M2RA 1T94A 2GQCA 3HT3A 3FUYA 1QUVA 5FIIA 1YRTA 4BRCA 2DGVA 2JEGA 1WNSA 3UCUP 3C6TB 4A8XA 4JI5F 3TAPA 4WQ5C 2NXNA 3SUPA 1X4GA 4CDIA 2DO4A 2XHWA 4IFVA 4QYZK 4LJMA 3D2EB 5SZTA 2HNDA 1RBVA 1TUUA 1HBOB 5AJ3F 2D0AA 2V68A 2DGOA 3VGLA 2HNZA 4FZVA 4OI1A 4JYAK 4C2MA 3R8YA 2LXFA 1GH8A 2P9IB 1RT5B 4M5GA 4U7UK 3I31A 1PJ5A 2EC0A 5CCLA 2PA8D 1VK8A 2VG5B 3UW1A 1ICEB 3ZNUA 3IDHA 2U1AA 3UDEA 3ZTOA 3EE8A 1FKPB 1NK8A 4BE1A 3I8DA 3HM9A 1S5JA 4K59A 2VWKA 1H3DA 3L7UA 1XMOJ 2BUPA 5C24B 2HF4A 1RBSA 4M5KA 2AQ4A 4C8YA 1EQ0A 3B6PA 3KLHB 4ZVEA 3M2VB 3EXYA 1HNXJ 4ID5B 4FWLA 5FDLB 1K6YA 1NH8A 5IV4A 4QCLA 3ZZYA 3H8YA 3RMDA 3NFAA 1FDDA 1U47A 1WHXA 1SPBP 4ZLPA 3E1YA 1U1QA 1Q4RA 5AQMA 2ZUAA 4HACB 4I69A 2YVSA 1SB6A 2QK9A 3H3OB 1SKSA 1RT1B 4BROA 3QESA 4GV3A 2LQ9A 3CMAS 1RBOB 1HRHA 3SV4A 4YB5A 5D0RA 3N4PA 4YMEA 3J7ZT 1QQMA 3MR3A 1BI4B 2XI3A 3H98A 1C0GA 4C97A 1FEEA 3M9MB 3OS0A 4OYIA 1TKTB 1Y3KA 1PC5A 3OFHA 2A6MA 4BRLA 3E01A 3GYGA 2IVNA 3D1HA 2MHEA 4H5TA 2WVCA 1X5PA 4ELVA 2KG0A 4DTPA 4WQ5A 1JCFA 1FKOA 1UJ4A 1YVUA 4JD2A 4ERDA 4J9PA 1FFWB 1XQSC 1ZM4A 5DZ6A 2Z1GA 1CZ9A 4LF7K 5KOXA 2H1YA 4LRCA 1UVLA 2DH9A 2PT0A 3CMQA 1IKYA 2VQFK 5E3AA 4X4VA 3BH7B 1ZBLA 4FM0A 1S72S 3AAQA 4J9KA 4GY2B 4WF9L 3CTRA 1BCOA 3LP0B 2Y9HA 4IRKA 4NI2B 3VN5A 5BPNA 3BYPA 4FXWA 3FLCO 1P1TA 3HJFA 5J2PA 3T5HA 5RUBA 1KD1O 4WCEQ 5IXUA 2VBYA 3M8PB 3CCEN 3ZXWA 3SMZA 1B92A 3NAEA 2MQNA 5E3CA 3CJ7A 1U1OA 2HQIA 3EUNA 4FKYA 2J6TA 4DL4A 3L0QA 1B0PA 3TTCA 3QGGA 1KXPA 4PL8A 2YWHA 2VJUA 3MAQA 5T41A 5MLCQ 3ZT4A 4CEAA 2AF6A 3HM8A 4NLVA 1YTUA 3T1YF 3VQBA 1X4HA 2HRYA 2FJBB 4HL9A 3TAMB 4PKHA 5CZ1A 3KMQA 4ZVOB 4EO8A 2OTLN 2AYMA 2GAHC 4X4OA 4HCBA 1RAIB 1VSIA 1RT7A 4NMLA 3A3PB 1S6UA 3DJCA 1Q1KA 3TNVA 4K5SA 5KT2A 5GADP 2DT9A 2ILZA 3UFCX 2UP1A 2AU0A 2WONB 4C8LA 4LFAF 4CM0A 2BKPA 4B3MF 2LKZA 4QR0A 4ZHRA 3M1FA 1NGAA 1N6QB 4JV2A 3SSSA 2IRYA 1HQEA 5SWMA 4DR7J 3BF3A 3KOAA 1L3KA 4B3RF 1JWWA 4PABA 1SUQA 4FXDA 3AA2A 3OVSA 3ULDA 2VG7A 4BDYA 4PRFA 3HKZD 3GFZA 3AQPA 3V81A 2LEAA 4L76A 2FF3B 4KGKA 1WC5A 4DG1B 3SUQA 4V19X 4DOZA 2I8EA 4YR3A 4RWXA 4DR2K 3EVMA 3CCSS 2QWMA 3MMJA 4A61A 2QIFA 3F73A 4QIGA 4G9ZA 1U2RA 1NXIA 4GKJF 5AZJA 2IDLA 2C2ZB 1RLCL 3F0NA 1HX1A 1GLCG 3VOVA 3CEDA 4H4KC 2IBKA 2EWHA 4LSLA 4IOAQ 1LFWA 4XAKA 2Q36A 1ZC6A 4Q2MA 1EX8A 4IG0A 2E6LA 3MDFA 4IH7A 1W2BR 3PVXA 4TU7A 2YNGB 1C0MA 4XPEA 5C2FA 2MLXA 3ET6A 4ED0A 4RW7B 2MKHA 3EICA 4NXMF 2WK4A 1M5PC 5I9EB 4E1JA 5BR8J 1N32K 3PYGA 3DHXA 1KS2A 2GQQA 1YQHA 3LPTA 3SSQA 5D4OA 3KDOA 3THYA 4IH5A 5HANA 4LBPA 3RAMA 4LD0A 4HT5A 1TAUA 5F1XA 3CNQP 3HRGA 3EKUA 3BV8A 1N8RO 1A5WA 3IP0A 5HJYA 4KHYA 1JJCB 2R7QA 4QAGA 4OQJA 1Q81O 1JLFB 2JC0A 4PEOA 1YT3A 1PAEX 3W8GA 5AE3A 4KKOB 3RMCA 3W62A 3GP9A 5ETMA 2CQIA 4IH6A 2RE1A 3C14A 1C0UB 2OUGA 4DUTA 3CJKA 2HHHJ 4JKGB 1R3NA 4W5NA 2YI1A 4OZ2A 3H5XA 2CKWA 3Q7BA 4P2XA 3THVA 4RG8A 2X78A 2CG8A 2KYZA 3EXCX 1TK0A 4NMXA 4M3YA 1VQ6S 5DM6Q 4CGFA 1E6YA 4CCHA 3ZSRA 3AARA 4H4OA 3OYNA 4XEIA 2YX4A 3JYTB 3IAYA 1T9XA 4J9SA 4K4TA 4KGVB 4FF1A 3K57A 1FT8A 3BDEA 2VD3A 2RUGA 1KQKA 2JLEA 4KFBB 2ASJA 2ABYA 2AGOA 1R8CA 4H4KA 4N5SA 1UVIA 5E33A 1MG7A 3V9SA 3B82A 2KFNA 2W42A 1JLAA 3P49B 4NLUA 4URSA 5CD4H 5K8NA 5E2QA 2HRUA 4RZRA 1UEUA 3TJ9A 2BGGA 2P1JA 3BS9A 4DV3K 2QMXA 3OYFA 1SKWA 1FD8A 1SJ3P 5CYQB 2B56A 2JH3A 1JXVA 3DU5A 2DXDA 4ZVHA 1D3WA 1IN0A 3TX0A 4ZCKA 2IIRA 3M1VB 1RYRA 3ISNC 1LFPA 3IWXA 3DM2B 2OSQA 3IR6B 4XK8C 1UTAA 5F8IA 1JCGA 4IKFA 1JL1A 3CULA 4CFBA 3R1LA 1IG8A 2GQ2A 3NVMA 3CVKA 3MN6A 1FW6A 1HIYA 4NA1A 1RHUB 3SDEB 1KBRA 2CNLB 3AY9A 3MMAA 4FYYB 3D1QA 4TLRA 4JEPA 1MA9B 2R42A 3U4LA 1E3MA 2R2RA 2BZ2A 2BXJA 3GILA 2P9UA 2Q31A 3EEQA 2P9GA 1S4FA 2PD1A 3M30B 1KVCA 3A5LC 2G8FA 3MAAB 3ZSZA 5KFXA 4CJ3A 4FWMA 2NZ4A 2V4QA 2XZWA 3DLGA 2P9NB 4UZCA 2HBMA 3BR9A 5KRSA 3DDNA 5J1EA 3M9OB 1VBZA 2V94A 1TFYA 1M5KC 2VB6A 5I42A 4NXNK 3WXJA 1B9DA 3EKSA 3O5BA 4NYNA 3W9JA 4YEAA 2VBXA 1NJIT 2B4JA 1D0EA 3KHYA 1YHQN 1CJUA 5HLFB 4DUZJ 2XB2D 1HHQA 3W66A 3HI0A 1WEZA 1Z2ZA 4CVNE 4RWTA 1MWMA 3DGPB 1RT2B 2E1PA 2YY3A 4QPXA 4RBTA 1L3UA 4KRWA 4RW4A 4BS2A 3ZT0A 1B9FA 2ZJRL 3SCLE 3Q89A 1KVBA 1WSHA 1YJ7A 3J81j 4FWRA 4NLXA 3VQEA 4A8FA 2OGUA 4PQAA 5I3QA 2CQBA 4I7FB 4FO0A 5DZ7A 3CDBA 4CLTA 3ISND 1AUSL 5CCMA 3HXMA 1RWMB 1EAYC 3MEDA 2PGCA 2J4RA 2NRZA 1RAHB 2ZE2A 2JJ4D 1GMVA 2RIJA 1TK8A 1X3NA 1WEXA 5JVHQ 3PTWA 2YBVA 3DOMB 5A2QY 4BGBA 3MHYA 2BJDA 3H40A 3M6UA 2W2QP 3GV5B 1TVRB 1N36K 2H4WB 1U24A 1KQFB 4ISGA 4E3SA 5DQHA 3OYIA 3VAGA 4LH5A 3GYXB 2AJ0A 3FEYB 3NCQA 4O3RA 3QFUA 3K5MA 1GLBG 3OBWA 1CZAN 4EBCA 1HWLA 4NYFA 1WUAA 1CLFA 2D4WA 4LF2A 4WFYA 4CD3A 4A8OA 5KFAA 2W8KA 3T1AA 4C1NK 4YS2A 2F8HA 4H0TB 3C6TA 1YJ9N 3M6VA 3JQJA 3NY0A 4I6WA 5KFMA 2DITA 4RUAA 3QWPA 1TL4A 4NLSA 3RR8A 1N33J 2FB0A 3D2EA 2M8DB 4QOTA 5A2QU 1QQOA 1HBOA 3FDSA 1NPRA 3U1MA 4A8MP 3PFOA 3CCJN 4USWA 4CHQA 1GX5A 2WRMA 2P9IA 5L1LA 1RT5A 2XLKA 2VQFF 4JI1K 2VF3A 3RSEB 3NOCA 1HJRA 5I4MA 2F40A 4CNZA 3QERA 3EZOA 2VG5A 4JK7A 1FKPA 4UW2A 4CHOA 4A57A 3ONQA 1NSPA 1IBKK 4J5OA 4ZPAA 5C24A 2NUBA 2OAUA 2KW4A 3N0VA 4AE5A 3CJ1A 3AO5A 3LM9A 2CJAA 1XHZA 3KLHA 4ENOA 4ID5A 5FDLA 2DNNA 1YG0A 3CCRN 1RAFB 2MSSA 3W5XA 2DTUA 5EDWA 3MXJA 4PWWA 3O4NA 1AB8A 5A2QO 5IS2A 3BYRA 4HACA 1VSFA 1IBLJ 4OX8A 1R43A 4CO0A 3GIMA 4C4WA 4FWPA 1RT1A 4MDAA 3LZIA 4PG5A 2W7OA 3H4BA 3BZKA 2O8BB 3NE6A 3OHRA 3FE1A 5BPLA 2AP6A 1UEVA 1WG1A 1FDAA 4R0EA 1BI4A 3HZEA 2A1SA 1VQ7S 4H03B 1TKTA 1CC8A 4CO4A 3MPYA 4FOEA 1EZZB 5JVGL 5KGWA 1RADB 4M45A 2CQ2A 1BIUA 3I82A 1RJJA 1YTYA 1TGOA 3C66A 3SFUA 5C2DA 4NCGB 4JRPA 2A42A 2I7PA 3L4QA 4GVEA 4HTUA 2COLA 4B3SK 4JV5K 4XH1A 3VQSA 1H38A 2UXDF 1YITN 4IOCQ 5KFFA 3OLBA 1VQMS 3ZSYA 5FPDA 5K9FA 3M32A 1RTJB 3OTOF 3LP0A 4LIWA 4R8UB 2GFFA 4NI2A 4DQSA 5DG8A 2RHKA 5CYMB 4ZN1A 4DV1F 2XO6A 1XNRK 2ASLA 3M8PA 1QTNB 5GAHU 4KPYA 4OZLA 2VICA 4NLOA 1Z25A 3AH6A 1J6ZA 3VQ8A 3L3VA 2M0GB 4DSJA 2UUTA 4CJ4A 1VYAA 1SS6A 3K17A 2F9TA 3KLEB 2FVQA 1M90T 3PO4A 4Q8FA 4TLQA 4ZMMA 2W4PA 3ITHB 3GTYX 2QRRA 4UY8T 4BRFA 2OP5A 4DZ6A 3TAMA 1AXQA 4OI6A 3CDAA 4E1NA 4XH5A 1WG5A 3WNFA 3OFFA 2Q6BA 4HWIA 1EHWA 5ETVA 4KGZB 3RB4A 3PSFA 2HBYB 2XQCA 1B4SA 3CC2N 1SXLA 1RAGB 1N32F 1MSWD 4TU9A 4FSVA 3D7EO 1ZBUA 3RW6A 4JI4K 2FC9A 3G6VA 5DLGA 2CDRB 1RT4B 2WONA 3CCMS 1HR0K 3QEPA 1QVGM 2DBBA 2FGCA 2DRDA 2FJDB 2QA4G 1N6QA 3JXUA 5KFDA 2BJ3A 3QNNA 4K4UA 3CQYA 2A1RA 5M1OA 4M5LA 1CS4B 4KHUA 3MCMA 1YJNS 3ADAC 1RT6B 3AT1B 3NNHA 1APSA 4CEDA 1WAJA 4DPUA 3HO1A 1H6KX 4WKRA 3CCQN 2XMUA 4DTRA 1N5SA 1Y64A 3N01A 5E7OB 5FRNA 4KB7A 1TKXB 1QSSA 4RNHA 3BBFA 2EFVA 1N0VC 4CO5A 2E5LF 3TAQA 1HLWA 4DG1A 4LRBA 2NXUA 4X64J 3S41A 3EPIA 1VK3A 4W4MA 5KPRA 4NPOA 3MURP 3J7YP 4ZTFA 2LDIA 3A5NC 1J5OB 1BXNA 3N6LA 3M6WA 1H7WA 2M88A 3C0BA 4KTQA 1MNEA 1VHIA 4DV6J 1P27B 4RUHA 4FJHA 2R8HA 4CGDA 1U7LA 3MCAB 1BQMA 2CFXA 2WVEA 2WW4A 4F2RA 3AODA 4ZVRB 5F9LA 4KH0B 1FFGB 1M5SA 5B0FA 5AQHA 3I5CA 3DLEB 2RDJA 4XDDA 3O9TA 5B0BA 5JMVA 2ZVIA 4X66J 3RRGA 4E7IA 4DV0K 2IM2A 3IMQJ 3A4TA 1SCJB 2H5EA 3GIRA 5ETTA 1X9SA 2B5JB 2FDNA 5F0XA 4RW7A 5LM7E 5T7LA 1W97L 3VQ7A 2W2NP 2R7TA 4CFAA 3Q24A 3PW2A 4WIQA 3W0LA 2ZZMA 3I9V9 4ZOSA 2KRRA 1GTHA 4FWKA 3DMJB 3MTJA 5BYRA 1R27B 2ZH7A 1NSAA 4RBVA 4CJTA 4LRFA 3AB4B 1K9MO 4OMFG 2EC2A 4PAAA 4OKJA 2W2MP 3LL3A 4AF1A 1U1MA 4IR1A 1N52B 4GV9A 3AVCA 3QZ8A 1JLFA 4CF0A 3DN9A 4QIWD 3GV8B 3HZGA 3MCSA 2L08A 1VQKN 1JL2A 3TO8A 1HPZB 3WIVA 4KKOA 2HZAA 1VC0A 2NZCA 1S57A 5D3GB 3TEGA 3MN7A 1C0UA 3CJ3A 3CFRA 5C12A 3LDSA 3K5LA 1WC3A 1L3TA 4JKGA 4DKWA 4ECQA 1NK4A 5E3RA 5IWAK 4RJVA 2YH1A 1PAUB 4FS1A 5DQIA 3HPGA 2AW0A 3H45C 4X4PA 3OTCA 2G2ZA 2O8CB 3L2RA 2CPDA 1HBUB 3VF4A 2QEXS 1F2GA 4LSNB 3NGSA 3O9UA 3JYTA 2E44A 3PW7A 1VK0A 3ZT1A 4YY3K 1VLOA 1YXQA 2D74B 1GX6A 3FZFA 4A8WA 2ZBCA 2XSJA 1S9EB 4KFBA 4Z4GA 2LLZA 1E4FT 2R7RA 2UUCJ 4NXNF 1IBMJ 2V2VA 3OA9A 1HBNA 1LKZA 2KHCA 2FVSA 1VQSA 3VQ6A 4U8VA 4J91A 2VQEJ 2DPIA 3GJRB 3D3BJ 2KO1A 2UUWA 3FRZA 3G10A 4YOTA 4EEYA 1KDNA 3ZT2A 3BN7A 2ZUGA 3SLCA 2I6WA 1NBEB 4K0KF 3VQCA 1DGKN 3QZ7A 2XMKA 3UO0A 4JI6K 5CYQA 1RK8A 2EWSA 2HEKA 4CBWA 3V6HA 4PR6A 2P5OA 2E7WA 2Z1IA 1W2IA 3HDSA 4F4WA 3M1VA 3FKBA 4J2AA 3D4JA 1K1QA 1RWKB 2DXFA 4BRHA 3DM2A 3QRPA 3JXOA 3CJTA 4WBFA 3C94A 4WF9Q 3NF7A 4KHPK 2Y8YA 1MWKA 3IRWP 4BRDA 4AHSA 2FJEB 3TJAA 2JDJA 4X62F 4PXEA 2KHDA 3WXKA 3X1LB 1LEOA 3TZZA 1JXEA 2XLIA 2MKJA 4MLEA 1Q86O 2AHOB 2BH1A 3OFEA 4JV0A 1FWPA 5LY3A 3SDEA 3CCZA 4TY8B 4CI0B 4MKVA 2H4YB 2IMWP 1YLXA 3AVKA 4F0KA 5AQZA 1WDTA 4ES2A 3HHNB 1C0TB 5AT1B 3CW2C 2AGPA 3M30A 1F3VA 1NZAA 3MAAA 5BYQA 1K73O 2EFPA 2VFSA 4CK3A 2P9NA 4DX5A 2QFJA 2KKHA 1VQLS 2WB4A 2OPQB 3TZWA 3DYAB 2WC9A 3JSYA 1SC3B 2QL7B 2KYXA 3KWGA 4RW9B 2OFGX 2DIUA 5HLFA 2BQ3A 4YHHK 3ZZTA 2BUNA 3IA0A 2RDIA 4Z4IA 3DGPA 1UPPA 4ALZA 1RT2A 1B64A 4A59A 5HVHA 3N9UC 5A6PA 3PW5A 4IUFA 4OX9J 3A0IX 1KKHA 3EPGA 4B3TF 4MIWA 1WLJA 3OSPA 3T6BA 3OBYA 3G6YA 4I7FA 5M1QA 4PPDA 5LJVA 1RDWX 2VJVA 2CPIA 3VEVA 1RI7A 5KOWA 2E9RX 3KG1A 1IBKF 2XS7A 4F3OA 1AW0A 4RR5A 3DLJA 2DJWA 5HO4A 4A8SA 2AYEA 1YVFA 1UA1A 3NLCA 2G1DA 1U25A 2UV8A 2HBKA 4ZJQA 3DOMA 4CLYA 3L2VA 5C15A 2J7KA 4Y1CA 2YNHB 4RX6A 2XHCA 3U6FA 3SI6A 2VIHA 2UXCJ 4ZCLA 3ZSWA 1TVRA 2BJ8A 4QS9A 4EFAC 3D6RA 2HBLA 2WVFA 3G82B 4F50A 2ZH4A 2VFVA 3BBCA 5HAOA 5SUHA 1RWWB 1NNEA 2VDHA 5A8RB 4NRUA 4BR0A 3EGVA 2MMYA 4H5WA 3P45B 2DNLA 2LMIA 3HFKA 3WC2A 1OH7A 1M1HA 4PQUB 4D3HA 3GQCA 3EJMA 4DV4K 2KJVA 2R2UA 5KG0A 1FERA 5KFNA 5ADZA 4LF6J 3H1QA 2E1ZA 3RMAA 4CBUA 2ZZNA 1LOTB 3TRGA 2HHQA 1EQYA 4M1KA 3IC1A 3H08A 3OYHA 2MZJA 2DNMA 2MQPA 2RQMA 1S7HA 3OL6A 1S3XA 3ZSVA 4DV2J 2P9CA 3PR5B 3NCRA 5LJWA 1X8DA 4B9QA 3ZTRA 4J9RA 3CQXA 3SAHA 2QTDA 1VQOS 2JVOA 2ETJA 5KG7A 1CVJA 4B3SF 4JV5F 3QBXA 1K8AT 3POTB 2ZH8A 2X6NA 3P3DA 2NREA 4DL0C 1U6FA 2PAVA 3OR2B 1I3OB 5HP1B 3RSEA 1RXOB 3BY5A 1OSDA 3GIKA 4DN9A 3MUVP 4QU6A 4EIAA 4OLPA 1WC1A 1RTDB 3MXHP 1UL3A 5EWGA 3PR4A 1EWRA 1HHSA 3UD5A 2KQ2A 4J37A 5C10A 4AQYF 3FCWA 2D3O1 4FF4A 3UN2A 3L3CA 1BGXT 1Q8BA 1VSJA 4MK7A 4DSKA 2NXCA 4CERA 3G86A 2DCLA 4PUOB 1ZOTA 3QIPA 1R31A 3GR1A 3PACA 1R8HA 2POKA 1RDBA 4R5PB 4OZ3A 2KZZA 2WZ1A 1EKEA 2DY4A 1HNXK 3CCVN 4CJVA 5JJBA 1BQXA 1OH6A 2BANB 3QLHB 1VAZA 3DXKB 4Z4HA 3ZZZA 1Y5NB 2MZSA 2B7CB 5M1PA 4DR5K 1U8SA 4HTJA 2C2EA 3UB5A 2V4RA 2JLGA 3N5BA 3NS7B 1VCTA 2O8BA 4QPTA 2X1AA 5GMEA 3QRRA 4WFNL 1NM1A 1DARA 2CPJA 1IH7A 2HQFA 2RILA 4JI4F 2CQ1A 3I56N 1YJWS 2FHJD 5J2NB 3LW5C 1HR0F 2K2PA 4CGGA 4OV1A 3LGMA 3BQ0A 1VQMN 2VV5A 2CWKA 3BKTA 3AO1A 3S6EA 2WTFA 5KFGA 2EBEA 2UUAK 3E9PA 3OYDA 4NCGA 1ACMB 4JI2K 3MR2A 4WP8A 3A2FA 4G1QB 3D6MB 4PHTX 5KFPA 5KFEA 2Q79A 2OZSA 4FNIA 1NNDA 4H0PA 2RUSA 1RHRB 1RTJA 4UOHA 2M8HA 1G4CA 4FWQA 2V4JB 3LA0A 3TZYA 5EX0A 3VEXA 1PBUA 5CYMA 2BTFA 1RBTA 2HAIA 1FJCA 1FJGK 4CJSA 3ZZUA 2LXIA 5HOOA 1J5EF 2D7SA 4ZDNA 4DV5J 4V19S 3Q8UA 2QXLA 3NH0A 3D6FB 2HGLA 4RW6B 2JL9A 3G6ES 4LFCK 2LU2A 5DG9A 3D6TB 4JI0J 3ZTSA 2OPRB 2F1FA 4EYIB 1FO1A 3M9NB 2R2TA 4O4GB 1GNKA 2B43A 3KLEA 1NJXA 4B02A 2F3JA 3R1XA 2UXBJ 3ITHA 2MYFA 1NRKA 1J53A 1P90A 1TL7B 4DV0F 1EKSA 4CJKA 2O3DA 4B8CA 4ZP8A 4ZK7M 4EGLA 4QWCA 2MKYA 4K4XA 2LU1A