1IKWA

Wild type hiv-1 reverse transcriptase in complex with efavirenz
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL POLYPROTEIN
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Structural basis for the inhibitory efficacy of efavirenz (DMP-266), MSC194 and PNU142721 towards the HIV-1 RT K103N mutant.
pubmed doi rcsb
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1ikwA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ikwA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ikwA05
3L2VA 2B5JA 3QIPA 4WZMA 5CZ2A 4CHOA 4ED0A 3L3VA 2YKNB 1RYSA 1RTDB 2P5GA 5KFGA 1K1SA 2ZKUA 5DK5A 2VG5A 5L9XA 3M9MB 3V6DA 1S9EA 5DQHA 4J2DA 3AO5A 3V6DB 3HKWA 1RBRA 4KV8A 3MR6A 4ED2A 4Q43A 3KHGA 3SQ4A 2D0BA 1S6QB 3L2WA 3D28A 1B9FA 4F8RA 4L8RB 4ZP8A 2C28A 5C24B 4IOBA 4I2PB 3AVMA 3SYZA 4I9QA 1XWLA 3MXMA 4KHMA 3SUPA 2XHBA 3F73A 5KFYA 3CWJA 4JV2A 4DU3A 1MU2A 3BQ2A 1RT2B 2Y1JA 3O3GA 4CJVA 4RW4B 5HRSA 4JS5A 1VRUA 1QQCA 5C25B 4GMJB 4OJRA 4DU4A 3UR0A 4JV0A 2JGUA 4W5QA 4CJTA 5I3UB 2R8HA 4RUAA 3VQ8A 1TK0A 1QUVA 4EYIB 4J9KA 1NJYA 1RILA 3H59A 3C94A 1SKSA 3VQAA 4UQGA 4RNMA 3M8RA 3HM9A 4Z4IA 4B9NA 3GIIA 1HMVB 2D5RA 1ASUA 4Z4HA 1EX4A 2O5DA 3I0RA 2HNZB 4QW9A 4RW8B 4Q45A 4J9PA 4FM0A 2BE2A 3PW2A 3IRXA 1S9GA 3T5LA 2IMWP 3RB3A 4M3RA 1DLOB 3E01B 4DL7A 4RW8A 4IRCA 4K4UA 4TXSA 3PW4A 4CEQA 4E0DA 4FJIA 1LWFA 3BQ0A 3BGRA 4GW6A 4DL2A 4KI4A 1XR5A 1RT2A 4R0EA 5F9LA 4J9MA 2W9BB 2Z1IA 2EX3A 2IOCA 4F4YA 3KLFA 1XI1A 3KTQA 1VSDA 1TVRB 4GVMA 3KLIA 2V4QA 5J2QA 3P1GA 3RR7A 2ASJA 4C8OA 1RT7A 1T03A 2KTQA 1FKOB 5DQIA 4XPEA 4LSLB 4CJSA 1C0TB 2KZZA 5KFLA 3PVXA 2VG7A 3AA4A 3K57A 4KV8B 3DLBA 3RRHA 4Z4FA 3AA5X 4NRUA 1F21A 3AVAA 3NL0A 3SPZA 5KGWA 1S0NA 2G8IA 2YHBA 2AJQA 1T7PA 3KD5E 3LZJA 2YKNA 5KG0A 1TL1B 2B5JB 4B9LA 2PY5A 1IKVB 1BQNB 4WXOA 5SWMA 4DLEA 3CJ0A 2GV9A 4F2RA 4ELUA 2RF2B 1O1WA 2CJQA 5KGXA 4DTUA 4N47A 5KG2A 5DG8A 1C0UA 3TAQA 3DLEB 2W42A 3AO4A 4ECSA 3DRPB 4TYAA 3OYDA 2QKBA 3SI6A 1QTMA 3HVWA 1TP7A 2HNDA 1Z26A 4E7KA 3NBPB 3I0SB 1LWCB 1G15A 4FS2A 3RB0A 3MEDB 4DTXA 1QAIA 2HWHA 3B6OA 1NKEA 3WNHA 3PR4A 4FK0A 1RT5B 3HVAA 3MXJA 5JUMA 3RB6A 2AGQA 3I8DA 4CJFA 3BJYA 3V6JA 2WCXA 3HT3A 4NCAA 4KI6A 5DQGA 5KFDA 1YT3A 5FRMA 3HP9A 4EEYA 4FBTA 1Q8IA 3CFOA 4QPXA 4DSIA 1BIUA 3QGGA 3DLKB 4ED8A 3UQSA 2XI2A 3KLEB 1JLAA 1JLBB 1KHWA 3AVHA 3NAEA 2RF2A 4N76A 1QHTA 2G8UA 1TKXA 4M45A 1R0AA 4QWEA 2IS3A 1GX5A 4PA1A 4F4ZA 4NLQA 1IKXA 4ECYA 3E01A 4J2EA 4B9UA 3GV5B 3DM2A 2AGPA 1J9AA 4CESA 4FJ8A 3G0ZA 3KKRA 3DI6B 1QE1A 3DI6A 5FDLB 2C2EA 3OYMA 4QAGA 5KFRA 5DGBA 4W5TA 1ZBLA 1C1CA 4FLVA 3LP2B 1JLCB 4ZPBA 3N6MA 1VSEA 2GUIA 1UA1A 1A5VA 5C5JA 4JRQA 4DL4A 4M3XA 3AVNA 4BE0A 2HNDB 3HVRA 4K8XA 4Q0BB 4CERA 4O0JA 2GBZA 3QIOA 3QYYA 3LAKA 3DLEA 1EKEA 3RR8A 5KTQA 4F2SA 4Y2AA 1DTQA 3MEEA 2OPRB 2IBKA 4DQSA 4CJPA 3OL8A 2J6SA 1HJRA 4Q0BA 3EPIA 2AQ4A 3H08A 3KHHA 4O3SA 2JEGA 2E9RX 4KSEB 1TV6B 4N41A 5DGAA 4ECRA 3NF6A 3GV7B 4FS1A 3PX6A 3WNFA 1LWEB 3OHBA 2OPQA 4K4ZA 4DTPA 1S1VA 3QIPB 1C0TA 4OLBA 4FJ9A 2HWIA 2HNZA 4K4VA 4EP5A 1SUQB 2XC9A 3NF7A 1JLBA 3DLRA 3G10A 4BACA 4RU9A 3KD1E 5KFFA 4WFXA 3BSAA 1X9SA 3HYFA 4M42A 5EUHA 3VQDA 3M9OB 2ASDA 1NK5A 1D1UA 2IM1A 3DOKA 3VQEA 4ZP7A 3OYHA 4EZ6A 3K58A 4IDKA 5SZTA 1N48A 3CIZA 4CJWA 4IRKA 3DRSB 2HVIA 2VG7B 1SV5A 3BR9A 3VQ9A 4CGFA 5HRNA 1N56A 3ASMA 4E7HA 1IKWA 2R7YA 3L3UA 1RDDA 1T03B 3DRSA 3VQPA 1HNVA 3ZT3A 5KFNA 3NGYA 4MKAA 4H4MB 2W9AA 4CJKA 3RB4A 3AVKA 4Y2CA 5HP1B 2HHXA 4O4GA 3EYZA 3NH1A 2R2TA 3MFIA 3OYLA 1KLMB 2XWYA 3HSTB 4B08A 1X9WA 1IO2A 3M9NB 3OYNA 1S97A 5HBMB 3S3NA 1A5WA 5C24A 4WFYA 3ZT1A 2XGQA 4C8MA 1D0EA 4ZVGA 4YR0A 3NCIA 3CDEA 4HTUA 4MK9A 5I42A 1BISA 1VK0A 1TL3B 5J2MA 1BCMA 5C25A 3L2UA 1VRUB 1VSFA 2BQUA 1I3AA 3ULDA 2F96A 3FFIB 3O4QA 3V9XA 5KG6A 1SL2A 4NCGB 1SH2A 1JLEB 3AVCA 3SUOA 3S9HA 1S1TB 4KE5A 5KT2A 3V81A 1L3TA 3AVGA 4DTJA 4DTNA 4IH7A 4KPYA 5D3GA 2EC0A 3VQBA 3TABA 1NOYA 4I2PA 3SQ1A 3AVBA 2FBVA 2D3UA 3G6YA 4CIFA 5KFPA 1D9DA 3VQCA 3SZ2A 3H5SA 4KHYA 4R5PA 2IM0A 1DLOA 3PJWA 3EPGA 4Z0UA 3ITHA 4NRTA 3G6XA 1QE1B 3CFPA 2V0NA 2FC0A 1TQLA 1RA6A 3NGIA 3HHKA 4DTMA 1JLGA 1ZTWA 3Q8QB 1EETA 3VQQA 1R0AB 1VSMA 3SCXA 4TY8A 4ZTJA 5KT5A 3IS9B 4DL6A 4IFYA 3SV4A 1LW2A 3KLEA 2IJNA 4CEDA 4K4WA 4FM2A 3OJSA 5KG3A 3KMSA 2ATQA 4LY7A 4CJQA 4DQRA 5KFMA 3GIMA 2W8KA 3CM5A 3OYIA 4ZPCA 4LQ9A 4FK2A 5EWEA 2R8JA 4BDPA 5I3UA 1VSIA 4KTZA 1RTDA 2XGPA 2BQ3A 4CEFA 2XCAA 1K1QA 2E9TA 2WOMA 4ID5B 3SV3A 4J9QA 2X6SA 1TK5A 3OSPA 2VG6B 2W9CA 1RT1B 1LWCA 3DOKB 4CFBA 1ZBHA 2R8KA 3ISNC 3SUQA 5KRTA 5KI6A 4IG3A 4Y1CA 4E3SA 3DOLB 4RNOA 3QZ7A 3M8QB 4M94A 2EHGA 3ZT0A 1NK8A 4G1QB 4RW6B 1BQMB 4C8KA 4RNHA 3BSNA 4NCBA 4H4OB 3EZ5A 4FJLA 1IH7A 4QCLA 3UPFA 1J5OB 3SNNA 4KO0A 1N5YB 1NK9A 2IC3A 2YHAA 5J1EA 4KTWA 4DTRA 4J9RA 4CFDA 1IKYA 4E7LA 3VQ7A 4CFCA 4CEBA 1HPZB 1HYSA 1HQEB 3KK1B 1UAXA 2HHUA 3GILA 3B6PA 2WTFA 4CHZA 3QEWA 3BSCA 3ZCMA 3TI0A 3DLGA 1RTHA 1RT7B 2QKKA 1KSPA 4IFVB 2C2DA 5C42B 1TKTA 3KIOA 2OH2A 5KT3A 3OLBA 4PUOB 3H5UA 3RMAA 2PYJA 4ED7A 3RBDA 1RBTA 1RCHA 3KK2B 4J2BA 3PX4A 1KCFA 3OHAA 2W7PA 3K5LA 1REVA 2HHVA 5K14A 3GQCA 2YKMB 1JKHA 3DMJB 1S9GB 4ECUA 4FXDA 3JSMA 3DM2B 3CJ5A 5J2PA 4FZXC 4DFJA 4NLWA 4RW7A 3K59A 3TARA 5KFXA 1I6JA 3KJVB 4E7JA 4CJEA 4K8ZA 3WNGA 3QLHB 3V6HA 4Z4GA 5KT4A 4B9VA 5CZ1A 1WLJA 3DMJA 1L3VA 3RAQA 3U3GA 2Z1GA 5DMRA 4CJRA 4CFAA 3NHGA 1JLQA 3CDWA 2HMIB 2DFEA 2FVCA 3OYCA 3OVNA 3KNAA 4Y34A 1KLNA 1NK6A 4DG1B 2QE5A 3QIDA 1GX6A 5KFHA 4B3OB 4F3TA 1UWBA 3OYAA 4KKOB 3K5MA 2UVUA 4NLDA 3HO1A 4HUFA 2OPPB 3C6TB 1TKTB 5F8JA 4RW9B 1NJXA 5KT6A 1JL1A 4KHRA 2G8FA 1HNIB 1NK7A 1LW0B 2FVSA 4GC6A 4EZ9A 4IR1A 4HKQA 5EDWA 2WK4A 4O3OA 1VSLA 1HQEA 1JLFB 4PQUA 1EXQA 2HB5A 3DYAB 1IKVA 1BQNA 4O3QA 3V6KA 3KK3B 3LZIA 4WZQA 3V9UA 4AHVA 1YTUA 2HVHA 1BI4A 2AU0A 2O4GA 4FVMA 3AVLA 5T7BA 4B9SA 3OLAA 4Z4EA 1VRTB 4LQ3A 3KK3A 4AHUA 4HUEA 3PV8A 1MMLA 1VSKA 3IGNA 4FLZA 3LP0B 4QWAA 3BSOA 2B6AB 1D9FA 1X1PA 3AVFA 4O44B 4CIGA 5T14A 3C6UB 3I5CA 1LW0A 2Y1IA 1HNIA 2D7SA 4I7FA 2FVRA 4TN2A 3A2FA 4CHQA 4ZHRA 2YNGA 2RKIB 4FBUA 3P5JA 1DTTA 1U04A 3AV9A 3VQ5A 4RZRA 3L8BA 3IG1A 1W0HA 2FVPA 3FSIA 1RAJA 2GIQA 1EP4A 3QO9B 4EP4A 1CXUA 4N56A 2WB4A 3IAYA 3BGRB 1S1XA 3H4DA 1VSHA 4DS5A 2E6LA 3BDPA 2YNHB 3V1QA 2G8HA 2HNYA 2V4RA 4DF4A 4DU1A 3HVTA 3RTVA 1RT3B 3K5OA 4JS4A 1HQUB 4FLXA 1YVFA 1N4LA 1TGOA 3NF9A 3AO3A 3RRGA 1ASWA 4NLGA 4I2QB 5J2NA 4DTOA 3PJXA 1S1UB 2G8WA 1NNDA 4DSEA 4FW1A 4LSNB 4WYWA 3S3OA 4QWBA 3KLGA 3KOAA 1KFSA 3HPGA 4CHYA 3TAMB 4M3YA 3QETA 4EO6A 4CEOA 2ZE2B 3EZUA 5CYMB 3KLVA 4OGCA 2DY4A 3I5AA 1ZYQA 4JLHA 2KFNA 1D5AA 2Z1JA 3D45A 1HYVA 2HAIA 4O3PA 3E51A 1MU2B 1RBSA 4MH8A 4EYHB 2W7OA 4HHTA 1S1UA 4BE2A 3HP6A 2XY7A 1RDCA 1RTIA 4TQSA 3LP1A 3LP0A 4CEAA 1L3SA 1C1BB 1HYSB 3LP3A 3PHEA 4TSXA 5CYMA 2YNIB 3JYTB 2PYLA 3GV8B 1HQUA 3PW5A 5HROB 2FLNA 5CYQB 1KHVA 5CYQA 2D0AA 2VWKA 4KHQA 3RMCA 3LWMA 4PWDB 1WAFA 3OS2A 5KFWA 4DQPA 1U09A 4F3OA 4CJUA 2DFFA 5DLGA 5FRNA 4FYDA 5J2NB 3DOLA 4DMNA 1NK4A 4TY9A 1FKPB 3I5BA 3SPYA 4KB1A 5HLFA 2ZD1A 4DF8A 1ITGA 4WXWA 2OPPA 3NAIA 4F50A 3HL8A 2P5OA 3H98A 2YNFB 1JX4A 2FJVA 4KREA 5F8MA 3OYEA 1FKPA 5KFEA 2NUBA 4FJ5A 4QW8A 4CK1A 2R2SA 3BREA 3VA3A 3M8PA 3TAMA 3FQLA 1WSGA 3SQ2A 3KMQA 2QK9A 1JLQB 3N6NA 1RYRA 1U47A 4AHRA 3QO9A 2PZSA 3VN5A 4BWJA 3IN5A 1BCOA 1RDRA 3ZSQA 1S4FA 3QLHA 1SL0A 4GC7A 5HRRA 5KRSA 1VSJA 3K5NA 1RT4A 4RW7B 3SFUA 4DTSA 1JLGB 2IAJB 2W8LA 1S1VB 4DFPA 1RT3A 1SKRA 3TAEA 4QWCA 3CFRA 5HRPA 1XHXA 4N5SA 2F8SA 3NF8A 1S0MA 3G86A 2HHWA 2Q3SA 4OKEA 1TV6A 1ZETA 1TAUA 1S1XB 4IH5A 3OL6A 2OA8A 3G6VA 3KHLA 2ZE2A 3QINA 1EP4B 4MK8A 3OY9A 4IQXA 3MEGA 5D3GB 2BRKA 1S49A 4NYNA 3OYBA 3PR5B 3ZSYA 4FJMA 3CG7A 2R8GA 1RT6A 4ECXA 2JLEA 4BE1A 4YP3A 1NKBA 4I7FB 3D0PA 1KVBA 3P83D 1S10A 3QEIA 3T1AA 3QNNA 3C6UA 3C6TA 3UIQA 3T3FA 3V4IB 4KKOA 1UWBB 2GIRA 4DS4A 3SJJA 2FJWA 1ZBUA 4DWIA 4FM1A 4FJ7A 4KRFA 1HPZA 1IKYB 1RBUA 1VRTA 1S6PA 1ASVA 4KFBA 1UOCA 1T05A 5J1EB 1QAJA 4QWDA 2OPSA 1NKCA 3V1OA 1TAQA 2P51A 3NFAA 4YMEA 3PW0A 4W5RA 2ATLA 3RBEA 4NYZA 1TKZB 4Q8EA 3L2RA 2ETJA 1T94A 4FZYA 1BQMA 2E6MA 3M8PB 3OYKA 3OL9A 1KLMA 4CGGA 1ZTTA 1NHVA 3TAFA 3PO4A 4FJXA 3ZT2A 3MTKA 4PY5A 1FK9B 4C8LA 4J9NA 2WRMA 3KJVA 4FJGA 4ZP9A 1T3NA 2LSNA 2ALZA 4NZ0A 3O4NA 1RTJA 4ECTA 3MR3A 3ZSRA 3AO2A 4C8NA 4MFBA 3PY8A 3QEVA 2FBXA 2QXFA 1LV5A 1Q9YA 4ED3A 1QSSA 3HVTB 4FLWA 4LH4A 1J54A 3CVKA 4LD0A 3V9WA 2HNYB 4MIBA 2R8IA 2FBTA 1B9DA 4AHTA 1SH0A 3LPTA 3MEDA 3QGIA 1KRPA 4KHUA 3MEGB 1TKZA 2XY6A 4DQQA 4AHSA 1S9FA 4FLTA 3I0SA 3NBPA 2CKWA 3NKYA 1WAJA 3ALYA 1WSFA 2D41A 2GC8A 1OS5A 1YVUA 3FDSA 2IC3B 2R2RA 4DSLA 4HVJA 5DG9A 2E4LA 3GYNA 2A1SA 2RN2A 1J5OA 3QEPA 4DSFA 3NGDA 4CGIA 1YTAA 4DLGA 1TK8A 3HK2A 4CHPA 3DLGB 1RTIB 4ICLB 4OGEA 3OYGA 5J2PB 2XY5A 2XI3A 4Q44A 4W5OA 3VA0A 5KFJA 1LWEA 4I9LA 3DRRB 3ITHB 3KHRA 4CF9A 4RW9A 4FK4A 3HJFA 3H4BA 4J9OA 2G8VA 3LPUA 1REVB 5JXSA 1BGXT 3FRZA 5KFTA 1BI4B 2DPIA 2I5JA 3KLHA 5F8NA 4G3IA 3WNEA 2HHTA 3C95A 1CSJA 4E1NA 4CK2A 1FKOA 4JRPA 1SKWA 3U6FA 4M3UA 4YFUA 1U45A 3ZSWA 2HMIA 2JEFA 3LP1B 3CJ2A 4RW6A 3MEEB 1DTQB 4M3ZA 4M41A 4O5BA 5C42A 1S1WB 4O4RA 3LALA 2KZMA 1C6VA 4ID1A 3EY1A 4MFBB 3CM6A 1JLEA 1RT1A 4EBEA 1RTJB 1L5UA 3FFIA 4RG8A 4IFYB 2E9ZA 4WFZA 4NLOA 4ID5A 1JLCA 1FK9A 2BDPA 4KHSA 4CF8A 4NYFA 2AWZA 4H54A 3Q8PB 4FCYA 4O3NA 4DL5A 3OYFA 4CGJA 1BL3A 1CZ9A 5F9NA 4TQRA 4J2AA 4ECZA 2JEJA 1XHZA 4FLUA 3CJ3A 3NMAA 5CY4A 3I0RB 1T05B 2KQ2A 3PX0A 2UVVA 4KFBB 1QSLA 4DEZA 1HMVA 4XIUA 2VA2A 4FLYA 1C1BA 3KK2A 4HUGA 1WSEA 4TY8B 3ZSVA 1DTTB 3QGHA 2OZSA 4H4MA 4X2BA 1S1TA 2ZD1B 5HLFB 3JSMB 4ZPDA 3M8SA 1RTHB 2AGOA 2V9WA 2WOMB 4NLRA 2OYQA 4NCGA 1QS4A 4R5PB 1WNEA 4MQ3A 4KHWA 3KK1A 4IH6A 3TQ1A 4OLAA 1NOZA 3LAMA 4FW2A 3OJUA 4M95A 1KTQA 4NLUA 5L1JA 4PWDA 5J2MB 3H5XA 3KLHB 2I5JB 3DRPA 5KG4A 3ZSOA 1WSIA 4ZHRB 4BDZA 1QSYA 2X74A 3RWUA 4H4OA 4YNQA 4CEZA 3DRRA 2IGIA 2X6NA 3LANA 2FLPA 3V1RA 1EETB 2J6TA 3AA3A 4OPKA 4IKFA 2QV6A 2OZMA 4FJJA 3VQSA 3SUNA 3N6LA 1RT4B 3HPHA 1TKDA 4NLVA 3D5MA 1HYZA 1Z4UA 5JS1A 4XO0A 2IM2A 2VG5B 1CXQA 5KG5A 1C2PA 4U7CA 3MAQA 2UVWA 4CECA 2YV0X 3MF5A 4LSLA 3JYTA 4YR3A 4OPJA 3DYAA 5L1IA 5DG7A 4CGHA 1IG9A 1S0OA 4IDKB 1GOAA 4O0IA 3M8QA 3OS1A 3PO5A 1JIHA 3MR5A 4EBDA 3TR8A 3ZT4A 3T5KA 2VA3A 1KVCA 1U49A 2X78A 4YR2A 2W9BA 1I39A 5HP1A 1XR6A 3T5JA 4H8KA 3O3HA 3HPOA 2A1RA 4YQWA 1S48A 1J53A 4CF1A 5KFCA 3IS9A 4B3OA 2JEIA 2FVQA 4DG1A 3OYJA 4KBIA 5FDLA 3LWLA 2OPQB 2B43A 4DSKA 2B6AA 5F8LA 1W9HA 1JKHB 2YKMA 3KLGB 2BR0A 4CEEA 2VWJA 1CLQA 3RAXA 4ZTFA 5KFBA 4OKJA 5JS2A 4KAZA 5KFUA 4CJ5A 4LH5A 2YNHA 3NE6A 4LSNA 2DPJA 3Q8SB 3H2LA 4CE9A 3MXIA 1BIZA 1NHUA 4ECWA 1S6PB 3THVA 4I2QA 1LW2B 2FBYA 3SQ0A 4PQUB 3VQ4A 3V4IA 3MR2A 4CK3A 2XRIA 3KKSA 1U4BA 2YNGB 3TVKA 4Y1DA 4RNFA 5EWGA 4IFVA 4M3WA 3LDSA 5KG1A 1HNVB 3H40A 3SI8A 3OL7A 4J9SA 1RDBA 4JUZA 1S1WA 4AILC 1RT6B 3O3FA 4KTQA 3MFHA 4O44A 3AA2A 3VQ6A 2D3ZA 5KT7A 4KAIA 4Q8FA 1WNSA 1A5XA 2KFZA 4HYKA 3LP2A 1JXEA 3DDKA 4HCBA 1GOCA 3TWHA 2ZQBA 2IJFA 4URSA 2ASLA 4K4TA 5KFVA 2XO7A 4IG0A 1KFDA 3ICLA 3CYMA 4KO0B 3OSNA 4B8AB 3AVIA 3HXMA 4KHNA 5KFZA 2RKIA 1L3UA 3V81B 1C0UB 1KVAA 3QESA 4DSJA 1ZBFA 4E1MA 1CZBA 1C1AA 4ELVA 1IM4A 1JLAB 2RPIA 4K4SA 4G1QA 5F8HA 5KFOA 1T8EA 4FJKA 3BQ1A 2IAJA 3FQKA 1W25A 1S6QA 1TL1A 4CCHA 4OKKA 4ICLA 3MECA 1BHLA 4J9LA 2D0CA 2HHSA 3CJ4A 4K4YA 5KFSA 5EU7A 2O4IA 3PZPA 1D8YA 2R2UA 2ILYA 4WYLA 3AO1A 2DTUA 4FJNA 4AHCA 2HW3A 1HARA 3NH2A 3QZ8A 3S3MA 1WSHA 5K14B 4O3RA 1IKWB 4IRDA 4MIAA 1ZBIA 1WN7A 1SV5B 2UUTA 2IDOA 3PW7A 1NK0A 2DFHA 2BRLA 3KLIB 4M3TA 5FROA 3H5YA 4E7IA 1Z25A 1RNHA 4CF0A 3T19A 2C22A 3IG1B 2YNFA 3QERA 4PUOA 4K4XA 1S5JA 2F8TA 4URQU 1NJZA 4ZVEA 1N6QA 3OS0A 2I1RA 2UUWA 5KG7A 4R8UB 1WSJA 2ITGA 4TLRA 4U6PA 3ISND 4CGDA 2B4JA 1FXXA 4F4XA 2C2RA 2F8EX 3TAGA 5L1LA 3IRXB 5E41A 4ZVHA 2ILZA 2BE2B 3IGVA 4NLPA 4IR9A 1RDAA 1NJWA 4RUCA 2OPSB 1Q9XA 2FLLA 5KFQA 2BGGA 3UDLA 1SH3A 5HROA 2BQRA 3MECB 2P1JA 4ZPAA 1B92A 3DLKA 2BANB 4CIEA 2IA6A 4HCCA 2YNIA 3PUFA 3CQ8A 1JLFA 2AX1A 4JV1A 4URGA 4B9MA 1SUQA 5KFIA 2J6UA 3ZSZA 4CHNA 5EWFA 3NDKA 4FJHA 1RBVA 4WE1B 4W5NA 3AVJA 2JC0A 1TVRA 3CO9A 4NLTA 1XR7A 3QNOA 3L2QA 2RDIA 4EO8A 2IM3A 4IG0B 3NGZA 3DLHA 4ELTA 4RNNA 4ECQA 4IG3B 4E89A 3K2PA 4KB0A 4CJLA 2FJXA 4ED1A 4CJ4A 2XY8A 2XCPA 5DLFA 3GIJA 3CDUA 4MK7A 1C0MA 4BDYA 2W9CB 2VG6A 4B9TA 2WONB 2KW4A 4DL3A 1LWFB 4OVLA 3V9ZA 2WONA 1LAWA 4FZZA 1C1CB 3T5HA 4CJ3A 5L1KA 3QEXA 5I42B 1SL1A 1N5YA 2UVRA 3U3YA 2OPRA 5J2QB 5F8IA 1IKXB 4BWMA 5KFKA 3RMBA 4WE1A 4Z4CA 1JXLA 4CF2A 3KLFB 4AH9A 4QOZB 4E19A 2BANA 2Z1HA 1JL2A 1X9MA 4ZP6A 2G8KA 1GOBA 3TANA 3RMDA 4NLSA 3Q8RB 1XC9A 4EBCA 1UA0A 4NLYA 3NAHA 4F4KA 3F9KA 1S9EB 4ED6A 1TL3A 2WHOA 4ZMMA 1LAVA 2HHQA 5KFAA 1U48A 3ZSXA 4ZVFA 2RDJA 4Q5VA 3V9SA 1JXBA 4IKAA 4O55A 4R8UA 5HBMA 1RA7A 4RW4A 1TKXB 1N6QB 4B8CA 5F8GA 4KB7A 4XPCA 3SFGA 1Y97A 4ECVA 2AX0A 4NLXA 1HRHA 4DFKA 4O4GB 3GIKA 4OL8A 4Y3CA 4TYBA 4F4WA 4K50A 3NH0A 4IBNA 1K6YA 3TAPA 4DFMA 4MKBA 4DQIA 1RT5A 2JC1A
chains in the Genus database with same CATH superfamily
3OHRA 4CHOA 4ED0A 3L3VA 1GMWD 1JMTA 3QT7A 2P5GA 1RACB 1K1SA 4YHHK 3C3LA 3V6DA 1P8ZA 3PLAA 2YKQA 3AO5A 2J0WA 3JSBA 2GV1A 4KV8A 2HEKA 3KHGA 1N8RO 1RHRB 3L2WA 1HBMA 2J0SD 2IMOA 2C28A 2CNNB 4IOBA 3BPDA 3B4DA 3DGPA 1WG4A 5EX5A 2HRTA 1XWLA 3MXMA 4KHMA 3S01A 2QA4G 3F73A 5H9FK 3CJRA 4K8RA 5KFYA 4AM6A 3CWJA 4H0TB 3WIUA 4ANDA 1H1VA 3M30B 4PG6A 2JVRA 1RT2B 2QEXS 3CPWM 2ASPA 3TZXA 4HT5A 2JHEA 3Q8UA 2V4JB 3R27A 4CJVA 3OW2M 1SIZA 4RW4B 3M6GA 2RJZA 2DHXA 1VRUA 1QQCA 1PCAA 5C25B 3CXCM 2AMCB 2BABA 2DHAA 4LFCK 4DU4A 3UR0A 2JGUA 4M5DB 2OP5A 1S3XA 2L41A 3PYFA 3RBXA 1Y0HA 3QDKA 1NJYA 2O8DA 3W64A 3MMCA 3GTYX 3DNCA 3CJTA 1U2FA 1JCGA 4U67Q 1K8AO 1KQGB 3M32B 1FD8A 3U7JA 4EI2A 1JJ2M 2OEJA 4EFAC 3VAKA 3H1VX 4UT4A 3RW6A 4Q45A 1FT8A 2VFVA 4FM0A 1VAZA 4EUVA 2I38A 3T5LA 2R7UA 4M3RA 1NWKA 3E01B 3LPYA 2WVEA 4JK7A 2BM1A 4RW8A 4IRCA 2NCKL 4CEQA 3PW4A 1O6XA 3GJSB 4JI1J 2FHMA 4KT0C 4GW6A 3WC0A 5LMUJ 3IMQJ 1LWXA 2Z1IA 2IOCA 3KLFA 2F7TA 4IEIA 3VGLA 3LDQA 2V4QA 3T7ZA 3ZEUA 2XBPA 4LFAF 4CLZA 1V9OA 4GVEA 3EM1A 1C0TB 3PVXA 2ZWPA 2DGSA 4OX6A 1G99A 3RRHA 1F21A 2BJ8A 3G6EN 1Q7YO 2LQ5A 3CCVN 2RRAA 5KGWA 2AJQA 4OZLA 1AFIA 3D2EA 3F0NA 1FJCA 3O8MA 1WTBA 5AE3A 1IJEB 1SC1B 4F2RA 1O1WA 2CRLA 4DPXA 1X8DA 3IR7B 4DTUA 1A6LA 3ZTOA 2HBKA 4P9SA 2FXUA 4CZGA 3OYDA 1WI6A 4TNOA 4AFFA 3HVWA 4DR6J 4A61A 2Y1RI 4USVA 4LF7F 3UI3A 3CPEA 3MEDB 1GMWA 1U26A 4LR8A 3ZETB 4DTXA 3FK4A 1W26A 3SSRA 4Y0FA 2JWKA 4HI2A 3L0QA 3HVAA 1N54B 3VGSA 2ZZNA 2OMOA 3D6HB 4ILGB 1BXNA 5FLXU 3TSPA 2UUAK 3BJYA 2RUGA 2WCXA 5C2CA 3KUHA 1EJ7L 3HT3A 4KI6A 1YT3A 1G1XA 5GIPA 4FBTA 3D2WA 5AQKA 3CMES 2BJ7A 4IO1A 3QGGA 3KLEB 2AW0A 4N76A 3CCQS 4M45A 1R0AA 2IS3A 5L9NA 3FZBA 2AGPA 4CESA 4FJ8A 4CT8A 4OV6A 3DI6B 4H5RA 2EC2A 5FDLB 4GV3A 2W2PP 3VENA 3OYMA 5KFRA 4W5TA 4ZJLA 3F56A 4FLVA 1JLCB 5BR8J 1VSEA 4YOVA 2GHVC 5C5JA 1WWHA 5LMNF 4HH1A 1TUGB 3W61A 1GLFO 2HNDB 2AEFA 4K8XA 2GBZA 3E9OA 2R7VA 3RR8A 4PYDA 4F2SA 2VBZA 3R2CJ 3UE2A 4DQSA 4CJPA 4C0BA 2J6SA 2DB1A 1HQ2A 4DCPB 3H08A 3UN5A 1HBMB 1RJJA 1FXLA 4O3SA 2F9TA 2JEGA 3M1VA 4KSEB 1TV6B 3P31A 3MPYA 4N41A 1VQKN 2WBRA 3GV7B 2ZOFA 4FS1A 3THPA 4DUTA 4NXMJ 1LWEB 1QVGM 2OPQA 1Y64A 3K7RA 1PC4A 5JVGQ 4ENOA 1E6YB 1U1QA 2VU5A 2E20A 3ULEA 2V2ZA 1GTEA 2PA8D 4PKDB 3G10A 3M8ZA 2FZKB 4BR0A 3VETA 4BACA 2F9JA 4PG8A 5KFFA 3U4LA 1X9SA 4P6QA 5GIOA 2NSCA 2XMAA 5AE2A 5CCMA 5SZTA 1N48A 4CJWA 4IRKA 2M8HA 3DRSB 2HVIA 1R8BA 4NYPA 2U1AA 2YQ3A 3ATUA 4CGFA 1N56A 3ASMA 2W4CA 1IKWA 4C4WA 3BGUA 1T03B 3I6PA 4DU7A 5D0GA 3L4QA 4CT9A 2WSCC 2AHOB 3RB4A 4ZKAA 3HHLB 2CVIA 2VPXB 5HP1B 4UOGA 2HHXA 3EYZA 3NH1A 1CJVB 3KG1A 2XWYA 3HSTB 1FRMA 4ISGA 2CFXA 3C65A 1EKSA 3OYNA 2MZSA 5GAHP 2K3IA 3ZT1A 4NA2A 4C8MA 3UD3P 2K06A 4ZVGA 2KYXA 4HHHA 4K0KK 1CQMA 3CDEA 4MK9A 3CCRS 2BKPA 2PEHA 4QIGA 2F63A 2V94A 5J2MA 4IO9L 4OZ3A 1BCMA 2FDNA 3PYEA 3L2UA 4DR5K 4L3KA 5E5NA 3A5LC 2BQUA 3FFIB 2ZFHA 1X9JA 3AY9A 2B4UA 4NCGB 3HX9A 3AVCA 3MUVP 3SUOA 5LT5A 3S9HA 1ITPA 1S1TB 4A48A 4KE5A 3V81A 1L3TA 1ZPWX 3GLJA 4DTNA 4IH7A 2EC0A 3TABA 2FHJD 4I2PA 2UUAJ 3FVYA 3JS6A 4LF4F 4CIFA 1LQ9A 4U7UK 4FWMA 3H5SA 5ETNA 4R5PA 5C2DA 4F4AA 5HO4A 1X4GA 4BRHA 5ETQA 3O9RA 1WJ9A 4NRTA 4X4OA 3G6XA 1AZSA 2GX8A 3FNNA 3ILJA 2QT7A 1ZAXA 2DNOA 4CO5A 2R7OA 4QU6A 1R8CA 3SCXA 3W9JA 1VSMA 4TY8A 5KT5A 1Y3KA 3K8VA 2IJNA 1QUPA 3DLLQ 4YORA 4WK1A 2UUBJ 2HPUA 2ATQA 5BREA 4LFAJ 3PEJA 5ETRA 2IRYA 4ZVSB 1Q79A 2BE9B 2W8KA 5B0GA 1K8KA 2R8JA 4YS2A 3JQJA 3AT1B 2E1PA 3U1LA 5DS7A 1VC5A 3KDOA 2J0XA 4U8YA 4F04B 4J9QA 1NGAA 4E8UA 3MURP 3HULA 1BWVA 2W9CA 1HNZK 1GMVA 4UY8O 1YI2S 3PIOQ 3SUQA 5KRTA 4IG3A 3FFKB 4NMLA 1YLXA 3ET6A 3IO1A 4X62F 1NK8A 4G1QB 4DI6A 2X1BA 2C3PA 1M0SA 2C3MA 5CH7B 4NZ6A 4RNHA 4CDIA 4OHZA 2I7NA 1IH7A 4QCLA 2EFGA 2RB7A 2HQGA 1NK9A 1XERA 1KAZA 5J1EA 4KTWA 5AZIB 1YBTA 2UP1A 3AAPA 2RVJA 3BF3A 1IKYA 2GVDB 2J7UA 4CEBA 2LMIA 1HPZB 3MWPA 4GO7X 4JAXA 1UAXA 3GILA 3B6PA 3IWXA 2NXEA 4FWKA 1ZZNA 1RTHA 1RLCL 2BE7D 1KSPA 3D1OA 4IFVB 3NNAA 1TKTA 1SS6A 4ZA1A 2PYJA 4BGBA 3RBDA 1RCHA 8ATCB 3VEWA 4MDBA 4LMZA 3KK2B 1FRKA 5AZJB 1KCFA 1FI4A 2KFYA 1VQ9N 4A8XA 2ZVSA 2Q1LA 4JI8J 1V5IB 3GB0A 3GQCA 1S9GB 5IQ6A 4X64K 2GMLA 1VJQA 3F41A 4FXDA 3A8JA 3OBIA 1HHSA 1CJKB 2ROPA 4UW2A 4NLWA 4C3MA 3MN5A 2OAUA 3KJVB 4CJEA 3EKUA 3QLHB 1F6TA 1N5QA 2EVZA 3B54A 5KT4A 4CBXA 2D0PA 3A8YA 3EGWB 5CZ1A 1FERA 1WLJA 4KGKA 1L3VA 5LMUK 2J7KA 3H7HB 4UF4A 2Z1GA 4CJRA 3ELHA 3CDWA 3KXDA 3PIPQ 3E2EA 2DNRA 1LCUA 5IT9Y 4IOAQ 4KHPK 2R7SA 1KLNA 3NCRA 2QE5A 1FRIA 5A8WB 4B3OB 3J7YP 2UV8A 3BP8A 2Z2ZA 1RAEB 4NLDA 3HO1A 3SAGA 4PYAA 2OPPB 2ZHOA 1V4TA 1TKTB 4LF9J 2DEJA 4P73A 4RW9B 5HJXA 3MR7A 4L73A 4YDDB 1LW0B 3CHWA 2YWFA 2VBYA 1JLFB 2HB5A 2PFFB 3OXLA 2KT5A 1IKVA 4JV5K 3LZIA 2BKNA 4MAKA 4WZQA 1HHTP 3C7NA 4WFBL 4AHVA 2GMJA 4JI4F 1UMJA 4B9SA 1NLVA 3KK3A 4HUEA 1MMLA 1YJVA 1CPZA 4RX6A 2B6AB 1D9FA 1LXNA 1X1PA 1RZMA 5FPMA 3FZHA 2D7SA 4I7FA 2GVZA 2NRXA 1HD0A 1U2RA 1REGX 4CHQA 2NPFA 2UU9J 2YNGA 3P5JA 2XZDB 2Y1LB 3LF0A 2YX6A 3FSIA 1RAJA 3QO9B 2QMXA 4N56A 2WB4A 3IAYA 4U7BA 4PR6A 1EAYC 5BYQA 3BGRB 2H1YA 3H4DA 4DS5A 1MWZA 3V1QA 5ETTA 2G8HA 4WWSA 2V8DA 4NLBA 4L3QA 1RT3B 3L6QA 2C3YA 3R5CA 4H5VA 3LM2A 3NF9A 3R6LB 3OFFA 2IPOB 2MQLA 1OJ4A 3QB0A 4NLGA 3R5JB 1RDUA 1S1UB 2HRYA 4LRCA 3FZ2A 4C6AA 4DSEA 3WXIA 4FW1A 4WYWA 1SQKA 3S3OA 2CQ3A 2P9NB 1ZC6A 1XNRJ 5IT9O 3QRQA 3TAMB 4M3YA 1FXDA 4EO6A 2ZE2B 5JMNA 3Q23A 1HD1A 3ENQA 2IDLA 2VFUA 3GSIA 3PFOA 3IWNC 3A8KA 3WT0A 1D5AA 2KM8C 1G2EA 2ZBRA 2LA4A 1N5VA 1MU2B 1WC5A 1RBSA 4YOTA 4MH8A 4ERDA 1RWNB 1NPRA 4NOHA 4X66K 1RDCA 1SJ4P 1MWKA 4JYAF 3O9TA 4E2FB 4IWVA 1QDUB 4P10A 4KGVB 2X7IA 5CYMA 3JYTB 2ZDPA 3CCSS 2PYLA 3GV8B 1HQUA 4LF6F 2W41A 2DGWA 3JXUA 1U1OA 2K2PA 5T41A 2XMVA 3RMCA 2I9SA 4TVAB 4XAKA 1GXTA 4DQPA 3VAMA 2M7SA 3H3OB 3TU5A 5FRNA 1AUDA 3AGKA 4EMDA 5J2NB 3CD6N 2M2BA 1CJVA 2DH8A 3SPYA 4DV2J 1YJWS 5DRKA 4KH6A 3NAIA 3IA0A 4F50A 3AARA 4H5TA 2CZVC 5A76A 2H5EA 4I6MA 2RNEA 1JX4A 2G0JA 1SJQA 2FJVA 3MPUB 4QW8A 3DDNA 5F41A 1PILA 3OR2A 2UZAA 3BREA 4FYYB 3VV2B 1X7VA 1WSGA 3W3SA 1DY3A 5ETOA 1DGKN 4X4PA 3UKRA 2WB1D 2OTLN 1X4FA 1BCOA 3THXA 3BH7B 4C11A 1NGJA 2Q6BA 3B8HA 1Q95G 5HRRA 3SQGA 3SFUA 5DETA 2HFZA 2IAJB 3N79A 4QWCA 1MA9B 4QIVA 1B99A 1I94F 4M8LA 2C2ZB 4N5SA 5HRPA 2F8SA 3NF8A 4NX9A 3G86A 1R7IA 2Q3SA 4ZJQA 1TV6A 1ZETA 1VQYA 1TAUA 4IH5A 2B3TB 4ISFA 5AFUA 2J4RA 4BC2A 4FPIA 1P9QC 2ZE2A 1TZ0A 3QINA 1EP4B 4MK8A 2GA7A 3BBCA 1XMQF 3KFWX 2V67A 3HMJG 1Y10A 3E66A 3K0SA 1Q4RA 2R8GA 1U0SA 2LDIA 3SMPA 4YP3A 3MN6A 2EBEA 1VBXA 2RSQA 1S6UA 1GLBG 3C6UA 1OSDA 2VF3A 3C6TA 1HBUA 3BBFA 3GFXA 3SDEB 3T3FA 3V4IB 2E88A 2QWPA 3GG4A 2FJWA 4FM1A 4FJ7A 2FYXA 3NVMA 1DARA 4ILRA 1VRTA 2V51B 1S6PA 1ASVA 1NGEA 2EFVA 1Q86O 3VTHA 4QWDA 2ZM6K 2P51A 3W2WB 2ZH5A 3NFAA 4YMEA 2KHOA 3PW0A 4BR7A 2ATLA 4K0KJ 2IBOA 4FPRA 2EFQA 4HHUA 3NS7B 2ETJA 1JJHA 4FZYA 2Q66A 4BRMA 2VUGA 1KLMA 4C23A 3TAFA 1NHVA 4FJXA 1S72N 5BN9A 3PIPL 2WRMA 2ZBQA 4ZP9A 2IRXA 1RTJA 1VDHA 3OW2R 4P72A 4JKAA 1VQ7S 4EWTA 4LRDA 4K2XA 3UO0A 3PY8A 4DV3J 2ZWHA 2WTUA 2FBXA 1LV5A 4FLWA 2QC3A 5THWA 2G2OA 3M2RA 2HNYB 2QMUB 4MIBA 4AHTA 3OFGA 1CS4B 1SH0A 1HHQA 3MEDA 3ILOA 3QGIA 2K7JA 1B7YB 1Q81O 4KHUA 2LYVA 3W5ZA 2AJ1A 3Q24A 3PRDA 4YB7A 3C66A 4WYBA 3AY0A 3W60A 5SUHA 2KYZA 4LR7A 3AAQA 1NBEB 2E4LA 2A1SA 3A1YG 4OI4A 2FF6A 3HHLD 2PT0A 2Z4PA 4DV0J 3TTCA 4OIXA 1RKJA 3FSXA 4LRBA 2ZBIA 1HNWF 1RTIB 2JFDA 3OYGA 3DAWA 2XI3A 3SQGB 2PMHA 3D6MB 4I9LA 3DRRB 3ITHB 4RW9A 4PRFA 3DLLL 3HJFA 3H4BA 2M8DB 1URNA 4J9OA 1XMOF 3QGPA 3TRGA 5JXSA 5KFTA 2VODA 3M2VB 2GIFA 4M63A 3WNEA 4G3IA 2KI2A 2E1MC 2BOPA 1XUPO 3GG0A 4YFUA 2ZVIA 3ZSWA 3S6EA 3VEOA 3PSFA 3GFYA 3MEEB 3LA0A 4EAHD 4O5BA 1T02A 1UJ5A 2DEIA 1OY8A 4ILHA 2E5LK 4DUYF 1RT1A 3CJ8A 3PCOB 5H1SV 2M0GB 2MQPA 4RU2A 3EXYA 3C2PA 2EBGA 1FK9A 5TKWA 3W9IA 1NH7A 1P27B 1UWAA 7AT1B 4KHSA 1PJ6A 4CO0A 1KAXA 4RPFA 4FCYA 3SLCA 3OYFA 4CGJA 2ZUGA 1BL3A 2FHJA 1NZAA 2W25A 3UN3A 2F3JA 2BOAA 2MHNA 5FJ4A 4HEA9 5DDPC 1QSLA 2DGVA 2GJIA 4JKCA 4JK9A 3KK2A 5A6WA 3ZSVA 2ACYA 1T3VA 3Q0AA 1DTTB 2QRRA 2OZSA 4DV6F 1VISA 3W5XA 4ZJOA 3H42A 5LMNJ 5GAEI 3G82A 4JD2B 2PC6A 3ZLJA 5GAEU 1RTHB 4CBUA 2ZOMA 2WOMB 1C4CA 1IWGA 2OYQA 5L46A 1QS4A 4D3HA 4IH6A 5KPTA 4OLAA 4OI6A 3VF2A 1FTCA 3J81O 2HSEB 2V4JA 3CMQA 1XN9A 2GVDA 1ELOA 4NLUA 4PWDA 3M30A 1WKKA 2IVOA 1HW9A 3DRPA 1UJ4A 3GIRA 2CQDA 2R7QA 1FNXH 1WSIA 1R59O 4BDZA 2X74A 3RWUA 4YNQA 2CXEA 3LANA 1E6VB 2UXCK 3BGLA 1JJCB 2QV6A 3SUNA 3GG1A 4K42A 3HPHA 3T1YK 3ET6B 4WK3A 1FNMA 4U67L 4FWOA 1HYZA 1AB8A 2YHXA 4OLOA 2W6KA 5AQGA 3UVJA 2DNNA 3MAQA 3MD1A 2XZWA 4J8FA 4A8MP 4LF1A 3JYTA 4YR3A 3DYAA 1FVSA 1YQHA 3GMGA 1GOAA 1NRKA 1KTVA 2IVMA 2JLGA 2XSJA 5KPZA 2N82B 1TTHB 1WEYA 4BR5A 3OR1A 5LJ3Y 1YBUA 3IKMA 3T5JA 3L7OA 5HMZA 2A3ZA 4OLPA 2YQ0A 3TNVA 2BJ3A 5GAHU 1RP5A 1Q7LB 1TFYA 3QAEA 1NG9A 2OGUA 1S59A 2ZHAA 2B6AA 4CBWA 4ZVTB 2AJ4A 2AEJA 2VWJA 2HGNA 1CLQA 1PYSB 4OKJA 5JS2A 1M90O 2NUUG 2XO6A 2YNHA 3BEGB 3NE6A 2ZJQL 5E0OA 2DPJA 4FP9A 3H2LA 2P9IB 2P9EA 4PXEA 4JKDA 3THVA 2FBYA 2A2CA 3SQ0A 3KK7A 3VQ4A 5AQLA 3P45B 4LC9B 2GCFA 2N4DA 5IM0B 3NXZA 3P5BP 1WI8A 3UFCX 3TP2A 4QJVA 1RAAB 2CPZA 3I82A 5KG1A 1RDBA 4JUZA 2GZOA 4AILC 3P6YC 4USMA 2M3DA 3N4QA 2YTCA 5KT7A 5IFMA 1VLOA 1WNSA 5A8WA 2KFZA 1DEJA 3MX5A 3PRVA 1GOCA 4LBHA 1TMMA 2ASLA 2HGLA 2CQ1A 2UXCF 5KFVA 2XO7A 4IG0A 5KQDA 3ICLA 2GQ2A 4AL7A 3OSNA 1SB6A 3SEOA 2DYAA 3HXMA 4BRAA 5KQ8A 3CDAA 5B0CA 1C0UB 1KVAA 3IAS9 3GCWP 5FIIA 2HOEA 4E1MA 4CLTA 3GDQA 1QAXA 3G4SS 1JLAB 4K4SA 1EO1A 5F8HA 4FJKA 2ZC4A 3FQKA 2O8FB 2GAHC 2OTLS 2P6TA 3M2UA 4JKHA 1W25A 4ICLA 3MECA 3A5NC 4W90B 2LKZA 2HHSA 5KFSA 1EX8A 2O4IA 5AJ3F 4C7QA 2R2UA 2QSFA 3VCDA 2DTUA 1OY9A 2DRBA 3ZX0A 1AUSL 4ZIWA 1KQSR 2HW3A 1HARA 3NLCA 4XH5A 3QZ8A 2VBXA 1FRLA 4IOXA 1WSHA 2BV3A 1IKWB 4KYZA 3W0LA 4DR1K 4NL5A 1WN7A 2DR6A 4G65A 1FTRA 5HVHA 4LVOP 1C0GA 4J91A 3PW7A 5AXNA 4TU7A 3KLIB 3O2IA 2CQ4A 5FPDA 3J80U 4E7IA 1OWXA 1W2IA 2WVFA 3C14A 3RU0A 4FKYA 4CLWA 3KUGA 2HFVA 4FKXA 4URQU 3FBBA 3THYA 2OTJS 1WUUA 1XNQJ 1KWMA 2OCEA 2UUWA 4GVBB 5KG7A 4DL0C 1WSJA 2ITGA 1VQ4S 1GLAG 4U6PA 4CGDA 2VQFF 2HZCA 2F8EX 2GQCA 5CR4A 2PFDA 2VQFJ 4JI3F 4JK8A 2KKHA 2MLZA 3MCOA 4OYOA 2BE2B 1RDAA 2OTJN 4FXWA 3MPWA 2FTRA 3H90A 1V6HA 3DLKA 2BANB 2IA6A 2RQKA 2YNIA 1S57A 2DXDA 5KOXA 5BJRA 2JL9A 2CYYA 4URGA 2HS3A 1SUQA 5KFIA 4OX9J 4A2AA 4W5NA 5IS2A 2QO3A 2C42A 2O8CA 4PXDA 4B17A 3CO9A 1HPMA 1R43A 3QNOA 2NQPA 1M1HA 1EQYA 1EIYB 4RNNA 4ECQA 4IG3B 1KOOA 2FJXA 4ED1A 3KG4A 2QA4S 4DR2J 4FWQA 1X4DA 3HFZB 1GT8A 5DLFA 4MK7A 3I31A 2W9CB 2KW4A 4DL3A 1LWFB 2QFIA 2KLAA 2DTJA 2WONA 3UCZP 1DRZA 1LAWA 2AYGA 4FZZA 5LJVA 1JQGA 4OX9K 4I69A 3EE8A 3C8YA 5HAOA 4KR0B 2V69A 2QLFB 4B3RJ 1N5YA 4B1ZA 5CD4H 1BDGA 4MKVA 4OX9F 4OHVA 4WP8A 3N28A 4C3KA 3ETMA 3TX8A 3ILLA 3T41A 1ROFA 1BO5O 1GOBA 3UD4P 4NMXA 1N34K 1UA0A 4F4KA 3MCSA 5CXTA 4MKYA 1MSWD 3CXCR 3OT9A 4NI2B 4ZVFA 1X0PA 3RUBL 5A2QY 3Q2SC 1FRXA 5HBMA 3GOIA 1TKXB 1D3WA 4B8CA 2O01C 3VAGA 4J90A 4M5KA 1IBKF 3SFGA 3OTOF 5DJBA 1YRXA 4PZVA 4O4GB 4Y3CA 3UN2A 3LPEA 1VQ8S 5K20B 1OSCA 1Q8KA 1UVLA 3TAPA 1NU0A 2B7BB 1VQSA 4GV9A 3CD6S 5IOLA 2HQFA 4QYZK 4B3TF 1RT5A 3L2VA 5CZ2A 1YVNA 3AOBA 3D2EB 1X4AA 3VEVA 5KFGA 1Q78A 2FJDB 2ZKUA 3M9MB 4C8ZA 1RE1B 1XTZA 3CC2S 5DQHA 1T9XA 3HI0A 4J2DA 4I4BA 1RHJB 3MDFA 3HKWA 3ENWA 2VB6A 5MLCQ 4ED2A 1AFJA 4Q43A 2DKOB 5K8NA 3SQ4A 1RAIB 5B7WA 3D28A 3UWTA 2G0IA 1B9FA 4JI4J 3WXKA 2PMZD 1B0VA 4ILJA 3CCSN 1H74A 2MKCA 2XS2A 3OTCA 1JJ2R 3MM7A 2ZH6A 5JLHA 1T9VA 4ZOSA 2UYTA 4RKUC 2V7ZA 4M5GA 3HSZA 1Q5VA 4HLBA 3M3ZA 4ID8A 4A47A 4UTGA 2Y1JA 4I67A 5M1OA 1Y00A 1HNWK 2CWKA 3NNCA 1OVYA 5HRSA 5BR8F 2E7VA 3R5DA 2RUSA 3Q86A 9ATCB 2A1BA 4CM2A 5AQSA 2ADCA 1E3MA 5I3UB 1TK0A 3OUYA 3A8EA 3BZQA 5A8RB 1GLDG 4G1PA 1PBAA 1FFGB 2KRBA 4UQGA 3VQAA 2VPZB 4Z4IA 2MY8A 4Z4HA 4O5FA 5DO2A 2GHPA 2MLYA 3I0RA 4I0WA 1HBNB 1RCOB 4OX8A 2A42A 2BUPA 1VQ5S 3JAMU 2WFBA 3NCPA 3MUTP 1BLUA 4X66J 3IRXA 3RB3A 3AA9A 1RSCA 4DL7A 4FJIA 1WC6A 1LWFA 1RDWX 1PG5B 1PSDA 1FEEA 4EGLA 4QS7A 1RT2A 4R0EA 5D4PA 4J9MA 2W9BB 4N8OA 4F4YA 1XI1A 3KTQA 4OJGA 4GVMA 3P1GA 3WEEB 3RR7A 3VGKA 2HFUA 4KBOA 3PJ9A 4C8OA 1SZ2A 1OYDA 1T03A 4PKIA 4J9UE 1KC8T 3NWRA 2ZEJA 2GMHA 3K57A 4KV8B 3ZZOA 3U9DA 4NO7A 3AVAA 2R4FA 3E9PA 2QWOA 2O3DA 3D3CJ 3UE5A 4RLEA 3THWA 4BR4A 4OHXA 2UXDF 2DXEA 4LRFA 1TL1B 1OKJA 3DRXA 4LF5K 2Q0UA 5IXUA 4B9LA 2CJXB 1FRHA 3UKUB 4DLEA 3D3BJ 2OO4A 3CD7A 4OI2A 2CJQA 5EHHA 4PCQA 4ZIVA 3BEXA 2EK1A 4CW7B 4WJBA 3AO4A 1TYQB 2GO8A 4TYAA 2QKBA 1KDNA 3C14B 4YOWA 5E3CA 3CIMA 5AE1A 1Z26A 2YI1A 3I0SB 1LWCB 3KYLA 1FE0A 5D15A 1S72S 2P9LB 4FO0A 1LOTB 2K8GA 3B6OA 4FK0A 3CJAA 4H0YB 3N9UC 2GWJA 5JUMA 1IVZA 3QBXA 5M1QA 3I8DA 4DR2F 3ZTQA 4CJFA 1VS3A 3P39A 2I7PA 1PJ7A 1R6YA 5C15A 1ZZFA 1FDAA 3CJKB 2NRRA 8AT1B 1OY6A 1BC6A 4DSIA 3DLKB 2KXHA 4ED8A 2FSNA 2XI2A 1JLAA 1JLBB 2L9DA 3OTDA 4QWEA 2FGCA 4PA1A 3RBZA 2CPDA 4ECYA 4J2EA 3GV5B 4K5SA 1J9AA 3G0ZA 4RO0A 3AH6A 2K1RA 3DI6A 2DHGA 4FF2A 2FGOA 5LXYA 1RWXB 2WC9A 4LF2A 3EDQB 1ZM4A 1ZBLA 1Z1ZA 3NEKA 2WVBA 5HMXA 2HQCA 1Y4ZB 1KN6A 4JRQA 3AVNA 2GFFA 5BXIA 3R5GA 4Q0BB 4FVCA 3FE1A 3ILIA 2C1EB 1S99A 3QYYA 3DLEA 2QL5B 5KTQA 2HBMA 3MWBA 4OFZA 5IM0A 4Y2AA 1DTQA 2MKKA 1UPMB 2OPRB 2L08A 1S5ZA 3OL8A 3EVMA 4K0KF 1IQZA 2LVWA 5GAGI 4X66F 2CJKA 1IBCB 2KHDA 2CNOB 4RBVA 4KY3A 3GZ7A 2E9RX 2VC1A 3RGIA 1DQ8A 3B78A 3NWGA 2ZJPL 4DMZA 1BQXA 2O8EA 3LGHA 3PX6A 3OHBA 5BR9A 4K4ZA 4H5WA 5FD1A 1G6BA 4FJ9A 4K4VA 2XC9A 1J5EJ 2Z2YB 2H3EB 4JP8A 4DV1K 4RR5A 3KD1E 1QJHA 3G2XA 3BSAA 4WFAL 3VGUA 4M42A 3CCLS 3M9OB 2ASDA 1D1UA 3EWGA 3DOKA 4ZP7A 3CIZA 4DX5A 3KVGA 2F8HA 1U8WA 2NXNA 1H72C 3WQPA 5HRNA 2M9KA 2QWRA 1RHMB 2LU1A 1QLNA 4MKAA 3AVKA 3AXMA 3BO4A 3TPQA 4O4GA 2HFNA 3DC2A 1YIJN 2MQNA 2D0OA 3TUPA 2ERRA 1ATRA 3O9UA 1IO2A 3M9NB 5HBMB 1T3OA 1A5WA 4WFYA 2MDAA 3IBCB 3HZGA 3CQXA 2WVCA 2H4YB 4HTUA 4DPYA 1SKUB 2JWNA 1UVMA 1VSFA 3ULDA 1I3AA 1IJJA 2BJ1A 1RK8A 4BQLA 1X4EA 5KG6A 3EL2A 2EKYA 5LMNK 4I1TA 3J8AA 1JLEB 4A62A 4JKGB 3OR1B 5B0AA 3MMCB 2PFUA 4A5AA 4OI0A 4XH1A 4DB3A 1YWXA 2WUSA 1BE4A 3AVGA 3C6AA 3VQBA 3DLJA 2PDAA 4YB5A 3SQ1A 5ADXH 1WHVA 1WBDA 1M1KO 4O8KA 4CJ7A 4CH1A 3VQCA 1VCTA 4QIWD 2XHCA 5AQPA 2VOOA 4PKHA 1RQ0A 1DLOA 2KJWA 3PJWA 3S8SA 4Z0UA 3AOCA 4C1NK 3F2KA 1VQ7N 4H5NA 1QE1B 2GAGC 2V0NA 4OYIA 4HDHA 3NGIA 1JLGA 1RAOA 2O8CB 5I4MA 1NCLA 3SIPB 4ZTJA 5CA5A 2EFOA 2BBEA 4DL6A 2HIQA 1SC6A 1LW2A 1FW6A 4FPBA 2HZVA 4DR7J 2VQFK 3B6BA 1MWMA 4K4WA 3H46O 4FM2A 4OI3A 5LMUF 3RW7A 3ZZUA 5IWAJ 5KFMA 3GIMA 4M7XA 1Z2ZA 3CM5A 3BKTA 1ATSA 1X4HA 4LQ9A 4ZPCA 3OYIA 4BDPA 2I2YA 1VSIA 3TUJC 1SQFA 1VC6A 3HHLC 2Y8WA 3CCJN 5BPNA 3DCAA 2IIHA 3LW5C 2BQ3A 4DQ8A 1MN9A 2ZH1A 2IYIA 4CEFA 5HVFA 1K1QA 2E9TA 2VDIA 2WOMA 4ID5B 2P9KB 5AQIA 3OSPA 1NMDA 3DOKB 4AQYK 3JSYA 5CHIA 4AUKA 4Y1CA 1O8BA 1Y11A 5CQGA 4E3SA 3M7VA 3DOLB 2FUG9 4OHWA 3ZT0A 2APOA 2G2YA 4CH0S 4RW6B 4QZVB 4KC5A 1BQMB 4Q7AA 2ASYA 3M6VA 3RRKA 4H4OB 4KO0A 4J9RA 2CDRB 1H0HB 1HLWA 4WTOB 3J7AN 2Q79A 1NPPA 1QQNA 4E7LA 3VQ7A 3BN7A 4CFCA 5HN0A 4IJNA 1HYSA 2GWKA 3KK1B 2FY8A 2OANA 2BACA 2CVEA 2HHUA 3VMFB 2WTFA 5EY4A 2P2CB 1H98A 2YWGA 3TI0A 3DLGA 1RT7B 2XMJA 2B7CB 4DR5F 4PQAA 4PUOB 4JI7F 4RBTA 4ED7A 1RBTA 1HNXF 3MCPA 4J2BA 4OZ5A 3BR8A 3PX4A 1VQLN 4BS2A 1VMBA 4NB4A 2W7PA 4GNIA 3GJRB 5IV3A 1JKHA 2MEWA 3MHYA 2EKNA 4DPUA 4JI1K 2QLBB 3O4WA 4RW7A 3K59A 2E5LJ 3TARA 1P9YA 3JQMA 5KFXA 1I6JA 1RWKB 4B1VA 3V6HA 1NDCA 3MX2A 4B9VA 4DR7F 4BG8A 3CJKA 4C0OC 2CH6A 3DMJA 4DUZJ 3CJSA 1YJNS 3ZYYX 4NA3A 1IXKA 3U3GA 1H7XA 2MGZA 4IXCA 1T9TA 4CFAA 3NHGA 4OHYA 4AXIA 5CCLA 3D0GE 2DFEA 2RQ4A 3UDCA 3CT9A 2EI5A 1DURA 1NK6A 5KFHA 5BYRA 4F3TA 3KJQB 2UVUA 2NRVA 3FZLA 4HUFA 1XK8A 3A8IA 2PD1A 4Y6IA 5F8JA 1NU4A 1HNIB 1TYQA 2FVSA 4LF4K 5I3QA 4HKQA 3D9BA 1HQEA 1EXQA 3DYAB 3I32A 4EFHA 3TVYA 3V9UA 1V4SA 2VL1A 4BC9A 3THXB 1NB2A 1KP6A 2HVHA 2LU2A 2AU0A 3THWB 4FVMA 2O4GA 5T7BA 3OLAA 1VRTB 2XYPB 3CMAS 3EN9A 1WSVA 1VSKA 2M52A 3M05A 5EXWA 4CD3A 4FZVA 1YX2A 2HQ3A 4YDUC 4CIGA 1U6ZA 3C6UB 3I5CA 2Y1IA 4OQJA 3I55S 2FVRA 3J7ZO 4D3GA 2RKIB 4OZ1A 3CIPA 3DRYA 3IG1A 2RS2A 3D2FB 2XLKA 2FVPA 4KJIA 1EP4A 5H1SQ 4JHDA 2FF3B 3X1LB 2J76E 3OFHA 1EKRA 1VSHA 1DBDA 1Q7YT 4DF4A 1HWKA 2G4BA 3GFHA 3HVTA 3RTVA 1VQPS 2RH3A 2AT1B 2UUCK 1FX2A 2Y0SD 3K5OA 1HQUB 3HD1A 4ZS6A 1YVFA 4FNIA 5LM7E 1U0HA 1N5TA 4DR5J 5LL6d 2RD5C 2Q36A 1W7AA 2A6MA 5M1PA 3OV7A 1NNDA 1Q82O 4LSNB 2A40A 2W2OP 2DGTA 1QHAA 4CYUA 3VGTA 4UOCA 1YIJS 3KOAA 2ZITA 1KFSA 3CJCA 3HPGA 3D0IE 2LQBA 3L7UA 3VWSA 3OR2B 4QQBA 4JHDB 5C2GA 1GLJO 4X64F 2BVZA 4JLHA 3A3NB 2KFNA 2QA2A 3J7YI 3D45A 2ZC3A 4DV5K 1EZZB 4O3PA 3E51A 3CUNA 2HZAA 3PYGA 4EYHB 4A8SA 1S1UA 3AHPA 2AV5A 1Q5YA 3MM7B 3J7A1 1VQNS 3LP3A 4BG9A 1HW8A 1LNQA 3GSDA 1QD1A 2H9ZA 2AJ0A 5HROB 2HVDA 2FLNA 4J5OA 4LIWA 4RCHA 1WAFA 4M5MA 1HWUA 4QBUA 1FA0A 1U09A 2MKYA 1J6ZA 3DXMA 1YK9A 3EO3A 3BO3A 4CJUA 5DLGA 3SCKE 1NK4A 3I5BA 4JI2F 3TZYA 2QSWA 5HLFA 4JI2J 4YOUA 4F25A 4WXWA 1ITGA 3HL8A 2P5OA 2HBQB 2RE1A 1RGVA 1NGGA 2F65A 4KREA 2AYEA 4LF8K 2FD2A 2DNHA 3OTEA 3EGZA 2R2SA 2B4VA 3IP0A 4H0PA 3TAMA 4L75A 1KD1O 3ZZRA 4CH7A 3GJQB 4M7YA 2GNKA 4KH0B 5M2RA 4BWJA 3QFPA 3TSQA 4CLYA 1NAQA 1B3TA 1YSJA 1S4FA 2QA4N 1VSJA 2AJ2A 4RW7B 2DRAA 2HHPA 4NEYA 2PN6A 2LP4A 5GMEA 4A59A 3J7YU 2Z2MA 1RT3A 2KT3A 3D66A 3CCEN 3V5RA 1KKHA 1S0MA 2J7WA 4BLGA 2HHWA 2JJ4D 2Y8YA 2HS0A 4K5RA 2OA8A 3KHLA 3LGNA 3OY9A 1CBKA 4IQXA 5D3GB 4GRSA 3HI9A 1XMQK 4X65F 4OI1A 2MZQA 3PR5B 2Z8QA 4FJMA 3CG7A 1RT6A 1Y5IB 4ECXA 2JLEA 4I7FB 3P83D 2VQEK 3C16A 2AIRB 3QEIA 4BRQA 3GWCA 4XDCA 3W65A 4FF1A 5GADU 4KKOA 1UWBB 4DS4A 2D9PA 3O5TB 5GAGP 3U27A 1RBUA 3Q89A 3AOAA 2UXDJ 1H38A 1T05A 1QAJA 5GVQA 4CLPA 4CYUB 4W5RA 1WACA 2OELA 1TKZB 3BF1A 3KUEA 1BQMA 1K9MT 1U1RA 3M8PB 3OYKA 2OSRA 3HSJA 2VWBA 4C8LA 4J9NA 5IC6B 3VEYA 1T3NA 2LSNA 3O4NA 4ECTA 1U1LA 1WORA 1U0HB 3R1XA 3HHEA 3ZSRA 3QBWA 2ITMA 3AO2A 1ZH5A 1F9HA 3QEVA 4IO8A 3QJPA 4ED3A 3ZNUA 3HVTB 4LH4A 3NGTA 3V9WA 1PBUA 1M5PC 1LFPA 2CG4A 4P2XA 3LPTA 4NWBA 2AYMA 5C0YA 2AZ1A 1CEZA 3CCTA 4JI7J 1TKZA 5HL7Q 4DQQA 3CJ1A 1S9FA 5F2RA 1NM1A 2CKWA 3ALYA 3TEHB 4GKKK 1WSFA 3PSIA 4U8VA 5LJ5Y 1NH8A 1YVUA 1Q8BA 2R2RA 4LREA 4HVJA 4YUDA 3M6WA 5DG9A 2OKQA 3QEPA 2CQIA 2FJBB 3ZZZA 2I8EA 3IAM9 3HM8A 5AQJA 4ETZA 4DLGA 1TK8A 1FDDA 4CLSA 1RHQB 1UTAA 4ICLB 2XY5A 4I6WA 2HURA 1HR0J 4ANEA 1WEXA 4CF9A 4FK4A 4BROA 4WP9A 5FLXY 2G8VA 3UR3C 1RU2A 3EVOA 3UDVA 3C6HA 4OJHA 3KLHA 2Z30B 2OI2A 2HHTA 2RU9A 4E1NA 4WQ4C 1FKOA 4M3UA 4K59A 2HMIA 3G8SA 4PG4A 1UCNA 2KZMA 1C6VA 4KRWA 4CO2A 4MFBB 3D54A 1JLEA 3MI7X 1R0BG 2MYFA 1VRQC 2N7CA 3C46A 4WFZA 5M2UA 2VIHA 2VJUA 1LFWA 4NYFA 4HTLA 3NGRA 2AWZA 2P9GA 1FDBA 4H54A 4FWRA 1WC0A 4WKYA 4AL5A 1QTNB 1NGDA 2V63A 2V2VA 3DU6A 4ECZA 1XHZA 1S76D 4UUXA 1FRJA 3CJ3A 5CY4A 4MIWA 3CC4S 4JI0K 4KFBB 5BRDA 4KGZB 1TFWA 4XIUA 2G1DA 1WSEA 2KVIA 2YXLA 1X60A 3QGHA 1S1TA 2ZJQQ 5HLFB 2YJFA 1U2VA 2AGOA 4NCGA 4GKJK 2XYGB 3A13A 3H3NO 2JFKA 2CQ2A 3TQ1A 2H65B 2VPYB 3LAMA 4FW2A 1K8KB 4C48A 1F2HA 3NNHA 2ZBPA 5J2MB 3DHWC 3KLHB 2HHHK 3F5TA 3SCIE 3B82A 4LF6J 4H4KA 4P2MA 3KJFB 2OEMA 2ZM6F 2D74B 3BPSP 2NXCA 2FZCB 1MN7A 4DV3F 4WQ5C 3HSDA 2FLPA 3R2DJ 2P6SA 2J6TA 4GKKF 4OPKA 3KWIA 2VJVA 2OZMA 4FJJA 3VQSA 3N6LA 1RT4B 3MGJA 1VQKS 2V34A 2RE2A 4BHQA 2MZ1A 1SVDA 2Q97A 2YY3A 4XO0A 5D4OA 3TVZA 1UAWA 5KG5A 7FD1A 2CQGA 2UVWA 4CECA 3MF5A 5D8HB 4LSLA 1S0VA 2PEBA 4RUBA 3W8GA 3BV8A 3L4BC 5DG7A 1F3FA 4USHA 1N34J 1WBBA 3VEXA 3LL3A 1JIHA 1N52B 4EBDA 3ZT4A 2G1HA 2VA3A 1KVCA 2PBDA 2X78A 3HPOA 1K47A 3O3HA 3TW0A 2QJ3A 3WUHA 4A57A 1S48A 1J53A 4CF1A 2ZKTA 4LF5J 3IS9A 4B3OA 2DR7A 2JEIA 1X5TA 1VBYA 5D77A 2ATCB 3EGNA 3T6BA 2OPQB 2Z58B 1OQ6A 2CZ4A 2C2MB 5F8LA 1W9HA 1YGYA 1R6VA 4I6AA 2YKMA 3RAXA 4ZTFA 2MKSA 3MUMP 3MN9A 3SJHA 3Q83A 2CGJA 4LH5A 3HHDA 4WFBQ 2KH9A 1IBLJ 3Q8SB 5GMDA 1R8AA 2FHKA 2QZ8A 1HBOA 1BIZA 4ECWA 4OMFG 1JB0C 5BPLA 1SJFA 4I2QA 1LW2B 4PQUB 3A0IX 4N7TA 2XRIA 4CRJA 3KKSA 1NLKL 1U4BA 2IIRA 4F3QA 2FJEB 5EWGA 2Q43A 4M3WA 3SBMA 1YITN 3OL7A 4J9SA 3IUCA 4PL8A 1RT6B 3MFHA 3AXKA 2HKEA 4HVZA 1A5XA 3D1HA 1F3VA 3DDKA 4DR3K 3T6JA 4HCBA 1HI1A 3TWHA 2IJFA 1HUXA 3CCWA 3AB2B 3QFHA 4MLHA 3Q7BA 3CYMA 3UCUP 4B8AB 3AVIA 3VAHA 4KHNA 4WQ5A 1H3DA 4X4TA 1HNZJ 5LL6Z 2NPIA 3D6RA 2DNZA 1CZBA 4RWWA 1C1AA 4ELVA 2NRZA 3FBEA 5KFOA 1T8EA 2O8BB 5ETMA 1T95A 4JOUA 1S6QA 1TL1A 2JZ5A 4OKKA 4K4YA 2BW2A 2RHQB 2MKJA 3MN7A 2YWWA 4AHCA 2J8AA 3G4SN 2AA4A 1RISA 5AZIA 3NH2A 3BN4A 2COLA 3AA8A 2OFHX 4YY3K 4NA1A 4O3RA 4MIAA 3TJ8A 2MQ8A 5LOQA 1GFWB 2N7YA 2D9OA 4I68A 4KQZA 1NK0A 3R8EA 5FROA 1KBRA 3H5YA 3CJBA 4ZLJA 5EX3A 5F3TA 3T19A 2C22A 3LDLA 1UL3A 1DFDA 3MD3A 4K4XA 3LQVA 4YY3J 1S5JA 3J7ZT 1V5VA 3VEZA 3HD2A 1NJZA 4X4NA 1EB0A 3KWMA 3I9V9 4TLRA 3ISND 2QIFA 2B4JA 1FDNA 3WIVA 3H6EA 1TR0A 2C2RA 3TAGA 3PIOL 1F0XA 1KR4A 3IRXB 1FVQA 5E41A 1ZAVA 1RBAA 4ZVHA 1BOTO 3IGVA 4W98A 1NJWA 2FSKA 1HIYA 5KFQA 3UDLA 1SH3A 5HROA 2BQRA 4ZPAA 3I56N 1MMDA 5HMWA 4B3MJ 4JV1A 3SDEA 4WE1B 1SJ3P 2J9DE 3OUYB 2RDIA 2L3MA 1ESVA 2GHWA 4WQ4A 3DLHA 2NZ4A 4E89A 4KB0A 2XY8A 3CDUA 2VG6A 4B9TA 4WP3A 5HSPA 4NLCA 4OVLA 3V9ZA 3WXLA 4CVNE 2CQPA 3T5HA 3WQUA 4CJ3A 1X4CA 3RG6A 3QEXA 5I42B 2BKOA 2V7YA 2E5JA 2RU3A 4ZCIA 1SL1A 3VR1A 5HI7A 3WHIA 2OPRA 5J2QB 4BWMA 5KFKA 2CQCA 4WE1A 1IBKJ 2V8HA 1NGHA 3IBFB 1BHNA 1JL2A 1U1PA 5D78A 2LA6A 3VAJA 2NR0A 2XTJP 1XC9A 4EBCA 5DDRC 4NLYA 3NAHA 3F9KA 1F5AA 3HF5A 1K44A 5U47A 3DXSX 3VHQA 4JKBA 1WEZA 5KFAA 2DISA 4Q5VA 3V9SA 4OYMA 4IKAA 1TUUA 4RW4A 1OH5A 4U7UD 1IJFB 5DM6Q 1Y97A 5AQZA 3QFUA 3KDNA 4FSVA 4XH4A 3FGUA 3GIKA 4OL8A 4BR9A 1T6DA 4KIAA 4TU8A 2XS5A 3GJTB 5A8KA 3NG8A 4FF3A 2HYIB 1K6YA 2X1GA 1KQKA 4LF9F 3Q2TC 2IJRA 4USWA 3CCZA 4P2SA 1ZOTA 3JTPA 2XMWA 2B5JA 3QIPA 3UDEA 4WZMA 2YKNB 2G2ZA 1AROP 5H9FJ 2VG5A 5L9XA 1N36J 3V6DB 1NGIA 2HBRB 3NRBA 1RBRA 2KB2A 2X1FA 1Y5LB 3MR6A 3H1QA 1S6QB 3VPZA 1QZ5A 4ZP8A 5C24B 4NXNK 1I94J 1F60B 5A2QU 5HQMA 4B3MF 1BUXA 3AJDA 3SUPA 2XHBA 3OPKA 4JV2A 4JKGA 3TOQA 2R9LA 3UCGA 1MU2A 4HACB 1UEVA 2JDJA 2A6AA 4KHPJ 3MCMA 4MMOA 3RAMA 7FDRA 1RABB 2RIJA 1HWLA 2Q2RA 4OJRA 2BH1A 3FGVA 5M1NA 1KOHA 2GUPA 2R8HA 3MM5A 1QUVA 4JI1F 3QT8A 4RJVA 4J9KA 3H59A 2P9NA 3QMLA 5AQTA 2F8MA 1SKSA 2KJVA 1YHQS 3VESA 3LUYA 4RNMA 3HM9A 2NXJA 4B9NA 3GIIA 1HMVB 3SMSA 1VGYA 3NOCA 5G4DA 1ASUA 2YHYA 1SQGA 4LUBA 2O5DA 1JNRB 6FD1A 3CCVS 1G4CA 1Z05A 3DGVA 5BN8A 4OZJA 1EARA 1APSA 5C10A 4X64J 1Q0NA 4IOCL 2JOQA 2Q6CA 5GAEP 5HK4A 1UZHA 2BE2A 3PW2A 4DN0A 3QQCD 1OH8A 4K4UA 4E0DA 3CCMN 3QWPA 2Q0RA 3BGRA 4USKA 2CJBA 2DCUB 5F0XA 2B8PA 4DL2A 3CCJS 3IRWP 4H0OA 1FHTA 1RGIA 4DR4F 4QU7A 2UXCJ 4X4UA 4OJ1A 3Q8YA 3KLIA 2AZ3A 5J2QA 2ASJA 3RZAA 2MQOA 1RT7A 3CI5A 3Q7CA 3ONQA 1KVJA 4A2BA 2KTQA 2BM0A 1JXVA 4QS8A 4LSLB 4BBYA 4CJSA 2KZZA 5KFLA 1NNEA 4JEPA 3CF5Q 1YF5L 3DLBA 3AA4A 4CZMA 3M6UA 4NRUA 1B7FA 1VIOA 1DQ9A 3W8PA 3SPZA 3WQTA 1S0NA 2G8IA 2XNRA 2YHBA 3K9JA 2K3KA 3RVCA 1Y3JA 3BY5A 1UETA 3HDSA 1T7PA 2DJWA 2RS8A 4DUZK 2O8FA 2BJEA 2HVZA 2PY5A 1IKVB 3MZIA 4O0NA 2QLXA 1W7WA 2HGMA 4UQTA 4B3SJ 4N47A 3SCLE 1ZA2B 5KG2A 5DG8A 1C0UA 3TAQA 4XEIA 3DLEB 2W42A 1MWYA 4ECSA 1CLFA 3O1BA 1VQ6S 3U1MA 2EFPA 2DCLA 4JN4A 3MPDA 1QTMA 1K0TA 3A3PB 5LY3A 1TUVA 2QW9A 2D3O1 2R7WA 3NBPB 4B3TK 1XNQF 1G15A 4FS2A 2NUHA 4DR1J 4DV3K 2AKWB 3LDNA 5A0YA 4IYQA 1VQON 2HWHA 3PR4A 3R1HA 1RT5B 4PPDA 2ZOGA 3RB6A 4FL9A 2PO4A 1N32K 4IO9Q 2DR8A 1WSRA 3OTOK 4NCAA 3SK3A 3HP9A 1YZ7A 4EEYA 3BGOP 2O66A 2AYBA 1BIUA 4OYAA 3SAFA 3NAEA 2RF2A 4F0MA 1TKXA 2RMLA 1IKXA 2V8GA 3E01A 4QR1A 4B9UA 1W2BR 3V2UC 3AD8C 1QE1A 1KVKA 4PABA 1FCAA 1DZ5A 4H0XB 2P9CA 2C2EA 3HFVA 3FMBA 5HQ8A 3DWLA 4QAGA 5DGBA 4BC7A 4ZCKA 1C1CA 1J27A 4JI0F 2MMYA 3LP2B 4GY2B 2EEYA 4ZPBA 3N6MA 2GUIA 1A5VA 4JNEA 3M32A 1M1KT 4DL4A 1BWFO 3FZFA 4M3XA 2EG1A 5AXMA 1NHKL 4CERA 3QIOA 4DHVA 3LAKA 2E1YA 2GX9A 1M5SA 3M6XA 4DV7J 2Y3YA 3MPVA 2IBKA 2BZ2A 5KOWA 4FWPA 3H20A 3IM8A 1GNKA 5J1PA 2DR9A 1NGBA 1Y9OA 4WTYA 4ECRA 1FEHA 4B3TJ 2MZRA 5G0RA 3WNFA 4DTPA 1IV0A 1RUSA 1S1VA 4CNYA 3QIPB 1MLAA 2B56A 2HNZA 1X3MA 5B0BA 3W5YA 1FJEB 1SUQB 2OJ3A 1HKBA 3NF7A 1BG3A 3A4TA 3DLRA 5L8RC 1N0VC 2MKIA 4B1YB 3OTOJ 2D1CA 4ILMA 3VQDA 3MMBA 1NK5A 3ENVA 3AD7C 3VQEA 2P8IA 3KKFA 3JB9k 2VG7B 5B08A 5EVZA 1SV5A 4Q2MA 1ZBTA 2HBYB 4DV2K 1WELA 4Y2IA 4E7HA 4DV1F 1QM9A 4GVLA 3CJQA 2GO9A 1HNVA 4M5NA 1SQEA 5KFNA 5HANA 2GJFA 2KN4A 1T6CA 2R7RA 4Y2CA 3FJ2A 2ZUAA 3TJ9A 4AT1B 4OYZA 2H51B 3MFIA 1M5HA 4OYBA 3OYLA 3IC1A 2EW9A 2D1KA 4S0MA 2GELA 2MLXA 2CQBA 1X9WA 1T0TV 4W4MA 1Q82T 2MB0B 5DDOC 3S3NA 1R89A 5AQMA 1UP1A 1HNXJ 2XGQA 5AJ3K 3NCIA 4CZEA 3VF4A 5I42A 1BISA 1TL3B 1K73T 4UOHA 1OPZA 2F96A 3O4QA 5J1NA 5GADP 3QJLA 3HZEA 3V9XA 1SH2A 4JI6K 2ZH2A 2HLUA 2DNYA 1U6BA 3ZNJ1 3OA9A 5DDQC 4LF7K 4OV1A 3FZKA 5D6GA 5KT2A 1M5KC 1VQMN 1N88A 3IFRA 3S41A 4DTJA 4KPYA 5D3GA 3FEZA 2RDDA 1SCJB 4F02A 1HKCA 1LOUA 3AVBA 4B1UB 3JAMY 3PFEA 5KFPA 5IWAF 2ZHBA 4ZVUB 1J5EK 1U1MA 2P9SB 4M5HA 4X65K 4AD6A 3EPGA 3ITHA 4WIIA 5AQXA 3CFPA 4IOAL 3Q8QB 1EETA 2YKAA 4DHYA 4OYWA 2VFSA 3SV4A 3ZTRA 4DV4J 3TQEA 5MAOA 3KNGA 2J9DA 2LXIA 2P9IA 3KMSA 4CJQA 2GGPA 4DQRA 3OD2A 1D9AA 2OUGA 4DBQA 3RSEA 4ZK7M 1HR0K 3LGMA 3HZ6A 1RTDA 3U8XA 4PEOA 1MMNA 5B8HA 4JBCA 1QAYA 5B0FA 2XCAA 2IHR1 4HWIA 2X6SA 5AJ3J 1TK5A 2OIHA 1Y5NB 3DU5A 4PAAA 1LWCA 4CFBA 4CZKA 4LF5F 2R8KA 3CF5L 5KI6A 4A8FA 3POTA 4RNOA 4M94A 4FOIA 1VQPN 2EHGA 3O80A 4C8KA 3DXMB 3BSNA 1HNXK 3ULEB 4NCBA 3EZ5A 4FJLA 1J5OB 4ZPVR 1LXJA 3D6FB 3SNNA 1N5YB 2CAJA 3IM9A 2YHAA 1B4SA 4B3SK 1IG8A 3UVJB 2F7VA 4CFDA 5ADXA 4CWBA 3O1WA 3N0VA 3FRYA 2CH5A 1N5SA 4P75A 4CHZA 3QEWA 2EXUA 3ZCMA 2QKKA 5C42B 3MEKA 4FYVB 3OLBA 2QLJB 3H5UA 3R5AA 3RMAA 1P1TA 4HH0A 2VDHA 2XLIA 1FE4A 1JNZB 3K9KA 4B9QA 4OZNA 5ETPA 1HBOB 3GR0A 3OHAA 1S12A 3FKBA 1REVA 2HHVA 3K17A 2DH9A 5K14A 2QG9B 2YKMB 2OFGX 4WPAA 1H2UX 1W2BM 2H48B 2LXUA 3CJ5A 4FZXC 2W2MP 4DFJA 2HHHJ 5B0DA 4FDFA 3EX7B 2ABYA 1XJWB 1GXLA 2CADA 4C11B 1NEEA 3EKSA 2NREA 2NZTA 2MKHA 3ZTSA 3RAQA 1EQ0A 2G0CA 5DMRA 1AA1B 1X5SA 1QVFR 3MCNA 1TMJA 1RU1A 1AT1B 4E98A 2FVCA 4E1JA 2ZH8A 3OYCA 2MJNA 4DUYK 4CLKA 3KNAA 1SXLA 1GX6A 3PRBA 4UZBA 1UWBA 5RUBA 4KKOB 3K89A 2KG1A 4I64A 2EWHA 1MNEA 2OLWA 3R7BB 5K8PA 1NJXA 2AP6A 1MROA 3F9MA 1JL1A 5ETSA 1CJTB 1NK7A 3M2UB 4IR1A 5EDWA 2WK4A 3GONA 5BYSA 3CULA 2CNKB 1OH6A 3RYLA 4O3QA 1YZ6A 1IBLK 2DIUA 1YTUA 1DKGD 4ZITA 2KM8B 1NO8A 4DKWA 3W63A 4IOCQ 2RHSB 4AHUA 4FOEA 3NS6A 3WX4A 3ZZTA 4FLZA 4QWAA 5DZ6A 4Y65A 2VD3A 5CABA 2ZBCA 2V2KA 2YKOA 1HNIA 4HI1A 3CJ7A 2WAQD 4TN2A 4X4QA 1KQSM 2QL9B 4FBUA 4RZRA 3KWGA 4JI5J 1PAEX 1M5OC 2SXLA 2A3JA 2R3VA 4EP4A 3T1YJ 1CXUA 2PAVA 2N4CA 2YH1A 2E6LA 4YB1P 2E2QA 2FLOA 4Z2XA 2YNHB 2B0GA 2HNYA 3IWLA 1JWWA 2W4DA 2VBWA 1VK8A 3TTDA 2XULA 4FLXA 2QWNA 5D4NA 4W92B 4DV7K 1RTZA 1VK3A 3R97A 3AD9C 3GE9A 4WBFA 3RRGA 1ASWA 1ZAWA 1VHIA 4ZLLA 2B9WA 2QFJA 2R7TA 4QWBA 3KLGA 1YHQN 2DGXA 4MYUA 4NZ7A 4M5DA 2KO1A 3QETA 3DFEA 4NPOA 1SPBP 4L3NA 1WB9A 3EZUA 4OGCA 4HTJA 2DY4A 3I5AA 2KT2A 1ZYQA 3CPWR 2BJDA 4U9RA 4MT1A 1HYVA 1SC3B 2QYGA 4G6VB 2W24A 2W7OA 2UV8G 2I6WA 2J5AA 4AXJA 1B64A 3K5PA 2XY7A 3LP1A 4JI3K 4CEAA 3DGPB 1C1BB 1HYSB 3PHEA 4TSXA 2YNIB 4NYOA 5IT4A 1HKGA 5CYQB 4KHQA 4C2MA 4PWDB 1YRUA 2VV5A 3DDIA 2V5HG 2YX1A 2HRUA 3CC7S 3C15A 4DV6J 4L72B 4F3OA 3H0PA 4FYDA 2YKPA 3DOLA 4DMNA 1NBWA 3VZIA 1FKPB 4DR3J 1IWAA 4DF8A 2PE8A 5JVHL 2OPPA 2LDYA 2DNQA 4AL6A 3CJ9A 3CB4A 5F8MA 3OYEA 1FKPA 3CCMS 1NJIO 4FJ5A 2MY7A 4USIA 4CK1A 3M8PA 3FQLA 1IR1A 2W1BA 3KMQA 2QK9A 4LSZB 3LO3A 3N6NA 1T9YA 2I0XA 1U47A 4LVNP 3VN5A 1FWKA 1VQ8N 3AGRA 2V50A 1XMBA 3TYTA 3IFEA 3R9PA 1G3OA 3AQPA 3P49B 4UY8T 4ILLA 3QLHA 1NUEA 4Y2KA 2VPWB 3K5NA 1RT4A 1S7IA 4DTSA 1CJKA 1JLGB 2WBMA 2W8LA 1S1VB 4DFPA 1SKRA 3TAEA 2BMBA 4DR6K 4LF6K 2F4VJ 1XHXA 3Q22A 1KC8O 4DZ6A 4EK2A 2Y9HA 3ENHA 1S1XB 3OL6A 3BB5A 1EWQA 3DXBA 4WFAQ 3G6VA 3NOGA 5AZJA 3MEGA 3P96A 4CZCA 4QYZJ 3OYBA 1ATNA 3ZSYA 2J9EA 2E1ZA 5LXRA 3D0PA 2UUBK 1KVBA 1S10A 2OD4A 3T1AA 3QNNA 2XMUA 4NEZA 4IUFA 2P9PB 4LBIA 2GIRA 4DWIA 2BX6A 1ZBUA 1HPZA 5JVGL 5ADZA 1IKYB 4BCAA 4KFBA 3FBFA 4YOXA 1YRTA 5J1EB 1KD1T 2FSJA 2OPSA 3V1OA 1TAQA